4BROA

Legionella pneumophila ntpdase1 crystal form iv (part-open)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
351
Chain Sequence
NPCEKHSCIAVIDAGSTGSRLHIYSYDTDDTNTPIHIEEIWNKKIKPGFASIQPNSVTIDAYLTMLLADAPIHNIPVYFYATAGMRLLPQSQQKKYYDELDYWFRQQSQWQLVEAKTITGNDEALFDWLAVNYKLDTLKKSVGVMDMGGASVQIVFPMPKNAEISKHNQVELNIYGQNINLYVHSFLGLGQTEMSHQFLNSPSCFANDYPLPDGESGQGNAPSCKEEVTSLMNSVHKVNQQIQPLLALNPVNEWYSIGGISNLASSQLFHFENSELTNQSLLQQGDNQICHQQWDILNGQYPDDEYLYQYCLLSSYYYALMVDGYGINPNQTIHYIPPEDWTIGVVLHRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE I
publication title Crystallographic Snapshots Along the Reaction Pathway of Nucleoside Triphosphate Diphosphohydrolases
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 110
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2013-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4broA01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 4broA02
1NGHA 1JCFA 1NGBA 2IVOA 1BDGA 3CIPA 3HI0A 2I7PA 5AQPA 3LDPA 4YDUA 4FWSA 5AQSA 3SMSA 1QQOA 4CBXA 3A5MC 3CJCA 1P8ZA 3MN5A 1H1VA 5EVZA 4K41A 3QICA 1RFQA 4DQ8A 4LC9B 1U2VB 3UB5A 1NLVA 5EY4A 4BRKA 2CGKA 3FZFA 2YI1A 3O4WA 4I6MA 1V4TA 4MO4A 3BP8A 4HTLA 3CQYA 1KAXA 2P9LB 4FWOA 2Q36A 1TUUA 4H5NA 2P9NA 1WUAA 2PBDA 1HPMA 4BRQA 2P9KA 3A5OC 3DXMB 4XH5A 4M7YA 3VGMA 3EO3A 3UKUA 3AARA 4H5RA 3ULEB 2HMPA 1SAZA 4E1JA 3HM8A 2A40A 3EKSA 4BRNA 5BRDA 4GNIA 4H0OA 4IZ9A 5AQRA 2FSKA 3VESA 4H5WA 1NM1A 3VETA 5FPMA 1IJJA 1JCGA 4AM6A 5JLFA 3WQTA 3EZWA 3VF6A 1V4SA 3SMPA 3MN7A 4CJ7A 3C7NA 2HF4A 3LL3A 1RGIA 3KVGA 2QWLA 2A5XA 2ITMA 3UKRA 3VF4A 5ADXH 3BUZB 5BN8A 3WXLA 2D4WA 4BRCA 4H0VB 3U9ZA 2QM1A 5AZIA 2Q0RA 1NGEA 3LM9A 3QFPA 2GWKA 5CE3A 1T44A 2V52B 2ZWHA 4CD3A 2YHXA 4JN4A 1GLCG 4JAXA 5LY3A 1GLJO 3D2EB 3M6GA 3ATUA 1MWKA 3GE1A 3M3ZA 5FPNA 4BRMA 2ASOA 3ZEUA 3VEYA 2P9IA 2QWNA 5AQMA 3CERA 1QQNA 4QS8A 1D4XA 1J6ZA 3O80A 2A6AA 1HJOA 5B8HA 3LDNA 3MN6A 4B1XB 1S3XA 4DCHA 5BR9A 3IDHA 4H0TB 2CH6A 4CZLA 2AA4A 4EFHA 3QFUA 1G99A 4RWTA 3SLCA 1DKGD 3IFRA 1QQMA 4BRDA 2E2QA 1GLFO 4FWMA 3P4IA 1ATNA 3M1FA 3VEZA 4IO8A 5AQUA 2P9PA 5EX5A 3W3DA 2F9WA 2YHYA 5ELZA 3J8AA 3JXUA 2E88A 4WYBA 3W0LA 4CZJA 1HUXA 1YUWA 2IVPA 3LM2A 4XH4A 3UE5A 4BR4A 4B1YB 4BC4A 1ATSA 3ENHA 2QWPA 4FWPA 1BA1A 3IMXA 4BR2A 1QZ5A 4HWIA 3C0BA 3LDLA 1Z05A 1K8KA 1BU6O 4I6MB 2A41A 2GTDA 1ESVA 4JNEA 3WXJA 1YAGA 4H03B 4H0PA 5EOYA 3O1BA 4CBUA 2P9KB 5KPRA 5FPEA 4BGBA 3L6QA 3O8MA 3VF2A 4Y0WA 4YDUC 4C23A 2NLXA 3VENA 4BC2A 4FWQA 2E1ZA 3VPZA 3CETA 3ENOA 4BR9A 4EHUA 1XC3A 4EHTA 4BR5A 3WUHA 5AQWA 4PL8A 4BGAA 3ZX0A 1T6CA 4BRPA 3GDQA 3RSEA 3C7NB 2YCHA 1S22A 3GG4A 5ADXA 4CZMA 3BF1A 4BRLA 2NRHA 3BF3A 4CZKA 3AY9A 4JD2A 1QZ6A 3D2FB 4IJAA 5AZIB 4BREA 1QHAA 1IG8A 4BG9A 5AQTA 1BWFO 1BA0A 1Z6RA 1HLUA 3O1WA 2Q1NA 2GWJA 1Q18A 1U6ZA 3G25A 2Q2RA 2YJFA 1E4FT 2VWBA 2QWOA 4WQ4A 3LDOA 1R59O 2YHWA 1E4GT 1MA9B 1ZXOA 3EL2A 4WQ4C 5F2RA 1GLAG 2P9IB 2P9UB 4K42A 5BPMA 4IWVA 4MLHA 4BRAA 3L4IA 2QW9A 2IVNA 3MK6A 1NGCA 2FSNA 4RCHA 4ISFA 1KXPA 3CQXA 3U9DA 1NWKA 2HF3A 5AR0A 3VEXA 3VOVA 4FSVA 3H46O 4FO0A 3VEOA 3VEWA 2P9SB 4CBWA 1SQKA 3MCPA 3U8XA 5AQXA 3ZX3A 3FZMA 4CD1A 5AZJA 2IIRA 3CJAA 4FWLA 4AM7A 4JHDA 4J8FA 4M7XA 4KBOA 5BPLA 4RTFD 5BREA 2AP1A 1CZAN 5E26A 4ISGA 5AQNA 3BEXA 4B1WB 1ZBSA 3GL1A 1C0GA 3SJHA 1BUPA 3H1VX 5BPNA 5AQZA 1HKGA 4B1ZA 3I8BA 2GUPA 3R9PA 1K8KB 1NGFA 2CH5A 3H3NO 4FPAA 5AQVA 4EAHD 5BRHA 3TU5A 2J4RA 3HBTA 2FSJA 4WQ5A 5F1XA 3H45C 3KZBA 3HZ6A 3ZX2A 4F9OA 1X3MA 5AQOA 3FLCO 4CZEA 4DHYA 2ZGZA 3R6MA 3FR0A 5KQDA 3CJ7A 2ASMA 4CZFA 1X3NA 2ASPA 2V7YA 1GLLO 4FWKA 1SZ2A 2VCPA 3EN9A 3WEEA 3MDQA 2Q97A 5AQGA 3EKUA 4CZGA 3ZETA 1T6DA 3JS6A 3AAQA 5AQJA 2E8AA 4XEIA 1YVNA 4O8KA 1HKBA 4H0YB 2P9NB 2E2PA 4CZHA 1LCUA 2DPNA 4BR0A 4BVPA 1BO5O 5AQIA 2CGLA 3HSCA 4QS9A 3RSEB 2E2NA 3UKUB 1KAYA 1XQSC 1TYQA 1ZC6A 3QB0A 4FL9A 1C0FA 4JD2B 5E84A 5F0XA 2EWSA 1BOTO 1OKJA 4CZIA 1X9JA 3FZHA 4K43A 4BRGA 4BQZA 2FXUA 4MO5A 2E1YA 3R8EA 5AQQA 4QS7A 3KHYA 3QBWA 3ATVA 2W41A 3CHWA 3A8YA 3GOIA 5LJVA 1BG3A 2QWQA 3D7EO 3UKRB 2H3GX 4BRIA 2Q0UA 4NO7A 2ZF5O 3MN9A 3FZKA 5FPDA 3B8AX 2I7NA 4A61A 1JCEA 5AQYA 3DXKA 3GBTA 3S41A 1DEJA 1KAZA 1XUPO 2E20A 4PKHA 4L3QA 5EXWA 4EIAA 2V7ZA 5KPZA 4H0XB 3CI5A 2YJEA 3LDQA 2F9TA 4XH1A 1U2VA 5AQKA 3ZEUB 2KHOA 1NGAA 1GLDG 3ID8A 4CI6A 1NMDA 2QWMA 5AZJB 4BQLA 5BRFA 4M63C 2D0OA 4JHDB 5AQHA 3A0IX 2P9LA 1Y64A 3HTVA 3O08A 4PKGA 5AQLA 3DWLA 2BUPA 3H1QA 3VEVA 3DXMA 3DJCA 2VYPA 1EQYA 4BR7A 1NGDA 2GELA 4FOEA 5JMVA 1TUYA 3FFKB 3ULEA 5I9EB 3VGKA 2BTFA 4Z94A 3CJ9A 1RDWX 4K25A 1WOQA 2QXLA 1HKCA 2WUSA 3D2FA 2V51B 3CJBA 5TKYA 4FOIA 1GLEG 2FF3B 2P9PB 4BC5A 3A5NC 3TPQA 4BRFA 5AFUA 1NGGA 5KQ8A 2GEMA 3CJ1A 2A42A 2E2OA 1NBWA 1DGKN 2Q31A 4IXCA 4MLEA 4A2BA 4GY2B 3VGLA 4FPBA 1MWMA 5LJWA 3H6EA 5AQFA 4B1VA 4DB3A 2ZGYA 3WEEB 2P9UA 2A3ZA 3ZETB 2FF6A 3FE1A 4H5VA 4WQ5C 2PAVA 1HX1A 2W40A 3IUCA 5AFUH 3QDKA 1ATRA 1GLBG 4NB4A 5BN9A 3WXKA 3FZLA 3FGUA 1TYQB 4PKIA 4BG8A 1NGJA 3QBXA 2CGJA 3D2EA 2UYTA 4ISEA 1LOTB 1MDUB 4BVOA 2P9SA 4BRHA 1NGIA 2FLOA 4BC3A 3OHRA 5JLHA 3WT0A 2HOEA 3WXIA 3O6WA 4FWNA 1YXQA 3I33A 4H5TA 4IJNA 2D1KA 3AAPA 3MMVA 2NZTA 2QWRA 3L0QA 3F9MA 2OANA 3DAWA 4BROA 3H3OB 3O5BA 3QMLA 4O5FA 5JICA 3SK3A 4A62A 3WQUA 4B9QA 3A5LC 4FWRA 4A2AA 3U4LA 2D0PA 4PL7A 3DXKB 5KPTA 3VERA 4B1UB
chains in the Genus database with same CATH superfamily
1NGHA 3K59A 1NGBA 2IVOA 3HI0A 1RDCA 3LANA 3ZSQA 3OYCA 1WBBA 2I7PA 1T3VA 1T7PA 4FZXC 3K5OA 3CJCA 1GOCA 1L5UA 2DFFA 5FROA 4DQ8A 1U2VB 4B9VA 1NLVA 5EY4A 3HO1A 1KFDA 4BRKA 4BDYA 2YI1A 1TKZA 4IO9L 3LP2A 1U45A 5GAEP 3NE6A 4BRQA 2P9KA 3CCMN 4B9UA 4XH5A 4M7YA 1W2BM 3VGMA 1P90A 1EWQA 4H5RA 3AGRA 3MX2A 4J2AA 3PUFA 2HMPA 1SAZA 3PO4A 1FXXA 2OA8A 3MEDA 4IZ9A 5AQRA 2IDOA 3CG7A 5FPMA 1JCGA 3AVMA 3PO5A 5JLFA 3O4QA 3KLIA 2O8CB 1V4SA 3SMPA 3MN7A 3C7NA 3OVNA 4DTNA 4FLWA 2A5XA 1CZBA 3UKRA 4BE1A 4PHTX 4BRCA 3V9ZA 2UUCK 3ZSYA 2DY4A 3QEXA 3QERA 4QOZB 4ID1A 2Q0RA 3O9TA 3VQBA 1NGEA 4IG3A 3LP0A 3I8DA 2JWLA 5CE3A 1LV5A 1T44A 4JI7K 2V52B 4FJ9A 1VSMA 3SYZA 2QA4N 1RDUA 4CJEA 2HBMA 4BE0A 1GLJO 3D2EB 4FW2A 1TGOA 5FPNA 4BRMA 2KFNA 3CCSN 4ZTJA 3ZEUA 4Y1CA 4FZZA 3NGIA 4LFCK 3C6UA 4CEQA 1RDBA 3ZSOA 4OPAA 1J6ZA 3PSFA 4DUZK 2EX3A 1HR0K 3OYNA 2QK9A 3LDNA 1S3XA 5BR9A 3QFUA 1G99A 1UA1A 1DKGD 1X9MA 4OKEA 2E2QA 4YOTA 4JK8A 4N76A 2P1JA 3RMDA 1HYZA 1BQMA 2YNIA 5AQUA 5EX5A 2F9WA 4FZYA 2NRVA 5HROA 1HUXA 2E6LA 2IVPA 1BI4B 1IKYA 1ATSA 3ENHA 3L2RA 5M1PA 3IMXA 4EZ9A 4HWIA 3S3MA 1RDDA 1Z05A 1BU6O 2A41A 1BGXT 1ESVA 4JYAK 5CYMA 1A5XA 4JNEA 4DTJA 4O8UA 3C65A 3RMCA 2YHBA 4DUYK 4DR3K 1HNXK 1Z25A 4BGBA 3NHGA 4YDUC 3OYMA 3K58A 3K0SA 3VENA 3CF5L 1WSEA 4E0DA 4BC2A 3LAKA 2P5OA 4I2QA 3CETA 4BR9A 3RR7A 3HRGA 4DFPA 4DFKA 4I7FA 3PY8A 4I2PA 3NVMA 1UOCA 1S1VA 3HP6A 3RSEA 4X62K 3QEWA 3C95A 3LAMA 4OLBA 2KLAA 3J81O 1JXBA 4CZKA 3SCXA 4ZTFA 3N4QA 5CZ1A 4BREA 3I0RA 2O8EB 1JJ2M 4BG9A 1C0MA 3CPEA 3MECA 2GV9A 4GV6A 1GOBA 1U6ZA 4FLZA 1E4FT 4Z4FA 4EP4A 4CFDA 4RW7A 2DTUA 1CXUA 4WQ4A 5H1SQ 3HPOA 4MDBA 1S1WA 3OJUA 1KC8O 2UXCK 1RCHA 4DTOA 5BPMA 4KHNA 4BRAA 4CIFA 2QW9A 4ELUA 3AVJA 1NGCA 2FSNA 4RCHA 2HW3A 3S3NA 3U9DA 1XC9A 1NWKA 3DRSA 4FSVA 5GIPA 3H46O 2YNHA 4FO0A 3VQ6A 4E3SA 3VEWA 3AVBA 2P9SB 4FK4A 5AQXA 3ZX3A 1Q82O 1VQ9N 3AO1A 1SS6A 3CCRN 4R79A 4JHDA 4J8FA 3I0SA 3THWA 1K9MO 4TSXA 4OJRA 1C0UA 5AQNA 4CE9A 3LWMA 4LH5A 3SUPA 3GL1A 1C0GA 1VQKN 3TSQA 1BUPA 5BPNA 1N5YA 4DV6K 4CHQA 1K8KB 4FPAA 1NJWA 3H45C 1DTQA 4OPJA 3KZBA 2HHSA 3HZ6A 2W42A 1XMQK 4JKGA 4DLGA 3HT3A 4JKFA 3THVA 3R6MA 3ISNC 2F4VK 2O8FA 3O3HA 4JI1K 1KVAA 2PFUA 3BY5A 3MDQA 3VTIA 3AA5X 3MAQA 1IKWA 3EKUA 3KJVA 4CJ3A 5KI6A 1RBRA 3NGZA 1Q9XA 1N33K 2DPNA 4ZHRA 4CF0A 3HSCA 3I55N 1HYSA 1IG9A 2VWJA 3V9UA 4CESA 1Q7YO 1XQSC 4FLXA 4IFEA 3C6HA 4DTSA 1IBLK 5E84A 5F0XA 4UQGA 3V81A 4JEPA 3VN5A 1ILYA 4BRGA 1NOZA 4DS4A 3OS2A 4QCLA 3R8EA 1WSFA 3Q7BA 2Z1JA 3NH1A 3AVNA 3QBWA 