3F2KA

Structure of the transposase domain of human histone-lysine n-methyltransferase setmar
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
197
Chain Sequence
HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Transposase Domain of Human Histone-lysine N-methyltransferase SETMAR.
rcsb
source organism Homo sapiens
total genus 67
structure length 197
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3f2kA00
4MDBA 4MDAA 5HOOA 4U7BA 5CR4A 3HOTA 2F7TA 3HOSA 3K9JA 3K9KA 3F2KA 4R79A
chains in the Genus database with same CATH superfamily
3C65A 3M6GA 4JRQA 3C0BA 4DSIA 2QW9A 4Q0BA 3GOIA 1ILYA 4FO0A 3WEEB 3ZT2A 2HHTA 2I5JA 4A5AA 3S3MA 4CF9A 3SBTA 4I9LA 2P9NA 4QS7A 3UKUA 3DI6A 3ZCMA 4BRQA 5AQQA 4IWVA 2IAJA 4FLYA 1W9HA 4JKBA 4CJ7A 2YHBA 4F2RA 1GLEG 2OTJN 3HXMA 1ASWA 3KD1E 3AAQA 3LDLA 4YY3K 4FJ8A 4KV8A 4QOZB 2JGUA 5JLFA 1JXBA 4W5NA 1LWCA 2QWQA 4DG1A 2HHQA 3RRHA 1LW0A 3L4QA 3LPUA 4CD1A 2P9UB 4YOWA 4DFPA 3EKUA 4OO1J 1Y64A 3CHWA 1EKEA 4FJJA 1ATSA 4DTRA 1FXXA 3ZSQA 1JLQA 2HHHK 4WFNL 5KRTA 3KVGA 1JCGA 1KLMA 1V4TA 5AQMA 4H5VA 4B9LA 3ASMA 4B08A 3VQEA 3C7NA 1HYSA 3VOVA 3CCRN 4LH4A 4FVMA 5BPNA 5AQKA 3OA9A 2UYTA 1JLBA 3EE9A 1YF5L 2QWMA 3IAYA 2V7ZA 4DFMA 3KIOA 5AZIA 4L3QA 5AQWA 4MLEA 2A40A 1J53A 4DQSA 3MWTA 4BR4A 3O4WA 3VF2A 3F5TA 4CK2A 2GBZA 1SUQA 3MMVA 3R3LA 1X9JA 3M8PA 5H1SQ 2V52B 4BRDA 4LF7K 1RT7A 2P9PB 3THYA 2B5JA 3ZX3A 2HF3A 1IBMK 4DR7K 4YOYA 2BANA 4HVJA 4IFEA 3HBTA 3HZ6A 3MXIA 2E2OA 4J2BA 1VSJA 1RT4A 2HF4A 4KHYA 4YOTA 4BR2A 3R1XA 2VG5A 3VMFB 5AZIB 2VCPA 4BQZA 1U4BA 3JSMA 3P4IA 3AVIA 1VSFA 3AAPA 1VQ5N 3AA5X 5GINA 4J2AA 4BRLA 3QIPA 5GAGP 2YHAA 4DFJA 4NYNA 3OYCA 2QWLA 4JKCA 3RR7A 1HQUA 1KAYA 1E3MA 1C1CA 2FSNA 5M1FA 4PKHA 3AO2A 4DF4A 2OZSA 3OHRA 4FWPA 1NLVA 1LCUA 5GADP 4H03B 5JLHA 4OJRA 2JWLA 4CBUA 3EZ5A 4KKOA 4DS4A 4FLUA 3A0IX 1QZ6A 2O8FA 3EN9A 4CJEA 4K8XA 3CXCM 3QO9A 1DTTA 2RPIA 5E84A 1O13A 4FWNA 2NRZA 4DF8A 1HR0K 2NLXA 3SPZA 3AVHA 3TI0A 4DV4K 2W40A 2E1ZA 4Z0UA 1HX1A 1YT3A 3K5OA 4E89A 1NK0A 1VQKN 1KRPA 4U67L 1JLEA 2FSKA 4M3YA 1MDUB 3JAMO 3UIQA 5KQ8A 2WTUA 3KKRA 1YVNA 2AA4A 3D2EB 4KHNA 5F0XA 3OYAA 1HJRA 2P9SA 4F3TA 3RMCA 2E8AA 3ZETA 4MLHA 1WOQA 3NAEA 4CGHA 4CGDA 2VG7A 3G71N 1ATRA 3QDKA 1JL2A 1OH5A 4O8KA 3NH1A 1NOZA 3HL8A 4JI5K 3L3VA 3O4NA 1B9FA 1Q18A 2ZD1A 2QTDA 2YKNA 4CEFA 4FOEA 4B1XB 2ZF5O 3THXB 1NOYA 1O1WA 2D0CA 2A3ZA 3T69A 3ULEB 5BREA 1L3SA 3B6PA 1TUUA 4BE0A 1RTDA 3U4LA 1VQMN 1UA1A 4QS9A 3PX4A 1WBBA 3J7YP 1L3UA 2ZM6K 1XUPO 4JKEA 3U3YA 1JKHA 3D45A 4AHUA 4CEEA 4BRNA 3MEGA 3HPGA 1U6ZA 3EKSA 3SJHA 1YAGA 2DFHA 3RMDA 3G10A 4BR0A 2Q97A 4CHZA 4KRFA 4FM0A 3DLRA 4CEQA 3VGKA 4B3RK 2G8VA 3G25A 3L8BA 5AQTA 3ZSYA 3BDPA 3L2QA 3SLCA 4JK9A 5FROA 4FJNA 3J7AP 3O3HA 3MEEA 3OYHA 3ITHA 4BWMA 3T3FA 2HMIA 1K8KA 3WXKA 3WNFA 2J4RA 5J1EA 4JKFA 3MCAB 4CZGA 1YTAA 2D0BA 1H1VA 1WAFA 3CC7N 1TV6A 1K73O 2FBYA 5F1XA 1HNIA 3QBXA 3ENOA 4CJLA 3ID6A 1NU0A 4F9OA 4B9MA 3UKRB 3VQ8A 3ULDA 3P83D 3SAHA 3AVNA 1CZBA 4BR9A 2R7YA 4DQPA 1BQNA 1NMNA 4X62K 4AM7A 2YHYA 3QMLA 3VA3A 3P1GA 5JS2A 2G8IA 4JK7A 1K8KB 1KD1O 1DKGD 4KI4A 1NMDA 3SYZA 4PKIA 4AHTA 2UUCK 4OPHA 1FW6A 4KHWA 3CCUN 1HKCA 3RWUA 4JV5K 3R9PA 1ZBIA 3OVNA 5HLFA 3CF5L 2UU9K 2NRWA 5K14A 4JN4A 3OS0A 1KAZA 3TABA 1RT2A 4NB4A 4EIAA 4BROA 4KHSA 1BIZA 3HYFA 3SUNA 4LFBK 3W3DA 1QSLA 1VQNN 1I3AA 4CJUA 1ESVA 2P1JA 1NKEA 3VQQA 2PFUA 1W7AA 1GLJO 1TYQB 2JLEA 5I42A 2HSTA 3HI0A 3LALA 3CCQN 2HHWA 3SAGA 4O0JA 4M3UA 3ID8A 3LZIA 2KFZA 3OS1A 4IJNA 2A1SA 3AO1A 1YIJN 3JYTA 3FZKA 3T1YK 2Q0UA 1VQ7N 4FZXC 2YX6A 3QINA 1FKPA 1G99A 2KTQA 3F9MA 1RTIA 3MN9A 3TAGA 4C1NK 4FWQA 1IH7A 4YOVA 1VQON 2EHGA 1U2VA 1QSYA 4BRCA 1WSFA 3AA4A 3PY8A 2IVOA 4BC3A 2X74A 5AJ3K 3KZBA 3HSTB 2I7PA 3ATVA 1EETA 2Q0RA 2X6NA 4CD3A 2VWJA 3BP8A 5DM6L 4JS5A 4CIFA 1L3VA 4LFAK 2P9LB 2O8CA 1KVBA 5BRHA 2E20A 3THWB 3DOKA 3F2KA 1XNQK 2JWKA 3QEPA 1RBVA 3SMPA 4J2EA 1RDDA 3MN7A 4PKGA 5FRNA 2GWKA 4NCBA 2VYPA 3DMJA 4LF5K 3S41A 5SWMA 3IRXA 2DPNA 1QQOA 4CGGA 3SK3A 4DR5K 3KK1A 1XC3A 1NGGA 3FZLA 2PAVA 4FW1A 1QHTA 4JK8A 3T19A 3OYGA 3U9DA 2ZQBA 4OX9K 4CHOA 3O6WA 1UWBA 3C95A 3VGMA 1NKBA 4CZMA 4E7IA 1KSPA 4CFCA 1HKBA 2E6LA 4Y0WA 5FRMA 5LY3A 2FBXA 1HNWK 1CZAN 4LF6K 5EU7A 3FGUA 2OPRA 1XC9A 4A61A 3BGRA 3O08A 3VQCA 4B1UB 2B6AA 3NH2A 1P8ZA 1Q7YO 1ZBHA 2NRRA 4CW7B 1ZBFA 4M3RA 3V81A 3WXMB 1NKCA 3N4PA 4DS5A 2Q36A 5EY4A 3L3UA 1HPMA 1LW2A 2IIRA 3LWLA 5AQPA 1HQEA 1BCOA 4E7LA 3WUHA 3AY9A 3K2PA 5BPLA 2O8BA 4B1ZA 3L2WA 3NGZA 4K42A 4FLTA 3QERA 3IMXA 3HT3A 3NDKA 3TSQA 5C12A 2DTUA 3WQUA 4FWRA 1P90A 4HCBA 4CESA 1QZ5A 4O0IA 2YNIA 2QKBA 4BRGA 3DLBA 4CFAA 1SKWA 4OKJA 2YHWA 4FL9A 4HTLA 1MA9B 1FJGK 2IVPA 3SV4A 4DTUA 3E9OA 4AHVA 3AVLA 4L8RB 3LDNA 2KZZA 2ITMA 1BCMA 3NCIA 4DMNA 1CZ9A 2O8BB 3WXJA 4O4GA 3LAMA 1RT5A 3O8MA 3GDQA 3E1YA 3KLGA 4E7HA 1JLFA 1NG9A 2P5OA 4PUOA 4AM6A 4CZFA 3HP6A 1QS4A 2E2QA 4LSLA 1YJNN 1C0FA 3ZT3A 2YJEA 4JEPA 4CHYA 5AZJA 3CQ8A 1ITGA 2P9IA 4Y1DA 4CJSA 2BUPA 3PX0A 3CCSN 3K0SA 3THVA 3DWLA 4BDPA 5C42A 4ICLA 1Y97A 3NF8A 4CIGA 3A8YA 2P5GA 4FSVA 2ZGZA 2EWSA 5JMVA 2UUBK 4WQ5A 3ATUA 4H5RA 3MCPA 2W42A 3QFPA 1S1VA 3K5NA 1NJYA 3OTOK 4LF8K 2P51A 2E2PA 4KFBA 2BDPA 3CG7A 1XHXA 5KI6A 3SQ2A 1RDAA 2YCHA 1RDWX 1D5AA 3CD6N 1BGXT 3F9KA 1Q82O 5AQOA 3O9QA 4CGIA 3AVGA 4DTSA 4KB1A 3FLCO 2UXBK 1HNVA 1VSEA 3DOLA 1ATNA 3WNHA 4C1NI 3OYFA 4C8LA 1D9DA 1QQMA 3L2RA 1HMVA 4CJ3A 1KXPA 4JI1K 1NK8A 4C8NA 2NZTA 3U9ZA 4BC2A 3DLKA 3VA0A 1SL2A 4B9UA 3AA3A 1GLBG 2P9UA 4ISFA 4DTMA 4JS4A 2A41A 4BREA 4B9NA 4H0YB 4BACA 1EO1A 3ZX0A 3OJSA 2PZSA 2FXUA 3FR0A 2ASOA 2HVIA 4DSJA 4BR7A 1IBLK 2HVHA 4RTFD 3MEDA 4KTZA 3OYJA 2Z1IA 4DR2K 2YNGA 4IKFA 1RTJA 3GL1A 1OH7A 4FK0A 4BG9A 2WBNA 1X9WA 2UXCK 3R8EA 2G8KA 4CHQA 3LWMA 4LC9B 5EX5A 4AQYK 2AP1A 2RF2A 4CECA 1VAZA 4KI6A 3AGKA 3BF3A 1OVQA 1S5JA 3KKSA 4GKKK 1KVCA 3O1WA 4G1QA 4MO4A 1NK5A 1BU6O 2F8TA 1J5EK 3TPQA 4ZHRA 3TTCA 3TAFA 1EP4A 3TANA 2P9PA 1LAVA 3EEQA 4J8FA 4CBWA 4H0PA 1U04A 4TSXA 1SKSA 1KVAA 1C1BA 1GOAA 1WNSA 4GY2B 3SUOA 5AQXA 4CEDA 3QBWA 3J80O 3EO3A 4DLGA 4EP4A 3J7ZO 4IBNA 3H6EA 4JNEA 2E5LK 3CM5A 4NCAA 1TL1A 4EFHA 3PUFA 3AVFA 4DR1K 3NBPA 3HOTA 1N6QA 4CJRA 4JI3K 5KPZA 1BI4B 1DGKN 4WF9L 3VGLA 3HO1A 4OLAA 1VRTA 4CEOA 4IO8A 2G8FA 3V9XA 1WB9A 3V1RA 3VEXA 4CI6A 2QI2A 1JLGA 1N5YA 3AO5A 1QQCA 1NGAA 4MDBA 3LDQA 1L5UA 4JI6K 1IKVA 4W5RA 3Q7BA 1JLCA 1NGIA 3V9UA 3CPEA 3AA2A 1IG9A 4H0TB 4E7KA 3QEIA 5GAEP 5FPEA 3ALYA 5AQNA 3MK6A 4K41A 2DFEA 2GEMA 1WSGA 3DRPA 5BRDA 4KBOA 1TGOA 3OYIA 