3FFIA

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
553
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 549
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ffiA05
2CJQA 3FRZA 4EP5A 3DLEA 4C8MA 1RILA 4B08A 2ATQA 5KG4A 4TQSA 3L2WA 4KHUA 2P5GA 4U7CA 1HARA 1RT2B 4RUAA 3TAEA 1IKVB 3CFPA 4RNHA 1T3NA 4BE1A 5KFSA 3QESA 1LAVA 4CJFA 1HYZA 3FQKA 4B9UA 4HCBA 1TKDA 3KK1A 4IG3A 3SQ4A 1Y97A 1TK8A 3SUNA 5I42B 3KJVA 4J2DA 3KK1B 2OH2A 4GMJB 3RRHA 1D1UA 1S4FA 1L3UA 1Q9XA 3I5BA 3BSOA 2R2UA 1RT5A 3QGIA 2PYLA 3G6YA 4N47A 3KD5E 3I0SB 4OGCA 3OSNA 2D41A 1TVRA 3AA2A 1NJYA 2DTUA 1X9MA 1HRHA 3ISND 4CGFA 4G1QA 1TKZA 1RTJB 3HL8A 4RW4A 3AO3A 3OYIA 4RW7A 4QCLA 4CF2A 4MK8A 1RBVA 1N48A 4ZP6A 4BDYA 2ETJA 4IRDA 4FZXC 3KK3B 1C1AA 1C0UA 1NK6A 4CGIA 4NLVA 1LWFB 3H4BA 4HVJA 2RDIA 1UAXA 3OYFA 1RT1A 3NAEA 1SH2A 3MF5A 1T03B 1CSJA 4FXDA 4DTXA 2KFNA 3IGVA 3AV9A 3MXJA 1KSPA 1VSEA 4AHRA 4DL5A 3ULDA 1REVA 4URGA 2G8VA 4GW6A 2YHBA 3L3VA 3KHGA 3VQPA 3TANA 3I5AA 4EBEA 4CJKA 5HROB 4FJMA 1T8EA 5C25A 2V0NA 1SH3A 3VQQA 1A5XA 4DMNA 1RA6A 1TP7A 1QHTA 1NK0A 2OZSA 2HNDB 3PVXA 1NK7A 1KVAA 5DGAA 1RT2A 4J9OA 4E7LA 4J9MA 1NJZA 4KTQA 4ELUA 2B6AA 1JLBB 2AWZA 3PO5A 3VQ6A 4XPEA 1VSDA 3M8RA 2R7YA 3G6VA 3FDSA 2IS3A 4B8CA 2DPJA 3PW7A 3V1RA 4EP4A 1FKPA 1S1UA 4KO0B 1BHLA 3OYMA 3NGDA 3L8BA 5KT7A 5KT4A 1ZBLA 2GIRA 3E01A 3GILA 2XI3A 3MAQA 3AVMA 4B9VA 2ILZA 1WSIA 3TQ1A 4AHUA 4DL3A 3OLAA 2V4RA 4NLWA 2YNHB 4O3QA 3V81B 3HVRA 1I39A 4CEFA 4DTNA 2OPRB 4Q0BA 2FLPA 2YHAA 5L1IA 4YP3A 4W5TA 5CY4A 4NYFA 4CGDA 4IOBA 4O44A 4RU9A 3KIOA 3V9WA 4EYIB 1C0TA 2BQUA 4E1MA 3EY1A 3NH1A 1Z25A 3BQ2A 2VA2A 4WYLA 4WFXA 5C24B 1C0MA 2OPQA 3HK2A 2FC0A 3NL0A 4CEZA 2W9CB 3OS1A 4FJ5A 5DG9A 3SJJA 1RTIA 4OLAA 4IKFA 4FZZA 4E1NA 4IFVB 4FZYA 4QPXA 4JRPA 4Y2CA 2DFFA 3HVAA 1VRTB 3M9MB 3D28A 1A5VA 4DTJA 2E9RX 3AVBA 3VQEA 2VWKA 1KLMB 3KLEB 4ELVA 2I5JA 4DF8A 5KFXA 3NF7A 2JEIA 2Y1JA 3LWLA 4M3TA 4AH9A 4M3UA 2YKMB 4BWMA 1ITGA 3C94A 3T19A 2E6LA 4CJLA 2IM1A 4ECSA 3MXMA 3HP6A 1JLEB 4M41A 1J54A 4J2AA 1KCFA 3S3OA 1FK9B 3FFIB 5DLFA 2HNZA 3BSCA 4ED0A 3KJVB 2YNGA 5I42A 4Y1DA 4KKOB 2D3ZA 3MFHA 4QW8A 4O55A 2XY7A 4CJ4A 3G6XA 4TN2A 4B9LA 1SV5B 3PZPA 4K4ZA 1SKSA 1YVFA 3AA5X 3MECB 4ZVGA 3JYTA 4FK2A 4HHTA 4KV8A 1S5JA 3NGYA 3CVKA 4R5PA 4KHSA 3DLGA 2R2TA 1ZETA 4M45A 3QINA 4WXOA 4CF1A 3PX0A 3ZSOA 1JLAB 1VSFA 3H4DA 1BQMA 5KT2A 1IM4A 4WZQA 5KFEA 1D5AA 1C1BA 2C22A 2HNYA 2ASDA 3K5OA 3L2UA 3DLBA 4IKAA 1L5UA 1S10A 4JV0A 4JRQA 2W8KA 4M3RA 4FLWA 2ATLA 1BISA 2XC9A 1S1TB 5KG0A 3KLGA 4Q44A 2XCPA 1NOZA 1HJRA 1DLOB 2P1JA 3G10A 3T5KA 5KG5A 5C5JA 4KREA 3OYAA 1SL1A 5HRNA 2HW3A 3LZJA 5EUHA 3WNGA 1S9EA 3BQ0A 4CJUA 4NLXA 2FJXA 3GV8B 3M9OB 4B3OA 4KB1A 2IJFA 3GV7B 4K4XA 4DQSA 4J2EA 3V6JA 3TWHA 3AVAA 3RBEA 2XCAA 2E6MA 3DDKA 1RT7B 4DL6A 3OYBA 3EPGA 3SCXA 4OKJA 4PUOB 5FDLA 3CWJA 3RB0A 3NBPB 4NLGA 3CJ5A 4DSJA 4KHWA 3PW5A 1QTMA 3NDKA 4CJWA 3OSPA 4RW8A 4B9TA 4FJKA 4ZTJA 1NK9A 2D0CA 4I9LA 3H98A 4F50A 5F9LA 2QK9A 1SL0A 2AGQA 3TAMB 3NAHA 1FKOB 3NGZA 1JLQA 5HBMA 2UVWA 4WZMA 5HRPA 2RF2A 3H08A 3H5SA 3QGGA 2BGGA 2XO7A 4QWEA 1T7PA 4F2SA 3AO5A 3PR4A 4HKQA 4NLOA 3LP1A 3AVCA 3S3MA 2DFEA 4BDPA 4CFCA 1HQUB 1DTTA 3DMJA 3OYLA 4OGEA 4CEAA 4QOZB 5KFAA 3KLVA 3LP0B 5J2NA 3HHKA 2W9BA 1T03A 4M3XA 3DLHA 1WAJA 1TL3B 3IS9A 2AGOA 2YNGB 1TK0A 3PR5B 4IRKA 1KVCA 3HPGA 1NJWA 3ASMA 3LP3A 4ICLB 4WFZA 4ZPCA 1QQCA 3M8PB 1XR7A 3OYJA 3PX4A 4E7IA 3I5CA 1MMLA 4RW6B 2HHQA 1HYSA 1JLBA 2JEJA 1VSMA 1TL1B 1IH7A 3M8PA 4DTRA 1YTAA 1TKXB 3HVTB 4LSNA 2HHXA 1EXQA 3OYCA 4XIUA 3DLRA 4FJXA 4Z4FA 2X74A 4QWAA 3OS2A 3BJYA 4HYKA 1QSYA 4EBDA 1EETA 1KTQA 5KFUA 3D0PA 4JV1A 3V6HA 4KHRA 1TQLA 4ZP8A 2ZE2B 1REVB 4KI6A 1R0AA 3TVKA 4RUCA 3MXIA 4NLRA 1WAFA 5DG7A 1BQNA 4B9SA 4F4YA 4CJVA 2YNFB 2UVUA 4CK3A 5F8LA 5J2QA 2BANA 3MEGB 3GIIA 5KRSA 3GIMA 4Z4HA 1DTQB 4OKKA 1LW0A 4NCAA 1S9FA 4TYAA 2D0BA 3N6NA 3AVGA 2OA8A 3OL6A 4KPYA 3BGRA 3L2VA 3V9ZA 1N6QB 3SYZA 4W5NA 4O4GB 3FQLA 1RT6A 3S9HA 2W9CA 2IAJA 4ZVHA 4M3WA 4KAZA 4KI4A 3HVTA 3AVHA 3OL8A 3ALYA 4PWDA 4IH5A 2Y1IA 1BIZA 4C8NA 3TAMA 1C1CB 5DQHA 1J5OB 1NKBA 2GIQA 1JLQB 2YKNA 2JGUA 1UA1A 4AHSA 4DFKA 2XGPA 1ZBUA 3BSAA 4O3RA 4O4RA 3AA3A 5KTQA 5J2PA 1JLEA 2QE5A 5JS1A 1JLCB 5KFBA 4ECVA 4O4GA 3NH0A 3OJUA 5KG7A 4CF9A 3N6LA 2WB4A 5L1KA 1U09A 2GBZA 4CGGA 3KK3A 3RMCA 2KW4A 2RKIB 3OLBA 3JSMA 3UDLA 2BDPA 3QIOA 4FJHA 4J9LA 2A1RA 1QE1B 3HM9A 3AVFA 3G86A 1FKOA 3PJWA 2HB5A 1BCOA 2J6UA 4KO0A 1C6VA 4MK7A 2PZSA 3QLHB 4DTSA 2AX0A 5HLFA 2X6SA 4FJNA 3MR2A 1BI4B 3AVIA 1BQMB 4W5OA 4DLGA 5HLFB 5HP1A 2G8IA 2WONA 2AJQA 3FSIA 2V4QA 2AX1A 4KFBB 1TVRB 5KFLA 2W9AA 3OVNA 5J2MA 2XHBA 5F8IA 3LP1B 3KNAA 3CG7A 1IKVA 3K58A 2ASLA 5EDWA 5HROA 3SNNA 1HNVA 4R8UA 4ED7A 4CFDA 1RT5B 4ZPDA 4DFPA 4Z0UA 3UR0A 1S1VB 2QKBA 4YMEA 2RF2B 2CKWA 2NUBA 4HTUA 3NAIA 4MKBA 5D3GA 3ITHA 3PUFA 4DFMA 3IN5A 3M9NB 1S6PB 3K5MA 3H40A 3LANA 3BQ1A 3KKSA 2WOMB 1HQEA 1XHZA 3V6DA 4YR2A 4LQ9A 2WRMA 4QWBA 3BR9A 1RAJA 3TAQA 3KHLA 3LAMA 1HQUA 2IAJB 1J9AA 3AO2A 3OY9A 4O5BA 3KLEA 2DPIA 4ZPAA 3RMBA 1W25A 4L8RB 1GX6A 