4BROA

Legionella pneumophila ntpdase1 crystal form iv (part-open)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
351
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
total genus 110
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4broA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4broA02
2A5XA 1R59O 5B8HA 4JD2A 3W0LA 1NGHA 3UKRA 4BGAA 4JHDA 3QBXA 4IO8A 1ZXOA 5BRFA 1BO5O 3CQYA 3HTVA 4XH1A 3O4WA 1J6ZA 3VPZA 1BUPA 3IFRA 4CZJA 3VF4A 4BR0A 3FZFA 1NLVA 4IZ9A 5ADXH 4QS7A 3LDNA 1YXQA 3GDQA 1YVNA 2D0OA 3ENOA 5EX5A 2E1YA 4QS8A 1HUXA 4A62A 4IJNA 5AQMA 3GE1A 1NGFA 3DXMA 3QDKA 1QQNA 1DGKN 4H5RA 5AFUA 3L0QA 3JS6A 4ISEA 3H3NO 3J8AA 3VF6A 3C7NA 3WEEA 2ZWHA 1HKCA 2Q0UA 4BC4A 3H1VX 2DPNA 3MCPA 3U9DA 3VEOA 5FPEA 3DAWA 3ULEA 5AQYA 2EWSA 2QWOA 1HPMA 5AQZA 1C0FA 2CH5A 1GLEG 2A42A 4BC2A 1E4FT 1MWKA 3CIPA 5F1XA 3GG4A 3D2FA 1BDGA 1QHAA 4PL8A 5AQKA 4AM7A 4M7YA 3MN6A 2GUPA 4IWVA 2P9LA 1BG3A 2P9PB 2P9UA 4K43A 3P4IA 5KPZA 1ATNA 3ZEUB 3R8EA 5LJWA 2GWJA 1YUWA 1KAYA 5AQRA 3A5MC 1XQSC 2D0PA 3F9MA 4RCHA 4PKIA 1IJJA 4BRGA 3CJ7A 1JCGA 1GLCG 4BRFA 5LY3A 4BRLA 4GY2B 4BR5A 3O80A 3IUCA 4BG8A 1ESVA 2CGJA 1S22A 5JLHA 3LDLA 3AY9A 1DKGD 4ISGA 3VEWA 5FPDA 2ZF5O 3I33A 4NB4A 3ZETA 5KPRA 3QB0A 5AQVA 1NBWA 3C0BA 4HTLA 3RSEB 3FR0A 2QWMA 4CJ7A 2P9IA 3DJCA 2A40A 2QWLA 3QFUA 1ZBSA 4WQ4C 5KQDA 5E84A 4FWKA 4FWSA 3QBWA 3R6MA 2I7NA 3MN5A 4Y0WA 5EOYA 2A41A 5AQXA 1GLFO 3CHWA 5ELZA 2D1KA 3CQXA 4CBXA 3O08A 1NGCA 5F2RA 3H6EA 3LM2A 4QS9A 4EHTA 2FF6A 3VGLA 1NM1A 2BTFA 3D2EB 2PBDA 3MK6A 3DWLA 5BPNA 5JICA 3ID8A 2D4WA 3U9ZA 3EKUA 4B1ZA 4FWRA 1NWKA 4FWQA 4K25A 3MDQA 3LDOA 4FSVA 5AQNA 5AZIA 3VERA 3WUHA 1SQKA 4IXCA 1MDUB 1U6ZA 2V52B 5JMVA 4CZHA 4BQZA 2IVOA 1NGAA 5TKYA 1TYQA 4BRPA 3WXKA 4BC5A 4MLHA 5AQIA 4A61A 3DXMB 4WQ5C 1NGIA 2ASMA 2ASOA 3LL3A 3ZX3A 5AQWA 3ATUA 3QMLA 5AQTA 2E2NA 3WXIA 4DCHA 5AR0A 3VEZA 3TU5A 3SJHA 4EAHD 3DXKB 5KQ8A 3UKUA 3IMXA 1CZAN 4CBWA 3JXUA 2CGKA 5AQLA 5I9EB 3W3DA 1V4SA 5AQFA 1LOTB 4AM6A 5BRDA 2P9KB 4CZGA 2Q97A 3VEVA 2NZTA 4FOEA 1GLDG 4EFHA 1E4GT 5AQOA 3A0IX 4H0PA 4BRCA 4Z94A 2GEMA 1G99A 2H3GX 3H1QA 3KZBA 2P9SB 5AFUH 4J8FA 4BRQA 1ATRA 4H5NA 4H0TB 4BRMA 1XUPO 2YCHA 2ASPA 5AZJB 4JNEA 1OKJA 5FPMA 4FWOA 2E1ZA 4XH4A 3D7EO 3CJAA 3VF2A 5BN8A 5BRHA 1C0GA 1Y64A 2W40A 3CETA 1WOQA 1X3MA 4CZMA 3SMSA 4H5WA 3VEXA 2YHWA 1NGGA 4MO5A 2V7YA 1U2VB 4B1UB 1LCUA 1Z05A 2F9WA 3H3OB 3G25A 1XC3A 1TUUA 4GNIA 1K8KB 3LDQA 1SAZA 4H0OA 3FFKB 1QQOA 4DB3A 3ATVA 2KHOA 4BR9A 2Q0RA 4CBUA 3GL1A 4BR2A 4FPAA 3FZKA 4XH5A 4C23A 4WYBA 4CZLA 1ZC6A 2QWNA 2YHYA 3BF3A 2HF3A 3A5LC 4H0XB 2BUPA 3UB5A 3SLCA 1EQYA 3HSCA 1QZ6A 4B1VA 3BF1A 4H0VB 2P9NB 2P9PA 3O8MA 1BA0A 4PL7A 4FL9A 4H03B 1BU6O 4O5FA 3EN9A 3O1WA 3ZEUA 5FPNA 2HF4A 3O5BA 2AP1A 2A6AA 3AAPA 5KPTA 4CZIA 3B8AX 4I6MA 5AQQA 2UYTA 2E2QA 2E2PA 3A5NC 3ZX2A 1X3NA 1NGBA 2VWBA 3EZWA 3M1FA 4JD2B 4A2BA 4BRNA 3UKRB 4K42A 3VGMA 3FZMA 3OHRA 4JHDB 3QFPA 4BRIA 1GLLO 3R9PA 4M63C 3WQTA 4BRAA 4CI6A 2QWRA 2ZGZA 3RSEA 1YAGA 3MMVA 4YDUA 3HBTA 1TUYA 2IVPA 1GLAG 1BOTO 5AQPA 4BVPA 2Q1NA 2GELA 4DHYA 2QXLA 3M6GA 5BR9A 3H45C 3A5OC 5AQJA 4BVOA 5BPMA 1HX1A 3UE5A 4FPBA 1WUAA 4B1YB 3KHYA 3CI5A 4LC9B 1Z6RA 1V4TA 3O6WA 1X9JA 3D2EA 1BA1A 2Q36A 3GBTA 4IJAA 1RDWX 3C7NB 4FO0A 3WEEB 2CGLA 2QW9A 1P8ZA 1HKBA 5BN9A 4B1WB 3CERA 4CZFA 5ADXA 4RWTA 3MN7A 3ULEB 1NMDA 4BR7A 3M3ZA 4ISFA 2A3ZA 1ATSA 4M7XA 3FLCO 4MLEA 3AARA 2V51B 1MWMA 1KAZA 2PAVA 4PKGA 3HI0A 3D2FB 4H5TA 1QZ5A 3U8XA 3VENA 4WQ5A 3WXJA 4EIAA 1QQMA 4F9OA 2Q2RA 2GTDA 2P9LB 2V7ZA 2P9UB 4BRDA 4BREA 5BPLA 2ZGYA 3LM9A 2YJEA 4H5VA 2FF3B 1T6CA 2FSJA 3CJCA 4HWIA 5BREA 2Q31A 5AQUA 2QM1A 2YJFA 4A2AA 3I8BA 5JLFA 2F9TA 3DXKA 1GLBG 3VOVA 2IVNA 1NGEA 3L4IA 5F0XA 2FSNA 1RGIA 1JCFA 3ZX0A 2HOEA 3FGUA 4MO4A 4FWNA 4BRKA 5CE3A 2E88A 2P9KA 2FLOA 3VGKA 3ENHA 4KBOA 3KVGA 4BQLA 1S3XA 1KAXA 3U4LA 4RTFD 4BG9A 3ZETB 3WT0A 3BP8A 3WXLA 2QWQA 2OANA 2HMPA 2NRHA 3SMPA 3H46O 3EL2A 2P9IB 1NGDA 1T44A 5EVZA 2P9SA 3O1BA 3QICA 1HJOA 2YI1A 3BEXA 5AZJA 3LDPA 4K41A 2FSKA 2WUSA 4BGBA 4CD1A 4FOIA 1JCEA 1H1VA 2E20A 1BWFO 4EHUA 4CD3A 3IDHA 2CH6A 4JAXA 1Q18A 2YHXA 2IIRA 4NO7A 2GWKA 4I6MB 3VETA 4CZKA 4O8KA 4FWLA 5EXWA 5EY4A 3L6QA 3BUZB 1NGJA 5AQGA 1U2VA 3HM8A 3EO3A 1DEJA 2NLXA 3FZLA 3HZ6A 3WQUA 3VEYA 2W41A 2J4RA 3MN9A 5E26A 4E1JA 1SZ2A 1K8KA 5AZIB 1MA9B 2E2OA 1T6DA 4B1XB 4BC3A 3CJ9A 1RFQA 4XEIA 3TPQA 3EKSA 4JN4A 1IG8A 4BR4A 1D4XA 3GOIA 1TYQB 4WQ4A 2E8AA 4BROA 4BRHA 2VCPA 4PKHA 4B9QA 4FWPA 3SK3A 4YDUC 3A8YA 1KXPA 3S41A 3FZHA 3AAQA 2VYPA 4FWMA 3CJBA 2QWPA 2FXUA 4DQ8A 1GLJO 2AA4A 2P9NA 1HKGA 5AQSA 3VESA 3UKUB 4L3QA 2I7PA 2ITMA 3CJ1A 5AQHA 5LJVA 4CZEA 1HLUA 4H0YB 3FE1A
chains in the Genus database with same CATH superfamily
4GV9A 1R59O 1NKCA 5B8HA 3VA3A 4JD2A 3OW2M 1J5OA 1K6YA 3NFAA 3HTVA 1J6ZA 1ASUA 1BUPA 2IOCA 3HRGA 2ZE2A 4OKEA 3IFRA 1TL1A 4OPAA 4CZJA 5C10A 3FZFA 4JLHA 1QTMA 4QS7A 3LWMA 2HBKA 4FK2A 1YVNA 4FCYA 2X6NA 3ENOA 3C6HA 1YJNN 1KC8O 2VG5A 1C0MA 3GE1A 4MFBA 4GKJK 2X74A 1NGFA 3DXMA 4GV6A 1DGKN 1VK0A 5KI6A 1JLFA 5AFUA 2Z1GA 3KK2A 4CK2A 5FPEA 2NRWA 4AHRA 3ULEA 5AQYA 2EWSA 3WNGA 1HPMA 2CH5A 1GLEG 2A42A 4CJVA 3CIPA 4CJKA 4IOAL 3GG4A 5C2DA 4CJWA 3LP3A 4IKFA 4ICLA 1TAUA 1A5VA 2HBJA 1JLQA 1BG3A 2P9PB 2PZSA 5J2PA 4U67L 5LJWA 3PLAA 3U3GA 2F8SA 4BRGA 1RT2A 2ZJQL 4C8NA 1GLCG 4Z4EA 1FXXA 4BR5A 2GBZA 1SL2A 3AVHA 3Q7CA 4BG8A 2DFFA 2HHVA 3KIOA 1DKGD 5GIOA 4R5PA 3VEWA 4LF7K 1S72N 4ILGB 2OCEA 3OYLA 3OTOK 2VQFK 2A1SA 3ZSRA 3T19A 4OGCA 4DR4K 2P9IA 5T7BA 1CXUA 3DJCA 4JKGB 5CYMA 1RT5A 4FWKA 3TAQA 4DR3K 1WSIA 3R6MA 5HP1A 4Y0WA 1VQ6N 1X9MA 2A41A 1J54A 1C6VA 4AH9A 4KAZA 4FLVA 4IG0A 3VQEA 4M3WA 5HL7L 3SQ4A 1SV5A 3H6EA 3LM2A 4OVLA 2FF6A 2BE2A 2G8IA 1NM1A 2BTFA 1HYZA 3C6AA 3D2EB 3MEDA 1TVRA 5BPNA 4B08A 3THYA 2D4WA 3U9ZA 3EKUA 1NWKA 4M3TA 3K9KA 4RW4A 4K25A 3MDQA 4DQPA 4DTXA 2NNWA 3FFIA 3TSUA 4IEIA 4QCLA 4NYFA 3ISNC 3EE8A 1L5UA 5JVHL 1Q9YA 4NCAA 3TSPA 1TYQA 1VQKN 3Q7BA 4MLHA 1VSLA 4WE1A 5AQIA 4A61A 4FYDA 2ASMA 3UIQA 3LL3A 1VAZA 3CCSN 3THXA 5AR0A 3TU5A 4DUYK 4IEEA 3DXKB 1U48A 3UKUA 3IMXA 1DLOA 1LOTB 2P9KB 4JI4K 4FOEA 1GLDG 4EFHA 4GKKK 1IKXA 4ZTJA 4FXDA 4KHNA 4Z94A 4IBNA 5D3GA 1JLAA 3A2FA 2GEMA 1L3UA 1S1TA 3PIPL 2P9SB 2WONA 2QKBA 1ATRA 4H5NA 4DSKA 4H0TB 2YCHA 4DQRA 3ZCMA 3AO4A 4XH4A 4DSFA 3K5LA 5BN8A 1R0AA 2X78A 3NGYA 5FDLA 3NHGA 4BACA 4FJLA 1S6PA 3MEEA 3VQ6A 3O3HA 2F8TA 3LPUA 4MO5A 3OJUA 2QEXN 4DR2K 2V7YA 1TAQA 4F2SA 1EXQA 4DLEA 3ZT0A 4CEAA 1TUUA 4FLYA 3CC4N 1VRTA 3L2QA 2WTUA 2QA4N 4FLUA 1VQLN 3ZT4A 4BR9A 4WFBL 1W0HA 2Q3SA 3GL1A 4XH5A 4WYBA 4CZLA 1ZC6A 2HBMA 1K8AO 2YHYA 4C8LA 1ITGA 4H4MA 3WNEA 4A57A 3VQPA 4DSIA 3OBWA 1TK0A 3BF1A 4H0VB 3AVAA 3SUOA 1YF5L 2P9PA 3T3FA 3TSQA 3QESA 4AILC 2OPRA 4Q0BA 3L3UA 1JLEA 1SKRA 4B9LA 2HB5A 4JS5A 1IH7A 3NBPA 2QXFA 3E9LA 3HSTB 2E2QA 3EZWA 2VWBA 2VG7A 5J2QA 4MDBA 4K42A 3OYNA 3OHRA 3NVMA 4BRIA 3I56N 3CF5L 3QO9A 3R9PA 3ITHA 2D0CA 1HNWK 2O4IA 4KFBA 3I55N 4YDUA 3DMJA 3HJFA 1D9DA 2IVPA 2AJQA 2BGGA 1YJ9N 1BOTO 4KI4A 5IT9O 1SUQA 4ELTA 2G8KA 5J2NA 2NRVA 3H45C 4B9MA 4DU1A 4FZZA 3CPWM 1BCMA 3V1RA 5KRSA 2XO7A 1ZBUA 3THVA 2O8EB 4NYNA 1HPZA 3CI5A 1NK9A 1V4TA 4OX9K 3CG7A 3V9XA 3ZYYX 3D2EA 3NDKA 3L2UA 1RDWX 4FO0A 2HVIA 2CGLA 1JXEA 4B3SK 4E19A 1X1PA 4CZFA 4RWTA 4CIFA 4BWJA 3CCQN 3SQ2A 4M7XA 1EX4A 4FVMA 4M3XA 3AARA 1XWLA 3BZCA 3TTFA 1KTQA 4O4GA 3CM5A 4HUEA 4H5TA 3VENA 3WXJA 3AO5A 2HSTA 4JV5K 4RW8A 2P9LB 2V7ZA 2E4LA 3PO5A 4BREA 5BPLA 4JI1K 3OYFA 2OTLN 2DFEA 4HWIA 2FF3B 1HNZK 1RDDA 5BREA 1KVBA 4YY3K 1NNEA 3DXKA 2JWKA 3MXJA 1RT1A 2FSNA 1JCFA 1W97L 2HOEA 1CZBA 4BRKA 5M1QA 2P9KA 1RT7A 4HUGA 4KBOA 4O5BA 1SS6A 3P38A 4HUFA 1YTAA 1VSHA 3ZETB 3D45A 3BP8A 3HP9A 1TKTA 3SMPA 2NRHA 2OANA 3V1QA 3DRSA 3H46O 2LSNA 4AF1A 1HQEA 3EL2A 4YOYA 1LV5A 4FJGA 1T44A 4FM1A 2P9SA 1QSLA 1YVUA 