4RW4A

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 145
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw4A05
1RA6A 4NLUA 1RA7A 2WOMA 3CM5A 2ETJA 4CK1A 1IG9A 1HQUA 1RT3A 1YVFA 3JSMB 3DLKA 4M45A 2W9BA 3HJFA 1JLEA 3G86A 4FXDA 1R0AB 3U3GA 3PW2A 3OYHA 3DOKA 1T3NA 3V9SA 1RTIA 4IDKB 4FM2A 1WSFA 3BGRB 4HUFA 4KRFA 2D5RA 2P51A 5F8JA 3EPIA 3QLHB 3NF6A 3VQ4A 2I5JA 4BWMA 3OYAA 3ZSOA 1VRUB 4Z4EA 1BHLA 2YKMA 3RBEA 3L2UA 4DL4A 1HNIA 3O4QA 4EP5A 3SUPA 4WE1B 3TWHA 2UUWA 2IC3B 3V6DB 3CJ5A 4IOBA 3GIKA 1QSSA 3BDPA 4J9NA 4OPKA 4DQQA 1XI1A 4O55A 4CGIA 1S9EA 2I1RA 4MK8A 4IFYA 3Q8PB 3OVNA 4TN2A 4CEDA 2W42A 1LW0A 2FVCA 3Q8RB 3AVGA 4IKFA 1XHXA 4ED0A 1JLCA 1LWEB 4DSKA 4DL2A 1ZTWA 4DS5A 3AO3A 4JRQA 4ZTFA 3RB6A 3PR4A 4CGJA 5CYMA 3H5YA 4CHOA 4RW8A 4DTNA 1JLQA 2ALZA 4KHUA 4YR2A 3NAEA 1JLFA 1IO2A 1SV5B 3AO5A 1C0TA 3MECB 4WYLA 5KFJA 5EWEA 5DG7A 4F2RA 1NHUA 1XR5A 4RNMA 1DTTB 3QINA 4O4RA 3UPFA 4HCBA 1VSFA 1RDAA 5J2MB 2HNZA 1RT4B 1WLJA 1DTQB 4C8NA 4NCGB 3ZCMA 3LDSA 4CFAA 4C8LA 3QO9B 2XY5A 3HVWA 3N6LA 4J9MA 4OVLA 2D0BA 3OS2A 4DLEA 3LP0B 4R0EA 1TKXA 3OL7A 4J2DA 1TKZA 1S49A 4WFXA 3ZT2A 4JV2A 3OYMA 2ZE2B 5KFRA 4Q8FA 4U6PA 2B4JA 4QWCA 2OPSB 2XO7A 1JLGB 3VQ7A 1QAJA 3DRPA 4Z4HA 4URQU 4AILC 3OYBA 3VQPA 2FLPA 1YTUA 3F9KA 3MR3A 4RNOA 2FJWA 3RB0A 2OZMA 5L1LA 4FK4A 1VSLA 2W8KA 3HK2A 2ZD1A 1S6PA 1L3UA 1B9FA 3TAQA 3IAYA 3PO4A 1WSJA 1N5YB 4CF1A 4LSNA 5EWFA 4NCAA 1NK9A 1G15A 5EDWA 4B9SA 1C0UA 4CJUA 3OJUA 3HSTB 1QHTA 4LD0A 2IS3A 2OYQA 1KLMA 4DLGA 4NYZA 3KLGA 3BQ2A 5KFGA 5I3UA 4CJLA 5F8IA 1VRTB 1NNDA 1S9GA 3LP1A 3BSNA 1W9HA 3NCIA 4DTUA 1S1XA 2KTQA 1FKOA 2GIQA 1WSEA 2RF2B 3M9NB 3GILA 3QIDA 4EBEA 5DQHA 3ZSXA 4KAIA 3KHGA 4B3OB 2R2TA 5FDLB 1LW2B 4CFDA 1LAVA 3O3FA 2QXFA 1T05A 3PJXA 3JYTA 1HMVB 3VQCA 3D28A 1KFSA 3GYNA 5FROA 1VSEA 5KG7A 4CF2A 1S1TB 1HARA 2FBXA 4FLYA 3LP3A 1XWLA 4RNHA 5C5JA 1OS5A 2VG6B 4G1QA 2E6MA 4FM1A 3MEDA 4ZVGA 2WONB 2BANB 4NRTA 1JIHA 3B6PA 2IM1A 1CSJA 4R5PA 1RYSA 1RDCA 3M8RA 3HP9A 3IRXA 5DK5A 3C94A 3KKSA 3VQ5A 4NYNA 3BGRA 4JS4A 3BSOA 4Q45A 3QLHA 3OYJA 3AVNA 3ITHB 2D3ZA 4K4YA 4KPYA 2YKNB 4RW7B 4M3XA 1VRUA 2PYJA 4KO0A 1N4LA 4FZZA 3K59A 1GX6A 2IC3A 2FVPA 3CFOA 2QKBA 4CJ5A 1BISA 1JXEA 4RW6A 4CIGA 4CE9A 5HROB 1S1WB 1N6QB 3LALA 3MF5A 4F3TA 2G8IA 4ID5B 3SFGA 4GC7A 4RW9B 1LWFB 5SZTA 2IJNA 2HB5A 4NYFA 2AX0A 4NLDA 1QSLA 3H59A 5KFTA 1LWEA 4IH5A 3C95A 4ED1A 2RPIA 2QKKA 3NL0A 2WOMB 5DQGA 1RNHA 5KRSA 4KHQA 4OKJA 4B9LA 2UVWA 2JEJA 2XY6A 1MU2B 1HQUB 1RT3B 2V9WA 4E7IA 1F21A 4ZPBA 3PX0A 3E01A 1JLEB 5KI6A 2R8GA 4TQSA 3ZSVA 2W9AA 3ISNC 1DTTA 3AVFA 1SKWA 3SZ2A 4Q5VA 3DOKB 1RT4A 1SKSA 3KLFB 1DTQA 1IH7A 3QZ8A 1LV5A 1JKHB 3QO9A 1TL3B 4FJ5A 1S1VA 4CJRA 5CY4A 4ECVA 3RR7A 4Y2AA 2IMWP 5HBMA 3OL9A 4CF0A 4E1MA 1VSHA 5KG3A 3PW0A 3HL8A 4Y1CA 5CZ1A 1RBRA 4E7KA 3IG1A 2ATLA 3H4DA 1UOCA 2XHBA 2HMIA 2RN2A 2OPSA 2HHSA 3RMBA 4ECRA 2JGUA 4OJRA 4IH6A 4IG0B 2BDPA 4AHRA 1TVRA 4E89A 4ECUA 1S9EB 5KGXA 3FQKA 4IFYB 4CJ4A 4G3IA 3NHGA 4FJGA 3RR8A 2BRLA 2ILZA 3THVA 3ICLA 3VQ8A 3OL8A 1WSHA 4ECQA 4I2QA 1S6QA 4E7JA 1RT1A 1QE1A 4BE2A 5HRNA 4I2PB 5CYMB 3V1RA 3NMAA 3SUOA 1BGXT 5C25A 4K4XA 4FZXC 1A5VA 2FBYA 1J5OB 4O3SA 1C0TB 1NKEA 4DU4A 4AHTA 3BQ0A 4WYWA 4C8MA 3CJ4A 4O3OA 3SPZA 5EWGA 4RG8A 2GUIA 3OY9A 3FSIA 1KVAA 4PY5A 2HNZB 3CJ2A 2J6UA 4Z4IA 4YQWA 4KHNA 3VQ6A 5K14A 1TKTB 1VRTA 3SYZA 3TANA 1NJWA 3NAHA 3CFPA 1TKXB 3ULDA 1TKZB 1CZBA 1SH0A 2QV6A 4IQXA 5J2NA 1TGOA 3B6OA 4M95A 1LWCA 4CJSA 2W9CA 1C1AA 4ECSA 4Q8EA 3VA0A 1RBVA 5FDLA 1LW2A 3DLBA 3SNNA 3T19A 4MIBA 4O0IA 3LP2A 4DTMA 4CJFA 2IJFA 3I5AA 2DFEA 4F4KA 3RAXA 4KREA 1XR6A 3GQCA 2E6LA 1NOZA 1YVUA 1S1TA 4WXOA 4TLRA 4ZP7A 2Z1JA 2E9TA 4QAGA 4FLVA 1UWBB 3MTKA 2HHWA 2ZD1B 3K2PA 3NGYA 4K4WA 2DTUA 3QYYA 4F8RA 4LSNB 4MKBA 4ICLA 4NLSA 2JEIA 3N6MA 4X2BA 1L5UA 1C0UB 3QNNA 1HQEA 3TAPA 4ZP8A 3UR0A 4CFCA 1NKCA 4MQ3A 2KFNA 3ITHA 3KLGB 5HLFB 1YT3A 5I3UB 2YKNA 3CQ8A 3K58A 3MR6A 1RTHA 1SL1A 3CG7A 3V9ZA 1S9GB 2YV0X 3PO5A 3LP1B 4F2SA 5J2PA 1S1XB 3DLEB 2OH2A 1FKOB 3H2LA 1T94A 1Z4UA 3C6UA 5HROA 4KTWA 4ELTA 4M3UA 3AVJA 1TP7A 1NJXA 1DLOA 4GVMA 3ZSYA 4DWIA 4WXWA 2HNDA 4E7HA 3NGDA 3OS1A 3QGHA 1LWFA 1KTQA 1VSKA 1EKEA 4CFBA 4M3YA 3JYTB 3LPTA 1RBTA 1RDBA 4ZHRA 4DTRA 3KHRA 1VK0A 3AVHA 4JV1A 4TSXA 1L3SA 3U3YA 3SI8A 1MU2A 1BIZA 3HVTB 4G1QB 1A5XA 2E9RX 4FJ8A 3MEDB 2HHTA 4QWDA 1S1UB 2GBZA 4QWBA 2W8LA 2F8SA 4QW9A 4LQ9A 4R5PB 2HW3A 3H98A 3KLFA 3RB3A 4DQSA 3IRXB 3C6TA 4IRDA 4DTXA 3K57A 2YNIB 1JKHA 1Q8IA 1TL3A 2Z1HA 3GV5B 4MK7A 4KV8A 4YMEA 3RMDA 2XGQA 4FLZA 1ZTTA 1WN7A 5DGBA 3K5OA 3CDUA 2C22A 3VQ9A 4NLVA 4KO0B 1C0MA 4KTZA 3H40A 3HHKA 4CEZA 3I0SA 4J2EA 2YNGA 1WNSA 1N56A 4RUCA 4H4OB 4IG0A 2O4GA 4RW6B 4O3PA 4URSA 4TYAA 4HHTA 4CJQA 4ZPDA 4CEEA 1U4BA 2G8HA 1S10A 3SQ0A 4ID1A 1RDDA 5KG0A 3DRRA 5C24A 3KD5E 3OYDA 4IR1A 4QWEA 3EZ5A 4I2PA 4J9LA 1IKVB 5KFSA 2R2RA 4DL5A 1QAIA 4N5SA 4OLAA 3OYGA 3HP6A 1J5OA 5KFEA 1TKDA 3I0RB 4J9QA 4XO0A 4Z4FA 4FCYA 3E01B 3KK1A 2YHBA 3TR8A 4ED6A 2IDOA 3TAMA 4EYIB 5DG8A 3NBPA 5L1IA 3DLGA 4KHWA 1JXLA 5KFIA 2OPRB 3NGZA 