4PQUA

Crystal structure of hiv-1 reverse transcriptase in complex with rna/dna and datp
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
545
structure length
545
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/dna/rna
molecule keywords HIV-1 Reverse Transcriptase, p66 subunit
publication title Structures of HIV-1 RT-RNA/DNA ternary complexes with dATP and nevirapine reveal conformational flexibility of RNA/DNA: insights into requirements for RNase H cleavage.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 146
structure length 545
sequence length 545
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4pquA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4pquA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4pquA05
1RT4B 3VQAA 4IFVB 4NLRA 3PW7A 4NLOA 3NAEA 2I1RA 1WAFA 4Q44A 4ZHRB 4HVJA 3V6DB 1S0OA 2Y1JA 3NH0A 1EXQA 3MECB 2R8GA 4K4ZA 4B9LA 4KB0A 4ID1A 4O4GB 4M3XA 1HARA 4DQPA 4LSNA 3LAMA 5KT4A 2RF2A 2C22A 4WFXA 3GV7B 4C8MA 3ISNC 3ZSOA 4CJLA 4IBNA 5CYMA 4FLZA 3OYGA 4OLAA 1C6VA 4IRDA 4OVLA 3H98A 1J5OA 3UDLA 1HPZA 3CFOA 2WHOA 4ECUA 3D5MA 3P1GA 4OL8A 4H4OA 4CJPA 1HNVA 5CYQA 1JKHB 2HB5A 4J9NA 1ASWA 2HNDB 2VG6A 2IOCA 4F4YA 4CERA 5KI6A 5KG4A 2AGPA 4K4XA 3M8SA 5KFPA 4RU9A 4CF9A 2OZSA 1KRPA 4RNHA 3CFPA 1JL1A 3S3OA 1RTIB 1UA1A 2WONA 3DI6B 4KKOB 3SQ0A 4CF1A 2ZD1A 3ZT3A 5KT3A 2C2RA 1L3TA 4KHRA 4KHNA 1RBUA 3HPOA 1BQMA 1A5WA 3E01A 1IH7A 4WFYA 1XC9A 4Q8FA 1T05B 4XPEA 3UR0A 1RT5B 4C8NA 4YFUA 2UUTA 2DTUA 1RILA 1CSJA 5L9XA 4GW6A 3TR8A 1VK0A 2YNFB 4FJMA 3S9HA 5F8LA 4CJUA 3S3NA 1KVBA 3MFIA 5J2NB 3HO1A 4YR3A 1SV5A 1L5UA 1JIHA 3VN5A 4NYFA 3GIKA 1QAJA 3CDUA 1U45A 4MFBB 3V4IB 4FM0A 5F8MA 5F8NA 4KAZA 4H54A 3M8QA 2QXFA 3EZUA 3I5CA 3CFRA 1WSIA 1U04A 1FKPA 4FW1A 4QCLA 5EWFA 4YMEA 4IG0A 2XY6A 4FM1A 1C0UB 3KLEB 4F4ZA 3IG1A 1A5VA 1DTTA 4BE0A 2YNHA 5L1LA 3M8RA 4ZMMA 3KLIA 3K59A 2CKWA 2GUIA 3MAQA 2IM3A 4URQU 3LP0A 3DLGB 3JSMA 4E7HA 2ETJA 3RAQA 3OLBA 1L3UA 2DY4A 4AHRA 4IDKB 4FVMA 4OKJA 2UVUA 3MEEB 4FZXC 1S10A 4PWDB 3DOKB 3TVKA 4F3TA 1XR5A 2FVCA 4ED0A 1IKXA 3BGRB 3RTVA 3V1QA 3FRZA 1DLOB 5DG9A 5J2MA 3ZT1A 4CFAA 3QEWA 3QGGA 4IR9A 2RDIA 1BI4A 1QQCA 3RR8A 4CEAA 1QSSA 3DLBA 1XR7A 4J9QA 5KG0A 2ZQBA 3MEGB 1UA0A 1C0TB 4R5PA 4R8UA 2O5DA 3LAKA 2X6NA 4ED7A 3KHRA 4FJGA 4LY7A 3TAGA 4X2BA 3AVKA 4AHVA 4RW6A 2IDOA 1X1PA 3OS0A 3SNNA 2J6SA 4IKFA 1GX5A 5F8IA 4CGJA 2F8TA 5CZ1A 3FFIB 4DSJA 4QW8A 1QUVA 3RBDA 3SQ4A 4Z4GA 1YVUA 3AO3A 3IRXA 2FBYA 4FJXA 4GVMA 2IAJA 3MF5A 4JS5A 1SH3A 4I2QA 4ZVHA 1BGXT 4XPCA 2VG7A 3NF8A 4I2PB 3EZ5A 3V9WA 4MKBA 4ZPBA 5HROB 1N5YB 4O3PA 4ZVFA 5EDWA 2DFHA 2Z1HA 4Z4FA 4TN2A 4M45A 1JLQA 4CHQA 1LV5A 4M95A 1RT4A 5KFTA 4CEQA 4IFVA 4DL7A 1JLBA 1QHTA 4N41A 3OYEA 4O3OA 2YKMA 1RDCA 4ZHRA 2BGGA 2G8IA 3OHAA 4NLDA 1U4BA 3V6DA 2FJXA 1U49A 2W9AA 4ECVA 1S9FA 3BR9A 1RTJB 4O4GA 5HRSA 4OLBA 3NFAA 1SKRA 1SUQB 5F9NA 3VQSA 2C28A 1ASVA 4RW4B 3T19A 3SV4A 4LQ9A 3AA4A 1D9FA 1ZBUA 4W5QA 1J53A 2D0BA 1HNVB 4TXSA 4DTNA 4DL6A 3PR4A 2JGUA 5DK5A 4F4WA 3SPZA 1WSJA 3NDKA 1NJWA 3KKRA 1JKHA 3AO2A 3UIQA 4HKQA 3FDSA 2HNDA 4RUCA 5DGBA 3DM2B 3BSOA 4FLYA 4RUAA 2WONB 3M9MB 4H8KA 1Q9YA 2WRMA 4N47A 4DEZA 2FBVA 1RTIA 4EP4A 4KB7A 1C1BB 1R0AA 1UOCA 3LZJA 3DI6A 4KKOA 4B9VA 4I7FB 3PX4A 4NLPA 2BANB 4DTPA 3PO5A 2QK9A 2RN2A 4DFPA 1TK0A 3OYNA 1NJXA 1TKTB 5I3UB 3V1RA 3DRPB 4ED6A 3WNHA 1JLGA 1T05A 3LPTA 4JLHA 2W8LA 2HHXA 5KRSA 1O1WA 3C6UB 1C0MA 2IM0A 1SV5B 3QIDA 2UUWA 5KFUA 3AO1A 3ULDA 3BSCA 3QERA 1NK6A 4CFBA 5J2NA 4CJ5A 3PW4A 1SKWA 3G6VA 3VQ7A 5DQHA 1S5JA 1WLJA 4NCAA 3EPGA 3F9KA 3WNGA 3M8QB 4KFBA 1KFDA 2ILYA 2R8KA 3V4IA 4CHOA 4FS1A 3KK2A 4ZVGA 4DF8A 5I42B 3RMAA 3TAMA 4DFJA 3KLEA 5EWGA 1C0UA 4ZP7A 2FJVA 4F3OA 3IGNA 4IKAA 4DSLA 1G15A 2I5JB 4KPYA 4Y2AA 2HAIA 3CDEA 3P5JA 1KVCA 4F4KA 1TKXA 3HJFA 2HHTA 3MXMA 4MIAA 1VSIA 2IJNA 4PA1A 3LP0B 3NGZA 4RZRA 3JSMB 3AV9A 1VRTA 1WSHA 3PW2A 2OZMA 2BQRA 3EPIA 3KJVB 1N6QB 4TLRA 4GC6A 4FLUA 3DLGA 3L2UA 4N5SA 2UVRA 3MR3A 4NCBA 3LP1B 3RR7A 1BQNB 2B5JB 2AU0A 4B08A 1Z25A 3HL8A 3SYZA 1S49A 3RMDA 3OYJA 3V9XA 4DQIA 3SI8A 4IDKA 5DQIA 3BDPA 3K5LA 1MU2B 1HMVB 3MEEA 1IKXB 1XHXA 3GIJA 2YHAA 3DOKA 1TVRB 3QIOA 4CJRA 3MEDB 3GIMA 1T03A 3MXJA 2YHBA 1DLOA 2QKKA 3AA5X 1NHUA 4RNMA 5KT5A 4KTZA 3KHLA 3OYCA 4OGCA 3K5NA 2F96A 2FBTA 2D7SA 3NGIA 1D5AA 3V9UA 2OPRA 1S6PB 4DL4A 4R8UB 1BIZA 1U47A 2E4LA 3V9SA 3MEGA 3PUFA 1JXBA 3NAHA 3P83D 1SH2A 4BDZA 4FJ7A 1FKOB 1QTMA 3LP2B 4K4UA 4FJIA 1S0NA 3THVA 4M3TA 3HHKA 1VSLA 2WB4A 3LALA 3FSIA 2OPQB 3TQ1A 4Q5VA 3CO9A 1MMLA 5KFMA 2V9WA 4CEZA 4WXOA 3GQCA 3RB0A 4OKKA 2BR0A 2D0CA 1JL2A 1TAUA 4I2PA 2C2EA 2KTQA 3H5XA 4CF0A 1VRUA 1KSPA 2F8SA 4CF2A 4BE1A 5HROA 1N5YA 4C8LA 3QZ7A 4E7KA 1NOZA 3HSTB 1JLBB 4TY9A 1L3SA 3AO5A 4QWDA 1IKVB 3NCIA 2YKMB 1ZETA 2W7OA 4LQ3A 5KRTA 3OY9A 2ASDA 1RCHA 4NLQA 2C2DA 1NK4A 4CJKA 3I0SB 3B6OA 4CGIA 4CK3A 3NF9A 3I5AA 1RTDA 4ZP9A 2E9RX 5C42B 4DL5A 1S1TB 1Q8IA 3KD5E 5KFSA 3AVCA 4WZQA 1RTJA 3L2RA 4WFZA 3LWLA 1VSHA 2KQ2A 3TAQA 3SCXA 5KGWA 4OGEA 1SUQA 2KW4A 4RW4A 5HRRA 4Q8EA 2OPSA 2G8VA 4ZPDA 2BE2A 4Z4HA 2JLEA 2HVHA 3VA0A 5KFKA 1RDBA 3Q8SB 4HCBA 