4RW4A

Crystal structure of hiv-1 reverse transcriptase (k103n,y181c) variant in complex with (e)-3-(3-chloro-5-(4-chloro-2-(2-(2,4-dioxo-3,4- dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj494), a non-nucleoside inhibitor
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
554
structure length
538
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIWRKLVDFRELNKRTQDFWGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H, p66 subunit
publication title Structure-Based Evaluation of Non-nucleoside Inhibitors with Improved Potency and Solubility That Target HIV Reverse Transcriptase Variants.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 145
structure length 538
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4rw4A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rw4A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4rw4A05
2D3UA 1JXLA 3AVJA 5EU7A 2VG6B 5KGXA 4KHYA 1S0NA 4CJ5A 2HMIB 4H4MB 4CK3A 1IKWA 3OYIA 5KFZA 2FVPA 1GX5A 1WSHA 4DSKA 4OLAA 3V6DB 1W9HA 2WCXA 1DTQB 4LSLA 4CJFA 2OPPA 4C8LA 5EWFA 2E4LA 3MXMA 4TY9A 1IKXA 4B08A 3G6VA 1EKEA 5J2PB 1RA7A 3V4IB 3GIJA 4WZMA 3CDEA 4FK2A 5SWMA 3UDLA 4KV8B 3ISND 4DTOA 3L3UA 4BACA 2YKMA 4LQ3A 1LWEA 3DI6B 2G8UA 3H08A 3MEDA 2HHUA 3K57A 2BDPA 3CVKA 3QEPA 3BQ1A 5HRPA 3RB3A 1HNIA 1YT3A 1C0UB 1RT4A 3QZ8A 4CF9A 3TAEA 1TKXB 4KTZA 1KFSA 5KFIA 4QCLA 3PY8A 3OYFA 2R7YA 4ED0A 4CJWA 3HO1A 3V9SA 1RDDA 3C94A 4NLGA 4CGGA 5I3UB 4ECRA 3DLRA 4AHVA 3DRPA 3WNGA 3M8QB 1TQLA 2UVWA 1ZBHA 4IH6A 1XR5A 3LP1B 4OKEA 4PQUB 3EPGA 2ZQBA 2VG6A 3AVCA 2HMIA 1RT6B 3JSMB 4RG8A 3K59A 3PX0A 1RTHA 4FW2A 3BDPA 4CJPA 4O4RA 1RBSA 1WAJA 4KI6A 3V6DA 2QV6A 3HP9A 1DTQA 4IFVB 5C42A 4TYAA 2GBZA 5J2NB 3KD5E 3DLBA 4DFJA 1TV6B 4OPKA 2J6SA 3O3GA 4DFKA 3V4IA 5KFXA 2FBYA 2DFFA 5DG7A 3HKWA 4Q0BB 3RRHA 2YNGA 4B3OA 2I5JB 1RBTA 4KV8A 4F50A 3LP0B 3ZSVA 4JV0A 1VSKA 3LPTA 4CEFA 4F4WA 3S9HA 3VQ4A 1IKYB 4IDKA 2E6MA 2KW4A 4EZ9A 3IS9A 4DU3A 4MIAA 4WE1B 1D8YA 4J9NA 1TKXA 2F8EX 2O5DA 4DU4A 2GIQA 1VSEA 1RTIA 1KVAA 3KJVA 4DEZA 3FFIB 4IG3B 2VWJA 4Y2CA 1D9DA 4HKQA 3RR8A 4DL3A 4BE0A 2BRLA 4UQGA 4ECXA 3M8QA 4ECZA 2GC8A 1S6PB 3V6JA 1L3TA 3LP1A 1VSJA 3KHGA 2XI2A 3D45A 4Z4HA 4I7FB 3MFIA 3BGRB 2HVIA 1BI4B 3JSMA 4X2BA 4J9KA 4E7LA 1JX4A 3PJXA 5KT5A 4DG1B 4CEQA 1JLQA 3DLKB 2FJWA 2RDIA 3C6UA 1Z4UA 4O3SA 3SQ4A 3OHBA 3SUNA 4DF8A 3T1AA 5J2NA 3H5SA 3VQEA 3C6TB 5DQHA 5KT3A 1TV6A 3PR4A 4AHRA 3NKYA 3M8RA 3QLHB 2XGQA 2DFHA 4BWMA 2WTFA 3G10A 2X6SA 3OL8A 3OYJA 4Q0BA 1YTUA 3S3MA 3RWUA 2FLNA 3RMCA 2B4JA 4RU9A 1K1QA 1TKTB 1RT1B 1FXXA 3NHGA 3LP0A 4O0JA 3L3VA 1LAWA 2HNZB 