4PQUA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
total genus 146
structure length 545
sequence length 545
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pquA05
2ASLA 1RT6A 2D5RA 1HRHA 4KB1A 1IO2A 4ED7A 2IC3A 3CJ3A 3DM2A 4IRDA 1QAJA 1JLEA 3U6FA 5KFUA 5HP1A 3HP6A 4FBUA 2QK9A 3K5OA 4Y2AA 3AA3A 4QWEA 4FM1A 2BR0A 2JC0A 1S9FA 3KK3B 4ECQA 1LW0A 3LP0A 5DMRA 1S9EA 3MEDB 2YNGA 1KFDA 1D0EA 4BWMA 4KBIA 1X9WA 3NKYA 5EWFA 2DPJA 4CIGA 2OPPB 4CJ4A 5C25B 2RPIA 4NLGA 1N6QB 3V6DA 3Q8QB 4YNQA 4AH9A 3ZT1A 3IRXB 3V6KA 4I9LA 3QEIA 3I5BA 5KFQA 2ZD1B 4EBDA 3MEGB 4CEDA 2YNHB 1HYVA 1S1TA 4YP3A 4KO0B 4NLXA 3DLRA 4M3RA 4HKQA 4Z4EA 4TY9A 3PO5A 4XO0A 3MTKA 2ZE2B 3N6MA 1F21A 4O4GA 3GIMA 2RKIB 4ZP8A 4FJ5A 1N5YA 3EZUA 1NOZA 1S1UA 2WOMB 4CJRA 3OJUA 2X78A 1DLOB 3QIOA 3PUFA 1KSPA 2G8IA 2ASDA 2P5OA 2E4LA 4BDPA 3PX0A 2FLPA 4CJFA 3PX4A 4TYBA 1RTJB 3CO9A 4FK0A 1WN7A 4RW9B 1S97A 3EPIA 1W9HA 1Z4UA 2W8KA 2C2DA 4Y1DA 4H4MB 2R2TA 4QWCA 2FVSA 1JLQB 2BQ3A 3KNAA 4HYKA 3LZIA 2OPQA 5KFHA 3HYFA 3UIQA 3MEEB 4ID5A 3TAMB 1TK5A 4YFUA 3AO4A 1HYZA 5KGWA 1BQNB 4PQUB 1Z26A 1K1SA 3LPUA 4F4ZA 1S9GA 4CEAA 4F3OA 3M8PB 3LP1A 3UQSA 3ZCMA 3HVRA 1S6PA 4RW6B 3AVAA 1RAJA 1RDAA 4O3NA 4E19A 2IM0A 4FK4A 4HVJA 5EDWA 4CEEA 2KW4A 5J2MA 4ZP9A 3I5CA 4CHYA 4FZXC 3OLAA 5E41A 4LH4A 4KTZA 1S0MA 2VA2A 2YHAA 1NKBA 1T7PA 3AV9A 4B8AB 4FJMA 3AVBA 5KG2A 3QEXA 3OS0A 4QCLA 3M9OB 1HNIB 4OPKA 4FJLA 2HHQA 4IH7A 4J9RA 4K4YA 4G1QB 2HWIA 2HMIA 2OPSA 3HVTA 4Q5VA 4BDYA 1J5OA 3TQ1A 4CE9A 3TAEA 1LWCA 5KFWA 5KFJA 4X2BA 3RMCA 2YHBA 2G8VA 5CYQA 5C24A 2JGUA 4EBCA 2R2UA 5KFSA 3P83D 2Q3SA 2P5GA 4B9VA 2G8WA 3PO4A 1CSJA 1KVCA 3SPYA 5KFGA 2OZMA 4NYZA 5CYMB 4DSIA 4MQ3A 3ZSRA 3KMQA 3IG1A 4DF4A 4IG3A 2W9BB 5FDLA 1KHVA 2BRKA 2XHBA 1BL3A 3EY1A 3GIJA 3NF6A 5F8NA 1EX4A 4JUZA 1TV6A 4CFBA 4CESA 4JS4A 3OYLA 2W7OA 4J9PA 4DTMA 4LSLA 3BSNA 2FLNA 4BDZA 1MU2A 3DLKB 5KG6A 4ZHRB 4DF8A 3DRSB 4RW4A 3K2PA 4DQIA 4OLAA 4ECYA 1G15A 3TVKA 1TKTA 4LSNA 3KLEB 2IOCA 3DMJB 1JIHA 2DFFA 1LWFB 4E7IA 4FLXA 4TSXA 4AHTA 1NJZA 1IKVB 5J2NA 5C42A 4FJNA 3KK2A 4BE0A 2KZMA 1SH2A 2HWHA 3D45A 3K57A 5F8JA 4M42A 3RR8A 4IR9A 1UOCA 2F8SA 3KLGA 2VG7A 4GMJB 3RRHA 2HAIA 1WSIA 3OL7A 3H5UA 1U47A 3RB4A 3DYAB 1J54A 2OZSA 2OH2A 3AO1A 4TYAA 2ASJA 2VWKA 2FJXA 2JEJA 4Y1CA 1T03B 3L2UA 2EX3A 3EYZA 2D0AA 4Z0UA 3GIKA 5KT4A 2I5JA 1K6YA 4K4SA 4IG0B 1WNEA 1YTAA 4M3UA 3MR3A 4KE5A 1S1XA 4J9QA 3C6TA 3QZ7A 3OHBA 3OVNA 4FJXA 5KT3A 4AHRA 3PW5A 4KHNA 4CF8A 2GC8A 4W5QA 5KTQA 4R8UA 1S0NA 4URGA 4GW6A 3JSMB 1TL3B 1Q9YA 1ZBFA 3RMDA 2AX0A 2P51A 4OJRA 4DL6A 2DTUA 2A1RA 3HK2A 3VQDA 3MF5A 3KHGA 3OY9A 4BWJA 2HNZA 1RBTA 4M3WA 4B9SA 4NCGB 3AVHA 4E0DA 3RAXA 1BI4A 3NE6A 4ELUA 4KKOB 1QSYA 5EWGA 4KV8B 1D9DA 3NDKA 2AWZA 3HJFA 3OLBA 2C2EA 1NK8A 3AO2A 3TWHA 4ZMMA 2WK4A 3C95A 2C2RA 1HPZA 1UWBB 1RT3B 4JRPA 3OYDA 3T5LA 4NLTA 3FFIA 2DY4A 1CXUA 4ELTA 2GV9A 4MK7A 2JEIA 4CCHA 1RYRA 4N47A 3V9UA 2O4GA 2BDPA 3I0SB 4IFVB 4M3XA 1FKPB 3CVKA 3NHGA 2OPRB 4HUEA 4CERA 2FVQA 3T5JA 3SFGA 4I2QB 3QGIA 4DTJA 1NK9A 3KK3A 4J2AA 1IKWB 4CJQA 4FLWA 3MEDA 5KG5A 4DTNA 3CWJA 1C1CB 3Q8SB 3G0ZA 2OPPA 4CFDA 5C25A 4E1NA 3LWLA 1BIUA 3RMBA 1N6QA 5DG7A 3QINA 3DRRB 4R0EA 1HNVB 3PW2A 3NGZA 4KHMA 4IKAA 2BQRA 3TARA 3IRXA 3M8SA 4KSEB 1VSMA 4WXOA 4NLVA 2ZD1A 3MEGA 3MXMA 2XWYA 2YNHA 4MIBA 2KTQA 4KO0A 1TGOA 3TAQA 1WAJA 3C94A 2ZE2A 5F8HA 2RKIA 2V4QA 1ZTTA 4FJJA 5KT5A 3ASMA 3HM9A 5CY4A 2WOMA 3IGVA 2IBKA 2A1SA 3H59A 4DL7A 2G8KA 4H8KA 1DLOA 2D3ZA 4N41A 2YKNB 3VQCA 4KFBB 2IA6A 1SKSA 3ZT2A 2AJQA 1RT7B 2KZZA 1TKDA 4C8KA 2HNDB 1FK9B 4O44B 5KRTA 1ASVA 1RTJA 4EO6A 5HRRA 4RW9A 4NLPA 2KFZA 4MIAA 4DU4A 4H4MA 3CDWA 3SFUA 3SI8A 4DU3A 2W9CB 1JLQA 1NK6A 5KFMA 4CK2A 4DWIA 2YNFB 3HSTB 2J6SA 3MEEA 3TAMA 2IS3A 4FJHA 4PY5A 4IH5A 2KFNA 3M8RA 5DGAA 3BSAA 3MR2A 4PA1A 3CJ0A 2IDOA 1C1BB 1C6VA 3AVCA 1BQNA 4J9NA 4PQUA 3KLIB 3IGNA 4O3OA 3CM6A 5DG8A 1RT2B 3KTQA 3T5HA 2UVVA 3M8PA 1R0AB 3QEVA 4RW6A 4CEBA 3HVWA 3CQ8A 1LAWA 2CJQA 3WNEA 4QW8A 4O4RA 4B9TA 3VQ9A 3CFPA 1JKHB 3O3GA 3KIOA 1HNIA 4CFCA 3RBEA 4E7JA 1NOYA 4G1QA 4ECUA 4FM2A 1TKXB 3H98A 3NGDA 4OKKA 2UVWA 3L2WA 4E7LA 1YVUA 3U3YA 2AGPA 2XY7A 2VG5B 4XPCA 3VQPA 4IRKA 4DSEA 4FW1A 4O0JA 1EXQA 2GBZA 1YVFA 3MR6A 1VSIA 1X9MA 1DTQB 5CYMA 5F8LA 4Q45A 4WYLA 4GC7A 3T5KA 3QGHA 4CJLA 3RWUA 4DQPA 2W9BA 3FDSA 4ECVA 4DTUA 2FVRA 2IJNA 1UAXA 4QPXA 3HPGA 3C6UB 1HMVB 4YR2A 5EU7A 4B9LA 4YR3A 3GV5B 1XHXA 4EZ9A 3Q8RB 4MKAA 1QTMA 5J2QB 3CDEA 3V81B 4ELVA 4O0IA 4XIUA 5KFLA 2HHWA 1RCHA 2YKMB 5I3UB 4FS2A 2IM3A 3DLKA 4ZHRA 3DRSA 1VSLA 1QE1B 4FVMA 3KLEA 2IJFA 3DMJA 4B3OB 1LWFA 2BQUA 1EKEA 4HHTA 1T05B 4YR0A 1VRTB 4H54A 1NHVA 4FJ7A 1IKVA 4J9SA 2ATQA 4IR1A 2ILZA 3OL6A 4FW2A 3RAQA 4OVLA 3DRPB 1GX6A 3OYIA 4ZPAA 4URQU 4IQXA 4Y2CA 4NLQA 1QUVA 1HYSB 4WFXA 2CKWA 3JYTB 3DYAA 1JL2A 4Z4GA 4KREA 1L3TA 4RNHA 1D1UA 2UUTA 4K4WA 2IAJB 1RA7A 3GYNA 1LW2B 1T03A 2B43A 3FSIA 4FJ9A 3RB0A 4FBTA 2VG6B 4CHPA 4DL2A 4OGEA 4IG0A 4K50A 1KLNA 2W8LA 1B9FA 3KHRA 2GIQA 2X74A 1SL2A 5L1KA 4CHNA 3U3GA 4ED6A 3WNGA 4M3TA 3JSMA 1TL3A 4ID1A 