4BROA

Legionella pneumophila ntpdase1 crystal form iv (part-open)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
351
Chain Sequence
b'NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEDWTIGVVLHRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 110
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4broA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4broA02
4FOIA 1NGEA 2GTDA 2QWNA 5AQLA 4FWMA 2DPNA 3ENHA 2P9NB 5F1XA 1NMDA 2V7ZA 2Q1NA 3MCPA 2Q0RA 3CJ1A 5EY4A 3VGLA 4DCHA 2CGLA 4BRLA 1NGBA 4A62A 1EQYA 5BPLA 1JCEA 4BRHA 2ASPA 4E1JA 3LL3A 1QHAA 3FZMA 4BC3A 2AA4A 4BRPA 4BC2A 3O1WA 4DHYA 4H0XB 3BEXA 1NGDA 4ISGA 4PKGA 3L6QA 4IWVA 3CETA 5AQHA 3VF2A 2IVNA 2P9IA 3FR0A 4MO5A 4XEIA 3SMSA 2Q2RA 1BWFO 3IFRA 4BVOA 1KAZA 3UKUB 1QQOA 5KQDA 4AM6A 3M1FA 5BREA 3L4IA 3MK6A 3HM8A 4H5RA 2QWMA 4CBXA 4IO8A 3EKUA 3VETA 4YDUC 4CZEA 3CJCA 4XH4A 3SK3A 4H0PA 4MLEA 3GOIA 1GLAG 4EAHD 3AAPA 4AM7A 4EHTA 3UB5A 2IVPA 4BR7A 3U8XA 3VESA 3GL1A 4IJNA 3MN5A 1BDGA 4BGBA 4O8KA 4BR4A 4BREA 3MMVA 2ZGZA 3CHWA 1HPMA 4H0TB 1DEJA 5EVZA 1KXPA 2EWSA 3HTVA 3VEWA 4BR9A 2P9IB 3ATUA 2F9WA 3S41A 1T6DA 1BO5O 1ZXOA 4J8FA 3UE5A 1NWKA 4LC9B 4CI6A 3KVGA 5AQGA 2VYPA 5AQRA 3CERA 5BN8A 2WUSA 4FL9A 4CZLA 1SQKA 2YHYA 4WQ4A 1T6CA 3BUZB 2H3GX 1Q18A 4FWNA 3VERA 3BF1A 2YHXA 3A0IX 1V4TA 4O5FA 1QQNA 2CGJA 5AQXA 5AZIA 2P9UB 3O6WA 4MLHA 3LDLA 3AY9A 1S22A 3DXKB 3O5BA 1MWMA 1C0FA 3CJBA 2NLXA 3A5OC 3WXJA 4BQLA 5EXWA 2YI1A 1GLEG 3GE1A 5AQYA 5B8HA 2QWOA 3CQXA 4FWQA 1WOQA 1NGIA 3U9DA 3DJCA 3IDHA 2QWLA 1SZ2A 1TUYA 3C7NA 2D1KA 3VEZA 3R8EA 4BR5A 4FO0A 3WXIA 3UKRB 3LM9A 4B1UB 5AZJA 5FPNA 5LJVA 4JN4A 4BRFA 4I6MB 3D7EO 3JXUA 1YUWA 3H45C 4ISFA 4H5TA 1Y64A 4IXCA 1CZAN 2YJEA 2E88A 3ZETA 1NM1A 3VF6A 2V52B 1TUUA 5KPRA 2I7NA 4FWPA 2E2PA 3HSCA 3FZKA 2YJFA 3FGUA 3CQYA 3GDQA 3WT0A 3QDKA 1HKCA 1LOTB 2P9PB 4EFHA 2CH6A 4DB3A 3J8AA 2Q36A 3U9ZA 1GLFO 3R9PA 3GG4A 1MWKA 1P8ZA 2E20A 2A6AA 5AQMA 3ZEUB 3D2EB 1BA0A 3WXLA 3WEEA 2VCPA 5AQVA 4NO7A 1K8KB 3CIPA 4CZJA 4JHDB 2FXUA 3MN6A 2D4WA 4BRDA 1ZBSA 2QXLA 3D2FA 5JLHA 4RWTA 3SJHA 1E4GT 1X3MA 2PAVA 3SMPA 1E4FT 5KQ8A 2E8AA 1NGHA 4KBOA 1HKGA 3FLCO 4XH1A 1MA9B 2NRHA 2IIRA 3VGMA 5ADXA 1YXQA 3FZLA 1X9JA 3TPQA 4CZIA 3MN9A 4CD1A 1XC3A 4FPAA 1IJJA 3QFPA 3ZX0A 3FZFA 3SLCA 1RFQA 3H6EA 5KPZA 4K41A 1WUAA 5EOYA 3VEVA 3A8YA 4HTLA 1BUPA 4JD2A 3M6GA 3ULEA 5BN9A 2BUPA 3ZX3A 4BRNA 2QWQA 3QFUA 1HX1A 1J6ZA 4JAXA 1YAGA 3VEYA 1BOTO 3DXMA 1NGGA 3EL2A 4FWSA 5AQNA 3IUCA 3FFKB 1RGIA 3O80A 3MN7A 4WQ4C 3TU5A 4QS8A 5AQOA 2CGKA 2ZWHA 3ENOA 1KAYA 2P9LA 4K43A 4CJ7A 2FSJA 4BRCA 4H5VA 2KHOA 5KPTA 3QICA 1Z6RA 4CZGA 1BU6O 5LJWA 3EN9A 3C0BA 1S3XA 1T44A 1DGKN 4BRAA 2FSNA 2GWJA 4XH5A 3LDPA 1GLLO 1R59O 3QBXA 3IMXA 2I7PA 5FPDA 4BVPA 4GY2B 4JD2B 3ULEB 4M7XA 3I8BA 3DWLA 3LDNA 1OKJA 4BRIA 3EKSA 1IG8A 3H1VX 3EO3A 3WQUA 5AQZA 3DXMB 3W0LA 2V51B 5CE3A 4WQ5A 5FPMA 4WYBA 5AQUA 1NGJA 5F0XA 3ATVA 4NB4A 1X3NA 5AFUA 2P9LB 2E1ZA 3MDQA 2E1YA 3VEXA 2HF3A 1GLCG 1ESVA 2E2QA 2HOEA 5AZIB 4CZHA 1ATRA 2NZTA 1U2VA 2W40A 5AQPA 3RSEA 2P9NA 5AQJA 1H1VA 5JLFA 4FWRA 5I9EB 4FWKA 2A40A 2P9SA 3VF4A 5JMVA 4BG8A 3F9MA 2GWKA 3VEOA 2FF6A 5BRDA 1XQSC 1NBWA 4QS9A 3L0QA 1HKBA 2V7YA 5FPEA 4CZKA 3P4IA 3FE1A 1BA1A 2GUPA 3C7NB 3QBWA 5AQQA 5F2RA 4A2BA 3M3ZA 1JCFA 2FF3B 5AZJB 4HWIA 4CBWA 4PL8A 5AQFA 1HLUA 5JICA 4FSVA 2PBDA 4BC4A 2A42A 1TYQA 3ZETB 1U2VB 3JS6A 3RSEB 3CI5A 4M63C 1Z05A 3H3NO 3A5LC 5E84A 2P9SB 2FLOA 2IVOA 3VGKA 2QWPA 4FPBA 4Z94A 4H5WA 4PKHA 5AQTA 3W3DA 2UYTA 3WXKA 2GELA 3KHYA 4H0VB 5AQWA 4C23A 1ATSA 1QQMA 2E2OA 3LDOA 5AQSA 2Q31A 3AARA 2FSKA 5AFUH 5ELZA 4A61A 1ZC6A 4H5NA 1G99A 3HZ6A 3H46O 5AQIA 4CZMA 1NGCA 4K42A 3WEEB 2QW9A 2ZGYA 3DAWA 2W41A 2ASMA 4FWLA 1TYQB 3O08A 3D2FB 4PL7A 4GNIA 2AP1A 4RCHA 2ZF5O 3G25A 1QZ5A 4K25A 4YDUA 3QB0A 2P9UA 4CD3A 1U6ZA 3O8MA 4BG9A 4EIAA 1NGAA 3OHRA 4JNEA 3DXKA 3H1QA 3O4WA 4BR0A 2P9KA 4L3QA 3LDQA 1XUPO 4BRQA 5BPNA 2VWBA 4B1ZA 4B1XB 3CJAA 1V4SA 5EX5A 3EZWA 1KAXA 2OANA 3O1BA 4BRGA 2A3ZA 3ZX2A 3VOVA 1RDWX 2YHWA 2D0PA 3A5NC 4FWOA 3HI0A 3HBTA 1SAZA 3CJ7A 3UKRA 1LCUA 3ID8A 4BR2A 1HJOA 3LM2A 1ATNA 2D0OA 3VPZA 4H0YB 4B9QA 4I6MA 4CBUA 3CJ9A 4BQZA 5BPMA 5E26A 4BC5A 5BR9A 4WQ5C 4RTFD 4A2AA 3BP8A 5LY3A 4CZFA 2QWRA 1BG3A 1GLBG 5ADXH 4IJAA 1NLVA 3AAQA 4DQ8A 1GLDG 4B1VA 1MDUB 2P9KB 2ASOA 4BROA 3FZHA 4H03B 1NGFA 2CH5A 3I33A 2F9TA 2GEMA 1JCGA 4FOEA 3KZBA 3B8AX 4QS7A 2P9PA 4M7YA 2A5XA 4F9OA 1C0GA 2BTFA 3WUHA 3WQTA 4EHUA 5BRFA 2ITMA 2HMPA 2QM1A 3H3OB 4H0OA 3ZEUA 3GBTA 1DKGD 2E2NA 1YVNA 4Y0WA 2Q0UA 3D2EA 4B1YB 5BRHA 3VENA 2J4RA 2YCHA 3R6MA 4ISEA 4MO4A 3U4LA 1K8KA 5TKYA 5AR0A 4JHDA 4BRKA 4BRMA 5AQKA 4PKIA 1D4XA 3QMLA 3A5MC 1HUXA 2HF4A 3BF3A 4B1WB 4BGAA 4IZ9A 1QZ6A 3UKUA 2A41A 2Q97A 1GLJO
chains in the Genus database with same CATH superfamily
4FOIA 5AQLA 1BGXT 3RMAA 3KKSA 1NMDA 4PWDA 4CEZA 3OYKA 4CHZA 4BRLA 4CGDA 1RDAA 5BPLA 4BRHA 1KC8O 1J5OA 4KHUA 4BRPA 3K57A 4ISGA 4PKGA 4IWVA 4FLYA 4MDBA 4XEIA 3FR0A 2Q2RA 4A5BA 3M8PA 1BWFO 3SNNA 4BVOA 2ZJQL 3UKUB 1QSYA 4U67L 3L4IA 3MK6A 3EEQA 3HM8A 2G8IA 3EKUA 4CEOA 5GAHP 4AQYK 4XH4A 3SK3A 4MLEA 4E7JA 1YJWN 3AVKA 3QEWA 3SUPA 4DQQA 3CMAN 3CCSN 3UB5A 3TAGA 4HTUA 1L3VA 4B3SK 4HHTA 2P1JA 4CEBA 3CCMN 3HL8A 2DFEA 1QSSA 2ZGZA 3CHWA 2HHWA 4BDYA 3NF6A 1KQSM 4JI6K 4BR9A 2P9IB 3ATUA 4HUEA 4FZYA 3AO5A 1BO5O 3P1GA 4J8FA 1X9SA 3UE5A 1OH8A 1YJNN 3RVCA 4Y1CA 4FL9A 2F8TA 1T6CA 4B3TK 3CD6N 3BUZB 4JK7A 3KJVA 1Q18A 1KTQA 4B3OA 5J1EA 3KWIA 2CGJA 2VG7A 4MLHA 2E6MA 1VSJA 3DXKB 3O5BA 1MWMA 1K9MO 3CJBA 1NMNA 4FCYA 1GLEG 3SPZA 2KQ2A 1SKWA 4RW7A 1N33K 3CCRN 4FWQA 3U9DA 4PHTX 3R3LA 4FJNA 1QS4A 3V4IA 3WNHA 3PIOL 3VEZA 3KK3A 3VQ9A 3LM9A 5AZJA 1WSJA 2F96A 3OW2M 3PIPL 4UQGA 4ISFA 1FKPA 1QTMA 2BH1A 4KFBA 4JYAK 4IXCA 4CEAA 3L2QA 3ZETA 3VTHA 3VF6A 3CCUN 2HSTA 4CECA 2I7NA 4FWPA 3V1OA 4CK1A 3HSCA 1WSFA 3FZKA 3O9TA 3NCIA 2OYQA 2HNDA 3GDQA 3WT0A 3OBWA 1HKCA 4PY5A 2P9PB 2Z1HA 4CF8A 3J8AA 3NF8A 3L3VA 4CJTA 2Q36A 1GLFO 3GG4A 3QESA 1HYVA 5AQMA 2P51A 1HNZK 3ZEUB 2RE2A 4DV6K 4DU4A 5HP1A 3O9RA 1BA0A 3FFIA 3WXLA 3QETA 4FJ5A 4DMNA 4BACA 1NK8A 2VCPA 1T7PA 3Q7CA 4CZJA 4F3TA 4FJ8A 3KLGA 3D2FA 4JI0K 1E4GT 1X3MA 3SMPA 5KQ8A 3OYIA 3IAYA 4G9ZA 3VQ8A 4KBOA 3AA5X 4KRFA 1HPZA 3HP9A 1YITN 2NRHA 1EWQA 3VGMA 5HBMA 2A1SA 4CD1A 3TABA 4FPAA 1IJJA 2UUBK 1VQPN 3SQ4A 3H6EA 2KW4A 3MX2A 1O13A 2NRTA 4LSLA 4YFUA 1WUAA 3ULEA 4CEQA 4DV1K 1VQLN 1HX1A 2KFNA 1J6ZA 3BZCA 4KH6A 3DLLL 3ID6A 4W5NA 3FFKB 1K6YA 2WFBA 4QS8A 5AQOA 3ENOA 2YKMA 4O4GA 3G0ZA 1HNIA 4F3OA 4DR5K 2G8KA 4H5VA 4Z4EA 4DSIA 1Z6RA 2DFFA 1YVUA 3HYFA 4CZGA 3THYA 3EN9A 3BY5A 3C0BA 1S3XA 1JKHA 3O3HA 3BZKA 1GLLO 3DLRA 2HBKA 3IMXA 4BVPA 4GY2B 4ILJA 4BDPA 3LDNA 4M3ZA 1TKXA 3P39A 3EKSA 1IG8A 3H1VX 4CEFA 2UU9K 3EO3A 3CCEN 5AQZA 3DXMB 3W0LA 5CE3A 4CHNA 5FPMA 4RG8A 4F2SA 1IKYA 4E0DA 3C6UA 1VQMN 3G6EN 2NUBA 1GLCG 2E2QA 5CYQA 4E7IA 3KWGA 5AZIB 1ATRA 2IS3A 3MAQA 5AQPA 1H1VA 3SV4A 1FK9A 5M1OA 4FWKA 2P9SA 4BG8A 4KTWA 3F9MA 4NXNK 1TVRA 3VEOA 5BRDA 3CCLN 3L0QA 2O8FB 5J2QA 2OPQA 2FBTA 3TAQA 3DMJA 1JCFA 1IKWA 3ZSYA 4CBWA 4PL8A 3TI0A 1WLJA 1U4BA 2P5OA 4FSVA 4CJFA 3C94A 4DR3K 3SUQA 4M3WA 2OPRA 1W0HA 4NYFA 4V19S 1NJYA 3RSEB 4M63C 5C42A 5E84A 2XHBA 4E19A 2IVOA 3THVA 4ILGB 4KO0A 3WXKA 1YTAA 4H0VB 3V1QA 1S1UA 3ZSZA 1ATSA 5AQSA 1GOBA 2RN2A 3AVMA 2ZM6K 3OS2A 4ICLA 5AQIA 1U47A 4LFCK 1NGCA 4K42A 3J81O 4DV7K 1NJIO 3V9UA 2YKNA 2P5GA 4Z4IA 2O8CB 2QKKA 3V6DA 4PL7A 4YOWA 4BY9C 1WN7A 4N56A 2ZF5O 4YDUA 4JLHA 1HRHA 4DQIA 3QB0A 3PO5A 3J7AP 5HRSA 3OYJA 1TK8A 2JWLA 5HRNA 1ZYQA 3O4WA 2P9KA 1ZBUA 3PSIA 1VAZA 1D9FA 5SWMA 1NOZA 3QNOA 1TV6A 2OCEA 3TAFA 1BI4B 4IO9L 4E1NA 3QEPA 4CIFA 2YHWA 2F4VK 3U6FA 3HI0A 1SAZA 3UKRA 1LCUA 4FLXA 2D0OA 1RT3A 4H0YB 4LD0A 3KK1A 1EETA 3CJ9A 1JL2A 1C1AA 5E26A 3LPTA 3P31A 5GINA 3BP8A 3MWPA 4CHPA 2QWRA 