5J1EA

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
550
structure length
541
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 133
structure length 541
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j1eA05
4NCGA 4LQ9A 2HMIB 2RF2A 5C42A 2V4QA 5CYMA 2BRKA 4KTZA 3VQ6A 1RBTA 3EZUA 3AVNA 3CM5A 4YNQA 3RBEA 3KLGB 5DQIA 4N47A 1LWCB 3HHKA 4IFVA 1IKXA 3G6YA 4ECXA 1KLMA 4FJNA 4KHSA 3TVKA 1S48A 5L1KA 1S9EB 1GOBA 4RG8A 1RBRA 3KMQA 4IRCA 1U4BA 3OSNA 1ZYQA 1EXQA 2AGPA 3M9MB 3QIPA 1LWFA 4W5RA 3M9NB 1S1TA 1L5UA 3VQ4A 3D5MA 2FJVA 4TN2A 1OS5A 5KFQA 3AO3A 3EPIA 4Q0BA 3BDPA 1S97A 3NL0A 1RT7B 5FDLB 4ZP9A 5KG1A 4RUCA 3VN5A 3LAMA 3CQ8A 1N4LA 3AO2A 5KG2A 2WRMA 5SZTA 1HYSB 3NAIA 4TQSA 3OHAA 4W5OA 4ECWA 4IFYA 2IAJB 4CGDA 3L2QA 1TKZA 4IG3A 3LWMA 5T7BA 4BE1A 3QLHA 4FZYA 2BRLA 3PR4A 3LZJA 1KLNA 3TAFA 1NK0A 1REVA 3THVA 4DTNA 2ITGA 3T19A 4R8UA 2NUBA 4Q5VA 3HK2A 2W9BA 2WONB 1VSFA 2YV0X 2W9AA 4KB0A 1U45A 4BDZA 4NLOA 4J9NA 3SNNA 3DOKA 4Z4CA 2IM1A 1RT2A 4Y1DA 4ICLA 3G86A 2YKMA 2B43A 3DMJB 2PZSA 4OPKA 4WE1B 2C2DA 4R0EA 3H5SA 4O0JA 3IS9A 1VSJA 4DTJA 2HW3A 2OPQA 3SV3A 4CK3A 3OL6A 1HNIB 1A5WA 2P51A 4NLYA 2P5OA 2HHUA 4IBNA 4KBIA 4DU4A 4CF2A 4M45A 1G15A 4B3OB 1NNDA 1C6VA 3HPOA 3OYDA 3OLBA 3DRPB 1X9MA 4QAGA 3EZ5A 5DQHA 4GW6A 2OZSA 4HCCA 2KFZA 1QSYA 4KKOB 1IKWA 4H4MB 4CJSA 1J53A 3HPGA 2B5JA 1SH3A 3B6PA 4BWMA 2VWJA 2ZD1B 2XI2A 4ED2A 4WZQA 5SWMA 4F2RA 4QCLA 1XR6A 4CF1A 1TP7A 1WSJA 4DTSA 3LANA 5I3UA 1SUQB 4IKFA 1LW0B 3M8QB 4NYFA 5KT2A 3Q8QB 1KVBA 3HPHA 5DMRA 4DSEA 2X74A 4ZTFA 4WFZA 4CGFA 2I1RA 5JXSA 2XGPA 4YR0A 3OYKA 5KI6A 3RB3A 2V0NA 2ILZA 4ZPBA 4O44B 3C6UA 1SKSA 3DYAB 3CFPA 3L3UA 2UUTA 4OKJA 1JLAB 4J9LA 4RW8B 2G8UA 4FXDA 3DLGB 1X9WA 3ZSVA 3ZSWA 1SL2A 3PX6A 3SZ2A 4CIFA 1W25A 2YNFA 4NRUA 1S1UA 1JLGB 2AWZA 2E4LA 4DTOA 2Y1IA 4FLYA 4B08A 4RW7A 3NCIA 3RMCA 1JLBA 1JL2A 1IH7A 5FRMA 4ECSA 1TKTB 2B6AA 5F8HA 3KLEA 3JYTB 4DTRA 1RDAA 3DLEA 2Z1JA 3NE6A 3KK3A 4K4XA 4CECA 4IG0B 5E41A 2JEJA 3VQ9A 2VA3A 5J2NA 3HP6A 4J9KA 3V1OA 5KT4A 4ED6A 4M3WA 3DRSB 1FKOB 4FJ5A 4XIUA 3CDWA 3GIMA 3BQ1A 3M9OB 4WYLA 2IJFA 5KGWA 3D45A 1MU2B 3AVHA 1RYRA 1EETA 1FK9B 1W0HA 1XR7A 2UVWA 4CEBA 1DLOB 2WOMA 1JLCA 4ZVGA 3L2UA 4OLAA 3CWJA 2ILYA 5KFYA 4W5QA 2DTUA 1RBUA 3V9UA 4XPEA 4ZP8A 4CGHA 3HO1A 3LDSA 3UQSA 2FBXA 2FBTA 1RAJA 2BR0A 4MK7A 3LPUA 4Q8FA 3VQBA 3ITHB 4GVMA 4CCHA 3DI6B 3V9WA 3KJVB 1JLEB 4AILC 3TAMB 2FJWA 4NLDA 2FLLA 4W5NA 3IG1B 2HHTA 1VK0A 1RA6A 3QETA 4CEDA 3KK1A 2PY5A 4IDKA 4I2PB 3H08A 3L8BA 4IH5A 3H5YA 2WB4A 2FVCA 4KHRA 4KRFA 1VSMA 2O4IA 3OYNA 1LW2A 4OJRA 4NCAA 1IKYB 2R2TA 4J9MA 4NRTA 2PYJA 3K2PA 1S6PB 1T05B 4RW4A 1HQUB 4N56A 1SV5A 1X9SA 4CEFA 2QE5A 4FS1A 4DQSA 2YNHB 2HB5A 1ZBFA 3HM9A 3P83D 1Y97A 4CEAA 5JS2A 4ID5B 2Z1GA 3AVIA 1GOAA 4DSIA 1NKCA 5J2PB 1TVRA 3DRRA 4O55A 3KD1E 4MFBB 2XCPA 3MXIA 3S3OA 5HROA 1RTJA 4DL3A 3SPZA 3SI6A 4N5SA 1TL3A 2VG5A 4H54A 4C8OA 4FCYA 3MTKA 4Z4IA 4ZVFA 1QAJA 1ZETA 3DOLB 4FW2A 4B9SA 3FFIA 5HRNA 4FLXA 2Y1JA 1TKXA 3U3GA 3PJXA 3HVWA 4LH4A 3MECA 4ZHRB 2R2UA 3T5LA 1RYSA 3OJSA 2C28A 1VSKA 4ZTJA 3IGNA 5K14A 1UAXA 4KV8B 3HVAA 2E9RX 2IOCA 5CY4A 3VQ5A 4OKEA 2ASJA 1ZBHA 4QWDA 1B92A 4FLZA 3KLGA 4IQXA 4DQPA 1LWCA 4CK2A 2FC0A 1YTUA 2YKNB 5KFXA 4FJKA 3QNOA 5HRPA 1F21A 2OPSB 2F96A 1WLJA 2P5GA 5KFEA 1ZBUA 4PUOB 2OPRB 2E6LA 3G6VA 5KRTA 4CF8A 5KFVA 3M8PB 4KE5A 3VA0A 1XHZA 4JV2A 4CJLA 4ZMMA 3V9XA 1S1VB 2JEIA 4CIGA 3SQ0A 1S9GA 1WNEA 3QINA 1HJRA 3CJ2A 3NAEA 3KD5E 4MKBA 3VQ8A 3VQCA 1T03B 4KB1A 5KG4A 2YNIB 1RT7A 1SKWA 4K4SA 3QZ7A 1TQLA 5L1JA 1B9DA 1NK6A 4Y2AA 4WFYA 1HYSA 2DPJA 1RILA 1EP4B 1S1WA 3OL7A 4N41A 5HBMB 2IAJA 1WSGA 4CFBA 4LSLB 4Y34A 3OJUA 3ZT3A 4O4GB 4FLVA 4NLQA 4CJ4A 3RRGA 3QNNA 3KKSA 5CYQB 2Z1HA 1RTDB 3RRHA 5KT5A 1CZBA 3FSIA 2WONA 3GILA 2IM2A 1RNHA 3MR6A 3C94A 2O4GA 4I7FB 4DS4A 2I5JA 3QEWA 2EC0A 2GBZA 3L3VA 3Q8PB 4LQ3A 3DMJA 3LP0A 4DLEA 4Q43A 4WE1A 4DL6A 2HNDB 4TSXA 1YT3A 4FJMA 3G0ZA 3I0SA 4EP5A 3FQLA 3SI8A 2Q3SA 3V6DB 4JUZA 5C24B 3FQKA 1BQMA 4O3SA 1HNIA 2HNYB 3I5AA 4QOZB 4PA1A 3SQ2A 4U7CA 3S3NA 2HNZA 4CHOA 3DRPA 3M8SA 1JLFA 4FLWA 4KKOA 3O4QA 4M42A 4H4MA 3CJ3A 4CJQA 3HP9A 2D3UA 4CFDA 4KAIA 2A1SA 2W7OA 3EPGA 4KO0A 4JLHA 3TR8A 4ED0A 1HNVB 3I0RA 3RBDA 4CFCA 1SUQA 2ZE2B 3S9HA 1LW0A 3I5CA 3M8QA 3TI0A 4G1QB 4ELVA 1TGOA 3GV5B 3VQAA 3K58A 3QERA 2BDPA 3I5BA 3IRXB 5HP1B 1JIHA 4YQWA 1DTQB 5KFRA 4CEEA 1C1AA 2F8TA 4FW1A 4TYBA 5KFTA 1CLQA 4LY7A 4CK1A 4B9UA 2QV6A 3DYAA 1NOZA 1X1PA 3LP3A 1JLAA 4NLPA 3KLFA 1NJWA 4FLTA 3DDKA 1RT5B 3NGZA 4JRPA 4OLBA 4K4WA 3PV8A 3E51A 4MQ3A 4RUAA 3KIOA 1JLGA 3RB0A 3ICLA 3GV8B 2UVRA 2G8WA 3QGGA 1VRTA 5KG3A 1N56A 4FJ8A 4FK0A 3QIDA 3IGVA 3DM2B 1C0UB 4DMNA 3PW2A 4ECVA 4R5PB 4DG1B 1BGXT 5JS1A 5C25B 3I8DA 1QE1B 1SL1A 2WTFA 3OLAA 4FM0A 3AO5A 4M3TA 1L3VA 1T8EA 2KZMA 1HYVA 2E9ZA 1KCFA 3ZT4A 3VA3A 5L9XA 4KREA 1T94A 1WNSA 3T3FA 5DLFA 4IG0A 4HYKA 4Q8EA 4B9TA 2BANB 1WSEA 4ED8A 1RT4B 4CJEA 3AO1A 1N5YB 4ED1A 4KHYA 3PW5A 5KRSA 3K57A 2X6NA 3OY9A 3DRSA 3LZIA 1FKOA 4CJ3A 4Q44A 1S0MA 2C2EA 3KHHA 5L1LA 1NHVA 1MU2A 4DTMA 1VSEA 