5J1EA

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
550
structure length
541
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 133
structure length 541
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j1eA05
1JLGB 1VSKA 5KRSA 2HHTA 4Q0BA 5HLFA 1JKHA 3NGIA 1NK6A 1LWCB 5KFSA 4ED0A 3QEVA 4F3OA 4H4OB 4Z4FA 4QW9A 1CXQA 4CJLA 1RCHA 4CF2A 5KFVA 3OSNA 5JS2A 3LZJA 3M8PA 5KT3A 4RW9B 5KFRA 4J9PA 2EX3A 4CE9A 3U3YA 4KKOA 1VSMA 1HYVA 3KLEB 3CWJA 4CJSA 1MU2A 3CDWA 2ZQBA 4ZP9A 1RILA 4DFPA 3FDSA 4CJUA 5DMRA 4FLTA 4CIEA 4CEAA 4CJ3A 1LW0A 4LSLB 3VQ6A 4FJKA 2YNGB 4CJRA 1C1BB 4IFVB 4Z4HA 1N6QA 5KG2A 1S6PB 3QO9B 4DLGA 2XO7A 3G0ZA 3TANA 1SL0A 1KFSA 1NJYA 4LH4A 1SH2A 1T03B 4DTMA 4QWBA 2UVUA 3THVA 2UUWA 2ATLA 1FKPA 5HRNA 3DRRB 4KRFA 2IM0A 2FVQA 3EYZA 1S9GA 4RW4B 4Z4GA 4ZPDA 4NYFA 4EBCA 3ZT4A 5I3UB 4TY9A 4N5SA 2FBTA 4IG3B 3KK2B 3SQ4A 4UQGA 3QNOA 2FVSA 1NKCA 2HNZB 3DOKB 4NLDA 4K50A 4FJLA 4XPEA 2W9CB 4DU3A 2V9WA 4GC7A 3QLHA 2QXFA 3ULDA 3QESA 3DM2B 1NK4A 5T7BA 1I3AA 2IM1A 2QE5A 3K57A 4DWIA 3KMQA 2FJWA 3MEEA 5HROA 4CJEA 1WSEA 3E01A 5EUHA 4N76A 3AA5X 3FRZA 4EYIB 4J9KA 3AVKA 1NK0A 4Q8EA 1Q9XA 3PV8A 3JSMB 1N56A 4IKFA 5FRNA 1WAFA 2C2RA 4ECUA 4ZVEA 1GOCA 3EY1A 4FVMA 3RMAA 2IAJA 4URSA 3BGRA 3DMJA 3OL9A 1RT5B 2YHAA 4PY5A 1LW2A 3DRPB 4I2PB 1LWEA 4R0EA 3SI6A 2RDIA 2JC1A 3DYAA 2XY6A 1FXXA 2RKIB 5J1EB 1EP4A 1JLGA 4OGEA 1RYSA 2YNFB 4DQPA 2HB5A 2CJQA 3SQ1A 1KCFA 2HMIB 2GIQA 3S3NA 3PJWA 3SUQA 3WNHA 3V4IB 3KLIB 3PUFA 1LWFB 1IO2A 4H4OA 1WSHA 4RW7B 3K59A 3PW5A 1FKOA 4C8LA 4E7KA 4BWJA 1GOBA 4E0DA 4AHRA 4EP5A 3LP0B 4FXDA 5I42B 4NRUA 4AHTA 4Y34A 1ZTWA 4CHQA 4DTPA 1NJWA 4J2BA 3KLEA 3OS0A 2FJXA 4ECSA 4IBNA 2B5JB 1HYSB 4B9VA 4LSLA 4IFYA 1I6JA 3T1AA 4U6PA 2BRLA 3CM5A 4IFVA 1S6PA 2PZSA 4ECXA 3HXMA 2G8KA 3SUOA 4J2DA 1T03A 1S9FA 3VQ8A 3ZSZA 2JGUA 4RG8A 4M3UA 3DRRA 2XI3A 4ECQA 4RW4A 1IG9A 1IKWA 3V1OA 5I3UA 4WE1A 1LV5A 3KK2A 3NE6A 2G8VA 4NYNA 3UQSA 1TKZB 5KG1A 4DU1A 1D9FA 2E9ZA 4YP3A 2QV6A 4FK0A 3QIDA 3BQ2A 4QWCA 2IMWP 4HVJA 4U7CA 5C24B 2F96A 1DTQA 1QQCA 3OYIA 3HVRA 3V6HA 3C6UB 4BDPA 4CEOA 4WFYA 3RMBA 3MEGB 5KFGA 4YR3A 2BANB 1SV5B 2GIRA 1WN7A 1BIZA 1TK0A 2YKNA 3TAPA 4B9NA 3KLHA 3MFHA 1S1WA 1N5YA 1S10A 3OYCA 3P1GA 3DLKA 3F73A 2AX1A 1HMVB 3IG1B 3KHRA 1RT6B 1RDCA 2R8KA 4O4RA 2R2TA 4KBIA 3DRPA 4I2PA 4DL7A 3LDSA 1ZTTA 3PO5A 3DI6B 3SQ2A 4NZ0A 3PY8A 1TL3A 3SPYA 1IH7A 4CHNA 4OL8A 3NH1A 1TV6B 4TSXA 4W5TA 4E7JA 1T94A 4B8AB 3CDEA 1WSFA 5C5JA 1UA1A 3TQ1A 2DFHA 4MQ3A 3AVLA 1C0UB 1BISA 1G15A 4KTWA 5DG8A 2XGQA 3DLEA 4LSNB 1TK8A 4RW7A 1RTDB 4DQIA 3D28A 4CGJA 3H5YA 1VSLA 3SZ2A 3CIZA 1D0EA 3OYBA 2FVRA 2FLNA 4M45A 1RT7B 4M3YA 1SUQA 3N6NA 3VN5A 4BE0A 1RA7A 4KV8A 4Q44A 1IKYA 2GUIA 1RBSA 3AVNA 4NLWA 3VQQA 4CGIA 4HTUA 3NF9A 3NL0A 4NLVA 5KFWA 1SH3A 1QSLA 2OPRB 3SYZA 5KG6A 3KLGB 3H5UA 4OKJA 3LP1A 3V9ZA 1ASUA 4CEBA 5CYMB 3M9NB 3O4NA 2UUTA 2XRIA 3NAEA 4CJPA 4ZPBA 4ZPAA 2HHXA 3QYYA 4M94A 4ZP8A 4M3RA 3IN5A 4DTSA 3HVAA 3CM6A 4IQXA 3OJSA 1Y97A 3SFGA 1B9FA 1FK9A 2OH2A 3NAIA 4ELTA 3IGNA 3G6VA 4F50A 4Z4EA 3MEGA 3QGIA 4DG1B 4CGHA 1TKTB 3DLBA 3C6TB 2NUBA 3CVKA 1JL2A 3HPGA 1RTJB 1JIHA 4IH7A 2HNDB 4ID1A 1UAXA 1ZETA 2ITGA 1JXBA 3QINA 2AWZA 4CFAA 3D45A 4OJRA 4MH8A 3ZSVA 1WSIA 2XY8A 1XHZA 3HP6A 2KFZA 2J6TA 5FDLA 3PHEA 3RAQA 3LP3A 2YNHB 3GIKA 2R2RA 1S0MA 2JEIA 3Q8PB 4ZTFA 4JV2A 1VSIA 1RTDA 5JXSA 1CZ9A 4AILC 1C0MA 4H8KA 4MK7A 4AH9A 5F8IA 2ASLA 4CEQA 3L3UA 1SKRA 3OS1A 2DPIA 3I0SB 4EYHB 5KFFA 4CJTA 5DG9A 2YKMB 3BQ0A 3HVTB 3NAHA 4ZVFA 2W7PA 4E7IA 2RF2A 4FLUA 2HNYB 4F4KA 5J2QB 1C2PA 3NBPA 4E89A 1JXLA 1TKDA 4J2AA 4CJ4A 2UVRA 3OJUA 4I7FB 4WFZA 3SUNA 4CK2A 1ZYQA 2OPRA 4B9LA 3ICLA 4CK3A 1WSGA 1RA6A 1T05B 4MK9A 4O3NA 4DSJA 5F8LA 4CCHA 2AX0A 3NH0A 2I5JA 4EZ9A 1CZBA 3NF8A 1ITGA 3RR8A 3BSNA 4CEFA 4Z4IA 2D3ZA 1BQNB 2ILZA 4AHSA 3K5OA 4URQU 1W9HA 4ECVA 5HRSA 2P1JA 1ZBUA 1JLAB 4CF9A 3MEDA 2A1SA 1J9AA 3JYTB 3NMAA 4CJWA 4LQ9A 3HKWA 4ECTA 4MFBB 2WONB 1XC9A 1NKBA 2J6UA 1W25A 2IGIA 3V6DA 3E51A 5KFEA 5KT7A 3AVCA 3LPUA 4DG1A 4TQRA 4WZQA 4BACA 5CYQA 3C6TA 2WTFA 1QE1A 4RW6B 5EWEA 1C0TA 4ZVGA 4EO6A 1RTJA 3WNFA 1N48A 1C1CB 3OL8A 4TQSA 1TKXA 4FJHA 5KFZA 4DSEA 4PQUB 4W5QA 1RBVA 1R0AB 3V81B 2YV0X 4KB7A 1QSYA 2IS3A 4F4XA 1KRPA 4QW8A 4B3OB 4R5PB 1NK8A 2XC9A 2OZSA 3BQ1A 2OYQA 2YNHA 1BIUA 2WRMA 4B08A 3OL7A 4TY8B 4NLGA 2ETJA 2BQ3A 3V6KA 3LP2A 3KLVA 3T5KA 3LANA 3MFIA 2IOCA 3H40A 4HCBA 4WXOA 2IA6A 4DTOA 4ICLA 3PO4A 2B6AA 2C22A 2VG6B 2IM2A 4CHPA 1NHVA 2OA8A 3OYAA 4MIBA 3RB0A 3L2UA 4H4MB 3QERA 2YKMA 4LD0A 5F9NA 3BSOA 5KFTA 3TI0A 2R8IA 1D8YA 3AVFA 4YR0A 5EWFA 3AO4A 1TL1B 3DLGA 3I5BA 1XHXA 2BQRA 2IM3A 4G1QB 1J5OB 4GMJB 1Q8IA 4GVMA 4TN2A 1XR6A 4RNOA 4CERA 4JRQA 1S6QB 3FQKA 3N6MA 2I1RA 4DTUA 4KPYA 4O3QA 1VSDA 4OKEA 2HVIA 4AHCA 1YT3A 2IC3B 4O55A 4LY7A 4QWEA 3PX0A 4MKAA 4KTZA 3OYNA 4CFBA 2BE2B 5F8GA 1HNIB 3KK3B 5SWMA 3EZ5A 5KFNA 3I0RA 2RDJA 1SL1A 3CDUA 1O1WA 3OYMA 3CG7A 3KLFB 3CFRA 3S3OA 4FJ7A 1TAQA 4KHSA 5F8MA 4KO0B 1CLQA 3AO2A 3PW2A 4DL6A 2DPJA 3O4QA 3IS9B 3SI8A 2VG5B 2WK4A 3AVBA 5KFOA 3CQ8A 4NLQA 