4BROA

Legionella pneumophila ntpdase1 crystal form iv (part-open)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
351
Chain Sequence
b'NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEDWTIGVVLHRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 110
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4broA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4broA02
1HPMA 4CZJA 2IVPA 3R8EA 4IO8A 5EX5A 3RSEB 1BOTO 5AQOA 4B1YB 3ZETA 2D1KA 2QWQA 3AY9A 3A5OC 4H03B 5FPMA 4GNIA 2P9KA 3W3DA 2CGLA 5JLHA 3JS6A 4FWLA 1GLFO 3D2EB 2P9UB 2QWOA 5AZJB 3L4IA 3SMPA 4QS8A 4BR5A 1GLJO 3LDPA 3VOVA 2GWKA 4B1ZA 2QXLA 3BUZB 1ATSA 5EOYA 3LM9A 3WT0A 2Q0UA 2YJFA 3CJCA 2CGJA 1BDGA 4Y0WA 4EHUA 2W41A 1ZC6A 2FF6A 3VERA 3CJ9A 5BRFA 3HBTA 4XH4A 2P9PA 3DXKA 1BUPA 3BEXA 1GLBG 2P9NA 3H3OB 1TYQB 1QHAA 4PKIA 2QWNA 5AR0A 4H0TB 3VETA 4LC9B 4EHTA 5AQKA 3O08A 1BWFO 4WQ4A 1R59O 2NZTA 1SZ2A 3G25A 4AM7A 1H1VA 3J8AA 3MN5A 3HM8A 1Q18A 2D0PA 2P9IB 5F1XA 4BR7A 1T6DA 3CHWA 1ZBSA 2YJEA 2GTDA 5KQDA 5AZIB 5KPRA 1NWKA 5AQGA 4BG8A 3VENA 1LOTB 4WYBA 1NGDA 5AQYA 2F9TA 3H6EA 3ZX2A 3FZMA 5AQPA 2V7ZA 4K41A 5AQRA 5JMVA 5BRHA 3IDHA 5TKYA 2OANA 5FPNA 3DAWA 3VF4A 3D2FA 2IIRA 2KHOA 2GEMA 4BGBA 3QB0A 4H0XB 4BROA 3DXMA 4CZKA 4DQ8A 1DKGD 2E2QA 3ULEB 3MN6A 3VEWA 2ASMA 2CH6A 3WXIA 4JHDA 3LDLA 5EXWA 4BGAA 3H45C 2GUPA 3CJ1A 1LCUA 4FWMA 4K43A 3VF6A 3SJHA 5BPNA 5FPEA 4PKHA 3WEEB 4C23A 2E8AA 3O1WA 2FF3B 1IG8A 3MMVA 1SQKA 5FPDA 2QWRA 1C0GA 4CZIA 2YHWA 2CH5A 1JCEA 1T44A 4BRLA 1U6ZA 2UYTA 4CZFA 2QWPA 4BRKA 2PBDA 1JCGA 1HKCA 4I6MA 4O5FA 5AQXA 5BPMA 4GY2B 4IZ9A 3WXJA 3CERA 4FWSA 4H0PA 4FWKA 2Q97A 1Z6RA 1MWMA 1QQOA 1S3XA 2VYPA 3HTVA 4JD2B 1X9JA 4JN4A 3U9DA 1DEJA 1IJJA 2HOEA 3C7NA 1KAXA 3SLCA 4QS7A 3W0LA 3WXLA 4BRCA 2P9LB 3VGLA 4B9QA 1NMDA 4PKGA 4WQ5C 1GLAG 1GLCG 5LJWA 5F2RA 3UKUA 4CD3A 4BR4A 2I7PA 4CZHA 3UB5A 3LL3A 4IJNA 5ADXH 3MK6A 5AFUA 1V4SA 4BQLA 4BC5A 1ZXOA 2P9SA 3O6WA 3VESA 1QZ5A 3WQUA 5BN8A 1TUYA 4BG9A 4A2BA 3GOIA 1HJOA 1QQMA 1V4TA 1K8KB 3ZX3A 4BREA 3RSEA 2V51B 3KZBA 4HTLA 1RGIA 3UKRB 4BRDA 5AQIA 5F0XA 4IWVA 1YAGA 3HSCA 2Q2RA 2AP1A 3TPQA 5AQWA 2EWSA 3SK3A 2Q36A 3KVGA 3ZEUB 3D2EA 4MLHA 2E1YA 2ASPA 3WXKA 2P9UA 3A8YA 4XH5A 1BU6O 2I7NA 5AQTA 5AZJA 4AM6A 2E2NA 3CJBA 3GL1A 3ENHA 2YCHA 1S22A 3CETA 1U2VB 5ELZA 3HI0A 3EN9A 3A5NC 4WQ4C 2CGKA 1CZAN 5E84A 3TU5A 3VEVA 4BVPA 4MO4A 5AQFA 3FGUA 2FSKA 4BR2A 1KAYA 3IUCA 2FLOA 1TYQA 1KXPA 2GWJA 4BRAA 5KPZA 5AQVA 1NGEA 3VF2A 4BR0A 3U4LA 3F9MA 4JAXA 3O4WA 1YXQA 2ZGYA 4JNEA 3FFKB 3ID8A 3WUHA 4EAHD 1D4XA 3L0QA 3FE1A 1NGHA 3WQTA 4YDUA 2P9IA 4EFHA 4PL8A 3CQYA 3AAPA 4CD1A 5KPTA 4H0VB 4B1XB 3MN7A 3GBTA 3M3ZA 3O5BA 3D7EO 3B8AX 5B8HA 1T6CA 3BF3A 4H5RA 5AZIA 5AQLA 5JICA 1G99A 1E4GT 3QMLA 4FWOA 2HMPA 3L6QA 4M7XA 1HUXA 2Q31A 3GDQA 2H3GX 3H1QA 1NGBA 1DGKN 3QBXA 4FSVA 2DPNA 5EVZA 1NGGA 1YVNA 3EKSA 2A41A 3A5MC 4FWPA 5AQSA 1GLLO 3H1VX 4ISGA 3U8XA 4RCHA 4DB3A 4BC4A 5LY3A 1SAZA 3CJ7A 2E2OA 3EL2A 3H46O 4E1JA 4CJ7A 5AQHA 2FSNA 4EIAA 3MN9A 4NB4A 1JCFA 5AQUA 3ULEA 4A61A 2ITMA 3ZETB 2ZF5O 3SMSA 4DCHA 2QM1A 4B1UB 4MO5A 1ESVA 5AQQA 5KQ8A 2F9WA 2GELA 1E4FT 4Z94A 3JXUA 4CZLA 3WEEA 5BPLA 3FZHA 2P9KB 1NGAA 5AQMA 1GLDG 1NM1A 2BUPA 5BREA 2HF4A 3GE1A 4FPBA 5LJVA 4F9OA 1HLUA 4CI6A 3BF1A 1RFQA 4H0YB 4H5VA 3VEXA 5AQNA 4RTFD 1NGJA 1XUPO 3R6MA 1C0FA 5JLFA 1WOQA 1YUWA 4A62A 5AQJA 5EY4A 3U9ZA 3A5LC 5AQZA 1NGIA 4CZMA 2P9PB 3DXKB 3I8BA 4BRIA 2P9NB 3ATVA 4M63C 1MDUB 4ISEA 1Z05A 1Y64A 3FZFA 4ISFA 4J8FA 2E2PA 3QICA 4O8KA 2VWBA 4JD2A 1MWKA 4H5NA 1MA9B 3C0BA 2A6AA 3GG4A 3MDQA 2A3ZA 2ZWHA 3VPZA 4CZGA 4BQZA 2A5XA 2P9LA 3EKUA 1NBWA 4XH1A 3OHRA 2J4RA 2YHYA 3QBWA 3HZ6A 3FZKA 2QWMA 3CI5A 3AAQA 2YHXA 4BR9A 1NLVA 1J6ZA 1XQSC 3DWLA 3UE5A 3O1BA 2Q0RA 3IMXA 3CJAA 2VCPA 4FPAA 1P8ZA 3KHYA 2QWLA 4BRPA 3A0IX 3LDNA 4FOIA 2FXUA 1XC3A 1K8KA 3P4IA 1BA0A 2NLXA 1KAZA 3VEZA 2PAVA 3D2FB 4B1WB 3FR0A 4CBUA 2A40A 2YI1A 3DXMB 3EO3A 3I33A 4M7YA 3LDQA 1HKGA 3CIPA 3UKRA 3QFPA 4FWQA 4K42A 1GLEG 4BRQA 2D4WA 5CE3A 4JHDB 3ATUA 5BR9A 5I9EB 3IFRA 4A2AA 4RWTA 2E20A 3VGMA 2QW9A 4H5TA 1WUAA 1NGFA 2ZGZA 3ZEUA 4KBOA 2HF3A 4BRFA 2V7YA 1QZ6A 4NO7A 3S41A 3VGKA 2AA4A 1RDWX 4PL7A 5AFUH 4B1VA 3VEYA 1U2VA 1OKJA 4CBWA 3O80A 4BRGA 5ADXA 5E26A 4BC3A 4K25A 3VEOA 1BG3A 4XEIA 4FWRA 2V52B 2E88A 4H5WA 2Q1NA 3DJCA 3MCPA 4I6MB 1X3NA 3LDOA 2WUSA 2E1ZA 5BRDA 1ATNA 3AARA 4YDUC 1BO5O 2W40A 4BRHA 3FLCO 4CZEA 4FWNA 1ATRA 4HWIA 4CBXA 1HX1A 1HKBA 4FO0A 4IXCA 1QQNA 2ASOA 2NRHA 3BP8A 4L3QA 3FZLA 2BTFA 4QS9A 4BC2A 2D0OA 3M6GA 3H3NO 2A42A 3C7NB 3LM2A 3QFUA 3CQXA 3M1FA 4BRMA 3UKUB 3ZX0A 3ENOA 3O8MA 1BA1A 1TUUA 2FSJA 3R9PA 4FOEA 2IVOA 4MLEA 5BN9A 2P9SB 4BRNA 2IVNA 3EZWA 4FL9A 4H0OA 4BVOA 4WQ5A 4DHYA 4IJAA 3QDKA 1EQYA 1X3MA 1NGCA
chains in the Genus database with same CATH superfamily
3ZSOA 2HHWA 1HNZK 3R8EA 1YITN 1R0AA 4HUEA 1C1CA 4C1NI 4YHHK 3NGZA 1ASVA 4Q0BA 3CCJN 4CFDA 2HMIA 3OJUA 2QWQA 3VQDA 4DV3K 4FJGA 5FPMA 3VQ9A 2F4VK 3V9ZA 1VSKA 4DQQA 3THYA 1QSSA 2IGIA 3EE9A 4N76A 1VK0A 5EU7A 4FLVA 1EWRA 5AZJB 1HNIA 4CJLA 2OTJN 1GLJO 3K5MA 1ATSA 1KLMA 4Z4EA 3LAMA 3TTFA 5HRPA 4DFMA 1JXBA 4Y0WA 4H8KA 3M8SA 3VERA 4XH4A 2P9PA 4FM2A 3R3LA 1BUPA 1GLBG 1TGOA 2P9NA 2ZJPL 2E6LA 4K0KK 4EHTA 2HHXA 1D9FA 1VSHA 4W5QA 4O44A 4AILC 4DTUA 4AM7A 2DFEA 2D0PA 1NK5A 1KVCA 1C6VA 3R1XA 4EZ9A 4Z4GA 2Z1IA 1ZBSA 4JS5A 1N36K 5KQDA 1EXQA 4NYNA 1VQKN 3CC4N 1LOTB 4DTMA 3TAPA 1NGDA 1Q82O 4J2DA 3I8DA 4CHYA 4IFVA 1VQ8N 3MXJA 4KO0A 1YVUA 1J5EK 2D0AA 4YNQA 1VSMA 2Q3SA 3RR8A 4FM0A 1WBBA 3CCRN 1NK4A 1NOYA 3ULEB 2ASMA 4ICLA 4RW4A 5C42A 2GUPA 4ZTFA 3NVKA 4IOAL 4K43A 1S6PA 5E41A 5FPEA 3WEEB 3MECA 3O1WA 2YNFA 2FF3B 4IG3A 1WAJA 5GAHP 3THWA 5FPDA 3HXMA 3DLRA 3QNOA 1JKHA 4CZIA 3PY8A 5FDLA 2YHWA 4C8LA 1JCEA 4DLGA 2RPIA 4KAZA 4O55A 4I7FA 1OH6A 3G10A 3HL8A 3K59A 2NRXA 1QVFM 4DV7K 4GY2B 2QXFA 2YHAA 3E66A 3WXJA 1JXEA 2BGGA 4JI4K 3U3GA 4DV4K 4DTPA 1UAXA 2BE2A 4FWKA 2Q97A 3AO1A 4DSJA 2DTUA 2WFBA 4AHRA 1MWMA 2I5JA 2VYPA 3BDPA 1QQCA 4YORA 4DLEA 3U9DA 3K9KA 4WFBL 3C7NA 1BHLA 2QA4N 4BDZA 3IG1A 4CCHA 1JLAA 3DLBA 1NMDA 2KFNA 4WQ5C 2ZJRL 3L2VA 2ZJQL 4AF1A 3S3OA 3P31A 2RKIA 2I7PA 3LL3A 4JKGB 1NJYA 3MK6A 2HHUA 2HNDA 3O9UA 3PX6A 2P9SA 3O6WA 3SYZA 4Q5VA 1VQMN 5C2DA 4DSIA 3MCAB 3J81O 4DG1A 3LAKA 4FLXA 1V4TA 1SS6A 4RW7A 1K8KB 2V51B 2NRRA 1Y97A 3LPUA 4JK9A 3V9XA 1SL0A 4CIEA 4AHVA 3OYEA 3EZ5A 3UIQA 4I9QA 4IFYA 3Q7CA 5C25A 3CMEN 4QAGA 3VQ4A 2Q2RA 4O4GA 3QNNA 2HHSA 1Q8IA 1NG9A 3D2EA 4FLYA 4DTNA 2E1YA 2OZSA 3RMCA 3CJBA 2RHKA 3GL1A 1W2BM 1S22A 4UQGA 3OJSA 3CM6A 4WF9L 3AO4A 1EX4A 4HCBA 3VQ5A 4FJIA 2CGKA 1CZAN 5E84A 1Q9XA 3VEVA 5HROA 4MO4A 3VA3A 1S9GA 3AVKA 2YNGA 2FSKA 3HRGA 3IUCA 2FLOA 4GV6A 1KXPA 4BRAA 4N47A 5AQVA 4BR0A 4YOUA 5M1NA 3U4LA 1WN7A 4JAXA 3O4WA 2ZGYA 4JNEA 4KHPK 3ID8A 4EAHD 4GKKK 3FE1A 4B8CA 3PX0A 1VSIA 3V1RA 4DSFA 2NUBA 1HQEA 3MN7A 3V9UA 2XY6A 1TKTA 4CVNE 1VQ5N 3BF3A 4H5RA 1NMNA 5JICA 1G99A 3QMLA 4FWOA 4B3RK 1DTTA 1LAVA 4DU1A 2A1SA 1X9SA 2OZMA 4M3TA 1NGBA 1DGKN 3K57A 3NBPA 1OH5A 3H1VX 3AVBA 4WCEL 1NOZA 4DB3A 5LY3A 2D0CA 4NXMK 4FJHA 2E2OA 5H1SQ 4CJ7A 5AQHA 3LWLA 2O8BA 2FSNA 4EIAA 3K58A 3V6DA 3SPZA 2ITMA 3NGIA 3CFPA 3SMSA 4KHNA 2QM1A 2KTQA 3AGRA 5KQ8A 3THYB 1NGAA 3F5TA 1I3AA 1A5WA 4BDPA 4CFBA 1KQSM 4KH6A 4F9OA 3C65A 2D0BA 1RFQA 3AVAA 4JEPA 5AQNA 3WNFA 5DK5A 2DFHA 5JLFA 1YUWA 3O3GA 3QEPA 3SUOA 4A5BA 3OYHA 4CZMA 2P9PB 3I8BA 2P9NB 4M63C 4ISFA 1SKRA 5J2NA 3JYTA 4JKBA 4O8KA 2VWBA 4M3XA 5J2QA 1MWKA 2Z1JA 3ISNC 3CYMA 3MDQA 5HLFA 3MAQA 1RBVA 3VQPA 2ZWHA 3VPZA 3DRSA 3ENBA 3EKUA 4XH1A 4CJVA 3TAEA 2XY8A 1L3TA 4AQYK 3AAQA 4BR9A 4E89A 3UE5A 2YNHA 1GOBA 3CG7A 2Q0RA 4FPAA 3A0IX 3P4IA 4OPKA 4FM1A 1WBDA 2VQFK 4B1WB 2YI1A 1HNWK 4KHSA 2O8FA 3CIPA 3ZYYX 3CF5L 3U3YA 4CJTA 3QFPA 4CFCA 4BRQA 3SCXA 1G15A 4LF9K 3D45A 3ATUA 4DV0K 3TI0A 1BL3A 