1XMOK

Crystal structure of mnm5u34t6a37-trnalysuuu complexed with aag-mrna in the decoding center
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The role of modifications in codon discrimination by tRNA(Lys)(UUU).
pubmed doi rcsb
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1xmoK00
2F4VK 4JI1K 4DR4K 4JI2K 4JI5K 4NXMK 4LF7K 4DV2K 1IBMK 4DR1K 4LF4K 2VQFK 4B3SK 3T1YK 4B3TK 5LL6Z 4B3RK 1IBLK 4B3MK 5LMNK 1HNWK 1HNZK 4DV3K 4AQYK 5LMUK 4OX9K 4X65K 5IT9O 2ZM6K 4LF8K 4DV0K 4X66K 3OTOK 5IWAK 2UUCK 4KHPK 3J7YP 4JV5K 4K0KK 4JYAK 2UXCK 1IBKK 4GKJK 2UXDK 4DR7K 4LFCK 1N32K 2UXBK 4DV6K 3J80O 4NXNK 1XMOK 4JI7K 4GKKK 2E5LK 4LFBK 4DR2K 3JAMO 4YY3K 4CW7B 1N36K 1FJGK 5A2QO 4LF9K 1I94K 4YHHK 4DV1K 1XMQK 1HR0K 4LF6K 2HHHK 5FLXO 4DV7K 3J7AP 4JI8K 4DUYK 1XNRK 1N34K 4V19S 4DR5K 4LF5K 3J81O 4JI6K 4DUZK 4DR3K 4X62K 1HNXK 4LFAK 2VQEK 2UUAK 4JI0K 1XNQK 4DV4K 4DR6K 2UU9K 4JI3K 3T1HK 4X64K 1J5EK 1N33K 5AJ3K 2UUBK 4JI4K 4CVNE 5BR8K 4DV5K
chains in the Genus database with same CATH superfamily
4ICLA 4DTSA 4CJ3A 1V4TA 1G15A 1O13A 2A41A 3NVKA 2P9LB 4DHYA 3CM6A 2QXLA 5FDLA 1IBMK 2HBJA 3C0BA 2ZQBA 3JXUA 3BF1A 4E0DA 4BVOA 1CXUA 3VQEA 4ELTA 2O8FB 1TKDA 3CMEN 3HK2A 1HKGA 3LAMA 4EFHA 2Q31A 3LDNA 2QWPA 4A5AA 5AQXA 3RMBA 1HYVA 2ZWHA 3S41A 4ILGB 1ZBSA 1YF5L 3ZCMA 1LAWA 4FJ9A 4DQQA 2F8SA 3THYA 3DXMA 4CJVA 3OHRA 1VQ8N 2F8TA 1IBKK 3ZSQA 1C0GA 2X6NA 3BY5A 3VETA 4BG8A 1B9DA 1U47A 3MEGA 3O4NA 1JLQA 3W0LA 4DV6K 2UYTA 1NK9A 1IV0A 3L2VA 3MXIA 3D0PA 4FJ8A 5DM7L 1CLQA 4EZ6A 3MWPA 3K5MA 4FYDA 3VGLA 1S3XA 4Z4EA 4NYFA 3GE1A 3R9PA 3JS6A 3DYAA 4H03B 4CF9A 3F73A 3RMDA 4K43A 3KKSA 1NJZA 4DV7K 1Q18A 2GWJA 4OPJA 3AVIA 4WE1A 3G10A 4LF5K 4CZHA 3J81O 1JJ2M 3BP8A 3GDQA 4H0TB 5C2FA 3V4IA 1ZC6A 3K9KA 4JKAA 4JKDA 4GW6A 3E01A 4J2DA 4IFYA 1UA1A 1E3MA 4CGGA 3ZX2A 4JI3K 3WEEB 2FF6A 3V1QA 1RT5A 4PY5A 2HHUA 3D2EA 3G4SN 1ASVA 4NCAA 1W0HA 4BRNA 3OYAA 4JKGA 3PY8A 4DFJA 4Z4HA 2IDOA 1BGXT 2VWKA 5LMNK 1KFDA 1HNWK 4LH5A 3L8BA 1RDAA 4O0IA 4E7KA 3OYIA 4CJTA 5IWAK 5M1KA 2KQ2A 4ILJA 1Z25A 4CGJA 1X9JA 1X9MA 3P5JA 1R59O 3PIOL 3CM5A 1VQON 4CGHA 4M3YA 2P9UB 1GLEG 3OS2A 4CJQA 4CERA 1SL0A 4CE9A 3VEOA 3SYZA 2YKNA 4W5NA 3MAQA 2FF3B 3SUOA 3O5BA 3BF3A 4BRMA 3LWMA 2G8WA 1Q8IA 2YNIA 3O4QA 1KXPA 3CERA 3O1WA 3TAQA 3ZSZA 5JICA 4YOTA 2HNYA 5FPNA 3KLHA 4NYNA 4OO1J 1KCFA 3VQ9A 3G6EN 4DQPA 1ZBUA 3MN5A 1ZXOA 3I33A 1N34K 2RF2A 1SAZA 4DFKA 3AAPA 3ULDA 3HM8A 5AQLA 1VQPN 2ZD1A 2D0PA 4CESA 4DS4A 2WOMA 3PUFA 1ZBFA 5LY3A 1VQMN 5AQNA 1ATNA 5ADXH 3LANA 3SJHA 3EY1A 3LL3A 1BCOA 5BR8K 4AILC 4DV5K 1X9SA 3L6QA 3TANA 3NF8A 3OJUA 1SS6A 3QIOA 1KFSA 5DMRA 4DSLA 1T05A 2RKIA 1NK0A 5AQKA 4DR1K 4CHZA 2CH6A 3R8EA 3IG1A 4JK7A 2O4IA 2NRRA 3LP2A 3ITHA 3D7EO 3CF5L 3CC7N 4JK9A 2QKBA 3NFAA 4PKIA 3OYHA 1NKBA 4DQ8A 3LM2A 5M1NA 4X66K 4J8FA 4R79A 4CZMA 3E66A 3DLEA 4WQ5C 3AA4A 4ILHA 3BUZB 3M8QA 2JWLA 4MO5A 2YHWA 4RWTA 3EZ5A 3OYBA 3QNNA 3C65A 1GLFO 5BPNA 1RT7A 3OYGA 3WXLA 4LFCK 4DR7K 4LD0A 3ENBA 5TKYA 3E1YA 2ASMA 5FPEA 3SPYA 3LDPA 5HP1A 3OYNA 4CJSA 1T03A 3VQBA 3MX5A 1HKCA 2H3GX 1LW2A 4BDZA 2FBXA 1SZ2A 3QDKA 3T19A 3K58A 3LP1A 2HBKA 3KK1A 4FLWA 1XMQK 5AQWA 4Q5VA 2G8KA 1JCEA 4ISFA 3KLIA 4YDUA 3J7AP 3RVCA 1YIJN 3AO1A 3DRRA 4DR5K 2IIRA 5DK5A 2P9PA 2PAVA 4BRDA 3V9ZA 1RDDA 4I9QA 5DM6L 4CBUA 2O8EB 3EL2A 3WXIA 1TGOA 3SQ4A 2R7YA 3ATUA 1N6QA 1O1WA 4JI0K 3VQCA 4PL7A 1D9DA 3RR7A 2DY4A 4BGBA 5CE3A 1DTQA 3H1QA 3VQ6A 5KTQA 3M8RA 1TV6A 3V9SA 4KTQA 4FW2A 2QWQA 3FR0A 5LJWA 1NLVA 3WNHA 3CHWA 4GVMA 1GLLO 4JI2K 1SL1A 4AHTA 1NWKA 4RW4A 3VQ5A 4BROA 2O8BA 3C7NA 4Y1CA 2FC0A 4FJMA 3T1YK 1HNIA 4BRFA 3MWTA 4NLBA 4B3MK 2GUIA 3GG4A 4K42A 1HNZK 3O9QA 4LSLA 2WTUA 4DTJA 1VSJA 3SI6A 3AA3A 3QEXA 4C23A 3ZX3A 3O6WA 4CEZA 3J7YP 4B9NA 4EP5A 2KW4A 3TTFA 4JYAK 4GKJK 3DM2A 1IKVA 5AQUA 1K8KA 2HNZA 2QK9A 2UXDK 1YITN 2O8CB 2VGMA 2QTDA 1N32K 3KTQA 1RDCA 1D4XA 1KAXA 4DF8A 2QKKA 1TYQA 4JS5A 1SQKA 4XEIA 4DTRA 3KJVA 1FXXA 3IMXA 3KLEA 4FJGA 3V9XA 4FXDA 1UWBA 3VQ8A 5C15A 4WYBA 4DR2K 3HO1A 2QI2A 4JN4A 4JEPA 5BRHA 5CYMA 4QAGA 4RW9A 3VEYA 2Q3SA 4RG8A 1U04A 5EVZA 4FWOA 3V1OA 3LWLA 1E4GT 3NH2A 3MXJA 4KH5A 3KKRA 4BR4A 2HF4A 3CD6N 5FPDA 4B1VA 4FWKA 3O3GA 4ID5A 4CJWA 4DUZK 4Z94A 3B6PA 5JS2A 3TSQA 4BGAA 4EHTA 4FW1A 3HSTB 1TK8A 2P9IB 4E89A 4CEEA 3AVBA 4CJUA 2EX3A 4DV4K 1RDBA 3DOKA 2BGGA 1GLDG 5HROA 4PA1A 5KQDA 3CCUN 4CECA 3ENOA 4ELUA 4FSVA 4JHDB 1C1AA 2YNHA 4CJLA 3VF4A 2P9KA 1YTUA 4CK1A 3CG7A 4CZKA 3KD5E 1L3TA 4UQGA 3AGRA 3EE8A 5CZ1A 1Q9YA 2W6KA 1EQYA 3MN6A 4CJ7A 1YHQN 4O55A 1S22A 4DU1A 2VYPA 4F2SA 5LL6Z 1BCMA 1X1PA 4O44A 3QEVA 3IKMA 3OVNA 1YVUA 4DV3K 4MLEA 4RW8A 3C6AA 1NOYA 3AO4A 4JAXA 4HUEA 3PX6A 3V9UA 4CJFA 3AAQA 3CCMN 1VK0A 1J6ZA 1VSLA 1RTJA 2QWLA 1QZ5A 4KHSA 3CC2N 2IVOA 2YHXA 3THXA 1BU6O 4OVLA 3ZETA 1KVBA 4H5RA 3MN7A 1XMOK 4M45A 1NK6A 3M1FA 3NDKA 4FLUA 2F7TA 2D0CA 2YNFA 3DXKA 4BC4A 4DF4A 1RBVA 4YOXA 1TK5A 2HOEA 3G25A 4F2RA 2O8DA 1TAQA 2AJQA 