1VSLA 1FK9A 4NCBA 4J9OA 4IH7A 3FRZA 1BCOA 4YMEA 4HVJA 3P5JA 4ECQA 5KFOA 4ED7A 3LPTA 2CKWA 2O5DA 1TAUA 1S5JA 4Z4FA 2R7YA 1BIZA 4MK9A 3ITHA 4ZVEA 1NJZA 4KAZA 5HRRA 5KG7A 3QGIA 3DI6A 3TARA 3KJVA 4TY8B 3QEVA 1JXEA 5KFBA 4FJXA 3TAMA 3KLHB 3IG1A 4OGEA 3E01B 4NLVA 1JXLA 1QHTA 1D1UA 2G8VA 4WXOA 4DSLA 3D28A 3LWLA 1CSJA 4W5TA 1NKEA 2IC3A 2JLEA 1IKYA 2V4RA 3MF5A 3TAPA 5F9LA 2XC9A 1JXBA 1T05A 1Z25A 2IBKA 5J2QA 3KLIB 4ECTA 1IKXB 4FBUA 3ISND 4DFMA 3SCXA 1KLMB 5DK5A 2ATLA 3HSTB 2AGQA 3CYMA 3SQ1A 2QKKA 4C8MA 3H98A 3DLRA 3ZSXA 1JKHB 2RDIA 4LH5A 3VQPA 3BSNA 2J6UA 3HXMA 3SQ4A 4DFPA 2FVRA 4ID5A 5I42A 2UUWA 4KHMA 5KG6A 1B9FA 4DL7A 2JGUA 3RB6A 2JC0A 3NDKA 5J2PA 2V9WA 4Q0BB 4URGA 5J1EA 4EYIB 3AVBA 4MFBA 4OPJA 3TAQA 1GX5A 4F8RA 5EDWA 3SUQA 2OPPA 1U47A 2F8EX 1S4FA 2YNGA 1RDRA 1KVAA 2EX3A 4IFYB 1SL0A 4CF9A 3O3HA 3AV9A 4AHRA 1D9DA 2DY4A 3NMAA 4FM1A 3ASMA 4Y3CA 1N6QB 1R0AB 1J5OB 3PVXA 1EX4A 3CFOA 4ZHRA 4AHTA 3RR8A 1Q8IA 1QAIA 3RMDA 1HPZA 3MEGB 4DFKA 2W9BB 3DLKA 5KTQA 3QEPA 4ECUA 4B9VA 2ASLA 4KV8A 2AX0A 2PYLA 4M3XA 4K4VA 1ZTWA 4B9LA 1ASWA 2FBYA 1JLQB 2OZMA 4K4YA 2HWHA 2YKMB 2ASDA 2XY6A 3MEDB 3OS0A 3TANA 3KK2A 3HVTB 1KFSA 4CGJA 3N6LA 3ZSRA 2KFNA 2D0BA 4KI6A 1DTTB 2ALZA 1L3TA 3UR0A 3KHRA 2OPSA 2OPQB 4EBDA 1NK9A 3MEEB 4PUOA 2OPRA 1LAVA 5EU7A 5F8NA 1S10A 4CJRA 4E1MA 4DSKA 3RAQA 2HVIA 3CJ5A 4CJKA 5KFNA 3DLHA 1S1VA 4DQRA 1S6QB 3KTQA 3PHEA 3LP2B 2D41A 2UVVA 3V9SA 2BQ3A 3IAYA 3N6NA 1HYZA 4CESA 3PZPA 5L1IA 1I6JA 4NLTA 1T03A 3N6MA 3QEXA 4CEZA 1N48A 2A1RA 1IM4A 4DSFA 3L2WA 3H4DA 3OL8A 5KG0A 2JEFA 4DLGA 5I3UB 3ZSOA 4K8XA 4DL4A 4PWDA 1IKVB 4ECYA 3WNFA 3NKYA 4LSNB 5HBMA 4E7HA 4DU3A 4LSLA 3U6FA 4O4GA 1HRHA 2VG7B 1SH0A 2W9CA 4URQU 4RZRA 2W8LA 1RTDA 4CIEA 2XRIA 3CM6A 2BGGA 3KNAA 3WNHA 3C6UB 2X78A 4KHNA 3NH2A 4GMJB 1Z4UA 3QZ8A 3U3YA 3V1RA 4I7FA 1S0OA 3PX0A 1RDDA 5FROA 4RW6B 3H40A 4FBTA 4DL5A 4C8NA 1GOCA 2W7PA 4F4ZA 5KG5A 5CZ1A 2XY5A 3SUOA 2HNDA 4CJWA 3D0PA 4FJ9A 1UWBB 2G8IA 2WK4A 3RMAA 4PQUA 4NLUA 3V6DA 3L2RA 1RT1A 5KT6A 5C24A 3AVGA 1S0NA 2FLPA 1C0TA 3AA3A 2HNYA 1UOCA 2FVQA 5EUHA 3OYBA 1HMVB 2XI3A 3K5LA 4DQQA 4Z4EA 2HHQA 1S49A 3NF7A 4J9QA 5KFSA 5HRSA 1NKBA 1WSIA 3V9ZA 3HYFA 3KHLA 2HMIA 4KI4A 2J6SA 1TL1B 3KOAA 1D0EA 5J2NB 1VRUB 2R8GA 3B6OA 5EWFA 4DTUA 2ZE2A 3NGDA 1RBVA 4G1QA 3SUNA 4M41A 3O3FA 4J2EA 1UA1A 1EETB 2IDOA 1QS4A 3AVFA 1S9EA 3LP1B 1JLCB 2KTQA 3L2VA 4IOBA 2ETJA 4KHWA 4H8KA 5HP1A 1DTQA 1RTIB 3RTVA 1XWLA 5J2MB 1ASUA 3NBPB 5KFJA 3KHGA 2XWYA 2X6SA 4KTWA 3GIIA 4FVMA 1RT5A 3OYGA 5FDLA 3KK1B 3ULDA 2HHSA 4TXSA 1TAQA 3OYHA 4QPXA 2FVSA 3VQQA 1A5VA 3K5NA 3DM2A 1C0UA 2ATQA 1J9AA 5KFPA 1S9FA 4R5PA 4DG1A 3GYNA 3H5UA 5C25A 1QE1A 3F73A 1KHVA 3OYEA 2HVHA 3C6TB 1SV5B 4FJ7A 4OVLA 2VA2A 2B4JA 2E9TA 3NGYA 2BE2B 4EO6A 4EZ6A 3FDSA 3CDEA 1HQEB 1CXQA 3HT3A 2BANA 4O3PA 1SH2A 2RPIA 1I39A 4M3RA 4AHSA 3GIJA 1BQNB 2R8JA 1UA0A 3T5KA 1C1BB 4ZPAA 3RWUA 5F9NA 4FK4A 1TK0A 4BDPA 4DL2A 3ZSZA 4DTPA 4FJIA 4HHTA 1BI4B 3K5MA 1RTHB 4YP3A 3AA4A 2GIQA 3DRRB 4F4WA 5HROB 5DG9A 2XY7A 1TV6B 4FK2A 1Q9YA 3BSOA 4G3IA 4U6PA 1ZBLA 1LWEB 4B3OA 5KT3A 2IGIA 1U04A 4ZPDA 3GV7B 3OYIA 5DGBA 1NOYA 4RNHA 4FS2A 5KFUA 2IA6A 3KLVA 3RB4A 1QTMA 1RA7A 1O1WA 4O3OA 1RDCA 3ALYA 3ZCMA 4Z4GA 4KFBB 4DU1A 4L8RB 2R8HA 5F8GA 4J2DA 3TAEA 4TY8A 4J2BA 3FFIB 4Z0UA 3GIKA 3TWHA 2G8HA 2ZD1A 2EHGA 3V81B 2D5RA 3C95A 4QW9A 3NGIA 3PO4A 2XHBA 3E01A 1BCMA 3AVJA 3G10A 5KFMA 2DPIA 4O3RA 3NF6A 1XHXA 1QSSA 1CZ9A 4DF8A 2D0CA 1L3SA 3AA2A 1YVFA 3MR2A 5KFHA 4FYDA 3HL8A 1GX6A 4EZ9A 4CHNA 4NLXA 4X2BA 4F4YA 1VSDA 4EBEA 4FJJA 1HARA 2AU0A 3BGRB 3O4NA 3KLIA 3AVKA 4HUGA 4JV1A 5DLGA 1C1CB 4O44A 4NLGA 4O3QA 4XO0A 3V4IB 4RW9B 4RW8A 1W9HA 3QEIA 3AVCA 3DLGA 4NYZA 3SYZA 1ZBIA 4H4OB 1JKHA 1A5XA 2F8SA 4CEOA 2GC8A 4WZMA 4E7KA 4RNOA 1S9GB 4ED3A 1FKPB 4ELUA 4FJGA 1K1QA 1WSHA 3BQ0A 3KMSA 3NFAA 4M3YA 4Y2CA 1C2PA 4KPYA 2RKIB 5EWEA 5HLFB 3SV4A 4NLWA 4FJHA 2HHVA 3GQCA 1TKTA 3PO5A 1WAJA 3JYTA 3ZSQA 2W42A 1S1WB 4E19A 3CIZA 2XY8A 1IG9A 2G8FA 5EWGA 4Q45A 4URSA 3QO9B 4QWEA 4CERA 4K4ZA 3TAGA 1N6QA 1R0AA 1J5OA 1KFDA 1WAFA 3PW7A 3WNGA 2KQ2A 4I2QB 4J9RA 3VQDA 3NF8A 3MEGA 1NJXA 3NAHA 2D3ZA 4EBCA 1TKDA 2VG6B 1JX4A 3H2LA 5KFCA 2KW4A 3PUFA 1S1XB 5DG7A 2FBVA 1KRPA 2C2RA 3HVRA 2I5JB 1JLQA 1DLOA 4MKAA 4CGIA 3LP0B 3MEDA 1RT3B 3HVTA 1I3AA 4PY5A 4CGGA 1MMLA 3DLBA 4DWIA 3I0SB 4BACA 3RR7A 1RT6B 1DTTA 4CHYA 2ZQBA 1BQMB 4ZP7A 3MEEA 1KVCA 1JLEA 4YR2A 5F8MA 3PJWA 3PW0A 4HUFA 3BQ2A 2HNZB 4TLRA 4RNMA 3T1AA 2GIRA 1BIUA 1JLFB 1S6QA 4MK8A 4I2PA 5C5JA 3LP2A 3OHBA 5D3GB 3JSMB 1U09A 5KFWA 3V6KA 5KFIA 4NCGB 4KO0B 2RF2B 5C42B 5CYMB 3S3MA 5F8JA 1BISA 3I0RB 3AO4A 4ECRA 1NK8A 1S6PA 3H59A 1K1SA 5KFDA 1HQUA 4NZ0A 1IKVA 4IFVB 3P1GA 4CEQA 2GUIA 4E7IA 5DG8A 3UDLA 4LSNA 1KSPA 2YNHA 1J54A 2DFEA 4RU9A 5KFAA 2BQRA 4TYAA 4EEYA 4JRQA 3LAKA 3RMBA 2VG7A 1KTQA 2W8KA 3QIPB 1LWFB 1JL1A 1S1TB 4Z4HA 4IR9A 4C8KA 4FZZA 3ZSYA 2CJQA 1NK7A 4JS4A 1YTAA 4QWBA 2OA8A 1RDBA 4FLUA 3Q8RB 3KLFB 2WCXA 3CO9A 4RW6A 2R8IA 4YR3A 2XCAA 1QUVA 3BSCA 3AA5X 4OGCA 3HKWA 1VRTB 4ZP6A 3OYCA 4IR1A 1UWBA 4KHUA 