4EP4A 1SL0A 4ED3A 4ECTA 4Z4HA 4WZMA 4RUAA 2R2RA 4CGFA 1IG9A 1VK0A 1TVRB 1WSEA 4OKJA 4NCGA 2ITGA 3NH1A 3WNHA 4WE1B 4FZZA 1VSDA 1UA1A 3PJWA 4KKOA 4E7KA 4QAGA 3TANA 4F2SA 4KV8A 1S1VB 4LY7A 3NH0A 2QV6A 4O3SA 1GX5A 1UWBA 1RT3A 4KI6A 3FQLA 1ITGA 2JLEA 4EYIB 3DDKA 4R5PB 3H40A 3OYMA 2QKBA 1VSJA 4BE1A 3OSNA 4M95A 2B6AB 1NJWA 1RDCA 1KLMB 4CHOA 5KRSA 4HUGA 3I0SA 3MECB 2AU0A 4J9KA 4IFVA 5F8IA 1XI1A 1FKPA 3RBDA 5JS1A 2OPRA 1S48A 5I42B 1IH7A 3BGRB 3TI0A 2P1JA 1U49A 4I2QA 3SPZA 4HUFA 4JLHA 1Q8IA 4PWDB 1IKWA 4KHQA 3OL8A 1TKZB 1C1CA 4KB7A 2RN2A 4DL5A 3L3VA 3N6LA 2FVCA 4WFZA 4WFYA 3CFOA 2E6MA 3DRRA 1N56A 1HNVA 4IKFA 4RW8B 2Z1HA 4KAZA 5DLFA 3CG7A 4CHZA 3KD1E 5KFEA 1X9SA 3KHLA 4CGGA 4NLDA 4IRCA 4HCCA 1L3SA 4F3TA 1S6QB 4YQWA 3SCXA 1XR6A 3HKWA 1B92A 4CF9A 2C22A 4L8RB 2WB4A 4F4WA 4F8RA 1LWEB 4RW7B 3LP3A 4CEOA 2V9WA 4QWDA 3THVA 3QGGA 3G10A 2YKNA 2C28A 2OYQA 4KFBA 4EZ6A 4I2PB 1GOAA 4W5TA 1RT7A 2Z1IA 3V9XA 2HNDA 4NLRA 2XGQA 3D28A 1FK9A 4W5OA 4O44A 4KPYA 4FK2A 1TL1B 4N56A 4CJEA 1FXXA 3NMAA 4F4YA 3QO9B 2PY5A 1RBSA 4OKEA 2W9CA 5HRPA 4U6PA 4DEZA 4F2RA 3ISND 3FQKA 1RTHB 1RT5B 5KG4A 3KMSA 2YNFA 1IKYB 5DQGA 4K8ZA 1SKRA 4RZRA 1SUQB 3K5MA 1WSHA 2ZKUA 5KFIA 3TAFA 3ITHB 4DMNA 3RB3A 1C1BA 2E9ZA 3ZSZA 3HO1A 1EETB 3KLIA 3K5LA 2HW3A 1RT2A 4DFMA 1ZBIA 4K4TA 4JRQA 4Z4IA 1R0AA 4CECA 5HLFB 3CJ2A 3AVFA 1D8YA 4C8MA 5K14B 4NLYA 3BQ2A 4JV0A 4CJTA 4K4VA 1CXQA 1BQMB 4DLEA 3V9ZA 3PW7A 4ICLB 5KFFA 3CFRA 1JKHA 1ZBLA 1RYSA 1OS5A 1JLFB 1QSLA 1C0MA 4C8LA 2GIRA 3OHAA 5J1EB 3SZ2A 4NLOA 4Q8EA 4DSFA 5KI6A 1TKXA 2XY6A 3QIPB 3G6VA 1REVB 1ZTWA 3SUNA 2D7SA 2V0NA 4OPJA 3ISNC 3M8QB 2VG5A 1BGXT 3SQ4A 3LANA 3QEPA 3T1AA 5KG7A 1RILA 4AHCA 2XI2A 4KHRA 2YNIB 1L3VA 1Q9XA 1DTQA 4O3PA 1UA0A 3T3FA 4ZPDA 1NJYA 2IM1A 2UVRA 1C0TB 1NK4A 4ED0A 2F8EX 4QWBA 1KCFA 1JXLA 4IBNA 4F4KA 3ICLA 4WYWA 3C6UA 1HMVA 3I0RB 3UR0A 5KT7A 3DOKB 1C1AA 4K4UA 1CLQA 5JUMA 2YV0X 5J2QA 2Y1IA 4FLYA 4IDKB 3V81A 1WAFA 1TAUA 1ZBHA 5KG1A 2YKMA 3MXIA 5I3UA 4TQSA 2JEGA 4JS5A 1TAQA 4FLUA 1QE1A 2R7YA 1TP7A 4CGIA 3SNNA 3B6OA 3MFHA 4CJUA 3DLEB 4B3OA 4Q0BB 1RA6A 3OS2A 1T05A 4EP5A 3MAQA 1VRTA 3OYEA 3QLHB 5KFBA 2RF2B 1SV5B 3DRPA 4EYHB 3UDLA 4Y34A 4M3ZA 3RTVA 4B9UA 1C0UB 5L1JA 5FRMA 4CFAA 4JV1A 3KLHB 5DK5A 5KFTA 2IM2A 2HNYB 4Q8FA 1HYSA 4ZP6A 4LD0A 4FJGA 4HTUA 1SKWA 1RTIB 3JYTA 1C2PA 4DTRA 3SJJA 2D41A 3DOLB 5F9NA 3RRGA 1K1QA 3KJVB 4K8XA 3LP2B 2IAJA 4NLUA 3TAPA 1JLAB 1HQUB 5L1LA 4DTOA 4LH5A 1LW2A 1J9AA 3NF7A 3G86A 4ECXA 2VG6A 2JEFA 3KLFB 2W9AA 2R2SA 1EP4B 3SQ1A 3KK1B 1VSHA 4CEFA 4CK1A 2GUIA 5F8MA 4Q44A 4MKBA 5EUHA 4O3QA 4M45A 1Z25A 3NF8A 4FCYA 1RT4B 4BACA 5DG9A 3BSCA 3OYFA 3OSPA 1SH0A 3RMAA 3H4DA 4IH6A 1VRUB 1U04A 3SUQA 4TQRA 3VA3A 2ATLA 2FVPA 2AX1A 4ZTJA 3AVNA 1TVRA 4DL4A 3VA0A 4WE1A 4DS5A 3ZSQA 3GV8B 2PZSA 3NBPB 2FJWA 3I8DA 3ZSVA 1BCOA 3OS1A 3SQ2A 1S1VA 1VSEA 4I7FB 4OLBA 4GVMA 3HP9A 4ZTFA 4B08A 2EHGA 3GQCA 1ZYQA 2LSNA 4OGCA 4CEZA 4FJ8A 4R5PA 4RNOA 3V1RA 1S1WB 2AQ4A 3SUOA 4MK8A 2D0BA 3F73A 2B6AA 4CJ5A 1KLMA 2DPIA 5D3GB 3MECA 3VQEA 3S3MA 1BISA 3QIDA 4CJVA 4FLVA 2ETJA 4AHUA 5I42A 3BSOA 3BGRA 4DG1B 1XR7A 2Z1JA 2V4RA 4WZQA 4PWDA 3KD5E 3EPGA 4CJSA 4H4OB 3CJ4A 3PW4A 3ZT3A 4J9LA 3AVGA 1TKZA 3PJXA 1DTTB 4RNNA 3E01B 3HXMA 2Z1GA 1B9DA 4IFYB 3EZ5A 3VQ8A 1QS4A 3TR8A 4TY8B 4RW8A 3PHEA 3SV3A 1JLCB 3HT3A 3S3OA 1JXEA 2IGIA 3IS9B 5F8GA 3SYZA 1S6QA 2XI3A 2AGQA 5J2PB 4ED2A 1RT1B 1FKOB 2HHTA 1KHWA 1HQEB 1I39A 1WSFA 3AVLA 4CIEA 2HHVA 3CJ5A 1LWEA 4NLSA 3LALA 4RW7A 3HPOA 4E7HA 3V4IB 1WLJA 3QNNA 2XY5A 3CIZA 3SQ0A 2DFHA 1NNDA 2ALZA 3PVXA 3L8BA 4RUCA 4I2PA 1RDRA 3VQQA 4Y3CA 3HL8A 4CK3A 4MFBB 1BIZA 4ZVHA 1YT3A 4NCBA 4ZVEA 1ZETA 1QHTA 3V6HA 2RDIA 1TL1A 3LPTA 5L1IA 1L5UA 3KKSA 3QO9A 3IAYA 2W7PA 3MFIA 3AO5A 3CYMA 5FRNA 3AA4A 1RTHA 1RT5A 3N6NA 2O4IA 1TK0A 1IKYA 3L2VA 5KFPA 1SUQA 3V9WA 4J9MA 4O5BA 3ITHA 2W42A 1SH3A 2Y1JA 1EETA 3AVMA 1GOBA 2HVIA 2X6SA 3ZSYA 1VSKA 4QOZB 5HLFA 1ASUA 2OA8A 4PUOB 3NFAA 2QXFA 3PR4A 5KT2A 5K14A 1JL1A 3PV8A 4C8NA 4CF1A 1BQMA 1S0OA 4FM0A 4ICLA 1QSSA 5FROA 4CGDA 2HHXA 4B8CA 2G8HA 4ZPBA 3BJYA 1CZBA 1JLFA 3RB6A 1NK7A 1YTUA 1RTDB 4RU9A 3O4NA 4DS4A 5J1EA 1SL1A 3SI6A 1XR5A 4DU1A 4CHQA 5T7BA 4NCAA 3GILA 3H4BA 1XC9A 3QIPA 1REVA 2B5JB 4CJPA 3M8QA 5EWEA 3ZT0A 3VQAA 5KFZA 3DI6B 5KFYA 2YNIA 4FLZA 3KOAA 3SV4A 2HB5A 1I3AA 4ECZA 1U09A 1C0TA 4C8OA 3VQ5A 3L3UA 3HPHA 3LZJA 4KHYA 3I0RA 1KRPA 2WONB 3DOKA 2RDJA 5HBMB 1MMLA 4M41A 3NF9A 4RG8A 2BANB 4IDKA 3NAEA 1BCMA 3G6YA 5CZ1A 1NJXA 5KFOA 4N5SA 3BQ0A 4DQRA 1KFSA 4YMEA 3S3NA 3DLEA 1T94A 2BE2B 3VQ6A 4Q0BA 2G8UA 3H5SA 5KFDA 3DLGB 4K4XA 1RBVA 1IKXB 1JLBB 3L2RA 1JLGB 1WSJA 4QWAA 3AO3A 3GV7B 4O55A 3VQ7A 1A5XA 3OYCA 1D9FA 4CJKA 3QLHA 3TABA 3HVAA 2RF2A 1SV5A 3V9SA 3GIIA 1L3UA 1C0UA 4DSKA 2WTFA 5HROB 3KLHA 4ED1A 5SWMA 4QW9A 1RDDA 2HNYA 3VN5A 1RT6B 4KB0A 3QETA 1RTIA 4DFJA 3DOLA 3AA5X 2IC3B 4Z4CA 3DM2B 4E89A 3KJVA 4W5NA 4LQ9A 4EBEA 4ECSA 5F9LA 3VQ4A 1JLEB 1S10A 2HHUA 3LP2A 3FRZA 2UVUA 5HP1B 5DQHA 4G3IA 4B9MA 5KFVA 1JLAA 1HQUA 2F96A 3RR7A 2D0CA 4ZVGA 4OL8A 4NZ0A 4DFPA 3KLFA 