4R79A 3OYIA 2G8VA 3KKSA 2UXBK 4CD1A 2VWKA 1BISA 3NF7A 4PA1A 2KLAA 5HLFA 3IDHA 2OZMA 4CHNA 3TTCA 4I6MB 4OPKA 1D8YA 3ZSZA 4JKCA 5EY4A 3L6QA 4Z4CA 1NGJA 3HM8A 3KLIA 3WQUA 2E6LA 4E1JA 1SL1A 1JXBA 1MA9B 3SPZA 1SKSA 4BC3A 4CJ5A 4MDAA 4CJTA 1BIUA 3KLGA 4FJ7A 4BE0A 3HK2A 4N56A 4O8UA 4I2QA 2HNZA 4FLXA 4OKKA 3IAYA 4PKHA 4LH5A 4KRFA 4FWPA 3SK3A 3A8YA 1KXPA 1BQMA 2PYJA 1UA1A 4A5BA 3AAQA 3AGKA 4FWMA 3K59A 2AA4A 2Z1JA 4OO1J 1HKGA 1NJZA 4Y1CA 5I42A 5AJ3K 1Q86O 2ITMA 1WNSA 1O13A 1JLCA 4CK3A 4CZEA 2ZJPL 4H0YB 2A5XA 3CCEN 4C8KA 2VG6A 4DF4A 2HNYA 3SYZA 3LZIA 3W0LA 4WCEL 1NK8A 4BGAA 4DTOA 5A2QO 1BIZA 5BRFA 3SV4A 1WBBA 3CQYA 3MEGA 1T7PA 4E0DA 1A5WA 2XY8A 5ADXH 5CY4A 1DT9A 2QI2A 1RTJA 1EP4A 2RKIA 4JYAK 2F7TA 3K2PA 3THWB 1NK6A 2IAJA 2RE2A 4JKHA 4IJNA 1KCFA 3QDKA 2O8EA 1VSIA 3L0QA 3JS6A 1F21A 1LWFA 3J8AA 3VF6A 4DF8A 4LSLA 2Q0UA 3F9KA 5C24A 2DPNA 4O55A 3MCPA 3ZSYA 2QWOA 2O8CB 3HVRA 4JI3K 3RTVA 4E7HA 5AQZA 1C0FA 1DTQA 4DR6K 4BC2A 1E4FT 1VHXA 1S1UA 4CF8A 3AA2A 4PL8A 4KHYA 5AQKA 4ELUA 4M7YA 1FKPA 5KTQA 3C6TA 4N41A 1CXQA 4K8ZA 4IWVA 2P9LA 3CFOA 1EETA 5C42A 3DRPA 4K43A 4M41A 1W2BM 1ATNA 2QKKA 1XC9A 3R8EA 2GWJA 5AQRA 3A5MC 2D0PA 3TR8A 3DI6A 4PKIA 3CJ7A 1JCGA 3ID6A 4BRFA 2BANA 2RN2A 1NU0A 3IKMA 1SKWA 5JLHA 4I2PA 4DWIA 2ZF5O 1FJGK 1RBRA 5KPRA 3ZETA 2Z1IA 3SBGA 3LWLA 2QWMA 4X66K 3L4QA 3SAFA 1KSPA 2QWLA 2KKZA 2P51A 4WFNL 5KQDA 3R1XA 3QBWA 3RMBA 3MN5A 1VQ4N 2HVHA 3TARA 3G10A 2UU9K 4FJ8A 2EHGA 3PUFA 1C1CA 1GOAA 5HRNA 3LP1A 4KI6A 1O1WA 3VQQA 5GAGP 3AVGA 1RBSA 4ELVA 2DTUA 3SBTA 3IG1A 2JGUA 4DV1K 1OH5A 3EE9A 3ID8A 3OYBA 4Z4FA 1KRPA 1T03A 4M3YA 1IKWA 3NAEA 4B8AB 1KVAA 3OS2A 4FJNA 1YHQN 5JMVA 5J2MA 4CZHA 2B5JA 1BI4B 5TKYA 1NMNA 1NJYA 1WBDA 4OPHA 1Q9XA 3IS9A 1XI1A 3CC7N 2G8FA 3I0SA 2NRTA 3E9PA 3ENBA 3M8SA 5AQWA 4Q5VA 1HJRA 3VEZA 4CEBA 3ALYA 3JXUA 5AQLA 5I9EB 3W3DA 2ZD1A 5AQFA 1IKYA 5BRDA 2HHTA 2NZTA 3K57A 1E4GT 1UOCA 3T69A 4BRCA 4FM0A 1G99A 4CIEA 2OTJN 3H1QA 3VQ5A 3LALA 4KTWA 1UWBA 3QEIA 5AZJB 4FWOA 3J7ZO 3VF2A 4CFCA 1LW2A 3ZSQA 1X3MA 4CZMA 4G9ZA 3OYKA 1C1BA 4JK7A 4GV3A 2E6MA 5GIPA 2YHWA 3AVBA 4KB0A 2HBLA 3J80O 3VQ8A 4PQUA 4FJMA 2ATQA 4CJ4A 1J9AA 3PV8A 1RBVA 3DOKA 3LDQA 1YITN 2IDOA 3FFKB 3SV3A 1B9FA 2O8CA 4CGGA 4BR2A 3FZKA 1RDAA 1QVFM 4OGEA 3AO2A 2QWNA 2ETJA 2HF3A 3UB5A 2BUPA 3G6EN 1VSMA 3SLCA 4ILJA 1RTDA 1EWRA 3WXMB 2YV0X 2KFZA 2P9NB 4E1NA 1BA0A 4PL7A 4FL9A 2I5JA 5M1OA 1BU6O 2GX9A 3O5BA 3SAGA 1S9EA 4CGHA 3SCXA 1GOCA 1QQCA 2YHBA 1JL1A 4CZIA 1NJXA 3KD5E 3V9ZA 3SAHA 2UYTA 3CCVN 4E7IA 1NJIO 1JLGA 5FRNA 1X3NA 3M1FA 4I9QA 4BRNA 3EEQA 5LMUK 5CYQA 3PIOL 1N36K 1S1XA 4F8RA 3QFPA 4CJSA 4DFMA 1P90A 4M63C 3RMAA 3O4QA 1C0TA 3TWHA 4J2EA 2ZGZA 5MLCQ 3HBTA 1B9DA 3CCLN 4L8RB 4IDHA 2Q1NA 3NH2A 2QXLA 1CLQA 3KTQA 4WFAL 4BVOA 4DFJA 4F3TA 1HX1A 1XHXA 4FJJA 2KFNA 3KD1E 3ZSOA 2OA8A 2ZJRL 3CFPA 1X9JA 3S3OA 4C8OA 4B3MK 3WEEB 3TANA 4KHPK 4B1WB 5BN9A 3CERA 4GW6A 4ISFA 4B3TK 3O4NA 2V51B 1QS4A 1MWMA 3AVKA 1KAZA 3K5MA 2PAVA 4PKGA 3HI0A 4AQYK 3NF8A 3D2FB 4FJ5A 3HT3A 4DTJA 1RT4A 4WQ5A 1QQMA 4LFCK 1BI4A 5FRMA 2Q2RA 1KLNA 2GTDA 4CF2A 3LDSA 1OVYA 3E9OA 2P9UB 1QHTA 5GAHP 3CCRN 2ZGYA 2YJEA 3CJCA 3P83D 2BDPA 4XIUA 4IFVA 4KPYA 4A2AA 4UQGA 1S5JA 3QLHA 1TKZA 4Z4IA 1G15A 3K5NA 1GLBG 3CD6N 2IVNA 1NGEA 3L4IA 1RGIA 3P31A 4JKFA 4AHTA 4DS5A 1SL0A 4BDPA 3DOLA 4MO4A 3FGUA 4CJQA 2OYQA 5FROA 3AGRA 2FLOA 3VGKA 4N5SA 1IO2A 4I9LA 3KVGA 4X62K 3U4LA 4RTFD 4BG9A 3SI6A 3WXLA 4DTPA 2HMPA 3ASMA 4BDZA 3QERA 3QICA 4EP5A 4YOVA 3SNNA 5HOOA 3KLFA 1WSHA 1L3SA 5AZJA 3D6RA 4K41A 1ZBIA 2FSKA 4BGBA 2Y1IA 1JCEA 4YOUA 1H1VA 3EY1A 4FLTA 3DLBA 4KHQA 3AA5X 4JAXA 4N76A 4NO7A 1X9WA 1WB9A 3VQDA 4FWLA 4CGDA 2VGNA 3PO4A 2DFHA 3LANA 3FZLA 2W41A 1IBMK 2J4RA 3MN9A 5E26A 4KH5A 4FK0A 5AZIB 2E2OA 1VQPN 4B3RK 3MX5A 4B1XB 4JN4A 1IG8A 3GOIA 4FJ9A 1RBTA 2E8AA 3ULDA 2VCPA 2Y1JA 4FM2A 4FLWA 3CMEN 3CJBA 3V9SA 4JKGA 4N47A 2FXUA 3M8QA 1GOBA 2P9NA 3WNFA 3ZT3A 1RT3A 1NK0A 1VSJA 5HBMA 4CHQA 2DY4A 1U04A 3PY8A 1VQ5N 5J1EA 3FE1A 4O44A 4Z0UA 3NH0A 3KWIA 1BO5O 4XH1A 1IBKK 2VGMA 3RMDA 3QNOA 1XMOK 1NLVA 4YNQA 4OPJA 4CJPA 3S3NA 3LDNA 3F2KA 3DLKA 3QEPA 4FZYA 2D0OA 4BWMA 1OH7A 5EX5A 2E1YA 3QINA 3SPYA 1HUXA 2Z1HA 4DTMA 1RILA 1KFDA 3QETA 1QQNA 4FLZA 4LD0A 2WOMA 1WSJA 1VQ7N 1XMQK 4ISEA 3H3NO 2JLEA 2GUIA 4M45A 3WEEA 2ZWHA 1NKBA 1S1WA 4MQ3A 4BC4A 3H1VX 3VEOA 2FC0A 3SUNA 4LF9K 2D5RA 3CFRA 3AVNA 3AO1A 3LAKA 4BDYA 3RR7A 3D2FA 1BDGA 4KKOA 3HL8A 4AM7A 3MXMA 4CEOA 2X6SA 1BL3A 3V4IA 2P9UA 4DSEA 2A1RA 4F3OA 2YX6A 3P4IA 4DV7K 3L8BA 1VQ8N 3ZEUB 4DV2K 2YKNA 1YUWA 1XQSC 4RCHA 3F9MA 1I39A 2VQEK 4BRLA 3MCAB 4B9UA 4I7FA 3PX0A 3SUQA 4ZHRA 3OYJA 3LDLA 4ISGA 4PHTX 4BE1A 5FPDA 3T1HK 5JS2A 3QB0A 5HRPA 3C0BA 3RSEB 3FR0A 4CJ7A 4U7BA 5IWAK 1NOYA 2A40A 1ZBSA 4NLBA 1YTUA 3BGRA 4CVNE 2QTDA 4TSXA 1TV6A 3AVFA 3G0ZA 5EOYA 3HVTA 4CEDA 4CHPA 1BGXT 4KHUA 1XNQK 1VSFA 5AQXA 1GLFO 2XY5A 2XRIA 3MXIA 4FJKA 5ELZA 2D1KA 3CQXA 4JKAA 2R7YA 1NGCA 3F5TA 4CIGA 4BY9C 3EZ5A 4EHTA 1KVCA 4DS4A 2ZQBA 3OA9A 2KZZA 3MK6A 3DWLA 1D5AA 1JJ2M 3VTHA 2D0AA 3S3MA 4FWRA 1U4BA 4FWQA 3C6UA 3NVKA 5TKWA 5AZIA 4DU3A 2HHSA 3VERA 4M3ZA 2G8HA 2RF2A 1SQKA 4H4OA 1MDUB 2KW4A 3CCUN 5JS1A 2IVOA 1NGAA 3WNHA 3OYEA 1S9GA 3E1YA 3WXKA 4BC5A 2KTQA 4DG1A 1RTIA 3DXMB 4WQ5C 3O9SA 3ZX3A 3ATUA 4ID1A 1LWCA 3QMLA 5AQTA 2E2NA 3WXIA 4DCHA 1VSEA 4DFPA 3SJHA 4EAHD 1YJWN 1U49A 1BCOA 1CZAN 4CBWA 2CGKA 1BHLA 2OPQA 1V4SA 3VN5A 3L2RA 3AV9A 2PYLA 5GINA 3C65A 3BY5A 3NCIA 4JK9A 3CYMA 3H08A 3A0IX 4HTUA 4DR5K 2QK9A 4PWDA 4ID5A 3SUPA 4DKWA 5AFUH 4J8FA 4QOZB 4BRQA 3KK3A 1MU2A 3DYAA 1XUPO 1L3VA 2ASPA 1W7AA 4JNEA 1OKJA 1OVQA 4JRPA 3CXCM 3D7EO 3CJAA 1TK8A 1E3MA 1ASVA 2YKMA 1C0GA 3V1OA 1D9FA 3CETA 4LF5K 4KH6A 3VEXA 3QEVA 4CESA 3KWGA 5HROA 3SQ1A 1U2VB 4O0JA 4E89A 3ZT1A 1Z05A 2W42A 1K8KB 4KH4A 5HRSA 4M3RA 3DLHA 4CFDA 4EZ9A 3LP2A 4NCGA 1WLJA 1QQOA 3OYGA 3ATVA 4JEPA 3C94A 1REVA 4CFBA 1RBUA 3KLHA 3JSMA 3VTIA 4CBUA 4HCBA 4C23A 3BF3A 4W5OA 5DK5A 4OLBA 1IV0A 2JWLA 3HOTA 1QZ6A 1RTHA 4B1VA 3B6PA 4B9VA 1ASWA 4JI2K 4AHUA 4IG3A 3OVNA 4CGJA 4CERA 4O5FA 3EN9A 3O1WA 3ZEUA 1X9SA 2HF4A 4IOXA 2AP1A 3OYHA 4JI6K 2A6AA 3CPEA 1VQON 3B6OA 4C1NK 3B8AX 4I6MA 4A5AA 3PX4A 5AQQA 2E2PA 3KJVA 3ZX2A 1NGBA 5M1KA 1J53A 4DSLA 3UKRB 3VGMA 3FZMA 4JHDB 4CE9A 3CCJN 4OKJA 1C0UA 1HMVA 3WQTA 4BRAA 3G4SN 3RSEA 2XY7A 5K14A 4E1MA 1T3VA 1HNVA 1TUYA 5GAEP 3NH1A 1GLAG 3ZT2A 4JI7K 5AQPA 1KFSA 4BVPA 3E66A 4YFUA 2GELA 4DHYA 3O9RA 3M6GA 5CR4A 3M5RA 4K8XA 4Y1DA 1RDBA 3MWPA 3DRRA 5CZ1A 3V6DA 3UE5A 4FPBA 4DQSA 1WUAA 2O8DB 3M8RA 4B1YB 4PUOA 3P5JA 3KHYA 4LC9B 4CEEA 3O6WA 2Q36A 3GBTA 4IJAA 3C7NB 2QW9A 1P8ZA 5ADXA 1ZBLA 4BR7A 3M3ZA 1WSGA 3QNNA 4MLEA 1HYVA 4JKBA 5SZTA 2IS3A 1U45A 1YT3A 3NGIA 2PFUA 1QZ5A 4EIAA 4F9OA 3HPHA 4FK4A 4UY8O 1TGOA 3KK1A 3K9JA 4BRDA 4B9TA 2FBYA 4FZXC 3LM9A 1W9HA 3DLRA 1T6CA 3SJJA 3T1YK 4M3UA 2QM1A 5M1NA 2GV9A 5C12A 3I8BA 1NK7A 4CJLA 5JLFA 2F9TA 4CEZA 3VOVA 3THWA 3J7AP 4OJRA 1JKHA 2WFBA 3AA3A 2W6KA 3P39A 1T05A 4FWNA 3VQ4A 4HVJA 3ENHA 3OYCA 4BQLA 1KAXA 2QWQA 4AHCA 1YIJN 3SQ0A 4J2BA 3CMAN 1NGDA 3NF9A 2WBNA 1A5XA 3O1BA 4DTSA 1JL2A 3AVIA 2WUSA 3N4PA 4YHHK 2HNDA 4DV5K 3ZSVA 3HPOA 2E20A 1BWFO 3TAMA 3DLEA 3TABA 5DMRA 4E7LA 4RW9A 4EHUA 4CJUA 4CD3A 1FKOA 1Q18A 4CGFA 2IIRA 3VETA 4CZKA 4O8KA 2UUAK 2ZM6K 3TI0A 5DM6L 1QSYA 3BUZB 4IFYA 4X65K 5AQGA 1U2VA 3EO3A 3G71N 1DEJA 2NLXA 5LMNK 3HZ6A 3EYZA 3VEYA 3AVLA 1K73O 4YOWA 1SZ2A 1K8KA 3HO1A 4B9SA 1T6DA 1OH8A 3C95A 1QE1A 2NRZA 4XEIA 4CJEA 5DM7L 3NGZA 4DUZK 2ITGA 4BR4A 4JI8K 3CQ8A 4KHSA 3R3LA 1HNIA 4BROA 3CM6A 4BRHA 4DV4K 3VQAA 4B9QA 3CCMN 1VQ9N 3FZHA 3KKRA 4LFBK 3L3VA 4F2RA 3K58A 3KLEA 2F96A 4DQ8A 2PY5A 3VESA 3OYAA 3QEWA 2D0BA 3CJ1A 5AQHA 4B8CA 5LJVA 3ZLJA 3MWTA 4CJRA 1HLUA 3K0SA 1HRHA 4CHOA 4GMJB 1TL3A 3O3GA 2HHHK 3HM9A 2HHUA 1NGHA 3UKRA 4JHDA 3QBXA 2O4GA 1ZXOA 