1TKTA 5L1JA 5KFCA 2FVRA 3L3VA 1RDRA 1S1VB 1TK8A 1TK5A 4ECYA 5HBMB 4MFBA 2KQ2A 4J9KA 5DGAA 1NOYA 4FJXA 3LAKA 1FKPB 2UVVA 3IG1B 4WFYA 4KB0A 2HMIB 4O3QA 4EEYA 2OPPB 2WCXA 4J9SA 4NLQA 1C1BB 5E41A 4FJ7A 2G8WA 4PWDB 1BCOA 1TVRB 3CVKA 4DS4A 4ELVA 3E51A 1RT6A 4AHCA 2XCPA 2CJQA 4WFZA 2R2SA 2BQRA 3VN5A 4LSLB 4CJWA 3L8BA 2IAJB 1UWBA 4O44A 3I5CA 5KG5A 4DL3A 4I2QB 1S6QB 2X6SA 1RT1B 2VWKA 4FJHA 2FVQA 2UVRA 2HAIA 4E19A 2FBVA 3N6NA 1QE1B 3EPGA 2V4QA 2HVIA 4KKOA 2IM3A 3SQ2A 3HPGA 4B9VA 1JLBA 5C25B 3RAQA 1HPZA 3LZJA 2HHXA 1S0NA 4HKQA 4R8UA 3KKRA 1BI4A 3WNHA 3GV8B 1X9WA 5HLFA 3OLBA 3S3OA 4J2BA 5K14B 3MR2A 1HYSB 1SH3A 1T03A 2WB4A 1X9MA 3G0ZA 4M94A 3L3UA 3PZPA 3G6XA 4DL6A 2J6SA 3DLEA 2BR0A 1KHWA 4CJEA 2EX3A 2R2UA 4YR3A 5J2NB 2RDJA 2VG7A 1LWCB 2DPJA 5F9NA 2W9CB 1JLAB 1FK9A 3AVLA 3QIOA 4F50A 4ED8A 3NE6A 1D8YA 3SUNA 3V6JA 1EETB 3LP2B 1WSGA 4W5NA 5J2QA 1BIUA 1QSYA 3M8SA 3AV9A 4DQIA 1XC9A 5KFZA 4AHSA 3H4BA 3NF8A 4FJMA 4MKAA 3KMSA 4J9RA 4K4ZA 2QK9A 3HVTA 4DTJA 3NF7A 2QE5A 3S3MA 1S1UA 3SFUA 2D3UA 4ZP6A 2B6AA 4ICLB 1J53A 4N47A 3KLHB 1MMLA 2HWHA 5T14A 1HQEB 2YNIA 3IS9B 1NK7A 2X74A 3OL6A 1N48A 4BDYA 1XHZA 3HPOA 4DU1A 4IG3A 1JL2A 5KGWA 4YNQA 4IRKA 1RTHB 3F73A 3TQ1A 2O4IA 1GX5A 4M3WA 5J2PB 4H4OA 3QGGA 2ASLA 3MEEA 1K6YA 4DMNA 2KW4A 3L2VA 3K5MA 3C6UB 3RWUA 1TAQA 4F4WA 4CHYA 4I9QA 1KCFA 3PX4A 1DLOB 2J6TA 2HNDB 3AO2A 3U6FA 1J9AA 1QTMA 4F4XA 1RTJA 3FQLA 1NK0A 4O0JA 4DFKA 4BWJA 1XR7A 3O4NA 1ITGA 3CDWA 2YNFB 3KOAA 5F8HA 4ZHRB 4DFPA 1KRPA 1RT5B 5KT7A 3SUQA 3CDEA 5FRMA 1IKVA 3T5JA 1EP4B 4KFBA 3D45A 3PY8A 1QS4A 3I0RA 2O5DA 4ECXA 4F4YA 3DDKA 4NRUA 2E9ZA 3G6YA 2JC0A 1NHVA 4RZRA 4Y2CA 2OPRA 3KMQA 4ZMMA 3AVCA 3C6TB 3D0PA 4FJKA 3ZSQA 1D5AA 4O4GB 4KV8B 4ZTJA 2P5OA 2HVHA 2D7SA 2KZMA 4ZVHA 2B43A 4FJJA 5L9XA 1U47A 4I7FA 3TAFA 3PHEA 1FKPA 1GOCA 1I39A 3V1OA 4CEBA 3DLRA 3M8QA 1ASUA 2OPPA 4H8KA 3SQ1A 3I0SB 5CYQB 4FW2A 2YNGB 4DG1A 1GOAA 4CHZA 1U09A 3PR5B 1C1BA 3ZSZA 4PWDA 1S5JA 3AO4A 2AGOA 1EXQA 1JXBA 2R8HA 4FBTA 4EP4A 2PYLA 3KLIB 2YNHA 4LSLA 5KFYA 2X6NA 2IAJA 3KK3A 1TL1B 3H08A 3RBDA 3OHAA 2ZQBA 1Q9YA 1NK5A 4RNFA 3DRRB 5C24B 5KFMA 5KT2A 3HO1A 2R8IA 4DEZA 3AVBA 4MK9A 2F8TA 3UIQA 3KD1E 4K8XA 3CJ3A 5J1EB 4FLUA 3KJVA 3CO9A 3Q8SB 4CHNA 1UA0A 3KLEA 5KT6A 3KHHA 1W0HA 3QEPA 3DYAB 3DOLA 1EX4A 3KK1B 1S0OA 2WTFA 3DMJA 3PUFA 3TAMB 3VQDA 4EO8A 3O3HA 4CF8A 3NBPB 3DLGB 4CGDA 1HYSA 3OSPA 3PV8A 4J9PA 3T5LA 3LANA 3ISND 4MFBB 4TYBA 2IGIA 3QGIA 3ZT3A 3PW7A 3CWJA 3RB4A 1T7PA 4IKAA 3T1AA 1TAUA 1JLAA 2B5JA 4CHQA 1RAJA 2DFHA 4UQGA 2LSNA 4DSFA 3KIOA 4IH7A 2A1RA 4C8OA 1HNVB 3WNFA 3V6HA 1IKXB 1EETA 4J9OA 5KT3A 2IOCA 4KSEB 3GIIA 4KHRA 3NFAA 2FLNA 4C8KA 5HP1B 5KFKA 1RT6B 3VQBA 4NLGA 2IBKA 4FVMA 5HRRA 3HT3A 1C1CB 2PZSA 2OPQA 4O44B 2VA3A 1RBUA 3H5SA 4CEQA 3OYCA 3H5UA 3SCXA 1NJZA 2FBTA 3QNOA 4M42A 3T5KA 4CEOA 3KLVA 3A2FA 4KKOB 3P83D 3KLHA 4CEAA 1JLBB 4BE0A 1L3VA 1HPZB 4FYDA 4ED3A 3L2RA 3HKWA 2AQ4A 4DFMA 3IS9A 4R8UB 1KSPA 3SJJA 2F96A 5DLGA 1BI4B 3BSCA 3V6KA 3DI6A 3QEIA 2FJXA 1UAXA 4KE5A 4CGHA 3TAEA 4RW4B 2CKWA 4FK0A 4NZ0A 1T03B 5L1KA 4OLBA 4QPXA 3O3GA 4CJTA 2GIRA 2IA6A 4O5BA 2RKIA 4LH4A 2WRMA 1SKRA 5D3GA 5KFLA 3MFIA 4M41A 3TABA 1U49A 2VG7B 1CLQA 1RT2B 1FK9B 1ZBUA 2G8VA 1BCMA 3HPHA 4HTUA 3FRZA 1IKWB 3RMCA 4JS5A 2P5GA 5DLFA 2FVSA 1S48A 5J2QB 4Q44A 4Y1DA 2YNFA 3DM2B 4N41A 3FDSA 1RT5A 4DL7A 2RDIA 4NLYA 4FJIA 1EP4A 4HUGA 2G8UA 2VWJA 2OA8A 3VQSA 1J54A 3QESA 1LAWA 3S9HA 1HYVA 1WSIA 4FM0A 2B6AB 4PUOA 4CJVA 1ZBHA 4Q0BA 4N56A 1IKYA 3ALYA 3T5HA 4CIEA 2IM2A 4O4GA 4GMJB 3V1QA 5KT4A 4IG3B 3IN5A 3LPUA 3DLHA 2FJVA 4ECZA 5KFAA 2XCAA 5KFQA 5CYQA 3AA5X 3OYLA 4BACA 3QEVA 5KFUA 2R7YA 1B92A 5HRSA 5KG2A 3PX6A 3MEEB 2HNYB 2JLEA 2XY7A 2Y1JA 2OZSA 4K4SA 2C2EA 3MFHA 3KNAA 4TQRA 3KLIA 2VA2A 4DU3A 1RTJB 1BQMB 3OYIA 4XIUA 1SL0A 1TL1A 4XPCA 5HRPA 1D1UA 3AO1A 4W5OA 2JEGA 3G6VA 1WAJA 1NKBA 3UQSA 1KFDA 4E7LA 2R8JA 3HM9A 4FJ9A 2BGGA 4EYHB 1O1WA 5J1EA 3AA2A 4AHVA 3FFIA 4KFBB 3L2WA 4B8CA 5KFXA 3QIPA 4MIAA 1I3AA 1RT7A 1NK4A 3AA3A 3DYAA 5KFOA 5KG6A 4Q43A 2C2DA 4K4TA 2ZKUA 4W5RA 4CERA 4CK2A 4ED2A 3NH1A 4L8RB 4QW8A 2G8FA 4NLRA 5FRNA 2Q3SA 3V9WA 2BE2B 4U7CA 4NCBA 2C2RA 1Y97A 4I7FB 3UDLA 3EYZA 1NK6A 2R8KA 4EBCA 4Z0UA 4PA1A 4K8ZA 3BJYA 3M8QB 2XI2A 3IGNA 4DSEA 5F9LA 4DG1B 4ZPCA 4Z4GA 5I42A 1HNVA 1IKXA 4FBUA 4EO6A 1NK8A 2WHOA 3TVKA 4DFJA 3LAMA 3GIJA 3DRSB 3SPYA 5HP1A 2V0NA 4F3OA 2YNHB 1C1CA 3KK3B 4CK3A 2WK4A 4K4UA 4KB1A 4OKEA 2PY5A 4IFVB 2JC1A 4HYKA 1KVBA 4HVJA 4Y34A 3QEXA 4CHPA 3LWMA 3MEGA 4FW1A 4NLTA 2GV9A 4QCLA 3AVIA 4BDPA 3KJVB 4Y3CA 3KLEB 5F8NA 3V81A 3HVRA 1ZYQA 4OPJA 3DOLB 5KG4A 4J2AA 4KI6A 3EY1A 3DMJB 4YP3A 4DF8A 4RW4A 3MR5A 3P1GA 3D5MA 2Z1IA 4OKKA 4CJPA 3CYMA 2FLLA 4OL8A 3G10A 4URGA 1RYRA 4CGGA 3RMAA 1HRHA 2ATQA 3AA4A 5KRTA 4DSJA 1BQNA 1RT2A 2B5JB 1REVB 1IKWA 2KFZA 3M9MB 1SUQA 4LH5A 4F4ZA 4HCCA 3M8PB 2AJQA 4RNNA 3KHLA 3OHBA 2ILYA 3ZSWA 3MAQA 3DM2A 4TY8B 1K1QA 1ASWA 4FJNA 5KTQA 4KB7A 5KFNA 4CECA 1WAFA 2OPQB 3KK2B 3OLAA 4IR9A 4DTOA 3CJ0A 2XWYA 5KG1A 3SV3A 5C42A 3QETA 3H5XA 2VG5B 2XGPA 