4BR0A 1U6ZA 4Y0WA 4UY8O 1U45A 1A5VA 4B9LA 1WUAA 3DRSA 2Q0UA 2HF3A 4IG0A 1MA9B 1GLJO 1HLUA 2P9SA 2W42A 2HSTA 4FLTA 3CPWM 4O5FA 3H6EA 4FWNA 5C2DA 1S1VA 3AVCA 4I6MA 2NRTA 4JK8A 4IDHA 2E20A 3JSMA 4M7YA 4BR9A 1N8RO 1HNXK 1ZYQA 4FPAA 2I5JA 5BN8A 3AVHA 1NGDA 1VSHA 4DLGA 1C6VA 1XI1A 2WFBA 3N4QA 3BDPA 5MLCQ 3OYMA 3LZJA 4B9UA 3HBTA 2IC3A 2GELA 2NNWA 3PSFA 2O4GA 2ZJQL 4ZTJA 1BIZA 4DCHA 4BR2A 3SUPA 2E1YA 2ZGYA 1L3VA 2V51B 4B3SK 4BQLA 1R0AA 1L3UA 2E6MA 4NLCA 3CQ8A 4H5WA 3SUQA 5KI6A 1UA0A 3ZSOA 5JLHA 3THYB 1NJXA 3DXMB 3QINA 5TKWA 3WXKA 3LP3A 1N5YA 4KHWA 1S1TA 1Q86O 4IEIA 2W41A 1NGBA 1VSIA 3SQ0A 1QQMA 5BPLA 4IOXA 3RWUA 1HYSA 3HM9A 4EIAA 2GEMA 4CFAA 1JXBA 2OCEA 5GADP 2EHGA 5JS1A 2D5RA 1TKZA 2NRZA 3NF6A 4OPAA 3L4QA 5FROA 3ZT3A 3MX2A 1VQNN 4E7LA 4IDKA 4BRLA 4DTOA 2G8FA 2BUPA 2XY5A 3OBYA 4HHTA 3OBWA 2GUPA 4PWDA 1VSMA 3HT3A 4PUOA 3JAMO 1XC3A 5F0XA 4YY3K 4A5BA 4CEBA 4BDYA 3ZSWA 1OH6A 3ZX0A 4FLZA 1KVCA 5J2NA 3SMPA 4IXCA 3K2PA 4BC3A 2FSNA 3QNOA 2OA8A 3NE6A 5AQHA 3CFPA 3LAKA 3PLAA 4G9ZA 1RTDA 3O4WA 5BN9A 1OVYA 1EWRA 3ZT1A 2A40A 3LP0A 1ATSA 4C1NI 1UOCA 5C42A 1S1WA 1IKWA 1NMDA 3TAMA 3D2EB 4ELVA 4IBNA 5GAGP 3O08A 4Z4IA 2PY5A 1Z05A 4CHYA 2E2NA 2BE2A 4JKGB 1C0UA 3M8SA 3QMLA 4BDPA 1IKXA 4DSIA 4WCEL 4B9QA 1IG9A 3C6HA 2ETJA 4DFMA 4I2PA 1T6DA 2NRWA 1M90O 3VEVA 3EKUA 5AQGA 3BZCA 4BWJA 4BWMA 1IBLK 3OYLA 3TU5A 4OGCA 5AQVA 2YJEA 4BRPA 3OYJA 4CFCA 1VQ6N 1LCUA 4AQYK 1GOAA 4M7XA 3DLGA 3QBXA 2ATQA 1QHTA 3C95A 1HKBA 3HYFA 3FZKA 1WSFA 2A5XA 4C8KA 1RDWX 2EWSA 3CJCA 3QFPA 4W5TA 4J2BA 4E7IA 4IG3A 4O8UA 3GOIA 2KFZA 3VA0A 4N76A 4BRAA 3TTCA 4CGIA 3AVNA 5EU7A 4H8KA 4CZLA 3B6OA 4CGFA 1JL2A 4FK2A 4OKEA 1NOZA 4CBWA 1JLEA 3O80A 1DT9A 1CXQA 1SKWA 4CF8A 1JLGA 5AQIA 4GV3A 2KKZA 4OLBA 1FKPA 5C0YA 1P90A 3SNNA 4BC2A 4DMNA 4PKHA 4BRQA 5HRPA 4IFEA 1W7AA 2YV0X 1B9FA 3SAFA 4B9VA 4H4OA 3VGMA 1TL3A 4IWVA 1U49A 3RRGA 3VQ4A 1YT3A 3WNEA 1NGIA 1K8AO 2CGKA 3PO5A 2YI1A 2ZE2A 4BREA 4A59A 2D1KA 3OS0A 3FZMA 3SLCA 1BWFO 4RW6A 4DKWA 2A1RA 5I9EB 2YHBA 2HNDA 2VWBA 2G8IA 4JI4K 3LDOA 1WSGA 4CD3A 3KK3A 4M3WA 2OANA 3ULEA 1BHLA 1U2VA 1WBDA 4FJLA 4CZFA 4B9TA 4CZGA 2XY7A 4HTUA 1B92A 3A2FA 5B8HA 3O8MA 3TPQA 2I7PA 3I56N 3OA9A 2HHTA 1S5JA 3EE9A 3GBTA 4B3RK 2OTLN 1E4FT 3AGKA 4Z4GA 1BL3A 3SCXA 4LF8K 4JKFA 1DLOA 3QETA 3OTOK 4WQ5A 4JRQA 3HVRA 4HCBA 4C1NK 3CCQN 1NK7A 5FPMA 3OYEA 1QQOA 3BZKA 3QEPA 2F96A 1FK9A 1VAZA 4M3ZA 2Q36A 5CR4A 2E6LA 1C0MA 1Q81O 3CFRA 4FJXA 4YNQA 3CJ1A 3K5OA 4DU4A 1BI4A 1RFQA 2Z1JA 3HTVA 1ITGA 1HPZA 3DWLA 1XWLA 4OPKA 3C6TA 2KTQA 1EWQA 1KAZA 4Z0UA 3SAGA 2CGLA 3DMJA 1N36K 4DSEA 2RHKA 3TTDA 2P9PB 1ILYA 2E4LA 3DJCA 2ZGZA 1MU2A 3NF9A 4YORA 3KVGA 2HHHK 2ASOA 1S9GA 3MMVA 4FWMA 3T7ZA 4JI6K 3UKRA 4B1YB 2QA4N 2HW3A 3I55N 1QHAA 3UE5A 1HJOA 1RBTA 4FOIA 1F21A 2VQEK 3AO3A 4CHOA 2IOCA 3RR8A 2Q2RA 3EEQA 1XNQK 4ZHRA 2RN2A 3QBWA 3L4IA 4CEOA 4XIUA 4IZ9A 3H08A 3ZLJA 2F9WA 1N33K 4C8MA 3MCAB 1I3AA 2KHOA 3IS9A 4IO8A 3OYDA 4IO9L 1RILA 1M1KO 3FZLA 3VESA 3VPZA 1X9WA 2O8BB 3C7NB 5HRRA 1VQ7N 3U4LA 3HRGA 2G8HA 2OPQA 1KRPA 4H5TA 5AQRA 4BY9C 1OVQA 4CJEA 5BRDA 1S6PA 1IH7A 4DR4K 4CJPA 2NRVA 1NGJA 1FKOA 4QS9A 5D3GA 1T8EA 4E1MA 4RCHA 3D2FA 5CHIA 3M3ZA 4WQ4C 1YJNN 4CK2A 3P1GA 1KLNA 3K9JA 1JLBA 4O8KA 4L3QA 4DWIA 2DFEA 4U7BA 1EP4A 3LZIA 1LW0A 1K8KB 1J5OA 3SV4A 1ZBIA 1LWCA 4DTUA 2YCHA 4NO7A 4GVEA 2ASPA 5AZJA 3P4IA 4B1UB 3CPEA 3I8DA 4DSKA 1KC8O 3AVGA 1RT6A 1TYQB 3NF7A 3E9LA 1QZ6A 3MEDA 1GLAG 3TAGA 1NGAA 2RE2A 1VHXA 4O0JA 5EY4A 1KVAA 4JKBA 3CXCM 1TK0A 3SQ1A 4XH5A 4DLEA 4KV8A 2Z1GA 5GIOA 3T1AA 3U9ZA 4K8XA 4DTXA 3D6RA 1A5XA 4B1XB 1JCGA 4LF9K 4BE1A 2WC9A 2DTUA 3ZT4A 3H3OB 3LDQA 3HZ6A 3WNFA 5JMVA 5GAEP 4BQZA 3FE1A 1NG9A 3NH1A 4J2EA 1QQNA 4MFBA 2FXUA 1RT4A 4FM0A 2HHXA 5BR9A 1VSDA 3F5TA 4B9MA 3IDHA 3O3HA 2OTJN 1RBUA 1I39A 1NKEA 4B8CA 1TKTA 2CGJA 1JCFA 4B3OA 4QS8A 3VTHA 4BE0A 1C0TA 3OYCA 3VF6A 4AF1A 3DLRA 2P9KB 2UU9K 3O9UA 3QB0A 2HMPA 2E2QA 1BG3A 3AA2A 4LH4A 3VEZA 4OKKA 4FZZA 3Q7BA 3UKUB 3T3FA 4KHQA 3M5RA 5J1EA 1DGKN 4CIGA 5M1QA 3HOTA 1JLCA 2YNGA 5K14A 2VQFK 3VQAA 5F2RA 1KD1O 2QWMA 4E19A 3WT0A 2OPPA 3ATVA 3TR8A 4A2AA 1QQCA 2HBMA 1HQUA 3DLBA 3PIPL 2P51A 4DV0K 5GIPA 3OW2M 3C94A 4CEDA 3SZ2A 3HJFA 2V52B 4MLHA 3WXMB 3THXB 1WAJA 3VERA 4CIEA 4C8LA 2IS3A 4BG9A 1HJRA 3ZETB 5EXWA 3KHYA 5SWMA 1TL1A 4BRCA 4B1ZA 2FBYA 4AM7A 4FJJA 3SUNA 3DXKB 2UXBK 3AO5A 3ZSRA 3A5MC 3CQYA 3OJSA 3G0ZA 5J2QA 2O8DB 1IJJA 4BRHA 4JI7K 2NZTA 1S6QA 3RMCA 3RRHA 3ZSVA 5E41A 2KFNA 1HUXA 2P9SB 4FM2A 3J8AA 4W5QA 1JL1A 3GL1A 4I7FA 1HR0K 3RMAA 3P83D 4I6MB 4A62A 4H4MA 5SZTA 3O9TA 4A2BA 4JI8K 3KWGA 3TI0A 5AFUA 1YI2N 2B4JA 1K9MO 1JLAA 1FW6A 1S1XA 5HRSA 1ATRA 1XHXA 3P31A 3CQXA 4CZEA 1U48A 5CY4A 5HRNA 4X62K 4JD2A 1WOQA 3LPUA 3SPZA 3ENHA 4CHQA 2YJFA 4AM6A 3S9HA 2IVNA 4DR6K 4XH1A 2JGUA 4CJKA 3EZWA 1NJWA 1KAYA 4JKEA 3NGYA 4Z4FA 4CBXA 4JRPA 4H0XB 4FJNA 4CEAA 1WSEA 5BREA 5LJVA 3O3FA 5AR0A 1EXQA 4RTFD 1D5AA 2DPNA 3KIOA 4MDAA 3HSCA 