4RW4A

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
554
structure length
538
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 145
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw4A05
2G8FA 3OYBA 3MEGB 4CJLA 3AO5A 1C1BA 1KFSA 3VQQA 4OLAA 1VRUA 2GV9A 1OS5A 4J9LA 2Y1IA 4CF1A 1K1QA 3SCXA 1TK0A 4BWMA 1N48A 1T03A 4G3IA 1ZBHA 5J2NA 1TKZB 3UQSA 3ZT1A 3DRRA 2I1RA 1RDRA 1WNEA 4RNFA 5F9NA 3V6KA 1RTHB 4EBCA 1ZYQA 2WOMB 5F8JA 3I5CA 3CM6A 3TAQA 2FLNA 2VG6A 1WNSA 3LAMA 4B08A 3K58A 4Y34A 1RT5A 2BANB 4ZPCA 4EYHB 5DGAA 1RT3A 3V1RA 4CEOA 4E3SA 3PVXA 3DLKB 3PJWA 1GOBA 2KZMA 5KFDA 4FS1A 1REVB 2VG5B 3L2QA 2DPJA 4ECUA 4K8XA 1WSIA 1NK7A 3KTQA 5FRMA 5J1EB 3KLGB 4ZP7A 1HYSA 4Z4CA 3V1OA 4FYDA 2OPPB 3OYAA 4JRPA 1BISA 2KW4A 1QUVA 4NLVA 3BSAA 4GVMA 4PQUA 1KSPA 4ZP9A 2R8KA 4WXOA 5KFOA 3QYYA 2O4IA 2VA2A 3H08A 2VA3A 1S97A 2F96A 4NCBA 3AVGA 4E7LA 4TSXA 3CJ2A 4ZMMA 1WAFA 4ECYA 4KBIA 2RN2A 5FRNA 1SUQB 3IS9B 3NCIA 5CYMB 3IRXB 3OYLA 4IG0B 1JLFB 3ITHB 4F8RA 1RT4B 1IKVB 1XC9A 4B8CA 4KO0A 3EZUA 1WAJA 3VA3A 4CJQA 3OL7A 4QWDA 2IJNA 3BDPA 3T5HA 3QIPB 2W8LA 1IH7A 4CIGA 2IC3B 4NZ0A 1RTDB 2BRKA 2FC0A 1SL1A 4KHQA 3H59A 4CFCA 1NJXA 3SZ2A 4HUFA 4DWIA 1JLAA 1RDBA 1JLGA 2HHTA 3HPOA 2OPQB 4C8LA 4B3OB 4RW9A 3V9SA 2R8HA 3NHGA 3EZ5A 1C0UB 1S1WA 2YKNA 4AHCA 1KHWA 3HM9A 1SH3A 2B4JA 2FVCA 3AA4A 4IH7A 4DSIA 3VQSA 1NJWA 4BWJA 4C8OA 4I2PB 1XR5A 4J9NA 4LSNB 1S49A 1XHXA 4RUCA 3FSIA 3CVKA 1BI4B 4CGJA 4N47A 2HAIA 3GIIA 4CK3A 3KHHA 2FLPA 2I5JA 4DL4A 3LALA 4ZVGA 3KHGA 3TAMB 3CJ4A 4W5OA 2ZE2A 3DYAB 2IM1A 1UA1A 4PA1A 1FK9B 4RUAA 3HT3A 2R7YA 1TVRA 1EP4B 4OL8A 4MQ3A 3M8QB 2YNIA 4I7FB 4CJFA 2BE2A 4CFAA 2HNZB 2XC9A 3S3MA 4I9LA 3K5OA 1RNHA 5J2MA 5HBMB 1NHUA 4KREA 4Q5VA 4ECSA 3ISND 2OZMA 2ZD1B 5KFPA 4DTPA 4K4WA 4FVMA 5J2QA 4FK2A 1Y97A 1HRHA 3NAHA 3OYFA 4DSFA 3L2VA 4I2QB 4FCYA 3K2PA 1BQNA 1FKOB 1JLEA 3OHBA 1QAJA 2JEJA 1DTTB 2XCAA 3DRSA 4Q8EA 4NLDA 4ECVA 4I9QA 3VQ8A 4O3QA 1CZ9A 1JLBA 5KI6A 2E9ZA 2RDIA 4IOBA 2AGPA 3PX0A 3S3OA 4E19A 3V6HA 4KB0A 1BQMB 4M95A 2ATLA 4G1QB 1D5AA 3K5NA 4DF4A 4Z4EA 3DMJA 3NAIA 4CF0A 2IM3A 5CZ2A 4FLZA 4JS5A 4CCHA 1QSSA 2NUBA 3KLIB 5KG5A 1A5VA 3NF6A 1S9EB 2IAJA 4FLYA 3TANA 1L3SA 4F4WA 5KFXA 1IKWB 1KFDA 1RTJA 4CERA 1J5OB 3RMBA 4TXSA 4JV0A 2HWHA 4H4OA 4FLVA 2DY4A 3NH1A 4IH5A 2V4RA 4QW9A 3DM2A 4PWDB 5KT2A 4RNNA 4RW6A 1D8YA 5FDLB 4PQUB 1TQLA 2UVWA 1VSLA 1U48A 4RW7A 3V6DA 5L1JA 4ECXA 3CFPA 2B5JA 3ZSZA 4IQXA 3NGZA 5KG4A 5E41A 4FM1A 3QEXA 3LANA 3MTKA 3UIQA 3KK3B 4ZHRA 4E1NA 4RW8B 3IN5A 1WSJA 3OL9A 5F8GA 2IM0A 4FXDA 4QWAA 1XR6A 4WZQA 4RG8A 3KNAA 2V4QA 2R8IA 1K1SA 4ZPDA 1RBTA 3G6VA 3QO9A 2X78A 5C24B 3KD5E 2D0AA 1KHVA 3FQLA 1FKPA 5KFQA 3VQCA 5C25A 3M8PA 4CHPA 3TWHA 2XI2A 3NGYA 5JS2A 3P5JA 4HUGA 2ILZA 4ELUA 1VSMA 1T3NA 2YNGA 3F9KA 4IG3A 3OSPA 4CEQA 3EY1A 4FJNA 4CF8A 1JLGB 3CM5A 4X2BA 4YFUA 4RW9B 3CJ0A 4HYKA 3AA2A 2AU0A 4FZZA 3VQEA 4YR2A 5SZTA 5D3GB 1C0TB 1NK4A 4F50A 2G8VA 5C5JA 1NOZA 4AH9A 4TLRA 2R2SA 1D0EA 3GQCA 4KPYA 3RB0A 3QGIA 4KTQA 1S1TA 3G6YA 4KHUA 2YNFB 4J9KA 4KE5A 2ASLA 3WNFA 2RDJA 4Y2CA 5CYQB 3LWLA 4ZPAA 3MEDA 1K6YA 1GX6A 3AVCA 3OYKA 5K14B 4Q44A 1RT6A 4ED2A 5CZ1A 4O3OA 1R0AB 4DLGA 2KTQA 1I3AA 5HRSA 3GV7B 3L8BA 1LV5A 3BSOA 4K4XA 3I5BA 2W9BA 1S0MA 4R8UA 3QNOA 1DLOB 4O0JA 4EO8A 3NBPA 2AWZA 4XPCA 3I0RA 4YR0A 3MR2A 3LP2A 5F9LA 1RT2A 3FDSA 3AVBA 4WYLA 5KG2A 1CXQA 4J9PA 4CFBA 1TGOA 2WK4A 4OPJA 2WTFA 2E4LA 3PR4A 3E01B 4F3OA 4HKQA 2D3ZA 1IKYB 4LD0A 4IFYA 1JLEB 2EC0A 4ICLA 1S1XA 4ED6A 2WONA 1BCOA 3K57A 2FBVA 5I3UB 3DOKB 3IG1A 4NLSA 1MMLA 5HROA 2ASDA 4OKEA 4IR9A 3I0SA 4ID5B 3SUPA 4OJRA 4CHYA 1XWLA 1TL1B 3OYGA 4TQSA 2DPIA 4AHVA 1CZBA 1HJRA 4FK0A 1ASWA 1S1VB 3ZSWA 3ZT0A 3L3UA 5I42B 1O1WA 3E51A 1A5XA 2ASJA 4UQGA 3RR7A 3O4NA 2V9WA 5KFMA 4NLGA 2R8JA 3PW5A 4CESA 4MK8A 1JL1A 4FW1A 4KHSA 2IGIA 3SUOA 3K59A 3PJXA 1RA6A 5DG9A 2B43A 1DTQB 1B9FA 1RCHA 3HJFA 4CHQA 3PX6A 3V9WA 3MEEB 2XWYA 5KT5A 4IDKB 2DFFA 3OL8A 4JLHA 4B9LA 4DU3A 3KK2B 4K4ZA 2HNDB 2E9TA 1S5JA 4KI6A 2HNYB 3JYTA 1S9GB 3PR5B 3L2UA 2ZQBA 5DG8A 3AVIA 1VRTA 1HQEB 3V81A 4ZVFA 2W9CA 3Q8QB 3QETA 3QLHA 2BQ3A 1S1UB 3OLAA 4TY8A 5EWFA 5J2PB 1UWBA 4F3TA 4NYFA 5KG1A 2A1SA 5DLFA 4DSEA 2HMIA 4KAIA 3QEIA 3H5SA 2B6AA 4HTUA 3V9XA 3RB6A 4PY5A 2YNHA 4WFZA 3H5XA 1YT3A 3SI8A 3OYDA 4DLEA 3RMCA 4WZMA 4C8NA 4CGDA 2OPRB 1W25A 1IG9A 4DTRA 4YMEA 3KKSA 4RW4A 4FJLA 4Q45A 2AQ4A 1Z26A 4RZRA 4DL6A 2FJXA 2W7OA 3NMAA 1KLNA 4CJUA 1HNVB 4CEBA 4IFVA 1C2PA 1HYVA 3LP1B 3KLHA 3OYEA 3RMAA 4ECTA 3ZT2A 2GUIA 2ILYA 4M3RA 3HVAA 2BR0A 1TP7A 1IO2A 3C6TB 1LW2A 4QWBA 3DRPB 1NKCA 3DOLA 1KRPA 1J54A 4N56A 1XHZA 5T7BA 4DTUA 2J6TA 1TKDA 3MECB 2ALZA 4Z4FA 2AJQA 3ULDA 3KLFA 4LH5A 1HNIB 4Y1DA 1X1PA 1N4LA 4IRKA 3C6UA 1RDAA 1EETA 4W5NA 4TQRA 3G6XA 4CK1A 1NHVA 4FLWA 2J6UA 3OJSA 2EHGA 5JXSA 4DG1B 1YTAA 2VWJA 3LP0B 4QW8A 4DL2A 4W5RA 2KFZA 2F8EX 2RPIA 1ASVA 3DLRA 1KLMB 3HXMA 5F8NA 1TL3A 3MXMA 3SQ1A 4E7JA 1X9MA 3CIZA 4WE1A 4B8AB 5HLFA 4FLXA 1MU2A 1F21A 5DQGA 5KFNA 3SV3A 3AVJA 3CG7A 4JRQA 4DS5A 5F8MA 4Z4IA 3PW4A 2AGQA 4DQRA 1TKTB 