5J1EA

Crystal structure of a hydroxypyridone carboxylic acid active-site rnase h inhibitor in complex with hiv reverse transcriptase
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
550
structure length
541
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 DOMAIN
publication title Design, Synthesis, and Biological Evaluations of Hydroxypyridonecarboxylic Acids as Inhibitors of HIV Reverse Transcriptase Associated RNase H.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/transferase inhibitor
total genus 133
structure length 541
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j1eA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j1eA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j1eA05
4O44B 1QS4A 2ZKUA 1KHWA 3CFPA 1NKBA 4FLTA 2DPJA 4CJWA 4DQPA 4OJRA 3AO4A 1KFDA 5HRRA 2ZE2B 4JV0A 2OA8A 2HVIA 3KLFA 1WAJA 2G8FA 4OLAA 2P5OA 2R7YA 1TVRA 4M3RA 1L3TA 4ZP6A 4K4WA 1RDCA 1F21A 1T03B 3QETA 4TSXA 4ED3A 5KFKA 1K1QA 3PW4A 4RNFA 4FJLA 3TVKA 2ALZA 2IJNA 3OYEA 4NYFA 4FJXA 3HP9A 3AA2A 4FJGA 4QWEA 1XR6A 4DLEA 3TAEA 5EU7A 1JLAA 5F8NA 3TAMB 3VQDA 4IG0B 4Z4IA 3KIOA 2JGUA 1L3SA 1Z4UA 2WCXA 4EBEA 3LP1A 3QEPA 2UVUA 1UOCA 2XCPA 4DQSA 3L2RA 3M9MB 3KKSA 3VN5A 4O0JA 1K6YA 3OYFA 3BGRA 1KHVA 5I42B 5J2NB 3OYIA 3QLHB 2HNDB 3G6YA 1U4BA 3NF9A 1C2PA 1CZ9A 3SPYA 3H5SA 4IG3A 1JLGB 3Q8SB 3NGYA 5KI6A 1XR7A 4HYKA 3T5KA 3OS0A 3MEDB 4E3SA 5KG0A 2W7OA 3L8BA 1TKZA 4URSA 1QAJA 1NOYA 2BR0A 1RDDA 5KRTA 4DTMA 3LDSA 4NLSA 4JV2A 5KFEA 3EZUA 5DK5A 1S49A 4NCGA 2D41A 4DLGA 1RTJA 3MEEA 3TAQA 4CEFA 2AX1A 3M8RA 4U6PA 3OYMA 3QIDA 1TV6A 1RT4A 4N47A 4DTJA 4IR9A 1S0OA 5J1EB 4H8KA 4CGGA 1U09A 3E01B 4FLVA 3S3OA 1BI4A 3TQ1A 1L3UA 1QSYA 3VQCA 2IC3B 3M8QA 3DRRB 2VG5A 5KFCA 1QQCA 1EETB 1JLFB 3I5CA 1NK9A 3I0RB 1BIZA 3D0PA 4DSFA 4LQ9A 2WB4A 4QOZB 2W9CB 1TGOA 3OL7A 3PX0A 3V9ZA 3TAPA 2XY5A 1LWFB 4ID5A 4O3PA 3ASMA 4DL4A 5HRPA 3RB3A 2W42A 1IH7A 4N41A 3F9KA 3PVXA 4AILC 4C8MA 1EXQA 3HVTA 3U3GA 4M3XA 5K14B 1S1VA 4CF0A 3O3FA 5FROA 1HNIA 3QGHA 3KLGB 4GMJB 3MTKA 4FZXC 3LALA 1A5VA 4CHPA 4RW6A 5F8LA 4J2AA 4J2DA 4CEEA 1KTQA 4O44A 3UIQA 2Z1HA 3DRPB 2VWJA 3C6UB 1VSFA 4ECZA 2XI3A 3IGVA 1OS5A 5FDLB 4Z4HA 4W5NA 5KFSA 5F8HA 3PW2A 1JIHA 1T03A 5HRSA 3RB4A 4O3OA 4M3YA 4H4OB 2Z1JA 3OLAA 2VA3A 4DL2A 4ECWA 3HYFA 4AHUA 4E7LA 3IS9B 1RYRA 3B6PA 4Z4GA 4CJRA 3MXIA 5DG8A 4J9PA 2KW4A 1XR5A 3TAMA 3V1QA 4EO8A 2AWZA 4QWAA 1S10A 1C0UB 4HTUA 2ZQBA 2B6AB 4IG0A 4K50A 4KHSA 2GUIA 4XPCA 4F2SA 1LW0B 1Y97A 3M8SA 3DOLB 4DL7A 2FLPA 2YNHB 5FRMA 3OS2A 3CJ5A 2R2SA 4CK1A 1G15A 1DTTB 1VSKA 3UQSA 5I3UB 4K8ZA 5I42A 2RDJA 5J2NA 5KFNA 3QLHA 2HNDA 4Z4FA 2VG6B 4KI6A 1BCMA 1JLGA 4R5PB 4DU1A 4YR2A 4DTPA 3THVA 4CEDA 3MEDA 2ETJA 2EC0A 4BDPA 3HP6A 2KFNA 3DLRA 3TABA 5KFIA 3MFIA 4IKAA 1BQMB 3DM2B 1YTAA 3I5BA 3OYGA 3NGZA 1NOZA 4FJNA 4B8AB 1ITGA 2WHOA 4O5BA 4F4KA 2G8VA 2EHGA 4DTNA 4W5RA 4ZPBA 5C25B 4DQQA 3L2WA 2DPIA 3AO1A 4DQIA 1C1BB 3ZT0A 2JEJA 3VQ6A 3DRSB 1QAIA 4RZRA 2JEIA 5J1EA 1S0NA 3ITHB 1HQUB 1HQEB 2VA2A 3E01A 4NCBA 3KLHB 3S3MA 4R0EA 4ELVA 2IC3A 4CHYA 4ZPAA 1B9DA 3DRRA 3TAGA 1L5UA 1EETA 1JLFA 4Q0BB 3KLVA 3I0RA 3QO9B 3DLHA 5EWEA 2W9AA 3OVNA 2W9CA 3O3HA 1XI1A 4ZMMA 1FKPB 4YP3A 5KT3A 1J54A 3KJVB 1BQNB 2RN2A 4B9MA 4GVMA 3BREA 3Q8QB 2R8HA 2V9WA 1JXEA 4OKKA 5K14A 2NUBA 1UAXA 4ECUA 3NAHA 3V6JA 4ZVEA 1K1SA 5KFLA 2W9BB 3G6XA 3KLGA 2GC8A 2PYJA 2HNZB 4Q8EA 4DS4A 4QPXA 3GYNA 1WN7A 3DLBA 3DRPA 1I3AA 3C6UA 1WNSA 1X9SA 5DLGA 4W5OA 3N6NA 5F8GA 5FDLA 3FDSA 4FJ5A 2G8KA 1GX6A 4DSEA 2RPIA 3L3VA 4M3TA 2X6NA 3HPHA 4CEBA 2YKMB 1VSMA 3AO5A 4H4OA 1KLNA 3LANA 3AVJA 3IS9A 3UR0A 4CCHA 4M3UA 3SQ2A 3V1OA 4K4XA 1T05B 4ZP7A 4URGA 1C0UA 3DLEB 4JUZA 1A5WA 1TKTB 3K5LA 2B6AA 1LW0A 3DOLA 3I8DA 4KHRA 3DLGB 4TY9A 1W25A 3NE6A 2YNHA 2OZSA 4CESA 1VRUB 3RMCA 4CF2A 4MQ3A 3GILA 3NFAA 3NF8A 4C8NA 4M41A 3AA3A 1DTTA 5I3UA 3OHBA 5CZ1A 3CDEA 3PR5B 4CEQA 2VG6A 3T3FA 4OPKA 4R5PA 4ZHRB 4YR0A 4MH8A 3SUPA 2KFZA 4URQU 4LH5A 4KFBB 3U6FA 1RA7A 1Q8IA 3D45A 4KTWA 5DQHA 5KFDA 1BQMA 3AVCA 3DM2A 1LAVA 2WONB 3NH0A 3PO5A 2Y1JA 5KFVA 3PHEA 3DMJB 3GIMA 3CDUA 1L3VA 2R8KA 1RBTA 3RBEA 5C25A 4DSKA 2C28A 3FRZA 1HMVB 2FVPA 5KFMA 2HHSA 3G10A 1S0MA 1C1BA 4CGHA 3DRSA 2YV0X 3RB6A 3ITHA 2B4JA 1HQUA 1HQEA 3LAKA 3KLHA 5EUHA 4OKEA 4AHSA 3SV3A 2D0CA 2WK4A 3T19A 4E1NA 1NK7A 1T3NA 1HYSB 2FVRA 3PR4A 3IG1B 4OGEA 1J9AA 3KLEB 3QO9A 1WSGA 4FLXA 2V4QA 4B08A 4NLDA 1FKPA 1RYSA 3PO4A 3OLBA 1NK4A 3NGDA 5KFQA 1RT3B 3KJVA 1BQNA 3MR5A 4I7FB 4R8UB 3V9WA 3GV7B 1JKHB 1QE1B 5KFJA 1BHLA 1REVB 4H54A 2FJVA 3HHKA 1D5AA 4KSEB 1U47A 5T7BA 5KG1A 4CHQA 2W9BA 2J6SA 1VSIA 3P5JA 4CHOA 4RW9B 2HNZA 3GV5B 4PY5A 1HJRA 3T5JA 1WAFA 2RKIB 4O0IA 3ZSXA 3V6KA 5F8MA 5KG2A 2F96A 3HM9A 2HHQA 3H5YA 3K5MA 4EBCA 3CM6A 1LWCB 2GV9A 2KZZA 3O4NA 2D5RA 2F8SA 2F8EX 2YKMA 1GOCA 4IR1A 4Q45A 5EWGA 2E9ZA 4XO0A 2FVCA 5C5JA 3V6DB 2AGOA 3PW5A 1Z25A 1T05A 1D9FA 1T7PA 4Z0UA 3DLEA 5HRNA 1TKTA 1GX5A 4BE1A 3HK2A 1RDRA 4J9LA 3MEGB 4Y1DA 4J9QA 2P5GA 3IRXB 1VSJA 3O3GA 2HHXA 3DLGA 4JV1A 2OYQA 3H40A 1J5OB 1VRUA 1MMLA 3PV8A 3ISNC 2WOMB 1NJZA 1JLBB 3BSOA 5CYQB 2HWHA 4KV8B 4Q43A 