4BROA

Legionella pneumophila ntpdase1 crystal form iv (part-open)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
351
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
total genus 110
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4broA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4broA02
1NGCA 3O80A 5AQFA 4A62A 1HUXA 1BU6O 2QWQA 4PL8A 2IVPA 3W0LA 3UKRA 4BRQA 1S3XA 2A41A 3GBTA 2ZGYA 1H1VA 4XH4A 3FFKB 3DAWA 2J4RA 1ZXOA 5AFUH 3ENHA 2QWMA 3U9DA 4FOIA 2D0PA 2P9PA 4H0OA 1NGGA 1NGDA 2CGKA 3QDKA 3F9MA 4GY2B 2YHWA 1ZBSA 3ENOA 2D0OA 1MA9B 2UYTA 5BPNA 4DQ8A 3DXKB 4BRKA 1BWFO 3L0QA 5EX5A 1U6ZA 4FSVA 3QFUA 4AM6A 3MCPA 3U4LA 2GUPA 2P9SA 1CZAN 3IDHA 1HLUA 4FWLA 4BRLA 3VEYA 2YI1A 1GLFO 4FWRA 5AQRA 2QW9A 4BR9A 4JAXA 4K41A 1TUUA 4BRFA 4EHTA 4B1XB 4CZHA 3AAPA 3C7NA 5ADXA 3KVGA 3ZETB 2VWBA 2P9UB 4QS7A 1DEJA 1U2VA 4CZJA 3CJCA 3VEWA 1KXPA 2PAVA 3ID8A 5FPDA 2Q2RA 1HKCA 1ZC6A 5ADXH 3VENA 3H46O 2IIRA 3FR0A 2AA4A 4E1JA 4BRDA 5EVZA 1GLBG 3RSEB 3LM9A 4B1UB 3AY9A 3CERA 4JNEA 3MMVA 2VYPA 4CZFA 3G25A 4CD1A 5EXWA 5BN8A 2FF6A 1TYQA 3FZLA 3OHRA 1T6CA 3D2EA 1ATSA 4BRAA 1ATRA 2KHOA 3DWLA 3EZWA 2A3ZA 3DJCA 4FWMA 3H3OB 5BREA 5FPEA 1NGFA 1T44A 1QQMA 4F9OA 4BQZA 4FPBA 2QM1A 5JMVA 4CBWA 1NBWA 3QFPA 4BVOA 2ZGZA 1LCUA 3ZETA 1SAZA 5F1XA 5AQTA 3ATUA 2FLOA 4QS9A 1XQSC 3VESA 3WXIA 2QWRA 3A0IX 3M6GA 1V4TA 2HMPA 2GELA 3BUZB 3CHWA 2E2QA 2P9IA 2V7YA 1YAGA 5AZIA 2ASOA 3UE5A 3EL2A 3ZEUA 2YJFA 4B1WB 3IFRA 5BR9A 3FE1A 4FWKA 3HM8A 3EKUA 3W3DA 4IXCA 2HF3A 3LDLA 4B9QA 2E2OA 3VEVA 4EAHD 5JLHA 1V4SA 5LJVA 4HWIA 4PKGA 4L3QA 1HJOA 4DHYA 3ZX2A 1BA0A 3GOIA 4JHDA 2QXLA 3LM2A 1E4GT 3QBXA 1BO5O 3VOVA 3WEEB 4CD3A 4FOEA 2P9LA 4FL9A 4JD2B 4BC4A 4BC2A 2GEMA 2W40A 1QQOA 4BQLA 3VEXA 5KQDA 2A5XA 4FWQA 4PKIA 3AARA 3VGKA 1BOTO 2FSNA 2P9NA 4MO5A 2F9TA 3FLCO 5FPMA 1JCEA 4NB4A 3A5MC 4BRCA 2YCHA 4WQ4A 3RSEA 3VETA 5AZJB 5AQGA 3S41A 4BR5A 3KZBA 4BROA 4BG9A 5CE3A 2ASPA 4JN4A 4BR4A 3MN7A 3O08A 3EKSA 3IUCA 5BPLA 1NGIA 1Q18A 2E2PA 4WQ5C 5AQIA 5AQOA 5AQMA 3UKUA 1WOQA 2NZTA 4PKHA 4CI6A 1RFQA 3MN5A 4BR0A 2IVOA 2V52B 3HBTA 3WQTA 1KAXA 3EN9A 2I7NA 5AR0A 1C0FA 1GLDG 2E8AA 4J8FA 3FZHA 5AQQA 4NO7A 2GWJA 2CGLA 4A2BA 4XH5A 3D2FA 3H45C 3VGLA 3SMPA 1YVNA 4YDUC 4BRNA 4FWPA 4O8KA 3TU5A 5AQUA 1ATNA 3H1VX 1S22A 1NMDA 1NGBA 2P9UA 3CJBA 5EOYA 2QWOA 3CJ9A 5EY4A 3O1BA 3DXKA 4K25A 1Y64A 4CBXA 4RWTA 3WXKA 5JLFA 4FWOA 3VERA 3VGMA 4FWNA 1JCGA 2Q0RA 5KQ8A 1TUYA 3D7EO 4H5VA 2CGJA 3QBWA 4M63C 4XH1A 3SK3A 2ASMA 1X9JA 4XEIA 1OKJA 2Q97A 4PL7A 1K8KA 1DKGD 1MDUB 1GLCG 4H0VB 1BDGA 3FZFA 3DXMA 4GNIA 4EFHA 3C7NB 4MLHA 3WUHA 5AQKA 4BRIA 4I6MA 3SLCA 4Z94A 3H6EA 5BRHA 1E4FT 3ZX0A 1RDWX 1NLVA 4WQ5A 1J6ZA 4CZKA 4BR2A 2P9NB 3J8AA 4CZGA 3KHYA 4K43A 3L4IA 1IJJA 3A5NC 4H5RA 2GTDA 3O4WA 1QHAA 3M1FA 2HF4A 3TPQA 1MWKA 1P8ZA 2IVNA 4C23A 3CJAA 1XC3A 2A6AA 2VCPA 3GDQA 4M7YA 2DPNA 1G99A 2Q0UA 2QWPA 5BPMA 1GLJO 3VEOA 2FSKA 3JS6A 3I33A 1C0GA 1NWKA 2HOEA 2BTFA 3VF2A 1XUPO 3CIPA 5AQLA 2E88A 4FWSA 2A40A 3JXUA 1RGIA 3DXMB 2D1KA 2V7ZA 2YHXA 2ZF5O 4H0PA 2P9SB 4MLEA 3SMSA 3UKRB 1GLAG 3WT0A 3UB5A 5AQSA 2E1ZA 1JCFA 4ISGA 4RCHA 4BREA 4ISFA 5KPZA 3LDPA 4CZIA 3GE1A 5AQNA 3CQXA 4CZEA 5AQPA 4H5WA 1YUWA 1SQKA 2P9LB 3FZMA 3SJHA 2QWNA 4KBOA 4CZLA 4IWVA 1YXQA 4H5NA 3D2FB 3R8EA 1BA1A 3GL1A 5AZJA 1MWMA 4H03B 2CH6A 3GG4A 4H0TB 1HPMA 3A5LC 2EWSA 4EIAA 4CJ7A 2NLXA 4YDUA 2CH5A 2ITMA 5I9EB 5E26A 3BEXA 4BRMA 2Q36A 1GLLO 5AFUA 3P4IA 2I7PA 4RTFD 3H1QA 5E84A 5LJWA 3FGUA 3EO3A 3BF3A 4IJNA 5AQYA 1QZ5A 4WQ4C 4JD2A 5AZIB 2FF3B 3LDOA 1U2VB 2YHYA 5ELZA 3ZX3A 1Z6RA 4BR7A 1K8KB 2AP1A 5AQXA 3U9ZA 3ULEA 4ISEA 1Z05A 3R9PA 3QB0A 2FXUA 3IMXA 3WXLA 5AQZA 3MK6A 4M7XA 5KPRA 2YJEA 5BRFA 5F0XA 2FSJA 2H3GX 2E1YA 2QWLA 3CETA 3CQYA 3HTVA 4BGBA 3H3NO 3I8BA 4IO8A 4B1ZA 4CZMA 1BUPA 3LL3A 3UKUB 4A61A 4BRPA 3CJ7A 4EHUA 1X3MA 2F9WA 3QMLA 3D2EB 1QZ6A 3ZEUB 1NGEA 1ESVA 1SZ2A 1NM1A 2P9IB 3HI0A 3MN6A 2ZWHA 5LY3A 4BVPA 5FPNA 1LOTB 4BRHA 5B8HA 1TYQB 2OANA 1HKGA 4H0YB 4CBUA 3C0BA 1HKBA 3MN9A 3VEZA 1IG8A 3ATVA 1NGHA 4BRGA 1X3NA 3LDNA 3FZKA 2E20A 1R59O 2P9KA 4MO4A 4WYBA 3A5OC 5AQWA 4I6MB 1WUAA 1HX1A 3CJ1A 1D4XA 3BP8A 3MDQA 3VF4A 3BF1A 3VF6A 4B1YB 4H0XB 4HTLA 4BC3A 3U8XA 2PBDA 3A8YA 2W41A 4H5TA 4BG8A 4B1VA 1EQYA 5BRDA 4O5FA 1T6DA 4AM7A 4A2AA 2Q31A 3O1WA 1KAZA 3O6WA 2P9PB 3QICA 3M3ZA 3WXJA 2A42A 3HSCA 4Y0WA 1BG3A 4BC5A 3WQUA 4FPAA 1DGKN 3LDQA 1KAYA 5AQJA 5BN9A 3HZ6A 1GLEG 4FO0A 1NGAA 4K42A 2NRHA 3R6MA 3B8AX 4BGAA 5AQVA 3VPZA 5KPTA 5F2RA 3O5BA 4LC9B 5TKYA 2GWKA 3WEEA 3CI5A 2WUSA 4IJAA 2E2NA 2P9KB 2D4WA 1NGJA 2V51B 4JHDB 1QQNA 3L6QA 4IZ9A 3O8MA 4DB3A 5JICA 2Q1NA 4QS8A 2BUPA 5AQHA 3AAQA 3ULEB 4DCHA
chains in the Genus database with same CATH superfamily
1NGCA 1U04A 5AQFA 2R7YA 5HL7L 4A62A 1VHXA 1HUXA 4FLVA 3KWGA 4PL8A 1WSHA 1XNRK 1ASWA 3LWLA 4DQSA 4OO1J 2HNDA 1ZXOA 3VMFB 3LAMA 5AFUH 4LSNA 3ENHA 2A1SA 3TSPA 4FZXC 3TARA 1S6PA 2CGKA 3F9MA 3ENOA 4M3WA 2E6LA 4DQ8A 3DXKB 2IAJA 3SPYA 3CC7N 3VA3A 3J80O 1F21A 2NRTA 3QFUA 4FSVA 4OVLA 4AM6A 3U4LA 3NCIA 3EE9A 2DFEA 1CZAN 3IDHA 3QLHA 5FROA 3O3GA 4DSKA 4RW6A 4E7KA 4B8AB 3AVIA 4BRFA 4BDPA 1RDDA 3C7NA 3E01A 1SUQA 1NK8A 4ID5A 4YY3K 4DU3A 3KVGA 1NJXA 1Z26A 1IBLK 2KKZA 3DLHA 3OYAA 4DQIA 3DM2A 1FW6A 4CIGA 2LSNA 3T3FA 4ELTA 1KXPA 5FPDA 3OYGA 3SUOA 3QEWA 4IG3A 5ADXH 2O4IA 3H46O 4E1JA 2HBLA 2HNZA 4NLCA 2HHSA 4YOVA 3RSEB 3LM9A 4B1UB 3CERA 3ENBA 4KFBA 1WN7A 5LMUK 5BN8A 2FF6A 3C65A 1TYQA 4BRAA 1RILA 3EZWA 1MU2A 3DJCA 4FWMA 4F4KA 5BREA 1NGFA 1Q86O 3F5TA 4CFBA 4WFNL 1LWCA 1UA0A 3TAGA 2ZGZA 1C1AA 3C6TA 1B92A 5F1XA 4DU4A 4LFCK 3ATUA 2HHWA 3OYLA 3CHWA 3SAFA 1YJ9N 4JRPA 2O8EB 4F3TA 2YJFA 3IFRA 3EYZA 3TSUA 3T69A 4FJIA 3FE1A 3RR7A 4N56A 4IXCA 1WLJA 1ZYQA 2F96A 4EAHD 1KFSA 4GV6A 4HWIA 2OCEA 4L3QA 4DR3K 1HR0K 3SCXA 3Q7CA 3E1YA 1VSEA 3KLGA 3GOIA 3DLKA 2E6MA 4FK0A 2OA8A 3QBXA 1NK0A 5SZTA 1TKTA 4U7BA 4FLYA 2F8TA 4FOEA 1FKOA 2OPQA 3O3FA 2W6KA 1JLCA 1HMVA 5KQDA 3D45A 4FJNA 1WSIA 3SBGA 4FWQA 3AVHA 3VQQA 2P9NA 2NRXA 1XMOK 3CCRN 3FLCO 5FPMA 3PO4A 1VAZA 1JCEA 4NXNK 1BI4A 3A5MC 2UXDK 3RSEA 3VETA 2HHVA 2IGIA 2G8KA 1J5OA 4CF9A 4JN4A 2ZJRL 3EKSA 5GAGP 3DOLA 3OS1A 1HNZK 4DFKA 1NGIA 3U6FA 4M42A 2RE2A 1WOQA 4CEBA 4CI6A 3QIPA 4BY9C 3EN9A 2QA4N 5CY4A 5AR0A 4LFAK 3FFIA 1RDAA 1C0FA 3AO4A 2HMIA 1NOYA 3FZHA 5AQQA 5KTQA 2GWJA 1VQLN 4WE1A 4FJMA 4AHRA 4KRFA 3VGLA 3H45C 5GADP 3PO5A 3F73A 3KK7A 3ZSOA 1UA1A 3ZSQA 5E41A 1C0TA 1ZBUA 5AQUA 3RRHA 2VWKA 4I2PA 3AVCA 4HUGA 1QE1A 4YNQA 2DFHA 4KI4A 5EOYA 5EY4A 4HVJA 1J54A 4JI6K 4MQ3A 1Y64A 1N36K 3L2WA 2OZSA 3NGYA 4FWOA 3VERA 5J2MA 3OYFA 3MCAB 5D3GA 2CGJA 4M63C 4XH1A 4F3OA 1X9JA 3HL8A 4JI2K 3K5NA 2Q97A 4JI7K 1K8KA 5I3UA 2VWJA 4H0VB 4GNIA 3THYB 4MLHA 5AQKA 1BQNA 2VGMA 1VQ9N 5HRRA 3TAMA 3LANA 3CD6N 3CCSN 4JK8A 4IKFA 1J6ZA 3QINA 4QAGA 3KHYA 3KKRA 4CGIA 4K43A 3L4IA 1YJNN 1T05A 3LPTA 4H5RA 4JV5K 3LP3A 2QEXN 3ZT4A 4JI0K 1T7PA 5HOOA 2VCPA 5BPMA 1WBBA 4EP5A 3G71N 2HBKA 3I33A 1C0GA 1NWKA 3HSTB 2HOEA 3RMDA 2E88A 4PHTX 3NF6A 3JXUA 3BGRA 4CECA 3I56N 2HHQA 2O8FB 1XMQK 1S72N 3O4QA 3UKRB 3KD1E 3MEEA 3WT0A 3UB5A 3KLHA 3SPZA 1HYVA 1JCFA 4ISGA 1BQMA 4ISFA 2OYQA 4JK7A 3T1AA 4CJRA 3GE1A 4O8UA 2G8WA 3I0SA 3E9OA 4H5WA 1L3TA 4JKGB 4UY8O 4KBOA 4ZTJA 1YXQA 4C8LA 4KO0A 3D2FB 4DSEA 1A5VA 1MWMA 3NH0A 4CF2A 2E4LA 5LL6Z 3A5LC 2EWSA 4EIAA 4FLZA 3M8QA 3PX6A 3IKMA 3KK2A 2FBXA 2ITMA 5E26A 1FJGK 4WFBL 4BRMA 2Q36A 4CJLA 4DSFA 1SKRA 4RTFD 3LALA 1Q9YA 4FZZA 3H1QA 3PIOL 3K5LA 5E84A 4BWMA 3OTOK 4FXDA 1S5JA 3EO3A 4B9UA 4IJNA 2B6AA 5AQYA 2FF3B 4FJ7A 3LDOA 4JKDA 3ZX3A 2YNIA 4FW1A 3MXJA 5DM7L 4IFYA 1SV5A 3B6OA 3ULEA 3ISNC 1N34K 4CK2A 3MWTA 3IMXA 2X78A 2E1YA 1KVBA 3L3VA 2QI2A 4FJJA 3CQYA 4LH4A 1VQON 1K73O 3QEPA 1BUPA 4BRPA 3UKUB 4A61A 3CJ7A 2GX9A 3ZEUB 1NGEA 1TL3A 1NJWA 3MWPA 1SZ2A 3PX0A 4GKKK 3HI0A 