1WUAA 1QE1A 4CHQA 4KBOA 2QKBA 4NO7A 1QZ6A 3VTIA 1HJRA 3S41A 3THWB 1RDCA 4PL7A 1BCMA 4M42A 1NK6A 4CBWA 5C0YA 5K14A 3P83D 1C0UA 4BC3A 2FBXA 3VEOA 4XEIA 4LD0A 4FWRA 2V52B 1RDBA 2QK9A 5SZTA 2XY7A 3KK3A 3MCPA 2WUSA 4FZXC 3FLCO 3NFAA 4C8OA 3HPGA 4RG8A 4HWIA 4FO0A 3AVLA 2ASOA 1B92A 4L3QA 2BTFA 2D0OA 4IEIA 3HP6A 3LWMA 4HHTA 3C7NB 3EE8A 2R7YA 3OTOK 4CE9A 1HR0K 4CGHA 3PV8A 4BRMA 3ZX0A 3WNHA 4XIUA 1OVQA 1TUUA 3HPHA 2IVOA 3PLAA 1KVAA 4N41A 2P9SB 2IVNA 4LF6K 3EZWA 1IKWA 4H0OA 4DHYA 4LF8K 1EQYA 1NK8A 4FCYA 1NNEA 3VTHA 4CESA 1N33K 1HPMA 2KLAA 2RE2A 1BOTO 4B1YB 3N4QA 3E01A 2W6LA 4JI6K 3A5OC 3I0RA 3IAYA 4JI7K 1W9HA 3QEIA 4KHUA 2P9KA 2WONA 4CW7B 4BWJA 4JI8K 2CGLA 4KHWA 3T69A 3D2EB 3U6FA 1S1UA 2QWOA 4M3ZA 4B8AB 2G8WA 1QSYA 4BR5A 3VOVA 4B1ZA 2GWKA 4JV5K 2QXLA 3BUZB 3DLGA 5FLXO 2YJFA 3DMJA 2FBYA 4EHUA 4DS5A 3T19A 2FF6A 3HJFA 3D0PA 5BRFA 3HBTA 1F21A 3H3OB 4PKIA 5AR0A 4E7HA 4LC9B 3OYKA 5AQKA 3O08A 3DLHA 3O9QA 4WQ4A 1IV0A 4DV1K 1R59O 3VQ7A 4DU3A 1TK5A 2UXCK 4CEZA 3AVNA 2Z1HA 3IS9A 3SUNA 4CJ4A 1FKOA 4M41A 5F1XA 1T6DA 1KFDA 1TAUA 3AVGA 4DR1K 4CF8A 2YJEA 3DLKA 4CJRA 2RF2A 1NWKA 1EP4A 4JRQA 4FW2A 2F9TA 3H6EA 1RCHA 5AQPA 2V7ZA 3L2QA 4FJLA 3HYFA 4OJRA 5BRHA 4M45A 3ASMA 5FPNA 3LP0A 3VF4A 3D2FA 1T3VA 3T1AA 4DQ8A 2O8BB 3MEDA 1DKGD 2W42A 2BDPA 5IT9O 2HVHA 2WTUA 4E7IA 4O5BA 4JHDA 3LDLA 1FK9A 1FW6A 5FROA 3RMBA 3H45C 4DTJA 4FWMA 1EKEA 4BE2A 4CJKA 3TARA 2ZQBA 4DUZK 1SUQA 3WNEA 1I39A 1IG8A 5GIOA 1SQKA 5KRTA 4NYFA 5AJ3K 4JS4A 3K0SA 4OGEA 2F8TA 1S1TA 3PSIA 3I0SA 4AHSA 3M8RA 1CZBA 1QVGM 4JKCA 1JJ2M 4I6MA 4FK0A 3P39A 4GV9A 3CERA 3MEEA 4FWSA 4FJJA 3ZT3A 4J2BA 3C6HA 3VA0A 2HB5A 5KRSA 4DMNA 1KRPA 4N56A 4AH9A 3ZSRA 5HRSA 3VQ6A 2EHGA 4KH4A 4CK1A 1Q9YA 3NH0A 3W0LA 4BRCA 1VQON 4DUYK 2RN2A 3OBWA 3VGLA 3ZSZA 4CK3A 4PKGA 5J2MA 5LJWA 1JLCA 3DOKA 5C2FA 3UKUA 2IS3A 4CZHA 2IAJA 4BE1A 4X66K 4FK4A 4KH5A 1V4SA 3J7YP 1N6QA 3VESA 2YKNA 3ID6A 1K6YA 4DF4A 3GOIA 1HJOA 5KGWA 3ZX3A 1C1AA 2HW3A 4BREA 3RSEA 3G71N 4CECA 2O8FB 3L4QA 3K5LA 4BRDA 3ZT4A 3KIOA 5AQIA 5F0XA 4IWVA 3TWHA 1YAGA 2LSNA 2VG5A 4YOVA 2AP1A 3V9SA 1D8YA 3TPQA 3SBGA 3HM9A 2EWSA 4EZ6A 3KVGA 4MLHA 1LWFA 2P9UA 3O3HA 1WSEA 4XH5A 1ZBHA 4FJ7A 3CETA 4K8ZA 4RW6A 3ITHA 3EN9A 4FLZA 5CR4A 3V81A 3VN5A 2GUIA 4C8KA 4CJQA 4BVPA 5AQFA 4Y1DA 1WAFA 3FGUA 3ULDA 5CHIA 5C10A 3SAFA 4FW1A 1TYQA 3AA4A 4CF9A 3OYCA 3WQTA 4KPYA 3CQYA 3AAPA 1SKWA 3GBTA 3M3ZA 4JLHA 5FRNA 1DT9A 4JI0K 1T6CA 5AZIA 5AQLA 3AV9A 1E4GT 3EYZA 3Q7BA 4Z4HA 2Q31A 4NCAA 3H1QA 4HUFA 3J80O 3ZSXA 1YVNA 4KTZA 3EKSA 4RCHA 4BC4A 5HRRA 1ZBFA 1SAZA 2G8HA 4NB4A 3LZJA 1JCFA 1N34K 5AQUA 2UXDK 2KZMA 4DCHA 1ESVA 3NF8A 5J2PA 5BPLA 2P9KB 4LSNA 3SNNA 4LY7A 4B9MA 4DTSA 5HL7L 2HF4A 4FJ8A 1HLUA 5GINA 3RMAA 3HVTA 4CJ5A 4H0YB 3QETA 3O9SA 4LSLA 1TKDA 3HPOA 5HRNA 1HNXK 4JI1K 4RTFD 3DRPA 4GVEA 3OYGA 4KB1A 1NGJA 1TVRA 1XUPO 4A62A 1HYSA 2KFZA 3U9ZA 5AQZA 4YOTA 4F3OA 3THVA 4NCBA 5HBMA 4Z4IA 2OCEA 4BRIA 3ATVA 1X9MA 3NMUA 3FZFA 4YY3K 1VRUA 2NNWA 3VQ8A 3AA3A 3CXCM 3EEQA 1RBTA 4H5NA 3C0BA 2XRIA 3ZSYA 2X6SA 4KTQA 5DMRA 1YTAA 3F73A 4CZGA 3TAQA 2P9LA 4KI6A 1JLEA 2GBZA 4FVUA 3OHRA 3K2PA 3O3FA 4CFAA 1KVBA 2QWMA 3CI5A 2YHXA 1NLVA 1BGXT 1RDDA 4CJEA 3O1BA 4DQIA 3ZSQA 3IMXA 4CHPA 4DR5K 2O8DA 2ZM6K 5KGXA 1P8ZA 1HPZA 3V4IA 4FOIA 2ETJA 1CXUA 4BDYA 1YHQN 3CFRA 1IKVA 1S9EA 2PAVA 1VAZA 3TSQA 4BACA 3D2FB 4M7YA 3QIOA 1J54A 3E9OA 3UKRA 2WBNA 4FWQA 4FZZA 2D4WA 4DS4A 4JHDB 3TANA 3PX4A 1S1XA 3IFRA 2XO7A 4PUOA 1NKEA 3PIPL 4H5TA 2AJQA 4BRFA 2UUCK 2HF3A 2V7YA 3VGKA 1ZBLA 1U4BA 1RDWX 1IG9A 4CIFA 4NLCA 1NK9A 1OKJA 5LMUK 1BQNA 3AA5X 4B3OA 3RVCA 4QOZB 4DQPA 4DV5K 4LFAK 1SL1A 2FC0A 2E88A 4DTOA 1W7AA 3N4PA 1YJNN 3KLHA 3O9RA 4DFJA 4I6MB 1X3NA 3CM5A 1TKXA 3LDOA 2HBJA 2XY5A 4FJKA 3AARA 1JLQA 4CF2A 1BO5O 2W40A 1L3VA 4CBXA 5CZ1A 1HKBA 4LH5A 1QQNA 3KK2A 3OS1A 2A1RA 1RTHA 4HCCA 3BP8A 1S72N 2DFFA 1NKCA 3FZLA 3RWUA 3K5OA 3NGYA 1YJ9N 3QFUA 1BISA 3UKUB 4DFKA 3KK7A 3R9PA 5CYMA 3AO2A 4GV3A 3KWIA 5SWMA 1RBSA 3P1GA 1RT4A 3WXMB 4DV2K 3L8BA 1LWCA 4G1QA 4CK2A 1NGCA 1ASWA 4CZJA 4RW8A 4CEEA 2IVPA 3RSEB 3NF7A 5AQOA 1NK0A 4QCLA 3AO5A 3RRHA 4HTUA 1XWLA 2HNYA 4ELVA 3PO5A 4ILJA 3AY9A 4CGJA 4KB0A 4H03B 4GNIA 3KTQA 3K5NA 2BH1A 2QKKA 3AVFA 4LF5K 2P9UB 3SMPA 1N32K 4QS8A 3DLLL 5EOYA 3WT0A 1RT6A 4FLWA 4H4OA 3AVMA 3C6AA 1KD1O 4NXNK 3KLFA 3NAEA 4U67L 3CJ9A 2F96A 2F8SA 3BEXA 1TYQB 3VETA 4H0TB 1T8EA 2X6NA 1BWFO 4C8NA 2NZTA 5M1KA 4H4MA 3NDKA 3J8AA 3MN5A 3HM8A 1Q18A 3NF6A 3QIPA 4CEBA 1UOCA 2HHVA 3JSMA 3OYFA 2G8FA 4GMJB 4IOXA 2HBKA 5GADP 2GTDA 5AZIB 3M8PA 5AQGA 4CERA 4A5AA 2Z1GA 4WYBA 4IBNA 3CMAN 1DTQA 1TL1A 4RW9A 5C24A 3ZX2A 4FK2A 1LW2A 3FZMA 4YOWA 1LV5A 4DTXA 1SL2A 5AQRA 5JMVA 4PA1A 1RILA 5I42A 3TAMA 1UA0A 3BY5A 3IDHA 5TKYA 4IG0A 1XI1A 4BGBA 3DAWA 2IIRA 4B9VA 4BROA 1BI4A 3QB0A 4H0XB 4A57A 3S9HA 3PSFA 1M1KO 4JYAK 4DSKA 1BIUA 2PYLA 2O8CA 1RDAA 3MN6A 3VEWA 2CH6A 1RT5A 3THXA 4BGAA 1QHTA 3CPEA 1L5UA 3VF6A 2GV9A 3SJHA 3S3MA 2B5JA 4PKHA 4FJXA 5KI6A 2E8AA 4CGFA 1P90A 1IO2A 3LALA 2QWRA 1ILYA 1C0GA 2G8VA 3CCLN 3A2FA 3O4QA 2QTDA 1T44A 4BRLA 4NCGA 2UYTA 2P51A 2OTLN 2QWPA 2G8KA 1JCGA 1HKCA 2YNIA 3IKMA 4O5FA 3DYAA 5BPMA 3QEVA 4IZ9A 3KD1E 3V1OA 4YOXA 1OH7A 4F2RA 1XMQK 3NF9A 4E19A 4DF8A 4W5NA 3CCMN 3HP9A 3P5JA 4IFEA 4WFAL 3HTVA 2UXBK 1X9JA 3MXMA 1DEJA 3BZCA 1HRHA 2HBLA 1IJJA 2HOEA 3SLCA 4QS7A 4PQUA 2P9LB 3PIOL 2JGUA 3LP3A 4KKOA 1GLCG 3QINA 4E1NA 3QEWA 3NHGA 4CD3A 4B3TK 3UB5A 4IJNA 2NRTA 3L2WA 2ATQA 3QERA 4BC5A 2B6AA 3SAGA 1ZXOA 2O8DB 1U47A 1QZ5A 3WQUA 1S5JA 4JK7A 4A2BA 1QQMA 4DSLA 2O8EA 1S1WA 4FZYA 3CCVN 3O9TA 3RMDA 1U48A 3KZBA 1RGIA 2NRVA 3UKRB 3SQ0A 4CJ3A 2HHQA 1DLOA 1VSLA 3J7ZO 5JS2A 3DI6A 5AQWA 3SK3A 1ZBUA 2ASPA 3WXKA 3A8YA 5AQTA 1RTDA 2E2NA 5ELZA 3HI0A 2JWLA 3A5NC 1XNQK 3QESA 4WQ4C 3TU5A 4V19S 4JKDA 2P1JA 3TTDA 1WB9A 4BR2A 1E3MA 1JL2A 1NGEA 3VF2A 3F9MA 3FFKB 1L3SA 3ALYA 1NGHA 4KI4A 4YDUA 2P9IA 4EFHA 1EO1A 1WSGA 5KPTA 4CD1A 4H0VB 1NU0A 4B1XB 4O0JA 1C0MA 1RDUA 3O5BA 4CGIA 3V9WA 1NJIO 3D7EO 2HVIA 5M1FA 3B8AX 3DOLA 3CCUN 4F4KA 4E7KA 1LW0A 3V1QA 2DY4A 3L2UA 3L6QA 1HUXA 2D5RA 3OY9A 1VQ6N 4FSVA 2DPNA 1NGGA 3KLGA 4HVJA 4O0IA 3NCIA 2A41A 4FWPA 4ISGA 3KK1A 4KREA 3KD5E 1XNRK 1QSLA 5JS1A 5GAEP 3P38A 3ZLJA 4B1UB 1M90O 2GELA 4FXDA 1YF5L 4Z94A 3JXUA 2VWKA 1YT3A 5CY4A 1NM1A 2BUPA 3CCQN 2PFUA 5BREA 3CC7N 1ASUA 1TKZA 4CEAA 4OKEA 1YJWN 4OLBA 4K8XA 5GIPA 2IDOA 4DR4K 1OH8A 4JI3K 3AO3A 5M1QA 3G4SN 1WOQA 3KKSA 5AQJA 3QLHA 1NGIA 3AVIA 2B4JA 3AA2A 1N8RO 3OYNA 2IC3A 4ISEA 1UWBA 4J8FA 2O4GA 1VRTA 3CPWM 1WNSA 4EP4A 4JD2A 4LF4K 4F3TA 1MA9B 3GG4A 2A6AA 2A3ZA 4ZHRA 1JLFA 3HK2A 4BQZA 2IOCA 2A5XA 3OS2A 1VQLN 1NBWA 3B6OA 2ZE2A 2VGMA 2VGNA 1JL1A 4I2PA 3BGRA 5M1PA 3KKRA 1ZBIA 3FZKA 5BR8K 3MX5A 1VSDA 4FLTA 2UUAK 3DWLA 4ELTA 4IEEA 3CJAA 3HSTB 3MXIA 2QWLA 4BRPA 3HVRA 4IOCL 1WSHA 3KLIA 3NE6A 1KAZA 3LDSA 5A2QO 1KFSA 4CJWA 1BI4B 1O1WA 3FR0A 4CBUA 2A40A 3I33A 3TSUA 2XHBA 2O8CB 1GLEG 4CIGA 3T1HK 5CE3A 2KKZA 3THXB 4LFCK 1KSPA 2W6KA 4M3RA 5I9EB 2E20A 3VGMA 2QW9A 1NGFA 3ZEUA 4FJ5A 4JKAA 2AA4A 4EP5A 3SZ2A 2YKMA 5AFUH 3ZT1A 4DQSA 3G0ZA 4CJUA 5FRMA 3VEYA 2FBVA 1U2VA 3K9JA 4OGCA 4BRGA 5T7BA 3DM2A 5E26A 1BG3A 2FBTA 4DQRA 3RR7A 4H5WA 2Q1NA 3WNGA 4G9ZA 4OPHA 4BWMA 4PWDA 2HHTA 1KTQA 2E1ZA 4JK8A 3M5RA 4LFBK 1C1BA 4BRHA 4CZEA 4FWNA 1KLNA 1CXQA 4FLUA 3SQ2A 1IBKK 4IXCA 5JVGL 1U04A 3NVMA 4BC2A 5M1OA 4QS9A 3M6GA 2A42A 2X74A 3LM2A 1Q7YO 4ID1A 4Z0UA 4J2AA 5HOOA 3M1FA 3OYIA 3TTCA 3D6RA 4DWIA 3O8MA 1IBMK 1BA1A 1Q81O 2YHBA 5BN9A 1ZYQA 4DSEA 4WQ5A 3SBTA 3QO9A 4NLBA 1T03A 2X78A 2O8EB 1RBRA 4IO8A 5EX5A 4R79A 4MDAA 4CJSA 1Z25A 3C6UA 1YTUA 3ZETA 2D1KA 3TABA 3CC2N 5I3UA 4KFBA 3FFIA 4DFPA 1Z26A 3OYBA 4I9LA 4CEDA 4GKJK 2VG7A 4M3UA 3ZCMA 1T7PA 3W3DA 4YOYA 5JLHA 4IDKA 3JS6A 4FWLA 1GLFO 1IH7A 3LP2A 4MDBA 3L4IA 2O4IA 3LDPA 1B9FA 3LM9A 2Q0UA 2VG6A 3CJCA 