1XMOK

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xmoK00
2HHHK 5LL6Z 4LF7K 4NXMK 2E5LK 4JI5K 4LF9K 1XNQK 4JI7K 4GKJK 4DV7K 4B3MK 4LF4K 1XMOK 4DV1K 3JAMO 5LMUK 1N32K 4DR4K 3T1YK 4DR5K 4JV5K 1XMQK 2UXBK 4DV6K 5A2QO 2ZM6K 4JI3K 4DR3K 1I94K 4KHPK 2UUCK 2UU9K 4LF8K 4YY3K 5AJ3K 5IWAK 4JI2K 2UXCK 4YHHK 4DV3K 4B3RK 1XNRK 4DR1K 4DV4K 4X64K 4V19S 4OX9K 2UUBK 4K0KK 2UXDK 4LFCK 1HNWK 5FLXO 4X65K 4DUYK 4DV2K 4LFBK 1IBMK 4DR2K 4X66K 1J5EK 3J80O 1N36K 2VQFK 1HNXK 4B3TK 4LF6K 2VQEK 4LFAK 4DR6K 5IT9O 1N34K 3J81O 4JI4K 4DUZK 4CVNE 1IBLK 4DR7K 4GKKK 1FJGK 2UUAK 2F4VK 4NXNK 4B3SK 4DV5K 1IBKK 5BR8K 1HNZK 3J7YP 4LF5K 4JYAK 5LMNK 4X62K 4DV0K 4JI1K 4JI6K 3OTOK 3J7AP 4AQYK 4CW7B 4JI8K 4JI0K 1N33K 3T1HK 1HR0K
chains in the Genus database with same CATH superfamily
4BE0A 3M3ZA 1YTUA 3L2WA 1VSHA 2VWBA 4H8KA 3V9WA 1KCFA 1QQCA 4RWTA 2HHXA 4WQ5A 3QICA 5M1KA 1HPMA 3AVHA 1GLBG 4OJRA 3VQ9A 5AQFA 3DLHA 3CQ8A 1S9GA 1DTQA 4GVEA 2GWKA 3AVGA 3ZCMA 5SWMA 2GEMA 2D0AA 1NK9A 3GE1A 1IKWA 5HRPA 3TAEA 2NRRA 2UXBK 4NYFA 3VF2A 3VQ4A 4JKAA 3RRGA 1VSFA 3BZKA 4CHZA 4KI6A 3AVFA 4CCHA 1CLQA 3CJBA 2G8VA 3CYMA 4E89A 2UU9K 4DSKA 1VHXA 1X3NA 4RW7A 3ZT3A 3RRHA 3B6OA 5JVGL 3P4IA 4F2SA 2W41A 3BF1A 2HNYA 1V4SA 3O4NA 3MXIA 4KAZA 3TAQA 4C8LA 3KLFA 1KQSM 3C94A 4M3TA 1KAXA 3U9ZA 3MEDA 2RKIA 3H3OB 1OH8A 3MN7A 1ILYA 1VQ8N 1Q8IA 1S3XA 3SCXA 1SZ2A 4IOAL 4CFCA 1YT3A 5FDLA 1YIJN 1YHQN 4E7LA 5AQZA 4J2BA 1RT4A 4W5TA 3MDQA 4CF2A 3BF3A 3CCSN 2W40A 3UKRB 4CEEA 2QKBA 1Q9YA 1BQMA 1HUXA 1N6QA 4A5BA 4KHYA 1BQNA 1S1VA 4JD2A 4CI6A 3KKRA 5KI6A 4OO1J 5AQQA 1N5YA 3KLHA 3QO9A 1NJIO 2BANA 3M6GA 3RVCA 1RFQA 1QQOA 4IFVA 1Q7YO 3SV3A 4IFEA 4DV0K 3MWPA 1VQLN 3DXKB 1WSJA 3CFOA 3NFAA 3IFRA 3ZETB 3LWLA 4PUOA 3THWB 4B9VA 3KZBA 3NGZA 4CGDA 2EHGA 4LSLA 3KHYA 3UE5A 4BVPA 3SMPA 1JLEA 3AVJA 2E20A 4WE1A 1XNQK 3CCVN 1TK5A 3D2EB 3NH1A 3M8RA 3DYAA 5C12A 3LDSA 3NBPA 4CIFA 3FFIA 4H5TA 4A2BA 2NRZA 1L3UA 4B9NA 4FWQA 1J54A 1C6VA 4CEQA 4B8CA 4ICLA 3O5BA 3MCPA 1D4XA 4FJHA 2W6KA 4CD3A 3QETA 2YKNA 5CZ1A 2WBNA 3I0SA 5HBMA 3AO3A 4DV3K 2V52B 2YHXA 5AQXA 1W0HA 3OYGA 1NK0A 2O4IA 4DTMA 4H0YB 5LJVA 5CYMA 4G9ZA 3AAPA 1FK9A 1E4GT 3VEZA 5E26A 3A5NC 2VG5A 2HMIA 2O8CB 3F5TA 4M3YA 1RT3A 1NU0A 3CC2N 3SUNA 1IH7A 1N36K 1HKGA 1GOAA 1NK4A 2VQEK 3LM2A 1IG8A 4QS9A 2NNWA 2B5JA 3DJCA 1KLNA 3A2FA 3U3GA 1FJGK 1BIUA 3CERA 4M3RA 5F1XA 3UB5A 4DQ8A 2OA8A 4A5AA 4NXNK 4DU1A 3G4SN 2IDOA 1NJWA 3VEYA 4FJGA 4YDUC 3V9SA 3O1BA 3L6QA 1WSHA 3J8AA 4CK1A 3T69A 3DLEA 3M5RA 2IVPA 2X78A 2HHWA 4EP4A 3PSIA 4YOVA 5EY4A 2HHHK 1VQKN 2G8KA 2GELA 1EX4A 2HHSA 4KH6A 3TTDA 4Z94A 5LY3A 1ZYQA 4CBUA 4O55A 4LF9K 4CJWA 2J4RA 4IO8A 1YVNA 3LP3A 3Q7BA 4DV1K 3SUQA 5AQRA 3JAMO 4W5NA 3HJFA 4QAGA 4BR0A 2HB5A 1VQPN 3ULDA 4DTRA 5EU7A 3V6DA 1SS6A 1YI2N 4HUGA 4DSEA 3V9ZA 1VSEA 4CEDA 2E1YA 5I9EB 3LL3A 2P9UA 3THVA 1XHXA 3PIPL 4BRDA 3EL2A 3H46O 5AQTA 4IO9L 4BRNA 4FLWA 4JS4A 5TKWA 4CEFA 3O8MA 3WNFA 4I9QA 4CGHA 4DTUA 3KJVA 3NF9A 2OZSA 1NG9A 3CJ1A 3ZLJA 3ENOA 1U4BA 3NH2A 3NF6A 1P90A 1BI4A 1HPZA 5M1OA 1ITGA 3WQTA 2ITMA 1D9FA 1WSFA 4E1JA 3L3VA 5AZIA 4JEPA 1ZBIA 3PLAA 3CCRN 2KLAA 3QNNA 3RR8A 5FRMA 1UOCA 4GV6A 5AQJA 1WBBA 2KZMA 2PYLA 1LWCA 1NJXA 1L3VA 5M1QA 1OH7A 3UKUB 2OPSA 5FRNA 4RW6A 1BDGA 1GOBA 2E2NA 2E88A 1NOYA 3HM8A 2FBYA 5I42A 3AARA 2W6LA 5AQKA 4FWKA 1MDUB 1T7PA 1YF5L 5J2MA 1GLFO 4AM7A 1SAZA 5AQPA 3OS1A 4DLEA 4IJAA 4LF7K 4NXMK 1RDUA 3EE8A 1UA1A 1XHZA 4KHQA 4JI5K 4OGCA 4DS5A 4FK2A 2P9NA 1VQ4N 3VN5A 3V9UA 4LF4K 4DB3A 3ZT2A 1X9MA 1RCHA 3KIOA 1YJNN 4CEOA 1N32K 1K8KA 3VPZA 3FFKB 3ZX0A 3QEVA 4QCLA 1BOTO 5HLFA 2A41A 3VEOA 4KHUA 4R79A 3DXMB 2PYJA 4JRQA 1C0MA 2QXFA 2ZGYA 5J2NA 4KREA 4E7IA 4OLAA 1TYQB 4KB1A 3QESA 1J9AA 2NZTA 2QI2A 2Z1GA 3FZKA 3L2VA 1SUQA 1DLOA 4H0VB 3NDKA 2DTUA 2EX3A 1NM1A 4IEIA 4CJEA 5KTQA 3CCMN 3HO1A 2UXCK 2AA4A 3LP0A 4IG3A 4MDAA 4FM1A 3I55N 2QA4N 2BTFA 2EWSA 4E1NA 2Q97A 1L3SA 2P51A 3OA9A 4DQQA 4IBNA 4LFBK 4CHYA 1KFDA 4FJ9A 3OYHA 3TTFA 2ASMA 5BPLA 1N8RO 2ITGA 1NMNA 3J80O 3VA0A 1YUWA 5DK5A 3CI5A 3PO5A 3CQYA 3EO3A 3R3LA 1ASWA 1T3VA 3LPTA 4JKCA 3RWUA 1P8ZA 4H5VA 1JLBA 4JI4K 2P5GA 4N47A 2QWOA 2O8EB 3O4WA 2UUAK 1EKEA 5C2DA 1SKWA 3O3HA 4KFBA 4E0DA 3BP8A 4K8ZA 5FPDA 4AHCA 2YI1A 3VGKA 2OPPA 1HQUA 1ATRA 1TKXA 4FWLA 4X62K 3O3GA 3HL8A 2HBMA 4KO0A 4BRKA 3G0ZA 4CW7B 3ZX2A 2QTDA 1C0GA 4FZYA 4Z4CA 2Y1JA 5CYQA 4NLCA 4AHVA 4M42A 2LSNA 5AQWA 3EEQA 3HPGA 3V1OA 2YHAA 3DOLA 4FK4A 4MO5A 3VQQA 2ZJRL 3SLCA 3S3NA 3ZT0A 4CZIA 4WFAL 1JL2A 3L3UA 4CK2A 3Q7CA 2P9UB 4E19A 2RHKA 3SZ2A 3R6MA 3VTIA 4YOWA 3RMAA 5JICA 3CIPA 2KFZA 2YNIA 2ZE2A 1CZAN 4NLBA 3OBYA 4DSJA 3HK2A 4LH4A 4DCHA 1VK0A 2D0OA 1U2VA 3T19A 1HYSA 3A8YA 4CEZA 4CJ7A 2FSNA 4DFJA 2FBXA 3KWIA 4FVMA 1S72N 4Y1DA 1NK8A 4DF8A 3M1FA 3MCAB 3P31A 4F8RA 4PA1A 5LJWA 3IS9A 3ISNC 1RBSA 3DXKA 3F9MA 3N4PA 3MN5A 1BI4B 3GDQA 4UY8O 3ZETA 3THWA 3VQCA 1TVRA 2HOEA 1NGAA 4JNEA 5JLHA 2CGKA 