4PQUA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
total genus 146
structure length 545
sequence length 545
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pquA05
4WYLA 2HHVA 1BQNA 3LZJA 1S0MA 1XC9A 2I1RA 5I42A 4ECXA 4KB7A 3QZ8A 3AVHA 2RF2B 3MEDB 3L3VA 4RW9A 2D7SA 4ZHRA 2D3ZA 4FS2A 1VRUA 3OLAA 3TR8A 4B8CA 2IMWP 3V9WA 3WNEA 1C1BB 4H4OA 4G3IA 3ALYA 3SQ4A 5KFTA 1HMVA 4DFKA 4RW8A 5L9XA 3I5BA 4DSEA 3SYZA 1TGOA 3KHGA 4B9LA 2BR0A 1JXEA 1B9FA 2IBKA 2ASDA 1Z26A 2ZD1B 4FLVA 1JL2A 3CO9A 4RG8A 4K8XA 2G8FA 3LPTA 3CDUA 3AA3A 1VSIA 3V81B 3RRHA 2BE2B 1S5JA 3BSCA 2IM2A 4E19A 2D3UA 4DL5A 4KI6A 4QPXA 3MECB 1I3AA 3P5JA 4HUFA 4B9TA 3HO1A 2JEJA 4Q45A 1NK9A 2B5JA 3VQQA 4B9SA 3PV8A 3C6TA 3K5OA 4ICLB 1KLMA 1JLCB 3MFIA 4LSLA 3KLFB 3KK2A 1VRTA 3BGRA 1KVAA 3KK3B 1BL3A 1GX6A 3KLVA 1TL1A 1TKDA 2W9CB 4RW6B 5KT4A 1NOZA 1RT1B 1WSEA 1LW2A 2W7PA 3PO4A 3UDLA 4LQ3A 3I0RB 3SFGA 1RT6B 1KTQA 3NBPA 4KB1A 4R5PA 3OYKA 3QLHB 1Q9XA 5J2PB 1RDBA 1YTAA 2BDPA 1RT2A 4E7LA 1JLEA 1S0OA 3FSIA 3RTVA 3CJ5A 3C95A 4CJUA 4F2SA 3MXIA 2R2RA 3SJJA 1N6QA 2DY4A 1ASWA 2E4LA 1Q9YA 2HNDB 3V9ZA 1LAWA 1MU2A 1ZBLA 2B4JA 2O4IA 1U04A 3ZSZA 5K14A 4B3OB 4WXOA 3G10A 3T5LA 2R8GA 4O3PA 4OLAA 2QE5A 5KT2A 5HROA 4LD0A 1ZBUA 2FJXA 4CJSA 3LP3A 3ZSVA 2DTUA 1HNVB 5T7BA 4IFVA 2R8HA 1EP4A 2WOMA 3NDKA 1IH7A 3DLGB 3KLGA 1XR7A 3E51A 3OYJA 3RR8A 4PWDB 2IJFA 5C25A 5CYQB 4FLUA 3SUOA 4YP3A 1TV6B 1RTHA 4DQPA 2X6SA 1RT4A 3LP1A 2BANA 1CSJA 2HNZA 1G15A 2FVCA 4M3XA 1JLBB 3IAYA 3OJUA 4LH4A 4ED2A 4CF8A 1NKEA 1C2PA 4IG3A 2QV6A 3KKRA 2F8TA 2YKNA 2G8UA 4C8NA 2AU0A 1KVCA 1J5OA 4AHRA 2Y1JA 4F8RA 1S49A 3DM2A 4FK2A 1NHVA 3BSNA 1JKHB 2J6UA 3PW5A 1N56A 4KE5A 3IN5A 3Q8RB 1TVRA 3S9HA 1RILA 1ASUA 2WONB 3QIPA 5F8NA 1BQMB 4R0EA 4F3OA 1U4BA 3GIKA 4UQGA 1C6VA 3RAQA 4RW7B 1L3UA 1S9EB 1JLAA 4MFBA 1X1PA 4K4YA 3KHHA 2PYJA 4QOZB 4CIEA 2UUWA 1L3VA 3AA2A 4CEFA 2GIRA 3KHRA 4CK1A 4IG0B 4C8MA 2HMIB 3VQEA 1I6JA 1VSHA 3E01A 3HVRA 1QHTA 4CJWA 3OSNA 4CHQA 3TAMA 3KK1A 3KNAA 4DFMA 3IRXA 1RTIA 4FLZA 3PW4A 3NF9A 3WNHA 3AV9A 5F8MA 4KI4A 1ITGA 4DTSA 1RDDA 4RW4B 2G8KA 1K1SA 1RTJB 2JEFA 2IC3B 4M42A 2WTFA 4DLEA 4DL4A 4CJ4A 2IGIA 5J2NB 3OYDA 1JXLA 1JLGB 3RMCA 3V6DA 4NYNA 4CJKA 4ECWA 1UA1A 4OJRA 1REVB 5HP1B 2RKIA 4KFBB 4HYKA 4B9NA 4RNNA 1RT3A 3HVAA 3AO1A 4PY5A 3BQ2A 2BGGA 1YVUA 1VSJA 4H4MB 5EWEA 4B9MA 1ZBIA 1S1UB 3HPHA 3QERA 5T14A 3VA3A 1S97A 4JS4A 1DLOB 1WAJA 2E9ZA 3LP2B 4DTPA 3PO5A 3D5MA 1BIUA 1X9SA 2RN2A 4FJXA 1QAIA 1C1BA 3D45A 1WN7A 3HVTA 2RPIA 4YFUA 3NGZA 4IRDA 4Q43A 1SV5B 4CIGA 3NGIA 4K4SA 4QWAA 3VN5A 5DGAA 5DG9A 1D5AA 1HYSB 4M3ZA 3DLKB 4NLGA 1FKPB 4ZPBA 3QEXA 3OS1A 3V81A 2XC9A 3SUPA 3DRSA 3HHKA 5SWMA 2BE2A 4CHYA 5KFLA 1SH0A 1VSLA 4Q0BA 4CGGA 4IBNA 5J1EB 2ATLA 3H08A 5KFGA 4DS5A 4EZ6A 4ICLA 4ZVFA 4FJJA 3O3HA 5KFHA 3QINA 3ZT4A 3KK3A 5DLFA 3CQ8A 1XHXA 3L3UA 3PY8A 1HPZA 3M9OB 1TAQA 1RDRA 3AVMA 2W9CA 1VSMA 4RW6A 4KRFA 1UWBB 4QWDA 3NCIA 3TAPA 1RT1A 3KLHA 3QYYA 2PY5A 4RNHA 1TK8A 1GOBA 3QLHA 4I7FB 5J2PA 3EPGA 4RNFA 4DSFA 4KHMA 4FJ9A 3Q8SB 2KQ2A 3FFIA 1RBSA 3VQBA 1CZBA 3AVIA 3OJSA 2ALZA 4IFYB 3TAFA 4ZVEA 4N41A 4IRKA 2FC0A 1SKSA 4DSLA 5FDLB 2JC0A 4ELUA 4CF1A 2QXFA 2FBYA 1S1XA 5KFAA 5JUMA 3ZSRA 3HJFA 3AVFA 4KBIA 4OPJA 1IKYB 4QW9A 3NGDA 3S3MA 2RDJA 4M45A 1C0UB 1KLNA 4K4UA 4F4YA 3RRGA 3NKYA 3AO3A 4K4XA 3AVKA 3SUQA 1HNVA 2G8HA 5C5JA 3DLGA 4YR0A 2W8LA 5CYQA 2LSNA 4O55A 4BWJA 4J2AA 1TV6A 2AWZA 2IM3A 3LAMA 1WSJA 1KHWA 2C2DA 3QEVA 1JLBA 1TKTB 4PQUA 1Z4UA 1DTTB 4O44A 4N5SA 1DTQB 3C94A 3THVA 3BDPA 3VQDA 2GUIA 5KFQA 4ECQA 5HRRA 1XHZA 5KFOA 4M3UA 5KG5A 4EBCA 4FK4A 1S1VB 3GIIA 4H8KA 1D9FA 1ZTWA 4HKQA 4J9QA 4CE9A 2R2TA 2V0NA 2A1RA 4FS1A 3KHLA 2XI2A 3BQ1A 3LWMA 1ZBFA 5DQHA 3V4IB 2AGOA 4PA1A 4CHZA 3RBEA 3MEEB 4JV0A 4EP5A 3T5HA 1RT5A 1LWFB 1S1TB 1BQMA 5L1KA 3U3YA 4B08A 4CJVA 4OVLA 2C2RA 5KG2A 2BRLA 3A2FA 4RW7A 1S4FA 4YQWA 3F73A 3G0ZA 1S9EA 5L1JA 2Q3SA 2OPQB 4AHTA 1C1AA 3JYTA 1NK6A 3P83D 1TAUA 3RWUA 3GIMA 4IG0A 4CESA 2IAJA 2ZQBA 3HSTB 3HYFA 3HKWA 4DL3A 3OS0A 4EO8A 3PUFA 4CEBA 4TYBA 4Y34A 3M8RA 5CYMB 4DSJA 2YNHB 3NF8A 2OPRB 4EO6A 4QAGA 1UA0A 4DTRA 2D5RA 3PR5B 3IG1A 2X78A 3NH0A 4JV1A 4RW4A 4IR9A 4CEDA 1RTJA 2IC3A 4AHVA 4C8LA 5DG7A 4W5RA 3M8QB 2G8IA 2DFHA 3OYGA 2ASJA 3TQ1A 3DLRA 3MXJA 1JLGA 2VG6B 2GC8A 3RMAA 3NAHA 1VSKA 3V1QA 3I8DA 5HP1A 4AHUA 1HARA 5KFZA 5KFXA 3NH2A 4JLHA 3N6LA 4NLPA 4R8UB 4NLYA 4DQSA 2HW3A 3HL8A 1A5WA 3H40A 3MF5A 5CZ2A 2P5OA 3V6JA 4M3TA 2R2SA 3TI0A 1S1UA 5KG4A 1S6QB 3CVKA 3LP2A 2J6SA 1C0MA 2HWHA 2HHXA 2KTQA 4KHSA 4TQSA 2KFNA 3KJVA 1B92A 1C0TB 4HUEA 1SV5A 4E1NA 4I9LA 1U48A 3VQ7A 4CF2A 1W9HA 5KG7A 1HYSA 3DLHA 1I39A 1NK5A 1FKOB 2CJQA 5KFJA 1S9FA 1FKPA 2IOCA 4J2DA 2AGPA 4F2RA 5HLFA 2F8EX 2XHBA 3CDWA 4QWBA 1S9GB 1W25A 3NL0A 1FK9A 3SQ1A 3I0SB 3M9MB 4J9LA 3MR3A 4ZP7A 3LPUA 1LWCA 4CJQA 1ZBHA 3SCXA 1T3NA 1VSEA 2P51A 4MIBA 3H4BA 4Z4IA 4ELTA 4JS5A 5F9NA 3BJYA 1MMLA 2VWKA 3K5NA 4ECVA 4CJ5A 2ILYA 1Y97A 3CDEA 3GQCA 4MQ3A 5DGBA 4F4XA 1F21A 2QKBA 1X9WA 2I5JB 4OGCA 3AO5A 3LAKA 4IDKB 4DF4A 1QQCA 4CIFA 2DPJA 3I5AA 