5J1EA

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
550
structure length
541
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
total genus 133
structure length 541
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j1eA05
4N41A 1CZ9A 2WB4A 4PQUB 1TV6B 4IDKA 3AVGA 4Q0BB 4K4XA 3O4NA 4AILC 1MU2A 4CF2A 1IKXA 1UAXA 3TABA 1TL3B 4OLAA 1NK5A 4C8LA 3KLEA 1XHXA 2IGIA 4RU9A 3MTKA 4K50A 1HNVB 4DSJA 2UUWA 1SL1A 2WRMA 3DDKA 3NF9A 1NK0A 2IC3B 3KD5E 4CFCA 4B3OA 3OSPA 3HKWA 4CHOA 2BGGA 3M9OB 4ID5A 3KHHA 3BQ0A 5SWMA 1JKHB 3LALA 1XR7A 4URQU 4H4MA 1QQCA 5KFBA 1ASVA 2W9CB 2D3UA 4O55A 2QKKA 3OL9A 4AHVA 1HYSB 2GC8A 3AO2A 2BANB 2HVHA 5J2QA 3K5LA 4CERA 1VSIA 4ZP6A 1S1WA 4DU1A 1REVA 4K4SA 5DG8A 4ID1A 2OA8A 2PZSA 1VSJA 4CK3A 1N6QA 2HHUA 1RNHA 4KE5A 1WSHA 3EYZA 3KLIB 2B4JA 2D0CA 5KG0A 1JLEA 1RAJA 3RWUA 4CIEA 4BACA 4K4TA 2WOMA 4NLTA 3GV5B 3GV8B 3ZSVA 4OLBA 1RDRA 3LP1A 2X74A 3LP0B 3NBPB 4CHZA 2R2UA 2W8KA 3BGRB 2AU0A 5CYQA 3M9NB 2W42A 3DYAB 1HMVA 3DLKB 3RB4A 2HB5A 4OKEA 4FK4A 3V1OA 3MEGB 3QIPB 1S1UA 2OPRA 3VQ9A 3OYEA 3AVCA 5KFOA 1LWCA 5HRRA 1JX4A 5FRNA 1RBUA 1JLFB 3CQ8A 4CJFA 4G1QB 1RDCA 3PUFA 3AVLA 4NLYA 4ED6A 2FVSA 3ISNC 1BI4B 4KTWA 3I0RA 3AVIA 5J2PA 3D28A 5KFUA 3DRSB 4FM1A 2W7PA 1XC9A 3PX6A 3K5NA 3GIMA 3RTVA 4E7IA 2KZZA 1LWCB 4TYAA 3ZSRA 1VSEA 1QHTA 5KG5A 4G1QA 2GIRA 1YVFA 1VSMA 1N4LA 1C1CB 2FVPA 3MXIA 1R0AA 4TSXA 3SPYA 3PX0A 3PV8A 3IG1A 3KNAA 4CHPA 1SL0A 3LZJA 5KFFA 4Q5VA 4CHQA 5CYQB 4OKKA 4CJQA 3HM9A 2R8KA 4M3WA 1RYRA 3VA0A 4L8RB 1JXBA 3T1AA 4Q44A 3DM2A 3GIJA 4JV1A 4FJNA 4F4KA 4DFMA 2AX1A 4F8RA 2QV6A 2UVRA 3M8PB 4B08A 2IJNA 4OPKA 4M3YA 1CXQA 4CJWA 3V6HA 5FDLA 1UA1A 2R8GA 1TKZA 3VQQA 1RTJA 4C8MA 3KK1A 4NYFA 1TKTB 5I42B 2BRLA 4FM2A 3PX4A 3PZPA 3H08A 5KG2A 3BGRA 1U47A 5KT2A 1VSDA 3PW0A 1S9EB 4WFZA 1CZBA 3LAMA 4DTOA 3TR8A 1T03A 4F4YA 2YNHA 3U6FA 5J2NA 4B9TA 4PUOA 5EU7A 3TVKA 4ZP7A 3QNOA 1VSKA 1S1TA 4IR9A 2HHXA 4O0JA 2IM0A 4Y34A 1S6PB 3NMAA 1BI4A 2FJWA 1ASUA 3S9HA 5HBMB 3GQCA 3QIDA 3PO5A 2G8FA 4KB1A 3QZ7A 1VSLA 2GUIA 5KFVA 4DSKA 5T14A 4FJLA 3KHLA 4CF9A 1HRHA 4JV0A 1JKHA 3MXJA 1REVB 4KKOB 4RNHA 4FZYA 1UWBB 4N76A 3Q8SB 1NK8A 4IRCA 4CFDA 4FW1A 2E9RX 4IR1A 4FBTA 4HCBA 4F50A 4KAIA 3K58A 2Y1IA 5F9NA 3CDEA 5DQGA 1KCFA 4IFYA 5F8HA 4K4WA 3VQSA 5L1IA 4JV2A 3BREA 3AV9A 4WZMA 3MECA 4BWJA 3V9WA 3K2PA 3MR5A 4K8XA 4J9KA 2HNDA 4ZHRB 1BL3A 1KSPA 3UR0A 2HW3A 1UOCA 5KFHA 2RDJA 5KG1A 3KK3B 3U3YA 2ASLA 4E89A 3NDKA 1LWEA 1KFDA 1WSFA 3AO5A 3QIOA 1L3SA 3DRPA 3H59A 1IM4A 5KFJA 3RAXA 5F8GA 5KFYA 3RB6A 4WE1B 4MQ3A 4FJ7A 1B9DA 1LW0A 3DI6B 4KHRA 3S3NA 4LSLB 1S10A 3DLEB 4Z4FA 5KFNA 1QUVA 4NLOA 5HROA 3KK2B 1RT4B 5CY4A 1RT1B 3OJSA 1L5UA 2OZSA 3BSNA 4JUZA 2W8LA 3SV4A 1C0UA 2D41A 3QINA 1SUQB 4U6PA 2NUBA 4KHYA 1C1BB 5KT5A 3QESA 4QWAA 3VQBA 3C6UB 4DSFA 3TI0A 2KFNA 4ZHRA 3V9XA 4KI6A 4RNMA 1TL1B 4Y1DA 4ZPCA 3V9UA 1DTQA 1QSSA 3I8DA 4IG3A 1R0AB 3AVFA 2FVQA 4ICLB 4AHUA 4URSA 1S9GB 2KTQA 4PWDB 2R2TA 4ECTA 4J2EA 5KFIA 3ZSWA 5KFDA 4YFUA 2WONB 4NLPA 4HUFA 3OL8A 1K1SA 4CCHA 4ZTFA 4FS1A 2JC0A 4J2DA 4ED7A 1L3TA 1S6QB 4KREA 4H4OB 2DFEA 3SQ0A 1RT1A 1D1UA 4YNQA 3HO1A 3KK3A 2ZD1A 3HVAA 2YNGA 5KRTA 5KFTA 5KFSA 2F8SA 3NCIA 4FLTA 4NLRA 4O44A 2WHOA 3KTQA 4M3XA 4DTMA 5J2PB 2KZMA 2GIQA 1RTDA 1KHWA 1K1QA 4DTRA 3WNHA 2IJFA 2F96A 4JS5A 3TAFA 4ZVEA 4DF8A 3UPFA 1D5AA 2G8UA 4Y1CA 3LP2A 3PJWA 2DPIA 1YVUA 4J2BA 3SFUA 2OPPB 4CJLA 4Q8EA 3ZCMA 4O4GB 4DL4A 1YT3A 1FK9B 2DTUA 4RNFA 3VQDA 2XGQA 1KLMA 1TK5A 2E4LA 1NKEA 3CJ0A 4LH4A 2IM3A 4GC7A 4DTSA 2ETJA 4B9UA 3FSIA 1RTHB 4ZVFA 3FQKA 4ZP9A 3DM2B 4K4ZA 4NLGA 2P1JA 3RRHA 1VK0A 3LP1B 3SQ4A 2PYLA 1RILA 1MU2B 3I5AA 5DQHA 5D3GB 4I7FB 3AVKA 3VQ5A 3VN5A 3L2RA 3MEEB 2XCAA 3JSMB 3MEDA 1X9MA 4KTQA 2FVRA 4KPYA 5KFLA 3SUNA 2YKMB 4CEAA 3LP2B 4F2RA 4CGJA 2OPSA 2G8KA 4XIUA 3L2VA 4EP4A 4O4GA 4QWBA 4E7KA 4MFBA 3MFIA 4CECA 3IAYA 1LAVA 4JLHA 4CHYA 1L3VA 2VG7A 3A2FA 1TK8A 1HYSA 2ASJA 1BCOA 3PW4A 3OYGA 5KT4A 3PW7A 4KHQA 2JEGA 4CEQA 4IRKA 4ED8A 4CGGA 4NCAA 4NLVA 1B92A 1BGXT 3G0ZA 2AWZA 4FJHA 2AQ4A 3I0SA 1Z25A 4ECWA 4ZVGA 4J9LA 1ZTTA 4M3RA 1EP4B 3QO9B 3T5HA 4DG1B 3SNNA 3NGDA 4KI4A 3C6TB 1RT6A 3OYDA 3GIIA 4DWIA 5DG9A 3V6KA 4CIGA 3EPGA 1TVRB 1EETB 4I2QA 3KHGA 3NF6A 4EBDA 3NBPA 4PA1A 4BWMA 2FLLA 1U4BA 4Q0BA 5KT3A 2HNZB 3NGIA 4JRPA 2R2RA 4WZQA 4KFBB 3V9ZA 2V4RA 3RR8A 1QSYA 4Q45A 5KG6A 4R8UB 4IFVB 4CGFA 3T5LA 1BISA 3V9SA 3AA3A 4MKBA 4DFPA 3HPOA 1NK4A 4EO8A 3RBEA 3MEDB 4FJGA 3G6VA 5KI6A 4YR3A 3HP6A 1HJRA 4DQSA 5J2NB 5EDWA 3DRSA 5KRSA 3RB0A 4J9QA 2YNFA 4CJTA 4H4OA 3CFPA 3CWJA 2ASDA 3OYLA 3DLGB 3OYAA 2OH2A 3OYNA 1LW0B 3OSNA 3C6TA 1BQMB 3Q8RB 3D45A 4DTNA 1EETA 4ECSA 3CDWA 2HHVA 4DS5A 4LQ3A 4J2AA 3BR9A 5KG3A 1HQUA 4FS2A 2XHBA 3OYMA 4G3IA 3VQ8A 4Y2CA 4DLEA 2PYJA 1WSIA 2D0BA 5C25A 1KRPA 4QW8A 3QEWA 1C0UB 1HPZB 1T8EA 2ALZA 4E7LA 4QW9A 4AHRA 3HPGA 4NZ0A 1UA0A 3DOLB 1HQUB 1TKDA 3GILA 4W5RA 4CFBA 4DS4A 4O3QA 1JLCB 1D8YA 3JYTA 2IM2A 1KVBA 1N56A 1L3UA 2R2SA 2XC9A 3F73A 3HVRA 5J2MB 2EX3A 3DMJA 5F8MA 3DLGA 4KHNA 4I7FA 2YHBA 4FLXA 2AGQA 3GYNA 3CFRA 3QGGA 