1BIUA

Hiv-1 integrase core domain complexed with mg++
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
154
structure length
147
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 48
structure length 147
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1biuA00
1RDDA 1TKDA 4OGEA 3PUFA 2XY6A 4EP4A 1YT3A 3SZ2A 3NAEA 2YKNA 4I9LA 5CY4A 1T03A 3O4NA 4KFBA 1NKCA 3PX4A 3LP1A 3NF7A 1JL1A 4E19A 2AJQA 1I39A 4KO0A 1RCHA 2OPPA 3O3GA 4FZXC 1TVRA 3QEXA 4CESA 2LSNA 1XC9A 5FDLA 3AVFA 4ZTJA 4FJNA 2X6NA 1HJRA 2EX3A 4FLTA 1B9FA 1SKWA 4CEDA 3THVA 4CEAA 3K2PA 1C1BA 2BANA 3WNGA 4CF9A 3S3OA 3AVLA 1CXQA 3VQ7A 3DM2A 1IKYA 1BIUA 4Q5VA 4DS5A 1C0UA 4I7FA 2G8WA 3KKRA 4DFJA 1JLBA 2X6SA 3TARA 1BCMA 5D3GA 4FJXA 2IS3A 2Z1GA 3LWMA 1LWCA 3DOLA 4OVLA 2HVIA 4AH9A 3OYGA 3QEPA 5J2QA 1RT6A 1WN7A 2PYLA 1WAFA 5HRPA 4ELUA 3D45A 3QIOA 4FCYA 3ZT4A 3AVGA 4W5OA 3F9KA 4CEEA 3B6OA 1ITGA 4O0IA 3NHGA 2Q3SA 4H8KA 4CEOA 1VSJA 3L2RA 4DTOA 4FJGA 1UAXA 3HL8A 3IRXA 1REVA 3WNHA 1KCFA 4B08A 4HUFA 2OPQA 3AA4A 1K6YA 3V1QA 4CGFA 1ASVA 1X9SA 3VQ9A 1U48A 1ZBHA 4Z4GA 1RT4A 4RW8A 2JLEA 4R5PA 3KD1E 4FZZA 2RF2A 1HPZA 2E6MA 2WOMA 3ZSOA 3OYJA 1RDAA 3K57A 4E7JA 4QCLA 5KGXA 1XHXA 5HRSA 4FW2A 1JLQA 1LWEA 1RT5A 3LPUA 2OPSA 4Z4HA 3KK1A 4DTXA 2BGGA 2EHGA 3QO9A 2E4LA 4I9QA 4BE2A 3CM5A 1JKHA 3V9ZA 3NF9A 2O4IA 2KQ2A 2HHVA 3RMBA 1TK0A 2QK9A 4FLXA 3LAKA 3MEDA 3NF8A 2KTQA 4FLZA 1NK9A 3LANA 2GV9A 1VRUA 1VSKA 4B9NA 2OPRA 3DRRA 3HXMA 2VWKA 2B6AA 4ID1A 3KK2A 5CZ2A 1VSDA 3G10A 3SUPA 4M3YA 1RT7A 3DI6A 3HPHA 1HRHA 4CF1A 2R7YA 1JXEA 4NCBA 1TKZA 4RW4A 1RTDA 3DYAA 3HK2A 3ZSYA 1LW0A 3DOKA 1D9DA 4F2RA 3OYKA 1BQNA 1RBTA 4HTUA 3MXIA 4CJ4A 3V1RA 3HPGA 1TAQA 4E89A 4N56A 4H4MA 1JLEA 1I3AA 1XWLA 4I2PA 4CIFA 1CZBA 3NDKA 3SYZA 3K5MA 3NH0A 1EKEA 4DG1A 4HVJA 4B9LA 1RDBA 3OYCA 1CLQA 1S1UA 1QSLA 4XIUA 4W5NA 3HVTA 4CJKA 3AO1A 3CQ8A 3QETA 4KI4A 2QKKA 1S6QA 2YNHA 1C0MA 1DLOA 4CHZA 4CIEA 4CEFA 3QEVA 4DWIA 3F73A 5T7BA 4KAZA 4J2EA 4AHCA 4M3ZA 4J2AA 3AVIA 4FLWA 2Y1JA 4M45A 1U47A 3IS9A 5E41A 2DTUA 3ZSWA 2QXFA 4LH5A 1S1WA 3ZT2A 3T3FA 1KSPA 3HVRA 1VK0A 1QQCA 1B9DA 4I2QA 1WSIA 2XO7A 3LAMA 4E7HA 3OYHA 2NUBA 1HMVA 5DK5A 4DQSA 4KB0A 1C6VA 3ISNC 4FW1A 5CYQA 3I0RA 4Z4FA 2HHXA 4O4GA 1UWBA 2G8FA 4KRFA 3KLGA 3ULDA 3CYMA 3OYNA 4KI6A 4C8NA 2ZD1A 4KTZA 4CIGA 4PY5A 3QEIA 2G8KA 2I5JA 4C8OA 3SQ2A 4DTRA 4CJWA 3SUOA 1KRPA 3MEGA 1TKTA 3V9WA 3V9XA 4CFBA 2D0BA 4CFCA 3SUNA 3IAYA 4J2DA 3L3VA 1WLJA 2OA8A 5KRSA 3KLEA 4N5SA 4CHPA 5C25A 4KHQA 4F3TA 1TK5A 3HSTB 1ZBIA 2P1JA 4Z4EA 4G1QA 3KLFA 3K5NA 3QNOA 1VSFA 4CFDA 3SPYA 4BDYA 3DLEA 5EU7A 4N47A 3L2WA 3AVKA 4RW6A 4CHNA 3VQAA 4O44A 2KFZA 4LH4A 4TSXA 1BHLA 3KTQA 3PX6A 2DFEA 1FK9A 2ETJA 4Y1CA 3K58A 4YNQA 5KI6A 2PY5A 2FBXA 3O3HA 3SI6A 3SQ0A 2D0AA 4KTQA 1LWFA 1C0TA 1N6QA 4DU3A 3AVAA 3ALYA 1L3TA 3EY1A 4M41A 3U6FA 4CGHA 1SL1A 3ZSRA 4E1NA 2OZSA 1HYZA 2YHBA 4JS4A 4BACA 3NGIA 3AO3A 3TWHA 3RR7A 3O4QA 3H08A 4OKEA 1S5JA 3LP0A 4CEBA 3RMCA 2ATQA 3KJVA 3NCIA 3CFOA 4CFAA 1NOZA 5KTQA 1CXUA 2G8UA 2GBZA 1X9WA 1KFSA 3ZT3A 1WSHA 3C6UA 1ZYQA 2Z1IA 2Y1IA 4O55A 4FK0A 3NH2A 4KHSA 2YKMA 5FRMA 1NJZA 4JLHA 4B9VA 4M42A 4NCGA 3C6TA 1JLCA 3L3UA 3ZSZA 1RBVA 1VSEA 4GVMA 4CHQA 4PWDA 3TR8A 1LAWA 1SUQA 3DLGA 3PV8A 1RNHA 4BDPA 2FBVA 3SV4A 4Y1DA 1L3VA 1TAUA 4F2SA 2DY4A 3TI0A 1HNVA 3AVJA 1RT1A 1NJXA 4M3UA 4OKJA 4O0JA 1L3SA 2IC3A 1A5VA 3HP9A 3S3MA 4ZTFA 1JL2A 4CJFA 3M8SA 3BDPA 1KVBA 4IDKA 2DFFA 1QSSA 4CJ3A 2KZMA 3MEEA 1D9FA 1ASWA 1XI1A 1JLGA 3AO5A 2P5GA 4C8MA 4RG8A 2FC0A 3K5OA 4CGDA 1HQUA 1YTAA 2FBTA 2ITGA 2X78A 3OS2A 3EYZA 2Z1JA 3V1OA 4KB1A 4DLEA 1TL1A 3U3YA 1F21A 4LY7A 4CJVA 3V4IA 5HLFA 1L3UA 1RILA 4CK1A 4F3OA 4Z4CA 1R0AA 3TAGA 3T19A 5J1EA 1S1TA 1WSFA 2P5OA 4OKKA 4W5TA 3OYMA 4JS5A 1ZBUA 3PY8A 3L8BA 3D0PA 3QLHA 3NFAA 4CGJA 3T1AA 1RBUA 3VQCA 1BQMA 4PUOA 4M3WA 2ZQBA 5JS2A 1RDCA 4DU4A 1IKXA 3HM9A 4K8ZA 1YTUA 2XHBA 1BIZA 4FYDA 5FRNA 2PZSA 4FJJA 1RBSA 1QHTA 1S6PA 2IOCA 3AA2A 4OGCA 4KTWA 1SKRA 1S9EA 3I0SA 5J2NA 1U4BA 4GW6A 5CYMA 3KLHA 4DF4A 4YFUA 3TANA 3AVCA 4ELVA 3VQQA 1GOAA 4IKFA 4NYNA 3OS1A 2G8VA 4FK2A 2QKBA 3MECA 4DQPA 3NF6A 4CJUA 2YNIA 4IFVA 4JRQA 2W42A 3KKSA 3P83D 3VQDA 1UA0A 2E6LA 3OYFA 4C8LA 1LW2A 1IH7A 4FLYA 4N41A 1NK5A 1L5UA 1U04A 3P1GA 1IKVA 1ZBLA 1EP4A 1J54A 3S9HA 4CJLA 3WNFA 3V81A 4CE9A 4ICLA 3PO4A 1VSHA 4IG3A 2KW4A 3OYAA 1JLFA 4CERA 3JSMA 1KLNA 4DSIA 4PQUA 2G8IA 3TABA 4DU1A 4FK4A 1RTHA 3V9SA 5J2MA 3JYTA 1WAJA 1VSIA 4FLUA 3AVNA 4GMJB 5J2PA 4QAGA 3L2QA 2HVHA 4HHTA 1QE1A 3QIPA 4WE1A 2VG5A 3KD5E 2RKIA 4AHVA 1KLMA 3HT3A 3LZJA 3SJJA 3SPZA 4DSKA 4E7KA 4FJHA 1T05A 3VQPA 4ZHRA 4DSJA 1VSMA 4AHTA 1DTQA 4CHYA 4M3TA 2VWJA 1GOBA 4Q0BA 1TL3A 2IGIA 1FKPA 4BWJA 4BE1A 3SV3A 4E7LA 1W0HA 4DTSA 1NK8A 2BDPA 3ZT0A 3ITHA 4NYFA 2KZZA 3BGRA 3VN5A 4C8KA 1SL2A 2YNFA 4JRPA 1S9GA 3DRSA 4DQRA 4EP5A 1TGOA 3O3FA 5I42A 2YNGA 1A5XA 1CZ9A 3SQ4A 3QERA 3LZIA 4UQGA 3TAMA 4OLBA 3NBPA 4EZ6A 4K8XA 3L2VA 1HYSA 4IG0A 3SUQA 3LP3A 1HQEA 2ZE2A 2HNYA 4CK2A 2IDOA 2A1SA 4H4OA 1MU2A 1NOYA 1QTMA 1BGXT 4F4KA 4MQ3A 4FM1A 4E3SA 4ELTA 1C1CA 3VQ5A 2HW3A 2XY8A 4DQIA 1KVCA 3LALA 1X1PA 2X74A 3QNNA 4CJEA 2XRIA 3KK3A 1NK6A 4HUEA 4CHOA 3RRHA 5HROA 1LV5A 4L8RB 2KFNA 1T8EA 2HHSA 1LAVA 1IKWA 3DLKA 3CG7A 3LPTA 3KIOA 3OJUA 3M8RA 3PX0A 2IAJA 2BE2A 3ZSXA 1D8YA 2HMIA 3RR8A 1WSGA 1KTQA 4DLGA 4CJPA 1VSLA 4E1MA 4AHRA 3WNEA 3IG1A 4CCHA 4J2BA 1GOCA 4FJIA 4CECA 4B8AB 4E0DA 3ZT1A 4CF8A 1U45A 1X9MA 3AVHA 4IBNA 3NH1A 1SV5A 3MXMA 2A1RA 3OS0A 3HO1A 4M3XA 1KFDA 3QESA 2FBYA 3TAFA 4CK3A 4DFKA 5K14A 1D5AA 1QS4A 3AO2A 4DS4A 5HRNA 3E01A 5CZ1A 1WSJA 4OPKA 4KHNA 1NK4A 3VQ8A 2WONA 4RW9A 2YHAA 4HCCA 3CM6A 2XY5A 1EETA 5HP1A 1S1XA 3FFIA 1G15A 3VA0A 4RW7A 4KHYA 4EZ9A 4IFYA 1TV6A 4CEQA 1UA1A 4LSLA 4DTNA 4E7IA 3RMDA 3HYFA 3HPOA 2DFHA 4KKOA 4BWMA 1KVAA 3B6PA 2HHWA 3RTVA 4DTMA 1ZBFA 1NKEA 5DMRA 5JS1A 1RTJA 3LP2A 4OJRA 3TAEA 4FJMA 2HNZA 2B5JA 3SQ1A 3G0ZA 3AVMA 1WSEA 4B9TA 3OY9A 3VQEA 4M3RA 3SNNA 4DTUA 2VG6A 4CF2A 3AV9A 3ZSQA 1BI4B 4AHUA 3NGZA 1UOCA 2Z1HA 3NE6A 4AILC 3AVBA 3S3NA 3HP6A 2PYJA 3AA3A 3CFPA 1ASUA 3P5JA 2HHQA 1YVUA 3MAQA 3ZSVA 3RRGA 3UIQA 3AA5X 3VQBA 4OLAA 4CJ5A 3OYLA 4FJ5A 1J53A 2RPIA 4FLVA 3DLRA 2O4GA 1FXXA 4LD0A 3L2UA 2B4JA 4PA1A 4CGGA 5C24A 1J5OA 4DFMA 4KREA 1C1AA 1EXQA 4CEZA 1Z26A 2HNDA 3ASMA 3I8DA 4LSNA 4HUGA 2P51A 3C95A 1Y97A 2D0CA 4CJRA 1RT3A 1Z25A 4CJQA 4W5QA 3PO5A 3TAQA 4KHUA 4B9UA 2HB5A 5HBMA 5C42A 1NJYA 1NJWA 4HCBA 1DTTA 1JXBA 3DLBA 4FJ7A 1RBRA 1RTIA 5HRRA 4BDZA 3OYIA 3C94A 4O5BA 3SCXA 1BL3A 1J9AA 3TAPA 1BI4A 4F8RA 2YV0X 3OYDA 4DTJA 3M8PA 1RT2A 1W9HA 3OJSA 3DLHA 4B9SA 2GUIA 3VQ4A 4OPJA 3VA3A 2D5RA 3QEWA 4FJ8A 1EX4A 3CFRA 1S1VA 1SKSA 2HHTA 3NGYA 3A2FA 4FVMA 3VQ6A 2F8TA 1FKOA 3DMJA 1NK7A 4W5RA 5SZTA 1NKBA 2F8SA 2VG7A 3KLIA 1IG9A 5KGWA 4MFBA 4KV8A 3EZ5A 4FXDA 4Z0UA 3V6DA 5KRTA 1Q9YA 1BISA 4DTPA 4N76A 3LWLA 5SWMA 3K5LA 2F96A 4DSEA 4Z4IA 4AHSA 1SL0A 2HHUA 3AO4A 1VRTA 2G8HA 3K59A 3DRPA 1N5YA 3QINA 4FJ9A 2RN2A 3M8QA 1TKXA 1NK0A 1U49A 3RMAA 2JGUA 2OYQA 1TK8A 1B92A 1Q8IA 3OYBA 4FZYA 3HJFA 4CGIA 3OVNA 2XY7A 4FJKA 4B3OA 4CJSA 1HNIA 4DFPA 4FM0A 3V9UA 4DF8A 4CJTA 4DSFA 3U3GA 5I3UA 1QSYA 1WNSA 3MXJA 1XHZA 1A5WA 3RWUA 4DMNA 1T7PA 4KPYA 4DQQA 1IO2A 1Q9XA 4DSLA 4FM2A 4NCAA 5FROA 4KHWA 4FJLA 4ID5A 4B8CA 3LDSA 1O1WA 3ZCMA 3OYEA 4CF0A 2OZMA 1HYVA 1JLAA 4B9MA 4BE0A 1BCOA 4QOZB
chains in the Genus database with same CATH superfamily
3Q7CA 1RDDA 4K25A 1K8KB 4OGEA 3O9SA 2XY6A 5IWAK 5CY4A 3FLCO 4C1NI 4JI5K 2E2NA 4KFBA 4JEPA 4BRPA 3HRGA 3AVFA 4ZTJA 2EX3A 1SKWA 3THVA 1C1BA 2VCPA 1TYQA 3S3OA 2ZF5O 3AVLA 1GLFO 1CXQA 1RGIA 2G8WA 4I7FA 2HF4A 1BCMA 1FW6A 5D3GA 1LWCA 1HNWK 4AH9A 3OYGA 2PYLA 3GE1A 1K8KA 3GOIA 4DV5K 3CC2N 2OTJN 4CEEA 4DTOA 2BTFA 3AAQA 1KCFA 5AQMA 3WT0A 2JLEA 3KD1E 5E84A 2A5XA 1RDAA 2P9UB 2QXLA 1LWEA 4DTXA 3QO9A 4I9QA 4BE2A 2IVNA 3CM5A 4BR4A 4EHUA 1IBKK 3NF9A 5HOOA 1TK0A 3DJCA 3LAKA 4BGAA 4XH4A 4M3YA 3BF1A 4CZGA 2YX6A 1GLDG 1Z05A 2ZWHA 4CF1A 5TKYA 1TKZA 1JCFA 3DYAA 1QZ6A 2AA4A 2FF6A 3N4PA 4DV0K 4O5FA 3V1RA 1TAQA 3P38A 4N56A 2P9UA 3SYZA 3QDKA 4PKHA 4B9LA 4FWPA 1CLQA 4XIUA 4W5NA 4HWIA 4CJKA 3CQ8A 3QETA 2UXCK 1S6QA 2Q1NA 5BR9A 1C0MA 3WEEB 3VEVA 4CEFA 1NNEA 5T7BA 4M45A 1VQNN 4DQ8A 1ATNA 2QXFA 3FZMA 3GDQA 1WSIA 4GNIA 4DQSA 4FW1A 4JKHA 5CYQA 3I0RA 4O4GA 4IO8A 3SLCA 2WTUA 2ZD1A 4PY5A 4IEIA 3QEIA 2I5JA 4C8OA 1NMDA 2E1ZA 1IV0A 4DTRA 3MEGA 3J7AP 3RSEB 3C6HA 3IAYA 3SUNA 4J2DA 5ELZA 5AQKA 4N5SA 3KLEA 3P31A 5C25A 1K9MO 1TK5A 4WFNL 3O4WA 3H1QA 4G1QA 3QNOA 4CFDA 4WF9L 5AFUH 3T7ZA 4RW6A 1X3NA 2CH5A 3PX6A 2P9SB 2DFEA 3CCSN 4Y1CA 3K58A 2NRVA 2D0AA 4BRFA 4IZ9A 3ALYA 1L3TA 3EY1A 1BO5O 4CGHA 2GELA 2YHWA 3HM8A 2OZSA 1HYZA 3RSEA 4M7YA 3WXIA 3NGIA 3D2EA 3RR7A 1S5JA 4CEBA 1N34K 5KQ8A 2A40A 2IVOA 4ILJA 5KTQA 2G8UA 1X9WA 4DV3K 3C6UA 1ZYQA 4O55A 4V19S 4M42A 1NGCA 2CGJA 1OH5A 1JLCA 4B1WB 1NLVA 4GVMA 3ZSZA 3J80O 3DLGA 1RNHA 2FBVA 4Y1DA 4FWNA 3TI0A 2VGMA 1RT1A 