4RW4A

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 145
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw4A05
3VQ9A 3JSMB 1FK9A 3NDKA 2OPQA 2DPJA 1ZETA 3RRHA 1RT5A 1TKXA 1JXEA 4EEYA 4WZQA 4CERA 3OYAA 4DQIA 1S1VB 3E51A 1RNHA 4B9VA 1JL2A 2XCAA 3DLBA 1ITGA 2GBZA 1GX6A 3UQSA 4TY9A 3CVKA 1VK0A 1JX4A 4Y2AA 1VSDA 4TQRA 2FJWA 5KFFA 4YFUA 3LPTA 4CGHA 4RW4A 4RNNA 3O3FA 3I0RA 5K14B 3VQSA 4W5QA 2W9CB 3QEVA 3V4IB 1C0TA 3Q8RB 1U49A 2YHAA 3DOLB 4NYFA 1RT2B 4ID5A 3KMSA 5HLFA 3QINA 3RTVA 4RU9A 4JV2A 3HVRA 3SCXA 3HJFA 4TYAA 3PX4A 3BDPA 4CF9A 3SI8A 4H4OB 2IBKA 4N41A 4Z4HA 1R0AA 1QAJA 4NCGB 3NGIA 1JKHB 4TYBA 3CFOA 4J2EA 3PJWA 1JLEB 5F8JA 1RYSA 1J9AA 1NK9A 1S0MA 1BL3A 4DQQA 1JL1A 2XI3A 4IFYA 2WRMA 3TAQA 3TQ1A 3MF5A 4DSIA 3RMDA 1IKYA 4Q5VA 4KB7A 3M9MB 3O4QA 4EP5A 3TI0A 5KFAA 3L3VA 4LY7A 4NYNA 1KLNA 2WOMB 5KFMA 2HHWA 1S1XB 2R8GA 1N6QB 1S6QB 3V9SA 1T05A 1W25A 4B8CA 1EP4A 4W5NA 1TL3A 1D5AA 3QGHA 3SI6A 4KTQA 1IM4A 4O3OA 3PW0A 2JGUA 4Y1DA 2D0AA 3KJVA 3M8SA 2JEFA 4BWMA 4C8NA 3SV4A 4JRPA 4M94A 4DTSA 4JUZA 3NH2A 2IMWP 1J5OB 1XC9A 4YR2A 3TR8A 3NCIA 5CZ2A 1KTQA 4KO0B 1N5YA 3HVTB 3QNNA 1LAWA 1NJYA 3E01A 4N76A 4J9PA 5DG8A 3M8RA 2VG7B 2HWHA 2VWJA 4ECWA 1S1TA 3B6PA 5F8LA 1D9FA 1S5JA 3H98A 2IDOA 3L3UA 3SJJA 5HP1B 4FBTA 4HUEA 4CJEA 4OGEA 1RILA 4DTUA 4DTPA 4WE1B 4Z4CA 4O44A 3M9OB 3G6VA 2BR0A 3LANA 3SUQA 1EETB 1TV6B 4CJWA 3SYZA 3V9ZA 3V4IA 5KG5A 2E4LA 5DGAA 3DOLA 4I2QA 4HKQA 1U47A 2HVHA 4E89A 3OYHA 1TK0A 2AGQA 3KK2B 2WB4A 3BQ0A 4CJRA 4DL2A 1RTIA 2YNFA 4EYHB 4CIEA 3QEWA 2B5JB 3RAXA 4M45A 3KKSA 2ZE2B 3BREA 4WFXA 4DF4A 3DLGB 3OY9A 1VSLA 3MR3A 2AJQA 3HL8A 4QAGA 4B9MA 4CF0A 3MEDA 4KBIA 1LW0A 2YNGA 3SZ2A 1QS4A 4CIGA 3M8PB 1F21A 1JLAB 2BANA 1UWBB 4WXOA 1C2PA 1TK8A 3UIQA 1S6QA 5JXSA 1NJZA 1T8EA 2OYQA 2VA2A 3O3GA 1S0NA 3VQEA 3OYDA 1S97A 2X74A 1S49A 2ZQBA 3KKRA 4DLEA 5DK5A 5T7BA 2G8VA 3MXJA 1VSHA 1HJRA 3V81A 4XPEA 4IFVA 1QUVA 4BDZA 1YTAA 2QKKA 3ZSVA 2IM1A 1LWCB 4KO0A 2E9RX 4FLXA 4NCBA 5J2NA 4M3UA 4K8ZA 2BGGA 4CIFA 3K58A 5DLFA 3O3HA 3S3MA 3NF6A 4IH5A 2R8HA 4KHQA 4CFAA 3MEEA 1XR5A 3V1RA 2RN2A 5KG0A 4Q45A 3I5BA 3AA3A 4R0EA 5L1LA 3FQLA 5JS1A 4ZVFA 3H4DA 4C8KA 4NLRA 4OLAA 3OYKA 3T5LA 4RW7A 4O5BA 1KVAA 3QGGA 1DLOB 4MK9A 4HUGA 4CEDA 2KW4A 1TV6A 2EX3A 3U6FA 4KV8B 3AA2A 2X78A 4FJJA 4FLTA 3PVXA 3I0SA 3V9XA 3IG1B 1ZTTA 4TQSA 4CEZA 3KTQA 1VSFA 3JYTA 4DTMA 2E9TA 3OL9A 3NH1A 3AVNA 2KTQA 1A5WA 5F8HA 1S4FA 1TKTB 4HCBA 3AVMA 1ZBUA 4TY8A 3CG7A 3SQ1A 1GOAA 4G1QB 2VG5B 3L2VA 3LZIA 1TKDA 2JC0A 1SUQB 2Q3SA 1HMVB 3C6TA 1S1WB 4DL6A 1UWBA 4DU1A 5DG7A 1B9DA 2D3UA 3ZSXA 3M9NB 1KRPA 5C42B 4QWCA 3T19A 5J2MB 1G15A 4CEEA 4R8UB 5KFXA 5E41A 3AVFA 2HNYA 4BWJA 5F8IA 2B6AA 1HQUB 4PY5A 4ECUA 4E1MA 3MEGB 4DQRA 3KLVA 4I9LA 2PY5A 1HPZA 4Y3CA 5J2PB 2AWZA 4OJRA 1JLBB 3FFIB 2FLNA 1T7PA 1IKXB 4DG1A 1BQMB 2WK4A 2GIRA 4BE1A 4CECA 1TL1A 2G8UA 1RTJB 4RW9B 4IDKA 1ASUA 5HBMB 2AQ4A 3B6OA 2IJNA 1KFSA 2G8HA 1KHWA 2HAIA 3VQ8A 1L3UA 4ELUA 2F8TA 4CEAA 4FLUA 3AVKA 4KKOB 4WYLA 4CHQA 2W9AA 4JS5A 4IG0B 2JEGA 2QKBA 3KD5E 4DU4A 4RW6A 2P51A 3FQKA 4CHOA 1DLOA 4ELVA 1C0UB 4NLXA 1BI4B 3NF8A 1NJXA 1UA0A 5DQHA 1N48A 4F50A 3QIPB 2ITGA 2OPPA 2FBTA 1FKPA 4FZYA 4CFBA 4FYDA 4B3OB 4F3TA 3BSNA 2HNZB 4DSFA 4DLGA 1BIZA 3N6LA 3V6KA 3DYAB 4GW6A 1T03B 2YNHB 1NOYA 3DRPB 4HHTA 4BDYA 4J2AA 2XY6A 4G1QA 4NLWA 3F9KA 1BCOA 3HPGA 3OYNA 1HNIA 3IN5A 1NK5A 1J53A 2GUIA 3QEIA 5F9LA 4ICLA 3NGZA 3KLGA 5CY4A 1QHTA 4H4MB 1ASVA 1RBVA 1WAFA 5FDLA 4PUOB 3ICLA 1KFDA 1WSGA 1L3SA 4WYWA 3DRRB 3KLIB 3RB6A 1XHZA 4K50A 1VSIA 3HXMA 4QCLA 2WONB 1HQUA 4B8AB 4URSA 3D28A 1IG9A 4KAIA 3F73A 3MEGA 1VSMA 3H08A 1SKWA 3DLEA 1JLBA 2HMIB 1X9WA 1K1QA 3SUPA 3LP1A 4J2DA 1ZBFA 4JLHA 4ED8A 3OHAA 4E7JA 3FSIA 3V6DB 1RBSA 2G8WA 1K6YA 1S1UB 2JC1A 4IBNA 1RDBA 5KI6A 4WFZA 5HRPA 3MR6A 2C2EA 3SQ2A 2FJVA 4WZMA 3BSAA 1QE1B 3KHHA 4OPKA 5KFUA 2HVIA 3CM5A 3VQ5A 3OL6A 1BGXT 3CM6A 4E1NA 2A1RA 1XR7A 3LP0B 2G8KA 2J6UA 5FRNA 3VQCA 3RAQA 1IKVA 4KTZA 4AHUA 3MXIA 1C0UA 3MR5A 1IH7A 3MECA 1Z4UA 1EX4A 4LH5A 4NYZA 3TAPA 4YR0A 1XR6A 5FRMA 2IGIA 5KFKA 3RBEA 3HKWA 1HNVA 1HARA 3KLEB 1LWFA 4OL8A 3HSTB 3BR9A 2D5RA 3AVGA 1I3AA 3WNHA 3PW4A 3IS9B 4PQUB 4O3QA 1VSJA 1GX5A 4ZVEA 5KG3A 3BGRB 4K4XA 4CJ4A 3G6XA 3QERA 2ZD1B 4KHNA 3M8QB 3KHLA 5KFCA 3DRPA 4O3PA 5FROA 3PX0A 4CGIA 3V9UA 1JLGB 4FK0A 1IKWB 3QESA 1CXQA 3ZT2A 3TWHA 3VA0A 3DMJA 3S3OA 2DFHA 4KSEB 3GV7B 4PWDB 4QW9A 4CJTA 1JLCB 4RG8A 4H8KA 2JLEA 4MIBA 1U45A 1DTTB 1S9GB 4PUOA 4CHYA 3G6YA 3HP6A 5KFIA 1NKCA 1TVRB 3KLIA 3H40A 5SWMA 1DTQB 1TKZB 4ZVGA 1GOBA 2WONA 4J9QA 3VQBA 1NKEA 1HYZA 3SQ0A 3L2WA 3DI6B 1K1SA 4KHSA 4DL3A 2B4JA 2V0NA 2QV6A 4MKAA 4AH9A 2HMIA 3OSNA 4FCYA 2AU0A 4Q8FA 1C0MA 4ZHRB 3OS0A 3H5YA 4CJUA 4Q0BB 1WAJA 3PHEA 1S1UA 4K4WA 2BQRA 4W5OA 4Z4FA 3U3GA 4N47A 2IC3A 3DLHA 3HHKA 1QE1A 2OZSA 4CEFA 3HYFA 4DFMA 2Z1IA 3A2FA 1C1BB 4ZP7A 1YVFA 3WNFA 5J1EA 5D3GA 3DOKA 4EBCA 2F8EX 4CHNA 1GOCA 3PUFA 3V1QA 4RZRA 2OPSB 4ED1A 3WNGA 4NLTA 1BQNB 3OYBA 3KIOA 1VRUB 4Q44A 2FVQA 3KLFB 2BDPA 4LSNB 3AVAA 2J6TA 3I5CA 4RNOA 