3FFIA

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
553
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 151
structure length 549
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ffiA05
4WE1B 1RBTA 3E01B 4CFAA 1VRUB 3TAMB 4E7JA 4O0IA 4K4TA 2VG5A 4NLSA 3KNAA 1T8EA 3QIPB 4CJVA 4FCYA 2IDOA 3LP1B 4OL8A 1I39A 1WSHA 1DTQA 1HQEB 4O5BA 4ECVA 3H59A 1EETB 1XR5A 1J54A 4ICLB 1WSFA 3CM6A 2IBKA 4ELVA 4ED3A 1U09A 3QEWA 3SQ0A 1BL3A 5KRSA 2G8WA 1CXUA 2B4JA 4DFPA 4KHNA 4IRCA 5J1EA 3LWLA 1X9SA 2ETJA 3AVJA 4OPKA 1A5WA 2ZE2A 3CDUA 2HW3A 3K58A 1C1AA 4CFDA 3RRGA 2ZE2B 1X1PA 3VQ7A 3KLIB 5KFRA 1SKWA 1D5AA 2A1SA 4YNQA 3QIDA 3V81A 1NNDA 1Y97A 2PY5A 3AVBA 4J9LA 4NRUA 2Q3SA 2WB4A 1A5VA 1NJWA 5F8GA 4J9PA 3DLHA 3VQQA 4DTNA 3THVA 4G1QB 1JKHB 3OHAA 4KTQA 2IM1A 4DTRA 3NCIA 4DU3A 3IG1B 4CF0A 5L9XA 2IM3A 4CEDA 1SL0A 4EYIB 2QK9A 3LAMA 1RT5B 1S1TA 5F8IA 3VQEA 3KK3B 3CIZA 3KLHB 4DEZA 3K5OA 4FJMA 3NL0A 4CIGA 1DLOB 2GIRA 3VQBA 3PW0A 1D1UA 3DLGB 3Q8RB 2D0AA 3PVXA 1ZTWA 4NLWA 4CHPA 3K57A 2FC0A 4Y34A 2E6MA 1XHZA 4K4YA 4QOZB 4IDKB 4M3YA 3QNNA 3U6FA 4IDKA 1YTUA 2ASLA 1IG9A 4YR0A 3K5LA 3PUFA 3L3VA 1S1WA 3OYNA 2HNZA 3ASMA 1RTJB 4YFUA 2W8LA 4JLHA 4F2SA 3QGGA 1VSJA 2JC1A 2FLLA 2RF2A 3S3OA 4CGGA 3DLKA 4HYKA 4FJLA 4ECXA 5C24B 3DMJA 3S3MA 3HKWA 1FK9B 1ZBIA 1XWLA 1ITGA 3V1QA 2P51A 4WZQA 4NYFA 4CHQA 3L3UA 2B6AB 1NK5A 3AVNA 4WXWA 1NJZA 2DTUA 4DG1B 5KG5A 3G0ZA 3GYNA 4NRTA 4ECWA 4HUGA 3VQ5A 2D3ZA 1WSIA 4K4UA 2HB5A 4F3TA 3QYYA 4Z4CA 1TV6B 2IA6A 4FS1A 4EO6A 3H5XA 1S49A 1BGXT 2YNGA 4O3SA 4LQ3A 1VSHA 4LSNB 1XHXA 3KLEB 2HWIA 5HBMB 1F21A 3ZCMA 4KREA 5J2QA 4CJEA 4NLXA 3H4DA 5EDWA 1RBSA 4TLRA 4TYBA 2DFHA 4ECQA 4Z0UA 4JV1A 3RMCA 4KI6A 4MK7A 2C2DA 4RUAA 1A5XA 2KFNA 3OLAA 3KMSA 5HP1B 4RZRA 4DL5A 1T7PA 1KHVA 3C94A 1TKDA 5L1JA 4W5TA 1TAUA 3QLHA 3SQ1A 4B8CA 2F8TA 3SUQA 2J6SA 1JLGB 5E41A 3KD5E 2BANA 2ILYA 1JLFB 1BIZA 4CJ4A 4PA1A 4CFCA 5EWGA 1S1TB 2FJXA 1LW0A 5KTQA 3QINA 4FM0A 3KK1B 4HCBA 3BR9A 2VG6A 3MEDB 1NK6A 3OS2A 1Z26A 4DFJA 1Q8IA 2WK4A 4Z4EA 3NE6A 2R2UA 2C2EA 3AA3A 2O4IA 1R0AB 3V4IB 4Y1CA 1XI1A 5EWFA 1CSJA 1R0AA 2B5JB 1EXQA 2W8KA 4CFBA 5SWMA 4EBCA 5KFZA 3CJ0A 4KHSA 1SUQB 4CHYA 1HYVA 1TVRA 4DLGA 2IJNA 1RT5A 3O4QA 4K50A 1LAVA 1TK5A 4NLTA 3EPGA 4KTWA 2VWJA 3CJ3A 3PY8A 5KGXA 3DRSA 1BI4B 2IJFA 2UUWA 4RW6B 4O4RA 3IAYA 4CEAA 5KFAA 4W5QA 1JLEB 4FJIA 1S1UA 1TV6A 3K59A 1QE1B 1T05B 4IQXA 3V6KA 4ELUA 2IM2A 4K4VA 2XY8A 4TQSA 3AVMA 3GIKA 2IS3A 3Q8QB 3NGZA 4EO8A 2BGGA 3MEEB 1BCOA 3SQ2A 3TQ1A 1HNVB 3AO1A 3I0SA 4ECYA 3CG7A 4NCAA 4I7FA 3NFAA 4HVJA 4O3NA 3ZSXA 2D7SA 5HRRA 4WE1A 4CERA 2W9CB 3ZSYA 1JLBB 3MXJA 4ELTA 3AVGA 4OPJA 2HHSA 4IR1A 1S1WB 4MIAA 3AO5A 1Z4UA 2X6NA 3OS1A 2XY5A 3TVKA 1IKXA 2KTQA 4FM2A 2XY7A 2G8HA 3CO9A 1WN7A 1O1WA 1LV5A 1TK8A 2HHUA 1S6PB 2E9ZA 2X74A 2G8IA 1DTQB 1HQEA 1RT3A 3VQ4A 1C0UA 3DDKA 3BQ2A 2R8KA 4M41A 2CJQA 4ZPCA 4IFYB 5F8LA 4IFYA 3OYBA 1C0UB 4KE5A 2KFZA 5CY4A 5HRNA 3TAMA 3LPUA 1HMVB 3UDLA 1VRUA 2DFEA 3RBEA 1NKEA 4M45A 4RNHA 4DMNA 3V4IA 3N6NA 3BQ0A 2HVHA 3L8BA 3PZPA 3ZT0A 2EC0A 5KT5A 1ZBUA 3DYAA 4FLZA 5KFCA 1QAIA 1D0EA 1RNHA 3OL6A 4DL2A 4URSA 4IH6A 3KK3A 4CHNA 3KLIA 2D0BA 3LANA 2GV9A 2HNYB 4DQSA 3ALYA 1S48A 4CEBA 1HQUA 3PR5B 4J9QA 4FJXA 3V6JA 3BJYA 3IRXA 1EKEA 4DS5A 1KLNA 4CCHA 4Z4GA 3M9OB 5J1EB 4G1QA 1SH2A 3T5JA 3K5MA 4PUOB 4WFXA 4J9MA 3QEVA 4QAGA 2ITGA 5F8MA 5DLFA 5D3GA 4DLEA 2VG7A 3BSCA 4IFVA 3V81B 4FLVA 3SUPA 3V9WA 3OJSA 3O3HA 2V4QA 4GMJB 1HYZA 1C2PA 1KCFA 3HT3A 5KFKA 3KLFB 3KLFA 3OL8A 3QO9B 4N47A 1L3TA 3QZ8A 2HHVA 4ECRA 4CJLA 4LY7A 3OS0A 3B6PA 5J2MA 2UUTA 3T5HA 3RB3A 3OVNA 4IR9A 2F96A 4OKKA 2C28A 5D3GB 4WZMA 3VQSA 2D41A 1JLAA 3ICLA 1RAJA 3D45A 4KHQA 3OYLA 1KLMA 4FBUA 4NLPA 3KMQA 5KI6A 2ATLA 2XRIA 3KK2A 4E7KA 2YNFA 3DI6B 1BI4A 1TP7A 3GQCA 4KHRA 3DM2A 3HP9A 3ZT3A 2UVUA 1RT2A 3EYZA 2DPJA 1LW2B 4DTSA 3SUNA 3PHEA 5DG9A 1QHTA 4MIBA 1WNEA 2JEFA 1CZBA 3PO4A 4I9LA 5C42B 4TN2A 4H4MB 4FJ8A 2BQUA 3G86A 3TABA 2AX0A 3KJVA 4NCBA 5HROB 3FQLA 4FJJA 2QV6A 4FJ7A 4AHUA 4KHYA 1KRPA 1TKTA 4QWBA 5HROA 4RW4A 3TAPA 1S1XA 1VRTA 3LP2B 2P5GA 3NBPA 3OYIA 2IGIA 3SV4A 4FLXA 4EZ6A 3CM5A 4ECZA 1J5OB 3HPOA 2W9BB 3CFRA 3JYTA 5T7BA 3L2RA 3QEIA 3M8QB 3RB4A 1RBRA 5DG7A 2ASJA 5KFVA 3M8RA 1ZBFA 2BE2B 2D5RA 2G8UA 1RCHA 4GVMA 1HNIB 3T3FA 3ZSVA 3RB6A 3MECA 5KFDA 3TWHA 5CYQB 3PW5A 4IH7A 4B9UA 4CEEA 2RKIA 3P5JA 1N6QB 4XPCA 3DRRA 2W9AA 4GW6A 4RW9A 4N76A 2I5JA 5KFHA 3NF8A 2I5JB 3BGRA 3H5UA 3OSNA 4LSNA 3VQCA 4AH9A 3GV7B 4BE2A 5KG2A 5J2QB 1RDBA 1IKVB 3PX4A 3VA3A 3U3YA 1RA7A 2QXFA 3DLEA 3VQAA 3SUOA 4AHVA 3DLBA 1I6JA 4B3OA 4IFVB 1S1UB 5CYMB 1S9FA 5CYMA 2V0NA 3KHLA 3P83D 5DQGA 3OHBA 1S1VA 2E6LA 4TQRA 2JEIA 3NGYA 2XGQA 4RG8A 4ED8A 4K8XA 4QCLA 2EX3A 3M8PA 4M3XA 3L2QA 2ASDA 1RDAA 4YP3A 1D9DA 1ZETA 3EPIA 1MU2A 4R5PA 5F8NA 4FZZA 2FVSA 4FXDA 4NLUA 3RRHA 1HARA 3V9SA 2JEGA 1KVCA 5EUHA 3TARA 4DSJA 1C0TB 3DI6A 5SZTA 1S0NA 1LAWA 1B9FA 3NF6A 3KJVB 4BDYA 1WSJA 4C8NA 3T1AA 3V9UA 4CK2A 4CJKA 1T3NA 4ZTJA 3MR5A 3AVCA 1BISA 4FBTA 5J2PA 4O44A 2BQ3A 3NBPB 4CF2A 3NGDA 5C25B 4WFZA 3KD1E 