4WZQA 3OYFA 3MR5A 5KFCA 2OPPB 1JLQA 2FVQA 3H98A 3D28A 4IFYA 3T19A 3TAQA 3KD5E 5FDLA 2R8JA 3ICLA 3SNNA 4KPYA 4TY8B 4ECZA 4OKJA 4CJ3A 3KMSA 4ECTA 4FM2A 1LW0A 3OL8A 2D0CA 1IKYA 1JX4A 2P5GA 4KREA 1C0UA 5DQGA 2WK4A 4C8KA 4FZXC 5KFPA 1RTDB 4DL7A 3SI8A 4O4GA 2FLNA 4E7IA 4FJMA 5KT7A 3WNGA 3T3FA 2Y1IA 4DTJA 3RB4A 4NCGB 3IS9A 2YV0X 1IG9A 1LV5A 4CF9A 1LAVA 1DTTA 3CJ4A 4HTUA 3OYCA 1DTQA 1T05B 2R8KA 2XO7A 1RBTA 1IKWB 3VQPA 4J9MA 2DFEA 3CM5A 1NK7A 1HYZA 2FVRA 3V1RA 2JGUA 3RMDA 3EYZA 2YNFB 4DQIA 2UVVA 3AVAA 4DFPA 4JRPA 4FJIA 4ZTJA 4CJTA 3FDSA 3AA4A 3V9SA 5JS1A 1ZTTA 2OPSA 3V9UA 3NH1A 4CGFA 3MEEA 4KHQA 2Z1IA 4DFJA 1S1TA 3DOLB 2W8KA 3PX4A 5F8JA 5J2QA 4DQRA 1VSDA 4AHSA 4KO0A 4U6PA 2OPQA 2Z1HA 2W7OA 4FM0A 4CJPA 3QGHA 3Q8QB 4IH7A 1C1CA 4Y2CA 3ZCMA 2VG5B 4DWIA 2YNIA 4ED7A 4ID5B 3DI6B 4RUCA 4NCAA 3MR6A 2O4GA 1HJRA 1Z25A 4FM1A 4X2BA 3EZ5A 1HQEA 1RT7B 1BI4A 4NRUA 1QE1A 3NHGA 5D3GB 3ITHA 2YNHA 5J2MB 2XCPA 4B9UA 4NYZA 1O1WA 1JL1A 4CFAA 5KG0A 1WSFA 2BQRA 4IQXA 5F8LA 3DMJB 4G1QA 3RMBA 3MXMA 2WRMA 4NLUA 3HPOA 2UVWA 2HHSA 3HT3A 1N5YB 1VK0A 3B6PA 5EUHA 4EP4A 4WFZA 4F4ZA 4FW2A 3QNOA 2VG6A 4YR3A 4URQU 4FJLA 4OPKA 2VG7B 3KKSA 3N6MA 4WZMA 1RCHA 2AX0A 3NE6A 3H2LA 4IH6A 4DG1B 4GC7A 4KAIA 4O4RA 1S6QA 3LDSA 1U47A 3IGNA 3VQAA 3BREA 1BHLA 4MIAA 2RF2A 3L2VA 1WAFA 1XWLA 3MEDA 4OLBA 2HVHA 1WSGA 1C0TA 5KFSA 2ZE2B 3NAIA 1BIZA 1UAXA 3T5KA 1D0EA 4ELVA 1S6PB 2W9AA 1EETB 3QO9B 5HBMB 4O3RA 4AH9A 2EHGA 4AILC 2IA6A 4XPCA 1TL3B 1CXUA 2DFFA 1S9GA 4LY7A 1SUQB 2ZD1A 2P1JA 5C24B 3I0SA 4TQRA 3VQ4A 4NLDA 3MTKA 4B8AB 3N6NA 1N48A 1WNSA 1HNIB 4BE0A 3SUNA 1IKXB 4CJFA 4CJRA 4JUZA 3MECA 3L2RA 3V6HA 2XWYA 2V4QA 4FVMA 4E7JA 4DTUA 3L2QA 1QAJA 5I3UB 1JLCA 2E6MA 1WSHA 4RW8B 3KLFA 3L2UA 1CLQA 4KKOB 4MKAA 4CFBA 4IDKA 4DSIA 3QGGA 5KFDA 4KB0A 4TY9A 2OPPA 3I0RA 4RUAA 1RT6A 5DMRA 1U09A 3TWHA 4ECUA 3DRPB 4DEZA 3RB0A 4DF8A 1TKZB 3NFAA 4J9PA 3IGVA 4J9OA 2JLEA 3H5XA 3QEIA 1RDAA 1SL1A 3C6TB 2UVUA 4MK7A 4MK9A 3K5MA 4BDZA 3M9NB 3PJWA 3KK2B 1VRTB 3PW7A 2HNDA 4IR1A 1TL1B 1TKXB 4W5OA 3PVXA 3G86A 2G8WA 1LW2B 3RR7A 4KAZA 2UUTA 1RTDA 4B3OA 1BGXT 5FRMA 3T5JA 3DLEB 4FJ7A 1RAJA 4ZP6A 1IKVB 2JC1A 4DU1A 1QSYA 2V4RA 4Q44A 4M41A 5KFNA 1T7PA 3OY9A 4L8RB 2WCXA 4HCBA 4M3YA 4PWDA 4EYHB 3OYLA 4URSA 5KFIA 1N6QB 1ASVA 4DQQA 1T05A 3WNFA 2XGQA 3UIQA 4XIUA 2VA3A 3K5LA 5KRSA 3C6UB 2G8VA 3OLBA 1JLFB 5K14B 3BSAA 4IH5A 2HVIA 3LP0B 1BCOA 3AVLA 4ZVGA 5L1LA 4EEYA 2XRIA 3SQ0A 4RU9A 2D0BA 2B6AB 2Z1GA 1GX5A 1NK0A 2WOMB 3KLGB 3I5CA 4J9RA 4FLTA 5C25B 3ZSOA 4Y1CA 3PHEA 1JKHA 4IKFA 2KW4A 1J9AA 1RT4B 3LP1B 2A1SA 4OKEA 2HNZB 4KTQA 1S10A 4JV2A 1L3TA 2V9WA 1IO2A 2WONA 5CY4A 2VG5A 4M3RA 3TAEA 5F9LA 4WYWA 4ID5A 3HK2A 4IG3B 3H5UA 2YKNB 1RT7A 1NK4A 2R8IA 4KTWA 3PW2A 3HVWA 3KOAA 5J2MA 1TP7A 3V6KA 2IS3A 2HMIA 4CGJA 4FJKA 3CJ2A 2FBVA 4E1MA 3NF6A 4DMNA 5HRNA 4Z4EA 4ZP9A 4FK0A 1OS5A 3DMJA 3O3FA 2F96A 4BACA 4ZMMA 4WE1B 1TVRB 1WNEA 3OYNA 3TARA 4FZYA 4O3NA 3B6OA 4J2EA 1N5YA 4KHUA 4DSKA 1SH3A 3M8SA 4YR2A 3ULDA 2YHBA 3ISNC 4J2BA 1SH2A 2NUBA 1JLAB 4MFBB 2IM1A 4K4VA 1WSIA 2IM0A 2O5DA 2AJQA 4NLVA 5J2NA 4HUGA 2FLLA 1B9DA 4B9VA 4DG1A 3V9XA 2FJWA 5KFWA 4FBUA 3OL7A 4DLGA 4Z0UA 5KGWA 1REVA 2HHWA 4KFBA 1IM4A 3TAMB 3EZUA 3O4NA 4HHTA 2IDOA 4YMEA 4I9QA 3ISND 4H4MA 4FJNA 2KZZA 3NGYA 1LWEB 2E9TA 3S3OA 4WXWA 2ZE2A 1DLOA 3QNNA 2DPIA 1S6PA 1KRPA 4ZPAA 5KFMA 3VQSA 1EETA 5HBMA 2D41A 4NZ0A 3DOKB 2BQ3A 4C8OA 3MAQA 1TL3A 3AO4A 3V6DB 3RB3A 4F3TA 1QUVA 4HCCA 4FJGA 4MH8A 1SUQA 1NJZA 2RKIB 3KLEB 5C24A 4BE1A 4XPEA 1RT3B 1KFDA 5DK5A 3DLKA 1HNIA 3CIZA 1NJYA 4TYAA 1IKXA 1ZYQA 4KV8B 4W5TA 2YKMB 2HNYB 1J54A 3QETA 3JSMB 5J1EA 4ED6A 5KG1A 3VQ8A 4CGDA 3MFHA 1RNHA 2D0AA 1NHUA 3QZ7A 2HWIA 5I3UA 3HVTB 5HRPA 3H5SA 3G6VA 4ED3A 3ZT2A 1RYSA 2ETJA 3MR2A 3SZ2A 3OL6A 4KKOA 4KHNA 4EBEA 3UPFA 1GOCA 4DTMA 1UWBA 1A5XA 3MEGB 4ZPCA 4WFXA 5KFVA 4CECA 5FROA 5HRSA 4U7CA 4CEEA 3DRSB 4I7FA 4DS4A 2R2UA 4BWMA 3PX0A 2PZSA 5F8GA 1A5VA 3DRPA 2HHQA 2FVSA 4Q0BB 4FZZA 1TKZA 1N4LA 3KLIB 1WLJA 4M95A 3OYBA 4I2QB 1K1QA 4ECSA 3VQ9A 1HPZB 3TANA 1R0AB 4CEAA 2WB4A 4CJEA 1TKXA 4ED1A 2AX1A 4ED8A 5KTQA 1YTUA 3KLHB 4E7HA 3PJXA 3DLEA 3QGIA 3P1GA 1IKVA 2ATQA 1HRHA 3OVNA 3GIJA 4LSNB 3ZT0A 3FFIB 3LWLA 3S3NA 1KHVA 2QK9A 4TLRA 3HP9A 4DTXA 3CJ0A 1KSPA 3DLBA 4QCLA 2ILZA 2CKWA 5EWGA 2GV9A 1L3SA 2OH2A 2WHOA 3L2WA 2HB5A 3C6UA 1TK5A 1TKTA 1JLFA 1NKBA 4M3WA 1S1XB 4NLQA 5EDWA 5KRTA 3LP0A 4FJHA 1QSSA 4NYFA 3HP6A 3SPZA 1EKEA 4KHYA 2KZMA 3OYIA 3H59A 1D9DA 2W9BB 2FBXA 1S1VA 5KFRA 1QS4A 2B6AA 3GYNA 3SPYA 1RYRA 1GOAA 1NNDA 3CFOA 4TXSA 4OL8A 2R7YA 3LZIA 3TABA 1RA6A 3OYHA 4IRCA 4O3QA 4Q5VA 3V4IA 4CEOA 3D0PA 3BSOA 1SL0A 4ZPDA 4CJLA 4OKKA 5JS2A 3QEWA 4N47A 4NLRA 3DYAB 4PQUB 1LWFA 4O44B 5SZTA 2KFZA 2C2EA 5C42B 2B43A 3M8PB 3PZPA 1BISA 1KFSA 4MK8A 4FYDA 5KFYA 2XY7A 3AVJA 3DRRB 1NKCA 5KFFA 3GILA 2FVPA 4NLOA 2C28A 4O5BA 1NJWA 2VWJA 4O3SA 3CFPA 4E89A 3UR0A 5KG3A 1W0HA 4FLWA 4LQ9A 5CYMA 2OYQA 4WE1A 1S0NA 2OPRA 3NF7A 4CGHA 1RT5B 4I2PB 3CJ3A 4JRQA 4Z4CA 5KT6A 3U3GA 4CK2A 3OHAA 4FLYA 5E41A 3Q8PB 4F4WA 4Q8EA 