3FFIA

Hiv-1 rt with pyridone non-nucleoside inhibitor
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
553
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Pyridone Diaryl Ether Non-Nucleoside Inhibitors of HIV-1 Reverse Transcriptase
rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 151
structure length 549
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ffiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ffiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ffiA05
3BSAA 3U3GA 3DOLA 1T03B 1S9EA 1JLGB 4W5TA 4WFZA 4BWJA 4FLXA 3H98A 4CJ4A 1VRUB 3LP2B 1HQEA 4FK2A 3HP6A 2AJQA 1ZETA 1Q9XA 2YNIA 1IKWA 1R0AB 3NAEA 3HO1A 4ECSA 3GV8B 4ZPDA 4B8AB 1UA1A 2P5OA 1C0MA 2OPQA 1S48A 1NOZA 4XIUA 2WOMB 3G6XA 2W9AA 1HMVA 4F4YA 4YQWA 1XR6A 3LP1B 4M3TA 5SZTA 5EU7A 1BISA 1NK6A 3FQLA 4DTSA 4CJEA 4MKAA 2RF2B 3M8PB 3KLHB 2XY8A 4EYIB 2YKMA 4Y3CA 3QNOA 1RTDB 4CK3A 3I5AA 4J9RA 3CDWA 3AVLA 4TLRA 5KFDA 3AVGA 2BE2A 1Y97A 3BSCA 3CJ5A 3SPYA 1VSDA 4CF0A 2RF2A 2ASLA 4YR3A 3SUNA 1N48A 4FM2A 3CG7A 2RDIA 4ECYA 1KLMB 1JLBB 4IBNA 3FFIB 1FK9B 1VK0A 3O4QA 3AA2A 4ECTA 2B6AB 1W25A 4MQ3A 1JLEB 1KLNA 2V4RA 2ALZA 4GMJB 4W5NA 1ZBUA 4LSLA 5T14A 2RN2A 4FLZA 4LSNB 3DI6B 3H2LA 4ELUA 4FLYA 4DFKA 3V6JA 4AHUA 1QQCA 4H54A 3QERA 1L3VA 4J2AA 3TVKA 1RAJA 3QEWA 4KE5A 5KFAA 4QWDA 1S0NA 2ILYA 1U4BA 1TKDA 4CEBA 1JLEA 1ASWA 3K57A 3NGIA 2ASJA 2R2SA 5EWFA 3VQEA 4JS4A 4DSLA 4FJJA 3ITHB 4CESA 2HNDA 3UDLA 3OS0A 3N6LA 5HRRA 3MTKA 4O3NA 1C1BA 1LWCB 3CFPA 3S3NA 4DU3A 4Z4EA 1FXXA 1BL3A 1L3SA 2IOCA 4CJ5A 3OYAA 3MEGB 2UVVA 4URGA 5DG8A 4IR9A 3M8RA 2JC1A 4RW9B 2D5RA 3TANA 2VG5A 2R8JA 1LV5A 3I0SA 4FS2A 5DLFA 2GIQA 5KFPA 3VQQA 1T05B 4KV8A 4ECRA 4XPEA 2HHUA 3RAXA 1LW2A 1SUQB 2HNYA 3M8SA 3TAQA 3NH0A 2X6SA 4DQSA 2D41A 4O55A 4FBTA 5J2NB 3SQ2A 4FJ5A 1S6PB 2FJXA 1S0OA 5C25A 5E41A 3NAHA 5KFUA 3F9KA 5T7BA 1NJWA 3D0PA 4HYKA 3OYIA 3LWMA 3K5MA 3IN5A 2DFFA 2G8IA 1SV5A 4G1QA 3N6NA 4O0IA 4M3WA 4DTRA 1S1XB 1C0UA 5KI6A 4HCCA 4F50A 3T5JA 3KLGB 4OVLA 4H4OB 3NH2A 2R8GA 3KD5E 4K8XA 1BI4A 3S9HA 4NLWA 1ZYQA 3PW0A 3HPGA 1JXLA 1G15A 2DFEA 3KK3B 5F8NA 3GYNA 2R8KA 2FVSA 3MFHA 3GV7B 1L3TA 1TL3A 3OL9A 3KJVB 1JKHA 5KRTA 3N6MA 4TY8A 4WE1A 5CZ2A 5KG3A 3V6KA 1FKPB 4ECZA 3H08A 2OPPA 5C5JA 3TAMA 3LZIA 4DG1A 4K4YA 2FBTA 1QTMA 3BQ0A 3PW4A 2JEFA 2E9RX 3H5UA 1HYZA 3TI0A 3AVHA 3HL8A 4NLQA 1FKPA 2G8KA 3DOKB 4J9SA 2Z1IA 4CE9A 3HM9A 2AGQA 3CM5A 2IDOA 3DRPA 3DLRA 4KB1A 1VRTB 3MEDB 1D9DA 3DMJB 1XWLA 4KPYA 3MR5A 4KBIA 3HVAA 3LP3A 3OS1A 2GV9A 2ZE2B 2XRIA 1UAXA 4DF4A 4M45A 3QLHA 1IKVB 3L3UA 3QESA 4CGGA 1EP4B 4DU1A 3AA5X 3CYMA 3V1QA 1DTTA 3BSOA 3C6UB 2AU0A 3M9OB 3BGRB 4ELTA 1RDCA 3V81A 2R2TA 4KI4A 3QO9B 2F8EX 3GILA 4CJLA 4Z4GA 3OYDA 1EETB 3V6DA 3KLVA 3OYKA 4KB0A 5KFMA 1RBUA 3LP0A 2DPJA 4RW4B 2E9TA 1VSFA 3C6UA 5KFRA 2XO7A 5I42B 2WCXA 1K1SA 4NCGA 3DLEA 5CZ1A 3DLGA 5SWMA 3TARA 3G6VA 1RTJA 3MR3A 3QO9A 2BQ3A 3ISNC 5C24B 3U3YA 1NKCA 2PYLA 1ZBHA 4IFYA 1RTHB 2AX1A 1NOYA 1QS4A 2ZKUA 4EBDA 4OPJA 4MFBB 2HNZB 4IFVA 1NKBA 4F4ZA 4WXWA 2IM2A 4NLXA 3AV9A 5D3GA 4O3QA 4CHQA 1S1VA 2X6NA 3C94A 4NCAA 4ZVHA 1GOCA 4DU4A 1RTHA 3O3FA 1YT3A 3AVNA 4M3UA 4Q0BA 4WYLA 3CJ4A 2OA8A 3RRGA 1JLCA 3O3HA 4DTOA 4F3OA 3T5LA 5KFEA 3H59A 3PX4A 1QE1A 4FJHA 3K5LA 4JUZA 4DLGA 3PX0A 3C95A 3TWHA 4FK0A 4CHZA 3VQ6A 4DF8A 1BQMA 3HPHA 1S4FA 4CEEA 1T7PA 2E9ZA 4DL5A 3ZSRA 2E4LA 2F8TA 4ECVA 1ZBIA 4MIAA 1ITGA 1S10A 3QGIA 3VQ5A 2KFZA 5KT7A 2AX0A 4Z0UA 3KHRA 4DLEA 4WFXA 2IAJB 2VWKA 3LANA 5KG7A 4DQQA 2FVRA 3SUOA 4CJWA 4ZMMA 3ICLA 3H4BA 4CEFA 3OVNA 4QWAA 1IM4A 4HKQA 4Y34A 2HAIA 3V4IB 2CKWA 2IM0A 1VSEA 4I2PA 1LWEB 2I5JA 5KG5A 4DQRA 1YTAA 1RT3B 5KFGA 5KFQA 2ILZA 4GC7A 3T3FA 3DM2A 3GQCA 2DPIA 1A5XA 2O4IA 2VG6A 4ZHRA 4QCLA 5HLFB 3NE6A 2J6TA 5K14B 4RW8B 3CQ8A 4DWIA 4B9VA 1J54A 3E01A 3AVKA 3L2WA 4FM1A 4DEZA 4KHNA 4NYFA 1RT5A 4PUOB 3BQ2A 3FRZA 3C6TA 4Q8EA 3KK1A 2KTQA 2C2DA 3PW2A 4Y1CA 3OYCA 5L1IA 1W9HA 5J2QA 1DLOB 5CYQA 3UQSA 4TXSA 3OSNA 2HHTA 1TKZA 2GUIA 2C2EA 3CDEA 4KAZA 4U7CA 4OJRA 2QK9A 2P5GA 1C1CB 3KLFA 4E7JA 4MH8A 2UUTA 3DYAA 4DSJA 1QSSA 4JRQA 4NLTA 4QW9A 1HNIB 3A2FA 1U45A 4K4TA 2R8HA 2IC3A 1DLOA 3BREA 3NKYA 3AVCA 4CGHA 3MEEA 1JLQB 2XY6A 2YNHB 4R5PB 4DL2A 3TR8A 4CFBA 1C1CA 5HROB 1SH2A 5KFWA 1I3AA 3L8BA 3SV4A 3VQ8A 2ZD1B 4B3OA 3P1GA 4I9QA 3WNEA 4IKFA 3OHBA 4O44B 5CYMA 4E1MA 1C0TB 4TYBA 4YFUA 4CJPA 3V9WA 1WN7A 3M8QA 3ALYA 3MECB 1WSFA 2Y1IA 2QV6A 3NL0A 5HROA 4O3RA 3IRXA 1S1UB 4CJSA 1CZBA 3I5BA 3KD1E 3T5HA 4J9PA 3SZ2A 2XGQA 1RT7B 1TKTB 3GIJA 4O44A 1S1WB 3HVTA 2OH2A 4NLUA 1C0TA 4ID5A 4EO6A 4M3YA 1SL1A 3CDUA 3JYTB 2D3UA 4WYWA 4RW6B 4ZPBA 4E89A 4RNOA 2JC0A 2W9CB 1J5OA 2VA2A 3RR7A 3ZT2A 1MMLA 3QZ7A 1SKSA 4CERA 3B6PA 4DSEA 4OLBA 5KRSA 4R0EA 4J2EA 4HUGA 1WSHA 2KZZA 3KK2A 1WLJA 4CEOA 4O3OA 4RW6A 2WONA 2W9CA 2X74A 3QIPA 3CJ0A 1D8YA 2C28A 3M9MB 2YNFB 1SKRA 1BHLA 4PWDB 1C6VA 5KT2A 3ZT4A 4ZTJA 4KKOB 2UVWA 5KFYA 3SI8A 1WSJA 3OL6A 3NFAA 1BCMA 1BQNB 1T03A 1JLGA 2J6SA 4CF9A 2OZSA 2FBXA 1VRUA 1S6QB 3LP2A 5DQGA 4PWDA 1RT6B 4J9QA 5DG7A 5F8IA 1RDDA 2F96A 4IDKB 4BDZA 4FZXC 4BE0A 3QEXA 4ZPAA 