4J9PA 3VQ5A 3RMAA 2C28A 1RYRA 3PY8A 1JKHA 1IKWA 4FLZA 3HKWA 4NLUA 5J2QB 2C2EA 4WE1B 3DRSA 4OKEA 4BACA 4KAIA 2IA6A 2IMWP 1RTIB 5D3GB 4DU4A 3V1OA 3RR7A 4RW8B 4RNFA 1WLJA 2GC8A 1RTDA 5KFZA 3LWMA 2KTQA 4Q43A 3DI6B 3M8SA 4LSLA 1D8YA 2O4GA 1TAQA 2JC0A 1LW0B 1L3VA 1LW2B 1IKWB 4M94A 4PWDB 3H59A 4TLRA 4ZPBA 4O3OA 3O3FA 1QUVA 3RMDA 3U6FA 1TAUA 4CJ5A 3MEDB 3QZ7A 3TABA 1TV6B 1S9GB 2FVRA 2VA3A 1ZTTA 4ED6A 4Y34A 4KHQA 1F21A 3PX6A 4K4SA 4K4WA 3A2FA 2YKNB 3QEXA 4FBUA 2DY4A 4ECZA 4DG1B 4DL2A 4K4VA 1JL2A 2R8KA 4ID5A 3B6PA 4ZTFA 2BRLA 3AVKA 4YNQA 2XRIA 5JXSA 3G0ZA 4YQWA 5DGBA 3LP0A 4NRTA 4CHOA 3E51A 3V9XA 1HPZA 4FJ9A 4Z4CA 1YT3A 1JLGA 3DOLB 4O3PA 4M3YA 3VQBA 4F4ZA 2X78A 2FVPA 2HHWA 3HSTB 1KHVA 3UPFA 1TK5A 1RTDB 3SFGA 3DOLA 4J9NA 2EC0A 3OYGA 5FROA 1MU2B 1RT3A 2W7PA 4AHTA 4N56A 4R5PB 1VRUA 1Z26A 5DMRA 1LV5A 4FJLA 2ZKUA 2IM0A 1NKCA 3AA4A 1GX5A 2IJNA 2IGIA 4K4YA 1UWBB 4TQRA 1SV5A 5CYMA 4CEBA 4ID5B 2ZE2A 4EO8A 3QO9B 4LSNB 4RZRA 3V9UA 4MKAA 3GV5B 2F8EX 3Q8QB 3C6TB 3SQ1A 4M3ZA 4CHNA 2XY8A 3CFRA 4H8KA 2OPSA 4CGJA 1ZBHA 1I6JA 3KLIB 4I9QA 3BDPA 3QEWA 1NK5A 2IM2A 1RT1B 1G15A 2YNIA 1N6QA 2WTFA 2F96A 1RDRA 3PJXA 4H4OB 2BQRA 3DMJB 2FVSA 3Q8SB 1JLGB 5DG8A 5KFRA 3SUPA 2FJWA 2LSNA 1XHXA 4J2BA 4B3OB 4CJTA 1N56A 3DOKA 3UQSA 4CERA 4CCHA 1NKEA 4DQQA 1BCMA 3FFIA 3O3HA 2EX3A 1XWLA 3VQ4A 1Q9YA 1D9FA 4FJJA 2Z1JA 4RNOA 3VQAA 2R8JA 1DLOA 4KE5A 4WXWA 3KLFB 4NCGA 3QIPA 3V81A 1RBRA 3QLHA 4MFBA 3VA3A 4DTOA 3L3UA 4I2QB 2IOCA 4K4TA 4ED2A 3Q8PB 3CDUA 4KBIA 5HRSA 4PUOA 5KFGA 1S97A 4DEZA 2RKIA 1JKHB 2D0AA 4CHYA 4HUFA 3V6KA 2JEGA 2RN2A 3TI0A 3GYNA 4KFBA 1X1PA 3E01B 1RTHA 2VG6B 3LP2A 3M8QB 4DLEA 3ZSXA 4FW1A 4ECYA 3IRXA 3WNFA 1R0AB 2EHGA 4CESA 3RB4A 3GIKA 4K8XA 4IR9A 3O3GA 2BR0A 4LSLB 4MIBA 4KB7A 4DSEA 4ECTA 2UVRA 3DM2A 3I8DA 4FCYA 3OYEA 4XPCA 1RT7A 1U47A 5EWFA 3I0RB 2D5RA 4IRCA 4FJIA 1RNHA 2FBTA 3JSMB 1DTQA 3D5MA 2E9ZA 5KFYA 3OS0A 2YNIB 5KRTA 3K57A 4DWIA 4LY7A 3SQ2A 5CYQB 4H54A 1EKEA 3TR8A 4FM2A 1S48A 3H5YA 1TKXA 2XY5A 3LAKA 4CJEA 3QEIA 3ISNC 4IH7A 4IH6A 4YR3A 4ICLA 2WHOA 5KFOA 4XO0A 4CIFA 4IFVA 3DRSB 1K1SA 2GV9A 4N5SA 1KFSA 2GUIA 1J5OA 4BDZA 4F2RA 4Y2AA 5CZ1A 2W9BB 5F8GA 4F3TA 1S0MA 4KTZA 3RAXA 3S3NA 1JLFA 3OL7A 5T14A 4WYWA 4F3OA 4YFUA 2ZD1B 4FM0A 3KK2A 3MEDA 5K14A 4IFYA 4TY8A 2ILYA 1A5WA 3KLHA 1T05A 3IS9B 3HYFA 1DTTB 4KHMA 4PQUB 1TL1A 4KRFA 5KFTA 1L3SA 3ZSZA 5DQGA 1NHUA 2O5DA 4FYDA 4ELTA 4DSIA 2ITGA 3QO9A 3BSNA 3DLEB 1JXLA 2C2DA 1VSIA 1HYSB 1I3AA 3KD1E 5KT3A 4ID1A 1D9DA 3KOAA 5DLGA 4ECUA 1LAWA 2IC3B 4M42A 4AHVA 1JL1A 2BQ3A 1C2PA 2V9WA 3IAYA 1CZ9A 1S1XA 4H4MB 2F8SA 2AU0A 1W9HA 4IBNA 2QKKA 1SH0A 4CEQA 4OLBA 4FLYA 3QYYA 3ZT1A 3KMQA 2D3UA 4DU3A 1S1WA 4IG3B 2OPRA 4Q0BB 2G8HA 5KFQA 3QNOA 4CF0A 4OL8A 3DYAB 2JC1A 3DRPA 4Z4EA 2JEFA 4K4UA 4ZP7A 3MR5A 4JS5A 3VQCA 4B9MA 2AGPA 2KQ2A 3AVNA 4Q5VA 4NZ0A 2IBKA 3KMSA 1HMVB 2VG5A 1S0NA 3HPHA 1LWEA 2YV0X 3ZSVA 4F4WA 4ZVEA 5L9XA 3C6TA 1NK4A 4BE2A 2KZZA 2HHSA 5L1LA 4FLUA 3MEGA 3T5JA 4KKOA 4DFJA 3K5NA 4W5QA 4U6PA 3RWUA 3NFAA 1QAIA 4FVMA 4ZP9A 2QV6A 4FS2A 1U48A 4NRUA 1ZBIA 4I2PA 3V4IA 1HNIB 5KFCA 4RNMA 3K59A 2HHVA 1QSSA 1JXEA 2QXFA 3OHAA 2X6NA 4J9KA 1S1TA 1LWCA 3VQSA 3NBPA 5J1EA 2OYQA 2I1RA 3U3GA 1FKPB 1S1UB 4C8KA 3SZ2A 3DRPB 5HRRA 3BGRB 5J2PB 3H2LA 3KHHA 3T5HA 2G8KA 4CK1A 1IKXB 3RB6A 4NLSA 2W7OA 4E19A 3QERA 2PYJA 4RW7B 2A1SA 3TARA 3OL9A 4FLTA 3SI8A 3QIPB 3ITHB 3DLGB 2HNDA 1S6PA 3HVWA 4KHYA 4BE0A 3JYTB 4H4MA 5F9NA 3DOKB 4URQU 4FS1A 1S6QB 4ED8A 4MQ3A 1RT4B 4FLXA 1GOBA 4OPKA 5KFKA 2FBXA 3ZCMA 3LP2B 2HNZB 5C42A 2FBVA 2B4JA 1TL3A 3WNEA 2HNYB 1EP4B 5SWMA 1LW2A 1TKTA 1RT6B 3PHEA 4Q8FA 3EYZA 2FLNA 1RTHB 2VG6A 4PY5A 4O0JA 1UOCA 1XI1A 1GOCA 4CHZA 4FK4A 1KRPA 5KG6A 4JLHA 3V9SA 1YTUA 3CM6A 4CHPA 2IM3A 4J9QA 3TAFA 4LH5A 4I7FA 1HQEB 3VQ9A 3CFOA 4I7FB 4CEEA 3OYDA 2D7SA 4CIEA 1GOAA 4ED1A 3C6UA 3KTQA 1IO2A 1JLFB 1TKTB 5E41A 1MU2A 1RT3B 3HO1A 3HXMA 2B6AB 3HPOA 1B9FA 1WSHA 5FRMA 4N76A 2OPPB 4KTWA 1ZYQA 1HMVA 2VG5B 4RW4B 4IFYB 1VK0A 4TY8B 1Q8IA 1YVUA 1KHWA 1SKWA 3ZSYA 1NNDA 3ICLA 2KZMA 1EP4A 3IGNA 4ECRA 1B92A 3OHBA 4ECQA 4MK9A 1ASUA 4DTMA 3MTKA 1RDBA 4E7KA 3K5LA 4DSLA 1RDDA 4J9RA 4K8ZA 5C42B 3O4QA 3OYKA 3HJFA 4E3SA 3F9KA 3CM5A 3ZSQA 2BANB 3KLIA 4PA1A 3KK2B 3KKRA 4CK2A 4IQXA 4WE1A 3AVLA 1U4BA 4Y1CA 1T94A 1U49A 2FLLA 1WNSA 3L2QA 4F4XA 4CJQA 3LZIA 1S9GA 4JS4A 3OYNA 3NMAA 4R8UB 1CZBA 3NF9A 4DSKA 3NE6A 3N6MA 4RG8A 4EO6A 5FDLB 4DQPA 2KFZA 2O4IA 4EBCA 3CO9A 3UIQA 4QWDA 4DQRA 3CJ0A 4IG0B 5KFHA 5KFMA 5K14B 3NKYA 3SFUA 4QAGA 5F8NA 1L3TA 3KLFA 1QSLA 3EPIA 3ZT0A 4KSEB 1ASVA 3DLKA 1S9EB 4MFBB 3QEPA 3ZT2A 3MEEA 1BI4A 1RCHA 1U45A 5HBMB 3EZ5A 4DSFA 5KI6A 1S1XB 1QAJA 4WFYA 5L1JA 1SUQA 4NLQA 3C95A 3CJ3A 3GQCA 4CFAA 1FXXA 3ZSWA 5KFFA 4CJSA 1EETB 3MFIA 2ZQBA 3OYHA 4W5RA 1VSHA 4G3IA 4NLPA 3K2PA 2YNHA 2XI2A 2RDJA 4EZ6A 3CJ4A 4X2BA 1X9WA 4FK0A 4YR0A 3PV8A 2HVHA 4DF4A 1KLMA 1KVBA 1KLNA 1TGOA 4JUZA 4E7JA 1ASWA 3I0SA 3GIJA 4CGHA 3SPYA 2IC3A 3MR6A 3DI6A 3MECA 2YNFA 1BL3A 3NF6A 3CQ8A 4MIAA 4F4KA 1IKYA 3C6UB 1UWBA 2R2RA 3L2RA 4E7HA 2BE2A 3OJSA 