3FFIA

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
553
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
total genus 151
structure length 549
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ffiA05
1C1AA 2F8EX 2BDPA 5C5JA 2E4LA 1S1VA 3ZT0A 1IKXA 1S1UA 4B9UA 4ECYA 1KRPA 3M8RA 4WE1B 2B5JB 1RTDA 5KGWA 1UWBA 3M8QB 1TKXB 4CGFA 3FSIA 1IKWB 5J2QA 3PV8A 4F50A 2HWIA 1WLJA 4Q5VA 3CFOA 1U45A 4MK7A 2GV9A 1I3AA 2O5DA 2R7YA 4FJ5A 4ZP6A 2XCAA 4HUFA 2P51A 2Z1HA 3U3GA 4IFYB 3ZCMA 4RW4B 1N6QA 2O4GA 5KFIA 1S5JA 2W7PA 1QSSA 1SH2A 3MXMA 2O4IA 1C1CA 1QSYA 5I42A 1T8EA 4KHWA 1G15A 4ECQA 3MECB 1RBRA 2J6UA 3M8SA 1RTIB 4NZ0A 3WNFA 3QIPB 4DL4A 1RDBA 1S1TA 4NLWA 1S6QB 4QPXA 4CFCA 3N6MA 3T3FA 4O3RA 4CHNA 1R0AA 4ELUA 1HMVB 4R8UB 2PYJA 2OH2A 3BREA 3KJVB 4TY8B 1J9AA 5K14B 2AX0A 2BE2B 2IGIA 5J2NA 3TAGA 4BDZA 4DTRA 1U48A 2P5OA 4CJ5A 4B9NA 3DRRA 1D9FA 4TN2A 1N4LA 3ASMA 2BR0A 4MK8A 2RKIB 5KFDA 1F21A 2GIRA 1FKPB 1U47A 2FLNA 4WFXA 1KFSA 1XHZA 1JIHA 2YNFA 3AA4A 1FKOB 5FROA 3HVTA 4GC7A 4DF4A 4QWCA 5KFFA 1QHTA 4O44B 2BQUA 3TANA 5DQHA 1C0MA 1K1SA 4EP5A 3S9HA 4OL8A 3AA5X 1LWFB 3BQ1A 1BIUA 4Z4FA 4E0DA 3WNHA 4ZVHA 5F9LA 4M3ZA 4QWDA 4E7IA 4L8RB 4IRDA 1ITGA 1XR6A 2YNIA 2C28A 4AHSA 1HPZB 4U6PA 4DQQA 4WE1A 3PR4A 2B5JA 2QE5A 5FRNA 1N48A 3IRXB 1A5WA 1VSEA 1XWLA 1HNVB 4Z4HA 4DL7A 3S3OA 1IKWA 4I7FB 1C2PA 4CEQA 1D0EA 3KHHA 4I2PB 4KV8B 4CECA 2HAIA 1X9MA 3LWLA 1EX4A 3DI6B 5KT4A 4I2QB 4K4VA 4IFYA 1GX5A 4RU9A 4NCGB 4RW4A 1BHLA 4TQRA 4DU4A 1IKYB 1RYRA 5F8HA 1RBTA 1L3TA 3MECA 1ZTWA 2YNGB 3CDEA 3HKWA 1RTIA 3BSCA 3QIPA 1SL2A 3I5BA 3OVNA 3QEVA 3RMBA 3AVLA 1JXLA 3AO1A 4KB1A 1RDDA 3QGHA 3T19A 1KLMB 5DGAA 1NOZA 1WSGA 1HMVA 4R8UA 2KW4A 3PZPA 4DQSA 1C0UA 3CM6A 3KJVA 4IRCA 4TY8A 1LWEB 5K14A 4CJ4A 2UVRA 3V9ZA 3IN5A 4QWEA 5D3GB 1JXEA 5J2PB 3BSNA 4DTUA 3IS9B 2AGQA 1QQCA 3OYHA 1NJYA 1JLGA 1WNSA 1IO2A 4ICLB 2YKNB 3KD1E 4DTPA 3NGYA 1FKPA 1ZBHA 2W9AA 3U3YA 3DOLB 4CEZA 2D0AA 5DG9A 3L2WA 3KIOA 3CDUA 2YNHA 3PY8A 3PJWA 5KG6A 4O44A 2QKBA 2ZQBA 3TR8A 1ASUA 4RW9B 2BANA 1LWFA 2AQ4A 4H4MB 4CGJA 3THVA 3L2VA 3K5LA 3MR6A 4CEOA 4ZP7A 3UQSA 1HPZA 3MFIA 4CJLA 4CF9A 4W5TA 4CJVA 4RUCA 3HL8A 1FK9A 4AH9A 4Q43A 3VQBA 4C8NA 4KHRA 5F8GA 3DLHA 5SZTA 4I2PA 2OPPB 4CFDA 2D0BA 3NL0A 1RT1B 5KFPA 5KRSA 3DI6A 2PYLA 4I2QA 1YTAA 4F3TA 1TKTB 3L2UA 1BCOA 4FW1A 3QGGA 5E41A 2AX1A 3U6FA 4J9QA 1IKYA 3I8DA 2X78A 3KD5E 1RAJA 3PHEA 1CXUA 3V1QA 3V6HA 3RR8A 2YNGA 4M45A 3SQ1A 4K4WA 3C6TB 1VRUB 4K8XA 1B92A 1QE1B 4MK9A 4F2SA 3AVKA 4EBCA 3HP6A 4C8MA 3VQDA 4EZ6A 1RTJB 2FLPA 3EYZA 5CZ2A 4DS5A 1TAQA 3O4NA 1RDAA 3T5HA 4FYDA 1KFDA 3OYFA 2X6SA 1LWEA 3TAMB 4ZP8A 4J9KA 3KK3A 3OYJA 3NAIA 3JYTB 3SV4A 4CJKA 3CM5A 4GVMA 3QLHB 4DFMA 4IRKA 3PO5A 3BR9A 2W7OA 5D3GA 5J2PA 2JEFA 4CJ3A 1DTQB 5EU7A 4ZP9A 5JXSA 4K4SA 2YHBA 1SH0A 5HRPA 3QGIA 2DFFA 3G0ZA 4ICLA 2YKNA 2IAJB 4RZRA 5FRMA 3E01B 4RW7A 4CEEA 1BIZA 2UUWA 5FDLA 4EO8A 3DOLA 4URGA 4DTSA 3OS0A 3OYLA 4R0EA 1CLQA 5KFSA 3TAFA 3CJ5A 5F8LA 4DTOA 2R8KA 3VN5A 4K4YA 5C42B 3P83D 5L1KA 1RTHB 4TYBA 5KFTA 5KFNA 4FLWA 3NH2A 3ZSQA 1W9HA 4E1NA 4DSJA 2WHOA 4DG1A 4RNOA 3VQ5A 2R2RA 4Y34A 2ETJA 4CGHA 5KFZA 1NHUA 2XGQA 3MR2A 2FC0A 3KLIB 4FJJA 1B9DA 3PX4A 3RTVA 3LPTA 4YNQA 1RT6B 2OA8A 3ZSYA 5HBMB 4NYZA 2HNZB 3DLKA 3RRGA 4FVMA 4LD0A 1JLQA 3SUPA 1ZBFA 1X9WA 3LZIA 2VA2A 1K6YA 1TL1B 5L1IA 2E9TA 4J9PA 4ED0A 4JLHA 5I3UA 2ITGA 4CHOA 1RT3B 5L9XA 4CFBA 4O0IA 3C6TA 1UA0A 4M3TA 4O3PA 1SKWA 1QE1A 2HNDA 2CKWA 3BDPA 1RTJA 3HVAA 1BL3A 4J9NA 3HJFA 4LQ3A 2CJQA 2YKMA 3DMJB 4DL3A 4R5PB 3QEPA 4FK2A 5HROB 1ZBIA 2ZKUA 4JV1A 1NK7A 3C6UB 3QLHA 1JL1A 4O4GB 1C0TB 1DTQA 3M9NB 4EP4A 3BSOA 4J9OA 2P1JA 3ALYA 4UQGA 3TWHA 5KFVA 4GC6A 3E01A 4KAIA 2AU0A 3HSTB 3BGRB 4CJWA 2ATQA 2AGOA 3T5LA 2VG5B 4DFPA 1L3VA 2V9WA 5KFKA 2V4RA 3OYEA 4J9MA 3CQ8A 4N76A 3MXIA 4RNNA 2YHAA 4DLGA 5C42A 4PUOB 4ZMMA 3B6OA 3OSPA 3ZT3A 3K59A 3DLBA 4KHUA 4JUZA 1A5VA 4AILC 2G8WA 2W9CB 3AVHA 3K5NA 4JRPA 1S0MA 4QOZB 3CJ2A 1A5XA 1QSLA 4C8OA 3LAKA 4RNHA 3ZSVA 3KLIA 3SFUA 5T7BA 3VA3A 1RDRA 3HXMA 4EEYA 2F8TA 1KVAA 2G8VA 3V9SA 5HBMA 2HNZA 5KFHA 2UUTA 4KBIA 2D5RA 4KFBB 3AVFA 3K57A 1TL1A 3GQCA 1JX4A 4CEFA 4NLGA 3AVNA 4JV0A 2RPIA 4FZXC 3IGVA 1VSMA 4PWDB 3V9XA 3SUNA 1HYSB 5J1EB 2IBKA 2F96A 3V6DA 1JL2A 2XI2A 2R2UA 4Q8EA 4B9LA 3DM2B 1EETA 2HVHA 3V1RA 3KLVA 1S6PB 1ZBUA 3QYYA 3KOAA 4E7KA 4MFBB 3MXJA 3EZ5A 3SPZA 1KLNA 2P5GA 3IAYA 4FLZA 3DMJA 3OYNA 4R5PA 1NNDA 4ECSA 4K4TA 1Q8IA 5HROA 2E9ZA 2Q3SA 3C6UA 3KLGB 4ZVGA 1JLFA 1Z4UA 4N56A 3LALA 2OPRB 3T5KA 2ALZA 4I9QA 5HP1B 4O4GA 4K4UA 2X74A 4F4WA 4O4RA 2JEGA 4ID5B 4WFYA 2HHWA 3KNAA 3OYKA 3PO4A 1WSIA 2JLEA 2KTQA 1LW0A 4DWIA 1RT7B 2E9RX 1BI4B 4CEBA 3NCIA 3UPFA 2WK4A 5KTQA 3BGRA 2IM2A 2VG5A 2ASJA 3MEDB 2HNYA 2XY7A 4IKAA 1L5UA 4BWMA 3CJ3A 3NHGA 3SQ2A 4CEAA 4TQSA 4QWBA 2E6MA 4KB7A 5EWEA 1VSIA 4PUOA 4BACA 3OYGA 2FBYA 2FJXA 3TQ1A 3OY9A 4C8LA 1X1PA 3D45A 3K2PA 3OL8A 4Y1CA 4M3YA 3HT3A 4FZZA 1Q9XA 5CYMB 4B8AB 3OSNA 4WZMA 4LY7A 1BQNB 1SV5A 5KG2A 1OS5A 2ASDA 3MR5A 2IOCA 3FDSA 4KI6A 4KTZA 4B9VA 4OGCA 4CJFA 3AVGA 2QV6A 