1L3SA 3BDPA 3MWPA 4CJFA 4YOYA 4CJ3A 1ASWA 3VGKA 4H0TB 1YTAA 2FBTA 3F9MA 2ITGA 2X78A 3EYZA 3TSUA 4DLEA 1TL1A 4WFAL 3QFUA 5J1EA 3OYMA 2IIRA 4L3QA 1NGHA 3D7EO 3L8BA 3NFAA 3VERA 4M3WA 4DU4A 1Q18A 1IKXA 3HM9A 4OX9K 3U9ZA 4EHTA 2XHBA 2PZSA 2KLAA 4FJJA 1XC3A 2WBNA 4OGCA 5BREA 1S9EA 4JKGB 3QBWA 3KLHA 4DF4A 1JCEA 4YFUA 3TANA 4ELVA 1LCUA 4NYNA 5AQFA 3OS1A 2QKBA 3LM2A 3ID6A 4IFVA 4JRQA 2W42A 3KKSA 1QQMA 4JHDB 1YUWA 5H1SQ 3P1GA 1W2BM 1EP4A 4CJLA 4FL9A 1SQKA 4ICLA 1VSHA 4Y0WA 3OYAA 1JLFA 3JSMA 1KLNA 3DXKB 4DU1A 4BG9A 1RTHA 3A5OC 1S72N 4JKGA 3AVNA 1P8ZA 5J2PA 1EWRA 3CHWA 2P9NB 2VG5A 3H1VX 3HT3A 3K9KA 3TTDA 1VSMA 4AHTA 4QS9A 5AQWA 2OTLN 4Q0BA 5KPZA 4BWJA 3SV3A 4YOXA 3ZT0A 1NGBA 4LF6K 3P4IA 2KZZA 2YNFA 2YHYA 4JRPA 3DXKA 4GV6A 3DRSA 3FZKA 5I42A 2GWKA 3QERA 3SQ4A 1E4FT 3OW2M 1NGIA 3CJ7A 3L2VA 3LDPA 1BG3A 2HNYA 5TKWA 1QVGM 2A1SA 3SAHA 2P9NA 1ZXOA 4E3SA 3VQ5A 2O8DB 4DQIA 3QNNA 4DR1K 3BUZB 3SBGA 3FE1A 2HHSA 3DLLL 3DLKA 1IKWA 1NK6A 2HMIA 3RR8A 4BRHA 1WSGA 3MDQA 2H3GX 4DLGA 4CJPA 4AHRA 1GOCA 3S41A 1U45A 2O8EA 5EXWA 4YY3K 4E1JA 1NWKA 3NH1A 2A1RA 2WFBA 2YJEA 3HOTA 1KFDA 4LF5K 2FBYA 4H0YB 4DFKA 2I7PA 3AO2A 3Q7BA 4DS4A 2O8DA 4IOXA 2Q31A 2PFUA 2WONA 4CW7B 3BP8A 1EETA 2GEMA 5HP1A 3EL2A 1G15A 4WQ5C 4AQYK 2O8CB 1DGKN 3AARA 4KKOA 4BWMA 3CMEN 2HHWA 3RTVA 3TSPA 1RTJA 4FJMA 3CQXA 2ASPA 3PIPL 2HOEA 3CJ9A 1RDWX 1TUUA 3VQEA 3SNNA 3ZSQA 3S3NA 4KI6A 5JMVA 1DT9A 3F5TA 4O8UA 4BVOA 4EAHD 3FZLA 4JK8A 3RRGA 3AA5X 4A2BA 5ADXH 4CJ5A 2DPNA 4IJAA 1J53A 5BRDA 3L2UA 3CCMN 4CGGA 1J5OA 1C1AA 4LSNA 2P51A 1Z25A 4CJQA 3PO5A 2F7TA 1NJYA 2O8FB 4BDZA 3ATVA 4MDBA 3SCXA 2JWLA 3R9PA 5GAGP 3TAPA 1FJGK 1JJ2M 2YV0X 3M8PA 1RT2A 1W9HA 4H03B 1J5EK 4BR7A 2D5RA 1GLBG 4KH5A 3I56N 3GG4A 4FVMA 2F8TA 1FKOA 3DMJA 3MN6A 4QS7A 4W5RA 2F8SA 2VG7A 3T1HK 4BRMA 1IG9A 4MFBA 1TUYA 4NB4A 3V6DA 1Q9YA 4N76A 4DTPA 4A5BA 1OH8A 2D4WA 1KD1O 1XNQK 4GY2B 2G8HA 1M1KO 2QWQA 3DRPA 3ZETB 3VENA 2O8FA 1NK0A 3RMAA 3DAWA 2JGUA 2RE2A 3QFPA 2OYQA 2HBMA 3HJFA 2HBLA 4FZYA 1WBBA 1YHQN 3OVNA 4B3OA 4CJSA 2VWBA 3V9UA 4M63C 1VQ5N 4CJTA 4WCEL 1T7PA 5FROA 2KHOA 2D1KA 3VEXA 5BRFA 4JI7K 4EP4A 4FPAA 4IDHA 1T03A 3ZETA 3PX4A 5AZIB 3EN9A 4E19A 1K8AO 1I39A 4BRAA 3O3GA 1TVRA 3KZBA 5FPMA 1I94K 4CEDA 4CEAA 3K2PA 4BRQA 4FWMA 1IKYA 2Q0RA 4DFJA 1JLBA 4FJXA 2Z1GA 4H0PA 4OVLA 3DOLA 5LMUK 4ELUA 3ZT4A 3NHGA 3B6OA 5C2FA 2UUBK 1VSJA 1Q7YO 3L2RA 2NRTA 5AZIA 3HL8A 1YITN 3IRXA 3R8EA 4A2AA 4B08A 3AA4A 1X9SA 4JV5K 4B9QA 1ZBHA 1RT4A 2P9KB 3JXUA 2RF2A 2E6MA 3OYJA 4QCLA 4DR3K 5KGXA 4LFAK 1Q81O 1XHXA 2OPSA 1S3XA 2BGGA 2EHGA 2JWKA 1JKHA 2P9IB 5JICA 2O4IA 2QI2A 2D0PA 5LJWA 5A2QO 4B9NA 1GLJO 1VRUA 3DRRA 1W7AA 3EKUA 2B6AA 4ID1A 4BG8A 3C7NB 1VSDA 3WXMB 3DI6A 3HPHA 2R7YA 4NCBA 4RW4A 1RTDA 3ZSYA 2P9KA 1LW0A 2HSTA 3DOKA 3MXIA 1NGFA 1YAGA 3HPGA 5BPNA 3NDKA 1XWLA 1CZBA 3NH0A 4HVJA 4DHYA 3KWGA 5EX5A 4B1XB 3AO1A 2P9IA 3AGKA 2YNHA 4DR4K 4DB3A 4CIEA 3LDOA 4B3RK 3CCEN 4OPAA 3L0QA 4DV7K 3F73A 4J2EA 5JVGL 4J2AA 3AVIA 3C7NA 4JI6K 5E41A 2ZGZA 1U47A 4JD2B 3ENOA 3E9PA 5KPTA 3LAMA 1J6ZA 3OYHA 4Z4FA 2D0OA 3N4QA 3CCUN 4KRFA 2QA4N 3KLGA 3HBTA 4FVUA 4C8NA 2AP1A 2IVPA 4CIGA 3NMUA 3SQ2A 3OTOK 4CJWA 1KRPA 3V9XA 4JD2A 4PKIA 4CHPA 4KHQA 4IFEA 2UXBK 3A8YA 4F9OA 4NXNK 3UB5A 1RFQA 3SPYA 4BDYA 5KQDA 3DLEA 5EU7A 1MWKA 2ITMA 3KTQA 5M1OA 2NRRA 4YNQA 4KTQA 2NRWA 1LWFA 5LY3A 1N6QA 3E1YA 2I7NA 3LDLA 2YHBA 3R6MA 3TWHA 2P9PA 4JN4A 5AQYA 3SK3A 4MO4A 1XUPO 1WSHA 3W3DA 1U6ZA 3J8AA 4FK0A 3NH2A 4KHSA 3VPZA 4EFHA 4NCGA 5BRHA 3C6TA 1YJ9N 3FFKB 1RBVA 3TR8A 3PV8A 3E9LA 3P39A 4F2SA 1YI2N 1NJXA 3VF4A 3OBYA 1A5VA 1R59O 3M8SA 4ISEA 4IDKA 2KZMA 3MEEA 4FWRA 1XI1A 1JLGA 3VTHA 2WC9A 4CGDA 3V1OA 4KB1A 3U3YA 1F21A 4CJVA 2ZM6K 1Z6RA 4CK1A 3THXB 1R0AA 3TAGA 4K0KK 1HKBA 1WSFA 4LF4K 4J8FA 4JS5A 1CZAN 4JI8K 3BY5A 3PY8A 3D0PA 1LOTB 4JK7A 3C65A 4DV6K 4CZLA 3MCAB 3J7ZO 1YTUA 5JLHA 1HNXK 3PLAA 3ZX2A 2A6AA 1SKRA 3BZKA 5J2NA 1XMOK 4GW6A 5CYMA 4I6MB 2QWRA 3AVCA 1GOAA 4B1VA 2NRXA 1KQSM 4JKDA 3VQDA 3P83D 2E6LA 2NLXA 1IH7A 3O9TA 4WQ5A 4FLYA 1NK5A 1L5UA 2W41A 1IKVA 5M1KA 3S9HA 3IUCA 4IG3A 4DSIA 4PQUA 4CZMA 3CCVN 1U2VB 3JYTA 5AQLA 1VSIA 4FLUA 1KAYA 2CH6A 4QAGA 3WEEA 3D6RA 4I6MA 5CE3A 5EVZA 4BVPA 4BR2A 4AHVA 1KLMA 3SJJA 4E7KA 3VQPA 4JI1K 3ULEB 4H0OA 4CZKA 4CHYA 3EE9A 3VF6A 3IKMA 4LC9B 2Q0UA 3EZWA 4BY9C 5CHIA 1NK8A 4BE1A 4HCBA 1W0HA 2BDPA 4H5WA 2FSNA 2ZGYA 4NYFA 3O8MA 1WBDA 3VN5A 4C8KA 1TGOA 3O9QA 3KHYA 1U2VA 2YNGA 5AQHA 5FPEA 3EEQA 3LZIA 4UQGA 1HYSA 4IG0A 3LP3A 2F9TA 2ZE2A 1NOYA 3IDHA 4H4OA 1QTMA 1BGXT 4MQ3A 1VQ8N 4FWSA 2HW3A 4JKFA 3ULEA 1VAZA 1X1PA 4DUZK 5HROA 4BC3A 4FSVA 3M8RA 2P5OA 3OJUA 3PX0A 3ZSXA 5AQVA 4M7XA 2P9SA 4FJIA 1T3VA 4B8AB 3HOSA 5IT9O 2CGLA 4ILHA 1T6DA 2HF3A 3AVHA 2FLOA 2F9WA 3MXMA 2W40A 3OS0A 2ZJQL 3TAFA 3HI0A 3QESA 4IOAL 1D5AA 3THYB 4OPKA 5AFUA 3VTIA 4KHNA 1NK4A 3VQ8A 4RW9A 3AAPA 1GLCG 1S1XA 5AQNA 4EZ9A 4IFYA 5GINA 1E3MA 3JAMO 3QICA 1ZBFA 3TPQA 5BPLA 3CETA 3AVMA 4M3RA 2VG6A 4CF2A 3NE6A 1BI4B 3NGZA 1UOCA 4CBXA 3AVBA 2UUAK 4B3SK 3THYA 3CFPA 3MAQA 3UIQA 3ZSVA 4WQ4C 3OYLA 1N33K 2O4GA 1FXXA 5C24A 5JVHL 3I8DA 1Z26A 4CZIA 3ASMA 2OCEA 4HUGA 1Y97A 4CJRA 3E66A 4W5QA 4RWTA 4LF9K 2PBDA 4B9UA 5C42A 3M6GA 1DTTA 1JXBA 3CERA 4FJ7A 5BPMA 1RTIA 4U67L 1EO1A 1O13A 2UU9K 4X64K 3M5RA 1J9AA 1BI4A 4DTJA 4PL7A 3OJSA 2GUIA 3VA3A 3QEWA 4FJ8A 3CFRA 1S1VA 2NZTA 4DCHA 3A2FA 2GUPA 5LL6Z 4K42A 5GAHP 5KGWA 4KV8A 1IBMK 3LWLA 3K5LA 1SL0A 2HHUA 4JHDA 3AO4A 1VRTA 2RN2A 5FLXO 1U49A 3GBTA 3FZFA 3ZYYX 1TK8A 1B92A 3O9UA 4CGIA 2XY7A 1HNIA 1QQOA 3R3LA 3ZEUB 4DSFA 3DWLA 4DF8A 2HMPA 2OZMA 3OYEA 1HYVA 4DR7K 1JLAA 4FOIA 1BCOA 1NGDA 4QOZB 1HJOA 4YOTA 1TKDA 2A3ZA 4CVNE 1YT3A 3SZ2A 2YKNA 3NVKA 3O4NA 3CJ1A 1BWFO 1NKCA 3VF2A 3LP1A 1JL1A 2AJQA 1G99A 2OPPA 2RHKA 5C12A 3QEXA 4CESA 5AQGA 5FDLA 2X6NA 1HJRA 1B9FA 4LFBK 2V51B 3ZEUA 1MDUB 2BANA 3WNGA 4CF9A 2WUSA 2ASOA 3VQ7A 3DM2A 1BIUA 4DS5A 3KKRA 1Q82O 2V52B 3L4QA 3O80A 3QEPA 3U9DA 5J2QA 5HRPA 4W5OA 4LFCK 4O0IA 5BN9A 1ITGA 4H8KA 4FJGA 1UAXA 1GLAG 1REVA 2Q36A 4JKBA 4HUFA 2OPQA 1K6YA 1IG8A 3V1QA 4CGFA 1ASVA 3B8AX 3VQ9A 4Z4GA 4RW8A 1N8RO 3KVGA 4R5PA 4FZZA 1HPZA 4IWVA 5HRSA 5GIPA 3LPUA 1RT5A 2KKZA 4Z4HA 3KK1A 4KHPK 1SZ2A 4DUYK 2W6KA 3V9ZA 3CCRN 2KQ2A 3CPEA 3MEDA 3BEXA 4FLZA 1NG9A 2O8CA 1JXEA 1YJWN 1HUXA 3HK2A 3WXKA 1D9DA 4F2RA 4OO1J 3OYKA 1BQNA 5FRNA 4E89A 4H4MA 1I3AA 1VQ6N 1EKEA 3OYCA 1S1UA 1QSLA 4A62A 1BU6O 4IOCL 5C2DA 4H5RA 4DWIA 4AHCA 4M3ZA 4FLWA 2Y1JA 3IS9A 2DTUA 3ZSWA 2FSJA 3ZT2A 4LH5A 3T3FA 3HVRA 3FR0A 3CC4N 1VK0A 3EO3A 1W97L 4KB0A 4BQZA 1C6VA 3ISNC 2HHXA 4PKGA 1UWBA 3THWB 2G8FA 3ULDA 3CYMA 5ADXA 5F2RA 3OYNA 4KTZA 2YJFA 3UKUB 4DV4K 1NGAA 1EQYA 3SUOA 4JI3K 5AQJA 1TKTA 3V9WA 2A42A 2OANA 2D0BA 2OA8A 1WLJA 4F3TA 3HSTB 4MDAA 1DEJA 2P1JA 4Z4EA 3WXJA 3KLFA 3K5NA 1VSFA 3O1WA 2O8BB 4N47A 3THWA 3AVKA 4FPBA 3VQAA 4O44A 4TSXA 3FGUA 3LDNA 4DR2K 2ETJA 5KI6A 2PY5A 2FBXA 3CF5L 3SI6A 3UKUA 4B1ZA 4CZHA 4DU3A 3AVAA 4M41A 3U6FA 1VQLN 1SL1A 4E1NA 1KAZA 1T44A 4K43A 3CJBA 1NGJA 3LP0A 3RMCA 2ATQA 4AM6A 4CFAA 3NCIA 1KFSA 3ZT3A 3VMFB 1NJIO 5AQIA 4BC4A 2Y1IA 5FRMA 2YKMA 2O8BA 4JLHA 4B9VA 3QBXA 4RCHA 3L3UA 1VSEA 4PWDA 4CHQA 4IEEA 1SUQA 3CMAN 4C1NK 2J4RA 4BDPA 5MLCQ 2W6LA 4OKJA 4ZTFA 3U4LA 1KVBA 4NLBA 1QSSA 1D9FA 4JKCA 3HZ6A 3AO5A 2FC0A 1HQUA 4BQLA 4CZJA 1Q86O 3SJHA 4BRKA 5HLFA 4BROA 1L3UA 3T19A 1S1TA 4OKKA 1ZBUA 2E1YA 1BA0A 3QLHA 1VQKN 1BQMA 3C0BA 1NGGA 2IOCA 3MX5A 4KTWA 3I0SA 1OKJA 5F0XA 1U4BA 3I55N 4IKFA 3SMSA 4FK2A 3MECA 3SMPA 4DQPA 1UA0A 4C8LA 3TU5A 3K0SA 1HKGA 5JLFA 5LMNK 5C0YA 1U04A 4G9ZA 3A5MC 5DM7L 4CE9A 3PO4A 3O9RA 2KW4A 3LDQA 2QWLA 2G8IA 3K9JA 5J2MA 3OHRA 2VQEK 3H3OB 5M1QA 3L2QA 3R1XA 2HVHA 1HLUA 4HHTA 3QIPA 5F1XA 3MN5A 3KD5E 2RKIA 3LZJA 4FJHA 3SPZA 1ESVA 1XNRK 1T05A 4ZHRA 4M3TA 3M3ZA 4FWLA 4B3MK 1GOBA 4BRLA 1TL3A 2IGIA 2NRZA 4E7LA 1HKCA 4BREA 3ATUA 3MX2A 4LF7K 4B1YB 4HTLA 1MA9B 3VGLA 3BGRA 4A5AA 1SL2A 5AQOA 3TTFA 4EP5A 1H1VA 3O3FA 1XMQK 3U8XA 1A5XA 1CZ9A 4XEIA 4OLBA 4EZ6A 4K8XA 1HQEA 1S22A 3PIOL 1YXQA 2IDOA 2V7ZA 1MU2A 1C1CA 2XY8A 3ZX3A 4CI6A 1BUPA 3LALA 3T69A 3VEWA 4CJEA 5BR8K 1LV5A 4L8RB 2KFNA 3LPTA 4U7BA 3KIOA 2IAJA 5M1NA 1KTQA 3CJCA 3IG1A 4CCHA 4J2BA 5CR4A 4CECA 3ZT1A 3J81O 4IBNA 4GVEA 4B3TK 5LJVA 3VOVA 4A59A 1XQSC 1OVQA 4BRGA 4CD1A 2UXDK 4H5VA 1VHXA 5K14A 4CZFA 3E01A 5CZ1A 1WSJA 3MN7A 5HRNA 2YHAA 4HCCA 3CM6A 2XY5A 1BOTO 1SS6A 3FFIA 3VA0A 4KHYA 4FWKA 4CEQA 1UA1A 4LSLA 4DTNA 4E7IA 3HYFA 4OPHA 3UE5A 2DFHA 1HR0K 3VETA 4RTFD 4O8KA 4YDUC 1NKEA 5DMRA 5JS1A 3LP2A 4OJRA 2B5JA 5GIOA 3SQ1A 3G0ZA 3A0IX 3OY9A 3H6EA 2UUCK 3AV9A 1OVYA 4AHUA 4AILC 4H0VB 1IBLK 3AA3A 2NRHA 1ASUA 3H45C 2HHQA 1P90A 3SBTA 3VQBA 3HSCA 4OLAA 5GADP 5E26A 2RPIA 2B4JA 5KPRA 1YF5L 4KREA 1EXQA 4CEZA 2HNDA 3TSQA 2QM1A 1VQMN 3THXA 3C95A 4WFBL 4KHUA 5HBMA 4YOWA 1NJWA 3DLBA 1ILYA 3OYIA 4O5BA 5AZJB 1BL3A 4F8RA 3JS6A 5FPNA 4FWOA 4B9SA 2HBJA 4OPJA 3O6WA 1E4GT 4YHHK 5GAEP 3QB0A 3T1YK 1NK7A 5SZTA 