5J1EA

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
550
structure length
541
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
total genus 133
structure length 541
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j1eA05
1ZBIA 2BR0A 3BGRA 3HKWA 1JL1A 3LWLA 3LP2A 2JC0A 1UAXA 4PQUB 2X74A 4Z4HA 2HHXA 1REVB 4KHYA 4MK9A 4HHTA 1HPZA 3QETA 3RR7A 1TGOA 1JLGB 2D0AA 3MXIA 3MXMA 3KLHB 3LP0A 2P5OA 4IKFA 3L3UA 1RDAA 4CK2A 4XIUA 4OL8A 1CLQA 1IKWA 2FBVA 2E9RX 5KT7A 2HHUA 3PR4A 4ED0A 4B9LA 4O0IA 1U47A 1R0AB 3KLFA 3DYAA 4AHCA 4CGJA 4ZHRB 2KQ2A 3N6NA 2FVRA 3I0SA 1LW0A 4URGA 4KHWA 3CJ2A 2QK9A 4H4MB 1LWFA 5DQGA 3G6VA 4HUEA 1YVUA 3SFUA 3QEXA 3OS0A 2P1JA 3CJ5A 2DPJA 5CZ1A 2ALZA 4PQUA 4RZRA 3AV9A 3SPYA 4M45A 4KREA 4CGIA 3ICLA 1JLBA 4ID5A 3KHRA 1REVA 4LH4A 4MFBB 4KFBA 2FLNA 2XI3A 3RBEA 1JLCA 4MQ3A 3DI6B 4XPCA 1EX4A 1B9FA 1RBSA 3P1GA 3DLBA 1GOBA 2RN2A 2JEFA 2PZSA 3H5UA 2BANB 4DF8A 3QINA 4QWDA 4RW6B 1RT5B 3QNNA 1X9SA 4DTNA 3VQQA 1R0AA 2GIQA 4RW7B 4G1QB 2IA6A 1S1XB 5HRPA 4CGDA 2B6AB 3QZ7A 4FJ9A 2WTFA 4EBEA 3LPUA 5D3GB 3MFIA 1O1WA 2A1SA 4H8KA 4K8XA 3OYIA 5KFKA 3A2FA 4BE0A 1ASUA 4DTPA 1RBVA 2AJQA 1DTTA 1YVFA 1D9FA 3DLGA 1NK4A 4DL7A 4JV0A 3AA3A 1U04A 5FRMA 3VQAA 4CJSA 3F73A 5CY4A 5F9NA 4FLUA 1XWLA 1J5OB 2BRKA 1L3TA 3ZSRA 1BQMA 4IG0B 2I1RA 5SZTA 2I5JA 3S3NA 1Z4UA 4QWEA 4ED1A 3DOLA 1UA1A 1KVBA 1L5UA 4CJRA 1RT5A 3ULDA 3B6PA 1NK8A 4E19A 1QE1B 2RKIA 1S9GB 3RMBA 3IS9A 3CJ3A 4ED6A 5CYQA 1JXBA 3ASMA 1UWBB 1VSDA 2B6AA 3HVTB 1SKSA 4K4WA 5D3GA 3OLBA 2DFFA 1FK9B 4O4GB 3GIIA 4KKOB 4KHRA 2W9BB 3OYCA 3DLHA 4DFPA 1A5WA 4IH7A 4CE9A 2IJFA 1S1WB 4NCAA 3TVKA 5EDWA 1JLEB 4DTSA 1VSIA 3PW0A 4O3NA 2GV9A 1K6YA 3GIKA 3QLHA 3K59A 3CDWA 1J5OA 1D0EA 3NGDA 4KI6A 4RW9A 4QCLA 4OKKA 4IG0A 3HL8A 5KG1A 3QIPB 3QIDA 4RUCA 4FLVA 4KPYA 3BSOA 4DS5A 3LPTA 4OLBA 1C0TB 1C1BA 2XI2A 1BIUA 3ZT4A 3V6HA 1XHXA 2HHWA 1RT7B 1VSFA 3M8SA 4DTUA 1DLOB 4RNHA 3HHKA 1RTIB 1FK9A 3SJJA 1RT2A 4KKOA 4KHMA 4CFAA 3RRGA 1FKOA 5KFZA 4M3RA 1BI4A 4CGFA 3KNAA 3C94A 1VSHA 2WK4A 4OVLA 3T1AA 4WXOA 4KHQA 1HYZA 1D5AA 2ILZA 4KO0A 4U6PA 2VA2A 1J9AA 3IGNA 2FJWA 5T14A 1N5YB 3K2PA 2OPSB 3H08A 1TK0A 1QS4A 4BWJA 3OYMA 4E7JA 4JUZA 4AH9A 4WFYA 4J9SA 4MIAA 1C0TA 4GVMA 1ZTTA 3PVXA 3DRPB 1KLMB 4Z4IA 2V4RA 1RT7A 2BRLA 5J2QB 3IRXB 4DSJA 3K5LA 3MR6A 1I6JA 1NK7A 4IRKA 1RTIA 4Z4GA 4CJLA 2FJXA 1KCFA 4ZPDA 4M3XA 3ZT2A 2R8HA 3QGGA 4RU9A 4YNQA 3LZIA 4H4OB 3TQ1A 3IG1B 4M3TA 1WSJA 3CWJA 3ZSZA 3H5SA 3U3GA 4DL5A 4FJHA 4HTUA 1SH2A 1VRTA 4FJ7A 4Q44A 4ED2A 4W5TA 4HKQA 3NH1A 4W5NA 1TK8A 3OJSA 4K4VA 1KFSA 3SQ4A 5J2NB 3DRPA 1JXEA 3KKRA 4J9OA 1SL2A 3SV4A 4N56A 1NK5A 1GX5A 4ZVEA 3FRZA 3IRXA 4ID1A 4ECRA 5KRTA 3TAPA 3OVNA 5L1IA 2BGGA 4KHUA 3C6UB 3K57A 1B92A 4FK2A 5FRNA 4MK8A 3RMCA 4J2DA 1S6PB 3DRSB 4NYZA 3KK1B 4O3RA 3NGIA 3M8QA 4R0EA 4DSFA 3NH2A 3IG1A 3L3VA 5KTQA 3RAQA 4Z4FA 3RB6A 1QQCA 1ASVA 3TR8A 4FJJA 4PUOB 4DS4A 4DSLA 3LWMA 4DFJA 3EYZA 4JV1A 3AO1A 1LV5A 1ZBUA 3QEPA 5EUHA 1VRUA 1WNEA 4EEYA 4DL3A 4F4WA 3QERA 3CDEA 2ASLA 3O3GA 5J2NA 3DM2A 3T3FA 4Q43A 4YR3A 2R2RA 4IKAA 4J9NA 2XY8A 4E1NA 3MR2A 3OSPA 3Q8PB 1TL1B 2HWHA 3T19A 4WXWA 4CF1A 5FROA 3KLVA 3NHGA 4ICLA 3NFAA 5F8GA 2D0CA 3AA4A 1RCHA 4CFDA 4KB1A 3NAHA 4LD0A 4Y1DA 4KI4A 3SNNA 4E7IA 4FZYA 2E6LA 5JS2A 1Q9XA 5DG7A 4FJNA 3M8RA 2HNYB 1RAJA 3KJVB 2PYLA 1WSGA 3UDLA 2YNFB 3U3YA 5I42B 2Q3SA 3DMJB 4DG1B 3V6JA 3MFHA 1N48A 3VQEA 4M41A 2RDJA 4N5SA 4Y1CA 3O3FA 5SWMA 2OH2A 4NLPA 1Z25A 4FLYA 2ZD1A 4GC7A 4FLXA 4JLHA 3V6DB 4M3ZA 3BQ0A 3H5XA 3ZSWA 3UIQA 4OKJA 4NLWA 2YHAA 1IKXB 4CHZA 3OYJA 2B5JB 1C1CB 4FM0A 3SI8A 3I5CA 3QGIA 3SUOA 5EWGA 1RT6B 4CJUA 3OYBA 1LWCB 1SKWA 4ZTFA 3ISNC 3DLKB 3KTQA 2YKNA 2ASJA 1TV6B 4CESA 4W5RA 4YR0A 1KFDA 4QW9A 4DQQA 3BGRB 4IOBA 1EP4A 1HNIB 3CJ4A 1D9DA 2YNFA 3RB4A 5C24A 4DG1A 4KSEB 4JS4A 1HPZB 1XR6A 3IGVA 3THVA 4CJWA 4ED7A 2IGIA 3AVGA 3PJWA 2W7OA 1VK0A 3V9ZA 1HQEB 2P51A 3LP0B 2RPIA 4E7LA 2G8WA 2IBKA 2C22A 1IKWB 4ZPBA 1WAJA 2Z1HA 1ZETA 1IKXA 4LQ9A 3HYFA 2B5JA 3HM9A 3OYFA 2OA8A 2J6SA 3TWHA 3KLFB 3DYAB 4CJ3A 3N6LA 4FJIA 4Y34A 3I0SB 3CG7A 4O0JA 1RT6A 1TL3A 2UVUA 1LWFB 4EYHB 2VG7A 5K14A 2KZZA 2YNGB 4E3SA 1TV6A 5KT2A 1GOCA 1HNIA 3BSAA 3PY8A 2Y1JA 3HO1A 3GV7B 1QAIA 5DLFA 4EZ6A 1KVAA 3QESA 3AVIA 2HHTA 1JXLA 2XHBA 1JLBB 4ID5B 1HMVB 4KFBB 4GW6A 3TABA 3LP1A 3TAGA 3Q8QB 1BGXT 1JLCB 1HQEA 5C42A 4Q0BA 4IBNA 1IKYB 4EYIB 1HARA 2AX0A 3BR9A 4ECXA 1KLNA 3NBPA 3AVFA 4E7HA 4F4XA 5HLFA 3PO5A 2HNZB 3D5MA 3S3MA 4CEEA 4B9VA 3KD5E 4ECZA 3CVKA 5KFCA 3CJ0A 1I3AA 3CQ8A 4OPKA 1EETA 1SV5B 4DQSA 4XO0A 3V9XA 3PX4A 3ZT0A 1RA6A 2YNGA 3FFIA 4HCBA 3MXJA 1DTTB 2BE2A 4HCCA 1C6VA 3SQ2A 3F9KA 2IM1A 5DGBA 1S1TB 3DLGB 2EX3A 1IKVA 1TKTA 1TKZA 1IM4A 4K4XA 3HPHA 1HMVA 3QO9B 4NLTA 4CJKA 2R2UA 4TYBA 4NCGA 4O44A 4MKAA 1IKYA 1BQMB 4NLGA 2I5JB 3CO9A 4Y3CA 1SL0A 3DOLB 3HT3A 2JC1A 2HNZA 4PA1A 2RKIB 3IS9B 1S0OA 5CYQB 3NF7A 4ELUA 4CERA 1RDBA 3SQ1A 2F8EX 1WSEA 4E0DA 1SV5A 3AA2A 3SZ2A 5CZ2A 3JSMA 4DFMA 3ZSXA 4DL6A 3RWUA 4KB7A 1WAFA 4Z0UA 1I39A 3WNGA 2DTUA 2FVSA 2D7SA 4CGHA 2VG6A 2QE5A 1LW2B 