1RT4A 3CJ0A 3U6FA 4ZTJA 1JLFA 4O4GB 1BHLA 5J2PB 3PX6A 4CK1A 1DLOB 4K8XA 2Z1HA 1GX6A 4RW6A 3VQEA 1W0HA 5DG7A 3GQCA 4AHVA 3RMCA 4RUCA 1K1QA 3H2LA 1K1SA 3PVXA 4YNQA 1L3VA 2FBYA 4F4ZA 1MMLA 1S0NA 1LWCA 4PQUA 1DTTB 3ITHB 1R0AA 2PYLA 2Z1IA 1RYRA 4IDKB 4JRPA 2EC0A 3RB4A 3L2QA 1KVAA 4B3OA 4R5PA 4RW9A 3FQLA 5KT6A 3K58A 4URGA 3G6XA 2D7SA 5SZTA 4J9NA 5KRTA 1RT1B 4FM2A 1RDDA 5KG7A 1S97A 1S4FA 2W9BB 4DFJA 3TWHA 2BR0A 2D0CA 2YNGA 3OYJA 5KFXA 4NCBA 3RRGA 2EHGA 1C1BA 1LAVA 3QO9A 1BQMB 4FLVA 3T5LA 1VRUB 2B43A 2VG7B 4RZRA 3AVAA 4ZHRB 1WSJA 3NGYA 1HARA 1TL1A 3BDPA 1T3NA 3MXJA 4FJGA 3H98A 3DOLB 1QAJA 4BDZA 1TGOA 1X9WA 1S1UB 2R8HA 3TAMB 3NHGA 4JV0A 4IG3A 4DTJA 4G1QA 1L3SA 4GC6A 3MTKA 3OYLA 2HNZA 3DOKA 4QCLA 3OYKA 5D3GB 1S49A 2W9CA 3ZT0A 1U45A 3HM9A 2XCPA 1JLCB 3DM2A 3CYMA 4FZZA 4N41A 3OYFA 1NOYA 4CEDA 2F8SA 2PYJA 1UWBB 2QKBA 4B9TA 2W8KA 2FBXA 3IAYA 2WHOA 1HNIA 3C95A 1RT3B 2YNIB 1HYZA 1S9EB 3ZSQA 4Y2CA 4C8OA 3CFOA 4K4TA 3MR5A 2RN2A 4IRCA 3JSMA 4FJ9A 2A1RA 2PY5A 2AU0A 3UIQA 4ED3A 4PUOB 3IS9A 1UA0A 4FLXA 1REVB 2VG5A 3KKSA 2FBVA 3UR0A 2O4GA 3L2VA 3BJYA 5J2PA 4WYWA 3HL8A 1RT5A 2F8EX 3QGHA 4WXWA 4ELVA 4ED1A 4OGCA 2FC0A 4DTRA 5KFDA 2QK9A 3G10A 4DLEA 2RKIA 5J1EA 5L1LA 3NGDA 2YNFA 2DFEA 5KFQA 2KZMA 2HMIA 2ILYA 4NLTA 4Z4CA 1IKXB 3V4IA 3H08A 3ITHA 3RB3A 5E41A 4KHWA 3KLIA 3AA4A 1LWFA 4KE5A 3LPTA 4DQRA 1S1VB 5L1JA 1QHTA 5EDWA 3CJ4A 1RT2B 4NYZA 3LP0A 5I42A 2W9AA 5KFIA 4NLSA 5DQHA 4YFUA 4KTQA 1JLEB 4E7LA 5KT4A 4J9QA 4NCGB 4EBEA 4IR1A 2G8FA 3DDKA 4WYLA 1BCMA 4DQSA 2B5JA 1HYSA 5JUMA 1Z26A 3AVMA 3OS2A 2OPSB 3G6YA 3V9XA 1HQUB 2E9TA 4CHYA 1BQMA 1VRTB 4WZMA 5CZ1A 4CHOA 5C25B 3TVKA 4FK4A 1YVUA 1VSJA 3OLBA 1CXUA 1B92A 4QAGA 3MXMA 4ZHRA 3SFUA 3KNAA 1GOAA 1BCOA 1VSFA 2DTUA 4TXSA 1XR5A 3OYEA 3TAMA 2XWYA 3CO9A 5KFAA 3B6OA 4CJFA 1TKZA 1KSPA 1RTIB 4IG0B 2D0AA 1RTHB 1IKVB 5D3GA 3ZSRA 3PX4A 4F8RA 3VA0A 4CECA 2G8UA 1KVBA 5C24A 3AVHA 4FJJA 1UWBA 3OHAA 3PR5B 3MECB 4NLYA 3PJXA 5J2NB 3C6UA 5KFPA 1EKEA 2RPIA 3LALA 3QNNA 1RT3A 3N6LA 2G8HA 4MK8A 1S9EA 2BGGA 3TAQA 3KTQA 2BANA 1SV5A 5J2MB 3NF6A 3VQ5A 2D0BA 3RR7A 1HNVB 4KHNA 3QGGA 2ALZA 1S1XB 1A5WA 1S0OA 4M95A 2XCAA 4XO0A 3TR8A 1TK5A 4DSKA 4R8UB 1HMVA 3IG1A 1RT6A 2KTQA 4KHQA 2W7OA 4O3RA 4IKAA 3DI6A 3ASMA 2OPQB 4ED8A 1L5UA 2C2EA 3AVIA 2IJFA 1X1PA 1KLMB 4ZVHA 3LAMA 1TV6A 4E1NA 4NLXA 1KTQA 1S5JA 3SV3A 5HLFB 3ZT1A 4F3TA 3Q8QB 1KHWA 1IKXA 1C0UA 3BREA 1WNSA 3V9SA 2HHVA 3QEIA 3DLHA 1ASVA 3NCIA 4LSNA 1ZBIA 4FJ8A 1NKEA 1QUVA 1RT2A 3B6PA 3NGZA 4KHMA 4FLYA 2XY7A 3O3HA 1RT7A 4N47A 3OY9A 3KMSA 4F2RA 1WNEA 5F9LA 1X9MA 2FJVA 4KKOB 1N4LA 3ZT3A 3AVJA 1RDRA 4DU4A 1MU2B 3SQ0A 2P5GA 3WNEA 5KFBA 4J9RA 1JXEA 1T8EA 1LW0B 4M41A 4RU9A 4BDYA 4RUAA 3AA3A 2HWHA 1N6QB 3C94A 2DFFA 3QZ7A 2KZZA 4JS4A 3KLGA 2R8JA 3H59A 5C25A 4RW8B 2AQ4A 3VQDA 2Y1JA 3H4BA 4CHZA 4B8CA 1NOZA 2BDPA 4QPXA 1L3TA 4I2QB 5CYMA 5F8JA 4J2EA 1S9GB 3Q8SB 3GIJA 4O3PA 1ZBFA 4OLAA 3OL6A 4CGDA 4B9SA 1JLBB 2ASDA 2E4LA 1RTIA 5C42B 2B4JA 3AVGA 3H5XA 2O5DA 1RTHA 4W5RA 1IKVA 4KI4A 4DSLA 3K5MA 4E1MA 4MKBA 5KFCA 4CEZA 3QLHB 2R2SA 2X74A 4ZPCA 4B9MA 4HUFA 2JLEA 4H54A 1YTAA 4DS5A 2JEFA 4TYBA 1NHUA 3RRHA 2R8GA 1D1UA 2D41A 1SKSA 3MF5A 5J2MA 4J9LA 4FM1A 3NF7A 1TKTA 3ZSWA 4X2BA 4KAZA 4DFMA 2P5OA 2GBZA 4FLWA 3L8BA 2J6SA 3V9WA 2IAJB 2GV9A 2HNDA 3O3GA 1B9DA 3PW0A 4KHRA 4FBUA 3DMJB 3K2PA 2FVPA 1LW2B 4J9SA 4O3OA 1LWEB 3QIOA 2OPQA 5HBMB 3U3GA 3PW4A 3P83D 4I9QA 4PWDB 3TABA 4NLPA 1KVCA 3GV8B 3M9MB 4IOBA 1UOCA 3AA2A 4BE2A 3UPFA 3D0PA 2HW3A 3G86A 1FKOB 2E9RX 3V9UA 1F21A 3WNGA 4DF4A 3I0SA 3FFIB 4DFKA 2VA3A 4DSFA 3HVTA 4CGFA 4OKKA 4IH5A 1BL3A 1U09A 3KD5E 2HNYA 5J2QA 3L2RA 5EU7A 3OLAA 2Z1GA 3I8DA 4KREA 2W42A 4IFYB 4Y2AA 4I7FA 2HVHA 1J54A 2P51A 4M3XA 2V4QA 4E3SA 4C8MA 3HVWA 1YVFA 4Z0UA 2AGQA 3NH2A 3DRSB 5KTQA 2D3UA 1T05A 1C1AA 4CIGA 4RW8A 3QEWA 3RBEA 5KFHA 2ATQA 3I5AA 1Q9YA 4Q43A 4I2QA 3AO1A 4KHUA 1IKWB 2KFNA 1BQNA 3VQSA 4F4WA 4WE1B 1NJZA 4KSEB 4NRTA 1JLBA 1NK7A 1QAIA 2ZD1B 3KK1B 5C42A 1C6VA 1JLAA 3KIOA 4ID5B 3VQAA 2OZMA 1HPZB 4W5OA 1U48A 3JYTA 4Y3CA 3V1QA 3HJFA 4RNNA 4DL4A 4EBDA 4FK2A 3IRXB 2AJQA 3NFAA 1DTQB 4MFBA 1U04A 4FCYA 3VA3A 2WONA 1QTMA 4YR2A 2V0NA 4K4WA 4HCCA 3OSPA 5K14B 2YKNB 3VQ9A 4NLOA 3HPOA 3KLHB 3LWLA 4NCAA 3QZ8A 3V6JA 1S1WB 3ZSOA 5DGBA 1J53A 1N5YB 3OYGA 3DLKB 4G3IA 1XWLA 1T7PA 2F8TA 2O4IA 1C1CA 1TQLA 5HRPA 4Y1CA 3GYNA 5KFUA 3V81A 3SJJA 2HHWA 5HBMA 1SH0A 2WB4A 2JC0A 4QOZB 4JV1A 1TL3B 4PWDA 2C2DA 2LSNA 1U4BA 4TLRA 1EX4A 5KFYA 1SKWA 3PW7A 3K5LA 4K4VA 1TP7A 5DLFA 3HK2A 4TY8A 3HHKA 4DL2A 3CFPA 2VWJA 4NLUA 3ZCMA 1JLQB 3DLEB 3GIIA 5EWGA 2VG6A 1HQEB 2E6MA 3H5SA 4IRKA 2X6SA 1NJXA 1SUQB 3Q8RB 4FZYA 4H4MA 4Y1DA 3T3FA 3FFIA 4KV8B 3AO3A 1IKYB 4E7HA 4C8NA 4FW1A 3TAFA 4PA1A 4KAIA 4N56A 2FLLA 4O0IA 5KGWA 3HPHA 4KB0A 5KFLA 4IH6A 3ALYA 4EZ6A 5KT2A 4F2SA 2HAIA 1I39A 5KFMA 5JS1A 3QEPA 4ECRA 4KI6A 1WAJA 3DRSA 4EP4A 1J5OA 4OLBA 5KGXA 3EPGA 1A5XA 3QETA 3LP1B 5T14A 1S6QA 4DTXA 3MR6A 5KG4A 4HYKA 3D5MA 4HUEA 1GX5A 1RAJA 3M9OB 2IC3A 3PZPA 4FLZA 3PR4A 4CF1A 3SPZA 4DS4A 2ZD1A 3KK1A 1NK5A 