3OJSA 2F8EX 4HUEA 1RILA 1RTDA 1S0MA 5DQIA 4OGEA 3V4IA 5JXSA 4DQRA 4ZPAA 2AX1A 3P5JA 4B8AB 1TV6B 4TXSA 4KHMA 4O3RA 2D0AA 3JSMA 3DI6B 3RRHA 5KFWA 1FXXA 3S3NA 4YR0A 4GC6A 5SWMA 4CEFA 4PQUB 1R0AA 3TAGA 2XY8A 4AH9A 4W5QA 1S9FA 4IDKA 3TI0A 1IM4A 1W25A 5F8GA 3OYEA 2E4LA 2RKIB 5D3GB 2HNYA 3PW4A 4NLPA 2XC9A 1JX4A 3QERA 4ZVFA 4EZ6A 2Y1IA 5EUHA 1YTAA 3BREA 1K1SA 5DMRA 2C28A 4IRCA 4ECWA 3AVMA 1D9FA 4CCHA 3AVAA 1BQMA 4QWAA 4DTPA 1ZBIA 4WE1A 3L2QA 3MXJA 3V6DA 3PVXA 3NF9A 4CIFA 5DG9A 1HYZA 3OYKA 1I6JA 5JS1A 3V9UA 1ZBFA 4B9NA 1KVCA 5KFPA 3BQ1A 4H54A 3NAIA 2XRIA 5KFVA 4KBIA 2EHGA 3WNEA 1X1PA 3HYFA 5KT5A 3CM6A 4KI4A 4H4MB 2ITGA 1NJYA 5T7BA 4PUOB 1RCHA 3ASMA 2XI3A 4Q0BB 2FC0A 1IKYB 4GW6A 1S97A 2BE2A 3OYFA 2NUBA 1VSIA 3OS0A 1SV5A 3DLKB 2W9BB 3MECA 5JUMA 1D9DA 4NLOA 2AGQA 1JL1A 1X9SA 5EU7A 5J2MA 2HWIA 3NKYA 2HHVA 1RTIB 4NCGA 1Q9XA 2UUTA 5KFDA 4E3SA 4CJ3A 5F8MA 1QUVA 3WNGA 3LP0A 3Q8QB 3NGIA 1CXQA 2I5JB 4E0DA 4JV0A 4EBDA 4WZMA 3K5NA 2GC8A 4DSIA 3DRSA 3SQ4A 2ZE2A 2YKMB 4DTSA 1ZETA 1HNIB 4RUAA 4RU9A 3ZSRA 4B9UA 3HXMA 4ECTA 3I5BA 2UVUA 1JLGA 2BQUA 4KHYA 3M9OB 4IFVA 1WNEA 2DY4A 4AHUA 4FS1A 1SL2A 2AWZA 3SV4A 1CZ9A 4FLXA 4DQPA 4I9LA 5KFHA 1C6VA 3FFIB 3HVAA 1ZBLA 4B9MA 1U48A 1LW0B 3QIPB 4JRPA 3MXMA 2W7PA 1RT7B 3VQEA 4K4VA 3SI6A 1JLCB 3LZIA 3V9XA 4QOZB 4ZP9A 5KFFA 1T8EA 2W7OA 4FJLA 4CJKA 4N76A 1N5YA 1U04A 4M3RA 4Z4CA 4RW8B 3ZT1A 1JLQB 4FZYA 5F8LA 3T3FA 1JLFB 1RBSA 2JEFA 3CFRA 3RRGA 3MXIA 3NH0A 1BL3A 2KZZA 4FS2A 4EZ9A 4TY9A 3OYNA 4KHSA 3NDKA 3BR9A 2ASDA 4XPEA 4FLWA 1REVA 2BRKA 2Z1GA 1TK0A 5I42B 3M8PA 5JS2A 4ELUA 2RF2A 4NLWA 1KHVA 3EZUA 3IGVA 1VSJA 3RTVA 3ZT0A 4MH8A 4TY8A 1GOBA 1CXUA 4LQ3A 1UA1A 4M3ZA 4B3OA 1TQLA 3KK2A 4CF9A 4OGCA 2AGPA 3TARA 3DRPB 2AU0A 4WZQA 5KFBA 2VG5A 3CIZA 3AVKA 1HMVA 3MEGB 2ASJA 2IM0A 3QEWA 4DF4A 1HJRA 2P1JA 1D0EA 3V81B 2VG6A 2G8KA 4BDZA 4FK2A 1TV6A 3PJWA 1S6PB 2X78A 1U45A 3GV7B 1L3TA 4E1NA 4FLTA 2WONA 2BANA 4B08A 4PQUA 3OSNA 4KTQA 4CESA 4CGFA 1KLNA 1ASVA 1VSMA 1A5WA 4K50A 3LWLA 1KLMB 4W5TA 4B9TA 4YFUA 1BQNB 4JUZA 3BSAA 4RW7A 4KAZA 2D0CA 1Z25A 2HHUA 4JLHA 3VQAA 1SUQB 5CZ2A 2BQ3A 1QQCA 4NLXA 2A1SA 1C2PA 4O3NA 2V4RA 1SH2A 1S1WA 1VSDA 4DSLA 1N6QA 1B9DA 4IBNA 2EC0A 4M3TA 4ID5A 1S4FA 4RW9A 4ZVEA 3GIMA 3VQQA 1T05B 2YHAA 5C42B 3QZ7A 4ED7A 3I8DA 2HHQA 4LY7A 3PW5A 3K5LA 4H4MA 1Z26A 3ZT4A 2D41A 2DPIA 1RTDB 3V4IB 4BE1A 3VA3A 2DFFA 3NH2A 3KTQA
chains in the Genus database with same CATH superfamily
2R7WA 3W9IA 1IR2A 4ZN1A 4QYZK 3AH6A 3QT8A 2GVDB 4WFAL 1HQUA 3C15B 3DLKA 5F3ZA 3G86A 5AJ3K 1R0AB 1H2VZ 3PW2A 3KG0A 3OYHA 3DOKA 1YXQA 1G3OA 1WSFA 2X51A 1R59O 2M2BA 2D5RA 2P51A 3EPIA 3QLHB 3ID8A 4V19S 2DGVA 3VGUA 3NS6A 2I5JA 4B3RK 4OZ5A 3ZSOA 4Z4EA 1BHLA 1XMOF 3JSBA 1FT8A 3EGVA 3O4QA 3SUPA 4PXBA 4GNIA 3ETOA 2DRBA 1QSSA 5F3TA 4DQQA 4CGIA 1CJVB 3GCXP 4I1TA 2XYGB 3ZTOA 4MK8A 1MN7A 4CEDA 3OXFA 1X4EA 4RUHA 4OX8A 4EI2A 1JQGA 1XHXA 4ED0A 1UW4A 4BRPA 1ZS6A 1WG1A 5CYMA 4CHOA 4RW8A 1P27B 5HANA 2ALZA 2H54B 3O5BA 1VJQA 3CCZA 3DU6A 1VHFA 3MECB 4WYLA 2CQCA 1NHUA 2CWKA 3FZBA 2J8SA 4RNMA 4DR3F 1J5EF 1E4GT 1VQOS 4C8NA 1N34K 5BYRA 3L4BC 4CFAA 3MMAB 3QO9B 1SBRA 2YVSA 4OVLA 2BE7D 1U2RA 4R0EA 1TKXA 2DNGA 2JNJA 4IJAA 2APOA 5DO2A 2ZE2B 4BVPA 4EUVA 3Q0AA 4UZBA 4QWCA 2XO7A 2BMBA 2OCEA 2LA4A 1W2BR 3ZEUB 2CQ4A 1QAJA 2ZUAA 3CCRN 3DRPA 4FXWA 5RUBA 1TL7B 1ZAXA 3BP8A 4KIAA 3G71N 4RNOA 3T1HK 3M6VA 2A2CA 2FHOB 3OD2A 3CJAA 4FK4A 2FY8A 3W5YA 1HNXK 2ZD1A 1Q86T 1LWXA 3CCQN 3BYPA 1N5YB 1NMEB 4CF1A 5EWFA 1YJTA 1KVJA 4Y2IA 2RU9A 4CJUA 3OJUA 2E2NA 3TPQA 2OFHX 4OIXA 4C3KA 2J7UA 4RWWA 1KLMA 4KH6A 2A41A 4EIAA 3BN4A 2VWBA 4ES1A 4FSVA 2P9NB 2QWRA 4CJLA 3C7NA 1VRTB 1NNDA 5M1NA 3VAMA 4QZVB 1W9HA 1WOSA 3FK4A 2GIQA 1KONA 1X0FA 4E98A 2EBEA 3LUYA 4FF1A 2GVZB 1EWRA 1OY8A 1LAVA 3O3FA 3AARA 2J5AA 5AXKA 1TFWA 4X66K 4OQJA 3AJ2A 1RWMB 3VQCA 1RHQB 5BRHA 5KPZA 3GYNA 1VSEA 4CF2A 4FLYA 1XWLA 3F0NA 4YN3B 4M5JA 2E1AA 4ZVUB 4BQZA 4PKGA 4G1QA 3MEDA 4ZVGA 1PSDA 4NRTA 2IM1A 2AYMA 2VU5A 1BXNA 1CSJA 1RDCA 3HP9A 3R3LA 2ZEJA 3KKSA 3VQ5A 2PFFB 2KKHA 1VGYA 2ZH5A 1SQGA 3PLAA 4E2FB 5F0XA 2I9SA 4K4YA 4M3XA 1VRUA 2UUCF 3RW7A 4B9QA 1TUUA 4EHUA 4KO0A 1N4LA 2FJBB 4FZZA 3K59A 3BO2A 2JFKA 3DXMB 4X65J 5A8WB 4H5VA 1YAGA 4RW6A 2VODA 5HROB 5ADXA 5F2RA 4F3TA 1JMTA 1UL3A 2EXUA 4GC7A 4RW9B 5GADU 2H4WB 3G25A 1HKCA 3PYEA 1NSPA 3OV7A 2QLXA 5KFTA 5J1NA 1LWEA 2NPIA 2RE2A 1U6FA 2K8GA 1ATNA 3J80O 3IBCB 5A8KA 5CCLA 2Y0SD 2WOMB 4DR2F 3QB0A 1MU2B 1RT3B 3HJVA 1F21A 3ZNUA 5HQ8A 3PX0A 4TQSA 3ZSVA 5M2UA 2QTWA 1AW0A 4Q5VA 4AM6A 3Q8YA 3NS7B 2UXCK 3QZ8A 1JKHB 2P9PA 2XTJP 2O8CA 4FJ5A 4YHHF 2ACMA 4Y2AA 4DR1J 5C2FA 3ET6A 2WUSA 1YI2S 1RBRA 3IKMA 4Q2LA 3NCPA 1OQ6A 2XHBA 3W7BA 3M8YA 2JGUA 3DNCA 2CG8A 4IG0B 3ZZRA 2RQ4A 2A0FB 4AHRA 1RHKB 1RUSA 1TVRA 4E89A 1VFJA 4ECUA 4ER8A 3M30A 2JFDA 3MOJB 1CJKB 3FQKA 4IFYB 3NHGA 4G3IA 2QIFA 3QFHA 3RR8A 2ILZA 3THVA 1WSHA 3L4QA 2J9CA 1R89A 3OBIA 4OO1J 2KU7A 4DV2K 1VCTA 4BE2A 1FCAA 3DC2A 3N0VA 2A5XA 3V1RA 3NMAA 1SC1B 1HX1A 1BGXT 1A5VA 2FBYA 5CCMA 1C0TB 5LOQA 4DU4A 2BKOA 