4PQUA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase, hydrolase/dna/rna
total genus 146
structure length 545
sequence length 545
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pquA05
3QNOA 5F8JA 2J6TA 3TAEA 2YV0X 3I5AA 3BGRA 1BHLA 3RMDA 3GV8B 4CEQA 2FVRA 2GC8A 2IM1A 4F4XA 1JKHB 4FJLA 2VG6B 2YKMA 1C1AA 4JRQA 4O44B 2P1JA 1RT7A 2OPQA 4FK0A 4DL2A 2BQRA 1T03B 3SPYA 4G1QB 4EBCA 3JYTA 2QKKA 4NCAA 4M3UA 3H4DA 3H5XA 1RAJA 3AA2A 5KFPA 4FCYA 4FLVA 2P5GA 1RT3B 3L3UA 4O3PA 3SI8A 3ZSXA 1U49A 4DQRA 2Y1JA 3AVIA 5I42A 4HKQA 2DFFA 4ZVHA 3OS0A 4CHZA 1TL3B 5DGAA 2AU0A 3SYZA 4IRCA 3TAPA 3PW5A 4HCCA 4ZVGA 4FK2A 3H5UA 1XC9A 4AHUA 4I2PB 5C24B 3DOKB 2I1RA 1KVBA 5KGWA 2F8EX 4JS4A 1KFDA 3K5LA 2W9BA 2ITGA 1HYSB 2KTQA 2HHQA 1R0AA 3MAQA 3HO1A 3PJWA 2W7PA 4LSLB 2XHBA 3IGVA 4TSXA 3D0PA 2IDOA 1HNVA 3WNEA 4I2PA 5C24A 1UWBA 1VRTA 2JC0A 4FS2A 3HM9A 1D0EA 1A5XA 4KO0A 1RTHA 2KW4A 3WNHA 2E9ZA 2I5JB 3O4NA 2FC0A 4TN2A 4O4RA 3CFRA 2D41A 4IRKA 3HPOA 4DQIA 2JGUA 4F8RA 3V4IB 3QINA 2B6AA 1S1XA 3V9SA 4TYAA 3VQEA 1TKTA 1NJXA 3DM2A 2XCAA 1I6JA 5L1IA 3I5BA 4OJRA 4W5OA 2ETJA 4MIAA 3D28A 3DLEA 1JLFB 5DG9A 4DTPA 1A5WA 4KAZA 5KFCA 2KZMA 2IJFA 4EO6A 4DTMA 3AVMA 4IFVB 3NHGA 4YMEA 2JEIA 3CG7A 3AV9A 3NL0A 3SQ4A 3C6TA 4CJWA 1FKPB 1Z25A 1HQEA 1RT5A 4RUCA 1WSIA 4WE1B 2ZE2A 4J9OA 4OPJA 1RTJA 5HROB 2AGOA 1JL2A 3VQCA 4ZVFA 4HTUA 3AVHA 4FVMA 1SL2A 3EPIA 3AA5X 3RR8A 5KG1A 3H4BA 2J6UA 4KB7A 4NLPA 3LP0A 4KFBB 3OYJA 4NCGB 2V4QA 4AHSA 3MR6A 3NF9A 5KG3A 4YFUA 1N5YA 3HJFA 4J9MA 5KFZA 3D5MA 2R8IA 1KVCA 4EP5A 1RBSA 3ZT3A 4ICLA 2FLLA 4DTSA 3QLHA 3QETA 3H98A 2PZSA 4E89A 5KFRA 3LP2A 4NRUA 1QAJA 4KFBA 2VG5B 3TVKA 3HVAA 1WSHA 4O3QA 2WRMA 2FBYA 3GV5B 4Y34A 1N56A 5HRSA 2P5OA 1IO2A 1C1BA 1RTIA 5KFVA 4CGHA 3TAFA 2A1SA 2D5RA 3Q8QB 3A2FA 4I9LA 4ECYA 3ITHA 2IGIA 3SUQA 1S6QB 1SKSA 2D3ZA 5KFQA 4MQ3A 1XR5A 4XIUA 5HRRA 4DF4A 1WSJA 4ID1A 4AILC 3DDKA 4NLTA 1WAFA 4M3TA 3E01A 3ZSQA 5JS1A 3IGNA 4HCBA 3NDKA 1B92A 3PR5B 1C0UA 3KMQA 4B9TA 4PY5A 4ZMMA 2JEFA 1QHTA 4LQ9A 5KFLA 4FM2A 3HVRA 3DMJB 4JS5A 2WB4A 4FJ5A 3K59A 3T5HA 3NF8A 1TVRB 2HNZB 3SFGA 4CEBA 1JX4A 5HLFB 1JIHA 4TY8A 3IG1B 4F2SA 1JLQB 3DI6A 4DFJA 4Q0BA 1J5OA 3DRPA 3NH2A 4O55A 2OA8A 3RRGA 1L3SA 3DMJA 5CYQA 3ISNC 1QAIA 4KB1A 2KZZA 3V6JA 3ZSYA 2IMWP 4N56A 5KFNA 5HRPA 1EETB 3V81B 1I39A 1RDBA 3CJ4A 1T05B 3OYFA 2PYLA 3OL7A 2WOMB 4W5RA 2HHTA 1BL3A 2ZD1A 3AVBA 4FM0A 4IKAA 5L1KA 1MMLA 3T5LA 3ZT2A 1WSEA 3CDUA 4DQSA 4CJKA 4W5NA 1BCMA 3L3VA 3IN5A 4NLRA 1KLMA 3CO9A 2GUIA 4YR3A 4KI4A 3VQ5A 3U3YA 4ECXA 4MKBA 2FJWA 4DTJA 5KFGA 3UPFA 4B3OA 2XC9A 4CECA 3GIJA 3SUPA 3SUOA 3RAQA 3ICLA 4CJEA 1L3VA 2JEJA 3PVXA 3ZSZA 4L8RB 4K4WA 3IS9B 2HNYB 4RW8A 3KJVB 5KFMA 4DL7A 3AA4A 4ED0A 3MF5A 3NGDA 2GIRA 4IH5A 3BSNA 2C28A 5KGXA 3E51A 4JV2A 4OKEA 3MEDB 1X1PA 3H5YA 3VQ9A 1BGXT 2HW3A 4O3OA 4ECVA 3I0SA 4RW4A 4YP3A 1NOZA 4KHQA 4DU1A 4ZP8A 1RT6B 1LW2B 3DLHA 3OYIA 4TY9A 5KFUA 2HNDB 1QE1B 3H08A 5KG2A 2WONB 1YVUA 4M95A 4Q8FA 3SPZA 2XRIA 1C6VA 4RW9B 2OH2A 1KVAA 2OPSB 3KK3B 4Z4FA 5C42B 1RT6A 4F4YA 5KT5A 1ITGA 1CSJA 1N4LA 1NKCA 4CJLA 1TKZA 4Q45A 1SV5B 4HYKA 3OY9A 4GC6A 4CJUA 3F73A 4FJHA 3HPHA 2IOCA 1D8YA 4KHRA 4N41A 4XO0A 2AX1A 1N6QB 4FJ7A 4M3RA 4LQ3A 3ISND 4NLDA 4GMJB 4OKKA 1XHZA 5E41A 4ED8A 4KBIA 4OLAA 4CF9A 1WSFA 1JLGB 3QIPB 1Z4UA 4F2RA 5K14A 4FZYA 2BE2A 4RUAA 3N6LA 3MFIA 2XI2A 2G8FA 2FJVA 4FZZA 4GW6A 1VSMA 3N6NA 3TAMA 4I9QA 5F8NA 3LDSA 4CHNA 2G8KA 2OZSA 3Q8PB 4ECWA 2F96A 3QIPA 1NHVA 4CJTA 4Z4GA 4FLZA 4K4XA 2X74A 4E7JA 3AVJA 4J2DA 1S1UB 3KLIB 3T5JA 2O4IA 1EXQA 3HVWA 1NJWA 4NLQA 1T8EA 2IM0A 4CEEA 3L2RA 4CGDA 4TQSA 5EDWA 4NLSA 1LWCB 4MFBB 1RDRA 4CF2A 4DTUA 1FKOA 2HWIA 3H2LA 3Q8RB 2OPPA 4CJQA 3DRRA 3VQ7A 3VQSA 4M3WA 1S0NA 3M8QA 3KTQA 3M8PA 4FW2A 4WFZA 1JLEB 1S6PB 1Q8IA 5HP1A 2IC3A 3G10A 1X9MA 2OZMA 3QGHA 2UVUA 2C2RA 1VSHA 2XY6A 5F8GA 3NCIA 1D1UA 4KHUA 2Z1JA 4J2BA 4CEOA 3CFPA 1RT4A 2GIQA 1HNIB 4PWDA 3I0RA 2WCXA 2B4JA 3OYKA 1NK6A 4DU3A 4BE0A 3NGYA 3DYAA 4C8KA 4IG3A 2G8WA 4CF0A 2V4RA 3HK2A 1TQLA 5L9XA 4U7CA 3PO5A 4R5PA 3NBPB 3OL6A 1JLBB 1DTQA 3TQ1A 3ZCMA 1VK0A 3ZT1A 1SH2A 4OKJA 1IKWA 1FK9B 1K6YA 3FQKA 2YNIB 3MR3A 1HJRA 2E4LA 4I2QA 3DLGB 4MK8A 4RNFA 1YTAA 3AO3A 5KI6A 1S1TA 4DFPA 4WYWA 3ASMA 1CLQA 1RYRA 4RW7A 1BI4A 3V1OA 5DK5A 1IKXA 3NH0A 1QSSA 5I3UB 3C6UA 1TK0A 2HVIA 2AX0A 2UVVA 4ZHRB 1MU2A 3UIQA 4FLTA 3V9UA 2BRKA 4CERA 3V9XA 1S1VB 4BE1A 3TANA 2B5JA 1ZBLA 3I5CA 4Z4EA 1SUQA 2HWHA 3BGRB 4KB0A 1ZBIA 4CJPA 4CFBA 4O3NA 4CHQA 5KG5A 2YKMB 4Z4HA 1IKVA 1RT7B 2OPQB 4CESA 5JXSA 3RTVA 5J1EA 3P5JA 4ED3A 1GX5A 2XGQA 3HP9A 4LH4A 4H4OB 3K57A 4ZPDA 2X6SA 1L3UA 2AJQA 3JYTB 4LSNA 1C1CA 1ZETA 3V9WA 2C2DA 3SQ2A 3OS1A 4B8CA 3O3HA 3V6HA 1FXXA 5KFOA 4M3YA 3OS2A 2IS3A 4F50A 5I42B 4H4OA 3DLRA 3QYYA 4ZP7A 4ED7A 2HMIA 3HPGA 3O3GA 3O3FA 4IG0A 5T14A 3HYFA 1UAXA 4CJ4A 3BJYA 3ULDA 3RMBA 1LWEA 2ASJA 4ZTFA 5KG6A 2B43A 3RB6A 4FJNA 3G6VA 4O4GA 3QO9A 2W9BB 4NLVA 3DRSA 1R0AB 1KSPA 1QSLA 1IH7A 1QQCA 1HNVB 4IR1A 2W9CA 1UWBB 1VRTB 4IQXA 4F3TA 4KO0B 1RTHB 4J9LA 2FVQA 3FDSA 2Z1HA 4C8NA 