4KHYA 4FBTA 2BE2A 3S9HA 4XIUA 3KK3A 2BQUA 5L1IA 4ID5A 4K4SA 1ZBHA 1HPZA 4RNFA 4DEZA 4CJVA 3MXIA 3HYFA 3KLFA 4DSIA 3IRXA 2XGPA 4KO0A 2KQ2A 4NLRA 1FK9B 1ZBLA 3SV4A 4O44B 4CJKA 2AGOA 3HSTB 3FSIA 1EXQA 4ZP7A 4CFCA 3KOAA 3M8QB 1Z4UA 4O4GA 4ZMMA 3RWUA 2HWIA 5K14A 1DLOA 1VSEA 1Z25A 2AGPA 2JEJA 2XY5A 4B9UA 3RAXA 4EO8A 3GV7B 2JEGA 3TARA 4DMNA 4O3SA 2BRKA 2X78A 3OYDA 5HRRA 3ZT2A 3RBDA 5DQGA 4KFBB 4IRDA 3EZUA 3KHHA 2Y1IA 1VSHA 4I9LA 4HKQA 1U49A 4M3ZA 3SUPA 1DTTA 4O0JA 1RBRA 2XHBA 4K4YA 2YHBA 4IDKA 2ZE2B 3I5CA 1RBTA 4AHUA 2E6LA 3SCXA 4ECWA 2UVWA 3VQ7A 4CJ5A 2ZKUA 4DQQA 3RMDA 3QIPB 3KKRA 5FDLB 4DL3A 5L9XA 3HT3A 4FJMA 5KG0A 1JLQA 1RT1A 4MIAA 4GW6A 1S1TB 4CF0A 1TVRB 2W9BA 4KB1A 4K4ZA 2R2UA 1HJRA 3KJVB 1TAUA 4O5BA 3SNNA 1RBUA 3S3MA 4M42A 1HQEA 4JLHA 4OVLA 4FYDA 2XI2A 2OPPB 1VK0A 1BGXT 2ASJA 1L3UA 1VRUA 4IR9A 4ECZA 4Q5VA 2VG7A 2HHSA 2RF2B 5CY4A 3ISND 3KD1E 3NBPB 3DOLA 4FJ5A 1S1UA 1D9DA 3HO1A 3T19A 4EEYA 5FROA 2VWKA 3CJ5A 3UDLA 2I5JB 4E19A 4HUGA 1SL2A 4FJNA 3LZIA 2GC8A 4FS1A 1JLCA 4ED7A 3TAGA 1HRHA 2G8IA 1NNDA 2HHUA 1EETB 3KHLA 2W8LA 2KW4A 4CIFA 5CZ2A 4WFXA 2YNIA 3M8RA 3MEDB 3V1RA 3F9KA 4YQWA 2WOMB 3ZSYA 4O44A 4TYAA 5FRMA 5DGAA 4PUOA 4J9OA 3RB6A 3VQPA 4FM0A 1REVA 2R7YA 1QS4A 4ZP6A 5HP1B 3V6DB 3LWMA 3IGVA 1S48A 3M8QA 1K6YA 3HP9A 4FJXA 3VQ4A 4DTNA 1BI4B 4F4YA 3RTVA 2IDOA 3GILA 3H4DA 5CYQB 4C8KA 1QE1B 5KT5A 5F8NA 1C0TB 2CKWA 1LAWA 2Q3SA 2IBKA 4CESA 4KFBA 4CEEA 2DY4A 4Q0BB 4RNMA 5DLGA 1TKXB 1JKHB 3MAQA 5DK5A 4J9MA 4BE1A 1KFDA 3MR3A 3AO5A 3TAEA 3OVNA 4ELUA 2ZE2A 1JL1A 1S1VA 1ASWA 3MR2A 4Q8FA 4YMEA 3M8PB 5DQIA 5KFKA 4Q45A 4OPKA 3QIPA 2VA2A 1JX4A 3GIMA 1JLEA 3KHGA 3BSAA 4NCGA 1CSJA 1IM4A 3LP2B 4DF8A 3OYHA 1S1TA 3CJ3A 1YTUA 4RNHA 1XI1A 1TVRA 3BSCA 3T5HA 2WCXA 1X9SA 3L3VA 4ICLB 2B6AB 3KJVA 2FVCA 2OPSA 1HQUA 2OPPA 3QEXA 4K4XA 1VRTA 2FLPA 3P5JA 4FJIA 1QSSA 1WLJA 3EPIA 4ECYA 3GV5B 4CF8A 1KHVA 5KI6A 2UVVA 2C28A 1FKPB 2HHQA 2QKKA 4FZXC 1RDAA 3DLGB 1RNHA 3ISNC 3OHBA 1NK9A 1XR7A 1D5AA 4CGGA 3AV9A 3T5JA 3DLRA 1A5VA 3VQCA 3K5NA 4QWAA 4IG0A 3LAKA 4M3WA 5F8HA 2Z1JA 4XPCA 5KFJA 4CFDA 3NDKA 3A2FA 1EETA 4JUZA 2X6NA 4FW2A 3BR9A 4K8ZA 3MECA 5J2NA 4DL5A 3MEEB 4QWDA 4W5NA 3O3FA 5HROB 4L8RB 4JS5A 4CJQA 3E01B 4ED2A 3I0RB 2IJNA 3L2WA 1OS5A 4BWMA 3M8SA 1HNVA 3ZSXA 2G8WA 2WOMA 3CJ2A 4LQ3A 1S1XA 1RDBA 3VQBA 4OPJA 1U47A 4HHTA 2D5RA 4M3TA 5HP1A 5KG5A 4LH5A 1RT4B 4R8UA 2V4RA 4FS2A 5L1KA 1JLFB 1BI4A 1KLNA 3BGRB 3NKYA 5KG3A 4K4UA 3DYAB 4ED6A 1KLMA 1EP4B
chains in the Genus database with same CATH superfamily
4Q0BA 4A8OA 4O0NA 1JKHA 5AE2A 3VESA 1K9MT 1VC6A 3QEVA 4DDFA 2BACA 3GR1A 1CXQA 3FGVA 3MPVA 1RCHA 1X4FA 2IVPA 5KFVA 4TKTA 2YX6A 5KFRA 4J9PA 1XNRF 2EX3A 1NJIT 4FWRA 2MYFA 2LQJA 3KVGA 5ETMA 1HYVA 4RPFA 3WQPA 3KLEB 3CWJA 1D8ZA 4DOZA 2ZQBA 4ZJLA 4ZP9A 4DFPA 3FDSA 3AJ1A 2E5IA 5T7LA 4CJUA 2KB2A 1PCAA 4YOVA 3O9QA 3MDQA 1C1BB 4IFVB 3WHIA 1N8RT 1SCJB 4DLGA 1KFSA 4CO0A 1SL0A 1KXPA 1NJYA 4USKA 2ZFHA 4YOYA 2QYGA 3FCWA 1FKPA 1CBKA 1HUXA 4BR0A 4KRFA 2NRRA 2DXFA 2FVQA 2IM0A 1S9GA 2LP4A 3HM8A 3M30A 4NYFA 3CEDA 1IR0A 4N5SA 4DB3A 4IG3B 4KQZA 1J27A 2PI5A 3MAAA 2ZKTA 3MGJA 4DV3K 3HD1A 3FGUA 1NKCA 3DOKB 2W9CB 4LSZB 1GLJO 4Z2XA 3PIPL 5D78A 3DM2B 2MQLA 1PGZA 1HLWA 5T7BA 4E8UA 1N32F 4AD6A 1M90O 4DWIA 4X66F 3KMQA 3LDQA 4CJEA 2RJZA 1WSEA 3E01A 5EUHA 3ILIA 1VQ5N 4N76A 3NS7B 3AA5X 3LUYA 4CLLA 4JD2B 4QU6A 5FRNA 4A2BA 1WAFA 3H2UB 4ZVEA 1GOCA 2WVDA 3N4WA 3J81U 2R7TA 4M63C 2W41A 3RMAA 4URSA 3D7EO 5AQQA 3DMJA 1J5EJ 1RT5B 4PY5A 3DRPB 1KQSR 1N32K 2V2ZA 5IC4B 1SJFA 7AT1B 1LEOA 3SQGB 1FXXA 1EP4A 5JMVA 4LFBK 1YJRA 3VAIA 4ZKAA 4LBIA 4DR1K 2VZ9A 4LVNP 3PUFA 1LWFB 2CGKA 4Y6IA 4OI4A 3O1LA 3FEXB 2PMHA 4AHRA 1UFKA 3LP0B 4AHTA 2XSJA 4CHQA 1ZZNA 2QA4N 3P6YC 1NJWA 4DTPA 2FJXA 4ILLA 4IBNA 3SSRA 2XULA 2GGPB 2LVWA 3EE9A 1S6PA 1K8AT 1PBAA 2CDRB 4ECXA 2G8KA 4A2AA 2J7KA 2K06A 2WVEA 3Q7CA 1S9FA 1VDHA 2Q43A 4AYBD 1NPPA 4JI6J 4M3UA 2RSQA 5AJ3F 4C0HA 4ECQA 2JFDA 2WW8A 5B0GA 4B3RJ 3T9ZA 4F0MA 3UQSA 1TKZB 5KG1A 5AQXA 3JAMU 2E9ZA 4YP3A 1UFLA 2QV6A 5AQKA 4USVA 4WIQA 2IMWP 4ZPWR 3QJJA 1V9OA 4U7CA 5C24B 2F96A 1FXRA 3OTDA 3GSIA 3V6HA 2YWEA 2DNGA 4RU2A 4BDPA 1YUWA 3LF0A 5AJ3K 3RMBA 1U0HB 3CCRN 1WD6A 1SV5B 2MB0B 2GIRA 4USWA 5U47A 3WXMB 1TK0A 2CVEA 1BIZA 4I6YA 4B9NA 3G8TA 1E6YA 1U6BA 3CD7A 4AL7A 1UAWA 3OYCA 3CC2N 5BR9A 2YHWA 3J81Y 1HBUB 3DDNA 3IG1B 1RLDA 5KPRA 4W92B 4O4RA 2R2TA 2PI4A 1PC5A 5HANA 5LY3A 4IJAA 1HBOB 7FDRA 2GMLA 4NZ0A 1OH6A 5F3TA 3SPYA 4OYWA 4U7UK 3NH1A 3B8HA 4W5TA 4C1NI 3CDEA 2QL9B 5C5JA 4EHTA 2JFKA 2DFHA 1N5QA 4UW2A 1FO1A 1JXVA 1G15A 1T11A 3U1MA 3MCOA 1XMOJ 1VBYA 4GKKF 3TX8A 3SZ2A 1VBXA 4P52A 2KHOA 4M3YA 3I87A 4ZDNA 1OSDA 3OBIA 1Z2ZA 1RA7A 4BR7A 1MG7A 3UN5A 2DNMA 3L95X 4NA3A 3E1YA 3VQQA 4HTUA 3NL0A 3D4JA 4RWWA 2FJBB 4NLVA 3NOCA 1UWAA 2HFSA 4JKHA 3W2WA 5KG6A 1IM6A 4JI7F 3H5UA 1K9MO 4X62F 4JHDA 1B7YB 4A8XA 2CDQA 4OZ0A 1BDGA 3OFEA 2QWNA 4M5DA 1F9EB 3EVOA 4CBUA 1NJIO 1BUPA 1GQEA 4ZPAA 2YKQA 4M94A 5H9EK 4ZP8A 4M3RA 1X4CA 1WC5A 2M3DA 4CLTA 1WELA 3MMJA 4CZCA 2Q3PA 2CQHA 4ELTA 4RJVA 