2CGJA 4JKFA 1RT1A 1BDGA 4CF1A 3L2RA 2JWKA 3LP1A 2W41A 1TK8A 1ZC6A 1QTMA 4WFNL 1HYZA 1REVA 3DXKA 2KZZA 1EWQA 3G6EN 1HQUA 1QHAA 1ITGA 2QWNA 4IO9L 4F2SA 4CEOA 3E1YA 3OYJA 1SZ2A 3G25A 1H1VA 3HOTA 4UY8O 4Z4CA 3CQ8A 4OVLA 2P9IB 4C8MA 2OA8A 4CJFA 4BR7A 3CHWA 3SQ1A 3OS0A 4OPAA 4KTWA 5KPRA 2E5LK 1WLJA 4BG8A 3VENA 4OKKA 1Q86O 3OW2M 1SV5A 1WSJA 1X1PA 5AQYA 3MEGA 4K41A 1TL3A 3SPYA 3OBYA 1JLGA 2PZSA 1IKYA 1D9DA 4LF7K 4A59A 4W5TA 2KW4A 2OANA 5JVHL 2KHOA 2GEMA 4B3MK 4CZKA 3DXMA 2E2QA 2HSTA 4CHZA 4ID5A 1NJWA 3WXIA 5EXWA 3ZSVA 4MFBA 4AHCA 3AVJA 3CJ1A 1LCUA 4FJ9A 5BPNA 1RNHA 3RTVA 5TKWA 4C23A 4KHQA 3MMVA 4ILGB 1O13A 1RT2A 3AGKA 4GW6A 1XHXA 2CH5A 1UA1A 2OPQA 5C15A 2P5OA 5KTQA 1U6ZA 3SJJA 4CZFA 3T3FA 3ZT0A 3C95A 1TAQA 2PBDA 4BRKA 5AQXA 2E6MA 1JLBA 3PUFA 4H0PA 2YX6A 2WOMA 3B6PA 3PO4A 1FKPA 2UUBK 4DU4A 1Z6RA 4E7JA 1QQOA 1XHZA 3T7ZA 1S3XA 2E4LA 4JN4A 4JD2B 4J2EA 4CGGA 2KQ2A 2JLEA 2WC9A 3C94A 4BY9C 3L3VA 5CYQA 5D3GA 2VWJA 3TR8A 1KAXA 2HBMA 3WXLA 2OPSA 3NH1A 4B9QA 3TAFA 3BZKA 1GLAG 5F2RA 4GVMA 4BR4A 4B9TA 3TAGA 4B9LA 4WE1A 5ADXH 5IWAK 4X64K 5AFUA 4BQLA 4N5SA 1RTJA 1A5VA 2QI2A 3MWTA 4FVMA 3I55N 4CEQA 5BN8A 1TUYA 4BG9A 3SV4A 4C1NK 1B9DA 4B3SK 3HO1A 1NJZA 1IBLK 3OYAA 4OO1J 3OYLA 4B9SA 2EX3A 4HTLA 1S6QA 5CZ2A 2VQEK 1VSEA 1VHXA 4DTRA 4B08A 1TK0A 3HSCA 3J7AP 2PYJA 4R5PA 2Q36A 1GOCA 3S3NA 3ZEUB 5GAGP 5AZJA 1BU6O 2I7NA 4FJMA 4AM6A 3KWGA 1L3UA 3KLEA 3SUPA 3ENHA 2YCHA 5LL6Z 1J53A 4JI2K 1U2VB 4B9NA 2G8IA 4MQ3A 4IDHA 2HHHK 1QS4A 3OYDA 3RRGA 1IKXA 1RTIA 1KAYA 2ITGA 2GWJA 3OVNA 5KPZA 1U49A 5HP1A 1BCOA 1OVYA 3MX2A 1YXQA 4OPJA 1XC9A 3WUHA 1RT3A 1D4XA 3L0QA 1LAWA 4PL8A 3TSPA 2BANA 1FJGK 1W0HA 4BE0A 1CZ9A 5B8HA 1U45A 4E7LA 1VSJA 2OYQA 1NK7A 4O8UA 3SAHA 1YI2N 2HMPA 2Y1JA 2NRZA 3LZIA 3O4NA 4M7XA 3GDQA 3M8QA 2H3GX 2PY5A 1VSFA 1T05A 3QBXA 1VQ4N 5EVZA 1HNVA 4DR2K 4AHUA 5AQSA 3A5MC 1GLLO 3U8XA 4KRFA 1VQ7N 1YIJN 3CJ7A 3EL2A 3H46O 4E1JA 4DR7K 5J1EA 3MN9A 4JKHA 4FJNA 1X9WA 3ULEA 4A61A 3ZETB 2ZF5O 1WSFA 1A5XA 4CGDA 4MO5A 5AQQA 4OLAA 2F9WA 1E4FT 2OPRA 4CZLA 3WEEA 4L8RB 3FZHA 5AQMA 4X62K 4M3YA 1GLDG 3ZT2A 4U7BA 3GE1A 4W5RA 4FPBA 3NH2A 1N5YA 1VQPN 5LJVA 4CI6A 3BF1A 4H5VA 4ELUA 3VEXA 1D5AA 2Y1IA 3VMFB 1NJXA 4I2QA 1CLQA 3R6MA 1C0FA 5EY4A 3CFOA 3A5LC 3CCEN 4ILHA 3CCSN 3H08A 3VQAA 1S1VA 4DKWA 1NKBA 3DXKB 1RT7A 1MDUB 2OPPA 3QEXA 3VQCA 1Z05A 1Y64A 1VQ9N 4CHOA 2E2PA 3QICA 5DM7L 4B9UA 4E1MA 1VQNN 3VQBA 5DM6L 3F2KA 2NRWA 2HNZA 2UU9K 3DLEA 2J4RA 3KJVA 1J5OA 2YHYA 4PY5A 3QBWA 3HZ6A 3F9KA 4JKGA 4PHTX 3LPTA 1J6ZA 1XQSC 1EETA 1BIZA 4JKEA 2VCPA 2YV0X 3KHYA 1MU2A 4AHTA 3EY1A 3LDNA 2FXUA 4YFUA 1XC3A 1K8KA 1BA0A 2NLXA 3VEZA 3MWPA 4OKJA 3DXMB 3EO3A 4HUGA 1K73O 3LDQA 1HKGA 5LMNK 4M3WA 4K42A 1K9MO 1J9AA 1GOAA 3CD6N 1SKSA 1HMVA 3DRRA 3JAMO 2P5GA 5BR9A 4X65K 3C6TA 4A2AA 3SUQA 4RWTA 3OA9A 3IRXA 2ZGZA 1HYVA 3HT3A 3VQEA 4F8RA 4TSXA 2F7TA 2GX9A 1RBUA 2ZD1A 4B1VA 3O80A 5ADXA 3SQ4A 4K25A 1LWEA 1TV6A 4CF0A 3AVCA 3VQQA 3ZSWA 4JRPA 4CEFA 3T1YK 1K8AO 3DJCA 4CJPA 2QEXN 4Y1CA 4DV6K 5BRDA 1ATNA 2G8UA 4YDUC 3SV3A 5C12A 4DR6K 3E9PA 4E0DA 4IKFA 1ATRA 1KC8O 1HX1A 4JI5K 3E9LA 2NRHA 1XMOK 1WSIA 3H3NO 4W5OA 4E3SA 4Z4FA 3CQXA 4CHNA 3HOSA 3I56N 3OYMA 3SI6A 4KHYA 4ZTJA 1FXXA 3ENOA 1I94K 2FSJA 3L3UA 4FYDA 4KV8A 4LH4A 1C0TA 4FOEA 4MLEA 5MLCQ 4DR3K 4OX9K 3AVHA 3LANA 4BRNA 1BQMA 4FL9A 4BVOA 4IJAA 3QDKA 1KCFA 1X3MA 1W97L
chains in the Genus database with same CATH topology
3VTHA 1HPMA 4CZJA 2IVPA 3R8EA 2KLAA 1YITN 4IO8A 5EX5A 2RE2A 1BOTO 3RSEB 4C1NI 5AQOA 4R79A 4MDAA 4B1YB 3N4QA 3ZETA 2D1KA 3CC2N 3CCJN 4ILJA 2QWQA 3AY9A 3A5OC 4H03B 5FPMA 4GNIA 2P9KA 3EE9A 3W3DA 4YOYA 2BH1A 2CGLA 5JLHA 3JS6A 4FWLA 3T69A 1GLFO 3D2EB 2P9UB 2QWOA 4MDBA 5AZJB 3L4IA 3SMPA 4QS8A 2OTJN 4BR5A 1GLJO 3LDPA 3VOVA 2GWKA 4B1ZA 2QXLA 3BUZB 1ATSA 3DLLL 5EOYA 3LM9A 3WT0A 2Q0UA 2YJFA 3CJCA 2CGJA 4JKFA 1BDGA 3TTFA 2JWKA 4Y0WA 4EHUA 2W41A 1ZC6A 3C6AA 1KD1O 2FF6A 3VERA 4U67L 3CJ9A 4WFNL 5BRFA 3HBTA 4XH4A 2P9PA 3DXKA 3R3LA 1BUPA 3BEXA 1GLBG 2P9NA 3H3OB 1TYQB 3G6EN 2ZJPL 1QHAA 4PKIA 2QWNA 5AR0A 4H0TB 3VETA 4LC9B 4EHTA 5AQKA 3O08A 4IO9L 3O9QA 1BWFO 4WQ4A 1R59O 3E1YA 2NZTA 1SZ2A 3G25A 4AM7A 5M1KA 1H1VA 3HOTA 3J8AA 3MN5A 3HM8A 4UY8O 1Q18A 2D0PA 2P9IB 3R1XA 5F1XA 4BR7A 1T6DA 3CHWA 4IOXA 2HBKA 5GADP 1ZBSA 4OPAA 2YJEA 2GTDA 5KQDA 5AZIB 5KPRA 1NWKA 5AQGA 4BG8A 3VENA 4A5AA 1VQKN 3CC4N 1LOTB 4WYBA 1Q86O 1NGDA 3OW2M 1Q82O 3CMAN 5AQYA 2F9TA 3H6EA 3ZX2A 3FZMA 5AQPA 2V7ZA 4K41A 4YOWA 3OBYA 5AQRA 5JMVA 1VQ8N 5BRHA 4A59A 3IDHA 5TKYA 2OANA 5FPNA 3DAWA 3VF4A 2IIRA 1T3VA 2GEMA 2KHOA 3D2FA 3QB0A 4H0XB 4BROA 3DXMA 4CZKA 4DQ8A 1DKGD 2E2QA 2HSTA 4A57A 3CCRN 1M1KO 3ULEB 3MN6A 3VEWA 2ASMA 2CH6A 3WXIA 4JHDA 3LDLA 5EXWA 4BGAA 3H45C 2GUPA 3CJ1A 1LCUA 3CPEA 4FWMA 3NVKA 4IOAL 4K43A 3VF6A 3SJHA 5BPNA 5TKWA 5FPEA 4PKHA 3WEEB 4C23A 2E8AA 3O1WA 2FF3B 1IG8A 3MMVA 1P90A 4ILGB 5GIOA 5GAHP 1SQKA 5FPDA 2QWRA 1ILYA 1C0GA 1O13A 3AGKA 3CCLN 4CZIA 2YHWA 2CH5A 1JCEA 2QTDA 5C15A 1T44A 4BRLA 1U6ZA 2UYTA 4CZFA 2OTLN 2QWPA 1QVGM 4JKCA 2PBDA 4BRKA 1JJ2M 1JCGA 1HKCA 2NRXA 3IKMA 4I6MA 4O5FA 5AQXA 5BPMA 3P39A 1QVFM 4GY2B 4IZ9A 3WXJA 4GV9A 3E66A 3CERA 4FWSA 4H0PA 2YX6A 4YOXA 3C6HA 4FWKA 2Q97A 3CCMN 1Z6RA 2WFBA 1MWMA 1QQOA 3T7ZA 4IFEA 4WFAL 1S3XA 2VYPA 3HTVA 4JD2B 1X9JA 4JN4A 4YORA 2WC9A 4BY9C 3U9DA 1DEJA 3K9KA 4WFBL 2HBLA 4KH4A 1IJJA 2HOEA 3C7NA 1KAXA 3SLCA 4QS7A 2HBMA 2QA4N 3W0LA 3WXLA 4BRCA 2P9LB 3PIOL 1VQON 3OBWA 3VGLA 4B9QA 1NMDA 4PKGA 4WQ5C 2ZJRL 1GLAG 1GLCG 5LJWA 5F2RA 5C2FA 4AF1A 3UKUA 2ZJQL 3P31A 4BR4A 2I7PA 4CD3A 4CZHA 3UB5A 3LL3A 4IJNA 4JKGB 5ADXH 2NRTA 3MK6A 4KH5A 5AFUA 1V4SA 3O9UA 4BQLA 4BC5A 3SAGA 1ZXOA 2P9SA 2QI2A 3MWTA 3O6WA 3VESA 3I55N 1QZ5A 3ID6A 3WQUA 5C2DA 1VQMN 3MCAB 5BN8A 1TUYA 4JK7A 4BG9A 4A2BA 3GOIA 1HJOA 4C1NK 1QQMA 1V4TA 1SS6A 1K8KB 3ZX3A 4BREA 3CCVN 3RSEA 3O9TA 4OO1J 2V51B 2NRRA 3G71N 3KZBA 4JK9A 4HTLA 1RGIA 2NRVA 3UKRB 3L4QA 3Q7CA 4BRDA 5AQIA 3CMEN 5F0XA 4IWVA 1YAGA 4YOVA 3HSCA 2Q2RA 2AP1A 3J7ZO 3TPQA 3SBGA 5AQWA 2EWSA 3SK3A 2Q36A 3KVGA 3ZEUB 3D2EA 4MLHA 2E1YA 2ASPA 3WXKA 2P9UA 3A8YA 5GAGP 4XH5A 1BU6O 2I7NA 5AQTA 5AZJA 4AM6A 2E2NA 3CJBA 3KWGA 2RHKA 3GL1A 3ENHA 2YCHA 1W2BM 1S22A 3CETA 1U2VB 4IDHA 4WF9L 5ELZA 3HI0A 3EN9A 2JWLA 3A5NC 4WQ4C 5CR4A 2CGKA 1CZAN 5E84A 3TU5A 4JKDA 3VEVA 4BVPA 4MO4A 5AQFA 3FGUA 3TTDA 5JVHL 2FSKA 3HRGA 1KAYA 3IUCA 4BR2A 5C10A 2FLOA 3SAFA 5CHIA 1TYQA 1KXPA 2GWJA 4BRAA 5KPZA 4GV6A 5AQVA 1NGEA 3VF2A 4BR0A 4YOUA 5M1NA 1OVYA 3MX2A 3F9MA 4JAXA 3U4LA 3O4WA 1YXQA 2ZGYA 4JNEA 3FFKB 3ID8A 3WUHA 4EAHD 1D4XA 3L0QA 3FE1A 1NGHA 3WQTA 4YDUA 2P9IA 4EFHA 4PL8A 1EO1A 3TSPA 3CQYA 3AAPA 4CD1A 5KPTA 4H0VB 1NJIO 4B1XB 3MN7A 1RDUA 3GBTA 3M3ZA 3O5BA 3D7EO 5M1FA 1DT9A 3B8AX 5B8HA 3CCUN 1VQ5N 1T6CA 3BF3A 4H5RA 5AZIA 5AQLA 5JICA 1G99A 1E4GT 3QMLA 4FWOA 4O8UA 3SAHA 1YI2N 2HMPA 3Q7BA 2NRZA 3L6QA 4M7XA 1HUXA 2Q31A 3GDQA 2H3GX 3H1QA 1NGBA 1DGKN 3QBXA 1VQ4N 1VQ6N 4FSVA 2DPNA 5EVZA 1NGGA 1YVNA 3EKSA 2A41A 3A5MC 4FWPA 5AQSA 1GLLO 3H1VX 4ISGA 4WCEL 3U8XA 4RCHA 4DB3A 4BC4A 5LY3A 1VQ7N 1SAZA 3CJ7A 2E2OA 3EL2A 3H46O 4E1JA 1YIJN 5H1SQ 4CJ7A 5AQHA 2FSNA 4EIAA 3MN9A 4JKHA 4NB4A 1JCFA 5AQUA 3ULEA 4A61A 2ITMA 3ZETB 5GAEP 2ZF5O 3P38A 3SMSA 4DCHA 2QM1A 4B1UB 4MO5A 1ESVA 5AQQA 3AGRA 1M90O 5KQ8A 2F9WA 2GELA 1E4FT 1YF5L 4Z94A 3JXUA 4CZLA 3WEEA 5BPLA 3FZHA 2P9KB 1NGAA 5AQMA 3F5TA 1GLDG 1NM1A 2BUPA 3CCQN 2PFUA 5HL7L 4U7BA 5BREA 2HF4A 3GE1A 3CC7N 4FPBA 1VQPN 1KQSM 5LJVA 4KH6A 1HLUA 4F9OA 4CI6A 5GINA 3C65A 1YJWN 3BF1A 1RFQA 4H0YB 4H5VA 3O9SA 4JEPA 5AQNA 3VEXA 3VMFB 5GIPA 4RTFD 4GVEA 1NGJA 1XUPO 5M1QA 3G4SN 3R6MA 1C0FA 5JLFA 1WOQA 1YUWA 4A62A 5AQJA 5EY4A 3U9ZA 3A5LC 3CCEN 5AQZA 1NGIA 4ILHA 4YOTA 3CCSN 4DKWA 4A5BA 1N8RO 4CZMA 2P9PB 3DXKB 3I8BA 4BRIA 2P9NB 3ATVA 4M63C 1MDUB 3NMUA 4ISEA 1Z05A 1Y64A 3FZFA 4ISFA 