3M8SA 4DQPA 1HQUB 1RDDA 4O44B 3TAFA 3KJVB 5CY4A 1S6PA 4ICLB 2FVRA 4Q0BA 3KLEB 5KFCA 3ZT3A 4URGA 1TAQA 1JXLA 3AVKA 5HP1B 4KFBB 3SPZA 2V0NA 2E6LA 4JV1A 2VG7A 1RT1B 4OLBA 4ZP8A 3AVMA 3FFIB 2HVHA 4JUZA 3DLGB 5EU7A 3TABA 2XCPA 3LPTA 3VQBA 3SNNA 4K4UA 1YTUA 3QIDA 2Z1HA 4FS2A 3NL0A 5HRPA 5SWMA 3BSNA 4CJRA 2DTUA 4ZTJA 2PZSA 3KK1A 1QSYA 4Z4GA 4J9MA 1LWFA 2Q3SA 3V4IA 4DEZA 4FJ5A 5DGBA 5KFKA 3NF8A 2HB5A 4U6PA 4E7KA 3AA5X 3CDUA 4NLQA 2UVUA 1RAJA 4DMNA 4JV2A 3AVFA 3OVNA 2PYJA 3UPFA 4DTMA 3VQPA 3O3HA 4KV8B 4E7HA 1X9WA 2X6NA 3AV9A 3PY8A 2YHAA 1RTIA 4FJ7A 2ATQA 1LWEB 4HUEA 4MFBB 2R2RA 4W5TA 2BQRA 1HARA 1VK0A 3ISNC 1LW0B 4Y3CA 1W9HA 4NRUA 3HVRA 3AO2A 4XPEA 1RDCA 1JLQB 4FM2A 4KKOA 1T94A 1QE1A 2FBTA 2KFNA 1Q9XA 3OYNA 4N76A 1SKRA 1HMVA 5EWEA 3QEWA 3MFIA 4E0DA 4H4MA 2D0BA 3SQ0A 3HPHA 2XY8A 1U45A 4URSA 3HVTB 3CJ3A 3KIOA 3LZIA 1XI1A 1YVUA 1C0MA 4FLUA 3PW0A 1JKHA 4E7IA 3QGGA 4CJSA 1N6QA 1N5YB 1ZETA 1KVAA 1SV5A 4O4GA 5L1IA 4QPXA 3QEPA 1C1BB 3ZT4A 2D41A 4R5PA 4B9VA 2OPSA 1VRUB 4AHTA 1RYRA 4NLXA 3KMQA 3DLBA 1U49A 1T03B 4NLOA 2RKIA 1VSEA 5J2NB 3ZSXA 1JXEA 1YVFA 5L9XA 4KB1A 3DRRB 1B92A 1T05A 3N6LA 1L3UA 4NCGA 3WNHA 4KI4A 4FJIA 1VSHA 3PW7A 2VG6B 1QSLA 1RT5B 5EWGA 3U3YA 3ZSVA 3RRGA 3SUQA 1RT3B 4KB7A 4HVJA 3KMSA 1BIUA 5KTQA 4LY7A 3T5KA 4CJEA 4AHSA 4CEAA 4FJHA 4K4YA 3CDEA 3OYHA 4NLUA 2IMWP 4J9SA 3O3GA 3RB4A 3BQ1A 1RT7A 4M3TA 3OJUA 2PY5A 3CQ8A 3L2RA 3PO5A 1HYSB 3TAGA 2YKMA 4CK2A 4HCBA 5KFYA 3LAKA 2R2UA 3VQ5A 4KHYA 1HPZA 4J9QA 3LDSA 4EBDA 1WSGA 4TY9A 3QZ8A 3OS1A 3HK2A 4DU4A 4ZVHA 4FJ9A 3MXIA 1L3VA 3BSCA 2RF2A 4R0EA 1ZBUA 5KRSA 4M45A 4IKAA 1SL0A 3ZSRA 3DLEA 1I39A 1S6QA 4CIFA 1S0OA 3L3VA 3BGRA 4ED8A 2G8WA 2D7SA 4M3UA 4KO0B 1C1CA 2G8KA 2W7PA 1D1UA 3DI6A 3U6FA 5KFEA 4H54A 4IR1A 1IKXA 4DFKA 3D0PA 1JLAB 4C8KA 4K50A 3IGVA 1B9DA 4Q43A 3JSMA 1TKXA 5FROA 5C42A 2F8SA 3RBEA 3UDLA 2HHWA 1S1WB 2YKNB 3THVA 4LSLA 4DSLA 4BDZA 1ITGA 3S3NA 2IOCA 4CF9A 4CEDA 2JEFA 3MEGA 2OH2A 2QXFA 1A5WA 3QGHA 1UAXA 2AGOA 4DTOA 3S9HA 2G8UA 1Q9YA 3LPUA 1TKZA 3G10A 4ED0A 3LWMA 4FZXC 1T8EA 3N6MA 4CJKA 4NLTA 1RTHA 4FJ8A 1S4FA 1XR7A 5KFUA 1SL2A 4HCCA 2I5JB 1RBVA 1JLCA 5KFHA 2BANA 2W8KA 4OGCA 2ZE2B 4Q8FA 1JXBA 4KRFA 4DU1A 2QK9A 3DLKA 3PW2A 1REVA 4M3YA 4FJMA 3OYCA 2VG5A 1TVRB 5DLGA 2YNIB 4DFMA 4ELTA 1LAWA 4CJTA 2BE2B 2R8GA 4F4XA 1C6VA 5J1EA 2FVPA 3KLGA 4FJGA 5J2MB 3M9MB 3B6PA 3LZJA 2G8IA 5J2QB 1S0NA 1BL3A 1U09A 3A2FA 2OPPA 2GIRA 2JC0A 4RNHA 1RBRA 3PZPA 2XHBA 1BQNB 4L8RB 2LSNA 3NKYA 3DRSB 5EDWA 2GC8A 2Z1IA 4QWEA 2W42A 1JLBB 4FBTA 4DQSA 3RWUA 4R5PB 3RAXA 5KFTA 3CJ5A 1SUQA 2UVVA 3IS9A 3RR8A 4E1MA 1GX5A 4IRDA 5CYMA 4DTJA 3IRXA 2WCXA 4IG0A 4DTNA 4B9UA 1JLFA 3ITHA 4H8KA 4KHRA 1RT4A 4M3XA 3LP3A 1RBUA 3DMJB 4EZ6A 3VN5A 3QIPA 4GC7A 4IH6A 4O3PA 2IC3A 4M41A 1RTDA 4ECQA 3OL6A 3VQ9A 4AHUA 1NJYA 2IJFA 4JS4A 3HL8A 4W5QA 4QWCA 2IAJB 3MXJA 2XGQA 5KFAA 2UUWA 1RTJB 3D28A 4CHNA 3Q8PB 3EPIA 2QKBA 3BQ0A 3GIMA 2OPQA 4KSEB 4B3OA 1BHLA 2QV6A 4H4OB 1C0UA 4NYZA 3M9NB 3O3FA 4J2EA 4CFDA 2QKKA 3DM2B 3M8RA 3MF5A 4GC6A 4RW6B 2ETJA 1BCMA 1Q8IA 1VSKA 4O4RA 2JGUA 4RW7B 4I2PA 3V6DB 4EEYA 4Y1CA 2B5JB 3ZSYA 3PO4A 4J2DA 4RNOA 4OKJA 4LSNA 2RF2B 3CYMA 4U7CA 4ZHRB 3HO1A 3MR5A 1NOYA 2HHVA 1BI4A 2QE5A 5KFZA 1KVCA 1ZTTA 5KG7A 3RMDA 3TAMA 1QTMA 3AVAA 3UR0A 4LQ9A 3DYAA 3QO9B 4MKAA 2AX1A 1FK9A 1ZBLA 4ED1A 4ECWA 1CLQA 1SKWA 2D5RA 1EP4A 1FKPB 1D9DA 4I7FA 3VQDA 5C25B 3M8PB 3EYZA 2HNZA 2JEGA 3NH0A 4BE1A 5KG3A 2XY6A 1NK5A 2OZSA 3CWJA 2HHQA 1BIZA 4DF8A 2YNGB 4IG3B 1S48A 5HBMA 3SFGA 5JS1A 4CHOA 3QERA 2ZD1A 3SYZA 2BRLA 4YR3A 5F8HA 2ITGA 2GIQA 4I2QA 3NH2A 1RILA 1FKOA 1BGXT 4NLPA 1FXXA 1DTTA 4MKBA 2XI3A 1S9FA 2YHBA 4MK7A 4MH8A 1KCFA 2FJVA 1QQCA 1S1TB 3HVWA 3BQ2A 4O55A 1BQMA 3TVKA 5KT4A 5DG7A 4G1QA 3TR8A 3T1AA 3MEDB 1VSFA 3PUFA 3KOAA 1NKEA 4N41A 4FJJA 4GW6A 3QESA 1RT6B 3CO9A 3D5MA 4CGHA 1JLCB 3WNEA 3KLIA 4KTWA 2W9BB 1S9EA 4DFJA 4R8UB 1IKWA 2AX0A 3H5UA 3GYNA 1J5OA 4O3SA 3GV5B 3KHLA 2FVQA 1RA7A 4CJPA 2JLEA 5KG6A 3NBPB 4B9NA 1TV6A 3C94A 3I0RB 1LWCA 3OLBA 2W9AA 3LP2B 4KAZA 1RT2B 2VWKA 3T5LA 4PWDA 4FZYA 5KT6A 4PUOA 2D3UA 4F2RA 3L2WA 5HRRA 5FDLA 4FK4A 3QIOA 3ZSQA 4IFYB 4FJXA 2XO7A 4FM0A 1TK5A 4IKFA 1S1XB 4MIAA 2WONB 1ZTWA 5KGWA 5DQHA 3AVHA 4FW2A 3NE6A 3OYIA 3PHEA 3IG1B 3KK3A 4ID1A 4KHNA 4RW8A 5HROB 3I0SB 2FVSA 4O3RA 1I6JA 4CJWA 1NK6A 3KD1E 5KT3A 3OY9A 3G0ZA 2E9RX 4BDYA 2PYLA 2P5OA 4MIBA 4NLYA 5C24A 3ZSOA 1KTQA 4J9RA 4BE0A 3CDWA 2Y1JA 5EUHA 1VSJA 1ZBFA 2E6MA 3VQAA 4Z4HA 1NK0A 4FBUA 4CEZA 3D45A 3GILA 3HYFA 4J2BA 3GIJA 5D3GA 4IRCA 1C0TA 5KFBA 3JYTB 4O0IA 3NFAA 4M94A 1VRTB 3V81B 4YP3A 2W9CB 2WRMA 3QLHB 1X9SA 4TY8B 2YNFA 1WSHA 4CJ4A 4DFPA 3V9UA 3RB3A 1UWBB 4O3NA 3FRZA 3Q8RB 2UVRA 2HMIB 2O5DA 1QHTA 5CYQA 3OS0A 1EXQA 2HHSA 2B6AB 1NNDA 3HP9A 1L5UA 5K14A 2WHOA 2YNHB 1R0AA 1UA0A 3RBDA 4J2AA 3P83D 5DK5A 4M3ZA 3TAPA 4CGFA 5F8IA 2BGGA 4K4TA 1DLOA 2IDOA 5KRTA 5KFSA 1WSFA 1U47A 2IS3A 4RW4B 4DTXA 3HKWA 1TAUA 3CFOA 3OYJA 2UUTA 4IFVB 2BQUA 4BDPA 1L3TA 3BJYA 3MAQA 3KLHB 4BACA 2HWIA 1T7PA 4B9SA 3K5LA 3AO3A 4EZ9A 2J6SA 3QINA 3E01A 5KFGA 