1N8RO 3OPKA 4X62K 1U2FA 1PKUA 3D9BA 4KYZA 3C6AA 3AD7C 1NGCA 4F50A 1NU4A 1HKAA 1S79A 2AD9A 1EJ7L 5AE3A 1N33J 2YH1A 1TKTB 4ES2A 3M6GA 3C6TB 3QGPA 1HKBA 2X1AA 2DGSA 4DX7A 4JI0J 3DKDA 1JIHA 1FE4A 4QS9A 4A47A 3K9KA 4BRNA 1UAXA 1BO5O 3D68A 1ZETA 3ILLA 1JXBA 1NGAA 4BRGA 4CFAA 1KONA 1YJNN 3MMCA 3UKRB 2XY8A 1Y3JA 2KFZA 2YBVA 5FDLA 3EZOA 2YNHB 4L74A 1GH8A 2DNRA 4JK7A 4ZVPB 5JXSA 3X1LB 1C0MA 3RW6A 4MK7A 1UW9A 2UV8G 5F8IA 2NRXA 1NDLA 3CCSS 1JQGA 2ZC4A 5A8RA 2YKMB 4PG6A 2FGOA 3BV8A 4E7IA 3EO3A 4F4KA 4JI1J 3IWXA 1QJHA 2ZBPA 4I7FB 1JK9B 4U7UD 1U6FA 3Q2SC 3W3DA 2OPRA 1GFWB 4LF9J 4O3NA 2AX0A 1YZ6A 2C3YA 2BTFA 2I5JA 2IDEA 3DWLA 3RR8A 1ITGA 4WK1A 3FZHA 3BSNA 5CHCB 3QFWA 1JNZB 4Z4IA 1BQNB 1N88A 4YEAA 1W9HA 1UZHA 4CF9A 1NLKL 3KJFB 5D4NA 4WF9L 1J9AA 1ATSA 4OX7A 5FIIA 1XMQJ 2WSCC 3JSRA 4ECTA 1K8AO 6AT1B 1PILA 2ZGZA 3V6DA 5J1NA 3VAKA 3AVCA 1LQ9A 1RU1A 4DG1A 2L9DA 4TQRA 4QU7A 4BACA 5CZXA 2QO3A 4WKYA 2ZH7A 2DIVA 2PT0A 3MN6A 3WNFA 1GLLO 4TQSA 1TKXA 3CDBA 1H73A 3TZXA 4W5QA 3V81B 4WFNQ 4KB7A 3GBTA 1QSYA 4F4XA 2QSFA 4QW8A 3ZTQA 3W64A 2XC9A 5AQFA 3UE5A 3VQTA 1KP6A 3BQ1A 3A5MC 2OYQA 4B08A 2BZ2A 3BZKA 2BM0A 3LP2A 5ADXH 3MFIA 1WOOA 2IOCA 4HCBA 3PO4A 3P8BB 3CPEA 2VG6B 2PFDA 1MWKA 4GV9A 1HBNB 3LPYA 3L2UA 4ZVUB 2QLWA 4H4MB 2RD5C 1JCEA 3BSOA 4DU8A 5C2CA 1D8YA 4NASA 1AXQA 2NYHA 4YUDA 1FDNA 3R5CA 1TL1B 4OJ3A 1CC8A 1TL7A 2BQRA 5IZHA 2V6AA 2PEBA 2FF6A 5LXRA 3KUHA 1S4EA 2JH3A 1J5EK 4FPBA 1VISA 1HLUA 2I1RA 2V50A 2OLWA 4O3QA 1VSDA 4AHCA 4I6MB 1YT3A 2KXHA 1VQ7N 5IOLA 4LY7A 2QJ3A 4RO0A 4MKAA 4KTZA 4CTAA 4CFBA 1HNIB 4LF5J 4AL6A 1SL1A 3CDUA 1O1WA 3MZIA 1ZAWA 2PEHA 3KLFB 2E1MC 3CFRA 4FJ7A 2Z8QA 3US5A 3AO2A 5DJBA 4JI6F 1FTRA 3IS9B 2WK4A 2DD8S 2RB7A 5KFOA 3CQ8A 1RT4A 3U6FA 3QFHA 1JLFA 4XH1A 3PX6A 4CK1A 4ZN3A 1GX6A 3OXGA 3L7UA 2G1HA 3VQEA 1W0HA 5M2PA 3ZNUA 2DNOA 1K1QA 3ZZZA 1X4HA 3CIMA 2NRTA 4BR4A 2QL7B 4RLEA 2FBYA 3C65A 1S0NA 2FHKA 1YHQN 1DTTB 3ITHB 1R0AA 3VEWA 4JI6K 1XNQJ 1AZSA 2KFYA 1PAUB 3THXB 3AXKA 5E2QA 2EC0A 3RB4A 5GMKa 1Q7YT 4JI4J 2G13A 4C1NK 4B3RK 2VU5A 4ZK7M 3FQLA 5KT6A 5MLCQ 3VAJA 2KRBA 1SJ3P 3R5JB 1EQ0A 3OVAA 3ZLJA 3JSBA 3P4UB 2CG4A 3CJCA 1S97A 5A8KA 2VODA 4CDIA 2EFPA 4IUFA 1C1BA 3HI0A 3J7A1 2EWSA 5AQUA 4RZRA 2HBJA 1Z05A 4PZVA 2CGLA 3MM9A 3SCKE 4DPOA 1T3NA 1TGOA 4JP8A 1S1UB 4QIGA 4IG3A 3MTKA 1W97L 4A61A 3OYLA 3DOKA 4JI5F 5KPTA 3OYKA 1U45A 1S49A 1DJ0A 2W9CA 3M8YA 1VFJA 3CSKA 1YBAA 3VHQA 3DM2A 2EVZA 1I94J 5F2RA 1VQ7S 4J7CA 5DM6Q 2V5HG 2QKBA 1X3NA 3PKMA 2FBXA 1IUJA 2WHOA 4CT9A 3C95A 1RT3B 2YNIB 2XZDB 4CO2A 1XMOK 4JD2A 4YY3J 2V2VA 2E5JA 2AU0A 2WFBA 2QM1A 3DOMB 2VYPA 2P9SB 1WBBA 3KKSA 2VPWB 5ETPA 1UEKA 1RT5A 2F8EX 2OEMA 3QGHA 4UUXA 1RHMB 3CQXA 4OGCA 2LU2A 3HT0A 3R5AA 5KFDA 3SQGA 1WF1A 3SIPB 2B8PA 4FXWA 3SEOA 3U8XA 1B0PA 2QFIA 2H51B 4KHWA 3MURP 1LWFA 1RI7A 5AQRA 1K8KB 4KE5A 4DQRA 1S1VB 2F9WA 3SAFA 3FMBA 1N33F 2ZWHA 4YORA 5ETLA 1YVNA 3A8IA 1RT2B 3CD6N 4NYZA 3LP0A 2B9EA 2W9AA 2KYXA 4NLSA 3TJAA 2G0JA 5DQHA 4KIAA 4KTQA 5KT4A 4HTLA 3SAHA 1OYEA 2HOEA 2G8FA 3DDKA 1BCMA 1Z26A 2GGPA 3R7SB 2G9OA 1HQUB 4B02A 3OR2B 3OTEA 4CHOA 1FX4A 1RWMB 3TVKA 4FK4A 4L76A 3MXMA 5HAOA 4ZHRA 1N33K 4UZCA 1VR6A 5AQWA 5A2QU 3K0JA 4MDBA 3OYEA 2D1CA 3TAMA 4JI0K 2C1EB 2H5EA 3R1LA 4ILMA 3BGOP 1H2VZ 1TKZA 4WJBA 1KSPA 3LH2S 3OQ2A 1E3MA 1RTHB 3PX4A 5D3GA 3HFKA 5CR4A 1H38A 5C24A 3AVHA 1UWBA 4F26A 4NLYA 4M5JA 4ETZA 1TZ0A 5KFPA 2QZ8A 3D6MB 3A13A 1Q53A 1HD0A 4JI2F 3N6LA 4MK8A 4IEIA 3TAQA 3KTQA 1U0HA 4CYUB 4LF9F 1SV5A 2CNLB 4IJNA 2LQBA 2ALZA 2MJUA 1HQ2A 1S1XB 1SPBP 4M95A 2XCAA 1TK5A 2C2KB 2AKWB 1G7CB 1HBUA 3IG1A 4KHQA 2W7OA 5B0AA 1HBOA 2DHXA 5C2GA 1X4DA 3ASMA 4JI1K 3WZ0A 3JTOA 2G1DA 2IJFA 4FWMA 1KLMB 1LOTB 1EX8A 3LAMA 2Y9HA 2GJ2A 4NLXA 3IWNC 4LF9K 2C2NA 3SV3A 1ZBSA 1WEZA 4F3TA 1CG2A 1YJ7A 1IKXA 3BREA 3V9SA 1G3OA 1ASVA 4CLPA 1CJKB 2O8DB 3THWA 2R7WA 2MQPA 4DR5J 3CJBA 3O3HA 3OV7A 1F9FA 3OY9A 1YAGA 2WVCA 4Q2LA 3MM5B 2CA9A 1LXJA 1S76D 4KKOB 3AVJA 1IJFB 2VBXA 3IMXA 1MU2B 2DRAA 1HX1A 1VIXA 4LF6J 5KFBA 3S7RA 1WKLA 1XMQK 5ETQA 4AXJA 3C15B 3N4QA 1JXEA 1T8EA 1LW0B 2F8HA 4NOHA 4CLKA 1NMNA 1N6QB 2BKNA 3C94A 3DXBA 3QMQA 4BRAA 4P6QA 2X51A 2AQ4A 2AV5A 4BGAA 1WTFA 2HIQA 4CHZA 2BDPA 1Q7YO 2BVZA 1U1QA 4ITSA 5AE1A 3OL6A 4CGDA 4B9SA 1JLBB 2DR9A 1QZ6A 3AVGA 3DXKA 2RDDA 1IKVA 4WU2A 1B0TA 1RBLA 4DSLA 4KI4A 2ZF5O 4MKBA 5KFCA 3S01A 4OJHA 2R2SA 4G6VB 5GMEA 2X74A 4DUTA 2OAUA 3GFHA 1QVGM 4X4VA 1YTAA 2PA3A 2V8PA 4TYBA 3E8OA 2KL8A 1RWOB 3L4IA 4J9VA 3CE8A 1D1UA 1SKSA 1HHQA 4ZN1A 1TKTA 2KXFA 4ZIWA 1SIWB 1S7HA 1X5SA 1K0TA 1ELOA 3AT1B 3GR0A 2DGTA 2UXBJ 1FRIA 1YRTA 3CCMN 3DU5A 2KRRA 1B9DA 2NSCA 2U2FA 2BJ8A 1BWEA 4MT1A 1LWEB 3QIOA 1KR4A 5HMWA 4X4OA 3H46O 3PW4A 4NMXA 1LKZA 3DXMA 2GNKA 1HWJA 2FZCB 3PFOA 1IBKF 4MKVA 4CLYA 4WP3A 4FP9A 1QY7A 2IFXA 2XNQA 4ILJA 1VS3A 1VQMN 4CZLA 2YTCA 3HZ6A 2HW3A 3UPFA 1BMQB 3CTRA 2HFOA 3SCJE 4LF5K 5M1QA 1NM2A 2E7VA 4IH5A 1U09A 3Q89A 5EU7A 3I8DA 4Y0WA 4I7FA 3VOVA 4M3XA 1KDNA 2PAVA 1NH7A 1HWIA 5KTQA 1NB2A 1KAYA 2NZ4A 4USTA 5KFHA 3AHPA 2ZJRL 4Q43A 4I2QA 4BC5A 3VPZA 2DNLA 