4IO8A 3VPZA 3O4WA 1L3TA 4W5QA 5HRRA 3VF4A 1EKEA 4BR0A 4IZ9A 3QIOA 1VQNN 3HP6A 2YNGA 1YXQA 2HW3A 3GDQA 1IKVA 1M1KO 4CEQA 4QS8A 1K9MO 3VMFB 4DV6K 1HR0K 3M8PA 1FK9A 5H1SQ 1Z26A 4A62A 2FBVA 5AQMA 2O8DA 3D0PA 2NRRA 4CECA 4H5RA 4F4KA 4DQQA 1KD1O 4PY5A 4CW7B 5CZ2A 4CFAA 5M1PA 3DLGA 3C7NA 1HKCA 2YNFA 3U9DA 3DAWA 3U3YA 1NK5A 1S1VA 4E7JA 1IBLK 1WAJA 1MWKA 4WF9L 5F1XA 5FLXO 1QHAA 3CC2N 4DR7K 3MN6A 3LP0A 1VSKA 4LF8K 4IFEA 2IC3A 2GUPA 4CJ3A 3J81O 5KPZA 4KO0A 4BE2A 3QIPA 4M42A 4DLGA 1KAYA 1IJJA 5LY3A 1ILYA 4GY2B 3O80A 3IUCA 2HMIA 1ESVA 2CGJA 2UXCK 1S22A 3U6FA 1RNHA 4DU4A 3AY9A 3KK7A 4ILHA 4CF0A 1OH6A 1N5YA 3I33A 4NB4A 1U47A 5AQVA 1NBWA 4HTLA 2XY6A 4JI5K 3S9HA 3VQ9A 4W5RA 1NKEA 5C0YA 4NXMK 1J5EK 3QFUA 3VA0A 2P5OA 3BZKA 2E5LK 4WQ4C 1ZYQA 4JK8A 5E84A 4FWSA 4EP4A 2UUCK 3I0RA 4J2AA 2I7NA 4B3OA 1UA0A 2O8BB 4KV8A 3TAEA 3CHWA 4FJXA 1B92A 4G1QA 4CBXA 2F4VK 3O08A 5F2RA 4QS9A 3VGLA 2PBDA 4YOXA 5JICA 4RW6A 4DTNA 2IGIA 3O9TA 4B1ZA 4JKDA 3PSFA 2XHBA 2KZMA 3LDOA 3J7YP 3PX6A 4FSVA 5AQNA 1VRUA 1QSSA 3WUHA 1IG9A 4IXCA 1TK5A 1RDCA 1U6ZA 2V52B 1LAWA 3JAMO 4BQZA 2W6LA 4KTQA 1ZBFA 3TTDA 2FBXA 4BRPA 4GVEA 4JI0K 4JKEA 4FJIA 3HYFA 4QAGA 1N6QA 5EU7A 1NGIA 2ASOA 4CF1A 3QEXA 4NLCA 5KQ8A 4DMNA 2RPIA 2P5GA 5GADP 1I94K 4AM6A 3O3FA 3AVMA 4CZGA 2Q97A 4DFKA 3VEVA 4KHWA 5AQOA 5C2FA 4RW7A 1RT6A 4H0PA 1DTTA 1CZ9A 4FW1A 4YOTA 3T1AA 2B4JA 2H3GX 3KZBA 4DSJA 5JVGL 3DLLL 2YNIA 1Q81O 4BRMA 5FPMA 1NOZA 1M90O 2E1ZA 4LSNA 1QVGM 4B9NA 1N32K 4RG8A 5BRHA 2EX3A 1Y64A 2W40A 1WOQA 3TAPA 3SMSA 4DTRA 4H5WA 1XNRK 4W5NA 1NGGA 3AVJA 1VQMN 3OS1A 4DTUA 4B1UB 1LCUA 5LL6Z 2F9WA 3H3OB 1UAXA 3G25A 3JYTA 4X64K 1NK4A 1LWEA 5BR8K 1XC3A 4GNIA 5CHIA 3AO3A 1ZBHA 3F73A 1SAZA 4H0OA 4CHZA 4DB3A 5SWMA 1S6QA 2KHOA 4KB1A 5M1FA 2Q0RA 3DM2A 4FPAA 5KGWA 2G8WA 5C15A 1I3AA 3N4QA 4FVUA 4H0XB 3A5LC 1EQYA 3HSCA 4EZ6A 2FBTA 2O8FB 4OLAA 3OYDA 3O8MA 1RDUA 4H03B 4CK1A 1WAFA 5C25A 3LPTA 5FPNA 4AHSA 3E01A 3V81A 4C1NI 3AAPA 5KPTA 1TKXA 4KTZA 5KRTA 3A5NC 4CI6A 1VSDA 4JD2B 2P1JA 4A2BA 4HHTA 1LAVA 4J2DA 1GLLO 4LF6K 4DV0K 2NUBA 3VQCA 2QWRA 4E3SA 3BDPA 2HHQA 1YAGA 3K5OA 2G8UA 3MMVA 3RMCA 3LAMA 4IO9L 4LH4A 3ZSWA 4NCBA 3SZ2A 4AHVA 3HOSA 4CCHA 4JRQA 2KQ2A 2O8BA 5BR9A 3RVCA 1EWQA 1C1AA 3A5OC 5AQJA 5BPMA 4Z4HA 4CHYA 3OY9A 2OPPA 1N8RO 1Z6RA 1NJWA 1JLBA 4O0IA 1BA1A 4CEFA 3MECA 3P1GA 2OPSA 1WSFA 4CGIA 1HKBA 1WSEA 5KGXA 3MN7A 3ULEB 1NMDA 2A3ZA 1ATSA 3FLCO 4FJHA 3MX2A 4YORA 1Q8IA 3O9QA 1N34K 1NG9A 3U8XA 3V9WA 4C8MA 4H8KA 2UXDK 4LFAK 3OJSA 3I8DA 1LW0A 3OBYA 3RR8A 3ZSXA 1T8EA 4H5VA 4A59A 2FSJA 3HXMA 2Q31A 4FW2A 5AQUA 2YJFA 3NMUA 2B6AA 5F0XA 4DV3K 1KQSM 3VQ7A 3ZX0A 5CE3A 2E88A 2NRXA 1WN7A 2RHKA 4IDKA 1S3XA 4IOCL 1Q82O 3WT0A 4ZTFA 5E41A 4V19S 4CF9A 1HQUA 4E7KA 3V9UA 4DQIA 2P9IB 5EVZA 4JS4A 3TAFA 1XHZA 3RRGA 4DR1K 2UUBK 1HJOA 2YI1A 3NF6A 4LY7A 3BEXA 3RWUA 3OS0A 1EO1A 1N33K 3LDPA 3L2WA 3OYMA 4FOIA 2OZSA 1Y97A 2CH6A 2YHXA 2GWKA 4LF4K 4KREA 5I3UA 3RRHA 5EXWA 4Z4GA 3THYB 4GVMA 2WC9A 3NE6A 1HYSA 1KLMA 3PSIA 2HHWA 1RCHA 3IRXA 3AA4A 1TKDA 3CJ9A 1RFQA 3TPQA 3EKSA 2YNHA 4K0KK 1Q7YO 1D4XA 1HNXK 2BH1A 1TYQB 4WQ4A 3T7ZA 3LZJA 3TAGA 4CJFA 4W5TA 4YDUC 3S41A 1YI2N 1BQNA 2VYPA 2QWPA 3MAQA 3VQBA 2O8FA 3HPGA 3THXB 1GLJO 2YHAA 3O9UA 4NXNK 5AQSA 3AVCA 3UKUB 4L3QA 1FW6A 2I7PA 3L2VA 4HCCA 2HHXA 2VWJA 1Z25A
chains in the Genus database with same CATH topology
2A5XA 3CCEN 1R59O 4GV9A 5B8HA 3KWIA 4JD2A 3W0LA 4WCEL 3OW2M 1NGHA 3UKRA 4BGAA 4JHDA 3QBXA 4IO8A 1ZXOA 5BRFA 1BO5O 3CQYA 3HTVA 4XH1A 3O4WA 1J6ZA 3VPZA 1BUPA 2VGMA 3HRGA 3IFRA 4OPAA 4CZJA 3VF4A 5C10A 4BR0A 3FZFA 1NLVA 4IZ9A 5ADXH 1VQNN 4QS7A 1DT9A 3LDNA 2QI2A 3F2KA 1YXQA 3GDQA 2HBKA 2F7TA 1YVNA 2D0OA 3ENOA 1M1KO 5EX5A 2E1YA 4QS8A 2RE2A 1K9MO 3VMFB 1HUXA 3C6HA 1YJNN 1KC8O 4JKHA 5H1SQ 4A62A 4IJNA 5AQMA 3GE1A 1NGFA 3DXMA 3QDKA 4GV6A 2NRRA 1QQNA 1DGKN 4H5RA 5AFUA 1VQ7N 3L0QA 3JS6A 4ISEA 1KD1O 3H3NO 3J8AA 5M1PA 3VF6A 3C7NA 3WEEA 2ZWHA 1HKCA 2Q0UA 4BC4A 3H1VX 2DPNA 3MCPA 3U9DA 2NRWA 3VEOA 5FPEA 3DAWA 3ULEA 5AQYA 2EWSA 2QWOA 1HPMA 5AQZA 1C0FA 2CH5A 1GLEG 2A42A 4BC2A 1E4FT 1MWKA 3CIPA 4WF9L 4IOAL 5F1XA 3GG4A 5C2DA 3D2FA 1BDGA 1QHAA 4PL8A 5AQKA 4AM7A 3CC2N 4M7YA 3MN6A 4IFEA 2GUPA 2HBJA 4IWVA 2P9LA 1BG3A 2P9PB 2P9UA 4K43A 2YX6A 3P4IA 5KPZA 1VQ8N 1W2BM 1ATNA 3ZEUB 3R8EA 4U67L 5LJWA 3PLAA 2GWJA 1YUWA 1KAYA 5AQRA 3A5MC 1XQSC 2D0PA 3F9MA 4RCHA 4PKIA 1IJJA 4BRGA 3CJ7A 2ZJQL 1JCGA 3ID6A 1GLCG 4BRFA 5LY3A 4BRLA 1ILYA 4GY2B 3MCAB 4BR5A 3O80A 3Q7CA 3IUCA 4BG8A 1ESVA 3IKMA 2CGJA 1S22A 5JLHA 3LDLA 3AY9A 1DKGD 4ISGA 4PHTX 5GIOA 3KK7A 4ILHA 3VEWA 5FPDA 2ZF5O 1S72N 4ILGB 3I33A 4NB4A 3ZETA 5KPRA 3QB0A 5AQVA 1NBWA 3C0BA 3SBGA 4HTLA 3RSEB 3FR0A 2QWMA 4CJ7A 2P9IA 4U7BA 3L4QA 3DJCA 5C0YA 3SAFA 2A40A 2KKZA 2QWLA 3QFUA 1ZBSA 4JKGB 4WFNL 4WQ4C 4JK8A 4NLBA 5E84A 5KQDA 4FWKA 2QTDA 4FWSA 3R1XA 3QBWA 3R6MA 2I7NA 3MN5A 4Y0WA 5EOYA 1VQ4N 1VQ6N 2A41A 5AQXA 1GLFO 3CHWA 5ELZA 2D1KA 3CQXA 4JKAA 4CBXA 5GAGP 3O08A 1NGCA 3F5TA 4BY9C 5F2RA 5HL7L 3H6EA 3LM2A 4QS9A 4EHTA 2FF6A 3VGLA 1NM1A 2BTFA 3C6AA 3D2EB 3OA9A 3SBTA 2PBDA 3MK6A 3DWLA 5BPNA 5JICA 4YOXA 1JJ2M 3EE9A 3VTHA 3ID8A 2D4WA 3U9ZA 3EKUA 3O9TA 4B1ZA 4FWRA 1NWKA 4FWQA 3K9KA 4K25A 4JKDA 3NVKA 3MDQA 5TKWA 3LDOA 4FSVA 5AQNA 5AZIA 3VERA 3WUHA 2NNWA 3TSUA 1SQKA 4IEIA 4IXCA 3EE8A 1MDUB 1U6ZA 2V52B 5JMVA 3CCUN 5JVHL 1YHQN 4CZHA 4BQZA 2IVOA 1NGAA 5TKYA 1TYQA 3TSPA 3TTDA 4BRPA 3E1YA 1VQKN 3WXKA 4BC5A 4OPHA 3Q7BA 4GVEA 4MLHA 4JKEA 3CC7N 5AQIA 2NRTA 4A61A 3DXMB 3E9PA 4WQ5C 1NGIA 2ASMA 2ASOA 3ENBA 3O9SA 3LL3A 3ZX3A 5AQWA 1VAZA 3ATUA 3QMLA 5AQTA 2E2NA 3WXIA 4NLCA 5AR0A 3VEZA 4DCHA 3CCSN 3TU5A 3SJHA 4IEEA 4EAHD 3DXKB 1YJWN 5KQ8A 3UKUA 3IMXA 1CZAN 4CBWA 3JXUA 2CGKA 5AQLA 5I9EB 3W3DA 1V4SA 5AQFA 5GADP 1LOTB 4AM6A 5BRDA 2P9KB 4CZGA 5GINA 3C65A 2Q97A 3VEVA 2NZTA 4FOEA 1GLDG 4EFHA 1E4GT 4JK9A 5AQOA 5C2FA 3T69A 3A0IX 4H0PA 4YOTA 4BRCA 4Z94A 2GEMA 1G99A 2H3GX 3PIPL 2OTJN 3H1QA 3KZBA 2P9SB 4DKWA 5AFUH 4J8FA 3DLLL 4BRQA 5JVGL 1Q81O 1ATRA 4H5NA 4H0TB 4BRMA 1XUPO 2YCHA 2ASPA 5AZJB 4JNEA 1OKJA 5FPMA 4FWOA 1M90O 2E1ZA 3CXCM 4XH4A 3D7EO 3CJAA 3J7ZO 1QVGM 3VF2A 5BN8A 5BRHA 1C0GA 1Y64A 2W40A 3CETA 1WOQA 1X3MA 4CZMA 4G9ZA 3SMSA 4H5WA 4JK7A 4GV3A 4KH6A 3VEXA 5GIPA 2YHWA 1NGGA 3KWGA 4MO5A 2QEXN 2HBLA 1VQMN 2V7YA 1U2VB 4B1UB 1LCUA 1Z05A 2F9WA 3H3OB 3G25A 1XC3A 1TUUA 4GNIA 5CHIA 1K8KB 3CC4N 3LDQA 4KH4A 1SAZA 4H0OA 1YITN 3FFKB 1QQOA 4DB3A 3ATVA 4JEPA 2QA4N 1VQLN 2KHOA 4BR9A 3VTIA 5M1FA 2Q0RA 4WFBL 4CBUA 3GL1A 4BR2A 4FPAA 3FZKA 4XH5A 4C23A 5C15A 1QVFM 4WYBA 4CZLA 1ZC6A 3N4QA 2HBMA 1K8AO 2QWNA 2YHYA 3BF3A 4FVUA 2HF3A 3A5LC 4H0XB 2BUPA 3UB5A 3G6EN 3SLCA 1EQYA 4A57A 2JWLA 3HSCA 4ILJA 3OBWA 3HOTA 1QZ6A 4B1VA 3BF1A 4H0VB 3WXMB 1NJIO 2P9NB 1YF5L 2P9PA 1BA0A 3O8MA 3TSQA 4PL7A 1RDUA 4FL9A 4H03B 5M1OA 1BU6O 4O5FA 3EN9A 3O1WA 2GX9A 3ZEUA 5FPNA 2HF4A 3O5BA 4IOXA 3SAGA 2AP1A 2A6AA 3CPEA 1VQON 4C1NI 3AAPA 5KPTA 4CZIA 4C1NK 3B8AX 4I6MA 3E9LA 4A5AA 5AQQA 2UYTA 2E2QA 2E2PA 3SAHA 3CCVN 3A5NC 3ZX2A 1X3NA 1NGBA 2VWBA 3EZWA 3M1FA 4JD2B 4A2BA 4BRNA 5M1KA 4MDBA 3UKRB 4K42A 3VGMA 3PIOL 3FZMA 3OHRA 4JHDB 3NVMA 3QFPA 3CCJN 4BRIA 3I56N 1GLLO 3CF5L 3R9PA 1P90A 4M63C 3WQTA 4BRAA 4CI6A 2QWRA 3G4SN 2ZGZA 5MLCQ 3RSEA 1YAGA 3MMVA 3I55N 4YDUA 4IO9L 1T3VA 3HBTA 1TUYA 5GAEP 3CCLN 2IVPA 3HOSA 1GLAG 1YJ9N 1BOTO 5AQPA 4IDHA 4BVPA 3E66A 2Q1NA 2GELA 4DHYA 3O9RA 2QXLA 3M6GA 2NRVA 5BR9A 3H45C 3RVCA 4WFAL 5CR4A 3A5OC 3M5RA 5AQJA 4BVOA 5BPMA 3MWPA 3CPWM 1HX1A 3UE5A 4FPBA 1WUAA 1N8RO 4B1YB 3KHYA 3CI5A 4LC9B 1Z6RA 1V4TA 2ZJRL 3O6WA 1X9JA 3ZYYX 3D2EA 1BA1A 2Q36A 3GBTA 4IJAA 1RDWX 3C7NB 4FO0A 3WEEB 2CGLA 2QW9A 1P8ZA 1HKBA 5BN9A 4B1WB 3CERA 4CZFA 5ADXA 4RWTA 3MN7A 3ULEB 1NMDA 4BR7A 3M3ZA 4ISFA 3CCQN 2A3ZA 1ATSA 4M7XA 3FLCO 4MLEA 4JKBA 3AARA 3MX2A 4YORA 2V51B 1MWMA 