3FFIA

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
553
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 151
structure length 549
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ffiA05
5CYMB 1SL2A 2W8LA 4XPEA 1SH2A 4Z0UA 3PW5A 3DOLB 2V9WA 1RCHA 3LP3A 2AGQA 3IGNA 3M8QB 3AO3A 3NH2A 4MIBA 3KJVB 1N56A 3DYAB 3RMDA 5J2MB 4G1QB 3HSTB 4BE1A 4KHYA 3RB3A 3V6JA 2UUTA 1T8EA 3G0ZA 3NGDA 3HVRA 3S9HA 3C6TB 1U4BA 4DTNA 2BANA 3HO1A 1F21A 3QYYA 1FKOA 1JLCA 4NLPA 1RDDA 1JLFB 3UR0A 3OYGA 5CY4A 3OLBA 1C0UA 3KHLA 4IOBA 5KT7A 4DSFA 3M9MB 3ALYA 4W5NA 4KTWA 3ZT4A 2X6NA 3CJ2A 2B6AA 4KFBB 4CF9A 4DQRA 1KTQA 5KT6A 5FDLA 5KG1A 2W9BA 1BQNA 5KFKA 1WAFA 1TL3B 2Z1HA 3VQ7A 3L3VA 4CJ3A 4H54A 2DFEA 1ZBIA 3P5JA 3KLGB 1TV6A 4CGDA 1RNHA 1JL2A 4FYDA 4DWIA 1UWBB 4PA1A 1YVFA 1ZBHA 1RBRA 1QAIA 3KLVA 2HAIA 1JLQB 3D0PA 2KZZA 1HRHA 4YMEA 1S1UB 4KE5A 3PUFA 4YNQA 3KKRA 3BJYA 5KG7A 4CIGA 2XCAA 3SUNA 4Z4HA 2Y1JA 1C1CB 1TL1A 2YHAA 4EYHB 4HVJA 4ZVFA 1JIHA 4MK8A 1S9EA 1ZTTA 4YR0A 1IH7A 4O4RA 1C6VA 4Y1DA 3B6PA 4OPJA 4OKKA 2OPPA 1T03B 3QO9B 5KFNA 3RTVA 2ASJA 5K14B 2P1JA 3B6OA 4PQUB 5EU7A 5JUMA 2JLEA 2R8KA 3OVNA 3DLHA 1I6JA 4YFUA 4FJKA 1UOCA 1K1QA 4ECVA 1JXBA 2WOMB 3N6MA 2HWIA 4MIAA 4U6PA 1JLBA 4G3IA 2WHOA 2R2SA 3LP0B 4KV8A 5C24B 1N5YA 1RT3B 4B9TA 1KHWA 3GIMA 3DRPA 3TABA 3DRRA 2DTUA 4O3OA 3PJWA 3HK2A 1T05A 2IJNA 4CIFA 3BSNA 3IRXA 4FLZA 1KHVA 4ECQA 4FJNA 3LALA 5KFFA 4K4WA 3H2LA 1HQUB 1LW0B 4FZXC 1TAQA 4C8MA 3LP2A 3DLRA 3CM5A 3K57A 3MTKA 2D0AA 2C2DA 3H40A 2DY4A 1TAUA 4RW6A 4AHRA 4TLRA 3CFOA 2W9CB 4DG1A 4O3RA 3DOKB 4CEAA 1TP7A 1WSFA 4Z4IA 4IRKA 3NAIA 1JLAA 2C2RA 3THVA 3NBPA 2HVHA 3G6VA 4CJ4A 2XI2A 4PWDA 3H98A 2BR0A 3OHBA 1FK9B 2D0BA 4M3YA 3FFIB 4AH9A 2AX0A 5C25A 4CIEA 3OJSA 1DLOB 2HNYA 4XO0A 1RT1A 4KO0B 3TAQA 4B3OB 1WSJA 1QSLA 1TK8A 3LPUA 4DS5A 5T7BA 3T3FA 4WE1A 3AVIA 2YNHA 5KG4A 1MU2B 3BSAA 4UQGA 4J2BA 3GV8B 3CQ8A 4DS4A 5I42A 4RW8B 4LY7A 2BE2B 3T5JA 1L3TA 3HP6A 2YKNB 1QQCA 3KHGA 3NFAA 1TKTB 1LWEB 3KK3B 4MFBB 4Q8FA 2RDJA 1UA0A 2KFNA 1J9AA 3KHHA 1R0AB 2JGUA 4K8ZA 5HROB 1C0MA 3HJFA 4QOZB 4ECYA 2W42A 4DTPA 2C22A 2QV6A 4ZPDA 4J2EA 3MEDA 2R8IA 4FS2A 1NJXA 1S5JA 4DSKA 5F8JA 3ZT3A 5KFOA 4FJLA 2VWJA 1NHUA 2E9ZA 4KSEB 4DQPA 2BANB 5CYQA 3VN5A 3QEPA 5DMRA 5HBMA 3Q8SB 1U09A 2X6SA 3BSCA 3CJ5A 4CJ5A 4Q8EA 2XRIA 3IS9A 3RMBA 1BGXT 2UVRA 4IKFA 1L3SA 1KCFA 4O4GB 4CJVA 5KFQA 3CFRA 2IM3A 4DQSA 4OGEA 1S49A 4KHRA 3TI0A 1S97A 1TKZA 2WONB 4NRUA 3SCXA 1NKBA 2VG5A 4RW9A 2HHUA 1C1BA 3SZ2A 4K8XA 2RKIB 1DTTA 2W9BB 5CZ2A 3LWMA 3ZSYA 4CHNA 3NAEA 1CZ9A 2QK9A 3NL0A 1IKVB 5EWEA 1Y97A 2UVUA 1J54A 4FLYA 4CFAA 5F8NA 4DSIA 3OSPA 2OPQA 4F4YA 3CIZA 4I2QB 3K58A 1VSEA 4L8RB 5EUHA 1RTHB 3V9SA 3QEIA 4EZ9A 3V6KA 1WSGA 1D0EA 4OLBA 1RT6B 3AA3A 4ID5B 3KD1E 1FKPA 2RPIA 3MXJA 5DGBA 1REVB 1NOZA 4N47A 4J9MA 4CJEA 3LZJA 4E0DA 2ASLA 3S3OA 3OYDA 3OYLA 5DK5A 5HRNA 4FJ7A 3HVTB 4JUZA 3QETA 1CXUA 1YTUA 5F8LA 1L3VA 4LH4A 5D3GA 3PV8A 3AO1A 5F8MA 3H4DA 1GX6A 3SI6A 4J2AA 2KW4A 1QUVA 3HPHA 2HHQA 3GIJA 2IM1A 3K5NA 1JLBB 3HL8A 1S1VA 3RR7A 1EXQA 1RA7A 4JV2A 4Y34A 3PO4A 1BCOA 4FJ8A 3PZPA 2AGPA 2ETJA 2ILYA 1T94A 2HNZB 3MEEB 1NOYA 1BL3A 5KT3A 1Z26A 4IH6A 3DLBA 3SJJA 4O3PA 3TANA 4Q0BB 2GIQA 4IR9A 1O1WA 3V81A 3WNEA 2V0NA 2FLPA 4LSNB 4EEYA 3RB6A 5KFLA 1XHZA 1ZTWA 2E6LA 3RAQA 3VQCA 4RW6B 3G6XA 3IG1B 5KTQA 2FVRA 3P83D 4BWJA 1FXXA 3RMCA 4TN2A 4OJRA 4ZPAA 3NBPB 4FJ9A 4NYNA 2A1RA 1BIZA 4NYFA 4DQQA 1ASWA 4IR1A 4F2RA 4QW9A 2G8IA 4GMJB 1DTQB 4JS5A 3CG7A 5J1EA 3L8BA 3GILA 3LP1B 3OYKA 4J2DA 3AO2A 1BQMA 4Q45A 3HKWA 1S1WA 3I0RB 3M9OB 3NH1A 3I5BA 4URGA 1RBVA 3MEGB 3M8SA 3QIPA 3KLIB 4YR2A 3DMJA 4ED2A 1QHTA 5DQHA 2HMIA 1KVBA 4ZP7A 3CJ4A 4Y1CA 3OJUA 4RNNA 4ED8A 5J2QA 1I39A 1LAWA 3KLFA 1IKYB 2XHBA 5HRSA 4R8UA 3SNNA 2BQUA 3ZSXA 3AO5A 2ZE2A 4R5PB 2AU0A 2F8SA 2HHVA 2AX1A 1KSPA 3DRSA 3CDWA 1QSYA 3V9XA 1JLGB 4HCBA 2IGIA 3SYZA 2FC0A 3BDPA 3VQEA 3CDEA 4F3TA 4FM2A 4ZP6A 4RW7B 1G15A 4NZ0A 3SFUA 1HPZB 4FBUA 4F4WA 4FJHA 4FJMA 4LH5A 2HW3A 1K1SA 2LSNA 3E51A 1S9GB 5J2NA 4WXOA 3QZ8A 4DF4A 1IKXA 3SUOA 1A5XA 2OZMA 3KMSA 4URQU 4CHPA 4DL6A 2A1SA 4Z4EA 2BGGA 1J5OA 3M8RA 3PR4A 4K4YA 1RDRA 4IG0A 5JS1A 5FRNA 4NCGA 1ASUA 3ITHB 1VRTA 2VG7B 4IFVA 5CYQB 1S4FA 2Y1IA 3IGVA 2I5JA 5KFIA 2QXFA 3E01A 3IS9B 2BDPA 4F50A 1TVRA 3GV5B 3SQ0A 3H5SA 2XY8A 3NKYA 1S6QA 4M3WA 3HT3A 1TKZB 3QZ7A 3GIKA 1WSIA 3KK2A 4KRFA 2CKWA 4KAZA 4DTRA 4O0JA 3ZT2A 2YV0X 4DFMA 5DG9A 2UVWA 1NKEA 1LWFA 3NMAA 1RT5A 5I3UA 4IBNA 2HNDA 5KT5A 4C8OA 1HMVB 4KBIA 1BI4B 1VSFA 4OGCA 2OPQB 1TKXB 3TAMB 2ZD1A 4LD0A 2D5RA 3BQ2A 3TAGA 4MK7A 4KTZA 2RDIA 2FJXA 1SKWA 4EBCA 4JLHA 4CFBA 3V9UA 3P1GA 1QTMA 4W5RA 5F8GA 4I7FB 1Z25A 1LWCA 3CYMA 3OYMA 4B9LA 3GQCA 2AWZA 4YR3A 3EPGA 4FJGA 4F3OA 1RDBA 1EKEA 1HJRA 1UAXA 1RA6A 3U3YA 4K4TA 2FVCA 1C0TA 2RF2B 4E1NA 4CGGA 1XC9A 4O44A 3JSMB 3ZT1A 4I2PA 3SFGA 2VG6A 4DFJA 3CO9A 4H4OA 1S1TA 4F4ZA 1TGOA 1S6PB 4DTSA 1RTDB 3EPIA 3TAFA 3V1RA 3UIQA 4WFXA 5F8HA 5HRPA 4NLXA 3ZSWA 3OL8A 2YNFA 2XY6A 3S3NA 1RYRA 5JXSA 4EBEA 3DLGB 4OPKA 4LSLB 4IQXA 5HLFA 2KTQA 1KLMB 