3BKUA 1BQNA 2B4VA 1SI9A 4WE1B 5L39A 2J7UA 2ATCB 3KK1B 1SS6A 5C42A 3FCVA 3DGPB 1XNQK 4NYPA 3IRXB 3OFHA 4UY8T 4JI4K 4GMKA 2PO4A 2DRDA 4HH1A 5HQMA 4DR6F 1KKHA 3T1HF 2RHSB 3R3TA 3C16B 1SVDA 2CJBA 3CJ8A 3B54A 3AQOA 4QIEA 2E1RA 1ATRA 3R1XA 2C2MB 2K3KA 1NRKA 2VF3A 3ENQA 3LGNA 3I32A 3ZSOA 1R3NA 1N5YB 1DARA 4LF8F 2HURA 9ATCB 1I94F 1T7PA 4AL5A 2GEMA 3CMEN 1P8ZA 1RWVB 1RWPB 3M7VA 1M5VC 3G71N 3GYNA 5D77A 1IBMJ 4PL8A 2GV1A 5C2DA 2DNKA 4A62A 3V81A 3U1NA 3RU0A 3W5XA 1ZM3A 5F41A 4QOZB 1TL3B 4PWDA 2C2DA 4Z7YA 4ETXA 4C0OC 3NNCA 3VTIA 2RUGA 1GMWD 3PW7A 2ZZNA 3PXGa 1WDDA 1GLBG 2VWJA 3ZCMA 3R3LA 3G4SS 1VQMS 5CCMA 5FLXO 3SMPA 3N28A 1FRKA 3KZBA 1I94K 2XMKA 2VG6A 3MMBA 2DK2A 3ZZOA 4CH1A 2E6MA 2YH0A 1HBNA 2AEMA 4BC9A 1NJXA 4H4MA 4P7TA 3T3FA 4KV8B 2GMHA 3AH6A 4O0IA 3FKBA 5AQSA 1YJUA 2UXDJ 3U9DA 3DN9A 5KFLA 2R7QA 3EICA 4F2SA 4KI6A 3DRSA 1HHTP 3RSEB 4OLBA 3N0VA 1E4GT 5KGXA 1JCGA 3LP1B 3LO3A 4DTXA 3MR6A 5D4OA 2UUCJ 3CJSA 3GONA 4WF9Q 4HUEA 3MK6A 4FLZA 3PR4A 5AXNA 3CGIA 4DS4A 2ZD1A 5AFUH 2ZDOA 3S9HA 4GVLA 4ID5A 1D09B 1ZBHA 1HPZA 4DEZA 3EX7B 4ZJQA 1VGYA 3KLFA 2QIFA 2EFVA 2XGPA 2Z56B 4HVZA 4H5WA 1F5BA 5JVHQ 4CJKA 2AGOA 3HSTB 1EXQA 2FPHX 4ZPVR 2YWFA 3KOAA 4F3MA 3FR0A 4JKFA 3QT7A 2JL9A 2JEJA 1DKGD 3PRVA 2HBLA 3RAXA 3CETA 3MX2A 3QBWA 2VUGA 2QC3A 4U67L 4YB1P 3O9UA 3RBDA 5DQGA 1U2CA 3EZUA 4OHYA 2AZ1A 3A0IX 3WC0A 1RLCL 3HHLC 1DTTA 4LR7A 3EMTA 2B9YA 4K42A 4K4YA 3Q23A 3THXA 2B4PA 1U25A 4AHUA 2KYZA 2RU3A 4CI6A 1A0OB 3OVBA 1YTYA 3C3LA 3BYPA 1Q8KA 3ULEB 1FKAF 3VQ7A 2ZKUA 4DQQA 5A6WA 2VC1A 4RBTA 2F40A 5KG0A 5FLXU 3E3XA 2HKEA 4B1XB 4HT5A 3MXHP 2F9TA 1ZAVA 2GUPA 4M42A 4FYDA 4JLHA 2Q1LA 1VQKN 1BGXT 5C2FA 4IR9A 5ITHA 2RF2B 1ZA1B 2DO0A 5HJXA 4PG8A 3O44A 1TYQA 3F2KA 4ZVRB 2IVMA 1S1UA 5A8WA 3HO1A 4EEYA 3GJRB 3W5YA 4WP9A 2VKZG 3NEKA 3AB2B 4E19A 1SL2A 4HUGA 3LZIA 3WXKA 3MCAB 2O8CA 1RU2A 2LQ9A 4FS1A 4ED7A 3TAGA 1HRHA 3ZEUB 3GL1A 4LF6F 3HF5A 4WKRA 4V19S 4DR4J 1EIYB 4HHHA 4A5AA 2YNIA 4PRFA 4WTYA 3QB0A 2RRBA 2PBDA 1WHWA 4QS7A 4DR5K 3F9KA 4YQWA 3ZSYA 2H54B 2HQCA 3RB6A 2EFOA 2HFUA 4IXCA 4EI2A 4B1VA 4ZP6A 3DOMA 2P9SA 3HP9A 3ELHA 3M32B 5K20B 4DPYA 3KG4A 4KH5A 1U8SA 4DTNA 2NPIA 1GLCG 1R43A 2D3O1 4LF6K 4OZNA 3THPA 5KT5A 4A8YA 1X0PA 2NCKL 3ATVA 1LAWA 3CMQA 4KFBA 3CB4A 3VGMA 2V8GA 3MR3A 5CH7B 3G6ES 1K8KA 2ZE2A 2GVDB 1S1VA 2VC0A 4UY8O 3EL2A 2X3GA 3R2CJ 4Q45A 5CD4A 1JX4A 2Z4PA 4DX6A 5T41A 1YQHA 1IM4A 1FXLA 2DIUA 5FLXY 2ADCA 3CJ3A 3CCVS 2E88A 4RNHA 3T5HA 3KJVA 2H5IB 3TUJC 3VETA 3VERA 3FZKA 1HQUA 1UMJA 4K4XA 2FLPA 3OR2A 2B7BB 1QSSA 1P27B 1KQFB 4JI3J 3EPIA 1TUUA 3K8VA 4ECYA 3OXFA 1XERA 5LL6Z 3EE3A 2CFXA 1TUVA 1NK9A 3WX8A 2LQ5A 2QFJA 3T5JA 2UXBK 1M5OC 1F3FA 1R6YA 3K5NA 4AQYJ 4NXMF 2ZZMA 1MMDA 1PC4A 4X4UA 1FRHA 1X0FA 5JJBA 3BO3A 2GFFA 2L48A 1D4XA 1EETA 5ETVA 2X6NA 2FDNA 3BKTA 4DL5A 3Q8YA 4QWDA 4O8KA 5HROB 3QFPA 1Q79A 2HFZA 2Z2ZA 2CUYA 2BX6A 4CYUA 4ANDA 2Z2YB 5SUHA 3SBGA 2BKOA 3M8SA 1KAXA 3HFVA 2VIHA 1WC6A 2WOMA 2KHDA 4LQ3A 3CJ2A 1S1XA 3VMFB 2JJ4D 2NXUA 3OHRA 3ZTSA 1ATNA 1FDBA 2D5RA 4M3TA 3CMAS 1VQLS 1D9AA 4LRFA 4FS2A 5L1KA 3FLCO 2JWKA 1BI4A 4FYYB 3BGRB 4OYXA 2B9XA 3NKYA 5E0OA 4ILRA 1W2BR 1BG3A 5BPNA 1U1KA 1KLMA 4B1ZA 1JLGB 1O6XA 2DXEA 2HGLA 3SBMA 5KRSA 2GAGC 2HHTA 1LWCB 4DZ6A 2DHAA 2ZOFA 1CJKA 3AB4B 2O8FB 2WVFA 3OSNA 5IWAF 4RW9B 1QQNA 1HBMB 4AT1B 3MM5A 5ETSA 4AE5A 1Z2LA 4KKOA 3U3YA 2L3MA 3R7NB 1I5OB 4YOEA 4CJSA 1MU2A 2LXFA 3CDWA 1EO1A 3O2IA 4OX8A 3K9JA 4IOXA 1IBMF 4RTFD 1CJTA 4FLTA 4CJ3A 1LW0A 4FYXB 5IQ6A 2I2YA 2NXNA 2A1BA 1N6QA 1W26A 3TUIC 3CO0P 3TANA 4FPRA 1UCNA 3EXYA 3HULA 2P9KB 2UVUA 3THVA 2FJEB 5HRNA 3P5BP 3EYZA 3UKUA 2FXUA 4M1KA 4EBCA 1PJ7A 4K0KJ 2BUPA 1RBAA 2FBTA 3KK2B 3OBWA 3QNOA 5BPLA 2JLFA 1IBMK 4FJLA 1PJ5A 4XPEA 4DU3A 2A5XA 1TELA 2DGUA 1YX2A 1Q81T 3ULDA 3QESA 4GV3A 3OT9A 1NK4A 1KBRA 2IM1A 2HBRB 2QE5A 3K57A 2UXDF 2FJWA 3MEEA 1F60B 2AYGA 1CJUB 2LEPA 1X4GA 2QRRA 3H1QA 4NXNF 4EYIB 4J9KA 4DV7F 5EOYA 1OIAA 1DQAA 2I9SA 1Q9XA 3JSMB 1N56A 3PKYA 3BF3A 2XZTB 1S0VA 4FVMA 4M8LA 3IC1A 5C0YA 4DCOB 3I31A 2PIIA 4I2PB 1LWEA 4R0EA 5M2RA 2UXDK 3SI6A 1SC4B 2RKIB 1FERA 1UVNA 2QA1A 1VLYA 2YNFB 3IKMA 3N4PA 5B08A 3SQ1A 1KCFA 1YJVA 2FSNA 1OH5A 2VOPA 2MMYA 1DT9A 2QWLA 1WG4A 1IO2A 4H4OA 3JTPA 1WSHA 3K59A 2UUCK 1T6CA 3PW5A 4C8LA 2HS0A 3U4LA 2L9NA 4FXDA 5I42B 3UW1A 2PMZD 4Y34A 1Y0HA 4IQMA 4J2BA 4M5KA 3BPDA 4M7XA 2N4DA 1HYSB 4LSLA 2MKYA 2PZSA 2FUG9 4JKBA 1T03A 3ZSZA 4RG8A 3W66A 3CCUN 2QMWA 3NVMA 3DRRA 1TL5A 4U96A 2UUAF 4RW4A 2RE2A 2I38A 1IG9A 1YBUA 2P9PB 2YCHA 3DU6A 3W9HA 3V1OA 5I3UA 3ENHA 4WE1A 2J9EA 1LV5A 1HPMA 3NE6A 3ZX0A 2F63A 5D15A 1UW4A 5E3RA 4CNYA 4Q2MA 2E5LJ 5GAGU 3EGVA 1YJ9S 3NGKA 3CT9A 3OYIA 2YHYA 3PFEA 4FZVA 4WFYA 5KFGA 2H9ZA 3UN2A 2QSWA 3C16A 3OR1B 1CC7A 2N4CA 3TAPA 4CO3A 1KOOA 3W1YC 3MFHA 3BZCA 2W6LA 1N5YA 2NUHA 2ZH1A 3F73A 5EX0A 1RDCA 3WX4A 1XBWA 4DL7A 3AD8C 1ZTTA 4DV5J 2F4FA 5I3QA 1R6VA 1TL3A 4CHNA 1WOSA 2GWJA 1T94A 1UA1A 2NR0A 3TQ1A 4C11A 1FEHA 2ZNYA 1QHAA 4IWVA 2XGQA 1TK8A 4RW7A 3GIRA 1LFWA 4CGJA 4LFAJ 1YF5L 1VSLA 3CIZA 4K5SA 3TYTA 1F5AA 1SJQA 2FVRA 