1S1WB 2OA8A 3KD1E 1RBUA 5L1IA 3M8QA 3JYTB 4O3OA 4IKAA 4GW6A 2IJNA 4O0IA 4WFYA 3AVNA 1HQUB 4DL2A 2IAJB 4PUOB 1EX4A 4KSEB 4NRTA 3O4QA 3ZSXA 2PYLA 2XGPA 3VQ5A 1CXQA 2X6NA 4R8UA 5EWFA 3RB6A 5KT5A 1RBVA 4HVJA 3AVCA 1KCFA 3FQLA 3PX6A 3OL9A 1T03B 1LWEA 2FLPA 4URGA 5KI6A 3IG1B 3GV7B 4CFDA 3TVKA 3GV5B 1TQLA 1FXXA 5DLGA 3SV4A 3OYAA 1JIHA 4KTZA 2JEGA 3SFUA 3DOKA 4Y2AA 2YNGB 2AGQA 2Z1JA 1S48A 5FRNA 1SL2A 1RBRA 1YT3A 1UOCA 3K58A 5F8HA 3QIDA 3F9KA 3KLEA 4FXDA 3FRZA 3PW0A 4CFCA 2QKKA 1FKOA 1HYVA 3EPIA 4DU4A 3CYMA 3BQ0A 4ID1A 3SV3A 1NOYA 4KV8A 1BQNB 3V1OA 2YKMA 2HNYA 1J53A 3JSMA 5I42B 1VSFA 5EU7A 4DTNA 4K4WA 2E6LA 2FJVA 2ZKUA 3KJVB 2VA2A 3ZT3A 4ZTFA 4DU3A 4RW9B 4DL6A 4ZHRB 4EBDA 2EC0A 3KMQA 3H4DA 4CHPA 1VRUB 5KFUA 4CF0A 4GMJB 3ZSWA 1KVBA 4W5QA 3MEGA 4IOBA 4W5NA 4H4OB 2HHTA 1XI1A 1HMVB 2XY8A 5HLFB 2I5JA 2ITGA 3SQ2A 4TSXA 1FK9B 2GBZA 2ASLA 4GVMA 4M94A 1LWCB 3KLIA 4F50A 4I2QA 4K8ZA 4Z4FA 3QEPA 4RNOA 4CCHA 4RNMA 2BQUA 1L5UA 1R0AA 4E7KA 4J9NA 2B5JB 1U45A 4CHOA 4TY8A 4NLTA 2EX3A 3CFRA 5DG8A 1KLMB 2JEIA 3HPGA 4N76A 4CEQA 3PR4A 4LSLB 3BGRB 1T94A 4BDPA 2AQ4A 3FQKA 4K50A 4ZVHA 5KFBA 3SI6A 4LSNA 4Y3CA 2OZSA 4BDYA 1K6YA 3L8BA 4QWCA 3KIOA 4KHRA 1NJXA 3NBPB 1JLQB 4ECYA 4R5PB 3GV8B 3VQ6A 2XI3A 2YHAA 4FW1A 4KHWA 1RT2B 4CK3A 1JLEB 4NCGA 2XY5A 4FBTA 4Z4HA 1LW0B 2GIQA 1RDCA 1QSLA 3NMAA 1NK8A 1QTMA 4ECRA 1SKWA 1IKWA 4EYIB 1XR6A 3DDKA 3AO2A 3K59A 1MU2B 3ZT1A 2W9BA 2UVRA 2YNFA 4NLSA 4AHCA 3CWJA 2F8SA 3LANA 4O4GB 1YVFA 1XR5A 4CGIA 3TAGA 5HROB 4QW8A 4N56A 3VA0A 4E0DA 3CM6A 4MKBA 1X9MA 3QESA 2J6TA 4NLWA 3ZSYA 1TK0A 4FCYA 4IFVB 3IS9B 1EP4B 3HXMA 3DYAA 3K57A 4Y1DA 5C42A 3DOLA 3M8PA 3BR9A 4CERA 3O3GA 1D8YA 3RBDA 4FJ8A 5KGXA 3AA5X 1RTHB 1ZETA 3OYMA 2C22A 3DRRA 2BANB 4GC6A 2XCAA 2RDIA 3VQCA 3KTQA 3CG7A 3G6YA 4QWEA 4H54A 2HHUA 1RA7A 4ZP8A 3DI6A 2OZMA 4BE2A 1CZ9A 4CEZA 3ZSQA 5KFKA 4F4KA 4J9KA 3OYEA 5D3GA 5DQIA 2OPSB 3LALA 2X74A 4NCBA 5KFEA 1J5OB 3HM9A 4Z4GA 4I2PA 3DM2B 4FLXA 1JXBA 4ED0A 4LH5A 2XY6A 4K4TA 1BCMA 5J2QB 3OS2A 4KO0B 1S1WA 5JXSA 4K4ZA 1C1CB 3QIPB 4TN2A 3T1AA 4E3SA 5KT3A 1Q8IA 1HQUA 2FBTA 2YNIB 4PUOA 3OSPA 3QIOA 2VG7A 1HQEB 4EZ9A 1BI4B 1QE1B 1EXQA 4RZRA 3ITHB 4XO0A 1T8EA 4YNQA 1U49A 3U6FA 3EY1A 1T03A 1SKRA 3E01B 4CHNA 3UQSA 2BRKA 3ASMA 3KK1B 1D1UA 4G1QB 4FJ5A 3RAXA 3AVBA 3IRXB 1RTIB 2YNGA 3H5YA 3OHBA 5F8IA 4O0JA 3NAEA 3K2PA 2HAIA 3QO9A 3AVGA 2E9RX 5CZ1A 4OGEA 3G6XA 2W42A 4Q8FA 5KG6A 4NLXA 4J9SA 4DTOA
chains in the Genus database with same CATH superfamily
1SXLA 4WYLA 4RKUC 2BJEA 2HHVA 2UUCF 5AQVA 1YF5L 3LZJA 1S0MA 3D7EO 2ALYB 2I1RA 3O9TA 1U1PA 3MEDB 1Y11A 1FO1A 2DGQA 3ZEUA 2Y8WA 2E1PA 1VRUA 5AQIA 2IMWP 4NZ6A 2LQ8A 3LQVA 1RU2A 4CTAB 1IBKJ 3SQ4A 1XNRJ 2MSSA 4C1NI 5L9XA 4LFBF 1PAUB 3I5BA 4JI1K 1UWAA 1PYTA 1TGOA 4ZIVA 3KHGA 1XQIA 4C98A 4FLVA 4OYPA 4RG8A 1X4HA 1LXJA 3CDUA 5K8PA 4M7YA 2VJUA 4DL5A 4O0NA 1FWLA 3MECB 2WBMA 3HO1A 4LF7K 3MD3A 2JEJA 1NCLA 2VV5A 3PKYA 1NK9A 3PV8A 3C6TA 4ZCLA 1JLCB 1PAEX 2VPXB 3G8TA 4H0XB 1QQNA 3KLVA 3MM9A 1OH8A 1TKDA 2M7SA 2QGFB 2POKA 5GINA 3I0RB 4IEIA 2VDHA 4YUDA 3DDIA 1U1LA 5I3QA 5RUBA 1WTBA 4E7LA 3QGPA 4XH5A 1JLEA 1AA1B 3VERA 3SCIE 1XBWA 4F2SA 4KGKA 1GXLA 1ZAXA 3LM2A 2HVEA 3SMSA 1N6QA 1ASWA 2HRTA 3M7VA 2VF3A 2O4IA 1U04A 3ZSZA 4B3OB 1C4AA 4B3RJ 2ZH6A 3T9NA 3M05A 2D3OR 2PO4A 2GEMA 2Q0RA 2E7VA 1ZBUA 4FNHA 4AQYF 5GAGP 2DYAA 2DTUA 4ETZA 4IFVA 1FX2A 2WW4A 3IDHA 2B0GA 3KLGA 2EBGA 4PWDB 1CJKA 2UU9F 1TV6B 2RNEA 2ZUGA 3SDEB 5IWAK 2GHPA 2BANA 4M3XA 3W5ZA 3J81j 4F36A 1PBUA 5D4LA 4BQZA 4A2AA 4ED2A 3HOSA 2BE7D 1C2PA 2IYGA 2PGCA 4CLTA 1DQ9A 3G96A 2YKNA 3T1YK 2G8UA 5FPMA 2E8AA 2UUAK 3EE9A 1NHVA 3AQPA 1HNXK 2BJDA 2PSZA 3JB9k 4IDHA 2EWHA 3QBWA 4BRGA 2B9EA 2H1YA 1RILA 3QIPA 3NOGA 3JQMA 1U4BA 1SJQA 5IQ6A 1ZM4A 4RW7B 3P6YC 1RU1A 2YX1A 4WJBA 2FHKA 1JLAA 1UZDA 2QWLA 4D3GA 2OSQA 3AA2A 4DV1F 5HL7L 1YWXA 2HZCA 2QL5B 2KG1A 3E01A 3HVRA 1QHTA 1ZPVA 3KNAA 3IWLA 1Y9OA 2D0OA 1WG1A 3NF9A 3UKUA 3WNHA 3K8VA 2DNGA 3RAMA 4LFAJ 3K17A 4KJIA 4NWBA 2DRBA 4X4OA 5DM7Q 3WXJA 2JEFA 4B1ZA 2WTFA 1SC6A 1VHIA 4M63C 1P1TA 1VQON 4CJ4A 3FGUA 1S5ZA 3GJQB 3R2CJ 2AYGA 4K0KK 2D9OA 3MAAB 4NYNA 5BR8J 2ZBIA 1TTHB 3HI9A 2PFFB 3CXCM 2KHOA 4OI0A 4RNNA 1RT3A 2FZKB 3HVAA 4PY5A 2BGGA 2C2KB 3IR6B 2NPIA 4M7XA 3A4TA 5EWEA 4B9MA 1S1UB 3BYRA 1VQOS 3QERA 3VA3A 3PO5A 3DOMA 3IRWP 1BO5O 1X9SA 1PC4A 2RN2A 1W97L 3D45A 1XERA 1Z2LA 4B02A 1UFWA 1SV5B 4LF4K 2FXUA 4JI3J 1T9UA 2ZZNA 4M3ZA 4NLGA 3U4LA 4WFBL 1TUGB 1FRHA 1VDHA 3HHKA 2DNPA 4DCJB 4AL7A 2XS7A 2BE2A 4CHYA 4A5AA 1DKGD 2VASA 2B8PA 1RDWX 3PFEA 3QFWA 3AQOA 3P39A 2CQ2A 5M1QA 5KFGA 2UU9J 4EZ6A 4ZVFA 2ASPA 4X66K 4CI0B 3QINA 3ZT4A 4K7QA 1KD1T 1RDRA 4OJHA 3TVZA 1GLAG 4PZVA 4KRFA 4USMA 3TAPA 1FT8A 2DH7A 2OEMA 4AFFA 4WTOB 2F65A 1GOBA 3QLHA 3EPGA 1BU6O 4DSFA 2N7CA 3Q8SB 1YZ7A 5M1PA 1HD1A 1RBSA 2GQQA 1CZBA 2ZHBA 1WACA 3Q8UA 2W40A 3D54A 3AVIA 3OJSA 4W90B 1HI8A 2ALZA 1Q8LA 4IRKA 2FC0A 5FDLB 4ELUA 1RAAB 4CF1A 5LT5A 5CHCB 3N9UC 1S1XA 3ZSRA 3HSGA 2BOPA 3AVFA 3NGDA 1RP5A 2RDJA 1Q86O 1KLNA 4A8FA 2CQHA 2D69A 2NPFA 3RRGA 