4WYWA 3CJ4A 3E8OA 3SPZA 4QYRA 4RG8A 4IDHA 3OY9A 2NQPA 2HNZB 2A40A 2FPHX 3NOCA 5K14A 1TKTB 2DIUA 3ZZPA 4B3TJ 1NJWA 1WOQA 2CADA 4LMZA 4M5MA 2QA4N 4GRSA 2KB2A 3RBXA 3T69A 2OAUA 3NMRA 3DXKA 4IQXA 3PG9A 1S76D 2C1EB 3B6OA 2W9CA 4MLEA 1VQ9S 1GNKA 1C1AA 4GVBB 2J4RA 5AE2A 5FDLA 3K2YA 4RL1A 3KUEA 4ED5A 3G2XA 2C3PA 4O0IA 4JI0K 1R27B 2DRAA 2GHVC 3RAXA 3R6MA 2YKPA 3TJ9A 3GQCA 1UPPA 5JVGQ 1NOZA 2XZDB 4TLRA 4GO5X 3D0GE 4FPRA 2OFGX 9ATCB 2FTRA 3WQTA 2ZWOA 2DTUA 3QYYA 4F8RA 3W0LA 4LSNB 3GCWP 4U8VA 3N6MA 4QS7A 3OVSA 1L5UA 1C0UB 1GK8A 3FRYA 1FXLA 4CFCA 1XNQK 1HD0A 4JKAA 2KFNA 5IM0B 3ITHA 1R43A 2NYHA 4YB1P 5I3UB 2XMAA 3O1BA 3MR6A 4WTOB 3CG7A 5AZIA 3V9ZA 5BR8K 3PO5A 3LP1B 2CH6A 5KPRA 1HI0P 1NGJA 2RT3A 1NH7A 2NZCA 3SBMA 4P74A 4WK3A 3O2IA 5FJ4A 4LSZB 2WB1D 4KTWA 4M3UA 2QWPA 1GLLO 1NJXA 4DV0J 1LFWA 4PG5A 3ZSYA 3HSDA 4X4VA 3NGDA 5AQUA 2Z2ZA 5CZVA 4M3YA 3JYTB 1RADB 2HWTA 5GMDA 1NDLA 1VBYA 4L3QA 1RBTA 1EWQA 5AQFA 4DTRA 3AVHA 3EM1A 4NWBA 3V2UC 3U3YA 4Y00A 5HL7L 3VZHA 4M5LA 2O8DB 3MD3A 1A5XA 5FPMA 5GAHP 3HULA 2ITMA 1YIJS 1IXKA 2NR0A 1VI7A 1ZBTA 5C7PA 4OZ1A 4DQ8A 4USUA 3LM2A 1NNEA 4ZVRB 1NGDA 4IRDA 2HIYA 1NGCA 1M5OC 3K57A 1PKUA 5CABA 1TL3A 2IIHA 3EGWB 2Z1HA 2HPUA 4YMEA 1UMJA 1YJWS 3GZ7A 4OV6A 2C22A 3VQ9A 2ZM6K 1C0MA 5LJWA 5HATA 4DR7K 3HHKA 2PI4A 2RRAA 1SQKA 1TMMA 3D6HB 3ZNJ1 1RISA 4MYUA 4URSA 1UP1A 3EVWA 4ZPDA 3TZZA 3H3NO 4DCHA 1U4BA 2Y1RI 1SAZA 2HGLA 3KNGA 2H1YA 4Z94A 2DHXA 1NSKL 3THYB 4ID1A 3NGSA 3D7EO 4ZCKA 3KD5E 2YPYA 1RHRB 4QWEA 3EZ5A 4O5FA 5ETSA 3CO0P 3ZTPA 5KFSA 2R2RA 3QBCA 4LF9F 2BJ8A 4JV5F 3AY9A 3AQPA 1DY3A 1EQMA 5KFEA 2IDLA 1GLDG 4Z4FA 1VISA 3K5PA 2N7CA 2ZFHA 4OHVA 4NO7A 3DLGA 1JXLA 5KFIA 1WTBA 2CPDA 2OPRB 1KVIA 5EX5A 4BRCA 4DB3A 2QN6B 3LDPA 5L1JA 5KFCA 1GLFO 3RZAA 1UFKA 2DITA 2DNKA 2V2VA 4IFEA 3I6PA 4USWA 4MFBA 3I9ZA 3CPWR 3IG1B 1W97L 4JK7A 5AR0A 4YB7A 3M2VA 2HQFA 2OPPB 1QUPA 1U0HB 2E1PA 2IVPA 4EK2A 2LXFA 1EB0A 5E41A 4FJ7A 1FTCA 3GE1A 2BJ1A 4BHQA 2HZVA 3NNHA 1BCOA 2X1GA 1S4EA 3TVYA 5IZHA 2CYYA 4AHCA 5MAOA 4NXMF 4WFZA 2ZH4A 3A8EA 4YOVA 2C3YA 2LXIA 4GKKF 4JI1K 1S6QB 4CP5A 2X6SA 1NDKA 5LMNF 1RT1B 3UWTA 3MAHA 5C2DA 1VQ8S 4LUBA 1QE1B 3CJTA 2I8EA 3EPGA 3Q8VA 2Z2MA 1Y3KA 4KKOA 2MSTA 3HPGA 4B9VA 3OR2A 2MLZA 5C25B 2FF6A 4XTTA 2W01A 4R8UA 1YGYA 5B0GA 2OKQA 1X4CA 2B8QA 3VV2B 3HHNB 4JI8K 3SCKE 1SH3A 1F5CA 4DR6J 3DLLL 4PQAA 3DLEA 2BR0A 1KHWA 2XULA 5J2NB 4AE5A 1SJQA 1JLAB 3OXLA 5G0RA 2ZKTA 2H65B 4DPYA 5GADI 3BZKA 2MQPA 3CJ7A 3V6JA 1FJEB 1YI2N 5J2QA 2CQHA 1VK3A 2H5EA 4NPOA 4AHSA 3QRRA 3H4BA 1NPRA 2DEJA 3NF8A 4FJMA 4YUDA 1UVNA 4J9RA 1Q8BA 5ETPA 3HVTA 1HW8A 1FNOA 2FHJD 2EWSA 3SFUA 2J76E 3N4QA 4ZP6A 4PG6A 4DUTA 1ATSA 4ICLB 4CLLA 1B99A 3CULA 2YX6A 3KLHB 4BRDA 5ETVA 1K44A 2RILA 5T14A 4OI0A 3T1YK 4JKCA 6FD1A 3T9NA 3FUYA 2OI2A 4DU1A 5AQMA 1VLYA 3UN3A 1NU4A 4IRKA 2CQ0A 1RTHB 4LVNP 4ZDNA 4WF9Q 2K3KA 2ASLA 1XMOJ 2XZTB 2KW4A 2QX0A 3C6UB 3RWUA 3HD2A 3D2FA 4I9QA 4DV3K 1KCFA 4OYXA 2DNYA 3AO2A 2YH0A 1V4SA 2GZOA 5A0YA 4C48A 1U1QA 1A6LA 2QYCA 4BWJA 2KG1A 3UO0A 1XR7A 1ITGA 1VAZA 1HWUA 1YRXA 3NLCA 2YNFB 1K8AO 1VQ9N 5F8HA 3SUQA 4OYPA 2AJFE 3HI9A 1IKVA 1EP4B 5M1OA 3D45A 5ETNA 3IWLA 1QS4A 1WSRA 2O5DA 2O8BA 3PSFA 2ADCA 3BF4A 3L7PA 3G6YA 2A1BA 2A6MA 3AD8C 4RZRA 3PFEA 2BEFA 2GJIA 1GLAG 3D0PA 3D2EB 3ZSQA 2YKQA 4DR3J 4O4GB 4WKRA 1J5EJ 2G0JA 2D7SA 2DCUB 4I7FA 2P9LB 4DV1F 1SI9A 1UZHA 1GOCA 1I39A 3V1OA 5SUHA 3DLRA 3M8QA 1Y00A 2E5JA 5JJBA 4FW2A 2XMTA 2YNGB 2A18A 4DG1A 2CVEA 2RMLA 1A9NB 4HTIA 4WK1A 4MO4A 2B3TB 2CJBA 1S5JA 3AO4A 4B3SK 4LF8F 1EXQA 1F1BB 2P9KA 3GLJA 3LW5C 1DURA 4ATNA 2VONA 2PYLA 1T3VA 2YNHA 4LSLA 5KFYA 1KAXA 4DI6A 1Q9YA 5LJ5Y 2IVMA 5BREA 5C24B 5KFMA 4DEZA 2F8TA 1H2UX 1Q79A 2VJVA 3CJ3A 4JI4K 2MZSA 4YDDB 3Q8SB 1P9YA 3D1HA 1DFDA 4JI3K 3R5BA 3TSQA 4NLBA 3DOLA 2AJ4A 1EX4A 3KK1B 3MN6A 3DMJA 3O3HA 4EO8A 4Y28C 1XC3A 2ZH8A 5KQDA 3NGTA 3AOCA 2VKRA 2YX7A 3PV8A 1WC1A 2C2KB 2NYIA 3IAM9 4DBQA 1YIJN 2M7SA 2FB0A 4QS9A 2CJKA 1NGIA 4TYBA 4USTA 3CWJA 3RB4A 3T1AA 1TAUA 1FRJA 2JLGA 2ZOGA 1JNRB 3S41A 3V6HA 5KT3A 2QL5B 1ZAVA 2B4VA 5GAGU 4HHUA 2YY3A 4WKYA 4KSEB 1GTHA 4NASA 2CWXA 2FLNA 4C8KA 4UY85 4NLGA 3PKMA 2KHOA 1C1CB 3O8WA 4O44B 3LGNA 3OYCA 3IP0A 3H5UA 3SCXA 3WXKA 5ETOA 4A8MP 1R8PA 3T5KA 2KXHA 5AQQA 1JLBB 1L3VA 2VGMA 4LFCF 1HPZB 2O8FB 4FYDA 4ED3A 3WXIA 4OHXA 3HKWA 3NGUA 4DR4J 3SJJA 1UTAA 3T7ZA 3QEIA 4AM7A 2E5LK 5ELZA 1RU1A 5DM6Q 4BQLA 1FVQA 3CD7A 4OLBA 3VF2A 3TR5A 4RTFD 4O5BA 2R3VA 4JB8B 5D3GA 2EEYA 1P90A 1UJ5A 4CBUA 3VEYA 1CJUB 1MMDA 1N32F 1U49A 3IUCA 3AB4B 1FK9B 4JI6F 3T9ZA 3RMCA 4JS5A 4F3MA 1P8ZA 5LT5A 4LT6A 2OSRA 2DEIA 2FF3B 4PG4A 1S48A 4USKA 4Y1DA 2RDIA 3M32B 4HUGA 3SCLE 2GIFA 1HBUB 3QESA 1WOPA 1XK8A 5EXWA 2UXBK 3BF1A 4FM0A 1N5VA 3BKTA 4DR2J 2F9TA 2JJ4D 5EN1A 1IKYA 3ALYA 4OI1A 2V51B 3HHEA 5B0FA 1QD1A 4CO1A 4GMJB 2B9YA 2JLFA 2HSTA 4IG3B 3IN5A 2PA3A 3LPUA 2GFFA 4PXDA 5BN9A 1WI8A 1R0CB 5KFQA 5CYQA 3OTEA 2VC1A 3EX7B 3PX6A 5EVZA 1HBMB 2CPIA 1B92A 1FKAF 4A2AA 3CCVN 2JRSA 2W6KA 2OTJS 5DZ7A 4UOFA 2AMCB 3TEHB 2ZC4A 2GA7A 4DDFA 3KLIA 2VA2A 