3F2KA

Structure of the transposase domain of human histone-lysine n-methyltransferase setmar
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
222
structure length
197
Chain Sequence
HELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLRKGPILLHDNARPHVAQPTLQKLNELGYEVLPHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-lysine N-methyltransferase SETMAR
publication title The Crystal Structure of Transposase Domain of Human Histone-lysine N-methyltransferase SETMAR.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 67
structure length 197
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2008-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3f2kA00
5HOOA 3HOTA 4MDAA 2F7TA 3F2KA 4MDBA 4U7BA 4R79A 3K9JA 5CR4A 3HOSA 3K9KA
chains in the Genus database with same CATH superfamily
1ITGA 3QIPA 2WTUA 4OPJA 4CJLA 3A0IX 4CGHA 4ID1A 3SBGA 1SZ2A 2IC3A 2YI1A 3H6EA 2QWMA 1N33K 4IKFA 3Q7CA 3N4QA 4DTUA 1XC3A 1JLCA 2HNDA 2ITGA 4FWNA 3O9UA 3P83D 2RHKA 2P9SB 3LDLA 5FRNA 2O8DA 3OYHA 1KTQA 3CFPA 4HCBA 3IKMA 2QA4N 4E7JA 3SMPA 2O4GA 4B3MK 1S22A 2YJEA 4BR9A 3V1QA 2HF4A 1N36K 5CYQA 2F96A 3MXIA 2QKBA 4IZ9A 2HNYA 3C6AA 5FDLA 4C8NA 1SKSA 4KBOA 1TK0A 2P9NB 3J80O 4CZIA 3QEVA 4CIGA 4CI6A 1QHAA 5I3UA 4W5OA 1C0TA 5FLXO 1NGEA 4RW7A 3SJJA 3LM2A 5AQFA 4OO1J 3S3MA 3CJBA 4FWMA 1LAWA 1NK6A 1C6VA 1SAZA 4RWTA 4Z4GA 3A2FA 3CJCA 4JKFA 2UYTA 2YNIA 4C1NI 2GTDA 1HLUA 2O8CA 3BY5A 3L2VA 3HK2A 2ZWHA 4JKGB 1K8AO 4JHDA 3ENOA 2QW9A 4MDBA 3U4LA 4E7KA 3UB5A 5KPZA 3CG7A 3DXMB 4F8RA 2IVPA 1YT3A 3J8AA 4JI7K 3T3FA 4DR6K 3H46O 4TSXA 1LCUA 5FROA 3VQ5A 4E0DA 4FZXC 4KRFA 1RDUA 1Y64A 5JVGL 3OYLA 2D0AA 3R9PA 3AAQA 1ILYA 1CZBA 3MDQA 3TAPA 4GW6A 5AFUH 4DV4K 3SV3A 1GLCG 4O5FA 3VEXA 1RFQA 3QDKA 2FC0A 5AQYA 1BQNA 4GKJK 2GBZA 4QS7A 4H0VB 4EAHD 3VQ4A 3HP6A 1ZBHA 3MN6A 3E9OA 4CHNA 4DU1A 1TUYA 1UA1A 1TL3A 1T3VA 3MCPA 1VQ6N 3RR7A 1U2VB 3JS6A 3D7EO 5HL7L 1VQKN 2XY8A 1MDUB 1NK0A 4FLWA 4CZGA 3CERA 4A59A 4FOEA 1I94K 4H0PA 3OA9A 1NKBA 3I8BA 5HOOA 3CCSN 2HNZA 2IS3A 5GIPA 2VGNA 4AHTA 3AVLA 2YHBA 2KFZA 4CZMA 2VWJA 4WFNL 3VQ6A 4JK7A 5AZJA 1ASUA 2O8BB 2IAJA 5BPNA 4RW6A 4FWKA 1DTQA 5KRTA 1VQON 3THWA 3SV4A 1T05A 3MX5A 5J1EA 2JWLA 5AQRA 4W5TA 2KLAA 4KHPK 4YOXA 3DRRA 2G8HA 3JAMO 3DXMA 4EZ9A 3RRGA 1Q9YA 4E89A 2YCHA 4H5WA 4CK1A 2OA8A 4JS4A 4FJ7A 4JKHA 3V9WA 3A8YA 2X6SA 4DF8A 3G10A 3LPTA 2YX6A 1QZ5A 3BZCA 4E7LA 1RTDA 3TTCA 3TSQA 1HQUA 2R7YA 3DAWA 3QB0A 3AV9A 1C1CA 1RT5A 4JYAK 2RPIA 1JCEA 3WXJA 3OYEA 3LWMA 4BC3A 4LFBK 2QTDA 1OH8A 3SUNA 3BF3A 3CQ8A 4OPKA 5M1NA 4Z4CA 1IO2A 4ILJA 4DR1K 1HKBA 3R6MA 3OW2M 1S1XA 3QO9A 3DXKB 4RTFD 2HMPA 4CJKA 4DQPA 3LDPA 4I9QA 4Z4FA 4LC9B 1NMDA 1GOBA 3QICA 3OYGA 4JKDA 3O3FA 1OH5A 1LWFA 2X74A 3RTVA 3PIOL 5C15A 3RMAA 3OS2A 3CHWA 4CGFA 5BN8A 3V9XA 1BISA 3PO5A 1IBKK 2JLEA 3J7ZO 3QEXA 4JKBA 2KZZA 3VMFB 2FXUA 3RMDA 1KAZA 3VENA 3VQAA 3PLAA 3G0ZA 5CY4A 4LY7A 1BA0A 1S3XA 4O4GA 1R0AA 2HF3A 2O8BA 2O8FA 3L6QA 3K59A 4CFCA 3O5BA 2W41A 3ULEB 1LWEA 4BC2A 4FPBA 4IOAL 2GUPA 4FLTA 3A5OC 3QNOA 3GL1A 5MLCQ 3F73A 4JEPA 3CJAA 2KFNA 4FLUA 3GG4A 4IWVA 5GIOA 3G4SN 2ITMA 1RGIA 3VQCA 4K41A 3NH1A 1YITN 4DV6K 4BY9C 3O9QA 2LSNA 1QVFM 4CJSA 1NGIA 1NJXA 4BR7A 2A1RA 1JKHA 1WBBA 1L3TA 1K6YA 1M1KO 3VGKA 2QWQA 5HBMA 2UU9K 3AVBA 2ATQA 3ATVA 3CPEA 5CZ2A 1SL1A 4CJUA 5C10A 4BRMA 4UY8O 4OPAA 3AO2A 1J5OA 1GOAA 2KZMA 1VSHA 1JLFA 4BG9A 4L3QA 4ILHA 3M1FA 4CJTA 1TL1A 2ZGYA 3DXKA 4N47A 4O0JA 2HMIA 3VPZA 4B9LA 1YJNN 1SL2A 4KHUA 4CHOA 3C6UA 2F9WA 3OYDA 3NHGA 4DSFA 4BDYA 4F9OA 1HYZA 3H1QA 2XY5A 3TAGA 4PY5A 2HHQA 1O13A 3OYIA 4MLEA 1KLNA 3FZHA 4RW9A 5ADXA 4CHPA 1V4TA 3CCLN 3V6DA 5CZ1A 4CESA 4CHZA 3CF5L 2KHOA 2E2OA 2XY6A 4CJEA 1DTTA 3ZSVA 4I2PA 2WFBA 3OVNA 3WQUA 1HNVA 1L5UA 2ZQBA 4CEAA 3VQEA 1B92A 4Y1DA 4NLCA 1DT9A 2A42A 3TU5A 2PZSA 3AVFA 3ULEA 3C7NB 3PX6A 1HUXA 4I2QA 5DM7L 3MN9A 5LY3A 1HRHA 4FJ9A 3M8PA 1KSPA 5C24A 2D4WA 2HBJA 3O9TA 4WQ4A 3QETA 3LZJA 2F8SA 3K57A 3OYBA 3FE1A 2JGUA 1NOYA 5I9EB 3CM5A 4B3TK 2RF2A 3DLKA 1Z6RA 1NGGA 4FLYA 3V9UA 4CEZA 5GINA 4GV9A 1S6PA 3ZSXA 4A2BA 4LF8K 4JLHA 4JI2K 4CIEA 3VA3A 1KLMA 2EWSA 4B1WB 1XMOK 4RW4A 3B6OA 1NWKA 3K5OA 5HRNA 3NGYA 3OHRA 3V9ZA 2F4VK 1ASVA 3LP0A 4F3TA 2GELA 1RT6A 3KJVA 3CJ9A 4DLEA 3F2KA 4H0XB 4IOCL 4PKIA 2UXBK 1JCGA 4CGDA 3SBTA 1BO5O 3AVHA 4M3YA 4QS9A 3ZSQA 2VQFK 5HRPA 1Z26A 2EX3A 1TAQA 4FK2A 4H8KA 4DQRA 4KO0A 4CF1A 4K0KK 3BP8A 1IKWA 4CEEA 4CHQA 3DLEA 4KB0A 2VWKA 2J4RA 3HZ6A 3LDQA 1Q9XA 4FWLA 1OVQA 4HTLA 4FW2A 4HWIA 3ZX0A 5KPTA 3O08A 4OKKA 5JS1A 1RDBA 2B4JA 3AGKA 3FZLA 1HYSA 3KIOA 3C7NA 5GAGP 4DR2K 5E41A 4V19S 3WNEA 3T1AA 1U4BA 4DQ8A 1Q86O 1LW0A 4Z4EA 3PX4A 2NRWA 4B9QA 1HYVA 4CGJA 1BDGA 5AQVA 3MN7A 5C12A 3C95A 3V81A 2PAVA 3FZKA 3WNFA 2W6LA 2CH5A 1BIZA 1NK4A 4B9TA 1KFSA 1EWRA 3KTQA 3E1YA 4H0YB 3JYTA 2HB5A 1U6ZA 4B08A 1KVCA 2D0PA 3T1HK 1WUAA 3O1WA 4FW1A 4O0IA 5B8HA 4LSNA 5HROA 1WSIA 2VG5A 3AA2A 5JMVA 2D0OA 1S6QA 4KHNA 4O44A 4FLZA 2BDPA 1WN7A 3SLCA 4JRPA 4XIUA 3E9LA 1NGHA 3EKSA 3QLHA 2W6KA 1GLFO 4O5BA 2HHSA 4PKHA 5GAEP 3C6HA 3NMUA 1KVBA 4NCBA 5J2MA 1BCMA 3HPHA 5AQLA 3MEDA 4X62K 2HBLA 2P51A 3HO1A 2GEMA 3IUCA 5HRSA 1NGDA 2HSTA 1T03A 3O4WA 2PBDA 2IVOA 3WNGA 4HUEA 1J53A 3TTFA 1QQOA 2HW3A 4B9NA 2CGLA 3T7ZA 2G8FA 3AO5A 4DTOA 4JI0K 2E2NA 3VF2A 4CF0A 2E20A 2G8IA 4GMJB 4PKGA 1CZ9A 3KK2A 3ZETB 2G8UA 4IOXA 4BRIA 3MECA 2Q2RA 3WUHA 2ZM6K 4AHRA 1YIJN 2IDOA 3O6WA 3MXMA 3U9DA 1W97L 3ZSYA 1TV6A 4ZHRA 4JI1K 4EFHA 1C0GA 1F21A 3ITHA 3TTDA 4JI3K 3WEEA 5M1FA 1D8YA 2HHUA 2W42A 3T1YK 3AVJA 1Q18A 1YAGA 2V52B 2HHVA 3HVRA 1VRTA 3ZT1A 3G6EN 5AQQA 4LF7K 4KH6A 1ZBLA 1TKTA 1JL2A 2BANA 4B9UA 3EL2A 1S5JA 5HLFA 3AARA 1JCFA 4GVMA 3VF4A 5JLFA 1T6CA 4AM7A 5AQXA 1U48A 4OGEA 2P9KB 3MK6A 4FSVA 4U67L 4OJRA 1C1BA 5E26A 4B1UB 4QOZB 1XC9A 1SQKA 1GLAG 3ZT3A 3WT0A 1J6ZA 3VQ8A 3EN9A 5H1SQ 4DB3A 5C42A 4FK0A 2WUSA 4DMNA 3EKUA 3ZSWA 1QQCA 3VEWA 3D2FA 3RVCA 2QWPA 3CJ7A 5AQZA 3ULDA 2D5RA 3KHYA 3TPQA 3BF1A 4NYFA 4CJRA 3CQXA 3J81O 1ZXOA 1X9MA 1OVYA 2KKZA 3CFRA 1M90O 1B9DA 4QCLA 4LF6K 4NCGA 5J2PA 1JXBA 1ATNA 1H1VA 3O9SA 4DR5K 1RBTA 1L3UA 3ZETA 1BCOA 2OCEA 4XH5A 1EX4A 2DY4A 1D4XA 4RW8A 1BL3A 2OPQA 4DS5A 1NNEA 2OZSA 2NRZA 3TSPA 3TARA 1A5VA 5BR8K 3NCIA 2QWNA 3QFUA 1RDCA 4FCYA 2QM1A 3V4IA 4H03B 5TKYA 2VG7A 3ZX3A 4LSLA 4L8RB 5D3GA 4YDUC 4Q0BA 2YNHA 2VG6A 3HBTA 4J2BA 4M3WA 4H5RA 1WB9A 3ID8A 4CJVA 2P9SA 1VHXA 1VQLN 3HOSA 1KC8O 1NKEA 4H0OA 3O9RA 4E1NA 5FPDA 1YF5L 5JLHA 4ZTFA 4GVEA 5AJ3K 4KI6A 1RDAA 4CZKA 1IKXA 1JXEA 1NG9A 3C0BA 1EQYA 