2ATQA 3IRXB 1IKYA 2ATLA 5KT2A 4M45A 4IKFA 3ICLA 2IM1A 1BIZA 4WE1A 2W7OA 4KHUA 4ZP9A 1KHWA 4BE1A 4DL2A 1XHZA 1JL1A 2RKIA 4HTUA 5CYQA 5KI6A 1NHUA 2AJQA 1RTJB 3KLEB 1UA0A 3QO9B 3TABA 4B8AB 2BQ3A 1B9DA 2OZMA 3SV4A 3QGGA 4CECA 1NK0A 1BQMB 3AO1A 5KFQA 5JS2A 1JLFB 1SKSA 1N6QB 2R8KA 4E1NA 4J9MA 4J9RA 4J2EA 3KOAA 1S6PA 3RB6A 3Q8QB 5J2MB 3BGRA 5KG0A 4AILC 4FLYA 3NH1A 5EWGA 4RW8B 3DLGB 2C22A 4HHTA 4DG1A 1C1BB 3CIZA 2CJQA 4CFBA 2B5JB 4OLBA 4IOBA 1ZBFA 4O4GB 1S1WA 1S6QA 3SUQA 2UVRA 3VA3A 3C6TA 2W7PA 3ISNC 3QLHA 4Y1DA 3DOKB 1KSPA 2DPJA 4K4UA 2R2TA 3ZT0A 4DTJA 1TKTA 4J9PA 1SKRA 5D3GB 1NOYA 1WN7A 4JV1A 3I5AA 4PWDB 3KMSA 1HQEA 1U09A 2HNZA 4LSNB 3IRXA 4YP3A 1KCFA 4CHQA 4ECVA 4OGEA 3QNNA 4CJEA 5HP1A 2JEFA 1RT3B 3SQ0A 2Y1IA 1HNVA 3K5LA 3VQSA 5JS1A 3LANA 3U6FA 1RTJA 4FLXA 3KLEA 3MEEA 2OA8A 1IKVB 4O3QA 4C8KA 3AVGA 4G1QB 4WZQA 5KT6A 1EX4A 1MU2B 3AA2A 4HUEA 4I9LA 1LWCA 4ZMMA 1KRPA 4CJSA 3G6XA 4RUAA 3DM2A 2EHGA 1LW0B 1KLMB 3OLBA 4FZZA 1RYRA 4CESA 3L2VA 4R5PB 2RDJA 1S9FA 4ECQA 5DQGA 1NHVA 4YNQA 3VQ7A 1WSGA 2Z1HA 4AHSA 2HWIA 1QE1B 3DLGA 3I0SB 4RW8A 4YR0A 1C1BA 3BSAA 5KFJA 4KE5A 3OJUA 2B5JA 3D5MA 3ZSQA 1WLJA 3V81A 1EETA 4URGA 3M8PA 4Q8FA 3DOKA 4ELTA 2FVRA 4DTMA 4W5OA 3NBPB 3HPGA 5KFSA 1FKOB 1A5XA 1J54A 4FM2A 2YHAA 4ZHRB 3BQ2A 1GX6A 5KRTA 5EUHA 3RTVA 3IAYA 3RR7A 5FDLB 4PWDA 4NLVA 5CY4A 4EBCA 3HYFA 4LSNA 4DL6A 2A1SA 3SV3A 3OYAA 5L1LA 1SV5B 2HWHA 3TANA 4ZTJA 4FS1A 2IGIA 4TY8A 4TSXA 4IFYB 3CO9A 2C2EA 4Q45A 1S1VB 4CGFA 2O4GA 3O4NA 3HXMA 3NGIA 1RT7B 2VA2A 4B9LA 3FRZA 4Y1CA 1IKVA 1D0EA 2W9BB 3B6PA 4G1QA 2BRKA 3OY9A 3HSTB 4Z0UA 3OS1A 1MU2A 4XPCA 4MK9A 2AWZA 3KKSA 3OHAA 4J9SA 1LW0A 2GIRA 4QWBA 1ZBIA 5F9LA 4R5PA 3O3HA 3Q8PB 3H4DA 4CHZA 2G8FA 3SJJA 4C8MA 4RW9B 1L3SA 4KREA 1QE1A 3I0SA 5DQIA 2YV0X 4PUOB 2KQ2A 4QOZB 4MK7A 2P1JA 5L9XA 4TYBA 4IG0A 4IQXA 3V9XA 3H59A 4M3RA 5KFLA 5J2QB 2C28A 5KFHA 4CIFA 2O4IA 1HPZB 5F8IA 5FROA 4J2BA 1N5YB 3LWMA 4FLWA 4E7KA 4E7IA 5KFFA 5FDLA 2ZE2B 2IAJB 4ED8A 4CGJA 2FVSA 1RYSA 4CHYA 1SV5A 4CEOA 3GV8B 2HW3A 3OL6A 1X1PA 1CLQA 1NNDA 3SFUA 3N6MA 4IFYA 1L5UA 4F2RA 3VN5A 4N76A 1HYSA 3NF7A 3QIOA 1ASUA 1RT7A 3VQAA 5KFRA 4KI4A 1SUQB 3QGHA 4TLRA 2W9BA 3NF9A 4NYFA 3MR2A 1HJRA 1C1AA 4DL7A 4GVMA 2A1RA 4RW7A 4RW6B 3SYZA 3P1GA 2OPQA 1O1WA 3QESA 4CGDA 2OPRA 2KFNA 1QTMA 4FM1A 4FS2A 2W42A 2YNIB 3K2PA 4RW9A 4WFXA 1RDBA 3BREA 4NYNA 2F8TA 4CK2A 4CJ3A 1XWLA 4DTNA 4GMJB 4NRUA 2AGPA 3KK3B 2J6UA 4F4KA 2XI3A 1ZYQA 4FCYA 5C25B 1U4BA 5J2QA 3VQDA 2ITGA 2W8LA 4KO0A 3CFOA 1HPZA 2ALZA 4DSIA 1N5YA 2XWYA 4CE9A 4NLWA 4IRKA 1S1XB 4FJGA 1QAIA 3JYTB 2JEJA 4H8KA 3HT3A 3HPHA 1T3NA 2IAJA 4ELVA 