4YOXA 3W0LA 1KAXA 1BG3A 2KLAA 4CJ5A 4FJ5A 1TUYA 3ZSVA 4FK4A 4DSLA 4DLEA 4CE9A 4N41A 1VSIA 3D2EA 4IFVA 5AQSA 4M41A 2ATQA 4CHNA 2ZWHA 1HLUA 3C6UA 4IDKA 4DSKA 2HBJA 3OYKA 1TK8A 2D4WA 4DV1K 4IJAA 3E9LA 2PYJA 2RE2A 5LL6Z 3CJ1A 4O55A 4LFCK 4X64K 2G8UA 4PWDA 5BR8K 4U7BA 4Z4EA 2NRXA 4AH9A 1YI2N 2O4IA 3THXA 5AQVA 1KFDA 3ULEA 4LY7A 1HYZA 2FF3B 2CH6A 4ILGB 5HRPA 1RT3A 3K57A 1MU2A 1HUXA 3OS2A 4CZLA 1RDCA 3CIPA 1D9FA 5A2QO 2GX9A 2GUPA 2F9TA 4BR5A 2FBTA 3KWIA 4M63C 3CCEN 3SQ4A 4OPKA 4H0OA 2HB5A 3P39A 3CCMN 3DRSA 1EWRA 4JI4K 3DLEA 4JKAA 3I56N 1TK0A 1RILA 4DQQA 1REVA 3LP2A 4I7FA 1VQ8N 4E1JA 4DV0K 2PBDA 3CJ9A 1KQSM 4A57A 3U8XA 3FE1A 3NF9A 4PL7A 1W2BM 3TAEA 4M3TA 3H46O 1T7PA 3QEVA 3ZT0A 2VG6A 2FC0A 4J2DA 4KTWA 3VETA 3AVBA 3QLHA 2HW3A 4OPAA 1ZBLA 3SJJA 3HPHA 5JVHL 3DLLL 4B3MK 1Z26A 1X1PA 4I2PA 3UKRA 4CEZA 1OH8A 1T44A 1UOCA 1NJIO 5FPNA 3CFRA 3VENA 4CHPA 3KTQA 4XH1A 4CZEA 4CK1A 1WLJA 1TKZA 3HP9A 4KAZA 5AR0A 1DLOA 3D6RA 3VQDA 4CZKA 1DTQA 1UA0A 4JI7K 4NCGA 3ZYYX 4GMJB 3TSUA 5GIOA 4C8KA 5I3UA 4JD2B 5KTQA 3NFAA 5CZ2A 3PSIA 1C0UA 3RTVA 3ENBA 5HRNA 4DTJA 2B4JA 4RW4A 1TKDA 1IG8A 3O3GA 4K8ZA 5IWAK 4ISEA 4JKGB 1K6YA 3T1AA 3HK2A 2UXDK 2QK9A 2H3GX 4AILC 1S72N 3A5MC 1TYQA 4IO9L 4DTXA 5FPMA 1YUWA 2D0OA 4YDUA 3CM6A 4OKKA 5EVZA 4C8MA 4AHSA 4DV6K 3QEWA 4M42A 3AV9A 1HNXK 4IEEA 3V6DA 4FW2A 3O3FA 1J54A 5KPTA 5AQFA 2QWRA 1NJZA 2OPSA 2CGKA 1NK9A 1QVFM 1RBRA 5I9EB 1CXUA 3L0QA 3RSEB 4DQRA 4M45A 3V9SA 3VF4A 4BRPA 3PLAA 1WAJA 4CGFA 4NLBA 2HBKA 4DB3A 4DU1A 2OTLN 3B8AX 4B9SA 4O8UA 1HYVA 2HBLA 2WFBA 2KHOA 3U6FA 1DEJA 3ISNC 1C0GA 1QQNA 4K0KK 2E88A 4N5SA 1SZ2A 4M7YA 4Z4GA 3MN6A 4RWTA 4FLVA 3VESA 3H3OB 4H8KA 3SQ0A 4IOAL 2X78A 3D0PA 2YNFA 2UUAK 3E01A 5DM7L 3FZFA 4AHCA 2VGMA 4DWIA 2P9LA 3MX2A 3THWA 5AFUH 3C6HA 1X9MA 3M1FA 2XY8A 4OVLA 3IFRA 5E26A 2PYLA 4CJFA 3TTFA 4O5FA 5CE3A 2KZMA 1U48A 3VTIA 4HTUA 1IKWA 4F3OA 4B8CA 1V4SA 5F2RA 1LWFA 4CBXA 3HM8A 1NK6A 3TTDA 3NF7A 4GKJK 3RR8A 2RKIA 2F8SA 1F21A 4KPYA 4FWSA 2Z1HA 1SKRA 4H0XB 1J9AA 4CIEA 1T3VA 2ZJQL 3KD5E 2NRHA 5AQHA 5TKWA 5HRRA 4DTPA 1WSEA 3MX5A 3MN5A 3UE5A 2YNHA 3CFPA 3O80A 4DU3A 4DR6K 3LM2A 4F8RA 2F7TA 3K59A 3NVMA 4BGAA 1NGEA 3DXKA 3T1HK 4JI2K 3UB5A 1FK9A 4QS8A 1RTHA 2W41A 2G8HA 3SBGA 4CJ4A 4AHRA 2G8WA 3DXMB 3VF6A 2XY5A 1BL3A 3S9HA 1SAZA 3QESA 1G15A 1KC8O 1WUAA 3HM9A 4PL8A 1OVYA 2Q1NA 1S22A 3MECA 4GW6A 4H5WA 1SQKA 3LP1A 1S1WA 2O8DA 1TVRA 4DUYK 4PA1A 2A42A 1QSSA 3QICA 4HWIA 3AVKA 2KW4A 3H08A 1OKJA 3TR8A 1L3TA 1S6PA 2E4LA 3DXKB 4EHTA 1EX4A 4H5TA 4DSFA 3JXUA 2QWNA 3BZCA 2IOCA 3QB0A 4FJIA 5AQIA 3J8AA 1I39A 4KB0A 4MQ3A 3WNEA 3SAFA 4YOUA 4V19S 3LDSA 2XHBA 4WQ4C 3ZLJA 1S3XA 5CYMA 3OYDA 3EE8A 1QVGM 3VQBA 4JAXA 1RT6A 2HHSA 3Q7CA 2O8DB 4CF8A 2CGJA 2NRTA 1D4XA 4HUFA 5KRSA 1Z25A 3HSCA 4EAHD 4FVUA 4I2QA 5FDLA 5C15A 3BY5A 3P38A 3CC2N 4H4OA 4DV3K 3IUCA 1MWMA 2V7YA 1E4FT 1Z6RA 1UAXA 4BC5A 3M8RA 1S6QA 5GIPA 2F4VK 5AQUA 3TU5A 4EZ6A 4JI0K 1S9GA 2GV9A 1T03A 3IS9A 3EYZA 1QE1A 1NBWA 2CGLA 3LM9A 4I6MB 4IG3A 2NUBA 2HMPA 1NJWA 4FZYA 1X3MA 2KQ2A 2OA8A 4WCEL 2FBVA 4YORA 2WONA 4BDZA 4RW8A 3HTVA 4BDYA 1GOCA 3AVMA 2F96A 1TAQA 4OGCA 4FJLA 1SV5A 3JS6A 4E1NA 2HHVA 3AVJA 4FWKA 4KH4A 5M1QA 1HKGA 1NK4A 1W0HA 1VQ9N 3C6AA 4PHTX 1VQLN 3NF6A 4W5OA 4CJTA 1VSMA 2A5XA 3M8QA 2IGIA 4CVNE 5LMUK 4JHDB 3WNGA 2QXFA 4DV7K 2WC9A 4FJMA 3L2UA 4B9QA 2GWJA 2BTFA 4MDAA 5HOOA 3SCXA 5AQGA 4Z94A 5GAHP 2Q31A 4JLHA 5M1OA 3EZWA 4M3XA 4RG8A 3LP3A 3T7ZA 4DCHA 3A5OC 3U3GA 5HP1A 1J5OA 3SZ2A 1ZYQA 4ELUA 4B8AB 4FLZA 5BR9A 3HRGA 3PSFA 4OLBA 3IKMA 1JCEA 5M1NA 4WE1A 4DHYA 4LD0A 1NGBA 4CF0A 2BE2A 4BVPA 3ZEUA 4JRPA 2KFNA 5C25A 3AO3A 1IO2A 3OYMA 1MWKA 4RW9A 2CH5A 3ZSWA 1WSIA 2VWKA 4OGEA 1K9MO 4UQGA 3CCLN 4BRAA 2HHXA 4XEIA 3TAQA 4CJKA 3NE6A 3SNNA 4CGJA 5D3GA 1VK0A 3OJUA 1S1XA 2X6SA 1LWEA 5C2FA 2OANA 5CYQA 5J2QA 3E66A 3L2VA 5T7BA 3KLHA 4NO7A 1RFQA 1LOTB 2A6AA 3K5LA 5J2PA 2HBMA 4B3OA 1A5XA 3ZEUB 3P5JA 3DRRA 4C23A 5M1KA 3TSPA 4E1MA 3CYMA 4NYFA 4M7XA 1GLDG 1ZBUA 4NLCA 5KGWA 4X65K 3CJCA 3K5MA 2QXLA 3VEYA 4E19A 4BE1A 4ELVA 3KHYA 3VEWA 1IBKK 2HNZA 1VQ6N 5BPMA 4WYBA 1WBDA 1BI4A 4Z4FA 3CFOA 1BOTO 2P9NB 1ZBSA 4HUGA 5ADXH 4B3SK 1KCFA 5HROA 2XY6A 4K25A 3DJCA 4YNQA 3UKUB 4W5TA 4ZTJA 3O5BA 5AQLA 3LPTA 1U45A 1VHXA 5LMNK 2YHXA 4YHHK 5J2MA 4A2AA 3LDOA 1N36K 2BH1A 4EHUA 4FJHA 3I0RA 2OPQA 3OYNA 3TARA 2OZMA 3OW2M 3O9TA 3EL2A 4DKWA 3ZSRA 1TKXA 4GNIA 2XRIA 1WSJA 3LP0A 1TK5A 2FSJA 3MXJA 1C0MA 4K43A 1BQMA 5B8HA 3CERA 3OYBA 4A5BA 3V4IA 3RMAA 1YITN 4WFAL 3I55N 1HJOA 2Q2RA 1KFSA 3NHGA 1R0AA 3FFIA 3KWGA 4ID5A 1ASUA 2HOEA 4FPBA 4RW6A 1ASVA 2ASMA 1C0TA 1X3NA 1Q9XA 3VQ5A 4EZ9A 3G4SN 3BEXA 1NGFA 3O4QA 3C7NB 4FM2A 4A59A 3RMBA 3ZX2A 1T8EA 1RBSA 1RBUA 3H1VX 1NJXA 2RN2A 4CCHA 3QNOA 1HRHA 4KH5A 2WUSA 2XO7A 3HPOA 4B3TK 4R5PA 3AARA 4CEBA 4CEAA 5CZ1A 4IZ9A 2D0PA 4H5NA 3ENHA 3KLEA 1J6ZA 1GLLO 2IDOA 1JXEA 3NVKA 3OBYA 3CCJN 3O9RA 3FZMA 3THYB 2IVNA 2Y1JA 3FZHA 3DAWA 5JS1A 4FZZA 1RGIA 5DK5A 3EY1A 2PY5A 4B1YB 3CI5A 3CJAA 5CY4A 4DFKA 3ZSZA 4WQ5C 3CMEN 4FXDA 1OH6A 4Q5VA 1BDGA 5KQDA 4IEIA 3LAKA 1WSHA 1U47A 5AQZA 4JYAK 4A2BA 3OBWA 4MFBA 3V1OA 2ETJA 3SQ1A 4DQIA 3O9SA 3L4IA 1RBTA 2XY7A 1YTUA 4E7JA 2I7NA 1RT1A 2EX3A 1RDBA 4G9ZA 2O8FB 4CFDA 5BN9A 4JI8K 1NM1A 3M8SA 3DLHA 4XH4A 1C6VA 2QM1A 3L6QA 3MAQA 5AFUA 3OY9A 1GLFO 3SI6A 4B1WB 3FFKB 3PIOL 2QWPA 2ZE2A 1S1UA 1IKYA 3LDPA 1EXQA 3V1QA 3WQTA 4CERA 3ZT4A 2Y1IA 4CF2A 4NXMK 3KJVA 1I94K 4XIUA 4JD2A 1S9EA 3KK3A 1WN7A 1N32K 1U49A 3TAMA 1RCHA 3O9UA 1XHZA 2O8EA 1Q9YA 3B6OA 3VQPA 2ASPA 2BGGA 2P9SB 3NGYA 3N4QA 3ZETB 3K9JA 5HBMA 2HNYA 4JKGA 4R79A 2W6KA 4A62A 4E0DA 1M1KO 3KLIA 1IJJA 3A5LC 3HOSA 4DU4A 4WQ4A 4F2SA 1BISA 3SMSA 1GLAG 1YJWN 4M3WA 3S3OA 1XWLA 3PV8A 1XNRK 3LZJA 4FYDA 3MWPA 4M3ZA 4BGBA 2WOMA 3KK7A 4B9TA 4B9VA 4ILHA 2O8EB 3S3NA 3PIPL 1T6CA 1RDUA 3I0SA 5IT9O 3RSEA 4GV3A 4CFBA 4MO5A 1NGDA 5C0YA 4CZHA 3QEXA 2OPPA 1TAUA 3P31A 4WFBL 1HPZA 4DUZK 2W6LA 1BO5O 1NK7A 4QAGA 5AQJA 3GG4A 3QNNA 3RRGA 1C1AA 1JL1A 1NGHA 3G0ZA 1EQYA 4GV9A 4IG0A 4FK2A 4Y1CA 4EP5A 4FPAA 4FLWA 1YVUA 3VEZA 4CZIA 1IV0A 4CF1A 3BZKA 4KTQA 3A5NC 4FJGA 1NGCA 5AQRA 3NH0A 3PO5A 4BRMA 4DR3K 3TAPA 2YJFA 4BY9C 3AO4A 1N34K 3SV3A 1EWQA 3I8DA 4Z4HA 4IXCA 2LSNA 4ID1A 3F73A 2F9WA 2O4GA 1SS6A 3VQ9A 2ZJRL 5FLXO 1VQ4N 2VWBA 4Z4IA 3KLFA 3LANA 2YI1A 1NWKA 3VPZA 3GBTA 3TWHA 1T05A 3I33A 3A2FA 3DYAA 4E3SA 5BRFA 1R59O 5HRSA 2QKKA 5DMRA 3ZT1A 3NGIA 3CJBA 2D1KA 4GV6A 3VERA 5KGXA 4C8OA 4ZTFA 1LV5A 4JKDA 2FF6A 3CCVN 4CJPA 3D2FA 2KKZA 