2Q2RA 4UUXA 3C6AA 1BQMB 1SL0A 4XPCA 3I56N 3AO1A 3FNNA 3G6VA 1CULA 3Q24A 3UQSA 3IWXA 4FPIA 3HHLA 3EEQA 4HR2A 5J1EA 2V7YA 3OR1A 1GT8A 1PG5B 2YBVA 4KFBB 2ABYA 2KI2A 2WC9A 3LM9A 3OTBA 3H25A 3DYAA 5KFOA 4Q43A 2C2DA 1M5HA 1S7HA 3B4DA 2DH8A 4ED2A 4QIVA 3HFZB 2BE2B 1F5AA 2PMHA 4PHTX 3PEJA 2AW0A 3T1HJ 1V3ZA 2K2PA 5H9FJ 4NCBA 2C2RA 4DV6K 3UDLA 3EYZA 5CHCB 1NK6A 2R8KA 4NA2A 2QZ8A 3FEYB 3NWRA 2O8EA 5AXNA 3G82B 5AQKA 2OEMA 2WSFC 4MJKA 4EO6A 2XMUA 5EX3A 1NK8A 2WHOA 5IWAK 3LAMA 2V0NA 5AQHA 4F3OA 5DM7Q 5D4OA 3FSXA 1QQOA 2J0WA 4KB1A 3MCNA 4OKEA 2PY5A 2WTUA 2GS8A 1SJRA 3H8YA 3M6UA 4FWLA 2W40A 3IBWA 1N52B 4CHPA 2VFVA 1U2CA 2DK2A 4NLTA 3CD6N 4BDPA 3KJVB 1HBNB 3V81A 3RVCA 4OPJA 4CD1A 4J2AA 2HS4A 1Q7YO 3R1HA 2F4VF 4DF8A 4RW4A 2B56A 1UVJA 3P1GA 4EWTA 2RS2A 2Z1IA 1DKGD 4CJPA 1N36F 5DETA 4OHZA 3I4PA 1KC8T 2PGCA 3G10A 4LF2A 5M2PA 4A8FA 5JVGL 5LXYA 4F26A 1HRHA 3EUNA 3K0SA 1RT2A 2B5JB 3TWZA 1VQ5S 3AODA 3TUZC 2H9ZA 2KFZA 1BWEA 3M9MB 4F4ZA 1Y5IB 4RX6A 2AJQA 4RNNA 5GAGP 2KYXA 1IBMF 3THTA 3KHLA 3HFKA 1IJFB 3LH2S 3DM2A 3TW0A 4LFBK 3BEGB 2MYFA 4FJNA 1NGHA 2GELA 4DN0A 3CUNA 4EFHA 5KFNA 4CECA 3O9UA 4YY3F 4QR2A 1NGEA 5H9EK 3ZYYX 3CJ0A 5KG1A 5DDOC 1IUJA 2ZOFA 3MM6B 3H5XA 3OJSA 3IR7B 1RTDA 4ZPAA 3MDQA 4B8AB 3THWB 3K17A 2P8IA 1RWWB 3M2UB 4C0BA 1AUSL 1UW9A 4O3RA 3FE1A 3DRYA 2O01C 2J0QD 3RRHA 1JCGA 3IM8A 3S8SA 5C15A 3I33A 2F3JA 3Q22A 1JB0C 3IAS9 2LQ9A 1UJ4A 4BRGA 3TI0A 1IM4A 3A8KA 1AA1B 3NP5A 5GAEI 3FCVA 5F8GA 3OYEA 2RKIB 4U8YA 2B0GA 2V8VA 5LXRA 1OYEA 1JJ4A 3VAGA 4ZVFA 1O8BA 2Y1IA 4K41A 1YTAA 4PL7A 3TA2A 1K1SA 2C28A 1D9FA 2D9OA 3AVAA 4KY3A 4QWAA 1ZBIA 2HZAA 3L2QA 4USJC 3V6DA 3PVXA 4GV9A 4CIFA 3OYKA 3TRGA 2UXCJ 4NXNK 3CCJS 4DUYF 2QT7A 4H54A 1BC6A 1KOOA 3MM9A 2HQ3A 4P6QA 2LEBA 4I0WA 4X64F 3HYFA 4IYQA 5KT5A 4LF9J 1UETA 1NJYA 4JV5J 4ETXA 3N4WA 1KTVA 1RCHA 3KWMA 2VD3A 2XI3A 3TUJC 4ZN3A 3JQJA 2HHHK 2NUBA 1CEZA 4BRQA 4A8WA 1MN9A 1CS4B 4NZ6A 4QIWD 1RWVB 3H42A 2PC6A 4W90B 1D9DA 2LA6A 3W60A 4M5HA 5J2MA 2LXUA 2R7VA 1B64A 2YXLA 3HLUA 4OZ2A 4LF6K 5KFDA 1Y10A 4X4PA 4FPBA 2CJAA 5D77A 3P38A 4LRFA 1QUVA 2DIVA 3Q8QB 5GAGI 2H5IB 4WZMA 4I6AA 3SQ4A 1OJ4A 4O8UA 3ZSRA 3CCES 1P1LA 4ECTA 4R25A 4IFVA 4FVCA 1WNEA 4DX8H 1TUVA 8ATCB 1B0PA 4GKKJ 2MQOA 1MWZA 2HFZA 3Q7BA 3B78A 1ZBLA 3IR5B 4B9MA 1RT7B 1JLCB 3LZIA 1TUGB 3V9XA 1T8EA 5KFFA 3CC7S 4FJLA 2FZGB 4N76A 3Q89A 4YEAA 5A6PA 5F8LA 1RBSA 2F40A 4U67Q 4CLSA 3F2KA 1MLAA 2KZZA 3BH7B 3VENA 3AD9C 4OZNA 4TY9A 4M5NA 1E6YB 1REVA 1FHTA 4ANEA 4DHYA 4ZVTB 2Z1GA 4OJHA 3M8PA 2M8HA 1NUEA 1YZ6A 2RF2A 3IFEA 2V6AA 3EZUA 2ZVSA 3CCWA 4NI2A 4DU7A 2H4YB 3KK2A 4CF9A 2OTJN 4OGCA 4LF1A 3R9LA 5DS7A 3X3UA 4C1NK 2CQBA 3MM7A 2VG5A 5FLXO 3CIZA 1HMVA 5BR8J 1H0HB 1QVFM 3HX9A 1CJTB 3J80U 3N4PA 3QBWA 4BROA 1U45A 1L3TA 5ADZA 3D4JA 1WHWA 1N0UA 4PQUA 3BPSP 4ZIWA 3VGSA 4KTQA 4CESA 3LA0A 2FDNA 4X4NA 2YHXA 1P8GA 3C3LA 2KN4A 2P6SA 4PEOA 1ZXOA 1A5WA 4DZ6A 4IQMA 3EJMA 3D0HE 3FBBA 3NMUA 4LF5F 2CQ3A 3LWLA 4FWMA 3UDVA 2ACYA 4W5TA 3OTOK 1BU6O 2AP1A 1Y5LB 4I6YA 4I6MB 1SUQB 5CZ2A 4RBUA 1TUWA 4KQZA 2A1SA 2GQCA 4QIEA 4X4QA 4O3NA 3PCOB 3CSKA 2FQQB 2QGFB 4QPTA 4E8UA 3GFYA 4IBNA 4M3TA 1S4FA 1R8BA 2QEXS 5M1FA 1S7IA 4XH4A 3A13A 1YF5L 1T05B 5E7OB 2LU2A 2ZM6J 4DR7J 1UZDA 1R6VA 1Z26A 4WU2A 2RRBA 5M1QA 1HWIA 3UKRB 2E1ZA 1WWHA 4WF9L 1RA6A 4NLUA 1OYDA 1RA7A 2OELA 3D1OA 4CK1A 2ETJA 1XNRK 1IG9A 1YVFA 3JSMB 1TFYA 2CH5A 2Z57B 3ZTSA 4ALZA 1JLEA 4FWSA 3HOTA 1HW9A 2XS2A 3U3GA 1RTIA 1HHSA 4IDKB 4ZJLA 4DV5K 1VJWA 3R5GA 1IBCB 1RACB 1HNWF 4BWMA 2NCKL 2NLWA 4HHJA 4JYAF 2XMMA 3NGRA 1HNIA 4EP5A 2BJDA 4WE1B 3D9BA 3CJ5A 1BQXA 2MB0B 3UD3P 3BDPA 3FEZA 1GMUA 4X4SA 4XEIA 4J91A 3OVNA 4LIRA 4M1KA 4YOWA 4KHPF 3MX2A 4OFZA 3GOIA 2FVCA 4PCQA 3BR8A 3U1MA 1HKGA 4DSKA 4NZ7A 4DL2A 1ZTWA 3IWNC 1HNZF 3AO3A 3FEXB 4ZTFA 3RB6A 3PR4A 2M52A 3H5YA 1E6VB 4DTNA 1JLQA 3OUYB 4OX7A 3EN9A 1EZZB 1IO2A 4IJNA 2KYZA 2AZ3A 5FD1A 3J7AP 2XMJA 1DTTB 1VSFA 3UE5A 1H7WA 5E3QA 3ENBA 1RT4B 1DTQB 3SSQA 4NCGB 3ZCMA 5BPMA 4C8LA 2IRXA 3AXMA 2OANA 2QWNA 2IRYA 5FIIA 3DGVA 1U2VA 3AA8A 4A8QA 5BPNA 1NH8A 4P52A 2OPSB 1RJJA 2F1FA 2FUG9 3J81O 4PG8A 1JLGB 3ENWA 1RQ0A 4JI8J 2H51B 4Z4HA 3CMES 4AILC 3VQPA 1YTUA 2YKOA 3F9KA 5CXTA 3O9RA 2UXDF 4IOCQ 3GTYX 4ZVSB 5E26A 4AUKA 3HK2A 2IY5B 2A3ZA 3AB2B 2L9DA 1L3UA 1O6XA 4HL9A 1WUAA 1S72N 4H5TA 3TAQA 3IAYA 3PO4A 1KP6A 4LFCJ 1EO1A 3TVZA 2QI2A 4G65A 5EDWA 4B9SA 2G4BA 1YKWA 2F9JA 2VUGA 1QHTA 3QWUA 3CJKA 3KVGA 3VERA 1U1OA 2VQEF 2VFSA 2P9GA 1N32J 3BSNA 2DNOA 5L38A 2YTCA 1S1XA 1FKOA 3AAPA 3GILA 1W2IA 3HKZD 2B4PA 3U4LA 2BW7A 3KHGA 2B4OA 4B3OB 3BGLA 2IVNA 2R2TA 4JHDB 1LW2B 3CW2C 2NXCA 1NM2A 3M05A 1S3XA 3PJXA 2GCFA 5DM6L 2VFRA 3CCEN 2W4CA 5FROA 2U2FA 1S1TB 2HGNA 2FBXA 3LP3A 2VF3A 5C12A 3QAUA 2VG6B 3ENOA 1J6ZA 2UP1A 4OHWA 2E6MA 1DT9A 4FM1A 2BUPA 2WONB 2IA0A 2N3LA 2OJ3A 1VMBA 2QFJA 2WVDA 4CO3A 1GH8A 5DK5A 3PM9A 3GJRB 4KGXB 3R5DA 1GEHA 3QLHA 2ZDPA 3OYJA 2D3ZA 1RAFB 4KPYA 2YKNB 4RW7B 4AL6A 3CIMA 3DWLA 2MZJA 1ZC6A 2W2QP 4CO4A 2GGPB 2HBRB 2RHSB 2HVZA 2QKBA 1JXEA 1IWAA 1G2EA 1FWKA 3CD5A 