2NUBA 4E89A 4EP4A 4IG3B 2D7SA 4OVLA 3Q8RB 2R2TA 2AJQA 3RR8A 3NF7A 4FLVA 2W7OA 2R8GA 4WZMA 4W5OA 2FBVA 3AVKA 3DI6B 4DFKA 4QWBA 2WTFA 3QNNA 1S1XB 3V81B 4TY8A 4TYAA 3KLHB 3V6DB 1HNVA 1RYSA 2VA3A 2HHSA 3NCIA 4DTXA 2O5DA 4ZVGA 4K50A 4IH7A 1SUQA 3AVFA 3CDUA 3KK1A 1EP4B 5C42B 2R2UA 4PUOA 5F8IA 3NF6A 1RTJB 2D0CA 3SV4A 2Z1GA 5L9XA 1RDAA 4B8AB 4CE9A 1KLNA 3AVLA 1VSIA 3N6LA 1XI1A 3ISNC 3CVKA 3UQSA 1LW2A 3O4QA 4RG8A 3RMAA 3BR9A 3JYTB 4M3XA 1RBTA 4Y2AA 4RZRA 1ASVA 3HHKA 3N6NA 1BHLA 3MECA 4OL8A 1A5VA 1A5WA 3O3FA 5J2PA 3DLKA 5L1JA 4DFPA 2PYLA 3OYHA 1Q9YA 1CLQA 2AGOA 1KVCA 4R8UB 3NGYA 3M8PA 4GC7A 2XY7A 1GOBA 1HNIB 2G8VA 2ZE2B 4J9RA 1S48A 4CEOA 4ZMMA 3D5MA 4KB7A 5E41A 3H5XA 1Q8IA 1VSMA 1RT7A 4CEQA 2OPRB 4ZVHA 1T7PA 5KT2A 4M95A 3OYCA 4DF8A 2FVPA 3K2PA 5J2NB 4B9NA 4MKAA 3QESA 2JEGA 5SWMA 4ZTFA 2YKMA 2EC0A 1ITGA 2EX3A 1VRUA 1EETB 1VK0A 3KLEA 3O3GA 4IG0B 4Y3CA 5DGAA 3FSIA 5EDWA 4QCLA 4NCGB 3ZSVA 4RW4B 1JL1A 3TAPA 3KTQA 1HYSB 2I5JB 3RB0A 1JLEB 2E9TA 2CJQA 4WXWA 4DU3A 5FROA 1RTIA 4NLYA 2AQ4A 2J6SA 2IAJA 1XWLA 3VQSA 3K5MA 4KHNA 4CEEA 1TKDA 3KK2B 3MR5A 3AVHA 3SUPA 3OYIA 3BSOA 4KI6A 5KG3A 3H59A 4KKOA 1LWFB 2FBYA 4NLRA 3AVJA 1FKOB 1CZBA 1RILA 2YNGA 1JLCB 3GYNA 3DLEA 3CWJA 4E7JA 3VQDA 1C0UB 2IC3A 4H4MA 3OYFA 2XY5A 1GX5A 3D28A 3PW2A 1I3AA 3K5LA 2B6AB 2W7PA 4IFYA 3G10A 1HQEA 3H5UA 3NH0A 2J6TA 1VSJA 2R2RA 3CJ0A 1NK6A 5T14A 3SQ2A 5CYMA 5FDLB 1BQNB 3CFPA 4N5SA 4WZQA 1TV6B 3F9KA 4CK3A 2HHXA 4KB0A 2ALZA 4CJLA 3HM9A 2HHWA 3TVKA 1B92A 3DYAA 3VQ8A 5J2MA 2PYJA 4G1QA 1NK9A 5DG8A 1VSKA 4O44B 4IH5A 1IO2A 2V4RA 4I9LA 3LPTA 3PY8A 1SH3A 4CEZA 3MAQA 4JV1A 3C6TA 4DL7A 4J9LA 4BDZA 4URSA 2GC8A 1SV5A 1TL1B 4ECUA 1JLFA 2ATQA 2ITGA 4O3NA 2KQ2A 3T1AA 1S9EB 3TARA 3AVAA 2B5JA 4KI4A 1IKWA 2OPPB 3AVBA 3Q8PB 1Q9XA 3L2RA 4EBDA 3ZSQA 2X74A 2UUWA 4ZP8A 2PZSA 5DG7A 3VA0A 1TL3A 3PR5B 1VSLA 4B9MA 3KLGA 4LQ9A 4DL5A 1T3NA 4FLWA 4W5QA 2JEIA 1ZBFA 3VQPA 4KV8B 1N5YB 3EYZA 3ZSOA 4Q44A 4RNHA 3T5HA 3QIOA 2C28A 1SUQB 4CGFA 3DRPB 3VQ4A 4FZYA 3DRRB 4QWDA 1S1UA 2DFFA 1T05B 2ZKUA 4K4ZA 4M42A 1NK5A 3IRXB 4W5TA 3V6HA 3C94A 2P5GA 4EP5A 4EO8A 5KI6A 4BWMA 4R0EA 3K5OA 3L2UA 4GVMA 3LP2B 4CEFA 4JRPA 1RT4A 4X2BA 1NHVA 4E7KA 3OS1A 5KFCA 1K6YA 4FLXA 1N48A 5DLGA 1T03A 3VQQA 3QO9A 4DG1B 4N56A 5K14A 4B9SA 4CFDA 1S0MA 3EZ5A 3SPZA 1B9FA 1KFSA 1JLAB 3C6UA 2XC9A 4CJKA 3ICLA 2VA2A 3VQBA 4PWDB 4XIUA 4B08A 4FM0A 3G6YA 3QINA 1LV5A 3M8PB 3T5KA 2FLNA 1JXEA 1SL0A 4EZ6A 5C24A 4CJRA 5KFVA 1RT3A 5C25B 4NYZA 3IN5A 1YVUA 2FJWA 4GW6A 1RT2A 3OY9A 2HNYB 1S10A 1RT1B 3AVGA 1RT7B 4Q43A 1NK7A 4M94A 3QIDA 1HQUA 1LW0A 3QGHA 3HYFA 4CEBA 3V9WA 4WE1B 4F4KA 1NK0A 4CF2A 2YNHB 5KG5A 2G8UA 1GOAA 4QAGA 2OYQA 2XI3A 2YKMB 2IBKA 3MR2A 2W8KA 4CJTA 1RAJA 4CJUA 3WNGA 4CK1A 5I42B 4CGJA 5CZ1A 1U47A 3DOKA 1WAJA 1S9FA 3TWHA 4CHZA 3GIIA 4N76A 4K4VA 4FLUA 1JKHA 1RBUA 3VQ5A 3OSNA 2BRKA 4ECTA 3I0SA 4JS4A 4FZZA 3MR6A 3AV9A 1FK9A 2FVSA 1D5AA 4KB1A 1YTAA 1RTIB 3FFIA 3PW4A 3L3UA 3PX0A 3MEDB 4EYIB 4IRDA 2DPJA 3NGIA 4M3TA 1WN7A 4E19A 4TYBA 4B3OA 2HWHA 2P5OA 4Z4FA 5KFXA 4NLVA 1SKRA 4HCCA 4KPYA 4DQIA 4ZPBA 4F2SA 4CEDA 4HUEA 4CJFA 5HBMB 2OPSA 4E7IA 2HB5A 1MU2A 4DL2A 2QKKA 2R8JA 1X9SA 3DDKA 2D3ZA 1LAVA 3MXMA 3BGRA 3L2QA 4FK4A 5KRSA 3HPGA 2IA6A 2Z1JA 4RW8A 2BE2A 5F9LA 5F9NA 2YKNA 3ULDA 4ELVA 1XR7A 1TKTA 1LWEA 1N6QA 4IFYB 4MFBA 1ZBUA 1HQEB 2VG5B 4DLEA 1IG9A 4RW9B 1C1BB 4IDKA 1DTTB 3OYNA 4K4UA 2G8KA 1X1PA 1R0AA 4MK9A 5HROA 2V4QA 2G8WA 4ECWA 3AA5X 4O3QA 3MXIA 4RUCA 4DTMA 4AHTA 4KAIA 3PVXA 4RNOA 4NLSA 3FRZA 3KHRA 3CJ3A 5KFTA 2FJVA 3PX6A 3VQ9A 4HKQA 4CHYA 3QEWA 1BCMA 1HYZA 4DSJA 1SV5B 4Z4CA 1RDCA 4ID1A 4NLOA 3LDSA 4M3ZA 1FKPB 4QWEA 4O4GA 3KOAA 3S3MA 1JX4A 3MF5A 4DTOA 4F4XA 4NLUA 4MQ3A 5EWGA 3LZIA 1U04A 5FRMA 2B5JB 4MKBA 2GV9A 2WONA 1OS5A 2IM2A 1IKWB 2DFHA 1CSJA 4ZPCA 4CF8A 5KGXA 1U49A 2RKIA 4Z4GA 3SI8A 5D3GB 3PW7A 3HVWA 1N4LA 4NCBA 1IKVA 4CJQA 3A2FA 4ZHRA 1S1VB 5KGWA 3LAMA 4OKEA 4FBTA 4I2QA 4JV0A 4B9VA 4LQ3A 3PJXA 3NGZA 1RTHA 3ZT0A 2B43A 4AHSA 4DSEA 3H08A 1HYVA 5DQGA 4B9UA 4FW2A 4M3RA 3OL9A 3I5CA 5DLFA 1SL1A 4HYKA 1RT6A 3FQKA 4ID5A 5KFPA 3HPOA 3ASMA 2OA8A 1REVA 1RT4B 5L1LA 4CFCA 2BQ3A 3Q8QB 1WLJA 4B8CA 4IKAA 2ILZA 4CESA 4ED3A 2E6MA 4DSLA 1ZYQA 3HVTA 4DLGA 4QWCA 3V9ZA 4N41A 4DL3A 4E1MA 4BACA 2GIRA 4ELUA 4NLQA 2O4GA 2JC0A 4ECXA 3C6UB 3RWUA 2OH2A 3ZSRA 1KFDA 4FJ5A 5L1KA 3QGGA 3RBEA 3MR3A 4Q5VA 4Y2CA 1L3UA 4GC6A 4AHVA 5KFYA 1J53A 5J1EB 1RT2B 1WNEA 4ZP9A 1BQMB 2HNZA 3MEEA 2R8HA 1TK0A 1S1WB 1SKSA 1NJZA 3BQ1A 1NJYA 5KFHA 3QIPB 4Q0BA 1B9DA 3QGIA 4DEZA 3DMJB 3UPFA 3OYBA 3RRGA 2HMIB 3L2VA 3NF9A 4LSNA 4FJJA 3AA2A 5J2QB 3KLFB 4KHQA 2E4LA 4ED7A 4BDPA 1ZETA 1YT3A 3ZCMA 3IG1A 3SQ1A 3BREA 3DRSB 4CCHA 5HRRA 1JKHB 1W25A 4E7HA 2HHTA 5KFDA 2FBTA 4C8KA 3U3GA 3I0SB 4J9PA 4NLTA 3RBDA 1VSDA 4NLWA 4NLDA 3H5YA 3OL6A 5KFZA 2F8TA 3KNAA 3QNOA 3MFIA 1IKXB 5KFJA 2EHGA 3MFHA 1DTQA 5KG0A 4ECRA 3I5AA 5L1IA 3QLHA 3LP1A 4HUFA 3OYJA 1J5OB 3I0RA 3SPYA 4CHQA 3MEGA 3KLIA 4F8RA 2XWYA 1KRPA 5JS2A 1VRTB 4IFVB 1X9WA 2OPSB 3T19A 4KTQA 3F73A 4YP3A 4M3UA 1IKYA 3E01B 