3E51A 2FBVA 2QKKA 1QAIA 1EP4A 1ASWA 1LW0B 3LP0B 3KK1A 2XC9A 3OL9A 1S9EB 4TN2A 2HHSA 2YNGB 4ED8A 4NYNA 5KFAA 4AHSA 3H08A 5KGXA 1RT4A 4ZPCA 1S4FA 4JV2A 3QZ8A 3V6DB 3LDSA 1T8EA 1VRUA 1I6JA 2ILYA 2R8JA 2QE5A 3PZPA 2VA3A 4ECWA 3ALYA 3NAHA 2KQ2A 1S1TB 2FC0A 1XHZA 5KFXA 2F8TA 2G8FA 3NBPA 4O4GB 4MK9A 4U7CA 3QNOA 4J2DA 1JX4A 3LAMA 1N5YB 4WXWA 1S5JA 4I7FA 1A5WA 1S1UB 3I5AA 3DLBA 1NKEA 4F50A 4B9NA 3D5MA 2WHOA 3HHKA 3BREA 3KKRA 1W25A 1S1WA 3V1QA 4ECRA 4EO8A 3ZSOA 4M3YA 2E9RX 1GOCA 3KHHA 2FJVA 5DGBA 2FBXA 1N48A 5D3GA 3OYGA 2XGPA 1RNHA 1W0HA 4XPEA 2B4JA 3QERA 5SZTA 4DQQA 3NH2A 1Y97A 4DG1A 1J53A 3PW0A 3LWMA 5KT6A 4KHWA 2OPQB 3V6JA 4ID5B 4URSA 4FXDA 4AILC 3AVJA 2D3UA 3NGIA 5JS2A 4N76A 4H4OA 1XWLA 2WCXA 1ZBUA 4CJWA 1NHUA 3P1GA 2XCPA 3L2QA 1TQLA 3NAIA 1RDBA 2AGOA 1S9GB 1U4BA 3BDPA 3O3FA 3OYNA 2XRIA 3UPFA 3LP1B 1DTTA 4FS1A 2IMWP 3E01A 1S6PB 4IFYA 5HRSA 1HARA 4FJIA 4TY8A 3K59A 4KRFA 3ZSXA 2JC1A 5J2MB 1JLCA 3H5XA 4LQ3A 3CM5A 3LAKA 3IS9A 5C5JA 2R8HA 3SUPA 1KVBA 4E3SA 4KTWA 5L9XA 2XCAA 4FYDA 4RNFA 3OJSA 4O3RA 1KVAA 2FLLA 2XY8A 5J2PA 2FBYA 1RT1A 3M9MB 1FKOA 1KTQA 1RBRA 1HQEA 2HMIB 2E6LA 3ZSWA 2OPSB 3HVTB 4J9OA 4F4XA 1J5OB 3NCIA 4J2BA 1LWCB 3V4IA 4Z4FA 2BRLA 1RBUA 1NK5A 5CYQB 4DFKA 5C24B 4CF0A 4CIFA 3M9NB 4GC6A 3NL0A 3G6XA 4MFBA 4TLRA 3A2FA 3OYKA 1LAVA 3IG1B 5KG3A 4IG3B 4CF2A 3MR5A 2R8IA 5FDLB 4FJKA 4FLTA 3V1OA 3K58A 4CGJA 4Q43A 2DFEA 3AVIA 4KHUA 4HCBA 1TV6B 3T19A 3H5YA 3KLVA 4M94A 3OYBA 4LSLB 1IM4A 3PR5B 1U48A 1MU2B 4UQGA 3TAGA 4NRUA 4E1MA 4RW4B 4NYFA 1S49A 1TK8A 3MXJA 3O3HA 4AHVA 1TKTB 4LSNB 4KI4A 3P5JA 4PUOA 1N4LA 3BQ1A 4W5RA 4I9QA 4DTXA 2VWJA 5J2NB 4CGHA 2XO7A 5C42B 4CEQA 4DQSA 5KFCA 4CJ3A 3KK2B 3QEWA 2I1RA 4IOBA 3D0PA 2EC0A 3O4QA 4RNMA 1U45A 1RTDA 2O5DA 3ULDA 3NGYA 5KFNA 4DTSA 3KLGB 2VG7B 1JXBA 3BR9A 1VSFA 5KFKA 2BGGA 3OYJA 3H2LA 2J6TA 3OYHA 3S9HA 2B5JA 5KG0A 2PYJA 4NRTA 5T14A 4DL3A 4J2EA 2X6NA 4MH8A 4DTPA 3B6PA 1X1PA 3ZT4A 5JXSA 3IN5A 3F9KA 3DI6A 3DLHA 3OYAA 4BE2A 2J6UA 2I5JB 5HRNA 3QESA 3K5NA 5DQIA 1D5AA 2HVHA 1S1XB 4ZP7A 3C6TB 3AA2A 4KHSA 4KAIA 2WONA 2R8KA 1A5VA 5HBMA 1NK0A 3VQSA 1LV5A 1NKCA 2BANA 3AVKA 4R8UB 2E9TA 1O1WA 1WNSA 4EEYA 4DSLA 3QYYA 1WSGA 2PYLA 5KFRA 3PX6A 5DLGA 5CZ2A 2UUWA 4NLWA 1QQCA 1BHLA 2NUBA 3VQBA 2R8GA 1T3NA 2HNZB 2FBTA 4TXSA 2BE2A 1BI4B 4DSJA 4FZYA 4K4ZA 3DLGA 1HJRA 1IKXA 1JLBA 1JLGA 4DLGA 3Q8PB 3CDUA 2ZQBA 3WNFA 3PY8A 1HPZB 1CZ9A 5HROA 4ZVFA 4KTQA 2WRMA 3FFIB
chains in the Genus database with same CATH superfamily
1RT6A 3FSXA 3I96A 3VGVA 9RUBA 3OBWA 4DZDA 2FJEB 1RAIB 3U6FA 3HLUA 5KFUA 1AYEA 1HI1A 3N9UC 4X4UA 1TL5A 4Y2AA 2J7KA 1SJQA 4FM1A 3ZZYA 4GO5X 3MEDB 2YNGA 3DFEA 1D0EA 2J4RA 5AQIA 3NKYA 2G0CA 2RPIA 4HL9A 1N6QB 1N54B 4ED5A 3HZGA 4AH9A 1NM2A 5LOQA 4ES1A 4UY8T 3MZIA 3V6KA 3QEIA 3PG9A 4ZLJA 4F0HA 4ETXA 2B9EA 3VGTA 5CABA 4CLPA 1WSVA 1VQ7S 2YNHB 4OX9F 4KO0B 3DLRA 2YQ1A 4M3RA 1EQMA 2HFUA 2M88A 2ZE2B 4O4GA 4Y65A 2RKIB 2ZDPA 3GIMA 3DXKB 4JI8F 3MUTP 2X1BA 1CS4B 5JMVA 1N5YA 1WG5A 3EZUA 2RQKA 1FWLA 3OW2M 3U9DA 3OJUA 1NSPA 2RB7A 2OSRA 3QIOA 3PUFA 3UN5A 1XQSC 1YWXA 2VODA 2P5OA 2GX8A 2V67A 1IBKF 2PI5A 2RHKA 4IUFA 1RTJB 1YZ6A 4RW9B 2AYMA 1Y5NB 1RDWX 4H4MB 2A6MA 3MD1A 5DM6L 2OPQA 1SJ1A 3MEEB 3TAMB 3I6PA 1P9YA 4QIVA 4I0WA 4YFUA 3C14A 2B4VA 1Y3JA 3AO4A 2UU9J 4ETZA 5KGWA 1Z26A 3MWPA 3LPUA 4F4ZA 3ZLJA 4ID8A 3LP1A 4JEPA 1S6PA 3KNGA 1LCUA 3AVAA 1TFWA 4E19A 1T9YA 4HVJA 4CEEA 5BRHA 5J2MA 3HHEA 3X3UA 2BACA 4CHYA 1FFSB 4LH4A 1S0MA 2XTJP 1NKBA 1T7PA 2ZOGA 3AV9A 4B8AB 4FJMA 2UXDK 3AVBA 5KG2A 1TUUA 2R7OA 4FJLA 3A5OC 3DGPA 1FTCA 3NGTA 3VF2A 2XO6A 2HMIA 3HVTA 4Q5VA 5ETTA 4GV3A 4CE9A 4F04B 5LL6Z 2YHBA 2G8VA 3E3XA 2BUPA 1R89A 2JGUA 2V4JB 2R2UA 2LVWA 2Q3SA 3R6LB 3TUJC 5KFGA 3IUCA 3ZSRA 3FZLA 2D3O1 2FZKB 2W9BB 4DF4A 4I56A 2BRKA 4AM6A 1BL3A 1X5TA 3GIJA 1FRLA 1UFKA 1O0PA 1RWVB 3NF6A 2DIVA 4CFBA 4C97A 4LF7K 4J9PA 2UUBJ 3IWXA 4LSLA 2XMUA 1UMJA 2FLNA 2EK1A 3DDNA 1NDKA 4F25A 5D4PA 3TVKA 3O4WA 2Y3YA 4RWXA 4ZCMA 1U2CA 1ATRA 2IOCA 2WAQD 2VF3A 4E7IA 4FL9A 4A47A 4AHTA 1IWGA 1ZAWA 4OHWA 1IKVB 4ZOSA 2DBBA 4KBOA 2KL8A 1YKWA 5F8JA 4M42A 3AA8A 2NPFA 4LF9J 2K06A 4GMJB 3BO3A 1VQ6S 4CYUB 1WD6A 1HR0K 3RB4A 1YTYA 1J54A 4M5HA 2J9CA 2FJXA 1T03B 2EX3A 3TUZC 1YRUA 2WSCC 4IG0B 3VZIA 4WIQA 3MR3A 2UYTA 4F67A 3OHBA 1XMOF 3CC7N 1OY8A 4FJXA 4EK2A 4W5QA 4U7UK 2F3JA 5AQXA 3VHQA 4C23A 1ZBFA 3RMDA 2ROGA 2B9WA 4DPYA 3TA0A 1RKIA 2FLOA 3A5NC 3AD8C 2DTUA 2A1RA 3VQDA 2QWRA 1JJCB 4CH7A 5A8RA 5B0GA 2DNLA 4OYPA 1RBTA 3SQOP 4E0DA 5M1FA 5D0GA 4ANEA 4LF1A 3D7EO 3HFVA 4PG8A 2QC3A 1X5OA 2GGPB 3OPKA 1DKGD 2C2EA 2ZC3A 1UVKA 2DNZA 1HPZA 1RT3B 2G4BA 1IBMJ 3R1LA 2F4FA 4ELTA 2OP5A 3RSEB 2CPEA 4ATNA 4MK7A 3LH2S 2E5IA 4N47A 3SK3A 3TVYA 2BDPA 2O8FB 5IFMA 4M5LA 2HG4A 3MCOA 2V8VA 4DDFA 1FKPB 5DETA 4LF8F 4HUEA 3CJTA 4AQYK 3T5JA 2H9ZA 3SFGA 4DTJA 2JVOA 2XBPA 1ZM2A 3B8AX 5IZHA 3MEDA 3WIUA 3O9QA 1MG7A 3WDOA 1BWVA 1SIWB 3Q8SB 3N0VA 4FNHA 1BIUA 1N6QA 3NNAA 1HJOA 2RQCA 3QINA 2WVCA 3DRRB 3NCRA 5FPMA 2A42A 2BV3A 4BRQA 2BQRA 1N33F 2AYEA 1VSMA 3QFHA 5LSRA 2YNHA 