1KAZA 2PAVA 4PKGA 3HI0A 3TTFA 3O9QA 3D2FB 4H5TA 2PFUA 1QZ5A 3U8XA 3VENA 4WQ5A 3WXJA 4EIAA 1QQMA 4F9OA 2HSTA 2Q2RA 2GTDA 2P9LB 2V7ZA 4UY8O 3K9JA 1OVYA 3E9OA 2P9UB 3OBYA 4BRDA 4BREA 5BPLA 5GAHP 2ZGYA 3CCRN 3LM9A 2YJEA 4H5VA 2FF3B 1T6CA 2FSJA 3CJCA 4HWIA 4A59A 5BREA 2Q31A 5AQUA 2QM1A 5M1NA 2YJFA 5C12A 4A2AA 3NMUA 3I8BA 5JLFA 2F9TA 3DXKA 1GLBG 3VOVA 3CD6N 2IVNA 1NGEA 2JWKA 3L4IA 5F0XA 2FSNA 1RGIA 1JCFA 2WFBA 1W97L 3P31A 4JKFA 1KQSM 3P39A 2HOEA 3FGUA 4MO4A 4FWNA 5M1QA 3ZX0A 4BRKA 5CE3A 2E88A 2NRXA 2FLOA 2P9KA 3AGRA 3VGKA 3ENHA 2RHKA 4KBOA 1SS6A 3KVGA 3P38A 4BQLA 1S3XA 1KAXA 3U4LA 4RTFD 4BG9A 4IOCL 3ZETB 1Q82O 3WT0A 3BP8A 3WXLA 2QWQA 2OANA 2HMPA 2NRHA 3SMPA 4AF1A 4YOYA 3H46O 1YIJN 2OTLN 3EL2A 2P9IB 3CMAN 1NGDA 1T44A 5EVZA 2P9SA 2WBNA 3O1BA 3QICA 4R79A 1HJOA 2YI1A 4YOVA 3BEXA 5HOOA 5AZJA 1EO1A 3D6RA 3LDPA 4K41A 2FSKA 2WUSA 3N4PA 4BGBA 4FOIA 4CD1A 1JCEA 4YOUA 1H1VA 2E20A 1BWFO 2KLAA 4EHUA 4CD3A 3IDHA 2CH6A 4JAXA 1Q18A 2YHXA 2IIRA 4NO7A 2GWKA 3TTCA 4I6MB 3VETA 4CZKA 4O8KA 4FWLA 4JKCA 5EXWA 2VGNA 5EY4A 5DM6L 3L6QA 3BUZB 1NGJA 5AQGA 1U2VA 3HM8A 3EO3A 2WC9A 3G71N 1DEJA 2NLXA 3FZLA 3HZ6A 3WQUA 3VEYA 2W41A 2J4RA 3MN9A 1K73O 5E26A 4KH5A 4E1JA 4YOWA 1SZ2A 1K8KA 5AZIB 1MA9B 2E2OA 1T6DA 1VQPN 3MX5A 4B1XB 4BC3A 2NRZA 3CJ9A 1RFQA 4MDAA 4XEIA 3EKSA 3TPQA 4JN4A 5DM7L 1IG8A 1Q7YO 4BR4A 4O8UA 1D4XA 3R3LA 3GOIA 2BH1A 1TYQB 4WQ4A 3T7ZA 2E8AA 4BROA 4BRHA 2VCPA 4PKHA 3CCMN 4B9QA 4FWPA 3SK3A 1VQ9N 4YDUC 3A8YA 1KXPA 3S41A 3CMEN 3FZHA 1YI2N 4A5BA 3AAQA 3AGKA 2VYPA 4FWMA 3CJBA 2QWPA 4JKGA 2FXUA 4DQ8A 1GLJO 2AA4A 2P9NA 3O9UA 1HKGA 5AQSA 3VESA 4OO1J 3UKUB 4L3QA 1Q86O 2I7PA 2ITMA 1O13A 3CJ1A 5AQHA 5LJVA 4CZEA 3MWTA 2ZJPL 1HLUA 1VQ5N 4H0YB 3FE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5X A;  1R59 O;  5B8H A;  4JD2 A;  3W0L A;  1NGH A;  3UKR A;  4BGA A;  4JHD A;  3QBX A;  4IO8 A;  1ZXO A;  5BRF A;  1BO5 O;  3CQY A;  3HTV A;  4XH1 A;  3O4W A;  1J6Z A;  3VPZ A;  1BUP A;  3IFR A;  4CZJ A;  3VF4 A;  4BR0 A;  3FZF A;  1NLV A;  4IZ9 A;  5ADX H;  4QS7 A;  3LDN A;  1YXQ A;  3GDQ A;  1YVN A;  2D0O A;  3ENO A;  5EX5 A;  2E1Y A;  4QS8 A;  1HUX A;  4A62 A;  4IJN A;  5AQM A;  3GE1 A;  1NGF A;  3DXM A;  3QDK A;  1QQN A;  1DGK N;  4H5R A;  5AFU A;  3L0Q A;  3JS6 A;  4ISE A;  3H3N O;  3J8A A;  3VF6 A;  3C7N A;  3WEE A;  2ZWH A;  1HKC A;  2Q0U A;  4BC4 A;  3H1V X;  2DPN A;  3MCP A;  3U9D A;  3VEO A;  5FPE A;  3DAW A;  3ULE A;  5AQY A;  2EWS A;  2QWO A;  1HPM A;  5AQZ A;  1C0F A;  2CH5 A;  1GLE G;  2A42 A;  4BC2 A;  1E4F T;  1MWK A;  3CIP A;  5F1X A;  3GG4 A;  3D2F A;  1BDG A;  1QHA A;  4PL8 A;  5AQK A;  4AM7 A;  4M7Y A;  3MN6 A;  2GUP A;  4IWV A;  2P9L A;  1BG3 A;  2P9P B;  2P9U A;  4K43 A;  3P4I A;  5KPZ A;  1ATN A;  3ZEU B;  3R8E A;  5LJW A;  2GWJ A;  1YUW A;  1KAY A;  5AQR A;  3A5M C;  1XQS C;  2D0P A;  3F9M A;  4RCH A;  4PKI A;  1IJJ A;  4BRG A;  3CJ7 A;  1JCG A;  1GLC G;  4BRF A;  5LY3 A;  4BRL A;  4GY2 B;  4BR5 A;  3O80 A;  3IUC A;  4BG8 A;  1ESV A;  2CGJ A;  1S22 A;  5JLH A;  3LDL A;  3AY9 A;  1DKG D;  4ISG A;  3VEW A;  5FPD A;  2ZF5 O;  3I33 A;  4NB4 A;  3ZET A;  5KPR A;  3QB0 A;  5AQV A;  1NBW A;  3C0B A;  4HTL A;  3RSE B;  3FR0 A;  2QWM A;  4CJ7 A;  2P9I A;  3DJC A;  2A40 A;  2QWL A;  3QFU A;  1ZBS A;  4WQ4 C;  5KQD A;  5E84 A;  4FWK A;  4FWS A;  3QBW A;  3R6M A;  2I7N A;  3MN5 A;  4Y0W A;  5EOY A;  2A41 A;  5AQX A;  1GLF O;  3CHW A;  5ELZ A;  2D1K A;  3CQX A;  4CBX A;  3O08 A;  1NGC A;  5F2R A;  3H6E A;  3LM2 A;  4QS9 A;  4EHT A;  2FF6 A;  3VGL A;  1NM1 A;  2BTF A;  3D2E B;  2PBD A;  3MK6 A;  3DWL A;  5BPN A;  5JIC A;  3ID8 A;  2D4W A;  3U9Z A;  3EKU A;  4B1Z A;  4FWR A;  1NWK A;  4FWQ A;  4K25 A;  3MDQ A;  3LDO A;  4FSV A;  5AQN A;  5AZI A;  3VER A;  3WUH A;  1SQK A;  4IXC A;  1MDU B;  1U6Z A;  2V52 B;  5JMV A;  4CZH A;  4BQZ A;  2IVO A;  1NGA A;  5TKY A;  1TYQ A;  4BRP A;  3WXK A;  4BC5 A;  4MLH A;  5AQI A;  4A61 A;  3DXM B;  4WQ5 C;  1NGI A;  2ASM A;  2ASO A;  3LL3 A;  3ZX3 A;  5AQW A;  3ATU A;  3QML A;  5AQT A;  2E2N A;  3WXI A;  4DCH A;  5AR0 A;  3VEZ A;  3TU5 A;  3SJH A;  4EAH D;  3DXK B;  5KQ8 A;  3UKU A;  3IMX A;  1CZA N;  4CBW A;  3JXU A;  2CGK A;  5AQL A;  5I9E B;  3W3D A;  1V4S A;  5AQF A;  1LOT B;  4AM6 A;  5BRD A;  2P9K B;  4CZG A;  2Q97 A;  3VEV A;  2NZT A;  4FOE A;  1GLD G;  4EFH A;  1E4G T;  5AQO A;  3A0I X;  4H0P A;  4BRC A;  4Z94 A;  2GEM A;  1G99 A;  2H3G X;  3H1Q A;  3KZB A;  2P9S B;  5AFU H;  4J8F A;  4BRQ A;  1ATR A;  4H5N A;  4H0T B;  4BRM A;  1XUP O;  2YCH A;  2ASP A;  5AZJ B;  4JNE A;  1OKJ A;  5FPM A;  4FWO A;  2E1Z A;  4XH4 A;  3D7E O;  3CJA A;  3VF2 A;  5BN8 A;  5BRH A;  1C0G A;  1Y64 A;  2W40 A;  3CET A;  1WOQ A;  1X3M A;  4CZM A;  3SMS A;  4H5W A;  3VEX A;  2YHW A;  1NGG A;  4MO5 A;  2V7Y A;  1U2V B;  4B1U B;  1LCU A;  1Z05 A;  2F9W A;  3H3O B;  3G25 A;  1XC3 A;  1TUU A;  4GNI A;  1K8K B;  3LDQ A;  1SAZ A;  4H0O A;  3FFK B;  1QQO A;  4DB3 A;  3ATV A;  2KHO A;  4BR9 A;  2Q0R A;  4CBU A;  3GL1 A;  4BR2 A;  4FPA A;  3FZK A;  4XH5 A;  4C23 A;  4WYB A;  4CZL A;  1ZC6 A;  2QWN A;  2YHY A;  3BF3 A;  2HF3 A;  3A5L C;  4H0X B;  2BUP A;  3UB5 A;  3SLC A;  1EQY A;  3HSC A;  1QZ6 A;  4B1V A;  3BF1 A;  4H0V B;  2P9N B;  2P9P A;  3O8M A;  1BA0 A;  4PL7 A;  4FL9 A;  4H03 B;  1BU6 O;  4O5F A;  3EN9 A;  3O1W A;  3ZEU A;  5FPN A;  2HF4 A;  3O5B A;  2AP1 A;  2A6A A;  3AAP A;  5KPT A;  4CZI A;  3B8A X;  4I6M A;  5AQQ A;  2UYT A;  2E2Q A;  2E2P A;  3A5N C;  3ZX2 A;  1X3N A;  1NGB A;  2VWB A;  3EZW A;  3M1F A;  4JD2 B;  4A2B A;  4BRN A;  3UKR B;  4K42 A;  3VGM A;  3FZM A;  3OHR A;  4JHD B;  3QFP A;  4BRI A;  1GLL O;  3R9P A;  4M63 C;  3WQT A;  4BRA A;  4CI6 A;  2QWR A;  2ZGZ A;  3RSE A;  1YAG A;  3MMV A;  4YDU A;  3HBT A;  1TUY A;  2IVP A;  1GLA G;  1BOT O;  5AQP A;  4BVP A;  2Q1N A;  2GEL A;  4DHY A;  2QXL A;  3M6G A;  5BR9 A;  3H45 C;  3A5O C;  5AQJ A;  4BVO A;  5BPM A;  1HX1 A;  3UE5 A;  4FPB A;  1WUA A;  4B1Y B;  3KHY A;  3CI5 A;  4LC9 B;  1Z6R A;  1V4T A;  3O6W A;  1X9J A;  3D2E A;  1BA1 A;  2Q36 A;  3GBT A;  4IJA A;  1RDW X;  3C7N B;  4FO0 A;  3WEE B;  2CGL A;  2QW9 A;  1P8Z A;  1HKB A;  5BN9 A;  4B1W B;  3CER A;  4CZF A;  5ADX A;  4RWT A;  3MN7 A;  3ULE B;  1NMD A;  4BR7 A;  3M3Z A;  4ISF A;  2A3Z A;  1ATS A;  4M7X A;  3FLC O;  4MLE A;  3AAR A;  2V51 B;  1MWM A;  1KAZ A;  2PAV A;  4PKG A;  3HI0 A;  3D2F B;  4H5T A;  1QZ5 A;  3U8X A;  3VEN A;  4WQ5 A;  3WXJ A;  4EIA A;  1QQM A;  4F9O A;  2Q2R A;  2GTD A;  2P9L B;  2V7Z A;  2P9U B;  4BRD A;  4BRE A;  5BPL A;  2ZGY A;  3LM9 A;  2YJE A;  4H5V A;  2FF3 B;  1T6C A;  2FSJ A;  3CJC A;  4HWI A;  5BRE A;  2Q31 A;  5AQU A;  2QM1 A;  2YJF A;  4A2A A;  3I8B A;  5JLF A;  2F9T A;  3DXK A;  1GLB G;  3VOV A;  2IVN A;  1NGE A;  3L4I A;  5F0X A;  2FSN A;  1RGI A;  1JCF A;  3ZX0 A;  2HOE A;  3FGU A;  4MO4 A;  4FWN A;  4BRK A;  5CE3 A;  2E88 A;  2P9K A;  2FLO A;  3VGK A;  3ENH A;  4KBO A;  3KVG A;  4BQL A;  1S3X A;  1KAX A;  3U4L A;  4RTF D;  4BG9 A;  3ZET B;  3WT0 A;  3BP8 A;  3WXL A;  2QWQ A;  2OAN A;  2HMP A;  2NRH A;  3SMP A;  3H46 O;  3EL2 A;  2P9I B;  1NGD A;  1T44 A;  5EVZ A;  2P9S A;  3O1B A;  3QIC A;  1HJO A;  2YI1 A;  3BEX A;  5AZJ A;  3LDP A;  4K41 A;  2FSK A;  2WUS A;  4BGB A;  4CD1 A;  4FOI A;  1JCE A;  1H1V A;  2E20 A;  1BWF O;  4EHU A;  4CD3 A;  3IDH A;  2CH6 A;  4JAX A;  1Q18 A;  2YHX A;  2IIR A;  4NO7 A;  2GWK A;  4I6M B;  3VET A;  4CZK A;  4O8K A;  4FWL A;  5EXW A;  5EY4 A;  3L6Q A;  3BUZ B;  1NGJ A;  5AQG A;  1U2V A;  3HM8 A;  3EO3 A;  1DEJ A;  2NLX A;  3FZL A;  3HZ6 A;  3WQU A;  3VEY A;  2W41 A;  2J4R A;  3MN9 A;  5E26 A;  4E1J A;  1SZ2 A;  1K8K A;  5AZI B;  1MA9 B;  2E2O A;  1T6D A;  4B1X B;  4BC3 A;  3CJ9 A;  1RFQ A;  4XEI A;  3TPQ A;  3EKS A;  4JN4 A;  1IG8 A;  4BR4 A;  1D4X A;  3GOI A;  1TYQ B;  4WQ4 A;  2E8A A;  4BRO A;  4BRH A;  2VCP A;  4PKH A;  4B9Q A;  4FWP A;  3SK3 A;  4YDU C;  3A8Y A;  1KXP A;  3S41 A;  3FZH A;  3AAQ A;  2VYP A;  4FWM A;  3CJB A;  2QWP A;  2FXU A;  4DQ8 A;  1GLJ O;  2AA4 A;  2P9N A;  1HKG A;  5AQS A;  3VES A;  3UKU B;  4L3Q A;  2I7P A;  2ITM A;  3CJ1 A;  5AQH A;  5LJV A;  4CZE A;  1HLU A;  4H0Y B;  3FE1 A; 