4I9QA 4BE0A 3BGRB 4KHMA 2UVVA 2IS3A 4ELTA 4K4XA 1TVRB 2F96A 5KFAA 4R5PA 1S6QB 4FXDA 4HTUA 4AHCA 2W9AA 4NLGA 4FJXA 4HUGA 3LWLA 4ECZA 1JLGA 1N6QB 4FK2A 1NNDA 3OL7A 2ATLA 5HP1A 2QKBA 4IDKB 3AVMA 4M41A 4RW7A 4E3SA 3DM2A 1HPZA 2GBZA 4OKJA 3ZSZA 2IOCA 2YNIA 1S9GA 3EZUA 1RT5B 2DPIA 5I3UB 3V4IA 1QE1A 2HNDB 4CJSA 1NJWA 1GOCA 3TQ1A 3AVCA 2G8HA 4KHWA 2WRMA 2BRLA 3D45A 4ZTJA 2ZD1B 2JC1A 3ITHA 3OLAA 2VG7A 2Z1IA 4ICLA 4HHTA 4KHSA 4CJWA 1XR5A 4TXSA 4QW8A 4AHUA 5KT4A 3U6FA 1LWCB 1EX4A 4DTJA 3PX4A 3KMQA 2J6UA 3AA4A 3DOLA 3T5LA 3QEXA 2FVQA 3HVAA 4ED1A 1HARA 2IM0A 5C5JA 1QSSA 3M8QA 5KFGA 3OYEA 2P51A 3KJVA 5KRTA 1C0TB 4WYWA 5KFEA 4DU1A 4WFYA 3V1QA 4NRTA 5KFBA 4I2PB 2VG6B 1QS4A 4CF0A 4H4OB 4CJPA 1S1TB 2C2EA 4CHOA 2F8EX 4J9SA 1QAJA 4FS1A 1TK5A 1C2PA 4ZHRB 3QERA 5KFSA 3C95A 1HMVA 1BI4A 2YNFB 1TKXA 3TAMA 1U48A 3BQ0A 5DQIA 2XO7A 3PW0A 2XGPA 3NE6A 2HVIA 4OLAA 1NK4A 4FW1A 4K4SA 5HLFB 4KHUA 2OZSA 1TQLA 2D41A 3SQ4A 4KFBA 1BISA 4QWAA 3QEVA 2O4IA 4DU4A 3NF8A 1JXLA 4I7FA 3RRHA 4TQRA 1NK8A 2QE5A 5KFMA 1D9DA 1W9HA 2VWKA 3LANA 4TY8B 1HNVB 4C8NA 1SH0A 1UWBA 4J9NA 1IM4A 2IDOA 2RF2A 1MMLA 1X9MA 5KFWA 1JLQA 3FDSA 2XCPA 3KK1B 4J9KA 2FBXA 2E9RX 3JSMA 4O5BA 3RAXA 4PUOB 3TR8A 1S6PA 1WSEA 4FK0A 1RTDA 2ZQBA 4CGIA 3HP9A 1C1CA 4M45A 2X78A 3LAKA 4ED0A 3ISND 4ECSA 4WFZA 1LW2B 4TSXA 2WK4A 3NAHA 4DL4A 4MH8A 2GUIA 1U45A 3DLGA 1W0HA 1D9FA 4LSLA 3WNHA 3UDLA 4RNFA 1KLMA 2XGQA 2YHBA 2R7YA 1ZBLA 3WNFA 4DMNA 1RBSA 4IG3A 4RNMA 3RB4A 4WYLA 4O3SA 2KZMA 3DI6A 4PQUA 3MECB 2RN2A 1D8YA 3V1OA 4NCAA 4QPXA 3NHGA 4DTUA 4XPCA 1S1XA 5J2PB 4ZVEA 1CXQA 4H8KA 3NDKA 4FLTA 3DLKB 3KLHA 3V6DA 4J9OA 4IRCA 2WOMA 2D3UA 1WNSA 3I8DA 1L5UA 5EWFA 3VQAA 1C1AA 2G8FA 4TQSA 3LP0A 1S0OA 1XHXA 3HXMA 3OS0A 1EP4A 5C42A 4BDYA 2WCXA 2BQRA 1RTJA 4FM1A 3PHEA 1UA1A 1BIUA 1Z4UA 1WSHA 3AO4A 3OS2A 3GV7B 1S0NA 3JYTA 2IMWP 3KIOA 3QLHB 2JEFA 4YQWA 3KD5E 4EO6A 4ED6A 3O4NA 4FVMA 1VRUB 4KREA 3KKSA 3VQ6A 3KLEB 2W9CA 3SUQA 2IJFA 4E7LA 4PY5A 4JRQA 4TY9A 3OYAA 4RU9A 3PO5A 2WB4A 3L2WA 4FJIA 5KG2A 3CM6A 3IAYA 3FQLA 3TAEA 3H4BA 1HNIA 2FLLA 2B4JA 2Q3SA 4O55A 3OHAA 4C8LA 2IAJB 1DLOA 4U7CA 2JEJA 4AILC 5HP1B 4KO0A 1VSHA 2OPRA 3DM2B 4CGHA 3SV3A 4J9QA 2I1RA 2YNIB 5KG6A 4KKOB 5SZTA 1XR6A 3V4IB 1QE1B 2YNGB 1NKCA 3O3HA 1D1UA 4RUAA 3DLEB 2PY5A 4FCYA 5KFUA 2IC3B 3VA3A 4BE2A 1EETA 2KFZA 3K59A 4H4MB 5KFRA 3AVNA 3G86A 4CF1A 1KVAA 2ASDA 4RW4A 3EY1A 4O0IA 4ICLB 4CECA 3KK3A 1HYSA 4CERA 3M9NB 1JLEA 4CK2A
chains in the Genus database with same CATH superfamily
2CXEA 4GV9A 2W8LA 1FTCA 2A40A 1OMSA 3LP3A 1RFQA 3M8QB 3AO3A 3NH2A 2HFVA 4B3MF 1SJRA 2HG4A 1FDNA 4KHYA 3RB3A 3G0ZA 3NGDA 2LA4A 3TA2A 3C6TB 2V2KA 1OSCA 2BANA 3HO1A 1HHSA 3AQOA 2QLFB 1NCLA 2DNPA 3KWGA 2P9SB 1K8KB 2DR7A 1C0UA 2O1PA 3KHLA 1EARA 2CNKB 5KT7A 3GSDA 3ALYA 4BBYA 2J9DA 3D4JA 4KTWA 1FFSB 3ZT4A 2X6NA 2P9EA 4ED5A 3H42A 2UXDK 3H1QA 2NXNA 3GJRB 1BQNA 2YWHA 3UE2A 1WAFA 1ZBIA 3L3VA 1EKSA 3SMSA 2B4OA 3U1MA 1MMDA 3KLGB 3PACA 2HBLA 3PXGa 4FYDA 1R27B 4PKIA 4K5SA 1HFEL 1RBRA 1RWOB 3W9HA 3VETA 5ADXA 2HAIA 2QX0A 2K2PA 2B8QA 4KE5A 3PUFA 5MAOA 4YNQA 5KG7A 2XCAA 1QQMA 4BRAA 4Z4HA 2Y1JA 1C1CB 3FJ2A 2KHDA 1F5BA 1QUPA 4MK8A 4YR0A 5GAHP 4OPJA 1FJCA 5K14B 5FJ4A 3CCRN 3Q8VA 3MM6B 4CO0A 1UJ4A 4JKEA 4JK9A 2F1FA 4NA2A 4QQBA 1ZPVA 1KHWA 3CEDA 2DTUA 4O3OA 1BXNA 1U2VB 3VGKA 2UXDJ 2XSJA 4FLZA 4ECQA 4U8YA 5D4LA 3OXFA 4K4WA 2UV8A 1D3WA 2D3O1 4FZXC 1TAQA 3VGVA 4C8MA 4CM2A 3MXHP 3EXCX 4X62F 2DKOB 3RBZA 1TMJA 1RJJA 1Z2LA 2BXJA 3IAS9 4CO3A 4CBWA 2JLFA 3T41A 4PR6A 2MGZB 4QR2A 2DY4A 5EOYA 4TLRA 2O8EB 2W9CB 5DRKA 2MZSA 3DOKB 4H0PA 4CEAA 1TP7A 4UT4A 3NAIA 2H4WB 1RAIB 2C2RA 2V5HG 3FZMA 4KC5A 1YKWA 4FNHA 4PWDA 3H98A 4DR2J 2BR0A 1T6CA 3CIPA 1YX2A 3U8XA 3PTWA 2AX0A 2FGCA 3FZ2A 3DFEA 2HNYA 1RT1A 1SJ1A 3BH6B 4C2MA 4CBUA 3A12A 4ALZA 1PGZA 3LPUA 3DRYA 5KG4A 2F4FA 1JJ4A 2O67A 4K43A 3U9DA 2MQNA 3EKSA 2NRTA 3GV8B 4OZ3A 3CQ8A 3FNNA 3Q8UA 4DS4A 1VQKN 2QEXN 4RW8B 1MWZA 1X0FA 2BTFA 1E6VB 2YKNB 1QQCA 5DETA 3NFAA 2CPHA 2WSFC 1RI7A 2KXNB 2LCWA 3U7JA 3KHHA 4DPUA 4YOWA 5DJBA 4L3KA 1UZHA 4E2FB 5HROB 1VBZA 4NMXA 4LF6K 4CZMA 1UETA 3HZ6A 4A8WA 2R8IA 1NJXA 1S5JA 1F0XA 5B0GA 1KS2A 1NHUA 1UTAA 4MT1A 5HVHA 2DY1A 4KSEB 3MM5A 4UY85 5AJ3F 5AQMA 2DYAA 3Q8SB 1WD6A 1X31C 2P8IA 3CCLS 1SIWB 3IS9A 2UVRA 1L3SA 5KFQA 3CFRA 1RXOB 4KHRA 5GVQA 1CJKB 3EE3A 2WONB 4HL9A 3A0IX 2YH0A 5AR0A 2MQMA 5E5NA 4KH0B 4DPWA 2HHUA 2HSTA 3SZ2A 2MKSA 4DJBA 2XBPA 4UUXA 2QWMA 3N28A 2W9BB 1YI2N 1WG5A 3NAEA 2CUYA 2PBDA 3QWUA 5E3PA 1IKVB 1ZAVA 3S41A 2UVUA 4FLYA 4YHHF 4Y2KA 4G6VB 2J9CA 3A3NB 5TKYA 5AT1B 3GP9A 1NSQA 1XMQF 4ILMA 2XYGB 3I4HX 2HS4A 2VH7A 3A8EA 1YIJS 2V8PA 1VSEA 1EKRA 4IFEA 1RTHB 3QEIA 3R1HA 3TUIC 3BEGB 2DNKA 3MM9B 1D0EA 4NB4A 1HA1A 1TL7B 3I4PA 4JV5K 4DV3F 2E1MC 4EU0A 1K73O 1FKPA 3J7ZT 2HURA 2G9OA 4H0VB 3UW1A 2RUGA 3JS6A 1R6VA 2VV5A 5DK5A 1CJUB 1VI7A 5B09A 2ZM6J 1Q82O 5F8LA 3ILLA 2JFDA 3PV8A 5F8MA 2R7SA 4OYOA 1Q5VA 1C0GA 3HX9A 5M1FA 1NZAA 3HPHA 4KBOA 2AT1B 3LPYA 3P49B 3GIJA 1JLBB 3CCJS 1EXQA 2ZDPA 1Y64A 4F36A 1CS4B 3TX8A 4CT8A 5CCMA 