4P10A 5ETPA 4LFAF 4KO0A 1TGOA 2VB6A 1WAJA 3C94A 4WFBL 2ZE2A 2RKIA 3DXKA 1F5BA 1ZTTA 1PC5A 1CS4A 4X4OA 1C0GA 1WOQA 2FXUA 4FJJA 2HQDA 1HWKA 3IGVA 2A1SA 3CIMA 2CH5A 2AMCB 3ZT2A 2RIJA 1RGVA 1RT7B 2KZZA 1TKDA 1FK9B 2MTLA 3BO4A 4O44B 1OJ4A 1RTJA 4EO6A 4RW9A 4NLPA 4F3QA 5DDRC 4MIAA 4H4MA 3CJ7A 1BUXA 3SI8A 1D4XA 4DU3A 2W9CB 4DWIA 2E1PA 3MEEA 4C9DA 3TAMA 4PY5A 2XYGB 2A3ZA 3MR2A 1C6VA 2RDDA 3TWZA 3VV2B 3AVCA 4J9NA 6FD1A 5DG8A 3T5HA 4LF4K 4U67Q 1R0AB 2L9NA 4YUDA 2DNGA 1VHXA 3HVWA 5C0YA 2MQNA 4A46A 3TTFA 3SSRA 3QBCA 1NMNA 3E8OA 4IO9Q 4EIAA 4QOTA 5EXWA 2VD3A 2YKAA 3N28A 2MQLA 3RBEA 1M5SA 3PTWA 4K0KJ 1WHYA 2NCKL 3GLJA 4EHTA 1SJRA 1U1KA 1K0TA 1QVFM 2UVWA 3L2WA 2AGPA 3CJRA 2NXNA 4DV4F 1R8PA 4FW1A 1PGZA 2V4JA 3FK4A 1YVFA 1LFWA 4A8MP 4NA3A 1OIAA 4GC7A 4ISEA 2KXHA 2Q43A 2V63A 3RWUA 2W9BA 4YHHK 3J7AP 2IJNA 3UCZP 3C6UB 3GV5B 1U1QA 4EZ9A 2KRBA 3BGOP 1YJUA 4FZVA 2UXCJ 3TJ9A 2XS5A 1R27B 4CO3A 3O9UA 4OHYA 3ULHA 1Q18A 4XIUA 5KFLA 2MZQA 3FVYA 5B7WA 4FS2A 3CCLS 3OVSA 4C3LA 4DV1F 5RUBA 2QI2A 4B02A 4RUBA 5ETSA 2YX1A 5ADXH 3KJNB 4YR0A 1VRTB 4H54A 2MJNA 1IKVA 2ATQA 4IR1A 1IM6A 5E3RA 1V3RA 2JLGA 3RAQA 1GX6A 2QN6B 3CGIA 3BO2A 4URQU 4IQXA 3OBIA 4CDIA 1VBYA 2FHJA 4Z37A 1HYSB 4CYUA 2YI1A 1H2UX 2H3EB 2E88A 2XZWA 1JL2A 4KREA 1UPPA 1D1UA 4M5DB 4CO5A 2C1EB 3QB0A 2D1CA 3SBTA 1T03A 4YDUA 3RB0A 1WACA 4DL2A 3D1HA 4IG0A 1QDUB 1JB0C 2W8LA 1N32J 4PAAA 1VQ9S 1RAFB 3KHRA 2GIQA 2HFOA 2ZH1A 4PKDB 3U3GA 4ED6A 2MQOA 3KHYA 4M3TA 4FPAA 2MGZB 3E9OA 2V34A 1PKUA 4Z4HA 2IVYA 1JNZB 4CD1A 3VVUA 4G1IA 1IG9A 2IPOB 4USJC 1TVRB 4OKJA 2GTDA 2ITGA 5F0XA 3NH1A 4K5SA 3FMWA 3D68A 4TU8A 2CQDA 2CNKB 2GGPA 1HWIA 3R3TA 4K41A 2QL9B 4JAXA 1NBWA 2QV6A 2ZNYA 2Q97A 3FGUA 1RT3A 3WXLA 4JKFA 3FQLA 3O3LA 4R5PB 4RO0A 1ZAXA 5HAOA 3RSEA 3E2EA 1NJWA 4NO7A 5E3CA 3BF1A 2O8FA 2MZRA 4J9KA 5F8IA 1FKPA 1T11A 3TNVA 1NGIA 3RBDA 5JS1A 1S48A 1Y9OA 3PJ9A 3BGRB 2CPHA 1V4TA 2P1JA 3L7UA 5I3PA 1IG8A 1Q8IA 3SMZA 1R8AA 4KHQA 3EN9A 3L3CA 2DT9A 2G2ZA 1NDPA 2ZWPA 2H5IB 1AUDA 2FVCA 1VQSA 3Q8UA 4NZ7A 4X62J 3HD1A 3CFOA 3DRRA 1N56A 2C3MA 4IKFA 1FNOA 4KAZA 1KOHA 3QQCD 4X66K 3T7ZA 3R8EA 2V7ZA 1Q81O 5DRKA 3IAS9 4F3TA 3SCXA 5CD4A 4HVZA 3HOTA 2M0GB 1U1OA 1LWEB 1KVIA 4QWDA 2QYCA 3KUGA 1G4CA 5MAOA 3EXYA 4EZ6A 2ABYA 3PEHA 4B1XB 3A0IX 1GOAA 2MSTA 1RT7A 2XGQA 3D28A 1FK9A 4O44A 2RUGA 2VPYB 4N56A 4CJEA 1N0VC 1FRHA 4IJNA 2W9CA 1HWLA 3GPAA 3TRGA 3ISND 3FQKA 1RT5B 1WEZA 5BXIA 3KMSA 3N4PA 3JTOA 1SUQB 3K5MA 3QRPA 4IO9L 5LMNJ 2XHWA 3RB3A 3LGHA 1EETB 2RMLA 3K5LA 2YBVA 1R6YA 4K4TA 2VKZG 1R0AA 4LVOP 4NLYA 4A59A 1R0BG 4JV0A 2M52A 3TU5A 4DLEA 4ICLB 1XNRJ 5KFFA 3CFRA 5IQQA 2Q1LA 4MDAA 4GVBB 4CLTA 2F1FA 4DCOB 3MM7B 2VYPA 4NA2A 4FP9A 4DSFA 3HHNB 1R8BA 3G6VA 2D7SA 2V0NA 3M8QB 4FSVA 5C2DA 2P9GA 5KG7A 3WZ0A 5BN9A 1L3VA 3POTB 4FWRA 3CHWA 4CH0S 4Y6IA 4GKKF 4DV5J 4F4KA 1BD6A 4NXMF 2ZEJA 4JI6J 3C6UA 5KT7A 1C1AA 2J0QD 3CC2N 1CLQA 1PJ7A 4PG7A 3VTHA 2HHHF 2W24A 2F63A 2VKRA 3G71N 4CP5A 1ZBHA 1NLKL 3EM1A 3UWTA 3BGLA 5KG1A 4GO7X 1TAQA 3VEZA 3DU6A 3R1HA 3CF5Q 2ACMA 3SNNA 3PIPL 4BC5A 2DEJA 3DLEB 1YUWA 1GT8A 3N5FA 3THTA 3MAQA 4DR3F 1VRTA 1TMMA 4IFEA 3QLHB 5A8KB 5F3TA 2AZ1A 3UDLA 2XHCA 4AXJA 1VQKN 4B9UA 2DR7A 2UU9K 5DK5A 1AT1B 4Q8FA 1HYSA 1YIJN 3EE9A 3IR6B 4YB5A 2FGCA 3KWIA 2BBEA 4WFAL 3I4HX 3SJJA 2PIIA 3TZXA 2V2QA 3KJVB 4DR7F 4M5DA 2CVEA 4NLUA 3TAPA 1JLAB 1HQUB 2O3DA 4ILGB 2J7UA 3NF7A 3G86A 5BYQA 1JNRB 2JEFA 3CCMS 2R2SA 1ZOTA 1ITPA 3KK1B 2ZH7A 4EWTA 3K17A 1UW4A 5EUHA 1W2BR 3VGSA 1Q82O 1OMSA 2XWXA 1LK5A 4NA1A 2OTJN 1DHMA 4H0XB 1VGYA 2RD5C 2MGZA 1SH0A 3P6YC 3A8KA 3RMAA 2ZH4A 1VRUB 3KFWX 3NLCA 2ATLA 2FVPA 3VAGA 4OZ0A 2AX1A 3AVNA 1TVRA 2O8EB 4OZ5A 3ATUA 1XN9A 4DS5A 3GV8B 4K2XA 4LFBF 2HZVA 2Q36A 3NBPB 3NS5A 3ZSVA 4LMZA 2W6KA 1U1PA 4OLBA 1VQLN 2NZCA 4FYWB 2UUBK 4ZTFA 1X3NA 3HSDA 4WP3A 4JK9A 1YITN 4C0BA 5AQRA 3J7ZO 4ERDA 2LSNA 7FDRA 4FJ8A 2H5EA 4R5PA 1UP1A 2JWKA 4FWKA 1M5OC 3F73A 3DJCA 1F2HA 2W4DA 1WF0A 2LA4A 3VGKA 1I51B 2RSQA 1B64A 4R0JA 3MMVA 1B3TA 3NCPA 3BGRA 3AB2B 2DPNA 2V4RA 1NJIT 3S1TA 4H4OB 4LF9K 1OY6A 4RL1A 2V9KA 3AVGA 3LDOA 3L95X 3SAHA 4WIIA 2HAFA 5I9EB 3W0LA 5HMYA 3AARA 1B9DA 4IFYB 3VQ8A 4DX6A 3MURP 1TMJA 1GXLA 1CVJA 3N4QA 3MMCB 1F60B 4KRWA 3OVBA 2PT0A 4OHZA 3FE1A 2AJFE 3M4XA 2Y1RI 1M90T 2XEXA 2RRBA 4EMDA 4IO8A 2AGQA 1NSAA 2VFSA 3ZFVA 2VASA 1RT1B 1FKOB 1KHWA 1XUPO 4BRFA 1FF2A 5EY4A 3CJ5A 1LWEA 1PSDA 3QNNA 2ZJQQ 2XY5A 4K59A 3J7YP 1CJKB 5B0DA 2NNWA 4RUCA 2GO8A 4ILMA 1RDRA 3VQQA 2A10A 1Q79A 2FJDB 2Z2MA 2YPYA 1D8ZA 3NGKA 3LPTA 1L5UA 3D66A 3IAYA 3MFIA 4ANDA 5BPNA 1RT5A 2O4IA 4M5JA 3QDKA 1YJNN 1CQMA 4NOHA 5K8OA 2HURA 1SUQA 3ILOA 1IBMK 4DUYJ 2W42A 1FDDA 5AQNA 2Y1JA 1EETA 4JD2B 3OA9A 2FQQB 3BH6B 2CA9A 1B0TA 4PPZA 1X5SA 4PG5A 4C8NA 3ZX0A 2E5GA 3DU5A 4ICLA 1TL7B 1QSSA 2HFNA 2JLFA 1LFPA 3LPYA 1FXLA 1N32F 3ZX3A 1CZBA 3BJYA 3DKDA 3RB6A 4GVBA 5A8WB 3THYB 1YTUA 3MM7A 3CUNA 1LOUA 1C0FA 4PKGA 4UF4A 2YHWA 1W97L 3BGUA 1WSRA 3M8QA 1LEOA 2UUCF 1F2GA 1FE4A 1OH6A 4WTOB 2DGQA 1LK7A 2M8DB 3LDPA 4E1JA 1WI6A 2MPUA 3POTA 2HB5A 4ECZA 1U09A 3M6GA 