4NLDA 2W8LA 3VQDA 2ALZA 2C2RA 1RA7A 5F8MA 3MEEB 1WSEA 3NCIA 4UQGA 2XWYA 4ZVFA 3CDEA 2I5JB 4QWCA 1HPZB 2IDOA 4EZ9A 5FRNA 5SZTA 5KG3A 2R8GA 4KV8B 4Y3CA 3V1QA 2OPSB 1IG9A 5CZ2A 5KFIA 4OVLA 3B6OA 2FVQA 5KFNA 4Q45A 4J9SA 4RW9B 4I2QA 1J53A 5DK5A 2BE2B 2HMIB 1RT4A 4H4OA 5KG2A 2Z1GA 2VG7B 4TYBA 3F73A 1KFDA 2HWIA 3V6DB 2E9TA 2ZD1A 3VQ7A 1NHVA 5KFVA 5HP1B 1RYSA 3VQ8A 5J2NB 2RPIA 4DTUA 1LWFA 3AO4A 3P83D 4KB0A 4AHCA 1N4LA 1O1WA 3M8QA 4DTPA 1S49A 4TY9A 2ASJA 1VSJA 4PQUA 4BWJA 4FJ8A 3IRXB 4ZHRA 4EYHB 1LWCB 3NF8A 4CIGA 1CXUA 4G1QB 4CJ3A 5I3UB 1HYVA 3DRRA 3LDSA 3THVA 4K50A 3QETA 4CEOA 3ZT4A 3ZT3A 4JV2A 1BIUA 1N5YA 3LPTA 2AQ4A 4DL7A 3VN5A 4FBTA 2P5OA 3PW2A 2G8WA 5KGXA 1Z4UA 1EX4A 3I0RA 1RDCA 1S6QA 1JIHA 5KFJA 1C1BB 5C24A 3IG1A 1OS5A 3PW4A 4NLTA 5DQIA 3NH2A 4IDKB 3CIZA 2P51A 1VSKA 4O44B 1TV6A 3DRRB 3SV4A 4ECXA 1XC9A 4EEYA 3NHGA 4GC6A 5KFDA 1B9DA 4M95A 4GVMA 3U3YA 1WNEA 5F8JA 2HWHA 3VA0A 4CJPA 4IG0A 2OPPA 1WSGA 4CJRA 3EZUA 2WK4A 3O4NA 2G8FA 1WSFA 1RTJA 4NYNA 2B43A 2R2SA 3HP9A 5KGWA 4E0DA 4DS5A 4NCGB 4C8OA 1FK9A 2UUTA 4NLYA 1SL2A 1C0UB 5EU7A 4NCBA 3CJ2A 4DS4A 3KLGB 3SQ0A 3P5JA 4ED3A 1D0EA 4LH4A 1QS4A 2UUWA 2J6SA 4DQIA 3SV3A 1LWEB 4RW9A 1T05B 3SUOA 3KHRA 2Z1IA 2WOMA 2J6TA 3AO1A 4Z4GA 4DL4A 1HNVB 4HCCA 1JLAA 3KLHB 2WONB 4O3SA 3Q8RB 3DYAA 1TKZB 2FVCA 2JLEA 4CFBA 3QZ8A 2HVIA 2R8IA 1W0HA 4URSA 2W42A 4FJ7A 4FJGA 2OPQB 4LQ3A 4RW6A 4CEDA 3T3FA 2YKMA 3ZSRA 5CYMB 4CF8A 3RBDA 1QE1A 3PO4A 5KFWA 2G8UA 1U04A 1VRUB 3PW0A 3TAPA 2Q3SA 1WSJA 1VRTA 4FM1A 4IR1A 3LPUA 5CYQA 5KT5A 1S1VA 1IKXA 4FLVA 1C0TB 2DFHA 1RDAA 4AILC 2HAIA 1JX4A 2Z1HA 1RBSA 2E4LA 5F8HA 3P1GA 3RAQA 3HT3A 1CLQA 4R0EA 3T5LA 3QNNA 3SPZA 1RBTA 2XY6A 4ZMMA 5JUMA 3RRGA 5KT6A 3SUQA 1CXQA 3T1AA 4DG1A 1S1WB 4NYZA 3AVJA 4TXSA 2R8HA 4B8AB 4CE9A 3IG1B 2HHTA 4B9NA 4DU1A 3RR8A 1ZTWA 4IDKA 3QGHA 4TSXA 1BQNB 3NGIA 2WCXA 1S0OA 3H5UA 4O0IA 1SUQB 4I2PB 3V4IB 3SI6A 2B5JB 4KHNA 3BREA 5JS2A 1IKYB 3CDWA 1WN7A 4RNNA 1ZBFA 2HMIA 1K6YA 1JXBA 4CECA 2PY5A 3H5XA 3WNHA 2OZMA 3CYMA 1JLCA 4O3NA 1UA0A 4ZHRB 5C25B 3RTVA 4CHQA 2FJVA 5EWEA 5J2MB 4HUEA 5J1EB 5T7BA 3DM2B 2VWJA 1VSLA 3D45A 3RB3A 1X9SA 3QEVA 3TAGA 2FBYA 1BGXT 2XGQA 4Z4IA 5KG1A 1NJXA 1XR5A 1K1QA 1SKRA 3LALA 4E89A 4LD0A 1RBUA 2VG7A 1HNIA 5EWGA 4GC7A 5KFPA 3MR3A 4F8RA 4MH8A 5I3UA 4FW2A 3QIDA 4N41A 2UVVA 1NK8A 4OJRA 2B5JA 2BRKA 4QW9A 4OPJA 1C1CA 4ECWA 1N5YB 4Q8EA 1NOYA 4C8LA 2F8TA 3DLKB 2HHUA 4HUGA 1XR6A
chains in the Genus database with same CATH superfamily
1FRMA 4DX6A 3EE8A 3MM5B 3D1HA 3DLEA 2U2FA 2E2PA 5LSLA 2R7TA 2MB0B 3L2WA 3WQPA 4RUAA 3TAEA 5BRFA 4WKRA 4RNHA 4BE1A 1GXTA 2H4YB 1UVJA 5KFSA 2C2ZB 3FQKA 3CJRA 1NGJA 3A4TA 4HCBA 2AZ3A 1RAGB 4IG3A 3O8WA 4B3TK 1TK8A 2YHXA 2OH2A 3QT5A 1S4FA 4F4AA 3I5BA 4CH7A 3VF2A 5THWA 1RT5A 5GAHI 3BO2A 1K73O 5AQSA 5B0DA 3AA2A 1UCNA 4X4PA 3AY9A 2QWNA 4QS7A 2HZVA 3HL8A 1F2HA 4FYWB 4DV3J 4RW7A 1WDTA 1RBVA 3WC2A 3WEEA 5KPRA 3MX5A 2UUAF 4HT5A 2WBMA 1C1AA 5GINA 2NZTA 1LWFB 4OYIA 2RDIA 2BJDA 5H1SQ 3NAEA 3VGVA 1T03B 1CSJA 2KFNA 1KSPA 1I3OB 2G1DA 2ZH8A 1WKJA 4AHRA 4ISEA 1REVA 1IV0A 2B4PA 3TANA 3U9ZA 3VQPA 2DNGA 3I5AA 1Y3JA 1DBDA 2HQCA 4B17A 1IN0A 5J1PA 4BGAA 2VF3A 2A3ZA 3VQQA 1WUAA 4DMNA 1D8ZA 2F4VK 2QLBB 2RD5C 1HBMA 4NXMF 4LF2A 3PVXA 2HGLA 2OSQA 1WHWA 4J9MA 1MWMA 7FD1A 2AWZA 3VQ6A 1F5AA 1VSDA 4F36A 3D7SB 3BBCA 2DR6A 2P9LA 3BH6B 3PW7A 2W40A 2CNOB 4KO0B 4UF4A 2B4VA 3L7PA 4PEOA 3CPWR 4S0MA 3ZZ0A 3AAQA 3GLJA 3MAQA 4L3NA 1OH6A 2ILZA 1FJGF 3TQ1A 4AHUA 4I56A 4OI4A 1HHSA 3CI5A 3D4JA 2B9WA 5IT9U 2V4RA 3VAKA 1XMOJ 4CIOA 2YNHB 1DURA 4I6YA 5E2QA 4DTNA 4Q0BA 3LDLA 2FLPA 2YHAA 4W5TA 3CD6N 5CY4A 4DV1K 5CR4A 4NYFA 1X4EA 2AD9A 4CGDA 5E3RA 4X62J 2VONA 1RE1B 3FBFA 4LF5K 4A4JA 2NZCA 3NH1A 1Z25A 3L4IA 3TUPA 4WFXA 1PC5A 1ZAXA 2G0CA 4OI0A 3NL0A 1FD2A 4CEZA 3IUCA 3OS1A 5DG9A 4Y2KA 2ZWPA 2VQFK 1ZPWX 4USWA 4GVEA 1H2UX 3HVAA 1P1LA 3M6XA 3M9MB 3CJKB 2KKZA 1A5VA 4DTJA 3AVBA 1IVZA 3KLEB 1KDNA 4DF8A 2MY8A 4JBCA 4B3SF 1MWKA 4CBXA 3LWLA 4LFCK 4AH9A 3T19A 1FRKA 5DM6Q 1D3WA 3MXMA 3HP6A 1JLEB 2PEHA 2RUGA 1J6ZA 2ZVSA 5A2QU 1S79A 3DGPA 3VR1A 3OHRA 1EB0A 3S8SA 1YJ9S 2PA3A 2QA4N 1N52B 5I42A 2YNGA 4XDCA 2D3ZA 2K7JA 3MFHA 1IBLF 1GLJO 4QW8A 2XY7A 2FZCB 1SKSA 3PZPA 1YVFA 3AA5X 3LDNA 4FK2A 2QYGA 4HHTA 3NWGA 1NPRA 1S5JA 3FMWA 3H2UB 2B7CB 3VAFA 2R2TA 2CQPA 4OI3A 2GV1A 3Q23A 4OZ2A 3D0GE 1VSFA 2KH9A 1M5HA 1IM4A 3B8HA 3D1QA 4B02A 2AT1B 1NSKL 2CA9A 2ASDA 3K5OA 4OLOA 3OFFA 4OHWA 2EK1A 4FF2A 3JAMO 4DL0C 1VC6A 3FZLA 5KG0A 4ILLA 1TYQA 3IFEA 2P1JA 5KG5A 3WUHA 4JHDB 3OYAA 3PKYA 3THYA 1NU0A 4TKTA 5GAGI 4EHTA 5HRNA 1HI8A 2HW3A 5EUHA 3WNGA 1S9EA 1PJ7A 2JDJA 3GE9A 5T41A 1RBOB 2A18A 4B3OA 2DNYA 4C2MA 4PG4A 2XMWA 1R7IA 3B82A 4K4XA 3RBEA 4BVOA 2J0WA 2XCAA 1RT7B 1S59A 3KJQB 3HKZD 2AIRB 5BPMA 1YKWA 1HKBA 1H0HB 3CWJA 2CIMA 4EK2A 2O8FA 4DSJA 3EZWA 1RP5A 3PW5A 1QTMA 3R6LB 4LIRA 1X7VA 3OSPA 4ILRA 5M2RA 1XQSC 3UKRB 1KKHA 3NAHA 1FKOB 5CD4A 1NGFA 2R7WA 2QWRA 5IZHA 3H08A 3QGGA 1U6BA 1G1XA 2DH7A 4HKQA 5F0XA 4BC9A 2VZ9A 1HQUB 1N5VA 1DTTA 4CO5A 1TR0A 4X64J 3OYLA 