3VOVA 5C15A 4FJ8A 3BP8A 1ACMB 3ENBA 2V7YA 1IWGA 3KUGA 2HNZB 3VV2B 2BJ9A 1UJ5A 1NOYA 1S99A 4P52A 2QWOA 4IH6A 1FNXH 3SJJA 1X5TA 3VWSA 2O01C 2GIQA 1UFLA 2KH9A 4H03B 3V81A 3WNEA 2FZGB 4KH1B 1RQ0A 3QFUA 3J80U 4LSNB 3RG6A 1Z2ZA 1HBUB 1N36F 3VEZA 3OTOJ 4BRMA 1XHZA 2WZ1A 2DY9A 3VQCA 4JD2A 2JRSA 5KOWA 1FXXA 1IV0A 2W25A 2HVDA 2PD1A 4ZPAA 4OJRA 2DRBA 4DQQA 3RU0A 4AL6A 1KTVA 3B82A 4F2RA 4QW9A 4PL7A 3F56A 3Q89A 3M30A 1GXTA 2YH1A 1CULB 1O8BA 2O66A 3GILA 3LP1B 3OYKA 3AO2A 1ATSA 4HACA 2RQ4A 3I0RB 3MCOA 3NH1A 4URGA 1RBVA 3MEGB 2OKQA 3M8SA 4YR2A 2HGMA 1QHTA 3R5GA 4W90B 3MOJB 3CCUN 4ZP7A 1TYQA 4RNNA 1LAWA 3KLFA 2O8FB 3W1YC 1WSVA 2YXLA 4P2XA 3ZSXA 3AO5A 2HHVA 2F8SA 4UY8O 4RX6A 3V9XA 2C3YA 1KQGB 1TR0A 2FC0A 4LFCF 2BUNA 3NLCA 4ZP6A 1HPZB 4F4WA 4DPOA 4PG4A 1S9GB 3CCMS 1IKXA 3FC9A 2BE9B 4ZCKA 4B9QA 3SUOA 2OUGA 1A5XA 2OZMA 3J81O 1JJ2M 1ULRA 3OBIA 1FHTA 2A1SA 4Z4EA 1FRKA 5HMXA 3L95X 2V52B 3PR4A 3DCAA 3A8KA 5G0RA 2QRRA 3HTVA 3RUBL 5LSOA 4GVBA 2YHXA 1IBMK 2Y1IA 1U02A 1G7CB 2NXJA 4DV5K 1OQ3A 1WJ9A 4CI6A 2XY8A 5E3AA 3ENAA 3EMTA 4M3WA 3GIKA 1KQSR 4LBHA 3KK2A 3I87A 3EVWA 2Y1RI 2QL5B 3ZT2A 1LWFA 3NMAA 7FD1A 2V2QA 4LRDA 5K8NA 4JI8K 3UKRB 2JVOA 4C8OA 1HMVB 1BI4B 2ASOA 3TAMB 1G2EA 4CZEA 4FL9A 2ZD1A 1YJ7A 4LD0A 3BGOP 2BKNA 3J7Z5 4KTZA 1DQ9A 5BPNA 2UXCJ 1QTMA 4W5RA 4ISEA 4W4MA 4EK2A 1KXPA 1YG0A 2E1RA 4LRFA 1NZ8A 3BN4A 2JZ5A 4FJGA 1HWKA 1RDBA 4NL5A 2FVCA 5LXYA 2RF2B 4USTA 4E1NA 4CGGA 4O44A 4LREA 3WEEB 1IBMJ 4H4OA 2WVEA 2MSTA 1S1TA 4F4ZA 1TGOA 1S6PB 3ZX0A 2F5GA 3AAPA 4OMFG 3TAFA 1WOOA 3V1RA 4DV5J 5IXUA 5JXSA 4EBEA 2MEWA 2Q36A 1M1HA 2R7VA 3DGPA 4B3MK 2ASPA 2GAGC 3OVBA 1X4FA 4EP4A 5FLXO 5DM6L 3J7A1 2R2TA 5EX5A 2MTLA 2W7OA 4W5OA 3TRGA 2FC9A 4JI8J 3D7SB 4AXIA 1SBRA 1I1GA 1HNVA 2HHSA 2OANA 2OCEA 1LOTB 5HI7A 4ZVGA 1UCNA 4QS7A 1VQ7S 2RMLA 3AVFA 3CJ1A 3KK1A 1RU1A 3HHLA 2P9LA 4PUOA 2KKZA 1F5AA 2UU9F 1RDAA 3HZGA 5IZHA 5L46A 3AVLA 4ISFA 3ISNC 1AROP 3UQSA 5AQVA 3O4QA 1VQYA 4RG8A 4P7VA 3JYTB 1Q7YT 4Y2AA 3U02A 1ASVA 3HHKA 4CZHA 2AYEA 2B56A 4ZVOB 2ZNYA 4KY3A 3Q83A 2FSNA 3M2UA 4YOTA 3RW6A 3J80Y 1X5OA 3RSEB 2PYLA 1YJWS 3PHTA 1KAXA 2B8PA 4OQJA 2AGOA 4R8UB 3A3PB 3WHIA 4GC7A 2IDLA 4LMZA 2XY7A 1WF0A 5C2FA 4C1NK 4B3MJ 3C16A 2FTRA 5BN9A 2HQ3A 1JCEA 3BO2A 3C8YA 3E3XA 2A6AA 2AJ1A 3D5MA 3CQXA 1RP5A 1RCOB 2P9PA 2BKPA 1SPBP 2FVPA 2ZKTA 2FXUA 5J2NB 3TW0A 2DNOA 5SWMA 4LFBF 2EC0A 3ENVA 2EX3A 1VRUA 1RBLA 1EETB 3H1VX 5DGAA 3HSJA 4B3RK 3FSIA 2ZH4A 1VHIA 3KTQA 4ID8A 2Y8WA 3CC4S 4LF2A 3RB0A 3SSQA 4X62K 3UD5A 2YKAA 1VQ5S 4DU3A 3J7ZO 5BR8F 1VQ4N 4IJNA 2JFKA 1VQ6N 1PYOB 3K5MA 2WW4A 4GNIA 2IBOA 3AVHA 1OPIA 4KI6A 5KG3A 3AOCA 3LTOA 2JDJA 2HRYA 3JXOA 1YJUA 3DLEA 4B02A 2IYIA 3VQDA 2W24A 5KPRA 2M4MA 3OYFA 3BKTA 1T9UA 3PW2A 3K5LA 2F9DA 2V34A 2W7PA 3SCKE 4OI3A 1HQEA 4BG8A 1VSJA 3CJ0A 1IG8A 2VB6A 1JCFA 4LJMA 3CJ7A 1Q86T 1TV6B 4X66K 4BR7A 1DBDA 4FPIA 4DN9A 3ZEUB 2HHXA 1VQPN 3HM9A 3M05A 4CO5A 4FF4A 4B3RJ 3WXMB 3DYAA 5J2MA 4G1QA 4BRKA 1NK9A 1P9QC 2V4RA 2AYBA 4JKDA 3PY8A 2V8HA 1SH3A 3GG1A 2EG2A 4X62J 1YJ9N 4URSA 2MLZA 2CA9A 1TL1B 1JLFA 4DR6F 3HSGA 4KH5A 3KHYA 1GTHA 2WB1D 2V2ZA 4WFAL 2RNEA 1IKWA 2F40A 3S01A 3AVBA 2I0XA 2ZH5A 4EBDA 3ZSQA 5AJ3K 1KONA 4PG7A 4ZCLA 2K7KA 4B9MA 4LQ9A 5E7OB 3L09A 1WTBA 4QIEA 2JEIA 1ZBFA 3G87A 3C6HA 4KV8B 1VAZA 4Q44A 3QIOA 3DRPB 3MCAB 2CQPA 3VAJA 2DFFA 2BJ1A 4CLLA 3SQOP 3O6QA 3QPIA 2W2OP 4EI2A 4EP5A 1GLAG 2CQIA 5KI6A 4BGAA 4NLCA 3K5OA 4YHHK 1XERA 5GADU 4X66J 3KVGA 4XAKA 1RT4A 1SQGA 1GLFO 5AXLA 3M32B 1GLJO 3W9IA 1XMQK 3QMLA 4FLXA 2P6TA 2SXLA 1T03A 2IVOA 3VQQA 3PNIA 2I2YA 4B9SA 3CCRS 2A6MA 3CJSA 3SPZA 1B9FA 3NS5A 4DV3K 4C3MA 4X4TA 5E3RA 1FWPA 1WORA 4BC9A 2NUUG 1JXEA 1SL0A 4JI6F 1GTEA 2XMWA 3ET6A 1RHQB 4CJRA 2M70A 4FYWB 4BRNA 3M4XA 1RT3A 3VEYA 5C25B 5A0YB 1WI8A 4NO7A 4LRAA 2H5IB 3W3SA 1XC3A 1S10A 2BM1A 1RT7B 1NK7A 2ADBA 3TVYA 1HQUA 3QDKA 4CZFA 1S5ZA 1N34F 4F4KA 1NK0A 4CF2A 5IT9Y 2XI3A 5B0CA 5GMDA 2W8KA 5IV3A 1ROFA 3THYB 5KPTA 1KQSM 1H2VZ 3TWHA 3KKFA 5HL7Q 1WUAA 4H4KC 4ECTA 4C11A 5E84A 2LQ9A 5M1OA 1D5AA 2FVSA 3AY9A 4KB1A 1N36K 2Y9HA 3IKMA 1Q79A 2EFPA 1XMQJ 4U7UD 3KK7A 3R97A 2UXBJ 3NNCA 3VEWA 2ACMA 5T7LB 2DPJA 1PBUA 3TSUA 2E5JA 1WN7A 4E19A 2LDIA 4Z4FA 2FJBB 2G0JA 1SKRA 4KPYA 4DQIA 4ZPBA 4ANEA 1H2TZ 3IR7B 3CJKA 4CJFA 1Y3KA 3U27A 4DL2A 5CQGA 1VQKS 1LAVA 2UV8G 2KJWA 1A9NB 2QEXS 3L3CA 1KVIA 3DWLA 3M1FA 2P9GA 2DXFA 4QIGA 3O8WA 1ZXOA 1SJFA 4ELVA 4GVLA 1TKTA 4IFYB 2ZWHA 3C2PA 3VQTA 2CGKA 5M2PA 1FA0A 4MK9A 1SC6A 3MN9A 2PSZA 2XM3A 2G8WA 3SCLE 4P75A 4O3QA 1NSAA 1NLKL 4AHTA 4IDHA 4KHPF 1WBDA 1HBNB 1DEJA 2DXDA 3O1LA 4RNOA 4NLSA 4LFCK 4F02A 3NS7B 3P38A 2ZF5O 4DUTA 2WAQD 1BCMA 4I69A 1SV5B 4ID1A 3AARA 4RLEA 1B3TA 1XTZA 3EO3A 3OBWA 4O4GA 3S3MA 5EWGA 2GV9A 4LSZB 3GU0A 2IM2A 1CSJA 1PJ6A 4JI4F 2LQBA 1URRA 4OYWA 2RKIA 1YI2S 3EGZA 3PW7A 1NEEA 3M5RA 1R0CB 3MCMA 5IM0B 4CJQA 2QLBB 3V4MA 2H51B 4PXDA 2KHCA 3FBFA 1FNOA 5B0AA 2Z2ZA 4I2QA 1U0HA 3TUPA 4DKWA 3J7AN 4ZLNA 1PJ5A 2UUAK 4KT0C 2WTUA 1CBKA 2RT3A 4USWA 2V8VA 3L0QA 4FW2A 1F3VA 3I5CA 4HYKA 1GQEA 4E8UA 4M7XA 3FQKA 2Q6BA 