2PBDA 1VQKN 3RSEB 4LF7K 1Q82O 4PL8A 2NRXA 1BQMA 2AA4A 3N4PA 3VA3A 2QEXN 3DLLL 4FJKA 2LSNA 4ID1A 3V1RA 3QIPA 1RNHA 1K6YA 5AQFA 4KPYA 3LALA 2HHWA 3VGKA 1KSPA 4N41A 3MDQA 5M1PA 3AO2A 1GOBA 1S72N 4YOWA 1RT1A 1XUPO 4H0YB 5AQQA 4CFBA 1LV5A 3HPOA 2E8AA 4F3OA 2HVHA 3TSUA 3CC4N 4CCHA 2UXCK 1REVA 3I0SA 4CFDA 3AVFA 1EKEA 3VQDA 3THWA 4FWQA 4BE2A 4DG1A 1DTTA 5AQMA 3L2WA 1OKJA 2DFFA 2VG7A 4FO0A 4JKHA 4LC9B 2B6AA 2Y1JA 1SUQA 5AQJA 3TWHA 3A5LC 5AQOA 3K57A 1TKXA 2G8UA 2HMIA 5T7BA 5CZ2A 5GINA 5KGWA 1IKYA 5AZIA 3U3GA 3ZT0A 3ZEUA 4MDBA 3VN5A 4DR3K 2P5OA 4XH4A 4L8RB 3I0RA 3AA5X 2W40A 2FSKA 2P9NA 1BO5O 3SV3A 3L0QA 1J54A 3S3NA 4M3RA 1HX1A 1XC9A 3EKSA 1LAVA 2V7YA 2DFHA 3F9KA 3OS1A 1D9FA 1RTIA 3UB5A 2UUBK 1S9EA 1NMNA 1RCHA 2NLXA 1NK4A 3VF2A 1WNSA 2D0AA 2QW9A 4JKCA 3H1VX 3OY9A 4JI5K 5GAHP 4KTWA 5J2MA 3EYZA 4IKFA 1J9AA 4CHPA 2YKMA 2OZMA 3P38A 2XRIA 1OH8A 3SMSA 3TARA 1HQEA 2P9LA 2J4RA 3OYKA 3L3VA 1WSJA 3CCLN 1Z26A 1QSSA 4X65K 1WLJA 2ZM6K 2PFUA 4KREA 4MO4A 2O8FA 3L3UA 3CJBA 1RT3A 3PO4A 4DSJA 5M1OA 3HOSA 2UUCK 3ZYYX 3U9DA 4JV5K 1QVFM 3H3NO 1NGEA 2Z1HA 3CCSN 3LDSA 2AP1A 3Q7CA 1LWEA 4CHNA 3IFRA 1YJWN 1BA0A 3LPTA 2GX9A 4JS4A 4AHUA 4U67L 2X6SA 4FWRA 2XO7A 2E5LK 1OH7A 2W6LA 1RBSA 3VQPA 4K25A 3J7ZO 1EETA 2Q97A 2B5JA 3QERA 1QTMA 3MCPA 2D0OA 1FJGK 3AARA 5FRNA 1TUUA 1I94K 4YHHK 4OJRA 3SAHA 3RTVA 1HYZA 1VQ4N 4O5BA 5F1XA 1T3VA 1MWMA 1NGGA 1L5UA 1ASWA 1C0FA 1QSLA 4DUYK 2HHQA 1KTQA 2GBZA 4FM1A 4DTPA 4JLHA 4FZXC 3DLHA 3CCJN 3PSIA 4FJHA 3W3DA 1QE1A 3D45A 2XY8A 1BOTO 5E84A 5FRMA 4BRIA 4M63C 3O1BA 4QCLA 3FFIA 4HTLA 5I42A 2BANA 1GLCG 3U8XA 4BVPA 2ZJPL 5KPTA 3ULEB 3A5NC 1U2VB 2FSJA 3TABA 5ADXA 3T69A 5AQSA 1VQ5N 4MQ3A 3AY9A 3ALYA 5H1SQ 3H46O 4PQUA 3CJAA 2E2OA 3WEEA 4N56A 3MXMA 3VQQA 2VG6A 3MECA 1RDUA 3ZT2A 1NJIO 4B3TK 4NCGA 3NH0A 4KBOA 4KAZA 1C1BA 1IG8A 2NRHA 5EX5A 4BR5A 1WSIA 1HNVA 3DLKA 1X3MA 3IUCA 2ITMA 3S3MA 4AHVA 2IAJA 1HMVA 1BI4B 4YOYA 3CYMA 4OLAA 4OKJA 2VCPA 4DFPA 4FWPA 3QEIA 1NK5A 3CCEN 1SV5A 2YX6A 2P9UA 3K5LA 3QICA 4C8OA 1W97L 4CJ5A 4NXNK 4A57A 3QFUA 3VEXA 4A61A 4WFBL 2GTDA 3DOLA 3MEEA 4KB0A 4CW7B 1H1VA 3VMFB 2I7NA 4DS5A 5JVGL 4DQIA 4CEFA 3R1XA 1VRUA 2HB5A 1T7PA 4E7HA 3KD1E 1LWFA 3UKRB 4K8ZA 4CJ4A 4IFVA 4E3SA 1JKHA 4B8AB 5JVHL 4FJ5A 3WQUA 2RPIA 4M3TA 1YAGA 3NGIA 3NCIA 2YHAA 3C6UA 5HOOA 2A1SA 4KH4A 4H0PA 1XHZA 4KI4A 4Y1DA 3FLCO 5KRTA 3SJJA 4EAHD 1YUWA 4KHUA 2BDPA 4M42A 3KWIA 4GV6A 3CJ9A 4R5PA 4BR7A 1SKSA 1WN7A 2VWJA 4AHRA 5AJ3K 3QESA 3VENA 3THVA 3HPGA 3NMUA 4CVNE 1OH5A 1NGHA 3AVMA 3VEWA 1IO2A 4EP4A 2ITGA 3D2FB 4Z4CA 1BIUA 4I9LA 4JI1K 3G71N 4H5VA 1MWKA 3F9MA 3ZSYA 1G99A 5JLFA 3AVAA 1NGCA 4W5RA 1HPMA 1V4SA 1CZAN 3O9RA 2Y1IA 1SL2A 4M3UA 3AVKA 4CF1A 3U3YA 4WQ4A 3S3OA 4FL9A 1CZBA 2KLAA 4FLXA 3TAPA 3M6GA 1DEJA 2QWOA 4CF0A 3HPHA 1TAUA 3AVJA 5IT9O 5HLFA 5AZJB 4KKOA 3R6MA 4PHTX 4FLYA 2PZSA 4YOUA 3QLHA 4GMJB 1YTAA 3EO3A 3BEXA 5C10A 2XHBA 3CI5A 3NBPA 2VGNA 1NK8A 1D8YA 4DSFA 3ID8A 1U4BA 1VSKA 1Y97A 3CJ7A 4JNEA 4F4KA 2G8VA 2OYQA 1JLFA 5KPRA 1JXEA 1L3SA 3SBTA 2VG5A 1GLBG 3UIQA 1Z6RA 3VTIA 3CCRN 2WONA 3H45C 2FLOA 2P1JA 3LM9A 4KB1A 1WB9A 3A0IX 4BC5A 5AQZA 1NJYA 1GOCA 3M8PA 4LFBK 3FFKB 2QWNA 1NM1A 4HUFA 1NU0A 4BRKA 3HL8A 3CMAN 5CYQA 3VOVA 2OPSA 4I2QA 2A3ZA 2OPRA 3U6FA 4KHNA 2X74A 5FLXO 4FJ7A 4FVUA 1TUYA 3WQTA 2E1ZA 5C24A 4E1NA 5ELZA 4YDUC 3E9OA 1XNRK 1ZBLA 4TSXA 4RW7A 4CF2A 3SBGA 4HCCA 2ZJRL 1Y64A 4EZ9A 3DAWA 4FLVA 2KZMA 4ISEA 5KPZA 2HHSA 4WFNL 3E9PA 4CEQA 4WF9L 4FWLA 2E2PA 3TSPA 1BISA 2JLEA 4C8NA 2O8EA 4AH9A 2E88A 3KLFA 3K0SA 1Q7YO 3MN9A 4KO0A 2F4VK 4OPHA 4B9SA 4FWSA 3TAFA 4LSNA 3A5OC 1BQNA 4M3XA 4FK0A 1VRTA 1YJ9N 2Z1IA 4DV2K 3PX4A 3HP6A 4DTMA 3AV9A 3KK2A 5I3UA 4DU3A 3IRXA 2XY6A 5C12A 4GY2B 3B8AX 3HVTA 4CJRA 1UAXA 2WUSA 1C1CA 1KLMA 4GV9A 3ID6A 4OGEA 5LMUK 4KFBA 4KHYA 3BGRA 5C25A 2HBLA 3FGUA 1VSEA 1QS4A 3AVLA 3L2QA 1RT2A 5KRSA 4FK4A 3WUHA 4NB4A 4KHPK 1P8ZA 2A6AA 1J53A 4PKGA 1QSYA 4K0KK 1ZBHA 3L2RA 2IGIA 5M1FA 1BA1A 4FPBA 3K5NA 1EO1A 2KZZA 4CI6A 1MDUB 4NCBA 3ISNC 2PYLA 1SKRA 4IOCL 4YFUA 3HI0A 2O8CA 3PV8A 1NKCA 4ISGA 2P5GA 1VQ9N 2WBNA 3FZHA 5KQ8A 3IAYA 2BH1A 4HWIA 1XQSC 2HHVA 3V6DA 2OZSA 4H0OA 3ASMA 5KGXA 3MK6A 5A2QO 5AQYA 4DV1K 4F3TA 1RBRA 4YOVA 2Q0RA 4LF6K 1DKGD 3PX0A 2JWKA 4CIFA 3SK3A 3P39A 4JD2B 1LOTB 2D4WA 4DQSA 4E7JA 3NGZA 3HP9A 3O9SA 3NAEA 4N5SA 3TAEA 3I8BA 1S1UA 2CH5A 1NGFA 3R3LA 2D0BA 4B08A 4LFAK 3CETA 4DTNA 4KRFA 3UKUA 2HVIA 3V9WA 3F2KA 2ZF5O 4X64K 4IJNA 1J5EK 2P9IA 4BRGA 2GV9A 4DB3A 5HL7L 3HXMA 2F9TA 3KLGA 5BPMA 3DI6A 4Q0BA 1X3NA 2X78A 3EN9A 4NXMK 1W2BM 3WNGA 1ASUA 4AHSA 4LF4K 4JHDA 4M41A 2FBVA 3SQ2A 4N47A 3CIPA 5HBMA 4BACA 4FZYA 1T6CA 1RTHA 3CFOA 4G1QA 3ZSXA 4OX9K 1A5WA 5AQPA 4WFAL 1EX4A 3OYFA 1YVNA 4AHCA 4ZTFA 3NVMA 1NNEA 3LDLA 1HRHA 4FJIA 1YXQA 2BTFA 4KI6A 2QWRA 1K73O 5BRFA 1RGIA 1WSHA 4CGDA 2IVPA 3THWB 3CCVN 4E1JA 2Q1NA 2PYJA 4H0VB 4H5NA 4KH6A 3J80O 4FCYA 1QVGM 1Q9XA 2NUBA 1BUPA 2A42A 3K59A 1VSFA 3JYTA 4FVMA 4HVJA 3NHGA 4GKKK 3KK7A 4HUGA 2V7ZA 3FZFA 4B1WB 4CZJA 4EHUA 4O4GA 2QXFA 4IEEA 3A8YA 1KQSM 1ESVA 2FBTA 5AZIB 1NBWA 4GNIA 3V81A 3ZEUB 4KTZA 4QOZB 3KZBA 3DRPA 5AFUH 4CK3A 4F9OA 2P9NB 4V19S 4DQRA 1W9HA 4F8RA 4J2AA 1WBBA 3L2UA 3VQ7A 4W5OA 4FOEA 4CD1A 5E26A 3QEWA 2UUAK 5EOYA 4LY7A 4IJAA 3WXJA 3T1HK 1T44A 1TVRA 4K41A 1VQLN 2QM1A 3QO9A 5AQTA 2GWKA 3RSEA 4CZIA 1WAFA 4QS7A 2YHYA 4IOAL 5J2PA 1BDGA 1CZ9A