3SJJA 3MF5A 3QGIA 5L1LA 4FBUA 5JUMA 4CESA 3RB3A 2UVVA 4EO6A 1KFSA 2J6SA 1KVCA 4Q43A 2OPSB 4K4UA 4KSEB 3ALYA 4TQRA 2AJQA 4DTUA 4YR0A 3KIOA 2OPQA 3PR4A 2D0AA 3E01B 5KFGA 4LH5A 2DFHA 1IKYA 1U09A 4NRTA 4MIBA 1Q9YA 3DOLA 4M95A 1QTMA 1HNIB 3KLFB 5HLFB 3K57A 3SUQA 4CEFA 3NKYA 2AX0A 2OYQA 1TV6A 4KHMA 4ZPDA 4N56A 4DFJA 3ZSXA 4CJSA 5DK5A 2OPPA 3N6NA 4DEZA 1GX6A 1DTQB 4TQSA 1G15A 1IKXB 2W9BB 3TANA 2V4QA 4ELUA 3HJFA 4CEZA 1JXLA 2JC1A 4QOZB 2RDIA 3QEXA 3GV7B 2I1RA 1WNEA 2B6AA 3T5KA 4HUGA 3M8QB 2OPQB 3AO4A 4ED2A 5KFPA 1ITGA 2JLEA 3VQAA 2BRKA 1ZETA 2Z1JA 1I3AA 4CEBA 3CJ3A 1NK6A 4IFVA 1Q9XA 4J9MA 2P5OA 2CJQA 1NNDA 4QWDA 2ILZA 1JLGA 4KO0B 4O5BA 3JSMA 5EUHA 5DG7A 4LD0A 3H5UA 3TARA 5C5JA 2PY5A 3T5JA 4XPCA 5T7BA 4GMJB 3DLHA 3AVNA 1OS5A 1GOBA 3NH2A 4RW6B 3NF8A 3IG1B 1RCHA 4ZPBA 3L3VA 4KBIA 3IN5A 1JLAA 5DLGA 3TAGA 3F9KA 1WN7A 2KFZA 1N5YB 2LSNA 1JL1A 4PY5A 1XI1A 4B9LA 1NHVA 3WNEA 2AGPA 4CJRA 2D7SA 4KAZA 5JS1A 4J9OA 3G86A 2IM1A 1T3NA 4BDYA 1VRUB 4RNOA 1S1XB 4M3TA 2V9WA 1TKTA 2HNYA 5I42A 3H5XA 1SH0A 4I2QB 4DL3A 5CYMB 1JLCA 3P83D 2IAJB 1O1WA 1DLOB 3I5BA 2ILYA 4J9SA 4IKFA 2HAIA 4WYLA 5KFXA 5J2MA 3L8BA 3V81A 2RF2B 1S1XA 4LY7A 4R5PA 4BE1A 4FJ8A 4CJEA 3QERA 1RDDA 1T05B 3NH0A 2R8JA 5KT7A 1U04A 1WAFA 3ITHB 2VG5A 4IG0A 1S48A 3IS9A 4DSEA 3DI6A 3PY8A 3L2QA 4CJKA 1RTIB 1FKOB 3HYFA 1VRUA 4CJPA 1DTTA 3RRGA 1RT2B 5FRMA 3E01A 4IH6A 2FJXA 3RMDA 4F4WA 4KKOA 4CK2A 3NL0A 3LDSA 1A5VA 4WXWA 4B9VA 1XR6A 3D0PA 3KOAA 2FBVA 1TKZB 4HHTA 4LSNB 5J2QB 3OS1A 3OYJA 4U7CA 1S1TB 4FZXC 2J6UA 3SQ1A 4ELVA 1Y97A 1KHVA 4FLVA 4W5OA 3N6MA 1XR5A 3RMAA 5EWFA 5KFQA 2OZMA 1TVRA 3VQCA 4CFAA 3LP3A 4JS4A 4Z4EA 4KHWA 1IG9A 4Z4HA 4OGEA 1U45A 3DLRA 4NLXA 1LWFB 2IS3A 4TYBA 4B3OB 2QK9A 4MK9A 4K4YA 3PVXA 1TAUA 3JYTB 3AVAA 2I5JA 2RPIA 4Z4IA 3EY1A 3K5MA 1TKXA 3NH1A 2HMIB 3QEVA 4KHUA 2YV0X 4FLZA 2P51A 4DMNA 4DTJA 2XY8A 3DLEA 5DGAA 1JXEA 3ASMA 5I3UA 2VWKA 4MKAA 5EWEA 5KFWA 4DL7A 4DTPA 3LANA 2WTFA 3LZIA 3OJUA 2Z1HA 4IRDA 4FK2A 4KB0A 4FXDA 3RAQA 2GV9A 1U48A 3H2LA 1RT2A 4JRQA 2X6NA 3I0SB 2R8HA 2C28A 4TY8A 3KLFA 5HLFA 4KRFA 1EP4A 4M94A 2WOMB 5F9LA 1NOYA 4DQPA 2XY5A 4TY9A 1HNIA 1JLBA 3CDUA 3LWMA 2Z1IA 4Q8FA 1NJYA 1LV5A 4IOBA 2ITGA 2FJVA 2BDPA 3SI6A 4DF4A 4DU4A 4YR2A 2HNZA 2G8IA 3KK2A 4ED1A 1WNSA 4OPJA 4FJXA 1S1WB 1NJZA 3G10A 2XO7A 4O4RA 2C2DA 3OYHA 4R8UA 2IOCA 3U3GA 2HWHA 4DFKA 4E1NA 3DOKB 1A5WA 4N47A 1I6JA 1C0TA 3ZT0A 4IKAA 3B6PA 3PHEA 3CVKA 3M9MB 4WE1A 4KTZA 3ULDA 3V4IB 4AHCA 5F8IA 4Z0UA 3SPZA 3ZSYA 3I0RB 1BQNB 4QPXA 1X9SA 4RUAA 3Q8PB 2ZD1B 3CFOA 1VRTB 4RW4B 4CGIA 3QLHB 1LAWA 4O0IA 3DOKA 3BDPA 1GOCA 1TL3A 4TY8B 4RW9B 4IQXA 4C8NA 1C2PA 3PW5A 1HMVB 4J9NA 3MAQA 3BQ1A 2HMIA 1FKPB 2YNIA 1SKRA 3V6DB 3CG7A 3QIPA 4XPEA 3KD1E 1T94A 3SQ2A 3TAQA 4EZ6A 1VRTA 3TAPA 4XO0A 1TL1A 3EZUA 3LPUA 1IKYB 3H4BA 1FXXA 3OHBA 1T7PA 4AHSA 5KT6A 4CJUA 1IKWA 1ZBIA 3IGVA 5DMRA 4Y2AA 3ISND 2Q3SA 3KLVA 1RT3B 2JEFA 5FDLB 4ED0A 4E3SA 4KHSA 3P1GA 1S1VB 1ZBHA 2WONA 2JGUA 1X1PA 2ATQA 3DLBA 4H8KA 3VA3A 3NAHA 3TAMA 4FLWA 1CXUA 1WSJA 4UQGA 4CEEA 1N6QB 2E9TA 4E19A 4CJ4A 4FJJA 5D3GA 3MFHA 3BSCA 1QAJA 4M3ZA 3H98A 3TWHA 1CSJA 4M3UA 1RT7A 4CJ3A 4FJMA 2YKMA 1I39A 4O3NA 1DLOA 1SV5B 1ZBFA 2W9AA 2BQ3A 4GVMA 5CYMA 4LQ9A 4W5QA 3LP0A 3HVTA 4K8ZA 2P5GA 3UIQA 4FJ9A 1ZYQA 1RTHA 3SFGA 4FM0A 3C6UA 3BQ2A 2ZQBA 3KMSA 3AVBA 3S3OA 3KKRA 4NLDA 3SZ2A 4GW6A 1TKXB 2R8IA 3I5CA 3AO3A 2YNHB 5DQIA 5HP1B 3IS9B 1S9FA 4B8CA 5L1JA 3VQ7A 2EHGA 1MMLA 1WSEA 1RTIA 3BJYA 3QEPA 3K5OA 1KVAA 4FCYA 2BE2A 2HWIA 4MFBB 3B6OA 1C1CA 1IKWB 1SH2A 4TXSA 2VG7B 3H5YA 5F8NA 5KGWA 1WAJA 4NYZA 3AA4A 1WLJA 3V1RA 4ZP8A 1S0OA 1QSLA 5F8LA 2KQ2A 1IH7A 1IKVB 4IBNA 3TAEA 2IAJA 3M8PA 4URGA 4NLSA 4WFXA 4I2PB 2WK4A 3QO9A 4E1MA 2R7YA 5CZ2A 1RBVA 4CEOA 1QAIA 3IRXA 2FBTA 3WNGA 2YNFB 1S6QA 5KFZA 3HSTB 4W5TA 4FJIA 2BQUA 1FK9A 3H5SA 3KMQA 3ZSZA 3HK2A 3UDLA 3G6YA 2YNIB 3H4DA 4NYNA 2XY7A 5KG4A 4PUOB 3AVMA 4X2BA 1RBRA 3N6LA 4ECZA 1N5YA 5E41A 2XWYA 3PO4A 4M45A 3PW2A 3KLHA 1IKVA 4Z4GA 1GX5A 3FFIA 1RA6A 1LW2B 3MXMA 3CM6A 4QWCA 1BHLA 3OS2A 3OS0A 3M8RA 2WCXA 1JLBB 3CJ4A 5FROA 2BE2B 3BSAA 1SUQA 1S0NA 4CK1A 3SUOA 2C2EA 4WXOA 4EYIB 3OVNA 3AVHA 4TN2A 4DTXA 1LWFA 4DQIA 3CJ2A 2X78A 4HVJA 4IG3B 2G8VA 3QYYA 1NJWA 1S5JA 4DQRA 3V4IA 1S49A 1XWLA 3SCXA 3CIZA 3KLGA 4MK8A 4O44B 1HNVA 4MH8A 3MECB 3ZSQA 2UVWA 1YTUA 2XRIA 3HVTB 4C8OA 4QAGA 4WFYA 3NAEA 1U49A 1RT7B 2VG5B 3HPHA 2D5RA 1BQNA 3QLHA 5KFMA 2FLPA 3K59A 2IC3A 1LWEB 4ECUA 1W25A 3NF7A 4NLWA 5JS2A 2D3ZA 4I9LA 3SI8A 3CO9A 3C94A 1SH3A 4NLQA 2W9CA 1S6PA 4KB7A 4YP3A 5C25B 4RG8A 4CEDA 1QS4A 3V6DA 2G8HA 4H4MB 3OL6A 4B9MA 2HVIA 5HBMA 1NOZA 4CGHA 5KFRA 1JLAB 1SL2A 4YMEA 1WSGA 2B5JB 4E7JA 3DRRA 4RW7A 3FDSA 4RNNA 4KFBA 4BDZA 5HRNA 4TLRA 5KFCA 3TQ1A 2ZE2A 1RDBA 4OJRA 1RT3A 3NE6A 1TK0A 3P5JA 4RUCA 2XY6A 3MEEA 2BR0A 1S1VA 4DG1A 2HHQA 2UVUA 3EZ5A 1RT6B 4R0EA 1YTAA 3BSOA 4M42A 3DYAA 2YHAA 1S4FA 3HXMA 5HROB 2ZKUA 3AVJA 1HYVA 4YQWA 1TQLA 4FYDA 4PWDA 3QNNA 1HQEA 4CF8A 4HUEA 3QGHA 1BIZA 1S9EA 5HRPA 5KTQA 1T03B 4Y3CA 1RA7A 2RKIA 2DFFA 4RW4A 3D5MA 5CZ1A 4H54A 