1TKDA 2W41A 1N36K 2VG5A 4JRPA 1NK7A 5AJ3K 4YOWA 4FM1A 1BG3A 4LF5K 3CMEN 3EYZA 4NO7A 5C12A 3B8AX 3ZT2A 2B4JA 4FJNA 4WCEL 4NCAA 3AVLA 1DEJA 1KAZA 4CF8A 1NJZA 4FJ5A 3DRPA 4H0XB 4CJUA 4DWIA 3G0ZA 5KTQA 1GLDG 2YX6A 5HRPA 4Z4IA 5BRFA 2P5GA 4GVEA 4LH4A 2P9LA 2YV0X 5AQLA 3DWLA 1XHXA 4DTPA 2BUPA 2WONA 4O0JA 4JS5A 1KLMA 4Z4HA 2I5JA 3TAPA 3FFKB 4FLUA 1QVFM 3ULEA 3HXMA 1QVGM 4LF8K 2BTFA 4CF9A 3KLEA 4Q0BA 1WB9A 4K0KK 3CJ9A 4DF8A 4CFBA 1NK6A 1T05A 5TKYA 3PX4A 2P9PB 2PZSA 4BC5A 1XNQK 3TPQA 4DLEA 3F2KA 5IWAK 1JLBA 3CJ1A 1W7AA 2RN2A 5C24A 4CCHA 3SAHA 3EZ5A 4GY2B 4DR4K 4FPBA 1MWMA 1RDAA 3DLRA 4DB3A 1OH7A 4BACA 4F3OA 3HOSA 3P1GA 3NH2A 2A3ZA 3ZETB 1J54A 4H5VA 4CIGA 4WQ5C 3AA4A 1HX1A 2ZJQL 1ATRA 5C42A 3WXKA 5JS1A 2NUBA 3E01A 4BG8A 5IT9O 3QBXA 2UYTA 4EP5A 2P9SA 3PX0A 2FLOA 3OHRA 1SUQA 3MXMA 2F8TA 1YXQA 2G8IA 1BL3A 1J5EK 3FFIA 1EKEA 5C25A 3OJSA 2OPRA 1YITN 3T1YK 4DR7K 3AVAA 3LP3A 4IOAL 1X9WA 1FJGK 4E7HA 3SK3A 4C8KA 4JKDA 2B6AA 2JGUA 4FWRA 4JK7A 4A2AA 3OS1A 4CK1A 4B1UB 1RT1A 2OTJN 4CHYA 3QEVA 4DQPA 3EE9A 3TAMA 4FWSA 4JKEA 3SMSA 3LWLA 3A5MC 2OYQA 1BCMA 3MN5A 3C6TA 5EVZA 3QICA 3CM6A 3MXJA 3K5NA 1K73O 2Z1HA 1KVCA 2HHHK 4O4GA 3K9KA 2Q36A 1TUUA 4N5SA 4E1NA 3OYFA 3L2QA 1Q81O 4OX9K 3OYGA 1RBSA 3A5OC 4WFBL 3EO3A 3IRXA 4M41A 5GAGP 4KHQA 1OVYA 2HHXA 4JKCA 4NXMK 3EKSA 2ZJRL 1JL2A 1VQNN 2BDPA 1NM1A 1IJJA 1YT3A 2JWKA 3HPGA 3TTCA 2G8WA 3VF6A 3OY9A 1HNZK 3M8QA 4CJFA 2HF4A 4HUEA 4Z0UA 2KTQA 3KVGA 1CZ9A 4OKJA 3CCVN 5BN8A 5JVHL 3U3YA 4FLYA 2D4WA 4FJIA 1RTHA 1NKBA 3C6AA 1YI2N 4KH6A 3WNFA 1U48A 5LMUK 2QEXN 1WSJA 2RKIA 3LM9A 3TWHA 1ZBLA 2HHTA 4CD3A 2YHXA 5A2QO 5M1FA 2OZSA 3EY1A 1VSDA 4F2SA 3GE1A 4IBNA 2QWNA 5AQMA 3CERA 1D4XA 3DI6A 3WXMB 4CEDA 4DCHA 1XI1A 3SUNA 3IDHA 4H0TB 3OYKA 4BDZA 4YOVA 2FC0A 3SUOA 3L2UA 1GLFO 4KKOA 5EU7A 4YOUA 1ATNA 1Q9YA 1CLQA 2RHKA 2P9PA 3CCEN 4FK2A 3JYTA 1BHLA 4X66K 3BDPA 4CEFA 3JXUA 1YJNN 2E88A 4WYBA 4CZJA 4KHYA 2GBZA 3D6RA 4BR4A 5M1KA 4BR2A 3C94A 2QI2A 1QZ5A 3M8RA 3LDLA 1D9DA 4I6MB 5KRTA 3NMUA 2GTDA 1QSLA 3JAMO 5C2DA 2P51A 4DV2K 4H03B 4CJKA 4H0PA 2BANA 5FPEA 3AGKA 3AV9A 4M45A 3OYJA 3L6QA 4H4OA 1YTUA 4IDHA 1VRTA 4M3YA 3CC4N 4FWQA 1TAUA 3VPZA 3T69A 4JKBA 3ENOA 5HRNA 3DLLL 3PX6A 4K8XA 4BR5A 4PUOA 4OPHA 2ATQA 1NNEA 5AQWA 4JI6K 4DQQA 4OLAA 2OPSA 4RW8A 4BRPA 1QSSA 4AHRA 1LWFA 1B9FA 3T7ZA 3PIOL 3LPUA 3BF1A 2NRHA 3TAEA 3AY9A 4JD2A 4B9TA 1QZ6A 3AVGA 5AZIB 4Z4EA 1SKSA 4ELVA 4M3RA 1SL2A 5I3UA 3V9XA 4W5RA 1OVQA 3SQ1A 4KB0A 1BA0A 5SWMA 4CHPA 4DQRA 5FRNA 5LMNK 4CJWA 4FVMA 1Q18A 4HHTA 3IG1A 4HCCA 2X74A 2ZQBA 4GMJB 1U49A 3A2FA 1R59O 1ZBFA 1E4GT 3EL2A 2XHBA 4WQ4C 3M8SA 1GLAG 2P9IB 3WNGA 4K42A 3ZT0A 4YFUA 1J9AA 3CMAN 3KD5E 3MK6A 2KZMA 4ISFA 1BQNA 4KHSA 1KXPA 1RT3A 4B3SK 1B9DA 5AR0A 4GKKK 3VEXA 3LP1A 1QTMA 4CGJA 4M3WA 4B3RK 4CBWA 1SQKA 1VSKA 1HQEA 1RTJA 2IIRA 3CJAA 3CCJN 4AM7A 2Q3SA 1O13A 4DR2K 3U6FA 1JLFA 5C15A 2A1SA 4B1WB 5TKWA 2YHAA 1ZBSA 1HNWK 3SJHA 3H1VX 1W97L 5J2PA 1L3SA 4CGDA 3I8BA 3O9QA 1IKXA 2GUPA 2CH5A 4EAHD 5GIOA 1HQUA 2FSJA 2G8KA 1WAFA 3DLHA 2HBKA 1S1UA 1QQCA 3THXA 1X3MA 3RRHA 3G71N 4B3MK 1HPZA 4AQYK 1RTDA 2ZGZA 2XY5A 2W6KA 3FR0A 4DV3K 3CJ7A 4CZFA 4LF4K 4J2DA 2V7YA 4E89A 3L4QA 2EHGA 2G8UA 4ICLA 3SAFA 3CM5A 3EN9A 2X78A 3LPTA 4YY3K 1X9SA 3CD6N 3AAQA 5AQJA 4NLBA 4XEIA 1RT7A 3MWPA 1YTAA 2WC9A 1IBMK 4H0YB 3OBYA 4CZHA 1LCUA 3T19A 4BR0A 3DLBA 1BO5O 4RW4A 2E2NA 4N41A 1Z26A 3UKUB 5JS2A 1ZC6A 2O8DA 1D9FA 3QB0A 2EWSA 3ZSWA 4JI8K 3VQQA 4CGGA 4O5BA 3FZHA 1TK5A 4OPKA 2FXUA 5SZTA 3VQ4A 5AQQA 4DSKA 4CEEA 3ATVA 3QNOA 3A8YA 4DF4A 4RG8A 4X64K 2H3GX 3RMAA 2ZF5O 3L2VA 3MN9A 3FZKA 4A5BA 4JI3K 1JCEA 4DTUA 3DXKA 2O4IA 1YIJN 1ZBUA 3QNNA 1YHQN 5KPZA 4CVNE 4WFAL 1XNRK 4DQSA 1GOAA 1U2VA 1A5WA 2ZJPL 4AHSA 2KHOA 3ID8A 4CI6A 1NMDA 5AZJB 4BQLA 5AQHA 3PSIA 1L3TA 1Y64A 3HTVA 1REVA 2X6NA 4BE2A 1JL1A 3J7YP 5FRMA 4AILC 5M1QA 3PV8A 3SPYA 4AH9A 4KFBA 4BR7A 1RT2A 5JMVA 1TUYA 3L3UA 4NLCA 2RPIA 3TAQA 4DMNA 3NH0A 2O8BB 5I9EB 1K8AO 3OS0A 1SV5A 1JLEA 4AHUA 1RDWX 2WUSA 4M3ZA 3CJBA 4FOIA 4GW6A 4BRFA 1NGGA 4WE1A 2O8CA 2UU9K 2GEMA 2E2OA 1DGKN 2Q31A 4IXCA 4MLEA 4CECA 3H6EA 3THYB 3S9HA 3WEEB 3FE1A 4JV5K 3P5JA 3QIOA 4DTMA 3NAEA 3IUCA 1S1TA 3QDKA 1HMVA 3NGYA 3FGUA 1TYQB 4GVMA 4PKIA 4KAZA 1NGJA 3D2EA 1MDUB 4BVOA 3ULDA 3RR8A 5JLHA 4FWNA 4KHPK 3I33A 3ID6A 4CEBA 1U47A 3ITHA 1KRPA 4CEZA 1SKRA 3ZLJA 3L0QA 4B08A 2OANA 4F4KA 4FCYA 4LY7A 3QEPA 3QMLA 3DMJA 4O5FA 5JICA 5JVGL 1NKEA 4A62A 3O9RA 3OYLA 3G10A 4DQIA 3L8BA 2D0PA 3RRGA 1VQ4N 4Q5VA 4KH5A 1EWRA 3BZKA 1IV0A 1BDGA 3VTHA 3SZ2A 4DU3A 1HNVA 4YDUA 1BI4A 4CBXA 4CJ5A 2E5LK 2FBXA 1H1VA 2G8FA 4K41A 1KQSM 3MEEA 3F73A 1JLQA 2CGKA 3CFOA 4RW6A 2R7YA 3BP8A 1ASWA 1KD1O 3CQYA 5C10A 4JKHA 3TI0A 3DXMB 1W0HA 2E4LA 4KTZA 5HOOA 3UKUA 4CHZA 3AARA 3VQPA 3RTVA 2VQEK 4XIUA 2A40A 3KD1E 4GNIA 4H0OA 3VESA 3K9JA 4H5WA 4Y1DA 1VQON 5M1NA 1FW6A 4KREA 4AM6A 2ETJA 1BCOA 3WQTA 1XHZA 3EZWA 1NK4A 1SKWA 4CJ7A 3LL3A 1RGIA 2QWLA 2ITMA 1VQPN 3BUZB 1A5VA 5GADP 4H0VB 2QM1A 4CF2A 2O8EA 3O4NA 3H08A 4DSLA 2GWKA 3DLGA 4IOXA 4JN4A 1GLCG 4JAXA 1TL1A 1M90O 5LY3A 3TARA 1LW0A 1MWKA 3M3ZA 4KRFA 2B5JA 3L2WA 3CFPA 4QS8A 1QQNA 3TTDA 1N34K 5FDLA 4C8LA 2A6AA 1HJOA 2KQ2A 5B8HA 3CPWM 3MN6A 3MWTA 4CZLA 2AA4A 2HHUA 4EFHA 4RWTA 1T03A 1ASUA 3SLCA 3QESA 1QQMA 4E7LA 1S1XA 2O8BA 3P4IA 3VQEA 3QEIA 3SQ2A 4J2BA 4IKFA 3VEZA 1Y97A 4DSEA 3W3DA 2YHYA 3TAFA 3J8AA 1C1BA 3SUQA 5D3GA 4IFVA 3W0LA 1YUWA 4JI2K 4B1YB 4BC4A 3E1YA 3OYIA 1BA1A 2G8VA 4CJLA 3EE8A 4DG1A 1K8KA 1DLOA 1WSHA 2D0CA 3HM9A 1RILA 2W6LA 1RT5A 1I3AA 3V1QA 4O0IA 1FKPA 2IS3A 3WXJA 4AHVA 1YAGA 4C1NK 4CGHA 5EOYA 3O1BA 4CBUA 2P9KB 3RVCA 5KPRA 2QXFA 2HBLA 2HMIA 4Y0WA 1QHTA 3EEQA 4FJJA 1N6QA 4FJGA 1KLNA 2YKNA 3LDSA 3QETA 4B9SA 4KV8A 2FBTA 3SV3A 3NF6A 3HPHA 4CHNA 4PL8A 1NK5A 3ZX0A 4F8RA 4CJTA 3C7NB 5HL7L 1XMOK 4DV5K 1CXQA 5DMRA 3BF3A 4W5OA 4FLVA 4G1QA 3SAGA 2DFEA 3D2FB 4IJAA 5KGWA 1QHAA 3AVHA 3OTOK 3TANA 1Q8IA 1Z6RA 2Q1NA 3SBGA 2XO7A 4JRQA 2GWJA 2Q2RA 1QE1A 1G15A 2VWBA 2QWOA 1KCFA 3LDOA 3LZJA 3NBPA 4PWDA 2YHWA 4I9QA 4OO1J 4KI4A 1ZXOA 1B92A 2P9UB 4C8OA 4IWVA 3KKRA 4MLHA 2HHVA 3L4IA 2ITGA 2IVNA 1DTTA 1YVUA 4HUGA 3SPZA 1JLAA 2VWKA 3DOLA 4CK3A 1U04A 1VK0A 4CK2A 3L3VA 3DYAA 3ZSVA 1LWCA 3MCPA 4DV0K 2XY8A 4DR6K 4CD1A 2VGMA 3IS9A 5CHIA 1NG9A 2YKMA 1BIUA 4M7XA 3BZCA 5BPLA 4ILGB 5BREA 1NJXA 3RWUA 4E1MA 1CZAN 4CERA 3BEXA 1C1AA 2XRIA 3SBTA 1HYVA 3R9PA 3DRRA 3H3NO 4C8NA 5BRHA 1N8RO 3HBTA 4YNQA 3SV4A 1NOYA 1VQ8N 4WQ5A 5F1XA 3DOKA 3CFRA 3VA3A 3ZX2A 4NCGA 5AQOA 4LSNA 4FVUA 4A5AA 4CZEA 4DHYA 3R1XA 1VRUA 2A1RA 1OH5A 2ASMA 2ASPA 3QINA 4H4MA 3O3GA 1GLLO 4FWKA 2VCPA 3ZT4A 2JLEA 2NNWA 4LF7K 5AQGA 2QKKA 3VQCA 3ZETA 5HLFA 1T6DA 3JS6A 1TKTA 4B3OA 1VSIA 1HKBA 2P9NB 2E2PA 1C0TA 4BVPA 2CGLA 4QS9A 4GKJK 3RSEB 1RBUA 4LSLA 5J2NA 5J2MA 3CYMA 3D45A 1NKCA 4CEOA 2VG6A 1C0FA 3KK7A 3DLEA 4CZIA 4W5TA 1ZBIA 1X9JA 4BQZA 1QSYA 4MO5A 4MDAA 5KGXA 4QS7A 1EX4A 3CC2N 2QKBA 5LJVA 4HVJA 3D7EO 4FJXA 3P31A 5J2QA 5FPDA 4WFNL 1W9HA 4NCBA 2IAJA 5AQYA 3GBTA 1BIZA 5FLXO 2HHQA 4B8AB 3S41A 4KTQA 4PKHA 1NJYA 4L3QA 4EIAA 3T3FA 2V7ZA 3T1AA 4DR5K 2YJEA 1VSFA 4A59A 3LDQA 4XH1A 4CW7B 4B9NA 1UA0A 5AQKA 5DM7L 1NGAA 4M3UA 2O4GA 3M8PA 1EO1A 1JKHA 1J5OA 4M63C 2UUAK 4JLHA 3KTQA 4JHDB 3M5RA 1OH8A 3A0IX 3O08A 4PKGA 3KLFA 4DV4K 3THWB 5C0YA 2X6SA 3UIQA 4KHWA 3H1QA 4RW9A 5GINA 1YJ9N 4LF9K 3E9OA 2VYPA 1NGDA 4FOEA 3HK2A 2WTUA 4Z94A 4W5NA 1HKCA 3D2FA 2OPPA 3R3LA 1GLEG 2FF3B 1SL1A 3V9WA 3A5NC 5AFUA 4ELTA 3LALA 1YJWN 1S5JA 4JKGB 5KQ8A 2A42A 1SL0A 1NBWA 5KRSA 4A2BA 4DTRA 3VGLA 5LJWA 3AO3A 4CJVA 5J1EA 2O8FB 1S6PA 4U67L 2P9UA 4DV7K 2G8HA 2FF6A 3SQ4A 3MCAB 5MLCQ 1NU0A 2YNGA 3J7AP 3VA0A 1GLBG 4NB4A 3VQAA 3FZLA 4L8RB 1KSPA 3AVFA 1HRHA 2XY7A 3O9SA 4ISEA 4ILJA 3WXIA 3O6WA 4B3TK 4B9LA 3KLHA 3U3GA 1TL3A 4ILHA 1TK8A 4H5TA 3P83D 4LF6K 4IJNA 1NK9A 5E41A 3AAPA 3MMVA 2NZTA 4DSJA 4DS5A 3NF7A 3OW2M 4BROA 1WAJA 3K5LA 