4DLGA 3L4QA 2O8EA 3AO2A 4O4GA 5HRPA 3ATVA 1NGHA 5C24A 1YITN 1VRTA 1X3NA 3LDNA 3FZKA 5I42A 4MO4A 4WYBA 4Z4CA 3LP0A 4I9QA 3HP6A 3HK2A 3VF4A 1X1PA 1VQMN 4M3RA 3OW2M 3BZCA 4C1NI 4C8MA 2ATQA 4I9LA 1TK8A 2W41A 4I7FA 2W42A 4BG8A 3DRPA 4B1VA 3V9XA 4O5FA 4AM7A 4DKWA 3OYCA 4OLAA 2Q31A 3K2PA 3O1WA 4Z4GA 4J2EA 4PQUA 1NKEA 4KHQA 3WXJA 4LH5A 4E1MA 4F8RA 4KHNA 4H4MA 4YOTA 1KAYA 3HZ6A 1GLEG 4I2QA 2PZSA 1HYZA 4RW8A 5KPTA 5F2RA 5GAEP 2YHAA 4K0KK 4NLBA 2QKKA 3WEEA 3CI5A 2WUSA 1A5XA 2P9KB 3R3LA 4DB3A 2Q1NA 2BUPA 3HXMA 3PSIA 3ULEB 1YVUA 4DCHA 1GOBA 2FC0A 4OGEA 2NRVA 2D0AA 2VG5A 4JI1K 1BU6O 3F9KA 1XHZA 4M3ZA 1S3XA 3P31A 5K14A 2A41A 3CCVN 2YNGA 2YX6A 2QWMA 4FOIA 2D0PA 4X62K 1N8RO 3WNEA 3SAHA 2D5RA 4H0OA 1VSMA 3QDKA 4LF4K 4CEOA 2UYTA 3P38A 3MXIA 4PWDA 5CR4A 5JVHL 4CJPA 5EX5A 5C12A 1YF5L 1EO1A 3CFOA 1VSJA 1VSHA 3AA2A 4OLBA 4JAXA 2QXFA 4B1XB 4CZHA 3AAPA 1BIZA 1O13A 4LF8K 2P9UB 3TAPA 3SBTA 3CJCA 4CK1A 2P1JA 1RBTA 2WTUA 3HT3A 1ZC6A 5A2QO 5EVZA 3TTCA 1Y97A 4F2RA 3MEDA 4JNEA 3MMVA 4G1QA 2VYPA 4YOWA 4DV1K 4AHSA 4E7HA 2DY4A 4CD1A 4KI6A 3KWIA 3D2EA 2KHOA 2VQEK 3T19A 4LD0A 3DWLA 3CXCM 2A3ZA 2G8VA 1D9DA 3V9WA 3QEVA 3AGKA 4FJXA 4BQZA 3TANA 4M41A 1LW2A 4F2SA 5KGXA 1ILYA 3NF9A 3ULDA 2UXCK 4FVMA 5HRNA 3CCUN 2FLOA 1L3SA 3M6GA 4Z4IA 5HP1A 2GELA 3NGZA 1VSFA 3BDPA 5CZ1A 4W5OA 1KTQA 1SL1A 3I55N 4IG0A 4E0DA 5BR9A 3V9SA 4B3RK 4FWKA 2VGNA 3W3DA 1SL2A 4AHVA 3O9TA 3L8BA 2E2OA 4DFMA 3C6AA 3RR8A 4DQRA 5HLFA 4KHPK 4JHDA 1WSGA 3LM2A 3LPUA 1NK4A 3NFAA 2BDPA 1E4GT 4B3TK 2NRRA 5JS1A 4CD3A 2D0BA 3NAEA 2A1RA 3VQAA 4OPJA 4FL9A 1SL0A 1VSLA 5IT9O 4PKIA 3AARA 3VGKA 5J2PA 1BOTO 2FSNA 2F9TA 1IKWA 3V1QA 5AZJB 5AQGA 3EE8A 4DQPA 4BROA 4BG9A 1X9SA 2ASPA 4CGGA 1QHTA 1HNIA 5C25A 5GINA 3O08A 5BPLA 1Q18A 4WQ5C 2E2PA 3QNOA 1ZBFA 4MFBA 4DR1K 4FJHA 4B3SK 4DTNA 2IS3A 4GVMA 2V52B 1KAXA 3ID6A 2I7NA 2OTJN 5C42A 3S3NA 5HROA 2OTLN 1VRUA 4ILJA 4J8FA 3CG7A 3MAQA 4NO7A 3IG1A 4DV7K 3CFPA 1WBDA 5KRSA 1JLBA 1S1TA 3SMPA 3NVMA 1YVNA 4QCLA 4YDUC 1QSLA 1T3VA 4FWPA 4FM2A 1S1VA 3F2KA 4FLTA 1ATNA 3H1VX 3ZT0A 1RT4A 2P9UA 4EP4A 3CJ9A 1RNHA 1QSSA 3PSFA 3HPHA 4N41A 2X74A 3NH2A 4CBXA 5JLFA 1KLNA 4KHSA 1JKHA 1GOAA 4CEAA 3DRRA 2RKIA 3MX2A 4CJFA 4FJ5A 2P5GA 4GV9A 3OYNA 1TUYA 4IFEA 2PYLA 2KW4A 3QBWA 3KLIA 4XEIA 4PL7A 1MDUB 3AO1A 1NJZA 1GLCG 4LFBK 2RPIA 1OH6A 1TAUA 2BE2A 4EFHA 3ZLJA 4BRIA 4CFAA 4YFUA 4O0IA 4CESA 1U48A 4M3UA 1RDWX 2DTUA 1QS4A 1NLVA 1ITGA 4WQ5A 4HUFA 2UUBK 3CPEA 4JI4K 4CZKA 2KFNA 4BR2A 3K9JA 1J5EK 4Q5VA 3AA3A 1VQ6N 2GTDA 1QHAA 3KTQA 4E7JA 3HPOA 5TKWA 1MWKA 2YNFA 1P8ZA 2IVNA 4C23A 1Q8IA 3AVLA 4W5TA 3PX4A 4M7YA 3DRSA 1RTDA 1GLJO 5C10A 3JS6A 5AJ3K 2BTFA 1XUPO 3LAKA 3J7AP 2XY5A 3M8SA 1WSEA 1CLQA 4CJ3A 1YHQN 3DXMB 2D1KA 3TTDA 4CK3A 5GAHP 4DTMA 4DLEA 2P9SB 2HHTA 1X9WA 3AVNA 2I5JA 2WOMA 1KD1O 3L2QA 1NMNA 1QQCA 2E1ZA 4TSXA 1R0AA 4BREA 1RT2A 1DTTA 3KKSA 2HBMA 2RN2A 1KVCA 4LF7K 2HVHA 3AVBA 3FZMA 3K5OA 5M1KA 3VQDA 4KHUA 1WAJA 4OPAA 3HO1A 1XNQK 5C0YA 3CM5A 4H5NA 4OKEA 3TABA 1OH7A 1BA1A 3OJSA 4CHZA 4FM0A 3GG4A 4H0TB 5FRNA 3CMAN 2NRZA 2NLXA 3AA4A 3G10A 5I9EB 4O5BA 5AFUA 4DTPA 2I7PA 2BGGA 4B3MK 3J7ZO 3BF3A 1QZ5A 4WQ4C 1U4BA 4DV3K 3PLAA 4DTRA 1U2VB 5ELZA 2UUAK 3RVCA 4CJ5A 4BR7A 4E89A 2XY7A 2PFUA 2AP1A 3U9ZA 4ISEA 3NVKA 3HYFA 3R9PA 1S6QA 2FXUA 2EHGA 4GVEA 4NCGA 5AQZA 4JLHA 2YJEA 3EEQA 4O0JA 1S9GA 4YHHK 3HTVA 4B1ZA 4IO8A 4EHUA 1TKZA 3QMLA 1YT3A 2HVIA 3THWB 4DTJA 1IKYA 3OYHA 1KRPA 1NM1A 2P9IB 3MN6A 2ZWHA 5LY3A 1OVQA 2OANA 1QVFM 4CBUA 3C0BA 3MN9A 1IG8A 3B6PA 4BRGA 4X64K 1NJYA 4DV5K 3DYAA 4KB0A 3SZ2A 2E20A 1R59O 5C2FA 3A5OC 4FVUA 2ZD1A 1W2BM 1HJRA 3CJ1A 1DT9A 3OBYA 3MDQA 3ZSVA 3TAQA 1NG9A 3THYA 1DLOA 2KQ2A 3VF6A 3HOTA 4MDAA 1RBUA 4H0XB 3ZCMA 4HTLA 2PBDA 1NU0A 4CFCA 4DU1A 3CPWM 3LDSA 1BL3A 4BWJA 3NGIA 4H5TA 1EQYA 1NKCA 1CZBA 3VA0A 1T6DA 1K9MO 3ZT3A 4A2AA 4RW7A 3K57A 1C1CA 2XRIA 3K0SA 3OYIA 2IDOA 3O9SA 3M3ZA 3QICA 4K8ZA 4IDHA 3LDQA 4AHTA 2ETJA 4GW6A 3T1YK 4DF8A 2YNHA 1TV6A 4CIFA 4K42A 2NRHA 3SQ4A 3O9RA 4B3OA 4FYDA 3VPZA 3O9QA 1EKEA 4IOCL 5TKYA 2O8BA 4OPKA 3TTFA 3L2UA 2E2NA 4FJ8A 2D4WA 3OYKA 3L6QA 3TAEA 3IS9A 4RW4A 3IAYA 1VSIA 4B9SA 3O80A 2UU9K 3DLLL 2QWQA 5KGWA 2IVPA 4DV0K 4NYFA 3UKRA 4BRQA 3DAWA 3DMJA 4DF4A 3U9DA 1HRHA 5FDLA 4OX9K 4LF6K 3CCLN 2Z1JA 1NGGA 1NGDA 1RTJA 3G4SN 4GY2B 4HCCA 1MA9B 3JSMA 5BPNA 4CF0A 3C94A 1C1BA 2ITGA 3L0QA 3VN5A 4KTQA 4CJ4A 4FWLA 1M90O 2VG6A 3VEYA 2YI1A 4OKJA 4FWRA 4B8CA 2G8UA 4B9TA 1QSYA 4DTSA 2Z1IA 4BR9A 4E7LA 4K41A 1TUUA 5T7BA 3TSQA 4FJLA 1RTIA 3KK1A 5ADXA 4E1NA 3MXMA 5M1QA 1LW0A 3ZETB 2VWBA 4QS7A 4CZJA 3VEWA 5M1FA 3ID8A 2O8CB 1HKCA 3VENA 1NK5A 1U49A 1IKXA 2AA4A 4BRDA 1BI4B 4FLXA 4LSLA 1ASUA 3AY9A 5C2DA 1RT1A 1TVRA 1P90A 3G25A 3FZLA 3OHRA 3AGRA 1T6CA 4AILC 2WBNA 1ATRA 4FM1A 5FPEA 3V1RA 4FK2A 1T44A 1RT3A 4F9OA 3ZSYA 4FPBA 1EX4A 4JKEA 4KKOA 4ILHA 4CEFA 4G9ZA 5JMVA 3E66A 4FCYA 2P5OA 1NBWA 4FLWA 3QFPA 1I94K 1KFDA 3CCMN 1Q81O 4DWIA 3MEGA 3T7ZA 1M1KO 3KLFA 3V6DA 3AO3A 3SYZA 3M8RA 5AQTA 1NJIO 4KTWA 1XQSC 2QWRA 3NF7A 3CMEN 2HMPA 4YORA 2KLAA 2V7YA 1YAGA 5J2QA 3EL2A 3ZEUA 5HRSA 3C6UA 1IKVA 3K5MA 3OY9A 5KRTA 4DS5A 4CJVA 4HUEA 4J2DA 4JK9A 5MLCQ 1IBKK 4CJKA 2HF3A 3LDLA 3I8DA 4B9QA 3HRGA 3KIOA 1HPZA 1V4SA 3VTIA 2G8FA 4H4OA 1VQPN 2QXLA 4CEDA 1VK0A 5DM6L 4CF1A 1BO5O 3IRXA 3WEEB 2ZM6K 4BDZA 4BC4A 4C8NA 4BC2A 3THXB 1OVYA 4K8XA 4M45A 2A5XA 2FBVA 2DFFA 1RBSA 3ASMA 2ZJQL 1VSDA 3RMCA 4X66K 4NB4A 3S41A 4BR5A 1TL1A 4HTUA 1Q7YO 2NUBA 3MN7A 3CC2N 3IUCA 3S3OA 1NK7A 3AO5A 4XIUA 3V81A 5AQIA 5LMNK 1BCMA 2NZTA 4PKHA 1HNWK 4BR0A 4BDYA 3HBTA 1IV0A 3WQTA 1JLEA 4CE9A 3PUFA 1HQUA 1SKWA 2E8AA 4BE2A 4B9MA 1HNXK 3AVJA 4DUYK 4XH5A 4N5SA 3D2FA 1VSKA 3JYTA 4DTUA 3CFRA 4BRNA 1RT7A 3VQCA 1JXBA 3TU5A 1S1WA 1TKXA 3I0RA 1D8YA 1NGBA 4KV8A 1JL1A 2QWOA 2XHBA 3O1BA 4KH6A 3L3UA 4RWTA 4JKGA 3OS2A 4ZHRA 3VGMA 3MECA 3AVGA 4FWNA 4DG1A 1JCGA 2Q0RA 3E9LA 4H5VA 4JKAA 3SK3A 4YOUA 2ASMA 3LZIA 1SKSA 4DSIA 4CGFA 1OKJA 1LWFA 3P1GA 1BDGA 3NBPA 3DXMA 1S9EA 2F8SA 1I39A 3N4QA 3SLCA 1E4FT 2PY5A 4FW2A 2HNYA 2IC3A 4IOXA 3AVKA 4ILGB 2P9NB 4CZGA 3SJJA 3QESA 3A5NC 1XI1A 3QIOA 3M1FA 3T1HK 4DSJA 3ZT2A 3TAFA 4Q0BA 3CM6A 2A6AA 5CYQA 3GDQA 4DMNA 2GUIA 2QWPA 1VQ7N 2NNWA 1BHLA 1Q82O 3VEOA 4W5QA 3THXA 1RCHA 2O8BB 4DR7K 5EU7A 3AVAA 5CHIA 5AQLA 4KHWA 1T8EA 1RGIA 3VQ7A 2YHXA 2ZF5O 1Q9XA 4JYAK 1G15A 3SMSA 2HW3A 3KD5E 1IG9A 4CIEA 1EXQA 4GKJK 1KCFA 5IWAK 4GMJB 3J7YP 4Y1CA 5KPZA 3O9UA 3SV3A 2Y1IA 3CQXA 1KLMA 1YJWN 1YUWA 1SQKA 2P9LB 3SV4A 1ZBIA 3SJHA 2GBZA 2QWNA 2ZQBA 1YTAA 4CZLA 3C95A 1UAXA 4ZTFA 4FJKA 2XO7A 5J2NA 4H03B 2CH6A 4M3YA 1HPMA 5FRMA 3EZ5A 4CJ7A 4CW7B 4YDUA 1RTHA 2QK9A 1BGXT 2CH5A 4DV6K 4PA1A 4DTXA 1GLLO 3CCJN 1XC9A 3U3GA 3P4IA 4B9NA 1QVGM 5LJWA 3FGUA 4HCBA 2JGUA 3THVA 1EWRA 4O55A 4JD2A 1W97L 3PIPL 2HHHK 2WFBA 4CJQA 2YHYA 1Z6RA 1K8KB 3C6HA 2WC9A 3ZYYX 3QB0A 2HHXA 3M8PA 1IBMK 5BRFA 4DR4K 2H3GX 4CJSA 3JAMO 2OPSA 2W6LA 3HOSA 3QEIA 4CZMA 1KC8O 1REVA 1X3MA 2F9WA 4DFJA 2B4JA 4BVPA 5FPNA 1LOTB 4BRHA 2EX3A 4YOYA 3P83D 3SUNA 1HKGA 3DI6A 4E7IA 1C6VA 4DR5K 1WB9A 4CHOA 1TGOA 1WUAA 2X6SA 1D4XA 2ZE2A 4M3TA 5GIPA 3BF1A 4B1YB 4KREA 4BC3A 3P39A 2KZZA 3V9ZA 1JJ2M 5GIOA 2O8FA 3SUPA 3SQ1A 3A2FA 2O8DB 4JRQA 4NCBA 1KAZA 1OH5A 2UXBK 3O6WA 4A57A 4BE0A 4PUOA 4IBNA 4Y0WA 4KPYA 3WQUA 4FLUA 3RRGA 1VQKN 3WNGA 5M1OA 3R6MA 4BGAA 2YHBA 4A5AA 3O5BA 4HHTA 3LZJA 2GWKA 4JI3K 1RT5A 4IJAA 4J2AA 3BY5A 3P5JA 1VQ8N 4JHDB 1QQNA 1WSJA 3O8MA 4IZ9A 3DLEA 1KVAA 4QS8A 2P51A 4B9VA 4LY7A 3AAQA 3QEXA 4DQQA 3S3MA 4QOZB 1S1XA 3HVTA 3W0LA 5M1PA 4WFAL 3GBTA 2ZGYA 1H1VA 1VQ5N 4XH4A 2ZJPL 3FFKB 4CHQA 4B08A 1C0MA 1BIUA 2J4RA 3CCQN 3OVNA 2VQFK 1CXUA 1FK9A 4JKCA 1D5AA 4E3SA 3D6RA 2P9PA 4UQGA 2Z1GA 3O3HA 5FLXO 2JWKA 2YHWA 1ZBSA 2D0OA 3CYMA 3K9KA 4BRKA 1BWFO 4KHYA 2Q3SA 3NH1A 1LAWA 1U6ZA 5JVGL 1HQEA 3MCPA 1RBRA 2GUPA 