4ED2A 3JSMB 2D3ZA 1NKEA 2DFHA 4PWDA 4Z4CA 4ELTA 4OKEA 1HYSA 5J1EA 2BQ3A 3OYBA 1NHVA 1I6JA 4KTQA 4M94A 4NLSA 3ISNC 1IM4A 4NYNA 2AWZA 5DG7A 3NH0A 3V4IB 4FLYA 4NLOA 5DLGA 3DM2A 3OLAA 3C94A 1S6PA 2BRLA 1REVB 1S9FA 4F8RA 5CY4A 3M8QA 1TKXA 3ITHB 4ZPAA 3KLFB 2XI3A 1B9FA 4FM0A 4FZYA 4G1QB 1EKEA 1KCFA 4CHQA 4W5NA 3KLGA 4RG8A 1S1WB 2OPRA 5KFQA 4ZPDA 5HP1A 4DL6A 1T03B 5KFUA 4Q0BB 1Z25A 4NLYA 2HW3A 4TY9A 3MFHA 3EPGA 3FQLA 1T05B 3CO9A 3VQ6A 2YV0X 3SUOA 2W9BB 1RT7A 3QNNA 1BI4A 5KFMA 3HYFA 4M3RA 2DPIA 3D28A 3QEWA 3LP1B 2JC1A 3V1OA 2OZSA 4RW8B 4WFZA 3MEDA 4ECXA 4WXOA 5HRNA 4OVLA 1DLOB 3BSAA 1S48A 4E7HA 4NCBA 4W5OA 5HRSA 1S6QA 4IQXA 2V0NA 4J9RA 3HPHA 5JUMA 4HCBA 4FS2A 4IOBA 3C95A 1VRTB 3DOKB 3NE6A 3SZ2A 1FXXA 4YQWA 3MR3A 1ASVA 4M41A 3HPGA 1S4FA 5KT7A 2I1RA 4Q45A 2BE2A 1KVCA 3V6JA 1Z26A 5CYMA 1RDCA 4KI4A 5SWMA 1TV6B 4DSIA 1SUQB 4XO0A 3A2FA 3O3FA 3VA0A 1J5OB 2RKIA 3OYDA 2VWJA 3HVWA 3ZT1A 4FJHA 2EHGA 4TSXA 1XR5A 4MIBA 1FKOA 1RT2B 3VQ4A 5EWGA 3JSMA 1WSJA 4BDYA 3VQ7A 3PJXA 4E3SA 3AVJA 3KKSA 2VA3A 1U49A 1RT5B 5DLFA 3PW0A 4RNFA 4J9SA 3KMSA 3V4IA 3VQEA 4HKQA 1HYVA 3QO9B 1REVA 2BRKA 1GOBA 4B9SA 1RA6A 3IRXA 3TAPA 3ITHA 3T5JA 1HRHA 3AO3A 5JS1A 1HNVA 3SQ4A 3KLFA 2J6TA 4I7FA 1LWCB 3SV3A 1S1XB 2GUIA 4KV8A 4RW6B 1L3UA 2FBXA 1JLBB 2KZMA 3RR7A 4Y2CA 4ECTA 4CE9A 1S0NA 4M3WA 1RBSA 1T03A 5C25B 4NCGA 4Q0BA 3G6YA 1DTTB 2WCXA 1T05A 3HP9A 1D8YA 2FVRA 4CGDA 2W9BA 1O1WA 2B4JA 3ISND 3LP1A 3FFIB 4NLRA 3GIJA 3OL9A 4E1MA 4RW8A 3O4QA 4HYKA 4F3OA 1DLOA 3TARA 4E89A 4RNMA 4IDKB 1KLMA 5KFLA 3OL7A 3PW5A 1IKVB 1W0HA 3KLEB 1VRTA 3DOKA 3GIIA 1HNIB 2WOMB 4KRFA 1HQUB 2HHTA 2ZD1B 3OYIA 4DTXA 4K50A 4Z4IA 5HLFB 3V9WA 3I0SB 3B6PA 4FLXA 4E7LA 1BQMB 1X9SA 2B43A 1NK6A 1TV6A 3IS9A 5F8JA 3CVKA 4MQ3A 4KSEB 4CK1A 3KLHB 3ULDA 1GOCA 1RT4B 5KG3A 3QETA 1S49A 3LZJA 3V81B 2KQ2A 3FRZA 3F9KA 2FVSA 4PA1A 5KRTA 5KT3A 1RT2A 3N6LA 4EBDA 4EYIB 1XI1A 1SKRA 3AO4A 4DLEA 2C2DA 4KTWA 1RT5A 4N41A 4DSEA 4RW9A 1VK0A 3CYMA 4H4MA 3H08A 4NLXA 4B8CA 2XWYA 4DSKA 3LP3A 3QO9A 3L2RA 5KG0A 3ZSZA 4FCYA 1TK8A 1NKCA 4KKOB 4HCCA 1S9GB 3L3VA 4MH8A 4CGIA 3S3MA 1LWCA 3I5AA 1S1XA 3AVBA 2OPPA 1NJZA 3M8PB 3MF5A 2OPQB 2G8KA 1RT1A 4O3NA 3RBEA 2ASLA 4NRTA 2PY5A 5KT5A 3VQPA 2I5JB 3I0RB 5C25A 1TKTA 5KFBA 1U09A 5KT6A 1U04A 1CXQA 3NDKA 1NK5A 4TXSA 3RAXA 4M95A 4ID1A 1NK8A 1WSFA 3TAQA 3FQKA 1VRUA 3VQCA 5DGBA 1Y97A 3LP2B 5CZ1A 3G10A 2XGPA 4ECRA 3H40A 5T14A 3PR5B 3CG7A 3SQ0A 4URSA 3T1AA 3NF9A 3ZSOA 4E19A 4IDKA 2IC3B 4ZPBA 3OLBA 4ECVA 5C24B 3I5CA 2DY4A 4CIEA 2WOMA 2R2TA 1HQUA 2GBZA 4LSLB 3UR0A 3KK2B 3TAMA 2ZD1A 3L8BA 3RMDA 3JYTA 1S1VB 1RNHA 1K1QA 2HHUA 1S1UB 4FW2A 1JLAB 1YTUA 1BQMA 3QINA 4WYLA 1RTDB 2IA6A 4Y1DA 4AHTA 2XC9A 1UWBB 4NLUA 2IM3A 5L1JA 2D41A 3GIKA 2IAJA 1TGOA 1RT4A 2W8KA 2D7SA 3V81A 4CK2A 2HB5A 3MEEB 4KO0B 3WNEA 1T3NA 4G3IA 3HHKA 2W8LA 4O0JA 3D5MA 1N6QB 1QAIA 3SYZA 5KG5A 1MMLA 2R8HA 3QEIA 4ELVA 1RTHA 4QW8A 5KFJA 1S0OA 3P5JA 1D5AA 4QCLA 1S9EB 3M9OB 2J6SA 4MKBA 1S1TB 4KKOA 4OGEA 2XHBA 4F2RA 3UIQA 4ZPCA 1QAJA 4PY5A 4IBNA 2OZMA 1R0AB 5KFXA 3M9MB 3DLGB 1RT6A 2FVPA 3BJYA 3QERA 4CHYA 3OS1A 1TVRB 2OPQA 4EZ9A 5KG4A 2HMIB 2JGUA 4ED8A 3QNOA 2IMWP 5J2NB 2I5JA 3I0RA 4HUEA 4JS4A 4IR9A 3ZT4A 4CF8A 3H59A 4ED3A 4YR3A 4CJQA 2ATLA 4B9TA 4FJNA 5KFGA 3QIDA 1RT3A 1J54A 2BGGA 4XPEA 4TLRA 3AVMA 1NK4A 4KE5A 4HTUA 4ED6A 3LP2A 4CCHA 1HQEB 3HVTB 3KHRA 3NAHA 2PZSA 1HJRA 4KB0A 3G86A 1WSHA 1QTMA 2Z1GA 2IC3A 4DU3A 4Z4EA 4EYHB 4ZVEA 5C24A 4CIFA 2FBVA 4M3UA 4W5QA 2IS3A 2R8IA 4LSLA 2FJWA 3KK2A 4FJ8A 4FJKA 2B6AB 2QKKA 1UAXA 4DSLA 1JLAA 2YNIB 3CJ0A 3CJ4A 3SI8A 1LAVA 3KHGA 1C0TA 4NLVA 3E51A 3NGDA 1NOYA 1TKZB 3NFAA 2WTFA 1WSEA 1RILA 3VQ8A 4BWJA 3EZUA 4OPJA 2R2SA 4H4OB 4FM2A 2HHQA 3MEEA 1C6VA 4KO0A 2JC0A 3SI6A 4FJMA 1YVUA 4EBEA 4IH5A 3PX0A 4Q8FA 1XC9A 3WNGA 4YFUA 4YR0A 5KFAA 5DQGA 1C1BB 1L3SA 1Q9YA 4FJ9A 1XR7A 2HHXA 4XIUA 5KFYA 4CK3A 3SNNA 3CIZA 2C22A 4WZQA 2W9CA 4ECZA 3RB3A 1S9EA 4W5RA 4FJGA 3H5YA 3GYNA 1N56A 2G8UA 1NK0A 3KK1B 5DQIA 4IG0B 1NJWA 3H98A 1JXBA 3DLGA 3LP0B 1LAWA 1C0UB 3OYMA 4DQRA 1KTQA 2V4QA 2UVWA 1TVRA 3H5SA 1S97A 3NF8A 2HMIA 4KFBA 2HVIA 2WONB 1KHVA 1KHWA 3Q8RB 3K58A 2NUBA 3EY1A 5KT2A 3HK2A 4KHQA 1LW2B 3HM9A 1EXQA 5L1LA 3MEGB 4KHNA 1JLGB 3G6XA 4OLAA 3QESA 4FK4A 4CGGA 5KI6A 2RF2B 1ASWA 5KFCA 1QUVA 2XY5A 4KAZA 4DS4A 3RAQA 1W25A 1HQEA 1VSFA 4N47A 3V6KA 5KFWA 2C2EA 2YNHB 5F9NA 4MFBA 1SKSA 4ZTFA 3LAMA 1ZYQA 4HUGA 2BANB 4AHRA 3H4BA 3MTKA 4CJPA 1D1UA 2B6AA 2BQRA 1J53A 1ZTTA 3LDSA 4FJ7A 3QZ8A 4CESA 3H4DA 4OPKA 3H5UA 1KSPA 4LSNB 4URQU 2RDJA 3D0PA 2EX3A 3BQ0A 1TKZA 1WAFA 4ID5A 1FK9B 5KGXA 2ILZA 4B3OB 2GIQA 4O5BA 4LH5A 4H4OA 4FJLA 2ILYA 1SL0A 4K8ZA 4F4XA 4GMJB 2FLLA 3GIMA 2HWHA 1NJXA 4QW9A 4ZTJA 4LQ9A 1C1BA 4I9LA 5KFRA 4U7CA 1UOCA 4FXDA 1HARA 2E6LA 3OL6A 5KG1A 3TVKA 4IH6A 4DMNA 2IDOA 1SL1A 4JRQA 1RCHA 3OYAA 3QZ7A 1WN7A 4MKAA 3O3GA 3KKRA 1JLCB 1RBVA 2EC0A 3KK1A 4FBTA 4IFVB 1EP4B 2D0CA 3NMAA 3MAQA 1BGXT 4B08A 4IG0A 4DU1A 1UA1A 1MU2B 2AGPA 1BQNA 3LP0A 1TQLA 3OS2A 4NLQA 4FM1A 3AA3A 4YMEA 3KK3B 2WONA 4IG3B 2R8GA 1RYSA 3OHAA 