3F2KA

Structure of the transposase domain of human histone-lysine n-methyltransferase setmar
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
197
Chain Sequence
b'HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Transposase Domain of Human Histone-lysine N-methyltransferase SETMAR.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 197
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3f2kA00
3F2KA 3HOTA 5HOOA 2F7TA 4MDBA 3K9JA 4U7BA 5CR4A 4MDAA 3K9KA 4R79A 3HOSA
chains in the Genus database with same CATH superfamily
2B4JA 3TARA 1U2VB 1KVBA 3KLGA 4JK8A 3OYCA 3VQ7A 4CGDA 2FC0A 4IOXA 3ATUA 3L6QA 3OYDA 3CFRA 5BPNA 3NGZA 4JKAA 2HHQA 1JCEA 1RBSA 3D2EB 3CM6A 4PWDA 5AQRA 3CF5L 1TAUA 4CJ7A 4FLYA 3KK1A 1RDCA 3NHGA 2YKNA 1RTJA 3ITHA 2G8UA 4FM1A 4WFAL 3A5NC 2IOCA 1VSKA 2Q3SA 4WYBA 5AJ3K 4Z4GA 2PAVA 4H0VB 3HPGA 1S9GA 2P9NB 5FPEA 1X3MA 3FFKB 3L2RA 4MFBA 5C2FA 2QXLA 5GAEP 3RTVA 2UUAK 3I8BA 1Y97A 4DQRA 5JS1A 2KQ2A 5BR8K 5AZJA 4BRPA 1U04A 2YI1A 3TPQA 4CZFA 2JLEA 2E1YA 4ZHRA 4MDAA 3QBXA 3VETA 1U49A 5I3UA 2A5XA 3D2FA 1K9MO 2BDPA 1W97L 3FZLA 4PA1A 4L8RB 4CK2A 1YVUA 3VMFB 4N47A 4FWOA 1EETA 3W3DA 4HCCA 4AHVA 3KLFA 3AA5X 3CETA 4FJNA 4NYNA 1EWRA 1QQOA 4JKDA 3ZX0A 4DG1A 1Q82O 3WXLA 2G8FA 1VQON 2FXUA 3DJCA 1JLCA 2NUBA 4FWNA 3NF8A 4BWMA 4O5FA 1LW2A 2FSJA 1X9MA 5DK5A 3V9UA 4B8CA 3MX5A 4BRGA 3MXIA 4Q5VA 2XY6A 2E5LK 5C12A 2W6LA 4RW7A 4CZEA 3EKSA 1E4GT 3KKSA 5J2PA 3PX0A 4CJWA 2IDOA 3OTOK 4LC9B 5CHIA 3DLHA 1YT3A 1HJRA 4K25A 3ZSVA 2ZJRL 3O9UA 3CYMA 4OPKA 2IAJA 2HHUA 4BGBA 3SI6A 1ATSA 1KTQA 3QEVA 3DOLA 3QEIA 1HNXK 3TSUA 4IFYA 5LMUK 3ULDA 4OJRA 5LMNK 3K9KA 3OYBA 3MWPA 2ZM6K 2GX9A 5HBMA 1T3VA 3C0BA 3OS0A 3NBPA 1FK9A 1DTTA 4KI6A 3IFRA 1KLNA 2HBKA 2O8FB 3ID8A 1XC3A 4IJAA 2ZGZA 1SKWA 3AVBA 4I6MA 3MN7A 4BY9C 3RSEB 4N5SA 4B9NA 2WUSA 3HI0A 1D9DA 1SKSA 1ZYQA 1BHLA 3V4IA 4BWJA 4GKKK 3PUFA 3OVNA 1JLQA 1IG9A 4DSIA 2D0CA 3BZCA 3THXB 1NOYA 4LF9K 2G8KA 4FK0A 5GAGP 4BR2A 3AO3A 5AQTA 4W5OA 1NK8A 4FWSA 4AM7A 5SZTA 4C8KA 2WTUA 3CCRN 3I0SA 5AQNA 3CCUN 4YFUA 1V4TA 4B9QA 2JWLA 1XHXA 1J5EK 2AP1A 4JK9A 3K59A 4O44A 3ZSRA 5EU7A 5KGWA 4MLHA 3B6PA 1I39A 3TAFA 5C25A 1FKOA 3ZT1A 1ZBSA 1RT4A 5AZIA 4B8AB 4FL9A 3HOSA 3RMAA 4KV8A 1RBTA 4H5TA 4K0KK 4DV3K 4FWKA 1QQMA 1NWKA 4DV0K 3ZSZA 2IIRA 1A5XA 3ZETA 4Z4CA 2HNDA 4DTXA 1O13A 1ZBFA 3CC4N 4DU1A 1S6PA 4YOWA 3HBTA 4WQ5A 4EZ9A 1RT7A 2QK9A 2HHSA 3LM2A 3NH1A 3U3YA 4IOAL 1RBVA 4DFPA 3NVKA 3P83D 4IG3A 4CIEA 4A62A 5AQKA 4FJ7A 3UIQA 3T3FA 3EO3A 2FSKA 3A0IX 5AZJB 4CGHA 3MEEA 4E1JA 4DUYK 4FJXA 4DF8A 1S1WA 3O08A 4C8OA 3D2FB 4CEEA 4RTFD 5GADP 3OYJA 4BRCA 4YOUA 4BE2A 3AAQA 3E9PA 2NLXA 3JXUA 5AQUA 4E7LA 3HT3A 4BQZA 1VK0A 4B9SA 4JK7A 3U9DA 3OW2M 4DTMA 2KKZA 1NGDA 1SL0A 1DKGD 1ZBLA 4C23A 3DRSA 5GIPA 2W40A 4B9TA 1GLEG 3HO1A 2A6AA 1NJWA 1T44A 2P9LA 3JAMO 4F2RA 1Q8IA 4DTOA 3CJ9A 5SWMA 3O4NA 4FWRA 2ZJPL 1C6VA 4H0TB 1HYZA 4QS7A 3O8MA 2WC9A 5K14A 1F21A 4A2AA 1L3VA 3DXKA 3UKUA 3TAPA 3KHYA 4LSNA 3KZBA 2OPSA 4PHTX 4FPAA 2CGJA 2V7YA 1T05A 4DHYA 1L3TA 3LAKA 3SJHA 1YIJN 2QWPA 3ENOA 5FPDA 3KK2A 2ZE2A 2RPIA 3K5OA 1NK9A 4DR7K 3AO5A 5FLXO 1QZ5A 3ZX2A 2QI2A 4BE0A 4FPBA 3VA3A 1NJZA 4DR6K 4B3RK 1YTAA 4I6MB 2VG5A 4JKHA 4YOVA 4B08A 3PX6A 5J1EA 1KQSM 4HWIA 4B1ZA 1SV5A 3M8RA 2E6MA 2XY5A 1KCFA 3L8BA 4JKEA 5ADXH 3MN6A 4ICLA 2ITGA 4LSLA 1LOTB 3MK6A 2A3ZA 2CGLA 3AGRA 5H1SQ 3EY1A 4I2PA 2BE2A 3L2UA 3DXMA 3CJAA 4O4GA 4Z94A 3SZ2A 4E7HA 3HZ6A 2YJEA 4IDHA 5T7BA 1LCUA 1QQNA 1UA0A 3MXMA 1WSEA 3TAGA 1L5UA 3QNNA 1NKBA 1KAZA 2GBZA 3PY8A 1YI2N 3G4SN 3V9ZA 4KREA 1C1CA 2X78A 3CM5A 5C42A 4AHUA 3AVFA 3ZYYX 3OA9A 3KD1E 1TKDA 1VRUA 4DFJA 3PX4A 2BANA 3M6GA 5AZIB 1OH8A 2LSNA 1EX4A 3GOIA 4CJFA 1S3XA 5M1FA 2VGNA 2HNYA 3KVGA 3VQAA 4JS4A 3P4IA 3LDNA 3SBTA 3ZETB 5HRPA 3S3OA 5C2DA 4JI7K 2FF6A 4DTUA 4J2BA 1I3AA 1KRPA 4B3MK 4BQLA 1JL1A 3O9SA 3DAWA 4DR4K 2OTLN 1CXUA 3J7ZO 3GG4A 3RVCA 4Z4IA 2GV9A 3C7NA 3WNFA 4DU4A 4DTPA 3G25A 3SUPA 3PIPL 1RDBA 1Z25A 4CK1A 5AQHA 4ILJA 3WNHA 3VENA 4B9LA 1DTQA 3HL8A 3CC7N 5CZ2A 1HKGA 4Q0BA 1NGIA 3R1XA 1W0HA 5AQIA 2IVPA 5KQDA 3L3UA 3DRPA 3CG7A 3C6AA 5A2QO 1EQYA 4DUZK 3ZT4A 1HPZA 1CXQA 4CIFA 3LANA 1VQ9N 2D5RA 3LPTA 2FBTA 4HUEA 4WCEL 4IG0A 3VEXA 3VF6A 3L2WA 2E8AA 4IO9L 1VQ6N 3VGKA 2HB5A 2BTFA 4C8NA 4B1VA 1LWFA 2QEXN 3MEDA 1NKEA 4JI4K 5KTQA 2XHBA 4DQ8A 1VQMN 4LH4A 4CHPA 3QLHA 3O80A 2F9TA 3VEZA 4DQPA 4FO0A 2XY7A 1X1PA 1HX1A 5KQ8A 5LL6Z 1KSPA 4F9OA 3JSMA 3LP0A 4MO5A 4ISGA 4M41A 2P9LB 4W5NA 2ZD1A 1UAXA 5M1PA 4ELVA 1JLBA 4M3RA 4CZLA 4E19A 4J8FA 3THYA 3VGMA 2YNHA 3TAEA 3M8QA 3QFPA 4FWLA 2VWKA 1LWCA 5FRMA 2DFFA 4AQYK 3QEXA 3OBYA 1XI1A 2ASOA 5AQLA 4M3ZA 1I94K 1IO2A 3MXJA 3S3NA 3NGYA 3NH0A 2G8IA 4HCBA 3VGLA 1SS6A 3DXKB 3UKUB 3VEYA 2P9KA 3LAMA 4BREA 4KHPK 1EP4A 1VQLN 1KD1O 3D6RA 4OLBA 3L0QA 1HKCA 2ATQA 4GVMA 5KGXA 3TABA 4FJIA 4CFCA 3DWLA 1VSMA 4KHUA 3KLEA 2PY5A 1OH5A 2OYQA 4JLHA 5JICA 1A5WA 1BIZA 5M1QA 4QS8A 3U3GA 1V4SA 2PBDA 4NXNK 3T69A 2VWBA 3E9OA 5AQMA 2NZTA 3RWUA 1KXPA 3SCXA 4H0XB 3MCPA 2B5JA 4YOYA 4O0JA 3EE8A 3SAGA 2Z1GA 2W6KA 4FJ5A 3OS2A 1TV6A 2P1JA 3NF7A 2HMPA 4K8ZA 4JI8K 5KPRA 1IBLK 4RG8A 2WBNA 3K9JA 1U4BA 3CQYA 4PUOA 3FZKA 3H45C 4CEFA 4LF8K 2QWRA 4EP4A 3EEQA 4CEBA 3H46O 5JLFA 1YVNA 4CEQA 5EY4A 4R5PA 4IFEA 3H3NO 5HROA 1UA1A 3O9QA 3DOKA 4A57A 3V9SA 4BC5A 1QVFM 4J2EA 3SMPA 3DXMB 5AQWA 4BR7A 3AA3A 3EE9A 2W41A 1R59O 4BDPA 1EWQA 4O8UA 2HBJA 4E3SA 3HPHA 4CJLA 4K41A 1HNZK 1KAXA 3VEVA 4AHRA 3RR7A 5KPTA 4X62K 5AQGA 4E7IA 1BOTO 4IFVA 1IBMK 3F5TA 3OYNA 1D9FA 3CPEA 1JKHA 3TSQA 4FJHA 3WXMB 4O55A 2D1KA 1FXXA 3AVJA 5AQFA 1BA0A 3H6EA 4FOEA 4GY2B 2G8VA 1QHTA 3T1YK 3BGRA 2ASMA 4HTLA 1KFSA 4NLCA 1D5AA 4OVLA 1SAZA 3ATVA 3SPZA 3CCQN 3VEOA 4LFCK 1WSIA 4FW2A 4AILC 4F4KA 3C7NB 3M3ZA 3ULEA 1JLAA 3AA2A 1RDAA 3HVRA 1NKCA 4RW8A 2D4WA 4IJNA 1N8RO 1QSSA 4B1WB 5M1NA 3PSFA 5CY4A 3DYAA 3T7ZA 2VQEK 3P39A 1GLJO 3VQPA 3CI5A 1BG3A 4CHNA 4FWMA 2YCHA 2O8DA 3GE1A 1HJOA 3V9WA 2Q36A 3G6EN 2HOEA 1WUAA 2RF2A 2E20A 4M7XA 4K8XA 5JLHA 4HUFA 4AM6A 3NAEA 4O5BA 3HP6A 4JNEA 1NU0A 4OKKA 2D0OA 4BDZA 5AQZA 2QXFA 3E9LA 2CH5A 2NRWA 3HTVA 4K43A 2F7TA 3OJSA 1XNRK 1RCHA 1SL1A 3Q7BA 5IT9O 2HVHA 1HNWK 4LD0A 4H5NA 4WQ4C 1YUWA 2YHYA 4NB4A 1GLDG 4FXDA 3OYIA 4PQUA 3THYB 1R0AA 3GDQA 1SUQA 4RWTA 3MDQA 4CZJA 5I42A 2NRHA 1E3MA 3EL2A 3IUCA 3VQEA 1LV5A 3AVGA 2OCEA 2P9KB 2Q31A 5F0XA 3QO9A 5HLFA 4FLUA 2IVOA 4BRIA 1E4FT 4GNIA 2V52B 4E1MA 3M8SA 4CJSA 2OANA 5BPMA 1NGFA 3ID6A 2EWSA 3ZCMA 1BUPA 4FK4A 4CW7B 