2HHSA 2ILZA 2R2RA 4B08A 3CIZA 4JRQA 3QO9B 1SV5A 3AVBA 4B9TA 3NHGA 5CYQB 1MU2A 1BISA 3EPGA 2RPIA 2PYLA 4RUAA 3OYJA 4CCHA 5EUHA 1RDDA 2X6SA 4YR3A 1IKWA 3JSMA 3LDSA 2G8IA 3OLBA 4DSJA 4J9NA 2Z1JA 4ZPAA 3NKYA 3RMAA 4CF8A 3CDWA 4ECYA 4K4SA 3RBDA 4GMJB 1S1VA 4ED6A 4O4GB 1WSIA 4DSKA 2UUWA 1SH3A 2F8SA 4IRCA 1LW2B 1WLJA 4AHCA 5KFOA 3ZSRA 1D0EA 3UDLA 4E7HA 1XI1A 1JXLA 3DLKB 3OYGA 3CJ3A 4I7FB 3MFHA 1BIUA 5KRSA 3OS1A 4KHRA 3GILA 1RT1B 2YKNB 4CESA 1LWEB 5K14A 5C25B 3OL8A 2FBXA 1C1CB 4G3IA 1EKEA 4ZHRA 2JEJA 2W9CA 1CZBA 4IR9A 1RT2A 4J2BA 1S9EB 4O3RA 2LSNA 2BQ3A 4FJ9A 5KTQA 4DTNA 4ZPCA 3IRXB 3L2RA 4H4OA 1RCHA 1RDAA 3NBPB 2I5JB 4KHUA 2IAJB 3V9WA 3MFIA 1X1PA 5KFWA 4NCGA 3MTKA 1JKHA 4C8OA 1JLEA 3PW5A 3VQPA 1FKOB 2C2DA 2HHUA 3AO2A 1SL0A 1NHVA 4CJKA 4MIAA 2P5GA 1SKRA 4RUCA 2WOMA 3OHBA 4CJLA 3HO1A 1UAXA 3MR2A 5KFZA 4AHTA 1S1XA 4NLUA 1RA7A 1N6QA 1HQEB 4YMEA 1WSHA 3CJ0A 4QOZB 4JV0A 1A5VA 3G86A 5KT7A 3HVAA 1XWLA 4U7CA 4ZTFA 3H4BA 4OVLA 2W9BB 2ASJA 3KLHB 1EXQA 1RBUA 3H5XA 2DY4A 3PR4A 3C94A 5KFSA 4N5SA 1KLMB 1J5OA 3CJ2A 5L1IA 3S9HA 2XY7A 2RDJA 1RT3B 3HVTA 2IM0A 3ZCMA 4O4GA 4AILC 5KT6A 5KFJA 4DFPA 1X9SA 2VG7A 1JIHA 5DG9A 1HYSB 4J9RA 2YNIB 4DFJA 5I42B 5HP1A 3DLKA 2B43A 2UVWA 4UQGA 2UUTA 4WE1A 1RT1A 4EO8A 4FS2A 4CJVA 4ZPBA 3AO3A 4HCCA 1EETA 3QGIA 2C28A 3T5KA 1SL1A 4AHSA 4KB1A 5DQIA 4CJ5A 3N6MA 4FK2A 3T5HA 4CK2A 1QQCA 3DDKA 5KGWA 3C95A 3GIKA 1S9EA 1TQLA 4FW1A 4RNMA 4DTOA 3KK2A 3VQ7A 4W5RA 3SPYA 3P5JA 4LQ3A 3OYLA 2XO7A 3OYIA 2B5JA 5KFEA 3OYFA 2Y1JA 1NK0A 3FDSA 2ZE2A 4QW8A 1SKSA 4I2PB 3DLGA 3CJ5A 4M3RA 4KTWA 3PY8A 3GQCA 1VSEA 3THVA 3LAKA 3NFAA 4ZPDA 3M8PA 2FVCA 1JLAA 4FJXA 4RW8B 3KK3B 2W7OA 4IH7A 1HQEA 2C22A 3QEXA 3T1AA 3ZSZA 4Q43A 5T14A 2OPRB 3VA3A 3RB0A 2ALZA 3SV3A 3DM2B 2RKIB 3KLHA 4FM2A 4MK7A 5KFQA 3H5SA 4F4XA 3BJYA 3TVKA 3CFRA 5C24B 2VG6B 4QWBA 5KG2A 4EZ9A 1LWCA 2ETJA 3RWUA 3ZT1A 3OLAA 3KK1B 3DRSB 4Y34A 4IG3B 2YKMB 4MKBA 2KQ2A 1NK8A 3U3YA 3NGYA 2GIQA 1BHLA 2RF2B 3KD1E 1S9FA 3T3FA 3OSPA 4M95A 1RYRA 1HYSA 4IRKA 1ZTWA 2DPIA 4FJ8A 3RR8A 1RT6B 2YNIA 4LQ9A 3D45A 5EWFA 3TABA 2HB5A 3AVHA 3VQDA 4CF2A 4FVMA 2EC0A 2R8IA 4DS4A 5F8MA 3LPUA 1T94A 2HWIA 1C1AA 4TN2A 3VQQA 4CJPA 4ZP6A 5L9XA 4URGA 4KV8A 1REVB 2A1SA 4KHMA 3IG1A 5EDWA 4MQ3A 1Q9YA 3AVCA 2DTUA 2I1RA 1HRHA 4CJ3A 1MMLA 4ED7A 3C6UB 1TKTA 3RB3A 4K4VA 4EYIB 3VN5A 4CFDA 3LP2B 3SUNA 4Z4IA 5KFHA 1RT4B 3PJXA 1FXXA 1RBRA 1RTHB 4I2PA 2VG5A 2GV9A 1KVCA 3OVNA 3EZUA 4O3SA 1SUQA 1HMVA 2IM3A 1JLFB 1A5XA 4LH4A 1QSSA 1S1WA 4RW8A 4CEBA 1X9MA 4J9SA 4MFBB 4CJFA 2W7PA 4FS1A 5C42A 3ZSQA 5J2MA 4CHZA 4R8UA 1FK9B 2OPQB 4I9QA 2OPRA 1RT5B 1L3TA 2IJFA 4M42A 1KVBA 1TKXB 4E0DA 1D1UA 3OS2A 3AA5X 5J2PA 4K4YA 1XHXA 3FFIA 1IKXA 4K4ZA 1BQMA 4OGCA 5C24A 2YHBA 1RA6A 3PO5A 4HYKA 4BACA 3TAEA 1WSEA 1RTJA 4RW9A 4ECTA 1N56A 4XPCA 3SQ4A 3AO1A 1J54A 4F3OA 5HBMA 1SH0A 3AO4A 3SUOA 2QE5A 4O4RA 4KHWA 4RW4B 4NRUA 4IOBA 3QIOA 1TK5A 3NE6A 3I0RB 4KKOA 1RT6A 3RRGA 3HM9A 5HROB 1C0TB 3ZT3A 3HT3A 4IG0A 2GC8A 3HK2A 4KI4A 2NUBA 3S3NA 4ID5B 5JS2A 1RTDB 5HLFB 4IRDA 5KFNA 1BI4A 4IQXA 3NAIA 2R7YA 4CGDA 3QIPA 5F9NA 2E6LA 4F4WA 5J2QB 4FLYA 4B3OA 4OLBA 2R2SA 2HNZA 4MK8A 4M3WA 5C5JA 4K4TA 3DYAA 3OYEA 4FLVA 5CYMB 1IKYB 4B9UA 2Z1HA 3LP2A 1KSPA 5I3UB 1T03A 2YNHA 4TXSA 4O0JA 2UVVA 4F2SA 4FZXC 3TARA 1NK7A 2P1JA 4DTRA 2O4IA 2BRLA 4CK3A 1T05B 2KFNA 4ED0A 1TL3B 2V9WA 2XY5A 1UOCA 1JLFA 3IGVA 4H4MA 3KJVB 3SPZA 4C8MA 4JS4A 3ZSWA 4CEOA 4Y2CA 1VRTB 3G0ZA 3DRRA 1YVUA 3UPFA 2IA6A 3TAMB 4E19A 1OS5A 2FC0A 3KNAA 1N5YB 4M3ZA 5KG6A 4ED3A 4FJKA 4W5TA 2XHBA 3BQ2A 3K5LA 3E01B 2FLLA 4PA1A 1JXBA 1KHVA 3HP9A 4URQU 2J6SA 1S1TB 4FJNA 3V6DA 2FBYA 3WNEA 3K5OA 2W8KA 4DQPA 4WFYA 5KFRA 3LALA 3K2PA 3KHGA 3ZSOA 4O44B 2F96A 4KB0A 3K59A 4E7KA 3QLHB 4NLOA 1QSYA 4DFKA 2XWYA 2BQUA 3T5JA 3EZ5A 3TANA 2JEIA 3HPOA 2WCXA 5HROA 2OA8A 2W8LA 4CGJA 4I2QB 1RDCA 4K4UA 3LP0A 2PYJA 2E9ZA 2O5DA 1RTDA 3QYYA 1WNEA 4DTJA 3NF7A 1QTMA 3K57A 2FLPA 1RTIB 1S6PB 2YNFB 1YT3A 3H59A 3KLEA 5J2QA 5DMRA 4QWEA 2R8KA 3ASMA 1RT7B 1CLQA 3IS9A 4PQUA 1RBTA 4DMNA 3H2LA 4XO0A 1NK4A 3BGRA 2UVRA 3AA4A 5CYMA 3MEDB 2ZD1A 5I3UA 1LW0B 2YNGB 3M8QA 2FVRA 3NMAA 4JV1A 5KFDA 4IKAA 2BANB 2ATLA 1JLGA 4M3TA 4BDPA 4DU3A 4PWDA 4ED2A 1JLCA 3DLRA 1DTTA 1S9GA 4J9LA 1VRTA 1TVRA 2QXFA 4LD0A 4H54A 3V81B 4IFVB 2XC9A 1DTQA 4DSLA 1TKZA 3ZT0A 5KFPA 4NLQA 3TAMA 4FBUA 5J2NB 4CGGA 3DI6A 3V6JA 3QETA 1ZBIA 1Q9XA 3P1GA 1WSFA 3PO4A 3AVIA 2FVPA 2HW3A 1Y97A 1Q8IA 1TAUA 3MEEB 1RAJA 3PV8A 1WSJA 3ITHB 4ECZA 3V1OA 3OYMA 4FJ5A 4Q0BA 4WXWA 4X2BA 3AVJA 4O3NA 1LAVA 1CXUA 4FJMA 3ALYA 2EHGA 2D41A 5KT3A 4DQSA 4K8XA 4RW7B 3QLHA 2HHTA 4ECVA 4EZ6A 2AX0A 1KCFA 1C1BA 3BSOA 2HHXA 4R5PB 4CHPA 4B9LA 4YQWA 3O4NA 3P83D 3I0SB 1QAIA 2CJQA 4C8LA 4F8RA 2BE2B 5KFLA 2XGQA 3JYTB 3NH0A 3D5MA 3QEPA 2OPSA 4O0IA 1BQNA 3RB4A 4CFCA 3GIIA 1NHUA 1L3VA 1VRUA 3LWMA 3NF9A 4IH6A 3TAGA 3KLFA 2OZMA 4LSNA 4ELTA 1S6PA 4FLZA 1NOZA 4GVMA 4RNFA 4NLDA 4KRFA 1ZYQA 4TLRA 1RT7A 4TY8B 2KFZA 3EPIA 2WHOA 1D9DA 4NLVA 2PZSA 3OL7A 3QO9A 2FJXA 5CYQA 3C6TB 3NAHA 1CZ9A 1W9HA 