4J8FA 2NNWA 3CPWM 4BGBA 1VQ9N 2E2PA 4JKBA 3QICA 5DM7L 3CXCM 4O8KA 2VWBA 4JD2A 1MWKA 4H5NA 1MA9B 3C0BA 2A6AA 3GG4A 1VQNN 3MDQA 5DM6L 2A3ZA 2ZWHA 3F2KA 3VPZA 4CZGA 2NRWA 4BQZA 2A5XA 3ENBA 2P9LA 3EKUA 1VQLN 1NBWA 4XH1A 3OHRA 4FVUA 2VGMA 2J4RA 2VGNA 5M1PA 2YHYA 3QBWA 3HZ6A 3FZKA 2QWMA 3CI5A 4JKGA 3MX5A 3AAQA 2YHXA 4BR9A 1NLVA 4PHTX 1J6ZA 1XQSC 3DWLA 3UE5A 3O1BA 2Q0RA 3IMXA 4JKEA 4IEEA 3CJAA 2VCPA 4FPAA 1P8ZA 3KHYA 2QWLA 4BRPA 4IOCL 3A0IX 3LDNA 4FOIA 2FXUA 1XC3A 1K8KA 3P4IA 1BA0A 1YHQN 2NLXA 1KAZA 3VEZA 2PAVA 1VAZA 3MWPA 3TSQA 3D2FB 4B1WB 3FR0A 4CBUA 2A40A 2YI1A 3DXMB 3EO3A 3I33A 4M7YA 1K73O 3E9OA 3LDQA 1HKGA 3CIPA 3TSUA 3ZYYX 3CF5L 3UKRA 3QFPA 2WBNA 4FWQA 4K42A 1GLEG 4BRQA 2D4WA 5CE3A 1K9MO 2KKZA 4JHDB 3CD6N 3ATUA 5BR9A 5I9EB 3IFRA 4A2AA 4RWTA 2E20A 3VGMA 3OA9A 2QW9A 3PIPL 4H5TA 1WUAA 1NGFA 2ZGZA 3ZEUA 4KBOA 2HF3A 4BRFA 2V7YA 1QZ6A 4NO7A 4JKAA 3VTIA 3S41A 3VGKA 2F7TA 2GX9A 2AA4A 1RDWX 4PL7A 5AFUH 4B1VA 4NLCA 3VEYA 3K9JA 1U2VA 1OKJA 4CBWA 3O80A 4BRGA 5ADXA 5C0YA 5E26A 3RVCA 4BC3A 4K25A 3VEOA 1BG3A 4XEIA 4FWRA 2V52B 2E88A 4H5WA 2Q1NA 1K8AO 4G9ZA 4OPHA 3N4PA 3DJCA 1YJNN 2QEXN 3O9RA 3MCPA 4I6MB 1X3NA 3LDOA 2WUSA 2E1ZA 2HBJA 1ATNA 5BRDA 3AARA 4YDUC 4JK8A 1BO5O 2W40A 3M5RA 5C12A 4BRHA 3FLCO 4CZEA 3E9PA 4FWNA 1ATRA 4HWIA 1KC8O 4CBXA 1HX1A 1HKBA 4FO0A 4IXCA 1QQNA 3E9LA 2ASOA 2NRHA 5JVGL 3BP8A 1S72N 4L3QA 3NVMA 3FZLA 2BTFA 4QS9A 5M1OA 2D0OA 3M6GA 4BC2A 3H3NO 4IEIA 2A42A 3C7NB 3EE8A 3LM2A 1YJ9N 3QFUA 1Q7YO 3CQXA 5HOOA 3HOSA 3I56N 3M1FA 4BRMA 3UKUB 3ZX0A 3TTCA 3D6RA 3ENOA 3O8MA 1BA1A 1TUUA 2FSJA 3KK7A 3R9PA 4FOEA 1Q81O 2IVOA 3PLAA 4MLEA 5BN9A 5MLCQ 4GV3A 3KWIA 2P9SB 4BRNA 2IVNA 3EZWA 4FL9A 4H0OA 4BVOA 4WQ5A 3SBTA 4IJAA 3WXMB 4DHYA 3QDKA 1EQYA 4NLBA 1X3MA 1W97L 1NGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPM A;  4CZJ A;  2IVP A;  3R8E A;  4IO8 A;  5EX5 A;  3RSE B;  1BOT O;  5AQO A;  4B1Y B;  3ZET A;  2D1K A;  2QWQ A;  3AY9 A;  3A5O C;  4H03 B;  5FPM A;  4GNI A;  2P9K A;  3W3D A;  2CGL A;  5JLH A;  3JS6 A;  4FWL A;  1GLF O;  3D2E B;  2P9U B;  2QWO A;  5AZJ B;  3L4I A;  3SMP A;  4QS8 A;  4BR5 A;  1GLJ O;  3LDP A;  3VOV A;  2GWK A;  4B1Z A;  2QXL A;  3BUZ B;  1ATS A;  5EOY A;  3LM9 A;  3WT0 A;  2Q0U A;  2YJF A;  3CJC A;  2CGJ A;  1BDG A;  4Y0W A;  4EHU A;  2W41 A;  1ZC6 A;  2FF6 A;  3VER A;  3CJ9 A;  5BRF A;  3HBT A;  4XH4 A;  2P9P A;  3DXK A;  1BUP A;  3BEX A;  1GLB G;  2P9N A;  3H3O B;  1TYQ B;  1QHA A;  4PKI A;  2QWN A;  5AR0 A;  4H0T B;  3VET A;  4LC9 B;  4EHT A;  5AQK A;  3O08 A;  1BWF O;  4WQ4 A;  1R59 O;  2NZT A;  1SZ2 A;  3G25 A;  4AM7 A;  1H1V A;  3J8A A;  3MN5 A;  3HM8 A;  1Q18 A;  2D0P A;  2P9I B;  5F1X A;  4BR7 A;  1T6D A;  3CHW A;  1ZBS A;  2YJE A;  2GTD A;  5KQD A;  5AZI B;  5KPR A;  1NWK A;  5AQG A;  4BG8 A;  3VEN A;  1LOT B;  4WYB A;  1NGD A;  5AQY A;  2F9T A;  3H6E A;  3ZX2 A;  3FZM A;  5AQP A;  2V7Z A;  4K41 A;  5AQR A;  5JMV A;  5BRH A;  3IDH A;  5TKY A;  2OAN A;  5FPN A;  3DAW A;  3VF4 A;  3D2F A;  2IIR A;  2KHO A;  2GEM A;  4BGB A;  3QB0 A;  4H0X B;  4BRO A;  3DXM A;  4CZK A;  4DQ8 A;  1DKG D;  2E2Q A;  3ULE B;  3MN6 A;  3VEW A;  2ASM A;  2CH6 A;  3WXI A;  4JHD A;  3LDL A;  5EXW A;  4BGA A;  3H45 C;  2GUP A;  3CJ1 A;  1LCU A;  4FWM A;  4K43 A;  3VF6 A;  3SJH A;  5BPN A;  5FPE A;  4PKH A;  3WEE B;  4C23 A;  2E8A A;  3O1W A;  2FF3 B;  1IG8 A;  3MMV A;  1SQK A;  5FPD A;  2QWR A;  1C0G A;  4CZI A;  2YHW A;  2CH5 A;  1JCE A;  1T44 A;  4BRL A;  1U6Z A;  2UYT A;  4CZF A;  2QWP A;  4BRK A;  2PBD A;  1JCG A;  1HKC A;  4I6M A;  4O5F A;  5AQX A;  5BPM A;  4GY2 B;  4IZ9 A;  3WXJ A;  3CER A;  4FWS A;  4H0P A;  4FWK A;  2Q97 A;  1Z6R A;  1MWM A;  1QQO A;  1S3X A;  2VYP A;  3HTV A;  4JD2 B;  1X9J A;  4JN4 A;  3U9D A;  1DEJ A;  1IJJ A;  2HOE A;  3C7N A;  1KAX A;  3SLC A;  4QS7 A;  3W0L A;  3WXL A;  4BRC A;  2P9L B;  3VGL A;  4B9Q A;  1NMD A;  4PKG A;  4WQ5 C;  1GLA G;  1GLC G;  5LJW A;  5F2R A;  3UKU A;  4CD3 A;  4BR4 A;  2I7P A;  4CZH A;  3UB5 A;  3LL3 A;  4IJN A;  5ADX H;  3MK6 A;  5AFU A;  1V4S A;  4BQL A;  4BC5 A;  1ZXO A;  2P9S A;  3O6W A;  3VES A;  1QZ5 A;  3WQU A;  5BN8 A;  1TUY A;  4BG9 A;  4A2B A;  3GOI A;  1HJO A;  1QQM A;  1V4T A;  1K8K B;  3ZX3 A;  4BRE A;  3RSE A;  2V51 B;  3KZB A;  4HTL A;  1RGI A;  3UKR B;  4BRD A;  5AQI A;  5F0X A;  4IWV A;  1YAG A;  3HSC A;  2Q2R A;  2AP1 A;  3TPQ A;  5AQW A;  2EWS A;  3SK3 A;  2Q36 A;  3KVG A;  3ZEU B;  3D2E A;  4MLH A;  2E1Y A;  2ASP A;  3WXK A;  2P9U A;  3A8Y A;  4XH5 A;  1BU6 O;  2I7N A;  5AQT A;  5AZJ A;  4AM6 A;  2E2N A;  3CJB A;  3GL1 A;  3ENH A;  2YCH A;  1S22 A;  3CET A;  1U2V B;  5ELZ A;  3HI0 A;  3EN9 A;  3A5N C;  4WQ4 C;  2CGK A;  1CZA N;  5E84 A;  3TU5 A;  3VEV A;  4BVP A;  4MO4 A;  5AQF A;  3FGU A;  2FSK A;  4BR2 A;  1KAY A;  3IUC A;  2FLO A;  1TYQ A;  1KXP A;  2GWJ A;  4BRA A;  5KPZ A;  5AQV A;  1NGE A;  3VF2 A;  4BR0 A;  3U4L A;  3F9M A;  4JAX A;  3O4W A;  1YXQ A;  2ZGY A;  4JNE A;  3FFK B;  3ID8 A;  3WUH A;  4EAH D;  1D4X A;  3L0Q A;  3FE1 A;  1NGH A;  3WQT A;  4YDU A;  2P9I A;  4EFH A;  4PL8 A;  3CQY A;  3AAP A;  4CD1 A;  5KPT A;  4H0V B;  4B1X B;  3MN7 A;  3GBT A;  3M3Z A;  3O5B A;  3D7E O;  3B8A X;  5B8H A;  1T6C A;  3BF3 A;  4H5R A;  5AZI A;  5AQL A;  5JIC A;  1G99 A;  1E4G T;  3QML A;  4FWO A;  2HMP A;  3L6Q A;  4M7X A;  1HUX A;  2Q31 A;  3GDQ A;  2H3G X;  3H1Q A;  1NGB A;  1DGK N;  3QBX A;  4FSV A;  2DPN A;  5EVZ A;  1NGG A;  1YVN A;  3EKS A;  2A41 A;  3A5M C;  4FWP A;  5AQS A;  1GLL O;  3H1V X;  4ISG A;  3U8X A;  4RCH A;  4DB3 A;  4BC4 A;  5LY3 A;  1SAZ A;  3CJ7 A;  2E2O A;  3EL2 A;  3H46 O;  4E1J A;  4CJ7 A;  5AQH A;  2FSN A;  4EIA A;  3MN9 A;  4NB4 A;  1JCF A;  5AQU A;  3ULE A;  4A61 A;  2ITM A;  3ZET B;  2ZF5 O;  3SMS A;  4DCH A;  2QM1 A;  4B1U B;  4MO5 A;  1ESV A;  5AQQ A;  5KQ8 A;  2F9W A;  2GEL A;  1E4F T;  4Z94 A;  3JXU A;  4CZL A;  3WEE A;  5BPL A;  3FZH A;  2P9K B;  1NGA A;  5AQM A;  1GLD G;  1NM1 A;  2BUP A;  5BRE A;  2HF4 A;  3GE1 A;  4FPB A;  5LJV A;  4F9O A;  1HLU A;  4CI6 A;  3BF1 A;  1RFQ A;  4H0Y B;  4H5V A;  3VEX A;  5AQN A;  4RTF D;  1NGJ A;  1XUP O;  3R6M A;  1C0F A;  5JLF A;  1WOQ A;  1YUW A;  4A62 A;  5AQJ A;  5EY4 A;  3U9Z A;  3A5L C;  5AQZ A;  1NGI A;  4CZM A;  2P9P B;  3DXK B;  3I8B A;  4BRI A;  2P9N B;  3ATV A;  4M63 C;  1MDU B;  4ISE A;  1Z05 A;  1Y64 A;  3FZF A;  4ISF A;  4J8F A;  2E2P A;  3QIC A;  4O8K A;  2VWB A;  4JD2 A;  1MWK A;  4H5N A;  1MA9 B;  3C0B A;  2A6A A;  3GG4 A;  3MDQ A;  2A3Z A;  2ZWH A;  3VPZ A;  4CZG A;  4BQZ A;  2A5X A;  2P9L A;  3EKU A;  1NBW A;  4XH1 A;  3OHR A;  2J4R A;  2YHY A;  3QBW A;  3HZ6 A;  3FZK A;  2QWM A;  3CI5 A;  3AAQ A;  2YHX A;  4BR9 A;  1NLV A;  1J6Z A;  1XQS C;  3DWL A;  3UE5 A;  3O1B A;  2Q0R A;  3IMX A;  3CJA A;  2VCP A;  4FPA A;  1P8Z A;  3KHY A;  2QWL A;  4BRP A;  3A0I X;  3LDN A;  4FOI A;  2FXU A;  1XC3 A;  1K8K A;  3P4I A;  1BA0 A;  2NLX A;  1KAZ A;  3VEZ A;  2PAV A;  3D2F B;  4B1W B;  3FR0 A;  4CBU A;  2A40 A;  2YI1 A;  3DXM B;  3EO3 A;  3I33 A;  4M7Y A;  3LDQ A;  1HKG A;  3CIP A;  3UKR A;  3QFP A;  4FWQ A;  4K42 A;  1GLE G;  4BRQ A;  2D4W A;  5CE3 A;  4JHD B;  3ATU A;  5BR9 A;  5I9E B;  3IFR A;  4A2A A;  4RWT A;  2E20 A;  3VGM A;  2QW9 A;  4H5T A;  1WUA A;  1NGF A;  2ZGZ A;  3ZEU A;  4KBO A;  2HF3 A;  4BRF A;  2V7Y A;  1QZ6 A;  4NO7 A;  3S41 A;  3VGK A;  2AA4 A;  1RDW X;  4PL7 A;  5AFU H;  4B1V A;  3VEY A;  1U2V A;  1OKJ A;  4CBW A;  3O80 A;  4BRG A;  5ADX A;  5E26 A;  4BC3 A;  4K25 A;  3VEO A;  1BG3 A;  4XEI A;  4FWR A;  2V52 B;  2E88 A;  4H5W A;  2Q1N A;  3DJC A;  3MCP A;  4I6M B;  1X3N A;  3LDO A;  2WUS A;  2E1Z A;  5BRD A;  1ATN A;  3AAR A;  4YDU C;  1BO5 O;  2W40 A;  4BRH A;  3FLC O;  4CZE A;  4FWN A;  1ATR A;  4HWI A;  4CBX A;  1HX1 A;  1HKB A;  4FO0 A;  4IXC A;  1QQN A;  2ASO A;  2NRH A;  3BP8 A;  4L3Q A;  3FZL A;  2BTF A;  4QS9 A;  4BC2 A;  2D0O A;  3M6G A;  3H3N O;  2A42 A;  3C7N B;  3LM2 A;  3QFU A;  3CQX A;  3M1F A;  4BRM A;  3UKU B;  3ZX0 A;  3ENO A;  3O8M A;  1BA1 A;  1TUU A;  2FSJ A;  3R9P A;  4FOE A;  2IVO A;  4MLE A;  5BN9 A;  2P9S B;  4BRN A;  2IVN A;  3EZW A;  4FL9 A;  4H0O A;  4BVO A;  4WQ5 A;  4DHY A;  4IJA A;  3QDK A;  1EQY A;  1X3M A;  1NGC A; 