2J6TA 4CGDA 3KK2B 1NK9A 4AHTA 3GV8B 3TAGA 1JL2A 4M3WA 5KG7A 4FJ9A 3CDWA 1LWCB 1BCMA 3SNNA 5HRPA 1HPZB 2F8SA 3U3GA 5KFGA 3OL9A 1HRHA 3H5YA 3QGIA 4LSLB 2G8KA 1TKZA 2W7OA 3OYHA 4EBDA 1LWEB 3RTVA 2G8VA 3LP0A 3BGRB 1LWEA 4TYAA 4YR2A 2A1RA 4KKOA 2RF2B 4J2EA 4RW9B 5DG8A 4DTMA 4CJWA 4F4WA 5KT6A 3RR7A 4KHWA 3G6XA 2WONB 3QNOA 5HBMA 4RW8A 3PO5A 3G10A 4JRQA 1VSMA 4KB0A 5L1LA 4Q44A 1KVBA 3E01A 4FJKA 3PR4A 1S5JA 4DQPA 4Q0BA 4ICLA 4ZVHA 1TKXA 2YKNA 1T03A 1RTIA 1YTAA 1RT1B 3DLGA 3D0PA 4RUCA 4UQGA 4CJRA 3O3GA 1VSIA 1RBVA 3BDPA 3NKYA 4CEFA 1HMVA 3S9HA 1N48A 3LP0B 3LP1A 5DK5A 4CJSA 2AX1A 3C6UB 5K14A 3CWJA 3CVKA 1WLJA 1FKOB 4DL7A 2XI3A 3V6HA 3PV8A 4B9TA 2Z1JA 2G8FA 3QETA 4KPYA 1NOZA 3CJ5A 3JSMA 3RMAA 1FKPB 4I2PA 1IKWB 4DWIA 4M3RA 3B6OA 2OPRB 3M9NB 3CFPA 4DL3A 3G6VA 5KFXA 3MR6A 3IRXB 2YHBA 1N5YA 4JS4A 2BRLA 4E1MA 1UWBA 2W42A 4R5PB 1BQMB 4DQIA 1JX4A 4FW2A 3QGHA 4MKBA 4C8MA 4E7HA 3MFIA 3H4BA 4I9QA 5KG1A 2YNIA 1B92A 1SH3A 3C95A 2OA8A 4DSIA 4ECUA 4H8KA 3ULDA 3TAFA 3M8PB 1LWFB 3AVLA 3ZT1A 2KQ2A 1K1SA 1NK0A 5KFBA 4DTUA 2ZD1A 2JLEA 3IS9A 4H54A 1QSYA 2HHQA 2WOMB 1JKHA 4Y2AA 4O3RA 4CJ3A 2X78A 1IKVA 1QAJA 2W9CA 3G6YA 4I7FB 4C8LA 5JS2A 5KT3A 1VSLA 3NHGA 2WTFA 4PWDA 5DQHA 5KFEA 1N56A 1JXBA 4RNFA 3OJUA 4ZP6A 4KBIA 1XC9A 2IM0A 2B43A 1WNSA 4Y1DA 1C1BA 3GIIA 5DQIA 3EY1A 4NLQA 3ZT4A 2R8HA 4QWEA 2OPPA 1W25A 4CJUA 1HPZA 3N6LA 1JLEA 1KFDA 1NHVA 2FVRA 4NLYA 3I0SB 2Z1IA 2FBXA 2HHXA 3V1RA 4OLBA 5CZ2A 2OPSB 3CQ8A 2BE2A 5C25A 1WSGA 4M3TA 3TAEA 1S6QA 4J9RA 4EP4A 2Z1GA 3DMJB 1S9GB 4CF8A 2R2SA 4M42A 3DOLA 1RYRA 1W0HA 1VSKA 1Z25A 3ZSZA 1RT7A 2GUIA 2DY4A 4NLGA 2FVPA 4CECA 2RN2A 1N6QA 4IG0B 2R8IA 4KO0B 3KLGB 3T5LA 1RDDA 2OPRA 1K6YA 4E0DA 3HO1A 3QLHB 4OKEA 4IH5A 1HNIA 2E9TA 1RA6A 5KT7A 4Q8EA 2AGQA 4CIEA 4JUZA 4MK9A 3RMBA 4H4OA 2OH2A 3VQDA 2VA3A 2WRMA 3KHRA 4DTJA 3D28A 3FDSA 4HTUA 4FLYA 1S9GA 3HPGA 4MH8A 2IAJB 4TXSA 4OGCA 2IAJA 3MEGB 3UPFA 4CHZA 4PQUA 4U6PA 4O3QA 2E9RX 1RT1A 4WXOA 1TL3B 3K2PA 3PJXA 1K1QA 4F4YA 1Q9YA 4EZ9A 1UOCA 1MMLA 2W7PA 4FLWA 5KG0A 4ZPDA 1YT3A 3NH2A 1IKYA 2R8GA 2HHTA 3A2FA 1L3SA 3SYZA 3SI6A 3NDKA 1REVA 2IC3A 2R2TA 4QWAA 2OZMA 2ZKUA 4ID1A 2KZMA 1VSDA 4AILC 1FK9A 4ED2A 4FS2A 2FVQA 3SJJA 5C5JA 4GC6A 2YNFB 2XC9A 1ZBHA 4JRPA 4CEZA 4NLDA 1LWCA 5KGWA 3SQ4A 3AA2A 4B3OB 4PUOA 4Q43A 4NCGB 1IO2A 1CXQA 3F73A 1QUVA 4DTPA 3WNGA 5J2MB 2PZSA 5KFYA 4EYHB 4TY8B 4RW7B 1RDRA 1EX4A 5KFSA 1BIUA 4FYDA 4Y2CA 4E7LA 5C24A 5EWEA 3OY9A 2XCPA 2JGUA 3NAEA 3SPZA 3PW7A 2I1RA 3MR2A 4M95A 1U04A 5KFUA 2P1JA 5I3UB 3HVRA 3DLKB 4F4KA 1EP4B 4IRKA 4F4XA 3I5BA 4URGA 4ED0A 5L1IA 4F4ZA 3BSOA 4ZVGA 4DFMA 3H08A 3AVKA 1JLQB 5L1KA 4BACA 3HL8A 1SKRA 5FDLA 4N5SA 3H40A 4J2AA 4F2RA 3AVIA 3AV9A 1C6VA 2XY6A 3RAQA 3SFGA 3V1OA 3V9ZA 3C6UA 1D8YA 3AVAA 1IH7A 2CKWA 1UAXA 1BHLA 4BWJA 2ALZA 1VK0A 2O4GA 3CJ4A 1S6PA 4KV8A 1OS5A 1RT3B 1YVUA 4DU4A 3RR8A 5KG3A 3AVFA 4B8AB 4IG3B 2YKMA 4J9KA 4WYWA 5FDLB 1I3AA 2RPIA 4QWDA 1C1CA 2GBZA 4B08A 5K14B 3MFHA 4KKOB 3WNHA 4KHUA 2WONA 3KKSA 4WFYA 3NMAA 4AHSA 1FKOA 4DSFA 4TSXA 5KG4A 4ED6A 3RBDA 3S3NA 3VQ8A 2UVRA 2UVWA 3RMDA 1S97A 1B9DA 3BSAA 1RTIB 1QQCA 2BRKA 3FSIA 2BR0A 4KAZA 1VSEA 3OYGA 4N56A 3ZSWA 3H5SA 1J9AA 2HVIA 5KFOA 2E4LA 2Y1JA 4J9NA 3WNEA 4ZP8A 4MFBB 1ZBLA 4FZXC 1RT4B 1HYSB 2VWKA 3LZIA 3LDSA 4DSEA 1C0MA 4J2DA 3T19A 3L2VA 2YNIB 1WAJA 2BQRA 2ZQBA 3T5KA 2FVCA 3HHKA 3HVTA 4EEYA 3GIJA 3LP2A 4B9SA 3Q8SB 4C8OA 1RT6A 4FK4A 3RAXA 4FJGA 4K8ZA 5JS1A 4Q8FA 4E89A 4M3UA 3AA5X 1NKBA 1LWFA 2AGOA 2XHBA 4YMEA 5KRTA 4O44B 1L3UA 3MAQA 1SH0A 5KFPA 1S9EB 3SZ2A 3WNFA 1DLOA 2BDPA 4IKFA 3I5AA 4KB7A 4CK1A 4KFBA 4FLTA 1EP4A 4R8UA 4WYLA 4ED7A 3KHGA 3BSNA 3TANA 3C6TB 4E1NA 4N41A 2OPSA 1U49A 3UR0A 5F8HA 1L5UA 4NCGA 1S0MA 1JLQA 5KG6A 4B9LA 2QKBA 1JIHA 4MQ3A 2J6UA 1C0TA 1QSSA 1W9HA 4QW9A 2O5DA 3VQPA 2OPPB 3V9XA 4HKQA 3OYAA 3HVAA 4O4GB 4NZ0A 4CK3A 2FBTA 5F9LA 1RT7B 1HNVA 3HSTB 3IGVA 4YR3A 3NF9A 1NK7A 4CGIA 4OKJA 1RTDB 4XPEA 1S4FA 4LSLA 1TQLA 3AVHA 3IN5A 4CGJA 4E7IA 1U45A 1D9FA 4RW7A 2GIQA 5DMRA 3NH0A 3N6MA 4Y3CA 2HNDB 2OYQA 4KHMA 1RYSA 1RTHA 2KZZA 1UA1A 1RTHB 3M9MB 3FQKA 3OYCA 2AJQA 5CYQA 4AHRA 3DLEB 4B9NA 1DTTA 4E3SA 3I0RB 1EETA 3NF7A 4DTOA 3OYKA 2W9BA 1KVAA 1WSEA 3DRRB 5T14A 5FROA 3M8QA 3ZSRA 3NAIA 2FBYA 3DRPB 1ZTTA 1IKYB 1UWBB 3LWMA 3OYDA 4LH5A 2FJVA 4IOBA 3SFUA 5KT4A 4ZPBA 2RKIB 1C1CB 4IKAA 3PX6A 2FLPA 4PY5A 4RW6A 3SV3A 1NKCA 1JLCA 4HCCA 1JLCB 1Q9XA 1KFSA 2B5JA 3L2UA 3CYMA 4J2BA 1IKWA 4OLAA 2R7YA 3OYEA 3LALA 3MEDA 4PQUB 3DLRA 3KK1A 4DF4A 4BDPA 1X9WA 3ZSOA 2F8EX 5F9NA 4TY9A 3I5CA 4R8UB 3LAKA 3ISNC 4ZTFA 1BQMA 3F9KA 4CJFA 4FK0A 4Q5VA 4J9SA 2OPQB 2HNZB 4DL4A 4ZHRA 4BE1A 2DFFA 1RT4A 3EZ5A 1JLAB 4M3ZA 1TAQA 1FKPA 1SV5B 2V9WA 3AO3A 4BE0A 2PYLA 5KFLA 1TL1A 1L3VA 2X6SA 4O3PA 3TAQA 3BREA 4F50A 1U48A 5I42A 3TR8A 3OYFA 5EU7A 1T94A 5I3UA 3L2WA 1LW2A 1MU2B 1RTDA 3ITHB 3QO9A 4KB1A 1VSFA 4HUFA 3CJ2A 4W5RA 3O3FA 4TY8A 4CJPA 1ASUA 4J9OA 1IM4A 4CEQA 1T05A 3KLEA 3AA4A 3RWUA 1XR6A 3M8SA 2VA2A 4IBNA 3QEXA 3PW4A 5HP1A 2YV0X 2YNHA 3EZUA 2ILZA 2XWYA 4CEOA 3LZJA 2HNDA 3MECB 