1KQSR 2NS1B 3NKYA 3AO3A 4EAHD 3OTDA 1HNVA 4DV1J 3R1HA 4P75A 2ZJPL 1WJ9A 2W8LA 2AJ1A 5K5MA 1HNWK 3LAMA 2C2DA 3QEVA 3B82A 4DPTA 3KNGA 4N5SA 2OCEA 1LK5A 3EM1A 3VQDA 4BVPA 3MCMA 3D4JA 3RZAA 5HRRA 1XHZA 2P9LA 5KFOA 4M3UA 1Y5IB 5CABA 4EBCA 3C6AA 3RVCA 1ZTWA 4HKQA 2W4CA 4I6AA 1ZM2A 2R2TA 5DO2A 1M5OC 3BKUA 2A1RA 3MUMP 1GLBG 4LUBA 1QLNA 1ZBFA 5C2CA 4J8FA 2AGOA 5FLXU 4PA1A 1UVKA 4CHZA 2VBXA 1RT5A 2J9CA 1BQMA 3U3YA 4HDGA 2GCFA 2RQ4A 2XYGB 3F73A 4AHTA 1TL7A 1YTYA 5CA5A 1VCTA 2PBDA 3QT6A 3RWUA 3O8MA 3IBCB 1B7FA 3EZWA 2PI4A 3IWNC 1HBMB 3ZX3A 3Q24A 1NSPA 1O6XA 3W7BA 2AKWB 3PR5B 2LXFA 1PJ5A 3IG1A 1KQGB 1KWMA 5IT9Y 5LY3A 1GLLO 3NH0A 1VQKN 2OFHX 4DV6K 1QY7A 1LFPA 1F60B 1NGBA 2R7XA 1P9YA 2IC3A 4UOGA 5DG7A 4W5RA 3GPAA 1N5VA 2HFNA 3TQ1A 1PG5B 1JLGA 2GC8A 1UAWA 4BGAA 3CT9A 3RMAA 1VSKA 5HP1A 4AHUA 4MAKA 2UXBF 1N33F 2HW3A 3HL8A 1VQKS 3THYB 3MM5A 5CZ2A 1WC5A 2R2SA 3TI0A 5KG4A 2HSTA 4Q2MA 3CVKA 3T7ZA 2RH3A 3WIUA 4YY3J 2E5JA 2K7JA 4J9VA 2KTQA 3LH2S 4KHSA 3F9MA 4TQSA 2KFNA 5IWAF 3KJVA 4OYIA 3VAIA 4HUEA 2LA4A 4OZ5A 4E1NA 3VQ7A 2ZGYA 3UI3A 1HWJA 2LFVA 1AUDA 1U8SA 2W25A 1I3OB 5L46A 3CULA 5KFJA 2IOCA 3GYXB 1YI2N 4QWBA 1S9GB 1W25A 3NL0A 2C3PA 3SQ1A 5D0RA 4MMOA 3VCDA 1HJOA 1U2CA 3MR3A 3HFVA 1BLUA 4J90A 5AQYA 3E8OA 8ATCB 4Z7YA 5AQMA 4A61A 4ELTA 4JS5A 2LQ5A 2VWKA 1G1XA 1Q7YO 1T9XA 4ED5A 2A5XA 2E2OA 1VYAA 2ILYA 2W4DA 1NEEA 1YI2S 3C16A 4RCHA 3CDEA 3GQCA 4DUYJ 1F21A 4KR0B 1WSVA 4BC9A 1X9WA 5IT9O 1RACB 4FWRA 1QQCA 5A2QU 4CIFA 2BM0A 4C23A 5KFCA 2QC3A 1ZOTA 2OD6A 4IFYA 3GTYX 3VZIA 1WDTA 3NS6A 3ICLA 1HI0P 3SNNA 5AQNA 4A46A 4OKJA 1WKJA 2W41A 1IKYA 3U7JA 1R8PA 3P96A 4P72A 4C8KA 2AJ4A 4FZXC 4X4PA 1H38A 1PIEA 2NRXA 4E7IA 5B0FA 2ZOGA 4OZJA 5B0EA 4J5OA 5M2PA 2XSJA 3NRBA 1AZSA 5KT7A 2AD9A 4DTJA 4NCGB 1LAVA 1DTTA 2LLZA 3OYCA 3SXLA 2P6SA 2V2KA 3EMTA 2C2ZB 4V1Ak 3JTNA 1NK7A 3V1RA 3A0IX 2W4PA 4QIVA 4FWLA 3U1LA 2YNFB 3EYZA 2NZTA 3AVAA 1KEKA 2YX7A 2VZ9A 3BDEA 2UXBJ 3MZIA 2HGMA 3AJ2A 2QMXA 3AOAA 1ZTTA 3W2WA 3V9UA 4ZLPA 3NH1A 2PMWA 3O1WA 1I1GA 3MDQA 2Z1IA 1Y3KA 1HHTP 3CJ9A 4WQ5C 1BE4A 2XULA 4CBXA 1N5SA 2RDDA 5J2QA 1VSDA 2VHGA 2GTDA 2MQ8A 4KO0A 4U6PA 2OPQA 3OPKA 4DX8H 2VH7A 4P2XA 1C1CA 3D1OA 4DN0A 4Y2CA 2CJAA 3C7NB 3G4SN 4I6YA 3GFXA 2R7QA 4BRHA 3D9BA 2DGWA 4RX6A 2EFGA 1KQSM 5J2MB 1CJVA 3NOCA 2C2OB 1O1WA 4CFAA 3O08A 2ZOMA 3VR1A 2BQRA 4IQXA 1N0VC 2VFRA 5ETPA 3RMBA 1VQ9N 1TR0A 1HNZK 3G4SS 1V3SA 2UVWA 2IRUA 3GE1A 3HT3A 1N5YB 3FKBA 4F4ZA 1NGEA 3WUHA 4FJLA 2BM1A 1WF0A 2NSCA 3N6MA 3ZZTA 3NE6A 3H2LA 1PYOB 4C1NK 1EO1A 4BREA 4WF9L 4PEOA 2MGZA 2HWTA 4DG1B 4GC7A 4AE5A 1VQ9S 4O4RA 3VOVA 1HBNB 1S6QA 4LT6A 2BH1A 4JNEA 1IQZA 2GGPB 3VQAA 3BREA 4OYBA 1BHLA 1WAFA 2HVHA 4GKJF 4PG8A 3CHWA 1KDNA 5KFSA 4BROA 5HMXA 3L0QA 3R5CA 2FY8A 3QO9B 4O3RA 2AHOB 4DUZJ 2IA6A 1U2VB 4JK9A 3DGPB 1PJ6A 2DISA 3W9HA 2VGMA 4LY7A 1A7GE 1SUQB 4UOHA 4OZ3A 5ETLA 4JYAK 3VMFB 2HFVA 3VQ4A 2QW9A 3MTKA 3ENBA 4B8AB 3N6NA 5GADP 2NRWA 3C3LA 3SUNA 2J5AA 1Q78A 3ZEUB 3AHPA 1E4FT 3QSIA 4LF1A 4DUTA 4DB3A 5ETOA 2QMWA 2DR6A 3V6HA 5BYQA 1XMOK 3N5BA 3Q8YA 4USTA 3POTA 2ZH2A 3MMVA 3VGKA 5M1KA 4F7VA 3KLFA 4LF2A 3L2UA 4KKOB 4IDKA 4USWA 1T9WA 1R0BG 4ISFA 4KB0A 2Y1LB 4RUAA 2J0XA 4FN5A 1ELOA 4ECUA 1W7AA 3DRPB 5M1FA 3R6LB 3RB0A 1FJEB 1TKZB 2JLEA 3C6TB 2UVUA 4MK7A 3K5MA 4BDZA 3M9NB 3PJWA 2DXFA 2H54B 4NXNK 5HSPA 1WUAA 3MM9B 2QM1A 4K25A 2NYIA 5E3CA 2ATCB 3G86A 2G8WA 1HR0F 1RLDA 3A12A 2ZJRL 3T5JA 1IUJA 2V51B 3Q83A 3ENQA 2HFZA 2V4RA 2Z2MA 4X4QA 3KDOA 5CHIA 4ITSA 2RQCA 5B0GA 4NA3A 1Q5YA 1YXQA 3PYEA 2EFNA 1N6QB 2XNRA 5DS7A 2DGOA 1RZMA 5E5NA 5KOWA 3UIQA 3VAKA 3C6UB 1JLFB 2YQ3A 2Z2LA 4A47A 1YJWN 1SJFA 4C4WA 4IH5A 4OHZA 3MWPA 2NRTA 1R8AA 5B7WA 4WPAA 2NXEA 4EEYA 3BPDA 3MWBA 3CUNA 4LR8A 4DR7J 3BH6B 3C14B 4B1WB 3KLGB 3BB5A 1CJKB 1YRUA 3W5YA 1NSKL 1YJWS 1DARA 1F5CA 6FD1A 3A5NC 5AQJA 3KJQB 4QS7A 1O13A 5ADXA 2Q3PA 3HK2A 2VDIA 2YKNB 3JAMY 4JI5J 3HVWA 2LEBA 1TP7A 1VQYA 3A8YA 2IS3A 4KPCA 1Y5LB 2V6AA 4FJKA 5HRNA 4Z4EA 4DV4J 1OS5A 3BGUA 3O3FA 3M2UB 4ZMMA 4WE1B 4ILGB 1WNEA 4FZYA 2HBRB 1HIYA 3BYPA 4LF8J 4DSKA 2OGUA 1S4EA 3UE2A 2YHBA 4C0HA 3ISNC 3A1YG 5AFUA 1SH2A 1X4BA 4DX6A 2NUBA 1JLAB 4HHUA 1RWUA 3VALA 1MWQA 4K4VA 1WSIA 2ZFHA 5JVHL 4F02A 5J2NA 1B9DA 3P5BP 1S76D 5KFWA 3OL7A 3R3TA 1M5HA 4Z0UA 2ZJPQ 4KFBA 2CQ0A 2F4VK 3O4NA 1WBBA 4CLSA 4I9QA 3UE5A 4H4MA 4IOCL 3UKUB 4TKTA 3FEZA 3S3OA 1U1OA 4M5DA 3HBTA 2QSFA 1DLOA 3US5A 4MYUA 2DPIA 3N28A 5KFMA 1RXOB 2D41A 3R3LA 1WTFA 2BQ3A 4C8OA 1N5TA 3AO4A 5AQKA 1OYEA 3OW2R 3RB3A 4OYAA 2V8PA 4AM7A 5T7LA 2HGNA 3WQTA 5C24A 1MWZA 2RQKA 3TVYA 3V5RA 3R7NB 4LMZA 4F0KA 5D0EA 3GJRB 1RT3B 5DK5A 3M1VB 2N82B 1HNIA 1LNQA 1AYEA 2X1FA 1NJYA 1IKXA 4I6MB 4FOEA 2Z30B 3QT7A 3QETA 3JAMO 3JSMB 2KG0A 4LF6F 3DOMB 3UVJA 3OVBA 3MFHA 3S1TA 3H5SA 3D6RA 3RBXA 4JD2B 4ZVSB 3PYDA 3S01A 3UPFA 1HX1A 3IA0A 3IP0A 1GOCA 4YOYA 4DV7J 1A5XA 3A8KA 3MM6B 4ZPCA 1MW7A 3QT8A 3EXYA 2J8SA 3R6GB 5FROA 4S0MA 4OI6A 4CEEA 3R9LA 4I1TA 5AQXA 4I7FA 5BR9A 4H5RA 3EICA 2HHQA 3CC2N 1N4LA 3KLIB 1UVLA 5LL6Z 1VBZA 1UJ6A 1K1QA 4BC3A 1UEVA 1BDGA 5C2FA 