4E19A 2P9SA 3ZSRA 1RDCA 1HYSA 1HLUA 4BRLA 4W5NA 1B9DA 2YKMA 1OH8A 1GLFO 4CCHA 1FKPA 5AQRA 2QW9A 2NRWA 4EHTA 3AVFA 4FZYA 5JS2A 4CVNE 4DUZK 1JLGA 1DEJA 3CC4N 2G8HA 1U2VA 4FJ9A 5H1SQ 2RF2A 2PAVA 3K59A 2Q2RA 3Q7BA 2RHKA 3WNFA 3HM9A 3TI0A 2IIRA 3ALYA 3FR0A 1GLBG 3SUQA 4V19S 4O44A 4CZFA 3SAGA 5EXWA 4C1NK 3DLRA 1JL2A 1CXQA 1ATSA 3DOKA 3VQPA 3NHGA 4NXMK 3H3OB 4CJTA 1JXEA 1WAFA 1S1UA 2WONA 1QQMA 3J81O 1NOZA 2QM1A 3TR8A 4CBWA 4BVOA 5BR8K 4KTZA 4N47A 2FBYA 3AA5X 1LCUA 3ZETA 1SAZA 3K58A 1TKDA 4QS9A 2O4GA 3WXIA 3VESA 3A0IX 1V4TA 4WCEL 1NK9A 3BUZB 1IH7A 1VQ4N 2E2QA 2P9IA 4KB1A 1RDBA 5AZIA 2ASOA 3UE5A 4JS5A 4J2BA 1J9AA 4FK4A 1TK5A 4B1WB 4JS4A 2F4VK 4H8KA 4AHUA 4CEQA 3HM8A 2G8IA 3EKUA 3KK3A 1ZBLA 3V1OA 4CHNA 1X9MA 3L2VA 3VEVA 5JLHA 2KFZA 4CERA 5LJVA 4PKGA 1HJOA 4DHYA 3ZX2A 5C15A 1BA0A 4GV3A 4CF8A 3SNNA 4CJEA 1KQSM 4Z4HA 3THWA 3VOVA 3VQBA 2JWLA 2P9LA 3SQ0A 3SQ2A 5KI6A 4N76A 1K6YA 3BZKA 4JD2B 2GEMA 2W40A 4KAZA 1QQOA 4BQLA 4DV2K 4DV4K 3VEXA 1QTMA 4DR2K 1RBVA 2PYJA 3OYJA 3CCEN 5J1EA 4DFPA 3QETA 4MO5A 2QKBA 4OPHA 3L2RA 4B9LA 4BRCA 2YCHA 4WQ4A 1CZ9A 1WSFA 4JKFA 3E9PA 3KZBA 4KH5A 5CE3A 4BR4A 1U47A 2HBJA 3G6EN 3UKUA 3WXMB 5AQOA 5AQMA 4NYNA 1D9FA 1WNSA 1Z25A 4X65K 1RFQA 3MN5A 2IVOA 3VQ4A 3OBWA 3S9HA 4EZ9A 1EETA 3RTVA 1GLDG 1VQNN 4CFDA 4DR6K 4C8OA 2CGLA 4Z4EA 1SS6A 4A2BA 4L8RB 1W9HA 3ZSXA 4RW9A 2OZMA 3ZSZA 3SI6A 4O8KA 4Z4FA 1B9FA 4W5RA 1S22A 3HP9A 1NMDA 3D0PA 3G0ZA 3CJBA 3VQ6A 5CYMA 4RG8A 2OPRA 4CGHA 3DXKA 4K25A 1XHXA 1NKBA 3WXKA 1YIJN 3VQEA 2JLEA 2GV9A 2O8DA 1E3MA 4CHPA 5KQ8A 3D7EO 4ID1A 1I3AA 2YV0X 1JLQA 2Z1HA 3HJFA 2BANA 1L3UA 4AF1A 3HVRA 1DKGD 3FZFA 1U45A 4IFVA 4YOXA 3C7NB 4CGDA 3WUHA 3KJVA 3H08A 4I6MA 5SWMA 4Z94A 3H6EA 2B5JA 4JKBA 5BRHA 3OYDA 3N4PA 3ZX0A 2D0CA 3NDKA 2IOCA 2XY8A 3UIQA 1JLAA 5CZ2A 4ELVA 2O8CA 3J8AA 4ELUA 3HPGA 1IJJA 3O4WA 2HF4A 3NF8A 4OJRA 3TPQA 3VQ8A 1YTUA 1C0UA 3CJAA 1XC3A 3U3YA 4R79A 5HBMA 2DPNA 1IO2A 1G99A 2Q0UA 2FSKA 3OS0A 3VF2A 3DLBA 3CIPA 3RMBA 4FWSA 1NK6A 1ASVA 2OPPA 2A40A 4C8KA 1UWBA 3OYBA 2V7ZA 3QNNA 4H0PA 4DSLA 1J53A 4ICLA 4MLEA 1GLAG 5AQSA 3R1XA 4WF9L 1N32K 1UOCA 4RCHA 5DK5A 5M1NA 3RMAA 1TK0A 4LF5K 3LDPA 1JLFA 3VQ5A 1N6QA 3VTHA 4JI8K 4CZIA 4Z0UA 5AQNA 4CZEA 2AJQA 3M5RA 5AQPA 1DTQA 4IEIA 1EWQA 2HSTA 1GOCA 1O1WA 4IWVA 3NMUA 3LP2A 3R8EA 3GL1A 1L3VA 4IEEA 4CHYA 5AZJA 1XWLA 1W7AA 3ITHA 3V9UA 3LP1A 3PV8A 4IDKA 4BACA 3BEXA 4MDBA 1YI2N 4A59A 3QERA 3OJUA 1RDUA 1LWEA 4U67L 4FJGA 1HNVA 4DTOA 1BISA 3ZSWA 3AV9A 2E5LK 4JI5K 5AZIB 4LF9K 5DMRA 4OKKA 4OGCA 3CQ8A 1BCOA 4CEEA 3LWMA 2KZMA 5AQXA 3RWUA 2YKNA 1Z05A 2X6NA 3AVMA 3WXLA 3MK6A 4M7XA 5KPRA 1LV5A 5F0XA 2FSJA 2XY6A 3DLGA 2QWLA 3CETA 4BGBA 3H3NO 3OA9A 3I8BA 3PY8A 3LL3A 4AQYK 3D2EB 1QZ6A 1N5YA 1ESVA 4Y1DA 2F7TA 2QTDA 3OYEA 4CJUA 5B8HA 4IOAL 1TYQB 4H0YB 1HKBA 3VEZA 1W0HA 4JEPA 2BH1A 2HHUA 2UUCK 1RT6A 2P9KA 4KH4A 5AQWA 4I6MB 2HB5A 3WNHA 1HX1A 1KSPA 3BP8A 1LAVA 3CF5L 4EZ6A 2FBTA 3U8XA 3VQ9A 4R5PA 1L5UA 4NCAA 4IO9L 3A8YA 2KTQA 1TAQA 4DS4A 3V4IA 5BRDA 4CGJA 4CJWA 1FXXA 1NNEA 1T03A 2P9PB 3QO9A 2VG7A 2A42A 3NE6A 3HSCA 1BG3A 4BC5A 2Y1JA 4FPAA 1DGKN 5AQJA 5BN9A 4FO0A 1A5WA 1NGAA 3O4NA 3EY1A 3B8AX 5AQVA 3ZT1A 1N33K 4PY5A 3KLEA 4LC9B 1EP4A 4A5BA 3MX5A 4AH9A 1NGJA 2V51B 4JKHA 1K8AO 3TWHA 4M3XA 5JICA 3OYMA 4BE1A 1ZBHA 4AHCA 5AQHA 4CEZA
chains in the Genus database with same CATH topology
1NGCA 3O80A 5AQFA 2NRVA 5HL7L 4A62A 1HUXA 3KWGA 1BU6O 2QWQA 4PL8A 3DLLL 2IVPA 3W0LA 5M1PA 3UKRA 4BRQA 1S3XA 3P31A 2A41A 3GBTA 4WFAL 2ZGYA 1H1VA 3CCVN 1VQ5N 4XH4A 2ZJPL 3FFKB 2YX6A 3DAWA 4OO1J 2J4RA 1ZXOA 3VMFB 3CCQN 5AFUH 3ENHA 2QWMA 3U9DA 3TSPA 4FOIA 2D0PA 4JKCA 1N8RO 3SAHA 3D6RA 3CCLN 2P9PA 4H0OA 1NGGA 1NGDA 2JWKA 2CGKA 3QDKA 3G4SN 3F9MA 4GY2B 2YHWA 1ZBSA 3ENOA 2D0OA 1MA9B 2UYTA 5BPNA 3P38A 3K9KA 4DQ8A 3DXKB 4BRKA 5CR4A 5JVHL 1BWFO 3CC7N 3L0QA 5EX5A 1U6ZA 2NRTA 4FSVA 3QFUA 4AM6A 3MCPA 5C12A 3U4LA 2GUPA 5JVGL 2P9SA 3EE9A 1YF5L 1EO1A 1CZAN 3IDHA 1HLUA 4FWLA 4BRLA 3VEYA 1M90O 2YI1A 1GLFO 4FWRA 5AQRA 2QW9A 4BR9A 4JAXA 4K41A 1TUUA 2NRWA 4BRFA 4EHTA 4B1XB 4CZHA 3AAPA 3TSQA 3C7NA 1O13A 5ADXA 3KVGA 5M1QA 3ZETB 2KKZA 2VWBA 2P9UB 3SBTA 4QS7A 1DEJA 3CC4N 1U2VA 4CZJA 3CJCA 3VEWA 1KXPA 5H1SQ 5M1FA 2PAVA 3ID8A 5FPDA 2Q2RA 3Q7BA 1HKCA 1ZC6A 5ADXH 3VENA 2RHKA 3H46O 2IIRA 3FR0A 2AA4A 4E1JA 2HBLA 4BRDA 5EVZA 1GLBG 3TTCA 4NLCA 4YOVA 3RSEB 3LM9A 4B1UB 3AY9A 3CERA 4JNEA 5C2DA 3MMVA 4YOWA 2VYPA 3ENBA 4CZFA 3SAGA 1P90A 3G25A 4CD1A 5EXWA 5BN8A 4C1NK 2FF6A 3C65A 1TYQA 3FZLA 3OHRA 3AGRA 1T6CA 3KWIA 3D2EA 1ATSA 2WBNA 4BRAA 1ATRA 2KHOA 3CXCM 3DWLA 3EZWA 2A3ZA 3DJCA 4FWMA 3H3OB 5BREA 5FPEA 1NGFA 1T44A 1Q86O 3AGKA 3F5TA 1QQMA 4F9OA 4BQZA 4FPBA 2QM1A 4JKEA 4WFNL 4ILHA 4G9ZA 5JMVA 3E66A 4CBWA 1NBWA 3QFPA 4BVOA 3CCMN 2ZGZA 1Q81O 1ILYA 1LCUA 3T7ZA 1M1KO 3ZETA 1SAZA 5F1XA 5AQTA 3ATUA 2FLOA 3CCUN 1NJIO 4QS9A 1XQSC 3VESA 3WXIA 2QWRA 3A0IX 3M6GA 3CMEN 1V4TA 2HMPA 2GELA 3BUZB 3CHWA 4YORA 2KLAA 2E2QA 2P9IA 4WCEL 2V7YA 1YAGA 3SAFA 1VQ4N 5AZIA 2ASOA 3UE5A 3I55N 3EL2A 3ZEUA 2YJFA 4B1WB 3IFRA 5BR9A 3TSUA 3T69A 3FE1A 4FWKA 3HM8A 2VGNA 3EKUA 3W3DA 4IXCA 3O9TA 4JK9A 5MLCQ 2HF3A 3LDLA 4B9QA 2E2OA 3HRGA 3VEVA 4EAHD 5JLHA 1V4SA 3VTIA 5LJVA 3C6AA 4GV6A 4HWIA 4PKGA 4L3QA 1VQPN 3Q7CA 1HJOA 3E1YA 4DHYA 3ZX2A 5C15A 1BA0A 3GOIA 4GV3A 4JHDA 2QXLA 3LM2A 5DM6L 1KQSM 1E4GT 3QBXA 2NRRA 4U7BA 1BO5O 3VOVA 3WEEB 4CD3A 4FOEA 2JWLA 2P9LA 4FL9A 4JD2B 4BC4A 4BC2A 2GEMA 2W40A 1QQOA 4BQLA 1OVYA 3VEXA 5KQDA 3SBGA 2A5XA 4FWQA 4PKIA 3CCEN 3AARA 3VGKA 1BOTO 2FSNA 2NRXA 2P9NA 4MO5A 2F9TA 2ZJQL 3FLCO 4OPHA 5FPMA 3CCRN 1VAZA 1JCEA 4NB4A 3A5MC 4BRCA 2YCHA 4WQ4A 3RSEA 3VETA 5AZJB 5AQGA 3EE8A 4JKFA 3S41A 4BR5A 3E9PA 3KZBA 4BROA 4KH5A 4BG9A 5CE3A 2ASPA 4JN4A 2ZJRL 1Q7YO 4BR4A 3MN7A 3CC2N 5GINA 3O08A 2HBJA 3EKSA 5GAGP 3IUCA 5BPLA 3G6EN 1NGIA 1Q18A 2E2PA 4WQ5C 5AQIA 5AQOA 5AQMA 3UKUA 2RE2A 3WXMB 1WOQA 2NZTA 4PKHA 4CI6A 4BY9C 1RFQA 3MN5A 4BR0A 2IVOA 2V52B 3HBTA 3WQTA 1KAXA 3EN9A 2I7NA 3ID6A 2QA4N 2OTJN 3OBWA 5AR0A 2OTLN 1C0FA 1GLDG 2E8AA 4ILJA 4J8FA 1VQNN 3FZHA 5AQQA 4NO7A 2GWJA 1VQLN 2CGLA 1SS6A 4XH5A 4A2BA 3D2FA 3H45C 3VGLA 5GADP 3SMPA 3KK7A 1YVNA 3NVMA 4YDUC 4BRNA 1T3VA 4FWPA 4O8KA 3TU5A 3F2KA 5AQUA 1ATNA 3H1VX 1S22A 1NMDA 1NGBA 2P9UA 3CJBA 5EOYA 2QWOA 3CJ9A 5EY4A 3O1BA 4KH6A 3DXKA 4K25A 1Y64A 4CBXA 4RWTA 3WXKA 5JLFA 1YIJN 4JKGA 4FWOA 3MX2A 3VERA 3VGMA 4FWNA 1JCGA 4GV9A 2Q0RA 5KQ8A 1TUYA 3E9LA 3D7EO 4IFEA 3MCAB 4H5VA 4JKAA 2CGJA 3QBWA 4M63C 4XH1A 4YOUA 3SK3A 2ASMA 1X9JA 4XEIA 1OKJA 2Q97A 4AF1A 4PL7A 1K8KA 1DKGD 1MDUB 1GLCG 4H0VB 1BDGA 3FZFA 3DXMA 4GNIA 4EFHA 4YOXA 3C7NB 4MLHA 3WUHA 3N4QA 5AQKA 4BRIA 4I6MA 3SLCA 2VGMA 4Z94A 3H6EA 4JKBA 1VQ9N 5BRHA 1E4FT 3N4PA 3ZX0A 1RDWX 3CD6N 1NLVA 3CCSN 4IOXA 4JK8A 4WQ5A 1J6ZA 4ILGB 3CPEA 4CZKA 4BR2A 2P9NB 3K9JA 3J8AA 4CZGA 3KHYA 4K43A 3L4IA 1YJNN 1IJJA 3A5NC 4H5RA 1VQ6N 2GTDA 3O4WA 1QHAA 3M1FA 2HF4A 3TPQA 2QEXN 5TKWA 1MWKA 1P8ZA 2IVNA 4C23A 5HOOA 3CJAA 1XC3A 2A6AA 2VCPA 3GDQA 4R79A 4M7YA 2DPNA 1G99A 2Q0UA 2QWPA 1VQ7N 2NNWA 1GLJO 5BPMA 1Q82O 3G71N 2HBKA 3VEOA 2FSKA 5C10A 3JS6A 3I33A 1C0GA 1NWKA 2HOEA 2BTFA 3VF2A 1XUPO 3CIPA 5CHIA 5AQLA 2E88A 4PHTX 4FWSA 2A40A 1YHQN 3JXUA 1RGIA 3DXMB 2D1KA 2V7ZA 2YHXA 2ZF5O 3TTDA 4H0PA 3I56N 5GAHP 2P9SB 4MLEA 1S72N 3SMSA 3UKRB 1KD1O 1GLAG 3WT0A 3UB5A 5AQSA 3R1XA 2E1ZA 4WF9L 1JCFA 4ISGA 4RCHA 4BREA 4ISFA 5M1NA 4JK7A 5KPZA 3O9UA 2HBMA 3LDPA 3VTHA 4CZIA 3GE1A 4O8UA 3CQXA 5AQNA 4CZEA 3M5RA 1YJWN 5AQPA 3E9OA 1YUWA 1SQKA 4H5WA 4JKGB 2P9LB 3FZMA 3SJHA 4IEIA 5M1KA 2HSTA 2QWNA 4KBOA 4UY8O 4CZLA 4OPAA 4IWVA 3NMUA 5C0YA 1YXQA 4H5NA 3D2FB 3R8EA 1BA1A 3GL1A 4IEEA 5AZJA 1MWMA 4H03B 2CH6A 3GG4A 4H0TB 1HPMA 3A5LC 3CMAN 2EWSA 2NRZA 4EIAA 4CJ7A 2NLXA 3IKMA 4YDUA 2CH5A 2ITMA 5I9EB 5E26A 3BEXA 4MDBA 4BRMA 2Q36A 4WFBL 