1YTAA 2NUBA 2BE2A 2P9KA 4BRKA 2W40A 4EP5A 1S1WA 3N4PA 5K14A 1QSSA 4C23A 4EZ6A 2F9TA 5A2QO 1LW2A 4KFBA 1U47A 4M3XA 4ISEA 1VSKA 4HCCA 3AVIA 4DR4K 2P9NA 4OLBA 3O3GA 4H4MA 4CGGA 2DFHA 4R5PA 4DV3K 2E88A 4IBNA 1YTUA 2YHYA 3AY9A 4HTUA 1KFDA 4A5AA 3NAEA 4M41A 2B5JA 4YNQA 4I6MB 3DLRA 4CZLA 3M8RA 4FJJA 2GUIA 4DR7K 4FOIA 4E3SA 2UUCK 3RMBA 3OYJA 3BDPA 4CJWA 4FJ8A 3NF7A 3IFRA 3SQ0A 2ZGZA 5C2FA 1W7AA 5AQIA 3B8AX 1N5YA 4JKGA 5T7BA 3VGMA 2ASMA 3L0QA 4FM0A 4KB1A 1NK9A 2FBYA 1VSMA 4E19A 3HPOA 4RCHA 4ELVA 2I7PA 1BHLA 1LV5A 4BRFA 4JK8A 2P9LB 3S3NA 3O1BA 3TR8A 3HOTA 1KAYA 4G9ZA 3CXCM 1NMNA 3E9PA 1DKGD 4CEOA 1EKEA 4WFBL 3S3OA 3TI0A 1VQMN 1JLAA 3W0LA 2UUAK 1ESVA 3WXIA 2Q31A 2Q0RA 3VF6A 1DEJA 1ZC6A 4DQIA 1BI4B 3F9MA 3H1VX 2XY7A 5AQTA 1VQ5N 4DLGA 1Y97A 2YHWA 4PA1A 3NGIA 4CEQA 4HVJA 2YKNA 4BR4A 4OKJA 4DQQA 3U6FA 4NXMK 4FO0A 4NCAA 1GLJO 3VEZA 5TKWA 4C1NK 4FWOA 3ZSRA 5KGWA 1VSIA 4J8FA 3OS0A 1U2VA 1N8RO 3AO3A 3PO4A 1NGFA 5BRDA 5AQKA 3M5RA 2Z1GA 4AQYK 1X3MA 1RBSA 3P1GA 3HYFA 3THVA 4K42A 3L2WA 2CGJA 3MWTA 2ZJRL 2YV0X 4A62A 3HSCA 5FPEA 4OKEA 2QXFA 5C25A 4KHYA 1NJZA 5CR4A 3NFAA 4IFVA 3BEXA 1W2BM 1YVUA 1W9HA 4FZZA 3OY9A 2NRRA 4NXNK 3SI6A 2QI2A 1YI2N 2YHXA 3HTVA 5CHIA 5BPMA 4CHYA 4PWDA 4FVMA 4JI4K 1T7PA 5LJWA 2UXCK 2G8KA 3IRXA 3THYB 1S1UA 3OBWA 4JKEA 1OKJA 3ASMA 2FF6A 3KKSA 4YORA 2P9LA 5AQJA 3DI6A 3P31A 1VQPN 4A5BA 5M1KA 4XH4A 4M42A 3TABA 4DFPA 4LH4A 4NLBA 4LF4K 1RILA 2BH1A 3SPZA 1NOZA 4DV2K 2P1JA 4BC5A 4DF4A 3OYFA 4MFBA 4CBXA 1N32K 3M6GA 3MEEA 3VQ9A 4ID5A 1X1PA 2OTJN 3SCXA 2DFFA 3EE8A 1BI4A 3KK7A 1QVGM 4YY3K 1BGXT 1BOTO 5DM6L 4A57A 4FJXA 4FZYA 3HM9A 5KTQA 2VGMA 4FJHA 3DLLL 4DG1A 3L3UA 3I0RA 5M1OA 1WAFA 5F2RA 4BE0A 2GWKA 2QK9A 3IG1A 4H5TA 3L2RA 1RT1A 3VOVA 1U04A 3HI0A 3VEYA 3PY8A 4BGAA 4B3RK 1Z05A 1N6QA 3L4QA 4BQLA 1CXUA 4FWSA 3R3LA 2Z1IA 4BVOA 4B3SK 3D0PA 2GV9A 3LL3A 2WBNA 2YNGA 3HJFA 1KCFA 4YFUA 3L4IA 3ZLJA 3O8MA 4B9VA 2YKMA 3VQ7A 3IS9A 1TAUA 1JLQA 4O8KA 4CJ5A 1BQMA 3MX2A 3SPYA 3CCQN 1JL1A 2WC9A 3RSEB 1VQ9N 3U8XA 3B6PA 4Q5VA 1JJ2M 4BQZA 1XNQK 2WONA 3H08A 5BRFA 3THYA 2QKKA 1NJYA 4CJQA 4CZFA 4IG3A 1ZYQA 4DTSA 4CERA 2P9UB 4BR5A 4IG0A 3P38A 1ZBUA 3OYCA 1QQMA 5SZTA 4YOWA 1Q82O 2FSKA 3QFPA 3K5NA 5BN9A 2ASPA 4PQUA 3AVNA 1QQNA 3T19A 3KK1A 3QBWA 3K0SA 3K5MA 4B9SA 5FRMA 1XI1A 4BDZA 3P5JA 1XUPO 4W5NA 1GLDG 4CECA 4YOYA 4JKCA 5FPMA 3QBXA 4M3RA 4C8OA 4FJLA 2HHTA 1BUPA 3SAHA 3E66A 2BUPA 4BREA 4B9MA 3RR8A 3CETA 1S9GA 3LWLA 4GV3A 1EWQA 5EY4A 1YUWA 3UIQA 1NGCA 4QAGA 4KHWA 3CQYA 3BUZB 4KI4A 5FPNA 4K8XA 1XQSC 1KXPA 3THXB 4BROA 3NDKA 4AILC 3JSMA 1TKZA 3CCRN 3F5TA 4LFCK 3AVGA 1TKDA 4N41A 3M8QA 4GNIA 1JLGA 2CGKA 2P9IB 4U7BA 1KVAA 3BGRA 3U3YA 4GKKK 3MN5A 4FWRA 4WFAL 4XEIA 3EZWA 3WNHA 4BWJA 3QNNA 3SK3A 4EP4A 3IDHA 2GWJA 2QWRA 1SKRA 4DSLA 2F7TA 2A5XA 3VN5A 4NYNA 3TAQA 1VK0A 4EHTA 4OVLA 3VQDA 1NJWA 3AO4A 1J54A 4IFEA 4KV8A 1TYQB 3HM8A 2PYLA 3C65A 2XHBA 1RBUA 3I0SA 3SAGA 4KTWA 3S41A 1VSEA 4M45A 3V1OA 2IGIA 3OYMA 5AQWA 4MLHA 1G99A 3AA5X 4WCEL 3FZMA 3WQTA 4HUFA 4BRCA 1HJOA 2OANA 5KQDA 2KTQA 4R79A 1I39A 4CFDA 1VQ4N 3E01A 2KW4A 1YXQA 1SUQA 4CD1A 3JXUA 4YDUA 2GX9A 3HT3A 3CCEN 3RRHA 3OBYA 4KPYA 4FJGA 5AQHA 2Z1JA 1X9WA 5KI6A 1K73O 3DRPA 4DWIA 4B1ZA 3OYKA 4FM1A 1LOTB 1CLQA 5I42A 3SQ4A 4CJ4A 5CYMA 1A5WA 3THXA 1DGKN 5KPRA 2E5LK 1VRUA 5LL6Z 3I8DA 3TAMA 4AHSA 3QMLA 1XMQK 3PUFA 4CEDA 4X66K 2P9IA 3PV8A 3L8BA 1S1VA 4YOTA 1NK7A 4JNEA 1MWKA 3C6TA 1QHTA 1RTJA 2HOEA 2IIRA 3CFOA 4DU3A 2EHGA 5ELZA 5JS2A 3GOIA 1IV0A 4AH9A 2F8TA 3CD6N 2O8CB 3DLHA 4WQ5C 3SQ2A 4BR0A 4W5QA 2HHWA 4E1MA 4JHDB 4DTRA 3VQPA 4IXCA 1RDDA 1NJIO 3LDOA 3A5NC 3TSUA 4Z94A 3K58A 1OH6A 3U3GA 4QS8A 1HR0K 5JVHL 4BDPA 4DV5K 4B3OA 3T69A 2UXDK 3V9SA 3VA0A 3CI5A 3UKUB 1TVRA 3GE1A 3NE6A 2YNFA 5KQ8A 1IJJA 3EEQA 1W0HA 2H3GX 3K2PA 4AHUA 4IEEA 4J2AA 1IBLK 3L2UA 1E4GT 1T44A 2HBMA 1HX1A 3LZIA 1HNXK 1ZBIA 2RE2A 4E7IA 5KRSA 3AVMA 3CM6A 1LAVA 4IO9L 2V51B 3PX0A 1B9FA 3P4IA 5GAHP 1QS4A 3WXMB 3PSFA 4DFJA 1QSYA 4K25A 4HUGA 3OTOK 1E4FT 4DSJA 3ZEUB 3CIPA 3DLGA 3F9KA 3LAKA 4DTXA 2G8WA 4FPAA 4DSEA 3NVKA 2VYPA 3CMEN 1C0FA 4DTMA 2O8EB 4DTJA 3LAMA 4CZJA 4ISGA 3D2EB 1TK8A 4CFAA 2FSNA 5EOYA 2A40A 2P5GA 1IG8A 4CJ3A 1C0MA 1FXXA 4K8ZA 3SUPA 2P9PB 4E1JA 5AZJB 2OPRA 3WXKA 3SUQA 3AO1A 5IWAK 3CCMN 4OPHA 5BRHA 4CCHA 3THWB 3IAYA 5AQNA 3LPUA 4NB4A 3KWIA 5AQPA 1K9MO 5KGXA 1O1WA 1BWFO 1SV5A 3KK3A 1BIUA 1KRPA 4Z0UA 1HNIA 1HKGA 3NGZA 4FYDA 3ISNC 2ZD1A 4GY2B 4BRNA 3SYZA 1NM1A 1HKCA 1RTIA 1U49A 3UKRB 2A41A 4PUOA 4F2RA 4CBWA 2OYQA 3WXLA 3UKUA 1Z25A 4KTZA 2E8AA 3MAQA 1ATSA 1HQEA 3AVAA 3CC4N 4IO8A 3EZ5A 1RT3A 2Z1HA 5F0XA 5BPLA 3CJ1A 2Y1IA 3SZ2A 2VWBA 4CEBA 4Y1CA 3I33A 3LALA 4O55A 3LP3A 2FLOA 5BR9A 3CCUN 1JLBA 2E6LA 3O3HA 3KVGA 2OZMA 3A5LC 2HHHK 4DTPA 2X78A 3KWGA 3FFKB 2RKIA 3J7YP 3VGLA 3KLIA 3TAEA 3NBPA 1WSEA 2FSJA 3EO3A 3OYNA 4AHCA 3G25A 1REVA 1MU2A 3ZYYX 3VQBA 4JI6K 3ZEUA 4M3ZA 3QIOA 1HNZK 2NRXA 3ALYA 3CCVN 3TAFA 2AJQA 1K8KB 3DJCA 1NK8A 1IH7A 2O8EA 4FK4A 3KKRA 2VQEK 1TUUA 2FF3B 3D2EA 4DKWA 4BR2A 3H3OB 5AQMA 1OH7A 3ENHA 3NF6A 4DTNA 4I7FA 1HPZA 1DLOA 3VTIA 2P9PA 2Q36A 2O8FB 3NVMA 1TK5A 1I3AA 4LH5A 4C8KA 1CXQA 2DTUA 3SNNA 3ID6A 4BRPA 3MXJA 1YVNA 3VEOA 2A6AA 3M3ZA 3UE5A 5GADP 5AFUA 1T8EA 2QEXN 1HPMA 5EXWA 4M3TA 4OLAA 2RN2A 1X9SA 3LP2A 5AR0A 3SUOA 1JLEA 3HRGA 1BU6O 2A1SA 3FGUA 4JK9A 3R1XA 4C8MA 3Q7BA 3L2QA 3U9ZA 3FZFA 2HBKA 4PHTX 4BACA 3UKRA 4DV7K 4Z4HA 3QINA 4I9LA 4YHHK 1RBVA 1GLLO 1WLJA 2OPPA 2I5JA 4IJNA 1T6DA 4JAXA 3C94A 2E1YA 1P90A 1IG9A 2O4IA 5AZIB 1NK5A 4FXDA 2QXLA 2V7YA 1UWBA 4CEFA 4DU4A 3GBTA 3DYAA 3H3NO 4ZTJA 5E84A 2Q1NA 4AHVA 2X6NA 1EO1A 2DFEA 3HVTA 3KD5E 2ZF5O 2XRIA 4AM6A 4WYBA 4JN4A 4H5VA 4M3UA 2IOCA 3CC7N 2FBTA 4KAZA 1X3NA 3EY1A 3AGRA 4BRLA 1IKVA 2NNWA 1VQNN 5M1PA 4I6MA 3HL8A 4ICLA 3K9JA 1BG3A 1J9AA 5HP1A 2QWOA 2NRTA 4FLXA 1S1TA 3HP9A 4JI5K 3J7AP 1WSHA 2D0BA 2UUBK 1Q81O 1RCHA 1L3VA 1K8KA 4YOVA 4FLVA 4G1QA 3HPGA 4ELUA 1RBRA 4MO4A 4IJAA 1FKOA 4X64K 4YOUA 5ADXH 4DFKA 4CE9A 1WSGA 1WAJA 3O4QA 3VEVA 3PSIA 3P39A 1FW6A 2PFUA 3CCJN 5EX5A 3CYMA 1D9DA 4N56A 5HRRA 4B8AB 4CIFA 4BGBA 2A3ZA 1RTHA 3I55N 3MMVA 4F4KA 3SQ1A 4A2AA 3DWLA 4E7HA 1C0UA 3AA3A 4BRHA 2E6MA 2KQ2A 4BRDA 1ZBSA 3OS1A 1D9FA 4LF9K 3M8SA 2AA4A 1NGAA 4CK3A 1HNWK 5M1QA 3OJUA 2E4LA 4FJMA 2HVIA 1A5XA 3KLFA 4Y0WA 1EETA 3SJHA 5C0YA 4X65K 2D0CA 3HXMA 5AZIA 1EP4A 5JICA 1S72N 3O4NA 4RG8A 1VAZA 4XH1A 2AP1A 4JKAA 1ASWA 2E2QA 4O8UA 3G71N 1VSJA 4KTQA 3MCAB 4B8CA 3O80A 5DMRA 4BE2A 1WNSA 3AA4A 2JWKA 4MQ3A 3LM9A 3FLCO 4BRAA 3TWHA 