4CIFA 3O4QA 4DTMA 1S1TA 3KK3A 1RBRA 1XR7A 3T5HA 4CJEA 4FM1A 3QO9A 4LSLB 5DQIA 4DF4A 4EP5A 4CFCA 1U45A 3QLHB 1GX6A 3HVRA 3B6OA 2R2SA 4OPJA 4RW9B 4B9SA 4DSEA 4CHPA 2D3UA 4DTRA 5F8HA 3KLIA 4J9RA 3AVAA 2UUTA 3WNHA 2OZSA 4FJKA 2BDPA 4I2QA 1U49A 3E51A 1C1BB 2KTQA 3L2UA 2ZKUA 4KAIA 2UUWA 4J9PA 5DK5A 4BACA 4MK7A 1L3SA 4NCBA 1X9WA 1T05B 3EPGA 3OYNA 2R8GA 3BQ2A 4KAZA 4FZXC 4NLOA 4CEBA 1J54A 1W0HA 1JL2A 3V4IB 4O5BA 1RILA 1RT2B 4AHRA 4LH5A 1LW2A 4TN2A 3FQLA 1FKOB 3ALYA 1BI4B 5EWFA 2Y1IA 1SL1A 1QHTA 4Z4CA 4LSLA 2W9CA 4K4ZA 3L2VA 4KO0B 4ZP8A 3ZCMA 4J9KA 3PW4A 1T3NA 3O4NA 1NK9A 5KFDA 5EU7A 4FCYA 1HQUA 2C2DA 3NL0A 4GMJB 3Q8SB 5F8LA 1F21A 3KHGA 4CCHA 3IN5A 1GOAA 4FJGA 2UVRA 4OLAA 4NLVA 4ZP7A 1T05A 2R8KA 3D28A 4KHSA 4B3OB 3MEDA 4KV8A 5HROB 3V4IA 4FJ5A 3NF9A 1RT1A 5KFAA 3VQCA 3H40A 4O3OA 5KGWA 4PY5A 1S1UB 4O3PA 3HSTB 4DTXA 2G8FA 2XY7A 1RTJA 2V4QA 4BDPA 4CIGA 2ILYA 1Z26A 3M8PB 2IM2A 4IFYB 4ED3A 2WOMB 4IR1A 4W5QA 1RBUA 3K5NA 3TANA 1S49A 3H4BA 1U09A 4M94A 1VRTB 2FVQA 3D45A 3CIZA 4Q5VA 1S5JA 2P5GA 2FC0A 2GC8A 3G6XA 2FLLA 5KG3A 3H59A 4CJ4A 1DTQA 4ZVFA 4DTOA 1BQNB 2X78A 2GIRA 1NOZA 3I8DA 4F3OA 4QW8A 3KMSA 1X1PA 4B3OA 5L9XA 4WFZA 3T5LA 5HROA 1UA0A 4CHQA 3TAFA 3PX0A 3PW7A 2RF2A 3TI0A 4CIEA 2GUIA 1RYRA 2DFHA 1S1UA 3M8QB 2WB4A 3K58A 2AWZA 3I5AA 4CJQA 3JYTB 1K1SA 3DRRA 3M8PA 4Q8FA 4IFYA 2WOMA 3FQKA 3PUFA 3ZSYA 3CFRA 2JGUA 3WNFA 5HRRA 1KSPA 1VRUB 5KI6A 2HWIA 4TY9A 4Q8EA 1XI1A 2YKMA 4DLEA 2W8LA 4DQRA 1XR5A 3S9HA 3DM2B 1Q9YA 1BQNA 4ECTA 3AO5A 4MH8A 4C8LA 2O4GA 3KK2B 3PR5B 4ZVGA 4WZQA 4YQWA 4ICLB 3NGZA 3NAEA 3VQ7A 1WLJA 4Z4EA 1A5XA 1RTHB 3V1OA 1LAVA 4FS2A 2G8VA 1ASWA 3AO4A 4FJMA 2QKKA 1IH7A 5DGAA 3U6FA 3JYTA 3OL7A 2XGPA 4KTQA 1ZTWA 3SUNA 3H2LA 1J53A 4R8UA 1ZBFA 3QEIA 4C8OA 3MR3A 3OJUA 3LZJA 4QPXA 4OGCA 3RR8A 3PV8A 1TVRA 4FLZA 4FK4A 4F8RA 5KRSA 4AHUA 2RDIA 2JEJA 3HVWA 4LQ3A 4BE1A 1N56A 5J1EB 1QTMA 3CM6A 4DLGA 2IC3A 2B4JA 3QEVA 3VN5A 1BIZA 5J2PA 3KK2A 2ZD1B 3OS1A 4RG8A 3AO2A 3OYGA 2WONB 4QWBA 3GYNA 2OPQB 5KG2A 1RTHA 3RRHA 2B43A 3KIOA 4B9UA 2F8TA 1C0UB 2G8KA 3G6YA 2IM3A 4O3SA 3OYDA 3H5YA 5KFXA 4B9MA 1RDRA 5KFPA 1RBTA 3V9SA 1T94A 2UVVA 3UQSA 3EY1A 3L2WA 1HRHA 3BJYA 3HVAA 1ZBHA 3AVMA 1WNSA 4N47A 3RB0A 2YKNB 4XPEA 5KT5A 4KTZA 4NLYA 3G10A 3SCXA 4M42A 3TARA 3T5KA 1EP4B 3RMDA 2HW3A 1JX4A 2R7YA 2OPRA 1VSLA 5I3UB 4MIBA 2BQUA 4EBDA 5C24B 1TAQA 5HRNA 3LALA 5J1EA 5KG5A 3HP9A 1MU2A 2W9AA 4IRDA 3KMQA 2VA3A 4EP4A 4E89A 2WONA 4NLUA 2OPQA 1T03A 5KFMA 4ZPCA 5KFLA 2W7PA 3HPOA 3SV3A 4RNFA 1XHZA 4JV2A 1C0UA 4URQU 5JUMA 3ISND 3QGHA 3M9OB 4M3YA 4FW1A 4F2SA 5L1LA 1S6QB 3G86A 1JLQB 4RNMA 1B9DA 1TL3B 1CZ9A 3HJFA 2VG7B 5K14B 4ZVHA 4FVMA 4U7CA 1VSJA 2DFEA 4CEDA 5E41A 2V9WA 3L8BA 2C28A 4FBTA 1SUQA 2NUBA 3RB3A 4JRPA 2R8JA 1EXQA 4C8NA 5KFFA 5FDLA 5I3UA 5L1JA 4ED8A 4Q45A 1BCOA 3LP1B 3GIMA 1TQLA 3HP6A 1VSMA 4EBCA 5C42B 4Q0BB 3MTKA 5DMRA 5J2MA 3S3OA 1FKPB 1RNHA 2FBTA 3NBPB 4ZMMA 1KRPA 2OYQA 5HLFB 4M3UA 4N41A 5KFTA 4B8CA 3GV8B 2HMIA 3BDPA 2KFZA 2HHQA 4CHNA 2EC0A 2G8IA 2XRIA 3NKYA 4ZTJA 3C6TA 4DU4A 1S6QA 3QEWA 3AVLA 1BHLA 1EETB 1JLQA 4CEAA 4YFUA 4URSA 3AVJA 4ECWA 1RDDA 2C2EA 3LDSA 3H4DA 3GILA 3FFIB 3BQ1A 4J2AA 4IH5A 2BE2B 4AHSA 4K4TA 2OPPA 2YV0X 1RTDA 1S0MA 1HYVA 4B08A 1IKVB 1TKTB 1TKZB 4TYAA 5DG8A 2YNIA 4NCGB 4O44B 2OZMA 2F8SA 2XC9A 3KHLA 3PX6A 1UOCA 3MEGA 5KFHA 1FKPA 4ELVA 2YNHA 1NK0A 2D0BA 3LANA 5KGXA 4CF9A 2HVIA 4K4SA 3BREA 4WE1B 2ITGA 1RT4A 4K8ZA 3KLEB 1WSFA 3NF6A 4F4ZA 4O4RA 4KRFA 4R5PB 3OL9A 1ZBLA 4IG3A 4ECYA 3JSMB 3OS2A 2R8IA 1JLFA 2BQ3A 4AHTA 1CXUA 2Z1GA 2D3ZA 4W5OA 3CFPA 4HYKA 2VG6B 1RDCA 3DLEB 3BSCA 2VG5B 4RW8A 2G8HA 1Q8IA 1S9EA 3KK3B 5KFIA 4I2PA 1C0MA 1CZBA 4L8RB 3ZSVA 1JLAB 4RNOA 5C25A 4QAGA 4RW4A 3ITHB 1NNDA 1KVCA 3MECA 3AVHA 3V1QA 2JLEA 1N6QB 4IFVB 4DQIA 3PW2A 3V1RA 3KLIB 4AHVA 4FJLA 3CYMA 1QSSA 4K4UA 4CHOA 1L3UA 4I2QB 5KFJA 3OY9A 4I9QA 4WE1A 2BQRA 1JLGA 4NRTA 2DY4A 3TAEA 4DL4A 2XY6A 3KLEA 3KLHA 4CFBA 3DDKA 3P83D 4R5PA 1T8EA 1KHVA 4Y2AA 4PWDB 3KLGB 5KFSA 1OS5A 4NLDA 3ZSOA 1N4LA 4ZPAA 4RNNA 2W8KA 5DG9A 3DLEA 2VG5A 4WFXA 4ZHRA 2IM0A 3TAMB 1LAWA 4M95A 3NE6A 3EPIA 3NF8A 4CK1A 4H4MA 2CJQA 1JLAA 2W9CB 3ITHA 3AA5X 2AU0A 4IDKB 5KFVA 1N6QA 4IFVA 3OYEA 1HQUB 4Y2CA 1HNVB 3T5JA 5C5JA 4DQPA 5HP1B 1FXXA 4MFBA 4BWMA 1WSHA 4GC6A 1L3VA 2GBZA 4B9NA 2O4IA 4RUAA 3DI6A 3PJXA 1NJYA 4TQRA 2FJVA 1NJWA 4FLWA 4DSKA 1U48A 1WN7A 2BANA 4PWDA 3KLGA 2J6UA 3MEDB 4KV8B 3OSNA 4RW6A 3MF5A 3K5OA 1RT1B 4FS1A 2AQ4A 3QIOA 3NDKA 4M3WA 3SUPA 4NLXA 1S97A 4RW7A 4I9LA 3VQPA 4G1QA 1SKRA 1S1XA 3RAXA 3TAMA 1CXQA 3QZ8A 3O3HA 1W25A 4E7KA 2IDOA 4WYLA 1RTJB 4NLSA 4O55A 4J2BA 4IR9A 3QNOA 4IDKA 1VSKA 1RT3B 3PO4A 1S48A 2PY5A 3MAQA 3V9UA 4KTWA 4LY7A 1HNVA 4F4YA 3OL6A 3L2RA 2QV6A 5HP1A 3GV5B 3EZ5A 1NJXA 2AGPA 2E9TA 2FBXA 2HVHA 5KT4A 3SYZA 1TP7A 1DTQB 2Z1IA 3DLRA 3UR0A 1S1VB 2HNDB 3MEEB 4FXDA 3SPZA 1YT3A 5KFGA 3OYHA 5T7BA 1QE1A 3V6KA 1S9GA 3NMAA 2RF2B 4WZMA 4CGGA 4FLTA 1UWBA 4CK3A 3VQ5A 3V9WA 3M9NB 2FVCA 5HBMB 3HVTA 5KFBA 3DRRB 1KTQA 4HUGA 4FJ8A 3VQ6A 1RT3A 3EZUA 4NLRA 1NJZA 1TKXB 4O4GA 