4M41A 3OYEA 3TAPA 1R0AA 3SFGA 3MXMA 2AGPA 1B9FA 4DL4A 2VG7B 3H40A 4GC6A 4CJTA 3SYZA 2WOMA 4I9LA 3PW7A 2CJQA 1HQUB 3NHGA 1TAUA 3PV8A 3LP1A 5KGWA 1WAJA 4C8OA 4I2QB 1RBVA 1RNHA 4E0DA 5FRMA 4FLVA 1KTQA 2BR0A 2EX3A 2BRLA 5I3UB 3CO9A 3M8PA 4AH9A 3L2UA 4FZYA 2VG7A 3KLHA 1YTUA 3OJSA 5F8LA 1ASVA 1RBTA 1QSLA 1RTDA 4FJIA 1K1QA 4FCYA 1HQUA 4FJ7A 3VA0A 1RT2B 1L3UA 4OKJA 3DLBA 3VQCA 3MR2A 1SH0A 2YHAA 3WNGA 4CEAA 4EP5A 4WFYA 3D5MA 3FSIA 3RMDA 3IAYA 4C8LA 3ASMA 3SFUA 4EP4A 1KLMA 3OJUA 1JLBA 3RTVA 3FFIA 1FK9A 4IKAA 2XCPA 4O4RA 5KT6A 2QXFA 1T94A 2B6AA 1JXBA 4FW1A 3DLKB 5J1EB 3AO5A 2HWIA 4KHRA 4KO0B 4ED6A 3UPFA 4O5BA 3AVFA 4KREA 4LSNA 3DI6A 3SUPA 4JS5A 4DFPA 4N41A 2FLPA 3OYGA 5FROA 4DSIA 4E7KA 3RB0A 3EPIA 2YKNB 4K50A 2QE5A 4RNNA 2ASDA 3DLKA 3QGHA 4CEZA 1JLFB 2UVUA 4KO0A 3L2VA 2XC9A 4LQ3A 3NCIA 3AA3A 4DSFA 5FDLB 3JSMB 3ZSQA 3ITHA 1IKYB 1SH3A 3OYMA 2W7PA 2KFNA 4O3PA 1LWCA 4RUAA 2ETJA 3HSTB 3IG1B 4E7LA 1JLFA 4LH4A 3MEGA 3HT3A 2DY4A 4RW9A 4LD0A 1RDRA 4CJVA 3H5YA 3B6OA 1EX4A 2W9BB 1LWFB 1JL1A 2DFHA 4FXDA 3WNFA 2KQ2A 1T05A 4N5SA 3AO1A 1HNVB 5DGBA 4Q45A 5KFTA 2IM3A 3SPZA 1SUQA 1RDAA 3D45A 2PYJA 4NRTA 1ZBLA 5F8GA 3TAFA 3LAMA 4RU9A 5J2NA 3OYLA 4CEDA 3SCXA 3H5XA 4F4KA 1S6PA 4FYDA 4DTJA 5F9LA 3OLBA 4O0JA 4RNFA 4CHOA 3QIOA 4F3TA 1KCFA 5EUHA 4IOBA 3KKSA 1S1XA 1FKOB 3KLGA 4H4OA 3K5NA 1Q9YA 1QUVA 3OL8A 4O4GB 1REVB 4DSKA 4H8KA 4C8NA 4BDPA 5KFCA 4QPXA 3KK3A 4NLOA 4DMNA 1UOCA 1KHWA 4ZVEA 3NMAA 4OKKA 4Z4FA 3NDKA 3VQ9A 3KJVA 4K4UA 4IG0B 4MK9A 1RT1B 2IS3A 2V9WA 1LAWA 3SV3A 2FBVA 1U49A 2XGPA 1A5VA 3NF6A 4PQUB 4EZ6A 3DLHA 1J53A 4KTZA 4KTQA 4IH5A 3DRRB 4WZMA 3HYFA 4FM0A 1X9WA 2Q3SA 3P5JA 1GX5A 3DOKA 1U48A 1JX4A 4M3ZA 2QKBA 2YHBA 1VRTA 3MEDA 4K4SA 4F2SA 3DMJA 2IJFA 4FJ9A 3ZSVA 3VQPA 4DL6A 3HHKA 4PQUA 2XCAA 1J9AA 2ZE2A 2PY5A 4J9OA 1RILA 4FLWA 1IKVA 2JLEA 1EP4A 2FVPA 1NK4A 4IH6A 4ED7A 4DQIA 1CXUA 3BGRA 1D5AA 3T19A 3OYJA 3KLIB 3O4NA 1RYSA 3ZT3A 3NF8A 1EETA 2Y1JA 3AVAA 3QYYA 3SQ1A 2UVRA 1VSIA 2BANB 4OGEA 3PZPA 4LH5A 4RW4A 1W0HA 5I42A 1S9FA 2G8UA 4URQU 4L8RB 3QEVA 3ZSZA 1HJRA 3K5OA 5C24A 1NK8A 4OLAA 4Q43A 3EZ5A 4RNMA 5L1JA 4CJ3A 2XHBA 1N5YB 3V9XA 1MU2B 4MFBA 2HNZA 1XHZA 3QIDA 4YR0A 4CGJA 1S1TB 1HYVA 3OS2A 4FJNA 4DL3A 3IS9B 4LY7A 3EY1A 2VA3A 5KGXA 4K4ZA 4KAIA 3MFIA 2I1RA 3AO4A 4FJXA 3K2PA 1QSYA 3FDSA 5HBMB 4FLTA 1S49A 3BR9A 4RNHA 5DGAA 4J2BA 1TQLA 1S9GB 1S97A 3NBPB 2OPSB 3V9ZA 5KFJA 2AWZA 3CWJA 4J2DA 4CIFA 4ED8A 3SQ0A 4HHTA 4KSEB 1RTIB 5DMRA 5KG2A 4FJ8A 2HMIB 1EXQA 3PY8A 1TKXB 3V1RA 2B5JB 1B9DA 1WSIA 2D0CA 3BSNA 3D28A 2W7OA 2A1RA 2OPSA 1KVAA 2R7YA 3PJXA 2IAJA 2BQUA 4O3SA 4M3RA 3SUQA 2KZMA 3AO3A 3KOAA 4CF8A 3DDKA 3KKRA 2YNGB 1GOAA 1RT4B 4DFMA 1TKXA 1RBRA 3TAEA 2JEIA 4Y2AA 4HUEA 1Z25A 5J2MB 2IMWP 3TQ1A 4K8ZA 4IR1A 3V4IA 1UWBB 2X78A 1LWEA 3RMBA 3FQKA 1RT3A 1QAJA 3RWUA 2OPRB 3RB6A 1F21A 3KLEB 2HHSA 1Z4UA 1TVRB 5HLFA 2C22A 1JLAB 5K14A 4RW8A 4KHSA 1NHUA 4AHTA 5C42B 2V4QA 2RDJA 3GIIA 4CFDA 3PO4A 3QZ8A 3ZSYA 2B4JA 4PA1A 1B92A 3NH1A 4PUOA 5KT5A 3HK2A 2OPRA 3ISND 4TN2A 1VSLA 3DRSB 1TVRA 4QOZB 4ECWA 1TK0A 2FVQA 1KRPA 4TSXA 3Q8PB 3AVMA 2D7SA 3Q8RB 4Q5VA 3OYNA 3CIZA 2VWJA 4ED2A 4B9SA 4YMEA 1JIHA 1HRHA 2HB5A 3LPTA 1HNIA 3LZJA 4JRPA 4M95A 2GC8A 5F8MA 3VQAA 3RBEA 4Z4CA 4R8UB 4HUFA 1JLQA 4IQXA 2YNHA 1HYSB 4R5PA 3VQSA 2IA6A 3PR5B 4BWMA 2ZD1A 1TK8A 4KRFA 3Q8SB 1NK9A 2G8HA 4ZP8A 1CZ9A 4CEQA 4RW7B 5DLGA 3PVXA 4MK7A 1HYSA 3MECA 3QNNA 4ZVGA 4Q44A 2GIRA 4E19A 4DTXA 3VA3A 1S1UA 3NGZA 1LW0B 4I7FB 4IG3B 3AO2A 1NHVA 1RT7A 1TKTA 3ZSWA 4TQSA 4WXOA 4FJLA 5FRNA 1S1WA 2HVHA 1YVFA 3JYTA 1S9EB 3QETA 1JXEA 1C1AA 3BJYA 1TK5A 1XI1A 1RCHA 5KG0A 4W5OA 5DQIA 4DS5A 4CGFA 2OZMA 1QHTA 1WNSA 2YNIB 4CHNA 4IH7A 2IJNA 1IKWB 4JV2A 2HVIA 3K59A 1NJXA 4NYZA 5JS2A 4QAGA 2HWHA 4DS4A 3KHHA 3G10A 2OPQB 1LAVA 4ID1A 3S3MA 2YNFA 2AGOA 1VSMA 1HMVB 4NLYA 3VQDA 4KKOA 3TAGA 4UQGA 4ECQA 3THVA 2HHVA 1U09A 1TGOA 2RKIB 4J9NA 5KFBA 3LALA 3ZCMA 2FVCA 1BQNA 4FJKA 4KB7A 4Y1DA 1RA7A 4FK4A 2YKMB 1X9SA 3UR0A 1S6QA 4AILC 5KTQA 3PO5A 3UIQA 1RT6A 4RUCA 4CCHA 4JV0A 2BE2B 4IDKA 4NZ0A 2KW4A 3BDPA 3MR6A 1DTQB 3TABA 2RKIA 4Q8FA 2WRMA 4TYAA 4K4WA 3KNAA 4LQ9A 3ZT1A 5KFVA 4TQRA 2JGUA 1CLQA 4CF1A 2PZSA 4OL8A 1NJYA 3RB3A 3HVWA 4KHUA 1KFSA 3VQ7A 4CECA 1S0MA 4I2QA 4GVMA 1D1UA 1DTQA 3VQ4A 4EZ9A 3E51A 5I3UA 3GIKA 5EWEA 4LSLB 5KFSA 1I39A 3LDSA 4KHMA 2R8IA 2P1JA 2EHGA 3CM6A 2XY5A 3RAQA 1S5JA 2DTUA 1XC9A 4HTUA 3CJ2A 1RT2A 4HVJA 1X1PA 4OPKA 1ZTWA 5F8HA 1SL2A 2J6UA 1WAFA 3H4DA 1N4LA 3QGGA 4DTMA 2HNDB 3SNNA 4B9LA 4F8RA 4CJFA 4AHSA 4NLVA 1KHVA 1C1BB 2JEJA 5J1EA 5HP1B 2YV0X 3VN5A 1JL2A 3SQ4A 4E7HA 4ZTFA 4PY5A 2B43A 5L1LA 3O3GA 2VG5B 2Z1JA 3L3VA 5L9XA 1U04A 2D0BA 3I0SB 1IO2A 5J2PB 3NAIA 3MXJA 1SKWA 4B9UA 5KFHA 3MAQA 4FJGA 3HXMA 1N6QB 1GX6A 2YKNA 3ZSXA 2BRKA 2WB4A 3LWLA 5HP1A 4ZP6A 1XR7A 4KV8B 1OS5A 3RBDA 3RB4A 4DTPA 1LW2B 5FDLA 2HNYB 5JXSA 3I8DA 3JSMA 3M9NB 3I5CA 5HRSA 3V6HA 2A1SA 4DL7A 1IKYA 5J2PA 3ULDA 3CFOA 4MKBA 1N6QA 1T8EA 4M94A 5C25B 3IG1A 1YVUA 3WNHA 3OYFA 5F9NA 1NNDA 4FVMA 1IH7A 4ED0A 4OGCA 1NK7A 3PX6A 1GOBA 4NLSA 1SV5B 1TV6B 3ZSOA 4G1QB 4E7IA 