3PIPL 5BREA 4A61A 1VSLA 4IFYA 4DQSA 4OGCA 3QERA 3NH2A 4BWMA 3QESA 3SMSA 4CF2A 4DFMA 3HSTB 4ISFA 4CGIA 4H4OA 1NU0A 2ETJA 4J2EA 5SWMA 1BA1A 4KHSA 4FM2A 2Y1JA 4ILGB 4BC4A 1IBMK 5F1XA 4W5RA 1RNHA 5J2NA 1XHZA 2QWLA 4DUYK 1X9JA 1GOCA 3VQQA 2Q3SA 3NF8A 1ZBFA 3H45C 1D5AA 1Q8IA 3MWPA 4DS4A 3KLGA 2BGGA 4JS5A 4JRQA 1SL0A 3VETA 4EHUA 2PY5A 1KQSM 3ZX2A 3RWUA 4OX9K 1RT7A 2CH6A 4CZHA 4BG8A 1FK9A 4CF8A 3FFIA 3TANA 1KAXA 4CJFA 3VTHA 4FVUA 4Z4IA 3S9HA 1UOCA 3OYAA 4N76A 1NGBA 1U45A 5EU7A 4CBUA 4FJ5A 3BZKA 4CF9A 4CFBA 3LANA 4M7XA 1MWMA 4KHQA 2Q0UA 1SKWA 4FL9A 4BVPA 1HMVA 3KLHA 2VCPA 4JD2B 1CZAN 4WQ5A 5EVZA 4DHYA 1P8ZA 3VESA 3ZSZA 3KD1E 3A5MC 3QEWA 3ZT0A 3CC2N 4BE1A 5IT9O 3CPWM 4DUZK 1L3SA 4K43A 4F3OA 3NH0A 1XWLA 1UA0A 1WSFA 4IDKA 4DR3K 3AAPA 1QTMA 5AQUA 2NRVA 4CZEA 3D45A 4EIAA 4B1XB 2P5OA 1VQ8N 4CJPA 3DM2A 3MEGA 2WOMA 1MA9B 4MDAA 4CW7B 4B1YB 1VQ7N 1G15A 3L3VA 5AQSA 1TKXA 3ZT4A 3SAFA 3QEPA 1FKPA 4FJKA 4F2SA 3ZSOA 1EXQA 3RSEA 2Q97A 4LFAK 1SS6A 4BRQA 3D6RA 4CJ7A 2FBVA 4JV5K 3FR0A 4IEIA 2ASOA 3DRSA 1VSFA 2HHXA 3VERA 3AVKA 4AF1A 2OPSA 1V4SA 1VSDA 2PYJA 4CK2A 4LD0A 5LJVA 3ATUA 2P9UA 1YHQN 4UQGA 2I7NA 1HJRA 2BTFA 1IKYA 4M63C 1NKCA 1LWCA 3IMXA 4FJIA 3NF9A 4HHTA 4DSKA 1TGOA 4DV1K 1NGJA 1YJWN 4LF5K 3WEEB 1ATRA 3K9KA 4IDHA 2OTLN 2NRHA 1NLVA 1RDWX 4MO5A 5J2QA 4KH4A 2NLXA 1WSJA 4H5NA 3DMJA 1GLBG 3LP1A 2FBXA 4J2DA 1QZ6A 3I56N 3CMAN 2G8VA 3R8EA 4DCHA 4JD2A 1RT4A 5CE3A 4JI8K 5AQGA 1E3MA 2B6AA 2O8DB 1Q7YO 2ZJQL 3GDQA 2NZTA 3DOLA 3ZCMA 1J5EK 2HVHA 4GV6A 3ENBA 3AVCA 1RT2A 3OJSA 4BRGA 3EYZA 1WBDA 5LMUK 1N34K 4CD3A 1XNRK 2E1ZA 3RMCA 4PL7A 3LDNA 5AQOA 4C8LA 4KH5A 3LDSA 1FJGK 2IVNA 1C1AA 4FJNA 1YJ9N 4CVNE 3K5LA 1QSLA 2E2PA 4ELTA 1WOQA 3EE9A 3V1RA 3W3DA 3D2FB 4FWQA 4DV0K 3KZBA 3DLBA 4DSIA 4N5SA 4KREA 1GLEG 3ZT2A 4KKOA 2YHAA 4WQ4C 5LMNK 4WE1A 3QEIA 4PL8A 4NO7A 2XO7A 2ZE2A 1QE1A 5C2DA 1R59O 2D1KA 1TYQA 1XHXA 2DPNA 1KD1O 1S9EA 4WF9L 1NBWA 2V7ZA 1UAXA 4M7YA 4H0TB 2ZJPL 2YJFA 3KLEA 3DOKA 4FWPA 4B1VA 5DK5A
chains in the Genus database with same CATH topology
1JCGA 3FFKB 4NLBA 3SBTA 2BH1A 1BO5O 3VGLA 3A0IX 4QS9A 4BC5A 2FSJA 3SBGA 3EO3A 1SZ2A 4CBXA 2YI1A 3H6EA 3G25A 3M6GA 3ZYYX 2QWMA 3Q7CA 3N4QA 3ZEUA 3BP8A 2OTJN 2NRXA 1XC3A 3CCVN 3EE8A 4FWNA 3KK7A 1QVGM 3O9UA 1BOTO 1K8KB 5DM6L 2J4RA 2RHKA 3DJCA 3HZ6A 2P9SB 3LDLA 3LDQA 4A57A 4FWLA 4HTLA 4HWIA 3ZX0A 1TUUA 2VGMA 2FF3B 3D2EA 4DKWA 4BR2A 5KPTA 3DLLL 3H3OB 3IKMA 3O08A 5AQMA 2QA4N 3ENHA 3SMPA 3AGKA 5M1OA 1S22A 3FZLA 2YJEA 4BR9A 3NVKA 3C7NA 5F2RA 2HF4A 3VTIA 5GAGP 2P9PA 2GWKA 2Q36A 3NVMA 4H5TA 4DQ8A 1Q86O 3ID6A 4IZ9A 3VOVA 4BRPA 3C6AA 3HI0A 3VEYA 1YVNA 2NRWA 3VEOA 4BGAA 2A6AA 3M3ZA 1Z05A 4KBOA 3UE5A 3L4QA 4B9QA 4BQLA 5AFUA 1BDGA 5GADP 1HPMA 5EXWA 2P9NB 5AQVA 2QEXN 4CZIA 3MN7A 4FWSA 3R3LA 5AR0A 5C12A 4BVOA 3HRGA 1BU6O 3LL3A 2PAVA 3FZKA 3FGUA 4JK9A 2CH5A 3R1XA 4CI6A 1QHAA 3Q7BA 2WBNA 3U9ZA 3FZFA 2HBKA 1NGEA 4PHTX 3E1YA 3LM2A 4H0YB 5AQFA 4OO1J 3L4IA 3O8MA 3UKRA 3CJBA 1U6ZA 4FWMA 2D0PA 1SAZA 4RWTA 1WUAA 1GLLO 3O1WA 4IJNA 4O8KA 1T6DA 4JAXA 3CJCA 2E1YA 1P90A 4JKFA 3MX2A 2UYTA 5B8HA 3CCQN 2WC9A 5AZIB 3RSEB 1VQ9N 3U8XA 2QXLA 4C1NI 2GTDA 1HLUA 2V7YA 1JJ2M 4BQZA 3GBTA 3H3NO 5BRFA 5JMVA 2D0OA 5E84A 2Q1NA 2ZWHA 4JKGB 1K8AO 4CZFA 4JHDA 1EO1A 3ENOA 2ZF5O 2QW9A 4MDBA 3SLCA 3U4LA 3UB5A 4AM6A 4WYBA 3E9LA 5KPZA 1NGHA 3EKSA 4JN4A 4H5VA 1GLFO 2P9UB 4PKHA 3CC7N 3DXMB 4BR5A 5GAEP 3C6HA 1X3NA 3AGRA 3P38A 2IVPA 4BRLA 3J8AA 3CMAN 3NMUA 2NNWA 1VQNN 5M1PA 4I6MA 1QQMA 3H46O 4YOWA 1Q82O 3K9JA 1BG3A 1LCUA 5AQLA 2QWOA 2HBLA 2FSKA 3QFPA 2GEMA 2NRTA 3IUCA 5BN9A 1NGDA 2ASPA 2HSTA 1RDUA 1Y64A 3O4WA 1Q81O 5JVGL 2PBDA 1QQNA 2IVOA 1K8KA 4YOVA 3QBWA 3R9PA 3AAQA 1ILYA 3TTFA 3MDQA 1QQOA 1XUPO 2CGLA 4IJAA 4MO4A 1GLDG 3T7ZA 5AFUH 4YOYA 1GLCG 4JKCA 5FPMA 4O5FA 4YOUA 3QBXA 5ADXH 2E2NA 3VEXA 3VF2A 2E20A 1RFQA 3QDKA 4PKGA 5AQYA 3ZETB 4IOXA 4BRIA 4QS7A 4H0VB 2Q2RA 3VEVA 4EAHD 3WUHA 1BUPA 3MN6A 1YIJN 3SAHA 3E66A 3E9OA 3O6WA 2BUPA 3U9DA 1W97L 4BREA 1TUYA 3P39A 2PFUA 3CCJN 4EFHA 5EX5A 1C0GA 1T3VA 3CETA 3TTDA 3MCPA 4GV3A 5EY4A 1VQ6N 3WEEA 1YUWA 5M1FA 1NGCA 1U2VB 3CQYA 4BGBA 2A3ZA 3JS6A 3BUZB 3D7EO 5FPNA 5HL7L 3MMVA 3I55N 1VQKN 1MDUB 1XQSC 4A2AA 3DWLA 1KXPA 4BRHA 1Q18A 4CZGA 3CERA 1YAGA 2V52B 4BROA 1ZBSA 4A59A 4BRDA 4FOEA 4H0PA 2AA4A 3G6EN 3CCRN 3F5TA 5AQQA 4KH6A 3OA9A 3I8BA 5HOOA 3CCSN 3EL2A 4GNIA 1NGAA 2CGKA 5M1QA 5GIPA 2P9IB 2VGNA 3AARA 1JCFA 3VF4A 4U7BA 4PKIA 5JLFA 1T6CA 3MN5A 4AM7A 4CZMA 5AQXA 4FWRA 4WFAL 4XEIA 3EZWA 4Y0WA 4WFNL 3SJHA 3SK3A 5C0YA 4JK7A 3IDHA 5AZIA 5AZJA 2GWJA 5JICA 2QWRA 2P9KB 5BPNA 3MK6A 4FSVA 1S72N 2F7TA 2A5XA 4U67L 4FWKA 1VAZA 1VQON 4XH1A 2AP1A 4JKAA 2E2QA 3MX5A 4O8UA 5E26A 4B1UB 4EHTA 3G71N 1SQKA 1GLAG 3MCAB 3O80A 2JWLA 5AQRA 3WT0A 1J6ZA 3EN9A 4IFEA 2KLAA 5H1SQ 1TYQB 3HM8A 2JWKA 3C65A 3LM9A 3FLCO 4BRAA 4DB3A 4YOXA 2WUSA 3EKUA 3PIPL 3DXMA 3SAGA 5BREA 3S41A 4A61A 3VEWA 3D2FA 2YCHA 4H5WA 3RVCA 5AQWA 2QWPA 3CJ7A 5AQZA 4MLHA 3SMSA 1G99A 4ISFA 4WCEL 3KHYA 3FZMA 4JKHA 3BF1A 3A8YA 3TPQA 3WQTA 4BRCA 1BA1A 3CQXA 4ILGB 1HJOA 1ZXOA 4BC4A 5F1XA 2OANA 1QZ5A 2YX6A 5KQDA 1OVYA 2KKZA 2QWLA 1M90O 3TTCA 3TSQA 4R79A 3DAWA 1X9JA 3QB0A 1VQ4N 1JCEA 3WXJA 1ATNA 4BC3A 1YXQA 2QTDA 3H45C 1H1VA 3O9SA 3MWPA 4CD1A 3BF3A 3ZETA 5M1NA 4XH5A 3JXUA 4ILJA 3VETA 1HKBA 4YDUA 4EHUA 2GX9A 1D4XA 3R6MA 1KQSM 3ZX2A 3CCEN 3OBYA 2CH6A 3OW2M 4CZHA 5AQHA 3DXKB 2NRZA 2HMPA 4RTFD 3TSPA 3LDPA 4BG8A 2QWNA 3QFUA 4LC9B 1NMDA 1K73O 3QICA 1KAXA 2QM1A 4B1ZA 3VTHA 4FVUA 1LOTB 4H03B 5TKYA 4JKDA 3ZX3A 1NGBA 4YDUC 3PIOL 4CBUA 5C15A 3HBTA 1DGKN 4M7XA 5KPRA 4H5RA 3ID8A 1MWMA 2P9SA 1VQLN 3CHWA 2Q0UA 4FL9A 5BN8A 3HOSA 1KC8O 4BVPA 4H0OA 3J7ZO 3QMLA 3O9RA 4JKBA 2VCPA 4JD2B 3VMFB 1CZAN 2FXUA 2P9IA 5FPDA 1KAZA 1YF5L 3VENA 5JLHA 4GVEA 3PLAA 4WQ5A 4YOTA 5EVZA 4JNEA 1MWKA 1P8ZA 1BA0A 3VESA 4DHYA 1S3XA 3A5MC 4CZKA 2HOEA 3C0BA 1EQYA 2HF3A 2IIRA 2P9KA 4BRKA 3CC2N 2W40A 3L6QA 5ELZA 3O5BA 3CPWM 2W41A 3N4PA 3ULEB 4K43A 4C23A 3GOIA 2F9TA 4BC2A 3CD6N 4FPBA 4IOAL 2GUPA 4ISEA 4WQ5C 3A5OC 2P9NA 3AAPA 3GL1A 5AQUA 5MLCQ 2NRVA 4BR0A 4JEPA 3CJAA 4JHDB 4CZEA 3GG4A 4IWVA 4IXCA 4EIAA 2E88A 4B1XB 5GIOA 3G4SN 1NJIO 2ITMA 1VQ8N 3LDOA 3A5NC 1RGIA 2YHYA 3AY9A 4K41A 3TSUA 1YITN 1MA9B 4Z94A 4MDAA 4QS8A 4A5AA 4BY9C 3O9QA 4B1YB 5JVHL 1QVFM 1NGIA 4I6MB 4CZLA 4BR7A 3T69A 1VQ7N 5AQSA 3SAFA 4FOIA 1M1KO 3CI5A 3UKUB 3VGKA 3RSEA 2QWQA 3GE1A 5KQ8A 1IJJA 3IFRA 2ZGZA 5C2FA 2Q97A 3ATVA 1SS6A 2H3GX 3CPEA 3D6RA 5AQIA 4BRQA 4CJ7A 3B8AX 4IEEA 5C10A 4JKGA 4BRMA 