4FJGA 2IAJA 4F4ZA 4IKFA 4FJ8A 4RW6A 5DQIA 3AVLA 3QERA 4MIBA 4OLBA 2B6AB 4KHYA 1S1XB 4NCBA 4B9SA 4CE9A 1SH3A 3CQ8A 3VN5A 1TKTB 3DM2B 1S9EA 1U09A 3QZ8A 1G15A 1ASWA 3AO2A 3DLEB 1ZTTA 3HXMA 2YNHA 1B9DA 1HQUA 4R8UA 3QEWA 1SL1A 1RTDA 2V0NA 3ZT4A 2W7OA 4DSKA 3SFUA 3MR5A 4URQU 4CCHA 1S9GA 4Z4IA 4BWMA 4U6PA 3C6TB 1HQEB 1RT5B 3LWMA 4IRDA 3QEXA 2ZE2B 1RILA 4FJ9A 1RTJB 1JL1A 4KHWA 1CXQA 3PY8A 4F4WA 4PQUA 3OLBA 1KLNA 2BDPA 4CGGA 4AHVA 4CJRA 1UA1A 3H40A 1VRUA 4QOZB 2YNGA 3PO4A 3WNFA 2RKIA 3RR7A 3LP0B 4M3ZA 1BIUA 1Y97A 1RA6A 2O5DA 3KLHA 1N5YB 3H5SA 5KFXA 1Q9YA 4FJMA 4ICLB 1X9WA 3QLHB 2XWYA 5L1LA 3LP2B 3BREA 5CYMA 4DMNA 3LANA 4DEZA 3S3NA 4K4SA 4FJKA 2XY8A 2R7YA 2HVHA 5J2QA 4CGFA 3MEEA 3Q8SB 1VSJA 2F8SA 1C1BB 1RBUA 1RTIB 1KHVA 4J9RA 4H4MA 2LSNA 5KRTA 5KFIA 1J9AA 2JLEA 4DFKA 3KHLA 3ITHB 3LAMA 5FDLA 4QWDA 4ID5A 4GC7A 1RT2A 3FFIA 4QWBA 4X2BA 1ZTWA 2ILYA 4B8AB 1RDCA 2IM3A 3L8BA 4CFAA 2R2UA 5F9NA 1VSIA 1TAUA 3E01B 5F8LA 3MECA 3BR9A 1A5VA 1HYVA 3NAEA 1KFSA 3NE6A 1C0UB 4B9MA 3OHAA 2UVRA 5DGBA 3B6PA 1EP4A 5KFHA 3G6YA 1LV5A 5F8HA 1BQNB 1NK7A 1TL1A 1RDAA 4TY8B 1RDDA 3DI6B 1DTTA 4Q0BB 4KTZA 1J5OB 3DRPB 2WTFA 2G8IA 1RYSA 4CJ5A 4RNHA 2KQ2A 2YHAA 3M9NB 5CYQB 5EWFA 4AH9A 3TWHA 1SH0A 3NAIA 3L2QA 1BQNA 3K2PA 4KE5A 1REVA 4N47A 3EYZA 4QWAA 3AO1A 2VG7A 3DLKA 4J9SA 3AVNA 2ZD1B 2R2TA 4Q8EA 4OGCA 4CIGA 1LW0A 3P1GA 2VWJA 3GIMA 4K50A 4YR2A 1KLMB 2C22A 4LY7A 3NKYA 2FVPA 3AVCA 3GV7B 3KNAA 4FLXA 3CIZA 1NK5A 1HARA 3LZJA 4KPYA 3OYGA 4B3OB 2YHBA 3KHHA 1D9FA 1RA7A 4FJXA 3K5MA 4KRFA 1OS5A 4JV1A 4ZP9A 3RMAA 2D7SA 1CZBA 2EX3A 4RW8B 5KFBA 3M8RA 1BQMA 3AVAA 2DFHA 3KHGA 4PUOA 5KFYA 3OL9A 1BIZA 2BANB 4B9UA 4NZ0A 4FS1A 4DL5A 4JUZA 2RDIA 4O0IA 3GYNA 2JC1A 2R8HA 1NHUA 3KIOA 1YT3A 2XGPA 3I0SB 4RW4B 3KLGA 2UUTA 3CJ5A 3BQ1A 4M45A 4H8KA 2BANA 3TABA 2A1RA 3IRXA 4K8XA 2Z1GA 2W8KA 4RZRA 1WSGA 3RAXA 1W0HA 4HUFA 1HMVA 4TQRA 4ZPCA 4KKOA 4BDZA 3H59A 4OL8A 4EO8A 2GV9A 4ECRA 5KFFA 4CGJA 4M94A 3BQ2A 4IH6A 5KFAA 1TKZB 4XPEA 3EPGA 4BWJA 4FM1A 2J6SA 4Q43A 1T94A 3SCXA 4NYNA 1TV6A 1JLCA 2QE5A 2X6NA 3KLEA 1S49A 3N6MA 1O1WA 1NK4A 1RBTA 1NKEA 2FVCA 3UDLA 4LD0A 5K14B 3U3GA 1JLAA 1GX6A 4QPXA 2BE2B 1JXLA 4F4KA 3T19A 1U48A 5KT7A 4E1NA 2FBXA 3V1RA 3C95A 4OPKA 3TAMB 4Z4CA 3QEVA 5FRMA 1XWLA 4IR9A 1TKXB 3MXIA 4M42A 3VA3A 3U6FA 1F21A 1NOYA 1J54A 3FQLA 4DTRA 1RNHA 4FJIA 4CIEA 1TKXA 3LP1A 4J2EA 3MR2A 3K58A 1FKOB 4MK9A 1GOBA 2HHWA 3QNNA 1WNEA 4CHOA 4E0DA 2OPPB 3DRRB 2W8LA 2NUBA 2EC0A 1CXUA 5D3GA 4B9NA 3L2WA 3M9OB 4CK1A 3LPTA 4FJJA 5CZ1A 1L3TA 3M8QB 1K1QA 1Z26A 3M8PB 4QAGA 3OYLA 4IH7A 5HP1B 2IC3B 5HBMA 2D0BA 1NK9A 1RT4B 1ZBUA 4PWDB 5SWMA 3I0RB 4J9PA 2FBTA 3GQCA 4AHCA 3OYHA 2D3UA 1SL0A 3DYAB 3LP3A 4IG3B 3FRZA 1WLJA 3VQ4A 3PX6A 5DLFA 1U45A 4R5PB 1DTQB 2ALZA 1HPZA 1IKWB 4CEZA 2O4GA 2DY4A 3KKSA 4N76A 4I2QB 1D9DA 3LPUA 2RF2A 3CDEA 3NF7A 1N48A 1T3NA 1S1TB 3MFHA 4CEAA 3KK2A 3BSAA 3CYMA 5KTQA 4WXOA 4RW7B 1BI4B 4Y1DA 3TR8A 1IKXB 4IFYA 3OJUA 3QGIA 3C6UB 4DS5A 3MEGA 1IKYA 3QEPA 1U47A 4TLRA 1S5JA 1MU2B 3KLFA 2P51A 4DG1A 5KFJA 1RT1A 3EY1A 4K4ZA 3PW7A 1I3AA 2YNFA 4J2AA 4JV0A 3TAGA 2B5JB 3JSMA 3PR4A 3RBEA 1SUQB 2ASDA 4NLWA 3OYAA 1NK8A 3DOLA 3VQQA 1NJYA 3CVKA 4HUGA 2YKNA 1SKRA 4DSIA 3NGZA 5DG7A 4IDKA 2R8JA 2R2RA 4BE2A 1IKVB 3WNGA 1W25A 4ZVEA 2WK4A 4ZP6A 1KHWA 4DTNA 4JRPA 5KG7A 5J1EB 2D0CA 5J2MA 3VQ8A 4E3SA 4TXSA 3ZSVA 3NAHA 1TK8A 4LSNB 1C1CB 2OPRA 3QESA 4N5SA 3S3OA 3PW4A 3V9ZA 2KFNA 4O3SA 1BISA 4DL4A 4FLYA 5J2NA 3V6DA 3T3FA 2FLNA 1DLOA 2PY5A 5EU7A 3KKRA 4I7FA 4E19A 3KK1A 3CWJA 4DSEA 1QTMA 4EP4A 2HMIB 3KD5E 5J2PA 1C0TA 4IG0B 3VQPA 4WFYA 3NF6A 3IAYA 1ASUA 3LALA 1LWEB 4DU4A 4WXWA 4J9QA 3BSCA 1S1WA 2E9RX 4NRTA 1D5AA 2CJQA 4O4GB 3QO9B 1SKWA 2V9WA 4O5BA 4MK7A 3HSTB 4E1MA 3DRSB 2CKWA 4B08A 5EWGA 5EUHA 4KAIA 4E7LA 4FLWA 1NJZA 1LWFA 1VSFA 5C25B 2W9CB 4CFDA 4HVJA 1NKBA 3QIDA 2R8KA 4NLUA 1YVFA 1JKHA 3AO5A 4KTWA 2VG6A 2XY7A 3SJJA 2IAJB 5KRSA 4R0EA 4RW6B 4O44A 4ZPBA 5C25A 1T03A 1RCHA 3PW0A 4G1QA 2BR0A 2ZKUA 3LAKA 4DWIA 2FBVA 2BQUA 4QWCA 2AQ4A 1S9EB 3NGIA 3HVTB 4K4TA 4DL6A 4Y1CA 5FROA 1HRHA 4GVMA 1RT3A 1TK5A 2YNHB 4EYHB 1HQUB 4R8UB 2Z1IA 3CJ3A 3SQ1A 1UOCA 1RTDB 2VA2A 3RMCA 3T5KA 1U4BA 4PA1A 4YNQA 3EZ5A 4NLXA 1TL3A 1S9GB 1RBRA 3HVTA 3V1QA 4CK2A 2R2SA 4EZ6A 5F8MA 1S10A 4ELUA 1T7PA 3D45A 3PX0A 2FJXA 2VWKA 3DOKA 4K8ZA 4CJVA 5EWEA 4PQUB 3TARA 5F9LA 4CEDA 1S97A 3M8SA 1HYSA 3SI6A 2DTUA 1VRUB 3OYCA 4C8OA 4DTXA 3KD1E 4LSLA 2YNGB 4ZPAA 3CM5A 2RKIB 3S9HA 4NLOA 1QUVA 3HL8A 1U04A 3KLHB 3AVFA 1QS4A 2I5JA 3PHEA 2KFZA 1VSLA 5DG8A 5CYMB 1EX4A 4Q44A 3OJSA 3G0ZA 5KT3A 2XO7A 4CFCA 3V4IA 3LZIA 1IM4A 4KHMA 3SUNA 5J2QB 3MEEB 4KREA 3ZSOA 4BACA 2ATLA 3VA0A 3RRHA 4H4MB 4ECTA 3PZPA 1YTUA 1JLFA 4FK4A 1WAJA 3KOAA 3QGGA 4MKAA 2Y1IA 4K4YA 3RWUA 2QK9A 4XPCA 3BDPA 4IFVA 5FDLB 4ID5B 5T7BA 4QWEA 4QW9A 4DF8A 4DQQA 2QKBA 1RT2B 3FFIB 1JXBA 1FKPA 2AWZA 4CEFA 4UQGA 4FBUA 4KSEB 4TYBA 4LH5A 4WE1A 3AVGA 3L2VA 5HROA 4AHTA 4DSLA 2DPJA 4ED1A 3VQDA 4DQPA 4WZMA 3AA3A 4DL3A 3MECB 4KV8B 2PYJA 3PJXA 3V6KA 3K5OA 1L5UA 2G8UA 1EP4B 1LAWA 4NCGA 