1DT9A 3WT0A 2VQEK 5TKYA 2NNWA 3DLGA 5CR4A 4ELTA 4CK3A 4FJKA 4LH5A 3J81O 3KK2A 3DXMA 4JKHA 4W5QA 5EXWA 3LL3A 5CHIA 1CLQA 2YV0X 4BVOA 4KHQA 4HUEA 3QETA 5AQYA 4DQ8A 4LSNA 4BRIA 5FPDA 4CJVA 5JVGL 1K8AO 2GELA 3RVCA 3D2FB 4BG8A 1VRUA 2E2NA 4BE2A 1NNEA 2FLOA 4DSEA 4DV2K 5J2NA 3PX6A 1JJ2M 1VQPN 2IC3A 4ILJA 2QEXN 2HHUA 1A5VA 5ELZA 4OPJA 3PO4A 1VSHA 4O44A 3CQXA 5HL7L 3HJFA 1N8RO 1Q81O 3CPWM 2D5RA 3HVTA 3SUPA 1ZC6A 4FWOA 4N56A 3H45C 1N33K 2A1RA 1GLCG 4N76A 3QIOA 2HNDA 4ISGA 3CETA 1U2VB 4DTNA 1XMOK 3IG1A 2ZJPL 4PY5A 3E9PA 4CZJA 3K9KA 3OYEA 2AJQA 3IDHA 4BRHA 1BA1A 3OYLA 3H1QA 1GOBA 2O8CB 4H4MA 1T6DA 3M3ZA 4I6MA 2GTDA 4BRKA 2IS3A 1B92A 3V9ZA 2Z1JA 4IDHA 4FJ7A 4AF1A 1YXQA 4YFUA 4CJQA 2VQFK 4XH5A 3WXIA 1LAWA 3BUZB 4O5BA 1VSKA 2QA4N 1B9DA 4KHPK 3VQ4A 4Z4CA 1ZXOA 1BHLA 4KHUA 4B1VA 1TL3A 4KREA 1XQSC 1X9SA 1TKTA 1Q8IA 3K58A 3AVAA 4BC4A 3CJ7A 4LF9K 4FOIA 3SUQA 2P9KA 1BUPA 3WXLA 1RNHA 2ITGA 2D0AA 3VTHA 4H0VB 3AVCA 1HNZK 4NXNK 3D7EO 4IFYA 4BQLA 3DM2A 3C94A 1FKOA 3I8BA 1Z05A 4HHTA 1IKXA 4JHDA 3C6TA 2NRVA 5SZTA 1M90O 4DV5K 4HCCA 4FJ9A 3VQ6A 1KTQA 3O1BA 2DFFA 3NMUA 3H3NO 4KH6A 3V9WA 1NGJA 5ADXA 3R6MA 4FCYA 5LJWA 1A5WA 5EOYA 3AGRA 5C10A 5C2DA 4DR4K 4IOCL 2P9KB 3BF1A 3ZSOA 5JICA 2YKMA 4GVMA 4YDUC 2RHKA 4KO0A 1XMQK 4CJWA 2OCEA 2GUIA 1W97L 4X66K 4FJXA 1SL0A 3M5RA 4RCHA 4BRFA 3CC4N 2Q3SA 2VGNA 1JCFA 1S1TA 2V51B 1QTMA 1E4GT 3MDQA 3QFUA 1QHAA 1XI1A 3VEOA 2OYQA 5KPRA 5LJVA 4UY8O 4FWMA 1KLNA 2E6MA 4FWLA 1BA0A 2ZGYA 1Q86O 3HVRA 3VN5A 4DTOA 3VEVA 3ZSXA 4IOXA 1CXQA 5BN8A 1VSDA 1YJ9N 1YHQN 3WEEA 3SPYA 4LF4K 2E1YA 4F4KA 1BIUA 4GVEA 4N47A 4OKEA 1SL1A 4FM1A 4I9QA 1VSLA 5C24A 2Z1GA 4RW7A 4PQUA 1JLAA 3G6EN 3VQAA 2QWOA 1D8YA 4BWJA 5AZJB 4FLXA 3MXMA 2DY4A 1BWFO 4QCLA 2P9IB 5M1PA 5MLCQ 3VQ7A 5E41A 3GE1A 3CQYA 3CMAN
chains in the Genus database with same CATH topology
3C65A 3M6GA 1HKBA 4H5NA 3C0BA 3ENHA 2QW9A 1J6ZA 1GLLO 4Y0WA 3GOIA 2H3GX 1S72N 1ILYA 4FO0A 5LY3A 3A5MC 3NVKA 1TYQA 3WEEB 1CZAN 3OBYA 3O9RA 3CCJN 3FZMA 5FPMA 4IO9L 1YUWA 2IVNA 3FGUA 3FZHA 2D0OA 4A5AA 4A61A 4YDUA 3O08A 5EVZA 3DAWA 3SBTA 4B1UB 4IEEA 2P9NA 1RGIA 1Q7YO 1P8ZA 5KPTA 4QS7A 2NRRA 5AQFA 4B1YB 3CI5A 3UKUA 2QWRA 4BRQA 3CJAA 2CGKA 4WQ5C 5AQQA 3WXMB 1QVFM 3CMEN 5I9EB 3L0QA 3N4PA 3RSEB 2Q36A 4IWVA 5EY4A 1BDGA 1HPMA 2IIRA 3VF4A 4IEIA 4BRPA 4JKBA 4CJ7A 5KQDA 3PLAA 5AQPA 4NLBA 1GLEG 3WUHA 3AY9A 5AQZA 2HBKA 4DB3A 2OTJN 4A2BA 5BPLA 3OBWA 4B1ZA 2OTLN 3B8AX 4O8UA 2HBLA 2WFBA 3AAQA 2KHOA 3LDLA 1DEJA 4K42A 1C0GA 3IMXA 1QQNA 3O9SA 2E88A 3L4IA 1SZ2A 3TSQA 4M7YA 5C12A 5JLFA 2I7NA 3MN6A 4RWTA 3WQUA 2QWQA 4FWRA 1P90A 3VESA 3H3OB 1QZ5A 3L4QA 4CD1A 4IOAL 2P9UB 4YOWA 4BRGA 3EKUA 5DM7L 3FZFA 4OO1J 1Y64A 4G9ZA 2VGMA 3CHWA 2P9LA 3MX2A 2YHWA 4FL9A 1NM1A 4HTLA 5BN9A 1MA9B 1ATSA 5AFUH 2IVPA 4XH4A 3C6HA 3E9OA 3M1FA 2QM1A 3L6QA 3IFRA 5AFUA 3LDNA 5E26A 2ITMA 3TTFA 4O5FA 5CE3A 1GLFO 4WFNL 3KVGA 3VTIA 4B1WB 1JCGA 3FFKB 3PIOL 2QWPA 1V4TA 1V4SA 5AQMA 4H5VA 5F2RA 4CBXA 3HM8A 3WXJA 3O8MA 3GDQA 3LDPA 3E1YA 3WQTA 3C7NA 3TTDA 3VOVA 4AM6A 3CCRN 4CZFA 2E2QA 4FWSA 4JD2A 1YJNN 1C0FA 4H0XB 5BPNA 5AQKA 3OA9A 2UYTA 3O9UA 3EE9A 2QWMA 2YJEA 1YF5L 1T3VA 4JEPA 5AZJA 2ZJQL 2ASPA 2NRHA 2V7ZA 5AQHA 2P9SB 5TKWA 2P9IA 2BUPA 3N4QA 3CCSN 3MX5A 5AZIA 4L3QA 3ZETB 3MN5A 3DWLA 5AQWA 4MLEA 2A40A 3K9JA 3UE5A 3MWTA 4JKGA 3O80A 4A62A 4R79A 4BR4A 3O4WA 3VF2A 3F5TA 1M1KO 3LM2A 3MMVA 3R3LA 3A8YA 2F7TA 1IJJA 1X9JA 3A5LC 3NVMA 4BGAA 3HOSA 5H1SQ 4FSVA 4WQ4A 2ZGZA 1NGEA 2EWSA 5JMVA 3DXKA 2V52B 4BRDA 4WQ5A 3SMSA 3UB5A 2P9PB 1GLAG 3ATUA 1YJWN 4H5RA 4QS8A 3MCPA 3ZX3A 2W41A 2HF3A 4YOYA 3SBGA 3QFPA 3DXMB 3MWPA 3VF6A 4BGBA 3KK7A 1SAZA 4IFEA 3HBTA 3HZ6A 2E2OA 1KC8O 4ILHA 1WUAA 2E2PA 4PL8A 3PIPL 2HF4A 1OVYA 1T6CA 1RDUA 4YOTA 3RSEA 4BR2A 2Q1NA 1S22A 2YCHA 3R1XA 4GV3A 1RDWX 3VMFB 4H5WA 2VCPA 4MO5A 1NGDA 1SQKA 5AZIB 4BQZA 4CZHA 5C0YA 3CD6N 2A42A 3P4IA 1Q82O 5AQOA 3QICA 3P31A 4HWIA 3O9QA 4WFBL 3AAPA 1VQ5N 5GINA 1BO5O 4BRLA 3FLCO 1OKJA 5AQJA 4IZ9A 5GAGP 1ATNA 4C1NI 3GG4A 3DXKB 4EHTA 1NGHA 1QQMA 2QWLA 4H5TA 1EQYA 4JKCA 1KAYA 4GV9A 1KXPA 2FSNA 3JXUA 2QWNA 4PKHA 2NZTA 5M1FA 3U9ZA 4BC2A 3OHRA 3QB0A 4FWPA 1NLVA 1LCUA 4FPAA 5GADP 4H03B 5JLHA 3VEZA 5AQIA 2JWLA 3J8AA 4CZIA 4CBUA 3SAFA 1GLBG 2P9UA 4ISFA 3A5NC 4YOUA 1NGCA 5AQRA 3A0IX 1QZ6A 2A41A 4BREA 4H0YB 4BRMA 4WQ4C 1EO1A 3EN9A 2YJFA 3ZX0A 1S3XA 3CXCM 4BY9C 2FXUA 3EE8A 1QVGM 5E84A 1O13A 4FWNA 2NRZA 4JAXA 3FR0A 2NLXA 3Q7CA 2ASOA 2CGJA 2NRTA 4IXCA 1D4XA 2W40A 2E1ZA 2F9WA 3HSCA 1SS6A 4BR7A 4EAHD 2ZJRL 4FVUA 1HX1A 4RTFD 5C15A 3P38A 3CC2N 1KD1O 3IUCA 1VQ4N 2VWBA 1MWMA 2V7YA 1VQKN 4U67L 1E4FT 1Z6RA 2YI1A 3GL1A 1NWKA 3VPZA 3GBTA 4BG9A 2FSKA 2WBNA 3I33A 3R8EA 4BC5A 1MDUB 5GIPA 5AQUA 5BRFA 3TU5A 5KQ8A 1R59O 4LC9B 1YVNA 2AA4A 5EX5A 2AP1A 3D2EB 5F0XA 3CJBA 2D1KA 1VAZA 1NBWA 4GV6A 2CGLA 2P9SA 3VERA 3LM9A 4I6MB 3AGKA 3BF3A 2E8AA 2HMPA 3ZETA 4MLHA 1WOQA 3G71N 1X3MA 1ATRA 3O1WA 3QDKA 2FF6A 4JKDA 4O8KA 3CCVN 4MO4A 3D2FA 1BU6O 2KKZA 3TPQA 3TTCA 1DT9A 3WT0A 4WCEL 1Q18A 5TKYA 2QTDA 2NNWA 5CR4A 2P9PA 4YORA 4FOEA 4B1XB 2ZF5O 4J8FA 4CBWA 4H0PA 3HTVA 2A3ZA 3T69A 3ULEB 3DXMA 4JKHA 5BREA 5EXWA 3LL3A 5CHIA 4GY2B 3JS6A 5AQXA 4BVOA 1TUUA 3QBWA 3EO3A 3U4LA 4FWKA 4KH4A 5M1QA 1HKGA 1VQMN 4QS9A 3J7ZO 1VQ9N 3H6EA 5AQYA 4JNEA 4DQ8A 3C6AA 4PHTX 1VQLN 5FPDA 4BRIA 4EFHA 1XUPO 4JKEA 2A5XA 5JVGL 1K8AO 3HOTA 2GELA 3RVCA 4JHDB 3D2FB 4BRNA 4BG8A 5KPZA 1U6ZA 2E2NA 1DGKN 3EKSA 2WC9A 2FLOA 4WF9L 3VGLA 3SJHA 1YAGA 4BR0A 4B9QA 1VQPN 4IO8A 1JJ2M 2Q97A 2GWJA 2BTFA 3VGKA 3VEXA 4CI6A 2QI2A 4ILJA 4MDAA 5HOOA 3G25A 2QEXN 5ELZA 5AQGA 1NGAA 4Z94A 5GAHP 5AQTA 2Q31A 4MDBA 3CQXA 5M1OA 5HL7L 3EZWA 3LDQA 3SLCA 1N8RO 1Q81O 3CPWM 4JK9A 3Q7BA 3T7ZA 1NGIA 1ZC6A 3CPEA 4FWOA 3H45C 4DCHA 4H0TB 3A5OC 1GLCG 1K8KA 3WXKA 4ISGA 5GAEP 2J4RA 5FPEA 3CETA 3HRGA 1U2VB 5AQNA 5BR9A 3MK6A 4K41A 4JKFA 3MCAB 3IKMA 1JCEA 5M1NA 2GEMA 2ZJPL 4CZGA 5BRDA 4KBOA 4DHYA 1H1VA 3E9PA 4YOXA 1NGBA 3W0LA 3CC7N 1KAXA 4CZJA 1BG3A 4BVPA 2KLAA 3K9KA 3ZEUA 1K73O 1TUYA 5F1XA 3QBXA 3ENOA 1MWKA 1BA1A 3IDHA 4BRHA 3ID6A 4F9OA 2CH5A 3UKRB 3H1QA 3SAHA 3D2EA 5AQSA 1K9MO 1T6DA 4BR9A 3M3ZA 3CCLN 4BRAA 2ZWHA 1HLUA 4XEIA 2HBJA 4I6MA 2GTDA 4BRKA 2D4WA 4AM7A 2YHYA 3QMLA 4IDHA 1K8KB 4JK7A 4AF1A 4IJAA 5C2FA 3E9LA 1DKGD 1YXQA 1NMDA 2OANA 2RE2A 3E66A 4PKIA 3CJ1A 4NO7A 4OPHA 1RFQA 1LOTB 4XH5A 3WXIA 3BUZB 2A6AA 3CCUN 1HKCA 2QA4N 4U7BA 3R9PA 2HBMA 2NRXA 3CF5L 1YI2N 1ZXOA 2NRWA 4B1VA 4JN4A 5AQVA 3ZEUB 4C23A 3ULEA 1XQSC 5M1KA 