3FR0A 3VGMA 4UY8O 2ASMA 3L0QA 4OPAA 1E4GT 4IEIA 2ASOA 1T44A 2HBMA 1HX1A 3VERA 4BG9A 4AF1A 1V4SA 4L3QA 4ILHA 3M1FA 2RE2A 4RCHA 2ZGYA 5LJVA 2I7PA 2P9UA 3ATUA 1YHQN 3DXKA 4BRFA 2I7NA 4IO9L 2V51B 2BTFA 4JK8A 2P9LB 3VPZA 1YJNN 4M63C 3P4IA 3IMXA 5GAHP 3O1BA 3HOTA 1KAYA 4G9ZA 3WXMB 3CXCM 1NGJA 3E9PA 1YJWN 1DKGD 2F9WA 3WEEB 4WFBL 1ATRA 4K25A 3K9KA 3H1QA 4IDHA 4F9OA 1VQMN 2OTLN 3W0LA 2NRHA 1NLVA 1ESVA 1E4FT 1RDWX 2Q31A 1O13A 4MO5A 3WXIA 3ZEUB 2Q0RA 4KH4A 3CIPA 3FZHA 2NLXA 4MLEA 3VF6A 5ADXA 4H5NA 1DEJA 1V4TA 1GLBG 1ZC6A 3CCLN 3F9MA 3H1VX 1QZ6A 3I56N 4FPAA 5AQTA 3R8EA 4DCHA 2KHOA 2E2OA 2VYPA 4JD2A 5AQGA 5CE3A 3CF5L 1VQ5N 3CMEN 2YHWA 1C0FA 2WFBA 1Q7YO 3WQUA 2ZJQL 4CZJA 4ISGA 3GDQA 4BR4A 3D2EB 2NZTA 2FSNA 5EOYA 2A40A 4FO0A 4NLCA 1DT9A 4GV6A 2A42A 1GLJO 3TU5A 3ENBA 5TKWA 3VEZA 4C1NK 4FWOA 4BRGA 1IG8A 3ULEA 3C7NB 1HUXA 4CD3A 2E1ZA 2P9PB 5AZJB 4E1JA 5DM7L 3MN9A 5LY3A 3WXKA 4PL7A 3LDNA 5AQOA 4KH5A 3CCMN 4OPHA 5BRHA 4J8FA 1U2VA 1N8RO 5AQNA 2IVNA 4NB4A 1NGFA 3KWIA 5AQPA 5BRDA 5AQKA 1K9MO 2D4WA 1YJ9N 2HBJA 3O9TA 3M5RA 1X3MA 4WQ4A 1BWFO 4K42A 2CGJA 3MWTA 2E2PA 1WOQA 3FE1A 3EE9A 3W3DA 2ZJRL 1HKGA 3D2FB 4FWQA 4A62A 3KZBA 5I9EB 3HSCA 5FPEA 4GY2B 4BRNA 1NM1A 1HKCA 3UKRB 2A41A 1Z6RA 1NGGA 5CR4A 4CBWA 3WXLA 3BEXA 1W2BM 3UKUA 1GLEG 2NRRA 5GINA 4WQ4C 4GV9A 2E8AA 2QI2A 1YI2N 2YHXA 1ATSA 3HTVA 5CHIA 5BPMA 3CC4N 4A2BA 4PL8A 4NO7A 4IO8A 5F0XA 5BPLA 3CJ1A 2VWBA 2EWSA 4B1WB 5C2DA 1R59O 2D1KA 1NWKA 3I33A 3OHRA 5LJWA 1TYQA 2FLOA 2DPNA 5BR9A 3CCUN 1KD1O 4WF9L 3OBWA 4JKEA 1NBWA 2V7ZA 3KVGA 1OKJA 4M7YA 2GELA 4H0TB 2FF6A 3CJ9A 2ZJPL 3A5LC 2YJFA 3F2KA 4H0XB 4YORA 2P9LA 5AQJA 4IOCL 4FWPA 3P31A 1VQPN 4B1VA 4A5BA 5M1KA 4XH4A 3KWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOO A;  3HOT A;  4MDA A;  2F7T A;  3F2K A;  4MDB A;  4U7B A;  4R79 A;  3K9J A;  5CR4 A;  3HOS A;  3K9K A; 
#chains in the Genus database with same CATH topology
 1ITG A;  3QIP A;  2WTU A;  4OPJ A;  4CJL A;  3A0I X;  4CGH A;  4ID1 A;  3SBG A;  1SZ2 A;  2IC3 A;  2YI1 A;  3H6E A;  2QWM A;  1N33 K;  4IKF A;  3Q7C A;  3N4Q A;  4DTU A;  1XC3 A;  1JLC A;  2HND A;  2ITG A;  4FWN A;  3O9U A;  3P83 D;  2RHK A;  2P9S B;  3LDL A;  5FRN A;  2O8D A;  3OYH A;  1KTQ A;  3CFP A;  4HCB A;  3IKM A;  2QA4 N;  4E7J A;  3SMP A;  2O4G A;  4B3M K;  1S22 A;  2YJE A;  4BR9 A;  3V1Q A;  2HF4 A;  1N36 K;  5CYQ A;  2F96 A;  3MXI A;  2QKB A;  4IZ9 A;  2HNY A;  3C6A A;  5FDL A;  4C8N A;  1SKS A;  4KBO A;  1TK0 A;  2P9N B;  3J80 O;  4CZI A;  3QEV A;  4CIG A;  4CI6 A;  1QHA A;  5I3U A;  4W5O A;  1C0T A;  5FLX O;  1NGE A;  4RW7 A;  3SJJ A;  3LM2 A;  5AQF A;  4OO1 J;  3S3M A;  3CJB A;  4FWM A;  1LAW A;  1NK6 A;  1C6V A;  1SAZ A;  4RWT A;  4Z4G A;  3A2F A;  3CJC A;  4JKF A;  2UYT A;  2YNI A;  4C1N I;  2GTD A;  1HLU A;  2O8C A;  3BY5 A;  3L2V A;  3HK2 A;  2ZWH A;  4JKG B;  1K8A O;  4JHD A;  3ENO A;  2QW9 A;  4MDB A;  3U4L A;  4E7K A;  3UB5 A;  5KPZ A;  3CG7 A;  3DXM B;  4F8R A;  2IVP A;  1YT3 A;  3J8A A;  4JI7 K;  3T3F A;  4DR6 K;  3H46 O;  4TSX A;  1LCU A;  5FRO A;  3VQ5 A;  4E0D A;  4FZX C;  4KRF A;  1RDU A;  1Y64 A;  5JVG L;  3OYL A;  2D0A A;  3R9P A;  3AAQ A;  1ILY A;  1CZB A;  3MDQ A;  3TAP A;  4GW6 A;  5AFU H;  4DV4 K;  3SV3 A;  1GLC G;  4O5F A;  3VEX A;  1RFQ A;  3QDK A;  2FC0 A;  5AQY A;  1BQN A;  4GKJ K;  2GBZ A;  4QS7 A;  4H0V B;  4EAH D;  3VQ4 A;  3HP6 A;  1ZBH A;  3MN6 A;  3E9O A;  4CHN A;  4DU1 A;  1TUY A;  1UA1 A;  1TL3 A;  1T3V A;  3MCP A;  1VQ6 N;  3RR7 A;  1U2V B;  3JS6 A;  3D7E O;  5HL7 L;  1VQK N;  2XY8 A;  1MDU B;  1NK0 A;  4FLW A;  4CZG A;  3CER A;  4A59 A;  4FOE A;  1I94 K;  4H0P A;  3OA9 A;  1NKB A;  3I8B A;  5HOO A;  3CCS N;  2HNZ A;  2IS3 A;  5GIP A;  2VGN A;  4AHT A;  3AVL A;  2YHB A;  2KFZ A;  4CZM A;  2VWJ A;  4WFN L;  3VQ6 A;  4JK7 A;  5AZJ A;  1ASU A;  2O8B B;  2IAJ A;  5BPN A;  4RW6 A;  4FWK A;  1DTQ A;  5KRT A;  1VQO N;  3THW A;  3SV4 A;  1T05 A;  3MX5 A;  5J1E A;  2JWL A;  5AQR A;  4W5T A;  2KLA A;  4KHP K;  4YOX A;  3DRR A;  2G8H A;  3JAM O;  3DXM A;  4EZ9 A;  3RRG A;  1Q9Y A;  4E89 A;  2YCH A;  4H5W A;  4CK1 A;  2OA8 A;  4JS4 A;  4FJ7 A;  4JKH A;  3V9W A;  3A8Y A;  2X6S A;  4DF8 A;  3G10 A;  3LPT A;  2YX6 A;  1QZ5 A;  3BZC A;  4E7L A;  1RTD A;  3TTC A;  3TSQ A;  1HQU A;  2R7Y A;  3DAW A;  3QB0 A;  3AV9 A;  1C1C A;  1RT5 A;  4JYA K;  2RPI A;  1JCE A;  3WXJ A;  3OYE A;  3LWM A;  4BC3 A;  4LFB K;  2QTD A;  1OH8 A;  3SUN A;  3BF3 A;  3CQ8 A;  4OPK A;  5M1N A;  4Z4C A;  1IO2 A;  4ILJ A;  4DR1 K;  1HKB A;  3R6M A;  3OW2 M;  1S1X A;  3QO9 A;  3DXK B;  4RTF D;  2HMP A;  4CJK A;  4DQP A;  3LDP A;  4I9Q A;  4Z4F A;  4LC9 B;  1NMD A;  1GOB A;  3QIC A;  3OYG A;  4JKD A;  3O3F A;  1OH5 A;  1LWF A;  2X74 A;  3RTV A;  3PIO L;  5C15 A;  3RMA A;  3OS2 A;  3CHW A;  4CGF A;  5BN8 A;  3V9X A;  1BIS A;  3PO5 A;  1IBK K;  2JLE A;  3J7Z O;  3QEX A;  4JKB A;  2KZZ A;  3VMF B;  2FXU A;  3RMD A;  1KAZ A;  3VEN A;  3VQA A;  3PLA A;  3G0Z A;  5CY4 A;  4LY7 A;  1BA0 A;  1S3X A;  4O4G A;  1R0A A;  2HF3 A;  2O8B A;  2O8F A;  3L6Q A;  3K59 A;  4CFC A;  3O5B A;  2W41 A;  3ULE B;  1LWE A;  4BC2 A;  4FPB A;  4IOA L;  2GUP A;  4FLT A;  3A5O C;  3QNO A;  3GL1 A;  5MLC Q;  3F73 A;  4JEP A;  3CJA A;  2KFN A;  4FLU A;  3GG4 A;  4IWV A;  5GIO A;  3G4S N;  2ITM A;  1RGI A;  3VQC A;  4K41 A;  3NH1 A;  1YIT N;  4DV6 K;  4BY9 C;  3O9Q A;  2LSN A;  1QVF M;  4CJS A;  1NGI A;  1NJX A;  4BR7 A;  2A1R A;  1JKH A;  1WBB A;  1L3T A;  1K6Y A;  1M1K O;  3VGK A;  2QWQ A;  5HBM A;  2UU9 K;  3AVB A;  2ATQ A;  3ATV A;  3CPE A;  5CZ2 A;  1SL1 A;  4CJU A;  5C10 A;  4BRM A;  4UY8 O;  4OPA A;  3AO2 A;  1J5O A;  1GOA A;  2KZM A;  1VSH A;  1JLF A;  4BG9 A;  4L3Q A;  4ILH A;  3M1F A;  4CJT A;  1TL1 A;  2ZGY A;  3DXK A;  4N47 A;  4O0J A;  2HMI A;  3VPZ A;  4B9L A;  1YJN N;  1SL2 A;  4KHU A;  4CHO A;  3C6U A;  2F9W A;  3OYD A;  3NHG A;  4DSF A;  4BDY A;  4F9O A;  1HYZ A;  3H1Q A;  2XY5 A;  3TAG A;  4PY5 A;  2HHQ A;  1O13 A;  3OYI A;  4MLE A;  1KLN A;  3FZH A;  4RW9 A;  5ADX A;  4CHP A;  1V4T A;  3CCL N;  3V6D A;  5CZ1 A;  4CES A;  4CHZ A;  3CF5 L;  2KHO A;  2E2O A;  2XY6 A;  4CJE A;  1DTT A;  3ZSV A;  4I2P A;  2WFB A;  3OVN A;  3WQU A;  1HNV A;  1L5U A;  2ZQB A;  4CEA A;  3VQE A;  1B92 A;  4Y1D A;  4NLC A;  1DT9 A;  2A42 A;  3TU5 A;  2PZS A;  3AVF A;  3ULE A;  3C7N B;  3PX6 A;  1HUX A;  4I2Q A;  5DM7 L;  3MN9 A;  5LY3 A;  1HRH A;  4FJ9 A;  3M8P A;  1KSP