4JS5A 2G8UA 3OL8A 2W9BA 1MMLA 4DEZA 4FM2A 1S1WA 4K4YA 4IH6A 3TAQA 1JLEA 3GIJA 5KG6A 3NH0A 2YKMB 1WSIA 4ZP9A 4DU1A 4FK0A 2X6SA 4F4KA 1NOYA 1YTAA 4UQGA 4O3QA 4J9MA 4BDZA 4CEOA 3VQ9A 2IJNA 1NKCA 1Y97A 4FYDA 1CSJA 1S1VA 2XY5A 2HNDA 1NKEA 4EZ9A 3QIPA 3UPFA 3AVCA 3MEEA 2O5DA 2F96A 3IAYA 1X9MA 1EKEA 2KZMA 2JEGA 1QSLA 3VQSA 3M9MB 4OKEA 3I0RB 3ZSQA 2ATLA 2KW4A 3L2QA 4TXSA 4TLRA 3VQBA 4ECVA 4JRQA 5KG7A 1QUVA 1G15A 3SQ0A 5HBMA 3AVBA 1DLOA 3P5JA 3KHHA 1NK6A 4X2BA 4J9QA 4IQXA 1TKXA 4HUFA 2ZQBA 4KB0A 4R8UB 2AX1A 3N6MA 5CYMB 4QWCA 5L1KA 4DWIA 3LAMA 5KFYA 1TVRB 4I7FB 4B8AB 2ASDA 3SI6A 2FLPA 4OJRA 2HHVA 2XCAA 3C95A 1N5YA 2IC3B 2OPSA 5J2PB 3SFGA 2PYJA 1D8YA 2FBYA 1K1QA 2HHSA 2CKWA 1S10A 4ZP6A 2IS3A 4C8MA 3I0RA 2V0NA 5F8IA 3SUQA 5KT3A 1TAUA 4TY8B 1KLMA 5F8JA 4DFKA 1S4FA 2E6MA 5J2QA 1LWEB 3KOAA 3BSNA 3RMAA 2A1RA 1T7PA 3DOKB 4EO6A 4CEZA 1JKHB 2FVPA 4CECA 1SH0A 3RTVA 4WYWA 3V81B 5JXSA 3PW5A 4MKBA 4CJTA 4F2RA 3VQDA 3AVKA 5CYMA 5F9LA 1BISA 4LSNB 4H4OA 4KHNA 3OHBA 2QKBA 2OPRB 4I7FA 3HPGA 4YR2A 4BE2A 2IMWP 1ITGA 4CF8A 2KFNA 2E9ZA 3LAKA 4CHYA 2YHBA 4ECUA 4B9TA 2VWKA 5EWEA 5KFUA 2X6NA 1MU2B 2ZE2B 3HK2A 5F8MA 5F8NA 1T03B 3FDSA 1JIHA 3CM5A 4OGEA 3I5BA 2VWJA 2QXFA 4DTJA 4TY8A 2IOCA 5DQHA 4DMNA 1TKDA 5KFEA 1HJRA 1LWEA 3DOKA 3ZT1A 1NKBA 1JKHA 1S9FA 4CJPA 5JS1A 3V81A 1NHUA 4G3IA 4CEQA 3C6UA 3KKSA 3CFOA 5HRSA 2WHOA 4NYNA 1S6PA 3DRSA 1SUQB 4LSNA 3AO3A 2D41A 3KK1A 3E01B 4DL2A 4NYFA 1ZYQA 5FDLB 2WCXA 2E4LA 4AILC 3NAIA 3QYYA 4FJXA 5KFQA 4NLQA 3Q8RB 2D5RA 4PUOA 3OHAA 4ELTA 1YTUA 3LP3A 2HAIA 2XGQA 2ZE2A 5J2MB 4E1MA 3H98A 2AGQA 4CF0A 4TSXA 2ETJA 2XWYA 4ECSA 1A5VA 4YP3A 2HMIB 1RYSA 3OYAA 5KFOA 2W42A 4KE5A 4HVJA 1TL1A 1QSYA 3K5MA 2IAJB 3C6TB 3ZT3A 4F50A 4TQSA 3GQCA 2DPIA 1TK5A 1S0NA 1QAJA 1SH3A 1HYSB 4J9LA 2HB5A 3NGYA 1C2PA 4DSIA 1IG9A 3OYKA 2UVWA 3E01A 4C8KA 3KD1E 4KBIA 4QWAA 3G0ZA 1RA7A 4F3TA 2OPPB 1U4BA 1RTDB 3MR5A 1XC9A 3D0PA 1D1UA 1NHVA 4J2EA 1BCMA 3PZPA 3RBDA 3OLAA 2YNIB 2WRMA 4H54A 3FSIA 2ATQA 2C2RA 2LSNA 4ECQA 2HNYA 4YMEA 3VA3A 3LP2B 3MEGB 3KJVA 3CDUA 2YNHB 5KFRA 3PHEA 5I42A 4CJVA 4CJFA 2EHGA 3DMJA 2XCPA 1VSEA 1W9HA 5KT6A 3AVNA 1RT4B 2XO7A 4FZZA 5KG0A 5DLGA 4FW2A 2IAJA 4BDYA 4CJ5A 3V6DA 2R2TA 4IG3B 5KFNA 4EO8A 3WNEA 4IRCA 2JEIA 1HYSA 4K50A 1JLFB 4QOZB 1C1CA 2J6TA 3VA0A 4CEFA 3HXMA 3NCIA 4CF2A 1BL3A 5KFWA 4RW8B 4N76A 1LW0B 1S9EB 1KHWA 3OYLA 4I2PB 2AGOA 1C1AA 3VQ4A 2Z1JA 1IO2A 5C25B 1LWCA 4RW4B 4NRUA 3VQ8A 3MECB 3DLKA 4NZ0A 4FBUA 5KG4A 4DU3A
chains in the Genus database with same CATH superfamily
2QMXA 3HKWA 1FDDA 3M1FA 4BRAA 1REGX 1HBUA 4UY8T 3HHLA 4LFBF 1HHQA 4CM2A 1REVB 4KHYA 4JI1F 1HPZA 3QETA 3A8EA 1JLGB 2E20A 4RBVA 1RHMB 3MXMA 2LU2A 2HRYA 1U2CA 2P5OA 1F3FA 5B7WA 4IKFA 2X7IA 2DEJA 4I68A 1RDAA 2AW0A 4CK2A 1PILA 3ATVA 1RAFB 2HHUA 4N8OA 3BP8A 1R0AB 3FBBA 2KU7A 2GWJA 4CGJA 1WOPA 1R6VA 2MQPA 2FVRA 4C3KA 3I0SA 1IQZA 1NGHA 4M5LA 4PZVA 3G6VA 3EGZA 3ILIA 2RS8A 1E4FT 4DCJB 1S3XA 3MOZA 2EBGA 4ZIVA 3R8EA 3W1YC 4DI6A 2DPJA 3K7RA 5CZ1A 4FXVA 4RZRA 3NS6A 3OW2R 1JLBA 3KHRA 2V4JB 3R2DJ 1OWXA 2FJDB 5CHCB 3DLJA 4U67Q 4MFBB 3UN2A 2CH5A 2GHVC 3ZNJ1 4CYUB 1HNZF 1Y00A 2O8BB 4OIXA 1EX4A 4CLTA 1B9FA 4B3RF 2JEFA 3KWMA 3H5UA 2V8HA 4C3LA 1ULRA 5K8OA 3O80A 1M90O 4ANEA 4C8YA 1X9SA 1HW9A 4DUTA 3VQQA 2GIQA 1XMOJ 3VVUA 2EXUA 4CGDA 2ZHBA 1U1RA 3CCRN 3MD3A 4IQMA 2WTFA 3MFIA 1O1WA 3OYIA 4P7TA 3C6AA 1RBVA 5T7LA 3CMAN 2P6TA 2NYIA 3CPWM 3DLGA 1NK4A 4ZJQA 3M2VB 3MPDA 4OJHA 2MHEA 1U25A 5JJBA 3Q8VA 2Z57B 2J7WA 4JK9A 3MPYA 5F9NA 1XWLA 3R27A 1J5OB 3FZLA 2PGCA 3ZSRA 4IG0B 1Z4UA 5C2DA 1HWLA 1BXNA 3AJDA 2J4RA 2Q36A 3C16A 2CQCA 3L0QA 4LVNP 4CJRA 5JVGQ 2AJ4A 2ZH5A 3RMBA 1WC1A 2A6AA 3R7BB 4B3TK 1Y5IB 2B8QA 2B6AA 2M8HA 4LF5F 4EHTA 4QQBA 1C4AA 4Q2MA 4DR1F 3BB5A 4KHRA 1IN0A 4X62F 3DLHA 4BS2A 3OYCA 3CCVN 1A5WA 1Q7LB 2M2BA 3KUHA 1WOQA 3TVKA 5EDWA 3N4PA 1LEOA 2BYCA 1BA1A 3WDOA 1WTBA 4UZBA 3MM5B 2WFBA 3QQCD 1KC8O 4OKKA 4HTIA 3U8XA 3R97A 2BKNA 4JI5F 4RUCA 2FC9A 4DR6K 4RL1A 2GIFA 1IBLJ 3O3LA 3GG4A 3LPTA 3DXMA 4WP8A 2UXCF 3TZWA 3V6HA 1YZ7A 2CG8A 4PL7A 1HWKA 1FFWB 1K47A 4ZJOA 3M8SA 1WB9A 3LGHA 4DHVA 1GFWB 3EICA 1OVQA 2COLA 3HHKA 4MKVA 4KHMA 2DGWA 2K2PA 1NGBA 1JCEA 4ILLA 2DNYA 5KFZA 1A0OB 4OVLA 1PYSB 4WXOA 4KHQA 1HYZA 1FNXH 4UF4A 1YI2N 2ILZA 2EK1A 2Q1LA 4JI2J 3CGIA 1J9AA 1G4CA 4BWJA 1QS4A 3VZIA 4ANDA 2E5GA 2LDIA 4DV5K 1FWPA 1KNZA 5LMUJ 3CC2N 4JEPA 3THTA 3NRBA 3EL2A 2C3OA 5DM7Q 2GJ2A 4A57A 1JCGA 4Z4IA 1MN9A 3NGTA 5JLFA 5J2QB 1UEUA 1UEKA 2YHWA 4FSVA 3VTIA 2FLOA 1IBKK 2MKYA 4OI6A 4IRKA 4EUVA 3N79A 2ROPA 2R8HA 3QGGA 3LZIA 1PIEA 1UTAA 2LU1A 3AAWB 4M3TA 2Q97A 1OIAA 2Q1NA 3QJPA 3H5SA 2DVIA 3U3GA 4DL5A 3TUZC 2FZKB 1H0HB 3I96A 3U9ZA 4Q44A 3M1VA 2FUG9 1KD1T 2OANA 4HKQA 1HHTP 1VMBA 2EBEA 3OJSA 2E1RA 4Y0FA 2Y8WA 2HHHK 3SQ4A 5J2NB 2BW2A 4DUYF 2HEKA 3NGUA 4N56A 1OMSA 3TAPA 4H0TB 5L1IA 4W92B 4M5NA 1FJGJ 1P1LA 2NZCA 3K0JA 2BE9B 3E66A 2GCFA 1LXNA 2CQ4A 2B3TB 1B92A 4MK8A 3RMCA 4MDAA 1S6PB 3DRSB 3R3LA 4O3RA 1KS2A 5DETA 1IBCB 3L3VA 4Y65A 4IJNA 2XZWA 4YOYA 3K0SA 4DFJA 3EN9A 3VV2B 1W26A 