3IRXB 1S1UB 2OPRB 4HCCA 1EXQA 1RDAA 4CE9A 1TP7A 3QETA 4F4XA 3O3GA 1ZBUA 4NCGA 4RW6A 1TGOA 4CF1A 1VSFA 1ZTWA 3OYBA 3PJXA 4HTUA 4ICLA 1DTTB 2HHTA 2F8EX 3T3FA 3V1QA 3O3HA 1RT5B 4DLGA 5K14A 3LAKA 4EEYA 2O4GA 4EZ9A 2O5DA 1NHUA 1GOAA 1TAQA 5KFAA 3THVA 3KJVB 1BQMA 2C22A 1RTDB 3T19A 3MR3A 1S97A 4CF0A 4IH7A 1C1BA 4F4ZA 2FC0A 4O3SA 3LPTA 4FLYA 4LSNA 2IMWP 3DMJB 1VSHA 1LW2A 2KW4A 2Y1JA 1EKEA 2B5JA 3NFAA 4ELTA 3M8QA 5K14B 4PQUA 3C95A 1W0HA 3KJVA 5JXSA 2AGOA 3KLHB 4NCBA 4B9NA 4ECQA 4E7HA 3RR7A 1Q8IA 4FK0A 1C0TB 4O3RA 4KO0A 4CGDA 3KHRA 4OVLA 3AA5X 3MEGA 4OGCA 2IBKA 2VG6A 4CJ5A 4M41A 3NGZA 3OLBA 1CLQA 3CYMA 5L9XA 1QE1B 1X9WA 3DRPB 2E6MA 2UUTA 1W9HA 1JLQA 2QE5A 4IG0B 5KFEA 3SV3A 4DSLA 4ZPAA 2VA2A 4RZRA 3OYCA 3ICLA 1FKPA 2RKIB 3G6XA 4RW8A 2CKWA 1EX4A 2XI3A 2BQRA 4ZTJA 4EYHB 4GC6A 1JL2A 2E6LA 3V81B 1RT4A 4R5PB 4F3TA 4I9QA 1RBTA 3O3FA 1HARA 3IGNA 1K6YA 1JIHA 3M8SA 4DL5A 1HPZA 4IH5A 4MK7A 4O3OA 1SKWA 3RBDA 2XCPA 4FW2A 3HT3A 4Z4CA 2FVCA 3OHAA 3AA2A 4KV8A 3AO1A 3TAMB 1RBSA 3OY9A 3QEIA 4BDPA 1BCMA 1NJXA 3HHKA 2A1RA 4AHTA 1UWBA 3MR6A 5C24A 4HYKA 1ZBLA 3ZT4A 1KLMB 3GIKA 5KGXA 4B9SA 3DLKA 4WYWA 3ZT2A 3KLEB 3Q8QB 3E51A 3VQEA 3S3MA 3L2WA 4F2SA 1S0MA 1SV5A 2ATLA 2W9BA 1XHZA 1JLFA 1IO2A 1NK7A 1NK9A 4J9RA 3RMCA 4EBCA 4E0DA 4EP5A 2G8WA 3ITHA 1J9AA 3VQ6A 4K4VA 3SYZA 4DU3A 5J1EA 1KTQA 2V0NA 1N48A 1SKSA 3SUPA 4ID5B 2F8TA 2W7OA 4DL6A 3PR5B 2JEJA 3VQPA 4EBEA 4FLUA 4DL2A 4RW9A 4NRUA 1F21A 1KLNA 5KG7A 1QE1A 5I3UB 3KLGB 1JLGB 3NAIA 1C6VA 3FRZA 1HQEB 3OYIA 2X6SA 1Z4UA 4NCGB 3V6JA 4AH9A 3ZT3A 2FBXA 5HP1A 4ECRA 2BANA 3FQLA 1JLEB 2I5JB 4LSLA 3EPIA 2FLNA 4C8KA 3ZSOA 4QWEA 4FJ5A 2JEIA 4FJKA 3CJ5A 3KLIA 3ZT1A 3NGYA 4ECYA 4ZMMA 3L2UA 3FFIB 4MIAA 3KKSA 2B43A 3DRRB 4RW7B 4KV8B 2DPJA 2RF2A 1B9FA 3HL8A 5KFKA 4CIFA 5J1EB 1RT5A 2HHWA 4B8AB 4DQQA 3MR2A 4CHNA 2ZE2B 4J9PA 2EC0A 3QZ8A 5C42A 1C0MA 3LWLA 2C2RA 2IA6A 3UQSA 1RTJB 5C24B 1D0EA 5HRSA 3RMBA 1D9DA 2J6TA 1HYZA 1S9GA 4QCLA 1J5OA 3OYFA 2VA3A 2DY4A 4W5NA 4I2PA 4N5SA 4O3PA 4ZVHA 2QKBA 2VG6B 5C42B 1FKOA 3NHGA 2VWJA 4CJVA 5SZTA 4DSIA 4ECVA 1C1AA 4IDKB 1J5OB 2FBYA 1J54A 1NKBA 4OL8A 2A1SA 2B6AB 3O4QA 5F8JA 1T05A 1Z26A 4ED3A 3L3UA 3VQ4A 2YNGB 5DLFA 5EWGA 3HVWA 1RYSA 4FZZA 3OLAA 3OL7A 1A5XA 2HHSA 4BE0A 2YKNB 1ASWA 2IDOA 4ECXA 1JLQB 2RN2A 3OYKA 2QXFA 2XGPA 1D9FA 5DGBA 1NKCA 4RW8B 3H40A 4OKJA 1BIUA 4FVMA 2Z1GA 5L1KA 2XI2A 4IFYB 4HKQA 2YKNA 2E9ZA 2GBZA 4F3OA 2O4IA 3KK1B 1J53A 2HNYB 3HP9A 4NLUA 3WNFA 4BE2A 3CM5A 2HNDB
chains in the Genus database with same CATH superfamily
4N41A 4FPRA 3T1YF 2VQEF 4PQUB 1TV6B 4IDKA 3D3BJ 3JXUA 3CC7S 5MAOA 1S59A 2K7JA 3O4NA 4AILC 4LF8J 1ATNA 4W90B 4JI3F 4H5RA 1N0UA 3DXSX 1SL1A 2WRMA 3DDKA 4G65A 4LRBA 3HKWA 4CHOA 2BGGA 3KHHA 3KXDA 5BXIA 4W4MA 5THWA 1XR7A 3ZZRA 1ASVA 3C2PA 2YJFA 1XQIA 3VWSA 4AHVA 4BC4A 1Q7YO 3JQJA 2BKNA 3E9PA 2ZHOA 4ZP6A 1UETA 3L7UA 3R6GB 3TP2A 1H2TZ 4BRLA 1WTBA 1OH5A 3ZXWA 2HHUA 4DR1J 3EYZA 2B4JA 3W2VB 1JLEA 2HBYB 5CABA 2V34A 1B64A 1BUXA 1SJ4P 3LP1A 1Y3KA 2X74A 2OSRA 2W8KA 2LDYA 3V4MA 2AU0A 5B09A 2HB5A 4FK4A 3HHDA 2VV5A 2XYGB 4OYPA 1S1UA 2ZDPA 3BM7A 3AVCA 5HRRA 1OO0B 1K0TA 5FRNA 1JLFB 2NPFA 4G1PA 4HH0A 4ED6A 2FVSA 4CO0A 3W61A 5KFUA 3VF6A 2W7PA 1XC9A 4DV7K 3PX6A 3I33A 3RTVA 2V52B 4QR2A 2KZZA 4TYAA 1RISA 2YI1A 1VSEA 1UW9A 3HI9A 3N4PA 4LR8A 2VQFK 1N4LA 3MUTP 4H0PA 4OYWA 4LFAJ 1T9TA 3PX0A 2I7PA 4BGAA 3IG1A 3KNAA 4CHPA 5GMKa 3JSRA 4JI3K 3QT6A 4Q5VA 4CHQA 2DGSA 4CJQA 5HATA 4M3WA 2HF3A 3VA0A 4L8RB 1BA0A 9ATCB 4DFMA 5AQQA 1MWZA 2IJNA 4OPKA 1DQ8A 4XDDA 4JI3J 3W1YC 4LF5K 1WOQA 2BVZA 1S12A 1UA1A 2R8GA 1TU0B 8RUCA 1WUAA 1SQKA 1U1PA 1OH6A 1FEEA 4FF1A 4JI6J 3EDQB 2KDOA 1RTJA 4C8MA 4HWIA 2IPOB 4DXLA 5A0YB 1RZMA 2CPEA 3BGRA 3LM9A 1S9EB 1E3MA 1CZBA 1KAZA 1PG5B 3TR8A 2Z58B 4Y2KA 3P45B 2LQ9A 4MLEA 4MKYA 4CNZA 3TQEA 3UN2A 2IVNA 3AB4B 3VF4A 2POKA 3HM8A 4RPFA 3MCMA 2R7WA 2ZH5A 5IT9Y 1S1TA 2Q0UA 5DDPC 5E84A 2DHGA 5F0WA 2PFDA 1KAXA 4OZ0A 2G8FA 2NPIA 2UU9F 2IY5B 1P1TA 2VPZB 1VSLA 5GAHU 2BKOA 5CAAA 3TVYA 1FEHA 1REVB 3CF5Q 2AV5A 1UWBB 1PKUA 2YTCA 3ZTQA 4CFDA 3J7ZT 4PHTX 3W5ZA 2E9RX 3SAHA 4ISGA 1WHXA 4V19J 4FBTA 2DR6A 5F9NA 3CDEA 4CZMA 4F02A 1EWRA 2AJ1A 3CE8A 1R31A 3PYGA 2JZ5A 4WZMA 1RABB 3V9WA 4J9KA 4ZHRB 1ELOA 1BL3A 2CXEA 4KT0C 4ANDA 3CCJN 3U3YA 2Q43A 1HNXK 2F4VK 1IM4A 1WSRA 4CH7A 4O5FA 2CQ4A 4WE1B 1HW9A 2EWHA 3CPEA 1HL6A 5C2CA 3Q8YA 2PEBA 4C0BA 1VLOA 3S3NA 1GMWD 3A5MC 4CLPA 3DLEB 1QUVA 2UUBK 4X4OA 2OZSA 1HHTP 1FX2A 4BLGA 2W8LA 4DR5F 1GNKA 1UVMA 3BGLA 1SUQB 1C1BB 3ENBA 3FFKB 4QWAA 1RU1A 3C6UB 4ZHRA 3V9XA 3Q2SC 4RNMA 3NLCA 4NA3A 4IG3A 2W24A 1HNWJ 1R0AB 4AHUA 4FSVA 4URSA 1U24A 2JFKA 2UUAJ 3CJBA 5GAEP 3VENA 1XNQK 4M5GA 2DT9A 4NLPA 3OL8A 4ZJLA 1N33J 3QWPA 4CCHA 4DV2K 4IJAA 3GCXP 1OYEA 1OQ6A 1GEHA 4OZJA 4UY8T 4BRFA 4KREA 1S6QB 2DFEA 4ISEA 3SQ0A 5G0RA 4CO5A 4ZJQA 2VICA 5JMNA 2CPZA 4KIAA 5C7PA 2ZD1A 1NGJA 5KRTA 5KFTA 5CCMA 1K47A 2XNQA 1RADB 2D0PA 2WHOA 2CNOB 3D67A 1AZSB 2KZMA 1X4GA 4IXCA 2R7RA 1HWIA 2QFIA 4LFAK 3Q83A 2DPIA 2NS1B 4U95A 3S01A 2N4CA 4O4GB 1YT3A 1FK9B 3K5PA 