chains in the Genus database with same CATH topology
2F4VK 4JI1K 4DR4K 4JI2K 4JI5K 4NXMK 4LF7K 4DV2K 1IBMK 4DR1K 4LF4K 2VQFK 4B3SK 3T1YK 4B3TK 5LL6Z 4B3RK 1IBLK 4B3MK 5LMNK 1HNWK 1HNZK 4DV3K 4AQYK 5LMUK 4OX9K 4X65K 5IT9O 2ZM6K 4LF8K 4DV0K 4X66K 3OTOK 5IWAK 2UUCK 4KHPK 3J7YP 4JV5K 4K0KK 4JYAK 2UXCK 1IBKK 4GKJK 2UXDK 4DR7K 4LFCK 1N32K 2UXBK 4DV6K 3J80O 4NXNK 1XMOK 4JI7K 4GKKK 2E5LK 4LFBK 4DR2K 3JAMO 4YY3K 4CW7B 1N36K 1FJGK 5A2QO 4LF9K 1I94K 4YHHK 4DV1K 1XMQK 1HR0K 4LF6K 2HHHK 5FLXO 4DV7K 3J7AP 4JI8K 4DUYK 1XNRK 1N34K 4V19S 4DR5K 4LF5K 3J81O 4JI6K 4DUZK 4DR3K 4X62K 1HNXK 4LFAK 2VQEK 2UUAK 4JI0K 1XNQK 4DV4K 4DR6K 2UU9K 4JI3K 3T1HK 4X64K 1J5EK 1N33K 5AJ3K 2UUBK 4JI4K 4CVNE 5BR8K 4DV5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V K;  4JI1 K;  4DR4 K;  4JI2 K;  4JI5 K;  4NXM K;  4LF7 K;  4DV2 K;  1IBM K;  4DR1 K;  4LF4 K;  2VQF K;  4B3S K;  3T1Y K;  4B3T K;  5LL6 Z;  4B3R K;  1IBL K;  4B3M K;  5LMN K;  1HNW K;  1HNZ K;  4DV3 K;  4AQY K;  5LMU K;  4OX9 K;  4X65 K;  5IT9 O;  2ZM6 K;  4LF8 K;  4DV0 K;  4X66 K;  3OTO K;  5IWA K;  2UUC K;  4KHP K;  3J7Y P;  4JV5 K;  4K0K K;  4JYA K;  2UXC K;  1IBK K;  4GKJ K;  2UXD K;  4DR7 K;  4LFC K;  1N32 K;  2UXB K;  4DV6 K;  3J80 O;  4NXN K;  1XMO K;  4JI7 K;  4GKK K;  2E5L K;  4LFB K;  4DR2 K;  3JAM O;  4YY3 K;  4CW7 B;  1N36 K;  1FJG K;  5A2Q O;  4LF9 K;  1I94 K;  4YHH K;  4DV1 K;  1XMQ K;  1HR0 K;  4LF6 K;  2HHH K;  5FLX O;  4DV7 K;  3J7A P;  4JI8 K;  4DUY K;  1XNR K;  1N34 K;  4V19 S;  4DR5 K;  4LF5 K;  3J81 O;  4JI6 K;  4DUZ K;  4DR3 K;  4X62 K;  1HNX K;  4LFA K;  2VQE K;  2UUA K;  4JI0 K;  1XNQ K;  4DV4 K;  4DR6 K;  2UU9 K;  4JI3 K;  3T1H K;  4X64 K;  1J5E K;  1N33 K;  5AJ3 K;  2UUB K;  4JI4 K;  4CVN E;  5BR8 K;  4DV5 K; 
#chains in the Genus database with same CATH topology
 4ICL A;  4DTS A;  4CJ3 A;  1V4T A;  1G15 A;  1O13 A;  2A41 A;  3NVK A;  2P9L B;  4DHY A;  3CM6 A;  2QXL A;  5FDL A;  1IBM K;  2HBJ A;  3C0B A;  2ZQB A;  3JXU A;  3BF1 A;  4E0D A;  4BVO A;  1CXU A;  3VQE A;  4ELT A;  2O8F B;  1TKD A;  3CME N;  3HK2 A;  1HKG A;  3LAM A;  4EFH A;  2Q31 A;  3LDN A;  2QWP A;  4A5A A;  5AQX A;  3RMB A;  1HYV A;  2ZWH A;  3S41 A;  4ILG B;  1ZBS A;  1YF5 L;  3ZCM A;  1LAW A;  4FJ9 A;  4DQQ A;  2F8S A;  3THY A;  3DXM A;  4CJV A;  3OHR A;  1VQ8 N;  2F8T A;  1IBK K;  3ZSQ A;  1C0G A;  2X6N A;  3BY5 A;  3VET A;  4BG8 A;  1B9D A;  1U47 A;  3MEG A;  3O4N A;  1JLQ A;  3W0L A;  4DV6 K;  2UYT A;  1NK9 A;  1IV0 A;  3L2V A;  3MXI A;  3D0P A;  4FJ8 A;  5DM7 L;  1CLQ A;  4EZ6 A;  3MWP A;  3K5M A;  4FYD A;  3VGL A;  1S3X A;  4Z4E A;  4NYF A;  3GE1 A;  3R9P A;  3JS6 A;  3DYA A;  4H03 B;  4CF9 A;  3F73 A;  3RMD A;  4K43 A;  3KKS A;  1NJZ A;  4DV7 K;  1Q18 A;  2GWJ A;  4OPJ A;  3AVI A;  4WE1 A;  3G10 A;  4LF5 K;  4CZH A;  3J81 O;  1JJ2 M;  3BP8 A;  3GDQ A;  4H0T B;  5C2F A;  3V4I A;  1ZC6 A;  3K9K A;  4JKA A;  4JKD A;  4GW6 A;  3E01 A;  4J2D A;  4IFY A;  1UA1 A;  1E3M A;  4CGG A;  3ZX2 A;  4JI3 K;  3WEE B;  2FF6 A;  3V1Q A;  1RT5 A;  4PY5 A;  2HHU A;  3D2E A;  3G4S N;  1ASV A;  4NCA A;  1W0H A;  4BRN A;  3OYA A;  4JKG A;  3PY8 A;  4DFJ A;  4Z4H A;  2IDO A;  1BGX T;  2VWK A;  5LMN K;  1KFD A;  1HNW K;  4LH5 A;  3L8B A;  1RDA A;  4O0I A;  4E7K A;  3OYI A;  4CJT A;  5IWA K;  5M1K A;  2KQ2 A;  4ILJ A;  1Z25 A;  4CGJ A;  1X9J A;  1X9M A;  3P5J A;  1R59 O;  3PIO L;  3CM5 A;  1VQO N;  4CGH A;  4M3Y A;  2P9U B;  1GLE G;  3OS2 A;  4CJQ A;  4CER A;  1SL0 A;  4CE9 A;  3VEO A;  3SYZ A;  2YKN A;  4W5N A;  3MAQ A;  2FF3 B;  3SUO A;  3O5B A;  3BF3 A;  4BRM A;  3LWM A;  2G8W A;  1Q8I A;  2YNI A;  3O4Q A;  1KXP A;  3CER A;  3O1W A;  3TAQ A;  3ZSZ A;  5JIC A;  4YOT A;  2HNY A;  5FPN A;  3KLH A;  4NYN A;  4OO1 J;  1KCF A;  3VQ9 A;  3G6E N;  4DQP A;  1ZBU A;  3MN5 A;  1ZXO A;  3I33 A;  1N34 K;  2RF2 A;  1SAZ A;  4DFK A;  3AAP A;  3ULD A;  3HM8 A;  5AQL A;  1VQP N;  2ZD1 A;  2D0P A;  4CES A;  4DS4 A;  2WOM A;  3PUF A;  1ZBF A;  5LY3 A;  1VQM N;  5AQN A;  1ATN A;  5ADX H;  3LAN A;  3SJH A;  3EY1 A;  3LL3 A;  1BCO A;  5BR8 K;  4AIL C;  4DV5 K;  1X9S A;  3L6Q A;  3TAN A;  3NF8 A;  3OJU A;  1SS6 A;  3QIO A;  1KFS A;  5DMR A;  4DSL A;  1T05 A;  2RKI A;  1NK0 A;  5AQK A;  4DR1 K;  4CHZ A;  2CH6 A;  3R8E A;  3IG1 A;  4JK7 A;  2O4I A;  2NRR A;  3LP2 A;  3ITH A;  3D7E O;  3CF5 L;  3CC7 N;  4JK9 A;  2QKB A;  3NFA A;  4PKI A;  3OYH A;  1NKB A;  4DQ8 A;  3LM2 A;  5M1N A;  4X66 