3WQUA 4FXDA 3I33A 5KRTA 1BISA 2F96A 4JK9A 4AHSA 4XH1A 1KXPA 3QINA 2YHXA 1TKXA 5AZJA 3H46O 1QHAA 3OYBA 4FJKA 4GV9A 4CJ7A 2E88A 3U3GA 5I3UA 1WNSA 1A5WA 4KPYA 4DMNA 4DQQA 4NCAA 4FM2A 3D2EB 4KHWA 4FJLA 4ID5A 1O1WA 3ZCMA 4CF0A 4BE0A 3L4IA 1DKGD 2ZJPL 3PUFA 3NAEA 4PL8A 4I9LA 2QWPA 4Z94A 3NF7A 5AQRA 4KO0A 4C23A 1RCHA 4FZXC 1XC9A 2LSNA 4FJNA 4BR9A 4QS8A 4FLTA 4IJNA 1SAZA 5M1PA 3CQYA 4Q5VA 1C0UA 4BRIA 4NXMK 2X6SA 3TARA 2IS3A 3LWMA 2HVIA 1ZC6A 1RT6A 1WN7A 1WAFA 1YJNN 3D45A 3QIOA 4FCYA 3EE8A 5AQPA 3AVGA 3F9KA 2Q3SA 4CEOA 1JCGA 1X9JA 1MWMA 3WNHA 3C6AA 2QWNA 3ZX0A 1U48A 2BUPA 3ENHA 5B8HA 4DV2K 4E7JA 2WOMA 3ZSOA 3K57A 3VEYA 4B1UB 3SAFA 3CCQN 2FSKA 4FW2A 1JLQA 4BRCA 1HX1A 2HHHK 2E4LA 3BZCA 4LF8K 1VQ9N 4IO9L 3RMBA 2HHVA 5M1FA 4FLXA 2QK9A 3NF8A 2KTQA 1NK9A 1X3MA 3LANA 2GV9A 1VSKA 3AY9A 2OPRA 3HXMA 2FF3B 2VWKA 2YI1A 3WXLA 3KK2A 5CZ2A 3G10A 3SUPA 1RT7A 4GV3A 1HRHA 4ILGB 1OH7A 2BH1A 1Y64A 1ATRA 4HTUA 1RBTA 4X65K 5HL7L 2PAVA 4CJ4A 4UY8O 4CIFA 1JLEA 4I2PA 4FWQA 3G25A 3K5MA 4DG1A 1VQON 1RDBA 3HVTA 4KI4A 2QKKA 4XH5A 1DLOA 4CHZA 3OBWA 3G4SN 3QEVA 1HPMA 4KAZA 3VEOA 5FPDA 4CBUA 1KSPA 1S1WA 4JI0K 2QTDA 3TTCA 1QQCA 1B9DA 4I2QA 2XO7A 4E7HA 2NUBA 1HMVA 4KH4A 5DK5A 3A5NC 3I8BA 2HBKA 1T6CA 4JAXA 4K41A 2G8KA 2YCHA 3CCLN 3CXCM 3CIPA 2QWMA 4CFBA 2VGNA 4CFCA 2Q97A 4MO5A 3ID8A 3L3VA 5KRSA 3NVMA 3O5BA 1ZBIA 1EWQA 3MMVA 1VQ7N 5AQXA 3L2WA 4GKKK 4CHNA 2KFZA 4LH4A 1BHLA 4FOEA 2A41A 4AF1A 1FK9A 2GX9A 2O8EB 3SQ0A 3O3HA 1C0TA 5AQSA 2ASMA 3ZSRA 4JS4A 4BACA 3AO3A 5BN8A 3O4QA 3H08A 4OKEA 3LM9A 3KJVA 3CFOA 1NOZA 3O1BA 1CXUA 4JNEA 1D4XA 2GBZA 4EIAA 2Z1IA 4DR6K 3MWTA 1K73O 5AQTA 1NJZA 3W0LA 3BF3A 4DV1K 5AQZA 1WUAA 4JI2K 3G6EN 4JI4K 4IXCA 1LAWA 4GKJK 3SV4A 1L3VA 1TAUA 2VQFK 2DY4A 1HNVA 3H3NO 1QQNA 3AVJA 3CJAA 4M3UA 1NU0A 3MCPA 4O0JA 2IC3A 3HP9A 3S3MA 1JL2A 1M90O 2GWJA 1N36K 2DFFA 4BR0A 5AQQA 2P5GA 4C8MA 4RG8A 4ISGA 3K5OA 3QMLA 3OS2A 4YOUA 1NMNA 2Z1JA 4BGBA 3L6QA 3SAGA 4LY7A 4H5NA 3V4IA 1RILA 5C15A 4F3OA 4Z4CA 3J7YP 4AM7A 4BC5A 3PSFA 1ATSA 4W5TA 2E8AA 1WB9A 4CGJA 3VQCA 3T1AA 1RBUA 2UYTA 4PUOA 2ZQBA 3ZLJA 5JS2A 1RDCA 4K8ZA 5AJ3K 1NGEA 4KBOA 4FYDA 1BIZA 2E20A 1BDGA 1RBSA 1QHTA 1S6PA 1WOQA 3AA2A 2QW9A 5EOYA 4CBWA 2ZJRL 3OA9A 3VQQA 2G8VA 3UKRB 4A57A 3NF6A 3KK7A 2YNIA 4CJUA 4NLCA 3OYFA 5AQUA 1LW2A 2NNWA 1RDUA 4N41A 1ZBLA 1J54A 3CI5A 4FO0A 3WNFA 3V81A 5I9EB 3G71N 4CERA 3VEZA 3TABA 4YDUA 4FK4A 3V9SA 1WAJA 1NM1A 4GMJB 1QE1A 4WE1A 3IFRA 3UKRA 4DSKA 4DSJA 3PSIA 2V7YA 5EY4A 1IJJA 1DTQA 2VWJA 3VESA 4BRNA 4JYAK 1FKPA 4DTSA 4MLEA 3ITHA 1V4SA 1S9GA 4DQRA 1OH6A 1BA1A 3TAMA 3NBPA 3WQTA 3SUQA 1N32K 4CK2A 3WUHA 4F4KA 4FM1A 4CZEA 3CCJN 4ELTA 4DR5K 2Q2RA 1KVCA 2X74A 4MLHA 3E9OA 2XRIA 3KK3A 4HUEA 4CHOA 3RRHA 3FZHA 5AR0A 3O08A 1T8EA 1LAVA 2E2PA 3CG7A 2BE2A 3DXMB 1D8YA 1V4TA 1HNZK 5DM6L 4NO7A 4E1MA 1VSLA 3WNEA 4E0DA 4CF8A 4H0XB 1X9MA 2E2QA 3M1FA 1SV5A 1KAXA 3HO1A 4M3XA 1YVNA 4CK3A 4DKWA 1QS4A 1C0GA 3CPWM 4CD3A 4RW7A 2GTDA 1TV6A 2E5LK 3RMDA 3DXMA 4ISFA 3HPOA 1KVAA 3B6PA 4DTMA 3RVCA 1VQPN 3TAEA 2QEXN 1GLLO 2HNZA 3GL1A 1WSEA 4B9TA 2FXUA 4DTUA 3IMXA 2Z1HA 2EWSA 1GLEG 3HP6A 2PYJA 3P5JA 1YVUA 3CC7N 3EKSA 4FJ5A 4FLVA 3DLRA 2VYPA 4LD0A 4PA1A 4DFMA 1C0FA 2D0CA 4PHTX 1RT3A 3TAQA 3KWIA 4X66K 3HTVA 2HB5A 4X62K 1NBWA 3F2KA 3D2FB 4R79A 1RBRA 5HRRA 3C94A 3LL3A 3OYDA 4KH6A 5C10A 3DLHA 3VQ4A 4JKAA 1ZBSA 4A61A 4YOVA 1EX4A 1SKSA 2HHTA 3ENBA 4WYBA 3NGYA 3VQ6A 3A5LC 4BC2A 1NKBA 3KLIA 2E2OA 3EZ5A 2P9LB 4Z0UA 4BRDA 4DSEA 5SWMA 4Z4IA 4JKEA 3AGRA 3MN9A 4WQ4A 1VQ4N 3K59A 1N5YA 4YORA 4FJ9A 3CD6N 1QVFM 3M8QA 1YIJN 1QZ5A 3D2FA 3MK6A 1Q8IA 1KC8O 3VGMA 4DFPA 4FM0A 2F4VK 2CGKA 1TYQB 1QSYA 3MXJA 4BR5A 1XHZA 3RWUA 1Q9XA 1IO2A 4DSLA 4H5TA 4B8CA 3LDSA 2P9PB 2QWOA 4B9MA 2P9LA
chains in the Genus database with same CATH topology
1RDDA 1TKDA 4OGEA 3PUFA 2XY6A 4EP4A 1YT3A 3SZ2A 3NAEA 2YKNA 4I9LA 5CY4A 1T03A 3O4NA 4KFBA 1NKCA 3PX4A 3LP1A 3NF7A 1JL1A 4E19A 2AJQA 1I39A 4KO0A 1RCHA 2OPPA 3O3GA 4FZXC 1TVRA 3QEXA 4CESA 2LSNA 1XC9A 5FDLA 3AVFA 4ZTJA 4FJNA 2X6NA 1HJRA 2EX3A 4FLTA 1B9FA 1SKWA 4CEDA 3THVA 4CEAA 3K2PA 1C1BA 2BANA 3WNGA 4CF9A 3S3OA 3AVLA 1CXQA 3VQ7A 3DM2A 1IKYA 1BIUA 4Q5VA 4DS5A 1C0UA 4I7FA 2G8WA 3KKRA 4DFJA 1JLBA 2X6SA 3TARA 1BCMA 5D3GA 4FJXA 2IS3A 2Z1GA 3LWMA 1LWCA 3DOLA 4OVLA 2HVIA 4AH9A 3OYGA 3QEPA 5J2QA 1RT6A 1WN7A 2PYLA 1WAFA 5HRPA 4ELUA 3D45A 3QIOA 4FCYA 3ZT4A 3AVGA 4W5OA 3F9KA 4CEEA 3B6OA 1ITGA 4O0IA 3NHGA 2Q3SA 4H8KA 4CEOA 1VSJA 3L2RA 4DTOA 4FJGA 1UAXA 3HL8A 3IRXA 1REVA 3WNHA 1KCFA 4B08A 4HUFA 2OPQA 3AA4A 1K6YA 3V1QA 4CGFA 1ASVA 1X9SA 3VQ9A 1U48A 1ZBHA 4Z4GA 1RT4A 4RW8A 2JLEA 4R5PA 3KD1E 4FZZA 2RF2A 1HPZA 2E6MA 2WOMA 3ZSOA 3OYJA 1RDAA 3K57A 4E7JA 4QCLA 5KGXA 1XHXA 5HRSA 4FW2A 1JLQA 1LWEA 1RT5A 3LPUA 2OPSA 4Z4HA 3KK1A 4DTXA 2BGGA 2EHGA 3QO9A 2E4LA 4I9QA 4BE2A 3CM5A 1JKHA 3V9ZA 3NF9A 2O4IA 2KQ2A 2HHVA 3RMBA 1TK0A 2QK9A 4FLXA 3LAKA 3MEDA 3NF8A 2KTQA 4FLZA 1NK9A 3LANA 2GV9A 1VRUA 1VSKA 4B9NA 2OPRA 3DRRA 3HXMA 2VWKA 2B6AA 4ID1A 3KK2A 5CZ2A 1VSDA 3G10A 3SUPA 4M3YA 1RT7A 3DI6A 3HPHA 1HRHA 4CF1A 2R7YA 1JXEA 4NCBA 1TKZA 4RW4A 1RTDA 3DYAA 3HK2A 3ZSYA 1LW0A 3DOKA 1D9DA 4F2RA 3OYKA 1BQNA 1RBTA 4HTUA 3MXIA 4CJ4A 3V1RA 3HPGA 1TAQA 4E89A 4N56A 4H4MA 1JLEA 1I3AA 1XWLA 4I2PA 4CIFA 1CZBA 3NDKA 3SYZA 3K5MA 3NH0A 1EKEA 4DG1A 4HVJA 4B9LA 1RDBA 3OYCA 1CLQA 1S1UA 1QSLA 4XIUA 4W5NA 3HVTA 4CJKA 3AO1A 3CQ8A 3QETA 4KI4A 2QKKA 1S6QA 2YNHA 1C0MA 1DLOA 4CHZA 4CIEA 4CEFA 3QEVA 4DWIA 3F73A 5T7BA 4KAZA 4J2EA 4AHCA 4M3ZA 4J2AA 3AVIA 4FLWA 2Y1JA 4M45A 1U47A 3IS9A 5E41A 2DTUA 3ZSWA 2QXFA 4LH5A 1S1WA 3ZT2A 3T3FA 1KSPA 3HVRA 1VK0A 1QQCA 1B9DA 4I2QA 1WSIA 2XO7A 3LAMA 4E7HA 3OYHA 2NUBA 1HMVA 5DK5A 4DQSA 4KB0A 1C6VA 3ISNC 4FW1A 5CYQA 3I0RA 4Z4FA 2HHXA 4O4GA 1UWBA 2G8FA 4KRFA 3KLGA 3ULDA 3CYMA 3OYNA 4KI6A 4C8NA 2ZD1A 4KTZA 4CIGA 4PY5A 3QEIA 2G8KA 2I5JA 4C8OA 3SQ2A 4DTRA 4CJWA 3SUOA 1KRPA 3MEGA 1TKTA 3V9WA 3V9XA 4CFBA 2D0BA 4CFCA 3SUNA 3IAYA 4J2DA 3L3VA 1WLJA 2OA8A 5KRSA 3KLEA 4N5SA 4CHPA 5C25A 4KHQA 4F3TA 1TK5A 3HSTB 1ZBIA 2P1JA 4Z4EA 4G1QA 3KLFA 3K5NA 3QNOA 1VSFA 4CFDA 3SPYA 4BDYA 3DLEA 5EU7A 4N47A 3L2WA 3AVKA 4RW6A 4CHNA 3VQAA 4O44A 2KFZA 4LH4A 4TSXA 1BHLA 3KTQA 3PX6A 2DFEA 1FK9A 2ETJA 4Y1CA 3K58A 4YNQA 5KI6A 2PY5A 2FBXA 3O3HA 3SI6A 3SQ0A 2D0AA 4KTQA 1LWFA 1C0TA 1N6QA 4DU3A 3AVAA 3ALYA 1L3TA 3EY1A 4M41A 3U6FA 4CGHA 1SL1A 3ZSRA 4E1NA 2OZSA 1HYZA 2YHBA 4JS4A 4BACA 3NGIA 3AO3A 3TWHA 3RR7A 3O4QA 3H08A 4OKEA 1S5JA 3LP0A 4CEBA 3RMCA 2ATQA 3KJVA 3NCIA 3CFOA 4CFAA 1NOZA 5KTQA 1CXUA 2G8UA 2GBZA 1X9WA 1KFSA 3ZT3A 1WSHA 3C6UA 1ZYQA 2Z1IA 2Y1IA 4O55A 4FK0A 3NH2A 4KHSA 2YKMA 5FRMA 1NJZA 4JLHA 4B9VA 4M42A 4NCGA 3C6TA 1JLCA 3L3UA 3ZSZA 1RBVA 1VSEA 4GVMA 4CHQA 4PWDA 3TR8A 1LAWA 1SUQA 3DLGA 3PV8A 1RNHA 4BDPA 2FBVA 3SV4A 4Y1DA 1L3VA 1TAUA 4F2SA 2DY4A 3TI0A 1HNVA 3AVJA 1RT1A 1NJXA 4M3UA 4OKJA 4O0JA 1L3SA 2IC3A 1A5VA 3HP9A 3S3MA 4ZTFA 1JL2A 4CJFA 3M8SA 3BDPA 1KVBA 4IDKA 2DFFA 1QSSA 4CJ3A 2KZMA 3MEEA 1D9FA 1ASWA 1XI1A 1JLGA 3AO5A 2P5GA 4C8MA 4RG8A 2FC0A 3K5OA 4CGDA 1HQUA 1YTAA 2FBTA 2ITGA 2X78A 3OS2A 3EYZA 2Z1JA 3V1OA 4KB1A 4DLEA 1TL1A 3U3YA 1F21A 4LY7A 4CJVA 3V4IA 5HLFA 1L3UA 1RILA 4CK1A 4F3OA 4Z4CA 1R0AA 3TAGA 3T19A 5J1EA 1S1TA 1WSFA 2P5OA 4OKKA 4W5TA 3OYMA 4JS5A 1ZBUA 3PY8A 3L8BA 3D0PA 3QLHA 3NFAA 4CGJA 3T1AA 1RBUA 3VQCA 1BQMA 4PUOA 4M3WA 2ZQBA 5JS2A 1RDCA 4DU4A 1IKXA 3HM9A 4K8ZA 1YTUA 2XHBA 1BIZA 4FYDA 5FRNA 2PZSA 4FJJA 1RBSA 1QHTA 1S6PA 2IOCA 3AA2A 4OGCA 4KTWA 1SKRA 1S9EA 3I0SA 5J2NA 1U4BA 4GW6A 5CYMA 3KLHA 4DF4A 4YFUA 3TANA 3AVCA 4ELVA 3VQQA 1GOAA 4IKFA 4NYNA 3OS1A 2G8VA 4FK2A 2QKBA 3MECA 4DQPA 3NF6A 4CJUA 2YNIA 4IFVA 4JRQA 2W42A 3KKSA 3P83D 3VQDA 1UA0A 2E6LA 3OYFA 4C8LA 1LW2A 1IH7A 4FLYA 4N41A 1NK5A 1L5UA 1U04A 3P1GA 1IKVA 1ZBLA 1EP4A 1J54A 3S9HA 4CJLA 3WNFA 3V81A 4CE9A 4ICLA 3PO4A 1VSHA 4IG3A 2KW4A 3OYAA 1JLFA 4CERA 3JSMA 1KLNA 4DSIA 4PQUA 2G8IA 3TABA 4DU1A 4FK4A 1RTHA 3V9SA 5J2MA 3JYTA 1WAJA 1VSIA 4FLUA 3AVNA 4GMJB 5J2PA 4QAGA 3L2QA 2HVHA 4HHTA 1QE1A 3QIPA 4WE1A 2VG5A 3KD5E 2RKIA 4AHVA 1KLMA 3HT3A 3LZJA 3SJJA 3SPZA 4DSKA 4E7KA 4FJHA 1T05A 3VQPA 4ZHRA 4DSJA 1VSMA 4AHTA 1DTQA 4CHYA 4M3TA 2VWJA 1GOBA 4Q0BA 1TL3A 2IGIA 1FKPA 4BWJA 4BE1A 3SV3A 4E7LA 1W0HA 4DTSA 1NK8A 2BDPA 3ZT0A 3ITHA 4NYFA 2KZZA 3BGRA 3VN5A 4C8KA 1SL2A 2YNFA 4JRPA 1S9GA 3DRSA 4DQRA 4EP5A 1TGOA 3O3FA 5I42A 2YNGA 1A5XA 1CZ9A 3SQ4A 3QERA 3LZIA 4UQGA 3TAMA 4OLBA 3NBPA 4EZ6A 4K8XA 3L2VA 1HYSA 4IG0A 3SUQA 3LP3A 1HQEA 2ZE2A 2HNYA 4CK2A 2IDOA 2A1SA 4H4OA 1MU2A 1NOYA 1QTMA 1BGXT 4F4KA 4MQ3A 4FM1A 4E3SA 4ELTA 1C1CA 3VQ5A 2HW3A 2XY8A 4DQIA 1KVCA 3LALA 1X1PA 2X74A 3QNNA 4CJEA 2XRIA 3KK3A 1NK6A 4HUEA 4CHOA 3RRHA 5HROA 1LV5A 4L8RB 2KFNA 1T8EA 2HHSA 1LAVA 1IKWA 3DLKA 3CG7A 3LPTA 3KIOA 3OJUA 3M8RA 3PX0A 2IAJA 2BE2A 3ZSXA 1D8YA 2HMIA 3RR8A 1WSGA 1KTQA 4DLGA 4CJPA 1VSLA 4E1MA 4AHRA 3WNEA 3IG1A 4CCHA 4J2BA 1GOCA 4FJIA 4CECA 4B8AB 