3PX4A 1D8YA 2VWKA 3T5HA 1CXUA 1TKZB 4IG3B 3SFUA 3DOLA 3QLHB 4CJFA 1U48A 4K8ZA 4LD0A 4NLSA 3OL9A 3QIOA 4F4KA 5DQGA 1REVB 1HMVA 4DF4A 2C22A 4R8UB 4JV0A 3OYLA 4BE0A 4DFJA 1BL3A 4CE9A 4E1NA 4CJTA 3Q8SB 4BWJA 1NJYA 2QK9A 4DTXA 1VSIA 5FRNA 5KGXA 4E3SA 3DOKB 1FXXA 1T7PA 1RT2B 4GC6A 1TL1A 4ICLB 3MXMA 2R8KA 1VRUA 4DS5A 3SUPA 4C8LA 1XC9A 2E6MA 1LV5A 3MR5A 2YKNA 3IS9B 2IJNA 4O4RA 5F8IA 4HKQA 3BR9A 4J9SA 3OYAA 3IN5A 3LP1A 2BQUA 1TK5A 3M8PA 2XO7A 3ZT0A 1YVUA 1RTIA 3TABA 2OYQA 3OYFA 5J2MA 3A2FA 3NBPA 1IKWB 3CG7A 5DGAA 2B5JB 4TY9A 2G8KA 4EYHB 1BHLA 1QQCA 1NHUA 4K4UA 4I9LA 2YNIA 1K6YA 4J2AA 1XR5A 5KFFA 3PR5B 2YHAA 4B9NA 1ITGA 4AH9A 4IH6A 3BJYA 1LAWA 4O0IA 1EP4A 4CF0A 2QXFA 3QYYA 3NHGA 5KFGA 2KZZA 2IC3B 3CJ0A 4F50A 4DEZA 4KSEB 3AVAA 3V6JA 4KHQA 4F4XA 1T3NA 3C6TA 5J2QB 4JS5A 5CYQA 3K5OA 4B8AB 4QWCA 2AQ4A 5KFKA 1KHWA 3V6HA 4B8CA 4I9QA 2HHWA 2BE2A 4RNFA 4NYNA 4CJUA 4CJ5A 1RBSA 3NH0A 1HQEA 4EO8A 1ASVA 4XPCA 2JC1A 3UPFA 1BQNA 2YNFB 1S1UB 1C1BA 5I42B 2AGOA 3AVLA 3EY1A 2IMWP 4B9MA 1BI4A 4YFUA 4CJVA 1RTHA 4WXWA 2IM0A 4M94A 3SFGA 5J1EB 3NH1A 2HWIA 4RW7B 3TQ1A 1JLBB 4E7JA 1TV6A 3OYJA 4HCBA 2OPPB 3CVKA 4FZXC 3O3GA 2B6AB 1LWEA 4GC7A 4E7LA 4N76A 4M3UA 3KLEB 2YNGB 2DFFA 3MFIA 2D0AA 4ZPCA 3DLEB 1WSFA 1TK8A 3KK3B 4MH8A 4AHVA 3CDUA 2ZKUA 2YHBA 4KFBA 3RAXA 3HJFA 5T14A 2HAIA 4WFXA 4MIBA 4O5BA 3LALA 3V81A 3EYZA 1HNVA 5KFZA 4ID1A 4HTUA 4CHZA 3SPYA 3UIQA 4ZVHA 4DSJA 2FJXA 4RNNA 1D5AA 1HPZB 4Y1CA 3DLKB 4ELTA 3QESA 4IKAA 5JUMA 4AHCA 3AVMA 5KT7A 4IRKA 4FJLA 3OYMA 2AJQA 2WOMB 4CHPA 3OS2A 4FM2A 2AX1A 3OS1A 3T5JA 3IRXA 3KK2B 4DQIA 1ZTTA 2J6TA 1QSLA 3BREA 3BGRA 2HHXA 2R2SA 1C1CA 3MAQA 4KTQA 4J9PA 3V4IA 4RW9A 1RCHA 1VSHA 4H4OA 1Z26A 3PW4A 3MFHA 2LSNA 4HUEA 5F8LA 4IDKB 4K50A 3VQ7A 4BDYA 4M95A 2WHOA 1FKPA 3OVNA 3M8RA 2IM3A 2QKBA 2R2RA 1LW2B 2RKIA 2RDJA 2OH2A 5HLFA 1L3UA 4NLRA 3VQEA 2DFHA 3H4BA 4QWAA 4RW4B 4PWDB 3ZT1A 1U49A 3WNEA 3F9KA 2RN2A 1D9FA 3QO9A 3ZT2A 1NK4A 4KB7A 1RT4A 4OKKA 4M3ZA 3G6XA 4MIAA 2XGQA 1N5YA 4I2QA 4WYWA 2W9CB 2JEGA 3CJ4A 4TQRA 3NF9A 1WN7A 3QGHA 3VQSA 1EKEA 2VG6A 1NK5A 3K59A 1XI1A 4CHQA 4E89A 1TVRB 1S1XA 4AHUA 5KFLA 3V1QA 4UQGA 4OL8A 1C0MA 1RTJB 3H5XA 4CFAA 4F3TA 1RT3A 5CZ2A 1TL3B 2VG5B 2P1JA 4O3NA 2Z1IA 1RT6A 1Q9XA 3MR3A 4IRDA 4BE2A 4PQUB 2IS3A 4EP4A 1RT1B 3CFRA 3MXJA 2FVPA 1C0TB 1TKXB 3KLHA 4ECZA 3KKRA 2FLNA 3MECB 3OSPA 3ISNC 4K4TA 2GV9A 4QW8A 4F3OA 1IO2A 2D7SA 5K14B 1SKRA 3SJJA 5D3GA 4CJPA 3BSAA 4E0DA 3JSMA 4F2SA 2UVUA 3PY8A
chains in the Genus database with same CATH superfamily
2HMIB 3O1WA 4OX7A 2RF2A 2V4QA 3NVKA 2V68A 1NLKL 5BR8J 5D4LA 3KDNA 2VBWA 4I6WA 4PWUA 4N47A 3MURP 2K7KA 3M1VB 5E3QA 1FE0A 5L1KA 4F04B 3BV8A 3W66A 1NBEB 3DXKB 4DUYK 2XS5A 4IRCA 4UOCA 1U4BA 3W0LA 5BJRA 2ZDPA 2XS2A 5AQQA 4W5RA 4OMFG 2H65B 3CJSA 1K8KA 3EPIA 2LECA 4P7TA 1Q5YA 3BDPA 1RT7B 3CE8A 3IWXA 4ZP9A 4OZ5A 5KG1A 4RUCA 2M52A 3CQ8A 1CLFA 3JTNA 3ILOA 4YHHJ 5SZTA 2F1FA 1HYSB 2CJ9A 3C7NA 3G8QA 1FDBA 3J80Y 1TKZA 4NMXA 3LWMA 4IYQA 3QLHA 3VGKA 4ILLA 1REVA 2XB2D 1XMOK 1HBUB 4CWBA 3T19A 1H72C 2W9BA 2Y1LB 2Q79A 4UY8O 2KLAA 4P75A 2O8DA 1NMNA 4KB0A 1U45A 5ETKA 4EK2A 3DMJB 1TUVA 2VBZA 4OPKA 1RWKB 3UKRA 2QA1A 4YOVA 3IAM9 4R0EA 4JI5J 1VSJA 4LFAJ 2P9SB 2HW3A 1DHMA 3A8IA 2OO4A 4CK3A 3DU6A 2P51A 4DU4A 2XM3A 4CF2A 1ICEB 2HQFA 3DXSX 1CPZA 1FFWB 1W26A 3HPOA 4FVUA 1X9MA 5E33A 1CJVB 5DQHA 4QAGA 4HCCA 1J5EJ 1QSYA 2IYIA 2RAQA 2HVEA 4FWNA 2L48A 1UVLA 2B5JA 1SH3A 2VFTA 3GSDA 2NREA 3I6PA 2ZD1B 2XI2A 4WZQA 4IJAA 3LDQA 4F2RA 2VFRA 4QCLA 1F9HA 1XR6A 3C19A 1FA0A 1TP7A 3G8SA 4DTSA 2UUAK 1SUQB 2C3OA 3ENQA 1FKAF 2HKEA 5DMRA 4DV2J 2MTLA 4YR0A 5KI6A 1UJ4A 2V0NA 4IOCQ 4B1WB 3FR0A 1K0TA 2ILZA 5CABA 4YDDB 4A57A 3M6WA 2GQQA 3LW5C 5HI7A 2G8UA 4H5TA 1SL2A 3SSQA 5DM7Q 1W25A 1KQGB 1JLGB 2XHCA 4NXNF 2D0OA 4BHQA 1K73T 3ULEB 3GFZA 1D4XA 1X0PA 3OR1B 5CCMA 4Y65A 1HIYA 1IH7A 1D09B 2CZ4A 1TUUA 1VQSA 4D3HA 2QT7A 5LMUK 2DNOA 3KLEA 3HM8A 4G9ZA 2Z1JA 3K7RA 3GR0A 1EQ0A 3RSEB 2DNMA 4IG0B 3TVZA 4DN0A 4DR5J 1HR0F 1YJTA 3R97A 3N01A 4CD1A 1R0CB 5KT4A 4M3WA 3A8YA 2VOOA 3IFEA 3J7AN 2VASA 5CE3A 4Z2XA 1FEEA 2BJ8A 2KVIA 1DZ5A 2AMCB 3H6EA 1MU2B 2R7SA 2RHKA 1EETA 1W0HA 1R8PA 3CJCA 3A13A 2DTUA 1U1OA 3V9UA 3GR1A 1K44A 3HD1A 3LDSA 4FXWA 2FBTA 1RAJA 4RWTA 2FZKB 4GVMA 3NCPA 1U1MA 4CCHA 2R7TA 3DI6B 1ZAXA 2B3TB 3UDCA 2ZFHA 4AILC 2FJWA 2FLLA 1GT8A 1FRJA 4A47A 4KHRA 4V19S 4KRFA 4XH5A 2LYVA 1NPKA 2PYJA 2WAQD 1S6PB 2YQ1A 4QPTA 5B0GA 2I7NA 1AXQA 4K7QA 3TUZC 1IUJA 4CEFA 1NPPA 2QE5A 3ENAA 3KK7A 2CDQA 4GV6A 2DHSA 3J81O 4P9SA 1RDUA 4DBQA 1ZBFA 3HM9A 4LF5J 5CXTA 2E2OA 3P83D 1OH5A 1P1TA 4LF4K 4WFAL 4X64K 1OQ3A 4A2BA 5HVFA 4OYBA 1QM9A 4JI0K 4AXJA 1Q7LB 2IRYA 1RI7A 1R43A 2YWWA 3VEWA 4ZN1A 2XCPA 3KD1E 3NCRA 3DHXA 5E84A 5HROA 1UCNA 1YG0A 3SI6A 4LF8K 4N5SA 5JLHA 4FVCA 2JVRA 2YBVA 2VD3A 3MTKA 3M8WA 3KWMA 3DOLB 1ESVA 4BQLA 4B9SA 1SJ1A 2CGKA 5HRNA 3KUGA 3MECA 2ZUAA 4X62J 2R2UA 3MM8B 1BA1A 1Y10A 4JV5F 1VSKA 5F0UA 4ZTJA 4HI1A 2OEKA 4KV8B 3H90A 2VQFF 5GAGP 4OYOA 5CY4A 4AD6A 1KP6A 1ZBHA 3QSIA 4DX7A 4B3RJ 3PG9A 4K2XA 3D6MB 