5FLXO 4CZFA 4F8RA 4CGGA 4C8OA 1GOAA 5CHIA 1GLDG 4KH4A 1EX4A 3ITHA 1NGFA 3MWTA 1RCHA 2GEMA 4M3XA 1EWRA 3KZBA 3HRGA 2Z1JA 3B8AX 4M7YA 4CF0A 4JS4A 3ZYYX 4EHUA 2KFZA 2HMPA 3TAEA 1DKGD 3ISNC 4AHCA 1YVNA 1SKRA 4FM1A 4B1YB 1HNXK 2PZSA 4J2AA 4FJXA 4ISEA 5AR0A 4JHDA 3VA3A 4BRKA 1RBSA 4DTJA 3OYBA 3OYAA 1QHTA 3VQ5A 3A5MC 5TKWA 5C10A 4B3MK 3SBTA 5GAEP 2IGIA 4IZ9A 2A41A 3ZSVA 4R5PA 1Q82O 1Q86O 1WBDA 4H4MA 2HNZA 5T7BA 2DPNA 3ENHA 3TTDA 2ITGA 2P9NB 1Q7YO 3D0PA 2UXDK 2O8BA 3TAMA 2V7ZA 3QIPA 3MCPA 3THWA 5EY4A 4DCHA 2CGLA 5JVGL 1NGBA 4JEPA 1WSEA 1JCEA 4E1JA 2ASPA 1J9AA 3LL3A 4BC3A 4OVLA 1T8EA 3KIOA 5C25A 4DR1K 4BC2A 1JL1A 3BEXA 3E9LA 4YOUA 1RT6A 4CGIA 3C65A 1ZBHA 4MO5A 2BGGA 4PA1A 1UA0A 4Z4GA 3IFRA 4A57A 1N32K 4WF9L 3D45A 3M8SA 4YDUC 4CZEA 3OYDA 4CJSA 3NFAA 4CF1A 4OLBA 1HQEA 4ILHA 2DTUA 2IVPA 4B9VA 4BR7A 3A2FA 4Z0UA 3U8XA 3GL1A 4CJ5A 1RT7A 3HXMA 4NYNA 4BGBA 5C2DA 1CLQA 4BR4A 3HJFA 3MMVA 4H0TB 1DEJA 3ZT1A 2EWSA 3HTVA 3S41A 2F9WA 4YHHK 4CFBA 3ZT0A 3PV8A 2D0AA 2OPSA 3KVGA 3CC4N 5AQRA 3CERA 3TANA 2WUSA 1NU0A 1VSKA 3WNFA 2YHXA 1QQNA 3L2WA 4M3UA 3LDLA 4Y1DA 1C0FA 1S1TA 2NLXA 3A5OC 3WXJA 3MXJA 5LL6Z 4BQLA 4KI6A 3T7ZA 2ZJRL 2VGNA 4YOYA 4B9TA 5AQYA 3CQXA 4LF5K 1B9DA 3F73A 1T05A 4CESA 3SQ2A 2QWLA 4JKEA 1TUYA 4DQPA 1OVYA 1NJZA 2D1KA 3R8EA 4BR5A 4CFDA 5FPNA 4BRFA 3OYLA 1UOCA 1RT5A 1SL0A 2NRVA 3SV3A 3VQEA 1Y64A 4YNQA 2E88A 4JI4K 1KFSA 3WXMB 1ASVA 1NM1A 1VQ9N 1S5JA 1TUUA 4RW6A 5D3GA 3V1RA 2YNFA 2E2PA 3CQYA 2X6SA 4OX9K 3QDKA 1LOTB 3WNGA 3ZSWA 4RW4A 2NRXA 3U9ZA 1SKSA 1C0TA 1F21A 1MWKA 4CE9A 1P8ZA 1L3TA 5GAGP 3SQ0A 4DTNA 3OTOK 2QKBA 2UXCK 3WEEA 3ZSXA 1LAVA 4X62K 1JLGA 4N41A 3J80O 2D4WA 2QXLA 3SJHA 2XRIA 4B8AB 4CFAA 2OZSA 2E8AA 5FDLA 5E41A 1KLNA 1VRTA 4XH1A 5FRMA 3PSFA 4FJGA 1NKEA 2QI2A 3PUFA 1MA9B 4KAZA 1HR0K 2IIRA 3I0SA 1NK5A 5ADXA 1YXQA 3TPQA 3L2RA 3K0SA 1X9MA 4IFVA 1RTJA 2XY6A 1FKOA 5CR4A 1KSPA 5C12A 3AVHA 3QFPA 4OLAA 3FZFA 3SLCA 1RFQA 3M5RA 5KPZA 1JLAA 4DV2K 3VEVA 1JXEA 1EXQA 4DQSA 2RHKA 1Z26A 3CFPA 3AA3A 1T3VA 1BOTO 3EL2A 4IBNA 5DM6L 4ELUA 1RGIA 3MN7A 3HVRA 2JLEA 2CGKA 2P9LA 4M45A 1YF5L 3TAPA 1I94K 2HHVA 2FSJA 2W42A 4UY8O 4IG3A 4PQUA 1RBRA 3E01A 4BRCA 4E1MA 3RMCA 2FBXA 2QXFA 2G8UA 1BU6O 5LJWA 4DFPA 1T44A 3S3OA 4BRAA 4XH5A 3QBXA 2I7PA 1ILYA 3ULEB 3I8BA 3DWLA 4JRPA 2FBVA 3BGRA 2ZQBA 3WQUA 4BDZA 4CJ4A 1YJ9N 2V51B 4AHTA 2IC3A 4WYBA 5AQUA 1NGJA 5F0XA 3HK2A 5AFUA 2RF2A 5M1NA 1NK6A 2Y1JA 1QVFM 1Z25A 1C0MA 4CZHA 1U2VA 2W40A 5AQJA 4GKKK 1I3AA 3QNNA 1TL1A 4LH4A 1T03A 3L4QA 4OPKA 1VSLA 2UUCK 1YT3A 1J54A 1A5VA 2V7YA 1KVCA 5FPEA 3T3FA 3ZT4A 3AO2A 3P4IA 3MXIA 3NH1A 2O4IA 2GUPA 3C7NB 4JKGA 4K8ZA 4LY7A 1S72N 4CJ3A 4ELVA 1C1BA 2RKIA 3DLEA 3L3UA 3OYGA 2PBDA 1BHLA 4DUZK 1UA1A 2A42A 1KFDA 1TYQA 2KTQA 4DTOA 1WBBA 4DTXA 3KLHA 1DLOA 4KHNA 3A5LC 5BR8K 2P9SB 2FLOA 3VGKA 1RBUA 4H5WA 4PKHA 1D9DA 2GELA 4N76A 1D5AA 3AV9A 2IOCA 3P83D 4IFYA 5I42A 4GVMA 3AARA 4O0IA 5AFUH 1J53A 3V9WA 1UAXA 4H5NA 3OS1A 3VQCA 1G99A 3HZ6A 4DV3K 1U48A 3LP2A 3H46O 4ZHRA 2HNYA 4FLZA 5SZTA 3DAWA 2ASMA 5IT9O 1YHQN 3J7YP 3T69A 2YNIA 4TSXA 4GNIA 2AP1A 2E6LA 1TL3A 1QZ5A 3NE6A 2X74A 4CD3A 3O8MA 2VWJA 2UUAK 1HYSA 1S9GA 4JNEA 3DXKA 4J2EA 3H1QA 2PYJA 4BR0A 3O9SA 3LDQA 4BRQA 1S6PA 2VWBA 2VWKA 4B1ZA 4DU3A 4CF2A 3CJAA 2EX3A 4HUFA 3VA0A 1Q81O 1VQON 4EP5A 2OANA 4MFBA 2A3ZA 4BRGA 5IWAK 2GBZA 1NJWA 1VSHA 4WE1A 1SV5A 3L2UA 5KPRA 3MEGA 3HBTA 4BR2A 4CJUA 3AVNA 4B9QA 4KI4A 3VPZA 4CBUA 3T1AA 1LAWA 4FLTA 3TARA 4BQZA 4Z4CA 4GV3A 5BR9A 2HHTA 3AVIA 4AHRA 5JS2A 4FK0A 3S3NA 1Y97A 1GOCA 1WSGA 2HHSA 2QA4N 2P9KB 4BROA 3FZHA 3QIOA 4KB1A 4OKKA 4QS7A 2Y1IA 2P9PA 3M8QA 2A5XA 1M1KO 4JI2K 1BISA 3F5TA 4FW2A 1C0GA 4F9OA 1KRPA 3WNEA 1L3UA 1XWLA 2ITMA 1VSMA 3AGKA 2QM1A 3H3OB 3DRRA 4H0OA 2NNWA 3VMFB 3ZEUA 3HSTB 5HLFA 4Y0WA 4FJJA 2Q0UA 3TSPA 4EZ6A 5BRHA 2J4RA 2YCHA 3DI6A 3LPUA 3R6MA 4MO4A 3S9HA 4BRMA 5AQKA 2G8FA 3NH2A 1NK0A 2YV0X 1RDBA 3BF3A 3KLEA 1RT2A 4LFAK 2NRRA 3L2VA 2Q97A 4CZLA 3IG1A 1GLJO 3N4QA 1NGEA 2GTDA 2HBLA 5J2PA 4I2PA 4LF6K 2NRZA 3MCAB 3I8DA 2Q1NA 2Q0RA 3OS0A 4A62A 1EQYA 4CEDA 4GV6A 1IBLK 4FJHA 4DHYA 4I7FA 4H0XB 4DS5A 1WB9A 1NGDA 3L6QA 4G1QA 3VF2A 2IVNA 3SMSA 2WONA 5JS1A 1RDCA 1N34K 1X9WA 2YHBA 4JI3K 3QEXA 4FM0A 1QQOA 4H5RA 3VETA 4KV8A 3CMEN 3PX6A 4H0PA 1LWCA 2D5RA 3ZT3A 2WTUA 2DFHA 3ZSOA 3C6TA 4EAHD 3CCQN 1HQUA 3AA4A 3AAPA 1NOYA 4BE2A 1S1XA 4FJKA 3RTVA 2HW3A 3C6HA 4Z4FA 4YOVA 4IJNA 4O55A 4JK9A 1TKZA 4GVEA 3DRSA 1EKEA 3PX4A 4GW6A 4JKAA 2HHUA 1IBKK 3VQBA 3N4PA 4FJMA 1U04A 2HVIA 1T6DA 3ALYA 4CHOA 2O8DB 1BCOA 3I55N 3NF7A 4LC9B 4CI6A 5AQGA 2VYPA 1SQKA 1QQCA 3KLIA 3VERA 3BF1A 3A0IX 4KHYA 1U49A 1V4TA 4DV4K 5AQXA 5AZIA 4AHVA 2P9UB 4CJRA 3OYNA 3O6WA 3K59A 4F2RA 4Q0BA 3AY9A 5GADP 3MX5A 3RRGA 5CYMA 3VTIA 3BDPA 3HPOA 1TGOA 2YI1A 4RW8A 1JJ2M 5KGXA 2OPPA 1TK5A 1NG9A 4CJLA 5CZ2A 1QE1A 2O8FA 2IAJA 1SZ2A 4CF9A 4WFAL 4C1NK 1TKTA 2VG6A 2OTLN 1VQKN 4FO0A 4B1UB 5LJVA 4JN4A 4I6MB 4OPAA 3D7EO 4AILC 1JLFA 4E89A 3H45C 4BWJA 3DLHA 3QLHA 2HHQA 1CZAN 1XHXA 2YJEA 1N36K 1DTQA 1XI1A 2V52B 4M3YA 1NK9A 3DLGA 4O44A 2QTDA 4CJWA 3FGUA 1XC9A 3PO4A 4LF9K 2CH6A 4FJ9A 3SJJA 5FRNA 3E9OA 2I5JA 1SL2A 3ZLJA 4NCAA 3U3YA 4KHSA 2HVHA 2A6AA 2E4LA 2KLAA 1S1WA 4E7LA 4WFBL 5CY4A 3LANA 2YNHA 3D2EB 4NO7A 1K8KB 2O8CA 2FXUA 4DTSA 4BRDA 4RWTA 1Q9XA 2BANA 1TKDA 4ID5A 3OYFA 1E4FT 2KZMA 1NGHA 1HKGA 1OH7A 4JI1K 3FLCO 3CFRA 2DY4A 2HBMA 1CXUA 4JS5A 2O8EA 4FVMA 3CPEA 1RNHA 2Q3SA 4CZIA 1K8AO 3NGIA 1XC3A 2VGMA 4DR6K 3OYEA 1VQ7N 3ZX0A 3P5JA 2NRWA 1EP4A 4DV0K 3LAKA 2ZJPL 4K41A 2PFUA 1TAUA 4GKJK 2QK9A 4Z4HA 3PX0A 4JI8K 4JD2A 3M6GA 4BRNA 2BUPA 3ZX3A 2HBJA 2QWQA 3B6OA 3KK7A 3AO4A 5A2QO 3VQ6A 3NMUA 4JAXA 3VEYA 1NGGA 4FWSA 5AQNA 3IUCA 4AH9A 3I56N 3CCVN 3TU5A 1KAYA 1LWFA 1TAQA 1B9FA 3CG7A 4CJ7A 4W5QA 3G4SN 3SZ2A 2AJQA 4E7HA 5KRTA 1NK4A 2KHOA 5KPTA 3QICA 4KHWA 3R1XA 4KKOA 3THXA 3NDKA 4FZXC 2ETJA 4I9QA 1OH6A 1NJXA 1DGKN 4DR2K 4DLGA 2FSNA 2GWJA 3LDPA 1R59O 1VQ6N 5FPDA 2RPIA 4FK2A 4NLBA 4M7XA 4FVUA 1JLQA 1OKJA 4BRIA 4FLVA 4DSKA 4CK3A 4R79A 3VQPA 3G10A 5HOOA 2KZZA 1R0AA 3DRPA 4IG0A 4FLUA 4YOXA 4I9LA 4DG1A 1X3NA 2P9LB 4AHSA 2E1ZA 3AVJA 5GIOA 4B9MA 2HF3A 3O9UA 4FLWA 1ESVA 4CVNE 4M42A 1ITGA 3F2KA 2P9NA 1JLBA 4JV5K 3LP1A 3OA9A 2GWKA 3K9KA 5KTQA 2BE2A 4M41A 3RRHA 4CZKA 3AA2A 3FE1A 4NXMK 1REVA 4OPHA 4CIEA 3AVAA 4A2BA 1YIJN 4F4KA 2FF3B 4JKBA 3NVMA 5AZJB 4JKHA 2XY7A 4X64K 5JICA 3NHGA 4CGJA 4FM2A 4CGHA 1A5WA 4BC4A 3VQQA 2EHGA 1NKCA 3V81A 2HB5A 1VSIA 3AO1A 3ZETB 1U2VB 4ZTJA 4FZZA 3CI5A 2B6AA 1IG9A 3H3NO 4CCHA 2LSNA 4Z94A 4LFBK 4DQRA 2XY5A 2UYTA 3KHYA 5AQWA 2FC0A 1QQMA 2E2OA 1K73O 3KLFA 2E5LK 1HYZA 2FSKA 4JKGB 5ELZA 2UXBK 3I0RA 3SQ1A 4HVJA 3HO1A 1RBVA 4X65K 4DFJA 1QVGM 3HP6A 1RDUA 1RTHA 1SUQA 1IKXA 5KI6A 4KHQA 1TYQB 1ASUA 3D2FB 4AF1A 1NNEA 4RCHA 4C8LA 2ZD1A 4K25A 4OJRA 4JKDA 1LWEA 2PY5A 3VQ7A 4BG9A 1N5YA 4JK8A 4EIAA 1NGAA 3OHRA 4FW1A 4L3QA 3IKMA 4CJVA 5GIPA 5BPNA 4ID1A 2WC9A 1W9HA 4B1XB 1V4SA 1KAXA 3O1BA 3VOVA 1RDWX 3CPWM 5M1QA 1N6QA 4DSFA 3CJ7A 1RDDA 3ID8A 1RT4A 3LM2A 1Q9YA 3SI6A 3EYZA 5BPMA 4OKEA 1BQMA 4RTFD 5LY3A 1KVAA 4QAGA 3IRXA 4O0JA 2VQEK 3SUNA 2X6NA 5ADXH 1JLEA 2ASOA 3KKRA 4QCLA 5HRPA 4JKFA 3SUOA 2F9TA 4C1NI 1JCGA 5LMNK 4FOEA 4A5AA 4JI5K 4FK4A 2BTFA 3QEIA 1WAJA 2WBNA 3THYB 1E3MA 3WQTA 3HOSA 3NAEA 1WAFA 1NKBA 3GBTA 2E2NA 4IFEA 4KH5A 3OYHA 5J2NA 1ZBLA 4BWMA 3U4LA 3V9ZA 2F8SA 4FXDA 3TTFA 1HNVA 4WCEL 3V9SA 1XNRK 4PKIA 1D4XA 3JAMO 1MU2A 3QMLA 4XIUA 1BL3A 1X1PA 1RTIA 5FROA 2B5JA 4B1WB 1FW6A 4DTUA 2R7YA 3K58A 3UKUA 4KREA 2QWNA 4FWMA 4GV9A 5M1FA 3MEDA 5F1XA 3VGLA 2BDPA 3CJ1A 1OH5A 4O5BA 4HCCA 2ATQA 3CM6A 1UWBA 1ZBIA 1QHAA 3FZMA 1ASWA 1KD1O 3CF5L 2AA4A 3DOKA 3NBPA 3TTCA 3JYTA 3O1WA 2QEXN 4DS4A 3CXCM 4J2BA 4DSJA 3CETA 5AQHA 3KD5E 2P9IA 3RR8A 5KRSA 5J2MA 3QERA 1KAZA 5KQDA 2VG5A 3M1FA 4AM6A 2W6KA 4B8CA 5BREA 4CBXA 