2DEJA 4YDUA 4M45A 5GADI 1QVFM 4DR4K 3N6NA 1CPZA 2RHQB 3KDNA 4BE0A 4Q44A 4KV8A 1VQ4S 3JQJA 2K3IA 3G9CA 1TMMA 1T9VA 3AVNA 1NGIA 2CRLA 2YHXA 4EU0A 3MMAB 1ROFA 1BQXA 1B0VA 2ZVIA 1QSLA 2LFVA 3PG9A 2DR5A 3KG1A 3RSEA 2MLZA 3VAFA 4H0OA 5GIOA 2ZUGA 3LP1A 3QAEA 1ASUA 1U0SA 4CEBA 5CYMB 3M9NB 4M7YA 4RUHA 1UP1A 5K8MA 3IDHA 4BLGA 2XRIA 1KD1T 4CJPA 4ZPBA 3QYYA 2AYMA 2ZJQL 2HQDA 4JI3F 3CM6A 5HN0A 3SFGA 1VQPS 2OH2A 1KQKA 4JOUA 2VGNA 1NHKL 2EWHA 2YWWA 1QLNA 3IGNA 3FNNA 2CQBA 3MEGA 2SXLA 3QGIA 1WHYA 1O51A 3M4XA 1EKRA 4CGHA 2I7NA 2VWBA 2MZSA 3HPGA 2CWKA 2DCUB 4FYVB 4P10A 4UY85 1GK8A 3M6XA 4JI3K 4IH7A 4OI2A 2E66A 2WBRA 1OY9A 1G6BA 4P72A 1NCLA 3QINA 4OZJA 3D45A 4OJRA 3ZSVA 5AQHA 4OLOA 1WSIA 2F3JA 3HZEA 3LM9A 3HP6A 3PHEA 1QD1A 4NEZA 4AQYK 2VPXB 4A48A 4B3TF 4TU9A 1S0MA 3QRPA 1FT8A 1RTDA 2A3ZA 3VVTA 3P38A 4AILC 2QEXS 4AH9A 2VONA 4CEQA 1GTEA 1SKRA 1MWZA 2ASOA 2ZM6J 5LMUJ 4CJTA 5DG9A 2FJDB 3HVTB 3NAHA 1TFYA 4ZVFA 3DJCA 2W7PA 2NNWA 2RF2A 2HNYB 3HTVA 3PEJA 4J2AA 4CJ4A 2UVRA 3WQUA 3D2EB 4OZLA 2JDJA 2XLKA 2NRWA 3ICLA 4NLBA 2RQ4A 4MK9A 3KG0A 5DRKA 3BEXA 1G1XA 5TKWA 1CZBA 1ILYA 3RBZA 2FHJA 5BR8F 1IBLJ 3O9TA 2KKZA 4GVEA 3ZEUA 4WFBQ 1WI8A 2D3ZA 2RVJA 3K89A 3MMVA 2VV5A 3K5OA 4URQU 4ECVA 2P1JA 1JLAB 4U8YA 4B3SF 1HWKA 3J7AP 3HOTA 3JYTB 3TOQA 2WVBA 2BW2A 4CJWA 4LQ9A 3RBXA 3W2VA 3HKWA 3EN9A 4MFBB 2WONB 4M5NA 2JRSA 3IO1A 2IGIA 3WUHA 3MM6B 1IG8A 4K0KF 5KFEA 5KT7A 1IBCB 3MHYA 4PABA 4ZPTR 5K5MA 5EWEA 3AODA 4ZVGA 4H03B 1S57A 4EO6A 3HMJG 1RTJA 3AY0A 3AARA 3CC4N 1Q78A 5KFZA 3GFYA 4DSEA 4PQUB 4GO5X 5FPEA 2YV0X 2IS3A 4QIWD 5DDOC 4B3OB 2HVDA 1NK8A 4K0KK 2OZSA 1T9XA 1TUYA 4NLGA 4NZ7A 1HIYA 3KLVA 2GJIA 3Q83A 1MN9A 2C22A 4B17A 3OYAA 3VZIA 3HSJA 3RB0A 2XM3A 1WOPA 5LMNJ 5IT0A 1KEKA 5F9NA 1FNOA 5KFTA 2MKJA 3TI0A 3IUCA 1HL6A 2P9UB 1EARA 4PHTX 3BY5A 3I5BA 4L72B 1XHXA 4GKJJ 2ZOMA 2XHWA 1I1GA 4GMJB 1KVKA 3EEQA 4K5RA 4TN2A 5HMZA 1EAYC 1S6QB 3FQKA 3WT0A 5G0RB 4DTUA 4EUVA 4KPYA 2W25A 2MZJA 3MCSA 4O55A 4QWEA 5AQIA 3PX0A 3KKFA 3U9ZA 1YK9A 2BE2B 4CLSA 5GAGP 3KK3B 3NRBA 5GVQA 2RDJA 3KUGA 2LA6A 1GXLA 3D7SB 1WSVA 2EC2A 4AUKA 1WG1A 4LRAA 3S3OA 1NEEA 1TAQA 4KO0B 1CLQA 3PW2A 3SI8A 1AT1B 4NLQA 3BUZB 2IA0A 4ZTJA 1OJ4A 1DEJA 2EBEA 2OTJN 2J0QD 3H45C 3EUNA 4K8XA 1UVLA 3WC2A 1VOMA 4RW6A 1XNRJ 1VBKA 5IFMA 3RMCA 5IC6B 1FD2A 2L41A 2GMJA 4CZIA 2EFQA 3D66A 2FQQB 3H2LA 4FVUA 1K1SA 1KD1O 3CC4S 4OYAA 3VGTA 1L3VA 2HGMA 1Y5IB 1LWCA 4V19J 3EVWA 2Z1IA 2DTJA 1RYRA 2O8FA 2AJ4A 3L2QA 4R5PA 5AZIB 4RW9A 2V69A 4URGA 1HBMA 3G6XA 1IXKA 1VQ6N 2D7SA 2KVQE 3AY9A 4M5IA 5SZTA 2E5LK 4OI3A 4J9NA 2IVYA 1RT1B 3J7AN 3QDKA 4FM2A 1RDDA 3FZMA 2D0CA 3D6RA 4DV5F 4NCBA 3RRGA 2EHGA 1Q5YA 2PDAA 2Z2LA 3D0IE 4OFZA 1W7WA 1F5CA 1BQMB 2UUBF 4FLVA 5E26A 4TU8A 1VRUB 1R8AA 2VG7B 2P9KA 3AVAA 2PE8A 2JWLA 1X4EA 2VFRA 4X66J 3H98A 1QAJA 1M0SA 1X9WA 5ETKA 2UU9F 2H65B 4ZITA 2Q2RA 4JV0A 2W4CA 3FBBA 4G1QA 1X5OA 4LF7J 3AOBA 3QBCA 3HM9A 1MWMA 4DV5K 3M5RA 3Q8VA 3OYFA 3OBYA 2PYJA 3A3OB 3H8YA 4B9TA 3IAYA 1B70B 3ETMA 5AZJA 1EHWA 2FY8A 4ZJOA 3ZSQA 1CJVB 3GOIA 3CFOA 3CF5L 4HHUA 3CCQS 3UDVA 3MR5A 2RN2A 4LFAK 2FIUA 3JSMA 2PY5A 3AGKA 4PUOB 4FLXA 4YHHJ 4P71A 2VG5A 2VHGA 2E8AA 5LSRA 4DR7J 3PTWA 5J2PA 4PL7A 4KRWA 3HL8A 2XB2D 4ED1A 2QK9A 1HI8A 4DLEA 2RKIA 2J0XA 4Y0FA 5L1LA 2YNFA 2DFEA 5KFQA 5DM7L 1OSCA 4NLTA 2PA8D 6FDRA 3H08A 3AA4A 4OYIA 4AM7A 1N54B 1QHTA 3CJ4A 2G2OA 5I42A 3Q8UA 1JLEB 1Y11A 4E7LA 4WFNL 4NCGB 2V4JB 4DQ8A 1RHRB 3EGWB 1HYSA 3T6BA 2Q0UA 3HKZD 3G6YA 1V4TA 1SJ1A 3V9XA 1GXUA 4CHYA 1VRTB 4WZMA 2A40A 5CQGA 5C25B 2DR8A 1VSJA 2XMMA 4YS2A 3OLBA 4PQAA 1CXUA 1B92A 2MKHA 1OWXA 2N3LA 2HK2A 1R27B 4IO9L 4D3GA 2XWYA 2NXEA 5DETA 3A3NB 3GCXP 1YXQA 2ZM6F 2D0AA 2P2CB 4F8RA 1EWRA 4BR2A 3VA0A 4CECA 2J4RA 1MN7A 3PDNA 4FJJA 3BO4A 3PJXA 5J2NB 4ZCLA 4O5FA 1WF2A 1EKEA 2JLGA 3LALA 2XYHB 3QNNA 3PYEA 1S9EA 5J2MB 5LXYA 3NF6A 4LF1A 3VQ5A 3OR1A 3RR7A 2J9CA 4HDHA 2CVIA 1A5WA 3BGFA 1S0OA 2ZM6K 3MPWA 5LMUK 4LBPA 4XO0A 4DSKA 1NUEA 4FOIA 4ATNA 2CPZA 5FJ4A 4ISEA 5E5NA 3RZAA 4GKKJ 1V3ZA 1KS2A 4P2SA 4TLQA 2OPQB 3P39A 2C2EA 3AVIA 4ZVHA 1LK7A 2ZH9A 4H0VB 1DHMA 1YRUA 1S5JA 2OSQA 2GQQA 2HHVA 3NCIA 3CC7S 1IBLK 4FJ8A 3GLJA 1NKEA 1QUVA 3B6PA 4JI7J 1TFWA 2XY7A 4FLYA 4WQ4A 4N47A 1RHUB 3GJTB 1X9MA 2K1RA 4E1JA 1N4LA 3VWSA 3W9JA 1RDRA 2MQNA 1SQGA 4ED4A 2P5GA 1UPPA 1GLFO 3KUEA 3WNEA 1RCOB 4J9RA 2D69A 3M2RA 4YDUC 2W40A 5G4DA 2EKYA 4JS4A 4CBWA 3H59A 2B8QA 3FBFA 4RW8B 5CZVA 4DCHA 4AFFA 4BHQA 4WCEL 3CCLN 3ZTOA 2G0IA 2HF3A 2VQEF 3H4BA 2DXDA 3GG4A 4B8CA 1NOZA 2A41A 3FSYA 3NGUA 1EQMA 5CYMA 1JJ2R 4UOCA 4C48A 4OHWA 3GIJA 1ZBFA 2ASMA 2HAFA 2ASDA 2E4LA 1VLOA 5C12A 1RTIA 1MSWD 2ZHBA 2GWKA 5LMNF 4W5RA 4GVBA 3NXZA 8AT1B 3PM9A 4CEZA 3QLHB 1N0VC 4AM6A 3SLCA 4ZPCA 2CJ9A 4DV4F 1UL3A 4HUFA 2G4BA 4DS5A 1H98A 1VCTA 2VQEK 4ZCMA 4QJVA 3UD3P 2R8GA 4GKJF 3ISZA 1BLUA 4JKGB 2RS8A 3TJ9A 4BY9C 1OVYA 3WDOA 4X2BA 2HG4A 4A8FA 5HATA 1HNXF 3SAGA 4EMDA 1RFQA 5LMNK 4PPDA 1VQ9N 1HW9A 1DY3A 2IAJB 2GV9A 4R25A 3PW0A 4FBUA 4X4PA 5ADXA 4IOCL 4J9SA 4O3OA 3E9LA 4QIVA 1PSDA 3U3GA 2KT3A 3PLAA 2ZBRA 