3EZUA 5KFSA 2IJNA 3HKWA 1TL1B 3PX4A 3KLVA 2W9AA 1ASVA 4KV8A 2AGQA 2D0AA 1DTTB 4Y3CA 4DSJA 1CZ9A 4ED2A 3CM6A 2VG5A 3B6OA 1ZYQA 2GBZA 3M9MB 4F3OA 2W42A 1WNSA 1REVB 1S48A 1NNDA 4QCLA 3SV4A 3L2UA 2ASLA 4K4UA 2BGGA 1TP7A 3NMAA 2ILZA 4KI6A 2VG7B 3DLKB 4FZXC 4NYZA 3OHBA 4YQWA 3F9KA 4H54A 1C0MA 1LW0B 1S6QA 4B9VA 2QXFA 4EBEA 4ECUA 4E7KA 3GIKA 4DFMA 1GOAA 2JEGA 1W9HA 1IG9A 1GOCA 4YR0A 1ZBHA 1X9SA 2QV6A 2FLPA 3S3MA 3RBDA 5KFDA 4E7IA 3HT3A 3GILA 4OGEA 5KFWA 3KMSA 3UR0A 4O3RA 1J53A 4ELVA 4KHNA 5KT6A 1BQMB 4PUOB 1TVRA 2HNZA 5HLFA 4FBTA 3IG1A 1JLQA 1TKDA 4FXDA 4CGIA 5FRNA 3CJ2A 5HRNA 4DSFA 3KLGB 4NLGA 2BRLA 4URSA 4Y2CA 3OYBA 3MXJA 5KG4A 4NLYA 3IRXB 1EETA 3V81A 1HYZA 4NYFA 4DLEA 3LWLA 4ECSA 3NFAA 5DQGA 2X78A 2UVWA 1T05A 2WOMA 1HMVB 5KT2A 2DPIA 4B9LA 2XY5A 4KKOB 3HHKA 1TGOA 4E7HA 1TAQA 1KTQA 1S9FA 4EZ9A 2BQ3A 4QW8A 4CJ3A 2HHXA 3RB4A 2RPIA 3OVNA 2G8HA 4G3IA 3AO4A 1XR7A 1S4FA 1TV6B 1JLCB 4CJFA 3KLEB 3QZ7A 2C2EA 5CY4A 1BCOA 1VSEA 2WHOA 4DLGA 5L1JA 1C2PA 4RNMA 5KFTA 1XI1A 3IS9A 2HNYA 1VSDA 1NK0A 3KJVA 2ATQA 1JLAB 4BDPA 2DFEA 3SZ2A 3HP6A 3OSNA 4CHPA 2IM2A 3MEDA 5SZTA 3KHRA 2E6LA 3VQBA 2R8GA 2EHGA 3ZT0A 4Z0UA 4W5QA 3ALYA 1LW2A 4WFXA 1ZBFA 4FW1A 2HNDA 1QE1A 2WONA 3LP1B 4DS4A 5KT4A 2E6MA 4RW9A 4URGA 2OPSA 3KK3A 4O0JA 3OYEA 5C42A 2HAIA 2IA6A 3QIOA 4RG8A 4CJSA 3G6XA 5D3GB 3OL8A 4MH8A 4ED6A 4OVLA 1SV5A 3CDWA 3C94A 2IBKA 3CFOA 2F8TA 5KG0A 4KTQA 3BQ0A 1N6QA 4RNOA 3OSPA 4ELTA 5HBMB 4ZTJA 4HUEA 3OYMA 4EYIB 2RN2A 4DTOA 1EKEA 1JLGA 1XHXA 3ZSRA 3UQSA 4Q5VA 1RBVA 4JLHA 3OYDA 1HPZB 2G8VA 4EBDA 2OYQA 1B9FA 1KCFA 2VA3A 3P83D 3NH1A 4IOBA 3PW2A 4C8MA 2HB5A 1S1UA 3KLIA 3MTKA 3SV3A 2UUWA 2RF2B 3QEIA 3GIIA 2ZQBA 2E9TA 4K4VA 3O4QA 3KK2B 1LWCA 4MFBA 3FSIA 4W5TA 1WN7A 1VSKA 5CZ2A 4IFYB 2FVSA 3OLAA 3THVA 3AVKA 3MEGB 4M41A 1IKYB 3KLFB 4DG1B 3ZSWA 1RT1B 4C8LA 4CF8A 2RDJA 5JUMA 1JLEA 1S6PA 2YNFB 4BDYA 3DLBA 4CIFA 3JSMB 3I8DA 3DOLB 4WYLA 1HNIA 2YKNB 4ECQA 5DLGA 5DQHA 3MXMA 4EEYA 4IDKB 3RB3A 4M3XA 5DMRA 1LAVA 2Q3SA 4ECZA 3NBPA 3TAQA 3PUFA 3K5NA 5J2MB 1JLBA 5KFKA 5KFEA 4RNNA 3T1AA 4AHRA 4J9KA 3TI0A 1XR6A 2OPRB 4FLUA 1FK9A 2YNIA 4FYDA 3DLGA 3VQ6A 5J2NB 3V6DB 1DLOB 4Y2AA 1S0OA 2AGPA 2XCPA 1QSYA 4CF1A 4I7FB 3KK1B 3BSOA 3SNNA 4HHTA 5J2PB 1C0TB 4RU9A 3G86A 3OYNA 4WZQA 4J9NA 4IBNA 2HHVA 5C5JA 1UA0A 3PV8A 5I3UA 1K1SA 5F8IA 1JXEA 2XI3A 1KRPA 2HHSA 4KHSA 1S1WB 4ZHRA 3CJ0A 1S0MA 3SQ0A 3RB0A 2HHUA 5JS2A 4CK3A 3VQAA 1S1VA 1LWFB 1Q9XA 4CHYA
chains in the Genus database with same CATH superfamily
1Y11A 3TAEA 3I5AA 4CZCA 4BRIA 3CD6N 2I7NA 3GV8B 4CEQA 2IM1A 4F4XA 1JKHB 1KTVA 4YB6A 1WTBA 2YKMA 1C1AA 4JRQA 1TR0A 3B4DA 1XTZA 2WW8A 4FK0A 5T7LB 4HTIA 3D1QA 2CVEA 1HLWA 2CQGA 4EK2A 3FZHA 2QKKA 4NCAA 1RWXB 3FMWA 3ZTRA 3H5XA 3BYPA 2WSFC 3AA2A 1QVGM 3THPA 3MM6B 4FLVA 1RACB 2O8EB 4UOFA 3ZSXA 4BCAA 4DQRA 2GJIA 1FVQA 4CZGA 3B4MA 3M2UB 3D2WA 1TL3B 2AU0A 2YHYA 1K8AO 1HKCA 4MLEA 5GINA 6AT1B 4OX7A 4IRCA 1PKUA 2XMUA 3H5UA 1GMWA 4AHUA 5D78A 2I1RA 5EHHA 5KGWA 2F8EX 4NZ6A 3BKTA 4JS4A 2KTQA 1S7HA 1HYSB 2J5AA 4X4TA 2W7PA 3UCUP 3C19A 2CZVC 2IDOA 4FPAA 4NEZA 4I2PA 3C7NA 2HHHJ 1D0EA 1A5XA 1RTHA 1X60A 3BM7A 3O4NA 2YWHA 3HPOA 1U6ZA 1OH8A 4DL0C 2CAJA 3RYLA 4F8RA 3V4IB 1H7XA 3OTEA 3QINA 4LC9B 1V6HA 1UL3A 1H2VZ 1O8BA 4ZN1A 3CC7N 3AFGA 2MKCA 2DNLA 1TKTA 3FZKA 3DM2A 1ILYA 3A8YA 4EWTA 4MIAA 4L75A 2BYCA 5DG9A 4KAZA 5KFCA 2IJFA 5AJ3K 3AVMA 4IFVB 2PMZD 3IA0A 3NL0A 3C6TA 4CJWA 1RT5A 1WSIA 2ZE2A 4J9OA 1HNXK 1RTJA 2AJ1A 4J91A 1SJ4P 1SL2A 1WSRA 4CO0A 1P1TA 4LIWA 2GHVC 2J6UA 1DJ0A 3VGKA 3LP0A 4UQTA 3OYJA 4NCGB 3PIOL 2LKZA 3NF9A 5AQPA 3MWTA 3IBWA 1RFQA 3D5MA 4CP5A 1RAFB 1Y5NB 4ICLA 4DTSA 2RMLA 3QLHA 2PZSA 4OHYA 2EK1A 3B8AX 2B7BB 3CCMS 4FWKA 3PFOA 4JP8A 1RCXB 2VG5B 2A3ZA 2F9TA 1HL6A 1B7FA 2FBYA 3QRQA 3US5A 3VZHA 1FWKA 3D3CJ 5DRKA 1M0SA 2P5OA 1IO2A 4CLWA 1I5OB 1YG0A 4LRFA 1RTIA 1U0HB 2F8HA 5IQ6A 4DU7A 5AJ3F 1EQ0A 1WG1A 3Q8QB 3A2FA 3BH6B 4ECYA 5CD4A 2QMUB 1FA0A 1XJWB 3HHLB 3RJMB 4KH0B 3CJBA 3SUQA 4B3RF 5DZ7A 1CS4A 4FSVA 3QMLA 3GG4A 2FHKA 4XIUA 1HNXF 1OH6A 1FNXH 1WG5A 1WSJA 4X64F 4CZFA 4WYBA 4AILC 1YJNN 1NLVA 2ADCA 5D77A 2J8SA 4NX9A 3IGNA 4L6V3 3NDKA 4XH1A 1YIJS 2VPXB 3DN9A 1C0UA 3KMQA 5F0UA 4B9TA 2CPXA 4C3LA 4ZMMA 4I6YA 5KFLA 3A5OC 2XS5A 3DMJB 1IBMK 1HKAA 4JS5A 2W6KA 4FJ5A 3K2YA 3K59A 3AD7C 3NF8A 2HNZB 1YDLA 4TY8A 3IG1B 2XZDB 4L3NA 2QM1A 3DRPA 4X62K 3AXKA 2OA8A 2GAHC 2BZ2A 2WVEA 5CYQA 4EGLA 3ISNC 1O13A 4ID8A 3ISZA 5KFNA 3P38A 1NBWA 3CJ4A 2W7AA 2PYLA 2WOMB 1SC3B 5DM6L 4W5RA 4M5HA 3NGUA 4OZ1A 3MAAA 2CH6A 4CH0S 4I1TA 4NI2B 1WSEA 3I82A 4DQSA 2LQ8A 4CJKA 2ZDPA 4ZA1A 2L41A 4H0XB 3O8WA 2KHCA 4ECXA 1YITN 4O5FA 4CECA 2DH9A 1SIZA 4JHDB 4PXBA 2CIMA 4QPTA 4XDCA 1WBDA 4CH1A 2JEJA 3VEXA 3IS9B 3R97A 5KFMA 4DL7A 2UU9F 2E2QA 2EEYA 4ED0A 1Y4ZB 3VAKA 3I87A 4LF2A 3O6WA 2M5YA 1R8AA 2J7WA 4JKGA 4ITSA 4Z94A 3UO0A 2YQ1A 2MTLA 4X62F 5ADXA 2C28A 1YJVA 1NH7A 3H5YA 2GCFA 2UXCJ 2VUGA 2U2FA 3I0SA 1YJTA 4WCEQ 3EUNA 4WIQA 1XNRJ 3PACA 1F5BA 2NYIA 4TY9A 3OW2R 1I51B 1VQ6N 1GQEA 2KKHA 3NXZA 2RQMA 2BMBA 4Q8FA 2ZH4A 