1XMOK

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xmoK00
4AQYK 3JAMO 4LFBK 4NXMK 1N33K 2UUAK 4LF6K 4JI3K 4GKKK 4DR6K 3OTOK 2UUCK 1I94K 3J7AP 2VQEK 2E5LK 4JV5K 1J5EK 4DR7K 4LFAK 2UUBK 1IBKK 3J7YP 4JI8K 4DV2K 4JI7K 2UU9K 4LF4K 4DV0K 4DV6K 1XMOK 4K0KK 2VQFK 3J80O 4DUZK 4YY3K 4LF7K 5FLXO 4DR5K 4JI0K 3J81O 4B3MK 5IT9O 4DV3K 4B3SK 1HNXK 4DV7K 3T1HK 1XNRK 5BR8K 5LMUK 4LF5K 4KHPK 2UXCK 5A2QO 1XMQK 4OX9K 5LMNK 2ZM6K 4JI5K 4X65K 1N34K 3T1YK 1HNZK 2UXBK 4X64K 4GKJK 1N36K 4X66K 4DR2K 2F4VK 1N32K 4JI2K 4DV5K 5IWAK 5AJ3K 1HR0K 1IBLK 1HNWK 4B3RK 4DV4K 4DR4K 4V19S 4JYAK 2UXDK 1IBMK 4JI1K 4LF9K 2HHHK 4CVNE 4DR1K 4JI6K 1FJGK 4YHHK 4B3TK 4CW7B 4DUYK 1XNQK 4DR3K 4LF8K 4NXNK 4DV1K 4LFCK 5LL6Z 4X62K 4JI4K
chains in the Genus database with same CATH superfamily
4FWMA 3I8DA 2F7TA 1U04A 3AVMA 1OH5A 3M8RA 4BDZA 1ILYA 3I0SA 3G10A 3CQ8A 5JLFA 5F1XA 2ZJRL 1D4XA 3EO3A 4H0YB 1BCOA 4BG8A 2BGGA 4CJ3A 4H4OA 4FJ7A 4W5RA 3WXJA 3J7YP 5DK5A 3VQDA 2P5OA 3MN7A 1B92A 4BR9A 1TVRA 4PQUA 3SNNA 5FPDA 5DM7L 1S1UA 1SL0A 3O4NA 3ZT3A 4DU3A 3HI0A 4YY3K 1X9WA 3MEDA 1IV0A 5FLXO 3O9QA 4YOTA 4DHYA 3FR0A 3ISNC 4QAGA 3AO1A 4DV3K 4KB1A 1DLOA 2OZMA 1RDDA 1TUUA 3L0QA 1K73O 1RTHA 4U7BA 3O4WA 2B5JA 1TGOA 2OTLN 5J2QA 1Q86O 3ULDA 3O3FA 3ZSOA 3QINA 3PIOL 1RCHA 2O8FA 1QSLA 1YJNN 4CK2A 3FZKA 2IAJA 4CECA 4GY2B 1KRPA 2O8EA 4BC3A 3B8AX 1YJ9N 1HNIA 4ICLA 5AZJA 3TPQA 2P9PA 2AJQA 1Z05A 3SV3A 4G1QA 4YOVA 5FPNA 3F73A 5FPEA 2OTJN 5GIPA 3B6PA 1XC9A 3ZEUB 4EP5A 2NRTA 3TAEA 5AQSA 4OVLA 2P9KB 2P9LA 4FPAA 4H0VB 4AM7A 5MLCQ 1D9DA 2Y1IA 1BA1A 1L3VA 3ITHA 4O55A 2YHXA 1ASUA 1W97L 4DLEA 3VEOA 3MXIA 3O6WA 4N5SA 1ZBIA 1LAWA 3Q7CA 1BGXT 4Y0WA 1VQ7N 3VA0A 2YX6A 3U3GA 1A5VA 4KH4A 4DUYK 2P9SB 3NF6A 4NXNK 4LF8K 4DQQA 3BGRA 1RBVA 3HYFA 3VENA 3V1OA 2GWKA 2O8DA 2E2QA 1TAUA 2ZJPL 1RBRA 2UUCK 3CPWM 3CC2N 3WNHA 4DR7K 2UUBK 3VQ4A 3QBXA 3AVFA 3O8MA 1IJJA 1CXQA 2RKIA 4JD2B 4CF0A 2F8SA 4BRIA 1VQON 4DQIA 3V6DA 3HO1A 4M3YA 3CETA 3KLHA 5FDLA 2Q97A 1Q9XA 3HPHA 3KD5E 1NMDA 4J8FA 2G8KA 4BRDA 1T7PA 1NGCA 1REVA 3C65A 3QMLA 4DV7K 3VGLA 1J9AA 4FJXA 3QFUA 2R7YA 1NJXA 5AQJA 1XNRK 3VEVA 4GV6A 1NM1A 5FRNA 4EHTA 3M8QA 4XH4A 2IC3A 2BUPA 5C2DA 3WUHA 3V9ZA 2I7NA 2I5JA 4OKKA 1RT7A 3UKRB 3VA3A 4DS5A 1GOBA 3E1YA 3GDQA 2HNZA 2JLEA 4IG0A 3KKRA 2D0BA 3DLBA 3BEXA 4EAHD 4E7HA 2ZWHA 4L3QA 3THXA 1OH6A 1QS4A 3VQQA 1U2VA 4FLWA 3LP3A 5HRRA 4FJLA 1LWCA 4CEDA 1JLBA 5AQPA 3ZETA 3AGKA 4E1JA 1OH8A 3SYZA 4IBNA 5E41A 3OBYA 3LP1A 3IG1A 3EE8A 3M5RA 3WEEA 1JLQA 2Z1JA 1C1BA 3OS1A 3HOTA 3E9LA 1QQOA 2E4LA 4DR3K 4K25A 3QESA 2DFHA 5CYQA 3PIPL 2HHXA 4DFKA 1KAXA 1ITGA 2FSKA 5I9EB 3AVGA 4C8KA 3CJAA 2E20A 2CH5A 1I94K 1WNSA 1U49A 1BI4B 4IJNA 3CCEN 3VF2A 4U67L 4DFPA 2PBDA 1NWKA 3DLGA 3ZT1A 3LWMA 5GAEP 4TSXA 4BWJA 1IBKK 4CK1A 1NGDA 3NBPA 3L2VA 3H3NO 2FBTA 4EZ9A 2QM1A 3U6FA 1VQ5N 1GLJO 2VQFK 2Q1NA 5C10A 4BRHA 5B8HA 3NF9A 4B3MK 5J2NA 1BUPA 3BUZB 1LAVA 3LAMA 4DSJA 1VQNN 1KC8O 4RW4A 1VSIA 1NGEA 5JS2A 2P9UA 4DSKA 3HL8A 3NAEA 1RTIA 2AP1A 2P9IB 2DPNA 2YI1A 4CFCA 3BZCA 4DTPA 4PKIA 1WBBA 3SAFA 2UXCK 3A5LC 2IDOA 1NOZA 1LOTB 4M3RA 5GAGP 4ELTA 2DTUA 1ASWA 5LMNK 1GOAA 4BRLA 1VSLA 3HSCA 4CFBA 2Y1JA 2GELA 3PUFA 3SUQA 1RILA 5JVGL 3NHGA 1ATSA 1DKGD 2HHVA 1XI1A 3SMPA 1MWMA 2J4RA 2VYPA 5BPLA 1RBSA 3VQ7A 3SJHA 4AHUA 3C7NA 2KZZA 4FJGA 4CGJA 3D6RA 4LY7A 1KAZA 4OKJA 3D2FA 3A5MC 3MEEA 4DG1A 1VQ8N 2KZMA 4PY5A 4J2AA 4KBOA 1RDUA 4KRFA 1BHLA 5CE3A 4CW7B 3O9SA 1RTDA 4X62K 2HSTA 3AA2A 5KPZA 1NNEA 4IOAL 3QETA 2PFUA 5BRHA 4LSNA 1IKVA 4CJ4A 3OYFA 3JXUA 1L3UA 2ZGZA 3V9UA 4I7FA 3SZ2A 1JCGA 4DTSA 3DXKB 3KTQA 4JKDA 4FO0A 3CJ1A 1ZBLA 2XRIA 4JAXA 1BWFO 5J1EA 3FZMA 1NJIO 4K41A 2VG7A 1YTUA 4BRAA 2IS3A 3O80A 4MDAA 4HCCA 4RCHA 3DMJA 4JEPA 1K9MO 5E26A 3DRPA 2OCEA 2ZD1A 3LPTA 1WSHA 4FK2A 1ZYQA 3WXIA 3HTVA 2E88A 3RMCA 1XHXA 4J2DA 1WSIA 4GVEA 4CJPA 1VSEA 5KPTA 1HYVA 4WQ4C 1VSJA 3CPEA 5AQMA 1A5WA 4XH5A 4B9NA 1YF5L 1B9FA 3T1YK 4B1UB 4RW7A 4A2BA 2VG5A 4MFBA 3AA4A 3SMSA 1BQNA 1YVNA 1T03A 3LDQA 3DRRA 3AA5X 3PV8A 4W5OA 2HBLA 2P51A 1SV5A 3VETA 5GAHP 1W0HA 2ZE2A 3THYB 5GADP 4WFNL 3PX0A 3QICA 3RRGA 2IIRA 3SPZA 4KO0A 3PX4A 4H8KA 4DTMA 1OH7A 3TWHA 1KLMA 5AQUA 4B8AB 4FL9A 5AFUH 4A5BA 4NYFA 3VEYA 2E2PA 3A0IX 2P9KA 3MMVA 1A5XA 1JKHA 1KVAA 1JXBA 4DFJA 4BG9A 1JL1A 3QDKA 3KZBA 2YNFA 3CMAN 2QWNA 3OYGA 4BR4A 4DTOA 1RT6A 1R59O 3K5NA 2NRHA 3CCUN 4KKOA 4KTZA 2YNGA 3O3GA 4WYBA 4EP4A 4DSIA 3NH1A 4Y1DA 3ATVA 5JLHA 5AFUA 3S9HA 3HBTA 3D45A 4M7YA 3QIOA 3SAHA 3UKUB 3HM9A 5AQGA 2OPRA 1Q81O 1WAJA 5AQXA 4ELVA 4LF7K 1U47A 4CJTA 1EQYA 4GNIA 4JI0K 5C15A 4DSEA 3I55N 4I2PA 4CJKA 3T7ZA 5FRMA 5M1KA 4C8NA 1CXUA 3SI6A 1NK7A 1JXEA 1T6DA 2WC9A 3ZX2A 5BREA 4GW6A 2CH6A 3OW2M 4WFAL 4CEOA 1HRHA 4YOUA 4W5NA 5T7BA 5AQWA 1LW2A 5J2MA 3IKMA 3VGMA 4NB4A 1S9EA 4DLGA 3KJVA 5EX5A 1MA9B 4BY9C 2QK9A 2O8CA 2WBNA 4ISGA 1N32K 4IZ9A 4A5AA 3ULEA 1YT3A 3GG4A 3K58A 5M1NA 3CERA 2XY5A 