4CD1A 3AAPA 2AA4A 4BC3A 4B1YB 4EFHA 4CJKA 2I7PA 4FJLA 1TKTA 2Z1HA 4LY7A 4DSJA 3SAFA 4DF4A 1HQUA 4IZ9A 2GWJA 4CJRA 1WAJA 4DWIA 3D7EO 2Y1JA 2V51B 4BR4A 2P5GA 1J9AA 4OGCA 1BO5O 4GV6A 4U7BA 2JGUA 2UXBK 1JCFA 4EAHD 1TKXA 3B6OA 2O8CA 2IS3A 2Z1IA 3RR8A 4FVUA 3SPYA 2Q0UA 3CXCM 5BN8A 2OZMA 4H4OA 4CF1A 2R7YA 1HQEA 1X9SA 2HF4A 3NVMA 4BRKA 4B9VA 1GLCG 1HKBA 2KLAA 4CF9A 3VQBA 2QM1A 1K8AO 3I55N 3BY5A 3DLEA 5C15A 2OZSA 4YORA 3NFAA 4DV2K 1VRTA 5C24A 3VERA 3OYHA 1WSGA 1OH6A 3WUHA 2A1RA 4DCHA 4H0PA 4W5TA 1XMQK 1QS4A 4OO1J 4JKFA 1RNHA 4DB3A 4FSVA 1IKWA 4DSKA 2WONA 3ZT2A 1NG9A 3O4WA 3PO4A 2HHHK 3LL3A 1NK0A 3O5BA 3VEWA 1X3NA 4JAXA 1TK0A 2G8HA 3IG1A 4OKEA 4BROA 2WOMA 1OVYA 4CF2A 4R79A 3J7YP 4M42A 3PV8A 2FBYA 3VOVA 4DKWA 5B8HA 1BCMA 5JVGL 2GEMA 4RW9A 4Y1CA 1IJJA 1HMVA 3PLAA 2Q0RA 3AVKA 3KJVA 3CPWM 2KTQA 3ULEB 4I2QA 4XEIA 4KH5A 2GUIA 3TR8A 1NGBA 2ZWHA 4B3SK 4IEEA 3HYFA 5C10A 1ZBHA 4LFBK 5HP1A 1NK5A 1N5YA 2P9SA 3FZMA 4BR5A 4BRQA 4HTUA 1XC9A 1FJGK 5BRHA 1S1XA 1REVA 5KRSA 3K58A 3V1RA 4DTJA 1QSYA 2E2NA 2O8DB 1JL2A 3D45A 3MWTA 3OYEA 4LH5A 3Q7CA 1S1UA 1HUXA 3PSIA 1ASVA 1QSLA 2BGGA 4G9ZA 1XWLA 2O4GA 4CECA 4H0OA 2EHGA 2YV0X 1CZ9A 2O8EA 2CGKA 3MN9A 3S9HA 4DSLA 5BR9A 4CERA 3VQQA 1BGXT 4OLAA 1WAFA 1NOZA 3BF3A 4OGEA 3O3HA 1KAYA 3WEEA 1S6QA 2UUBK 4XH4A 5J2MA 2UXCK 3L2QA 5AQOA 1TKZA 1YJ9N 1NJXA 4FJGA 4KAZA 2OA8A 3SUQA 3WQTA 1ASUA 4KI4A 1RBUA 3ZSXA 3DRRA 4CJUA 4BVOA 2D0BA 4CE9A 2YHBA 3CMAN 1JXEA 1K6YA 4OX9K 2P9UA 2HHTA 1BISA 4GVEA 3K57A 4NCBA 3UKRA 4BRNA 1KVCA 4A61A 5HL7L 3LP3A 3SQ4A 2IC3A 5E26A 3FZFA 1S1VA 2XY8A 4ILHA 3KK7A 3VQ5A 2ZF5O 1A5VA 1IKYA 5AQVA 1Z26A 3AY9A 4I7FA 4AHCA 5JMVA 4Z4EA 4GV9A 3C95A 1BI4A 1BQMA 2RN2A 3SUNA 4JN4A 4CJ3A 1SZ2A 2GWKA 2A42A 4FJ9A 4BC2A 4IO8A 3M8PA 1CLQA 2O8CB 3ZSOA 4KBOA 3OYFA 4DTRA 3HP9A 3HSCA 4Y1DA 4B1UB 3AVIA 1NGHA 2YNIA 4NO7A 4BVPA 4TSXA 4LF7K 1SQKA 3LZIA 1BU6O 2FLOA 3J81O 3ENBA 3KLIA 4CF8A 1YHQN 4M3YA 3KLHA 3WXKA 1GOAA 3HM9A 4CEZA 1VQKN 4BR0A 1HLUA 4B1XB 2KW4A 3H3OB 1T6DA 4MLEA 1BQNA 5JS2A 3TAQA 3U8XA 5CYMA 4MDBA 2A40A 3IRXA 2NNWA 3UB5A 1MWMA 3FFIA 2Y1IA 5EXWA 3FE1A 3OYMA 4A5AA 1HRHA 1WNSA 4J2DA 4DR2K 4YY3K 4AHSA 5M1KA 1K8KA 1C0FA 4G1QA 4FJMA 3NGIA 3VF4A 1Q9XA 3LDPA 1WBDA 2ETJA 1IV0A 1NNEA 1B9DA 3BZKA 1VSJA 1RT5A 4OPHA 4ID5A 1N36K 3GL1A 4WE1A 5I9EB 4J2AA 5BN9A 3JS6A 1XHZA 5DM6L 3FZHA 4N56A 4EZ6A 3QFUA 2D0PA 1QE1A 5KPZA 2NRVA 3V6DA 2IVNA 2HSTA 3NDKA 1RDUA 3QB0A 4FJKA 4FWPA 5GIOA 3ENHA 2KFZA 4CJ5A 3CHWA 3SMSA 4W5QA 3LDLA 3LPUA 1HPMA 3W0LA 3LZJA 3A5OC 4JRQA 1SKRA 4HVJA 3A5LC 4IEIA 4MQ3A 4KTWA 4CK3A 3O3GA 2FSNA 2QKKA 3CERA 2P9SB 1Q81O 1NM1A 3CC2N 4X64K 4Z0UA 1Q9YA 1NGAA 3VTIA 5DM7L 3EN9A 1QZ6A 1ZBUA 4K42A 2HHWA 5E84A 2DFHA 2RKIA 1WB9A 2O8EB 5HRRA 4LFAK 4DLGA 3LP2A 1D8YA 3QBWA 1KC8O 5CR4A 1WN7A 3C6UA 3CCSN 2F8SA 2VGMA 3CQXA 4PKGA 1QVGM 3KKRA 4BACA 1T6CA 3E66A 5HOOA 3WEEB 3ISNC 3AVHA 2O8BA 2HBMA 3CFPA 2WFBA 1D4XA 2F4VK 5E41A 1M90O 1RILA 1Z6RA 2E4LA 1WSFA 2VWJA 2PYLA 2UYTA 4CHZA 1YJWN 2YHXA 1GLLO 2VG7A 3IKMA 3TTCA 1WBBA 4KKOA 3NE6A 2HW3A 2P9UB 3J80O 3UKRB 4GV3A 3M1FA 2UU9K 3EYZA 4H5WA 4CBWA 4DR1K 4WFBL 1YF5L 3U9ZA 1TVRA 1W2BM 3ZSYA 3VPZA 2X6SA 4FK2A 2FBXA 4XIUA 4BG8A 4IWVA 1EO1A 3V9XA 1UOCA 4ISFA 4DFMA 3CIPA 1IBKK 1BI4B 3VQDA 3R9PA 4X66K 3QEPA 4FJ8A 3AVCA 3OBWA 5F1XA 2QKBA 3MAQA 4B3OA 4JI6K 2GTDA 4JKCA 1TL3A 3CJBA 3MX2A 4DS4A 4UQGA 3SNNA 4DV7K 1RT2A 3T1AA 2EX3A 4YDUA 4JKBA 3P38A 4DTSA 3G71N 3RMCA 1CZAN 4NYFA 4OPJA 1TK5A 1ASWA 2UXDK 2KZZA 3MN5A 3WXJA 2E88A 4B3TK 1RT3A 3LDOA 3NF6A 3QETA 5J2NA 4DR5K 3QINA 2HF3A 4M7YA 3RMBA 4C8LA 3SQ0A 1JCGA 2X74A 4JS5A 2ASPA 1U48A 2XO7A 3LDQA 3AARA 3THVA 3O1BA 2A1SA 3SQ1A 1J53A 2BH1A 2FBVA 3SBGA 4KH4A 3I56N 1TL1A 1FW6A 1GOCA 4A5BA 4JI3K 3EZWA 2X6NA 1K8KB 4FVMA 5AQPA 4KO0A 4CVNE 4E7JA 1YITN 3V81A 1XQSC 2HBLA 4F8RA 4BRLA 1NMNA 3KWIA 2XRIA 1IKXA 1RFQA 3UE5A 2OPRA 3SLCA 5TKYA 3CCVN 4CEAA 2W42A 2I5JA 3C65A 5FROA 4DLEA 1IH7A 1IKVA 1NGCA 3VN5A 1NGEA 4KH6A 5LJWA 4DSFA 3MEGA 1Q86O 4BRDA 4FLVA 4ID1A 1P8ZA 3QDKA 4DV4K 3A5MC 4ELTA 5BPLA 2ZQBA 1OH7A 3HK2A 1VQ5N 4C8MA 3VQCA 4KTQA 4M3XA 1C1BA 1N6QA 4L3QA 4I9LA 1U47A 3I0RA 3M5RA 4LF6K 3B8AX 3L4QA 4JKGA 3F9MA 1NJIO 1TYQA 4RW6A 4FYDA 4CBUA 4FLXA 3AO4A 1U6ZA 3WNEA 1XUPO 3ZX3A 2RHKA 3MECA 3ZT3A 3CQ8A 3LALA 3HOTA 1X9WA 4YOXA 3FGUA 4CEOA 1C0GA 5D3GA 3O1WA 4IDKA 1VQ8N 3OYGA 1CZBA 3TU5A 4AF1A 5BRDA 4ZTJA 4B9MA 2KFNA 4DV6K 3D0PA 3OY9A 3H08A 4DFKA 2NRXA 3CJ1A 5HRNA 1NGGA 2YKMA 3P1GA 3CD6N 4BGAA 5CYQA 1WSHA 3WNGA 1VSIA 2I7NA 5LJVA 1NK4A 4DV5K 2QTDA 4CD3A 1M1KO 4FZZA 2OPPA 4NLBA 1MU2A 2DFEA 3HM8A 2O8BB 5AQXA 4BRHA 1Z05A 4E7KA 4QAGA 3THWA 4CEDA 1L3UA 3DI6A 3CJCA 3QMLA 4M45A 4NCAA 3HXMA 5GAHP 4JEPA 4KB1A 4H5VA 1UWBA 2JWKA 3O6WA 4OPAA 3VF2A 4PL7A 4CJTA 4WQ5C 3ZSQA 2F8TA 1TUUA 1JLFA 2VQFK 4CGFA 3DLGA 2OTJN 1JLEA 3LWLA 2HVIA 4GKJK 3TTDA 4H4MA 4C1NI 4FW1A 5GINA 3VQ6A 1JJ2M 1TAQA 1P90A 2Q1NA 1TGOA 3E01A 4WQ4A 4IKFA 4KHSA 3U4LA 4UY8O 1YXQA 1YTUA 2DTUA 2CH6A 3HPOA 3JYTA 2E2QA 3L2VA 3N4QA 4PKHA 2YNGA 1QTMA 2YHAA 1Q7YO 4ILGB 4YOTA 4DQIA 3L3VA 4H0YB 4FM2A 4JD2A 2QWOA 4FJJA 1N32K 4BRMA 2DPNA 4DSEA 1BA1A 2VCPA 3SYZA 3F73A 1U45A 4FZXC 4CZMA 4H8KA 4XH5A 1QHAA 3QERA 1VQ4N 4CZKA 1FKPA 3SAHA 3ASMA 4QCLA 3OYLA 4ELUA 3TSPA 4CJ4A 3AA4A 4LF5K 4M3UA 1VQPN 1BCOA 2H3GX 3TAMA 4H5RA 2P5OA 3LDSA 5J2QA 4M3TA 3OYKA 1T03A 3BEXA 1VSDA 3ZEUA 1ATNA 4CESA 1LWEA 4JI1K 3BP8A 1G99A 1JXBA 2NRRA 4FCYA 3FR0A 4AHTA 4BC4A 3SV4A 1S1TA 1KFDA 4U67L 3H1QA 3OHRA 5DMRA 1VSFA 3R3LA 4DMNA 2B6AA 4KHNA 1RBRA 1ZC6A 2OPQA 3DMJA 1SL2A 1S9EA 1ZBIA 1G15A 4CI6A 5AQJA 4FLZA 4KFBA 3OS1A 2DY4A 1S72N 3J8AA 3TI0A 2Q2RA 1RTDA 1MA9B 1VQ7N 4N41A 3OYAA 4NXMK 4V19S 4WF9L 3VESA 3QIPA 2QWQA 3R8EA 3CFOA 5LY3A 1BDGA 2Z1JA 2E6LA 4JKGB 3C6HA 3O4QA 2QW9A 3T1HK 1TYQB 1DEJA 1X9JA 5BRFA 4X65K 3G0ZA 2YHWA 4YHHK 3SUOA 4BG9A 1VQNN 3HVTA 1WOQA 3KTQA 3MMVA 3HJFA 3CCMN 5FPNA 4PL8A 3K5MA 3WT0A 2P9PA 5TKWA 2E1ZA 3ZT0A 2RE2A 1J54A 1IG8A 2QWMA 4RW4A 1RT1A 2YJFA 1NJYA 3V1OA 3C6TA 4FWQA 1DLOA 4CGIA 4FOIA 4JHDA 1O1WA 1KLMA 4IOCL 2P9IA 3WXIA 4B9UA 5JVHL 3VQ4A 3DM2A 2PYJA 2F96A 3KWGA 3SJJA 3WQUA 4F3TA 4BDYA 3P5JA 3OJUA 4Z4HA 4MO4A 5KI6A 2Q97A 2E2OA 1YJNN 1N34K 4CJEA 1K73O 1XNQK 2VG6A 1Y64A 2E2PA 4CFBA 3THWB 5AR0A 2BUPA 4JRPA 1LW0A 2HHXA 3AVLA 3A8YA 1W9HA 3KIOA 2A41A 4BR9A 1RT6A 4CZHA 3S3MA 4I9QA 4M63C 4E0DA 1TK8A 3QICA 4CGJA 1BL3A 1C0MA 1DT9A 5HRSA 1C0UA 1VSEA 1LAVA 1RDWX 5AQYA 1RTIA 2HNZA 5AQQA 2NRTA 3C94A 5M1OA 4DR3K 3CCEN 1GLFO 