4NZ0A 3OYBA 4CHYA 4MK8A 1TQLA 4ECRA 4F2RA 4OKEA 1TL3A 5D3GA 2IM2A 3DM2A 4K8XA 1R0AB 4JRPA 4EYIB 1F21A 4K4WA 4FJ9A 1IG9A 1NJYA 5KG5A 5L1IA 2WCXA 4BE2A 2ZE2A 4ZP8A 1C1BA 2G8HA 1XI1A 2FJWA 1HNIB 3VQ8A 3G0ZA 2HHWA 4I7FA 3PR5B 4E3SA 3L3VA 4J2AA 1DTQB 2BANA 4ELUA 5KG2A 2V0NA 3RRHA 4LD0A 1JLGB 4B8CA 4ECXA 2DFEA 3NH2A 1LWCB 1TKTA 5I3UA 3DRPA 3VQEA 4O3NA 3QGIA 4CIFA 4CEOA 4RNNA 2P1JA 4DF4A 4ECTA 3C6UA 1JLEB 2XY8A 3V1OA 2HW3A 4J2BA 2YNIB 4HUFA 1RT6B 4ICLA 2IGIA 1JX4A 5KT2A 1J9AA 1T7PA 4CIGA 3H5UA 2AX0A 2FLNA 2Q3SA 3N6LA 2Z1GA 2QE5A 4KFBB 3KK2B 4ECWA 3T5LA 4NLWA 3QESA 1X9WA 2G8WA 3HKWA 1VSFA 3TAMB 4DG1B 4ID5B 4NLSA 2ASJA 4TQRA 3IS9B 4XIUA 5I42A 3F73A 3Q8QB 1CXQA 3DMJA 5HP1A 3U6FA 1WSGA 4FZZA 2XGQA 2DPIA 1UAXA 1TKXB 2I5JA 3CJ5A 1ITGA 1BCOA 3VQPA 4QWBA 1VRTB 5KT6A 3QIPA 4TQSA 3AVIA 2WTFA 3OHBA 4Y3CA 4NYNA 4DFKA 1CXUA 4KE5A 2RDJA 1FK9B 3TABA 2HWHA 3KJVA 1N6QA 3EY1A 1NK8A 3U3GA 5DGAA 3KLGB 3LP1A 3ISND 3CM5A 4FJHA 3OL7A 5KFAA 3BSNA 1BQNA 2B5JA 4KB1A 2Y1IA 4DSKA 3H40A 3PW0A 2IBKA 3CM6A 2XY7A 1IKYA 3LPUA 3O3HA 1REVB 3NAIA 4URSA 3OSPA 2FC0A 1MU2A 1HMVA 3KMQA 4CJFA 1T8EA 1ZTWA 5DLFA 1K6YA 1T03B 4CE9A 1TVRA 3N6MA 5J2QB 3OYAA 4U6PA 3RRGA 3GV8B 3MEDA 3IN5A 3PX0A 1U48A 3UPFA 3K57A 4CJQA 4B9TA 3KIOA 4CEFA 4AHSA 1JLAA 3T5KA 1QE1A 3HXMA 2OPRB 2HHUA 1S6QB 4JRQA 4URGA 1S6PA 1VSKA 5KG7A 4B3OA 3SFGA 4Q43A 5DG8A 3Q8PB 1FKOA 2EHGA 3LP2A 3VQQA 3HP9A 3TAFA 3H08A 2OPQA 3KHHA 2XI2A 4IRKA 4ELTA 4FJ5A 1HQEB 4JUZA 4CFDA 1NHVA 1SH0A 1VSMA 1QS4A 4DU4A 1C1AA 4YQWA 5FRMA 5FRNA 4J9KA 3CIZA 2WK4A 3TAEA 3AVHA 3ITHB 4QWCA 1S48A 3QINA 1JLCB 1VRUB 3FQKA 2VA2A 2E6MA 2BRLA 4CJEA 1LAVA 4HUGA 1YVFA 5KFRA 4EEYA 4E7LA 1D8YA 1GX6A 4RW7A 3PW5A 3QYYA 5KFQA 1XWLA 4L8RB 1IKVA 5SWMA 1RTHB 2IS3A 4C8OA 5KFXA 4AH9A 5DG7A 1TAQA 3I5BA 1B9FA 1RTDB 3BSAA 4RW9B 1JXLA 3I0SA 5DLGA 2PZSA 5C42A 1S1TA 4LH4A 3OL9A 4ZTFA 5FDLA 4IH7A 2OPSB 2ILZA 1WAJA 3OSNA 2BE2B 4FW2A 3OYHA 4M42A 4NLVA 3RMBA 4KHWA 2A1RA 1KFSA 1TKDA 3SZ2A 2HHQA 3AVMA 3PV8A 1D9DA 3LWMA 3NKYA 2RPIA 3QLHB 3Q8RB 1TL3B 1T3NA 1TV6B 5D3GB 2WOMB 1NK7A 3QEVA 3BQ1A 2VWJA 2P5OA 4B9UA 4O5BA 3ZSQA 2KZZA 4QW9A 4KAIA 2ZE2B 4CHNA 1NJZA 4CEDA 4DL2A 3SQ2A 3PY8A 1RT1A 5JS2A 3NL0A 4IFYB 4EO6A 3OS2A 1HNIA 3QEXA 2W9CA 1SL2A 2G8FA 4RNOA 2D41A 4ZTJA 4FJ8A 1DTQA 1NNDA 3TARA 2ATQA 4CJSA 3HVWA 2JEFA 4J9PA 2UVVA 1KVAA 1LWCA 4TYBA 4TYAA 5C24B 4PUOA 4KV8B 4ICLB 3D45A 1ASUA 2BRKA 1I3AA 1JLEA 4QWAA 2Z1JA 2YNIA 1RT6A 3GV5B 4PY5A 4IG3B 2X6SA 1RAJA 2XRIA 2XO7A 3VQCA 3OJSA 3TAPA 1IM4A 4Y2CA 4HCCA 1NKEA 1HRHA 4K4SA 1JLFB 3DMJB 5HP1B 2OA8A 4FLTA 3HVTB 2E6LA 4EP5A 1RT2B 3SI6A 4M41A 4DG1A 4ID5A 3ZT2A 3IS9A 3DDKA 4NLTA 5CZ2A 1RT7A 1S1VA 5SZTA 4O3SA 1VSEA 1QAIA 3ZSRA 1TP7A 2AGQA 3WNFA 5L1KA 4IRCA 3QIPB 3NHGA 1KHWA 1N4LA 5KFZA 2R8IA 3RB3A 5HRNA 3OYMA 4EZ6A 1KHVA 4CCHA 3AO4A 4F2SA 2IC3B 2D3ZA 5J2PA 2FLLA 3SUQA 4JV2A 4CJWA 3CJ0A 1FK9A 2FVQA 1K1SA 2XCPA 5F8JA 3HP6A 3KLGA 1IKYB 1RNHA 2RKIB 5J1EA 1S97A 2D3UA 3SQ1A 4M3ZA 3OLAA 3PO4A 4AHTA 3OYLA 2AQ4A 4FLVA 3DLHA 4DQRA 3OL6A 1REVA 4ED1A 1NOYA 1QSYA 5KT7A 1S0MA 4ZVEA 3HYFA 2B6AB 3ALYA 1TGOA 5J2QA 4HTUA 5JUMA 4BDYA 1W25A 1HYVA 1JLAB 1RT3A 3ZSYA 1KLNA 4CJTA 4DTRA 1QE1B 3G10A 5KTQA 5EWEA 5KFFA 4E89A 2X74A 4NRUA 2XY5A 2B4JA 3DLKA 4C8KA 3I0RB 2HMIA 2EC0A 3AVLA 3K5MA 3AVGA 4OPKA 5CY4A 5FROA 3VQ9A 4KBIA 1S6QA 3A2FA 2PYJA 2OPPB 4B3OB 4J9LA 4J9SA 3OYKA 1OS5A 4H4MB 2R2UA 3QNOA 1LW0B 4WE1A 1RBVA 4Z4IA 4FBUA 1N48A 5JS1A 4CHZA 4YR0A 4O0JA 4FCYA 1ZBLA 3KHGA 2BDPA 1RDDA 1HQEA 5HBMB 3MFHA 3SV3A 1X9MA 4J2DA 3QZ8A 1A5XA 3GIIA 3AA2A 2J6UA 2HHVA 1CZ9A 3IGVA 2FVPA 4AHCA 1EKEA 2JEJA 3H4DA 1YT3A 4WYWA 3ITHA 3OVNA 1JLCA 3M8PB 1GOCA 4WXWA 2O4GA 2R8JA 4FJNA 2ATLA 3V81B 1YTAA 4RW7B 4ECZA 3T5JA 4YNQA 1VSJA 3ZSZA 2PYLA 1C1CA 4MIBA 1TKZA 3KLVA 4M3WA 4DTMA 4DLGA 1BL3A 3L3UA 3C6TB 2J6TA 4LSLA 3N6NA 5JXSA 1RDAA 1RTHA 4CGGA 4E7JA 4ECYA 2AX1A 4K50A 2BQ3A 3G6YA 4CK1A 4BDPA 4RW9A 1KCFA 2IJFA 4FJLA 5FDLB 4HYKA 1Q9XA 1SKSA 2XGPA 1EP4B 4DSIA 3DLRA 4KO0A 3NF7A 2GIQA 3KK3A 2G8UA 3KLHB 4KHQA 4MQ3A 5K14B 4RW8B 3M9NB 4F8RA 3E51A 4ECQA 2GBZA 1TL1A 4MH8A 3OYIA 4DLEA 2V4QA 5C25A 1IKWB 1HQUA 1LWFB 1S9EB 3RAXA 3NH1A 1J54A 1S1WA 3QNNA 3K5OA 4NCGA 3QLHA 2W9BB 3VQ6A 5KGXA 3HPGA 1TV6A 5KFLA 3HVRA 2WOMA 1GOBA 4DS4A 1NK0A 1WNSA 1RDRA 4AHUA 3NBPB 1ZBHA 1C2PA 4EYHB 4Q0BB 2YKNB 3DRSB 1RT1B 1WSFA 5KFNA 2AGOA 3VA3A 4KTQA 4OPJA 4Z4CA 3SJJA 2W9CB 1W9HA 4IFYA 2BQUA 4DL3A 2R8HA 3B6PA 1TK5A 4NLYA 1SL0A 4NLUA 4OJRA 4HHTA 1QSLA 3HK2A 3V6KA 1S1XA 3PJWA 4FXDA 3BQ2A 4TSXA 4CJ3A 4PUOB 2HNYA 3FQLA 4FM2A 4DSEA 3CWJA 4DFMA 4ELVA 1RBSA 3KK1A 5C24A 5HLFB 3H4BA 2DPJA 4KV8A 4DTUA 3TANA 4CGHA 4AILC 3CDWA 4IG3A 5KFEA 4ZP6A 3LP3A 1I39A 3AA3A 1JLFA 1RT7B 4Y34A 1S1VB 4J9RA 3HPHA 1KLMB 3HVTA 1WSEA 1RT2A 4O44A 4O3RA 4DWIA 4CESA 1BIUA 2HNZB 4W5RA 1HYSB 3H59A 2IM1A 1S9GA 5J2PB 1D0EA 3KNAA 2IC3A 2HVIA 1UWBB 1ZBFA 4JS4A 3LDSA 4DU3A 4KHMA 2PY5A 4DSFA 3CJ4A 3ZCMA 4ED2A 4K4YA 5J1EB 3OL8A 4M3RA 3KLFB 4NYZA 1NKCA 2OH2A 2RKIA 2OYQA 3G6XA 3L8BA 3ZSVA 2NUBA 5T7BA 1S4FA 4G1QB 2XI3A 3DLEB 3H5YA 2FVRA 2B6AA 1RT3B 4W5OA 4DTJA 3SUNA 3AVJA 4RNFA 