1YI2N 1GLLO 4A59A 3CCJN 5AFUA 3P4IA 2I7PA 4RTFD 1RDUA 3H1QA 1QVGM 4U67L 3PIOL 5E84A 3J7ZO 5LJWA 3FGUA 3EO3A 3BF3A 4IJNA 5AQYA 1QZ5A 4WQ4C 4JD2A 5AZIB 1W97L 2FF3B 3PIPL 3LDOA 4JKDA 3PLAA 1U2VB 2WFBA 2YHYA 5ELZA 3RVCA 1Z6RA 3ZX3A 1K8KB 4BR7A 3C6HA 5DM7L 2PFUA 2AP1A 2WC9A 5AQXA 3U9ZA 3ULEA 4ISEA 3ZYYX 1Z05A 3NVKA 3R9PA 3QB0A 3MWTA 2FXUA 3IMXA 3WXLA 4GVEA 5AQZA 3MK6A 4M7XA 5KPRA 2YJEA 5BRFA 5F0XA 2FSJA 2H3GX 2E1YA 2QWLA 2QI2A 3CETA 3CQYA 3HTVA 4BGBA 3H3NO 3OA9A 3HOSA 3I8BA 4IO8A 4B1ZA 1VQON 4CZMA 1BUPA 1K73O 3LL3A 3UKUB 4A61A 4BRPA 3CJ7A 4EHUA 1KC8O 1X3MA 2F9WA 3QMLA 2GX9A 3D2EB 1QZ6A 3ZEUB 1NGEA 1ESVA 3MWPA 1SZ2A 2F7TA 1NM1A 2P9IB 2QTDA 3HI0A 3MN6A 2ZWHA 5LY3A 4BVPA 5FPNA 1LOTB 3L4QA 4BRHA 5B8HA 4YOYA 4IOAL 1TYQB 2OANA 1HKGA 4H0YB 4CBUA 1QVFM 3C0BA 1HKBA 3MN9A 3VEZA 1IG8A 3ATVA 1NGHA 4BRGA 1YITN 4JEPA 2BH1A 1X3NA 3LDNA 3FZKA 2E20A 1R59O 2P9KA 4KH4A 4MO4A 4WYBA 5C2FA 3A5OC 4FVUA 5AQWA 4I6MB 1W2BM 1WUAA 1HX1A 3CJ1A 1D4XA 1DT9A 3BP8A 3MDQA 3OBYA 3VF4A 1VQMN 5GIPA 3BF1A 3VF6A 4B1YB 3CF5L 3HOTA 4MDAA 4H0XB 4HTLA 4BC3A 3P39A 3U8XA 3OW2M 2PBDA 4IO9L 3A8YA 4C1NI 3CPWM 1JJ2M 5GIOA 2W41A 4H5TA 4BG8A 4B1VA 1EQYA 5BRDA 4O5FA 1T6DA 1K9MO 4AM7A 4A2AA 4DKWA 2Q31A 1YJ9N 3O1WA 1KAZA 3O6WA 4A57A 2P9PB 3O9SA 3M3ZA 3QICA 3WXJA 2A42A 3HSCA 4Y0WA 1BG3A 4YOTA 3WQUA 4BC5A 4FPAA 4IDHA 1DGKN 3LDQA 1KAYA 5AQJA 5BN9A 3HZ6A 1GLEG 4FO0A 1NGAA 1VQKN 4K42A 2NRHA 5M1OA 3O9RA 3R6MA 3B8AX 4BGAA 5AQVA 3VPZA 5KPTA 3O9QA 5F2RA 5GAEP 4A5AA 3O5BA 4LC9B 4NLBA 4IOCL 5TKYA 2GWKA 4A5BA 3MX5A 3WEEA 3TTFA 3CI5A 2WUSA 4IJAA 2E2NA 2P9KB 2D4WA 1NGJA 2V51B 4JKHA 4JHDB 3R3LA 1QQNA 1K8AO 1VQ8N 3L6QA 4IZ9A 3O8MA 4DB3A 5JICA 2Q1NA 4QS8A 2BUPA 5AQHA 3AAQA 3ULEB 4DCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGC A;  3O80 A;  5AQF A;  4A62 A;  1HUX A;  1BU6 O;  2QWQ A;  4PL8 A;  2IVP A;  3W0L A;  3UKR A;  4BRQ A;  1S3X A;  2A41 A;  3GBT A;  2ZGY A;  1H1V A;  4XH4 A;  3FFK B;  3DAW A;  2J4R A;  1ZXO A;  5AFU H;  3ENH A;  2QWM A;  3U9D A;  4FOI A;  2D0P A;  2P9P A;  4H0O A;  1NGG A;  1NGD A;  2CGK A;  3QDK A;  3F9M A;  4GY2 B;  2YHW A;  1ZBS A;  3ENO A;  2D0O A;  1MA9 B;  2UYT A;  5BPN A;  4DQ8 A;  3DXK B;  4BRK A;  1BWF O;  3L0Q A;  5EX5 A;  1U6Z A;  4FSV A;  3QFU A;  4AM6 A;  3MCP A;  3U4L A;  2GUP A;  2P9S A;  1CZA N;  3IDH A;  1HLU A;  4FWL A;  4BRL A;  3VEY A;  2YI1 A;  1GLF O;  4FWR A;  5AQR A;  2QW9 A;  4BR9 A;  4JAX A;  4K41 A;  1TUU A;  4BRF A;  4EHT A;  4B1X B;  4CZH A;  3AAP A;  3C7N A;  5ADX A;  3KVG A;  3ZET B;  2VWB A;  2P9U B;  4QS7 A;  1DEJ A;  1U2V A;  4CZJ A;  3CJC A;  3VEW A;  1KXP A;  2PAV A;  3ID8 A;  5FPD A;  2Q2R A;  1HKC A;  1ZC6 A;  5ADX H;  3VEN A;  3H46 O;  2IIR A;  3FR0 A;  2AA4 A;  4E1J A;  4BRD A;  5EVZ A;  1GLB G;  3RSE B;  3LM9 A;  4B1U B;  3AY9 A;  3CER A;  4JNE A;  3MMV A;  2VYP A;  4CZF A;  3G25 A;  4CD1 A;  5EXW A;  5BN8 A;  2FF6 A;  1TYQ A;  3FZL A;  3OHR A;  1T6C A;  3D2E A;  1ATS A;  4BRA A;  1ATR A;  2KHO A;  3DWL A;  3EZW A;  2A3Z A;  3DJC A;  4FWM A;  3H3O B;  5BRE A;  5FPE A;  1NGF A;  1T44 A;  1QQM A;  4F9O A;  4BQZ A;  4FPB A;  2QM1 A;  5JMV A;  4CBW A;  1NBW A;  3QFP A;  4BVO A;  2ZGZ A;  1LCU A;  3ZET A;  1SAZ A;  5F1X A;  5AQT A;  3ATU A;  2FLO A;  4QS9 A;  1XQS C;  3VES A;  3WXI A;  2QWR A;  3A0I X;  3M6G A;  1V4T A;  2HMP A;  2GEL A;  3BUZ B;  3CHW A;  2E2Q A;  2P9I A;  2V7Y A;  1YAG A;  5AZI A;  2ASO A;  3UE5 A;  3EL2 A;  3ZEU A;  2YJF A;  4B1W B;  3IFR A;  5BR9 A;  3FE1 A;  4FWK A;  3HM8 A;  3EKU A;  3W3D A;  4IXC A;  2HF3 A;  3LDL A;  4B9Q A;  2E2O A;  3VEV A;  4EAH D;  5JLH A;  1V4S A;  5LJV A;  4HWI A;  4PKG A;  4L3Q A;  1HJO A;  4DHY A;  3ZX2 A;  1BA0 A;  3GOI A;  4JHD A;  2QXL A;  3LM2 A;  1E4G T;  3QBX A;  1BO5 O;  3VOV A;  3WEE B;  4CD3 A;  4FOE A;  2P9L A;  4FL9 A;  4JD2 B;  4BC4 A;  4BC2 A;  2GEM A;  2W40 A;  1QQO A;  4BQL A;  3VEX A;  5KQD A;  2A5X A;  4FWQ A;  4PKI A;  3AAR A;  3VGK A;  1BOT O;  2FSN A;  2P9N A;  4MO5 A;  2F9T A;  3FLC O;  5FPM A;  1JCE A;  4NB4 A;  3A5M C;  4BRC A;  2YCH A;  4WQ4 A;  3RSE A;  3VET A;  5AZJ B;  5AQG A;  3S41 A;  4BR5 A;  3KZB A;  4BRO A;  4BG9 A;  5CE3 A;  2ASP A;  4JN4 A;  4BR4 A;  3MN7 A;  3O08 A;  3EKS A;  3IUC A;  5BPL A;  1NGI A;  1Q18 A;  2E2P A;  4WQ5 C;  5AQI A;  5AQO A;  5AQM A;  3UKU A;  1WOQ A;  2NZT A;  4PKH A;  4CI6 A;  1RFQ A;  3MN5 A;  4BR0 A;  2IVO A;  2V52 B;  3HBT A;  3WQT A;  1KAX A;  3EN9 A;  2I7N A;  5AR0 A;  1C0F A;  1GLD G;  2E8A A;  4J8F A;  3FZH A;  5AQQ A;  4NO7 A;  2GWJ A;  2CGL A;  4A2B A;  4XH5 A;  3D2F A;  3H45 C;  3VGL A;  3SMP A;  1YVN A;  4YDU C;  4BRN A;  4FWP A;  4O8K A;  3TU5 A;  5AQU A;  1ATN A;  3H1V X;  1S22 A;  1NMD A;  1NGB A;  2P9U A;  3CJB A;  5EOY A;  2QWO A;  3CJ9 A;  5EY4 A;  3O1B A;  3DXK A;  4K25 A;  1Y64 A;  4CBX A;  4RWT A;  3WXK A;  5JLF A;  4FWO A;  3VER A;  3VGM A;  4FWN A;  1JCG A;  2Q0R A;  5KQ8 A;  1TUY A;  3D7E O;  4H5V A;  2CGJ A;  3QBW A;  4M63 C;  4XH1 A;  3SK3 A;  2ASM A;  1X9J A;  4XEI A;  1OKJ A;  2Q97 A;  4PL7 A;  1K8K A;  1DKG D;  1MDU B;  1GLC G;  4H0V B;  1BDG A;  3FZF A;  3DXM A;  4GNI A;  4EFH A;  3C7N B;  4MLH A;  3WUH A;  5AQK A;  4BRI A;  4I6M A;  3SLC A;  4Z94 A;  3H6E A;  5BRH A;  1E4F T;  3ZX0 A;  1RDW X;  1NLV A;  4WQ5 A;  1J6Z A;  4CZK A;  4BR2 A;  2P9N B;  3J8A A;  4CZG A;  3KHY A;  4K43 A;  3L4I A;  1IJJ A;  3A5N C;  4H5R A;  2GTD A;  3O4W A;  1QHA A;  3M1F A;  2HF4 A;  3TPQ A;  1MWK A;  1P8Z A;  2IVN A;  4C23 A;  3CJA A;  1XC3 A;  2A6A A;  2VCP A;  3GDQ A;  4M7Y A;  2DPN A;  1G99 A;  2Q0U A;  2QWP A;  5BPM A;  1GLJ O;  3VEO A;  2FSK A;  3JS6 A;  3I33 A;  1C0G A;  1NWK A;  2HOE A;  2BTF A;  3VF2 A;  1XUP O;  3CIP A;  5AQL A;  2E88 A;  4FWS A;  2A40 A;  3JXU A;  1RGI A;  3DXM B;  2D1K A;  2V7Z A;  2YHX A;  2ZF5 O;  4H0P A;  2P9S B;  4MLE A;  3SMS A;  3UKR B;  1GLA G;  3WT0 A;  3UB5 A;  5AQS A;  2E1Z A;  1JCF A;  4ISG A;  4RCH A;  4BRE A;  4ISF A;  5KPZ A;  3LDP A;  4CZI A;  3GE1 A;  5AQN A;  3CQX A;  4CZE A;  5AQP A;  4H5W A;  1YUW A;  1SQK A;  2P9L B;  3FZM A;  3SJH A;  2QWN A;  4KBO A;  4CZL A;  4IWV A;  1YXQ A;  4H5N A;  3D2F B;  3R8E A;  1BA1 A;  3GL1 A;  5AZJ A;  1MWM A;  4H03 B;  2CH6 A;  3GG4 A;  4H0T B;  1HPM A;  3A5L C;  2EWS A;  4EIA A;  4CJ7 A;  2NLX A;  4YDU A;  2CH5 A;  2ITM A;  5I9E B;  5E26 A;  3BEX A;  4BRM A;  2Q36 A;  1GLL O;  5AFU A;  3P4I A;  2I7P A;  4RTF D;  3H1Q A;  5E84 A;  5LJW A;  3FGU A;  3EO3 A;  3BF3 A;  4IJN A;  5AQY A;  1QZ5 A;  4WQ4 C;  4JD2 A;  5AZI B;  2FF3 B;  3LDO A;  1U2V B;  2YHY A;  5ELZ A;  3ZX3 A;  1Z6R A;  4BR7 A;  1K8K B;  2AP1 A;  5AQX A;  3U9Z A;  3ULE A;  4ISE A;  1Z05 A;  3R9P A;  3QB0 A;  2FXU A;  3IMX A;  3WXL A;  5AQZ A;  3MK6 A;  4M7X A;  5KPR A;  2YJE A;  5BRF A;  5F0X A;  2FSJ A;  2H3G X;  2E1Y A;  2QWL A;  3CET A;  3CQY A;  3HTV A;  4BGB A;  3H3N O;  3I8B A;  4IO8 A;  4B1Z A;  4CZM A;  1BUP A;  3LL3 A;  3UKU B;  4A61 A;  4BRP A;  3CJ7 A;  4EHU A;  1X3M A;  2F9W A;  3QML A;  3D2E B;  1QZ6 A;  3ZEU B;  1NGE A;  1ESV A;  1SZ2 A;  1NM1 A;  2P9I B;  3HI0 A;  3MN6 A;  2ZWH A;  5LY3 A;  4BVP A;  5FPN A;  1LOT B;  4BRH A;  5B8H A;  1TYQ B;  2OAN A;  1HKG A;  4H0Y B;  4CBU A;  3C0B A;  1HKB A;  3MN9 A;  3VEZ A;  1IG8 A;  3ATV A;  1NGH A;  4BRG A;  1X3N A;  3LDN A;  3FZK A;  2E20 A;  1R59 O;  2P9K A;  4MO4 A;  4WYB A;  3A5O C;  5AQW A;  4I6M B;  1WUA A;  1HX1 A;  3CJ1 A;  1D4X A;  3BP8 A;  3MDQ A;  3VF4 A;  3BF1 A;  3VF6 A;  4B1Y B;  4H0X B;  4HTL A;  4BC3 A;  3U8X A;  2PBD A;  3A8Y A;  2W41 A;  4H5T A;  4BG8 A;  4B1V A;  1EQY A;  5BRD A;  4O5F A;  1T6D A;  4AM7 A;  4A2A A;  2Q31 A;  3O1W A;  1KAZ A;  3O6W A;  2P9P B;  3QIC A;  3M3Z A;  3WXJ A;  2A42 A;  3HSC A;  4Y0W A;  1BG3 A;  4BC5 A;  3WQU A;  4FPA A;  1DGK N;  3LDQ A;  1KAY A;  5AQJ A;  5BN9 A;  3HZ6 A;  1GLE G;  4FO0 A;  1NGA A;  4K42 A;  2NRH A;  3R6M A;  3B8A X;  4BGA A;  5AQV A;  3VPZ A;  5KPT A;  5F2R A;  3O5B A;  4LC9 B;  5TKY A;  2GWK A;  3WEE A;  3CI5 A;  2WUS A;  4IJA A;  2E2N A;  2P9K B;  2D4W A;  1NGJ A;  2V51 B;  4JHD B;  1QQN A;  3L6Q A;  4IZ9 A;  3O8M A;  4DB3 A;  5JIC A;  2Q1N A;  4QS8 A;  2BUP A;  5AQH A;  3AAQ A;  3ULE B;  4DCH A; 