4K25A 3OUYB 1WUAA 4IFEA 5BREA 5C2CA 1G6BA 3MCMA 3WXMB 2DIVA 4C0OC 1ITGA 1X4EA 5AZJB 1NKCA 4WWSA 3MPDA 4M5KA 4A61A 1CJVA 3O9RA 4FJHA 4DV1J 1XUPO 1RSCA 2JVOA 3W66A 4D3HA 3RBZA 5F0XA 1NB7A 3ISND 3JXUA 4ZVPB 3Q22A 2IBOA 2G0CA 3TVYA 5E41A 1U1NA 4CLTA 3AARA 4K0KK 3VETA 5M1QA 4H4KC 1KBRA 1Z4UA 3C15A 4EU0A 4FZYA 4M5LA 4CLKA 2XI2A 3UNYA 1YKWA 3H1VX 1U7LA 4UY8T 4RL1A 1PAEX 2HRUA 3X1LB 4E7JA 1E4GT 3H2VE 2O4IA 4A8XA 2V8GA 4A5BA 4CT9A 3SAHA 3FE1A 1T9YA 2PT0A 2BE9B 3L2RA 1OPIA 3SQGB 2VL1A 5BN9A 4CGDA 2H54B 2HHHF 4NLSA 2AHOB 1LWCB 2AW0A 4JYAJ 3THYB 1FKOA 2UUAJ 2HWIA 1FE4A 1RB0A 3C66A 3H2LA 1ZOTA 3GJQB 2H9ZA 1TTHB 1AW0A 4M3WA 4IDHA 1BWFO 8RUCA 3KTQA 1WOQA 4CZKA 4YOEA 4C1NK 3T6BA 4WFZA 5LJ3Y 1ATRA 3WEEB 3FZMA 4P52A 3M6XA 3QGHA 2UVUA 2XY6A 2F4VJ 1NGAA 3NCIA 2N4CA 3CFPA 3L4QA 2CWKA 1HNIB 5LSRA 1N5TA 2WCXA 4DU3A 4X4UA 4DR5J 2G8WA 4CF0A 3HK2A 5L9XA 3ZTPA 4ZLLA 3NBPB 5DDQC 3OL6A 2KKZA 1JLBB 1DTQA 3TQ1A 3ZCMA 1O5JA 2LYVA 1VK0A 3ZT1A 1MWYA 1SH2A 2EW9A 5FD1A 3LGNA 1HLUA 3J80U 4Y00A 4RNFA 1YTAA 1JXVA 4V1Ak 1NGCA 1MNEA 4HH0A 5EXWA 3ASMA 2NSBA 1U24A 1SC6A 2GS8A 2UVVA 4LFBJ 4NA3A 4ZHRB 1MU2A 3H3OB 2BRKA 3MMBB 2HMPA 3PEJA 4WQ5A 2ERRA 2WSCC 1EARA 4BE1A 2DEIA 3TUJC 4Z4EA 1SUQA 2GHPA 1J6ZA 4KGZB 2AJFE 3DRXA 4ZLNA 3W60A 4J8FA 4CHQA 2YKMB 3IM9A 2NS1B 2FJDB 2CJXB 5D4OA 3M30A 4B3TJ 3RTVA 2XMMA 4IO8A 1CULA 2DNGA 4JI8J 4BVPA 1GX5A 2E7WA 1NGFA 3O9QA 1WKJA 2AJQA 2ZVSA 3MCPA 3BKFA 2XLJA 4OZJA 2A18A 3G82A 3ZXWA 5KFOA 3M8ZA 4F50A 4LF6K 4ZP7A 1NGIA 3TO8A 3WQUA 2UUBK 2HMIA 4BG8A 3AOBA 5AQNA 1FRHA 3LL3A 5AZIA 4Y2KA 1EQMA 4ZTFA 4ZN3A 2KU7A 3VTHA 3FSYA 3RB6A 1HIYA 5AQSA 1XNRK 3IMQJ 3LPEA 3BGFA 2L9WA 2HGNA 2GEMA 1WTFA 1DRZA 2ZH3A 4YDUC 1U1RA 2W9CA 4IR1A 2CPJA 3C7NB 1T11A 1K0VA 3A8JA 1RTHB 3Q24A 4DV0K 2Z1HA 3CERA 2VHGA 3SXLA 2IAJA 4BRFA 4Y2MA 2O01C 1ESVA 3P4IA 1VC6A 3GPAA 1AUDA 4DR3K 4DV1K 4OLBA 4KHYA 2P9GA 4K5SA 3K17A 3A13A 4RPFA 1IR0A 3VN5A 1TKTB 3DM2B 1SZ2A 1JQGA 4BR2A 1NZ8A 4L3KA 2E7VA 5D4LA 4OMFG 4M5IA 1HQUA 1SL1A 4N8OA 1RTDA 3C16A 2X1BA 2BKNA 4DSKA 4PXCA 2DJWA 4CCHA 2VFTA 2FDNA 3C6TB 2IMOA 4PKDB 1RT5B 2ALYB 2ZE2B 1RTJB 2DNYA 2UXCF 1EHWA 3N5FA 4L76A 1XNRF 4AF1A 3OLBA 3DWLA 3ZZRA 4ZIWA 4UZBA 1GLAG 5L46A 4CJRA 1Q86O 1VRUA 2Z2ZA 5ETPA 5GIPA 4QOZB 3WNFA 1PJ7A 1C0GA 3LP0B 3RSEA 4M3ZA 3C0BA 4BY9C 2KYZA 1X8DA 5E0OA 3KLHA 5KFXA 1Q9YA 2UUAK 1OSCA 3TW0A 3EDQB 5CCMA 4ICLB 4DUYK 2MJNA 3KUGA 3QLHB 2BV3A 2XWYA 4RR5A 3BREA 4DV1F 3GR1A 4FF3A 1Q8BA 1VQ4N 1YRUA 2CGKA 3NCQA 1UAWA 4K4SA 2IJRA 1Z6RA 4JAXA 5J2QA 4F3MA 1ZM3A 4DCHA 4CGFA 2ZH8A 3PYDA 4C11A 1RTIB 1RBUA 5E26A 2BOAA 4WCEL 2A5XA 5BN8A 3FMBA 2LSNA 5DETA 3A12A 3C14A 4LMZA 4DFKA 4FYVB 3CETA 3EZOA 3KHLA 3KG0A 1R59O 1T0TV 5FDLA 3ZNJ1 4DJBA 2POKA 4A8QA 4QWDA 3A3NB 4ID5A 1X4BA 1CS4B 4USTA 3AH6A 1GH8A 1RT2A 1ZTWA 3HOSA 2B51A 4BRAA 4OZ3A 2IM3A 2R2UA 3SMZA 5ITHA 4LRDA 2RQ4A 2O8DA 3PSFA 3UE5A 3BR9A 2DNKA 2B4VA 1KFSA 1C0UB 4B9MA 1BU6O 1D9AA 2E1MC 4JYAF 2Z57B 4NPOA 2OTJS 3G6YA 2DY1A 2UUAF 1BQNB 1NK7A 1HI8A 1YF5L 2DO0A 4HEA9 4TY8B 2G8IA 3DRPB 4OYIA 2OANA 2KQ2A 2YHAA 1IV0A 5CYQB 5EWFA 2J4RA 1KN6A 3NAIA 4DCJB 2BJDA 2F4VF 4CH7A 3MTJA 5TKYA 2H4YB 1F9EB 1B4SA 2I0XA 5DDRC 2QFIA 3AO1A 4J9SA 4DR5F 4FF4A 3MAAB 4OGCA 2ZEJA 3W2VA 5A0YA 3UW1A 1IBKK 3BV8A 4DV7J 4MJKA 4DR4K 1R8CA 4JI8K 4K50A 4YR2A 4KGMA 1N32K 4LY7A 1D4XA 1B99A 2LVWA 4ZCIA 4OJHA 2V8PA 1R43A 1JJ2M 3TEGA 4KPYA 2BJ7A 2IYIA 2BUPA 3W7BA 3KHHA 4FJXA 3HKZD 2C3UA 2BM1A 3K5MA 5BYSA 4ZP9A 3BGUA 2B3TB 2EX3A 3ZTQA 3OQ2A 3EGWB 1ROFA 3M8RA 3FR0A 2PDAA 2DFHA 3KHGA 5LXRA 3OL9A 1BIZA 3N79A 2Q97A 1AYEA 2BANB 4B9UA 4OV1A 4JKGB 4FS1A 1VFJA 4LFBF 3BF4A 2CJBA 3I0SB 3CJ5A 2XGPA 3BQ1A 2FTRA 7FDRA 2QWLA 2A1RA 2W8KA 2C42A 4Y0FA 4HUFA 5GIOA 2MKYA 3KZBA 4KKOA 4EO8A 2QL7B 3CCRS 2GV9A 4B3TF 2VB6A 1DARA 2BBEA 4JI8F 4M94A 4IH6A 1JCEA 5D0HA 1O6XA 1CJVB 1IWGA 3EPGA 4BBYA 2YPYA 3Q0AA 1RKJA 2NXNA 2MZJA 1CJKB 3KLEA 2RJZA 2GMJA 2NUUG 2ZZTA 3I56S 5EGYA 5A2QU 3N6MA 3O9UA 1O1WA 1NK4A 3VF0B 3MN7A 4ES2A 2FVCA 1GLJO 1ZM4A 4TVAB 1ULRA 3C15B 1DHMA 3MMAA 5BR9A 2R7QA 3W9JA 3MWBA 3V1RA 5K8PA 4OPKA 3RBXA 2DKOB 2O3DA 4M42A 2ZWPA 4A46A 1F21A 4HI2A 3ENVA 1T6DA 3FQLA 3DGVA 3R1LA 3LP1A 1FKOB 1FDBA 2IVFB 3SSQA 2MQPA 1ZZNA 2PEBA 4CK1A 3HHEA 1RI7A 3OYLA 2GV1A 3WX8A 2V34A 4IH7A 3MCAB 4W92B 2E2NA 1WDDA 2R7WA 5HBMA 2ZH6A 2O67A 1UW9A 3AHPA 3G71N 1RWPB 3DLJA 1NSPA 3KXDA 3QBXA 2XMJA 3NS7B 1VQ5N 2CDQA 1MROA 5ETSA 1DTQB 2ALZA 5L9NA 3R9PA 1KAYA 1DEJA 2ASYA 2J76E 5CQGA 3HMJG 1IBCB 3LPUA 2KM8C 2ZH7A 3R2CJ 1S72N 2RF2A 3CDEA 3G8SA 1N48A 3NWGA 3AGKA 5KTQA 5SUHA 4IFYA 3QGIA 3IC1A 4USKA 5AT1B 5AXMA 3GONA 3MEGA 1VQ9S 1YI2N 1U47A 4TLRA 1MU2B 2P51A 2VQEJ 5ETQA 3TEHB 3CD5A 1YZ6A 3TZXA 1I3AA 5LMUK 3PKMA 4DPWA 1UETA 3RBEA 1SUQB 3DOLA 3VQQA 4DUZJ 2QL5B 4EFAC 4PYAA 1Q0NA 4QYRA 2OTLN 3M30B 4ZP6A 4ZVEA 5DS7A 3QMQA 1KHWA 4DTNA 2KVQE 3BH7B 3VQ8A 3JAMY 4B1XB 5JVHQ 2QSWA 3J7YU 4ES3A 1ZH5A 5B0GA 2UYTA 4B1VA 2YWKA 1CLFA 4FLYA 2FLNA 3WC2A 4CO4A 3G82B 4I7FA 1GK8A 2W40A 2HMIB 3KD5E 5J2PA 1N54B 4ZPWR 1C0TA 3NF6A 1ASUA 3CPWR 5AZIB 