2Q3PA 3L3UA 3CF5L 3JQKA 1KRPA 1MMLA 1Q5VA 3CJBA 2E1CA 1YJWN 3KZBA 2W2NP 1L3KA 5CZ1A 2YVSA 1NJXA 4CZMA 1W7AA 3R2DJ 2QA4N 2LP4A 3J81O 4DQRA 3ZC4A 4M8LA 4X4PA 3S3NA 1DY3A 3DLEA 5BRDA 3N5BA 4MKYA 3H5SA 3F44A 1IKXB 2HQCA 3ZNJ1 4DV6F 5J1PA 1KN6A 3P96A 3QLHA 3TABA 5A8KA 2OEJA 3V9SA 1FW6A 4X64F 4V19X 2QA1A 4A8FA 1L3UA 3T1HF 4DSKA 4ZITA 4OYZA 4PWUA 4QW9A 1RDDA 2R42A 3G4SN 2HLTA 4OX7A 3QETA 1REGX 1P8GA 5K20B 3CCVS 5IC6B 4KJIA 2MZSA 2IC3B 4ZDNA 5AFUH 4Z4CA 3KJVA 4LQ9A 5F9LA 4FDFA 1JLEB 1PILA 3IP0A 4B9MA 5HP1B 1VK8A 2KB2A 4G3IA 1JWWA 2UUAK 3CXCM 1JLAA 1HQUA 3RR7A 3W3DA 3E51A 3TW0A 2B3TB 1N8RT 1ASWA 1LW0B 3KK1A 4ILJA 1FEHA 2W2QP 2HHPA 4AM7A 4TN2A 4NYNA 4K0KK 1GLFO 2FSKA 2KJWA 2Z0GA 1YJ9S 4W98A 4DV2F 1YHQS 5KGXA 4OHVA 4JK7A 1S4FA 3EGVA 4JI1F 1VRUA 1K73O 3DOMB 2M8HA 1I6JA 1AFIA 5GAHP 3L0QA 2R8JA 3HSJA 4ECWA 2CQGA 2O8EA 2XMTA 5KFXA 2DIUA 4PEOA 4IO1A 4X4TA 3CI5A 2F8TA 8AT1B 3NBPA 2WUSA 2K7KA 1H98A 3UD4P 3LAMA 2UXCK 4Y2KA 1WKLA 1A9NB 1A5WA 1IJJA 1SBRA 4F0KA 1NKEA 3D5MA 2VGMA 3EZWA 2ZHBA 3MWBA 3BREA 3VMFB 4M3YA 3KHHA 3EDRB 4J9UE 1UETA 3CMQA 3MPUB 3SQGB 2IDEA 3LF0A 1ZM4A 3SAGA 3AHPA 2C2MB 1RNHA 2B4JA 1Y0HA 2APOA 3C15B 1J53A 2RHQB 3V6JA 4OI1A 2J7WA 5IOLA 1XC3A 5ETOA 2B51A 1NDLA 3AVJA 4AE5A 5H9FJ 3NGIA 4H4OA 1I94F 2WCXA 4CJWA 4ED4A 2E5LJ 2XCPA 3L2QA 1U4BA 3GJRB 3O3FA 1MSWD 3J7AN 4IFYA 2W40A 1HARA 2W2OP 4FJIA 1O8BA 3NOGA 3MMCA 3B82A 3H5XA 2Q31A 5C5JA 4KTWA 5L9XA 1VQ7N 1JK9B 5JVHQ 4J8FA 4BVPA 1KVAA 5BYSA 1RT1A 2FBYA 1FKOA 2I7NA 3QSIA 4J9OA 1UCNA 1Q0NA 1UZHA 1J5OB 3TA2A 1T02A 2BRLA 5C24B 4YOEA 2DR9A 4CF0A 3JB9k 2ASMA 1CJKA 4WFNL 1X9JA 1SPBP 2J5AA 4GC6A 2P9SB 5JICA 2Z2YB 3NL0A 2V50A 3G6XA 1KEKA 4O8UA 2QMXA 2A0FB 3H7HB 1G99A 4IG3B 3MR5A 5FDLB 2XMJA 3NOCA 3F56A 2DFEA 4HCBA 1TV6B 3SCLE 3OYBA 2PMHA 4DR5F 1U48A 1MU2B 3TAGA 3A8JA 4JD2A 1DGKN 3O2IA 4RW4B 1QQOA 1S49A 3GG0A 4F3MA 3MXJA 5BN8A 3MN9A 4AHVA 4PG6A 3KWGA 3P5JA 3QMQA 2HBLA 1N4LA 3BBFA 3BQ1A 3OTCA 2IBOA 4DTXA 3MCPA 2V51B 2M70A 3B8HA 2V2KA 4CW7B 5IV3A 1JMTA 2XO7A 5C42B 1TL7A 5KFCA 1OY9A 4QIFA 4CJ3A 3KK2B 3QEWA 5IQ6A 1S76D 3TTCA 4IOBA 3D0PA 2EC0A 5KOWA 5A8WA 3THYA 2MHNA 3HHLD 1R8CA 3S6EA 1U6BA 2XULA 4DTSA 2VG7B 3MN5A 2PO4A 2EKYA 3MPVA 3VENA 3BR9A 5KFKA 3MCSA 1C4CA 3PYFA 3OYJA 3IAM9 5KG0A 3DRYA 1X5PA 3KG1A 4NRTA 5T14A 1RISA 2DNNA 2H65B 1FDNA 4IOXA 5AQGA 4X62K 3B6PA 3A8YA 3GBTA 1DEJA 1X1PA 3ZT4A 5JXSA 2DGTA 4XAKA 3VF4A 3OYAA 4QU6A 1FHTA 3PIOQ 1S1XB 2HQ3A 3OV7A 3HULA 3LGNA 5IV4A 1NK0A 4EAHD 1ZXOA 1MNEA 5EGYA 3AVKA 3FBEA 1UVIA 5CAAA 5GAGP 1WNSA 4FYVB 4B17A 1RFQA 5CZ2A 3OTOJ 1QQCA 2QTDA 1GLDG 3VQBA 3NXZA 1HKAA 3THWB 3NGRA 1KAZA 1IKXA 4DLGA 4DCJB 3CDUA 2W2MP 2HRYA 1RSCA 3H42A 4PQAA 5LMNK 3G82B 3FFIB 1T3VA 2ZM6K 3CC7S 1Q7YO 2D5RA 1X4EA 1MWZA 1XJWB 2MXYA 3CIPA 1IO2A 1HNZJ 2IC3A 3TEGA 5AZJB 4TU7A 4IRDA 3WX4A 2CVIA 3SSQA 1NGGA 1JLEA 5HP1A 4FBUA 2QWMA 3IMQJ 1XK8A 4ISGA 2FF3B 3R27A 1XNRK 2JH3A 3K5OA 1VC0A 1UKUA 3R6MA 1JCEA 1Q53A 3B54A 3QAUA 3VF0B 1LW0A 4P7VA 5DMRA 2YPZA 3JS6A 2XQCA 3W9IA 4LREA 1SC6A 1SZ2A 3SEOA 2HZAA 1X9WA 2ROPA 2VV5A 2DPJA 1VMBA 1YF5L 1IBLJ 5GAEP 2WTUA 2W25A 4WYBA 1DFDA 4K25A 2HOEA 2IY5B 2QM1A 3FFKB 2M9KA 3DOMA 4KYZA 3GG1A 3OFEA 2ZD1B 3MEGB 3EKSA 3W7BA 4DV3F 4DN9A 2QJ3A 4DV5K 1BHNA 4WF9Q 2YX6A 4BR0A 1ZBTA 4JI6K 5HMWA 2DCLA 3MTKA 3MN6A 2B4UA 3ZNUA 1NOZA 1WBDA 4YB1P 1SXLA 3B4DA 2POKA 5CR4A 5H9EJ 3DGVA 2X78A 4DV7F 2H4YB 3KUHA 1KSPA 5FLXO 3LO3A 5GINA 3G87A 3PX0A 5FPEA 4TNOA 2FLPA 2CQCA 4CJFA 5HO4A 4QQBA 1EO1A 2LEBA 3U4LA 1MWQA 1OPIA 1WEYA 2WFBA 1J5EK 3SQGA 1W9HA 3LOUA 2R2TA 2FVSA 2E2OA 3C15A 2BQ3A 1HLWA 5KFHA 3HYFA 1WUUA 2GQQA 2JFDA 3D0IE 4NMXA 1HYZA 3VEOA 5ETMA 3CJ1A 2GX9A 3NCQA 3M8PB 3UQSA 3HVRA 1Y11A 4RW6B 2ADCA 4Z94A 1Q86O 4FK4A 2LYVA 1HWUA 3I5CA 4ITSA 1T6CA 5E41A 4WK1A 4KTZA 2P6SA 1V5VA 2VA2A 2RQ4A 1NB2A 4BRPA 3CQXA 1FJGF 1DT9A 4J9RA 4FWSA 1QD1A 3CC4S 1K9MT 1J5OA 3BKTA 1FERA 3TAEA 5KFWA 2GJ2A 3CCUS 3RMCA 3K7RA 2IDLA 5C24A 1XQIA 2YWWA 4EBCA 2BJ7A 4B9VA 4BY9C 4LRBA 1K8AO 2HWTA 2P9SA 2OZMA 4F9OA 4NYZA 1H2VZ 1HX1A 4DSIA 5LT5A 3KMQA 2KT5A 4IG3A 3ELHA 5FDLA 1RTZA 4BG8A 2XHBA 3HKZD 3A8EA 1QJHA 4B3RJ 3QRRA 2UXBF 1TV6A 2XS2A 4CESA 1S4EA 3SMSA 3OYLA 4CZKA 1HFEL 2DXFA 4DUZK 3AJ2A 3BSNA 4K8RA 2I0XA 4RUHA 2JHEA 1MU2A 3G8TA 5BPLA 2BUNA 3DLKB 4DF8A 3MPWA 3DRSB 4RW4A 2LEPA 4DQIA 3MMJA 2KDOA 4LFCF 4OLAA 1RBOB 2WVDA 3S01A 2KKHA 2R3VA 3J7YI 4CRJA 3KLEB 1JIHA 2DFFA 1XNQJ 4TSXA 4YY3F 4JI5J 2RUSA 5C42A 2OAUA 4FJNA 1RAAB 4WTYA 3WXKA 3KK2A 4BE0A 4D3GA 4P6QA 2CNNB 3D45A 1R8HA 3G6ES 3K57A 4H5WA 3ZZPA 1O6XA 4IR9A 2F8SA 1NSQA 2VG7A 3RRHA 1QQMA 4KHPK 3PIOL 1ILYA 1WSIA 2Q0UA 3H5UA 1U47A 2HIYA 3IFRA 3DYAB 2V7YA 1VR6A 2OH2A 4JI4F 2LU2A 5HL7Q 4ILRA 4TYAA 3GONA 2JEJA 4Y1CA 4Z0UA 1SC3B 2V2VA 3CPEA 1K6YA 1UW9A 2DY9A 1U8SA 1YLXA 4K4SA 1WNEA 1CG2A 4IOAQ 4M3UA 1S1XA 1IXKA 3OXFA 3EWGA 1CQNA 4ZS6A 3OVNA 2IIHA 5KT3A 4AHRA 1WDDA 2E1RA 4CF8A 3H3OB 4YOVA 4BC4A 4GW6A 3DXBA 4GKJF 2M5YA 3ENBA 4OYMA 4OJRA 2CWKA 2E1ZA 4YOYA 2G0JA 4L6V3 1KC8O 3AJ1A 1NDCA 2RHSB 3QFPA 3MF5A 3KHGA 4ZJQA 