4RW4A

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
total genus 145
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw4A05
4CHPA 3GIJA 4FJKA 3SPYA 4MK7A 2WOMB 3RMCA 5C5JA 4FJHA 2GIQA 3UIQA 5F8HA 2XGQA 4KHRA 4Q0BB 3HVRA 4HCBA 4J9KA 5KFGA 2XWYA 4DQIA 1I3AA 1JLQB 2FLNA 1N5YA 2X74A 1NHUA 3TVKA 1RBUA 4B9SA 4NLSA 4M94A 3KD5E 2YNHA 1T3NA 4QAGA 4URQU 3ITHB 5KFPA 2ZQBA 3M8QB 4O44A 3OYCA 4JS4A 1UWBB 2OPSB 4N41A 4URSA 3ZSXA 4CJEA 1QSSA 2OA8A 4ED8A 3KLEA 1KHWA 4B9VA 4DQQA 3NBPA 3HK2A 4H4MB 3VQSA 4QOZB 1K6YA 4LY7A 5I3UB 3L2WA 1C1CA 4C8LA 3SJJA 2KFNA 4XPCA 3MXIA 3KLFB 4NYNA 5J2MB 1EP4B 3DRPB 4KHYA 2XY8A 1JXBA 4W5TA 3TAQA 2KW4A 3OSPA 4J2DA 4F4XA 1RTIB 4ED1A 5T14A 3KK2B 4Q8EA 5C24A 2J6TA 4ECTA 3GILA 2C22A 4H8KA 4E7IA 1C0UB 4K4SA 4CJ3A 3ZSWA 1RDRA 5KFVA 3QETA 1JLCB 4IOBA 2ITGA 3RMDA 2OZMA 3RWUA 3DDKA 1S5JA 2AX1A 2F8TA 4TYAA 4IH5A 4ICLB 3AO5A 1EETA 1NJWA 3TQ1A 5F8NA 2FJXA 2E9TA 1WNEA 5HBMB 4CIEA 5DMRA 4EP5A 4OGCA 4ZVGA 2RDIA 4KHMA 1BQMA 4CECA 2QXFA 4L8RB 1ASVA 4KB7A 4B8AB 3OYFA 4KSEB 2B4JA 3SNNA 5KFIA 1ZTWA 3ZT1A 4CF1A 4CGFA 4FZZA 4ED2A 1JLCA 3GYNA 1QAJA 4XIUA 1S49A 4LQ3A 3DOLB 1J53A 2UVVA 4QCLA 4Q8FA 5KFZA 4CJQA 1XWLA 4M95A 4NLDA 4J9RA 4E19A 4BDPA 3V1OA 4NCAA 3HPOA 3LWMA 3K57A 4DTSA 4Q44A 3ISND 4WYWA 2ATQA 1ASUA 1QTMA 5EWFA 3H4BA 1U04A 4O4GA 3MR6A 4CEAA 4E1MA 4FW2A 2W9BA 1NJZA 3KLHA 3HKWA 1JXLA 4O4RA 2XC9A 3I8DA 1ASWA 2HHWA 3NAIA 4F2SA 3CG7A 3V4IB 2J6UA 2FVSA 4CFCA 1HYVA 3PZPA 3CDUA 1JLFB 5EU7A 4WZQA 3FRZA 2HHQA 3ZCMA 1RT7A 5DG9A 1S9EB 3KK3A 3C6TB 1S0NA 3OYIA 4B8CA 4ECSA 3CFRA 4FW1A 1CXUA 3NE6A 3M8QA 4MFBB 4OVLA 3PUFA 4K8XA 4O3NA 4CEEA 2WB4A 2E9ZA 4FM0A 3VA0A 4M3YA 2HNDB 4M3RA 3V6HA 2YNIA 3DLEA 3VQPA 3CFOA 2QKKA 4M45A 1VSFA 3V9XA 3SPZA 3L3VA 4FJGA 3ZT3A 3ZT2A 2ALZA 1LWCA 3HVAA 1VSJA 3L2VA 4QWDA 2R8GA 1RNHA 1S1WA 2VG6B 2X6NA 1DTTB 5L1LA 3OYAA 5L1IA 4RUAA 5F9NA 4KKOB 1S0OA 2QV6A 2VG7B 3QIOA 1ZBLA 1ZBIA 2OZSA 4AHCA 2E6LA 3QNNA 3BQ0A 1RYSA 2QK9A 3HVWA 3KLIB 2JEGA 1HNVB 4DQPA 1CXQA 4KTWA 1B92A 3TAFA 3E01A 1N4LA 3DYAA 1R0AA 4CJPA 4FM2A 4I9LA 4NYZA 4FM1A 2FJWA 2HVIA 3MTKA 3LAMA 4ED6A 3CWJA 3WNHA 3UPFA 3VQ6A 4WZMA 4Y1DA 5J2QB 3SQ0A 2HHSA 3AO4A 3KKSA 1RDCA 3TAMA 5KG0A 1C2PA 2R2SA 4QWBA 2HNZA 1Q9XA 4QW8A 1KVCA 1FKPA 3KKRA 4RNNA 3MEDB 3CIZA 4Q45A 5KFRA 4F50A 5E41A 1LWEB 4OKJA 3VQQA 1MU2B 3OYGA 5KFEA 1QAIA 2IAJB 3NDKA 4H4MA 3AVKA 3GQCA 3EY1A 1VSKA 1D5AA 4OPJA 3IN5A 4FLZA 4TY8B 5J2NB 4MH8A 1BL3A 3CFPA 4QW9A 2IAJA 4I2PB 4N5SA 3PO5A 1RBRA 5KG7A 5C42B 3LPTA 2UUWA 3LAKA 3CVKA 4LD0A 4RW4A 4R5PA 4Y2AA 1U45A 1RTHB 4ED3A 3KJVA 1JLFA 1RTIA 1IM4A 4URGA 2AQ4A 2P51A 4I9QA 1KLMA 5HLFA 4HUEA 3IG1B 4MIBA 3NH0A 3C94A 1BI4B 4JLHA 2D3UA 4EZ9A 2HNYB 5I42A 3HPGA 3GIMA 5KT6A 4F4ZA 1TL1B 4OPKA 1JL1A 1FKOB 4GC7A 2EHGA 1BI4A 4RW4B 4R5PB 3N6LA 4NLOA 3GV5B 2HHVA 3DM2A 1CSJA 1EX4A 5CY4A 3V9ZA 4DSLA 2PZSA 3OJUA 1JLBA 1UWBA 3SUNA 2G8WA 4Z4HA 2Y1JA 1KSPA 4WFZA 5I42B 4Q5VA 4FZXC 4IFVA 2PYJA 3ZSQA 4N76A 2OPRB 3QLHA 4ZP7A 1T8EA 1TKZA 2DPIA 3HT3A 5FROA 3LP1A 3SI6A 3G0ZA 1NJYA 5JS1A 1ZBFA 3CJ4A 1TQLA 4CF2A 1FK9B 4FJ5A 4O3QA 4YNQA 1N5YB 2B43A 4K4VA 5KT3A 2BDPA 1RT5A 2JC1A 3DRRA 3UR0A 1YVFA 4G1QB 5EUHA 3H59A 4W5RA 1JLBB 4DL6A 1NKBA 2OPPA 5D3GA 4X2BA 5KFSA 4FLVA 4LH5A 1HYZA 2D0BA 3IGVA 4CEBA 3CJ0A 4NYFA 5EWEA 3SQ1A 5KFHA 3C6UB 4ZPAA 4WYLA 1IKXB 1RBTA 4Y34A 2AGQA 3A2FA 2ASDA 3ISNC 4J9SA 3NGDA 1HPZB 4FJXA 1S6QB 3NF7A 1S9EA 3KK3B 4CGGA 1TAUA 1S1XB 3NF6A 1IKVA 2Y1IA 2YNHB 2NUBA 2IGIA 3AO3A 4WXOA 4FK4A 3I5CA 1MU2A 5HROB 1T03B 2G8UA 1KRPA 3RR7A 4PY5A 3KMSA 4FJ8A 3ITHA 4IH6A 3OYJA 3QLHB 4NLGA 5DQGA 2BRLA 1W25A 4BE0A 1YTUA 1NOZA 2P1JA 1UA0A 4CCHA 2HMIB 3WNGA 1W0HA 3ZSVA 3H5XA 4CK2A 2G8IA 2WRMA 3RMAA 4MKBA 1LV5A 2C28A 1RT4B 4DTMA 3LZIA 4M3TA 3H08A 4JS5A 3KHGA 3CYMA 3OYEA 4LSNA 1HARA 3OL6A 4O55A 4ECXA 1U49A 5HRSA 3DOLA 3DRPA 3OLAA 3QINA 1KFSA 1HNVA 4M3XA 1UA1A 2VA3A 1JKHB 3PJXA 1JLEB 2G8HA 1RT1A 4NLVA 4FJNA 1R0AB 1NK4A 3Q8QB 5KG4A 2YNGA 4YR2A 1EKEA 5KGXA 3DMJA 4H54A 2GC8A 1IO2A 4CJVA 3OY9A 3S3MA 5C25A 4CGIA 2I1RA 2C2RA 1TK8A 1WAJA 3V6DA 4RW7B 2F8EX 4MK8A 3NCIA 2R2UA 1QSYA 2RDJA 1YVUA 2JEJA 4J9OA 3WNFA 4LSLA 4ECZA 1DTQA 5SWMA 4EYHB 2VG6A 4K50A 3TWHA 4ELUA 1JIHA 3LDSA 2ASLA 4YR3A 3V81B 4O4GB 4DL3A 1KFDA 4KTZA 3PO4A 4TYBA 4ZPDA 5KRSA 3SV4A 3M8SA 1GX6A 2YKMA 4PWDA 3NH2A 1S9GB 4G3IA 1BCOA 4W5NA 2YNFB 4EBCA 3OL9A 1HMVA 4J2AA 3NAHA 2IM3A 1C0TA 3KLGA 1LWFA 4FK0A 1A5WA 4I7FA 1C6VA 4PQUA 2FC0A 3M8PA 4AHUA 3DI6B 5K14A 2QKBA 2EC0A 4FJLA 3DRRB 3LP0B 2ZE2A 1REVB 1S9GA 2E4LA 4TQSA 3K5LA 4J9QA 1LW2B 4HUGA 3DLBA 4ZMMA 4EBDA 4KFBA 2R8HA 1T03A 3OYLA 1X9WA 5KRTA 4FJMA 1S1UA 4MK9A 3RRGA 1Y97A 4PQUB 1JL2A 1HYSA 4ZVEA 3H40A 3DRSB 3FFIB 1TK5A 5HRPA 4Y1CA 1WSJA 5J2PA 3O3HA 4FS1A 3UQSA 3QIDA 3KOAA 2V0NA 3AA3A 4CJWA 4FLWA 2W8KA 3NL0A 1K1QA 5JUMA 5KFOA 3VA3A 4DFKA 4DU3A 5J2PB 3CO9A 4CJ5A 4DWIA 1N6QB 3QO9B 3D45A 1RTHA 4B9LA 2IMWP 5L1KA 4KTQA 3I0SB 3L2UA 2IM0A 4FYDA 1RT2B 4OGEA 5KG6A 5F8GA 2RN2A 1N56A 1XHZA 4I7FB 2F96A 1B9DA 3PVXA 4ECQA 2RKIA 3V1RA 3KLIA 