4ISEA 1YAGA 4A59A 4O0IA 4DQSA 2HMIA 3AO1A 2O4IA 4AH9A 5IWAK 3CCLN 2D0AA 5FPMA 4BRFA 3IS9A 3SV3A 1NLVA 1U2VA 3I33A 4DS5A 4Z4FA 1C1AA 4CIGA 3RRGA 3N4PA 3KK3A 1BIUA 1ITGA 1RGIA 5FDLA 4EHUA 1TUYA 3AVNA 3PO5A 4KB0A 2V7ZA 3D2EA 1GLBG 4CHYA 5AFUH 3TWHA 1VSLA 5KRTA 4JD2B 3QESA 1JLGA 2HHVA 1C0TA 1ESVA 1HYVA 1L3SA 2AJQA 3T19A 4CGGA 5BREA 3KD5E 3CMEN 1T7PA 4E1NA 3K2PA 3SK3A 3VA0A 4KHQA 4CJPA 3HRGA 1NGJA 3O9TA 3GBTA 4EIAA 1QQCA 2ZGYA 1ATRA 2P9NA 4Y0WA 4JI5K 3A2FA 1MDUB 4CBXA 4CZGA 3EKUA 4N76A 4KHYA 5EVZA 4KHWA 1VAZA 2F9WA 2QWLA 4QS9A 3ZEUB 1NBWA 3NCIA 1T8EA 4H03B 2J4RA 3I8DA 4F2SA 3RRHA 1B9FA 3F9KA 2ZJQL 3VQ9A 3U6FA 5EOYA 5CZ1A 4F3OA 4JI0K 5ADXA 4RCHA 4CHQA 3NH2A 4DV1K 1MWKA 1N33K 2GELA 4XH1A 4BE1A 4PY5A 2KHOA 3L4IA 3CJ7A 3ZSWA 4EHTA 3VTHA 1WLJA 1NK6A 1GLAG 1HYSA 1ZXOA 2QWNA 4FM0A 4HHTA 3NF9A 1Q18A 3QNOA 3E1YA 4CFDA 1NK7A 4E89A 4YNQA 3CCJN 3DLLL 4DTNA 3BDPA 4JI2K 3TTFA 3V1QA 5AFUA 1B92A 3DLRA 3IDHA 3QIOA 4KRFA 1OVQA 4DU3A 3TANA 3FLCO 4BRAA 1DGKN 2YX6A 4ZTFA 3NMUA 3R6MA 4QOZB 4LF4K 5CE3A 3S41A 2KZMA 3ZLJA 1OKJA 1VHXA 3LM9A 4CZIA 4M3WA 2PFUA 3BUZB 3P31A 1WSJA 3DLBA 3AVAA 3PIOL 4HUGA 3IAYA 4PKIA 2P9PB 4FLWA 3EZ5A 5FRNA 2FF3B 4NCGA 2NRZA 1XMOK 5ELZA 2VYPA 4CF0A 1RDDA 4IXCA 1KVAA 4JHDB 4YDUC 2PZSA 3J7AP 2O8FA 1BWFO 2P9IB 3F2KA 5C0YA 2IGIA 4CHOA 3RSEA 4GMJB 5EX5A 3AGKA 1W7AA 3K0SA 4FZYA 5AQSA 4EP5A 3HSTB 3O3FA 4A2BA 1J6ZA 1RTHA 4WFNL 4O8KA 4KPYA 3SQ2A 4IBNA 4JV5K 1GOBA 3LWMA 3O9RA 3LP1A 1H1VA 4CFAA 1S5JA 3H1VX 2QA4N 3THXA 3RMDA 2G8WA 3VQ8A 2UUCK 4C1NK 1HNVA 4DQQA 3DLKA 4FLTA 1EKEA 3QEWA 2P51A 3AO2A 3K5LA 3ALYA 4GW6A 1HNIA 1J5OA 4W5RA 3MCAB 3AV9A 4OKJA 4CJVA 1VSHA 4KTZA 5F2RA 4CCHA 3BF1A 4CJQA 3AVMA 2ITMA 3K5NA 3IMXA 2GUPA 5MLCQ 1S22A 2YNFA 1LAWA 1HR0K 1NMDA 1ILYA 1EXQA 3G10A 4JYAK
chains in the Genus database with same CATH topology
3VENA 3CJCA 3QMLA 2CGKA 3MN9A 3CC7N 1HKGA 1U2VB 5BR9A 1NGIA 5GAHP 3R1XA 4JEPA 4JK8A 4H5VA 5AQIA 2IVPA 2JWKA 4IOXA 3ATUA 5KQDA 3O6WA 4OPAA 3VF2A 3C6AA 4PL7A 3L6QA 4WQ5C 1EQYA 5BPNA 4JKAA 3BF3A 1JCEA 1TUUA 3D2EB 1VQ9N 1KAYA 2OTJN 5AQRA 3WEEA 4WCEL 4XH4A 3CF5L 3TTDA 3VEXA 4C1NI 4CJ7A 3VF6A 5GINA 1JJ2M 1P90A 2E8AA 2Q1NA 5AQOA 4IO9L 1YJ9N 1VQ6N 3VGKA 2BTFA 4WFAL 3A5NC 4WQ4A 3WQTA 4B1VA 2QEXN 3U4LA 4UY8O 4WYBA 4BVOA 1YXQA 2CH6A 4DQ8A 1VQMN 2E2QA 2PAVA 3CMAN 4H0VB 3N4QA 4PKHA 2P9UA 2P9NB 3O80A 2F9TA 4GVEA 3VEZA 4FO0A 5FPEA 3UKRA 1X3MA 1Q7YO 3FFKB 4BRNA 5C2FA 2QXLA 5GAEP 4A61A 3I8BA 5HL7L 1HX1A 4ILGB 5KQ8A 4YOTA 4F9OA 5E26A 3FZFA 4MO5A 4H0YB 4ISGA 4ILHA 3KK7A 5AZJA 4BRPA 2P9LB 4JD2A 5M1PA 2ZF5O 2QWOA 2YI1A 3TPQA 4CZFA 4BRMA 2DPNA 5AQVA 2E1YA 4CZLA 4J8FA 3VGMA 4MDAA 1BA1A 3QBXA 3VETA 3AY9A 2VCPA 2A5XA 3D2FA 3QFPA 4FWLA 5JMVA 1K9MO 1W97L 3OBYA 4GV9A 2ASOA 5AQLA 3FZLA 4XH5A 4CZMA 1QHAA 4JN4A 1VQ4N 4CZKA 1SZ2A 2GWKA 3SAHA 3VGLA 1SS6A 2A42A 3DXKB 3UKUB 4FWOA 3VMFB 3VEYA 2P9KA 3TSPA 3W3DA 4BC2A 4BREA 4IO8A 1VQPN 3CETA 1VQLN 3ZX0A 1QQOA 4JKDA 1KD1O 3D6RA 1Q82O 2H3GX 3L0QA 4KBOA 3WXLA 1HKCA 4H5RA 1VQON 2FXUA 3DJCA 3DWLA 3BEXA 3HSCA 4FWNA 3ZEUA 1ATNA 4B1UB 3BP8A 1NGHA 1G99A 2NRRA 4NO7A 4O5FA 4BVPA 2FSJA 1SQKA 1BU6O 3FR0A 3MX5A 2FLOA 5JICA 4BC4A 3ENBA 4BRGA 5M1QA 4QS8A 4U67L 1YHQN 5C12A 3H1QA 1V4SA 2PBDA 3OHRA 3WXKA 4CZEA 3T69A 1VQKN 2VWBA 3E9OA 4BR0A 5AQMA 3EKSA 1E4GT 1HLUA 2NZTA 3H3OB 3R3LA 4B1XB 1KXPA 1T6DA 4MLEA 1ZC6A 3U8XA 4H0XB 4LC9B 4MDBA 5CHIA 4CI6A 3MCPA 2A40A 4YOYA 5AQJA 2NNWA 3EE8A 3UB5A 1MWMA 3SAGA 4K25A 5EXWA 2HMPA 3FE1A 2ZJRL 3O9UA 4A5AA 5KPRA 1S72N 2WBNA 3K9JA 3J8AA 4BGBA 1ATSA 3CQYA 2Q2RA 1MA9B 1VQ7N 3FZKA 3H45C 3TSUA 2QWRA 3H46O 5JLFA 1YVNA 5M1KA 3K9KA 5EY4A 1K8KA 4IFEA 3H3NO 3MWPA 1C0FA 4WF9L 3VF4A 3VESA 3LDPA 3O9QA 2GX9A 4A57A 1T3VA 2QWQA 3C0BA 3R8EA 4BC5A 5LY3A 1QVFM 1BDGA 4JKGB 3SMPA 3C6HA 3IFRA 3DXMB 5AQWA 4OPHA 2HBKA 4BR7A 2QW9A 3ID8A 1TYQB 1DEJA 1XC3A 1X9JA 2ZGZA 3GL1A 3EE9A 4IJAA 5BRFA 2W41A 5I9EB 1R59O 4I6MA 3MN7A 4BY9C 3RSEB 2YHWA 4O8UA 2HBJA 4BG9A 1VQNN 5BN9A 1WOQA 3JS6A 3MMVA 2WUSA 3CCMN 5DM6L 5FPNA 4K41A 3FZHA 1KAXA 3VEVA 3QFUA 3HI0A 2D0PA 4PL8A 3WT0A 2P9PA 5KPTA 5KPZA 5AQGA 5TKWA 2NRVA 2E1ZA 2IVNA 2HSTA 1RDUA 2RE2A 3QB0A 1BOTO 1IG8A 2QWMA 4FWPA 3F5TA 5GIOA 2YJFA 3CPEA 3ENHA 3TSQA 3CHWA 3SMSA 4FWQA 5GAGP 3LDLA 4BR2A 3WXMB 1HPMA 5AQTA 4FOIA 4JHDA 3W0LA 3A5OC 4IOCL 2P9IA 3A5LC 2D1KA 4FWSA 5AQFA 4IEIA 1BA0A 3WXIA 4AM7A 3H6EA 5JVHL 2FSNA 4FOEA 4GY2B 3CCRN 5AQNA 3CERA 3CCUN 2P9SB 2ASMA 1V4TA 4HTLA 4B9QA 2JWLA 1Q81O 3KWGA 2AP1A 4NLCA 4JK9A 3WQUA 1SAZA 4MO4A 3ATVA 4MLHA 1NM1A 2Q97A 3CCQN 2E2OA 3VEOA 3CC2N 1YJNN 1K73O 1ZBSA 1NGAA 3VTIA 5AZIA 5DM7L 3EN9A 1QZ6A 3C7NB 3M3ZA 4FL9A 3ULEA 4K42A 5E84A 3HOSA 1Y64A 2E2PA 4H5TA 4FWKA 1QQMA 5AR0A 2BUPA 2D4WA 4IJNA 1NWKA 1N8RO 4B1WB 2IIRA 3A8YA 3ZETA 4BR9A 2A41A 5M1NA 3QBWA 1KC8O 5CR4A 4CZHA 3T7ZA 4M63C 3P39A 1O13A 3QICA 3CC4N 3CCSN 1GLJO 3CI5A 1BG3A 1DT9A 2VGMA 3CQXA 4PKGA 1QVGM 4FWMA 1RDWX 2YCHA 5AQYA 5AQQA 4YOWA 3HBTA 1T6CA 3E66A 3GE1A 1HJOA 2NRTA 2Q36A 3WEEB 5HOOA 2HOEA 1WUAA 3G6EN 2HBMA 2E20A 4WQ5A 5M1OA 4M7XA 3CCEN 1GLFO 4ISEA 1YAGA 4A59A 2WFBA 5JLHA 1D4XA 4AM6A 3LM2A 1M90O 4JNEA 1Z6RA 4IOAL 2D0OA 3CCLN 5FPMA 4BRFA 2UYTA 5AQZA 1YJWN 3E9LA 2YHXA 3NVKA 1GLLO 2CH5A 1NLVA 1U2VA 2NRWA 3IKMA 3TTCA 4A62A 3HTVA 3I33A 4K43A 5AQKA 2F7TA 2P9UB 3EO3A 3UKRB 4GV3A 3M1FA 3Q7BA 2FSKA 3N4PA 4H5WA 4CBWA 1RGIA 4WFBL 4EHUA 1TUYA 1YF5L 2V7ZA 3D2EA 3U9ZA 1GLBG 1W2BM 3A0IX 5AFUH 3VPZA 5AZJB 4JD2B 4E1JA 4BG8A 4H5NA 4WQ4C 1YUWA 2YHYA 4NB4A 4IWVA 1GLDG 1ESVA 1EO1A 3O08A 5BREA 3GDQA 4ISFA 4RWTA 3D2FB 3CMEN 3MDQA 4CZJA 3CIPA 4RTFD 2NRHA 5GADP 3SK3A 3R9PA 4BRCA 3EL2A 3IUCA 4YOUA 3AAQA 1NGJA 3HRGA 3E9PA 3O9TA 2NLXA 3GBTA 3JXUA 5AQUA 4EIAA 3OBWA 5F1XA 2ZGYA 1ATRA 2P9NA 4BQZA 4Y0WA 2P9KB 2Q31A 1MDUB 4JK7A 3U9DA 4CBXA 4CZGA 3EKUA 2KKZA 1NGDA 5F0XA 1DKGD 2GTDA 4C23A 4JKCA 3OW2M 2IVOA 3CJBA 3MX2A 5GIPA 4BRIA 1E4FT 4GNIA 2V52B 5EVZA 2W40A 1GLEG 1VAZA 2OANA 2F9WA 2A6AA 4YDUA 5BPMA 2QWLA 3P38A 4JKBA 1NGFA 1T44A 2P9LA 1NBWA 3ID6A 4QS9A 3ZEUB 3G71N 1CZAN 2EWSA 3CJ9A 4H03B 3MN5A 2J4RA 4FWRA 1BUPA 3WXJA 2E88A 2ZJPL 2ZJQL 4CD1A 5EOYA 3AAPA 2AA4A 3LDOA 4H0TB 4BC3A 4B1YB 5ADXA 4EFHA 4RCHA 2I7PA 4QS7A 1MWKA 3O8MA 2WC9A 2HF3A 3SAFA 2GELA 4M7YA 4XH1A 4A2AA 2KHOA 3L4IA 2GWJA 3CJ7A 4IZ9A 4EHTA 3VTHA 3D7EO 2V51B 1GLAG 3DXKA 1JCGA 3UKUA 4BR4A 1BO5O 1ZXOA 3KHYA 4GV6A 4U7BA 1JCFA 2ASPA 4EAHD 2QWNA 3LDQA 3AARA 3KZBA 3O1BA 4FVUA 1Q18A 4PHTX 3E1YA 2Q0UA 4FPAA 2CGJA 2V7YA 5BN8A 4DHYA 