3TSPA 2FF3B 2CH6A 1KAZA 4ILGB 4BC4A 3CJ7A 4NB4A 4FOIA 1HUXA 4M7XA 1GLDG 4EIAA 2P9KA 4BROA 1BUPA 4NLCA 4CZLA 4UY8O 3CJCA 3WXLA 3CIPA 3W3DA 2QXLA 1VQNN 2GX9A 1ESVA 3VTHA 4H0VB 3VEYA 2GUPA 2F9TA 4BR5A 3D7EO 4BQLA 3KWIA 4M63C 3CCEN 3I8BA 2PFUA 3KHYA 1Z05A 3VEWA 1GLJO 1TYQB 4H0OA 3P39A 1VQ6N 4JHDA 5BPMA 2NRVA 4WYBA 2HSTA 3HI0A 3CCQN 1M90O 3CCMN 3O1BA 3SAGA 4JKAA 1BOTO 3NMUA 3I56N 3H3NO 2P9NB 1ZBSA 5ADXH 4KH6A 4K25A 3DJCA 3UKUB 1NGJA 5ADXA 3R6MA 3ID8A 4IJNA 5EOYA 5LJWA 3AGRA 3O5BA 5AQLA 5C10A 1YIJN 1VQ8N 4E1JA 5C2DA 3FZKA 4IOCL 3BF1A 2P9KB 2PBDA 2Q0UA 2YHXA 3CJ9A 2YX6A 5JICA 1KQSM 1VQ7N 4A2AA 1G99A 2RHKA 3F9MA 3LDOA 3MN9A 4YDUC 3U8XA 4A57A 4C1NK 4FWQA 2BH1A 4EHUA 4YOVA 1W97L 3FE1A 4PL7A 1W2BM 1VQON 3H46O 3OW2M 3O9TA 1U2VA 3EL2A 4DKWA 4BRCA 4GNIA 3M5RA 4RCHA 2IVOA 4BC3A 2FSJA 4BRFA 3VETA 3CC4N 2VGNA 1JCFA 2V51B 1E4GT 3KZBA 3MDQA 4K43A 3QFUA 1QHAA 5B8HA 3CERA 4OPAA 2I7PA 3ATVA 4A5BA 2Q0RA 1YITN 3VEOA 5JVHL 5KPRA 4WFAL 3DLLL 5LJVA 3I55N 1HJOA 2Q2RA 3BP8A 4FWMA 3UKRA 4CD3A 5DM6L 1T44A 2P9LB 4FWLA 1BA0A 2ZGYA 5BRHA 5FPNA 2E20A 1Q86O 1NJIO 3VENA 3KWGA 4XH1A 3F2KA 3VEVA 2JWKA 4CZEA 2HOEA 4FPBA 4IOXA 3SMPA 5BN8A 2ASMA 3MN7A 1YJ9N 1YHQN 5AR0A 1X3NA 3WEEA 2E1YA 4PKGA 4GVEA 2GWKA 3D6RA 2VYPA 3G4SN 3BEXA 1NGFA 4CZKA 3S41A 3ZYYX 3C7NB 3TSUA 5GIOA 4A59A 2DPNA 1QQOA 3SK3A 1XC3A 1NGGA 3FZLA 2PAVA 4JD2B 3ZX2A 4JK8A 3U9DA 3H1VX 2QWOA 3G6EN 3ENBA 3O6WA 5AZJB 4KH5A 1BWFO 2P9IB 2WUSA 3VGMA 5M1PA 5MLCQ 4CZMA 3AARA 1IG8A 3GE1A 3CQYA 4ISEA 2D0PA 4JKGB 3CMAN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDB A;  4MDA A;  5HOO A;  4U7B A;  5CR4 A;  3HOT A;  2F7T A;  3HOS A;  3K9J A;  3K9K A;  3F2K A;  4R79 A; 
#chains in the Genus database with same CATH topology
 3C65 A;  3M6G A;  4JRQ A;  3C0B A;  4DSI A;  2QW9 A;  4Q0B A;  3GOI A;  1ILY A;  4FO0 A;  3WEE B;  3ZT2 A;  2HHT A;  2I5J A;  4A5A A;  3S3M A;  4CF9 A;  3SBT A;  4I9L A;  2P9N A;  4QS7 A;  3UKU A;  3DI6 A;  3ZCM A;  4BRQ A;  5AQQ A;  4IWV A;  2IAJ A;  4FLY A;  1W9H A;  4JKB A;  4CJ7 A;  2YHB A;  4F2R A;  1GLE G;  2OTJ N;  3HXM A;  1ASW A;  3KD1 E;  3AAQ A;  3LDL A;  4YY3 K;  4FJ8 A;  4KV8 A;  4QOZ B;  2JGU A;  5JLF A;  1JXB A;  4W5N A;  1LWC A;  2QWQ A;  4DG1 A;  2HHQ A;  3RRH A;  1LW0 A;  3L4Q A;  3LPU A;  4CD1 A;  2P9U B;  4YOW A;  4DFP A;  3EKU A;  4OO1 J;  1Y64 A;  3CHW A;  1EKE A;  4FJJ A;  1ATS A;  4DTR A;  1FXX A;  3ZSQ A;  1JLQ A;  2HHH K;  4WFN L;  5KRT A;  3KVG A;  1JCG A;  1KLM A;  1V4T A;  5AQM A;  4H5V A;  4B9L A;  3ASM A;  4B08 A;  3VQE A;  3C7N A;  1HYS A;  3VOV A;  3CCR N;  4LH4 A;  4FVM A;  5BPN A;  5AQK A;  3OA9 A;  2UYT A;  1JLB A;  3EE9 A;  1YF5 L;  2QWM A;  3IAY A;  2V7Z A;  4DFM A;  3KIO A;  5AZI A;  4L3Q A;  5AQW A;  4MLE A;  2A40 A;  1J53 A;  4DQS A;  3MWT A;  4BR4 A;  3O4W A;  3VF2 A;  3F5T A;  4CK2 A;  2GBZ A;  1SUQ A;  3MMV A;  3R3L A;  1X9J A;  3M8P A;  5H1S Q;  2V52 B;  4BRD A;  4LF7 K;  1RT7 A;  2P9P B;  3THY A;  2B5J A;  3ZX3 A;  2HF3 A;  1IBM K;  4DR7 K;  4YOY A;  2BAN A;  4HVJ A;  4IFE A;  3HBT A;  3HZ6 A;  3MXI A;  2E2O A;  4J2B A;  1VSJ A;  1RT4 A;  2HF4 A;  4KHY A;  4YOT A;  4BR2 A;  3R1X A;  2VG5 A;  3VMF B;  5AZI B;  2VCP A;  4BQZ A;  1U4B A;  3JSM A;  3P4I A;  3AVI A;  1VSF A;  3AAP A;  1VQ5 N;  3AA5 X;  5GIN A;  4J2A A;  4BRL A;  3QIP A;  5GAG P;  2YHA A;  4DFJ A;  4NYN A;  3OYC A;  2QWL A;  4JKC A;  3RR7 A;  1HQU A;  1KAY A;  1E3M A;  1C1C A;  2FSN A;  5M1F A;  4PKH A;  3AO2 A;  4DF4 A;  2OZS A;  3OHR A;  4FWP A;  1NLV A;  1LCU A;  5GAD P;  4H03 B;  5JLH A;  4OJR A;  2JWL A;  4CBU A;  3EZ5 A;  4KKO A;  4DS4 A;  4FLU A;  3A0I X;  1QZ6 A;  2O8F A;  3EN9 A;  4CJE A;  4K8X A;  3CXC M;  3QO9 A;  1DTT A;  2RPI A;  5E84 A;  1O13 A;  4FWN A;  2NRZ A;  4DF8 A;  1HR0 K;  2NLX A;  3SPZ A;  3AVH A;  3TI0 A;  4DV4 K;  2W40 A;  2E1Z A;  4Z0U A;  1HX1 A;  1YT3 A;  3K5O A;  4E89 A;  1NK0 A;  1VQK N;  1KRP A;  4U67 L;  1JLE A;  2FSK A;  4M3Y A;  1MDU B;  3JAM O;  3UIQ A;  5KQ8 A;  2WTU A;  3KKR A;  1YVN A;  2AA4 A;  3D2E B;  4KHN A;  5F0X A;  3OYA A;  1HJR A;  2P9S A;  4F3T A;  3RMC A;  2E8A A;  3ZET A;  4MLH A;  1WOQ A;  3NAE A;  4CGH A;  4CGD A;  2VG7 A;  3G71 N;  1ATR A;  3QDK A;  1JL2 A;  1OH5 A;  4O8K A;  3NH1 A;  1NOZ A;  3HL8 A;  4JI5 K;  3L3V A;  3O4N A;  1B9F A;  1Q18 A;  2ZD1 A;  2QTD A;  2YKN A;  4CEF A;  4FOE A;  4B1X B;  2ZF5 O;  3THX B;  1NOY A;  1O1W A;  2D0C A;  2A3Z A;  3T69 A;  3ULE B;  5BRE A;  1L3S A;  3B6P A;  1TUU A;  4BE0 A;  1RTD A;  3U4L A;  1VQM N;  1UA1 A;  4QS9 A;  3PX4 A;  1WBB A;  3J7Y P;  1L3U A;  2ZM6 K;  1XUP O;  4JKE A;  3U3Y A;  1JKH A;  3D45 A;  4AHU A;  4CEE A;  4BRN A;  3MEG A;  3HPG A;  1U6Z A;  3EKS A;  3SJH A;  1YAG A;  2DFH A;  3RMD A;  3G10 A;  4BR0 A;  2Q97 A;  4CHZ A;  4KRF A;  4FM0 A;  3DLR A;  4CEQ A;  3VGK A;  4B3R K;  2G8V A;  3G25 A;  3L8B A;  5AQT A;  3ZSY A;  3BDP A;  3L2Q A;  3SLC A;  4JK9 A;  5FRO A;  4FJN A;  3J7A P;  3O3H A;  3MEE A;  3OYH A;  3ITH A;  4BWM A;  3T3F A;  2HMI A;  1K8K A;  3WXK A;  3WNF A;  2J4R A;  5J1E A;  4JKF A;  3MCA B;  4CZG A;  1YTA A;  2D0B A;  1H1V A;  1WAF A;  3CC7 N;  1TV6 A;  1K73 O;  2FBY A;  5F1X A;  1HNI A;  3QBX A;  3ENO A;  4CJL A;  3ID6 A;  1NU0 A;  4F9O A;  4B9M A;  3UKR B;  3VQ8 A;  3ULD A;  3P83 D;  3SAH A;  3AVN A;  1CZB A;  4BR9 A;  2R7Y A;  4DQP A;  1BQN A;  1NMN A;  4X62 K;  4AM7 A;  2YHY A;  3QML A;  3VA3 A;  3P1G A;  5JS2 A;  2G8I A;  4JK7 A;  1K8K B;  1KD1 O;  1DKG D;  4KI4 A;  1NMD A;  3SYZ A;  4PKI A;  4AHT A;  2UUC K;  4OPH A;  1FW6 A;  4KHW A;  3CCU N;  1HKC A;  3RWU A;  4JV5 K;  3R9P A;  1ZBI A;  3OVN A;  5HLF A;  3CF5 L;  2UU9 K;  2NRW A;  5K14 A;  4JN4 A;  3OS0 A;  1KAZ A;  3TAB A;  1RT2 A;  4NB4 A;  4EIA A;  4BRO A;  4KHS A;  1BIZ A;  3HYF A;  3SUN A;  4LFB K;  3W3D A;  1QSL A;  1VQN N;  1I3A A;  4CJU A;  1ESV A;  2P1J A;  1NKE A;  3VQQ A;  2PFU A;  1W7A A;  1GLJ O;  1TYQ B;  2JLE A;  5I42 A;  2HST A;  3HI0 A;  3LAL A;  3CCQ N;  2HHW A;  3SAG A;  4O0J A;  4M3U A;  3ID8 A;  3LZI A;  2KFZ A;  3OS1 A;  4IJN A;  2A1S A;  3AO1 A;  1YIJ N;  3JYT A;  3FZK A;  3T1Y K;  2Q0U A;  1VQ7 N;  4FZX C;  2YX6 A;  3QIN A;  1FKP A;  1G99 A;  2KTQ A;  3F9M A;  1RTI A;  3MN9 A;  3TAG A;  4C1N K;  4FWQ A;  1IH7 A;  4YOV A;  1VQO N;  2EHG A;  1U2V A;  1QSY A;  4BRC A;  1WSF A;  3AA4 A;  3PY8 A;  2IVO A;  4BC3 A;  2X74 A;  5AJ3 K;  3KZB A;  3HST