3OYBA 5KFAA 3NCIA 5L9XA 3MXJA 2G8WA 4IDKB 2PYLA 4F4YA 1RNHA 4ZHRA 4RUAA 3M9NB 3L3UA 4KFBA 2EX3A 3VQSA 4C8LA 3PX6A 2BANB 4HCBA 3LP3A 3SZ2A 4E7JA 2C22A 4CF9A 1N4LA 2WONA 4ED7A 3DMJA 4TLRA 1WSHA 2UVRA 5JS2A 1TK5A 3QINA 3IN5A 1KFSA 1TAQA 2QKBA 4J9OA 2DTUA 4WE1B 4DL3A 1HMVA 4I2QB 4KHNA 3CJ0A 4FVMA 3PZPA 2Q3SA 4RG8A 2HHVA 3L2UA 4DEZA 4EP4A 5F9LA 3H59A 2IM2A 4RU9A 2FBXA 1WSJA 1HYSA 3IG1A 4EZ9A 4MIBA 4HVJA 4F4XA 4H4MB 4F2RA 4IFVB 3KLEA 3E51A 3ISND 1IKVB 4FJ8A 1NK6A 3CIZA 3CG7A 4DSJA 4BE2A 3KD5E 1A5XA 2CJQA 2Z1IA 2JC0A 2HHTA 1RT3A 4WFXA 3NAEA 4FLWA 4I7FA 4R8UA 4RW8B 1JKHA 1QE1A 4CF1A 1REVA 3AV9A 4Y3CA 3RWUA 4CGFA 2B5JB 2W8KA 1RT6B 3VQ5A 4J9NA 3OYDA 3V81B 1VSHA 3SFGA 2IJFA 4HUFA 4RW9A 4ECYA 4CGDA 3H4DA 4C8KA 4CJQA 2IDOA 2RKIA 4HUGA 3AVBA 5J2PB 3CWJA 4EEYA 3C6TB 1WSFA 2XY6A 1JXLA 4J9MA 4FJMA 1LWCA 1SUQB 5KFUA 3HKWA 4RNHA 3KKRA 2OPQB 3N6MA 3KOAA 3DYAB 4KO0B 1X9MA 3AO2A 2JLEA 4FW1A 5SWMA 4JS5A 3LAMA 3WNGA 1YT3A 4TYBA 2FJXA 3ZSVA 1VK0A 4Z4CA 3V6DA 1QSLA 4GC7A 2ZD1B 4NZ0A 4E7IA 3ZT2A 1C1AA 3PJXA 4DFPA 4ZTFA 1I39A 3EYZA 4AHTA 1KRPA 5HP1B 1CZBA 1RT5B 3MEGA 3CFRA 2I5JB 3IRXA 5SZTA 3OYJA 2Z1GA 2W7PA 5F8JA 3P1GA 3QZ8A 3QZ7A 1J5OA 3VQQA 3RAXA 1FXXA 5CYMB 3DI6B 3EPIA 2AX0A 4DQRA 3OYLA 2WOMA 1JLBA 2X78A 3DOKB 1T8EA 5CYQA 5J2MB 3BQ2A 2GBZA 1JL1A 4MIAA 3CDWA 4KV8A 4MKBA 3ALYA 2R8GA 4IDKA 4I2PB 3P83D 2QKKA 3QEIA 3VQ9A 1GOAA 3BSNA 4TXSA 3OJSA 2BANA 3FSIA 1CSJA 5KG3A 5KFHA 5KFOA 2QXFA 3RRGA 4RNNA 2OPSB 4IQXA 4BDZA 4TY8A 4K4ZA 4CFAA 1DLOB 1U48A 4WE1A 4I2QA 3DDKA 3WNFA 3V9XA 1LW2B 4ED0A 4OL8A 1JLCB 4J9KA 3TWHA 2HNYB 3GV8B 2D0AA 4FYDA 2X74A 2R2UA 5KFYA 2IBKA 4B3OB 3EY1A 3Q8RB 5EWFA 2R8IA 4ICLB 2IMWP 2D3UA 4H4MA 4IFVA 2OPPB 5DG7A 3BQ1A 2AU0A 1IKVA 4ECSA 4KAIA 4LH4A 4ZPDA 3T5LA 1HNVB 1LAWA 4OVLA 4FM0A 3HSTB 2KTQA 3OJUA 4KHWA 4FJ7A 4WFYA 3RBDA 3NMAA 4N56A 2FVQA 3M9OB 4RW8A 3LPTA 2FBVA 3RMDA 4F50A 5KFTA 2R2RA 5DMRA 4AHRA 4ID1A 2FBYA 2B5JA 4CIGA 3HXMA 5HBMB 2YNGB 1RT6A 1D1UA 5DGBA 1UWBB 4CIFA 5KTQA 3V81A 3SQ0A 2F8TA 4FJ9A 2AGQA 4IBNA 3SFUA 4DSIA 4LSNB 1RT1B 3DLKB 4NRUA 1D9DA 1CLQA 1KLMB 1S6QB 1O1WA 4G1QB 2FBTA 3CO9A 3LP2B 4KE5A 1N5YB 2G8UA 2BGGA 5J2PA 3ZT1A 4RNOA 4IH6A 3QNOA 1VSEA 2A1SA 3C6TA 3L2VA 4ZTJA 1QHTA 5KT6A 2YNIB 3HPGA 1SUQA 3ZCMA 2OPQA 3NKYA 4ECVA 3UDLA 2JEFA 3SQ4A 3DYAA 1TL1B 4KO0A 4J9SA 4KB0A 2ZD1A 3SUNA 2XO7A 1TL3B 1SKSA 1SKWA 5HP1A 4HKQA 2LSNA 1RT5A 1NK8A 3SQ1A 1NNDA 3VQ8A 3CJ3A 5DQIA 2I5JA 4EBDA 3WNHA 2OZMA 3QGGA 2J6TA 3KHGA 2XRIA 2ASLA 4PWDB 3NGIA 5CYMA 3DI6A 4ED2A 4N5SA 4DTRA 4MKAA 3DOKA 1S9GB 4M94A 3CQ8A 5J2MA 3OYKA 4RW4B 3VQAA 4ED1A 2FJWA 4FBTA 4WZQA 5KGWA 2BE2B 2C2DA 3HVRA 4J2BA 1U49A 3G86A 4IRKA 4I2PA 5CZ2A 2HHUA 5JUMA 3RMBA 5KG5A 4F3OA 4RUCA 1LWEB 3H5UA 3Q8PB 4TYAA 4ECRA 4FZZA 4CJEA 3OSPA 1KVBA 4KB7A 3LWLA 3AVKA 4K4TA 2D0BA 1SH0A 4K4UA 1RCHA 1HYVA 3VQBA 3BSCA 2OPSA 3I5AA 3KTQA 3OYNA 1DLOA 3OL6A 2DFFA 5F9NA 5KFRA 1LW2A 1JLCA 2HNYA 3LZJA 1U45A 3OSNA 3AVAA 1IKXB 1S97A 1C1CB 1QTMA 1B9FA 4NLPA 4CK3A 4B3OA 2RDIA 3G6VA 4ICLA 2UVWA 2OPPA 4DTOA 4CGIA 2XCAA 2R8JA 4CJ4A 4RNMA 2UVVA 1HNVA 3K58A 3PUFA 3NH1A 1NJXA 5KFZA 4O3NA 3LP0B 2P1JA 3SCXA 1TK8A 4CHNA 2OPRB 3RR8A 3LWMA 1HARA 3KK1B 5KG4A 1XHZA 2B43A 5HBMA 4OPJA 2YNGA 2IS3A 2XY8A 1RILA 1N56A 1UWBA 4MK7A 4CGJA 4IOBA 1VSLA 4OGCA 1SV5B 1RAJA 1YVUA 4LSNA 1RT1A 3DLKA 1KLMA 1S6QA 2VWKA 1S6PB 4G1QA 4O4RA 3FFIB 2BDPA 3LP2A 3SV4A 4DU4A 2IOCA 1N5YA 1XWLA 2PZSA 4IH7A 3SNNA 1EP4B 2RF2B 4CIEA 3AA5X 3GIKA 2E9RX 4DF4A 1Q9YA 2YNIA 4IFYB 4LY7A 3WNEA 3I0SB 2C2RA 4NYNA 3VQPA 1KVCA 1NJYA 4HCCA 1TL1A 1VRTB 4FLZA 4PUOB 1MU2B 4EZ6A 4O3QA 1U04A 1JX4A 2ITGA 1UA1A 4KI4A 1TL3A 3H2LA 2YHAA 3BR9A 4DF8A 2XI2A 4FM1A 3ZSRA 4QCLA 3HVWA 1JXBA 4ZPCA 4E89A 5KFFA 4KHQA 4PWDA 3SI8A 4HUEA 4FLYA 4MFBB 4YMEA 1S9GA 2BRLA 4RW4A 1CXUA 4WZMA 4FK0A 4C8OA 2E4LA 3QERA 2BE2A 3GIJA 4KB1A 3HO1A 4CFBA 3C95A 3RTVA 4RW7B 4IRDA 1BL3A 3MFHA 2IAJB 1LWEA 4K8XA 1S4FA 1S1UA 4BWJA 4DG1B 4CJLA 4ELUA 2KQ2A 1DTQB 5DG9A 4KREA 1WSEA 4EYIB 3CJ4A 1SH2A 1RBUA 3MR6A 3T5HA 1ASWA 1VSDA 1W0HA 4QWDA 4DFJA 4B8CA 2O4IA 1KCFA 1J53A 3A2FA 5F8IA 2XGPA 4WXWA 4CJFA 3QESA 4NLOA 1IKXA 4F4WA 3OYHA 4NYZA 1IKYB 1C1CA 1TK0A 1KSPA 3TANA 3BQ0A 5D3GA 4J9RA 3OL9A 2YNFB 3NF7A 1S9EB 3LZIA 4IRCA 4B9UA 4OLBA 5HLFB 2E6LA 1HPZB 4Y2CA 4TY8B 2D3ZA 4U7CA 3TR8A 1ASVA 1S5JA 3AO3A 4JRPA 2DFHA 4ZP9A 1IM4A 3LP0A 1S1TB 2DY4A 1C0TB 2OPRA 3NF6A 4LD0A 4N76A 3KK1A 4WYWA 2E9TA 3KMSA 5KT2A 4PQUB 4QW8A 3BJYA 3HPOA 4E0DA 1SH3A 2HAIA 1SV5A 4QAGA 1JLQB 4FBUA 2IGIA 5KG7A 4ED6A 2AGPA 4EO6A 4NLYA 4Q5VA 1S1XB 1S6PA 4DWIA 3FFIA 3QNNA 5JS1A 3K59A 3JSMB 4CK2A 1QSSA 1ZBIA 4I9LA 1EP4A 4EYHB 2RF2A 4BE0A 4KAZA 4E7KA 2BRKA 1JL2A 4IFYA 4EP5A 2HHWA 5KFGA 3I0SA 1BCOA 4ZVFA 3MR3A 4NLWA 4W5TA 4WFZA 3NL0A 3SI6A 2W8LA 3AVMA 1VRTA 1GOBA 3CM5A 3VA0A 4PUOA 1MU2A 2XWYA 3KHRA 4DTXA 4FCYA 3RMAA 4K4YA 2HWIA 4CEOA 3SUQA 2I1RA 3V1RA 1RTHB 4DL5A 1FKOB 3KHHA 4WXOA 2OH2A 3ZSWA 3ZT4A 1NHUA 1BIUA 1HRHA 3QGIA 1X1PA 4CJ3A 1D0EA 4CJPA 4DTUA 3V4IB 4NLTA 3QEVA 5JXSA 3S9HA 1S1WB 5CY4A 5KT7A 1EKEA 4DTSA 4MFBA 4E1MA 1IG9A 3MF5A 4BWMA 2IM3A 4FS2A 4OKJA 2ATLA 1Z26A 