1ZBUA 3VQ8A 3HVTA 2DPJA 3BSAA 4BE1A 4OLAA 1T05B 1LWCB 2WTFA 2XHBA 4IFYA 4ID5B 2XI2A 1IKYA 4IR1A 1SKSA 1RYRA 1RTJA 1HNIA 1S48A 1LAVA 3DRSA 2R2RA 4O0JA 1OS5A 1B9FA 4YP3A 1J5OA 3AVLA 4KAZA 3RBDA 1VSLA 1TL1A 2HHTA 2IBKA 4FS2A 2XGPA 4CGHA 3QEIA 3RB0A 2OPQB 4YQWA 3HP9A 1TKXA 3DYAB 5KG1A 3OYKA 2RF2B 1TVRA 1REVA 2ETJA 4KREA 1HRHA 3SQ2A 1N6QA 1X1PA 1IH7A 2W9BB 1C0MA 4C8MA 3B6OA 4DF4A 2KFZA 3QEWA 4CIGA 4IG0A 3G86A 4C8NA 1T7PA 4NLUA 4BDZA 1QSLA 3HJFA 4IDKB 3C95A 4DQSA 2XY6A 2ZD1B 3OS0A 1S6PA 5HP1B 4NLRA 3KMQA 4M3UA 1SL2A 5F8MA 3KK1B 1WN7A 4Z4EA 1S4FA 1WSHA 4EYIB 3MFHA 1J9AA 1SKRA 3AA4A 4KV8A 2FJVA 5KFYA 5KT5A 4KB0A 1CZBA 2YNIB 1Q9YA 3BSNA 3GV7B 3SUOA 2ASJA 3FSIA 3PW7A 3OSNA 1TV6B 4CHOA 3KLEB 1BHLA 3GIKA 3NGYA 4H4OA 1F21A 4TN2A 4CIFA 4TY8A 3DOKA 4B9MA 4JRQA 1XR5A 2RF2A 2BR0A 4RNMA 2D3ZA 3QEPA 2VG7A 2BQ3A 4ID1A 3TANA 1C1AA 1G15A 1D8YA 5FDLB 4BDYA 4HCCA 4DL4A 2JEFA 2YKNB 4ECUA 3MEEA 3MEDA 5KFJA 4K4UA 2RKIB 3KLFA 2IM2A 1RT6B 4K4TA 1SH0A 3D5MA 1W9HA 1KTQA 3CJ5A 3QZ8A 3KK1A 3BR9A 1TL3A 4I2QB 3MR3A 1NHVA 4KHWA 3T5LA 3NFAA 4QWAA 4NLXA 3QGHA 4AH9A 5KFUA 2KQ2A 4JV0A 1RTDB 1VSMA 4E0DA 4YR0A 3PX6A 4CF9A 1S1VB 1RBSA 4FLUA 3EPIA 3E01B 4CHQA 4QWCA 4ED7A 1TGOA 4DSKA 1U47A 4J9NA 1C1CB 1JKHA 1LWEA 3AVCA 5KG2A 4ECWA 1KVBA 4U6PA 4EEYA 1TV6A 5DGAA 1KLNA 1RTDA 4RW8B 4EO6A 2XRIA 2HNZB 2BQUA 2PYLA 3DI6A 4FJJA 3GIIA 4Z4IA 3Q8RB 3ICLA 2ZKUA 4CEDA 4KHUA 3BDPA 2JC0A 5KFMA 2P5OA 5JXSA 2W9AA 3CJ2A 1RDBA 4CEFA 2W9CA 3PW4A 1SL1A 1C1BA 4R8UA 3P1GA 2D7SA 3SI8A 3KLVA 3I0RA 2B5JB 4KFBB 1D1UA 4DFMA 1IG9A 1GOCA 4RW6B 4ELVA 1DLOB 3IS9A 4CJKA 2YNFA 3QIPA 1KCFA 4IG0B 5T7BA 4LH4A 3O3GA 2HVHA 4E1NA 3NF8A 4CJSA 1SV5A 3JSMB 3BQ2A 2E6MA 1JLQA 3L8BA 1HNIB 1QE1A 1NKCA 2DFHA 3PX4A 3G6VA 4E7HA 3OL8A 3ALYA 4BWJA 1VRUB 2W7PA 1QE1B 5KFCA 1CZ9A 4NLQA 3PR5B 5CYMB 3DLEB 3RB4A 1Z25A 4DTNA 3QNOA 1HYSB 3QGIA 2IA6A 3SFUA 1WSEA 3V81A 4NLWA 3CDWA 1X9SA 3MAQA 5KI6A 1TKTB 3Q8SB 1Q8IA 4PA1A 2VWJA 2VA2A 4RNHA 4F4WA 3QEXA 3PV8A 3RAXA 4NZ0A 2FVQA 2OH2A 1NNDA 3KNAA 3TI0A 1HQEA 3LP0A 2YV0X 5CZ2A 4IKAA 2R8IA 3IGNA 4K4XA 2UUTA 3HL8A 1S6QA 5KTQA 2PY5A 4DS5A 4CJLA 2JGUA 2WCXA 1IKVB 2JEIA 1BISA 1SH3A 2V4QA 1UOCA 3IAYA 2KZMA 1SL0A 2A1SA 4EZ6A 4DTOA 1HQUA 4RNOA 2HWHA 1SKWA 3ULDA 4O3PA 3KTQA 4ZP8A 3H5UA 1S1XA 2FVCA 3V9UA 4HTUA 5KFBA 2WHOA 1SUQB 3PW0A 2QE5A 5DG8A 3HVTB 4DTJA 1U09A 4LQ9A 2YHAA 3NF9A 4ZHRA 4ECVA 1RT7B 2XO7A 1D0EA 4ID5A 1BCMA 3BSOA 3Q8PB 3LANA 1QUVA 3ZT0A 4O5BA 3DLKB 1J54A 3RB3A 1JLGB 2ZE2B 2BANA 1Z26A 4KHSA 3I0RB 4NRTA 1JX4A 3MR2A 4WXWA 1TKXB 1RT1B 2E9RX 4E7JA 1RA6A 3VQ9A 3QIPB 3AVNA 3K5MA 3ZT4A 2CKWA 3TAGA 1XR7A 4FJ9A 4KBIA 4CGDA 3AVMA 1S10A 3MEGB 3GV8B 2Z1IA 3V6KA 4F4YA 3F9KA 3IG1A 3HPHA 4WE1B 3K5NA 1TK0A 3JYTA 4IG3A 2WONB 2ILZA 4IFYB 3TAEA 4BE2A 3MEEB 1S6PB 5HP1A 4KPYA 4QPXA 1DTQB 4B9NA 3AVJA 2C2EA 4AHVA 4O3OA 3NMAA 4CERA 3N6NA 3FQLA 5HRNA 4DQRA 5DQHA 5C25B 5DGBA 1L3TA 4Z4CA 4HVJA 4RW8A 3LP3A 3RR8A 4Z4GA 4FBUA 3PJWA 4CEOA 1ZETA 1TKDA 3BQ1A 4EBEA 2IJNA 3OJSA 4DSEA 1WSIA 4FJ7A 4F8RA 3V4IA 3K59A 4B08A 3FQKA 2D0CA 4FLTA 1NK8A 1JXEA 1JLAA 2HAIA 5HBMA 3P83D 3SV3A 3P5JA 1DTTA 4M3WA 4DLGA 3OL7A 1FKPB 3OYDA 1SUQA 4OLBA 1X9MA 3AVAA 3TR8A 5C24B 3ZSOA 1HMVB 4YFUA 4XPEA 2UVUA 2BE2A 5J1EA 1XC9A 4LSLB 3IRXA 3OVNA 4CFAA 1XI1A 5KFNA 3KHRA 4BWMA 1L5UA 4FLXA 3QESA 3KJVB 3NKYA 3KHHA 2HB5A 3NGZA 1S0MA 4KHQA 2OPQA 3SCXA 5DLGA 4TXSA 4O3SA 4NCGA 1Z4UA 2IDOA 4IDKA 4OKEA 2R8KA 5JS2A 1LW0B 2W8LA 4B9TA 5KT2A 4M3ZA 3DMJB 4HYKA 4FVMA 2V9WA 2AGOA 2O4IA 1ZTTA 3VQ4A 4AHSA 4C8OA 3AO1A 1VK0A 3QGGA 1IKXA 1C1BB 1NJXA 3SZ2A 5L9XA 4O3RA 3THVA 1U4BA 1S1TB 3E51A 2O4GA 3MECB 1NK9A 1NK6A 1VRTB 4DL5A 2X6SA 3HHKA 4CHZA 4CEZA 3OYNA 3V1QA 3N6MA 3RRHA 4LSNB 4ZVFA 4CHNA 3UDLA 3CJ3A 1D9FA 4RW9A 3OHAA 1RAJA 2D41A 1A5VA 1S1TA 4ZP9A 2FVPA 2DFFA 1RT3A 4W5OA 1HQUB 5KFQA 3B6PA 4Q43A 4HKQA 4Z0UA 3OLBA 4ECRA 4K4ZA 3TARA 5F8LA 1RT3B 1O1WA 1EETB 4DSIA 5DG7A 3NGIA 4DTUA 2Z1GA 5F8JA 2LSNA 1ZBHA 4Y2CA 2BQRA 2B6AB 1VSEA 4Y3CA 4CJTA 2UVRA 1VSIA 4WE1A 4IRDA 4E7LA 2GV9A 5KFKA 1KVAA 4DSFA 2FLLA 3EYZA 4E3SA 1IKWB 3S9HA 4UQGA 3L3UA 1S1UB 4RNFA 4NLPA 3HO1A 2G8KA 3PR4A 2FBYA 1KLMB 5HLFB 5F8IA 4JRPA 2X78A 3FFIA 4R8UB 5KFLA 3SUPA 3AVFA 5J2QA 4FXDA 2G8FA 4GW6A 4ZPCA 2R2TA 3QZ7A 2OPPB 2GIRA 1FKOA 4TY9A 5KG5A 3V9WA 5FRMA 3O4NA 3ZSRA 4RW7A 3F73A 4B3OA 1U48A 5C42A 3SFGA 1WNSA 3LP2A 1RCHA 1S1VA 2IC3B 3T1AA 3LWLA 3QEVA 3ASMA 3H5YA 1RA7A 4IKFA 5KGWA 1DLOA 3IS9B 4BACA 4M41A 2XY5A 4B3OB 3I5BA 3I0SA 4ZTFA 2Z1JA 3M9MB 1TKZB 4MKAA 2R7YA 4OL8A 3LZJA 3S3OA 5KT4A 3T5HA 4DS4A 4W5QA 3MXMA 5EDWA 4FJIA 4AHTA 1NK5A 4GMJB 3TAMB 1TL3B 2IC3A 4IQXA 3OYMA 3L2QA 1L3UA 5J1EB 1CLQA 1EP4A 4TLRA 1NK7A 4ZPBA 1T94A 3VN5A 3BJYA 5KG3A 1L3SA 3OYHA 1VRUA 1XHXA 1T05A 2HHUA 1RT4A 5J2MA 2XI3A 1D9DA 4IBNA 4ZVHA 1EXQA 5KFTA 3M8PB 1ITGA 4XO0A 4DG1B 5J2NA 3CDEA 1VSDA 1I6JA 3G6XA 1SV5B 3V6DB 2BRKA 2Z1HA 1YTAA 2I5JB 3HYFA 4F2RA 3AA5X 1LW2A 1K1SA 4DTXA 4KAIA 3PX0A 1BIZA 5FDLA 1JLEA 1WAFA 4NRUA 3L2RA 2D5RA 2UVWA 2YHBA 1RBVA 3LP2B 2XCPA 4CK3A 3DLKA 2OPSA 