4C8LA 2ASOA 2YV0X 2CGKA 4BR5A 3DXMB 4B3RK 5I3UA 1NK0A 4B3OA 1S1WA 1BG3A 2RE2A 5BRFA 1UOCA 1F21A 3H6EA 4CGDA 3JS6A 3EL2A 5KQ8A 4CZIA 2CGJA 3R9PA 4BRGA 5EY4A 3AA3A 3MX2A 2X74A 2ETJA 1YI2N 4BC5A 4CZEA 1NJWA 3FE1A 4LFCK 4QS8A 4MQ3A 2FF6A 3WXKA 3N4PA 3DLHA 4AM6A 1N33K 1VSHA 1TK5A 2Z1IA 5J2PA 3OYMA 4FJ8A 3DOLA 3I0RA 3C0BA 1WOQA 3A8YA 1BQMA 3E9OA 3GOIA 3HPOA 4DV2K 1VK0A 1KD1O 2Z1HA 3MX5A 1UA1A 4B9SA 1HPZA 3L3VA 2HHSA 4FM2A 2QXLA 3SUOA 4LH5A 5AQIA 1KAYA 4KFBA 1NKCA 2NRVA 1TKXA 3E66A 5KRSA 4O5FA 3PO5A 4B8CA 4FZYA 3H46O 4H5RA 3MECA 1QVGM 4RW9A 4B3SK 4DTRA 1KLNA 3T1HK 3UE5A 4ELUA 4E0DA 5C24A 3O1BA 2HVIA 1EWQA 4E3SA 2LSNA 4CEZA 4DKWA 3VEWA 3HM8A 4L8RB 4LF5K 1C0MA 2GUPA 4KH5A 2A3ZA 3CCLN 2VWJA 4K42A 2E6LA 3ATUA 2V52B 4DQSA 3L4QA 4FOEA 3RR8A 2DFEA 4CE9A 4JI5K 4CFAA 2RF2A 4C1NI 4CJWA 5KI6A 3U4LA 3CCMN 2RN2A 3SQ0A 2UXBK 3O9UA 4FLUA 3L2UA 3K5LA 4AILC 2D1KA 5TKWA 5M1OA 1BOTO 4JKEA 4FLZA 4FPBA 1EX4A 1SQKA 3ZYYX 3LDLA 1HJOA 1XQSC 1NKBA 3R1XA 3VERA 4B9QA 1HNWK 3LM9A 4Z4CA 4FW2A 3QEPA 2E6MA 2QWOA 3Q7BA 3F2KA 2WTUA 3CCSN 1UAXA 4JLHA 4CD1A 1KVCA 2Q0UA 4NO7A 1L5UA 5AQTA 4DWIA 4CHQA 2QKBA 3THWB 5LY3A 1E4FT 3H08A 2NZTA 2HNDA 4RW6A 4FJMA 1NKEA 3CJBA 5KPRA 1QTMA 5AQNA 2AA4A 4A62A 2ITMA 4EHUA 3UB5A 4GKKK 1YVUA 4A59A 3V9XA 3CCRN 4M42A 4HUGA 1OVQA 3HOSA 1J5OA 3ZLJA 4BREA 4LD0A 4O0IA 4JKCA 2UU9K 4E7IA 1MDUB 3P5JA 4R5PA 4YNQA 1SKRA 4GVMA 3S3MA 4DV0K 3SCXA 4FJIA 2FSJA 2GTDA 3IFRA 4DS4A 3MEGA 1BO5O 2NLXA 5AQOA 3IMXA 1RBTA 1QQCA 1VHXA 3ZT2A 3C6UA 3J81O 3HT3A 1ASVA 4YOWA 1NGIA 2D0OA 4BRCA 2KKZA 4OPHA 5AQKA 3OJSA 1QVFM 2XY8A 3P1GA 2OPQA 4K8XA 4E19A 5F0XA 3CG7A 2P9NB 4BDYA 3AVAA 3RSEB 4F9OA 3WNEA 5A2QO 3D2EA 3M6GA 3V1RA 4HUFA 2YNIA 5K14A 3FZFA 4Z4HA 4I2QA 1RT3A 3FFIA 4PWDA 1KVBA 4BRFA 1NJZA 3U8XA 5CZ1A 3SLCA 3ZSZA 1OVYA 3D0PA 4B1WB 3DLRA 4BDPA 3K9JA 3MWPA 1TKDA 1P8ZA 4DQ8A 5IWAK 4CCHA 5BN8A 2Q36A 3VQBA 1QZ5A 4JRQA 3LPUA 2XHBA 1WSEA 3AVIA 4ILHA 1TYQB 3LP0A 3KLFA 4PKGA 2KQ2A 1B9DA 4V19S 3DAWA 4AHTA 2XO7A 4FM1A 5HRPA 4FWNA 4CZFA 4ZHRA 5HP1A 2B4JA 5AQYA 5D3GA 4CVNE 1N6QA 1I3AA 1YXQA 4DTNA 2QWMA 1NK4A 1BL3A 4MO4A 3R6MA 4IJAA 3VQCA 4KTWA 3T19A 2VGNA 3THYA 4H5NA 3J7AP 4RWTA 3PY8A 2W42A 4JV5K 4KV8A 1QQMA 1BU6O 3NF8A 3BZKA 3AO3A 3WT0A 3LDPA 1JJ2M 3MN9A 4MLHA 4JS5A 3ZSXA 5C42A 3ENBA 3H1VX 4N56A 4PKHA 4BR0A 3DOKA 4C23A 2KTQA 2A40A 1NGJA 3O9RA 4DTUA 3CXCM 4FWLA 4RG8A 1ATRA 1T05A 4A61A 3QIPA 1NGBA 3CFOA 4FZXC 3OYJA 5ELZA 3OS0A 3SUPA 3DWLA 5DM6L 4IDKA 4W5QA 2Z1GA 1N8RO 3OYNA 3MN6A 4CEBA 1T3VA 3JSMA 4JKFA 4BQZA 4CGHA 5HRNA 4HTUA 4JKHA 3VQ8A 4R79A 2O4GA 4JKAA 4BROA 1ATNA 1K8AO 4E1NA 1MWKA 5AZIB 2Q2RA 5BPNA 1YITN 3UKUA 3NF7A 1RNHA 3VQPA 2KHOA 3TTDA 4YDUC 4CGGA 2YNHA 3ID8A 1Y64A 3WQUA 2H3GX 4DSFA 3ZT4A 3RR7A 4KHWA 1KCFA 4DR2K 4FLXA 3IAYA 4Z4FA 3BY5A 4ILJA 1RFQA 5AQFA 4FLVA 3TTCA 3HK2A 3TAFA 2GUIA 2PYLA 3SPYA 4KB0A 4DV4K 2WFBA 3EYZA 5LJWA 3OBWA 4NCAA 3HVRA 4JHDA 4CBXA 3L8BA 3O1WA 2X6NA 4FWKA 3AVHA 3P83D 4JKBA 2G8WA 2QI2A 4LF9K 4WQ4A 1E4GT 3CJ7A 1FJGK 4B3TK 2HNYA 3GBTA 2FSNA 3KVGA 4CJFA 5LL6Z 4JI4K 4CJVA 3TSQA 2WOMA 2ITGA 1JCEA 3CJCA 3DXMA 4CHZA 1TKTA 4FJ9A 4PL8A 2O8FB 1TAQA 3THVA 4B1YB 3MDQA 2YHWA 4YORA 4BC2A 4JKGA 1VSMA 4NCGA 2O8EB 2KFZA 5AZJB 2P9PB 3QERA 4O0JA 1ZBUA 2EX3A 3W3DA 1IH7A 4BWMA 2QKKA 2W41A 3BF1A 4N47A 3TAPA 3PLAA 1X9MA 1S22A 3ZSWA 3FGUA 3OJUA 2ASPA 3EKSA 4LSLA 5IT9O 1EXQA 4B1VA 1GLFO 1KFDA 2V7ZA 3B6OA 3ZSRA 3CM5A 4E7JA 2XY7A 4WE1A 2D0CA 1NBWA 4ILGB 2G8IA 3FZLA 2YKMA 1IO2A 1W7AA 3HPGA 4DF8A 3EY1A 1YAGA 2O8DB 2RHKA 4DB3A 4H0PA 2ZQBA 5LJVA 1LCUA 1LW0A 4WCEL 4H0TB 3ZSYA 1HYZA 3ENOA 4KHQA 1IKYA 4NYNA 2DY4A 4KHNA 4CD3A 4W5TA 1JLGA 4DV5K 1Z6RA 4BC4A 1VQMN 2NRZA 5E84A 1IBLK 2WUSA 5JMVA 1S1VA 1YHQN 1SKWA 1W9HA 3MCPA 3G6EN 1H1VA 1FW6A 2X6SA 5EXWA 1WSJA 3ALYA 4H0XB 3NFAA 4XH1A 4CJ7A 4DU4A 1EP4A 3TI0A 1QHTA 4Q5VA 4CFDA 4FOIA 1S5JA 4BGAA 3F9MA 3P38A 3EZWA 2FBYA 4CBWA 5HL7L 1SS6A 2EHGA 1XNQK 4FJ5A 1SL1A 4IWVA 4KI4A 3T69A 4O44A 4CHOA 4F3OA 1NGHA 3SQ4A 1G15A 3G25A 4UQGA 2JWLA 1C0UA 3MAQA 5F2RA 4CJQA 4CHNA 1LWEA 3THWA 2NUBA 3CCQN 2G8HA 3THXB 4XEIA 1IG9A 3A5NC 4CEFA 1S1TA 1D5AA 3V9WA 4B9MA 2CGLA 3ZEUA 4WQ5A 3VOVA 2GWJA 3RRHA 1YUWA 5FPMA 4ID1A 3WEEB 2FC0A 4CESA 4AHRA 3LZJA 1FK9A 4EIAA 1DTQA 4DSLA 4KHYA 3K9KA 3NGYA 3MXMA 4YOXA 2P9SA 3VQ5A 4BRKA 5SWMA 1CZ9A 4IEEA 4BGBA 5FROA 1EWRA 4B9TA 1QHAA 3I56N 3MK6A 2VCPA 1HNZK 4M3ZA 3VPZA 4DQRA 1WSGA 4HWIA 3QBWA 1XUPO 1YTAA 2GEMA 2QW9A 2XY6A 1HQEA 2F4VK 4O8KA 4CF2A 1Q18A 2OANA 2OPPA 3U9DA 3N4QA 3IDHA 5HRSA 4NLBA 4CZKA 3VGKA 4I6MB 4JD2A 3RSEA 1C0GA 1S72N 2HBMA 4QCLA 3OYBA 1WB9A 1WBDA 2GV9A 4FWPA 3S3NA 4FK0A 3E01A 4AF1A 5AQHA 3P39A 1EETA 3L2WA 4F2SA 2P9UB 3H3OB 4C1NK 4DCHA 1IBMK 1ZBSA 3CFPA 4CJLA 1ESVA 4Z94A 4JNEA 4YHHK 4GV9A 1Z26A 4DV1K 2NRRA 4BRPA 5M1FA 3HJFA 5GIOA 4ISFA 3JAMO 3KLIA 2O4IA 3C95A 1HNVA 4JI3K 3UKRA 1TYQA 4J2BA 3L6QA 1L3TA 5EU7A 4OLAA 4CZJA 