A;  5C24 A;  2D4W A;  2HBJ A;  3O9T A;  4WQ4 A;  3QET A;  3LZJ A;  2F8S A;  3K57 A;  3OYB A;  3FE1 A;  2JGU A;  1NOY A;  5I9E B;  3CM5 A;  4B3T K;  2RF2 A;  3DLK A;  1Z6R A;  1NGG A;  4FLY A;  3V9U A;  4CEZ A;  5GIN A;  4GV9 A;  1S6P A;  3ZSX A;  4A2B A;  4LF8 K;  4JLH A;  4JI2 K;  4CIE A;  3VA3 A;  1KLM A;  2EWS A;  4B1W B;  1XMO K;  4RW4 A;  3B6O A;  1NWK A;  3K5O A;  5HRN A;  3NGY A;  3OHR A;  3V9Z A;  2F4V K;  1ASV A;  3LP0 A;  4F3T A;  2GEL A;  1RT6 A;  3KJV A;  3CJ9 A;  4DLE A;  3F2K A;  4H0X B;  4IOC L;  4PKI A;  2UXB K;  1JCG A;  4CGD A;  3SBT A;  1BO5 O;  3AVH A;  4M3Y A;  4QS9 A;  3ZSQ A;  2VQF K;  5HRP A;  1Z26 A;  2EX3 A;  1TAQ A;  4FK2 A;  4H8K A;  4DQR A;  4KO0 A;  4CF1 A;  4K0K K;  3BP8 A;  1IKW A;  4CEE A;  4CHQ A;  3DLE A;  4KB0 A;  2VWK A;  2J4R A;  3HZ6 A;  3LDQ A;  1Q9X A;  4FWL A;  1OVQ A;  4HTL A;  4FW2 A;  4HWI A;  3ZX0 A;  5KPT A;  3O08 A;  4OKK A;  5JS1 A;  1RDB A;  2B4J A;  3AGK A;  3FZL A;  1HYS A;  3KIO A;  3C7N A;  5GAG P;  4DR2 K;  5E41 A;  4V19 S;  3WNE A;  3T1A A;  1U4B A;  4DQ8 A;  1Q86 O;  1LW0 A;  4Z4E A;  3PX4 A;  2NRW A;  4B9Q A;  1HYV A;  4CGJ A;  1BDG A;  5AQV A;  3MN7 A;  5C12 A;  3C95 A;  3V81 A;  2PAV A;  3FZK A;  3WNF A;  2W6L A;  2CH5 A;  1BIZ A;  1NK4 A;  4B9T A;  1KFS A;  1EWR A;  3KTQ A;  3E1Y A;  4H0Y B;  3JYT A;  2HB5 A;  1U6Z A;  4B08 A;  1KVC A;  2D0P A;  3T1H K;  1WUA A;  3O1W A;  4FW1 A;  4O0I A;  5B8H A;  4LSN A;  5HRO A;  1WSI A;  2VG5 A;  3AA2 A;  5JMV A;  2D0O A;  1S6Q A;  4KHN A;  4O44 A;  4FLZ A;  2BDP A;  1WN7 A;  3SLC A;  4JRP A;  4XIU A;  3E9L A;  1NGH A;  3EKS A;  3QLH A;  2W6K A;  1GLF O;  4O5B A;  2HHS A;  4PKH A;  5GAE P;  3C6H A;  3NMU A;  1KVB A;  4NCB A;  5J2M A;  1BCM A;  3HPH A;  5AQL A;  3MED A;  4X62 K;  2HBL A;  2P51 A;  3HO1 A;  2GEM A;  3IUC A;  5HRS A;  1NGD A;  2HST A;  1T03 A;  3O4W A;  2PBD A;  2IVO A;  3WNG A;  4HUE A;  1J53 A;  3TTF A;  1QQO A;  2HW3 A;  4B9N A;  2CGL A;  3T7Z A;  2G8F A;  3AO5 A;  4DTO A;  4JI0 K;  2E2N A;  3VF2 A;  4CF0 A;  2E20 A;  2G8I A;  4GMJ B;  4PKG A;  1CZ9 A;  3KK2 A;  3ZET B;  2G8U A;  4IOX A;  4BRI A;  3MEC A;  2Q2R A;  3WUH A;  2ZM6 K;  4AHR A;  1YIJ N;  2IDO A;  3O6W A;  3MXM A;  3U9D A;  1W97 L;  3ZSY A;  1TV6 A;  4ZHR A;  4JI1 K;  4EFH A;  1C0G A;  1F21 A;  3ITH A;  3TTD A;  4JI3 K;  3WEE A;  5M1F A;  1D8Y A;  2HHU A;  2W42 A;  3T1Y K;  3AVJ A;  1Q18 A;  1YAG A;  2V52 B;  2HHV A;  3HVR A;  1VRT A;  3ZT1 A;  3G6E N;  5AQQ A;  4LF7 K;  4KH6 A;  1ZBL A;  1TKT A;  1JL2 A;  2BAN A;  4B9U A;  3EL2 A;  1S5J A;  5HLF A;  3AAR A;  1JCF A;  4GVM A;  3VF4 A;  5JLF A;  1T6C A;  4AM7 A;  5AQX A;  1U48 A;  4OGE A;  2P9K B;  3MK6 A;  4FSV A;  4U67 L;  4OJR A;  1C1B A;  5E26 A;  4B1U B;  4QOZ B;  1XC9 A;  1SQK A;  1GLA G;  3ZT3 A;  3WT0 A;  1J6Z A;  3VQ8 A;  3EN9 A;  5H1S Q;  4DB3 A;  5C42 A;  4FK0 A;  2WUS A;  4DMN A;  3EKU A;  3ZSW A;  1QQC A;  3VEW A;  3D2F A;  3RVC A;  2QWP A;  3CJ7 A;  5AQZ A;  3ULD A;  2D5R A;  3KHY A;  3TPQ A;  3BF1 A;  4NYF A;  4CJR A;  3CQX A;  3J81 O;  1ZXO A;  1X9M A;  1OVY A;  2KKZ A;  3CFR A;  1M90 O;  1B9D A;  4QCL A;  4LF6 K;  4NCG A;  5J2P A;  1JXB A;  1ATN A;  1H1V A;  3O9S A;  4DR5 K;  1RBT A;  1L3U A;  3ZET A;  1BCO A;  2OCE A;  4XH5 A;  1EX4 A;  2DY4 A;  1D4X A;  4RW8 A;  1BL3 A;  2OPQ A;  4DS5 A;  1NNE A;  2OZS A;  2NRZ A;  3TSP A;  3TAR A;  1A5V A;  5BR8 K;  3NCI A;  2QWN A;  3QFU A;  1RDC A;  4FCY A;  2QM1 A;  3V4I A;  4H03 B;  5TKY A;  2VG7 A;  3ZX3 A;  4LSL A;  4L8R B;  5D3G A;  4YDU C;  4Q0B A;  2YNH A;  2VG6 A;  3HBT A;  4J2B A;  4M3W A;  4H5R A;  1WB9 A;  3ID8 A;  4CJV A;  2P9S A;  1VHX A;  1VQL N;  3HOS A;  1KC8 O;  1NKE A;  4H0O A;  3O9R A;  4E1N A;  5FPD A;  1YF5 L;  5JLH A;  4ZTF A;  4GVE A;  5AJ3 K;  4KI6 A;  1RDA A;  4CZK A;  1IKX A;  1JXE A;  1NG9 A;  3C0B A;  1EQY A;  1YTA A;  2NUB A;  2BE2 A;  2P9K A;  4BRK A;  2W40 A;  4EP5 A;  1S1W A;  3N4P A;  5K14 A;  1QSS A;  4C23 A;  4EZ6 A;  2F9T A;  5A2Q O;  1LW2 A;  4KFB A;  1U47 A;  4M3X A;  4ISE A;  1VSK A;  4HCC A;  3AVI A;  4DR4 K;  2P9N A;  4OLB A;  3O3G A;  4H4M A;  4CGG A;  2DFH A;  4R5P A;  4DV3 K;  2E88 A;  4IBN A;  1YTU A;  2YHY A;  3AY9 A;  4HTU A;  1KFD A;  4A5A A;  3NAE A;  4M41 A;  2B5J A;  4YNQ A;  4I6M B;  3DLR A;  4CZL A;  3M8R A;  4FJJ A;  2GUI A;  4DR7 K;  4FOI A;  4E3S A;  2UUC K;  3RMB A;  3OYJ A;  3BDP A;  4CJW A;  4FJ8 A;  3NF7 A;  3IFR A;  3SQ0 A;  2ZGZ A;  5C2F A;  1W7A A;  5AQI A;  3B8A X;  1N5Y A;  4JKG A;  5T7B A;  3VGM A;  2ASM A;  3L0Q A;  4FM0 A;  4KB1 A;  1NK9 A;  2FBY A;  1VSM A;  4E19 A;  3HPO A;  4RCH A;  4ELV A;  2I7P A;  1BHL A;  1LV5 A;  4BRF A;  4JK8 A;  2P9L B;  3S3N A;  3O1B A;  3TR8 A;  3HOT A;  1KAY A;  4G9Z A;  3CXC M;  1NMN A;  3E9P A;  1DKG D;  4CEO A;  1EKE A;  4WFB L;  3S3O A;  3TI0 A;  1VQM N;  1JLA A;  3W0L A;  2UUA K;  1ESV A;  3WXI A;  2Q31 A;  2Q0R A;  3VF6 A;  1DEJ A;  1ZC6 A;  4DQI A;  1BI4 B;  3F9M A;  3H1V X;  2XY7 A;  5AQT A;  1VQ5 N;  4DLG A;  1Y97 A;  2YHW A;  4PA1 A;  3NGI A;  4CEQ A;  4HVJ A;  2YKN A;  4BR4 A;  4OKJ A;  4DQQ A;  3U6F A;  4NXM K;  4FO0 A;  4NCA A;  1GLJ O;  3VEZ A;  5TKW A;  4C1N K;  4FWO A;  3ZSR A;  5KGW A;  1VSI A;  4J8F A;  3OS0 A;  1U2V A;  1N8R O;  3AO3 A;  3PO4 A;  1NGF A;  5BRD A;  5AQK A;  3M5R A;  2Z1G A;  4AQY K;  1X3M A;  1RBS A;  3P1G A;  3HYF A;  3THV A;  4K42 A;  3L2W A;  2CGJ A;  3MWT A;  2ZJR L;  2YV0 X;  4A62 A;  3HSC A;  5FPE A;  4OKE A;  2QXF A;  5C25 A;  4KHY A;  1NJZ A;  5CR4 A;  3NFA A;  4IFV A;  3BEX A;  1W2B M;  1YVU A;  1W9H A;  4FZZ A;  3OY9 A;  2NRR A;  4NXN K;  3SI6 A;  2QI2 A;  1YI2 N;  2YHX A;  3HTV A;  5CHI A;  5BPM A;  4CHY A;  4PWD A;  4FVM A;  4JI4 K;  1T7P A;  5LJW A;  2UXC K;  2G8K A;  3IRX A;  3THY B;  1S1U A;  3OBW A;  4JKE A;  1OKJ A;  3ASM A;  2FF6 A;  3KKS A;  4YOR A;  2P9L A;  5AQJ A;  3DI6 A;  3P31 A;  1VQP N;  4A5B A;  5M1K A;  4XH4 A;  4M42 A;  3TAB A;  4DFP A;  4LH4 A;  4NLB A;  4LF4 K;  1RIL A;  2BH1 A;  3SPZ A;  1NOZ A;  4DV2 K;  2P1J A;  4BC5 A;  4DF4 A;  3OYF A;  4MFB A;  4CBX A;  1N32 K;  3M6G A;  3MEE A;  3VQ9 A;  4ID5 A;  1X1P A;  2OTJ N;  3SCX A;  2DFF A;  3EE8 A;  1BI4 A;  3KK7 A;  1QVG M;  4YY3 K;  1BGX T;  1BOT O;  5DM6 L;  4A57 A;  4FJX A;  4FZY A;  3HM9 A;  5KTQ A;  2VGM A;  4FJH A;  3DLL L;  4DG1 A;  3L3U A;  3I0R A;  5M1O A;  1WAF A;  5F2R A;  4BE0 A;  2GWK A;  2QK9 A;  3IG1 A;  4H5T