3RMCA 4EO8A 1IKXB 1C0UB 4J9MA 4CGIA 3OY9A 5JS1A 2W9BA 1LWFA 2R2RA 1D0EA 1Z26A 3V9UA 1QAIA 1U47A 1BI4B 2EC0A 2D3ZA 5HRPA 4CJUA 4E1NA 4ZPCA 1HNVA 4F4WA 4CJRA 1ASUA 4ELVA 4QWBA 1TV6A 1RYRA 1TL3B 1IKXA 1JKHB 4TY8B 5JUMA 4WE1B 5EDWA 1CXQA 3L2QA 3OLAA 3HVRA 4B9NA 4TY9A 4RZRA 5DG9A 2OPPB 2E6MA 3TAMB 2XI2A 2W8KA 4FBUA 2D0AA 1NK0A 4IRKA 2GBZA 4DG1B 4JV1A 4KTWA 3I0RB 2XY7A 4FJMA 4ZP9A 1FKOA 3PUFA 4CFAA 4CJQA 4O4GA 3DRPB 1REVA 2BQRA 1WSEA 3K58A 2ATLA 3OSPA 4Z4IA 4B08A 4DQPA 3H5SA 3I0RA 2IBKA 4ECXA 4IG0A 3QLHB 1D9FA 4U6PA 1RT1A 4K4XA 3OYBA 4H4MB 4IRCA 3NF7A 2IM1A 4CF2A 1DTTB 2C2RA 4MIBA 4Z4HA 3OL7A 1T3NA 3MXIA 3U6FA 5DQHA 3KHLA 5KFIA 4ED3A 3KIOA 4WZQA 3RR8A 3V81B 4J9LA 4M42A 2F8SA 3DRRA 3V6DB 4ED1A 2FLNA 1N56A 3F73A 4H4MA 1TL1B 3CJ3A 2W42A 3LP0B 5KFOA 3KMSA 3Q8QB 4CJKA 1A5WA 4OKEA 4NCGB 3DLEB 2ZQBA 3DLGB 3EZUA 4AHCA 4W5QA 2IGIA 1RTJB 3SI6A 4YR2A 1KSPA 4KI6A 4IFYB 4B8CA 4YNQA 4X2BA 4ZVFA 4FZZA 4CGDA 1TL1A 4IFVB 2E6LA 5CY4A 3HPOA 4QW8A 3T5KA 4QWCA 1VSHA 5D3GB 1S1VB 1BCOA 3KLIA 3NGDA 4CIEA 2G8FA 1X9MA 1Q8IA 1NK5A 3GV5B 4ICLB 4FS1A 3VQBA 4AHRA 1HARA 4Q0BB 1O1WA 2HHWA 4BE2A 2BANA 5KFFA 1JLCB 1I6JA 4F4XA 4ECUA 3GIMA 2O4GA 3AVJA 1QE1B 2P51A 2WHOA 5KFXA 2Z1GA 5KFKA 4N76A 4ICLA 1TAQA 4NYNA 1VSJA 1BQMB 3BQ1A 3AVBA 1N5YA 2QKKA 1MU2A 2NUBA 3KTQA 1HPZB 2RPIA 1S1TA 4K4VA 1ZTTA 4FW2A 1KVCA 4KHWA 1SL0A 3IS9A 1WNEA 1EKEA 2OYQA 2BDPA 3PHEA 3HKWA 1XHXA 2FBYA 4Y2CA 4CHPA 3PJWA 2ITGA 3QEIA 4CK1A 1RA6A 4NCBA 3NGYA 2WK4A 3G0ZA 1HPZA 3QINA 5HBMA 5F8JA 2UUWA 2WTFA 3V9SA 4B9TA 4W5RA 1S9GA 4I2PB 2I5JB 2XI3A 3NBPA 5KT3A 1BIZA 3HJFA 1BGXT 4EEYA 3DM2B 3RMAA 3PR4A 2G8VA 1ZBFA 2Z1HA 2VG6B 5HRNA 4NLDA 3NF9A 4ZHRB 3IGNA 1RTIA 2HMIA 4DTUA 5KFNA 2B5JA 4QWEA 4XPCA 2HHQA 3E01B 3RRHA 3LAKA 3OHAA 5DK5A 1RT5B 4BE1A 4CK2A 3C6TB 3KK1B 5L1KA 3S3OA 2YNGA 1RT4A 5KT4A 4NLRA 1WSGA 5J2MA 5J2QB 5CYQB 5KG4A 4AHVA 1UWBA 4CFCA 1TKZB 4DFJA 4HCBA 3P83D 2FJVA 4IRDA 3KLFB 2FLLA 2HW3A 3KHGA 2AQ4A 3DYAB 5KFLA 4M3XA 3KLEA 4YP3A 4NRUA 1JLAA 4CHYA 3AVIA 4URSA 1XR5A 2IC3B 2LSNA 5C42A 1TP7A 1L5UA 3SJJA 4C8KA 2JEGA 2XWYA 4KFBB 3MEEB 1UA0A 3T1AA 2W8LA 1NJZA 3CFRA 3IGVA 1NKEA 3QEPA 5KFZA 3EPGA 4B3OB 4EYHB 3DRSA 4GW6A 4EBEA 1RDBA 5KG6A 4RG8A 5CYMB 1C2PA 2V0NA 2G8WA 4XO0A 1RBSA 4KFBA 3M8QB 2HHXA 4NLPA 4B9MA 3IRXB 4KHYA 3LPUA 3PW5A 3CVKA 1KVBA 3HVTB 4F2RA 5KG1A 1K6YA 4ID5B 1CSJA 4FLUA 3HP9A 2ATQA 3ZT0A 2R2UA 4R8UA 4E3SA 2FJWA 3KMQA 4CIGA 4EBCA 4DTNA 3G6YA 4N56A 3OYHA 4KHQA 1J5OB 1VSKA 4NLGA 4C8MA 1IG9A 4N47A 3MF5A 1BIUA 3V1OA 3KK2B 4J9KA 4JLHA 4RW7A 3DOLB 3AA4A 4MK8A 2WONB 3QIPB 2O5DA 4ZP7A 1LW0A 1HQEB 5EWGA 4G3IA 4BACA 4BDYA 3L2RA 4I7FA 4IG3A 2FC0A 1KFDA 2BGGA 3EYZA 3G86A
chains in the Genus database with same CATH superfamily
2GX9A 4WP9A 3BYRA 3QFUA 4YDDB 3BSAA 1JLGB 1FX4A 3CCMN 3MDQA 2HEKA 4BWJA 4Y65A 1B70B 4FLXA 1X4EA 1KP6A 4CJ4A 4M5HA 1HQEA 4FK2A 3WXJA 4RWWA 3CCWA 3HP6A 1BQXA 1Q9XA 2GGPB 3DLLQ 4AQYK 2UUCF 4P75A 3TUZC 2ZH5A 1UA1A 4OPHA 1VAZA 2OPQA 4LFAJ 4C2MA 1RKJA 3I56S 2LA6A 4X4RA 2UV8G 1YJRA 3QT6A 2MSTA 2DR5A 2QG9B 5EU7A 1BISA 2YY3A 3D0IE 1K8KA 4CJEA 3AB2B 3QICA 4EMDA 3O9QA 2DTJA 3EGWB 4EYIB 3UD3P 4YOVA 4I64A 4M5LA 3WC0A 2CPEA 2HFUA 3RZAA 2CGJA 3BSCA 1U7LA 4CF0A 1I5OB 2YX7A 1Y10A 3SUNA 4DV0F 2BXJA 4Q2MA 5BJRA 1N48A 4LF4J 1N36J 2DNYA 4P74A 2RDIA 4ECYA 4BRIA 4JHDA 3UO0A 1KLMB 1JLBB 2P9LA 2A42A 4K41A 3T1HK 2PMWA 2ASYA 1YVNA 1FHTA 1WOQA 4LR9A 2V4RA 2OSRA 2ALZA 2YTCA 4W5NA 4LSLA 5T14A 1WOOA 2P6SA 3D6MB 2RN2A 3GL1A 4J9UE 4A46A 3GB0A 1H74A 4D3GA 2VV5A 3U02A 3QEWA 2VJVA 1X0FA 4QWDA 1RISA 1UVIA 2GQCA 1U4BA 1JLEA 4LF2A 1J27A 3NGIA 2ASJA 4UQTA 5EWFA 5C2FA 1JWWA 4F04B 2J4RA 1XMBA 5AZJA 1HR0K 1Q53A 2Q66A 4MYUA 3ZXWA 3UDLA 1ILYA 3OS0A 3N6LA 2HQFA 2IDLA 3MTKA 4NMLA 1LWCB 4A5AA 1GMVA 2G1DA 1BXNA 2OUGA 2QA4S 3W62A 3ONQA 1XEZA 3ZX3A 4IR9A 3QB0A 4KH1B 2EC2A 2R8JA 2VDIA 4NXNF 3PCOB 4A8YA 2U2FA 2CIMA 2Z2ZA 5A8RA 3RBZA 2FY8A 3EGVA 4XPEA 1VMBA 4OYAA 3RAXA 3WXKA 1U1OA 3OBIA 2QI2A 3OHRA 1YRUA 5I9EB 2QL9B 1ZOTA 4B17A 1S6PB 2I38A 1FD2A 2PT0A 5AXKA 5C25A 1OJ4A 1ZM9A 3QBXA 3F9KA 3IO1A 5T7BA 3M32A 4L6V3 3AQPA 2V7ZA 1GH8A 4M3WA 3N6NA 2XSJB 4CYUB 3A8IA 3KLGB 3TJAA 1SC1B 4K8XA 1RWWB 3CCQS 1VDHA 3HPGA 1Y3KA 2DFEA 2E1MC 1HKAA 3GYNA 1NPPA 1UMJA 5HATA 5F8NA 3GV7B 4ITSA 1RWMB 5IV3A 3THYB 1WF2A 4WE1A 5CZ2A 2FF3B 3T7ZA 1FKPB 3U7JA 4UW2A 2A2DA 2RQ4A 4IO1A 3AJ2A 2VODA 1M5VC 1S7HA 2ZH9A 1R31A 4X65J 4U8VA 2GVDA 3HLUA 4B3MK 1WOPA 2JDJA 3AVHA 3QAUA 4NLQA 3SQGA 4EI2A 2NSCA 4DR7K 2FLOA 2IDOA 4KB1A 3DMJB 2HK3A 4LF9J 3HVAA 4QIVA 3FZMA 3LP3A 3F5TA 1VYAA 5JLHA 1M5SA 1P27B 2F4VF 3CCSS 1IKVB 2ASOA 2UUAJ 1LOTB 3AA5X 3D3BJ 1DTTA 4LVOP 2AU0A 2QA1A 4M5NA 1YJWS 3GDQA 2NXCA 3FBEA 4BY9C 1YUWA 3ZZPA 4KI4A 4F3QA 2F8EX 4CJLA 4OO1J 1ITPA 2XLJA 4KB0A 3JQMA 5KFMA 5BPLA 2QTWA 2P9KA 2E9TA 4A47A 3C6UA 1K1SA 1U2VA 2ZUAA 5BRHA 3DLEA 5SWMA 4JI7J 3TARA 3G6VA 3QO9A 2XYPB 3ISNC 2AJ0A 4LFCJ 2J0XA 4ILLA 1YJWN 1QS4A 3KZBA 2G2YA 3AFGA 4WFBL 4MFBB 4PHTX 4IFVA 1GTEA 1NM2A 4CLZA 1WD6A 4NLXA 3AV9A 2F5GA 2Y9HA 2SXLA 2X6NA 4DHYA 1J2VA 1P90A 4ILJA 3FZFA 3WIUA 1SS6A 2AKWB 