2HHSA 2DFEA 1LW2A 3MEGA 4BE2A 1VSLA 1IG9A 3OJSA 3DYAB 5KG7A 4FBUA 4HVJA 3OHBA 2Y1IA 2RF2A 2WRMA 4NLDA 4FLTA 3NBPB 4OKKA 4RW7B 3DRPB 1WAJA 5FDLB 2G8FA 4H54A 4CF2A 1CZBA 3LWMA 4O3SA 3PX6A 5EWFA 4YP3A 3O3HA 4AHVA 3RMCA 5F8IA 4AHUA 4KPYA 3CDWA 1N5YB 4OJRA 1BCMA 4O55A 4G1QA 2ZE2B 3SUQA 2XRIA 3AV9A 4DG1B 4PQUB 1S1WA 4LSNA 1BISA 3AO5A 3AA2A 4AHCA 4RUAA 5DMRA 2VG7B 3TI0A 4B3OA 3L2QA 1TK5A 4FJIA 2JEIA 3F73A 1ZETA 1KVBA 1TL3B 3DLKB 3CFPA 3DLRA 1JLQB 4KHSA 4J2AA 2VWKA 4CIGA 5CYQB 3NGZA 4Q44A 4N5SA 3Q8PB 2D3UA 3QEXA 5EUHA 5KFOA 4CHZA 4O3OA 5J2MB 4DTJA 2VG6B 4DL2A 2IJNA 4E7JA 4FS1A 4CJUA 4CJRA 3NH1A 4KHYA 5I3UB 3DRSB 3GV5B 4Z4GA 2XY8A 1VSDA 2HNDB 3HO1A 1JLCA 4O3QA 4IKFA 3NF6A 4NRUA 2IJFA 4LH4A 4IFVA 3ZT2A 1EP4A 1TAUA 3S3NA 2QK9A 3VQQA 1SUQA 3SJJA 2YKMB 3DLEB 3HVRA 1MU2A 2RN2A 3CWJA 2KFNA 1J5OA 4MIAA 4J2DA 3RB6A 1LV5A 2LSNA 4DSFA 1TP7A 4CJSA 3L3UA 3RBDA 4FJXA 4IG3A 3ICLA 2OPSB 3IGNA 3AVAA 4BE0A 3PW2A 4CERA 2UVUA 3DDKA 3EPIA 2KZZA 3H2LA 4B9MA 4J2BA 3OJUA 2C2RA 3GV8B 3DYAA 3BQ2A 3ZSXA 4X2BA 3NBPA 2F8SA 5HRRA 1YT3A 3DRPA 2RDIA 1GOAA 2W42A 3G6VA 4OLBA 4CF1A 3VQ9A 3PW4A 4KREA 4IH7A 4CEDA 3SCXA 2UVVA 2Z1IA 1JLEB 4FK0A 1N5YA 3SFGA 1XHXA 3PW7A 3LPUA 3AVCA 1TKDA 3LANA 3HPOA 2ZE2A 5F8MA 4RW6A 4EO6A 4FLVA 4ECUA 1JLBA 4PQUA 3OYCA 4NYFA 3SPYA 2VG7A 1GX6A 2AJQA 3RRHA 4F4YA 1DTTA 2FJVA 5DK5A 4ED7A 3ZSRA 4JS5A 2X6NA 1HYZA 1VSJA 3ZSWA 1TL3A 4OKJA 3FFIA 2XO7A 5JS2A 1T94A 4ZHRB 3NAEA 5KFEA 1TK0A 2HHVA 4QAGA 1JKHB 3TABA 4KHMA 4CHPA 4DF8A 5CYQA 3RB4A 3UDLA 2KFZA 4YR2A 2G8IA 3RB0A 5J2MA 2VG6A 1SH3A 4BDPA 2XY6A 4Z0UA 3V6DB 4Y2AA 3DRSA 1IKVA 3IG1B 3KLEA 1HNIA 1T7PA 4F4KA 2QXFA 4DTMA 1RA7A 4ZVFA 5EDWA 3AO2A 3Q8QB 4DFKA 1VSKA 1EETB 3GV7B 5HLFA 4J9LA 3K5OA 4NLTA 1IKXB 3I0SA 4HHTA 4QWAA 4DQPA 3KMQA 4M42A 3DLEA 4XPCA 4NLPA 3Q8SB 5J2QB 3KLHA 2A1RA 3KTQA 4CJTA 1CZ9A 4DFJA 2IM1A 1JLFB 2OPSA 3PUFA 1WNEA 4NCAA 2JEJA 1VSHA 4CF0A 2XCPA 3NGIA 2WB4A 4DL5A 4CJEA 1C1CB 1LW0B 5I42B 4WXWA 4DQIA 4K4XA 3NKYA 2FVCA 3RMAA 3VQAA 2HNYB 4BE1A 2Z1JA 1ZBLA 3RWUA 4DTNA 4ED1A 2R8JA 4IR1A 2FBTA 1NK9A 1JLEA 3GILA 3KHLA 2GC8A 1S9GA 1QS4A 4K4ZA 1RBUA 1CSJA 2A1SA 3P1GA 3H5XA 4J2EA 3M8PA 2G8HA 2DPJA 4GW6A 2IM0A 4WYWA 1IH7A 4M3XA 5F8NA 5DG8A 1YVFA 4ECWA 1U4BA 4C8KA 3DRRB 4DEZA 3AVIA 1SV5B 4H8KA 4FLUA 3PVXA 3VQSA 2DTUA 1S10A 2Y1JA 4ZHRA 1D9DA 4JV2A 1JKHA 2YNFB 3N6NA 1I39A 3K5MA 4CFAA 2OYQA 4F4ZA 3TAEA 4Y3CA 4TYAA 2FVQA 1NKBA 3NF7A 3IG1A 3QIOA 3CFRA 3V9UA
chains in the Genus database with same CATH superfamily
3CHWA 3O5TB 3GDQA 4LF7F 3G2XA 4B9UA 1ESVA 2ZH5A 4JD2A 4WE1B 5K8MA 5GADP 2VONA 4A57A 4CGFA 3FSIA 1LEOA 3HKZD 4JI7K 3PV8A 1IXKA 1U8SA 2GV9A 2R7YA 5DETA 3MR7A 1WSVA 3F56A 4IFYB 3DCAA 2NXNA 4FO0A 4RW4B 1N6QA 2NZ4A 2O4GA 2BVZA 3U8XA 4USHA 5HOOA 1PGZA 2O4IA 2K8GA 1FDBA 1T8EA 1G15A 1TELA 4GKKJ 4JI0K 3AA8A 3K17A 1GLBG 4I4BA 2MKHA 2VPWB 3CE8A 1RDBA 3V4MA 3N6MA 2DISA 2FJBB 4CZLA 3R97A 4C0OC 2RH3A 3D6RA 1UFWA 4ELUA 4R8UB 2E2OA 3KJVB 4TY8B 4QYZK 1J9AA 4CZKA 4YN3B 1WKLA 4JHDA 1GTEA 2IGIA 4X62J 3TAGA 4DTRA 4FWOA 1U48A 3ILJA 2QX0A 1T11A 3ASMA 1Y5IB 1RAEB 1F21A 2GIRA 3O6WA 1XHZA 4OYWA 3HHLB 4A2BA 2X1GA 4X65F 1QHTA 3THYA 1KAZA 1C0MA 4EP5A 2WVBA 2WBNA 3R7SB 3AA5X 4PG8A 3BQ1A 4LFAJ 1BIUA 3OFFA 3WNHA 4L74A 3HSGA 2MHEA 1RE1B 3D0IE 3FMBA 3UW1A 4AXJA 4AHSA 4U6PA 2CNNB 2KG1A 4DQQA 4WE1A 3TSPA 1HHSA 1XWLA 5A76A 4XTTA 2J0XA 2W1BA 1W2BM 4NO7A 2NRWA 1OH7A 1C2PA 5AQSA 1D0EA 2LFVA 4BR0A 4KV8B 2B9XA 5C2FA 2HHHF 2HAIA 1Q8LA 2UUCJ 3ILOA 4IFYA 4RU9A 3KYLA 4RW4A 2E20A 1BE4A 2A2CA 3D2EA 1HD1A 2ZJRL 2HBLA 4DU4A 1IKYB 4OX9F 5F8HA 5IOLA 3I33A 3TTFA 3CDEA 2QXLA 1VQ5S 2QLJB 4DV3J 5D0HA 4NXNF 4JI4K 3D6FB 3RMBA 1QQMA 1H7WA 3LH2S 3AO1A 1NJIO 4CLYA 5L39A 1KLMB 3FSXA 4R8UA 4DQSA 1U26A 2RB7A 2DR6A 2KW4A 4AUKA 4ZLJA 3PYEA 4JV5J 3KJVA 4TY8A 2QL5B 3AJ1A 2V2VA 3POTB 2KHCA 1HHQA 3DXMB 3IN5A 2QWOA 3AAWB 2AP1A 2GJFA 1JXEA 4F0HA 3BSNA 4DTUA 2XB2D 1WJ9A 1SPBP 4DV6F 4YORA 3OFEA 2CRLA 2YKNB 3KD1E 3AAPA 4LF4J 2E5IA 4KHPK 1VMBA 4CBUA 2VQEK 3CERA 3U3YA 3DOLB 2F7TA 4GVEA 3KIOA 3HHLA 2YNHA 2HHHJ 4YEAA 1XTZA 2AEJA 3ENOA 4KH5A 4K2JA 2ZQBA 2IRXA 2C2OB 1W7AA 1P6TA 3THVA 3L2VA 3MR6A 3EX7B 5D6GA 4OX9J 3DGVA 5BYRA 2OEJA 4P7VA 2CGLA 4W5TA 3FBFA 1QJHA 2MQOA 4Q43A 1B7YB 3MM8B 1BWVA 1RADB 5F8GA 2R7SA 2D0BA 4EI2A 5KFPA 3MPWA 4F7VA 2E88A 2PYLA 4BRNA 4F3TA 2W41A 2DHGA 2W7AA 3I6PA 2AX1A 1IKYA 1FTRA 4PZVA 3D6TB 3VF2A 2N4DA 1FD8A 2E5LK 3I87A 2E1RA 4GV9A 3E1YA 3SQ1A 4QR2A 4MK9A 4F2SA 1KVIA 2PC6A 5H9FJ 3NNHA 2ZWOA 3DDIA 2FLPA 4TU8A 3RW6A 1J6ZA 1TTHB 2AA4A 2Y3YA 3LGMA 4DR1K 1CULB 2MQLA 4J9KA 3NAIA 3SV4A 3DXMA 1KXPA 1H1VA 4IRKA 2W7OA 2JEFA 3L6QA 1DTQB 1IM6A 2GJIA 1G1XA 3O3LA 4ZP9A 1WF2A 3QGIA 2DFFA 2YKNA 1V9OA 3MDFA 4P2MA 5A2QY 2B3TB 4RW7A 2GVDB 2G2OA 3DOLA 4URGA 4JI1J 2DKOB 1HKCA 1CLQA 2YQ1A 3QQCD 5F8LA 2D9PA 2ZM6F 1U1QA 3BH7B 2R8KA 3VN5A 4USVA 2EBGA 1RAOA 5KFTA 4FLWA 2CH5A 3NH2A 2BJ8A 2WHOA 4OZLA 3VQ5A 3OTOF 1Q82O 2MZQA 2LQ9A 2ETJA 2QL9B 2KJWA 2XGQA 3KLIB 3VAIA 1B9DA 3PX4A 3QFWA 3RTVA 1EJ7L 3LPTA 1RT6B 2OA8A 5HBMB 3VZHA 