4RW8B 1KSPA 1G15A 2R2RA 5KFIA 1S10A 3FRZA 1HJRA 3SI8A 4CGHA 4ZVEA 4Q45A 4DF8A 1QSLA 2HNYA 3ITHA 3ZSQA 4FJ5A 2XI2A 4CESA 3QIPA 3KHHA 4O0JA 4F8RA 2HWHA 4JV0A 4XIUA 3NGIA 4KAIA 1GX5A 1J5OA 2IMWP 4FJHA 3LP3A 3BQ1A 4IRDA 4GC7A 2YNGB 4O55A 3O4NA 3HPHA 1N5YB 2VG5B 5J2NB 3D5MA 5KFMA 5KFWA 2RDJA 3OLBA 3HP6A 4G3IA 4CIFA 5F8JA 4ZPAA 3KOAA 1TKTB 4OVLA 2HMIB 2D0CA 3OSPA 4I2QA 4RNMA 4DSLA 5DLGA 1RBUA 1GX6A 4ZP7A 4X2BA 5DGAA 2OZSA 2GC8A 2YKMB 4DQQA 2VG6B 4IG3A 3I8DA 4FLUA 4URQU 1QS4A 1HQUB 2XGPA 4XO0A 3DOKA 3MF5A 4KI4A 1ASVA 4C8KA 5HLFB 4FJNA 1BQNB 4R0EA 1GOCA 1TGOA 5DGBA 3OL7A 4B9VA 3DOKB 3NAHA 3DYAB 2P5OA 1JXEA 4W5NA 5KFNA 4JS5A 1SKSA 4I2QB 3IG1A 4CGFA 4MFBA 3KKRA 4CE9A 1NHUA 3HM9A 1RT6B 3VN5A 1KLMB 3JSMB 1TKXB 4MKAA 1J53A 1TK0A 1NK4A 1N4LA 3UQSA 2C2RA 2AGPA 4ZP9A 4LH4A 1X9MA 3KLHA 2ATQA 3GILA 2FJWA 2JC0A 1NJYA 4DSKA 5KT2A 4W5OA 4QPXA 1JXLA 4BDZA 4K4SA 4MK8A 4CHOA 4M94A 4ED1A 1HYSA 3FFIA 1REVB 4DQRA 3LPTA 2JEJA 1IKXB 1JLBA 4E19A 4JV2A 3GIMA 1ASWA 1TL1B 5JXSA 2FBVA 4HHTA 1SV5A 5HRSA 4DG1A 4EBEA 2AWZA 4ECSA 2LSNA 2B6AA 4Z4IA 5KFFA 1S0OA 1C1BB 4DTXA 3MEEA 4FM1A 4OGEA 4AHCA 5J2PB 2OPQA 4PWDB 3ISND 2D3UA 3CDEA 4RU9A 4DL6A 3NH1A 1TVRB 3HK2A 1TKZB 1RTJA 1SL1A 3SPYA 1FXXA 3K5NA 5I42B 2YNHB 3ZT2A 3H98A 3HVWA 3KTQA 4RW4B 4CJ5A 2ZD1B 3IS9B 4OJRA 3PX0A 2V4RA 3KLVA 4L8RB 4EP5A 2Z1HA 4ECTA 4QW8A 3E51A 3Q8PB 4YQWA 2AQ4A 3MXMA 1TL3A 3IGNA 1LW0B 4KV8B 4DS4A 5CZ1A 3P1GA 3PJWA 3QZ7A 3HJFA 2Y1IA 3JYTB 2PYJA 4KTZA 1BQNA 4HUEA 3H2LA 5HLFA 4H4OB 5KFTA 5KFJA 1S6QB 3RB0A 5KFQA 4ZMMA 2UVVA 2KW4A 1DTTB 4NLVA 2HHWA 1KHWA 4ID5A 4LD0A 2HMIA 4CF9A 4IG0A 2NUBA 4B9MA 4I2PB 2RDIA 3KLGA 3VQ6A 1GOAA 4FZYA 3DRPA 4RNOA 4K4XA 3QESA 5J2NA 4BWMA 2AU0A 5JUMA 2QKKA 2R8JA 1WAFA 3HVTB 4Z4FA 1YVFA 2XO7A 3DOLB 3CFOA 4K4ZA 4FK2A 1JLFA 4NLOA 3I0RA 1QTMA 3PW2A 1U4BA 3V6DA 1JLGA 4FW1A 2IC3B 1JL1A 3GV5B 1RILA 3HXMA 1S1VB 4K4WA 4ZVFA 1SL2A 2YKNB 1T03B 2VG7B 4Q0BB 3VQ9A 1GOBA 3MTKA 2FLNA 1ZYQA 2YHAA 3VA0A 3DRSB 1RDCA 3UIQA 2DPIA 2C22A 3MR3A 4CJQA 4FVMA 3MXIA 3C6TA 3MEGA 3AO4A 3V6DB 4LQ9A 4O3OA 1SUQA 3KIOA 1QE1A 1CZ9A 3QIOA 1VRTB 2WOMA 4CJTA 1NOYA 1U47A 1NJXA 2HAIA 4CF1A 4KSEB 4NYZA 2EHGA 3OYMA 3FFIB 4ZHRB 5C42A 4QWCA 4F3OA 1NK8A 1XR7A 4NLRA 2WHOA 2WCXA 4Z4HA 5FRNA 4H4MA 1UA0A 4U7CA 3QERA 4O4GA 1RT2B 4KFBB 5FRMA 3QEPA 1S1XB 4DU1A 1S9EA 3HYFA 4NYNA 2BANB 3TI0A 3OYJA 2IOCA 3SCXA 3DM2B 1CLQA 2XCAA 4ID5B 4KRFA 1KTQA 3AO2A 2QE5A 4KO0A 4RNNA 4DFKA
chains in the Genus database with same CATH superfamily
2GS8A 1H0HB 4CZMA 1IBLJ 4Z2XA 1ATSA 4K4TA 2UZAA 3OV7A 1T8EA 3SCKE 5CZXA 1Y11A 1JJ2R 5M1KA 1PO6A 4W90B 4FCYA 3ZX3A 2IDOA 2KI2A 4OL8A 4DV6K 1WC0A 4Y0FA 2IVFB 1HQEB 1K8KA 4O5BA 1EETB 1EZZB 2QLWA 5K8OA 4JV5F 3H1VX 1FHTA 1WSFA 1GXLA 3IBCB 3NRBA 4KGVB 1X3MA 3UR3C 2EW9A 2K7JA 3VWSA 4OZ5A 5EOYA 1KAXA 1N0VC 5JVGL 3LWLA 2KHDA 2D74B 2ETJA 3HD2A 4OPKA 2Q1LA 1P27B 2V5HG 3CDUA 3MI7X 2KH9A 2HW3A 2POKA 3RRGA 4JI3J 4K8RA 3TA2A 4B3SJ 4DOZA 4M5HA 2QMXA 4I4BA 3Q83A 1A5VA 4AM7A 1OVQA 2CJXB 2DCLA 1VK3A 2Z2ZA 4LFBK 3Q24A 1HR0J 2HG4A 3D3CJ 3CMAS 2DNPA 5BPMA 1FXRA 4CRJA 1ZAWA 2QWRA 1F9HA 2MKHA 4CIGA 1DLOB 2M3DA 3P5TL 1YJTA 4HWIA 3Q8RB 3NS7B 4DR5K 2QWPA 1QAXA 5HJXA 2E6MA 4H0XB 1XHZA 4K4YA 2LXFA 2MPUA 4QOZB 1BDGA 4IDKB 3U6FA 4RPFA 2K7KA 4QIVA 1W2BR 4IDKA 2A2CA 3R6MA 4B3SF 2ASLA 3CO0P 1IG9A 5B0CA 1LKZA 3CCZA 1IQTA 1S1WA 3L3VA 3OYNA 3ASMA 2VIHA 2W8LA 1IUJA 4LF5K 4JLHA 2FLLA 2BKOA 2CJYB 1WEXA 2RF2A 3DLKA 2NCKL 4HYKA 4FJLA 5C24B 3S3MA 3HKWA 2DGVA 5IT9U 4JI8J 4NYFA 2QMUB 2B6AB 2B51A 3AVNA 4H5WA 4WFBQ 2DTUA 3G0ZA 2VICA 1WSIA 1NB2A 4Z4CA 2CPIA 1HPMA 3JQJA 2IVPA 2O8EB 2YY3A 1K73T 4LQ3A 3A1YG 3X1LB 5HBMB 1PILA 1FJGK 4I1TA 1RBSA 3D2FA 3NVKA 1HWLA 3HFKA 2DFHA 3TJ8A 4MK7A 5IQQA 2ZM6J 2QLFB 2C2DA 1W26A 1WTBA 2P9SA 4DZDA 3GLJA 3OLAA 1UZDA 1VQPS 3EKSA 2Y3YA 4RZRA 4FWLA 4DL5A 3MEKA 1KHVA 3C94A 1G2EA 1TAUA 1IWGA 3SQ1A 2F8TA 2R7QA 2ZJRQ 3CC4S 5IWAK 3KD5E 1BIZA 2BJDA 4MLHA 4B1UB 1KQSM 2UU9K 3QINA 4FM0A 4HCBA 3TSPA 1P1TA 2IMOA 3BR9A 3HT0A 5BYQA 4JI5F 1WB9A 2R2UA 2C2EA 3SMSA 3D0GE 2O4IA 2DK2A 1YHQN 3H2VE 2YKPA 2AEMA 2FB0A 4P9SA 5KFZA 3ZETA 1SUQB 2IVOA 1TVRA 1RT5A 4K50A 3DU6A 3OQ2A 1TK5A 5LL6d 1TYQA 2CQIA 1OKJA 1XMQJ 1IR0A 3CJ3A 3PY8A 5KGXA 3MPVA 2IJFA 3HTVA 3D6TB 2UXCK 4RW6B 4RTFD 1N5VA 4HTJA 1HI8A 1WC5A 2F7VA 3K59A 1QE1B 1T05B 4F67A 4USUA 3T1YK 1QLNA 3V6KA 4YUDA 4OYZA 3PIPL 5A0YA 1L3KA 3CC4N 2X1FA 3AVMA 3HSGA 4EO8A 2WTUA 3I0SA 3RJMB 4JI3F 5H1SV 4J9VA 3NOGA 1KXPA 2FHJA 4I7FA 3VGLA 2F63A 4IWVA 3VEVA 2W2NP 1YRXA 2BJEA 1U7LA 3ZSXA 4CERA 3ZSYA 2MZQA 3SXLA 4ELTA 2HHSA 2VPZB 2AJ2A 3KFWX 1HWUA 3OS1A 2XY5A 1IKXA 2KTQA 5LMNF 1WN7A 4NI2B 3VAIA 4B3MF 2HHUA 4I6WA 2QW9A 3ET6B 2BUPA 1DTQB 1U0HB 4JYAK 1C0UA 4CVNE 1HIYA 2R8KA 2P9PB 5HQLA 4BR0A 1OSDA 3JTPA 1JCGA 2MQPA 2Z2LA 1VRUA 2IY5B 4JK9A 3KUEA 4KC5A 4LRBA 3R8YA 5FPDA 1MNEA 2GAHC 3AB4B 4U7BA 3N6NA 4ILLA 2HVHA 3PZPA 3P5BP 3Q8UA 2EC0A 5KT5A 4E2FB 2CQ0A 1Q8LA 1RNHA 1BUXA 3J7A1 4JI2K 3KLIA 5L9NA 4ZPVR 3W3SA 4OI4A 4NXNK 4CEBA 4E98A 2BABA 3DC2A 3V6JA 3BJYA 4ILJA 