4I9QA 4NCAA 2ILZA 3HVAA 4Q44A 2FLLA 3AVFA 4RW7A 4KHMA 1UA0A 2BQUA 2IAJA 2YHBA 2PY5A 4HHTA 4DS5A 1RT2B 4GC6A 3O4QA 1RTIB 2V4RA 4DG1A 2E6MA 3IAYA 2JC1A 3ZSOA 1DTQA 4F4ZA 3KK2B 1ZBFA 4F8RA 3UPFA 3D5MA 4M3ZA 3NBPB 3OY9A 3K5NA 4TQRA 1R0AB 5KGXA 4O55A 4Y34A 4XPEA 4KKOB 2AJQA 2ZE2A 4BDYA 2O5DA 4TQSA 5L1IA 3HT3A 3QYYA 5KFXA 4FJIA 4O4GB 1I6JA 4W5QA 1HYZA 1IKYA 1IO2A 4NLXA 3MAQA 2YNFA 2JEGA 1S9EA 4M42A 3T1AA 3KLIB 5HLFA 1NK0A 2XGQA 4FW2A 1HPZA 1RTDB 4ECTA 4K4VA 3CYMA 4PA1A 4ECQA 1QUVA 3M8PB 4NRTA 3KNAA 4UQGA 3GQCA 3FQKA 3AVGA 5KFWA 1NJWA 1S1TA 5J2QB 4K4SA 4ZP8A 3VQ4A 2QK9A 1C0TA 4WYLA 4CJVA 1N6QB 3QIOA 4DSLA 1RT7B 4DMNA 4PQUA 4NLVA 4KRFA 3PY8A 5KG6A 1WSIA 4KTQA 4LSLB 1JLQA 1CXQA 4CERA 3EZ5A 1S1XA 3IGNA 2FVSA 4X2BA 4JS4A 1WLJA 5EDWA 2ASJA 3JSMA 4BACA 4FJHA 3G0ZA 1ASUA 4GW6A 4CECA 5L1KA 1WNEA 3CVKA 3AA4A 4MK8A 4DL6A 3TARA 1SL2A 1D8YA 3KD1E 1BGXT 1ZBHA 5KFBA 4YQWA 5KRSA 2A1RA 1SL1A 2ASDA 4QW9A 4E19A 1IKWB 3CJ2A 1X9WA 3LPUA 4AHCA 2UUWA 3AVLA 4NLUA 4ZVGA 5FRNA 3RRHA 1XC9A 1RTHA 4ED8A 1FKOA 1BISA 2Y1IA 3QIPB 1EX4A 1SKRA 3SUOA 1FK9B 4G3IA 3GIIA 4FS1A 2QV6A 2XY7A 4FJKA 1RDAA 1KVAA 2R2TA 5KFPA 3AVIA 1B92A 3C94A 1ZTTA 3V4IA 1S1WA 4O3SA 5E41A 1YTUA 2HVHA 3QEWA 2IM1A 2XHBA 5C24B 4JRQA 3PX4A 1XHXA 1LWFA 2V0NA 3MXMA 3OS1A 5KT4A 3SPZA 1JLEB 3U3YA 4KPYA 5DLFA 4CFDA 5C42B 3OL8A 5HROB 2HMIB 2YKNB 4M45A 1RT2A 1RTIA 3KK3B 1SL0A 3TAFA 2DFEA 2AQ4A 1RBSA 4FM2A 3KK2A 3D28A 3SYZA 3VA3A 3F73A 3NBPA 5L1JA 5KT5A 1R0AA 3KMQA 3ZSQA 4KKOA 4CJUA 1Q9XA 3EPGA 4B9LA 4TN2A 1W9HA 1ZYQA 1T94A 3OYCA 1TP7A 2GIQA 3ZT3A 4FK2A 4KHYA 4O4GA 2XC9A 4CJSA 3JYTB 4CEZA 2VG7B 3K2PA 1TKXB 3K57A 4AH9A 1S1UB 2FLNA 4ELTA 3KLIA 3RR7A 3MECB 1RTDA 2UUTA 3RB0A 4DFMA 3KHLA 4M95A 3K5OA 3M8PA 4ECXA 2ILYA 1RDBA 2G8IA 3MR2A 4QWBA 2KZMA 5J2QA 4CHZA 3KLFB 4CE9A 3H4BA 1N6QA 1TVRB 1RT7A 3ULDA 4Y1CA 4NLGA 3ICLA 3CFOA 1TQLA 3H08A 1NHVA 4NLQA 3V6HA 4B9NA 1RA6A 5D3GB 4LSLA 3FQLA 1NKCA 3NH2A 4B9SA 1ZETA 2ATQA 2X6SA 4CEAA 3VQEA 4CF8A 4KBIA 3AVNA 1JLAB 4M3WA 4E7HA 2WRMA 2CKWA 2HB5A 3AVHA 4FXDA 2O4GA 2P51A 3TI0A 1N48A 4FJJA 3RAQA 4DU3A 2GIRA 4XIUA 1ZTWA 1LV5A 3OHAA 4L8RB 3S3NA 3LP1B 4CJTA 2G8HA 4KTZA 3NDKA 1ZBUA 3H5XA 1TAUA 4B9TA 2IA6A 3PW0A 4CJKA 3BGRB 5DGAA 4IKFA 1IKWA 1RBRA 4QWCA 3H98A 4FLUA 4IG3B 3QIPA 2J6UA 4Y2AA 4J2EA 1FK9A 3BDPA 1TKZB 5T14A 4NLRA 4CJ5A 2C2EA 4O3RA 4YNQA 4Q0BA 1S48A 2BQRA 1C6VA 3N6LA 3V9UA 4NCGB 5C24A 2D7SA 1RTJB 3MEEB 4CFCA 1NKEA 4MK9A 3BSAA 5L1LA 1TV6B 4FZYA 1JLEA 1RT4B 3NAIA 5C42A 4KHUA 4YR3A 5HROA 4Z4EA 2HMIA 2YKNA 1ZBLA 3PJWA 3KK3A 3L2QA 1TKDA 1BI4B 1S9FA 3VQ7A 4YFUA 4ZVHA 3M8QB 4AHVA 4IH5A 2VG5B 2FC0A 3HL8A 1NK5A 4FK4A 5DQGA 3ZSYA 3PW7A 4LQ3A 4B9VA 2BQ3A 3OYAA 3QEXA 4ID5B 3SJJA 3HJFA 2HW3A 4JLHA 3JYTA 3HVTB 2VG7A 2QE5A 1S1VB 1YVFA 1TKXA 4Q8FA 4DFKA 1HNIB 3B6OA 2IM0A 1C0MA 3NHGA 1RBVA 4RW6B 2WTFA 3MECA 3V9SA 3ZSZA 4F3TA
chains in the Genus database with same CATH superfamily
3MUTP 2ZKUA 5FPDA 1BQXA 3NGSA 2DPJA 4DQPA 4OJRA 4Y6IA 2HFVA 3TJ9A 1QDUB 1BE4A 1T9WA 1PC5A 4ZP6A 5IWAJ 1T03B 4ED3A 1K1QA 1XK8A 4DR1F 1AT1B 2JVRA 4OYPA 1VYAA 1XR6A 3TAEA 3VGMA 2CGKA 1JLAA 2V8HA 1D09B 1FRHA 2AJFE 4Z4IA 2JGUA 1NMEB 3D6FB 3EDRB 2GJFA 4CZEA 3GDQA 4XK8C 3M6VA 2UU9J 1X5SA 1PJ5A 1SQGA 4EHTA 5L8RC 4V19S 4I68A 5I42B 1PSDA 1F9FA 3OYIA 2JOQA 3VF0B 1X3MA 1CZ9A 3MWTA 3WQTA 3SPYA 1DKGD 5KI6A 4OZ1A 4HYKA 2Y0BB 3T5KA 5KG0A 3D67A 5LMUF 1XMQF 1NM1A 3OW2M 4AXJA 2IYIA 4DV5F 3CCQS 4NLSA 2DHXA 3QICA 1U6BA 3EZUA 2W2PP 3MMBB 1EARA 1GLBG 1FX4A 1S49A 4DV4F 4U6PA 1TV6A 4IFEA 3MDQA 5H1SV 4FXVA 3JXUA 4CGGA 1NGCA 1HR0J 4TKTA 1QSYA 2X7IA 4CNZA 2RRAA 3P3DA 4MLEA 2VG5A 5C2GA 1JLFB 3I5CA 3SXLA 4DSFA 4QOZB 4WQ4C 3OL7A 3PX0A 2FYXA 4ID5A 3IWLA 5HRPA 3RW7A 2PI4A 1IH7A 4B3RF 2OKQA 1WI8A 5K14B 2DR7A 3SBMA 4UZBA 4JD2A 3HBTA 1RCXB 2HOEA 2MQOA 1M5PC 5DJBA 2HF4A 2WVEA 3HOSA 1Q1KA 4GVEA 4J2DA 1IBLJ 4NEYA 2Z1HA 3C0BA 3IMXA 3DRPB 4BRGA 1FEEA 2VWJA 2NZ4A 4OHWA 1VSFA 2EFPA 2FZCB 4GV3A 2XI3A 3DJCA 3GFHA 1O5JA 4W5NA 3MAHA 1X4EA 3CE8A 1F9HA 1KQGB 2UXDK 3RB4A 3B54A 2O01C 3QFPA 4X62J 3IS9B 1RYRA 5IT9O 1R89A 5AFUA 2G2OA 5DG8A 2MB0B 2KW4A 4FWSA 1XR5A 3S6EA 2ZQBA 3O4WA 2EBEA 4LF7J 3W8GA 4KRWA 4TLQA 2P9EA 5JMNA 1X4FA 3ID8A 4M5LA 2YNHB 2HZVA 3BZQA 2YX4A 3CJ5A 3JAMU 1LK7A 4CK1A 3UQSA 2AP6A 4EIAA 1WF2A 1MN7A 3QRRA 2JWNA 2HNDA 4Z4FA 4DZ6A 3GL1A 2E1ZA 4FVCA 4M8LA 4C48A 1VI7A 3HSZA 1QJHA 3HHDA 4DU1A 1OSCA 4DTPA 3CJSA 3RSEB 2P6SA 2EC0A 1U2CA 3TZYA 2PI5A 3HP6A 1A9NB 2KFNA 1BA0A 5JVHQ 3DLRA 3TABA 2HRYA 3QRQA 3PEJA 3NGZA 4R0JA 2CAJA 3M1VA 1NOZA 4K7QA 4AQYF 5H9FK 1ITGA 1RK8A 2AJ0A 4JHDB 1KEKA 1HBOB 4W5RA 4DQQA 4DR3K 4JKFA 3L2WA 2DPIA 3AO1A 4RZRA 2JEIA 5J1EA 1T0TV 3UW1A 2F4VJ 2V50A 2P9NA 4HT5A 3D0IE 2V7ZA 4WQ4A 4NZ6A 4AM7A 1FRMA 4ZPAA 1UEUA 3TAGA 1YF5L 1PJ6A 3QO9B 4DUYF 1VQON 3FSXA 4BG9A 1R0CB 2EI5A 1FKPB 3MAAB 2MDAA 3WEEA 2Z2MA 3KJVB 3MCMA 2OTLN 1BQNB 1R6YA 3N28A 3VCDA 2RN2A 5F1XA 4AL6A 1I5OB 2GMLA 3MN6A 2WVCA 1UFLA 1JXEA 1UAXA 5DZ6A 4A4JA 3V6JA 3SCKE 1K1SA 4B3MK 2OTJS 3O5BA 3FLCO 4LBHA 3W2WA 3B6BA 5LL6Z 2CJKA 3LM2A 2QL5B 3NRBA 1OVYA 4JI4F 4L3QA 1C0GA 2VFRA 1KR4A 1HHQA 