2CJAA 3M2UB 4CLUA 1IVZA 4I9QA 2AJ1A 4GKJK 3TABA 4ZS6A 3BS9A 2R7SA 2NZCA 3FZ2A 1RHQB 4BE2A 1M5SA 1FW6A 3FFKB 1FKOB 4YDXA 5HSPA 3RYLA 4DF4A 3WNGA 4M5LA 5BRHA 3LOUA 1NZAA 4DJBA 3R1HA 3CCEN 3FFIB 3I4HX 4DFKA 1YSJA 2ROPA 3HVTA 4CGFA 4OKKA 2DCLA 2HNYA 4LIWA 3I56N 1SJ4P 2Z1GA 4KREA 1NSQA 2CG8A 1X60A 1I3OB 1J54A 1QQOA 3UR3C 3D2EA 4B1WB 4C8ZA 4E3SA 1K73T 1N5SA 2AGQA 3UE2A 3NH2A 5EVZA 3KJNB 4NZ6A 5GAHI 3RBEA 1V4SA 2ATQA 3I5AA 2ZJQQ 1RWKB 1XNRK 3TQEA 1NJZA 4KSEB 4NRTA 1QAIA 5LM7E 2MGZB 2ACYA 1JLAA 3LTOA 5ELZA 3KIOA 3VQAA 5KQ8A 1U48A 4W5OA 3JYTA 3F9MA 5E84A 3D3CJ 1Q4RA 2B7CB 3H90A 1DTQB 4MFBA 4FN5A 1U04A 2WONA 2OELA 4KH4A 1WUUA 2VH7A 2W01A 3RUBL 2W2NP 4K4WA 1FRJA 1NB7A 1OPIA 3MTJA 5B0CA 5C15A 2G2YA 2VQFJ 3R97A 4LF7F 1RADB 3HPOA 3KLHB 3LWLA 3DHXA 1S1WB 3O3LA 4HI2A 2XBPA 1UVMA 4QYRA 4L3QA 3OYGA 1XWLA 3FRYA 3TRGA 2O4IA 1CEZA 1VQON 5IXUA 4EIAA 3CPWR 2DRBA 4F25A 2CZ9A 5HBMA 1SH0A 4X66K 2DGWA 2WB4A 2JC0A 5JLHA 3GB0A 1DFDA 2D0PA 1RDWX 3HRGA 1GEHA 2UV8A 4TLRA 4ZVOB 3K5LA 4LF7K 1TP7A 4YHHF 3N9UC 4DL2A 4BGBA 2NXCA 3CFPA 2C3MA 1JLQB 4DR7F 4A59A 3FK4A 2DBBA 1FWKA 5IT9O 1U1RA 3Q8RB 1YIJN 4ZVQB 3CCES 3VR1A 3FJ2A 3NLCA 1IKYB 4C8NA 2J76E 3TAFA 4PA1A 4KAIA 2P9UA 3O9RA 2BJDA 4BROA 2CQDA 4BCAA 2PSZA 3UCGA 3HPHA 4IH6A 3MOJB 2IHR1 2HAIA 2ZWPA 4YHHK 5KFMA 4BREA 2ZH2A 2HMPA 1Y3KA 2IRUA 2BA9A 4DR7K 1A5XA 2OKQA 3DLJA 1S6QA 2IRXA 4FPAA 4HYKA 3D5MA 1IJJA 1SQEA 2P9GA 1M5KC 3PZPA 2WBNA 1FEEA 2BE2A 3KK3A 2XHCA 2BQUA 2O3DA 5L1IA 4ANEA 2IPOB 4RNFA 2YWHA 4DSIA 5E3CA 2P5VA 4KO0A 3H3NO 1FK9B 5AQGA 1N36J 4CFCA 5B09A 4IDHA 1VQ5S 3RAMA 3UWTA 2GHVC 4ZMMA 3ZZ0A 2PC6A 5K14A 5AQZA 2YQ3A 2GO8A 4B9UA 4CRJA 3IMQJ 4EO8A 3GV7B 3PHTA 3TARA 4L6V3 2X78A 3NVKA 5HRRA 1JNRB 1SKUB 1R89A 3KHHA 3MOZA 4HKQA 1VAZA 3SUPA 1RBRA 2DJWA 1H7XA 4HR2A 3W7BA 3POTA 5DS7A 3B4DA 2RRAA 2H48B 1RTZA 3I5CA 5AZIA 3M3ZA 3SCXA 2HSTA 3VAGA 1EQYA 3RMDA 4NL5A 3FEZA 1O13A 1WC4A 2YPYA 2MZQA 3CJAA 2B3TB 2JOQA 2UZAA 3TO8A 4BBYA 3EKUA 1RT1A 4Y2KA 1TVRB 3NGTA 3ZO7A 4K4ZA 1HJRA 4O5BA 3SNNA 1RBUA 4PKIA 5I9EB 3S3MA 1HQEA 4OVLA 2HRTA 2XI2A 2OPPB 4JI5J 1VRUA 1S72N 2ZHAA 2QA4S 5LJVA 4OX9J 2VG7A 3OD2A 2BEFA 2ZITA 2XTJP 3ISND 4XTTA 1FDAA 2CPXA 1IV0A 4PXDA 4BQLA 1Z6RA 3T19A 1IWAA 4CW7B 1RGIA 1C4AA 2VWKA 3UDLA 2DHHA 4DUZF 4GKKK 2D0OA 2K8GA 4FPIA 4FJNA 2QLBB 2NSBA 4LF4J 1O8BA 4GNIA 2CYYA 3QWUA 2W8LA 3A8EA 4WFXA 2MHNA 3M8RA 3MEDB 4FWOA 1CJVA 3R7BB 4FYWB 2J8SA 3QAUA 1YRXA 2VFVA 4C3MA 3MCMA 1F3VA 2I6WA 3HBTA 4O44A 4JI7K 5FRMA 3C14A 4PUOA 1K73O 4FM0A 2Y0SD 5HP1B 2GQCA 3M8QA 1MW7A 4QYZJ 3T1YF 3MD3A 3VQ4A 3O08A 3CCRS 3VF2A 1ZZFA 4F4YA 3RTVA 2IDOA 5H1SV 4L73A 5CYQB 4I69A 1QE1B 2C3OA 5F8NA 2WB1D 1C0TB 5TKYA 3AXMA 1QDUB 3CC2S 4A8QA 2EI5A 1RKJA 4CEEA 4Q0BB 2BJ7A 1OKJA 2ZVSA 1JKHB 5DK5A 1E6VB 1ZA2B 3QJPA 2HHHJ 3TAEA 3OVNA 1MMNA 3UDEA 1JL1A 4Q8FA 2V94A 2EW9A 3QIPA 1VHFA 3I55N 3ZX2A 1OY8A 2B9WA 3FUYA 1JLEA 3KHGA 3TA2A 3BSAA 4NCGA 4PPZA 4F02A 2V4JA 4WPAA 2ZHOA 5HVHA 1S1TA 1A9NB 2IDLA 1XI1A 3BSCA 4USIA 3L3VA 2O1PA 4ALZA 1LK5A 5IT9Y 2V8DA 3R6GB 1VRTA 4FF2A 4L75A 4DR3J 1CQNA 3BO2A 2F65A 3IBFB 1FKPB 2QKKA 3B78A 4K7QA 3DLGB 3GFZA 3OHBA 4JI2J 1XR7A 4CI0B 4CGGA 3WXLA 2EBGA 1U1LA 4MMOA 3DLRA 1HW8A 2E2PA 1BY9A 3HLUA 4QWAA 4JV5F 3LAKA 1BUXA 2VFSA 4M3WA 2KI2A 4XPCA 1U02A 2F4VJ 3A2FA 2RIJA 2RMLA 1VK8A 3CF5Q 4JUZA 4K8ZA 4V1Ak 1DQ9A 2OTLN 2PFUA 5J2NA 2WAQD 3J80O 3TWZA 2DO4A 2CZ4A 4JS5A 4CJQA 4ED2A 1M1KT 3E01B 1S59A 2OUGA 1LOUA 1OMSA 2RQCA 4DV6F 3VV2B 3L2WA 3CJRA 4P2MA 2KXNB 4OYZA 3ZSXA 2G8WA 2QA4G 3VQBA 1RDBA 1XN9A 3EE8A 4OPJA 2CNKB 2J9DE 5AR0A 1U47A 4JV5K 4JYAJ 2CQIA 2E29A 3VVUA 1F6TA 1QQMA 4PXBA 1BA1A 2BV3A 1KLNA 5DDQC 5DM7Q 4J91A 1MWYA 5JVHL 4K4UA 4N7TA 5AQLA 1P6TA 2B4OA 1EP4B 5FD1A 2EKNA 1VSKA 2YWKA 2RS2A 4MTPA 3R8YA 2NZTA 3QWPA 3AJDA 4ED0A 1OH8A 3G87A 4F3OA 3CCJN 4Z4FA 2VQFF 1YJNS 2DGVA 5E3PA 4KGVB 3M8PA 1KWMA 1BHNA 1HHSA 2GJFA 2V7YA 4NPOA 4H5NA 4CE9A 1NM1A 2CAJA 4Y00A 1X7VA 1VSMA 4CLZA 4WFAQ 1RILA 3K2YA 4CIEA 4RBUA 3VQ6A 4WQ4C 2YNGB 4LRCA 2F5GA 4Z4HA 1S6PB 2ZNZA 4IO9Q 1FI4A 2HZAA 2XO7A 1UJ5A 5LSLA 2V52B 4LH4A 3TZYA 4QWBA 2VQFK 2UUWA 1A7GE 4OJGA 2ATLA 1NGFA 2P9IB 4FWNA 1D3WA 2HS4A 4Z4GA 4ZPDA 3ZT4A 4TY9A 3RG6A 1AB8A 3SQ4A 4UQGA 2J7WA 3A5NC 5GAEI 2W7AA 3TNVA 4GC7A 5D0HA 3QLHA 3HI9A 1FHTA 3OVSA 5EGYA 3K8WA 1I3AA 1H72C 2HIYA 4G65A 4S0MA 4JKGA 2E1ZA 5BN8A 5EHHA 3QT5A 3FRZA 1IBKJ 3VF4A 2VB6A 1NK0A 3PV8A 4P74A 2CQCA 4IKFA 1E6YB 1HR0J 3EY1A 4LMZA 3P96A 1KTVA 2V9KA 3CXCR 2IAJA 2AIRB 4EK2A 1V3RA 3OL9A 3GPAA 4FKXA 3HHLA 4ANCA 2RDIA 2JC1A 3DYAA 1WC3A 3KHYA 2FC9A 5J1EB 3M2UA 2OIHA 3LGMA 1RYSA 4MLEA 4DQPA 4PG5A 5CCLA 2V34A 2ABYA 2PFFB 4BS2A 2HMIB 4DBQA 2AJ2A 3PJWA 1N36F 3SUQA 3V4IB 2XLIA 2VBWA 3UNYA 3SBTA 3KLIB 5F0XA 3UN3A 2HBKA 1WC0A 1FKOA 4CM2A 4DCPB 1HD1A 3VGUA 4EP5A 1Y00A 4NRUA 2DT9A 2QLJB 3GSDA 3HSZA 4EFAC 2ZH6A 3KLEA 2FYXA 2RE1A 3U1LA 4WCEQ 4B9VA 4BRCA 3T1AA 1UTAA 4IFVA 3PIOQ 2MJNA 2QGFB 1N36K 4LRBA 5AFUA 3HXMA 5MAOA 3BGLA 1U2VB 1JCFA 3KWMA 3SUOA 4J2DA 4IO8A 1YZ7A 3BKFA 2NREA 2XI3A 4DR6J 1Y9OA 4CZGA 1U26A 