4UOCA 2M8DB 4BROA 3PFOA 1TR0A 1AT1B 2XGQA 2LQ5A 4NMLA 1QAXA 1VYAA 2Y0BB 1TK5A 5LMUK 4OZNA 3W2VA 1HWLA 2IM3A 4GC7A 3OD2A 1IQZA 1EZZB 3UVJA 3JS6A 1BMQB 4LF4F 4NLGA 3RRHA 4ZVPB 3UE2A 1FXDA 3P96A 3R9PA 1RILA 3I5AA 5DQHA 1FTCA 2CJ9A 3OW2M 3P5BP 1YI2N 3JSMB 3MEDA 1DRZA 1SQGA 1XK8A 3HHNB 4DX8H 1P90A 2O8CB 4CEAA 4DCJB 4EWTA 3J8AA 1HQ2A 2OPSA 4ZVRB 3ENQA 3NS7B 3DHXA 3L4BC 4FWOA 4CHYA 3OFEA 2VG7A 2P6SA 1BCOA 2RH3A 3OHRA 1T11A 3NNAA 3PW4A 2OEMA 1RAAB 2E5IA 3OTEA 4IRKA 4BC3A 1Q86T 3T1YK 2A40A 4OX9F 2QA4S 2W4DA 4FJHA 4KH0B 1SC4B 3I0SA 1Z25A 2GTDA 4ZVGA 1KEKA 1GXUA 4CIOA 1EP4B 3KFWX 4H0XB 1ICEB 3SNNA 3NGDA 3KUGA 3C6TB 3AQOA 1EAYC 1S22A 5D77A 3W9JA 4CIGA 3EPGA 1EETB 2QW9A 2A3JA 2Y1LB 2FLLA 2KYXA 2QRRA 1U4BA 1D09B 2NSBA 4U9RA 4JRPA 2DXEA 1B70B 3RR8A 1NG9A 1Q16B 1QSYA 4WKYA 4CGFA 3T5LA 1BISA 3V9SA 1QVFM 4DFPA 2CH5A 3ZX2A 3CCES 3HPOA 1NK4A 4EO8A 4BR5A 3OVBA 3IMXA 2WZ1A 2HK3A 3DRSA 5A2QY 2QL9B 2I2YA 3FMBA 1VJQA 5KRSA 4Y0WA 2YNFA 4CJTA 4H4OA 3CFPA 2GZOA 2ASDA 1TFWA 1CPZA 3KK7A 2VH7A 3OYLA 3DLGB 2CZ4A 3OYAA 2OH2A 3T7ZA 3OSNA 1BY9A 3C6TA 1HR0K 1BQMB 4PXCA 2OD4A 1EETA 3CDWA 4YOTA 2HHVA 3O1LA 5GADU 1EQ0A 5KG3A 1HQUA 1ZM3A 3TW0A 1PSDA 3R5JB 4ZVTB 3O9QA 2D0BA 5C25A 1LOTB 1C0UB 4EFHA 1HPZB 1T8EA 3OT9A 2ALZA 1WF2A 1AXQA 3P6YC 2HS0A 4E7LA 2CPHA 1W7WA 4AHRA 3HPGA 2NRHA 4R0JA 3MPYA 1D3WA 2GX9A 3NOCA 2XLIA 2G2YA 5GIOA 4ITSA 4DS4A 4O3QA 2DH9A 2FDNA 1D8YA 4M5DA 2LMIA 3DLGA 4KHNA 3GYNA 3AXMA 1Q86O 3Q24A 4KHPF 2PFFB 4CESA 4YOWA 1U6ZA 2JFDA 3D7SB 3VTHA 1F9EB 4DDFA 4DR4F 2D3OR 3WQPA 4DTUA 4YR0A 1KOOA 4OYIA 1VQ8N 4LH5A 2DFHA 1FJCA 2FGCA 3QGPA 4YB5A 3AHPA 1IR1A 4K5SA 4BR2A 1IBKK 2W6KA 3V5RA 2QXLA 3VGLA 3KLFB 2HQFA 1UFWA 3AOBA 1H1VA 2W2NP 5ETSA 3SUQA 1WKJA 2ZOMA 3IWLA 1WHWA 3BBFA 4C6AA 2OO4A 3B6BA 3M30B 3IC1A 4QYRA 4ZPDA 5ETNA 4U67L 1H0HB 4LRCA 3DOMA 3F56A 5K20B 3EL2A 4FWNA 3J7YI 4DEZA 1GX6A 1DTQB 4TQSA 1G15A 1IKXB 2IDEA 3D1OA 3TANA 2V4QA 4OI2A 3BUZB 1JXLA 3N4QA 2JC1A 3I8BA 4Y6IA 1X4AA 4NYPA 2L48A 4UOGA 1ITGA 2JLEA 2Z1JA 4JKGA 4CEBA 4IFVA 2A0FB 4KO0B 1GLFO 4O5BA 5LSOA 2O8CA 3MEKA 3UD4P 3CETA 4LD0A 4DUYF 2VFSA 3LO3A 3M30A 1TELA 3NGUA 4XPCA 2OD6A 5DETA 5C15A 3M6WA 2RUGA 3TPQA 3BGOP 1OS5A 3C6AA 1HI8A 4OYAA 3CHWA 3IG1B 4KBIA 5HOOA 5DLGA 3CMQA 3F9KA 1HW8A 5K8PA 1MROA 3PDNA 1N5SA 1SJFA 2ZHBA 3WXMB 3SMPA 1VQ4N 1OVQA 2EBGA 3GDQA 4RNOA 1S1XB 4M3TA 4CT8A 2QA4G 2B56A 4BRDA 3HTVA 3OR1B 5D15A 4FWMA 3A3PB 2VBXA 3CCJS 1JB0C 5F2RA 2L9WA 2V9WA 2DCLA 3H5XA 4OMFG 4XK8C 5CYMB 1JLCA 5LSLA 5AQZA 5AQLA 2HVZA 3TTFA 4J9SA 4CLFA 4IKFA 2HAIA 5CD4A 4B1XB 4BE1A 2LEBA 4CTAB 1ROFA 3FNNA 4FWQA 2E1AA 4B02A 1IJJA 4P10A 1WAFA 2RS8A 3WXJA 2E7XA 3PY8A 4CJKA 3DU5A 1DT9A 4I6AA 4LVNP 4X4NA 1FKOB 3DAWA 3HYFA 3AFGA 5FRMA 4OYZA 3RMDA 4F4WA 2M0GB 5B8HA 2HEKA 4FWKA 2FJAB 3X1LB 3LDSA 3MAAA 4L75A 2Y8YA 2K8GA 4A62A 4ID8A 1IBMJ 1XERA 4LSNB 1YHQS 3OYJA 1X4FA 4ELVA 3W3DA 2DJWA 2X3DA 3B8AX 5IOLA 1CBKA 5ETLA 3ZZOA 1XR5A 5G4DA 1FW6A 4ILJA 4CFAA 2FHKA 4ZOSA 1HBNA 2I9SA 2XB2D 3L4QA 3DLRA 4LF4K 4NLXA 4FNHA 5KPTA 4YUDA 1VIOA 3BN7A 2V94A 4TU8A 2CG4A 3K5MA 2GQQA 3PRVA 3MPVA 3OFHA 1OWXA 1Y4ZB 1KC8O 4TVAB 3W5YA 4CM2A 3WIUA 2P51A 1H73A 4DTJA 1W2IA 2MB0B 5AZIA 2G1HA 5M1PA 2DGQA 3K9KA 2HZVA 2E1RA 2VWKA 2MJNA 2XNRA 1K73O 2OMLA 2WTFA 3LZIA 1GAOA 1F2GA 4KB0A 1BQXA 3S8SA 3G71N 1B7YB 3SQGA 3EO3A 3Q0AA 1VQ5N 2MSTA 1OPIA 1U48A 5AQFA 1HHSA 4DPOA 3DLLQ 4JRQA 5H1SV 2R8HA 4ZVUB 2C28A 2OEJA 2FHOB 2Z30B 1QZ5A 4M94A 2G0JA 3JAMY 2XY5A 4K0KF 3LWMA 1FFGB 2Z1IA 1NJYA 3AJDA 1VBYA 1CJKA 3LDLA 2FJVA 3Q22A 3CC2N 2BDPA 3M32B 4YR2A 4UQTA 2G8IA 4B1WB 3KK2A 2PO4A 3THPA 4UY8O 4WYBA 4NLCA 1KTVA 1SQFA 2C2DA 3OYHA 4R8UA 1E6VA 2HWHA 2H4WB 4E1NA 4CI0B 4DV7J 1A5WA 4N47A 1I6JA 3CMAS 3LUYA 1C0TA 2QG9B 3M8WA 1FT8A 4IKAA 2UXBK 2VQEK 3CVKA 4WE1A 2BABA 2G0CA 4KTZA 3W64A 1IBKF 1XNRJ 4Z0UA 3ZSYA 1BQNB 3MM6B 4QPXA 1YZ7A 1NZ8A 4RUAA 3UFCX 2VDHA 1LKZA 2P9IA 3QLHB 4YEAA 2YQ0A 1Q8LA 1GOCA 3G82B 5AQOA 3PW5A 4YDDB 3BBBA 3BQ1A 4ISFA 2HMIA 1U1RA 1FKPB 6FDRA 1CULA 4C7QA 2YNIA 1SKRA 3CCEN 2KJVA 3CG7A 1RTZA 4EU0A 4EZ6A 1VRTA 2XLJA 1JJ4A 3WQTA 1R7IA 1FXXA 4P2MA 4X84A 4DPTA 4Z37A 4JI2J 4OYBA 3IAM9 3UR3C 3IGVA 4DV3J 4HEA9 3BZCA 3CQYA 3NG8A 2WUSA 2JEFA 5B0BA 4HACB 4U7UD 1RGVA 1X1PA 2JGUA 2ATQA 4DCHA 2GMLA 3NAHA 4B3TJ 2HFNA 4FN5A 4UZCA 2BW2A 4CEEA 3AGRA 1YRTA 3BN4A 2P9IB 5HMWA 3AB2B 5AQUA 1CJUB 3NXZA 2M70A 1CSJA 3MHYA 4DV5K 4USVA 4ZA1A 1T3OA 1EQYA 3UKRB 1ZBFA 5CYMA 5M1QA 1FRMA 1Q7YT 4C2MA 4K8ZA 4B3SK 2FGOA 3MCOA 3LPEA 2F8MA 4FJ9A 2E5HA 3E2EA 1NH8A 3MMAB 2B4UA 4FM0A 1VAZA 4DBQA 5AJ3F 3SBGA 3F41A 5EHHA 3U7JA 2BEFA 3KKRA 4ZLLA 4GW6A 1K8AO 4B3MK 1TKXB 3QRPA 3I4HX 2QWMA 3I5CA 2RD5C 3AO3A 2YNHB 1SZ2A 2GJ2A 2AHOB 2NUHA 1W2BM 4KH4A 1ZAXA 3QBWA 3PXGa 3BPSP 1MMLA 4AXJA 3BJYA 4P2SA 5BPNA 2LU1A 4FCYA 3B6OA 1X3MA 2F4FA 3CQXA 4GKJJ 1IKWB 1RAEB 2V67A 1SH2A 4YB1P 1X9JA 1WHVA 3EM1A 3H5YA 1ZPVA 1XNRF 4CD3A 3PYFA 1CC8A 3R7BB 3QJPA 2V9KA 1WAJA 4NYZA 1N54B 4DR7K 1VS3A 4DX7A 2YX4A 1WLJA 5A8RA 3V1RA 2QN6B 1S0OA 2KQ2A 1QJHA 3TAEA 3WXIA 1Y7PA 3BZQA 2JJ4D 