4WQ4C 2Z1IA 2O8DB 2G8HA 2PY5A 1NGEA 3AVCA 1E3MA 3ZSQA 2DFEA 5DMRA 1NKCA 3D2EA 1IJJA 4ZHRA 4IZ9A 3ZSVA 3TAMA 4N5SA 4PQUA 1KAZA 3CM5A 3PUFA 4KKOA 5M1FA 4RG8A 1S6QA 4BRLA 1U6ZA 1RTHA 3D45A 3SJHA 1NNEA 3MN9A 3ID8A 3DRPA 2QWRA 3MECA 2IAJA 4OGEA 4B8AB 3O9SA 4O8KA 4WFBL 3FZHA 4ID5A 4CJSA 2HVIA 1VSMA 1JLAA 1TUUA 4W5OA 1BIZA 3SQ4A 4LF5K 3FZMA 3SAHA 5J2PA 5MLCQ 2OYQA 4GVMA 2ZJPL 2HHUA 3AV9A 4CZKA 3OYMA 1QZ6A 1RTJA 1GLAG 4HCCA 3RMBA 3TANA 1TL3A 3LDPA 1JLFA 4ZTJA 4OPJA 4DLGA 2P9SA 4AH9A 3VQ5A 3ITHA 4CBXA 4JK7A 1A5WA 3MXJA 2E2OA 4CJTA 4Z4EA 1KVBA 1UWBA 4CJKA 1KRPA 2F96A 4JV5K 5GADP 4GY2B 1WOQA 1XC9A 3KKSA 1ASUA 3LP2A 4XEIA 1REVA 2A1SA 1U48A 4ISEA 4H0PA 4BG9A 1L5UA 3TR8A 3NVMA 5AJ3K 4JHDB 4DSIA 5BPMA 4YHHK 3L2UA 2PZSA 2F8TA 4B9TA 3K9JA 2VWKA 5HRNA 4ELTA 4BDYA 5J1EA 2HF3A 1KTQA 4FLUA 2ZWHA 3CETA 1GOCA 5KRSA 5FLXO 1Z25A 3HTVA 4X65K 5AZJB 4FJ5A 3KWGA 1VSKA 4OPKA 2F8SA 3TSQA 5DM6L 2OPQA 2IVOA 2W42A 3LANA 3PX6A 2VQFK 1BWFO 1WNSA 1QQMA 2P9IB 1BCOA 3AGKA 5BPNA 4O44A 1BCMA 3H1VX 4WQ4A 1NGFA 4M3ZA 4DR7K 3H3NO 3U4LA 3NMUA 3EZ5A 4FVUA 4PHTX 3LZIA 4BQZA 2F4VK 4JK9A 2DFFA 3SYZA 4RW8A 3T3FA 3VQAA 1OH5A 4KB0A 4O8UA 4EP5A 3LAKA 1S9EA 3S41A 1EP4A 4FJNA 1TV6A 4AF1A 4FJMA 5KPTA 4MO4A 1XWLA 3OTOK 1SL1A 1YJ9N 3NHGA 4NCBA 2AJQA 2NRTA 5GIPA 5C24A 4N56A 4O5FA 1VRUA 2HBKA 4B1YB 1U2VB 1T6DA 3NF8A 4TSXA 4J2DA 3FR0A 4Z4IA 3DOKA 2QKKA 3EN9A 4DV7K 3OYLA 2FLOA 1QHAA 3HI0A 4FOIA 4F2RA 4L3QA 1NKEA 2E1ZA 3CD6N 2D4WA 4DR4K 4LSNA 3J7ZO 4FWMA 4MDBA 3P39A 4CJQA 3JYTA 1TL1A 2YNFA 3KK1A 5T7BA 2ZM6K 4JI3K 5EOYA 4B1WB 4QS8A 3UKUA 1K8AO 2WUSA 3LP1A 4QS7A 1JKHA 4CK3A 4IKFA 3KK2A 3LDOA 5CY4A 3IMXA 2X6NA 5C2FA 3WT0A 1BA0A 4B3RK 4K41A 4NYNA 4GW6A 3KD5E 1VSJA 2I5JA 4DV4K 4BRGA 3LAMA 2VGMA 2UXDK 4FJJA 1MA9B 3QMLA 2GV9A 3QEXA 4KTWA 3SJJA 1RT6A 3LWMA 4OKKA 4JKHA 1FKPA 3EKSA 4CFBA 3CCUN 4MLEA 2QWPA 3L4QA 1J5EK 4RW9A 1FKOA 3QBXA 2XY6A 1HJOA 3M8SA 4C1NK 1NGHA 1ZBLA 1RBTA 3CF5L 2GTDA 3DXMA 4OPAA 3TABA 4FPBA 4IG0A 3HSCA 3DLGA 4BACA 3QERA 1TYQA 4GV3A 1IBKK 4BC5A 5LMNK 5H1SQ 5BRFA 1VSLA 4B1XB 2ASPA 1Q81O 1KD1O 3C7NA 3H08A 3TU5A 4M3UA 1I39A 2IIRA 4JI0K 2Q3SA 5FPEA 5FROA 2P9SB 4CJFA 1WUAA 4HWIA 3DRSA 4BRQA 4H5RA 4YOUA 4ELVA 1WLJA 4BRFA 1RGIA 4JKFA 5E84A 3VQ6A 4DTPA 3VMFB 2XRIA 4C23A 1K9MO 2IC3A 4GKJK 3IRXA 4B9SA 3P5JA 4FK0A 1S1TA 3QLHA 1A5XA 4DTOA 1Q86O 3QBWA 4J8FA 2O8EA 3NF7A 1ATNA 3GL1A 3HVRA 4H4OA 4Z4HA 3L2QA 2YHYA 4LH5A 2KFNA 5AQYA 2WFBA 3VETA 3ZSXA 4FZZA 1JLGA 1K73O 5C10A 2PAVA 3MWTA 3RSEB 1LAWA 4HUFA 4Y0WA 4JRPA 3DLLL 2OZMA 5AQMA 4B1ZA 4KH4A 2O8FB 4CF0A 2FF6A 3VOVA 3DLRA 3THXB 3HOSA 1GLCG 4H4MA 3E9LA 2BH1A 3JS6A 5ADXH 3I8DA 4BQLA 4YORA 2HNDA 1Q9XA 1CZ9A 1XQSC 3ZT1A 2OPRA 4CIGA 3HVTA 3M8PA 4CECA 4BDZA 2GX9A 1HLUA 3SUPA 4BRHA 3AO1A 3OS2A 1BA1A 5AQOA 1WSGA 4JKGB 4FJIA 5IT9O 2KQ2A 2HMPA 3J81O 4HHTA 4DUZK 1RTDA 2FSJA 1D8YA 1BU6O 4M7YA 4GMJB 3WNEA 1QS4A 3A0IX 3ATUA 3TI0A 5BN8A 3AO5A 1B92A 4FXDA 3O6WA 3J7YP 3WQUA 5D3GA 3DI6A 4Q5VA 4JI1K 4JI6K 3KTQA 1IKYA 4KV8A 4CFAA 4BC3A 4DS4A 2DPNA 2ETJA 1SQKA 2G8IA 1CXUA 3CFRA 1YTAA 4E7KA 1HR0K 3K58A 2O8DA 3ASMA 5LL6Z 3C6AA 5C42A 2P9PA 4BWJA 1X3MA 4Q0BA 1JXEA 4F3OA 3DLBA 5AFUH 5KQDA 1JCGA 1EO1A 2B4JA 4CGJA 3WXKA 2G8UA 1S22A 3W0LA 5SZTA 2X74A 3HSTB 3KLGA 1U45A 3NGIA 1VQ9N 3HXMA 3D2FB 3AAQA 3V9XA 3CJAA 1IO2A 3RTVA 4DR5K 3A5LC 4IWVA 1T8EA 4CZEA 4I2QA 4CBWA 2YCHA 3HZ6A 4PKGA 4ISGA 3O9UA 4YY3K 1ZBSA 5C0YA 1RBRA 4DQPA 3IG1A 4JKEA 1SKRA 3QIPA 4DU4A 1BHLA 3MEGA 2HHQA 3TPQA 3ZEUA 3CCJN 4FO0A 5AQNA 4E7HA 5HRRA 1BO5O 5AR0A 1NBWA 2B6AA 2Q0UA 2YV0X 1WSEA 2PBDA 3GBTA 4E3SA 3U3YA 1WBDA 4K8XA 3KVGA 5GIOA 3V4IA 1O13A 3JSMA 1M1KO 2RE2A 4YOTA 4KI4A 3WXJA 4B9LA 5KGWA 4CEBA 3C7NB 1QSLA 4DFPA 3THYB 1OVQA 2XO7A 4B3SK 1DEJA 2BDPA 2VYPA 5JS1A 1QVGM 3N4QA 4H0OA 4JHDA 4ZTFA 4BROA 4J2EA 5AQVA 1DT9A 5AQLA 3TAFA 3NAEA 2VWJA 1L3TA 4KRFA 5HRSA 1CZBA 3QEPA 1XC3A 1N33K 4BC4A 1K6YA 5CE3A 4IFYA 4FJ8A 5AZJA 2WONA 1LOTB 3AVLA 1WB9A 5ADXA 4KTZA 3HPOA 1LW2A 4CZLA 2A40A 1XUPO 2AP1A 3JXUA 1R0AA 3ZYYX 2P9IA 4N76A 4KHWA 1Y64A 3UIQA 2WOMA 1XMOK 3L2RA 3RR7A 3IKMA 1Z6RA 4FJLA 4M45A 1C0UA 1BG3A 3L8BA 5J2QA 3AA4A 4JKDA 1OH6A 3I33A 5F0XA 1VQMN 4DU3A 4FJ7A 4DTXA 3OYKA 1KLMA 5JVHL 4OPHA 1QHTA 1KXPA 3PX0A 2O8BA 3AA2A 2V51B 1TKZA 2A3ZA 2E6LA 3PX4A 4JKBA 1UAXA 5AQSA 1X9WA 4DR1K 3ZSRA 1IG9A 4V19S 3H45C 3ZSZA 1S6PA 5GINA 5DM7L 4LFCK 1HNWK 1QTMA 4H0TB 1VSDA 4YNQA 1D9DA 1J5OA 3WNGA 4IOCL 1BGXT 3T7ZA 3ZSYA 4C1NI 3O08A 3KK3A 4MFBA 1RDAA 4CJUA 1KSPA 4IJNA 1H1VA 3FGUA 1HNIA 2F9WA 2Z1HA 3E01A 1ASVA 3ZSOA 2R7YA 1NJYA 1RT2A 4EIAA 4DQRA 4GKKK 4FWNA 1ATSA 3NH0A 4CD1A 2GWJA 3SPZA 5GAHP 4FLVA 2P9PB 4F3TA 5EX5A 4DFKA 4J2AA 2HBJA 1M90O 1HNZK 1EWRA 2OANA 3IAYA 1QSSA 2H3GX 3TAGA 5JLFA 4KBOA 4B3OA 1C1AA 5EXWA 3PO4A 3DRRA 5JS2A 2NRWA 2P1JA 5E41A 4FLZA 4BWMA 3CCQN 4CJ5A 4DQIA 2QWLA 1NGJA 3BUZB 3LALA 4CZFA 4CJRA 1W9HA 3L0QA 1Y97A 3T1YK 4BDPA 