2IM2A 2ASDA 3OYGA 4O44B 2GV9A 4DQIA 4IRCA 4Q8EA 4CIEA 3VQ8A 1Z25A 1JIHA 2X74A 3PJWA 4KSEB 3MXIA 4K4VA 3P83D 3KK2B 4NZ0A 5DG8A 2W9CA 4PA1A 3CWJA 3CJ3A 1WSFA 1SUQA 3CG7A 3MEGB 2CKWA 4M3YA 4FJLA 4FK4A 3BSNA 2R2SA 4ID5A 3T5HA 2UVVA 2EC0A 4W5QA 4AHUA 4XO0A 3H5YA 1CZBA 4HUGA 2IMWP 4F2SA 3QEVA 3NE6A 4FK0A 4CEAA 4NYZA 4N5SA 2X6NA 2PYLA 2Q3SA 4C8OA 2WB4A 2YNIA 4H4MA 4U6PA 2AQ4A 4CEDA 2YHBA 4M95A 3PW4A 4KTWA 1Q9YA 3KK3A 4CF2A 1KLNA 1S48A 3LAMA 5KG3A 5J2PA 4IBNA 4Q5VA 4AHCA 5C25A 1NOZA 1BL3A 3OVNA 1QUVA 3ITHB 3L2RA 4ZP6A 3KLGB 3KMQA 1LW2B 4YMEA 1TK0A 3AVBA 4B9MA 5KFBA 1CZ9A 1B92A 3DI6A 4EP5A 3NDKA 2KZZA 1HARA 2BE2B 3GYNA 4ZPAA 4IRDA 4O44A 1UAXA 3VQ5A 2R8GA 4NLPA 3AVMA 2XO7A 3KK2A 1C0UA 4CGIA 1SH3A 2QKKA 2OPSB 2FVCA 3UIQA 2ASLA 4M3UA 4KAZA 3DLEB 4KB1A 2FBVA 3U3GA 2Z1JA 3BSCA 3MEGA 4CIGA 4F3OA 5I3UA 2V9WA 2FBTA 2R8JA 1FK9B 3OYEA 3K58A 3ZSXA 3QZ7A 1NK6A 3TAPA 1WSJA 3T3FA 3CJ2A 2UVUA 4PQUA 5KFEA 1I39A 4KHSA 1JLAB 4IR9A 4DQRA 1RT6A 3V9ZA 3VQQA 4Z4CA 4O0IA 3PUFA 1RDCA 4CJTA 3T19A 3RRGA 4ZPBA 4IFVA 4NLOA 4HYKA 3MECB 1QSYA 1VSFA 1VSMA 5HRRA 1T94A 2HHTA 1N4LA 3EZUA 1DTTB 4OPJA 3ITHA 4BE2A 3DYAB 3NMAA 4Q44A 1S4FA 3MR6A 3KLGA 4FLZA 3WNHA 2I5JA 2VWKA 4I2PB 3HK2A 1LW2A 3FSIA 3G0ZA 2F96A 3OJSA 4CEEA 1SL2A 4NCAA 3VQ6A 2BE2A 1RTDB 4J2DA 3E01B 5F8LA 1TL1B 3UR0A 1K1SA 4E7HA 1BCMA 3ZSYA 2R8HA 2IBKA 1BCOA 1JLBB 3DLEA 4ED6A 2P5OA 5KTQA 2G8VA 4QWEA 3FFIA 2PYJA 4IG3A 2B6AB 3LP3A 2X78A 3V9WA 5T14A 5FRMA 2P51A 1HYZA 5KGWA 3ZT2A 3HVAA 4NLUA 1ZBLA 4TXSA 3K5OA 3RB4A 1RAJA 4KBIA 1N48A 4CF1A 4CFCA 2ZD1B 5L1KA 1JLAA 4I7FA 4MFBB 3RAXA 3AA5X 3QEXA 1BI4A 2XRIA 5DMRA 1KFDA 2XY5A 5KG1A 2E6LA 2JC0A 3DLKA 2BANB 4CEZA 4WYLA 2XCAA 3PHEA 4QPXA 4M3WA 3BQ0A 3T5KA 3MECA 4B9VA 1IH7A 4E3SA 4DWIA 1QSLA 3KNAA 4DQSA 4CJKA 4K8ZA 3EY1A 4DFMA 2IM0A 1NJWA 3QIPB 3F73A 4CFDA 1ZTWA 1RT1A 4NLYA 2Z1GA 3I5BA 3NAEA 4ED1A 3HJFA 1NJZA 4CJUA 3NGDA 1RBRA 2I1RA 3HP6A 3E01A 3MF5A 2YNFB 3L2WA 5F8MA 4OKJA 1EXQA 3VQBA 4CFAA 3SQ1A 2G8KA 4KAIA 3I5CA 4WFYA 3MFHA 2B43A 3V1OA 3DDKA 4QWCA 2HHXA 4CHNA 3QO9A 1U45A 4J9OA 4Y34A 2AX0A 4F3TA 4K4XA 4FZXC 1TKZB 2DTUA 5HBMB 1BQMA 3HL8A 4ED7A 4I2QB 3LWLA 1JLFA 1N6QA 4O3RA 4K8XA 4CCHA 3L8BA 1F21A 2HVHA 5K14B 2ZD1A 5J2MA 4DLEA 4MFBA 4HVJA 2BR0A 4DLGA 3HM9A 2WRMA 1R0AB 2OH2A 1LV5A 2BANA 3SUOA 4B9TA 4O4GA 4NCGB 4I9QA 2HB5A 5I42B 5F8NA 3QYYA 4W5TA 5L1JA 1HRHA 4CF8A 3V1RA 3QIPA 4ELUA 4K4TA 3CQ8A 3AVKA 4K4ZA 5D3GA 4DL5A 3K5MA 3GQCA 4C8NA 4CJ4A 4NLDA 1SL0A 1D9FA 1TVRB 5KFPA 4BDZA 2YNFA 4IH5A 4NLRA 1QQCA 1RT3A 2D5RA 5JXSA 4FLUA 4M3TA 1RT2B 1JKHB 4N56A 4PY5A 2JEIA 3P5JA 3AA4A 2WONB 3MR3A 