#chains in the Genus database with same CATH topology
 3ZSO A;  2HHW A;  1HNZ K;  3R8E A;  1YIT N;  1R0A A;  4HUE A;  1C1C A;  4C1N I;  4YHH K;  3NGZ A;  1ASV A;  4Q0B A;  3CCJ N;  4CFD A;  2HMI A;  3OJU A;  2QWQ A;  3VQD A;  4DV3 K;  4FJG A;  5FPM A;  3VQ9 A;  2F4V K;  3V9Z A;  1VSK A;  4DQQ A;  3THY A;  1QSS A;  2IGI A;  3EE9 A;  4N76 A;  1VK0 A;  5EU7 A;  4FLV A;  1EWR A;  5AZJ B;  1HNI A;  4CJL A;  2OTJ N;  1GLJ O;  3K5M A;  1ATS A;  1KLM A;  4Z4E A;  3LAM A;  3TTF A;  5HRP A;  4DFM A;  1JXB A;  4Y0W A;  4H8K A;  3M8S A;  3VER A;  4XH4 A;  2P9P A;  4FM2 A;  3R3L A;  1BUP A;  1GLB G;  1TGO A;  2P9N A;  2ZJP L;  2E6L A;  4K0K K;  4EHT A;  2HHX A;  1D9F A;  1VSH A;  4W5Q A;  4O44 A;  4AIL C;  4DTU A;  4AM7 A;  2DFE A;  2D0P A;  1NK5 A;  1KVC A;  1C6V A;  3R1X A;  4EZ9 A;  4Z4G A;  2Z1I A;  1ZBS A;  4JS5 A;  1N36 K;  5KQD A;  1EXQ A;  4NYN A;  1VQK N;  3CC4 N;  1LOT B;  4DTM A;  3TAP A;  1NGD A;  1Q82 O;  4J2D A;  3I8D A;  4CHY A;  4IFV A;  1VQ8 N;  3MXJ A;  4KO0 A;  1YVU A;  1J5E K;  2D0A A;  4YNQ A;  1VSM A;  2Q3S A;  3RR8 A;  4FM0 A;  1WBB A;  3CCR N;  1NK4 A;  1NOY A;  3ULE B;  2ASM A;  4ICL A;  4RW4 A;  5C42 A;  2GUP A;  4ZTF A;  3NVK A;  4IOA L;  4K43 A;  1S6P A;  5E41 A;  5FPE A;  3WEE B;  3MEC A;  3O1W A;  2YNF A;  2FF3 B;  4IG3 A;  1WAJ A;  5GAH P;  3THW A;  5FPD A;  3HXM A;  3DLR A;  3QNO A;  1JKH A;  4CZI A;  3PY8 A;  5FDL A;  2YHW A;  4C8L A;  1JCE A;  4DLG A;  2RPI A;  4KAZ A;  4O55 A;  4I7F A;  1OH6 A;  3G10 A;  3HL8 A;  3K59 A;  2NRX A;  1QVF M;  4DV7 K;  4GY2 B;  2QXF A;  2YHA A;  3E66 A;  3WXJ A;  1JXE A;  2BGG A;  4JI4 K;  3U3G A;  4DV4 K;  4DTP A;  1UAX A;  2BE2 A;  4FWK A;  2Q97 A;  3AO1 A;  4DSJ A;  2DTU A;  2WFB A;  4AHR A;  1MWM A;  2I5J A;  2VYP A;  3BDP A;  1QQC A;  4YOR A;  4DLE A;  3U9D A;  3K9K A;  4WFB L;  3C7N A;  1BHL A;  2QA4 N;  4BDZ A;  3IG1 A;  4CCH A;  1JLA A;  3DLB A;  1NMD A;  2KFN A;  4WQ5 C;  2ZJR L;  3L2V A;  2ZJQ L;  4AF1 A;  3S3O A;  3P31 A;  2RKI A;  2I7P A;  3LL3 A;  4JKG B;  1NJY A;  3MK6 A;  2HHU A;  2HND A;  3O9U A;  3PX6 A;  2P9S A;  3O6W A;  3SYZ A;  4Q5V A;  1VQM N;  5C2D A;  4DSI A;  3MCA B;  3J81 O;  4DG1 A;  3LAK A;  4FLX A;  1V4T A;  1SS6 A;  4RW7 A;  1K8K B;  2V51 B;  2NRR A;  1Y97 A;  3LPU A;  4JK9 A;  3V9X A;  1SL0 A;  4CIE A;  4AHV A;  3OYE A;  3EZ5 A;  3UIQ A;  4I9Q A;  4IFY A;  3Q7C A;  5C25 A;  3CME N;  4QAG A;  3VQ4 A;  2Q2R A;  4O4G A;  3QNN A;  2HHS A;  1Q8I A;  1NG9 A;  3D2E A;  4FLY A;  4DTN A;  2E1Y A;  2OZS A;  3RMC A;  3CJB A;  2RHK A;  3GL1 A;  1W2B M;  1S22 A;  4UQG A;  3OJS A;  3CM6 A;  4WF9 L;  3AO4 A;  1EX4 A;  4HCB A;  3VQ5 A;  4FJI A;  2CGK A;  1CZA N;  5E84 A;  1Q9X A;  3VEV A;  5HRO A;  4MO4 A;  3VA3 A;  1S9G A;  3AVK A;  2YNG A;  2FSK A;  3HRG A;  3IUC A;  2FLO A;  4GV6 A;  1KXP A;  4BRA A;  4N47 A;  5AQV A;  4BR0 A;  4YOU A;  5M1N A;  3U4L A;  1WN7 A;  4JAX A;  3O4W A;  2ZGY A;  4JNE A;  4KHP K;  3ID8 A;  4EAH D;  4GKK K;  3FE1 A;  4B8C A;  3PX0 A;  1VSI A;  3V1R A;  4DSF A;  2NUB A;  1HQE A;  3MN7 A;  3V9U A;  2XY6 A;  1TKT A;  4CVN E;  1VQ5 N;  3BF3 A;  4H5R A;  1NMN A;  5JIC A;  1G99 A;  3QML A;  4FWO A;  4B3R K;  1DTT A;  1LAV A;  4DU1 A;  2A1S A;  1X9S A;  2OZM A;  4M3T A;  1NGB A;  1DGK N;  3K57 A;  3NBP A;  1OH5 A;  3H1V X;  3AVB A;  4WCE L;  1NOZ A;  4DB3 A;  5LY3 A;  2D0C A;  4NXM K;  4FJH A;  2E2O A;  5H1S Q;  4CJ7 A;  5AQH A;  3LWL A;  2O8B A;  2FSN A;  4EIA A;  3K58 A;  3V6D A;  3SPZ A;  2ITM A;  3NGI A;  3CFP A;  3SMS A;  4KHN A;  2QM1 A;  2KTQ A;  3AGR A;  5KQ8 A;  3THY B;  1NGA A;  3F5T A;  1I3A A;  1A5W A;  4BDP A;  4CFB A;  1KQS M;  4KH6 A;  4F9O A;  3C65 A;  2D0B A;  1RFQ A;  3AVA A;  4JEP A;  5AQN A;  3WNF A;  5DK5 A;  2DFH A;  5JLF A;  1YUW A;  3O3G A;  3QEP A;  3SUO A;  4A5B A;  3OYH A;  4CZM A;  2P9P B;  3I8B A;  2P9N B;  4M63 C;  4ISF A;  1SKR A;  5J2N A;  3JYT A;  4JKB A;  4O8K A;  2VWB A;  4M3X A;  5J2Q A;  1MWK A;  2Z1J A;  3ISN C;  3CYM A;  3MDQ A;  5HLF A;  3MAQ A;  1RBV A;  3VQP A;  2ZWH A;  3VPZ A;  3DRS A;  3ENB A;  3EKU A;  4XH1 A;  4CJV A;  3TAE A;  2XY8 A;  1L3T A;  4AQY K;  3AAQ A;  4BR9 A;  4E89 A;  3UE5 A;  2YNH A;  1GOB A;  3CG7 A;  2Q0R A;  4FPA A;  3A0I X;  3P4I A;  4OPK A;  4FM1 A;  1WBD A;  2VQF K;  4B1W B;  2YI1 A;  1HNW K;  4KHS A;  2O8F A;  3CIP A;  3ZYY X;  3CF5 L;  3U3Y A;  4CJT A;  3QFP A;  4CFC A;  4BRQ A;  3SCX A;  1G15 A;  4LF9 K;  3D45 A;  3ATU A;  4DV0 K;  3TI0 A;  1BL3 A;  1WUA A;  1QE1 A;  4CHQ A;  4KBO A;  2QKB A;  4NO7 A;  1QZ6 A;  3VTI A;  1HJR A;  3S41 A;  3THW B;  1RDC A;  4PL7 A;  1BCM A;  4M42 A;  1NK6 A;  4CBW A;  5C0Y A;  5K14 A;  3P83 D;  1C0U A;  4BC3 A;  2FBX A;  3VEO A;  4XEI A;  4LD0 A;  4FWR A;  2V52 B;  1RDB A;  2QK9 A;  5SZT A;  2XY7 A;  3KK3 A;  3MCP A;  2WUS A;  4FZX C;  3FLC O;  3NFA A;  4C8O A;  3HPG A;  4RG8 A;  4HWI A;  4FO0 A;  3AVL A;  2ASO A;  1B92 A;  4L3Q A;  2BTF A;  2D0O A;  4IEI A;  3HP6 A;  3LWM A;  4HHT A;  3C7N B;  3EE8 A;  2R7Y A;  3OTO K;  4CE9 A;  1HR0 K;  4CGH A;  3PV8 A;  4BRM A;  3ZX0 A;  3WNH A;  4XIU A;  1OVQ A;  1TUU A;  3HPH A;  2IVO A;  3PLA A;  1KVA A;  4N41 A;  2P9S B;  2IVN A;  4LF6 K;  3EZW A;  1IKW A;  4H0O A;  4DHY A;  4LF8 K;  1EQY A;  1NK8 A;  4FCY A;  1NNE A;  3VTH A;  4CES A;  1N33 K;  1HPM A;  2KLA A;  2RE2 A;  1BOT O;  4B1Y B;  3N4Q A;  3E01 A;  2W6L A;  4JI6 K;  3A5O C;  3I0R A;  3IAY A;  4JI7 K;  1W9H A;  3QEI A;  4KHU A;  2P9K A;  2WON A;  4CW7 B;  4BWJ A;  4JI8 K;  2CGL A;  4KHW A;  3T69 A;  3D2E B;  3U6F A;  1S1U A;  2QWO A;  4M3Z A;  4B8A B;  2G8W A;  1QSY A;  4BR5 A;  3VOV A;  4B1Z A;  2GWK A;  4JV5 K;  2QXL A;  3BUZ B;  3DLG A;  5FLX O;  2YJF A;  3DMJ A;  2FBY A;  4EHU A;  4DS5 A;  3T19 A;  2FF6 A;  3HJF A;  3D0P A;  5BRF A;  3HBT A;  1F21 A;  3H3O B;  4PKI A;  5AR0 A;  4E7H A;  4LC9 B;  3OYK A;  5AQK A;  3O08 A;  3DLH A;  3O9Q A;  4WQ4 A;  1IV0 A;  4DV1 K;  1R59 O;  3VQ7 A;  4DU3 A;  1TK5 A;  2UXC K;  4CEZ A;  3AVN A;  2Z1H A;  3IS9 A;  3SUN A;  4CJ4 A;  1FKO A;  4M41 A;  5F1X A;  1T6D A;  1KFD A;  1TAU A;  3AVG A;  4DR1 K;  4CF8 A;  2YJE A;  3DLK A;  4CJR A;  2RF2 A;  1NWK A;  1EP4 A;  4JRQ A;  4FW2 A;  2F9T A;  3H6E A;  1RCH A;  5AQP A;  2V7Z A;  3L2Q A;  4FJL A;  3HYF A;  4OJR A;  5BRH A;  4M45 A;  3ASM A;  5FPN A;  3LP0 A;  3VF4 A;  3D2F A;  1T3V A;  3T1A A;  4DQ8 A;  2O8B B;  3MED A;  1DKG D;  2W42 A;  2BDP A;  5IT9 O;  2HVH A;  2WTU A;  4E7I A;  4O5B A;  4JHD A;  3LDL A;  1FK9 A;  1FW6 A;  5FRO A;  3RMB A;  3H45 C;  4DTJ A;  4FWM A;  1EKE A;  4BE2 A;  4CJK A;  3TAR A;  2ZQB A;  4DUZ K;  1SUQ A;  3WNE A;  1I39 A;  1IG8 A;  5GIO A;  1SQK A;  5KRT A;  4NYF A;  5AJ3 K;  4JS4 A;  3K0S A;  4OGE A;  2F8T A;  1S1T A;  3PSI A;  3I0S A;  4AHS A;  3M8R A;  1CZB A;  1QVG M;  4JKC A;  1JJ2 M;  4I6M A;  4FK0 A;  3P39 A;  4GV9 A;  3CER A;  3MEE A;  4FWS A;  4FJJ A;  3ZT3 A;  4J2B A;  3C6H A;  3VA0 A;  2HB5 A;  5KRS A;  4DMN A;  1KRP A;  4N56 A;  4AH9 A;  3ZSR A;  5HRS A;  3VQ6 A;  2EHG A;  4KH4 A;  4CK1 A;  1Q9Y A;  3NH0 A;  3W0L A;  4BRC A;  1VQO N;  4DUY K;  2RN2 A;  3OBW A;  3VGL A;  3ZSZ A;  4CK3 A;  4PKG A;  5J2M