3CJ7A 3O80A 3BEXA 2CGLA 4K43A 3KK7A 4FW2A 5A2QO 3I0RA 4A2AA 3ZEUB 4FWSA 5HP1A 1G15A 2I7NA 3AO2A 3SQ0A 2DFHA 4AHTA 3EYZA 4G1QA 4FM2A 4DQSA 2QXLA 4CHOA 3S3MA 2YNGA 3WNHA 4ILGB 4C8OA 4CZGA 4HTUA 3HPHA 1CXQA 1NWKA 2CH5A 5AQUA 3C0BA 4H03B 1SKSA 1YJWN 1JCFA 2E2QA 4I6MB 4PKHA 2E2PA 3AVAA 4YOXA 1HYZA 3CXCM 3OHRA 1LWFA 1X9JA 2HSTA 2FC0A 5HOOA 4FLYA 1Q18A 2P9KA 2YHBA 4UQGA 4DR6K 3C6TA 4CZJA 4IEEA 2KW4A 2FBTA 1TGOA 3ULEA 3DM2A 4CHNA 2Q36A 3U9DA 1IKXA 4DFMA 1NK7A 3RMDA 1DGKN 2NRXA 1GLEG 1ZBUA 5M1PA 3RSEA 4BRAA 4BGBA 4DV5K 4BE2A 5BN9A 1FXXA 4ISFA 2O8FA 1OVYA 4BGAA 3SAGA 2IGIA 3THXA 3J7AP 4B1VA 3H6EA 4IDHA 4JAXA 3SMSA 4NO7A 2YJEA 4CERA 1IV0A 3R9PA 3K57A 4A62A 3AVIA 4BRCA 1WAJA 3KLEA 3F2KA 2YJFA 1RT1A 4AM6A 3ID6A 3OYIA 4LC9B 3NGYA 3SBTA 4CGFA 4XIUA 1A5VA 5CR4A 1JJ2M 3QEIA 4JKGA 4C8KA 4OLBA 2BUPA 3F73A 3AA3A 1T05A 1U49A 1YITN 2O8BB 1VQNN 2D0CA 3OY9A 2NRVA 2VCPA 3DMJA 3ENBA 3K5NA 4O0JA 4EAHD 2HNZA 1NLVA 3G25A 1EQYA 3GOIA 2HW3A 4PWDA 4RCHA 3SUOA 4FM0A 4DR3K 1QE1A 1RT7A 2Z1JA 2HF4A 1W2BM 2KHOA 4BRPA 4KPYA 4LF8K 3WXLA 3MX2A 5IWAK 3DWLA 1O1WA 4QOZB 4H0XB 3NCIA 1XNRK 4CF8A 3DLKA 1V4TA 2A1RA 3PSFA 4DMNA 4HVJA 2Y1IA 3OYCA 4PL8A 1I3AA 4DG1A 4YOYA 1JLCA 3E1YA 3FZFA 3ZSWA 3SI6A 3A5MC 3R1XA 5BRDA 2KKZA 2E6MA 4K25A 5HL7L 1VQON 3VF6A 3FLCO 4B3TK 1VRTA 3LM9A 3D2FA 1RDWX 2IS3A 4M41A 3D6RA 3ATVA 3PV8A 1QSYA 4HCBA 2P5OA 4GNIA 3CMAN 5CHIA 3G6EN 5CZ2A 2RN2A 2WTUA 4O0IA 3S3OA 4CESA 4FZXC 2D1KA 3CQXA 4DSFA 4DTJA 4B1UB 2HHTA 2QEXN 5KPRA 2V7ZA 3VF4A 4WF9L 3MAQA 4JK8A 3LDLA 3OYFA 2P9LB 4AQYK 1MU2A 4L8RB 3H1QA 1BISA 5TKYA 2Q2RA 2I7PA 3IUCA 5B8HA 1KC8O 2CGJA 1KVAA 3HOTA 3VGMA 1RILA 3MEEA 4LY7A 5I3UA 3QB0A 2XY5A 2ZF5O 3HM9A 3G71N 3DAWA 4ILJA 3K0SA 1RBUA 5KGXA 4BRIA 1WSIA 4BR2A 1RBVA 2XY7A 4OKEA 1RDCA 1EETA 2GUPA 2QWMA 4CGIA 3LZJA 4A61A 4CJ4A 4M63C 3THYA 1XMQK 4AILC 3VA3A 1NGDA 2VG6A 3AO4A 3MX5A 1XI1A 3OYAA 4BREA 1RT5A 3AY9A 5C25A 1NGBA 3QIOA 1FW6A 1RDBA 4KHPK 1TKTA 5F2RA 4CF1A 5C15A 3HT3A 1MWMA 1JXBA 1ESVA 3QINA 4FWRA 4R5PA 4B08A 3D7EO 2P9KB 4X64K 3KLIA 2UUBK 4K0KK 3S9HA 2Q1NA 3ULEB 4NB4A 1IBMK 5FPNA 2JWLA 3AA5X 4DTNA 3L4IA 4YFUA 3AVNA 1HNXK 2JLEA 4LF6K 3SBGA 2FF3B 3O1WA 2ZGZA 4MQ3A 4U7BA 4W5QA 1QQNA 4WFNL 4LD0A 2RPIA 1JLQA 4CVNE 4PY5A 2VG7A 5ELZA 3I56N 2UYTA 5EVZA 4C8MA 3V1QA 4M3XA 3WUHA 3BDPA 5GAEP 4JLHA 3K2PA 2YKMA 3OBWA 3D0PA 4CE9A 5BR8K 3OJSA 2GUIA 1ZBFA 4N41A 1LCUA 4CJVA 4BR5A 1NGCA 2NUBA 4ELUA 2ZJQL 1TKDA 2HHVA 3C65A 4JI8K 1TK8A 3OYJA 4IDKA 4FWOA 1NKBA 3VTHA 2BE2A 1RNHA 2ATQA 4EFHA 1IKVA 1S5JA 1JL1A 3GG4A 4FOEA 1HQEA 2HVHA 2VGNA 1TK0A 2RF2A 3VQDA 4NCGA 3OS0A 4F9OA 2FBVA 1NMDA 5BREA 4FSVA 4FLXA 1BL3A 3U6FA 4BC2A 3QDKA 5JMVA 3C6HA 4I9LA 4BY9C 2QK9A 4DKWA 3LDQA 4A59A 3QFPA 1C0TA 1SL2A 1KVCA 3BY5A 5AQGA 3OYEA 1Q82O 3K5LA 4JD2B 1HX1A 1HKCA 3HBTA 5AQHA 1DTTA 3E9OA 1I94K 4A57A 3O9RA 2Q0RA 3O3FA 3VENA 2DY4A 3FZLA 3MK6A 3EKUA 2E8AA 2OTLN 4I7FA 4EZ9A 2QWQA 2F9TA 3WXMB 4O5BA 3AGRA 3ENHA 4M7XA 3CPWM 4DV2K 2KTQA 3OJUA 1NGIA 4X66K 1OKJA 3CG7A 1W97L 1EWQA 4OKJA 3CM6A 3CMEN 2FSKA 4CZMA 2YHWA 1SV5A 3C6UA 2XHBA 2O4GA 4M3WA 3SV4A 1BUPA 3VEVA 4CF9A 3SPYA 1T03A 5BR9A 1HMVA 1VQ6N 2QWNA 2G8WA 1IBLK 4Z4GA 4YDUA 3CHWA 3SQ2A 3VQPA 3SNNA 3P1GA 1HYVA 3MN6A 4AHRA 4XH5A 3WEEA 4EHUA 4XH1A 3T1AA 4XH4A 1LAVA 3IDHA 4K42A 1WAFA 2F7TA 3HRGA 3TAPA 4CIEA 2YX6A 3LPUA 3B8AX 4AHUA 4BRMA 5KQ8A 3AVBA 3EZWA 3P83D 1E4FT 1T44A 3T1HK 1ZC6A 1HNVA 4B9QA 3MXMA 1KAYA 1YAGA 4B9UA 4I6MA 3V81A 4PL7A 4FYDA 4FW1A 1YVUA 4BG8A 3OYNA 3F9KA 3K5MA 4O4GA 4FPAA 3CC4N 1NK5A 4IXCA 2QW9A 2E5LK 4BVOA 3AVMA 2OCEA 3BZCA 4BR7A 3KD1E 4CJ3A 1X1PA 4CZHA 1DKGD 4H5NA 3K59A 5BRHA 4E7JA 3R8EA 1Z05A 2A6AA 4MLHA 2YNHA 1GLDG 4CGGA 4BR9A 4DV6K 4CHPA 3O9QA 1RTIA 1YXQA 4IOXA 1ZBHA 3VEWA 2KZZA 3FE1A 3TSUA 4CJLA 4KHNA 1VSIA 4JI2K 2G8FA 1VQ5N 3LDNA 3VEXA 2GBZA 3ZT4A 4OX9K 3NE6A 1RDDA 3EY1A 2V7YA 3AVKA 4DUYK 1SL0A 4DR2K 4CHQA 3G10A 4HTLA 4DHYA 4KHSA 3M8QA 1S1WA 3O4QA 4U67L 3OW2M 3VERA 4F4KA 3OYDA 3SAFA 3CJ9A 3BGRA 1U47A 2OTJN 5K14A 4GV9A 3VQ7A 1QZ5A 1NOZA 3TWHA 1N34K 4DWIA 3WXIA 1TAQA 3SQ1A 2A42A 3E9PA 4B9MA 3HYFA 3VQ8A 4Y1CA 1G99A 5KPZA 1GLLO 4RTFD 1NK6A 4RW4A 1R59O 3QEWA 3C95A 4DSLA 5GAGP 3CCEN 1QVFM 3UKRA 5AFUA 1J53A 3PIOL 2JWKA 3PY8A 4OVLA 4Z0UA 4WYBA 4E1MA 4WQ5C 1S1XA 2E4LA 4ILHA 1C0FA 4EZ6A 3EE9A 3ALYA 1ZXOA 4NCAA 3W3DA 4FCYA 2D0BA 4CJPA 3CPEA 4ID1A 2ASOA 4C8NA 5M1NA 2D0PA 1J6ZA 1UA0A 3QNOA 4JI7K 4HUEA 3CJCA 4B3MK 5FPMA 3OYBA 3NVKA 4BR4A 4CEAA 5LMUK 5AQIA 3A5OC 2D5RA 3E66A 4FJXA 1TUYA 2QM1A 1D5AA 1NJZA 2IOCA 3P38A 4H5WA 5AZIB 1U04A 3VESA 3CFPA 1B9DA 4W5RA 3HP6A 1S1UA 2FXUA 2Q31A 4JS5A 4JN4A 3QFUA 2CH6A 3VQBA 3ZX3A 3CCLN 2UUCK 1WN7A 4CFDA 5HROA 3VQEA 4PKIA 1X9SA 2P9LA 3K5OA 1T6CA 1VQ7N 1EXQA 1GLJO 3TTCA 1TAUA 4BE1A 1JCEA 2ZD1A 3K9KA 4FWPA 2XY8A 4AHSA 3OVNA 2NLXA 5KRTA 1C1BA 4FL9A 2X6SA 3TARA 1VAZA 1LV5A 1B9FA 1NGGA 3VGLA 2PFUA 4FJKA 4DF4A 1LW0A 3WEEB 1MWKA 2ZQBA 4Z4FA 4LFAK 3HP9A 3RMCA 2P9NB 2JGUA 1HRHA 2BGGA 1K8KB 3U8XA 1Z26A 3B6PA 2O8CA 4KH5A 3SK3A 4FLTA 4DTSA 3V1RA 3O9TA 2IVNA 1KFSA 2HBLA 1LWEA 3TSPA 1HJRA 1HKBA 4JYAK 4KTQA 3CC7N 4WCEL 1F21A 3I8BA 2NRHA 3MMVA 4I2PA 4EHTA 2A5XA 1W7AA 1C1CA 2WC9A