3PW5A 4CF0A 4CE9A 5CYQA 4F3TA 1RDDA 4JV2A 3VQ7A 4DL2A 3BREA 2I5JA 2FLPA 3CM6A 3AVGA 4IR9A 3IRXB 1S1WB 5KFWA 3RAQA 4F3OA 1VSHA 4DFJA 4M42A 4I2QA 4DG1A 1SH2A 1C0TB 2CJQA 4DU1A 2EX3A 2B6AA 1WSGA 1C0UA 5KFFA 1BQNB 4FLYA 4C8KA 4HHTA 3MFIA 2ILYA 3SQ4A 4YMEA 4KHNA 3SUQA 3G6YA 3MEGA 2OYQA 4CFDA 2AX0A 1FXXA 4O44B 4KE5A 3AVHA 5HROA 1HQEB 1BQMB 3T19A 4NLYA 4RZRA 1FK9A 2HHXA 3PW2A 5I3UA 4K8ZA 3NHGA 4IRCA 2AWZA 3BSCA 2D0AA 2HMIA 1LAWA 4ZP6A 3QERA 1N48A 3AVIA 4HUFA 2IM1A 3QO9A 2F8SA 3MXJA 2RPIA 4E89A 1IKYB 3D28A 3H5SA 4ELTA 3DM2B 2FBTA 3AA2A 2HW3A 2IOCA 4ZHRB 1GOAA 3CM5A 3VQAA 2G8VA 3JYTB 4MQ3A 3M8RA 4DSJA 1A5XA 3OS1A 4J9LA 1WSFA 3EZ5A 3OS2A 5EWGA 2IJFA 1MMLA 4DMNA 4OKKA 1VRTA 4MIAA 2IS3A 4CJFA 3NBPB 3VQCA 1XR6A 2KZZA 3VQ5A 4NLTA 3H4DA 4RG8A 4CFBA 3C6TA 3U3YA 3FDSA 4DU4A 2YNGB 1LWFB 4J2EA 4IFVB 4K4WA 4ICLA 3KIOA 1RTJB 3ZSYA 3BGRA 3RB6A 1RT2A 4R0EA 3AVBA 4NCGB 2WONA 3QYYA 3LP1B 3K5OA 4PUOB 1HPZA 3VQBA 3KD1E 5DQIA 1WLJA 4IG3B 4N47A 4NCBA 2YKNA 2JLEA 4ECYA 4G1QA 3DLGB 1HJRA 4CK1A 4WFXA 2R8JA 3H2LA 4PUOA 1GX5A 3H98A 4CJRA 2GUIA 2GBZA 2WK4A 4EP4A 3K2PA 4FK2A 3T3FA 1QS4A 4ZTJA 1RT5B 1JLAB 4F4KA 3K58A 1LW0A 4MFBA 2KTQA 3I5AA 4KB1A 1QHTA 3PHEA 1NK0A 5CYQB 4KI6A 3TAPA 4WFYA 2DY4A 4TSXA 3LALA 3OHBA 5KFDA 2P5GA 1TVRB 3PY8A 4O0IA 3V9SA 4CJUA 2VG5B 3M9OB 2OPRA 3U3GA 3HM9A 5K14B 5SZTA 1RT6A 2BGGA 4KI4A 2HNYA 4U7CA 3OYBA 5HRRA 3M9NB 4KO0A 4N56A 2V4RA 4CF8A 5DLFA 2BE2B 2Q3SA 3CQ8A 3HXMA 3MECA 2VG5A 3LPUA 3AO2A 4J9PA 3MF5A 2W42A 2XCAA 3O3FA 5L1JA 2ZD1A 4Z4FA 4EO8A 4I2PA 2AJQA 3DLGA 2DTUA 1I39A 4IH7A 4B9UA 1ZYQA 3T5JA 4DTRA 2FBXA 3DLRA 4CGJA 5F9LA 3D0PA 2A1RA 1TAQA 4RUCA 4KRFA 5FRNA 4CHYA 3AV9A 3S3NA 2FVRA 1GOBA 3RTVA 2VWKA 2J6SA 1RDAA 1RILA 2DFEA 3VQDA 4CESA 4FBTA 4GVMA 1BQNA 3U6FA 2BANB 4ED0A 1IKWA 3RBEA 3NH1A 3T5KA 5KFXA 2YKMB 4PWDB 5KT7A 1S9FA 4AILC 2W9CB 2XY7A 2WOMA 4J9MA 3EZUA 2W7OA 3WNEA 4JUZA 4RW9B 4KKOA 4Q0BA 3MR5A 4KO0B 1L3VA 4DTPA 2HNDA 3DOKB 5CZ1A 1NOYA 2O5DA 5CYMA 5KFAA 2AU0A 3NAEA 3KHLA 1TP7A 4GC6A 3HSTB 3O4QA 4QWEA 4OJRA 4TQRA 1UAXA 1BGXT 1KHVA 3BGRB 4IRKA 4AHRA 3V6JA 4JV1A 4FCYA 4K4YA 1JLGA 1BIUA 3KLGB 4DL7A 3ZSZA 2HWIA 2B5JA 4H4OB 4FZYA 3RMBA 3VQEA 4RU9A 4E7KA 4DFPA 1YT3A 2AGPA 1NKEA 3C6UA 4RW6A 3DLHA 4DF8A 3KK2A 4CEQA 3TABA 4J2BA 3SYZA 4DEZA 4KV8B 5D3GB 5DK5A 4DLEA 3HP6A 2C2DA 4CJ4A 1TKTA 1QQCA 3G10A 3EPGA 2ATLA 3KLHB 1S97A 1J5OB 2FBVA 3JSMA
chains in the Genus database with same CATH superfamily
1OQ6A 4CHPA 4MK7A 5C5JA 1IM6A 4DV6K 2GIQA 5GAGP 4ILHA 2XGQA 4KHRA 2ZM6J 4O8UA 4HCBA 1X4CA 2IA0A 3D68A 1I3AA 1JLQB 3D2WA 2FLNA 3O08A 4B9SA 1NHUA 3TTFA 3KD5E 2YNHA 4URQU 3ITHB 4L3NA 1X4EA 1NDCA 3M8QB 3QB0A 4PXBA 4N41A 3ZZTA 4URSA 4GMKA 4LR9A 3NBPA 4H4MB 3VQSA 2MJUA 3PJ9A 4DPTA 3EKUA 2Z4PA 3IFRA 2QEXS 3MXIA 5CCLA 3E2EA 2Z2MA 2XY8A 1JXBA 4OI2A 2V69A 3DOMA 3QATA 2J5AA 4GO7X 1V3RA 2JVOA 4ED1A 3EO3A 2MZRA 5M1NA 4K8RA 2ZFHA 3FUYA 3I56S 3QETA 2EFPA 3RWUA 3DDKA 3JXUA 4DHVA 3OVBA 4AQYK 1IVZA 4ICLB 2WBMA 2XNQA 1ZBTA 5F8NA 1VIXA 1WWHA 1IBKJ 4QS9A 1OO0B 2QL5B 1WNEA 5DMRA 2V34A 4OGCA 4ZVGA 4EP5A 3K0SA 3KNGA 3NNHA 3K8WA 2HVDA 3C7NA 3BGOP 4MKYA 5DM7Q 4L8RB 1ASVA 3SMSA 4KSEB 1S7HA 4IOAL 5BPNA 2P9EA 5KFIA 2W01A 1GEHA 3RGIA 2VQFF 1Z2LA 1QAJA 3OXFA 4LQ3A 1J53A 4QCLA 1PC5A 5KFZA 1ZZFA 5HVHA 2ZJQL 1XWLA 1EQYA 4L73A 4J9RA 1WC6A 2R4FA 3HPOA 2I38A 2M8HA 3OW2R 1MWMA 2NPFA 3SCKE 4WYWA 1ASUA 1QTMA 1UWAA 4YY3F 3MR6A 2HQGA 4CEAA 4FW2A 4BROA 3KLHA 4O4RA 1KQKA 5LY3A 3G4SS 5C2GA 3CG7A 4A8FA 2FSJA 5I9EB 2FVSA 4CFCA 1F2HA 3JSYA 4NXNJ 3ID6A 1FE4A 4MT1A 4O5FA 4A47A 1YJNN 4W92B 3OYIA 4KGZB 4JI7K 1ZA2B 3GG0A 2K7JA 1K47A 3KHYA 3CFRA 1N32K 3UR3C 4K8XA 4C2MA 1WF2A 2RAQA 3DLEA 4MJKA 3MHYA 3CFOA 1VSFA 3V9XA 3SPZA 3HSJA 3JQKA 1FJGJ 3UDEA 3ZT3A 2BMBA 1RWVB 2ALZA 3D0IE 3CCVS 3OD2A 3FBEA 2O8CA 4QWDA 1S6OA 2ZF5O 2R8GA 3AODA 1Y5NB 1S1WA 1LEOA 4P10A 2QV6A 1Y4ZB 1JJ2M 2H54B 4FO0A 1HNVB 2EPIA 4Y65A 4HTLA 3OA9A 1GMWA 1VQLS 2CGLA 4YDUC 4D3HA 3VGTA 4DUYF 1R0AA 3PKMA 4UQTA 3GU0A 4XAKA 1RWXB 2NSCA 3B8AX 3LAMA 4ED6A 4KGXB 3UPFA 2XQCA 3FCWA 4WZMA 4Y1DA 1PJ6A 2WBNA 1U1PA 3VF2A 3KKSA 5AQQA 4TNOA 3R8YA 4Y0FA 2RS2A 2R2SA 3FSXA 5CE3A 1WF1A 4LF4J 1FKPA 2C3PA 3G6EN 2M2BA 1JJ2R 4Q45A 5ADXA 1F6TA 2J7UA 1LWEB 4OKJA 4CT8A 3OYGA 2QA4N 1FJGF 4BR7A 2IAJB 3NGRA 2RJZA 1VSKA 1Q81T 4TY8B 1EAYC 2W2OP 1SJFA 1RBRA 3PNIA 1YJUA 2X51A 1NB7A 2CQGA 3R1HA 5HSPA 1RTHB 4ED3A 5LT5A 2P51A 3HJVA 2KO1A 4DV2F 3IG1B 4WCEQ 1HKBA 2F8HA 3NH0A 3C94A 1BI4B 3O2IA 4F4ZA 5A6PA 4PAAA 1UCNA 2Z2ZA 1FKOB 3GBTA 4JOUA 2YWKA 1BI4A 4RW4B 3N6LA 2FC8A 1DJ0A 3MMCB 4NLOA 2DY9A 3L0QA 4CI0B 3V9ZA 2PZSA 3OJUA 1JLBA 2E20A 4N77A 4KRWA 4MKVA 4WFZA 1UJ4A 4JI6J 3U1NA 3OV7A 4N76A 2OPRB 3DXMB 5AQPA 1T8EA 4A2BA 2AYEA 2ADCA 3OW2M 1NJYA 5JS1A 3G0ZA 3GWCA 2P9GA 1R8HA 1FK9B 1K0VA 4BC4A 3VEWA 1VGYA 2LQ5A 4Y2KA 2MKKA 2P9IA 2DR7A 5GINA 1RT5A 2X7IA 2DR6A 1RWPB 2ZKTA 4LFAJ 1KR4A 4W5RA 1B0PA 5D3GA 4LH5A 4NE9C 2KXNB 1MLAA 3FC9A 5EWEA 1BG3A 4WYLA 3EXYA 1IKXB 3Q8UA 2UUBJ 1G1XA 3N9UC 5AJ3F 4JI5F 3DLLQ 3I82A 1TMJA 3KFWX 4H4KA 