2DY9A 4TLQA 3EE9A 4XH4A 2DTJA 3FCWA 3HHEA 4LBHA 3TR5A 1RSCA 1YZ7A 2E1RA 2V51B 2B51A 3DHWC 3DLHA 1WAJA 2ZEJA 3IS9A 2J5AA 1VQ9S 4QU7A 3R5BA 3A8YA 3PR5B 1KVCA 2SXLA 4JI6F 4G1PA 4O23A 3MMCB 3ZZRA 2V4JA 1O6XA 3QDKA 3AJ1A 2FJEB 3E8OA 3WX8A 3I5CA 4A46A 3PFEA 2W2QP 2HHQA 1JLBA 1VSMA 2VQFJ 4DTRA 3HVTB 4LSNA 4E98A 1XNRK 1Q8KA 3EX7B 2B0GA 2YKPA 4C8YA 4Z4FA 4KGVB 3EN9A 2X74A 3PRBA 3OS2A 3BJYA 3HTVA 4EBDA 5KFUA 1NGHA 3ZEUB 2W01A 4JI8K 1UWAA 1TQLA 3U8XA 4ZK7M 1WJ9A 4JI1F 2ZE2B 2CPXA 1N32F 2HMPA 1UEKA 2E1ZA 1RHMB 5BR9A 4RUCA 4NLRA 3TUJC 2WZ1A 3W9HA 1T02A 4F4YA 4CJVA 5DDOC 1S5ZA 2UVUA 4CK3A 2EFQA 3SCIE 1BUXA 3OTBA 2CPFA 2ZZTA 3MEGB 1GT8A 5CQGA 2AEFA 2ZH1A 1DTQB 5GAHU 3N6NA 3PNIA 2RHSB 4H0YB 2W9CA 2IAJA 2EFOA 4JB8B 4M3WA 1BG3A 1R8HA 3FCVA 3W9JA 4W90B 4PWDA 4CBWA 2Y1IA 3QSIA 4X65J 1C1CB 2RDDA 3P3DA 3GU0A 5AQIA 2HK3A 2XULA 2Z8QA 1QM9A 4HACB 2IVNA 1NXIA 2XO6A 3OD2A 4O4RA 3RUBL 4KGZB 5JS1A 4ECVA 2COLA 4O4GA 4CF9A 2YI1A 1YBAA 1BOTO 2Q1LA 1YJRA 3N28A 2J0XA 3TZXA 3DU5A 4M5JA 3CJQA 3MM9B 2BJ7A 2QA4S 3IC1A 3UDLA 2BDPA 4RWXA 4FJHA 4DR5F 3PYGA 4PZVA 3PIPQ 4FYXB 5ETVA 5A8KA 2C2KB 2ZBQA 2H5EA 2QYCA 4G9ZA 3GG4A 2OHDA 2VBXA 3I96A 3SSSA 4ZPVR 4UW2A 2W2MP 3CJ9A 1Q53A 1QZ6A 4W5OA 4DLGA 5AQVA 2F7TA 1N88A 5HP1A 4QZVB 1TUYA 4BBYA 4DV5K 3U1LA 3AA9A 2V4QA 3WIUA 4JI2F 3PJ9A 5J2MA 4NB4A 2LCWA 4WFNL 3E66A 3O8MA 4MO4A 4QYZK 4V19J 3DXMB 2ASLA 1CS4A 5EDWA 1B99A 2F9DA 1FE0A 4QIGA 5MAOA 2KL8A 2RUSA 1HNVA 4CT9A 5GADP 1N36J 2KLAA 4DFPA 4RWWA 1YWXA 3QFPA 2FHMA 3UR0A 2QKBA 2RF2B 2CQBA 4N8OA 4DCHA 2NUBA 4WQ5A 2QFIA 2UXDK 3ITHA 3PUFA 4DFMA 2O8EA 4CLUA 3EDQB 3M9NB 4B1YB 2BE9B 3K5MA 3LANA 3BQ1A 1WWHA 2LEBA 4DOZA 2DRDA 3TU5A 2EI5A 4QWBA 5LMNK 4USUA 3BR9A 3HHLC 4PXCA 1NBWA 2UXCJ 1VQPN 3T6BA 2IVOA 2IAJB 5H9EK 1Y64A 3OY9A 4H0OA 1SBRA 1T9WA 4O5BA 2KT5A 3KLEA 2XNQA 3SMZA 4ZPAA 3CC2N 1UEVA 4J9PA 3VQ5A 1RAOA 3WHIA 3H3OB 2E5IA 2DGXA 3NNCA 4LF8F 1XMQK 3KKFA 5A8WB 2C2EA 4OKEA 5EVZA 2HKEA 3S01A 3O1WA 2EFPA 3N4PA 5D3GB 3W63A 2OEKA 2GWJA 4V19S 3OT9A 4PKIA 1RTDA 5KFZA 3LWMA 3NNHA 3I9V9 2VHGA 3Q7BA 1D8YA 2JC0A 2ZDPA 3G25A 1PAUB 1LW0B 2D3O1 4H5WA 1L3VA 4ANDA 3CCVN 4TLRA 3I33A 2WVCA 2XMAA 1TAUA 5ETKA 2N3OA 3GG0A 3DU6A 4UY85 2ZUAA 1OIAA 4P7VA 1RKJA 1ZTTA 2ACYA 1CG2A 1YAGA 1BA1A 1CJKA 1EX8A 1FNMA 3QQCD 4K4WA 3W3SA 2YKNB 2DY4A 4ECZA 3ATUA 5E3CA 4K4VA 1RLCL 4ID5A 3CF5Q 1FDNA 4HH0A 2Q0RA 4DR5K 2Y0SD 2XRIA 2KG1A 5HVGA 1U8SA 4YQWA 4CHOA 4NRTA 3OXFA 4Z4CA 1JLGA 3VQBA 5K9FA 2KDOA 2ZH7A 2KM8C 3DOLA 5FROA 2W7PA 1RT3A 2FHJA 3W5ZA 4N56A 5HO4A 4KBOA 1KC8O 4IJAA 4HACA 4PKDB 1LV5A 3X1LB 1NKCA 3AA4A 2QW9A 1YG0A 1VRQC 1UWBB 1YVNA 1OQ3A 4EO8A 3VZHA 2A6OA 1TL7A 4P2XA 2GX9A 1HBNA 2IFXA 5GMEA 2QLWA 4MKAA 3ZO7A 4JI0K 2VFVA 4A8YA 3PIOQ 2HS0A 3UDCA 1Q82T 3MCOA 4H8KA 2DGOA 3KLIB 3ZX0A 3QT7A 3QEWA 1NK5A 4KPCA 1RT1B 2YNIA 4FO0A 2YX6A 4JV5K 1VLYA 3HHLB 1FFWB 5M1QA 2UYTA 3MX2A 2MQLA 1AFIA 1JLGB 2G0IA 2V52B 1Z6RA 5FPDA 4NOHA 4PPZA 2DXEA 3PHTA 4B3OB 2ZGYA 4CJTA 4CO1A 2XYHB 4DMZA 1N56A 3DOKA 4HDGA 3UQSA 4PG7A 1W26A 3FFIA 1YLXA 3DLLL 4CZFA 4RUBA 3H90A 5EHHA 3KLFB 4DUTA 4NCGA 3QIPA 3CD0A 3OFHA 4A48A 4I6AA 3GDQA 3VA3A 4DTOA 3L3UA 2IOCA 4K4TA 4CW7B 1VC5A 2NUHA 2CUYA 1YZ6A 1FA0A 4CHYA 2R7SA 4FWLA 1N33F 3V6KA 3BV8A 3O4WA 4P6QA 2ZOFA 2RN2A 3MMJA 4NZ7A 4BCAA 1IUJA 3G71S 2VG6B 3M8QB 2K3KA 4M5DA 1WF2A 2Y9HA 4DLEA 5LMUJ 2I0XA 2QG9B 1T3OA 3IRXA 4DV0F 3RSEA 4K7QA 4LR8A 1VQ5S 1YJUA 1R0AB 5F41A 4CESA 2RE1A 3GIKA 4K8XA 1D4XA 1P9QC 3VGUA 4CQ1A 2N4CA 3I8DA 4FCYA 3OYEA 4A61A 2NSCA 2B8QA 4C6AA 1G7CB 2D1KA 4BROA 1H73A 2FBTA 3JSMB 1DTQA 1Q5YA 3OS0A 3N9UC 5KRTA 5E33A 4M1KA 3Q0AA 1OSCA 4V1Ak 3MAAA 1EKEA 2GUPA 3AB4B 4KQZA 5ETOA 3LAKA 4IH6A 4ICLA 1U6ZA 1LXJA 2WHOA 4XO0A 4WK1A 5KFOA 1HL6A 4KGXB 2RHQB 3VZIA 2EWHA 4N5SA 1KFSA 1J5OA 2QIFA 4UY8O 3MN9A 1HI0P 2CH6A 3S3NA 4K2JA 3J8AA 3D6FB 3O9QA 1FT8A 5DDRC 2BJ9A 4DV3F 4NXNK 1ZM3A 3D6MB 3TTCA 4IFYA 4TY8A 4C3MA 1Q8BA 3HYFA 1F60B 3EXCX 5KFTA 5C0YA 3ZSZA 3QATA 1NHUA 2WBNA 4ZLLA 5TKYA 4FYDA 2AP6A 4DSIA 1CQMA 2NS1B 2Z57B 1CLFA 1ZS6A 3JSRA 4CI6A 4DR6J 4U96A 2C2DA 2O8CB 1I3AA 4C98A 4JI0F 4DV2J 5AQYA 2DD8S 4JHDA 3GP9A 2IC3B 1S12A 4M42A 4AHVA 3SAFA 1N5TA 1C2PA 1CZ9A 1S1XA 3I31A 4H4MB 3GR0A 4NEZA 3T1HK 2F4VJ 4CEQA 3VEZA 4EFAC 5H1SV 4QR0A 1NGAA 3HT0A 5E7OB 2D3UA 4DU3A 4IG3B 3MPVA 4G1IA 1B7YB 3A5LC 3CMAS 4CF0A 2W7AA 3LGMA 1Q18A 2OEJA 4NPOA 3ETOA 2AGPA 2KQ2A 5A8KB 2VG5A 4D3GA 2YWGA 3KMSA 3HPHA 2GNKA 2UV8G 3B6BA 4ZVEA 1YJWN 3DRYA 1NGCA 1FRXA 5L1LA 1KAXA 1HI1A 4U6PA 4FVMA 3R27A 4AQYF 4FS2A 2QSWA 5KFCA 3K59A 2PC6A 1QSSA 2X6NA 1I51B 3VQSA 3DKDA 4DV6J 1S1UB 4C8KA 1PBAA 5HRRA 1WOPA 3CULA 3F9MA 5J2PB 3FSYA 2JX2A 3T5HA 3ZFVA 4B3TF 3MUMP 1IKXB 4YUDA 3PCOB 3RB6A 4RW7B 2ABYA 3MPDA 3RJMB 1APSA 4FLTA 3QIPB 2GHWA 3AY0A 3UFCX 2HNDA 1BQXA 2MKJA 3VQTA 3QRRA 2JWKA 3JYTB 3HSZA 3KUGA 4TNOA 4H4MA 4X66J 3CCUS 3DOKB 4FS1A 4ED8A 4MQ3A 5KFKA 2DNZA 3BEXA 3LP2B 3GCWP 2HNZB 3AJDA 3POTA 2HS3A 2QC3A 5DRKA 2FBVA 1YITS 3WNEA 4PL8A 1OVYA 2CGKA 3O1LA 2HNYB 1B7FA 4AL6A 1RT6B 3GTYX 1K9MO 1RTHB 2JH3A 4AM6A 