3H5UA 4OKKA 5C24B 2E9RX 1DLOB 1J9AA 1TKZA 1TGOA 1WAFA 5HBMA 4E19A 1S9EB 4ZTFA 1T03B 4KB0A 2ZKUA 3ZSOA 4Y3CA 1IO2A 1EP4B 3OYLA 1KLMA 4ID1A 3H4BA 1KHVA 3PV8A 4TQRA 1C0MA 5K14A 1RILA 4EBEA 4YQWA 4WXWA 3QNOA 2E9TA 2HNYB 1T8EA 4CJQA 1RDAA 5KG2A 2KFZA 1R0AA 1S49A 3OLAA 5KFNA 3TAMB 2AGOA 2IM3A 3QIDA 3CFRA 4NLQA 4ECTA 2XY7A 4OJRA 4NCGA 3NAHA 5KFMA 1MMLA 4YR2A 1L3VA 1SH2A 3TAGA 4FJMA 3TAFA 1XI1A 3NBPA 1J53A 1FKOA 1SH0A 4DFPA 4ZHRA 4L8RB 3OYCA 3AO3A 2OPPB 1J5OB 3ZSZA 4FZYA 4E1MA 1CXUA 1A5WA 1IKXB 4R8UB 2YNHB 4DSJA 2HNDB 3DRRB 4ZVEA 2R2RA 4E89A 3ZT3A 3KLHB 5KFWA 3DMJB 3ALYA 4CJLA 4M3XA 4J9LA 1S0MA 5L1IA 3SNNA 5KG7A 5FRNA 2HHVA 3NF8A 1S1VA 2YKMB 2IJFA 4FM0A 4FYDA 3NH2A 3QEIA 4JS5A 3MEDB 1D1UA 2IS3A 3NF6A 3QERA 5C24A 1DLOA 3FQKA 4NLTA 4KTQA 3TAQA 3ZSWA 1T03A 4RNFA 1RT4B 2J6TA 1EP4A 5KFCA 3NH0A 1A5VA 4ZP8A 1W0HA 4GC6A 5DK5A 3SPZA 4ECYA 4KFBB 4DTPA 1YVFA 2V4QA 2HNYA 1WNSA 4ZVHA 2Z1IA 4YFUA 3CFPA 3M8SA 2VG5B 3DRPB 1UA1A 4FVMA 3GV7B 4H54A 3TAMA 3RBDA 3LZIA 5T7BA 1LAVA 1HMVB 3PZPA 4WYWA 4PUOA 3PVXA 3F9KA 3SQ2A 4EYHB 4KHMA 3IGNA 4DTUA 3RB0A 2YKNB 4KHRA 1RTHB 2XGPA 4B9UA 4NLXA 4TN2A 4EBDA 3WNEA 5KFVA 4NCBA 5KG5A 5C42B 1JL2A 1J5OA 3RAQA 2ZE2A 4R8UA 2YNHA 3OSNA 5KFGA 3EYZA 2HNDA 3DRRA 4B9NA 1NKEA 3O3FA 5KT4A 3KLHA 2YNGB 3DMJA 3VQPA 4F8RA 4B3OB 4FJJA 1NK4A 2D7SA 1X9MA 3CJ4A 4CGHA 3AV9A 5F8GA 1YVUA 5KFTA 4EO6A 2V4RA 4N47A 2BQRA 1FKPB 2VG7B 4EO8A 2QKBA 4IR1A 3MR5A 4IDKB 3AVLA 4FJIA 2FC0A 5DLFA 1U49A 3H40A 3IS9B 3L2UA 1U04A 1S0OA 4AHTA 2QE5A 1T7PA 1XHXA 4RW6A 2C2DA 1S97A 4LY7A 1QS4A 3LPUA 2XHBA 3QINA 3PX4A 1NKCA 1RTIB 1QHTA 3KJVB 3N6NA 2ASJA 4KFBA 3BSOA 3L2QA 3SZ2A 2C2RA 1BGXT 2AX1A 3UQSA 2VG5A 2HHQA 4Q43A 2R8IA 3TVKA 3MXJA 3RMDA 1VK0A 4KHQA 3B6OA 3MTKA 4ECUA 4TQSA 1TAUA 1HMVA 5DGBA 3N6LA 1XC9A 2P5GA 5KRSA 4QWAA 4LD0A 2YKNA 3GILA 1RCHA 3NCIA 1JLQB 3C6UB 4KRFA 4RZRA 5HRSA 2UUTA 4JLHA 1BISA 1JLEB 3KKRA 3PO4A 3TQ1A 3D28A 1S1XA 3GIKA 1NJYA 3JYTA 2XY8A 1N56A 4O3OA 4CHPA 2D0BA 4DF4A 3OS0A 4ZVFA 1XR6A 3H98A 3ZSRA 3AVHA 5J1EB 3NL0A 3M9MB 3DOLB 4FBTA 3IGVA 4IKAA 3SI6A 3C95A 3I8DA 1X9WA 5KFKA 1S1TB 3V6HA 4ZP7A 3PW5A 4K4YA 4EYIB 2W9AA 1REVB 5DGAA 1FKPA 2VG7A 3WNFA 3CM5A 1UWBB 1ZTTA 3Q8SB 4N41A 4MKAA 1CXQA 2G8IA 1IM4A 1BQNB 3ZT4A 4WFZA 3PW2A 3ZT1A 4DSEA 4F4ZA 2RKIB 2JGUA 3KIOA 5CYQB 3KHRA 4FBUA 3AVNA 3DLHA 3UPFA 1IG9A 4FJ7A 4WXOA 4EZ6A 1HQUB 1Q8IA 5F8HA 2AU0A 3RMBA 4R0EA 1U47A 5KG4A 2FLPA 3HVTB 3ULDA 3H5XA 2WOMB 1C2PA 4MQ3A 3U3YA 4ICLB 3NFAA 4Y2AA 4DL4A 1B9FA 3NGZA 3M9OB 3V6KA 3SUPA 3GIMA 1JXBA 2XC9A 4IH7A 4JS4A 2ILYA 2ILZA 4NLSA 2E9ZA 3KLFB 2JC1A 3BJYA 4OGCA 3SPYA 4MIBA 3CDUA 