3VF4A 5GINA 4LFAK 4WQ5C 2DFFA 3WQTA 4JI8K 3OHRA 3EKUA 2OYQA 4IOXA 4DFMA 3KKSA 4HUEA 5H1SQ 4CHYA 1XMOK 3C7NB 3OS2A 1ZBHA 1BIZA 2Q3SA 1TUYA 4BACA 2NRXA 4ID5A 3C94A 2ZGYA 5KGXA 2Q31A 1S1XA 3VEZA 4IO8A 3KK1A 3CJ9A 4WF9L 1Y97A 4YOYA 4BRQA 1NK8A 3AO5A 1QZ6A 4FJHA 3AGRA 4FZZA 2QWLA 3AO4A 3K2PA 1HQUA 4B1ZA 4CZLA 2D5RA 3OYDA 4DTXA 1KSPA 1LWFA 4H0OA 2HMPA 2QTDA 1CZAN 3AVCA 1WN7A 3C6AA 1BI4A 1CLQA 1HPMA 3MN5A 3H45C 2KFNA 4CJRA 2FBVA 1NOYA 5KTQA 1BISA 3G4SN 4OPKA 4RTFD 2ATQA 2NNWA 1TK8A 1JLFA 2HF4A 4OJRA 3ZCMA 1QSYA 3SAGA 5AZIA 1HR0K 2G8FA 4OPAA 1ZBFA 3PSFA 4FVMA 1NK5A 3GL1A 2HW3A 1S6PA 4FWSA 3KWGA 1BDGA 2F96A 5HOOA 3WXLA 1YIJN 4A2AA 4EZ6A 3AO2A 1HMVA 4F2RA 2D4WA 3OYCA 2UXDK 4KPYA 4CJUA 2HHHK 3OYHA 1KFSA 3O08A 3LDOA 2P9IA 3IUCA 3HZ6A 4OKEA 3DYAA 4OO1J 3PX6A 2UUAK 2VGMA 2PZSA 1R0AA 2B6AA 3IRXA 3AARA 4J2EA 2IVOA 1K8KB 2F9TA 1J53A 2E5LK 1IKXA 4B1XB 2A41A 2IVNA 3QEIA 3LP2A 4JI7K 3CFRA 1Q82O 4OPJA 4F4KA 4G9ZA 1KXPA 4GV3A 2GX9A 4LC9B 4DQPA 4C8OA 3SK3A 3M3ZA 1C0FA 1SKSA 1VRUA 1GLLO 2BE2A 4FVUA 1HKBA 3SBGA 3P4IA 3QFPA 1M90O 3K0SA 3ZT0A 1SL2A 3RMDA 1KQSM 3QLHA 1WUAA 1G99A 4HTLA 4K8ZA 3VESA 1P90A 5AQZA 3WNGA 2A6AA 2IGIA 3TARA 1RT5A 4E7KA 1HX1A 1GOCA 3ZX3A 5CYMA 1JL2A 4KREA 3VMFB 3KK3A 4IO9L 3K57A 4H03B 1X3NA 1IG8A 1N34K 4KTQA 3CF5L 4FK4A 4GMJB 4BQLA 3SQ2A 3J7ZO 1VSDA 3CIPA 4FSVA 2QXFA 3O9TA 4QS9A 4X64K 3MCAB 4KAZA 4BVPA 3DXKA 3AAPA 1RDAA 4K43A 3ZSVA 1U48A 1RDWX 4E89A 4CK3A 4FM0A 1BIUA 1DT9A 3KWIA 3TSPA 5CZ2A 3L2QA 4F8RA 4FXDA 3DM2A 4KHSA 3KIOA 3VN5A 1HLUA 4CGIA 2OZSA 4IFVA 1VRTA 3TABA 2E2NA 2PYJA 4H5WA 3AVKA 4YDUA 3ZX0A 4M45A 4AQYK 2V51B 1JLEA 3QO9A 1X9JA 1C6VA 3WNFA 4E7LA 1QE1A 4XIUA 3AAQA 4DR6K 3LM2A 5SZTA 4CJ5A 2NRWA 1VQPN 4FW1A 3AV9A 1EKEA 2HB5A 3KHYA 3HP6A 2O8CB 4OGEA 3T3FA 3RMAA 3O5BA 3HP9A 3ULEB 1GLAG 4B9UA 1NG9A 3TU5A 4M3TA 3CHWA 3J80O 3OYAA 3OYIA 2V7YA 3OA9A 3KK2A 2YJEA 4BE0A 4F3TA 1Q9YA 2FF3B 5AQLA 4C8MA 4Z0UA 3U3YA 2VG6A 2O8BB 3HRGA 3FZHA 3VF6A 3G71N 4AHCA 3S3OA 5M1PA 2PY5A 4IKFA 3A5OC 2X78A 4M41A 3ENHA 2A5XA 4BR2A 1KTQA 3LDNA 1NK9A 3OVNA 1TL1A 4CHPA 4OX9K 4PL7A 1JLCA 3TR8A 3AY9A 1C0TA 3AVJA 4FWRA 4JK7A 3O3HA 4AHSA 3RMBA 3E9PA 4ZTFA 2OPSA 2IVPA 3CCVN 5HLFA 1N36K 3M8PA 4JS4A 2YHBA 4Z4GA 4JI2K 4FJNA 3I8BA 2HHUA 4OLBA 1M1KO 3QNNA 5AJ3K 5JICA 2HMIA 1RGIA 4H5VA 1TV6A 1XWLA 3F9KA 3OYEA 2HHTA 3TAGA 1RDBA 2BANA 5KGWA 4DR4K 1FXXA 1RT1A 3RWUA 4JYAK 4MLEA 3QNOA 1DTTA 4CJSA 1MU2A 4BR7A 4IXCA 2F8TA 1TKZA 4N41A 2HF3A 2P1JA 4FWQA 5DMRA 2E1YA 4I6MA 3UIQA 1NLVA 4OGCA 3QEWA 2HHQA 1J6ZA 3NH0A 3VQ9A 3L4IA 4CBUA 1X3MA 3OY9A 3G0ZA 4FJJA 3CD6N 3OTOK 5EVZA 2VQEK 3NDKA 1J5EK 4A57A 1RTJA 3V81A 3AVLA 3QB0A 2KW4A 3F5TA 4HCBA 3L2RA 2ZJQL 3KD1E 5C0YA 4UY8O 3CC7N 3ZSQA 2JGUA 4Z4IA 4JRPA 3S41A 4IFEA 4CJEA 2IOCA 4Q0BA 1X1PA 3MWTA 3NMUA 5ADXH 1WLJA 1SUQA 4WFBL 2QA4N 5HROA 1O13A 2QWPA 4CZGA 1N5YA 2VWBA 1ZC6A 3NE6A 5BN9A 3NH2A 2YHYA 3KLGA 3TAQA 3V4IA 4Z4EA 2P9LB 1CZBA 3PSIA 1NGFA 4CZMA 4BVOA 2ZM6K 1VSFA 4YFUA 4PA1A 1C1CA 3H1QA 3K5MA 3I33A 4FCYA 3VTHA 1NK6A 3K5OA 3VTIA 5ADXA 3A2FA 1U4BA 4M7XA 1GLBG 4FLTA 1D9FA 3CM6A 2BDPA 1RT2A 1GLEG 1TL3A 1BCMA 2W40A 4CIEA 4I9QA 4O5BA 1FKOA 1OKJA 2YJFA 1D8YA 4MDBA 1Q7YO 3HSTB 1ZXOA 1HJRA 2Q0RA 3NGZA 4ZTJA 3IS9A 4BE1A 5CHIA 2KLAA 2FBXA 4DMNA 1WAFA 1NGAA 1NU0A 5HBMA 1E3MA 3C6TA 3D2EB 3DLEA 4ISEA 1FKPA 4NXMK 4CZHA 2E2OA 4LF6K 3V1QA 1K6YA 4O4GA 3BF3A 4O8UA 2WONA 3TTFA 1IKWA 3T1AA 5KRTA 1SZ2A 3CCJN 3SV4A 1W2BM 5KQDA 1XC3A 1DGKN 5CR4A 3LDSA 4CF1A 4FJKA 2QEXN 2VWKA 4DV6K 4K0KK 5BR9A 4DR5K 2A1RA 2BTFA 1K8KA 1SAZA 5BPMA 4NCBA 1YJWN 4QOZB 3KLEA 4CF8A 2HHWA 3CQYA 4BRMA 2I7PA 1VQLN 3LALA 5C25A 1JLAA 2GBZA 4MO5A 5LMUK 1U2VB 2E8AA 5AQVA 4EFHA 1T8EA 3VQ6A 3CMEN 4FWOA 3ASMA 1JCFA 1XMQK 1UA0A 1RDCA 3ZETB 1LV5A 1I39A 3P31A 2D0PA 3KK7A 2PAVA 4NLCA 1NGGA 2FXUA 5TKYA 1HKCA 1VSKA 3RTVA 3BP8A 3JYTA 4GKJK 3V9SA 1T6CA 1GLCG 2QWRA 4X66K 4IG3A 1V4SA 4QS7A 4IDHA 2RPIA 3GE1A 4M63C 3O4QA 4JN4A 1QSSA 3ID6A 5BRDA 3NGIA 1X9SA 2YHAA 1S9GA 4CEEA 4HHTA 2HOEA 4DTJA 4CEQA 1VQKN 1VQ6N 5JVHL 3VQAA 1TK0A 3LANA 5C2FA 2P5GA 4IOCL 3MXJA 4JK8A 1GLDG 5AR0A 3LZIA 4H5TA 4CGFA 3DRSA 2G8VA 4B08A 4AH9A 4DR1K 3WXMB 3EN9A 2P9NA 1T44A 2W6LA 2UYTA 4LFBK 3EEQA 3QEVA 4KH6A 4KHUA 4AHVA 2EWSA 4BRNA 1RT4A 3D7EO 2D0AA 4BE2A 3BDPA 1Z25A 2W6KA 3AVNA 4RW8A 3CQXA 2QWQA 2BH1A 1J54A 4CIGA 3LL3A 3W0LA 4M3XA 5AQQA 3C6HA 4H4MA 4LF4K 1C1AA 3AVBA 3CYMA 2OA8A 3FFKB 3DLKA 4DUZK 2G8UA 4PUOA 3M8SA 1RBUA 4IFYA 2JWKA 5C12A 3DLLL 1VQ4N 2HBJA 3VQEA 1BA0A 1HYSA 4JHDB 3R3LA 1HNXK 3TAMA 4I9LA 3SBTA 2YKNA 3LAKA 4B9VA 1L3SA 3EE9A 3TANA 4M3WA 3EZ5A 1S3XA 5BR8K 1WSFA 3M1FA 3HXMA 4DF4A 4KI6A 3CC4N 4KHPK 4CI6A 1HUXA 1XHZA 4M3UA 5JS1A 2ZF5O 3HVTA 4B9LA 1UWBA 3LWLA 4CIFA 5M1QA 5AQRA 1U6ZA 4X65K 4JKGB 2ASMA 5EOYA 4CERA 3NCIA 3NVKA 5CY4A 4FLYA 3J8AA 3D2FB 2O8BA 4JK9A 1NMNA 1V4TA 1VAZA 3DJCA 1HKGA 2A42A 3R8EA 1EO1A 4CF9A 1QQNA 3OYKA 2E1ZA 3CI5A 3SQ1A 4FYDA 3TSUA 3SJJA 3RVCA 4E1MA 4Y1CA 1U45A 1O1WA 3QEXA 2HVHA 3FLCO 4LH4A 4DU1A 3PO4A 3L3UA 3SUNA 3U9ZA 4HVJA 3K59A 2YCHA 4CEAA 4IEIA 5I42A 4N76A 2F9WA 4JI1K 1VQ9N 1DEJA 2HBKA 3NVMA 4JI6K 3OYLA 2FLOA 1NJYA 4PHTX 2A1SA 3DI6A 1Q8IA 1S6QA 3VEXA