1RYRA 5F9LA 3RB4A 2XHBA 4TY8B 3CG7A 3QEIA 3DRRB 3DLKB 2HMIB 5KG1A 4B9SA 4CF8A 4W5NA 2E9ZA 3I0RA 4U7CA 1LW2B 4E1MA 4DS5A 3QO9A 2KFNA 2OPPA 2HWIA 3KD1E 1LWEA 4E0DA 3AVFA 4RG8A 4FK0A 3AVAA 4BWJA 4N56A 1S1UA 4WE1B 4R0EA 1EETB 4CIEA 3O4QA 4H4MA 3O4NA 1LW0A 3C94A 3DYAB 1CZBA 5KFGA 3PJXA 5KFJA 4CGDA 4JV1A 2VWKA 4IR1A 2V4RA 3DOLB 5KG3A 4O55A 3L2QA 5HBMA 5F8HA 3JYTB 3PVXA 4FK2A 3MTKA 4MKAA 2IMWP 4WZMA 4FJJA 3T5HA 4QPXA 3QETA 4KHSA 3NF6A 3MR6A 4JV0A 2R2SA 3M8PA 2KZMA 4EZ9A 4KRFA 1C1CB 3V81A 1TKZB 4FLWA 3ZSWA 5DQGA 2AJQA 2YNGB 4LSLB 5KFHA 4F4XA 3MR2A 3QEPA 1XHZA 2FLPA 2VG5B 4Y1DA 4ECSA 3TI0A 4PQUB 4CECA 3KLIB 3NMAA 4DU1A 5KFWA 4CEBA 3CQ8A 3C6TA 3QGHA 2R2RA 4G3IA 3C95A 4KI6A 3ASMA 4E1NA 1LAWA 1B92A 2HHSA 4K4TA 4KO0B 2P5GA 3KK3B 3EYZA 1TK8A 3UQSA 4IH5A 3D0PA 4XO0A 1FXXA 1EP4A 3HVAA 1NK5A 4I9LA 3KOAA 1YTUA 3KLHA 4FZYA 1TL1B 3MECA 5K14A 4RW8A 4LSNB 5C25B 4DQSA 1SL1A 2RF2B 4QOZB 1X9SA 1HQUB 4DMNA 5KG6A 5CYMB 4YR2A 3NGYA 1J5OB 1IKWA 1S1WB 2FVSA 1LWFA 4NCGB 1HPZB 4DTXA 4B9NA 4M3YA 1S9EA 1N56A 3VQ4A 1ZBIA 4BWMA 1KTQA 3IAYA 4H4OB 4BACA 5CYQB 3CJ2A 1IO2A 2W9BA 4NLXA 1L3VA 3NBPA 2VG6B 3T1AA 2G8KA 4Q0BA 2XCAA 2YKNA 3DRSA 4GMJB 2IA6A 3OJUA 3KMSA 2W42A 4ED3A 2GV9A 4B8AB 3BQ0A 4K4VA 4J2EA 3SUOA 2XWYA 4KTWA 4IH6A 4J9OA 1Y97A 4KSEB 4IOBA 4FLXA 4B9MA 2ZD1B 1Z4UA 3CVKA 4ED8A 1S1XB 1W0HA 4EBCA 2W7PA 3PZPA 2ITGA 3NGDA 2HNYB 4DTSA 3S3MA 2FBXA 1BQMB 3MXIA 3ZT4A 4E7IA 3E01B 2A1SA 4M3UA 3KK1B 3SFUA 4DTOA 3GILA 3SPYA 1D1UA 4EBDA 3ZT0A 1BHLA 2CJQA 3VQDA 2ZKUA 3O3GA 5HLFA 3KKSA 4EBEA 4KREA 3CJ3A 3WNEA 1GOAA 5F8GA 2B43A 4WYLA 3GYNA 5KFOA 4CK2A 5T14A 1RT5A 1WNEA 4QAGA 4MK9A 2GIRA 3PHEA 3CYMA 1RBRA 5KFVA 3V6HA 2YNFA 2W8KA 2YV0X 1EX4A 1Z26A 4UQGA 4O44B 1HJRA 4CEEA 1KLMA 1RA6A 3RWUA 3MR5A 3K2PA 3BJYA 3T3FA 1FKPB 2ALZA 3RBEA 4MFBA 1S9GB 2XC9A 2HNZA 4IG0B 5DMRA 1HYZA 4Z0UA 3AVNA 4I9QA 4FYDA 1HYSA 3IG1B 3NE6A 2JC0A 4MK7A 3OYDA 1DTTB 2YNHB 3HT3A 4F50A 3OYFA 1UWBA 2EX3A 4CJ4A 3U3YA 1JXEA 4W5TA 2E9TA 2DFFA 2R2TA 4K8ZA 1RYSA 2D0AA 3V9ZA 2JC1A 5EU7A 3H2LA 3KLFA 2QV6A 3VQBA 4M94A 2ASLA 3O3FA 3OS1A 4G1QA 3LZIA 3DLEA 2D5RA 1ZYQA 4FS2A 3AVBA 4IQXA 4O3QA 3HM9A 3D28A 3SUPA 5L1JA 4PWDA 1NK9A 2LSNA 4TY8A 1NKBA 3DRRA 2X78A 3V6JA 3BGRA 2P51A 4Z4EA 5J2MB 5KFBA 5KFYA 3QO9B 1RBTA 4O0IA 4NRTA 1LWEB 5KFCA 3RMCA 1I6JA 3PX6A 2JEGA 4ZPAA 3L2VA 2QKBA 3VQ5A 2JEIA 1LW2A 1S1UB 1BI4B 3LANA 1B9DA 2AWZA 4EO8A 2KFZA 3I8DA 2R7YA 3H5SA 4R5PB 3G86A 1EETA 3TWHA 1RA7A 4ZPCA 4YP3A 4FJKA 3DYAA 1C0TA 3KTQA 4CFCA 4RW6B 5E41A 1XR6A 4KHUA 2Z1IA 4CJVA 5HRPA 5C5JA 4GC7A 4J9MA 2UVWA 1K1QA 4Y1CA 4HUEA 5KFIA 3DOLA 1WN7A 2O4IA 4QWEA 4DQQA 1U09A 4FK4A 4NLGA 3RB6A 3JYTA 3IRXB 3M9OB 3FFIA 5EUHA 2GC8A 4FBTA 2IAJB 3ICLA 4I2QB 1BISA 3BREA 3K58A 1T94A 4CHPA 2VG7B 3ZSXA 4Q45A 4E19A 4N76A 4KI4A 4LH5A 1ZTTA 2F8EX 2VA3A 1BCMA 2YNGA 1VSDA 3L2WA 1CLQA 2VG5A 4CGFA 5KFDA 4PQUA 4KHYA 1JLQB 4O4RA
chains in the Genus database with same CATH superfamily
3UN5A 3R6LB 3D6FB 3MMBB 3HKZD 4NLOA 1WOPA 3NAEA 4DUYK 4ZHRB 2E2OA 2M8HA 4LF8K 5F3ZA 2Y1JA 3MECB 2R8GA 3WXLA 1TELA 3QATA 2LEPA 4O4GB 4DQPA 3N9UC 5KT4A 2C22A 4ZCLA 2I8EA 1F2HA 5CYMA 2CH6A 2QZ8A 1OIAA 1MN7A 3O8WA 4JKAA 1MROA 2GHWA 1YBAA 1JKHB 3G4SS 2HB5A 2Z8QA 1ZAWA 2VG6A 2F4FA 4F4YA 4CERA 3LQVA 3AARA 5KFPA 2M88A 5IFMA 4RNHA 1RTIB 5C2FA 3QFUA 4KKOB 1BDGA 1LFPA 2GO9A 2ZD1A 1MWZA 3MR7A 1ZA1B 3HPOA 1BQMA 1A5WA 2WVCA 3G82A 1XC9A 2W2NP 2FHMA 1T05B 3G6ES 4C8NA 2FYXA 1JCEA 2DTUA 4MIWA 3CC7N 2DGSA 2YX7A 2NRTA 2CFXA 1VK0A 2YNFB 4FJMA 4CJUA 1WC3A 3S3NA 2HF4A 3HO1A 5AQKA 1HNWF 5HMZA 4S0MA 3CF5L 2AZ3A 4NYFA 3GIKA 1U45A 3V4IB 4A46A 3WDOA 5F8MA 4HLBA 3GCXP 1FKPA 4FW1A 3OXLA 5EWFA 4B3MF 4YMEA 2V8DA 2DO0A 5E84A 3LGHA 4JI5F 2M7SA 3PYDA 1A5VA 4BE0A 4NA1A 3HHLB 2IYGA 2EBGA 3TUIC 1S3XA 4X4SA 3DLGB 4LF6F 4E7HA 3CF5Q 3ZTQA 3DGPA 3DNCA 2NS1B 2VC1A 4AHRA 4FVMA 3L9ZA 5RUBA 1S22A 3QICA 4LF2A 2J7UA 1N5QA 4LF8F 2V2KA 1VISA 3UCZP 3QRQA 4OHXA 1IKXA 3BGRB 2YX1A 3I9V9 3VOVA 5DM7L 2FC8A 1RACB 4USIA 4FPBA 1UFKA 4LR7A 1ILYA 1FWPA 2RDIA 2PAVA 2QL9B 4J9QA 1UVJA 2C3MA 5H9EJ 3EVOA 5JICA 3GG4A 1RADB 1Q18A 5AR0A 4AHVA 1KD1O 3OS0A 2J6SA 4IKFA 2RRBA 1GX5A 4A8KA 3IR7B 1K8AO 2YWFA 5F8IA 4BRHA 3IDHA 5CZ1A 1UJ4A 1QUVA 3Q83A 3QSYB 3SQ4A 3UR3C 3GJRB 3B6BA 3UN2A 4MKVA 3W2VA 1WELA 3SBMA 1VQOS 1YQHA 2VG7A 3ZETA 3THXA 3Q23A 3FZHA 2R7XA 1VDHA 1RWMB 4ZN3A 4ZVFA 4OI0A 2BM1A 2DFHA 2Z1HA 2BM0A 3T1YK 1RAOA 1RBOB 2Z57B 1JLQA 4M45A 4M95A 1RABB 2LXIA 3C46A 4XK8C 2FSNA 1UW9A 2I2YA 4IFVA 1JLBA 2AJ2A 4FPAA 3ATUA 3OR2B 2YKMA 2W6LA 2ZM6K 5HI7A 3OHAA 5G0RA 1YAGA 2W9AA 4JI4J 2Z2YB 1HNXJ 4Z7YA 2PGCA 4BRKA 1R8AA 2V2QA 2F9WA 2ZH9A 2XMWA 4P9SA 1VYAA 4X4UA 4LQ9A 3OFFA 4ZPTR 1MROB 4ILHA 2PA8D 4DN0A 4DTNA 5EXWA 4F4WA 3F0NA 2APOA 3D9BA 3KKRA 2QLBB 4RTFD 1MWKA 1F5CA 5DGBA 1VK8A 3L4QA 2ZUAA 3H3NO 4H8KA 2WRMA 2FBVA 2UUBJ 1NLVA 2IIHA 2XS7A 1VGYA 1C1BB 1UOCA 1Q7YO 3O9TA 2FSKA 2CPJA 4B9VA 2CPXA 4NLPA 1KC8O 2BANB 4DXLA 4OMFG 3G82B 2XM3A 3HT0A 3SCKE 1R0BG 4LF6J 3OD2A 2QI2A 3BS9A 1TK0A 2YJEA 2VIHA 1IWAA 3DRPB 4ZS6A 3WNHA 1X3NA 4FVUA 4C9DA 2RD5C 1FEHA 2NSCA 1Z2ZA 1T3VA 1WHYA 2CJAA 4GO5X 