2O67A 4M5DB 3T1HJ 4FNHA 2P9CA 4MO4A 2YX1A 4NYNA 4C97A 1HI0P 2OP5A 2HVEA 2ZOGA 4FK0A 3QIDA 3BQ2A 3ID6A 2DNQA 4QWCA 2HRUA 4OX9F 4LF8J 4D3HA 4HVJA 1DTQA 1FWPA 3TSPA 3MN5A 4MIWA 2E1PA 4YR3A 3UFCX 2X1GA 1WN7A 1YG0A 2OI2A 4LF4F 4IOCQ 3KLHA 3NP5A 1S1WA 1VK3A 2KJVA 4JI5K 3P1GA 4JB8B 3ENAA 2AX1A 3ENBA 1HMVB 3KHRA 2CPYA 4OX9K 1LWXA 4KBIA 4YOTA 3VEXA 2I8EA 3DRPA 1O5JA 3LDSA 1NGDA 1VI7A 3PO5A 5J1PA 3PY8A 2E5GA 5D8HB 2RRNA 2O8BB 1IH7A 1TV6B 4TSXA 4E7JA 8RUCA 1WSFA 3BH7B 2PN6A 3CD5A 3D0HE 3TX0A 5D0GA 1M1KO 1YHQS 3ZZRA 2FJAB 2CH5A 4LF4K 1UZDA 1BISA 4KTWA 5DG8A 3IM9A 5DZ7A 2KDOA 3D28A 3MD1A 5GAGI 3O80A 5GINA 3OYBA 1D0EA 2FLNA 2MLYA 3VN5A 3K0SA 4R79A 4E2FB 1IKYA 3SCLE 1NGBA 2CPHA 2R9LA 2XMJA 1RBSA 3Q0AA 4LFCJ 4ZCKA 4CGIA 3NF9A 4HH0A 1ZM4A 4DI6A 4WP8A 2HHHF 3H6EA 4OI1A 1OO0B 1SH3A 1CS4B 2OPRB 3VEOA 4QYZK 4PR6A 2A42A 3AJ2A 3O5TB 3A5OC 3W8GA 4WYBA 3CQYA 3V9ZA 2DNHA 2C3UA 4DUYJ 3O4NA 1WSRA 2UUTA 4X4NA 1BXNA 2C42A 1IQZA 1X4BA 4FF3A 1Q7LB 4ZLNA 2HHHK 4J8FA 4DR3F 1QAXA 1VMBA 4IQXA 4KPCA 3VENA 1FK9A 3NAIA 5I4MA 3DDIA 5CABA 1V5VA 1F2GA 2VD3A 3HSGA 1WI6A 4Z4EA 2OMOA 1QVFR 2ZGYA 4DG1B 1FJGJ 4KBOA 4X65F 5JVGQ 3CVKA 1JL2A 4PWWA 2F4VF 3GYGA 2FGCA 2QXLA 4DR3K 2FLOA 4IEEA 2AYBA 4Z37A 1FVSA 4JI8J 1GMVA 1R31A 5E3QA 1NGGA 3OA9A 4JI2K 1WJ9A 1X4AA 3RAQA 1Q1KA 3EXCX 3LP3A 4JYAF 3GIKA 2R2RA 3HFZB 4ZTFA 3CI5A 1WDTA 2F4VK 4H8KA 3CD6S 3I0SB 8ATCB 3MDFA 3R9PA 4KGKA 3BQ0A 5CE3A 4HHJA 1S22A 2XMTA 4UOFA 3BBCA 4FLUA 1S3XA 5J2QB 1C2PA 5KPZA 1JXLA 4USMA 4WFZA 1ACMB 1TL7B 4B9LA 4JYAK 4CK3A 1WSGA 1GTHA 1RDUA 4G9ZA 4DSJA 1RA6A 1T05B 3L7PA 2CPFA 4EZ9A 1RB0A 2W2QP 3NF8A 4KC5A 2RQMA 1YKWA 5E33A 1RE1B 3IFEA 1C0FA 2V51B 1X5PA 2ILZA 2MXYA 4BC2A 1SQKA 1BWFO 4CTAB 1ZBUA 1T9YA 3MEDA 2MEWA 3NMUA 4EAHD 2A1SA 2LEAA 4RWTA 3MCNA 4FXVA 1T3OA 3NMAA 4FL9A 1RP5A 2HBMA 1NKBA 1XUPO 1W25A 3E66A 1JB0C 3J81O 4O8UA 3LPUA 3BZQA 2HYIB 4WZQA 2X1FA 1KOHA 5CYQA 2KO1A 3C6TA 2HBZB 1QE1A 2OFHX 1C0TA 4LT6A 1FJ7A 3P3DA 4FDFA 2W4DA 1M1GA 3NMRA 2NRZA 1N48A 5A76A 3OL8A 3TUPA 2OGUA 4FJHA 2P9LB 1E6VA 3MWTA 1PAEX 1WHVA 2ZBIA 1R0AB 1AZSB 4BRKA 4WQ5A 3G8SA 2ZBQA 3IR6B 2GELA 5M1FA 3V5RA 2D3OR 2MHEA 3UKRA 3ZNJ1 2I0XA 1HR0F 2DB1A 2YNHA 1KAZA 2WRMA 3OL7A 4TY8B 3T5KA 4DV3F 3M1VB 3I4PA 2DKOB 1Y5LB 2CXEA 4WXOA 2MQQA 2IA6A 4DTOA 1MLAA 5A8KB 4NLCA 2IM2A 1K0VA 4CHPA 4NXMJ 2HLTA 3BYRA 1FVQA 3D1OA 3QERA 2YKMA 5IM0B 2R8IA 1KVIA 4YR0A 1T9TA 2GCFA 3EKSA 3OW2R 1SIZA 1IBKK 3MM9B 2QMUB 2ROGA 4DXLA 3DLGA 1HR0K 1FX2A 3D6FB 1KVJA 4BG9A 2NRHA 1Q8IA 4GVMA 1XR6A 4QS8A 4RNOA 3JAMO 2EG2A 4CERA 4O23A 2AA4A 1P9YA 4OKEA 2HVIA 2DITA 3AAWB 4OJ1A 3OYNA 1Y7PA 5F8GA 3EZ5A 5KFNA 4LFBF 4H5RA 3W9IA 1FXDA 2YJEA 3E9OA 1FNMA 3CG7A 4DR1F 4KHSA 2LQ8A 3BB5A 1VBZA 4DL6A 1YJWN 3DGVA 1M1HA 2DPJA 3O4QA 2ZDPA 3TUZC 3KK7A 4J37A 2BJ3A 2P6TA 2Z57B 4ES3A 2MZTA 2V68A 1YI2N 4YOWA 1DLOB 1R8HA 1U6ZA 2HSEB 5IWAJ 3WBZA 5AQPA 5IS2A 2Q36A 5DG7A 3GQCA 2CWXA 4AHVA 2WC9A 4FWLA 1HWLA 3CCMS 1UVIA 1FTCA 2M5YA 4F4ZA 1MMLA 4DPUA 1VHXA 4IDKB 2F7TA 1X3MA 1G2EA 3TSQA 4DR6K 1KVAA 3THTA 3T1HK 3G2XA 2FSJA 2Q79A 2DHSA 3NCQA 3QSYB 2N7CA 1YLXA 2M88A 4EWTA 4DN9A 1NSPA 5KG7A 4LF8K 1S4FA 2W9BB 1RAIB 3TWHA 2BR0A 2YNGA 5KFXA 1FJEB 5HL7L 1F0XA 3T5LA 2DH9A 4K8RA 3VEVA 2B43A 4OX6A 4MO5A 3BN7A 5HVFA 3V4MA 1R59O 4ZHRB 4HDGA 2P9IA 3FBEA 5B8HA 3NGYA 1TL1A 3BDPA 4FJGA 3DOLB 1OQ6A 3DXSX 3PYFA 2R8HA 3TAMB 1WUAA 3D3BJ 4NXNJ 1L3SA 4GC6A 4DV7J 5D3GB 3P5TL 3ZT0A 5AT1B 2XCPA 5CXTA 3T69A 3R6MA 4LF2A 4FZZA 2V67A 4LFCF 4I6MA 4CEDA 3VCDA 2F8SA 1HNWJ 1UWBB 5GADU 2DNPA 2R7OA 4CP5A 4JKDA 4KH0B 3PCOB 1HNIA 1WKKA 3IAM9 4C8OA 4WFBL 1GMUA 4K4TA 1AFJA 4IRCA 1OQ3A 2MQOA 1YJWS 1RWNB 4ED3A 2XWXA 3IS9A 4QIFA 4DUYF 1REVB 2RILA 3E2EA 3UR0A 4I0WA 1YI2S 3BJYA 3QBXA 4WYWA 4DHYA 4LFCK 4PKGA 4WXWA 4ELVA 2FC0A 4DTRA 5LJWA 1QUPA 2H3EB 5J1EA 4BRMA 2XMVA 4BRIA 3CMES 1VJWA 1OYDA 2KZMA 3QT6A 2HMIA 1RCXB 2ILYA 3G71S 2HQFA 4CH0S 4Z4CA 1IKXB 1OY6A 3V4IA 3ITHA 5E41A 1Q86T 3KLIA 3R6LB 4DUYK 1QM9A 2IIHA 3LPTA 5F1XA 3THWB 1FJGF 2JZ5A 4OZ1A 1HA1A 1ZM2A 3DCAA 3A4TA 1NXIA 2GZOA 2HBQB 3CCSN 5H9FJ 2RUSA 5CA5A 2UUAJ 2O66A 4WYLA 4DQSA 3HHDA 3ZETB 3OS2A 2OPSB 4JI8F 4J90A 1IR2A 4N8NA 2E9TA 2DGXA 1U2VA 3VGLA 5CZ1A 5B0FA 4CO4A 2NQPA 1FJGK 4LRDA 3KNAA 5A6PA 1BCOA 1P1LA 3L4QA 2DTUA 4TXSA 2A0FB 2CQ2A 2K7JA 3OFGA 2AW0A 3A12A 2LLZA 3X3UA 1A6LA 3DXKB 2AT1B 4IG0B 5HJYA 1DBDA 1NWKA 3JAMY 1IKVB 5D4LA 4LIRA 2GHWA 2YXLA 3H25A 4JI8K 2G8UA 2OD4A 3FVYA 5LSOA 3MECB 3T41A 2P9NB 4K25A 1RT3A 1RXOB 1NGHA 3W8PA 2A18A 2D0BA 4I68A 4KHNA 2M70A 1Q0NA 3IP0A 4H0YB 1IN0A 1UVKA 2UXCJ 2MKCA 4X84A 2XEXA 2BMBA 4R0JA 3RJMB 2ALYB 1SC1B 4FO0A 1HMVA 1L3KA 2GW8A 3W65A 5H1SQ 4IKAA 1TUWA 4C7QA 4C6AA 3Q22A 3DXMB 2O8BA 1X1PA 4FWSA 3GG0A 1TV6A 5F3ZA 2UYTA 2QWMA 1S99A 3SQOP 5HLFB 1B4SA 1IR1A 3ZT1A 3Q8QB 1KHWA 2FB0A 5ETRA 1WNSA 4NO7A 2C2ZB 3QEIA 2RH3A 2H5JB 3DLLQ 5M1PA 4OV1A 4GY2B 2MKIA 2E20A 2OD6A 1V5IB 3MEKA 1RT2A 3NGZA 4TNOA 3PNIA 2BYCA 4PG7A 2RNEA 4F2RA 1WNEA 2KM8B 1HWUA 2FJVA 4C3KA 4I6AA 2ERRA 2YKPA 4DU4A 3SQ0A 2H1YA 1Q18A 3OTCA 3J81j 4M41A 4BDYA