chains in the Genus database with same CATH topology
4AQYK 3JAMO 4LFBK 4NXMK 1N33K 2UUAK 4LF6K 4JI3K 4GKKK 4DR6K 3OTOK 2UUCK 1I94K 3J7AP 2VQEK 2E5LK 4JV5K 1J5EK 4DR7K 4LFAK 2UUBK 1IBKK 3J7YP 4JI8K 4DV2K 4JI7K 2UU9K 4LF4K 4DV0K 4DV6K 1XMOK 4K0KK 2VQFK 3J80O 4DUZK 4YY3K 4LF7K 5FLXO 4DR5K 4JI0K 3J81O 4B3MK 5IT9O 4DV3K 4B3SK 1HNXK 4DV7K 3T1HK 1XNRK 5BR8K 5LMUK 4LF5K 4KHPK 2UXCK 5A2QO 1XMQK 4OX9K 5LMNK 2ZM6K 4JI5K 4X65K 1N34K 3T1YK 1HNZK 2UXBK 4X64K 4GKJK 1N36K 4X66K 4DR2K 2F4VK 1N32K 4JI2K 4DV5K 5IWAK 5AJ3K 1HR0K 1IBLK 1HNWK 4B3RK 4DV4K 4DR4K 4V19S 4JYAK 2UXDK 1IBMK 4JI1K 4LF9K 2HHHK 4CVNE 4DR1K 4JI6K 1FJGK 4YHHK 4B3TK 4CW7B 4DUYK 1XNQK 4DR3K 4LF8K 4NXNK 4DV1K 4LFCK 5LL6Z 4X62K 4JI4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY K;  3JAM O;  4LFB K;  4NXM K;  1N33 K;  2UUA K;  4LF6 K;  4JI3 K;  4GKK K;  4DR6 K;  3OTO K;  2UUC K;  1I94 K;  3J7A P;  2VQE K;  2E5L K;  4JV5 K;  1J5E K;  4DR7 K;  4LFA K;  2UUB K;  1IBK K;  3J7Y P;  4JI8 K;  4DV2 K;  4JI7 K;  2UU9 K;  4LF4 K;  4DV0 K;  4DV6 K;  1XMO K;  4K0K K;  2VQF K;  3J80 O;  4DUZ K;  4YY3 K;  4LF7 K;  5FLX O;  4DR5 K;  4JI0 K;  3J81 O;  4B3M K;  5IT9 O;  4DV3 K;  4B3S K;  1HNX K;  4DV7 K;  3T1H K;  1XNR K;  5BR8 K;  5LMU K;  4LF5 K;  4KHP K;  2UXC K;  5A2Q O;  1XMQ K;  4OX9 K;  5LMN K;  2ZM6 K;  4JI5 K;  4X65 K;  1N34 K;  3T1Y K;  1HNZ K;  2UXB K;  4X64 K;  4GKJ K;  1N36 K;  4X66 K;  4DR2 K;  2F4V K;  1N32 K;  4JI2 K;  4DV5 K;  5IWA K;  5AJ3 K;  1HR0 K;  1IBL K;  1HNW K;  4B3R K;  4DV4 K;  4DR4 K;  4V19 S;  4JYA K;  2UXD K;  1IBM K;  4JI1 K;  4LF9 K;  2HHH K;  4CVN E;  4DR1 K;  4JI6 K;  1FJG K;  4YHH K;  4B3T K;  4CW7 B;  4DUY K;  1XNQ K;  4DR3 K;  4LF8 K;  4NXN K;  4DV1 K;  4LFC K;  5LL6 Z;  4X62 K;  4JI4 K; 
#chains in the Genus database with same CATH topology
 4FWM A;  3I8D A;  2F7T A;  1U04 A;  3AVM A;  1OH5 A;  3M8R A;  4BDZ A;  1ILY A;  3I0S A;  3G10 A;  3CQ8 A;  5JLF A;  5F1X A;  2ZJR L;  1D4X A;  3EO3 A;  4H0Y B;  1BCO A;  4BG8 A;  2BGG A;  4CJ3 A;  4H4O A;  4FJ7 A;  4W5R A;  3WXJ A;  3J7Y P;  5DK5 A;  3VQD A;  2P5O A;  3MN7 A;  1B92 A;  4BR9 A;  1TVR A;  4PQU A;  3SNN A;  5FPD A;  5DM7 L;  1S1U A;  1SL0 A;  3O4N A;  3ZT3 A;  4DU3 A;  3HI0 A;  4YY3 K;  1X9W A;  3MED A;  1IV0 A;  5FLX O;  3O9Q A;  4YOT A;  4DHY A;  3FR0 A;  3ISN C;  4QAG A;  3AO1 A;  4DV3 K;  4KB1 A;  1DLO A;  2OZM A;  1RDD A;  1TUU A;  3L0Q A;  1K73 O;  1RTH A;  4U7B A;  3O4W A;  2B5J A;  1TGO A;  2OTL N;  5J2Q A;  1Q86 O;  3ULD A;  3O3F A;  3ZSO A;  3QIN A;  3PIO L;  1RCH A;  2O8F A;  1QSL A;  1YJN N;  4CK2 A;  3FZK A;  2IAJ A;  4CEC A;  4GY2 B;  1KRP A;  2O8E A;  4BC3 A;  3B8A X;  1YJ9 N;  1HNI A;  4ICL A;  5AZJ A;  3TPQ A;  2P9P A;  2AJQ A;  1Z05 A;  3SV3 A;  4G1Q A;  4YOV A;  5FPN A;  3F73 A;  5FPE A;  2OTJ N;  5GIP A;  3B6P A;  1XC9 A;  3ZEU B;  4EP5 A;  2NRT A;  3TAE A;  5AQS A;  4OVL A;  2P9K B;  2P9L A;  4FPA A;  4H0V B;  4AM7 A;  5MLC Q;  1D9D A;  2Y1I A;  1BA1 A;  1L3V A;  3ITH A;  4O55 A;  2YHX A;  1ASU A;  1W97 L;  4DLE A;  3VEO A;  3MXI A;  3O6W A;  4N5S A;  1ZBI A;  1LAW A;  3Q7C A;  1BGX T;  4Y0W A;  1VQ7 N;  3VA0 A;  2YX6 A;  3U3G A;  1A5V A;  4KH4 A;  4DUY K;  2P9S B;  3NF6 A;  4NXN K;  4LF8 K;  4DQQ A;  3BGR A;  1RBV A;  3HYF A;  3VEN A;  3V1O A;  2GWK A;  2O8D A;  2E2Q A;  1TAU A;  2ZJP L;  1RBR A;  2UUC K;  3CPW M;  3CC2 N;  3WNH A;  4DR7 K;  2UUB K;  3VQ4 A;  3QBX A;  3AVF A;  3O8M A;  1IJJ A;  1CXQ A;  2RKI A;  4JD2 B;  4CF0 A;  2F8S A;  4BRI A;  1VQO N;  4DQI A;  3V6D A;  3HO1 A;  4M3Y A;  3CET A;  3KLH A;  5FDL A;  2Q97 A;  1Q9X A;  3HPH A;  3KD5 E;  1NMD A;  4J8F A;  2G8K A;  4BRD A;  1T7P A;  1NGC A;  1REV A;  3C65 A;  3QML A;  4DV7 K;  3VGL A;  1J9A A;  4FJX A;  3QFU A;  2R7Y A;  1NJX A;  5AQJ A;  1XNR K;  3VEV A;  4GV6 A;  1NM1 A;  5FRN A;  4EHT A;  3M8Q A;  4XH4 A;  2IC3 A;  2BUP A;  5C2D A;  3WUH A;  3V9Z A;  2I7N A;  2I5J A;  4OKK A;  1RT7 A;  3UKR B;  3VA3 A;  4DS5 A;  1GOB A;  3E1Y A;  3GDQ A;  2HNZ A;  2JLE A;  4IG0 A;  3KKR A;  2D0B A;  3DLB A;  3BEX A;  4EAH D;  4E7H A;  2ZWH A;  4L3Q A;  3THX A;  1OH6 A;  1QS4 A;  3VQQ A;  1U2V A;  4FLW A;  3LP3 A;  5HRR A;  4FJL A;  1LWC A;  4CED A;  1JLB A;  5AQP A;  3ZET A;  3AGK A;  4E1J A;  1OH8 A;  3SYZ A;  4IBN A;  5E41 A;  3OBY A;  3LP1 A;  3IG1 A;  3EE8 A;  3M5R A;  3WEE A;  1JLQ A;  2Z1J A;  1C1B A;  3OS1 A;  3HOT A;  3E9L A;  1QQO A;  2E4L A;  4DR3 K;  4K25 A;  3QES A;  2DFH A;  5CYQ A;  3PIP L;  2HHX A;  4DFK A;  1KAX A;  1ITG A;  2FSK A;  5I9E B;  3AVG A;  4C8K A;  3CJA