4E0DA 3ZT1A 4CF8A 1U45A 1X9MA 3AVHA 4IBNA 3NH1A 1SV5A 3MXMA 2A1RA 3OS0A 3HO1A 4M3XA 1KFDA 3QESA 2FBYA 3TAFA 4CK3A 4DFKA 5K14A 1D5AA 1QS4A 3AO2A 4DS4A 5HRNA 3E01A 5CZ1A 1WSJA 4OPKA 4KHNA 1NK4A 3VQ8A 2WONA 4RW9A 2YHAA 4HCCA 3CM6A 2XY5A 1EETA 5HP1A 1S1XA 3FFIA 1G15A 3VA0A 4RW7A 4KHYA 4EZ9A 4IFYA 1TV6A 4CEQA 1UA1A 4LSLA 4DTNA 4E7IA 3RMDA 3HYFA 3HPOA 2DFHA 4KKOA 4BWMA 1KVAA 3B6PA 2HHWA 3RTVA 4DTMA 1ZBFA 1NKEA 5DMRA 5JS1A 1RTJA 3LP2A 4OJRA 3TAEA 4FJMA 2HNZA 2B5JA 3SQ1A 3G0ZA 3AVMA 1WSEA 4B9TA 3OY9A 3VQEA 4M3RA 3SNNA 4DTUA 2VG6A 4CF2A 3AV9A 3ZSQA 1BI4B 4AHUA 3NGZA 1UOCA 2Z1HA 3NE6A 4AILC 3AVBA 3S3NA 3HP6A 2PYJA 3AA3A 3CFPA 1ASUA 3P5JA 2HHQA 1YVUA 3MAQA 3ZSVA 3RRGA 3UIQA 3AA5X 3VQBA 4OLAA 4CJ5A 3OYLA 4FJ5A 1J53A 2RPIA 4FLVA 3DLRA 2O4GA 1FXXA 4LD0A 3L2UA 2B4JA 4PA1A 4CGGA 5C24A 1J5OA 4DFMA 4KREA 1C1AA 1EXQA 4CEZA 1Z26A 2HNDA 3ASMA 3I8DA 4LSNA 4HUGA 2P51A 3C95A 1Y97A 2D0CA 4CJRA 1RT3A 1Z25A 4CJQA 4W5QA 3PO5A 3TAQA 4KHUA 4B9UA 2HB5A 5HBMA 5C42A 1NJYA 1NJWA 4HCBA 1DTTA 1JXBA 3DLBA 4FJ7A 1RBRA 1RTIA 5HRRA 4BDZA 3OYIA 3C94A 4O5BA 3SCXA 1BL3A 1J9AA 3TAPA 1BI4A 4F8RA 2YV0X 3OYDA 4DTJA 3M8PA 1RT2A 1W9HA 3OJSA 3DLHA 4B9SA 2GUIA 3VQ4A 4OPJA 3VA3A 2D5RA 3QEWA 4FJ8A 1EX4A 3CFRA 1S1VA 1SKSA 2HHTA 3NGYA 3A2FA 4FVMA 3VQ6A 2F8TA 1FKOA 3DMJA 1NK7A 4W5RA 5SZTA 1NKBA 2F8SA 2VG7A 3KLIA 1IG9A 5KGWA 4MFBA 4KV8A 3EZ5A 4FXDA 4Z0UA 3V6DA 5KRTA 1Q9YA 1BISA 4DTPA 4N76A 3LWLA 5SWMA 3K5LA 2F96A 4DSEA 4Z4IA 4AHSA 1SL0A 2HHUA 3AO4A 1VRTA 2G8HA 3K59A 3DRPA 1N5YA 3QINA 4FJ9A 2RN2A 3M8QA 1TKXA 1NK0A 1U49A 3RMAA 2JGUA 2OYQA 1TK8A 1B92A 1Q8IA 3OYBA 4FZYA 3HJFA 4CGIA 3OVNA 2XY7A 4FJKA 4B3OA 4CJSA 1HNIA 4DFPA 4FM0A 3V9UA 4DF8A 4CJTA 4DSFA 3U3GA 5I3UA 1QSYA 1WNSA 3MXJA 1XHZA 1A5WA 3RWUA 4DMNA 1T7PA 4KPYA 4DQQA 1IO2A 1Q9XA 4DSLA 4FM2A 4NCAA 5FROA 4KHWA 4FJLA 4ID5A 4B8CA 3LDSA 1O1WA 3ZCMA 3OYEA 4CF0A 2OZMA 1HYVA 1JLAA 4B9MA 4BE0A 1BCOA 4QOZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDD A;  1TKD A;  4OGE A;  3PUF A;  2XY6 A;  4EP4 A;  1YT3 A;  3SZ2 A;  3NAE A;  2YKN A;  4I9L A;  5CY4 A;  1T03 A;  3O4N A;  4KFB A;  1NKC A;  3PX4 A;  3LP1 A;  3NF7 A;  1JL1 A;  4E19 A;  2AJQ A;  1I39 A;  4KO0 A;  1RCH A;  2OPP A;  3O3G A;  4FZX C;  1TVR A;  3QEX A;  4CES A;  2LSN A;  1XC9 A;  5FDL A;  3AVF A;  4ZTJ A;  4FJN A;  2X6N A;  1HJR A;  2EX3 A;  4FLT A;  1B9F A;  1SKW A;  4CED A;  3THV A;  4CEA A;  3K2P A;  1C1B A;  2BAN A;  3WNG A;  4CF9 A;  3S3O A;  3AVL A;  1CXQ A;  3VQ7 A;  3DM2 A;  1IKY A;  1BIU A;  4Q5V A;  4DS5 A;  1C0U A;  4I7F A;  2G8W A;  3KKR A;  4DFJ A;  1JLB A;  2X6S A;  3TAR A;  1BCM A;  5D3G A;  4FJX A;  2IS3 A;  2Z1G A;  3LWM A;  1LWC A;  3DOL A;  4OVL A;  2HVI A;  4AH9 A;  3OYG A;  3QEP A;  5J2Q A;  1RT6 A;  1WN7 A;  2PYL A;  1WAF A;  5HRP A;  4ELU A;  3D45 A;  3QIO A;  4FCY A;  3ZT4 A;  3AVG A;  4W5O A;  3F9K A;  4CEE A;  3B6O A;  1ITG A;  4O0I A;  3NHG A;  2Q3S A;  4H8K A;  4CEO A;  1VSJ A;  3L2R A;  4DTO A;  4FJG A;  1UAX A;  3HL8 A;  3IRX A;  1REV A;  3WNH A;  1KCF A;  4B08 A;  4HUF A;  2OPQ A;  3AA4 A;  1K6Y A;  3V1Q A;  4CGF A;  1ASV A;  1X9S A;  3VQ9 A;  1U48 A;  1ZBH A;  4Z4G A;  1RT4 A;  4RW8 A;  2JLE A;  4R5P A;  3KD1 E;  4FZZ A;  2RF2 A;  1HPZ A;  2E6M A;  2WOM A;  3ZSO A;  3OYJ A;  1RDA A;  3K57 A;  4E7J A;  4QCL A;  5KGX A;  1XHX A;  5HRS A;  4FW2 A;  1JLQ A;  1LWE A;  1RT5 A;  3LPU A;  2OPS A;  4Z4H A;  3KK1 A;  4DTX A;  2BGG A;  2EHG A;  3QO9 A;  2E4L A;  4I9Q A;  4BE2 A;  3CM5 A;  1JKH A;  3V9Z A;  3NF9 A;  2O4I A;  2KQ2 A;  2HHV A;  3RMB A;  1TK0 A;  2QK9 A;  4FLX A;  3LAK A;  3MED A;  3NF8 A;  2KTQ A;  4FLZ A;  1NK9 A;  3LAN A;  2GV9 A;  1VRU A;  1VSK A;  4B9N A;  2OPR A;  3DRR A;  3HXM A;  2VWK A;  2B6A A;  4ID1 A;  3KK2 A;  5CZ2 A;  1VSD A;  3G10 A;  3SUP A;  4M3Y A;  1RT7 A;  3DI6 A;  3HPH A;  1HRH A;  4CF1 A;  2R7Y A;  1JXE A;  4NCB A;  1TKZ A;  4RW4 A;  1RTD A;  3DYA A;  3HK2 A;  3ZSY A;  1LW0 A;  3DOK A;  1D9D A;  4F2R A;  3OYK A;  1BQN A;  1RBT A;  4HTU A;  3MXI A;  4CJ4 A;  3V1R A;  3HPG A;  1TAQ A;  4E89 A;  4N56 A;  4H4M A;  1JLE A;  1I3A A;  1XWL A;  4I2P A;  4CIF A;  1CZB A;  3NDK A;  3SYZ A;  3K5M A;  3NH0 A;  1EKE A;  4DG1 A;  4HVJ A;  4B9L A;  1RDB A;  3OYC A;  1CLQ A;  1S1U A;  1QSL A;  4XIU A;  4W5N A;  3HVT A;  4CJK A;  3AO1 A;  3CQ8 A;  3QET A;  4KI4 A;  2QKK A;  1S6Q A;  2YNH A;  1C0M A;  1DLO A;  4CHZ A;  4CIE A;  4CEF A;  3QEV A;  4DWI A;  3F73 A;  5T7B A;  4KAZ A;  4J2E A;  4AHC A;  4M3Z A;  4J2A A;  3AVI A;  4FLW A;  2Y1J A;  4M45 A;  1U47 A;  3IS9 A;  5E41 A;  2DTU A;  3ZSW A;  2QXF A;  4LH5 A;  1S1W A;  3ZT2 A;  3T3F A;  1KSP A;  3HVR A;  1VK0 A;  1QQC A;  1B9D A;  4I2Q A;  1WSI A;  2XO7 A;  3LAM A;  4E7H A;  3OYH A;  2NUB A;  1HMV A;  5DK5 A;  4DQS A;  4KB0 A;  1C6V A;  3ISN C;  4FW1 A;  5CYQ A;  3I0R A;  4Z4F A;  2HHX A;  4O4G A;  1UWB A;  2G8F A;  4KRF A;  3KLG A;  3ULD A;  3CYM A;  3OYN A;  4KI6 A;  4C8N A;  2ZD1 A;  4KTZ A;  4CIG A;  4PY5 A;  3QEI A;  2G8K A;  2I5J A;  4C8O A;  3SQ2 A;  4DTR A;  4CJW A;  3SUO A;  1KRP A;  3MEG A;  1TKT A;  3V9W A;  3V9X A;  4CFB A;  2D0B A;  4CFC A;  3SUN A;  3IAY A;  4J2D A;  3L3V A;  1WLJ A;  2OA8 A;  5KRS A;  3KLE A;  4N5S A;  4CHP A;  5C25 A;  4KHQ A;  4F3T A;  1TK5 A;  3HST B;  1ZBI A;  2P1J A;  4Z4E A;  4G1Q A;  3KLF A;  3K5N A;  3QNO A;  1VSF A;  4CFD A;  3SPY A;  4BDY A;  3DLE A;  5EU7 A;  4N47 A;  3L2W A;  3AVK A;  4RW6 A;  4CHN A;  3VQA A;  4O44 A;  2KFZ A;  4LH4 A;  4TSX A;  1BHL A;  3KTQ A;  3PX6 A;  2DFE A;  1FK9 A;  2ETJ A;  4Y1C A;  3K58 A;  4YNQ A;  5KI6 A;  2PY5 A;  2FBX A;  3O3H A;  3SI6 A;  3SQ0 A;  2D0A A;  4KTQ A;  1LWF A;  1C0T A;  1N6Q A;  4DU3 A;  3AVA A;  3ALY A;  1L3T A;  3EY1 A;  4M41 A;  3U6F A;  4CGH A;  1SL1 A;  3ZSR A;  4E1N A;  2OZS A;  1HYZ A;  2YHB A;  4JS4 A;  4BAC A;  3NGI A;  3AO3 A;  3TWH A;  3RR7 A;  3O4Q A;  3H08 A;  4OKE A;  1S5J A;  3LP0 A;  4CEB A;  3RMC A;  2ATQ A;  3KJV A;  3NCI A;  3CFO A;  4CFA A;  1NOZ A;  5KTQ A;  1CXU A;  2G8U A;  2GBZ A;  1X9W A;  1KFS A;  3ZT3 A;  1WSH A;  3C6U A;  1ZYQ A;  2Z1I A;  2Y1I A;  4O55 A;  4FK0 A;  3NH2 A;  4KHS A;  2YKM A;  5FRM A;  1NJZ A;  4JLH A;  4B9V A;  4M42 A;  4NCG A;  3C6T A;  1JLC A;  3L3U A;  3ZSZ A;  1RBV A;  1VSE A;  4GVM A;  4CHQ A;  4PWD A;  3TR8 A;  1LAW A;  1SUQ A;  3DLG A;  3PV8 A;  1RNH A;  4BDP A;  2FBV A;  3SV4 A;  4Y1D A;  1L3V A;  1TAU A;  4F2S A;  2DY4 A;  3TI0 A;  1HNV A;  3AVJ A;  1RT1 A;  1NJX A;  4M3U A;  4OKJ A;  4O0J A;  1L3S A;  2IC3 A;  1A5V A;  3HP9 A;  3S3M A;  4ZTF A;  1JL2 A;  4CJF A;  3M8S A;  3BDP A;  1KVB A;  4IDK A;  2DFF A;  1QSS A;  4CJ3 A;  2KZM A;  3MEE A;  1D9F A;  1ASW A;  1XI1 A;  1JLG A;  3AO5 A;  2P5G A;  4C8M A;  4RG8 A;  2FC0 A;  3K5O A;  4CGD A;  1HQU A;  1YTA A;  2FBT A;  2ITG A;  2X78 A;  3OS2 A;  3EYZ A;  2Z1J A;  3V1O A;  4KB1 A;  4DLE A;  1TL1 A;  3U3Y A;  1F21 A;  4LY7 A;  4CJV A;  3V4I A;  5HLF A;  1L3U A;  1RIL A;  4CK1 A;  4F3O A;  4Z4C A;  1R0A A;  3TAG A;  3T19 A;  5J1E A;  1S1T A;  1WSF A;  2P5O A;  4OKK A;  4W5T A;  3OYM A;  4JS5 A;  1ZBU A;  3PY8 A;  3L8B A;  3D0P A;  3QLH A;  3NFA A;  4CGJ A;  3T1A A;  1RBU A;  3VQC A;  1BQM A;  4PUO A;  4M3W A;  2ZQB A;  5JS2 A;  1RDC A;  4DU4 A;  1IKX A;  3HM9 A;  4K8Z A;  1YTU A;  2XHB A;  1BIZ A;  4FYD A;  5FRN A;  2PZS A;  4FJJ A;  1RBS A;  1QHT A;  1S6P A;  2IOC A;  3AA2 A;  4OGC A;  4KTW A;  1SKR A;  1S9E A;  3I0S A;  5J2N A;  1U4B A;  4GW6 A;  5CYM A;  3KLH A;  4DF4 A;  4YFU A;  3TAN A;  3AVC A;  4ELV A;  3VQQ A;  1GOA A;  4IKF A;  4NYN A;  3OS1 A;  2G8V A;  4FK2 A;  2QKB A;  3MEC A;  4DQP A;  3NF6 A;  4CJU A;  2YNI A;  4IFV A;  4JRQ A;  2W42 A;  3KKS A;  3P83 D;  3VQD A;  1UA0 A;  2E6L A;  3OYF A;  4C8L A;  1LW2 A;  1IH7 A;  4FLY A;  4N41 A;  1NK5 A;  1L5U A;  1U04 A;  3P1G A;  1IKV A;  1ZBL A;  1EP4 A;  1J54 A;  3S9H A;  4CJL A;  3WNF A;  3V81 A;  4CE9 A;  4ICL A;  3PO4 A;  1VSH A;  4IG3 A;  2KW4 A;  3OYA A;  1JLF A;  4CER A;  3JSM A;  1KLN A;  4DSI A;  4PQU A;  2G8I A;  3TAB A;  4DU1 A;  4FK4 A;  1RTH A;  3V9S A;  5J2M A;  3JYT A;  1WAJ A;  1VSI A;  4FLU A;  3AVN A;  4GMJ B;  5J2P A;  4QAG A;  3L2Q A;  2HVH A;  4HHT A;  1QE1 A;  3QIP A;  4WE1 A;  2VG5 A;  3KD5 E;  2RKI A;  4AHV A;  1KLM A;  3HT3 A;  3LZJ A;  3SJJ A;  3SPZ A;  4DSK A;  4E7K A;  4FJH A;  1T05 A;  3VQP A;  4ZHR A;  4DSJ A;  1VSM A;  4AHT A;  1DTQ A;  4CHY A;  4M3T A;  2VWJ A;  1GOB A;  4Q0B A;  1TL3 A;  2IGI A;  1FKP A;  4BWJ A;  4BE1 A;  3SV3 A;  4E7L A;  1W0H A;  4DTS A;  1NK8 A;  2BDP A;  3ZT0 A;  3ITH A;  4NYF A;  2KZZ A;  3BGR A;  3VN5 A;  4C8K A;  1SL2 A;  2YNF A;  4JRP A;  1S9G A;  3DRS A;  4DQR A;  4EP5 A;  1TGO A;  3O3F A;  5I42 A;  2YNG A;  1A5X A;  1CZ9 A;  3SQ4 A;  3QER A;  3LZI A;  4UQG A;  3TAM A;  4OLB A;  3NBP