1BIZA 2QWMA 4IO8A 1S9EA 3VQDA 4B08A 3CJCA 2OTJN 1OVQA 3SAGA 3K5NA 3GOIA 2A1RA 3OJUA 1GLAG 3HOTA 3HPGA 3LP3A 4AM7A 4EHTA 4CEEA 3LWMA 3QEVA 1VSFA 4DTMA 3VESA 5HL7L 1KLMA 3MN5A 1BDGA 1RT1A 4DFMA 4NCGA 4O8KA 4BREA 1C0UA 5C15A 5KGWA 3D6RA 4ZTFA 1HPMA 5EVZA 1KXPA 3VEWA 2G8HA 1BIUA 3CFOA 4JI7K 4DF8A 3Q7BA 4WFNL 3ZT2A 1ZXOA 1XHZA 1NWKA 4H4OA 5BN8A 5H1SQ 2YHYA 4WQ4A 2H3GX 2IDOA 3SAHA 4FWNA 5DK5A 4O5FA 3G71N 3J7ZO 4DR4K 4YY3K 1S22A 2YX6A 2WOMA 3NGZA 4Q5VA 3SBGA 5EXWA 1WSHA 3GE1A 4CJQA 5B8HA 2QWOA 4CFCA 4IOXA 1IKVA 1WOQA 1NGIA 1VK0A 4FJ7A 3DJCA 3IDHA 1FJGK 3C7NA 1HNWK 4DR7K 2YNGA 1TK0A 3AVFA 4N5SA 3WXIA 3UKRB 3VN5A 4H8KA 4IOCL 3JXUA 1YUWA 1KVBA 4IKFA 3TR8A 5LMUK 3LZJA 4H5TA 3ENBA 3NF9A 4NLCA 3SPYA 1BQNA 3RWUA 5I3UA 4RW9A 3TSUA 2FBYA 1W7AA 3O3GA 4DF4A 2YHAA 5JVHL 3T1YK 2D0CA 2PYLA 2YJFA 4DTPA 3M8RA 3E1YA 4LSNA 3LZIA 4EFHA 3AVLA 4DB3A 3C95A 1A5XA 4B9NA 4ELTA 3R9PA 4B9LA 4BE0A 4DFKA 4CJEA 2E20A 3PLAA 3CQ8A 3B6PA 1W2BM 3RMDA 1L3SA 3K9JA 5AQVA 3CIPA 4JHDB 1RTDA 3MN6A 1ZBSA 5JLHA 2PAVA 4CW7B 2OZMA 1DTTA 1VSEA 2KKZA 5AJ3K 4NCBA 4LF7K 1IBMK 4KB0A 4DLEA 4HUGA 4W5OA 3FZLA 2O8BB 1X9JA 3MN9A 1N8RO 3THWB 2VQFK 3TSQA 3VQ4A 4E3SA 3U3GA 2HMIA 1SL1A 2GX9A 4CHYA 4FJLA 1S6QA 5C2FA 5EOYA 3A8YA 4HTLA 4O8UA 1BUPA 5BN9A 4DSLA 4W5TA 3QFUA 2OA8A 3O4NA 1YAGA 3DXMA 1J5EK 1HJRA 3KK2A 3O80A 1XNQK 4K8XA 4OGCA 1YI2N 1EO1A 4YOTA 3DLBA 4WQ4C 4CHQA 3SAFA 4C8KA 2ZWHA 4EP4A 2O8EB 1DT9A 4K43A 1RBTA 3MXMA 1NK7A 3LAMA 3LP0A 3VQAA 3HPHA 3ULDA 5M1PA 2XO7A 3CM5A 1IH7A 3ZSRA 1D8YA 4U7BA 5C0YA 4W5RA 3CC2N 1JLCA 1VQ5N 4JD2B 3KD1E 1BCMA 4CGFA 4CJKA 3O3FA 2JGUA 1VQ8N 3K2PA 3OYMA 4DV5K 4WQ5A 3AGRA 3AVGA 3K5OA 3ATVA 1C1CA 4NB4A 3CCJN 3MDQA 2E1YA 3VEXA 4E7KA 5M1KA 4OO1J 1IV0A 1CZBA 4OPJA 3EZ5A 2HOEA 3LALA 3F9KA 2NZTA 4DTRA 2JWKA 3THXB 3RR7A 3ZSQA 2X78A 3RSEA 5JLFA 4FWRA 5I9EB 1WSIA 4KHPK 3O9QA 2A40A 3VF4A 5JMVA 3K5LA 1KCFA 5DMRA 2FF6A 3EE8A 1XQSC 3T1HK 1NBWA 4QS9A 3SCXA 1HKBA 1LW2A 3LWLA 1BA1A 2W6LA 3DOLA 1VHXA 3OJSA 3QBWA 5AQQA 5F2RA 3NVKA 4B9SA 4KTQA 3M3ZA 3IS9A 3OY9A 3PY8A 4J2DA 4HWIA 5AQFA 1HLUA 3MEEA 2ZE2A 2F7TA 4CK2A 4X66K 1VSDA 4K0KK 1CZ9A 3HT3A 3MECA 1B92A 3DYAA 4JRQA 3AO3A 4LF8K 1QSLA 3UIQA 3LDSA 5HRRA 3JS6A 5MLCQ 1I39A 1Z05A 4C8MA 3JSMA 4IEIA 1LV5A 2QWPA 4KPYA 4FPBA 2B4JA 5AQTA 3W3DA 4IDKA 1VRUA 4C23A 3OYCA 2GUIA 3ZCMA 4DU1A 3LDOA 3ASMA 1HMVA 4LH5A 1SS6A 2Q31A 4CIGA 3E9PA 3AVBA 4A61A 1ZC6A 1U45A 4EZ9A 1BI4A 4CZMA 2Z1IA 1IO2A 2HHHK 3QINA 4PUOA 2O8DA 4DWIA 3WEEB 4GMJB 2QW9A 1C6VA 2ZGYA 4CERA 3CC7N 2W41A 4FWLA 3O08A 3RMBA 4IEEA 3V9XA 3P38A 2XY8A 3EE9A 3H08A 3CYMA 3SYZA 3G25A 3L8BA 4FJIA 2D0BA 3DLKA 5K14A 4DUYK 2P9UA 1U6ZA 3C6AA 2O4GA 4L8RB 1M90O 4KTZA 3EY1A 5HROA 1XUPO 1CXQA 1W97L 3S3MA 1RILA 5EX5A 3EZWA 4M3RA 4HCBA 4BE1A 1G15A 1L5UA 4IOAL 4A59A 3ZX2A 3HVTA 2D0PA 4FWOA 3A5NC 1P90A 4N47A 1VQNN 4QOZB 3T19A 2Z1GA 1HJOA 1ATNA 4I6MA 5C24A 4BC5A 4WQ5C 2HHXA 4CJPA 1JXBA 3AVCA 4A2AA 4JKCA 1Q8IA 1BG3A 3E66A 1GLBG 2G8WA 1O1WA 1NLVA 3O4QA 3OBYA 4IJAA 3AAQA 4MDAA 4DQ8A 4B1VA 4C8NA 1MDUB 4DKWA 1YTUA 4H03B 4DSEA 2CH5A 3I33A 4FYDA 1VQ4N 4OKJA 2G8VA 1FXXA 3HM9A 4I2QA 1ZBFA 3WUHA 4B3RK 5CZ1A 3KTQA 1XMQK 4LF4K 5BRFA 1LW0A 3NGYA 3NH0A 3K5MA 2GV9A 1S1VA 3QO9A 3D2EA 3VENA 1K8KA 5TKYA 4AHUA 3DM2A 3OVNA 4M3TA 5EU7A 3TWHA 4OGEA 1XMOK 4MQ3A 1WNSA 1HUXA 2HF4A 4YORA 4IDHA 4BGAA 5DM7L 1QZ6A 4B9UA
chains in the Genus database with same CATH topology
4FOIA 1NGEA 2GTDA 2QWNA 5AQLA 4FWMA 2HBLA 2DPNA 3ENHA 3TTDA 2P9NB 1Q7YO 4GV9A 5M1FA 5F1XA 1NMDA 2NRZA 3MCAB 2V7ZA 2Q1NA 3MCPA 2Q0RA 3CJ1A 5EY4A 3VGLA 4DCHA 2CGLA 5JVGL 4BRLA 1NGBA 4JEPA 4A62A 1EQYA 5BPLA 1JCEA 4BRHA 2ASPA 4E1JA 4GV6A 3LL3A 1KC8O 1QHAA 3FZMA 4BC3A 1KD1O 3CF5L 2AA4A 3TTCA 4BRPA 4BC2A 3O1WA 4DHYA 2QEXN 4H0XB 3CXCM 3BEXA 1NGDA 4ISGA 3E9LA 4PKGA 3L6QA 4IWVA 3CETA 4YOUA 4MDBA 5AQHA 3VF2A 2IVNA 2P9IA 3C65A 3FR0A 4MO5A 4XEIA 2Q2RA 3SMSA 4A5BA 1BWFO 3IFRA 4A57A 4WF9L 4BVOA 2ZJQL 1KAZA 3UKUB 1QQOA 4U67L 5KQDA 4AM6A 3M1FA 5BREA 3L4IA 3MK6A 3HM8A 4H5RA 2QWMA 4CBXA 4IO8A 3EKUA 5GAHP 3VETA 4YDUC 4CZEA 3CJCA 4XH4A 3SK3A 4H0PA 4MLEA 3CMEN 2OTJN 3SAGA 3GOIA 1YJWN 1GLAG 4EAHD 3HOTA 3CCQN 3AAPA 4AM7A 4EHTA 3CMAN 3CCSN 3UB5A 4ILHA 2IVPA 4BR7A 3C6HA 3U8XA 3VESA 3GL1A 4YOVA 5HL7L 4IJNA 3MN5A 1BDGA 4BGBA 4JK9A 3CCMN 5C2DA 4O8KA 4GVEA 4BR4A 4BREA 3MMVA 5C15A 2ZGZA 3CHWA 3D6RA 1KQSM 1HPMA 4H0TB 1DEJA 5EVZA 1KXPA 2EWSA 3HTVA 3VEWA 4JKAA 3N4PA 4BR9A 2P9IB 3ATUA 2F9WA 3S41A 1T6DA 3Q7BA 1BO5O 4WFNL 1ZXOA 4J8FA 3UE5A 1NWKA 3I55N 1YJNN 3RVCA 4LC9B 4CI6A 3KVGA 5AQGA 2VYPA 5AQRA 3CERA 5BN8A 3CC4N 2WUSA 4FL9A 4CZLA 1SQKA 5H1SQ 2YHYA 4WQ4A 1T6CA 3CD6N 3BUZB 2H3GX 4JK7A 3SAHA 1Q18A 4FWNA 3VERA 3BF1A 2YHXA 3A0IX 1V4TA 4O5FA 1QQNA 3KWIA 3G71N 2CGJA 5AQXA 5AZIA 3J7ZO 2P9UB 3O6WA 4MLHA 3LDLA 3AY9A 1S22A 3DXKB 3O5BA 1MWMA 2YX6A 5GADP 1C0FA 1K9MO 3CJBA 2NLXA 3A5OC 3MX5A 3WXJA 4BQLA 3VTIA 3SBGA 5EXWA 3T7ZA 2ZJRL 2YI1A 1GLEG 3GE1A 1JJ2M 2VGNA 4YOYA 5AQYA 5B8HA 2QWOA 3CQXA 4IOXA 3CCRN 4FWQA 1WOQA 1NGIA 3U9DA 4PHTX 3R3LA 3DJCA 3IDHA 2QWLA 4JKEA 1SZ2A 1TUYA 3C7NA 4WFAL 1OVYA 3PIOL 4C1NK 2D1KA 3VEZA 2OTLN 3R8EA 4BR5A 1VQKN 4FO0A 3WXIA 3UKRB 3LM9A 4B1UB 5AZJA 5FPNA 5LJVA 4JN4A 4BRFA 4IOCL 4I6MB 4OPAA 2NRVA 3D7EO 3JXUA 3OW2M 1YUWA 3H45C 3PIPL 4ISFA 2BH1A 4H5TA 1Y64A 4IXCA 3ENBA 1CZAN 2YJEA 2E88A 4NLCA 3WXMB 3ZETA 3VTHA 1NM1A 1VQ9N 3VF6A 2V52B 3CCUN 1TUUA 2HSTA 3TSUA 5KPRA 2I7NA 4FWPA 2E2PA 5JVHL 2QTDA 3HSCA 3FZKA 3O9TA 2YJFA 3FGUA 3CQYA 3GDQA 3WT0A 3OBWA 3QDKA 3E1YA 1HKCA 1LOTB 2P9PB 4EFHA 2CH6A 4DB3A 3J8AA 2NRXA 3E9OA 2Q36A 3U9ZA 1GLFO 3R9PA 3GG4A 1MWKA 1P8ZA 2E20A 2A6AA 5AQMA 2KLAA 3ZEUB 2RE2A 5GAGP 3PLAA 4WFBL 3D2EB 3O9RA 1BA0A 1W2BM 3WXLA 3WEEA 3K9JA 2VCPA 5AQVA 4NO7A 1K8KB 3CIPA 3Q7CA 4JHDB 4CZJA 2FXUA 3MN6A 2D4WA 4BRDA 1ZBSA 2QXLA 3D2FA 5JLHA 4RWTA 3SJHA 1E4GT 1X3MA 2PAVA 3SMPA 1E4FT 5KQ8A 4G9ZA 2E8AA 1NGHA 2KKZA 1HKGA 4KBOA 3FLCO 4XH1A 1Q86O 2HBMA 2QI2A 1MA9B 1YITN 2NRHA 2IIRA 3CPEA 3VGMA 5ADXA 1YXQA 3FZLA 1X9JA 3TPQA 4CZIA 3MN9A 1K8AO 1N8RO 4CD1A 1XC3A 2VGMA 3TSQA 4FPAA 1IJJA 5CR4A 5C12A 1VQ7N 3QFPA 3ZX0A 1VQPN 3FZFA 3SLCA 2GX9A 2NRWA 1RFQA 3M5RA 3H6EA 5KPZA 2ZJPL 3MX2A 2PFUA 4K41A 1O13A 2NRTA 5C2FA 1WUAA 5EOYA 3VEVA 3A8YA 4HTLA 4O8UA 1BUPA 4JD2A 3M6GA 3ULEA 5BN9A 2BUPA 3ZX3A 4BRNA 2HBJA 1VQLN 2QWQA 2RHKA 3QFUA 1HX1A 1J6ZA 3KK7A 3NMUA 4JAXA 1YAGA 3VEYA 1T3VA 1BOTO 4KH6A 3DXMA 1NGGA 3EL2A 3ID6A 4FWSA 3IUCA 3FFKB 5AQNA 5DM6L 1RGIA 3O80A 3MN7A 3I56N 1YI2N 1EO1A 4YOTA 3CCVN 2WFBA 4WQ4C 3TU5A 4QS8A 5AQOA 3SAFA 2CGKA 2ZWHA 3ENOA 1KAYA 1DT9A 2P9LA 4K43A 1YF5L 3G4SN 4CJ7A 2FSJA 4UY8O 4BRCA 4H5VA 2KHOA 5KPTA 3QICA 1Z6RA 3R1XA 5M1PA 4CZGA 1BU6O 5LJWA 3EN9A 3C0BA 1S3XA 1T44A 1DGKN 4BRAA 2FSNA 2GWJA 4XH5A 3LDPA 1GLLO 1R59O 3QBXA 2HBKA 3IMXA 2I7PA 5FPDA 4U7BA 3CC2N 1VQ6N 5C0YA 1ILYA 4BVPA 4GY2B 1VQ5N 4JD2B 4NLBA 4M7XA 3I8BA 3ULEB 4ILJA 4FVUA 3DWLA 3LDNA 1OKJA 3P39A 3EKSA 4BRIA 4R79A 1IG8A 3H1VX 1VQ8N 3EO3A 3CCEN 3WQUA 5HOOA 5AQZA 3DXMB 3W0LA 1YJ9N 2V51B 5CE3A 4WQ5A 3AGRA 5FPMA 4WYBA 4YOXA 5AQUA 1NGJA 5F0XA 3ATVA 4NB4A 1X3NA 5AFUA 2P9LB 3CCJN 2E1ZA 3MDQA 5GIOA 2E1YA 3VEXA 1VQMN 5M1NA 5M1KA 3G6EN 4OO1J 2HF3A 3O9UA 1GLCG 1ESVA 2E2QA 1QVFM 2HOEA 3KWGA 5AZIB 4CZHA 1ATRA 2NZTA 2JWKA 1U2VA 2W40A 5AQPA 3F2KA 3RSEA 2P9NA 5AQJA 1H1VA 5JLFA 4FWRA 5I9EB 5M1OA 3L4QA 3O9QA 4FWKA 2A40A 2P9SA 3VF4A 5JMVA 3DLLL 4BG8A 3F9MA 3OA9A 2GWKA 3K9KA 3VEOA 2FF6A 3EE8A 1XQSC 5BRDA 3CCLN 1NBWA 4QS9A 3L0QA 1HKBA 2V7YA 5FPEA 4CZKA 3P4IA 3FE1A 1BA1A 2GUPA 3C7NB 4JKGA 3QBWA 4OPHA 5AQQA 5F2RA 1S72N 3NVKA 4A2BA 1YIJN 3M3ZA 1JCFA 2FF3B 4JKBA 3NVMA 4HWIA 5AZJB 4PL8A 4CBWA 5AQFA 1HLUA 4JKHA 5JICA 2F7TA 4FSVA 2PBDA 4BC4A 2A42A 1TYQA 3ZETB 1U2VB 3JS6A 5MLCQ 3RSEB 3CI5A 4M63C 1Z05A 3H3NO 3A5LC 5E84A 4IEIA 2P9SB 2FLOA 2IVOA 