A;  2E20 A;  2CH5 A;  1I94 K;  1WNS A;  1U49 A;  1BI4 B;  4IJN A;  3CCE N;  3VF2 A;  4U67 L;  4DFP A;  2PBD A;  1NWK A;  3DLG A;  3ZT1 A;  3LWM A;  5GAE P;  4TSX A;  4BWJ A;  1IBK K;  4CK1 A;  1NGD A;  3NBP A;  3L2V A;  3H3N O;  2FBT A;  4EZ9 A;  2QM1 A;  3U6F A;  1VQ5 N;  1GLJ O;  2VQF K;  2Q1N A;  5C10 A;  4BRH A;  5B8H A;  3NF9 A;  4B3M K;  5J2N A;  1BUP A;  3BUZ B;  1LAV A;  3LAM A;  4DSJ A;  1VQN N;  1KC8 O;  4RW4 A;  1VSI A;  1NGE A;  5JS2 A;  2P9U A;  4DSK A;  3HL8 A;  3NAE A;  1RTI A;  2AP1 A;  2P9I B;  2DPN A;  2YI1 A;  4CFC A;  3BZC A;  4DTP A;  4PKI A;  1WBB A;  3SAF A;  2UXC K;  3A5L C;  2IDO A;  1NOZ A;  1LOT B;  4M3R A;  5GAG P;  4ELT A;  2DTU A;  1ASW A;  5LMN K;  1GOA A;  4BRL A;  1VSL A;  3HSC A;  4CFB A;  2Y1J A;  2GEL A;  3PUF A;  3SUQ A;  1RIL A;  5JVG L;  3NHG A;  1ATS A;  1DKG D;  2HHV A;  1XI1 A;  3SMP A;  1MWM A;  2J4R A;  2VYP A;  5BPL A;  1RBS A;  3VQ7 A;  3SJH A;  4AHU A;  3C7N A;  2KZZ A;  4FJG A;  4CGJ A;  3D6R A;  4LY7 A;  1KAZ A;  4OKJ A;  3D2F A;  3A5M C;  3MEE A;  4DG1 A;  1VQ8 N;  2KZM A;  4PY5 A;  4J2A A;  4KBO A;  1RDU A;  4KRF A;  1BHL A;  5CE3 A;  4CW7 B;  3O9S A;  1RTD A;  4X62 K;  2HST A;  3AA2 A;  5KPZ A;  1NNE A;  4IOA L;  3QET A;  2PFU A;  5BRH A;  4LSN A;  1IKV A;  4CJ4 A;  3OYF A;  3JXU A;  1L3U A;  2ZGZ A;  3V9U A;  4I7F A;  3SZ2 A;  1JCG A;  4DTS A;  3DXK B;  3KTQ A;  4JKD A;  4FO0 A;  3CJ1 A;  1ZBL A;  2XRI A;  4JAX A;  1BWF O;  5J1E A;  3FZM A;  1NJI O;  4K41 A;  2VG7 A;  1YTU A;  4BRA A;  2IS3 A;  3O80 A;  4MDA A;  4HCC A;  4RCH A;  3DMJ A;  4JEP A;  1K9M O;  5E26 A;  3DRP A;  2OCE A;  2ZD1 A;  3LPT A;  1WSH A;  4FK2 A;  1ZYQ A;  3WXI A;  3HTV A;  2E88 A;  3RMC A;  1XHX A;  4J2D A;  1WSI A;  4GVE A;  4CJP A;  1VSE A;  5KPT A;  1HYV A;  4WQ4 C;  1VSJ A;  3CPE A;  5AQM A;  1A5W A;  4XH5 A;  4B9N A;  1YF5 L;  1B9F A;  3T1Y K;  4B1U B;  4RW7 A;  4A2B A;  2VG5 A;  4MFB A;  3AA4 A;  3SMS A;  1BQN A;  1YVN A;  1T03 A;  3LDQ A;  3DRR A;  3AA5 X;  3PV8 A;  4W5O A;  2HBL A;  2P51 A;  1SV5 A;  3VET A;  5GAH P;  1W0H A;  2ZE2 A;  3THY B;  5GAD P;  4WFN L;  3PX0 A;  3QIC A;  3RRG A;  2IIR A;  3SPZ A;  4KO0 A;  3PX4 A;  4H8K A;  4DTM A;  1OH7 A;  3TWH A;  1KLM A;  5AQU A;  4B8A B;  4FL9 A;  5AFU H;  4A5B A;  4NYF A;  3VEY A;  2E2P A;  3A0I X;  2P9K A;  3MMV A;  1A5X A;  1JKH A;  1KVA A;  1JXB A;  4DFJ A;  4BG9 A;  1JL1 A;  3QDK A;  3KZB A;  2YNF A;  3CMA N;  2QWN A;  3OYG A;  4BR4 A;  4DTO A;  1RT6 A;  1R59 O;  3K5N A;  2NRH A;  3CCU N;  4KKO A;  4KTZ A;  2YNG A;  3O3G A;  4WYB A;  4EP4 A;  4DSI A;  3NH1 A;  4Y1D A;  3ATV A;  5JLH A;  5AFU A;  3S9H A;  3HBT A;  3D45 A;  4M7Y A;  3QIO A;  3SAH A;  3UKU B;  3HM9 A;  5AQG A;  2OPR A;  1Q81 O;  1WAJ A;  5AQX A;  4ELV A;  4LF7 K;  1U47 A;  4CJT A;  1EQY A;  4GNI A;  4JI0 K;  5C15 A;  4DSE A;  3I55 N;  4I2P A;  4CJK A;  3T7Z A;  5FRM A;  5M1K A;  4C8N A;  1CXU A;  3SI6 A;  1NK7 A;  1JXE A;  1T6D A;  2WC9 A;  3ZX2 A;  5BRE A;  4GW6 A;  2CH6 A;  3OW2 M;  4WFA L;  4CEO A;  1HRH A;  4YOU A;  4W5N A;  5T7B A;  5AQW A;  1LW2 A;  5J2M A;  3IKM A;  3VGM A;  4NB4 A;  1S9E A;  4DLG A;  3KJV A;  5EX5 A;  1MA9 B;  4BY9 C;  2QK9 A;  2O8C A;  2WBN A;  4ISG A;  1N32 K;  4IZ9 A;  4A5A A;  3ULE A;  1YT3 A;  3GG4 A;  3K58 A;  5M1N A;  3CER A;  2XY5 A;  4C8L A;  2ASO A;  2YV0 X;  2CGK A;  4BR5 A;  3DXM B;  4B3R K;  5I3U A;  1NK0 A;  4B3O A;  1S1W A;  1BG3 A;  2RE2 A;  5BRF A;  1UOC A;  1F21 A;  3H6E A;  4CGD A;  3JS6 A;  3EL2 A;  5KQ8 A;  4CZI A;  2CGJ A;  3R9P A;  4BRG A;  5EY4 A;  3AA3 A;  3MX2 A;  2X74 A;  2ETJ A;  1YI2 N;  4BC5 A;  4CZE A;  1NJW A;  3FE1 A;  4LFC K;  4QS8 A;  4MQ3 A;  2FF6 A;  3WXK A;  3N4P A;  3DLH A;  4AM6 A;  1N33 K;  1VSH A;  1TK5 A;  2Z1I A;  5J2P A;  3OYM A;  4FJ8 A;  3DOL A;  3I0R A;  3C0B A;  1WOQ A;  3A8Y A;  1BQM A;  3E9O A;  3GOI A;  3HPO A;  4DV2 K;  1VK0 A;  1KD1 O;  2Z1H A;  3MX5 A;  1UA1 A;  4B9S A;  1HPZ A;  3L3V A;  2HHS A;  4FM2 A;  2QXL A;  3SUO A;  4LH5 A;  5AQI A;  1KAY A;  4KFB A;  1NKC A;  2NRV A;  1TKX A;  3E66 A;  5KRS A;  4O5F A;  3PO5 A;  4B8C A;  4FZY A;  3H46 O;  4H5R A;  3MEC A;  1QVG M;  4RW9 A;  4B3S K;  4DTR A;  1KLN A;  3T1H K;  3UE5 A;  4ELU A;  4E0D A;  5C24 A;  3O1B A;  2HVI A;  1EWQ A;  4E3S A;  2LSN A;  4CEZ A;  4DKW A;  3VEW A;  3HM8 A;  4L8R B;  4LF5 K;  1C0M A;  2GUP A;  4KH5 A;  2A3Z A;  3CCL N;  2VWJ A;  4K42 A;  2E6L A;  3ATU A;  2V52 B;  4DQS A;  3L4Q A;  4FOE A;  3RR8 A;  2DFE A;  4CE9 A;  4JI5 K;  4CFA A;  2RF2 A;  4C1N I;  4CJW A;  5KI6 A;  3U4L A;  3CCM N;  2RN2 A;  3SQ0 A;  2UXB K;  3O9U A;  4FLU A;  3L2U A;  3K5L A;  4AIL C;  2D1K A;  5TKW A;  5M1O A;  1BOT O;  4JKE A;  4FLZ A;  4FPB A;  1EX4 A;  1SQK A;  3ZYY X;  3LDL A;  1HJO A;  1XQS C;  1NKB A;  3R1X A;  3VER A;  4B9Q A;  1HNW K;  3LM9 A;  