3VGSA 3FFKB 1VQSA 4F25A 1WNEA 4DL3A 4OYPA 4PG6A 2E2OA 5GVQA 3CDEA 2ASLA 3O3GA 1B7YB 2G1DA 2QC3A 3DM2A 1I3OB 4YR3A 2IFXA 2XY8A 3MR2A 2HWHA 5LMNK 2OTLN 2ZDOA 3US5A 3K5PA 4DB3A 5F8GA 4RTFD 3TU5A 1OYDA 4AM7A 2AYBA 4F0HA 1KWMA 4KB1A 2M5YA 2W4PA 3NAHA 4FF4A 5EGYA 2ZH8A 2NLXA 1N52B 5GAEP 1SXLA 5H1SQ 4E7IA 2HNYB 1RAJA 4X65J 3KJVB 4DR7F 2PYLA 3UDLA 1GLEG 2YNFB 2WSFC 2V9KA 3MGJA 4BQZA 2Q3SA 4DKWA 4YOUA 1FNOA 3MFHA 1N48A 4B1YB 4N5SA 2RDJA 1KQFB 5HN0A 4GC7A 4LF6J 3OTDA 4JLHA 3V6DB 2LP4A 2DHHA 4W98A 2JWKA 5AQUA 4PABA 5AZIA 3UIQA 1VQ8S 3CMEN 4NLWA 1NBEB 3OBYA 2UXDK 3CD7A 4UQTA 2XEXA 3CCMN 2CJAA 1VC6A 1DJ0A 2F8MA 4HVZA 3MTJA 5J1PA 2BE7D 3S1TA 4CJUA 3OYBA 1HBMB 4O8UA 3ISNC 3KTQA 2QWPA 2YKNA 3W3DA 4W5RA 1KFDA 4RR5A 3BGRB 1HNIB 4ZVRB 3W63A 1KAZA 4XDCA 4P6QA 5CHIA 3RB4A 1CC8A 1RWKB 1NGDA 4KSEB 4JS4A 4ZVUB 3IGVA 4TNOA 1ZPWX 3AVGA 3V9ZA 3HULA 3ZLJA 3IC1A 1YBUA 1QY7A 1BY9A 1XNRF 4DR5J 2IBKA 1IKWB 3KZBA 1IKXA 4JP8A 2LQ9A 3WQTA 2O8EB 3V2UC 3THPA 3KLFB 1U6FA 3TWHA 1U1MA 3DYAB 3JTNA 4CJ3A 1TZ0A 3D1HA 3AODA 5M1KA 1B99A 4DR3K 1TL3A 2UVUA 3G6ES 2M70A 3MDQA 2KZZA 1YGYA 4UTGA 2CJBA 5AQFA 1RACB 5DDPC 4A62A 4FWLA 4A46A 3BSAA 3HO1A 1I1GA 3J7AP 4EZ6A 2X1AA 2UXBK 3ILOA 2HHTA 1JXLA 3EO3A 3H90A 2XHBA 2GMJA 1TUUA 5H9FJ 4WQ4C 1HQEA 2RE1A 5BRFA 5C42A 2AEMA 3KJQB 3BR9A 5D8HB 3THXB 5HLFA 3D5MA 2V52B 2Y0SD 3KD5E 3UE2A 3UE5A 3CJ0A 1I3AA 1EETA 3BGFA 1SV5B 2XHCA 4XO0A 1WWHA 2PE8A 4I64A 1TUYA 2KRRA 3FFIA 1KXPA 2YWGA 3M8YA 3SQ2A 5DGBA 2KLAA 1RFQA 4DV3F 5BXIA 2H54B 1IKVA 2ZNYA 2IVFB 1IM4A 1HNXK 3HPHA 4FOEA 4NLTA 4CJKA 2BA9A 5H9EJ 4O44A 1IKYA 3ADAC 1BQMB 4Y3CA 4IO8A 3G4SS 1TMMA 4QIVA 3HT3A 2NRVA 2EPIA 2JC1A 1ZM4A 2HBYB 3H1VX 1PJ7A 2VZ9A 2FY8A 4ES3A 1F2HA 5D4NA 5A2QY 3TSQA 1DBDA 1YTYA 1S0OA 4YOVA 4M5GA 2EFQA 2DPNA 3SQ1A 3IFEA 3CCSS 2F8EX 3BYPA 3MUTP 3AA2A 1CJKB 3JSMA 4PAAA 3EXYA 1JNZB 2QWLA 1LW2B 2RD5C 3O4QA 3AGRA 2EKNA 4JKAA 4JI8F 2ZVIA 1XR7A 1X4CA 4CJEA 3QO9A 3I82A 3FLCO 4DF4A 2W2NP 2MKCA 1GX6A 3IMXA 2FHMA 1I94K 1OY8A 4CHPA 1Y5LB 1U7LA 1Q7YT 1MROB 3KLIA 3GU0A 4BRFA 2UUTA 3WNHA 1IR2A 1A9NB 3ENBA 4FJKA 4JK8A 4I2QA 3R5DA 1YJ9S 1NU0A 3A5LC 5DK5A 1L3SA 5BRHA 2Z30B 1X9WA 3OYNA 3IRWP 4KAZA 3TA2A 2JL9A 1W0HA 1RILA 3GYXB 3NG8A 4MMOA 2MZQA 1RT2B 1BE4A 3CJAA 1MA9B 4AHRA 4LH5A 3ALYA 4NA2A 1HKBA 5EWFA 3UW1A 2Y1IA 1SL1A 1QHTA 4DPYA 4Z4CA 3CCZA 4LSLA 4OV1A 1K0VA 2GWKA 1VQON 4FL9A 5FLXU 4QYRA 4ZP8A 4HTLA 1T3NA 1WC0A 1NK9A 5KFDA 5EU7A 2C2DA 4CDIA 1QM9A 3Q8SB 2XMVA 3L3CA 4LSZB 4BGBA 3PNIA 3KHGA 3O5BA 2Q31A 4A8MP 2JLGA 4FJGA 2A1BA 2QA2A 5LJ3Y 4H5TA 8RUCA 1ESVA 1T05A 2VPYB 2QMUB 2QWQA 4LRFA 4H0PA 2BKPA 2VQEF 2GQ2A 1RT1A 1RWPB 1H3DA 1ACMB 5KGWA 2ZUGA 1TYQA 1S1UB 4A8YA 5LSLA 3BF4A 2G8FA 3G8SA 3MPWA 1PO6A 3UVJA 2NUHA 1RTJA 2V4QA 2VH7A 3M8PB 4ED3A 1OSCA 4B3MK 4B3TJ 2CGLA 3K5NA 3TANA 3H4BA 4USTA 1SJRA 4JOUA 3CIZA 2FC0A 1XJWB 4WTOB 1N34K 1F1BB 3HHEA 2BOAA 1RAOA 3G6XA 2FLLA 2OSRA 1MWKA 4I6MB 2KM8C 2LA6A 2MSTA 3MWBA 4QW8A 4BC5A 4B3OA 3ZTRA 2B7BB 1IJEB 5AQHA 2RF2A 2HAFA 5KPZA 1GXLA 2GUIA 1GNKA 1NSKL 3K58A 2AWZA 4CJQA 2YWFA 3JYTB 1K1SA 1RHUB 2PAVA 5LSOA 4IFEA 4ID8A 4FNHA 2JGUA 5AQQA 5D4PA 4NA1A 4TY9A 4YOWA 1R3NA 2XYPB 2HBMA 4EIAA 2G4BA 2HLTA 7FD1A 1NZ8A 2A6MA 5E33A 1XQIA 3D2EA 1Q0NA 2XHWA 3THWA 2O4GA 2O67A 3CJ7A 1XIQA 1U1NA 4QIEA 3NGZA 2F4VK 3VQ7A 3CCJS 3W5XA 4DV5J 1LAVA 4X64F 3Q23A 2V8DA 3MZIA 4GO7X 4IOCL 3FGVA 4HHUA 2XGPA 1ZTWA 1YRUA 3G9CA 5E26A 4LF8F 2XSJA 1SJ1A 1XNQF 4R8UA 2V94A 4M5IA 1IBKJ 4FWOA 4C8OA 4DR4F 2RDIA 3CI5A 4LQ3A 4Q2LA 1QTMA 2VPWB 3CM6A 2IC3A 1NSPA 2B4JA 5C10A 1BIZA 4LFCF 3KK2A 4USWA 2PO4A 3LQVA 1M5VC 1F0XA 4F0MA 3AO2A 4RG8A 1TFWA 1R8HA 1FE0A 4USJC 3DC2A 5J1NA 3DN9A 1RLCL 2W2OP 4PYDA 2VGMA 2B43A 2KXHA 1GTEA 2IM3A 3F44A 2HHHJ 1NB7A 1RHJB 1K8AT 2VFTA 4YORA 3L2WA 3BJYA 1YXQA 1EWRA 4RKUC 4N47A 4XPEA 2VFRA 4KTZA 4NLYA 3G10A 4OZ0A 3R1LA 3T5KA 1HUXA 1EP4B 3HX9A 3SQGB 3MN9A 3WX8A 4DPWA 3DDNA 3J81U 4E98A 1LCUA 1T02A 2RHKA 3SAGA 5D0RA 1MU2A 2OP5A 3D6FB 2VA3A 2OEJA 3UKRA 2QFIA 1VQYA 1QQNA 3BYRA 5KFMA 3GE1A 3QAEA 3VEWA 4ZPCA 5KFLA 3SV3A 4EU0A 5K20B 3VZHA 3AD8C 3J7YI 4YDUC 2CNLB 3ZC4A 5JUMA 3QGHA 2HKEA 4IO1A 1WC3A 4HLBA 4FW1A 2F65A 5L1LA 1BOTO 4OZ1A 3G86A 4RNMA 4DV2J 2WW8A 3MCSA 1CZ9A 2VG7B 1UFLA 2LCWA 4FVMA 5LMNJ 4CEDA 1LFPA 3W8PA 4FWKA 2MKIA 2ZM6F 3RB3A 4JRPA 2R8JA 5FDLA 4OX7A 4QIGA 3CJ1A 4ED8A 3ETOA 1BCOA 2DCLA 1R8AA 5MLCQ 1VSMA 4DV4K 1H98A 2DYAA 3IWXA 3MMBA 1RNHA 2FBTA 2UU9F 3NBPB 1KRPA 2OYQA 2BUNA 3ZTPA 5IZHA 3GFHA 5KFTA 4N41A 2I2YA 2C2MB 2HHQA 1N54B 3D1QA 1K8KB 4WTYA 1AZSA 4F3QA 2GHWA 3AVLA 1QZ5A 1TUVA 1JLQA 4YFUA 3AVJA 4Y2MA 1WF2A 3MHYA 4LFAF 2PN6A 3LDSA 3GILA 1R7IA 4AHSA 1RLDA 1WHVA 4TU9A 2Q2RA 2OPPA 1S0MA 4OYOA 3T1YF 4IEEA 1TKZB 2UXDJ 3AB4B 4TYAA 4QS9A 3EM1A 4KGMA 2YNIA 4CWBA 2MGZB 1YJWS 2OZMA 3M8WA 4Y00A 3KHLA 4NX9A 2A0FB 4LBHA 1FKPA 3UCZP 2OELA 4YB6A 2HVIA 4LF5K 4K4SA 3SBMA 2B7CB 3PRVA 2I8EA 3KLEB 2PEBA 2VKZG 2QSWA 1AUSL 2OHDA 4DR1K 1NDLA 4ZS6A 3UB5A 1YLXA 4BRCA 2BQ3A 4CO4A 1CXUA 1UWAA 2D3ZA 3CFPA 4HYKA 3GTYX 1RDCA 1VISA 4KPCA 3BSCA 