3CXCM 2BH1A 3SBGA 3CCJN 4KH4A 3SJHA 3I56N 3DLLL 1YIJN 2HF4A 3NVMA 2QWPA 3ENOA 1GLCG 3TTFA 4BRKA 5FPDA 1HKBA 4A5BA 5AFUA 3EZWA 3IDHA 2KLAA 1K8KB 5AQPA 3FLCO 2QM1A 1K8AO 3I55N 4BRAA 1DGKN 2YX6A 5C15A 3NMUA 3R6MA 1YITN 1QZ5A 4YORA 1XQSC 3ZX2A 2HBLA 2QI2A 4BRLA 4FPBA 3S41A 5CE3A 3KWIA 1OKJA 3LM9A 3VERA 4CZIA 4I6MB 1RFQA 2PFUA 3UE5A 3SLCA 3BUZB 3P31A 4JKHA 5TKYA 4YOVA 3CCVN 1KQSM 4HWIA 3C65A 3WUHA 1NGCA 4B1ZA 4DCHA 1NGEA 4KH6A 5LJWA 1Q86O 3PIOL 4H0PA 4BRDA 4PKIA 2P9PB 1P8ZA 2FF3B 3QDKA 3A5MC 4OO1J 4JKEA 5ADXH 3MN6A 5BPLA 4JKFA 2NRZA 1VQ5N 4DB3A 4FSVA 1LOTB 3MK6A 2A3ZA 4L3QA 5ELZA 2CGLA 2VYPA 3AGRA 5H1SQ 3O4WA 3M5RA 3LL3A 3B8AX 4IXCA 3L4QA 3O5BA 4JKGA 4JHDB 3F9MA 3DXMA 3VEWA 3CJAA 4YDUC 1BWFO 1X3NA 2P9IB 1TYQA 3F2KA 4JAXA 4Z94A 1NJIO 5C0YA 3HZ6A 2YJEA 4BROA 4IDHA 3RSEA 4CBUA 1OVYA 5EX5A 3AGKA 1LCUA 1QQNA 4R79A 5AQSA 1KAZA 1U6ZA 1YI2N 3G4SN 4A2BA 3VOVA 1XUPO 1J6ZA 2RHKA 3ZX3A 4DKWA 5B8HA 5JVGL 4WFNL 4O8KA 3ZYYX 2GEMA 3HOTA 3OA9A 4YOXA 3FGUA 1IJJA 3PLAA 2Q0RA 1C0GA 3O9RA 3CPWM 3O1WA 3M6GA 5AZIB 1H1VA 1VQ8N 3ULEB 3H1VX 4AF1A 3TU5A 5BRDA 2QA4N 3GOIA 1S3XA 4C1NK 4XEIA 5M1FA 2VGNA 2NRXA 3CJ1A 4KH5A 3KVGA 1NGGA 3P4IA 3LDNA 3SBTA 3ZETB 3CD6N 5C2DA 1NGBA 2ZWHA 4BGAA 2FF6A 4IEEA 5C10A 2I7NA 5LJVA 2P9SA 3FZMA 4BR5A 2QTDA 4CD3A 4BRQA 3MCAB 4BQLA 1M1KO 5BRHA 3O9SA 4NLBA 2E2NA 5F2RA 3DAWA 3BF1A 3MWTA 3HM8A 5AQXA 2OTLN 3Q7CA 4BRHA 1HUXA 2ITMA 3J7ZO 3GG4A 3RVCA 3IMXA 2GUPA 5MLCQ 3C7NA 1S22A 4G9ZA 1Z05A 3G25A 3PIPL 1NMDA 1ILYA 5AQHA 4ILJA 4H0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2K A;  3HOT A;  5HOO A;  2F7T A;  4MDB A;  3K9J A;  4U7B A;  5CR4 A;  4MDA A;  3K9K A;  4R79 A;  3HOS A; 
#chains in the Genus database with same CATH topology
 2B4J A;  3TAR A;  1U2V B;  1KVB A;  3KLG A;  4JK8 A;  3OYC A;  3VQ7 A;  4CGD A;  2FC0 A;  4IOX A;  3ATU A;  3L6Q A;  3OYD A;  3CFR A;  5BPN A;  3NGZ A;  4JKA A;  2HHQ A;  1JCE A;  1RBS A;  3D2E B;  3CM6 A;  4PWD A;  5AQR A;  3CF5 L;  1TAU A;  4CJ7 A;  4FLY A;  3KK1 A;  1RDC A;  3NHG A;  2YKN A;  1RTJ A;  3ITH A;  2G8U A;  4FM1 A;  4WFA L;  3A5N C;  2IOC A;  1VSK A;  2Q3S A;  4WYB A;  5AJ3 K;  4Z4G A;  2PAV A;  4H0V B;  3HPG A;  1S9G A;  2P9N B;  5FPE A;  1X3M A;  3FFK B;  3L2R A;  4MFB A;  5C2F A;  2QXL A;  5GAE P;  3RTV A;  2UUA K;  3I8B A;  1Y97 A;  4DQR A;  5JS1 A;  2KQ2 A;  5BR8 K;  5AZJ A;  4BRP A;  1U04 A;  2YI1 A;  3TPQ A;  4CZF A;  2JLE A;  2E1Y A;  4ZHR A;  4MDA A;  3QBX A;  3VET A;  1U49 A;  5I3U A;  2A5X A;  3D2F A;  1K9M O;  2BDP A;  1W97 L;  3FZL A;  4PA1 A;  4L8R B;  4CK2 A;  1YVU A;  3VMF B;  4N47 A;  4FWO A;  1EET A;  3W3D A;  4HCC A;  4AHV A;  3KLF A;  3AA5 X;  3CET A;  4FJN A;  4NYN A;  1EWR A;  1QQO A;  4JKD A;  3ZX0 A;  4DG1 A;  1Q82 O;  3WXL A;  2G8F A;  1VQO N;  2FXU A;  3DJC A;  1JLC A;  2NUB A;  4FWN A;  3NF8 A;  4BWM A;  4O5F A;  1LW2 A;  2FSJ A;  1X9M A;  5DK5 A;  3V9U A;  4B8C A;  3MX5 A;  4BRG A;  3MXI A;  4Q5V A;  2XY6 A;  2E5L K;  5C12 A;  2W6L A;  4RW7 A;  4CZE A;  3EKS A;  1E4G T;  3KKS A;  5J2P A;  3PX0 A;  4CJW A;  2IDO A;  3OTO K;  4LC9 B;  5CHI A;  3DLH A;  1YT3 A;  1HJR A;  4K25 A;  3ZSV A;  2ZJR L;  3O9U A;  3CYM A;  4OPK A;  2IAJ A;  2HHU A;  4BGB A;  3SI6 A;  1ATS A;  1KTQ A;  3QEV A;  3DOL A;  3QEI A;  1HNX K;  3TSU A;  4IFY A;  5LMU K;  3ULD A;  4OJR A;  5LMN K;  3K9K A;  3OYB A;  3MWP A;  2ZM6 K;  2GX9 A;  5HBM A;  1T3V A;  3C0B A;  3OS0 A;  3NBP A;  1FK9 A;  1DTT A;  4KI6 A;  3IFR A;  1KLN A;  2HBK A;  2O8F B;  3ID8 A;  1XC3 A;  4IJA A;  2ZGZ A;  1SKW A;  3AVB A;  4I6M A;  3MN7 A;  4BY9 C;  3RSE B;  4N5S A;  4B9N A;  2WUS A;  3HI0 A;  1D9D A;  1SKS A;  1ZYQ A;  1BHL A;  3V4I A;  4BWJ A;  4GKK K;  3PUF A;  3OVN A;  1JLQ A;  1IG9 A;  4DSI A;  2D0C A;  3BZC A;  3THX B;  1NOY A;  4LF9 K;  2G8K A;  4FK0 A;  5GAG P;  4BR2 A;  3AO3 A;  5AQT A;  4W5O A;  1NK8 A;  4FWS A;  4AM7 A;  5SZT A;  4C8K A;  2WTU A;  3CCR N;  3I0S A;  5AQN A;  3CCU N;  4YFU A;  1V4T A;  4B9Q A;  2JWL A;  1XHX A;  1J5E K;  2AP1 A;  4JK9 A;  3K59 A;  4O44 A;  3ZSR A;  5EU7 A;  5KGW A;  4MLH A;  3B6P A;  1I39 A;  3TAF A;  5C25 A;  1FKO A;  3ZT1 A;  1ZBS A;  1RT4 A;  5AZI A;  4B8A B;  4FL9 A;  3HOS A;  3RMA A;  4KV8 A;  1RBT A;  4H5T A;  4K0K K;  4DV3 K;  4FWK A;  1QQM A;  1NWK A;  4DV0 K;  3ZSZ A;  2IIR A;  1A5X A;  3ZET A;  4Z4C A;  2HND A;  4DTX A;  1O13 A;  1ZBF A;  3CC4 N;  4DU1 A;  1S6P A;  4YOW A;  3HBT A;  4WQ5 A;  4EZ9 A;  1RT7 A;  2QK9 A;  2HHS A;  3LM2 A;  3NH1 A;  3U3Y A;  4IOA L;  1RBV A;  4DFP A;  3NVK A;  3P83 D;  4IG3 A;  4CIE A;  4A62 A;  5AQK A;  4FJ7 A;  3UIQ A;  3T3F A;  3EO3 A;  2FSK A;  3A0I X;  5AZJ B;  4CGH A;  3MEE A;  4E1J A;  4DUY K;  4FJX A;  4DF8 A;  1S1W A;  3O08 A;  4C8O A;  3D2F B;  4CEE A;  4RTF D;  5GAD P;  3OYJ A;  4BRC A;  4YOU A;  4BE2 A;  3AAQ A;  3E9P A;  2NLX A;  3JXU A;  5AQU A;  4E7L A;  3HT3 A;  4BQZ A;  1VK0 A;  4B9S A;  4JK7 A;  3U9D A;  3OW2 M;  4DTM A;  2KKZ A;  1NGD A;  1SL0 A;  1DKG D;  1ZBL A;  4C23 A;  3DRS A;  5GIP A;  2W40 A;  4B9T A;  1GLE G;  3HO1 A;  2A6A A;  1NJW A;  1T44 A;  2P9L A;  3JAM O;  4F2R A;  1Q8I A;  4DTO A;  3CJ9 A;  5SWM A;  3O4N A;  4FWR A;  2ZJP L;  1C6V A;  4H0T B;  1HYZ A;  4QS7 A;  3O8M A;  2WC9 A;  5K14 A;  1F21 A;  4A2A A;  1L3V A;  3DXK A;  3UKU A;  3TAP A;  3KHY A;  4LSN A;  3KZB A;  2OPS A;  4PHT X;  4FPA A;  2CGJ A;  2V7Y A;  1T05 A;  4DHY A;  1L3T A;  3LAK A;  3SJH A;  1YIJ N;  2QWP A;  3ENO A;  5FPD A;  3KK2 A;  2ZE2 A;  2RPI A;  3K5O A;  1NK9 A;  4DR7 K;  3AO5 A;  5FLX O;  1QZ5 A;  3ZX2 A;  2QI2 A;  4BE0 A;  4FPB A;  3VA3 A;  1NJZ A;  4DR6 K;  4B3R K;  1YTA A;  4I6M B;  2VG5 A;  4JKH A;  4YOV A;  4B08 A;  3PX6 A;  5J1E A;  1KQS M;  4HWI A;  4B1Z A;  1SV5 A;  3M8R A;  2E6M A;  2XY5 A;  1KCF A;  3L8B A;  4JKE A;  5ADX H;  3MN6 A;  4ICL A;  2ITG A;  4LSL A;  1LOT B;  3MK6 A;  2A3Z A;  2CGL A;  3AGR A;  5H1S Q;  3EY1 A;  4I2P A;  2BE2 A;  3L2U A;  3DXM A;  3CJA A;  4O4G A;  4Z94 A;  3SZ2 A;  4E7H A;  3HZ6 A;  2YJE A;  4IDH A;  5T7B A;  1LCU A;  1QQN A;  1UA0 A;  3MXM A;  1WSE A;  3TAG A;  1L5U A;  3QNN A;  1NKB A;  1KAZ A;  2GBZ A;  3PY8 A;  1YI2 N;  3G4S N;  3V9Z A;  4KRE A;  1C1C A;  2X78 A;  3CM5 A;  5C42 A;  4AHU A;  3AVF A;  3ZYY X;  3OA9 A;  3KD1 E;  1TKD A;  1VRU A;  4DFJ A;  3PX4 A;  2BAN A;  3M6G A;  5AZI B;  1OH8 A;  2LSN A;  1EX4 A;  3GOI A;  4CJF A;  1S3X A;  