A;  3L2R A;  1RT1 A;  3VOV A;  1U04 A;  3HI0 A;  3VEY A;  3PY8 A;  4BGA A;  4B3R K;  1Z05 A;  1N6Q A;  3L4Q A;  4BQL A;  1CXU A;  4FWS A;  3R3L A;  2Z1I A;  4BVO A;  4B3S K;  3D0P A;  2GV9 A;  3LL3 A;  2WBN A;  2YNG A;  3HJF A;  1KCF A;  4YFU A;  3L4I A;  3ZLJ A;  3O8M A;  4B9V A;  2YKM A;  3VQ7 A;  3IS9 A;  1TAU A;  1JLQ A;  4O8K A;  4CJ5 A;  1BQM A;  3MX2 A;  3SPY A;  3CCQ N;  1JL1 A;  2WC9 A;  3RSE B;  1VQ9 N;  3U8X A;  3B6P A;  4Q5V A;  1JJ2 M;  4BQZ A;  1XNQ K;  2WON A;  3H08 A;  5BRF A;  3THY A;  2QKK A;  1NJY A;  4CJQ A;  4CZF A;  4IG3 A;  1ZYQ A;  4DTS A;  4CER A;  2P9U B;  4BR5 A;  4IG0 A;  3P38 A;  1ZBU A;  3OYC A;  1QQM A;  5SZT A;  4YOW A;  1Q82 O;  2FSK A;  3QFP A;  3K5N A;  5BN9 A;  2ASP A;  4PQU A;  3AVN A;  1QQN A;  3T19 A;  3KK1 A;  3QBW A;  3K0S A;  3K5M A;  4B9S A;  5FRM A;  1XI1 A;  4BDZ A;  3P5J A;  1XUP O;  4W5N A;  1GLD G;  4CEC A;  4YOY A;  4JKC A;  5FPM A;  3QBX A;  4M3R A;  4C8O A;  4FJL A;  2HHT A;  1BUP A;  3SAH A;  3E66 A;  2BUP A;  4BRE A;  4B9M A;  3RR8 A;  3CET A;  1S9G A;  3LWL A;  4GV3 A;  1EWQ A;  5EY4 A;  1YUW A;  3UIQ A;  1NGC A;  4QAG A;  4KHW A;  3CQY A;  3BUZ B;  4KI4 A;  5FPN A;  4K8X A;  1XQS C;  1KXP A;  3THX B;  4BRO A;  3NDK A;  4AIL C;  3JSM A;  1TKZ A;  3CCR N;  3F5T A;  4LFC K;  3AVG A;  1TKD A;  4N41 A;  3M8Q A;  4GNI A;  1JLG A;  2CGK A;  2P9I B;  4U7B A;  1KVA A;  3BGR A;  3U3Y A;  4GKK K;  3MN5 A;  4FWR A;  4WFA L;  4XEI A;  3EZW A;  3WNH A;  4BWJ A;  3QNN A;  3SK3 A;  4EP4 A;  3IDH A;  2GWJ A;  2QWR A;  1SKR A;  4DSL A;  2F7T A;  2A5X A;  3VN5 A;  4NYN A;  3TAQ A;  1VK0 A;  4EHT A;  4OVL A;  3VQD A;  1NJW A;  3AO4 A;  1J54 A;  4IFE A;  4KV8 A;  1TYQ B;  3HM8 A;  2PYL A;  3C65 A;  2XHB A;  1RBU A;  3I0S A;  3SAG A;  4KTW A;  3S41 A;  1VSE A;  4M45 A;  3V1O A;  2IGI A;  3OYM A;  5AQW A;  4MLH A;  1G99 A;  3AA5 X;  4WCE L;  3FZM A;  3WQT A;  4HUF A;  4BRC A;  1HJO A;  2OAN A;  5KQD A;  2KTQ A;  4R79 A;  1I39 A;  4CFD A;  1VQ4 N;  3E01 A;  2KW4 A;  1YXQ A;  1SUQ A;  4CD1 A;  3JXU A;  4YDU A;  2GX9 A;  3HT3 A;  3CCE N;  3RRH A;  3OBY A;  4KPY A;  4FJG A;  5AQH A;  2Z1J A;  1X9W A;  5KI6 A;  1K73 O;  3DRP A;  4DWI A;  4B1Z A;  3OYK A;  4FM1 A;  1LOT B;  1CLQ A;  5I42 A;  3SQ4 A;  4CJ4 A;  5CYM A;  1A5W A;  3THX A;  1DGK N;  5KPR A;  2E5L K;  1VRU A;  5LL6 Z;  3I8D A;  3TAM A;  4AHS A;  3QML A;  1XMQ K;  3PUF A;  4CED A;  4X66 K;  2P9I A;  3PV8 A;  3L8B A;  1S1V A;  4YOT A;  1NK7 A;  4JNE A;  1MWK A;  3C6T A;  1QHT A;  1RTJ A;  2HOE A;  2IIR A;  3CFO A;  4DU3 A;  2EHG A;  5ELZ A;  5JS2 A;  3GOI A;  1IV0 A;  4AH9 A;  2F8T A;  3CD6 N;  2O8C B;  3DLH A;  4WQ5 C;  3SQ2 A;  4BR0 A;  4W5Q A;  2HHW A;  4E1M A;  4JHD B;  4DTR A;  3VQP A;  4IXC A;  1RDD A;  1NJI O;  3LDO A;  3A5N C;  3TSU A;  4Z94 A;  3K58 A;  1OH6 A;  3U3G A;  4QS8 A;  1HR0 K;  5JVH L;  4BDP A;  4DV5 K;  4B3O A;  3T69 A;  2UXD K;  3V9S A;  3VA0 A;  3CI5 A;  3UKU B;  1TVR A;  3GE1 A;  3NE6 A;  2YNF A;  5KQ8 A;  1IJJ A;  3EEQ A;  1W0H A;  2H3G X;  3K2P A;  4AHU A;  4IEE A;  4J2A A;  1IBL K;  3L2U A;  1E4G T;  1T44 A;  2HBM A;  1HX1 A;  3LZI A;  1HNX K;  1ZBI A;  2RE2 A;  4E7I A;  5KRS A;  3AVM A;  3CM6 A;  1LAV A;  4IO9 L;  2V51 B;  3PX0 A;  1B9F A;  3P4I A;  5GAH P;  1QS4 A;  3WXM B;  3PSF A;  4DFJ A;  1QSY A;  4K25 A;  4HUG A;  3OTO K;  1E4F T;  4DSJ A;  3ZEU B;  3CIP A;  3DLG A;  3F9K A;  3LAK A;  4DTX A;  2G8W A;  4FPA A;  4DSE A;  3NVK A;  2VYP A;  3CME N;  1C0F A;  4DTM A;  2O8E B;  4DTJ A;  3LAM A;  4CZJ A;  4ISG A;  3D2E B;  1TK8 A;  4CFA A;  2FSN A;  5EOY A;  2A40 A;  2P5G A;  1IG8 A;  4CJ3 A;  1C0M A;  1FXX A;  4K8Z A;  3SUP A;  2P9P B;  4E1J A;  5AZJ B;  2OPR A;  3WXK A;  3SUQ A;  3AO1 A;  5IWA K;  3CCM N;  4OPH A;  5BRH A;  4CCH A;  3THW B;  3IAY A;  5AQN A;  3LPU A;  4NB4 A;  3KWI A;  5AQP A;  1K9M O;  5KGX A;  1O1W A;  1BWF O;  1SV5 A;  3KK3 A;  1BIU A;  1KRP A;  4Z0U A;  1HNI A;  1HKG A;  3NGZ A;  4FYD A;  3ISN C;  2ZD1 A;  4GY2 B;  4BRN A;  3SYZ A;  1NM1 A;  1HKC A;  1RTI A;  1U49 A;  3UKR B;  2A41 A;  4PUO A;  4F2R A;  4CBW A;  2OYQ A;  3WXL A;  3UKU A;  1Z25 A;  4KTZ A;  2E8A A;  3MAQ A;  1ATS A;  1HQE A;  3AVA A;  3CC4 N;  4IO8 A;  3EZ5 A;  1RT3 A;  2Z1H A;  5F0X A;  5BPL A;  3CJ1 A;  2Y1I A;  3SZ2 A;  2VWB A;  4CEB A;  4Y1C A;  3I33 A;  3LAL A;  4O55 A;  3LP3 A;  2FLO A;  5BR9 A;  3CCU N;  1JLB A;  2E6L A;  3O3H A;  3KVG A;  2OZM A;  3A5L C;  2HHH K;  4DTP A;  2X78 A;  3KWG A;  3FFK B;  2RKI A;  3J7Y P;  3VGL A;  3KLI A;  3TAE A;  3NBP A;  1WSE A;  2FSJ A;  3EO3 A;  3OYN A;  4AHC A;  3G25 A;  1REV A;  1MU2 A;  3ZYY X;  3VQB A;  4JI6 K;  3ZEU A;  4M3Z A;  3QIO A;  1HNZ K;  2NRX A;  3ALY A;  3CCV N;  3TAF A;  2AJQ A;  1K8K B;  3DJC A;  1NK8 A;  1IH7 A;  2O8E A;  4FK4 A;  3KKR A;  2VQE K;  1TUU A;  2FF3 B;  3D2E A;  4DKW A;  4BR2 A;  3H3O B;  5AQM A;  1OH7 A;  3ENH A;  3NF6 A;  4DTN A;  4I7F A;  1HPZ A;  1DLO A;  3VTI A;  2P9P A;  2Q36 A;  2O8F B;  3NVM A;  1TK5 A;  1I3A A;  4LH5 A;  4C8K A;  1CXQ A;  2DTU A;  3SNN A;  3ID6 A;  4BRP A;  3MXJ A;  1YVN A;  3VEO A;  2A6A A;  3M3Z A;  3UE5 A;  5GAD P;  5AFU A;  1T8E A;  2QEX N;  1HPM A;  5EXW A;  4M3T A;  4OLA A;  2RN2 A;  1X9S A;  3LP2 A;  5AR0 A;  3SUO A;  1JLE A;  3HRG A;  1BU6 O;  2A1S A;  3FGU A;  4JK9 A;  3R1X A;  4C8M A;  3Q7B A;  3L2Q A;  3U9Z A;  3FZF A;  2HBK A;  4PHT X;  4BAC A;  3UKR A;  4DV7 K;  4Z4H A;  3QIN A;  4I9L A;  4YHH K;  1RBV A;  1GLL O;  1WLJ A;  2OPP A;  2I5J A;  4IJN A;  1T6D A;  4JAX A;  3C94 A;  2E1Y A;  1P90 A;  1IG9 A;  2O4I A;  5AZI B;  1NK5 A;  4FXD A;  2QXL A;  2V7Y A;  1UWB A;  4CEF A;  4DU4 A;  3GBT A;  3DYA A;  3H3N O;  4ZTJ A;  5E84 A;  2Q1N A;  4AHV A;  2X6N A;  1EO1 A;  2DFE A;  3HVT A;  3KD5 E;  2ZF5 O;  2XRI A;  4AM6 A;  4WYB A;  4JN4 A;  4H5V A;  4M3U A;  2IOC A;  3CC7 N;  2FBT A;  4KAZ A;  1X3N A;  3EY1 A;  3AGR A;  4BRL A;  1IKV A;  2NNW A;  1VQN N;  5M1P A;  4I6M A;  3HL8 A;  4ICL A;  3K9J A;  1BG3 A;  1J9A A;  5HP1 A;  2QWO A;  2NRT A;  4FLX A;  1S1T A;  3HP9 A;  4JI5 K;  3J7A P;  1WSH A;  2D0B A;  2UUB K;  1Q81 O;  1RCH A;  1L3V A;  1K8K A;  4YOV A;  4FLV A;  4G1Q A;  3HPG A;  4ELU A;  1RBR A;  4MO4 A;  4IJA A;  1FKO A;  4X64 K;  4YOU A;  5ADX H;  4DFK A;  4CE9 A;  1WSG A;  1WAJ A;  3O4Q A;  3VEV A;  3PSI A;  3P39 A;  1FW6 A;  2PFU A;  3CCJ N;  5EX5 A;  3CYM A;  1D9D A;  4N56 A;  5HRR A;  4B8A B;  4CIF