2QXLA 4ZPTR 2CADA 5LM7E 3MX5A 2E9RX 4NRTA 2CJQA 2NRWA 2G0JA 4MK7A 3D66A 3TRGA 2YKOA 2HQFA 1WBBA 5C25B 4M1KA 1MWZA 2W9CB 4ZVRB 3MGJA 2GUPA 3DXBA 3L7OA 3NCPA 3QGPA 2R8KA 4NLUA 1YJWN 4IEEA 4DV7F 2D9OA 3MCNA 2VG6A 2XY7A 2IAJB 4R0EA 4OZ2A 4O44A 2EWSA 3VCDA 2BVZA 2JOQA 1YJ9S 2BR0A 4G1QA 2E5LJ 4DWIA 1Z2LA 1RU2A 4EMDA 3QB0A 3NGIA 4WK3A 1SKUB 2YCHA 2E5JA 4Y1CA 4B9QA 5CHCB 3OFFA 4JV5J 1ZZFA 1HQUB 2Z1IA 1UOCA 1RTDB 3RMCA 1NDCA 5DDPC 2M52A 2MPUA 2ZC4A 1RBRA 1WJ9A 3V1QA 1S10A 3HULA 2AEFA 5C7PA 2VWKA 3DOKA 4CYUA 3TARA 1VCTA 2FZKB 3M8WA 1BOTO 2FHJD 1FDDA 2A0FB 1VRUB 4KH6A 4DTXA 4LSLA 3RSEB 4FF1A 2YY3A 1ICEB 2DRBA 4K8RA 4QS7A 1UMJA 1QUVA 3KLHB 2OSRA 2I5JA 2JH3A 3PHEA 5IOLA 4CI0B 1RWUA 1QM9A 2PSZA 1F5AA 4CFCA 1Q18A 2RIJA 1H38A 2YJFA 5J2QB 1GLDG 2P8IA 4KREA 3GTYX 1U02A 3ZSOA 4P73A 2ATLA 4C11B 1FERA 1NJIT 2GWKA 3C14B 4FK4A 2Y1IA 2GHWA 3GU0A 1HW8A 1V3ZA 3LDQA 2LU1A 3D0HE 5FDLB 2QEXN 5AXKA 4ID5B 5T7BA 2DH8A 3DJCA 4DF8A 2QKBA 1RT2B 4XK8C 1JXBA 4BRDA 2AWZA 4TYBA 3CC4S 4BGBA 4WE1A 4CJ7A 3AVGA 3L2VA 4XH5A 4IO1A 5HROA 2DPJA 1KP6A 2O8DB 4DQPA 4DPOA 3MEKA 3J7ZT 4DL3A 3ELHA 1ZM9A 2PYJA 3V6KA 1FE0A 1ZXOA 2AYEA 2CYYA 1ZAWA 2QTDA 1AT1B 4FWLA 2DRDA 1VIXA 1XMBA 1GTHA 1KD1T 3PX4A 2W9AA 1ASVA 4X66J 1CZ9A 3AY0A 1JJHA 3AY9A 2J9EA 2VQEK 2MLYA 3M9MB 3ID8A 1S48A 2VDHA 1RWMB 2MXYA 2ASMA 1N33J 4R79A 1NUEA 3POTA 3M2VA 1VQON 2B8PA 4YQWA 4OYPA 4M7YA 3W2VB 5A0YB 4H54A 2ASPA 4LR7A 3THXB 4F02A 2MLZA 3SIPB 3GIKA 5F41A 3HD2A 1GOAA 1BE4A 4ZLJA 3EZWA 2YI1A 3MPYA 3OFEA 1ZBHA 2FLPA 1JK9B 2WBNA 2CJKA 2L9NA 2OEMA 3GILA 1OPZA 2HPUA 3CD0A 3S7RA 3KMSA 4BRNA 1N34J 2FJEB 1TKDA 4FXDA 5T41A 4C8ZA 2VQEF 3NGSA 3VEYA 4URSA 4Y2CA 3OYBA 2DNZA 1K47A 4NLYA 1EETA 3V81A 1B3TA 2DXDA 4BRCA 2M9KA 2CJ9A 4DUZF 5DQGA 1YK9A 3C3LA 5KT2A 2XY5A 4KKOB 3VAIA 3MAHA 3TVZA 1KC8T 2Q6CA 4NXMJ 2BQ3A 5IWAK 2E5LK 2HHXA 3RB4A 3LM2A 2AJ4A 2VICA 1S4FA 2YXLA 3KLEB 4WTOB 2YH1A 3MUTP 1K8KB 1OYEA 4ETXA 3DFEA 2X51A 4DLGA 1C2PA 2IVNA 2ROPA 3VEOA 1G4CA 1NU0A 1VSDA 3W65A 4ZVOB 3VALA 3MMAB 3SZ2A 2MHEA 3D0IE 2RU9A 2IM2A 1PBAA 4EI2A 2IVOA 3KHRA 2MZTA 4GRSA 2Q2RA 4W5QA 5F3TA 5JVHL 3ALYA 2G2OA 4ISFA 4BGAA 1ZBFA 4FW1A 1HFEL 2XHWA 2LDYA 3T1YJ 3LP1B 1WKKA 3O1LA 4DZDA 3ZTOA 1KNZA 2HBJA 2OPSA 2R4FA 2V8HA 4WTYA 2HAIA 3QIOA 1HA1A 2XBPA 3LDOA 2FB0A 4RG8A 3G6XA 3W62A 1AFJA 4MH8A 2QWNA 4PG8A 1SV5A 2E5LF 2IBKA 2VBYA 4KTQA 3BQ0A 1KONA 1N6QA 2BM0A 4RNOA 4ELTA 1OJ4A 5HBMB 2A3JA 4EHUA 4JV5F 3CMES 4EYIB 3GE9A 2KG0A 4P2XA 1JLGA 5LSLA 3VVUA 2CZ4A 2I38A 1MROB 4WBFA 4HDHA 4Q5VA 2MY7A 3MD1A 1VK3A 3N4PA 1B9FA 3JAMO 1KCFA 3ONQA 1HBOA 3P83D 2AA4A 3WX4A 2HFOA 3PW2A 4C8MA 4CWBA 3SV3A 5I4MA 3CQYA 2CQ0A 2RF2B 4YDUA 2QYCA 1NB2A 3O4QA 4H0TB 4MDBA 3FSIA 2Q6BA 4W5TA 3QRRA 4OHWA 1TUUA 4IFYB 3JXOA 3THVA 4X66K 2W4DA 3MEGB 4HTLA 1GAOA 2OHDA 3KDNA 2QWRA 5AQZA 4DV3K 3A1YG 1JLEA 1S6PA 4OYBA 4PG5A 4BDYA 2XS2A 4CIFA 2ZHAA 2ZUAA 5ETOA 3MPUB 3DOLB 4USUA 2D69A 3GCXP 3A3OB 3NEKA 2EWHA 4QS9A 2DNMA 1LAVA 4ECZA 3K5NA 3K5PA 2MQQA 3CCMN 2RRAA 4KJIA 1VQLN 1XR6A 4FLUA 2ZOMA 4FYDA 3DLGA 3CE8A 1S0OA 4JKEA 4I7FB 5H9FK 1SJFA 2BH1A 1WB9A 3VV2B 2DISA 5J2PB 2OCEA 2V8DA 1C0TB 4G1IA 4WZQA 3TNVA 4X66F 2IVYA 2G0IA 3PV8A 4C2MA 1EKSA 2HHSA 2RE2A 2V94A 3WQTA 5BRHA 2HFVA 2OD6A 4ZOSA 4K42A 5JS2A 5K8MA 3OR2A 1U1PA 1E4FT 1YIJN 4HHUA 1N33F 1R8BA 5F2RA 4CHYA 3EKSA 3QNOA 1A6LA 2YV0X 3BGRA 2DXEA 2QMWA 1SJ1A 4MTPA 4JKBA 2NLXA 2MKIA 3BR8A 2GC8A 3H20A 1Q7LB 4FJLA 2VG6B 4NXMK 4O44B 1RT7A 2OPQA 1XNQJ 5M1PA 1IVZA 4G1QB 3N5BA 2HQ3A 4DR1J 4EBCA 3JYTA 4OX9J 2PFFB 2GWJA 1C4AA 4OZNA 2PMWA 3QAUA 1RAJA 1QQMA 5KFPA 2E44A 1Y9OA 3R6GB 4ZVTB 3R6LB 1TL4A 1U49A 2J9CA 3L3UA 5I42A 2BJ8A 2W6LA 2A6OA 1H7WA 3OS0A 1GNKA 4CHZA 2DHXA 1N34F 3SYZA 3VGSA 3TUZC 4NXNK 3PW5A 2X7IA 4ZVGA 1HBUB 2IYGA 1M5HA 4UUWA 3DOKB 4CYUB 4WK1A 1QD1A 1NSQA 3C6AA 3K5LA 2W9BA 3AD9C 1M1HA 2HHQA 3HO1A 1BMQB 4LSLB 1VQSA 3T1YK 1H0HB 4NB4A 3DNCA 5C24A 1UWBA 1VRTA 2JC0A 4FS2A 3LO3A 2YHWA 4FL9A 1BQXA 2E9ZA 2I5JB 4NXMF 1YHQS 4M5NA 4O4RA 3SCJE 3EDRB 2K06A 5AQTA 4I6MA 3AGRA 2Q1NA 2LQJA 3CHWA 3CGIA 1K73O 4IOAQ 1I6JA 2PE8A 4W5OA 2ETJA 1RXOB 3D28A 1U8WA 3L09A 1NGBA 3BPDA 2IY5B 3UD3P 4YMEA 2JEIA 3MM7A 3CIPA 1CQMA 3SQ4A 4B3MJ 3D6RA 3E8OA 3R27A 4RUCA 4WE1B 1OKJA 4GV9A 3LDPA 2KN4A 3IR6B 4GKKJ 5HROB 2AGOA 1MWKA 2ZDOA 4HTUA 4FVMA 4GY2B 4TKTA 4K2JA 1DKGD 4X65J 4JI1J 3T1YF 3U7JA 2UZAA 5H9EJ 4AHSA 5KG3A 5BPMA 1FRIA 3HJFA 2CFXA 3QQCD 3VR1A 3OTCA 2F65A 2VJUA 4BC4A 2FLLA 4E89A 1QAJA 3BN4A 4KFBA 3T1HJ 3QATA 2DGTA 3N9UC 3NMUA 4O3QA 1WOOA 3K9KA 3GV5B 4Y34A 4LT6A 1N56A 5HRSA 3I9V9 5KFVA 3DDIA 3AT1B 3TAFA 3DRYA 2A1SA 2D5RA 3POTB 1IJJA 4BRPA 3M2VB 3ITHA 1QJHA 2RNEA 3TOQA 1D3WA 2KYXA 3AJ1A 4QU6A 4JKFA 2GX9A 5KFQA 3R8YA 4HHHA 2CWXA 5DM7Q 4DF4A 4ER8A 4CD3A 2V8VA 1LFWA 3A5LC 2YX1A 4YDXA 1NZAA 2IVMA 3DDKA 1GLFO 3P8BB 4M3TA 1WAFA 3E01A 2RAQA 3ZSQA 1UFWA 5JS1A 2Y8YA 3PR5B 1WUUA 2HS3A 1PGZA 2JEFA 4LQ9A 3OBIA 4WKRA 3FBEA 2WB4A 1WWHA 3CJ7A 1V5VA 3T5HA 4CEBA 4F2SA 3DI6A 4DFJA 2Y8WA 4Q0BA 1J5OA 3NH2A 1PAUB 4ZS6A 2RH3A 5HMXA 1L3SA 3SAFA 4KB1A 