#chains in the Genus database with same CATH topology
 4GV9 A;  1R59 O;  1NKC A;  5B8H A;  3VA3 A;  4JD2 A;  3OW2 M;  1J5O A;  1K6Y A;  3NFA A;  3HTV A;  1J6Z A;  1ASU A;  1BUP A;  2IOC A;  3HRG A;  2ZE2 A;  4OKE A;  3IFR A;  1TL1 A;  4OPA A;  4CZJ A;  5C10 A;  3FZF A;  4JLH A;  1QTM A;  4QS7 A;  3LWM A;  2HBK A;  4FK2 A;  1YVN A;  4FCY A;  2X6N A;  3ENO A;  3C6H A;  1YJN N;  1KC8 O;  2VG5 A;  1C0M A;  3GE1 A;  4MFB A;  4GKJ K;  2X74 A;  1NGF A;  3DXM A;  4GV6 A;  1DGK N;  1VK0 A;  5KI6 A;  1JLF A;  5AFU A;  2Z1G A;  3KK2 A;  4CK2 A;  5FPE A;  2NRW A;  4AHR A;  3ULE A;  5AQY A;  2EWS A;  3WNG A;  1HPM A;  2CH5 A;  1GLE G;  2A42 A;  4CJV A;  3CIP A;  4CJK A;  4IOA L;  3GG4 A;  5C2D A;  4CJW A;  3LP3 A;  4IKF A;  4ICL A;  1TAU A;  1A5V A;  2HBJ A;  1JLQ A;  1BG3 A;  2P9P B;  2PZS A;  5J2P A;  4U67 L;  5LJW A;  3PLA A;  3U3G A;  2F8S A;  4BRG A;  1RT2 A;  2ZJQ L;  4C8N A;  1GLC G;  4Z4E A;  1FXX A;  4BR5 A;  2GBZ A;  1SL2 A;  3AVH A;  3Q7C A;  4BG8 A;  2DFF A;  2HHV A;  3KIO A;  1DKG D;  5GIO A;  4R5P A;  3VEW A;  4LF7 K;  1S72 N;  4ILG B;  2OCE A;  3OYL A;  3OTO K;  2VQF K;  2A1S A;  3ZSR A;  3T19 A;  4OGC A;  4DR4 K;  2P9I A;  5T7B A;  1CXU A;  3DJC A;  4JKG B;  5CYM A;  1RT5 A;  4FWK A;  3TAQ A;  4DR3 K;  1WSI A;  3R6M A;  5HP1 A;  4Y0W A;  1VQ6 N;  1X9M A;  2A41 A;  1J54 A;  1C6V A;  4AH9 A;  4KAZ A;  4FLV A;  4IG0 A;  3VQE A;  4M3W A;  5HL7 L;  3SQ4 A;  1SV5 A;  3H6E A;  3LM2 A;  4OVL A;  2FF6 A;  2BE2 A;  2G8I A;  1NM1 A;  2BTF A;  1HYZ A;  3C6A A;  3D2E B;  3MED A;  1TVR A;  5BPN A;  4B08 A;  3THY A;  2D4W A;  3U9Z A;  3EKU A;  1NWK A;  4M3T A;  3K9K A;  4RW4 A;  4K25 A;  3MDQ A;  4DQP A;  4DTX A;  2NNW A;  3FFI A;  3TSU A;  4IEI A;  4QCL A;  4NYF A;  3ISN C;  3EE8 A;  1L5U A;  5JVH L;  1Q9Y A;  4NCA A;  3TSP A;  1TYQ A;  1VQK N;  3Q7B A;  4MLH A;  1VSL A;  4WE1 A;  5AQI A;  4A61 A;  4FYD A;  2ASM A;  3UIQ A;  3LL3 A;  1VAZ A;  3CCS N;  3THX A;  5AR0 A;  3TU5 A;  4DUY K;  4IEE A;  3DXK B;  1U48 A;  3UKU A;  3IMX A;  1DLO A;  1LOT B;  2P9K B;  4JI4 K;  4FOE A;  1GLD G;  4EFH A;  4GKK K;  1IKX A;  4ZTJ A;  4FXD A;  4KHN A;  4Z94 A;  4IBN A;  5D3G A;  1JLA A;  3A2F A;  2GEM A;  1L3U A;  1S1T A;  3PIP L;  2P9S B;  2WON A;  2QKB A;  1ATR A;  4H5N A;  4DSK A;  4H0T B;  2YCH A;  4DQR A;  3ZCM A;  3AO4 A;  4XH4 A;  4DSF A;  3K5L A;  5BN8 A;  1R0A A;  2X78 A;  3NGY A;  5FDL A;  3NHG A;  4BAC A;  4FJL A;  1S6P A;  3MEE A;  3VQ6 A;  3O3H A;  2F8T A;  3LPU A;  4MO5 A;  3OJU A;  2QEX N;  4DR2 K;  2V7Y A;  1TAQ A;  4F2S A;  1EXQ A;  4DLE A;  3ZT0 A;  4CEA A;  1TUU A;  4FLY A;  3CC4 N;  1VRT A;  3L2Q A;  2WTU A;  2QA4 N;  4FLU A;  1VQL N;  3ZT4 A;  4BR9 A;  4WFB L;  1W0H A;  2Q3S A;  3GL1 A;  4XH5 A;  4WYB A;  4CZL A;  1ZC6 A;  2HBM A;  1K8A O;  2YHY A;  4C8L A;  1ITG A;  4H4M A;  3WNE A;  4A57 A;  3VQP A;  4DSI A;  3OBW A;  1TK0 A;  3BF1 A;  4H0V B;  3AVA A;  3SUO A;  1YF5 L;  2P9P A;  3T3F A;  3TSQ A;  3QES A;  4AIL C;  2OPR A;  4Q0B A;  3L3U A;  1JLE A;  1SKR A;  4B9L A;  2HB5 A;  4JS5 A;  1IH7 A;  3NBP A;  2QXF A;  3E9L A;  3HST B;  2E2Q A;  3EZW A;  2VWB A;  2VG7 A;  5J2Q A;  4MDB A;  4K42 A;  3OYN A;  3OHR A;  3NVM A;  4BRI A;  3I56 N;  3CF5 L;  3QO9 A;  3R9P A;  3ITH A;  2D0C A;  1HNW K;  2O4I A;  4KFB A;  3I55 N;  4YDU A;  3DMJ A;  3HJF A;  1D9D A;  2IVP A;  2AJQ A;  2BGG A;  1YJ9 N;  1BOT O;  4KI4 A;  5IT9 O;  1SUQ A;  4ELT A;  2G8K A;  5J2N A;  2NRV A;  3H45 C;  4B9M A;  4DU1 A;  4FZZ A;  3CPW M;  1BCM A;  3V1R A;  5KRS A;  2XO7 A;  1ZBU A;  3THV A;  2O8E B;  4NYN A;  1HPZ A;  3CI5 A;  1NK9 A;  1V4T A;  4OX9 K;  3CG7 A;  3V9X A;  3ZYY X;  3D2E A;  3NDK A;  3L2U A;  1RDW X;  4FO0 A;  2HVI A;  2CGL A;  1JXE A;  4B3S K;  4E19 A;  1X1P A;  4CZF A;  4RWT A;  4CIF A;  4BWJ A;  3CCQ N;  3SQ2 A;  4M7X A;  1EX4 A;  4FVM A;  4M3X A;  3AAR A;  1XWL A;  3BZC A;  3TTF A;  1KTQ A;  4O4G A;  3CM5 A;  4HUE A;  4H5T A;  3VEN A;  3WXJ A;  3AO5 A;  2HST A;  4JV5 K;  4RW8 A;  2P9L B;  2V7Z A;  2E4L A;  3PO5 A;  4BRE A;  5BPL A;  4JI1 K;  3OYF A;  2OTL N;  2DFE A;  4HWI A;  2FF3 B;  1HNZ K;  1RDD A;  5BRE A;  1KVB A;  4YY3 K;  1NNE A;  3DXK A;  2JWK A;  3MXJ A;  1RT1 A;  2FSN A;  1JCF A;  1W97 L;  2HOE A;  1CZB A;  4BRK A;  5M1Q A;  2P9K A;  1RT7 A;  4HUG A;  4KBO A;  4O5B A;  1SS6 A;  3P38 A;  4HUF A;  1YTA A;  1VSH A;  3ZET B;  3D45 A;  3BP8 A;  3HP9 A;  1TKT A;  3SMP A;  2NRH A;  2OAN A;  3V1Q A;  3DRS A;  3H46 O;  2LSN A;  4AF1 A;  1HQE A;  3EL2 A;  4YOY A;  1LV5 A;  4FJG A;  1T44 A;  4FM1 A;  2P9S A;  1QSL A;  1YVU A;  4R79 A;  3OYI A;  2G8V A;  3KKS A;  2UXB K;  4CD1 A;  2VWK A;  1BIS A;  3NF7 A;  4PA1 A;  2KLA A;  5HLF A;  3IDH A;  2OZM A;  4CHN A;  3TTC A;  4I6M B;  4OPK A;  1D8Y A;  3ZSZ A;  4JKC A;  5EY4 A;  3L6Q A;  4Z4C A;  1NGJ A;  3HM8 A;  3KLI A;  3WQU A;  2E6L A;  4E1J A;  1SL1 A;  1JXB A;  1MA9 B;  3SPZ A;  1SKS A;  4BC3 A;  4CJ5 A;  4MDA A;  4CJT A;  1BIU A;  3KLG A;  4FJ7 A;  4BE0 A;  3HK2 A;  4N56 A;  4O8U A;  4I2Q A;  2HNZ A;  4FLX A;  4OKK A;  3IAY A;  4PKH A;  4LH5 A;  4KRF A;  4FWP A;  3SK3 A;  3A8Y A;  1KXP A;  1BQM A;  2PYJ A;  1UA1 A;  4A5B A;  3AAQ A;  3AGK A;  4FWM A;  3K59 A;  2AA4 A;  2Z1J A;  4OO1 J;  1HKG A;  1NJZ A;  4Y1C A;  5I42 A;  5AJ3 K;  1Q86 O;  2ITM A;  1WNS A;  1O13 A;  1JLC A;  4CK3 A;  4CZE A;  2ZJP L;  4H0Y B;  2A5X A;  3CCE N;  4C8K A;  2VG6 A;  4DF4 A;  2HNY A;  3SYZ A;  3LZI A;  3W0L A;  4WCE L;  1NK8 A;  4BGA A;  4DTO A;  5A2Q O;  1BIZ A;  5BRF A;  3SV4 A;  1WBB A;  3CQY A;  3MEG A;  1T7P A;  4E0D A;  1A5W A;  2XY8 A;  5ADX H;  5CY4 A;  1DT9 A;  2QI2 A;  1RTJ A;  1EP4 A;  2RKI A;  4JYA K;  2F7T A;  3K2P A;  3THW B;  1NK6 A;  2IAJ A;  2RE2 A;  4JKH A;  4IJN A;  1KCF A;  3QDK A;  2O8E A;  1VSI A;  3L0Q A;  3JS6 A;  1F21 A;  1LWF A;  3J8A A;  3VF6 A;  4DF8 A;  4LSL A;  2Q0U A;  3F9K A;  5C24 A;  2DPN A;  4O55 A;  3MCP A;  3ZSY A;  2QWO A;  2O8C B;  3HVR A;  4JI3 K;  3RTV A;  4E7H A;  5AQZ A;  1C0F A;  1DTQ A;  4DR6 K;  4BC2 A;  1E4F T;  1VHX A;  1S1U A;  4CF8 A;  3AA2 A;  4PL8 A;  4KHY A;  5AQK A;  4ELU A;  4M7Y A;  1FKP A;  5KTQ A;  3C6T A;  4N41 A;  1CXQ A;  4K8Z A;  4IWV A;  2P9L A;  3CFO A;  1EET A;  5C42 A;  3DRP A;  4K43 A;  4M41 A;  1W2B M;  1ATN A;  2QKK A;  1XC9 A;  3R8E A;  2GWJ A;  5AQR A;  3A5M C;  2D0P A;  3TR8 A;  3DI6 A;  4PKI A;  3CJ7 A;  1JCG A;  3ID6 A;  4BRF A;  2BAN A;  2RN2 A;  1NU0 A;  3IKM A;  1SKW A;  5JLH A;  4I2P A;  4DWI A;  2ZF5 O;  1FJG K;  1RBR A;  5KPR A;  3ZET A;  2Z1I A;  3SBG A;  3LWL A;  2QWM A;  4X66 K;  3L4Q A;  3SAF A;  1KSP A;  2QWL A;  2KKZ A;  2P51 A;  4WFN L;  5KQD A;  3R1X A;  3QBW A;  3RMB A;  3MN5 A;  1VQ4 N;  2HVH A;  3TAR A;  3G10 A;  2UU9 K;  4FJ8 A;  2EHG A;  3PUF A;  1C1C A;  1GOA A;  5HRN A;  3LP1 A;  4KI6 A;  1O1W A;  3VQQ A;  5GAG P;  3AVG A;  1RBS A;  4ELV A;  2DTU A;  3SBT A;  3IG1 A;  2JGU A;  4DV1 K;  1OH5 A;  3EE9 A;  3ID8 A;  3OYB A;  4Z4F A;  1KRP A;  1T03 A;  4M3Y A;  1IKW A;  3NAE A;  4B8A B;  1KVA A;  3OS2 A;  4FJN A;  1YHQ N;  5JMV A;  5J2M A;  4CZH A;  2B5J A;  1BI4 B;  5TKY A;  1NMN A;  1NJY A;  1WBD A;  4OPH A;  1Q9X A;  3IS9 A;  1XI1 A;  3CC7 