2CPYA 1BHNA 1IBLK 1R0AB 4CJEA 1TKXA 2Y8YA 4ED8A 2MMYA 3CCSN 5KTQA 3JSYA 4E7HA 4A5BA 3TQEA 3DLEA 3E1YA 3CC2S 3P1GA 4PL7A 3DN9A 3DHWC 3CCTA 4IYQA 2D0PA 2A2CA 3LWLA 4OX7A 2XO6A 2KT5A 4D3HA 3J7ZT 3P4UB 4IWVA 4EHTA 3CCSS 4GVBA 2A6OA 1DAXA 2YWGA 2B56A 2ZWHA 5E33A 2HVDA 2RIJA 1NKBA 1S1XB 3LP0A 4B3MJ 1HA1A 3W65A 3SPZA 2YKPA 4PKIA 3OYIA 4XDDA 3UCUP 2OMLA 1J5EK 3BKTA 2DGTA 5CR4A 4IJNA 1QS4A 2B6AA 1NGHA 2R9LA 3U8XA 2PT0A 1OIAA 1GOAA 4JYAF 3IR5B 4M8LA 4UZCA 2L9DA 1SC1B 1G6BA 4OL8A 3TUIC 1FE4A 3TABA 2B4PA 4O3QA 1HWLA 4DV2J 4CJLA 2HBKA 2A1BA 3DYAB 1LWFA 5SZTA 3BF3A 2C2EA 5C42B 4TVAB 2O8BA 5AQPA 2EVZA 3ATVA 1YITN 2O8FB 1BQXA 4JI6K 1BISA 2CDRB 3KG1A 3DHXA 1PBAA 4MK8A 5CCMA 4ZPWR 3FR0A 4OZ0A 1X4FA 3RU0A 2P9LB 1MMDA 4FPIA 3SSRA 1Q82O 3QJJA 4PKGA 2FVPA 3MN6A 5CE3A 4ISEA 2NR0A 2CQGA 1UKUA 4FLWA 2BXJA 2O1PA 3QJPA 2OYQA 1YITS 3QRQA 4YB6A 4J9UE 3NF7A 1RT5B 2PMHA 4I2PB 3FE1A 2XSFA 2BE9B 5FLXY 1Q95G 2W2QP 4FLYA 5E41A 3Q8PB 4Q8EA 3VGVA 4IKAA 4C11A 4GW6A 1HQUB 5GAHI 1EX4A 2CWXA 3LDOA 4NRTA 4ZVRB 2PYLA 5IV4A 1G7CB 1TZ0A 1CXQA 2X6NA 4R8UA 5EWFA 3FQLA 5B0CA 3R7BB 1K8KA 3TUJC 3WC0A 2FLPA 3CIPA 3IMQJ 4TLQA 3Q22A 3IG1B 2VBWA 4DR4J 4DPOA 1RAIB 1S72N 5D77A 3M2VB 1RCXB 3SFUA 3G8SA 3DOKA 1NWKA 2YNGB 2LP4A 2MQPA 1WKKA 1NM2A 1RWWB 4CH1A 2KI2A 5TKWA 2HK3A 3KLEA 2HIYA 4C0OC 2QKKA 3MM5B 1HYVA 1S72S 5AQLA 4OZ2A 1NOYA 1BQNB 3V1OA 5AQUA 5I42B 1ZBSA 3Q89A 4C6AA 2SXLA 2JLFA 2ZH3A 3KJVB 4DU3A 1U24A 3O44A 4RW9B 4NMXA 4EBDA 2Y0SD 1AUSL 4X4SA 3C15A 1NNEA 4U7BA 1CEZA 4FXWA 1IWGA 2HHTA 1HMVB 2J0WA 2I5JA 3SQ2A 2DGVA 1IBMF 4OX9F 5LMUJ 1UVNA 4I67A 4K8ZA 1F0XA 5F2RA 3QEPA 4RNOA 1DHMA 2VYPA 4RNMA 2BQUA 3A5LC 4FOIA 1K0VA 2VQEJ 1HBOA 2B5JB 2EFQA 4CHOA 4TY8A 3CFRA 4M1KA 3W3DA 1KLMB 4N76A 3MGJA 4CEQA 2KYXA 4WF9Q 3GU0A 3BGRB 2ZGZA 3GBTA 2ROGA 3FQKA 1CVJA 3HHEA 3OW2M 2HKEA 4LSNA 5KAKA 3FZBA 3M8ZA 5DM6L 1WUUA 2MHNA 2F4VF 4L75A 2A2DA 1NJXA 4ILHA 1MROA 3GV8B 4QIEA 1TFWA 4OYOA 2YHAA 4FW1A 3QFUA 4KHWA 2H4YB 3OUYA 2HQGA 2CYYA 2C1EB 1N8RO 3JS9A 5GAHU 3ATUA 4U7UK 3QRRA 4BRPA 3I82A 1J27A 1FX4A 2R7SA 3THWA 4JI7K 1NK8A 4CD1A 1MU2B 2J7WA 4RL1A 2QZ8A 4ZS6A 4B1YB 4F4AA 1SZ2A 4AHCA 3CWJA 3FMBA 3U9ZA 2YHXA 2F8SA 3LANA 1YVFA 3GSIA 4CGIA 3HZEA 5HROB 4QW8A 3VA0A 3EO3A 1AZSB 3QESA 4DJBA 4C3MA 3PSFA 2R42A 3SAFA 2DR8A 3K57A 5GAGI 3I96A 4JI4F 3BR9A 4BR9A 1D8YA 3N4PA 1K8AT 3RBDA 4FJ8A 3ULHA 5KGXA 5EY4A 1VC5A 2IA0A 4O8UA 3DRRA 4DR3F 3CC7N 1MNEA 4ANCA 1N32K 4OHVA 2RDIA 2V7ZA 3UKRA 1RE1B 4QWEA 4WP9A 1ROFA 1UZHA 5LXRA 2UUBJ 1AT1B 2OZMA 4YOWA 3PSIA 2ACYA 2ZBPA 1CZ9A 4C0BA 4CEZA 2DH9A 3LALA 1URRA 3D6MB 3DM2B 4FLXA 1NMNA 4ED0A 2KO1A 4LH5A 2XY6A 3O80A 3CC7S 4B3TF 5J2QB 5LOQA 4Y00A 2HQDA 4KO0B 1S1WA 1C1CB 4TN2A 4E3SA 3GZ7A 2FBTA 5FPEA 1EQYA 3QIOA 2ZJRQ 2VG7A 4OHWA 4EZ9A 2ZH5A 4TU9A 4RZRA 1T8EA 1CJVB 3SAGA 3KUGA 4LBPA 3U6FA 1IBMJ 5DZ7A 1SKRA 5JMNA 4JKAA 1LWXA 2AEFA 3P3DA 6FDRA 2IVPA 5HMZA 1U26A 2M8HA 2BRKA 2UP1A 1OMSA 2ZUAA 1S3XA 4C2MA 4C97A 1O8BA 4RPFA 1T9TA 4CZFA 3OHBA 3EGNA 4O0JA 2O8EA 3K2PA 1QZ5A 2ZH8A 4J7CA 4Q8FA 2UYTA 2VQFK 4EU0A 4NLXA 2IVMA 2CAJA 3EN9A 2I38A 2VICA 2DNHA 5JMVA 5FPNA 2EPIA 3EUNA 3E2EA 3LUYA 3L3VA 5E2QA 4C3KA 2D3ZA 3CETA 2HVZA 3NGUA 4M5MA 4DR2F 4JI2K 3OLAA 5AFUH 3OBYA 2ZC3A 1C1BB 5D0HA 2YVSA 4H4OA 4UUWA 2CVEA 4DFKA 4RW8A 1JJCB 4DSEA 3SYZA 4B9LA 1JXEA 4IXCA 2IBKA 1JL2A 2YPYA 3CO9A 5GAGU 3QWPA 4K8XA 4O23A 4K41A 1FJGF 3C6HA 1VSIA 3TUPA 3V81B 4H4KC 3B8HA 2Q36A 4E19A 2D3UA 4PRFA 2FHJA 2MLYA 2P9KA 4WCEL 4HUFA 4B9TA 3THPA 4B9SA 3HDSA 3VQQA 1Q16B 3IWXA 5IC6B 2MY7A 3POTB 4FF1A 2DCLA 4LSLA 3CJSA 3KLFB 1KVAA 5KQDA 2CGJA 2C2MB 2RQMA 4LF7J 2W9CB 4RW6B 1RT1B 1LW2A 1WSEA 2W7PA 1CQNA 3W3SA 2E5LF 3FUYA 4LQ3A 3BN7A 1KTQA 3GCXP 3TA1A 2FF3B 4OPHA 4Y0FA 2XTJP 3GP9A 5J2PB 3MMAB 4IOCQ 1RDBA 1RT2A 3SBTA 3GJSB 3TP2A 1NMDA 3AAWB 3FSIA 3RTVA 3MXIA 3IM8A 2R2RA 4Z37A 4B3TJ 1RISA 3ZTOA 1IG8A 2E4LA 2XZWA 3PIPQ 1GEHA 5LSOA 5HAOA 4N8NA 1TFYA 3ELHA 1JB0C 4CBWA 1FW6A 3VEOA 3G10A 1YJ7A 4U8VA 3CJQA 5T7BA 2IJFA 5C25A 5CYQB 2CQ3A 1UFKA 1RTHA 1FESA 4PPZA 3W1YC 1WHWA 4CLLA 4ILJA 1JLBB 1BWVA 4HH0A 1CS4B 3OJUA 2PEHA 4CF8A 1QUPA 2GAGC 4C3LA 1KVIA 1OJ4A 1J5OA 2W1BA 4DU7A 2JLGA 3ET6A 2VFUA 3CJ8A 2BKPA 3IAS9 4CZLA 4FK2A 2W2OP 2J6UA 2JL9A 4USUA 3VESA 4E8UA 3WIVA 3H1VX 1ASUA 5F8NA 1UVMA 4R0EA 5AQWA 2UUAJ 3W0LA 1W2BR 2XMKA 3GIKA 1K9MT 2NUUG 3RAQA 1C6VA 3IO1A 1L3UA 2CJ9A 4MFBA 4K4YA 3L4QA 5AZJB 1Z1ZA 4QOZB 4CIEA 3JS6A 1ZM9A 4CEFA 4CK1A 4IG0B 4C8MA 2X3GA 1VSHA 3OTBA 1FNOA 3OSNA 3KK1A 3D6HB 3CD7A 2RRAA 2ROPA 3CD5A 3K5PA 3OTOK 4DFMA 5IOLA 1FJGJ 3W62A 2JJ4D 4LFCK 3IRXA 1RTIA 4NXMF 1DFDA 4FWNA 2HQIA 3AV9A 4KI4A 4B3SF 1IJEB 2KM8C 2YWEA 1I94K 4RW4B 1RTJB 2JSXA 2ZC4A 1N36K 1DY3A 4X4VA 4M5HA 3VF4A 2V4JA 5J2NB 3GB0A 1JXLA 3RUBL 2Q0UA 2I8EA 1QVFR 2P9NB 3RMCA 5L38A 2QL7B 1ESVA 4OJRA 1PYSB 3CCQN 4KFBB 3J7Z5 1FCAA 1VR6A 3BQ2A 1YVUA 1RWNB 1VSJA 4H4MB 2PE8A 4K0KJ 2GX9A 3D6TB 3HPHA 2JWKA 4M5DB 1S97A 1Q8BA 1DLOB 1WAJA 4DTPA 4L74A 2K3IA 1RB0A 4I68A 1NPPA 4AYBD 1RQ0A 1WN7A 3HM8A 5FPDA 4CTAA 2RPIA 3CCQS 3HHLA 