2XNQA 4WP9A 4B17A 4DQPA 2FC0A 5KFXA 3QNOA 2OPSB 3ETMA 3VGUA 1DQ9A 5KFEA 1FO1A 1UVMA 5A6PA 1ZBUA 2OPRB 3NEKA 3G6VA 2R7QA 5KRTA 3M8PB 3W61A 4MLHA 4DR1J 2E1CA 3MK6A 1B0TA 5LXYA 1WNEA 2YWFA 3C16B 3CJ2A 3W3DA 1BA0A 5ADXA 1RWOB 3GONA 4RL1A 4LF7J 3PTWA 3POTA 3RZAA 3DOMA 1X4CA 3M30A 4B1VA 4HDGA 4CI6A 4WFYA 3FSYA 4G1PA 1EP4B 1S1WA 4QR0A 4YORA 1N0UA 5AQHA 3DGPB 2MKCA 2VQEF 3ZX2A 1B7FA 1EWQA 4O4GB 2JL9A 1KQSM 5AQLA 3PFOA 4NLQA 3OVAA 1WKKA 3RRGA 4YB7A 4CZEA 3TW0A 3R1XA 2EFQA 2WONA 1R8HA 3FKBA 3M8YA 3BB5A 1GEHA 3Q8YA 5FLXU 3HSGA 3UI3A 1VQLS 4DS4A 2QFIA 3LP0A 3PYDA 3T1YF 4GKJK 1Y11A 1HBNA 2VFVA 4FJMA 2OCEA 1EO1A 3FQLA 3GJSB 5EX5A 4USKA 2B7CB 1BQMA 1VQLN 1KN6A 5ETSA 3S3NA 3ISZA 2HNZA 3ZXWA 2BYCA 4GRSA 3M8SA 2ZWHA 4CZHA 4KKOA 3O4QA 4M42A 2QYCA 2VC1A 1AB8A 4WTOB 4KAIA 2A1SA 3TR8A 1CQNA 4ED0A 2P9NA 3UR3C 1RWPB 1YF5L 1U1KA 2ZE2B 4PEOA 3M8QA 1IR1A 1EKRA 1WHXA 2BJ1A 2AEMA 5AQTA 1IJJA 2E5GA 3OV7A 5BRHA 1MG7A 1R8CA 5HP1B 2B8QA 3KYLA 2W4DA 2GS8A 1C1AA 4TYBA 4DR4F 1KXPA 5KFTA 1FD8A 4HACA 3JQKA 3DYAA 1QZ5A 2YKOA 3LP3A 4KGZB 4NLPA 2NUUG 2BJ7A 3KLFA 1NJWA 4UY85 2P9LB 1RT5B 2VFUA 1U6ZA 4MQ3A 3KIOA 1I94J 2NRHA 2UVRA 2PEBA 5ETOA 5KG3A 4FJ8A 1NGIA 3EDRB 2IRUA 4M1KA 4ECVA 5AFUA 4ETZA 3HOSA 4DG1B 1QE1B 2JDJA 4HHJA 3CPWM 1JCEA 4FXVA 3A0IX 1IR2A 2VB6A 4YB1P 5E5NA 4M3TA 4A8QA 3EE3A 2KZMA 3HHLA 2E9ZA 4OYWA 1KCFA 2Q0RA 3R7SB 5D4PA 2Y0BB 5BPLA 1WNSA 3T3FA 4Q8EA 2BANB 3P49B 4AF1A 3Q7BA 1RT4B 3R5CA 1F2GA 3AO1A 3QFWA 5D78A 1PJ5A 3OY9A 3DRSA 2N7YA 3IWNC 4Q44A 2OUGA 5JMNA 5L1LA 1NHVA 3B82A 3DDNA 4KGMA 3X1LB 5FPDA 4IH7A 2AEFA 1RWMB 2UV8G 1F60B 4ECQA 1N52B 4AFFA 3D2WA 4CZJA 2O5DA 2DXFA 4ZJLA 2CJYB 4RO0A 2RJZA 3ITHA 1Q7YT 2P9EA 3TARA 2BJEA 3MN7A 3QEVA 2Z2ZA 1JXEA 4RLEA 2EG2A 2J9DE 2VIHA 3QT8A 1JXLA 3DNCA 1QHTA 2UU9J 4K42A 3BKFA 2DPNA 4WXOA 4DSLA 4KY3A 1FWPA 1HNZF 4W5TA 4PG5A 3TTDA 4DUZF 2KT2A 2YI1A 2M9KA 4X65K 1X8DA 5AZJB 4GNIA 1T05A 1G3OA 4M5LA 1Z25A 5J2QA 4AQYJ 3KLIB 4FBUA 3ISND 2VC0A 2I0XA 4DR7K 2ATLA 3J8AA 1EQYA 1WWHA 2QKKA 3H98A 4JD2B 4X66J 3D2FB 1JKHB 4LH5A 2J6UA 3QJJA 3SQ4A 3WUHA 4ID5A 5I42A 2F4FA 5G4DA 2UUWA 4OV1A 2Z57B 2V2VA 4DL7A 2IA0A 3RB6A 2GAHC 5J2PA 4EYIB 5IXUA 5EDWA 2F8EX 3D1HA 4BGAA 3EKUA 1KVAA 2EX3A 1RADB 3F41A 1ATNA 2QJ3A 5B0BA 5C15A 2XBPA 3LF0A 4Q2LA 3CTRA 3ZZTA 4FM1A 4Y3CA 1R0AB 1YAGA 1VQNS 3RMDA 1RLCL 3MEGB 4DFKA 3DLKA 2G2ZA 1B4SA 1GMWA 2PYLA 4I6YA 4K4VA 3NMRA 2J9EA 3CPEA 3G82B 1ZOTA 4BQZA 3CCUS 4V19J 3DCAA 2XY6A 2ASDA 3ENOA 1Y4ZB 1VQNN 3HVTB 3ZC4A 3D67A 3VHQA 2KFNA 3N6LA 2D0BA 2Q97A 4YOWA 2NLXA 2DTJA 3AJ2A 3SEOA 1VLYA 3UR0A 4RPFA 2IVNA 3MWBA 3FE1A 3IR6B 3CCUN 1YJRA 5EU7A 1S10A 4CJRA 2POKA 1B70B 3RAQA 2HVIA 2V69A 3M32A 5C7PA 3W8GA 1VQYA 1YRTA 2QGFB 1N32J 2BQ3A 2NPIA 3VF4A 1HYZA 4P7VA 5L1IA 3R2DJ 4NLTA 4Y2MA 4LFBF 1UVNA 1PYTA 4CYUB 2A1RA 2DNLA 5KG0A 5I3UB 4K8XA 4PWDA 1IKVB 1TFWA 1TYQB 1OH8A 4U8VA 2GMHA 4LSNB 4E7HA 1FJCA 2ZOGA 3W8PA 2HFZA 2DBBA 2R4FA 1WB9A 2PI5A 2W9CA 4FWOA 2LQBA 3CM6A 4KHNA 5HMWA 4Y28C 2FHMA 4XDCA 2OAUA 4CO2A 5E3PA 2O8BA 3V1RA 4I7FA 3PX0A 1UETA 4Q7AA 2DR5A 4RW6B 1FRMA 4MLEA 1YWXA 1FESA 2PMZD 2B8PA 4F4ZA 5KG5A 1HPMA 3IUCA 2XY5A 2MPUA 2HNDA 2PEHA 3D0PA 2J7KA 5KOXA 8ATCB 1ULRA 3RMAA 3V6DA 2O66A 3BBBA 4DCJB 3AVGA 1CS4B 3G87A 3FGUA 2Z30B 1VBXA 1SIZA 5EUHA 3OYBA 4Z4EA 2HHQA 3J7YP 2C1EB 1S49A 4BRMA 1CULA 2Z2YB 1ZZFA 3TZZA 5TKWA 3HYFA 2ZM6K 3KHLA 1IM6A 2HMIA 4KH1B 1FE4A 2HS4A 3EGVA 4USIA 1GXLA 1VRUB 3H1QA 2DH7A 2G4BA 4DTUA 2FHJA 1RBVA 3TO8A 1YRXA 2HYIB 3ENVA 5F0XA 3M1VA 1QS4A 4M7YA 3LP1B 3E9LA 4FKXA 5EN1A 1RACB 1JLCB 1Y3JA 2ETJA 3IMXA 1RTIB 3K89A 5LJ3Y 4I6MB 4DV4F 3VVUA 3UKUB 5D6GA 3FZHA 3MCOA 3UO0A 2W4PA 4QR1A 5AZIB 1UVIA 2E7WA 1NH8A 3KK1B 3ULDA 5JLFA 3AJDA 1A5VA 2BTFA 1GXTA 1C0UA 4DCHA 1J9AA 1MWQA 5H9EJ 5DJBA 4NA1A 3GYNA 3H5UA 5C25A 2GHPA 4DUYJ 4ZLNA 3F73A 3KHYA 3H2VE 1EARA 4A8KA 1TMJA 2ZH4A 2PN6A 4C1NK 3FZLA 3C6TB 2UXDK 1VAZA 4EO6A 3FDSA 3V5RA 4O3PA 1SH2A 2W2OP 3AARA 3BN7A 4AHSA 2MKKA 2R8JA 1C1BB 5F9NA 1P9QC 2K3IA 2MY8A 2WVBA 4WQ4C 3A8EA 4DTPA 3BZKA 3GCXP 3MMBB 3HHDA 2WBMA 4LF9K 3DRRB 2XNRA 2CFXA 4I69A 5L8RC 4CO3A 1LK5A 5HOOA 1Q9YA 3BSOA 1FTRA 2AP1A 1ZBLA 1HKBA 3C66A 3MPWA 3GV7B 5M1FA 5B08A 5A2QY 2CNLB 3W63A 5DM6Q 4U67L 2YQ3A 2WBRA 1O1WA 1RAEB 4Y00A 3BH6B 5KOWA 2J7WA 3VENA 3TAEA 4J2BA 5A8WA 1VLOA 3GIKA 2ZD1A 3CIMA 2QRRA 5B0AA 2EHGA 2OSQA 2D4WA 5HATA 3PO4A 1BCMA 1WC4A 1WORA 2VDHA 2DPIA 4QS8A 3MOZA 4CLLA 1CZ9A 4DR2F 1NGGA 2DNZA 3BP8A 4FWQA 3B78A 1L3SA 3NG8A 1NLVA 5KFHA 2EFVA 2DR6A 2LU2A 5IT4A 1VSDA 4ER8A 4OHZA 5AE3A 4EBEA 4FJJA 4OI0A 3W9JA 4YS2A 4KGKA 2HS3A 5CHCB 4DUTA 2DHGA 3AVKA 1S72S 1C1CB 2MY7A 4NLGA 2DIVA 1IWAA 3V4IB 1G6BA 3O8WA 2DNPA 3F0NA 3B8HA 4H4OB 3C15B 1A5XA 1ITPA 4DV7K 2F8SA 1TU0B 4CEOA 4WZMA 5JICA 1S72N 1S9GB 4ELUA 1HWKA 4FJGA 4EU0A 4FF3A 2M70A 5EWEA 4ILMA 3BBFA 2HHVA 2G1DA 1UW9A 3I4HX 1R7IA 1QQMA 2G8FA 1RHMB 3R1HA 4URSA 2P9PB 4K4ZA 1N6QA 1J5OA 1KFDA 4R79A 2HZVA 5GAGI 2KQ2A 5D15A 4I2QB 4J9RA 4FN5A 1XQSC 1T9YA 1FI4A 4BC5A 2VG6B 1JX4A 1V5IB 5KFCA 2QWMA 4UW2A 4FPAA 3ZNJ1 2FJAB 