3VGKA 2QWPA 4FPBA 4Z94A 4H5WA 4PKHA 4ILGB 5AQTA 3W3DA 2UYTA 3WXKA 2GELA 3KHYA 4H0VB 5AQWA 4C23A 1ATSA 1QQMA 2E2OA 3LDOA 1K73O 5AQSA 1SS6A 2Q31A 3AARA 2FSKA 3E9PA 4JKGB 5AFUH 5ELZA 4A61A 1ZC6A 4H5NA 1G99A 3HZ6A 3H46O 5AQIA 4CZMA 1NGCA 4K42A 1QVGM 1NJIO 3WEEB 1RDUA 2QW9A 2ZGYA 3CC7N 3DAWA 2W41A 2ASMA 4FWLA 1TYQB 3O08A 1Q82O 4IEEA 1YHQN 3T69A 3D2FB 3P38A 4PL7A 4YOWA 4AF1A 4BY9C 4GNIA 2AP1A 3EE9A 4RCHA 2ZF5O 3G25A 1QZ5A 4K25A 4YDUA 4JKDA 3QB0A 2P9UA 4CD3A 1U6ZA 3O8MA 4BG9A 3C6AA 4JK8A 4EIAA 2JWLA 1NGAA 3OHRA 4JNEA 3DXKA 3H1QA 1M90O 3O4WA 4BR0A 2P9KA 4L3QA 3O9SA 3LDQA 1XUPO 3IKMA 5GIPA 1VAZA 4BRQA 1W97L 5BPNA 2VWBA 2WC9A 4B1ZA 4B1XB 3CJAA 1V4SA 5EX5A 3EZWA 1Q81O 1VQON 1KAXA 4IO9L 2OANA 4IOAL 4A59A 3O1BA 4BRGA 2A3ZA 3ZX2A 3VOVA 1RDWX 3CPWM 2YHWA 5M1QA 2D0PA 3A5NC 1P90A 3HI0A 3HBTA 1SAZA 3CJ7A 4FWOA 1LCUA 3ID8A 3UKRA 4BR2A 1VQNN 1HJOA 3LM2A 1ATNA 2D0OA 3VPZA 4H0YB 4B9QA 4I6MA 4CBUA 3CJ9A 4BQZA 5BPMA 5E26A 4GV3A 3P31A 4BC5A 4WQ5C 5BR9A 5GINA 4RTFD 4A2AA 3BP8A 3MWPA 4CZFA 2QWRA 4JKCA 5LY3A 1BG3A 3E66A 1GLBG 5ADXH 4IJAA 1NLVA 3OBYA 4MDAA 3AAQA 4DQ8A 5CHIA 1GLDG 4B1VA 1MDUB 2QA4N 2P9KB 4KH4A 2ASOA 4BROA 3FZHA 4DKWA 4H03B 1NGFA 2CH5A 4JKFA 3I33A 3MWTA 2F9TA 2GEMA 1JCGA 4C1NI 4FOEA 1VQ4N 3KZBA 4A5AA 3HRGA 3B8AX 4QS7A 2P9PA 4M7YA 2A5XA 1M1KO 4F9OA 3F5TA 1C0GA 2BTFA 3WUHA 2WBNA 3ZYYX 3WQTA 4EHUA 5BRFA 2ITMA 3HOSA 3AGKA 2HMPA 2QM1A 3H3OB 4H0OA 2NNWA 3VMFB 3ZEUA 3GBTA 1DKGD 2E2NA 4IFEA 4KH5A 1YVNA 4Y0WA 2Q0UA 3D2EA 3TSPA 4B1YB 5BRHA 3VENA 2J4RA 2YCHA 3R6MA 4ISEA 4MO4A 3U4LA 1K8KA 5TKYA 5AR0A 4JHDA 4BRKA 4BRMA 5AQKA 3TTFA 4WCEL 4PKIA 1D4XA 3QMLA 3A5MC 1HUXA 5TKWA 2HF4A 3BF3A 4YORA 4IDHA 4B1WB 5C10A 3SBTA 4BGAA 5GAEP 4IZ9A 5DM7L 1QZ6A 3UKUA 2A41A 2NRRA 2Q97A 1GLJO 3N4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FOI A;  1NGE A;  2GTD A;  2QWN A;  5AQL A;  4FWM A;  2DPN A;  3ENH A;  2P9N B;  5F1X A;  1NMD A;  2V7Z A;  2Q1N A;  3MCP A;  2Q0R A;  3CJ1 A;  5EY4 A;  3VGL A;  4DCH A;  2CGL A;  4BRL A;  1NGB A;  4A62 A;  1EQY A;  5BPL A;  1JCE A;  4BRH A;  2ASP A;  4E1J A;  3LL3 A;  1QHA A;  3FZM A;  4BC3 A;  2AA4 A;  4BRP A;  4BC2 A;  3O1W A;  4DHY A;  4H0X B;  3BEX A;  1NGD A;  4ISG A;  4PKG A;  3L6Q A;  4IWV A;  3CET A;  5AQH A;  3VF2 A;  2IVN A;  2P9I A;  3FR0 A;  4MO5 A;  4XEI A;  3SMS A;  2Q2R A;  1BWF O;  3IFR A;  4BVO A;  1KAZ A;  3UKU B;  1QQO A;  5KQD A;  4AM6 A;  3M1F A;  5BRE A;  3L4I A;  3MK6 A;  3HM8 A;  4H5R A;  2QWM A;  4CBX A;  4IO8 A;  3EKU A;  3VET A;  4YDU C;  4CZE A;  3CJC A;  4XH4 A;  3SK3 A;  4H0P A;  4MLE A;  3GOI A;  1GLA G;  4EAH D;  3AAP A;  4AM7 A;  4EHT A;  3UB5 A;  2IVP A;  4BR7 A;  3U8X A;  3VES A;  3GL1 A;  4IJN A;  3MN5 A;  1BDG A;  4BGB A;  4O8K A;  4BR4 A;  4BRE A;  3MMV A;  2ZGZ A;  3CHW A;  1HPM A;  4H0T B;  1DEJ A;  5EVZ A;  1KXP A;  2EWS A;  3HTV A;  3VEW A;  4BR9 A;  2P9I B;  3ATU A;  2F9W A;  3S41 A;  1T6D A;  1BO5 O;  1ZXO A;  4J8F A;  3UE5 A;  1NWK A;  4LC9 B;  4CI6 A;  3KVG A;  5AQG A;  2VYP A;  5AQR A;  3CER A;  5BN8 A;  2WUS A;  4FL9 A;  4CZL A;  1SQK A;  2YHY A;  4WQ4 A;  1T6C A;  3BUZ B;  2H3G X;  1Q18 A;  4FWN A;  3VER A;  3BF1 A;  2YHX A;  3A0I X;  1V4T A;  4O5F A;  1QQN A;  2CGJ A;  5AQX A;  5AZI A;  2P9U B;  3O6W A;  4MLH A;  3LDL A;  3AY9 A;  1S22 A;  3DXK B;  3O5B A;  1MWM A;  1C0F A;  3CJB A;  2NLX A;  3A5O C;  3WXJ A;  4BQL A;  5EXW A;  2YI1 A;  1GLE G;  3GE1 A;  5AQY A;  5B8H A;  2QWO A;  3CQX A;  4FWQ A;  1WOQ A;  1NGI A;  3U9D A;  3DJC A;  3IDH A;  2QWL A;  1SZ2 A;  1TUY A;  3C7N A;  2D1K A;  3VEZ A;  3R8E A;  4BR5 A;  4FO0 A;  3WXI A;  3UKR B;  3LM9 A;  4B1U B;  5AZJ A;  5FPN A;  5LJV A;  4JN4 A;  4BRF A;  4I6M B;  3D7E O;  3JXU A;  1YUW A;  3H45 C;  4ISF A;  4H5T A;  1Y64 A;  4IXC A;  1CZA N;  2YJE A;  2E88 A;  3ZET A;  1NM1 A;  3VF6 A;  2V52 B;  1TUU A;  5KPR A;  2I7N A;  4FWP A;  2E2P A;  3HSC A;  3FZK A;  2YJF A;  3FGU A;  3CQY A;  3GDQ A;  3WT0 A;  3QDK A;  1HKC A;  1LOT B;  2P9P B;  4EFH A;  2CH6 A;  4DB3 A;  3J8A A;  2Q36 A;  3U9Z A;  1GLF O;  3R9P A;  3GG4 A;  1MWK A;  1P8Z A;  2E20 A;  2A6A A;  5AQM A;  3ZEU B;  3D2E B;  1BA0 A;  3WXL A;  3WEE A;  2VCP A;  5AQV A;  4NO7 A;  1K8K B;  3CIP A;  4CZJ A;  4JHD B;  2FXU A;  3MN6 A;  2D4W A;  4BRD A;  1ZBS A;  2QXL A;  3D2F A;  5JLH A;  4RWT A;  3SJH A;  1E4G T;  1X3M A;  2PAV A;  3SMP A;  1E4F T;  5KQ8 A;  2E8A A;  1NGH A;  4KBO A;  1HKG A;  3FLC O;  4XH1 A;  1MA9 B;  2NRH A;  2IIR A;  3VGM A;  5ADX A;  1YXQ A;  3FZL A;  1X9J A;  3TPQ A;  4CZI A;  3MN9 A;  4CD1 A;  1XC3 A;  4FPA A;  1IJJ A;  3QFP A;  3ZX0 A;  3FZF A;  3SLC A;  1RFQ A;  3H6E A;  5KPZ A;  4K41 A;  1WUA A;  5EOY A;  3VEV A;  3A8Y A;  4HTL A;  1BUP A;  4JD2 A;  3M6G A;  3ULE A;  5BN9 A;  2BUP A;  3ZX3 A;  4BRN A;  2QWQ A;  3QFU A;  1HX1 A;  1J6Z A;  4JAX A;  1YAG A;  3VEY A;  1BOT O;  3DXM A;  1NGG A;  3EL2 A;  4FWS A;  5AQN A;  3IUC A;  3FFK B;  1RGI A;  3O80 A;  3MN7 A;  4WQ4 C;  3TU5 A;  4QS8 A;  5AQO A;  2CGK A;  2ZWH A;  3ENO A;  1KAY A;  2P9L A;  4K43 A;  4CJ7 A;  2FSJ A;  4BRC A;  4H5V A;  2KHO A;  5KPT A;  3QIC A;  1Z6R A;  4CZG A;  1BU6 O;  5LJW A;  3EN9 A;  3C0B A;  1S3X A;  1T44 A;  1DGK N;  4BRA A;  2FSN A;  2GWJ A;  4XH5 A;  3LDP A;  1GLL O;  1R59 O;  3QBX A;  3IMX A;  2I7P A;  5FPD A;  4BVP A;  4GY2 B;  4JD2 B;  3ULE B;  4M7X A;  3I8B A;  3DWL A;  3LDN A;  1OKJ A;  4BRI A;  3EKS A;  1IG8 A;  3H1V X;  3EO3 A;  3WQU A;  5AQZ A;  3DXM B;  3W0L A;  2V51 B;  5CE3 A;  4WQ5 A;  5FPM A;  4WYB A;  5AQU A;  1NGJ A;  5F0X A;  3ATV A;  4NB4 A;  1X3N A;  5AFU A;  2P9L B;  2E1Z A;  3MDQ A;  2E1Y A;  3VEX A;  2HF3 A;  1GLC G;  1ESV A;  2E2Q A;  2HOE A;  5AZI B;  4CZH A;  1ATR A;  2NZT A;  1U2V A;  2W40 A;  5AQP A;  3RSE A;  2P9N A;  5AQJ A;  1H1V A;  5JLF A;  4FWR A;  5I9E B;  4FWK A;  2A40 A;  2P9S A;  3VF4 A;  5JMV A;  4BG8 A;  3F9M A;  2GWK A;  3VEO A;  2FF6 A;  5BRD A;  1XQS C;  1NBW A;  4QS9 A;  3L0Q A;  1HKB A;  2V7Y A;  5FPE A;  4CZK A;  3P4I A;  3FE1 A;  1BA1 A;  2GUP A;  3C7N B;  3QBW A;  5AQQ A;  5F2R A;  4A2B A;  3M3Z A;  1JCF A;  2FF3 B;  5AZJ B;  4HWI A;  4CBW A;  4PL8 A;  5AQF A;  1HLU A;  5JIC A;  4FSV A;  2PBD A;  4BC4 A;  2A42 A;  1TYQ A;  3ZET B;  1U2V B;  3JS6 A;  3RSE B;  3CI5 A;  4M63 C;  1Z05 A;  3H3N O;  3A5L C;  5E84 A;  2P9S B;  2FLO A;  2IVO A;  3VGK A;  2QWP A;  4FPB A;  4Z94 A;  4H5W A;  4PKH A;  5AQT A;  3W3D A;  2UYT A;  3WXK A;  2GEL A;  3KHY A;  4H0V B;  5AQW A;  4C23 A;  1ATS A;  1QQM A;  2E2O A;  3LDO A;  5AQS A;  2Q31 A;  3AAR A;  2FSK A;  5AFU H;  5ELZ A;  4A61 A;  1ZC6 A;  4H5N A;  1G99 A;  3HZ6 A;  3H46 O;  5AQI A;  4CZM A;  1NGC A;  4K42 A;  3WEE B;  2QW9 A;  2ZGY A;  3DAW A;  2W41 A;  2ASM A;  4FWL A;  1TYQ B;  3O08 A;  3D2F B;  4PL7 A;  4GNI A;  2AP1 A;  4RCH A;  2ZF5 O;  3G25 A;  1QZ5 A;  4K25 A;  4YDU A;  3QB0 A;  2P9U A;  4CD3 A;  1U6Z A;  3O8M A;  4BG9 A;  4EIA A;  1NGA A;  3OHR A;  4JNE A;  3DXK A;  3H1Q A;  3O4W A;  4BR0 A;  2P9K A;  4L3Q A;  3LDQ A;  1XUP O;  4BRQ A;  5BPN A;  2VWB A;  4B1Z A;  4B1X B;  3CJA A;  1V4S A;  5EX5 A;  3EZW A;  1KAX A;  2OAN A;  3O1B A;  4BRG A;  2A3Z A;  3ZX2 A;  3VOV A;  1RDW X;  2YHW A;  2D0P A;  3A5N C;  4FWO A;  3HI0 A;  3HBT A;  1SAZ A;  3CJ7 A;  3UKR A;  1LCU A;  3ID8 A;  4BR2 A;  1HJO A;  3LM2 A;  1ATN A;  2D0O A;  3VPZ A;  4H0Y B;  4B9Q A;  4I6M A;  4CBU A;  3CJ9 A;  4BQZ A;  5BPM A;  5E26 A;  4BC5 A;  5BR9 A;  4WQ5 C;  4RTF D;  4A2A A;  3BP8 A;  5LY3 A;  4CZF A;  2QWR A;  1BG3 A;  1GLB G;  5ADX H;  4IJA A;  1NLV A;  3AAQ A;  4DQ8 A;  1GLD G;  4B1V A;  1MDU B;  2P9K B;  2ASO A;  4BRO A;  3FZH A;  4H03 B;  1NGF A;  2CH5 A;  3I33 A;  2F9T A;  2GEM A;  1JCG A;  4FOE A;  3KZB A;  3B8A X;  4QS7 A;  2P9P A;  4M7Y A;  2A5X A;  4F9O A;  1C0G A;  2BTF A;  3WUH A;  3WQT A;  4EHU A;  5BRF A;  2ITM A;  2HMP A;  2QM1 A;  3H3O B;  4H0O A;  3ZEU A;  3GBT A;  1DKG D;  2E2N A;  1YVN A;  4Y0W A;  2Q0U A;  3D2E A;  4B1Y B;  5BRH A;  3VEN A;  2J4R A;  2YCH A;  3R6M A;  4ISE A;  4MO4 A;  3U4L A;  1K8K A;  5TKY A;  5AR0 A;  4JHD A;  4BRK A;  4BRM A;  5AQK A;  4PKI A;  1D4X A;  3QML A;  3A5M C;  1HUX A;  2HF4 A;  3BF3 A;  4B1W B;  4BGA A;  4IZ9 A;  1QZ6 A;  3UKU A;  2A41 A;  2Q97 A;  1GLJ O; 
#chains in the Genus database with same CATH topology
 4FOI A;  5AQL A;  1BGX T;  3RMA A;  3KKS A;  1NMD A;  4PWD A;  4CEZ A;  3OYK A;  4CHZ A;  4BRL A;  4CGD A;  1RDA A;  5BPL A;  4BRH A;  1KC8 O;  1J5O A;  4KHU A;  4BRP A;  3K57 A;  4ISG A;  4PKG A;  4IWV A;  4FLY A;  4MDB A;  4XEI A;  3FR0 A;  2Q2R A;  4A5B A;  3M8P A;  1BWF O;  3SNN A;  4BVO A;  2ZJQ L;  3UKU B;  1QSY A;  4U67 L;  3L4I A;  3MK6 A;  3EEQ A;  3HM8 A;  2G8I A;  3EKU A;  4CEO A;  5GAH P;  4AQY K;  4XH4 A;  3SK3 A;  4MLE A;  4E7J A;  1YJW N;  3AVK A;  3QEW A;  3SUP A;  4DQQ A;  3CMA N;  3CCS N;  3UB5 A;  3TAG A;  4HTU A;  1L3V A;  4B3S K;  4HHT A;  2P1J A;  4CEB A;  3CCM N;  3HL8 A;  2DFE A;  1QSS A;  2ZGZ A;  3CHW A;  2HHW A;  4BDY A;  3NF6 A;  1KQS M;  4JI6 K;  4BR9 A;  2P9I B;  3ATU A;  4HUE A;  4FZY A;  3AO5 A;  1BO5 O;  3P1G A;  4J8F A;  1X9S A;  3UE5 A;  1OH8 A;  1YJN N;  3RVC A;  4Y1C A;  4FL9 A;  2F8T A;  1T6C A;  4B3T K;  3CD6 N;  3BUZ B;  4JK7 A;  3KJV A;  1Q18 A;  1KTQ A;  4B3O A;  5J1E A;  3KWI A;  2CGJ A;  2VG7 A;  4MLH A;  2E6M A;  1VSJ A;  3DXK B;  3O5B A;  1MWM A;  1K9M O;  3CJB A;  1NMN A;  4FCY A;  1GLE G;  3SPZ A;  2KQ2 A;  1SKW A;  4RW7 A;  1N33 K;  3CCR N;  4FWQ A;  3U9D A;  4PHT X;  3R3L A;  4FJN A;  1QS4 A;  3V4I A;  3WNH A;  3PIO L;  3VEZ A;  3KK3 A;  3VQ9 A;  3LM9 A;  5AZJ A;  1WSJ A;  2F96 A;  3OW2 M;  3PIP L;  4UQG A;  4ISF A;  1FKP A;  1QTM A;  2BH1 A;  4KFB A;  4JYA K;  4IXC A;  4CEA A;  3L2Q A;  3ZET A;  3VTH A;  3VF6 A;  3CCU N;  2HST A;  4CEC A;  2I7N A;  4FWP A;  3V1O A;  4CK1 A;  3HSC A;  1WSF A;  3FZK A;  3O9T A;  3NCI A;  2OYQ A;  2HND A;  3GDQ A;  3WT0 A;  3OBW A;  1HKC A;  4PY5 A;  2P9P B;  2Z1H A;  4CF8 A;  3J8A A;  3NF8 A;  3L3V A;  4CJT A;  2Q36 A;  1GLF O;  3GG4 A;  3QES A;  1HYV A;  5AQM A;  2P51 A;  1HNZ K;  3ZEU B;  2RE2 A;  4DV6 K;  4DU4 A;  5HP1 A;  3O9R A;  1BA0 A;  3FFI A;  3WXL A;  3QET A;  4FJ5 A;  4DMN A;  4BAC A;  1NK8 A;  2VCP A;  1T7P A;  3Q7C A;  4CZJ A;  4F3T A;  4FJ8 A;  3KLG A;  3D2F A;  4JI0 K;  1E4G T;  1X3M A;  3SMP A;  5KQ8 A;  3OYI A;  3IAY A;  4G9Z A;  3VQ8 A;  4KBO A;  3AA5 X;  4KRF A;  1HPZ A;  3HP9 A;  1YIT N;  2NRH A;  1EWQ A;  3VGM A;  5HBM A;  2A1S A;  4CD1 A;  3TAB A;  4FPA A;  1IJJ A;  2UUB K;  1VQP N;  3SQ4 A;  3H6E A;  2KW4 A;  3MX2 A;  1O13 A;  2NRT A;  4LSL A;  4YFU A;  1WUA A;  3ULE A;  4CEQ A;  4DV1 K;  1VQL N;  1HX1 A;  2KFN A;  1J6Z A;  3BZC A;  4KH6 A;  3DLL L;  3ID6 A;  4W5N A;  3FFK B;  1K6Y A;  2WFB A;  4QS8 A;  5AQO A;  3ENO A;  2YKM A;  4O4G A;  3G0Z A;  1HNI A;  4F3O A;  4DR5 K;  2G8K A;  4H5V A;  4Z4E A;  4DSI A;  1Z6R A;  2DFF A;  1YVU A;  3HYF A;  4CZG A;  3THY A;  3EN9 A;  3BY5 A;  3C0B A;  1S3X A;  1JKH A;  3O3H A;  3BZK A;  1GLL O;  3DLR A;  2HBK A;  3IMX A;  4BVP A;  4GY2 B;  4ILJ A;  4BDP A;  3LDN A;  4M3Z A;  1TKX A;  3P39 A;  3EKS A;  1IG8 A;  3H1V X;  4CEF A;  2UU9 K;  3EO3 A;  3CCE N;  5AQZ A;  3DXM B;  3W0L A;  5CE3 A;  4CHN A;  5FPM A;  4RG8 A;  4F2S A;  1IKY A;  4E0D A;  3C6U A;  1VQM N;  3G6E N;  2NUB A;  1GLC G;  2E2Q A;  5CYQ A;  4E7I A;  3KWG A;  5AZI B;  1ATR A;  2IS3 A;  3MAQ A;  5AQP A;  1H1V A;  3SV4 A;  1FK9 A;  5M1O A;  4FWK A;  2P9S A;  4BG8 A;  4KTW A;  3F9M A;  4NXN K;  1TVR A;  3VEO A;  5BRD A;  3CCL N;  3L0Q A;  2O8F B;  5J2Q A;  2OPQ A;  2FBT A;  3TAQ A;  3DMJ A;  1JCF A;  1IKW A;  3ZSY A;  4CBW A;  4PL8 A;  3TI0 A;  1WLJ A;  1U4B A;  2P5O A;  4FSV A;  4CJF A;  3C94 A;  4DR3 K;  3SUQ A;  4M3W A;  2OPR A;  1W0H A;  4NYF A;  4V19 S;  1NJY A;  3RSE B;  4M63 C;  5C42 A;  5E84 A;  2XHB A;  4E19 A;  2IVO A;  3THV A;  4ILG B;  4KO0 A;  3WXK A;  1YTA A;  4H0V B;  3V1Q A;  1S1U A;  3ZSZ A;  1ATS A;  5AQS A;  1GOB A;  2RN2 A;  3AVM A;  2ZM6 K;  3OS2 A;  4ICL A;  5AQI A;  1U47 A;  4LFC K;  1NGC A;  4K42 A;  3J81 O;  4DV7 K;  1NJI O;  3V9U A;  2YKN A;  2P5G A;  4Z4I A;  2O8C B;  2QKK A;  3V6D A;  4PL7 A;  4YOW A;  4BY9 C;  1WN7 A;  4N56 A;  2ZF5 O;  4YDU A;  4JLH A;  1HRH A;  4DQI A;  3QB0 A;  3PO5 A;  3J7A P;  5HRS A;  3OYJ A;  1TK8 A;  2JWL A;  5HRN A;  1ZYQ A;  3O4W A;  2P9K A;  1ZBU A;  3PSI A;  1VAZ A;  1D9F A;  5SWM A;  1NOZ A;  3QNO A;  1TV6 A;  2OCE A;  3TAF A;  1BI4 B;  4IO9 L;  4E1N A;  3QEP A;  4CIF A;  2YHW A;  2F4V K;  3U6F A;  3HI0 A;  1SAZ A;  3UKR A;  1LCU A;  4FLX A;  2D0O A;  1RT3 A;  4H0Y B;  4LD0 A;  3KK1 A;  1EET A;  3CJ9 A;  1JL2 A;  1C1A A;  5E26 A;  3LPT A;  3P31 A;  5GIN A;  3BP8 A;  3MWP A;  4CHP A;  2QWR A;  5FLX O;  4CZF A;  4F8R A;  4CGG A;  4C8O A;  1GOA A;  5CHI A;  1GLD G;  4KH4 A;  1EX4 A;  3ITH A;  1NGF A;  3MWT A;  1RCH A;  2GEM A;  4M3X A;  1EWR A;  3KZB A;  3HRG A;  2Z1J A;  3B8A X;  4M7Y A;  4CF0 A;  4JS4 A;  3ZYY X;  4EHU A;  2KFZ A;  2HMP A;  3TAE A;  1DKG D;  3ISN C;  4AHC A;  1YVN A;  1SKR A;  4FM1 A;  4B1Y B;  1HNX K;  2PZS A;  4J2A A;  4FJX A;  4ISE A;  5AR0 A;  4JHD A;  3VA3 A;  4BRK A;  1RBS A;  4DTJ A;  3OYB A;  3OYA A;  1QHT A;  3VQ5 A;  3A5M C;  5TKW A;  5C10 A;  4B3M K;  3SBT A;  5GAE P;  2IGI A;  4IZ9 A;  2A41 A;  3ZSV A;  4R5P A;  1Q82 O;  1Q86 O;  1WBD A;  4H4M A;  2HNZ A;  5T7B A;  2DPN A;  3ENH A;  3TTD A;  2ITG A;  2P9N B;  1Q7Y O;  3D0P A;  2UXD K;  2O8B A;  3TAM A;  2V7Z A;  3QIP A;  3MCP A;  3THW A;  5EY4 A;  4DCH A;  2CGL A;  5JVG L;  1NGB A;  4JEP A;  1WSE A;  1JCE A;  4E1J A;  2ASP A;  1J9A A;  3LL3 A;  4BC3 A;  4OVL A;  1T8E A;  3KIO A;  5C25 A;  4DR1 K;  4BC2 A;  1JL1 A;  3BEX A;  3E9L A;  4YOU A;  1RT6 A;  4CGI A;  3C65 A;  1ZBH A;  4MO5 A;  2BGG A;  4PA1 A;  1UA0 A;  4Z4G A;  3IFR A;  4A57 A;  1N32 K;  4WF9 L;  3D45 A;  3M8S A;  4YDU C;  4CZE A;  3OYD A;  4CJS A;  3NFA A;  4CF1 A;  4OLB A;  1HQE A;  4ILH A;  2DTU A;  2IVP A;  4B9V A;  4BR7 A;  3A2F A;  4Z0U A;  3U8X A;  3GL1 A;  4CJ5 A;  1RT7 A;  3HXM A;  4NYN A;  4BGB A;  5C2D A;  1CLQ A;  4BR4 A;  3HJF A;  3MMV A;  4H0T B;  1DEJ A;  3ZT1 A;  2EWS A;  3HTV A;  3S41 A;  2F9W A;  4YHH K;  4CFB A;  3ZT0 A;  3PV8 A;  2D0A A;  2OPS A;  3KVG A;  3CC4 N;  5AQR A;  3CER A;  3TAN A;  2WUS A;  1NU0 A;  1VSK A;  3WNF A;  2YHX A;  1QQN A;  3L2W A;  4M3U A;  3LDL A;  4Y1D A;  1C0F A;  1S1T A;  2NLX A;  3A5O C;  3WXJ A;  3MXJ A;  5LL6 Z;  4BQL A;  4KI6 A;  3T7Z A;  2ZJR L;  2VGN A;  4YOY A;  4B9T A;  5AQY A;  3CQX A;  4LF5 K;  1B9D A;  3F73 A;  1T05 A;  4CES A;  3SQ2 A;  2QWL A;  4JKE A;  1TUY A;  4DQP A;  1OVY A;  1NJZ A;  2D1K A;  3R8E A;  4BR5 A;  4CFD A;  5FPN A;  4BRF A;  3OYL A;  1UOC A;  1RT5 A;  1SL0 A;  2NRV A;  3SV3 A;  3VQE A;  1Y64 A;  4YNQ A;  2E88 A;  4JI4 K;  1KFS A;  3WXM B;  1ASV A;  1NM1 A;  1VQ9 N;  1S5J A;  1TUU A;  4RW6 A;  5D3G A;  3V1R A;  2YNF A;  2E2P A;  3CQY A;  2X6S A;  4OX9 K;  3QDK A;  1LOT B;  3WNG A;  3ZSW A;  4RW4 A;  2NRX A;  3U9Z A;  1SKS A;  1C0T A;  1F21 A;  1MWK A;  4CE9 A;  1P8Z A;  1L3T A;  5GAG P;  3SQ0 A;  4DTN A;  3OTO K;  2QKB A;  2UXC K;  3WEE A;  3ZSX A;  1LAV A;  4X62 K;  1JLG A;  4N41 A;  3J80 O;  2D4W A;  2QXL A;  3SJH A;  2XRI A;  4B8A B;  4CFA A;  2OZS A;  2E8A A;  5FDL A;  5E41 A;  1KLN A;  1VRT A;  4XH1 A;  5FRM A;  3PSF A;  4FJG A;  1NKE A;  2QI2 A;  3PUF A;  1MA9 B;  4KAZ A;  1HR0 