4PEOA 2KZZA 2YWGA 3ZSYA 5EN1A 4N56A 2IMWP 5JLFA 3GG0A 5HANA 1EETB 3V81B 1RQ0A 1RDBA 2F3JA 5C2DA 2HLUA 1M5VC 2MKSA 4ZCKA 3OYFA 3OL7A 4CLFA 2HHTA 1N88A 4FNIA 1Q79A 2ZD1A 4L73A 4KHPJ 1VQ8S 2ZGYA 1MMLA 3B82A 3T5LA 3ZT2A 1XNQK 4W5NA 3L3VA 3IN5A 2HIQA 3LQVA 3VQ5A 3U3YA 1ELOA 4OX9K 1X4GA 2WTUA 2J8AA 4DTJA 3UPFA 4B3OA 1U25A 1M90T 3GIJA 2NUHA 4IJAA 1S79A 3V2UC 4KGXB 2CQ2A 4CJEA 2EKYA 3PVXA 1T9VA 1NO8A 4B3SJ 1N0UA 1ZC6A 5JLHA 1YX2A 5IC4B 3NGDA 2GIRA 2C2KB 3BSNA 3E51A 4UOCA 2W24A 1X1PA 1BG3A 1VQPS 3VQ9A 1BGXT 1BO5O 4ECVA 1F3VA 3PXGa 5HAOA 1YXQA 4DU1A 1TU0B 3I32A 1S76D 1VHIA 1LKZA 2QGFB 3QBCA 1J27A 1NMDA 4MYUA 5E3CA 2XRIA 1UWAA 1C6VA 4I4BA 2RU3A 2AEMA 2OPSB 2BTFA 5L39A 1OYDA 1RT6A 4PCQA 1XNQF 3U1MA 1CSJA 2ZBIA 1N4LA 2QG9B 1MA9B 5HL7Q 1NH8A 1Q16B 2FHJA 4CJLA 1SV5B 2PD1A 4DR1F 2IOCA 2M3DA 3OXGA 4KHRA 4OX9F 4N41A 1P9YA 4LF4J 2AX1A 1N6QB 2EPIA 1LEOA 2IHR1 1HD1A 4FJ7A 4M3RA 4LQ3A 4NLDA 2YWFA 3CCLS 3WXKA 4ED8A 4OLAA 5K8OA 4I0WA 4H0PA 1JLGB 2EFPA 1QVFM 4YEAA 2HFUA 4UT4A 2HVEA 3MFIA 4B3MK 3HZ6A 1UJ4A 4GW6A 2HRTA 3IFEA 1YJ7A 4I9QA 3LDSA 4GKKK 4CHNA 3AD8C 3Q8PB 1HBOB 3VHQA 1NJIO 3QIPA 4Z4GA 5E5NA 3DOMB 4FLZA 2V50A 4J2DA 2CRLA 3QJPA 1EXQA 4ZK7M 3IBFB 3HVWA 4V19X 5GAGI 2IM0A 4CEEA 3W9HA 3CQXA 4TQSA 5B0AA 2DO4A 2PAVA 1RDRA 4DTUA 5I3PA 3EL2A 3W64A 4J7CA 3Q8RB 4OFZA 2OPPA 1RKIA 3ZTSA 4CJQA 3SEOA 3VQ7A 3VQSA 3J7ZO 5GADI 3B78A 3GCWP 1JLEB 1S6PB 1Q8IA 3OV7A 5HP1A 2OZMA 3TZYA 1VSHA 5F8GA 1QAXA 4G1PA 3KWIA 1RDUA 4PWDA 2MZQA 3FCVA 1OO0B 4USHA 1NK6A 4YB5A 5GMKa 4Z7CA 1YBUA 2V4RA 4G9ZA 5L38A 1TQLA 4B3MF 4U7CA 3PO5A 2V2ZA 2OAUA 5GAHP 4GKKF 3R2DJ 4U67Q 3GZ7A 1U2FA 4OKJA 4BQZA 1TYQA 3GYGA 1K6YA 2FPHX 3FQKA 3MR3A 2E4LA 1TMMA 4X65F 3DLGB 4JI1F 3FGUA 3MDQA 1M5PC 3G25A 1DURA 3J7YI 2O8BA 3ZNUA 5KI6A 5HQ8A 4A8KA 4IOAL 3EJMA 1S1TA 3DHXA 1HR0J 1RYRA 3V1OA 5DK5A 5E7OB 3C6UA 1TK0A 1WDTA 4YOYA 2AX0A 3T1HF 1X7VA 4FLTA 3UIQA 1PYOB 3V9UA 5CZXA 4CI6A 3CCWA 2UXBJ 3OR2B 5HJYA 2CQPA 1R0BG 2B5JA 1FXDA 3TANA 1ZBLA 3I5CA 2V2KA 3SQOP 2Q0RA 1OY8A 3EGVA 2OTJN 4MO4A 3BGRB 4KR0B 3W0LA 4KB0A 3TJAA 1KS2A 4WPAA 2G1HA 4FWMA 4Z4HA 2QWQA 1IKVA 3IO1A 4M5MA 1TFWA 1RT7B 2OPQB 2KT2A 1XMQJ 5J1EA 4ED3A 2XGQA 2DPNA 3W1YC 4ZPDA 4USVA 3HSZA 2X6SA 3ZX3A 3JYTB 1N5QA 4NWBA 2MB0B 5B0EA 1VAZA 1EIYB 2KHOA 1JWWA 1BY9A 5GMEA 3V6HA 1FXXA 1YLXA 1KOOA 3CPWM 4P71A 3OS2A 5I42B 4H4OA 3DLRA 1H2TZ 4ZVUB 2W4PA 1H2UX 3HPGA 3O3FA 1Y10A 1XEZA 3BJYA 2GVZA 2ZHOA 3ULDA 3RMBA 3W2WA 2B43A 1U1MA 1MWMA 1WF1A 4FJNA 5DM7L 3NGTA 3O2IA 3QO9A 2W9BB 3F0NA 4OLOA 1QSLA 4LFCK 3OVBA 2MEWA 4KHPF 1UWBB 1VRTB 2CZ9A 2Q66A 4J9LA 3DU6A 1FWPA 3FDSA 4A8MP 4PZVA 2V6AA 4RWTA 4FJ8A 3QWUA 5IT9Y 4I6MB 2Q31A 4CNZA 2PFUA 3BGOP 5GAGP 3QFHA 3HSJA 4CE9A 3CQ8A 3D1OA 3AO2A 1Z1ZA 4JKHA 1ZTTA 4B3SF 4PG7A 2YNHA 3A8KA 4R8UA 5TKWA 3QEWA 1FI4A 2HZVA 3ZT4A 4JI0J 3MR5A 3CCRN 5G0RA 3CDAA 4U6PA 2BJ3A 3QEXA 1RILA 3SSRA 4KHWA 2V2QA 5BR8J 3D0GE 1R27B 2BDPA 2QA4S 1CVJA 3I56N 4JI7J 1UA1A 3W8PA 3H40A 1YBAA 2YNGA 1X31C 2V68A 1BIUA 1RA6A 1CC7A 3R6MA 1FESA 2A2DA 4WQ5C 2MSTA 3AA8A 5CYMA 2NLWA 4DEZA 4LF4F 3FCHA 1SQFA 2HVHA 4LIRA 5JMNA 3G8TA 2QT7A 3ILJA 1KHVA 4BRMA 5KRTA 5KFIA 2JLEA 3MN9A 1MG7A 2RVJA 3ITHB 1URRA 4FOIA 1CBKA 1KQSR 2VC1A 3WIUA 3BN7A 4X2BA 4DDFA 1GMVA 1EWRA 4HI1A 2MGZA 5F9NA 2X1GA 3E01B 5F8LA 2RB7A 1T9WA 3MECA 3H42A 1M1KT 3U9DA 4DX8H 4WFAQ 2CNKB 3M6UA 2UVRA 4ILJA 5THWA 2IVPA 3B6PA 2NYHA 1EP4A 1LV5A 1HR0K 5GMDA 3TA2A 3GB0A 1TL1A 1RDAA 3C6HA 1YRXA 3DI6B 4Q0BB 1J5OB 4WF9Q 2DR5A 1RYSA 5CABA 3M9NB 1P27B 1BLUA 3I8BA 2QA4G 2Z0GA 1REVA 4N47A 2VBZA 4ILRA 4CTAA 3AVNA 2ZD1B 3EGNA 4Q8EA 2ZJRQ 3DCAA 5LY3A 2E1CA 1ZBSA 4CIGA 4WQ4C 5MLCV 2JFDA 1VQ9N 4NA2A 3G4SS 1B64A 5HI7A 1EAYC 2FVPA 3AVCA 2B9XA 4FLXA 2H3EB 3LZJA 4RUHA 3FUYA 2KM8B 4B3OB 4YN3B 4JK8A 1RA7A 1N8RT 5HO4A 2P6SA 2E8AA 4JV1A 2D7SA 4F0MA 5FLXU 1HR0F 5KFBA 3NS5A 2HWTA 3AVAA 1U1LA 5KFYA 4YY3J 4A8WA 4JUZA 3H3NO 3MMVA 1ITPA 4ILHA 1R7IA 2RSQA 1VQKS 3AOCA 2R8HA 4LF9J 3KIOA 2UXBF 2UUCJ 2FQQB 4U67L 4Y6IA 4H8KA 4Z37A 2M88A 1UW4A 4RZRA 1WSGA 3CCQS 3X3UA 1W0HA 2Q79A 2NPFA 4ZPCA 2DNRA 3H59A 2HEKA 4ECRA 1XMQF 4DPYA 4GKJJ 5KFAA 4XPEA 5KQDA 1OMSA 4BWJA 3TYTA 4J90A 4FM1A 2F8MA 1SQGA 3SCXA 2Z4PA 3UB5A 2QE5A 3T41A 2H4WB 2GGPA 1S49A 3TPQA 3CI5A 1NKEA 3PJ9A 3JTOA 2DHSA 3CJ9A 4JI0K 2CH5A 2JVRA 3NCRA 1GX6A 4QPXA 2HOEA 3UWTA 2FBXA 5FRMA 3C95A 4Z4CA 1YJ9N 4DR2K 2O8FA 3MXIA 2VCPA 5BR8K 3UR3C 3VA3A 1NOYA 4PG6A 2DYAA 4DTRA 1MN7A 4CIEA 1TKXA 2CQHA 4IUFA 5BXIA 5CR4A 3ATVA 2JLFA 2E1RA 3MR2A 3K58A 3CCSN 3P5BP 2K2PA 4BLGA 1RABB 3H2UB 2R7UA 1WNEA 4E0DA 4CHOA 4IEIA 3HX9A 1P8GA 5AQXA 2OPPB 2EC0A 4Y65A 3L2WA 3M9OB 3CJQA 3LPTA 4FJJA 4KRWA 3U27A 3PYGA 5B8HA 2VDIA 5HP1B 3DKDA 1U0SA 4C0HA 4DR7K 2OP5A 3T69A 4PWDB 1Q7YO 3GQCA 3R5BA 3FSXA 4JI0F 3EGZA 3FRZA 3VQ4A 3PX6A 1U45A 1HPZA 3W5XA 5BR8F 1TYQB 2O4GA 4JI7F 2DH7A 2HLTA 3KKSA 3MK6A 2LXUA 2O8BB 1T02A 2AF6A 3ETOA 1S1TB 3MFHA 4CEAA 4WP9A 4USMA 3A5NC 4PPZA 3CYMA 5AQJA 4WXOA 3TR8A 3OJUA 2D3O1 3C6UB 3R5AA 4C97A 3CC4N 3KJNB 1IKYA 4ZVSB 2NREA 4CIOA 5CXTA 5EVZA 