4FJXA 4NI2B 3WT0A 5GADI 3NF7A 1S9EA 1DQAA 3VETA 2W7AA 3AA8A 4WTOB 3CCMS 2LVWA 5BPMA 2IGIA 2V7YA 2VICA 4P52A 4FK4A 4BRCA 3MX5A 3QBXA 5ELZA 2DGXA 2LQJA 2ZM6K 4FKYA 2G8UA 3RR7A 3KKFA 1QQNA 2OGUA 1UJ6A 3AAPA 4DV1J 2NQPA 1X5SA 3MM7A 1W25A 2PO4A 1P90A 1UVNA 1NOZA 1UA0A 4CCHA 2HMIB 2CIMA 3UE2A 3VVUA 2G8IA 4CZCA 3RMAA 2ASPA 1LV5A 4OHYA 4M3TA 4JS5A 4K7QA 3CYMA 4B9QA 3VAIA 1FJ7A 2ZM6F 3CSKA 3TPQA 5HRSA 3DRPA 4LF9F 2VDIA 3QINA 4I6MA 5AQVA 4OX7A 2VA3A 2B51A 2Z56B 4QQBA 2W41A 2ITMA 4FJNA 1DZ5A 4YR2A 3MM8A 1YGYA 2LMIA 2GC8A 3QJLA 1IO2A 4GY2B 4I1TA 3MZIA 3S3MA 2C2RA 1TK8A 1WAJA 3N5FA 4RW7B 3L95X 1K8AO 2RDJA 2RS8A 3D0HE 2E5HA 3NMRA 5MLCV 4LSLA 2DNOA 1N33F 3MN5A 5D0HA 4ELUA 1B7FA 3BZCA 5IT9U 2QLWA 1BO5O 1RHRB 2ASLA 1SIWB 1N5VA 1YZ7A 4FNHA 2DGVA 3G25A 4DL3A 4A8SA 1EQ0A 3CTRA 3P4IA 3D7EO 3NH2A 2HS3A 4W5NA 2E5JA 2YNFB 3VAKA 2BJ7A 1GFWB 5F3TA 2IM3A 3W2WA 1C0TA 1R0BG 1H7WA 3LM9A 1LWFA 3Q86A 4I7FA 1C6VA 3H45C 4AHUA 1LNQA 2B9XA 4FJLA 4KGMA 1REVB 1JCGA 1PBAA 2E4LA 2LU2A 3D1OA 4HUGA 4ZMMA 1KDNA 2ZNYA 3BZKA 1MN7A 2ZZTA 5CAAA 5KRTA 1Y97A 2GVDB 3BF4A 5JVGQ 1HYSA 4I0WA 3TEGA 3DRSB 4JI1F 1V5IB 3VEZA 2KXFA 3VVTA 1GLFO 2L3MA 3QIDA 3KOAA 3T1HF 1O5JA 2M52A 2XSJA 2W8KA 1K1QA 1GLLO 1CG2A 4OV6A 2OUGA 2P8IA 4NEYA 3FZLA 2NXEA 5L1KA 3I0SB 2ZZNA 2N3OA 2RQ4A 2IM0A 1NSPA 2AP1A 1RB0A 4ZVPB 5F8GA 3DXKB 3EL2A 2BJ3A 3MCNA 3WXKA 4I7FB 2F96A 2Z2LA 2ZOMA 5DDRC 4ECQA 2RKIA 2M7SA 4RR5A 5TKWA 4ZIWA 2N82B 2GJFA 5H9EK 5AQKA 3VQ8A 2J7KA 2GWJA 4RX6A 3EN9A 3THTA 4ID5B 2XI2A 4C3LA 4IR1A 1SKSA 1RLCL 1HNXK 3DRSA 2R2RA 3F44A 1YRXA 1N88A 1ZM4A 2WUSA 2HURA 1B9FA 4KAZA 3RBDA 1VSLA 2LDYA 2HHTA 5AE3A 1UEVA 4FS2A 2QRRA 4LMZA 1VBKA 2CPYA 3HP9A 3DYAB 4PQAA 1REVA 5CZVA 1NBWA 2ETJA 2DB1A 4E98A 2DH7A 4C8MA 4DB3A 4DF4A 1Q4RA 1WG4A 1MSWD 5D4PA 3HSCA 2VQFJ 4C8NA 5ETNA 1F3VA 1OVQA 4FPBA 4M3UA 5F8MA 2CPFA 2CRLA 4CLFA 1WI6A 2DEJA 2OEJA 7AT1B 3ENVA 3MGJA 5KT5A 1MDUB 3HULA 2YNIB 3D67A 2BJ1A 3CCVN 3BSNA 3AQPA 3GV7B 3SUOA 2ASJA 5U47A 4HTIA 3OSNA 1T02A 2FY1A 1M5KC 5FPNA 4CHOA 2E5LJ 4USJC 4B1WB 2Q0RA 1RKJA 3Q89A 1PJ7A 3WHIA 3BGLA 5A2QO 4B9MA 4JRQA 1Q5YA 4JKGA 4RNMA 2VG7A 4ID1A 3TANA 1NB2A 1OH6A 5FDLB 2UV8G 2JEFA 3MEEA 1OY9A 3MEDA 2BW2A 1VC0A 5KFJA 2VBZA 1BD6A 2C1EB 3VENA 1RT6B 2ALYB 2R7UA 3KK1A 2IIRA 1TL3A 2YHWA 4I2QB 3MM5B 4PR6A 3NFAA 3QGHA 5J1PA 2OI2A 1RTDB 1H74A 5AZJB 6AT1B 4LFCF 5HL7Q 4YR0A 2UUAK 4CF9A 1S1VB 1HBOA 3E01B 4YDUA 1VS3A 1LOUA 1HW8A 3IUCA 4LC9B 1U47A 4QIFA 1UFLA 1JKHA 1EARA 3JB9k 3AVCA 2HHPA 5KG2A 1VQ9N 1UZDA 1GH8A 1RTDA 4B3TK 4RW8B 2JWNA 2C2MB 2GNKA 3J7A1 2BQUA 3CF5L 2PYLA 3GIIA 1WF0A 4Z4IA 3DLJA 2P9NA 3UO0A 4CEDA 2BUPA 4HWIA 2JC0A 2Q6BA 3CDBA 5EVZA 2W4PA 2VONA 3QMLA 3RU0A 4XH5A 5IWAJ 2YKAA 1SL1A 2RQCA 1C1BA 2QC3A 1SC3B 3M30A 3SI8A 3SSSA 3EGNA 3KLVA 1KQSR 2FHMA 3IFEA 2DCUB 1NGDA 1IG9A 4WF9L 3C3LA 3QRQA 1RU1A 4X66F 4DV3J 1GOCA 3CC7S 4ELVA 1P8ZA 3IS9A 2I9SA 3ZZUA 5L39A 3BO3A 1FNOA 1OQ3A 5T7BA 3W65A 3CCSS 1VK3A 1Q86O 2VIHA 5A8KB 3D1HA 4BC7A 4DR7F 2E6MA 1BMQB 3S6EA 3L8BA 1HNIB 2F8MA 3FEXB 2UXCF 1QE1A 2DKOB 1NKCA 1RK8A 4LFCK 1B4SA 3W62A 3G6VA 4IWVA 3ALYA 4BWJA 4NX9A 1VRUB 2JWKA 1AW0A 1QE1B 3VALA 1CZ9A 3EVWA 2KKZA 4DTNA 3QGIA 2IA6A 1O6XA 2GZOA 3SFUA 5E3CA 3V81A 1FT8A 4A2AA 3Q8SB 2EWHA 1WC3A 4DR3J 3W7BA 2OCEA 5HK4A 2VWJA 1U1LA 2KB2A 2H5EA 5B0BA 3C65A 3RAXA 4NZ0A 4DR2J 4B3SK 1YIJS 2MGZA 4BRHA 1HQEA 5CZ2A 3CCLS 4NXNF 4K4XA 5LMUK 2PY5A 2JGUA 3RUBL 1NPRA 1SH3A 5K5MA 1XIQA 2V4QA 4X64K 2VD3A 1NJIT 2BH1A 4E8UA 3IAYA 3D66A 4C1NI 3OHRA 1UFKA 4Z7CA 3RJMB 1RZMA 3ULDA 4O3PA 1MNEA 4CD3A 2WHOA 1E4FT 2CJBA 1NNEA 3J80O 2Y1LB 4Q7AA 4ZHRA 4ECVA 1DGKN 4MO4A 2VZ9A 2XO7A 2JHEA 4JI3F 1OWXA 3HT0A 4OJ1A 3HSDA 1M1KO 1QUVA 2V7ZA 3EGWB 3DLKB 1U0HA 3DN9A 4U9RA 2BANA 4RTFD 4KHSA 1VDHA 5A8WA 2DNMA 2QLXA 4GNIA 2B9WA 5DETA 1PSDA 3JQJA 5BYQA 5BN8A 1LXJA 2PSZA 1TKXB 3MMAB 2GCFA 5DZ7A 2B4PA 3H46O 1GQEA 3K5MA 1J2VA 2BJ8A 2ZWHA 4FJ9A 1IWAA 2AHOB 2GEMA 4CGDA 1S10A 1U8SA 4CJ7A 2MKIA 4LF4F 1H73A 4WFAQ 5AFUH 4OYOA 3SQGB 2K1RB 1R6VA 1FF2A 2D0OA 5LXYA 4BE2A 1S6PB 4LF8K 4QPXA 4B9NA 4AHVA 3NMAA 3FQLA 1U26A 4ZCLA 5HRNA 3A5OC 2ZUAA 5BJRA 1GTEA 1VCTA 5DGBA 2KT2A 1WDDA 2FZCB 1N8RT 5BPLA 2GVZA 4FBUA 3PIPL 2XEXA 4LJMA 3KG0A 4CEOA 3CETA 1TKDA 5D78A 3BQ1A 5I4MA 4RU2A 4ZJOA 3OJSA 3GJSB 1YRTA 1VQPN 2CQBA 1SC6A 2EVZA 3AY9A 1SXLA 5HBMA 1HI1A 2ROGA 2J9EA 3P5JA 4M3WA 1U24A 4DLGA 3D3BJ 2V8PA 1TU0B 3OYDA 4OLBA 3GIRA 5E2QA 3AVAA 3TR8A 5AZJA 3C66A 3VWSA 1SC1B 4YFUA 1FWPA 5LMUF 2ROEA 4X4UA 1NU0A 3W63A 1RWKB 4LSLB 1JB0C 3OVNA 4CFAA 1XI1A 2KRBA 4X4RA 3IAS9 1XNRJ 4NPOA 1O13A 3KHHA 2O8DA 4FYWB 3F41A 2GIFA 4CQ1A 4LF8J 2HB5A 1S0MA 1D09B 4X65J 5FLXY 2CQ3A 5DLGA 1V3SA 3HTVA 3SCXA 1Z4UA 4DU8A 3J80Y 5HMWA 2R8KA 3MMJA 5CD4H 3UN2A 2CQCA 1R8PA 1U0HB 1ZPWX 2VC0A 3ILLA 4WIQA 1HX1A 2HFVA 4BC3A 1X0FA 2O4IA 1ZTTA 2BA9A 4AHSA 4WFBQ 4C8OA 3M05A 3QGGA 4XH1A 3US5A 4FF4A 3UCGA 1HQ2A 4A59A 3THVA 1U4BA 1S1TB 3E51A 4DV1F 2XO6A 4OMFG 3MECB 3I55S 4CHZA 3HHKA 1TELA 2YVSA 4S0MA 2QA4S 3I33A 3H20A 2RIJA 5LL6d 3BY5A 2V8DA 4LSNB 