chains in the Genus database with same CATH topology
2HHHK 5LL6Z 4LF7K 4NXMK 2E5LK 4JI5K 4LF9K 1XNQK 4JI7K 4GKJK 4DV7K 4B3MK 4LF4K 1XMOK 4DV1K 3JAMO 5LMUK 1N32K 4DR4K 3T1YK 4DR5K 4JV5K 1XMQK 2UXBK 4DV6K 5A2QO 2ZM6K 4JI3K 4DR3K 1I94K 4KHPK 2UUCK 2UU9K 4LF8K 4YY3K 5AJ3K 5IWAK 4JI2K 2UXCK 4YHHK 4DV3K 4B3RK 1XNRK 4DR1K 4DV4K 4X64K 4V19S 4OX9K 2UUBK 4K0KK 2UXDK 4LFCK 1HNWK 5FLXO 4X65K 4DUYK 4DV2K 4LFBK 1IBMK 4DR2K 4X66K 1J5EK 3J80O 1N36K 2VQFK 1HNXK 4B3TK 4LF6K 2VQEK 4LFAK 4DR6K 5IT9O 1N34K 3J81O 4JI4K 4DUZK 4CVNE 1IBLK 4DR7K 4GKKK 1FJGK 2UUAK 2F4VK 4NXNK 4B3SK 4DV5K 1IBKK 5BR8K 1HNZK 3J7YP 4LF5K 4JYAK 5LMNK 4X62K 4DV0K 4JI1K 4JI6K 3OTOK 3J7AP 4AQYK 4CW7B 4JI8K 4JI0K 1N33K 3T1HK 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH K;  5LL6 Z;  4LF7 K;  4NXM K;  2E5L K;  4JI5 K;  4LF9 K;  1XNQ K;  4JI7 K;  4GKJ K;  4DV7 K;  4B3M K;  4LF4 K;  1XMO K;  4DV1 K;  3JAM O;  5LMU K;  1N32 K;  4DR4 K;  3T1Y K;  4DR5 K;  4JV5 K;  1XMQ K;  2UXB K;  4DV6 K;  5A2Q O;  2ZM6 K;  4JI3 K;  4DR3 K;  1I94 K;  4KHP K;  2UUC K;  2UU9 K;  4LF8 K;  4YY3 K;  5AJ3 K;  5IWA K;  4JI2 K;  2UXC K;  4YHH K;  4DV3 K;  4B3R K;  1XNR K;  4DR1 K;  4DV4 K;  4X64 K;  4V19 S;  4OX9 K;  2UUB K;  4K0K K;  2UXD K;  4LFC K;  1HNW K;  5FLX O;  4X65 K;  4DUY K;  4DV2 K;  4LFB K;  1IBM K;  4DR2 K;  4X66 K;  1J5E K;  3J80 O;  1N36 K;  2VQF K;  1HNX K;  4B3T K;  4LF6 K;  2VQE K;  4LFA K;  4DR6 K;  5IT9 O;  1N34 K;  3J81 O;  4JI4 K;  4DUZ K;  4CVN E;  1IBL K;  4DR7 K;  4GKK K;  1FJG K;  2UUA K;  2F4V K;  4NXN K;  4B3S K;  4DV5 K;  1IBK K;  5BR8 K;  1HNZ K;  3J7Y P;  4LF5 K;  4JYA K;  5LMN K;  4X62 K;  4DV0 K;  4JI1 K;  4JI6 K;  3OTO K;  3J7A P;  4AQY K;  4CW7 B;  4JI8 K;  4JI0 K;  1N33 K;  3T1H K;  1HR0 K; 
#chains in the Genus database with same CATH topology
 4BE0 A;  3M3Z A;  1YTU A;  3L2W A;  1VSH A;  2VWB A;  4H8K A;  3V9W A;  1KCF A;  1QQC A;  4RWT A;  2HHX A;  4WQ5 A;  3QIC A;  5M1K A;  1HPM A;  3AVH A;  1GLB G;  4OJR A;  3VQ9 A;  5AQF A;  3DLH A;  3CQ8 A;  1S9G A;  1DTQ A;  4GVE A;  2GWK A;  3AVG A;  3ZCM A;  5SWM A;  2GEM A;  2D0A A;  1NK9 A;  3GE1 A;  1IKW A;  5HRP A;  3TAE A;  2NRR A;  2UXB K;  4NYF A;  3VF2 A;  3VQ4 A;  4JKA A;  3RRG A;  1VSF A;  3BZK A;  4CHZ A;  4KI6 A;  3AVF A;  4CCH A;  1CLQ A;  3CJB A;  2G8V A;  3CYM A;  4E89 A;  2UU9 K;  4DSK A;  1VHX A;  1X3N A;  4RW7 A;  3ZT3 A;  3RRH A;  3B6O A;  5JVG L;  3P4I A;  4F2S A;  2W41 A;  3BF1 A;  2HNY A;  1V4S A;  3O4N A;  3MXI A;  4KAZ A;  3TAQ A;  4C8L A;  3KLF A;  1KQS M;  3C94 A;  4M3T A;  1KAX A;  3U9Z A;  3MED A;  2RKI A;  3H3O B;  1OH8 A;  3MN7 A;  1ILY A;  1VQ8 N;  1Q8I A;  1S3X A;  3SCX A;  1SZ2 A;  4IOA L;  4CFC A;  1YT3 A;  5FDL A;  1YIJ N;  1YHQ N;  4E7L A;  5AQZ A;  4J2B A;  1RT4 A;  4W5T A;  3MDQ A;  4CF2 A;  3BF3 A;  3CCS N;  2W40 A;  3UKR B;  4CEE A;  2QKB A;  1Q9Y A;  1BQM A;  1HUX A;  1N6Q A;  4A5B A;  4KHY A;  1BQN A;  1S1V A;  4JD2 A;  4CI6 A;  3KKR A;  5KI6 A;  4OO1 J;  5AQQ A;  1N5Y A;  3KLH A;  3QO9 A;  1NJI O;  2BAN A;  3M6G A;  3RVC A;  1RFQ A;  1QQO A;  4IFV A;  1Q7Y O;  3SV3 A;  4IFE A;  4DV0 K;  3MWP A;  1VQL N;  3DXK B;  1WSJ A;  3CFO A;  3NFA A;  3IFR A;  3ZET B;  3LWL A;  4PUO A;  3THW B;  4B9V A;  3KZB A;  3NGZ A;  4CGD A;  2EHG A;  4LSL A;  3KHY A;  3UE5 A;  4BVP A;  3SMP A;  1JLE A;  3AVJ A;  2E20 A;  4WE1 A;  1XNQ K;  3CCV N;  1TK5 A;  3D2E B;  3NH1 A;  3M8R A;  3DYA A;  5C12 A;  3LDS A;  3NBP A;  4CIF A;  3FFI A;  4H5T A;  4A2B A;  2NRZ A;  1L3U A;  4B9N A;  4FWQ A;  1J54 A;  1C6V A;  4CEQ A;  4B8C A;  4ICL A;  3O5B A;  3MCP A;  1D4X A;  4FJH A;  2W6K A;  4CD3 A;  3QET A;  2YKN A;  5CZ1 A;  2WBN A;  3I0S A;  5HBM A;  3AO3 A;  4DV3 K;  2V52 B;  2YHX A;  5AQX A;  1W0H A;  3OYG A;  1NK0 A;  2O4I A;  4DTM A;  4H0Y B;  5LJV A;  5CYM A;  4G9Z A;  3AAP A;  1FK9 A;  1E4G T;  3VEZ A;  5E26 A;  3A5N C;  2VG5 A;  2HMI A;  2O8C B;  3F5T A;  4M3Y A;  1RT3 A;  1NU0 A;  3CC2 N;  3SUN A;  1IH7 A;  1N36 K;  1HKG A;  1GOA A;  1NK4 A;  2VQE K;  3LM2 A;  1IG8 A;  4QS9 A;  2NNW A;  2B5J A;  3DJC A;  1KLN A;  3A2F A;  3U3G A;  1FJG K;  1BIU A;  3CER A;  4M3R A;  5F1X A;  3UB5 A;  4DQ8 A;  2OA8 A;  4A5A A;  4NXN K;  4DU1 A;  3G4S N;  2IDO A;  1NJW A;  3VEY A;  4FJG A;  4YDU C;  3V9S A;  3O1B A;  3L6Q A;  1WSH A;  3J8A A;  4CK1 A;  3T69 A;  3DLE A;  3M5R A;  2IVP A;  2X78 A;  2HHW A;  4EP4 A;  3PSI A;  4YOV A;  5EY4 A;  2HHH K;  1VQK N;  2G8K A;  2GEL A;  1EX4 A;  2HHS A;  4KH6 A;  3TTD A;  4Z94 A;  5LY3 A;  1ZYQ A;  4CBU A;  4O55 A;  4LF9 K;  