5M1F A;  2VGN A;  2HNY A;  3KVG A;  3VQA A;  4JS4 A;  3P4I A;  3LDN A;  3SBT A;  3ZET B;  5HRP A;  3S3O A;  5C2D A;  4JI7 K;  2FF6 A;  4DTU A;  4J2B A;  1I3A A;  1KRP A;  4B3M K;  4BQL A;  1JL1 A;  3O9S A;  3DAW A;  4DR4 K;  2OTL N;  1CXU A;  3J7Z O;  3GG4 A;  3RVC A;  4Z4I A;  2GV9 A;  3C7N A;  3WNF A;  4DU4 A;  4DTP A;  3G25 A;  3SUP A;  3PIP L;  1RDB A;  1Z25 A;  4CK1 A;  5AQH A;  4ILJ A;  3WNH A;  3VEN A;  4B9L A;  1DTQ A;  3HL8 A;  3CC7 N;  5CZ2 A;  1HKG A;  4Q0B A;  1NGI A;  3R1X A;  1W0H A;  5AQI A;  2IVP A;  5KQD A;  3L3U A;  3DRP A;  3CG7 A;  3C6A A;  5A2Q O;  1EQY A;  4DUZ K;  3ZT4 A;  1HPZ A;  1CXQ A;  4CIF A;  3LAN A;  1VQ9 N;  2D5R A;  3LPT A;  2FBT A;  4HUE A;  4WCE L;  4IG0 A;  3VEX A;  3VF6 A;  3L2W A;  2E8A A;  4IO9 L;  1VQ6 N;  3VGK A;  2HB5 A;  2BTF A;  4C8N A;  4B1V A;  1LWF A;  2QEX N;  3MED A;  1NKE A;  4JI4 K;  5KTQ A;  2XHB A;  4DQ8 A;  1VQM N;  4LH4 A;  4CHP A;  3QLH A;  3O80 A;  2F9T A;  3VEZ A;  4DQP A;  4FO0 A;  2XY7 A;  1X1P A;  1HX1 A;  5KQ8 A;  5LL6 Z;  1KSP A;  4F9O A;  3JSM A;  3LP0 A;  4MO5 A;  4ISG A;  4M41 A;  2P9L B;  4W5N A;  2ZD1 A;  1UAX A;  5M1P A;  4ELV A;  1JLB A;  4M3R A;  4CZL A;  4E19 A;  4J8F A;  3THY A;  3VGM A;  2YNH A;  3TAE A;  3M8Q A;  3QFP A;  4FWL A;  2VWK A;  1LWC A;  5FRM A;  2DFF A;  4AQY K;  3QEX A;  3OBY A;  1XI1 A;  2ASO A;  5AQL A;  4M3Z A;  1I94 K;  1IO2 A;  3MXJ A;  3S3N A;  3NGY A;  3NH0 A;  2G8I A;  4HCB A;  3VGL A;  1SS6 A;  3DXK B;  3UKU B;  3VEY A;  2P9K A;  3LAM A;  4BRE A;  4KHP K;  1EP4 A;  1VQL N;  1KD1 O;  3D6R A;  4OLB A;  3L0Q A;  1HKC A;  2ATQ A;  4GVM A;  5KGX A;  3TAB A;  4FJI A;  4CFC A;  3DWL A;  1VSM A;  4KHU A;  3KLE A;  2PY5 A;  1OH5 A;  2OYQ A;  4JLH A;  5JIC A;  1A5W A;  1BIZ A;  5M1Q A;  4QS8 A;  3U3G A;  1V4S A;  2PBD A;  4NXN K;  3T69 A;  2VWB A;  3E9O A;  5AQM A;  2NZT A;  3RWU A;  1KXP A;  3SCX A;  4H0X B;  3MCP A;  2B5J A;  4YOY A;  4O0J A;  3EE8 A;  3SAG A;  2Z1G A;  2W6K A;  4FJ5 A;  3OS2 A;  1TV6 A;  2P1J A;  3NF7 A;  2HMP A;  4K8Z A;  4JI8 K;  5KPR A;  1IBL K;  4RG8 A;  2WBN A;  3K9J A;  1U4B A;  3CQY A;  4PUO A;  3FZK A;  3H45 C;  4CEF A;  4LF8 K;  2QWR A;  4EP4 A;  3EEQ A;  4CEB A;  3H46 O;  5JLF A;  1YVN A;  4CEQ A;  5EY4 A;  4R5P A;  4IFE A;  3H3N O;  5HRO A;  1UA1 A;  3O9Q A;  3DOK A;  4A57 A;  3V9S A;  4BC5 A;  1QVF M;  4J2E A;  3SMP A;  3DXM B;  5AQW A;  4BR7 A;  3AA3 A;  3EE9 A;  2W41 A;  1R59 O;  4BDP A;  1EWQ A;  4O8U A;  2HBJ A;  4E3S A;  3HPH A;  4CJL A;  4K41 A;  1HNZ K;  1KAX A;  3VEV A;  4AHR A;  3RR7 A;  5KPT A;  4X62 K;  5AQG A;  4E7I A;  1BOT O;  4IFV A;  1IBM K;  3F5T A;  3OYN A;  1D9F A;  3CPE A;  1JKH A;  3TSQ A;  4FJH A;  3WXM B;  4O55 A;  2D1K A;  1FXX A;  3AVJ A;  5AQF A;  1BA0 A;  3H6E A;  4FOE A;  4GY2 B;  2G8V A;  1QHT A;  3T1Y K;  3BGR A;  2ASM A;  4HTL A;  1KFS A;  4NLC A;  1D5A A;  4OVL A;  1SAZ A;  3ATV A;  3SPZ A;  3CCQ N;  3VEO A;  4LFC K;  1WSI A;  4FW2 A;  4AIL C;  4F4K A;  3C7N B;  3M3Z A;  3ULE A;  1JLA A;  3AA2 A;  1RDA A;  3HVR A;  1NKC A;  4RW8 A;  2D4W A;  4IJN A;  1N8R O;  1QSS A;  4B1W B;  5M1N A;  3PSF A;  5CY4 A;  3DYA A;  3T7Z A;  2VQE K;  3P39 A;  1GLJ O;  3VQP A;  3CI5 A;  1BG3 A;  4CHN A;  4FWM A;  2YCH A;  2O8D A;  3GE1 A;  1HJO A;  3V9W A;  2Q36 A;  3G6E N;  2HOE A;  1WUA A;  2RF2 A;  2E20 A;  4M7X A;  4K8X A;  5JLH A;  4HUF A;  4AM6 A;  3NAE A;  4O5B A;  3HP6 A;  4JNE A;  1NU0 A;  4OKK A;  2D0O A;  4BDZ A;  5AQZ A;  2QXF A;  3E9L A;  2CH5 A;  2NRW A;  3HTV A;  4K43 A;  2F7T A;  3OJS A;  1XNR K;  1RCH A;  1SL1 A;  3Q7B A;  5IT9 O;  2HVH A;  1HNW K;  4LD0 A;  4H5N A;  4WQ4 C;  1YUW A;  2YHY A;  4NB4 A;  1GLD G;  4FXD A;  3OYI A;  4PQU A;  3THY B;  1R0A A;  3GDQ A;  1SUQ A;  4RWT A;  3MDQ A;  4CZJ A;  5I42 A;  2NRH A;  1E3M A;  3EL2 A;  3IUC A;  3VQE A;  1LV5 A;  3AVG A;  2OCE A;  2P9K B;  2Q31 A;  5F0X A;  3QO9 A;  5HLF A;  4FLU A;  2IVO A;  4BRI A;  1E4F T;  4GNI A;  2V52 B;  4E1M A;  3M8S A;  4CJS A;  2OAN A;  5BPM A;  1NGF A;  3ID6 A;  2EWS A;  3ZCM A;  1BUP A;  4FK4 A;  4CW7 B;  4CD1 A;  3AAP A;  2AA4 A;  4BC3 A;  4B1Y B;  4EFH A;  4CJK A;  2I7P A;  4FJL A;  1TKT A;  2Z1H A;  4LY7 A;  4DSJ A;  3SAF A;  4DF4 A;  1HQU A;  4IZ9 A;  2GWJ A;  4CJR A;  1WAJ A;  4DWI A;  3D7E O;  2Y1J A;  2V51 B;  4BR4 A;  2P5G A;  1J9A A;  4OGC A;  1BO5 O;  4GV6 A;  4U7B A;  2JGU A;  2UXB K;  1JCF A;  4EAH D;  1TKX A;  3B6O A;  2O8C A;  2IS3 A;  2Z1I A;  3RR8 A;  4FVU A;  3SPY A;  2Q0U A;  3CXC M;  5BN8 A;  2OZM A;  4H4O A;  4CF1 A;  2R7Y A;  1HQE A;  1X9S A;  2HF4 A;  3NVM A;  4BRK A;  4B9V A;  1GLC G;  1HKB A;  2KLA A;  4CF9 A;  3VQB A;  2QM1 A;  1K8A O;  3I55 N;  3BY5 A;  3DLE A;  5C15 A;  2OZS A;  4YOR A;  3NFA A;  4DV2 K;  1VRT A;  5C24 A;  3VER A;  3OYH A;  1WSG A;  1OH6 A;  3WUH A;  2A1R A;  4DCH A;  4H0P A;  4W5T A;  1XMQ K;  1QS4 A;  4OO1 J;  4JKF A;  1RNH A;  4DB3 A;  4FSV A;  1IKW A;  4DSK A;  2WON A;  3ZT2 A;  1NG9 A;  3O4W A;  3PO4 A;  2HHH K;  3LL3 A;  1NK0 A;  3O5B A;  3VEW A;  1X3N A;  4JAX A;  1TK0 A;  2G8H A;  3IG1 A;  4OKE A;  4BRO A;  2WOM A;  1OVY A;  4CF2 A;  4R79 A;  3J7Y P;  4M42 A;  3PV8 A;  2FBY A;  3VOV A;  4DKW A;  5B8H A;  1BCM A;  5JVG L;  2GEM A;  4RW9 A;  4Y1C A;  1IJJ A;  1HMV A;  3PLA A;  2Q0R A;  3AVK A;  3KJV A;  3CPW M;  2KTQ A;  3ULE B;  4I2Q A;  4XEI A;  4KH5 A;  2GUI A;  3TR8 A;  1NGB A;  2ZWH A;  4B3S K;  4IEE A;  3HYF A;  5C10 A;  1ZBH A;  4LFB K;  5HP1 A;  1NK5 A;  1N5Y A;  2P9S A;  3FZM A;  4BR5 A;  4BRQ A;  4HTU A;  1XC9 A;  1FJG K;  5BRH A;  1S1X A;  1REV A;  5KRS A;  3K58 A;  3V1R A;  4DTJ A;  1QSY A;  2E2N A;  2O8D B;  1JL2 A;  3D45 A;  3MWT A;  3OYE A;  4LH5 A;  3Q7C A;  1S1U A;  1HUX A;  3PSI A;  1ASV A;  1QSL A;  2BGG A;  4G9Z A;  1XWL A;  2O4G A;  4CEC A;  4H0O A;  2EHG A;  2YV0 X;  1CZ9 A;  2O8E A;  2CGK A;  3MN9 A;  3S9H A;  4DSL A;  5BR9 A;  4CER A;  3VQQ A;  1BGX T;  4OLA A;  1WAF A;  1NOZ A;  3BF3 A;  4OGE A;  3O3H A;  1KAY A;  3WEE A;  1S6Q A;  2UUB K;  4XH4 A;  5J2M A;  2UXC K;  3L2Q A;  5AQO A;  1TKZ A;  1YJ9 N;  1NJX A;  4FJG A;  4KAZ A;  2OA8 A;  3SUQ A;  3WQT A;  1ASU A;  4KI4 A;  1RBU A;  3ZSX A;  3DRR A;  4CJU A;  4BVO A;  2D0B A;  4CE9 A;  2YHB A;  3CMA N;  1JXE A;  1K6Y A;  4OX9 K;  2P9U A;  2HHT A;  1BIS A;  4GVE A;  3K57 A;  4NCB A;  3UKR A;  4BRN A;  1KVC A;  4A61 A;  5HL7 L;  3LP3 A;  3SQ4 