3O9QA 4OZJA 1YJUA 1CJVA 5EGYA 2DXDA 3P45B 2G8IA 4ID5B 3SFGA 4CH1A 1LWFB 5FPDA 1TZ0A 1QSLA 3O3LA 4ED1A 4LF4F 2QKKA 3MZIA 1RKIA 3P3DA 2D69A 4B3SJ 2C2NA 4KHQA 2V2QA 2G2YA 4B9LA 2JEJA 2XY6A 1HQUB 2V9WA 1QZ5A 4E7IA 4ZPBA 2F4FA 2R8GA 4X65K 3G8QA 3AVFA 3DOKB 3KLFB 4YDXA 2F7TA 2J9DE 3QO9A 3MMAA 4C8ZA 4BRMA 1URNA 4JI4J 5HN0A 4CZMA 1YX2A 2IMWP 5HBMA 3OL9A 4CF0A 1VSHA 5KG3A 4Y1CA 3HL8A 3LDNA 2DHSA 3O4WA 2YWEA 2BKPA 2Y9HA 3H4DA 1UOCA 2HMIA 2RN2A 2HHSA 1AB8A 2PBDA 2W2OP 3ZEUA 4OJRA 2ZBCA 1VBKA 1FRIA 1VC6A 3MMBB 4AD6A 4CJ4A 1F6TA 4U7UK 1WKJA 1Q82O 3VQ8A 1FO1A 1S6OA 4JAXA 5E33A 4ECQA 4UT4A 2CNLB 1XEZA 4HLBA 4I2QA 3N5FA 3FJ2A 5C2CA 3G4SS 5AQLA 1JCEA 4I2PB 1QZ6A 4IEIA 4C2MA 4H0YB 5CYMB 2QEXN 4WP3A 4FZXC 3FGVA 3WXMB 1J5OB 4K43A 1MA9B 2PEHA 1NKEA 1YJVA 3MPYA 4AHTA 3W63A 2GUIA 2DGWA 1N36J 3P39A 5DM7L 1KVAA 5ADXH 9RUBA 2BX6A 3CMQA 4PY5A 4Z4IA 3M4XA 4QR1A 2P9NA 3QGPA 1ZM9A 1VRTA 2W41A 2D4WA 1NDPA 4LR9A 3NAHA 4HACB 3FFKB 1TKXB 3ULDA 1CZBA 2QV6A 1O5JA 1UEKA 2EW9A 4LRDA 4UW2A 2BUNA 1TGOA 1LWCA 4CJSA 2K3IA 2D0OA 4K0KF 1F9EB 4HT5A 1IBMJ 4ECSA 1RBVA 4FKYA 4YOUA 2MKSA 3T19A 1H98A 2K7JA 5EY4A 3LP2A 4M8LA 3MPWA 1U1PA 2JWLA 1RK8A 4YY3J 4JI7F 3AGRA 1XR6A 4QIGA 3R7NB 1VBXA 4WXOA 4CLKA 4USIA 2E5HA 1U1NA 3L09A 2HHWA 2ZD1B 2AYEA 3SIPB 3K2PA 3NGYA 2NZ4A 3RG6A 1X9JA 4B3TK 2XMVA 3F5TA 4I4BA 5AQWA 4FWKA 2V94A 1HUXA 3QNNA 2OUGA 1HQEA 2KH9A 1L3KA 4ZP8A 3UR0A 4BRLA 2YQ1A 4CLUA 2CFXA 4C7QA 1ROFA 1YT3A 2OD4A 3CQ8A 4Y65A 3C7NB 3K58A 3QICA 1SL1A 2UXBJ 4CH7A 1WKKA 3FCWA 1CC8A 4MKVA 4OYBA 1MG7A 2QC3A 5I9EB 3ZO7A 5HROA 5JMVA 5B0CA 1JNZB 1DLOA 4DWIA 4WXWA 3L9ZA 1VSKA 5B0BA 3I55S 3CXCM 1EKEA 4FDFA 3E2EA 3C16A 3WX4A 1RDBA 1WB9A 4ZHRA 2Z58B 3KHRA 4ES3A 4X64J 4ZA1A 1V5VA 1OPIA 3SI8A 4OHYA 1NJIT 3OFFA 1MU2A 2FXUA 2GAGC 3VEWA 4G1QB 2E9RX 3MEDB 2HHTA 4C6AA 1S1UB 2LU1A 2GBZA 4ILHA 3GG4A 1U8SA 2F8SA 4LQ9A 1T9XA 3H98A 4LRAA 1R31A 3RB3A 3C6TA 2LDYA 4P2MA 1JKHA 2V34A 3CJSA 4OYAA 4R79A 3GV5B 4MK7A 2BH1A 1H74A 2XGQA 4FLZA 2HRTA 1WN7A 3TO8A 3CDUA 2HVDA 3MMJA 4NLVA 4KO0B 4CWBA 3R6GB 1ZOTA 4CEZA 3I0SA 4DV4F 4RWXA 4LC9B 1APSA 1N56A 1YTYA 1RWNB 4H4OB 4IG0A 1WD6A 2RSQA 4RW6B 4O3PA 5A8RA 4CJQA 4WIIA 1CJKA 1U1LA 1KVKA 3OW2M 1JJ2M 3MD1A 2ZWHA 4WIQA 1P6TA 2QLBB 4HI2A 2OMLA 1RDDA 3O6WA 2FZCB 3P5TL 3OYDA 3M1FA 2AD9A 4C9DA 1HL6A 5A8KB 2PDAA 3VEVA 4J9LA 4FP9A 4OZ0A 5IWAJ 4N5SA 1SIWB 3P6YC 2P9EA 3I0RB 1O0PA 4XO0A 4L3KA 1M1KT 4FCYA 5LSRA 2YHBA 5CZXA 1NXIA 3UD4P 5A2QY 2YJFA 3TA1A 4AF1A 3ZLJA 2AEFA 3N79A 1TKTA 3EXYA 2FVRA 3L3VA 3QT5A 3R8YA 1TK5A 2VASA 4BRNA 1NOYA 3ET6B 1YJNS 2EG1A 2H5JB 1FKPB 2UVVA 3H46O 3PRVA 2CPZA 2DNHA 4O3QA 3CF5Q 2WCXA 4GVBA 2ZOMA 2PE8A 2WFBA 4JKGA 1NLVA 1WORA 5ETLA 4BVOA 1RP5A 3VGLA 4PWDB 4YB6A 2CJYB 5IC6B 1TVRB 3M30B 3WX8A 2HQCA 1RT6A 4BY9C 4IWVA 2BQRA 1EARA 3V5RA 4CJWA 4BR5A 4U67L 2RUGA 3PDNA 4DL3A 1I94K 1MWMA 3QMLA 1B7YB 5BPLA 2UVRA 3W8PA 3J81Y 2V4QA 2PMWA 4FO0A 3RAQA 2HHXA 1QTNB 3PRDA 1S0NA 4HKQA 3VPZA 3RYLA 1G1XA 1BI4A 1H6KX 3GV8B 5H9EJ 3MM5B 2ASYA 4FWNA 4M63C 5K14B 3V4MA 1T03A 4LF5J 1NBWA 1URRA 2NSCA 3L3UA 2AEJA 2GMHA 5BYSA 1H3DA 3DXKB 3BO4A 3NNAA 2NZTA 2VG7A 3JQMA 1KAYA 1NMDA 5F9NA 2W9CB 1LXNA 2YCHA 2AHOB 2P9UB 2GX8A 1YITS 4F50A 3IC1A 3FBFA 3NE6A 2DR9A 3PYFA 1WSGA 4W5NA 4U7BA 3UD5A 4PKHA 3VTIA 1FJGF 3AV9A 1RBLA 1Q8LA 1HPMA 3MK6A 3J7YI 3DN9A 4B3MF 4CI0B 4O0NA 2ZBPA 3NF7A 1F3FA 1RB0A 1YRUA 2BM1A 2B6AA 1RAAB 1YJ7A 1VQLS 2ZNYA 2HWHA 2HK3A 4NXNJ 2X74A 1EAYC 4I64A 2Z2YB 1HKBA 1U02A 1XHZA 3HPOA 2MKKA 2HS3A 1JL2A 5K8MA 5KGWA 4J7CA 2K7KA 2UU9F 3NNCA 3EDQB 2P5VA 2MKYA 3TQ1A 5AZIB 4TU7A 3H2VE 3N01A 3VR1A 4M3WA 2DXEA 3MEEA 1K6YA 3L2VA 3K5MA 2FIUA 3GJSB 4F4WA 3EE8A 1Z6RA 2HZCA 3U6FA 4FWPA 1RTJA 3FQLA 3FSYA 1KQGB 2DD8S 4O0JA 1TTHB 2WBMA 3CDWA 2Z56B 5LM7E 4DFPA 1KRPA 1RT5B 1WI6A 1K0TA 3CC4S 4R0JA 1ZZNA 3C46A 1UVMA 2IVOA 4EAHD 1VRQC 3J7A1 5E3RA 3HFVA 3W5XA 4DR5F 4F4YA 1UJ6A 4MAKA 2JC0A 4USVA 3N28A 5GIPA 4DUZF 1GQEA 1XMOK 2OPRA 2IFXA 1XJWB 3H6EA 4KH1B 3NY0A 1VQYA 1D5AA 3FC9A 3BZCA 2F65A 2W2NP 4ZTJA 1KQSM 2P5OA 4B1XB 2KZMA 4ZVHA 3TAFA 1PGZA 2HFNA 5L9NA 2P9IB 1ASUA 2OPPA 3BBFA 2YH1A 1GOAA 3PR5B 3A4TA 4RCHA 3ZSZA 5F1XA 1JXBA 1NZ8A 2MQ8A 4Z37A 3DXBA 1QQNA 1WG4A 4KRWA 2ADBA 3RBDA 3OHAA 2QLFB 1TUYA 3VMFB 1NK5A 2UXDJ 2HK2A 3HO1A 3SQOP 4BRKA 2R8IA 5M1KA 3UIQA 5LY3A 4DR3K 3I55N 1J5EK 2XG8A 1UA0A 3KLEA 4CLPA 4ISFA 3KHHA 1SZ2A 3AAQA 1YVNA 5LMUF 1RFQA 2WTFA 2ZH6A 5GMEA 1KXPA 3PUFA 4MO5A 3DLGB 1KOHA 1Q4RA 2CPHA 4B02A 3WUHA 1QM9A 3OSPA 4OPHA 4OLOA 4K7QA 4ZCMA 1XERA 2GNKA 4J9PA 1QY7A 1UEUA 1RAEB 2VGNA 1UFWA 4MFBB 2VQEJ 4IOCL 3U02A 3PW7A 4BC3A 4Q7AA 1JLAA 3M2VB 1RAJA 3CDAA 2OLWA 4IH7A 4C8OA 3DDNA 2DH7A 1B7FA 3VCDA 1CC7A 3GIIA 4KHRA 2YHWA 4CLTA 2PZSA 2OPQA 3OTOJ 2DYAA 3A8JA 2VA3A 1FRHA 3GFZA 2FBTA 1D3WA 1XN9A 4CEOA 4KKOB 3P83D 3KLHA 4BE0A 5AFUA 4C23A 1CZAN 4IOAQ 4R8UB 5DLGA 2FJXA 3GYXB 1UAXA 1MROB 4KE5A 4CGHA 3TAEA 3OA9A 3CJQA 4H0XB 4NZ0A 2MPUA 3EZWA 4CJTA 2KG0A 4LR8A 2CPXA 2C3UA 1SKRA 3M6GA 3MFIA 4LF7F 1EJ7L 1HA1A 5G4DA 3EWGA 2Q1NA 2NRTA 1XNRJ 1BCMA 