5JMNA 3CJ4A 2OA8A 3Q89A 1S3XA 2EG1A 4P73A 3T5LA 4C0BA 3DRXA 5AXNA 1YXQA 1Y0HA 3K5LA 4ZIVA 4DLGA 3J7AP 2HK2A 4I67A 3PX0A 3C95A 3Q7BA 4FK0A 3FBBA 4CHZA 3VQ6A 2AHOB 2EKYA 3CJ1A 1RBOB 3PYFA 5ETVA 2DGUA 3ZSRA 2XLIA 2F8TA 4ECVA 9RUBA 2KXFA 1ITGA 4PG5A 3VQ5A 2KFZA 2Z56B 4WFAQ 4G65A 3O9UA 3KHRA 4WFXA 4CJWA 2AF6A 2MQLA 1N54B 4ZMMA 1QY7A 2J7WA 4HKQA 1H73A 4LFBK 2HAIA 1X5PA 2AJFE 4I2PA 2EBEA 2I5JA 1YTAA 1RT3B 2P8IA 3MMJA 3DM2A 3GQCA 2DPIA 1WC0A 2VQFK 5HLFB 1JJHA 4X4VA 4QR1A 4FWPA 5K14B 1MWQA 3IR6B 2PIIA 2V4JA 4PQAA 4A8MP 4DWIA 3E2EA 2LEAA 3AVKA 3GFZA 1AYEA 1T9UA 3NVKA 3FRZA 4Q8EA 3HKZD 2W1BA 1TUUA 2R9LA 2KTQA 3VEYA 4WQ5C 4DV6J 5CCMA 3VGUA 3T9NA 4RBTA 3R2DJ 2HHTA 5D78A 1SVDA 1SCJB 2CJYB 2P5GA 4MH8A 2L3MA 4N8OA 3R5DA 4QW9A 3OT9A 3VGVA 2DT9A 4JI0J 2IC3A 1KQSR 2ADBA 1DLOA 4YS2A 3NKYA 4FL9A 5M2RA 2R3VA 1H2UX 2RH3A 4JI5K 2O66A 3CCUS 5KFWA 2MKSA 2V8GA 1P9QC 3M6WA 3OD2A 1SIZA 3P1GA 4I9QA 3H7HB 5GMEA 1HBNA 3M05A 3CJTA 3I31A 1W7AA 5CYMA 2EFNA 3UVJA 4YFUA 2IY5B 4CJPA 3V9WA 2HPUA 3M8QA 3HHLC 3TOQA 3MECB 2Y1IA 3PKYA 3AHPA 5BR8F 5HROA 2FB0A 3IRXA 1HWLA 4CJSA 2RVJA 3I5BA 4X4TA 3T5HA 3G82B 3P3DA 4BR2A 2XGQA 3BUZB 1UPPA 2C3YA 4PYAA 2RS8A 1S1WB 5AQXA 2AYGA 4ID5A 4EO6A 4M3YA 1Q16B 4GRSA 2ZZTA 2BM1A 2JFKA 3MPUB 3BO3A 4J37A 4E89A 2JC0A 2A6AA 3IA0A 2VA2A 3RR7A 1V3RA 4CERA 3C3LA 2BA9A 2XMJA 4R0EA 2ADCA 4CT9A 5HVFA 1UJ5A 4OZLA 4RW6A 1RBAA 2WONA 3BO4A 3NEKA 3CJ0A 4CO3A 5BREA 3VHQA 4FWOA 4W90B 4PWDB 1VC0A 3P6YC 1C6VA 1HI8A 3ZT4A 2W2OP 2KKZA 4WF9L 3BBBA 3SJHA 2Q43A 5IWAJ 1T03A 2P9EA 4JI3J 4CF9A 2FBXA 5K9FA 2ZC4A 5HMYA 1OYEA 1EKRA 1RAEB 1U8WA 4DUZJ 1ICEB 4LR7A 1RQ0A 4G9ZA 2AIRB 4BE0A 3O1LA 4M41A 3JTNA 1GLLO 3VAJA 3N9UC 5IT9U 2HFOA 3F9MA 4GKKK 3A8KA 2W2NP 1F1BB 2ZDPA 3NLCA 1V9OA 1AZSB 3PV8A 1WAJA 5AJ3K 4C8OA 1EQMA 4GKJF 2LXFA 4FLVA 3CERA 2BR0A 4QU6A 5I3UB 3M8PA 1VQON 5H9EK 3MM6A 2DXEA 4PYDA 3OJSA 1SAZA 4KY3A 1RTDA 4FJIA 1K1QA 2ERRA 4FCYA 3VA0A 1RT2B 4RPFA 3PRVA 3GR1A 4OX9J 1SH0A 2YHAA 3WNGA 3GLJA 4CEAA 4EP5A 1SC3B 5IT9Y 3FSIA 3RMDA 4C8LA 2BZ2A 3FFIA 4IUFA 4CBXA 2B4UA 3ATVA 2XCPA 1YHQS 1JXBA 4FW1A 5J1EB 5HI7A 3ULHA 2NZ4A 5M2UA 4ED6A 3MM7A 2FGOA 4O5BA 3J80O 3AVFA 1ZAWA 2VL1A 1X60A 5FLXO 1ROFA 4DSIA 1WEYA 3EPIA 3PHTA 4WTYA 4RNNA 2ASDA 3DLKA 3QGHA 5GAGI 2LQ9A 4KO0A 1AFJA 2XC9A 1YHQN 2G1HA 3ZTOA 4CI0B 3JSMB 4DV3F 4CZMA 3ITHA 3EGNA 1SH3A 3T41A 5LJ3Y 4O3PA 3HSTB 3WEEA 1JLFA 4LH4A 3MEGA 5DJBA 4X4OA 1H2VZ 1T0TV 4J90A 1GLJO 3MCAB 5BYQA 3MMBA 2X1BA 3A8EA 5DS7A 2KVQE 1CULB 1LWFB 3H42A 4DN9A 4GVEA 1RDWX 4A8FA 1PCAA 5LSOA 3BF1A 3WNFA 1T05A 1FJEB 4FWRA 3AO1A 1KOHA 2AA4A 4Q45A 2H1YA 5KFTA 5M2PA 3D1QA 2R7VA 5B08A 3D45A 4KIAA 4DCJB 1HLUA 4NRTA 3FLCO 5F8GA 4H4KA 2NQPA 5AQOA 5D6GA 3TAFA 2P2CB 3LAMA 3EKUA 1U8SA 4CRJA 4P72A 5J2NA 5MLCV 5GAEP 5HMZA 3OR1B 4JKDA 2E88A 4OI1A 4DTJA 2FZKB 3B6BA 5K8MA 3SQOP 5GAGU 4CQ1A 3OLBA 3WXIA 1T9WA 2DGXA 5EUHA 1S1XA 3MOZA 3MMAA 1IQZA 2PFUA 4H4OA 3KYLA 4C8NA 4QPXA 3TSQA 1KC8O 3QRRA 4DMNA 3SDEA 3DXKB 4A2AA 1KHWA 4OKKA 5B8HA 3KJVA 3SIPB 4KGMA 3L4BC 4F0KA 4IO9Q 4NXMJ 1UEVA 1RT1B 3HSGA 2LLZA 2ROGA 5IV4A 1Y5IB 3SV3A 1KONA 2FBVA 1U49A 1BO5O 2Q1NA 2DRDA 1IBLF 1Y5LB 5ETKA 1DEJA 1O13A 4LF5J 2WBNA 4WZMA 3I82A 3P5JA 3MHYA 1U48A 4DR5F 2QKBA 2MKHA 4FWKA 1N34J 3T1YF 3VAMA 5AQVA 2EBGA 2QN6B 1CQMA 2IHR1 4F2SA 2GV1A 4FJ9A 3ZSVA 2DO0A 4P71A 4DL6A 3JSRA 4FXVA 3HHKA 1QAXA 1J9AA 1A0OB 2ZE2A 1FD8A 4ANDA 2YPZA 4FLWA 4P2MA 1EP4A 1FEHA 4ED7A 3MD1A 3BGRA 3R1HA 2VASA 3L9ZA 4OHXA 3OYJA 3O4NA 2CVIA 2R7WA 2P9PA 3LOUA 4TU8A 1EETA 3AVAA 3ELHA 4ZN3A 3QYYA 3DGPA 4DPOA 4LF8F 2BANB 3MWBA 4ZCMA 3QBCA 3KJNB 4A61A 2M5YA 4OJGA 2MZSA 3HULA 5FPEA 4OHVA 4L8RB 4X62F 2PE8A 1XC3A 4DV7K 1GMWD 3P5BP 5L1JA 2EFVA 4CJ3A 2XHBA 1EWQA 5AQSA 2HNZA 2XG8A 4K0KJ 2D1CA 1VC5A 4OLPA 2BW7A 1HYVA 1BMQB 3ID6A 2J9DA 4DR2F 4DL3A 3IS9B 4LY7A 4WFNL 3ZETB 4ZVQB 2CJXB 3MFIA 1XIQA 2ZBQA 2FSKA 3BEXA 1CZAN 3K2PA 1QSYA 3TA2A 4CTAB 5HBMB 5G0RA 3FMBA 4RNHA 5DGAA 4J2BA 1TQLA 1S9GB 3UDVA 1AB8A 1OPZA 4V19X 4QS8A 3K9KA 4J2DA 1R59O 4ED8A 2ZH6A 4BVPA 3RG6A 3VF6A 2B5JB 1B9DA 1WSIA 2AYBA 1DURA 3BSNA 4CZGA 3D28A 1VBYA 1XNRF 2RHKA 5BRDA 1JXVA 1UWAA 2HMPA 2CWXA 1NH7A 1KVAA 2DRAA 5JVGQ 5BN9A 2BQUA 3SUQA 4OX7A 2UU9K 1FFWB 2QWLA 3EXYA 4CM2A 2YNGB 1RT4B 4DFMA 1TKXA 2RT3A 3O9TA 2YI1A 4Y2AA 4HUEA 4QIWD 5J2MB 3TQ1A 4LF6J 1VQ8N 1NLVA 4CZJA 2X78A 1LWEA 3DCAA 3KFWX 3RMBA 2MGZA 2QL7B 1QAJA 5HN0A 2OPRB 3KLEB 4USKA 2C22A 3CI5A 1JLAB 4DMZA 4KHSA 4AHTA 1W97L 4FYYB 3H25A 3PO4A 3TU5A 5CE3A 4PA1A 4PUOA 1S72S 3HK2A 3VR1A 3ISND 4TN2A 1BU6O 4UZBA 4MO5A 3DRSB 2MSSA 3CD0A 1WKJA 4FVCA 4A62A 1AFIA 5E7OB 1RDUA 3Q8PB 2Z4PA 2D7SA 4Q5VA 1JCFA 5FPNA 2UXBK 1RHMB 2LU2A 1LK5A 4KQZA 4ED2A 1DGKN 2I8EA 2M88A 1HRHA 3QBWA 4M95A 1S72N 3GTYX 4CLLA 2CDRB 5F8MA 1RKIA 3TSUA 1JLQA 1SJQA 4IQXA 1TTHB 1HYSB 4P2SA 4HACA 3PACA 4DUYK 2O8DB 1FTRA 2KXHA 4ED5A 4PCQA 2PAVA 4ZP8A 4CLTA 4IOAL 5CXTA 3DAWA 1PBUA 5A2QO 3VENA 4GO5X 3HOTA 2C3PA 2E7XA 4RW7B 3BB5A 5DLGA 4LMZA 2V9KA 2PSZA 4Q44A 2GIRA 4DTXA 1LW0B 4AXJA 2MB0B 4TNOA 2DGVA 1OH5A 4JD2A 5FRNA 2KRBA 5AT1B 4FJLA 4WP3A 1MLAA 