4M3XA 1T8EA 3O5BA 3QO9A 4OGCA 4FLTA 3WNEA 2RE2A 1XWLA 2KKZA 1ZYQA 4B9QA 3S3OA 3U4LA 4PL7A 5KPTA 3VERA 1JCFA 3CIPA 1LAVA 4MQ3A 4IFYA 5AQPA 3LDPA 2Z1GA 5AQSA 3F9KA 1QQOA 2NRTA 2NRRA 4AHTA 3CCLN 4GV3A 1P8ZA 2E6MA 3V9SA 1RFQA 4LC9B 3G4SN 3UB5A 1VSLA 1LAWA 3ZT1A 4IDKA 3CC7N 3FZFA 4HTUA 4X65K 3O4WA 4I6MA 1FKOA 3ENBA 1V4TA 4MO4A 5HBMA 3ZSZA 4HTLA 2F8SA 1KAXA 1UAXA 2P9LB 4FWOA 2VQFK 2D0BA 4H5NA 4IG0A 1S72N 2P9NA 1WUAA 2PBDA 1HPMA 2AJQA 3NVKA 3CCUN 4JK9A 2GX9A 2VGNA 4CJSA 4FK0A 2HB5A 1NK8A 3ULEB 3QLHA 4K8ZA 1JLCA 4E1JA 1VSHA 2OPQA 3HM8A 1VSJA 4BRNA 5BRDA 5T7BA 2FSKA 3SNNA 3VETA 4YORA 1D8YA 3MXIA 3HL8A 1QS4A 1MU2A 4CJQA 1WN7A 4CFCA 1ASVA 2HNYA 3TABA 1TV6A 4CGFA 3NF9A 3VF4A 5ADXH 4HCBA 3WXLA 4KH4A 3U9ZA 1HNIA 5AZIA 1E3MA 3QFPA 4FJKA 2WBNA 2ZWHA 3VQ7A 4J2EA 3KWGA 3M6GA 3ATUA 1DT9A 2ASOA 3VEYA 5HRRA 1WSIA 2P9IA 1EETA 3SI6A 2BE2A 3O80A 3J80O 3SQ0A 2HVIA 2BGGA 4HUFA 3AA3A 4BWMA 4B1XB 2CH6A 1RNHA 3AO4A 4U7BA 1RT6A 3IFRA 3V4IA 1TAQA 4BRDA 4FWMA 3KK3A 4G9ZA 4W5QA 3M1FA 1VQ7N 4IO8A 1TKXA 2ZE2A 4MFBA 3KLGA 3KK1A 3IKMA 3VQDA 1Q86O 5ELZA 3HVTA 3J7ZO 4M42A 1KVBA 2OCEA 3LM2A 4XH4A 3UE5A 1N32K 3E9LA 4DFMA 2HBJA 2QWPA 4FWPA 4R5PA 4LFAK 1VQLN 3C0BA 2PYJA 2KFZA 3HVRA 1ZBHA 1KTQA 2GUIA 1VQ5N 2WOMA 3N4PA 4B9MA 4JKAA 4C8MA 4CIEA 4V19S 2D5RA 4Z4GA 1LW2A 3MEGA 4YOYA 3T1HK 4A57A 3O8MA 3VF2A 4CJPA 2YNFA 4QAGA 4C23A 2NLXA 4DSFA 4PQUA 4AF1A 4CGIA 2E1ZA 4LD0A 2VG7A 4B8CA 2ZD1A 4EHUA 4DSIA 1XC3A 3G6EN 4EHTA 2HNZA 3WUHA 2OTLN 4PA1A 4BGAA 1T6CA 1RBVA 3CXCM 5HP1A 1R0AA 3GDQA 3OBWA 2YCHA 1S22A 3GG4A 5ADXA 4DU4A 2IC3A 4NYFA 4CZMA 4BRLA 2WFBA 1WNSA 2UXDK 3TSPA 4E7KA 3AO5A 4YHHK 4WF9L 1IG8A 4DKWA 3SJJA 4ID5A 5AQTA 1BWFO 3O1WA 1HLUA 3OYAA 1I94K 4JI0K 3TR8A 3G25A 3V6DA 2YJFA 3P39A 3AVIA 3P38A 5C2FA 1OH6A 3HOTA 3HSTB 3VQ9A 2KW4A 1M1KO 5DK5A 1MA9B 3ZT3A 2BH1A 5F2RA 3KIOA 1NMNA 1IO2A 1O1WA 3I56N 4CFAA 1I39A 1D5AA 4NYNA 4DTXA 4JS4A 3CQXA 4O44A 1RTIA 2HF3A 2HVHA 3VOVA 3Q7CA 1RBTA 3ZSXA 3VEOA 3NFAA 2QTDA 3U8XA 3FZMA 3B6PA 5AZJA 4IEEA 4FWLA 3HYFA 3TTFA 4CJRA 3NF8A 4KBOA 1L3VA 4RTFD 2KZZA 3OYEA 1VAZA 2AP1A 1HJRA 1WSGA 4JI5K 5E26A 4ISGA 4YOXA 4JI4K 3VQ5A 4H8KA 4KB1A 1FK9A 5AQZA 1VQ6N 1HKGA 4B1ZA 1WLJA 2HNDA 4E19A 1F21A 1NGFA 5AQVA 5I42A 4M3TA 3TU5A 2J4RA 5CY4A 4BWJA 2DFHA 1JXEA 3WNHA 1RT4A 4F9OA 2RF2A 2ZM6K 3FLCO 3ZYYX 5K14A 5LL6Z 5CZ2A 3VMFB 1X3NA 1S6QA 3THYA 4EZ6A 1SZ2A 3AVKA 3D0PA 4KHUA 3WEEA 5CR4A 1LWEA 2Q97A 2NRXA 4LFBK 4CZGA 3KKSA 1IH7A 3ZCMA 2E8AA 4O8KA 1YVNA 4KPYA 4N47A 4IOCL 4DU1A 1X1PA 4NXNK 5AQIA 2D0AA 4AHCA 5GAHP 1KAYA 2FBYA 1TYQA 3AVCA 4DR1K 4KO0A 3CQ8A 2NRWA 1U4BA 4FL9A 2NRZA 4JD2B 4FJHA 1BOTO 3KWIA 1NK0A 1OKJA 1S9EA 4K43A 3OYBA 1S9GA 3AA2A 2E1YA 1JLGA 1KFSA 3TAGA 3TSUA 2Z1IA 3KHYA 3CHWA 4F2RA 3GOIA 2QWQA 5CYQA 3UKRB 1VHXA 4FM2A 4BRIA 2Q0UA 1EXQA 2I7NA 4A61A 2HHWA 1VQMN 4FJ7A 1WBDA 3V1OA 3RMBA 1XUPO 2F96A 2E20A 1J53A 5EXWA 3K5MA 4E7IA 4CJ4A 3CI5A 2F9TA 1C6VA 4I9LA 1L3UA 2UXBK 3OA9A 4OGEA 3ZEUB 1TK0A 3LZIA 4GV9A 1IBKK 2QWMA 3MX5A 4FJLA 3ASMA 4KTWA 3NCIA 2D0OA 3DLKA 3HP9A 4DV1K 3E9PA 4KI6A 2LSNA 3IAYA 2XY6A 3PLAA 3VEVA 3DXMA 5M1OA 3DJCA 2FBVA 1EQYA 3BGRA 2GELA 4FJMA 1K6YA 3VGKA 3ALYA 3O3FA 4K25A 1WOQA 2QXLA 4IEIA 3K2PA 5HRSA 2V51B 3OYDA 1BISA 3NDKA 2F7TA 3ZSRA 3THXB 3V1RA 4O55A 4Z4CA 3QIPA 1VSEA 2OZMA 3JSMA 2IGIA 5AQFA 4B1VA 2HSTA 2UUBK 2ZGYA 5BR8K 3HJFA 4N56A 2Y1JA 1EP4A 5DM6L 2PY5A 1TVRA 2PAVA 4BDPA 2W40A 3PIPL 3CCQN 5AFUH 5BN9A 3AO2A 2Y1IA 3B6OA 4OKKA 1YF5L 3OYHA 1NJIO 3O9UA 2CGJA 3E66A 2O8DB 4DFJA 1LOTB 2IOCA 4F3TA 4BRHA 1NGIA 4BC3A 3F5TA 4FJ8A 4UY8O 3WT0A 2HOEA 4CF1A 1C1CA 1UWBA 4FXDA 2D1KA 4FW1A 4CHOA 4FYDA 1IKVA 4PY5A 3KK2A 4C1NI 2QWRA 3F9MA 3DAWA 3VQ8A 4OVLA 4E7JA 3DM2A 3H3OB 4FM0A 1ITGA 4CEAA 3WQUA 3A5LC 4BY9C 2PYLA 3K57A 3DXKB 5KQDA
chains in the Genus database with same CATH topology
1NGHA 1JCFA 1NGBA 2IVOA 1BDGA 3CIPA 3HI0A 3VTHA 2OTJN 2I7PA 3EE9A 1T3VA 5AQPA 3LDPA 4YDUA 4FWSA 4JKEA 5AQSA 3SMSA 1QQOA 4CBXA 2NRTA 3A5MC 3CJCA 2NRRA 3CCLN 4GV3A 1P8ZA 3MN5A 1H1VA 5EVZA 4K41A 3QICA 1KQSM 1RFQA 4DQ8A 4LC9B 1K73O 1U2VB 3G4SN 3UB5A 1NLVA 5EY4A 4BRKA 2CGKA 3CC7N 3FZFA 2YI1A 3O4WA 4I6MA 4IO9L 3ENBA 1V4TA 4MO4A 3BP8A 4HTLA 1KD1O 3CQYA 3K9KA 1KAXA 2P9LB 4FWOA 4JKHA 5C10A 2Q36A 1TUUA 4H5NA 1S72N 5GAEP 2P9NA 1WUAA 2PBDA 1HPMA 1Q81O 4BRQA 2P9KA 3CCMN 3NVKA 3A5OC 3DXMB 3CCUN 4XH5A 4JK9A 4M7YA 1W2BM 2GX9A 4WFBL 5HOOA 3VGMA 2VGNA 3EO3A 1P90A 3UKUA 3AARA 4H5RA 3AGRA 3MX2A 5GAGP 3ULEB 2HMPA 1SAZA 1OVYA 4JKCA 4E1JA 3HM8A 2A40A 3EKSA 4BRNA 2ZJRL 5BRDA 4GNIA 1VQNN 4H0OA 4IZ9A 5AQRA 2FSKA 3K9JA 3VESA 4H5WA 1VQON 1NM1A 5M1NA 3VETA 5FPMA 1IJJA 1JCGA 4YORA 2JWKA 4AM6A 5JLFA 3WQTA 3TTCA 3EZWA 3VF6A 1V4SA 3SMPA 3MN7A 4CJ7A 3C7NA 2HF4A 3LL3A 1RGIA 3KVGA 2QWLA 2A5XA 2ITMA 3CCVN 3UKRA 3VF4A 1VQPN 5ADXH 3BUZB 5BN8A 5JVHL 4PHTX 3WXLA 2D4WA 4KH4A 4H0VB 4BRCA 3U9ZA 5GADP 2QM1A 3C6AA 4B1UB 4KH6A 5AZIA 1YI2N 2Q0RA 3O9TA 1NGEA 2QEXN 3LM9A 3QFPA 2GWKA 2JWLA 5CE3A 1T44A 2WBNA 2V52B 4IOXA 2ZWHA 4CD3A 2YHXA 4JN4A 1GLCG 4JAXA 2QA4N 3KWGA 1RDUA 5M1FA 2HBMA 1M90O 5LY3A 1GLJO 3D2EB 3M6GA 3ATUA 1DT9A 1MWKA 3GE1A 3M3ZA 5FPNA 4BRMA 3CCSN 2ASOA 3ZEUA 3VEYA 2P9IA 2QWNA 5AQMA 4OPAA 3CERA 1QQNA 4QS8A 3TTDA 1D4XA 1J6ZA 3O80A 2A6AA 1HJOA 5B8HA 3CPWM 3WXMB 3LDNA 3MN6A 4B1XB 1S3XA 4DCHA 5BR9A 3MWTA 3IDHA 4H0TB 2CH6A 4CZLA 2AA4A 4YOVA 4U7BA 4EFHA 3QFUA 1G99A 4RWTA 3SLCA 1DKGD 3IFRA 1QQMA 4BRDA 2E2QA 4YOTA 1GLFO 4FWMA 3P4IA 4JK8A 4YOUA 4G9ZA 1ATNA 3M1FA 3VEZA 4IO8A 1VQ7N 2RHKA 2P9PA 5AQUA 5EX5A 3W3DA 3CCEN 2F9WA 3IKMA 2NRVA 1Q86O 2YHYA 5ELZA 3J8AA 3J7ZO 3JXUA 1YJNN 2E88A 4WYBA 3W0LA 4CZJA 1HUXA 1YUWA 2IVPA 3LM2A 3D6RA 4XH4A 3E9LA 3UE5A 4BR4A 4B1YB 4BC4A 1ATSA 3ENHA 2HBJA 2QWPA 4FWPA 3E1YA 5M1KA 1BA1A 5M1PA 3IMXA 3EE8A 4BR2A 2QI2A 1QZ5A 1VQ4N 1VQLN 4HWIA 3C0BA 3LDLA 1Z05A 1K8KA 1BU6O 4I6MB 3NMUA 2A41A 1VQ5N 2GTDA 1ESVA 3N4PA 4JNEA 4JKAA 4O8UA 5C2DA 3WXJA 3C65A 1YAGA 4C1NK 4H03B 4YOYA 4H0PA 5EOYA 3O1BA 4A57A 2P9KB 3RVCA 4CBUA 5KPRA 5FPEA 3AGKA 4BGBA 2HBLA 3L6QA 3O8MA 3VF2A 4Y0WA 4YDUC 4IDHA 4C23A 2NLXA 3CC4N 3VENA 3CF5L 4AF1A 4BC2A 4FWQA 2E1ZA 3VPZA 3T69A 4JKBA 3CETA 3ENOA 3DLLL 4BR9A 4EHUA 1XC3A 3HRGA 4EHTA 3G6EN 4BR5A 4OPHA 3WUHA 2OTLN 5AQWA 4PL8A 4BGAA 3ZX0A 3NVMA 1T6CA 4BRPA 3CXCM 3T7ZA 3GDQA 3RSEA 3C7NB 5HL7L 3OBWA 2YCHA 1S22A 3GG4A 5ADXA 2KLAA 3PIOL 4CZMA 3BF1A 4BRLA 2NRHA 3BF3A 4CZKA 3AY9A 2WFBA 3N4QA 4JD2A 3TSPA 1QZ6A 3SAGA 3D2FB 4IJAA 5AZIB 4BREA 1QHAA 4WF9L 1JJ2M 1IG8A 4DKWA 4BG9A 5AQTA 1BWFO 1BA0A 1Z6RA 1HLUA 3CPEA 3O1WA 4GV6A 2Q1NA 3SBGA 2GWJA 1Q18A 1U6ZA 3G25A 2Q2RA 2YJFA 1E4FT 3P39A 3P38A 2VWBA 2QWOA 5C2FA 4WQ4A 5H1SQ 3LDOA 3HOTA 4MDBA 1R59O 1M1KO 1KC8O 2YHWA 4OO1J 1E4GT 1MA9B 1ZXOA 3EL2A 4WQ4C 2BH1A 5F2RA 1GLAG 2P9IB 2P9UB 4K42A 5BPMA 4IWVA 4MLHA 3I56N 4BRAA 3CMAN 3L4IA 2QW9A 2IVNA 3MK6A 1NGCA 2FSNA 4RCHA 4ISFA 1KXPA 3CQXA 3U9DA 1NWKA 2HF3A 5AR0A 3VEXA 3VOVA 3Q7CA 4FSVA 5GIPA 3H46O 4FO0A 3VEOA 3VEWA 2P9SB 4CBWA 1SQKA 2QTDA 3MCPA 3U8XA 5AQXA 3ZX3A 3FZMA 2VGMA 4CD1A 1Q82O 1VQ9N 1SS6A 5AZJA 2IIRA 3CCRN 3CJAA 4FWLA 4IEEA 4AM7A 3CCJN 4R79A 1O13A 4JHDA 3TTFA 5CHIA 4J8FA 4M7XA 4KBOA 5BPLA 4ILGB 4RTFD 5BREA 1K9MO 5C15A 4UY8O 1VAZA 2AP1A 1CZAN 5E26A 4ISGA 5AQNA 3BEXA 4B1WB 5TKWA 4YOXA 1ZBSA 3GL1A 1C0GA 3SJHA 3TSQA 1BUPA 1VQKN 3H1VX 5BPNA 5AQZA 1W97L 1VQ6N 1HKGA 4B1ZA 3SBTA 3I8BA 3O9QA 2GUPA 3R9PA 1K8KB 1NGFA 2CH5A 3H3NO 4FPAA 5AQVA 4EAHD 5BRHA 3TU5A 5GIOA 1N8RO 2J4RA 3HBTA 1VQ8N 2FSJA 4WQ5A 5F1XA 3H45C 3KZBA 3HZ6A 3ZX2A 2HBKA 4F9OA 1X3MA 5AQOA 4JKGA 3G71N 4FVUA 4A5AA 3FLCO 4CZEA 3ZYYX 4DHYA 4JKFA 2ZGZA 3R1XA 3R6MA 3FR0A 5KQDA 3CJ7A 2ASMA 3VMFB 1X3NA 4CZFA 2ASPA 2V7YA 1GLLO 4FWKA 3L4QA 1SZ2A 2VCPA 3SAFA 3EN9A 3WEEA 2NNWA 5CR4A 2PFUA 3MDQA 2Q97A 2NRXA 5AQGA 3EKUA 3VTIA 4CZGA 3ZETA 3CD6N 1T6DA 3JS6A 3AAQA 5AQJA 2E8AA 4NLBA 1YVNA 3MWPA 4O8KA 1HKBA 2WC9A 4XEIA 4H0YB 