2NCKL 5DLGA 1REGX 3T7ZA 4OV1A 4C4WA 4C3KA 2F4FA 1CJUA 2B51A 5A6WA 2FHKA 1GX6A 4DSEA 2RPIA 3L3VA 2IRYA 1YJ7A 2N4CA 4CEBA 4H4OA 3MM5B 3LANA 5CQGA 3AVJA 3T1YF 2D0PA 3X1LB 3PRVA 3JQKA 4DV3J 3D3CJ 3HSDA 3DLEB 4JUZA 1A5WA 3EEQA 1G1XA 4BHQA 2OEMA 2BKPA 4MO5A 2ACYA 3CCJN 1D9AA 1W25A 1N33F 2OZSA 1YUWA 2VGNA 2C3MA 5GADU 3GILA 3NFAA 2O67A 3THWB 4M41A 3AA3A 4CM2A 4JV5F 5I3UA 2BE7D 3VZIA 4DR2F 2VG6A 5GAHU 2QA4G 2LKZA 2CQ2A 2MQ8A 4ZHRB 3BH7B 1XMOF 3SUPA 3IMQJ 4DN0A 6AT1B 1Q8IA 1RA7A 2BX6A 2FLOA 2NREA 4NA2A 9RUBA 1OQ6A 2Q0UA 3NH0A 3M6XA 2BJ3A 2Y1JA 1F5CA 3PHEA 1F3FA 2ZHAA 3CDUA 4IXCA 1L3VA 2R8KA 3RBEA 4DSKA 3FRZA 2FVPA 4UW2A 3B4MA 3DRSA 3RB6A 4JK9A 3ITHA 3I32A 4BBYA 2ACMA 5EUHA 3SV3A 2MHEA 3KWGA 3T19A 2H3GX 2CRLA 2QA1A 5LJ5Y 2DNRA 4OI6A 4LRAA 2RQKA 4LF5J 4WIQA 1GNKA 4ZPTR 2MQQA 5HQMA 3MR5A 4R8UB 4NXMK 1REVB 3CC4N 4O8UA 4CLLA 1NPRA 1QM9A 3ZZZA 5AXNA 3LO3A 2XSJA 4OX9J 2NR0A 5KG1A 1PIEA 1VSIA 3NOGA 3P5JA 3D0HE 2POKA 1NGAA 1HJRA 2E2OA 1CJKB 4GV6A 2RKIB 4BRQA 4B9QA 3NGKA 5F8MA 1FRXA 2LP4A 1RACB 3VTIA 3CCZA 1LWCB 3UKUA 3O4NA 3O6WA 4IOAL 4J9VA 2F8EX 2YKMA 2RD5C 3CD6N 2E9ZA 3TUIC 4M7XA 3MTJA 2XMTA 4JI8K 4QR0A 1YIJS 3HHNB 2DGVA 5C5JA 2HHHF 4QOTA 1Z25A 1N5QA 3OR2A 1T05A 1N0UA 4DX5A 1KVIA 1JJ4A 4I4BA 4Z0UA 1TKTA 2CNLB 2DR6A 3MEGB 4Y1DA 2P5GA 1VSJA 4CO5A 4IOAQ 2G0IA 4M5MA 5JVGQ 2P9KA 2ZM6J 3PTWA 3QSYB 1FJGK 3PV8A 2JX2A 5GIPA 3OTDA 3BSOA 1NSAA 3VESA 1A7GE 1FNXH 3J7ZO 4QPTA 4CTAB 5L9XA 3MXJA 1Q8LA 3BF3A 4QR2A 1WC0A 2JDJA 1RNHA 2K1RB 2M2BA 2P9IB 2UUAK 3JB9k 3H3NO 2EX3A 2XHWA 4Q2LA 4U8VA 1R59O 3EE3A 1HNZK 2DRAA 5C10A 4CF9A 2DCUB 1MWZA 2NRXA 3R5DA 4TLRA 5JS2A 4JI0F 3DNCA 1TK5A 3QINA 3IN5A 2QKBA 2DTUA 3VHQA 4FVMA 3EICA 4RBUA 2Q3SA 4RG8A 2EXUA 3O3LA 3ZZUA 2IM2A 3QBWA 2KVQE 2YX6A 1HYSA 4I0WA 3IG1A 3KG0A 4HVJA 4OLPA 3ISND 3FBFA 2C2KB 4ZCLA 3MURP 3KD5E 4BE2A 1P1LA 2Z1IA 1RT3A 2O1PA 2QMUB 2ZBCA 3NAEA 4FLWA 1FVQA 1JKHA 1QE1A 4CF1A 4NXNF 1B7YB 3AV9A 3M32B 3GJQB 2RRBA 5HSPA 3EXCX 2CJBA 3JTNA 1IBKK 3SFGA 2IJFA 4HUFA 2EFQA 1Q86O 1SQEA 2QXLA 1UL3A 4Z2XA 2A3JA 4CH0S 3H4DA 2HGLA 2IDOA 3PRBA 3MD1A 3TZWA 4HUGA 1JWWA 2KYZA 5J2PB 4G65A 1JJHA 3Q0AA 2IA0A 3ZO7A 4DJBA 4DN9A 2CPDA 1JXLA 1B7FA 4J9MA 3NOCA 5D4OA 5KFUA 3HKWA 3TW0A 1DBDA 2PFFB 4YOTA 1UZHA 5LJ3Y 3AQPA 3R9LA 4X84A 2FHJD 4KO0B 1X9MA 1XNRF 4OX7A 2LCWA 3AAQA 4LREA 3RBZA 1TU0B 2DD8S 4F26A 4GC7A 2ZD1B 3FBBA 3OD2A 2BYCA 4BRLA 1WF1A 2IRUA 3EYZA 4A46A 2Y8WA 1UVKA 1RT5B 1RISA 3M3ZA 2J7KA 3G8QA 3EE8A 3IRXA 4PYDA 4OJGA 4RX6A 5F8JA 2U2FA 3RAXA 3O9TA 1NSQA 2WOMA 4CBUA 1JLBA 2ROPA 1K44A 3QWPA 1H2UX 4ZVRB 2FJDB 4FN5A 5ETQA 1VQ5N 2O8BB 3QEIA 4F3QA 2E20A 2UV8A 3CQXA 4LFCF 3UVJB 1RCOB 2FPHX 4WU2A 2B7BB 3I55S 2G1HA 3GJTB 4CYUA 2DNPA 1GMWD 5KFOA 5C12A 5JLFA 3SSQA 1YJWN 5KOXA 3CD0A 4WE1A 3DDKA 1MWQA 1NH8A 2ZH2A 3D1OA 3LA0A 5L9NA 1B3TA 1JJ2R 4B3OB 5CCMA 3EY1A 5EWFA 3KZBA 3VV2B 4IFVA 2XWXA 3FCVA 2AU0A 2BW2A 4ECSA 4UQTA 3BKFA 4ZPDA 1LAWA 2KTQA 2RRNA 2XHCA 4KHWA 3P4UB 3DXKB 4WFYA 3PIOL 2FVQA 3B4DA 4YOUA 2IY5B 1ZA2B 3RMDA 4F50A 5DMRA 3NNAA 3UD3P 3H2UB 2FBYA 4CIGA 2MGZB 2YNGB 2QSWA 2DHSA 5KTQA 1T9YA 1TFYA 1VHXA 2AGQA 2GA7A 3DLKB 1PBUA 4MYTA 2HBYB 3US5A 1YZ6A 2FBTA 1N88A 3J7ZT 3MM6A 1T9VA 3BUZB 1CULA 1OPZA 3ZT1A 1VRQC 1V5VA 1U26A 5ETPA 4NPOA 4CP5A 1YHQS 3QNOA 2YH1A 1VSEA 1WDTA 3CEDA 5KT6A 3W5YA 2E7VA 2YNIB 1SUQA 3I96A 5AQPA 2Q36A 4ECVA 3CD5A 3UDLA 2JEFA 4OIXA 3RRKA 3QSIA 3PNIA 1GXLA 2KH9A 1SKSA 2WFBA 1QQNA 3SQOP 2QWNA 2Q31A 1NK8A 4NA1A 2I5JA 4OX6A 2M3DA 3ZNUA 4GKKK 2VZ9A 2CNOB 2ADCA 4PXEA 2ASLA 4PWDB 4XEIA 5CYMA 4ED2A 4DTRA 2J4RA 2RNEA 3OYKA 3MPUB 4ED1A 2FJWA 2VBYA 4FBTA 2LDYA 1CJTB 2AEFA 5KGWA 4UY85 2BE2B 4J2BA 2MXYA 4IRKA 5E3CA 3CJKB 2HHUA 5JUMA 2ALYB 1APSA 2HWTA 4F3OA 3H5UA 1Z6RA 4FZZA 4CJEA 3OSPA 1NUEA 1S7IA 1KVBA 4BLGA 3AVKA 3TTFA 4UF4A 2AKWB 1XQIA 1SJ4P 1Q86T 4K4UA 3VQBA 2OPSA 3HFVA 2WBNA 2NUUG 2QN6B 3HHLD 3OL6A 3EN9A 2DFFA 5F9NA 1F5BA 1LW2A 2DNZA 4BROA 2HNYA 2N3LA 3LZJA 3OSNA 4GO5X 5AJ3K 2QMWA 1NDPA 1B9FA 3G6VA 2XSFA 2CVEA 2XCAA 2J8AA 3QWUA 2E2NA 3CT9A 4PG4A 4OZNA 3CCSN 2UVVA 3PJ9A 1O8BA 1NJXA 5KFZA 1WB9A 4A48A 4CLKA 2LQJA 2DCLA 3Q22A 3LP0B 1KQSR 1W2BR 4J91A 1TK8A 1QVFM 4CHNA 3SCLE 4RL1A 4OPJA 3UKRA 1UWAA 2XY8A 4NLBA 1N56A 2XO6A 4CGJA 3ID6A 4OGCA 4KQZA 4I6MB 1YVUA 3VAFA 4G1QA 3AD8C 4PRFA 3FFIB 3SBGA 3FCHA 1N5YA 5IS2A 2K7JA 4A8OA 3AOBA 1Y9OA 3SNNA 1EP4B 1WSRA 5BYSA 3AA5X 4LF4F 3H3OB 2CQ4A 3WX4A 1X5TA 3ZZ0A 4IFYB 2NRRA 4A8YA 3SJHA 3I0SB 3WNEA 4BR2A 3GONA 1NBEB 4HCCA 1TL1A 4NMLA 1VRTB 2Q1LA 1RHKB 1UA1A 3MMAB 1WKKA 4KI4A 1TUVA 3M2VB 3VQTA 2YHAA 4JI2F 1Y0HA 2XI2A 2CQCA 2ITMA 5D78A 1X4HA 2FJAB 4QCLA 2H3EB 3HVWA 1Q16B 1FFWB 4E89A 2Y3YA 4Y2IA 5KFFA 4KHQA 1FD2A 3ZTOA 1QZ6A 4NYPA 3FVYA 2M52A 5D4PA 3MMCA 1YZ7A 4OZ2A 1J2VA 2BRLA 1CXUA 4C8OA 4P10A 4LMZA 2CZVC 4I6WA 2KKZA 3GIJA 3HO1A 2HFZA 1M5OC 1SS6A 4IRDA 5A0YB 4DR5J 2IAJB 2VC0A 4WTOB 3AAWB 3CCEN 1I51B 1SJQA 2R7QA 4X64J 4ELUA 2ZWOA 2ERRA 4CJLA 1KVKA 4A8KA 4C23A 4KREA 1WWHA 1VSDA 1W0HA 2GELA 4LRFA 2R7SA 3L4IA 1WG1A 2QT7A 1ZAWA 5F8IA 3A2FA 4I69A 2E5LJ 2O8CB 4WXWA 4CJFA 4ETXA 2AHOB 5ITHA 1H1VA 1VQMN 1RI7A 4LF8F 