4WBFA 4RW8A 2XMWA 4ED4A 3EDQB 3DNCA 5KFIA 4H0XB 1C0MA 4L8RB 3SXLA 3ZSVA 1NNDA 2ZFHA 2ZUAA 2CUYA 1WHWA 4WQ4A 3JSBA 1F5CA 3AA9A 3EKUA 4IFVB 4ZPTR 4DQIA 1NRKA 4AHVA 4FJLA 2IMOA 1T9WA 1L3UA 5KFJA 2J9DA 3OY9A 4I9QA 1JLGA 4BG9A 2VL1A 2UXBJ 2N7YA 4I6AA 4CFBA 2OMOA 2FJBB 3RZAA 5A8WB 4NLDA 3SBTA 2MPUA 2KT2A 3ZO7A 3QFPA 1H73A 4I6WA 2W41A 4JKBA 3NE6A 4M95A 2VHGA 3UFCX 4TU8A 2CJQA 3GFXA 2M0GB 4QPTA 1QAXA 3DRXA 3AA5X 4CZFA 2DXDA 1YF5L 4Y2CA 1MWMA 3A3PB 4DN0A 5B0FA 5CZXA 3M30B 2V4JA 1FXXA 1VHFA 4MFBA 4BWMA 2ZJPL 3FBCA 3PIOL 1WSHA 4CYUA 1L3VA 1NMNA 2ZF5O 2O8BA 2CNOB 2P9PA 4DUZJ 2OFGX 1WN7A 1CJUA 3CIPA 2GJFA 1D9AA 4PWDA 3MEDB 3G82B 4FF1A 3MF5A 3QIOA 4NLXA 1S97A 2GTDA 2F40A 4I9LA 5KPRA 2KHCA 3QT5A 1VDHA 3QZ8A 3O3HA 9ATCB 4E7KA 4F02A 3O8WA 4O55A 3ZZTA 3QNOA 4IDKA 3PEHA 4HACA 4DUYK 4KTWA 1UJ6A 2LQ8A 2N3OA 5HP1A 2LXUA 4V19S 3M2VA 4C11A 2AGPA 2E5JA 5EX3A 4KHPJ 1MWZA 2HVHA 1TP7A 4A8KA 1DTQB 2JVRA 3QSIA 1VC5A 2OFHX 5AQSA 2OD6A 2ZGYA 4ERDA 5C2CA 3FSYA 3RJMB 5KFGA 4CI0B 3OYHA 2C2KB 2O8FB 2IYIA 2WBMA 3SMSA 4OZJA 3PDNA 4CLUA 3GYGA 3ENQA 1YK9A 3DRRB 4FJ8A 3EZUA 3OVBA 4NE9C 2XNQA 2V67A 2G8UA 3U27A 2MZTA 4QYZJ 3TAQA 2NRZA 2DO0A 3NH0A 1WSIA 2X6SA 4F4KA 4O3QA 2UUAK 4FYDA 3AJ2A 1S1VA 4EHUA 2HNDA 1WG1A 2B9YA 2O5DA 1MNEA 1IBMJ 1EKEA 4ZKAA 1M1HA 2JEGA 4B1XB 3J7YU 1VQ8N 4ZCMA 3BZCA 1U0HB 3PG9A 4M7YA 3LDOA 2ACYA 4YN3B 4M7XA 4ECVA 2M7SA 1QUVA 1G15A 2NSCA 3CERA 5HBMA 3P5JA 1Y5NB 1SKUB 2ZBPA 3KHHA 5A0YB 2YH1A 1TKXA 2VODA 1S6OA 2JZ5A 3O9UA 2AX1A 2Z58B 4QWCA 1DZ5A 3DHXA 4I69A 3D6HB 2QXLA 1YRTA 1TVRB 2WSEC 2M4MA 2FLPA 1SC6A 2DNRA 5RUBA 4JKDA 3SIPB 2EVZA 2L41A 5J2PB 2E1AA 2J7KA 4CNZA 5D0EA 2FBYA 1K1QA 4B3MJ 2CKWA 2H51B 5LL6d 4F3MA 5CD4A 1XC3A 3SUQA 3VQTA 2DR5A 4CO0A 3IM8A 4TY8B 1NGGA 5BN8A 1S4FA 3L4QA 5J2QA 1N34J 3KOAA 1KAXA 2CJ9A 3TYTA 2KJWA 4CEZA 4K59A 2FVPA 1HHSA 3CJKA 3V81B 5JXSA 3C15B 3G6EN 4MKBA 3KDOA 2VQFK 4OZNA 5AE1A 2WW4A 3OHBA 1CVJA 5E3PA 3GJTB 4I7FA 1MSWD 2IMWP 1ITGA 4CHYA 3ZNUA 1U6ZA 1XMQJ 3I4HX 4QZVB 1K9MO 1NM2A 1KKHA 3J81Y 3HK2A 3P49B 2A3ZA 3FDSA 1JIHA 3CM5A 1ZH5A 4X4NA 2MDAA 3GCWP 3F2KA 1TKDA 2JLFA 3M2UA 1LWEA 2Y0BB 1DGKN 4P73A 3E8OA 5IC4B 1JKHA 1FWLA 3VAGA 4G3IA 1KEKA 4DR2K 1FJGF 2WHOA 2DH7A 4NYNA 2BKOA 4XDDA 1U1OA 2GZOA 3BN7A 1S6PA 3DRSA 4LSNA 3AO3A 6FD1A 2YTCA 4NYFA 2E4LA 3NAIA 3QYYA 3Q8RB 1YTUA 4IOCQ 5IV3A 3C6HA 5B0DA 2HAIA 2YX4A 4PQAA 2OEKA 3H98A 2MKKA 3G4SN 3M8ZA 4ITSA 4YP3A 2HMIB 3AH6A 5ETQA 2HBLA 2BW7A 1Q8KA 3C6TB 3ZT3A 2PMWA 3MD1A 1DT9A 3CCSN 3U02A 4FF2A 4OHXA 3P96A 1FA0A 1VQ5S 2CPYA 2POKA 5E84A 1W2IA 2YY3A 3E2EA 4CZCA 1CS4B 3AA8A 4OHWA 4FYWB 4LF4F 3KXDA 5HAOA 1N32K 3DDIA 1IR1A 4YB7A 5C2FA 1U2VB 3HF5A 3OLAA 4JYAK 2G9OA 4BRGA 1M5KC 3FSIA 2ATQA 2GW8A 2LSNA 2HNYA 3MEGB 3KJVA 2VWBA 4JI6K 2B9EA 3IBFB 4X65F 1W2BR 2EHGA 1WEZA 3VMFB 3EVWA 5KT6A 1NGEA 4FZZA 1Q53A 4YDUA 4ZITA 5KG0A 1YJ9N 4BDYA 3V6DA 4IG3B 4LF6F 4K50A 2F9JA 3R2CJ 3NLCA 3TPQA 4EMDA 2J6TA 4CEFA 1NJIO 3HXMA 2UUBK 2LA4A 3QDKA 2Q6BA 3B6BA 1RI7A 1RWXB 4MAKA 4I2PB 2E7VA 2NXCA 4P10A 1B4SA 1X5OA 2KO1A 1U1LA 3AJ1A 2IBOA 2GS8A 4DJBA 2F7VA 1Q95G 1PAUB 4ES1A 3PIPL 3CCES 2BR0A 3BGRA 1WC4A 3WXLA 1JL1A 3LWLA 5B0GA 2QA1A 2HQCA 3W60A 2HBQB 4LRCA 4Z4HA 1OQ6A 4E2FB 4CTAA 2VV5A 2D0AA 3MXIA 3TUIC 3KLHB 3EGWB 2AJFE 3CJSA 2IVYA 4G65A 4BC7A 4DV4J 4DR5F 1RUSA 1CLQA 1IKWA 2FBVA 3F56A 4B9LA 1U47A 2X3DA 4H0VB 3KLFA 3DYAA 4DX6A 3CC4S 3N6NA 1RBLA 2L9WA 2RMLA 5CD4H 4BRMA 2PBDA 4AXJA 2E2QA 3IFRA 3D7SB 2U1AA 3OD2A 5T7LB 2WUSA 3VEVA 3CJ5A 3DLLQ 1CEZA 1T11A 4PQUA 3AV9A 1HL6A 3VF4A 5BRDA 4KREA 2X1FA 3SBGA 3MM9B 1UMJA 1RKIA 5AQTA 4I0WA 4XPCA 2DHXA 4CD3A 5ETVA 4AYBD 2PZSA 2DJWA 4DF8A 3VF2A 4UY8O 5HQLA 1GAOA 3C16B 2QIFA 4QWDA 1WEXA 3UD4P 4H0OA 1SC4B 2DK2A 4RW7B 4NLCA 4G1QB 2MQMA 1NGCA 5JVHL 1S1XB 1YHQN 1OH6A 1LOTB 2B6AB 3QZ7A 5AJ3J 4EBEA 2A1SA 4K8XA 4JV5K 5KFKA 3A2FA 4BE0A 1Q82T 2E1PA 3AGKA 2AJQA 3U9DA 2V2VA 4W90B 1AW0A 2PD1A 3QJJA 4WP3A 3HTVA 5FRMA 4YOEA 5CY4A 4FLUA 2G2YA 3KYLA 1VJQA 4S0MA 1B70B 1VBXA 1BQMA 3HD1A 3NCPA 4QWEA 4ED1A 3CMQA 5AR0A 5KQ8A 1UA1A 1OY9A 4ZDNA 5JLHA 2G0JA 4ZCKA 4JHDA 3KDNA 4OMFG 3DXMB 1VBKA 1S9GB 2RVJA 1JXBA 3AT1B 1O8BA 2XNRA 5D0GA 4RU2A 1SJFA 2ZJQQ 3WXIA 4FWSA 4O4GB 3LDNA 2ZWHA 3DGPA 4AQYJ 2R7RA 4CE9A 2XQCA 1GMUA 1S1WB 2VJUA 4IDHA 1JLEB 1BG3A 1VSIA 2MB0B 3PW0A 4JAXA 2ZH4A 3K59A 3NGDA 3M3ZA 4JI0K 3QIDA 5ELZA 2P9KB 4V19J 4IXCA 4FLVA 4A2AA 4OLBA 2H5EA 3KJNB 5L8RC 3S01A 2V2ZA 4ZN1A 1W2BM 2KG0A 1XHXA 4FVUA 1J5EK 4LF8K 3GL1A 3PIOQ 2WTUA 1VSFA 3MN7A 2IY5B 1FJ7A 1Q8LA 4DR4K 3WBZA 1UETA 3HHDA 1LNQA 3ETMA 5GAEI 3I8BA 3SJJA 1RT2A 4KKOA 3RRGA 2NXNA 4NASA 1WF1A 3D6MB 5DS7A 2Z2LA 4OZLA 4M3RA 1YVNA 3ID8A 2JH3A 3LM2A 1WC5A 2IHR1 1F6TA 4WPAA 1D5AA 2CQDA 2XMAA 4X66K 1JXVA 1NPRA 3IGNA 5AQGA 1N5YB 1ELOA 1UVNA 2OPSB 1NDKA 4P72A 1TK0A 3OYMA 3VAHA 2LYVA 1FDBA 4JUZA 2VBZA 4RLEA 3M1VB 4AH9A 1Z2LA 3GZ7A 2HOEA 4J9SA 4MIAA 1RHQB 2VFSA 1C0TA 3EZOA 4FKYA 4KQZA 2FZGB 2ADBA 1KLMB 1VQKS 1RT7A 2J8AA 2WVEA 2FHOB 3VAFA 5HSPA 5BR8K 1X9JA 1I6JA 2GJIA 4GVBB 1KCFA 3Q8UA 4M3XA 4G6VB 1VQNS 3ZT2A 