N;  2G8F A;  3I0S A;  2NRT A;  3E9P A;  3ENB A;  3M8S A;  5AQW A;  4Q5V A;  1HJR A;  3VEZ A;  4CEB A;  3ALY A;  3JXU A;  5AQL A;  5I9E B;  3W3D A;  2ZD1 A;  5AQF A;  1IKY A;  5BRD A;  2HHT A;  2NZT A;  3K57 A;  1E4G T;  1UOC A;  3T69 A;  4BRC A;  4FM0 A;  1G99 A;  4CIE A;  2OTJ N;  3H1Q A;  3VQ5 A;  3LAL A;  4KTW A;  1UWB A;  3QEI A;  5AZJ B;  4FWO A;  3J7Z O;  3VF2 A;  4CFC A;  1LW2 A;  3ZSQ A;  1X3M A;  4CZM A;  4G9Z A;  3OYK A;  1C1B A;  4JK7 A;  4GV3 A;  2E6M A;  5GIP A;  2YHW A;  3AVB A;  4KB0 A;  2HBL A;  3J80 O;  3VQ8 A;  4PQU A;  4FJM A;  2ATQ A;  4CJ4 A;  1J9A A;  3PV8 A;  1RBV A;  3DOK A;  3LDQ A;  1YIT N;  2IDO A;  3FFK B;  3SV3 A;  1B9F A;  2O8C A;  4CGG A;  4BR2 A;  3FZK A;  1RDA A;  1QVF M;  4OGE A;  3AO2 A;  2QWN A;  2ETJ A;  2HF3 A;  3UB5 A;  2BUP A;  3G6E N;  1VSM A;  3SLC A;  4ILJ A;  1RTD A;  1EWR A;  3WXM B;  2YV0 X;  2KFZ A;  2P9N B;  4E1N A;  1BA0 A;  4PL7 A;  4FL9 A;  2I5J A;  5M1O A;  1BU6 O;  2GX9 A;  3O5B A;  3SAG A;  1S9E A;  4CGH A;  3SCX A;  1GOC A;  1QQC A;  2YHB A;  1JL1 A;  4CZI A;  1NJX A;  3KD5 E;  3V9Z A;  3SAH A;  2UYT A;  3CCV N;  4E7I A;  1NJI O;  1JLG A;  5FRN A;  1X3N A;  3M1F A;  4I9Q A;  4BRN A;  3EEQ A;  5LMU K;  5CYQ A;  3PIO L;  1N36 K;  1S1X A;  4F8R A;  3QFP A;  4CJS A;  4DFM A;  1P90 A;  4M63 C;  3RMA A;  3O4Q A;  1C0T A;  3TWH A;  4J2E A;  2ZGZ A;  5MLC Q;  3HBT A;  1B9D A;  3CCL N;  4L8R B;  4IDH A;  2Q1N A;  3NH2 A;  2QXL A;  1CLQ A;  3KTQ A;  4WFA L;  4BVO A;  4DFJ A;  4F3T A;  1HX1 A;  1XHX A;  4FJJ A;  2KFN A;  3KD1 E;  3ZSO A;  2OA8 A;  2ZJR L;  3CFP A;  1X9J A;  3S3O A;  4C8O A;  4B3M K;  3WEE B;  3TAN A;  4KHP K;  4B1W B;  5BN9 A;  3CER A;  4GW6 A;  4ISF A;  4B3T K;  3O4N A;  2V51 B;  1QS4 A;  1MWM A;  3AVK A;  1KAZ A;  3K5M A;  2PAV A;  4PKG A;  3HI0 A;  4AQY K;  3NF8 A;  3D2F B;  4FJ5 A;  3HT3 A;  4DTJ A;  1RT4 A;  4WQ5 A;  1QQM A;  4LFC K;  1BI4 A;  5FRM A;  2Q2R A;  1KLN A;  2GTD A;  4CF2 A;  3LDS A;  1OVY A;  3E9O A;  2P9U B;  1QHT A;  5GAH P;  3CCR N;  2ZGY A;  2YJE A;  3CJC A;  3P83 D;  2BDP A;  4XIU A;  4IFV A;  4KPY A;  4A2A A;  4UQG A;  1S5J A;  3QLH A;  1TKZ A;  4Z4I A;  1G15 A;  3K5N A;  1GLB G;  3CD6 N;  2IVN A;  1NGE A;  3L4I A;  1RGI A;  3P31 A;  4JKF A;  4AHT A;  4DS5 A;  1SL0 A;  4BDP A;  3DOL A;  4MO4 A;  3FGU A;  4CJQ A;  2OYQ A;  5FRO A;  3AGR A;  2FLO A;  3VGK A;  4N5S A;  1IO2 A;  4I9L A;  3KVG A;  4X62 K;  3U4L A;  4RTF D;  4BG9 A;  3SI6 A;  3WXL A;  4DTP A;  2HMP A;  3ASM A;  4BDZ A;  3QER A;  3QIC A;  4EP5 A;  4YOV A;  3SNN A;  5HOO A;  3KLF A;  1WSH A;  1L3S A;  5AZJ A;  3D6R A;  4K41 A;  1ZBI A;  2FSK A;  4BGB A;  2Y1I A;  1JCE A;  4YOU A;  1H1V A;  3EY1 A;  4FLT A;  3DLB A;  4KHQ A;  3AA5 X;  4JAX A;  4N76 A;  4NO7 A;  1X9W A;  1WB9 A;  3VQD A;  4FWL A;  4CGD A;  2VGN A;  3PO4 A;  2DFH A;  3LAN A;  3FZL A;  2W41 A;  1IBM K;  2J4R A;  3MN9 A;  5E26 A;  4KH5 A;  4FK0 A;  5AZI B;  2E2O A;  1VQP N;  4B3R K;  3MX5 A;  4B1X B;  4JN4 A;  1IG8 A;  3GOI A;  4FJ9 A;  1RBT A;  2E8A A;  3ULD A;  2VCP A;  2Y1J A;  4FM2 A;  4FLW A;  3CME N;  3CJB A;  3V9S A;  4JKG A;  4N47 A;  2FXU A;  3M8Q A;  1GOB A;  2P9N A;  3WNF A;  3ZT3 A;  1RT3 A;  1NK0 A;  1VSJ A;  5HBM A;  4CHQ A;  2DY4 A;  1U04 A;  3PY8 A;  1VQ5 N;  5J1E A;  3FE1 A;  4O44 A;  4Z0U A;  3NH0 A;  3KWI A;  1BO5 O;  4XH1 A;  1IBK K;  2VGM A;  3RMD A;  3QNO A;  1XMO K;  1NLV A;  4YNQ A;  4OPJ A;  4CJP A;  3S3N A;  3LDN A;  3F2K A;  3DLK A;  3QEP A;  4FZY A;  2D0O A;  4BWM A;  1OH7 A;  5EX5 A;  2E1Y A;  3QIN A;  3SPY A;  1HUX A;  2Z1H A;  4DTM A;  1RIL A;  1KFD A;  3QET A;  1QQN A;  4FLZ A;  4LD0 A;  2WOM A;  1WSJ A;  1VQ7 N;  1XMQ K;  4ISE A;  3H3N O;  2JLE A;  2GUI A;  4M45 A;  3WEE A;  2ZWH A;  1NKB A;  1S1W A;  4MQ3 A;  4BC4 A;  3H1V X;  3VEO A;  2FC0 A;  3SUN A;  4LF9 K;  2D5R A;  3CFR A;  3AVN A;  3AO1 A;  3LAK A;  4BDY A;  3RR7 A;  3D2F A;  1BDG A;  4KKO A;  3HL8 A;  4AM7 A;  3MXM A;  4CEO A;  2X6S A;  1BL3 A;  3V4I A;  2P9U A;  4DSE A;  2A1R A;  4F3O A;  2YX6 A;  3P4I A;  4DV7 K;  3L8B A;  1VQ8 N;  3ZEU B;  4DV2 K;  2YKN A;  1YUW A;  1XQS C;  4RCH A;  3F9M A;  1I39 A;  2VQE K;  4BRL A;  3MCA B;  4B9U A;  4I7F A;  3PX0 A;  3SUQ A;  4ZHR A;  3OYJ A;  3LDL A;  4ISG A;  4PHT X;  4BE1 A;  5FPD A;  3T1H K;  5JS2 A;  3QB0 A;  5HRP A;  3C0B A;  3RSE B;  3FR0 A;  4CJ7 A;  4U7B A;  5IWA K;  1NOY A;  2A40 A;  1ZBS A;  4NLB A;  1YTU A;  3BGR A;  4CVN E;  2QTD A;  4TSX A;  1TV6 A;  3AVF A;  3G0Z A;  5EOY A;  3HVT A;  4CED A;  4CHP A;  1BGX T;  4KHU A;  1XNQ K;  1VSF A;  5AQX A;  1GLF O;  2XY5 A;  2XRI A;  3MXI A;  4FJK A;  5ELZ A;  2D1K A;  3CQX A;  4JKA A;  2R7Y A;  1NGC A;  3F5T A;  4CIG A;  4BY9 C;  3EZ5 A;  4EHT A;  1KVC A;  4DS4 A;  2ZQB A;  3OA9 A;  2KZZ A;  3MK6 A;  3DWL A;  1D5A A;  1JJ2 M;  3VTH A;  2D0A A;  3S3M A;  4FWR A;  1U4B A;  4FWQ A;  3C6U A;  3NVK A;  5TKW A;  5AZI A;  4DU3 A;  2HHS A;  3VER A;  4M3Z A;  2G8H A;  2RF2 A;  1SQK A;  4H4O A;  1MDU B;  2KW4 A;  3CCU N;  5JS1 A;  2IVO A;  1NGA A;  3WNH A;  3OYE A;  1S9G A;  3E1Y A;  3WXK A;  4BC5 A;  2KTQ A;  4DG1 A;  1RTI A;  3DXM B;  4WQ5 C;  3O9S A;  3ZX3 A;  3ATU A;  4ID1 A;  1LWC A;  3QML A;  5AQT A;  2E2N A;  3WXI A;  4DCH A;  1VSE A;  4DFP A;  3SJH A;  4EAH D;  1YJW N;  1U49 A;  1BCO A;  1CZA N;  4CBW A;  2CGK A;  1BHL A;  2OPQ A;  1V4S A;  3VN5 A;  3L2R A;  3AV9 A;  2PYL A;  5GIN A;  3C65 A;  3BY5 A;  3NCI A;  4JK9 A;  3CYM A;  3H08 A;  3A0I X;  4HTU A;  4DR5 K;  2QK9 A;  4PWD A;  4ID5 A;  3SUP A;  4DKW A;  5AFU H;  4J8F A;  4QOZ B;  4BRQ A;  3KK3 A;  1MU2 A;  3DYA A;  1XUP O;  1L3V A;  2ASP A;  1W7A A;  4JNE A;  1OKJ A;  1OVQ A;  4JRP A;  3CXC M;  3D7E O;  3CJA A;  1TK8 A;  1E3M A;  1ASV A;  2YKM A;  1C0G A;  3V1O A;  1D9F A;  3CET A;  4LF5 K;  4KH6 A;  3VEX A;  3QEV A;  4CES A;  3KWG A;  5HRO A;  3SQ1 A;  1U2V B;  4O0J A;  4E89 A;  3ZT1 A;  1Z05 A;  2W42 A;  1K8K B;  4KH4 A;  5HRS A;  4M3R A;  3DLH A;  4CFD A;  4EZ9 A;  3LP2 A;  4NCG A;  1WLJ A;  1QQO A;  3OYG A;  3ATV A;  4JEP A;  3C94 A;  1REV A;  4CFB A;  1RBU A;  3KLH A;  3JSM A;  3VTI A;  4CBU A;  4HCB A;  4C23 A;  3BF3 A;  4W5O A;  5DK5 A;  4OLB A;  1IV0 A;  2JWL A;  3HOT A;  1QZ6 A;  1RTH A;  4B1V A;  3B6P A;  4B9V A;  1ASW A;  4JI2 K;  4AHU A;  4IG3 A;  3OVN A;  4CGJ A;  4CER A;  4O5F A;  3EN9 A;  3O1W A;  3ZEU A;  1X9S A;  2HF4 A;  4IOX A;  2AP1 A;  3OYH A;  4JI6 K;  2A6A A;  3CPE A;  1VQO N;  3B6O A;  4C1N K;  3B8A X;  4I6M A;  4A5A A;  3PX4 A;  5AQQ A;  2E2P A;  3KJV A;  3ZX2 A;  1NGB A;  5M1K A;  1J53 A;  4DSL A;  3UKR B;  3VGM A;  3FZM A;  4JHD B;  4CE9 A;  3CCJ N;  4OKJ A;  1C0U A;  1HMV A;  3WQT A;  4BRA A;  3G4S N;  3RSE A;  2XY7 A;  5K14 A;  4E1M A;  1T3V A;  1HNV A;  1TUY A;  5GAE P;  3NH1 A;  1GLA G;  3ZT2 A;  4JI7 K;  5AQP A;  1KFS A;  4BVP A;  3E66 A;  4YFU A;  2GEL A;  4DHY A;  3O9R A;  3M6G A;  5CR4 A;  3M5R A;  4K8X A;  4Y1D A;  1RDB A;  3MWP A;  3DRR A;  5CZ1 A;  3V6D A;  3UE5 A;  4FPB A;  4DQS A;  1WUA A;  2O8D B;  3M8R A;  4B1Y B;  4PUO A;  3P5J A;  3KHY A;  4LC9 B;  4CEE A;  3O6W A;  2Q36 A;  3GBT A;  4IJA A;  3C7N B;  2QW9 A;  1P8Z A;  5ADX A;  1ZBL A;  4BR7 A;  3M3Z A;  1WSG A;  3QNN A;  4MLE A;  1HYV A;  4JKB A;  5SZT A;  2IS3 A;  1U45 A;  1YT3 A;  3NGI A;  2PFU A;  1QZ5 A;  4EIA A;  4F9O A;  3HPH A;  4FK4 A;  4UY8 O;  1TGO A;  3KK1 A;  3K9J A;  4BRD A;  4B9T A;  2FBY A;  4FZX C;  3LM9 A;  1W9H A;  3DLR A;  1T6C A;  3SJJ A;  3T1Y K;  4M3U A;  2QM1 A;  5M1N A;  2GV9 A;  5C12 A;  3I8B A;  1NK7 A;  4CJL A;  5JLF A;  2F9T A;  4CEZ A;  3VOV A;  3THW A;  3J7A P;  4OJR A;  1JKH A;  2WFB A;  3AA3 A;  2W6K A;  3P39 A;  1T05 A;  4FWN A;  