5KPRA 4BWJA 4ZVPB 2MYFA 4B9SA 3THWA 4NCGB 2X51A 2QT7A 3RAXA 3HFZB 1FXRA 2NUUG 3L6QA 4UW2A 3UCGA 4ZIVA 3QMLA 2LKZA 5AQKA 3D6FB 4BRHA 3W64A 3P4IA 4YDXA 1YDLA 5JVGQ 4M7XA 1NK8A 4GVEA 2WK4A 3C95A 2C2RA 3R97A 3OYDA 4PXCA 2FY8A 3G82A 4DUYK 4M5IA 4J9VA 4NLTA 3FFIA 2YX4A 2DITA 5AE1A 2RU9A 5DZ6A 1T9TA 2HSTA 3AT1B 1RYRA 3PYGA 1GFWB 5AZJA 2I38A 2F4VF 1AA1B 3T1YJ 4M3XA 1TFYA 1WHVA 2ZOFA 4CERA 3QGIA 4PKHA 2IVNA 2GQ2A 5ETKA 4I1TA 3ID6A 1IKWB 1HD1A 1S57A 4LC9B 5GADP 3TTDA 2E2QA 2LXUA 4CFDA 3N4WA 4A57A 1Y64A 1M5PC 3RMBA 4X65F 5A2QY 4OI6A 1BY9A 4R0EA 3R7SB 3PW2A 4KHMA 5LMUJ 1U26A 4OJ3A 4WXOA 3HSCA 2ZD1A 4G9ZA 3MEGA 3MXMA 2XWYA 1FT8A 4MIBA 2KTQA 3KYLA 2V4QA 2PC6A 5ETQA 2LQ9A 1FRMA 3ASMA 3W8PA 4IJAA 3PKYA 5CY4A 4DPWA 3GR0A 4M5NA 2WVFA 2G8KA 2D3ZA 4FPBA 3VQCA 4KFBB 2UXDJ 2IA6A 3MI7X 4P72A 2QZ8A 3ENWA 2AJQA 1SQGA 4RBUA 4QBUA 4C8KA 2HNDB 2ZJPL 3D1OA 4A8SA 2RH3A 5GAHI 1KQFB 1GH8A 2H48B 2QFIA 4BC9A 3CDWA 5AQVA 1F3FA 5F3ZA 1NK6A 5KFMA 3Q23A 3C66A 5I4MA 3HSTB 2IS3A 4JI7J 3VF6A 3IM9A 1SQEA 1C1BB 2J76E 4ZPTR 1YGYA 3KLIB 1H2TZ 1RT2B 1H7WA 5LSOA 2UVVA 3M8PA 4KT0C 3D6TB 1Y4ZB 3QEVA 4RW6A 4YOTA 2R7WA 3CQ8A 1CEZA 4LF7J 3FC9A 5GAGU 5G4DA 5DDOC 2DRBA 2DHSA 1UL3A 2AKWB 3AH6A 4O4RA 1UJ5A 4BC7A 3M2UB 4MJKA 3CCJN 4CFCA 1NOYA 3EE3A 3MMBB 4FM2A 4OKKA 3F5TA 1RWPB 3NNHA 3OTOF 1QZ5A 2KVIA 1KQGB 3TR5A 1VSIA 3AODA 3DLLL 1X9MA 4WYLA 3SBGA 3UR3C 4CT9A 5KAKA 4CJLA 2ZC4A 2EI5A 4DQPA 3FDSA 3CJCA 1QVGR 5L38A 2Y0SD 4QIWD 2DR8A 1UAXA 2CQBA 4B9LA 4YR3A 1XHXA 2ITMA 3VCDA 1HKGA 1Q8LA 1K0VA 5F41A 5BR8J 3S8SA 4CLFA 4ELVA 4O0IA 3RW6A 1OQ6A 2HHWA 2YKMB 5G0RB 2F7VA 3I55N 3DLKA 3DRSA 2AJ0A 4MO4A 1QE1B 1S5ZA 4P75A 3AGRA 3KLEA 2IJFA 4B3OB 1WB9A 1PCAA 1EKEA 3OTEA 3MR7A 4J9SA 5HOOA 2CUYA 3QATA 2ILZA 2I2YA 2MMYA 1XERA 3BGFA 5H9FK 3D67A 3HF5A 5B09A 3VEVA 1VC6A 4NLQA 1XMQF 2HRUA 3D2EB 4A2BA 3GIRA 4XDCA 4WFXA 4ZVTB 2QX0A 3F9MA 1Q16B 3DYAA 2EG2A 2XNRA 2OEMA 2Y8YA 1LNQA 1L3TA 3ID8A 4I6MB 2IAJB 3W5YA 4UY85 1YRTA 2GEMA 3TO8A 3VEXA 3BDEA 3VAFA 2R7SA 1KLNA 2NRWA 2XZDB 2ERRA 2X74A 4CHNA 2VQEJ 1YJRA 3RW7A 1FRJA 4YOXA 1HBMB 1VQKS 4EP4A 4DXLA 4ENOA 3U8XA 4ED3A 3V5RA 2XB2D 1YIJS 2A18A 4RUAA 4CGFA 1RI7A 4C1NK 3AAPA 1WSEA 2VGNA 4NCGA 1JJ2M 1DQ9A 4DMZA 3AY0A 4FZZA 2G9OA 1UA1A 1I5OB 2YQ3A 3TANA 3Q0AA 1S1VB 1HW8A 5IWAF 4LY7A 1WC1A 2VUGA 2ZH5A 4OI0A 2VL1A 4JKGB 1PO6A 4I6YA 2GJIA 2DB1A 3A12A 4DCPB 5GAGI 3OYMA 1Q8BA 2CGKA 1SC1B 3IMXA 2HLUA 1W2IA 3FBCA 2B6AB 3CCZA 1KLMB 5KRSA 4Z2XA 3A1YG 2L9WA 4BRGA 4BLGA 1BU6O 2F9JA 2AEFA 4L76A 3OW2R 2E2NA 3CNQP 2D1KA 3P31A 4IEIA 2HGNA 3M2VB 4J7CA 3GB0A 1IKWA 3K5PA 3O6QA 2P5VA 3DXMB 1GLBG 1TKZB 5LY3A 3B6BA 1VQ5N 1YVNA 3L3VA 2RRAA 3N6LA 5AE2A 1ZS6A 4ZN3A 5L39A 4EFHA 5THWA 1YITS 2Z1HA 4F0MA 1WC3A 3PRBA 5DLFA 3CG7A 3ZYYX 1KBRA 3HMJG 5ITHA 2ZGYA 2PE8A 5E0OA 2AP1A 1WC6A 2VC0A 1U6FA 2ZJRL 4B3RF 4DX7A 1GLLO 3HKWA 2C22A 1CC7A 2DNHA 2WB4A 1CPZA 3JAMY 4RW7B 3THVA 2PN6A 3I33A 2OYQA 4KFBA 2KT2A 5GAEI 1G1XA 4BC2A 3VGMA 4I2PB 4W5TA 3P5TL 4PYAA 1HNXF 3M05A 2HNDA 4NLRA 4W5OA 2XLKA 1BXNA 1XNQF 4KPYA 4FK2A 1TL1B 4OMFG 3FZ2A 1FJCA 4JI5F 1FXXA 3K0JA 2PY5A 1NWKA 1X4DA 1SS6A 5TKYA 2GAHC 3IWNC 1MWKA 4ZKAA 1YJ7A 2P9EA 4RZRA 1WSHA 2ZKUA 1C1BA 4FXVA 3HO1A 3ZSZA 3KLIA 2R7QA 2KRRA 2HW3A 1RT2A 4DFMA 1YX2A 4O0NA 1NGAA 4B3SK 1HNZK 4Z4IA 1Y3KA 1D8YA 4H0VB 2FC9A 4CLZA 1FKAF 5K14B 4L3KA 2W41A 4K4VA 4P71A 1BQMB 3PNIA 3V9ZA 3HT0A 3PW7A 4LR8A 1ZBLA 3QRQA 1WF2A 5K5MA 3C8YA 1JLFB 3M2UA 4C8LA 4QR0A 5GVQA 3OHAA 4B3MJ 5J1EB 5F0WA 1WKKA 4DKWA 1ZM3A 3FCVA 3CO0P 4NLOA 3MMBA 2D3OR 3R5AA 5KI6A 2MKKA 1GTHA 1GMVA 2HVZA 2VQFF 2RS2A 3QIPB 1ZTWA 3SUNA 1SI9A 3H0PA 3FZKA 3BKFA 1FNXH 2WSFC 4O3PA 1UA0A 3CMAN 3C2PA 3TQEA 2BH1A 1NJYA 2IM1A 1C0TB 1JXLA 1BWEA 3ICLA 4OPAA 3HZ6A 3I0RB 3UR0A 2DVIA 2BJEA 2DGVA 1F3VA 3OQ2A 1ZPVA 5JUMA 1NU4A 1OVQA 4JYAF 5LJWA 1TAUA 3MXIA 2YKMA 1IUJA 5G0RA 7AT1B 4TQSA 4IQMA 1S59A 1QE1A 2R7YA 2WW8A 3ULEB 2Q79A 3B6OA 2HRTA 4FVCA 5GADU 4B3OA 4PXDA 1RA6A 1N5QA 3OS2A 1VLYA 2EFVA 2A41A 4I4BA 2IVPA 1DQ8A 4M3ZA 1C0UB 4B3TJ 2EBGA 1QY7A 3KLHB 4LUBA 3D2EA 2HNYB 4ZP6A 4LD0A 2HFSA 2HK2A 4HTUA 1DBDA 1RTIB 1C2PA 4ZN1A 4DTRA 3ZTQA 3KJQB 5F9NA 3RRGA 4FN5A 3W62A 1K1QA 4EU0A 4I6MA 2IAJA 1HBUB 2QA4S 4ALZA 4ECXA 3KUEA 2W9AA 3UW1A 3NWRA 4MKBA 3NS7B 2P9IB 1NH8A 5BJRA 1CZAN 3D3CJ 4P52A 2OKQA 2XS7A 1C4AA 4LR9A 1HBMA 4MKVA 3OYFA 2QG9B 2PEHA 3D4JA 1EX8A 2Z57B 3H4DA 5JMNA 4OX8A 4IH6A 4OYIA 1FJEB 4ZVOB 2ZVIA 3WQUA 2K8GA 3CULA 2ZBQA 2N4CA 2QLWA 1GMWA 4DL4A 2MY8A 1RXOB 4ZJOA 4LIRA 4G1PA 4QR2A 4UQTA 7FD1A 2P9CA 4KGVB 1KQSM 3L4QA 3SQ2A 2ATCB 1S1VA 1RABB 1VCTA 3LGMA 2K3KA 4C3KA 4JKGA 4B1ZA 3UNGC 3L9ZA 2HF3A 4B08A 2K7JA 2EHGA 1B4SA 1MA9B 5EX0A 2PA8D 4CEZA 5IT9Y 1S1WB 2AQ4A 4JI1K 2I6WA 2C42A 2E7XA 1JXVA 2B6AA 4NYPA 4C6AA 4LF7F 1KLMA 2J8SA 3GFYA 3K89A 2W1BA 3CCVN 2YWGA 5AQUA 3QIDA 1WTFA 1SAZA 4AHUA 3BSOA 4BRAA 4DG1B 2Z1JA 1LOTB 4XH1A 3AOAA 3AGKA 3M2VA 3KD5E 3EPGA 2R4FA 3H45C 3CJ4A 3DXMA 2XYPB 1TKZA 4A8YA 2HS4A 5LJ3Y 3RGIA 1DTTB 4L75A 5C2CA 1V9OA 3HXMA 1Z05A 4A5AA 3R5CA 1EQYA 3SV3A 2V94A 