4RU9A 3QFHA 4P2XA 2QYGA 3CCRS 1RWWB 5F2RA 1NM1A 4OFZA 1TUGB 4BGAA 3ISZA 5C15A 2DD8S 2IDEA 1NUEA 3H8YA 4B3TF 2YQ3A 4ED2A 3DXBA 1RAGB 1IUJA 1Z1ZA 1WBBA 5CABA 5H1SV 3DRPA 4PG5A 4J9OA 4I6MA 3AOAA 1N8RT 2LLZA 1NK5A 3IRXA 2CA9A 2VBWA 4ID1A 1R43A 2HS4A 5AQOA 2BGGA 2RAQA 4KHUA 3ELHA 1RU2A 2NNWA 1EO1A 3I32A 4M63C 2VJVA 4KGVB 2W2MP 1T6DA 2P9UA 2YHXA 5IT9O 3HSZA 3OBIA 4WIQA 4DR6F 3NGIA 4R0EA 4DSFA 1X5TA 3NH2A 5C0YA 2W4CA 1QQCA 1ASVA 1P6TA 4FJJA 5GMKa 4H03B 1GLAG 2OIHA 1LV5A 1ZBUA 3QEPA 3MN6A 4DX8H 2P9LA 3PHTA 2R42A 3GPAA 4OZ5A 2YWWA 4CLKA 3L6QA 2R2RA 4IKAA 4E1NA 3MM6A 3Q8PB 1HNWJ 1HD1A 5FROA 1KD1O 3NHGA 1HW8A 5AZIB 4FZVA 5I4MA 4CFDA 2XMKA 2EC2A 1S5ZA 4DV5F 1WOSA 3GCXP 1UL3A 2P5VA 2N3LA 2XZTB 4OLPA 4NO7A 2ZOFA 1D09B 1Q81T 5M2UA 5DG7A 4FJNA 2AEJA 4H4KC 1IBKF 2HMPA 3PLAA 2VQFJ 5FLXO 1YI2S 4OYIA 3MMAA 4NMXA 1Y4ZB 4PCQA 2QW9A 4HHJA 1H6KX 5SWMA 2OH2A 2JSXA 2P8IA 3NS7B 3CC2S 2W4DA 4M3ZA 2FQQB 1Y3JA 3H5XA 4OKJA 2BM1A 1IKXB 5HVHA 4CHZA 2DRAA 3A8YA 5AFUA 4ILGB 3NOCA 3EVOA 1PJ5A 1WC6A 3FBFA 2HHHF 4I1TA 4I4BA 2QN6B 1EWQA 4CM0A 3W8GA 4O0NA 1UCNA 2VGNA 4HEA9 1EP4A 3OTBA 4AT1B 5IWAK 4DR2J 4IJAA 2V50A 4GKKJ 4DG1A 4LF9J 3M6VA 2Q0RA 4CJWA 3VGLA 1WKJA 1VK0A 1HQEB 1HPMA 2E1MC 3ENWA 1JB0C 3CJCA 3LP0B 1WORA 1W7AA 1AXQA 2RS2A 2J9DE 1WAJA 2Z1HA 4K0KK 1NMDA 4LQ9A 2B5JA 2WBNA 5CA5A 4ZLNA 2QLXA 2OKQA 4PXDA 4DU7A 4Y34A 4C23A 3DGVA 3CG7A 3C8YA 1AROP 4I6YA 2GQQA 3IDHA 1LWFB 4EYHB 2VG7A 3CW2C 1M5PC 1TV6A 2JVOA 5KT2A 3M6UA 5LMNF 3PXGa 4ES2A 3GV7B 1QAIA 1F2GA 1KVAA 2EFGA 3AVIA 4ID5B 1FFSB 4HH0A 1YJNS 3TABA 4YHHK 1JLCB 1IKYB 1HARA 3UN3A 3G25A 5TKYA 2HQIA 2E1ZA 3NBPA 4E7HA 4F4XA 1ZBTA 4WYBA 1XMOK 3Q2TC 2QRRA 2W2PP 4D3HA 3W0LA 3JTPA 2ACMA 2DKOB 4CEEA 3HKZD 3CVKA 2CNKB 5KFCA 1VYAA 5AQPA 2QWNA 2FYXA 2DRDA 2OTLS 3CJQA 1VQ9N 2DNZA 2Q66A 5ETKA 3MXJA 3VEYA 3BZKA 4HCCA 4YB1P 3F9KA 2IM1A 5A8RA 4LF1A 3W9HA 3WQUA 1IM6A 1QUPA 1TKZA 3QO9B 1BLUA 3TA0A 2UXDF 2MGZA 2J5AA 3K9JA 2HSTA 4J90A 3GSIA 4OI2A 2I5JB 3CO9A 3DOLB 2MMYA 2FHJD 5GMEA 4PA1A 1PYTA 2XS2A 1F5BA 3QRRA 3CNQP 4B1UB 4ELUA 3FR0A 3LW5C 3VF6A 1XTZA 3HI9A 1RQ0A 1UPMB 4DL6A 4KB7A 1WAFA 2GNKA 4CGHA 3Q8YA 3A13A 4BLGA 1D8ZA 1FRLA 3CCMS 1EQ0A 2QE5A 4CIFA 4ZVTB 5IC6B 3OT9A 2PMHA 1S1TA 4JN4A 3T5HA 3NEKA 3NVMA 4LSLB 4G1PA 4CFCA 2GV1A 5AZJA 4ZA1A 4YUDA 2C2OB 1IBLK 5FPMA 4F67A 4FPRA 2QA4N 2KDOA 2Y8YA 3W2VA 3J81O 3E51A 2KTQA 4NYPA 1VQ6N 1WKKA 3OFGA 2UUWA 3TJ9A 2HG4A 2MZJA 4EFAC 2UXBF 3OBWA 1ILYA 1T05B 5A8WA 3O44A 2FC8A 1J54A 1JNRB 2CPXA 2FF6A 2PFUA 3A8IA 4CZGA 1LWXA 4FP9A 1TYQB 1BI4B 4X4VA 4JI2K 5ETLA 2HVEA 2ZGZA 2P9IB 2A6OA 4WU3A 5JVHQ 3L2VA 4AFFA 4DV1K 3PW4A 5LMUK 3O4NA 1JMTA 2HWTA 4JV5J 2PC6A 3NL0A 2NSBA 3T9NA 3M30A 4KGZB 2C3UA 5DM7L 1OH8A 2BJ7A 1F21A 3D3BJ 3M2RB 2CJKA 4CCHA 3MCPA 3JB9k 2UVRA 1NGAA 3MM7B 4Y2IA 1HNXF 4KHSA 1N5TA 4B3OB 3MEDA 4P74A 2UYTA 5ADZA 3G82A 1WI8A 4FJ5A 3NF9A 1X7VA 5KFAA 3GDQA 2WC9A 4PY5A 2I38A 4MDBA 1FCAA 5ITHA 1DQ8A 5F41A 2H9ZA 2A2CA 1ZM2A 4BDPA 3EWGA 4CIOA 1Z26A 3HBTA 4IR1A 3JQKA 2XB2D 3SJHA 1RBUA 3CPEA 2MKSA 4A48A 1F9EB 3LM9A 2V8GA 1PAEX 1IG8A 2FVQA 3D45A 4WU2A 4QIWD 4Q5VA 2P5GA 1AA1B 2ZH1A 1DTQA 4KHPF 5LM7E 2K8GA 4RJVA 2O1PA 4P9SA 1NOZA 3I8DA 4F3OA 3KMSA 1X1PA 3MCMA 4CHQA 3DFEA 1GEHA 4BR0A 3TAFA 4P52A 5BYSA 3PX0A 2DH9A 2KHDA 3PW7A 3TI0A 2HFUA 2XG8A 2YVSA 1RYRA 2DFHA 2LKZA 3M8QB 2WB4A 1T9UA 3WT0A 1EIYB 2VICA 2K06A 1J5EJ 3DRRA 2FY1A 3PUFA 3ZSYA 2XSJB 5THWA 1HKGA 4DCOB 1VRUB 5KI6A 3K8WA 3EDRB 4RCHA 2HWIA 3I6PA 4F04B 1XR5A 1DKGD 3GR0A 2XLKA 3SMZA 2ZH2A 3KK2B 1T44A 4X66J 4XTTA 4CZLA 2L48A 2RNEA 1TUWA 2E7XA 4OQJA 3SSSA 3NAEA 3V4MA 1WLJA 1S4EA 1HKCA 4CZEA 4A8WA 1VGYA 1RISA 1HIYA 2BJEA 3OPKA 3TZXA 4FJMA 2QKKA 1HI1A 5DGAA 3U6FA 4U95A 3OL7A 1V3ZA 2K3IA 5A0YA 4CLZA 2IVMA 2EW9A 1BWFO 2XM3A 2KHOA 4ZCIA 5BR8J 1ZBFA 2CRLA 3CCEN 3OJUA 4ISEA 1NHKL 3RR8A 1FHTA 1LXJA 1SCJB 1TVRA 1VQOS 1VC0A 5KRSA 4AHUA 3PYFA 2HF4A 4HT7A 3W7BA 2ADCA 1N56A 4DLGA 3QEVA 3VN5A 5J2PA 1FESA 2JX2A 3VGVA 3GYNA 2GX8A 1X4FA 2OAUA 4B3MF 1X60A 2AV5A 4C0HA 4H0YB 5K9FA 4DV6J 3FCWA 1RTHA 4M63A 2VBYA 3TWZA 4Z94A 3KIOA 4B9UA 2F8TA 2FSNA 2HQ3A 2G8KA 3H0PA 3G6YA 3OYDA 2MHNA 3CC4N 1N34F 4B9MA 1RBTA 5KFPA 3IXQA 4FYXB 3EY1A 4F0KA 4DU8A 3AVMA 1URRA 2DRBA 2F9TA 1CQMA 3SCXA 1VQPS 1VHIA 3NOGA 4EGLA 3BPDA 1VSLA 1TAQA 1P27B 1VRQC 4DR5K 1YJVA 1X3MA 4J91A 5J1EA 4KBOA 4B3SK 5ETMA 1RGIA 2BJ8A 3DRYA 3HP9A 4A2BA 2W9AA 3HFZB 2YXLA 4IRDA 3KMQA 3EE9A 1X5PA 4K5RA 1DRZA 2OPQA 2Q3PA 1RAAB 2Z2MA 1DY3A 3JQMA 1KVJA 1XHZA 4JV2A 1TL7B 3CD5A 2J8SA 4BQLA 3ISND 1GXTA 3QT8A 2VASA 1JLQB 4NPOA 1UVJA 5ETPA 3WEEB 4ZVHA 5E41A 3EE8A 4H4KA 1N5QA 2YWEA 2M3DA 3OUYA 1SC3B 3AXKA 4JI1J 2F4VF 5L1JA 4KH1B 3ULHA 5KOWA 3POTB 3LP1B 2CGKA 2ZNZA 2QFJA 3EX7B 4Q0BB 2ZWOA 4PPZA 3P4IA 1FKPB 1ATRA 4J8FA 3T1HJ 4WKYA 2HMIA 3BDPA 1PG5B 3G8TA 1OYEA 2EC0A 4WK3A 4BC3A 2XRIA 1KONA 4ZTJA 3C6TA 1S6QA 3QEWA 1T95A 2F3JA 4ECWA 2Z2YB 2C2EA 4A5BA 2CGJA 5DRKA 3BQ1A 4J2AA 4IH5A 2CQ0A 2DHGA 1CS4A 4K4TA 3VGTA 5H9EK 4B08A 5D4LA 1TKTB 3PKMA 1FRHA 2YPZA 2D0OA 3I33A 2P9SB 3A3OB 4NCGB 4B3RJ 