4DR2K 3RRKA 2LKZA 4CHZA 1XTZA 4USTA 4PXEA 2A40A 4J9QA 1X5OA 2OI2A 2HHHF 2GVDA 1HQEB 5IM0B 1T44A 3CFOA 3KHYA 4X4VA 2RJZA 2V8PA 5D0GA 3UI3A 1GOAA 4ED1A 4LUBA 2ZJRL 1TKTB 4HT7A 3FRYA 1RT3B 3UNYA 3HPOA 4N76A 3UVJA 4YHHK 1WSVA 4JN4A 4RW4B 3S41A 3TJAA 3ENAA 3I9ZA 2HOEA 1UFKA 3ICLA 5CXTA 4K5SA 4USKA 4GKJJ 1B92A 4ECQA 3L9ZA 1N0VC 4AXJA 1RDDA 4J9RA 3HFKA 4DR5J 4GV6A 3O4QA 1VCTA 1EARA 3HLUA 3HJFA 1H6KX 1GXUA 3ZSQA 4Z7CA 3VVTA 2YTCA 4UT4A 2Q36A 5HAOA 1BHNA 1U4BA 4YORA 2C3OA 3L2QA 3LZIA 3N5FA 4JS4A 1VQ4N 2CNKB 3NF9A 4BY9C 4CLWA 4RG8A 4EO6A 3IRWP 4Y00A 4JKBA 2O4IA 3FEYB 4EBCA 1LEOA 4PQAA 4PXBA 2I38A 4QWDA 1C0FA 4H03B 3NP5A 1S77D 2ADCA 4IG0B 3HD1A 1YRUA 4OZNA 5E84A 3OBWA 4QAGA 4X4UA 3IR5B 1QSLA 4KSEB 4J90A 1S9EB 3ZT2A 1U45A 1YJVA 1V4SA 3EZ5A 5KI6A 4IO1A 4A59A 4WKYA 5IOLA 4NLQA 4PPDA 3C95A 3CJ3A 3GQCA 2E7XA 3E9PA 3GOIA 2E7WA 2ZM6F 4FWMA 3QGPA 3EKUA 3UD4P 2HFZA 3CD6S 2ZQBA 2FJBB 1M90O 3CXCR 2ZZMA 2VCPA 4RTFD 4CT8A 3H42A 2FQQB 4OPAA 2B4OA 2PD1A 4UZBA 4ISGA 1HNWJ 1ZOTA 1YBTA 4OJHA 4FF1A 2ZHBA 1HLWA 1HBUB 4CYUA 1KVBA 2UUBK 4E7JA 1Q7YO 3AA8A 3GIJA 4I67A 3MR6A 1RK8A 3DI6A 1UW4A 2YNFA 2NRVA 1IKYA 3JXOA 4USMA 4DR7J 3L2RA 3H1QA 2LLZA 3R1LA 2W8LA 3JQMA 3LA0A 1Q8LA 2DGVA 4AD6A 3C14A 1P27B 2LQ8A 2A6AA 4GKKK 2OFGX 1R8PA 4QWCA 2IDOA 1RU2A 4TU8A 1U1NA 5M1PA 3J81j 2R8GA 4Y3CA 2OPSB 1IG9A 5CZ2A 5KFIA 2PDAA 3Q8VA 4CO4A 2QEXS 3FGUA 4NWBA 5KFNA 4Q45A 4J9SA 5CCLA 4NO7A 4BR9A 3UR3C 2FJDB 4I2QA 3SQGB 2BE2B 1RWPB 2VG7B 2QL7B 1FVSA 4TYBA 1B70B 3F73A 2M9KA 3V6DB 2E9TA 3MK6A 3CJTA 3R5AA 3R3LA 4YOUA 2KHDA 4CDIA 4YDXA 4DDFA 2RPIA 2XWXA 2OD6A 1RHKB 5C12A 3JTPA 4LR9A 4DV2F 4AHCA 2H48B 4OX9J 1O1WA 4FNIA 3TW0A 2QI2A 1WEYA 1M5PC 4AFFA 4FJ8A 2R4FA 1GTHA 3TNVA 1CXUA 3N4WA 4EGLA 1FNOA 4ZJQA 4CJ3A 2YHWA 3DRRA 2LEAA 1W2BR 2I7NA 4F0HA 4A8QA 3ZT3A 3DN9A 1BIUA 2MQ8A 3VN5A 2FSKA 2NSBA 3THWA 4MYUA 5ETNA 2WVEA 1PSDA 2HK2A 4GRSA 2LYVA 4ED4A 4JI5F 2X1GA 3MD3A 1C1BB 3BO3A 3IG1A 4P9SA 2L48A 1OS5A 4KH4A 3OUYB 4PKGA 4M5HA 3NH2A 4IDKB 2BXJA 2OUGA 4DCOB 2BTFA 5AQFA 1B9DA 2V69A 1T11A 2Z2MA 3MM6A 2IYIA 5DDQC 2GMJA 3VA0A 2PN6A 1Q7YT 5ETLA 3PSIA 3OFGA 1WSGA 4NA1A 1VIXA 4CJRA 4B3RK 3ZZTA 3O4NA 3VALA 1WSFA 4F25A 2B43A 3HP9A 1FDDA 5KGWA 4RBUA 4WP8A 3Q86A 2P9UA 4MTPA 4DS4A 3UKUA 3KLGB 4JI8F 3ILIA 4LH4A 2O8EB 4R79A 2I8EA 4B3TJ 3FBCA 2VDHA 1IR0A 5ETPA 4RW9A 1AROP 8ATCB 3SUOA 3DXMA 1ROFA 2WOMA 2IVMA 2ZFHA 4I64A 2OTJS 3AOBA 4PWWA 4HCCA 1HNVB 2UU9J 2WONB 3O6QA 2F3JA 1MN7A 1X9JA 3QZ8A 1I1GA 2RQMA 4FWPA 1ZBSA 4FJGA 4RLEA 4RW6A 3GMGA 1PJ6A 2YKMA 5CYMB 3ZXWA 3RBDA 3CMEN 4PG5A 3JSYA 3O9RA 4ZA1A 3IFRA 1WSJA 3M30A 4UUXA 5KT5A 3UDVA 1IKXA 1NMEB 4NX9A 1U2VA 2QMWA 2HFVA 3C2PA 5K8MA 2HAIA 4AILC 2XZDB 4LVNP 1VHFA 4OYZA 2Z1HA 1RBSA 2FDNA 2H1YA 4FL9A 3G71N 3RAQA 3JB9k 5BR8J 3SPZA 4QYRA 4ZMMA 1FDBA 4CI0B 2RNEA 3H8YA 3SUQA 4ZLJA 4NYZA 3AVJA 1IBMJ 1U1RA 1SJ1A 3IM8A 4DU1A 2F7VA 2RILA 2O8DA 1S0OA 3TA0A 2OJ3A 2IJRA 3E2EA 4O0IA 2EK6A 4KHNA 1NGGA 1IKYB 3ULHA 1H2VZ 3I4PA 1WN7A 4RNNA 1NO8A 2HMIA 2OZMA 2EW9A 4M5NA 3GL1A 3D54A 3BF1A 3OV7A 3FC9A 1D9AA 2WVDA 1GXLA 3BDEA 5EWEA 3P6YC 3TEHB 3DM2B 2W6LA 1RWXB 1B0TA 3OBIA 3QEVA 4DKWA 3TAGA 3MWBA 1BGXT 4U67Q 2XGQA 3ID8A 3DC2A 3I6PA 4IJNA 1NJXA 4NXMK 2ZH2A 1XR5A 3J7AN 1SKRA 3C66A 3A0IX 3T41A 3BGOP 2DT9A 3OQ2A 3KNGA 3LO3A 2VG7A 4GC7A 4W4MA 4F8RA 3NS7B 2DNOA 4OPHA 3ENBA 4OYXA 3ZTQA 4F04B 2W1BA 4OJRA 3NMUA 1X4GA 1OY9A 4QW9A 1OPIA 4ECWA 3TVZA 4ID8A 2HHUA 3HSDA 2RQ4A 4WTYA 1XR6A 1RAAB 4MYTA 5K8OA 1RILA 5KG4A 2CDQA 4KHUA 4U7CA 4BRAA 4HEA9 1HARA 1UL3A 4A62A 2WSEC 2V50A 3CFPA 1JJ2M 3SJHA 3QBWA 5AQHA 3H2VE 4CM2A 3CNQP 3VEVA 1SB6A 3J81U 4B9UA 1IR1A 1TKDA 2R3VA 2AJ0A 2XLJA 4HTIA 1U24A 1QVFR 3SQ4A 1K8AO 4J2DA 5ETSA 3KK1B 4QIWD 3IBCB 4GMJB 1L3UA 1Q9XA 2RSQA 6FD1A 3QGIA 1X5SA 3G6YA 1NJIO 4WJBA 4OGCA 2D41A 2ROGA 3S6EA 5LJ5Y 3ISND 4CGFA 4G1QA 1TKZA 2MDAA 4RW4A 1WORA 3ZTPA 2X1AA 2ZKTA 4BDYA 3NEKA 2BM0A 3GJRB 2P9NA 4LF6K 2ETJA 4IRDA 3MM6B 1RU1A 1C0UA 4JI2J 2VOOA 4NLVA 4DR1J 3V5RA 2V2VA 1RT1A 3VAIA 1HR0J 2VH7A 3CCJS 4ILMA 3R5GA 5HMWA 2D0PA 1U6FA 3HMJG 4Y65A 3G6EN 4QOTA 4UOFA 4DL5A 3C16B 4URGA 2O8BA 4LFAJ 3G87A 2YHBA 3RW6A 4JI3K 4EBEA 4DX7A 4CJKA 3AQPA 2KVQE 4ANEA 1T8EA 5C25A 3SAGA 3R7BB 5AXMA 1A5XA 4DPYA 1RA6A 2BW2A 3FVYA 3H46O 3B4MA 1S0VA 2YBVA 1NK0A 2OZSA 2L3MA 1NK7A 1RT2A 1GAOA 2GVZA 4QIFA 3D2EB 4JKCA 1BC6A 2RRBA 2E2QA 4OV1A 3ZNJ1 2B6AA 2LECA 4XPEA 3FDSA 4GO5X 2IS3A 4B8CA 4ZKAA 1JK9B 1WC4A 3I55N 4EP4A 1FKPA 1BHLA 3TSUA 3OYMA 3NGDA 2ATCB 2EG2A 3AXMA 3E01A 1N34K 2QLXA 4ISFA 2XI3A 3FK4A 4ZCLA 3AVMA 4LVOP 4B9VA 1ZM9A 4KH6A 1X3MA 3DWLA 2W4CA 2XQCA 1BD6A 1R27B 1Q86O 4O3QA 1I39A 2X1FA 3QJPA 2M8DB 2CGLA 3VAHA 1FRJA 1PGZA 3A5MC 4WCEL 4PAAA 2HRTA 3IBFB 2YWWA 4K5RA 2BJ1A 4O44A 4RU9A 4EYIB 3G8TA 3AARA 4D3HA 3FUYA 2NZ4A 1WF1A 4DUZJ 4JI5K 3E9OA 3ULEA 3PEJA 2FC0A 2CQ2A 3G82A 2W9CB 2DNNA 4FJ5A 2V67A 4IO9Q 4QU6A 2FXUA 2IVFB 4OLAA 4IUFA 2Q0UA 1IJEB 4E1NA 4QPXA 3GB0A 4Y2CA 2DFFA 4CLSA 2UV8A 2Y1LB 1UJ5A 2MJUA 2BM1A 2E9RX 1NAQA 2VWKA 4BVPA 4DR6F 4ELVA 1TTHB 5KFXA 1U2VB 3NF7A 