1NSAA 2HBJA 1VCTA 2HVHA 5LMNJ 3JYTA 4B3RK 3SSSA 1C1AA 5LMUF 4DPTA 2AMCB 3D9BA 1NPRA 3ZZRA 5B0BA 3AJ1A 4ZCIA 3VMFB 4NYZA 4QYZK 3ZTPA 3CPEA 2OPQB 4ID1A 4PXEA 3MPVA 5EX0A 2YNFA 4H0PA 1VLYA 4NLYA 4DV4F 3POTB 1DJ0A 2KDOA 4KKOA 3NOGA 2OHDA 3I9ZA 1K8KB 2FQQB 2HHVA 3THVA 2LQ5A 2YJEA 4J9NA 2FVCA 3M6GA 5DM6Q 4K59A 4FJKA 3P4IA 4FK4A 3I96A 5AQQA 3D6TB 3WIVA 2E44A 5KTQA 2B9WA 4RUCA 2WBMA 4CCHA 4IDKA 4KR0B 2FJBB 1DTQB 4IEEA 4CD3A 2RKIA 4TYAA 2EPIA 3P96A 4CF1A 4AD6A 4OL8A 1NJYA 4JHDB 2UXCF 4PRFA 2DR6A 4USWA 3VVTA 3HVWA 3MCNA 4KHUA 4A2BA 1R8AA 1KFSA 3DFEA 2P9LB 3BZKA 3VQ7A 2CPDA 3IFEA 2CUYA 2MKJA 2QJ3A 5HK4A 2APOA 4LSLB 3HHLD 4DZ6A 2P1JA 1SQGA 3OV7A 3CM6A 2XY5A 3RAQA 1H72C 1XC9A 4HTUA 3FZLA 4HVJA 2RQMA 1VQ6S 4C23A 4OZ0A 2VB6A 3CCLN 4MO4A 2N82B 2J9DE 1CC8A 4IFEA 1Q7YO 1MW7A 3QGGA 4DTMA 3SNNA 3HZEA 4AHSA 1H98A 3T9ZA 2BYCA 4C8ZA 1NZAA 4KGKA 5IZHA 4OI0A 3CMAS 5C10A 2YKQA 4E7HA 4ZTFA 4PY5A 1VGYA 2Z1JA 3MPYA 1X4AA 3MXJA 3NAIA 3D2EA 3MAQA 2H4YB 2HRYA 1GX6A 1WC6A 5A8RB 3ZSXA 4B1VA 5E2QA 3JAMU 3OXLA 1FRHA 1IBKF 2R7TA 4NZ6A 5JXSA 2R7RA 4ES3A 1DT9A 2HHHK 3I5CA 3R3TA 2W40A 5J2PA 2CZ4A 2YWHA 3W9JA 3ZLJA 3BKUA 1T8EA 1NGFA 5C25B 1U1NA 3EUNA 3KWMA 1O51A 3M32B 3R5BA 2A3JA 4ZN1A 2MYFA 3TZWA 4NLSA 4PEOA 1D9AA 2W6KA 4OX8A 1IKXB 5JS1A 1RI7A 2W9BA 2R2RA 5H1SQ 1Z26A 3V9UA 5JVHQ 3BN4A 2EC0A 3W60A 2HFVA 4F4WA 3WQPA 3JAMY 3BBCA 4M5MA 5JUMA 3VEWA 2KHCA 4WE1B 4W4MA 5ETQA 4ZVOB 2HSEB 3TUPA 2Q0RA 3ENWA 4R0JA 2CFXA 2LDYA 2ZZNA 2E6MA 3EE9A 2W8KA 4CO1A 2VOOA 4W92B 2GVDB 3R7BB 2XY7A 4FJMA 2XS2A 3SQGB 3RBXA 3N28A 2DIUA 4BLGA 4X66K 4CJQA 1WSEA 3K58A 3PDNA 3U1MA 4JKBA 2RD5C 1IJFB 3TWZA 1WSRA 2RSQA 5K8OA 4MKYA 1OYDA 5GADP 3QWPA 2CPJA 2IBKA 2VC1A 4CO0A 3B8AX 4FF4A 4CZFA 4DV5J 2IM1A 1DTTB 1GTHA 1VJQA 4Z4HA 3QT8A 1HWJA 3OL7A 3R1LA 1T3NA 4B1UB 3MXIA 4ED3A 4HEA9 3VERA 3RVCA 4ED1A 2WVEA 4DR1F 4N8NA 5B7WA 4UY8O 1TFWA 2W42A 2P9KB 4C4WA 3Q8QB 1WHXA 5AQMA 1A5WA 1U2VB 2CQ2A 3DLEB 3W65A 4OFZA 4DJBA 3EZUA 2D74B 4AHCA 4F67A 4W5QA 1HPMA 3R5JB 4F26A 3ETMA 1YG0A 2LKZA 1VQ5N 4ZVFA 5A0YA 4CGDA 1FNXH 4DR7F 4IFVB 4GY2B 5CY4A 4QW8A 5BYRA 4QWCA 1FCAA 2B56A 4UY85 3KLIA 3P5TL 4ZVRB 1Q8IA 1W2BM 3D1OA 4ICLB 1UW4A 2DNNA 3VTIA 1OVQA 1O1WA 3H2UB 4DR4K 4OZ3A 1RAIB 4OI3A 4F4XA 4ECUA 3GIMA 1R0CB 4YB1P 2F7TA 2O4GA 2XNQA 5KFXA 2Z1GA 5KFKA 4FSVA 3G87A 4NYNA 4CLWA 1AT1B 2R7XA 2NUBA 2NS1B 1YDLA 4ANEA 2RPIA 1S1TA 5D15A 3AOBA 4FW2A 3CC4N 5FD1A 5MAOA 2BDPA 3FGVA 1XHXA 3UCZP 4R79A 1RA6A 2XS5A 3S8SA 3NGYA 4USTA 2Z58B 1FRMA 2UUWA 4M5IA 4B9TA 1YJTA 4W5RA 4I2PB 2MLXA 2I5JB 3O9RA 2J8AA 2XI3A 1FXRA 1BIZA 4IWVA 3DM2B 3NGSA 2NSBA 3E9PA 2DHHA 2HMIA 2OO4A 4FPRA 4DTUA 4M1KA 3F56A 1RZMA 2V4JB 4PG6A 2DR9A 1WBBA 3OXGA 2X51A 2VIHA 4B3SK 4JKAA 3RSEB 3NS5A 1VQPS 1HIYA 4Q2LA 3TO8A 5L1KA 5HJXA 2N4CA 3S3OA 4M5DA 3CCZA 5AQYA 1WSGA 1DHMA 2HZVA 3BGFA 1UWBA 2X3GA 4C1NI 3VESA 3AA8A 2HW3A 4KH4A 1R8CA 2DYAA 1KD1O 2AQ4A 4JI1J 4CHYA 2P9NA 2IC3B 3MD3A 5E3AA 4DR3J 3H8YA 1L5UA 2JEGA 3OQ2A 4KFBB 3SCJE 4KH5A 1UA0A 4KC5A 3W2WA 2QWOA 1NXIA 3CFRA 1NKEA 3VAIA 3F0NA 2VQFF 3RW6A 4GW6A 4WYBA 1HBNB 1RDBA 2MPUA 4FWSA 3DKDA 2GAHC 5CYMB 2ZJPQ 3J7YP 3UVJB 1HNZK 1N32K 4LF7K 1UFLA 4ENOA 3C8YA 3M8QB 4E2FB 5CR4A 2HQDA 3IRXB 4MTPA 4KHYA 3LPUA 3PW5A 1N33F 2GIFA 4HDGA 4RU2A 5AQNA 2MQNA 2GWJA 5E3RA 4F2RA 5C2CA 1K6YA 4ID5B 2R2UA 4R8UA 1KXPA 2NXNA 2J0QD 3GYXB 2A40A 4YOWA 3IWNC 2AZ3A 3EJMA 1PILA 3CGIA 3MMCA 2QXLA 3O80A 4C8MA 3KNGA 4U96A 1M1KO 2YKOA 3I9V9 1OH7A 2O1PA 4NEZA 5HSPA 1BIUA 2GHVC 3V1OA 1LCUA 3FCWA 3DOLB 4MK8A 1ACMB 3R8YA 2WONB 4KHPJ 3N5FA 3G25A 1Q5VA 4BACA 3L2RA 1KFDA 2BGGA 3SXLA 3G86A 2J76E 1NJIT 2P9IA 2DCLA 4DV1F 1M1HA 1T03B 3DLJA 4ZIWA 4NO7A 5U47A 3H98A 1U0HA 3CCJS 2B7CB 1CBKA 3HO1A 3FEZA 1C0GA 1S12A 4CIOA 2CPHA 4DV0K 1S48A 2EEYA 1NOZA 4M5KA 3G6XA 4WBFA 2W9AA 1VIXA 1D09B 4CNYA 3DJCA 3CCJN 3M8PB 1SJRA 3CJKB 3MM6B 4H0YB 3E9LA 1XERA 1WG1A 2YKMA 1M90O 2RDDA 1RTDB 3K5PA 4CK3A 3I5AA 3CDWA 3W5ZA 1VQNN 4AQYJ 4TLRA 5KFDA 3AVGA 1ATSA 1MMNA 3SPYA 1VSDA 2KN4A 1NNEA 3H46O 2WC9A 3J7ZT 4FVUA 2XB2D 4FM2A 3N4PA 4IBNA 3FFIB 3MM8A 1VK0A 3AA2A 4ECTA 4A4JA 1LQ9A 2XZWA 1KLNA 2VKZG 4C8YA 4GKKF 2IPOB 3MM7B 4JOUA 4FLYA 3V6JA 4LF1A 4H54A 4J2AA 1YJUA 3WZ0A 4NXNK 3HMJG 1S0NA 2ILYA 2CPFA 3AXKA 3FMWA 1WKKA 4R25A 3K57A 2YBVA 2PBDA 3BS9A 5ITHA 1VQMS 4JI4F 3VQEA 4FJJA 3LPYA 1XMQJ 3T1HJ 3ITHB 4U67Q 2IVMA 1H6KX 4O3NA 3CFPA 4DU3A 1FXXA 3CHWA 2F9TA 3TW0A 3WEEB 1L3SA 3OYAA 3MEGB 4URGA 3V2UC 3SEOA 2D5RA 5J1NA 1U02A 5J1PA 1RABB 3CCVS 2DXFA 2QSWA 3PKMA 4M7YA 3VQQA 1T05B 4KV8A 2HHUA 1HR0J 5JMVA 5AQGA 1LW2A 2RQKA 2HNYA 3DU5A 2X6SA 3EDRB 1RHQB 2KH9A 5J2NB 5L38A 2KHDA 2GQ2A 3CW2C 2CG8A 3LPEA 4LVNP 3MEKA 1DFDA 3GG0A 3DDNA 4HYKA 3CB4A 3D0PA 3LWMA 2IRUA 3CMEN 4OJHA 1SV5A 2D4WA 3G71S 4AM6A 4DTRA 1S1XB 3QJJA 4HCCA 4F50A 4UZCA 3ZZYA 3ZZ0A 3MMAB 2EKNA 4OVLA 4H4OB 1VQ4S 3KD5E 1R89A 3VOVA 4NLWA 1N5TA 3PW0A 3IR7B 1VQ9S 2ROEA 3EVMA 2HFSA 3TNVA 2HGMA 1OY6A 3I55S 2P5VA 4FF2A 3SDEB 2FVSA 3MFHA 2NYHA 4JI2F 4YOXA 4JI6F 3OL9A 3KJVB 1JKHA 5KRTA 2XEXA 3N6MA 4TY8A 1UTAA 2K3KA 1GLEG 4ECZA 2F4VK 1ZBSA 3G71N 5RUBA 