4Z4C A;  4FW2 A;  3QEP A;  2E6M A;  2QWO A;  3Q7B A;  3F2K A;  2WTU A;  3CCS N;  1UAX A;  4JLH A;  4CD1 A;  1KVC A;  2Q0U A;  4NO7 A;  1L5U A;  5AQT A;  4DWI A;  4CHQ A;  2QKB A;  3THW B;  5LY3 A;  1E4F T;  3H08 A;  2NZT A;  2HND A;  4RW6 A;  4FJM A;  1NKE A;  3CJB A;  5KPR A;  1QTM A;  5AQN A;  2AA4 A;  4A62 A;  2ITM A;  4EHU A;  3UB5 A;  4GKK K;  1YVU A;  4A59 A;  3V9X A;  3CCR N;  4M42 A;  4HUG A;  1OVQ A;  3HOS A;  1J5O A;  3ZLJ A;  4BRE A;  4LD0 A;  4O0I A;  4JKC A;  2UU9 K;  4E7I A;  1MDU B;  3P5J A;  4R5P A;  4YNQ A;  1SKR A;  4GVM A;  3S3M A;  4DV0 K;  3SCX A;  4FJI A;  2FSJ A;  2GTD A;  3IFR A;  4DS4 A;  3MEG A;  1BO5 O;  2NLX A;  5AQO A;  3IMX A;  1RBT A;  1QQC A;  1VHX A;  3ZT2 A;  3C6U A;  3J81 O;  3HT3 A;  1ASV A;  4YOW A;  1NGI A;  2D0O A;  4BRC A;  2KKZ A;  4OPH A;  5AQK A;  3OJS A;  1QVF M;  2XY8 A;  3P1G A;  2OPQ A;  4K8X A;  4E19 A;  5F0X A;  3CG7 A;  2P9N B;  4BDY A;  3AVA A;  3RSE B;  4F9O A;  3WNE A;  5A2Q O;  3D2E A;  3M6G A;  3V1R A;  4HUF A;  2YNI A;  5K14 A;  3FZF A;  4Z4H A;  4I2Q A;  1RT3 A;  3FFI A;  4PWD A;  1KVB A;  4BRF A;  1NJZ A;  3U8X A;  5CZ1 A;  3SLC A;  3ZSZ A;  1OVY A;  3D0P A;  4B1W B;  3DLR A;  4BDP A;  3K9J A;  3MWP A;  1TKD A;  1P8Z A;  4DQ8 A;  5IWA K;  4CCH A;  5BN8 A;  2Q36 A;  3VQB A;  1QZ5 A;  4JRQ A;  3LPU A;  2XHB A;  1WSE A;  3AVI A;  4ILH A;  1TYQ B;  3LP0 A;  3KLF A;  4PKG A;  2KQ2 A;  1B9D A;  4V19 S;  3DAW A;  4AHT A;  2XO7 A;  4FM1 A;  5HRP A;  4FWN A;  4CZF A;  4ZHR A;  5HP1 A;  2B4J A;  5AQY A;  5D3G A;  4CVN E;  1N6Q A;  1I3A A;  1YXQ A;  4DTN A;  2QWM A;  1NK4 A;  1BL3 A;  4MO4 A;  3R6M A;  4IJA A;  3VQC A;  4KTW A;  3T19 A;  2VGN A;  3THY A;  4H5N A;  3J7A P;  4RWT A;  3PY8 A;  2W42 A;  4JV5 K;  4KV8 A;  1QQM A;  1BU6 O;  3NF8 A;  3BZK A;  3AO3 A;  3WT0 A;  3LDP A;  1JJ2 M;  3MN9 A;  4MLH A;  4JS5 A;  3ZSX A;  5C42 A;  3ENB A;  3H1V X;  4N56 A;  4PKH A;  4BR0 A;  3DOK A;  4C23 A;  2KTQ A;  2A40 A;  1NGJ A;  3O9R A;  4DTU A;  3CXC M;  4FWL A;  4RG8 A;  1ATR A;  1T05 A;  4A61 A;  3QIP A;  1NGB A;  3CFO A;  4FZX C;  3OYJ A;  5ELZ A;  3OS0 A;  3SUP A;  3DWL A;  5DM6 L;  4IDK A;  4W5Q A;  2Z1G A;  1N8R O;  3OYN A;  3MN6 A;  4CEB A;  1T3V A;  3JSM A;  4JKF A;  4BQZ A;  4CGH A;  5HRN A;  4HTU A;  4JKH A;  3VQ8 A;  4R79 A;  2O4G A;  4JKA A;  4BRO A;  1ATN A;  1K8A O;  4E1N A;  1MWK A;  5AZI B;  2Q2R A;  5BPN A;  1YIT N;  3UKU A;  3NF7 A;  1RNH A;  3VQP A;  2KHO A;  3TTD A;  4YDU C;  4CGG A;  2YNH A;  3ID8 A;  1Y64 A;  3WQU A;  2H3G X;  4DSF A;  3ZT4 A;  3RR7 A;  4KHW A;  1KCF A;  4DR2 K;  4FLX A;  3IAY A;  4Z4F A;  3BY5 A;  4ILJ A;  1RFQ A;  5AQF A;  4FLV A;  3TTC A;  3HK2 A;  3TAF A;  2GUI A;  2PYL A;  3SPY A;  4KB0 A;  4DV4 K;  2WFB A;  3EYZ A;  5LJW A;  3OBW A;  4NCA A;  3HVR A;  4JHD A;  4CBX A;  3L8B A;  3O1W A;  2X6N A;  4FWK A;  3AVH A;  3P83 D;  4JKB A;  2G8W A;  2QI2 A;  4LF9 K;  4WQ4 A;  1E4G T;  3CJ7 A;  1FJG K;  4B3T K;  2HNY A;  3GBT A;  2FSN A;  3KVG A;  4CJF A;  5LL6 Z;  4JI4 K;  4CJV A;  3TSQ A;  2WOM A;  2ITG A;  1JCE A;  3CJC A;  3DXM A;  4CHZ A;  1TKT A;  4FJ9 A;  4PL8 A;  2O8F B;  1TAQ A;  3THV A;  4B1Y B;  3MDQ A;  2YHW A;  4YOR A;  4BC2 A;  4JKG A;  1VSM A;  4NCG A;  2O8E B;  2KFZ A;  5AZJ B;  2P9P B;  3QER A;  4O0J A;  1ZBU A;  2EX3 A;  3W3D A;  1IH7 A;  4BWM A;  2QKK A;  2W41 A;  3BF1 A;  4N47 A;  3TAP A;  3PLA A;  1X9M A;  1S22 A;  3ZSW A;  3FGU A;  3OJU A;  2ASP A;  3EKS A;  4LSL A;  5IT9 O;  1EXQ A;  4B1V A;  1GLF O;  1KFD A;  2V7Z A;  3B6O A;  3ZSR A;  3CM5 A;  4E7J A;  2XY7 A;  4WE1 A;  2D0C A;  1NBW A;  4ILG B;  2G8I A;  3FZL A;  2YKM A;  1IO2 A;  1W7A A;  3HPG A;  4DF8 A;  3EY1 A;  1YAG A;  2O8D B;  2RHK A;  4DB3 A;  4H0P A;  2ZQB A;  5LJV A;  1LCU A;  1LW0 A;  4WCE L;  4H0T B;  3ZSY A;  1HYZ A;  3ENO A;  4KHQ A;  1IKY A;  4NYN A;  2DY4 A;  4KHN A;  4CD3 A;  4W5T A;  1JLG A;  4DV5 K;  1Z6R A;  4BC4 A;  1VQM N;  2NRZ A;  5E84 A;  1IBL K;  2WUS A;  5JMV A;  1S1V A;  1YHQ N;  1SKW A;  1W9H A;  3MCP A;  3G6E N;  1H1V A;  1FW6 A;  2X6S A;  5EXW A;  1WSJ A;  3ALY A;  4H0X B;  3NFA A;  4XH1 A;  4CJ7 A;  4DU4 A;  1EP4 A;  3TI0 A;  1QHT A;  4Q5V A;  4CFD A;  4FOI A;  1S5J A;  4BGA A;  3F9M A;  3P38 A;  3EZW A;  2FBY A;  4CBW A;  5HL7 L;  1SS6 A;  2EHG A;  1XNQ K;  4FJ5 A;  1SL1 A;  4IWV A;  4KI4 A;  3T69 A;  4O44 A;  4CHO A;  4F3O A;  1NGH A;  3SQ4 A;  1G15 A;  3G25 A;  4UQG A;  2JWL A;  1C0U A;  3MAQ A;  5F2R A;  4CJQ A;  4CHN A;  1LWE A;  3THW A;  2NUB A;  3CCQ N;  2G8H A;  3THX B;  4XEI A;  1IG9 A;  3A5N C;  4CEF A;  1S1T A;  1D5A A;  3V9W A;  4B9M A;  2CGL A;  3ZEU A;  4WQ5 A;  3VOV A;  2GWJ A;  3RRH A;  1YUW A;  5FPM A;  4ID1 A;  3WEE B;  2FC0 A;  4CES A;  4AHR A;  3LZJ A;  1FK9 A;  4EIA A;  1DTQ A;  4DSL A;  4KHY A;  3K9K A;  3NGY A;  3MXM A;  4YOX A;  