A;  2IC3 A;  5E26 A;  3FZF A;  1S1V A;  2XY8 A;  4ILH A;  3KK7 A;  3VQ5 A;  2ZF5 O;  1A5V A;  1IKY A;  5AQV A;  1Z26 A;  3AY9 A;  4I7F A;  4AHC A;  5JMV A;  4Z4E A;  4GV9 A;  3C95 A;  1BI4 A;  1BQM A;  2RN2 A;  3SUN A;  4JN4 A;  4CJ3 A;  1SZ2 A;  2GWK A;  2A42 A;  4FJ9 A;  4BC2 A;  4IO8 A;  3M8P A;  1CLQ A;  2O8C B;  3ZSO A;  4KBO A;  3OYF A;  4DTR A;  3HP9 A;  3HSC A;  4Y1D A;  4B1U B;  3AVI A;  1NGH A;  2YNI A;  4NO7 A;  4BVP A;  4TSX A;  4LF7 K;  1SQK A;  3LZI A;  1BU6 O;  2FLO A;  3J81 O;  3ENB A;  3KLI A;  4CF8 A;  1YHQ N;  4M3Y A;  3KLH A;  3WXK A;  1GOA A;  3HM9 A;  4CEZ A;  1VQK N;  4BR0 A;  1HLU A;  4B1X B;  2KW4 A;  3H3O B;  1T6D A;  4MLE A;  1BQN A;  5JS2 A;  3TAQ A;  3U8X A;  5CYM A;  4MDB A;  2A40 A;  3IRX A;  2NNW A;  3UB5 A;  1MWM A;  3FFI A;  2Y1I A;  5EXW A;  3FE1 A;  3OYM A;  4A5A A;  1HRH A;  1WNS A;  4J2D A;  4DR2 K;  4YY3 K;  4AHS A;  5M1K A;  1K8K A;  1C0F A;  4G1Q A;  4FJM A;  3NGI A;  3VF4 A;  1Q9X A;  3LDP A;  1WBD A;  2ETJ A;  1IV0 A;  1NNE A;  1B9D A;  3BZK A;  1VSJ A;  1RT5 A;  4OPH A;  4ID5 A;  1N36 K;  3GL1 A;  4WE1 A;  5I9E B;  4J2A A;  5BN9 A;  3JS6 A;  1XHZ A;  5DM6 L;  3FZH A;  4N56 A;  4EZ6 A;  3QFU A;  2D0P A;  1QE1 A;  5KPZ A;  2NRV A;  3V6D A;  2IVN A;  2HST A;  3NDK A;  1RDU A;  3QB0 A;  4FJK A;  4FWP A;  5GIO A;  3ENH A;  2KFZ A;  4CJ5 A;  3CHW A;  3SMS A;  4W5Q A;  3LDL A;  3LPU A;  1HPM A;  3W0L A;  3LZJ A;  3A5O C;  4JRQ A;  1SKR A;  4HVJ A;  3A5L C;  4IEI A;  4MQ3 A;  4KTW A;  4CK3 A;  3O3G A;  2FSN A;  2QKK A;  3CER A;  2P9S B;  1Q81 O;  1NM1 A;  3CC2 N;  4X64 K;  4Z0U A;  1Q9Y A;  1NGA A;  3VTI A;  5DM7 L;  3EN9 A;  1QZ6 A;  1ZBU A;  4K42 A;  2HHW A;  5E84 A;  2DFH A;  2RKI A;  1WB9 A;  2O8E B;  5HRR A;  4LFA K;  4DLG A;  3LP2 A;  1D8Y A;  3QBW A;  1KC8 O;  5CR4 A;  1WN7 A;  3C6U A;  3CCS N;  2F8S A;  2VGM A;  3CQX A;  4PKG A;  1QVG M;  3KKR A;  4BAC A;  1T6C A;  3E66 A;  5HOO A;  3WEE B;  3ISN C;  3AVH A;  2O8B A;  2HBM A;  3CFP A;  2WFB A;  1D4X A;  2F4V K;  5E41 A;  1M90 O;  1RIL A;  1Z6R A;  2E4L A;  1WSF A;  2VWJ A;  2PYL A;  2UYT A;  4CHZ A;  1YJW N;  2YHX A;  1GLL O;  2VG7 A;  3IKM A;  3TTC A;  1WBB A;  4KKO A;  3NE6 A;  2HW3 A;  2P9U B;  3J80 O;  3UKR B;  4GV3 A;  3M1F A;  2UU9 K;  3EYZ A;  4H5W A;  4CBW A;  4DR1 K;  4WFB L;  1YF5 L;  3U9Z A;  1TVR A;  1W2B M;  3ZSY A;  3VPZ A;  2X6S A;  4FK2 A;  2FBX A;  4XIU A;  4BG8 A;  4IWV A;  1EO1 A;  3V9X A;  1UOC A;  4ISF A;  4DFM A;  3CIP A;  1IBK K;  1BI4 B;  3VQD A;  3R9P A;  4X66 K;  3QEP A;  4FJ8 A;  3AVC A;  3OBW A;  5F1X A;  2QKB A;  3MAQ A;  4B3O A;  4JI6 K;  2GTD A;  4JKC A;  1TL3 A;  3CJB A;  3MX2 A;  4DS4 A;  4UQG A;  3SNN A;  4DV7 K;  1RT2 A;  3T1A A;  2EX3 A;  4YDU A;  4JKB A;  3P38 A;  4DTS A;  3G71 N;  3RMC A;  1CZA N;  4NYF A;  4OPJ A;  1TK5 A;  1ASW A;  2UXD K;  2KZZ A;  3MN5 A;  3WXJ A;  2E88 A;  4B3T K;  1RT3 A;  3LDO A;  3NF6 A;  3QET A;  5J2N A;  4DR5 K;  3QIN A;  2HF3 A;  4M7Y A;  3RMB A;  4C8L A;  3SQ0 A;  1JCG A;  2X74 A;  4JS5 A;  2ASP A;  1U48 A;  2XO7 A;  3LDQ A;  3AAR A;  3THV A;  3O1B A;  2A1S A;  3SQ1 A;  1J53 A;  2BH1 A;  2FBV A;  3SBG A;  4KH4 A;  3I56 N;  1TL1 A;  1FW6 A;  1GOC A;  4A5B A;  4JI3 K;  3EZW A;  2X6N A;  1K8K B;  4FVM A;  5AQP A;  4KO0 A;  4CVN E;  4E7J A;  1YIT N;  3V81 A;  1XQS C;  2HBL A;  4F8R A;  4BRL A;  1NMN A;  3KWI A;  2XRI A;  1IKX A;  1RFQ A;  3UE5 A;  2OPR A;  3SLC A;  5TKY A;  3CCV N;  4CEA A;  2W42 A;  2I5J A;  3C65 A;  5FRO A;  4DLE A;  1IH7 A;  1IKV A;  1NGC A;  3VN5 A;  1NGE A;  4KH6 A;  5LJW A;  4DSF A;  3MEG A;  1Q86 O;  4BRD A;  4FLV A;  4ID1 A;  1P8Z A;  3QDK A;  4DV4 K;  3A5M C;  4ELT A;  5BPL A;  2ZQB A;  1OH7 A;  3HK2 A;  1VQ5 N;  4C8M A;  3VQC A;  4KTQ A;  4M3X A;  1C1B A;  1N6Q A;  4L3Q A;  4I9L A;  1U47 A;  3I0R A;  3M5R A;  4LF6 K;  3B8A X;  3L4Q A;  4JKG A;  3F9M A;  1NJI O;  1TYQ A;  4RW6 A;  4FYD A;  4CBU A;  4FLX A;  3AO4 A;  1U6Z A;  3WNE A;  1XUP O;  3ZX3 A;  2RHK A;  3MEC A;  3ZT3 A;  3CQ8 A;  3LAL A;  3HOT A;  1X9W A;  4YOX A;  3FGU A;  4CEO A;  1C0G A;  5D3G A;  3O1W A;  4IDK A;  1VQ8 N;  3OYG A;  1CZB A;  3TU5 A;  4AF1 A;  5BRD A;  4ZTJ A;  4B9M A;  2KFN A;  4DV6 K;  3D0P A;  3OY9 A;  3H08 A;  4DFK A;  2NRX A;  3CJ1 A;  5HRN A;  1NGG A;  2YKM A;  3P1G A;  3CD6 N;  4BGA A;  5CYQ A;  1WSH A;  3WNG A;  1VSI A;  2I7N A;  5LJV A;  1NK4 A;  4DV5 K;  2QTD A;  4CD3 A;  1M1K O;  4FZZ A;  2OPP A;  4NLB A;  1MU2 A;  2DFE A;  3HM8 A;  2O8B B;  5AQX A;  4BRH A;  1Z05 A;  4E7K A;  4QAG A;  3THW A;  4CED A;  1L3U A;  3DI6 A;  3CJC A;  3QML A;  4M45 A;  4NCA A;  3HXM A;  5GAH P;  4JEP A;  4KB1 A;  4H5V A;  1UWB A;  2JWK A;  3O6W A;  4OPA A;  3VF2 A;  4PL7 A;  4CJT A;  4WQ5 C;  3ZSQ A;  2F8T A;  1TUU A;  1JLF A;  2VQF K;  4CGF A;  3DLG A;  2OTJ N;  1JLE A;  3LWL A;  2HVI A;  4GKJ K;  3TTD A;  4H4M A;  4C1N I;  4FW1 A;  5GIN A;  3VQ6 A;  1JJ2 M;  1TAQ A;  1P90 A;  2Q1N A;  1TGO A;  3E01 A;  4WQ4 A;  4IKF A;  4KHS A;  3U4L A;  4UY8 O;  1YXQ A;  1YTU A;  2DTU A;  2CH6 A;  3HPO A;  3JYT A;  2E2Q A;  3L2V A;  3N4Q A;  4PKH A;  2YNG A;  1QTM A;  2YHA A;  1Q7Y O;  4ILG B;  4YOT A;  4DQI A;  3L3V A;  4H0Y B;  4FM2 A;  4JD2 A;  2QWO A;  4FJJ A;  1N32 K;  4BRM A;  2DPN A;  4DSE A;  1BA1 A;  2VCP A;  3SYZ A;  3F73 A;  1U45 A;  4FZX C;  4CZM A;  4H8K A;  4XH5 A;  1QHA A;  3QER A;  1VQ4 N;  4CZK A;  1FKP A;  3SAH A;  3ASM A;  4QCL A;  3OYL A;  4ELU A;  3TSP A;  4CJ4 A;  3AA4 A;  4LF5 K;  4M3U A;  1VQP N;  1BCO A;  2H3G X;  3TAM A;  4H5R A;  2P5O A;  3LDS A;  5J2Q A;  4M3T A;  3OYK A;  1T03 A;  3BEX A;  1VSD A;  3ZEU A;  1ATN A;  4CES A;  1LWE A;  4JI1 K;  3BP8 A;  1G99 A;  1JXB A;  2NRR A;  4FCY A;  3FR0 A;  4AHT A;  4BC4 A;  3SV4 A;  1S1T A;  1KFD A;  4U67 L;  3H1Q A;  3OHR A;  5DMR A;  1VSF A;  3R3L A;  4DMN A;  2B6A A;  4KHN A;  1RBR A;  1ZC6 A;  2OPQ A;  3DMJ A;  1SL2 A;  1S9E A;  1ZBI A;  1G15 A;  4CI6 A;  5AQJ A;  4FLZ A;  4KFB A;  3OS1 A;  2DY4 A;  1S72 N;  3J8A A;  3TI0 A;  2Q2R A;  1RTD A;  1MA9 B;  1VQ7 N;  4N41 A;  3OYA A;  4NXM K;  4V19 S;  4WF9 L;  3VES A;  3QIP A;  2QWQ A;  3R8E A;  3CFO A;  5LY3 A;  1BDG A;  2Z1J A;  2E6L A;  4JKG B;  3C6H A;  3O4Q A;  2QW9 A;  3T1H K;  1TYQ B;  1DEJ A;  1X9J A;  5BRF A;  4X65 K;  3G0Z A;  2YHW A;  4YHH K;  3SUO A;  4BG9 A;  1VQN N;  3HVT A;  1WOQ A;  3KTQ A;  3MMV A;  3HJF A;  3CCM N;  