3OBYA 2P9NB 2E2PA 4CZHA 4IOCL 1LCUA 2DPNA 4BR0A 4BVPA 1BO5O 5AQIA 2CGLA 3HSCA 4QS9A 3RSEB 3I55N 2E2NA 5GAHP 3UKUB 1KAYA 1Q7YO 1XQSC 1TYQA 1ZC6A 4IFEA 2NRWA 3C6HA 3QB0A 4FL9A 1C0FA 2NRZA 4JD2B 5E84A 4JEPA 5F0XA 2EWSA 1BOTO 3KWIA 1OKJA 3KK7A 4CZIA 1X9JA 3FZHA 4K43A 1ILYA 4BRGA 4BQZA 2FXUA 4MDAA 4MO5A 2E1YA 3R8EA 3Q7BA 3TSUA 5AQQA 4QS7A 3KHYA 3QBWA 3ATVA 2W41A 3CHWA 3CC2N 3A8YA 3GOIA 5LJVA 4YOWA 1BG3A 2QWQA 3D7EO 3UKRB 3CMEN 2H3GX 4BRIA 2Q0UA 3P31A 4NO7A 5C12A 2ZF5O 3MN9A 3FZKA 4A5BA 5FPDA 4WFNL 3B8AX 2I7NA 4A61A 1JCEA 5AQYA 3DXKA 3GBTA 1YIJN 1VQMN 4WCEL 3S41A 1DEJA 1KAZA 1XUPO 2E20A 4PKHA 4L3QA 1YHQN 5EXWA 4EIAA 2V7ZA 5KPZA 4H0XB 3CI5A 2YJEA 4A59A 3LDQA 2F9TA 4XH1A 4WFAL 1U2VA 3OA9A 5AQKA 3ZEUB 5DM7L 2KHOA 1NGAA 2ZJPL 1GLDG 2YX6A 3ID8A 1NMDA 2QWMA 4CI6A 4GV9A 1EO1A 3MX5A 5AZJB 4BQLA 5BRFA 4M63C 2D0OA 4GVEA 4JHDB 3M5RA 5AQHA 3A0IX 2P9LA 1Y64A 3E9PA 3HTVA 3O08A 4PKGA 5AQLA 3DWLA 5C0YA 2BUPA 3PLAA 3H1QA 5M1QA 3VEVA 5GINA 1YJ9N 3DXMA 5M1OA 3DJCA 3E9OA 2VYPA 1EQYA 4BR7A 1NGDA 2GELA 4FOEA 5JMVA 1TUYA 4NLCA 3FFKB 1QVFM 3ULEA 1QVGM 5I9EB 3VGKA 2BTFA 1K8AO 4Z94A 3CJ9A 1RDWX 4K25A 1WOQA 2QXLA 1HKCA 2WUSA 3D2FA 4IEIA 2V51B 3CJBA 5TKYA 3R3LA 1GLEG 2FF3B 2P9PB 4FOIA 4BC5A 2F7TA 3A5NC 3TPQA 4BRFA 5AFUA 1NGGA 3F2KA 1YJWN 4JKGB 5KQ8A 2GEMA 3CJ1A 2A42A 2E2OA 1NBWA 1DGKN 2Q31A 4IXCA 4MLEA 4A2BA 3SAHA 4GY2B 3VGLA 4FPBA 1MWMA 5LJWA 3H6EA 5AQFA 4B1VA 2HSTA 4DB3A 2ZGYA 3WEEB 3HOSA 4U67L 2P9UA 2A3ZA 3ZETB 2FF6A 5DM6L 3FE1A 4H5VA 3MCAB 4WQ5C 5MLCQ 2PAVA 1HX1A 2W40A 3IUCA 3PIPL 3CCQN 5AFUH 2ZJQL 3QDKA 1ATRA 1GLBG 4NB4A 5BN9A 3WXKA 3FZLA 1YF5L 1NJIO 3FGUA 1TYQB 4PKIA 3O9UA 4BG8A 1NGJA 3O9SA 2CGJA 2UYTA 3D2EA 3E66A 3QBXA 4ISEA 1LOTB 1MDUB 4ILJA 2P9SA 4BVOA 4BRHA 1NGIA 2FLOA 3F5TA 3OHRA 4BC3A 5JLHA 3WT0A 2HOEA 3WXIA 3O6WA 4FWNA 1YXQA 3I33A 4ILHA 3ID6A 4H5TA 4IJNA 2D1KA 1YITN 3AAPA 3MMVA 2NZTA 4C1NI 2QWRA 3L0QA 3OW2M 3F9MA 2OANA 3DAWA 4BROA 4IOAL 3H3OB 3O5BA 3QMLA 4O5FA 5JICA 5JVGL 2RE2A 3SK3A 4A62A 2KKZA 3O9RA 3WQUA 4B9QA 3A5LC 4JKDA 4FWRA 4JK7A 4A2AA 4BY9C 3U4LA 2D0PA 4PL7A 3DXKB 5KPTA 3VERA 4KH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGH A;  1JCF A;  1NGB A;  2IVO A;  1BDG A;  3CIP A;  3HI0 A;  2I7P A;  5AQP A;  3LDP A;  4YDU A;  4FWS A;  5AQS A;  3SMS A;  1QQO A;  4CBX A;  3A5M C;  3CJC A;  1P8Z A;  3MN5 A;  1H1V A;  5EVZ A;  4K41 A;  3QIC A;  1RFQ A;  4DQ8 A;  4LC9 B;  1U2V B;  3UB5 A;  1NLV A;  5EY4 A;  4BRK A;  2CGK A;  3FZF A;  2YI1 A;  3O4W A;  4I6M A;  1V4T A;  4MO4 A;  3BP8 A;  4HTL A;  3CQY A;  1KAX A;  2P9L B;  4FWO A;  2Q36 A;  1TUU A;  4H5N A;  2P9N A;  1WUA A;  2PBD A;  1HPM A;  4BRQ A;  2P9K A;  3A5O C;  3DXM B;  4XH5 A;  4M7Y A;  3VGM A;  3EO3 A;  3UKU A;  3AAR A;  4H5R A;  3ULE B;  2HMP A;  1SAZ A;  4E1J A;  3HM8 A;  2A40 A;  3EKS A;  4BRN A;  5BRD A;  4GNI A;  4H0O A;  4IZ9 A;  5AQR A;  2FSK A;  3VES A;  4H5W A;  1NM1 A;  3VET A;  5FPM A;  1IJJ A;  1JCG A;  4AM6 A;  5JLF A;  3WQT A;  3EZW A;  3VF6 A;  1V4S A;  3SMP A;  3MN7 A;  4CJ7 A;  3C7N A;  2HF4 A;  3LL3 A;  1RGI A;  3KVG A;  2QWL A;  2A5X A;  2ITM A;  3UKR A;  3VF4 A;  5ADX H;  3BUZ B;  5BN8 A;  3WXL A;  2D4W A;  4BRC A;  4H0V B;  3U9Z A;  2QM1 A;  5AZI A;  2Q0R A;  1NGE A;  3LM9 A;  3QFP A;  2GWK A;  5CE3 A;  1T44 A;  2V52 B;  2ZWH A;  4CD3 A;  2YHX A;  4JN4 A;  1GLC G;  4JAX A;  5LY3 A;  1GLJ O;  3D2E B;  3M6G A;  3ATU A;  1MWK A;  3GE1 A;  3M3Z A;  5FPN A;  4BRM A;  2ASO A;  3ZEU A;  3VEY A;  2P9I A;  2QWN A;  5AQM A;  3CER A;  1QQN A;  4QS8 A;  1D4X A;  1J6Z A;  3O80 A;  2A6A A;  1HJO A;  5B8H A;  3LDN A;  3MN6 A;  4B1X B;  1S3X A;  4DCH A;  5BR9 A;  3IDH A;  4H0T B;  2CH6 A;  4CZL A;  2AA4 A;  4EFH A;  3QFU A;  1G99 A;  4RWT A;  3SLC A;  1DKG D;  3IFR A;  1QQM A;  4BRD A;  2E2Q A;  1GLF O;  4FWM A;  3P4I A;  1ATN A;  3M1F A;  3VEZ A;  4IO8 A;  5AQU A;  2P9P A;  5EX5 A;  3W3D A;  2F9W A;  2YHY A;  5ELZ A;  3J8A A;  3JXU A;  2E88 A;  4WYB A;  3W0L A;  4CZJ A;  1HUX A;  1YUW A;  2IVP A;  3LM2 A;  4XH4 A;  3UE5 A;  4BR4 A;  4B1Y B;  4BC4 A;  1ATS A;  3ENH A;  2QWP A;  4FWP A;  1BA1 A;  3IMX A;  4BR2 A;  1QZ5 A;  4HWI A;  3C0B A;  3LDL A;  1Z05 A;  1K8K A;  1BU6 O;  4I6M B;  2A41 A;  2GTD A;  1ESV A;  4JNE A;  3WXJ A;  1YAG A;  4H03 B;  4H0P A;  5EOY A;  3O1B A;  4CBU A;  2P9K B;  5KPR A;  5FPE A;  4BGB A;  3L6Q A;  3O8M A;  3VF2 A;  4Y0W A;  4YDU C;  4C23 A;  2NLX A;  3VEN A;  4BC2 A;  4FWQ A;  2E1Z A;  3VPZ A;  3CET A;  3ENO A;  4BR9 A;  4EHU A;  1XC3 A;  4EHT A;  4BR5 A;  3WUH A;  5AQW A;  4PL8 A;  4BGA A;  3ZX0 A;  1T6C A;  4BRP A;  3GDQ A;  3RSE A;  3C7N B;  2YCH A;  1S22 A;  3GG4 A;  5ADX A;  4CZM A;  3BF1 A;  4BRL A;  2NRH A;  3BF3 A;  4CZK A;  3AY9 A;  4JD2 A;  1QZ6 A;  3D2F B;  4IJA A;  5AZI B;  4BRE A;  1QHA A;  1IG8 A;  4BG9 A;  5AQT A;  1BWF O;  1BA0 A;  1Z6R A;  1HLU A;  3O1W A;  2Q1N A;  2GWJ A;  1Q18 A;  1U6Z A;  3G25 A;  2Q2R A;  2YJF A;  1E4F T;  2VWB A;  2QWO A;  4WQ4 A;  3LDO A;  1R59 O;  2YHW A;  1E4G T;  1MA9 B;  1ZXO A;  3EL2 A;  4WQ4 C;  5F2R A;  1GLA G;  2P9I B;  2P9U B;  4K42 A;  5BPM A;  4IWV A;  4MLH A;  4BRA A;  3L4I A;  2QW9 A;  2IVN A;  3MK6 A;  1NGC A;  2FSN A;  4RCH A;  4ISF A;  1KXP A;  3CQX A;  3U9D A;  1NWK A;  2HF3 A;  5AR0 A;  3VEX A;  3VOV A;  4FSV A;  3H46 O;  4FO0 A;  3VEO A;  3VEW A;  2P9S B;  4CBW A;  1SQK A;  3MCP A;  3U8X A;  5AQX A;  3ZX3 A;  3FZM A;  4CD1 A;  5AZJ A;  2IIR A;  3CJA A;  4FWL A;  4AM7 A;  4JHD A;  4J8F A;  4M7X A;  4KBO A;  5BPL A;  4RTF D;  5BRE A;  2AP1 A;  1CZA N;  5E26 A;  4ISG A;  5AQN A;  3BEX A;  4B1W B;  1ZBS A;  3GL1 A;  1C0G A;  3SJH A;  1BUP A;  3H1V X;  5BPN A;  5AQZ A;  1HKG A;  4B1Z A;  3I8B A;  2GUP A;  3R9P A;  1K8K B;  1NGF A;  2CH5 A;  3H3N O;  4FPA A;  5AQV A;  4EAH D;  5BRH A;  3TU5 A;  2J4R A;  3HBT A;  2FSJ A;  4WQ5 A;  5F1X A;  3H45 C;  3KZB A;  3HZ6 A;  3ZX2 A;  4F9O A;  1X3M A;  5AQO A;  3FLC O;  4CZE A;  4DHY A;  2ZGZ A;  3R6M A;  3FR0 A;  5KQD A;  3CJ7 A;  2ASM A;  4CZF A;  1X3N A;  2ASP A;  2V7Y A;  1GLL O;  4FWK A;  1SZ2 A;  2VCP A;  3EN9 A;  3WEE A;  3MDQ A;  2Q97 A;  5AQG A;  3EKU A;  4CZG A;  3ZET A;  1T6D A;  3JS6 A;  3AAQ A;  5AQJ A;  2E8A A;  4XEI A;  1YVN A;  4O8K A;  1HKB A;  4H0Y B;  2P9N B;  2E2P A;  4CZH A;  1LCU A;  2DPN A;  4BR0 A;  4BVP A;  1BO5 O;  5AQI A;  2CGL A;  3HSC A;  4QS9 A;  3RSE B;  2E2N A;  3UKU B;  1KAY A;  1XQS C;  1TYQ A;  1ZC6 A;  3QB0 A;  4FL9 A;  1C0F A;  4JD2 B;  5E84 A;  5F0X A;  2EWS A;  1BOT O;  1OKJ A;  4CZI A;  1X9J A;  3FZH A;  4K43 A;  4BRG A;  4BQZ A;  2FXU A;  4MO5 A;  2E1Y A;  3R8E A;  5AQQ A;  4QS7 A;  3KHY A;  3QBW A;  3ATV A;  2W41 A;  3CHW A;  3A8Y A;  3GOI A;  5LJV A;  1BG3 A;  2QWQ A;  3D7E O;  3UKR B;  2H3G X;  4BRI A;  2Q0U A;  4NO7 A;  2ZF5 O;  3MN9 A;  3FZK A;  5FPD A;  3B8A X;  2I7N A;  4A61 A;  1JCE A;  5AQY A;  3DXK A;  3GBT A;  3S41 A;  1DEJ A;  1KAZ A;  1XUP O;  2E20 A;  4PKH A;  4L3Q A;  5EXW A;  4EIA A;  2V7Z A;  5KPZ A;  4H0X B;  3CI5 A;  2YJE A;  3LDQ A;  2F9T A;  4XH1 A;  1U2V A;  5AQK A;  3ZEU B;  2KHO A;  1NGA A;  1GLD G;  3ID8 A;  4CI6 A;  1NMD A;  2QWM A;  5AZJ B;  4BQL A;  5BRF A;  4M63 C;  2D0O A;  4JHD B;  5AQH A;  3A0I X;  2P9L A;  1Y64 A;  3HTV A;  3O08 A;  4PKG A;  5AQL A;  3DWL A;  2BUP A;  3H1Q A;  3VEV A;  3DXM A;  3DJC A;  2VYP A;  1EQY A;  4BR7 A;  1NGD A;  2GEL A;  4FOE A;  5JMV A;  1TUY A;  3FFK B;  3ULE A;  5I9E B;  3VGK A;  2BTF A;  4Z94 A;  3CJ9 A;  1RDW X;  4K25 A;  1WOQ A;  2QXL A;  1HKC A;  2WUS A;  3D2F A;  2V51 B;  3CJB A;  5TKY A;  4FOI A;  1GLE G;  2FF3 B;  2P9P B;  4BC5 A;  3A5N C;  3TPQ A;  4BRF A;  5AFU A;  1NGG A;  5KQ8 A;  2GEM A;  3CJ1 A;  2A42 A;  2E2O A;  1NBW A;  1DGK N;  2Q31 A;  4IXC A;  4MLE A;  4A2B A;  4GY2 B;  3VGL A;  4FPB A;  1MWM A;  5LJW A;  3H6E A;  5AQF A;  4B1V A;  4DB3 A;  2ZGY A;  3WEE B;  2P9U A;  2A3Z A;  3ZET B;  2FF6 A;  3FE1 A;  4H5V A;  4WQ5 C;  2PAV A;  1HX1 A;  2W40 A;  3IUC A;  5AFU H;  3QDK A;  1ATR A;  1GLB G;  4NB4 A;  5BN9 A;  3WXK A;  3FZL A;  3FGU A;  1TYQ B;  4PKI A;  4BG8 A;  1NGJ A;  3QBX A;  2CGJ A;  3D2E A;  2UYT A;  4ISE A;  1LOT B;  1MDU B;  4BVO A;  2P9S A;  4BRH A;  1NGI A;  2FLO A;  4BC3 A;  3OHR A;  5JLH A;  3WT0 A;  2HOE A;  3WXI A;  3O6W A;  4FWN A;  1YXQ A;  3I33 A;  4H5T A;  4IJN A;  2D1K A;  3AAP A;  3MMV A;  2NZT A;  2QWR A;  3L0Q A;  3F9M A;  2OAN A;  3DAW A;  4BRO A;  3H3O B;  3O5B A;  3QML A;  4O5F A;  5JIC A;  3SK3 A;  4A62 A;  3WQU A;  4B9Q A;  3A5L C;  4FWR A;  4A2A A;  3U4L A;  2D0P A;  4PL7 A;  3DXK B;  5KPT A;  3VER A;  4B1U B; 