2OPPA 3EX7B 5GIOA 1VQ4N 2HVDA 3MCSA 4DG1A 4K4YA 2FBTA 2E9RX 5IT4A 1VQ9N 1KOOA 3PFEA 1HYZA 3I55N 2XYGB 4NL5A 1FKPA 2C3OA 1KAZA 4J9SA 2Z1IA 4CE9A 3HM9A 2AGQA 4CZLA 5K8PA 3CM5A 3DRPA 1D9DA 1NUEA 3HI9A 4LBHA 3OR2A 2GV9A 2ZE2B 2DH7A 4YY3F 4DF4A 3QLHA 3QESA 1EP4B 4DU1A 2PFFB 3V1QA 2FHOB 3VGMA 1E6VA 2LQJA 3M9OB 1F9EB 2HLUA 3BGRB 2ZM6F 1K73T 3MAAA 1RDCA 3ZFVA 4B3MJ 4JKCA 2P9UA 2P9PB 2G9OA 4IOCL 4RCHA 3OYDA 1EETB 1FDAA 2W4CA 2VF3A 3DGPB 3MX5A 1NSQA 2BX6A 2DPJA 2V8HA 2R7QA 5A2QU 3D6HB 3SMSA 1AA1B 4NCGA 1B7FA 1ZA1B 3MI7X 1RTJA 2DO4A 4A8OA 2BQ3A 3U3YA 1IM6A 1FRIA 1S57A 3C7NA 2AX1A 1NOYA 1VOMA 2ZKUA 2BKPA 4EBDA 4OPJA 2HNZB 3CCEN 3JTOA 4JEPA 4WXWA 5DM7L 1S5ZA 2IM2A 4CNZA 1NGJA 4O3QA 1KQGB 4ZVHA 4YHHF 3LH2S 1YX2A 4DU4A 3O3FA 3AVNA 4Q0BA 4WYLA 1YKWA 2HS4A 2HSTA 1JJ4A 4CBWA 2V8PA 5KFEA 3PX4A 4C48A 1QE1A 4MJKA 2Y1RI 5A2QY 2CQDA 4JYAF 1HX1A 3UCGA 2DJWA 3QFWA 3ZNJ1 3TWHA 2WVFA 3OW2M 2WTUA 3HPHA 2DBBA 5DETA 1S4FA 2AZ1A 3EXCX 4MIAA 2G2OA 3QGIA 3VZHA 4ZA1A 1FJGJ 4UOHA 1J5EK 1TL7A 1YSJA 2QSFA 5KG7A 4WQ4A 1OH6A 2ZOGA 2BTFA 3ICLA 2VGNA 4OYIA 5FPDA 1S7IA 2Y0BB 1NMEB 3EE3A 4Y34A 5DDRC 1X5SA 3HFVA 1GLCG 2FZCB 2EK1A 3PM9A 4K43A 1LWEB 2I9SA 5KFGA 2MGZB 1XMOK 3JS9A 3D6RA 1KS2A 4A59A 2EG2A 4DCOB 3WQUA 3NE6A 1D3WA 2ZOMA 3FBCA 3AB4B 3CQ8A 1J54A 4DEZA 2KL8A 1NZ8A 1N0UA 4PUOB 3VWSA 4X4QA 4LFBJ 1RHJB 1WELA 5J2QA 2YH1A 5CYQA 2PMZD 3UQSA 4HR2A 1TKZA 1NU4A 2XMAA 4FF3A 1C1CB 3KLFA 2UU9F 4E7JA 5BR8K 1SXLA 2W7AA 4BVOA 4NLTA 1YI2N 3A13A 2FXUA 3OTBA 1U45A 1Z1ZA 2NRXA 3AOAA 1YRXA 5DDOC 3BREA 1X3MA 4CGHA 2GJFA 4UF4A 3MEEA 1JLQB 2V68A 2XY6A 4U7BA 2ZJRL 4DL2A 3TR8A 4CFBA 2FC8A 1JMTA 1VC6A 3SV4A 2COLA 1TUYA 4B3OA 2ZH1A 3HHNB 3W5YA 2KKHA 2HBRB 2OD4A 4AE5A 4IKFA 2Y0SD 4O44B 3H90A 2WFBA 2OD6A 3DHWC 3ZC4A 1C0TB 1VBXA 2GMJA 2ZWHA 2HVEA 1WSFA 3O2IA 2OCEA 3KD1E 4PXCA 3EZOA 3W9IA 2B51A 2OTLN 4AT1B 4K5RA 2OH2A 1M0SA 4NLUA 4JI5J 4C11A 1YQHA 1SL1A 1UFWA 3JYTB 2D3UA 4XK8C 5CA5A 2LU1A 2F63A 4RNOA 2W9CB 1QDUB 1Y3JA 3QZ7A 3Q0AA 3B6PA 4WIIA 2GWKA 4DSEA 1ZM4A 5KRSA 4JKEA 2KZZA 3I87A 2YVSA 4CEOA 2IRXA 1HNWF 3V4MA 4JV5F 3D67A 5SUHA 5I3PA 2YNFB 1XNQF 3TTCA 2W01A 2OGUA 5KT2A 3NGUA 4KKOB 2UVWA 5KFYA 3UKRA 1RWNB 3OL6A 4GKJK 3A12A 2B9XA 5FIIA 4YB7A 2J6SA 2OZSA 1JK9B 3AXMA 3EM1A 3O1BA 3LP2A 5DQGA 2ZH7A 4PWDA 5DG7A 1MROA 5F8IA 4IDKB 3L09A 3QEXA 3TAPA 3OYEA 2AW0A 3SFGA 2C42A 3MXMA 2LA4A 1VISA 1HWUA 2VG7B 4GC6A 4CJTA 2WVDA 1U2RA 5AQUA 2GMHA 2DR7A 3NS6A 3A8JA 2WOMA 3CD5A 5GAEI 4I9LA 4H0VB 2CJQA 2NZTA 1HQUB 3LGMA 5GVQA 1TAUA 2GEMA 5F41A 3LP1A 3ZZOA 1RNHA 5FRMA 3MUTP 1HBMA 3L2UA 4FZYA 3KLHA 1FXDA 1REGX 1VS3A 1YJNN 1ASVA 1RBTA 2O8CA 3TRGA 3IWXA 3BY5A 5B0EA 2RILA 3DLBA 4OKJA 2ZC3A 4GKKJ 4DX6A 4OJ1A 2CJAA 3MURP 4WFYA 2JJ4D 3IAYA 5AJ3J 4DV3K 1EIYB 3OJUA 3RTVA 1D4XA 2H4WB 3IR5B 5H9EJ 1ZPWX 2B6AA 3U27A 3AO5A 3MWPA 1ZM2A 3NNCA 2VBZA 5DDPC 3DI6A 4OYMA 4PWWA 3SUPA 3CUNA 2JWKA 4J8FA 3PSIA 4N41A 2XLKA 2FLPA 1H0HB 3D2EB 3GR0A 5GAEU 3OYGA 5FROA 1RWPB 3GE1A 3RB0A 3W5XA 2VICA 3L7UA 2MQOA 4B3TF 4QU7A 2UXDJ 2ZJQQ 2UVUA 1U6BA 5KPTA 3UNYA 3CJAA 4WWSA 1TUWA 4CZHA 3I4HX 1X4BA 4I68A 1QAYA 2IVYA 5L8RC 3OYMA 1YJ9S 2B8QA 2W7PA 2ZUGA 2VFTA 1RHRB 4CZCA 4RUAA 4BRQA 5BN8A 2OANA 4E7LA 1RWVB 4YOTA 2YX4A 3GMGA 2BVZA 1YZ6A 2DY4A 1RWOB 4RW9A 2Z8QA 1IJEB 4CJVA 2XZDB 2ZGYA 3UW1A 2W9BB 1JL1A 2DFHA 4QJVA 3IWLA 5IS2A 1VR6A 1YJ9N 4N5SA 3CXCM 2GMLA 4L72B 2GHPA 2CH5A 1CVJA 4FWQA 4JK7A 4X65K 1R7IA 4RU9A 2P9CA 3TVYA 3H5XA 4FYDA 4RUHA 4BRAA 1B0VA 4WFBQ 1SJ3P 5F9LA 1S6OA 3U9ZA 2GCFA 3KVGA 3MAHA 4RNFA 1PBAA 4CHOA 3QIOA 2E1ZA 4F3TA 3QAEA 4IOBA 3ILIA 2VWBA 2LEBA 1X4CA 4F25A 3LM2A 1T3OA 1G6BA 2DHXA 3OW2R 4DR5K 1AROP 1OPIA 3T1YK 5F0UA 4BDPA 2UUAK 1HNXF 3G9CA 3KK3A 4OYBA 1UOCA 2RRBA 2ZH4A 2ASPA 5DRKA 4ZVEA 3NMAA 4Z4FA 4K4UA 1JJ2R 2ASMA 2UUBF 4ILHA 3GJSB 4C97A 2OLWA 3C19A 1ZA2B 5D4LA 3TPQA 2ATCB 3DXKA 5GAHI 4EZ6A 1XUPO 4KTZA 2QWMA 3PTWA 1GX5A 1FXLA 4IDHA 3DOKA 4M3ZA 4LF8K 2YHBA 3QWUA 1VRTA 3MEDA 4CH0S 1GFWB 5B0GA 4OYOA 5ETMA 3VQPA 4X62K 3Q22A 3TUIC 4GV9A 3UD4P 1Q86O 3AAWB 2PY5A 2LP4A 3BKTA 4J9OA 1RTZA 2B4PA 4D3HA 5HVGA 1W26A 7AT1B 3CCRS 2PDAA 1X5TA 3MOJB 3S1TA 1FWLA 2MJUA 1CJUA 1ZXOA 1SQKA 4ANCA 4DQIA 1FW6A 2MZRA 2QA2A 3KLIB 4DR2K 1RYSA 4BQZA 4TVAB 3NF8A 4YDUC 3H0PA 1GLDG 2Y1JA 1RXOB 3SQ1A 1TUGB 2HQCA 2MKYA 4RW4A 1W0HA 2G8UA 3ZZUA 2RNEA 4URQU 2BBEA 2GTDA 3M6UA 2BOPA 3QEVA 3K5OA 3SMPA 2E2OA 1RJJA 8ATCB 1NK8A 4LJMA 4YOYA 2GW8A 3NNAA 4OLAA 4Q43A 4ZLJA 2H5JB 5GAHU 5L46A 1N52B 4MDBA 1U25A 1FNMA 1S1TB 2WUSA 3GCXP 4L3KA 4O8KA 2D9PA 1XNRK 3EY1A 5AQHA 1N8RO 5KGXA 4K4ZA 3AO4A 3FUYA 2CQ3A 4F0HA 5HANA 4FJXA 3QMQA 3TZXA 5CZVA 1PAEX 3FDSA 1VI7A 3BR9A 4DV7J 3M2UA 2OPSB 3V9ZA 5KFJA 3O6QA 3CWJA 3CQXA 3GG1A 1NDPA 4CIFA 1I94F 3P8BB 3SQ0A 5E0OA 3D0GE 3HF5A 5DMRA 1KQFB 5HQLA 2HMIB 1CC7A 5E3CA 1FTCA 5LL6d 2D0CA 3OUYA 1YITN 2W7OA 3W9HA 4AM7A 2OTJS 4NLBA 2KFYA 4O3SA 3K0SA 3AO3A 3FCHA 3TAEA 1FDBA 2VC0A 2HFNA 4IR1A 1IUJA 1UWBB 1K9MO 3H3NO 4JI0K 2ZEJA 2ZHOA 2QLFB 2W24A 2GVZA 1HI1A 1QVFR 3RWUA 2DD8S 3RB6A 3PSFA 2QYGA 1TVRB 1WJ9A 2P9NB 2YQ0A 3IC1A 4FNIA 2VOPA 4QIFA 2V4QA 