B;  2I7P A;  3ATV A;  1EET A;  2Q0R A;  2X6N A;  4CD3 A;  2VWJ A;  3BP8 A;  5DM6 L;  4JS5 A;  4CIF A;  1L3V A;  4LFA K;  2P9L B;  2O8C A;  1KVB A;  5BRH A;  2E20 A;  3THW B;  3DOK A;  3F2K A;  1XNQ K;  2JWK A;  3QEP A;  1RBV A;  3SMP A;  4J2E A;  1RDD A;  3MN7 A;  4PKG A;  5FRN A;  2GWK A;  4NCB A;  2VYP A;  3DMJ A;  4LF5 K;  3S41 A;  5SWM A;  3IRX A;  2DPN A;  1QQO A;  4CGG A;  3SK3 A;  4DR5 K;  3KK1 A;  1XC3 A;  1NGG A;  3FZL A;  2PAV A;  4FW1 A;  1QHT A;  4JK8 A;  3T19 A;  3OYG A;  3U9D A;  2ZQB A;  4OX9 K;  4CHO A;  3O6W A;  1UWB A;  3C95 A;  3VGM A;  1NKB A;  4CZM A;  4E7I A;  1KSP A;  4CFC A;  1HKB A;  2E6L A;  4Y0W A;  5FRM A;  5LY3 A;  2FBX A;  1HNW K;  1CZA N;  4LF6 K;  5EU7 A;  3FGU A;  2OPR A;  1XC9 A;  4A61 A;  3BGR A;  3O08 A;  3VQC A;  4B1U B;  2B6A A;  3NH2 A;  1P8Z A;  1Q7Y O;  1ZBH A;  2NRR A;  4CW7 B;  1ZBF A;  4M3R A;  3V81 A;  3WXM B;  1NKC A;  3N4P A;  4DS5 A;  2Q36 A;  5EY4 A;  3L3U A;  1HPM A;  1LW2 A;  2IIR A;  3LWL A;  5AQP A;  1HQE A;  1BCO A;  4E7L A;  3WUH A;  3AY9 A;  3K2P A;  5BPL A;  2O8B A;  4B1Z A;  3L2W A;  3NGZ A;  4K42 A;  4FLT A;  3QER A;  3IMX A;  3HT3 A;  3NDK A;  3TSQ A;  5C12 A;  2DTU A;  3WQU A;  4FWR A;  1P90 A;  4HCB A;  4CES A;  1QZ5 A;  4O0I A;  2YNI A;  2QKB A;  4BRG A;  3DLB A;  4CFA A;  1SKW A;  4OKJ A;  2YHW A;  4FL9 A;  4HTL A;  1MA9 B;  1FJG K;  2IVP A;  3SV4 A;  4DTU A;  3E9O A;  4AHV A;  3AVL A;  4L8R B;  3LDN A;  2KZZ A;  2ITM A;  1BCM A;  3NCI A;  4DMN A;  1CZ9 A;  2O8B B;  3WXJ A;  4O4G A;  3LAM A;  1RT5 A;  3O8M A;  3GDQ A;  3E1Y A;  3KLG A;  4E7H A;  1JLF A;  1NG9 A;  2P5O A;  4PUO A;  4AM6 A;  4CZF A;  3HP6 A;  1QS4 A;  2E2Q A;  4LSL A;  1YJN N;  1C0F A;  3ZT3 A;  2YJE A;  4JEP A;  4CHY A;  5AZJ A;  3CQ8 A;  1ITG A;  2P9I A;  4Y1D A;  4CJS A;  2BUP A;  3PX0 A;  3CCS N;  3K0S A;  3THV A;  3DWL A;  4BDP A;  5C42 A;  4ICL A;  1Y97 A;  3NF8 A;  4CIG A;  3A8Y A;  2P5G A;  4FSV A;  2ZGZ A;  2EWS A;  5JMV A;  2UUB K;  4WQ5 A;  3ATU A;  4H5R A;  3MCP A;  2W42 A;  3QFP A;  1S1V A;  3K5N A;  1NJY A;  3OTO K;  4LF8 K;  2P51 A;  2E2P A;  4KFB A;  2BDP A;  3CG7 A;  1XHX A;  5KI6 A;  3SQ2 A;  1RDA A;  2YCH A;  1RDW X;  1D5A A;  3CD6 N;  1BGX T;  3F9K A;  1Q82 O;  5AQO A;  3O9Q A;  4CGI A;  3AVG A;  4DTS A;  4KB1 A;  3FLC O;  2UXB K;  1HNV A;  1VSE A;  3DOL A;  1ATN A;  3WNH A;  4C1N I;  3OYF A;  4C8L A;  1D9D A;  1QQM A;  3L2R A;  1HMV A;  4CJ3 A;  1KXP A;  4JI1 K;  1NK8 A;  4C8N A;  2NZT A;  3U9Z A;  4BC2 A;  3DLK A;  3VA0 A;  1SL2 A;  4B9U A;  3AA3 A;  1GLB G;  2P9U A;  4ISF A;  4DTM A;  4JS4 A;  2A41 A;  4BRE A;  4B9N A;  4H0Y B;  4BAC A;  1EO1 A;  3ZX0 A;  3OJS A;  2PZS A;  2FXU A;  3FR0 A;  2ASO A;  2HVI A;  4DSJ A;  4BR7 A;  1IBL K;  2HVH A;  4RTF D;  3MED A;  4KTZ A;  3OYJ A;  2Z1I A;  4DR2 K;  2YNG A;  4IKF A;  1RTJ A;  3GL1 A;  1OH7 A;  4FK0 A;  4BG9 A;  2WBN A;  1X9W A;  2UXC K;  3R8E A;  2G8K A;  4CHQ A;  3LWM A;  4LC9 B;  5EX5 A;  4AQY K;  2AP1 A;  2RF2 A;  4CEC A;  1VAZ A;  4KI6 A;  3AGK A;  3BF3 A;  1OVQ A;  1S5J A;  3KKS A;  4GKK K;  1KVC A;  3O1W A;  4G1Q A;  4MO4 A;  1NK5 A;  1BU6 O;  2F8T A;  1J5E K;  3TPQ A;  4ZHR A;  3TTC A;  3TAF A;  1EP4 A;  3TAN A;  2P9P A;  1LAV A;  3EEQ A;  4J8F A;  4CBW A;  4H0P A;  1U04 A;  4TSX A;  1SKS A;  1KVA A;  1C1B A;  1GOA A;  1WNS A;  4GY2 B;  3SUO A;  5AQX A;  4CED A;  3QBW A;  3J80 O;  3EO3 A;  4DLG A;  4EP4 A;  3J7Z O;  4IBN A;  3H6E A;  4JNE A;  2E5L K;  3CM5 A;  4NCA A;  1TL1 A;  4EFH A;  3PUF A;  3AVF A;  4DR1 K;  3NBP A;  3HOT A;  1N6Q A;  4CJR A;  4JI3 K;  5KPZ A;  1BI4 B;  1DGK N;  4WF9 L;  3VGL A;  3HO1 A;  4OLA A;  1VRT A;  4CEO A;  4IO8 A;  2G8F A;  3V9X A;  1WB9 A;  3V1R A;  3VEX A;  4CI6 A;  2QI2 A;  1JLG A;  1N5Y A;  3AO5 A;  1QQC A;  1NGA A;  4MDB A;  3LDQ A;  1L5U A;  4JI6 K;  1IKV A;  4W5R A;  3Q7B A;  1JLC A;  1NGI A;  3V9U A;  3CPE A;  3AA2 A;  1IG9 A;  4H0T B;  4E7K A;  3QEI A;  5GAE P;  5FPE A;  3ALY A;  5AQN A;  3MK6 A;  4K41 A;  2DFE A;  2GEM A;  1WSG A;  3DRP A;  5BRD A;  4KBO A;  1TGO A;  3OYI A;  4YOX A;  3W0L A;  1KAX A;  1BG3 A;  2KLA A;  4CJ5 A;  4FJ5 A;  1TUY A;  3ZSV A;  4FK4 A;  4DSL A;  4DLE A;  4CE9 A;  4N41 A;  1VSI A;  3D2E A;  4IFV A;  5AQS A;  4M41 A;  2ATQ A;  4CHN A;  2ZWH A;  1HLU A;  3C6U A;  4IDK A;  4DSK A;  2HBJ A;  3OYK A;  1TK8 A;  2D4W A;  4DV1 K;  4IJA A;  3E9L A;  2PYJ A;  2RE2 A;  5LL6 Z;  3CJ1 A;  4O55 A;  4LFC K;  4X64 K;  2G8U A;  4PWD A;  5BR8 K;  4U7B A;  4Z4E A;  2NRX A;  4AH9 A;  1YI2 N;  2O4I A;  3THX A;  5AQV A;  1KFD A;  3ULE A;  4LY7 A;  1HYZ A;  2FF3 B;  2CH6 A;  4ILG B;  5HRP A;  1RT3 A;  3K57 A;  1MU2 A;  1HUX A;  3OS2 A;  4CZL A;  1RDC A;  3CIP A;  1D9F A;  5A2Q O;  2GX9 A;  2GUP A;  2F9T A;  4BR5 A;  2FBT A;  3KWI A;  4M63 C;  3CCE N;  3SQ4 A;  4OPK A;  4H0O A;  2HB5 A;  3P39 A;  3CCM N;  3DRS A;  1EWR A;  4JI4 K;  3DLE A;  4JKA A;  3I56 N;  1TK0 A;  1RIL A;  4DQQ A;  1REV A;  3LP2 A;  4I7F A;  1VQ8 N;  4E1J A;  4DV0 K;  2PBD A;  3CJ9 A;  1KQS M;  4A57 A;  3U8X A;  3FE1 A;  3NF9 A;  4PL7 A;  1W2B M;  3TAE A;  4M3T A;  3H46 O;  1T7P A;  3QEV A;  3ZT0 A;  2VG6 A;  2FC0 A;  4J2D A;  4KTW A;  3VET A;  3AVB A;  3QLH A;  2HW3 A;  4OPA A;  1ZBL A;  3SJJ A;  3HPH A;  5JVH L;  3DLL L;  4B3M K;  1Z26 A;  1X1P A;  4I2P A;  3UKR A;  4CEZ A;  1OH8 A;  1T44 A;  1UOC A;  1NJI O;  5FPN A;  3CFR A;  3VEN A;  4CHP A;  3KTQ A;  4XH1 A;  4CZE A;  4CK1 A;  1WLJ A;  1TKZ A;  3HP9 A;  4KAZ A;  5AR0 A;  1DLO A;  3D6R A;  3VQD A;  4CZK A;  1DTQ A;  1UA0 A;  4JI7 K;  4NCG A;  3ZYY X;  4GMJ B;  3TSU A;  5GIO A;  4C8K A;  5I3U A;  4JD2 B;  5KTQ A;  3NFA A;  5CZ2 A;  3PSI A;  1C0U A;  3RTV A;  3ENB A;  5HRN A;  4DTJ A;  2B4J A;  4RW4 A;  1TKD A;  1IG8 A;  3O3G A;  4K8Z A;  5IWA K;  4ISE A;  4JKG B;  1K6Y A;  3T1A A;  3HK2 A;  2UXD K;  2QK9 A;  2H3G X;  4AIL C;  1S72 N;  3A5M C;  1TYQ A;  4IO9 L;  4DTX A;  5FPM A;  1YUW A;  2D0O A;  4YDU A;  3CM6 A;  4OKK A;  5EVZ A;  4C8M A;  4AHS A;  4DV6 K;  3QEW A;  4M42 A;  3AV9 A;  1HNX K;  4IEE A;  3V6D A;  4FW2 A;  3O3F A;  1J54 A;  5KPT A;  5AQF A;  2QWR A;  1NJZ A;  2OPS A;  2CGK A;  1NK9 A;  1QVF M;  1RBR A;  5I9E B;  1CXU A;  3L0Q A;  3RSE B;  4DQR A;  4M45 A;  3V9S A;  3VF4 A;  4BRP A;  3PLA A;  1WAJ A;  4CGF A;  4NLB A;  2HBK A;  4DB3 A;  4DU1 A;  2OTL N;  3B8A X;  4B9S A;  4O8U A;  1HYV A;  2HBL A;  