4CJW A;  2J4R A;  4IO8 A;  1YVN A;  3LP3 A;  3Q7B A;  4DV1 K;  3SUQ A;  5AQR A;  3JAM O;  4W5N A;  3HJF A;  4QAG A;  4BR0 A;  2HB5 A;  1VQP N;  3ULD A;  4DTR A;  5EU7 A;  3V6D A;  1SS6 A;  1YI2 N;  4HUG A;  4DSE A;  3V9Z A;  1VSE A;  4CED A;  2E1Y A;  5I9E B;  3LL3 A;  2P9U A;  3THV A;  1XHX A;  3PIP L;  4BRD A;  3EL2 A;  3H46 O;  5AQT A;  4IO9 L;  4BRN A;  4FLW A;  4JS4 A;  5TKW A;  4CEF A;  3O8M A;  3WNF A;  4I9Q A;  4CGH A;  4DTU A;  3KJV A;  3NF9 A;  2OZS A;  1NG9 A;  3CJ1 A;  3ZLJ A;  3ENO A;  1U4B A;  3NH2 A;  3NF6 A;  1P90 A;  1BI4 A;  1HPZ A;  5M1O A;  1ITG A;  3WQT A;  2ITM A;  1D9F A;  1WSF A;  4E1J A;  3L3V A;  5AZI A;  4JEP A;  1ZBI A;  3PLA A;  3CCR N;  2KLA A;  3QNN A;  3RR8 A;  5FRM A;  1UOC A;  4GV6 A;  5AQJ A;  1WBB A;  2KZM A;  2PYL A;  1LWC A;  1NJX A;  1L3V A;  5M1Q A;  1OH7 A;  3UKU B;  2OPS A;  5FRN A;  4RW6 A;  1BDG A;  1GOB A;  2E2N A;  2E88 A;  1NOY A;  3HM8 A;  2FBY A;  5I42 A;  3AAR A;  2W6L A;  5AQK A;  4FWK A;  1MDU B;  1T7P A;  1YF5 L;  5J2M A;  1GLF O;  4AM7 A;  1SAZ A;  5AQP A;  3OS1 A;  4DLE A;  4IJA A;  4LF7 K;  4NXM K;  1RDU A;  3EE8 A;  1UA1 A;  1XHZ A;  4KHQ A;  4JI5 K;  4OGC A;  4DS5 A;  4FK2 A;  2P9N A;  1VQ4 N;  3VN5 A;  3V9U A;  4LF4 K;  4DB3 A;  3ZT2 A;  1X9M A;  1RCH A;  3KIO A;  1YJN N;  4CEO A;  1N32 K;  1K8K A;  3VPZ A;  3FFK B;  3ZX0 A;  3QEV A;  4QCL A;  1BOT O;  5HLF A;  2A41 A;  3VEO A;  4KHU A;  4R79 A;  3DXM B;  2PYJ A;  4JRQ A;  1C0M A;  2QXF A;  2ZGY A;  5J2N A;  4KRE A;  4E7I A;  4OLA A;  1TYQ B;  4KB1 A;  3QES A;  1J9A A;  2NZT A;  2QI2 A;  2Z1G A;  3FZK A;  3L2V A;  1SUQ A;  1DLO A;  4H0V B;  3NDK A;  2DTU A;  2EX3 A;  1NM1 A;  4IEI A;  4CJE A;  5KTQ A;  3CCM N;  3HO1 A;  2UXC K;  2AA4 A;  3LP0 A;  4IG3 A;  4MDA A;  4FM1 A;  3I55 N;  2QA4 N;  2BTF A;  2EWS A;  4E1N A;  2Q97 A;  1L3S A;  2P51 A;  3OA9 A;  4DQQ A;  4IBN A;  4LFB K;  4CHY A;  1KFD A;  4FJ9 A;  3OYH A;  3TTF A;  2ASM A;  5BPL A;  1N8R O;  2ITG A;  1NMN A;  3J80 O;  3VA0 A;  1YUW A;  5DK5 A;  3CI5 A;  3PO5 A;  3CQY A;  3EO3 A;  3R3L A;  1ASW A;  1T3V A;  3LPT A;  4JKC A;  3RWU A;  1P8Z A;  4H5V A;  1JLB A;  4JI4 K;  2P5G A;  4N47 A;  2QWO A;  2O8E B;  3O4W A;  2UUA K;  1EKE A;  5C2D A;  1SKW A;  3O3H A;  4KFB A;  4E0D A;  3BP8 A;  4K8Z A;  5FPD A;  4AHC A;  2YI1 A;  3VGK A;  2OPP A;  1HQU A;  1ATR A;  1TKX A;  4FWL A;  4X62 K;  3O3G A;  3HL8 A;  2HBM A;  4KO0 A;  4BRK A;  3G0Z A;  4CW7 B;  3ZX2 A;  2QTD A;  1C0G A;  4FZY A;  4Z4C A;  2Y1J A;  5CYQ A;  4NLC A;  4AHV A;  4M42 A;  2LSN A;  5AQW A;  3EEQ A;  3HPG A;  3V1O A;  2YHA A;  3DOL A;  4FK4 A;  4MO5 A;  3VQQ A;  2ZJR L;  3SLC A;  3S3N A;  3ZT0 A;  4CZI A;  4WFA L;  1JL2 A;  3L3U A;  4CK2 A;  3Q7C A;  2P9U B;  4E19 A;  2RHK A;  3SZ2 A;  3R6M A;  3VTI A;  4YOW A;  3RMA A;  5JIC A;  3CIP A;  2KFZ A;  2YNI A;  2ZE2 A;  1CZA N;  4NLB A;  3OBY A;  4DSJ A;  3HK2 A;  4LH4 A;  4DCH A;  1VK0 A;  2D0O A;  1U2V A;  3T19 A;  1HYS A;  3A8Y A;  4CEZ A;  4CJ7 A;  2FSN A;  4DFJ A;  2FBX A;  3KWI A;  4FVM A;  1S72 N;  4Y1D A;  1NK8 A;  4DF8 A;  3M1F A;  3MCA B;  3P31 A;  4F8R A;  4PA1 A;  5LJW A;  3IS9 A;  3ISN C;  1RBS A;  3DXK A;  3F9M A;  3N4P A;  3MN5 A;  1BI4 B;  3GDQ A;  4UY8 O;  3ZET A;  3THW A;  3VQC A;  1TVR A;  2HOE A;  1NGA A;  4JNE A;  5JLH A;  2CGK A;  4WQ4 C;  2Z1I A;  2O8D B;  2G8H A;  2PY5 A;  1NGE A;  3AVC A;  1E3M A;  3ZSQ A;  2DFE A;  5DMR A;  1NKC A;  3D2E A;  1IJJ A;  4ZHR A;  4IZ9 A;  3ZSV A;  3TAM A;  4N5S A;  4PQU A;  1KAZ A;  3CM5 A;  3PUF A;  4KKO A;  5M1F A;  4RG8 A;  1S6Q A;  4BRL A;  1U6Z A;  1RTH A;  3D45 A;  3SJH A;  1NNE A;  3MN9 A;  3ID8 A;  3DRP A;  2QWR A;  3MEC A;  2IAJ A;  4OGE A;  4B8A B;  3O9S A;  4O8K A;  4WFB L;  3FZH A;  4ID5 A;  4CJS A;  2HVI A;  1VSM A;  1JLA A;  1TUU A;  4W5O A;  1BIZ A;  3SQ4 A;  4LF5 K;  3FZM A;  3SAH A;  5J2P A;  5MLC Q;  2OYQ A;  4GVM A;  2ZJP L;  2HHU A;  3AV9 A;  4CZK A;  3OYM A;  1QZ6 A;  1RTJ A;  1GLA G;  4HCC A;  3RMB A;  3TAN A;  1TL3 A;  3LDP A;  1JLF A;  4ZTJ A;  4OPJ A;  4DLG A;  2P9S A;  4AH9 A;  3VQ5 A;  3ITH A;  4CBX A;  4JK7 A;  1A5W A;  3MXJ A;  2E2O A;  4CJT A;  4Z4E A;  1KVB A;  1UWB A;  4CJK A;  1KRP A;  2F96 A;  4JV5 K;  5GAD P;  4GY2 B;  1WOQ A;  1XC9 A;  3KKS A;  1ASU A;  3LP2 A;  4XEI A;  1REV A;  2A1S A;  1U48 A;  4ISE A;  4H0P A;  4BG9 A;  1L5U A;  3TR8 A;  3NVM A;  5AJ3 K;  4JHD B;  4DSI A;  5BPM A;  4YHH K;  3L2U A;  2PZS A;  2F8T A;  4B9T A;  3K9J A;  2VWK A;  5HRN A;  4ELT A;  4BDY A;  5J1E A;  2HF3 A;  1KTQ A;  4FLU A;  2ZWH A;  3CET A;  1GOC A;  5KRS A;  5FLX O;  1Z25 A;  3HTV A;  4X65 K;  5AZJ B;  4FJ5 A;  3KWG A;  1VSK A;  4OPK A;  2F8S A;  3TSQ A;  5DM6 L;  2OPQ A;  2IVO A;  2W42 A;  3LAN A;  3PX6 A;  2VQF K;  1BWF O;  1WNS A;  1QQM A;  2P9I B;  1BCO A;  3AGK A;  5BPN A;  4O44 A;  