4PRFA 3MEGA 1FI4A 3H6EA 3MAAA 3LANA 3OA9A 3OV7A 3M6GA 2ITGA 5IWAJ 3Q0AA 3ZZRA 3IM9A 4O4RA 4KRFA 3SMPA 3OL9A 4IG3A 4ECYA 2MZ1A 3EJMA 2AJ1A 4W5OA 5LSRA 4XEIA 3O9QA 3AFGA 4K0KJ 1TU0B 3BKFA 2A10A 2R7WA 1NGFA 4I2PA 1X5SA 2NQPA 4I56A 1KVCA 4CZMA 3AVHA 2KH9A 3V1QA 1LK7A 3ZX2A 1FFGB 4DXLA 3WQPA 1QD1A 4CJ7A 5ETTA 5GAHU 1QSSA 4K4UA 1UFWA 3T6BA 4XH4A 4WE1A 3IWNC 1VAZA 4PEOA 1YAGA 3KLHA 3HFVA 2P9PB 2KN4A 1VQKN 3DDKA 3FZ2A 4R5PA 4OX9K 1CJUB 1T8EA 4YHHJ 2V69A 4PWDB 3JS9A 2R7TA 2QL5B 1N4LA 2DHAA 3HM8A 4DV4F 4RNNA 4OX6A 2W8KA 5DG9A 3DLEA 1ZAWA 5LJWA 4WFXA 1VQNN 1SB6A 2RHQB 3NF8A 4CK1A 2MTLA 2W9CB 3ITHA 3D68A 4IDKB 4JD2A 4X4PA 4JI5J 1N6QA 4HACB 1UEVA 1UW4A 1HQUB 1BMQB 4FXWA 3O2IA 1GXUA 3NNCA 5HP1B 2RRNA 5F3ZA 1HLUA 1N36J 4C11B 5AQWA 3MM9A 3W5YA 2E1CA 1UKUA 3NS5A 4GC6A 2QEXS 2L9DA 4ILJA 4TQRA 3T69A 3M32A 4FLWA 1QDUB 4KRWA 1XBWA 5A2QU 2C2NA 4EAHD 2J6UA 4KV8B 3OSNA 3K5OA 1U6BA 4FS1A 1S77D 3NDKA 4M3WA 2C3PA 3QBXA 4RW7A 3GR1A 9RUBA 5AT1B 4G1QA 1ZS6A 3H42A 1S1XA 3TAMA 4DPTA 5LL6Z 2LXFA 2H1YA 2XBPA 1H7XA 3CT9A 4NLSA 1MDUB 3NGRA 1VSKA 4KGXB 3VETA 2FHKA 5IV4A 2VB6A 4F4YA 4CD1A 3OL6A 3H7HB 4A5AA 1NJXA 1OY6A 3EGNA 3NMUA 1VIOA 2HF3A 5AQYA 2Z1IA 4JK7A 2EK6A 2R7QA 3UR0A 1S1VB 4GY2B 2ZBQA 2HNDB 3MWPA 4F26A 3J7A1 4GVLA 5EX0A 3D0GE 2CQPA 3CD6S 2BJ9A 4FXDA 1WELA 1YT3A 2DR8A 5T7BA 3ILJA 1S9GA 3NMAA 4QJVA 4MTPA 3FKBA 4OHZA 4FPAA 4FLTA 3VGUA 4CK3A 1XQSC 5M1OA 3M9NB 4UUXA 5HBMB 2VFVA 5KFBA 1S76D 2GO9A 1KTQA 4HUGA 1RT3A 4NLRA 1MWYA 1TKXB 4O4GA 4BCAA 3M7VA 3MM8B 3JAMU 4DEZA 2MQNA 4FM2A 1S1WA 3TQEA 5IXUA 4CI6A 1JLEA 3ZXWA 1SIWB 1M1KO 1WJ9A 3VALA 2YKMB 4ZP9A 1WUAA 1IR0A 1YTAA 4J9MA 4PG7A 2E2NA 3VQ9A 1Y97A 2CZ4A 1CSJA 2DITA 2KM8B 8AT1B 1CJTB 3IO1A 2F96A 5L38A 3IAYA 1X9MA 2P9KA 4DV1J 4YY3K 4L76A 4Q7AA 3KK7A 4FF3A 2ATLA 2KW4A 3L2QA 3ULEB 1RWNB 4ZN3A 3EMTA 4K8RA 4TXSA 2XLJA 1CULB 4WFBQ 3DCAA 2E66A 2NCKL 3QMLA 1BHNA 2HYIB 3CJKB 2PEHA 1KP6A 4IQXA 4HUFA 3N6MA 1V4SA 4UT4A 2DGTA 1NWKA 4OJGA 2DO4A 4DWIA 1I5OB 7FDRA 4YEAA 1SQGA 4I7FB 4FVCA 2CQ3A 2ASDA 3SI6A 4P2MA 2M9KA 2XCAA 3WXJA 4BRNA 2E5HA 1N5YA 1FNMA 2OPSA 3WX4A 3CCQS 2ZJRQ 1KOOA 4HTJA 1D8YA 4ZP6A 2IS3A 3OW2M 3I0RA 1GH8A 5F8IA 3GWCA 1QQOA 1H2TZ 1KLMA 3IKMA 5F8JA 3M2UB 1LWEB 3SDEA 4CT9A 1Y64A 1T7PA 3RMAA 3CSKA 3OTOJ 1JKHB 4CECA 3RTVA 4WYWA 1U1KA 2XS7A 5AQVA 4GVBA 3VQDA 3AVKA 1GTHA 4LSNB 2MYFA 1HI8A 1RTZA 4ENOA 4KHNA 2QKBA 2W01A 3HPGA 4YR2A 1BA0A 3GJQB 1DAXA 4DZDA 4CF8A 3FZHA 5F1XA 3B8AX 1R59O 4LC9B 1YJNN 2F5GA 5EWEA 5KFUA 4UY85 5EHHA 5IM0B 1M0SA 1W97L 3OXLA 1T9TA 2DCUB 5F8MA 2PA8D 3I5BA 1TL5A 1FXRA 5DQHA 1B0PA 4DV2K 2DNGA 3U4LA 4OO1J 1CG2A 1WHXA 3UD3P 3DOKA 4HDHA 3NXZA 1NKBA 2CYYA 2UUAF 4X4RA 1NHUA 2DGOA 5HRSA 4C48A 3ZTQA 4DBQA 1R31A 1SUQB 3HSCA 4CZJA 2D41A 1YJRA 2R7OA 1ZYQA 2D1KA 4AILC 2MQLA 3UDCA 2D5RA 4ELTA 4MYUA 2P2CB 5AXMA 1Q5VA 1XNRJ 1FT8A 2AIRB 2VUGA 3VOVA 3HT0A 1Q1KA 2BUPA 2CG4A 2UP1A 2XWYA 4KGKA 2DNNA 3L09A 2J0QD 4FPBA 3OYAA 3UDVA 3KG0A 4Z7CA 4O23A 3OFHA 4KE5A 4WFNL 1QSYA 3H2UB 3K5MA 4ETXA 2FJAB 1G6BA 3ZZUA 3GQCA 1TK5A 2DPIA 4LR8A 1HNWF 2VIHA 5IOLA 3OYKA 4DX5A 4C8KA 4QWAA 4FOIA 1RTDB 5DZ6A 2ZH6A 3MR5A 1XC9A 3BBBA 2YX7A 4NXMK 2HQFA 3RBDA 1Q78A 3SCJE 2QI2A 4YMEA 1HWIA 5EN1A 3CJTA 3UD5A 3L4IA 1KVIA 1CLFA 4OPHA 5KFRA 2DEIA 4B17A 4ILHA 3I55S 2VQFF 4DN9A 3N28A 3LF0A 2XCPA 3TTDA 4BRQA 4U8YA 4CTAB 1RT4B 1A6LA 2BVZA 4RUHA 4YB5A 2M52A 2YQ0A 4ZK7M 4CJ5A 4CO3A 4B3SJ 5AQXA 4EO8A 4IRCA 3UR3C 2JEIA 1HYSA 1PSDA 1JLFB 1RAIB 2LFVA 5AQKA 1YZ6A 5D6GA 3WIVA 2BJ1A 1BL3A 3PRDA 5HQ8A 1NDCA 2RE2A 1N33K 1S9EB 3OYLA 1SVDA 3W9JA 5LJVA 1C1AA 2AGOA 2Z1JA 1IO2A 4OX8A 5C25B 1UFKA 4NRUA 3VQ8A 1VIXA 2J9EA 4ETZA 1KR4A 1VI7A 4DU3A 4BVOA 2OCEA 4R79A 2JC0A 2X74A 4PQUB 1VQMS 2HBZB 3VAIA 4DR2F 3UNYA 2HHXA 5FPDA 3BH7B 1U02A 1S99A 4OHYA 1TGOA 2YX1A 3LP0A 2R3VA 1V6HA 5CZVA 4HWIA 3L3UA 2FXUA 1U2FA 1FKAF 5HJYA 5KT7A 2JOQA 1V9OA 2WSCC 2XMMA 3P39A 4ZHRB 2KQ2A 4KH5A 1LW0A 4XH1A 4KHWA 3CJ2A 2QK9A 4LREA 1LWFA 3AOCA 3ENVA 4HUEA 1FJCA 1WG4A 3SFUA 5K5MA 2ALZA 3SPYA 4M45A 3ICLA 2DNHA 4ID5A 4DUZK 2FLNA 3S6EA 3RBEA 3VERA 1JLCA 2GMLA 5I3PA 4MQ3A 3DI6B 3QFWA 1RBSA 5AE3A 1MMDA 3DLBA 1N32F 4GKJK 1PJ6A 2BANB 1YWXA 5HK4A 3VPZA 4JYAF 1KQSR 1CBKA 3ILLA 4JHDB 4DTNA 3RBXA 2NRTA 1K44A 1R8CA 2IVPA 4IWVA 4JI6F 5HRPA 4BC4A 1IXKA 3ZETA 3P5TL 3FZMA 2YKQA 3LPUA 2JDJA 2V5HG 3MI7X 2W2QP 4ILMA 4DTPA 3DGPB 4KHPK 4HR2A 2HZCA 1D9FA 1QTNB 2KKZA 3TTCA 4DL7A 4MT1A 5ETOA 1R0BG 4JV0A 3AA3A 3GFYA 4RX6A 2UUBF 1M1GA 3E9PA 2CQHA 2BRKA 1L3TA 2I1RA 6FDRA 5SZTA 2I5JA 3DOLA 3H25A 3TW0A 1H2VZ 2VQEJ 3CUNA 1FDAA 1L5UA 4P71A 1RT5A 2CDRB 3B6PA 1NK8A 2H3EB 4DPOA 1TTHB 3MDFA 2FHJA 1Y3KA 5LXRA 3ZZOA 1UWBB 3OR2B 3RU0A 2JJ4D 5G4DA 1BUPA 5D3GA 2DFFA 2J9CA 4QYZK 3K8VA 4OX9J 1GMVA 3GIIA 4KKOB 2YI1A 4ER8A 1JQGA 2YH0A 2W9BB 4DFPA 5I9EB 2G2OA 2NRWA 3VWSA 2P9NA 2KYZA 4DTSA 3H46O 3JAMY 1YDLA 4O3NA 2ASMA 1IBMK 3CDWA 1D0EA 1Q82O 5EY4A 3NGKA 5DO2A 3HL8A 1DFDA 3AAQA 3QIPB 2OO4A 1UJ4A 4DCPB 4KPYA 3BSOA 2QO3A 1X31C 3AAPA 4QIFA 1C0TB 3HMJG 3ZT4A 5FJ4A 3SCIE 4ANCA 1RT7B 2HVDA 