3OHRA 4DV1J 3BQ0A 4B3SJ 5D3GA 4J9RA 4JKGB 4K43A 4U7BA 1IBMK 4IJNA 3LZIA 1PGZA 3H0PA 1HPZB 3GG0A 4FWOA 3C3LA 2Q6BA 4WFAL 3TR8A 1S5JA 4P75A 4ZP9A 1IM4A 2YHWA 2DY4A 2APOA 2WVBA 4FF1A 5CH7B 4LD0A 2CQBA 3VEWA 2IJRA 2YKPA 5BYQA 1RU2A 3KMSA 4B1ZA 2IPOB 3VEXA 4E0DA 1HLUA 3THYB 5KG7A 1S1XB 3AJ2A 2H4WB 2M7SA 3VVUA 4DHYA 1UAWA 2RB7A 3RW6A 4FL9A 2RF2A 4KAZA 1GLFO 5C7PA 1AROP 2BRKA 3IWXA 4E7KA 4EP5A 2HHWA 1BCOA 3MR3A 1HNXK 3NL0A 3SI6A 4UOHA 3VA0A 2B9YA 1D4XA 2LEAA 4FCYA 4FWRA 3EGVA 3AY9A 3N4PA 1RB0A 2I1RA 3KHHA 4PWWA 1XN9A 4DU8A 2MTLA 2OH2A 1DT9A 3P6YC 3H1QA 1WF0A 1PO6A 2ZUGA 2MQMA 4DV5J 4P52A 4CJPA 3V4IB 4NLTA 5DM6L 3QEVA 2F9DA 4OZJA 2CQDA 4E1MA 3ULEB 5SUHA 3MF5A 1KP6A 3QBCA 4BWMA 4DU7A 1TFWA 1Z26A 3EM1A 2QC3A 4DKWA 1BDGA 3PKYA 2I9SA 2FLLA 3AVFA 4RW7A 4KHMA 2YHBA 1IBKJ 4PPDA 4PG6A 4CO2A 1BHNA 4J90A 2E6MA 4FNIA 5DM6Q 3BF1A 3ZSOA 3L9ZA 5B0DA 3KK2B 3H8YA 4F8RA 2M5YA 4ES1A 3UPFA 4M3ZA 5T7LB 3E8OA 1KTVA 4Z37A 4W92B 3K9KA 5EX3A 4O55A 2A1BA 4P73A 4QS9A 2ZE2A 3PKMA 2DGTA 2VQEK 2ZOGA 4B3RJ 3VERA 3QYYA 1I6JA 4QR1A 4W5QA 5FPNA 1IO2A 2H5EA 2HSEB 3MAQA 2YNFA 1UPPA 2QYCA 1S9EA 4B1YB 5CD4H 1GLEG 4K4VA 1QUVA 3M8PB 2P2CB 3GQCA 1S1TA 4K4SA 4ZP8A 3VQ4A 1C0TA 4WYLA 1N6QB 3PSFA 1YSJA 2RILA 4PQUA 4NLVA 2Z57B 3PY8A 3AOAA 4FYXB 4I56A 5AQXA 3G82A 5THWA 2P9UB 3L0QA 5LMNK 3WBZA 2V8PA 1JLQA 1B99A 4CERA 4I67A 4QQBA 4CO4A 1TYQA 1QY7A 5J1PA 4EK2A 5LM7E 3ULHA 4BS2A 2ZITA 2ZH5A 4DR4K 2F1FA 3CERA 1WG5A 3CVKA 3SAFA 3TARA 5ETNA 4RLEA 3N79A 1D8YA 1SQFA 3G4SN 4E8UA 3N4WA 2N82B 3LDQA 1N5VA 2WSFC 3AH6A 1GH8A 2A1RA 2ASDA 3G9CA 1UJ6A 3LPUA 2BZ2A 2GUPA 4QYRA 3AVLA 4ZVGA 2ZZNA 3CNQP 1ULRA 2Y1RI 3RRHA 1FKOA 2Y1IA 1S59A 1SKRA 4USVA 4AE5A 5KAKA 1RKJA 5D4NA 3DWLA 3N5FA 3P5TL 3CCLS 3T9NA 3AVIA 3C94A 3ZTSA 2HGMA 4DV2K 2L41A 1QVGR 1S1WA 4JI5F 3J81j 2RUGA 3J7YI 3OW2R 1U1MA 5FLXU 1YTUA 4TU9A 3IC1A 4M63C 2HVHA 2IM1A 3JSYA 4EWTA 1XHXA 3PYDA 4DCHA 3MXMA 1EB0A 3SPZA 3DN9A 2F9WA 4CFDA 2Z0GA 3OL8A 5AQJA 1UETA 3UDVA 1NAQA 4HH0A 3C6AA 4PKGA 3CMEN 2RAQA 1RT2A 3KK3B 5HVGA 3NVMA 3NEKA 2DFEA 3F73A 3CW2C 3VPZA 2C2NA 2ZH6A 1R0AA 3ENAA 4X66K 4FSVA 3KMQA 3ZSQA 2ZH4A 3M8ZA 4CO1A 5HANA 3AJDA 1FE0A 5T41A 3EPGA 4TN2A 1W9HA 1RSCA 1RWUA 1T94A 1HWIA 2W2QP 3OYCA 4KHYA 1BLUA 3KK7A 1KONA 3DHWC 4CEZA 4U95A 4A2AA 4BG8A 3MK6A 4ELTA 4OHVA 3ZETB 4JI4J 4ZS6A 3I33A 3LGMA 3VR1A 2RS2A 1VBYA 3POTB 2ILYA 2VBXA 2G8IA 3IAM9 4FWNA 4WP8A 1VMBA 2V8VA 3A3OB 1XIQA 1RT7A 3ULDA 4Y1CA 3CFOA 3V6HA 2YWFA 2P9SA 3ATVA 4LSLA 3T1YJ 3MMJA 1HNWK 1M1KO 1ZETA 2AD9A 8AT1B 4GKJK 1FF2A 4KBIA 4M3WA 2HFOA 4E7HA 2HB5A 2O4GA 4FJJA 2DNMA 2GIRA 3WX8A 4XIUA 3OHAA 3O1LA 4ZCMA 2F7TA 3TZXA 1TAUA 4B9TA 4IUFA 4XDDA 1IG8A 2ZH9A 2MYFA 1S76D 3BGRB 1IUJA 4LFAJ 3CJRA 3W5ZA 1R6VA 2VKRA 2RUSA 3GU0A 4S0MA 4FLUA 1YJVA 2CQ1A 3OVAA 1HI0P 1XNQK 3BDPA 4NE9C 1QLNA 4HVZA 1ZM9A 2C2EA 2UXBF 2KFYA 2CQ3A 1C6VA 4EU0A 3D0GE 2DITA 4JKBA 2PO4A 3A8KA 1RTJB 4ANCA 1NKEA 2PD1A 3PEHA 5E5NA 1S4EA 2XTJP 2VUGA 3EVMA 3NAIA 5C42A 3A0IX 4BRCA 2JH3A 5HROA 1ZBLA 3CCRN 3OUYB 1BI4B 2ZBIA 3WHIA 2XLIA 1SBRA 2NZCA 4L3KA 3SQGA 3ADAC 1H2TZ 2FC0A 2A2CA 3CCWA 5DQGA 2IIRA 2DTJA 4XH5A 3GB0A 3DCAA 4WCEQ 1X3NA 1WC3A 4YY3K 3WC2A 1KOOA 3L4QA 3HVTB 5GAEP 2KT5A 3BGLA 5AZIB 1S1VB 1YVFA 3OTCA 4Q8FA 1OMSA 3AARA 1HNIB 2IM0A 3NHGA 3OXGA 3D2FB 3WXKA 4BC4A 4RW6B 3T6JA 4CLUA 3MECA 4O44B 3A12A 3MUVP 1KHWA 3CFPA 4FLTA 2B8PA 4ZKAA 2UUCF 5L46A 3I6PA 4JV0A 2HVIA 3MR7A 1WAJA 2CPXA 3TJ8A 1TVRA 3SMZA 3LDPA 5EGYA 4TSXA 2UU9F 2KJVA 1UTAA 5EXWA 1ACMB 4P2FA 4RNFA 2QFJA 4NWBA 5AFUH 2O66A 2IJNA 3AFGA 1ZM2A 3OYEA 2HHHJ 4FJXA 3ET6A 4JI7J 4ZN1A 2XZTB 2M88A 2C3YA 4ILGB 1EHWA 3VQDA 1TR0A 4IG0B 2E1MC 3HT0A 3F5TA 3KIOA 5HL7Q 2QLXA 3FE1A 3FJ2A 4CI6A 3M30B 2UVUA 3CHWA 2XCPA 2DGOA 1M1GA 4U8YA 4DQSA 3VEYA 4O0JA 2QWLA 5J2NB 4RUBA 2HVDA 1U4BA 1C2PA 1GTHA 2UUBK 1UCNA 1X7VA 1JLGB 4O8KA 1XR7A 2FSKA 2YH0A 4DV4K 3MEDB 1WORA 1Q82T 1TKZA 1G6BA 4URSA 3Q89A 4AYBD 5BRFA 1IBMJ 2BR0A 1RDDA 1TMMA 4DTMA 1FTRA 4JV2A 4ISGA 5KFEA 4JI0J 5DK5A 4U9RA 1RAFB 4NCGA 3MEEA 4CEFA 1YJNN 3I4HX 3M8RA 3CI5A 1RLDA 1ILYA 1UEKA 4N47A 4ZDNA 4CZCA 4KJIA 1VHIA 1Q5YA 4CO0A 2KHCA 1ZM3A 4FLVA 5IXUA 5AQQA 3CC2S 1L3UA 5AQUA 2PDAA 4HDHA 2IYGA 4CO3A 3DRRB 4JI3J 4FP9A 1EETB 2F8MA 2C3UA 3I0RB 1VQ7N 2Q43A 5IFMA 1IBLF 2WB4A 4H0OA 1TGOA 2XY5A 1LWFB 4O3PA 3H6EA 2DNNA 1WOOA 4NXNJ 4D3HA 4EI2A 1RWKB 3ZFVA 1HNXJ 2YWWA 5AXMA 1SKUB 3DDNA 3U3GA 4F9OA 4M3XA 3I9ZA 4PL8A 1BOTO 2X1BA 2YWKA 3BY5A 3CPWR 3QGHA 3MTKA 3DLLL 1X0FA 2CPYA 2QLBB 3I82A 2Q2RA 4WYBA 5GVQA 3C6UB 3OXFA 4RWWA 1WHWA 4JOUA 1OS5A 1V5IB 5FDLB 2GIFA 2HHPA 2R7OA 1YLXA 2P9LA 4R79A 1T03A 4DPUA 1SPBP 1VQSA 4ZLPA 1MROB 2VL1A 5KPRA 3QAUA 2LEPA 3NG8A 4OI0A 3LGNA 3DLLQ 1ESVA 4USMA 3OLAA 2PMWA 2VA3A 4DL2A 4ECWA 1HHSA 4AHUA 3VGUA 4CJRA 1U1PA 3QFHA 1HWKA 1FXDA 2CWKA 3MM8B 2B6AB 3QRPA 2F40A 4USKA 4K50A 3FGVA 2GUIA 4XPCA 2X51A 1LW0B 4Y28C 3D7EO 3DOLB 3KG1A 3K8VA 2DHGA 2GFFA 1GAOA 5FRMA 3OS2A 1VAZA 2NYIA 5DM7L 2R2SA 1G15A 3B8HA 4K8ZA 5I42A 2VQEJ 5D4LA 4ER8A 3P39A 5D0HA 4AXIA 2GO8A 5A8WB 4KIAA 4F0HA 3AB4B 2RDDA 1BCMA 3I4PA 4AQYK 3Q8VA 2NYHA 4R5PB 4K59A 2F4VF 2ETJA 