4NYOA 2OTLN 4XDCA 2WK4A 4X4UA 1EO1A 4LUBA 2R7YA 5CZ2A 1DY3A 1SXLA 1BG3A 3HLUA 1QAIA 3IRXA 1NJIT 1S6QA 4ERDA 4F36A 1S99A 4ER8A 1HI1A 4JI2F 3PSFA 4FJIA 1H74A 3KMQA 1T0TV 3G96A 5KPRA 2YHWA 2YNIB 3H4DA 2VF3A 2XY7A 2V2ZA 2F1FA 4X2BA 3AJ2A 5E41A 3SSSA 3GB0A 3PO4A 4LF8F 4M45A 3PW2A 1YJRA 3FCHA 4X65K 3LOUA 3FFIA 2HPUA 1RA6A 3MXMA 5FLXO 3OS2A 1MA9B 3CD6S 4I6WA 2X1AA 4KPCA 3BSAA 2RHKA 3KWMA 3KG4A 2DNMA 2GJIA 5HN0A 3ZX3A 2V6AA 3VAIA 3H90A 2QSFA 3GOIA 2VCPA 3MMJA 1ZBTA 3QFPA 3G6EN 2VFVA 3AVHA 4DQIA 4HVJA 2XMUA 3UVJB 2ALYB 2UUCK 4B3RJ 2DNZA 2PMZD 3NGSA 1S49A 2EFPA 1VR6A 3SCXA 3R5CA 2YH1A 2UVWA 3CI5A 3F5TA 2E5GA 1G7CB 3GPAA 2VBZA 4OPHA 1LXJA 3I32A 1BQNA 3MM6A 2FLPA 2RQCA 4ZCKA 4ECUA 3AJ1A 3TZWA 1NU4A 1W25A 5A8KA 1YTYA 3AXKA 2ZJPL 3Q23A 2APOA 4K5RA 4I9LA 3VR1A 3CO9A 3C94A 4NLQA 5C25B 4YY3K 4DV0K 5AFUH 2AYMA 1KR4A 1JLAB 1NDPA 3CPWM 2NUUG 3PHTA 1F0XA 3E66A 2CQ3A 1VBZA 2C1EB 3DGPB 2B5JB 4P73A 4DR3F 4CBUA 4RNNA 3FDSA 2P9UA 4AM6A 5T7LB 4KHPK 5KFCA 3TQ1A 2GO8A 3E3XA 4JD2A 2ZE2A 1RDBA 1FVSA 4NO7A 2Q66A 1IR2A 3CTRA 4RUCA 2XY6A 3MEEA 4L73A 1VBKA 2HYIB 2CQDA 4DG1A 4CZLA 5MLCQ 3EEQA 2HHQA 3EZ5A 4R0EA 4JKGB 1GLEG 1YTAA 1HYVA 1TQLA 4PWDA 1GXLA 1HQEA 1XMOJ 3QGHA 4LF6F 1BWEA 3EX7B 5KTQA 5DM7Q 5EOYA 1RA7A 2H54B 1K9MT 3DJCA 2EBEA 3G6ES 5BRFA 2OPRB 1RDAA 3CCVN 1FWLA 4IQMA 3F2KA 3QETA 1NMNA 2XS7A 3K17A 4F4XA 2YJEA 3TNVA 2F40A 4CF1A 1TGOA 1AUSL 2ZM6J 1ZTWA 2BH1A 2PFUA 3M2UB 2KU7A 4ICLA 3UNGC 1F6TA 1DTTB 2YKPA 2F8EX 4DX6A 4X4TA 2CQPA 3V1QA 1K73T 1ZM4A 5K14A 4QIFA 2GGPB 1VQ9S 3FCVA 1NHUA 1TAQA 4DV4J 3MR3A 4CF0A 5AQRA 1QY7A 3MAHA 3Q89A 1PBAA 1SC3B 4O3SA 3UN5A 2Q31A 2QA2A 3SCJE 3DMJB 5AXLA 3I56S 2Y1JA 4EHUA 4HACA 5KAKA 4ELTA 4RCHA 4F7VA 3C95A 3EICA 3C14B 3KJVA 3KLHB 2CJKA 4BRHA 4B9NA 2I7NA 1Q8IA 4PKDB 4FK0A 4CGDA 3WQUA 3CNQP 3AA5X 1CC7A 3TZYA 3IWNC 2W6LA 4GV6A 4NPOA 2LLZA 1CLQA 5L9XA 2HHPA 4CLTA 2DR9A 1JLQA 2IIHA 2QE5A 3VF0B 4DSLA 2J8AA 5ADZA 1X3NA 4RZRA 3TX8A 2GW8A 3G6XA 4DR6K 1EX4A 1FWKA 4DR3J 2H5IB 3GIRA 4AFFA 2E6LA 3PFEA 2L9DA 1IBKJ 2MMYA 5D0GA 4R5PB 4F3TA 4A59A 3IAS9 1JIHA 2VYPA 4DL5A 4O3OA 1PGZA 1SKWA 2XCPA 4Z4CA 2XMVA 2FVCA 3OHAA 3AA2A 1MW7A 3MWBA 1X0FA 2HOEA 3DGPA 2EFNA 3OBWA 3HHKA 4AHTA 1UWBA 2Q79A 3MR6A 4HYKA 2Q3PA 4B9SA 2ZHAA 3ZT2A 3KLEB 3QAEA 3E51A 3PG9A 4USJC 5HQLA 3QWUA 1D8ZA 1JMTA 4F2SA 2RILA 3EVOA 2ZH6A 3OQ2A 1XHZA 2VDIA 1NK9A 1QVGR 1IJEB 1QQNA 3O1BA 3SQOP 4EP5A 5KQ8A 4NMXA 3M1VA 4B1ZA 4K4VA 3G25A 2BV3A 1G2EA 2V0NA 4ID5B 2F8TA 1FRJA 2BACA 4ZLJA 2JEJA 2HFSA 1B3TA 2DIUA 1Y00A 3KLGB 5B0CA 1JLGB 1H98A 4DV1F 1SIWB 1ZXOA 2X6SA 4EHTA 5AQIA 3V6JA 3BH7B 4WK1A 2ZJQL 3H6EA 2RJZA 2V7YA 4QS8A 4ECRA 3EDRB 2BANA 1DQAA 5FLXY 2K3IA 1JLEB 4B3MF 2K3KA 5CZVA 3BEGB 4LSLA 1R0BG 3ZSOA 1RAGB 2MQLA 2X1BA 1WI8A 4CZGA 5IT0A 2KM8B 4FJKA 1NGFA 1GLLO 3C16A 1M90T 3K0JA 4A8YA 1FD2A 1WDTA 3FFIB 3DC2A 2UXCK 2RF2A 4OHXA 2P9UB 4B8AB 4WBFA 4IOCQ 3MR2A 3I56N 2AP1A 3MOZA 2MXYA 4QR0A 2CNKB 2IA6A 4QS9A 2IMOA 2LKZA 2J6TA 1S9GA 2OLWA 4D3GA 3OYFA 4JI0K 2NLWA 2DY4A 2HURA 1DQ9A 1T95A 4USUA 3ZTPA 2NZCA 2UXBF 1RDUA 3GE9A 3CMAN 2DR7A 2O1PA 5SZTA 3L3CA 4DSIA 1U1MA 4N7TA 2KI2A 4LVOP 2FBYA 1J5OB 2A1SA 5F8JA 4WIIA 1NCLA 3ET6B 4OV6A 4DR2J 4ED3A 3I87A 3VQ4A 4P2XA 1YBTA 3HVWA 2W25A 1RYSA 1A5XA 2NXEA 1VGYA 3QICA 1N8RO 1TL5A 3NCPA 5DM6Q 1D9FA 5DGBA 5AQJA 1NKCA 4FKXA 3H40A 4L6V3 1EWQA 5L1KA 1BDGA 3M2VA 4O0NA 4DN0A 2YKNA 4F3OA 2O4IA 2DD8S 4K41A 3KK1B 5HO4A 3HP9A 1U1KA 2HNDB 3MMCA 4FF3A 2OUGA 2WB4A 1OYDA 4JEPA 4F67A 2BJ9A 3IR5B 3GTYX 2DGXA 3ET6A 5F41A 1FWPA 2QM1A 2DNYA 4RLEA 4C8LA 1UVKA 1XHXA 4K50A 2YPZA 4DSJA 2QIFA 3KD5E 4QPTA 4CFCA 3OSPA 1O0PA 5D0RA 3SSQA 4ID5A 1YBAA 3C0BA 3CD0A 1NSQA 3BQ0A 5AQWA 2ZBIA 3LALA 1ACMB 1S4EA 4H4MA 5D4PA 5KFBA 3BF3A 2D3UA 1R6VA 3FR0A 3FZBA 3V2UC 4PL8A 4WP9A 3Q8UA 2DNQA 5EX0A 3AO2A 4F3MA 1MG7A 1UEKA 2HVHA 3CERA 5J2QA 4YOXA 3K5LA 5D4LA 3KUEA 1S1WA 2F7VA 1WG4A 5GMEA 3AY9A 2FB0A 2QTDA 4CK3A 1NGBA 1NGAA 5AXMA 5A2QO 2QSWA 1KONA 3K8WA 3AD7C 1A0OB 1IN0A 2ACMA 2CWXA 3CDAA 4LC9B 2JWKA 1PCAA 3DCAA 2MKYA 5BR8F 2WVFA 3GV5B 3GV8B 1A6LA 3BR8A 2JWLA 2WVCA 3ZSVA 4OLBA 1RDRA 3VGUA 3LP0B 2RSQA 2KHDA 3H1VX 5CYQA 3VHQA 2W42A 3KKFA 1T3VA 3W5XA 2V2VA 3A8KA 3V1OA 3QIPB 3TEHB 3VQ9A 4DV0F 3HHLA 4JI5K 5KFOA 1JX4A 4A61A 1RBUA 1Z1ZA 4LSZB 4CLZA 3D1HA 4G1QB 4Q2MA 3MUVP 4KTWA 3AVIA 2Q1LA 3N4WA 2NRRA 4WCEL 3W8PA 1N36F 2M7SA 2QWOA 4E7IA 1CS4A 5D78A 4P7TA 5KG5A 2GIRA 1VSMA 2FVPA 5DM6L 1AA1B 1R0AA 3SPYA 2MQQA 4WFBQ 5JLHA 3SXLA 1Q8BA 2XS5A 2P9PA 4M5LA 3R9LA 2QWNA 3OXLA 4F4AA 2J9CA 3HM9A 2QEXN 4CYUB 3OR2A 4KGZB 4X66K 3T1AA 3DM2A 4WTYA 4JV1A 4FJNA 5A0YA 3JB9k 1WOSA 2AX1A 4F8RA 2UVRA 4LFBJ 3M8PB 3FZFA 1I94F 1YJ7A 4M3YA 3MM7A 4C9DA 1RXOB 2KFYA 3UE5A 4BQLA 4Z94A 4C4WA 2MGZA 1XTZA 2WBRA 4NYFA 2BUNA 5I42B 4CH1A 4DI6A 1VQ7S 2ZOGA 2KT3A 3H08A 3NGRA 3CW2C 3PW0A 4WFZA 1TUUA 3LAMA 1I5OB 1T03A 4F4YA 3I4PA 1RK8A 1N32J 2B4PA 4GVBB 5ETQA 3TVKA 3G71S 2OANA 4ZP7A 3G8SA 4IR9A 2HHXA 4O0JA 5F0UA 3FSXA 3WIVA 4LF7J 5ETVA 3S9HA 3NMUA 3GQCA 3QIDA 1FFSB 1MWQA 1B99A 4B1UB 4QIGA 2E1YA 3QZ7A 