A;  4EZ6 A;  4K8X A;  3L2V A;  1HYS A;  4IG0 A;  3SUQ A;  3LP3 A;  1HQE A;  2ZE2 A;  2HNY A;  4CK2 A;  2IDO A;  2A1S A;  4H4O A;  1MU2 A;  1NOY A;  1QTM A;  1BGX T;  4F4K A;  4MQ3 A;  4FM1 A;  4E3S A;  4ELT A;  1C1C A;  3VQ5 A;  2HW3 A;  2XY8 A;  4DQI A;  1KVC A;  3LAL A;  1X1P A;  2X74 A;  3QNN A;  4CJE A;  2XRI A;  3KK3 A;  1NK6 A;  4HUE A;  4CHO A;  3RRH A;  5HRO A;  1LV5 A;  4L8R B;  2KFN A;  1T8E A;  2HHS A;  1LAV A;  1IKW A;  3DLK A;  3CG7 A;  3LPT A;  3KIO A;  3OJU A;  3M8R A;  3PX0 A;  2IAJ A;  2BE2 A;  3ZSX A;  1D8Y A;  2HMI A;  3RR8 A;  1WSG A;  1KTQ A;  4DLG A;  4CJP A;  1VSL A;  4E1M A;  4AHR A;  3WNE A;  3IG1 A;  4CCH A;  4J2B A;  1GOC A;  4FJI A;  4CEC A;  4B8A B;  4E0D A;  3ZT1 A;  4CF8 A;  1U45 A;  1X9M A;  3AVH A;  4IBN A;  3NH1 A;  1SV5 A;  3MXM A;  2A1R A;  3OS0 A;  3HO1 A;  4M3X A;  1KFD A;  3QES A;  2FBY A;  3TAF A;  4CK3 A;  4DFK A;  5K14 A;  1D5A A;  1QS4 A;  3AO2 A;  4DS4 A;  5HRN A;  3E01 A;  5CZ1 A;  1WSJ A;  4OPK A;  4KHN A;  1NK4 A;  3VQ8 A;  2WON A;  4RW9 A;  2YHA A;  4HCC A;  3CM6 A;  2XY5 A;  1EET A;  5HP1 A;  1S1X A;  3FFI A;  1G15 A;  3VA0 A;  4RW7 A;  4KHY A;  4EZ9 A;  4IFY A;  1TV6 A;  4CEQ A;  1UA1 A;  4LSL A;  4DTN A;  4E7I A;  3RMD A;  3HYF A;  3HPO A;  2DFH A;  4KKO A;  4BWM A;  1KVA A;  3B6P A;  2HHW A;  3RTV A;  4DTM A;  1ZBF A;  1NKE A;  5DMR A;  5JS1 A;  1RTJ A;  3LP2 A;  4OJR A;  3TAE A;  4FJM A;  2HNZ A;  2B5J A;  3SQ1 A;  3G0Z A;  3AVM A;  1WSE A;  4B9T A;  3OY9 A;  3VQE A;  4M3R A;  3SNN A;  4DTU A;  2VG6 A;  4CF2 A;  3AV9 A;  3ZSQ A;  1BI4 B;  4AHU A;  3NGZ A;  1UOC A;  2Z1H A;  3NE6 A;  4AIL C;  3AVB A;  3S3N A;  3HP6 A;  2PYJ A;  3AA3 A;  3CFP A;  1ASU A;  3P5J A;  2HHQ A;  1YVU A;  3MAQ A;  3ZSV A;  3RRG A;  3UIQ A;  3AA5 X;  3VQB A;  4OLA A;  4CJ5 A;  3OYL A;  4FJ5 A;  1J53 A;  2RPI A;  4FLV A;  3DLR A;  2O4G A;  1FXX A;  4LD0 A;  3L2U A;  2B4J A;  4PA1 A;  4CGG A;  5C24 A;  1J5O A;  4DFM A;  4KRE A;  1C1A A;  1EXQ A;  4CEZ A;  1Z26 A;  2HND A;  3ASM A;  3I8D A;  4LSN A;  4HUG A;  2P51 A;  3C95 A;  1Y97 A;  2D0C A;  4CJR A;  1RT3 A;  1Z25 A;  4CJQ A;  4W5Q A;  3PO5 A;  3TAQ A;  4KHU A;  4B9U A;  2HB5 A;  5HBM A;  5C42 A;  1NJY A;  1NJW A;  4HCB A;  1DTT A;  1JXB A;  3DLB A;  4FJ7 A;  1RBR A;  1RTI A;  5HRR A;  4BDZ A;  3OYI A;  3C94 A;  4O5B A;  3SCX A;  1BL3 A;  1J9A A;  3TAP A;  1BI4 A;  4F8R A;  2YV0 X;  3OYD A;  4DTJ A;  3M8P A;  1RT2 A;  1W9H A;  3OJS A;  3DLH A;  4B9S A;  2GUI A;  3VQ4 A;  4OPJ A;  3VA3 A;  2D5R A;  3QEW A;  4FJ8 A;  1EX4 A;  3CFR A;  1S1V A;  1SKS A;  2HHT A;  3NGY A;  3A2F A;  4FVM A;  3VQ6 A;  2F8T A;  1FKO A;  3DMJ A;  1NK7 A;  4W5R A;  5SZT A;  1NKB A;  2F8S A;  2VG7 A;  3KLI A;  1IG9 A;  5KGW A;  4MFB A;  4KV8 A;  3EZ5 A;  4FXD A;  4Z0U A;  3V6D A;  5KRT A;  1Q9Y A;  1BIS A;  4DTP A;  4N76 A;  3LWL A;  5SWM A;  3K5L A;  2F96 A;  4DSE A;  4Z4I A;  4AHS A;  1SL0 A;  2HHU A;  3AO4 A;  1VRT A;  2G8H A;  3K59 A;  3DRP A;  1N5Y A;  3QIN A;  4FJ9 A;  2RN2 A;  3M8Q A;  1TKX A;  1NK0 A;  1U49 A;  3RMA A;  2JGU A;  2OYQ A;  1TK8 A;  1B92 A;  1Q8I A;  3OYB A;  4FZY A;  3HJF A;  4CGI A;  3OVN A;  2XY7 A;  4FJK A;  4B3O A;  4CJS A;  1HNI A;  4DFP A;  4FM0 A;  3V9U A;  4DF8 A;  4CJT A;  4DSF A;  3U3G A;  5I3U A;  1QSY A;  1WNS A;  3MXJ A;  1XHZ A;  1A5W A;  3RWU A;  4DMN A;  1T7P A;  4KPY A;  4DQQ A;  1IO2 A;  1Q9X A;  4DSL A;  4FM2 A;  4NCA A;  5FRO A;  4KHW A;  4FJL A;  4ID5 A;  4B8C A;  3LDS A;  1O1W A;  3ZCM A;  3OYE A;  4CF0 A;  2OZM A;  1HYV A;  1JLA A;  4B9M A;  4BE0 A;  1BCO A;  4QOZ B; 
#chains in the Genus database with same CATH topology
 3Q7C A;  1RDD A;  4K25 A;  1K8K B;  4OGE A;  3O9S A;  2XY6 A;  5IWA K;  5CY4 A;  3FLC O;  4C1N I;  4JI5 K;  2E2N A;  4KFB A;  4JEP A;  4BRP A;  3HRG A;  3AVF A;  4ZTJ A;  2EX3 A;  1SKW A;  3THV A;  1C1B A;  2VCP A;  1TYQ A;  3S3O A;  2ZF5 O;  3AVL A;  1GLF O;  1CXQ A;  1RGI A;  2G8W A;  4I7F A;  2HF4 A;  1BCM A;  1FW6 A;  5D3G A;  1LWC A;  1HNW K;  4AH9 A;  3OYG A;  2PYL A;  3GE1 A;  1K8K A;  3GOI A;  4DV5 K;  3CC2 N;  2OTJ N;  4CEE A;  4DTO A;  2BTF A;  3AAQ A;  1KCF A;  5AQM A;  3WT0 A;  2JLE A;  3KD1 E;  5E84 A;  2A5X A;  1RDA A;  2P9U B;  2QXL A;  1LWE A;  4DTX A;  3QO9 A;  4I9Q A;  4BE2 A;  2IVN A;  3CM5 A;  4BR4 A;  4EHU A;  1IBK K;  3NF9 A;  5HOO A;  1TK0 A;  3DJC A;  3LAK A;  4BGA A;  4XH4 A;  4M3Y A;  3BF1 A;  4CZG A;  2YX6 A;  1GLD G;  1Z05 A;  2ZWH A;  4CF1 A;  5TKY A;  1TKZ A;  1JCF A;  3DYA A;  1QZ6 A;  2AA4 A;  2FF6 A;  3N4P A;  4DV0 K;  4O5F A;  3V1R A;  1TAQ A;  3P38 A;  4N56 A;  2P9U A;  3SYZ A;  3QDK A;  4PKH A;  4B9L A;  4FWP A;  1CLQ A;  4XIU A;  4W5N A;  4HWI A;  4CJK A;  3CQ8 A;  3QET A;  2UXC K;  1S6Q A;  2Q1N A;  5BR9 A;  1C0M A;  3WEE B;  3VEV A;  4CEF A;  1NNE A;  5T7B A;  4M45 A;  1VQN N;  4DQ8 A;  1ATN A;  2QXF A;  3FZM A;  3GDQ A;  1WSI A;  4GNI A;  4DQS A;  4FW1 A;  4JKH A;  5CYQ A;  3I0R A;  4O4G A;  4IO8 A;  3SLC A;  2WTU A;  2ZD1 A;  4PY5 A;  4IEI A;  3QEI A;  2I5J A;  4C8O A;  1NMD A;  2E1Z A;  1IV0 A;  4DTR A;  3MEG A;  3J7A P;  3RSE B;  3C6H A;  3IAY A;  3SUN A;  4J2D A;  5ELZ A;  5AQK A;  4N5S A;  3KLE A;  3P31 A;  5C25 A;  1K9M O;  1TK5 A;  4WFN L;  3O4W A;  3H1Q A;  4G1Q A;  3QNO A;  4CFD A;  4WF9 L;  5AFU H;  3T7Z A;  4RW6 A;  1X3N A;  2CH5 A;  3PX6 A;  2P9S B;  2DFE A;  3CCS N;  4Y1C A;  3K58 A;  2NRV A;  2D0A A;  4BRF A;  4IZ9 A;  3ALY A;  1L3T A;  3EY1 A;  1BO5 O;  4CGH A;  2GEL A;  2YHW A;  3HM8 A;  2OZS A;  1HYZ A;  3RSE A;  4M7Y A;  3WXI A;  3NGI A;  3D2E A;  3RR7 A;  1S5J A;  4CEB A;  1N34 K;  5KQ8 A;  2A40 A;  2IVO A;  4ILJ A;  5KTQ A;  2G8U A;  1X9W A;  4DV3 K;  3C6U A;  1ZYQ A;  4O55 A;  4V19 S;  4M42 A;  1NGC A;  2CGJ A;  1OH5 A;  1JLC A;  4B1W B;  1NLV A;  4GVM A;  3ZSZ A;  3J80 O;  3DLG A;  1RNH A;  2FBV A;  4Y1D A;  4FWN A;  3TI0 A;  2VGM A;  1RT1 A;  1L3S A;  3BDP A;  3MWP A;  4CJF A;  4YOY A;  4CJ3 A;  1ASW A;  3VGK A;  4H0T B;  1YTA A;  2FBT A;  3F9M A;  2ITG A;  2X78 A;  3EYZ A;  3TSU A;  4DLE A;  1TL1 A;  4WFA L;  3QFU A;  5J1E A;  3OYM A;  2IIR A;  4L3Q A;  1NGH A;  3D7E O;  3L8B A;  3NFA A;  3VER A;  4M3W A;  4DU4 A;  1Q18 A;  1IKX A;  3HM9 A;  4OX9 K;  3U9Z A;  4EHT A;  2XHB A;  2PZS A;  2KLA A;  4FJJ A;  1XC3 A;  2WBN A;  4OGC A;  5BRE A;  1S9E A;  4JKG B;  3QBW A;  3KLH A;  4DF4 A;  1JCE A;  4YFU A;  3TAN A;  4ELV A;  1LCU A;  4NYN A;  5AQF A;  3OS1 A;  2QKB A;  3LM2 A;  3ID6 A;  4IFV A;  4JRQ A;  2W42 A;  3KKS A;  1QQM A;  4JHD B;  1YUW A;  5H1S Q;  3P1G A;  1W2B M;  1EP4 A;  4CJL A;  4FL9 A;  1SQK A;  4ICL A;  1VSH A;  4Y0W A;  3OYA A;  1JLF A;  3JSM A;  1KLN A;  3DXK B;  4DU1 A;  4BG9 A;  1RTH A;  3A5O C;  1S72 N;  4JKG A;  3AVN A;  1P8Z A;  5J2P A;  1EWR A;  3CHW A;  2P9N B;  2VG5 A;  3H1V X;  3HT3 A;  3K9K A;  3TTD A;  1VSM A;  4AHT A;  4QS9 A;  5AQW A;  2OTL N;  4Q0B A;  5KPZ A;  4BWJ A;  3SV3 A;  4YOX A;  3ZT0 A;  1NGB A;  4LF6 K;  3P4I A;  2KZZ A;  2YNF A;  2YHY A;  4JRP A;  3DXK A;  4GV6 A;  3DRS A;  3FZK A;  5I42 A;  2GWK A;  3QER A;  3SQ4 A;  1E4F T;  3OW2 M;  1NGI A;  3CJ7 A;  3L2V A;  3LDP A;  1BG3 A;  2HNY A;  5TKW A;  1QVG M;  2A1S A;  3SAH A;  2P9N A;  1ZXO A;  4E3S A;  3VQ5 A;  2O8D B;  4DQI A;  3QNN A;  4DR1 K;  3BUZ B;  3SBG A;  3FE1 A;  2HHS A;  3DLL L;  3DLK A;  1IKW A;  1NK6 A;  2HMI A;  3RR8 A;  4BRH A;  1WSG A;  3MDQ A;  2H3G X;  4DLG A;  4CJP A;  4AHR A;  1GOC A;  3S41 A;  1U45 A;  2O8E A;  5EXW A;  4YY3 K;  4E1J A;  1NWK A;  3NH1 A;  2A1R A;  2WFB A;  2YJE A;  3HOT A;  1KFD A;  4LF5 K;  2FBY A;  4H0Y B;  4DFK A;  2I7P A;  3AO2 A;  3Q7B A;  4DS4 A;  2O8D A;  4IOX A;  2Q31 A;  2PFU A;  2WON A;  4CW7 B;  3BP8 A;  1EET A;  2GEM A;  5HP1 A;  3EL2 A;  1G15 A;  4WQ5 C;  4AQY K;  2O8C B;  1DGK N;  3AAR A;  4KKO A;  4BWM A;  3CME N;  2HHW A;  3RTV A;  3TSP A;  1RTJ A;  4FJM A;  3CQX A;  2ASP A;  3PIP L;  2HOE A;  3CJ9 A;  1RDW X;  1TUU A;  3VQE A;  3SNN A;  3ZSQ A;  3S3N A;  4KI6 A;  5JMV A;  1DT9 A;  3F5T A;  4O8U A;  4BVO A;  4EAH D;  3FZL A;  4JK8 A;  3RRG A;  3AA5 X;  4A2B A;  5ADX H;  4CJ5 A;  2DPN A;  4IJA A;  1J53 A;  5BRD A;  3L2U A;  3CCM N;  4CGG A;  1J5O A;  1C1A A;  4LSN A;  2P51 A;  1Z25 A;  4CJQ A;  3PO5 A;  2F7T A;  1NJY A;  2O8F B;  4BDZ A;  3ATV A;  4MDB A;  3SCX A;  2JWL A;  3R9P A;  5GAG P;  3TAP A;  1FJG K;  1JJ2 M;  2YV0 X;  3M8P A;  1RT2 A;  1W9H A;  4H03 B;  1J5E K;  4BR7 A;  2D5R A;  1GLB G;  4KH5 A;  3I56 N;  3GG4 A;  4FVM A;  2F8T A;  1FKO A;  3DMJ A;  3MN6 A;  4QS7 A;  4W5R A;  2F8S A;  2VG7 A;  3T1H K;  4BRM A;  1IG9 A;  4MFB A;  1TUY A;  4NB4 A;  3V6D A;  1Q9Y A;  4N76 A;  4DTP A;  4A5B A;  1OH8 A;  2D4W A;  1KD1 O;  1XNQ K;  4GY2 B;  2G8H A;  1M1K O;  2QWQ A;  3DRP A;  3ZET B;  3VEN A;  2O8F A;  1NK0 A;  