K;  4J8F A;  4R79 A;  4CZM A;  3E66 A;  3DLE A;  4WQ5 C;  3AA4 A;  4ILH A;  3BUZ B;  3M8Q A;  2JWL A;  4MO5 A;  2YHW A;  4RWT A;  3EZ5 A;  3OYB A;  3QNN A;  3C65 A;  1GLF O;  5BPN A;  1RT7 A;  3OYG A;  3WXL A;  4LFC K;  4DR7 K;  4LD0 A;  3ENB A;  5TKY A;  3E1Y A;  2ASM A;  5FPE A;  3SPY A;  3LDP A;  5HP1 A;  3OYN A;  4CJS A;  1T03 A;  3VQB A;  3MX5 A;  1HKC A;  2H3G X;  1LW2 A;  4BDZ A;  2FBX A;  1SZ2 A;  3QDK A;  3T19 A;  3K58 A;  3LP1 A;  2HBK A;  3KK1 A;  4FLW A;  1XMQ K;  5AQW A;  4Q5V A;  2G8K A;  1JCE A;  4ISF A;  3KLI A;  4YDU A;  3J7A P;  3RVC A;  1YIJ N;  3AO1 A;  3DRR A;  4DR5 K;  2IIR A;  5DK5 A;  2P9P A;  2PAV A;  4BRD A;  3V9Z A;  1RDD A;  4I9Q A;  5DM6 L;  4CBU A;  2O8E B;  3EL2 A;  3WXI A;  1TGO A;  3SQ4 A;  2R7Y A;  3ATU A;  1N6Q A;  1O1W A;  4JI0 K;  3VQC A;  4PL7 A;  1D9D A;  3RR7 A;  2DY4 A;  4BGB A;  5CE3 A;  1DTQ A;  3H1Q A;  3VQ6 A;  5KTQ A;  3M8R A;  1TV6 A;  3V9S A;  4KTQ A;  4FW2 A;  2QWQ A;  3FR0 A;  5LJW A;  1NLV A;  3WNH A;  3CHW A;  4GVM A;  1GLL O;  4JI2 K;  1SL1 A;  4AHT A;  1NWK A;  4RW4 A;  3VQ5 A;  4BRO A;  2O8B A;  3C7N A;  4Y1C A;  2FC0 A;  4FJM A;  3T1Y K;  1HNI A;  4BRF A;  3MWT A;  4NLB A;  4B3M K;  2GUI A;  3GG4 A;  4K42 A;  1HNZ K;  3O9Q A;  4LSL A;  2WTU A;  4DTJ A;  1VSJ A;  3SI6 A;  3AA3 A;  3QEX A;  4C23 A;  3ZX3 A;  3O6W A;  4CEZ A;  3J7Y P;  4B9N A;  4EP5 A;  2KW4 A;  3TTF A;  4JYA K;  4GKJ K;  3DM2 A;  1IKV A;  5AQU A;  1K8K A;  2HNZ A;  2QK9 A;  2UXD K;  1YIT N;  2O8C B;  2VGM A;  2QTD A;  1N32 K;  3KTQ A;  1RDC A;  1D4X A;  1KAX A;  4DF8 A;  2QKK A;  1TYQ A;  4JS5 A;  1SQK A;  4XEI A;  4DTR A;  3KJV A;  1FXX A;  3IMX A;  3KLE A;  4FJG A;  3V9X A;  4FXD A;  1UWB A;  3VQ8 A;  5C15 A;  4WYB A;  4DR2 K;  3HO1 A;  2QI2 A;  4JN4 A;  4JEP A;  5BRH A;  5CYM A;  4QAG A;  4RW9 A;  3VEY A;  2Q3S A;  4RG8 A;  1U04 A;  5EVZ A;  4FWO A;  3V1O A;  3LWL A;  1E4G T;  3NH2 A;  3MXJ A;  4KH5 A;  3KKR A;  4BR4 A;  2HF4 A;  3CD6 N;  5FPD A;  4B1V A;  4FWK A;  3O3G A;  4ID5 A;  4CJW A;  4DUZ K;  4Z94 A;  3B6P A;  5JS2 A;  3TSQ A;  4BGA A;  4EHT A;  4FW1 A;  3HST B;  1TK8 A;  2P9I B;  4E89 A;  4CEE A;  3AVB A;  4CJU A;  2EX3 A;  4DV4 K;  1RDB A;  3DOK A;  2BGG A;  1GLD G;  5HRO A;  4PA1 A;  5KQD A;  3CCU N;  4CEC A;  3ENO A;  4ELU A;  4FSV A;  4JHD B;  1C1A A;  2YNH A;  4CJL A;  3VF4 A;  2P9K A;  1YTU A;  4CK1 A;  3CG7 A;  4CZK A;  3KD5 E;  1L3T A;  4UQG A;  3AGR A;  3EE8 A;  5CZ1 A;  1Q9Y A;  2W6K A;  1EQY A;  3MN6 A;  4CJ7 A;  1YHQ N;  4O55 A;  1S22 A;  4DU1 A;  2VYP A;  4F2S A;  5LL6 Z;  1BCM A;  1X1P A;  4O44 A;  3QEV A;  3IKM A;  3OVN A;  1YVU A;  4DV3 K;  4MLE A;  4RW8 A;  3C6A A;  1NOY A;  3AO4 A;  4JAX A;  4HUE A;  3PX6 A;  3V9U A;  4CJF A;  3AAQ A;  3CCM N;  1VK0 A;  1J6Z A;  1VSL A;  1RTJ A;  2QWL A;  1QZ5 A;  4KHS A;  3CC2 N;  2IVO A;  2YHX A;  3THX A;  1BU6 O;  4OVL A;  3ZET A;  1KVB A;  4H5R A;  3MN7 A;  1XMO K;  4M45 A;  1NK6 A;  3M1F A;  3NDK A;  4FLU A;  2F7T A;  2D0C A;  2YNF A;  3DXK A;  4BC4 A;  4DF4 A;  1RBV A;  4YOX A;  1TK5 A;  2HOE A;  3G25 A;  4F2R A;  2O8D A;  1TAQ A;  2AJQ A;  4BR0 A;  1U6Z A;  4Y0W A;  4UY8 O;  1U45 A;  1A5V A;  4B9L A;  1WUA A;  3DRS A;  2Q0U A;  2HF3 A;  4IG0 A;  1MA9 B;  1GLJ O;  1HLU A;  2P9S A;  2W42 A;  2HST A;  4FLT A;  3CPW M;  4O5F A;  3H6E A;  4FWN A;  5C2D A;  1S1V A;  3AVC A;  4I6M A;  2NRT A;  4JK8 A;  4IDH A;  2E20 A;  3JSM A;  4M7Y A;  4BR9 A;  1N8R O;  1HNX K;  1ZYQ A;  4FPA A;  2I5J A;  5BN8 A;  3AVH A;  1NGD A;  1VSH A;  4DLG A;  1C6V A;  1XI1 A;  2WFB A;  3N4Q A;  3BDP A;  5MLC Q;  3OYM A;  3LZJ A;  4B9U A;  3HBT A;  2IC3 A;  2GEL A;  2NNW A;  3PSF A;  2O4G A;  2ZJQ L;  4ZTJ A;  1BIZ A;  4DCH A;  4BR2 A;  3SUP A;  2E1Y A;  2ZGY A;  1L3V A;  2V51 B;  4B3S K;  4BQL A;  1R0A A;  1L3U A;  2E6M A;  4NLC A;  3CQ8 A;  4H5W A;  3SUQ A;  5KI6 A;  1UA0 A;  3ZSO A;  5JLH A;  3THY B;  1NJX A;  3DXM B;  3QIN A;  5TKW A;  3WXK A;  3LP3 A;  1N5Y A;  4KHW A;  1S1T A;  1Q86 O;  4IEI A;  2W41 A;  1NGB A;  1VSI A;  3SQ0 A;  1QQM A;  5BPL A;  4IOX A;  3RWU A;  1HYS A;  3HM9 A;  4EIA A;  2GEM A;  4CFA A;  1JXB A;  2OCE A;  5GAD P;  2EHG A;  5JS1 A;  2D5R A;  1TKZ A;  2NRZ A;  3NF6 A;  4OPA A;  3L4Q A;  5FRO A;  3ZT3 A;  3MX2 A;  1VQN N;  4E7L A;  4IDK A;  4BRL A;  4DTO A;  2G8F A;  2BUP A;  2XY5 A;  3OBY A;  4HHT A;  3OBW A;  2GUP A;  4PWD A;  1VSM A;  3HT3 A;  4PUO A;  3JAM O;  1XC3 A;  5F0X A;  4YY3 K;  4A5B A;  4CEB A;  4BDY A;  3ZSW A;  1OH6 A;  3ZX0 A;  4FLZ A;  1KVC A;  5J2N A;  3SMP A;  4IXC A;  3K2P A;  4BC3 A;  2FSN A;  3QNO A;  2OA8 A;  3NE6 A;  5AQH A;  3CFP A;  3LAK A;  3PLA A;  4G9Z A;  1RTD A;  3O4W A;  5BN9 A;  1OVY A;  1EWR A;  3ZT1 A;  2A40 A;  3LP0 A;  1ATS A;  4C1N I;  1UOC A;  5C42 A;  1S1W A;  1IKW A;  1NMD A;  3TAM A;  3D2E B;  4ELV A;  4IBN A;  5GAG P;  3O08 A;  4Z4I