4ZVFA 3IC1A 4DR4K 2V4JB 4BRNA 1ICEB 2D41A 1G6BA 1GLDG 1S57A 4CLZA 1QD1A 1FFSB 1RWWB 1U1OA 3JTNA 3OLBA 3TARA 1FD8A 1YZ6A 3OBYA 4JHDA 4GKJJ 1O1WA 3CMEN 1TL5A 4WU2A 2HRTA 1F9HA 4LVNP 5F8JA 1ZBHA 4UUXA 2BQRA 1S6UA 1VSIA 4WPAA 4IRDA 3H2UB 2R7XA 3FBFA 2Q3PA 2CQHA 4WYBA 1IKWB 3S9HA 3VHQA 1WSRA 5D4LA 3L3UA 2PC6A 3HO1A 1VQ5S 2G1DA 3KJFB 2MQLA 3SUPA 3GZ7A 2DD8S 3OUYB 3HHLA 4DV7J 4LF6J 3ATUA 3H3OB 3B4MA 1FE0A 4TY9A 3IR7B 3D2FB 1HKCA 1Q79A 3F73A 3LWLA 3C14B 2JX2A 4TU7A 3VGUA 1RA7A 3M2UA 3KDOA 3PIOL 3IS9B 3UD3P 4BACA 4ZTFA 3VERA 3M9MB 1TKZB 4MKAA 1X3NA 1MWKA 1N33J 1R8BA 2C3OA 4OL8A 2V52B 3T5HA 1CULB 3MXMA 4AHTA 1XMQF 4GMJB 1W26A 2OANA 4MDBA 3VGKA 1UTAA 3K8VA 3EE8A 4TLRA 1ACMB 4ISEA 3OYHA 3J81Y 1XHXA 3DHWC 2QWRA 1D9DA 2DHAA 5DDOC 1N54B 2XMKA 3HHEA 1SAZA 5D4OA 4DG1B 5J2NA 3UB5A 2KH9A 4JBCA 1SV5B 4ZA1A 1LW2A 2ZWOA 3AA5X 4ZS6A 1N36K 3QFUA 4P7TA 3MDFA 2N7CA 5BRDA 2MZ1A 5KOWA 2OPSA 3PW5A 1J5EF 4CE9A 1RDDA 5HMXA 4B17A 4L3QA 4KT0C 3A8IA 3CCRS 4H4KC 4B02A 2VBXA 2I5JA 1WC4A 4IR9A 1S1WB 1UL3A 4GVBB 1MG7A 1VSHA 2HYIB 4I2QA 3MM5A 1JQGA 1C0TB 4LRFA 3UD5A 2GUPA 1IR1A 5M1PA 4A57A 1C0UA 1BQNB 4C8KA 1UPPA 2EWSA 3MFIA 4HHTA 1R31A 3SQ4A 1VHFA 4KHNA 1MWZA 3G6YA 3MEGA 2OYQA 1HI0P 1T9YA 4DV2K 1U1QA 3QRPA 1BQMB 5RUBA 3H1QA 3QDKA 4NLYA 5AQYA 2HHXA 1VQ4S 4WK1A 3DXSX 4IRCA 2KJWA 2CPZA 2HMIA 4ZP6A 4JB8B 4HH0A 3PACA 2F5GA 3MM6A 2AJ0A 4YHHK 2F8SA 1IBLF 1YBTA 1IKYB 4FNIA 1JK9B 3H5SA 3HD1A 4BQZA 2FBTA 3AA2A 2HW3A 1CQNA 1GOAA 2BZ2A 4DR6K 5HL7L 3JYTB 4PL8A 1AT1B 2H1YA 3AB2B 3D6TB 2BUNA 2NRZA 3OS1A 3GONA 4Y28C 4OX9F 4CT9A 2AYBA 3GYGA 2D3OR 1VQMS 1EWQA 3VQTA 1IJEB 2RB7A 4GKKK 3T41A 1VRTA 4MIAA 3PRDA 3W1YC 4MLEA 3C7NB 2FQQB 3NBPB 3VQCA 1MMNA 1Q5VA 2YHXA 4C0HA 3HKZD 3UNGC 2QFIA 2CQ0A 3A5NC 3U3YA 1GAOA 3FDSA 2YNGB 4J2EA 4IFVB 4OJGA 1NAQA 4K4WA 4ICLA 2CNLB 3NGSA 2IPOB 1RT2A 2ACYA 1X31C 1W7AA 1HBNB 4N7TA 2VFTA 4N47A 4NCBA 2YKNA 2XZWA 3DLGB 2EKNA 2J4RA 2RH3A 4CK1A 2R8JA 1UP1A 2G9OA 3PM9A 2GS8A 4LRCA 2HRUA 3H2LA 4TLQA 3ILIA 2I2YA 3H98A 2MQQA 2V63A 2GBZA 5HANA 2VFRA 3VMFB 4EP4A 1IQZA 3T3FA 2EG1A 2V9KA 1HL6A 2HF4A 4F4KA 2LQ9A 1WOSA 1LW0A 4MFBA 1N0UA 3MURP 4KB1A 1PILA 4CTAA 1NK0A 2PFUA 3W9HA 4DV0J 3LALA 2DGUA 3VF4A 3U02A 2VG5B 2QA1A 3U3GA 2RILA 4JI7F 4U95A 5K14B 2CDRB 2KDOA 1X5OA 2Q36A 2AEFA 4DUYJ 2R7RA 4KH5A 3M9NB 4KO0A 4HACB 4OJ3A 3FJ2A 1NH7A 1RGIA 1RAFB 2DGTA 4DOZA 4YOWA 2CJAA 4BHQA 2W42A 4CH0S 3ULEB 3TSPA 5IS2A 3CJBA 4FP9A 1I39A 1FX4A 4B9UA 4FDFA 2H9ZA 4DTRA 4OYZA 3UKRB 1N8RO 4RCHA 2FLOA 1Q18A 3D0PA 1TAQA 1GXUA 3MWPA 4BRLA 2DISA 1GOBA 2KKHA 2MGZB 1T6DA 1YJTA 2VWKA 5T41A 1RISA 4CESA 3GCWP 4FBTA 5CD4A 3C14A 3U6FA 5IZHA 1IKWA 3MPVA 3MCSA 1KS2A 4JI0K 2ZVIA 2MB0B 2ZITA 2WOMA 4J9MA 4DCPB 1SVDA 1SJ3P 4JUZA 4Q0BA 2QWLA 2XS7A 4CZLA 1Y7PA 5FJ4A 4DUYK 4KO0B 5DDPC 4PABA 2HNDA 3DOKB 3P45B 5KFAA 4YOXA 4ISGA 3CCRN 4CLPA 1EWRA 2N7YA 3BGRB 2UXBJ 1M90O 2HSEB 4JV1A 2XS5A 4K4YA 4FOIA 4DL7A 4HTJA 4H4OB 3VQEA 4UT4A 2O1PA 3IA0A 2BACA 2LA4A 1YT3A 3THXB 1DARA 3KWIA 3TABA 4KV8B 4DLEA 1OYEA 4ILGB 2V4JA 3I6PA 1TKTA 2G0CA 2ATLA 1K73O 4UOCA 3TOQA 3KLHB 1J5OB 1H38A 4JI0J 4FJKA 2B8QA 3RMCA 4FJHA 2MLYA 4J9KA 4K41A 1OY8A 2XWYA 4DQIA 1VQ4N 3TVKA 1Q81O 4M94A 2FXUA 3CCSN 1HKAA 5EX3A 3AFGA 2ZQBA 4G1IA 4O44A 4FXVA 1U2VB 3A8KA 4JS4A 1UWBB 2Q1NA 5B08A 1KHWA 4NMXA 4B9VA 1KD1T 3I9V9 1N36J 3H2VE 1C1CA 4C8LA 5HATA 2KFNA 3SQGA 3E8OA 3PFEA 3KLFB 1HBMB 5J2MB 5HO4A 3DRPB 3KWGA 4I56A 2GFFA 1Y3KA 2QSWA 3FRYA 2Q79A 2Y9HA 3ISZA 1SQEA 4AQYJ 4W5TA 2QA2A 3ZNUA 2WB1D 1DQ9A 3KK2B 5C24A 3OXGA 1VQ7N 4H8KA 4USVA 5E0OA 3UVJA 3ZSWA 4BGAA 1RDRA 4QIGA 4KHPF 1JLCB 2D9OA 2ITGA 1S5JA 2AX1A 3WQUA 2F8TA 1T44A 3SJHA 3AO5A 4BR5A 5DZ6A 4GV9A 2RDDA 3CCJS 1NJWA 3TQ1A 1FRJA 2FJXA 1S0VA 4AL5A 5HBMB 1T9WA 2KVQE 9ATCB 1FRHA 5JLFA 2QWOA 2VH7A 1BQMA 1U1NA 2B4JA 1Y5IB 4CF1A 4FZZA 3QBCA 3OVAA 4V19X 1Q7YT 1NSKL 3J7Z5 4QIEA 5G0RB 4E19A 5D8HB 4P7VA 4YDXA 3MCOA 2B9YA 3B54A 3K57A 4M5GA 2DHHA 2ATQA 2X3DA 4LT6A 4CM0A 4QZVB 4JI5J 4DPUA 4E1MA 5ETVA 4CLYA 2W9BA 2RD5C 5A8WB 3I8DA 3QPIA 2HHWA 1QLNA 1X4AA 5J1NA 1YITS 4H0PA 3R27A 2J6UA 5GAEP 2XMUA 5A0YA 3PZPA 3CDUA 1JLFB 3M1VA 5EU7A 4A61A 5DG9A 3KK3A 3C6TB 1R8AA 2MZQA 4ECSA 2DHXA 5AQZA 3DJCA 1SJ1A 1CXUA 3NE6A 3M8QA 4WQ4A 4OVLA 2NLXA 1IBKF 2HNDB 2HIYA 3V6HA 1XQSC 3Q83A 3VQPA 4M7YA 3TVZA 3MD3A 3ZFVA 2ZNZA 3JAMU 1RFQA 3PYGA 3BKUA 3NGKA 4NA2A 3AY0A 1HHSA 1PG5B 4A8XA 2EKYA 2VBWA 2AJ4A 2JJ4D 2F9WA 1DTTB 5L1LA 5L1IA 3THYB 5HMZA 5F9NA 4KKOB 1U1RA 1RBAA 3QIOA 1ZBLA 4OX6A 4EIAA 1YX2A 3AAWB 4JHDB 1A6LA 2E6LA 4AF1A 3FLCO 3HVWA 1XMOK 3KLIB 2BV3A 2LLZA 2E88A 5BYSA 1U02A 2DXDA 2YQ1A 3M2VB 4JI6F 4CJPA 4FM2A 2HVIA 3MTKA 4QS7A 3GTYX 1MN9A 3GLJA 2IRXA 4TU9A 3TAMA 4RBTA 1C2PA 1IUJA 1AUDA 4QWBA 3M6GA 4JI2F 1Q9XA 3W8GA 3TR5A 2YKPA 4PZVA 3CIZA 3ZZZA 3AD8C 5KFRA 2GMJA 2NCKL 1MU2B 2KI2A 3C46A 4CH1A 3NG8A 2LQ8A 1VR6A 3EZOA 3EY1A 1EB0A 3E9OA 1BL3A 5IT9O 3M30B 4N5SA 2POKA 4HT7A 4U7UD 3HMJG 5C42B 2UXDK 4BQLA 3LAKA 4LD0A 4R5PA 1S72S 1TYQA 3B6BA 1JLFA 3M1VB 1IM4A 1KLMA 4HUEA 5LJWA 1M1HA 4MIBA 