#chains in the Genus database with same CATH topology
 1NGH A;  3K59 A;  1NGB A;  2IVO A;  3HI0 A;  1RDC A;  3LAN A;  3ZSQ A;  3OYC A;  1WBB A;  2I7P A;  1T3V A;  1T7P A;  4FZX C;  3K5O A;  3CJC A;  1GOC A;  1L5U A;  2DFF A;  5FRO A;  4DQ8 A;  1U2V B;  4B9V A;  1NLV A;  5EY4 A;  3HO1 A;  1KFD A;  4BRK A;  4BDY A;  2YI1 A;  1TKZ A;  4IO9 L;  3LP2 A;  1U45 A;  5GAE P;  3NE6 A;  4BRQ A;  2P9K A;  3CCM N;  4B9U A;  4XH5 A;  4M7Y A;  1W2B M;  3VGM A;  1P90 A;  1EWQ A;  4H5R A;  3AGR A;  3MX2 A;  4J2A A;  3PUF A;  2HMP A;  1SAZ A;  3PO4 A;  1FXX A;  2OA8 A;  3MED A;  4IZ9 A;  5AQR A;  2IDO A;  3CG7 A;  5FPM A;  1JCG A;  3AVM A;  3PO5 A;  5JLF A;  3O4Q A;  3KLI A;  2O8C B;  1V4S A;  3SMP A;  3MN7 A;  3C7N A;  3OVN A;  4DTN A;  4FLW A;  2A5X A;  1CZB A;  3UKR A;  4BE1 A;  4PHT X;  4BRC A;  3V9Z A;  2UUC K;  3ZSY A;  2DY4 A;  3QEX A;  3QER A;  4QOZ B;  4ID1 A;  2Q0R A;  3O9T A;  3VQB A;  1NGE A;  4IG3 A;  3LP0 A;  3I8D A;  2JWL A;  5CE3 A;  1LV5 A;  1T44 A;  4JI7 K;  2V52 B;  4FJ9 A;  1VSM A;  3SYZ A;  2QA4 N;  1RDU A;  4CJE A;  2HBM A;  4BE0 A;  1GLJ O;  3D2E B;  4FW2 A;  1TGO A;  5FPN A;  4BRM A;  2KFN A;  3CCS N;  4ZTJ A;  3ZEU A;  4Y1C A;  4FZZ A;  3NGI A;  4LFC K;  3C6U A;  4CEQ A;  1RDB A;  3ZSO A;  4OPA A;  1J6Z A;  3PSF A;  4DUZ K;  2EX3 A;  1HR0 K;  3OYN A;  2QK9 A;  3LDN A;  1S3X A;  5BR9 A;  3QFU A;  1G99 A;  1UA1 A;  1DKG D;  1X9M A;  4OKE A;  2E2Q A;  4YOT A;  4JK8 A;  4N76 A;  2P1J A;  3RMD A;  1HYZ A;  1BQM A;  2YNI A;  5AQU A;  5EX5 A;  2F9W A;  4FZY A;  2NRV A;  5HRO A;  1HUX A;  2E6L A;  2IVP A;  1BI4 B;  1IKY A;  1ATS A;  3ENH A;  3L2R A;  5M1P A;  3IMX A;  4EZ9 A;  4HWI A;  3S3M A;  1RDD A;  1Z05 A;  1BU6 O;  2A41 A;  1BGX T;  1ESV A;  4JYA K;  5CYM A;  1A5X A;  4JNE A;  4DTJ A;  4O8U A;  3C65 A;  3RMC A;  2YHB A;  4DUY K;  4DR3 K;  1HNX K;  1Z25 A;  4BGB A;  3NHG A;  4YDU C;  3OYM A;  3K58 A;  3K0S A;  3VEN A;  3CF5 L;  1WSE A;  4E0D A;  4BC2 A;  3LAK A;  2P5O A;  4I2Q A;  3CET A;  4BR9 A;  3RR7 A;  3HRG A;  4DFP A;  4DFK A;  4I7F A;  3PY8 A;  4I2P A;  3NVM A;  1UOC A;  1S1V A;  3HP6 A;  3RSE A;  4X62 K;  3QEW A;  3C95 A;  3LAM A;  4OLB A;  2KLA A;  3J81 O;  1JXB A;  4CZK A;  3SCX A;  4ZTF A;  3N4Q A;  5CZ1 A;  4BRE A;  3I0R A;  2O8E B;  1JJ2 M;  4BG9 A;  1C0M A;  3CPE A;  3MEC A;  2GV9 A;  4GV6 A;  1GOB A;  1U6Z A;  4FLZ A;  1E4F T;  4Z4F A;  4EP4 A;  4CFD A;  4RW7 A;  2DTU A;  1CXU A;  4WQ4 A;  5H1S Q;  3HPO A;  4MDB A;  1S1W A;  3OJU A;  1KC8 O;  2UXC K;  1RCH A;  4DTO A;  5BPM A;  4KHN A;  4BRA A;  4CIF A;  2QW9 A;  4ELU A;  3AVJ A;  1NGC A;  2FSN A;  4RCH A;  2HW3 A;  3S3N A;  3U9D A;  1XC9 A;  1NWK A;  3DRS A;  4FSV A;  5GIP A;  3H46 O;  2YNH A;  4FO0 A;  3VQ6 A;  4E3S A;  3VEW A;  3AVB A;  2P9S B;  4FK4 A;  5AQX A;  3ZX3 A;  1Q82 O;  1VQ9 N;  3AO1 A;  1SS6 A;  3CCR N;  4R79 A;  4JHD A;  4J8F A;  3I0S A;  3THW A;  1K9M O;  4TSX A;  4OJR A;  1C0U A;  5AQN A;  4CE9 A;  3LWM A;  4LH5 A;  3SUP A;  3GL1 A;  1C0G A;  1VQK N;  3TSQ A;  1BUP A;  5BPN A;  1N5Y A;  4DV6 K;  4CHQ A;  1K8K B;  4FPA A;  1NJW A;  3H45 C;  1DTQ A;  4OPJ A;  3KZB A;  2HHS A;  3HZ6 A;  2W42 A;  1XMQ K;  4JKG A;  4DLG A;  3HT3 A;  4JKF A;  3THV A;  3R6M A;  3ISN C;  2F4V K;  2O8F A;  3O3H A;  4JI1 K;  1KVA A;  2PFU A;  3BY5 A;  3MDQ A;  3VTI A;  3AA5 X;  3MAQ A;  1IKW A;  3EKU A;  3KJV A;  4CJ3 A;  5KI6 A;  1RBR A;  3NGZ A;  1Q9X A;  1N33 K;  2DPN A;  4ZHR A;  4CF0 A;  3HSC A;  3I55 N;  1HYS A;  1IG9 A;  2VWJ A;  3V9U A;  4CES A;  1Q7Y O;  1XQS C;  4FLX A;  4IFE A;  3C6H A;  4DTS A;  1IBL K;  5E84 A;  5F0X A;  4UQG A;  3V81 A;  4JEP A;  3VN5 A;  1ILY A;  4BRG A;  1NOZ A;  4DS4 A;  3OS2 A;  4QCL A;  3R8E A;  1WSF A;  3Q7B A;  2Z1J A;  3NH1 A;  3AVN A;  3QBW A;  1TKD A;  2W41 A;  1N36 K;  2VG5 A;  4JRP A;  1NK7 A;  5AJ3 K;  4YOW A;  4FM1 A;  1BG3 A;  4LF5 K;  3CME N;  3EYZ A;  4NO7 A;  5C12 A;  3B8A X;  3ZT2 A;  2B4J A;  4FJN A;  4WCE L;  4NCA A;  3AVL A;  1DEJ A;  1KAZ A;  4CF8 A;  1NJZ A;  4FJ5 A;  3DRP A;  4H0X B;  4CJU A;  4DWI A;  3G0Z A;  5KTQ A;  1GLD G;  2YX6 A;  5HRP A;  4Z4I A;  5BRF A;  2P5G A;  4GVE A;  4LH4 A;  2P9L A;  2YV0 X;  5AQL A;  3DWL A;  1XHX A;  4DTP A;  2BUP A;  2WON A;  4O0J A;  4JS5 A;  1KLM A;  4Z4H A;  2I5J A;  3TAP A;  3FFK B;  4FLU A;  1QVF M;  3ULE A;  3HXM A;  1QVG M;  4LF8 K;  2BTF A;  4CF9 A;  3KLE A;  4Q0B A;  1WB9 A;  4K0K K;  3CJ9 A;  4DF8 A;  4CFB A;  1NK6 A;  1T05 A;  5TKY A;  3PX4 A;  2P9P B;  2PZS A;  4BC5 A;  1XNQ K;  3TPQ A;  4DLE A;  3F2K A;  5IWA K;  1JLB A;  3CJ1 A;  1W7A A;  2RN2 A;  5C24 A;  4CCH A;  3SAH A;  3EZ5 A;  4GY2 B;  4DR4 K;  4FPB A;  1MWM A;  1RDA A;  3DLR A;  4DB3 A;  1OH7 A;  4BAC A;  4F3O A;  3HOS A;  3P1G A;  3NH2 A;  2A3Z A;  3ZET B;  1J54 A;  4H5V A;  4CIG A;  4WQ5 C;  3AA4 A;  1HX1 A;  2ZJQ L;  1ATR A;  5C42 A;  3WXK A;  5JS1 A;  2NUB A;  3E01 A;  4BG8 A;  5IT9 O;  3QBX A;  2UYT A;  4EP5 A;  2P9S A;  3PX0 A;  2FLO A;  3OHR A;  1SUQ A;  3MXM A;  2F8T A;  1YXQ A;  2G8I A;  1BL3 A;  1J5E K;  3FFI A;  1EKE A;  5C25 A;  3OJS A;  2OPR A;  1YIT N;  3T1Y K;  4DR7 K;  3AVA A;  3LP3 A;  4IOA L;  1X9W A;  1FJG K;  4E7H A;  3SK3 A;  4C8K A;  4JKD A;  2B6A A;  2JGU A;  4FWR A;  4JK7 A;  4A2A A;  3OS1 A;  4CK1 A;  4B1U B;  1RT1 A;  2OTJ N;  4CHY A;  3QEV A;  4DQP A;  3EE9 A;  3TAM A;  4FWS A;  4JKE A;  3SMS A;  3LWL A;  3A5M C;  2OYQ A;  1BCM A;  3MN5 A;  3C6T A;  5EVZ A;  3QIC A;  3CM6 A;  3MXJ A;  3K5N A;  1K73 O;  2Z1H A;  1KVC A;  2HHH K;  4O4G A;  3K9K A;  2Q36 A;  1TUU A;  4N5S A;  4E1N A;  3OYF A;  3L2Q A;  1Q81 O;  4OX9 K;  3OYG A;  1RBS A;  3A5O C;  4WFB L;  3EO3 A;  3IRX A;  4M41 A;  5GAG P;  4KHQ A;  1OVY A;  2HHX A;  4JKC A;  4NXM K;  3EKS A;  2ZJR L;  1JL2 A;  1VQN N;  2BDP A;  1NM1 A;  1IJJ A;  1YT3 A;  2JWK A;  3HPG A;  3TTC A;  2G8W A;  3VF6 A;  3OY9 A;  1HNZ K;  3M8Q A;  4CJF A;  2HF4 A;  4HUE A;  4Z0U A;  2KTQ A;  3KVG A;  1CZ9 A;  4OKJ A;  3CCV N;  5BN8 A;  5JVH L;  3U3Y A;  4FLY A;  2D4W A;  4FJI A;  1RTH A;  1NKB A;  3C6A A;  1YI2 N;  4KH6 A;  3WNF A;  1U48 A;  5LMU K;  2QEX N;  1WSJ A;  2RKI A;  3LM9 A;  3TWH A;  1ZBL A;  2HHT A;  4CD3 A;  2YHX A;  5A2Q O;  5M1F A;  2OZS A;  3EY1 A;  1VSD A;  4F2S A;  3GE1 A;  4IBN A;  2QWN A;  5AQM A;  3CER A;  1D4X A;  3DI6 A;  3WXM B;  4CED A;  4DCH A;  1XI1 A;  3SUN A;  3IDH A;  4H0T B;  3OYK A;  4BDZ A;  4YOV A;  2FC0 A;  3SUO A;  3L2U A;  1GLF O;  4KKO A;  5EU7 A;  4YOU A;  1ATN A;  1Q9Y A;  1CLQ A;  2RHK A;  2P9P A;  3CCE N;  4FK2 A;  3JYT A;  1BHL A;  4X66 K;  3BDP A;  4CEF A;  3JXU A;  1YJN N;  2E88 A;  4WYB A;  4CZJ A;  4KHY A;  2GBZ A;  3D6R A;  4BR4 A;  5M1K A;  4BR2 A;  3C94 A;  2QI2 A;  1QZ5 A;  3M8R A;  3LDL A;  1D9D A;  4I6M B;  5KRT A;  3NMU A;  2GTD A;  1QSL A;  3JAM O;  5C2D A;  2P51 A;  4DV2 K;  4H03 B;  4CJK A;  4H0P A;  2BAN A;  5FPE A;  3AGK A;  3AV9 A;  4M45 A;  3OYJ A;  3L6Q A;  4H4O A;  1YTU A;  4IDH A;  