3R27A 3GIIA 2DNLA 3R2CJ 4OIXA 4CFDA 5H9FK 5CABA 1PG5B 4WF9Q 3W2WB 3QZ8A 2BV3A 3ZSYA 1B92A 3NH1A 1K8AO 3QQCD 2OPRA 1B0PA 4FWNA 1TK0A 3AVMA 5ETOA 2VFUA 2HOEA 4B3SF 4DV2F 3OYNA 2ZBCA 3UDEA 4X4NA 1MWZA 4DBQA 4YMEA 1JIHA 2ZFHA 2HB5A 2G0JA 4JRPA 3HJVA 2GC8A 1VQKS 3Q8VA 4HH0A 2K06A 3RBEA 5C15A 4Z4CA 4R8UB 1NHKL 1OSDA 2G2ZA 4HUFA 4I4BA 3PYDA 5D4NA 2GNKA 3MMCB 4BWMA 4E1JA 4KRFA 4AFFA 3NMRA 2DY9A 5LMUK 1A6LA 4C7QA 2CNKB 1NK9A 2ZOFA 2UXBJ 2A10A 4CZIA 4JI8F 1WTBA 2CZVC 5C2DA 1EJ7L 1HYSA 2KG0A 1VQKN 2WW8A 3BO2A 3VA3A 1S1UA 5ETTA 2W2MP 4I69A 2I7NA 2N3OA 5CCLA 1NHVA 1RT7A 3ZSWA 4HHHA 2G4BA 4DV4K 4XAKA 4DUZK 2P9IB 2DVIA 1R27B 4DUYJ 3CPWM 3LGNA 2A5XA 4EU0A 1JXEA 1OQ6A 1D8ZA 4EK2A 2QT7A 3BJYA 4DR6F 1R6VA 1RCHA 5KG0A 3NCQA 2HVZA 2VZ9A 2W4PA 4YB5A 4Z7CA 4NYPA 2ALYB 1IWGA 3CC7N 2OZMA 4CO5A 2AEJA 2LVWA 3K59A 2CDQA 5JS2A 3KHHA 1RWUA 3CJ7A 3B8HA 1PC5A 3VF4A 2JFDA 4WTOB 3O8WA 3S3MA 3ENHA 3NGKA 2XMVA 1QM9A 1HKCA 2UXCK 2P9SA 3AGRA 4ZKAA 4ZCKA 2MXYA 3CC2S 2WSCC 4ECQA 4B3RJ 1U09A 1TGOA 5D4PA 5KFBA 4CBUA 1BQNA 2R4FA 1RA7A 3HRGA 2IVOA 2YKMB 4WPAA 3CXCR 3UR0A 4AILC 1RT6A 1U1LA 3POTA 4JV0A 3FZBA 3BDPA 2KW4A 4QYZJ 4L74A 2MMYA 3WC2A 3EKSA 4Q8FA 4K4WA 3HOSA 3WX8A 2RS2A 5KFVA 5IQ6A 3CC2N 2LQ8A 2DGWA 3FSYA 3UCUP 3R6GB 1KQSM 1FDDA 3MM8B 4OYZA 4PR6A 3J81U 3I56N 4I2QA 2YWGA 2PI4A 1DTQA 1GMWA 1F2GA 3VQ4A 2V67A 2VBWA 1OMSA 2CQHA 1TL4A 3OFEA 4RO0A 4Y0FA 3IRWP 4W98A 2I7PA 1S99A 1DARA 3CJ2A 1CJTA 4OPKA 5F8HA 5GADI 3G4SS 2J6UA 4CVNE 1IBKK 5DZ6A 5LSRA 2EW9A 4NB4A 2F3JA 4NEYA 1Z6RA 4QIEA 4BRLA 3P31A 4PG7A 1NB2A 4P6QA 3J81Y 2E2PA 3J7Z5 2RHSB 2H5EA 2YV0X 3VN5A 3GFYA 1PYSB 3SQ4A 4EUVA 2HKEA 2MKCA 2B43A 2MQQA 2D0BA 4OJ3A 3G4SN 4B9UA 4FJGA 4DCPB 1N6QB 2BRKA 4FWMA 4AL6A 1XR7A 4KV8B 1TZ0A 3AAPA 2WVCA 4DTPA 2D0PA 1LW2B 5FDLA 2HNYB 2NUHA 2H51B 2VFSA 2A1SA 1QZ6A 1BUXA 3CFOA 4AF1A 1PAUB 3R9PA 2BUNA 3IG1A 3OYFA 4FVMA 2DGTA 2R42A 1WI8A 5GADU 3A3PB 1SV5B 2QA4N 5G4DA 3OY9A 3BN7A 5BPNA 2FHKA 2JRSA 2ZWPA 2KT2A 2D3ZA 4G1PA 5HRPA 4CJUA 4TU9A 4CJRA 2HHHJ 1ASUA 1U1PA 2HRUA 4ELVA 4QWBA 3DNCA 2HWTA 1IKXA 1JKHB 4TY8B 5AE1A 3QSYB 3L2QA 3JSYA 3OLAA 3MCOA 4B9NA 2HF4A 1Y00A 4RZRA 1LEOA 2HAFA 2OPPB 1P1TA 5HO4A 2KB2A 2VQEF 4FBUA 2D0AA 2FJDB 4X64F 2GBZA 4DG1B 4KTWA 1BOTO 5F2RA 4WFNQ 2QWNA 3BH7B 3OFHA 1FKOA 2YJFA 4JN4A 4ISEA 4DR1K 2V8DA 1DBDA 4O4GA 3DRPB 1REVA 2NLXA 3Q24A 1GT8A 4Z4IA 3CCQN 3OR2B 2JOQA 2YKAA 4B08A 3H5SA 2IVNA 4ZVTB 2MKKA 3S41A 2ZJQL 3QLHB 2IBOA 2CQGA 3J8AA 3K17A 2KHOA 4MLHA 4YUDA 1E6VB 2YHXA 3MAAB 3KHLA 2DNOA 2P9UB 3KUEA 4X66J 1N56A 1TL1B 3ENAA 3CJ3A 3HDSA 4CJKA 3EVOA 4NCGB 4QOTA 1MWYA 3SI6A 1RTJB 1LXJA 4YR2A 3OXFA 4ZVUB 2KXNB 3OTOF 2V2KA 4B8CA 3C7NB 1T9YA 4RBVA 3D54A 1RU2A 3C65A 2KYZA 3CCSN 2VD3A 2FIUA 2U1AA 2G8FA 1X9MA 4WQ5A 3GV5B 5LJVA 4ILRA 4AHRA 4Q0BB 3IDHA 3J7YI 2BH1A 5KFFA 2IMOA 2OIHA 1KNZA 4HWIA 2ROPA 3D6FB 1IBMK 4DX8H 1QE1B 3TQEA 1OKJA 2P51A 1L3KA 2WHOA 2PN6A 3OVAA 4LC9B 2DGOA 5I4MA 4ICLA 4GVBA 2MQ8A 2L9NA 5HQMA 3Q83A 1SJ4P 1HI0P 3AVBA 2M70A 2QKKA 3FK4A 4FPBA 3HHEA 3KTQA 4IJNA 2QW9A 3DU6A 3FZHA 4KHWA 4LRCA 3TJ8A 4LF6K 1TL7B 4LSZB 1PGZA 3PHEA 1YK9A 4DR4J 2IFXA 3HKWA 2L9WA 4CHPA 1Z2ZA 4ZK7M 4NCBA 2CWKA 1Q7LB 3HHLA 2QMXA 2GHWA 4DUTA 2WTFA 1RWXB 1PSDA 2E5LF 3NBPA 4IOAQ 3FZ2A 3FGUA 1BGXT 3K8WA 4EEYA 3RMAA 3CPWR 5HRNA 3E66A 3NF9A 3W0LA 4OYWA 4QWEA 3J7YU 2BJ8A 3N4WA 5DK5A 4DKWA 4NA3A 3LGHA 4BE1A 4WKRA 3A4TA 3WX4A 2M3DA 4BC2A 3HD2A 3IP0A 1VQLS 4OPAA 5J2QB 5CYQB 5DDQC 5LM7E 4AHVA 4CFCA 1TKZB 3KUHA 4DFJA 3RSEA 1J5EF 4CT8A 3KLFB 2X3DA 4F3MA 2HRTA 4YP3A 2F8MA 1N33K 3SJJA 2XWYA 1LKZA 2XWXA 3L3CA 3MEEB 3C15A 3GCWP 1NDKA 1XMOF 3T1AA 2W8LA 3LL3A 1Y64A 3QEPA 3SCIE 3EPGA 3NRBA 4B3OB 4EBEA 2NRRA 3THWA 1OH8A 3CE8A 1K47A 1Y11A 3G96A 1OY8A 4RG8A 1RBSA 4KFBA 2C2MB 4WU2A 4J5OA 2HHXA 4NLPA 4MLEA 3A5OC 4B9MA 3R7NB 4L76A 3RUBL 4OHZA 3MN6A 3JQKA 3L4IA 1RCXB 2E7VA 1W2IA 1CSJA 4C11B 2OEMA 1Q18A 3ZT0A 4YEAA 4DV1K 2FJWA 3KMQA 3UN5A 4DTNA 3I6PA 3OYHA 3D3CJ 2JX2A 2J7UA 2E1AA 3GJQB 1NBEB 2POKA 4NLGA 4NASA 3CCUN 1IG9A 1HNZJ 1N32J 2E1RA 4LF7J 4Y2IA 3FBFA 4J9KA 2F9JA 1GXLA 4BR9A 3U4LA 1X3NA 4C9DA 2ABYA 2JVOA 2WSEC 4IG3A 3CF5L 3UKRB 1X7VA 2AEFA 1IR0A 3DOLA 2RJZA 4B1YB 2RAQA 1S9EA 4I6MA 3LP2B 1MROB 1ZETA 3PEHA 2YNIA 2JNJA 2UUCJ 4C6AA 4ECSA 3SBTA 4ZPDA 1HJOA 2DEJA 1NGDA 1HBUA 1CJVA 1V6HA 3M1VA 2WOMB 4LFAF 1FX2A 1HMVA 4YQWA 1XR6A 2FDNA 1PKUA 3LP1B 5LSLA 4M3TA 5SZTA 1N5VA 2VDHA 5IC6B 3AD8C 4MKAA 1OQ3A 3IAM9 2RF2B 1HBMB 3M4XA 4C0HA 3KLHB 2XY8A 3W2VB 2O8CB 4Y3CA 3QNOA 4FXWA 3TA0A 3ZTRA 4ZOSA 2MHEA 3A5NC 1Y97A 1WC3A 4NI2A 4DV0J 4L73A 3KKFA 1J6ZA 4UOGA 3CJKA 4FOEA 3CG7A 5KPRA 4LF4F 4JI4K 1N36F 4QYRA 3U1NA 1C4AA 1MA9B 1NDLA 3ZX2A 1FRJA 1WC1A 3G6ES 4OZ1A 2B6AB 1W25A 3DGVA 4MQ3A 2WAQD 4GMJB 3MN7A 1ZBUA 1UP1A 3DI6B 3H2LA 4ELUA 1L3VA 1NSPA 3QERA 1LFWA 3TVKA 4KE5A 1RACB 2VFVA 1N5QA 1IQTA 3OBYA 2Y1LB 3GJRB 2XULA 4FDFA 1ASWA 3SMZA 2LXUA 5ADXA 2R2SA 3M2VA 3C0BA 3S3NA 3GU0A 4Z4EA 3VAHA 4U8YA 1Q81O 2VJUA 4MYTA 5DG8A 2HYIB 4P10A 2AP1A 4I6WA 2V2QA 4NXNJ 4L75A 4RW9B 1PYTA 3PIPL 3TANA 2MZTA 1X31C 4P2XA 4FS2A 5DLFA 1NSKL 