4XDCA 3R5AA 4CIGA 1ULRA 4NA1A 4QR2A 1JCGA 2BUNA 4CO2A 3NMRA 3VN5A 3G87A 5DG9A 1HYSB 1FKPB 3QEXA 3WZ0A 3SUPA 3DRSA 1S0VA 4MLHA 3CI5A 4LF4J 3VZHA 4IBNA 4YB7A 1O51A 3UVJB 3H08A 3MR7A 2H65B 3O3HA 2M70A 3ZC4A 4HEA9 3TSPA 3PY8A 1MLAA 3AVMA 2CJBA 3NCIA 3TR5A 3A8EA 2W2PP 3HOTA 2PY5A 3BH7B 2R7OA 4I7FB 2Q79A 4X66J 1NH8A 4YHHF 3FFIA 3QAEA 2LQ9A 1NHKL 5E3RA 4ZVEA 5IC4B 2UXDK 3PCOB 4PG5A 4DSLA 1R31A 2JC0A 5IZHA 2ZKTA 4ZCIA 1HHQA 2MZSA 4GRSA 2QXFA 2DCUB 2FBYA 5ETRA 3D2EA 4QW9A 4P10A 1C0UB 3R27A 4KBOA 4K4UA 4F4YA 4P9SA 2LEPA 3VPZA 3ZZRA 2A41A 1KOHA 4CYUA 5C5JA 1ACMB 4ALZA 2LSNA 2IYIA 1SQEA 4BWJA 5ETVA 1TV6A 2EI5A 2AWZA 2IM3A 4PXBA 1WSJA 3SDEA 4NXMJ 3TW0A 4PQUA 4O44A 3C94A 1BC6A 2DITA 2OMOA 2WZ1A 1NPKA 4DR6K 1HNWJ 5A0YA 4H8KA 1OSCA 1D9FA 1FXLA 4LF9K 4ZLLA 1NLVA 3DLJA 1FRLA 3R6MA 3EWGA 1RWXB 2HEKA 2XS5A 1FA0A 3MEEB 4DV3F 3T5HA 1LWFB 1NBEB 1JJ2M 1S1TB 4KHPK 5L1KA 2CJKA 4B08A 2O8BB 4OVLA 2BUPA 2I6WA 3A2FA 2RRNA 4PG6A 4RW7A 5L1JA 2CH5A 1PSDA 3C8YA 3J81Y 1NK6A 3P83D 2YWKA 4GV3A 4ER8A 5DM6Q 3GIMA 3HSTB 2YX6A 1SQKA 1KBRA 2RUSA 1S99A 3FZHA 4DL3A 1X4CA 1KVJA 4EO8A 3HF5A 4DSJA 3RSEA 2YNHB 3NF8A 2CNKB 4A8YA 2EWSA 3ZNUA 4C7QA 2D5RA 1FEEA 3AARA 3KYLA 4KGXB 1EJ7L 2X78A 3EGVA 4IR9A 2JVOA 4AHVA 4LF5J 4C8LA 3B6BA 4WWSA 5GMDA 3DLRA 3KWMA 3SCKE 3MAAA 2H48B 2ABYA 2VG6B 5IM0B 3V1QA 2XG8A 5C2DA 5KFXA 4JLHA 2MKSA 3T1HF 4R8UB 1X5SA 4NLYA 3TA2A 1V3ZA 4X62F 4LRBA 3UN2A 1K8KB 3E9LA 1S1UA 4NOHA 3O9UA 1BXNA 2J6SA 3H2UB 5LM7E 1C0MA 1IBKK 4YOXA 2U1AA 1EARA 1B92A 1C0TB 4M5GA 1SV5A 1U02A 4I9LA 3PXGa 1U48A 1N8RT 3J7YP 5HANA 2WVBA 2NRRA 1M90T 4LRCA 5IQQA 3S7RA 3PEJA 4CZGA 3L7UA 1MG7A 5HVHA 3KUEA 2QTWA 3H20A 3LPUA 1LWCA 3KK7A 3J81O 4CJQA 1IQTA 1T3NA 3NXZA 1F9HA 1VSEA 2P51A 1WB9A 4UY8O 3H4BA 1XUPO 1F3FA 5F9NA 5IT4A 2HOEA 3BJYA 4FZVA 4JK8A 1XMQK 1HKAA 1X4GA 3K5NA 3C15B 4OFZA 3OBIA 4CJ5A 1SPBP 5L39A 5DGBA 3MTJA 2GJFA 2KXFA 2FY1A 3PNIA 2QKBA 5CZXA 2I5JB 3ZFVA 3K2YA 5GMKa 3LAKA 9RUBA 4DF4A 2V50A 5CZVA 2DKOB 3I5AA 4WZQA 3MR5A 1VQLN 4ZJLA 2EW9A 3BF1A 3MCAB 2GO8A 3Q2SC 2FVQA 3H98A 4P74A 3LDLA 4I0WA 1X7VA 4JI0F 5AQOA 1YAGA 5FDLA 1NGCA 1ZA2B 3GE9A 3L95X 1HBOB 4BR2A 4TY8B 1LKZA 1T95A 4JI8F 3BBFA 3P45B 1U1QA 1LW0A 2EKYA 3CD6N 2RT3A 1VQLS 2YHWA 1NZAA 2XZDB 3UR3C 2JZ5A 5KFPA 2BEFA 4DL7A 2HBLA 2A40A 5H1SQ 3CO0P 2XWXA 2PFDA 4FJMA 4DR5F 3WNGA 3OUYB 3T3FA 3CD6S 2Y1IA 5D15A 3IS9A 2YV0X 1IG9A 5M1NA 3CJ4A 4HTUA 5DM7L 1AROP 5DDOC 4PXDA 3A5MC 4OPAA 5A8KB 2YKOA 4M5LA 1T05B 4EFHA 4YOEA 4EGLA 5HJXA 4RLEA 3O9RA 3CM5A 3SMPA 2GHVC 1HYZA 4PL8A 2FVRA 4MKYA 3BO4A 2Q1LA 2JGUA 3PIOL 3QPIA 4JRPA 4QYZJ 4FJIA 2UUCK 4OO1J 4NI2A 1I5OB 3M6GA 4E98A 3SLCA 5U47A 2KDOA 5JS1A 3T1HJ 3K7RA 1KD1O 2HZAA 4KHQA 4WCEQ 3C19A 4RUBA 4A8MP 4RR5A 2PDAA 5T41A 4DQRA 4AHSA 3ADAC 1YBTA 3K0SA 1YLXA 3O4WA 3S41A 4LFBK 1R43A 2DB1A 4RBVA 3ZCMA 2VG5B 2YNIA 4ED7A 4RUCA 1HBMA 1HJRA 4X2BA 1HQEA 1RT7B 1BI4A 4NRUA 3NHGA 2A6AA 4B9UA 2XMJA 2FDNA 1JL1A 3HULA 1FRKA 5F8LA 4H0YB 1T02A 3M32B 4LVNP 3CJKB 1EQMA 2WRMA 1CLFA 3H8YA 2FZGB 2HHSA 2WSEC 1VK0A 4WFZA 4FW2A 3QNOA 1RWVB 2DRDA 4BRDA 2NXUA 1F2GA 2NYHA 4URQU 4OPKA 2VG7B 3LGMA 4C8YA 2K8GA 2YBVA 1HNZJ 4IH6A 1P9QC 1X0FA 2QEXN 4Q2LA 3LDSA 3EDRB 3K9KA 5LXYA 1NXIA 1U47A 3IGNA 2WSFC 4PABA 1NDPA 2RF2A 3L2VA 2EBEA 1RBLA 4OLBA 3R7SB 1S79A 2ZE2B 3KDNA 1BIZA 1UAXA 3T5KA 1S6PB 2AYEA 2W9AA 1OQ3A 5K8OA 2YTCA 2QEXS 1VHFA 2DNRA 4LIWA 2EHGA 4AILC 1TL3B 4AQYK 4LSZB 1VQPN 4JV5J 4CT9A 2FQQB 1S9GA 2ZD1A 3EJMA 2P1JA 3FZ2A 1WNSA 2UU9K 3PKMA 4DR5J 4GKKF 4CJFA 1Q18A 5EOYA 4CJRA 2LXUA 4IOAL 3L2RA 1K47A 4YOUA 2A3ZA 1VQPS 5BN8A 5H1SV 3L2QA 3ENWA 5D4PA 2HPUA 4L72B 2E6MA 4RW8B 2XEXA 3MAHA 4MKAA 2D1CA 4CFBA 1ZPWX 4HLBA 2GFFA 1TL5A 5KFDA 3R97A 3LF0A 1XMOJ 4TY9A 5A8WB 3U1NA 4CNYA 1RT6A 5DMRA 1JQGA 2R7WA 2P9PA 3TWHA 1B7YB 1Q81T 3UNYA 3S8SA 5AJ3F 1D3WA 2YXLA 4J9OA 2DNLA 1M0SA 1GLEG 3QMLA 2Z8QA 4X65F 4FPRA 3P49B 1H73A 4DV1K 3MD1A 4LREA 1QDUB 1LW2B 5I3PA 1BGXT 4DV5F 3BP8A 2AJ0A 4FJ7A 2N4DA 2MHEA 2GQCA 4A62A 4ZP6A 1IKVB 1QSYA 2MZTA 5D6GA 2NSBA 4YN3B 2QFIA 4Q44A 4M41A 5KFNA 1T7PA 3FCWA 3OY9A 2AYMA 5K20B 5DDRC 3D1QA 3EZOA 2J0QD 1P6TA 5KFIA 5LSRA 3MPYA 3IAM9 1XNRF 1ASVA 2FTRA 2XMVA 2NREA 3WNFA 4HTLA 3D3CJ 4XIUA 2WUSA 2AJ2A 1GK8A 1WF2A 3AA8A 2JX2A 2AMCB 1AFJA 4ZVGA 5L1LA 1S7IA 3UCZP 3O5BA 2M9KA 2LVWA 4RU9A 2D0BA 2Z1GA 4ISGA 4X4UA 2J8AA 2ZEJA 4DPUA 5C25B 2AW0A 3ZSOA 4Y1CA 5AQFA 1RSCA 4V19S 1Q1KA 4XK8C 4ES3A 3HMJG 4IKFA 2CVIA 2IHR1 3TRGA 1ATRA 3TTFA 2A1SA 1UETA 2ZHAA 1S10A 1L3TA 2V9WA 1IO2A 2WONA 4G9ZA 3THTA 5CY4A 3TAEA 5F9LA 4RWXA 1KS2A 5ETMA 1CC7A 3H1QA 2B4OA 3H5UA 3TJ8A 1FDDA 2FSJA 5J2MA 2BJ3A 3ET6B 2HMIA 3VTIA 2FBVA 4E1MA 5CYJA 3NF6A 1D8ZA 4CLKA 4ZP9A 4CLZA 2KJWA 2DNYA 2F96A 4BACA 3TEGA 4BR5A 2V7YA 5GAHP 3TARA 4H0TB 3ID8A 1BWFO 3O8WA 1N5YA 4Y65A 3CCVN 1H7XA 1RBOB 3ULDA 4B3RF 2MY8A 4J2BA 5F3TA 3MCPA 4MFBB 2IM0A 2AJQA 1F5BA 1VIXA 4HUGA 4DG1A 2UXCF 3V9XA 1U1RA 4FBUA 3WXLA 2KJVA 1HBNA 5KGWA 2HHWA 2QA1A 4YY3K 4DBQA 2F9JA 3G2XA 3ZETA 2IDOA 4YMEA 3CCVS 2DIUA 1HPMA 1RJJA 3U27A 1U0SA 5ETTA 