A;  5LJW A;  1JLC A;  3DOK A;  5C2F A;  3UKU A;  2IS3 A;  4CZH A;  2IAJ A;  4BE1 A;  4X66 K;  4FK4 A;  4KH5 A;  1V4S A;  3J7Y P;  1N6Q A;  3VES A;  2YKN A;  3ID6 A;  1K6Y A;  4DF4 A;  3GOI A;  1HJO A;  5KGW A;  3ZX3 A;  1C1A A;  2HW3 A;  4BRE A;  3RSE A;  3G71 N;  4CEC A;  2O8F B;  3L4Q A;  3K5L A;  4BRD A;  3ZT4 A;  3KIO A;  5AQI A;  5F0X A;  4IWV A;  3TWH A;  1YAG A;  2LSN A;  2VG5 A;  4YOV A;  2AP1 A;  3V9S A;  1D8Y A;  3TPQ A;  3SBG A;  3HM9 A;  2EWS A;  4EZ6 A;  3KVG A;  4MLH A;  1LWF A;  2P9U A;  3O3H A;  1WSE A;  4XH5 A;  1ZBH A;  4FJ7 A;  3CET A;  4K8Z A;  4RW6 A;  3ITH A;  3EN9 A;  4FLZ A;  5CR4 A;  3V81 A;  3VN5 A;  2GUI A;  4C8K A;  4CJQ A;  4BVP A;  5AQF A;  4Y1D A;  1WAF A;  3FGU A;  3ULD A;  5CHI A;  5C10 A;  3SAF A;  4FW1 A;  1TYQ A;  3AA4 A;  4CF9 A;  3OYC A;  3WQT A;  4KPY A;  3CQY A;  3AAP A;  1SKW A;  3GBT A;  3M3Z A;  4JLH A;  5FRN A;  1DT9 A;  4JI0 K;  1T6C A;  5AZI A;  5AQL A;  3AV9 A;  1E4G T;  3EYZ A;  3Q7B A;  4Z4H A;  2Q31 A;  4NCA A;  3H1Q A;  4HUF A;  3J80 O;  3ZSX A;  1YVN A;  4KTZ A;  3EKS A;  4RCH A;  4BC4 A;  5HRR A;  1ZBF A;  1SAZ A;  2G8H A;  4NB4 A;  3LZJ A;  1JCF A;  1N34 K;  5AQU A;  2UXD K;  2KZM A;  4DCH A;  1ESV A;  3NF8 A;  5J2P A;  5BPL A;  2P9K B;  4LSN A;  3SNN A;  4LY7 A;  4B9M A;  4DTS A;  5HL7 L;  2HF4 A;  4FJ8 A;  1HLU A;  5GIN A;  3RMA A;  3HVT A;  4CJ5 A;  4H0Y B;  3QET A;  3O9S A;  4LSL A;  1TKD A;  3HPO A;  5HRN A;  1HNX K;  4JI1 K;  4RTF D;  3DRP A;  4GVE A;  3OYG A;  4KB1 A;  1NGJ A;  1TVR A;  1XUP O;  4A62 A;  1HYS A;  2KFZ A;  3U9Z A;  5AQZ A;  4YOT A;  4F3O A;  3THV A;  4NCB A;  5HBM A;  4Z4I A;  2OCE A;  4BRI A;  3ATV A;  1X9M A;  3NMU A;  3FZF A;  4YY3 K;  1VRU A;  2NNW A;  3VQ8 A;  3AA3 A;  3CXC M;  3EEQ A;  1RBT A;  4H5N A;  3C0B A;  2XRI A;  3ZSY A;  2X6S A;  4KTQ A;  5DMR A;  1YTA A;  3F73 A;  4CZG A;  3TAQ A;  2P9L A;  4KI6 A;  1JLE A;  2GBZ A;  4FVU A;  3OHR A;  3K2P A;  3O3F A;  4CFA A;  1KVB A;  2QWM A;  3CI5 A;  2YHX A;  1NLV A;  1BGX T;  1RDD A;  4CJE A;  3O1B A;  4DQI A;  3ZSQ A;  3IMX A;  4CHP A;  4DR5 K;  2O8D A;  2ZM6 K;  5KGX A;  1P8Z A;  1HPZ A;  3V4I A;  4FOI A;  2ETJ A;  1CXU A;  4BDY A;  1YHQ N;  3CFR A;  1IKV A;  1S9E A;  2PAV A;  1VAZ A;  3TSQ A;  4BAC A;  3D2F B;  4M7Y A;  3QIO A;  1J54 A;  3E9O A;  3UKR A;  2WBN A;  4FWQ A;  4FZZ A;  2D4W A;  4DS4 A;  4JHD B;  3TAN A;  3PX4 A;  1S1X A;  3IFR A;  2XO7 A;  4PUO A;  1NKE A;  3PIP L;  4H5T A;  2AJQ A;  4BRF A;  2UUC K;  2HF3 A;  2V7Y A;  3VGK A;  1ZBL A;  1U4B A;  1RDW X;  1IG9 A;  4CIF A;  4NLC A;  1NK9 A;  1OKJ A;  5LMU K;  1BQN A;  3AA5 X;  4B3O A;  3RVC A;  4QOZ B;  4DQP A;  4DV5 K;  4LFA K;  1SL1 A;  2FC0 A;  2E88 A;  4DTO A;  1W7A A;  3N4P A;  1YJN N;  3KLH A;  3O9R A;  4DFJ A;  4I6M B;  1X3N A;  3CM5 A;  1TKX A;  3LDO A;  2HBJ A;  2XY5 A;  4FJK A;  3AAR A;  1JLQ A;  4CF2 A;  1BO5 O;  2W40 A;  1L3V A;  4CBX A;  5CZ1 A;  1HKB A;  4LH5 A;  1QQN A;  3KK2 A;  3OS1 A;  2A1R A;  1RTH A;  4HCC A;  3BP8 A;  1S72 N;  2DFF A;  1NKC A;  3FZL A;  3RWU A;  3K5O A;  3NGY A;  1YJ9 N;  3QFU A;  1BIS A;  3UKU B;  4DFK A;  3KK7 A;  3R9P A;  5CYM A;  3AO2 A;  4GV3 A;  3KWI A;  5SWM A;  1RBS A;  3P1G A;  1RT4 A;  3WXM B;  4DV2 K;  3L8B A;  1LWC A;  4G1Q A;  4CK2 A;  1NGC A;  1ASW A;  4CZJ A;  4RW8 A;  4CEE A;  2IVP A;  3RSE B;  3NF7 A;  5AQO A;  1NK0 A;  4QCL A;  3AO5 A;  3RRH A;  4HTU A;  1XWL A;  2HNY A;  4ELV A;  3PO5 A;  4ILJ A;  3AY9 A;  4CGJ A;  4KB0 A;  4H03 B;  4GNI A;  3KTQ A;  3K5N A;  2BH1 A;  2QKK A;  3AVF A;  4LF5 K;  2P9U B;  3SMP A;  1N32 K;  4QS8 A;  3DLL L;  5EOY A;  3WT0 A;  1RT6 A;  4FLW A;  4H4O A;  3AVM A;  3C6A A;  1KD1 O;  4NXN K;  3KLF A;  3NAE A;  4U67 L;  3CJ9 A;  2F96 A;  2F8S A;  3BEX A;  1TYQ B;  3VET A;  4H0T B;  1T8E A;  2X6N A;  1BWF O;  4C8N A;  2NZT A;  5M1K A;  4H4M A;  3NDK A;  3J8A A;  3MN5 A;  3HM8 A;  1Q18 A;  3NF6 A;  3QIP A;  4CEB A;  1UOC A;  2HHV A;  3JSM A;  3OYF A;  2G8F A;  4GMJ B;  4IOX A;  2HBK A;  5GAD P;  2GTD A;  5AZI B;  3M8P A;  5AQG A;  4CER A;  4A5A A;  2Z1G A;  4WYB A;  4IBN A;  3CMA N;  1DTQ A;  1TL1 A;  4RW9 A;  5C24 A;  3ZX2 A;  4FK2 A;  1LW2 A;  3FZM A;  4YOW A;  1LV5 A;  4DTX A;  1SL2 A;  5AQR A;  5JMV A;  4PA1 A;  1RIL A;  5I42 A;  3TAM A;  1UA0 A;  3BY5 A;  3IDH A;  5TKY A;  4IG0 A;  1XI1 A;  4BGB A;  3DAW A;  2IIR A;  4B9V A;  4BRO A;  1BI4 A;  3QB0 A;  4H0X B;  4A57 A;  3S9H A;  3PSF A;  1M1K O;  4JYA K;  4DSK A;  1BIU A;  2PYL A;  2O8C A;  1RDA A;  3MN6 A;  3VEW A;  2CH6 A;  1RT5 A;  3THX A;  4BGA A;  1QHT A;  3CPE A;  1L5U A;  3VF6 A;  2GV9 A;  3SJH A;  3S3M A;  2B5J A;  4PKH A;  4FJX A;  5KI6 A;  2E8A A;  4CGF A;  1P90 A;  1IO2 A;  3LAL A;  2QWR A;  1ILY A;  1C0G A;  2G8V A;  3CCL N;  3A2F A;  3O4Q A;  2QTD A;  1T44 A;  4BRL A;  4NCG A;  2UYT A;  2P51 A;  2OTL N;  2QWP A;  2G8K A;  1JCG A;  1HKC A;  2YNI A;  3IKM A;  4O5F A;  3DYA A;  5BPM A;  3QEV A;  4IZ9 A;  3KD1 E;  3V1O A;  4YOX A;  1OH7 A;  4F2R A;  1XMQ K;  3NF9 A;  4E19 A;  4DF8 A;  4W5N A;  3CCM N;  3HP9 A;  3P5J A;  4IFE A;  4WFA L;  3HTV A;  2UXB K;  1X9J A;  3MXM A;  1DEJ A;  3BZC A;  1HRH A;  2HBL A;  1IJJ A;  2HOE A;  3SLC A;  4QS7 A;  4PQU A;  2P9L B;  3PIO L;  2JGU A;  3LP3 A;  4KKO A;  1GLC G;  3QIN A;  4E1N A;  3QEW A;  3NHG A;  4CD3 A;  4B3T K;  3UB5 A;  4IJN A;  2NRT A;  3L2W A;  2ATQ A;  3QER A;  4BC5 A;  2B6A A;  3SAG A;  1ZXO A;  2O8D B;  1U47 A;  1QZ5 A;  3WQU A;  1S5J A;  4JK7 A;  4A2B A;  1QQM A;  4DSL A;  2O8E A;  1S1W A;  4FZY A;  3CCV N;  3O9T A;  3RMD A;  1U48 A;  3KZB A;  1RGI A;  2NRV A;  3UKR B;  3SQ0 A;  4CJ3 A;  2HHQ A;  1DLO A;  1VSL A;  3J7Z O;  5JS2 A;  3DI6 A;  5AQW A;  3SK3 A;  1ZBU A;  2ASP A;  3WXK A;  3A8Y A;  5AQT A;  1RTD A;  2E2N A;  5ELZ A;  3HI0 A;  2JWL A;  3A5N C;  1XNQ K;  3QES A;  4WQ4 C;  3TU5 A;  4V19 S;  4JKD A;  2P1J A;  3TTD A;  1WB9 A;  4BR2 A;  1E3M A;  1JL2 A;  1NGE A;  3VF2 A;  3F9M A;  3FFK B;  1L3S A;  3ALY A;  1NGH A;  4KI4 A;  4YDU A;  2P9I A;  4EFH A;  1EO1 A;  1WSG A;  5KPT A;  4CD1 A;  4H0V B;  1NU0 A;  4B1X B;  4O0J A;  1C0M A;  1RDU A;  3O5B A;  4CGI A;  3V9W A;  1NJI O;  3D7E O;  2HVI A;  5M1F A;  3B8A X;  3DOL A;  3CCU N;  4F4K A;  4E7K A;  1LW0 A;  3V1Q A;  2DY4 A;  3L2U A;  3L6Q A;  1HUX A;  2D5R A;  3OY9 A;  1VQ6 N;  4FSV A;  2DPN A;  1NGG A;  3KLG A;  4HVJ A;  4O0I A;  3NCI A;  2A41 A;  4FWP A;  4ISG A;  3KK1 A;  4KRE A;  3KD5 E;  1XNR K;  1QSL A;  5JS1 A;  5GAE P;  3P38 A;  3ZLJ A;  4B1U B;  1M90 O;  2GEL A;  4FXD A;  1YF5 L;  4Z94 A;  3JXU A;  2VWK A;  1YT3 A;  5CY4 A;  1NM1 A;  2BUP A;  3CCQ N;  2PFU A;  5BRE A;  3CC7 N;  1ASU A;  1TKZ A;  4CEA A;  4OKE A;  1YJW N;  4OLB A;  4K8X A;  5GIP A;  2IDO A;  4DR4 K;  1OH8 A;  4JI3 K;  3AO3 A;  5M1Q A;  3G4S N;  1WOQ A;  3KKS A;  5AQJ A;  3QLH A;  1NGI A;  3AVI A;  2B4J A;  3AA2 A;  1N8R O;  3OYN A;  2IC3 A;  4ISE A;  1UWB A;  4J8F A;  2O4G A;  1VRT A;  3CPW M;  1WNS A;  4EP4 A;  4JD2 A;  4LF4 K;  4F3T A;  1MA9 B;  3GG4 A;  2A6A A;  2A3Z A;  4ZHR A;  1JLF A;  3HK2 A;  4BQZ A;  2IOC A;  2A5X A;  3OS2 A;  1VQL N;  1NBW A;  3B6O A;  2ZE2 A;  2VGM A;  2VGN A;  1JL1 A;  4I2P A;  3BGR A;  5M1P A;  3KKR A;  1ZBI A;  3FZK A;  5BR8 K;  3MX5 A;  1VSD A;  4FLT A;  2UUA K;  3DWL A;  4ELT A;  4IEE A;  3CJA A;  3HST B;  3MXI A;  2QWL A;  4BRP A;  3HVR A;  4IOC L;  1WSH A;  3KLI A;  3NE6 A;  1KAZ A;  3LDS A;  5A2Q O;  1KFS A;  4CJW A;  1BI4 B;  1O1W A;  3FR0 A;  4CBU A;  2A40 A;  3I33 A;  3TSU A;  2XHB A;  2O8C B;  1GLE G;  4CIG A;  3T1H K;  5CE3 A;  2KKZ A;  3THX B;  4LFC K;  1KSP A;  2W6K A;  4M3R A;  5I9E B;  2E20 A;  3VGM A;  2QW9 A;  1NGF A;  3ZEU A;  4FJ5 A;  4JKA A;  