2C2RA 1JLQA 4O8UA 1ATRA 2IDEA 5LMUJ 3MEDA 6AT1B 2RSQA 4CGGA 5GVQA 4BACA 4OZNA 1E6VB 2LDYA 1WD6A 4BVOA 3CERA 1D8ZA 2MQ8A 3MEEA 2G2YA 2IRXA 1O0PA 4YR2A 2LQJA 3PJWA 3WIUA 5HVGA 3PIPL 2CYYA 4GV3A 5SUHA 3MX5A 4JN4A 1RAIB 2LMIA 3QT7A 1BIUA 1JLFB 5AQIA 4MK8A 1F5AA 1VC5A 2E44A 3OHBA 3JSMB 2ZVSA 3OBIA 2B4OA 4KO0B 5C42B 3GCWP 4BRQA 5F8JA 2D74B 3TNVA 4ECRA 1NK8A 4AUKA 1S6PA 3US5A 5AE1A 1K1SA 2H5JB 2ZHOA 2LEAA 2BJ3A 4DX5A 3P1GA 3IO1A 2GUIA 3AA9A 3ZZYA 1KSPA 2JX2A 3PFEA 1J54A 5LT5A 2KKHA 4TYAA 3LAKA 1Y5LB 3RMBA 3RAMA 3EM1A 1S1TB 4K25A 4Z4HA 4C8KA 4CLPA 4FZZA 3QDKA 1I94F 4JS4A 1YTAA 1RDBA 4FLUA 5GMEA 5LSOA 5A8KB 1K9MO 2CQCA 3BSCA 2W2NP 1WF1A 2X3GA 3AA5X 5EHHA 4V19X 2QC3A 1VRTB 2I2YA 3SMZA 3OYCA 2BXJA 4KHUA 2K7JA 1IBLF 3T5HA 1CXUA 4IG3B 3DOLA 4CJFA 4K8ZA 4NLSA 2V8PA 3OL9A 4F4KA 1QDUB 1WTBA 2C22A 4X64J 2ZBRA 1HL6A 1RB0A 5AQSA 4JI0J 4BR0A 2GFFA 4BE0A 1NXIA 4X4SA 1BL3A 1RCOB 3BUZB 5FRNA 4E3SA 3MMAA 2IVMA 3BBCA 4UQTA 3MXMA 2DISA 2VFSA 3QWUA 4LF8J 5MLCV 4OLPA 1HD1A 4RWXA 2Z56B 2E6MA 2DH8A 4CBWA 2VICA 2KM8C 1P8GA 3PYEA 5F8IA 2IBOA 2AJ4A 2W24A 3LM9A 2GVDA 4PXDA 2EKNA 4AE5A 2ZHAA 1TK5A 1ACMB 4A4JA 4DPXA 4K8RA 3M8PA 4GMKA 4FF1A 2XTJP 2W4CA 5D8HB 5T41A 4FWMA 1X7VA 2DRDA 1KVKA 1VOMA 1R6VA 1NHUA 3L09A 4I9LA 4ILJA 1X4GA 3QJLA 2YHAA 1YI2S 3MOJB 1WC1A 1PG5B 3J81j 4GVEA 1EP4A 4NEZA 3I56S 3NHGA 4AQYF 2YKAA 3HOTA 1RHQB 3CULA 2IC3B 3DGPA 3FLCO 1U24A 2BM0A 4F50A 4KSEB 1YI2N 3AVAA 3V6JA 4KHQA 1YJVA 1RZMA 2G0IA 4QBUA 4LUBA 2AQ4A 4WF9L 3I56N 5KFKA 1KHWA 3V6HA 1HI0P 2XLJA 4B8CA 4RNFA 3GTYX 1HQEA 1KQFB 3MM6A 3EEQA 3CW2C 4XPCA 1WC0A 3UPFA 4IXCA 1BQNA 1KAYA 1S1UB 2EBEA 2GJ2A 2FIUA 5AR0A 3UW1A 2JSXA 4JI3J 2QTWA 4WXWA 2HFSA 5GMDA 3R2CJ 3AD8C 3HI0A 1BU6O 4H0PA 4H0XB 4E7JA 1FT8A 3OYJA 2KM8B 4WFAQ 2B6AB 4M3UA 3Q86A 1V4TA 2V8VA 5FIIA 4FWLA 1AYEA 1S6OA 1LQ9A 4ZIVA 1VQ4S 3JXUA 3J81Y 2ZKUA 4KFBA 1RSCA 2ZBIA 4ZITA 5J1PA 1S59A 3LALA 2MZSA 4HTUA 4GKJJ 2CGLA 2FJXA 1FD2A 4RNNA 1D5AA 1HPZB 4RR5A 1NH7A 3I8BA 3H46O 3K9JA 1VQ4N 3QESA 4JB8B 3U9DA 4AHCA 5EGYA 1VR6A 1VMBA 2HGNA 2CPFA 3OYMA 2FSKA 3T5JA 4ILGB 2VJVA 2A6OA 2J6TA 1RWUA 3PRDA 3OVSA 3VGMA 4NXMJ 3D7EO 3RW7A 1RU1A 4KTQA 3UNGC 4RW9A 1N32F 1OPZA 2QL5B 3M2RB 4IOXA 1N34J 2LSNA 1RWWB 3VALA 2YX1A 4M95A 2WHOA 2CG8A 2R7XA 1FKPA 1LFWA 3HHEA 2EC2A 2H1YA 3THXB 2IM3A 1LW2B 2OH2A 5E0OA 1L3UA 5F3TA 3PIOL 4QWAA 4P2MA 1YQHA 5EX3A 3WNEA 1VIOA 5IOLA 4DV3F 3OA9A 3KWIA 1NHKL 2KHDA 1RT4A 3HZGA 4C6AA 2XGQA 2V50A 4R0JA 3CJ4A 4K5SA 4TQRA 2JWKA 4BROA 4OQJA 1NJIO 3K59A 1GH8A 2CNOB 4JKEA 1S1XA 4P74A 2D3O1 3RGIA 1RT3A 2HBYB 1XC3A 4ZN3A 2VG5B 4DV5J 1DT9A 3BO2A 4YY3F 1RT6A 3S6EA 4ANDA 1Q9XA 2OANA 4IRDA 1KOOA 1BDGA 1W2IA 3QNWB 2OEMA 2ABYA 2FLNA 3OSPA 4K4TA 2GV9A 3UN3A 3OTCA 3OFEA 1K8AT 5K14B 1SKRA 2FHOB 3WEEA 3OFHA 3PY8A 3J7A1 5L46A 3MUVP 4CQ1A 4WU2A 3VQ6A 2ZBPA 2QLJB 3CM5A 3KLGB 5DQIA 2I38A 1NSAA 4IFVA 1NG9A 3ILJA 2J0SD 4Y0FA 1VBYA 3P4IA 4ECXA 4C98A 4KHSA 4OHWA 4RG8A 2ITMA 3KMQA 4DPWA 3OSNA 3GFHA 1ZYQA 2NYHA 3CCWA 3Q89A 2AGPA 2QTDA 2PA3A 2AIRB 4LRCA 5IV3A 3M9NB 2CQBA 5F1XA 4DB3A 5C2DA 1Z1ZA 1DAXA 1OS5A 1U2CA 4BG9A 3AO3A 4W92B 1PBUA 3TA0A 1BC6A 3NMUA 3OTEA 4JI8J 1MDUB 3K2YA 5FDLB 1IVZA 3MM9B 3VN5A 4FOEA 1N4LA 2B51A 4DUYF 3AO2A 2D69A 2KFYA 2WRMA 1ATSA 4C4WA 4TQSA 1SAZA 3I9V9 4ECWA 1X4FA 2MDAA 3D6FB 4DR7J 3RJMB 3CGIA 2IAJB 1B0VA 1U1RA 4BE1A 5M2RA 1Q86T 2BRLA 5GAEP 2DNGA 3TAFA 4JHDB 3THVA 2ITGA 5BRFA 1UVKA 4LRDA 2V5HG 1S99A 4Q5VA 2NUBA 3HK2A 1FRHA 4ED4A 2V67A 1VSFA 2KO1A 4XK8C 1HNWK 4HH0A 4BDZA 1PYOB 3SNNA 1HFEL 1RBOB 3DOKA 4Z4CA 2IM1A 1RT2A 5K20B 4WE1B 1TL7A 4I1TA 1T9UA 1XMOF 4O0JA 2YY3A 3WQUA 4JKHA 3D7SB 4DTJA 1WF0A 3K0SA 2MKIA 4CW7B 3OL6A 2F4VJ 2FJDB 5DDQC 2HAFA 1YJWS 4M45A 3U7JA 1G15A 4B3OB 2YWKA 1NNDA 4WU3A 1C6VA 3LTOA 3GG0A 4YOUA 3DRPB 2KFZA 3EZ5A 4WBFA 4DUZK 1FXRA 5L38A 3QFUA 3HPGA 3DGVA 1BUPA 3QRPA 3MN6A 4BWMA 3WXJA 1LWXA 3F5TA 1IBKK 1YJWN 5SWMA 3A3NB 2FB0A 1CJKA 4CYUA 3LANA 5I3UA 2BEFA 1EJ7L 1LW0B 5JVGL 3F44A 2P9UA 4H5RA 3Q8QB 4OIXA 1AA1B 2DRBA 2UXBK 1U0SA 1H73A 2RHSB 3SAGA 1N33K 2X74A 2RE1A 5HL7L 4WFZA 1BE4A 2I1RA 3MWPA 3OYKA 4JI6K 2Q36A 2QWLA 5HO4A 7FDRA 2HFOA 3R27A 2FYXA 4O44B 2UUAF 2IVYA 4HHHA 1CG2A 1Y5NB 4CZFA 5EVZA 4J9LA 4RW8B 3MMVA 1X9WA 3BO4A 3WC0A 1H6KX 3A3PB 5E3RA 3SZ2A 4NRUA 1KS2A 3M05A 2AWZA 2HQ3A 3QFHA 4X4VA 2P8IA 3UVJB 2G2OA 3W5XA 4RW7A 3NCIA 3RMCA 1JLBA 2LP4A 3CD5A 5FRMA 3VGTA 1TKTB 4OI1A 3SIPB 2CUYA 4FF2A 1DURA 4OYPA 1C4CA 1OY6A 3DLEA 3KK3A 2R7WA 4K4XA 2Q6CA 4CECA 2XWXA 3SAFA 2KL8A 4BREA 5AQKA 1Z6RA 4YUDA 4O5FA 5AQNA 2X51A 4OJGA 3M1FA 1ZM9A 3WIVA 1FKOB 4XIUA 3BQ1A 2HFVA 4M5NA 2GW8A 2UXCJ 3AVHA 3W5ZA 4CT8A 1FK9B 1OY8A 2DR8A 2WOMA 1JLCA 1JCGA 2BJ9A 5KFYA 1X4DA 4XPEA 2R7OA 2E8AA 1LXNA 4CGHA 3HO1A 3UQSA 4I6MA 4ISFA 4X4RA 4MK7A 3LPUA 3VQBA 1HKCA 1UEVA 3KJNB 4CLZA 4NYOA 2GQCA 5G0RB 3AJ1A 3KJVB 2HHTA 1NUEA 3CC2S 1JJ2M 3KK1A 3U1MA 3CHWA 2O3DA 3H5YA 2WB4A 2GGPB 2CQ0A 1SQGA 3SBTA 3OYNA 5IWAJ 3CMES 2Q6BA 1KQKA 4OJRA 2VL1A 3HHLD 5E2QA 1IKYB 5KPTA 1IQTA 2R2TA 4J9MA 3CC2N 1YBTA 4WFNQ 1FEHA 1WKJA 3KNGA 