2Y1JA 1O13A 1TUGB 3BYPA 2YKMB 4MKVA 1ITGA 2E6LA 2IM1A 3BN4A 3CETA 3WBZA 2AYBA 1J54A 1KCFA 5DZ6A 1FK9B 3F0NA 3KWMA 1N33K 4XDDA 4Y1DA 2KT3A 4KKOB 4CZKA 4AQYJ 3CCMN 4F02A 4LF4J 1YF5L 2DGQA 4B9LA 2OTLN 2VPXB 3NS6A 2QTDA 1N0UA 2GVDB 4ZITA 3JAMY 3CVKA 3SBMA 1H7XA 4KHSA 3W65A 3AODA 5JVHL 3W62A 3O5BA 4UUWA 4CF1A 3V4MA 4U8VA 3ETMA 1BQMA 5KT2A 2YPYA 1V5VA 4CLKA 2ZITA 4OI2A 3ZZOA 2C22A 2HNYA 3D1OA 3L2UA 1CJVB 1L5UA 3MM7A 5F0WA 4JV0A 4BLGA 2W8KA 1PCAA 1GLCG 3NCRA 2XCPA 4JAXA 2VL1A 3P5BP 1DLOB 4KH1B 2P9SA 3G10A 4KREA 3R2DJ 1SL1A 2OANA 5AQRA 4CJUA 4ILHA 1WACA 2MXYA 3M9OB 4KB1A 2IJFA 4J2EA 1HBMB 2AP1A 3DDKA 1FXDA 3K2YA 1FE4A 4JYAJ 3EPGA 3P38A 5AT1B 3SCXA 4YS2A 1VQKS 4WQ4A 1WKLA 4P10A 3RB0A 4NLGA 4FVCA 3CJ5A 2WAQD 5T7LB 1DKGD 4YOTA 3NDKA 4CJWA 2XS2A 2WSFC 5LT5A 2O8FB 4FJKA 4ZTJA 4P72A 4AL5A 3H98A 5F9LA 1M1KT 2AGQA 2VBYA 2IVYA 5DM7Q 3M3ZA 1P1TA 3BEGB 4WZMA 5HRPA 2RF2A 3NGUA 4O8UA 4NXMJ 2ZHAA 5EN1A 1IQTA 2MYFA 3CJ8A 2F1FA 3QJLA 4CFCA 3BBBA 3DMJA 5A6WA 4CEAA 1HKGA 2EEYA 3D6TB 4QOZB 1G4CA 4JI7F 3M2UB 3MM8A 4CZEA 3KLVA 3G6ES 3LP0B 4H5TA 3HHKA 3WEEB 4A8FA 3U1MA 1RZMA 4O0NA 2V5HG 1TK0A 1EIYB 3IR7B 3D6RA 3HPGA 3ASMA 3K0JA 1T9XA 2VPYB 4ICLB 2GFFA 2ZM6J 1XR7A 3PX4A 4RW6B 2VDIA 1HYSA 3MAAB 2JEJA 1S6UA 2RT3A 4M5LA 1X5PA 2KRRA 1TKXB 3QRQA 1SQEA 2IRUA 2C1EB 3US5A 3J7YI 4FJXA 4QWAA 3C19A 3TVYA 4HYKA 4A57A 3NNAA 3V6HA 2KFYA 2ZJRQ 2ZNYA 3D0IE 5C2FA 4KHRA 4FWOA 3G82B 2B9XA 4ZDNA 2CPHA 1OVQA 3C16A 3DCAA 3VWSA 4LF7K 1R0AA 5AJ3K 3DGPB 5G0RB 1BWFO 4MT1A 3MXIA 4LFBJ 2GHPA 3KYLA 1N32K 1WAFA 1HJOA 4KIAA 3D0HE 5A2QY 2YNFB 2NREA 3VTIA 1NEEA 1W2BM 3GIIA 3QRPA 2CQDA 4Z4HA 2PGCA 4OKKA 1GLDG 3BZCA 4J37A 4OO1J 4MAKA 1S9FA 4TYAA 2D0BA 5BYQA 3WC0A 4GY2B 3BGRA 3L2VA 3V9ZA 2OMLA 3FQLA 4DCPB 3S9HA 4ZVHA 4KAZA 1LWXA 1YRTA 1GTEA 1YRXA 4MMOA 1X8DA 3AVHA 3VVUA 2UUBF 3MMBB 2AJ2A 1BIZA 1O0PA 2RHKA 1RDUA 4ZCIA 5DQHA 1NKBA 2YKNA 2JGUA 2J7UA 2GELA 2QL9B 3M2VA 1CVJA 5C15A 2JFDA 4AHSA 1K9MT 4RPFA 5AQTA 3BSAA 2E5JA 5D15A 4YDUC 3AA3A 1S7HA 3DXBA 2QE5A 1S22A 1JLCB 3R1HA 3WXLA 5KG7A 4OFZA 1IWGA 2WB4A 4HHHA 1VQSA 4WFNQ 4Y0WA 3QFUA 1U09A 3KK3A 3RMCA 3D9BA 4CVNE 2M5YA 2RKIB 4RBTA 3AD8C 3OLBA 2R7QA 2A0FB 4ER8A 4WU3A 1EWRA 3TX0A 1QE1B 3BS9A 3HM9A 5CE3A 2MKCA 4LBPA 4FWSA 2M3DA 1YIJS 5CA5A 2J6UA 3AAWB 4KO0A 1WD6A 5FLXY 1FEHA 1NGEA 8AT1B 3CPWM 5HLFB 2JLFA 1K8KA 2AJQA 4KFBB 1XK8A 5KFLA 4JI7K 3IMXA 2ZJQQ 4OX6A 5F8IA 5M1KA 1XMOK 1VQ8N 1IKVA 1HNZF 1UKUA 4OV6A 2VYPA 1WOQA 1LKZA 4R8UA 2QWQA 3G8QA 3MGJA 4ED7A 4CFDA 3BGLA 2ZF5O 4Z0UA 5HVFA 1S1VB 2UUAJ 4YMEA 4DR1K 1NPPA 2MQQA 1OO0B 3ULEB 1YX2A 3Q24A 3VAJA 5D78A 3H40A 1HKCA 1RWUA 4JKAA 3S7RA 4JP8A 5BRDA 1I94J 3NVKA 2WRMA 1MROA 2CNNB 3QAEA 3TAQA 2VJUA 2DPIA 1VHXA 1OWXA 4L8RB 3EM1A 1X31C 1OJ4A 2O66A 2PAVA 3H45C 1VQ4S 2R42A 2C28A 5FPMA 1CJUA 2L41A 4FLZA 4DR4F 3CW2C 4C1NK 2CZVC 1VQYA 3R8YA 5AQGA 2QEXN 3P5TL 3MPYA 2BJEA 1F0XA 2JLGA 3DRSA 2F4FA 2IA6A 2IMWP 3KFWX 4DU4A 3V1OA 4HHJA 4P71A 4B3MJ 4JD2A 5KAKA 2YWEA 3Q83A 2KTQA 4Q43A 3DXKA 1MDUB 1URNA 2O4GA 3ET6A 1U1OA 4JI3J 3J7AP 2CADA 3O3FA 3RAMA 5HMXA 3M6WA 4JI1J 2DNQA 4GVLA 2RS8A 4CJ5A 1RHJB 1U2RA 4ZIVA 2PMZD 1RJJA 3MEDB 1QQNA 1S9GB 2FVRA 2VA3A 3BF3A 1UETA 3BPDA 4ED6A 4Y34A 2GJ2A 2CGJA 2FGOA 1KQSR 1VDHA 4NLBA 4ES3A 1NDCA 3Q2SC 2Y1RI 3J80Y 4K4SA 3A2FA 4FBUA 1VIOA 2L9NA 4DL2A 4BR0A 2R8KA 5KQDA 3B6PA 4ZTFA 4J8FA 4RJVA 3DHXA 2XYPB 2HF4A 2B9YA 1ILYA 2HFSA 5JXSA 4CYUB 2C3PA 4X62F 3DOLB 2N7YA 1WI8A 4LIWA 3NG8A 2FVPA 2X78A 2ASMA 3HSTB 1KHVA 2YJEA 3CDAA 3OYGA 2KXNB 2F65A 2AJ4A 4R5PB 3KDNA 1FCAA 5E0OA 3R3TA 4ATNA 3UVJB 2MQMA 5DMRA 4RL1A 2BZ2A 2IM0A 2IGIA 3BY5A 1SV5A 3A5NC 5CYMA 1KS2A 4CEBA 4JYAF 4B3MK 4ID5B 2ZE2A 1R59O 2MSTA 1X4DA 3W2WA 4BC5A 4EIAA 3FZMA 3SBGA 3V9UA 3WXMB 3QFHA 3MM9A 3ZZUA 1HUXA 2BKNA 2DVIA 1K0VA 2B8PA 4I9QA 2DGSA 5CYJA 1NM1A 2IM2A 3ENQA 3PEHA 1N6QA 4P7TA 2XMJA 4X4RA 2F96A 4H4OB 2OLWA 2BQRA 3Q8SB 5L39A 3A3PB 5DG8A 3FZBA 2LXIA 4NXNF 2FJWA 2I7PA 5GVQA 2XZTB 4J2BA 3C6HA 1R8CA 2LDIA 3THXB 4CERA 5GAEI 1NKEA 2EX3A 4U8YA 1IBKF 4FJJA 1HIYA 3EMTA 4RNOA 3VQAA 3MDQA 3A3OB 3UCZP 3W2WB 1OH7A 3FJ2A 3TZZA 2EWSA 3V81A 3IWXA 1X4AA 4I2QB 3JQJA 1H74A 4KBIA 2LQBA 4PUOA 1S97A 5M2PA 1NBEB 4DEZA 4X4TA 2D0AA 2D9PA 4HUFA 5M1FA 3VAMA 1N34J 1PKUA 3I8BA 3GYNA 1RQ0A 4ES1A 1FFSB 4ZJLA 2BJ3A 2IVPA 4A8MP 1F3FA 5E5NA 2EHGA 2D9OA 2M0GB 3RB4A 2VPWB 3RSEB 3QBXA 4LC9B 2NQPA 4LSLB 1HNZJ 3KJFB 4MIBA 2ZJQL 4DSEA 4ECTA 4EWTA 2UVRA 1FX4A 2A10A 1AYEA 2PFUA 1RT7A 4QQBA 1K47A 4FJIA 1RNHA 5U47A 4I6MA 2E9ZA 3NGKA 1SQGA 5KFYA 2CJAA 3FZ2A 5HL7L 3K57A 4LY7A 3SQ2A 1TUUA 3O9TA 1CJTB 2CQ3A 3FEXB 2E5LK 1SQFA 4GVBB 1Y7PA 4IZ9A 4ZS6A 1MN9A 3H5YA 1TKXA 2EC2A 2XY5A 2D4WA 4JKFA 5DZ7A 2W24A 1NHKL 4CIFA 1WC6A 3DRSB 2GV9A 2P8IA 1P6TA 5CZ1A 2AJFE 2MQNA 5GMDA 1DZ5A 1NG9A 4BR7A 2KJVA 4KTZA 2GHVC 4WQ4C 3ATVA 4AL7A 1R43A 3D2EA 1HWUA 2ZD1B 4HHUA 1VQ9N 5F1XA 3MCNA 1D09B 4ZPTR 2J9DA 4PQUB 1TL1A 1Y4ZB 3O2IA 4GV3A 4B3MF 2DNKA 2ITGA 2KKHA 4RU2A 3BSNA 3DLEB 3RGIA 1JXLA 5GIPA 1ZZNA 1U1MA 1D9DA 3KOAA 5DLGA 4ECUA 1LAWA 1G3OA 1WG4A 