2WFB A;  2KHO A;  3U6F A;  1DEJ A;  3ISN C;  1C0G A;  1QQN A;  4K0K K;  2E88 A;  4N5S A;  1SZ2 A;  4M7Y A;  4Z4G A;  3MN6 A;  4RWT A;  4FLV A;  3VES A;  3H3O B;  4H8K A;  3SQ0 A;  4IOA L;  2X78 A;  3D0P A;  2YNF A;  2UUA K;  3E01 A;  5DM7 L;  3FZF A;  4AHC A;  2VGM A;  4DWI A;  2P9L A;  3MX2 A;  3THW A;  5AFU H;  3C6H A;  1X9M A;  3M1F A;  2XY8 A;  4OVL A;  3IFR A;  5E26 A;  2PYL A;  4CJF A;  3TTF A;  4O5F A;  5CE3 A;  2KZM A;  1U48 A;  3VTI A;  4HTU A;  1IKW A;  4F3O A;  4B8C A;  1V4S A;  5F2R A;  1LWF A;  4CBX A;  3HM8 A;  1NK6 A;  3TTD A;  3NF7 A;  4GKJ K;  3RR8 A;  2RKI A;  2F8S A;  1F21 A;  4KPY A;  4FWS A;  2Z1H A;  1SKR A;  4H0X B;  1J9A A;  4CIE A;  1T3V A;  2ZJQ L;  3KD5 E;  2NRH A;  5AQH A;  5TKW A;  5HRR A;  4DTP A;  1WSE A;  3MX5 A;  3MN5 A;  3UE5 A;  2YNH A;  3CFP A;  3O80 A;  4DU3 A;  4DR6 K;  3LM2 A;  4F8R A;  2F7T A;  3K59 A;  3NVM A;  4BGA A;  1NGE A;  3DXK A;  3T1H K;  4JI2 K;  3UB5 A;  1FK9 A;  4QS8 A;  1RTH A;  2W41 A;  2G8H A;  3SBG A;  4CJ4 A;  4AHR A;  2G8W A;  3DXM B;  3VF6 A;  2XY5 A;  1BL3 A;  3S9H A;  1SAZ A;  3QES A;  1G15 A;  1KC8 O;  1WUA A;  3HM9 A;  4PL8 A;  1OVY A;  2Q1N A;  1S22 A;  3MEC A;  4GW6 A;  4H5W A;  1SQK A;  3LP1 A;  1S1W A;  2O8D A;  1TVR A;  4DUY K;  4PA1 A;  2A42 A;  1QSS A;  3QIC A;  4HWI A;  3AVK A;  2KW4 A;  3H08 A;  1OKJ A;  3TR8 A;  1L3T A;  1S6P A;  2E4L A;  3DXK B;  4EHT A;  1EX4 A;  4H5T A;  4DSF A;  3JXU A;  2QWN A;  3BZC A;  2IOC A;  3QB0 A;  4FJI A;  5AQI A;  3J8A A;  1I39 A;  4KB0 A;  4MQ3 A;  3WNE A;  3SAF A;  4YOU A;  4V19 S;  3LDS A;  2XHB A;  4WQ4 C;  3ZLJ A;  1S3X A;  5CYM A;  3OYD A;  3EE8 A;  1QVG M;  3VQB A;  4JAX A;  1RT6 A;  2HHS A;  3Q7C A;  2O8D B;  4CF8 A;  2CGJ A;  2NRT A;  1D4X A;  4HUF A;  5KRS A;  1Z25 A;  3HSC A;  4EAH D;  4FVU A;  4I2Q A;  5FDL A;  5C15 A;  3BY5 A;  3P38 A;  3CC2 N;  4H4O A;  4DV3 K;  3IUC A;  1MWM A;  2V7Y A;  1E4F T;  1Z6R A;  1UAX A;  4BC5 A;  3M8R A;  1S6Q A;  5GIP A;  2F4V K;  5AQU A;  3TU5 A;  4EZ6 A;  4JI0 K;  1S9G A;  2GV9 A;  1T03 A;  3IS9 A;  3EYZ A;  1QE1 A;  1NBW A;  2CGL A;  3LM9 A;  4I6M B;  4IG3 A;  2NUB A;  2HMP A;  1NJW A;  4FZY A;  1X3M A;  2KQ2 A;  2OA8 A;  4WCE L;  2FBV A;  4YOR A;  2WON A;  4BDZ A;  4RW8 A;  3HTV A;  4BDY A;  1GOC A;  3AVM A;  2F96 A;  1TAQ A;  4OGC A;  4FJL A;  1SV5 A;  3JS6 A;  4E1N A;  2HHV A;  3AVJ A;  4FWK A;  4KH4 A;  5M1Q A;  1HKG A;  1NK4 A;  1W0H A;  1VQ9 N;  3C6A A;  4PHT X;  1VQL N;  3NF6 A;  4W5O A;  4CJT A;  1VSM A;  2A5X A;  3M8Q A;  2IGI A;  4CVN E;  5LMU K;  4JHD B;  3WNG A;  2QXF A;  4DV7 K;  2WC9 A;  4FJM A;  3L2U A;  4B9Q A;  2GWJ A;  2BTF A;  4MDA A;  5HOO A;  3SCX A;  5AQG A;  4Z94 A;  5GAH P;  2Q31 A;  4JLH A;  5M1O A;  3EZW A;  4M3X A;  4RG8 A;  3LP3 A;  3T7Z A;  4DCH A;  3A5O C;  3U3G A;  5HP1 A;  1J5O A;  3SZ2 A;  1ZYQ A;  4ELU A;  4B8A B;  4FLZ A;  5BR9 A;  3HRG A;  3PSF A;  4OLB A;  3IKM A;  1JCE A;  5M1N A;  4WE1 A;  4DHY A;  4LD0 A;  1NGB A;  4CF0 A;  2BE2 A;  4BVP A;  3ZEU A;  4JRP A;  2KFN A;  5C25 A;  3AO3 A;  1IO2 A;  3OYM A;  1MWK A;  4RW9 A;  2CH5 A;  3ZSW A;  1WSI A;  2VWK A;  4OGE A;  1K9M O;  4UQG A;  3CCL N;  4BRA A;  2HHX A;  4XEI A;  3TAQ A;  4CJK A;  3NE6 A;  3SNN A;  4CGJ A;  5D3G A;  1VK0 A;  3OJU A;  1S1X A;  2X6S A;  1LWE A;  5C2F A;  2OAN A;  5CYQ A;  5J2Q A;  3E66 A;  3L2V A;  5T7B A;  3KLH A;  4NO7 A;  1RFQ A;  1LOT B;  2A6A A;  3K5L A;  5J2P A;  2HBM A;  4B3O A;  1A5X A;  3ZEU B;  3P5J A;  3DRR A;  4C23 A;  5M1K A;  3TSP A;  4E1M A;  3CYM A;  4NYF A;  4M7X A;  1GLD G;  1ZBU A;  4NLC A;  5KGW A;  4X65 K;  3CJC A;  3K5M A;  2QXL A;  3VEY A;  4E19 A;  4BE1 A;  4ELV A;  3KHY A;  3VEW A;  1IBK K;  2HNZ A;  1VQ6 N;  5BPM A;  4WYB A;  1WBD A;  1BI4 A;  4Z4F A;  3CFO A;  1BOT O;  2P9N B;  1ZBS A;  4HUG A;  5ADX H;  4B3S K;  1KCF A;  5HRO A;  2XY6 A;  4K25 A;  3DJC A;  4YNQ A;  3UKU B;  4W5T A;  4ZTJ A;  3O5B A;  5AQL A;  3LPT A;  1U45 A;  1VHX A;  5LMN K;  2YHX A;  4YHH K;  5J2M A;  4A2A A;  3LDO A;  1N36 K;  2BH1 A;  4EHU A;  4FJH A;  3I0R A;  2OPQ A;  3OYN A;  3TAR A;  2OZM A;  3OW2 M;  3O9T A;  3EL2 A;  4DKW A;  3ZSR A;  1TKX A;  4GNI A;  2XRI A;  1WSJ A;  3LP0 A;  1TK5 A;  2FSJ A;  3MXJ A;  1C0M A;  4K43 A;  1BQM A;  5B8H A;  3CER A;  3OYB A;  4A5B A;  3V4I A;  3RMA A;  1YIT N;  4WFA L;  3I55 N;  1HJO A;  2Q2R A;  1KFS A;  3NHG A;  1R0A A;  3FFI A;  3KWG A;  4ID5 A;  1ASU A;  2HOE A;  4FPB A;  4RW6 A;  1ASV A;  2ASM A;  1C0T A;  1X3N A;  1Q9X A;  3VQ5 A;  4EZ9 A;  3G4S N;  3BEX A;  1NGF A;  3O4Q A;  3C7N B;  4FM2 A;  4A59 A;  3RMB A;  3ZX2 A;  1T8E A;  1RBS A;  1RBU A;  3H1V X;  1NJX A;  2RN2 A;  4CCH A;  3QNO A;  1HRH A;  4KH5 A;  2WUS A;  2XO7 A;  3HPO A;  4B3T K;  4R5P A;  3AAR A;  4CEB A;  4CEA A;  5CZ1 A;  4IZ9 A;  2D0P A;  4H5N A;  3ENH A;  3KLE A;  1J6Z A;  1GLL O;  2IDO A;  1JXE A;  3NVK A;  3OBY A;  3CCJ N;  3O9R A;  3FZM A;  3THY B;  2IVN A;  2Y1J A;  3FZH A;  3DAW A;  5JS1 A;  4FZZ A;  1RGI A;  5DK5 A;  3EY1 A;  2PY5 A;  4B1Y B;  3CI5 A;  3CJA A;  5CY4 A;  4DFK A;  3ZSZ A;  4WQ5 C;  3CME N;  4FXD A;  1OH6 A;  4Q5V A;  1BDG A;  5KQD A;  4IEI A;  3LAK A;  1WSH A;  1U47 A;  5AQZ A;  4JYA K;  4A2B A;  3OBW A;  4MFB A;  3V1O A;  2ETJ A;  3SQ1 A;  4DQI A;  3O9S A;  3L4I A;  1RBT A;  2XY7 A;  1YTU A;  4E7J A;  2I7N A;  1RT1 A;  2EX3 A;  1RDB A;  4G9Z A;  2O8F B;  4CFD A;  5BN9 A;  4JI8 K;  1NM1 A;  3M8S A;  3DLH A;  4XH4 A;  1C6V A;  2QM1 A;  3L6Q A;  3MAQ A;  5AFU A;  3OY9 A;  1GLF O;  3SI6 A;  4B1W B;  3FFK B;  3PIO L;  2QWP A;  2ZE2 A;  1S1U A;  1IKY A;  3LDP A;  1EXQ A;  3V1Q A;  3WQT A;  4CER A;  3ZT4 A;  2Y1I A;  4CF2 A;  4NXM K;  3KJV A;  1I94 K;  4XIU A;  4JD2 A;  1S9E A;  3KK3 A;  1WN7 A;  1N32 K;  1U49 A;  3TAM A;  1RCH A;  3O9U A;  1XHZ A;  2O8E A;  1Q9Y A;  3B6O A;  3VQP A;  2ASP A;  2BGG A;  2P9S B;  3NGY A;  3N4Q A;  3ZET B;  3K9J A;  5HBM A;  2HNY A;  4JKG A;  4R79 A;  2W6K A;  4A62 A;  4E0D A;  1M1K O;  3KLI A;  1IJJ A;  3A5L C;  3HOS A;  4DU4 A;  4WQ4 A;  4F2S A;  1BIS A;  3SMS A;  1GLA G;  1YJW N;  4M3W A;  3S3O A;  1XWL A;  3PV8 A;  1XNR K;  3LZJ A;  4FYD A;  3MWP A;  4M3Z A;  4BGB A;  2WOM A;  3KK7 A;  4B9T A;  4B9V A;  4ILH A;  2O8E B;  3S3N A;  3PIP L;  1T6C A;  1RDU A;  3I0S A;  5IT9 O;  3RSE A;  4GV3 A;  4CFB A;  4MO5 A;  1NGD A;  5C0Y A;  4CZH A;  3QEX A;  2OPP A;  1TAU A;  3P31 