2RIJA 4RW4A 1HQUB 4N56A 2UUBK 1QLNA 3EGNA 1UFLA 2VF3A 3CMEN 4DQSA 2YNHB 2HB5A 2MJNA 5AJ3K 5GIOA 2VODA 3TRGA 4ANEA 1RDWX 5JS2A 3NOGA 4DZ6A 2AD9A 3LL3A 3D54A 1P9YA 5B0EA 4PG7A 1AT1B 4CLYA 3THWB 3MMBA 1ZM4A 1TVRA 3DRRA 3TEGA 4KJIA 3S3OA 2HZCA 1AUDA 3QAEA 1RTJA 4DL3A 2G1HA 3L7UA 3SPZA 3FUYA 2GHVC 5KQ8A 1V3RA 1TL3A 4JYAK 4C8OA 4LF4F 1F6TA 1DARA 2EEYA 2FGOA 1K47A 1QAJA 4X64F 1ZETA 4FW2A 4UOHA 4KH5A 3CMQA 3TVYA 1YJNS 1LFPA 3VEYA 4FLXA 3U3GA 2KDOA 1FJEB 4U95A 1GLDG 3T5LA 3OJSA 4DV6K 2C28A 3IGNA 2B9WA 3D0GE 1UAXA 4WJBA 3MAAB 2E9RX 4LF9J 2A2DA 3VV2B 4NL5A 2IOCA 1YJNN 2CPHA 3VQ5A 5E26A 4OKEA 2AYBA 3A3OB 2ROGA 3ID6A 1HUXA 2N4DA 1LWCA 1OH6A 4MYTA 1X3NA 1F21A 2F96A 1WLJA 2E6LA 1N0VC 2EBGA 4KE5A 4PXBA 4J37A 1UJ5A 4C48A 1Q1KA 1S1VB 3MD1A 4CIGA 4YDUC 1S9GA 3QINA 1FJGK 2UYTA 4JAXA 3VQCA 4WQ4A 1G4CA 2FF3B 3BYPA 2EFGA 3G25A 3NGRA 2EK6A 5L1JA 1S6UA 4Y2AA 5IT0A 1NGFA 3LO3A 4FF4A 3OL7A 5GAGU 5HBMB 3RRKA 4NYPA 3DLJA 4CFBA 4Y34A 3OJUA 4DPUA 2JNJA 3EJMA 2P9PA 1R8AA 4DMZA 1CZBA 3FSIA 2L9DA 2F3JA 4ZPWR 1T6DA 2IM2A 2O4GA 4LBPA 4LFCF 3G71S 1RAAB 1QJHA 2EC0A 2GBZA 3L3VA 4LQ3A 4DLEA 2K1RB 3DU5A 2E5LK 4DV0K 3NCQA 3BZCA 1E6VA 1WDDA 4GVBB 3A5MC 3O9RA 4L75A 1XERA 2JH3A 1HNIA 3DFEA 4QOZB 3SQ2A 3CD0A 4QZVB 3TSPA 5B7WA 4UUXA 3C14B 4OX9K 2K2PA 4BVPA 1JLFA 2DD8S 4GKJF 3CXCM 4H4MA 2OGUA 3KVGA 5GIPA 1PKUA 4CJQA 1EQMA 3HP9A 2D3UA 4LR7A 4KO0A 2DEIA 1IWGA 1HNVB 3F9MA 3LDNA 4U67Q 5CCLA 1HHSA 3QT6A 4YDXA 1WF2A 4CFCA 4FZVA 4F26A 4G1QB 3I4PA 3GV5B 3IR7B 1J6ZA 2DXEA 4CI0B 2I9SA 5DS7A 3QERA 2BDPA 3I5BA 2O8CA 3IRXB 1DTQB 5KFRA 1C0FA 3ENBA 1SVDA 4TVAB 4FW1A 1KD1O 4O23A 1N8RT 1H2TZ 2ZWPA 1CLQA 4CK1A 5IQQA 4B9UA 5LJWA 1NOZA 3I9ZA 1JLAA 4OJ3A 2CPIA 1WUUA 2RT3A 5JJBA 3RYLA 3NGZA 1WACA 4OLBA 3PV8A 3DLLL 1QTNB 3DC2A 1S22A 3ICLA 3GV8B 3QGGA 2BE9B 1VRTA 4Z37A 4FK0A 3GYGA 1B64A 3SCIE 3A8KA 4BR4A 2GVZA 4R5PB 1BGXT 5JS1A 2VONA 4DR6K 4FM0A 3KG1A 3S41A 1ZBSA 1L3VA 1T8EA 1HYVA 1M1KO 2B9YA 3RU0A 5L9XA 1NO8A 2GEMA 4HI2A 4ED8A 2HSTA 3FVYA 3BN4A 3BPSP 1N5YB 2DCLA 5F3ZA 1NZ8A 4KHYA 3PW5A 5KRSA 1IR0A 3O2IA 3R6GB 4ISGA 1HR0J 4XEIA 4DTMA 2O1PA 1VSEA 4D3GA 3VAKA 4CZIA 3FRZA 1NGBA 3I96A 5DETA 2V6AA 3ELHA 1FRLA 1VQ8S 4Z4FA 2R7YA 1YLXA 4EHTA 1NJZA 3BR8A 1NB7A 1NPRA 2DY9A 2FDNA 2GHWA 2BKNA 3TAMA 1KNZA 3P96A 2WUSA 3IG1A 2DR7A 4HDHA 1QY7A 2ZUGA 4USWA 4ZVRB 1VQ8N 4NLVA 4YOYA 2KJVA 4QU7A 2GA7A 2G8VA 3EO3A 1A0OB 3D28A 2IC3A 3PIPQ 2QFJA 3MF5A 3TAPA 5LL6d 2CQGA 2IBKA 5DO2A 4DFMA 3VF6A 1KLMB 5DK5A 5C2CA 2AGQA 4GKKK 3FMWA 3W62A 1KD1T 2DT9A 4CO1A 4OZ0A 1YSJA 2B56A 1J27A 4DN9A 1RBAA 2RRNA 1Q18A 4X65F 3H20A 2JRSA 2B0GA 1U8SA 4KHMA 2HQIA 3M6UA 1M90T 2KRRA 2ASPA 3NDKA 4F9OA 2QXLA 1BHNA 1GXUA 3K8VA 2V9WA 4Q0BB 4DZDA 2C2MB 4OPJA 4MFBA 4DR7F 1VK8A 4X4UA 2FZCB 3SUQA 2PC6A 1U47A 3MCSA 1RCXB 4HT5A 4WYBA 1RDRA 1UAWA 1SL0A 3O3HA 4USTA 2MKJA 4O0NA 2DY4A 1ZAWA 3ASMA 3WQPA 2DNRA 3PVXA 4ZHRA 5HMZA 1Q82O 4CTAB 1IJEB 1HPZA 5AQJA 5D0RA 9ATCB 3O9TA 4BRCA 4NI2A 4B9VA 2CPEA 2ASLA 1BLUA 5GAHP 1NMDA 1ZTWA 1ASWA 2B4PA 2FBYA 4BRLA 1LOUA 2QLBB 2YKMB 2DGOA 3OS0A 4FOIA 3DRYA 3KJFB 2VQFJ 2CDRB 1FX4A 2E88A 3JAMU 1NK9A 2E66A 2P5VA 1JMTA 4PUOA 3CJKB 1R89A 2YKQA 5F8NA 2Y1RI 3M2RA 1RGVA 3CJ5A 5KFNA 2M5YA 4DQRA 1PYSB 1HWLA 3AT1B 3V9SA 3IAYA 3TUPA 2VKRA 5F0WA 2HVDA 2PSZA 3THXA 4R25A 1T03A 3N6MA 1WOSA 1P90A 4CLKA 1QQOA 1RGIA 2Q0UA 3L2WA 3H4DA 2ZJPL 2JEFA 4DLGA 1CJUA 4B9QA 4OPHA 5GAEI 1W2BM 4C11B 4XH4A 3GP9A 4DU3A 1TUGB 4LSLA 4JI4K 3U6FA 3IXQA 1SJ3P 1WHWA 1S12A 4CLWA 1VC6A 1SH0A 3H25A 4RZRA 1RTDA 2XRIA 5JMVA 2ZGYA 2VQEJ 3KNAA 4GMJB 5LMNK 3QZ8A 3U3YA 1N5QA 5LM7E 1RDDA 2J0QD 3CF5Q 4ZIWA 4JK9A 5FROA 4CM2A 2W7PA 4WF9Q 3EUNA 1WTFA 4CJWA 3GZ7A 2G8IA 1UWBB 3PSIA 4A5AA 2NZTA 5C24A 3AFGA 1CEZA 2ZKTA 3T1YJ 1QVGM 3AA3A 2HNYA 4BRGA 3NWGA 1WHYA 3D2EB 3Q23A 4DQQA 2XI3A 2Z8QA 3CCLS 5BN9A 2E1RA 3NF7A 3OFFA 1Q82T 5HRSA 1NKBA 3HSCA 5AXNA 1S7IA 2PDAA 2J6SA 3PRBA 1TL1B 5J2NB 5A2QU 1WKLA 5EWFA 3CCLN 5ETPA 1KOHA 5A0YB 4WQ5C 3NGDA 1RK8A 3OUYB 3MCMA 4FNIA 1G7CB 4M41A 3BGUA 3O3FA 5KPZA 1OWXA 2QL9B 4U96A 1UPMB 3C0BA 2KTQA 1OVQA 3H3NO 4KHWA 4H8KA 2LXIA 2ZM6F 1S57A 3M2VB 2MHNA 1YIJS 2JHEA 5J2MB 3NBPB 2JWNA 5KFJA 5BN8A 4DV1K 1HWUA 4F4AA 1RKJA 3GIIA 3CSKA 1E6YA 4C2MA 4DR4J 1VI7A 5FDLA 1YIJN 4TXSA 1GFWB 2MLXA 2IIRA 4QPXA 3MMCB 4DU7A 2ACYA 3K5NA 3DM2A 2ATQA 1HWJA 1KAZA 3GG1A 4OHYA 2UUCK 4B3MK 2VHGA 4IJNA 3ONQA 3NXZA 4J8FA 2YWEA 4OZ2A 3OYEA 2ASYA 1YKWA 4E8UA 4E98A 4FJ7A 2YX7A 3NGYA 5AXKA 3TYTA 4EZ6A 4K5RA 3CDEA 3EICA 4BC4A 3PIOQ 3GIJA 4YY3K 1RP5A 3T5KA 3RWUA 1EAYC 1YJ9S 4J9UE 4FK4A 4PKGA 3ZSZA 1HBOA 3IKMA 1BI4B 2UXDF 3K5MA 2E2PA 2OMLA 4F4WA 1XMQK 3EXCX 1Q5VA 4RCHA 2KYXA 1TV6B 3U1NA 4G3IA 1NDKA 3KG0A 4U6PA 4B3OA 2U1AA 5KT3A 5I9EB 1YJ9N 2GV1A 2MMYA 2AJ1A 4CLFA 4RNHA 4NEYA 3KLVA 4FPRA 2V8DA 1BY9A 3IMQJ 1WG1A 3ALYA 1RU2A 1HNWJ 2R8HA 2U2FA 4TY8A 4Z0UA 2G8HA 4LF9F 3LGHA 2D5RA 3C95A 4A5BA 3E01A 3AVJA 3G10A 2JOQA 2E5HA 4P73A 2ZWOA 4M63A 1ROFA 4YOXA 2YX6A 2HRYA 2Y8WA 1XHXA 1QSSA 2QIFA 4IO9L 4RKUC 4CH0S 2LLZA 4TU9A 3AA2A 4CD3A 2DO0A 2K06A 