3E66A 2OHDA 4FVMA 5CYJA 2VA2A 1N5SA 1K6YA 1TL1B 3IAM9 2QZ8A 4H4KC 1FE4A 5IFMA 4OZJA 4YB7A 3SEOA 4O0IA 5M1OA 1RWWB 3R9PA 4USMA 2F5GA 3AOAA 1VGYA 3BDPA 1NDPA 3CC4N 2MKKA 4HHJA 3DHWC 4MLHA 2CJQA 1S5ZA 1SJ4P 2YWEA 4CBWA 1CULA 2OTLN 1K73O 1ZBIA 1NK7A 5AJ3K 1VQ8N 1A0OB 3CXCR 1WG1A 2ZH4A 1ZXOA 1DTQA 3VR1A 5IXUA 1RKIA 2X3DA 4HTLA 1HI1A 3TWHA 2AU0A 2EKNA 3BGRB 2GVDA 2HS0A 2PN6A 2AGOA 2ATQA 4OYMA 1Q78A 1L3VA 1I94K 3UNYA 4WQ4C 2XNQA 2RQ4A 4N76A 4B3MF 3DN9A 4K5RA 2MLZA 2ZH6A 2NZTA 2ZJPQ 1RBAA 5IQ6A 2OFGX 3K59A 1N34K 4KHUA 3AD7C 4A8SA 4MIWA 4AILC 3TJ8A 3TZYA 3ISZA 1X3NA 3GG0A 4B3SJ 1KVKA 1M90O 1SQEA 4IUFA 3KLIA 5T7BA 1WELA 4EEYA 1KVAA 2ZOMA 3V9SA 5HBMA 5KFHA 1OY8A 5LT5A 1YJNS 2D5RA 3HOTA 4IO1A 6AT1B 4IOXA 1TL1A 3NNAA 4CEFA 4USJC 3A1YG 3AVNA 3IWLA 2RPIA 3CULA 2VFRA 3RJMB 1VR6A 1UL3A 3IWNC 3NGSA 1JL2A 4C0HA 3FUYA 3R1HA 2GAHC 3BKUA 2RJZA 4ED5A 1S6PB 4DZDA 1ZBUA 4E7KA 3EZ5A 2FHKA 3SPZA 1UVNA 2BX6A 2MY8A 4AM6A 1U8WA 5D4NA 3AQPA 2GA7A 2A5XA 1UVIA 4A62A 4ZVGA 3L95X 2LEBA 4N56A 2OPRB 4I9QA 5HP1B 2HZVA 4L3NA 4O4RA 2V8PA 3KNAA 3OYKA 1RHRB 2JLEA 4DV1J 3G6ES 4DWIA 2QTDA 5CHIA 1RT7B 3UPFA 3BGRA 1N54B 3WDOA 3IA0A 3PJ9A 2FUG9 2ASJA 3D1QA 5GAGU 2HNYA 2XY7A 4IKAA 4JKCA 4CBXA 3NHGA 4QWBA 2ZZMA 1VSIA 2ZBRA 1XK8A 4PWWA 1LOUA 1X1PA 3D45A 4FZZA 1MN9A 3MN5A 3O9QA 1FERA 3T1YF 1NSAA 2X1AA 2W01A 4LF5K 4KPCA 2UV8A 3FDSA 2HF3A 4CJFA 3AVGA 4ED2A 2RD5C 1RBOB 2C2NA 2ZH8A 4BC2A 2D3ZA 4Z4CA 4B3RF 1IR0A 3OYBA 3QBWA 5CA5A 3Q2TC 1IM4A 5A8RB 1PO6A 4GVBB 1EWQA 4NLOA 2P2CB 1B0VA 3MGJA 1S6PA 3GOIA 3CCUS 4J7CA 3BGOP 4YB6A 1R8PA 3VERA 3WQUA 4KC5A 3KLFB 2XI3A 1VC6A 4FM0A 3MX5A 2P9KB 5HVHA 4HLBA 4W5NA 3GFZA 3QT5A 4RG8A 5CABA 1S1WB 2OPRA 4CO0A 5HP1A 2JLFA 2QSWA 3WT0A 1T03B 1SZ2A 1X0PA 1Z25A 5JMNA 2HW3A 4TY9A 3SBTA 3CO9A 4OX7A 4DV0K 1NWKA 3SUOA 3T1YJ 1RT7A 2DIUA 3D28A 4WJBA 3V1OA 3TVYA 2O66A 2ZJQL 2OZSA 4RW8B 4ECXA 1RWKB 2GHVC 3QWPA 2DGXA 4W5OA 3CJ1A 4IQXA 2V0NA 3JQKA 2VUGA 3C95A 4JI3F 1TZ0A 3MR3A 4M41A 2BJ3A 3HPGA 2DITA 1S4FA 5KT7A 1VBZA 4LF6K 1IJEB 4QR0A 1IQTA 1H3DA 2HS3A 4OV6A 4LFBK 1T0TV 1ZOTA 3HVWA 1UW4A 2YY3A 1FW6A 2K7KA 3HT0A 1VQ5N 4TSXA 4DB3A 2IMOA 1AFIA 1IJFB 3VQ4A 3UE2A 1WSJA 2FYXA 2NRXA 3PJXA 5AXMA 4LFCJ 1VQ7S 4P75A 4E3SA 4YHHJ 4M63C 4C11B 4BS2A 2KVIA 4BVPA 5LMNK 4U9RA 1HYVA 1UJ6A 1TUUA 2QC3A 2YKQA 1CC8A 3T5JA 1HRHA 3AO3A 5JS1A 1HNVA 3FEXB 3KLFA 3ZNJ1 3KK7A 1RHMB 1PBAA 3O9SA 3SV3A 3C8YA 2GUIA 1R3NA 2W4DA 1JLBB 3RR7A 4Y2CA 1AB8A 1T03A 3G25A 2VICA 5C25B 4NCGA 3SAFA 4JKEA 5G4DA 1B0TA 2VCPA 4K0KF 4I6AA 1SI9A 2W2QP 2LYVA 3OL9A 4RW8A 3O4QA 4HYKA 4NASA 3A8EA 3NOGA 4ZVTB 1YJTA 3S7RA 4EFHA 1F0XA 1VBYA 4EHTA 4PABA 4RNMA 3JTOA 4IDKB 3GZ7A 3OL7A 3CMES 1M0SA 3KLEB 3KXDA 1HNIB 2YH0A 2B9EA 3VGSA 4OZ1A 1HQUB 3WBZA 2ZD1B 7AT1B 4M7YA 1XMOK 4U7UK 2UUAF 4DTXA 1OVYA 3I0SB 2PFUA 3B6PA 4FLXA 4E7LA 2CNOB 5BPLA 2DGUA 2IYIA 4F26A 2W4PA 1PKUA 3TP2A 1LXJA 1RT4B 3PIPL 1S49A 3LZJA 4BR4A 1FVSA 5H9EJ 3F9KA 3NGTA 2V2QA 2UXCF 3OR1B 2GELA 2CDQA 4WIQA 4EBDA 4LRDA 1DKGD 4PHTX 4EYIB 4GRSA 1VQ6S 1XI1A 1SKRA 4ED4A 3GMGA 3RZAA 3CEDA 1KC8O 4KTWA 4MYTA 3QNWB 1C0GA 2D4WA 4N41A 4RW9A 4A8QA 2OIHA 4OO1J 1Y7PA 3VF6A 3H08A 4NLXA 4IOCL 2VODA 3M6VA 1PG5B 1YITN 4GKJJ 3KJNB 2K06A 4DSKA 3IRWP 1QVGM 3LP3A 5IT0A 1HA1A 1IBKK 1FJGJ 2KH9A 2VOPA 1K0VA 4JI2J 2QMXA 2OPPA 1FFGB 2MPUA 1NJZA 3M8PB 4UT4A 1NGHA 4HHHA 3ZTPA 3RBEA 4NRTA 2Y0BB 3VQPA 5C25A 1NZ8A 1TKTA 1AZSB 1N0VC 1U09A 4Y2KA 5KT6A 4JI5F 3MCSA 1M5VC 1CXQA 4QIEA 3D67A 3NDKA 5MLCV 1NK5A 4ANEA 3K5PA 3TAQA 3FQKA 5DGBA 1K8AO 5IT9Y 2FDNA 2MLXA 2UXCJ 2C3OA 4DI6A 2CZ9A 3SQ0A 1YBAA 3QBXA 2ROGA 4E19A 2AJ4A 4IDKA 2JNJA 4ZPBA 3GCWP 2MHNA 2DEJA 3AA9A 1HQUA 4OZ3A 2ZD1A 3JYTA 1K44A 4RJVA 1SKUB 1RNHA 1K1QA 4YB5A 1YF5L 4DCHA 3QINA 1RTDB 2IA6A 2NRRA 2MGZA 1UWBB 4B1WB 3W63A 4NLUA 5L1JA 1C4CA 2ZH3A 4UUXA 1RT4A 2RS8A 4CK2A 1K9MO 5GAHU 4KO0B 2QW9A 4BR2A 4PG7A 3CNQP 4G6VB 1FDNA 2CQGA 3KVGA 4U7BA 4I68A 3D6HB 3SYZA 2NREA 3A4TA 1HNWK 1U7LA 2R8HA 3QEIA 4ZK7M 5ETRA 2XO6A 3A3OB 2J0SD 4QW8A 1S0OA 3ULHA 2CPYA 1YX2A 4MKBA 2FJDB 1RWXB 3OPKA 4ERDA 1UAWA 2YPZA 4OGEA 2V67A 3MXHP 1ZH5A 2IIHA 4IBNA 2E5JA 1NMNA 3OBIA 3V2UC 4CHYA 2VDIA 1F3FA 1TVRB 2AKWB 2GEMA 5C2DA 1GLJO 2L9DA 4ED8A 3QNOA 5DRKA 5J2NB 2NNWA 4HUEA 4MMOA 1AZSA 4IR9A 1FEHA 5B0FA 4CF8A 4ED3A 4YR3A 4CJQA 2G2ZA 4U96A 2V4JB 4X84A 5LMUF 3T41A 2GO9A 1YJWN 1J54A 4PKHA 3N0VA 4TLRA 4KE5A 1UEUA 4CCHA 3TEHB 1HQEB 3HVTB 1R31A 3OT9A 2DYAA 4PKGA 1X31C 2VQFF 1WSHA 4AYBD 2V8DA 4BC5A 4M3UA 2IS3A 1YJNN 4FJ8A 2A40A 4FJKA 2QKKA 3W8GA 2DRDA 3KHGA 5GIPA 3T69A 3CT9A 4NLVA 3E51A 2NR0A 1P8ZA 4RBVA 1S3XA 3UB5A 3EZUA 4OPJA 2HWTA 4H4OB 1NSKL 1NM1A 3A5NC 4KO0A 2K3KA 4IH5A 2YHWA 3ZEUB 3WNGA 3R5AA 2QT7A 1W7WA 5KFAA 5DQGA 1Q9YA 1XEZA 4E1JA 4FJ9A 1XR7A 4JYAF 1NPRA 3OUYB 2C22A 1SIWB 2W9CA 1WDTA 5GMKa 3VENA 1JCFA 4W5RA 3CCMS 1NBEB 3F0NA 1N56A 4UY8T 2Z30B 4M5IA 3WHIA 5ELZA 1ZBTA 5HMZA 2AZ1A 3P31A 4DKWA 3PHTA 2O8CB 5EX5A 3G6EN 3H98A 4ZVOB 1LAWA 3N4PA 3CUNA 1C0UB 4DQRA 2VQFJ 2M3DA 4XAKA 5DZ6A 1TVRA 1S97A 2HVIA 1KHVA 5E5NA 4H5TA 1HNZK 2W2NP 