A;  2PY5 A;  1Z05 A;  4CHY A;  2E2N A;  2BE2 A;  4JKG B;  1C0U A;  3M8S A;  3QML A;  4BDP A;  1IKX A;  4DSI A;  4WCE L;  4B9Q A;  1IG9 A;  3C6H A;  2ETJ A;  4DFM A;  4I2P A;  1T6D A;  2NRW A;  1M90 O;  3VEV A;  3EKU A;  5AQG A;  3BZC A;  4BWJ A;  4BWM A;  1IBL K;  3OYL A;  3TU5 A;  4OGC A;  5AQV A;  2YJE A;  4BRP A;  3OYJ A;  4CFC A;  1VQ6 N;  1LCU A;  4AQY K;  1GOA A;  4M7X A;  3DLG A;  3QBX A;  2ATQ A;  1QHT A;  3C95 A;  1HKB A;  3HYF A;  3FZK A;  1WSF A;  2A5X A;  4C8K A;  1RDW X;  2EWS A;  3CJC A;  3QFP A;  4W5T A;  4J2B A;  4E7I A;  4IG3 A;  4O8U A;  3GOI A;  2KFZ A;  3VA0 A;  4N76 A;  4BRA A;  3TTC A;  4CGI A;  3AVN A;  5EU7 A;  4H8K A;  4CZL A;  3B6O A;  4CGF A;  1JL2 A;  4FK2 A;  4OKE A;  1NOZ A;  4CBW A;  1JLE A;  3O80 A;  1DT9 A;  1CXQ A;  1SKW A;  4CF8 A;  1JLG A;  5AQI A;  4GV3 A;  2KKZ A;  4OLB A;  1FKP A;  5C0Y A;  1P90 A;  3SNN A;  4BC2 A;  4DMN A;  4PKH A;  4BRQ A;  5HRP A;  4IFE A;  1W7A A;  2YV0 X;  1B9F A;  3SAF A;  4B9V A;  4H4O A;  3VGM A;  1TL3 A;  4IWV A;  1U49 A;  3RRG A;  3VQ4 A;  1YT3 A;  3WNE A;  1NGI A;  1K8A O;  2CGK A;  3PO5 A;  2YI1 A;  2ZE2 A;  4BRE A;  4A59 A;  2D1K A;  3OS0 A;  3FZM A;  3SLC A;  1BWF O;  4RW6 A;  4DKW A;  2A1R A;  5I9E B;  2YHB A;  2HND A;  2VWB A;  2G8I A;  4JI4 K;  3LDO A;  1WSG A;  4CD3 A;  3KK3 A;  4M3W A;  2OAN A;  3ULE A;  1BHL A;  1U2V A;  1WBD A;  4FJL A;  4CZF A;  4B9T A;  4CZG A;  2XY7 A;  4HTU A;  1B92 A;  3A2F A;  5B8H A;  3O8M A;  3TPQ A;  2I7P A;  3I56 N;  3OA9 A;  2HHT A;  1S5J A;  3EE9 A;  3GBT A;  4B3R K;  2OTL N;  1E4F T;  3AGK A;  4Z4G A;  1BL3 A;  3SCX A;  4LF8 K;  4JKF A;  1DLO A;  3QET A;  3OTO K;  4WQ5 A;  4JRQ A;  3HVR A;  4HCB A;  4C1N K;  3CCQ N;  1NK7 A;  5FPM A;  3OYE A;  1QQO A;  3BZK A;  3QEP A;  2F96 A;  1FK9 A;  1VAZ A;  4M3Z A;  2Q36 A;  5CR4 A;  2E6L A;  1C0M A;  1Q81 O;  3CFR A;  4FJX A;  4YNQ A;  3CJ1 A;  3K5O A;  4DU4 A;  1BI4 A;  1RFQ A;  2Z1J A;  3HTV A;  1ITG A;  1HPZ A;  3DWL A;  1XWL A;  4OPK A;  3C6T A;  2KTQ A;  1EWQ A;  1KAZ A;  4Z0U A;  3SAG A;  2CGL A;  3DMJ A;  1N36 K;  4DSE A;  2RHK A;  3TTD A;  2P9P B;  1ILY A;  2E4L A;  3DJC A;  2ZGZ A;  1MU2 A;  3NF9 A;  4YOR A;  3KVG A;  2HHH K;  2ASO A;  1S9G A;  3MMV A;  4FWM A;  3T7Z A;  4JI6 K;  3UKR A;  4B1Y B;  2QA4 N;  2HW3 A;  3I55 N;  1QHA A;  3UE5 A;  1HJO A;  1RBT A;  4FOI A;  1F21 A;  2VQE K;  3AO3 A;  4CHO A;  2IOC A;  3RR8 A;  2Q2R A;  3EEQ A;  1XNQ K;  4ZHR A;  2RN2 A;  3QBW A;  3L4I A;  4CEO A;  4XIU A;  4IZ9 A;  3H08 A;  3ZLJ A;  2F9W A;  1N33 K;  4C8M A;  3MCA B;  1I3A A;  2KHO A;  3IS9 A;  4IO8 A;  3OYD A;  4IO9 L;  1RIL A;  1M1K O;  3FZL A;  3VES A;  3VPZ A;  1X9W A;  2O8B B;  3C7N B;  5HRR A;  1VQ7 N;  3U4L A;  3HRG A;  2G8H A;  2OPQ A;  1KRP A;  4H5T A;  5AQR A;  4BY9 C;  1OVQ A;  4CJE A;  5BRD A;  1S6P A;  1IH7 A;  4DR4 K;  4CJP A;  2NRV A;  1NGJ A;  1FKO A;  4QS9 A;  5D3G A;  1T8E A;  4E1M A;  4RCH A;  3D2F A;  5CHI A;  3M3Z A;  4WQ4 C;  1YJN N;  4CK2 A;  3P1G A;  1KLN A;  3K9J A;  1JLB A;  4O8K A;  4L3Q A;  4DWI A;  2DFE A;  4U7B A;  1EP4 A;  3LZI A;  1LW0 A;  1K8K B;  1J5O A;  3SV4 A;  1ZBI A;  1LWC A;  4DTU A;  2YCH A;  4NO7 A;  4GVE A;  2ASP A;  5AZJ A;  3P4I A;  4B1U B;  3CPE A;  3I8D A;  4DSK A;  1KC8 O;  3AVG A;  1RT6 A;  1TYQ B;  3NF7 A;  3E9L A;  1QZ6 A;  3MED A;  1GLA G;  3TAG A;  1NGA A;  2RE2 A;  1VHX A;  4O0J A;  5EY4 A;  1KVA A;  4JKB A;  3CXC M;  1TK0 A;  3SQ1 A;  4XH5 A;  4DLE A;  4KV8 A;  2Z1G A;  5GIO A;  3T1A A;  3U9Z A;  4K8X A;  4DTX A;  3D6R A;  1A5X A;  4B1X B;  1JCG A;  4LF9 K;  4BE1 A;  2WC9 A;  2DTU A;  3ZT4 A;  3H3O B;  3LDQ A;  3HZ6 A;  3WNF A;  5JMV A;  5GAE P;  4BQZ A;  3FE1 A;  1NG9 A;  3NH1 A;  4J2E A;  1QQN A;  4MFB A;  2FXU A;  1RT4 A;  4FM0 A;  2HHX A;  5BR9 A;  1VSD A;  3F5T A;  4B9M A;  3IDH A;  3O3H A;  2OTJ N;  1RBU A;  1I39 A;  1NKE A;  4B8C A;  1TKT A;  2CGJ A;  1JCF A;  4B3O A;  4QS8 A;  3VTH A;  4BE0 A;  1C0T A;  3OYC A;  3VF6 A;  4AF1 A;  3DLR A;  2P9K B;  2UU9 K;  3O9U A;  3QB0 A;  2HMP A;  2E2Q A;  1BG3 A;  3AA2 A;  4LH4 A;  3VEZ A;  4OKK A;  4FZZ A;  3Q7B A;  3UKU B;  3T3F A;  4KHQ A;  3M5R A;  5J1E A;  1DGK N;  4CIG A;  5M1Q A;  3HOT A;  1JLC A;  2YNG A;  5K14 A;  2VQF K;  3VQA A;  5F2R A;  1KD1 O;  2QWM A;  4E19 A;  3WT0 A;  2OPP A;  3ATV A;  3TR8 A;  4A2A A;  1QQC A;  2HBM A;  1HQU A;  3DLB A;  3PIP L;  2P51 A;  4DV0 K;  5GIP A;  3OW2 M;  3C94 A;  4CED A;  3SZ2 A;  3HJF A;  2V52 B;  4MLH A;  3WXM B;  3THX B;  1WAJ A;  3VER A;  4CIE A;  4C8L A;  2IS3 A;  4BG9 A;  1HJR A;  3ZET B;  5EXW A;  3KHY A;  5SWM A;  1TL1 A;  4BRC A;  4B1Z A;  2FBY A;  4AM7 A;  4FJJ A;  3SUN A;  3DXK B;  2UXB K;  3AO5 A;  3ZSR A;  3A5M C;  3CQY A;  3OJS A;  3G0Z A;  5J2Q A;  2O8D B;  1IJJ A;  4BRH A;  4JI7 K;  2NZT A;  1S6Q A;  3RMC A;  3RRH A;  3ZSV A;  5E41 A;  2KFN A;  1HUX