1JLCB 3A3NB 1HL6A 4M5KA 2Q2RA 1JXEA 1OH7A 2C2ZB 2IGIA 2QW9A 1HR0F 3GJSB 4BR4A 2NYHA 2EWHA 2KYZA 2DRDA 4RJVA 1RUSA 3FZHA 1RADB 1I94K 4DU8A 2GJFA 4RW7A 1WLJA 5AQZA 1N5TA 4YDUC 5GADI 4XH4A 1VQPN 2DFHA 1RHJB 1WORA 1KAXA 4BQLA 4DR2K 4CZIA 2I9SA 4I2PA 4Y3CA 4CK3A 4ZCLA 3HTVA 2VJVA 2FYXA 3SMPA 3VOVA 4W92B 4ZVEA 1ZETA 1QHTA 3Q2SC 2RDIA 1TL1A 2Z2LA 4J37A 3TX8A 4UUXA 3WEEB 4GV6A 5FRNA 1QVFR 4PKIA 3AD9C 1FXDA 2DHXA 2EG1A 1FD2A 5KFPA 4X4NA 2JVRA 3I56N 3UI3A 1OPZA 1FI4A 4O5BA 1M5HA 4YDDB 3VGUA 3I82A 3AXMA 2LU1A 2BMBA 3AVMA 1IR2A 2HVIA 3Q86A 2X6SA 2OA8A 5AZIB 4PUOB 5K14A 3PV8A 2C3PA 3T1YK 2D69A 1J27A 1BQMA 1S0OA 4FM0A 2C2NA 1N36F 2IVOA 2AA4A 3B78A 4B8CA 4ZPBA 5AJ3K 2DEIA 1JLFA 2MHEA 1RTDB 1RHMB 5J1EA 4JKAA 4DU1A 2Z30B 3H4BA 4OQJA 4FWLA 3QIPA 2KI2A 1N34J 1VC5A 1ATSA 4AQYF 1F9HA 5EWEA 3ZT0A 2ZOMA 5LMUK 3L09A 5KFYA 3OUYB 3J80Y 3R5JB 5IS2A 1TTHB 1C0TA 3O1WA 3VQ5A 2E5JA 5BRFA 1SQFA 3JSRA 3LZJA 4KC5A 3I0RA 2NR0A 5HBMB 3ET6B 1KD1T 3NF9A 4PL7A 2BANB 4IYQA 3M2RB 4A62A 1GTEA 3D6RA 3BP8A 1VQNN 1X4GA 1RWNB 4N5SA 3EICA 2GVDB 4OPHA 1X4HA 3MM6B 1TL4A 3ULEA 5A2QU 2NUHA 4JI3K 3Q22A 1KFSA 4YMEA 3TPQA 4IOCQ 2LFVA 1T94A 1Q5YA 2OFHX 5JLFA 2GHVC 1RBVA 5B0AA 1JLGB 4QWAA 3AO3A 4O55A 3VQ7A 4EFAC 1D9FA 1ZPWX 4GNIA 2HBKA 3GIIA 4JI7K 3DHWC 1P6TA 3CD7A 4PABA 1C0UA 2OHDA 4DUTA 3KLHA 3WHIA 4ED1A 5SWMA 2HNYA 3I4PA 4M63A 4KB0A 2PBDA 2CG4A 2O01C 1RTIA 2A2CA 3AA5X 3DM2B 4QPTA 1WWHA 1JQGA 4DV0K 2O8BB 1PJ5A 3FRZA 5FJ4A 2UVUA 5KFVA 1HBUA 1T95A 3QT6A 2KXFA 4LF4F 2N7YA 1QAIA 3GDQA 4NWBA 3LP0B 1S9EB 4DR1J 4ED8A 1TR0A 3P3DA 3H08A 2P9IA 3NGUA 1RWUA 3O9TA 3Q7CA 5F1XA 1CBKA 3P38A 4GV9A 1PAUB 5M2PA 2CPIA 2IHR1 3QZ8A 3V6DB 1T8EA 3LDSA 1RAGB 2BJ9A 2Z2ZA 4USVA 2RJZA 3ZZZA 2QE5A 1EARA 4ZLNA 3UDCA 1S0VA 4GY2B 3NAHA 2KQ2A 4BS2A 1S1TB 5M2UA 2VU5A 2J9DA 5B8HA 1NMEB 2ZZNA 3RUBL 2G8FA 4MK9A 3QNOA 1NRKA 4USTA 5BR8K 1FWKA 2HBMA 1RCXB 3TX0A 2FPHX 2OUGA 3DLBA 2HFVA 4YHHF 4B9NA 4LF6J 2AJ4A 1DJ0A 4KR0B 3KKRA 1S1WA 1OH8A 3ZSOA 4JI2J 2E9RX 6FDRA 2FBXA 4CI6A 1VHIA 4H5NA 1CJTB 4FWNA 3CCTA 4H0YB 3OYGA 1VDHA 2XGPA 3C6AA 4ANCA 1QAXA 1X4FA 2MDAA 3MAHA 1Y5LB 3W63A 1Y97A 4DG1A 3PW0A 3E1YA 3NEKA 4ID5B 3OXGA 4URSA 3UNYA 4AILC 1AXQA 3OVAA 5JS2A 1RB0A 1H74A 1XWLA 4ZA1A 5A76A 1NHUA 1TQLA 3BPDA 3NAIA 1MDUB 4J5OA 1RWOB 3NGSA 3OYNA 1DTTA 2MLXA 1MN9A 2ZUGA 5DDPC 1KTVA 3K59A 2DGSA 2JC1A 1JLCA 3MXHP 4ILHA 3CM5A 2N4DA 2R7RA 2R8HA 2A3JA 4E3SA 1URNA 2RE2A 3PRDA 4FYDA 3ZZ0A 4B1UB 2V69A 5HN0A 1KTQA 1RBRA 2G0IA 1VISA 1LXNA 3ZSWA 3CPWM 2VQEK 1VOMA 4Y2IA 4J2BA 3C46A 2VFUA 1LWCB 1APSA 4Z4FA 3FCWA 4JKBA 3BZCA 2WBRA 2MZ1A 4JV5J 4B1WB 4CIFA 3M9NB 3EXCX 2ZH6A 4H0PA 3QPIA 4TLRA 1YXQA 3A2FA 1LAVA 3W5ZA 1RBAA 1U8WA 2NXCA 2R8IA 2ZH8A 3WEEA 5KOXA 4FLTA 3FZMA 1KVJA 3AVIA 3JXUA 3KDNA 4QYRA 1IM4A 1XIQA 3DRXA 3HJVA 4C0OC 5B08A 4NRUA 3VZHA 1PC4A 2MQMA 4WQ4A 4AD6A 2M2BA 5AZIA 1WC0A 4PUOA 1WOOA 3UKUB 1TZ0A 4I9QA 3QGPA 2M7SA 4KQZA 2F9TA 1WJ9A 2FHMA 4YS2A 1DRZA 3IKMA 3WQTA 2YXLA 3C19A 5CYJA 1U45A 1RTDA 3NGYA 3VQTA 1JXBA 4DR4J 1VSFA 3BR8A 1OSDA 1SJ3P 2BGGA 2J6TA 3S9HA 4U7BA 3CC4N 1HA1A 4J2EA 4MH8A 3CCUN 2H51B 3SCJE 4LBHA 4Q2MA 3OUYA 2CNOB 1NPKA 4X4RA 2J6UA 3R9PA 2HK3A 2FZCB 3K5NA 3U02A 5DQIA 2HVHA 3C6TB 4KH1B 3AA2A 5HBMA 2QLFB 3ET6A 3WXMB 1LV5A 1EHWA 1NKCA 4RR5A 2BANA 2DJWA 4X66F 3M32B 2UUAJ 4R8UB 2E9TA 3IWLA 1O1WA 3LQVA 3M2RA 3QYYA 2PYLA 2KVQE 2ZH9A 5ETRA 5DLGA 4KGXB 4Y0WA 2V8GA 2GVDA 2X3DA 4NLWA 2KHDA 2ZBIA 3MM6A 1BHLA 2NUBA 3DNCA 3VPZA 1KAYA 4XTTA 1QHAA 5C7PA 3MX5A 2FBTA 1BI4B 4FZYA 4K4ZA 5CXTA 1HJRA 2CPZA 1JLGA 3ZTRA 2IYIA 2ZQBA 2AHOB 3H2UB 5AQPA 1R0CB 1FRKA 5JLHA 1ZBSA 4TVAB 2OIHA 4Y00A 4ZVFA 1DARA 2WRMA 1HI0P 3JAMU 3G6EN 2AP6A 3PCOB 2ASLA 1YG0A 4KB1A 4ED7A 3UE2A 4I64A 5HQ8A 4F36A 3CJ3A 3DM2A 1U0HB 4ZK7M 2GFFA 2O8BA 1QAJA 2JSXA 2QK9A 1H3DA 1URRA 3CCSS 3H2VE 3AA3A 1U7LA 5ETVA 4DR6K 2JC0A 1S9FA 3KK3B 2BE9B 5U47A 5H1SQ 4ECQA 2HQGA 3LP0A 2EFOA 1S9EA 4B3MK 1E3MA 4BWMA 4KBIA 3UN2A 1Z2LA 2KG0A 2AEJA 3C3LA 1FX4A 2OPPB 4CJ4A 4OX9J 4NLGA 4H03B 2QWPA 2ROEA 3LM9A 3R2CJ 4USKA 3V6DA 2YJEA 4JI8J 3Q8QB 4YNQA 1X7VA 3ADAC 3ZT1A 5KFQA 3QBXA 4E8UA 4CEDA 1S1TA 4YP3A 2JRSA 4HWIA 2RE1A 3AOCA 1AZSB 3PO5A 2RT3A 2F5GA 2KFYA 4CLLA 4ZP8A 1OQ3A 4FJ5A 1IBKJ 4CJRA 4WJBA 1Y00A 2DTJA 1DLOB 3G9CA 3P45B 2WB1D 3FZBA 3HSZA 2JOQA 3CCWA 2G8IA 4M5MA 4BDPA 4ZCIA 1CJTA 4FK0A 1WN7A 1S97A 2E44A 1Z4UA 2QO3A 3W9JA 2GVZB 1FD8A 2C2DA 4QWCA 4Y1DA 3EZOA 2CQ2A 2MQPA 3LZIA 3UIQA 4ID5A 1TK5A 1QLNA 3A4TA 1ATNA 1TUYA 4B3TK 2OMOA 5D4NA 1RKJA 1NNEA 2GS8A 1XEZA 3EGWB 4U8YA 3QSYB 5AQLA 4L3NA 1Y5IB 2V8HA 1BQXA 1SJFA 4F3OA 2FDNA 1VQMS 2EVZA 1RDAA 2IM0A 1NPPA 1V6HA 2KW4A 4ZP9A 1G3OA 2UU9F 4E2FB 2HBRB 1WI8A 5E26A 2FGOA 3OLAA 4FF2A 3LM2A 3RYLA 1NGEA 4A5BA 4MIWA 2X1AA 5E3PA 3QEXA 4CLWA 3OS0A 4WCEQ 4QCLA 3M9OB 2HHQA 2V5HG 4IH7A 4G1QB 2HWIA 1Z2ZA 1WC5A 2GZOA 2CXEA 2ASYA 3TQ1A 1LWCA 5KFJA 4KY3A 2E8AA 2E1AA 2ZH2A 5C12A 2QWQA 3U9ZA 1BO5O 4ZVRB 1B99A 2G8WA 3PO4A 2G1DA 3SPYA 2ZBCA 3QT5A 2E20A 1MMNA 5CYMB 3NP5A 4MQ3A 2BOPA 4C0HA 2W6LA 2P6TA 1KHVA 2U2FA 1V3ZA 