2PA8D 4BG9A 3W2VA 1SQKA 4EZ9A 3WXIA 1E4GT 2YKOA 2HNYB 5I42A 4PG8A 3GIMA 2ASMA 1I1GA 4OPKA 3MEKA 3O9SA 8AT1B 3AT1B 4UTGA 4GC7A 2VJVA 3GV5B 2HHVA 3DM2A 4H5TA 2GV1A 4YB1P 1UWBA 3QAEA 3AAQA 1KSPA 3R2CJ 4AL6A 4Q5VA 5GMEA 4IFVA 1X5TA 1F0XA 3QLHA 2BM1A 4LFAK 3M3ZA 3D6MB 5F0UA 3G71N 2Q97A 3JSBA 4H03B 4QPTA 1HR0K 4BC2A 2YBVA 4CF2A 1FI4A 4O3QA 1N5YB 3DRRA 1JNRB 2UXBF 4UY85 3LDQA 5EUHA 2AEMA 4HDGA 4DL6A 1NKBA 2OPPA 4YB5A 4X4NA 3NMUA 5KFSA 4FLVA 3O6QA 2D0BA 1OSCA 2MKJA 1YTYA 4NYFA 3SQ1A 2PN6A 4ZPAA 1RBTA 4Y34A 2AGQA 4HI2A 2ASDA 3EDQB 3ISNC 3PSIA 3NGDA 5AE2A 2YXLA 1HPZB 1OH7A 1WORA 1TAUA 1S1XB 5FPMA 3SCLE 4Y0WA 2GWKA 1XMBA 2AZ1A 3CXCR 5H1SQ 1Y11A 3LM2A 2OO4A 1P9YA 1HUXA 3OPKA 2ZBPA 5A2QY 2AIRB 2A10A 1N5TA 1KRPA 4PY5A 4FJ8A 5GADP 3ITHA 4UOFA 3OYJA 3QLHB 1FA0A 2ZEJA 3A3PB 3BO2A 4BE0A 1KAZA 3U7JA 2P2CB 2P1JA 2C2KB 4FYVB 4EGLA 3ZSVA 4CK2A 4Y00A 2WRMA 3MN6A 4MKBA 2HFNA 3O9UA 5HJXA 2A42A 3A5MC 4DTMA 1FRKA 3J7YU 4LF1A 3H08A 2HGMA 3OL6A 5A2QU 4ECXA 1WELA 1WOQA 2FHJD 3EVMA 1LFPA 5GAHU 1JJCB 3SLCA 5DM6L 1OH8A 3RSEA 1UA1A 2FY8A 3R9PA 3BS9A 4PG7A 3Q8YA 4NLVA 2DYAA 1MMDA 5KG4A 4JP8A 2GELA 3P6YC 3DMJA 5FD1A 4H54A 1OPZA 2IRYA 1RADB 4AXJA 4MK8A 3OVSA 2ZH5A 2R2UA 4PKIA 2E7VA 1YVUA 2AA4A 4MDAA 1DTQA 5SWMA 4K50A 5GVQA 4FN5A 3TWHA 4OZ3A 1JIHA 2XS2A 4OIXA 3C16A 2CH5A 4YR3A 2R7TA 1UZHA 1WKJA 2XLJA 3H42A 4O4GB 4FF3A 3JAMY 1OJ4A 1Q82T 4ZPDA 3M8SA 2YKMA 1BCOA 5AQGA 4EBCA 4CO5A 3P5TL 4CZHA 1HMVA 3BKTA 2XZTB 2NXJA 4FK0A 1A5WA 1B0TA 2GVDA 3M1FA 2FC0A 2CPDA 5K14A 2EC0A 5FLXO 1S72N 4TQSA 2ZOFA 3ZO7A 2R8HA 2FYXA 1T03A 4DV5K 3G8SA 3CPWM 3DDIA 3OYLA 2ZUGA 1RBOB 1X9WA 3ATVA 1YBAA 3QFPA 4FJMA 3NXZA 4MK9A 1JL2A 4ZVEA 4P75A 5AQSA 3UVJB 4Y1CA 1WSJA 3N01A 3DHXA 4JYAK 4FS1A 3UQSA 3P3DA 3AA3A 2O01C 4NYPA 4CJWA 1RE1B 3K5PA 1H3DA 3QFHA 2YPZA 3B8HA 1VQOS 3QO9B 1UMJA 2DRAA 2AJFE 5HVGA 3LPYA 4M5KA 3ZTQA 1IBLJ 3JAMO 1RT2B 4RUBA 4FXWA 1XHZA 3ZTRA 1YLXA 1ZOTA 1B9DA 2NXNA 1Y10A 3NS6A 4JI7J 2JFDA 3ADAC 3K17A 5LXRA 4I6YA 2R7SA 2HG4A 1Q95G 4RJVA 1Q7YO 1T05B 1ZPVA 2WTFA 3TJAA 4IFYA 2VASA 1Q53A 3SXLA 1IKYA 2W2MP 1RYRA 1LAVA 1IR0A 1CJKA 1EKSA 4G6VB 4ZVQB 1TL1A 3CJSA 3P31A 2GJ2A 1RGVA 2XGPA 2OPQB 2KU7A 5KG1A 3OYKA 1TVRA 3D2EB 4A5BA 3TUJC 2HHHK 1F60B 3R3LA 4IG0A 1T7PA 4FWLA 4JV5F 2XY6A 2ZD1B 3WEEA 1G7CB 2MMYA 3KMQA 3TU5A 2DR5A 4HL9A 1SL2A 3KK1B 4Z4EA 5C2DA 1ZAXA 3LDOA 3Q0AA 2HF3A 3FZKA 1J9AA 1SKRA 4R0JA 4KV8A 3ENQA 3MMVA 5KFYA 3CPWR 1REGX 2V2VA 4KB0A 3W2VB 2JDJA 3WC2A 1XEZA 3GJQB 3A8YA 4YOEA 3GFZA 1LK7A 1F3FA 3F56A 3PW7A 1KC8T 2JVRA 3LGNA 3MM9A 1BHLA 2AD9A 4M5LA 1WG5A 3UN5A 3NGYA 3TSQA 2JRSA 2P9UB 4ANCA 1FWKA 3MM6B 4CIFA 3V5RA 4NA3A 1H0HB 1XR5A 1CC8A 2BR0A 4XH4A 4NXMK 2KT3A 2I7NA 4JV5J 3GFXA 2A3JA 3CIMA 4HCCA 4DL4A 1B70B 4ECUA 2YCHA 4KH4A 4PXDA 5M2UA 3N5BA 4CH7A 2PBDA 2K2PA 3IR6B 2AT1B 2J76E 1SH0A 1VOMA 2YKQA 3D5MA 1KTQA 1L3KA 1OPIA 3MUVP 3BR9A 2HWTA 2RSQA 2W2PP 4IOCL 3KDNA 4KHWA 3T5LA 4QWAA 3EE9A 4E0DA 1VSMA 4B3TJ 4QWCA 2RQMA 2H3EB 1RSCA 4CP5A 1LWEA 1KVBA 4U6PA 1RHQB 2IFXA 5D0EA 1YI2N 6FD1A 3CJ9A 4FWKA 1BLUA 4DN0A 2Q6CA 5IWAK 5EN1A 3DRYA 1CPZA 2W9AA 4QS8A 2MLZA 1MROA 3OUYA 3PDNA 3VV2B 3PW4A 2CPEA 2HBRB 5IT0A 2V94A 1WB9A 1I94J 2YX7A 3B78A 2B5JB 1RQ0A 4WBFA 3OBWA 1D1UA 4DFMA 4XTTA 2XLKA 1U6BA 2PA3A 3NY0A 3M5RA 2QA4G 2FPHX 4RW6B 4DX5A 2OFGX 1DLOB 4RLEA 3HM8A 4CJKA 4LH4A 3VAGA 3O3GA 2HVHA 4CJSA 3JSMB 3BQ2A 1DAXA 4TU8A 2O8BB 1FW6A 2E1YA 3AD7C 1QVGR 2DFHA 1S79A 2HBMA 1N5QA 3OL8A 4X4VA 2PMWA 3HOTA 1UPMB 2W7PA 4DPWA 1RDUA 4CD1A 1BWEA 2ASOA 1Z25A 1Q82O 1HYSB 1NDKA 3CDWA 4DV5F 1KXPA 4HHHA 4KBOA 2NSBA 4C8ZA 4RNHA 1WEYA 3C0BA 3QEXA 1V6HA 2GQQA 2FVQA 2M8DB 2OH2A 1BOTO 4CW7B 1NNDA 2P6SA 3NWRA 2QG9B 3T1YJ 2J8AA 5KQ8A 2UUTA 5K9FA 1IKVB 3G71S 1VC5A 1BISA 2J8SA 5LMNF 2UUCJ 2QYCA 4E2FB 2A1SA 1HFEL 4DTOA 1TUWA 4OYBA 3HRGA 4DR7J 2JOQA 3R5AA 4J9UE 2IBOA 3KTQA 1RAAB 1S1XA 4N8OA 4DX8H 2QE5A 5DG8A 3HVTB 4MIWA 4DTJA 1U09A 4LQ9A 3LOUA 2CQ1A 4DV6F 4H5WA 4FPIA 1XC3A 4YDDB 2EI5A 5AFUA 3THWA 4C0BA 3J7AP 1IJJA 1JCEA 2QYGA 4HHJA 4V19S 4NRTA 3CNQP 1FX2A 4ZDNA 4B3RF 3MR2A 1CJTB 2V2QA 2DXFA 4J5OA 4AFFA 3QIPB 1RCXB 3ZT4A 3T1YK 3VOVA 1IBLK 3TAGA 1B99A 1NM1A 4IO9Q 3MEGB 3EWGA 2DEIA 2M4MA 4FPRA 4DXLA 2HZCA 3CJ7A 1RTZA 3LUYA 1HNZJ 4ZITA 4K25A 3K5NA 3N28A 2YX4A 3JYTA 2ILZA 2WONB 4IFYB 1YXQA 2A6OA 3MEEB 2FGCA 3Q23A 3MPWA 5KQDA 1QAYA 3EMTA 3QT5A 8RUCA 2K1RA 1RHMB 4DQRA 5C25B 2ZGYA 2BKPA 1L3TA 4OLPA 5AXNA 3RBXA 1M0SA 5I3QA 4Z4GA 4DUTA 1FNMA 3O1LA 3EVOA 2EW9A 1X4BA 1VQYA 4OZ0A 1R3NA 4YOYA 3V4IA 1M5SA 3FQKA 1GXLA 1JLAA 3QT7A 2LXIA 4OHWA 3EJMA 1PCAA 2UZAA 4WQ5A 7FDRA 3WUHA 2OFHX 2ZHAA 4FWRA 4LRBA 4H0XB 2UVUA 2BE2A 4C0OC 4HDHA 3H1VX 1NBEB 3PXGa 3L3CA 2XYHB 5AZIB 4KC5A 3KHRA 4BWMA 2VOPA 1T9VA 1OMSA 3DRXA 5HQMA 3D3CJ 4O3SA 4NCGA 2IDOA 1K9MO 4IDKA 3SAGA 2R7VA 3C8YA 4CLSA 5JS2A 3NCQA 1TFYA 3G9CA 5L9NA 4LSZB 3DMJB 2QMXA 2V9WA 1RAOA 3G6ES 1N52B 3VQ4A 4BGBA 1T0TV 2H65B 2O67A 4OZLA 1KAYA 1T9XA 2VPYB 2VQFK 4O3RA 3KUHA 2O4GA 3OTEA 2OAUA 1NK6A 2OTJS 5BRFA 2X6SA 1DT9A 3H6EA 1QVFM 4C3KA 4HR2A 