3NF7A 4EP4A 1IKYA 4CEFA 3BR9A 4ECZA 3NF9A 4B9TA 1WLJA 3AVLA 1LW2B 1SKSA 5I3UA 3DOKA 3DOLB 4OPKA 3ZCMA 2Z1GA 3SQ2A 4ID5A 2CKWA 1TL1A 4TYBA 1RBSA 4FLTA 4CF2A 2F8TA 2R2TA 1EX4A 5F8LA 3KLFB 1S1VA 2HW3A 1SH2A 3MR6A 1ASUA 4HHTA 3C6UB 4XO0A 1EETB 5I42A 4MK9A 2Z1JA 3OYMA 4Y2AA 4CJ5A 1KVBA 3IAYA 1NK8A 3M9OB 4ZPBA 4RU9A 1J9AA 3PV8A 3DLHA 1DTQA 1TL3B 3ALYA 3AO1A 1VSDA 5KGXA 3VQ6A 4QOZB 3MEEA 4DL5A 3CFRA 3ASMA 4WE1B 3Q8SB 1TV6B 4IDKA 1LWCB 5HLFB 5L1KA 1MU2B 4K4SA 2EX3A 3KK2A 2HNDA 2CJQA 3H4DA 2HNYA 1S9GA 4PUOB 3QNNA 3H40A 1HQEA 3I5AA 4DSKA 3SFUA 2WB4A 4EP5A 1S1UA 3NDKA 1S6PB 4Q0BB 5J2PA 5DMRA 4CJ3A 4J9OA 3NGDA 3H2LA 1WSEA 4QAGA 2P51A 3GIKA 3SI6A 2VG7B 4CE9A 1C1AA 4ZP6A 4GMJB 4CGIA 3NAEA 2O4GA 2C22A 2JEIA 2FJWA 2IM2A 3QEVA 5DQIA 1EKEA 4CIEA 2OA8A 3HPGA 2IBKA 4M42A 1J53A 4KTZA 4M3WA 2OPRA 1U04A 1QAIA 1GOCA 2ZKUA 1D9FA 4TN2A 3KK1B 4LQ3A 2P1JA 3QZ7A 1LWFB 2GBZA 3V4IB 3FQKA 3O4QA 2HHUA 3HP6A 1N56A 1HNVA 3EPGA 4DL3A 4DTSA 3LP1A 3OHAA 1CXUA 2DFHA 3TI0A 4XIUA 4CGGA 4IBNA 2DFEA 4NLWA 3C6TA 4CHZA 1RTIB 2HHXA 2C2RA 1RYSA 3AVNA 3DRPA 4OGEA 5KFIA 4EYIB 2WOMA 2P5GA 1W0HA 2HVIA 1S10A 2XRIA 4Z0UA 1NJZA 4YQWA 3MECA 4KKOB 2XGPA 3AO4A 4O5BA 2BDPA 1QE1B 5KG0A 1HNIA 4ED3A 4RNMA 4ZTFA 1HMVB 3ICLA 4C8MA 2G8HA 3OS2A 3BREA 4K8ZA 4H4MB 4DG1A 4DL7A 3LP0A 3B6OA 4WFXA 4YNQA 2XY5A 4KHMA 2KQ2A 1KLMA 3KHRA 1JKHB 1N6QB 3V1QA 4URQU 4TYAA 3SV4A 4ED7A 5KT7A 1SV5B 4WXWA 1WN7A 4O4GB 1SH0A 5KFJA 4F4YA 4FJKA 3SPYA 3I8DA 4OVLA 1GOAA 3C95A 3H5YA 2OPSB 1IM4A 3MFHA 2XY7A 2OYQA 1TKTA 1Z4UA 2RKIB 1TK8A 1HQUA 1ZBIA 4O44A 4CEEA 3KJVA 4NRTA 5HRNA 1IKVA 3KLEA 1T05B 2YV0X 4E89A 4NCGB 3U3GA 4N5SA 3RAQA 5HP1A 4LH4A 4KFBA 1Z25A 1RT1A 5KFFA 3FFIA 3H98A 3DLGA 3OSNA 3IGNA 2FBYA 1LAVA 4F2SA 2IA6A 4NCAA 4DQIA 4OKKA 2C2DA 5KFVA 3SUNA 5T14A 1RT7B 3NGIA 4B9MA 1HYZA 4KHWA 2A1RA 3RTVA 3P1GA 3TQ1A 2YKMB 2C2EA 4AILC 4ELVA 1QS4A 3SQ4A 3RRHA 1HPZB 3PX4A 2X6SA 2KZZA 1G15A 4KV8A 1JX4A 4DS4A 3WNGA 5JUMA 2JC1A 1LWEA 3V6JA 4MFBA 4NYNA 5KFLA 4QCLA 3K5MA 1LW0A 3SJJA 3DLEB 3G86A 4NLRA 5L1LA 1CSJA 3V9ZA 4K4VA 3HSTB 1S6QB 2C28A 3BGRB 4F4KA 1JLQA 3AA3A 4AHRA 1NK9A 4DQQA 3T3FA 3H4BA 3TAEA 3DDKA 3HHKA 1U4BA 1C1CB 4DSJA 1JL2A 4EBEA 1VSIA 3MR3A 4EO6A 3DI6B 4WFYA 3F73A 1JIHA 5KFRA 5KFWA 4ECRA 1UOCA 3M8QA 2D0CA 3KKRA 3KLVA 4WYWA 1IKXB 4CECA 4CJVA 3GV8B 4BE2A 2FBXA 4ZVEA 3N6NA 3VA0A 3T19A 3JSMB 3HVTA 1TKXB 3TARA 1NKBA 5C42B 4F4ZA 3VQ4A 1N5YA 3VQ7A 2X74A 2FLLA 4LSLB 3T5JA
chains in the Genus database with same CATH superfamily
4DN0A 3QWPA 4M5HA 3AO5A 4OLAA 2VH7A 2GV9A 2AD9A 4CF1A 1K1QA 3SCXA 2V4JB 5E3CA 4G3IA 3X1LB 3UQSA 3ZT1A 3DRRA 4ILRA 3HFVA 2F9JA 5D15A 1ZYQA 2WOMB 5F8JA 3CM6A 3ZX2A 2D69A 2VFSA 5EHHA 1M0SA 5D77A 2BANB 4EYHB 3GMGA 2ITMA 3V1RA 3OVBA 4FOIA 3AD7C 3DLKB 3B54A 2KZMA 2JZ5A 2VG5B 4J8FA 2UXDJ 1DQAA 1VQ6S 1Y0HA 5J1EB 5BRFA 4KRWA 4DL0C 1ZBTA 1GXUA 2X7IA 1KQFB 2H4YB 4FYDA 4XDDA 3OYAA 1BISA 4PQUA 1KSPA 1PG5B 4ZP9A 2KG1A 4PL8A 4LSZB 1P1LA 4IOCQ 4KT0C 4DV5J 2O8EA 4UTGA 4ZMMA 4ECYA 1SUQB 3NCIA 2MY8A 4QYRA 4ANCA 3L9ZA 4WQ4A 3OYLA 1RHQB 3GPAA 1JLFB 3ITHB 1ZAVA 1IKVB 1WKJA 2IMOA 3G71S 3VA3A 3EGWB 1IH7A 3FZLA 3TSQA 5K20B 2BW7A 1NJXA 3SZ2A 4HUFA 2CQPA 4DWIA 3QMLA 1PKUA 3TTCA 2HHTA 3HPOA 3A5OC 2DR9A 1R8HA 4JD2B 4AQYJ 5BR8J 2EWHA 2R8HA 3NHGA 3EZ5A 1UFKA 2YKNA 1UVKA 5ETRA 1SC3B 4B3TJ 5LMNK 2FVCA 2VBYA 2GX8A 3CB4A 1NJWA 5EOYA 3MWTA 4C8OA 4YOTA 4I2PB 3M32A 4FNIA 4NXNF 3HHLC 1Q7YO 3AXKA 3CVKA 4DV6J 3MD1A 2IJRA 3GIIA 3A5LC 1NAQA 1AXQA 2I5JA 4DL4A 3BO2A 3VAGA 2F63A 5H9EK 5EX0A 2OTLS 2QWOA 4PA1A 3HT3A 2F8MA 1EP4B 3VTIA 3RYLA 4MQ3A 4OQJA 2PD1A 2XC9A 4CFAA 3MGJA 3R7SB 4XTTA 5HBMB 1SIWB 2NXNA 4Q5VA 3ISND 2OZMA 4X4PA 2ZD1B 5KFPA 4FK2A 4CT9A 3BV8A 1KAYA 1IBMK 3NAHA 3OYFA 4CBUA 4DSFA 3BS9A 4DV2K 4I2QB 4FCYA 2D0PA 4JV5K 1FKAF 4ECVA 3SXLA 1YF5L 2E1YA 1YI2N 3EEQA 4F9OA 4HHUA 3MN7A 1NLVA 4HL9A 2QX0A 2RDIA 2AGPA 4K42A 4KHPJ 3F41A 3PTWA 3R1LA 3ETOA 3TVZA 4BCAA 2V2ZA 3V6HA 2PT0A 4F0HA 2R3VA 2H3GX 2DGWA 1S72S 2EFOA 1D5AA 3ZEUA 1JJ2R 4BRQA 2F1FA 4FLZA 4FWRA 1QSSA 3UE5A 1SC6A 1QZ6A 3ET6A 1W26A 1A5VA 3NF6A 3TANA 4FLYA 4H5VA 3J7AN 1KFDA 2QA4N 2ZNZA 1FFWB 3RMBA 4BRGA 1V3RA 1NDKA 1JQGA 2HG4A 3O9TA 3F56A 2DY4A 4CD3A 3MUMP 5GADP 2ASOA 4QYZK 5IT0A 3FEZA 4AYBD 2NXCA 4RNNA 2CXEA 4PPZA 5ETMA 5FDLB 4DMZA 4L6V3 4PQUB 5AQGA 1TQLA 1U48A 1VSLA 4RW7A 5L1JA 4GY2B 3CFPA 5KG4A 5E41A 2H54B 4X62F 1I94K 1S0VA 3UCUP 4UOGA 3MTKA 4ZHRA 2GJFA 4RW8B 2G0CA 2DR8A 2MXYA 3W62A 3NCRA 1HBMB 1YJWN 1XR6A 4RG8A 1YWXA 2XLKA 4ZPDA 3DXBA 1N34F 3P31A 2G0JA 3MCAB 1XNRF 3M2RA 5BR9A 5C24B 4K59A 3RRKA 3GTYX 4BC3A 3A5NC 2Q3PA 2D0AA 1EZZB 5KFQA 3M8PA 3TEGA 4HUGA 2WTUA 1VQ8S 1T3NA 4IFEA 4IG3A 3OSPA 3PIPQ 4H0TB 4CF8A 4FJNA 4YFUA 2P9PB 1QAYA 2AU0A 2GMJA 4OZ2A 1YVNA 2IFXA 1NK4A 3D0IE 4DR1K 3ENWA 2HBQB 3A3NB 1NOZA 2DNOA 1XNRK 4YS2A 1OQ6A 4AH9A 4TLRA 4BRMA 2R2SA 1D0EA 3NCQA 2W4DA 3OXFA 1T95A 4NASA 4Y00A 5LXRA 4ZCMA 4DBQA 2HRTA 3ATUA 4ZPAA 4ED4A 3I82A 1K6YA 4C3MA 2ZC3A 2C3MA 4TU9A 2GFFA 5AQUA 3OR1A 2WFBA 1UFLA 3I5BA 3SAGA 1XTZA 2GAGC 2QT7A 2G9OA 