5EWEA 1SH2A 4KREA 1Z26A 2V4RA 4KPYA 2G8FA 4RNHA 3H5UA 3SFUA 2DFFA 4CEQA 5KGXA 2HNYB 4FJIA 2B6AB 3V6HA 1L5UA 2VWKA 4FXDA 4OKKA 3HPHA 1CSJA 1NNDA 3MXMA 3SFGA 2W42A 3SNNA 1I39A 1HPZB 4J9MA 2OH2A 1Z25A 5EWGA 3OJUA 2YV0X 2Y1IA 1LW2A 4J9KA 4F4ZA 3BSCA 4DG1B 1IO2A 3UR0A 4F4KA 3KOAA 1NK6A 4DL4A 4AHRA 2KZZA 3ZT4A 1NJWA 1TL1B 4IDKB 3I8DA 3VQ4A 4I7FA 3GV5B 4KE5A 4GC6A 4ZMMA 1QSLA 4DS5A 3QNOA 2YKNA 1UA1A 1LWEA 3NL0A 4FLWA 5C25A 3Q8QB 1C1CA 3ITHA 4M3XA 3CFPA 4ZP8A 3ISNC 1I6JA 3TAFA 1W0HA 1TP7A 4NLGA 4GC7A 5HRNA 4E7IA 2V4QA 2IS3A 4RW6B 3CO9A 1O1WA 3NAEA 3I5AA 3IRXA 5F8NA 3D0PA 3NBPA 2I5JA 1S48A 4EBDA 2IAJA 1ASWA 1ZBLA 2D3ZA 4R5PA 4Z0UA 4NLPA 2ILYA 5DQGA 2OPPB 5KG1A 1HYVA 1FKPB 4B9NA 3RMBA 2QK9A 2BE2A 4ECQA 3IAYA 4DSEA 1TGOA 3Q8SB 4FJHA 3HVWA 4ECSA 1FKOA 4DWIA 3BQ1A 1U04A 4L8RB 1ZBHA 5KG4A 4DL7A 3G10A 2AGPA 3IGNA 2D0CA 3CWJA 2AX1A 2IM2A 3K5NA 3AVLA 4KAZA 5KT4A 2C2RA 2ATQA 1HNIB 3LP3A 2X6NA 2W9BA 4FZZA 1U4BA 4ICLB 3KLGB 2FVSA 5FDLB 5KFBA 4YP3A 3L2QA 1KLMA 1D8YA 3KHRA 1WN7A 4LSLB 3GIMA 3GV8B 3LAMA 4Z4EA 1RT3A 3EYZA 2XRIA 2HNDB 4OKJA 5HRRA 4KHYA 3DLEB 2XY8A 2UVUA 3LP1B 4ZP9A 5L1JA 3K5MA 5DGBA 4FM1A 5I42A 3RMCA 2XCPA 4NLSA 1B9FA 2DFEA 2R2TA 1U48A 3OYCA 4FJGA 2WTFA 3MAQA 4NCAA 3L8BA 2CKWA 3PW2A 3VQ6A 3GIJA 4F4YA 4KFBB 4TSXA 5KT5A 1RDRA 4DF8A 1C6VA 1IKVB 4CK1A 1B92A 4N56A 1WNSA 3MECB 3Q8PB 4MH8A 4AHVA 4O55A 1HNVB 1TAQA 1LWFB 4ZVHA 4OPJA 2RDIA 4HVJA 4ECXA 3CYMA 3CDUA 4DTXA 4DL5A 3FRZA 5JUMA 1JLQB 1VSKA 5SZTA 4J9OA 4OKEA 5KFVA 2ZKUA 2R8JA 3KK3A 4QWAA 2D0BA 2E6MA 4YNQA 4KI6A 1S10A 3QZ7A 4ECRA 3PR5B 2XGPA 3PW7A 4BE0A 3DMJB 4ID1A 3DM2A 2RKIA 2D7SA 4Q8EA 4FJ7A 3QZ8A 4NZ0A 4B9SA 4CJQA 1T3NA 2VG6A 4FJLA 3GYNA 4IR1A 4LSLA 4CJSA 3NGDA 3LWLA 5KFGA 4ZTJA 3KK1A 3DRSA 4M41A 4IG3A 2HNDA 2YKMA 3PX6A 1NKBA 2FBVA 3OJSA 2KZMA 2RF2A 2HHQA 2P5OA 5KFTA 4FM0A 2AGOA 4FK4A 4DEZA 4IKFA 4QWDA 1LV5A 4NRTA 4NLYA 1S0OA 3KMQA 2R2UA 4U6PA 3N6NA 2IC3B 3ZSYA 4E7LA 3ISND 1YTUA 2ASDA 4E3SA 1R0AB 1REVA 3ULDA 4KFBA 2VA3A 4Z4GA 3AO5A 4CE9A 3QIDA 5KG7A 3AV9A 5J1EB 5D3GB 3VQAA 3EY1A 3DOKB 4CGFA 4IFYB 4EP4A 4HUFA 2XI2A 3C6UA 1U09A 4M3YA 5KRTA 2ASLA 4XIUA 3CJ4A 4FW2A 4EO6A 2BRKA 1RT4A 4BE2A 5DLGA 3RR7A 4Y1CA 4HTUA 2HHVA 1BCMA 5KT2A 5CZ1A 4CF1A 1SL2A 1RTHA 4EBEA 4F2RA 3L2UA 5HRSA 3CQ8A 1N4LA 1EP4B 1JLQA 2IOCA 5L1KA 2Z1GA 1SV5B 3CDEA 3LZJA 1MU2B 3PZPA 2O4GA 5F8GA 4QPXA 5KFYA 5EU7A 4MFBA
chains in the Genus database with same CATH superfamily
2PI5A 2DPJA 3W2WB 1GMWA 1Z1ZA 1HBNB 1RT5A 1ZC6A 1JXEA 2DNKA 4WZQA 4CERA 3OYAA 1PKUA 4HLBA 1RWMB 3P8BB 2HYIB 4PPZA 3CF5Q 4FYVB 5IM0A 5FPNA 3BO2A 3BZCA 4LF9J 2NRWA 3I0RA 2P6SA 3CJTA 4W5QA 3NS5A 3QEVA 2O1PA 1FDNA 3OPKA 4NOHA 1U49A 2YHAA 4OHYA 1Q8KA 4ID5A 2KRBA 1HI0P 3R3TA 4LFCF 3QINA 4RU9A 4JV2A 4DZ6A 1N0UA 3SCXA 4QYRA 5ELZA 4N41A 1R0AA 1YJVA 4DX8H 3NGIA 3F0NA 4JV5F 3QJLA 5BYQA 4IO1A 1JLEB 1VYAA 1J9AA 1FWPA 4BG8A 1S0MA 3QT7A 2Q1LA 4DQQA 2WRMA 3UD4P 3Q23A 3I31A 4KB7A 3O4QA 3CJCA 3H0PA 4WFNL 2KL8A 2RD5C 4J7CA 1N6QB 2BJ1A 4PXDA 1W25A 1TL3A 2V2QA 1Q8LA 4O3OA 3KJVA 5DS7A 3M8SA 5DDOC 3OR2A 4BWMA 4P2FA 1LQ9A 4C8NA 4M94A 4F25A 3NH2A 3VAKA 2OMOA 1J5OB 4ZKAA 4OYIA 1GFWB 4AQYJ 4KO0B 3HD2A 1N5YA 1F9EB 2HGLA 3OTCA 5E33A 1LAWA 3B82A 2IDEA 3CD7A 3QFPA 1U02A 3DGVA 4ZVTB 4J9PA 5DG8A 1N8RO 4CNYA 2VC0A 2VG7B 2HWHA 4YY3J 2VWJA 4M5KA 3B6PA 2O8CA 3BF4A 3BKTA 3H98A 3L3UA 5IT9U 1AXQA 4HUEA 4LUBA 4OGEA 3ZZTA 3MM5B 1IBLF 2RNEA 3MDFA 1OPIA 3G6VA 1XN9A 2HRTA 3R7BB 1TV6B 2CAJA 2F1FA 4NPOA 3IAM9 4CJWA 4DQ8A 3V4IA 1G1XA 3M32B 2E4LA 2CQPA 4P73A 3DOLA 3E9PA 3KWGA 2OHDA 3VMFB 1U47A 2OIHA 2AGQA 4CNZA 1VQ7N 2K7JA 1RTIA 3TYTA 4QIGA 1XMQF 2DCUB 3GJTB 3EICA 3MCAB 4M45A 2ZE2B 1N32K 4DF4A 1RHJB 2KH9A 4ZVUB 4B9MA 3MEDA 2J7WA 4UTGA 5BN8A 4HH1A 3ENBA 1QS4A 2PEHA 3H20A 1JLAB 2A3ZA 3VGUA 4WXOA 2DNGA 4K2XA 3MK6A 2RHSB 3D1OA 4M5IA 3UDCA 4C4WA 3WC0A 4LR9A 2CFXA 5IT9O 3HHNB 1B70B 1S97A 1WBDA 2X74A 5DK5A 2QG9B 2UUCF 2QWMA 2VJUA 2HBLA 3GDQA 3CJAA 4FF2A 2DGTA 1HJRA 4H03B 4IFVA 2Z4PA 3CCEN 1LWCB 5A8KA 1FF2A 4NXMK 4FLXA 2AEJA 3UFCX 5K8NA 2CH6A 3VF6A 3O3HA 3LGMA 4JK8A 5LJ3Y 3MEEA 1XR5A 3LH2S 4H5WA 1A9NB 2RN2A 5E2QA 4Q45A 4R0EA 3HD1A 3FQLA 4M5HA 4XTTA 2F9JA 2K3KA 4WFAQ 1AT1B 4PG6A 4CZHA 2X1BA 4NLRA 3OYKA 3RAMA 2L9WA 1DLOB 4YB6A 1X5SA 4HUGA 4OHWA 2EX3A 4FJJA 4OI0A 3CC7N 3DXKB 3V9XA 3CUNA 3KTQA 1ZTTA 4CEZA 1VSFA 3FEZA 3DN9A 3NH1A 3ZEUB 1SC6A 5IWAJ 4QIEA 4HCBA 2RS8A 3GE1A 4X4UA 1LNQA 3KK7A 5E3QA 1KN6A 3WQUA 2MKIA 2GMLA 1EQ0A 2JWLA 3CG7A 3SBTA 1GOAA 4XEIA 2K7KA 2MB0B 2VG5B 3IC1A 4H0TB 2M52A 1PC5A 4JI4K 1SUQB 1NUEA 3M2VA 2Q3SA 2NRVA 1S1WB 2V94A 1UWBA 3CCZA 3FZ2A 3GTYX 4DV0K 4UOHA 4GKJJ 3M9NB 5C42B 2NRZA 3B4DA 5J2MB 5KFXA 4MLHA 2HNYA 1FHTA 5F8IA 4TLQA 4E1MA 1KWMA 4NX9A 4NXNF 4DPUA 1UKUA 1JLBB 3FFIB 2FLNA 1T7PA 1N33F 1BQMB 3MMJA 1PCAA 3OXFA 1EWQA 3BO3A 4CECA 1RTJB 4IDKA 1ASUA 5GAGU 3DGPA 2I8EA 3B6OA 4KHPF 4FPAA 3VQ8A 1XERA 3DLJA 4Y28C 1S3XA 4MLEA 2N82B 1YXQA 4HHJA 3HHLA 2QM1A 2QKBA 4ES1A 4USHA 3HFVA 2ZJRL 1VQ8N 3NF8A 1H7WA 3AJDA 5DQHA 1UJ5A 3QIPB 2ITGA 2MJNA 