5D8HB 3WEEB 3HK2A 4H0XB 2V34A 2NRTA 1LW2B 2QO3A 3CPWM 2V4JA 2RF2B 5KFCA 3KG4A 5CH7B 2QMUB 4DS4A 5GINA 3RAQA 2VDHA 2ZH2A 2ADCA 4NA1A 3IUCA 1HQEA 4N47A 3EE8A 3V6KA 3T1HF 5KFWA 4OZ5A 2OCEA 5C15A 2HEKA 4MFBA 1HWUA 4ZLPA 3EVOA 4DV4F 1NGFA 1ZYQA 4OI0A 2BANB 3P6YC 1D1UA 4CJPA 2QM1A 2GMHA 1S6OA 2BQRA 4OPAA 4RTFD 3LDSA 3TX8A 3QZ8A 4BRFA 1KSPA 2MKCA 3D0PA 4CH1A 2EX3A 3BQ0A 3BPSP 4CO1A 5HQLA 1F60B 4GKKK 5AQXA 3IBWA 2Q79A 2J8SA 2EFVA 4O5BA 3NRBA 2JVRA 4H4OA 1XNQJ 2BKNA 4ZIVA 1EAYC 4L3KA 3CCUN 4DUYF 5AQJA 3ZEUA 4ZTJA 4U7CA 1URNA 1UOCA 2CGJA 8RUCA 3OUYA 3RSEB 5KG1A 3AODA 3FCWA 3QB0A 4IH6A 1SL1A 2IDOA 4X62K 1IV0A 4JRQA 1RCHA 4P2XA 1XQSC 2EC0A 5E26A 4FBTA 4IFVB 5KOWA 3NMUA 3T1HJ 2X7IA 4IYQA 1TQLA 1YRXA 4NLQA 4I0WA 4YMEA 2A1BA 4ETXA 1R0BG 3WEEA 4A61A 3OHAA 2QA4S 1LW2A 4CLWA 4CLUA 1SQKA 4LFAK 1IG9A 3OJSA 4ES3A 1EO1A 1CZAN 3BZQA 2A6OA 3OHBA 2RF2A 2WRMA 5BYSA 4FLTA 1FRIA 5EX0A 1G3OA 1WAJA 4IOAL 3CD7A 4YP3A 3O3HA 3ENVA 3M6UA 4X4TA 4P6QA 3K0SA 3W66A 2IJRA 1BCMA 5AZIA 3CQXA 2UUCK 2KM8C 4DV2J 3AV9A 3T9NA 5HL7L 4PQUB 1XIQA 3MEKA 3AO5A 3AA2A 4AHCA 2VGNA 1VQ7N 2VG7B 3QMQA 3A5OC 3L2QA 3CCVS 5ADXA 1ZETA 1ZS6A 2QTWA 2IDLA 4DV3K 2EFOA 4IJAA 1TL3B 4EFAC 2OI2A 5DJBA 1JLQB 3BYRA 2QYCA 1ZAWA 2VWKA 4CIGA 1E4FT 3MOJB 4N5SA 3Q8PB 4A5BA 3QEXA 4CHZA 4O3OA 5J2MB 5AQWA 4DTJA 2VG6B 2ZJQQ 1SJ3P 2IJNA 3SSSA 4CJUA 4JV5K 2CQHA 3NH1A 4KHYA 1A9NB 4DR7J 3DRSB 1UVJA 2DNHA 1N32J 2ZOFA 1V5IB 3HO1A 3GR1A 3L7OA 4DPYA 4NRUA 2IJFA 4IFVA 3LDPA 2XHWA 3S3NA 3U1LA 4LF4K 2QK9A 1SUQA 1Q79A 2YKMB 3DLEB 1WC5A 2KFNA 3MOZA 3RB6A 3RBDA 2HHHK 3VAJA 3QATA 5JVHL 2W2MP 4FXWA 1H72C 1KEKA 4CERA 3CMEN 1HX1A 2JDJA 5HRRA 4OX9K 4DUZF 4OLBA 4CF1A 3PW4A 2KJVA 2Z1IA 1J5EF 2OMLA 3DXKB 4AQYJ 1WI8A 3PW7A 3LPUA 4X4QA 3O1LA 4UY85 3HPOA 5F8MA 4KGKA 2DXFA 4ECUA 4LC9B 3BF1A 4PQUA 3DWLA 2MZJA 4OZ0A 1VQ6N 4E2FB 2VG7A 1GX6A 1T9YA 2AJQA 3RYLA 4F4YA 1DTTA 2FJVA 3UD3P 5AQPA 5ETLA 4JI7F 4DCPB 2XZDB 1HYZA 2XLIA 3ZSWA 1TL3A 4MJKA 5H9FK 4QIFA 5ADXH 3NAEA 2OAUA 3TABA 4KHMA 2HVZA 2QFIA 3RB4A 5J2MA 3P38A 3QRRA 2VG6A 1SH3A 5K8PA 4OYAA 5EGYA 3C16A 3V6DB 3DRSA 4JI0F 3IG1B 4QIVA 1RA7A 2FGOA 1VLOA 3Q8QB 1Y3KA 3C14B 1VSKA 5D0RA 4H0TB 3W8PA 4DQPA 2VPYB 1F9HA 3DLEA 1R7IA 4WCEL 1GK8A 1X4DA 1J5EJ 5J2QB 4CJTA 4BC7A 4JI1K 3K8WA 4DFJA 2EWHA 2IM1A 4BRDA 4NCAA 3PUFA 2JEJA 1VSHA 4CF0A 1Z05A 2FXUA 1N0UA 2WB4A 3W64A 3MD3A 4EIAA 1FEEA 2E5GA 1JCGA 1C1CB 1LW0B 2BOPA 1YJRA 4DXLA 3JXUA 4WXWA 4DQIA 3JS9A 2DEIA 3M1FA 3NKYA 2FVCA 3RMAA 1HWKA 1K0TA 3IFEA 2FZGB 3CI5A 3AY0A 1N5QA 2R8JA 2B4PA 2FBTA 1KQKA 3GFYA 3DXKA 3M4XA 2H51B 3HHEA 1GXTA 1RBUA 4YDXA 5BPNA 1OIAA 3PKYA 3H5XA 1S57A 4J2EA 2EK6A 1IH7A 1RJJA 3WIUA 1ATRA 2ACMA 5F8NA 2OKQA 1MWMA 2UYTA 1U4BA 4KIAA 3VTIA 4H8KA 1Y5LB 1GH8A 4FLUA 3VQSA 3PFOA 2Y1JA 2QWLA 2XULA 5F0UA 3GONA 4M5GA 3SCIE 5CR4A 2QLXA 3TVZA 4L73A 4BC9A 4RU2A 3D68A 4ISFA 1VQOS 5HN0A 2GTDA 2CVIA 1NKBA 3OTEA 1G99A 3IG1A 4JP8A 1R8AA 3V9UA 5HJYA 3HD1A 2BDPA 3C14A 4OYZA 1S1VA 4CZMA 1S1UA 4QBUA 3TTDA 4DN9A 3M8RA 2RUSA 3M8QB 3PFEA 1W2IA 3EXYA 5J2QA 3M6WA 1WLJA 4YY3F 1X3MA 2J76E 2I9SA 1FD2A 3LGHA 4OJHA 4OV1A 3H2UB 2Z1HA 2AF6A 1WUAA 5KFIA 1S5JA 1O5JA 4J91A 2W7PA 5E3AA 5EX3A 3MXMA 1C1CA 3CW2C 3K89A 3NCPA 4Q2MA 4KHPF 3SLCA 3SXLA 4KHWA 3MECB 2VQEF 5CCLA 5A8KA 1NGGA 4B3SK 2J6UA 3HZEA 2WVCA 4LRAA 3QIPB 1QD1A 3DNCA 1S7IA 3K9JA 4CFCA 3ENBA 4DN0A 4CHNA 2DIVA 1U1PA 1HMVB 3SSQA 5EN1A 2PYJA 1WOQA 4CZIA 2UXDJ 3GSDA 4BDZA 1ULRA 3MMJA 1HLWA 5HI7A 1N4LA 5E33A 5I3QA 2P9NB 4MK8A 4WFBL 2XMTA 5AFUA 1FKPB 4WFXA 3CCMN 1NH8A 3AA4A 1FKOB 4YY3J 3NS5A 5FROA 4GC7A 4DV7J 4Q7AA 1NH7A 4ILGB 4QWCA 4H5RA 2BQUA 2E5LF 4WK1A 4TNOA 3S9HA 2V2KA 4OL8A 2UXBJ 1ZPVA 5DDQC 4Z4FA 1XN9A 3R7BB 4L3QA 2AW0A 1VIXA 1XR6A 7FDRA 3WXJA 1HR0J 3LDLA 5CAAA 4CI6A 4DV1K 1YI2S 5FRNA 1A5WA 1VBXA 3B54A 4BROA 4Z4HA 2O8DB 4DR1F 3S3OA 2LXFA 4I7FB 5IV4A 4CEQA 3KHHA 4I2PB 1Y10A 4CECA 3LWLA 4FWPA 2HFUA 1YQHA 5C12A 1DQAA 3MWTA 2ASYA 2HPUA 3BF4A 2D69A 4DV5J 3I32A 3N01A 2DR9A 2JRSA 1RBTA 3MECA 2BH1A 5JMVA 2YWKA 3KNGA 2Z2LA 4KT0C 3FGVA 3QIPA 1SL2A 1AYEA 3QT7A 1VQ4S 3OVNA 5K20B 3AVLA 2N82B 5DGAA 5TKYA 1HMVA 3PZPA 4FF1A 3CM6A 1LWEB 1JJCB 1OYEA 2J9EA 2DNZA 2HFSA 4X4UA 4QWEA 1RI7A 5D3GB 3HOSA 2A10A 5J2PB 3IS9B 3OBYA 2RUGA 2AGQA 1QQCA 3OYHA 3GTYX 1NJYA 1JLGA 4P9SA 4F36A 1IO2A 2P9NA 5CCMA 4Y2MA 1GXLA 3NGYA 1FKPA 1ZBHA 4CYUA 2XZTB 2XMJA 5A2QU 2D0AA 5DG9A 5AFUH 3CDUA 4JNEA 3L09A 3PY8A 2Z4PA 2IVPA 3PJWA 5KG6A 1FXLA 4F3MA 1BDGA 2QKBA 2RMLA 2AQ4A 2EFPA 4M5DA 3O80A 4FPBA 3NWGA 2J9DE 5ETNA 1HLUA 4CEOA 3LDQA 2F9WA 2QA4N 4CJLA 4CJVA 2G0IA 3T1YK 4D3GA 4AH9A 3VQBA 4CRJA 5SZTA 4I2PA 3LQVA 4CFDA 4G1IA 3UDEA 3A8KA 5AJ3F 3Q2SC 2ZKTA 2OLWA 1B0PA 1V3ZA 4EAHD 3D7SB 2WVFA 2K2PA 4FW1A 3QGGA 2OD4A 2ADBA 4NOHA 2VFUA 4B3TJ 1RAJA 1CXUA 3V1QA 3RR8A 2XSFA 1GMVA 2G13A 1VRUB 4EK2A 1QE1B 2GUPA 1I94F 4EBCA 5ADZA 1X5OA 3R5GA 3HD2A 4C8MA 2GVZB 4DS5A 1TAQA 5CZXA 3CCVN 4HVZA 1N34F 2J7WA 3T5HA 3HMJG 3ATUA 2J9CA 2UU9J 4FYDA 1KFDA 2EC2A 1LWEA 3TAMB 4ZP8A 3KK3A 3NVKA 4CJKA 3CM5A 4GVMA 2VJUA 2ROEA 1A7GE 4LFCK 