1VRT A;  4M3Y A;  3CC4 N;  4FWQ A;  1TAU A;  3VPZ A;  3T69 A;  4JKB A;  3ENO A;  5HRN A;  3DLL L;  3PX6 A;  4K8X A;  4BR5 A;  4PUO A;  4OPH A;  2ATQ A;  1NNE A;  5AQW A;  4JI6 K;  4DQQ A;  4OLA A;  2OPS A;  4RW8 A;  4BRP A;  1QSS A;  4AHR A;  1LWF A;  1B9F A;  3T7Z A;  3PIO L;  3LPU A;  3BF1 A;  2NRH A;  3TAE A;  3AY9 A;  4JD2 A;  4B9T A;  1QZ6 A;  3AVG A;  5AZI B;  4Z4E A;  1SKS A;  4ELV A;  4M3R A;  1SL2 A;  5I3U A;  3V9X A;  4W5R A;  1OVQ A;  3SQ1 A;  4KB0 A;  1BA0 A;  5SWM A;  4CHP A;  4DQR A;  5FRN A;  5LMN K;  4CJW A;  4FVM A;  1Q18 A;  4HHT A;  3IG1 A;  4HCC A;  2X74 A;  2ZQB A;  4GMJ B;  1U49 A;  3A2F A;  1R59 O;  1ZBF A;  1E4G T;  3EL2 A;  2XHB A;  4WQ4 C;  3M8S A;  1GLA G;  2P9I B;  3WNG A;  4K42 A;  3ZT0 A;  4YFU A;  1J9A A;  3CMA N;  3KD5 E;  3MK6 A;  2KZM A;  4ISF A;  1BQN A;  4KHS A;  1KXP A;  1RT3 A;  4B3S K;  1B9D A;  5AR0 A;  4GKK K;  3VEX A;  3LP1 A;  1QTM A;  4CGJ A;  4M3W A;  4B3R K;  4CBW A;  1SQK A;  1VSK A;  1HQE A;  1RTJ A;  2IIR A;  3CJA A;  3CCJ N;  4AM7 A;  2Q3S A;  1O13 A;  4DR2 K;  3U6F A;  1JLF A;  5C15 A;  2A1S A;  4B1W B;  5TKW A;  2YHA A;  1ZBS A;  1HNW K;  3SJH A;  3H1V X;  1W97 L;  5J2P A;  1L3S A;  4CGD A;  3I8B A;  3O9Q A;  1IKX A;  2GUP A;  2CH5 A;  4EAH D;  5GIO A;  1HQU A;  2FSJ A;  2G8K A;  1WAF A;  3DLH A;  2HBK A;  1S1U A;  1QQC A;  3THX A;  1X3M A;  3RRH A;  3G71 N;  4B3M K;  1HPZ A;  4AQY K;  1RTD A;  2ZGZ A;  2XY5 A;  2W6K A;  3FR0 A;  4DV3 K;  3CJ7 A;  4CZF A;  4LF4 K;  4J2D A;  2V7Y A;  4E89 A;  3L4Q A;  2EHG A;  2G8U A;  4ICL A;  3SAF A;  3CM5 A;  3EN9 A;  2X78 A;  3LPT A;  4YY3 K;  1X9S A;  3CD6 N;  3AAQ A;  5AQJ A;  4NLB A;  4XEI A;  1RT7 A;  3MWP A;  1YTA A;  2WC9 A;  1IBM K;  4H0Y B;  3OBY A;  4CZH A;  1LCU A;  3T19 A;  4BR0 A;  3DLB A;  1BO5 O;  4RW4 A;  2E2N A;  4N41 A;  1Z26 A;  3UKU B;  5JS2 A;  1ZC6 A;  2O8D A;  1D9F A;  3QB0 A;  2EWS A;  3ZSW A;  4JI8 K;  3VQQ A;  4CGG A;  4O5B A;  3FZH A;  1TK5 A;  4OPK A;  2FXU A;  5SZT A;  3VQ4 A;  5AQQ A;  4DSK A;  4CEE A;  3ATV A;  3QNO A;  3A8Y A;  4DF4 A;  4RG8 A;  4X64 K;  2H3G X;  3RMA A;  2ZF5 O;  3L2V A;  3MN9 A;  3FZK A;  4A5B A;  4JI3 K;  1JCE A;  4DTU A;  3DXK A;  2O4I A;  1YIJ N;  1ZBU A;  3QNN A;  1YHQ N;  5KPZ A;  4CVN E;  4WFA L;  1XNR K;  4DQS A;  1GOA A;  1U2V A;  1A5W A;  2ZJP L;  4AHS A;  2KHO A;  3ID8 A;  4CI6 A;  1NMD A;  5AZJ B;  4BQL A;  5AQH A;  3PSI A;  1L3T A;  1Y64 A;  3HTV A;  1REV A;  2X6N A;  4BE2 A;  1JL1 A;  3J7Y P;  5FRM A;  4AIL C;  5M1Q A;  3PV8 A;  3SPY A;  4AH9 A;  4KFB A;  4BR7 A;  1RT2 A;  5JMV A;  1TUY A;  3L3U A;  4NLC A;  2RPI A;  3TAQ A;  4DMN A;  3NH0 A;  2O8B B;  5I9E B;  1K8A O;  3OS0 A;  1SV5 A;  1JLE A;  4AHU A;  1RDW X;  2WUS A;  4M3Z A;  3CJB A;  4FOI A;  4GW6 A;  4BRF A;  1NGG A;  4WE1 A;  2O8C A;  2UU9 K;  2GEM A;  2E2O A;  1DGK N;  2Q31 A;  4IXC A;  4MLE A;  4CEC A;  3H6E A;  3THY B;  3S9H A;  3WEE B;  3FE1 A;  4JV5 K;  3P5J A;  3QIO A;  4DTM A;  3NAE A;  3IUC A;  1S1T A;  3QDK A;  1HMV A;  3NGY A;  3FGU A;  1TYQ B;  4GVM A;  4PKI A;  4KAZ A;  1NGJ A;  3D2E A;  1MDU B;  4BVO A;  3ULD A;  3RR8 A;  5JLH A;  4FWN A;  4KHP K;  3I33 A;  3ID6 A;  4CEB A;  1U47 A;  3ITH A;  1KRP A;  4CEZ A;  1SKR A;  3ZLJ A;  3L0Q A;  4B08 A;  2OAN A;  4F4K A;  4FCY A;  4LY7 A;  3QEP A;  3QML A;  3DMJ A;  4O5F A;  5JIC A;  5JVG L;  1NKE A;  4A62 A;  3O9R A;  3OYL A;  3G10 A;  4DQI A;  3L8B A;  2D0P A;  3RRG A;  1VQ4 N;  4Q5V A;  4KH5 A;  1EWR A;  3BZK A;  1IV0 A;  1BDG A;  3VTH A;  3SZ2 A;  4DU3 A;  1HNV A;  4YDU A;  1BI4 A;  4CBX A;  4CJ5 A;  2E5L K;  2FBX A;  1H1V A;  2G8F A;  4K41 A;  1KQS M;  3MEE A;  3F73 A;  1JLQ A;  2CGK A;  3CFO A;  4RW6 A;  2R7Y A;  3BP8 A;  1ASW A;  1KD1 O;  3CQY A;  5C10 A;  4JKH A;  3TI0 A;  3DXM B;  1W0H A;  2E4L A;  4KTZ A;  5HOO A;  3UKU A;  4CHZ A;  3AAR A;  3VQP A;  3RTV A;  2VQE K;  4XIU A;  2A40 A;  3KD1 E;  4GNI A;  4H0O A;  3VES A;  3K9J A;  4H5W A;  4Y1D A;  1VQO N;  5M1N A;  1FW6 A;  4KRE A;  4AM6 A;  2ETJ A;  1BCO A;  3WQT A;  1XHZ A;  3EZW A;  1NK4 A;  1SKW A;  4CJ7 A;  3LL3 A;  1RGI A;  2QWL A;  2ITM A;  1VQP N;  3BUZ B;  1A5V A;  5GAD P;  4H0V B;  2QM1 A;  4CF2 A;  2O8E A;  3O4N A;  3H08 A;  4DSL A;  2GWK A;  3DLG A;  4IOX A;  4JN4 A;  1GLC G;  4JAX A;  1TL1 A;  1M90 O;  5LY3 A;  3TAR A;  1LW0 A;  1MWK A;  3M3Z A;  4KRF A;  2B5J A;  3L2W A;  3CFP A;  4QS8 A;  1QQN A;  3TTD A;  1N34 K;  5FDL A;  4C8L A;  2A6A A;  1HJO A;  2KQ2 A;  5B8H A;  3CPW M;  3MN6 A;  3MWT A;  4CZL A;  2AA4 A;  2HHU A;  4EFH A;  4RWT A;  1T03 A;  1ASU A;  3SLC A;  3QES A;  1QQM A;  4E7L A;  1S1X A;  2O8B A;  3P4I A;  3VQE A;  3QEI A;  3SQ2 A;  4J2B A;  4IKF A;  3VEZ A;  1Y97 A;  4DSE A;  3W3D A;  2YHY A;  3TAF A;  3J8A A;  1C1B A;  3SUQ A;  5D3G A;  4IFV A;  3W0L A;  1YUW A;  4JI2 K;  4B1Y B;  4BC4 A;  3E1Y A;  3OYI A;  1BA1 A;  2G8V A;  4CJL A;  3EE8 A;  4DG1 A;  1K8K A;  1DLO A;  1WSH A;  2D0C A;  3HM9 A;  1RIL A;  2W6L A;  1RT5 A;  1I3A A;  3V1Q A;  4O0I A;  1FKP A;  2IS3 A;  3WXJ A;  4AHV A;  1YAG A;  4C1N K;  4CGH A;  5EOY A;  3O1B A;  4CBU A;  2P9K B;  3RVC A;  5KPR A;  2QXF A;  2HBL A;  2HMI A;  4Y0W A;  1QHT A;  3EEQ A;  4FJJ A;  1N6Q A;  4FJG A;  1KLN A;  2YKN A;  3LDS A;  3QET A;  4B9S A;  4KV8 A;  2FBT A;  3SV3 A;  3NF6 A;  3HPH A;  4CHN A;  4PL8 A;  1NK5 A;  3ZX0 A;  4F8R A;  4CJT A;  3C7N B;  5HL7 L;  1XMO K;  4DV5 K;  1CXQ A;  5DMR A;  3BF3 A;  4W5O A;  4FLV A;  4G1Q A;  3SAG A;  2DFE A;  3D2F B;  4IJA A;  5KGW A;  1QHA A;  3AVH A;  3OTO K;  3TAN A;  1Q8I A;  1Z6R A;  2Q1N A;  3SBG A;  2XO7 A;  4JRQ A;  2GWJ A;  2Q2R A;  1QE1 A;  1G15 A;  2VWB A;  2QWO A;  1KCF A;  3LDO A;  3LZJ A;  3NBP A;  4PWD A;  2YHW A;  4I9Q A;  4OO1 J;  4KI4 A;  1ZXO A;  1B92 A;  2P9U B;  4C8O A;  4IWV A;  3KKR A;  4MLH A;  2HHV A;  3L4I A;  2ITG A;  2IVN A;  1DTT A;  1YVU A;  4HUG A;  3SPZ A;  1JLA A;  2VWK A;  3DOL A;  4CK3 A;  1U04 A;  1VK0 A;  4CK2 A;  3L3V A;  3DYA A;  3ZSV A;  1LWC A;  3MCP A;  4DV0 K;  2XY8 A;  4DR6 K;  4CD1 A;  2VGM A;  3IS9 A;  5CHI A;  1NG9 A;  2YKM A;  1BIU A;  4M7X A;  3BZC A;  5BPL A;  4ILG B;  5BRE A;  1NJX A;  3RWU A;  4E1M A;  1CZA N;  4CER A;  3BEX A;  1C1A A;  2XRI A;  3SBT A;  1HYV A;  3R9P A;  3DRR A;  3H3N O;  4C8N A;  5BRH A;  1N8R O;  3HBT A;  4YNQ A;  3SV4 A;  1NOY A;  1VQ8 N;  4WQ5 A;  5F1X A;  3DOK A;  3CFR A;  3VA3 A;  3ZX2 A;  4NCG A;  5AQO A;  4LSN A;  4FVU A;  4A5A A;  4CZE A;  4DHY A;  3R1X A;  1VRU A;  2A1R A;  1OH5 A;  2ASM A;  2ASP A;  3QIN A;  4H4M A;  3O3G A;  1GLL O;  4FWK A;  2VCP A;  3ZT4 A;  2JLE A;  2NNW A;  4LF7 K;  5AQG A;  2QKK A;  3VQC A;  3ZET A;  5HLF A;  1T6D A;  3JS6 A;  1TKT A;  4B3O A;  1VSI A;  1HKB A;  2P9N B;  2E2P A;  1C0T A;  4BVP A;  2CGL A;  4QS9 A;  4GKJ K;  3RSE B;  1RBU A;  4LSL A;  5J2N A;  5J2M A;  3CYM A;  3D45 A;  1NKC A;  4CEO A;  2VG6 A;  1C0F A;  3KK7 A;  3DLE A;  4CZI A;  4W5T A;  1ZBI A;  1X9J A;  4BQZ A;  1QSY A;  4MO5 A;  4MDA A;  5KGX A;  4QS7 A;  1EX4 A;  3CC2 N;  2QKB A;  5LJV A;  4HVJ A;  3D7E O;  4FJX A;  3P31 A;  5J2Q A;  5FPD A;  4WFN L;  1W9H A;  4NCB A;  2IAJ A;  5AQY A;  3GBT A;  1BIZ A;  5FLX O;  2HHQ A;  4B8A B;  3S41 A;  4KTQ A;  4PKH A;  1NJY A;  4L3Q A;  4EIA A;  3T3F A;  2V7Z A;  3T1A A;  4DR5 K;  2YJE A;  1VSF A;  4A59 A;  3LDQ A;  4XH1 A;  4CW7 B;  4B9N A;  1UA0 A;  5AQK A;  5DM7 L;  1NGA A;  4M3U A;  2O4G A;  3M8P A;  1EO1 A;  1JKH A;  1J5O A;  4M63 C;  2UUA K;  4JLH A;  3KTQ A;  4JHD B;  3M5R A;  1OH8 A;  3A0I X;  3O08 A;  4PKG A;  3KLF A;  4DV4 K;  3THW B;  5C0Y A;  2X6S A;  3UIQ A;  4KHW A;  3H1Q A;  4RW9 A;  5GIN A;  1YJ9 N;  4LF9 K;  3E9O A;  2VYP A;  1NGD A;  4FOE A;  3HK2 A;  2WTU A;  4Z94 A;  4W5N A;  1HKC A;  3D2F A;  2OPP A;  3R3L