3VQ4 A;  4HVJ A;  3ENH A;  3OYC A;  4BQL A;  1KAX A;  2QWQ A;  4AHC A;  1YIJ N;  3SQ0 A;  4J2B A;  3CMA N;  1NGD A;  3NF9 A;  2WBN A;  1A5X A;  3O1B A;  4DTS A;  1JL2 A;  3AVI A;  2WUS A;  3N4P A;  4YHH K;  2HND A;  4DV5 K;  3ZSV A;  3HPO A;  2E20 A;  1BWF O;  3TAM A;  3DLE A;  3TAB A;  5DMR A;  4E7L A;  4RW9 A;  4EHU A;  4CJU A;  4CD3 A;  1FKO A;  1Q18 A;  4CGF A;  2IIR A;  3VET A;  4CZK A;  4O8K A;  2UUA K;  2ZM6 K;  3TI0 A;  5DM6 L;  1QSY A;  3BUZ B;  4IFY A;  4X65 K;  5AQG A;  1U2V A;  3EO3 A;  3G71 N;  1DEJ A;  2NLX A;  5LMN K;  3HZ6 A;  3EYZ A;  3VEY A;  3AVL A;  1K73 O;  4YOW A;  1SZ2 A;  1K8K A;  3HO1 A;  4B9S A;  1T6D A;  1OH8 A;  3C95 A;  1QE1 A;  2NRZ A;  4XEI A;  4CJE A;  5DM7 L;  3NGZ A;  4DUZ K;  2ITG A;  4BR4 A;  4JI8 K;  3CQ8 A;  4KHS A;  3R3L A;  1HNI A;  4BRO A;  3CM6 A;  4BRH A;  4DV4 K;  3VQA A;  4B9Q A;  3CCM N;  1VQ9 N;  3FZH A;  3KKR A;  4LFB K;  3L3V A;  4F2R A;  3K58 A;  3KLE A;  2F96 A;  4DQ8 A;  2PY5 A;  3VES A;  3OYA A;  3QEW A;  2D0B A;  3CJ1 A;  5AQH A;  4B8C A;  5LJV A;  3ZLJ A;  3MWT A;  4CJR A;  1HLU A;  3K0S A;  1HRH A;  4CHO A;  4GMJ B;  1TL3 A;  3O3G A;  2HHH K;  3HM9 A;  2HHU A;  1NGH A;  3UKR A;  4JHD A;  3QBX A;  2O4G A;  1ZXO A;  4IO8 A;  3VPZ A;  3O4W A;  1L3T A;  4W5Q A;  5HRR A;  3VF4 A;  1EKE A;  4BR0 A;  4IZ9 A;  3QIO A;  1VQN N;  3HP6 A;  2YNG A;  1YXQ A;  2HW3 A;  3GDQ A;  1IKV A;  1M1K O;  4CEQ A;  4QS8 A;  1K9M O;  3VMF B;  4DV6 K;  1HR0 K;  3M8P A;  1FK9 A;  5H1S Q;  1Z26 A;  4A62 A;  2FBV A;  5AQM A;  2O8D A;  3D0P A;  2NRR A;  4CEC A;  4H5R A;  4F4K A;  4DQQ A;  1KD1 O;  4PY5 A;  4CW7 B;  5CZ2 A;  4CFA A;  5M1P A;  3DLG A;  3C7N A;  1HKC A;  2YNF A;  3U9D A;  3DAW A;  3U3Y A;  1NK5 A;  1S1V A;  4E7J A;  1IBL K;  1WAJ A;  1MWK A;  4WF9 L;  5F1X A;  5FLX O;  1QHA A;  3CC2 N;  4DR7 K;  3MN6 A;  3LP0 A;  1VSK A;  4LF8 K;  4IFE A;  2IC3 A;  2GUP A;  4CJ3 A;  3J81 O;  5KPZ A;  4KO0 A;  4BE2 A;  3QIP A;  4M42 A;  4DLG A;  1KAY A;  1IJJ A;  5LY3 A;  1ILY A;  4GY2 B;  3O80 A;  3IUC A;  2HMI A;  1ESV A;  2CGJ A;  2UXC K;  1S22 A;  3U6F A;  1RNH A;  4DU4 A;  3AY9 A;  3KK7 A;  4ILH A;  4CF0 A;  1OH6 A;  1N5Y A;  3I33 A;  4NB4 A;  1U47 A;  5AQV A;  1NBW A;  4HTL A;  2XY6 A;  4JI5 K;  3S9H A;  3VQ9 A;  4W5R A;  1NKE A;  5C0Y A;  4NXM K;  1J5E K;  3QFU A;  3VA0 A;  2P5O A;  3BZK A;  2E5L K;  4WQ4 C;  1ZYQ A;  4JK8 A;  5E84 A;  4FWS A;  4EP4 A;  2UUC K;  3I0R A;  4J2A A;  2I7N A;  4B3O A;  1UA0 A;  2O8B B;  4KV8 A;  3TAE A;  3CHW A;  4FJX A;  1B92 A;  4G1Q A;  4CBX A;  2F4V K;  3O08 A;  5F2R A;  4QS9 A;  3VGL A;  2PBD A;  4YOX A;  5JIC A;  4RW6 A;  4DTN A;  2IGI A;  3O9T A;  4B1Z A;  4JKD A;  3PSF A;  2XHB A;  2KZM A;  3LDO A;  3J7Y P;  3PX6 A;  4FSV A;  5AQN A;  1VRU A;  1QSS A;  3WUH A;  1IG9 A;  4IXC A;  1TK5 A;  1RDC A;  1U6Z A;  2V52 B;  1LAW A;  3JAM O;  4BQZ A;  2W6L A;  4KTQ A;  1ZBF A;  3TTD A;  2FBX A;  4BRP A;  4GVE A;  4JI0 K;  4JKE A;  4FJI A;  3HYF A;  4QAG A;  1N6Q A;  5EU7 A;  1NGI A;  2ASO A;  4CF1 A;  3QEX A;  4NLC A;  5KQ8 A;  4DMN A;  2RPI A;  2P5G A;  5GAD P;  1I94 K;  4AM6 A;  3O3F A;  3AVM A;  4CZG A;  2Q97 A;  4DFK A;  3VEV A;  4KHW A;  5AQO A;  5C2F A;  4RW7 A;  1RT6 A;  4H0P A;  1DTT A;  1CZ9 A;  4FW1 A;  4YOT A;  3T1A A;  2B4J A;  2H3G X;  3KZB A;  4DSJ A;  5JVG L;  3DLL L;  2YNI A;  1Q81 O;  4BRM A;  5FPM A;  1NOZ A;  1M90 O;  2E1Z A;  4LSN A;  1QVG M;  4B9N A;  1N32 K;  4RG8 A;  5BRH A;  2EX3 A;  1Y64 A;  2W40 A;  1WOQ A;  3TAP A;  3SMS A;  4DTR A;  4H5W A;  1XNR K;  4W5N A;  1NGG A;  3AVJ A;  1VQM N;  3OS1 A;  4DTU A;  4B1U B;  1LCU A;  5LL6 Z;  2F9W A;  3H3O B;  1UAX A;  3G25 A;  3JYT A;  4X64 K;  1NK4 A;  1LWE A;  5BR8 K;  1XC3 A;  4GNI A;  5CHI A;  3AO3 A;  1ZBH A;  3F73 A;  1SAZ A;  4H0O A;  4CHZ A;  4DB3 A;  5SWM A;  1S6Q A;  2KHO A;  4KB1 A;  5M1F A;  2Q0R A;  3DM2 A;  4FPA A;  5KGW A;  2G8W A;  5C15 A;  1I3A A;  3N4Q A;  4FVU A;  4H0X B;  3A5L C;  1EQY A;  3HSC A;  4EZ6 A;  2FBT A;  2O8F B;  4OLA A;  3OYD A;  3O8M A;  1RDU A;  4H03 B;  4CK1 A;  1WAF A;  5C25 A;  3LPT A;  5FPN A;  4AHS A;  3E01 A;  3V81 A;  4C1N I;  3AAP A;  5KPT A;  1TKX A;  4KTZ A;  5KRT A;  3A5N C;  4CI6 A;  1VSD A;  4JD2 B;  2P1J A;  4A2B A;  4HHT A;  1LAV A;  4J2D A;  1GLL O;  4LF6 K;  4DV0 K;  2NUB A;  3VQC A;  2QWR A;  4E3S A;  3BDP A;  2HHQ A;  1YAG A;  3K5O A;  2G8U A;  3MMV A;  3RMC A;  3LAM A;  4IO9 L;  4LH4 A;  3ZSW A;  4NCB A;  3SZ2 A;  4AHV A;  3HOS A;  4CCH A;  4JRQ A;  2KQ2 A;  2O8B A;  5BR9 A;  3RVC A;  1EWQ A;  1C1A A;  3A5O C;  5AQJ A;  5BPM A;  4Z4H A;  4CHY A;  3OY9 A;  2OPP A;  1N8R O;  1Z6R A;  1NJW A;  1JLB A;  4O0I A;  1BA1 A;  4CEF A;  3MEC A;  3P1G A;  2OPS A;  1WSF A;  4CGI A;  1HKB A;  1WSE A;  5KGX A;  3MN7 A;  3ULE B;  1NMD A;  2A3Z A;  1ATS A;  3FLC O;  4FJH A;  3MX2 A;  4YOR A;  1Q8I A;  3O9Q A;  1N34 K;  1NG9 A;  3U8X A;  3V9W A;  4C8M A;  4H8K A;  2UXD K;  4LFA K;  3OJS A;  3I8D A;  1LW0 A;  3OBY A;  3RR8 A;  3ZSX A;  1T8E A;  4H5V A;  4A59 A;  2FSJ A;  3HXM A;  2Q31 A;  4FW2 A;  5AQU A;  2YJF A;  3NMU A;  2B6A A;  5F0X A;  4DV3 K;  1KQS M;  3VQ7 A;  3ZX0 A;  5CE3 A;  2E88 A;  2NRX A;  1WN7 A;  2RHK A;  4IDK A;  1S3X A;  4IOC L;  1Q82 O;  3WT0 A;  4ZTF A;  5E41 A;  4V19 S;  4CF9 A;  1HQU A;  4E7K A;  3V9U A;  4DQI A;  2P9I B;  5EVZ A;  4JS4 A;  3TAF A;  1XHZ A;  3RRG A;  4DR1 K;  2UUB K;  1HJO A;  2YI1 A;  3NF6 A;  4LY7 A;  3BEX A;  3RWU A;  3OS0 A;  1EO1 A;  1N33 K;  3LDP A;  3L2W A;  3OYM A;  4FOI A;  2OZS A;  1Y97 A;  2CH6 A;  2YHX A;  2GWK A;  4LF4 K;  4KRE A;  5I3U A;  3RRH A;  5EXW A;  4Z4G A;  3THY B;  4GVM A;  2WC9 A;  3NE6 A;  1HYS A;  1KLM A;  3PSI A;  2HHW A;  1RCH A;  3IRX A;  3AA4 A;  1TKD A;  3CJ9 A;  1RFQ A;  3TPQ A;  3EKS A;  2YNH A;  4K0K K;  1Q7Y O;  1D4X A;  1HNX K;  2BH1 A;  1TYQ B;  4WQ4 A;  3T7Z A;  3LZJ A;  3TAG A;  4CJF A;  4W5T A;  4YDU C;  3S41 A;  1YI2 N;  1BQN A;  2VYP A;  2QWP A;  3MAQ A;  3VQB A;  2O8F A;  3HPG A;  3THX B;  1GLJ O;  2YHA A;  3O9U A;  4NXN K;  5AQS A;  3AVC A;  3UKU B;  4L3Q A;  1FW6 A;  2I7P A;  3L2V A;  4HCC A;  2HHX A;  2VWJ A;  1Z25 A; 
#chains in the Genus database with same CATH homology
 2A5X A;  3CCE N;  1R59 O;  4GV9 A;  5B8H A;  3KWI A;  4JD2 A;  3W0L A;  4WCE L;  3OW2 M;  1NGH A;  3UKR A;  4BGA A;  4JHD A;  3QBX A;  4IO8 A;  1ZXO A;  5BRF A;  1BO5 O;  3CQY A;  3HTV A;  4XH1 A;  3O4W A;  1J6Z A;  3VPZ A;  1BUP A;  2VGM A;  3HRG A;  3IFR A;  4OPA A;  4CZJ A;  3VF4 A;  5C10 A;  4BR0 A;  3FZF A;  1NLV A;  4IZ9 A;  5ADX H;  1VQN N;  4QS7 A;  1DT9 A;  3LDN A;  2QI2 A;  3F2K A;  1YXQ A;  3GDQ A;  2HBK A;  2F7T A;  1YVN A;  2D0O A;  3ENO A;  1M1K O;  5EX5 A;  2E1Y A;  4QS8 A;  2RE2 A;  1K9M O;  3VMF B;  1HUX A;  3C6H A;  1YJN N;  1KC8 O;  4JKH A;  5H1S Q;  4A62 A;  4IJN A;  5AQM A;  3GE1 A;  1NGF A;  3DXM A;  3QDK A;  4GV6 A;  2NRR A;  1QQN A;  1DGK N;  4H5R A;  5AFU A;  1VQ7 N;  3L0Q A;  3JS6 A;  4ISE A;  1KD1 O;  3H3N O;  3J8A A;  5M1P A;  3VF6 A;  3C7N A;  3WEE A;  2ZWH A;  1HKC A;  2Q0U A;  4BC4 A;  3H1V X;  2DPN A;  3MCP A;  3U9D A;  2NRW A;  3VEO A;  5FPE A;  3DAW A;  3ULE A;  5AQY A;  2EWS A;  2QWO A;  1HPM A;  5AQZ A;  1C0F A;  2CH5 A;  1GLE G;  2A42 A;  4BC2 A;  1E4F T;  1MWK A;  3CIP A;  4WF9 L;  4IOA L;  5F1X A;  3GG4 A;  5C2D A;  3D2F A;  1BDG A;  1QHA A;  4PL8 A;  5AQK A;  4AM7 A;  3CC2 N;  4M7Y A;  3MN6 A;  4IFE A;  2GUP A;  2HBJ A;  4IWV A;  2P9L A;  1BG3 A;  2P9P B;  2P9U A;  4K43 A;  2YX6 A;  3P4I A;  5KPZ A;  1VQ8 N;  1W2B M;  1ATN A;  3ZEU B;  3R8E A;  4U67 L;  5LJW A;  3PLA A;  2GWJ A;  1YUW A;  1KAY A;  5AQR A;  3A5M C;  1XQS C;  2D0P A;  3F9M A;  4RCH A;  