K;  2IIR A;  3I0S A;  1NK5 A;  5ADX A;  1YXQ A;  3TPQ A;  3L2R A;  3K0S A;  1X9M A;  4IFV A;  1RTJ A;  2XY6 A;  1FKO A;  5CR4 A;  1KSP A;  5C12 A;  3AVH A;  3QFP A;  4OLA A;  3FZF A;  3SLC A;  1RFQ A;  3M5R A;  5KPZ A;  1JLA A;  4DV2 K;  3VEV A;  1JXE A;  1EXQ A;  4DQS A;  2RHK A;  1Z26 A;  3CFP A;  3AA3 A;  1T3V A;  1BOT O;  3EL2 A;  4IBN A;  5DM6 L;  4ELU A;  1RGI A;  3MN7 A;  3HVR A;  2JLE A;  2CGK A;  2P9L A;  4M45 A;  1YF5 L;  3TAP A;  1I94 K;  2HHV A;  2FSJ A;  2W42 A;  4UY8 O;  4IG3 A;  4PQU A;  1RBR A;  3E01 A;  4BRC A;  4E1M A;  3RMC A;  2FBX A;  2QXF A;  2G8U A;  1BU6 O;  5LJW A;  4DFP A;  1T44 A;  3S3O A;  4BRA A;  4XH5 A;  3QBX A;  2I7P A;  1ILY A;  3ULE B;  3I8B A;  3DWL A;  4JRP A;  2FBV A;  3BGR A;  2ZQB A;  3WQU A;  4BDZ A;  4CJ4 A;  1YJ9 N;  2V51 B;  4AHT A;  2IC3 A;  4WYB A;  5AQU A;  1NGJ A;  5F0X A;  3HK2 A;  5AFU A;  2RF2 A;  5M1N A;  1NK6 A;  2Y1J A;  1QVF M;  1Z25 A;  1C0M A;  4CZH A;  1U2V A;  2W40 A;  5AQJ A;  4GKK K;  1I3A A;  3QNN A;  1TL1 A;  4LH4 A;  1T03 A;  3L4Q A;  4OPK A;  1VSL A;  2UUC K;  1YT3 A;  1J54 A;  1A5V A;  2V7Y A;  1KVC A;  5FPE A;  3T3F A;  3ZT4 A;  3AO2 A;  3P4I A;  3MXI A;  3NH1 A;  2O4I A;  2GUP A;  3C7N B;  4JKG A;  4K8Z A;  4LY7 A;  1S72 N;  4CJ3 A;  4ELV A;  1C1B A;  2RKI A;  3DLE A;  3L3U A;  3OYG A;  2PBD A;  1BHL A;  4DUZ K;  1UA1 A;  2A42 A;  1KFD A;  1TYQ A;  2KTQ A;  4DTO A;  1WBB A;  4DTX A;  3KLH A;  1DLO A;  4KHN A;  3A5L C;  5BR8 K;  2P9S B;  2FLO A;  3VGK A;  1RBU A;  4H5W A;  4PKH A;  1D9D A;  2GEL A;  4N76 A;  1D5A A;  3AV9 A;  2IOC A;  3P83 D;  4IFY A;  5I42 A;  4GVM A;  3AAR A;  4O0I A;  5AFU H;  1J53 A;  3V9W A;  1UAX A;  4H5N A;  3OS1 A;  3VQC A;  1G99 A;  3HZ6 A;  4DV3 K;  1U48 A;  3LP2 A;  3H46 O;  4ZHR A;  2HNY A;  4FLZ A;  5SZT A;  3DAW A;  2ASM A;  5IT9 O;  1YHQ N;  3J7Y P;  3T69 A;  2YNI A;  4TSX A;  4GNI A;  2AP1 A;  2E6L A;  1TL3 A;  1QZ5 A;  3NE6 A;  2X74 A;  4CD3 A;  3O8M A;  2VWJ A;  2UUA K;  1HYS A;  1S9G A;  4JNE A;  3DXK A;  4J2E A;  3H1Q A;  2PYJ A;  4BR0 A;  3O9S A;  3LDQ A;  4BRQ A;  1S6P A;  2VWB A;  2VWK A;  4B1Z A;  4DU3 A;  4CF2 A;  3CJA A;  2EX3 A;  4HUF A;  3VA0 A;  1Q81 O;  1VQO N;  4EP5 A;  2OAN A;  4MFB A;  2A3Z A;  4BRG A;  5IWA K;  2GBZ A;  1NJW A;  1VSH A;  4WE1 A;  1SV5 A;  3L2U A;  5KPR A;  3MEG A;  3HBT A;  4BR2 A;  4CJU A;  3AVN A;  4B9Q A;  4KI4 A;  3VPZ A;  4CBU A;  3T1A A;  1LAW A;  4FLT A;  3TAR A;  4BQZ A;  4Z4C A;  4GV3 A;  5BR9 A;  2HHT A;  3AVI A;  4AHR A;  5JS2 A;  4FK0 A;  3S3N A;  1Y97 A;  1GOC A;  1WSG A;  2HHS A;  2QA4 N;  2P9K B;  4BRO A;  3FZH A;  3QIO A;  4KB1 A;  4OKK A;  4QS7 A;  2Y1I A;  2P9P A;  3M8Q A;  2A5X A;  1M1K O;  4JI2 K;  1BIS A;  3F5T A;  4FW2 A;  1C0G A;  4F9O A;  1KRP A;  3WNE A;  1L3U A;  1XWL A;  2ITM A;  1VSM A;  3AGK A;  2QM1 A;  3H3O B;  3DRR A;  4H0O A;  2NNW A;  3VMF B;  3ZEU A;  3HST B;  5HLF A;  4Y0W A;  4FJJ A;  2Q0U A;  3TSP A;  4EZ6 A;  5BRH A;  2J4R A;  2YCH A;  3DI6 A;  3LPU A;  3R6M A;  4MO4 A;  3S9H A;  4BRM A;  5AQK A;  2G8F A;  3NH2 A;  1NK0 A;  2YV0 X;  1RDB A;  3BF3 A;  3KLE A;  1RT2 A;  4LFA K;  2NRR A;  3L2V A;  2Q97 A;  4CZL A;  3IG1 A;  1GLJ O;  3N4Q A;  1NGE A;  2GTD A;  2HBL A;  5J2P A;  4I2P A;  4LF6 K;  2NRZ A;  3MCA B;  3I8D A;  2Q1N A;  2Q0R A;  3OS0 A;  4A62 A;  1EQY A;  4CED A;  4GV6 A;  1IBL K;  4FJH A;  4DHY A;  4I7F A;  4H0X B;  4DS5 A;  1WB9 A;  1NGD A;  3L6Q A;  4G1Q A;  3VF2 A;  2IVN A;  3SMS A;  2WON A;  5JS1 A;  1RDC A;  1N34 K;  1X9W A;  2YHB A;  4JI3 K;  3QEX A;  4FM0 A;  1QQO A;  4H5R A;  3VET A;  4KV8 A;  3CME N;  3PX6 A;  4H0P A;  1LWC A;  2D5R A;  3ZT3 A;  2WTU A;  2DFH A;  3ZSO A;  3C6T A;  4EAH D;  3CCQ N;  1HQU A;  3AA4 A;  3AAP A;  1NOY A;  4BE2 A;  1S1X A;  4FJK A;  3RTV A;  2HW3 A;  3C6H A;  4Z4F A;  4YOV A;  4IJN A;  4O55 A;  4JK9 A;  1TKZ A;  4GVE A;  3DRS A;  1EKE A;  3PX4 A;  4GW6 A;  4JKA A;  2HHU A;  1IBK K;  3VQB A;  3N4P A;  4FJM A;  1U04 A;  2HVI A;  1T6D A;  3ALY A;  4CHO A;  2O8D B;  1BCO A;  3I55 N;  3NF7 A;  4LC9 B;  4CI6 A;  5AQG A;  2VYP A;  1SQK A;  1QQC A;  3KLI A;  3VER A;  3BF1 A;  3A0I X;  4KHY A;  1U49 A;  1V4T A;  4DV4 K;  5AQX A;  5AZI A;  4AHV A;  2P9U B;  4CJR A;  3OYN A;  3O6W A;  3K59 A;  4F2R A;  4Q0B A;  3AY9 A;  5GAD P;  3MX5 A;  3RRG A;  5CYM A;  3VTI A;  3BDP A;  3HPO A;  1TGO A;  2YI1 A;  4RW8 A;  1JJ2 M;  5KGX A;  2OPP A;  1TK5 A;  1NG9 A;  4CJL A;  5CZ2 A;  1QE1 A;  2O8F A;  2IAJ A;  1SZ2 A;  4CF9 A;  4WFA L;  4C1N K;  1TKT A;  2VG6 A;  2OTL N;  1VQK N;  4FO0 A;  4B1U B;  5LJV A;  4JN4 A;  4I6M B;  4OPA A;  3D7E O;  4AIL C;  1JLF A;  4E89 A;  3H45 C;  4BWJ A;  3DLH A;  3QLH A;  2HHQ A;  1CZA N;  1XHX A;  2YJE A;  1N36 K;  1DTQ A;  1XI1 A;  2V52 B;  4M3Y A;  1NK9 A;  3DLG A;  4O44 A;  2QTD A;  4CJW A;  3FGU A;  1XC9 A;  3PO4 A;  4LF9 K;  2CH6 A;  4FJ9 A;  3SJJ A;  5FRN A;  3E9O A;  2I5J A;  1SL2 A;  3ZLJ A;  4NCA A;  3U3Y A;  4KHS A;  2HVH A;  2A6A A;  2E4L A;  2KLA A;  1S1W A;  4E7L A;  4WFB L;  5CY4 A;  3LAN A;  2YNH A;  3D2E B;  4NO7 A;  1K8K B;  2O8C A;  2FXU A;  4DTS A;  4BRD A;  4RWT A;  1Q9X A;  2BAN A;  1TKD A;  4ID5 A;  3OYF A;  1E4F T;  2KZM A;  1NGH A;  1HKG A;  1OH7 A;  4JI1 K;  3FLC O;  3CFR A;  2DY4 A;  2HBM A;  1CXU A;  4JS5 A;  2O8E A;  4FVM A;  3CPE A;  1RNH A;  2Q3S A;  4CZI A;  1K8A O;  3NGI A;  1XC3 A;  2VGM A;  4DR6 K;  3OYE A;  1VQ7 N;  3ZX0 A;  3P5J A;  2NRW A;  1EP4 A;  4DV0 K;  3LAK A;  2ZJP L;  4K41 A;  2PFU A;  1TAU A;  4GKJ K;  2QK9 A;  4Z4H A;  3PX0 A;  4JI8 K;  4JD2 A;  3M6G A;  4BRN A;  2BUP A;  3ZX3 A;  2HBJ A;  2QWQ A;  3B6O A;  3KK7 A;  3AO4 A;  5A2Q O;  3VQ6 A;  3NMU A;  4JAX A;  3VEY A;  1NGG A;  4FWS A;  5AQN A;  3IUC A;  4AH9 A;  3I56 N;  3CCV N;  3TU5 A;  1KAY A;  1LWF A;  1TAQ A;  1B9F A;  3CG7 A;  4CJ7 A;  4W5Q A;  3G4S N;  3SZ2 A;  2AJQ A;  4E7H A;  5KRT A;  1NK4 A;  2KHO A;  5KPT A;  3QIC A;  4KHW A;  3R1X A;  4KKO A;  3THX A;  3NDK A;  4FZX C;  2ETJ A;  4I9Q A;  1OH6 A;  1NJX A;  1DGK N;  4DR2 K;  4DLG A;  2FSN A;  2GWJ A;  3LDP A;  1R59 O;  1VQ6 N;  5FPD A;  2RPI A;  4FK2 A;  4NLB A;  4M7X A;  4FVU A;  1JLQ A;  1OKJ A;  4BRI A;  4FLV A;  4DSK A;  4CK3 A;  4R79 A;  3VQP A;  3G10 A;  5HOO A;  2KZZ A;  1R0A A;  3DRP A;  4IG0 A;  4FLU A;  4YOX A;  4I9L A;  4DG1 A;  1X3N A;  2P9L B;  4AHS A;  2E1Z A;  3AVJ A;  5GIO A;  4B9M A;  2HF3 A;  3O9U A;  4FLW A;  1ESV A;  4CVN E;  4M42 A;  1ITG A;  3F2K A;  2P9N A;  1JLB A;  4JV5 K;  3LP1 A;  3OA9 A;  2GWK A;  3K9K A;  5KTQ A;  2BE2 A;  4M41 A;  3RRH A;  4CZK A;  3AA2 A;  3FE1 A;  4NXM K;  1REV A;  4OPH A;  4CIE A;  3AVA A;  4A2B A;  1YIJ N;  4F4K A;  2FF3 B;  4JKB A;  3NVM A;  5AZJ B;  4JKH A;  2XY7 A;  4X64 K;  5JIC A;  3NHG A;  4CGJ A;  4FM2 A;  4CGH A;  1A5W A;  4BC4 A;  3VQQ A;  2EHG A;  1NKC A;  3V81 A;  2HB5 A;  1VSI A;  3AO1 A;  3ZET B;  1U2V B;  4ZTJ A;  4FZZ A;  3CI5 A;  2B6A A;  1IG9 A;  3H3N O;  4CCH A;  2LSN A;  4Z94 A;  4LFB K;  4DQR A;  2XY5 A;  2UYT A;  3KHY A;  5AQW A;  2FC0 A;  1QQM A;  2E2O A;  1K73 O;  3KLF A;  2E5L K;  1HYZ A;  2FSK A;  4JKG B;  5ELZ A;  2UXB K;  3I0R A;  3SQ1 A;  4HVJ A;  3HO1 A;  1RBV A;  4X65 K;  4DFJ A;  1QVG M;  3HP6 A;  1RDU A;  1RTH A;  1SUQ A;  1IKX A;  5KI6 A;  4KHQ A;  1TYQ B;  1ASU A;  3D2F B;  4AF1 A;  1NNE A;  4RCH A;  4C8L A;  2ZD1 A;  4K25 A;  4OJR A;  4JKD A;  1LWE A;  2PY5 A;  3VQ7 A;  4BG9 A;  1N5Y A;  4JK8 A;  4EIA A;  1NGA A;  3OHR A;  4FW1 A;  4L3Q A;  3IKM A;  4CJV A;  5GIP A;  5BPN A;  4ID1 A;  2WC9 A;  1W9H A;  4B1X B;  1V4S A;  1KAX A;  3O1B A;  3VOV A;  1RDW X;  3CPW M;  5M1Q A;  1N6Q A;  4DSF A;  3CJ7 A;  1RDD A;  3ID8 A;  1RT4 A;  3LM2 A;  1Q9Y A;  