3MM7A 3AA9A 3QIDA 2UUWA 1WHVA 4LSZB 3BSCA 3QERA 1Y64A 5J2NA 3PW4A 1SKWA 4ZVTB 1F9FA 4DR4J 4J8FA 4CZGA 3F9KA 1KS2A 4KFBA 3PEHA 4DV5K 4FNIA 2F8HA 4DF8A 5DS7A 5HN0A 1CS4A 4JI6J 3EWGA 4C3KA 4IKAA 1G15A 4Y2AA 3R3TA 1R6YA 1KVCA 2XWXA 3GFYA 5HMYA 2RIJA 3HJFA 4DR2J 4MIAA 1VSIA 4C7QA 4RZRA 3AV9A 2NLWA 3EPIA 4GC6A 4FLUA 2P9KB 3THYA 3T1YF 5ETOA 5IT4A 2UVRA 1GFWB 3EN9A 1BQNB 2DNMA 1Z25A 1XNQF 1W7WA 1S49A 3RMDA 3CETA 3OYJA 4IDKA 5DQIA 3TTCA 2ZM6F 3HHLD 3CC4S 3K5LA 1HMVB 3MEEA 1IKXB 1SQFA 1XHXA 4DR7K 1RWWB 2YHAA 2B9XA 3PACA 3GE9A 4CJRA 1IV0A 1WC0A 3EM1A 1T03A 4IJNA 2YHBA 1Q81T 1DLOA 1QQOA 3BM7A 3AA5X 2GW8A 5I3QA 5KT5A 4KTZA 1YZ6A 2F96A 2D7SA 1U2VB 1S6PB 1BIZA 4N8OA 2E4LA 2VFSA 2F1FA 4UOFA 2MMYA 3PUFA 1JXBA 2F40A 1R6VA 1AFIA 1SH2A 4BDZA 3N5BA 3LP2B 3MM8A 2XHWA 4FJIA 2W2OP 3FBCA 3THVA 2DGQA 4M3TA 5AQFA 4XEIA 3C14B 3ZO7A 3A8JA 3TQ1A 5M1NA 4GY2B 1ITPA 4NXMK 3DXKA 4CZLA 2ERRA 1UCNA 4OHYA 4WXOA 2QWRA 4OKKA 2BR0A 3ZETB 1LXJA 5L8RC 2ZNZA 4DR6J 1JL2A 1TAUA 2LU1A 2C2EA 4DZ6A 4CD3A 2JLGA 3O44A 1KSPA 1ACMB 2E5LK 4CF2A 4BE1A 1NB2A 4E7KA 1JLBB 4JI2K 4ISGA 2MLYA 5CH7B 3NCIA 2X1GA 2YKMB 4YDUA 4LQ3A 1FRKA 3U4LA 2AMCB 1I94J 2ASDA 1RCHA 2WVEA 4DV5F 4A5AA 5IC4B 3W2WA 2CADA 1NSKL 3P39A 1RDWX 2E9RX 2K7JA 4ES2A 2AEJA 1XNRK 2VODA 2HHPA 2CVEA 2Y1RI 4WZQA 3L2RA 2KQ2A 3ZEUA 2V63A 3SCXA 4FWSA 2NZTA 1SUQA 4RW4A 2C42A 3WC2A 1OSDA 5A8KA 4K5RA 1FKAF 1UKUA 4F4AA 4HI2A 4X62F 2JNJA 3Q8SB 2V7YA 3AAWB 1RHMB 4NZ0A 2CZ9A 3SK3A 4MK8A 3AFGA 1VJWA 1YIJS 3P96A 4F2RA 3R5CA 1Y5LB 3VEWA 4DV3J 1RBLA 6AT1B 3ILIA 4F36A 3ZZ0A 4FJ9A 1TMMA 4DR7F 4BE2A 2WCXA 3TUPA 4JKEA 2G8HA 2B56A 3VQ8A 3PR5B 4XDDA 2WBNA 3VAFA 1DTQB 5KG2A 4NX9A 3U9DA 2ZZMA 1EWQA 1FD2A 1IBLF 4BLGA 4B8CA 3NH2A 1TKTA 2C2OB 3J7YP 3QGIA 1XNQJ 3MM7B 4CEOA 3LO3A 1S4EA 1TL7B 5IS2A 1JLEB 3OUYA 2HW3A 2F9DA 4J2BA 2IGIA 3DXMB 4GVBA 4CIGA 4A8QA 2AHOB 2AX0A 2Z1GA 4KFBB 4LBIA 1VQON 2J8SA 1SBRA 3QESA 2G8WA 3UDCA 4DG1B 4NLSA 3AAQA 3LL3A 3M1FA 4XIUA 4NXMF 4DV7K 1ZM3A 3TR5A 1PIEA 4I68A 3QBXA 2LDYA 1WG1A 1BCOA 2KHCA 3VQPA 3D1QA 4QWBA 3UE2A 3MURP 2ACMA 3QIPA 4BC4A 2WVFA 1W26A 4Y3CA 3THYB 2CZVC 4NYNA 1FK9B 3TSPA 3KJVA 1N6QA 2NXUA 1Y10A 4JI2F 2P9UB 4OYMA 5DGAA 3KLGB 4BGAA 3CM5A 4ZPWR 2O01C 1M90T 3BSNA 2WVDA 5CD4A 3KFWX 2Y1IA 4K8RA 4DSKA 4LFBK 3H40A 2L9DA 4I6MB 1IBMF 2R7WA 1MLAA 3EX7B 3M30A 4HVZA 1MU2A 4JK8A 1T8EA 1ZTWA 1T03B 4CE9A 4Z37A 2X1FA 3OYAA 1XNRF 3RRGA 4LFCK 3CJSA 1VC0A 2DITA 2ASOA 1FFGB 3H46O 3T5KA 2M4MA 1QE1A 5J1NA 3AD8C 2OANA 2RDDA 2HHUA 4BHQA 1S6QB 2DHSA 2ASMA 4ILJA 3FEYB 3IP0A 4WBFA 4JB8B 1VSKA 4B3OA 3ET6A 2ZOGA 4IDHA 3CIPA 1TYQB 3K8WA 1UEVA 2HZCA 4DB3A 5K9FA 2OPQA 1YK9A 4OZNA 5GAEI 1HQEB 4BRCA 4CFDA 2UXDK 4QIVA 1VK3A 5FRMA 4FYWB 1GNKA 4X62J 2WK4A 2XSFA 2QA4G 4FL9A 1Y11A 3AVHA 5GMDA 1Y00A 1S77D 1T0TV 2NQPA 2LA4A 4CJEA 1LAVA 4HUGA 3OV7A 2QTDA 4F26A 5D4NA 4CVNE 4FWNA 3IAM9 1RCOB 1XWLA 2BKPA 2M3DA 2IS3A 4UZBA 3MMVA 2R7SA 3I5BA 5G4DA 2EWSA 2YX4A 3NMRA 1IBLJ 2JRSA 2V52B 2B4UA 1H1VA 4DV7F 1O13A 1UAWA 3M05A 2MYFA 5C42A 5AQVA 3ENWA 4NZ7A 3OL9A 4ZTFA 4IH7A 2MSSA 1N33J 1SAZA 4EFAC 5F0WA 1WAJA 3K2YA 3OSNA 4M42A 2HLUA 2HS3A 3CC4N 4WCEQ 3JSRA 1H98A 3M2UA 3UKUB 4FP9A 5C10A 4CLYA 3PLAA 1KFSA 1FJGK 3DOMB 4OZ0A 1R3NA 4CWBA 4H0OA 5C0YA 4M5NA 1T3NA 1TV6B 3MM9B 3BQ1A 2VWJA 1LWXA 3PEJA 4LFBF 4O5BA 5M1FA 3L6QA 3ZSQA 3O1BA 3D2WA 2A6OA 1HKBA 2CQ3A 2KO1A 3SQ2A 3RJMB 4RL1A 1RT1A 2Y0BB 3NL0A 2F9JA 3OS2A 2YQ3A 4MYTA 2PD1A 3T1HJ 4RKUC 4LFCF 3QEXA 4KJIA 4YB7A 4FJ8A 1NNDA 1YJVA 2O3DA 2JEFA 3TJ8A 2UVVA 2P6TA 2KJVA 3O9RA 1LWCA 1RB0A 1Z2LA 4GMKA 5C24B 3I32A 3OUYB 2J9CA 1IBMJ 2KL8A 3D45A 1P9YA 3UNYA 4GVBB 1V3ZA 4CNZA 4QWAA 2DNQA 5GADU 1G6BA 2FZKB 2JFDA 1TTHB 4HACA 4NA2A 2X6SA 1WUAA 1R43A 4GNIA 2XRIA 3FEZA 4CO3A 4DV0J 1QAYA 1IM4A 5M2RA 3QPIA 5LMUJ 2YX6A 4H0TB 4K4SA 3CC2S 1K73O 1NM1A 4JN4A 2B7CB 1QUPA 3UD3P 4ID5A 2UXDF 5CZ2A 1JCFA 2CPHA 1QAIA 3ZSRA 5BREA 2N4DA 3EDQB 2AGQA 2PC6A 2NXCA 2BW2A 3QIPB 3JSYA 3CDBA 4CD1A 5HANA 1RAIB 5KFZA 1F9HA 2R8IA 2YTCA 4HT5A 4CCHA 3AO4A 4QYZJ 2PMZD 5J2PA 4FVCA 5F1XA 3CJ0A 1U6FA 4GRSA 2XCPA 1SCJB 5BPMA 3IR5B 3SJHA 4DUTA 2W4DA 2ATCB 1RNHA 5J1EA 2GEMA 3NG8A 2D3UA 4WIQA 5HVFA 3BZQA 4F0HA 4B17A 2CH5A 3OBIA 4M3ZA 5D0EA 4AHTA 2RU3A 5IWAJ 4LT6A 3G8TA 3LGMA 3J7AP 2QN6B 1R0CB 2CJBA 5JUMA 2HMPA 4BDYA 3ZZPA 1W25A 3BGUA 1KLNA 4X66J 1QE1B 3VF4A 1WEYA 5EWEA 1FX4A 5ADXA 1H74A 3C16A 1V5VA 2A0FB 3CIMA 2XY5A 2HQ3A 4CZJA 1YITS 1BC6A 1FJGF 4OPKA 3GJQB 4KBOA 5CY4A 2AV5A 4B3OB 2V4JB 3RYLA 4J9SA 3QFPA 4FBUA 1WSRA 1IQTA 2ZH7A 5JS1A 5LL6Z 5CHIA 4CHZA 2MLZA 1YBUA 2BDPA 1NZAA 2G2ZA 3VAIA 4ZIWA 2YHYA 1A5XA 2NR0A 2I0XA 5EVZA 3UW1A 3AQOA 2X3DA 4RBVA 4OJ1A 3ITHA 4AD6A 4ZK7M 1JLCA 2W24A 3M8PB 1GOCA 3MZIA 4L3QA 2HGLA 2ATLA 4JYAJ 1H2VZ 4ECZA 4YNQA 4DR5J 1UP1A 1VSJA 3CCQS 3ZSZA 3MD1A 5MLCV 5AJ3J 1C1CA 2RHSB 1RBAA 4DTMA 2BKNA 4LSLA 1Q5VA 1FRXA 5JXSA 4JHDA 9RUBA 3L4IA 3UO0A 4E7JA 3POTA 1RI7A 3AOCA 2IJFA 3MX5A 4A59A 4RUBA 5BXIA 3MPUB 3MM5B 4KO0A 3NF7A 2ZWOA 3GPAA 4KHQA 3G25A 4RW8B 3M2UB 3ZX3A 4PXBA 3M9NB 4F8RA 2F63A 2MPUA 2MLXA 1TL1A 5CABA 2V4QA 5C25A 1WF1A 2H4WB 3O9QA 4ZCMA 1J54A 4O5FA 2C3YA 