2FBTA 1VQKS 2V8PA 4CFBA 2G9OA 4F3TA 2UV8G 4QU7A 3BH6B 4DSFA 1BIZA 3DYAB 3H8YA 4FWPA 2RB7A 1NGJA 3BBFA 2YNHB 2F8MA 2CJXB 2UUBF 3VEWA 4HHTA 3MUVP 3R5GA 4WK3A 4F0MA 3WX4A 4OX9F 4WCEQ 1HNIA 1WG4A 2GUIA 2O66A 2JLGA 3OW2M 1QHTA 3AJ1A 4ITSA 3AD8C 3FBEA 4OYWA 2B8PA 1BQXA 3LDLA 3DRRB 3M6WA 1FESA 2IHR1 4K50A 2EWHA 3HXMA 2WONB 4B8AB 2EI5A 2J0QD 4LF4F 4KAIA 1PYTA 1SKWA 2V4JB 4QS9A 4C6AA 4DMZA 3SUPA 1RWOB 1UFWA 4JLHA 4QZVB 1K73T 2HHHJ 3FSIA 2YX4A 1IM6A 5JJBA 1S1UB 3PXGa 2YX6A 4IBNA 1LFPA 3D6HB 1WI6A 3CCLN 2NLXA 4ZVRB 3CM5A 4FYWB 5MAOA 1BGXT 4CI6A 4E1NA 1XR7A 5JICA 3AB2B 1KQSM 3LP0B 1SJQA 2J6UA 4DV2J 2XSJA 3L95X 5AQNA 4CLWA 1FEHA 3MXIA 4NYPA 2FUG9 2J4RA 4CLTA 1RAEB 3MECA 4LH5A 4NYZA 4YR0A 2ZWHA 3G8QA 5KFKA 2ROEA 2ZZNA 3BR9A 2W4CA 4GKKJ 1I3AA 1M5SA 5CH7B 2V9KA 4PQUB 3IWLA 5LMUK 2QSFA 2VFVA 1JWWA 4K4XA 4X62F 3M8QB 3EVOA 2ASMA 3KHLA 5FROA 2WVDA 5GAEP 3UKUB 3U27A 2A3JA 1F9FA 3NLCA 3ZT2A 3TWHA 3DMJA 4ZOSA 1E6YB 4KSEB 4CT9A 2OTLN 4CJTA 2YXLA 4Y0FA 2NUHA 3C6HA 2D3O1 2M70A 3HP6A 3A13A 2JWNA 3H2UB 1YUWA 2EFGA 4CZJA 3MMBA 1DTQB 2PA3A 1GOBA 1OH5A 2CIMA 3L2WA 1HBUB 3DI6B 2NRRA 4KT0C 4DL3A 5B0GA 2V0NA 1TFWA 2KJWA 2CQ4A 3D66A 3POTB 3N5FA 1FXRA 4W92B 1GXTA 1KOOA 1SZ2A 2FXUA 5CHIA 4CJUA 2BZ2A 2A2CA 5HQMA 1FCAA 2BQRA 4W5OA 3U3GA 3DLHA 2R7SA 2MLZA 4LBPA 4V19J 1ESVA 4DV4K 4ZP7A 1JCEA 5D3GA 3DOKA 5B8HA 4JEPA 4RZRA 4ED1A 5A8RB 5I4MA 2HF4A 4Q44A 3KLFB 3O1BA 1VHXA 1OH6A 3AVAA 2LYVA 4PEOA 2EPIA 1VBXA 5AR0A 4KBOA 2IYGA 4CM0A 4B08A 4AQYF 3DCAA 2QWPA 3QO9B 4A8WA 3AVBA 1Y64A 4CLKA 1MU2A 1NCLA 1BISA 4RUAA 4A62A 1U0SA 5F0UA 3U1MA 5EUHA 1RDDA 1ZPVA 1IKWA 3L3CA 1AZSB 4CBWA 5EXWA 1NLVA 1WC6A 3KFWX 5BRFA 4ED6A 2VQEJ 3KJNB 4GO7X 3HSCA 2VIHA 1GLJO 2CJYB 1F3VA 1OY6A 1LW2B 2ERRA 4EFHA 4KQZA 5KFOA 3C19A 4KGXB 4WYBA 3ZX3A 5IFMA 1XI1A 4CYUB 3EEQA 2AJ2A 3DLKB 2HLUA 4C2MA 2BM1A 3PRBA 1DURA 2DISA 5K8OA 2VICA 1NSQA 3CJKB 5C25B 5F3TA 3OL8A 1EKEA 2W9CA 4I0WA 1URNA 4FWSA 1KTVA 1RT2A 3D7EO 4JI8K 1S9EB 5CD4A 3ZZ0A 5KTQA 2J9DA 4DTNA 3DLLQ 4QIVA 3L2RA 4H4OA 3NOCA 4USWA 4CO2A 1RDAA 2IAJB 4Z37A 1H38A 1Y0HA 1JKHA 4C8OA 4ZITA 2CA9A 2P9GA 1X3MA 2XLJA 1FKOB 3PJ9A 2LECA 2BJ9A 2Y0SD 3IMXA 3M2UB 1BO5O 3S01A 4RUCA 4PKIA 1UAXA 4NI2A 3MR2A 4AHTA 1S1XA 1HQEB 4HHUA 4B3MK 4JI1J 5MLCQ 3H2VE 2RS2A 4LF5K 2GW8A 1NSKL 1OIAA 3EUNA 3H5XA 2WBRA 3K8VA 5D6GA 5BR9A 3HHLC 4YDDB 1NH8A 5KFSA 2RHQB 4TU7A 5L1IA 3GP9A 1N0VC 1MWZA 4A8YA 3F41A 2ZHBA 1F5BA 2CWXA 1VRQC 2QTWA 5JLFA 4AL7A 4O4GA 4AILC 5KFJA 3KKFA 5D78A 4ZDNA 3LDPA 1JIHA 2O8BB 1ZM9A 1EZZB 1K44A 3ILOA 2JRSA 5I42B 5HP1A 3NGRA 4GV9A 4MYUA 2UVWA 2BOPA 5HVHA 3DHXA 4WE1A 2HWTA 1RT1A 3CJ9A 1FX4A 4EMDA 5IWAF 1F9HA 1Q5YA 3I56N 1KOHA 2C28A 4KB1A 2D69A 1UPPA 3CCJS 4FK2A 2F63A 3DDKA 2DHAA 8ATCB 5KGWA 1CJUB 3GIKA 1Y10A 3Q8VA 3R6GB 2DNRA 1GNKA 1TQLA 2VODA 3PDNA 2RJZA 1RWKB 3T6BA 2O8FA 3P5JA 4LQ3A 2NS1B 3DU6A 4JHDA 3OYFA 3I32A 2VFUA 3BM7A 1NK0A 4U7BA 4HACA 2DHGA 1SKSA 2VOOA 3J81Y 3CJ5A 3D0HE 4GY2B 1APSA 3HI9A 5GIOA 2PDAA 2F9DA 3THVA 5LL6Z 3ET6A 3M8PA 4UT4A 3JTOA 4LBHA 5EGYA 3QEXA 1EHWA 2L48A 3H3NO 2P9LB 5T14A 2ALZA 5ETSA 2IVNA 3KLHA 2AZ1A 3P5TL 2BE7D 4WJBA 5KFQA 5A0YB 4OPHA 1KEKA 1YJTA 4DR7K 2UU9F 3LPYA 4E98A 1ATSA 2XYGB 4OJ1A 1FDBA 5C24B 2VG6B 1CULB 2LMIA 2IBOA 2NXEA 1CJKB 3M2RB 4EZ9A 2ZH5A 1HR0K 4BRLA 3RWUA 2UXDK 4DR3K 4MKBA 1GTEA 3U3YA 4CWBA 1BHLA 4LFBF 3KD1E 1S9FA 3CPWM 3G82B 1ZTWA 3D45A 1VFJA 1S72N 2RILA 3LUYA 3AVHA 4RO0A 2EC0A 3SCLE 2R8IA 4DS4A 1CJTA 3LPUA 2HWIA 2VV5A 1C1AA 1ZM4A 3QBCA 2OD4A 4URGA 1YITS 1REVB 4B9QA 2K06A 3UN3A 1FEEA 4RU2A 3F2KA 1I94K 3QT6A 4FXWA 2RVJA 4C97A 2NYIA 1Q9YA 3AAQA 2I1RA 2NRHA 3PSIA 3RB3A 4AF1A 4CFDA 4J37A 1EKRA 3SUNA 2RT3A 1RT4B 3OW2R 3HFKA 5AJ3K 1FXXA 2AHOB 1W7WA 1RBRA 1PJ6A 1P9QC 3CJQA 4I2PA 4KRWA 4OYAA 1HMVA 4UUXA 4ERDA 3U1NA 2RIJA 3O9QA 3G6EN 2EKYA 4M5DB 3EKUA 4J9SA 3BBCA 1NGEA 4FS1A 1UCNA 2XNRA 3ZSQA 2DNZA 4CHZA 4DN0A 2HHHF 3ZX2A 3AA9A 2WB1D 2LQ8A 3OQ2A 2KHDA 1RT5B 5HQLA 4CTAB 2Y0BB 2WC9A 1GTHA 3FZMA 3ZTSA 2QC3A 4DOZA 2OSQA 3LGHA 3TAEA 4RW9A 1YBTA 2JJ4D 4ECTA 1N56A 2N7CA 2CJBA 5IM0B 1J54A 2OTJN 1SH0A 3AO4A 2CQGA 3SUOA 1S79A 4PG8A 4DV2F 4O4RA 4KHWA 2YJFA 1TK5A 3QIOA 3I0RB 3D9BA 1IG8A 2KKZA 4RBTA 1RT6A 3W62A 3RRGA 3M3ZA 4QS7A 4KR0B 4GKKF 3S3NA 4ID5B 5J1NA 1C0FA 3VAHA 1X4EA 5AQYA 4CP5A 3K9KA 2KO1A 2DHHA 3WXIA 1SXLA 3NAIA 3NMRA 4AL6A 4C23A 4B3OA 3BZKA 4JI0K 4OLBA 1RKIA 4LJMA 4DV3F 2HNZA 3ILJA 2PFFB 1M1HA 1DQAA 2DH8A 2CQCA 3WIVA 1WHXA 4E1JA 4FLVA 5I3UB 3JTNA 1G7CB 4TXSA 4O0JA 4KH5A 4F2SA 5F0XA 3I55N 4X64J 1HKAA 4NYOA 4P75A 4XAKA 2AW0A 3UKRB 4PG7A 5CAAA 2PIIA 2F4VK 3CC4N 1TL3B 3BR8A 3WQPA 2XYHB 3KJVB 5GAHU 3SPZA 2OI2A 3G0ZA 1T9YA 1WKKA 4PKGA 2CDRB 4LF8J 1YVUA 3ZNUA 1OS5A 1N5YB 4ZLLA 4HEA9 4W5TA 3EKSA 4KH0B 2FLLA 1Y5IB 3HP9A 3R1LA 2HK3A 6AT1B 3J80U 5GADU 2O8CB 3V6DA 3K5OA 4PKHA 3ID8A 2KXNB 3KYLA 4WFYA 5KFRA 5GVQA 4OJHA 3TSPA 3K2PA 3HMJG 3K2YA 1FWKA 4JI2J 3PSFA 2BQUA 4F67A 3EZ5A 1YRUA 5B0EA 2WCXA 5HROA 2OA8A 3VGSA 2W8LA 4DPXA 3VALA 2YHWA 3R8EA 3SMSA 1RDCA 2W2QP 2E9ZA 4I67A 1DEJA 