5FPN A;  4PL8 A;  3K5M A;  3WT0 A;  2P9P A;  5TKW A;  2E1Z A;  3ZT0 A;  2RE2 A;  1J54 A;  1IG8 A;  2QWM A;  4RW4 A;  1RT1 A;  2YJF A;  1NJY A;  3V1O A;  3C6T A;  4FWQ A;  1DLO A;  4CGI A;  4FOI A;  4JHD A;  1O1W A;  1KLM A;  4IOC L;  2P9I A;  3WXI A;  4B9U A;  5JVH L;  3VQ4 A;  3DM2 A;  2PYJ A;  2F96 A;  3KWG A;  3SJJ A;  3WQU A;  4F3T A;  4BDY A;  3P5J A;  3OJU A;  4Z4H A;  4MO4 A;  5KI6 A;  2Q97 A;  2E2O A;  1YJN N;  1N34 K;  4CJE A;  1K73 O;  1XNQ K;  2VG6 A;  1Y64 A;  2E2P A;  4CFB A;  3THW B;  5AR0 A;  2BUP A;  4JRP A;  1LW0 A;  2HHX A;  3AVL A;  3A8Y A;  1W9H A;  3KIO A;  2A41 A;  4BR9 A;  1RT6 A;  4CZH A;  3S3M A;  4I9Q A;  4M63 C;  4E0D A;  1TK8 A;  3QIC A;  4CGJ A;  1BL3 A;  1C0M A;  1DT9 A;  5HRS A;  1C0U A;  1VSE A;  1LAV A;  1RDW X;  5AQY A;  1RTI A;  2HNZ A;  5AQQ A;  2NRT A;  3C94 A;  5M1O A;  4DR3 K;  3CCE N;  1GLF O;  4ISE A;  1YAG A;  4A59 A;  4O0I A;  4DQS A;  2HMI A;  3AO1 A;  2O4I A;  4AH9 A;  5IWA K;  3CCL N;  2D0A A;  5FPM A;  4BRF A;  3IS9 A;  3SV3 A;  1NLV A;  1U2V A;  3I33 A;  4DS5 A;  4Z4F A;  1C1A A;  4CIG A;  3RRG A;  3N4P A;  3KK3 A;  1BIU A;  1ITG A;  1RGI A;  5FDL A;  4EHU A;  1TUY A;  3AVN A;  3PO5 A;  4KB0 A;  2V7Z A;  3D2E A;  1GLB G;  4CHY A;  5AFU H;  3TWH A;  1VSL A;  5KRT A;  4JD2 B;  3QES A;  1JLG A;  2HHV A;  1C0T A;  1ESV A;  1HYV A;  1L3S A;  2AJQ A;  3T19 A;  4CGG A;  5BRE A;  3KD5 E;  3CME N;  1T7P A;  4E1N A;  3K2P A;  3SK3 A;  3VA0 A;  4KHQ A;  4CJP A;  3HRG A;  1NGJ A;  3O9T A;  3GBT A;  4EIA A;  1QQC A;  2ZGY A;  1ATR A;  2P9N A;  4Y0W A;  4JI5 K;  3A2F A;  1MDU B;  4CBX A;  4CZG A;  3EKU A;  4N76 A;  4KHY A;  5EVZ A;  4KHW A;  1VAZ A;  2F9W A;  2QWL A;  4QS9 A;  3ZEU B;  1NBW A;  3NCI A;  1T8E A;  4H03 B;  2J4R A;  3I8D A;  4F2S A;  3RRH A;  1B9F A;  3F9K A;  2ZJQ L;  3VQ9 A;  3U6F A;  5EOY A;  5CZ1 A;  4F3O A;  4JI0 K;  5ADX A;  4RCH A;  4CHQ A;  3NH2 A;  4DV1 K;  1MWK A;  1N33 K;  2GEL A;  4XH1 A;  4BE1 A;  4PY5 A;  2KHO A;  3L4I A;  3CJ7 A;  3ZSW A;  4EHT A;  3VTH A;  1WLJ A;  1NK6 A;  1GLA G;  1HYS A;  1ZXO A;  2QWN A;  4FM0 A;  4HHT A;  3NF9 A;  1Q18 A;  3QNO A;  3E1Y A;  4CFD A;  1NK7 A;  4E89 A;  4YNQ A;  3CCJ N;  3DLL L;  4DTN A;  3BDP A;  4JI2 K;  3TTF A;  3V1Q A;  5AFU A;  1B92 A;  3DLR A;  3IDH A;  3QIO A;  4KRF A;  1OVQ A;  4DU3 A;  3TAN A;  3FLC O;  4BRA A;  1DGK N;  2YX6 A;  4ZTF A;  3NMU A;  3R6M A;  4QOZ B;  4LF4 K;  5CE3 A;  3S41 A;  2KZM A;  3ZLJ A;  1OKJ A;  1VHX A;  3LM9 A;  4CZI A;  4M3W A;  2PFU A;  3BUZ B;  3P31 A;  1WSJ A;  3DLB A;  3AVA A;  3PIO L;  4HUG A;  3IAY A;  4PKI A;  2P9P B;  4FLW A;  3EZ5 A;  5FRN A;  2FF3 B;  4NCG A;  2NRZ A;  1XMO K;  5ELZ A;  2VYP A;  4CF0 A;  1RDD A;  4IXC A;  1KVA A;  4JHD B;  4YDU C;  2PZS A;  3J7A P;  2O8F A;  1BWF O;  2P9I B;  3F2K A;  5C0Y A;  2IGI A;  4CHO A;  3RSE A;  4GMJ B;  5EX5 A;  3AGK A;  1W7A A;  3K0S A;  4FZY A;  5AQS A;  4EP5 A;  3HST B;  3O3F A;  4A2B A;  1J6Z A;  1RTH A;  4WFN L;  4O8K A;  4KPY A;  3SQ2 A;  4IBN A;  4JV5 K;  1GOB A;  3LWM A;  3O9R A;  3LP1 A;  1H1V A;  4CFA A;  1S5J A;  3H1V X;  2QA4 N;  3THX A;  3RMD A;  2G8W A;  3VQ8 A;  2UUC K;  4C1N K;  1HNV A;  4DQQ A;  3DLK A;  4FLT A;  1EKE A;  3QEW A;  2P51 A;  3AO2 A;  3K5L A;  3ALY A;  4GW6 A;  1HNI A;  1J5O A;  4W5R A;  3MCA B;  3AV9 A;  4OKJ A;  4CJV A;  1VSH A;  4KTZ A;  5F2R A;  4CCH A;  3BF1 A;  4CJQ A;  3AVM A;  2ITM A;  3K5N A;  3IMX A;  2GUP A;  5MLC Q;  1S22 A;  2YNF A;  1LAW A;  1HR0 K;  1NMD A;  1ILY A;  1EXQ A;  3G10 A;  4JYA K; 
#chains in the Genus database with same CATH homology
 3VEN A;  3CJC A;  3QML A;  2CGK A;  3MN9 A;  3CC7 N;  1HKG A;  1U2V B;  5BR9 A;  1NGI A;  5GAH P;  3R1X A;  4JEP A;  4JK8 A;  4H5V A;  5AQI A;  2IVP A;  2JWK A;  4IOX A;  3ATU A;  5KQD A;  3O6W A;  4OPA A;  3VF2 A;  3C6A A;  4PL7 A;  3L6Q A;  4WQ5 C;  1EQY A;  5BPN A;  4JKA A;  3BF3 A;  1JCE A;  1TUU A;  3D2E B;  1VQ9 N;  1KAY A;  2OTJ N;  5AQR A;  3WEE A;  4WCE L;  4XH4 A;  3CF5 L;  3TTD A;  3VEX A;  4C1N I;  4CJ7 A;  3VF6 A;  5GIN A;  1JJ2 M;  1P90 A;  2E8A A;  2Q1N A;  5AQO A;  4IO9 L;  1YJ9 N;  1VQ6 N;  3VGK A;  2BTF A;  4WFA L;  3A5N C;  4WQ4 A;  3WQT A;  4B1V A;  2QEX N;  3U4L A;  4UY8 O;  4WYB A;  4BVO A;  1YXQ A;  2CH6 A;  4DQ8 A;  1VQM N;  2E2Q A;  2PAV A;  3CMA N;  4H0V B;  3N4Q A;  4PKH A;  2P9U A;  2P9N B;  3O80 A;  2F9T A;  4GVE A;  3VEZ A;  4FO0 A;  5FPE A;  3UKR A;  1X3M A;  1Q7Y O;  3FFK B;  4BRN A;  5C2F A;  2QXL A;  5GAE P;  4A61 A;  3I8B A;  5HL7 L;  1HX1 A;  4ILG B;  5KQ8 A;  4YOT A;  4F9O A;  5E26 A;  3FZF A;  4MO5 A;  4H0Y B;  4ISG A;  4ILH A;  3KK7 A;  5AZJ A;  4BRP A;  2P9L B;  4JD2 A;  5M1P A;  2ZF5 O;  2QWO A;  2YI1 A;  3TPQ A;  4CZF A;  4BRM A;  2DPN A;  5AQV A;  2E1Y A;  4CZL A;  4J8F A;  3VGM A;  4MDA A;  1BA1 A;  3QBX A;  3VET A;  3AY9 A;  2VCP A;  2A5X A;  3D2F A;  3QFP A;  4FWL A;  5JMV A;  1K9M O;  1W97 L;  3OBY A;  4GV9 A;  2ASO A;  5AQL A;  3FZL A;  4XH5 A;  4CZM A;  1QHA A;  4JN4 A;  1VQ4 N;  4CZK A;  1SZ2 A;  2GWK A;  3SAH A;  3VGL A;  1SS6 A;  2A42 A;  3DXK B;  3UKU B;  4FWO A;  3VMF B;  3VEY A;  2P9K A;  3TSP A;  3W3D A;  4BC2 A;  4BRE A;  4IO8 A;  1VQP N;  3CET A;  1VQL N;  3ZX0 A;  1QQO A;  4JKD A;  1KD1 O;  3D6R A;  1Q82 O;  2H3G X;  3L0Q A;  4KBO A;  3WXL A;  1HKC A;  4H5R A;  1VQO N;  2FXU A;  3DJC A;  3DWL A;  3BEX A;  3HSC A;  4FWN A;  3ZEU A;  1ATN A;  4B1U B;  3BP8 A;  1NGH A;  1G99 A;  2NRR A;  4NO7 A;  4O5F A;  4BVP A;  2FSJ A;  1SQK A;  1BU6 O;  3FR0 A;  3MX5 A;  2FLO A;  5JIC A;  4BC4 A;  3ENB A;  4BRG A;  5M1Q A;  4QS8 A;  4U67 L;  1YHQ N;  5C12 A;  3H1Q A;  1V4S A;  2PBD A;  3OHR A;  3WXK A;  4CZE A;  3T69 A;  1VQK N;  2VWB A;  3E9O A;  4BR0 A;  5AQM A;  3EKS A;  1E4G T;  1HLU A;  2NZT A;  3H3O B;  3R3L A;  4B1X B;  1KXP A;  1T6D A;  4MLE A;  1ZC6 A;  3U8X A;  4H0X B;  4LC9 B;  4MDB A;  5CHI A;  4CI6 A;  3MCP A;  2A40 A;  4YOY A;  5AQJ A;  2NNW A;  3EE8 A;  3UB5 A;  1MWM A;  3SAG A;  4K25 A;  5EXW A;  2HMP A;  3FE1 A;  2ZJR L;  3O9U A;  4A5A A;  5KPR A;  1S72 N;  2WBN A;  3K9J A;  3J8A A;  4BGB A;  1ATS A;  3CQY A;  2Q2R A;  1MA9 B;  1VQ7 N;  3FZK A;  3H45 C;  3TSU A;  2QWR A;  3H46 O;  5JLF A;  1YVN A;  5M1K A;  3K9K A;  5EY4 A;  1K8K A;  4IFE A;  3H3N O;  3MWP A;  1C0F A;  4WF9 L;  3VF4 A;  3VES A;  3LDP A;  3O9Q A;  2GX9 A;  4A57 A;  1T3V A;  2QWQ A;  