2GIQA 4EGLA 4BBYA 2HIYA 3MM5A 2UYTA 2BKOA 1CPZA 3G8SA 1IR1A 1NMNA 3VZIA 3W66A 1UZHA 3AT1B 3SSRA 4UUWA 3GZ7A 3QJPA 2HBQB 1I1GA 3OTCA 4JI2K 3CJRA 4JI6K 5AFUA 2D41A 1Q78A 4FBTA 2DHGA 2IVFB 2DNGA 4QR2A 3SQ2A 4FJ5A 2FJXA 1S0OA 3VCDA 3N5BA 2E1YA 2DKOB 5E41A 2G8IA 2BJ7A 1W7WA 5A6PA 4BRPA 4O0IA 2O01C 2XNRA 2R8GA 2K1RA 4ILGB 1BI4A 1KC8T 1ZYQA 4CLUA 2E8AA 3AOCA 5GMDA 4ED4A 1JXLA 4DV5K 3KK3B 2QWQA 2R8KA 4GVLA 1L3TA 1TL3A 3O1WA 5E33A 2VPWB 5CHIA 4IZ9A 4YY3K 5LJ5Y 3IFRA 3H08A 2VPZB 3NS7B 4USUA 4PXDA 5C5JA 3TAMA 3OBWA 3LZIA 2ZM6K 4X65F 4EHUA 4Y6IA 3C14A 3MCMA 2XHCA 4NE9C 3HL8A 5EY4A 2G8KA 3DOKB 4ES1A 2HGNA 4FYWB 9ATCB 1VRTB 3MEDB 3FFKB 1XWLA 3R5GA 1T44A 4F0MA 5ETLA 4LF9F 3ZEUA 2F4VJ 2XRIA 4ZPTR 1UAXA 4ERDA 4M45A 2BUPA 3L3UA 3M30B 4CGGA 5D0RA 2VFRA 4DDFA 3T6JA 4OHYA 2KJVA 3AY0A 2UUAF 2CG4A 4LRBA 1CJUB 3LUYA 4MAKA 3V81A 2I2YA 1SPBP 4YHHK 1ZC6A 4DXLA 3V6DA 3KUGA 3KLVA 1CS4A 4RW4B 1F5CA 5F0WA 3I4PA 5BYSA 1VSFA 5KFRA 2XO7A 1VBKA 2WCXA 3C16A 1YWXA 5CZ1A 3M3ZA 4QS7A 3DLGA 1U6FA 2ZH3A 3RJMB 2XQCA 4YOUA 3KHYA 4JI7F 1NKCA 2PYLA 4JYAK 1RTHB 1AUDA 4LFCF 1DRZA 1TMJA 4BS2A 4KGXB 1NGCA 4BR0A 4F4ZA 2Y3YA 1B7YB 4H5VA 3D2WA 2Z2MA 2VHGA 4A8KA 4M3UA 3BZQA 1JLCA 3O3HA 4DTOA 2KM8B 1NH8A 3FJ2A 4FJHA 3M2UB 1V5IB 4N77A 2A6MA 3I33A 5JICA 1DQ8A 2EXUA 4DF8A 4BGAA 4LREA 1YGYA 4CEEA 1BLUA 4DL5A 1VHIA 2E4LA 3BGOP 1GQEA 1ZBIA 1IV0A 4KGVB 4OZNA 1S10A 2FY1A 4U9RA 3OUYB 2YXLA 5KT7A 4K42A 1V5VA 2AX0A 4DLEA 4DU7A 2E2QA 5EVZA 2QWRA 2O8FA 3A3NB 2V2ZA 4K7QA 4B9QA 2YKPA 3OVNA 4JKFA 2GO8A 2CYYA 2A1BA 5AQWA 2HQIA 1VSEA 5KG5A 4DQRA 5KFQA 2GVZB 1A5XA 1HQ2A 2Q2RA 2VG6A 3PRBA 4QCLA 4HDHA 5GAHP 5MLCQ 4CLKA 2J6TA 3UD5A 3PIOL 3IMQJ 1WG5A 8RUCA 3LDOA 1UCNA 3E01A 4DQ8A 4KHNA 4NYFA 4OYPA 5EXWA 3QFHA 3C2PA 4B02A 3KK1A 3M2RA 1TMMA 3VEXA 2C2NA 2MLYA 2M7SA 2RRAA 2P6TA 4Y1CA 3OYCA 4UUXA 5L1IA 4TXSA 4DV6F 2C1EB 4E98A 3CDEA 4KAZA 2QK9A 1WF0A 2FPHX 4FF1A 3DYAA 4DSJA 1QSSA 1URNA 3A2FA 3TSPA 2R8HA 4JI0F 2JVRA 1HUXA 2HS3A 1WORA 3AVCA 4M7XA 5ETNA 1QVGM 1C1CA 1SH2A 4B1WB 4Y2MA 3VQ8A 3WNEA 4FOIA 3W63A 3O3LA 4E1MA 1WN7A 5BR8J 2EI5A 4O0NA 2HFZA 2JWNA 2QV6A 3NL0A 1HNWK 1S1UB 4JV5K 2NYIA 1XNQK 1RT7B 3GIJA 5AQLA 4YORA 4O44A 4QR0A 3HVTA 1VLOA 3CCMS 2HQ3A 1C0TA 2MLZA 4WYWA 1IJJA 4ZPBA 1V3ZA 2FSNA 3N4QA 2XS7A 1MMLA 5M1OA 5M1QA 3IUCA 1NPKA 4J2EA 1WSHA 2V51B 1HWKA 1LOUA 3U8XA 1U24A 1WLJA 4ZJQA 4NOHA 5AQJA 2W9CA 1RCOB 1RE1B 4K2JA 1F3VA 1BHLA 2P9SB 2YWKA 2ZH2A 4BC5A 4LIRA 1Z05A 1P6TA 5AR0A 2LEPA 2QMWA 1AXQA 3KJFB 3SI8A 1WSJA 1ZBTA 1FVQA 1BQNB 3BBFA 3W1YC 1X4HA 5IWAF 3FC9A 4HT7A 4JI3F 1VRUA 3SAGA 1RT6B 4DUZF 1RDDA 5FPMA 4FZXC 4ZPAA 1R0AA 2E5GA 3ZX0A 3Q86A 2AGPA 1B9FA 3CMQA 4NPOA 3MR7A 1EQYA 3RW7A 3H40A 1G99A 2O3DA 2M8HA 4GKJJ 3CNQP 4I2QB 1RBVA 1ZZNA 4QIGA 3E8OA 3VF0B 4PPZA 3VV2B 5ADXH 2BRLA 2EX3A 4YN3B 2NRVA 3CO9A 4XH1A 2A2CA 4Q7AA 2H9ZA 2VG7A 1YTUA 1RK8A 1BWEA 4J9VA 1QSLA 5EX5A 3TYTA 1HQUA 2GS8A 4U7UK 2EFQA 1CEZA 2FGCA 1XMQK 1L3UA 1CJTB 3VQCA 2X7IA 1FWKA 1PJ6A 3CEDA 4USHA 1F60B 1Q7YT 4B3TK 4H5NA 1GMUA 1G3OA 1QUPA 4OX9F 3O08A 3MGJA 3D5MA 3OTDA 3UDCA 3GFXA 4EP4A 3VPZA 3VAKA 1FK9A 2BMBA 4IKAA 4WU3A 5KT6A 2QXFA 4FKYA 4MIWA 2HWIA 4F02A 2QIFA 3UPFA 5AFUH 5AQPA 4LSNA 3TTFA 3BPSP 4BC4A 2FF6A 2CVEA 1P1LA 3R5CA 2KI2A 1NG9A 1SBRA 5E26A 3IXQA 2VUGA 5HMXA 2YHYA 3HM8A 4NA1A 3L2VA 3JQJA 2BM0A 4LQ3A 3IKMA 3NCIA 3AA3A 4DSFA 4DV3J 1VQ6N 5FDLB 2A3ZA 4V1Ak 1KKHA 1SJ1A 2J9CA 1UAWA 2Z2LA 4USIA 2ETJA 1Y4ZB 3IG1B 3UKUA 2VBYA 1KTVA 4LD0A 3CMAN 2PC6A 2BJEA 3ENBA 2NUUG 2GUPA 4IOCQ 1X9JA 3MXHP 2CAJA 2AJ4A 3ZZZA 4ZCLA 2MKIA 4HI1A 2IM3A 4N7TA 2UP1A 1SUQA 4M8LA 1RDAA 1HNXK 2VPYB 3R1XA 3O4WA 4LBPA 1ZBLA 2V69A 3MN5A 1CQNA 5HMWA 3DXMB 1SC4B 5BPMA 2UUBK 3OYLA 3OPKA 3SCXA 4F4KA 3HFKA 1FVSA 4USJC 2KT3A 2UV8A 3DOMA 4J7CA 2FZGB 2NXUA 5DM7Q 1SIWB 2NCKL 1XJWB 1KCFA 3EO3A 1X5OA 3QDKA 5LOQA 1FKOB 5ETRA 4JAXA 1QUVA 4PABA 4O4GB 1REVB 3ILLA 4H8KA 4JNEA 5KFCA 2W6LA 2HBMA 4NLOA 3QSIA 2IIRA 2MZQA 3HD1A 3ZTQA 7FDRA 4NMXA 2NRHA 3CT9A 2CADA 3HI0A 1BA1A 3K7RA 3EVWA 3H45C 1FDNA 4NXMF 2IS3A 4HVZA 1TFYA 3ENQA 1F5AA 1ATRA 1IBLJ 2B4OA 2XGPA 2CQPA 1P8ZA 3VEZA 1B0TA 4PQUB 4UY8T 4ALZA 3FR0A 4KTQA 4IH5A 2I0XA 4FM0A 1X9WA 4DR5J 3T1YJ 4LF5F 2B0GA 1JX4A 3WXMB 2QLJB 2M9KA 1N34F 4K4SA 2IJFA 5L9NA 4JBCA 2VYPA 2XM3A 1UVNA 2DR8A 1S22A 1RILA 4TU7A 1K44A 5THWA 2Q1LA 1CXUA 1D5AA 1CJKA 4Z2XA 3T19A 1RLDA 1U0SA 2DNKA 2D1KA 4MT1A 1E4GT 3J81j 1R8BA 3ZT3A 4LF8J 4IQMA 5C0YA 1WOSA 2UVRA 1DZ5A 4OGEA 1KDNA 4CZKA 1U2FA 1YLXA 3RRKA 2YHWA 4X62J 5I42A 2ACYA 2Z2YB 3L7OA 2JWLA 1HJRA 5C24A 3QRQA 3P39A 4GVBB 1FJGK 3EZ5A 6FD1A 1I94K 1QVGR 3Q2SC 4UOCA 5B0CA 1F0XA 4YR0A 4CGJA 5K5MA 5KOWA 2V6AA 4DR2J 4K0KF 1F9FA 2QC3A 4CD1A 3JAMO 4MKVA 2ZHBA 2VA3A 3GFHA 3BF4A 2OKQA 2Q79A 2L08A 2ZJRQ 3HHLB 4DPXA 4H0XB 2DEIA 2B7BB 1UZDA 4FLTA 1S49A 1S4EA 2CH6A 1P9YA 3NBPB 1S97A 2QEXS 4JK9A 2AWZA 2IVPA 3GSDA 4LBIA 3B82A 1I3OB 1G7CB 4KSEB 3SBGA 3CIMA 4H5TA 1EXQA 3PY8A 2NRTA 3V1RA 3VTHA 1WI6A 3CDAA 1XNRJ 1IBMF 3QMLA 1RBLA 2HBYB 4MDAA 2NRZA 2OPSA 4FWLA 2IAJA 4M3RA 2KZMA 4CF8A 2YX6A 3DDKA 3KKRA 2QEXN 2C3MA 2ZBPA 1HBOA