2RQKA 1S1WA 3QNNA 1U8SA 2KKHA 3QLHA 2W9BB 3VQ6A 3HPGA 3HVRA 4CYUA 5LSLA 3O9SA 2Q0RA 1ZBHA 1C2PA 3U8XA 4OYBA 4Q0BB 4AL6A 4MMOA 1RT1B 4L6V3 5A2QO 3R1HA 3FZBA 3HF5A 4CIOA 3M3ZA 1HBUA 4KTQA 1VQ7S 1W9HA 3UKRB 4DL3A 2VFUA 4QIWD 2CNKB 4RU2A 2NZCA 3GMGA 2GAHC 1NGIA 4YOXA 4NLUA 4HHTA 4ZLNA 2CPDA 3IMQJ 5DETA 3V6KA 1S1XA 3PJWA 2XMVA 2XMKA 2QSWA 4ELVA 1LEOA 1RBSA 2DPJA 3WEEA 3NRBA 4KV8A 4CZKA 3CDWA 2MKKA 4HHHA 1N32F 1OKJA 1Q95G 3K89A 2ZDOA 2HQFA 2FIUA 4YB5A 5M1KA 2O8FB 1IWGA 1P8ZA 1UEKA 1HX1A 1ZZNA 4CESA 1BIUA 2B3TB 1DRZA 4K0KJ 4NYPA 4WTYA 2FF6A 2WSFC 3M1VA 2EFGA 1NMEB 3W5XA 5J2PB 3SLCA 2V9KA 5E5NA 5B0GA 3KNGA 3AB2B 3E9OA 3LDSA 4DU3A 2PN6A 4DSFA 3N4PA 4AL7A 4Q7AA 3IKMA 5ETTA 5J1EB 4DR3J 2FJDB 3FSYA 3PSFA 3P6YC 3OL8A 4NYZA 2OH2A 1KN6A 2OO4A 2ZNYA 2O8DB 3L8BA 5HO4A 1WI6A 1DFDA 4GV6A 1QVFR 4M63C 3SEOA 4H5WA 1Z1ZA 2B6AA 5IXUA 3AVJA 4RNFA 4X64J 1NSPA 1K9MT 5DDQC 4BRDA 2J9DE 3CG7A 2E1CA 3QEIA 2SXLA 3C16B 4C98A 4A2BA 3VZIA 3HJVA 5DJBA 2W2MP 1C0GA 1J5EK 2ZHAA 4B3RJ 4LF9K 4U7CA 4I64A 3QO9A 3P49B 4WP8A 4LF5K 4H5TA 4FK0A 4BWJA 5DO2A 3PFOA 4J90A 5C15A 4H4MA 4EK2A 2YWKA 4Q2LA 3C94A 2QL7B 1CG2A 1HL6A 1WC4A 3D6RA 1CZBA 5IV3A 4YY3J 3I6PA 3SSRA 3GZ7A 4ZPVR 3FCHA 3EXCX 2R7RA 2BOAA 4GV3A 3DOLB 1VQ4N 3L2QA 1OMSA 1X5PA 2CG8A 4FK2A 2FY8A 2P9PB 3SQGA 4KYZA 3C6HA 3VEOA 2MZTA 3RVCA 3CCLN 3THWB 3CC2N 2R2SA 2KB2A 5ADZA 5AQYA 2KHOA 1I5OB 1YJTA 1C1CB 2P8IA 2BJ3A 5DQGA 4LSLB 3HFVA 4Y1DA 4ECSA 3KLIB 3POTB 2R2RA 2DD8S 3C95A 4NO7A 2UUCK 2RH3A 4K4TA 4KO0B 1TK8A 3MGJA 1VQMN 3TO8A 1FXXA 1EP4A 1JXVA 4ZIVA 1NGEA 2GX8A 4I9LA 4A8OA 4JKHA 4FZYA 1TL1B 4LSNB 2DYAA 5C25B 1N32J 4CRJA 4YR2A 1N36K 1S1WB 2FVSA 5AQXA 1LWFA 5KPZA 1S9EA 4CYUB 2G1HA 4B3SK 2DY9A 2EK1A 1PILA 3ZLJA 3F44A 3CJ2A 3LUYA 1AYEA 2RRNA 1L3VA 4PG8A 5E7OB 4DPTA 3T1AA 2G8KA 2LEAA 2VOOA 4UY85 2A3ZA 1GXLA 1X0PA 3OFGA 2YKNA 2KJWA 4GMJB 1YVNA 2IA6A 1YITN 3DLLL 3MCMA 2GV9A 1Y97A 4KSEB 4IOBA 4B9MA 3HLUA 3CVKA 4ED8A 1S1XB 4FOIA 3PZPA 1RAFB 1WG4A 3I56N 2IYIA 3MXIA 3ZT4A 3E01B 2A1SA 1J5EF 3SFUA 2Y0SD 5A8WA 3A8YA 3Q24A 2CJQA 2G9OA 2D0PA 5HLFA 4BC7A 4LF5F 3KKSA 2QO3A 4KREA 2OHDA 3CJ3A 2DGVA 4WYLA 3GYNA 4CK2A 4UOHA 3M6VA 1RT5A 1KR4A 4OZ5A 2XNRA 2GIRA 3CYMA 3PYGA 3LDPA 4ANDA 1PG5B 2YH1A 5KFVA 1DJ0A 4USMA 2ZDPA 1Z26A 4LF7K 2DPNA 3D3CJ 2GS8A 4PWUA 3CCQN 3K2PA 3T3FA 4MFBA 2HNZA 3ZC4A 5BN8A 4U67L 1HYZA 2QMUB 2I9SA 3AVNA 4Z0UA 2D0OA 1HYSA 4G9ZA 3NE6A 1MWQA 4ZVPB 5AQZA 3A8IA 5LMNK 2HKEA 4V19S 2WAQD 3OYFA 1UWBA 1VAZA 4N77A 1J6ZA 1KEKA 2EEYA 2DFFA 2R2TA 2D3OR 3HSDA 2G0IA 5L39A 1W2IA 1UVNA 2AA4A 2JC1A 5EU7A 3QJJA 4M94A 5GAHI 2UUCF 4U67Q 4G1QA 2VQEJ 3LZIA 2OEKA 4XH1A 2ZGZA 3AVBA 3GCWP 3HM9A 1VQ5S 1H72C 5L1JA 4AT1B 1WDTA 1OY8A 3O6WA 4TY8A 3DRRA 2QRRA 2CPFA 1UTAA 5J2MB 1N5VA 1N36F 3QO9B 3KWIA 3DDIA 5KFCA 3RMCA 1I6JA 1FI4A 3VQ5A 4B3SF 1NMDA 4DPWA 2HQGA 3LANA 2AWZA 1SQGA 1RISA 3O5TB 1NZ8A 4QIFA 3H5SA 5LT5A 1WOSA 1HWUA 4ZPCA 4FJKA 3KTQA 5AQSA 4RW6B 2OI2A 2OSRA 4QU6A 4UTGA 4CJVA 5HRPA 3RSEA 5C5JA 4GC7A 1K1QA 2IDLA 4Y1CA 3SQGB 2Q1LA 3ILJA 2NLXA 3MDFA 4FK4A 2LVWA 5C2CA 3JYTA 2DY1A 2IDEA 3FFIA 5DDPC 2LA6A 1O0PA 3BREA 2JFKA 3K58A 1T94A 4CHPA 3ZSXA 4N76A 4LH5A 1ZTTA 1RWPB 2PE8A 1R89A 1FFWB 1DT9A 3TPQA 1YJRA 2VA3A 4AUKA 3L2WA 2VG5A 4CGFA 4KHYA 1AT1B 4XPCA 1RT4B 4JP8A 1FVSA 3VQAA 2DR7A 2CVIA 5JVHQ 3OBYA 2BV3A 4LF7F 2Y3YA 4BQLA 1U1MA 3R6GB 2KRRA 3G71S 4M1KA 3V6DB 3MWTA 1EXQA 5ETQA 4B9LA 4LF5J 4ID1A 2WSCC 4M3XA 2AYEA 4KHPJ 5LMNF 3CMES 4WFXA 3ZSOA 3UVJA 2ZJRL 4OVLA 1CULB 2R42A 3MWBA 1HPZA 2IMOA 1E6YA 3D5MA 3P1GA 2HFVA 1HWLA 2L08A 4H4OA 4CJPA 2C3OA 5CYQA 2KXFA 1HR0J 2HNDB 2IOCA 3UWTA 3M2RA 5KI6A 2AGPA 4B1YB 5F0XA 3SMPA 4FKXA 4CO1A 3KJQB 1M1HA 4K41A 3D2FB 3IM8A 4CF9A 1OWXA 1UA1A 2WONA 1KONA 3FR0A 3OTOK 5F41A 4CF1A 3ZT3A 3FGUA 1KAYA 3C15A 2C2RA 3VAKA 1B3TA 3MMJA 1X5OA 2BACA 5KQDA 3ULEB 1IH7A 5AQRA 1Y3KA 4PXEA 4JI7K 1NGDA 3CQYA 4LFAJ 4USVA 2DNZA 1RT5B 1XUPO 4MTPA 2UUTA 5H9FJ 4YFUA 3OVBA 4LRDA 2JL9A 5L9XA 4RWWA 2DXFA 2QMWA 4Y65A 1RE1B 1TFYA 3S9HA 1ZA2B 4ALZA 2DNGA 5KPRA 4OV1A 1LOUA 3VN5A 3C2PA 4CBWA 3HBTA 1X5SA 2DHGA 5U47A 4MFBB 1SB6A 4X4NA 4KAZA 3AT1B 3EZUA 2JZ5A 3K8VA 1U04A 2VICA 1CVJA 4IG0A 4KR0B 3ID6A 4FM1A 3KLEB 4BC5A 1XMOK 1XTZA 4E98A 1DTTA 3FMWA 1UVLA 2YNHA 5M1OA 2E29A 5L1LA 3BGOP 4ID8A 3K59A 2CKWA 3DGVA 1KAXA 4URQU 3LP0A 2I38A 4M5LA 3D54A 3R7NB 1S0VA 4BC9A 4ZN1A 2ETJA 4ES3A 1WF2A 2W40A 3R9PA 2DY4A 4OI3A 1N8RT 5LSOA 3BF4A 3QT6A 2LLZA 1FF2A 5AXKA 2UVUA 4BS2A 3MD3A 4FZXC 4BR9A 1S10A 2ZBIA 1HNZK 1OYDA 3M2VB 1OH8A 3J7ZT 3QRRA 4J5OA 2QTWA 2QLJB 5AQJA 2U1AA 1VMBA 4PCQA 2H54B 5DG9A 1N88A 2FHKA 4E2FB 4P7VA 4OX9K 5BR8K 4M7YA 2C2NA 3QGGA 3HM8A 2L9NA 1XR7A 1QM9A 5KG0A 2MZSA 1UA0A 2O5DA 2ZVIA 2HQCA 4D3HA 1T9UA 4LY7A 4X2BA 3RSEB 1PC5A 3AVKA 4X65J 2IDOA 3VTIA 2QA4S 2GHVC 4GKJK 4ETXA 3N79A 3OTOF 3FFIB 4QW8A 3FUYA 4Z4GA 1YVUA 3AJDA 3O8MA 2RHQB 4F02A 5GADP 2QLFB 4JS5A 1SH3A 4I2QA 3BKTA 1OYEA 4JI7F 3Q7BA 5T7LA 5C7PA 3NF8A 2C2KB 3CNQP 2E7VA 1RWOB 3V9WA 3NVMA 4WF9L 4MKBA 1N5YB 5EDWA 4O3PA 2HFUA 4OX7A 4B1UB 3AD9C 3J81j 4Z4FA 4WTOB 4TN2A 4ZJOA 3VVTA 2GVZA 1VBZA 4P2XA 5KFTA 4CI0B 3V2UC 