2BBEA 5LJVA 3QNOA 2CH5A 4P10A 2KKHA 4P2SA 1IM6A 4LF7J 4JI1K 3NBPA 3H7HB 3NGKA 4XPCA 2IYGA 2V34A 3MR2A 3THYA 3AOBA 3FDSA 1Q0NA 4B02A 3EJMA 3VF4A 4JI3F 1CXQA 5KG2A 1MROB 8ATCB 3ZZYA 4NL5A 3CQYA 4F3OA 3QB0A 2PMZD 1X5SA 4LD0A 3WDOA 3OVAA 4M5KA 1FFSB 2RNEA 2HZCA 2NLWA 4ED6A 2D4WA 3K57A 3MMJA 2ZBPA 5AE2A 2XYPB 4OKEA 4IR9A 3I0SA 3M8WA 1FDBA 5GMEA 3I55S 1Q7LB 1TL1B 2W2MP 5AQLA 1RWNB 4AHVA 1HJRA 1ASWA 1S1VB 2DNHA 3CIPA 4CBWA 2G2YA 3Q22A 1SC1B 4KY3A 2OIHA 1KVIA 1FDAA 4CESA 1BA0A 4PYAA 1JL1A 1CG2A 2VDHA 2UUAF 3SUOA 3BBBA 1DTQB 5IM0A 1B9FA 3HJFA 3H46O 3PX6A 5D4PA 3V9WA 5BPMA 4JHDB 3VHQA 1MW7A 3CJTA 1R8BA 3D67A 5M1NA 1HJOA 4B9LA 4DU3A 4F26A 2HIYA 1S5JA 4KI6A 4K5SA 1WC5A 3FBBA 1PC5A 3L2UA 2ZQBA 1HQEB 4ZVFA 1EX8A 1S1UB 5DDQC 3CJQA 1FRHA 3WC0A 2LQ5A 5HJYA 3U7JA 3M2UA 4KAIA 3WX4A 2PN6A 2HF3A 1FJEB 2J9EA 2VQFK 2B6AA 3NEKA 1YT3A 1NZ8A 2WZ1A 4WWSA 4YOVA 1S77D 4LF5J 1ZAXA 2KXNB 4DLEA 2GGPA 2GIFA 4CLSA 4CGDA 1H7WA 1W25A 4X65F 2K1RB 1XMOF 4YMEA 3O8MA 3T41A 4RW4A 1PIEA 3PLAA 5MLCQ 1VQKS 4JI2F 4HEA9 1FXRA 1VC0A 1O0PA 4ECTA 1H98A 4CTAB 2LDYA 4CZIA 2DB1A 3HVAA 2MZSA 2LKZA 4Z7CA 4QWBA 1B0PA 1VQMN 3ZZOA 3WEEB 5AXKA 4X65K 4N56A 3HHLA 1XMOK 1XHZA 2MQLA 3SMSA 2AHOB 3AGRA 1B7FA 3MM5A 1WWHA 4WFAL 3WXIA 4Z4FA 2RS2A 3CJ7A 3EE8A 4X4QA 4FWMA 3J7ZT 4W5NA 3CJKA 3OJSA 2CJKA 3CCVN 2EHGA 1OH6A 2W4CA 3LP0B 3ZXWA 4I6MB 3O6WA 5EX5A 1ASVA 2BZ2A 1KLMB 1X9MA 1VI7A 4A8MP 1YJNS 4J91A 3SV3A 2D3OR 1NNEA 3CG7A 2FJEB 1MLAA 3CO0P 2W41A 2FXUA 2XULA 5CY4A 1SKUB 3GWCA 3KLEB 3ZT3A 3F44A 2G13A 5CH7B 3L4BC 1E6YB 2PSZA 3QRRA 3HULA 1RT1B 3NCPA 4UT4A 5DETA 2QWMA 2PA8D 2V8GA 2RU3A 2BX6A 1F1BB 2ACYA 5AQOA 5ETQA 4JI7F 1TL5A 2Z1HA 4FS2A 1N36F 2ZH3A 2GVDA 1T6DA 1FESA 2PZSA 3KK1A 1O8BA 2Q3SA 4DEZA 3BGLA 3NF8A 4F0KA 3AA5X 3TX8A 4DMNA 3OVNA 4BLGA 3O3HA 4DV4J 4A8KA 3AOAA 4E7HA 3DDNA 1UVNA 1X9WA 2BKPA 3B4DA 4IUFA 2AA4A 4HUEA 1N36K 4IYQA 1CJUA 1W9HA 3AO2A 2H5JB 1FX2A 4XPEA 1GFWB 1XJWB 3KHYA 2AZ1A 3VENA 2O8BA 2K3KA 3UKUA 3S6EA 1QE1A 2V68A 5LJ5Y 3PSFA 3J81j 3W9IA 4N76A 3QEWA 2RHQB 4MLHA 4G6VB 2FGOA 2FGCA 2ZVSA 1F5BA 1U2VA 3HHDA 2D0BA 2XY8A 3VGUA 4URSA 1GLAG 1KP6A 3OUYA 2J7WA 1YVUA 3VAKA 3IBWA 1CJTB 3PW0A 4FLUA 3GJQB 2QA2A 4CJSA 3ZC4A 1O13A 1ZETA 3O80A 3KUHA 1EARA 1SV5A 1LKZA 3ZT4A 1RHMB 3CUNA 4OJ1A 1ZC6A 4IJAA 4F7VA 2CG8A 3W5YA 3JSRA 4NLXA 3U1LA 2V8VA 1VS3A 4I56A 1T03B 3DJCA 2AF6A 4NLOA 2RKIA 4RWWA 5AQIA 1YVFA 3OTDA 3VOVA 2Q1LA 2P2CB 1L3UA 4M63C 4DX6A 4JI5J 4NCGA 1Q18A 1HQ2A 2K2PA 1YRTA 2VG6B 4OYWA 4WP3A 3MPVA 1DY3A 1RT5B 1QDUB 3U3YA 3MMCB 3SUQA 4HVJA 2XZTB 1CC8A 1BIUA 2QGFB 4CEAA 2UUBJ 3OYHA 1AUDA 2NCKL 2QWLA 2MGZA 2E5LJ 4RJVA 4ILLA 3GDQA 2PY5A 2WVBA 3DRYA 5KFYA 3SQOP 3LAKA 3WHIA 3HZ6A 1YSJA 5F0WA 1N52B 1X4CA 1KONA 3T6JA 3VETA 3QZ8A 3OS1A 4IO8A 3HK2A 2KM8C 3ATVA 2HQIA 4DU4A 4FJ9A 3QICA 5ELZA 3VAFA 2R7TA 4ZVRB 1RAGB 1ATSA 5KRSA 2RUSA 4IKAA 2ROEA 3F0NA 5AQNA 2IDEA 4Y28C 1U02A 2ZM6J 4OLOA 2GUPA 1T9WA 2QLWA 4IXCA 3THXB 4BRHA 3GZ7A 4M3UA 2EK6A 3TA1A 2KHCA 4LF6J 2G8KA 2LXFA 2E20A 4AFFA 3U6FA 4OYOA 3EE9A 4GO5X 4H54A 2EVZA 2YKPA 2B9WA 1UVIA 4DFKA 1WTBA 4EMDA 3A8KA 2V67A 4AL7A 3EZWA 4Q43A 3D2FB 3H20A 2D9PA 1YIJS 2F8SA 2YX1A 1LQ9A 2YPZA 4JI6F 5BYRA 3ULEA 2JEFA 3MEGA 3HLUA 3H3OB 4F3MA 5AQJA 2YH0A 1A5WA 3D0HE 3P4UB 5KQDA 4DTOA 4LT6A 2X1GA 2FZKB 3VEYA 3D4JA 4HI2A 3TSUA 5ADZA 3KYLA 3IDHA 4OLPA 3LWMA 4FZXC 2L9NA 4BQZA 4NLTA 1QQOA 5KFUA 4YY3F 3T69A 4HCCA 2AYGA 1SCJB 2G2ZA 4YHHF 5BJRA 2ZE2B 4Q8FA 2VBXA 2O8BB 3J7YU 2VPZB 1HNZF 1REVA 1V4TA 4M3YA 4LBPA 1M1KT 2YNIB 2HLTA 4DFMA 4CJTA 1F3VA 5J2MB 2NRXA 2UUCF 2ACMA 5J2QB 1S0NA 2ZC4A 2F9WA 4MJKA 1YJWS 1UFWA 2GIRA 4NPOA 1Q8KA 2HGLA 4O0NA 3CCJN 3UO0A 3PZPA 4IO9L 3D0GE 3H1QA 4Y2IA 1WTFA 2GC8A 5E3AA 2YHWA 4A8OA 4UQTA 1Q79A 3MM9B 1YKWA 3F9MA 4WCEL 2HBRB 4E1MA 1I5OB 5CYMA 4IG0A 2AIRB 4B9UA 2NRTA 1RT4A 4LR8A 3MDQA 2UUCK 3VGLA 3DHWC 1J2VA 1FWPA 3NMUA 3A8JA 2V8PA 2IC3A 3VQ9A 2CPDA 4JS4A 3HL8A 3ILOA 3BF1A 4P71A 2XGQA 1U2CA 2UUWA 3Q8PB 1MDUB 2RH3A 1U8WA 3U8XA 2XSJA 1PAUB 1C0UA 3H2VE 3A13A 3O3FA 4J2EA 1RCXB 2W2QP 3LO3A 3CCUS 2EKYA 1BCMA 5AQKA 4CP5A 4BC4A 2LCWA 4DCOB 3V6DB 3FMWA 3J7AP 4PG6A 3ZSYA 5HATA 2H5EA 3H42A 1V3SA 3SSRA 3O9RA 1T44A 4J2DA 4GKKJ 4LSNA 2MKJA 1D8ZA 2Y1RI 4JI8K 5HQ8A 3OR2A 4KH0B 1BI4A 2A42A 3CETA 4CVNE 5BRHA 3NS5A 4B3RJ 3ADAC 4C8ZA 1WKKA 2QWRA 5KG7A 3UR0A 2AX1A 1FK9A 1ZBLA 1R8PA 2KH9A 1DKGD 2D5RA 1FKPB 1D9DA 3CMAS 4I7FA 3VQDA 5C25B 4PYDA 3EYZA 3NH0A 5KG3A 1NK5A 1XNQF 5FLXY 2OTJN 1ZOTA 1BIZA 3VR1A 3DCAA 2BOPA 1FRIA 2Q6BA 4CLWA 1S7IA 3DXKA 3M8ZA 1UP1A 2XMWA 4DV0J 2BRLA 4CQ1A 5F8HA 2ITGA 1HWLA 3CMES 2RUGA 1RILA 5AQTA 4MDAA 2K06A 2YJFA 1C4AA 5A8RB 1FXXA 4OYIA 4USVA 4JI4K 4S0MA 1S9FA 1VBZA 4CLUA 3ENQA 3OTOK 3CF5L 1YX2A 3JAMO 4OYXA 1QQCA 3CJSA 5GAGI 3HVWA 3BQ2A 3LPEA 3K2YA 1XNQK 2P9KB 1UAWA 3W2VB 5IC4B 3R9LA 1M1HA 3TVKA 5DG7A 1FI4A 3MEDB 4OZLA 3A3PB 5A8WA 2GVZA 3IFRA 4CGHA 2YKAA 5BYSA 1FRKA 3KLIA 4PG8A 3M7VA 3H5UA 1SB6A 3GV5B 3KHLA 1WHYA 4CJPA 2JLEA 5KG6A 2J7KA 1JCGA 2VODA 4B9NA 1XQSC 3C94A 1J5EJ 4K25A 4USUA 1RT2B 3T5LA 