3BR9A 3FDSA 1RT5B 4CERA 4RNNA 1X9SA 4JUZA 4Z4FA 1HYVA 3AVAA 4JRQA 1S1WB 1JLEA 1S6QB 4BDYA 2OZSA 1GOAA 2G8WA 1VSDA 1JLCB 5JUMA 2G8HA 3T5JA 3MAQA 1QAJA 1RBVA 4DTSA 4U7CA 5J1EA 2EX3A 1K6YA 3DOLA 2OYQA 4RW4B 1BHLA 1S1TA 2OPSA 4B8CA 4KHNA 1RNHA 1REVA 1HQEB 5CYMB 2QXFA 3AO2A 3TR8A 1UWBA 3KLIB 1NK8A 1C6VA 4GC7A 1BQNA 1S1UB 5HP1B 5F9NA 2D3ZA 1WNEA 1QSSA 1FK9A 3EPIA 2DY4A 1HNVB 4DSLA 3OYMA 4J9QA 4URQU 2RPIA 4YR3A 5KFOA 3QEWA 3K5NA 1SL1A 3MEEB 1TKDA 3KD1E 3OSPA 4W5RA 3KLVA 4RNHA 4Z4IA 1HQUA 4FJ9A 1Q9XA 1S5JA 4HUFA 4E0DA 3O4QA 2D0CA 1LWCB 3SI8A 3DM2B 4DTXA 3HVTA 3VQ9A 5E41A 2WOMA 1ITGA 5KFYA 1CSJA 1RA6A 4ICLA 3PW7A 2JLEA 2RF2B 1I3AA 1DTTA 3IG1B 2XY6A 3I0RB 2R2UA 4M94A 3DYAA 4K50A 1C0TB 3KLFA 4K4SA 1RT5A 5F8JA 4I2PA 5HLFB 4EEYA 1U48A 5HROB 2IDOA 3V81B 2BGGA 1EETB 4EP4A 1JLCA 3M8PB 3CDWA 3AVFA 1RTDA 4F4XA 1TL1A 4LH4A 2WK4A 4FJNA 4RW4A 2DPIA 3LALA 3QGIA 4DU1A 1JLBA 4CJRA 5CYMA 2XCPA 4OL8A 5KT7A 1NK5A 1NJXA 3KLIA 2B6AA 5C5JA 5EDWA 4OVLA 3OYHA 1S1UA 4TY8B 3CJ0A 4DQQA 1NK9A 4QW9A 3ZCMA 3M9NB 3OL7A 4FJKA 3RMAA 3GV5B 5SZTA 4M3ZA 3E51A 3AA3A 2IC3B 3GIIA 3RBEA 2GUIA 5KFDA 1ZETA 1VRTB 3CM6A 3DRSB 4M42A 3PR5B 4FLTA 1SKWA 3V1QA 3THVA 1C1CB 1VRUB 4RNMA 3LZJA 4ZPDA 4ED3A 1TL3B 4G3IA 4KKOB 2FVQA 1JXEA 3G6YA 4DSFA 3TI0A 4JV2A 1ASWA 3V9UA 1LWFB 3AO4A 1TAQA 2RF2A 2WHOA 3CJ5A 2W8KA 1S10A 4RNOA 3IG1A 3SFGA 3I0RA 5DG9A 1GOBA 5CZ1A 1VSLA 1C0TA 2IJNA 4M41A 3Q8RB 1RDRA 1YTAA 3S3NA 1UOCA 3KHHA 3PO5A 5HLFA 3HPOA 5HROA 1WSIA 1T05B 2KZMA 1NK7A 4CF0A 4HCCA 1ASVA 3AVIA 1S9GB 4IG0B 3G86A 1KTQA 4JRPA 4H4OB 2F8SA 4CJVA 3OL9A 2LSNA 3OS2A 2HHWA 5KFUA 4KPYA 3VA0A 4BWJA 3NAIA 4ECSA 1Z26A 5EWEA 2QK9A 4O55A 3T5LA 4CEBA 1JLGB 3HVWA 2D0AA 2FBXA 4DS4A 3CYMA 2UUWA 3FQLA 2JEGA 3HVRA 2IOCA 2FLLA 4I2QA 3ASMA 1L3UA 3KTQA 1HYSB 1XR7A 2VA3A 4AH9A 4LQ9A 4FJ5A 2IC3A 4E7JA 3IN5A 3KK1B 4FXDA 4QW8A 2Y1JA 1VRTA 3AO5A 1W25A 4FJHA 3DRSA 2IA6A 3LP2B 3OYDA 4DTRA 1C1CA 1VRUA 4XIUA 3TARA 4RW7B 4Z4GA 4URSA 3HHKA 1TL3A 4KKOA 2OPQB 2PZSA 1KVCA 3OYBA 2OPRB 3PW0A 1TK8A 1LWFA 1RBUA 1VSHA 4HCBA 5CZ2A 1IKWB 5I42A 1ZBUA 1WSEA 2PY5A 4RUCA 4F4YA 4XPEA 4J2AA 4MH8A 4O3NA 4LSLB 3VQCA 4CK1A 3LAKA 1T05A 1S9GA 1TP7A 1Y97A 4H4OA 4DQPA 4KHWA 1NKBA 1I6JA 1TVRA 1KVBA 4MK8A 3OYNA 4KO0B 4BDPA 2DFEA 2AGQA 4DMNA 3NGYA 4QWDA 1RT2A 1JKHA 1BIUA 2ETJA 1VSIA 1JLGA 1LWEB 4K4WA 4DS5A 2D41A 1D5AA 2WONA 2RN2A 1OS5A 4ECWA 4Z4EA 2HHSA 4B9SA 3TWHA 1HNIB 4O5BA 4ED2A 2V0NA 3KHLA 1S9EA 3D0PA 1TK5A 3QETA 2KTQA 4FJ8A 1G15A 5HRNA 3EZ5A 3H2LA 4LH5A 2W9CB 4CHOA 2HAIA 3OYKA 4FLVA 2FJXA 2FJVA 5DLGA 3SCXA 4FW1A 3KK1A 4NRTA 4W5NA 4QAGA 3A2FA 3S3OA 4FJXA 5KG6A 3LP2A 4ID5B 4GW6A 1GOCA 4ZPCA 4ZVGA 5KFAA 2NUBA 4KB7A 4O3PA 3PX6A 2BQUA 4MKBA 3LDSA