3MR2A 4FYDA 2QA4G 3MCAB 1T0TV 2AU0A 2VGMA 3O4NA 1HNZJ 3SLCA 4HUGA 4DUZJ 2MQNA 4JV1A 4O44A 4O3QA 3T6BA 2C3MA 7AT1B 3SCKE 5CA5A 4RW8A 1IBKJ 3AVCA 3D0HE 4LVOP 3SYZA 2DHXA 1F5BA 1RAGB 3JS6A 5H9FJ 2GC8A 4RNOA 2V4JA 4OI6A 3MUTP 2ZHBA 3FCVA 3NFAA 3BQ0A 2NXEA 4M3YA 4Y2CA 1AROP 2PE8A 3AY9A 5HLFB 4LR9A 3SV4A 2FLOA 3HMJG 4MIWA 3TX8A 1TKTA 1WAJA 1NRKA 5I3QA 4DV7F 4E19A 4A8SA 5E7OB 5EWGA 4X4PA 1VS3A 3QO9B 2PD1A 3OR2B 1FFGB 4LF6K 1FFSB 2B4VA 3RBZA 1HBMB 3D4JA 2L9WA 2WB1D 2CPZA 2LDIA 3NAHA 1BD6A 1H0HB 2D3ZA 3IBCB 2ADBA 2Y3YA 3H2LA 2KW4A 4X84A 3FZMA 3E3XA 3FBBA 1KRPA 3BO3A 2QA2A 5CD4H 5AQZA 3CB4A 2I5JB 5ITHA 2C3PA 1U25A 4LC9B 5BR8K 2FY1A 3DLBA 4P2FA 4DWIA 2Z58B 4X4QA 3GL1A 3I0SB 3RR7A 1DRZA 2IYGA 1DTTA 4HLBA 4CRJA 1WHVA 3DJCA 4HEA9 3PYGA 2ZNZA 5HAOA 1X5OA 2FZGB 2DB1A 3BQ2A 3ZTSA 3MXHP 2C3YA 1S6QA 3LP2A 2GGPA 1GMVA 2G0CA 1U09A 5B0FA 5KFWA 3V6KA 1BXNA 3ZLJA 1N36F 2RF2B 5BR9A 4C0HA 4ATNA 1BISA 3I0RB 2CPXA 3WXMB 5BPNA 1SJ4P 1HQUA 4YHHK 4L73A 4P2SA 4CEQA 3VGVA 2XZDB 4CZMA 4LFBJ 2OKQA 3TWZA 2QN6B 3NRBA 3MHYA 2YNHA 2DFEA 5EY4A 3Q2SC 5KFAA 3FGVA 2KJWA 2R3VA 3PHTA 2VG7A 1KTQA 5JVGQ 3CDAA 1NK7A 3VAMA 3HKZD 4QWBA 2HBQB 1HQ2A 1KDNA 4DCOB 2N7CA 1K8KB 2ZBQA 2XS7A 5HL7Q 1QZ6A 1WEYA 2F63A 3CO9A 2R8IA 2CPYA 2XCAA 1QUVA 4ZLPA 2H5EA 4RTFD 3HKWA 2PFDA 4U9RA 1WEZA 4F0MA 4QIFA 4IR1A 1D8YA 4JI5K 1TKZB 4LFAK 2OD4A 3QLHB 2BE7D 2MQMA 1NBWA 2A5XA 3VGSA 2KXNB 3CCTA 2B7BB 3QIOA 2QX0A 3V4MA 2KG1A 4KIAA 1REVB 3I32A 1EHWA 4X4NA 3R1LA 1HMVA 1L3KA 4F3QA 4H4KA 2W41A 3OYLA 1J5EK 4CJTA 1GK8A 4M8LA 4U7UK 3Q8UA 1T7PA 4GC6A 1PC5A 4UY8T 1FDNA 3QMQA 2XYGB 2DH9A 1UJ6A 3VTHA 2HQGA 2IJNA 2VU5A 4H03B 1ZM3A 1S7HA 1SQEA 2BQUA 2BBEA 1SJRA 1T95A 4DV2K 1BMQB 2XO7A 1JJHA 2W25A 3TJAA 4FKYA 2OYQA 2M8DB 3A2FA 3W64A 8AT1B 2F7VA 1U02A 3D0IE 2YQ0A 5AXLA 4OPAA 3RBXA 3WZ0A 5DGAA 2B5JB 2P6TA 1RE1B 3PKYA 1YBAA 4B1UB 3D1OA 1QQCA 4K4UA 4IWVA 2X7IA 4DV4J 3PR5B 5KFFA 3AXMA 2NRVA 4PWWA 3EE9A 1BO5O 4AH9A 2YHWA 1UP1A 3BJYA 1YZ6A 3R3TA 4ZVQB 2GO9A 4DI6A 5LXRA 1GAOA 2KZZA 2M8HA 4KC5A 2IMOA 2ZEJA 3QSYB 4ZA1A 2ALYB 2F9TA 2NSCA 3HULA 1T3NA 3K5OA 4U8YA 4QWCA 3D66A 4B8AB 2BH1A 4N8OA 2BE2A 4NYNA 3NH0A 1W97L 3ADAC 3PDNA 4CNYA 4DR5K 2JC1A 4KRWA 1WI6A 2W40A 1SC1B 2MKSA 3AVLA 3EY1A 1WOOA 3S8SA 2IMWP 1KC8O 1RBLA 1RTHA 4PRFA 2FHKA 3B4MA 3G6ES 3NH1A 1T6CA 1RWNB 2R7UA 4DR3K 3TQ1A 2OPPB 2LQ5A 2EFOA 3CVKA 1R59O 1LWEA 3KLEB 2YNGB 3NS7B 3C14A 2ZH9A 4DPOA 1TK8A 2LXFA 1RHKB 4QJVA 3CDUA 2OMOA 4OYAA 3G6EN 1KEKA 4BS2A 2HAIA 2YHXA 4MIBA 1M1HA 2Q1LA 2C2NA 3V81A 1HNVA 4CHZA 4ZVHA 4DSJA 4ETXA 2E5LJ 2VUGA 4DV0J 4ELTA 3DHWC 4IKAA 2JFDA 3CD7A 1VGYA 1Q95G 5JUMA 3AVMA 1IG8A 3DWLA 4MYUA 5F2RA 2E2QA 3VZIA 4FM2A 2P9GA 2WBNA 1HHQA 3IRXA 9RUBA 4DQIA 4OX9J 2O8FA 4DR2J 2E1YA 3BGRA 4RUBA 2R2SA 4P71A 3ET6B 3M5RA 3M4XA 1O8BA 3WX8A 4J9PA 2CNKB 4LF5K 5DZ7A 4CIOA 1SI9A 2DEJA 1RLDA 1NB2A 1NSPA 1Q78A 1U0HB 3A5NC 2NNWA 2BW7A 2XYHB 5F8LA 4K50A 3VQ7A 4BDYA 4G6VB 3TA1A 3U1LA 2W2PP 1OH7A 5AQXA 4PQAA 1PAUB 2QKBA 2RKIA 4NLRA 3IR5B 4PYDA 3O6QA 2H54B 4PL8A 3NP5A 1U49A 4LFCK 1RTZA 1SS6A 3M8ZA 4L3QA 3SCJE 3JQJA 2DHHA 2RN2A 1HX1A 3DN9A 4H5VA 4PKDB 4C8YA 5GAHI 1RAOA 1RISA 4L74A 1A7GE 1N5YA 1T02A 2HBMA 2C2ZB 4X62K 4WYWA 4JKGB 2JEGA 3NF9A 1WN7A 3QGHA 4ENOA 1GLEG 3QJPA 2IY5B 1NK5A 1XI1A 4E89A 2GJIA 2XMKA 4EHUA 5KFLA 4DR6J 4OL8A 1P6TA 1C0MA 3H5XA 3VF0B 1SZ2A 4BRAA 1N5SA 4CFAA 4B3RK 5AQGA 1MNEA 2A6MA 4O3NA 1SBRA 2Z1IA 2ZF5O 1O51A 4LR8A 4BRIA 3HFKA 1X5PA 2QSWA 1TELA 4BE2A 2IS3A 3MXJA 1WSVA 2FVPA 1C0TB 4M5GA 1V3SA 4X4OA 3MECB 1KQSR 3VMFB 2ZZMA 4DR1K 2EKYA 4ZVTB 4F3OA 5IV4A 2D7SA 1B0PA 2DXDA 4BRDA 3SJJA 5D3GA 3O80A 3BSAA 2P9IB 2Y8YA 4CJPA 3UD5A 5A8RB 2LVWA 3N4PA 4NCGA 3U8XA 5CYMA 5M2UA 2BRKA 4C97A 3EKSA 1RBTA 3EZUA 3AVNA 2ZZNA 2AP6A 3RBEA 2EW9A 3LH2S 1FNMA 3HHKA 3G6YA 1ZPVA 1KLMA 2OD6A 1X5TA 1UEUA 3TVKA 1S48A 4USMA 2W1BA 1GOBA 1OO0B 2QI2A 3I55S 1JQGA 5K9FA 4YEAA 3M9MB 3QIPA 1LWFA 1NGAA 2HWTA 3U02A 1ZC6A 3VQ4A 2CWXA 4TN2A 3GBTA 1HLWA 2KG0A 2PI4A 4ES3A 3RW6A 4Q0BA 3I55N 3OTBA 3MM7A 3DOMB 2IHR1 3ZZUA 3LAMA 2OJ3A 2QWNA 3NAIA 2B9XA 3OHAA 2X1FA 4CGDA 4GKKJ 2I7PA 4FZYA 1NGEA 5U47A 3ZETA 3DLLQ 3LZJA 1N88A 1PGZA 3W2VB 1NK0A 1XMBA 4CTAA 4DTNA 2IVFB 4R8UA 1IBLJ 2FSJA 4YB5A 2WONB 3AGRA 2VCPA 3E1YA 2YV0X 2W9AA 4KPCA 2BW2A 2V8GA 3OXLA 2FUG9 1HI1A 4ICLA 4Y1DA 3G86A 2YKMA 2PZSA 3FNNA 2Y9HA 1DKGD 4C0OC 3IS9A 3A5OC 3HHLC 3E66A 5K5MA 2GMLA 3SV3A 1A5WA 1XN9A 2P5OA 3PSFA 3AD9C 1HNWF 4JI1K 3E9PA 3AAWB 2HOEA 4DCPB 5ELZA 3OYDA 2MZTA 2OZSA 4GW6A 1CBKA 2CAJA 4KKOB 1IKWA 4CZCA 4USVA 1GLJO 1J53A 4K0KF 5GAEU 4FPBA 2O8EA 4RBVA 4ED2A 3VPZA 2B9EA 4CLSA 1NM2A 4CF1A 1WSJA 3BF4A 1FJ7A 4IKFA 3M8QB 4C11A 3WC2A 1IBCB 4B3TF 1OYDA 1KVBA 1UWAA 1X4BA 3GWCA 5HSPA 4DSEA 5DRKA 4CP5A 4CGFA 3EGWB 5JXSA 1IBKF 3F56A 3RB3A 2JJ4D 3VWSA 1NSQA 1MW7A 1R0BG 4HACB 2PO4A 1SKSA 3DYAB 4LT6A 2ZOMA 3CFPA 3L3UA 2UUTA 4DX8H 1XQIA 2A42A 3DLGB 2UXBF 3ZSVA 3JTPA 3MM5A 4I56A 4L6V3 3G96A 1OY9A 3W7BA 1HD0A 1N33F 4CIFA 4B3SK 2YNFA 2E4LA 4DTOA 4JI6F 3BM7A 4B08A 2NXUA 2RHQB 3QBCA 3D2EA 4PKIA 