4XK8C 4HTUA 1B0VA 3DXSX 1IWGA 1YJNN 4CIOA 2ZNZA 1YHQN 2W2PP 5J2QB 1UPMB 3TSPA 2QO3A 2YNFA 2VKZG 1C0GA 1IR1A 4DL7A 3D66A 3D67A 4NLYA 2H3EB 1EP4A 5JLFA 2J9EA 3VQSA 4A46A 5MLCQ 4LF4J 1LAWA 4BC2A 4B1WB 1X7VA 3S9HA 3CJ1A 3K7RA 4CJVA 2UUCK 1ZBHA 4Q0BA 4N56A 4CO2A 1NRKA 4OLPA 4O4GA 3V1QA 3NCQA 2P9LA 2N4DA 5GINA 3TTCA 3PIPQ 1FRKA 1RDWX 2FJVA 2ROGA 4ECZA 5D0GA 4JI2F 5KFAA 3K8VA 2XCAA 1Y9OA 3AA5X 4BACA 3A8YA 5HRSA 2HNYB 2Y1JA 4WU3A 5JLHA 3D2FB 1SCJB 3Q2TC 2DRDA 5HMWA 3ULEA 2I7PA 4JD2B 3E3XA 3ETMA 1TL5A 4DU3A 2CQ2A 2HKEA 5A0YB 4XIUA 3OYIA 1IBKF 4DR2K 5HRPA 1X8DA 4V19X 2I38A 3P31A 4CNYA 4QR0A 1U1RA 4E7LA 5FLXU 1YITN 2JWNA 5D8HB 4FJ9A 2BGGA 4EYHB 2V68A 3PSIA 5U47A 4B8CA 3QIPA 1EKSA 4RKUC 5IFMA 1I3AA 1VIXA 4YHHK 3AA3A 3ZFVA 1AFIA 1S57A 4W5RA 2B9EA 4CERA 5AZJA 3OT9A 2G8FA 1Y64A 5FRNA 2KDOA 2NS1B 4U7CA 2V8DA 1WBBA 3LQVA 4GKJF 2EFOA 2GTDA 4I7FB 5H1SQ 1VQLN 2G2ZA 4PA1A 3DKDA 4K59A 3W3SA 3M8QB 1X5TA 3IGNA 5HMYA 3R5JB 4CBXA 4DG1B 2CZ9A 3AOAA 5I42A 2V7ZA 1NCLA 4K0KJ 3TZWA 3ELHA 1TU0B 3TVKA 4CVNE 2E2OA 4CNZA 3GIJA 4OYZA 2YNHB 3UR3C 2NRHA 1C1CA 2E66A 1X4BA 4JI7J 4K4UA 2WBNA 4NEYA 2ZBIA 1S79A 1HWKA 3NWGA 2WVBA 3VEXA 3U27A 1KVBA 3QEXA 1W7AA 4OJ1A 1U6BA 3VAKA 5H9FK 1DQAA 3G87A 2Q6BA 3CJBA 3I96A 3CERA 2O8FA 2W6LA 2Y1LB 4CW7B 3DOLB 4ITSA 3DMJB 2RNEA 3CC4N 3D5MA 2CNOB 2HFOA 5K8NA 2RHKA 3G6ES 1VQ6S 2LEPA 2EFGA 4WFNQ 4OL8A 5FPEA 2V2KA 2VQFF 2X7IA 3EZOA 4DSJA 1BQNA 4QBUA 4CYUA 1V6HA 4HCCA 2PAVA 2D1CA 3OHBA 1Q18A 4CO0A 2F5GA 1FE0A 4DV7F 4TY8B 5KTQA 3M32A 1FERA 4P7TA 3SSSA 4IR9A 1WHYA 1UVLA 3PTWA 5C42A 4PKIA 1VYAA 4U96A 1SJ1A 5DQIA 3V4IA 5JXSA 4DQRA 3T6BA 2UUAF 3POTB 2NRWA 3H3OB 1TV6B 2YX1A 4ZPVR 2D0AA 1NG9A 4PL8A 3ILOA 1FXXA 3S3NA 3DDIA 4YR0A 3GONA 3TAGA 2XY8A 3C6HA 1C4CA 1S9FA 1W25A 2HAFA 2E4LA 1HBMA 5D3GB 3TJAA 4NLPA 2XC9A 1DRZA 2ZH9A 3D0IE 5EUHA 3BREA 4IRCA 4ECWA 1U24A 3AVMA 1QAYA 3NS5A 3JTPA 3D3CJ 4LFAF 1BQMA 2R7SA 3ZXWA 1FJ7A 3J81U 2OD6A 3AJDA 3NF9A 3HHDA 4USHA 1HYZA 1I6JA 2F8MA 3U9ZA 4B1VA 2YPZA 1KVCA 5KFPA 3BQ1A 3RJMB 3NAIA 4FYYB 2DISA 1X4FA 1BWFO 1EQ0A 4KI4A 1RU2A 1IJJA 3O1LA 3SLCA 3CC2N 4P10A 1IKYB 2CGLA 2DGSA 4GW6A 4C97A 4CZLA 4FNIA 2BE2A 3OYFA 1J27A 3OS0A 1LKZA 2IMOA 1SV5A 3G9CA 2W9BB 4NLOA 2AGQA 1X9SA 1T6DA 4WYBA 2UUTA 5HMZA 1X5SA 3G82A 4CJ3A 2CQPA 3WNGA 2MQLA 3LP0A 4K2XA 2ZHBA 5HJXA 2QG9B 4JV0A 4EBDA 2LLZA 3P4UB 3K9JA 2YKMB 4DTSA 3C66A 1R8CA 4RUAA 4B9UA 1X4DA 4X62F 4WQ5A 4LF9K 2E5IA 4P7VA 1YRTA 2CXEA 4JV5K 3QFWA 1WEYA 4RUBA 4KHYA 4BGAA 2AWZA 4I68A 2RRNA 3HHLB 4OPAA 1Q5YA 3HVAA 2LQBA 3HOSA 1HBNA 3SAFA 1LW0B 4CD3A 3JAMY 2W7PA 4PWUA 4QOZB 4ZP9A 5ITHA 3J81j 1YZ7A 5HSPA 3ONQA 3CF5L 3PFOA 3CCSS 4M3RA 1IV0A 1RAHB 4PXCA 2QL9B 2F8HA 2MHNA 4OI4A 1JLFB 2F63A 3QJPA 3D7SB 1N54B 2VDIA 3MXIA 1BL3A 4EZ9A 1NO8A 1Z1ZA 4MDBA 3NDKA 2KVIA 2KL8A 2ASDA 3DFEA 4NXMK 5HVHA 2O8EB 2EVZA 4DMZA 1WBDA 1W26A 3TQEA 1TK0A 4GKKK 5JS2A 2QYGA 2CA9A 3WQPA 5LMNK 3EDRB 4NLWA 3W9HA 2BV3A 3RTVA 1VSJA 4MH8A 3R5AA 2A3JA 3OQ2A 2B51A 4M3ZA 4PYAA 4F0MA 3TTFA 4UQTA 1BD6A 1FJGJ 4Z7YA 3TARA 3BV8A 5DDRC 4B17A 3M5RA 1ACMB 3MM6A 3AVKA 2E29A 3QEWA 4DF4A 3VGVA 3V81B 4KBOA 3THWA 4BDZA 3M2UA 2HS0A 1S6PB 2X78A 4C98A 1F9HA 3KG4A 5IT9O 2BANA 3D68A 4B08A 1AT1B 2JVOA 4OV1A 4RLEA 3D6RA 2FGCA 1H72C 1ASVA 1VSMA 6FDRA 2HRUA 3ZZYA 2UU9J 4K50A 2X1BA 4DCPB 2YWGA 4JUZA 3VVTA 4Z2XA 3GJTB 4CLYA 1I5OB 4JLHA 1KD1O 2BQ3A 2M4MA 1C2PA 5K8OA 3WBZA 1NDCA 2G0IA 1G6BA 2V4RA 3WC0A 1SH2A 5HAOA 5DZ6A 1VQON 1S1WA 3T6JA 1VSDA 4DSLA 1N6QA 1NBEB 2AIRB 4J9UE 2VIHA 1ICEB 2EC0A 1JXVA 3C14A 4QIFA 2LCWA 1GAOA 1BLUA 4ED7A 1ITPA 3I8DA 3K5LA 1VC0A 2ZHOA 1RTDB 1NGBA 4BE1A 4DR5J 3IGVA 2LECA 3NH2A 3KTQA 2BJ9A 4MDAA 2JVRA 3QWPA 3CM5A 5DJBA 4HDHA 1RLDA 4OX9F 3MX5A 2OEKA 4FXDA 2VL1A 4F7VA 4FM2A 2ZH7A 3BGRB 2DNPA 2DO0A 4HUFA 4KRFA 5F8JA 3VQ4A 4P75A 2W24A 4DU8A 1ELOA 3RBEA 3L2UA 2MQQA 4DL4A 1PYOB 2OIHA 3TWHA 2UUWA 2IC3B 3V6DB 4IOBA 5CD4A 3G8SA 2HMPA 1RWKB 3MI7X 1YK9A 2EPIA 4J9NA 4OPKA 4G6VB 4O55A 3QRQA 1S9EA 2I1RA 1PYSB 3S7RA 4A2BA 2HHPA 4TN2A 5GADP 4S0MA 1BMQB 4ZVOB 2I6WA 2IJRA 2W42A 1M90T 7FDRA 3Q8RB 3AVGA 4P2SA 4IKFA 3R5CA 1JLCA 1EHWA 4TNOA 2VZ9A 4O23A 5EX0A 2DBBA 4JRQA 4DV1K 3UDEA 2Q97A 4CI6A 1BA1A 5LMUJ 1YJ9S 4EGLA 3M1VA 2IVFB 4YR2A 5HO4A 3AO5A 5CAAA 1KC8O 2GHPA 5KFJA 3CCMS 5DG7A 1XR5A 3DAWA 4LF8K 3F44A 3QINA 3GFHA 4O4RA 5C2GA 4HCBA 1I51B 1LK5A 3OVAA 5J2MB 1I94J 3B4MA 4DR1F 4BREA 3LDSA 2XY5A 3HVWA 4LRCA 3N6LA 3CCLS 4J9MA 2D0BA 4WCEQ 3OL7A 1TKZA 1S49A 3RW6A 5B7WA 4Q8FA 4U6PA 2B4JA 2YWHA 4U95A 1WOOA 4O8KA 2Y8YA 2QJ3A 5I3PA 5D4LA 2FLPA 2V4JB 3MR3A 2FJWA 1OO0B 3FZ2A 4A8XA 3RB0A 1AZSA 1V4TA 2OZMA 1Q53A 4FF4A 4YS2A 1VSLA 5CE3A 3GPAA 2W8KA 4V1Ak 4JK8A 4PPDA 3UDCA 1XMQF 2JH3A 2OP5A 2Q36A 4G9ZA 4FYXB 4LRBA 1NK9A 1G15A 3CGIA 1Z2ZA 1LEOA 1N0VC 2JSXA 3R9PA 3EGZA 3A3NB 4LD0A 2OYQA 5F0UA 4NYZA 3KLGA 5KFGA 3DOMB 2KFYA 3VAIA 5F8IA 3ENAA 1FD8A 3CDBA 2Q3PA 3HM8A 3CQYA 5KQ8A 5AQSA 1S9GA 1U1KA 1IG8A 4DTUA 2RQKA 2KTQA 3KFWX 1VQ7S 2RF2B 3M9NB 3LL3A 4PYDA 2EG2A 3QIDA 5K20B 1ZZFA 4EBEA 4MYTA 3WDOA 