chains in the Genus database with same CATH superfamily
2D3UA 2DIVA 4BREA 5EU7A 5KGXA 2VG6B 2DR9A 1S0NA 2V8GA 2K7KA 4H4MB 2DH8A 2Q66A 2XMTA 2FVPA 3T1HK 4OLAA 2GNKA 3DJCA 3MDFA 2QYGA 1J5EF 3V6DB 3PYGA 2WCXA 2HG4A 2U1AA 3O9RA 3QGPA 1RWWB 2E4LA 4CH0S 1RA7A 3SSSA 3C19A 2X3GA 1YUWA 5HL7Q 5CR4A 1GXLA 1MG7A 1T9YA 4OI6A 4KV8B 5AJ3F 2FF6A 1LWEA 2RNEA 2VYPA 2HHUA 3K57A 2BDPA 1LEOA 3QB0A 5HRPA 4CO3A 5C10A 5ETQA 2QWOA 2DNMA 1RT4A 4XDCA 3TAEA 1TKXB 1RHQB 2RQMA 3KHYA 1F5BA 1KFSA 4FYWB 5FLXU 2MKKA 4ED0A 2UUBF 4LF6F 3QSYB 4WKRA 3C94A 5HOOA 2V68A 4AYBD 1VYAA 2GHWA 3DRPA 2XMAA 3M30B 1TQLA 2DEJA 4K2JA 3AJDA 4PQUB 2ZJQL 2ZQBA 4HDHA 3DKDA 2VG6A 3CW2C 4DR4F 1RTHA 4FW2A 3WIVA 4WFNL 2L9WA 4A4JA 1RBSA 1WAJA 3V6DA 3VEWA 1TV6B 4XH5A 3ZO7A 2RUGA 4JI0J 4FNHA 3UDEA 3W3SA 1FDNA 2DFFA 5KPRA 5LJ3Y 2BE7D 1RGIA 3TZXA 3EKUA 2CQ3A 1VK8A 3ZZTA 3MPUB 2GELA 4KV8A 1VSKA 3LPTA 4CEFA 5GAHP 4Y28C 4JI3J 1RDWX 4IDKA 2DISA 4EZ9A 2AEJA 3J7ZO 3HULA 3ET6B 1FCAA 2OHDA 4MDBA 4DR3J 1TKXA 2ZJRQ 2F8EX 2O5DA 3AHPA 5ETSA 3DLJA 4DU4A 1VSEA 4E98A 4Y2CA 4FWKA 3I9V9 1T9TA 4M8LA 4UQGA 3ZXWA 3NMRA 4ECZA 2DB1A 2HFOA 2GEMA 4RBUA 3GJRB 4ILRA 3UI3A 3R5DA 2CQ1A 2VQEJ 1VSJA 3KHGA 3D45A 2BV3A 4I7FB 3BGRB 3B78A 4FSVA 3G6ES 4YB7A 3PJXA 4U96A 2CQ0A 3I8BA 2H51B 3LO3A 3BKTA 1RCXB 3DLKB 4AXIA 1Z4UA 3GSDA 3NS7B 2AEMA 1FFWB 3DLLL 2YJFA 2CJYB 3T1AA 2CQPA 4UZCA 3VQEA 4CBXA 3C6TB 5KT3A 1TV6A 3PR4A 3M8RA 2XGQA 3TTCA 2DFHA 2C3YA 2GQ2A 3T6JA 2CPJA 3UKRB 3TSQA 2R7XA 2FLNA 4L73A 1K1QA 4OI0A 1TKTB 1Q5VA 3PFOA 1FXXA 1CC7A 3NHGA 1XNRJ 3U1NA 1RADB 5K8OA 4O0JA 3A3NB 4H4KA 4FPIA 2FQQB 3NLCA 3D2FB 2RE1A 2AJ0A 5AQJA 3IRXB 2B51A 2W40A 1ZM4A 2AV5A 4OI2A 3ICLA 4CNYA 3MCOA 4H5RA 3ET6A 4DPYA 1KHWA 2R7RA 4LFAJ 4HTUA 2IVMA 2J5AA 3W66A 1U1KA 2AJQA 1RTJB 4DV7J 1E4FT 4DV1K 3TABA 4B8AB 1RU2A 2FC8A 1FO1A 5CCMA 2ZC4A 1OSDA 2F40A 1NK0A 2K1RB 5JS2A 1VISA 4OX8A 1DBDA 3RB6A 1D3WA 4JI6K 3Q8QB 3MTJA 4LIRA 5J2MB 3BGRA 1E4GT 1KTVA 3DLGB 1C1BB 1REGX 4MTPA 4PYAA 3OA9A 3JB9k 1I94J 1XEZA 4O4GB 5IV4A 3UW1A 1IJFB 3NNAA 3CUNA 2RVJA 3VA3A 3C6TA 1NSKL 2KT5A 1Q53A 2DPJA 3AD7C 1SC6A 3FEYB 3UKRA 2R7UA 5M1FA 1TKTA 3W3DA 1SKRA 5D3GB 1WN7A 2Q43A 1AFJA 1YJUA 1CJVA 3O1BA 1U2RA 4LSNB 1FTCA 3D2FA 3CJKA 3IRXA 3G4SN 4A61A 4QR1A 2V2VA 3O1LA 4ECVA 1Y7PA 4FF3A 2VC1A 1YZ6A 2CPFA 4H5TA 2Y1IA 1HNVA 3LANA 3WEEB 1RTJA 2NYHA 4DX7A 3NNHA 4C8KA 3GYGA 3H0PA 1EX4A 2ZZMA 4EAHD 2K1RA 1UEUA 1KRPA 4WTOB 1KLMB 3QAEA 2EXUA 1Y3KA 4NXNK 2VOOA 1WSGA 1XBWA 1QE1B 3DLGA 3I0SB 3NWRA 4YR0A 1C1BA 3BSAA 5KFJA 1F60B 