A;  4WFB L;  1HPZ A;  4DUZ K;  2W6L A;  1BO5 O;  1NK7 A;  4QAG A;  5AQJ A;  3GG4 A;  3QNN A;  3RRG A;  1C1A A;  1JL1 A;  1NGH A;  3G0Z A;  1EQY A;  4GV9 A;  4IG0 A;  4FK2 A;  4Y1C A;  4EP5 A;  4FPA A;  4FLW A;  1YVU A;  3VEZ A;  4CZI A;  1IV0 A;  4CF1 A;  3BZK A;  4KTQ A;  3A5N C;  4FJG A;  1NGC A;  5AQR A;  3NH0 A;  3PO5 A;  4BRM A;  4DR3 K;  3TAP A;  2YJF A;  4BY9 C;  3AO4 A;  1N34 K;  3SV3 A;  1EWQ A;  3I8D A;  4Z4H A;  4IXC A;  2LSN A;  4ID1 A;  3F73 A;  2F9W A;  2O4G A;  1SS6 A;  3VQ9 A;  2ZJR L;  5FLX O;  1VQ4 N;  2VWB A;  4Z4I A;  3KLF A;  3LAN A;  2YI1 A;  1NWK A;  3VPZ A;  3GBT A;  3TWH A;  1T05 A;  3I33 A;  3A2F A;  3DYA A;  4E3S A;  5BRF A;  1R59 O;  5HRS A;  2QKK A;  5DMR A;  3ZT1 A;  3NGI A;  3CJB A;  2D1K A;  4GV6 A;  3VER A;  5KGX A;  4C8O A;  4ZTF A;  1LV5 A;  4JKD A;  2FF6 A;  3CCV N;  4CJP A;  3D2F A;  2KKZ A;  1DT9 A;  3WT0 A;  2VQE K;  5TKY A;  2NNW A;  3DLG A;  5CR4 A;  4ELT A;  4CK3 A;  4FJK A;  4LH5 A;  3J81 O;  3KK2 A;  3DXM A;  4JKH A;  4W5Q A;  5EXW A;  3LL3 A;  5CHI A;  1CLQ A;  2YV0 X;  4BVO A;  4KHQ A;  4HUE A;  3QET A;  5AQY A;  4DQ8 A;  4LSN A;  4BRI A;  5FPD A;  4CJV A;  5JVG L;  1K8A O;  2GEL A;  3RVC A;  3D2F B;  4BG8 A;  1VRU A;  2E2N A;  4BE2 A;  1NNE A;  2FLO A;  4DSE A;  4DV2 K;  5J2N A;  3PX6 A;  1JJ2 M;  1VQP N;  2IC3 A;  4ILJ A;  2QEX N;  2HHU A;  1A5V A;  5ELZ A;  4OPJ A;  3PO4 A;  1VSH A;  4O44 A;  3CQX A;  5HL7 L;  3HJF A;  1N8R O;  1Q81 O;  3CPW M;  2D5R A;  3HVT A;  3SUP A;  1ZC6 A;  4FWO A;  4N56 A;  3H45 C;  1N33 K;  2A1R A;  1GLC G;  4N76 A;  3QIO A;  2HND A;  4ISG A;  3CET A;  1U2V B;  4DTN A;  1XMO K;  3IG1 A;  2ZJP L;  4PY5 A;  3E9P A;  4CZJ A;  3K9K A;  3OYE A;  2AJQ A;  3IDH A;  4BRH A;  1BA1 A;  3OYL A;  3H1Q A;  1GOB A;  2O8C B;  4H4M A;  1T6D A;  3M3Z A;  4I6M A;  2GTD A;  4BRK A;  2IS3 A;  1B92 A;  3V9Z A;  2Z1J A;  4IDH A;  4FJ7 A;  4AF1 A;  1YXQ A;  4YFU A;  4CJQ A;  2VQF K;  4XH5 A;  3WXI A;  1LAW A;  3BUZ B;  4O5B A;  1VSK A;  2QA4 N;  1B9D A;  4KHP K;  3VQ4 A;  4Z4C A;  1ZXO A;  1BHL A;  4KHU A;  4B1V A;  1TL3 A;  4KRE A;  1XQS C;  1X9S A;  1TKT A;  1Q8I A;  3K58 A;  3AVA A;  4BC4 A;  3CJ7 A;  4LF9 K;  4FOI A;  3SUQ A;  2P9K A;  1BUP A;  3WXL A;  1RNH A;  2ITG A;  2D0A A;  3VTH A;  4H0V B;  3AVC A;  1HNZ K;  4NXN K;  3D7E O;  4IFY A;  4BQL A;  3DM2 A;  3C94 A;  1FKO A;  3I8B A;  1Z05 A;  4HHT A;  1IKX A;  4JHD A;  3C6T A;  2NRV A;  5SZT A;  1M90 O;  4DV5 K;  4HCC A;  4FJ9 A;  3VQ6 A;  1KTQ A;  3O1B A;  2DFF A;  3NMU A;  3H3N O;  4KH6 A;  3V9W A;  1NGJ A;  5ADX A;  3R6M A;  4FCY A;  5LJW A;  1A5W A;  5EOY A;  3AGR A;  5C10 A;  5C2D A;  4DR4 K;  4IOC L;  2P9K B;  3BF1 A;  3ZSO A;  5JIC A;  2YKM A;  4GVM A;  4YDU C;  2RHK A;  4KO0 A;  1XMQ K;  4CJW A;  2OCE A;  2GUI A;  1W97 L;  4X66 K;  4FJX A;  1SL0 A;  3M5R A;  4RCH A;  4BRF A;  3CC4 N;  2Q3S A;  2VGN A;  1JCF A;  1S1T A;  2V51 B;  1QTM A;  1E4G T;  3MDQ A;  3QFU A;  1QHA A;  1XI1 A;  3VEO A;  2OYQ A;  5KPR A;  5LJV A;  4UY8 O;  4FWM A;  1KLN A;  2E6M A;  4FWL A;  1BA0 A;  2ZGY A;  1Q86 O;  3HVR A;  3VN5 A;  4DTO A;  3VEV A;  3ZSX A;  4IOX A;  1CXQ A;  5BN8 A;  1VSD A;  1YJ9 N;  1YHQ N;  3WEE A;  3SPY A;  4LF4 K;  2E1Y A;  4F4K A;  1BIU A;  4GVE A;  4N47 A;  4OKE A;  1SL1 A;  4FM1 A;  4I9Q A;  1VSL A;  5C24 A;  2Z1G A;  4RW7 A;  4PQU A;  1JLA A;  3G6E N;  3VQA A;  2QWO A;  1D8Y A;  4BWJ A;  5AZJ B;  4FLX A;  3MXM A;  2DY4 A;  1BWF O;  4QCL A;  2P9I B;  5M1P A;  5MLC Q;  3VQ7 A;  5E41 A;  3GE1 A;  3CQY A;  3CMA N; 
#chains in the Genus database with same CATH homology
 3C65 A;  3M6G A;  1HKB A;  4H5N A;  3C0B A;  3ENH A;  2QW9 A;  1J6Z A;  1GLL O;  4Y0W A;  3GOI A;  2H3G X;  1S72 N;  1ILY A;  4FO0 A;  5LY3 A;  3A5M C;  3NVK A;  1TYQ A;  3WEE B;  1CZA N;  3OBY A;  3O9R A;  3CCJ N;  3FZM A;  5FPM A;  4IO9 L;  1YUW A;  2IVN A;  3FGU A;  3FZH A;  2D0O A;  4A5A A;  4A61 A;  4YDU A;  3O08 A;  5EVZ A;  3DAW A;  3SBT A;  4B1U B;  4IEE A;  2P9N A;  1RGI A;  1Q7Y O;  1P8Z A;  5KPT A;  4QS7 A;  2NRR A;  5AQF A;  4B1Y B;  3CI5 A;  3UKU A;  2QWR A;  4BRQ A;  3CJA A;  2CGK A;  4WQ5 C;  5AQQ A;  3WXM B;  1QVF M;  3CME N;  5I9E B;  3L0Q A;  3N4P A;  3RSE B;  2Q36 A;  4IWV A;  5EY4 A;  1BDG A;  1HPM A;  2IIR A;  3VF4 A;  4IEI A;  4BRP A;  4JKB A;  4CJ7 A;  5KQD A;  3PLA A;  5AQP A;  4NLB A;  1GLE G;  3WUH A;  3AY9 A;  5AQZ A;  2HBK A;  4DB3 A;  2OTJ N;  4A2B A;  5BPL A;  3OBW A;  4B1Z A;  2OTL N;  3B8A X;  4O8U A;  2HBL A;  2WFB A;  3AAQ A;  2KHO A;  3LDL A;  1DEJ A;  4K42 A;  1C0G A;  3IMX A;  1QQN A;  3O9S A;  2E88 A;  3L4I A;  1SZ2 A;  3TSQ A;  4M7Y A;  5C12 A;  5JLF A;  2I7N A;  3MN6 A;  4RWT A;  3WQU A;  2QWQ A;  4FWR A;  1P90 A;  3VES A;  3H3O B;  1QZ5 A;  3L4Q A;  4CD1 A;  4IOA L;  2P9U B;  4YOW A;  4BRG A;  3EKU A;  5DM7 L;  3FZF A;  4OO1 J;  1Y64 A;  4G9Z A;  2VGM A;  3CHW A;  2P9L A;  3MX2 A;  2YHW A;  4FL9 A;  1NM1 A;  4HTL A;  5BN9 A;  1MA9 B;  1ATS A;  5AFU H;  2IVP A;  4XH4 A;  3C6H A;  3E9O A;  3M1F A;  2QM1 A;  3L6Q A;  3IFR A;  5AFU A;  3LDN A;  5E26 A;  2ITM A;  3TTF A;  4O5F A;  5CE3 A;  1GLF O;  4WFN L;  3KVG A;  3VTI A;  4B1W B;  1JCG A;  3FFK B;  3PIO L;  2QWP A;  1V4T A;  1V4S A;  5AQM A;  4H5V A;  5F2R A;  4CBX A;  3HM8 A;  3WXJ A;  3O8M A;  3GDQ A;  3LDP A;  3E1Y A;  3WQT A;  3C7N A;  3TTD A;  3VOV A;  4AM6 A;  3CCR N;  4CZF A;  2E2Q A;  4FWS A;  4JD2 A;  1YJN N;  1C0F A;  4H0X B;  5BPN A;  5AQK A;  3OA9 A;  2UYT A;  3O9U A;  3EE9 A;  2QWM A;  2YJE A;  1YF5 L;  1T3V A;  4JEP A;  5AZJ A;  2ZJQ L;  2ASP A;  2NRH A;  2V7Z A;  5AQH A;  2P9S B;  5TKW A;  2P9I A;  2BUP A;  3N4Q A;  3CCS N;  3MX5 A;  5AZI A;  4L3Q A;  3ZET B;  3MN5 A;  3DWL A;  5AQW A;  4MLE A;  2A40 A;  3K9J A;  3UE5 A;  3MWT A;  4JKG A;  3O80 A;  4A62 A;  4R79 A;  4BR4 A;  3O4W A;  3VF2 A;  3F5T A;  1M1K O;  3LM2 A;  3MMV A;  3R3L A;  3A8Y A;  2F7T A;  1IJJ A;  1X9J A;  3A5L C;  3NVM A;  4BGA A;  3HOS A;  5H1S Q;  4FSV A;  4WQ4 A;  2ZGZ A;  1NGE A;  2EWS A;  5JMV A;  3DXK A;  2V52 B;  4BRD A;  4WQ5 A;  3SMS A;  3UB5 A;  2P9P B;  1GLA G;  3ATU A;  1YJW N;  4H5R A;  4QS8 A;  3MCP A;  3ZX3 A;  2W41 A;  2HF3 A;  4YOY A;  3SBG A;  3QFP A;  3DXM B;  3MWP A;  3VF6 A;  4BGB A;  3KK7 A;  1SAZ A;  4IFE A;  3HBT A;  3HZ6 A;  2E2O A;  1KC8 O;  4ILH A;  1WUA A;  2E2P A;  4PL8 A;  3PIP L;  2HF4 A;  1OVY A;  1T6C A;  