4FF2A 4FJNA 1P8ZA 3J80U 3LA0A 4F3QA 3OFHA 4WXWA 4CO3A 4PCQA 5AJ3J 1AFIA 4ZPAA 4G6VB 1R0CB 3VQSA 4GY2B 4HHJA 1U2VA 3W9IA 2V4JB 2K2PA 3DGPA 1HBUB 4HCCA 3NGSA 3G9CA 4RU2A 3AFGA 1SUQA 1NJZA 3VAJA 4DV5J 3ILLA 4XPEA 2VJVA 1KFDA 2NZ4A 3DLKA 1UEUA 3R1LA 2P9UA 4H5TA 4P52A 4KV8B 3AAPA 4W5TA 2PAVA 2HRUA 1VISA 1JCEA 5KG1A 4NEZA 2V63A 2KHDA 1RNHA 3QZ7A 1PO6A 2OJ3A 5HRPA 3ZT2A 2C3OA 3HHLB 1RYSA 3MR2A 3OL6A 4KKOA 2JHEA 1Q8KA 1H74A 2IDEA 1HI1A 3OA9A 2G4BA 3MX2A 3MEGB 4ILLA 4WFXA 2MLZA 5KFVA 3TUZC 3DRSB 1NGDA 1ATSA 4LFAF 4BWMA 2GMHA 1A5VA 3DRPA 2EXUA 1TKZA 2MQMA 3CE8A 4AXJA 1ZAVA 2HHHF 1WLJA 4ANEA 3R1XA 2UZAA 2XMMA 3T69A 3VQ9A 4FYYB 2X1BA 2B8QA 5BR8F 4CEAA 5AXMA 4ED1A 2VCPA 3FEYB 3AD7C 1YRXA 2KXHA 2DHXA 2KKZA 1E6YB 4K59A 3K0JA 1S6UA 1HRHA 3ZTQA 1IBLJ 3R5BA 2LKZA 4YB5A 4R0JA 3FFIB 3D2WA 3A8IA 1SCJB 4LRFA 2NXNA 2JNJA 2QK9A 1RHMB 1KVKA 4TLRA 3N79A 1TUWA 2CKWA 1M5VC 4LRAA 5EWGA 3FBEA 2GV9A 1L3SA 2VIHA 2HB5A 3C6UA 1UPPA 1Y00A 1TKTA 1JLFA 4JI3F 2ZF5O 4NLQA 3D2EB 3BZCA 3I6PA 1IR2A 2D3O1 1QSSA 4FJHA 2RE1A 1EKEA 2AA4A 1N33K 2UXBK 2GELA 1D9DA 2W9BB 1AB8A 1S1VA 2UXCJ 3GYNA 4OX6A 3SPYA 4CYUB 3C14A 3SQGA 1NNDA 1C4CA 2XLKA 1FDAA 3DXKA 2RD5C 5M2UA 2WFBA 3V4IA 3BSOA 1I51B 5JS2A 3QEWA 4N47A 4NLRA 4PQUB 4O44B 2KFZA 4QBUA 4IJAA 2I7PA 1SJRA 1KFSA 2L9WA 5A0YB 3GILA 4NLOA 1FDBA 1GH8A 5ITHA 1YJ9N 1VRQC 3AD8C 4JI6J 1W0HA 2PEBA 5C15A 3EVOA 2CH6A 3TX0A 3M2UA 4WE1A 1CC8A 2AZ3A 1UCNA 3C46A 3CJ3A 3AXMA 4Z4CA 1TUYA 1R3NA 1NZ8A 2BJ1A 4DCOB 4OHXA 4F4WA 1YJ9S 4CZHA 2KKHA 2OA8A 1RBUA 5L1IA 1WDDA 4UY8T 1P90A 4O0IA 4WFYA 3AVNA 2JH3A 3D1HA 5AQRA 4MIWA 2R7VA 1Q0NA 3VQ5A 3RSEB 2H5IB 1KCFA 4LBHA 1R7IA 3PX6A 4BRLA 3DC2A 4C9DA 4URGA 3AY0A 3DU6A 1CG2A 4CFDA 2P9CA 4R79A 2HHHJ 1APSA 2QT7A 3CJCA 4PYAA 4FWPA 1LOUA 3CJRA 3W5XA 1SL2A 3DKDA 2HG4A 3PIOQ 3K58A 5AQSA 3IXQA 5F8HA 3QIDA 3F9KA 2YQ1A 3UW1A 3PW0A 1EWRA 1FKOA 2CRLA 5AE3A 3M1VA 3H0PA 3UD3P 3CYMA 3N5FA 3BQ0A 4UUXA 4I6MA 3ZO7A 4ID1A 4JP8A 2VC0A 3JSMA 2LQJA 5EU7A 3TZYA 4OX8A 1WEZA 4ZJOA 4K4WA 2GA7A 2HS4A 3VGLA 3VAMA 2QSWA 4JD2A 4ZHRB 2EC0A 2P2CB 3KMQA 1DEJA 4CZMA 4WKYA 5KFUA 3EGWB 4PR6A 2JFDA 3AT1B 1TL4A 5HJYA 3G6EN 4IOBA 3MM6A 4CZIA 3M1FA 3SEOA 2MZRA 3FFKB 3GONA 3UDCA 4DOZA 2B7BB 2DRAA 4GVMA 3VEXA 3JSRA 3GDQA 1LWCB 3KLIA 2V2VA 1V5IB 4BY9C 4Z4FA 4OJ3A 1IV0A 2RRBA 1FJCA 2E5IA 3G6ES 1R0AA 2VODA 4E7KA 2DR9A 2VWBA 4P7VA 2EX3A 1SJ3P 3PTWA 2K06A 4BCAA 1X4AA 4F3MA 2AQ4A 2BACA 3FGVA 4K50A 2RHKA 5KFBA 2IY5B 3LGNA 3THXB 2Q43A 2OZSA 2CIMA 4YY3F 3RRKA 2MSTA 3NBPB 1XNQJ 4PWWA 4R5PB 1WELA 1RGIA 2XI3A 5LL6d 3IFRA 4AL6A 4FWSA 2MKYA 4FBTA 3AJDA 3W9JA 1LW0B 1RDCA 4FXVA 4OV6A 1G2EA 5B0BA 3NMAA 4ECRA 1SKWA 1X9JA 2UVRA 2V5HG 4NLSA 4N8OA 4PKDB 2XQCA 4JI7J 3GFYA 3CM6A 4FDFA 3J7A1 5ETKA 4NLWA 1TK0A 4GKJK 3IS9B 1EP4B 3QAUA 3DYAA 1ZC6A 1NO8A 4IOAQ 4Y1DA 5C42A 3GFHA 3DOLA 2VONA 1ZAWA 4J91A 2O8FA 2GMLA 4DUYF 2WVCA 1WG4A 4HWIA 3QFHA 1UMJA 5FJ4A 1YX2A 3VQCA 2QYCA 1IBCB 2BBEA 3DJCA 4JBCA 1S57A 2XM3A 2HHUA 2HSEB 4CNZA 4DPWA 4NI2B 2VBZA 3OVSA 2QN6B 4F4KA 3P31A 2VKRA 2X74A 3F0NA 5KFEA 3ILOA 2LXIA 4I2PA 2OSRA 2V67A 1SB6A 4WTYA 3WQPA 5GAEP 1SVDA 2BKOA 2RU3A 4AL5A 1XC3A 4K4ZA 1CPZA 3T1AA 3FZKA 5KT3A 5IS2A 3VF2A 1SBRA 2HAFA 1HQUA 3I87A 2YNIB 3UB5A 2MLXA 2KU7A 3J7ZO 2DNNA 2DK2A 1HQEB 5DDPC 4X4TA 1BI4B 5B08A 3QFPA 1DZ5A 3MEKA 2HS3A 1E4GT 4BRNA 4BG8A 3BO3A 4P71A 4OI1A 1D1UA 4ZIWA 3RAXA 3M2VA 2V8DA 2YWFA 2YNGA 1FVQA 1Z05A 5F8IA 4P2SA 4F0MA 2QRRA 3JSBA 3UWTA 4MDAA 1HR0K 2E9RX 5KPZA 1RHJB 2W42A 4RBTA 5KG6A 4J9SA 3M6WA 3ZZZA 4ID8A 1BQNA 4K43A 3TNVA 5I42A 4ECXA 3G82A 2VUGA 3QZ8A 3AVHA 2HF3A 2RF2B 2OD4A 1U2FA 5JLFA 4RW9A 2D7SA 5DJBA 4LC9B 2E88A 2OKQA 4X4NA 2E2PA 2CQ1A 4A8KA 3AB4B 3TR8A 4NASA 3V4MA 3JXUA 4JKEA 2ZVIA 1NGIA 2FJEB 1GAOA 4G3IA 3VEZA 3ALYA 3PRVA 5KFTA 1HMVA 3QNWB 2AF6A 2BR0A 2BW2A 1SC4B 1B9FA 4P7TA 2ZD1B 2BABA 1CZAN 1B4SA 2G8FA 3AJ1A 2ASYA 3N4QA 1UW9A 1F9EB 5EN1A 3G25A 5SUHA 4HH1A 2QMUB 3RRHA 1S5JA 3BSCA 2QLBB 4KI6A 3FBCA 1I3AA 2LCWA 3P5JA 1NSQA 4ZOSA 4Q45A 1WOSA 2HBMA 1BD6A 3PDNA 2B5JA 4JKHA 3QQCD 4CLYA 4ICLB 1KLMA 1YHQN 4P2MA 3KK2A 5M1OA 1VRTA 3BGRA 3KK3B 1BL3A 4BR0A 1TL1A 2DGSA 1RWOB 1H2TZ 3CW2C 1FWKA 1Y10A 3MOJB 3PO4A 1RT6B 4KB1A 1LCUA 2DR5A 3OYKA 1RGVA 1FRJA 2P9PB 3EE8A 1WG5A 1QM9A 2CPDA 1OQ6A 3VWSA 3VVUA 1YHQS 1S0OA 3OVAA 3CJ5A 1GMWA 4CJUA 4DUZF 3SJJA 2DY4A 4FPBA 5B0AA 3NWRA 2DR7A 3RBZA 3UD5A 3V9ZA 1LAWA 1MU2A 4BRMA 4Y28C 3T41A 2GJ2A 3PLAA 1VI7A 2KVIA 5K14A 1U1KA 3UD4P 4WXOA 2WTUA 3I32A 2JRSA 4JKGA 1XEZA 4O3PA 2QE5A 5KT2A 5HROA 1R89A 4LD0A 5KQ8A 4GVLA 4CJSA 3LP3A 3ZSVA 4QU6A 2A42A 1Q5VA 1G3OA 4CW7B 2WOMA 1IH7A 3DLGB 3RR8A 4M63A 4BS2A 3SUOA 4YP3A 3SK3A 2BYCA 2HRYA 3M4XA 4DQPA 1HLWA 5D4OA 1G15A 2GS8A 3OT9A 1YBUA 3TTDA 4X4RA 1NH7A 4LH4A 3KJNB 1NKEA 4ZVUB 2QV6A 3KKRA 2GJIA 4C8NA 3FRYA 2RUGA 4F8RA 4MTPA 2ZDOA 3DM2A 1EQ0A 2P9EA 3R9PA 4WBFA 1S77D 4LF6K 3VAFA 2W7AA 4KE5A 5IT9U 3Q8RB 3KG0A 1TVRA 1VMBA 2FHJD 2KB2A 5IFMA 3S9HA 2WONB 4KIAA 3IC1A 1MN9A 4OLOA 2QX0A 2HBQB 3OXFA 4UQGA 1NLKL 1S9EB 5HQLA 1X1PA 2OFGX 1YJRA 4B17A 