3I87A 3AB4B 4M63A 1IJJA 1QHTA 4N41A 3OYEA 1TUYA 1RWKB 5B0DA 2FJXA 1U49A 2OD4A 2F4VJ 5HAOA 1VHIA 1XMOF 5HRSA 3B8HA 4KH1B 2N7YA 4NLBA 5F9NA 2C28A 5ITHA 3T19A 3OFHA 1E6YB 3AA4A 1AUDA 4LF4J 1ZBUA 4WJBA 1CJUA 2JGUA 2H4YB 1YJ9N 3UIQA 3G2XA 4HKQA 1C4CA 3DM2B 1BQXA 1U8WA 2B0GA 3GL1A 1RUSA 4FLYA 4RUAA 2WONB 2HHHJ 4N47A 4OLOA 5AZJB 4EP4A 4DN9A 1HNZF 3B78A 3DI6A 3GWCA 3PX4A 4EHUA 3JAMO 1MMDA 2VONA 2MZQA 4DTPA 1D3WA 4CZFA 2QK9A 3A8KA 2RN2A 4DR1J 1SC4B 3OYNA 1NJXA 3V1RA 4KRWA 4OX9F 5BR8F 1JLGA 5C2DA 4JLHA 2DBBA 3LPYA 3ID8A 5KRSA 1O1WA 3C6UB 3I31A 2KM8B 5E3AA 4GO7X 4OYPA 2IM0A 3VGSA 5KFUA 2O8BB 3AO1A 4F0MA 4EAHD 2Z0GA 3R9LA 4DPYA 2E1AA 5B08A 1VC6A 1NK6A 4CJ5A 4N7TA 2W6KA 3FKBA 1EIYB 1RGVA 1S5JA 4OFZA 1WLJA 3TU5A 3SSSA 1TUWA 3LDOA 5BRDA 4GKJF 2IVNA 1X3MA 2VPWB 1KFDA 2R8KA 3OR1A 4ZVGA 4A8YA 5I42B 4ISEA 4WFNQ 3TAMA 2IVYA 4DKWA 2YCHA 1C0UA 4ZP7A 4DSLA 2I5JB 4KPYA 2XNQA 3CDEA 4NE9C 4AM6A 1HPMA 3H1VX 2V2ZA 3D1HA 2KG0A 2HHTA 2EI5A 4M5IA 3MXMA 3G71N 3LP0B 1F0XA 1GXTA 1VRTA 2UV8G 3PW2A 4EHTA 2BQRA 1SJFA 3L2UA 4P6QA 3MR3A 2OGUA 1K8KB 3RR7A 1HFEL 1D4XA 2B5JB 4B08A 3EL2A 3SYZA 3G9CA 2M5YA 4Q2MA 3IO1A 4DQIA 3IR6B 2IBOA 4C23A 4CLLA 1VIXA 3BDPA 3CD6S 2BABA 2OFGX 2X7IA 3GIJA 3DOKA 1PYTA 2E1RA 3QIOA 1XN9A 3I55N 4M5JA 3EGVA 2X1BA 2N82B 1JJCB 3SCLE 1H73A 3I96A 4FYXB 3MUMP 5H1SV 2CDQA 3GG1A 1NHUA 3O3LA 3KHLA 1URRA 4OGCA 3E8OA 4P2SA 2FBTA 1D5AA 3N4WA 4DL4A 3DC2A 3V9SA 2D4WA 3MEGA 2VQFF 4FJ7A 1FKOB 1QTMA 2BKOA 2RS2A 3SDEB 3LALA 1VCTA 3ZZUA 4ED5A 5GAGU 5KFMA 4GV9A 4NZ6A 3NVKA 4OV6A 3AXMA 4CEZA 2RMLA 3GQCA 1XJWB 3RB0A 1NPRA 4NASA 2HPUA 1TL4A 3EKSA 2UU9K 4I2PA 3J80Y 2KTQA 4WPAA 4CF0A 3CMAN 1H0HB 1RK8A 2F8SA 2YI1A 4XTTA 2X51A 5HROA 4C8LA 2FHJD 5HQMA 1L3SA 4NOHA 4ZVOB 1IKVB 4OPHA 3D2EB 4R79A 3ZZYA 2CNOB 1NO8A 2ACYA 1M5VC 2QWOA 5KRTA 2W7OA 5MAOA 4NLQA 2C2DA 3K9JA 2RHKA 2QEXN 2V68A 3TW0A 4CJKA 4WKRA 3I0SB 4E8UA 3I5AA 4K59A 3EO3A 4DL5A 1S1TB 1ZH5A 3KD5E 1S59A 1RTJA 3LWLA 3TAQA 5KGWA 3WIUA 1EQ0A 1KQFB 4BRGA 4Q8EA 2XMAA 2ZJQL 2G8VA 1VQKS 4ZVSB 4Z4HA 5ETKA 2Z58B 4JI8K 2IVOA 3O1WA 2ZEJA 4L74A 2BJEA 2VJVA 1N54B 1HHTP 1QQNA 4OI1A 3O4WA 3OYBA 4ECRA 4OKEA 3EGWB 5D3GA 2IM2A 3IM9A 1DHMA 4JRPA 2CQHA 1HBOA 4ILGB 4BR2A 2JOQA 1IG9A 4ETZA 1XI1A 2AJFE 4I7FA 3CPWM 4E3SA 2BH1A 1R8HA 3R7BB 2ZJQQ 3NWRA 2ROGA 3ETMA 4W92B 3KK7A 1JLGB 3ILOA 3O5BA 5I3UA 4RWTA 4L3NA 5EHHA 2OFHX 4RNNA 4DF4A 4ECTA 3P8BB 2XY8A 1V6HA 2YNIB 2UZAA 3EE3A 1RT6B 4OJGA 1J9AA 1T7PA 4DHVA 2FLNA 3J7YI 2Q3SA 3N6LA 3OR1B 4UOCA 2VFVA 2YWEA 4ECWA 4FSVA 1S79A 3T5LA 4NLWA 1X9WA 1VSFA 3TAMB 4HDGA 2B9WA 2ASJA 3ZX0A 2IY5B 3CCZA 3U6FA 4M5HA 3CCMS 5BJRA 4PG6A 4ITSA 1MG7A 3CCSS 2XGQA 1NPKA 1PGZA 1NBWA 3BV8A 4IXCA 1DQ8A 1VHFA 3H0PA 1VRTB 2VQFJ 3M5RA 3ZX2A 3F2KA 4TQSA 3AVIA 3OHBA 2K8GA 3NCQA 4AYBD 1E6VA 1WTFA 4KE5A 5HOOA 3GR1A 5EGYA 2HWHA 1HKGA 3FMBA 2HQIA 2XZDB 3EY1A 1WC1A 3OBWA 3HHEA 3LP1A 3ISND 3QT8A 3OL7A 3CCTA 1UW4A 1RQ0A 4KB1A 4LF1A 3PW0A 2RUSA 1IKYA 3LPUA 2KT5A 3NAIA 3LPEA 3W61A 1DKGD 2FC0A 3VENA 3KMQA 4O8KA 2GTDA 3K0JA 2CXEA 1YI2S 2DNLA 1TVRA 3N6MA 5J2QB 3QAUA 4U6PA 2MZ1A 1YTYA 3MEDA 8RUCA 3IN5A 4DUZK 3PX0A 1NGHA 3H8YA 3EKUA 2HFOA 3KIOA 2HLTA 4AHSA 3ENHA 4BRAA 4DI6A 4OZLA 2MKHA 1RHQB 4NXNF 1EQMA 4URGA 4JI8F 5JVGL 1E3MA 2ZBPA 3Q22A 5KG7A 4PL8A 2HF3A 2R7OA 3R27A 3SFGA 2CQ0A 2Z2MA 5DG8A 3Q8PB 5DDRC 5D15A 1HWKA 2PA3A 3HP9A 3TAFA 3H08A 4YDXA 4RJVA 4Y0WA 2CUYA 3KHHA 2XI2A 4IRKA 1XQSC 1VSMA 4YQWA 5GIOA 1ZS6A 4EFHA 3CC7S 4F7VA 3CJKA 3TX0A 3FQKA 2BRLA 1VQ9S 4A5BA 4JI3J 1QJHA 4RUHA 1HA1A 9ATCB 5KFRA 4OHWA 1H2TZ 4C3MA 4E7LA 4CDIA 4JV5K 4PKGA 5KFQA 3U1LA 5SWMA 4YDDB 3QSIA 3FBBA 1TAQA 4RW9B 1NG9A 2V34A 2I7NA 4USHA 2OSQA 3RBZA 5HVGA 3IFRA 5A6WA 2UUAK 1R31A 5FDLA 2B51A 5A6PA 4J37A 3GYGA 1NDKA 1SKUB 1UJ6A 4QR2A 1X8DA 1Q81O 4NMLA 4ERDA 3D4JA 2FZCB 4PYAA 4NLVA 3CD6N 1PAUB 2A1RA 3IA0A 2HHQA 3LWMA 5THWA 3E9LA 5D3GB 1NK7A 2LMIA 4B9UA 1M5PC 3K9KA 3M32A 3TJ9A 1HBOB 1T02A 5D8HB 2PBDA 1VQPN 1NJZA 3PY8A 4IFYB 4EO6A 3LM9A 2CJXB 1U7LA 1HNIA 2A1BA 3KJNB 4B1ZA 2OKQA 4BR7A 1GQEA 1FXRA 2XZTB 5F0UA 4CO4A 4J9PA 1MN9A 5KAKA 2GJIA 2IVFB 5HL7L 4DPUA 1IBCB 4LJMA 1PBUA 4OPAA 2XSJA 3GV5B 4LRCA 4IG3B 1VHXA 4I56A 1EB0A 3BH7B 2OP5A 4HCCA 1J27A 3TZWA 5HQ8A 1HRHA 2Q79A 3CCRN 2ZBQA 3PJ9A 3HVTB 3SI6A 4FO0A 3IS9A 4NLTA 4NXNJ 3TWZA 5SZTA 4ZOSA 2O8CB 1P1LA 4O3SA 1VSEA 3CQXA 3OTDA 1TP7A 4Y0FA 2E8AA 5HL7Q 3JTPA 4IRCA 1HI1A 3OYMA 4EZ6A 3TYTA 1RGIA 2NCKL 2Y9HA 1Q78A 2FLLA 3J8AA 4JV2A 4CJWA 2JJ4D 1K1SA 4ZDNA 2ASYA 4JV5F 5F8JA 2AYBA 3HP6A 3LDLA 1IKYB 2RKIB 4OI6A 1I3OB 3SQ1A 2DHXA 2QIFA 2DVIA 2MGZA 2AQ4A 3N28A 1VQKN 1REVA 4ED1A 1SXLA 2A42A 5FPEA 4IOAL 2Z56B 1Q86T 1S0MA 3HYFA 4V19J 3ALYA 2UUAF 5B7WA 4HTUA 1JJ4A 3Q89A 1WTBA 3FJ2A 1HYVA 3ZSYA 4CJTA 4DTRA 3CSKA 1IM6A 3G10A 5ELZA 3TVYA 3T41A 3PYFA 5AFUA 4C8KA 3DLKA 2B4JA 3I0RB 2HMIA 2RILA 2EC0A 4DV1J 3VQ9A 2KN4A 1QVGM 4C8ZA 1LXNA 1TFWA 3BUZB 2WZ1A 2VBWA 4A2AA 2B4PA 4IOAQ 2R2UA 1FESA 1N48A 3HHNB 2DGWA 2F8MA 2F9TA 4O0JA 1F5AA 3CJ8A 2QXLA 4NPOA 1HIYA 3IBWA 3KHGA 3BH6B 2P9LA 3CDAA 3SV3A 4J2DA 4LRBA 1QZ6A 2W41A 2JWLA 2J6UA 2QGFB 4A57A 2HHVA 1PJ6A 1O5JA 