#chains in the Genus database with same CATH topology
 1NGC A;  1U04 A;  5AQF A;  2R7Y A;  5HL7 L;  4A62 A;  1VHX A;  1HUX A;  4FLV A;  3KWG A;  4PL8 A;  1WSH A;  1XNR K;  1ASW A;  3LWL A;  4DQS A;  4OO1 J;  2HND A;  1ZXO A;  3VMF B;  3LAM A;  5AFU H;  4LSN A;  3ENH A;  2A1S A;  3TSP A;  4FZX C;  3TAR A;  1S6P A;  2CGK A;  3F9M A;  3ENO A;  4M3W A;  2E6L A;  4DQ8 A;  3DXK B;  2IAJ A;  3SPY A;  3CC7 N;  3VA3 A;  3J80 O;  1F21 A;  2NRT A;  3QFU A;  4FSV A;  4OVL A;  4AM6 A;  3U4L A;  3NCI A;  3EE9 A;  2DFE A;  1CZA N;  3IDH A;  3QLH A;  5FRO A;  3O3G A;  4DSK A;  4RW6 A;  4E7K A;  4B8A B;  3AVI A;  4BRF A;  4BDP A;  1RDD A;  3C7N A;  3E01 A;  1SUQ A;  1NK8 A;  4ID5 A;  4YY3 K;  4DU3 A;  3KVG A;  1NJX A;  1Z26 A;  1IBL K;  2KKZ A;  3DLH A;  3OYA A;  4DQI A;  3DM2 A;  1FW6 A;  4CIG A;  2LSN A;  3T3F A;  4ELT A;  1KXP A;  5FPD A;  3OYG A;  3SUO A;  3QEW A;  4IG3 A;  5ADX H;  2O4I A;  3H46 O;  4E1J A;  2HBL A;  2HNZ A;  4NLC A;  2HHS A;  4YOV A;  3RSE B;  3LM9 A;  4B1U B;  3CER A;  3ENB A;  4KFB A;  1WN7 A;  5LMU K;  5BN8 A;  2FF6 A;  3C65 A;  1TYQ A;  4BRA A;  1RIL A;  3EZW A;  1MU2 A;  3DJC A;  4FWM A;  4F4K A;  5BRE A;  1NGF A;  1Q86 O;  3F5T A;  4CFB A;  4WFN L;  1LWC A;  1UA0 A;  3TAG A;  2ZGZ A;  1C1A A;  3C6T A;  1B92 A;  5F1X A;  4DU4 A;  4LFC K;  3ATU A;  2HHW A;  3OYL A;  3CHW A;  3SAF A;  1YJ9 N;  4JRP A;  2O8E B;  4F3T A;  2YJF A;  3IFR A;  3EYZ A;  3TSU A;  3T69 A;  4FJI A;  3FE1 A;  3RR7 A;  4N56 A;  4IXC A;  1WLJ A;  1ZYQ A;  2F96 A;  4EAH D;  1KFS A;  4GV6 A;  4HWI A;  2OCE A;  4L3Q A;  4DR3 K;  1HR0 K;  3SCX A;  3Q7C A;  3E1Y A;  1VSE A;  3KLG A;  3GOI A;  3DLK A;  2E6M A;  4FK0 A;  2OA8 A;  3QBX A;  1NK0 A;  5SZT A;  1TKT A;  4U7B A;  4FLY A;  2F8T A;  4FOE A;  1FKO A;  2OPQ A;  3O3F A;  2W6K A;  1JLC A;  1HMV A;  5KQD A;  3D45 A;  4FJN A;  1WSI A;  3SBG A;  4FWQ A;  3AVH A;  3VQQ A;  2P9N A;  2NRX A;  1XMO K;  3CCR N;  3FLC O;  5FPM A;  3PO4 A;  1VAZ A;  1JCE A;  4NXN K;  1BI4 A;  3A5M C;  2UXD K;  3RSE A;  3VET A;  2HHV A;  2IGI A;  2G8K A;  1J5O A;  4CF9 A;  4JN4 A;  2ZJR L;  3EKS A;  5GAG P;  3DOL A;  3OS1 A;  1HNZ K;  4DFK A;  1NGI A;  3U6F A;  4M42 A;  2RE2 A;  1WOQ A;  4CEB A;  4CI6 A;  3QIP A;  4BY9 C;  3EN9 A;  2QA4 N;  5CY4 A;  5AR0 A;  4LFA K;  3FFI A;  1RDA A;  1C0F A;  3AO4 A;  2HMI A;  1NOY A;  3FZH A;  5AQQ A;  5KTQ A;  2GWJ A;  1VQL N;  4WE1 A;  4FJM A;  4AHR A;  4KRF A;  3VGL A;  3H45 C;  5GAD P;  3PO5 A;  3F73 A;  3KK7 A;  3ZSO A;  1UA1 A;  3ZSQ A;  5E41 A;  1C0T A;  1ZBU A;  5AQU A;  3RRH A;  2VWK A;  4I2P A;  3AVC A;  4HUG A;  1QE1 A;  4YNQ A;  2DFH A;  4KI4 A;  5EOY A;  5EY4 A;  4HVJ A;  1J54 A;  4JI6 K;  4MQ3 A;  1Y64 A;  1N36 K;  3L2W A;  2OZS A;  3NGY A;  4FWO A;  3VER A;  5J2M A;  3OYF A;  3MCA B;  5D3G A;  2CGJ A;  4M63 C;  4XH1 A;  4F3O A;  1X9J A;  3HL8 A;  4JI2 K;  3K5N A;  2Q97 A;  4JI7 K;  1K8K A;  5I3U A;  2VWJ A;  4H0V B;  4GNI A;  3THY B;  4MLH A;  5AQK A;  1BQN A;  2VGM A;  1VQ9 N;  5HRR A;  3TAM A;  3LAN A;  3CD6 N;  3CCS N;  4JK8 A;  4IKF A;  1J6Z A;  3QIN A;  4QAG A;  3KHY A;  3KKR A;  4CGI A;  4K43 A;  3L4I A;  1YJN N;  1T05 A;  3LPT A;  4H5R A;  4JV5 K;  3LP3 A;  2QEX N;  3ZT4 A;  4JI0 K;  1T7P A;  5HOO A;  2VCP A;  5BPM A;  1WBB A;  4EP5 A;  3G71 N;  2HBK A;  3I33 A;  1C0G A;  1NWK A;  3HST B;  2HOE A;  3RMD A;  2E88 A;  4PHT X;  3NF6 A;  3JXU A;  3BGR A;  4CEC A;  3I56 N;  2HHQ A;  2O8F B;  1XMQ K;  1S72 N;  3O4Q A;  3UKR B;  3KD1 E;  3MEE A;  3WT0 A;  3UB5 A;  3KLH A;  3SPZ A;  1HYV A;  1JCF A;  4ISG A;  1BQM A;  4ISF A;  2OYQ A;  4JK7 A;  3T1A A;  4CJR A;  3GE1 A;  4O8U A;  2G8W A;  3I0S A;  3E9O A;  4H5W A;  1L3T A;  4JKG B;  4UY8 O;  4KBO A;  4ZTJ A;  1YXQ A;  4C8L A;  4KO0 A;  3D2F B;  4DSE A;  1A5V A;  1MWM A;  3NH0 A;  4CF2 A;  2E4L A;  5LL6 Z;  3A5L C;  2EWS A;  4EIA A;  4FLZ A;  3M8Q A;  3PX6 A;  3IKM A;  3KK2 A;  2FBX A;  2ITM A;  5E26 A;  1FJG K;  4WFB L;  4BRM A;  2Q36 A;  4CJL A;  4DSF A;  1SKR A;  4RTF D;  3LAL A;  1Q9Y A;  4FZZ A;  3H1Q A;  3PIO L;  3K5L A;  5E84 A;  4BWM A;  3OTO K;  4FXD A;  1S5J A;  3EO3 A;  4B9U A;  4IJN A;  2B6A A;  5AQY A;  2FF3 B;  4FJ7 A;  3LDO A;  4JKD A;  3ZX3 A;  2YNI A;  4FW1 A;  3MXJ A;  5DM7 L;  4IFY A;  1SV5 A;  3B6O A;  3ULE A;  3ISN C;  1N34 K;  4CK2 A;  3MWT A;  3IMX A;  2X78 A;  2E1Y A;  1KVB A;  3L3V A;  2QI2 A;  4FJJ A;  3CQY A;  4LH4 A;  1VQO N;  1K73 O;  3QEP A;  1BUP A;  4BRP A;  3UKU B;  4A61 A;  3CJ7 A;  2GX9 A;  3ZEU B;  1NGE A;  1TL3 A;  1NJW A;  3MWP A;  1SZ2 A;  3PX0 A;  4GKK K;  3HI0 A;  4DLG A;  3L4Q A;  2O8E A;  3AO2 A;  4O4G A;  5HRP A;  3ATV A;  1NGH A;  5C24 A;  1YIT N;  1VRT A;  1X3N A;  3LDN A;  3FZK A;  5I42 A;  4MO4 A;  4WYB A;  4Z4C A;  3LP0 A;  4I9Q A;  3HP6 A;  3HK2 A;  3VF4 A;  1X1P A;  1VQM N;  4M3R A;  3OW2 M;  3BZC A;  4C1N I;  4C8M A;  2ATQ A;  4I9L A;  1TK8 A;  2W41 A;  4I7F A;  2W42 A;  4BG8 A;  3DRP A;  4B1V A;  3V9X A;  4O5F A;  4AM7 A;  4DKW A;  3OYC A;  4OLA A;  2Q31 A;  3K2P A;  3O1W A;  4Z4G A;  4J2E A;  4PQU A;  1NKE A;  4KHQ A;  3WXJ A;  4LH5 A;  4E1M A;  4F8R A;  4KHN A;  4H4M A;  4YOT A;  1KAY A;  3HZ6 A;  1GLE G;  4I2Q A;  2PZS A;  1HYZ A;  4RW8 A;  5KPT A;  5F2R A;  5GAE P;  2YHA A;  4K0K K;  4NLB A;  2QKK A;  3WEE A;  3CI5 A;  2WUS A;  1A5X A;  2P9K B;  3R3L A;  4DB3 A;  2Q1N A;  2BUP A;  3HXM A;  3PSI A;  3ULE B;  1YVU A;  4DCH A;  1GOB A;  2FC0 A;  4OGE A;  2NRV A;  2D0A A;  2VG5 A;  4JI1 K;  1BU6 O;  3F9K A;  1XHZ A;  4M3Z A;  1S3X A;  3P31 A;  5K14 A;  2A41 A;  3CCV N;  2YNG A;  2YX6 A;  2QWM A;  4FOI A;  2D0P A;  4X62 K;  1N8R O;  3WNE A;  3SAH A;  2D5R A;  4H0O A;  1VSM A;  3QDK A;  4LF4 K;  4CEO A;  2UYT A;  3P38 A;  3MXI A;  4PWD A;  5CR4 A;  5JVH L;  4CJP A;  5EX5 A;  5C12 A;  1YF5 L;  1EO1 A;  3CFO A;  1VSJ A;  1VSH A;  3AA2 A;  4OLB A;  4JAX A;  2QXF A;  4B1X B;  4CZH A;  3AAP A;  1BIZ A;  1O13 A;  4LF8 K;  2P9U B;  3TAP A;  3SBT A;  3CJC A;  4CK1 A;  2P1J A;  1RBT A;  2WTU A;  3HT3 A;  1ZC6 A;  5A2Q O;  5EVZ A;  3TTC A;  1Y97 A;  4F2R A;  3MED A;  4JNE A;  3MMV A;  4G1Q A;  2VYP A;  4YOW A;  4DV1 K;  4AHS A;  4E7H A;  2DY4 A;  4CD1 A;  4KI6 A;  3KWI A;  3D2E A;  2KHO A;  2VQE K;  3T19 A;  4LD0 A;  3DWL A;  3CXC M;  2A3Z A;  2G8V A;  1D9D A;  3V9W A;  3QEV A;  3AGK A;  4FJX A;  4BQZ A;  3TAN A;  4M41 A;  1LW2 A;  4F2S A;  5KGX A;  1ILY A;  3NF9 A;  3ULD A;  2UXC K;  4FVM A;  5HRN A;  3CCU N;  2FLO A;  1L3S A;  3M6G A;  4Z4I A;  5HP1 A;  2GEL A;  3NGZ A;  1VSF A;  3BDP A;  5CZ1 A;  4W5O A;  1KTQ A;  1SL1 A;  3I55 N;  4IG0 A;  4E0D A;  5BR9 A;  3V9S A;  4B3R K;  4FWK A;  2VGN A;  3W3D A;  1SL2 A;  4AHV A;  3O9T A;  3L8B A;  2E2O A;  4DFM A;  3C6A A;  3RR8 A;  4DQR A;  5HLF A;  4KHP K;  4JHD A;  1WSG A;  3LM2 A;  3LPU A;  1NK4 A;  3NFA A;  2BDP A;  1E4G T;  4B3T K;  2NRR A;  5JS1 A;  4CD3 A;  2D0B A;  3NAE A;  2A1R A;  3VQA A;  4OPJ A;  4FL9 A;  1SL0 A;  1VSL A;  5IT9 O;  4PKI A;  3AAR A;  3VGK A;  5J2P A;  1BOT O;  2FSN A;  2F9T A;  1IKW A;  3V1Q A;  5AZJ B;  5AQG A;  3EE8 A;  4DQP A;  4BRO A;  4BG9 A;  1X9S A;  2ASP A;  4CGG A;  1QHT A;  1HNI A;  5C25 A;  5GIN A;  3O08 A;  5BPL