1WNEA 2IRXA 3CCQN 1QTMA 2HBYB 1RTIB 1YT3A 5DMRA 1U1NA 3AB4B 1RT7B 2BXJA 2MQOA 3IS9A 1RBTA 3H2LA 3MXHP 4ZN3A 1XUPO 2KB2A 1DGKN 3BGRA 3CMAS 1M5KC 3MEDB 2F40A 2R7XA 2VQEF 1Q82T 4IKAA 2FF6A 4LF9K 2PMHA 5AXNA 2KN4A 3Q22A 2AYBA 5C15A 1NGGA 5FPMA 1SS6A 2QMUB 3TP2A 3THWA 4PWDA 1T3OA 1HNXK 4L73A 2WBMA 2DY1A 1QTNB 3M6UA 1R6YA 4C0OC 3VGVA 2ZVIA 1YI2S 2FDNA 3CEDA 1TVRA 4LD0A 3IBFB 4H54A 4D3HA 2UXCJ 1A7GE 3MM6A 4IFVB 7FDRA 1IBCB 4UOCA 1VGYA 5A8KB 4CGGA 2YCHA 3PYEA 1ILYA 2EBEA 4PAAA 5BREA 4K25A 2FVPA 2B56A 1Q8IA 3MEEB 2FHMA 1RAJA 1WSJA 1DARA 1V4TA 1KS2A 2GJ2A 4U95A 3NGKA 1LAVA 3E8OA 4ZCIA 2MKCA 2GNKA 3HZEA 5AFUA 3QLHA 2HHTA 4X4VA 1HHQA 2HHXA 4CHPA 1PG5B 2BM0A 4B3TK 3P83D 1QAIA 2BE2B 2VJVA 4JI1F 4ED5A 1FD8A 3RB4A 4ZIVA 4H5RA 2OO4A 4PWWA 1VRUA 3NF9A 3R97A 5B0DA 2M5YA 1WEZA 4NLDA 1NMEB 3HDSA 1KVKA 2LCWA 2EFNA 3A8JA 4DV1J 1IUJA 5JVGL 4FNIA 5CYQA 2FIUA 2AT1B 3G71N 1HQ2A 2G8FA 2XLKA 3SFUA 1CJVA 2HNYB 1NGCA 3EM1A 3JAMY 2LQ5A 4DR2J 4IWVA 2VWKA 3W9HA 4FXDA 3HPHA 4DUYK 2QWOA 3K89A 2YH1A 1G2EA 1RADB 2W42A 2OH2A 2QZ8A 4J9KA 4F4ZA 1TUVA 3UR0A 3T1HJ 3L6QA 4DL4A 5H9EJ 2L9DA 3ZT4A 4K43A 4IDKB 2ALYB 2MKJA 3W5YA 3DGPB 2HFOA 2RHKA 2HAFA 1VQ5S 2DR9A 1QSLA 2FHJA 4DS5A 3C6AA 2HSTA 1RAOA 1LWEA 3CW2C 3NL0A 4FLWA 1VJWA 1R8CA 3ITHA 4C3LA 1QY7A 4ZP8A 3SAHA 2GAGC 1W0HA 1PAEX 4EIAA 4G9ZA 2N3LA 3HHLB 1J5EF 5E3CA 2Q0UA 4M7XA 2P2CB 3BO4A 2ZF5O 4DR5K 5DDRC 3NAEA 3PRDA 3PKYA 5F8NA 3GOIA 2I5JA 2DGWA 1ZA2B 1XMOK 2IMOA 4NLPA 5E3RA 1MROA 5KG1A 1HYVA 3UN5A 2DGQA 3RMBA 2QK9A 2C3PA 1QVGM 1HWUA 3Q8SB 3HVWA 1Y5LB 2C42A 4L8RB 2IYIA 5KG4A 1S6OA 3G10A 5EY4A 5F2RA 1YBUA 1U2VA 3FFKB 1Q81O 3CWJA 5ETTA 2IM2A 4U8VA 5JVHL 1LOUA 2ZBQA 3AVLA 5KT4A 1OH7A 2C2RA 4P72A 2ATQA 1HNIB 4JI3K 3N01A 4NB4A 3PACA 4ANCA 1U24A 4WFBL 2MQ8A 2W25A 1B7YB 5KFBA 3AQOA 3C66A 2RRAA 1WN7A 3CPWR 3GIMA 3LAMA 2H4YB 1UVJA 1T6CA 2XRIA 4J90A 2V6AA 4A47A 3FNNA 5LMNJ 4LF6K 3VOVA 2GX9A 4DUZK 4C1NI 1OSDA 3C7NA 4NLSA 1OYDA 1B9FA 3OYCA 2AV5A 3PM9A 3DHWC 3QATA 3SCKE 3GIJA 4F4YA 3DRXA 1MG7A 2CPYA 1VQOS 1LK7A 4DV6F 1WUAA 2XSJB 1C6VA 4GKJK 4CK1A 1X4HA 1HNWF 4N56A 3FCVA 3MECB 4MH8A 4AHVA 4PRFA 2HOEA 3MX2A 3WBZA 4O55A 1BA0A 4CD3A 1PBAA 1U2FA 1S72S 1TAQA 2EVZA 3CYMA 5HMXA 3FRZA 4NA2A 2Z58B 2MJUA 4J9OA 2W7AA 4I6YA 2CNKB 4WF9Q 2ZKUA 3KK3A 2D0BA 4KI6A 1S10A 2UXBK 2GQ2A 2DEJA 4BE0A 3DMJB 2GHVC 3PYFA 4QYZJ 2Y8YA 3DM2A 4ID1A 1FVSA 2RKIA 1JCFA 3W63A 1HA1A 3V5RA 2D7SA 2WVCA 4Q8EA 4FJ7A 3QZ8A 1UVLA 3KWIA 3VGKA 4ZPVR 4CJQA 3GYNA 3DJCA 3MMBB 4DDFA 3LWLA 4ZTJA 1O0PA 3KK1A 3GWCA 2HNDA 2YKMA 5AQLA 4TNOA 4P6QA 4K0KF 1RWWB 2HHQA 1RLCL 3ZZUA 4CI0B 2C2ZB 5EOYA 5B7WA 3D6RA 2XMJA 2DHXA 3J81O 4FM0A 3C0BA 4FK4A 5RUBA 4M63A 3O3LA 3KMQA 4LBIA 1YVNA 2E44A 3N4WA 3IM9A 3AARA 1T02A 2CGJA 2BVZA 4AUKA 4JKDA 2VA3A 1HNZK 4Z4GA 4CE9A 4X64F 4ZJQA 5D3GB 3VQAA 3DOKB 3PKMA 1X0PA 2XI2A 2CQ3A 2KHCA 2ASLA 2I2YA 2OLWA 4Y1CA 4HTUA 1BCMA 5KT2A 1SL2A 2CWKA 2OAUA 4EBEA 3L2UA 5HRSA 1NH7A 2WBNA 3CQ8A 1EP4B 1JLQA 3NGSA 3UW1A 5L1KA 2Z1GA 4ALZA 3I9ZA 2QA4S 1X9JA 1MU2B 1NBWA 2AA4A 4CVNE 2W4PA 1FE4A 3MPWA 1FK9A 2D0PA 2XWXA 3D1QA 3SSQA 3CSKA 3VAGA 4NMLA 1TKXA 4EEYA 3CIPA 3OUYA 1ITGA 2GQQA 1GX6A 2WVBA 4DI6A 3TJAA 1YF5L 4TY9A 4F0KA 3TJ9A 1FVQA 3CC4S 4C1NK 4PL8A 3CXCM 4DR4F 4P7TA 3CQYA 2VHGA 5HQ8A 1SI9A 2Q3PA 4RBVA 3EDRB 2W9CB 1VBZA 1C0TA 5CXTA 1GAOA 3SDEA 1RT2B 5CABA 1RSCA 3MCPA 5HLFA 1VQ9N 1GLAG 3HVRA 4TU8A 5L9NA 3BDPA 3EL2A 3SI8A 4H4OB 2H51B 3FCHA 4Z4HA 1OJ4A 5M1FA 3Q8YA 1JKHB 3CFOA 1RAFB 1WHYA 4YOEA 1WJ9A 3WC2A 2V69A 3W64A 2XI3A 4KGVB 1K0VA 4UZCA 4YEAA 4DSIA 2FLOA 4RWWA 2GWJA 1IKYA 2ZEJA 3M5RA 4EP5A 4NYNA 5KQ8A 2XMKA 2QA4G 3C2PA 5KFMA 1R8PA 4NI2B 1KAXA 1S1XB 1T9UA 2UXCF 2W40A 1GXUA 1T05A 1S6UA 4W5NA 3DWLA 1D5AA 3QGHA 4KTQA 1IM4A 1C4AA 3PW0A 2JVRA 2JGUA 2PE8A 1REGX 4ZJLA 4JRPA 4LR8A 4DTSA 1V3SA 3TZZA 2KT5A 2IA0A 4ILLA 3D54A 2GV1A 1WF2A 4BR7A 4LC9B 1R43A 1JQGA 4K5RA 2ASOA 1KTQA 1LFWA 3G8TA 1NPPA 4X4OA 4CZLA 3E01A 4N76A 4IOAQ 4LFCK 2MEWA 4ECWA 5H9FK 1FE0A 5F8LA 1LEOA 5AQKA 1S5JA 2IDOA 1OY9A 3OXLA 5HP1B 2OEMA 3SJJA 4FBTA 5HI7A 3MM7A 1P1TA 3RBXA 5GAEI 3R1XA 4WE1B 3M9OB 3VZHA 1VQSA 4B3RF 3LANA 1WOOA 4JKGA 1VMBA 3SYZA 2HEKA 3V9ZA 4OJ3A 4JD2A 4IJNA 4HKQA 4PYAA 4E89A 3OYHA 4CD1A 2ZJQL 1Y11A 4DV1F 4H0XB 2U1AA 3W8PA 1TUUA 1FNXH 1QZ5A 4JHDB 2CQBA 3FGUA 1S7IA 4HACB 3V2UC 3KKSA 3EXYA 4WQ5A 4WFXA 2NZTA 5EHHA 3OY9A 4DR2F 4J5OA 1OPZA 3T41A 4CZKA 3MR3A 5HOOA 3HL8A 5LSLA 1LW0A 2YNGA 3ET6B 4A5AA 3M8PB 2BANA 4NZ6A 2Z56B 2EXUA 4LRFA 2HBZB 2LXUA 4X65F 3T1HF 3NY0A 2OYQA 2CPHA 2VA2A 1S49A 4HR2A 3KKRA 1YG0A 2HQ3A 5HVFA 4DV5K 3MCNA 1VIOA 1VSHA 5D0RA 3J7ZT 3JB9k 1UW9A 2DR8A 2W1BA 1CBKA 1ZM3A 4KO0A 3LDQA 4M3UA 3EE9A 2HPUA 3M05A 4YDUA 3SLCA 4M5NA 4JI4J 4WFNQ 3S3MA 3SAFA 1UFLA 4CFAA 3V1RA 2GJIA 2YWEA 3O6QA 4KIAA 5L1LA 3SCJE 2PO4A 1IXKA 5JS1A 3H4DA 4C8KA 3MM5A 1QVGR 1XMQK 1HI1A 3KJFB 3NGUA 3T5LA 4O5BA 1CJTB 2KT3A 2KW4A 1B0VA 1TV6A 5IV3A 3IA0A 2WFBA 5CHCB 3M32A 2P5VA 4TQSA 3JYTA 4JKHA 2C3MA 2JVOA 3OL9A 3SXLA 1TUGB 3AVNA 3HBTA 2KTQA 2ZH2A 3NNHA 3NG8A 5F8HA 