3JYTB 1MMNA 4BY9C 4M5JA 1D9AA 3MN5A 5B09A 2QWPA 3W65A 2WW8A 2JEJA 2VA3A 3CCSS 1RHJB 3R7BB 2E1PA 1JJ4A 5J2NA 4H0OA 3AA8A 1M5HA 4J9KA 3EDQB 4M5HA 5DDRC 3DRSB 3C6HA 4V1Ak 2UU9K 2COLA 3CDWA 3GIMA 3M9OB 2IJFA 3CCSN 2RUSA 1XR7A 2KT3A 2CVIA 4CEBA 1P8ZA 4F02A 1HI8A 4ZVGA 3L2UA 1EB0A 2BX6A 2ILYA 2QMUB 2EVZA 3LGNA 5GADI 1RBUA 3M2VA 3CCMS 2WC9A 2BR0A 2FSNA 2HBRB 3ITHB 4Y6IA 2GX9A 1U6FA 4OLOA 2Z2MA 6FDRA 2QSFA 1NAQA 2AJ2A 3G4SS 2L3MA 2ZGZA 5IC6B 1VK0A 4X66K 4BCAA 4BC3A 4AM7A 1T9XA 3CCMN 4WFNL 2PY5A 2V94A 4IDKA 4I2PB 3H08A 4IH5A 2ZH3A 5IM0A 4KHPK 4NASA 1VSMA 4EMDA 4NCAA 3G4SN 2HS0A 3K2PA 3MPVA 3VR1A 1T05B 3LDOA 4AL6A 2JVOA 2VH7A 1X9SA 2HIQA 5IT9O 2W2QP 3N4WA 4H0VB 1WELA 3HFVA 3JAMO 3CCEN 1H98A 2ZJPQ 2EWSA 5KPRA 3TP2A 5IQ6A 4CEAA 2F5GA 4ID5B 2CQIA 4DV3J 3ZZZA 1CJTB 2Z1GA 3AVIA 4ZKAA 1GOAA 2UUBF 5J2PB 4WKYA 4B3MJ 2F9JA 2HSEB 4N7TA 5AJ3F 4PPZA 3SDEB 4L76A 1HNXF 2V7YA 4H54A 1U7LA 3P39A 4FCYA 4M5DA 4ZVFA 2I6WA 2Q3PA 1NDLA 2DJWA 3BEXA 1UMJA 2Y1JA 1TKXA 3PJXA 4QYRA 4YY3J 3BKUA 1ZPWX 5ETLA 3C8YA 3FZKA 2V34A 2KHOA 2KHCA 3MPDA 4JYAF 1TL4A 2VPWB 2ZITA 2QLWA 4PABA 2ASJA 4QWDA 2A18A 3P3DA 4FLZA 2DR9A 1U2VB 3FFKB 4IQXA 4ZCMA 2YKNB 4FJKA 5HRPA 4AYBD 4DV6F 4EWTA 4PL7A 1HLUA 2G9OA 4DPTA 1NDPA 3DXKA 4CF8A 5D0EA 5KFVA 2QYGA 3OW2M 1XHZA 4JV2A 1CZAN 3HSZA 4CJLA 3M32B 3D68A 1HJRA 2RU3A 4LRFA 3NAEA 3KD5E 1XK8A 2FC8A 3CNQP 2CWKA 2XMTA 3NWRA 3MTJA 4YN3B 2YNIB 2M7SA 5KG4A 1RT7A 1SKWA 1MN7A 3QZ7A 4JK7A 2F8MA 3CO0P 1TQLA 3FMBA 4U7BA 1B9DA 3UN2A 5A2QO 3S01A 1HYSA 1YJUA 4ILHA 2EI5A 1RILA 4F0KA 3G2XA 3EVWA 4N41A 4KYZA 3VAIA 2KRBA 5H1SV 3ZT3A 1FJGF 4KGXB 3VF2A 3LM2A 4CBUA 2RILA 3ZTOA 4ZJOA 4CJ4A 3QNNA 2XYPB 1M5PC 2MQLA 1HBUA 3CJTA 1U2RA 2Z1HA 3RRHA 2JFKA 5KT5A 3NNCA 1JWWA 2QMXA 4FWKA 3ILIA 2W7AA 1RNHA 3AD7C 2L9NA 4I7FB 2OP5A 3JTOA 3CCVS 2QA4S 2VWBA 4UUWA 2I5JA 3QEWA 2RH3A 1EIYB 3DMJA 3ZZOA 4DHVA 1TL5A 2HNDB 4H0TB 4TSXA 4HT7A 2ROPA 4WPAA 3I0SA 2L08A 3IP0A 4EP5A 3SI8A 2Q3SA 5L39A 1W7AA 4BRNA 3M2UB 3V6DB 2DKOB 4JUZA 3O1BA 2P9SA 3JSRA 3CCVN 2QA4N 2XMVA 4O3SA 3L7PA 3P5TL 1FF2A 4Z7YA 4Q2MA 4BC2A 3QT5A 3ATVA 1XMOJ 2DNKA 4BLGA 1VQOS 3CI5A 2OFHX 2DGQA 2RU9A 1CJVA 1DGKN 3MDQA 1T3OA 3Q22A 2E5LF 1CULB 4DV0F 2GZOA 4CFDA 2W7OA 3TSUA 2VYPA 4BR9A 2NRXA 1VQON 3I0RA 1N54B 3RBDA 4AM6A 1Q8BA 6FD1A 1SUQA 1LOTB 3S9HA 1ZXOA 3O4WA 5DDPC 4OX9F 2YJFA 1PSDA 5H9EK 4A8YA 3K0JA 2NRTA 1NU0A 4CEEA 3H0PA 3HDSA 3IAS9 4CJ7A 4HL9A 4IO9Q 1GLLO 2QV6A 1VQ7S 1MROB 2VZ9A 3GSIA 1MMDA 4S0MA 2HPUA 4OHVA 2D3OR 5ETTA 4FLTA 3IM8A 1DEJA 1K73O 2HBZB 2P9KB 3OBYA 4RUAA 4RX6A 1JLGA 3RB0A 2UUAJ 2G8WA 2LA6A 2QWQA 1VQ7N 3ULEA 3IGVA 1IN0A 1C0UB 4DMNA 3QRRA 2IVOA 2V8HA 4A8MP 3OR1A 5C25B 3I8DA 1SL1A 3HD2A 1YK9A 2WTFA 3OLAA 3AO5A 2PFFB 3VA3A 3ZT4A 1ZS6A 2CQ1A 4GO7X 3WDOA 5CD4A 4KREA 3J7Z5 2XHWA 1VYAA 3RSEA 4ISEA 4IG0A 4ZVPB 3L4QA 3VESA 2WW4A 1WSEA 3ZFVA 2ZBCA 2A0FB 4DR6F 1LCUA 5KAKA 3OT9A 4RBUA 4C3LA 3FZFA 3MD3A 5BPMA 5AQUA 3AAPA 1OQ6A 2C2EA 1S0MA 1MU2A 1S5ZA 4QU6A 1F9EB 4J9VA 3MI7X 1BCOA 4YMEA 3P5JA 5KFOA 3LPTA 2Q43A 3K5PA 2CKWA 3VZHA 4TU7A 4CO0A 4DPYA 2OEJA 1S5JA 3VEVA 1SJQA 1Q79A 4CM0A 1BIZA 1N36K 4MK9A 4ZVEA 5ETMA 2HG4A 4KAZA 5KG7A 2GAGC 2NRRA 3DI6A 1QVFR 3ZX0A 5A8WB 3KLHB 3S1TA 1JNZB 1YRUA 4OGEA 2AYMA 5CHIA 2FY8A 1D1UA 4OFZA 1YVNA 5AQWA 5IFMA 2YWHA 3LWLA 1CSJA 2M88A 1RKIA 1NKEA 3GU0A 1WC6A 2JLEA 4BRPA 1U26A 4NO7A 2XC9A 1JXBA 2QLXA 1GQEA 2DHAA 1BUXA 2BVZA 2H51B 3CDBA 3MCPA 3VEOA 1IKXB 2KXHA 1LKZA 3SCXA 4CZGA 1H1VA 4NOHA 3HSTB 4LIRA 3SQ1A 2RD5C 2RQCA 1AFIA 4C8MA 3THPA 5C2FA 1ZA1B 1Y64A 3VQPA 3BSNA 4NWBA 3HXMA 4LRBA 4OZJA 2ACMA 2FVRA 2BACA 3B4DA 2RQMA 2MGZB 4JBCA 5KG6A 1DFDA 1WG4A 3FCHA 3B6BA 2JGUA 3C6AA 7FD1A 1GMUA 1VRQC 4URGA 3I87A 3AVBA 1UEKA 1GX5A 4GKKF 2OPPA 5HK4A 3WBZA 1I3OB 1S4FA 2YNGA 2R42A 4IFYB 2V51B 4CF9A 5CAAA 3NMAA 1N6QB 3JSYA 1J5OB 3N4QA 3KJQB 4LF4J 4AHTA 3RR8A 3FEXB 1Q8IA 3MM8A 1QAIA 4BRHA 2KN4A 1Y9OA 2CQHA 2AZ3A 3A5LC 2GX8A 2X1BA 3QEPA 1AZSB 2WVFA 5DDOC 4KV8A 4M3XA 1VHXA 1WOPA 1CC8A 4JI2F 3CEDA 4DR3J 4B9LA 4FYXB 5BYQA 1JLQB 2OZMA 2FQQB 2HWHA 3CJQA 1G2EA 3MEDB 5B0DA 3PEJA 3CD6S 4CGJA 3ZSRA 1Z05A 3KKFA 2HGMA 4KI6A 1HW9A 3ET6A 2OPSA 4A8WA 2OPQB 4EBDA 4WIIA 5LOQA 3MEEB 3CC4S 2OPRA 3PNIA 1Q16B 2XZWA 1SPBP 4I6AA 2OTJS 3CD6N 1U0HA 1KVIA 3PHEA 2DYAA 2D41A 3RUBL 2UVVA 3C16A 1LXJA 3N6NA 4OX8A 1JJCB 3CC4N 3RG6A 3PZPA 1I6JA 2ZC3A 3QEXA 4CEZA 3GE9A 1N48A 2OTJN 4DSFA 4QYZK 3AXKA 2XG8A 3ZSOA 4DL4A 3CJAA 4NZ7A 1GTEA 5GAHU 3WNFA 3NKYA 1AUSL 3CC7S 2Z2LA 4Z7CA 4I0WA 4O4GA 5MLCQ 1HRHA 1ILYA 3CF5L 3TTFA 2N3OA 2DGUA 4JKGA 3TU5A 5LJ5Y 4CIEA 2XMMA 2BGGA 2A10A 3C6UB 2X78A 3NH2A 3CC7N 1Z4UA 4X4TA 2F8HA 3W3SA 4JI4F 2YPYA 1U8WA 4FBTA 1WUAA 4DL5A 4C8NA 5CZ1A 3L0QA 1VBZA 1K9MT 4LFCJ 4JI7F 2WK4A 3UCUP 4NLUA 4B1ZA 3L2RA 4IEIA 5KT6A 2HHPA 1S0NA 2FLPA 3TZYA 2R7RA 1C0TA 4XDDA 5LMNF 2OIHA 2FVQA 1RABB 2HHHK 3K5LA 1F3VA 1RXOB 3O08A 3BF1A 3P45B 3M6VA 1H3DA 3BDEA 2P9IA 1CQMA 1WSIA 3GDQA 3QGPA 5A8RA 3OPKA 4OJ1A 4EUVA 4KI4A 3MMAB 3KOAA 1D0EA 4LVNP 3OTOF 2GJFA 2BMBA 2R8GA 2C3UA 1I51B 2ZE2A 1UW4A 1UZDA