1H0HB 1I3OB 5F8NA 4JUZA 5D78A 5EHHA 4JI0K 2GHWA 2ZKTA 3Q83A 3DHXA 2BJ8A 4BDZA 3BN7A 4RLEA 3CCJS 4C48A 2B56A 2R7UA 1RWXB 1W26A 3AXKA 3K2PA 2H5JB 3TJ8A 5HVGA 3NY0A 4K43A 3DC2A 3UKUA 2UUBF 1LWFB 4DHVA 4FLXA 1ZZFA 4QYZJ 5HJYA 1NJZA 4BRCA 1WELA 2MLZA 4A8KA 2IJRA 1SH2A 4M7YA 2HWHA 3ONQA 3ENAA 1UOCA 2OFGX 2IRYA 1U1LA 4U67L 5D4OA 3GJTB 4RTFD 5CD4H 3OL7A 5HANA 5IT9U 3H20A 4RX6A 2OZSA 1VQYA 1XMOJ 4UY8O 4LF9F 3I55S 4D3HA 4QS8A 4PXBA 4OV6A 4WQ5A 5KT4A 2ZM6J 5DDQC 2NRHA 1YTAA 1TYQB 2UV8G 3BUZB 3D6HB 4J9QA 3C6TA 4LF5K 4NX9A 4KPCA 3FNNA 1ZC6A 2CIMA 4UOGA 4KHNA 1VFJA 3M32A 4R8UA 3Q8VA 1I1GA 4URGA 1TL3B 1Q9YA 1CLFA 3CXCR 2P51A 3JTPA 3CCEN 3F0NA 4AFFA 4A8QA 4X4VA 3D2WA 3OY9A 3CMEN 2KM8B 3AVHA 1BI4A 1NGCA 1GXUA 2AJ1A 5I3QA 5EWGA 4KV8B 1JCFA 1D9DA 2V6AA 3HJFA 3OLBA 1EIYB 3TWHA 4ZMMA 3ENOA 2K2PA 1UWBB 3W1YC 2BW7A 1RLDA 3T5LA 3AAQA 2CG8A 4I6AA 1WUAA 1CXUA 4LF8J 3EE8A 2GV9A 2NZTA 2XZTB 4CCHA 1U0HA 3V9UA 2O4GA 1K47A 3I0SB 3FKBA 1IWAA 1IBMF 4IFVB 1PYTA 1RLCL 3HHDA 2FVQA 3G25A 4I2QB 3M6WA 3GCXP 3KK3A 3I9ZA 2HQFA 4J2AA 1QZ6A 1RK8A 3CJ9A 5IWAK 4CJQA 4DPTA 2GW8A 2LQBA 4HDHA 3H3NO 4FLWA 5AR0A 1N33J 5KG5A 1J5EJ 3TYTA 4DTNA 3FUYA 1C1CB 2VFVA 1VJQA 3G0ZA 2OPPA 3T9NA 5EN1A 4LFAJ 1N34K 2JL9A 1YRXA 4PWWA 3EVWA 4S0MA 1UJ6A 1WF1A 1FDAA 3EVMA 4IKAA 3TARA 3M8SA 4JKHA 1K44A 4L72B 3QT7A 1NH7A 1JJHA 5BYRA 3TAQA 3GU0A 3NS6A 3CJKB 1M5VC 1AZSA 4HTJA 2XSJB 5F8HA 1U0SA 2CZ9A 5MLCQ 4P2SA 2AYGA 5T7LB 3B4MA 2IBKA 1FFGB 3H59A 4DL7A 4DPXA 4H8KA 1DLOA 3Q7BA 2YKNB 1SKSA 1Q78A 5TKWA 4CO4A 4A2AA 2Q6CA 1VQ5S 1N5SA 1GNKA 1ASVA 3W60A 3IBWA 3J80U 5AXKA 2GVZA 4DU4A 3SFUA 1S3XA 2R7XA 2CGLA 3HFKA 2QWLA 2J6SA 4FJHA 2D4WA 3BV8A 5DGAA 3CD6N 3CJ0A 2IDOA 1LKZA 2QTWA 2GCFA 3IGNA 4OI3A 3CM6A 3KTQA 1BG3A 3OBYA 2XM3A 2VBZA 4NLBA 3D0HE 1NG9A 1M5KC 4CEBA 5M2RA 4WP8A 1LAWA 2O67A 4CO0A 2CJQA 1VIXA 4BR9A 4DUZJ 4E98A 1NB7A 4QW8A 1GLEG 1MLAA 4B9TA 3LW5C 3CFPA 5HMXA 3A5MC 4NXNK 1UEUA 5M1KA 3T9ZA 2NSBA 4LSZB 2NRRA 3KIOA 3WIVA 4DR1K 4E7JA 2CYYA 4G1QA 2UUAF 1TKXB 3H98A 3NGDA 4E7LA 1YK9A 3QFWA 3U3YA 2VICA 3O1BA 3Q89A 4DSEA 4LRCA 5KPTA 3MR6A 2HBYB 4K0KF 5CYMA 5F8LA 4Q45A 2QYGA 3T5KA 3QGHA 2RRNA 1FRXA 3QICA 4G6VB 3ZEUB 1Z1ZA 1W7WA 4KHPJ 2G2OA 4DTUA 1Q81T 2D74B 1Z6RA 5HK4A 1X60A 3MUVP 4QPXA 2ZHOA 1HMVB 4YR2A 4DV1J 5EU7A 4I67A 1RDUA 4MKAA 1QTMA 3UDEA 5J2QB 3CDEA 3CSKA 2BJDA 2OJ3A 4LIWA 1JCGA 1RCHA 2VQFK 1VQ8N 5GMKa 5D6GA 2IM3A 4LF6K 3CEDA 4OZ1A 2F9WA 4JI2K 4AF1A 2OTLN 4FVMA 4UZBA 2DGWA 2UXCF 2PGCA 1SJ4P 5M1NA 1LWFA 2BQUA 4HHTA 5AQMA 2L3MA 2QIFA 1PYOB 3OL6A 1GLCG 3CMAS 4OVLA 4LRAA 2CNLB 3O8WA 2KT3A 4JYAK 4Y2CA 2FUG9 1BA0A 3W5XA 3M1VB 4EHUA 1T9UA 1QQNA 2CKWA 5LXRA 4CD3A 2BJ3A 4JB8B 4Z4GA 2OD6A 3GL1A 1KVKA 1SIZA 4RNHA 3EL2A 2UUTA 4K4WA 1RA7A 4OO1J 3GYNA 4U8VA 1LW2B 4A8WA 4FJ9A 3PACA 3QWPA 2VG6B 3AA9A 4K50A 1XTZA 2GMJA 3WQPA 1TYQA 1HNWK 3UB5A 2GMHA 1X31C 1VQOS 2IRXA 1SL2A 4WFBQ 3WNGA 1RE1B 2BABA 3BZKA 2ZVSA 1G6BA 5HSPA 1TL3A 2ZBPA 4ID1A 3M6UA 2NLXA 5E2QA 1PBAA 1SL0A 2PI4A 4JV5K 3A5LC 1T3OA 3IBCB 2R2RA 3GG4A 1R59O 2BJ1A 1VK0A 4RPFA 4KH4A 3WNHA 4WE1B 4DQ8A 1VSDA 3L4IA 4E7KA 2VBYA 4F2SA 4KV8A 4UZCA 4O3SA 1UWBA 1S6UA 2HSEB 1NGBA 5AQSA 4KI6A 4ZLLA 2JLEA 4JNEA 4BR2A 4EYIB 3DDKA 2N3OA 2CJYB 3VETA 5IT0A 1VSJA 4BE1A 2Q6BA 3OSNA 2VFRA 1GLAG 3MGJA 1QM9A 3SIPB 3SBMA 4HUGA 3I0SA 4IFVA 1XI1A 2ADBA 1DURA 1IH7A 3TI0A 1NGFA 4I2QA 4Z7YA 3SPZA 4JLHA 4PWDB 3O44A 3TOQA 4OLOA 1C1CA 3KDOA 2RN2A 4DR4K 2JNJA 4DL5A 4ES2A 3BKUA 1NUEA 2IIRA 1H38A 1T6DA 3BPSP 1B7FA 2AEMA 1Q95G 4EI2A 2AJ2A 1HHSA 4C8YA 2J0WA 4CHZA 1H72C 3KHLA 2MKHA 5AQJA 4CGGA 1NLVA 4FKXA 1L3SA 3KG4A 3CJKA 4X62F 4YQWA 2XSJA 1R43A 3HHLB 1XR6A 5K8NA 2Z8QA 1WTBA 1RWMB 3M1FA 2KLAA 4CF9A 4L8RB 5T7LA 4F8RA 2YWEA 4P2FA 1Q82T 3A3PB 4CEOA 3QGGA 1IJFB 2HIQA 4HACB 2DR6A 2YKNA 2ASPA 1M0SA 4YEAA 2ZFHA 1NXIA 1E4GT 2HBJA 2Z1IA 5B0BA 2O66A 2HFZA 4P74A 4GMKA 1RQ0A 2NS1B 3NMAA 2QA2A 4F4YA 3QO9B 1RBSA 4F2RA 4U6PA 5HRPA 5KG4A 4PRFA 1IKYB 1SKRA 3ITHB 4DMNA 2DH7A 2HYIB 2E9ZA 4C1NI 2DXEA 5M1PA 3J7ZT 3F2KA 2DHGA 1ZBIA 2A6AA 1P1TA 3U1MA 4CECA 5HLFB 2E7WA 3DAWA 3CJ2A 3IC1A 3MX2A 4OJGA 2HGMA 1VQPS 4C7QA 4OJ1A 5LMNF 4CJTA 1OH5A 3TUPA 1CXQA 4DJBA 2CQIA 2ZM6F 2IRUA 1CJVB 2BM1A 4DU7A 1RYSA 1OS5A 3C65A 4DHYA 3T41A 4MLHA 2CPYA 3J7A1 4X4QA 4Q8EA 1TKXA 4H4KC 5E3AA 3CCQS 3FSYA 2XY6A 1XNRF 1REVB 4GKKJ 3U7JA 3DDIA 4OX9K 3I56S 4OPJA 4NXMJ 1P8ZA 1BGXT 3QEPA 4JI8K 1ICEB 2OMLA 1N88A 2DKOB 4J91A 1RILA 5SUHA 1Q9XA 2HHHJ 5IC4B 4HHHA 2H54B 2BEFA 4ZPDA 3BEXA 4DPUA 3ZEUA 2UVRA 1NK4A 4ED0A 1N36K 2F8EX 4QWBA 4IBNA 2CJ9A 3UVJB 1HMVA 2CQ1A 3K8WA 1IBKK 2ZBRA 1WOSA 3TA1A 2YV0X 2ZJQL 3W2VB 2AYBA 5J2QA 4FLYA 4DCHA 1X8DA 4DR3J 3KXDA 5B0CA 4DV5F 2JEGA 4JS5A 4JI6F 4FLUA 1CULB 2DO4A 1EJ7L 3P4UB 1OWXA 1TP7A 4CGIA 3PFEA 3LL3A 3M7VA 3MFHA 4HH0A 1FO1A 3IA0A 1BC6A 3CCRN 4Q0BB 4GVLA 4Y28C 2NYIA 1VBZA 1AUSL 3OYEA 2Z56B 4DPOA 5KFBA 2RF2B 1NSKL 4EYHB 2VCPA 3RTVA 3KVGA 4DR7J 5L1JA 4CFAA 1J5EF 4JV1A 2L9DA 4C98A 4FJGA 3M1VA 2ZDOA 1SKWA 2ASOA 2P8IA 1NBEB 2D41A 3GZ7A 2JZ5A 2J9DE 1VQNS 2KHCA