1RCOB 2WUSA 3W2VA 5ETLA 5EX5A 2A18A 5AXMA 2UUCK 1TKDA 2IJRA 1Z6RA 1HMVB 3C6TA 3LPEA 1UFKA 5A6WA 3TUJC 1NDCA 4M63C 1CVJA 1KRPA 3VTHA 1R89A 3L7UA 5E41A 2V2KA 2B6AA 1NWKA 3MMCA 1HQUB 1TTHB 5T41A 4ECUA 2OJ3A 3MEGB 4DQRA 4OIXA 4V19S 1VOMA 4Y3CA 4OJRA 4HDHA 2HBMA 2MGZB 1RQ0A 2AYEA 3GE9A 4YHHF 4RW9B 2NZ4A 3G9CA 3E3XA 2AQ4A 2LU1A 3OFGA 1KHWA 3WX8A 2KI2A 4XH4A 4DJBA 3JS6A 1ZM2A 1D8ZA 4ELUA 2F8TA 4H0OA 4FLUA 2O8DA 2RRNA 4PXBA 4WYLA 2FY1A 2QL9B 4EI2A 2W9AA 4JS5A 2VGNA 2XLIA 1YWXA 1GLFO 4M5LA 4C7QA 3KD5E 2MKYA 1HLWA 5GMKa 2P51A 2DCLA 2D74B 2DR5A 2HZVA 3FQKA 4CHOA 1DLOA 3TVZA 1C0UB 4ELVA 2DGOA 1HUXA 1FFSB 4EFAC 5F1XA 4PZVA 1R8AA 4IJAA 3JAMO 3DXKA 4A8XA 1ZOTA 4B3OB 1KXPA 9RUBA 3BSNA 3LDNA 1EO1A 4OO1J 4BVPA 3GYXB 2HNZB 3UE5A 4DLGA 2KJVA 1V3RA 3MN9A 3V6KA 4LSZB 3UB5A 2E7VA 3K8WA 4GW6A 2J0XA 2ZWOA 3C8YA 1NOYA 1RHQB 4ETXA 4BDYA 2CPIA 1NPRA 4J2AA 2ADBA 4Z2XA 4NLWA 3O9UA 1R31A 1BHNA 1J53A 5F9LA 1N33K 2KXHA 3KLGA 5CY4A 4J9UE 4CLPA 4RJVA 3J8AA 2P6TA 2C2NA 5FDLA 3ICLA 2AEMA 2BABA 2H48B 3BY5A 4DHVA 2V2ZA 4WYWA 3VZIA 3KLIB 1QQNA 3RB6A 2HZCA 4URSA 1SIWB 1IG9A 3ELHA 2VBZA 1F5CA 5LMUJ 1JLBA 2HMIB 4UY8T 1NRKA 1ZBFA 4RWXA 4ED8A 4ZVPB 3V6DB 5CE3A 2G8WA 4XK8C 3N79A 3OVAA 2JC1A 3GJQB 3VETA 5KI6A 1TL5A 2H65B 5AQOA 4BC9A 1SKUB 2C2EA 2QLWA 2FJVA 3G4SN 5KFUA 2KRRA 3MR7A 3GR1A 3OL6A 2DB1A 4ANEA 2RUSA 3QPIA 3CD5A 5FRNA 3VQCA 2AD9A 2I9SA 4YN3B 4AHUA 2E1CA 1NU4A 2YQ0A 1IH7A 1Z4UA 2ZUAA 3TAPA 3CO0P 3HKWA 1HARA 3M1FA 4K5SA 3HSTB 4L76A 2RQ4A 4AYBD 2A42A 4ES2A 3IS9B 3IR7B 3PW4A 5J1PA 3BGLA 2Y9HA 5KG3A 3BGRB 3JS9A 4ILJA 4CJ4A 1VQNN 1YHQN 1A0OB 3CD6N 5KFCA 2ZDPA 3CJ7A 2WZ1A 3PX0A 4CGIA 4LF4K 1ZAXA 5HMZA 4CDIA 2P9IA 3RZAA 3VA0A 4OZ3A 1YKWA 4DV4J 4A8FA 3S3OA 2DFHA 2C2MB 4PWDB 4QW9A 2ZJRQ 4RG8A 3T7ZA 1EB0A 4Q2LA 4H8KA 4MIBA 2ZOGA 2QO3A 3H46O 1U1KA 3CXCR 5KFIA 3B6BA 1NKCA 1TVRB 2WONA 3NP5A 1VHIA 4BBYA 4KHSA 3R2CJ 2V2VA 2B4JA 3T1YK 4MKAA 3NXZA 1JJ2R 2YTCA 4DCPB 2BMBA 3CETA 5CQGA 2DITA 2YKQA 2H5JB 1RU1A 3BH7B 2XEXA 4M5JA 3W7BA 4Q8FA 2Z30B 5BXIA 2HRUA 4ZHRB 3PHEA 2ZM6K 1S1UA 2R7UA 3Q83A 1S12A 4YB5A 2IC3A 4A59A 4CLZA 2A40A 3HHKA 1NEEA 2OZSA 2JFKA 3TWZA 4DFMA 3A2FA 4JOUA 2ASYA 4FOIA 2U2FA 5J1EA 1GMWD 3H42A 4EBCA 4X62K 4DV7K 4CHNA 1GOCA 1WORA 4LF7F 2ZC4A 1M5VC 3BF1A 4NLTA 3I6PA 3G87A 2XS7A 3GCXP 4CH1A 1VQYA 3OD2A 1VRUB 4MIWA 3VEZA 2FVQA 1L3KA 4OX7A 1JCGA 1VQMN 2ILZA 4EHUA 4YDUC 4USVA 3TSQA 1N88A 3HJVA 3L9ZA 2RQCA 1K73O 3U9DA 4DR1F 5CYQB 1WC5A 4JI8J 1N32F 1I51B 4DPTA 3KZBA 3CCSN 1RWXB 3OYJA 4OYXA 1FRXA 2X6SA 3LDSA 1VDHA 3KDOA 1CJVB 1VBKA 4ZPAA 5IOLA 1E6YA 1U0HA 2YPYA 4CF8A 3CDWA 3RBDA 2PI4A 3MZIA 2FSJA 1BWFO 2E7XA 2BW7A 4FL9A 1HHSA 4DSKA 1SH3A 2F8SA 3ZTRA 4IRCA 1F3FA 1CPZA 4QBUA 5JLHA 3W9IA 2GS8A 1D0EA 1U8SA 3UDLA 2C3UA 4E7HA 4BROA 1NXIA 2WTUA 2OELA 3D2FA 1S77D 3R27A 4X66F 2Q36A 4USKA 2BYCA 3CC2S 1HBUA 3GG1A 3CJ3A 4M5GA 3MFHA 3DRYA 4KHRA 3I8BA 1FXDA 3MCSA 3W1YC 4NXMF 1RBAA 4LF5J 2PAVA 4CESA 1LWEB 5K14A 2QI2A 2N4DA 4DX7A 4G3IA 1NGIA 1FRLA 5ETNA 3TX0A 3K17A 4UY85 2I6WA 4Q7AA 2LSNA 2P9SA 4IFEA 2VCPA 3Q7BA 2I5JB 3RUBL 3FCWA 4NCGA 2Z57B 2N3OA 1MROB 3MUMP 4A8QA 3QRPA 1H98A 4U9RA 3PW5A 3EO3A 3OTBA 4FDFA 3DDIA 2PMWA 1RHMB 5AQJA 4ZLJA 3ZTOA 4CJKA 1SKRA 2WOMA 4CJLA 5K8MA 5KFZA 3NRBA 2KDOA 2WSEC 1YJNS 4QOZB 3MX5A 3IR5B 3G86A 1NMDA 1Q95G 1XWLA 1UTAA 3H4BA 2ASJA 1RBUA 2QWQA 4CQ1A 4WTYA 2DY4A 1JJHA 2QL5B 1NU0A 2E1YA 4N5SA 1KC8T 3CJ2A 2F5GA 3S9HA 1NPKA 3D0GE 4DV0F 3O9RA 1WHVA 1NLKL 4FPRA 4CH0S 3HVTA 3ZCMA 3A12A 3AOBA 2VU5A 4DFPA 3BBBA 1X9SA 4NASA 2CGLA 2B9XA 3PYDA 2P8IA 2J7KA 1HYSB 3NWGA 4FO0A 1X5PA 4J9RA 4CYUA 4S0MA 5LSRA 3DLKA 2B43A 1NMNA 4L3NA 2Q66A 2UUTA 4H0VB 7AT1B 4EO8A 4FS2A 4JKEA 4DKWA 3LTOA 3AO3A 5AXLA 2DRBA 1EETA 2VPZB 1SL1A 4AHSA 5DQIA 3N6MA 4DR7J 3M6VA 3E2EA 1S9EA 3JQKA 4P9SA 2YWHA 3B54A 2A41A 4FW1A 5GMDA 1U1MA 4DTOA 1HR0J 2FJBB 3O4WA 1YIJN 2DVIA 1NGFA 2UXDJ 3G2XA 3SPYA 1ZBTA 3FZKA 2FB0A 2G1HA 4DPYA 2H1YA 2Y1JA 4PCQA 4Z94A 3WDOA 4QW8A 3HTVA 2MZ1A 2QLBB 1RTZA 2KXFA 1VR6A 3GQCA 1OQ6A 3LAKA 3I96A 5U47A 2IVOA 2FVCA 1S76D 4ILHA 3KK3B 3NNAA 1IBMJ 1HQEA 1BG3A 3LGNA 3ZSZA 5AE2A 3SCIE 3DM2B 1I94J 3ID6A 4ZCMA 2RKIB 3EZOA 5D4PA 4MK7A 2FY8A 4NE9C 3TQEA 1TL7A 2AMCB 3H5SA 3TVKA 4DBQA 1BLUA 3RG6A 1ZPWX 1GQEA 5AJ3J 2VYPA 3TTDA 1J6ZA 3KK1B 3KDNA 2DY9A 1PJ5A 2YKMB 2DNOA 1NK8A 1SQKA 2ZJPL 1SQFA 1M5PC 2P9UA 3RJMB 4B1WB 3QT8A 2LEAA 3T3FA 3OSPA 4U96A 2N7YA 4M95A 4FJ8A 2HLTA 3O8MA 5EWFA 2NXCA 4LVOP 1Q86O 3U4LA 3GSIA 4FVMA 4BHQA 2KYZA 2XMAA 5D4NA 1T94A 1YJWS 3VQQA 2R7QA 3CDBA 1QJHA 5L9XA 3FBFA 2F7TA 2ZGZA 5EDWA 3BZQA 1CJUA 4MQ3A 3CERA 2H4WB 1MDUB 1M5OC 4PQAA 1LCUA 4ED7A 1V4SA 1S59A 4K4VA 3WXMB 4PXEA 3LP2B 1G6BA 1W26A 2FF3B 2GV9A 4G6VB 3OVNA 3EZUA 3KVGA 2UU9K 2XULA 5D77A 1GH8A 3VR1A 1DQ9A 1IBKK 2W2MP 3G96A 1N34K 4CEBA 5LMUF 3SIPB 3J7A1 3TW0A 4U8YA 4I56A 1FK9B 4I9QA 4QOTA 3HHLD 3MD3A 4LFBK 1U1RA 4JI0J 1GLEG 1TKXB 1D1UA 3OUYB 2R7OA 2NUUG 5J2PA 3DDNA 3W60A 5GAGI 1EQMA 2M8HA 1UZHA 2HBJA 5C24A 1AFIA 4BACA 1WSEA 4OZJA 3VEXA 4XPCA 3SQ4A 4FF1A 3P4UB 