3PO5A 3BR9A 4YHHK 5D3GA 4X66J 5J2PA 5EU7A 5B7WA 2FSJA 4K4SA 3KWGA 3G0ZA 4UOHA 2IAJB 3C15A 2N4CA 3M2VB 1WF1A 4IQMA 3E01B 1U2RA 3M8WA 1BIZA 3LF0A 3OYLA 1E6YB 1REGX 5KFSA 3TAFA 3MMCB 3T6JA 4I67A 3CMAS 4I6MB 4WYBA 4ZVSB 4ANCA 1WEYA 4BRLA 3ZSQA 1W9HA 4DG1A 1FWLA 3SBMA 3A5MC 4U8YA 4J5OA 1NHUA 1OVQA 1ITPA 3MR2A 2FC0A 3RG6A 3AJDA 3ZSYA 2A18A 1SBRA 2DGSA 3VGMA 4LD0A 3SUPA 1FTCA 3LZIA 3MWBA 4CO3A 3VPZA 1R6VA 4QOTA 4ED0A 2N3LA 4OJ1A 2U2FA 3THPA 4Z2XA 3AQOA 3W5ZA 2E7XA 5I3UA 2ITGA 4CHOA 1SJRA 1RT3B 2LQJA 3NOCA 2VBWA 4K7QA 4O3PA 4WFNL 1QE1A 2HNDA 4M5MA 2CKWA 1N88A 1KTVA 2RQMA 4H0PA 1BL3A 1RWOB 2RHQB 2GVZA 1CJUB 4ZA1A 4LQ3A 2PA3A 2B9WA 4LF1A 3DMJB 1HBOB 2NXUA 5H9EK 3OR2B 5AQRA 3GBTA 4FK2A 1LK5A 4QYRA 4RL1A 3C6UB 2KXNB 1VHIA 3NGKA 3P96A 4AFFA 2DTJA 1CLFA 1HWJA 4ZPVR 4OFZA 3H1QA 3EKUA 2E1YA 3Q0AA 4LF5F 3TNVA 5JVHQ 2HURA 2P9SB 1M5HA 2OD6A 2FSKA 4YDUA 4GKJK 4UQGA 1KS2A 3E01A 1UFLA 2BABA 2O8FB 2EKYA 3CJSA 2DGOA 3T5LA 1E6YA 1KAXA 3M1VB 4CJ7A 3OYEA 3CQ8A 2HK2A 1FJGK 3MXIA 3MMCA 5HQMA 2YHAA 3L4IA 4DLGA 9ATCB 4I6MA 4JI2K 1HQ2A 4PUOB 2R7QA 4DU8A 3OSPA 3FZKA 3BUZB 2YTCA 2F9TA 4CM2A 1YHQS 3K5NA 4JRPA 5CHCB 2OEKA 4EGLA 1A5XA 2WVDA 1QSLA 4NXMJ 4RNHA 3ZSVA 3VA3A 1FWPA 4FPRA 5KPTA 4ILJA 2G8VA 4G1PA 3WIVA 1XBWA 3WC2A 4KBIA 4KFBB 3S1TA 3GJRB 1N8RT 4KH6A 2UXCK 3D4JA 1UZHA 1JX4A 1IR2A 4C6AA 4FL9A 3IGVA 4DV0F 4PWDB 3MTJA 1HYSB 1OYDA 2NPFA 1NB2A 2KFYA 4LF5J 5HJXA 1XMQJ 4B9LA 3DM2B 1EETA 3PYGA 3V1RA 3ZYYX 3J81O 3R8YA 1PJ6A 3KOAA 1CJUA 3MXJA 1KLNA 3MM7A 4WQ5A 3IAYA 3HLUA 3DMJA 3OYNA 1HBOA 3FEYB 1NNDA 1Q81T 4DPOA 4K4TA 1WWHA 2OP5A 3OR2A 1KQFB 2F4VJ 4LF6F 3C6UA 2CZVC 3EXCX 3KLGB 4ANDA 1JLFA 2ALZA 4K4UA 2X74A 1P9QC 4JKHA 3WQTA 2LMIA 4LFBF 2DBBA 2KTQA 1E3MA 3BO4A 4C97A 3SBGA 2QRRA 4X4NA 3A8YA 2WK4A 4LREA 1FT8A 4DHYA 2ZBQA 4R79A 2O8FA 4QU6A 3OFHA 1FNXH 2CQ2A 3M1VA 2MQ8A 1VHFA 1WSRA 4QS8A 4I69A 1BWFO 4CEAA 4TQSA 3OTCA 2W24A 2E6MA 4KB7A 4RUBA 4PUOA 2B8QA 2OUGA 4GY2B 2H5IB 1RLCL 4HACA 4B02A 3IM8A 1QZ6A 5JVGL 1RUSA 4Y1CA 3HT3A 2MQMA 2RS2A 2DR5A 3BB5A 5CYMB 4WKRA 5K5MA 5JLFA 4FWQA 4LY7A 1BQNB 1SV5A 1NXIA 1TR0A 3VV2B 3ET6A 3MR5A 2IOCA 1F5BA 1RABB 4B9VA 4OGCA 1Y3JA 2VD3A 4F04B 2KHDA 5FLXO 2CJYB 3MN9A 3CCQS 2DFHA 4PWDA 2ZVSA 4ELTA 4OKEA 3SQOP 1HYSA 1Z1ZA 4M94A 5H1SQ 5DG7A 1P27B 2HAFA 1X8DA 3DM2A 2BRLA 3EN9A 3EZOA 3IFRA 3JS6A 3FKBA 1H98A 3P3DA 1TKXA 2D9OA 3ITHB 1JNZB 3IO1A 4F9OA 1B9FA 4G1QB 1EKEA 1KCFA 2LEPA 2G1DA 5ETVA 2GO8A 5L8RC 1UCNA 1XMOF 3KLGA 3DDNA 1T95A 1TUVA 4DL6A 4DOZA 2CQ3A 5KFUA 3CIPA 3FLCO 3MFHA 2JOQA 3FQLA 1T05B 4UY8O 2VKZG 3J8AA 3VQ6A 2ACYA 4LBPA 2KDOA 3UNGC 2W9BB 1BG3A 5KFMA 1NM2A 2DPIA 1IG8A 3QEWA 3LP1B 2JC1A 4FWLA 1PAUB 5T7LA 4WXOA 3QRPA 4OVLA 1DLOB 2Q1LA 1S48A 1CJVB 1SS6A 5HRSA 1S6QA 4J9RA 1VYAA 3HPHA 4HCBA 2IVMA 1IR1A 2VQFK 2PD1A 2FQQB 3SZ2A 4R25A 4YQWA 4YS2A 2ZNZA 5BN8A 2XYPB 2BE2A 1DGKN 3OA9A 3J7ZT 1Z26A 5CYMA 2FHJA 2ZHOA 1IBKF 4LRFA 4TVAB 2AV5A 4XO0A 3CJAA 2OEMA 2KI2A 4C0BA 3O3FA 3VA0A 2RKIA 1YKWA 1VQKS 1RU2A 3W1YC 2R4FA 4F67A 4FJHA 3L0QA 2R7VA 3G9CA 2MXYA 3DC2A 1VQ4N 2FB0A 3CETA 1RT2B 2CZ4A 3AAQA 1R6YA 3TUIC 1HD0A 3AVJA 4MO5A 4HDGA 2VA3A 1U49A 4NYPA 1B7FA 3JTNA 2DHHA 5DLFA 3PW0A 3BKTA 3OTDA 2ZOGA 1WUUA 3VQEA 4DPTA 2AIRB 3CO0P 4HKQA 3QO9B 3FK4A 2F8MA 4USWA 4RPFA 2DNPA 2CPZA 3IRXA 4CZJA 1J27A 3ITHA 3V5RA 3CJ9A 4NMLA 2J6TA 1XNQK 1S1XB 4RW6B 3GP9A 2Q66A 2KZMA 4CE9A 2IBOA 1S0NA 4M3WA 1RBSA 1S0VA 1WHXA 4DR5J 2NCKL 3G6YA 2WCXA 1T05A 2PMWA 2FVRA 2W9BA 1O1WA 2H9ZA 1FJ7A 1IWGA 3LP1A 3HULA 1BA0A 1RTZA 4F3OA 1DLOA 2JSXA 3NS6A 1CJVA 4X64J 3CMQA 2NXCA 2VB6A 3CCSS 1HNWF 2MQNA 5IT9U 4A8FA 1FXDA 4PRFA 4KGMA 3FZ2A 3RBZA 5GAEU 4LIWA 2RU3A 1VQLN 4WTOB 2DH7A 1IKVB 3GIIA 3UD4P 4KRFA 2Y8YA 2QEXS 4BCAA 4K50A 1U24A 1WC4A 1Y64A 4ZDNA 1OH8A 1ILYA 3CVKA 3FE1A 4NL5A 5LSOA 4MQ3A 4KGZB 4CK1A 4CT9A 1JQGA 1ZM2A 2NYIA 3ULDA 2C3YA 5KG3A 1T9TA 1H2VZ 2RHKA 3U4LA 1RT2A 3VEYA 2NLXA 1T44A 2JFKA 3UWTA 4DLEA 2C2DA 1HIYA 4NZ7A 2DGVA 4DMZA 2VH7A 1NSQA 4DV2K 3BBCA 4BRGA 3M6XA 1BU6O 3CYMA 4H4MA 2CPFA 1B4SA 1AUSL 2Q97A 2XWYA 4CNZA 2ZJPL 1X0FA 3QO9A 2C3UA 3VETA 3ZSZA 1SC1B 3FJ2A 1S9GB 3L3VA 4CGIA 1K9MT 3BEGB 1DQ9A 3H7HB 5AQIA 1S1XA 4WTYA 3AVBA 1KWMA 3HDSA 4YOEA 2OPQB 4UOCA 1RT1A 2L9WA 1FDDA 4L6V3 2PY5A 2I5JB 1SC4B 1GLCG 5KFBA 1QY7A 4BRKA 1HBUB 4DR7K 5AE1A 2X1BA 2DXDA 1U1LA 3AGRA 1N32K 4BY9C 2EEYA 2LEAA 4O5FA 3U1MA 3J81Y 3RAXA 1NK8A 2VV5A 2GIFA 2DNGA 3LP2B 4L75A 4ECRA 3UKRB 1HNXJ 3ZSOA 1NBWA 1VHXA 2IC3B 5ETQA 3N5BA 5D0GA 3I5CA 2DY4A 2GBZA 3NCRA 2GZOA 2G1HA 4OI2A 1Q7LB 2OO4A 2HHUA 1JLAB 4EU0A 2WBMA 4M7XA 3HZ6A 1Y9OA 2F3JA 2XC9A 3D2WA 4CP5A 2D41A 3GIKA 1PYOB 2R3VA 3WC0A 3MEEB 4F02A 3WNEA 3DOMA 1HNZF 1DZ5A 2GS8A 3VEWA 4Q2LA 1FWKA 1T3NA 2VFSA 5E3PA 4AQYK 4M1KA 1XJWB 5ETSA 1N6QB 1QAIA 5B08A 2N7CA 5AQQA 4RX6A 4JB8B 1WHWA 1EKRA 2KT5A 1RTHA 3MCMA 3ZTQA 4BC3A 4OLOA 5AXNA 2DK2A 3P5JA 5IQQA 1X60A 2H4YB 4DR4J 1S9EB 1Q18A 1P1TA 3BGLA 5SUHA 3GB0A 4F2RA 3TUJC 2XHBA 1QAJA 3Q8UA 2D74B 2OZMA 2BE7D 3J7Z5 5FLXY 3M9MB 3QERA 2XSJA 1KAYA 2ALYB 4C3LA 1YTYA 2OPQA 4EZ9A 