A;  1Q18 A;  4WQ5 C;  2E2P A;  3QNO A;  1ZBF A;  4MFB A;  4DR1 K;  4FJH A;  4B3S K;  4DTN A;  2IS3 A;  4GVM A;  2V52 B;  1KAX A;  3ID6 A;  2I7N A;  2OTJ N;  5C42 A;  3S3N A;  5HRO A;  2OTL N;  1VRU A;  4ILJ A;  4J8F A;  3CG7 A;  3MAQ A;  4NO7 A;  3IG1 A;  4DV7 K;  3CFP A;  1WBD A;  5KRS A;  1JLB A;  1S1T A;  3SMP A;  3NVM A;  1YVN A;  4QCL A;  4YDU C;  1QSL A;  1T3V A;  4FWP A;  4FM2 A;  1S1V A;  3F2K A;  4FLT A;  1ATN A;  3H1V X;  3ZT0 A;  1RT4 A;  2P9U A;  4EP4 A;  3CJ9 A;  1RNH A;  1QSS A;  3PSF A;  3HPH A;  4N41 A;  2X74 A;  3NH2 A;  4CBX A;  5JLF A;  1KLN A;  4KHS A;  1JKH A;  1GOA A;  4CEA A;  3DRR A;  2RKI A;  3MX2 A;  4CJF A;  4FJ5 A;  2P5G A;  4GV9 A;  3OYN A;  1TUY A;  4IFE A;  2PYL A;  2KW4 A;  3QBW A;  3KLI A;  4XEI A;  4PL7 A;  1MDU B;  3AO1 A;  1NJZ A;  1GLC G;  4LFB K;  2RPI A;  1OH6 A;  1TAU A;  2BE2 A;  4EFH A;  3ZLJ A;  4BRI A;  4CFA A;  4YFU A;  4O0I A;  4CES A;  1U48 A;  4M3U A;  1RDW X;  2DTU A;  1QS4 A;  1NLV A;  1ITG A;  4WQ5 A;  4HUF A;  2UUB K;  3CPE A;  4JI4 K;  4CZK A;  2KFN A;  4BR2 A;  3K9J A;  1J5E K;  4Q5V A;  3AA3 A;  1VQ6 N;  2GTD A;  1QHA A;  3KTQ A;  4E7J A;  3HPO A;  5TKW A;  1MWK A;  2YNF A;  1P8Z A;  2IVN A;  4C23 A;  1Q8I A;  3AVL A;  4W5T A;  3PX4 A;  4M7Y A;  3DRS A;  1RTD A;  1GLJ O;  5C10 A;  3JS6 A;  5AJ3 K;  2BTF A;  1XUP O;  3LAK A;  3J7A P;  2XY5 A;  3M8S A;  1WSE A;  1CLQ A;  4CJ3 A;  1YHQ N;  3DXM B;  2D1K A;  3TTD A;  4CK3 A;  5GAH P;  4DTM A;  4DLE A;  2P9S B;  2HHT A;  1X9W A;  3AVN A;  2I5J A;  2WOM A;  1KD1 O;  3L2Q A;  1NMN A;  1QQC A;  2E1Z A;  4TSX A;  1R0A A;  4BRE A;  1RT2 A;  1DTT A;  3KKS A;  2HBM A;  2RN2 A;  1KVC A;  4LF7 K;  2HVH A;  3AVB A;  3FZM A;  3K5O A;  5M1K A;  3VQD A;  4KHU A;  1WAJ A;  4OPA A;  3HO1 A;  1XNQ K;  5C0Y A;  3CM5 A;  4H5N A;  4OKE A;  3TAB A;  1OH7 A;  1BA1 A;  3OJS A;  4CHZ A;  4FM0 A;  3GG4 A;  4H0T B;  5FRN A;  3CMA N;  2NRZ A;  2NLX A;  3AA4 A;  3G10 A;  5I9E B;  4O5B A;  5AFU A;  4DTP A;  2I7P A;  2BGG A;  4B3M K;  3J7Z O;  3BF3 A;  1QZ5 A;  4WQ4 C;  1U4B A;  4DV3 K;  3PLA A;  4DTR A;  1U2V B;  5ELZ A;  2UUA K;  3RVC A;  4CJ5 A;  4BR7 A;  4E89 A;  2XY7 A;  2PFU A;  2AP1 A;  3U9Z A;  4ISE A;  3NVK A;  3HYF A;  3R9P A;  1S6Q A;  2FXU A;  2EHG A;  4GVE A;  4NCG A;  5AQZ A;  4JLH A;  2YJE A;  3EEQ A;  4O0J A;  1S9G A;  4YHH K;  3HTV A;  4B1Z A;  4IO8 A;  4EHU A;  1TKZ A;  3QML A;  1YT3 A;  2HVI A;  3THW B;  4DTJ A;  1IKY A;  3OYH A;  1KRP A;  1NM1 A;  2P9I B;  3MN6 A;  2ZWH A;  5LY3 A;  1OVQ A;  2OAN A;  1QVF M;  4CBU A;  3C0B A;  3MN9 A;  1IG8 A;  3B6P A;  4BRG A;  4X64 K;  1NJY A;  4DV5 K;  3DYA A;  4KB0 A;  3SZ2 A;  2E20 A;  1R59 O;  5C2F A;  3A5O C;  4FVU A;  2ZD1 A;  1W2B M;  1HJR A;  3CJ1 A;  1DT9 A;  3OBY A;  3MDQ A;  3ZSV A;  3TAQ A;  1NG9 A;  3THY A;  1DLO A;  2KQ2 A;  3VF6 A;  3HOT A;  4MDA A;  1RBU A;  4H0X B;  3ZCM A;  4HTL A;  2PBD A;  1NU0 A;  4CFC A;  4DU1 A;  3CPW M;  3LDS A;  1BL3 A;  4BWJ A;  3NGI A;  4H5T A;  1EQY A;  1NKC A;  1CZB A;  3VA0 A;  1T6D A;  1K9M O;  3ZT3 A;  4A2A A;  4RW7 A;  3K57 A;  1C1C A;  2XRI A;  3K0S A;  3OYI A;  2IDO A;  3O9S A;  3M3Z A;  3QIC A;  4K8Z A;  4IDH A;  3LDQ A;  4AHT A;  2ETJ A;  4GW6 A;  3T1Y K;  4DF8 A;  2YNH A;  1TV6 A;  4CIF A;  4K42 A;  2NRH A;  3SQ4 A;  3O9R A;  4B3O A;  4FYD A;  3VPZ A;  3O9Q A;  1EKE A;  4IOC L;  5TKY A;  2O8B A;  4OPK A;  3TTF A;  3L2U A;  2E2N A;  4FJ8 A;  2D4W A;  3OYK A;  3L6Q A;  3TAE A;  3IS9 A;  4RW4 A;  3IAY A;  1VSI A;  4B9S A;  3O80 A;  2UU9 K;  3DLL L;  2QWQ A;  5KGW A;  2IVP A;  4DV0 K;  4NYF A;  3UKR A;  4BRQ A;  3DAW A;  3DMJ A;  4DF4 A;  3U9D A;  1HRH A;  5FDL A;  4OX9 K;  4LF6 K;  3CCL N;  2Z1J A;  1NGG A;  1NGD A;  1RTJ A;  3G4S N;  4GY2 B;  4HCC A;  1MA9 B;  3JSM A;  5BPN A;  4CF0 A;  3C94 A;  1C1B A;  2ITG A;  3L0Q A;  3VN5 A;  4KTQ A;  4CJ4 A;  4FWL A;  1M90 O;  2VG6 A;  3VEY A;  2YI1 A;  4OKJ A;  4FWR A;  4B8C A;  2G8U A;  4B9T A;  1QSY A;  4DTS A;  2Z1I A;  4BR9 A;  4E7L A;  4K41 A;  1TUU A;  5T7B A;  3TSQ A;  4FJL A;  1RTI A;  3KK1 A;  5ADX A;  4E1N A;  3MXM A;  5M1Q A;  1LW0 A;  3ZET B;  2VWB A;  4QS7 A;  4CZJ A;  3VEW A;  5M1F A;  3ID8 A;  2O8C B;  1HKC A;  3VEN A;  1NK5 A;  1U49 A;  1IKX A;  2AA4 A;  4BRD A;  1BI4 B;  4FLX A;  4LSL A;  1ASU A;  3AY9 A;  5C2D A;  1RT1 A;  1TVR A;  1P90 A;  3G25 A;  3FZL A;  3OHR A;  3AGR A;  1T6C A;  4AIL C;  2WBN A;  1ATR A;  4FM1 A;  5FPE A;  3V1R A;  4FK2 A;  1T44 A;  1RT3 A;  4F9O A;  3ZSY A;  4FPB A;  1EX4 A;  4JKE A;  4KKO A;  4ILH A;  4CEF A;  4G9Z A;  5JMV A;  3E66 A;  4FCY A;  2P5O A;  1NBW A;  4FLW A;  3QFP A;  1I94 K;  1KFD A;  3CCM N;  1Q81 O;  4DWI A;  3MEG A;  3T7Z A;  1M1K O;  3KLF A;  3V6D A;  3AO3 A;  3SYZ A;  3M8R A;  5AQT A;  1NJI O;  4KTW A;  1XQS C;  2QWR A;  3NF7 A;  3CME N;  2HMP A;  4YOR A;  2KLA A;  2V7Y A;  1YAG A;  5J2Q A;  3EL2 A;  3ZEU A;  5HRS A;  3C6U A;  1IKV A;  3K5M A;  3OY9 A;  5KRT A;  4DS5 A;  4CJV A;  4HUE A;  4J2D A;  4JK9 A;  5MLC Q;  1IBK K;  4CJK A;  2HF3 A;  3LDL A;  3I8D A;  4B9Q A;  3HRG A;  3KIO A;  1HPZ A;  1V4S A;  3VTI A;  2G8F A;  4H4O A;  1VQP N;  2QXL A;  4CED A;  1VK0 A;  5DM6 L;  4CF1 A;  1BO5 O;  3IRX A;  3WEE B;  2ZM6 K;  4BDZ A;  4BC4 A;  4C8N A;  4BC2 A;  3THX B;  1OVY A;  4K8X A;  4M45 A;  2A5X A;  2FBV A;  2DFF A;  1RBS A;  3ASM A;  2ZJQ L;  1VSD A;  3RMC A;  4X66 K;  4NB4 A;  3S41 A;  4BR5 A;  1TL1 A;  4HTU A;  1Q7Y O;  2NUB A;  3MN7 A;  3CC2 N;  3IUC A;  3S3O A;  1NK7 A;  3AO5 A;  4XIU A;  3V81 A;  5AQI A;  5LMN K;  1BCM A;  2NZT A;  4PKH A;  1HNW K;  4BR0 A;  4BDY A;  3HBT A;  1IV0 A;  3WQT A;  1JLE A;  4CE9 A;  3PUF A;  1HQU A;  1SKW A;  2E8A A;  4BE2 A;  4B9M A;  1HNX K;  3AVJ A;  4DUY K;  4XH5 A;  4N5S A;  3D2F A;  1VSK A;  3JYT A;  4DTU A;  3CFR A;  4BRN A;  1RT7 A;  3VQC A;  1JXB A;  3TU5 A;  1S1W A;  1TKX A;  3I0R A;  1D8Y A;  1NGB A;  4KV8 A;  1JL1 A;  2QWO A;  2XHB A;  3O1B A;  4KH6 A;  3L3U A;  4RWT A;  4JKG A;  3OS2 A;  4ZHR A;  3VGM A;  3MEC A;  3AVG A;  4FWN A;  4DG1 A;  1JCG A;  2Q0R A;  3E9L A;  4H5V A;  4JKA A;  3SK3 A;  4YOU A;  2ASM A;  3LZI A;  1SKS A;  4DSI A;  4CGF A;  1OKJ A;  1LWF A;  3P1G A;  1BDG A;  3NBP A;  3DXM A;  1S9E A;  2F8S A;  1I39 A;  3N4Q A;  3SLC A;  1E4F T;  2PY5 A;  4FW2 A;  2HNY A;  2IC3 A;  4IOX A;  3AVK A;  4ILG B;  2P9N B;  4CZG A;  3SJJ A;  3QES A;  3A5N C;  1XI1 A;  3QIO A;  3M1F A;  3T1H K;  4DSJ A;  3ZT2 A;  3TAF A;  4Q0B A;  3CM6 A;  2A6A A;  5CYQ A;  3GDQ A;  4DMN A;  2GUI A;  2QWP A;  1VQ7 N;  2NNW A;  1BHL A;  1Q82 O;  3VEO A;  4W5Q A;  3THX A;  1RCH A;  2O8B B;  4DR7 K;  5EU7 A;  3AVA A;  5CHI A;  5AQL A;  4KHW A;  1T8E A;  1RGI A;  3VQ7 A;  2YHX A;  2ZF5 O;  1Q9X A;  4JYA K;  1G15 A;  3SMS A;  2HW3 A;  3KD5 E;  1IG9 A;  4CIE A;  1EXQ A;  4GKJ K;  1KCF A;  5IWA K;  4GMJ B;  3J7Y P;  4Y1C A;  5KPZ A;  3O9U A;  3SV3 A;  2Y1I A;  3CQX A;  1KLM A;  1YJW N;  1YUW A;  1SQK A;  2P9L B;  3SV4 A;  1ZBI A;  3SJH A;  2GBZ A;  2QWN A;  2ZQB A;  1YTA A;  4CZL A;  3C95 A;  1UAX A;  4ZTF A;  4FJK A;  2XO7 A;  5J2N A;  4H03 B;  2CH6 A;  4M3Y A;  1HPM A;  5FRM A;  3EZ5 A;  4CJ7 A;  4CW7 B;  4YDU A;  1RTH A;  2QK9 A;  1BGX T;  2CH5 A;  4DV6 K;  4PA1 A;  4DTX A;  1GLL O;  3CCJ N;  1XC9 A;  3U3G A;  3P4I A;  4B9N A;  1QVG M;  5LJW A;  3FGU A;  4HCB A;  2JGU A;  3THV A;  1EWR A;  4O55 A;  4JD2 A;  1W97 L;  3PIP L;  2HHH K;  2WFB A;  4CJQ A;  2YHY A;  1Z6R A;  1K8K B;  3C6H A;  2WC9 A;  3ZYY X;  3QB0 A;  2HHX A;  3M8P A;  1IBM K;  5BRF A;  4DR4 K;  2H3G X;  4CJS A;  3JAM O;  2OPS A;  2W6L A;  3HOS A;  3QEI A;  4CZM A;  1KC8 O;  1REV A;  1X3M A;  2F9W A;  4DFJ A;  2B4J A;  4BVP A;  5FPN A;  