1RAHB 3AXMA 4CM2A 3K0JA 3M9OB 3T5JA 3K5MA 3Q2TC 4WFXA 4W98A 1Q18A 3H3OB 3BSCA 2AP6A 3V81B 2P9LB 4FLVA 3V9WA 3SUPA 1WHYA 4LRAA 4GMJB 1KCFA 3HT3A 3KK7A 2DR9A 5DDQC 3KLFB 2WW4A 3JAMU 2FF6A 5KOWA 2NUUG 4ECRA 2Y8YA 3OS0A 2W2QP 3RB3A 3DDNA 1BU6O 4WZMA 3V4MA 1JLAA 3ICLA 3D45A 3OYLA 1KLMA 4NLPA 1TU0B 3KUGA 1F60B 3QSYB 4AXJA 2YNFA 3U02A 5JJBA 3GQCA 1IJJA 4KHRA 1VR6A 4ZVQB 3ZT3A 4LBIA 2DR6A 4MIBA 3W0LA 2X1GA 5BJRA 4I9LA 4TN2A 5CYJA 1X4DA 2GX8A 3EGZA 4GVEA 4FJJA 2QV6A 4KHYA 1R59O 3O6WA 3OBIA 3ZLJA 2XMMA 2AHOB 3PRDA 2P9SB 4WQ5A 3W5YA 4EZ6A 3CM5A 4ECZA 5CHCB 1J5OB 1NMDA 2W9BB 3CFRA 2G1DA 3R7NB 2I9SA 3RB4A 1V5IB 3M8RA 2O1PA 4XDCA 4YS2A 5GINA 3NG8A 2BE2B 1FERA 2D5RA 2HSEB 2N7CA 1F3VA 3QICA 4GVMA 4CDIA 3MECA 1C0GA 1NZ8A 5KFDA 3B8HA 4QR2A 5CYQB 3WX4A 5M2PA 2C2KB 4P6QA 1WEYA 1N6QB 4ZCLA 1ITPA 5IT0A 3WXLA 4JB8B 3J7YP 2M8HA 3TNVA 1F5AA 3N28A 2W9AA 1X5SA 4F3MA 2I5JA 1R8CA 3V5RA 3NF8A 1OWXA 3OSNA 4LSNA 1H3DA 4YY3J 4AH9A 2KXFA 2V4JB 4NXMF 3OHRA 1WI6A 1IKVB 3EX7B 4IFEA 1R31A 2YQ1A 1RA7A 3MDQA 1VAZA 3K8VA 3DLBA 4FNHA 2ASPA 4DV2F 1YGYA 4B3OA 4IFVB 5CYMA 5AJ3F 1OH8A 2XZTB 2Q1NA 3KHLA 2BJ8A 5DQGA 3OHBA 2ERRA 4HI1A 2OJ3A 2EX3A 2DGTA 4X4TA 3ZTRA 1RDAA 3VEZA 3I4HX 3RRHA 1Q0NA 4N8OA 3EE9A 2AYBA 1T02A 1KVCA 4KBOA 2GMJA 2OTLN 2WBRA 4DSJA 4X66K 1LAWA 1H7XA 1Z6RA 4DMZA 2YX6A 2LCWA 1WSJA 5I4MA 4JI6F 4IQMA 3CJRA 4CJKA 4ZTJA 1RDUA 2E7WA 3MR5A 3OT9A 2HBLA 4YHHK 2ZH3A 1R6YA 2PFUA 3MCAB 3NBPB 3KD1E 2J6TA 4PPZA 3MMCB 4V1Ak 3AY0A 1MA9B 3IFRA 3TAGA 5DM7Q 2EG1A 2KYXA 4M3WA 1HBNA 1JCEA 1VQ8S 3SNNA 2ZM6K 3PCOB 1HPZB 4AL7A 1SB6A 3DN9A 3SBTA 5KFGA 1HRHA 3D6MB 3H5YA 1YKWA 2CDQA 1E6VB 1LWEB 1OQ3A 2MQQA 3M8YA 1LWEA 4JI0F 4RJVA 4KKOA 4XK8C 1AXQA 2ZWPA 4DTMA 2WAQD 2MKIA 3KWIA 4RU2A 1GAOA 5HBMA 1X0PA 3VOVA 2CGKA 4JRQA 4KB0A 1LFPA 1RBLA 2RQMA 3PR4A 3WXKA 1S5JA 3OR1B 2DNZA 3O80A 4DQPA 4ICLA 4ZVHA 2L9WA 1TKXA 4HT5A 3KVGA 4B3RK 2P9NA 5IM0A 2V8VA 3ZX2A 1N32F 1RT1B 4RUCA 3O3GA 3W60A 3NKYA 4CEFA 3CERA 2VPYB 3S9HA 1OY9A 4P74A 4BRAA 1WBDA 3LP1A 5B09A 1U1OA 3CVKA 4NA3A 3MM6A 3M6WA 4UY8T 4DL7A 4BROA 3D66A 3V6HA 1UCNA 4BR2A 4KPYA 3QETA 5HO4A 3RMAA 1IKWB 4KGXB 2ZWOA 5GAGU 3OVSA 2KU7A 4DL3A 1EWQA 3GBTA 1X4FA 3OVBA 2BBEA 4QBUA 1N5YA 4JS4A 4KHPF 5D77A 3D2EB 1S5ZA 3CQXA 1S6OA 3UVJB 2WFBA 3MCNA 2NQPA 4OHZA 2BMBA 3CJQA 1JX4A 1RWPB 3CCSS 3MR7A 2GMHA 2LEPA 4E7HA 5DETA 2XBPA 3EXYA 3THTA 1B92A 1RAGB 4H8KA 4BRCA 3TAFA 2HRTA 1FNXH 3A8IA 1HHSA 2KQ2A 4UOGA 1K1SA 2DHAA 2W6LA 4DTUA 5A6WA 5D8HB 1XMOJ 3BS9A 2HHQA 2VD3A 4Y2AA 4X64F 2P9KA 3N79A 1IKVA 1U8WA 1Q81O 1UZHA 1W7WA 4C8LA 3WT0A 5KT3A 1U1NA 4PWDA 4L6V3 2XMTA 5KFEA 1JXBA 4RX6A 2Q6CA 4ZP6A 1H38A 4MAKA 4LF8J 4CP5A 4QWEA 1RLDA 2B7CB 5GAHI 1W25A 2NZTA 3MN9A 5F1XA 4A61A 1NHVA 4JV5J 2MHEA 1DFDA 3OW2R 2OPSB 2DXDA 4H4KC 1Q86O 1WSGA 5IT9Y 3VGMA 1M0SA 3TAEA 4ZCMA 5TKWA 5HL7Q 1S9GB 1Z25A 4YORA 3ZSZA 4NLGA 1HQ2A 4IG0B 3NOCA 4IEIA 3OTBA 3KLGB 4Q2LA 1IJEB 2UUAK 2VOOA 1UPPA 3G4SS 2OPRA 1HHQA 1K6YA 1HX1A 3QLHB 4M7YA 4C11B 2E9TA 1FW6A 5KT7A 2AGQA 3S01A 4MK9A 4IOAQ 4H4OA 2VBZA 2QWLA 2WRMA 4FLYA 3D7SB 4MH8A 2IAJB 4PCQA 4MMOA 4A48A 4PQUA 5ELZA 3T6JA 4NXNJ 3CCVN 2HQIA 4DU7A 5HVHA 3QRRA 2O8BA 3CULA 2DGXA 1UOCA 3MN7A 1Q7LB 5CQGA 5KG0A 3NEKA 3VAFA 1VQ5S 3C46A 2HHTA 1L3SA 3VEOA 3NDKA 4NXNF 4DV7F 4EHUA 3MAHA 2IC3A 3VTIA 2OZMA 3N9UC 3ZYYX 1DRZA 2E5LK 3R9LA 1FK9A 3NWGA 1SI9A 2MKYA 5GAGI 3A3NB 4FS2A 2FVQA 3EGNA 3TP2A 4JRPA 4NLDA 2F4VF 1P90A 3DXMA 1A0OB 2HHHF 4ZVPB 6FD1A 2MLYA 4NCGB 1FFWB 1IO2A 1QUVA 3MM5B 4JI6J 5KFYA 4LFCJ 5AQTA 1RDRA 2WVCA 1BIUA 2LMIA 4FYDA 1FTCA 1CULA 3OY9A 3MAAB 3MR2A 1S7IA 2UUCK 4F04B 2YJEA 2M4MA 4F4KA 4MDBA 3VCDA 1DQAA 2JZ5A 3W2WB 5L1IA 3CD6S 1VJQA 2A6MA 2DRAA 1X5PA 3H08A 4PXEA 3AVKA 3W7BA 3JB9k 4X4RA 4LREA 4DV1F 4BY9C 4J2AA 4TKTA 2AYMA 2PE8A 2AYGA 2OMOA 4BLGA 3V9ZA 3C6UA 4ED4A 4IO8A 4CZEA 4BWJA 1VK0A 1S6PA 5D0EA 3MWTA 4KV8A 4KIAA 1YVUA 3AVFA 4OHXA 2CPHA 3H46O 1HHTP 4WP3A 1VCTA 5G0RA 4CLZA 4ETZA 3O8WA 2VKZG 2V50A 3GG0A 5A2QY 1ZPWX 3E1YA 4DI6A 2V2VA 2D69A 3W66A 2VODA 5K20B 5K14B 4KHUA 3KKSA 4WFYA 4HACB 3NMAA 3CMES 4TSXA 2OI2A 1IQZA 3Q8VA 4CIOA 2FY8A 3VQ8A 3CCUS 3BSAA 1RTIB 1QQCA 2BE7D 4DR2K 5IV4A 3ZSWA 3H5SA 3OBWA 3ENVA 2QG9B 2Y9HA 3BF4A 4MFBB 2BJ9A 1ZBLA 4FZXC 3R1HA 1ZZFA 2VWKA 3TSUA 4ILGB 3LZIA 3LDSA 1C0MA 2QFJA 4BR4A 3L2VA 2YNIB 3G9CA 1UVJA 3QJJA 1F9EB 2BQRA 3BH6B 3WQTA 4HTIA 1N34J 3UE5A 4CO2A 1RWNB 3HHKA 4EEYA 3RW7A 3SEOA 3PHTA 4A8XA 4JD2A 3W9IA 1RT6A 4JI1J 3F2KA 3MD3A 4FO0A 3MAQA 3SZ2A 3HZGA 2BDPA 3J80Y 4KB7A 1Q78A 4FLTA 4R8UA 1VOMA 1S12A 2GUPA 3CMEN 4WYLA 3BB5A 4V19S 2XWXA 4E1NA 2OPSA 4I64A 4NCGA 1S0MA 2CQ4A 2QYCA 4L75A 1JJ4A 4MQ3A 2J6UA 1QSSA 4IO9L 4QW9A 5AZIB 3W8GA 1FE0A 1M5SA 2DHSA 2E88A 2MY7A 3MWBA 1H7WA 4GV3A 3D2FB 2DNMA 3HSTB 3M1VA 4AYBD 4CZFA 2FXUA 4DB3A 1MN9A 1NK7A 3N4WA 3FBCA 4XPEA 3IWLA 5LMNK 4Z37A 2GGPA 4M5DB 1S4FA 2V34A 4FYWB 3IN5A 2MKSA 2B9EA 4X65K 1U45A 2R7VA 3B4DA 1CJTB 1M5HA 3HHDA 1S72S 2KZZA 4DV6F 5AXMA 2FJAB 2YX1A 2AJQA 1NM1A 4AHRA 2V7YA 3PACA 3QT6A 3TJ9A 2XLJA 1IBKF 1HNXK 4B9NA 4E3SA 4DTOA 