3SI6 A;  3EYZ A;  5BPM A;  4OKE A;  1BQM A;  4RTF D;  5LY3 A;  1KVA A;  4QAG A;  3IRX A;  4O0J A;  2VQE K;  3SUN A;  2X6N A;  5ADX H;  1JLE A;  2ASO A;  3KKR A;  4QCL A;  5HRP A;  4JKF A;  3SUO A;  2F9T A;  4C1N I;  1JCG A;  5LMN K;  4FOE A;  4A5A A;  4JI5 K;  4FK4 A;  2BTF A;  3QEI A;  1WAJ A;  2WBN A;  3THY B;  1E3M A;  3WQT A;  3HOS A;  3NAE A;  1WAF A;  1NKB A;  3GBT A;  2E2N A;  4IFE A;  4KH5 A;  3OYH A;  5J2N A;  1ZBL A;  4BWM A;  3U4L A;  3V9Z A;  2F8S A;  4FXD A;  3TTF A;  1HNV A;  4WCE L;  3V9S A;  1XNR K;  4PKI A;  1D4X A;  3JAM O;  1MU2 A;  3QML A;  4XIU A;  1BL3 A;  1X1P A;  1RTI A;  5FRO A;  2B5J A;  4B1W B;  1FW6 A;  4DTU A;  2R7Y A;  3K58 A;  3UKU A;  4KRE A;  2QWN A;  4FWM A;  4GV9 A;  5M1F A;  3MED A;  5F1X A;  3VGL A;  2BDP A;  3CJ1 A;  1OH5 A;  4O5B A;  4HCC A;  2ATQ A;  3CM6 A;  1UWB A;  1ZBI A;  1QHA A;  3FZM A;  1ASW A;  1KD1 O;  3CF5 L;  2AA4 A;  3DOK A;  3NBP A;  3TTC A;  3JYT A;  3O1W A;  2QEX N;  4DS4 A;  3CXC M;  4J2B A;  4DSJ A;  3CET A;  5AQH A;  3KD5 E;  2P9I A;  3RR8 A;  5KRS A;  5J2M A;  3QER A;  1KAZ A;  5KQD A;  2VG5 A;  3M1F A;  4AM6 A;  2W6K A;  4B8C A;  5BRE A;  4CBX A;  1BIZ A;  2QWM A;  4IO8 A;  1S9E A;  3VQD A;  4B08 A;  3CJC A;  2OTJ N;  1OVQ A;  3SAG A;  3K5N A;  3GOI A;  2A1R A;  3OJU A;  1GLA G;  3HOT A;  3HPG A;  3LP3 A;  4AM7 A;  4EHT A;  4CEE A;  3LWM A;  3QEV A;  1VSF A;  4DTM A;  3VES A;  5HL7 L;  1KLM A;  3MN5 A;  1BDG A;  1RT1 A;  4DFM A;  4NCG A;  4O8K A;  4BRE A;  1C0U A;  5C15 A;  5KGW A;  3D6R A;  4ZTF A;  1HPM A;  5EVZ A;  1KXP A;  3VEW A;  2G8H A;  1BIU A;  3CFO A;  4JI7 K;  4DF8 A;  3Q7B A;  4WFN L;  3ZT2 A;  1ZXO A;  1XHZ A;  1NWK A;  4H4O A;  5BN8 A;  5H1S Q;  2YHY A;  4WQ4 A;  2H3G X;  2IDO A;  3SAH A;  4FWN A;  5DK5 A;  4O5F A;  3G71 N;  3J7Z O;  4DR4 K;  4YY3 K;  1S22 A;  2YX6 A;  2WOM A;  3NGZ A;  4Q5V A;  3SBG A;  5EXW A;  1WSH A;  3GE1 A;  4CJQ A;  5B8H A;  2QWO A;  4CFC A;  4IOX A;  1IKV A;  1WOQ A;  1NGI A;  1VK0 A;  4FJ7 A;  3DJC A;  3IDH A;  1FJG K;  3C7N A;  1HNW K;  4DR7 K;  2YNG A;  1TK0 A;  3AVF A;  4N5S A;  3WXI A;  3UKR B;  3VN5 A;  4H8K A;  4IOC L;  3JXU A;  1YUW A;  1KVB A;  4IKF A;  3TR8 A;  5LMU K;  3LZJ A;  4H5T A;  3ENB A;  3NF9 A;  4NLC A;  3SPY A;  1BQN A;  3RWU A;  5I3U A;  4RW9 A;  3TSU A;  2FBY A;  1W7A A;  3O3G A;  4DF4 A;  2YHA A;  5JVH L;  3T1Y K;  2D0C A;  2PYL A;  2YJF A;  4DTP A;  3M8R A;  3E1Y A;  4LSN A;  3LZI A;  4EFH A;  3AVL A;  4DB3 A;  3C95 A;  1A5X A;  4B9N A;  4ELT A;  3R9P A;  4B9L A;  4BE0 A;  4DFK A;  4CJE A;  2E20 A;  3PLA A;  3CQ8 A;  3B6P A;  1W2B M;  3RMD A;  1L3S A;  3K9J A;  5AQV A;  3CIP A;  4JHD B;  1RTD A;  3MN6 A;  1ZBS A;  5JLH A;  2PAV A;  4CW7 B;  2OZM A;  1DTT A;  1VSE A;  2KKZ A;  5AJ3 K;  4NCB A;  4LF7 K;  1IBM K;  4KB0 A;  4DLE A;  4HUG A;  4W5O A;  3FZL A;  2O8B B;  1X9J A;  3MN9 A;  1N8R O;  3THW B;  2VQF K;  3TSQ A;  3VQ4 A;  4E3S A;  3U3G A;  2HMI A;  1SL1 A;  2GX9 A;  4CHY A;  4FJL A;  1S6Q A;  5C2F A;  5EOY A;  3A8Y A;  4HTL A;  4O8U A;  1BUP A;  5BN9 A;  4DSL A;  4W5T A;  3QFU A;  2OA8 A;  3O4N A;  1YAG A;  3DXM A;  1J5E K;  1HJR A;  3KK2 A;  3O80 A;  1XNQ K;  4K8X A;  4OGC A;  1YI2 N;  1EO1 A;  4YOT A;  3DLB A;  4WQ4 C;  4CHQ A;  3SAF A;  4C8K A;  2ZWH A;  4EP4 A;  2O8E B;  1DT9 A;  4K43 A;  1RBT A;  3MXM A;  1NK7 A;  3LAM A;  3LP0 A;  3VQA A;  3HPH A;  3ULD A;  5M1P A;  2XO7 A;  3CM5 A;  1IH7 A;  3ZSR A;  1D8Y A;  4U7B A;  5C0Y A;  4W5R A;  3CC2 N;  1JLC A;  1VQ5 N;  4JD2 B;  3KD1 E;  1BCM A;  4CGF A;  4CJK A;  3O3F A;  2JGU A;  1VQ8 N;  3K2P A;  3OYM A;  4DV5 K;  4WQ5 A;  3AGR A;  3AVG A;  3K5O A;  3ATV A;  1C1C A;  4NB4 A;  3CCJ N;  3MDQ A;  2E1Y A;  3VEX A;  4E7K A;  5M1K A;  4OO1 J;  1IV0 A;  1CZB A;  4OPJ A;  3EZ5 A;  2HOE A;  3LAL A;  3F9K A;  2NZT A;  4DTR A;  2JWK A;  3THX B;  3RR7 A;  3ZSQ A;  2X78 A;  3RSE A;  5JLF A;  4FWR A;  5I9E B;  1WSI A;  4KHP K;  3O9Q A;  2A40 A;  3VF4 A;  5JMV A;  3K5L A;  1KCF A;  5DMR A;  2FF6 A;  3EE8 A;  1XQS C;  3T1H K;  1NBW A;  4QS9 A;  3SCX A;  1HKB A;  1LW2 A;  3LWL A;  1BA1 A;  2W6L A;  3DOL A;  1VHX A;  3OJS A;  3QBW A;  5AQQ A;  5F2R A;  3NVK A;  4B9S A;  4KTQ A;  3M3Z A;  3IS9 A;  3OY9 A;  3PY8 A;  4J2D A;  4HWI A;  5AQF A;  1HLU A;  3MEE A;  2ZE2 A;  2F7T A;  4CK2 A;  4X66 K;  1VSD A;  4K0K K;  1CZ9 A;  3HT3 A;  3MEC A;  1B92 A;  3DYA A;  4JRQ A;  3AO3 A;  4LF8 K;  1QSL A;  3UIQ A;  3LDS A;  5HRR A;  3JS6 A;  5MLC Q;  1I39 A;  1Z05 A;  4C8M A;  3JSM A;  4IEI A;  1LV5 A;  2QWP A;  4KPY A;  4FPB A;  2B4J A;  5AQT A;  3W3D A;  4IDK A;  1VRU A;  4C23 A;  3OYC A;  2GUI A;  3ZCM A;  4DU1 A;  3LDO A;  3ASM A;  1HMV A;  4LH5 A;  1SS6 A;  2Q31 A;  4CIG A;  3E9P A;  3AVB A;  4A61 A;  1ZC6 A;  1U45 A;  4EZ9 A;  1BI4 A;  4CZM A;  2Z1I A;  1IO2 A;  2HHH K;  3QIN A;  4PUO A;  2O8D A;  4DWI A;  3WEE B;  4GMJ B;  2QW9 A;  1C6V A;  2ZGY A;  4CER A;  3CC7 N;  2W41 A;  4FWL A;  3O08 A;  3RMB A;  4IEE A;  3V9X A;  3P38 A;  2XY8 A;  3EE9 A;  3H08 A;  3CYM A;  3SYZ A;  3G25 A;  3L8B A;  4FJI A;  2D0B A;  3DLK A;  5K14 A;  4DUY K;  2P9U A;  1U6Z A;  3C6A A;  2O4G A;  4L8R B;  1M90 O;  4KTZ A;  3EY1 A;  5HRO A;  1XUP O;  1CXQ A;  1W97 L;  3S3M A;  1RIL A;  5EX5 A;  3EZW A;  4M3R A;  4HCB A;  4BE1 A;  1G15 A;  1L5U A;  4IOA L;  4A59 A;  3ZX2 A;  3HVT A;  2D0P A;  4FWO A;  3A5N C;  1P90 A;  4N47 A;  1VQN N;  4QOZ B;  3T19 A;  2Z1G A;  1HJO A;  1ATN A;  4I6M A;  5C24 A;  4BC5 A;  4WQ5 C;  2HHX A;  4CJP A;  1JXB A;  3AVC A;  4A2A A;  4JKC A;  1Q8I A;  1BG3 A;  3E66 A;  1GLB G;  2G8W A;  1O1W A;  1NLV A;  3O4Q A;  3OBY A;  4IJA A;  3AAQ A;  4MDA A;  4DQ8 A;  4B1V A;  4C8N A;  1MDU B;  4DKW A;  1YTU A;  4H03 B;  4DSE A;  2CH5 A;  3I33 A;  4FYD A;  1VQ4 N;  4OKJ A;  2G8V A;  1FXX A;  3HM9 A;  4I2Q A;  1ZBF A;  3WUH A;  4B3R K;  5CZ1 A;  3KTQ A;  1XMQ K;  4LF4 K;  5BRF A;  1LW0 A;  3NGY A;  3NH0 A;  3K5M A;  2GV9 A;  1S1V A;  3QO9 A;  3D2E A;  3VEN A;  1K8K A;  5TKY A;  4AHU A;  3DM2 A;  3OVN A;  4M3T A;  5EU7 A;  3TWH A;  4OGE A;  1XMO K;  4MQ3 A;  1WNS A;  1HUX A;  2HF4 A;  4YOR A;  4IDH A;  4BGA A;  5DM7 L;  1QZ6 A;  4B9U A; 
#chains in the Genus database with same CATH homology
 4FOI A;  1NGE A;  2GTD A;  2QWN A;  5AQL A;  4FWM A;  2HBL A;  2DPN A;  3ENH A;  3TTD A;  2P9N B;  1Q7Y O;  4GV9 A;  5M1F A;  5F1X A;  1NMD A;  2NRZ A;  3MCA B;  2V7Z A;  2Q1N A;  3MCP A;  2Q0R A;  3CJ1 A;  5EY4 A;  3VGL A;  4DCH A;  2CGL A;  5JVG L;  4BRL A;  1NGB A;  4JEP A;  4A62 A;  1EQY A;  5BPL A;  1JCE A;  4BRH A;  2ASP A;  4E1J A;  4GV6 A;  3LL3 A;  1KC8 O;  1QHA A;  3FZM A;  4BC3 A;  1KD1 O;  3CF5 L;  2AA4 A;  3TTC A;  4BRP A;  4BC2 A;  3O1W A;  4DHY A;  2QEX N;  4H0X B;  3CXC M;  3BEX A;  1NGD A;  4ISG A;  3E9L A;  4PKG A;  3L6Q A;  4IWV A;  3CET A;  4YOU A;  4MDB A;  5AQH A;  3VF2 A;  2IVN A;  2P9I A;  3C65 A;  3FR0 A;  4MO5 A;  4XEI A;  2Q2R A;  3SMS A;  4A5B A;  1BWF O;  3IFR A;  4A57 A;  4WF9 L;  4BVO A;  2ZJQ L;  1KAZ A;  3UKU B;  1QQO A;  4U67 L;  5KQD A;  4AM6 A;  3M1F A;  5BRE A;  3L4I A;  3MK6 A;  3HM8 A;  4H5R A;  2QWM A;  4CBX A;  4IO8 A;  3EKU A;  5GAH P;  3VET A;  4YDU C;  4CZE A;  3CJC A;  4XH4 A;  3SK3 A;  4H0P A;  4MLE A;  3CME N;  2OTJ N;  3SAG A;  3GOI A;  1YJW N;  1GLA G;  4EAH D;  3HOT A;  3CCQ N;  3AAP A;  4AM7 A;  4EHT A;  3CMA N;  3CCS N;  3UB5 A;  4ILH A;  2IVP A;  4BR7 A;  3C6H A;  3U8X A;  3VES A;  3GL1 A;  4YOV A;  5HL7 L;  4IJN A;  3MN5 A;  1BDG A;  4BGB A;  4JK9 A;  3CCM N;  5C2D A;  4O8K A;  4GVE A;  4BR4 A;  4BRE A;  3MMV A;  5C15 A;  2ZGZ A;  3CHW A;  3D6R A;  1KQS M;  1HPM A;  4H0T B;  1DEJ A;  5EVZ A;  1KXP A;  2EWS A;  3HTV A;  3VEW A;  