2UU9K 2FB0A 3M4XA 4KH4A 3L2WA 2UZAA 4DR2J 5HRRA 3MM6B 2VDIA 5BXIA 1UCNA 3ZSQA 4IFYB 4FJXA 3GLJA 4U7UK 4A8FA 2XO7A 5CCMA 1TK5A 3LDLA 2WONB 1RWOB 3B78A 2HFVA 4ZN1A 5DQHA 3KK3A 3SQGB 4CZFA 3EGVA 4M63A 3ZTOA 1OVQA 3MPWA 1K44A 4CJWA 3HHEA 3KZBA 3OY9A 3NS7B 1RP5A 4DOZA 4CZCA 3G0ZA 2H65B 2PYLA 1HL6A 1NGFA 2WBMA 5GIOA 1BY9A 2FTRA 3BZKA 1A9NB 4J9RA 3CDWA 2Y1JA 2CADA 4FYYB 5EUHA 1ZBFA 3U9DA 1QVFM 1VBYA 3VQAA 2QLXA 1S57A 4FKXA 3HOTA 3BPSP 2OSQA 3LDQA 2FF3B 3HI0A 4EI2A 2CZ4A 2BYCA 3U02A 2JL9A 3POTA 5D3GA 4IRCA 4OX7A 3JAMU 4LFAJ 2WAQD 2DHSA 3DFEA 5G0RA 2GWKA 1IR2A 2W9CB 5HN0A 2YNFA 2KVQE 2MMYA 3FCWA 3RB3A 1V4SA 1NSAA 1VJWA 5JLHA 2HMIB 3CEDA 1NDCA 2FHJD 2WW8A 2G1DA 1EXQA 5AZIA 1YXQA 1WF1A 3KG4A 3HP9A 4KYZA 1H2TZ 1FE4A 1UA0A 3RBDA 1RBLA 1WDDA 1RAFB 4CGFA 4N8NA 4WFAQ 2M70A 3VEOA 3N4QA 4LF9J 3MZIA 2RT3A 2IDOA 3DLLQ 3TEHB 4FSVA 1E6VB 3AARA 3CC2S 3HSCA 4LREA 1U47A 4N77A 3Q7CA 1TAUA 2BUPA 3F5TA 4IFVB 2RHSB 4ISGA 4B9SA 2V8HA 3QINA 3E01A 2EFVA 3R27A 1IKYA 4CEFA 3PRVA 3DOMA 1KR4A 3U1NA 4HH1A 4OPKA 1BO5O 4KQZA 3TVYA 5AZJB 3IBFB 3RSEB 2AEJA 2N82B 3N5FA 2VQEF 1N5QA 2CKWA 2A2DA 2XLJA 2C3YA 3T6BA 1Q78A 3CCSN 2Y9HA 3MR6A 1YJ9S 1ZM3A 3GJSB 3WBZA 1KVBA 1MN9A 4M5GA 3CJ8A 2OFHX 1WEYA 1J9AA 3PV8A 1VK8A 3VQ6A 1YITS 2FF6A 3AT1B 4QOZB 3O6QA 1YJTA 3O8WA 3CFRA 1YAGA 3ASMA 4DR7F 3Q83A 5HLFB 4K4SA 2EX3A 2FYXA 3RU0A 2Y1LB 5B0AA 1VHXA 5H1SQ 1GMWA 1VQON 1S9GA 2Q43A 1RHRB 5AQZA 3NDKA 2VOOA 4WK3A 1S99A 1AFIA 4MDBA 4ZCLA 1BD6A 4XH1A 2RHKA 4CJ3A 2QMXA 2C3OA 3H2LA 3TUIC 3IR7B 4LF8F 1LK7A 3GIKA 3SI6A 1R6VA 4GMJB 2C22A 1RWXB 2CNLB 3CCES 3QEVA 4QIEA 4M5DB 1IQTA 3D7EO 1B7YB 4ATNA 3ILLA 1U2FA 4PKGA 5BPLA 1PJ5A 4LVOP 3KKFA 1X4DA 3IMQJ 1LWFB 4P6QA 2HHUA 3V4IB 1PILA 1ATNA 1N56A 3EPGA 1I51B 5LMNJ 2GQCA 2ZBCA 1IN0A 4LF8K 3BGFA 3OHAA 1GLLO 4NLWA 3NGUA 2C2RA 2DR5A 3AVNA 5KFIA 4ANDA 1U6ZA 4EYIB 1MMDA 2FQQB 5GAGU 1T9XA 2R7RA 2R7UA 2Z2YB 4NI2B 4HI1A 3MECA 4QU6A 3R1HA 4FXVA 5H9EJ 1HNIA 4I0WA 1PC4A 2NXJA 4C8MA 1H6KX 1EKRA 4F02A 2E1PA 3BREA 1OY6A 1HWIA 4OI4A 1X0PA 3D66A 4ER8A 4WFXA 2E1AA 2MLYA 3D3CJ 1UKUA 5IV3A 2QL9B 1Q5VA 1NPPA 3MMAB 2GMLA 2JOQA 4TYAA 1REGX 1IBMJ 5KT7A 1VQNN 1WN7A 4DV2J 1SH0A 5D0HA 1FNXH 1CC7A 4JV5J 3SPYA 2ZNYA 2OPSB 2E7WA 3H8YA 1IM4A 3MFHA 3BPDA 2DEJA 1Z4UA 2AP1A 1CS4A 1U26A 4TU7A 5LJWA 2VBWA 4LFBK 2YV0X 1PBAA 1QZ5A 1Y10A 3AJ1A 1VDHA 3RAQA 4J9UE 2HFNA 5BR8F 4LH4A 5D6GA 1FEEA 3FFIA 3NY0A 3PHTA 3H98A 3DLGA 3GJRB 3MI7X 1U6BA 2IA6A 2EI5A 2H51B 2ZZNA 3LM9A 4J9VA 3A3OB 5KFVA 1W2IA 2RQ4A 3SLCA 3G6EN 1RT7B 3CNQP 4B9MA 2DNPA 4B3MK 3ZLJA 3P1GA 4PL7A 3DU5A 1M5HA 2QEXN 4AE5A 3KUEA 4QYZJ 2ZOMA 2X6SA 4FYXB 1WDTA 2RILA 1G15A 4KV8A 1JX4A 3M6VA 4OX9F 3WNGA 4WTOB 5HL7L 4ZVQB 4X4RA 1XMBA 3VALA 1I94J 4J90A 4YB6A 3QDKA 5LMUF 3G86A 4NLRA 1S6QB 2MKCA 2P9SA 1JCFA 3SBGA 1X5TA 4AHRA 4DQQA 3T3FA 1EIYB 1U4BA 1C1CB 2MSSA 4DSJA 4EBEA 1ROFA 1VSIA 3DI6B 1RCOB 3D9BA 4WFYA 2E5IA 2D0CA 1GT8A 4DR6F 1IKXB 2PMWA 4OX9K 4CECA 2P9IA 4UUXA 1UVJA 3GV8B 1P9YA 5A6WA 3T19A 3JSMB 3P39A 3IR6B 4NYPA 2DR7A 2VC1A 5LMUK 1BQXA 2KHOA 4F4ZA 4MYTA 2XYHB 5CZXA 2FLLA 3DXSX 1FE0A 2G8FA 3P5TL 1C1BA 4DR1J 1XNRJ 1VRUA 1OS5A 2Y1IA 1IBKK 3AAPA 3ZZUA 3R9PA 4DR6K 4BWMA 1N48A 4DUZF 1ZBHA 5J2NA 1B64A 2I1RA 4IEEA 5F9NA 2DY1A 3R7NB 1KC8T 4EBCA 2FLNA 1XQIA 4O23A 2H1YA 4BRIA 1WNSA 3LAMA 4B08A 3K58A 4PXEA 2HFUA 4WK1A 4U9RA 4D3HA 3LM2A 3L4QA 5DGAA 1RT3A 2HSEB 4P2XA 4CEOA 4WCEQ 2FHKA 3PVXA 1GOBA 4E3SA 1NU0A 5D8HB 1WC3A 1VQ7S 1F5AA 3I32A 2DPJA 1X4HA 4DUZK 2DCLA 1WSIA 3KTQA 2RVJA 4JI1J 1HYSA 7AT1B 1WELA 2EPIA 3AY0A 5JICA 3PSIA 4U8VA 1P8GA 2KW4A 2DGUA 4NLVA 4GVMA 2VA3A 1KD1O 3AVGA 4E7LA 3MN5A 3FGVA 4KBIA 3MAAA 5FRNA 3DXMA 2HWTA 3IS9B 3CJAA 5AQMA 1Q82T 1QLNA 4KH6A 5K8NA 4UY85 2DGXA 3O9SA 4F0MA 3MMBA 4B8CA 5L38A 2QTWA 3VZHA 2LECA 3BDPA 3HZGA 2W8LA 4NZ0A 4DB3A 4DX8H 4CFCA 1JLAA 4DUTA 4K41A 4V19X 2V9KA 3L3CA 1QUPA 3ZX0A 4UF4A 1JLGA 1VLOA 2OPQB 3ILJA 3MD3A 2PFDA 1S1WA 1ELOA 5ADXH 1C4CA 1SH3A 2OP5A 2NR0A 4C8YA 2MQ8A 3R8EA 3AA4A 4DSIA 4BG9A 1AZSB 2P6TA 3MWBA 4I6WA 4DZ6A 1KBRA 2VD3A 3KXDA 4IJNA 3QSIA 3WUHA 2XS2A 1XHXA 1NXIA 5IC6B 3RUBL 1DGKN 4WBFA 1RADB 3KHHA 3CF5Q 4ZVGA 2VQFJ 1EQYA 3J80U 3CJ4A 4W5OA 5BRDA 1XBWA 3B8HA 2Y8WA 1UA1A 5BYQA 4RUAA 5F2RA 2ZEJA 4OL8A 4TVAB 1BG3A 1YJUA 3A4TA 3W7BA 3PKYA 4Z7YA 1NDPA 4CJFA 4LC9B 2BE2A 4I9LA 3K5OA 2DTJA 2QA4G 2P9IB 2GQQA 2BMBA 1FCAA 4KREA 2O01C 2GHPA 4DTPA 1XN9A 1Y97A 2DNLA 1LXNA 2AJ2A 2BTFA 2BKOA 2DRDA 4W4MA 1BQNA 1JLEA 4K43A 4NLDA 5LL6Z 1CZ9A 1RGIA 1JLBA 2E9ZA 2L9DA 2CJ9A 1JJCB 3PX0A 3M6GA 1QVFR 1KDNA 2Z0GA 1RXOB 4X65J 1XMOJ 2UV8A 4KB0A 1BQMB 2GELA 2UXCF 2HBMA 3HI9A 2A40A 1FHTA 3I87A 4I64A 1TL7B 3SDEA 1S9EB 1IKWB 4GVBB 1RTJA 1J5OB 2EC2A 1T6CA 2XMVA 4FVCA 3LGNA 2CJYB 1S3XA 4H4OA 2WB1D 1UMJA 4FLVA 2UXCK 3UVJB 3FEXB 2FJDB 4YUDA 4PWDB 2MY7A 4H0PA 2DBBA 2VFUA 1RWMB 2LXUA 4GO7X 5CD4H 4UZCA 1D8YA 2LA6A 1Y5IB 2UVWA 1B0TA 3EDQB 2B5JA 1H1VA 3QEXA 1WSJA 1K9MO 3OL9A 4LF1A 3FK4A 3SMPA 2IM0A 1VK3A 4QWAA 3KNAA 1WHWA 4F4AA 3FUYA 3O44A 2R8IA 3QJJA 1M5PC 3MXHP 2OFGX 3ID8A 3QO9A 