4BDPA 1VC0A 3MFIA 5B8HA 4IKAA 3DM2B 2F63A 2NSCA 3I5BA 3P45B 1FWPA 3KUHA 2VCPA 2YXLA 3MMBA 1SIWB 2YQ1A 1C1BB 3ZT0A 3VQ6A 1QAIA 2DIUA 1S0NA 2VA2A 3LH2S 2ZDPA 5LMNJ 3S3MA 2VV5A 4ELVA 5A6PA 2EKNA 1YKWA 1JLFA 4LF6K 3TTCA 2B9WA 5HI7A 3DLHA 3CJ9A 3VAJA 3LPEA 4ZMMA 4DR4J 3CCES 2MMYA 2W4CA 4NOHA 2B9EA 3T1HK 5E3AA 4YHHK 5K14A 4C6AA 3NAHA 4CLSA 4Y0FA 2OMOA 4CW7B 4QBUA 5K8PA 5K20B 2PYJA 2HNZB 4DS4A 1O0PA 3DLBA 3DRPA 3IWNC 5BJRA 1WNSA 3BV8A 5IV4A 4DV3F 1YVNA 4W5OA 5MLCV 2WSEC 5K5MA 3FDSA 2HF3A 4N77A 2GMJA 3UDEA 2DR5A 1TL4A 4M3TA 3HPHA 3IA0A 2F3JA 1VSMA 4G1IA 3FBCA 1H3DA 2X1FA 3I87A 2PFDA 3IS9A 4RJVA 3W9IA 4M3UA 3SQ2A 1N33K 4JYAJ 3V1OA 5BREA 5FIIA 4N8NA 4LR9A 3IBFB 5CXTA 4URGA 3SDEB 3H7HB 2ZH8A 3PACA 4A5BA 1FJCA 4DR2K 3HLUA 2ZWPA 4D3GA 3I8DA 4TY9A 3NE6A 2YNHA 1WEYA 1XMOK 3BGFA 1VRUB 2Z2ZA 4CF2A 4MQ3A 3BF4A 4X66J 3NF8A 2EPIA 2AMCB 1RAAB 2YVSA 3PR5B 4C3MA 4CEQA 4LRBA 4OPKA 4YR0A 1I94K 3RSEA 3X3UA 1BA1A 5AXKA 4LH5A 4KFBB 2E1CA 3U6FA 4KTWA 4ED4A 5DQHA 2MJUA 3AVCA 1LAVA 1FCAA 2WONB 2Q1NA 2KRBA 2RU3A 3G8TA 5KFVA 1VJQA 4JHDA 4WFNL 3CJBA 1HBOA 3D7SB 4WIIA 3IFRA 1WOSA 1HMVB 3NS5A 3G10A 2W25A 1S0MA 2ZBRA 4CGHA 4UTGA 4LIWA 5DDQC 2YV0X 1FDAA 2ZC4A 4YS2A 4OKEA 3NGUA 4OX9F 1T3NA 3RAMA 1HNWJ 2FJEB 4ALZA 3J7YU 4GKJJ 2M0GB 3H2VE 2HMPA 3QO9A 1WSGA 4PWUA 1FKPA 3MAAA 3KJVA 1N32K 1BQNA 3GV7B 4PXCA 1BY9A 4YB7A 1KXPA 2QWPA 3HHKA 5EX5A 1D5AA 4KSEB 1DFDA 3U1MA 2DNHA 3OBIA 3QT5A 4CHQA 1OSDA 2J6SA 3L95X 3LTOA 5D6GA 4WKRA 4RW9B 3Q86A 4JK7A 5A8KB 3V6KA 5KG2A 2VQFJ 3W9HA 4LF4J 2HHQA 3K5MA 3PFOA 3CJAA 2WUSA 2GQQA 3CM6A 2ABYA 2EEYA 2ZM6F 3W1YC 2F8SA 1GOCA 1SB6A 2JVOA 5E3RA 4Q45A 3HJVA 4WF9Q 3QJJA 3MM5A 2DVIA 4X4OA 3CPEA 1XMBA 5IT9U 3EL2A 3J7A1 5LJVA 2QJ3A 3FSYA 3DLEA 5HRNA 4BE1A 3HK2A 2LMIA 4PG7A 4J9LA 4J9QA 1V9OA 4OI4A 2RIJA 2MHNA 2OYQA 3IRWP 2NXNA 1U1OA 1IBCB 1J5OB 3THWA 2ZJRL 5ETMA 3IFEA 2M8DB 4F04B 5CYQB 2EBGA 2NS1B 4YY3J 2HWHA 3OYBA 3VEVA 4IDKB 3UE5A 4DV6K 4ZHRA 2G0JA 4RUAA 3P38A 2JL9A 3MUMP 2EFOA 3L3UA 3FC9A 3GBTA 1IJEB 4C8LA 1S77D 2ZZTA 4HCBA 2H54B 2V52B 3LP3A 1NHKL 2C22A 3U8XA 2FB0A 4ED7A 1FFGB 1WSHA 3VGSA 1EQ0A 5LSLA 4OJ3A 2JWLA 3RUBL 4F0MA 4KHNA 3CJ0A 2R42A 1DRZA 2QZ8A 3NP5A 2FZGB 1SCJB 4DEZA 4EP4A 2GQCA 4RU9A 2GWJA 1Q53A 4ZPWR 2QM1A 4EZ9A 4F4XA 4FJ8A 1R3NA 3KFWX 4OYXA 3CG7A 4H03B 2CJQA 2JC0A 1RWVB 1FW6A 2ZBQA 3C8YA 4R8UA 3UO0A 1F2GA 4RW8B 4KH4A 1REVA 1NJIO 3D6MB 3QATA 4J7CA 4BRPA 3ENBA 3EKUA 2B5JB 5F3ZA 1QHAA 1RT6B 4J9NA 3PYEA 3OYDA 3V81B 2UUBJ 1FVSA 5CAAA 3E9PA 2DR9A 1CJKA 4C8KA 2RKIA 2OEKA 1H7WA 5BPLA 3TUPA 3C65A 3WEEB 4EEYA 4I6YA 4ATNA 4FJMA 1LWCA 4RNHA 3G87A 4OHYA 2OPQB 4ZN3A 3AO2A 2JLEA 4FW1A 5SWMA 1VQYA 1YT3A 1SIZA 3ZSVA 1RHJB 1YAGA 2K8GA 2XMWA 3TZZA 4NZ0A 4E7IA 3ZT2A 3Q83A 1NWKA 4E98A 4PAAA 3JTPA 1E4GT 4NASA 5HP1B 2D74B 4HI2A 3ENWA 3MEGA 2RU9A 3H90A 3CCMN 2LQ8A 4M5JA 5SZTA 2GV1A 3QZ8A 1KWMA 2KT3A 2NZTA 8RUCA 3EPIA 1N36K 2X78A 3DOKB 4KY3A 3D2EB 5J2MB 5FLXY 3VGVA 3ATUA 2GBZA 1JL1A 4F3MA 3CDWA 4O5FA 4CTAA 3IDHA 3ALYA 1S22A 2R8GA 3E9LA 4A47A 2P9IA 2K1RA 3VQ9A 4Y00A 4P72A 2VBZA 3BSNA 4TXSA 3DGVA 1VIOA 3K2YA 2K06A 1K8AT 3OR1B 3P31A 4KGXB 5KG3A 1Z2LA 5KFHA 2QXFA 4IEIA 4LIRA 1MMNA 4TY8A 3AXKA 4CFAA 1Y7PA 2HKEA 4OL8A 1F9EB 4J9KA 1ZZNA 4WBFA 4UY8O 4L73A 4A59A 3JS9A 2F65A 4P9SA 5KFYA 5GADI 2IBKA 2JWKA 2CQIA 3O5TB 1Z05A 3Q8RB 2R8IA 4ICLB 4QU6A 2OPPB 3K0JA 3GE1A 4KAIA 2C42A 5GAHI 1HNVB 4OVLA 4FF2A 4QIFA 4Z94A 4N56A 3NMAA 5AE1A 3LPTA 2FBVA 4OX8A 4ID1A 3M32A 2B8QA 3HXMA 4CD1A 1D1UA 2VGMA 4CIFA 3PDNA 3SQ0A 1FXLA 2F8TA 3PXGa 4DR3F 4FJ9A 3SFUA 3VAMA 1RT1B 1XUPO 1O1WA 2YWGA 1QTNB 1DY3A 2QIFA 3D6TB 2BGGA 5J2PA 2FD2A 4DPWA 4RNOA 4YOXA 4DPOA 2KL8A 1NH7A 3KUEA 1QHTA 2J0XA 3HHLB 4BGBA 2V2QA 3MCPA 1VC6A 3O1WA 3TQEA 3OQ2A 2AV5A 4KO0A 2PT0A 2DY1A 4MJKA 3GLJA 1KKHA 2ZJPL 4OZLA 3HCXA 4YN3B 2ZD1A 1TL3B 4YB1P 2C3OA 2J9CA 4DBQA 3I31A 4HKQA 2LSNA 1RT5A 2VF3A 3P5BP 2NRTA 3SQ1A 2CJYB 3MOZA 3CJ3A 3VAKA 5DQIA 4EBDA 3WNHA 5K8NA 2X3GA 5K9FA 2XRIA 2W7AA 2VDIA 2FC8A 2GX8A 4MKAA 3C66A 3WQPA 2ZJPQ 1S9GB 1HD1A 3CQ8A 2G4BA 3FEYB 3T1HJ 2ZJQL 4YHHJ 4EFAC 3IM8A 2C2DA 4BGAA 2LXUA 2O8BA 1SAZA 1K9MO 3Q8PB 1DAXA 2RHKA 2V4JB 4ECRA 3UVJA 3R27A 5B0CA 3LWLA 5E3PA 1RZMA 2HYIB 3HZEA 5DDOC 1S6UA 5D0GA 5CD4A 4NX9A 2ZJQQ 1NB2A 5D15A 1WHXA 3MWPA 4CDIA 2HFNA 3GWCA 5J1NA 4PXBA 1IKXB 3V5RA 4DR7J 2MLXA 3C14B 4CK3A 2B56A 4B3OA 3B82A 1NPKA 2V69A 2UVWA 2ROEA 3LW5C 2R8JA 1CLFA 2NUHA 2UYTA 5HQ8A 2FSJA 4JI6K 3PUFA 3DAWA 2XZWA 3DXKA 2DISA 1GK8A 4MT1A 2P1JA 5E33A 5BR9A 3KK1B 4LBPA 2MGZA 2B43A 2YNGA 1RQ0A 1VQ7S 2IS3A 4MK7A 2BV3A 1S72S 4IOBA 1J6ZA 1VSLA 1SV5B 2YWEA 3DLKA 1S6PB 1HI1A 3O2IA 4O4RA 2BDPA 3SV4A 1N34K 1NLVA 2NLXA 3LGHA 3ELHA 1RTZA 2PZSA 4IH7A 2VICA 3P96A 3GZ7A 4CIEA 4DV0J 1NM2A 2YNIA 9ATCB 4H4KC 2C2RA 3VQPA 1ATRA 4JI2K 2JSXA 4C1NK 4IZ9A 3AJ1A 1F1BB 2ZH3A 1F6TA 4FLZA 3R97A 1U04A 1JX4A 3GPAA 3BR9A 3AD7C 4CZGA 3EVOA 1LFPA 4F02A 1AYEA 2QA2A 2V8DA 3TA0A 4BCAA 3VAHA 3W61A 1JXBA 4OYWA 2UXBJ 4PWDA 2DKOB 2VFUA 4LSZB 3DKDA 3OA9A 2F9JA 5DETA 1M5KC 4FLYA 2XMAA 1RAEB 3NGRA 5HMWA 5C2CA 1N32J 4FK0A 2IMOA 3TX8A 1CJTA 2M70A 2BE2A 1GTEA 