1JL1A 2BQ3A 3WDOA 3IAYA 1F5CA 2DB1A 1HQ2A 4Q7AA 2MMYA 4YDDB 2RS2A 4OLBA 4OJ1A 3JAMU 2G8HA 3VEOA 3DYAB 2JC1A 4Z4EA 4K4UA 3IWLA 4DR4J 3V2UC 3MR5A 4JS5A 1XMOF 2HBRB 4B9MA 3U02A 4RBVA 1VBZA 4K59A 2HFUA 2XB2D 4ENOA 3VEXA 3C7NB 2M52A 4USVA 1QAXA 4JI2K 3C6TA 1NK4A 4BE2A 2HHSA 2A2DA 3LQVA 1LCUA 3MEGA 1PBUA 5I3QA 4W5QA 5DDPC 4QPTA 3RWUA 1E6YA 5B09A 3CTRA 1Y3KA 4DBQA 4NRUA 3V4IA 2HBJA 1HNIB 2MLYA 3C65A 4RNMA 2HHVA 4K43A 1JXEA 2QXFA 2J0QD 3CCLS 3QB0A 1LWCA 5J1EA 2L9WA 2W6KA 3MPWA 3LPYA 3DRPB 4K0KK 5DETA 4F7VA 3H2LA 3KHHA 1HNXJ 2W7OA 2A1SA 2F9WA 3TARA 4BRFA 3SI8A 3P31A 4QIVA 2IIHA 4I69A 1S6PA 4KHYA 3THYB 1U0HB 3MZIA 1UJ4A 4URQU 4FLXA 1RT4B 1GOBA 4USIA 4OPKA 4WK3A 3FMBA 3U9DA 3W64A 3HULA 2B4JA 1FI4A 3L95X 1J5EF 5JMNA 1TKTA 4Q8FA 2H5JB 2FLNA 1RGVA 4PY5A 2EKYA 1XI1A 1GOCA 5KG6A 1FJCA 1YTUA 5EXWA 5C2DA 4A8SA 1P9YA 3ADAC 5AE1A 4JI3F 3TAFA 1RCOB 4LF8K 2YWHA 3BF4A 2DRBA 4NI2A 2CRLA 4DPUA 3QPIA 3EE3A 3FE1A 4CEEA 3OYDA 4CIEA 1C4CA 2C2OB 3KTQA 3NGSA 1JLFB 1S99A 5E41A 2RRNA 5HQ8A 4PR6A 1HW9A 1ZYQA 2VG5B 2LEPA 2QGFB 1Q8IA 1TMMA 1KHWA 1H2TZ 2HYIB 2KZMA 1B3TA 5HN0A 2RQCA 3OHBA 3CT9A 3O1BA 4MK9A 1ASUA 4JKEA 4DPOA 4E7KA 3K5LA 5IT4A 3OXGA 3ZX2A 4DPTA 4KHPJ 3F9KA 2AKWB 3TQEA 3CM5A 4YDUA 2YCHA 4BG9A 1V3SA 4PA1A 4QS9A 4B3RJ 4Y28C 3KK2B 3HFZB 2IPOB 4CLFA 4CK2A 4IQXA 5JVHQ 2QMUB 3AVLA 1RWVB 1U8WA 2CJKA 1TFWA 2RE2A 1SIWB 1WB9A 2FLLA 4F4XA 5LSOA 3LM2A 3VPZA 1FESA 4DSKA 4IOAL 3HFVA 3R9LA 2U1AA 4CLLA 4DQPA 2KFZA 3AQOA 3GG1A 1KQFB 1LK7A 2PFDA 2VU5A 4ZJOA 1FERA 4DQRA 3CJ0A 5KFHA 3EVMA 5KFMA 1UVMA 5E26A 3ILJA 5F8NA 2FIUA 1L3TA 1RHUB 3A12A 4X66K 5GAGU 3DLKA 4MFBB 1VQ7N 3QEPA 1BI4A 4IWVA 1QAJA 2ROEA 4WFYA 2D1CA 4U7UD 4BRHA 1N5SA 3IDHA 1F2GA 4OZ5A 2KT2A 2XMTA 4DR6K 3J7A1 1S72S 2K3IA 2HLTA 1WDDA 2BH1A 4F0MA 2GQQA 4ZIWA 3LTOA 3OYHA 4DV1F 3SK3A 1VSHA 1UVLA 3RG6A 4EZ6A 1U0SA 1V9OA 4KRWA 2HG4A 2HVHA 4Y2IA 1LFPA 5B0AA 1YQHA 1KLNA 4JUZA 3SPYA 2IC3A 3FLCO 3R7NB 3MECA 2EVZA 1BL3A 3SSQA 3L4BC 2R2RA 2CWXA 1FD8A 2ERRA 4E7HA 3OJSA 2BABA 4I0WA 4NLDA 3P96A 2ALZA 3EGVA 4LF7F 2P9KA 3CCWA 2MKKA 2C2RA 1RA7A 2HBYB 5F8MA 3LW5C 1VAZA 1WSEA 5IWAK 4NZ6A 3NCIA 3T7ZA 1EJ7L 2BE7D 2WTUA 1VS3A 1WKKA 2I5JB 2A2CA 1HPZB 1NGIA 5FRNA 4LF9F 4DUZF 3CF5L 1UZHA 2XLKA 4OVLA 3IAS9 3ZLJA 1KC8T 2CQGA 1VBXA 2LXUA 2FF3B 5DK5A 2CJBA 3HHDA 2IBOA 1KFDA 2HZAA 2HWIA 2ZD1A 3HZ6A 2XZWA 1NHVA 2UUCJ 5HP1B 1RYSA 1LFWA 3VQ8A 1DHMA 5BRHA 2X1BA 3GFZA 3QAUA 2PE8A 2VPZB 4BRIA 1XQIA 4NYPA 2OFHX 2DHXA 2FZGB 3L6QA 3VESA 1PC4A 4ETZA 4DTPA 2YQ1A 2Z30B 1UFWA 1S49A 4TY9A 3SCJE 1QQMA 2H54B 3OPKA 4K2XA 4EYHB 4IOAQ 5I3UB 1HYVA 3VGSA 3UKRA 3N5BA 5E3PA 4CEOA 3C14B 5B8HA 3QETA 1ZZFA 3ZT4A 3KZBA 4OZ0A 2LU2A 1C0GA 1AFJA 1RAFB 3W3DA 1S6QA 1JIHA 2KU7A 2VD3A 7AT1B 3W60A 4NLCA 5IT9O 1HR0F 2MSSA 5C2GA 2DJWA 2QJ3A 4ZVOB 5G0RA 5ITHA 4O44B 2AV5A 3DRRB 4HTJA 1XC9A 4LFAF 1EQYA 5AQXA 3DXKB 4C23A 3T1HF 4IXCA 5F8JA 5AQLA 2HQ3A 2HWHA 1H1VA 2OPPA 1O51A 1RFQA 1WSRA 2G8FA 4BRNA 4Y6IA 2J76E 2K1RB 1VQNS 1JJHA 4E0DA 4CM0A 5I3PA 2HEKA 4CD1A 1WI6A 1U2CA 1M5KC 2X3GA 2KJWA 1SIZA 3CUNA 4DR1F 2GJIA 2KYZA 3SQ0A 4ED3A 3C3LA 4DV7F 2HSEB 2V34A 2Z56B 4DQIA 3SV3A 4IDHA 1F9FA 1LWEB 1T05B 4X65F 5BR8F 2VC1A 4GVBA 2BYCA 3E9LA 2DHGA 3AO1A 4Z4GA 4DL4A 5MLCV 1RDWX 3GE1A 4ZVRB 2JLEA 5KOXA 1S3XA 4I6MB 1W0HA 4URSA 4MDAA 1R6VA 2OPQB 4LQ3A 4CEDA 4Y2MA 3T3FA 1NMNA 3ZSRA 4CF8A 3HJVA 5D4PA 2E5HA 2G8UA 3CDBA 1VQKN 5A0YA 3BKTA 1LOUA 1U25A 3OR1A 5B08A 3Q7CA 3LPUA 1C0TB 3CCVS 3NRBA 1HHQA 1MWQA 4JI6K 1JX4A 1IM6A 2E4LA 5F8HA 3F56A 3HT3A 2J9EA 3T5LA 3QNNA 5FLXU 2FTRA 3T1AA 4CE9A 3IG1B 2VFRA 4ETXA 3E3XA 5IV3A 4B9NA 3L0QA 3KDOA 4IDKA 3QGHA 3NGIA 3W2VA 2WCXA 5AQZA 3MM7B 3OTOK 2E1MC 1OH8A 5AQMA 4I2PB 2B5JB 3CDWA 3MOJB 4UOCA 4NL5A 1G2EA 1KVJA 5JJBA 3DGVA 4N7TA 3THXA 5D8HB 1K6YA 4JI4K 4CECA 3QMQA 3CYMA 1JLCA 3THWB 2CQIA 5AQOA 5C25B 6AT1B 1KN6A 4M63C 3C6AA 4LRAA 5J2MB 5J1EB 3UN5A 3J7ZT 2MJNA 1HNXK 5JVGQ 1SVDA 3DDIA 4Z4IA 4K0KJ 3LPEA 2IIRA 5D6GA 2YX1A 1B64A 5L8RC 3BBFA 4E89A 1HW8A 2DHAA 2Z2ZA 1RBUA 4L76A 1RHRB 2GQCA 5KFPA 1UVKA 4JYAK 1WEZA 4FW2A 2FGCA 2ZWHA 4N41A 2E88A 2PFFB 1N5YB 1NOYA 4YHHF 1GFWB 2XHWA 4F67A 1GH8A 1R3NA 3VGTA 1U1PA 3FRZA 4C8MA 4B08A 2ATQA 3J7ZO 2M7SA 4TQSA 3T1HJ 1EKRA 1RT2B 2GVZB 3WQTA 1O5JA 1Q16B 2BMBA 1CQNA 1H7WA 1LAVA 2F8MA 4CJFA 4LRBA 4OI6A 4R25A 2E29A 2C3UA 1PG5B 2NRHA 1Y97A 4LBIA 5BJRA 3SUNA 5I42B 2FSJA 5ADXH 5A6PA 1D1UA 2P6TA 1RGIA 4LF1A 4ED5A 3BSOA 1N8RT 3KD5E 4N47A 3DAWA 3R97A 1NJYA 2QA1A 3C0BA 1X9MA 2V2QA 2GMLA 3GZ7A 1SC6A 3AO3A 1NB7A 3OYIA 4QCLA 1M5OC 3ISZA 3SDEB 1HBUA 1VISA 2MKYA 3MDFA 3CJKA 1JCGA 2R7VA 1KONA 1OY6A 3HRGA 4YOXA 1NK6A 1Y5LB 4HVJA 2OP5A 3E1YA 2IA0A 1UAXA 2RQKA 1IXKA 2Y8YA 3OYFA 1WOSA 4LF6F 2XMMA 1SH2A 3MF5A 2Q6BA 3ONQA 3M1VB 4DTXA 5ETTA 5LL6Z 3Q8YA 4PL7A 2CYYA 1I94F 2DNPA 2G8VA 1KR4A 5DJBA 3KHGA 1NB2A 1REGX 2V0NA 5H9FJ 1C4AA 3KK7A 4M63A 2FJAB 4NXNJ 1QHTA 5M2UA 2LQJA 2UXDF 1QVGM 3AAPA 2BJ8A 5DGAA 3VENA 4J9OA 3OTDA 4E7LA 2QSFA 4GKKF 3MN5A 3PO5A 1JLBB 3M8RA 2E5LF 2IDEA 2AEMA 1BUPA 2FSNA 2MLXA 2DPJA 4BQZA 