1BCM A;  3H1V X;  4WQ4 A;  1NGF A;  4M3Z A;  4DR7 K;  3H3N O;  3U4L A;  3NMU A;  3EZ5 A;  4FVU A;  4PHT X;  3LZI A;  4BQZ A;  2F4V K;  4JK9 A;  2DFF A;  3SYZ A;  4RW8 A;  3T3F A;  3VQA A;  1OH5 A;  4KB0 A;  4O8U A;  4EP5 A;  3LAK A;  1S9E A;  3S41 A;  1EP4 A;  4FJN A;  1TV6 A;  4AF1 A;  4FJM A;  5KPT A;  4MO4 A;  1XWL A;  3OTO K;  1SL1 A;  1YJ9 N;  3NHG A;  4NCB A;  2AJQ A;  2NRT A;  5GIP A;  5C24 A;  4N56 A;  4O5F A;  1VRU A;  2HBK A;  4B1Y B;  1U2V B;  1T6D A;  3NF8 A;  4TSX A;  4J2D A;  3FR0 A;  4Z4I A;  3DOK A;  2QKK A;  3EN9 A;  4DV7 K;  3OYL A;  2FLO A;  1QHA A;  3HI0 A;  4FOI A;  4F2R A;  4L3Q A;  1NKE A;  2E1Z A;  3CD6 N;  2D4W A;  4DR4 K;  4LSN A;  3J7Z O;  4FWM A;  4MDB A;  3P39 A;  4CJQ A;  3JYT A;  1TL1 A;  2YNF A;  3KK1 A;  5T7B A;  2ZM6 K;  4JI3 K;  5EOY A;  4B1W B;  4QS8 A;  3UKU A;  1K8A O;  2WUS A;  3LP1 A;  4QS7 A;  1JKH A;  4CK3 A;  4IKF A;  3KK2 A;  3LDO A;  5CY4 A;  3IMX A;  2X6N A;  5C2F A;  3WT0 A;  1BA0 A;  4B3R K;  4K41 A;  4NYN A;  4GW6 A;  3KD5 E;  1VSJ A;  2I5J A;  4DV4 K;  4BRG A;  3LAM A;  2VGM A;  2UXD K;  4FJJ A;  1MA9 B;  3QML A;  2GV9 A;  3QEX A;  4KTW A;  3SJJ A;  1RT6 A;  3LWM A;  4OKK A;  4JKH A;  1FKP A;  3EKS A;  4CFB A;  3CCU N;  4MLE A;  2QWP A;  3L4Q A;  1J5E K;  4RW9 A;  1FKO A;  3QBX A;  2XY6 A;  1HJO A;  3M8S A;  4C1N K;  1NGH A;  1ZBL A;  1RBT A;  3CF5 L;  2GTD A;  3DXM A;  4OPA A;  3TAB A;  4FPB A;  4IG0 A;  3HSC A;  3DLG A;  4BAC A;  3QER A;  1TYQ A;  4GV3 A;  1IBK K;  4BC5 A;  5LMN K;  5H1S Q;  5BRF A;  1VSL A;  4B1X B;  2ASP A;  1Q81 O;  1KD1 O;  3C7N A;  3H08 A;  3TU5 A;  4M3U A;  1I39 A;  2IIR A;  4JI0 K;  2Q3S A;  5FPE A;  5FRO A;  2P9S B;  4CJF A;  1WUA A;  4HWI A;  3DRS A;  4BRQ A;  4H5R A;  4YOU A;  4ELV A;  1WLJ A;  4BRF A;  1RGI A;  4JKF A;  5E84 A;  3VQ6 A;  4DTP A;  3VMF B;  2XRI A;  4C23 A;  1K9M O;  2IC3 A;  4GKJ K;  3IRX A;  4B9S A;  3P5J A;  4FK0 A;  1S1T A;  3QLH A;  1A5X A;  4DTO A;  1Q86 O;  3QBW A;  4J8F A;  2O8E A;  3NF7 A;  1ATN A;  3GL1 A;  3HVR A;  4H4O A;  4Z4H A;  3L2Q A;  2YHY A;  4LH5 A;  2KFN A;  5AQY A;  2WFB A;  3VET A;  3ZSX A;  4FZZ A;  1JLG A;  1K73 O;  5C10 A;  2PAV A;  3MWT A;  3RSE B;  1LAW A;  4HUF A;  4Y0W A;  4JRP A;  3DLL L;  2OZM A;  5AQM A;  4B1Z A;  4KH4 A;  2O8F B;  4CF0 A;  2FF6 A;  3VOV A;  3DLR A;  3THX B;  3HOS A;  1GLC G;  4H4M A;  3E9L A;  2BH1 A;  3JS6 A;  5ADX H;  3I8D A;  4BQL A;  4YOR A;  2HND A;  1Q9X A;  1CZ9 A;  1XQS C;  3ZT1 A;  2OPR A;  4CIG A;  3HVT A;  3M8P A;  4CEC A;  4BDZ A;  2GX9 A;  1HLU A;  3SUP A;  4BRH A;  3AO1 A;  3OS2 A;  1BA1 A;  5AQO A;  1WSG A;  4JKG B;  4FJI A;  5IT9 O;  2KQ2 A;  2HMP A;  3J81 O;  4HHT A;  4DUZ K;  1RTD A;  2FSJ A;  1D8Y A;  1BU6 O;  4M7Y A;  4GMJ B;  3WNE A;  1QS4 A;  3A0I X;  3ATU A;  3TI0 A;  5BN8 A;  3AO5 A;  1B92 A;  4FXD A;  3O6W A;  3J7Y P;  3WQU A;  5D3G A;  3DI6 A;  4Q5V A;  4JI1 K;  4JI6 K;  3KTQ A;  1IKY A;  4KV8 A;  4CFA A;  4BC3 A;  4DS4 A;  2DPN A;  2ETJ A;  1SQK A;  2G8I A;  1CXU A;  3CFR A;  1YTA A;  4E7K A;  1HR0 K;  3K58 A;  2O8D A;  3ASM A;  5LL6 Z;  3C6A A;  5C42 A;  2P9P A;  4BWJ A;  1X3M A;  4Q0B A;  1JXE A;  4F3O A;  3DLB A;  5AFU H;  5KQD A;  1JCG A;  1EO1 A;  2B4J A;  4CGJ A;  3WXK A;  2G8U A;  1S22 A;  3W0L A;  5SZT A;  2X74 A;  3HST B;  3KLG A;  1U45 A;  3NGI A;  1VQ9 N;  3HXM A;  3D2F B;  3AAQ A;  3V9X A;  3CJA A;  1IO2 A;  3RTV A;  4DR5 K;  3A5L C;  4IWV A;  1T8E A;  4CZE A;  4I2Q A;  4CBW A;  2YCH A;  3HZ6 A;  4PKG A;  4ISG A;  3O9U A;  4YY3 K;  1ZBS A;  5C0Y A;  1RBR A;  4DQP A;  3IG1 A;  4JKE A;  1SKR A;  3QIP A;  4DU4 A;  1BHL A;  3MEG A;  2HHQ A;  3TPQ A;  3ZEU A;  3CCJ N;  4FO0 A;  5AQN A;  4E7H A;  5HRR A;  1BO5 O;  5AR0 A;  1NBW A;  2B6A A;  2Q0U A;  2YV0 X;  1WSE A;  2PBD A;  3GBT A;  4E3S A;  3U3Y A;  1WBD A;  4K8X A;  3KVG A;  5GIO A;  3V4I A;  1O13 A;  3JSM A;  1M1K O;  2RE2 A;  4YOT A;  4KI4 A;  3WXJ A;  4B9L A;  5KGW A;  4CEB A;  3C7N B;  1QSL A;  4DFP A;  3THY B;  1OVQ A;  2XO7 A;  4B3S K;  1DEJ A;  2BDP A;  2VYP A;  5JS1 A;  1QVG M;  3N4Q A;  4H0O A;  4JHD A;  4ZTF A;  4BRO A;  4J2E A;  5AQV A;  1DT9 A;  5AQL A;  3TAF A;  3NAE A;  2VWJ A;  1L3T A;  4KRF A;  5HRS A;  1CZB A;  3QEP A;  1XC3 A;  1N33 K;  4BC4 A;  1K6Y A;  5CE3 A;  4IFY A;  4FJ8 A;  5AZJ A;  2WON A;  1LOT B;  3AVL A;  1WB9 A;  5ADX A;  4KTZ A;  3HPO A;  1LW2 A;  4CZL A;  2A40 A;  1XUP O;  2AP1 A;  3JXU A;  1R0A A;  3ZYY X;  2P9I A;  4N76 A;  4KHW A;  1Y64 A;  3UIQ A;  2WOM A;  1XMO K;  3L2R A;  3RR7 A;  3IKM A;  1Z6R A;  4FJL A;  4M45 A;  1C0U A;  1BG3 A;  3L8B A;  5J2Q A;  3AA4 A;  4JKD A;  1OH6 A;  3I33 A;  5F0X A;  1VQM N;  4DU3 A;  4FJ7 A;  4DTX A;  3OYK A;  1KLM A;  5JVH L;  4OPH A;  1QHT A;  1KXP A;  3PX0 A;  2O8B A;  3AA2 A;  2V51 B;  1TKZ A;  2A3Z A;  2E6L A;  3PX4 A;  4JKB