2AA4 A;  4EP5 A;  3SZ2 A;  2YKM A;  5AFU H;  3ZT1 A;  4DQS A;  3G0Z A;  4CJU A;  5FRM A;  3VEY A;  2FBV A;  1U2V A;  3K9J A;  4OGC A;  4BRG A;  5T7B A;  3DM2 A;  5E26 A;  1BG3 A;  2FBT A;  4DQR A;  3RR7 A;  4H5W A;  2Q1N A;  3WNG A;  4G9Z A;  4OPH A;  4BWM A;  4PWD A;  2HHT A;  1KTQ A;  2E1Z A;  4JK8 A;  3M5R A;  4LFB K;  1C1B A;  4BRH A;  4CZE A;  4FWN A;  1KLN A;  1CXQ A;  4FLU A;  3SQ2 A;  1IBK K;  4IXC A;  5JVG L;  1U04 A;  3NVM A;  4BC2 A;  5M1O A;  4QS9 A;  3M6G A;  2A42 A;  2X74 A;  3LM2 A;  1Q7Y O;  4ID1 A;  4Z0U A;  4J2A A;  5HOO A;  3M1F A;  3OYI A;  3TTC A;  3D6R A;  4DWI A;  3O8M A;  1IBM K;  1BA1 A;  1Q81 O;  2YHB A;  5BN9 A;  1ZYQ A;  4DSE A;  4WQ5 A;  3SBT A;  3QO9 A;  4NLB A;  1T03 A;  2X78 A;  2O8E B;  1RBR A;  4IO8 A;  5EX5 A;  4R79 A;  4MDA A;  4CJS A;  1Z25 A;  3C6U A;  1YTU A;  3ZET A;  2D1K A;  3TAB A;  3CC2 N;  5I3U A;  4KFB A;  3FFI A;  4DFP A;  1Z26 A;  3OYB A;  4I9L A;  4CED A;  4GKJ K;  2VG7 A;  4M3U A;  3ZCM A;  1T7P A;  3W3D A;  4YOY A;  5JLH A;  4IDK A;  3JS6 A;  4FWL A;  1GLF O;  1IH7 A;  3LP2 A;  4MDB A;  3L4I A;  2O4I A;  3LDP A;  1B9F A;  3LM9 A;  2Q0U A;  2VG6 A;  3CJC A;  2CGJ A;  4JKF A;  1RT1 A;  1BDG A;  4CF1 A;  3L2R A;  2JWK A;  3LP1 A;  2W41 A;  1TK8 A;  1ZC6 A;  1QTM A;  4WFN L;  1HYZ A;  1REV A;  3DXK A;  2KZZ A;  1EWQ A;  3G6E N;  1HQU A;  1QHA A;  1ITG A;  2QWN A;  4IO9 L;  4F2S A;  4CEO A;  3E1Y A;  3OYJ A;  1SZ2 A;  3G25 A;  1H1V A;  3HOT A;  4UY8 O;  4Z4C A;  3CQ8 A;  4OVL A;  2P9I B;  4C8M A;  2OA8 A;  4CJF A;  4BR7 A;  3CHW A;  3SQ1 A;  3OS0 A;  4OPA A;  4KTW A;  5KPR A;  2E5L K;  1WLJ A;  4BG8 A;  3VEN A;  4OKK A;  1Q86 O;  3OW2 M;  1SV5 A;  1WSJ A;  1X1P A;  5AQY A;  3MEG A;  4K41 A;  1TL3 A;  3SPY A;  3OBY A;  1JLG A;  2PZS A;  1IKY A;  1D9D A;  4LF7 K;  4A59 A;  4W5T A;  2KW4 A;  2OAN A;  5JVH L;  2KHO A;  2GEM A;  4B3M K;  4CZK A;  3DXM A;  2E2Q A;  2HST A;  4CHZ A;  4ID5 A;  1NJW A;  3WXI A;  5EXW A;  3ZSV A;  4MFB A;  4AHC A;  3AVJ A;  3CJ1 A;  1LCU A;  4FJ9 A;  5BPN A;  1RNH A;  3RTV A;  5TKW A;  4C23 A;  4KHQ A;  3MMV A;  4ILG B;  1O13 A;  1RT2 A;  3AGK A;  4GW6 A;  1XHX A;  2CH5 A;  1UA1 A;  2OPQ A;  5C15 A;  2P5O A;  5KTQ A;  1U6Z A;  3SJJ A;  4CZF A;  3T3F A;  3ZT0 A;  3C95 A;  1TAQ A;  2PBD A;  4BRK A;  5AQX A;  2E6M A;  1JLB A;  3PUF A;  4H0P A;  2YX6 A;  2WOM A;  3B6P A;  3PO4 A;  1FKP A;  2UUB K;  4DU4 A;  1Z6R A;  4E7J A;  1QQO A;  1XHZ A;  3T7Z A;  1S3X A;  2E4L A;  4JN4 A;  4JD2 B;  4J2E A;  4CGG A;  2KQ2 A;  2JLE A;  2WC9 A;  3C94 A;  4BY9 C;  3L3V A;  5CYQ A;  5D3G A;  2VWJ A;  3TR8 A;  1KAX A;  2HBM A;  3WXL A;  2OPS A;  3NH1 A;  4B9Q A;  3TAF A;  3BZK A;  1GLA G;  5F2R A;  4GVM A;  4BR4 A;  4B9T A;  3TAG A;  4B9L A;  4WE1 A;  5ADX H;  5IWA K;  4X64 K;  5AFU A;  4BQL A;  4N5S A;  1RTJ A;  1A5V A;  2QI2 A;  3MWT A;  4FVM A;  3I55 N;  4CEQ A;  5BN8 A;  1TUY A;  4BG9 A;  3SV4 A;  4C1N K;  1B9D A;  4B3S K;  3HO1 A;  1NJZ A;  1IBL K;  3OYA A;  4OO1 J;  3OYL A;  4B9S A;  2EX3 A;  4HTL A;  1S6Q A;  5CZ2 A;  2VQE K;  1VSE A;  1VHX A;  4DTR A;  4B08 A;  1TK0 A;  3HSC A;  3J7A P;  2PYJ A;  4R5P A;  2Q36 A;  1GOC A;  3S3N A;  3ZEU B;  5GAG P;  5AZJ A;  1BU6 O;  2I7N A;  4FJM A;  4AM6 A;  3KWG A;  1L3U A;  3KLE A;  3SUP A;  3ENH A;  2YCH A;  5LL6 Z;  1J53 A;  4JI2 K;  1U2V B;  4B9N A;  2G8I A;  4MQ3 A;  4IDH A;  2HHH K;  1QS4 A;  3OYD A;  3RRG A;  1IKX A;  1RTI A;  1KAY A;  2ITG A;  2GWJ A;  3OVN A;  5KPZ A;  1U49 A;  5HP1 A;  1BCO A;  1OVY A;  3MX2 A;  1YXQ A;  4OPJ A;  1XC9 A;  3WUH A;  1RT3 A;  1D4X A;  3L0Q A;  1LAW A;  4PL8 A;  3TSP A;  2BAN A;  1FJG K;  1W0H A;  4BE0 A;  1CZ9 A;  5B8H A;  1U45 A;  4E7L A;  1VSJ A;  2OYQ A;  1NK7 A;  4O8U A;  3SAH A;  1YI2 N;  2HMP A;  2Y1J A;  2NRZ A;  3LZI A;  3O4N A;  4M7X A;  3GDQ A;  3M8Q A;  2H3G X;  2PY5 A;  1VSF A;  1T05 A;  3QBX A;  1VQ4 N;  5EVZ A;  1HNV A;  4DR2 K;  4AHU A;  5AQS A;  3A5M C;  1GLL O;  3U8X A;  4KRF A;  1VQ7 N;  1YIJ N;  3CJ7 A;  3EL2 A;  3H46 O;  4E1J A;  4DR7 K;  5J1E A;  3MN9 A;  4JKH A;  4FJN A;  1X9W A;  3ULE A;  4A61 A;  3ZET B;  2ZF5 O;  1WSF A;  1A5X A;  4CGD A;  4MO5 A;  5AQQ A;  4OLA A;  2F9W A;  1E4F T;  2OPR A;  4CZL A;  3WEE A;  4L8R B;  3FZH A;  5AQM A;  4X62 K;  4M3Y A;  1GLD G;  3ZT2 A;  4U7B A;  3GE1 A;  4W5R A;  4FPB A;  3NH2 A;  1N5Y A;  1VQP N;  5LJV A;  4CI6 A;  3BF1 A;  4H5V A;  4ELU A;  3VEX A;  1D5A A;  2Y1I A;  3VMF B;  1NJX A;  4I2Q A;  1CLQ A;  3R6M A;  1C0F A;  5EY4 A;  3CFO A;  3A5L C;  3CCE N;  4ILH A;  3CCS N;  3H08 A;  3VQA A;  1S1V A;  4DKW A;  1NKB A;  3DXK B;  1RT7 A;  1MDU B;  2OPP A;  3QEX A;  3VQC A;  1Z05 A;  1Y64 A;  1VQ9 N;  4CHO A;  2E2P A;  3QIC A;  5DM7 L;  4B9U A;  4E1M A;  1VQN N;  3VQB A;  5DM6 L;  3F2K A;  2NRW A;  2HNZ A;  2UU9 K;  3DLE A;  2J4R A;  3KJV A;  1J5O A;  2YHY A;  4PY5 A;  3QBW A;  3HZ6 A;  3F9K A;  4JKG A;  4PHT X;  3LPT A;  1J6Z A;  1XQS C;  1EET A;  1BIZ A;  4JKE A;  2VCP A;  2YV0 X;  3KHY A;  1MU2 A;  4AHT A;  3EY1 A;  3LDN A;  2FXU A;  4YFU A;  1XC3 A;  1K8K A;  1BA0 A;  2NLX A;  3VEZ A;  3MWP A;  4OKJ A;  3DXM B;  3EO3 A;  4HUG A;  1K73 O;  3LDQ A;  1HKG A;  5LMN K;  4M3W A;  4K42 A;  1K9M O;  1J9A A;  1GOA A;  3CD6 N;  1SKS A;  1HMV A;  3DRR A;  3JAM O;  2P5G A;  5BR9 A;  4X65 K;  3C6T A;  4A2A A;  3SUQ A;  4RWT A;  3OA9 A;  3IRX A;  2ZGZ A;  1HYV A;  3HT3 A;  3VQE A;  4F8R A;  4TSX A;  2F7T A;  2GX9 A;  1RBU A;  2ZD1 A;  4B1V A;  3O80 A;  5ADX A;  3SQ4 A;  4K25 A;  1LWE A;  1TV6 A;  4CF0 A;  3AVC A;  3VQQ A;  3ZSW A;  4JRP A;  4CEF A;  3T1Y K;  1K8A O;  3DJC A;  4CJP A;  2QEX N;  4Y1C A;  4DV6 K;  5BRD A;  1ATN A;  2G8U A;  4YDU C;  3SV3 A;  5C12 A;  4DR6 K;  3E9P A;  4E0D A;  4IKF A;  1ATR A;  1KC8 O;  1HX1 A;  4JI5 K;  3E9L A;  2NRH A;  1XMO K;  1WSI A;  3H3N O;  4W5O A;  4E3S A;  4Z4F A;  3CQX A;  4CHN A;  3HOS A;  3I56 N;  3OYM A;  3SI6 A;  4KHY A;  4ZTJ A;  1FXX A;  3ENO A;  1I94 K;  2FSJ A;  3L3U A;  4FYD A;  4KV8 A;  4LH4 A;  1C0T A;  4FOE A;  4MLE A;  5MLC Q;  4DR3 K;  4OX9 K;  3AVH A;  3LAN A;  4BRN A;  1BQM A;  4FL9 A;  4BVO A;  4IJA A;  3QDK A;  1KCF A;  1X3M A;  1W97 L; 
#chains in the Genus database with same CATH homology
 3VTH A;  1HPM A;  4CZJ A;  2IVP A;  3R8E A;  2KLA A;  1YIT N;  4IO8 A;  5EX5 A;  2RE2 A;  1BOT O;  3RSE B;  4C1N I;  5AQO A;  4R79 A;  4MDA A;  4B1Y B;  3N4Q A;  3ZET A;  2D1K A;  3CC2 N;  3CCJ N;  4ILJ A;  2QWQ A;  3AY9 A;  3A5O C;  4H03 B;  5FPM A;  4GNI A;  2P9K A;  3EE9 A;  3W3D A;  4YOY A;  2BH1 A;  2CGL A;  5JLH A;  3JS6 A;  4FWL A;  3T69 A;  1GLF O;  3D2E B;  2P9U B;  2QWO A;  4MDB A;  5AZJ B;  3L4I A;  3SMP A;  4QS8 A;  2OTJ N;  4BR5 A;  1GLJ O;  3LDP A;  3VOV A;  2GWK A;  4B1Z A;  2QXL A;  3BUZ B;  1ATS A;  3DLL L;  5EOY A;  3LM9 A;  3WT0 A;  2Q0U A;  2YJF A;  3CJC A;  2CGJ A;  4JKF A;  1BDG A;  3TTF A;  2JWK A;  4Y0W A;  4EHU A;  2W41 A;  1ZC6 A;  3C6A A;  1KD1 O;  2FF6 A;  3VER A;  4U67 L;  3CJ9 A;  4WFN L;  5BRF A;  3HBT A;  4XH4 A;  2P9P A;  3DXK A;  3R3L A;  1BUP A;  3BEX A;  1GLB G;  2P9N A;  3H3O B;  1TYQ B;  3G6E N;  2ZJP L;  1QHA A;  4PKI A;  2QWN A;  5AR0 A;  4H0T B;  3VET A;  4LC9 B;  4EHT A;  5AQK A;  3O08 A;  4IO9 L;  3O9Q A;  1BWF O;  4WQ4 A;  1R59 O;  3E1Y A;  2NZT A;  1SZ2 A;  3G25 A;  4AM7 A;  5M1K A;  1H1V A;  3HOT A;  3J8A A;  3MN5 A;  3HM8 A;  4UY8 O;  1Q18 A;  2D0P A;  2P9I B;  3R1X A;  5F1X A;  4BR7 A;  1T6D A;  3CHW A;  4IOX A;  2HBK A;  5GAD P;  1ZBS A;  4OPA A;  2YJE A;  2GTD A;  5KQD A;  5AZI B;  5KPR A;  1NWK A;  5AQG A;  4BG8 A;  3VEN A;  4A5A A;  1VQK N;  3CC4 N;  1LOT B;  4WYB A;  1Q86 O;  1NGD A;  3OW2 M;  1Q82 O;  3CMA N;  5AQY A;  2F9T A;  