3CCVN 1HI8A 5IS2A 4PL8A 4ZN1A 5IT4A 1AROP 4CZFA 4IYQA 3M8PA 2XYGB 3R7BB 2FVRA 4DTMA 2IYGA 2UP1A 3HPGA 2CQHA 4BGBA 3T1YF 4FM2A 2YHAA 1KVKA 1GX6A 1XUPO 5EUHA 3RTVA 4B3TK 5FDLB 4AL6A 1KQSR 4B1VA 4LSNA 4OYXA 2B7CB 2R7OA 1RB0A 4RTFD 4GMKA 3OYAA 2G1HA 1KQFB 4ZTJA 4FS1A 2A6MA 2I0XA 1LKZA 4LF8K 5AQNA 3ZETB 2C2EA 5IQQA 5U47A 3GMGA 4OLOA 2JDJA 2KKZA 3WEEA 5T41A 4ALZA 3CCMN 3FRZA 2CUYA 3S01A 5BRDA 2B3TB 3B6PA 2NQPA 1NMNA 3CDAA 4XPCA 3M6UA 2AWZA 1QJHA 4JP8A 2KG1A 2YCHA 4XEIA 4QU6A 4CH7A 3O3HA 3PYFA 2HS3A 3SJJA 5DRKA 1QE1A 3I0SA 2IBOA 2JHEA 2MKHA 5DQIA 2Q0UA 1CBKA 1UVMA 4X4VA 3CCSS 4JKDA 1GMUA 1R6YA 2C28A 1HPZB 1B0TA 4WWSA 5F8IA 3MCAB 3IBFB 3LWMA 3CT9A 5FDLA 2ZE2B 4JI2F 1SPBP 4CGJA 1PYOB 1FJGF 2XMMA 1DFDA 1U25A 3D7EO 2DNPA 3SFUA 2WC9A 2FJDB 2V51B 4IZ9A 4N76A 1WC3A 3VQAA 2AYBA 4V19X 3TP2A 2PI4A 1FTRA 2ZITA 1KQKA 1HR0K 5M1QA 5E84A 4DV5J 2RU3A 4RW7A 1YQHA 4OI3A 3SYZA 2OPQA 4X65K 1O1WA 5EN1A 5I9EB 1E6YB 3U1LA 3LQVA 3QT7A 2W42A 1A6LA 2X51A 5LOQA 3F9MA 1VQ5N 1JCEA 1GXTA 1XWLA 4DTNA 4KGZB 4NRUA 2A5XA 4F4KA 1NDKA 3DU5A 2XI3A 1PC5A 1ZYQA 3J7AN 4OYZA 4KO0A 1HPZA 3BPSP 2RMLA 1JXVA 4IRKA 2JEJA 4B3RK 3HT3A 1VQMN 2IM2A 3CJ8A 2ASDA 5CD4H 1WEZA 1HHSA 4IRCA 1V4SA 4NXMJ 4Q8EA 3BH6B 1S77D 1JIHA 2X74A 2AZ1A 4KSEB 3MXIA 1VC5A 3P83D 1N36F 2B9EA 2RILA 1K44A 4P9SA 1KC8T 3CWJA 5EXWA 2E7WA 2AHOB 3MEGB 2CKWA 4M3YA 2HBLA 2GO8A 2JZ5A 3BSNA 3T5HA 3HHEA 1CZBA 5IT9U 1IN0A 2HRYA 3O1WA 3QEVA 3PHTA 1TFYA 4NYZA 4N5SA 3FLCO 1QVGM 3R1HA 2HF4A 4OHYA 3ENWA 4LF5K 4B3SK 2WFBA 5GADI 3NVKA 1SQEA 1Q9YA 1VQON 2W24A 2DNLA 4HH1A 1FNXH 2E2NA 3TU5A 1IWGA 2G2YA 3NG8A 4Q5VA 1BL3A 3BV8A 1OIAA 4PZVA 2MTLA 3W61A 4DUYK 3AVBA 4B9MA 3C16B 3H1QA 4B1ZA 4UOCA 2K06A 3N9UC 2Z4PA 1YAGA 5JMNA 2BKOA 5B7WA 4KQZA 4E1JA 4PYDA 3M2RB 3IFRA 2QKKA 3I82A 3UIQA 2UUBJ 4LF6J 5H1SV 2O67A 3PIOQ 1FRJA 2Z1JA 4WP8A 4KH5A 2QZ8A 5FD1A 1SS6A 4BLGA 3MEGA 3HF5A 4CIGA 1ZA2B 3BN4A 5I3UA 5HMZA 2V9WA 2ZUAA 2V8PA 2MQ8A 4ILMA 2R8JA 2W2OP 2DNQA 3EWGA 2P9NB 4X4PA 4X65F 3A13A 2HFNA 3T3FA 5KQ8A 1K73T 1K9MO 5KFEA 2QWRA 2CNOB 2OTLN 3IBCB 4KHSA 1Z1ZA 4LRDA 3JSBA 3VQQA 4Z4CA 3KUGA 3QFHA 2JFKA 3ZFVA 2Q6CA 4YS2A 2VQFJ 4Y0FA 2UV8G 3PEHA 1XIQA 4NLOA 4HYKA 3MECB 3NGRA 1VSFA 2HHTA 2O1PA 1DTTB 4OPJA 4JK9A 4BE2A 4Q44A 3MR6A 4I2PB 3HK2A 1X4FA 3C16A 3FSIA 4KHPF 2F96A 5E5NA 3Q7CA 2RQCA 4NCAA 3VQ6A 2J8SA 4P2SA 3UR0A 2IY5B 1BCMA 4PABA 1UJ5A 1WF0A 3VVTA 2LA6A 3ZSYA 4HWIA 3AQPA 1X0FA 1JLBB 3IWXA 2GGPA 4ED6A 2KXHA 3FFIA 4UTGA 2CPEA 2J7WA 1RISA 3ZT2A 3D6HB 3SSQA 5B0GA 1ZBLA 4HTIA 4TXSA 2A3JA 3ILLA 1N48A 3LOUA 3CF5L 2X7IA 3TSPA 3AA5X 4X64F 3QEXA 1BI4A 4LFBK 1KFDA 2HBYB 