A;  1UAX A;  5AQS A;  1X9W A;  4DR1 K;  3ZSR A;  1IG9 A;  4V19 S;  3H45 C;  3ZSZ A;  1S6P A;  5GIN A;  5DM7 L;  4LFC K;  1HNW K;  1QTM A;  4H0T B;  1VSD A;  4YNQ A;  1D9D A;  1J5O A;  3WNG A;  4IOC L;  1BGX T;  3T7Z A;  3ZSY A;  4C1N I;  3O08 A;  3KK3 A;  4MFB A;  1RDA A;  4CJU A;  1KSP A;  4IJN A;  1H1V A;  3FGU A;  1HNI A;  2F9W A;  2Z1H A;  3E01 A;  1ASV A;  3ZSO A;  2R7Y A;  1NJY A;  1RT2 A;  4EIA A;  4DQR A;  4GKK K;  4FWN A;  1ATS A;  3NH0 A;  4CD1 A;  2GWJ A;  3SPZ A;  5GAH P;  4FLV A;  2P9P B;  4F3T A;  5EX5 A;  4DFK A;  4J2A A;  2HBJ A;  1M90 O;  1HNZ K;  1EWR A;  2OAN A;  3IAY A;  1QSS A;  2H3G X;  3TAG A;  5JLF A;  4KBO A;  4B3O A;  1C1A A;  5EXW A;  3PO4 A;  3DRR A;  5JS2 A;  2NRW A;  2P1J A;  5E41 A;  4FLZ A;  4BWM A;  3CCQ N;  4CJ5 A;  4DQI A;  2QWL A;  1NGJ A;  3BUZ B;  3LAL A;  4CZF A;  4CJR A;  1W9H A;  3L0Q A;  1Y97 A;  3T1Y K;  4BDP A;  3CJ7 A;  3O80 A;  3BEX A;  2CGL A;  4K43 A;  3KK7 A;  4FW2 A;  5A2Q O;  3I0R A;  4A2A A;  3ZEU B;  4FWS A;  5HP1 A;  1G15 A;  2I7N A;  3AO2 A;  3SQ0 A;  2DFH A;  4AHT A;  3EYZ A;  4G1Q A;  4FM2 A;  4DQS A;  2QXL A;  4CHO A;  3S3M A;  2YNG A;  3WNH A;  4ILG B;  4C8O A;  4CZG A;  4HTU A;  3HPH A;  1CXQ A;  1NWK A;  2CH5 A;  5AQU A;  3C0B A;  4H03 B;  1SKS A;  1YJW N;  1JCF A;  2E2Q A;  4I6M B;  4PKH A;  2E2P A;  3AVA A;  4YOX A;  1HYZ A;  3CXC M;  3OHR A;  1LWF A;  1X9J A;  2HST A;  2FC0 A;  5HOO A;  4FLY A;  1Q18 A;  2P9K A;  2YHB A;  4UQG A;  4DR6 K;  3C6T A;  4CZJ A;  4IEE A;  2KW4 A;  2FBT A;  1TGO A;  3ULE A;  3DM2 A;  4CHN A;  2Q36 A;  3U9D A;  1IKX A;  4DFM A;  1NK7 A;  3RMD A;  1DGK N;  2NRX A;  1GLE G;  1ZBU A;  5M1P A;  3RSE A;  4BRA A;  4BGB A;  4DV5 K;  4BE2 A;  5BN9 A;  1FXX A;  4ISF A;  2O8F A;  1OVY A;  4BGA A;  3SAG A;  2IGI A;  3THX A;  3J7A P;  4B1V A;  3H6E A;  4IDH A;  4JAX A;  3SMS A;  4NO7 A;  2YJE A;  4CER A;  1IV0 A;  3R9P A;  3K57 A;  4A62 A;  3AVI A;  4BRC A;  1WAJ A;  3KLE A;  3F2K A;  2YJF A;  1RT1 A;  4AM6 A;  3ID6 A;  3OYI A;  4LC9 B;  3NGY A;  3SBT A;  4CGF A;  4XIU A;  1A5V A;  5CR4 A;  1JJ2 M;  3QEI A;  4JKG A;  4C8K A;  4OLB A;  2BUP A;  3F73 A;  3AA3 A;  1T05 A;  1U49 A;  1YIT N;  2O8B B;  1VQN N;  2D0C A;  3OY9 A;  2NRV A;  2VCP A;  3DMJ A;  3ENB A;  3K5N A;  4O0J A;  4EAH D;  2HNZ A;  1NLV A;  3G25 A;  1EQY A;  3GOI A;  2HW3 A;  4PWD A;  4RCH A;  3SUO A;  4FM0 A;  4DR3 K;  1QE1 A;  1RT7 A;  2Z1J A;  2HF4 A;  1W2B M;  2KHO A;  4BRP A;  4KPY A;  4LF8 K;  3WXL A;  3MX2 A;  5IWA K;  3DWL A;  1O1W A;  4QOZ B;  4H0X B;  3NCI A;  1XNR K;  4CF8 A;  3DLK A;  1V4T A;  2A1R A;  3PSF A;  4DMN A;  4HVJ A;  2Y1I A;  3OYC A;  4PL8 A;  1I3A A;  4DG1 A;  4YOY A;  1JLC A;  3E1Y A;  3FZF A;  3ZSW A;  3SI6 A;  3A5M C;  3R1X A;  5BRD A;  2KKZ A;  2E6M A;  4K25 A;  5HL7 L;  1VQO N;  3VF6 A;  3FLC O;  4B3T K;  1VRT A;  3LM9 A;  3D2F A;  1RDW X;  2IS3 A;  4M41 A;  3D6R A;  3ATV A;  3PV8 A;  1QSY A;  4HCB A;  2P5O A;  4GNI A;  3CMA N;  5CHI A;  3G6E N;  5CZ2 A;  2RN2 A;  2WTU A;  4O0I A;  3S3O A;  4CES A;  4FZX C;  2D1K A;  3CQX A;  4DSF A;  4DTJ A;  4B1U B;  2HHT A;  2QEX N;  5KPR A;  2V7Z A;  3VF4 A;  4WF9 L;  3MAQ A;  4JK8 A;  3LDL A;  3OYF A;  2P9L B;  4AQY K;  1MU2 A;  4L8R B;  3H1Q A;  1BIS A;  5TKY A;  2Q2R A;  2I7P A;  3IUC A;  5B8H A;  1KC8 O;  2CGJ A;  1KVA A;  3HOT A;  3VGM A;  1RIL A;  3MEE A;  4LY7 A;  5I3U A;  3QB0 A;  2XY5 A;  2ZF5 O;  3HM9 A;  3G71 N;  3DAW A;  4ILJ A;  3K0S A;  1RBU A;  5KGX A;  4BRI A;  1WSI A;  4BR2 A;  1RBV A;  2XY7 A;  4OKE A;  1RDC A;  1EET A;  2GUP A;  2QWM A;  4CGI A;  3LZJ A;  4A61 A;  4CJ4 A;  4M63 C;  3THY A;  1XMQ K;  4AIL C;  3VA3 A;  1NGD A;  2VG6 A;  3AO4 A;  3MX5 A;  1XI1 A;  3OYA A;  4BRE A;  1RT5 A;  3AY9 A;  5C25 A;  1NGB A;  3QIO A;  1FW6 A;  1RDB A;  4KHP K;  1TKT A;  5F2R A;  4CF1 A;  5C15 A;  3HT3 A;  1MWM A;  1JXB A;  1ESV A;  3QIN A;  4FWR A;  4R5P A;  4B08 A;  3D7E O;  2P9K B;  4X64 K;  3KLI A;  2UUB K;  4K0K K;  3S9H A;  2Q1N A;  3ULE B;  4NB4 A;  1IBM K;  5FPN A;  2JWL A;  3AA5 X;  4DTN A;  3L4I A;  4YFU A;  3AVN A;  1HNX K;  2JLE A;  4LF6 K;  3SBG A;  2FF3 B;  3O1W A;  2ZGZ A;  4MQ3 A;  4U7B A;  4W5Q A;  1QQN A;  4WFN L;  4LD0 A;  2RPI A;  1JLQ A;  4CVN E;  4PY5 A;  2VG7 A;  5ELZ A;  3I56 N;  2UYT A;  5EVZ A;  4C8M A;  3V1Q A;  4M3X A;  3WUH A;  3BDP A;  5GAE P;  4JLH A;  3K2P A;  2YKM A;  3OBW A;  3D0P A;  4CE9 A;  5BR8 K;  3OJS A;  2GUI A;  1ZBF A;  4N41 A;  1LCU A;  4CJV A;  4BR5 A;  1NGC A;  2NUB A;  4ELU A;  2ZJQ L;  1TKD A;  2HHV A;  3C65 A;  4JI8 K;  1TK8 A;  3OYJ A;  4IDK A;  4FWO A;  1NKB A;  3VTH A;  2BE2 A;  1RNH A;  2ATQ A;  4EFH A;  1IKV A;  1S5J A;  1JL1 A;  3GG4 A;  4FOE A;  1HQE A;  2HVH A;  2VGN A;  1TK0 A;  2RF2 A;  3VQD A;  4NCG A;  3OS0 A;  4F9O A;  2FBV A;  1NMD A;  5BRE A;  4FSV A;  4FLX