4JKA A;  3N4P A;  4BR9 A;  2P9I B;  3ATU A;  2F9W A;  3S41 A;  1T6D A;  3Q7B A;  1BO5 O;  4WFN L;  1ZXO A;  4J8F A;  3UE5 A;  1NWK A;  3I55 N;  1YJN N;  3RVC A;  4LC9 B;  4CI6 A;  3KVG A;  5AQG A;  2VYP A;  5AQR A;  3CER A;  5BN8 A;  3CC4 N;  2WUS A;  4FL9 A;  4CZL A;  1SQK A;  5H1S Q;  2YHY A;  4WQ4 A;  1T6C A;  3CD6 N;  3BUZ B;  2H3G X;  4JK7 A;  3SAH A;  1Q18 A;  4FWN A;  3VER A;  3BF1 A;  2YHX A;  3A0I X;  1V4T A;  4O5F A;  1QQN A;  3KWI A;  3G71 N;  2CGJ A;  5AQX A;  5AZI A;  3J7Z O;  2P9U B;  3O6W A;  4MLH A;  3LDL A;  3AY9 A;  1S22 A;  3DXK B;  3O5B A;  1MWM A;  2YX6 A;  5GAD P;  1C0F A;  1K9M O;  3CJB A;  2NLX A;  3A5O C;  3MX5 A;  3WXJ A;  4BQL A;  3VTI A;  3SBG A;  5EXW A;  3T7Z A;  2ZJR L;  2YI1 A;  1GLE G;  3GE1 A;  1JJ2 M;  2VGN A;  4YOY A;  5AQY A;  5B8H A;  2QWO A;  3CQX A;  4IOX A;  3CCR N;  4FWQ A;  1WOQ A;  1NGI A;  3U9D A;  4PHT X;  3R3L A;  3DJC A;  3IDH A;  2QWL A;  4JKE A;  1SZ2 A;  1TUY A;  3C7N A;  4WFA L;  1OVY A;  3PIO L;  4C1N K;  2D1K A;  3VEZ A;  2OTL N;  3R8E A;  4BR5 A;  1VQK N;  4FO0 A;  3WXI A;  3UKR B;  3LM9 A;  4B1U B;  5AZJ A;  5FPN A;  5LJV A;  4JN4 A;  4BRF A;  4IOC L;  4I6M B;  4OPA A;  2NRV A;  3D7E O;  3JXU A;  3OW2 M;  1YUW A;  3H45 C;  3PIP L;  4ISF A;  2BH1 A;  4H5T A;  1Y64 A;  4IXC A;  3ENB A;  1CZA N;  2YJE A;  2E88 A;  4NLC A;  3WXM B;  3ZET A;  3VTH A;  1NM1 A;  1VQ9 N;  3VF6 A;  2V52 B;  3CCU N;  1TUU A;  2HST A;  3TSU A;  5KPR A;  2I7N A;  4FWP A;  2E2P A;  5JVH L;  2QTD A;  3HSC A;  3FZK A;  3O9T A;  2YJF A;  3FGU A;  3CQY A;  3GDQ A;  3WT0 A;  3OBW A;  3QDK A;  3E1Y A;  1HKC A;  1LOT B;  2P9P B;  4EFH A;  2CH6 A;  4DB3 A;  3J8A A;  2NRX A;  3E9O A;  2Q36 A;  3U9Z A;  1GLF O;  3R9P A;  3GG4 A;  1MWK A;  1P8Z A;  2E20 A;  2A6A A;  5AQM A;  2KLA A;  3ZEU B;  2RE2 A;  5GAG P;  3PLA A;  4WFB L;  3D2E B;  3O9R A;  1BA0 A;  1W2B M;  3WXL A;  3WEE A;  3K9J A;  2VCP A;  5AQV A;  4NO7 A;  1K8K B;  3CIP A;  3Q7C A;  4JHD B;  4CZJ A;  2FXU A;  3MN6 A;  2D4W A;  4BRD A;  1ZBS A;  2QXL A;  3D2F A;  5JLH A;  4RWT A;  3SJH A;  1E4G T;  1X3M A;  2PAV A;  3SMP A;  1E4F T;  5KQ8 A;  4G9Z A;  2E8A A;  1NGH A;  2KKZ A;  1HKG A;  4KBO A;  3FLC O;  4XH1 A;  1Q86 O;  2HBM A;  2QI2 A;  1MA9 B;  1YIT N;  2NRH A;  2IIR A;  3CPE A;  3VGM A;  5ADX A;  1YXQ A;  3FZL A;  1X9J A;  3TPQ A;  4CZI A;  3MN9 A;  1K8A O;  1N8R O;  4CD1 A;  1XC3 A;  2VGM A;  3TSQ A;  4FPA A;  1IJJ A;  5CR4 A;  5C12 A;  1VQ7 N;  3QFP A;  3ZX0 A;  1VQP N;  3FZF A;  3SLC A;  2GX9 A;  2NRW A;  1RFQ A;  3M5R A;  3H6E A;  5KPZ A;  2ZJP L;  3MX2 A;  2PFU A;  4K41 A;  1O13 A;  2NRT A;  5C2F A;  1WUA A;  5EOY A;  3VEV A;  3A8Y A;  4HTL A;  4O8U A;  1BUP A;  4JD2 A;  3M6G A;  3ULE A;  5BN9 A;  2BUP A;  3ZX3 A;  4BRN A;  2HBJ A;  1VQL N;  2QWQ A;  2RHK A;  3QFU A;  1HX1 A;  1J6Z A;  3KK7 A;  3NMU A;  4JAX A;  1YAG A;  3VEY A;  1T3V A;  1BOT O;  4KH6 A;  3DXM A;  1NGG A;  3EL2 A;  3ID6 A;  4FWS A;  3IUC A;  3FFK B;  5AQN A;  5DM6 L;  1RGI A;  3O80 A;  3MN7 A;  3I56 N;  1YI2 N;  1EO1 A;  4YOT A;  3CCV N;  2WFB A;  4WQ4 C;  3TU5 A;  4QS8 A;  5AQO A;  3SAF A;  2CGK A;  2ZWH A;  3ENO A;  1KAY A;  1DT9 A;  2P9L A;  4K43 A;  1YF5 L;  3G4S N;  4CJ7 A;  2FSJ A;  4UY8 O;  4BRC A;  4H5V A;  2KHO A;  5KPT A;  3QIC A;  1Z6R A;  3R1X A;  5M1P A;  4CZG A;  1BU6 O;  5LJW A;  3EN9 A;  3C0B A;  1S3X A;  1T44 A;  1DGK N;  4BRA A;  2FSN A;  2GWJ A;  4XH5 A;  3LDP A;  1GLL O;  1R59 O;  3QBX A;  2HBK A;  3IMX A;  2I7P A;  5FPD A;  4U7B A;  3CC2 N;  1VQ6 N;  5C0Y A;  1ILY A;  4BVP A;  4GY2 B;  1VQ5 N;  4JD2 B;  4NLB A;  4M7X A;  3I8B A;  3ULE B;  4ILJ A;  4FVU A;  3DWL A;  3LDN A;  1OKJ A;  3P39 A;  3EKS A;  4BRI A;  4R79 A;  1IG8 A;  3H1V X;  1VQ8 N;  3EO3 A;  3CCE N;  3WQU A;  5HOO A;  5AQZ A;  3DXM B;  3W0L A;  1YJ9 N;  2V51 B;  5CE3 A;  4WQ5 A;  3AGR A;  5FPM A;  4WYB A;  4YOX A;  5AQU A;  1NGJ A;  5F0X A;  3ATV A;  4NB4 A;  1X3N A;  5AFU A;  2P9L B;  3CCJ N;  2E1Z A;  3MDQ A;  5GIO A;  2E1Y A;  3VEX A;  1VQM N;  5M1N A;  5M1K A;  3G6E N;  4OO1 J;  2HF3 A;  3O9U A;  1GLC G;  1ESV A;  2E2Q A;  1QVF M;  2HOE A;  3KWG A;  5AZI B;  4CZH A;  1ATR A;  2NZT A;  2JWK A;  1U2V A;  2W40 A;  5AQP A;  3F2K A;  3RSE A;  2P9N A;  5AQJ A;  1H1V A;  5JLF A;  4FWR A;  5I9E B;  5M1O A;  3L4Q A;  3O9Q A;  4FWK A;  2A40 A;  2P9S A;  3VF4 A;  5JMV A;  3DLL L;  4BG8 A;  3F9M A;  3OA9 A;  2GWK A;  3K9K A;  3VEO A;  2FF6 A;  3EE8 A;  1XQS C;  5BRD A;  3CCL N;  1NBW A;  4QS9 A;  3L0Q A;  1HKB A;  2V7Y A;  5FPE A;  4CZK A;  3P4I A;  3FE1 A;  1BA1 A;  2GUP A;  3C7N B;  4JKG A;  3QBW A;  4OPH A;  5AQQ A;  5F2R A;  1S72 N;  3NVK A;  4A2B A;  1YIJ N;  3M3Z A;  1JCF A;  2FF3 B;  4JKB A;  3NVM A;  4HWI A;  5AZJ B;  4PL8 A;  4CBW A;  5AQF A;  1HLU A;  4JKH A;  5JIC A;  2F7T A;  4FSV A;  2PBD A;  4BC4 A;  2A42 A;  1TYQ A;  3ZET B;  1U2V B;  3JS6 A;  5MLC Q;  3RSE B;  3CI5 A;  4M63 C;  1Z05 A;  3H3N O;  3A5L C;  5E84 A;  4IEI A;  2P9S B;  2FLO A;  2IVO A;  3VGK A;  2QWP A;  4FPB A;  4Z94 A;  4H5W A;  4PKH A;  4ILG B;  5AQT A;  3W3D A;  2UYT A;  3WXK A;  2GEL A;  3KHY A;  4H0V B;  5AQW A;  4C23 A;  1ATS A;  1QQM A;  2E2O A;  3LDO A;  1K73 O;  5AQS A;  1SS6 A;  2Q31 A;  3AAR A;  2FSK A;  3E9P A;  4JKG B;  5AFU H;  5ELZ A;  4A61 A;  1ZC6 A;  4H5N A;  1G99 A;  3HZ6 A;  3H46 O;  5AQI A;  4CZM A;  1NGC A;  4K42 A;  1QVG M;  1NJI O;  3WEE B;  1RDU A;  2QW9 A;  2ZGY A;  3CC7 N;  3DAW A;  2W41 A;  2ASM A;  4FWL A;  1TYQ B;  3O08 A;  1Q82 O;  4IEE A;  1YHQ N;  3T69 A;  3D2F B;  3P38 A;  4PL7 A;  4YOW A;  4AF1 A;  4BY9 C;  4GNI A;  2AP1 A;  3EE9 A;  4RCH A;  2ZF5 O;  3G25 A;  1QZ5 A;  4K25 A;  4YDU A;  4JKD A;  3QB0 A;  2P9U A;  4CD3 A;  1U6Z A;  3O8M A;  4BG9 A;  3C6A A;  4JK8 A;  4EIA A;  2JWL A;  1NGA A;  3OHR A;  4JNE A;  3DXK A;  3H1Q A;  1M90 O;  3O4W A;  4BR0 A;  2P9K A;  4L3Q A;  3O9S A;  3LDQ A;  1XUP O;  3IKM A;  5GIP A;  1VAZ A;  4BRQ A;  1W97 L;  5BPN A;  2VWB A;  2WC9 A;  4B1Z A;  4B1X B;  3CJA A;  1V4S A;  5EX5 A;  3EZW A;  1Q81 O;  1VQO N;  1KAX A;  4IO9 L;  2OAN A;  4IOA L;  4A59 A;  3O1B A;  4BRG A;  2A3Z A;  3ZX2 A;  3VOV A;  1RDW X;  3CPW M;  2YHW A;  5M1Q A;  2D0P A;  3A5N C;  1P90 A;  3HI0 A;  3HBT A;  1SAZ A;  3CJ7 A;  4FWO A;  1LCU A;  3ID8 A;  3UKR A;  4BR2 A;  1VQN N;  1HJO A;  3LM2 A;  1ATN A;  2D0O A;  3VPZ A;  4H0Y B;  4B9Q A;  4I6M A;  4CBU A;  3CJ9 A;  4BQZ A;  5BPM A;  5E26 A;  4GV3 A;  3P31 A;  4BC5 A;  4WQ5 C;  5BR9 A;  5GIN A;  4RTF D;  4A2A A;  3BP8 A;  3MWP A;  4CZF A;  2QWR A;  4JKC A;  5LY3 A;  1BG3 A;  3E66 A;  1GLB G;  5ADX H;  4IJA A;  1NLV A;  3OBY A;  4MDA A;  3AAQ A;  4DQ8 A;  5CHI A;  1GLD G;  4B1V A;  1MDU B;  2QA4 N;  2P9K B;  4KH4 A;  2ASO A;  4BRO A;  3FZH A;  4DKW A;  4H03 B;  1NGF A;  2CH5 A;  4JKF A;  3I33 A;  3MWT A;  2F9T A;  2GEM A;  1JCG A;  4C1N I;  4FOE A;  1VQ4 N;  3KZB A;  4A5A A;  3HRG A;  3B8A X;  4QS7 A;  2P9P A;  4M7Y A;  2A5X A;  1M1K O;  4F9O A;  3F5T A;  1C0G A;  2BTF A;  3WUH A;  2WBN A;  3ZYY X;  3WQT A;  4EHU A;  5BRF A;  2ITM A;  3HOS A;  3AGK A;  2HMP A;  2QM1 A;  3H3O B;  4H0O A;  2NNW A;  3VMF B;  3ZEU A;  3GBT A;  1DKG D;  2E2N A;  4IFE A;  4KH5 A;  1YVN A;  4Y0W A;  2Q0U A;  3D2E A;  3TSP A;  4B1Y B;  5BRH A;  3VEN A;  2J4R A;  2YCH A;  3R6M A;  4ISE A;  4MO4 A;  3U4L A;  1K8K A;  5TKY A;  5AR0 A;  4JHD A;  4BRK A;  4BRM A;  5AQK A;  3TTF A;  4WCE L;  4PKI A;  1D4X A;  3QML A;  3A5M C;  1HUX A;  5TKW A;  2HF4 A;  3BF3 A;  4YOR A;  4IDH A;  4B1W B;  5C10 A;  3SBT A;  4BGA A;  5GAE P;  4IZ9 A;  5DM7 L;  1QZ6 A;  3UKU A;  2A41 A;  2NRR A;  2Q97 A;  1GLJ O;  3N4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...