5KOWA 2RHSB 3KHLA 5BR8J 4KGMA 1JKHA 4WIQA 3MXJA 4RNHA 1YJUA 1U6BA 2VHGA 4N76A 3Q8SB 3QRQA 1BA1A 2JL9A 4JV5J 2KRRA 5GADI 2GELA 1Q95G 3IFEA 4HCBA 3M5RA 4K0KK 2GQ2A 5DQGA 3A3NB 5F8HA 3DDIA 3W2WB 4NLBA 1S6OA 5EGYA 2KRBA 3EGNA 1WHYA 4BWJA 3BH6B 3K2PA 4K8XA 1KSPA 3UR0A 2HW3A 4YY3F 5KFHA 3SCKE 3I82A 1FE0A 3CXCR 1YHQN 5KG1A 3H2UB 5B0DA 3WZ0A 3NDKA 2FY1A 2VFRA 2E1ZA 1HLUA 4OZ2A 2IDLA 2XZTB 3IM9A 2J4RA 3QIOA 1L3SA 3AD8C 7FDRA 3RAXA 1DHMA 2Z2MA 2BMBA 3DI6B 4PYDA 1RWPB 2RU3A 3H45C 4H0OA 5KFNA 1JNZB 4NLOA 5HROA 2HVEA 2RRBA 1FDAA 2K1RA 2QGFB 3SV4A 3E8OA 4U6PA 4KHYA 2R7SA 3VQBA 3QJLA 4CRJA 3TI0A 4UUWA 3UCGA 2XM3A 4KI6A 1TL1B 2FF6A 2MZ1A 3UKUB 2FPHX 4GKKF 3I8DA 2QEXS 2DISA 2FVQA 5CD4H 5BYQA 3R8YA 4WWSA 2KTQA 2EVZA 4PWDB 2R2TA 4J91A 2JX2A 4ECTA 4YDXA 3ZSWA 3A4TA 4NOHA 4YFUA 1WJ9A 4HUFA 2ZC4A 3UI3A 4OI6A 4FS1A 1VQ4S 2D4WA 1HKAA 1ZZNA 5ADXA 2YVSA 4NWBA 3CJ9A 1D1UA 4I1TA 3TYTA 4YNQA 5D8HB 2UUBF 1H7XA 3QFUA 3HVAA 4O8UA 2YNGA 2IJRA 2VKZG 5KFSA 5IT4A 1YIJS 3NCIA 4DV3K 4NLRA 1NZAA 1ZOTA 1YBUA 2KH9A 2GIQA 3OVSA 2XEXA 1KHWA 4DTRA 3FE1A 1VC0A 1AB8A 4DR6F 2F96A 1CS4B 4EFAC 1D5AA 2ZJRQ 2ZEJA 2CQGA 3MN9A 1VQ8S 2ZBQA 2OPPB 3SFUA 4IUFA 3HOTA 2CQ2A 2JLFA 4J37A 1J2VA 2DTUA 5AZJB 3SCIE 4RNFA 3GJQB 3HFKA 4JP8A 2XYPB 5AFUA 1UMJA 2L9NA 3CJ0A 2B9YA 5LSRA 3VEZA 2ETJA 2CJBA 3FSIA 2WAQD 1IQTA 2HQIA 1KQKA 3O4WA 1GXTA 4ZVFA 2MTLA 4PEOA 2ASMA 4KH5A 3SQ4A 4Y65A 2FHJD 5FPDA 2LXUA 2G0IA 4PG6A 3MEEB 2XCAA 3DXBA 3NVKA 2FVRA 1YI2S 3W7BA 3B54A 3KNGA 1DJ0A 2DH8A 5BN9A 2ROEA 4CLSA 2G8KA 3L2VA 3CCZA 2W01A 2VODA 1LEOA 1B0PA 2NXCA 4ZCMA 1L3VA 2AW0A 1TK8A 2QX0A 3MD1A 2PE8A 3PW7A 5LMUF 2JEGA 2MLZA 4NCAA 4USKA 1JJCB 1UZDA 5A8KB 1ZTTA 4PRFA 1GLJO 2G1DA 3B8HA 3HRGA 5AQYA 2M3DA 1FDBA 1GLAG 4KI4A 5B0AA 2BXJA 1TMMA 4CBXA 1U1LA 3D54A 5C2FA 4CZEA 3IO1A 4JKAA 2M88A 3KHGA 2C2OB 3ZNUA 3NF6A 3KUHA 4EBDA 4B1YB 2PMWA 5KT3A 3NGIA 2F4VF 2V4RA 4M5KA 2CJYB 4M5MA 4R8UB 1RI7A 4NEZA 1VQLS 2DGWA 4DUZJ 2MLYA 4MKBA 3T1HK 5AQXA 3DGVA 5K8OA 3OTOF 1V4TA 3MEDB 1RWXB 3M6VA 4DQSA 2MDAA 3RB0A 3FCWA 4J9QA 2RRAA 3ISZA 3CB4A 1HBOB 1WOPA 5G0RB 4ZIVA 3OYNA 2QA4N 1LW0B 1JNRB 4H0VB 4DTNA 4ECSA 1OJ4A 4IO8A 3C19A 2V8GA 4JHDB 2XHBA 3D68A 3OYMA 4G3IA 4DLEA 4UW2A 2Z8QA 1WSIA 1KRPA 2M52A 3IWXA 4ZN3A 3QEWA 2B4OA 5U47A 3ETMA 2E1MC 4L74A 5HAOA 5JVHQ 1N5QA 5H9FK 4DX5A 3DOLB 1FJGK 2QMUB 3GILA 2A42A 2ZJRL 3AAQA 4JOUA 4KYZA 4M5JA 4YB7A 4BCAA 3JYTA 1N56A 5LOQA 2CGLA 3DMJA 4FWLA 4I7FA 3D2FB 4I68A 2YHBA 2E5LJ 1YJTA 3PIPL 4FYVB 3CFRA 2MYFA 2VJUA 4PKHA 3SJJA 3QGIA 4FBUA 3KJFB 2FZKB 4A47A 2P6TA 3ZNJ1 3CSKA 3I9V9 4J7CA 2ZBRA 1KWMA 4LIRA 4EO6A 1PIEA 5LMNJ 1KFSA 4HDGA 3OXGA 4DU8A 5I3QA 4IO9L 3W0LA 4JI8J 3KIOA 2OPQA 2DYAA 3PR4A 4X66F 4HDHA 3E01B 1IKYA 4NRTA 3DFEA 4IEIA 4M95A 1QTMA 1CJTA 1DURA 2CGKA 1DBDA 5HLFB 1P9QC 5ETPA 4GRSA 1X4DA 2AEJA 5M1FA 2X1FA 3SLCA 4X64K 4DFJA 1WF0A 2ASOA 2ATCB 2KL8A 3PRDA 4ELUA 2R7VA 1ZAWA 2GVDA 4CEZA 2JSXA 4HTLA 5T41A 5A8WB 3CJ1A 2B6AA 4JI0J 3T5KA 3M8QB 2OPQB 1BWVA 5KFPA 4X64J 3ID6A 3G9CA 1S5ZA 4V19S 2I0XA 2ZZNA 2G9OA 4J9MA 4BVOA 4QWDA 2DR8A 5IV4A 3TU5A 2FTRA 3TZXA 1S72N 4BVPA 4CJ7A 2VL1A 4JBCA 4GV9A 4FWPA 4WFBL 2Q1NA 3DXMB 4QIEA 4C3LA 2FHMA 4GMJB 2DO4A 4IOAQ 1RCHA 4ZPBA 1XUPO 3E9OA 1SQEA 2NXUA 4HHHA 2GQCA 5C2DA 2KFZA 1WN7A 4BRQA 2E29A 4AL7A 2O8DB 2LSNA 1U8SA 3CCMS 2Q97A 4PY5A 3KJNB 4JI5F 5M1KA 2AGPA 4CJRA 4KAZA 4J9OA 3X3UA 1J5EK 3G86A 1T3NA 2HQ3A 3DNCA 2P9CA 1KNZA 4CP5A 2XMMA 2F5GA 2CIMA 1RAHB 1NXIA 4MTPA 3HCXA 5FLXU 4I2QB 3P83D 2IAJB 5LMNF 3POTA 2ILYA 4WYLA 5KFXA 2DTJA 1PAUB 3L8BA 2RF2B 1S1XA 3ULHA 2WW8A 1BLUA 4CJEA 2WBMA 2O3DA 1MNEA 1RDDA 3SAGA 2KXHA 4DQ8A 4F0HA 4B17A 2H3GX 2R8JA 5KT7A 1J5EJ 2UZAA 2F9JA 2Q6BA 4LFAF 1YX2A 1T02A 5HMYA 2GEMA 2VG5A 4IG0A 5LT5A 3ENOA 3D9BA 3KWGA 4MO5A 3L2QA 4NL5A 2MKKA 2K06A 3EWGA 1VRUA 4XH4A 1DTTA 3T6BA 2M9KA 4RUBA 4P75A 3CJ7A 1HR0J 3VGKA 5CHIA 2NQPA 4KKOA 3NL0A 3THYB 1A5VA 4WXWA 1RAIB 4LRDA 5HJYA 3KOAA 2FSKA 2DVIA 1UEVA 5J2QB 2AA4A 2CPIA 3I6PA 4JI0F 3J7YP 3SQ1A 4W92B 1Y97A 4X64F 3D0IE 3L7OA 2DY1A 2R9LA 5EWFA 1G99A 4FO0A 2G13A 2KT5A 1ZA2B 5KFQA 2DB1A 3VQCA 5DM7L 4Z4EA 2VOPA 1IG9A 4OGEA 2J7WA 1U45A 3CCQN 2NCKL 3OR1A 2C2KB 1W97L 4TYBA 4B3OB 2COLA 2YQ1A 4MKVA 1P6TA 1N5VA 1WBDA 3PYEA 1TKXA 5GAGP 3GR1A 2OFHX 2HMIB 4ILRA 2JOQA 4EK2A 1SI9A 3QEVA 4KHUA 4JN4A 3S1TA 1XJWB 5DGAA 4AQYK 3BEXA 2D74B 2D1KA 5I3UA 4MKAA 3J7A1 2ZF5O 3U1LA 2Z1HA 4IRDA 2O67A 5CA5A 5JICA 5RUBA 4PG5A 4XAKA 1DFDA 2GV9A 5IM0B 2PA8D 3TUIC 2X6NA 3I0SB 3MPWA 5HLFA 3CD6N 4KGVB 5J1PA 2HIYA 4DQPA 4CDIA 1UZHA 4F3QA 1NOYA 4W98A 2H3EB 1HNIA 4Q8FA 1VQ7N 1LV5A 4CZKA 2BJ8A 3ENAA 3CJSA 1KD1O 2HNZA 4ED1A 1WNSA 3G10A 3R7NB 1P8ZA 5AXKA 3Q7CA 5D0EA 4QIVA 2CQHA 3U3GA 3IM8A 3DDNA 4DV5J 3ULDA 3B4DA 1RWNB 4ILMA 4AHCA 2Z2LA 1PAEX 1IG8A 1QZ6A 3Q8PB 4CWBA 1VRTB 4RW4B 3BKUA 3EVWA 3BDPA 2Z57B 1TL3A 4IQXA 3D0GE 1YZ6A 1C2PA 2JWNA 4WF9Q 3SDEA 3J80Y 2OSQA 2CPDA 3O8MA 1QVGM 1NGDA 1IBMF 3QIPA 3BF4A 3KD1E 1T94A 3TAPA 1TL1A 3DRXA 2HAFA 3RZAA 4PKIA 3OTOJ 2ZH9A 5LJ3Y 4MYUA 2XMKA 4CJUA 1UVNA 1RLDA 1IBLJ 1EKSA 