3IGVA 2FVPA 3THTA 2MKIA 2JEJA 3H4DA 3WX4A 2E2NA 4WYWA 4OJ3A 2DR6A 3W63A 1NM2A 2BA9A 2O4GA 1U2CA 2IHR1 4I69A 4CLKA 3PRDA 2R7VA 4PG5A 2PYLA 1TKZA 3KLVA 3O80A 4M3WA 3CCSN 3GIRA 1NJIT 1RWUA 4U95A 2DNKA 1RTHA 4U8VA 2QFIA 2X1AA 2BQ3A 5CYJA 1GLLO 2DKOB 2ASPA 5BPNA 2NRZA 2OAUA 3HD1A 4FJLA 2VC0A 5FDLB 1FRIA 2DK2A 4DSIA 2J0XA 3DLRA 3O08A 3CE8A 3KK3A 2N3LA 2G8UA 3TZXA 5F2RA 4IO1A 4J7CA 1N5SA 4FWOA 5E3QA 3P3DA 4B1VA 1IKWB 5BPLA 1YI2N 3RAXA 2YKPA 4AE5A 3NH1A 1SJ3P 1P6TA 3M32B 3K5OA 5KFLA 2WOMA 1RDRA 2JVOA 2KU7A 3DRSB 1LFWA 3NOCA 1WSFA 2FSJA 3VA3A 3TJAA 4JI0J 1ZM2A 4OPJA 3HD2A 1NCLA 4NB4A 3L95X 2D9OA 2QL5B 2R8HA 5ETLA 5HMXA 1TK5A 4NLYA 3BF3A 4G1PA 5IQ6A 4OJRA 2HS4A 4CZCA 2E5GA 1QSLA 2BVZA 4JD2A 4NMXA 2HNYA 4C11A 4M5GA 4FM2A 3CWJA 4DFMA 4B3TK 3H4BA 2XSJB 5HMWA 4DTUA 4AILC 3VZHA 3MPWA 1M1KT 2OTJN 2CQDA 1X5TA 2DJWA 3LDNA 2PFDA 1VQ9N 3LP3A 2OMLA 2KVQE 3W60A 1I39A 2BW7A 4MO4A 2XYPB 2AT1B 3TTDA 4U7UD 4M5MA 1JLFA 4Y34A 3HPHA 1KLMB 3LA0A 1RT2A 2P9NA 2FZGB 2EVZA 4W5RA 2Q1NA 1RZMA 4I6AA 3PFEA 4ILRA 4NI2A 3H1QA 4DV4K 2IM1A 1R27B 1VLOA 5AQNA 1D0EA 1W7AA 1XMQK 3L0QA 2DR8A 3KNAA 2IC3A 2DGUA 4NEZA 1HBNA 1ZBFA 3CUNA 3M8WA 4JS4A 5B0CA 5T41A 4K4YA 2FJEB 1UMJA 1HJOA 3NXZA 3RGIA 3BGFA 2VPXB 1RU2A 1NWKA 3KLFB 4CO0A 2K1RB 2M0GB 2YQ0A 3E1YA 4QR1A 5T7BA 1S4FA 2XI3A 1BOTO 3K5PA 4G6VB 3TP2A 4DUYF 3I4HX 4W5OA 5BRFA 2DH8A 3K0SA 3DKDA 4KPCA 1WEZA 2RRAA 3DLKB 2HMIB 2B9EA 1SQEA 4W5NA 1UPPA 1BXNA 2MKSA 2OPPA 2HWIA 3OXFA 3RRKA 1JK9B 4RG8A 3AVAA 1MWMA 3E2EA 2H9ZA 4CIEA 1EETB 5LXRA 4G1IA 5KQ8A 1DY3A 1LW0A 4J9VA 7FDRA 3JS9A 3VHQA 1FX2A 1LNQA 3GG0A 5KFGA 2ABYA 5KFJA 4X4QA 1U0HA 5IT9U 3M7VA 4O55A 3OPKA 5DM7Q 3PRBA 5HBMA 1GLEG 5ETVA 1YJUA 1U1QA 2GUPA 5C12A 4QPXA 1S72N 4FDFA 1U1PA 1QVGR 4KHSA 3O6QA 4B3TF 3HDSA 3V81A 1TKZB 2QG9B 5LY3A 4FLWA 3JB9k 3SXLA 2YNGB 3QEPA 3M6WA 3J81Y 2FLPA 4PQUB 4CECA 4RBTA 2HVDA 2GJ2A 4C97A 3CQ8A 3C6TA 3QGHA 4G3IA 4KI6A 4Y2KA 1LAWA 4JAXA 3C6AA 4LIRA 2UP1A 2BYCA 4FN5A 3KK3B 1DQAA 4XO0A 2B4OA 3HVAA 2QW9A 4DV4F 3KLHA 2FD2A 2IRYA 5K14A 4DQSA 4QOZB 1X9SA 3ZZZA 1XMQF 5KG6A 3H45C 1HKCA 3QJLA 1QZ5A 5CYMB 3W62A 3NGYA 5CZVA 1B7YB 2AYMA 4DTXA 2CQ1A 1ZBIA 4KGMA 2XLIA 1VFJA 1KTQA 3HHLC 2GQCA 3IAYA 1HNWJ 3MOJB 1GTEA 4CJ7A 4QS9A 3NBPA 2VG6B 3PIOL 1NGFA 4H5VA 4ZKAA 4PKIA 3KMSA 2PEBA 2P9IA 4ED3A 4B3MJ 2K06A 3PIPL 4IO8A 3SUOA 2XWYA 2CQGA 5DM6L 2JWNA 4IH6A 3NGSA 4JI5J 4CT8A 2ZD1B 1W0HA 2HVZA 4EBCA 2W7PA 2VFTA 3NGDA 4UZCA 4JK9A 2HNYB 3SMSA 4PAAA 2FBXA 4M5DA 1BQMB 1HWJA 2OTLN 4OYOA 2BJDA 1GLJO 1NNEA 4M3UA 1RHKB 3HFKA 2MQQA 1HLWA 2ZKUA 1HBMA 4DU8A 4QQBA 5E26A 3WNEA 2NZ4A 4NWBA 4P2MA 2O8EA 2B43A 3AOAA 4DUYJ 4QAGA 5FLXO 5GAGP 1WKJA 1RBRA 4LF8J 3V6HA 2ZOFA 3QFHA 2W8KA 2YV0X 1BUXA 4X4TA 1ZC6A 1XK8A 2JHEA 2WVBA 5M2PA 2M52A 5FIIA 1RA6A 2HBKA 3RWUA 4NI2B 2PFFB 1FKPB 2AP1A 4YORA 3H7HB 2XC9A 3QMLA 1S76D 4FYDA 2HBRB 1F9EB 5AE3A 1PCAA 4EUVA 2VPYB 1M5OC 4AQYK 1H7WA 4TU8A 2Q6BA 1A7GE 4CJ4A 3FLCO 5K8PA 4W5TA 2E20A 1Q7LB 4OHZA 2EKYA 2GFFA 2D0AA 2MZRA 1U2RA 3VEYA 3DGPB 3FZFA 2QV6A 3VQBA 5AE2A 3A5MC 2ZITA 3L7PA 3UN3A 3OS1A 3OTBA 3DLEA 2HZAA 5FJ4A 4EWTA 4CH7A 2PSZA 2DCUB 4O3QA 4BR0A 3D28A 4PWDA 2GAGC 3OFEA 1C4AA 2HQDA 1VBXA 2C2ZB 4OX8A 1G1XA 2HRYA 2X78A 3V6JA 3QJPA 4AF1A 3R6MA 4HTLA 4Z4EA 3W1YC 3DCAA 2QYCA 2BX6A 1WDDA 2IRXA 1GEHA 2CQPA 3PX6A 1LW2A 2E1PA 2UXCK 5D4PA 3D6TB 4KGXB 2GMJA 2AP6A 1XBWA 4BG9A 2KFZA 1FWKA 2R7YA 1UZHA 2KYXA 1IBKK 1N0VC 3FZ2A 2LXFA 4RO0A 1RCXB 1GLBG 3FZLA 4ZCIA 1N34K 3KG0A 2ZH3A 4YP3A 2ZUGA 3DYAA 4CFCA 1U0HB 3BP8A 3R2CJ 1Q16B 4QBUA 2K3KA 1KQGB 2CNNB 3I4PA 4M8LA 2UVWA 5KFIA 4H5RA 5MLCQ 2O4IA 3QT7A 3W8PA 3VTHA 3RB6A 2KG1A 3MCAB 4FPIA 4PPDA 3ENQA 2GC8A 5JLHA 3W2VB 4MT1A 1U1RA 3VF0B 1H38A 4BGBA 2EBEA 3FGVA 4F3MA 4ZA1A 2VG7B 4Q45A 3THXB 1RKJA 3A5NC 2F8EX 3EJMA 1U26A 1BCMA 5FPDA 1JNZB 4CZIA 1B99A 1JLQB 4O4RA 1I3AA 5IOLA 4U96A 4IFVB 1XQIA 4NLRA 3D6HB 2JWKA 3P5BP 2HK2A 4YB6A 2OD6A 3SSQA 1ZZFA 2I1RA 1WAFA 2VGNA 4FF2A 3VEXA 5G0RB 1VI7A 2VCPA 1CLFA 3B4DA 2FQQB 2WSEC 1WG5A 4K4ZA 4KB0A 1ZPVA 1K9MO 1HARA 2DGXA 3OT9A 2BJ7A 2RF2A 2E5JA 4CJLA 4AQYF 1C6VA 1J5OA 4YB1P 4WP9A 3CFOA 4WU2A 4DX6A 4ECUA 1HNVA 1HW8A 1FERA 4TU9A 2QMXA 5IT9O 4J9NA 2GNKA 4QIGA 1ASWA 2EFOA 2HBQB 4D3GA 2P9IB 3IAS9 5KG4A 3CGIA 4K4XA 3QWPA 2BMBA 1S6OA 4RU9A 1KRPA 1Z6RA 3CFPA 3S3OA 3VCDA 5HVHA 2P9GA 3SQ0A 2FJAB 2UXBK 1YKWA 1T9YA 5KT3A 1GLFO 1L3TA 4KHRA 4QOTA 3MN7A 2DGTA 3DXSX 5EOYA 1LOTB 1K0TA 4Q8FA 3Q7CA 4WIIA 3UR0A 3T1YJ 4ATNA 4JI1K 5GVQA 3ZZOA 1RILA 4WWSA 1IBKF 3MMAA 4HHJA 4P52A 3QDKA 3BN4A 5C2GA 2ZM6J 1KVBA 1N34F 3CXCM 1ZBTA 5J2NB 3MFIA 1FXLA 1OY6A 5CQGA 3MUTP 1FE4A 2KFYA 1GXUA 1WBBA 3W65A 3SMZA 2QXFA 3I5CA 1WSIA 4CTAA 1CS4B 4QCLA 5B0BA 1IJEB 3BPDA 3IG1A 2QA1A 4FF4A 4DV6K 4HDHA 4Z2XA 2ZF5O 1P90A 3M8RA 3UE5A 1AFJA 3H2VE 2GUIA 3MAQA 1YGYA 1F1BB 4IOXA 2IM3A 1EKSA 2MKYA 3IUCA 2E5LF 3ADAC 1NAQA 4X84A 1ZAXA 1L3UA 4DPXA 3DRXA 3M6XA 3MCPA 4IDKB 1Q82T 4OKJA 4XH5A 4RPFA 2HWTA 3MEEB 3NNCA 4PWDB 1PKUA 4WQ4C 3WHIA 2XMUA 1XR5A 2XHCA 4ED0A 3WQUA 2YPYA 3CD0A 1YRUA 3PKMA 3W9HA 1EKRA 1DLOB 2EG2A 2RT3A 1U6ZA 3ZT1A 2CNLB 2O66A 1KNZA 3QEWA 1BI4A 1QQCA 