2P9S A;  3VQ5 A;  4BRK A;  5SWM A;  1CZ9 A;  4IEE A;  4BGB A;  5FRO A;  1EWR A;  4B9T A;  1QHA A;  3I56 N;  3MK6 A;  2VCP A;  1HNZ K;  4M3Z A;  3VPZ A;  4DQR A;  1WSG A;  4HWI A;  3QBW A;  1XUP O;  1YTA A;  2GEM A;  2QW9 A;  2XY6 A;  1HQE A;  2F4V K;  4O8K A;  4CF2 A;  1Q18 A;  2OAN A;  2OPP A;  3U9D A;  3N4Q A;  3IDH A;  5HRS A;  4NLB A;  4CZK A;  3VGK A;  4I6M B;  4JD2 A;  3RSE A;  1C0G A;  1S72 N;  2HBM A;  4QCL A;  3OYB A;  1WB9 A;  1WBD A;  2GV9 A;  4FWP A;  3S3N A;  4FK0 A;  3E01 A;  4AF1 A;  5AQH A;  3P39 A;  1EET A;  3L2W A;  4F2S A;  2P9U B;  3H3O B;  4C1N K;  4DCH A;  1IBM K;  1ZBS A;  3CFP A;  4CJL A;  1ESV A;  4Z94 A;  4JNE A;  4YHH K;  4GV9 A;  1Z26 A;  4DV1 K;  2NRR A;  4BRP A;  5M1F A;  3HJF A;  5GIO A;  4ISF A;  3JAM O;  3KLI A;  2O4I A;  3C95 A;  1HNV A;  4JI3 K;  3UKR A;  1TYQ A;  4J2B A;  3L6Q A;  1L3T A;  5EU7 A;  4OLA A;  4CZJ A;  3VF4 A;  5GIN A;  4LFA K;  4WQ5 C;  2DFF A;  3WQT A;  4JI8 K;  3OHR A;  3EKU A;  2OYQ A;  4IOX A;  4DFM A;  3KKS A;  4HUE A;  5H1S Q;  4CHY A;  1XMO K;  3C7N B;  3OS2 A;  1ZBH A;  1BIZ A;  2Q3S A;  1TUY A;  4BAC A;  2NRX A;  4ID5 A;  3C94 A;  2ZGY A;  5KGX A;  2Q31 A;  1S1X A;  3VEZ A;  4IO8 A;  3KK1 A;  3CJ9 A;  4WF9 L;  1Y97 A;  4YOY A;  4BRQ A;  1NK8 A;  3AO5 A;  1QZ6 A;  4FJH A;  3AGR A;  4FZZ A;  2QWL A;  3AO4 A;  3K2P A;  1HQU A;  4B1Z A;  4CZL A;  2D5R A;  3OYD A;  4DTX A;  1KSP A;  1LWF A;  4H0O A;  2HMP A;  2QTD A;  1CZA N;  3AVC A;  1WN7 A;  3C6A A;  1BI4 A;  1CLQ A;  1HPM A;  3MN5 A;  3H45 C;  2KFN A;  4CJR A;  2FBV A;  1NOY A;  5KTQ A;  1BIS A;  3G4S N;  4OPK A;  4RTF D;  2ATQ A;  2NNW A;  1TK8 A;  1JLF A;  2HF4 A;  4OJR A;  3ZCM A;  1QSY A;  3SAG A;  5AZI A;  1HR0 K;  2G8F A;  4OPA A;  1ZBF A;  3PSF A;  4FVM A;  1NK5 A;  3GL1 A;  2HW3 A;  1S6P A;  4FWS A;  3KWG A;  1BDG A;  2F96 A;  5HOO A;  3WXL A;  1YIJ N;  4A2A A;  4EZ6 A;  3AO2 A;  1HMV A;  4F2R A;  2D4W A;  3OYC A;  2UXD K;  4KPY A;  4CJU A;  2HHH K;  3OYH A;  1KFS A;  3O08 A;  3LDO A;  2P9I A;  3IUC A;  3HZ6 A;  4OKE A;  3DYA A;  4OO1 J;  3PX6 A;  2UUA K;  2VGM A;  2PZS A;  1R0A A;  2B6A A;  3IRX A;  3AAR A;  4J2E A;  2IVO A;  1K8K B;  2F9T A;  1J53 A;  2E5L K;  1IKX A;  4B1X B;  2A41 A;  2IVN A;  3QEI A;  3LP2 A;  4JI7 K;  3CFR A;  1Q82 O;  4OPJ A;  4F4K A;  4G9Z A;  1KXP A;  4GV3 A;  2GX9 A;  4LC9 B;  4DQP A;  4C8O A;  3SK3 A;  3M3Z A;  1C0F A;  1SKS A;  1VRU A;  1GLL O;  2BE2 A;  4FVU A;  1HKB A;  3SBG A;  3P4I A;  3QFP A;  1M90 O;  3K0S A;  3ZT0 A;  1SL2 A;  3RMD A;  1KQS M;  3QLH A;  1WUA A;  1G99 A;  4HTL A;  4K8Z A;  3VES A;  1P90 A;  5AQZ A;  3WNG A;  2A6A A;  2IGI A;  3TAR A;  1RT5 A;  4E7K A;  1HX1 A;  1GOC A;  3ZX3 A;  5CYM A;  1JL2 A;  4KRE A;  3VMF B;  3KK3 A;  4IO9 L;  3K57 A;  4H03 B;  1X3N A;  1IG8 A;  1N34 K;  4KTQ A;  3CF5 L;  4FK4 A;  4GMJ B;  4BQL A;  3SQ2 A;  3J7Z O;  1VSD A;  3CIP A;  4FSV A;  2QXF A;  3O9T A;  4QS9 A;  4X64 K;  3MCA B;  4KAZ A;  4BVP A;  3DXK A;  3AAP A;  1RDA A;  4K43 A;  3ZSV A;  1U48 A;  1RDW X;  4E89 A;  4CK3 A;  4FM0 A;  1BIU A;  1DT9 A;  3KWI A;  3TSP A;  5CZ2 A;  3L2Q A;  4F8R A;  4FXD A;  3DM2 A;  4KHS A;  3KIO A;  3VN5 A;  1HLU A;  4CGI A;  2OZS A;  4IFV A;  1VRT A;  3TAB A;  2E2N A;  2PYJ A;  4H5W A;  3AVK A;  4YDU A;  3ZX0 A;  4M45 A;  4AQY K;  2V51 B;  1JLE A;  3QO9 A;  1X9J A;  1C6V A;  3WNF A;  4E7L A;  1QE1 A;  4XIU A;  3AAQ A;  4DR6 K;  3LM2 A;  5SZT A;  4CJ5 A;  2NRW A;  1VQP N;  4FW1 A;  3AV9 A;  1EKE A;  2HB5 A;  3KHY A;  3HP6 A;  2O8C B;  4OGE A;  3T3F A;  3RMA A;  3O5B A;  3HP9 A;  3ULE B;  1GLA G;  4B9U A;  1NG9 A;  3TU5 A;  4M3T A;  3CHW A;  3J80 O;  3OYA A;  3OYI A;  2V7Y A;  3OA9 A;  3KK2 A;  2YJE A;  4BE0 A;  4F3T A;  1Q9Y A;  2FF3 B;  5AQL A;  4C8M A;  4Z0U A;  3U3Y A;  2VG6 A;  2O8B B;  3HRG A;  3FZH A;  3VF6 A;  3G71 N;  4AHC A;  3S3O A;  5M1P A;  2PY5 A;  4IKF A;  3A5O C;  2X78 A;  4M41 A;  3ENH A;  2A5X A;  4BR2 A;  1KTQ A;  3LDN A;  1NK9 A;  3OVN A;  1TL1 A;  4CHP A;  4OX9 K;  4PL7 A;  1JLC A;  3TR8 A;  3AY9 A;  1C0T A;  3AVJ A;  4FWR A;  4JK7 A;  3O3H A;  4AHS A;  3RMB A;  3E9P A;  4ZTF A;  2OPS A;  2IVP A;  3CCV N;  5HLF A;  1N36 K;  3M8P A;  4JS4 A;  2YHB A;  4Z4G A;  4JI2 K;  4FJN A;  3I8B A;  2HHU A;  4OLB A;  1M1K O;  3QNN A;  5AJ3 K;  5JIC A;  2HMI A;  1RGI A;  4H5V A;  1TV6 A;  1XWL A;  3F9K A;  3OYE A;  2HHT A;  3TAG A;  1RDB A;  2BAN A;  5KGW A;  4DR4 K;  1FXX A;  1RT1 A;  3RWU A;  4JYA K;  4MLE A;  3QNO A;  1DTT A;  4CJS A;  1MU2 A;  4BR7 A;  4IXC A;  2F8T A;  1TKZ A;  4N41 A;  2HF3 A;  2P1J A;  4FWQ A;  5DMR A;  2E1Y A;  4I6M A;  3UIQ A;  1NLV A;  4OGC A;  3QEW A;  2HHQ A;  1J6Z A;  3NH0 A;  3VQ9 A;  3L4I A;  4CBU A;  1X3M A;  3OY9 A;  3G0Z A;  4FJJ A;  3CD6 N;  3OTO K;  5EVZ A;  2VQE K;  3NDK A;  1J5E K;  4A57 A;  1RTJ A;  3V81 A;  