2PYJA 4KGMA 1VQ4N 1FXDA 4GO7X 1K0TA 2WW8A 2HMIB 4K5SA 2MQLA 4TNOA 4CJWA 4CHQA 5BYSA 3TAMA 1Y64A 2AZ1A 1NGGA 4ZN1A 2ZH1A 2HBYB 4CH0S 1ITGA 4DTSA 3BUZB 2V8GA 4KGVB 2IBOA 3LO3A 4CBUA 5K8MA 4M42A 1VQ4S 2N4CA 4DLEA 1SI9A 1UVIA 4C48A 2IGIA 1XK8A 4ES2A 4DR7F 3OXLA 5HVFA 3V6DA 2RE2A 4CJKA 3CMEN 4ECWA 1UA1A 2CPIA 1I94J 4WK3A 1K8AO 3HFZB 2CNLB 1OKJA 1N36J 1BWEA 2J7UA 3ZETB 5D4NA 1R6YA 3PHTA 3BEGB 2OANA 5BPNA 3ZZUA 3EE3A 4JS4A 3LP2B 1X3NA 3FZMA 5TKYA 3H2VE 1BIUA 3CMES 4FJXA 1C1BA 1FERA 4JI5F 3CCJN 3OR1B 3O2IA 3LDQA 4ZVOB 3HKZD 4IRDA 4Q43A 4K4SA 1Q79A 4ZJQA 4QR0A 1WD6A 1NUEA 5DGAA 4DV4F 2YX4A 2QWQA 3OR2A 2Q66A 3DLKB 3J7YI 3VVTA 5ADZA 2QYGA 1VQ7N 2GWKA 3V81A 4LF8F 5SWMA 1RHUB 2IRXA 2P9UB 2E66A 3Q86A 1SH0A 1VSLA 3CCJS 4Q0BA 1FFSB 4CM0A 2ZM6F 5BN9A 3NVKA 2QO3A 3F56A 4Z7CA 2WC9A 4FJJA 2AEJA 5KFHA 5DLFA 3CQ8A 1XHXA 3L3UA 1B0VA 4Y0WA 4FYXB 1VQ7S 2W9CA 4RW6A 4QWDA 1ZZFA 1RT1A 2CQ4A 2IRYA 1WSRA 3QYYA 2CA9A 2XZTB 4X64J 3WHIA 2AIRB 1TK8A 4QIFA 1NJIT 5J2PA 4RNFA 3MMAA 4KHMA 3J7AN 1FFGB 2KQ2A 2MEWA 1IM6A 3VQBA 2VOPA 4LIRA 2J9DE 1AW0A 1KONA 1EB0A 2G0CA 3VV2B 1SKSA 3KKFA 4UY85 3HRGA 3SSQA 3BBCA 2LDIA 5IV3A 5JUMA 5KFAA 3HJFA 2V69A 2IMOA 1CJTB 1GTEA 4OPJA 1JWWA 2YCHA 3FBFA 1OY9A 1YQHA 4Y6IA 3NNHA 2UXDJ 3ZZPA 4K4XA 3AVKA 3WXIA 1NAQA 3LW5C 4WYBA 1R8BA 5CYQA 4IO9L 4O8KA 3EX7B 4K2JA 4EHUA 2G0IA 1B3TA 2IIHA 4J2AA 3MMBA 2P9IB 1KHWA 4I69A 1VBXA 1RAOA 4ZITA 1H6KX 3J7AP 4XH4A 1JLBA 3JQKA 1TKTB 1CS4A 4DV7F 1YJTA 1DTQB 5DZ6A 5HQMA 3THVA 3BDPA 2RMLA 2GUIA 1IR0A 5KFQA 1M1HA 3HHLD 1UEKA 1OH7A 1KP6A 3ISZA 4K2XA 4CO4A 4FK4A 1S1VB 1L3KA 4N7TA 3O9QA 2G2ZA 4CE9A 3SQGB 3K89A 2V0NA 4FS1A 2XI2A 3Q7CA 4DHYA 3DXKB 4A59A 1YZ6A 2QA4N 3V4IB 3HZGA 2L08A 3RBEA 4JV0A 4MO4A 4L3KA 4B9QA 4LF9J 4CJVA 4ZCMA 1PKUA 2BRLA 1S4FA 3G0ZA 3ILJA 5CCLA 3J7YU 1FRIA 1C1AA 4DV0J 5AZJA 3M5RA 3O6WA 3M6UA 5B0DA 2HHPA 1EWQA 2DIVA 1IBMK 3BGFA 2QA4S 4OX9K 4IG0A 4CESA 2V94A 2ZQBA 5D0GA 2F7TA 2M3DA 1M1KT 1VQ6N 2X1GA 5HO4A 3KWIA 4TYBA 4Y34A 3M8RA 4CLPA 1UA0A 4QAGA 1PILA 3OBWA 2CADA 4IOXA 4B3MF 4JV1A 4JKCA 4RW4A 2CFXA 4CEDA 1KC8T 2ZM6J 1RTJA 2KT2A 3ZX2A 2NZCA 3CDBA 2DFHA 3OYGA 2ASJA 2DGXA 3CJ1A 5AQZA 1VQ6S 4UOFA 3MXJA 5ETSA 2P9NA 3CJBA 2LYVA 4E1JA 3I8DA 3QWUA 4HACB 2RVJA 5LMNF 3NH2A 3N6LA 4YORA 1OH5A 4NLPA 3TO8A 1HWKA 3MPDA 4DV2F 1A5WA 3H40A 3MF5A 3CTRA 1Y0HA 2P5OA 3O9SA 4M3TA 2AEMA 3H6EA 1ICEB 5H9EK 2FSNA 4ZKAA 1YGYA 4ES1A 3F2KA 2O3DA 1RK8A 4A4JA 3NG8A 3PIPL 3CMAN 3O5TB 2QLWA 4CWBA 4G1IA 1MWKA 2Q1NA 1H7WA 5KG7A 1HYSA 1PGZA 1NK5A 3KUHA 1FKOB 1I39A 1S9FA 1FKPA 2AGPA 4F2RA 3MURP 2XHBA 2YQ0A 4CP5A 4USIA 1T44A 4USHA 3I0SB 2LQBA 1K9MO 4J9LA 4JI4K 4ZPVR 3CMAS 1ZBHA 3C2PA 2HFUA 4ZVQB 3GR0A 2MPUA 4DR3K 1R8CA 1MMLA 1YJUA 3CPEA 2W2NP 4DN9A 1FFWB 3P5TL 1WHVA 1RWPB 3I9ZA 1D09B 3TX8A 4JK7A 1YRTA 3GYGA 1HHSA 3AO5A 4WQ5A 1GTHA 1N34F 1XMQJ 4DR4F 2BVZA 2DPJA 3U1MA 5LJVA 3OYFA 1TMMA 2OPPB 3DXMB 2CQCA 3I8BA 3MMJA 4B3TK 1K73O 1JLQA 3R5JB 3D28A 4I64A 3ULEA 2IVNA 1NGFA 3T19A 3QRPA 3UFCX 3TAQA 3KD5E 5C10A 2ZHOA 5CD4H 4KPYA 2CUYA 3KMSA 4FM2A 3A3PB 3OL8A 3NY0A 1JX4A 1C0UA 1VQ8N 1M5KC 2MB0B 2MDAA 3SIPB 3A5OC 1MN7A 1RTDB 3SI8A 2XMUA 5EXWA 4JHDB 1VQ8S 4DR1F 1LV5A 1DRZA 1SQGA 2C3UA 4KT0C 3PRDA 2XO7A 4J9MA 2MQQA 1VQSA 3RMDA 5LMUF 3T6BA 3JAMU 4DQIA 4NLCA 4DFPA 3PG9A 4ZTJA 4CJTA 3TA0A 2L41A 4EFAC 5LMNJ 1CBKA 5AXLA 3AA4A 2VL1A 1QVGR 1GXUA 2WB1D 5E7OB 1GMUA 1Y7PA 4FVCA 3U02A 3R5GA 1V4SA 4HL9A 4CGFA 3MEEA 2VQEF 3SAHA 4HT5A 4DPXA 1S1TA 3BEXA 2M8DB 4KH5A 4DR2K 3DOLB 2W8KA 3PX4A 1KKHA 2H51B 2UUCJ 5F8JA 4OQJA 5EGYA 2B9WA 4EMDA 5AZIA 2H4WB 2V2ZA 3HHNB 2ZWPA 2Z1HA 3NCRA 2R4FA 4CJPA 3QGHA 2Z2YB 2O8CA 1OO0B 4AM6A 2NRZA 3BBBA 1EX8A 4ID5B 4NCAA 1VBKA 2O4GA 4FM1A 2NRVA 1FJGK 1TMJA 1QE1A 2EG1A 2Q6CA 3BV8A 3ITHA 2YNHA 3WX4A 3W66A 4LFBJ 3AD9C 1JJ4A 4NYZA 1Y3JA 5JVGQ 2F40A 1C0GA 3QDKA 1WSFA 4G65A 3NP5A 3A13A 1B0TA 3DMJB 4G1QA 2OTLN 3JXOA 3UN5A 2KRRA 4KH4A 4X84A 3GG0A 2NLWA 3B6PA 4JB8B 2VG6A 4YR3A 4ILMA 2GV1A 5IM0A 4DPYA 3NCQA 2E5LK 5HN0A 5J1PA 2MZQA 1LOTB 3QT5A 3VAGA 2HZVA 4ZA1A 1W26A 3CCRN 1WEXA 2OTLS 3ZYYX 5BRHA 1N34J 2E44A 2EC2A 3KJFB 4WP3A 4MIAA 1UP1A 5D78A 1CULB 1H72C 1C0TA 4OZLA 1X3MA 1OVQA 2UUBF 4CDIA 3CCRS 1EETB 5HBMB 4AH9A 1TU0B 1CJUA 1Q4RA 4XPCA 3UDVA 3J8AA 2DFFA 3ENOA 3GJTB 3CCEN 2BMBA 1UJ4A 3PEHA 4DQ8A 3FK4A 1KQFB 2CPXA 3G82B 3M3ZA 1W2IA 2AJFE 4FPAA 4AQYJ 3ZX0A 4JUZA 1H98A 5H9FK 4DR1J 2BJ8A 4E7JA 3FMWA 4NZ7A 1QAJA 5KPRA 5I3UB 1VLYA 3CCES 5E0OA 1WSHA 2DVIA 4DCPB 4FWKA 5FLXO 1YBAA 4DSIA 3QGGA 2JWLA 5E3AA 1NG9A 2CWKA 4KGZB 2Q97A 1X5OA 3Q0AA 1U09A 3MCOA 1SJ1A 1DJ0A 2U2FA 4DF8A 4J9PA 3IGVA 3E3XA 3H5XA 1RDAA 1SL1A 4MK9A 1UW4A 8RUCA 1JK9B 3KK2B 1VRTB 3PW7A 5K9FA 2HNDA 2VC1A 4IR1A 1TL1B 1VS3A 3CB4A 7FD1A 3Q2TC 4YS2A 3PVXA 2NRHA 4KAZA 2UUTA 5FRMA 1RFQA 2E5GA 1RAJA 2X3DA 2HLUA 5A2QY 3HD1A 4WFAL 3VGTA 4NXMK 2ZBRA 1EKSA 5HQ8A 5LJ5Y 4B3SK 4L8RB 2WCXA 2OEKA 2P6TA 1M90O 3E66A 4DX5A 1RKJA 2IVFB 2K1RB 4URSA 4NB4A 5A8KA 5DRKA 1T05A 2XGQA 4BRFA 2AYBA 3K5LA 5KRSA 4WQ4A 2OAUA 2YHYA 2DNKA 3OLBA 2P9SB 5K14B