1UFKA 1IKWA 4Y2AA 2AYBA 2CQIA 2Q3SA 1M1KO 4CLYA 2UUAF 4PG7A 3TTDA 1RKJA 5FDLB 4WQ4C 1RWVB 1NHKL 2P2CB 3DLBA 3VA3A 1TYQA 3TAMA 4FLWA 2GWJA 1N6QB 2HIQA 1WUUA 4LF9F 4FJJA 4M5DB 5D3GA 5LJWA 1X5OA 4M3ZA 1G3OA 4M3UA 1RT7A 3GMGA 1GMWA 1I39A 3ZZTA 3FK4A 2J0XA 2W9AA 2BQ3A 3QFWA 4W5QA 3HVTA 2N82B 5F3ZA 1SC6A 4QZVB 3SFGA 2FJDB 2I6WA 1AUDA 4JV5K 3M2RA 2ZQBA 4BG8A 3KMSA 2IVOA 3R2DJ 3SZ2A 2KB2A 3O6WA 2EG2A 2YWWA 4DUZK 3RUBL 4C48A 2Y1RI 5HVHA 4MFBB 3MR7A 4YHHK 1N34J 4DV5F 1NDCA 5L9NA 2UUCJ 2HKEA 3GR0A 5F8NA 3QT7A 4X65F 1J6ZA 4GO7X 3A5NC 1JQGA 1QSLA 3IFRA 2O8FA 2QA1A 1WBBA 3KDNA 1M1HA 3K9JA 4WFXA 3POTB 3VEWA 3QNWB 1TUWA 1F60B 4I2PB 5F0XA 5HSPA 4KQZA 3CXCM 1RBVA 1Y9OA 4N8NA 1H2UX 2D69A 3WNGA 2D1CA 4RUHA 3HSTB 1UP1A 4W5TA 2BQUA 3OTCA 4WU3A 1UTAA 3HK2A 3PIOL 3UDLA 3G6YA 3JXOA 1S6UA 1HNZK 4PUOB 3AVMA 1SJ3P 2VC1A 2DRDA 2VBYA 1QHAA 2W1BA 1R0CB 4K42A 2ZH2A 4U8YA 4ZCLA 4QWCA 1LFPA 3OS0A 4M7YA 2V8PA 5EY4A 1JLBB 2BE2B 4OI1A 2M2BA 2XZDB 4BRAA 3C8YA 3OW2R 4CK1A 1RAFB 5ELZA 3H46O 4WXOA 2OTJS 4EYIB 4JKBA 5DZ7A 2EC2A 1N36K 3LW5C 1VMBA 2CPXA 1PJ7A 4DTXA 4OYOA 2F3JA 3FUYA 3CJ2A 5AJ3J 1Q18A 2QMXA 2IRXA 3O2IA 1K8KA 4ETZA 2QMWA 3V4IA 1BHNA 3LGHA 1EX8A 1HNVA 4WFAQ 4MH8A 3ZSQA 2BBEA 3HVTB 4HT7A 3NAEA 3HPHA 2UV8G 2HZAA 4NI2B 3ZETB 3K59A 4LFCJ 2IC3A 3FZ2A 4ZDNA 2UU9K 3EZOA 5AE1A 4LT6A 3VV2B 5IWAJ 4NLWA 5JS2A 4LF6K 1BUPA 1SH3A 2W9CA 1S6PA 4YP3A 1HWUA 1YGYA 3V6DA 1MWYA 3OL6A 1R8BA 4B9MA 5HBMA 2HVIA 3Q86A 4YMEA 1C4CA 3BDEA 4PCQA 4AD6A 4JI7F 4E7JA 2V4JA 3O8WA 3DRRA 4G1IA 4OV1A 5AQNA 3OXFA 4OJRA 1WG1A 4DV6F 2VASA 1RT3A 1TK0A 1JWWA 4JKFA 3P5JA 4GKKK 1DARA 2J0SD 1X7VA 3PIPQ 1N36J 1A9NB 2JDJA 2LQ8A 4PWWA 5B08A 4BR4A 1PJ6A 3AVJA 4CF8A 4HUEA 1OY6A 1WSVA 3VEYA 3D3CJ 2YWKA 4Y3CA 2DFFA 2BJDA 4GVBA 4RW4A 5IZHA 1FRHA 4OZLA 3BZKA 1EXQA 2YXLA 2QC3A 1U02A 3TX0A 2LECA 3UKUA 4NCGA 1RCXB 2O66A 2E20A 4HTUA 3CC2S 2GWKA 3T3FA 3VPZA 3HZEA 2CYYA 1JCEA 3LAKA 5DJBA 2O4GA 2EKYA 1JJHA 1GOAA 4K25A 2ZH7A 4HH1A 5C12A 4Y28C 3KJVB 5E2QA 1S97A 3PSIA 1C1BA 1U1QA 2FC0A 3LPTA 1GQEA 3RBZA 4LSNA 5E3QA 2EXUA 1CQNA 2RQ4A 5EVZA 5M2UA 3MCPA 4V19X 3Q2TC 1W0HA 2AZ3A 3KJQB 5B0GA 4M5HA 3J7ZO 4IO1A 4B3TF 3IBWA 5JXSA 3GE1A 5HL7L 2E88A 4E7HA 3HT0A 1NDKA 4O3RA 1MDUB 4DN9A 4WQ5C 1SIZA 2VG6A 2IBKA 3GJTB 1LQ9A 3K89A 2NXJA 5LMNK 5L38A 3OLBA 3CYMA 3VGMA 1S72S 1X9WA 3FKBA 1SB6A 3GSIA 1NU0A 2DNLA 3NWGA 3G8TA 4IG0B 4ZPAA 4C98A 4X62K 4YB6A 3ICLA 1FKPA 1Q8KA 1RHRB 2A6OA 2BQRA 4EYHB 4JI7J 1VQON 2NZTA 4R25A 3CIMA 1YXQA 2MPUA 2WSEC 1RT4A 3CCVS 3ZZYA 4ILLA 4I9QA 1RBTA 1HARA 3IGNA 1K6YA 3A8IA 5H9FJ 3RBDA 3HT3A 4DZDA 2CJXB 4M1KA 1FO1A 1W2BR 1S7HA 4N8OA 4A8XA 4X62J 5AR0A 4WF9L 4WU2A 4WTOB 3MWPA 4ATNA 3I9ZA 3G8QA 1YITS 5AQGA 3GIKA 4K2XA 4WYWA 3WHIA 3OTOK 2CG8A 2LDIA 3L2WA 4GVLA 2ABYA 4B3SF 1OSCA 1SV5A 2W9BA 3B4MA 5BR8K 1IO2A 4J9RA 2N3OA 2QL7B 2CPFA 5IQ6A 1J9AA 3SYZA 4CNYA 1TUVA 4ZVOB 4HHJA 2W7OA 4DL6A 4FLUA 2MZRA 4RW9A 1F21A 2H5EA 1QE1A 4F25A 1C4AA 1U7LA 2LP4A 3AA9A 2J9DA 3THYA 3FRZA 3VVTA 1FDDA 4NI2A 3IMQJ 3WC0A 3ZT3A 2CFXA 2FBXA 2VIHA 2HFUA 3NGKA 5HP1A 5IM0A 1WF1A 2NSCA 3O9TA 2VPXB 3LA0A 2HZCA 1X31C 1KBRA 3ZT1A 3L2UA 4P7VA 3DRRB 1UFLA 1B9FA 3HL8A 5KFKA 1QAYA 4CIFA 1RT5A 2HHWA 1AFIA 4CHNA 1NJIO 4KR0B 2OJ3A 1H38A 3PJ9A 3GP9A 1C0MA 3LWLA 2C2RA 4OZ3A 1RTJB 3LDNA 3ZTSA 1ESVA 1R27B 3RMBA 3R5DA 1HYZA 4QCLA 1J5OA 2AEFA 2LQBA 5BJRA 4O3PA 4ZVHA 4KGKA 2QKBA 3HOSA 4AL5A 3D7EO 3H42A 1RFQA 1SPBP 2XMJA 3N0VA 4PG8A 2NRWA 1C1AA 4DUYK 3A8JA 4DKWA 2WBNA 2OCEA 1PILA 2F7TA 1Z26A 1VQLN 1N88A 4X62F 1FCAA 4IOCL 5EWGA 4FZZA 1Q81T 1R6YA 1F5BA 4BE0A 2YKNB 3CC4N 3S6EA 4C3MA 3C3LA 4NXMF 3OV7A 1JLQB 2RN2A 5ETKA 3OYKA 1U2FA 2QXFA 2XGPA 3TJ9A 4O8KA 3A12A 1VLYA 2C3MA 3NRBA 1VDHA 2IFXA 1HD1A 5LM7E 2XI2A 2P8IA 2J0QD 3D2EA 2E9ZA 3BY5A 2YQ3A 3JQMA 1UVLA 2BTFA 2MY7A 3N01A 2AJ2A 3QBCA 4BE2A 3CM5A 1NB2A 1CZ9A 1XMQF 1WWHA 1TL4A 1E6YA 3RW7A 4K4XA 1NEEA 2C3UA 3HHLB 2AF6A 4F9OA 1MU2A 1IKXA 1UAXA 3TABA 1TL3B 5IQQA 1GFWB 2DEJA 3GFYA 3KLEA 3MTKA 2UUWA 2MZTA 3ZTOA 4A46A 4B3OA 1OQ3A 4JI4J 1JCGA 5D4NA 2A5XA 3M9OB 1Y5LB 3GCWP 2MHNA 1GMUA 2BOPA 1JKHB 3O6QA 4URQU 1QQCA 1Y11A 5IT9U 2U2FA 2XHWA 1FJGF 1HYSB 2GC8A 2GVDB 2FF3B 3A8EA 1X0PA 1ZS6A 3CCRN 4CERA 1VSIA 2O8EA 4ED4A 1REVA 4K4SA 5A8WA 3BBCA 5DG8A 2OA8A 2PZSA 1N6QA 1RNHA 1WSHA 3KLIB 4JI7K 1EJ7L 2D0CA 3VF2A 1WKLA 4DV4F 3VAFA 2W2MP 1RAJA 3RWUA 4M5IA 5GVQA 2HBQB 5IWAF 2BOAA 3MOJB 3R7SB 2DR5A 1EKRA 4OJ1A 1YG0A 2AMCB 2QFJA 5FPNA 3L95X 2DNOA 3M8YA 4NLTA 4RX6A 1KXPA 3MURP 4CHZA 3AGKA 2ZGYA 2R2UA 3HKZD 3M6UA 3DYAB 1HMVA 3RB4A 4OKEA 3R3LA 4USHA 3GYXB 1PC5A 3PACA 2OPRA 1VRQC 2QJ3A 3OYEA 5A2QU 1LWCA 2R3VA 2V5HG 1RDCA 2O8EB 5DO2A 3PUFA 3WX4A 3AVLA 3ISNC 2IIRA 3O5BA 2CUYA 4MIWA 5J2PA 3E9LA 3CJKA 2HFVA 3CF5L 5L46A 3K5NA 1GLDG 4BRGA 3SMZA 2ZJPQ 2CNLB 4G1QA 2JRSA 4DOZA 3AOAA 1YVFA 1C1CB 2DITA 3HD2A 1FHTA 2H51B 4TSXA 2XG8A 4NXMK 4KH1B 2UXCF 1SL0A 3LZJA 2QZ8A 5KFFA 5CE3A 1MLAA 1RBAA 3LM2A 4OKKA 1KC8T 3TUJC 3C66A 1RYRA 2M4MA 5FIIA 4HHUA 1NM2A 2GVZA 2VZ9A 1GTEA 4Q44A 2RE1A 3GIJA 4F4KA 1YLXA 2XMWA 