4DG1A 3M1FA 5AQMA 2DRAA 2QWMA 4AT1B 3P6YC 1JB0C 2YNFA 3LOUA 4X84A 2B5JB 3JSMA 1OSDA 4A8YA 4A2BA 3CVKA 1YBTA 2YKNA 4DSIA 4DB3A 3M3ZA 1HWIA 4GVBA 1WEXA 2KRRA 1IKVB 2K3KA 3Q8YA 1VC5A 2GMHA 2WK4A 1KQKA 4JRPA 5IT9O 5J1EB 2B4UA 4QR0A 5J2MA 1AROP 3IM8A 1FFWB 3ILOA 2Y3YA 4TXSA 1APSA 5HMYA 1IBMJ 3PFEA 4PAAA 1VQYA 5FLXY 4N5SA 5AQWA 3V9ZA 2KFNA 2MDAA 4DL4A 1BISA 5HJXA 4P2SA 1QAYA 3CSKA 3QJLA 5I9EB 3V6DA 3T3FA 3S6EA 5F3ZA 1Z05A 5I3QA 3JS6A 3CCVS 4X62J 4E19A 1S6UA 3KK1A 3CWJA 4I6AA 1QTMA 3NGRA 4EP4A 1KDNA 2PN6A 3VQPA 1P6TA 3IAYA 3LALA 4YY3K 2CQ1A 3EE8A 1S0VA 4DU4A 1F2GA 3W2WB 4TNOA 4WXWA 4UZCA 3BSCA 1QVGR 1D5AA 3R9LA 4U96A 1Q82T 5IT4A 2UUCK 3QO9B 1SKWA 3K0SA 4E1MA 1JJ4A 2Z30B 3WBZA 4FLWA 4C4WA 3UFCX 2XTJP 4HVJA 3PIPL 4ALZA 1Y3JA 3VGLA 4IO9L 4WFAL 1YVFA 3AO5A 4KTWA 5KRSA 4GKJK 4WF9L 4L74A 2AQ4A 1N52B 3IP0A 1VQMS 4K4TA 4DL6A 5FROA 2VODA 1TK5A 5DJBA 2YNHB 4GVMA 2L48A 4HDGA 4R8UB 5G0RB 4A47A 5G4DA 4HT5A 3R3LA 4YY3F 3HVTA 4USIA 2ZJRL 3ZZUA 4LF9F 4NZ7A 3HCXA 1VBXA 3MOJB 1T7PA 3D45A 2FJXA 4U8YA 2UUCF 1DQ8A 5M2RA 4CEDA 1S97A 4PWUA 1REGX 2ACYA 3O44A 2H5IB 4HACA 2YNGB 1LCUA 2WZ1A 1U2VA 8AT1B 3HL8A 2O1PA 2KXNB 3VAFA 3AVFA 3PTWA 4I69A 2KT5A 5AQKA 2KFZA 4GKJF 3TJ9A 1PBUA 3GSIA 2WVBA 5CYMB 1EX4A 4K0KJ 3IDHA 2XO7A 2DHHA 1SJQA 1SJRA 4KHMA 1GLLO 4BRGA 3KDOA 4KGVB 4C98A 2YH0A 3RRHA 2FC8A 4ECTA 2PA3A 2W41A 2GJ2A 3UD5A 1WAJA 3KOAA 4P74A 3J81j 3BDPA 2MY8A 2M8HA 3F44A 4YDDB 4RTFD 2GQ2A 4QW9A 4DR6K 3TTFA 1F9FA 1FKPA 1M1GA 4CEFA 3CDBA 1S99A 1RDWX 4DSLA 2MGZB 1FRKA 2QJ3A 3CC2N 2OMLA 3CMEN 3MECB 3VOVA 1R8HA 5RUBA 1UEUA 2R9LA 1S4EA 3WIVA 4M63A 1EP4B 4KQZA 1WC0A 1VQLS 3LUYA 2CQDA 3CEDA 1TL1B 4U7UK 4KV8A 3TUIC 4KPCA 2D0AA 3ENQA 4Y3CA 2N3LA 5LT5A 2W25A 1WD6A 2P9PA 4AXIA 2KL8A 2BOPA 1UPMB 1ZYQA 1X0PA 4F3OA 3DAWA 1P1LA 1REVB 4DKWA 4QCLA 4LF8K 4FZVA 2ASLA 4CTAB 3JB9k 3CTRA 4FZXC 3OFHA 1AXQA 1S6QA 4QIWD 4B9VA 2LQ9A 2AT1B 4E7KA 1YTYA 2JEGA 5A6PA 3BP8A 2WW4A 1RLCL 3VZIA 4U7BA 3ZZPA 1X9SA 3S3MA 1T9UA 3RBDA 2FGCA 3HF5A 1HWKA 3MMCA 1QZ6A 5KFWA 3QBWA 4O3RA 1J53A 4NMXA 4ELVA 5KT6A 4ZJLA 3NOCA 1TVRA 3E9LA 3SLCA 1DQAA 1K44A 2XM3A 1OWXA 1NGDA 3HJVA 3Q2TC 3IAS9 5L8RC 2XSFA 3CCEN 2BRLA 2VGNA 8ATCB 3TA0A 2HGLA 2QYGA 4LF8F 1HYZA 2QWPA 2WVFA 3QFUA 3LWLA 2X78A 3SSSA 1T05A 4C9DA 2YPZA 2EI5A 3AODA 3HHKA 4JK7A 1U26A 4OYWA 3HHDA 1TMJA 1YRTA 1TAQA 2G1DA 3ULEA 2BE7D 1YVNA 5AQHA 5ETVA 1S9FA 3MM5A 4EZ9A 2WB1D 3O1WA 1U6FA 3NVMA 3OVNA 1IBMF 4I67A 1VQ7S 4LF6J 1X5TA 3QICA 4CZEA 4CJFA 3QZ7A 3WXJA 2GGPB 2UUBJ 2E88A 5CY4A 2KO1A 2VPWB 4OIXA 4WIIA 4E8UA 1BCOA 1RHQB 4OYXA 3R5CA 5L1JA 2WUSA 3J81U 5KFTA 1XI1A 2HNYA 2V63A 3KJVA 2ATQA 3OVAA 3DGPA 2RT3A 3G6ES 3HP6A 1Q5VA 4CZIA 4ANDA 2M2BA 5EOYA 3L95X 1NDLA 4NL5A 5BYQA 3BBBA 2AV5A 4Y2IA 2O8FB 4RU2A 1RBOB 2CJAA 3NGKA 2GX8A 4ED4A 1V5IB 4OPHA 2HK2A 3VQBA 3CMAS 2EHGA 4Z0UA 5AQLA 2X3DA 4DV0J 4LBIA 2Q1LA 1LW2A 4WFXA 4FKXA 1QE1A 2WONA 3CJSA 4QR2A 1MN9A 4DR3J 1KAXA 1X4FA 5KT4A 2QW9A 4URGA 1NLKL 3KK3A 4USWA 3TA1A 4CJSA 3FEXB 1S5ZA 4ZCLA 1H6KX 3D6HB 2F8TA 2NRVA 4EAHD 3ZFVA 3OSPA 2KDOA 1PYTA 2GO9A 2NZ4A 4RBVA 3Q8UA 3E66A 1EKEA 3OVSA 2CUYA 2L3MA 4MKVA 1YHQN 3EM1A 2KG1A 2QIFA 4HH1A 2OSQA 2KB2A 3OYDA 1HPZB 4EBDA 2B56A 1UFKA 2VA3A 3KLIA 2NQPA 2XMVA 1QHAA 3DU5A 2W1BA 3ZX2A 2UUWA 3MMJA 3ILIA 4DUYJ 3QRPA 2E9TA 2ZBCA 5IC6B 1PJ6A 4LF1A 1N5VA 2QLWA 1VSKA 3Q89A 2DHGA 3OLAA 3MM9A 4LF7K 4TU9A 3AVKA 4M7XA 1IKYB 4K0KF 3PG9A 2QA1A 4DG1B 4KH4A 3MCOA 3IR5B 2HQCA 2YNFB 2W2MP 3VMFB 1PSDA 3JSMB 1XN9A 1HWJA 3CJ1A 4GO7X 3EEQA 2YKNB 1SQEA 5DQHA 4GVBB 4MO5A 3K8VA 4WJBA 1VDHA 2VWBA 4M3XA 5J2MB 5KFKA 5KFEA 3GOIA 1NM1A 4J9KA 3G96A 1BC6A 1ZA1B 1FK9A 3TSQA 2YNIA 1S77D 2KXHA 4G65A 3T6JA 3VQ6A 3V6DB 1T6CA 4YOVA 2XCPA 2R42A 5DO2A 2HQDA 3KK1B 3EMTA 4HHTA 3VEZA 4PRFA 1T3OA 2VPZB 2BKOA 3OYNA 3Q8VA 4LR8A 3SDEA 4DQ8A 5D0GA 5I3UA 1Q5YA 3RAMA 2XI3A 1KRPA 1N8RO 4C0BA 4MAKA 4KHSA 1VC0A 2HG4A 4XH4A 3M6WA 1NGHA 3VEVA 2ZOGA 1T3VA 3R7BB 1VBKA 5LL6Z 1IBKJ 3VQAA 1S1VA 1FTRA 1N5SA 3CJ8A 4DR4J 3HOTA 1N32J 5F8JA 3RMDA 2FVRA 3I33A 4JKAA 4CLPA 1GEHA 2QRRA 2P1JA 2BQRA 4PXEA 2GQQA 4FNHA 1FNMA 1S59A 3J81Y 4ERDA 4NLBA 3H4DA 4A8SA 5E3RA 4FCYA 2K8GA 4O3PA 2Y1JA 3AVIA 4HKQA 2DFFA 1VQ8N 3N28A 1OY6A 2CQIA 1H73A 4HCCA 2P9KA 3Q2SC 4I2PB 1KVBA 2HBLA 2NSCA 3THTA 2ZBQA 1VBZA 1FHTA 3NNAA 2OLWA 4CO3A 2K3IA 1R0AA 4JK9A 4HACB 1RHMB 2KI2A 2GTDA 4H0YB 5GVQA 3UI3A 3ENOA 3OT9A 1HNVA 1U2VB 3HM9A 2GJFA 4KO0A 2P9CA 4WQ4A 5HMWA 3GFYA 4QZVB 2DD8S 2FC0A 3R7SB 3VF2A 4MLHA 3A4TA 3VGMA 4J9UE 4DQIA 1VQPN 4LF6F 2B6AA 4MIWA 2UUBF 3VQEA 3PLAA 2XCAA 3PRDA 5L1IA 2G9OA 4X4SA 3DLEA 2P9LA 4ATNA 3SK3A 4DTMA 3NHGA 4C3KA 2DNNA 1OVQA 4DV2J 4Z7YA 3AV9A 3SJHA 3MI7X 3PRBA 4CRJA 1FKPB 2CNOB 1HQEA 2FY1A 2D0OA 1HNZJ 4S0MA 3TWZA 4PWWA 3GFHA 1JL2A 2CGLA 4ZVFA 4HTJA 1X9JA 3FZLA 2I8EA 4DV0F 1VQNS 1H3DA 2CQ3A 4P2MA 5KG1A 3P31A 2NXCA 3CCLN 1S57A 4NLPA 4MT1A 5BYRA 4DR3F 1KXPA 2FY8A 2ZJPQ 4O0NA 3N0VA 1CG2A 4OHVA 3MR6A 4YFUA 3KG1A 4JI3J 1N5YA 4J9MA 4PKHA 1XMOJ 1J2VA 2R8IA 1KVCA 3ZT3A 1I94J 4NRUA 2P9PB 3TVKA 3HVAA 3IRWP 1J5EK 