1LOT B;  4BRH A;  2EX3 A;  4YOY A;  3P83 D;  3SUN A;  1HKG A;  3DI6 A;  4E7I A;  1C6V A;  4DR5 K;  1WB9 A;  4CHO A;  1TGO A;  1WUA A;  2X6S A;  1D4X A;  2ZE2 A;  4M3T A;  5GIP A;  3BF1 A;  4B1Y B;  4KRE A;  4BC3 A;  3P39 A;  2KZZ A;  3V9Z A;  1JJ2 M;  5GIO A;  2O8F A;  3SUP A;  3SQ1 A;  3A2F A;  2O8D B;  4JRQ A;  4NCB A;  1KAZ A;  1OH5 A;  2UXB K;  3O6W A;  4A57 A;  4BE0 A;  4PUO A;  4IBN A;  4Y0W A;  4KPY A;  3WQU A;  4FLU A;  3RRG A;  1VQK N;  3WNG A;  5M1O A;  3R6M A;  4BGA A;  2YHB A;  4A5A A;  3O5B A;  4HHT A;  3LZJ A;  2GWK A;  4JI3 K;  1RT5 A;  4IJA A;  4J2A A;  3BY5 A;  3P5J A;  1VQ8 N;  4JHD B;  1QQN A;  1WSJ A;  3O8M A;  4IZ9 A;  3DLE A;  1KVA A;  4QS8 A;  2P51 A;  4B9V A;  4LY7 A;  3AAQ A;  3QEX A;  4DQQ A;  3S3M A;  4QOZ B;  1S1X A;  3HVT A;  3W0L A;  5M1P A;  4WFA L;  3GBT A;  2ZGY A;  1H1V A;  1VQ5 N;  4XH4 A;  2ZJP L;  3FFK B;  4CHQ A;  4B08 A;  1C0M A;  1BIU A;  2J4R A;  3CCQ N;  3OVN A;  2VQF K;  1CXU A;  1FK9 A;  4JKC A;  1D5A A;  4E3S A;  3D6R A;  2P9P A;  4UQG A;  2Z1G A;  3O3H A;  5FLX O;  2JWK A;  2YHW A;  1ZBS A;  2D0O A;  3CYM A;  3K9K A;  4BRK A;  1BWF O;  4KHY A;  2Q3S A;  3NH1 A;  1LAW A;  1U6Z A;  5JVG L;  1HQE A;  3MCP A;  1RBR A;  2GUP A;  4E19 A;  2P9S A;  3ZSR A;  1RDC A;  1HYS A;  1HLU A;  4BRL A;  4W5N A;  1B9D A;  2YKM A;  1OH8 A;  1GLF O;  4CCH A;  1FKP A;  5AQR A;  2QW9 A;  2NRW A;  4EHT A;  3AVF A;  4FZY A;  5JS2 A;  4CVN E;  4DUZ K;  1JLG A;  1DEJ A;  3CC4 N;  2G8H A;  1U2V A;  4FJ9 A;  5H1S Q;  2RF2 A;  2PAV A;  3K59 A;  2Q2R A;  3Q7B A;  2RHK A;  3WNF A;  3HM9 A;  3TI0 A;  2IIR A;  3ALY A;  3FR0 A;  1GLB G;  3SUQ A;  4V19 S;  4O44 A;  4CZF A;  3SAG A;  5EXW A;  4C1N K;  3DLR A;  1JL2 A;  1CXQ A;  1ATS A;  3DOK A;  3VQP A;  3NHG A;  4NXM K;  3H3O B;  4CJT A;  1JXE A;  1WAF A;  1S1U A;  2WON A;  1QQM A;  3J81 O;  1NOZ A;  2QM1 A;  3TR8 A;  4CBW A;  4BVO A;  5BR8 K;  4KTZ A;  4N47 A;  2FBY A;  3AA5 X;  1LCU A;  3ZET A;  1SAZ A;  3K58 A;  1TKD A;  4QS9 A;  2O4G A;  3WXI A;  3VES A;  3A0I X;  1V4T A;  4WCE L;  1NK9 A;  3BUZ B;  1IH7 A;  1VQ4 N;  2E2Q A;  2P9I A;  4KB1 A;  1RDB A;  5AZI A;  2ASO A;  3UE5 A;  4JS5 A;  4J2B A;  1J9A A;  4FK4 A;  1TK5 A;  4B1W B;  4JS4 A;  2F4V K;  4H8K A;  4AHU A;  4CEQ A;  3HM8 A;  2G8I A;  3EKU A;  3KK3 A;  1ZBL A;  3V1O A;  4CHN A;  1X9M A;  3L2V A;  3VEV A;  5JLH A;  2KFZ A;  4CER A;  5LJV A;  4PKG A;  1HJO A;  4DHY A;  3ZX2 A;  5C15 A;  1BA0 A;  4GV3 A;  4CF8 A;  3SNN A;  4CJE A;  1KQS M;  4Z4H A;  3THW A;  3VOV A;  3VQB A;  2JWL A;  2P9L A;  3SQ0 A;  3SQ2 A;  5KI6 A;  4N76 A;  1K6Y A;  3BZK A;  4JD2 B;  2GEM A;  2W40 A;  4KAZ A;  1QQO A;  4BQL A;  4DV2 K;  4DV4 K;  3VEX A;  1QTM A;  4DR2 K;  1RBV A;  2PYJ A;  3OYJ A;  3CCE N;  5J1E A;  4DFP A;  3QET A;  4MO5 A;  2QKB A;  4OPH A;  3L2R A;  4B9L A;  4BRC A;  2YCH A;  4WQ4 A;  1CZ9 A;  1WSF A;  4JKF A;  3E9P A;  3KZB A;  4KH5 A;  5CE3 A;  4BR4 A;  1U47 A;  2HBJ A;  3G6E N;  3UKU A;  3WXM B;  5AQO A;  5AQM A;  4NYN A;  1D9F A;  1WNS A;  1Z25 A;  4X65 K;  1RFQ A;  3MN5 A;  2IVO A;  3VQ4 A;  3OBW A;  3S9H A;  4EZ9 A;  1EET A;  3RTV A;  1GLD G;  1VQN N;  4CFD A;  4DR6 K;  4C8O A;  2CGL A;  4Z4E A;  1SS6 A;  4A2B A;  4L8R B;  1W9H A;  3ZSX A;  4RW9 A;  2OZM A;  3ZSZ A;  3SI6 A;  4O8K A;  4Z4F A;  1B9F A;  4W5R A;  1S22 A;  3HP9 A;  1NMD A;  3D0P A;  3G0Z A;  3CJB A;  3VQ6 A;  5CYM A;  4RG8 A;  2OPR A;  4CGH A;  3DXK A;  4K25 A;  1XHX A;  1NKB A;  3WXK A;  1YIJ N;  3VQE A;  2JLE A;  2GV9 A;  2O8D A;  1E3M A;  4CHP A;  5KQ8 A;  3D7E O;  4ID1 A;  1I3A A;  2YV0 X;  1JLQ A;  2Z1H A;  3HJF A;  2BAN A;  1L3U A;  4AF1 A;  3HVR A;  1DKG D;  3FZF A;  1U45 A;  4IFV A;  4YOX A;  3C7N B;  4CGD A;  3WUH A;  3KJV A;  3H08 A;  4I6M A;  5SWM A;  4Z94 A;  3H6E A;  2B5J A;  4JKB A;  5BRH A;  3OYD A;  3N4P A;  3ZX0 A;  2D0C A;  3NDK A;  2IOC A;  2XY8 A;  3UIQ A;  1JLA A;  5CZ2 A;  4ELV A;  2O8C A;  3J8A A;  4ELU A;  3HPG A;  1IJJ A;  3O4W A;  2HF4 A;  3NF8 A;  4OJR A;  3TPQ A;  3VQ8 A;  1YTU A;  1C0U A;  3CJA A;  1XC3 A;  3U3Y A;  4R79 A;  5HBM A;  2DPN A;  1IO2 A;  1G99 A;  2Q0U A;  2FSK A;  3OS0 A;  3VF2 A;  3DLB A;  3CIP A;  3RMB A;  4FWS A;  1NK6 A;  1ASV A;  2OPP A;  2A40 A;  4C8K A;  1UWB A;  3OYB A;  2V7Z A;  3QNN A;  4H0P A;  4DSL A;  1J53 A;  4ICL A;  4MLE A;  1GLA G;  5AQS A;  3R1X A;  4WF9 L;  1N32 K;  1UOC A;  4RCH A;  5DK5 A;  5M1N A;  3RMA A;  1TK0 A;  4LF5 K;  3LDP A;  1JLF A;  3VQ5 A;  1N6Q A;  3VTH A;  4JI8 K;  4CZI A;  4Z0U A;  5AQN A;  4CZE A;  2AJQ A;  3M5R A;  5AQP A;  1DTQ A;  4IEI A;  1EWQ A;  2HST A;  1GOC A;  1O1W A;  4IWV A;  3NMU A;  3LP2 A;  3R8E A;  3GL1 A;  1L3V A;  4IEE A;  4CHY A;  5AZJ A;  1XWL A;  1W7A A;  3ITH A;  3V9U A;  3LP1 A;  3PV8 A;  4IDK A;  4BAC A;  3BEX A;  4MDB A;  1YI2 N;  4A59 A;  3QER A;  3OJU A;  1RDU A;  1LWE A;  4U67 L;  4FJG A;  1HNV A;  4DTO A;  1BIS A;  3ZSW A;  3AV9 A;  2E5L K;  4JI5 K;  5AZI B;  4LF9 K;  5DMR A;  4OKK A;  4OGC A;  3CQ8 A;  1BCO A;  4CEE A;  3LWM A;  2KZM A;  5AQX A;  3RWU A;  2YKN A;  1Z05 A;  2X6N A;  3AVM A;  3WXL A;  3MK6 A;  4M7X A;  5KPR A;  1LV5 A;  5F0X A;  2FSJ A;  2XY6 A;  3DLG A;  2QWL A;  3CET A;  4BGB A;  3H3N O;  3OA9 A;  3I8B A;  3PY8 A;  3LL3 A;  4AQY K;  3D2E B;  1QZ6 A;  1N5Y A;  1ESV A;  4Y1D A;  2F7T A;  2QTD A;  3OYE A;  4CJU A;  5B8H A;  4IOA L;  1TYQ B;  4H0Y B;  1HKB A;  3VEZ A;  1W0H A;  4JEP A;  2BH1 A;  2HHU A;  2UUC K;  1RT6 A;  2P9K A;  4KH4 A;  5AQW A;  4I6M B;  2HB5 A;  3WNH A;  1HX1 A;  1KSP A;  3BP8 A;  1LAV A;  3CF5 L;  4EZ6 A;  2FBT A;  3U8X A;  3VQ9 A;  4R5P A;  1L5U A;  4NCA A;  4IO9 L;  3A8Y A;  2KTQ A;  1TAQ A;  4DS4 A;  3V4I A;  5BRD A;  4CGJ A;  4CJW A;  1FXX A;  1NNE A;  1T03 A;  2P9P B;  3QO9 A;  2VG7 A;  2A42 A;  3NE6 A;  3HSC A;  1BG3 A;  4BC5 A;  2Y1J A;  4FPA A;  1DGK N;  5AQJ A;  5BN9 A;  4FO0 A;  1A5W A;  1NGA A;  3O4N A;  3EY1 A;  3B8A X;  5AQV A;  3ZT1 A;  1N33 K;  4PY5 A;  3KLE A;  4LC9 B;  1EP4 A;  4A5B A;  3MX5 A;  4AH9 A;  1NGJ A;  2V51 B;  4JKH A;  1K8A O;  3TWH A;  4M3X A;  5JIC A;  3OYM A;  4BE1 A;  1ZBH A;  4AHC A;  5AQH A;  4CEZ A; 
#chains in the Genus database with same CATH homology
 1NGC A;  3O80 A;  5AQF A;  2NRV A;  5HL7 L;  4A62 A;  1HUX A;  3KWG A;  1BU6 O;  2QWQ A;  4PL8 A;  3DLL L;  2IVP A;  3W0L A;  5M1P A;  3UKR A;  4BRQ A;  1S3X A;  3P31 A;  2A41 A;  3GBT A;  4WFA L;  2ZGY A;  1H1V A;  3CCV N;  1VQ5 N;  4XH4 A;  2ZJP L;  3FFK B;  2YX6 A;  3DAW A;  4OO1 J;  2J4R A;  1ZXO A;  3VMF B;  3CCQ N;  5AFU H;  3ENH A;  2QWM A;  3U9D A;  3TSP A;  4FOI A;  2D0P A;  4JKC A;  1N8R O;  3SAH A;  3D6R A;  3CCL N;  2P9P A;  4H0O A;  1NGG A;  1NGD A;  2JWK A;  2CGK A;  3QDK A;  3G4S N;  3F9M A;  4GY2 B;  2YHW A;  1ZBS A;  3ENO A;  2D0O A;  1MA9 B;  2UYT A;  5BPN A;  3P38 A;  3K9K A;  4DQ8 A;  3DXK B;  4BRK A;  5CR4 A;  5JVH L;  1BWF O;  3CC7 N;  3L0Q A;  5EX5 A;  1U6Z A;  2NRT A;  4FSV A;  3QFU A;  4AM6 A;  3MCP A;  5C12 A;  3U4L A;  2GUP A;  5JVG L;  2P9S A;  3EE9 A;  1YF5 L;  1EO1 A;  1CZA N;  3IDH A;  1HLU A;  4FWL A;  4BRL A;  3VEY A;  1M90 O;  2YI1 A;  1GLF O;  4FWR A;  5AQR A;  2QW9 A;  4BR9 A;  4JAX A;  4K41 A;  1TUU A;  2NRW A;  4BRF A;  4EHT A;  4B1X B;  4CZH A;  3AAP A;  3TSQ A;  3C7N A;  1O13 A;  5ADX A;  3KVG A;  5M1Q A;  3ZET B;  2KKZ A;  2VWB A;  2P9U B;  3SBT A;  4QS7 A;  1DEJ A;  3CC4 N;  1U2V A;  4CZJ A;  3CJC A;  3VEW A;  1KXP A;  5H1S Q;  5M1F A;  2PAV A;  3ID8 A;  5FPD A;  2Q2R A;  3Q7B A;  1HKC A;  1ZC6 A;  5ADX H;  3VEN A;  2RHK A;  3H46 O;  2IIR A;  3FR0 A;  2AA4 A;  4E1J A;  2HBL A;  4BRD A;  5EVZ A;  1GLB G;  3TTC A;  4NLC A;  4YOV A;  3RSE B;  3LM9 A;  