2XYHB 2F65A 4B08A 1O6XA 3FBEA 1CXQA 5FDLA 1XNQF 5AQSA 1TKZA 1WC5A 4WCEQ 4GV3A 3M2VB 2HFZA 4C97A 2VU5A 2A2DA 3VQQA 3KK1A 1E6YB 1TKTB 2BRLA 2C2MB 5KG2A 5KT2A 4OIXA 4DR7J 2B7CB 2M8HA 5E26A 1KQGB 2YNHA 2F9WA 4LBHA 4B9TA 4PUOA 3I31A 1MMNA 5K5MA 1VSKA 2YKOA 2AEMA 2IM0A 4Y34A 2R7OA 1VHXA 1S6PB 1BI4A 3CCUN 3B78A 1WC3A 1IJFB 4H03B 5HBMB 4LRFA 2NRZA 2ASPA 3MWTA 2ZNYA 3OBIA 1RHKB 1VI7A 3MM5A 4KB1A 4DSKA 5KFVA 5T14A 3MUMP 4CF9A 1HRHA 4B3MJ 2W40A 4RWXA 1K9MO 4FZYA 1NK8A 2OP5A 1HNXF 1RJJA 1T9YA 2D9PA 4FW1A 1T6DA 1CJUA 2J7UA 3GG0A 4F50A 4HI1A 4NA1A 2Y1IA 1VQKS 4LREA 2P9NB 1YRUA 4A8FA 4K4WA 1QQMA 3VQSA 5L1IA 4JV2A 1FESA 3AV9A 4OQJA 3M1VB 2WFBA 3UW1A 1RU2A 3MR5A 5I4MA 3CT9A 3M6GA 1RWKB 1Q79A 2X51A 4FVUA 4E89A 5H1SQ 2XULA 4BS2A 1KFDA 4PG4A 3AO5A 5BREA 3SAFA 3DRPA 3MX2A 1AW0A 5F8GA 3VGTA 4JI4K 5KFYA 3D6HB 4FJ7A 1IWAA 4BRKA 4JYAF 3VVUA 3G2XA 4KHRA 4OJ3A 1FX4A 4LSLB 2OELA 4Z4FA 2IA0A 5CY4A 2WSFC 3ZO7A 3H1QA 3CMES 2E7WA 1SKUB 2D9OA 1C0UA 3O9RA 2D41A 2U1AA 3VALA 2HS4A 1I94J 2NUBA 3VCDA 5KT5A 2H65B 2OKQA 2KFNA 4Y1DA 4NE9C 4ZPCA 3QPIA 1DTQA 3EJMA 2G2ZA 2IVMA 5D0HA 3MZIA 3AVFA 4ICLB 2HBLA 2DHHA 4DR7F 1S9GB 1FVQA 4JKEA 4I4BA 3DU6A 1VOMA 2BJ7A 3OR2B 4A8MP 5HQ8A 1K1SA 4P74A 1U1NA 2JC0A 3C65A 4J2DA 3WXLA 1VHIA 3EE9A 2PT0A 3NNHA 2X7IA 1B0VA 2AT1B 2HGLA 2QLFB 4DUYJ 3KK3A 3ATVA 3VERA 3UD3P 2BE7D 2F8SA 4K59A 2F9TA 2R4FA 1VQPS 1O13A 4CZHA 5J2PB 1YJWN 1TYQB 1Y5IB 3W60A 1K1QA 4JV5F 1M5PC 2WW4A 3WNHA 2IJFA 4D3HA 1M90O 2AP6A 5IFMA 3UPFA 3P4UB 5GIPA 4Y1CA 3LP2A 1ZZFA 3PJWA 4DV2J 2OI2A 4J2BA 4BC9A 4CJLA 2GHWA 1S79A 1YJNS 1RWUA 4Y2IA 4Z2XA 4F26A 1Z05A 3U4LA 2KG0A 2E4LA 4J5OA 1NKEA 4QS7A 1MN9A 3K8VA 4DTSA 4B9UA 4C8YA 2ASYA 3FQKA 1NSAA 1UL3A 4ZP9A 3A5OC 1HWJA 2P1JA 1VK0A 4QU7A 3LP1B 2PYLA 1KOHA 1RQ0A 1FXRA 1B4SA 3BB5A 3VN5A 2VQFF 2CH6A 4CTAA 5BYRA 1FRKA 1X5SA 2KM8C 4KPYA 3FBBA 4LF5J 3M4XA 3LP2B 4BRCA 2B3TB 3TA2A 4EP4A 4O4GA 1YDLA 4QWBA 4MFBA 5GAHI 3MFIA 5ETTA 3IAYA 1LAVA 1X4BA 4NXNF 3RYLA 5HVFA 5KOXA 3A2FA 3DN9A 3J7AP 2V7ZA 1MROB 1X60A 4GKKJ 3GYGA 3VMFB 4P72A 8AT1B 1QVFR 1RSCA 5EN1A 4NLVA 4WP8A 1B92A 3MAAB 3HSCA 5LL6Z 1BGXT 1N5TA 2AQ4A 1ITPA 2ADBA 4CZJA 2GS8A 1F9HA 3QO9B 4DG1B 3ENWA 2YWEA 5AE2A 2IRUA 1UAWA 5DG9A 3MMCB 2J8SA 2OEKA 3NBPA 4PA1A 4BWMA 4Q0BA 1IR0A 2PN6A 2HNZB 4CZCA 4WZQA 4KFBB 3TSUA 4IFVB 1VQMN 3AA3A 3GONA 3VESA 3OTDA 3BKTA 2O01C 3U9ZA 3RBEA 4FJGA 3THWA 3HI0A 1TFYA 1HJRA 3BO4A 3BGFA 5EDWA 2C2NA 2HBMA 2RS2A 3IKMA 4NX9A 1F2HA 2Q0RA 2ZVSA 1HWKA 2GMHA 2GHVC 5EXWA 2KG1A 3Q8RB 1WELA 2HVDA 4LF7F 4Z7YA 3UCZP 4DS5A 4TU7A 4K0KJ 2R7QA 4Y2CA 3VQ8A 5E3RA 1PYOB 4QW8A 2HQGA 1RBLA 4AQYJ 3IBFB 2EWSA 4QW9A 1ILYA 1WB9A 1WC0A 2H1YA 4NZ0A 2CDRB 3HDSA 3H3NO 3CPWR 1V5VA 4OJHA 4LF5F 2NNWA 2H4YB 1JLCB 3JQKA 2IM2A 2R2SA 1RKIA 2V8DA 4QOTA 3F73A 5J2MB 5F8MA 4FLXA 3D1QA 5IXUA 3T1HJ 3EVMA 3UCUP 3MF5A 1NPKA 5L1LA 3WC2A 1X5PA 3I55S 3RB3A 1M5OC 1KVKA 4JK8A 1NBEB 4RTFD 2UVVA 2OPSB 1FERA 2NYIA 1NGHA 4QIWD 4CVNE 2QWLA 4R79A 4P9SA 3ETOA 1HLWA 5HQMA 2AJ4A 3B82A 1XC3A 2KHOA 2D0AA 5KFGA 3O3LA 1U09A 1RWWB 5AE3A 4ZLNA 2ZZMA 4M63C 3L0QA 3FGVA 4YOVA 2LFVA 2ADCA 2NRVA 2MQNA 2MEWA 2CGJA 4CEFA 4EAHD 4G6VB 4CYUA 2OYQA 1TV6A 4KHMA 4DPUA 5AQPA 4N56A 2Z56B 3ZSXA 1SJ1A 4CJSA 2E5LK 1FKAF 5DK5A 3SK3A 5JLFA 1PYSB 3CCLS 2ZBCA 4H4KC 4DUZF 5AQTA 5HANA 4ZKAA 1NPPA 2E5JA 4QOZB 1VK3A 1U1OA 3CCTA 2H5JB 4HUGA 4DL0C 3AO4A 4ED2A 1MMDA 3TOQA 1Q82T 2BRKA 1N33F 1VQ6N 3CJ3A 3QRRA 1Q9XA 2P5OA 1HNZJ 2CJQA 1NNDA 2PSZA 2ILZA 3P49B 1JLGA 2DKOB 5I3PA 3JSMA 5L8RC 3LGNA 3WEEB 2UUBJ 5DG7A 3EGZA 2N3LA 2PY5A 4BC2A 2C42A 5T7BA 1BE4A 4ES3A 3DLHA 4AM7A 1GOBA 4CO2A 4RW6B 3NF8A 2MSSA 3L3VA 4XTTA 2DNNA 4G9ZA 3TAGA 3FEXB 3H2VE 4E8UA 1S57A 1JL1A 4B9LA 1NHVA 2ZOFA 2HHHK 5JS1A 2IM1A 3IR7B 1GK8A 3UO0A 2KXFA 2FZGB 2MY8A 3TSPA 5JVHL 1U2VA 2ZUAA 1OY8A 2Z0GA 4LR9A 3D2EB 1UJ6A 3BS9A 4DV0J 1HIYA 3HJVA 1TKTA 2HNYA 2P9LB 3N5BA 2K7KA 5FPMA 1BWFO 1DLOB 3I5BA 5J2MA 4LY7A 1IV0A 2C3PA 2ZH8A 3QERA 2KO1A 4X4QA 1Q78A 1T05B 1NLKL 3NP5A 2HHHF 4IDHA 4MT1A 3NH0A 2VJVA 2AYEA 2YCHA 4I67A 2G2OA 4U7UK 3RGIA 4CZIA 5LJVA 3CCQS 3DI6A 1MWKA 3HFZB 1RTIB 3WX8A 2MQOA 4CJPA 3RRGA 1RT2B 1IXKA 3ZC4A 1G4CA 4IH6A 3A8YA 2FJXA 4NA2A 2PD1A 2V8VA 3AQPA 5GMDA 3CD5A 4PYAA 4L3KA 4OX9J 2MLXA 3D0PA 1FA0A 2UXDF 1M5KC 2FBVA 1TKZB 4HHTA 1YKWA 2ZNZA 4U7CA 4FZXC 1EHWA 2J6UA 1KS2A 2AIRB 4FLVA 4W5OA 1FXLA 5A8RB 3N6MA 3TTCA 3BYRA 5IWAK 3RMAA 2R42A 4JI1F 2OZMA 1IWGA 2ZDOA 3MM9B 3LP3A 4JS4A 4KHWA 4Z4HA 1KVJA 1LWFB 2D3O1 2IS3A 4MMOA 4GVEA 1CVJA 2QK9A 1KD1T 3IR6B 3SBTA 3WBZA 2JVRA 5F1XA 1TAUA 3AVAA 3M32A 2I5JA 4Z4IA 1Z2ZA 3EY1A 1N33K 2CZ9A 2Q36A 4CZFA 3KG1A 3D6FB 3W2WA 4FLZA 4DMNA 2W7AA 2CA9A 1PC4A 4KC5A 2XY8A 3DLEA 1JXEA 4EI2A 3ASMA 4UF4A 5EWEA 2R7UA 3OJUA 3J81U 4TLQA 2DHAA 5ETRA 1V6HA 4FXDA 3RAQA 3LGMA 3NCQA 4DR2F 3W63A 2P9NA 1OMSA 4IFEA 4A2AA 3KWIA 2RQKA 3KLFA 5HL7Q 5GINA 2WOMB 5F9LA 4TY9A 2PGCA 5IC6B 1CULB 3PNIA 4IOBA 4XEIA 5IC4B 1Z6RA 5DDOC 4DF4A 4DU4A 3VGSA 4FJXA 1NJZA 2YWGA 1IM6A 4JYAK 1JCFA 4DFKA 1SBRA 1O51A 3DOKB 3ILIA 3HBTA 3THXB 3IDHA 3RRKA