1KXPA 4NYOA 3EMTA 3RR8A 4CEAA 3THPA 4AXIA 3CJ7A 3OXGA 3QFWA 4A8FA 3GYXB 4CLUA 4R5PA 4DV5J 3LAKA 2X6NA 3CJTA 2D9PA 3KHRA 4FJGA 3MM8B 3TAGA 5ETMA 4BQZA 1TMJA 3SNNA 1CC8A 5HK4A 2XYGB 4DJBA 4HTJA 1F3VA 4OQJA 4JKGA 4CGJA 2F8TA 3BEGB 4DSJA 3Q2TC 2UXBF 4QJVA 3RBDA 2OEMA 5AT1B 3DXKB 3HOTA 3F56A 3IRXA 2FBYA 3HOSA 3D3BJ 5EX0A 3U1NA 5A2QU 4JKDA 2F65A 4FJXA 4GVMA 2IAJA 3MF5A 1XIQA 4CO5A 3J7AN 1BGXT 3I33A 4PPZA 3EGZA 1Y7PA 4JI1F 1WACA 3EZ5A 1VIOA 2PT0A 1H7XA 3AGRA 1F2GA 4ZPBA 4K7QA 3IC1A 3P45B 1IN0A 5GADI 4C1NI 4CHQA 2QT7A 2QLWA 3SQOP 4DR7J 1T9TA 4DL7A 2RAQA 3TEHB 2MY8A 4O3OA 1RWVB 3W2WB 3MWPA 4ZHRA 3T9NA 4HH1A 2BGGA 2G8IA 2L3MA 2Y8YA 1U4BA 3ATVA 3MEKA 4Z7CA 3LM2A 3ILLA 4O4GA 3ZEUB 4DV6F 2X3GA 4L72B 1SUQB 2HIQA 3HFZB 3VQSA 4RW4B 2WB1D 1RKIA 3SV4A 2XYHB 5A8KB 2HK3A 2AKWB 5JLFA 1HNVB 4TXSA 5CCMA 1EARA 3PR4A 5DK5A 2K7KA 1WSJA 3NDKA 2MDAA 1NJWA 1T9XA 4GVLA 1VQSA 3TNVA 3U02A 1JKHA 3AO2A 1YLXA 2V8GA 2BXJA 3FDSA 1J2VA 5HATA 4NXMJ 1FEEA 2BUPA 3D0GE 3M9MB 1Q9YA 2GWKA 3QWUA 4MDAA 1RTIA 4KB7A 2GMLA 3EICA 3M6UA 4KKOA 3FFKB 4IFEA 4NEYA 2F7TA 1DAXA 4OYAA 2CDRB 1ULRA 1H3DA 3PO5A 3CO0P 4DV2K 4L3KA 4DFPA 1ATSA 3H25A 1PSDA 2E5LJ 4IZ9A 1NGJA 1TKTB 4QPTA 1QHAA 4ED6A 3KWGA 5CA5A 4JI2J 1T05A 2DRAA 3DU6A 1VRQC 4P75A 5IT9Y 3MMAB 2W8LA 2HHXA 1TL5A 4OIXA 2V8HA 4H0YB 1C0MA 4LBPA 3ULDA 2NRWA 1VQ4S 3TA1A 1BU6O 3VQ7A 4G65A 4F9OA 2XMMA 3S1TA 4ZVUB 4K25A 1XNRJ 5H9EK 3WNGA 3WQPA 4CTAB 2ZVSA 4USWA 1YJ7A 3V4IA 3CCLS 3ZFVA 3KK2A 3UDEA 2VJUA 2LQ9A 4L75A 2QA2A 2VKRA 5LJ5Y 3ENAA 4FXWA 5EWGA 2FJVA 3IGNA 5LM7E 1OH5A 4DOZA 3QGPA 3GLJA 2NRVA 1TKXA 1HHSA 2LU2A 3HHLA 3MOZA 1WSHA 2P9EA 2OZMA 3CXCR 3FSXA 3KJVB 1N6QB 2FDNA 3CEDA 2ZH2A 3DLGA 4N5SA 2IVPA 1VQMS 1VS3A 3RW6A 1FO1A 4YDUC 3D67A 3D7SB 3G96A 3SI8A 3M30B 1MU2B 2YH0A 4PXDA 3UCUP 4OZJA 4KGVB 1X4HA 2CAJA 1CJKA 5EY4A 2VYPA 3MXJA 2QKKA 1M5HA 4CO2A 4JI4K 4MO5A 1HNXK 3OYCA 1YWXA 3B8AX 4FWLA 4OYWA 3NGIA 2XO6A 1BWEA 3V9UA 4ZLLA 3HRGA 1U47A 3BYRA 3ET6B 5I4MA 3IBCB 1KWMA 2HOEA 3P83D 2V51B 1YX2A 2H3GX 4DHYA 3R5DA 4DV7J 1S0NA 4LIWA 4JKGB 3I56S 3HHKA 1RFQA 4BRMA 3FSIA 1WC5A 2OPQB 3KXDA 3CO9A 1MMLA 3UFCX 1C0FA 3KWMA 2RQCA 2H1YA 2MQOA 3LW5C 2UUBK 4DV2F 2DHHA 1D09B 2EC2A 3X1LB 1U1NA 2NPIA 2EPIA 1VRUA 4LFBJ 4LF6K 2NYHA 2G0JA 3RAMA 4USUA 3QZ7A 4QWDA 1WJ9A 2NSBA 2NXNA 3JTOA 1P27B 3SIPB 1ZETA 4Y28C 2XMTA 1VBKA 3OY9A 1N8RO 3IBFB 4LFCJ 2OMOA 4X4PA 1WSVA 2JDJA 3OR2A 2GWJA 4ZITA 3B6OA 2RU9A 4CGIA 3NF9A 4ED4A 1B0PA 3EZOA 4OI4A 4ZP9A 1KVJA 5C42B 4DR4K 3WC0A 4DU7A 5KFSA 3AVCA 1Q5YA 2PI4A 4WFZA 3UD4P 3MHYA 3J7ZO 2ROPA 1X9JA 3TA2A 4U7BA 1EJ7L 2KW4A 1E4GT 3GU0A 4JI6K 3JSBA 3NCPA 1B7FA 1F5BA 4ZPDA 2BE2A 2JLEA 2HVHA 3VA0A 5KFKA 3N4QA 2DISA 3HSCA 4HCBA 4DR2K 2Q43A 3MN6A 5B0EA 3VQTA 3C65A 2O67A 4BR4A 4B9QA 1BA0A 4EYIB 2Q2RA 3R3LA 2UXDJ 1NJYA 5KG5A 5L1IA 4RCHA 3CCEN 2ZE2A 4ZP8A 1C1BA 3ZZTA 2FJWA 1UFLA 3WZ0A 2V2VA 1VC5A 1WWHA 4L73A 3L3VA 4J2AA 2BANA 4ELUA 1X60A 2V0NA 3RRHA 4A62A 2CPEA 4JI4F 2FPHX 1X0FA 1HNXF 2LQJA 5D4OA 1LWCB 3DRPA 4FWKA 5E33A 3VQEA 3O1LA 3BR8A 3V1OA 1N5TA 3H3OB 4C2MA 4HACB 1ELOA 2DIUA 1AXQA 1CJVA 5LJWA 1SJ1A 3KK2B 4JKBA 3HKWA 3Q0AA 3EGNA 4ID5B 4TQRA 1P1TA 2ZHOA 5HP1A 1SC6A 2UUBF 4FZZA 3VGMA 4UQTA 1FJGJ 3ZYYX 2V50A 1TKXB 3CJ5A 1ITGA 1CPZA 2HBLA 5KT6A 5D77A 1FRMA 5E3RA 3ULHA 1Q8KA 1WOOA 4DFKA 2RDJA 4PEOA 2D74B 1NK8A 2P9KA 3IWXA 3NY0A 4DR6K 3U3GA 4FJHA 1Y4ZB 1BQNA 1YHQS 4BVPA 4ZJQA 3MPVA 4LRFA 3NS5A 2IBKA 1QTNB 2VH7A 1S6UA 4DV2J 2P9CA 4OZ2A 1T6CA 3OSPA 1T95A 3HTVA 1HMVA 5IC6B 1AROP 2ZZTA 4CQ1A 4DR4F 4CJFA 2VBXA 1CJKB 5DLFA 1K6YA 1I94K 3UD5A 1NH7A 3GV8B 3DWLA 3UPFA 5LJVA 4B9TA 3FEXB 3MMCA 4PZVA 3UNGC 4JI6F 3HXMA 1Q4RA 4JRQA 3H20A 3PRVA 5AQLA 1U2VA 2HSEB 1S6PA 4DR2F 3D7EO 5A0YA 4Q43A 1X4AA 1JB0C 2DH9A 3LP2A 4UW2A 1BHNA 4KQZA 2WUSA 3C14A 5LSRA 1X4CA 4DV3K 4FJ5A 3Q8YA 4JUZA 3LTOA 1SH0A 3BB5A 1B0TA 1C1AA 2RE1A 2DNYA 2D1KA 5FRNA 4J9KA 3CIZA 3DN9A 4C4WA 1UVIA 3VERA 3JTNA 3ITHB 4QWCA 1RAHB 3OTCA 3QINA 2C2MB 1JLCB 1VRUB 2VA2A 2J5AA 4K42A 2E2QA 4HL9A 3ZTSA 3T69A 3W7BA 4O23A 2RE2A 3A13A 4P10A 4EEYA 3CD7A 3KVGA 3PW5A 4L8RB 2CPYA 1XNQK 5AXMA 2W7AA 1FDNA 4JHDB 4C8OA 4AH9A 3QMQA 1U24A 1BE4A 1SS6A 4WQ4A 1B9FA 1NH8A 2J4RA 5DLGA 2PZSA 2KT2A 2P6SA 3CTRA 1NPPA 1ZXOA 5ETRA 3AY9A 1REGX 1RU1A 1WC6A 1MA9B 2ILZA 2BE2B 3OYHA 4UUWA 4CP5A 2A6MA 5M1QA 1UFWA 3ENVA 2XS2A 3SZ2A 1KTVA 4A8XA 2Z4PA 3PV8A 1D9DA 2YKOA 3OVSA 1X4FA 1DBDA 4DR6F 3NKYA 3VALA 2RPIA 3D0HE 3QLHB 5AE1A 3UDVA 3QEVA 1LQ9A 3EUNA 2P5OA 3KUHA 5B0FA 4OJHA 1WD6A 4WYBA 4H4KC 4LBHA 4KAIA 2ZE2B 1PYOB 4KGKA 1HBUB 4CHNA 4CEDA 4FKYA 3W66A 4KH4A 5JS2A 3FZKA 3D0IE 3F5TA 4HWIA 1G7CB 5CD4H 1I94F 2BTFA 4B02A 2W9CA 2G8FA 4OYXA 2D41A 4ZTJA 1DTQA 2WBRA 3BKUA 3TARA 4CJSA 3HVWA 4DCPB 1OJ4A 3BY5A 2Y1LB 1HD0A 1S12A 4TYBA 4TYAA 1VQNS 1FRHA 3WEEB 3C7NA 4KV8B 4LF9F 3U7JA 4DL0C 1TL7A 5L9NA 3EXYA 2IIRA 2KVIA 1EHWA 1JLEA 2DNRA 1CJVB 4KY3A 3HZ6A 4PY5A 3DXMA 2B8QA 1U2FA 5A2QY 1MMNA 1RAJA 3DLLQ 3J7A1 3OJSA 3AXKA 3TAPA 4Y2CA 1WUUA 1FNMA 2QJ3A 2CJYB 3CI5A 1NKEA 3M8ZA 4UUXA 5LL6d 3R8YA 5HP1B 3BPSP 2LQ5A 3ZNJ1 2E6LA 4DV3F 1XMBA 4RR5A 4DG1A 3CCVS 2VASA 1RT7A