3C0B A;  3R8E A;  4BC5 A;  5LY3 A;  1QVF M;  1BDG A;  4JKG B;  3SMP A;  3C6H A;  3IFR A;  3DXM B;  5AQW A;  4OPH A;  2HBK A;  4BR7 A;  2QW9 A;  3ID8 A;  1TYQ B;  1DEJ A;  1XC3 A;  1X9J A;  2ZGZ A;  3GL1 A;  3EE9 A;  4IJA A;  5BRF A;  2W41 A;  5I9E B;  1R59 O;  4I6M A;  3MN7 A;  4BY9 C;  3RSE B;  2YHW A;  4O8U A;  2HBJ A;  4BG9 A;  1VQN N;  5BN9 A;  1WOQ A;  3JS6 A;  3MMV A;  2WUS A;  3CCM N;  5DM6 L;  5FPN A;  4K41 A;  3FZH A;  1KAX A;  3VEV A;  3QFU A;  3HI0 A;  2D0P A;  4PL8 A;  3WT0 A;  2P9P A;  5KPT A;  5KPZ A;  5AQG A;  5TKW A;  2NRV A;  2E1Z A;  2IVN A;  2HST A;  1RDU A;  2RE2 A;  3QB0 A;  1BOT O;  1IG8 A;  2QWM A;  4FWP A;  3F5T A;  5GIO A;  2YJF A;  3CPE A;  3ENH A;  3TSQ A;  3CHW A;  3SMS A;  4FWQ A;  5GAG P;  3LDL A;  4BR2 A;  3WXM B;  1HPM A;  5AQT A;  4FOI A;  4JHD A;  3W0L A;  3A5O C;  4IOC L;  2P9I A;  3A5L C;  2D1K A;  4FWS A;  5AQF A;  4IEI A;  1BA0 A;  3WXI A;  4AM7 A;  3H6E A;  5JVH L;  2FSN A;  4FOE A;  4GY2 B;  3CCR N;  5AQN A;  3CER A;  3CCU N;  2P9S B;  2ASM A;  1V4T A;  4HTL A;  4B9Q A;  2JWL A;  1Q81 O;  3KWG A;  2AP1 A;  4NLC A;  4JK9 A;  3WQU A;  1SAZ A;  4MO4 A;  3ATV A;  4MLH A;  1NM1 A;  2Q97 A;  3CCQ N;  2E2O A;  3VEO A;  3CC2 N;  1YJN N;  1K73 O;  1ZBS A;  1NGA A;  3VTI A;  5AZI A;  5DM7 L;  3EN9 A;  1QZ6 A;  3C7N B;  3M3Z A;  4FL9 A;  3ULE A;  4K42 A;  5E84 A;  3HOS A;  1Y64 A;  2E2P A;  4H5T A;  4FWK A;  1QQM A;  5AR0 A;  2BUP A;  2D4W A;  4IJN A;  1NWK A;  1N8R O;  4B1W B;  2IIR A;  3A8Y A;  3ZET A;  4BR9 A;  2A41 A;  5M1N A;  3QBW A;  1KC8 O;  5CR4 A;  4CZH A;  3T7Z A;  4M63 C;  3P39 A;  1O13 A;  3QIC A;  3CC4 N;  3CCS N;  1GLJ O;  3CI5 A;  1BG3 A;  1DT9 A;  2VGM A;  3CQX A;  4PKG A;  1QVG M;  4FWM A;  1RDW X;  2YCH A;  5AQY A;  5AQQ A;  4YOW A;  3HBT A;  1T6C A;  3E66 A;  3GE1 A;  1HJO A;  2NRT A;  2Q36 A;  3WEE B;  5HOO A;  2HOE A;  1WUA A;  3G6E N;  2HBM A;  2E20 A;  4WQ5 A;  5M1O A;  4M7X A;  3CCE N;  1GLF O;  4ISE A;  1YAG A;  4A59 A;  2WFB A;  5JLH A;  1D4X A;  4AM6 A;  3LM2 A;  1M90 O;  4JNE A;  1Z6R A;  4IOA L;  2D0O A;  3CCL N;  5FPM A;  4BRF A;  2UYT A;  5AQZ A;  1YJW N;  3E9L A;  2YHX A;  3NVK A;  1GLL O;  2CH5 A;  1NLV A;  1U2V A;  2NRW A;  3IKM A;  3TTC A;  4A62 A;  3HTV A;  3I33 A;  4K43 A;  5AQK A;  2F7T A;  2P9U B;  3EO3 A;  3UKR B;  4GV3 A;  3M1F A;  3Q7B A;  2FSK A;  3N4P A;  4H5W A;  4CBW A;  1RGI A;  4WFB L;  4EHU A;  1TUY A;  1YF5 L;  2V7Z A;  3D2E A;  3U9Z A;  1GLB G;  1W2B M;  3A0I X;  5AFU H;  3VPZ A;  5AZJ B;  4JD2 B;  4E1J A;  4BG8 A;  4H5N A;  4WQ4 C;  1YUW A;  2YHY A;  4NB4 A;  4IWV A;  1GLD G;  1ESV A;  1EO1 A;  3O08 A;  5BRE A;  3GDQ A;  4ISF A;  4RWT A;  3D2F B;  3CME N;  3MDQ A;  4CZJ A;  3CIP A;  4RTF D;  2NRH A;  5GAD P;  3SK3 A;  3R9P A;  4BRC A;  3EL2 A;  3IUC A;  4YOU A;  3AAQ A;  1NGJ A;  3HRG A;  3E9P A;  3O9T A;  2NLX A;  3GBT A;  3JXU A;  5AQU A;  4EIA A;  3OBW A;  5F1X A;  2ZGY A;  1ATR A;  2P9N A;  4BQZ A;  4Y0W A;  2P9K B;  2Q31 A;  1MDU B;  4JK7 A;  3U9D A;  4CBX A;  4CZG A;  3EKU A;  2KKZ A;  1NGD A;  5F0X A;  1DKG D;  2GTD A;  4C23 A;  4JKC A;  3OW2 M;  2IVO A;  3CJB A;  3MX2 A;  5GIP A;  4BRI A;  1E4F T;  4GNI A;  2V52 B;  5EVZ A;  2W40 A;  1GLE G;  1VAZ A;  2OAN A;  2F9W A;  2A6A A;  4YDU A;  5BPM A;  2QWL A;  3P38 A;  4JKB A;  1NGF A;  1T44 A;  2P9L A;  1NBW A;  3ID6 A;  4QS9 A;  3ZEU B;  3G71 N;  1CZA N;  2EWS A;  3CJ9 A;  4H03 B;  3MN5 A;  2J4R A;  4FWR A;  1BUP A;  3WXJ A;  2E88 A;  2ZJP L;  2ZJQ L;  4CD1 A;  5EOY A;  3AAP A;  2AA4 A;  3LDO A;  4H0T B;  4BC3 A;  4B1Y B;  5ADX A;  4EFH A;  4RCH A;  2I7P A;  4QS7 A;  1MWK A;  3O8M A;  2WC9 A;  2HF3 A;  3SAF A;  2GEL A;  4M7Y A;  4XH1 A;  4A2A A;  2KHO A;  3L4I A;  2GWJ A;  3CJ7 A;  4IZ9 A;  4EHT A;  3VTH A;  3D7E O;  2V51 B;  1GLA G;  3DXK A;  1JCG A;  3UKU A;  4BR4 A;  1BO5 O;  1ZXO A;  3KHY A;  4GV6 A;  4U7B A;  1JCF A;  2ASP A;  4EAH D;  2QWN A;  3LDQ A;  3AAR A;  3KZB A;  3O1B A;  4FVU A;  1Q18 A;  4PHT X;  3E1Y A;  2Q0U A;  4FPA A;  2CGJ A;  2V7Y A;  5BN8 A;  4DHY A;  3CXC M;  2BH1 A;  3SBG A;  3CCJ N;  4KH4 A;  3SJH A;  3I56 N;  3DLL L;  1YIJ N;  2HF4 A;  3NVM A;  2QWP A;  3ENO A;  1GLC G;  3TTF A;  4BRK A;  5FPD A;  1HKB A;  4A5B A;  5AFU A;  3EZW A;  3IDH A;  2KLA A;  1K8K B;  5AQP A;  3FLC O;  2QM1 A;  1K8A O;  3I55 N;  4BRA A;  1DGK N;  2YX6 A;  5C15 A;  3NMU A;  3R6M A;  1YIT N;  1QZ5 A;  4YOR A;  1XQS C;  3ZX2 A;  2HBL A;  2QI2 A;  4BRL A;  4FPB A;  3S41 A;  5CE3 A;  3KWI A;  1OKJ A;  3LM9 A;  3VER A;  4CZI A;  4I6M B;  1RFQ A;  2PFU A;  3UE5 A;  3SLC A;  3BUZ B;  3P31 A;  4JKH A;  5TKY A;  4YOV A;  3CCV N;  1KQS M;  4HWI A;  3C65 A;  3WUH A;  1NGC A;  4B1Z A;  4DCH A;  1NGE A;  4KH6 A;  5LJW A;  1Q86 O;  3PIO L;  4H0P A;  4BRD A;  4PKI A;  2P9P B;  1P8Z A;  2FF3 B;  3QDK A;  3A5M C;  4OO1 J;  4JKE A;  5ADX H;  3MN6 A;  5BPL A;  4JKF A;  2NRZ A;  1VQ5 N;  4DB3 A;  4FSV A;  1LOT B;  3MK6 A;  2A3Z A;  4L3Q A;  5ELZ A;  2CGL A;  2VYP A;  3AGR A;  5H1S Q;  3O4W A;  3M5R A;  3LL3 A;  3B8A X;  4IXC A;  3L4Q A;  3O5B A;  4JKG A;  4JHD B;  3F9M A;  3DXM A;  3VEW A;  3CJA A;  4YDU C;  1BWF O;  1X3N A;  2P9I B;  1TYQ A;  3F2K A;  4JAX A;  4Z94 A;  1NJI O;  5C0Y A;  3HZ6 A;  2YJE A;  4BRO A;  4IDH A;  3RSE A;  4CBU A;  1OVY A;  5EX5 A;  3AGK A;  1LCU A;  1QQN A;  4R79 A;  5AQS A;  1KAZ A;  1U6Z A;  1YI2 N;  3G4S N;  4A2B A;  3VOV A;  1XUP O;  1J6Z A;  2RHK A;  3ZX3 A;  4DKW A;  5B8H A;  5JVG L;  4WFN L;  4O8K A;  3ZYY X;  2GEM A;  3HOT A;  3OA9 A;  4YOX A;  3FGU A;  1IJJ A;  3PLA A;  2Q0R A;  1C0G A;  3O9R A;  3CPW M;  3O1W A;  3M6G A;  5AZI B;  1H1V A;  1VQ8 N;  3ULE B;  3H1V X;  4AF1 A;  3TU5 A;  5BRD A;  2QA4 N;  3GOI A;  1S3X A;  4C1N K;  4XEI A;  5M1F A;  2VGN A;  2NRX A;  3CJ1 A;  4KH5 A;  3KVG A;  1NGG A;  3P4I A;  3LDN A;  3SBT A;  3ZET B;  3CD6 N;  5C2D A;  1NGB A;  2ZWH A;  4BGA A;  2FF6 A;  4IEE A;  5C10 A;  2I7N A;  5LJV A;  2P9S A;  3FZM A;  4BR5 A;  2QTD A;  4CD3 A;  4BRQ A;  3MCA B;  4BQL A;  1M1K O;  5BRH A;  3O9S A;  4NLB A;  2E2N A;  5F2R A;  3DAW A;  3BF1 A;  3MWT A;  3HM8 A;  5AQX A;  2OTL N;  3Q7C A;  4BRH A;  1HUX A;  2ITM A;  3J7Z O;  3GG4 A;  3RVC A;  3IMX A;  2GUP A;  5MLC Q;  3C7N A;  1S22 A;  4G9Z A;  1Z05 A;  3G25 A;  3PIP L;  1NMD A;  1ILY A;  5AQH A;  4ILJ A;  4H0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...