4B1U B;  3AY9 A;  3CER A;  4JNE A;  5C2D A;  3MMV A;  4YOW A;  2VYP A;  3ENB A;  4CZF A;  3SAG A;  1P90 A;  3G25 A;  4CD1 A;  5EXW A;  5BN8 A;  4C1N K;  2FF6 A;  3C65 A;  1TYQ A;  3FZL A;  3OHR A;  3AGR A;  1T6C A;  3KWI A;  3D2E A;  1ATS A;  2WBN A;  4BRA A;  1ATR A;  2KHO A;  3CXC M;  3DWL A;  3EZW A;  2A3Z A;  3DJC A;  4FWM A;  3H3O B;  5BRE A;  5FPE A;  1NGF A;  1T44 A;  1Q86 O;  3AGK A;  3F5T A;  1QQM A;  4F9O A;  4BQZ A;  4FPB A;  2QM1 A;  4JKE A;  4WFN L;  4ILH A;  4G9Z A;  5JMV A;  3E66 A;  4CBW A;  1NBW A;  3QFP A;  4BVO A;  3CCM N;  2ZGZ A;  1Q81 O;  1ILY A;  1LCU A;  3T7Z A;  1M1K O;  3ZET A;  1SAZ A;  5F1X A;  5AQT A;  3ATU A;  2FLO A;  3CCU N;  1NJI O;  4QS9 A;  1XQS C;  3VES A;  3WXI A;  2QWR A;  3A0I X;  3M6G A;  3CME N;  1V4T A;  2HMP A;  2GEL A;  3BUZ B;  3CHW A;  4YOR A;  2KLA A;  2E2Q A;  2P9I A;  4WCE L;  2V7Y A;  1YAG A;  3SAF A;  1VQ4 N;  5AZI A;  2ASO A;  3UE5 A;  3I55 N;  3EL2 A;  3ZEU A;  2YJF A;  4B1W B;  3IFR A;  5BR9 A;  3TSU A;  3T69 A;  3FE1 A;  4FWK A;  3HM8 A;  2VGN A;  3EKU A;  3W3D A;  4IXC A;  3O9T A;  4JK9 A;  5MLC Q;  2HF3 A;  3LDL A;  4B9Q A;  2E2O A;  3HRG A;  3VEV A;  4EAH D;  5JLH A;  1V4S A;  3VTI A;  5LJV A;  3C6A A;  4GV6 A;  4HWI A;  4PKG A;  4L3Q A;  1VQP N;  3Q7C A;  1HJO A;  3E1Y A;  4DHY A;  3ZX2 A;  5C15 A;  1BA0 A;  3GOI A;  4GV3 A;  4JHD A;  2QXL A;  3LM2 A;  5DM6 L;  1KQS M;  1E4G T;  3QBX A;  2NRR A;  4U7B A;  1BO5 O;  3VOV A;  3WEE B;  4CD3 A;  4FOE A;  2JWL A;  2P9L A;  4FL9 A;  4JD2 B;  4BC4 A;  4BC2 A;  2GEM A;  2W40 A;  1QQO A;  4BQL A;  1OVY A;  3VEX A;  5KQD A;  3SBG A;  2A5X A;  4FWQ A;  4PKI A;  3CCE N;  3AAR A;  3VGK A;  1BOT O;  2FSN A;  2NRX A;  2P9N A;  4MO5 A;  2F9T A;  2ZJQ L;  3FLC O;  4OPH A;  5FPM A;  3CCR N;  1VAZ A;  1JCE A;  4NB4 A;  3A5M C;  4BRC A;  2YCH A;  4WQ4 A;  3RSE A;  3VET A;  5AZJ B;  5AQG A;  3EE8 A;  4JKF A;  3S41 A;  4BR5 A;  3E9P A;  3KZB A;  4BRO A;  4KH5 A;  4BG9 A;  5CE3 A;  2ASP A;  4JN4 A;  2ZJR L;  1Q7Y O;  4BR4 A;  3MN7 A;  3CC2 N;  5GIN A;  3O08 A;  2HBJ A;  3EKS A;  5GAG P;  3IUC A;  5BPL A;  3G6E N;  1NGI A;  1Q18 A;  2E2P A;  4WQ5 C;  5AQI A;  5AQO A;  5AQM A;  3UKU A;  2RE2 A;  3WXM B;  1WOQ A;  2NZT A;  4PKH A;  4CI6 A;  4BY9 C;  1RFQ A;  3MN5 A;  4BR0 A;  2IVO A;  2V52 B;  3HBT A;  3WQT A;  1KAX A;  3EN9 A;  2I7N A;  3ID6 A;  2QA4 N;  2OTJ N;  3OBW A;  5AR0 A;  2OTL N;  1C0F A;  1GLD G;  2E8A A;  4ILJ A;  4J8F A;  1VQN N;  3FZH A;  5AQQ A;  4NO7 A;  2GWJ A;  1VQL N;  2CGL A;  1SS6 A;  4XH5 A;  4A2B A;  3D2F A;  3H45 C;  3VGL A;  5GAD P;  3SMP A;  3KK7 A;  1YVN A;  3NVM A;  4YDU C;  4BRN A;  1T3V A;  4FWP A;  4O8K A;  3TU5 A;  3F2K A;  5AQU A;  1ATN A;  3H1V X;  1S22 A;  1NMD A;  1NGB A;  2P9U A;  3CJB A;  5EOY A;  2QWO A;  3CJ9 A;  5EY4 A;  3O1B A;  4KH6 A;  3DXK A;  4K25 A;  1Y64 A;  4CBX A;  4RWT A;  3WXK A;  5JLF A;  1YIJ N;  4JKG A;  4FWO A;  3MX2 A;  3VER A;  3VGM A;  4FWN A;  1JCG A;  4GV9 A;  2Q0R A;  5KQ8 A;  1TUY A;  3E9L A;  3D7E O;  4IFE A;  3MCA B;  4H5V A;  4JKA A;  2CGJ A;  3QBW A;  4M63 C;  4XH1 A;  4YOU A;  3SK3 A;  2ASM A;  1X9J A;  4XEI A;  1OKJ A;  2Q97 A;  4AF1 A;  4PL7 A;  1K8K A;  1DKG D;  1MDU B;  1GLC G;  4H0V B;  1BDG A;  3FZF A;  3DXM A;  4GNI A;  4EFH A;  4YOX A;  3C7N B;  4MLH A;  3WUH A;  3N4Q A;  5AQK A;  4BRI A;  4I6M A;  3SLC A;  2VGM A;  4Z94 A;  3H6E A;  4JKB A;  1VQ9 N;  5BRH A;  1E4F T;  3N4P A;  3ZX0 A;  1RDW X;  3CD6 N;  1NLV A;  3CCS N;  4IOX A;  4JK8 A;  4WQ5 A;  1J6Z A;  4ILG B;  3CPE A;  4CZK A;  4BR2 A;  2P9N B;  3K9J A;  3J8A A;  4CZG A;  3KHY A;  4K43 A;  3L4I A;  1YJN N;  1IJJ A;  3A5N C;  4H5R A;  1VQ6 N;  2GTD A;  3O4W A;  1QHA A;  3M1F A;  2HF4 A;  3TPQ A;  2QEX N;  5TKW A;  1MWK A;  1P8Z A;  2IVN A;  4C23 A;  5HOO A;  3CJA A;  1XC3 A;  2A6A A;  2VCP A;  3GDQ A;  4R79 A;  4M7Y A;  2DPN A;  1G99 A;  2Q0U A;  2QWP A;  1VQ7 N;  2NNW A;  1GLJ O;  5BPM A;  1Q82 O;  3G71 N;  2HBK A;  3VEO A;  2FSK A;  5C10 A;  3JS6 A;  3I33 A;  1C0G A;  1NWK A;  2HOE A;  2BTF A;  3VF2 A;  1XUP O;  3CIP A;  5CHI A;  5AQL A;  2E88 A;  4PHT X;  4FWS A;  2A40 A;  1YHQ N;  3JXU A;  1RGI A;  3DXM B;  2D1K A;  2V7Z A;  2YHX A;  2ZF5 O;  3TTD A;  4H0P A;  3I56 N;  5GAH P;  2P9S B;  4MLE A;  1S72 N;  3SMS A;  3UKR B;  1KD1 O;  1GLA G;  3WT0 A;  3UB5 A;  5AQS A;  3R1X A;  2E1Z A;  4WF9 L;  1JCF A;  4ISG A;  4RCH A;  4BRE A;  4ISF A;  5M1N A;  4JK7 A;  5KPZ A;  3O9U A;  2HBM A;  3LDP A;  3VTH A;  4CZI A;  3GE1 A;  4O8U A;  3CQX A;  5AQN A;  4CZE A;  3M5R A;  1YJW N;  5AQP A;  3E9O A;  1YUW A;  1SQK A;  4H5W A;  4JKG B;  2P9L B;  3FZM A;  3SJH A;  4IEI A;  5M1K A;  2HST A;  2QWN A;  4KBO A;  4UY8 O;  4CZL A;  4OPA A;  4IWV A;  3NMU A;  5C0Y A;  1YXQ A;  4H5N A;  3D2F B;  3R8E A;  1BA1 A;  3GL1 A;  4IEE A;  5AZJ A;  1MWM A;  4H03 B;  2CH6 A;  3GG4 A;  4H0T B;  1HPM A;  3A5L C;  3CMA N;  2EWS A;  2NRZ A;  4EIA A;  4CJ7 A;  2NLX A;  3IKM A;  4YDU A;  2CH5 A;  2ITM A;  5I9E B;  5E26 A;  3BEX A;  4MDB A;  4BRM A;  2Q36 A;  4WFB L;  1YI2 N;  1GLL O;  4A59 A;  3CCJ N;  5AFU A;  3P4I A;  2I7P A;  4RTF D;  1RDU A;  3H1Q A;  1QVG M;  4U67 L;  3PIO L;  5E84 A;  3J7Z O;  5LJW A;  3FGU A;  3EO3 A;  3BF3 A;  4IJN A;  5AQY A;  1QZ5 A;  4WQ4 C;  4JD2 A;  5AZI B;  1W97 L;  2FF3 B;  3PIP L;  3LDO A;  4JKD A;  3PLA A;  1U2V B;  2WFB A;  2YHY A;  5ELZ A;  3RVC A;  1Z6R A;  3ZX3 A;  1K8K B;  4BR7 A;  3C6H A;  5DM7 L;  2PFU A;  2AP1 A;  2WC9 A;  5AQX A;  3U9Z A;  3ULE A;  4ISE A;  3ZYY X;  1Z05 A;  3NVK A;  3R9P A;  3QB0 A;  3MWT A;  2FXU A;  3IMX A;  3WXL A;  4GVE A;  5AQZ A;  3MK6 A;  4M7X A;  5KPR A;  2YJE A;  5BRF A;  5F0X A;  2FSJ A;  2H3G X;  2E1Y A;  2QWL A;  2QI2 A;  3CET A;  3CQY A;  3HTV A;  4BGB A;  3H3N O;  3OA9 A;  3HOS A;  3I8B A;  4IO8 A;  4B1Z A;  1VQO N;  4CZM A;  1BUP A;  1K73 O;  3LL3 A;  3UKU B;  4A61 A;  4BRP A;  3CJ7 A;  4EHU A;  1KC8 O;  1X3M A;  2F9W A;  3QML A;  2GX9 A;  3D2E B;  1QZ6 A;  3ZEU B;  1NGE A;  1ESV A;  3MWP A;  1SZ2 A;  2F7T A;  1NM1 A;  2P9I B;  2QTD A;  3HI0 A;  3MN6 A;  2ZWH A;  5LY3 A;  4BVP A;  5FPN A;  1LOT B;  3L4Q A;  4BRH A;  5B8H A;  4YOY A;  4IOA L;  1TYQ B;  2OAN A;  1HKG A;  4H0Y B;  4CBU A;  1QVF M;  3C0B A;  1HKB A;  3MN9 A;  3VEZ A;  1IG8 A;  3ATV A;  1NGH A;  4BRG A;  1YIT N;  4JEP A;  2BH1 A;  1X3N A;  3LDN A;  3FZK A;  2E20 A;  1R59 O;  2P9K A;  4KH4 A;  4MO4 A;  4WYB A;  5C2F A;  3A5O C;  4FVU A;  5AQW A;  4I6M B;  1W2B M;  1WUA A;  1HX1 A;  3CJ1 A;  1D4X A;  1DT9 A;  3BP8 A;  3MDQ A;  3OBY A;  3VF4 A;  1VQM N;  5GIP A;  3BF1 A;  3VF6 A;  4B1Y B;  3CF5 L;  3HOT A;  4MDA A;  4H0X B;  4HTL A;  4BC3 A;  3P39 A;  3U8X A;  3OW2 M;  2PBD A;  4IO9 L;  3A8Y A;  4C1N I;  3CPW M;  1JJ2 M;  5GIO A;  2W41 A;  4H5T A;  4BG8 A;  4B1V A;  1EQY A;  5BRD A;  4O5F A;  1T6D A;  1K9M O;  4AM7 A;  4A2A A;  4DKW A;  2Q31 A;  1YJ9 N;  3O1W A;  1KAZ A;  3O6W A;  4A57 A;  2P9P B;  3O9S A;  3M3Z A;  3QIC A;  3WXJ A;  2A42 A;  3HSC A;  4Y0W A;  1BG3 A;  4YOT A;  3WQU A;  4BC5 A;  4FPA A;  4IDH A;  1DGK N;  3LDQ A;  1KAY A;  5AQJ A;  5BN9 A;  3HZ6 A;  1GLE G;  4FO0 A;  1NGA A;  1VQK N;  4K42 A;  2NRH A;  5M1O A;  3O9R A;  3R6M A;  3B8A X;  4BGA A;  5AQV A;  3VPZ A;  5KPT A;  3O9Q A;  5F2R A;  5GAE P;  4A5A A;  3O5B A;  4LC9 B;  4NLB A;  4IOC L;  5TKY A;  2GWK A;  4A5B A;  3MX5 A;  3WEE A;  3TTF A;  3CI5 A;  2WUS A;  4IJA A;  2E2N A;  2P9K B;  2D4W A;  1NGJ A;  2V51 B;  4JKH A;  4JHD B;  3R3L A;  1QQN A;  1K8A O;  1VQ8 N;  3L6Q A;  4IZ9 A;  3O8M A;  4DB3 A;  5JIC A;  2Q1N A;  4QS8 A;  2BUP A;  5AQH A;  3AAQ A;  3ULE B;  4DCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...