3R6LB 1YWXA 3P49B 1SQKA 1B99A 2VQEF 2ZUGA 1RWUA 1TYQB 2UUAF 2K8GA 4BVPA 1HWKA 3DRPB 5E2QA 1IKYB 4A47A 4DR6J 4IOBA 3SFUA 5KT4A 4LH5A 4ZPBA 5M1OA 2FLPA 1NKCA 3H1QA 4HCCA 1JLCB 3FNNA 4UY85 3L7OA 1IKWA 1VQPN 3LALA 4PQUB 1VQOS 4OI1A 3SDEB 5LMUF 2Y8WA 3AAQA 4ZKAA 5HSPA 2VJUA 1NWKA 3I5CA 1BQMA 2BACA 4DV2K 1DAXA 6AT1B 4Q5VA 3FMWA 3RGIA 3K2YA 1OY6A 4ZHRA 3S7RA 4X66F 4JI4K 4WFNL 1VQLN 1UETA 1CBKA 3QATA 5IQ6A 1EQ0A 3IC1A 1SV5B 1H2TZ 4DUZF 3TRGA 1S72N 1TL1A 2X6SA 2C42A 2DGOA 1WG4A 3BREA 5HL7L 1K0VA 3OYFA 3QFHA 1MWYA 3L2WA 3CW2C 3M32A 2NRWA 2VGMA 2BOPA 4C0BA 3O3FA 2RU9A 2E2NA 1S59A 2O8EA 1ZH5A 4FWSA 3QEXA 5HP1A 3KJFB 4MYTA 1HKBA 4FPRA 2UXBJ 3MDFA 1KSPA 1S10A 1FJ7A 3UDCA 4CGHA 2Z8QA 5A6PA 2EG2A 3M32B 4DUTA 4WWSA 3KHHA 4O0JA 4USKA 2W41A 2ROGA 5IT9O 4FJHA 3GYGA 3I82A 3G96A 2YNGB 3W65A 3PJ9A 4UY8O 1RABB 5KFWA 1RHUB 5KFMA 2RDJA 4DUYK 3HP6A 5M1NA 4G3IA 4CIFA 5F8JA 4ZPAA 1RQ0A 3OXLA 1FEEA 2MZ1A 2P6SA 4I2QA 3EN9A 2V63A 3L4IA 4DSLA 1SKUB 1RBUA 1GX6A 2RJZA 2XYPB 2HF3A 4X2BA 2V2QA 4RBVA 3HI9A 4IG3A 2YVSA 3C15A 2GW8A 1HQUB 3DOKA 2OGUA 4FJNA 1BQNB 1K47A 4P71A 1TL4A 5U47A 3K8WA 2DITA 5RUBA 4I2QB 5EVZA 1FA0A 2D3O1 2O8CA 2KM8C 5ETSA 4GO7X 2DNLA 3BBBA 1NJIT 3OUYA 2KRRA 2C2RA 3FSXA 4LH4A 2HGLA 1TTHB 2NZ4A 4DSKA 1CEZA 4CLYA 4QPXA 1RISA 2HS0A 4BDZA 1U2VB 2ZH2A 3VAHA 1FDAA 4M94A 1REVB 2GHPA 4AQYF 2JEJA 3PYFA 4IOCQ 1JLBA 5JXSA 4HHTA 5HRSA 2YTCA 3IMXA 1MW7A 3THWB 4GMKA 1GNKA 4B3MK 4CTAA 1YJNS 3MGJA 3MEEA 4JI6K 3FRYA 2CQCA 2KXHA 4BRFA 3ISND 2D3UA 5BYRA 2KFYA 1SL1A 3K5NA 1RU1A 1XN9A 4DPUA 4C48A 4MJKA 3HHLA 3KXDA 4LT6A 1U2CA 4OJRA 4RKUC 4I0WA 2DNKA 2V4RA 2Z1HA 4ECTA 3ULEA 1SQFA 4TNOA 3WX8A 3E51A 3Q8PB 3HOTA 1K73O 3MXMA 4TVAB 3UD4P 2K2PA 3ZO7A 3VVUA 4RUBA 2BXJA 3PJWA 2Q0UA 4EFHA 2VKRA 2DH8A 1XMOF 2PYJA 4KTZA 1BOTO 3G82A 5KFJA 3BZKA 3RB0A 4MKYA 4WKRA 3R2DJ 4NWBA 2V51B 1KHWA 4HT7A 3JQMA 2ZVSA 2EFGA 4LIWA 3DAWA 4OJGA 1MMDA 5IOLA 3HBTA 2EEYA 2RDIA 3VQ6A 2VFVA 1GOAA 3DRPA 1NGCA 4D3HA 4C6AA 4RNOA 4K4XA 1IVZA 4BWMA 4CNZA 3L95X 2HBJA 4I6YA 1WAFA 3ZZUA 1LK7A 3CC7N 1XK8A 2XO7A 2RD5C 3TO8A 4K4ZA 3ZTPA 1LCUA 3PW2A 1JLGA 8AT1B 4LR9A 3IRWP 1S1VB 4K4WA 2BKNA 2UU9F 4AFFA 1T03B 2EKYA 2VG7B 2CPZA 1D4XA 2NPFA 4ZVRB 3MTKA 1J27A 3LUYA 3FBFA 4KRWA 4ZIWA 1F9FA 5A8RA 3VA0A 3VV2B 5A2QU 4CO1A 2C22A 2XMUA 1S4EA 4FVMA 2ZH4A 3O9QA 3MXIA 4DR3J 1GMUA 1ZM9A 3V6DB 1HBUA 4AL5A 2KVIA 2QZ8A 1D3WA 4CO0A 2N3OA 4JI1K 1U1KA 3VESA 1YJNN 4OX9J 5LJ5Y 1UPMB 4CJTA 1O8BA 4PPDA 3D7EO 3HHEA 4NYZA 3TUPA 2EHGA 2ZJQQ 5LJWA 2CZ4A 3FFIB 3L7UA 4XH1A 1UFLA 2WHOA 4FKYA 2HFVA 2HF4A 2AIRB 1QVGR 3EDRB 4PZVA 4JKFA 1KD1T 1VQ6S 3L4QA 3MCPA 1V3ZA 1YIJS 4DU1A 2RU3A 4JNEA 3B4MA 3LDOA 2XCAA 4ID5B 1NO8A 5ADXA 4ETXA 5AQUA 1P6TA 1KTQA 2RAQA 4LRCA 3DJCA 4KO0A 4WE1B 3E01B 2ABYA 4CFAA 4M63A 3TAMB 4E7JA 4O0IA 2VG5A 4XH5A 3QIPB 3VTHA 2HBKA 2R7WA 4WP9A 1WSHA 4MO4A 2VV5A 1DTQA 3O2IA 2AP1A 2WBMA 3QFPA 4JKGB 2BZ2A 2QA2A 3PLAA 3CM6A 3ENAA 4ELVA 1IJFB 4ED3A 1U09A 3OVAA 2ASOA 3TWZA 4M5NA 3K9KA 3KWMA 2O8FB 5KRSA 1F3FA 4MT1A 4DFPA 1S79A 4IRCA 1X9SA 3TQEA 2VQFJ 4FSVA 1BG3A 1UVIA 2HFUA 2ZE2A 8ATCB 2ZE2B 4WIQA 3KLIB 1V3SA 5KFRA 4RWXA 1D5AA 2WVFA 2BW7A 4YNQA 3V81A 1NNDA 2P9LA 1Y97A 2PY5A 2CJBA 3ZETB 2LECA 4NRUA 2O8FA 1PAUB 4DTNA 1JKHB 2RSQA 3H20A 4HHJA 5E3AA 3MM8B 2RB7A 5F41A 4ZLLA 4EYIB 1RT5B 4PXBA 3VQEA 3CIZA 1VQKN 4DEZA 2Q3PA 3K5OA 3NL0A 2YX4A 3ZTSA 4J37A 2GIRA 3VQBA 3HX9A 4FPBA 3DLGB 2D0AA 4BC4A 4ZN3A 1VQ8N 3K57A 4Y34A 3ET6A 4LF5J 5JVGQ 3PNIA 4C1NI 4M3YA 5CXTA 4FVCA 4JKAA 4DR3F 4YR0A 2GTDA 3F9MA 3ADAC 4ZS6A 5C15A 1RTJB 1LFWA 4DV4F 3C7NA 1VSJA 4CGGA 1TMJA 4ECXA 3DMJA 2ALYB 1R8AA 3MAAA 4ES2A 5BR8K 1XWLA 2P51A 3B78A 1CULB 4NI2A 3L3UA 1HL6A 3HSJA 1NGGA 4WXWA 2UXBK 1MG7A 1NCLA 2HB5A 5HVFA 5B8HA 3QYYA 3NCRA 2IA6A 3VVTA 2NREA 1KD1O 3BPDA 4FVUA 1FFSB 4EO6A 2DGUA 4DV3K 4ANDA 1NU4A 4N8NA 1U24A 3KLEB 2HWIA 4WF9Q 3PRVA 3D1QA 3G87A 5HAOA 4NLXA 5EDWA 1TL5A 4TLRA 4TYBA 3M30A 3PEJA 1QUPA 2P9CA 3ENWA 4RUAA 1RI7A 2DO0A 2DBBA 4OYXA 1V4SA 3TZXA 3FZHA 2E1RA 4OX9F 5L1JA 1VHXA 3QLHA 3UE2A 3M6GA 4B8CA 4JI4J 2CUYA 1GMWA 3SUQA 5E41A 1K44A 1IXKA 1RGVA 3EZWA 4JKGA 4QYZK 2JFKA 1T9YA 2ILYA 1LXJA 4CJ4A 2J9DA 4AQYJ 1G1XA 3ZZ0A 4PA1A 4CFCA 2H51B 2RVJA 3NNCA 3TZZA 2GWJA 2X1AA 4P75A 4CYUA 1S1TB 2DRDA 2OHDA 2Q6BA 3CE8A 4ANEA 3KK1B 1S3XA 3BEXA 1FVQA 3MEDB 1TL7A 3WIVA 1JWWA 3ZNUA 4DFJA 1TFWA 1W97L 1Q8IA 3BO3A 1N34F 4Z4EA 3GP9A 2M7SA 2NZCA 2B5JB 1EXQA 3RU0A 4CFBA 3SSSA 4UF4A 3CJ0A 4KHSA 4LFAF 1K0TA 2A10A 4PRFA 2UUBK 3CGIA 4DLGA 4BG8A 1G7CB 4KTWA 2QI2A 1GQEA 1SJFA 2P2CB 1E6YB 4LF7K 2OEJA 4O4RA 2KXNB 3LO3A 4CEAA 3E3XA 4FJIA 2J76E 1S1UA 1TV6A 4USMA 4B3TF 3CCRS 4XTTA 5JMNA 4ELUA 3CD0A 2V9KA 3L0QA 1GLJO 5BRDA 2FZKB 2C3PA 3MPYA 3GIKA 1HNXF 3Q8QB 4PHTX 3MEEB 3TQ1A 1HNVB 4OZ3A 4CO4A 2LYVA 3AO1A 1HI0P 3CG7A 3DDIA 3GE1A 2Z2YB 1GLDG 4O3NA 2DR8A 3ZZYA 2W9CB 1S1WB 4H5NA 3J81O 1Z4UA 2F9DA 2X6NA 4FM2A 3CO9A 4CI0B 3GFYA 1LV5A 1G3OA 2PI5A 3AOCA 1KQGB 4E8UA 3VQ4A 5F8LA 1SXLA 3SBGA 3C15B 5LY3A 2VZ9A 4YOVA 3GIRA 2KFZA 2DFEA 3I9V9 3RBEA 2UUCJ 5EGYA 