2RB7A 2L3MA 2PA3A 5DZ7A 1HBOB 4BROA 4DTUA 4RNHA 4A8SA 3UNGC 1BDGA 5M1QA 1FK9A 1FRMA 2DXEA 5CR4A 3DXKB 4CFAA 5L39A 1BI4A 1VQPN 3LA0A 2P9GA 3KNAA 3C94A 2BH1A 2P9IA 3T1AA 3DOMA 5ADXA 4U6PA 2VA2A 1QLNA 2ZHAA 2FJWA 3TVYA 3K2PA 1WHYA 1KQGB 3FZFA 3IR6B 4KH0B 4WFYA 2V68A 4JV5F 1P90A 4GVMA 1F3VA 3M2RA 1RADB 4CO2A 5A76A 3DRPB 4OYMA 3JQJA 4TLQA 3MM7A 1RB0A 4C8ZA 1QVGR 1HLWA 3IRXB 3K5LA 3MR6A 2UZAA 4CT8A 1XNQJ 1RTIA 1KAYA 1K9MT 4Z4GA 3HD2A 4RO0A 2FJXA 3VAJA 4ZPDA 2P6SA 2P9UB 1YHQS 2HVZA 2ZKTA 4H4OB 1XMQK 2M8DB 4USHA 1WSJA 2FB0A 4JI3J 1UZDA 4DZ6A 4Z7YA 3CWJA 2ERRA 3ZSZA 4OYWA 4FJHA 4HTUA 1SH2A 2B9WA 4FJ7A 1NSQA 2OD4A 4W5TA 1NPKA 4CRJA 2P9LB 1PBAA 3QAUA 4K4VA 1KFSA 3ZYYX 2MZRA 3KKRA 4C0OC 4MJKA 3LPYA 3SV4A 4OZ3A 3MM6B 1V3SA 2RQMA 4ZVEA 3C7NA 4ECRA 3VEOA 3E1YA 3OVNA 2Q0UA 1JWWA 2RT3A 3HDSA 3MMCA 4JI0F 3C6UB 1VHXA 5C12A 1KQSM 5FRNA 4J2DA 4YY3J 2A3JA 2BZ2A 4NYZA 2PDAA 3M8QA 2DNOA 3IG1A 5KTQA 3RG6A 4Z4FA 3H20A 3ZTSA 3FVYA 2NYHA 1J5EF 2RJZA 1UVIA 2MKHA 5EOYA 4CBWA 4LR7A 2DR7A 4JV1A 5GIOA 4FNIA 3AO1A 5EUHA 1VRUA 2AP6A 1JJCB 4F4WA 2E8AA 1Y11A 3MMAB 4CLPA 3T3FA 3RW7A 1WKLA 4J9NA 5D0HA 2IYGA 5B8HA 4ZLPA 1YBAA 3D6RA 4CF1A 3E9LA 2PI5A 4EI2A 4PXCA 3KLVA 2HFNA 4XK8C 3NFAA 4X66F 2CAJA 3PFEA 4BBYA 3LUYA 4RUBA 1O6XA 3NGSA 2D0CA 3AA4A 1NB2A 1YSJA 3TTFA 2RILA 4OYZA 4IYQA 2CJXB 4Y1DA 1S72S 3T9ZA 5LY3A 2JFDA 3SNNA 2WVFA 4HH1A 3TZZA 4FZYA 3IBCB 2DNMA 3SCLE 3M8RA 5BR8F 2UU9J 3KNGA 2QYCA 2Q79A 7AT1B 4QR1A 4WK1A 1ZZFA 3U3YA 5I42B 4B02A 3DMJB 4DG1B 2G13A 1NJIT 3HFKA 4LRAA 3L4BC 3VQEA 4ZPVR 4M41A 4ZVPB 1JJHA 3O3FA 2FGCA 3GMGA 5HJXA 1Z25A 3EZWA 4FLXA 1RBAA 1D4XA 3ZSWA 5GAHP 4DX7A 2YHAA 3OYJA 5CQGA 2B5JB 5B09A 3SI8A 3R5CA 3I5CA 3MPUB 3QGIA 4FN5A 4J5OA 4P7VA 5EWGA 1VBZA 2J0SD 2NXEA 3DLKB 2HPUA 3TJ8A 2ASJA 4KY3A 1TV6B 4DQQA 4C1NI 4IOBA 2IVOA 3J7ZO 4Y2KA 3MN5A 3PJ9A 3QT6A 3R7SB 3IBWA 4DV7K 3MAHA 2RU3A 4ED7A 1K73O 2NUUG 1RABB 3PJWA 2W7OA 1X4DA 2P51A 2QEXN 3ID6A 2E29A 5ADXH 3I4PA 4E7LA 2G8WA 2XLIA 3HZGA 2Z4PA 3OFFA 4NEZA 3P31A 4JBCA 3HYFA 3OYFA 2OA8A 2J6SA 3C2PA 1TL7A 5GIPA 1SJ4P 2V34A 2V63A 3AD9C 3SAHA 3N6LA 3QBCA 4FJIA 1QVFR 1HBNB 4O0JA 3HI0A 1RT6A 3W2WA 4WFNQ 3LDQA 4G1IA 4PKDB 1V3RA 1KN6A 4QU7A 3WEEA 1SQKA 3DLLL 5B0CA 3UKUB 3A8KA 4E3SA 1DQAA 1Y0HA 3R5BA 2VD3A 4OHVA 2Y1JA 3D9BA 2R9LA 5A8RB 3D0HE 3QESA 3IR7B 3EXCX 4KFBB 4GW6A 3AY9A 3POTA 4C9DA 3LP1A 3TAGA 2W6KA 1O0PA 4Q0BA 4NXMJ 4EYIB 4ECXA 2AT1B 3AVFA 4GO5X 2LVWA 3CD6N 3S8SA 3S3MA 2JNJA 3T1HF 2D74B 2MY7A 4U8VA 5AJ3K 4ECZA 3LOUA 3D2FA 2AZ3A 2W24A 5IFMA 8ATCB 4FWNA 1F9HA 3CE8A 4DQSA 4OPAA 1EKRA 5E3QA 5KAKA 3ZT0A 1OH7A 3RBZA 2YNGA 1DTTB 1C6VA 2RQKA 1S1TB 2EX3A 1Q86O 4CLFA 1TKTA 4K4XA 1NAQA 1HMVA 3Q7BA 4USKA 1AT1B 2DIUA 2R2UA 2P9SA 4NCGA 1NCLA 1N33J 5AZJB 1M5SA 1ZOTA 4NLGA 1RU1A 2V8VA 3BKTA 3W3SA 3E3XA 3W2VB 5FD1A 3WC2A 2HNZA 4XH5A 2RKIB 2J0XA 3IS9B 2DNPA 5CYQB 1TFYA 5IWAF 3NF7A 1EJ7L 3OTCA 3JS6A 2ZJQL 4CERA 1RDBA 1WSEA 4JB8B 4AQYK 1RDUA 2MEWA 3FRYA 3ZSXA 3R5AA 4X4QA 2NLWA 1I39A 3WNGA 2DTUA 3AY0A 3G2XA 3C3LA 2CFXA 1NU4A 4DTMA 4USMA 3JTOA 2CZVC 2IJRA 4K0KF 2R7UA 4OLOA 4EP5A 1TMJA 3QLHB 2F1FA 4ZLLA 4RW9B 4B9SA 3I9V9 5GMDA 3CCQN 1WEYA 2D3UA 1BUXA 3AVAA 3AQPA 2PFDA 4CZHA 4IOXA 1U49A 4CP5A 1C1BB 3L2UA 2ZKUA 4J9PA 3WUHA 4NCBA 4BACA 4MK7A 2R7VA 2PIIA 4GV3A 1RWVB 2Y1LB 2CWKA 2JRSA 3I87A 4NLOA 3BGOP 2RIJA 1T9VA 4YHHF 4O5BA 2H5JB 2VDIA 4JKFA 5M1FA 2K1RB 4GKJJ 2BTFA 3FQLA 1KOHA 4ATNA 1FKOB 2EFVA 1SPBP 1XMOF 1YBTA 3AXMA 2D1CA 2EFNA 2OUGA 2W9CA 4K4ZA 4KO0B 3ZCMA 5LXYA 4NOHA 2ZZMA 4PWWA 5GAGU 1HFEL 5L9NA 2FPHX 3PKYA 1HQUA 2LEBA 2HBKA 4GMJB 2KYXA 2W1BA 3G8QA 1ZA1B 2BV3A 1JK9B 1N36F 3IN5A 1GOAA 3W62A 3TO8A 1UVLA 1WD6A 2R8KA 3D28A 4KV8A 3KWGA 5AXKA 3AHPA 3V4IA 2MQ8A 3VQCA 3ZZPA 3H40A 2ROGA 5HVGA 3O6QA 3KWIA 4DTXA 4LF7K 1FO1A 2XY7A 5G0RA 1QVFM 4OI3A 3TJAA 1VQ9S 4PKGA 4W5QA 3TRGA 5EXWA 1S49A 2HZVA 4BRLA 4M94A 1VRTB 1HA1A 4BVPA 5AQRA 4DV0K 1U0SA 3ATUA 3B54A 2EWHA 1XERA 4WF9L 3ENHA 5M2RA 5KG3A 3H59A 4CJ4A 2F7TA 4ZVFA 3BO3A 4FWQA 2GIRA 2MKJA 3GIRA 5HROA 1UA0A 1QQMA 1IBLF 4CH1A 4J9UE 3UWTA 4ZVQB 2LEAA 2B9XA 4P2SA 3RAMA 4IFYA 2WOMA 3ET6A 3FQKA 1BQXA 3RYLA 1FERA 2HFSA 3CFRA 3MM8A 2D9OA 4NWBA 1V5IB 5IT4A 1HR0K 3QGPA 1KSPA 1XK8A 1Q18A 1L3KA 4Q8EA 2YKMA 1O13A 2W8LA 4DQRA 1OH5A 2XULA 3I55N 1HNWK 1Q9YA 1BQNA 3AO5A 4MH8A 2G0IA 1CJTA 4JI2F 2QA4S 2QJ3A 1XEZA 3PR5B 2MZSA 1M5OC 4ZVGA 3GFZA 4YQWA 4ICLB 4DV1F 3N9UC 2B4UA 1VQ6S 5LMUF 1A5XA 1RTHB 3ULEA 4E8UA 4FS2A 1GMWD 2G8VA 4K2XA 1CULA 1A7GE 2CQBA 1ASWA 4C0BA 1S6UA 2B8PA 3HSDA 4KTQA 5IT0A 4B1WB 3A0IX 4BRIA 4PKHA 3H2LA 3CXCR 1ZXOA 3G96A 2HLUA 3QEIA 3QWUA 3OR1B 3LZJA 4QPXA 3PV8A 4NLBA 3DJCA 4FK4A 4F8RA 1U8WA 1VQMN 3HVWA 1SI9A 1R0CB 5J1EB 1URNA 3FE1A 1VK3A 3CCUS 1FJEB 2ZD1B 1FRKA 1ZPVA 3S7RA 4JI7K 1AYEA 3OYGA 3X3UA 2OPQB 1YJ7A 5KG2A 2CVEA 4OJ1A 3MR7A 3FMWA 5B0EA 4R25A 4LF4J 2CNNB 3LGNA 5A2QO 5AXLA 1R89A 4F36A 3D67A 1N5VA 2D4WA 2UVVA 4JKGA 2HIYA 3OTOF 1ZBHA 1IVZA 1JCFA 3F0NA 2BACA 3RB0A 1XMBA 5KT5A 4M42A 3BBFA 3ZX3A 4GKKK 3TARA 1JJ4A 3RMDA 2HW3A 4LF9K 3OUYB 2LXIA