4PKI A;  1IJJ A;  4BRG A;  3CJ7 A;  2ZJQ L;  1JCG A;  3ID6 A;  1GLC G;  4BRF A;  5LY3 A;  4BRL A;  1ILY A;  4GY2 B;  3MCA B;  4BR5 A;  3O80 A;  3Q7C A;  3IUC A;  4BG8 A;  1ESV A;  3IKM A;  2CGJ A;  1S22 A;  5JLH A;  3LDL A;  3AY9 A;  1DKG D;  4ISG A;  4PHT X;  5GIO A;  3KK7 A;  4ILH A;  3VEW A;  5FPD A;  2ZF5 O;  1S72 N;  4ILG B;  3I33 A;  4NB4 A;  3ZET A;  5KPR A;  3QB0 A;  5AQV A;  1NBW A;  3C0B A;  3SBG A;  4HTL A;  3RSE B;  3FR0 A;  2QWM A;  4CJ7 A;  2P9I A;  4U7B A;  3L4Q A;  3DJC A;  5C0Y A;  3SAF A;  2A40 A;  2KKZ A;  2QWL A;  3QFU A;  1ZBS A;  4JKG B;  4WFN L;  4WQ4 C;  4JK8 A;  4NLB A;  5E84 A;  5KQD A;  4FWK A;  2QTD A;  4FWS A;  3R1X A;  3QBW A;  3R6M A;  2I7N A;  3MN5 A;  4Y0W A;  5EOY A;  1VQ4 N;  1VQ6 N;  2A41 A;  5AQX A;  1GLF O;  3CHW A;  5ELZ A;  2D1K A;  3CQX A;  4JKA A;  4CBX A;  5GAG P;  3O08 A;  1NGC A;  3F5T A;  4BY9 C;  5F2R A;  5HL7 L;  3H6E A;  3LM2 A;  4QS9 A;  4EHT A;  2FF6 A;  3VGL A;  1NM1 A;  2BTF A;  3C6A A;  3D2E B;  3OA9 A;  3SBT A;  2PBD A;  3MK6 A;  3DWL A;  5BPN A;  5JIC A;  4YOX A;  1JJ2 M;  3EE9 A;  3VTH A;  3ID8 A;  2D4W A;  3U9Z A;  3EKU A;  3O9T A;  4B1Z A;  4FWR A;  1NWK A;  4FWQ A;  3K9K A;  4K25 A;  4JKD A;  3NVK A;  3MDQ A;  5TKW A;  3LDO A;  4FSV A;  5AQN A;  5AZI A;  3VER A;  3WUH A;  2NNW A;  3TSU A;  1SQK A;  4IEI A;  4IXC A;  3EE8 A;  1MDU B;  1U6Z A;  2V52 B;  5JMV A;  3CCU N;  5JVH L;  1YHQ N;  4CZH A;  4BQZ A;  2IVO A;  1NGA A;  5TKY A;  1TYQ A;  3TSP A;  3TTD A;  4BRP A;  3E1Y A;  1VQK N;  3WXK A;  4BC5 A;  4OPH A;  3Q7B A;  4GVE A;  4MLH A;  4JKE A;  3CC7 N;  5AQI A;  2NRT A;  4A61 A;  3DXM B;  3E9P A;  4WQ5 C;  1NGI A;  2ASM A;  2ASO A;  3ENB A;  3O9S A;  3LL3 A;  3ZX3 A;  5AQW A;  1VAZ A;  3ATU A;  3QML A;  5AQT A;  2E2N A;  3WXI A;  4NLC A;  5AR0 A;  3VEZ A;  4DCH A;  3CCS N;  3TU5 A;  3SJH A;  4IEE A;  4EAH D;  3DXK B;  1YJW N;  5KQ8 A;  3UKU A;  3IMX A;  1CZA N;  4CBW A;  3JXU A;  2CGK A;  5AQL A;  5I9E B;  3W3D A;  1V4S A;  5AQF A;  5GAD P;  1LOT B;  4AM6 A;  5BRD A;  2P9K B;  4CZG A;  5GIN A;  3C65 A;  2Q97 A;  3VEV A;  2NZT A;  4FOE A;  1GLD G;  4EFH A;  1E4G T;  4JK9 A;  5AQO A;  5C2F A;  3T69 A;  3A0I X;  4H0P A;  4YOT A;  4BRC A;  4Z94 A;  2GEM A;  1G99 A;  2H3G X;  3PIP L;  2OTJ N;  3H1Q A;  3KZB A;  2P9S B;  4DKW A;  5AFU H;  4J8F A;  3DLL L;  4BRQ A;  5JVG L;  1Q81 O;  1ATR A;  4H5N A;  4H0T B;  4BRM A;  1XUP O;  2YCH A;  2ASP A;  5AZJ B;  4JNE A;  1OKJ A;  5FPM A;  4FWO A;  1M90 O;  2E1Z A;  3CXC M;  4XH4 A;  3D7E O;  3CJA A;  3J7Z O;  1QVG M;  3VF2 A;  5BN8 A;  5BRH A;  1C0G A;  1Y64 A;  2W40 A;  3CET A;  1WOQ A;  1X3M A;  4CZM A;  4G9Z A;  3SMS A;  4H5W A;  4JK7 A;  4GV3 A;  4KH6 A;  3VEX A;  5GIP A;  2YHW A;  1NGG A;  3KWG A;  4MO5 A;  2QEX N;  2HBL A;  1VQM N;  2V7Y A;  1U2V B;  4B1U B;  1LCU A;  1Z05 A;  2F9W A;  3H3O B;  3G25 A;  1XC3 A;  1TUU A;  4GNI A;  5CHI A;  1K8K B;  3CC4 N;  3LDQ A;  4KH4 A;  1SAZ A;  4H0O A;  1YIT N;  3FFK B;  1QQO A;  4DB3 A;  3ATV A;  4JEP A;  2QA4 N;  1VQL N;  2KHO A;  4BR9 A;  3VTI A;  5M1F A;  2Q0R A;  4WFB L;  4CBU A;  3GL1 A;  4BR2 A;  4FPA A;  3FZK A;  4XH5 A;  4C23 A;  5C15 A;  1QVF M;  4WYB A;  4CZL A;  1ZC6 A;  3N4Q A;  2HBM A;  1K8A O;  2QWN A;  2YHY A;  3BF3 A;  4FVU A;  2HF3 A;  3A5L C;  4H0X B;  2BUP A;  3UB5 A;  3G6E N;  3SLC A;  1EQY A;  4A57 A;  2JWL A;  3HSC A;  4ILJ A;  3OBW A;  3HOT A;  1QZ6 A;  4B1V A;  3BF1 A;  4H0V B;  3WXM B;  1NJI O;  2P9N B;  1YF5 L;  2P9P A;  1BA0 A;  3O8M A;  3TSQ A;  4PL7 A;  1RDU A;  4FL9 A;  4H03 B;  5M1O A;  1BU6 O;  4O5F A;  3EN9 A;  3O1W A;  2GX9 A;  3ZEU A;  5FPN A;  2HF4 A;  3O5B A;  4IOX A;  3SAG A;  2AP1 A;  2A6A A;  3CPE A;  1VQO N;  4C1N I;  3AAP A;  5KPT A;  4CZI A;  4C1N K;  3B8A X;  4I6M A;  3E9L A;  4A5A A;  5AQQ A;  2UYT A;  2E2Q A;  2E2P A;  3SAH A;  3CCV N;  3A5N C;  3ZX2 A;  1X3N A;  1NGB A;  2VWB A;  3EZW A;  3M1F A;  4JD2 B;  4A2B A;  4BRN A;  5M1K A;  4MDB A;  3UKR B;  4K42 A;  3VGM A;  3PIO L;  3FZM A;  3OHR A;  4JHD B;  3NVM A;  3QFP A;  3CCJ N;  4BRI A;  3I56 N;  1GLL O;  3CF5 L;  3R9P A;  1P90 A;  4M63 C;  3WQT A;  4BRA A;  4CI6 A;  2QWR A;  3G4S N;  2ZGZ A;  5MLC Q;  3RSE A;  1YAG A;  3MMV A;  3I55 N;  4YDU A;  4IO9 L;  1T3V A;  3HBT A;  1TUY A;  5GAE P;  3CCL N;  2IVP A;  3HOS A;  1GLA G;  1YJ9 N;  1BOT O;  5AQP A;  4IDH A;  4BVP A;  3E66 A;  2Q1N A;  2GEL A;  4DHY A;  3O9R A;  2QXL A;  3M6G A;  2NRV A;  5BR9 A;  3H45 C;  3RVC A;  4WFA L;  5CR4 A;  3A5O C;  3M5R A;  5AQJ A;  4BVO A;  5BPM A;  3MWP A;  3CPW M;  1HX1 A;  3UE5 A;  4FPB A;  1WUA A;  1N8R O;  4B1Y B;  3KHY A;  3CI5 A;  4LC9 B;  1Z6R A;  1V4T A;  2ZJR L;  3O6W A;  1X9J A;  3ZYY X;  3D2E A;  1BA1 A;  2Q36 A;  3GBT A;  4IJA A;  1RDW X;  3C7N B;  4FO0 A;  3WEE B;  2CGL A;  2QW9 A;  1P8Z A;  1HKB A;  5BN9 A;  4B1W B;  3CER A;  4CZF A;  5ADX A;  4RWT A;  3MN7 A;  3ULE B;  1NMD A;  4BR7 A;  3M3Z A;  4ISF A;  3CCQ N;  2A3Z A;  1ATS A;  4M7X A;  3FLC O;  4MLE A;  4JKB A;  3AAR A;  3MX2 A;  4YOR A;  2V51 B;  1MWM A;  1KAZ A;  2PAV A;  4PKG A;  3HI0 A;  3TTF A;  3O9Q A;  3D2F B;  4H5T A;  2PFU A;  1QZ5 A;  3U8X A;  3VEN A;  4WQ5 A;  3WXJ A;  4EIA A;  1QQM A;  4F9O A;  2HST A;  2Q2R A;  2GTD A;  2P9L B;  2V7Z A;  4UY8 O;  3K9J A;  1OVY A;  3E9O A;  2P9U B;  3OBY A;  4BRD A;  4BRE A;  5BPL A;  5GAH P;  2ZGY A;  3CCR N;  3LM9 A;  2YJE A;  4H5V A;  2FF3 B;  1T6C A;  2FSJ A;  3CJC A;  4HWI A;  4A59 A;  5BRE A;  2Q31 A;  5AQU A;  2QM1 A;  5M1N A;  2YJF A;  5C12 A;  4A2A A;  3NMU A;  3I8B A;  5JLF A;  2F9T A;  3DXK A;  1GLB G;  3VOV A;  3CD6 N;  2IVN A;  1NGE A;  2JWK A;  3L4I A;  5F0X A;  2FSN A;  1RGI A;  1JCF A;  2WFB A;  1W97 L;  3P31 A;  4JKF A;  1KQS M;  3P39 A;  2HOE A;  3FGU A;  4MO4 A;  4FWN A;  5M1Q A;  3ZX0 A;  4BRK A;  5CE3 A;  2E88 A;  2NRX A;  2FLO A;  2P9K A;  3AGR A;  3VGK A;  3ENH A;  2RHK A;  4KBO A;  1SS6 A;  3KVG A;  3P38 A;  4BQL A;  1S3X A;  1KAX A;  3U4L A;  4RTF D;  4BG9 A;  4IOC L;  3ZET B;  1Q82 O;  3WT0 A;  3BP8 A;  3WXL A;  2QWQ A;  2OAN A;  2HMP A;  2NRH A;  3SMP A;  4AF1 A;  4YOY A;  3H46 O;  1YIJ N;  2OTL N;  3EL2 A;  2P9I B;  3CMA N;  1NGD A;  1T44 A;  5EVZ A;  2P9S A;  2WBN A;  3O1B A;  3QIC A;  4R79 A;  1HJO A;  2YI1 A;  4YOV A;  3BEX A;  5HOO A;  5AZJ A;  1EO1 A;  3D6R A;  3LDP A;  4K41 A;  2FSK A;  2WUS A;  3N4P A;  4BGB A;  4FOI A;  4CD1 A;  1JCE A;  4YOU A;  1H1V A;  2E20 A;  1BWF O;  2KLA A;  4EHU A;  4CD3 A;  3IDH A;  2CH6 A;  4JAX A;  1Q18 A;  2YHX A;  2IIR A;  4NO7 A;  2GWK A;  3TTC A;  4I6M B;  3VET A;  4CZK A;  4O8K A;  4FWL A;  4JKC A;  5EXW A;  2VGN A;  5EY4 A;  5DM6 L;  3L6Q A;  3BUZ B;  1NGJ A;  5AQG A;  1U2V A;  3HM8 A;  3EO3 A;  2WC9 A;  3G71 N;  1DEJ A;  2NLX A;  3FZL A;  3HZ6 A;  3WQU A;  3VEY A;  2W41 A;  2J4R A;  3MN9 A;  1K73 O;  5E26 A;  4KH5 A;  4E1J A;  4YOW A;  1SZ2 A;  1K8K A;  5AZI B;  1MA9 B;  2E2O A;  1T6D A;  1VQP N;  3MX5 A;  4B1X B;  4BC3 A;  2NRZ A;  3CJ9 A;  1RFQ A;  4MDA A;  4XEI A;  3EKS A;  3TPQ A;  4JN4 A;  5DM7 L;  1IG8 A;  1Q7Y O;  4BR4 A;  4O8U A;  1D4X A;  3R3L A;  3GOI A;  2BH1 A;  1TYQ B;  4WQ4 A;  3T7Z A;  2E8A A;  4BRO A;  4BRH A;  2VCP A;  4PKH A;  3CCM N;  4B9Q A;  4FWP A;  3SK3 A;  1VQ9 N;  4YDU C;  3A8Y A;  1KXP A;  3S41 A;  3CME N;  3FZH A;  1YI2 N;  4A5B A;  3AAQ A;  3AGK A;  2VYP A;  4FWM A;  3CJB A;  2QWP A;  4JKG A;  2FXU A;  4DQ8 A;  1GLJ O;  2AA4 A;  2P9N A;  3O9U A;  1HKG A;  5AQS A;  3VES A;  4OO1 J;  3UKU B;  4L3Q A;  1Q86 O;  2I7P A;  2ITM A;  1O13 A;  3CJ1 A;  5AQH A;  5LJV A;  4CZE A;  3MWT A;  2ZJP L;  1HLU A;  1VQ5 N;  4H0Y B;  3FE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...