A;  2P9S B;  4FM2 A;  3J8A A;  4W5Q A;  1JL1 A;  3GL1 A;  4I7F A;  1HR0 K;  3RMA A;  3P83 D;  4I6M B;  4A62 A;  4H4M A;  5SZT A;  3O9T A;  4A2B A;  4JI8 K;  3KWG A;  3TI0 A;  5AFU A;  1YI2 N;  2B4J A;  1K9M O;  1JLA A;  1FW6 A;  1S1X A;  5HRS A;  1ATR A;  1XHX A;  3P31 A;  3CQX A;  4CZE A;  1U48 A;  5CY4 A;  5HRN A;  4X62 K;  4JD2 A;  1WOQ A;  3LPU A;  3SPZ A;  3ENH A;  4CHQ A;  2YJF A;  4AM6 A;  3S9H A;  2IVN A;  4DR6 K;  4XH1 A;  2JGU A;  4CJK A;  3EZW A;  1NJW A;  1KAY A;  4JKE A;  3NGY A;  4Z4F A;  4CBX A;  4JRP A;  4H0X B;  4FJN A;  4CEA A;  1WSE A;  5BRE A;  5LJV A;  3O3F A;  5AR0 A;  1EXQ A;  4RTF D;  1D5A A;  2DPN A;  3KIO A;  4MDA A;  3HSC A;  2PBD A;  1VQK N;  3RSE B;  4LF7 K;  1Q82 O;  4PL8 A;  2NRX A;  1BQM A;  2AA4 A;  3N4P A;  3VA3 A;  2QEX N;  3DLL L;  4FJK A;  2LSN A;  4ID1 A;  3V1R A;  3QIP A;  1RNH A;  1K6Y A;  5AQF A;  4KPY A;  3LAL A;  2HHW A;  3VGK A;  1KSP A;  4N41 A;  3MDQ A;  5M1P A;  3AO2 A;  1GOB A;  1S72 N;  4YOW A;  1RT1 A;  1XUP O;  4H0Y B;  5AQQ A;  4CFB A;  1LV5 A;  3HPO A;  2E8A A;  4F3O A;  2HVH A;  3TSU A;  3CC4 N;  4CCH A;  2UXC K;  1REV A;  3I0S A;  4CFD A;  3AVF A;  1EKE A;  3VQD A;  3THW A;  4FWQ A;  4BE2 A;  4DG1 A;  1DTT A;  5AQM A;  3L2W A;  1OKJ A;  2DFF A;  2VG7 A;  4FO0 A;  4JKH A;  4LC9 B;  2B6A A;  2Y1J A;  1SUQ A;  5AQJ A;  3TWH A;  3A5L C;  5AQO A;  3K57 A;  1TKX A;  2G8U A;  2HMI A;  5T7B A;  5CZ2 A;  5GIN A;  5KGW A;  1IKY A;  5AZI A;  3U3G A;  3ZT0 A;  3ZEU A;  4MDB A;  3VN5 A;  4DR3 K;  2P5O A;  4XH4 A;  4L8R B;  3I0R A;  3AA5 X;  2W40 A;  2FSK A;  2P9N A;  1BO5 O;  3SV3 A;  3L0Q A;  1J54 A;  3S3N A;  4M3R A;  1HX1 A;  1XC9 A;  3EKS A;  1LAV A;  2V7Y A;  2DFH A;  3F9K A;  3OS1 A;  1D9F A;  1RTI A;  3UB5 A;  2UUB K;  1S9E A;  1NMN A;  1RCH A;  2NLX A;  1NK4 A;  3VF2 A;  1WNS A;  2D0A A;  2QW9 A;  4JKC A;  3H1V X;  3OY9 A;  4JI5 K;  5GAH P;  4KTW A;  5J2M A;  3EYZ A;  4IKF A;  1J9A A;  4CHP A;  2YKM A;  2OZM A;  3P38 A;  2XRI A;  1OH8 A;  3SMS A;  3TAR A;  1HQE A;  2P9L A;  2J4R A;  3OYK A;  3L3V A;  1WSJ A;  3CCL N;  1Z26 A;  1QSS A;  4X65 K;  1WLJ A;  2ZM6 K;  2PFU A;  4KRE A;  4MO4 A;  2O8F A;  3L3U A;  3CJB A;  1RT3 A;  3PO4 A;  4DSJ A;  5M1O A;  3HOS A;  2UUC K;  3ZYY X;  3U9D A;  4JV5 K;  1QVF M;  3H3N O;  1NGE A;  2Z1H A;  3CCS N;  3LDS A;  2AP1 A;  3Q7C A;  1LWE A;  4CHN A;  3IFR A;  1YJW N;  1BA0 A;  3LPT A;  2GX9 A;  4JS4 A;  4AHU A;  4U67 L;  2X6S A;  4FWR A;  2XO7 A;  2E5L K;  1OH7 A;  2W6L A;  1RBS A;  3VQP A;  4K25 A;  3J7Z O;  1EET A;  2Q97 A;  2B5J A;  3QER A;  1QTM A;  3MCP A;  2D0O A;  1FJG K;  3AAR A;  5FRN A;  1TUU A;  1I94 K;  4YHH K;  4OJR A;  3SAH A;  3RTV A;  1HYZ A;  1VQ4 N;  4O5B A;  5F1X A;  1T3V A;  1MWM A;  1NGG A;  1L5U A;  1ASW A;  1C0F A;  1QSL A;  4DUY K;  2HHQ A;  1KTQ A;  2GBZ A;  4FM1 A;  4DTP A;  4JLH A;  4FZX C;  3DLH A;  3CCJ N;  3PSI A;  4FJH A;  3W3D A;  1QE1 A;  3D45 A;  2XY8 A;  1BOT O;  5E84 A;  5FRM A;  4BRI A;  4M63 C;  3O1B A;  4QCL A;  3FFI A;  4HTL A;  5I42 A;  2BAN A;  1GLC G;  3U8X A;  4BVP A;  2ZJP L;  5KPT A;  3ULE B;  3A5N C;  1U2V B;  2FSJ A;  3TAB A;  5ADX A;  3T69 A;  5AQS A;  1VQ5 N;  4MQ3 A;  3AY9 A;  3ALY A;  5H1S Q;  3H46 O;  4PQU A;  3CJA A;  2E2O A;  3WEE A;  4N56 A;  3MXM A;  3VQQ A;  2VG6 A;  3MEC A;  1RDU A;  3ZT2 A;  1NJI O;  4B3T K;  4NCG A;  3NH0 A;  4KBO A;  4KAZ A;  1C1B A;  1IG8 A;  2NRH A;  5EX5 A;  4BR5 A;  1WSI A;  1HNV A;  3DLK A;  1X3M A;  3IUC A;  2ITM A;  3S3M A;  4AHV A;  2IAJ A;  1HMV A;  1BI4 B;  4YOY A;  3CYM A;  4OLA A;  4OKJ A;  2VCP A;  4DFP A;  4FWP A;  3QEI A;  1NK5 A;  3CCE N;  1SV5 A;  2YX6 A;  2P9U A;  3K5L A;  3QIC A;  4C8O A;  1W97 L;  4CJ5 A;  4NXN K;  4A57 A;  3QFU A;  3VEX A;  4A61 A;  4WFB L;  2GTD A;  3DOL A;  3MEE A;  4KB0 A;  4CW7 B;  1H1V A;  3VMF B;  2I7N A;  4DS5 A;  5JVG L;  4DQI A;  4CEF A;  3R1X A;  1VRU A;  2HB5 A;  1T7P A;  4E7H A;  3KD1 E;  1LWF A;  3UKR B;  4K8Z A;  4CJ4 A;  4IFV A;  4E3S A;  1JKH A;  4B8A B;  5JVH L;  4FJ5 A;  3WQU A;  2RPI A;  4M3T A;  1YAG A;  3NGI A;  3NCI A;  2YHA A;  3C6U A;  5HOO A;  2A1S A;  4KH4 A;  4H0P A;  1XHZ A;  4KI4 A;  4Y1D A;  3FLC O;  5KRT A;  3SJJ A;  4EAH D;  1YUW A;  4KHU A;  2BDP A;  4M42 A;  3KWI A;  4GV6 A;  3CJ9 A;  4R5P A;  4BR7 A;  1SKS A;  1WN7 A;  2VWJ A;  4AHR A;  5AJ3 K;  3QES A;  3VEN A;  3THV A;  3HPG A;  3NMU A;  4CVN E;  1OH5 A;  1NGH A;  3AVM A;  3VEW A;  1IO2 A;  4EP4 A;  2ITG A;  3D2F B;  4Z4C A;  1BIU A;  4I9L A;  4JI1 K;  3G71 N;  4H5V A;  1MWK A;  3F9M A;  3ZSY A;  1G99 A;  5JLF A;  3AVA A;  1NGC A;  4W5R A;  1HPM A;  1V4S A;  1CZA N;  3O9R A;  2Y1I A;  1SL2 A;  4M3U A;  3AVK A;  4CF1 A;  3U3Y A;  4WQ4 A;  3S3O A;  4FL9 A;  1CZB A;  2KLA A;  4FLX A;  3TAP A;  3M6G A;  1DEJ A;  2QWO A;  4CF0 A;  3HPH A;  1TAU A;  3AVJ A;  5IT9 O;  5HLF A;  5AZJ B;  4KKO A;  3R6M A;  4PHT X;  4FLY A;  2PZS A;  4YOU A;  3QLH A;  4GMJ B;  1YTA A;  3EO3 A;  3BEX A;  5C10 A;  2XHB A;  3CI5 A;  3NBP A;  2VGN A;  1NK8 A;  1D8Y A;  4DSF A;  3ID8 A;  1U4B A;  1VSK A;  1Y97 A;  3CJ7 A;  4JNE A;  4F4K A;  2G8V A;  2OYQ A;  1JLF A;  5KPR A;  1JXE A;  1L3S A;  3SBT A;  2VG5 A;  1GLB G;  3UIQ A;  1Z6R A;  3VTI A;  3CCR N;  2WON A;  3H45 C;  2FLO A;  2P1J A;  3LM9 A;  4KB1 A;  1WB9 A;  3A0I X;  4BC5 A;  5AQZ A;  1NJY A;  1GOC A;  3M8P A;  4LFB K;  3FFK B;  2QWN A;  1NM1 A;  4HUF A;  1NU0 A;  4BRK A;  3HL8 A;  3CMA N;  5CYQ A;  3VOV A;  2OPS A;  4I2Q A;  2A3Z A;  2OPR A;  3U6F A;  4KHN A;  2X74 A;  5FLX O;  4FJ7 A;  4FVU A;  1TUY A;  3WQT A;  2E1Z A;  5C24 A;  4E1N A;  5ELZ A;  4YDU C;  3E9O A;  1XNR K;  1ZBL A;  4TSX A;  4RW7 A;  4CF2 A;  3SBG A;  4HCC A;  2ZJR L;  1Y64 A;  4EZ9 A;  3DAW A;  4FLV A;  2KZM A;  4ISE A;  5KPZ A;  2HHS A;  4WFN L;  3E9P A;  4CEQ A;  4WF9 L;  4FWL A;  2E2P A;  3TSP A;  1BIS A;  2JLE A;  4C8N A;  2O8E A;  4AH9 A;  2E88 A;  3KLF A;  3K0S A;  1Q7Y O;  3MN9 A;  4KO0 A;  2F4V K;  4OPH A;  4B9S A;  4FWS A;  3TAF A;  4LSN A;  3A5O C;  1BQN A;  4M3X A;  4FK0 A;  1VRT A;  1YJ9 N;  2Z1I A;  4DV2 K;  3PX4 A;  3HP6 A;  4DTM A;  3AV9 A;  3KK2 A;  5I3U A;  4DU3 A;  3IRX A;  2XY6 A;  5C12 A;  4GY2 B;  3B8A X;  3HVT A;  4CJR A;  1UAX A;  2WUS A;  1C1C A;  1KLM A;  4GV9 A;  3ID6 A;  4OGE A;  5LMU K;  4KFB A;  4KHY A;  3BGR A;  5C25 A;  2HBL A;  3FGU A;  1VSE A;  1QS4 A;  3AVL A;  3L2Q A;  1RT2 A;  5KRS A;  4FK4 A;  3WUH A;  4NB4 A;  4KHP K;  1P8Z A;  2A6A A;  1J53 A;  4PKG A;  1QSY A;  4K0K K;  1ZBH A;  3L2R A;  2IGI A;  5M1F A;  1BA1 A;  4FPB A;  3K5N A;  1EO1 A;  2KZZ A;  4CI6 A;  1MDU B;  4NCB A;  3ISN C;  2PYL A;  1SKR A;  4IOC L;  4YFU A;  3HI0 A;  2O8C A;  3PV8 A;  1NKC A;  4ISG A;  2P5G A;  1VQ9 N;  2WBN A;  3FZH A;  5KQ8 A;  3IAY A;  2BH1 A;  4HWI A;  1XQS C;  2HHV A;  3V6D A;  2OZS A;  4H0O A;  3ASM A;  5KGX A;  3MK6 A;  5A2Q O;  5AQY A;  4DV1 K;  4F3T A;  1RBR A;  4YOV A;  2Q0R A;  4LF6 K;  1DKG D;  3PX0 A;  2JWK A;  4CIF A;  3SK3 A;  3P39 A;  4JD2 B;  1LOT B;  2D4W A;  4DQS A;  4E7J A;  3NGZ A;  3HP9 A;  3O9S A;  3NAE A;  4N5S A;  3TAE A;  3I8B A;  1S1U A;  2CH5 A;  1NGF A;  3R3L A;  2D0B A;  4B08 A;  4LFA K;  3CET A;  4DTN A;  4KRF A;  3UKU A;  2HVI A;  3V9W A;  3F2K A;  2ZF5 O;  4X64 K;  4IJN A;  1J5E K;  2P9I A;  4BRG A;  2GV9 A;  4DB3 A;  5HL7 L;  3HXM A;  2F9T A;  3KLG A;  5BPM A;  3DI6 A;  4Q0B A;  1X3N A;  2X78 A;  3EN9 A;  4NXM K;  1W2B M;  3WNG A;  1ASU A;  4AHS A;  4LF4 K;  4JHD A;  4M41 A;  2FBV A;  3SQ2 A;  4N47 A;  3CIP A;  5HBM A;  4BAC A;  4FZY A;  1T6C A;  1RTH A;  3CFO A;  4G1Q A;  3ZSX A;  4OX9 K;  1A5W A;  5AQP A;  4WFA L;  1EX4 A;  3OYF A;  1YVN A;  4AHC A;  4ZTF A;  3NVM A;  1NNE A;  3LDL A;  1HRH A;  4FJI A;  1YXQ A;  2BTF A;  4KI6 A;  2QWR A;  1K73 O;  5BRF A;  1RGI A;  1WSH A;  4CGD A;  2IVP A;  3THW B;  3CCV N;  4E1J A;  2Q1N A;  2PYJ A;  4H0V B;  4H5N A;  4KH6 A;  3J80 O;  4FCY A;  1QVG M;  1Q9X A;  2NUB A;  1BUP A;  2A42 A;  3K59 A;  1VSF A;  3JYT A;  4FVM A;  4HVJ A;  3NHG A;  4GKK K;  3KK7 A;  4HUG A;  2V7Z A;  3FZF A;  4B1W B;  4CZJ A;  4EHU A;  4O4G A;  2QXF A;  4IEE A;  3A8Y A;  1KQS M;  1ESV A;  2FBT A;  5AZI B;  1NBW A;  4GNI A;  3V81 A;  3ZEU B;  4KTZ A;  4QOZ B;  3KZB A;  3DRP A;  5AFU H;  4CK3 A;  4F9O A;  2P9N B;  4V19 S;  4DQR A;  1W9H A;  4F8R A;  4J2A A;  1WBB A;  3L2U A;  3VQ7 A;  4W5O A;  4FOE A;  4CD1 A;  5E26 A;  3QEW A;  2UUA K;  5EOY A;  4LY7 A;  4IJA A;  3WXJ A;  3T1H K;  1T44 A;  1TVR A;  4K41 A;  1VQL N;  2QM1 A;  3QO9 A;  5AQT A;  2GWK A;  3RSE A;  4CZI A;  1WAF A;  4QS7 A;  2YHY A;  4IOA L;  5J2P A;  1BDG A;  1CZ9 A; 
#chains in the Genus database with same CATH homology
 2F4V K;  4JI1 K;  4DR4 K;  4JI2 K;  4JI5 K;  4NXM K;  4LF7 K;  4DV2 K;  1IBM K;  4DR1 K;  4LF4 K;  2VQF K;  4B3S K;  3T1Y K;  4B3T K;  5LL6 Z;  4B3R K;  1IBL K;  4B3M K;  5LMN K;  1HNW K;  1HNZ K;  4DV3 K;  4AQY K;  5LMU K;  4OX9 K;  4X65 K;  5IT9 O;  2ZM6 K;  4LF8 K;  4DV0 K;  4X66 K;  3OTO K;  5IWA K;  2UUC K;  4KHP K;  3J7Y P;  4JV5 K;  4K0K K;  4JYA K;  2UXC K;  1IBK K;  4GKJ K;  2UXD K;  4DR7 K;  4LFC K;  1N32 K;  2UXB K;  4DV6 K;  3J80 O;  4NXN K;  1XMO K;  4JI7 K;  4GKK K;  2E5L K;  4LFB K;  4DR2 K;  3JAM O;  4YY3 K;  4CW7 B;  1N36 K;  1FJG K;  5A2Q O;  4LF9 K;  1I94 K;  4YHH K;  4DV1 K;  1XMQ K;  1HR0 K;  4LF6 K;  2HHH K;  5FLX O;  4DV7 K;  3J7A P;  4JI8 K;  4DUY K;  1XNR K;  1N34 K;  4V19 S;  4DR5 K;  4LF5 K;  3J81 O;  4JI6 K;  4DUZ K;  4DR3 K;  4X62 K;  1HNX K;  4LFA K;  2VQE K;  2UUA K;  4JI0 K;  1XNQ K;  4DV4 K;  4DR6 K;  2UU9 K;  4JI3 K;  3T1H K;  4X64 K;  1J5E K;  1N33 K;  5AJ3 K;  2UUB K;  4JI4 K;  4CVN E;  5BR8 K;  4DV5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...