2CVEA 2X78A 1Q86O 3EMTA 4PG4A 5DZ6A 3D6TB 3FQLA 1ESVA 4LVNP 5GAEI 4P7VA 3NGYA 4AXIA 3P5JA 5JS2A 1VSMA 2V52B 3F9KA 3W2WB 1N5SA 4CEQA 3EY1A 1JLGB 1IWGA 2XSFA 3CM5A 1HBNA 3CJ0A 3OBWA 3CPEA 2KL8A 4FZZA 3VQEA 4YR2A 1C0TB 4F50A 3N4PA 3AAWB 2G8VA 2JH3A 2YJEA 4RUHA 1CVJA 1FF2A 3IWXA 1S1TA 1N36J 2XMJA 1P1TA 4CYUB 2YX7A 2VF3A 4KE5A 2GHWA 5CYQB 4FVUA 1GX6A 3OYKA 5K14B 2B51A 4Q44A 4ED2A 5CZ1A 4O3OA 1R0AB 3PACA 2KTQA 3BY5A 1I3AA 1HKBA 3GV7B 3L8BA 1RZMA 1LV5A 5JJBA 2ZH6A 1FO1A 1S0MA 1DLOB 1TELA 4NA1A 4EO8A 2E1ZA 1SQKA 3I9ZA 3EXCX 4A61A 3PM9A 3AA9A 4DR5F 1Y9OA 3FZMA 3CIMA 4YR0A 4GVEA 3FBEA 3O5BA 3LP2A 3AH6A 4PHTX 4WYLA 3CC4N 4CFBA 2FIUA 2WTFA 2I7PA 2M2BA 1JLEB 2EC0A 3GONA 1XIQA 1RU1A 2F8HA 1S1XA 4LRCA 5I3UB 3DOKB 1FW6A 3IG1A 5HROA 3MOZA 2ZWOA 3SUPA 4CHYA 4DR5K 3OYGA 2H4WB 4XH5A 4QIVA 4USKA 5T7LA 4OHZA 1GTHA 5AQRA 1UJ4A 3AOCA 2DRBA 5D4NA 1IR0A 3E51A 1A5XA 1Q81T 4UQGA 3OTBA 3O4NA 4Q2MA 1SBRA 1RAOA 2M8HA 1YBTA 4C48A 3PW5A 2RE1A 3SDEB 4B1VA 3BZQA 4MIWA 4KHSA 3PJXA 4B3SK 1RA6A 5DG9A 2B43A 2EEYA 1AB8A 4DHVA 4CHQA 3QFWA 2FHOB 2D1CA 1ZM9A 2QYGA 2XWYA 1NGIA 5KT5A 4W98A 3AODA 3QJLA 1K8KB 4L74A 2DFFA 1HIYA 1MMNA 3KK2B 2CJAA 2HNDB 1BXNA 2E9TA 3JYTA 2YBVA 3TZYA 2B9EA 5DG8A 2L3MA 2EWSA 4CZKA 4OHYA 3V81A 1IR1A 4OHWA 3Q8QB 3D7SB 1B3TA 4TY8A 5EWFA 5J2PB 3UNYA 1EQ0A 4QIFA 3OD2A 4NYFA 5KG1A 2ZOGA 4DSEA 4DV3K 1SZ2A 1URRA 3UD5A 4BR2A 2C2NA 2YNHA 4WFZA 1TUWA 2W2OP 4A2BA 1WC1A 4JK7A 5B7WA 4Y0WA 1Q4RA 3P5BP 2A0FB 3OYDA 4WZMA 2OPRB 1EKSA 3MTJA 5KPTA 3GFXA 4EWTA 4AUKA 3CCTA 4DTRA 2WSFC 2QL7B 3KKSA 1KVJA 3R5GA 4FJLA 2O8CA 2E1RA 2ZBRA 4JI5F 1HNVB 1C2PA 3GP9A 3OYEA 3QMQA 3ZT2A 2YKOA 4F36A 3HM8A 4DV1F 4HACA 4WFNL 3FCVA 2GUIA 1M90O 2ZZTA 2BR0A 1TP7A 1SQFA 2C2KB 1LW2A 3B6BA 4M8LA 3DRPB 3MPYA 3KJFB 4X4TA 4OJHA 2Z56B 1OH5A 3ZTSA 4DTUA 1TKDA 1YZ6A 3JSYA 3FZBA 2CZVC 4OYZA 1QAXA 2AJQA 3KLFA 4O8UA 4CNZA 2IPOB 1O5JA 3C6UA 1RDAA 1EETA 3VCDA 4DV1K 3G6XA 2J6UA 1WHVA 5JXSA 3GOIA 3KFWX 3U27A 4OO1J 4ZVOB 3C66A 4DG1B 4HTJA 2VWJA 4W5RA 2KFZA 1QY7A 3J7YP 3DLRA 3K89A 1N5TA 3I33A 1TL3A 3MXMA 2B4VA 5CD4A 3DHXA 2ZM6F 4WE1A 4ZCKA 4B8AB 3HBTA 2AMCB 4FLXA 5KFNA 5AQSA 1AYEA 4LF6F 4DQPA 4O44B 2CNKB 3TAFA 2FVRA 4Q0BA 4P75A 1RDUA 2ZF5O 1UEKA 2UUCJ 4A62A 1P6TA 1LNQA 2N3OA 3ZTQA 3AVKA 5HP1B 4KFBB 5HL7Q 2V0NA 2E6LA 4JV1A 4DCJB 4JUZA 2J0SD 5EU7A 1HBUA 2XCPA 3TUJC 2P9UB 2HAFA 3G96A 5KQ8A 4CLFA 2MJUA 1Z2LA 2ERRA 3MOJB 1ATRA 2VGMA 1U1OA 5HRPA 5SWMA 2DTUA 4H0XB 3O1WA 1UJ5A 1NJIO 5GAEU 1HNXK 4J9MA 1OYEA 4FJ5A 4U6PA 4E7KA 3CDUA 1S5ZA 4NLQA 5DO2A 2UVUA 1PO6A 2NZ4A 3AVFA 1NM1A 4DTMA 2KI2A 4YDDB 5AQWA 2JLFA 4X4SA 2X6NA 4FF3A 2ZITA 4L75A 1G2EA 2YHAA 2ATQA 1LWEB 1DBDA 4PCQA 2JWNA 2BQRA 4JKGB 4W5TA 5FPDA 1VK0A 3ISNC 1LW0B 4Y3CA 4ZS6A 4JI8J 1RDCA 3HTVA 1JLQB 2ZGYA 2CQ0A 3W9JA 4KKOA 2LP4A 1T94A 2FBTA 1NMDA 2DNZA 4N7TA 3IFEA 2KFNA 1Q9XA 3OYNA 3GB0A 2V6AA 1SKRA 1HMVA 2HQDA 3JAMY 4F04B 3S7RA 3FBFA 1ACMB 4E0DA 2GEMA 2MZ1A 3HVTB 1SIZA 2DHHA 3US5A 1Q8LA 1XI1A 1JKHA 4E7IA 3TX0A 1N6QA 1N5YB 2CVIA 2WC9A 3EKSA 1FTCA 2ZH8A 1RSCA 4O4GA 2DISA 2X3GA 2Z2MA 2E2NA 1RAIB 1SS6A 2DCUB 4R5PA 4JI4J 4CBXA 1SI9A 3O3LA 4AHTA 1RYRA 3OTOJ 5IWAF 3TTDA 1RBAA 1VQ5S 5AJ3K 3ZSXA 4I4BA 2X1BA 1V9OA 3L7OA 2HK2A 3AAQA 2AJ4A 1XNQJ 1T05A 1B92A 2QI2A 2F7VA 4DCPB 5SUHA 2ZGZA 1PJ6A 3WNHA 4U7BA 1KAZA 2W4PA 3PJ9A 3ZO7A 2VZ9A 2AKWB 1FT8A 4XDCA 3ZSVA 4NOHA 3RRGA 3V2UC 4KB7A 3C7NA 4AF1A 4ZLLA 3T5KA 4CJEA 4AHSA 3K0JA 4HLBA 3W1YC 3CDEA 5IWAK 2IMWP 3O3GA 2AT1B 4JAXA 3J7Z5 2VHGA 1GXTA 2XO6A 3LDOA 1BLUA 5LSRA 4KHYA 1HPZA 4J9QA 2UU9J 1VIXA 4FOEA 4TY9A 4ZVSB 1Q53A 4ZVHA 4BG8A 4OHVA 3BSCA 4KH1B 4AM7A 1NUEA 3C14A 3CCRS 2DXEA 5KPRA 2B4UA 3ZSRA 3DLEA 1D3WA 1VQPS 3L3VA 2A41A 4ED8A 4FWPA 4JKHA 4WKYA 4KO0B 2OMOA 1HLUA 1WSRA 2ZJPQ 4NO7A 3CTRA 2QG9B 2HURA 1JWWA 1CJVB 3GFZA 4EU0A 1UETA 5RUBA 2Z4PA 4ZPVR 3D0PA 1VQ4N 3IGVA 1B9DA 3CJRA 1TKXA 3IC1A 5C42A 2XG8A 2OEMA 5DM7L 4DV7K 2HHWA 4I1TA 3CHWA 4OI1A 5JVGL 1DARA 4BDZA 2DNKA 3HF5A 2IOCA 4CEDA 1R27B 2OH2A 2QXFA 1SJ4P 3HJVA 5AXMA 1LXJA 2BUNA 3N0VA 4OZ3A 2G8UA 3LPUA 1RHUB 2NSCA 2F9TA 3SAHA 1CJKB 4ED0A 3DKDA 1WC6A 2GNKA 3A5MC 4FF2A 3P3DA 2KB2A 4CJKA 4RWXA 1R43A 3V4MA 5C0YA 2GMHA 3WQTA 1JLCA 5KFHA 2BANA 4OGCA 4G9ZA 1FTRA 3TSPA 1LOUA 4OMFG 3DLKA 3PW2A 5ETVA 1F60B 3OYCA 2VG5A 1TVRB 2QO3A 3OT9A 2HQFA 4CLYA 2R8GA 4F4XA 1C6VA 5J1EA 4XEIA 1HBOA 2J9CA 3LZJA 1BL3A 1U09A 4K7QA 1XUPO 2BJEA 2XHBA 3DRSB 2YX6A 4QBUA 2Z1IA 4ES1A 3FZKA 3Q8VA 2UXBF 2QA1A 2KN4A 3UKRB 4R5PB 4LMZA 1F2HA 4OFZA 4CM0A 1SUQA 3PYFA 3RR8A 2OEKA 1GX5A 1MA9B 2VOPA 1VRQC 4IRDA 3Q2TC 4DTJA 2WCXA 3R5JB 1JLFA 3ITHA 7FDRA 4KHRA 3C16B 1KOOA 2GQ2A 1RBUA 3DMJB 3JQKA 4EZ6A 4GC7A 5F0UA 1IXKA 4BC9A 3ISZA 1SJRA 3MHYA 2VPXB 4M5IA 3NWGA 1ZBSA 5E5NA 2UXBK 2IAJB 1FWKA 4NXMF 3KVGA 4KPCA 2MLXA 2LDIA 3EPIA 4LR7A 4KSEB 2E2OA 3CERA 4JD2A 4BREA 3M9NB 3P96A 2DXFA 4CFDA 4N8OA 3DM2B 3M8RA 2ZUAA 4ZJQA 4RW6B 3QSYB 3AXMA 5H9FK 1OPIA 4I2PA 4JKFA 4Y1CA 1G3OA 2XZDB 1VIOA 4NXMK 1WOOA 3CYMA 1FJGK 2PC6A 4WTYA 3J81O 3BO4A 2HHHF 1ZTTA 3FFKB 4DHYA 4HHJA 1TL4A 