2NXUA 2WRMA 1JNZB 4ISGA 3F41A 2XMAA 1O51A 1FX2A 3SCIE 1C1BA 1NPPA 3W5YA 1RHJB 3J80Y 4I9LA 1WI6A 3K0JA 3QFPA 5JJBA 2IGIA 1S6QB 1W7WA 2H65B 3GLJA 3N01A 1SKSA 2D3ZA 1IJEB 1XR5A 2QTWA 2VASA 2QX0A 3CO0P 1PILA 2NRHA 1FX4A 2IA0A 5JMVA 2XYPB 4NLTA 4DUYF 2DIUA 4HCBA 3MMCB 1B92A 4WFNQ 2CA9A 5IS2A 5CE3A 2FIUA 2ATCB 2LLZA 1TVRB 3SFGA 5LJ5Y 1JX4A 1JIHA 5LMUJ 3FNNA 4YOTA 2EG2A 1W2BM 2F9DA 1JJ2R 5IV3A 4O55A 3RRGA 2ZBPA 4CDIA 3MXHP 3DMJA 2YWEA 1QAIA 2MJUA 4LBPA 3V6JA 2XQCA 2V7ZA 3F9MA 2B4PA 5HRPA 2HIYA 1I1GA 2C2NA 2J0SD 3QPIA 1T05B 2M4MA 4DXLA 3WXLA 1BL3A 1KOHA 3M32A 4U7UD 3AVBA 2XYGB 4IKAA 3VGTA 3IMXA 5FPEA 4FYYB 3OTDA 1Q82O 2K1RA 3ULEB 4RBUA 2VPYB 3CDUA 2R7VA 1BCMA 2PFDA 3MM5B 2C3YA 3CO9A 2GUIA 2KH9A 2C2MB 1WORA 4JOUA 1UJ5A 3M6GA 2F63A 4MKBA 2FJWA 2FXUA 2XC9A 3H45C 3SUPA 1MSWD 3KFWX 3ICLA 4AQYJ 2MKHA 1VLOA 3H90A 1L3VA 3ZSZA 5GAHU 4AXJA 2HNYB 4RW8A 2H5EA 3KJVB 3D2FA 3DGPB 1Q95G 3AA4A 2OJ3A 4JI5K 3MF5A 2QZ8A 3QT8A 2I6WA 4DPXA 4CM2A 1NMEB 4IH5A 2DK2A 3D7EO 4JV2A 4OKEA 5AR0A 2ZF5O 2VFSA 4O3OA 4RW4A 4KHQA 1IBKF 4ZP8A 3QWPA 1LW2B 3DLHA 4DR4F 3IWLA 3OYIA 3VERA 3E3XA 2E2OA 5KFUA 1W2IA 1QE1B 5KG2A 2WONB 1N32F 3SPZA 1U1KA 3A3PB 2OH2A 3KK3B 1UPPA 4Z4FA 1NSKL 5LSOA 3EE9A 2PGCA 1NG9A 3EVWA 4Q45A 2DNOA 3OY9A 1SC4B 1VI7A 2LEPA 3HPHA 2DHAA 3L7UA 1D8YA 1R8PA 2GMLA 5HMZA 1Y64A 1MWQA 1GT8A 4GMJB 1XHZA 4OKKA 3HRGA 1HW9A 4UUXA 1WOSA 4CF9A 1WSFA 4R0JA 2KHDA 2XS7A 3D2EA 3M6VA 1NBEB 4GVEA 4F2RA 4DV2K 4RUAA 2HVZA 4RX6A 3ADAC 3OXFA 4PKIA 2ROGA 2FJVA 4FZZA 2XG8A 3Q7CA 3TAMA 1HNZK 2MLXA 2RQCA 5F8NA 2JRSA 2LA4A 2OZSA 4ECWA 2F96A 4X4PA 2DCUB 1Q86T 2P9EA 4OYOA 3AVJA 3KLIB 4QJVA 3ZZOA 4ETZA 1XK8A 1NJWA 2M7SA 3D68A 4DV4J 3TP2A 4ENOA 1I3OB 4JI3K 3NG8A 1XMOK 5A6WA 2PI4A 2N7YA 3MM9B 2CVIA 1ZS6A 1I94K 3EXYA 3VF4A 3BKUA 1S0NA 3M8PA 2QA4N 2UXDJ 1P8ZA 2IC3A 3G10A 2C2RA 4DPUA 1MW7A 1D1UA 4E1JA 1OVYA 4KHUA 2Z1JA 4J2BA 4CEOA 3AJDA 3SBMA 3I0RA 3CNQP 5E3PA 3NGYA 5GAGU 3DYAA 1RCOB 1SB6A 4IG3A 2Q3PA 3AJ2A 4DV2F 4C8KA 3BZKA 4R5PA 3PYEA 3FZ2A 1HNZF 1FEHA 1FKAF 4EHTA 1FK9B 1HJRA 2YNIB 1X4AA 5E2QA 3QDKA 5GADU 2YKPA 2VKZG 4MK8A 2J0XA 3AO3A 5FIIA 4YOWA 3QT7A 4MMOA 4JI3F 1XMOF 4WYWA 3D9BA 2P9NA 1BI4A 4GNIA 1IKXA 3G87A 3SDEB 4C3MA 1QSSA 5I3UB 2EKNA 1I94F 2PO4A 4OZLA 1ZA2B 1IR2A 1G99A 2WVDA 3GJSB 4CERA 4A59A 1S1VB 1TUYA 2AZ3A 1CULB 5FPDA 1ZBIA 1YGYA 4V19J 4O3NA 4CFBA 2A42A 2ZJPL 3IFRA 2ZOFA 2HRYA 2M8DB 5JXSA 4XAKA 2FF6A 2E1AA 4YHHJ 3HP9A 4LH4A 1FD2A 1VLYA 1L3UA 1VGYA 1C1CA 2QO3A 1ZETA 2D0PA 2J0WA 3OS1A 2QLJB 4AQYK 2D1KA 2FSKA 1FEEA 3I55S 3O3HA 4DMZA 3V4MA 4M3YA 3CXCM 5KOXA 1VHXA 4ED7A 2E1YA 2NRTA 2F9WA 5LMUF 1UAXA 4CJ4A 1HWUA 3G4SN 2XWXA 3CCUS 5KG6A 2P9KB 2OFHX 1SC1B 1CJTA 5D4NA 2MKKA 4A62A 2LP4A 3U02A 3WXIA 4PXDA 3G6VA 4O4GA 2SXLA 3M4XA 1LXNA 3K7RA 3DRSA 1R0AB 1KSPA 5K9FA 1VISA 3RVCA 1LQ9A 1QQCA 5CHIA 1HNVB 5A2QY 5AQQA 5IWAJ 3LF0A 3KHYA 4FYXB 4IQXA 3NMRA 1RBLA 4KO0B 4WFNL 1KVIA 2XSJA 4C8NA 2OEJA 4F4ZA 4E2FB 4RW6A 5DQIA 1VQKN 1SQKA 3QERA 4MIBA 3C16B 2B6AB 2VC0A 5A8KA 4OI2A 3AB4B 3QT6A 3CCSS 1U09A 3NLCA 1G15A 4AQYF 3CCQN 2CJYB 3DLEB 3HXMA 2P9LB 3SCKE 1XBWA 1B9DA 3J80O 3R5DA 2FZCB 3I4HX 1CZAN 4RLEA 4URQU 1TL7A 4BWMA 1UEKA 1KEKA 1HQEB 3LWMA 1BDGA 3WC0A 1FJEB 4IRDA 4FJ9A 3HHNB 4IZ9A 1JL1A 3ZZTA 2XMTA 3PY8A 4F4WA 4PQUA 1KLNA 4UY8O 4ANCA 1OY9A 4B3RK 4AHVA 1BD6A 2V69A 3HTVA 3RU0A 4DV4K 3PO4A 1WF2A 3RR7A 5HQLA 3CMQA 4X64K 3T9NA 5GAEP 1Y97A 2RHQB 3UN2A 1RWKB 1N5YB 2YKQA 3H5SA 4LBHA 3VAJA 2AIRB 3O5BA 4ILGB 4FJMA 4H03B 5L1LA 3O8MA 3MZIA 3LANA 1PC5A 4KYZA 3SCLE 3WT0A 2DBBA 4FJKA 2XY8A 2UXDK 2OD4A 4PR6A 1BWEA 2Z58B 3MEEA 2HAFA 3JQJA 3Q8SB 1Z2ZA 4KH5A 1NXIA 1C1BB 4BC9A 2YTCA 4H4MA 3LA0A 3QNWB 3BZCA 4C23A 2JJ4D 3LAMA 4OJGA 3P4UB 5AE1A 3FFIA 4QWBA 1NEEA 1RAOA 2XZTB 4DCOB 3R7NB 5J1NA 3HD1A 5AE2A 4B8AB 1VJQA 1FWLA 4CO1A 3L6QA 2NRRA 1ZPVA 2EFNA 1VSIA 4KT0C 1AZSA 1JNRB 1SBRA 4DV6J 1FDNA 4DV4F 1HYVA 2HYIB 1AFIA 4ZITA 5DGBA 4DBQA 2Q43A 4NE9C 4DV3J 4YOUA 5KPRA 4AD6A 2YVSA 4BC3A 3LH2S 4V19S 4RNHA 2UXDF 2HFSA 4WP8A 4WU2A 2UU9K 1SH0A 1VRQC 2MHNA 4RJVA 5C10A 3L2QA 1BQNA 1FNOA 4KE5A 2A40A 2RUSA 4OLPA 2D4WA 2VZ9A 1K0TA 4HT7A 4B1WB 3EYZA 4QWAA 2VG7A 4NOHA 1FCAA 1KR4A 3M32B 3UKUA 2JL9A 5U47A 1LW0A 2K1RB 2PEHA 2XB2D 3FLCO 2DGWA 4JI2J 2VWJA 2EK6A 2K7KA 3BYRA 4YHHK 2XMKA 5H9FJ 3KNAA 2EFOA 3Q23A 3CIZA 1HARA 3UN5A 4PABA 3PEHA 1WEZA 2EXUA 3FK4A 5MAOA 5A8RA 1OS5A 1WKLA 4I56A 3ZEUA 5IM0A 4RW8B 3D2FB 4A48A 3MPVA 2DR9A 4PUOA 3ZZZA 4NZ0A 4ZLPA 3K9JA 4MKYA 1H1VA 2RDIA 4O0IA 3GYNA 2JC1A 5CH7B 4C6AA 4QIFA 5ADZA 1G2EA 4LFAJ 4CLLA 4CQ1A 4RW4B 2NRXA 3MX2A 1Q1KA 4DOZA 2AKWB 4M45A 1YJUA 2BANA 4P10A 2F40A 1WC6A 3CCVN 1WHYA 1XERA 3RAXA 1TFYA 2V2VA 4KY3A 3C65A 2Z2YB 1WC5A 1HMVA 4ILMA 4BDZA 2V9KA 4C48A 1LOUA 1FFSB 4P6QA 4CGJA 4N77A 3CB4A 4YHHF 3SAGA 2HHHK 1T94A 4CBWA 1TV6A 4ILLA 4O23A 1JLCA 3ZLJA 4HLBA 4LRAA 4NXNJ 1RBTA 3RUBL 5BPNA 4H0OA 1EZZB 2FYXA 4CO2A 3D2EB 4NA1A 3OW2M 1Q8LA 3U3GA 1JLAA 1CJKA 1JXLA 2YWWA 3TAMB 1XWLA 3MDFA 4PQAA 2D1CA 2HFNA 4BS2A 3J7Z5 2M70A 4CZLA 3U6FA 5HOOA 1VQMN 2JWNA