3RMA A;  3DAW A;  2JGU A;  2RE2 A;  3QFP A;  2OYQ A;  2HBM A;  3HJF A;  2HBL A;  4FZY A;  1WBB A;  1YHQ N;  3OVN A;  4B3O A;  4CJS A;  2VWB A;  3V9U A;  4M63 C;  1VQ5 N;  4CJT A;  4WCE L;  1T7P A;  5FRO A;  2KHO A;  2D1K A;  3VEX A;  5BRF A;  4JI7 K;  4EP4 A;  4FPA A;  4IDH A;  1T03 A;  3ZET A;  3PX4 A;  5AZI B;  3EN9 A;  4E19 A;  1K8A O;  1I39 A;  4BRA A;  3O3G A;  1TVR A;  3KZB A;  5FPM A;  1I94 K;  4CED A;  4CEA A;  3K2P A;  4BRQ A;  4FWM A;  1IKY A;  2Q0R A;  4DFJ A;  1JLB A;  4FJX A;  2Z1G A;  4H0P A;  4OVL A;  3DOL A;  5LMU K;  4ELU A;  3ZT4 A;  3NHG A;  3B6O A;  5C2F A;  2UUB K;  1VSJ A;  1Q7Y O;  3L2R A;  2NRT A;  5AZI A;  3HL8 A;  1YIT N;  3IRX A;  3R8E A;  4A2A A;  4B08 A;  3AA4 A;  1X9S A;  4JV5 K;  4B9Q A;  1ZBH A;  1RT4 A;  2P9K B;  3JXU A;  2RF2 A;  2E6M A;  3OYJ A;  4QCL A;  4DR3 K;  5KGX A;  4LFA K;  1Q81 O;  1XHX A;  2OPS A;  1S3X A;  2BGG A;  2EHG A;  2JWK A;  1JKH A;  2P9I B;  5JIC A;  2O4I A;  2QI2 A;  2D0P A;  5LJW A;  5A2Q O;  4B9N A;  1GLJ O;  1VRU A;  3DRR A;  1W7A A;  3EKU A;  2B6A A;  4ID1 A;  4BG8 A;  3C7N B;  1VSD A;  3WXM B;  3DI6 A;  3HPH A;  2R7Y A;  4NCB A;  4RW4 A;  1RTD A;  3ZSY A;  2P9K A;  1LW0 A;  2HST A;  3DOK A;  3MXI A;  1NGF A;  1YAG A;  3HPG A;  5BPN A;  3NDK A;  1XWL A;  1CZB A;  3NH0 A;  4HVJ A;  4DHY A;  3KWG A;  5EX5 A;  4B1X B;  3AO1 A;  2P9I A;  3AGK A;  2YNH A;  4DR4 K;  4DB3 A;  4CIE A;  3LDO A;  4B3R K;  3CCE N;  4OPA A;  3L0Q A;  4DV7 K;  3F73 A;  4J2E A;  5JVG L;  4J2A A;  3AVI A;  3C7N A;  4JI6 K;  5E41 A;  2ZGZ A;  1U47 A;  4JD2 B;  3ENO A;  3E9P A;  5KPT A;  3LAM A;  1J6Z A;  3OYH A;  4Z4F A;  2D0O A;  3N4Q A;  3CCU N;  4KRF A;  2QA4 N;  3KLG A;  3HBT A;  4FVU A;  4C8N A;  2AP1 A;  2IVP A;  4CIG A;  3NMU A;  3SQ2 A;  3OTO K;  4CJW A;  1KRP A;  3V9X A;  4JD2 A;  4PKI A;  4CHP A;  4KHQ A;  4IFE A;  2UXB K;  3A8Y A;  4F9O A;  4NXN K;  3UB5 A;  1RFQ A;  3SPY A;  4BDY A;  5KQD A;  3DLE A;  5EU7 A;  1MWK A;  2ITM A;  3KTQ A;  5M1O A;  2NRR A;  4YNQ A;  4KTQ A;  2NRW A;  1LWF A;  5LY3 A;  1N6Q A;  3E1Y A;  2I7N A;  3LDL A;  2YHB A;  3R6M A;  3TWH A;  2P9P A;  4JN4 A;  5AQY A;  3SK3 A;  4MO4 A;  1XUP O;  1WSH A;  3W3D A;  1U6Z A;  3J8A A;  4FK0 A;  3NH2 A;  4KHS A;  3VPZ A;  4EFH A;  4NCG A;  5BRH A;  3C6T A;  1YJ9 N;  3FFK B;  1RBV A;  3TR8 A;  3PV8 A;  3E9L A;  3P39 A;  4F2S A;  1YI2 N;  1NJX A;  3VF4 A;  3OBY A;  1A5V A;  1R59 O;  3M8S A;  4ISE A;  4IDK A;  2KZM A;  3MEE A;  4FWR A;  1XI1 A;  1JLG A;  3VTH A;  2WC9 A;  4CGD A;  3V1O A;  4KB1 A;  3U3Y A;  1F21 A;  4CJV A;  2ZM6 K;  1Z6R A;  4CK1 A;  3THX B;  1R0A A;  3TAG A;  4K0K K;  1HKB A;  1WSF A;  4LF4 K;  4J8F A;  4JS5 A;  1CZA N;  4JI8 K;  3BY5 A;  3PY8 A;  3D0P A;  1LOT B;  4JK7 A;  3C65 A;  4DV6 K;  4CZL A;  3MCA B;  3J7Z O;  1YTU A;  5JLH A;  1HNX K;  3PLA A;  3ZX2 A;  2A6A A;  1SKR A;  3BZK A;  5J2N A;  1XMO K;  4GW6 A;  5CYM A;  4I6M B;  2QWR A;  3AVC A;  1GOA A;  4B1V A;  2NRX A;  1KQS M;  4JKD A;  3VQD A;  3P83 D;  2E6L A;  2NLX A;  1IH7 A;  3O9T A;  4WQ5 A;  4FLY A;  1NK5 A;  1L5U A;  2W41 A;  1IKV A;  5M1K A;  3S9H A;  3IUC A;  4IG3 A;  4DSI A;  4PQU A;  4CZM A;  3CCV N;  1U2V B;  3JYT A;  5AQL A;  1VSI A;  4FLU A;  1KAY A;  2CH6 A;  4QAG A;  3WEE A;  3D6R A;  4I6M A;  5CE3 A;  5EVZ A;  4BVP A;  4BR2 A;  4AHV A;  1KLM A;  3SJJ A;  4E7K A;  3VQP A;  4JI1 K;  3ULE B;  4H0O A;  4CZK A;  4CHY A;  3EE9 A;  3VF6 A;  3IKM A;  4LC9 B;  2Q0U A;  3EZW A;  4BY9 C;  5CHI A;  1NK8 A;  4BE1 A;  4HCB A;  1W0H A;  2BDP A;  4H5W A;  2FSN A;  2ZGY A;  4NYF A;  3O8M A;  1WBD A;  3VN5 A;  4C8K A;  1TGO A;  3O9Q A;  3KHY A;  1U2V A;  2YNG A;  5AQH A;  5FPE A;  3EEQ A;  3LZI A;  4UQG A;  1HYS A;  4IG0 A;  3LP3 A;  2F9T A;  2ZE2 A;  1NOY A;  3IDH A;  4H4O A;  1QTM A;  1BGX T;  4MQ3 A;  1VQ8 N;  4FWS A;  2HW3 A;  4JKF A;  3ULE A;  1VAZ A;  1X1P A;  4DUZ K;  5HRO A;  4BC3 A;  4FSV A;  3M8R A;  2P5O A;  3OJU A;  3PX0 A;  3ZSX A;  5AQV A;  4M7X A;  2P9S A;  4FJI A;  1T3V A;  4B8A B;  3HOS A;  5IT9 O;  2CGL A;  4ILH A;  1T6D A;  2HF3 A;  3AVH A;  2FLO A;  2F9W A;  3MXM A;  2W40 A;  3OS0 A;  2ZJQ L;  3TAF A;  3HI0 A;  3QES A;  4IOA L;  1D5A A;  3THY B;  4OPK A;  5AFU A;  3VTI A;  4KHN A;  1NK4 A;  3VQ8 A;  4RW9 A;  3AAP A;  1GLC G;  1S1X A;  5AQN A;  4EZ9 A;  4IFY A;  5GIN A;  1E3M A;  3JAM O;  3QIC A;  1ZBF A;  3TPQ A;  5BPL A;  3CET A;  3AVM A;  4M3R A;  2VG6 A;  4CF2 A;  3NE6 A;  1BI4 B;  3NGZ A;  1UOC A;  4CBX A;  3AVB A;  2UUA K;  4B3S K;  3THY A;  3CFP A;  3MAQ A;  3UIQ A;  3ZSV A;  4WQ4 C;  3OYL A;  1N33 K;  2O4G A;  1FXX A;  5C24 A;  5JVH L;  3I8D A;  1Z26 A;  4CZI A;  3ASM A;  2OCE A;  4HUG A;  1Y97 A;  4CJR A;  3E66 A;  4W5Q A;  4RWT A;  4LF9 K;  2PBD A;  4B9U A;  5C42 A;  3M6G A;  1DTT A;  1JXB A;  3CER A;  4FJ7 A;  5BPM A;  1RTI A;  4U67 L;  1EO1 A;  1O13 A;  2UU9 K;  4X64 K;  3M5R A;  1J9A A;  1BI4 A;  4DTJ A;  4PL7 A;  3OJS A;  2GUI A;  3VA3 A;  3QEW A;  4FJ8 A;  3CFR A;  1S1V A;  2NZT A;  4DCH A;  3A2F A;  2GUP A;  5LL6 Z;  4K42 A;  5GAH P;  5KGW A;  4KV8 A;  1IBM K;  3LWL A;  3K5L A;  1SL0 A;  2HHU A;  4JHD A;  3AO4 A;  1VRT A;  2RN2 A;  5FLX O;  1U49 A;  3GBT A;  3FZF A;  3ZYY X;  1TK8 A;  1B92 A;  3O9U A;  4CGI A;  2XY7 A;  1HNI A;  1QQO A;  3R3L A;  3ZEU B;  4DSF A;  3DWL A;  4DF8 A;  2HMP A;  2OZM A;  3OYE A;  1HYV A;  4DR7 K;  1JLA A;  4FOI A;  1BCO A;  1NGD A;  4QOZ B;  1HJO A;  4YOT A;  1TKD A;  2A3Z A;  4CVN E;  1YT3 A;  3SZ2 A;  2YKN A;  3NVK A;  3O4N A;  3CJ1 A;  1BWF O;  1NKC A;  3VF2 A;  3LP1 A;  1JL1 A;  2AJQ A;  1G99 A;  2OPP A;  2RHK A;  5C12 A;  3QEX A;  4CES A;  5AQG A;  5FDL A;  2X6N A;  1HJR A;  1B9F A;  4LFB K;  2V51 B;  3ZEU A;  1MDU B;  2BAN A;  3WNG A;  4CF9 A;  2WUS A;  2ASO A;  3VQ7 A;  3DM2 A;  1BIU A;  4DS5 A;  3KKR A;  1Q82 O;  2V52 B;  3L4Q A;  3O80 A;  3QEP A;  3U9D A;  5J2Q A;  5HRP A;  4W5O A;  4LFC K;  4O0I A;  5BN9 A;  1ITG A;  4H8K A;  4FJG A;  1UAX A;  1GLA G;  1REV A;  2Q36 A;  4JKB A;  4HUF A;  2OPQ A;  1K6Y A;  1IG8 A;  3V1Q A;  4CGF A;  1ASV A;  3B8A X;  3VQ9 A;  4Z4G A;  4RW8 A;  1N8R O;  3KVG A;  4R5P A;  4FZZ A;  1HPZ A;  4IWV A;  5HRS A;  5GIP A;  3LPU A;  1RT5 A;  2KKZ A;  4Z4H A;  3KK1 A;  4KHP K;  1SZ2 A;  4DUY K;  2W6K A;  3V9Z A;  3CCR N;  2KQ2 A;  3CPE A;  3MED A;  3BEX A;  4FLZ A;  1NG9 A;  2O8C A;  1JXE A;  1YJW N;  1HUX A;  3HK2 A;  3WXK A;  1D9D A;  4F2R A;  4OO1 J;  3OYK A;  1BQN A;  5FRN A;  4E89 A;  4H4M A;  1I3A A;  1VQ6 N;  1EKE A;  3OYC A;  1S1U A;  1QSL A;  4A62 A;  1BU6 O;  4IOC L;  5C2D A;  4H5R A;  4DWI A;  4AHC A;  4M3Z A;  4FLW A;  2Y1J A;  3IS9 A;  2DTU A;  3ZSW A;  2FSJ A;  3ZT2 A;  4LH5 A;  3T3F A;  3HVR A;  3FR0 A;  3CC4 N;  1VK0 A;  3EO3 A;  1W97 L;  4KB0 A;  4BQZ A;  1C6V A;  3ISN C;  2HHX A;  4PKG A;  1UWB A;  3THW B;  2G8F A;  3ULD A;  3CYM A;  5ADX A;  5F2R A;  3OYN A;  4KTZ A;  2YJF A;  3UKU B;  4DV4 K;  1NGA A;  1EQY A;  3SUO A;  4JI3 K;  5AQJ A;  1TKT A;  3V9W A;  2A42 A;  2OAN A;  2D0B A;  2OA8 A;  1WLJ A;  4F3T A;  3HST B;  4MDA A;  1DEJ A;  2P1J A;  4Z4E A;  3WXJ A;  3KLF A;  3K5N A;  1VSF A;  3O1W A;  2O8B B;  4N47 A;  3THW A;  3AVK A;  4FPB A;  3VQA A;  4O44 A;  4TSX A;  3FGU A;  3LDN A;  4DR2 K;  2ETJ A;  5KI6 A;  2PY5 A;  2FBX A;  3CF5 L;  3SI6 A;  3UKU A;  4B1Z A;  4CZH A;  4DU3 A;  3AVA A;  4M41 A;  3U6F A;  1VQL N;  1SL1 A;  4E1N A;  1KAZ A;  1T44 A;  4K43 A;  3CJB A;  1NGJ A;  3LP0 A;  3RMC A;  2ATQ A;  4AM6 A;  4CFA A;  3NCI A;  1KFS A;  3ZT3 A;  3VMF B;  1NJI O;  5AQI A;  4BC4 A;  2Y1I A;  5FRM A;  2YKM A;  2O8B A;  4JLH A;  4B9V A;  3QBX A;  4RCH A;  3L3U A;  1VSE A;  4PWD A;  4CHQ A;  4IEE A;  1SUQ A;  3CMA N;  4C1N K;  2J4R A;  4BDP A;  5MLC Q;  2W6L A;  4OKJ A;  4ZTF A;  3U4L A;  1KVB A;  4NLB A;  1QSS A;  1D9F A;  4JKC A;  3HZ6 A;  3AO5 A;  2FC0 A;  1HQU A;  4BQL A;  4CZJ A;  1Q86 O;  3SJH A;  4BRK A;  5HLF A;  4BRO A;  1L3U A;  3T19 A;  1S1T A;  4OKK A;  1ZBU A;  2E1Y A;  1BA0 A;  3QLH A;  1VQK N;  1BQM A;  3C0B A;  1NGG A;  2IOC A;  3MX5 A;  4KTW A;  3I0S A;  1OKJ A;  5F0X A;  1U4B A;  3I55 N;  4IKF A;  3SMS A;  4FK2 A;  3MEC A;  3SMP A;  4DQP A;  1UA0 A;  4C8L A;  3TU5 A;  3K0S A;  1HKG A;  5JLF A;  5LMN K;  5C0Y A;  1U04 A;  4G9Z A;  3A5M C;  5DM7 L;  4CE9 A;  3PO4 A;  3O9R A;  2KW4 A;  3LDQ A;  2QWL A;  2G8I A;  3K9J A;  5J2M A;  3OHR A;  2VQE K;  3H3O B;  5M1Q A;  3L2Q A;  3R1X A;  2HVH A;  1HLU A;  4HHT A;  3QIP A;  5F1X A;  3MN5 A;  3KD5 E;  2RKI A;  3LZJ A;  4FJH A;  3SPZ A;  1ESV A;  1XNR K;  1T05 A;  4ZHR A;  4M3T A;  3M3Z A;  4FWL A;  4B3M K;  1GOB A;  4BRL A;  1TL3 A;  2IGI A;  2NRZ A;  4E7L A;  1HKC A;  4BRE A;  3ATU A;  3MX2 A;  4LF7 K;  4B1Y B;  4HTL A;  1MA9 B;  3VGL A;  3BGR A;  4A5A A;  1SL2 A;  5AQO A;  3TTF