A;  1BL3 A;  3U6F A;  4BC2 A;  3QDK A;  5JMV A;  3C6H A;  4I9L A;  4BY9 C;  2QK9 A;  4DKW A;  3LDQ A;  4A59 A;  3QFP A;  1C0T A;  1SL2 A;  1KVC A;  3BY5 A;  5AQG A;  3OYE A;  1Q82 O;  3K5L A;  4JD2 B;  1HX1 A;  1HKC A;  3HBT A;  5AQH A;  1DTT A;  3E9O A;  1I94 K;  4A57 A;  3O9R A;  2Q0R A;  3O3F A;  3VEN A;  2DY4 A;  3FZL A;  3MK6 A;  3EKU A;  2E8A A;  2OTL N;  4I7F A;  4EZ9 A;  2QWQ A;  2F9T A;  3WXM B;  4O5B A;  3AGR A;  3ENH A;  4M7X A;  3CPW M;  4DV2 K;  2KTQ A;  3OJU A;  1NGI A;  4X66 K;  1OKJ A;  3CG7 A;  1W97 L;  1EWQ A;  4OKJ A;  3CM6 A;  3CME N;  2FSK A;  4CZM A;  2YHW A;  1SV5 A;  3C6U A;  2XHB A;  2O4G A;  4M3W A;  3SV4 A;  1BUP A;  3VEV A;  4CF9 A;  3SPY A;  1T03 A;  5BR9 A;  1HMV A;  1VQ6 N;  2QWN A;  2G8W A;  1IBL K;  4Z4G A;  4YDU A;  3CHW A;  3SQ2 A;  3VQP A;  3SNN A;  3P1G A;  1HYV A;  3MN6 A;  4AHR A;  4XH5 A;  3WEE A;  4EHU A;  4XH1 A;  3T1A A;  4XH4 A;  1LAV A;  3IDH A;  4K42 A;  1WAF A;  2F7T A;  3HRG A;  3TAP A;  4CIE A;  2YX6 A;  3LPU A;  3B8A X;  4AHU A;  4BRM A;  5KQ8 A;  3AVB A;  3EZW A;  3P83 D;  1E4F T;  1T44 A;  3T1H K;  1ZC6 A;  1HNV A;  4B9Q A;  3MXM A;  1KAY A;  1YAG A;  4B9U A;  4I6M A;  3V81 A;  4PL7 A;  4FYD A;  4FW1 A;  1YVU A;  4BG8 A;  3OYN A;  3F9K A;  3K5M A;  4O4G A;  4FPA A;  3CC4 N;  1NK5 A;  4IXC A;  2QW9 A;  2E5L K;  4BVO A;  3AVM A;  2OCE A;  3BZC A;  4BR7 A;  3KD1 E;  4CJ3 A;  1X1P A;  4CZH A;  1DKG D;  4H5N A;  3K59 A;  5BRH A;  4E7J A;  3R8E A;  1Z05 A;  2A6A A;  4MLH A;  2YNH A;  1GLD G;  4CGG A;  4BR9 A;  4DV6 K;  4CHP A;  3O9Q A;  1RTI A;  1YXQ A;  4IOX A;  1ZBH A;  3VEW A;  2KZZ A;  3FE1 A;  3TSU A;  4CJL A;  4KHN A;  1VSI A;  4JI2 K;  2G8F A;  1VQ5 N;  3LDN A;  3VEX A;  2GBZ A;  3ZT4 A;  4OX9 K;  3NE6 A;  1RDD A;  3EY1 A;  2V7Y A;  3AVK A;  4DUY K;  1SL0 A;  4DR2 K;  4CHQ A;  3G10 A;  4HTL A;  4DHY A;  4KHS A;  3M8Q A;  1S1W A;  3O4Q A;  4U67 L;  3OW2 M;  3VER A;  4F4K A;  3OYD A;  3SAF A;  3CJ9 A;  3BGR A;  1U47 A;  2OTJ N;  5K14 A;  4GV9 A;  3VQ7 A;  1QZ5 A;  1NOZ A;  3TWH A;  1N34 K;  4DWI A;  3WXI A;  1TAQ A;  3SQ1 A;  2A42 A;  3E9P A;  4B9M A;  3HYF A;  3VQ8 A;  4Y1C A;  1G99 A;  5KPZ A;  1GLL O;  4RTF D;  1NK6 A;  4RW4 A;  1R59 O;  3QEW A;  3C95 A;  4DSL A;  5GAG P;  3CCE N;  1QVF M;  3UKR A;  5AFU A;  1J53 A;  3PIO L;  2JWK A;  3PY8 A;  4OVL A;  4Z0U A;  4WYB A;  4E1M A;  4WQ5 C;  1S1X A;  2E4L A;  4ILH A;  1C0F A;  4EZ6 A;  3EE9 A;  3ALY A;  1ZXO A;  4NCA A;  3W3D A;  4FCY A;  2D0B A;  4CJP A;  3CPE A;  4ID1 A;  2ASO A;  4C8N A;  5M1N A;  2D0P A;  1J6Z A;  1UA0 A;  3QNO A;  4JI7 K;  4HUE A;  3CJC A;  4B3M K;  5FPM A;  3OYB A;  3NVK A;  4BR4 A;  4CEA A;  5LMU K;  5AQI A;  3A5O C;  2D5R A;  3E66 A;  4FJX A;  1TUY A;  2QM1 A;  1D5A A;  1NJZ A;  2IOC A;  3P38 A;  4H5W A;  5AZI B;  1U04 A;  3VES A;  3CFP A;  1B9D A;  4W5R A;  3HP6 A;  1S1U A;  2FXU A;  2Q31 A;  4JS5 A;  4JN4 A;  3QFU A;  2CH6 A;  3VQB A;  3ZX3 A;  3CCL N;  2UUC K;  1WN7 A;  4CFD A;  5HRO A;  3VQE A;  4PKI A;  1X9S A;  2P9L A;  3K5O A;  1T6C A;  1VQ7 N;  1EXQ A;  1GLJ O;  3TTC A;  1TAU A;  4BE1 A;  1JCE A;  2ZD1 A;  3K9K A;  4FWP A;  2XY8 A;  4AHS A;  3OVN A;  2NLX A;  5KRT A;  1C1B A;  4FL9 A;  2X6S A;  3TAR A;  1VAZ A;  1LV5 A;  1B9F A;  1NGG A;  3VGL A;  2PFU A;  4FJK A;  4DF4 A;  1LW0 A;  3WEE B;  1MWK A;  2ZQB A;  4Z4F A;  4LFA K;  3HP9 A;  3RMC A;  2P9N B;  2JGU A;  1HRH A;  2BGG A;  1K8K B;  3U8X A;  1Z26 A;  3B6P A;  2O8C A;  4KH5 A;  3SK3 A;  4FLT A;  4DTS A;  3V1R A;  3O9T A;  2IVN A;  1KFS A;  2HBL A;  1LWE A;  3TSP A;  1HJR A;  1HKB A;  4JYA K;  4KTQ A;  3CC7 N;  4WCE L;  1F21 A;  3I8B A;  2NRH A;  3MMV A;  4I2P A;  4EHT A;  2A5X A;  1W7A A;  1C1C A;  2WC9 A; 
#chains in the Genus database with same CATH homology
 2HHH K;  5LL6 Z;  4LF7 K;  4NXM K;  2E5L K;  4JI5 K;  4LF9 K;  1XNQ K;  4JI7 K;  4GKJ K;  4DV7 K;  4B3M K;  4LF4 K;  1XMO K;  4DV1 K;  3JAM O;  5LMU K;  1N32 K;  4DR4 K;  3T1Y K;  4DR5 K;  4JV5 K;  1XMQ K;  2UXB K;  4DV6 K;  5A2Q O;  2ZM6 K;  4JI3 K;  4DR3 K;  1I94 K;  4KHP K;  2UUC K;  2UU9 K;  4LF8 K;  4YY3 K;  5AJ3 K;  5IWA K;  4JI2 K;  2UXC K;  4YHH K;  4DV3 K;  4B3R K;  1XNR K;  4DR1 K;  4DV4 K;  4X64 K;  4V19 S;  4OX9 K;  2UUB K;  4K0K K;  2UXD K;  4LFC K;  1HNW K;  5FLX O;  4X65 K;  4DUY K;  4DV2 K;  4LFB K;  1IBM K;  4DR2 K;  4X66 K;  1J5E K;  3J80 O;  1N36 K;  2VQF K;  1HNX K;  4B3T K;  4LF6 K;  2VQE K;  4LFA K;  4DR6 K;  5IT9 O;  1N34 K;  3J81 O;  4JI4 K;  4DUZ K;  4CVN E;  1IBL K;  4DR7 K;  4GKK K;  1FJG K;  2UUA K;  2F4V K;  4NXN K;  4B3S K;  4DV5 K;  1IBK K;  5BR8 K;  1HNZ K;  3J7Y P;  4LF5 K;  4JYA K;  5LMN K;  4X62 K;  4DV0 K;  4JI1 K;  4JI6 K;  3OTO K;  3J7A P;  4AQY K;  4CW7 B;  4JI8 K;  4JI0 K;  1N33 K;  3T1H K;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...