3PSFA 3AT1B 3GSIA 5KFPA 3OFGA 4CM0A 4QU7A 5E33A 5IQQA 3MM8A 2PE8A 4PQAA 3QQCD 4CESA 3HMJG 4ED3A 2APOA 2E6MA 1NGIA 5A2QU 1X4CA 4QWCA 4E1MA 4S0MA 3MK6A 4NLQA 3ZNUA 4O8KA 2G1HA 2DNHA 2W1BA 3FK4A 4CTAA 1H7WA 4DPYA 2B4UA 2MKJA 1JMTA 4Q5VA 4QU6A 1HBMB 1Y10A 4BRQA 1J53A 2NYIA 4B1UB 3VF6A 2O8CA 4FYXB 3MEEA 2R8HA 2HRTA 2JNJA 5D78A 1S1WB 1NPRA 4HH0A 1NJYA 2QJ3A 3R2DJ 3UVJB 4GKJF 3DMJB 3RRGA 3P8BB 2MZRA 1QY7A 1UL3A 3AA2A 5J2QB 3GPAA 4WKRA 1KOOA 1U2FA 5F0UA 4BDPA 3IG1A 4MIWA 2UUAJ 4CCHA 1NMEB 1JKHB 4A8QA 4HT5A 1HNXF 3W2WB 2MJNA 3U3GA 1ZM9A 4NLDA 2WBRA 3H5YA 3C14A 2HIYA 1IR1A 2CPZA 2GVDB 4JI2F 3MFIA 4ZDNA 3I5AA 3W5XA 4HUFA 1XIQA 1TU0B 4IXCA 4CHQA 1FRLA 2NXCA 2UU9K 3L4BC 4NX9A 1N32J 4U9RA 3CCUS 1VGYA 2LXUA 2OPSB 2EK1A 3T19A 2GTDA 4A5AA 4WCEL 4MKYA 4KTQA 4DV7K 4I9QA 4BE0A 2W41A 4KHMA 3FRYA 4ZVUB 2PGCA 3CC7N 1WC1A 2PC6A 1S6QB 3MTJA 2AYGA 4HTUA 3D2WA 2W9AA 4FJXA 4HUGA 1MWMA 3CETA 2CH5A 4ECZA 1NWKA 1LQ9A 1N6QB 2WBMA 4M5DA 1NNDA 1TFWA 2QKBA 1NGGA 3GL1A 2YI1A 3WC0A 1TFYA 3NOGA 3DM2A 2DR6A 3W0LA 2IRYA 1RT5B 4PWUA 3V4IA 1NJWA 3TQ1A 2WRMA 1WEZA 2BRLA 4FP9A 3DXKB 2PMZD 3K8VA 3TTDA 1PG5B 4OI1A 1MDUB 2Z1IA 4B3TF 4ICLA 2CIMA 3VAGA 2L3MA 1XR5A 3HD2A 5C2DA 2GS8A 4QW8A 4AHUA 5KT4A 1YBAA 1EX4A 2ZHAA 4V19S 2C42A 4B3SJ 3QBXA 4MJKA 3AA4A 2JJ4D 3QEXA 2JWNA 3MCNA 4DCOB 3M8QA 1U1NA 5KFGA 1Z1ZA 4JI7F 2HS3A 5KRTA 2UU9J 4WYWA 1TL5A 4WFYA 2M9KA 3QB0A 1XMOK 4CF0A 1GMVA 4CJPA 4CHOA 2F8EX 4F26A 3O1WA 4JKGA 4DV7J 4J9SA 1DGKN 1RWVB 1C2PA 1UMJA 3QERA 5BR8K 3KZBA 4N8OA 2NRVA 2YNFB 1RISA 2P9SA 1U48A 4FPRA 1KVJA 1NK4A 4FW1A 3W3DA 3GLJA 4K4SA 5HLFB 2OZSA 5HK4A 2D41A 1R59O 4A46A 4QWAA 3ZZOA 1TL4A 2O4IA 2HAFA 4DU4A 2QE5A 2B51A 2DGOA 1D9DA 2R7TA 4USVA 1W9HA 2VWKA 3LANA 4TY8B 3CT9A 5F1XA 4OV6A 3HI0A 2C3PA 1WHWA 1IM4A 1B0PA 5AZJB 2IDOA 4WK3A 3JSRA 1X9MA 5LY3A 4F7VA 1CVJA 3FDSA 2XCPA 3RAXA 1XQSC 2ZUGA 1WSEA 4BR9A 2WVFA 3MD3A 3HP9A 1C1CA 4M45A 2X78A 4ED0A 3ISND 3I56N 3D2FA 2J7UA 4ECSA 1WOSA 3FR0A 1U45A 4LSLA 4H5WA 1S12A 3UDLA 1U6BA 4W92B 4OZNA 2XGQA 2LKZA 4DMNA 5F0XA 4IG3A 2V4JA 3AD9C 1OQ6A 1VBKA 3RB4A 1XMOJ 4NCAA 3MECB 2RN2A 2OMOA 5DM7L 4QPXA 4DTUA 1VHXA 2P9NA 1S1XA 3DLKB 2HFSA 5BR8J 3KLHA 3V6DA 4IRCA 4DR6K 2BOPA 1YHQN 1WNSA 2D3UA 3I8DA 3CJRA 2FJAB 5A2QY 3JQJA 4LR7A 1SXLA 4BREA 1C1AA 2G8FA 5AQGA 4BLGA 2HBJA 2ZH6A 3OS0A 5E2QA 2R7QA 3VENA 2BQRA 1UW4A 1UA1A 1BIUA 2Y0BB 2PFUA 1NGEA 2ABYA 3MAAB 2VICA 4FF3A 1K0TA 1ILYA 4LF5J 3GV7B 2QWQA 2IMWP 3D1QA 3QLHB 1OKJA 1TELA 1X4EA 2MGZA 4KREA 4DX6A 3KLEB 2W9CA 4F3MA 4RWTA 4ETZA 1XK8A 2DGXA 4E7LA 3L2WA 2FHKA 2VFVA 3IAYA 3R7SB 1MLAA 1YTYA 1YRUA 1OVYA 2GX9A 3TAEA 5LMNF 3TPQA 3QBWA 2XMJA 2B4JA 2Q3SA 4U67L 2NLWA 2IAJB 1HJOA 4U7CA 4CD3A 2JEJA 4AILC 3R5DA 4M5MA 4CZGA 3SV3A 2ZGZA 1T3VA 4DUYF 1VJWA 4KKOB 4OZ0A 1XR6A 1MNEA 1QE1B 4JI6K 3AXKA 2FHJD 5RUBA 1D1UA 4RUAA 2CNNB 5KFUA 3VA3A 2H5JB 3AVNA 1FXRA 1IQZA 3G86A 3R27A 4CF1A 5DDPC 4O0IA 4CECA 1HYSA 3F41A 2DIUA 1JLEA 1Q1KA 1N34K 3O1BA 5CYMB 1YBTA 1S7IA 5C2CA 4Z0UA 1VQ4S 3TU5A 3LDQA 4XH5A 3CCVN 3D1HA 1VQ6S 1RCHA 3JSBA 1RSCA 3FSXA 4UZBA 3IGNA 3H6EA 4YEAA 1J27A 3KJVB 2RQKA 4XTTA 1O6XA 1ATRA 4BE1A 1D9AA 3V6JA 3S9HA 1LK7A 1V5IB 3IA0A 1FKOA 3I9V9 1U7LA 2HK3A 1JLCA 1NM2A 3WXJA 1RDDA 2F8HA 4LIWA 5CY4A 3Q22A 4IOBA 1VQLN 1T9YA 4NASA 1FX2A 3LDOA 1HBOB 1CJKA 2ZH1A 3LGNA 4KFBB 1RWXB 3W62A 1KTQA 4L6V3 5HANA 4A59A 5B08A 3CMEN 4C9DA 1S4EA 2H54B 5KG1A 2W9BA 2RILA 1UWAA 4CJ3A 4RKUC 4H54A 3P5JA 4IEIA 1QM9A 3D54A 3R3TA 1WF1A 1VQPS 2B9XA 3ZYYX 1UWBB 4PA1A 4HI2A 1ZBHA 1QAIA 4H4KA 1JLQB 4ZPVR 3FGUA 5GAGI 3BJYA 3MM9A 1EQYA 2IJRA 1TL7A 2HFOA 2VU5A 4P2MA 2YHWA 2AJFE 2YHAA 4ZVFA 2F9TA 4KHPK 4P2FA 5K5MA 3SK3A 1HW9A 1IH7A 1N33F 3ATUA 4O4RA 1C6VA 4OKKA 2VBWA 3QO9B 3O2IA 3B6OA 3NMUA 2HLTA 5EX3A 1T3OA 1VISA 1I6JA 2E1AA 3I55N 1K1QA 3DU6A 3PKYA 4ECVA 4I0WA 1NDLA 3N6MA 2HWIA 1RAAB 2MHNA 4U6PA 1JLBA 4G3IA 1GXLA 1OVQA 2VJUA 3LP0B 5C24B 1N5YA 1RWUA 1B0VA 5I3QA 3K9KA 4B9TA 4H5TA 3TABA 4Q7AA 1R6YA 1T05A 1FRIA 3DHWC 1UFKA 1Q81T 1T0TV 4Z94A 1XNRJ 3KFWX 3TJ9A 1UEUA 1WC3A 5KFFA 4ILGB 1WACA 5IWAJ 1VK3A 2IPOB 1JQGA 2AMCB 4J90A 4PYAA 3LP2A 4Z2XA 2BMBA 3UN2A 3K57A 3MTKA 2D0AA 1GLBG 1HBUA 5K8PA 3H40A 2DO0A 4I68A 1W97L 4Z4IA 2GMHA 5AQKA 1NB2A 4RWXA 1NRKA 2Z8QA 1VQON 1U1RA 3UCUP 1SZ2A 1Q8LA 3D2EB 2D0BA 2R7XA 4DZDA 4M3YA 4CDIA 3FFIB 3K9JA 2HHHF 1YSJA 3HFZB 8ATCB 1RWPB 3G25A 1R8HA 2QC3A 4DU7A 1DLOB 2V8GA 4G65A 1HWIA 3GWCA 4LF4F 4OYBA 1UVIA 2XO6A 5T7BA 4WE1A 5GAEI 3ELHA 2JWKA 4JHDB 4HT7A 3BS9A 4J2BA 1F9HA 2BUPA 4Y65A 1OH5A 5I42A 3NWRA 2BE2B 3T5JA 5JMVA 1SC4B 1QQOA 2H48B 3KK3B 4Q8FA 3OV7A 4PEOA 1XNQF 4WQ5A 5CXTA 3Q0AA 3TTFA 3GJQB 1RACB 3SAFA 4QOZB 4IWVA 4IUFA 3IM8A 4G9ZA 1J5EF 4DTPA 2C22A 2QV6A 3G71N 4ZPDA 1X4BA 3M2RB 1LFWA 4DV1K 4FJLA 2HEKA 2DH9A 3PSIA 2E9ZA 2XZDB 3TZZA 2W4PA 3QEPA 2Z58B 3CJ5A 2A5XA 4Q8EA 1DQAA 3ATVA 4GKKJ 4JI2K 1Y5IB 2AA4A 3PYEA 5D0RA 1KCFA 4HH1A 3QSYB 1T9TA 2KDOA 5DM6Q 3MMAB 1IM6A 3KJNB 1RHMB 2HQIA 4NRUA 4WP3A 1DT9A 3SCXA 1Q8KA 1NKBA 2VG5A 1IR2A 4K8XA 1DTTA 1DY3A 3FUYA 1WWHA 3LWMA 4WK1A 