2VBYA 1JJ2M 3OTOK 2BYCA 3FEZA 2A40A 3BQ0A 4LF8F 1WDDA 1ZBUA 2MLXA 1QAIA 3OL6A 4IH6A 3KK3A 5GMKa 2O8DA 1BA0A 4X66J 1EIYB 2Q0RA 3J7Z5 1OYDA 1RHRB 2R42A 4Y2IA 1HQUA 3PR5B 4J9QA 4FJXA 1WUAA 5LOQA 3N5BA 1EKEA 2JJ4D 1CC8A 3LDNA 4Z4GA 3J7YI 4ZLNA 5AQMA 5LMUJ 1EO1A 4QAGA 1HBMA 3EMTA 4FXWA 2OSRA 4DLEA 3J81U 1RTZA 1UFKA 3OJSA 5FIIA 2YH1A 1ZPVA 1VQLS 2I38A 2F9WA 2G2OA 3TSQA 5KFKA 4FOEA 2UXCF 5AQVA 4NE9C 2BUNA 4CLFA 3IKMA 3QZ8A 2KYZA 1FXDA 2HHVA 4CJLA 2QLBB 3OVNA 2NSBA 4IR9A 2RT3A 2F96A 4ISGA 4OKKA 2CRLA 4CW7B 3VQSA 2XHWA 1RAJA 2QLXA 4FBUA 2Y1LB 3VGKA 4ZCKA 1GTEA 4LF9F 4QIGA 4E7KA 3P4IA 3DI6B 2CQGA 3NXZA 2IVNA 2FSJA 1RWOB 1EKSA 3ZZPA 2BJ1A 3MMCA 4PKDB 2UVUA 1LW2B 3NMRA 4G1IA 5HJYA 1APSA 1QHTA 2OMLA 3JAMO 2CQ3A 3PO4A 2RIJA 3CSKA 1UEUA 5C42B 3RYLA 2BQUA 3KJVA 5JMVA 1X4BA 3FQLA 1CJUA 1RHMB 4B02A 5DDOC 1KRPA 5HROA 1NBWA 2EPIA 4RW4A 1D8ZA 1S1XA 1VRTA 3AGRA 2P5GA 2QEXN 5A76A 2DR5A 4ZVSB 3SV4A 2IGIA 1Q5VA 4FLXA 3CD7A 2HIYA 2JH3A 4JI7J 2I8EA 1BXNA 1RE1B 2ROPA 5T7BA 1DY3A 3L2RA 3VALA 4QPTA 4HH1A 1CJKA 1K8AT 2DNHA 2Z4PA 1ATRA 5C2DA 3N4QA 3GOIA 4DHVA 1HNIB 2EXUA 3ZSVA 3SLCA 1PIEA 3PW5A 5AQGA 3VAKA 4B9UA 2VASA 5ETKA 2YWGA 1FEHA 2RKIA 2BM0A 3M2RB 4DR5F 1LOTB 3EGVA 4N7TA 4CT8A 1I94J 1RHJB 1YTYA 3MX2A 1W7AA 3GJRB 4RW9A 3OFFA 4N76A 1SJ3P 4JKEA 3N0VA 1M5VC 2I5JB 3H5UA 3VQCA 1VQSA 3NS6A 4X65J 1YVNA 5J2QB 2YI1A 2YWEA 1TUWA 3PX4A 3U3YA 4Y6IA 3DLEA 3QAEA 1TUGB 4JI7F 3OW2M 1I6JA 2FF3B 3AB2B 4JBCA 5CYMB 5DDPC 2VQEK 5AQRA 1UFWA 4BG9A 4M5LA 3O1WA 5I3PA 3NGYA 2QMWA 2GJFA 1H98A 2GELA 4RG8A 4ED8A 1I5OB 4QCLA 4MLEA 4M3XA 1ZA1B 1BMQB 3R27A 3CXCR 2FIUA 2ASDA 2KLAA 5DO2A 4OHVA 1MU2A 4R5PA 4FZZA 3CJKB 2FVSA 2HGMA 2VBWA 3SCLE 1N5SA 1WTFA 5AQPA 3V9SA 2JEGA 3C6HA 3JXOA 3TARA 1R3NA 3EEQA 3R5JB 5SZTA 1VQNS 1S0NA 2YPYA 4FWKA 1B9FA 4BDYA 4AE5A 1NM2A 1OYEA 1IBLF 4CK2A 2V67A 3BO2A 2VYPA 3D6FB 1O51A 3OTOF 4FBTA 5J2PA 3BUZB 4CF2A 4W92B 3NGDA 5C25B 1H74A 3KK2B 3GV8B 5L46A 5AXNA 3A5LC 1VQMS 5BXIA 5KG7A 3IWXA 1S0VA 1KP6A 5HRPA 2AEJA 1NPKA 3ATVA 1H72C 2UYTA 4UOCA 4KT0C 4X84A 3QT5A 1TKZA 4LRFA 5THWA 2R7XA 3BGRB 4TYAA 5LSRA 1RXOB 3M1VB 4EFAC 3VPZA 3I9ZA 4ZLPA 1TR0A 3RR7A 3QWPA 4KHWA 2WONB 1YZ7A 2LU1A 1VSMA 4HDHA 1HNZJ 1FVSA 1S7HA 5L1LA 2JWKA 3E01A 1FFGB 3SMPA 1N33K 4Q0BA 5G0RB 3KHYA 2O3DA 2DKOB 1X31C 3BY5A 2O8BB 3MM9A 5ADZA 1GFWB 1YTAA 2A2DA 1CQMA 2F4VJ 2ZVIA 3RW6A 1FT8A 3UI3A 2AX1A 3C6UB 4DCHA 2OELA 1KQFB 3PV8A 4B9TA 3IO1A 3IM8A 2G8FA 3V2UC 2J8AA 1NOZA 3FE1A 3JSMA 2QA1A 1NDKA 3C19A 5IWAJ 2OPRB 3M9NB 3G6VA 4S0MA 3T9ZA 5HN0A 3IRXB 2ADCA 1IG8A 4E1MA 1UWBA 2DT9A 4R5PB 1M1KT 4IUFA 4C9DA 2LEBA 5C0YA 4MKBA 4C8MA 3HULA 4OI2A 3MFIA 4X4VA 5KG1A 2YNIA 4OPHA 2KKHA 3C95A 4DSIA 5F2RA 2OA8A 5ETPA 1FE4A 3F5TA 3ULDA 3HKZD 3M8PB 4CZLA 1NSQA 3AVLA 4DPTA 1IBCB 1X4CA 5KFBA 2RQKA 2DO4A 1G6BA 1M90T 4H54A 1QSYA 2WOMB 4DPOA 1M90O 3G8SA 2HMPA 2X78A 1JNRB 4DV7J 3G71N 5EX0A 4HI2A 3I87A 3RZAA 3W2WA 1SAZA 3GPAA 2BJ3A 5HK4A 2OLWA 2WTFA 4A8SA 3C66A 4EI2A 1YK9A 4RNFA 2NSCA 2JDJA 4PG4A 1FNMA 2UXBF 2CH6A 3I8BA 3GIIA 3EY1A 5KAKA 3PDNA 3U7JA 2UUCF 5A8WB 2CAJA 3SSQA 3N6LA 2XO6A 1GLLO 4JI0K 1FD2A 2FVRA 4NLYA 3I0SB 1UVMA 2FBXA 4OLBA 2VH7A 5DZ7A 4KHPJ 1G99A 2PBDA 3CQ8A 2R3VA 5C25A 4M3TA 5M1QA 1S6QA 4J9RA 1Y3KA 2Z1GA 4IJAA 4JK8A 4EP4A 2NYHA 2PSZA 3CJ8A 2CA9A 4USWA 1RT7A 2LXUA 2V8PA 3OXFA 1IBLK 4CECA 2RN2A 1N36K 4DCJB 4Q7AA 3TX8A 2X51A 3D2WA 3GJTB 3H2UB 3CCMS 2GQ2A 4X4UA 3MHYA 4OYIA 1NMNA 2Y0BB 2MDAA 2D9PA 4C1NK 4OKEA 4IH5A 1RA6A 4PG7A 4JYAJ 2AV5A 3TR5A 2MKKA 1A6LA 1R8PA 3A8YA 3KHRA 3D28A 3MM6B 3FZKA 3FDSA 1S9GA 3K17A 4LF6K 1E3MA 3FZLA 2HS3A 4DV5J 5F0UA 3BGLA 3MEGB 5D0HA 2ZBPA 3GE9A 2GEMA 4ANCA 4O3QA 3PIOQ 3DHWC 4WXOA 2RDDA 4BR9A 3K2PA 3A8JA 2MHNA 2P8IA 4JEPA 3LGHA 4I6MB 2DXFA 4NO7A 1MMLA 3EICA 4USTA 3NH2A 3HZEA 1AUSL 3SYZA 2E5HA 2QWNA 3GSIA 1REVA 1ZM3A 4QWAA 4PKHA 5JLHA 2ZKUA 4ID1A 4HH0A 4J8FA 2KZMA 4AILC 1X5OA 3L4BC 5C5JA 2XC9A 2E1YA 4DHYA 1T9VA 3QRQA 1LWCA 4CWBA 1ZOTA 5KGWA 2HZCA 2LA4A 4ZPTR 4PUOA 4Y2KA 2JNJA 4CZJA 4DTPA 3WNGA 1QQNA 4OMFG 1Y7PA 1HWJA 2PZSA 1VBXA 4TY8B 3ENOA 3M1FA 4OJHA 4Y2CA 5C24A 3MMAB 4DR1F 2KKZA 2JGUA 3NAEA 4KH6A 3FEXB 1RK8A 2F7TA 5KFUA 5I3UB 3HVRA 3DLKB 4IRKA 3U8XA 4URGA 3BN4A 2YWHA 2O66A 1RCXB 2NRXA 1N34K 1FI4A 4ES1A 2B9XA 3TUZC 4K5RA 4K7QA 5L1KA 4BACA 5FDLA 5L38A 3H40A 1R43A 3AV9A 3SFGA 2H48B 2NXUA 3V1OA 2WC9A 4NZ7A 2DHXA 3AVAA 2FPHX 4A59A 3U4LA 4F3QA 2ALZA 1F6TA 1OS5A 5CCMA 5C10A 1RT3B 5KG3A 5IM0B 2AEFA 1OH5A 2YKMA 3JS6A 2PMHA 1P8GA 4WYWA 5FDLB 1I3AA 5F3TA 4LR8A 4JI8F 2P9EA 1C1CA 2GBZA 3MFHA 4KKOB 3OFGA 4BC5A 5E7OB 1FWKA 4DSFA 5MAOA 2IRXA 1CVJA 2CJ9A 4DR4J 2UVWA 1U8SA 2OUGA 3FSIA 2E8AA 3MN6A 2AJ1A 2I6WA 3ZZOA 2FSKA 3LA0A 2VFTA 2E4LA 3EO3A 4QYRA 5HANA 3R5BA 4ZP8A 2XULA 4FF2A 1HYSB 4P7TA 5AZJA 4DSEA 1VRQC 4J2DA 1U2VA 3T19A 3QBWA 4A2AA 3GU0A 1GLEG 5BPLA 4BRIA 1KEKA 4YY3F 3GFXA 2AKWB 1Y10A 3GIJA 1N32J 3D2EA 2M52A 2B7BB 2GX9A 4LF9K 3CIPA 2KM8B 4Z7YA 3T41A 1MSWD 4L73A 3RAXA 2ZBQA 4K8ZA 4RL1A 2O8CB 4Q8FA 3T6BA 4WFAL 1NKBA 1LWFA 4CBXA 2AGOA 1O0PA 4H4KA 2VU5A 