4F3OA 3KUGA 5HBMA 2R7VA 1KAZA 1K9MO 4NRUA 4IOBA 2F4VJ 3NE6A 4ZPTR 1B4SA 3TA2A 3ZNJ1 4CLYA 1HKBA 1C0TB 2XBPA 2GJFA 3HK2A 2BTFA 4KI4A 4FXVA 3SDEB 5JS2A 1TZ0A 1RTDB 1RB0A 5HLFB 2LXFA 4QPTA 2HURA 4IRDA 3O44A 3IDHA 4F4AA 5ADXA 2OEKA 3ZXWA 2E6LA 2XB2D 2E7WA 4FLYA 2IDLA 1OMSA 2MPUA 2Z2YB 2JDJA 4DV4F 2VF3A 5KPRA 3OYEA 4NLBA 2ZOFA 1IKYB 4DB3A 1T03A 5I3PA 5IC4B 2YWGA 2JZ5A 2UVVA 4F3QA 3QT5A 4FZXC 4IOAL 2VBXA 1D9AA 2QTDA 2YX1A 1T05B 2GWKA 4CO5A 3ADAC 2XY5A 5E84A 5TKYA 4C8MA 4M5DA 4JS4A 3ZSWA 2RQMA 4CEOA 4F26A 1VRTB 1F2HA 2XZWA 1JK9B 3VF0B 3TAMB 3ENOA 4CTAA 2FC0A 4OLPA 1YX2A 3BQ2A 3E01B 3RYLA 4RX6A 5M1PA 1KHVA 1WTFA 2NZCA 2ZH3A 4P71A 4YB7A 2J6SA 4OX8A 4DQPA 3D68A 2NXUA 3NWRA 3MM7B 3P38A 3GU0A 2DGXA 3GFHA 5THWA 2F96A 3K59A 1HNXJ 1QSYA 3EDQB 2M4MA 3JQJA 4DV3K 3T5JA 4JKGB 2X3GA 3VV2B 3A8KA 1X7VA 1R7IA 4CGJA 4JD2B 4K4UA 2QLJB 3QYYA 1YAGA 4CJ7A 1CQMA 2NREA 2ZH9A 2ROGA 1OVQA 4JI8F 1S6PB 5B0AA 2NSBA 3KLEA 2KKHA 3MHYA 1U6BA 1NJIT 3QRRA 5BYRA 3BEXA 1XC3A 1CC8A 3CCTA 4DMNA 1VQLN 4XO0A 4WQ4A 1RZMA 3AA4A 4IQMA 1NGAA 3FVYA 2CQ0A 2ZD1A 5I3UA 1LW0B 2YNGB 3R2DJ 2BANB 2ATLA 3EGNA 2HIYA 4IYQA 4MTPA 1IN0A 3UKRA 3OXGA 3R5JB 4R0JA 4F3MA 4BY9C 3C65A 3NVMA 2BE9B 4JKFA 3ZFVA 4B3TJ 4DU3A 4HDGA 4CO1A 1VQ6S 3GCWP 3Q0AA 4B3MF 5DETA 1S9GA 1VQMS 4OYOA 4LF5F 4DSLA 4LMZA 1TKZA 2JHEA 4FBUA 5A2QY 4ZLNA 3V6JA 3AQPA 3QETA 3PO4A 3THYA 5IC6B 4OHZA 4RUHA 4JK7A 3OYMA 1QQOA 3C3LA 4WKRA 5E5NA 2AJ4A 3QNWB 5BYSA 5L39A 4FJMA 4DQSA 4Y65A 3W0LA 4K8XA 4UF4A 1WB9A 4DUYJ 3UE2A 4QQBA 1N36K 3EMTA 2Z2ZA 1RISA 2CJQA 1Y7PA 5KFLA 2UUAK 3JYTB 3D6TB 2MKSA 3WXLA 1BQNA 2RSQA 4CFCA 1XNRF 2VQFK 3QWPA 3GIIA 1L3VA 4JI5K 2KU7A 1RHRB 1MWKA 2PN6A 5F0WA 3W2VB 4LRAA 4FLZA 4AXJA 5ITHA 3UDEA 1ITPA 5BPMA 4RNFA 2GHWA 3SSSA 1ZYQA 1RT7A 2A6AA 3EPIA 2WHOA 1PIEA 4NLVA 2PZSA 5E3PA 3OL7A 1DBDA 3H1QA 2EFQA 3C6TB 3NAHA 1W9HA 1TUYA 4DR5J 2V4RA 3E1YA 2DFFA 1XMOJ 1NSAA 2B6AB 3MMCB 2Z8QA 4YB1P 3RVCA 3OJUA 5EWGA 2YV0X 3MAAA 3P96A 1IO2A 4F4KA 1Q7YT 2G2ZA 3VAJA 1VQ4S 1B7FA 4AHRA 2PEBA 3TZXA 4DR7F 1PYOB 2GMHA 4I7FA 4G1IA 4M1KA 2O8EB 1W7AA 3UR3C 3VPZA 4JI3J 4R79A 5M2PA 3CTRA 3QNOA 2YKNA 2B0GA 2UXDF 3E9LA 1XBWA 2VBYA 3ZX0A 1QAXA 4DR3F 1C1CA 2O8DB 4M3XA 1IJJA 2FJEB 5AE1A 1I6JA 2HIQA 4RCHA 3R1HA 2KG1A 1TP7A 4CZFA 2CUYA 1Q82O 4GC7A 4E7IA 2V4QA 2E2PA 3CO9A 3IRXA 2LP4A 4F02A 1ASWA 2D3ZA 1V9OA 1WEYA 3O6WA 1YJ9N 4C11A 2BE2A 2QRRA 3W3DA 1TGOA 4LF6J 4FJHA 4DUZJ 4ECSA 4DWIA 3A5LC 3TVYA 1ZBHA 1I94F 5A8WA 4CH7A 2AGPA 2ZNYA 3CCRS 1FFWB 2BJ3A 5IS2A 3R5AA 4HI2A 4BRIA 2YKOA 4USMA 5ETRA 1LWXA 2X6NA 3LP3A 4PKDB 3ULEA 4OFZA 3M6XA 3KLGB 1V5IB 3FC9A 2QYCA 1OO0B 2CPEA 5K8PA 5FDLB 3L2QA 5BRHA 3IR6B 3O8WA 1D8YA 2K8GA 1QAYA 3KHRA 3S1TA 3MCMA 2CJ9A 3GV8B 1RT3A 1DAXA 1PAUB 1AW0A 4V1Ak 3ULHA 4CO3A 2FC8A 5KPTA 2FGOA 4E2FB 1C0GA 4BRGA 5L1JA 3GLJA 3T9ZA 5JVGQ 2XCPA 5KAKA 2ACYA 2UXBJ 1CG2A 2QEXS 4NCAA 5AQQA 3IMQJ 5ETKA 3L8BA 3GONA 4HT7A 3CCMS 1NG9A 3QGPA 3DOMA 2X1FA 3OA9A 5H1SV 1B64A 3H1VX 4MDBA 4KFBB 1XQSC 3OTOK 3AFGA 3MWPA 1F0XA 1RDRA 1AFJA 3FSXA 1LXJA 3CJ8A 4RTFD 1AUSL 1BDGA 3MPUB 4FVUA 3UD3P 4MO5A 4CBXA 4HH0A 4HVJA 1AYEA 3CDAA 3P39A 1WOSA 4DL5A 5JUMA 3WXJA 1T9WA 5LOQA 4K2JA 4JI0F 1VIXA 4CLSA 2HKEA 3GJRB 2JSXA 4OKEA 1FTRA 5KFVA 2YKPA 3MPYA 3GPAA 2MSSA 3VVTA 1UVKA 4JI6K 4ECRA 4RR5A 2P9IB 5ADZA 1XQIA 1HNZJ 3OT9A 3WHIA 2QYGA 2HFSA 5CD4H 2F4VF 3QJJA 3FZBA 2WSCC 3OTEA 1T3NA 2J9CA 3NGTA 4LF2A 4OZNA 4FJLA 1T6DA 4CJSA 5KFGA 1AROP 4OV6A 1G3OA 4IG3A 2CPDA 1NKBA 2FBVA 1S0VA 3OJSA 5JVHQ 1TR0A 4FPIA 2OMLA 2P5OA 4DR6K 5BRDA 4DV6K 2CG4A 4IOCL 4WQ4C 1BWVA 3ILLA 2HGMA 2G1DA 5G0RB 3CMES 5FPEA 4QWDA 1LV5A 2OKQA 1ZA1B 4NRTA 2DT9A 4WFBQ 3CCUN 2R2UA 3AD7C 2IC3B 4B3SK 3EGZA 1K8AT 2ASDA 1UVNA 3KUEA 4OZLA 4X4QA 5J1EB 4BQZA 4CGFA 4IFYB 2PD1A 1EARA 3L0QA 4FZVA 5AQPA 3C6UA 3G25A 5KRTA 1LXNA 5DRKA 3N28A 4BRNA 2BRKA 3W5ZA 4EWTA 5AQMA 1M5HA 5DLGA 3RR7A 1NZ8A 2HHVA 5AQRA 4MYTA 2HS3A 2LDYA 4AM6A 2GO9A 1N5VA 2GMJA 4A2AA 2Y3YA 5DZ6A 3CDEA 3LZJA 3RBZA 1P90A 5F8GA 1FI4A 4QPXA 4A57A 3D67A 2KM8C 5KFYA 3C15A 1U26A 1WSVA 4ZPWR 3NDKA 3AA8A 2OPQA 4ENOA 4FF4A 4OPAA 2D0OA 1N5QA 3RRHA 1U0HB 2CJAA 1CEZA 4LF9F 4P7VA 3E51A 1RNHA 1JL2A 3PRVA 3W8GA 2YJEA 3DLBA 3L4BC 5HJXA 2GBZA 1HNXF 5FPDA 3CVKA 1VK0A 1CLFA 4AFFA 3D2FB 2RUGA 5EX3A 5G4DA 2YHXA 4TU9A 5L46A 2CPXA 4YFUA 1X4DA 4CGHA 4RNNA 1XNQK 5IT9Y 3B4MA 1X8DA 3BF3A 5K14B 2ZH6A 4OZ1A 5GAEU 2PBDA 1Y9OA 1H3DA 3HULA 4NYFA 3QFWA 5BPNA 1FXLA 1HKCA 2P9SB 1FRJA 3MPVA 2IBKA 3P6YC 1QAJA 4NCGB 1EX8A 2MDAA 4J2EA 5F8JA 3ENQA 1JL1A 2ITMA 3TAQA 4LFCJ 2E1ZA 5H9FJ 4LIRA 3TQ1A 4CT8A 3MF5A 2ZOMA 2JX2A 3RMDA 1YJ7A 3M9MB 3TI0A 2GTDA 2GA7A 4LY7A 4JKAA 2AYGA 3VHQA 2WOMB 2HHWA 2R8GA 1S6QB 3V9SA 1RGIA 5AQWA 4B8CA 1EP4A 3SI6A 1P9YA 2D0AA 4JB8B 4USTA 2JEFA 1D4XA 5M2RA 3SV4A 1O6XA 2CQ2A 4C98A 4YY3F 4KPCA 3TR8A 3NCIA 2CZ4A 1Q81T 1MMDA 2MZTA 4ILRA 3HVTB 3QNNA 2E5IA 5GADI 1Q8BA 5CZXA 4IOXA 2V7ZA 2BJDA 1D9FA 2IVFB 4MAKA 3ENVA 1PO6A 1OY8A 4CJEA 1RILA 4GVBB 4Z4CA 1H2UX 4O44A 2CXEA 2BR0A 3EE8A 1EETB 3PHTA 2G13A 4DV5J 1FDAA 4I2QA 