A;  4EP5 A;  1H1V A;  3O3F A;  1XMQ K;  3U8X A;  1A5X A;  1CZ9 A;  4XEI A;  4OLB A;  4EZ6 A;  4K8X A;  1HQE A;  1S22 A;  3PIO L;  1YXQ A;  2IDO A;  2V7Z A;  1MU2 A;  1C1C A;  2XY8 A;  3ZX3 A;  4CI6 A;  1BUP A;  3LAL A;  3T69 A;  3VEW A;  4CJE A;  5BR8 K;  1LV5 A;  4L8R B;  2KFN A;  3LPT A;  4U7B A;  3KIO A;  2IAJ A;  5M1N A;  1KTQ A;  3CJC A;  3IG1 A;  4CCH A;  4J2B A;  5CR4 A;  4CEC A;  3ZT1 A;  3J81 O;  4IBN A;  4GVE A;  4B3T K;  5LJV A;  3VOV A;  4A59 A;  1XQS C;  1OVQ A;  4BRG A;  4CD1 A;  2UXD K;  4H5V A;  1VHX A;  5K14 A;  4CZF A;  3E01 A;  5CZ1 A;  1WSJ A;  3MN7 A;  5HRN A;  2YHA A;  4HCC A;  3CM6 A;  2XY5 A;  1BOT O;  1SS6 A;  3FFI A;  3VA0 A;  4KHY A;  4FWK A;  4CEQ A;  1UA1 A;  4LSL A;  4DTN A;  4E7I A;  3HYF A;  4OPH A;  3UE5 A;  2DFH A;  1HR0 K;  3VET A;  4RTF D;  4O8K A;  4YDU C;  1NKE A;  5DMR A;  5JS1 A;  3LP2 A;  4OJR A;  2B5J A;  5GIO A;  3SQ1 A;  3G0Z A;  3A0I X;  3OY9 A;  3H6E A;  2UUC K;  3AV9 A;  1OVY A;  4AHU A;  4AIL C;  4H0V B;  1IBL K;  3AA3 A;  2NRH A;  1ASU A;  3H45 C;  2HHQ A;  1P90 A;  3SBT A;  3VQB A;  3HSC A;  4OLA A;  5GAD P;  5E26 A;  2RPI A;  2B4J A;  5KPR A;  1YF5 L;  4KRE A;  1EXQ A;  4CEZ A;  2HND A;  3TSQ A;  2QM1 A;  1VQM N;  3THX A;  3C95 A;  4WFB L;  4KHU A;  5HBM A;  4YOW A;  1NJW A;  3DLB A;  1ILY A;  3OYI A;  4O5B A;  5AZJ B;  1BL3 A;  4F8R A;  3JS6 A;  5FPN A;  4FWO A;  4B9S A;  2HBJ A;  4OPJ A;  3O6W A;  1E4G T;  4YHH K;  5GAE P;  3QB0 A;  3T1Y K;  1NK7 A;  5SZT A;  3WQU A;  4FXD A;  3I33 A;  5KRT A;  1BIS A;  2F96 A;  4JK9 A;  4AHS A;  4XH1 A;  1KXP A;  3QIN A;  2YHX A;  1TKX A;  5AZJ A;  3H46 O;  1QHA A;  3OYB A;  4FJK A;  4GV9 A;  4CJ7 A;  2E88 A;  3U3G A;  5I3U A;  1WNS A;  1A5W A;  4KPY A;  4DMN A;  4DQQ A;  4NCA A;  4FM2 A;  3D2E B;  4KHW A;  4FJL A;  4ID5 A;  1O1W A;  3ZCM A;  4CF0 A;  4BE0 A;  3L4I A;  1DKG D;  2ZJP L;  3PUF A;  3NAE A;  4PL8 A;  4I9L A;  2QWP A;  4Z94 A;  3NF7 A;  5AQR A;  4KO0 A;  4C23 A;  1RCH A;  4FZX C;  1XC9 A;  2LSN A;  4FJN A;  4BR9 A;  4QS8 A;  4FLT A;  4IJN A;  1SAZ A;  5M1P A;  3CQY A;  4Q5V A;  1C0U A;  4BRI A;  4NXM K;  2X6S A;  3TAR A;  2IS3 A;  3LWM A;  2HVI A;  1ZC6 A;  1RT6 A;  1WN7 A;  1WAF A;  1YJN N;  3D45 A;  3QIO A;  4FCY A;  3EE8 A;  5AQP A;  3AVG A;  3F9K A;  2Q3S A;  4CEO A;  1JCG A;  1X9J A;  1MWM A;  3WNH A;  3C6A A;  2QWN A;  3ZX0 A;  1U48 A;  2BUP A;  3ENH A;  5B8H A;  4DV2 K;  4E7J A;  2WOM A;  3ZSO A;  3K57 A;  3VEY A;  4B1U B;  3SAF A;  3CCQ N;  2FSK A;  4FW2 A;  1JLQ A;  4BRC A;  1HX1 A;  2HHH K;  2E4L A;  3BZC A;  4LF8 K;  1VQ9 N;  4IO9 L;  3RMB A;  2HHV A;  5M1F A;  4FLX A;  2QK9 A;  3NF8 A;  2KTQ A;  1NK9 A;  1X3M A;  3LAN A;  2GV9 A;  1VSK A;  3AY9 A;  2OPR A;  3HXM A;  2FF3 B;  2VWK A;  2YI1 A;  3WXL A;  3KK2 A;  5CZ2 A;  3G10 A;  3SUP A;  1RT7 A;  4GV3 A;  1HRH A;  4ILG B;  1OH7 A;  2BH1 A;  1Y64 A;  1ATR A;  4HTU A;  1RBT A;  4X65 K;  5HL7 L;  2PAV A;  4CJ4 A;  4UY8 O;  4CIF A;  1JLE A;  4I2P A;  4FWQ A;  3G25 A;  3K5M A;  4DG1 A;  1VQO N;  1RDB A;  3HVT A;  4KI4 A;  2QKK A;  4XH5 A;  1DLO A;  4CHZ A;  3OBW A;  3G4S N;  3QEV A;  1HPM A;  4KAZ A;  3VEO A;  5FPD A;  4CBU A;  1KSP A;  1S1W A;  4JI0 K;  2QTD A;  3TTC A;  1QQC A;  1B9D A;  4I2Q A;  2XO7 A;  4E7H A;  2NUB A;  1HMV A;  4KH4 A;  5DK5 A;  3A5N C;  3I8B A;  2HBK A;  1T6C A;  4JAX A;  4K41 A;  2G8K A;  2YCH A;  3CCL N;  3CXC M;  3CIP A;  2QWM A;  4CFB A;  2VGN A;  4CFC A;  2Q97 A;  4MO5 A;  3ID8 A;  3L3V A;  5KRS A;  3NVM A;  3O5B A;  1ZBI A;  1EWQ A;  3MMV A;  1VQ7 N;  5AQX A;  3L2W A;  4GKK K;  4CHN A;  2KFZ A;  4LH4 A;  1BHL A;  4FOE A;  2A41 A;  4AF1 A;  1FK9 A;  2GX9 A;  2O8E B;  3SQ0 A;  3O3H A;  1C0T A;  5AQS A;  2ASM A;  3ZSR A;  4JS4 A;  4BAC A;  3AO3 A;  5BN8 A;  3O4Q A;  3H08 A;  4OKE A;  3LM9 A;  3KJV A;  3CFO A;  1NOZ A;  3O1B A;  1CXU A;  4JNE A;  1D4X A;  2GBZ A;  4EIA A;  2Z1I A;  4DR6 K;  3MWT A;  1K73 O;  5AQT A;  1NJZ A;  3W0L A;  3BF3 A;  4DV1 K;  5AQZ A;  1WUA A;  4JI2 K;  3G6E N;  4JI4 K;  4IXC A;  1LAW A;  4GKJ K;  3SV4 A;  1L3V A;  1TAU A;  2VQF K;  2DY4 A;  1HNV A;  3H3N O;  1QQN A;  3AVJ A;  3CJA A;  4M3U A;  1NU0 A;  3MCP A;  4O0J A;  2IC3 A;  3HP9 A;  3S3M A;  1JL2 A;  1M90 O;  2GWJ A;  1N36 K;  2DFF A;  4BR0 A;  5AQQ A;  2P5G A;  4C8M A;  4RG8 A;  4ISG A;  3K5O A;  3QML A;  3OS2 A;  4YOU A;  1NMN A;  2Z1J A;  4BGB A;  3L6Q A;  3SAG A;  4LY7 A;  4H5N A;  3V4I A;  1RIL A;  5C15 A;  4F3O A;  4Z4C A;  3J7Y P;  4AM7 A;  4BC5 A;  3PSF A;  1ATS A;  4W5T A;  2E8A A;  1WB9 A;  4CGJ A;  3VQC A;  3T1A A;  1RBU A;  2UYT A;  4PUO A;  2ZQB A;  3ZLJ A;  5JS2 A;  1RDC A;  4K8Z A;  5AJ3 K;  1NGE A;  4KBO A;  4FYD A;  1BIZ A;  2E20 A;  1BDG A;  1RBS A;  1QHT A;  1S6P A;  1WOQ A;  3AA2 A;  2QW9 A;  5EOY A;  4CBW A;  2ZJR L;  3OA9 A;  3VQQ A;  2G8V A;  3UKR B;  4A57 A;  3NF6 A;  3KK7 A;  2YNI A;  4CJU A;  4NLC A;  3OYF A;  5AQU A;  1LW2 A;  2NNW A;  1RDU A;  4N41 A;  1ZBL A;  1J54 A;  3CI5 A;  4FO0 A;  3WNF A;  3V81 A;  5I9E B;  3G71 N;  4CER A;  3VEZ A;  3TAB A;  4YDU A;  4FK4 A;  3V9S A;  1WAJ A;  1NM1 A;  4GMJ B;  1QE1 A;  4WE1 A;  3IFR A;  3UKR A;  4DSK A;  4DSJ A;  3PSI A;  2V7Y A;  5EY4 A;  1IJJ A;  1DTQ A;  2VWJ A;  3VES A;  4BRN A;  4JYA K;  1FKP A;  4DTS A;  4MLE A;  3ITH A;  1V4S A;  1S9G A;  4DQR A;  1OH6 A;  1BA1 A;  3TAM A;  3NBP A;  3WQT A;  3SUQ A;  1N32 K;  4CK2 A;  3WUH A;  4F4K A;  4FM1 A;  4CZE A;  3CCJ N;  4ELT A;  4DR5 K;  2Q2R A;  1KVC A;  2X74 A;  4MLH A;  3E9O A;  2XRI A;  3KK3 A;  4HUE A;  4CHO A;  3RRH A;  3FZH A;  5AR0 A;  3O08 A;  1T8E A;  1LAV A;  2E2P A;  3CG7 A;  2BE2 A;  3DXM B;  1D8Y A;  1V4T A;  1HNZ K;  5DM6 L;  4NO7 A;  4E1M A;  1VSL A;  3WNE A;  4E0D A;  4CF8 A;  4H0X B;  1X9M A;  2E2Q A;  3M1F A;  1SV5 A;  1KAX A;  3HO1 A;  4M3X A;  1YVN A;  4CK3 A;  4DKW A;  1QS4 A;  1C0G A;  3CPW M;  4CD3 A;  4RW7 A;  2GTD A;  1TV6 A;  2E5L K;  3RMD A;  3DXM A;  4ISF A;  3HPO A;  1KVA A;  3B6P A;  4DTM A;  3RVC A;  1VQP N;  3TAE A;  2QEX N;  1GLL O;  2HNZ A;  3GL1 A;  1WSE A;  4B9T A;  2FXU A;  4DTU A;  3IMX A;  2Z1H A;  2EWS A;  1GLE G;  3HP6 A;  2PYJ A;  3P5J A;  1YVU A;  3CC7 N;  3EKS A;  4FJ5 A;  4FLV A;  3DLR A;  2VYP A;  4LD0 A;  4PA1 A;  4DFM A;  1C0F A;  2D0C A;  4PHT X;  1RT3 A;  3TAQ A;  3KWI A;  4X66 K;  3HTV A;  2HB5 A;  4X62 K;  1NBW A;  3F2K A;  3D2F B;  4R79 A;  1RBR A;  5HRR A;  3C94 A;  3LL3 A;  3OYD A;  4KH6 A;  5C10 A;  3DLH A;  3VQ4 A;  4JKA A;  1ZBS A;  4A61 A;  4YOV A;  1EX4 A;  1SKS A;  2HHT A;  3ENB A;  4WYB A;  3NGY A;  3VQ6 A;  3A5L C;  4BC2 A;  1NKB A;  3KLI A;  2E2O A;  3EZ5 A;  2P9L B;  4Z0U A;  4BRD A;  4DSE A;  5SWM A;  4Z4I A;  4JKE A;  3AGR A;  3MN9 A;  4WQ4 A;  1VQ4 N;  3K59 A;  1N5Y A;  4YOR A;  4FJ9 A;  3CD6 N;  1QVF M;  3M8Q A;  1YIJ N;  1QZ5 A;  3D2F A;  3MK6 A;  1Q8I A;  1KC8 O;  3VGM A;  4DFP A;  4FM0 A;  2F4V K;  2CGK A;  1TYQ B;  1QSY A;  3MXJ A;  4BR5 A;  1XHZ A;  3RWU A;  1Q9X A;  1IO2 A;  4DSL A;  4H5T A;  4B8C A;  3LDS A;  2P9P B;  2QWO A;  4B9M A;  2P9L A; 
#chains in the Genus database with same CATH homology
 1RDD A;  1TKD A;  4OGE A;  3PUF A;  2XY6 A;  4EP4 A;  1YT3 A;  3SZ2 A;  3NAE A;  2YKN A;  4I9L A;  5CY4 A;  1T03 A;  3O4N A;  4KFB A;  1NKC A;  3PX4 A;  3LP1 A;  3NF7 A;  1JL1 A;  4E19 A;  2AJQ A;  1I39 A;  4KO0 A;  1RCH A;  2OPP A;  3O3G A;  4FZX C;  1TVR A;  3QEX A;  4CES A;  2LSN A;  1XC9 A;  5FDL A;  3AVF A;  4ZTJ A;  4FJN A;  2X6N A;  1HJR A;  2EX3 A;  4FLT A;  1B9F A;  1SKW A;  4CED A;  3THV A;  4CEA A;  3K2P A;  1C1B A;  2BAN A;  3WNG A;  4CF9 A;  3S3O A;  3AVL A;  1CXQ A;  3VQ7 A;  3DM2 A;  1IKY A;  1BIU A;  4Q5V A;  4DS5 A;  1C0U A;  4I7F A;  2G8W A;  3KKR A;  4DFJ A;  1JLB A;  2X6S A;  3TAR A;  1BCM A;  5D3G A;  4FJX A;  2IS3 A;  2Z1G A;  3LWM A;  1LWC A;  3DOL A;  4OVL A;  2HVI A;  4AH9 A;  3OYG A;  3QEP A;  5J2Q A;  1RT6 A;  1WN7 A;  2PYL A;  1WAF A;  5HRP A;  4ELU A;  3D45 A;  3QIO A;  4FCY A;  3ZT4 A;  3AVG A;  4W5O A;  3F9K A;  4CEE A;  3B6O A;  1ITG A;  4O0I A;  3NHG A;  2Q3S A;  4H8K A;  4CEO A;  1VSJ A;  3L2R A;  4DTO A;  4FJG A;  1UAX A;  3HL8 A;  3IRX A;  1REV A;  3WNH A;  1KCF A;  4B08 A;  4HUF A;  2OPQ A;  3AA4 A;  1K6Y A;  3V1Q A;  4CGF A;  1ASV A;  1X9S A;  3VQ9 A;  1U48 A;  1ZBH A;  4Z4G A;  1RT4 A;  4RW8 A;  2JLE A;  4R5P A;  3KD1 E;  4FZZ A;  2RF2 A;  1HPZ A;  2E6M A;  2WOM A;  3ZSO A;  3OYJ A;  1RDA A;  3K57 A;  4E7J A;  4QCL A;  5KGX A;  1XHX A;  5HRS A;  4FW2 A;  1JLQ A;  1LWE A;  1RT5 A;  3LPU A;  2OPS A;  4Z4H A;  3KK1 A;  4DTX A;  2BGG A;  2EHG A;  3QO9 A;  2E4L A;  4I9Q A;  4BE2 A;  3CM5 A;  1JKH A;  3V9Z A;  3NF9 A;  2O4I A;  2KQ2 A;  2HHV A;  3RMB A;  1TK0 A;  2QK9 A;  4FLX A;  3LAK A;  3MED A;  3NF8 A;  2KTQ A;  4FLZ A;  1NK9 A;  3LAN A;  