5FPNA 4ECWA 1BE4A 2AYEA 1K0VA 3DWLA 4FWKA 1H74A 1SKWA 5C7PA 1EP4A 4A8XA 1QJHA 4LIWA 1G99A 2XY6A 3CWJA 2HHQA 1OKJA 3EN9A 2YNGB 2B4PA 5HBMA 5JS1A 2NPFA 2ZD1A 3QBXA 2G0IA 4YR3A 4FNHA 2AV5A 5HK4A 3IAM9 4LF8J 2HHHK 4I2QA 3TJAA 1BGXT 1UPPA 3TW0A 5EXWA 3BGOP 4GRSA 2DYAA 2OD6A 3HDSA 4MH8A 3PRDA 4A4JA 2LQJA 3JXUA 3D54A 4ISFA 3M2VB 3TR8A 3T1AA 2HRYA 1ZM2A 4UY8O 3TYTA 2IYIA 2VBZA 5GAGP 3KOAA 4N41A 1ZA2B 3K8WA 4FJJA 3R5AA 4GW6A 3QESA 1RT6B 3CO9A 3D5MA 1U0HB 1U1KA 1JLCB 2BEFA 4KTWA 2W9BB 4DFJA 3W8GA 4R8UB 2EXUA 1NMEB 1YK9A 2MJNA 3TA0A 4O3SA 1RA7A 2RB7A 3IWLA 1TV6A 3I0RB 4LFCK 1HBOB 2Z58B 4M7YA 5M1KA 4E1JA 3CC7N 1WUUA 5KT6A 4PUOA 4HTIA 2EFNA 2OGUA 2ADCA 5FDLA 1RKJA 2RRAA 3BR8A 3NWRA 4OJGA 5AXLA 1ZTWA 3CD6N 4ZCIA 3J81U 2DNYA 2XBPA 3MPDA 1N32F 4ID1A 4LFBJ 1R31A 4KHNA 4RW8A 2M4MA 2V8DA 1RHJB 3BH7B 5F3TA 1HBMA 2AJ0A 2QFIA 1NPRA 4D3GA 3C2PA 4Y0FA 5LMNF 2E9RX 2P5OA 4YB1P 3JTNA 5C24A 5LJ3Y 2OLWA 3JS9A 4ZJOA 4A8SA 4BE0A 3O4WA 3R6GB 3O08A 2NUUG 3OPKA 1VSJA 1OH8A 3QBWA 4B3MJ 3UD3P 5HAOA 4CH7A 1NK0A 1N32K 4ZLNA 3D3BJ 5M2RA 2VV5A 1W97L 1N8RT 4BRDA 1U24A 1VMBA 4CO5A 4PPDA 2P9PA 5A8KB 4J2BA 1GQEA 2HFSA 3GIJA 2VB6A 3TUZC 4O0IA 2BM1A 2WVFA 4M94A 3HZEA 1VRTB 2MYFA 2ZBIA 4YP3A 4ZDNA 3LUYA 3NGTA 1Q86T 3QLHB 2HHPA 1X9SA 2W40A 3C19A 1WKLA 4DFPA 5CHIA 1UWBB 2DJWA 3IA0A 3OFFA 4WFNQ 3E9OA 2UVRA 3ELHA 2C2MB 4JYAF 4IOAL 3VAMA 3IRWP 1IBMF 1ZH5A 1L5UA 4DV2F 4B9QA 3K7RA 1TTHB 4JV5F 2JX2A 5DK5A 3WT0A 4M3ZA 2LEAA 4OX9J 3TAPA 5F8IA 1Q1KA 5KPZA 2BGGA 3PNIA 2P9EA 4CO4A 5LMUJ 3OYJA 2UUTA 5CXTA 4BDPA 1MROA 4CW7B 1Q16B 2LU2A 3KLHB 2HWIA 1T7PA 4JYAK 3NGRA 3AO3A 3C46A 5KFGA 5HI7A 4Q2LA 4DR6J 1LFWA 2MHNA 1NGAA 1VQ9N 1EHWA 4B9TA 3K5PA 1S12A 1WLJA 3WXJA 3DOLB 3VAJA 3SQ2A 1TL1A 3C6AA 1JNZB 1RBSA 4BRKA 4FLTA 3JB9k 5F8LA 1F9FA 1S1VA 3E2EA 4WJBA 3R3LA 4HHTA 2VONA 3LOUA 2YY3A 5HQLA 3CI5A 4CJ5A 4MT1A 4DUZJ 3M9OB 2A1BA 4RU9A 1I94F 2Y3YA 2QZ8A 2NUHA 2W1BA 4M5MA 3THWB 1DTQA 4C4WA 3ALYA 1HI1A 2J9DA 4FN5A 2XZWA 2VUGA 4DL5A 2CGJA 4JHDA 3LA0A 1TV6B 1MU2B 2NRRA 4PUOB 5M1OA 4BC5A 1SAZA 1CULB 1HQEA 2LU1A 3I5AA 4DSKA 3SFUA 1V3ZA 1S1UA 4C2MA 3MDFA 1KN6A 1S6PB 2VFRA 3T1HK 4CI0B 1WSEA 2W6KA 5A6PA 4BBYA 2P51A 4JB8B 2VG7B 1OIAA 2AYBA 3VF2A 1VQLN 2SXLA 1FX4A 4ZP6A 4CGIA 2D9OA 3P45B 3O2IA 2IM2A 2F9DA 3LDPA 4DR1F 4LF2A 4BVOA 2IVYA 2OA8A 4M42A 5AQQA 1J53A 4KTZA 4M3WA 1RHKB 1QAIA 3GYXB 4A5AA 2K1RA 1D9FA 4TN2A 2P1JA 3G25A 1RWKB 3FSXA 4YDUC 2HRUA 4DL3A 2YQ1A 3AB4B 3ZETB 1CXUA 4ITSA 3TI0A 4CTAA 1F3FA 3VESA 4CGGA 2QN6B 3BBCA 1RTIB 1DQ9A 5ETLA 2R42A 2FSKA 4CLTA 3WEEA 3CCZA 2N4CA 1W0HA 5AQVA 5C2CA 3EDRB 1IJJA 4JI1F 2HVIA 1NBWA 1K73T 3UW1A 4YQWA 3AO4A 4O5BA 3SK3A 3HMJG 2HQGA 4J37A 2HZAA 5KG0A 2W2PP 3MM7B 4U67L 3ICLA 1QVGM 2DGSA 3AY9A 8RUCA 1MWQA 2HOEA 4K8ZA 1Y3JA 5F0XA 3JQJA 1HHTP 1H72C 4DPTA 2GA7A 4H4MB 3LP0A 4CH1A 4I6MA 4YNQA 1HI8A 2ABYA 2VC0A 4NEZA 2D3O1 2K7JA 1G6BA 1KLMA 1V5IB 3KHRA 2VCPA 3V1QA 4QIWD 3FJ2A 2AJFE 3LGHA 4OVLA 3TO8A 3OBIA 1NH7A 4DKWA 2XY7A 5LT5A 3G4SS 1ZBIA 2ALYB 2F40A 4NRTA 3KLEA 4FF1A 2ZH9A 4E89A 4ISEA 5JVHL 1E6YA 3NXZA 2KO1A 1RT1A 5KFFA 2U1AA 2P9LB 2VKRA 3IGNA 3GU0A 1WI6A 1DQ8A 4F2SA 1LAVA 3K9KA 3UN2A 2B0GA 5FD1A 2BJ7A 4DQ8A 3QRPA 1HYZA 4PQAA 2FSJA 2BE7D 3RTVA 4H03B 3TQ1A 2YKMB 4JOUA 4ELVA 2UXCJ 1QS4A 3SQ4A 4P73A 3RRHA 4DV4K 1B99A 2D74B 3HT0A 3BKFA 1NG9A 3SJHA 2VQFF 4UW2A 1NRKA 1VQ6N 5JUMA 5DM7Q 4K5RA 5JVGQ 3MN6A 2EK1A 3NRBA 4QCLA 3K5MA 5L1LA 1YHQS 4K4VA 3HSTB 2C28A 2XMMA 2ZH2A 3BGRB 4F4KA 3K0SA 3AA3A 1NK9A 3NP5A 4P9SA 2RRBA 2IVNA 3MR3A 4EO6A 3GYGA 3F73A 1JIHA 3ENHA 3I56S 4XAKA 4PKIA 4A47A 3BM7A 1FNMA 2FBXA 4ZVEA 3N6NA 2H3EB 3KDNA 1OYDA 1XMQK 1RABB 4PG7A 1CJTA 1NM2A 4LSLB 3ILIA 1MWMA 1KS2A 4P2MA 3OYBA 4E8UA 2FLOA 3CCQS 3VQQA 3E9LA 4QR0A 3QPIA 4J9LA 2DRAA 1TK0A 1T03A 4RBUA 1TKZB 3R8YA 2HVDA 5E2QA 2WSCC 5B0EA 4MMOA 1RDRA 5HMXA 5BPNA 1RTHB 3QFHA 4GNIA 4FDFA 2VL1A 3TAQA 1NGDA 2VG6A 2XLIA 4QIGA 1SJFA 1TMJA 3NVKA 1RT5A 4MYUA 3MMCA 2QC3A 4EGLA 2CYYA 1FXDA 5KFDA 1T9VA 4BS2A 1NEEA 3L2QA 4CD1A 4K8XA 2Q79A 3VVTA 3DGPB 5FRMA 3KLGB 4Z4CA 2FZCB 1V5VA 2QM1A 2OPPB 3M5RA 4HWIA 3CJCA 2O8DB 1NGCA 2OTLN 4WIQA 5DDRC 4LR9A 3BSAA 1PGZA 2R8KA 3FRYA 4WXOA 5KFOA 3QYYA 2WSEC 2VA2A 3H08A 2CUYA 3GCXP 2F96A 1X4FA 2HQ3A 2MKHA 3MCNA 4TSXA 1G7CB 2RQMA 5TKYA 3GE9A 4A59A 3SIPB 5GINA 3IRXB 1HWJA 4WQ5C 3L6QA 4R0JA 1D09B 1DFDA 4DR5J 1XC9A 3THXA 3EZUA 4PAAA 3D6HB 1WAJA 1I3OB 2JHEA 2OI2A 4AT1B 4QWDA 3QIPB 5I3QA 4CIGA 1RTDB 2BRKA 3H59A 4LF4F 1M5VC 3C8YA 3NOGA 1RDBA 3OW2M 4EAHD 1S72N 2DH7A 3D2FA 4CZLA 4B3SJ 4B3OB 3GIRA 4RW9A 4C6AA 3V9SA 1S6UA 3NNHA 2MLZA 1KHWA 3HM9A 4UOCA 5L39A 1FD2A 2B7BB 4IH7A 3EM1A 2RQCA 4BR9A 4BWJA 4OYAA 4MAKA 3E9PA 3W5ZA 2N3LA 1XR5A 4J9NA 3K8VA 2WUSA 4LF4K 3RAMA 5JLFA 1S49A 4H5TA 4DPWA 4RUCA 2E66A 3FSIA 2HAIA 4DV3J 2MHEA 2FLPA 1WF2A 3KHGA 3TAMB 2ZE2A 5F41A 3DYAB 2GO8A 2JVOA 3TU5A 2KG0A 3L09A 5IOLA 6AT1B 1NSKL 4GMKA 3CJ9A 2YNIA 3D1OA 2HNZB 3S3MA 3ZTPA 1H38A 1B4SA 1RNHA 5J2MA 1NHUA 2BACA 3GE1A 3DNCA 4FVMA 4K4WA 5J2QA 1N0VC 1S79A 4YDUA 4USJC 2BVZA 1HRHA 3L2VA 