A;  4BGB A;  2A3Z A;  1RTH A;  3I55 N;  3MMV A;  4F4K A;  3SQ1 A;  4A2A A;  3DWL A;  4E7H A;  1C0U A;  3AA3 A;  4BRH A;  2E6M A;  2KQ2 A;  4BRD A;  1ZBS A;  3OS1 A;  1D9F A;  4LF9 K;  3M8S A;  2AA4 A;  1NGA A;  4CK3 A;  1HNW K;  5M1Q A;  3OJU A;  2E4L A;  4FJM A;  2HVI A;  1A5X A;  3KLF A;  4Y0W A;  1EET A;  3SJH A;  5C0Y A;  4X65 K;  2D0C A;  3HXM A;  5AZI A;  1EP4 A;  5JIC A;  1S72 N;  3O4N A;  4RG8 A;  1VAZ A;  4XH1 A;  2AP1 A;  4JKA A;  1ASW A;  2E2Q A;  4O8U A;  3G71 N;  1VSJ A;  4KTQ A;  3MCA B;  4B8C A;  3O80 A;  5DMR A;  4BE2 A;  1WNS A;  3AA4 A;  2JWK A;  4MQ3 A;  3LM9 A;  3FLC O;  4BRA A;  3TWH A;  3PIP L;  5BRE A;  4A61 A;  1VSL A;  4IFY A;  4DQS A;  4OGC A;  3QER A;  3NH2 A;  4BWM A;  3QES A;  3SMS A;  4CF2 A;  4DFM A;  3HST B;  4ISF A;  4CGI A;  4H4O A;  1NU0 A;  2ETJ A;  4J2E A;  5SWM A;  1BA1 A;  4KHS A;  4FM2 A;  2Y1J A;  4ILG B;  4BC4 A;  1IBM K;  5F1X A;  4W5R A;  1RNH A;  5J2N A;  1XHZ A;  2QWL A;  4DUY K;  1X9J A;  1GOC A;  3VQQ A;  2Q3S A;  3NF8 A;  1ZBF A;  3H45 C;  1D5A A;  1Q8I A;  3MWP A;  4DS4 A;  3KLG A;  2BGG A;  4JS5 A;  4JRQ A;  1SL0 A;  3VET A;  4EHU A;  2PY5 A;  1KQS M;  3ZX2 A;  3RWU A;  4OX9 K;  1RT7 A;  2CH6 A;  4CZH A;  4BG8 A;  1FK9 A;  4CF8 A;  3FFI A;  3TAN A;  1KAX A;  4CJF A;  3VTH A;  4FVU A;  4Z4I A;  3S9H A;  1UOC A;  3OYA A;  4N76 A;  1NGB A;  1U45 A;  5EU7 A;  4CBU A;  4FJ5 A;  3BZK A;  4CF9 A;  4CFB A;  3LAN A;  4M7X A;  1MWM A;  4KHQ A;  2Q0U A;  1SKW A;  4FL9 A;  4BVP A;  1HMV A;  3KLH A;  2VCP A;  4JD2 B;  1CZA N;  4WQ5 A;  5EVZ A;  4DHY A;  1P8Z A;  3VES A;  3ZSZ A;  3KD1 E;  3A5M C;  3QEW A;  3ZT0 A;  3CC2 N;  4BE1 A;  5IT9 O;  3CPW M;  4DUZ K;  1L3S A;  4K43 A;  4F3O A;  3NH0 A;  1XWL A;  1UA0 A;  1WSF A;  4IDK A;  4DR3 K;  3AAP A;  1QTM A;  5AQU A;  2NRV A;  4CZE A;  3D45 A;  4EIA A;  4B1X B;  2P5O A;  1VQ8 N;  4CJP A;  3DM2 A;  3MEG A;  2WOM A;  1MA9 B;  4MDA A;  4CW7 B;  4B1Y B;  1VQ7 N;  1G15 A;  3L3V A;  5AQS A;  1TKX A;  3ZT4 A;  3SAF A;  3QEP A;  1FKP A;  4FJK A;  4F2S A;  3ZSO A;  1EXQ A;  3RSE A;  2Q97 A;  4LFA K;  1SS6 A;  4BRQ A;  3D6R A;  4CJ7 A;  2FBV A;  4JV5 K;  3FR0 A;  4IEI A;  2ASO A;  3DRS A;  1VSF A;  2HHX A;  3VER A;  3AVK A;  4AF1 A;  2OPS A;  1V4S A;  1VSD A;  2PYJ A;  4CK2 A;  4LD0 A;  5LJV A;  3ATU A;  2P9U A;  1YHQ N;  4UQG A;  2I7N A;  1HJR A;  2BTF A;  1IKY A;  4M63 C;  1NKC A;  1LWC A;  3IMX A;  4FJI A;  3NF9 A;  4HHT A;  4DSK A;  1TGO A;  4DV1 K;  1NGJ A;  1YJW N;  4LF5 K;  3WEE B;  1ATR A;  3K9K A;  4IDH A;  2OTL N;  2NRH A;  1NLV A;  1RDW X;  4MO5 A;  5J2Q A;  4KH4 A;  2NLX A;  1WSJ A;  4H5N A;  3DMJ A;  1GLB G;  3LP1 A;  2FBX A;  4J2D A;  1QZ6 A;  3I56 N;  3CMA N;  2G8V A;  3R8E A;  4DCH A;  4JD2 A;  1RT4 A;  5CE3 A;  4JI8 K;  5AQG A;  1E3M A;  2B6A A;  2O8D B;  1Q7Y O;  2ZJQ L;  3GDQ A;  2NZT A;  3DOL A;  3ZCM A;  1J5E K;  2HVH A;  4GV6 A;  3ENB A;  3AVC A;  1RT2 A;  3OJS A;  4BRG A;  3EYZ A;  1WBD A;  5LMU K;  1N34 K;  4CD3 A;  1XNR K;  2E1Z A;  3RMC A;  4PL7 A;  3LDN A;  5AQO A;  4C8L A;  4KH5 A;  3LDS A;  1FJG K;  2IVN A;  1C1A A;  4FJN A;  1YJ9 N;  4CVN E;  3K5L A;  1QSL A;  2E2P A;  4ELT A;  1WOQ A;  3EE9 A;  3V1R A;  3W3D A;  3D2F B;  4FWQ A;  4DV0 K;  3KZB A;  3DLB A;  4DSI A;  4N5S A;  4KRE A;  1GLE G;  3ZT2 A;  4KKO A;  2YHA A;  4WQ4 C;  5LMN K;  4WE1 A;  3QEI A;  4PL8 A;  4NO7 A;  2XO7 A;  2ZE2 A;  1QE1 A;  5C2D A;  1R59 O;  2D1K A;  1TYQ A;  1XHX A;  2DPN A;  1KD1 O;  1S9E A;  4WF9 L;  1NBW A;  2V7Z A;  1UAX A;  4M7Y A;  4H0T B;  2ZJP L;  2YJF A;  3KLE A;  3DOK A;  4FWP A;  4B1V A;  5DK5 A; 
#chains in the Genus database with same CATH homology
 1JCG A;  3FFK B;  4NLB A;  3SBT A;  2BH1 A;  1BO5 O;  3VGL A;  3A0I X;  4QS9 A;  4BC5 A;  2FSJ A;  3SBG A;  3EO3 A;  1SZ2 A;  4CBX A;  2YI1 A;  3H6E A;  3G25 A;  3M6G A;  3ZYY X;  2QWM A;  3Q7C A;  3N4Q A;  3ZEU A;  3BP8 A;  2OTJ N;  2NRX A;  1XC3 A;  3CCV N;  3EE8 A;  4FWN A;  3KK7 A;  1QVG M;  3O9U A;  1BOT O;  1K8K B;  5DM6 L;  2J4R A;  2RHK A;  3DJC A;  3HZ6 A;  2P9S B;  3LDL A;  3LDQ A;  4A57 A;  4FWL A;  4HTL A;  4HWI A;  3ZX0 A;  1TUU A;  2VGM A;  2FF3 B;  3D2E A;  4DKW A;  4BR2 A;  5KPT A;  3DLL L;  3H3O B;  3IKM A;  3O08 A;  5AQM A;  2QA4 N;  3ENH A;  3SMP A;  3AGK A;  5M1O A;  1S22 A;  3FZL A;  2YJE A;  4BR9 A;  3NVK A;  3C7N A;  5F2R A;  2HF4 A;  3VTI A;  5GAG P;  2P9P A;  2GWK A;  2Q36 A;  3NVM A;  4H5T A;  4DQ8 A;  1Q86 O;  3ID6 A;  4IZ9 A;  3VOV A;  4BRP A;  3C6A A;  3HI0 A;  3VEY A;  1YVN A;  2NRW A;  3VEO A;  4BGA A;  2A6A A;  3M3Z A;  1Z05 A;  4KBO A;  3UE5 A;  3L4Q A;  4B9Q A;  4BQL A;  5AFU A;  1BDG A;  5GAD P;  1HPM A;  5EXW A;  2P9N B;  5AQV A;  2QEX N;  4CZI A;  3MN7 A;  4FWS A;  3R3L A;  5AR0 A;  5C12 A;  4BVO A;  3HRG A;  1BU6 O;  3LL3 A;  2PAV A;  3FZK A;  3FGU A;  4JK9 A;  2CH5 A;  3R1X A;  4CI6 A;  1QHA A;  3Q7B A;  2WBN A;  3U9Z A;  3FZF A;  2HBK A;  1NGE A;  4PHT X;  3E1Y A;  3LM2 A;  4H0Y B;  5AQF A;  4OO1 J;  3L4I A;  3O8M A;  3UKR A;  3CJB A;  1U6Z A;  4FWM A;  2D0P A;  1SAZ A;  4RWT A;  1WUA A;  1GLL O;  3O1W A;  4IJN A;  4O8K A;  1T6D A;  4JAX A;  3CJC A;  2E1Y A;  1P90 A;  4JKF A;  3MX2 A;  2UYT A;  5B8H A;  3CCQ N;  2WC9 A;  5AZI B;  3RSE B;  1VQ9 N;  3U8X A;  2QXL A;  4C1N I;  2GTD A;  1HLU A;  2V7Y A;  1JJ2 M;  4BQZ A;  3GBT A;  3H3N O;  5BRF A;  5JMV A;  2D0O A;  5E84 A;  2Q1N A;  2ZWH A;  4JKG B;  1K8A O;  4CZF A;  4JHD A;  1EO1 A;  3ENO A;  2ZF5 O;  2QW9 A;  4MDB A;  3SLC A;  3U4L A;  3UB5 A;  4AM6 A;  4WYB A;  3E9L A;  5KPZ A;  1NGH A;  3EKS A;  4JN4 A;  4H5V A;  1GLF O;  2P9U B;  4PKH A;  3CC7 N;  3DXM B;  4BR5 A;  5GAE P;  3C6H A;  1X3N A;  3AGR A;  3P38 A;  2IVP A;  4BRL A;  3J8A A;  3CMA N;  3NMU A;  2NNW A;  1VQN N;  5M1P A;  4I6M A;  1QQM A;  3H46 O;  4YOW A;  1Q82 O;  3K9J A;  1BG3 A;  1LCU A;  5AQL A;  2QWO A;  2HBL A;  2FSK A;  3QFP A;  2GEM A;  2NRT A;  3IUC A;  5BN9 A;  1NGD A;  2ASP A;  2HST A;  1RDU A;  1Y64 A;  3O4W A;  1Q81 O;  5JVG L;  2PBD A;  1QQN A;  2IVO A;  1K8K A;  4YOV A;  3QBW A;  3R9P A;  3AAQ A;  1ILY A;  3TTF A;  3MDQ A;  1QQO A;  1XUP O;  2CGL A;  4IJA A;  4MO4 A;  1GLD G;  3T7Z A;  5AFU H;  4YOY A;  1GLC G;  4JKC A;  5FPM A;  4O5F A;  4YOU A;  3QBX A;  5ADX H;  2E2N A;  3VEX A;  3VF2 A;  2E20 A;  1RFQ A;  3QDK A;  4PKG A;  5AQY A;  3ZET B;  4IOX A;  4BRI A;  4QS7 A;  4H0V B;  2Q2R A;  3VEV A;  4EAH D;  3WUH