2GV9 A;  1VRU A;  1VSK A;  4B9N A;  2OPR A;  3DRR A;  3HXM A;  2VWK A;  2B6A A;  4ID1 A;  3KK2 A;  5CZ2 A;  1VSD A;  3G10 A;  3SUP A;  4M3Y A;  1RT7 A;  3DI6 A;  3HPH A;  1HRH A;  4CF1 A;  2R7Y A;  1JXE A;  4NCB A;  1TKZ A;  4RW4 A;  1RTD A;  3DYA A;  3HK2 A;  3ZSY A;  1LW0 A;  3DOK A;  1D9D A;  4F2R A;  3OYK A;  1BQN A;  1RBT A;  4HTU A;  3MXI A;  4CJ4 A;  3V1R A;  3HPG A;  1TAQ A;  4E89 A;  4N56 A;  4H4M A;  1JLE A;  1I3A A;  1XWL A;  4I2P A;  4CIF A;  1CZB A;  3NDK A;  3SYZ A;  3K5M A;  3NH0 A;  1EKE A;  4DG1 A;  4HVJ A;  4B9L A;  1RDB A;  3OYC A;  1CLQ A;  1S1U A;  1QSL A;  4XIU A;  4W5N A;  3HVT A;  4CJK A;  3AO1 A;  3CQ8 A;  3QET A;  4KI4 A;  2QKK A;  1S6Q A;  2YNH A;  1C0M A;  1DLO A;  4CHZ A;  4CIE A;  4CEF A;  3QEV A;  4DWI A;  3F73 A;  5T7B A;  4KAZ A;  4J2E A;  4AHC A;  4M3Z A;  4J2A A;  3AVI A;  4FLW A;  2Y1J A;  4M45 A;  1U47 A;  3IS9 A;  5E41 A;  2DTU A;  3ZSW A;  2QXF A;  4LH5 A;  1S1W A;  3ZT2 A;  3T3F A;  1KSP A;  3HVR A;  1VK0 A;  1QQC A;  1B9D A;  4I2Q A;  1WSI A;  2XO7 A;  3LAM A;  4E7H A;  3OYH A;  2NUB A;  1HMV A;  5DK5 A;  4DQS A;  4KB0 A;  1C6V A;  3ISN C;  4FW1 A;  5CYQ A;  3I0R A;  4Z4F A;  2HHX A;  4O4G A;  1UWB A;  2G8F A;  4KRF A;  3KLG A;  3ULD A;  3CYM A;  3OYN A;  4KI6 A;  4C8N A;  2ZD1 A;  4KTZ A;  4CIG A;  4PY5 A;  3QEI A;  2G8K A;  2I5J A;  4C8O A;  3SQ2 A;  4DTR A;  4CJW A;  3SUO A;  1KRP A;  3MEG A;  1TKT A;  3V9W A;  3V9X A;  4CFB A;  2D0B A;  4CFC A;  3SUN A;  3IAY A;  4J2D A;  3L3V A;  1WLJ A;  2OA8 A;  5KRS A;  3KLE A;  4N5S A;  4CHP A;  5C25 A;  4KHQ A;  4F3T A;  1TK5 A;  3HST B;  1ZBI A;  2P1J A;  4Z4E A;  4G1Q A;  3KLF A;  3K5N A;  3QNO A;  1VSF A;  4CFD A;  3SPY A;  4BDY A;  3DLE A;  5EU7 A;  4N47 A;  3L2W A;  3AVK A;  4RW6 A;  4CHN A;  3VQA A;  4O44 A;  2KFZ A;  4LH4 A;  4TSX A;  1BHL A;  3KTQ A;  3PX6 A;  2DFE A;  1FK9 A;  2ETJ A;  4Y1C A;  3K58 A;  4YNQ A;  5KI6 A;  2PY5 A;  2FBX A;  3O3H A;  3SI6 A;  3SQ0 A;  2D0A A;  4KTQ A;  1LWF A;  1C0T A;  1N6Q A;  4DU3 A;  3AVA A;  3ALY A;  1L3T A;  3EY1 A;  4M41 A;  3U6F A;  4CGH A;  1SL1 A;  3ZSR A;  4E1N A;  2OZS A;  1HYZ A;  2YHB A;  4JS4 A;  4BAC A;  3NGI A;  3AO3 A;  3TWH A;  3RR7 A;  3O4Q A;  3H08 A;  4OKE A;  1S5J A;  3LP0 A;  4CEB A;  3RMC A;  2ATQ A;  3KJV A;  3NCI A;  3CFO A;  4CFA A;  1NOZ A;  5KTQ A;  1CXU A;  2G8U A;  2GBZ A;  1X9W A;  1KFS A;  3ZT3 A;  1WSH A;  3C6U A;  1ZYQ A;  2Z1I A;  2Y1I A;  4O55 A;  4FK0 A;  3NH2 A;  4KHS A;  2YKM A;  5FRM A;  1NJZ A;  4JLH A;  4B9V A;  4M42 A;  4NCG A;  3C6T A;  1JLC A;  3L3U A;  3ZSZ A;  1RBV A;  1VSE A;  4GVM A;  4CHQ A;  4PWD A;  3TR8 A;  1LAW A;  1SUQ A;  3DLG A;  3PV8 A;  1RNH A;  4BDP A;  2FBV A;  3SV4 A;  4Y1D A;  1L3V A;  1TAU A;  4F2S A;  2DY4 A;  3TI0 A;  1HNV A;  3AVJ A;  1RT1 A;  1NJX A;  4M3U A;  4OKJ A;  4O0J A;  1L3S A;  2IC3 A;  1A5V A;  3HP9 A;  3S3M A;  4ZTF A;  1JL2 A;  4CJF A;  3M8S A;  3BDP A;  1KVB A;  4IDK A;  2DFF A;  1QSS A;  4CJ3 A;  2KZM A;  3MEE A;  1D9F A;  1ASW A;  1XI1 A;  1JLG A;  3AO5 A;  2P5G A;  4C8M A;  4RG8 A;  2FC0 A;  3K5O A;  4CGD A;  1HQU A;  1YTA A;  2FBT A;  2ITG A;  2X78 A;  3OS2 A;  3EYZ A;  2Z1J A;  3V1O A;  4KB1 A;  4DLE A;  1TL1 A;  3U3Y A;  1F21 A;  4LY7 A;  4CJV A;  3V4I A;  5HLF A;  1L3U A;  1RIL A;  4CK1 A;  4F3O A;  4Z4C A;  1R0A A;  3TAG A;  3T19 A;  5J1E A;  1S1T A;  1WSF A;  2P5O A;  4OKK A;  4W5T A;  3OYM A;  4JS5 A;  1ZBU A;  3PY8 A;  3L8B A;  3D0P A;  3QLH A;  3NFA A;  4CGJ A;  3T1A A;  1RBU A;  3VQC A;  1BQM A;  4PUO A;  4M3W A;  2ZQB A;  5JS2 A;  1RDC A;  4DU4 A;  1IKX A;  3HM9 A;  4K8Z A;  1YTU A;  2XHB A;  1BIZ A;  4FYD A;  5FRN A;  2PZS A;  4FJJ A;  1RBS A;  1QHT A;  1S6P A;  2IOC A;  3AA2 A;  4OGC A;  4KTW A;  1SKR A;  1S9E A;  3I0S A;  5J2N A;  1U4B A;  4GW6 A;  5CYM A;  3KLH A;  4DF4 A;  4YFU A;  3TAN A;  3AVC A;  4ELV A;  3VQQ A;  1GOA A;  4IKF A;  4NYN A;  3OS1 A;  2G8V A;  4FK2 A;  2QKB A;  3MEC A;  4DQP A;  3NF6 A;  4CJU A;  2YNI A;  4IFV A;  4JRQ A;  2W42 A;  3KKS A;  3P83 D;  3VQD A;  1UA0 A;  2E6L A;  3OYF A;  4C8L A;  1LW2 A;  1IH7 A;  4FLY A;  4N41 A;  1NK5 A;  1L5U A;  1U04 A;  3P1G A;  1IKV A;  1ZBL A;  1EP4 A;  1J54 A;  3S9H A;  4CJL A;  3WNF A;  3V81 A;  4CE9 A;  4ICL A;  3PO4 A;  1VSH A;  4IG3 A;  2KW4 A;  3OYA A;  1JLF A;  4CER A;  3JSM A;  1KLN A;  4DSI A;  4PQU A;  2G8I A;  3TAB A;  4DU1 A;  4FK4 A;  1RTH A;  3V9S A;  5J2M A;  3JYT A;  1WAJ A;  1VSI A;  4FLU A;  3AVN A;  4GMJ B;  5J2P A;  4QAG A;  3L2Q A;  2HVH A;  4HHT A;  1QE1 A;  3QIP A;  4WE1 A;  2VG5 A;  3KD5 E;  2RKI A;  4AHV A;  1KLM A;  3HT3 A;  3LZJ A;  3SJJ A;  3SPZ A;  4DSK A;  4E7K A;  4FJH A;  1T05 A;  3VQP A;  4ZHR A;  4DSJ A;  1VSM A;  4AHT A;  1DTQ A;  4CHY A;  4M3T A;  2VWJ A;  1GOB A;  4Q0B A;  1TL3 A;  2IGI A;  1FKP A;  4BWJ A;  4BE1 A;  3SV3 A;  4E7L A;  1W0H A;  4DTS A;  1NK8 A;  2BDP A;  3ZT0 A;  3ITH A;  4NYF A;  2KZZ A;  3BGR A;  3VN5 A;  4C8K A;  1SL2 A;  2YNF A;  4JRP A;  1S9G A;  3DRS A;  4DQR A;  4EP5 A;  1TGO A;  3O3F A;  5I42 A;  2YNG A;  1A5X A;  1CZ9 A;  3SQ4 A;  3QER A;  3LZI A;  4UQG A;  3TAM A;  4OLB A;  3NBP A;  4EZ6 A;  4K8X A;  3L2V A;  1HYS A;  4IG0 A;  3SUQ A;  3LP3 A;  1HQE A;  2ZE2 A;  2HNY A;  4CK2 A;  2IDO A;  2A1S A;  4H4O A;  1MU2 A;  1NOY A;  1QTM A;  1BGX T;  4F4K A;  4MQ3 A;  4FM1 A;  4E3S A;  4ELT A;  1C1C A;  3VQ5 A;  2HW3 A;  2XY8 A;  4DQI A;  1KVC A;  3LAL A;  1X1P A;  2X74 A;  3QNN A;  4CJE A;  2XRI A;  3KK3 A;  1NK6 A;  4HUE A;  4CHO A;  3RRH A;  5HRO A;  1LV5 A;  4L8R B;  2KFN A;  1T8E A;  2HHS A;  1LAV A;  1IKW A;  3DLK A;  3CG7 A;  3LPT A;  3KIO A;  3OJU A;  3M8R A;  3PX0 A;  2IAJ A;  2BE2 A;  3ZSX A;  1D8Y A;  2HMI A;  3RR8 A;  1WSG A;  1KTQ A;  4DLG A;  4CJP A;  1VSL A;  4E1M A;  4AHR A;  3WNE A;  3IG1 A;  4CCH A;  4J2B A;  1GOC A;  4FJI A;  4CEC A;  4B8A B;  4E0D A;  3ZT1 A;  4CF8 A;  1U45 A;  1X9M A;  3AVH A;  4IBN A;  3NH1 A;  1SV5 A;  3MXM A;  2A1R A;  3OS0 A;  3HO1 A;  4M3X A;  1KFD A;  3QES A;  2FBY A;  3TAF A;  4CK3 A;  4DFK A;  5K14 A;  1D5A A;  1QS4 A;  3AO2 A;  4DS4 A;  5HRN A;  3E01 A;  5CZ1 A;  1WSJ A;  4OPK A;  4KHN A;  1NK4 A;  3VQ8 A;  2WON A;  4RW9 A;  2YHA A;  4HCC A;  3CM6 A;  2XY5 A;  1EET A;  5HP1 A;  1S1X A;  3FFI A;  1G15 A;  3VA0 A;  4RW7 A;  4KHY A;  4EZ9 A;  4IFY A;  1TV6 A;  4CEQ A;  1UA1 A;  4LSL A;  4DTN A;  4E7I A;  3RMD A;  3HYF A;  3HPO A;  2DFH A;  4KKO A;  4BWM A;  1KVA A;  3B6P A;  2HHW A;  3RTV A;  4DTM A;  1ZBF A;  1NKE A;  5DMR A;  5JS1 A;  1RTJ A;  3LP2 A;  4OJR A;  3TAE A;  4FJM A;  2HNZ A;  2B5J A;  3SQ1 A;  3G0Z A;  3AVM A;  1WSE A;  4B9T A;  3OY9 A;  3VQE A;  4M3R A;  3SNN A;  4DTU A;  2VG6 A;  4CF2 A;  3AV9 A;  3ZSQ A;  1BI4 B;  4AHU A;  3NGZ A;  1UOC A;  2Z1H A;  3NE6 A;  4AIL C;  3AVB A;  3S3N A;  3HP6 A;  2PYJ A;  3AA3 A;  3CFP A;  1ASU A;  3P5J A;  2HHQ A;  1YVU A;  3MAQ A;  3ZSV A;  3RRG A;  3UIQ A;  3AA5 X;  3VQB A;  4OLA A;  4CJ5 A;  3OYL A;  4FJ5 A;  1J53 A;  2RPI A;  4FLV A;  3DLR A;  2O4G A;  1FXX A;  4LD0 A;  3L2U A;  2B4J A;  4PA1 A;  4CGG A;  5C24 A;  1J5O A;  4DFM A;  4KRE A;  1C1A A;  1EXQ A;  4CEZ A;  1Z26 A;  2HND A;  3ASM A;  3I8D A;  4LSN A;  4HUG A;  2P51 A;  3C95 A;  1Y97 A;  2D0C A;  4CJR A;  1RT3 A;  1Z25 A;  4CJQ A;  4W5Q A;  3PO5 A;  3TAQ A;  4KHU A;  4B9U A;  2HB5 A;  5HBM A;  5C42 A;  1NJY A;  1NJW A;  4HCB A;  1DTT A;  1JXB A;  3DLB A;  4FJ7 A;  1RBR A;  1RTI A;  5HRR A;  4BDZ A;  3OYI A;  3C94 A;  4O5B A;  3SCX A;  1BL3 A;  1J9A A;  3TAP A;  1BI4 A;  4F8R A;  2YV0 X;  3OYD A;  4DTJ A;  3M8P A;  1RT2 A;  1W9H A;  3OJS A;  3DLH A;  4B9S A;  2GUI A;  3VQ4 A;  4OPJ A;  3VA3 A;  2D5R A;  3QEW A;  4FJ8 A;  1EX4 A;  3CFR A;  1S1V A;  1SKS A;  2HHT A;  3NGY A;  3A2F A;  4FVM A;  3VQ6 A;  2F8T A;  1FKO A;  3DMJ A;  1NK7 A;  4W5R A;  5SZT A;  1NKB A;  2F8S A;  2VG7 A;  3KLI A;  1IG9 A;  5KGW A;  4MFB A;  4KV8 A;  3EZ5 A;  4FXD A;  4Z0U A;  3V6D A;  5KRT A;  1Q9Y A;  1BIS A;  4DTP A;  4N76 A;  3LWL A;  5SWM A;  3K5L A;  2F96 A;  4DSE A;  4Z4I A;  4AHS A;  1SL0 A;  2HHU A;  3AO4 A;  1VRT A;  2G8H A;  3K59 A;  3DRP A;  1N5Y A;  3QIN A;  4FJ9 A;  2RN2 A;  3M8Q A;  1TKX A;  1NK0 A;  1U49 A;  3RMA A;  2JGU A;  2OYQ A;  1TK8 A;  1B92 A;  1Q8I A;  3OYB A;  4FZY A;  3HJF A;  4CGI A;  3OVN A;  2XY7 A;  4FJK A;  4B3O A;  4CJS A;  1HNI A;  4DFP A;  4FM0 A;  3V9U A;  4DF8 A;  4CJT A;  4DSF A;  3U3G A;  5I3U A;  1QSY A;  1WNS A;  3MXJ A;  1XHZ A;  1A5W A;  3RWU A;  4DMN A;  1T7P A;  4KPY A;  4DQQ A;  1IO2 A;  1Q9X A;  4DSL A;  4FM2 A;  4NCA A;  5FRO A;  4KHW A;  4FJL A;  4ID5 A;  4B8C A;  3LDS A;  1O1W A;  3ZCM A;  3OYE A;  4CF0 A;  2OZM A;  1HYV A;  1JLA A;  4B9M A;  4BE0 A;  1BCO A;  4QOZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...