3ZTSA 2QK9A 3NL0A 1Y97A 4MMOA 1YUWA 1RHUB 2LDYA 1HLUA 2IVPA 3M3ZA 3LM2A 4OYXA 4OHXA 3OSPA 4OYMA 2RS8A 1R3NA 2KG0A 4M1KA 2M8DB 3CIZA 1YK9A 1QZ6A 4CLWA 1HIYA 4L8RB 2IIHA 2AIRB 4F04B 1FJGF 3V9SA 1OYEA 3V6KA 1RAOA 4C98A 4ZLLA 3R2CJ 3AA3A 2YWWA 4F9OA 3UCGA 2VQFF 4PL8A 4FDFA 4N47A 2M3DA 3CDBA 3ENHA 2BJ3A 4JI3F 1B4SA 3S3OA 3OYDA 2DNZA 4JUZA 1NDKA 5M1QA 2JOQA 3QETA 4DV1J 3DXBA 5BRHA 1YTUA 2MB0B 5D77A 2Q43A 1ATNA 4B3TK 5D3GA 1H74A 1GX6A 2X3DA 2CWKA 5ETLA 4J2AA 3OW2M 3A1YG 2LXIA 2PFDA 1X9JA 3K5NA 1EX8A 1S1VA 2MSSA 4PG5A 4C3LA 1S79A 4TLQA 5AQRA 2DNMA 4BRIA 1U1PA 2AGPA 4JI7K 2ILYA 1K8AT 2R7RA 1A7GE 1BE4A 3FZKA 2XWXA 3BUZB 3TANA 4Q0BB 1HI0P 3K7RA 1T9WA 3TJ8A 3WX8A 3FE1A 3EX7B 2FLPA 4EEYA 5KFLA 1VQ8N 3RAQA 4RW6B 3BYPA 4OPHA 2L08A 3IMQJ 3M2VB 3G6XA 3W65A 1VBXA 3J8AA 1PYSB 4DN0A 3RMCA 2OI2A 1XQIA 4B1XB 2GVZA 3NBPB 1EAYC 3M6WA 2MKIA 1BIZA 4NYFA 3MX5A 2CPXA 2RVJA 4Y2IA 3TA0A 4BQZA 2CZ9A 4YDUC 4M8LA 3ULEA 4YB7A 2NR0A 2BW2A 4I1TA 5J1EA 4ZLJA 2C3OA 8AT1B 4J2DA 4Q45A 3NCQA 4HDGA 1YRXA 1X5SA 3KLIB 2HMIA 2LEBA 1SQKA 3Q24A 3CJ4A 3OJUA 5KOXA 4JI1K 1I39A 2EFVA 5I9EB 1YLXA 4R8UA 1P9YA 3AGKA 2BQUA 1FEHA 4JI7J 4R5PB 4FYVB 2AX1A 5M1KA 2EWSA 2QWLA 1F9FA 1JLGB 4FYYB 4ZJQA 3BDPA 5DZ6A 1GXUA 2PDAA 4RW7B 3EN9A 2DT9A 3DDNA 1N5QA 3VZIA 4FJHA 4FJMA 1K1SA 3VGSA 2LSNA 5J2NA 4WXOA 4DF4A 4U95A 3AAWB 5MLCQ 3EGWB 4DL6A 3E2EA 1J5OA 5AQJA 4K4YA 2C1EB 2DHHA 5JS1A 2XMMA 1V9OA 2UXDF 2K1RB 3ITHB 1VRTA 2VG7B 4IFVA 5CYQB 4YS2A 3IGVA 1NBWA 1Y9OA 2ZBIA 2QXFA 3E01A 2KN4A 3CC7S 3GV5B 1FESA 3SQ0A 4WFAQ 3NKYA 1S72N 2CZ4A 3NCRA 2CNLB 5DO2A 1CJTB 3HT3A 1TKZB 1P8GA 2FQQB 2P9CA 2RQMA 3F0NA 3NOCA 4KAZA 4O0JA 2O3DA 2DR9A 1C0FA 2CG8A 4TKTA 3GCXP 2YV0X 2ZH8A 2FJDB 3BH7B 5DG9A 4JI1J 2NZTA 3BF4A 2MZ1A 3J7YP 5I3UA 5LMNK 4DR2F 2HNDA 1U8SA 1XMBA 4KBIA 4OGCA 4BC2A 2G0CA 3KG0A 3IFEA 3R5BA 3DLLL 4DR5J 4YDDB 1EWQA 2D5RA 5ETPA 5GIPA 1ZM3A 4MK7A 3QJPA 3AY0A 3ETOA 4EBCA 4JLHA 3P1GA 3CJBA 4BRPA 4I7FB 1KBRA 4KPCA 4CVNE 5H9EK 2JX2A 3GQCA 1Z6RA 4A61A 3O3LA 4YR3A 3B78A 1N5TA 3I6PA 2KRBA 1HJRA 3U3YA 1RA6A 5A6PA 5BPMA 4BGBA 5ETSA 5CA5A 3S1TA 4FWMA 1QZ5A 1QQNA 3JSMB 4I2PA 4LFAJ 2VG6A 2VJVA 3CO9A 4DFJA 2E7XA 4DTSA 4J9VA 3UIQA 2GJFA 4NLXA 3GBTA 3G8SA 4MYUA 2XY6A 2QL9B 2HZVA 1JJCB 1UVLA 2KB2A 1I3OB 4M63C 4CZIA 1GK8A 3P5BP 1S6UA 1KLMB 1ZC6A 4OVLA 3Q8RB 4LT6A 3M8ZA 2R8GA 4WZMA 3KYLA 3CD6S 5AZIA 3AVKA 4DFKA 2Q79A 1YQHA 3TSQA 3GJTB 1IN0A 2EEYA 4YOYA 4BRFA 1LWXA 4NXMK 2AP1A 1BMQB 4DMZA 5AXKA 3W2VB 5EXWA 4P72A 4OX8A 2O5DA 4K50A 3MPDA 3CDUA 3Q2SC 2W2QP 1EP4B 3JS9A 5C42B 5FIIA 3WBZA 5F8IA 1RTJB 3C65A 2D0CA 5L9XA 4B8AB 1KLNA 3N6LA 3I56S 3FBEA 3QFPA 1GLEG 4FKXA 3A5OC 1OH8A 3BZCA 3D6TB 2N3OA 4EIAA 3RMAA 3GOIA 3BR9A 2ZBPA 3ZTRA 3LOUA 5HO4A 1RBTA 1N8RT 2GW8A 4B1VA 1X8DA 4OL8A 4LF8F 3DN9A 5J2PA 2JSXA 5L1JA 1YHQS 2GCFA 3OYHA 1CLQA 4OJ3A 3OVSA 1K44A 3N4WA 1GOBA 1HNIB 3CCTA 2MQOA 1N33K 4RPFA 4J9RA 1X60A 3UD3P 3H5XA 1Q8IA 1VSMA 1RT7A 2ZM6F 1X4AA 4CEQA 3SAHA 4C6AA 1T7PA 5KT2A 4NXMJ 3OYCA 1LOUA 3K2PA 3BF3A 2M7SA 3C7NB 2V94A 1Y11A 1KR4A 1NG9A 1S3XA 2NRWA 3MUMP 4YOXA 1VK0A 2XLIA 3H2UB 1JNZB 2FGOA 3AB2B 5EDWA 4Q2MA 2P9IB 1R0BG 3TAPA 1HPMA 1EHWA 2ADCA 2HOEA 3NGTA 2I5JB 2WVDA 4DCHA 3GJSB 5FPMA 3ULHA 1E6YA 4B1YB 2ZOFA 5CABA 5FROA 5ADXH 2AQ4A 4JKAA 3OTOF 1OO0B 4Y2MA 4KHNA 2BM0A 4CEEA 1TKDA 2LEAA 5E3QA 3T1YJ 1UVNA 4DOZA 1FD8A 3BSOA 1PIEA 2NNWA 4WU2A 4NLRA 2Z56B 4EFAC 3W8GA 3CXCR 1U8WA 3IBCB 2YNGA 3C19A 2HHHK 3GYNA 2Q31A 1HUXA 1C0UB 2IC3A 1V4TA 2HYIB 3BDEA 1I3AA 4LF4K 4IFYA 3NH0A 2J6TA 4C0BA 1NK6A 2C2MB 3SQ2A 2E5LJ 4A2AA 1BQNB 4F25A 2RD5C 1MSWD 3K5PA 4WZQA 3CCVS 2ASMA 3K2YA 3F9KA 1VHFA 2C2ZB 2FYXA 5CE3A 3VQ8A 5DG8A 2V69A 4IH5A 1IO2A 1XNQK 4YB6A 1RBOB 3MAQA 4DL7A 7AT1B 2ZJRL 1CQNA 4J9LA 4NEYA 4L73A 1SV5A 1J5EK 3WXKA 4IJAA 2BYCA 1VQLS 1MROA 2ITGA 4O3NA 4KGZB 4ZA1A 3CMAN 4AE5A 4H0TB 4KI4A 2RE2A 3CMES 1P6TA 1Q9XA 5IS2A 2MZTA 3A3OB 2UUWA 1RHRB 1HHTP 2PZSA 2GV1A 3D3CJ 2MYFA 1TL3A 1E4FT 3EM1A 1VLOA 3FFKB 3VQPA 1PC5A 3EYZA 3ZSOA 3T5HA 2C28A 4CGFA 4LF4J 1S77D 4FZYA 4QWDA 1S1UA 2HQGA 2G1DA 1RUSA 2XSJB 2LU1A 4EO8A 2VPWB 4W98A 4QBUA 3K0SA 2JLGA 1ICEB 3I32A 2V50A 3L2UA 4GVMA 4CEFA 1NHVA 1NNEA 3OQ2A 1IQTA 2KLAA 4E7KA 1R8CA 3NG8A 5DDOC 2YQ0A 1RLDA 4CFDA 2UXCF 4WCEQ 3I55S 3UDVA 4KYZA 3VQBA 2VQFK 4PWDB 1BQXA 4XIUA 1J5EJ 4FM0A 1M0SA 5KAKA 4CZJA 4C8ZA 4OX7A 2H9ZA 4ZITA 4ZS6A 5KFVA 2BJ7A 1HBMA 4P2SA 1YVUA 2IVMA 2HNYB 1RT1B 5K20B 1NHKL 4XEIA 2H4YB 3QIDA 2PA8D 1IBMF 1LW0A 2ZGYA 4JKHA 1SC1B 4ZN3A 3ENWA 3QGHA 1S22A 3V9WA 1RWWB 1HWJA 3ZLJA 4USJC 4DV5F 5KG5A 2G8UA 2IVYA 2YKMB 3H46O 2XMTA 2NYHA 4CJUA 5BYQA 1RBAA 1J2VA 3PYDA 1S9FA 1WAJA 3RJMB 4FPBA 4FLUA 1JKHA 1FVSA 5HMYA 1VQOS 2CJAA 1W2BM 3I9ZA 4JI8F 3MR6A 1UVMA 1FK9A 4UF4A 1YTAA 2XNQA 3TEGA 1GFWB 3JQMA 5AQQA 1H38A 2IFXA 4EYIB 4HLBA 3OFHA 3C3LA 3VALA 3X3UA 4B3OA 2HWHA 2CFXA 3DRXA 5KFXA 5I3PA 1JXVA 5A8KA 1BU6O 4NLVA 3ZO7A 4HCCA 5B0BA 1M90T 3MM5B 8RUCA 2VQFJ 4CEDA 4HUEA 2VPXB 4X64F 4M5KA 2OPSA 1RZMA 2ZOMA 4E7IA 1MU2A 3WQPA 3BZKA 2R8JA 2VC1A 3E8OA 3DDKA 4FK4A 3L2QA 2CVEA 