5KRTA 4O44B 2HBMA 1L3UA 1S9EB 2KB2A 3WNFA 1DLOA 4FL9A 4IKFA 3QRPA 4PEOA 4CK1A 4KFBA 1GH8A 4G65A 3KHGA 3TANA 1ACMB 5F8HA 1JLQA 1VQKS 2QKBA 2RS2A 5BRHA 3NGKA 5AQIA 2LQ9A 4DCPB 3AJ2A 4R0JA 4DU8A 3W3DA 3KG0A 5L39A 3M6XA 2JHEA 3VQPA 2OPPB 4HKQA 4HDGA 2FBTA 1RT7B 3TOQA 1BE4A 4YR3A 1UJ6A 3NF9A 4DR1K 4H5RA 4OKJA 1MWQA 3M2VB 3W1YC 4JKHA 3FSYA 4CGJA 2GJ2A 4ZVUB 1D9FA 5DMRA 4F4AA 3NH0A 4FYYB 1HNZK 1RADB 1HBNB 1RTHB 3M9MB 3FQKA 1PG5B 2MZTA 3ZEUB 5JLFA 3JTNA 5M2UA 4DUYF 3DCAA 2W4PA 1EETA 4CD3A 2APOA 3NF7A 3W62A 4J9UE 3OYKA 2W9BA 5FPMA 5HOOA 3ETOA 1R0BG 5FD1A 5AJ3K 3GSDA 3M8QA 2G0IA 1YJ9S 3ZSRA 2W2MP 3NAIA 3BP8A 4DZ6A 2CPDA 1UWBB 3L7PA 2KO1A 5FPNA 2R4FA 2ZH8A 3LWMA 3OYDA 1Z05A 3T1HK 5B7WA 1QDUB 2O01C 2P9IB 4OX7A 3SV3A 1JLCA 1KFSA 2CWKA 2B5JA 4BHQA 4OLAA 4X4NA 3LOUA 3DLRA 5AR0A 5AQLA 1XNRJ 4IOCL 5A2QO 3P4UB 4BGAA 2QFIA 2ZH1A 4P72A 1VQ5N 2ZHOA 3KG4A 3ISNC 3F9KA 2Z2MA 4OYPA 4CJFA 3MM8A 2OPQB 2LLZA 2A41A 2HNZB 4ES3A 4DL4A 2EBGA 4BE1A 3R5CA 3UW1A 2DFFA 3IWNC 4A8FA 2L9DA 4JD2B 3HJVA 3NGTA 1JLAB 4M3ZA 3H25A 2VDIA 1FKPA 3AO3A 3ZXWA 4RBUA 1L3VA 4H0YB 1VISA 4O3PA 1V3RA 3TAQA 1NLVA 4F50A 1U48A 5I42A 1KOHA 3B6BA 1T9UA 1RTDA 3ITHB 3HSDA 3JSBA 3R5AA 4W5RA 3CCLN 2MB0B 1YJ9N 1IM4A 1KNZA 1T05A 2VQFF 3AA4A 3GTYX 2VA2A 2Z56B 3KJNB 2YV0X 1H2VZ 3DHXA 2YNHA 4HR2A 3RAMA 2ILZA 4CEOA 3LZJA 3MECB 4RW8B 1HKAA 1WF1A 3DLJA 2R2RA 5KFIA 2XMVA 1XMQK 3U9DA 3FRZA 2D9OA 5K8MA 4YOUA 2U1AA 3M30B 4ZVEA 3QJLA 4A8YA 1WC4A 1B7FA 3CDBA 3ITHA 4FJ5A 4CESA 3QIPA 1J5EK 1S77D 4KGKA 4KAIA 1J5OA 4JI4F 3BQ1A 2R9LA 4GC7A 1QHAA 1RZMA 3HPHA 5J2NB 2J9DE 1XC3A 4C3KA 3FCWA 5AQOA 1HJOA 2D0CA 4RNMA 2EFOA 1X7VA 4LSZB 1PJ6A 1DBDA 2OZSA 3FEYB 2VG6B 1ESVA 4FLUA 3NMUA 1QS4A 3A3PB 2XGPA 5HMZA 2FLOA 3MF5A 2MZSA 5HLFB 3R9PA 3O5BA 3UCGA 5DGBA 2DNRA 4F26A 3OL7A 4B9VA 2IYGA 5K9FA 2MMYA 1RSCA 1SKSA 4LC9B 4JS5A 3IG1A 3GFZA 2V69A 2RQ4A 1PYOB 4CE9A 1VIOA 1RT6B 1IM6A 1KLMB 4CZIA 5KOXA 1TK0A 4ID8A 1NK4A 1NGFA 1KQSR 3CETA 5C2FA 3UQSA 2NRRA 1Q95G 1NJIO 1KVIA 2AD9A 1QVFR 4ZP9A 5GVQA 1O6XA 4CLPA 1V6HA 1VI7A 4F25A 2HHHK 8RUCA 4OI0A 1WELA 1NJYA 3A4TA 5DRKA 4NZ6A 4W5OA 3OPKA 1E4GT 2A6AA 4CHOA 2H5IB 1T9TA 2YX7A 1CS4B 3IBWA 4ED1A 3FFIA 3DXBA 3CPWM 5DM6Q 5ETVA 4DQRA 1IKXB 3I6PA 3D1OA 4E19A 2QX0A 5ETRA 3DRXA 2DNOA 1SJRA 3C65A 2BX6A 1YI2N 4C3MA 4Z4IA 5KFFA 2AJFE 4DTXA 1OSCA 3VERA 5GAHP 2YKAA 3P8BB 1OH6A 2VUGA 2V52B 1ZAVA 1FRHA 3EKUA 1PC5A 3CDEA 2JSXA 4CLSA 1IBMK 3GCWP 3VEWA 2YHYA 1HKCA 4DKWA 4KQZA 4CT9A 1FXXA 5I42B 2CFXA 3W9JA 4RW4B 4GVBB 2G1HA 1WORA 1OIAA 3C14A 4DR7J 4EP5A 4ZK7M 4QW8A 2PGCA 1ICEB 5FLXY 4YQWA 2AQ4A 4M5JA 2YH0A 1RBOB 1JQGA 3QZ7A 5B0BA 4YB6A 2ZNZA 4ISFA 3H2LA 5HLFA 3FMBA 4H4OB 3GCXP 1B7YB 3BKTA 3IAM9 1X3NA 3A12A 2NLWA 4PYDA 3TJAA 2KW4A 1U1LA 1DTTB 3U1MA 4NLVA 3HHLB 3ULEB 4UUWA 4ID5A 1TMMA 2HMIA 4CF9A 1SC3B 4G6VB 2BA9A 2AYEA 3GDQA 1RAFB 3KLGA 1XEZA 3EL2A 1SJ1A 4YDUA 4J91A 3QESA 5J2NA 4OLPA 2W1BA 4BRQA 2AU0A 2BM1A 2E66A 3DGPB 1GXTA 4Z4FA 2YWKA 5H1SQ 2CXEA 3AODA 3R7BB 3DOLB 4NLOA 3I0RA 1QTMA 1Q82O 4BGBA 5I3QA 2IC3B 1X60A 5GAEI 3GV5B 3MX5A 3I56N 4Y2MA 7FD1A 1RILA 4LMZA 5F3ZA 5AQXA 2YKNB 3HF5A 2W2OP 1DURA 3VQ9A 2V8HA 4EHTA 2QA4G 3GFHA 3EE8A 3VQTA 4X62J 2QA4N 3CJ9A 2YHAA 2DRBA 1AA1B 3Q0AA 2SXLA 2PFFB 4HLBA 2DPIA 4C0HA 1A7GE 3BV8A 4LQ9A 2PMZD 1CQNA 3VR1A 3KIOA 1HLWA 1QE1A 4BREA 1CZ9A 2OTLS 3QIOA 1VRTB 1NOYA 1YHQS 2XHCA 4AT1B 4KSEB 2B4PA 5C42A 1NK8A 1OVYA 4NLRA 4BCAA 3D6HB 5FRNA 1B0TA 4H4MA 4QR0A 1IV0A 1UA0A 2PC6A 1XMBA 1CZAN 2QN6B 4RWTA 1HKGA 3QERA 1TUVA 1ULRA 4O4GA 1B3TA 3DXKA 3D68A 2XQCA 1UAWA 3QEPA 1JJHA 1S1XB 1S9EA 3D0IE 3HYFA 2BANB 4FF3A 4ZPWR 2DY9A 2IOCA 4WCEQ 4KGZB 2UU9J 3I56S 4K0KK 3D4JA 2ZH9A 2GVDA 1OO0B 1RDWX 1QY7A 3AO2A 4DFKA 4F9OA 1RBTA 3US5A 1SZ2A 4QS7A 3MOZA 1GTHA 1U6ZA 4IOXA 4H03B 3KNAA 3G82B 3O9UA 4LF2A 4ATNA 1WC3A 4YB7A 2DHGA 3LP1B 1I39A 4LF4K 4JHDA 1IBKK 2MYFA 5AE2A 3GB0A 4ECVA 3H59A 4DN0A 1RWWB 3R8EA 1XR5A 4TU8A 4LBHA 2GZOA 1HI1A 4ICLB 3KG1A 4LF8K 3U1LA 1ZZNA 3AOAA 2IBKA 4WU3A 4ERDA 1ZBSA 3QEWA 3SQ0A 3MZIA 2R7RA 1CXUA 4ED5A 3S8SA 2B4JA 1NUEA 1P9YA 5J1EA 3AVJA 2FJDB 1A5WA 4PWWA 2DD8S 3A5NC 1ATNA 3K58A 4JHDB 1C1AA 4CFDA 2YXLA 4A8KA 1X1PA 3VQ7A 5GMDA 1WF2A 4PABA 3O9TA 3GG1A 1VQNN 1ZM4A 3QIDA 4A62A 3CCMN 2FZGB 2E5GA 3AVBA 4J9LA 2Q3SA 3Q22A 1PC4A 2WB4A 1JCFA 2Z30B 1RAEB 1YJUA 5F8GA 4J9PA 3FFKB 3THVA 3TPQA 3LW5C 4QOTA 4KTQA 2IM1A 4B3TJ 3BGOP 3NCIA 5CD4A 2HQGA 1TUYA 4CF0A 4BRKA 2IM3A 4CEDA 2QK9A 2AMCB 1S1TA 2E7XA 5F8IA 3KK3B 2UV8A 2O8DB 3KLHB 2GCFA 1D1UA 3PW0A 1HBOB 2PA3A 3PVXA 3OUYB 4DR1J 4CHPA 1FRXA 4ZA1A 2P9GA 3UVJA 3QBXA 3U27A 3WXJA 1S99A 5AE3A 3PUFA 3SK3A 1DQ8A 3OXGA 3HFVA 5DDRC 4DV2J 4F2SA 2JC1A 1FCAA 3EDQB 5D4LA 1UKUA 3S3OA 3VGUA 1VFJA 1ZBIA 2I0XA 4IEEA 3BN7A 4CHQA 3QBCA 1NK5A 1E4FT 3QFWA 5AQJA 4UW2A 1NJZA 3F0NA 3HM8A 3GYNA 1KAZA 4K4UA 2MLZA 3U9ZA 4PKGA 4DV6J 1TV6B 3P38A 3G8TA 4FS1A 3UKRB 2JFDA 1WOSA 7FDRA 2OD4A 1BGXT 2YNGA 2R7TA 1HW8A 1VSHA 4CZKA 1XNQF 4LSNB 3DGVA 3ZCMA 4AL6A 1XBWA 4CJEA 4YOEA 3VAGA 3AD9C 4ECQA 1VQ4S 5CCLA 2MY8A 2CNNB 1A5XA 