5LY3A 5M1NA 4JHDB 3MPVA 2IMWP 2I5JA 2VC0A 4CT8A 1AROP 4ZPWR 2E1PA 2XZWA 3FZHA 2M88A 4GKKF 2V50A 4DX7A 2E66A 1F5AA 1GMWD 4FF2A 1RGIA 1Y5NB 1SC6A 3CCRS 2CQ0A 4JOUA 4XPEA 1WHYA 1HW8A 1NK4A 1YHQN 2I7NA 4HTUA 1VI7A 3LP2A 2FHOB 3NAHA 1TL7B 4KGXB 4DDFA 3UKRA 4KB0A 4JI8J 1J5EK 3FBBA 4NEYA 4I64A 4DU3A 2IC3A 4Z4EA 4EYHB 3QMLA 3J81j 1RLDA 3ZXWA 4X62F 2IIRA 4PCQA 4ITSA 1FRXA 1LCUA 4DSLA 1JLAA 5ITHA 3LDOA 5D78A 2B4OA 1C0TA 4AL5A 3O9RA 1Z2ZA 3TQEA 2CQIA 1RILA 3VQ8A 4CZFA 4WF9L 4ZCKA 3FZLA 1YRTA 3HHDA 4DJBA 2HHQA 3MEEA 2JC0A 4A48A 2LQ5A 1PIEA 2I0XA 2EPIA 4Q8FA 1MWZA 4LFAF 3D2EB 2Z8QA 2Q6BA 1RAIB 2HQIA 2HHXA 4HI2A 3MX2A 1EKSA 5KFYA 2BUNA 1VDHA 3FZFA 4CK3A 3CIZA 7FD1A 4WZQA 4ECZA 1S9EA 1SJ1A 3GE9A 4FJGA 4ZLNA 4J9UE 2HLUA 1DFDA 2BV3A 3HF5A 4JK9A 5DQIA 4BHQA 3BP8A 3M2RB 1NJWA 3E9OA 3FEZA 2UUCF 1WG4A 5IC6B 3OYMA 2PIIA 2A2DA 2M7SA 2IRYA 8ATCB 3KKFA 3CCES 2NUBA 4OQJA 5KT2A 1EZZB 3DFEA 4GO7X 3QBCA 2PE8A 3HM9A 5L1LA 3DKDA 3G6XA 4DV3F 1O0PA 1UPPA 2QJ3A 3KUGA 2XY5A 4KAZA 1RHKB 3PKMA 2ZBIA 3CJBA 5E3QA 4OMFG 2CJAA 4A5AA 2C2KB 2C2EA 2YNHB 3CB4A 1TL7A 5F9NA 3O6QA 4JV5F 2P9EA 2B51A 2PEHA 1T3OA 2M9KA 4HUGA 4MDBA 3HSJA 3T7ZA 3H4BA 3PEHA 1J53A 1P90A 3ZZRA 1MN7A 4K5SA 4OPKA 5M2UA 3H5UA 3JXOA 5D0EA 1VJQA 2RDJA 2AYBA 3CCQN 2A6MA 2PGCA 4KRWA 3R5CA 4LF4F 3PSIA 2OSRA 4ID5A 2NRZA 2NPIA 4LH5A 3L3CA 2ILYA 2E2PA 1NAQA 5A0YB 4LF8J 2FLLA 3GIMA 2HWHA 1WBDA 2ZC3A 1NLKL 4QW9A 4PR6A 4W92B 2ZZTA 5KFRA 2H5EA 2UXDK 1XUPO 3TZXA 3MK6A 5AQMA 4M5JA 5AQTA 2BJEA 3OYAA 3S01A 2VBXA 3KKRA 3QFHA 3D9BA 1RBVA 3GWCA 1NU4A 3QWUA 3P5BP 1BGXT 4B08A 3M2RA 4LVNP 4DU1A 5JVGQ 4BRIA 2O01C 4UOGA 1U0SA 3BR8A 3OS2A 3EGWB 4FM1A 1RGVA 4YY3K 2HQCA 4K59A 4QJVA 3AGKA 4DV7K 2GQCA 1RYSA 1IBLJ 3P39A 2HHSA 2ITMA 2JWLA 1NPKA 4BLGA 3B6BA 2UXBK 3E8OA 4EHUA 2EG2A 3DYAB 3NBPB 1VK8A 1NGDA 2MSSA 4RW7B 3DRPB 4OZ2A 2W40A 1Q95G 2G8FA 1HR0K 2WC9A 3S8SA 2VF3A 4AHVA 2DXEA 4AHUA 5THWA 1N5YB 4OJRA 1ELOA 1VQKN 1SJQA 2QSFA 3SUQA 2XRIA 3TO8A 4LIRA 3IP0A 2Y9HA 5BR8J 3AXKA 4FZVA 1VC0A 4DV5K 5DMRA 3ZX2A 1T9WA 1VCTA 2P9IB 2APOA 2J4RA 1VQPN 1ZBSA 2JEIA 1BD6A 1KVBA 4JI1F 5C0YA 3MWPA 2WAQD 5A0YA 1FFSB 3DLRA 4J2AA 1WEZA 1YZ6A 2VPZB 1VQYA 5KFOA 2HGNA 4FS1A 3UI3A 5CD4H 3GV5B 1OO0B 5M1QA 1QVFM 4ZIWA 4IKFA 3CCJN 3NF6A 3WX4A 4FVCA 4CO4A 2KN4A 3T9ZA 3ZT2A 3LO3A 3BY5A 4V19X 4ZVUB 3VAFA 2QLWA 2ZNYA 4N8NA 1J5OA 2XWXA 3P4UB 4MIAA 4J2DA 2D1CA 4DSFA 5BXIA 1JXVA 4CJSA 4DR2F 4FJXA 2B4VA 1YITS 4ZN1A 1YBTA 2HBRB 3AVAA 2Y8WA 4BE0A 2EXUA 3CCSN 3J80Y 1UMJA 1YXQA 4BREA 2KZZA 2PDAA 4B9MA 3DYAA 1D3WA 4AL7A 4X2BA 3NBPA 1YT3A 3DRPA 2QEXN 3VEZA 4KREA 4OHYA 1HL6A 4B17A 2UVVA 2JWKA 1JLEB 2NRVA 3IBCB 1X4GA 4FK0A 1E4GT 1N5YA 3SFGA 2CADA 4ER8A 4TLQA 1MSWD 4FWKA 3EE3A 4EO6A 1VRQC 4A8KA 3R1XA 1TYQB 4FWSA 3HJVA 2P9IA 4B3TK 1OPIA 3G96A 4ED7A 3ZSRA 2JFDA 2C2ZB 1KQSM 3NS7B 1NUEA 2X6NA 2B56A 4GO5X 3NY0A 4ZCMA 2CDRB 1VSJA 1PJ5A 2GNKA 4OKJA 3FFIA 5AQHA 1T94A 4ZHRB 2RRBA 5KFEA 1NDCA 1TK0A 3EUNA 1JKHB 4CHPA 2WW4A 2NXJA 4YR2A 4DR2J 2G0CA 3RB0A 2OTJS 2UU9K 4MKVA 2BOAA 5AQFA 4Z0UA 4NLBA 2Z57B 4F4KA 4DTMA 4B3SF 2H5JB 3QFUA 3DHXA 3EDRB 2CGKA 4X66K 8AT1B 3K5OA 5HLFA 3GV7B 4J9LA 5LJVA 4HHTA 1NRKA 5D4LA 4QWAA 4ZCIA 2GV1A 4XPCA 4NLPA 3GLJA 3N28A 5AQKA 3KLHA 4U8VA 1CZ9A 2OELA 1U1OA 2H65B 3DLLQ 2KXFA 1DURA 1IVZA 3BN4A 5IS2A 4RWWA 1JNRB 3BO2A 4XDCA 4A8XA 1SJFA 5I42B 9RUBA 1YJ9N 2GHWA 4K4XA 4HT7A 3ZFVA 3VQAA 2HNYB 1YK9A 1X4CA 1ZBLA 1UTAA 3KZBA 4ED1A 1JLEA 4L72B 3GILA 3KHLA 2GC8A 1HPMA 1PC4A 3MAAA 4A47A 3HM8A 1YJWS 2H3GX 1GFWB 3P1GA 4GVLA 3OFGA 1F5CA 2HBMA 3SK3A 3I9V9 1TYQA 2HBZB 3O8MA 5I4MA 3E9LA 4DV1F 2MTLA 4C3KA 5GAEI 4ECWA 2HFVA 4OYPA 3DRRB 3AVIA 5IC4B 2KLAA 2DNRA 3MCOA 4E8UA 1S10A 2J0QD 4ZHRA 1D9DA 1VISA 1JKHA 4CFAA 2OYQA 2DNLA 3TAEA 2FGCA 4OHXA 1WC0A 3H25A 2E1CA 4KQZA 2F8EX 4ZJOA 5I3PA 2E4LA 3ZT0A 3VEVA 4K8RA 4TU9A 2D0OA 1T9VA 5KGWA 2NS1B 5IWAJ 2KT3A 1NPPA 4CLPA 3CCRN 1IKWB 3MPYA 2Q1NA 4F50A 1TMJA 2NUHA 1U45A 4MK7A 1I3AA 4IWVA 4CZEA 4FN5A 3PXGa 3U3GA 4JKBA 3J7AP 1KDNA 1RACB 1RP5A 3MN7A 4PXBA 3JB9k 3IWXA 3EJMA 1QSSA 3A8IA 5I42A 2MLYA 2P6TA 2EVZA 4ECQA 4AE5A 1BY9A 3KDOA 3P45B 3HZGA 3TA1A 4NZ0A 4LT6A 2LDYA 4NXMK 1ZM9A 3WNFA 1J2VA 1N36J 1S1TA 2RU9A 4NLWA 4LF9J 2ZH7A 4HTIA 1N8RO 3T3FA 4BR7A 1HKGA 2F1FA 4UF4A 3TEGA 3ULEB 4OYBA 1F9FA 2HOEA 2LQ8A 2HLTA 4FYVB 3GR0A 1R0AA 1XERA 3MDQA 2W2PP 2XEXA 2OH2A 2JLGA 2XNRA 3I55S 3RAMA 3MMVA 1V3SA 5K14B 2DB1A 4UOFA 4C8ZA 4U95A 2E8AA 4CJ5A 4N7TA 5C2CA 3DRRA 1V3RA 2HYIB 3BGUA 1XMQK 2BR0A 4PXCA 5HAOA 5KFDA 3FRYA 1U47A 4HTJA 2FLNA 1KFSA 3R6MA 3G8SA 2FZCB 2XMMA 1Q81O 2V8GA 1EB0A 1FNOA 5KFFA 3O4WA 3TANA 2F4VK 2VC1A 1RAAB 2O67A 4CZCA 3ZLJA 5GIOA 4EMDA 1LWFB 2DNMA 4ZVHA 2AZ3A 5F9LA 3J7YI 4M3ZA 4L8RB 4A8OA 3Q23A 4IRDA 1ITGA 3CCEN 2YNIA 1N33J 1HPZB 3PR4A 2QE5A 1N48A 1HNVB 3RGIA 3AT1B 4DL7A 1IKWA 3EMTA 3UFCX 1GMWA 1ZPWX 2AJFE 3NP5A 1X9MA 1N5VA 4LFCF 1EX4A 1NGIA 4YHHF 5KT4A 4GV6A 4NCGB 3GJQB 4WF9Q 3JQMA 1BHLA 2GQ2A 1Y00A 4QQBA 1RYRA 2YJFA 1ZTWA 1IBMJ 3MD1A 3W3DA 3HKWA 4DR6J 2BA9A 3BSCA 4BRCA 4QS9A 1FCAA 1MW7A 4A8MP 