1RBAA 4PG5A 2X1AA 2Y8YA 4KB1A 4CFBA 4JAXA 3CJKA 2E5LF 4FF3A 1MA9B 5CYJA 4DV1F 4BWJA 4DG1B 3CF5L 3GFYA 4CNYA 4B3SF 1DTQB 3SK3A 1MWMA 1WSEA 1KC8T 2OLWA 4LF8K 4IDHA 4C97A 1OQ3A 4EHUA 4QWDA 1AFJA 1DQ9A 4C2MA 4B8CA 2G13A 1U24A 3SIPB 5LSOA 3TVZA 2ZZMA 1NO8A 5KPZA 4JEPA 3A8EA 3G8SA 1CC7A 4NI2B 2R9LA 1UVLA 4NLOA 4F4WA 1IKYB 4CIOA 3CF5Q 1TK0A 1O51A 4FYWB 4RWXA 4WP3A 4OLBA 3G71N 5IC6B 4C0BA 1JXVA 4DV7J 2UUCJ 3D6HB 2UUAF 3AO3A 1PILA 4F7VA 2DFHA 2IVYA 5LL6d 3LP0A 3HZ6A 5A2QY 2O8DB 1GMVA 3NF6A 3CD7A 4CZHA 1VQPN 2OI2A 2E9TA 2VFSA 4CT9A 4I6MA 4QAGA 3PYGA 4ED6A 2AGPA 2L3MA 4GMKA 4Q5VA 4H4KA 1AUSL 2HLTA 3FFIA 5JS1A 3K59A 3JSMB 5ADZA 1EP4A 4Y2KA 4BE0A 3HMJG 4IFYA 2VODA 2WVFA 1P1TA 4ZVUB 3I0SA 4ZVFA 4NLWA 2KI2A 3IO1A 2EWHA 4YDUC 1M1HA 4P71A 3TTDA 4HH1A 3AVMA 1VRTA 1GOBA 1ELOA 4LFBJ 1DQAA 3DXMB 1PBAA 4HT7A 2OCEA 3MMAA 4DTXA 1HL6A 2QMXA 3M2VA 4K4YA 2CNKB 4CEOA 4J5OA 3SUQA 2MKHA 1RTHB 3AAPA 1HIYA 1NZ8A 2N4DA 3TUZC 1IBKF 1HW8A 1CJVB 3QGIA 4CJ3A 1Z2ZA 1I3OB 3I56S 2EG1A 5JXSA 2QA4N 1FWLA 1KQFB 2D3O1 1EKEA 3SBTA 4DTSA 1U2VB 3J7Z5 2DRDA 4FS2A 3A5LC 5M1NA 4NCAA 3G6EN 2HBJA 3G25A 1UJ5A 5HMYA 5M1FA 4BRKA 5EX0A 5A0YA 3FZFA 3FZMA 2IAJA 4X65K 4R25A 3M6WA 2UXCK 3MGJA 1VQNS 1TUUA 3U9DA 3IAYA 5F0UA 1VQ4S 4PXDA 1TELA 4KH6A 3OY9A 1X60A 1B0PA 3K5NA 3SCJE 4XPEA 1GFWB 1Y3KA 4OYMA 2HRUA 3K9JA 2O8CA 1WHYA 3VF4A 2G1DA 1RWWB 4O4GB 2NQPA 2DJWA 4KGKA 1WC4A 4PEOA 4BR5A 4CQ1A 4JKGA 5B0FA 2OUGA 1RWNB 3T1AA 3KLIB 1NK0A 1HPZA 1RTDB 4XDCA 3KNAA 3MWBA 5G0RB 3BBCA 3JTOA 3W3DA 2A10A 1NJWA 4H5RA 4CJVA 3MCAB 5JVHL 4DMNA 1HFEL 3N0VA 2DNQA 2QYGA 5CABA 1N36J 4LF9K 5KG6A 3QJLA 2RVJA 3THYA 4U7UD 3EZ5A 1S1XA 3IGNA 4YDUA 4X2BA 2DHAA 4JS4A 3CJ7A 2ASJA 5I4MA 2ASPA 4BACA 1DJ0A 2KU7A 4DPYA 4GW6A 3T69A 4CECA 2IFXA 5L1KA 1WBBA 1WNEA 4BQLA 3GR1A 4DL6A 2GQ2A 4FWQA 1SL2A 1MLAA 2FDNA 1BGXT 1P9QC 5KFBA 5KRSA 4IO8A 2CNNB 1SJ1A 1SL1A 4E19A 3CCVN 3CJ2A 3UR3C 2UUWA 4JI5K 1CVJA 2MEWA 1KD1O 1EWRA 4IO9L 1BISA 4J9UE 2H65B 5D77A 3SUOA 1FK9B 3ZC4A 4G3IA 4AF1A 4QU7A 4FS1A 4FJKA 5DDPC 1KVAA 4AT1B 5KFPA 1PAUB 1B92A 1OPIA 2VU5A 3V4IA 1ATSA 4I6AA 1NU4A 4QIWD 3EKSA 5BRHA 1IR0A 3ULEA 2XHBA 2K2PA 3PX4A 3C16B 3O8WA 1ITPA 1KDNA 3CCQN 5KT4A 4IO9Q 1FE4A 2CH5A 1JLEB 1U1KA 2D1CA 3U3YA 3MOJB 2BKNA 2HMIB 2YKNB 4M45A 2ZC3A 3LQVA 2QTWA 1SL0A 2W2NP 2CPJA 3GFZA 4FM2A 3KK2A 2VIHA 3IKMA 3D28A 3SYZA 3VA3A 1BU6O 5T7LA 3MD3A 1GLDG 1RWOB 4CJUA 1Q9XA 2OFHX 2FHMA 3K8WA 2GIQA 3ZT3A 4CJSA 3UCZP 3LUYA 2VG7B 4ZJLA 3FZLA 1VBXA 2ZBPA 1YK9A 2CQGA 4Q2MA 2E2PA 2QW9A 4C8ZA 3RR7A 3WT0A 3S1TA 3M5RA 4DFMA 2QSFA 3RB0A 3T9ZA 3M8PA 5D8HB 4LJMA 2YHXA 4J8FA 1E6VB 2MZRA 3KLFB 1N6QA 1U1QA 2Z56B 3R1XA 1ZPVA 4PPZA 4K25A 2FF6A 1FKAF 4NLGA 4ID8A 1TQLA 4NLQA 4YDDB 2P9UA 4CLTA 5D3GB 3FQLA 2CDQA 1NKCA 3NH2A 1F3VA 4LFAF 3LDOA 3W2VB 3OBYA 1VLYA 1UVJA 3QJPA 1FRJA 2X6SA 3VQEA 5AQFA 4CF8A 3MM9B 1RJJA 3AVHA 4FXDA 5AJ3F 4DQ8A 2O8FB 2JHEA 5B0BA 3T6BA 1ZTWA 1LV5A 3WIUA 3LP1B 4OYAA 1KNZA 1FJEB 4KTZA 1ZBUA 3HSCA 1VC5A 2IVNA 1FFSB 3F44A 2IA6A 2KXNB 4CLFA 2RE2A 3IP0A 1RBRA 1VHFA 1OWXA 4QWCA 5AQZA 1U8WA 3H98A 4IG3B 5LOQA 2J6UA 4BY9C 4Y2AA 4NA3A 2UV8G 4P2MA 1SC3B 4ZJQA 4NLRA 3Q7CA 1H74A 2ATCB 2YJEA 3LOUA 5EN1A 4H0TB 3IBWA 5IQ6A 4QIGA 4Q0BA 4JI6J 3BBBA 2BQRA 3KJQB 4MTPA 1P9YA 3HKZD 2BKOA 1EIYB 3GG4A 4CFCA 3ONQA 4MK9A 4PYAA 2W40A 5L1LA 1LQ9A 1HBNA 3ENQA 1R27B 1RT4B 1YJUA 3BKTA 3KDNA 1FT8A 4USHA 3H25A 1S7HA 2AEJA 3OTOK 3PJWA 3KK3A 2HQCA 3VETA 2ZNZA 4JKAA 2GZOA 3VQ7A 4K5RA 4YFUA 4OI3A 3GJRB 2KHOA 3M8QB 4AHVA 1N34J 3ZYYX 5IWAK 2PIIA 2GAHC 4ILHA 3ZSYA 3PW7A 2QEXS 4UUWA 3CO0P 3SJJA 4JNEA 3HJFA 2R7UA 2BVZA 4DX6A 1Q7YO 3GE9A 2GJ2A 4LF2A 1SJ3P 5JVGL 2Q6CA 4PZVA 3R2CJ 1OKJA 3ZNJ1 1G4CA 3B6OA 3ZETA 5MAOA 4HTLA 3C7NB 1SC1B 4JI7F 2PBDA 1JCFA 3ZSZA 3R6MA 2UU9K 1M90O 3POTA 2NRHA 4XH4A 2OTJN 4N8OA 1KD1T 4CJWA 1KFDA 2ZE2B 4ITSA 2OA8A 1R7IA 4FVUA 2G8FA 3BR8A 2R7YA 3R7NB 2FF3B 2I7NA 4JI1J 4M3RA 1RDCA 2QRRA 5ETRA 5KFKA 1OY6A 3DFEA 3PW4A 1CEZA 1E3MA 2CJAA 2CXEA 2XM3A 4HACB 1K8KB 4FJLA 3TVKA 2ALZA 3HP9A 1J5EK 2KLAA 3AA2A 2MKYA 4U67Q 4QWEA 3IBCB 3TAMB 3G96A 4K0KK 2CQ0A 4LUBA 3QNWB 3A8JA 4ETZA 1QAXA 2YTCA 5CE3A 1IBMF 3N4QA 1Y5NB 1Z4UA 2WCXA 4EBEA 2W6KA 2LYVA 3M9MB 3ILIA 3VN5A 1NNEA 3OYFA 1WUUA 3BGRA 1H0HB 1KHVA 3HOTA 1HR0K 3J7AP 3QLHB 3ZZTA 3G6YA 3NF9A 1VQ9S 2E2QA 4OFZA 3Q8SB 4E3SA 4KC5A 3L8BA 2XQCA 3AQOA 4GNIA 1DEJA 2DH7A 1NOYA 2VC1A 3K0SA 5KRTA 3LDSA 3BYRA 4JI3F 2CG8A 2V51B 2BUPA 4OLOA 3OT9A 2D41A 2DGXA 5IM0B 1RTJA 5HN0A 3OYMA 2J7WA 1BUPA 2EKYA 4DTJA 1Q95G 3HDSA 1HNXF 2A6OA 1S0OA 1Q8BA 4H8KA 3CCUS 3ZLJA 1U09A 3E01B 1Y00A 3OUYA 1YI2S 3W65A 4FPAA 4OO1J 3S3OA 4C9DA 1BI4A 3TQ1A 2I7PA 2FGOA 4B1XB 2IC3B 1V4TA 3R3TA 2PGCA 3DGPB 3CMAN 1NK9A 4LQ9A 2W9CB 1LNQA 1JMTA 3V9ZA 3TAPA 2DXEA 4FXWA 3O9QA 4X62K 4DL4A 2W42A 1VQ6N 4N41A 4AILC 3TP2A 2JLGA 3A8IA 4C8MA 5AQYA 1FJ7A 4BRFA 3HVTA 1AW0A 5AZIA 1S1VA 4CF0A 3O3FA 3NLCA 1IWAA 1HNIA 3PRDA 5AT1B 2ZH1A 4DR6K 1YQHA 2MSSA 4LF7K 3KLGB 3G2XA 1PG5B 4FZXC 2GGPB 1TZ0A 2ZUAA 4RW6A 2HQ3A 3BGUA 4J2AA 4CEEA 1OIAA 4O44A 4ES3A 1LFWA 2VOPA 5A8RB 1CC8A 2KXHA 2BBEA 3AY0A 5BR8K 5KFSA 5F8HA 3PW2A 