2KFNA 2LEAA 4BRPA 5C7PA 3KMSA 1URRA 3Q86A 5HP1B 2MQ8A 3ATUA 5CA5A 1AUDA 1T7PA 4LF7F 2JVOA 4WBFA 4CH7A 2BANA 4ILMA 1JLFB 2D1CA 5GAEP 1UTAA 3CCQN 2QWMA 2FJXA 1LW0A 5KTQA 2YHWA 4ZDNA 4CNYA 2VG6A 1O13A 2NR0A 1NK6A 5LL6Z 1Z26A 3AH6A 1T6DA 3EVOA 1BWEA 2WK4A 3G71S 3AA3A 1YSJA 1R0AB 4Y1CA 1CSJA 2ASYA 1OMSA 2ZJQL 1HYVA 4BC3A 4F0HA 1AW0A 2IJNA 3O4QA 4F0MA 2E1CA 3SDEA 2DH9A 1T9XA 2VWJA 1NSPA 1U6BA 4NYPA 2CPFA 2PD1A 1N5TA 3AXKA 4OX9K 2UUWA 4IO9Q 4X4PA 2ZZMA 2IIRA 2F1FA 1Y64A 4H5VA 2GAGC 1JLEB 2E2OA 1ELOA 1UVKA 3Q7CA 3TA0A 3M6UA 4X65F 4UT4A 4WU2A 2MKCA 2FC9A 2M9KA 2RUGA 2ZWHA 5E3PA 1AB8A 5FJ4A 3KDNA 4W4MA 2D1KA 3L09A 4WK1A 4X4SA 4ECYA 3WDOA 4WE1A 5HRRA 4BQLA 1HNWJ 3ONQA 3AVGA 3DKDA 3NNHA 2VGNA 4OQJA 2DR7A 4BRNA 4RO0A 3TVKA 2HHPA 3IXQA 4K42A 4ZJQA 1S6PB 3THXA 2XTJP 1YRTA 1T11A 4MDAA 1YQHA 2G8IA 3JQKA 4OPAA 4FN5A 3DDKA 1WSRA 3FR0A 1KS2A 5E33A 4IFYB 3IBFB 4C7QA 2M5YA 4IFYA 3OYBA 1RAAB 2CPYA 4DR7F 3FKBA 1I51B 1C0UB 2EI5A 4KE5A 2KT3A 4ALZA 4BRMA 5CY4A 5HRNA 3TAMA 3LPUA 1HMVB 3UDLA 3HZ6A 2IDLA 1BD6A 3WBZA 1NKEA 3QQCD 3J81Y 3UFCX 4M45A 4CZGA 5ETNA 2Q2RA 1X5TA 3CIMA 4RNHA 5JVHQ 4CLTA 3V4IA 5E3QA 2IBOA 3ZT0A 4UTGA 3DYAA 5DM6L 2EBEA 4DL2A 3O08A 5BPNA 1HNZF 4M5KA 1MROB 3AGKA 2D0BA 5DZ6A 2GV9A 3MOJB 1MLAA 3OD2A 2P9UA 3ALYA 4RBTA 1S48A 2ATCB 4H0PA 3IRXA 2HOEA 2COLA 3DLLL 4CCHA 2XYHB 2C1EB 6FDRA 2AJ4A 3M7VA 1SH2A 4G1QA 3R1LA 3T9NA 3HHNB 4L72B 3QEVA 2LQJA 2ITGA 2GQCA 5D3GA 4ENOA 2VG7A 3FLCO 3HCXA 3WHIA 2D0PA 3O3HA 1F1BB 1RB0A 1HYZA 1VBKA 4WK3A 4Z94A 2UXCJ 4DDFA 3QT7A 3G25A 3KLFA 2V2ZA 2YKQA 3OL8A 2DHHA 4N47A 3J7AN 4U95A 5A0YB 2C3UA 3B6PA 5J2MA 2QWQA 2G0JA 3SIPB 4HACA 2C28A 5D3GB 1C0FA 3AD7C 4EK2A 4MTPA 4KHQA 3QSIA 1LNQA 1B70B 1VC6A 5KI6A 4JV5K 3KK2A 4L3NA 2JVRA 3GJSB 1TP7A 3PKMA 1Q5YA 3DM2A 4IO1A 3EVMA 1RT2A 3T1YJ 3EYZA 2DPJA 3SUNA 2ADBA 1EB0A 2V94A 5DG9A 3ZZTA 2CNKB 2U2FA 2DIVA 2KVQE 3AQPA 4F7VA 3VAJA 1ZS6A 2VWBA 3G86A 1CC7A 2AX0A 1VQ9N 5HROB 3UN5A 4AHUA 4QIFA 4JI7K 2VQEJ 1CJUB 1R8BA 1IN0A 3MMBB 1EQYA 2VC0A 4HVZA 1IBMJ 1TELA 2HPUA 3H8YA 4L3QA 2B8PA 3OYIA 2QLJB 1T0TV 3PFEA 2W25A 1FJEB 1B64A 5LSOA 1HWIA 2IVYA 2OTJS 1Q4RA 3M8QB 3BZQA 5ITHA 1X4GA 5KFVA 1SVDA 3WIUA 4OO1J 1Y9OA 2G8UA 3TUIC 2V8GA 5FLXU 3ZEUA 3TWHA 5AFUH 4USHA 2DXEA 4DPXA 4IH7A 4CO3A 3UNGC 3VEXA 1AZSB 2Q36A 1WEZA 4XH4A 1AFJA 4JOUA 3HRGA 1XMOK 3ID6A 4GW6A 4QIWD 2KT5A 3ENQA 4LUBA 5KFHA 2RMLA 3BGRA 3M8WA 2P6TA 4MYUA 1VQ7N 5KG2A 4DV7K 2CNLB 1RDBA 1QJHA 2QXFA 3VQAA 3BF3A 2MQLA 1HBMB 4PQAA 3CHWA 2V0NA 3P83D 1S1VA 2E6LA 3J80U 2JEIA 1R89A 2FDNA 2CVEA 4DX6A 4H0TB 2OAUA 3L2QA 4M8LA 1D9DA 2UV8G 3IDHA 5CE3A 4NPOA 1FRLA 2K06A 4GY2B 3ILJA 4FXDA 4IZ9A 2W24A 2LFVA 1VYAA 4NLUA 5M1PA 3H90A 2FTRA 1HARA 1Y00A 3M2UA 5DJBA 3GR0A 5K8NA 3A3OB 3MK6A 2HBRB 2A18A 2HK3A 5C2CA 1C0TB 2MGZB 3DI6A 3OR2A 3TEGA 1GLFO 1NH7A 1ROFA 4FDFA 3KJVB 3KZBA 4U67L 3J80O 3T1AA 3IAS9 5D6GA 1T3NA 3AVCA 1BISA 4DUYJ 2EKNA 2J5AA 4OX8A 4CJ7A 1VLOA 3E9OA 4O44A 4I56A 2PDAA 3RSEB 2VPWB 1IR1A 3UB5A 3GR1A 2XMJA 2WBNA 1WG5A 4QZVB 4CTAB 2E1ZA 1M1KO 1LWCB 2MXYA 1BCMA 2OTJN 3MM7B 1VQYA 3A5OC 1FTRA 5E26A 4YB5A 4JI5K 2IIHA 5CABA 3QGIA 1Q1KA 4OHYA 2W7OA 2IVMA 3OYHA 4O5FA 3TW0A 3RTVA 4LFBJ 2G8VA 3LP0A 1Y4ZB 2A1RA 2RF2B 4J2EA 4RW9B 4CJWA 2GV1A 3SSRA 3QNOA 4FWPA 5KQDA 2ZH5A 3G10A 2CPEA 1KVBA 1T3OA 3VGSA 3CCRN 2VBXA 2E1PA 4DR2J 1T03A 3BGFA 2CWXA 4BRGA 4ZOSA 1FRJA 3D0PA 3BDPA 1RBVA 3E8OA 4C98A 2F40A 1N48A 3LP0B 4FZVA 5DK5A 2HS4A 3AJDA 4HEA9 3KYLA 1NSKL 2XI3A 4YY3K 4YOYA 3MUVP 3UCZP 2LDYA 3OTEA 4DWIA 1N8RT 4M3RA 3B6OA 4NA1A 2GVZB 3HOSA 3CFPA 1NGBA 2GFFA 3UKUB 2HEKA 3W5XA 3MR6A 3UKUA 1Y5NB 2RS8A 2W42A 2BTFA 1BQMB 4YB1P 3R1XA 3PSIA 4CBWA 2RUSA 2P5VA 4FW2A 2XMWA 4F0KA 4CYUB 3QMLA 1XERA 2RH3A 2MSSA 2XLIA 4B3TK 4A46A 1SH3A 5AQQA 1LWFB 3MD1A 4B9QA 4B1YB 1NK0A 1FRMA 4DV0F 2F4FA 3IS9A 2JLEA 2RHSB 5BRFA 3MMVA 4O3RA 1Q7YT 4X64K 2W9CA 2N7YA 5HVGA 1RAIB 3G6YA 1E6YA 3CCJN 1VSLA 2X3DA 3MMAA 3RG6A 4YN3B 3HD1A 5DQHA 1N56A 3OJUA 2VL1A 2G2YA 5HMXA 1XC9A 4QU7A 2IM0A 4ZJLA 2HAFA 5B0DA 1E6VA 3GMGA 1C1BA 5JVHL 1F5CA 5DQIA 3K9JA 4IOAL 2R8HA 2AZ3A 4A8OA 1M5OC 4CJUA 3T1HF 1HPZA 4LF1A 2B9WA 5KPRA 3EM1A 3ZTOA 1U6FA 3LL3A 5B0AA 4U9RA 3V1RA 5CZ2A 1X0FA 1IBMF 2BE2A 2XG8A 5H9EJ 2VOPA 2NRZA 2V6AA 3TTFA 2ZFHA 1GK8A 4QU6A 3DMJB 1N88A 4CF8A 4M42A 4YHHF 3DOLA 4IXCA 1VSKA 5ADXH 2B8QA 2ZOFA 3CNQP 2GUIA 3HFZB 4DR4K 2A6OA 1AZSA 1N6QA 4DUZK 1YX2A 2YPZA 3T5LA 3AOBA 3HO1A 3MMJA 3F44A 2HSTA 4DR6K 5LSLA 1RJJA 4Q8EA 4BRHA 3FUYA 3RMBA 2NRHA 2OH2A 2D3OR 3ZTQA 3BYPA 4DTJA 4H5TA 4GKKF 2E5JA 4TXSA 4DL0C 4OGCA 3LM9A 3UPFA 2KDOA 1KOOA 3BBFA 4KYZA 4CHZA 3C6AA 1UEKA 2K1RB 1DZ5A 3PJXA 4I67A 3CF5L 2KJVA 3N01A 2N4CA 1K1QA 4F4YA 2MGZA 4EZ9A 2EC2A 4ZPDA 1YT3A 1IKYA 1D9AA 2R8GA 2OKQA 3W9HA 4C8YA 2R2TA 2I7NA 1IR2A 1CS4A 5HQ8A 5E3CA 2G13A 3EE3A 2OEMA 3MUTP 1VSDA 2JX2A 2W4CA 4ED2A 2HVEA 2XZWA 4YDUC 3SJJA 4LF6F 3BPSP 2YNFB 1ZBHA 4CEZA 4WJBA 3O1LA 2FHMA 1PGZA 2N4DA 3SQ4A 1B4SA 3H7HB 2MEWA 1XIQA 3AA2A 4B3OB 3SQGA 1CXQA 3VETA 5J2MB 2ZGZA 4EYHB 1GLAG 4KY3A 4KH0B 4PL8A 5KFSA 2LKZA