3V1QA 4ES3A 2HBJA 3CB4A 2ZJRL 3FGUA 4CHNA 4BRGA 4JI4K 3JSRA 3OR2A 4RW9A 1RAJA 1A5VA 4CDIA 3AA9A 1G3OA 4ZP9A 1UAWA 1PAEX 1N34J 3G4SN 4W5OA 2M70A 3BYPA 2R3VA 3OR2B 2AF6A 1U6FA 1WC0A 1XNQJ 4WFNL 3CT9A 3CMAS 4A48A 1X3MA 3ZZ0A 2FIUA 3AJDA 1EETB 3MWBA 4ETZA 2LSNA 4C11B 5DO2A 3PYFA 1NDPA 3HHLB 3KXDA 2UVRA 4ERDA 1X4GA 2CZ9A 4JI1K 1VLOA 5KFKA 1KVAA 2CNOB 3EYZA 2BBEA 4E3SA 3KK7A 2HFUA 2O8CB 4LF4K 1MW7A 4OZ1A 3RYLA 2HOEA 1SKUB 2MYFA 1S1UB 2EFOA 5HLFB 4YB6A 2FBYA 2BE9B 1CZAN 2EC2A 2PFDA 4BY9C 4U8VA 5KFLA 3AVFA 3ZTOA 5J2QA 4FXDA 4ZPCA 1W2BR 5C10A 2GMLA 2OPPB 1BA1A 3UE5A 2QJ3A 3CCES 4PWUA 3K7RA 3ZSRA 2QEXN 5F0XA 4NWBA 4PG6A 3LP2A 1RCHA 1S1VA 2IC3B 1SQGA 2UUAJ 3OTCA 3QEVA 3A12A 1I94K 2CJXB 5B0FA 5KGWA 4ILLA 3KWMA 1Z2ZA 4B3OB 2XY5A 4UF4A 2Z1JA 2OIHA 2YPYA 5AQFA 3CDAA 1Z1ZA 2WVDA 2IRUA 5KT4A 2OTLN 4ALZA 4DL0C 5EDWA 1NK5A 1K0TA 3J7YP 4QBUA 4IQXA 4BCAA 1FWLA 2EFNA 1NK7A 3VN5A 3BJYA 5KG3A 1IBCB 3TX8A 2CGJA 1L3SA 2HHUA 4JI1J 1WEZA 5ETLA 3MWTA 3LDPA 3R6GB 2CQ4A 4FZVA 4IBNA 2YWEA 4JI6K 1EXQA 1RACB 3ZNJ1 2CPXA 4CLLA 1BXNA 3A8EA 1UW9A 4ITSA 3GFHA 2EK6A 5L46A 4L75A 2Z1HA 4QR1A 4LF7F 1YTAA 4DTXA 3B82A 1VQSA 5IXUA 5FDLA 1JLEA 1WAFA 2RE2A 3L2RA 1KP6A 2OHDA 4LF9K 5EGYA 3LP2B 3P39A 3WDOA 3DLKA 4PG5A 5CYQA 3QMQA 4JV2A 4EHUA 2K7KA 3NWGA 3NS5A 3QAUA 3TUPA 5KFWA 3SSQA 3NOGA 5HVFA 4ER8A 4ZVSB 4P9SA 4QR0A 2B6AA 2UUCK 1WSGA 4RO0A 5KFFA 5B0EA 2P9SA 1NGCA 2DNPA 3A4TA 2DIUA 4LR8A 2AX0A 5B8HA 4IJNA 5KPTA 4O44B 1B3TA 2F4FA 3AVHA 1GNKA 1RI7A 4YOUA 2JFKA 2CYYA 1LXNA 3VEVA 1NZAA 3VZIA 4DR3K 3PW2A 3BN7A 5LSOA 4BRMA 2Y8YA 2L9NA 1KTVA 2AZ3A 3AXKA 3BSCA 1LAWA 2Y0SD 1RXOB 1QZ5A 4HUFA 4HT5A 4MTPA 1MA9B 3QO9A 3F9MA 2LXFA 2MZTA 1MROB 1VBXA 3TNVA 3U8XA 3MUMP 3DM2B 2IOCA 3GL1A 3L4QA 4ZHRB 3VQAA 3CM5A 2G8VA 4F04B 4WIIA 4DSJA 1A5XA 2IVFB 2JNJA 5CHCB 3ZETA 4J9LA 1ZS6A 3EZ5A 4CNYA 2PD1A 5A8RA 3E9LA 1G99A 3M2RA 4DMNA 1FNXH 2C3MA 4JI3K 4LF5F 2BOPA 2P9IB 2H4YB 4ISFA 4GKJF 3CF5Q 4JI0F 3UD4P 1XR6A 1YKWA 2KZZA 3H4DA 4OFZA 3C6TA 1N36F 1UVLA 1NEEA 4PRFA 4DU4A 3KIOA 1F9FA 3BGRA 2UXCJ 5M1OA 3MAAB 1B64A 1E6YB 4OO1J 4R0EA 3EDRB 3AVBA 1HA1A 3R8EA 1T3OA 3LP1B 4OYWA 1KNZA 1OIAA 2FHKA 2V51B 3I8BA 1JNZB 4UOHA 2NNWA 4DR5K 1WLJA 2NRWA 2UUBF 3ZYYX 2V8VA 2JLEA 4G1QA 5ADXH 2J9CA 1VHIA 4WFXA 2F4VJ 4BS2A 1HHQA 2H5IB 2YWGA 5SUHA 4ZJQA 2W2NP 1GX5A 4JK7A 1NLKL 1TMMA 4CJRA 3FZMA 1WBDA 2WK4A 2A6AA 3K2PA 4ZTJA 1JLAB 1VMBA 1EZZB 2FJDB 3K58A 1RABB 3Q8VA 4X4TA 4IUFA 4JI3J 4FVUA 2R7OA 2DR9A 1UW4A 4HLBA 2UXDF 4TSXA 2P5GA 5KFDA 2XMJA 4O0IA 2EG2A 3M9OB 2P9KA 1U7LA 4EWTA 3VGVA 5K8OA 2MSSA 4KI4A 2XB2D 2DK2A 3C19A 1WDTA 5ETPA 4GKJK 1BHNA 4K0KF 5JVHL 1HBUA 4N56A 5DLFA 2BE2B 3SIPB 2Q3SA 4C7QA 1YUWA 3GE9A 2B4OA 4O8KA 3MECA 2VG5A 3WQTA 4JI2K 4M5IA 2U1AA 3O3FA 5L1JA 3HI0A 3GSIA 4I2PA 2QLBB 3TWZA 3DLGA 2DTUA 1YIJN 4IH7A 4X65F 3TA1A 1ZYQA 4ZLNA 3DLRA 4X66K 5GAEU 2C2NA 3VGMA 1VFJA 4QJVA 4RUCA 2V8GA 1KBRA 4KRFA 2OEKA 5FRNA 3W8PA 3LO3A 3LA0A 3D4JA 1P8GA 1RDAA 1RILA 3R7SB 2ZC4A 1C0GA 3VQDA 2K06A 3ZTSA 4CTAB 4GVMA 3QWPA 4DV4F 1BQNA 3AOAA 4A4JA 2H5JB 4ED0A 2MSTA 4KIAA 2NZTA 2G2YA 3RBEA 2Q1LA 3T5KA 3A3NB 2DPNA 4PWDB 5KT7A 1Q8KA 2W9CB 1XMOF 3S41A 1ZBSA 2CG8A 3HFZB 2C2ZB 3OTOK 1PC4A 1VISA 2XYGB 3BBFA 4DUZJ 4DTPA 1U1KA 3J81U 3F0NA 1R8CA 3DNCA 5CYMA 3THXA 2IDLA 2AU0A 1HWLA 3KHLA 1X9JA 2Y3YA 3ENWA 5F1XA 1TR0A 1X7VA 4I69A 5H9FK 3FNNA 4CZKA 3SAFA 2IMOA 4KR0B 4TQRA 1KHVA 4FWSA 2KFYA 2HMPA 1Q78A 5LOQA 3KLGB 1V3ZA 4CWBA 2HWIA 1QJHA 4HEA9 4ZIVA 3RMBA 4DFPA 2AGPA 1NKEA 2MKCA 2CJKA 3DLHA 3KK2A 4CEQA 1W97L 5CCMA 5D3GB 2DRBA 2CJYB 3EPGA 3G10A 1GMVA 1S97A 3R6LB 2IHR1 3HF5A 3GIJA 2LDIA 3HOSA 2WOMB 1AFIA 3UIQA 5F8HA 1IBMJ 4P2XA 3HVRA 3J7AN 4AT1B 3D2EA 2PAVA 1FRMA 2NXUA 3BO4A 2DITA 1N5YA 1WOOA 2X74A 1RBUA 4NLSA 2ZOGA 3CJ1A 1T3NA 4QAGA 2HBQB 2G2OA 5KFPA 3CPEA 4CLTA 2OPSB 4CJEA 2OA8A 4ED8A 3KLEA 3IM9A 5EX5A 3HK2A 1K6YA 4EUVA 4LY7A 3CO0P 3LDLA 2NLWA 5ETQA 1N33K 2E29A 4KHYA 5DM6Q 2MJNA 3AGRA 4YUDA 1NXIA 4XDDA 2AKWB 5D0RA 2GJIA 4H0TB 1PGZA 2KW4A 3OSPA 4F4XA 5T14A 2J6TA 3GILA 2C22A 5M1FA 4E7IA 1C0UB 4K4SA 2HHHF 3KJNB 4IOBA 4YY3K 3TJ9A 3M2UB 2NZCA 5M2PA 5A76A 4TYAA 1GLBG 3W5ZA 1EETA 2CPJA 4J91A 3CCWA 2VFUA 1H2VZ 2DNHA 2VB6A 3PIOQ 1HHTP 5K20B 2E9TA 4CIEA 2WW4A 3C2PA 3CMES 5IC6B 3AQOA 4A5AA 4R25A 4CECA 2QXFA 2UP1A 4B8AB 1VK8A 3OYFA 5E84A 1ZTWA 3ZT1A 3GYNA 3MCAB 3E3XA 3DOLB 2UVVA 3L6QA 3HSZA 2F65A 3P96A 4M95A 2ABYA 3GCXP 1GMUA 4NLDA 2MDAA 1R89A 4NCAA 3V1OA 3MDQA 2RU9A 1I5OB 3LWMA 4KH0B 1VQ8S 1SCJB 1VQKS 3ISND 4OPHA 4O4GA 3V4MA 3CC4S 3ID8A 1XJWB 1NJZA 1IV0A 3HKWA 1ASWA 2NRXA 4NEZA 3O9QA 1OKJA 1XK8A 2F9DA 3NAIA 4F2SA 1YDLA 3FKBA 4F3QA 1O51A 1S7IA 3M8WA 1KVIA 2ATCB 2QMWA 1S0NA 4MYTA 3CC2N 4B8CA 4Z37A 2MQNA 1SI9A 4LFCJ 1LKZA 4FW1A 2BM0A 1BUXA 2A0FB 4F36A 2WB4A 3UDVA 4CZMA 3ULEA 3OTDA 3BB5A 2IVNA 2QKKA 3HZEA 1N0VC 3F2KA 3ZT2A 1LWCA 3HVAA 1HNXF 2LFVA 1FEHA 4DR5J 3MUTP 2NZ4A 2MZSA 2GX8A 1HW9A 4P2FA 7FD1A 2VL1A 2CQDA 4R79A 1IQTA 4OYXA 4RUHA 4RUAA 4LUBA 1N32F 1S0OA 4I6WA 2CJ9A 1ZM9A 2F4VF 1ZBIA 2OZSA 1XMQJ 3TA0A 