A;  1GLE G;  2FF3 B;  1SL1 A;  3V9W A;  3A5N C;  5AFU A;  4ELT A;  3LAL A;  1YJW N;  1S5J A;  4JKG B;  5KQ8 A;  2A42 A;  1SL0 A;  1NBW A;  5KRS A;  4A2B A;  4DTR A;  3VGL A;  5LJW A;  3AO3 A;  4CJV A;  5J1E A;  2O8F B;  1S6P A;  4U67 L;  2P9U A;  4DV7 K;  2G8H A;  2FF6 A;  3SQ4 A;  3MCA B;  5MLC Q;  1NU0 A;  2YNG A;  3J7A P;  3VA0 A;  1GLB G;  4NB4 A;  3VQA A;  3FZL A;  4L8R B;  1KSP A;  3AVF A;  1HRH A;  2XY7 A;  3O9S A;  4ISE A;  4ILJ A;  3WXI A;  3O6W A;  4B3T K;  4B9L A;  3KLH A;  3U3G A;  1TL3 A;  4ILH A;  1TK8 A;  4H5T A;  3P83 D;  4LF6 K;  4IJN A;  1NK9 A;  5E41 A;  3AAP A;  3MMV A;  2NZT A;  4DSJ A;  4DS5 A;  3NF7 A;  3OW2 M;  4BRO A;  1WAJ A;  3K5L A;  4M3X A;  1T8E A;  3O5B A;  3QO9 A;  4OGC A;  4FLT A;  3WNE A;  2RE2 A;  1XWL A;  2KKZ A;  1ZYQ A;  4B9Q A;  3S3O A;  3U4L A;  4PL7 A;  5KPT A;  3VER A;  1JCF A;  3CIP A;  1LAV A;  4MQ3 A;  4IFY A;  5AQP A;  3LDP A;  2Z1G A;  5AQS A;  3F9K A;  1QQO A;  2NRT A;  2NRR A;  4AHT A;  3CCL N;  4GV3 A;  1P8Z A;  2E6M A;  3V9S A;  1RFQ A;  4LC9 B;  3G4S N;  3UB5 A;  1VSL A;  1LAW A;  3ZT1 A;  4IDK A;  3CC7 N;  3FZF A;  4HTU A;  4X65 K;  3O4W A;  4I6M A;  1FKO A;  3ENB A;  1V4T A;  4MO4 A;  5HBM A;  3ZSZ A;  4HTL A;  2F8S A;  1KAX A;  1UAX A;  2P9L B;  4FWO A;  2VQF K;  2D0B A;  4H5N A;  4IG0 A;  1S72 N;  2P9N A;  1WUA A;  2PBD A;  1HPM A;  2AJQ A;  3NVK A;  3CCU N;  4JK9 A;  2GX9 A;  2VGN A;  4CJS A;  4FK0 A;  2HB5 A;  1NK8 A;  3ULE B;  3QLH A;  4K8Z A;  1JLC A;  4E1J A;  1VSH A;  2OPQ A;  3HM8 A;  1VSJ A;  4BRN A;  5BRD A;  5T7B A;  2FSK A;  3SNN A;  3VET A;  4YOR A;  1D8Y A;  3MXI A;  3HL8 A;  1QS4 A;  1MU2 A;  4CJQ A;  1WN7 A;  4CFC A;  1ASV A;  2HNY A;  3TAB A;  1TV6 A;  4CGF A;  3NF9 A;  3VF4 A;  5ADX H;  4HCB A;  3WXL A;  4KH4 A;  3U9Z A;  1HNI A;  5AZI A;  1E3M A;  3QFP A;  4FJK A;  2WBN A;  2ZWH A;  3VQ7 A;  4J2E A;  3KWG A;  3M6G A;  3ATU A;  1DT9 A;  2ASO A;  3VEY A;  5HRR A;  1WSI A;  2P9I A;  1EET A;  3SI6 A;  2BE2 A;  3O80 A;  3J80 O;  3SQ0 A;  2HVI A;  2BGG A;  4HUF A;  3AA3 A;  4BWM A;  4B1X B;  2CH6 A;  1RNH A;  3AO4 A;  4U7B A;  1RT6 A;  3IFR A;  3V4I A;  1TAQ A;  4BRD A;  4FWM A;  3KK3 A;  4G9Z A;  4W5Q A;  3M1F A;  1VQ7 N;  4IO8 A;  1TKX A;  2ZE2 A;  4MFB A;  3KLG A;  3KK1 A;  3IKM A;  3VQD A;  1Q86 O;  5ELZ A;  3HVT A;  3J7Z O;  4M42 A;  1KVB A;  2OCE A;  3LM2 A;  4XH4 A;  3UE5 A;  1N32 K;  3E9L A;  4DFM A;  2HBJ A;  2QWP A;  4FWP A;  4R5P A;  4LFA K;  1VQL N;  3C0B A;  2PYJ A;  2KFZ A;  3HVR A;  1ZBH A;  1KTQ A;  2GUI A;  1VQ5 N;  2WOM A;  3N4P A;  4B9M A;  4JKA A;  4C8M A;  4CIE A;  4V19 S;  2D5R A;  4Z4G A;  1LW2 A;  3MEG A;  4YOY A;  3T1H K;  4A57 A;  3O8M A;  3VF2 A;  4CJP A;  2YNF A;  4QAG A;  4C23 A;  2NLX A;  4DSF A;  4PQU A;  4AF1 A;  4CGI A;  2E1Z A;  4LD0 A;  2VG7 A;  4B8C A;  2ZD1 A;  4EHU A;  4DSI A;  1XC3 A;  3G6E N;  4EHT A;  2HNZ A;  3WUH A;  2OTL N;  4PA1 A;  4BGA A;  1T6C A;  1RBV A;  3CXC M;  5HP1 A;  1R0A A;  3GDQ A;  3OBW A;  2YCH A;  1S22 A;  3GG4 A;  5ADX A;  4DU4 A;  2IC3 A;  4NYF A;  4CZM A;  4BRL A;  2WFB A;  1WNS A;  2UXD K;  3TSP A;  4E7K A;  3AO5 A;  4YHH K;  4WF9 L;  1IG8 A;  4DKW A;  3SJJ A;  4ID5 A;  5AQT A;  1BWF O;  3O1W A;  1HLU A;  3OYA A;  1I94 K;  4JI0 K;  3TR8 A;  3G25 A;  3V6D A;  2YJF A;  3P39 A;  3AVI A;  3P38 A;  5C2F A;  1OH6 A;  3HOT A;  3HST B;  3VQ9 A;  2KW4 A;  1M1K O;  5DK5 A;  1MA9 B;  3ZT3 A;  2BH1 A;  5F2R A;  3KIO A;  1NMN A;  1IO2 A;  1O1W A;  3I56 N;  4CFA A;  1I39 A;  1D5A A;  4NYN A;  4DTX A;  4JS4 A;  3CQX A;  4O44 A;  1RTI A;  2HF3 A;  2HVH A;  3VOV A;  3Q7C A;  1RBT A;  3ZSX A;  3VEO A;  3NFA A;  2QTD A;  3U8X A;  3FZM A;  3B6P A;  5AZJ A;  4IEE A;  4FWL A;  3HYF A;  3TTF A;  4CJR A;  3NF8 A;  4KBO A;  1L3V A;  4RTF D;  2KZZ A;  3OYE A;  1VAZ A;  2AP1 A;  1HJR A;  1WSG A;  4JI5 K;  5E26 A;  4ISG A;  4YOX A;  4JI4 K;  3VQ5 A;  4H8K A;  4KB1 A;  1FK9 A;  5AQZ A;  1VQ6 N;  1HKG A;  4B1Z A;  1WLJ A;  2HND A;  4E19 A;  1F21 A;  1NGF A;  5AQV A;  5I42 A;  4M3T A;  3TU5 A;  2J4R A;  5CY4 A;  4BWJ A;  2DFH A;  1JXE A;  3WNH A;  1RT4 A;  4F9O A;  2RF2 A;  2ZM6 K;  3FLC O;  3ZYY X;  5K14 A;  5LL6 Z;  5CZ2 A;  3VMF B;  1X3N A;  1S6Q A;  3THY A;  4EZ6 A;  1SZ2 A;  3AVK A;  3D0P A;  4KHU A;  3WEE A;  5CR4 A;  1LWE A;  2Q97 A;  2NRX A;  4LFB K;  4CZG A;  3KKS A;  1IH7 A;  3ZCM A;  2E8A A;  4O8K A;  1YVN A;  4KPY A;  4N47 A;  4IOC L;  4DU1 A;  1X1P A;  4NXN K;  5AQI A;  2D0A A;  4AHC A;  5GAH P;  1KAY A;  2FBY A;  1TYQ A;  3AVC A;  4DR1 K;  4KO0 A;  3CQ8 A;  2NRW A;  1U4B A;  4FL9 A;  2NRZ A;  4JD2 B;  4FJH A;  1BOT O;  3KWI A;  1NK0 A;  1OKJ A;  1S9E A;  4K43 A;  3OYB A;  1S9G A;  3AA2 A;  2E1Y A;  1JLG A;  1KFS A;  3TAG A;  3TSU A;  2Z1I A;  3KHY A;  3CHW A;  4F2R A;  3GOI A;  2QWQ A;  5CYQ A;  3UKR B;  1VHX A;  4FM2 A;  4BRI A;  2Q0U A;  1EXQ A;  2I7N A;  4A61 A;  2HHW A;  1VQM N;  4FJ7 A;  1WBD A;  3V1O A;  3RMB A;  1XUP O;  2F96 A;  2E20 A;  1J53 A;  5EXW A;  3K5M A;  4E7I A;  4CJ4 A;  3CI5 A;  2F9T A;  1C6V A;  4I9L A;  1L3U A;  2UXB K;  3OA9 A;  4OGE A;  3ZEU B;  1TK0 A;  3LZI A;  4GV9 A;  1IBK K;  2QWM A;  3MX5 A;  4FJL A;  3ASM A;  4KTW A;  3NCI A;  2D0O A;  3DLK A;  3HP9 A;  4DV1 K;  3E9P A;  4KI6 A;  2LSN A;  3IAY A;  2XY6 A;  3PLA A;  3VEV A;  3DXM A;  5M1O A;  3DJC A;  2FBV A;  1EQY A;  3BGR A;  2GEL A;  4FJM A;  1K6Y A;  3VGK A;  3ALY A;  3O3F A;  4K25 A;  1WOQ A;  2QXL A;  4IEI A;  3K2P A;  5HRS A;  2V51 B;  3OYD A;  1BIS A;  3NDK A;  2F7T A;  3ZSR A;  3THX B;  3V1R A;  4O55 A;  4Z4C A;  3QIP A;  1VSE A;  2OZM A;  3JSM A;  2IGI A;  5AQF A;  4B1V A;  2HST A;  2UUB K;  2ZGY A;  5BR8 K;  3HJF A;  4N56 A;  2Y1J A;  1EP4 A;  5DM6 L;  2PY5 A;  1TVR A;  2PAV A;  4BDP A;  2W40 A;  3PIP L;  3CCQ N;  5AFU H;  5BN9 A;  3AO2 A;  2Y1I A;  3B6O A;  4OKK A;  1YF5 L;  3OYH A;  1NJI O;  3O9U A;  2CGJ A;  3E66 A;  2O8D B;  4DFJ A;  1LOT B;  2IOC A;  4F3T A;  4BRH A;  1NGI A;  4BC3 A;  3F5T A;  4FJ8 A;  4UY8 O;  3WT0 A;  2HOE A;  4CF1 A;  1C1C A;  1UWB A;  4FXD A;  2D1K A;  4FW1 A;  4CHO A;  4FYD A;  1IKV A;  4PY5 A;  3KK2 A;  4C1N I;  2QWR A;  3F9M A;  3DAW A;  3VQ8 A;  4OVL A;  4E7J A;  3DM2 A;  3H3O B;  4FM0 A;  1ITG A;  4CEA A;  3WQU A;  3A5L C;  4BY9 C;  2PYL A;  3K57 A;  3DXK B;  5KQD A; 
#chains in the Genus database with same CATH homology
 1NGH A;  1JCF A;  1NGB A;  2IVO A;  1BDG A;  3CIP A;  3HI0 A;  3VTH A;  2OTJ N;  2I7P A;  3EE9 A;  1T3V A;  5AQP A;  3LDP A;  4YDU A;  4FWS A;  4JKE A;  5AQS A;  3SMS A;  1QQO A;  4CBX A;  2NRT A;  3A5M C;  3CJC A;  2NRR A;  3CCL N;  4GV3 A;  1P8Z A;  3MN5 A;  1H1V A;  5EVZ A;  4K41 A;  3QIC A;  1KQS M;  1RFQ A;  4DQ8 A;  4LC9 B;  1K73 O;  1U2V B;  3G4S N;  3UB5 A;  1NLV A;  5EY4 A;  4BRK A;  2CGK A;  3CC7 N;  3FZF A;  2YI1 A;  3O4W A;  4I6M A;  4IO9 L;  3ENB A;  1V4T A;  4MO4 A;  3BP8 A;  4HTL A;  1KD1 O;  3CQY A;  3K9K A;  1KAX A;  2P9L B;  4FWO A;  4JKH A;  5C10 A;  2Q36 A;  1TUU A;  4H5N A;  1S72 N;  5GAE P;  2P9N A;  1WUA A;  2PBD A;  1HPM A;  1Q81 O;  4BRQ A;  2P9K A;  3CCM N;  3NVK A;  3A5O C;  3DXM B;  3CCU N;  4XH5 A;  4JK9 A;  4M7Y A;  1W2B M;  2GX9 A;  4WFB L;  5HOO A;  3VGM A;  2VGN A;  3EO3 A;  1P90 A;  3UKU A;  3AAR A;  4H5R A;  3AGR A;  3MX2 A;  5GAG P;  3ULE B;  2HMP A;  1SAZ A;  1OVY A;  4JKC A;  4E1J A;  3HM8 A;  2A40 A;  3EKS A;  4BRN A;  2ZJR L;  5BRD A;  4GNI A;  1VQN N;  4H0O A;  4IZ9 A;  5AQR A;  2FSK A;  3K9J A;  3VES A;  4H5W A;  1VQO N;  1NM1 A;  5M1N A;  3VET A;  5FPM A;  1IJJ A;  1JCG A;  4YOR A;  2JWK A;  4AM6 A;  5JLF A;  3WQT A;  3TTC A;  3EZW A;  3VF6 A;  1V4S A;  3SMP A;  3MN7 A;  4CJ7 A;  3C7N A;  2HF4 A;  3LL3 A;  1RGI A;  3KVG A;  2QWL A;  2A5X A;  2ITM A;  3CCV N;  3UKR A;  3VF4 A;  