2NLWA 3QEVA 2MMYA 2XHCA 4GMKA 4Z37A 1JXLA 3LGNA 1ZZNA 4LVOP 3ULEA 1RDDA 3C2PA 3QGHA 3T19A 1NOZA 3HBTA 4H4KA 1XNRJ 5AXLA 3FCVA 5K14A 2A3ZA 5A6WA 3FZMA 4U67L 1WEXA 3GYGA 4FVUA 1Q16B 1Z6RA 3U1NA 4HH1A 4EUVA 3I96A 4DTPA 3CD5A 5ETMA 1WTBA 4H5WA 3AD8C 2W9AA 4CEZA 5GADI 3L2WA 1DJ0A 3C65A 3N79A 3DU5A 3Q22A 3TR8A 3VOVA 2NSCA 4RW9B 1LWFA 1WBBA 2H1YA 1GXUA 4CGJA 3K5LA 2YX4A 1X5TA 2LQBA 3UQSA 1HPZA 3OV7A 4NWBA 1JMTA 1BOTO 5F0WA 1APSA 3D0HE 4WQ4A 4RUCA 1FK9A 2ZC4A 4C8NA 4KHRA 5M2RA 2IY5B 2OPPB 3HI9A 3FNNA 3BH6B 2QWMA 2J5AA 1YTAA 2AJ1A 2YHXA 4LF2A 1TKTB 3L2UA 3G8QA 2DRAA 1BMQB 3J7ZO 3U6FA 3P4IA 3KD5E 2X78A 4GKJF 2JL9A 5GAEP 3V6HA 2BW2A 3DRXA 4M45A 1GEHA 3C6TB 2RIJA 4K8XA 1O51A 3H3NO 3HP6A 4CO5A 2QLFB 1FJGF 1U25A 1RTJB 4JI2F 3KFWX 1RWPB 1R43A 3H20A 3O4NA 2ABYA 2A0FB 3R5BA 1GLFO 5DZ7A 3TA0A 4TU7A 3U27A 3OYJA 3B4MA 3JYTB 3QLHB 3MPDA 4KGVB 4DFMA 3PRBA 1KQGB 4CJ3A 3CGIA 2MGZB 3EKSA 3MUTP 3OXFA 3R27A 4WP3A 5E7OB 4KH1B 4CNYA 1VQ9S 1SH0A 4ZVRB 2YHBA 1QUPA 4WBFA 4RZRA 5FRMA 3CSKA 1B3TA 4XDDA 2UUWA 5FDLA 1Q0NA 3E3XA 3OS0A 2RE1A 2NQPA 2QWPA 4PPDA 4P72A 1UETA 3CJ5A 2E1MC 3FVYA 2CWKA 3TWZA 3P83D 5J1NA 5LSRA 1S79A 4CH0S 5KFNA 3SJHA 3CQYA 2J9DA 4DSJA 4DR5K 3TSUA 2R2RA 4HT5A 4YOTA 5KFZA 4WP8A 1QLNA 4B1UB 3RW7A 1HJOA 2C1EB 2HQFA 4FJJA 4HR2A 3LPEA 3TZWA 4B9QA 1WB9A 2ZITA 4NYZA 4CIOA 3DLKA 2FTRA 2CPHA 4X64K 1ZBFA 2DNNA 1PBUA 1YZ7A 1NGJA 5L1IA 3BBFA 1R8BA 4QS7A 4J9PA 3AY9A 4Y28C 2K7JA 4V19J 1Q8BA 3VVTA 4HH0A 5GMEA 3IC1A 2H48B 1U1RA 4I6WA 5L9XA 4CFBA 5F0XA 2GMLA 2UZAA 3R9LA 3W9JA 3C6TA 2Q36A 4M3TA 1SKWA 3KG1A 3JQJA 3MM6A 2YJEA 2JZ5A 1U1NA 1RTJA 4J9NA 3QJLA 3SAGA 4WFAL 2AEMA 3TSQA 4KYZA 4RWXA 1RU1A 3N5FA 3H3OB 2I8EA 5HROB 2GGPB 3QGPA 1KN6A 1YRUA 3QLHA 4K41A 3HHLC 1K47A 2JX2A 4C3MA 1JL1A 2E44A 4K42A 5U47A 2OTJN 4J9OA 3PNIA 3GJTB 4OYIA 1VOMA 2P1JA 3NLCA 3ALYA 3OW2R 2MB0B 1K8KA 1TUYA 4CJWA 2BKOA 2VG5B 1FVQA 4ZPTR 2V9WA 1HI8A 1GLEG 1FX4A 2V4RA 4J9MA 4G9ZA 4RNNA 2O1PA 2XBPA 2HBKA 4CVNE 2PO4A 1KR4A 4ZMMA 3DLBA 3ZT3A 4ZLLA 4P2SA 2W9CB 2ZWHA 1S0MA 4OIXA 3CJ2A 2XMAA 4C8OA 3LAKA 4JI6J 1KBRA 1RDRA 3W5XA 5LOQA 2RQKA 3GYXB 1FRKA 2UUTA 5F1XA 3VEOA 4BVOA 3H90A 4NLGA 1HNXK 2GCFA 5AQLA 3ILLA 4JV0A 4M5NA 4FZXC 2NYHA 1UPMB 3DJCA 3MUMP 2IBKA 2XM3A 2DNOA 4IZ9A 2Q2RA 1EQMA 3PCOB 3DXSX 4B1XB 2HVHA 3KLVA 3QYYA 2R42A 3OTBA 4MFBB 2FY8A 3B82A 1SXLA 4NI2B 4FLZA 1M1HA 4ENOA 3OXLA 2POKA 2RHSB 5HROA 2GGPA 3VWSA 2E9ZA 4M63A 3VHQA 2Q3SA 1HWIA 1RISA 3ZZZA 1Z4UA 3LALA 3T5KA 2GWJA 3LL3A 1RDUA 4F4WA 3SDEA 4FYWB 2JEGA 4WFYA 3PO4A 4OHVA 1BI4B 4DR4K 4H0VB 2HG4A 3Q8VA 2IM2A 1WF0A 4FYYB 2VG5A 1TUWA 3KUHA 3MEDB 3SQGB 1MWQA 1L5UA 4BWMA 2UUBJ 3BBBA 2WB1D 1QVFR 4MLEA 3TR5A 4BACA 3OYGA 1X5SA 3QICA 2XMVA 4U7UD 3TQ1A 3GIRA 5GMDA 2HK3A 3M32B 4BGAA 3OL8A 2K3IA 1G7CB 4K25A 1Z2LA 1P9YA 1NEEA 4LF7J 2GFFA 1XNQF 1W97L 1RKJA 4OJ3A 3OSNA 2I38A 5KG2A 5AZJB 4AF1A 3FZBA 4KI6A 4KTZA 1VQMN 1BHNA 2M52A 4JAXA 4ALZA 4JI8K 1QZ5A 4W4MA 3J7AN 2M2BA 4RKUC 3JSMB 3DRYA 3G82B 3QFPA 3H42A 4BRMA 2BQ3A 1NHVA 4NLSA 4AL6A 2MSTA 4NYNA 3I55N 3NH0A 3V4IB 4FLYA 2VBYA 4N8OA 3CJTA 4I1TA 5DLGA 3OLAA 3C94A 2R7UA 1WI6A 1REVB 4F8RA 2JHEA 5CY4A 2AJ0A 4ZPAA 4NI2A 2RRNA 5AZIB 5HK4A 1YVNA 4CHQA 2LLZA 4CW7B 2KO1A 2PMZD 1KQSR 5KFQA 3A3PB 5LXRA 3NVMA 1OH6A 5BRHA 1FJEB 4Q0BB 1WOOA 4NLYA 2VJVA 3EPGA 2YV0X 3N4WA 2L3MA 4ZKAA 1BI4A 1VS3A 1UEVA 4QZVB 3MEDA 1H7XA 3SQGA 1NO8A 3NG8A 2CXEA 6FD1A 5A8WB 1GLLO 1KD1T 5JUMA 5HMYA 1FRLA 4DV2F 2BZ2A 1UW9A 4PG6A 4F0MA 2F9DA 4X65J 1NGCA 1ASVA 2KL8A 3ZZPA 3M32A 2I1RA 2D3OR 5IM0B 4YOUA 3MM9B 3FC9A 2DT9A 3V6JA 2YBVA 2MQQA 4WK3A 4C8YA 5SWMA 3M5RA 1TV6B 2F65A 3ILIA 4DSIA 1SUQB 3A2FA 3U02A 4Y0FA 4X4VA 5AZJA 3OYDA 2VWJA 4ATNA 2EHGA 1XR5A 4FWRA 3B8HA 2V6AA 1CBKA 4WWSA 3JSMA 5AQNA 4BDYA 3G82A 3PDNA 1CJKB 4DR7F 1YJVA 3QJJA 3PRDA 1N32F 4KH4A 2Y1RI 3TPQA 1UFKA 2AP6A 4J9SA 2CPEA 2O8BB 2LKZA 5K8NA 3V4IA 1AT1B 3DAWA 3LUYA 2PI4A 1REVA 1GOBA 4P52A 3CTRA 1RA6A 2G2YA 3TAPA 2BJ1A 4NPOA 4NXNJ 3SQ4A 3SMSA 1IWAA 1LWCB 2I6WA 4LF8K 4KV8A 1AW0A 1L3UA 2FBXA 1ATSA 3ZZOA 2WBRA 5AQUA 4Q0BA 2CH6A 3R5DA 1OKJA 2E5HA 1DTTB 5B0BA 1RHJB 3HP9A 4CGDA 4F4AA 1G4CA 2B4JA 4XK8C 3ISND 2AHOB 1WD6A 2GQQA 4CDIA 3GIJA 3B78A 3J81U 4DV6J 3EDQB 2QFJA 4E1MA 4A46A 4AQYF 2Q43A 3TARA 2E1AA 2XG8A 4OLPA 1Y4ZB 5A8WA 4FYXB 2MJNA 3PYFA 4E89A 2WTUA 4P2FA 1M1KT 2YCHA 1KLMA 5KFLA 3C16B 2ZFHA 3PW5A 4JN4A 2WOMB 5LM7E 3OBWA 1IBLK 4UZCA 2HHTA 3VAKA 3POTA 5IM0A 3MM9A 5AQYA 3V9WA 2IVFB 3VVUA 1BQMB 5K9FA 2B43A 2SXLA 1NK6A 1TV6A 4OX8A 3UVJB 3FSYA 4C48A 5F8JA 3ZTOA 1UWAA 4Y0WA 3CF5Q 4U67Q 3MPUB 3AARA 4C7QA 2YH1A 4DPWA 1BC6A 4C23A 3V81B 4H03B 2H4WB 5KRTA 2QMWA 4PA1A 4ILRA 2HSTA 1YJUA 3N6LA 1PSDA 4BR5A 1CJKA 2CPXA 3AFGA 4LRBA 4W90B 3ATVA 3JSBA 3CD6N 2L08A 1MDUB 2ZF5O 5BR8K 2O8BA 4O8UA 3IR6B 2E7WA 1RHUB 3VGVA 2ZHAA 3LPYA 2HIYA 4FCYA 1TK8A 4KKOB 4WU3A 1KKHA 4HCCA 1VQ9N 4MH8A 3LDNA 3MM8A 1LWCA 3I5AA 3H1VX 1Q7YO 3TRGA 1HKBA 5FLXU 4NZ6A 3BM7A 3I0RB 2FJAB 1LOTB 3P5TL 3BZKA 1OQ6A 3F5TA 3D0GE 1MNEA 1YSJA 3ENWA 1WSFA 2KB2A 1Y97A 1FA0A 5DS7A 3G10A 2XGPA