3H6E A;  3ZX2 A;  3FZM A;  5AQP A;  2V7Z A;  4K41 A;  4YOW A;  3OBY A;  5AQR A;  5JMV A;  1VQ8 N;  5BRH A;  4A59 A;  3IDH A;  5TKY A;  2OAN A;  5FPN A;  3DAW A;  3VF4 A;  2IIR A;  1T3V A;  2GEM A;  2KHO A;  3D2F A;  3QB0 A;  4H0X B;  4BRO A;  3DXM A;  4CZK A;  4DQ8 A;  1DKG D;  2E2Q A;  2HST A;  4A57 A;  3CCR N;  1M1K O;  3ULE B;  3MN6 A;  3VEW A;  2ASM A;  2CH6 A;  3WXI A;  4JHD A;  3LDL A;  5EXW A;  4BGA A;  3H45 C;  2GUP A;  3CJ1 A;  1LCU A;  3CPE A;  4FWM A;  3NVK A;  4IOA L;  4K43 A;  3VF6 A;  3SJH A;  5BPN A;  5TKW A;  5FPE A;  4PKH A;  3WEE B;  4C23 A;  2E8A A;  3O1W A;  2FF3 B;  1IG8 A;  3MMV A;  1P90 A;  4ILG B;  5GIO A;  5GAH P;  1SQK A;  5FPD A;  2QWR A;  1ILY A;  1C0G A;  1O13 A;  3AGK A;  3CCL N;  4CZI A;  2YHW A;  2CH5 A;  1JCE A;  2QTD A;  5C15 A;  1T44 A;  4BRL A;  1U6Z A;  2UYT A;  4CZF A;  2OTL N;  2QWP A;  1QVG M;  4JKC A;  2PBD A;  4BRK A;  1JJ2 M;  1JCG A;  1HKC A;  2NRX A;  3IKM A;  4I6M A;  4O5F A;  5AQX A;  5BPM A;  3P39 A;  1QVF M;  4GY2 B;  4IZ9 A;  3WXJ A;  4GV9 A;  3E66 A;  3CER A;  4FWS A;  4H0P A;  2YX6 A;  4YOX A;  3C6H A;  4FWK A;  2Q97 A;  3CCM N;  1Z6R A;  2WFB A;  1MWM A;  1QQO A;  3T7Z A;  4IFE A;  4WFA L;  1S3X A;  2VYP A;  3HTV A;  4JD2 B;  1X9J A;  4JN4 A;  4YOR A;  2WC9 A;  4BY9 C;  3U9D A;  1DEJ A;  3K9K A;  4WFB L;  2HBL A;  4KH4 A;  1IJJ A;  2HOE A;  3C7N A;  1KAX A;  3SLC A;  4QS7 A;  2HBM A;  2QA4 N;  3W0L A;  3WXL A;  4BRC A;  2P9L B;  3PIO L;  1VQO N;  3OBW A;  3VGL A;  4B9Q A;  1NMD A;  4PKG A;  4WQ5 C;  2ZJR L;  1GLA G;  1GLC G;  5LJW A;  5F2R A;  5C2F A;  4AF1 A;  3UKU A;  2ZJQ L;  3P31 A;  4BR4 A;  2I7P A;  4CD3 A;  4CZH A;  3UB5 A;  3LL3 A;  4IJN A;  4JKG B;  5ADX H;  2NRT A;  3MK6 A;  4KH5 A;  5AFU A;  1V4S A;  3O9U A;  4BQL A;  4BC5 A;  3SAG A;  1ZXO A;  2P9S A;  2QI2 A;  3MWT A;  3O6W A;  3VES A;  3I55 N;  1QZ5 A;  3ID6 A;  3WQU A;  5C2D A;  1VQM N;  3MCA B;  5BN8 A;  1TUY A;  4JK7 A;  4BG9 A;  4A2B A;  3GOI A;  1HJO A;  4C1N K;  1QQM A;  1V4T A;  1SS6 A;  1K8K B;  3ZX3 A;  4BRE A;  3CCV N;  3RSE A;  3O9T A;  4OO1 J;  2V51 B;  2NRR A;  3G71 N;  3KZB A;  4JK9 A;  4HTL A;  1RGI A;  2NRV A;  3UKR B;  3L4Q A;  3Q7C A;  4BRD A;  5AQI A;  3CME N;  5F0X A;  4IWV A;  1YAG A;  4YOV A;  3HSC A;  2Q2R A;  2AP1 A;  3J7Z O;  3TPQ A;  3SBG A;  5AQW A;  2EWS A;  3SK3 A;  2Q36 A;  3KVG A;  3ZEU B;  3D2E A;  4MLH A;  2E1Y A;  2ASP A;  3WXK A;  2P9U A;  3A8Y A;  5GAG P;  4XH5 A;  1BU6 O;  2I7N A;  5AQT A;  5AZJ A;  4AM6 A;  2E2N A;  3CJB A;  3KWG A;  2RHK A;  3GL1 A;  3ENH A;  2YCH A;  1W2B M;  1S22 A;  3CET A;  1U2V B;  4IDH A;  4WF9 L;  5ELZ A;  3HI0 A;  3EN9 A;  2JWL A;  3A5N C;  4WQ4 C;  5CR4 A;  2CGK A;  1CZA N;  5E84 A;  3TU5 A;  4JKD A;  3VEV A;  4BVP A;  4MO4 A;  5AQF A;  3FGU A;  3TTD A;  5JVH L;  2FSK A;  3HRG A;  1KAY A;  3IUC A;  4BR2 A;  5C10 A;  2FLO A;  3SAF A;  5CHI A;  1TYQ A;  1KXP A;  2GWJ A;  4BRA A;  5KPZ A;  4GV6 A;  5AQV A;  1NGE A;  3VF2 A;  4BR0 A;  4YOU A;  5M1N A;  1OVY A;  3MX2 A;  3F9M A;  4JAX A;  3U4L A;  3O4W A;  1YXQ A;  2ZGY A;  4JNE A;  3FFK B;  3ID8 A;  3WUH A;  4EAH D;  1D4X A;  3L0Q A;  3FE1 A;  1NGH A;  3WQT A;  4YDU A;  2P9I A;  4EFH A;  4PL8 A;  1EO1 A;  3TSP A;  3CQY A;  3AAP A;  4CD1 A;  5KPT A;  4H0V B;  1NJI O;  4B1X B;  3MN7 A;  1RDU A;  3GBT A;  3M3Z A;  3O5B A;  3D7E O;  5M1F A;  1DT9 A;  3B8A X;  5B8H A;  3CCU N;  1VQ5 N;  1T6C A;  3BF3 A;  4H5R A;  5AZI A;  5AQL A;  5JIC A;  1G99 A;  1E4G T;  3QML A;  4FWO A;  4O8U A;  3SAH A;  1YI2 N;  2HMP A;  3Q7B A;  2NRZ A;  3L6Q A;  4M7X A;  1HUX A;  2Q31 A;  3GDQ A;  2H3G X;  3H1Q A;  1NGB A;  1DGK N;  3QBX A;  1VQ4 N;  1VQ6 N;  4FSV A;  2DPN A;  5EVZ A;  1NGG A;  1YVN A;  3EKS A;  2A41 A;  3A5M C;  4FWP A;  5AQS A;  1GLL O;  3H1V X;  4ISG A;  4WCE L;  3U8X A;  4RCH A;  4DB3 A;  4BC4 A;  5LY3 A;  1VQ7 N;  1SAZ A;  3CJ7 A;  2E2O A;  3EL2 A;  3H46 O;  4E1J A;  1YIJ N;  5H1S Q;  4CJ7 A;  5AQH A;  2FSN A;  4EIA A;  3MN9 A;  4JKH A;  4NB4 A;  1JCF A;  5AQU A;  3ULE A;  4A61 A;  2ITM A;  3ZET B;  5GAE P;  2ZF5 O;  3P38 A;  3SMS A;  4DCH A;  2QM1 A;  4B1U B;  4MO5 A;  1ESV A;  5AQQ A;  3AGR A;  1M90 O;  5KQ8 A;  2F9W A;  2GEL A;  1E4F T;  1YF5 L;  4Z94 A;  3JXU A;  4CZL A;  3WEE A;  5BPL A;  3FZH A;  2P9K B;  1NGA A;  5AQM A;  3F5T A;  1GLD G;  1NM1 A;  2BUP A;  3CCQ N;  2PFU A;  5HL7 L;  4U7B A;  5BRE A;  2HF4 A;  3GE1 A;  3CC7 N;  4FPB A;  1VQP N;  1KQS M;  5LJV A;  4KH6 A;  1HLU A;  4F9O A;  4CI6 A;  5GIN A;  3C65 A;  1YJW N;  3BF1 A;  1RFQ A;  4H0Y B;  4H5V A;  3O9S A;  4JEP A;  5AQN A;  3VEX A;  3VMF B;  5GIP A;  4RTF D;  4GVE A;  1NGJ A;  1XUP O;  5M1Q A;  3G4S N;  3R6M A;  1C0F A;  5JLF A;  1WOQ A;  1YUW A;  4A62 A;  5AQJ A;  5EY4 A;  3U9Z A;  3A5L C;  3CCE N;  5AQZ A;  1NGI A;  4ILH A;  4YOT A;  3CCS N;  4DKW A;  4A5B A;  1N8R O;  4CZM A;  2P9P B;  3DXK B;  3I8B A;  4BRI A;  2P9N B;  3ATV A;  4M63 C;  1MDU B;  3NMU A;  4ISE A;  1Z05 A;  1Y64 A;  3FZF A;  4ISF A;  4J8F A;  2NNW A;  3CPW M;  4BGB A;  1VQ9 N;  2E2P A;  4JKB A;  3QIC A;  5DM7 L;  3CXC M;  4O8K A;  2VWB A;  4JD2 A;  1MWK A;  4H5N A;  1MA9 B;  3C0B A;  2A6A A;  3GG4 A;  1VQN N;  3MDQ A;  5DM6 L;  2A3Z A;  2ZWH A;  3F2K A;  3VPZ A;  4CZG A;  2NRW A;  4BQZ A;  2A5X A;  3ENB A;  2P9L A;  3EKU A;  1VQL N;  1NBW A;  4XH1 A;  3OHR A;  4FVU A;  2VGM A;  2J4R A;  2VGN A;  5M1P A;  2YHY A;  3QBW A;  3HZ6 A;  3FZK A;  2QWM A;  3CI5 A;  4JKG A;  3MX5 A;  3AAQ A;  2YHX A;  4BR9 A;  1NLV A;  4PHT X;  1J6Z A;  1XQS C;  3DWL A;  3UE5 A;  3O1B A;  2Q0R A;  3IMX A;  4JKE A;  4IEE A;  3CJA A;  2VCP A;  4FPA A;  1P8Z A;  3KHY A;  2QWL A;  4BRP A;  4IOC L;  3A0I X;  3LDN A;  4FOI A;  2FXU A;  1XC3 A;  1K8K A;  3P4I A;  1BA0 A;  1YHQ N;  2NLX A;  1KAZ A;  3VEZ A;  2PAV A;  1VAZ A;  3MWP A;  3TSQ A;  3D2F B;  4B1W B;  3FR0 A;  4CBU A;  2A40 A;  2YI1 A;  3DXM B;  3EO3 A;  3I33 A;  4M7Y A;  1K73 O;  3E9O A;  3LDQ A;  1HKG A;  3CIP A;  3TSU A;  3ZYY X;  3CF5 L;  3UKR A;  3QFP A;  2WBN A;  4FWQ A;  4K42 A;  1GLE G;  4BRQ A;  2D4W A;  5CE3 A;  1K9M O;  2KKZ A;  4JHD B;  3CD6 N;  3ATU A;  5BR9 A;  5I9E B;  3IFR A;  4A2A A;  4RWT A;  2E20 A;  3VGM A;  3OA9 A;  2QW9 A;  3PIP L;  4H5T A;  1WUA A;  1NGF A;  2ZGZ A;  3ZEU A;  4KBO A;  2HF3 A;  4BRF A;  2V7Y A;  1QZ6 A;  4NO7 A;  4JKA A;  3VTI A;  3S41 A;  3VGK A;  2F7T A;  2GX9 A;  2AA4 A;  1RDW X;  4PL7 A;  5AFU H;  4B1V A;  4NLC A;  3VEY A;  3K9J A;  1U2V A;  1OKJ A;  4CBW A;  3O80 A;  4BRG A;  5ADX A;  5C0Y A;  5E26 A;  3RVC A;  4BC3 A;  4K25 A;  3VEO A;  1BG3 A;  4XEI A;  4FWR A;  2V52 B;  2E88 A;  4H5W A;  2Q1N A;  1K8A O;  4G9Z A;  4OPH A;  3N4P A;  3DJC A;  1YJN N;  2QEX N;  3O9R A;  3MCP A;  4I6M B;  1X3N A;  3LDO A;  2WUS A;  2E1Z A;  2HBJ A;  1ATN A;  5BRD A;  3AAR A;  4YDU C;  4JK8 A;  1BO5 O;  2W40 A;  3M5R A;  5C12 A;  4BRH A;  3FLC O;  4CZE A;  3E9P A;  4FWN A;  1ATR A;  4HWI A;  1KC8 O;  4CBX A;  1HX1 A;  1HKB A;  4FO0 A;  4IXC A;  1QQN A;  3E9L A;  2ASO A;  2NRH A;  5JVG L;  3BP8 A;  1S72 N;  4L3Q A;  3NVM A;  3FZL A;  2BTF A;  4QS9 A;  5M1O A;  2D0O A;  3M6G A;  4BC2 A;  3H3N O;  4IEI A;  2A42 A;  3C7N B;  3EE8 A;  3LM2 A;  1YJ9 N;  3QFU A;  1Q7Y O;  3CQX A;  5HOO A;  3HOS A;  3I56 N;  3M1F A;  4BRM A;  3UKU B;  3ZX0 A;  3TTC A;  3D6R A;  3ENO A;  3O8M A;  1BA1 A;  1TUU A;  2FSJ A;  3KK7 A;  3R9P A;  4FOE A;  1Q81 O;  2IVO A;  3PLA A;  4MLE A;  5BN9 A;  5MLC Q;  4GV3 A;  3KWI A;  2P9S B;  4BRN A;  2IVN A;  3EZW A;  4FL9 A;  4H0O A;  4BVO A;  4WQ5 A;  3SBT A;  4IJA A;  3WXM B;  4DHY A;  3QDK A;  1EQY A;  4NLB A;  1X3M A;  1W97 L;  1NGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...