3LUYA 5A8RA 4M8LA 2DR8A 4NYOA 1W7WA 2GIRA 1E6YB 3K8VA 4DR7K 4A5AA 1ATNA 1WSIA 4DL3A 5K20B 5LMNJ 1WG1A 1PIEA 4NLWA 3V81B 4CEFA 2H3GX 2A6MA 3AHPA 2B7BB 2UUAK 4BS2A 3KIOA 3V9WA 1C0TA 1SC4B 2BQUA 3I55S 2VQEK 1Y0HA 3KG1A 1QVFM 4A47A 4OHYA 5M1OA 2OPQA 1FKAF 2BBEA 4LREA 2W4PA 1W2IA 4L75A 3AH6A 2J7WA 3SJJA 2Z0GA 1HWJA 4IKFA 4JKHA 4IFVB 4FZYA 3JTOA 4JRPA 1JNZB 2R7RA 4J9VA 2M2BA 4ZVSB 3FGVA 1BWVA 4DZDA 3D28A 3HX9A 2OAUA 3VQEA 2DR7A 2I5JA 3SLCA 3G2XA 3SSRA 2JEIA 1VGYA 3VGMA 3R1XA 3C94A 4IOCQ 4DZ6A 4ECSA 4DV0J 2LQ5A 5IFMA 3CJ7A 1FTCA 1HPMA 5DS7A 3S3OA 2DKOB 3T6JA 3FFIB 4AYBD 2HNZA 3BSCA 2ZJPQ 3GFYA 3DDNA 2ZZNA 3M6VA 4ED0A 1T0TV 4CJ4A 2DH9A 3CCES 4TN2A 3KVGA 3MMBA 1HBOB 4ZVGA 4KHPF 3JYTA 1T9YA 3WZ0A 5D0EA 4YB1P 1P8ZA 2NCKL 1G6BA 5BR8K 2W4DA 1ZETA 2HFNA 4KY3A 4MIWA 3PX0A 5AQJA 3OVSA 5EX3A 2Q43A 5ETQA 1D5AA 1SJQA 3HHLD 1C1BA 1CC8A 3DLBA 5LSRA 3VF0B 1YI2N 4FLWA 2ATLA 5CHIA 4N8NA 3L09A 4OX7A 1BISA 3K9JA 3KLGA 1NOZA 4JV5J 5HOOA 1WC0A 1WC1A 3LOUA 2Q66A 3T5KA 4OYMA 5HJXA 5C5JA 3C15A 4QR2A 1E6VB 2C3YA 1NUEA 4OX8A 3LZJA 4UZCA 4Q2MA 3ENWA 3TX8A 3GV8B 1KD1O 4AE5A 3BKUA 4H5NA 3V6JA 3NS5A 4KGKA 3AVAA 1GK8A 1J5EK 2J9CA 3BB5A 3F44A 4PUOB 3R5JB 3P4IA 4IYQA 5FDLA 2XNRA 4LFCF 3SIPB 4KHWA 1JNRB 3UO0A 4RW8A 1PYOB 3OTOF 4B3SJ 5CAAA 3TAMB 3NGZA 2IY5B 4H5RA 3NWRA 4JK8A 1JLQA 1BMQB 3GJQB 4JI4F 1SKUB 4FKYA 3H5SA 3K7RA 2BGGA 4PG6A 1U7LA 4F2SA 2BX6A 3LP1A 3FZFA 2DFEA 4OGEA 3WXKA 4WIIA 2YXLA 1M1GA 1WF0A 1HNWF 2Z2LA 4B1ZA 2W9BA 3ZTOA 4M3XA 2AGOA 3WXIA 2YNGB 1NJIT 4L3QA 3K0SA 4DV4K 1NJWA 3LP3A 1CEZA 4C3KA 4PCQA 3L7UA 3C8YA 1BLUA 1WC3A 3LM9A 2MGZB 4EFHA 1YTAA 1RAEB 3R6MA 3Q22A 1NWKA 3DLRA 3I32A 5LL6d 3LL3A 2K8GA 1QSYA 3IA0A 2CXEA 4UOHA 4ZP8A 4YY3K 1REVB 3OR1B 2N7CA 3TVKA 2P9CA 4LRDA 1M1KO 3KWGA 1N36K 3CQXA 5DG7A 1BQNA 2HSTA 5F8LA 5J2QA 3VMFB 2BANA 2Z2YB 2VGMA 1LW0A 5KPTA 1CULB 1BA0A 3O5TB 2EFVA 1N6QB 3SYZA 1BE4A 2DR5A 1RT6A 3CJSA 3A8EA 4KI4A 2ZH3A 3HVTA 2OIHA 3OL8A 3ALYA 3PFOA 1T6DA 3PSFA 4C8NA 3TAMA 1A0OB 1GNKA 2GIQA 2HZCA 3LH2S 2V7YA 1UA1A 4YB5A 2J9DE 4J7CA 1TELA 4NEYA 2XGPA 1ZBUA 5HQMA 2C2MB 2NPFA 1RWNB 2L9DA 5J2PA 2GX8A 3GIRA 5CD4H 5KFBA 3OJUA 1Y00A 3BPSP 3TTFA 3N6LA 5L1KA 1JMTA 4L6V3 4YOWA 3DOMA 2ZWOA 4AQYK 1F5BA 4FPBA 2P9IB 1DJ0A 1X0FA 2HAFA 2A1RA 4KR0B 1NMDA 3AVFA 4H4KC 3G86A 4WFAQ 3PJWA 2NXJA 1HKAA 1C6VA 2PZSA 2UXBF 2VJVA 4DTSA 3L7OA 2BW7A 3EDRB 3H3NO 5ELZA 2AX1A 1VQ6S 4HI1A 3OVNA 4V19X 2XHBA 3KNAA 1SAZA 3TP2A 4LR7A 3D67A 4M7XA 5HROA 5FLXO 3SNNA 1N32J 1RT5B 4ZPDA 1SCJB 1Q79A 4FOEA 1P90A 1HWIA 4HTUA 1ITPA 4MKBA 2QLFB 3IN5A 3MCSA 1S6PB 4FKXA 1RACB 5AE3A 5BYSA 4FF3A 2CPYA 4NMXA 4DU7A 4AM7A 1RWOB 2WOMB 1HQEA 5IM0A 3M2UA 3MM8B 3KG0A 3FNNA 2CQ1A 1RADB 4LQ9A 2APOA 3GPAA 3F41A 3KHLA 3LAMA 4FWNA 3DLLQ 1J9AA 3GBTA 3NGRA 4CRJA 3M32B 4NE9C 1F6TA 3K17A 4OYPA 4JK7A 3FFKB 1AW0A 3QICA 1RYRA 4YHHJ 3VCDA 3HKWA 5G4DA 4BRLA 1TL4A 2HBKA 3H0PA 5K8PA 5J2QB 2XS7A 4BACA 5AQPA 3H7HB 1EO1A 4LMZA 1RTIB 4KT0C 4L73A 2DEIA 4RW8B 2XSJA 4RNFA 2MKSA 1NLKL 1UJ6A 3UN3A 9ATCB 3D3BJ 3M8SA 4BR2A 5C2CA 1TAQA 2CJXB 2OTJN 2DCUB 2P9LB 1LW2B 1HFEL 4M94A 2KHCA 5LXYA 4O3OA 3TA2A 3RMDA 1KXPA 2AA4A 4CTAB 1MW7A 2UP1A 5GADI 4OIXA 3QZ7A 1LK5A 3A8JA 3M6GA 4O5FA 2JJ4D 4KHQA 1F21A 2CPEA 4JEPA 4DR3K 3PX6A 1GLBG 4C7QA 5CZXA 2JSXA 1LXNA 1QZ5A 4DG1B 2VKRA 2Y3YA 3GFHA 2CFXA 3AVKA 4YNQA 1NGBA 2CNLB 1B0PA 1SXLA 3V9XA 1HPZA 2Y8WA 5IQ6A 2NRZA 1YT3A 5AJ3F 4IO9L 4F4ZA 4MJKA 4Y0FA 3B8AX 2POKA 5B7WA 2HHWA 3UPFA 4HL9A 4F3MA 4PYDA 4J9NA 3C46A 1MU2B 3EUNA 1WTFA 3RBZA 2ASYA 1RAIB 1FF2A 2QWPA 2PI5A 1Z26A 5JVGL 1GX5A 2HVZA 4DV6F 2DGTA 2XMKA 3PYFA 1X60A 3M2VB 1OYDA 3QO9B 3AD9C 3SQGA 1K44A 3GV5B 3M6UA 2F8EX 2XY8A 3CFRA 2OPSA 4JI6J 4EI2A 3BDPA 1G15A 3CC4S 2YHYA 2WTFA 2V63A 3PJXA 3DMJB 2FVSA 4U67L 1YDLA 2YY3A 3CO0P 5F3ZA 4LF4K 4FF4A 2CJYB 1RTZA 3SUPA 1RXOB 1AUSL 2LSNA 3TEGA 1NH8A 2DITA 1YITN 1XHXA 3EEQA 3HOTA 1BCMA 3O3HA 1HNXF 5E3AA 1IBKJ 1Q9YA 2CQCA 1LQ9A 3K89A 4FPAA 3CCQS 5BN9A 3CMES 4KE5A 4WXWA 2MEWA 1SZ2A 2F4VF 3GSIA 2XM3A 3QLHA 3GYGA 3M4XA 4ED2A 1Z2ZA 3CDUA 5KFGA 1SC3B 2IDLA 1OYEA 5IT0A 1JKHB 1U2FA 1CBKA 3HSGA 1DQAA 2GGPA 4QYZJ 2DYAA 4KFBA 1X1PA 3E01B 2G4BA 1K8KB 3OFEA 4FW1A 1CZAN 4IQMA 3HSCA 4BR5A 1AA1B 5LJ3Y 2J4RA 1ZXOA 3O3GA 2P9SB 2HQFA 3CGIA 1VBYA 4I1TA 2JFKA 3F2KA 2XSJB 1U47A 1CJVA 3THPA 4IRCA 1YHQS 1BXNA 2G2YA 3QT6A 3D5MA 2HBZB 2YNIB 4ZVQB 1QTNB 4CLPA 2OEMA 2JWLA 5CYQB 3HF5A 4H54A 2L08A 3W9IA 3JTNA 4FM2A 1S48A 4CJEA 1MA9B 4IH7A 1FWLA 2AF6A 2XTJP 1TL7B 3ZX3A 4IFVA 2PMHA 2OTLS 1K1SA 2GUIA 4F2RA 4Y2AA 4FXWA 2UXCK 2GO9A 3MI7X 3PYEA 4F3TA 2KO1A 3QWUA 3OL7A 3JSBA 5T14A 1WG5A 4WYWA 3MMCA 3W66A 1B4SA 3MN7A 4FM0A 3KK2A 5I4MA 2KM8B 2ILYA 1A5WA 1ULRA 3KLHA 3IS9B 1DTTB 2GGPB 4KRFA 1L3SA 2Q79A 3TZWA 5DQGA 2O5DA 4ELTA 4DV6K 4BG8A 1CC7A 4CP5A 5JLHA 3GONA 1FWKA 1VSIA 4OZ1A 1DY3A 5KT3A 4OYOA 3G4SS 4ID1A 1I94K 2V9WA 4J91A 2AU0A 1W9HA 1RKIA 4IBNA 2GAGC 3O9SA 1HD0A 3KMQA 1S1WA 4C11A 4Q0BB 4BC7A 2RAQA 5KFQA 3QNOA 4F9OA 3DRPA 3M5RA 2PA8D 3SQOP 2JZ5A 4ZP7A 3OVBA 3VQCA 1ZH5A 3AVNA 2G2ZA 4Q5VA