1RDU A;  4YOT A;  3RSE A;  4BR2 A;  2Q1N A;  1S22 A;  2YCH A;  3R1X A;  4GV3 A;  1RDW X;  3VMF B;  4H5W A;  2VCP A;  4MO5 A;  1NGD A;  1SQK A;  5AZI B;  4BQZ A;  4CZH A;  5C0Y A;  3CD6 N;  2A42 A;  3P4I A;  1Q82 O;  5AQO A;  3QIC A;  3P31 A;  4HWI A;  3O9Q A;  4WFB L;  3AAP A;  1VQ5 N;  5GIN A;  1BO5 O;  4BRL A;  3FLC O;  1OKJ A;  5AQJ A;  4IZ9 A;  5GAG P;  1ATN A;  4C1N I;  3GG4 A;  3DXK B;  4EHT A;  1NGH A;  1QQM A;  2QWL A;  4H5T A;  1EQY A;  4JKC A;  1KAY A;  4GV9 A;  1KXP A;  2FSN A;  3JXU A;  2QWN A;  4PKH A;  2NZT A;  5M1F A;  3U9Z A;  4BC2 A;  3OHR A;  3QB0 A;  4FWP A;  1NLV A;  1LCU A;  4FPA A;  5GAD P;  4H03 B;  5JLH A;  3VEZ A;  5AQI A;  2JWL A;  3J8A A;  4CZI A;  4CBU A;  3SAF A;  1GLB G;  2P9U A;  4ISF A;  3A5N C;  4YOU A;  1NGC A;  5AQR A;  3A0I X;  1QZ6 A;  2A41 A;  4BRE A;  4H0Y B;  4BRM A;  4WQ4 C;  1EO1 A;  3EN9 A;  2YJF A;  3ZX0 A;  1S3X A;  3CXC M;  4BY9 C;  2FXU A;  3EE8 A;  1QVG M;  5E84 A;  1O13 A;  4FWN A;  2NRZ A;  4JAX A;  3FR0 A;  2NLX A;  3Q7C A;  2ASO A;  2CGJ A;  2NRT A;  4IXC A;  1D4X A;  2W40 A;  2E1Z A;  2F9W A;  3HSC A;  1SS6 A;  4BR7 A;  4EAH D;  2ZJR L;  4FVU A;  1HX1 A;  4RTF D;  5C15 A;  3P38 A;  3CC2 N;  1KD1 O;  3IUC A;  1VQ4 N;  2VWB A;  1MWM A;  2V7Y A;  1VQK N;  4U67 L;  1E4F T;  1Z6R A;  2YI1 A;  3GL1 A;  1NWK A;  3VPZ A;  3GBT A;  4BG9 A;  2FSK A;  2WBN A;  3I33 A;  3R8E A;  4BC5 A;  1MDU B;  5GIP A;  5AQU A;  5BRF A;  3TU5 A;  5KQ8 A;  1R59 O;  4LC9 B;  1YVN A;  2AA4 A;  5EX5 A;  2AP1 A;  3D2E B;  5F0X A;  3CJB A;  2D1K A;  1VAZ A;  1NBW A;  4GV6 A;  2CGL A;  2P9S A;  3VER A;  3LM9 A;  4I6M B;  3AGK A;  3BF3 A;  2E8A A;  2HMP A;  3ZET A;  4MLH A;  1WOQ A;  3G71 N;  1X3M A;  1ATR A;  3O1W A;  3QDK A;  2FF6 A;  4JKD A;  4O8K A;  3CCV N;  4MO4 A;  3D2F A;  1BU6 O;  2KKZ A;  3TPQ A;  3TTC A;  1DT9 A;  3WT0 A;  4WCE L;  1Q18 A;  5TKY A;  2QTD A;  2NNW A;  5CR4 A;  2P9P A;  4YOR A;  4FOE A;  4B1X B;  2ZF5 O;  4J8F A;  4CBW A;  4H0P A;  3HTV A;  2A3Z A;  3T69 A;  3ULE B;  3DXM A;  4JKH A;  5BRE A;  5EXW A;  3LL3 A;  5CHI A;  4GY2 B;  3JS6 A;  5AQX A;  4BVO A;  1TUU A;  3QBW A;  3EO3 A;  3U4L A;  4FWK A;  4KH4 A;  5M1Q A;  1HKG A;  1VQM N;  4QS9 A;  3J7Z O;  1VQ9 N;  3H6E A;  5AQY A;  4JNE A;  4DQ8 A;  3C6A A;  4PHT X;  1VQL N;  5FPD A;  4BRI A;  4EFH A;  1XUP O;  4JKE A;  2A5X A;  5JVG L;  1K8A O;  3HOT A;  2GEL A;  3RVC A;  4JHD B;  3D2F B;  4BRN A;  4BG8 A;  5KPZ A;  1U6Z A;  2E2N A;  1DGK N;  3EKS A;  2WC9 A;  2FLO A;  4WF9 L;  3VGL A;  3SJH A;  1YAG A;  4BR0 A;  4B9Q A;  1VQP N;  4IO8 A;  1JJ2 M;  2Q97 A;  2GWJ A;  2BTF A;  3VGK A;  3VEX A;  4CI6 A;  2QI2 A;  4ILJ A;  4MDA A;  5HOO A;  3G25 A;  2QEX N;  5ELZ A;  5AQG A;  1NGA A;  4Z94 A;  5GAH P;  5AQT A;  2Q31 A;  4MDB A;  3CQX A;  5M1O A;  5HL7 L;  3EZW A;  3LDQ A;  3SLC A;  1N8R O;  1Q81 O;  3CPW M;  4JK9 A;  3Q7B A;  3T7Z A;  1NGI A;  1ZC6 A;  3CPE A;  4FWO A;  3H45 C;  4DCH A;  4H0T B;  3A5O C;  1GLC G;  1K8K A;  3WXK A;  4ISG A;  5GAE P;  2J4R A;  5FPE A;  3CET A;  3HRG A;  1U2V B;  5AQN A;  5BR9 A;  3MK6 A;  4K41 A;  4JKF A;  3MCA B;  3IKM A;  1JCE A;  5M1N A;  2GEM A;  2ZJP L;  4CZG A;  5BRD A;  4KBO A;  4DHY A;  1H1V A;  3E9P A;  4YOX A;  1NGB A;  3W0L A;  3CC7 N;  1KAX A;  4CZJ A;  1BG3 A;  4BVP A;  2KLA A;  3K9K A;  3ZEU A;  1K73 O;  1TUY A;  5F1X A;  3QBX A;  3ENO A;  1MWK A;  1BA1 A;  3IDH A;  4BRH A;  3ID6 A;  4F9O A;  2CH5 A;  3UKR B;  3H1Q A;  3SAH A;  3D2E A;  5AQS A;  1K9M O;  1T6D A;  4BR9 A;  3M3Z A;  3CCL N;  4BRA A;  2ZWH A;  1HLU A;  4XEI A;  2HBJ A;  4I6M A;  2GTD A;  4BRK A;  2D4W A;  4AM7 A;  2YHY A;  3QML A;  4IDH A;  1K8K B;  4JK7 A;  4AF1 A;  4IJA A;  5C2F A;  3E9L A;  1DKG D;  1YXQ A;  1NMD A;  2OAN A;  2RE2 A;  3E66 A;  4PKI A;  3CJ1 A;  4NO7 A;  4OPH A;  1RFQ A;  1LOT B;  4XH5 A;  3WXI A;  3BUZ B;  2A6A A;  3CCU N;  1HKC A;  2QA4 N;  4U7B A;  3R9P A;  2HBM A;  2NRX A;  3CF5 L;  1YI2 N;  1ZXO A;  2NRW A;  4B1V A;  4JN4 A;  5AQV A;  3ZEU B;  4C23 A;  3ULE A;  1XQS C;  5M1K A;  3TSP A;  2FF3 B;  2CH6 A;  1KAZ A;  4ILG B;  4BC4 A;  3CJ7 A;  4NB4 A;  4FOI A;  1HUX A;  4M7X A;  1GLD G;  4EIA A;  2P9K A;  4BRO A;  1BUP A;  4NLC A;  4CZL A;  4UY8 O;  3CJC A;  3WXL A;  3CIP A;  3W3D A;  2QXL A;  1VQN N;  2GX9 A;  1ESV A;  3VTH A;  4H0V B;  3VEY A;  2GUP A;  2F9T A;  4BR5 A;  3D7E O;  4BQL A;  3KWI A;  4M63 C;  3CCE N;  3I8B A;  2PFU A;  3KHY A;  1Z05 A;  3VEW A;  1GLJ O;  1TYQ B;  4H0O A;  3P39 A;  1VQ6 N;  4JHD A;  5BPM A;  2NRV A;  4WYB A;  2HST A;  3HI0 A;  3CCQ N;  1M90 O;  3CCM N;  3O1B A;  3SAG A;  4JKA A;  1BOT O;  3NMU A;  3I56 N;  3H3N O;  2P9N B;  1ZBS A;  5ADX H;  4KH6 A;  4K25 A;  3DJC A;  3UKU B;  1NGJ A;  5ADX A;  3R6M A;  3ID8 A;  4IJN A;  5EOY A;  5LJW A;  3AGR A;  3O5B A;  5AQL A;  5C10 A;  1YIJ N;  1VQ8 N;  4E1J A;  5C2D A;  3FZK A;  4IOC L;  3BF1 A;  2P9K B;  2PBD A;  2Q0U A;  2YHX A;  3CJ9 A;  2YX6 A;  5JIC A;  1KQS M;  1VQ7 N;  4A2A A;  1G99 A;  2RHK A;  3F9M A;  3LDO A;  3MN9 A;  4YDU C;  3U8X A;  4A57 A;  4C1N K;  4FWQ A;  2BH1 A;  4EHU A;  4YOV A;  1W97 L;  3FE1 A;  4PL7 A;  1W2B M;  1VQO N;  3H46 O;  3OW2 M;  3O9T A;  1U2V A;  3EL2 A;  4DKW A;  4BRC A;  4GNI A;  3M5R A;  4RCH A;  2IVO A;  4BC3 A;  2FSJ A;  4BRF A;  3VET A;  3CC4 N;  2VGN A;  1JCF A;  2V51 B;  1E4G T;  3KZB A;  3MDQ A;  4K43 A;  3QFU A;  1QHA A;  5B8H A;  3CER A;  4OPA A;  2I7P A;  3ATV A;  4A5B A;  2Q0R A;  1YIT N;  3VEO A;  5JVH L;  5KPR A;  4WFA L;  3DLL L;  5LJV A;  3I55 N;  1HJO A;  2Q2R A;  3BP8 A;  4FWM A;  3UKR A;  4CD3 A;  5DM6 L;  1T44 A;  2P9L B;  4FWL A;  1BA0 A;  2ZGY A;  5BRH A;  5FPN A;  2E20 A;  1Q86 O;  1NJI O;  3VEN A;  3KWG A;  4XH1 A;  3F2K A;  3VEV A;  2JWK A;  4CZE A;  2HOE A;  4FPB A;  4IOX A;  3SMP A;  5BN8 A;  2ASM A;  3MN7 A;  1YJ9 N;  1YHQ N;  5AR0 A;  1X3N A;  3WEE A;  2E1Y A;  4PKG A;  4GVE A;  2GWK A;  3D6R A;  2VYP A;  3G4S N;  3BEX A;  1NGF A;  4CZK A;  3S41 A;  3ZYY X;  3C7N B;  3TSU A;  5GIO A;  4A59 A;  2DPN A;  1QQO A;  3SK3 A;  1XC3 A;  1NGG A;  3FZL A;  2PAV A;  4JD2 B;  3ZX2 A;  4JK8 A;  3U9D A;  3H1V X;  2QWO A;  3G6E N;  3ENB A;  3O6W A;  5AZJ B;  4KH5 A;  1BWF O;  2P9I B;  2WUS A;  3VGM A;  5M1P A;  5MLC Q;  4CZM A;  3AAR A;  1IG8 A;  3GE1 A;  3CQY A;  4ISE A;  2D0P A;  4JKG B;  3CMA N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...