A;  1BUP A;  3MN6 A;  1YIJ N;  3SAH A;  3E66 A;  3E9O A;  3O6W A;  2BUP A;  3U9D A;  1W97 L;  4BRE A;  1TUY A;  3P39 A;  2PFU A;  3CCJ N;  4EFH A;  5EX5 A;  1C0G A;  1T3V A;  3CET A;  3TTD A;  3MCP A;  4GV3 A;  5EY4 A;  1VQ6 N;  3WEE A;  1YUW A;  5M1F A;  1NGC A;  1U2V B;  3CQY A;  4BGB A;  2A3Z A;  3JS6 A;  3BUZ B;  3D7E O;  5FPN A;  5HL7 L;  3MMV A;  3I55 N;  1VQK N;  1MDU B;  1XQS C;  4A2A A;  3DWL A;  1KXP A;  4BRH A;  1Q18 A;  4CZG A;  3CER A;  1YAG A;  2V52 B;  4BRO A;  1ZBS A;  4A59 A;  4BRD A;  4FOE A;  4H0P A;  2AA4 A;  3G6E N;  3CCR N;  3F5T A;  5AQQ A;  4KH6 A;  3OA9 A;  3I8B A;  5HOO A;  3CCS N;  3EL2 A;  4GNI A;  1NGA A;  2CGK A;  5M1Q A;  5GIP A;  2P9I B;  2VGN A;  3AAR A;  1JCF A;  3VF4 A;  4U7B A;  4PKI A;  5JLF A;  1T6C A;  3MN5 A;  4AM7 A;  4CZM A;  5AQX A;  4FWR A;  4WFA L;  4XEI A;  3EZW A;  4Y0W A;  4WFN L;  3SJH A;  3SK3 A;  5C0Y A;  4JK7 A;  3IDH A;  5AZI A;  5AZJ A;  2GWJ A;  5JIC A;  2QWR A;  2P9K B;  5BPN A;  3MK6 A;  4FSV A;  1S72 N;  2F7T A;  2A5X A;  4U67 L;  4FWK A;  1VAZ A;  1VQO N;  4XH1 A;  2AP1 A;  4JKA A;  2E2Q A;  3MX5 A;  4O8U A;  5E26 A;  4B1U B;  4EHT A;  3G71 N;  1SQK A;  1GLA G;  3MCA B;  3O80 A;  2JWL A;  5AQR A;  3WT0 A;  1J6Z A;  3EN9 A;  4IFE A;  2KLA A;  5H1S Q;  1TYQ B;  3HM8 A;  2JWK A;  3C65 A;  3LM9 A;  3FLC O;  4BRA A;  4DB3 A;  4YOX A;  2WUS A;  3EKU A;  3PIP L;  3DXM A;  3SAG A;  5BRE A;  3S41 A;  4A61 A;  3VEW A;  3D2F A;  2YCH A;  4H5W A;  3RVC A;  5AQW A;  2QWP A;  3CJ7 A;  5AQZ A;  4MLH A;  3SMS A;  1G99 A;  4ISF A;  4WCE L;  3KHY A;  3FZM A;  4JKH A;  3BF1 A;  3A8Y A;  3TPQ A;  3WQT A;  4BRC A;  1BA1 A;  3CQX A;  4ILG B;  1HJO A;  1ZXO A;  4BC4 A;  5F1X A;  2OAN A;  1QZ5 A;  2YX6 A;  5KQD A;  1OVY A;  2KKZ A;  2QWL A;  1M90 O;  3TTC A;  3TSQ A;  4R79 A;  3DAW A;  1X9J A;  3QB0 A;  1VQ4 N;  1JCE A;  3WXJ A;  1ATN A;  4BC3 A;  1YXQ A;  2QTD A;  3H45 C;  1H1V A;  3O9S A;  3MWP A;  4CD1 A;  3BF3 A;  3ZET A;  5M1N A;  4XH5 A;  3JXU A;  4ILJ A;  3VET A;  1HKB A;  4YDU A;  4EHU A;  2GX9 A;  1D4X A;  3R6M A;  1KQS M;  3ZX2 A;  3CCE N;  3OBY A;  2CH6 A;  3OW2 M;  4CZH A;  5AQH A;  3DXK B;  2NRZ A;  2HMP A;  4RTF D;  3TSP A;  3LDP A;  4BG8 A;  2QWN A;  3QFU A;  4LC9 B;  1NMD A;  1K73 O;  3QIC A;  1KAX A;  2QM1 A;  4B1Z A;  3VTH A;  4FVU A;  1LOT B;  4H03 B;  5TKY A;  4JKD A;  3ZX3 A;  1NGB A;  4YDU C;  3PIO L;  4CBU A;  5C15 A;  3HBT A;  1DGK N;  4M7X A;  5KPR A;  4H5R A;  3ID8 A;  1MWM A;  2P9S A;  1VQL N;  3CHW A;  2Q0U A;  4FL9 A;  5BN8 A;  3HOS A;  1KC8 O;  4BVP A;  4H0O A;  3J7Z O;  3QML A;  3O9R A;  4JKB A;  2VCP A;  4JD2 B;  3VMF B;  1CZA N;  2FXU A;  2P9I A;  5FPD A;  1KAZ A;  1YF5 L;  3VEN A;  5JLH A;  4GVE A;  3PLA A;  4WQ5 A;  4YOT A;  5EVZ A;  4JNE A;  1MWK A;  1P8Z A;  1BA0 A;  3VES A;  4DHY A;  1S3X A;  3A5M C;  4CZK A;  2HOE A;  3C0B A;  1EQY A;  2HF3 A;  2IIR A;  2P9K A;  4BRK A;  3CC2 N;  2W40 A;  3L6Q A;  5ELZ A;  3O5B A;  3CPW M;  2W41 A;  3N4P A;  3ULE B;  4K43 A;  4C23 A;  3GOI A;  2F9T A;  4BC2 A;  3CD6 N;  4FPB A;  4IOA L;  2GUP A;  4ISE A;  4WQ5 C;  3A5O C;  2P9N A;  3AAP A;  3GL1 A;  5AQU A;  5MLC Q;  2NRV A;  4BR0 A;  4JEP A;  3CJA A;  4JHD B;  4CZE A;  3GG4 A;  4IWV A;  4IXC A;  4EIA A;  2E88 A;  4B1X B;  5GIO A;  3G4S N;  1NJI O;  2ITM A;  1VQ8 N;  3LDO A;  3A5N C;  1RGI A;  2YHY A;  3AY9 A;  4K41 A;  3TSU A;  1YIT N;  1MA9 B;  4Z94 A;  4MDA A;  4QS8 A;  4A5A A;  4BY9 C;  3O9Q A;  4B1Y B;  5JVH L;  1QVF M;  1NGI A;  4I6M B;  4CZL A;  4BR7 A;  3T69 A;  1VQ7 N;  5AQS A;  3SAF A;  4FOI A;  1M1K O;  3CI5 A;  3UKU B;  3VGK A;  3RSE A;  2QWQ A;  3GE1 A;  5KQ8 A;  1IJJ A;  3IFR A;  2ZGZ A;  5C2F A;  2Q97 A;  3ATV A;  1SS6 A;  2H3G X;  3CPE A;  3D6R A;  5AQI A;  4BRQ A;  4CJ7 A;  3B8A X;  4IEE A;  5C10 A;  4JKG A;  4BRM A;  3FR0 A;  3VGM A;  4UY8 O;  2ASM A;  3L0Q A;  4OPA A;  1E4G T;  4IEI A;  2ASO A;  1T44 A;  2HBM A;  1HX1 A;  3VER A;  4BG9 A;  4AF1 A;  1V4S A;  4L3Q A;  4ILH A;  3M1F A;  2RE2 A;  4RCH A;  2ZGY A;  5LJV A;  2I7P A;  2P9U A;  3ATU A;  1YHQ N;  3DXK A;  4BRF A;  2I7N A;  4IO9 L;  2V51 B;  2BTF A;  4JK8 A;  2P9L B;  3VPZ A;  1YJN N;  4M63 C;  3P4I A;  3IMX A;  5GAH P;  3O1B A;  3HOT A;  1KAY A;  4G9Z A;  3WXM B;  3CXC M;  1NGJ A;  3E9P A;  1YJW N;  1DKG D;  2F9W A;  3WEE B;  4WFB L;  1ATR A;  4K25 A;  3K9K A;  3H1Q A;  4IDH A;  4F9O A;  1VQM N;  2OTL N;  3W0L A;  2NRH A;  1NLV A;  1ESV A;  1E4F T;  1RDW X;  2Q31 A;  1O13 A;  4MO5 A;  3WXI A;  3ZEU B;  2Q0R A;  4KH4 A;  3CIP A;  3FZH A;  2NLX A;  4MLE A;  3VF6 A;  5ADX A;  4H5N A;  1DEJ A;  1V4T A;  1GLB G;  1ZC6 A;  3CCL N;  3F9M A;  3H1V X;  1QZ6 A;  3I56 N;  4FPA A;  5AQT A;  3R8E A;  4DCH A;  2KHO A;  2E2O A;  2VYP A;  4JD2 A;  5AQG A;  5CE3 A;  3CF5 L;  1VQ5 N;  3CME N;  2YHW A;  1C0F A;  2WFB A;  1Q7Y O;  3WQU A;  2ZJQ L;  4CZJ A;  4ISG A;  3GDQ A;  4BR4 A;  3D2E B;  2NZT A;  2FSN A;  5EOY A;  2A40 A;  4FO0 A;  4NLC A;  1DT9 A;  4GV6 A;  2A42 A;  1GLJ O;  3TU5 A;  3ENB A;  5TKW A;  3VEZ A;  4C1N K;  4FWO A;  4BRG A;  1IG8 A;  3ULE A;  3C7N B;  1HUX A;  4CD3 A;  2E1Z A;  2P9P B;  5AZJ B;  4E1J A;  5DM7 L;  3MN9 A;  5LY3 A;  3WXK A;  4PL7 A;  3LDN A;  5AQO A;  4KH5 A;  3CCM N;  4OPH A;  5BRH A;  4J8F A;  1U2V A;  1N8R O;  5AQN A;  2IVN A;  4NB4 A;  1NGF A;  3KWI A;  5AQP A;  5BRD A;  5AQK A;  1K9M O;  2D4W A;  1YJ9 N;  2HBJ A;  3O9T A;  3M5R A;  1X3M A;  4WQ4 A;  1BWF O;  4K42 A;  2CGJ A;  3MWT A;  2E2P A;  1WOQ A;  3FE1 A;  3EE9 A;  3W3D A;  2ZJR L;  1HKG A;  3D2F B;  4FWQ A;  4A62 A;  3KZB A;  5I9E B;  3HSC A;  5FPE A;  4GY2 B;  4BRN A;  1NM1 A;  1HKC A;  3UKR B;  2A41 A;  1Z6R A;  1NGG A;  5CR4 A;  4CBW A;  3WXL A;  3BEX A;  1W2B M;  3UKU A;  1GLE G;  2NRR A;  5GIN A;  4WQ4 C;  4GV9 A;  2E8A A;  2QI2 A;  1YI2 N;  2YHX A;  1ATS A;  3HTV A;  5CHI A;  5BPM A;  3CC4 N;  4A2B A;  4PL8 A;  4NO7 A;  4IO8 A;  5F0X A;  5BPL A;  3CJ1 A;  2VWB A;  2EWS A;  4B1W B;  5C2D A;  1R59 O;  2D1K A;  1NWK A;  3I33 A;  3OHR A;  5LJW A;  1TYQ A;  2FLO A;  2DPN A;  5BR9 A;  3CCU N;  1KD1 O;  4WF9 L;  3OBW A;  4JKE A;  1NBW A;  2V7Z A;  3KVG A;  1OKJ A;  4M7Y A;  2GEL A;  4H0T B;  2FF6 A;  3CJ9 A;  2ZJP L;  3A5L C;  2YJF A;  3F2K A;  4H0X B;  4YOR A;  2P9L A;  5AQJ A;  4IOC L;  4FWP A;  3P31 A;  1VQP N;  4B1V A;  4A5B A;  5M1K A;  4XH4 A;  3KWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...