5KRSA 3OXLA 2IA6A 2Z1JA 3JAMO 1Q5YA 2ZITA 5CYJA 5F9NA 5CHCB 5D0EA 3JB9k 1LWEA 1N6QA 4MFBA 4IO1A 4DLEA 1IG9A 5B7WA 2XZTB 4KRWA 4IOAL 1X1PA 1R0AA 3MGJA 2W40A 3AA5X 2P9UA 2FB0A 3MXIA 1QVGR 4RUCA 4DTMA 1S57A 1H98A 3ILJA 3RRKA 1IBCB 2HBMA 2OHDA 3PVXA 2W7AA 3UWTA 5ETTA 3KHRA 3CJ3A 4A48A 2XMAA 2O8DA 2KYZA 4PAAA 1DURA 4MO4A 3VQ9A 4HKQA 4CHYA 3QEWA 1DZ5A 4DSJA 1HYZA 3MDQA 1RDCA 2ZOGA 4NLOA 4M3ZA 1FKPB 2P2CB 4A2BA 2A6OA 2EFOA 2RQCA 3Q8YA 3LZIA 5FRMA 4Z7CA 1GMWA 2H5EA 4PABA 3IXQA 1K9MT 5DM7Q 4CF8A 4LF1A 5KGXA 3O9UA 4Z4GA 5HVFA 1GEHA 4Y00A 4DR3J 4FWQA 4C0HA 4GY2B 2VPYB 3DHXA 4USMA 4YY3J 1UJ6A 3ENQA 3JTOA 5H1SV 5GIOA 1ZAWA 3F5TA 5KGWA 4DDFA 4FBTA 5AQZA 4LRCA 4B9VA 4LQ3A 2U2FA 2OELA 3PJXA 5GAHU 1JB0C 4K41A 3ZT0A 1VQSA 1W7WA 2L9DA 3DAWA 3OL9A 5DLFA 3H25A 1SL1A 4GO5X 1RT6A 3UO0A 2XMVA 3EDRB 4ID5A 4EMDA 2V2VA 4DR2K 4CLZA 1REVA 3QT6A 1O13A 3ZETA 1T11A 3O9QA 4B8CA 4IKAA 2ILZA 1KAZA 3HVTA 4H5VA 5JVGL 4U7UK 3V9ZA 4N41A 4DL3A 2H1YA 3MD1A 3U9ZA 4BACA 3UCZP 3LA0A 4ELUA 3MWPA 3UDCA 2O4GA 3CIMA 5GADI 2RU3A 1KFDA 1NPKA 3QGGA 4U67Q 3EXYA 3MWBA 1EIYB 3QRRA 3MR3A 1L3UA 3CSKA 1RAGB 1RT2B 3P39A 4B3RF 4HACB 2R7OA 2OEMA 2LYVA 1NJZA 3HJVA 5KFHA 3QGIA 4C1NI 3OYBA 3NVMA 1GMWD 3L2VA 4GVEA 1FDDA 4LIRA 2HBRB 1TYQB 4O5FA 1VQ8S 3KLFB 2E4LA 2OIHA 4BRLA 3UD4P 1KEKA 1EZZB 3V2UC 1YT3A 1R8PA 2QSFA 3PG9A 1S0VA 2E29A 4PPZA 3F2KA 4QIWD 4E7HA 2HHTA 1F2HA 1YJNS 3RBDA 1SS6A 4NLWA 1QAYA 3GFYA 2LU2A 1R8AA 3VGTA 4I6AA 3VTIA 2D69A 3O9SA 1HQ2A 5KFZA 3KNAA 2PAVA 1IKXB 5KFJA 1DTQA 2WVBA 4ECRA 3QLHA 2J8SA 3VAFA 2ZH3A 4AM7A 3SPYA 1Y4ZB 2ROPA 5G0RB 4F8RA 1KRPA 1X9WA 3QRPA 4M3UA 1IKYA 4HHHA 4M63A 4X66F 1MMNA 1SJQA 3BGRB 2ZJQL 2ATCB 2F96A 6FDRA 5KFAA 4C3KA 4EHTA 4AHCA 4JI0F 1IR0A 3OL7A 2ATLA 1GT8A 4LF8K 2GA7A 4E3SA 4RUBA 2IOCA 1RCXB 2DPIA 4FWKA 4UW2A 1QE1A 5CAAA 4X65J 4ILRA 2VZ9A 4NI2A 2G8HA 4XH1A 4ZPWR 2ZD1B 4WIQA 2ZM6K 3SLCA 4OI2A 3J7YI 5BJRA 4HHTA 1LCUA 1YAGA 5IT0A 2XMUA 3QJJA 1RWMB 3CHWA 3PX4A 4UZCA 4TNOA 1S72S 2BVZA 4OZLA 3POTA 2RAQA 2OFHX 1N0UA 2RIJA 1BG3A 2FVQA 1NJIT 2FF3B 4ED1A 3MEKA 3KJVA 3MPWA 3E9OA 5KFEA 4DU1A 3BYRA 4XK8C 2Q0RA 4NRTA 3V1QA 3HF5A 1OJ4A 1QS4A 4H4OB 3IO1A 1S1TB 4DR1J 1SC3B 1VIXA 4FS1A 1QAJA 1TK5A 2E1ZA 4ZHRB 3C95A 2AJ0A 4DL0C 1TKXA 3OTOK 3IRWP 1RKIA 3PW0A 2UXBF 3DGPB 1HBOA 1TQLA 1I94J 3LDNA 4KFBA 4LF8J 4DBQA 3CPWR 3GYGA 5KFMA 3P96A 2DJWA 4ANCA 4PXCA 1HNVB 3BGFA 1MWKA 1UWBA 3OT9A 4J9NA 4P73A 4CH1A 1JLQA 1QJHA 3KK1B 2E9RX 5BYRA 1LNQA 3HHLB 4L72B 4PUOB 1BHNA 1W26A 3TR8A 2K3IA 4FK0A 1RTDA 4BHQA 1EO1A 2ZQBA 5KPZA 1U1OA 3BBFA 1WHVA 4RJVA 3BB5A 2E7WA 4ZVQB 2WK4A 4DL4A 2N4CA 3DLGA 4CNYA 1D9FA 3I8BA 3H2VE 4J5OA 4RNFA 1WUUA 3NGKA 3WNFA 4AM6A 2W2PP 3N5FA 2MDAA 2FJEB 2GHPA 3SCIE 9RUBA 1AUSL 4JI5J 3DI6A 4X4QA 3NHGA 3FGVA 3JQKA 4XPCA 2W2MP 3M2UB 2DRAA 1M90O 5D4OA 4EWTA 4NMLA 5EWFA 4FN5A 3VQAA 4TQSA 3LP0A 1S0OA 2HKEA 3C16B 5EX0A 4ZJLA 4BDYA 1FVQA 5LM7E 4FM1A 1M5KC 3ZXWA 2AJ2A 2KU7A 2M2BA 2UUBK 1RADB 3QBCA 3TQEA 4BR5A 2R7UA 1GNKA 3OS2A 3EGVA 5BYSA 3MN6A 2JEFA 4YQWA 3KD5E 4FVMA 1VRUB 3JAMU 3KKSA 2DRDA 1NSPA 4BQLA 3ENOA 3SUQA 1RAFB 2JH3A 2IJFA 1RGVA 2NZ4A 1F5CA 1T9XA 4RU9A 2YKQA 2WB4A 2Z2MA 3BM7A 4NOHA 3H4BA 2MKYA 1SCJB 3T7ZA 4O55A 4Q2LA 4C8LA 1NO8A 1DLOA 2CAJA 3ZZTA 1KVKA 1SAZA 2H3GX 2NPIA 1ESVA 2UXCK 4HEA9 1VSHA 2NREA 2OPRA 4J9QA 3H7HB 2GGPA 5KG6A 1CLFA 2A18A 2X1GA 1FD2A 3O3HA 2RH3A 4DV2J 3DLEB 4FCYA 3K59A 1KVAA 2ASDA 4RW4A 3EY1A 2CQ4A 4EFHA 2VFRA 4Y28C 3KK3A 2UUBJ 2GQ2A 1JCGA 4CK2A 2VYPA 1SL2A 4XPEA 1SH2A 3PW5A 1NPPA 2CQHA 2AGQA 2VGMA 1WOQA 3LF0A 4MIBA 3MWTA 4ZIVA 3DYAB 4Z37A 3RMDA 5J2MB 2UUAF 1KP6A 4G1QB 3ISZA 2R9LA 2XHCA 2BEFA 4RO0A 2UUTA 2V8DA 1T8EA 3HVRA 1FEEA 3KJQB 3AJ1A 1U4BA 2VF3A 1F21A 2GFFA 5IQ6A 2PA3A 2E1YA 2CG4A 4CD1A 1JLFB 4PCQA 2Y3YA 3OYGA 4OHWA 5D0HA 1KKHA 3M9MB 4DSFA 4BC3A 3UI3A 2LXFA 3MMAA 3CJ2A 5HQLA 2B6AA 4DHVA 3NP5A 3UKUB 4CF9A 4DQRA 5KT6A 3LL3A 4LR8A 3R6LB 2YWEA 3L9ZA 1N32F 5FDLA 4X64K 5KFKA 2GMJA 2Z1HA 4P10A 1CJVA 3O4WA 2DFEA 2A42A 3G6EN 2BABA 2XHWA 3O5BA 4ZCMA 4R0JA 1KD1T 2C3MA 4IEEA 3QFWA 2F65A 2QA1A 3CCJN 4EHUA 2KZZA 1HRHA 2RRNA 4PKHA 3R3LA 2J0QD 2J9EA 2A3ZA 3KKRA 4CIGA 3OUYA 4B1WB 3DXMA 5IOLA 2PI5A 1Y5NB 4HVJA 4ITSA 4WU3A 2W6LA 2E2OA 3THWB 1S9EA 1ZTTA 1X0PA 4BY9C 5IC6B 4C23A 4X4VA 4RCHA 3CTRA 4Y1DA 1RE1B 2OPPA 1T03B 3L7OA 2PMHA 2ASJA 3K0JA 5EU7A 2C2NA 5JUMA 2JLEA 3OVNA 2DTJA 3DLHA 4YFUA 4FJKA 1UOCA 5HATA 1DJ0A 1JXBA 4MIAA 2BJEA 3KWIA 4IOCL 4MTPA 2WHOA 3HULA 4YB1P 4B3SF 3J81j 1RT3B 3M8WA 4IQMA 3DRRA 1FFWB 2XSFA 4CIFA 3BSNA 3IRXA 1T9VA 1KHVA 2W4DA 2B9YA 4X64J 3Q7BA 2OD6A 1HQUB 2DIVA 1WEYA 4OJHA 4DV7F 3CM5A 4QS9A 2C2DA 2VOPA 2IVNA 1TAUA 4RW6A 1P8ZA 4WPAA 2P9KA 3M2VA 4CI0B 4DG1A 2KVQE 4U7BA 1FX4A 1NGCA 3T1HJ 1TMMA 4ZOSA 1WSFA 4PHTX 3MCSA 2KT5A 1JLAA 2J76E 3JTNA 3THVA 3NBPA 5LMUJ 2HVHA 2A10A 4ZCIA 2PEHA 1YJTA 4CJ4A 4C11B 3N79A 3OR2B 1D09B 2KO1A 4AQYF 2HIQA 4NYPA 2BZ2A 4FOIA 3O44A 3KUEA 3O9RA 1NJIO 4XO0A 4TVAB 5ETKA 4KO0B 1EJ7L 3G9CA 3TAQA 1QSLA 4HTLA 2YWFA 3DJCA 2VDHA 3PLAA 3CCSN 3CJKB 2YNHA 3R6GB 4M5NA 