1WTFA 4IOAL 4KAIA 3VF6A 1UKUA 2NUHA 4LFCK 3Q2SC 4AYBD 2QXFA 1T05A 3CPEA 3MWBA 3AA9A 3MM7B 3A5MC 3W2VB 1PJ5A 1T9YA 1HMVB 3D28A 4CJ7A 1HIYA 1KFSA 2F9WA 3R2CJ 3UKRA 4EHTA 2L08A 5C5JA 4USMA 3NG8A 4CZHA 1YJRA 4F25A 1WKLA 2VYPA 1JIHA 4IEEA 5HJYA 3B6PA 1N32K 4PRFA 5HVGA 4R5PA 3O8MA 4JI6K 5THWA 3VZIA 3IRXA 4NYNA 3BSOA 3CCSN 1NM1A 4JI2J 4WP9A 3AVNA 1S0VA 4CZEA 2PYJA 3ENQA 3DJCA 1M5VC 3PJ9A 2DCLA 3CFOA 2HBKA 4DV0F 2ZDOA 4BRHA 4CIGA 4CE9A 3CCQS 2ATCB 3LALA 2YQ3A 4WPAA 3QATA 4M5DB 1OVQA 5SZTA 2IJNA 2YKAA 2HB5A 4NYFA 3BB5A 4NLDA 3KKFA 5M2RA 4OJ3A 2DR6A 3PIPL 3IR6B 3C95A 2FC9A 2LVWA 1SB6A 2RPIA 3QT7A 2Q43A 2JWKA 3MDFA 2KHDA 2DR7A 5DQGA 4D3GA 1RNHA 4H5WA 3M3ZA 5KRSA 4OKJA 1HHQA 2LFVA 4X4OA 3E01A 1JLEB 2QLWA 1B0TA 2W9AA 3ISNC 3HSCA 1DTTA 2BBEA 3F9MA 1OKJA 4ZS6A 1RT4A 2EWHA 1SKSA 1DTQA 4GKJJ 4OX6A 2ZH2A 1VQKS 4GVLA 1S1VA 4CJRA 5CY4A 4ECVA 3KXDA 4KH0B 3MCOA 4E7KA 1DZ5A 2HQDA 2WSCC 2OPSA 5BXIA 2HFSA 3RMBA 5GAEU 1SC3B 1FESA 2Y0BB 2RH3A 4JN4A 4WQ4A 5AQVA 3UI3A 3F41A 3QQCD 2R42A 5M1PA 3ICLA 2NLXA 2FSKA 3TEGA 2KXNB 5JVHQ 2EFNA 4I56A 5IV3A 4I69A 2GMLA 4PWWA 4JI5F 3MXHP 3A5OC 4K4XA 2EKYA 4FPAA 3D54A 2Q66A 1T9TA 3BQ0A 1SS6A 5EWGA 4G1PA 2EK6A 4F4AA 3FSIA 3CJ2A 4DL0C 3SMSA 4YQWA 4KHNA 2VQFJ 3VQ6A 3G96A 4ZOSA 3DRXA 3SYZA 2V2ZA 3TANA 1HR0F 3CFPA 3GDQA 1U2VB 1SH0A 4BR9A 2B4UA 2DHHA 3CE8A 4M95A 1BA0A 3HF5A 3UKUA 3VA0A 4BCAA 3U7JA 1LW2A 3DLBA 3SNNA 4DV7J 3MM8B 1YJWN 3W64A 2D3O1 4DTMA 3Q7CA 3QPIA 4FWRA 1RZMA 3I5AA 3VHQA 2Z30B 4KREA 1Y7PA 2B9XA 2F4VK 3QT6A 5BYQA 1U1MA 1S1TA 4WFNL 4ZP7A 2E9TA 4QAGA 5B08A 1UWBB 4YDUC 2G2OA 1N36K 4PPZA 3OBWA 4H4KA 3AOBA 2PFDA 1N33F 1RCOB 4P73A 2UUAJ 4HVZA 4FKXA 4MKBA 2NXUA 3LDLA 5A76A 3HSZA 2D3OR 4GY2B 2UYTA 3TAPA 2W4PA 4U7UD 4X84A 1WUUA 4MQ3A 2K1RA 1IBMK 3W62A 4DR6F 3SXLA 1IBLF 3CJKB 5HLFB 4ANDA 4K2JA 1YJ9N 2YKNA 2BKNA 3CIPA 1LNQA 2NRZA 1KS2A 4YY3K 2GGPA 2YV0X 5IT9Y 4XH5A 5J2PA 1S1XB 2OH2A 2UUCJ 1FKOB 3H2LA 2CQDA 4YOXA 4LFAJ 3U8XA 3JAMU 1QHAA 1KR4A 1QVFR 3IMXA 3EE3A 3PNIA 3H2UB 3CCLN 2HNDA 3I8BA 5IC4B 1LWFA 1KTQA 3HT0A 4FZVA 3J8AA 3NRBA 4CFBA 3FZHA 2L9WA 4MT1A 2A2DA 4CZIA 5KPTA 2RIJA 4WFBQ 1VK0A 4AQYF 1G7CB 3M8ZA 1L3SA 2CRLA 3VALA 4ZLJA 1BIZA 3PYDA 1T95A 3HHLC 4QWBA 2QA4S 5BR9A 2CJXB 3M6WA 3KLFA 5D0HA 3W8GA 3K89A 3MPUB 1YBAA 2YNIB 1Q8IA 2MGZB 3NVMA 2RDDA 5HVFA 1VQ8N 1F0XA 4KV8A 1YSJA 3ULHA 3BZQA 3RMDA 4KT0C 4CRJA 4M7XA 2NNWA 3JSRA 1M5PC 1ZTTA 3ZZ0A 3K5OA 5DGBA 4YHHJ 3H40A 4OJGA 4DUYK 4ILRA 2N82B 4HDGA 4X4TA 1OVYA 4RUCA 3VGMA 2O4GA 4CH0S 4X64K 4X62J 4TYAA 2KLAA 4HHTA 1FDBA 2EI5A 3MMBA 3SAHA 4JP8A 3E1YA 1VQNS 1FWLA 1KD1T 4LVOP 1S10A 1VQ7N 3SQ0A 2E20A 3DRRA 3IMQJ 3EMTA 2D0PA 1Q78A 4IR1A 2Z4PA 2N7YA 1NHKL 4RR5A 4AFFA 4I2PA 4KGZB 1OH5A 2WVFA 4DL5A 4OYOA 2G9OA 2B7CB 5CR4A 3OYGA 5B0DA 1J5OA 1TKDA 4J9QA 1PIEA 3CI5A 1TR0A 1G99A 4ED6A 3TAMA 2QRRA 3NBPA 5L1IA 1PBUA 4KHWA 3US5A 2HLUA 1YUWA 4QOTA 2VDHA 1RXOB 4HACA 3B8HA 2UUBF 1U8WA 5HBMB 2KQ2A 2MMYA 4J9KA 3LAKA 2V50A 2C2OB 2LP4A 4WFYA 2L41A 1WC4A 1K8KA 2HMIB 2ROPA 2QW9A 4EEYA 3THXB 4J9SA 5GAEP 1C1BB 4DJBA 1HLUA 1VDHA 3TP2A 4AL7A 4F36A 2VCPA 1EKRA 4E1JA 2ZVIA 3CVKA 1QLNA 2XYPB 4DS4A 2QLJB 4ELVA 5L8RC 1WEXA 3O08A 3VN5A 3L8BA 2IAJB 5AQGA 3AY0A 5KG5A 4I2QB 4NOHA 3SQGB 1S59A 2JX2A 4FJHA 4ISEA 2RE1A 2FBVA 2DO4A 3N6NA 4J9VA 1ZAWA 3GJQB 2HVIA 2VHGA 1ZPVA 3TZXA 3LZJA 4ZK7M 4JKBA 5LSLA 5AQRA 3KKRA 1Q1KA 3WNHA 1ZA2B 2V52B 1X9WA 4A61A 1AYEA 4J2BA 3KDOA 3LPYA 1HYSB 2E7WA 2HF3A 2WB4A 3K9KA 1X9MA 3OFEA 1RWOB 2QSFA 2BE9B 4NA1A 2J8AA 3VWSA 1BO5O 3PZPA 3AHPA 1EQYA 4CJEA 1VQPS 2EX3A 2R2UA 1T6CA 3CJCA 3FBEA 4YR3A 2RDJA 1LWCB 5T7LB 2LYVA 1VQKN 2AJ1A 4ES2A 3QIOA 2FHJA 4KPCA 4ED8A 4K8RA 1CQMA 1EETB 1AXQA 3LP2B 2XSJB 1NPPA 3RUBL 3M8SA 3BPDA 1VHIA 1E3MA 3P5BP 5KFZA 2UV8G 4K4ZA 1FDAA 2CQGA 4UY8T 1HKAA 2QE5A 5GAHU 4LF5K 1S1UA 3I82A 2J7KA 4DR4F 3RSEA 2DY9A 5JICA 2BABA 5A6WA 1MMLA 4OX9J 5B09A 3SK3A 2CZ4A 2FD2A 1U26A 2N3OA 1HQEB 1VR6A 3VETA 3IS9B 2I0XA 3P8BB 1NK7A 1XTZA 1N48A 3NCRA 3GSDA 3QRPA 2GAHC 3TNVA 3KZBA 4CDIA 2XS5A 3VTHA 1SIZA 2AJ2A 4H4OA 1X31C 4DPTA 4RU2A 1V3RA 4DMNA 3RU0A 1MMNA 3E9OA 5E3PA 1TAQA 1JCFA 2O66A 5AJ3F 4DCJB 3D6MB 1KKHA 1DLOB 2J6TA 2GJ2A 1J9AA 1QTMA 4F4XA 5EOYA 1UVKA 3MOZA 1WSVA 3L95X 1WG5A 4FWQA 3C16B 5IXUA 4B3RF 4OZLA 4BRIA 3KOAA 1PC5A 4ZHRB 5KT7A 4LBIA 2GUPA 3CDEA 3S1TA 2VB6A 3PY8A 2KXFA 3BEXA 3I0RA 4ECXA 3PYGA 1HNWK 3OPKA 4JYAK 1MNEA 3KMQA 4ZMMA 3C6TB 1R3NA 3ILJA 4FJKA 3I32A 2FLOA 1QVGM 2VFUA 2HVHA 4FJJA 5L9XA 1U47A 1WC5A 2GW8A 1FKPA 4CEBA 4KHPK 3I0SB 1KNZA 1U09A 3HBTA 1E4FT 4L75A 4PWDA 1LK7A 5A8RB 2MZTA 3MCMA 2IYGA 1HNZK 2R8HA 2W1BA 1N34F 1MSWD 2OTLS 1RGIA 3KK3A 1TL1B 3BO3A 4IO9Q 3H20A 2ZQBA 2HBZB 1QQMA 4NXMJ 3EVOA 3WQUA 2XB2D 4L73A 3UCGA 1JJCB 1HBOA 1T11A 3EKSA 2PSZA 2PA8D 3AVBA 3I9V9 3GP9A 3UVJA 1LXJA 3I87A 1XMQJ 5LMNJ 4FYVB 3CO9A 1WDDA 3RAMA 3ATVA 4WCEL 3QAEA 1Q7LB 5KT6A 1Q5VA 3O80A 3IO1A 5D6GA 2PIIA 1S0OA 2EFVA 3T1HF 3VQDA 3MM5A 1KAZA 1HNXF 1LOTB 3S6EA 3LANA 3ISND 5E2QA 2IGIA 1U25A 2IDEA 1Q16B 1T7PA 4IKAA 3K8WA 5CYJA 5AQOA 4W4MA