4EMDA 3BQ0A 1Q0NA 3CD5A 2QK9A 4LF5J 2NR0A 3N4PA 4U7UK 2UUCF 4ZOSA 4DQPA 1QVGM 1CXQA 1KC8O 5HOOA 3TAFA 3E01A 1N4LA 1NSQA 2HVZA 4X64F 5ETSA 4I9LA 2H4WB 4NYZA 3DXBA 3VEYA 2FJWA 1EIYB 2F9TA 1SZ2A 4DHYA 4IO9L 4DV6J 1FEEA 1WJ9A 2FDNA 2VHGA 2MHNA 3AO4A 1RDCA 1RJJA 1GK8A 3H7HB 4EHTA 2NYHA 3NP5A 2RNEA 1KOOA 2ZJQQ 3KKRA 4RNNA 3MEDB 4V1Ak 3UCZP 2KLAA 5AQJA 1RHKB 3PEHA 3AH6A 4YOVA 5E41A 2O8FB 2EFVA 5KFEA 1QAIA 2PEHA 5IV3A 3NDKA 3GQCA 3ZZPA 3MM7B 5BYRA 3O6WA 5AJ3J 4OPJA 1DEJA 3IN5A 2HK2A 3H90A 2ZJPQ 5KG7A 4UY8T 2PIIA 3LPEA 4X66J 4DV3F 1HBOB 2UUWA 4JKHA 1Y5LB 3CVKA 4Y2AA 1U45A 5GIPA 2PMHA 4URGA 1V4SA 4I9QA 2UXBK 5HLFA 3LL3A 4JLHA 2D3UA 5B0GA 3HPGA 4EU0A 1NZ8A 4FWNA 2MKHA 2RUSA 2W25A 1I94F 2DBBA 1JL1A 3J7ZO 1PBUA 4G1PA 4R5PB 1CSJA 1EX4A 2OLWA 3UFCX 3SUNA 2K3IA 4LFBF 1F2GA 3GSDA 5I42B 4FZXC 3IWNC 3GR0A 2PYJA 1FXLA 3J81j 4ZP7A 4F67A 1TKZA 4ZLLA 3VF0B 2O3DA 4FVCA 4M5HA 3HT3A 1H2TZ 5FROA 3SI6A 3CJQA 2E1PA 2UU9F 3CJ4A 4FJ5A 2B43A 3ZX3A 2GQ2A 4K4VA 5KT3A 4C1NK 3UR0A 3D2FA 4NZ6A 1NPPA 1RAEB 2QL9B 1QVFR 1VBZA 4AXIA 3BPDA 3H59A 4USHA 1JLBB 2GO9A 2KG1A 1HYZA 4A8WA 3IGVA 3T1HJ 3CJ0A 3L09A 1TTHB 5L38A 3FE1A 5KFHA 3C6UB 4PKHA 2C2OB 1OH5A 3A2FA 1Q8LA 1FDAA 2IVPA 5F3ZA 1NGFA 4J9SA 1WSVA 2KRRA 5E7OB 5ITHA 3KK3B 4CGGA 1NRKA 4CM2A 3DWLA 4YS2A 2GGPA 1IKVA 2YNHB 3SBGA 3TA2A 3AO3A 3N4QA 3RBZA 1HNXJ 3I5CA 1MU2A 1IBMK 5HROB 1S59A 3ENOA 2EEYA 2COLA 4OI1A 4IH6A 1RAHB 4NLGA 5DQGA 2A2CA 2G0JA 4CBXA 4DQ8A 2APOA 2KHOA 4BRPA 1YTUA 1JWWA 3FCVA 3M4XA 4P71A 1W0HA 4YORA 3M7VA 4JYAJ 4LFBK 3EKSA 3EZWA 2C28A 1RT4B 3PRVA 1WTFA 3UI3A 4I67A 3LZIA 3IM8A 4M5DB 4RL1A 4OZ5A 1JCFA 1U2FA 2D9PA 2CZ4A 1IBMF 2PE8A 2O8EB 3DOLA 1ATSA 2DIVA 3OLAA 1NGEA 5IQQA 2PDAA 4FKXA 3LW5C 1CC7A 2DGOA 4M3XA 5BR8F 1JKHB 2QLJB 3PJXA 5L8RC 1RT1A 1R0AB 1R43A 1NK4A 1DURA 1TZ0A 4B3MF 3DU6A 4CJVA 3I4HX 3OY9A 1Q1KA 5C25A 5AQLA 4CGIA 1AA1B 4BRQA 1WTBA 3V6DA 4WTYA 3CCEN 2F8EX 3MCMA 3GB0A 4OV1A 4U8YA 2VQEF 2JEJA 3WNFA 3I96A 2D1CA 4EYHB 3QNWB 2CUYA 3CMQA 4WF9Q 4NLCA 3LDSA 3BGFA 4KHPJ 3V81B 4PL7A 1KFDA 3PO4A 4KTZA 2QWMA 1S4EA 4A8YA 2E1RA 5KRSA 3SV4A 3NCRA 2J7WA 5LJVA 2NRRA 1XNRF 4C23A 1S9GB 3EGVA 2FJAB 3OL9A 2N4CA 2EBGA 1P1TA 3GMGA 1KAXA 1AZSB 2YH1A 2B56A 2V2ZA 3RZAA 3M8PA 3SCJE 1N5SA 2QKBA 3LP0B 2ZE2A 3K5LA 1A9NB 4J9QA 3UCUP 3DLBA 4EBDA 4KFBA 3TYTA 5A0YB 3A8JA 2Q43A 3RRGA 3NLCA 4PQUB 1WC5A 2WZ1A 2HZVA 2HLUA 5AZIA 1YJRA 2MPUA 5HRPA 1C4AA 4H5RA 1CEZA 3L7OA 3O3HA 2MLXA 4IFEA 2RU3A 2Q31A 4B1ZA 1VQNN 2V0NA 1X4FA 4FLWA 2CZVC 3NL0A 3VA3A 2FF3B 4ANEA 4DU3A 5J2PB 1QQOA 1FTRA 5DDQC 1K9MT 4KHPK 3BEGB 1SB6A 2E1AA 4LBPA 3IDHA 3KG1A 3D45A 4B9LA 3TZZA 3MMAA 5CR4A 4KTQA 1KKHA 1RCOB 4DDFA 2CGKA 3L2UA 4IZ9A 3MCPA 4FYDA 1Y64A 3MM9B 5KG6A 3GP9A 1VQ6N 3BEXA 1NDLA 4XDCA 1DKGD 4IEEA 2DNZA 3V1RA 1UEUA 2CWXA 2NYIA 1ZBUA 4L76A 2MQ8A 3BSAA 4FYYB 4BE1A 4F02A 3W3DA 4KYZA 5GAGI 5AQUA 2CQPA 4CRJA 2QIFA 2LECA 5C7PA 1S48A 2YWHA 2F1FA 1PYSB 4QYZK 1UVJA 4YP3A 1J5OA 3BGUA 8ATCB 4WJBA 4F0KA 2IBKA 4X84A 3SQOP 4CGHA 2BABA 3QEIA 3RB0A 4YQWA 1TKXA 4Y6IA 5B0AA 2XMTA 4ATNA 2YY3A 2BJ9A 4KREA 2KJVA 3SQ2A 2YQ0A 2FTRA 5ETRA 1X1PA 1C0MA 1XMOJ 1NO8A 2VUGA 4V19J 2CQ2A 1U2VA 2Y8WA 4NLUA 3HJFA 1CJKB 3CCUN 3C95A 2V68A 2FB0A 1S6PA 4JI8K 3PFOA 2CQIA 2A41A 3SSRA 3CCUS 4OI3A 3TZXA 4J37A 1CZBA 2E2OA 1Q9YA 5EOYA 3CXCM 3FSIA 3NOCA 1OYDA 1TV6B 1K8KA 3GIKA 4P2SA 4ES2A 4H4OA 4LRDA 1F21A 4TN2A 1E6VA 4K42A 4DPYA 4TY8A 3DOKA 2HRYA 2ZC3A 4USIA 2RF2A 1HWJA 1F9EB 2D3ZA 3QEPA 2P9LA 4OI6A 1PIEA 1G15A 1V5VA 1D8YA 6FDRA 3GYXB 4BDYA 2YKNB 5HAOA 2HFOA 1WI8A 4DZDA 2YTCA 4K4UA 2RKIB 3BH6B 2I7PA 5BR8J 3A1YG 1K44A 3CJ5A 3QZ8A 4I68A 3FZBA 2DTJA 5H1SV 3MR3A 3EUNA 4RPFA 3FEZA 4NLXA 1VQMN 2KQ2A 1QTNB 4JV0A 2ZVSA 1RP5A 2GHPA 4ILJA 3PX6A 3EPIA 4JK8A 4JI8F 1RDWX 2Z30B 3NNAA 3W64A 2Z2YB 1DY3A 2F7VA 2O8BA 4J9NA 2GTDA 4EEYA 1TV6A 1K8KB 2HBKA 5GMDA 4G65A 5DGAA 1KLNA 3Q2SC 5BXIA 1HR0J 2WVCA 2XRIA 3I4PA 2HNZB 4K2JA 4FJJA 4NYOA 3FMBA 3Q8RB 2DNRA 2ZKUA 3KUGA 3JS9A 2OMOA 5KFMA 3VEOA 4KQZA 4OLOA 5GMKa 2FUG9 4CEFA 1FD2A 3CJKB 5GAGU 5E26A 2QTWA 2D7SA 2VKZG 4DKWA 2R9LA 3I0RA 1GMWD 3PTWA 2Y0BB 4F3MA 1ZM2A 5H9EJ 4H5NA 2XHWA 3UDCA 3IMQJ 2DH8A 2YNFA 2AV5A 4IG0B 2RRNA 1JXVA 4NXNK 1DRZA 3MXHP 3NF8A 3TZWA 1XNRK 5E33A 3NNCA 5G4DA 4ZPTR 4J9VA 2RVJA 4B3SF 3R7NB 1R27B 4A8KA 1J5EJ 4E7HA 1HWUA 2BOAA 3AARA 4MYUA 4C9DA 1Y9OA 2MKSA 2Z57B 2KG0A 2IDEA 5CYMB 3DLEB 2QFJA 2VODA 3TO8A 3QNOA 4ZKAA 3MAQA 2XULA 3R2DJ 5AQOA 2YHYA 4PCQA 3T7ZA 2MY7A 4WP9A 4IJAA 5GIOA 5M1QA 1X4DA 4USTA 4ZK7M 2PMZD 2M88A 5DRKA 1W2BM 1S77D 3KNAA 2NXCA 4JKGB 4B3MK 2ZH8A 4IKAA 2QL7B 3O5BA 3IXQA 4OYIA 3MN7A 2CVIA 5KTQA 2IVOA 1GXTA 3KVGA 2WCXA 4Z2XA 3NCPA 2QT7A 1UOCA 3E66A 2KZMA 4CIOA 4NASA 1SL0A 1HQUA 4RNOA 4DV4K 3KJQB 4GRSA 5BRHA 2B8PA 3PG9A 2HWHA 2HQ3A 2JLGA 1SKWA 1R7IA 1RKIA 1NGGA 1R59O 3N4WA 4IQMA 4ZP8A 4G9ZA 4ED4A 1LFWA 3ZX0A 4K59A 4HTUA 5KFBA 2HBZB 2QWQA 1FKAF 4DCJB 2YHAA 4E1JA 1RT7B 4PXCA 1BCMA 4DV7F 4LF6F 5CXTA 4ILMA 3ZT0A 4O5BA 1J54A 3HD2A 3MD1A 2ZE2B 5FIIA 4LIWA 3DXKA 3I0RB 2A6MA 2H48B 2HZAA