2Z0GA 3DLLQ 4C48A 1UPPA 2BV3A 3HM8A 1PC4A 3V5RA 1MA9B 1W7AA 2M88A 1FW6A 1L3TA 3HP6A 1RTZA 2F9WA 2C2OB 3R5CA 1TKTB 1X7VA 1UA0A 4U96A 1XMOF 3THXA 1NMNA 3CUNA 1TUYA 3L6QA 4WQ4C 2JGUA 4K8ZA 1C0MA 4MDBA 2MKKA 5IFMA 4ECYA 2E88A 3RW7A 2W42A 2EI5A 1CEZA 4NXNJ 4OI6A 4N8NA 2H65B 3MEDA 3NNHA 2GELA 4DSKA 1VS3A 4J7CA 3J7AP 5AQHA 3ZT3A 5KFOA 5JICA 4OI0A 2VWJA 2CQ1A 3K89A 3MURP 2ZJPL 5CYQA 3VN5A 2PT0A 5DMRA 5HBMA 2X6SA 3BSCA 1X4GA 1CQMA 2DHXA 3HHEA 4UOFA 1N52B 1BGXT 4O4GB 4LF5F 1C4CA 3K17A 3TI0A 5DDQC 1TKZA 3FCHA 1RWNB 1MWQA 2HZAA 2QFIA 2DB1A 3CGIA 2I6WA 4RW9A 1C1BA 2RKIB 1Q7LB 3TYTA 2KHOA 5CZ2A 3LGMA 3ZSYA 2RRBA 1RKJA 1CZ9A 4CQ1A 5KQDA 4UUWA 4CFAA 4DSIA 2AJ4A 3EKUA 1G4CA 4NZ6A 4DV4F 4H0OA 4I2QB 1U0HB 5A8RA 3SBMA 4JI0K 3G82B 2CZVC 3AOBA 3QGPA 4PXBA 3LDPA 2YKOA 3CULA 4ISGA 1F60B 2G13A 3M6UA 4PG8A 4CW7B 2QLJB 3B54A 2CQBA 3MXJA 5DGBA 3NGRA 1NOZA 3MM8B 1FT8A 4J9MA 4OFZA 4E0DA 3LZJA 3A5LC 4FJ7A 4NWBA 5HQ8A 5HRNA 2LLZA 4CLYA 2ROGA 4U8VA 1NH8A 2JHEA 3SQGA 4X4PA 1CXUA 3ZX2A 1L3VA 4LH4A 3B4DA 5CHIA 3H4DA 1LEOA 5GAGP 5HJYA 1QUVA 1U1MA 2HHQA 2W6KA 2IM1A 3T9NA 4CTAB 2P5VA 3HL8A 2LQ8A 3TJAA 3RR7A 2UP1A 1RA7A 4JV2A 3PO4A 3WXLA 1PAUB 1BCOA 1KC8T 3UFCX 4KH4A 4KGVB 1T94A 1YXQA 5FD1A 3MEEB 3PIOL 1Z26A 4RR5A 3ILOA 4OHZA 3BKUA 2DNQA 5A76A 1O1WA 2B7BB 2AP6A 5GINA 2V0NA 2Q66A 4OHVA 1FE0A 3W2VA 1ZTWA 1HR0J 2E6LA 2UXBK 4JI0J 3GDQA 3IG1B 4L3QA 4J91A 5KTQA 2FVRA 1TTHB 1M5OC 3X1LB 3TUZC 4BWJA 2UUCF 4OZ1A 3N5BA 4TN2A 1U6ZA 1IJFB 2ITMA 4NYNA 2A1RA 3SEOA 4G1IA 2OSRA 2YX1A 1ASWA 1BWEA 3C14B 4IR1A 4ZIWA 2CPYA 2VHGA 1FRXA 5AXNA 4BR4A 3J81U 3CG7A 2VQEJ 5BRDA 4ENOA 4DV6K 1BQMA 5DZ7A 3H0PA 3QIPA 5JVHL 4ED2A 5H1SQ 4WIIA 4ED8A 3ZC4A 2DD8S 3QATA 1OH6A 2DGWA 4AXJA 2YWGA 4M5HA 2FZCB 1BC6A 1F1BB 2AU0A 2MPUA 1KSPA 4K0KK 3DRSA 4GMKA 3FZFA 2ZBRA 4WFNL 4M5DB 5D15A 4NLBA 1AZSB 2V9KA 3SYZA 3CDEA 4F3TA 4FM2A 1WEXA 2NRXA 2HBQB 1G15A 5CD4A 1HNWF 4FBUA 5M2UA 3A8IA 1DAXA 3D6FB 3C7NA 5GAEP 2F7TA 2J5AA 3IBFB 4F0HA 4CHPA 1KD1O 1G6BA 2LECA 2F4VK 2Z30B 2W4CA 2W01A 1WC0A 2ZJRQ 5FRNA 1XNRF 2RSQA 2LVWA 1RU2A 4NA3A 2I5JA 5IWAF 5KFIA 1U26A 3DOMB 4C7QA 1JK9B 3HHLC 5EGYA 3BO3A 1TVRA 3BKFA 5K8MA 2CQDA 4DV6J 2AEJA 2O8BA 2X7IA 3QZ7A 4N7TA 4ZLPA 3IWXA 1H1VA 4LUBA 2FD2A 4KRFA 2CKWA 2B9WA 4DTRA 2CGJA 4DFMA 1UAWA 4DR7K 2UVWA 1NKEA 4JKGB 3EVOA 4IBNA 1R89A 2OPQB 3DLJA 4K0KJ 1Q78A 2MQ8A 2X51A 3BQ2A 2YJFA 4UY8T 3TAGA 3R7NB 5FLXU 2RDIA 3H8YA 4NPOA 1JJ2R 1PILA 2QT7A 1UKUA 1F9EB 2DEJA 1DFDA 3WUHA 4RUHA 1Z25A 3IR5B 1LWCA 3OR1A 3OYMA 4OI4A 3DU5A 4B9LA 2IY5B 3MCPA 5FPNA 2AWZA 2G0IA 3EPGA 4F3OA 1FNMA 3KDOA 4K4TA 1Q7YO 1Y7PA 2F4VJ 2OTLN 2VWBA 5ADZA 5ITHA 2FY1A 1C0TA 3MHYA 2VPZB 1NGFA 3ZZRA 1UEKA 5A8WB 4FWRA 3ZT1A 3SFGA 2A3JA 4CLFA 1YRTA 2FSJA 4WFXA 4IZ9A 4ZVPB 5HRPA 1IVZA 3OL8A 3MOZA 3W66A 1AYEA 4X84A 3S3NA 1RYRA 3D2FB 3R8EA 1V3SA 1YITN 4OPKA 4LSLB 3W8PA 2KTQA 2YTCA 2NUBA 4E89A 4IG3B 2V4JB 5EHHA 1X5PA 3R8YA 2AJQA 1Q0NA 4OX9K 4DR7J 2KG1A 4QWBA 5AQWA 1R43A 1QAXA 4E98A 3QNNA 2P9NB 1S1XB 1U25A 4I6MB 1NLVA 3KLHB 1HL6A 2DGQA 3CCEN 3V6DB 4GKKF 2ERRA 5MLCV 5HJXA 6FD1A 1AB8A 1XN9A 2ZC3A 4X4SA 4M5IA 4DTXA 4LRBA 2GAHC 2BACA 2GO8A 1M5SA 3H45C 4GV3A 4DUZK 2Q2RA 2E7VA 5BR9A 1N32K 1FJ7A 2Z1GA 2YHYA 1UP1A 4CE9A 1VSIA 1NUEA 4DR4K 1LW2A 1NDPA 3L4QA 1ZA1B 4M3XA 2Z2LA 1FRHA 1FO1A 3ONQA 3MMBA 3N6NA 3NGUA 1BHLA 1CZAN 1A5VA 2ZDOA 5D4NA 2NRRA 3O08A 5F2RA 2BE7D 4YN3B 3NGYA 1VQ9N 1FCAA 4RTFD 3PIPL 4JP8A 2ZE2B 4Y6IA 3TSPA 4A62A 2QSWA 4CEOA 2EVZA 4DV1F 2XS7A 4KB7A 5E41A 4OX9J 3CJTA 4IOAQ 1FI4A 3JTPA 4OLPA 1IXKA 3PRDA 2VL1A 9ATCB 4MKAA 1Q86O 4X4UA 3J81Y 4EAHD 3AODA 3QESA 4B3SK 5B0EA 3Q2TC 2YKMA 4ZTFA 5IT9O 3W7BA 2CVIA 2D0PA 2VONA 2E20A 4OYPA 5B0DA 4IG0B 4Y3CA 4DUZJ 4F0MA 1YJRA 5IV4A 3BBCA 4NCGB 3ZSVA 2N3LA 4JKCA 1FJEB 1URNA 4AL5A 3VGUA 1HYSB 2EBGA 1JLEB 2E9TA 4DR4J 2CJQA 1DARA 3QMQA 2DITA 3VAIA 2R4FA 4NLYA 2KRRA 2DR8A 3NMRA 2J6SA 1BUPA 4HI1A 4JAXA 4OZ2A 3BGLA 3FEXB 2J8AA 3MR5A 3SUPA 3OYIA 3H59A 2EXUA 2FBYA 3AVJA 2QYCA 1EWRA 2HBKA 5L9NA 1VQMN 3D7EO 1FKOB 1RILA 4AQYK 1JLCB 3UR3C 4I4BA 4H0YB 3GFXA 3UNYA 4E7JA 4H4MA 1WF2A 1GLLO 4DB3A 2XY5A 1KC8O 4DQ8A 5ETRA 2M8HA 2DNGA 1PYTA 3G10A 2H3EB 2FHMA 3P4UB 2R2RA 3CFPA 5L8RC 4EUVA 5JVGQ 4CK3A 2QGFB 4KB0A 2KT3A 4CJLA 2HHWA 7FDRA 2ACYA 3P4IA 2RE1A 3DXSX 2QLWA 1P1TA 2YX4A 4WTOB 4I9LA 4O8UA 4FVUA 3MN5A 3HSDA 4JV1A 3C6TA 2VBXA 1HW8A 4LR9A 3R5AA 2GC8A 4ECUA 2ATQA 1K8KA 4LF6J 1YBUA 2KQ2A 2ZNZA 5FLXY 3MPUB 4ZKAA 4CIOA 2XG8A 2FLOA 2VGNA 4YOEA 3L2RA 4J37A 3EICA 3G6ES 5DG7A 3VA0A 3PR5B 2GO9A 1VSLA 2EFNA 3PEHA 3KLGA 1WSRA 2BJDA 4AQYJ 4DL5A 1RDUA 4OO1J 4C4WA 1T3NA 4LF5K 4CP5A 4W5QA 1N5YB 3H90A 4RNHA 4AUKA 1VCTA 2IRUA 1WHXA 1SUQB 4TU8A 3VQ4A 1ITPA 4M42A 1T05B 3A13A 1PJ7A 4WQ4A 2QMUB 1NK5A 4W5TA 3V6HA 1EB0A 3OHRA 4QIVA 3GFHA 4R0EA 2K7JA 4JI1F 3LP2B 1EQ0A 4DV4K 4X2BA 2FDNA 2CJYB 3AJDA 1K6YA 1WDDA 3UN5A 1N48A 5DLGA 1NGHA 4DR5F 3IDHA 2FHJA 2VKZG 5K14A 1S0MA 5BRFA 2DXEA 1KFSA 1VMBA 2XC9A 3OTCA 3MM6A 2NXEA 4JV5J 2ZJQQ 4B08A 4A8MP 1LV5A 3M8PB 3T5KA 2G2OA 4EZ6A 3TP2A 3JXUA 4FOEA 3UNGC