3AVL A;  3QB0 A;  2KW4 A;  3F5T A;  4HCB A;  3L2R A;  2ZJQ L;  3KD1 E;  5C0Y A;  4UY8 O;  3CC7 N;  3ZSQ A;  2JGU A;  4Z4I A;  4JRP A;  3S41 A;  4IFE A;  4CJE A;  2IOC A;  4Q0B A;  1X1P A;  3MWT A;  3NMU A;  5ADX H;  1WLJ A;  1SUQ A;  4WFB L;  2QA4 N;  5HRO A;  1O13 A;  2QWP A;  4CZG A;  1N5Y A;  2VWB A;  1ZC6 A;  3NE6 A;  5BN9 A;  3NH2 A;  2YHY A;  3KLG A;  3TAQ A;  3V4I A;  4Z4E A;  2P9L B;  1CZB A;  3PSI A;  1NGF A;  4CZM A;  4BVO A;  2ZM6 K;  1VSF A;  4YFU A;  4PA1 A;  1C1C A;  3H1Q A;  3K5M A;  3I33 A;  4FCY A;  3VTH A;  1NK6 A;  3K5O A;  3VTI A;  5ADX A;  3A2F A;  1U4B A;  4M7X A;  1GLB G;  4FLT A;  1D9F A;  3CM6 A;  2BDP A;  1RT2 A;  1GLE G;  1TL3 A;  1BCM A;  2W40 A;  4CIE A;  4I9Q A;  4O5B A;  1FKO A;  1OKJ A;  2YJF A;  1D8Y A;  4MDB A;  1Q7Y O;  3HST B;  1ZXO A;  1HJR A;  2Q0R A;  3NGZ A;  4ZTJ A;  3IS9 A;  4BE1 A;  5CHI A;  2KLA A;  2FBX A;  4DMN A;  1WAF A;  1NGA A;  1NU0 A;  5HBM A;  1E3M A;  3C6T A;  3D2E B;  3DLE A;  4ISE A;  1FKP A;  4NXM K;  4CZH A;  2E2O A;  4LF6 K;  3V1Q A;  1K6Y A;  4O4G A;  3BF3 A;  4O8U A;  2WON A;  3TTF A;  1IKW A;  3T1A A;  5KRT A;  1SZ2 A;  3CCJ N;  3SV4 A;  1W2B M;  5KQD A;  1XC3 A;  1DGK N;  5CR4 A;  3LDS A;  4CF1 A;  4FJK A;  2QEX N;  2VWK A;  4DV6 K;  4K0K K;  5BR9 A;  4DR5 K;  2A1R A;  2BTF A;  1K8K A;  1SAZ A;  5BPM A;  4NCB A;  1YJW N;  4QOZ B;  3KLE A;  4CF8 A;  2HHW A;  3CQY A;  4BRM A;  2I7P A;  1VQL N;  3LAL A;  5C25 A;  1JLA A;  2GBZ A;  4MO5 A;  5LMU K;  1U2V B;  2E8A A;  5AQV A;  4EFH A;  1T8E A;  3VQ6 A;  3CME N;  4FWO A;  3ASM A;  1JCF A;  1XMQ K;  1UA0 A;  1RDC A;  3ZET B;  1LV5 A;  1I39 A;  3P31 A;  2D0P A;  3KK7 A;  2PAV A;  4NLC A;  1NGG A;  2FXU A;  5TKY A;  1HKC A;  1VSK A;  3RTV A;  3BP8 A;  3JYT A;  4GKJ K;  3V9S A;  1T6C A;  1GLC G;  2QWR A;  4X66 K;  4IG3 A;  1V4S A;  4QS7 A;  4IDH A;  2RPI A;  3GE1 A;  4M63 C;  3O4Q A;  4JN4 A;  1QSS A;  3ID6 A;  5BRD A;  3NGI A;  1X9S A;  2YHA A;  1S9G A;  4CEE A;  4HHT A;  2HOE A;  4DTJ A;  4CEQ A;  1VQK N;  1VQ6 N;  5JVH L;  3VQA A;  1TK0 A;  3LAN A;  5C2F A;  2P5G A;  4IOC L;  3MXJ A;  4JK8 A;  1GLD G;  5AR0 A;  3LZI A;  4H5T A;  4CGF A;  3DRS A;  2G8V A;  4B08 A;  4AH9 A;  4DR1 K;  3WXM B;  3EN9 A;  2P9N A;  1T44 A;  2W6L A;  2UYT A;  4LFB K;  3EEQ A;  3QEV A;  4KH6 A;  4KHU A;  4AHV A;  2EWS A;  4BRN A;  1RT4 A;  3D7E O;  2D0A A;  4BE2 A;  3BDP A;  1Z25 A;  2W6K A;  3AVN A;  4RW8 A;  3CQX A;  2QWQ A;  2BH1 A;  1J54 A;  4CIG A;  3LL3 A;  3W0L A;  4M3X A;  5AQQ A;  3C6H A;  4H4M A;  4LF4 K;  1C1A A;  3AVB A;  3CYM A;  2OA8 A;  3FFK B;  3DLK A;  4DUZ K;  2G8U A;  4PUO A;  3M8S A;  1RBU A;  4IFY A;  2JWK A;  5C12 A;  3DLL L;  1VQ4 N;  2HBJ A;  3VQE A;  1BA0 A;  1HYS A;  4JHD B;  3R3L A;  1HNX K;  3TAM A;  4I9L A;  3SBT A;  2YKN A;  3LAK A;  4B9V A;  1L3S A;  3EE9 A;  3TAN A;  4M3W A;  3EZ5 A;  1S3X A;  5BR8 K;  1WSF A;  3M1F A;  3HXM A;  4DF4 A;  4KI6 A;  3CC4 N;  4KHP K;  4CI6 A;  1HUX A;  1XHZ A;  4M3U A;  5JS1 A;  2ZF5 O;  3HVT A;  4B9L A;  1UWB A;  3LWL A;  4CIF A;  5M1Q A;  5AQR A;  1U6Z A;  4X65 K;  4JKG B;  2ASM A;  5EOY A;  4CER A;  3NCI A;  3NVK A;  5CY4 A;  4FLY A;  3J8A A;  3D2F B;  2O8B A;  4JK9 A;  1NMN A;  1V4T A;  1VAZ A;  3DJC A;  1HKG A;  2A42 A;  3R8E A;  1EO1 A;  4CF9 A;  1QQN A;  3OYK A;  2E1Z A;  3CI5 A;  3SQ1 A;  4FYD A;  3TSU A;  3SJJ A;  3RVC A;  4E1M A;  4Y1C A;  1U45 A;  1O1W A;  3QEX A;  2HVH A;  3FLC O;  4LH4 A;  4DU1 A;  3PO4 A;  3L3U A;  3SUN A;  3U9Z A;  4HVJ A;  3K59 A;  2YCH A;  4CEA A;  4IEI A;  5I42 A;  4N76 A;  2F9W A;  4JI1 K;  1VQ9 N;  1DEJ A;  2HBK A;  3NVM A;  4JI6 K;  3OYL A;  2FLO A;  1NJY A;  4PHT X;  2A1S A;  3DI6 A;  1Q8I A;  1S6Q A;  3VEX A; 
#chains in the Genus database with same CATH homology
 4AQY K;  3JAM O;  4LFB K;  4NXM K;  1N33 K;  2UUA K;  4LF6 K;  4JI3 K;  4GKK K;  4DR6 K;  3OTO K;  2UUC K;  1I94 K;  3J7A P;  2VQE K;  2E5L K;  4JV5 K;  1J5E K;  4DR7 K;  4LFA K;  2UUB K;  1IBK K;  3J7Y P;  4JI8 K;  4DV2 K;  4JI7 K;  2UU9 K;  4LF4 K;  4DV0 K;  4DV6 K;  1XMO K;  4K0K K;  2VQF K;  3J80 O;  4DUZ K;  4YY3 K;  4LF7 K;  5FLX O;  4DR5 K;  4JI0 K;  3J81 O;  4B3M K;  5IT9 O;  4DV3 K;  4B3S K;  1HNX K;  4DV7 K;  3T1H K;  1XNR K;  5BR8 K;  5LMU K;  4LF5 K;  4KHP K;  2UXC K;  5A2Q O;  1XMQ K;  4OX9 K;  5LMN K;  2ZM6 K;  4JI5 K;  4X65 K;  1N34 K;  3T1Y K;  1HNZ K;  2UXB K;  4X64 K;  4GKJ K;  1N36 K;  4X66 K;  4DR2 K;  2F4V K;  1N32 K;  4JI2 K;  4DV5 K;  5IWA K;  5AJ3 K;  1HR0 K;  1IBL K;  1HNW K;  4B3R K;  4DV4 K;  4DR4 K;  4V19 S;  4JYA K;  2UXD K;  1IBM K;  4JI1 K;  4LF9 K;  2HHH K;  4CVN E;  4DR1 K;  4JI6 K;  1FJG K;  4YHH K;  4B3T K;  4CW7 B;  4DUY K;  1XNQ K;  4DR3 K;  4LF8 K;  4NXN K;  4DV1 K;  4LFC K;  5LL6 Z;  4X62 K;  4JI4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...