1VQP N;  5ADX H;  3BUZ B;  5BN8 A;  5JVH L;  4PHT X;  3WXL A;  2D4W A;  4KH4 A;  4H0V B;  4BRC A;  3U9Z A;  5GAD P;  2QM1 A;  3C6A A;  4B1U B;  4KH6 A;  5AZI A;  1YI2 N;  2Q0R A;  3O9T A;  1NGE A;  2QEX N;  3LM9 A;  3QFP A;  2GWK A;  2JWL A;  5CE3 A;  1T44 A;  2WBN A;  2V52 B;  4IOX A;  2ZWH A;  4CD3 A;  2YHX A;  4JN4 A;  1GLC G;  4JAX A;  2QA4 N;  3KWG A;  1RDU A;  5M1F A;  2HBM A;  1M90 O;  5LY3 A;  1GLJ O;  3D2E B;  3M6G A;  3ATU A;  1DT9 A;  1MWK A;  3GE1 A;  3M3Z A;  5FPN A;  4BRM A;  3CCS N;  2ASO A;  3ZEU A;  3VEY A;  2P9I A;  2QWN A;  5AQM A;  4OPA A;  3CER A;  1QQN A;  4QS8 A;  3TTD A;  1D4X A;  1J6Z A;  3O80 A;  2A6A A;  1HJO A;  5B8H A;  3CPW M;  3WXM B;  3LDN A;  3MN6 A;  4B1X B;  1S3X A;  4DCH A;  5BR9 A;  3MWT A;  3IDH A;  4H0T B;  2CH6 A;  4CZL A;  2AA4 A;  4YOV A;  4U7B A;  4EFH A;  3QFU A;  1G99 A;  4RWT A;  3SLC A;  1DKG D;  3IFR A;  1QQM A;  4BRD A;  2E2Q A;  4YOT A;  1GLF O;  4FWM A;  3P4I A;  4JK8 A;  4YOU A;  4G9Z A;  1ATN A;  3M1F A;  3VEZ A;  4IO8 A;  1VQ7 N;  2RHK A;  2P9P A;  5AQU A;  5EX5 A;  3W3D A;  3CCE N;  2F9W A;  3IKM A;  2NRV A;  1Q86 O;  2YHY A;  5ELZ A;  3J8A A;  3J7Z O;  3JXU A;  1YJN N;  2E88 A;  4WYB A;  3W0L A;  4CZJ A;  1HUX A;  1YUW A;  2IVP A;  3LM2 A;  3D6R A;  4XH4 A;  3E9L A;  3UE5 A;  4BR4 A;  4B1Y B;  4BC4 A;  1ATS A;  3ENH A;  2HBJ A;  2QWP A;  4FWP A;  3E1Y A;  5M1K A;  1BA1 A;  5M1P A;  3IMX A;  3EE8 A;  4BR2 A;  2QI2 A;  1QZ5 A;  1VQ4 N;  1VQL N;  4HWI A;  3C0B A;  3LDL A;  1Z05 A;  1K8K A;  1BU6 O;  4I6M B;  3NMU A;  2A41 A;  1VQ5 N;  2GTD A;  1ESV A;  3N4P A;  4JNE A;  4JKA A;  4O8U A;  5C2D A;  3WXJ A;  3C65 A;  1YAG A;  4C1N K;  4H03 B;  4YOY A;  4H0P A;  5EOY A;  3O1B A;  4A57 A;  2P9K B;  3RVC A;  4CBU A;  5KPR A;  5FPE A;  3AGK A;  4BGB A;  2HBL A;  3L6Q A;  3O8M A;  3VF2 A;  4Y0W A;  4YDU C;  4IDH A;  4C23 A;  2NLX A;  3CC4 N;  3VEN A;  3CF5 L;  4AF1 A;  4BC2 A;  4FWQ A;  2E1Z A;  3VPZ A;  3T69 A;  4JKB A;  3CET A;  3ENO A;  3DLL L;  4BR9 A;  4EHU A;  1XC3 A;  3HRG A;  4EHT A;  3G6E N;  4BR5 A;  4OPH A;  3WUH A;  2OTL N;  5AQW A;  4PL8 A;  4BGA A;  3ZX0 A;  3NVM A;  1T6C A;  4BRP A;  3CXC M;  3T7Z A;  3GDQ A;  3RSE A;  3C7N B;  5HL7 L;  3OBW A;  2YCH A;  1S22 A;  3GG4 A;  5ADX A;  2KLA A;  3PIO L;  4CZM A;  3BF1 A;  4BRL A;  2NRH A;  3BF3 A;  4CZK A;  3AY9 A;  2WFB A;  3N4Q A;  4JD2 A;  3TSP A;  1QZ6 A;  3SAG A;  3D2F B;  4IJA A;  5AZI B;  4BRE A;  1QHA A;  4WF9 L;  1JJ2 M;  1IG8 A;  4DKW A;  4BG9 A;  5AQT A;  1BWF O;  1BA0 A;  1Z6R A;  1HLU A;  3CPE A;  3O1W A;  4GV6 A;  2Q1N A;  3SBG A;  2GWJ A;  1Q18 A;  1U6Z A;  3G25 A;  2Q2R A;  2YJF A;  1E4F T;  3P39 A;  3P38 A;  2VWB A;  2QWO A;  5C2F A;  4WQ4 A;  5H1S Q;  3LDO A;  3HOT A;  4MDB A;  1R59 O;  1M1K O;  1KC8 O;  2YHW A;  4OO1 J;  1E4G T;  1MA9 B;  1ZXO A;  3EL2 A;  4WQ4 C;  2BH1 A;  5F2R A;  1GLA G;  2P9I B;  2P9U B;  4K42 A;  5BPM A;  4IWV A;  4MLH A;  3I56 N;  4BRA A;  3CMA N;  3L4I A;  2QW9 A;  2IVN A;  3MK6 A;  1NGC A;  2FSN A;  4RCH A;  4ISF A;  1KXP A;  3CQX A;  3U9D A;  1NWK A;  2HF3 A;  5AR0 A;  3VEX A;  3VOV A;  3Q7C A;  4FSV A;  5GIP A;  3H46 O;  4FO0 A;  3VEO A;  3VEW A;  2P9S B;  4CBW A;  1SQK A;  2QTD A;  3MCP A;  3U8X A;  5AQX A;  3ZX3 A;  3FZM A;  2VGM A;  4CD1 A;  1Q82 O;  1VQ9 N;  1SS6 A;  5AZJ A;  2IIR A;  3CCR N;  3CJA A;  4FWL A;  4IEE A;  4AM7 A;  3CCJ N;  4R79 A;  1O13 A;  4JHD A;  3TTF A;  5CHI A;  4J8F A;  4M7X A;  4KBO A;  5BPL A;  4ILG B;  4RTF D;  5BRE A;  1K9M O;  5C15 A;  4UY8 O;  1VAZ A;  2AP1 A;  1CZA N;  5E26 A;  4ISG A;  5AQN A;  3BEX A;  4B1W B;  5TKW A;  4YOX A;  1ZBS A;  3GL1 A;  1C0G A;  3SJH A;  3TSQ A;  1BUP A;  1VQK N;  3H1V X;  5BPN A;  5AQZ A;  1W97 L;  1VQ6 N;  1HKG A;  4B1Z A;  3SBT A;  3I8B A;  3O9Q A;  2GUP A;  3R9P A;  1K8K B;  1NGF A;  2CH5 A;  3H3N O;  4FPA A;  5AQV A;  4EAH D;  5BRH A;  3TU5 A;  5GIO A;  1N8R O;  2J4R A;  3HBT A;  1VQ8 N;  2FSJ A;  4WQ5 A;  5F1X A;  3H45 C;  3KZB A;  3HZ6 A;  3ZX2 A;  2HBK A;  4F9O A;  1X3M A;  5AQO A;  4JKG A;  3G71 N;  4FVU A;  4A5A A;  3FLC O;  4CZE A;  3ZYY X;  4DHY A;  4JKF A;  2ZGZ A;  3R1X A;  3R6M A;  3FR0 A;  5KQD A;  3CJ7 A;  2ASM A;  3VMF B;  1X3N A;  4CZF A;  2ASP A;  2V7Y A;  1GLL O;  4FWK A;  3L4Q A;  1SZ2 A;  2VCP A;  3SAF A;  3EN9 A;  3WEE A;  2NNW A;  5CR4 A;  2PFU A;  3MDQ A;  2Q97 A;  2NRX A;  5AQG A;  3EKU A;  3VTI A;  4CZG A;  3ZET A;  3CD6 N;  1T6D A;  3JS6 A;  3AAQ A;  5AQJ A;  2E8A A;  4NLB A;  1YVN A;  3MWP A;  4O8K A;  1HKB A;  2WC9 A;  4XEI A;  4H0Y B;  3OBY A;  2P9N B;  2E2P A;  4CZH A;  4IOC L;  1LCU A;  2DPN A;  4BR0 A;  4BVP A;  1BO5 O;  5AQI A;  2CGL A;  3HSC A;  4QS9 A;  3RSE B;  3I55 N;  2E2N A;  5GAH P;  3UKU B;  1KAY A;  1Q7Y O;  1XQS C;  1TYQ A;  1ZC6 A;  4IFE A;  2NRW A;  3C6H A;  3QB0 A;  4FL9 A;  1C0F A;  2NRZ A;  4JD2 B;  5E84 A;  4JEP A;  5F0X A;  2EWS A;  1BOT O;  3KWI A;  1OKJ A;  3KK7 A;  4CZI A;  1X9J A;  3FZH A;  4K43 A;  1ILY A;  4BRG A;  4BQZ A;  2FXU A;  4MDA A;  4MO5 A;  2E1Y A;  3R8E A;  3Q7B A;  3TSU A;  5AQQ A;  4QS7 A;  3KHY A;  3QBW A;  3ATV A;  2W41 A;  3CHW A;  3CC2 N;  3A8Y A;  3GOI A;  5LJV A;  4YOW A;  1BG3 A;  2QWQ A;  3D7E O;  3UKR B;  3CME N;  2H3G X;  4BRI A;  2Q0U A;  3P31 A;  4NO7 A;  5C12 A;  2ZF5 O;  3MN9 A;  3FZK A;  4A5B A;  5FPD A;  4WFN L;  3B8A X;  2I7N A;  4A61 A;  1JCE A;  5AQY A;  3DXK A;  3GBT A;  1YIJ N;  1VQM N;  4WCE L;  3S41 A;  1DEJ A;  1KAZ A;  1XUP O;  2E20 A;  4PKH A;  4L3Q A;  1YHQ N;  5EXW A;  4EIA A;  2V7Z A;  5KPZ A;  4H0X B;  3CI5 A;  2YJE A;  4A59 A;  3LDQ A;  2F9T A;  4XH1 A;  4WFA L;  1U2V A;  3OA9 A;  5AQK A;  3ZEU B;  5DM7 L;  2KHO A;  1NGA A;  2ZJP L;  1GLD G;  2YX6 A;  3ID8 A;  1NMD A;  2QWM A;  4CI6 A;  4GV9 A;  1EO1 A;  3MX5 A;  5AZJ B;  4BQL A;  5BRF A;  4M63 C;  2D0O A;  4GVE A;  4JHD B;  3M5R A;  5AQH A;  3A0I X;  2P9L A;  1Y64 A;  3E9P A;  3HTV A;  3O08 A;  4PKG A;  5AQL A;  3DWL A;  5C0Y A;  2BUP A;  3PLA A;  3H1Q A;  5M1Q A;  3VEV A;  5GIN A;  1YJ9 N;  3DXM A;  5M1O A;  3DJC A;  3E9O A;  2VYP A;  1EQY A;  4BR7 A;  1NGD A;  2GEL A;  4FOE A;  5JMV A;  1TUY A;  4NLC A;  3FFK B;  1QVF M;  3ULE A;  1QVG M;  5I9E B;  3VGK A;  2BTF A;  1K8A O;  4Z94 A;  3CJ9 A;  1RDW X;  4K25 A;  1WOQ A;  2QXL A;  1HKC A;  2WUS A;  3D2F A;  4IEI A;  2V51 B;  3CJB A;  5TKY A;  3R3L A;  1GLE G;  2FF3 B;  2P9P B;  4FOI A;  4BC5 A;  2F7T A;  3A5N C;  3TPQ A;  4BRF A;  5AFU A;  1NGG A;  3F2K A;  1YJW N;  4JKG B;  5KQ8 A;  2GEM A;  3CJ1 A;  2A42 A;  2E2O A;  1NBW A;  1DGK N;  2Q31 A;  4IXC A;  4MLE A;  4A2B A;  3SAH A;  4GY2 B;  3VGL A;  4FPB A;  1MWM A;  5LJW A;  3H6E A;  5AQF A;  4B1V A;  2HST A;  4DB3 A;  2ZGY A;  3WEE B;  3HOS A;  4U67 L;  2P9U A;  2A3Z A;  3ZET B;  2FF6 A;  5DM6 L;  3FE1 A;  4H5V A;  3MCA B;  4WQ5 C;  5MLC Q;  2PAV A;  1HX1 A;  2W40 A;  3IUC A;  3PIP L;  3CCQ N;  5AFU H;  2ZJQ L;  3QDK A;  1ATR A;  1GLB G;  4NB4 A;  5BN9 A;  3WXK A;  3FZL A;  1YF5 L;  1NJI O;  3FGU A;  1TYQ B;  4PKI A;  3O9U A;  4BG8 A;  1NGJ A;  3O9S A;  2CGJ A;  2UYT A;  3D2E A;  3E66 A;  3QBX A;  4ISE A;  1LOT B;  1MDU B;  4ILJ A;  2P9S A;  4BVO A;  4BRH A;  1NGI A;  2FLO A;  3F5T A;  3OHR A;  4BC3 A;  5JLH A;  3WT0 A;  2HOE A;  3WXI A;  3O6W A;  4FWN A;  1YXQ A;  3I33 A;  4ILH A;  3ID6 A;  4H5T A;  4IJN A;  2D1K A;  1YIT N;  3AAP A;  3MMV A;  2NZT A;  4C1N I;  2QWR A;  3L0Q A;  3OW2 M;  3F9M A;  2OAN A;  3DAW A;  4BRO A;  4IOA L;  3H3O B;  3O5B A;  3QML A;  4O5F A;  5JIC A;  5JVG L;  2RE2 A;  3SK3 A;  4A62 A;  2KKZ A;  3O9R A;  3WQU A;  4B9Q A;  3A5L C;  4JKD A;  4FWR A;  4JK7 A;  4A2A A;  4BY9 C;  3U4L A;  2D0P A;  4PL7 A;  3DXK B;  5KPT A;  3VER A;  4KH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...