3G8SA 2E29A 2HVHA 2DGSA 1QUPA 2IVMA 2QN6B 1H0HB 2G4BA 4MT1A 3A0IX 2CNLB 4XDDA 2W41A 2LKZA 2EKNA 1T9TA 3J7YU 4CJRA 3LDOA 2R7WA 2YNFA 1QM9A 1URRA 1K8KA 1ICEB 3LA0A 4FNHA 3HSJA 1VSLA 2AJQA 5D8HB 2NYHA 3FJ2A 4K42A 3AY0A 4KBIA 3SMZA 4UOGA 4CIGA 1XMQJ 1F21A 1C2PA 1S99A 2Q6CA 1TK8A 3UIQA 5JXSA 1NJZA 1T8EA 4RWTA 3CI5A 1WG1A 2JFDA 3O3GA 2WSFC 4V19X 3HF5A 3IM8A 2HBRB 1VQ7S 3VQEA 2ZQBA 4KC5A 2QW9A 3T69A 1BY9A 1RGVA 1HJOA 5T7BA 4N7TA 2G8VA 3EGVA 1TL7B 1YZ6A 5HL7L 4JI3F 1QD1A 1IQTA 2YKAA 2YHYA 5A2QU 4X4SA 1QUVA 1YTAA 2QKKA 2IM1A 4NCBA 4B3RK 3UVJA 4CIFA 3K58A 5DLFA 2UUCJ 3NF6A 2P9UB 4KHQA 4WU2A 2HBKA 2E1AA 2QA1A 5KG0A 4M8LA 3I5BA 3CJRA 2X51A 4Q2MA 3WEEA 2E8AA 4LF6F 4BRDA 4RW7A 2M7SA 1TL4A 5HJYA 4UQTA 4CEDA 2FYXA 1NHKL 4ER8A 2UYTA 3CCES 3TJ8A 1JXVA 4DTMA 5BPLA 2E9TA 5IXUA 1F5AA 3ENWA 2RMLA 1A5WA 1RJJA 2IIRA 2ROPA 2C2KB 4X65K 4YOXA 2JH3A 3RW7A 5TKWA 1B0TA 2QFJA 4GKJF 4I69A 3N4PA 5A2QO 3GZ7A 4G1QB 2D4WA 1MW7A 3DXMA 3CGIA 3N4QA 3LZIA 3ENAA 3RRKA 1W97L 3VVUA 4PG5A 4W98A 5E7OB 4G65A 2FHJD 2ZDOA 1KVJA 3CC7S 2VFSA 5B08A 2XHCA 5K9FA 4K7QA 4QWCA 4CEEA 1G15A 2CJKA 4O8KA 3AVFA 2ZJQQ 4WWSA 3PFOA 3QB0A 3KLVA 2UXBF 4I9LA 1RHUB 4CZEA 5J2PB 3SMPA 2GIRA 3ILIA 3IFRA 2ZKTA 1VQKN 3RW6A 2V50A 2MQQA 5HBMB 3FMBA 4A48A 1KFSA 2X7IA 5DDQC 2HAIA 4DCHA 4WK1A 3AHPA 1N33J 3W65A 4JYAK 4KGZB 4F7VA 4RPFA 1WC4A 4CHQA 1UW4A 2CZ9A 2FJAB 2PSZA 4KHPJ 4DU4A 2R3VA 4RW6A 3CT9A 2CPJA 1KD1T 4OMFG 4F9OA 3MM8A 3CE8A 3IRWP 3M7VA 3JSBA 5AQTA 1IBMK 4HL9A 2ABYA 4F50A 2OPPA 1T9XA 2OFGX 1FKPA 4FYDA 1SIZA 2CH5A 2HHPA 2HQCA 3HHEA 1S5ZA 1HNZF 3N6LA 1NDKA 1RACB 4MDAA 2DD8S 1T03B 2GAHC 3DC2A 3DRPB 1FT8A 1RAHB 3F9KA 3HPGA 3ZLJA 2V7YA 3IN5A 3Q2TC 3KJQB 3NGZA 1VQ8S 2GVDA 4CBUA 3A3NB 3GMGA 2D9PA 4PUOB 5AFUH 2MLXA 1U2CA 2QJ3A 1L3SA 2IY5B 3A3PB 1NZAA 4QCLA 1HQUA 3ZYYX 1U1OA 3MEGA 1WF0A 4X84A 3UNGC 2D3OR 4HHHA 3DLEA 1X9WA 1N5SA 2VDIA 2MGZA 5C7PA 4J2DA 2CZVC 3ONQA 3OHAA 1RBSA 1R59O 4ZVQB 4LF4J 1U1LA 1K6YA 1RDBA 5HRPA 4WFZA 3MOZA 3MR6A 3SQ2A 1SAZA 2FZKB 4OI3A 4WZMA 1NGBA 1QE1B 3KHHA 4OPKA 4C0BA 1P8GA 3VQ5A 3NCPA 2A1RA 3CPEA 3MM9A 3NNCA 4FWMA 3P31A 3NEKA 4KTZA 1RBLA 1NGDA 1C0UA 1IR2A 3MR5A 2ZHAA 4U7UD 1EX4A 1XR6A 2IGIA 3T1YJ 3KLEB 3AOAA 2VGMA 2D5RA 3AVGA 1XMBA 2FSNA 2M88A 3WNHA 3TEGA 2E2QA 3BPSP 2HS0A 3CCLS 3IXQA 2ZM6J 3G6XA 5E26A 2ZD1B 5F3ZA 4KHNA 1TMMA 3TNVA 2DH9A 1WKLA 4O3PA 2VD3A 3TO8A 4FF3A 3U02A 1BE4A 3QESA 2DBBA 3DXSX 2MHEA 2XO6A 2ZVSA 4PG4A 3GV7B 1JJ4A 1HKGA 1GLLO 4X62J 4DV7J 4ZVOB 1S9GB 2FZGB 3K5PA 3KLIA 1DFDA 1TKZB 4ZVGA 4J9QA 1NKEA 1K1SA 1EKSA 2QLFB 4AH9A 2HMIA 3THYB 4JN4A 4FCYA 1C0MA 2OTLS 1WAJA 3T9NA 2KM8B 4K4WA 3Q2SC 4Z4FA 3ZZOA 1LKZA 4N47A 1G4CA 2HQGA 1WOPA 2I7PA 1KAYA 3NCRA 1MLAA 3HYFA 3VAMA 2HMPA 1YVFA 1FERA 5HO4A 3ETOA 3FE1A 3PUFA 3V1QA 2BBEA 1BQNB 4BRAA 3D6MB 4USIA 2W2PP 1M1GA 2BDPA 2LVWA 3ZC4A 2J6TA 3I5CA 4RNOA 2GGPA 2HHSA 1OH8A 3WIUA 1GT8A 4EUVA 4XH5A 2BA9A 4P2MA 3JSYA 4UY8O 3X3UA 3CIZA 4B02A 1UEVA 1J2VA 3KG0A 3OV7A 4B9TA 3M8YA 1ACMB 3EPGA 2RPIA 3H25A 3IO1A 4CCHA 3A4TA 4YR3A 8RUCA 3JSMA 1OKJA 2Z1JA 3BGUA 3NKYA 4KYZA 3ZZZA 3BN4A 3D6FB 4YOUA 3TOQA 1KDNA 4ECYA 1S1VA 1WSIA 1WTBA 2J8AA 2UUWA 3TA1A 3HLUA 3MAAB 3PTWA 1WLJA 4CZMA 3SAGA 4AHCA 4N77A 4DXLA 4DV5F 1YZ7A 3CB4A 1JXLA 1VLOA 4BQLA 4GRSA 4I7FB 1BIUA 2G0CA 1SC3B 2AZ3A 5DM6L 2RE2A 5ETOA 1MNEA 2EEYA 4CM2A 3QBWA 2GHPA 2YKNB 4WIIA 2FBXA 2PMZD 1C1CB 4ZHRA 4LREA 4LF7K 1SVDA 3T6JA 1HWLA 1HIYA 1B3TA 1F60B 1CZBA 4IR9A 3EXCX 3R5DA 4J2BA 1VI7A 1FJ7A 4P2XA 1NDPA 4ZPCA 3IRXB 5AQZA 2QWLA 1WELA 4KHUA 3MFIA 3MTKA 4WPAA 3THTA 4C11B 4F0HA 2E1RA 4DR1K 2A5XA 1IR0A 1BA1A 4I4BA 3VQPA 2C2DA 4BRKA 5A8WB 1SL0A 4A46A 1H6KX 4OX6A 4WP3A 1M1KT 3KG1A 4MIAA 2P5GA 3TTFA 1E4GT 3OHBA 3BYRA 3HO1A 1UEKA 4NLUA 1WSHA 3TTCA 3CJ0A 4DCJB 5KT7A 3W9JA 3HVAA 4OVLA 1WACA 1N52B 3ULEB 1EXQA 2DK2A 1PSDA 4X66K 2GO8A 1GLDG 2VUGA 2KVIA 2XY7A 3U7JA 4HTLA 3MUTP 1XEZA 1H2TZ 2RDJA 5IT0A 3CCJN 3MAHA 1RT3B 2IM0A 1RWVB 1YDLA 4PHTX 3BS9A 3W61A 2V8GA 5KT6A 3GG4A 2ZNZA 2G0JA 1QVFR 3MMAA 4ISGA 4FYYB 5DG9A 1Q78A 2YNIB 4QR0A 4DFJA 2L9NA 4ANDA 2MYFA 4ZJOA 4UQGA 1HL6A 2FQQB 3D3BJ 5HVGA 1KKHA 4ZPBA 1X4FA 1YQHA 3DOMB 4NEYA 1RP5A 2ADCA 3D4JA 4CJ5A 1FJGK 3T5HA 4CK2A 8AT1B 1QQCA 2DXDA 3C95A 2MY8A 1H2VZ 1T0TV 2KVQE 4FWOA 2GELA 3IFEA 5JMVA 3IAS9 1UVMA 1S57A 3KK2A 2ZBCA 3VQ7A 2DRDA 4X4NA 1IR1A 2EG2A 2KHOA 3OYLA 4BR5A 3EZWA 2B5JA 5AQSA 3MD1A 5KFEA 2YI1A 4CLLA 2DNHA 4B1ZA 5GAGP 3DLGA 2HFZA 2ZZTA 4BGBA 1FW6A 3HT0A 1VSEA 3HSGA 3I56S 1UAWA 2QA2A 4FJXA 2OEJA 4RW8B 2Q0RA 2W7OA 4W90B 4IH7A 4P52A 4XDCA 5ETQA 3EWGA 2C22A 5AQGA 2OPRB 4BR9A 2AJ1A 3SV3A 3RB0A 3EE3A 4I64A 1YK9A 2OCEA 3BPDA 4F4XA 2FSKA 3H45C 1DZ5A 3HFZB 2BV3A 3CFRA 1RFQA 5K5MA 1YITN 1CQNA 1G99A 2X1AA 3HZ6A 5D4OA 5KG2A 3HKZD 3GSDA 2WVEA 3SBGA 2ETJA 4QJVA 3OLAA 2ZZMA 4Y34A 4IG3B 1S4EA 2LQJA 2KQ2A 2E2NA 2UU9J 2CDQA 1FKAF 1VC0A 1IBKJ 1HYSA 4IRKA 2DPIA 2MY7A 1N34J 4UZBA 4I6WA 2VONA 3I4PA 4O5FA 3MURP 4KH4A 3BGOP 4CF2A 4C8ZA 1M0SA 5F8MA 4C9DA 4LFBJ 2GCFA 1TELA 2DIUA 4TN2A 2AYMA 2DTJA 4KV8A 4KHMA 3IG1