2V9KA 5HRSA 3M2RB 3CUNA 2QX0A 2ADBA 3JSBA 4O3OA 1M5VC 2Z1JA 5F3TA 5H1SQ 2B4PA 3NXZA 1TL5A 2VQEF 3B6PA 3V2UC 4Z4GA 3MXIA 2X3DA 3Q8UA 3BZKA 4CI0B 3V1QA 4QWAA 2AWZA 1S10A 4HTUA 1C0UB 2UXCJ 4IG0A 4F2SA 4PABA 1Y97A 4IOCL 5I3QA 4LVNP 3M7VA 3M30A 2FLPA 2YI1A 1AXQA 1H7XA 4JKDA 2OSQA 1DTTB 1VSKA 1Q7LB 2SXLA 5J2NA 2YJFA 4E1JA 2CGJA 3RG6A 4KI6A 1BMQB 1ICEB 4RTFD 3TX0A 1JLGA 2AZ1A 1Q7YT 4CEDA 2UXDJ 3MEDA 4IOCQ 3RYLA 2RH3A 4DMZA 4W4MA 3KJFB 5LMNF 5KFIA 4RO0A 1BQMB 1YTAA 3WIVA 3OYGA 3AHPA 5AQMA 4B8AB 1FA0A 1URRA 3FZ2A 3JS6A 4O5BA 4F4KA 4UOCA 4L3NA 2HK3A 2D4WA 2G8VA 4DTNA 1M90T 2VOOA 5C25B 4DR4F 3O44A 5GADP 2FC9A 4JN4A 3LL3A 1HQUB 1HQEB 2NXJA 3KLHB 1WKLA 3OXLA 4R0EA 5GAHP 4OPAA 1FDNA 1B9DA 1YBUA 4ZOSA 3DRRA 2E1YA 1WKJA 1EETA 3KLVA 3I0RA 5EWEA 3OVNA 1C0FA 4X4QA 1S99A 2NPFA 5EVZA 3Q8QB 3MDFA 4DV2F 2V9WA 4OKKA 2E1PA 1X4DA 2XYGB 5ETKA 5H9FJ 4DV3K 4ECUA 3ZX3A 2W9BB 3G6XA 4DR3J 4A8MP 4BRNA 4Q8EA 3VALA 3GYNA 1VK3A 4JYAF 2PC6A 1WN7A 3NCQA 1K0VA 2PEHA 3C6UA 1I3AA 1X9SA 3F0NA 2PMHA 1G2EA 3L3CA 3N6NA 1TMJA 4O0NA 1XERA 5FDLA 3A5OC 2WC9A 2KVIA 2KRRA 5C15A 1YXQA 2KM8B 3G71S 4FPBA 1MROA 1FWKA 1YG0A 4X66F 3EMTA 3VF2A 4W90B 3J80Y 3UR0A 4CCHA 3FMWA 2DEIA 4K4XA 2FXUA 2AW0A 4ZP7A 2VFVA 3MM8A 5M2PA 1RDUA 5A2QO 2B6AA 1FTCA 4B3MJ 3JXOA 1LW0A 1SVDA 2VFTA 2YX7A 5LSRA 3DOLA 1UVMA 4KHRA 1PYTA 2EFNA 3DLGB 1ZPWX 3J7AN 2CIMA 2O8EB 3GMGA 1S3XA 5F0WA 2FQQB 2DGSA 1ATNA 7FDRA 4RBTA 2IRXA 5A8WA 1QQMA 2UZAA 3M1FA 4LF5K 4R5PA 2YX1A 3VAIA 3HZGA 3WC0A 1RAOA 4NYOA 2KFZA 2VPYB 2MY7A 2Y1LB 3DM2A 1HNWF 3CULA 3Q23A 3PO5A 1IM6A 3SMPA 1T95A 3DMJB 4GKJF 2E5JA 2BM0A 4OJHA 2XS5A 5BRDA 2XYHB 1RBTA 3UE2A 2C28A 5GMKa 1MDUB 5C2DA 5KFMA 2NRWA 3D1QA 3VF6A 1C1BA 3QGPA 1PYOB 2CDRB 2ZOFA 4YORA 1R0BG 3BZCA 2D0CA 2V34A 1NGFA 5K8OA 3D1HA 2VKZG 4OGEA 3G6ES 3Q24A 3KLEB 4DCOB 5AQNA 2LFVA 1DZ5A 4NLDA 1UEVA 3NGDA 5KFQA 2VQFF 3CMQA 2P8IA 4I7FB 4WK1A 3V9WA 5KFJA 2W4DA 4B1VA 2XLKA 2FJVA 1PC4A 4FYYB 3UDCA 3L7OA 3PFEA 3P8BB 1YX2A 4ED5A 4CHOA 2E7XA 2HNZA 1R8PA 3EGWB 4PY5A 2LVWA 1WAFA 1HUXA 3U1LA 4O0IA 4B1UB 2E7WA 4WKYA 3K89A 3H5YA 1WD6A 2E5IA 4Y2MA 2HIYA 4DB3A 1T44A 4EBCA 4HWIA 1UW4A 2VJVA 1RWXB 1SC6A 2KZZA 1B64A 2KYXA 2D5RA 1YHQN 5EWGA 1V6HA 1KQKA 2VBWA 2XYPB 2FVCA 1ZC6A 1WELA 3V6DB 2FHOB 3GIRA 3PW5A 1VQLN 2OHDA 4NXMJ 4FWLA 4YY3F 2FUG9 1U7LA 5TKWA 2HG4A 3THXB 1T7PA 3OTOJ 3SDEA 4BR9A 1WOQA 1GX5A 4BC7A 2HS0A 4RBVA 1PCAA 3MPDA 3O3GA 2HHXA 3U9ZA 4JV1A 2P9LB 4ILLA 1YGYA 7FD1A 2DH9A 1VRUA 3ISNC 2OFGX 1UJ4A 2RHSB 4KV8B 4A2BA 2MY8A 5KFAA 3NCIA 2A5XA 2G8WA 2DY9A 4RCHA 3CJTA 3M9NB 4PR6A 2PMZD 4KFBA 4JI8J 4CJ7A 2A40A 5ETLA 1LK5A 3PX6A 4FOEA 2BANB 2Y0SD 4DL0C 1K0TA 3SZ2A 4E7JA 3CCVS 1G7CB 3VZHA 5K8MA 2WONA 1OO0B 4GVBA 1BUXA 4YOYA 2DNGA 3D66A 2HSTA 3EWGA 4LBIA 1RKIA 1TAQA 2Q66A 3QQCD 2HQGA 1YRUA 3FUYA 1HMVA 4I2QB 2IDLA 4OJ1A 2OEJA 3MI7X 1FJGJ 2HHVA 3L2UA 3HD1A 5AZJB 2R4FA 2NLWA 4NMXA 5F9LA 2AYMA 1VQOS 3BYPA 3JQJA 1QVGM 1WSJA 1PJ7A 1J5EJ 2MPUA 3SEOA 1U1LA 4RU2A 4G9ZA 2OTLS 4H4MB 4F2RA 2AYGA 1XC3A 3E51A 2UUBF 1IKVB 4K0KJ 2UUAJ 2W6LA 4DSJA 2HHTA 1HNZJ 2N7CA 2BJ7A 4B3TK 1GXTA 4BR0A 4A8XA 1NXIA 3TSUA 4CGFA 3MHYA 2W8KA 1AZSB 1RADB 3D6RA 4N7TA 5B09A 3JAMY 4NZ7A 2LQ9A 4RW9A 2VPZB 3V4MA 1WSVA 3VGTA 1B4SA 4CJQA 5A8KA 2BW7A 3CWJA 5ETSA 3C6TB 5KPTA 3R1HA 3M8YA 3KKRA 3U4LA 2LQBA 4JKEA 2AF6A 3DYAB 3EGNA 1RGIA 4JS5A 3LAMA 3WNGA 2Q3PA 3HSGA 4TYBA 1IR2A 4Z4CA 3QAEA 1QSLA 4CD3A 1C1AA 3PJXA 4DFPA 4ZTFA 1PYSB 3CCJS 3M6GA 1KRPA 1F60B 1CZBA 5TKYA 3CFRA 3C19A 5AE2A 3FZKA 3AGKA 4MDBA 3OYJA 2Z1GA 3O8MA 3P1GA 3ZTPA 1J5OA 3ZZOA 3VQQA 1FXXA 3DI6B 1UPMB 4YOVA 3MPYA 1OY8A 3OYLA 1MSWD 3HSJA 3BEXA 2ZEJA 1T8EA 5CYQA 4RR5A 3BQ2A 4FKYA 3O9RA 1VQKN 4MIAA 4P2SA 4ZA1A 4B17A 3MPVA 4BR4A 1MNEA 4IDKA 4I2PB 3P83D 5AQOA 2J5AA 1GOAA 2CFXA 5EOYA 4DR6J 2L9DA 3MCSA 3FSIA 3ILOA 2M9KA 4HTIA 4CZLA 1CSJA 3FZBA 2VB6A 4MAKA 4RNNA 3UB5A 3EE9A 2ZHBA 4CLZA 2VASA 2FHJA 1DLOB 5BR8J 1U48A 1IR1A 3EX7B 2DB1A 3S8SA 3V9XA 1JLCB 3GV8B 3R5CA 2QL9B 4FYDA 2BM1A 1MG7A 3SSSA 1WTBA 2MZ1A 5DG7A 3BQ1A 2OJ3A 1FERA 3CC4S 4MKYA 2G2ZA 4LH4A 2HQDA 3CB4A 2CQPA 3W7BA 4FJ7A 2MKKA 4L76A 3TEGA 4RW8A 1V3SA 1EWQA 5KFTA 4AHRA 2XG8A 4X4NA 2B5JA 2WW4A 4CWBA 5HBMB 2DBBA 1RT6A 2VH7A 4KHPK 1GLJO 2LA6A 1UWBB 3MN7A 3V81A 3QMLA 2HURA 4RWTA 4MO4A 2HS3A 4DSIA 4LSNB 4CZKA 1D3WA 4NRUA 4A8FA 1KLMB 1S6QB 1WC5A 4LRCA 1B0VA 1FI4A 3QT8A 4GY2B 1WG4A 3LP2B 4KE5A 5AQGA 1OH5A 1HKAA 3THTA 5ADXH 1GMWA 4AL7A 3CD6S 2A1SA 3PLAA 2JNJA 3MM7B 3L2VA 4ZTJA 4OYZA 2GVDB 3HPGA 2HFUA 2OPQA 3NKYA 4LF6F 1HX1A 1K73O 4H5TA 4TU8A 2ASYA 4G6VB 2R7WA 1Q0NA 2DPNA 1DQ8A 3HHLC 3SUNA 3T1HF 1IJFB 2H51B 4YHHF 3O80A 1KAYA 1OVQA 5HP1A 3WZ0A 1GLLO 3VQ8A 4ZLJA 1YTYA 5HO4A 3QGGA 5IOLA 4B02A 3KHGA 3FEZA 3NGIA 2QWMA 4N5SA 4MIWA 2F7VA 2W2MP 1E6YB 3DOKA 1BXNA 2D69A 3D2EA 4M94A 5J2MA 4BRAA 2K3IA 4RW4B 4ES2A 6FD1A 1U49A 3LDNA 2GVZB 4KYZA 4DDFA 5CZ2A 2KG0A 4AL5A 3BPDA 1LWEB 2RQMA 1EZZB 4LC9B 4DR7F 1HA1A 4A57A 2MLZA 3OR1A 4K4TA 2D0BA 1RCHA 3CXCM 3BSCA 3UI3A 3KTQA 3CSKA 4M5DB 3OYNA 2KT2A 2VPWB 1YJTA 4GKKJ 2LEBA 4IO1A 2BOPA 1LCUA 2EFGA 5FD1A 3GTYX 4XAKA 1Q8KA 2DEJA 2EWSA 1MWKA