2IDLA 3D6RA 4EK2A 3K2PA 1FKOB 1T11A 4MKVA 1QAJA 1DTTB 4Q8EA 5FPMA 2ADBA 1QQNA 1VQ8N 4QPTA 2POKA 1VISA 3MM9A 2IRYA 2V2VA 3S3OA 4CZHA 2QXLA 2GJ2A 1TYQB 1EQMA 1KEKA 2ATLA 4G1QB 3K5NA 3OA9A 2LA4A 2F65A 3D6MB 5A0YB 4Z4EA 4E2FB 3S1TA 3R97A 2HBKA 3RZAA 4CF0A 2IM3A 5CZ2A 1Y5LB 4DV1J 4JS5A 5A76A 2NUBA 4BRCA 4KGMA 5KFXA 3WZ0A 1WUAA 4NE9C 2NRHA 4X4UA 3EWGA 3MM8B 4TXSA 2HWHA 2W7AA 4JV0A 3G8SA 1HW9A 3NH1A 2V4RA 3LQVA 2P9NB 3FC9A 4QW9A 2JNJA 5KT2A 1HX1A 3V6DA 4ECXA 3ZSZA 4IQXA 3ZZTA 4K0KF 2O8FB 4DR4F 4FM1A 2AEFA 3VF6A 4GV6A 4E1NA 1DEJA 3TP2A 3NNAA 1A6LA 4LIRA 1HI0P 2GW8A 3AJDA 1X4BA 4FXDA 2JSXA 2O3DA 5E33A 2V4QA 1P90A 1WACA 2HVZA 4BRNA 2J4RA 4GV9A 2RDDA 3KD5E 2BE9B 1IWAA 5LM7E 4FPBA 2J8AA 1CBKA 4CZJA 1FKPA 3VQCA 5C25A 1YI2S 4K0KK 4H4KC 3TWHA 3I55N 4DR4K 4ELUA 4IOAQ 3OTCA 1HNXJ 5HVGA 1S4EA 2J7UA 4X2BA 1U1NA 4RW9B 3FVYA 4HYKA 3AA2A 3N5BA 3BBFA 4TNOA 5A8RA 3T9NA 2ZJRL 3OV7A 3QFUA 1WEZA 2NQPA 3CJ1A 5GAHP 4DR3F 3H1VX 2B56A 1BDGA 3GQCA 4KPYA 2E88A 2LLZA 3RB0A 4KTQA 3BYRA 3O5TB 3G6YA 4KHUA 2P9KA 1T02A 3W2VA 3BF3A 2E7XA 2ASLA 4BY9C 3WNFA 1U1PA 2QA4S 5JMVA 2RDJA 6FD1A 4CLLA 4DPYA 1R89A 3LWLA 2ZDPA 5HVHA 3MEDA 1R0CB 3GCWP 2FSNA 4EHUA 3QATA 3MEKA 4WU2A 4DLGA 5HRSA 3MPUB 2DGVA 4K4XA 1K47A 4DR3K 2ZH5A 2ATCB 3Q23A 4C0OC 1VBXA 1Z05A 1HHQA 2GX9A 3RG6A 3AHPA 2AWZA 3QWUA 1RT2A 1GEHA 3AVBA 3VGSA 4J9PA 5BN8A 1BUPA 1TGOA 4OPJA 3MM6A 2E4LA 4V19J 4HKQA 4IFYA 1O51A 3GFHA 4AXJA 1WEXA 4ICLA 2HS0A 2HQCA 5AJ3J 2WONA 3H45C 1BCOA 3G8QA 1GNKA 4LUBA 4CO3A 2FBVA 1YBUA 3TJ8A 4ZJLA 1HUXA 2L41A 4B17A 1VQKN 3SQGA 4ID5B 5CCLA 3VGMA 4OJRA 1XWLA 3THTA 2DPIA 2PEHA 1X8DA 2XS5A 1DAXA 3AFGA 2GZOA 2D0OA 2O1PA 3L3UA 6FDRA 3WXLA 1TUGB 5I42B 1O1WA 5DRKA 2ASJA 5IWAJ 4PG5A 1RAAB 2R8JA 4MK8A 3GG0A 3FR0A 2UP1A 1RCHA 3QT8A 4OIXA 3MEEB 4PABA 2EG1A 4JI8F 3CD0A 2VKZG 3KG0A 4IDKB 2ZFHA 3IM9A 3BN7A 3OL8A 4JLHA 5FLXU 1QVGR 2HNYB 5G4DA 3PR5B 4QR2A 2W9CA 1O6XA 1HR0K 3QETA 1DRZA 2BQ3A 2MZRA 4FWOA 3P49B 3UDEA 2CQ2A 1YJNN 2BM0A 4PKDB 4WQ5A 4C1NI 2A1SA 2M52A 5DLFA 2HMIA 2ASYA 3QEIA 3E3XA 5ITHA 2KKZA 2G4BA 3BDEA 3H5SA 2A6MA 2M8DB 5I3PA 5DJBA 3V9XA 3OXGA 3RB6A 2Q66A 4PY5A 2V94A 4CLKA 3BEGB 4DUYK 4JI4F 2KRBA 4RO0A 3OTOF 3RMCA 4C8NA 1SC4B 1E6VA 3HFZB 2XS7A 1N33K 4Q45A 4DV7J 1Z26A 1KLNA 3D6FB 4NZ7A 4U67Q 4CJUA 2CPJA 1M1KO 1HNWF 2FHJA 4IFVA 1HYVA 3LP1B 1RU2A 3RMAA 3ENBA 1L3KA 1Q7YT 2CDQA 1IO2A 3C6TB 4PXDA 2APOA 1NKCA 4J5OA 1FEHA 4DI6A 1VQSA 1EWRA 5AZJA 3RSEA 2I8EA 3E1YA 5T7BA 5DDOC 1FJCA 4A48A 1V6HA 2QL5B 2OKQA 1AUSL 3ULDA 1BHNA 1HNWK 4U96A 1WORA 1N4LA 2UU9F 4IRKA 2XQCA 4TQRA 4CK1A 1NHVA 2A10A 1YGYA 3QGPA 5JVHQ 3M30B 4DL2A 3M1VB 2F8EX 1LOTB 2LFVA 2RPIA 2EFGA 1NB7A 3HXMA 5F8NA 2HBYB 5E3QA 1ZA1B 2B8PA 1HHSA 5HLFA 5DQGA 1JJ4A 3AVJA 4ILGB 1IBCB 4DS5A 2PMHA 5F8MA 4Z4IA 1P9QC 3PW4A 1MWZA 3LF0A 2Q1NA 1TKTB 3CDBA 3M8SA 2IY5B 1HQUB 3G82B 1IJFB 3KJVB 4ICLB 4KGKA 4URGA 3NGSA 1JXLA 2Q0RA 5CQGA 1WBBA 2MEWA 2DO4A 3SPZA 2CH6A 3I4HX 4OLBA 3AVMA 3TABA 1R6YA 2Z8QA 3SNNA 4K4UA 1S22A 1RISA 1RWPB 2HVEA 1F0XA 3WXMB 4M5DA 3UD4P 2UXBJ 3W8PA 4CJRA 1FXLA 4X4VA 4ZTJA 3R2CJ 3J81Y 2YPYA 1QSYA 4Z4GA 2DH9A 1LWFA 3V4IA 1VQMS 5DGBA 1WHXA 3Q8YA 2HB5A 1Y3KA 2VGNA 3W3DA 1RAJA 4ZA1A 3IM8A 2Q2RA 4JV2A 3PYEA 2PYJA 3VWSA 3UPFA 3D1HA 3OXLA 5H9FJ 3A1YG 3FCHA 1UW4A 2OMLA 3FMBA 3AV9A 3PY8A 4DCHA 4BRLA 4MFBB 2R2RA 1SJ1A 4NXMJ 2CQIA 3CCVS 5C2FA 2C1EB 3HVRA 1FJGJ 4NI2A 1YDLA 4ZIWA 3VAHA 1OY8A 3L4IA 5HMYA 4RWTA 1W7WA 1HKGA 5EWEA 3TWZA 3THPA 3WQUA 4R25A 4NXNK 3SQ0A 3HPHA 4OYPA 4H4KA 3Q0AA 3CJ3A 3D2EA 3RW7A 2DXDA 3KIOA 3LZIA 3MMAA 2F3JA 4HTLA 4ERDA 1KVAA 2NS1B 4QS8A 3P8BB 2HHHJ 1GXLA 2D41A 4B9VA 4F3QA 2OPSA 1K0TA 3KMQA 1U49A 1SXLA 4P52A 1EWQA 1YIJN 2CNOB 3IAS9 3N28A 3OW2R 5L9XA 2HFZA 3ULHA 4KB1A 1T9TA 3DRRB 3EKUA 3N6LA 4PR6A 3D68A 1W2BM 1IG8A 2NPIA 3M6UA 3PW7A 2DHXA 3R6LB 1QSLA 2RSQA 3ZZ0A 5JMNA 2V50A 1M1GA 1IBLF 2VYPA 2Q31A 2BABA 2FY1A 3CD7A 3VEWA 2CQCA 2CPFA 2HS3A 3UWTA 4K4YA 1T9UA 4J9SA 2ZBQA 3OTEA 1OWXA 3BQ1A 3W64A 1RT7A 4M3TA 3UN3A 1APSA 1ZAWA 3CQ8A 2WBNA 3L2RA 3TAGA 4CK2A 2K8GA 3W5XA 4HCBA 4ZLPA 3OBYA 4LFCJ 4OV6A 1PSDA 4FYWB 2QWNA 2R2UA 1UEVA 2NNWA 3DN9A 1WOPA 4EBDA 2FHMA 2AW0A 2HF4A 1IBLK 3MXIA 2O8EB 2HS4A 4ID8A 3W65A 3OHRA 2RF2A 1JJHA 4R0EA 2LQ8A 1ZBUA 5B0FA 1JNRB 4ZLJA 1SL0A 4YEAA 4P72A 4JKDA 4OZ5A 3X3UA 1S6QA 1YJ7A 1S0OA 1C1CA 4DPUA 4LRFA 2I9SA 3BGUA 3DI6A 1VYAA 5KFEA 2KXFA 4IR1A 5HJXA 4C0BA 1IKXA 4X62K 2YQ3A 1WC4A 2N7CA 2QYCA 4C0HA 3MCPA 4C8KA 4PXBA 4M5NA 3JSMA 5C2GA 2NRZA 4U7UD 3LDNA 1N32J 3ZZPA 2E29A 4DPXA 1LFPA 2YKNB 1NGHA 2LYVA 2F4VF 1ITGA 4CF9A 1ZZNA 1UJ6A 1N34K 2CNNB 2XNRA 3CJBA 3QGHA 1KQKA 1WBDA 2AGOA 3W61A 1PYSB 3S9HA 1OQ3A 1X60A 3M32B 2BJ3A 2A6OA 1Y64A 3M1FA 4HDHA 3G10A 3CD5A 5CZVA 4CDIA 1OSCA 2KJVA 4FJ8A 1RFQA 3JQMA 1SL2A 3CCUN 4KH5A 2F4VK 2I5JB 1BUXA 1RBVA 2W8KA 1ULRA 1JXBA 4FPRA 1SQEA 5LSOA 2QK9A 1RWUA 1X4AA 4FJMA 1KKHA 4JKAA 4ELTA 2I7NA 1LAWA 2FVPA 2EKNA 4OJ3A 3M9MB 3VZIA 3B6PA 2G8IA 2N7YA 4LFBF 1MSWD 2FC8A 4L72B 1S76D 3A2FA 3D2EB 4RUBA 2JC0A 2ZWHA 3RVCA 3N4WA 4RNHA 4JYAJ 2A3ZA 2F4F