2E6LA 1Q7LB 2BANB 4WYLA 1JJHA 3CJRA 5DM6Q 3R9LA 2RRNA 3BZKA 5A6WA 5GADP 3MECA 2XULA 3O5BA 5E3PA 3LTOA 4AUKA 2L41A 4DFMA 2HLUA 2DR5A 3EY1A 2IM0A 3QIPB 5AQMA 2AMCB 4NLYA 5LT5A 3NAEA 3HJFA 3CMAN 3X3UA 3CCZA 4CJUA 2E2QA 1CJUB 3MF5A 2KFYA 3B54A 5F8MA 5T7LB 2MQLA 5JLHA 4KAIA 3W5XA 4QQBA 2FHOB 4ANDA 4CHNA 3QO9A 2LQ8A 3BGOP 1Q8KA 1Y5LB 3J80O 5C0YA 4I2QB 1JLFA 1BO5O 2GMHA 1HBUA 4O3RA 2ZC3A 3ZX3A 1SJ4P 2HGMA 1UFKA 2ROGA 5K14B 2VDHA 3FGVA 2BR0A 4D3GA 1R0AB 2BANA 2VWBA 4B9TA 1HNXF 2FSJA 2MKYA 3KXDA 3AXKA 1RBOB 4MDAA 1CQMA 3QBWA 4FYYB 2P9IB 5I42B 5GAEU 4PRFA 4CF8A 3V1RA 3QIPA 4CJ7A 2DRDA 4K4TA 4K4ZA 1TL7B 5B0FA 5IZHA 3VAJA 3IKMA 4FWNA 1D9FA 3THYB 1X4GA 3VAKA 1CJUA 4IH5A 1VR6A 3D2EB 3KG4A 2NRHA 5T7LA 1QQCA 1RT3A 4M5MA 3W9JA 3K8WA 1RT2B 4N56A 5DZ6A 3PKYA 2QLJB 2WONB 5B0DA 5C24B 1DLOB 4LF2A 3SCKE 1J9AA 2FHKA 3VAIA 4DOZA 5HJXA 4ZTFA 8ATCB 3O9SA 1WC0A 3OYLA 1SCJB 4ID1A 1XMOJ 2XNQA 2MSSA 3H4BA 4DZDA 3RGIA 2XHWA 5K14A 3ZEUA 4WXWA 1T8EA 2LVWA 3MCMA 1PAEX 4P74A 1R0AA 3OLAA 5KFNA 3TAMB 3H3OB 4YEAA 1Y11A 2AGOA 1X4DA 2IM3A 3QIDA 2BKPA 1XN9A 2K8GA 4OJHA 2CADA 3T1YJ 2P9IA 1RAOA 3NY0A 1ZAXA 2ZVIA 1J53A 3US5A 4QYZJ 5AQXA 3O2IA 1FKOA 1SH0A 2C3MA 1VQ4S 3OYCA 3AO3A 4CLSA 4GVBB 3A8IA 1YJVA 3ZSZA 3MMCB 4M5KA 1N34K 1ROFA 4ZVEA 3THYA 4LFCK 3A5OC 1N33F 3ZX2A 3ALYA 3D2EA 4CJLA 4J5OA 2CNLB 4J9LA 4R79A 4MYTA 1UZHA 3NF8A 4FYDA 4KH6A 3WQUA 2Z8QA 1BLUA 4QIGA 3HTVA 3QERA 5C24A 1VJWA 1DLOA 4UOGA 4KTQA 3AOAA 4K5RA 1BU6O 3TAQA 1GMVA 4G65A 2CJKA 2XS7A 3NH0A 1A5VA 4ZP8A 1K73O 4UF4A 5DK5A 4ECYA 1YRXA 1YVFA 4JKGB 1V5IB 4YY3J 2Z2YB 3GV7B 1GTHA 1U1LA 3TAMA 3PRVA 4XH4A 3ZLJA 3R5BA 2V8DA 2PI5A 4EYHB 1MMNA 3CC7N 3IGNA 3A0IX 4YORA 4B9UA 4EBDA 4TN2A 1V3RA 2NUHA 5KFVA 2CAJA 3D1QA 2HHHF 2R7QA 5KG5A 4JI2J 4NPOA 1X4BA 4BC4A 2XYPB 3GYXB 3MMCA 1FJGJ 3EYZA 1OJ4A 5AT1B 4E8UA 4B9NA 3GG0A 1NKEA 3O3FA 5KT4A 3AD9C 3FZBA 2YNGB 3HHDA 5C7PA 3CCUN 4CGHA 1T3VA 4YDDB 1K8AT 2WBNA 2LU2A 5KFTA 2V4RA 4EO6A 2VG7B 3VWSA 4EO8A 3BPDA 2FGCA 2FC0A 3GTYX 5DLFA 3VGMA 5AQLA 4GVLA 3L2UA 1S0OA 1IBLF 3J7YI 3ULEB 2ZM6F 2DRAA 2QE5A 2OKQA 2XSJB 4JV5F 4LY7A 3D6TB 2XHBA 3QINA 1NKCA 3TZWA 2ASJA 3QT5A 3MI7X 4JKGA 3QJPA 3TJAA 1RKIA 3I56S 5C2FA 3CE8A 1WELA 4Q43A 4F67A 2ZBPA 3MXJA 1JJCB 3B6OA 5JLFA 3MTKA 4ECUA 5HK4A 3G8TA 2P5GA 5KRSA 3M6XA 1T9XA 2P9KA 2VD3A 2DD8S 3C6UB 2BA9A 4OX9J 3GIRA 3KG1A 3EGVA 3O3LA 1BISA 4LR9A 1NJYA 1CLFA 1U0HA 2XY8A 1N56A 3OTCA 4OZLA 4CHPA 4DF4A 1N34F 3L4BC 4A48A 3AVHA 1N36J 2A2DA 3DOLB 1QHAA 2RS8A 2XM3A 5KFKA 5CH7B 3MK6A 1S1TB 1SBRA 1QY7A 4I6YA 3PW5A 2QL5B 4U9RA 1U1NA 5IT9Y 2HZAA 2BJDA 5ADZA 2MY7A 1XNQF 2L48A 2VG7A 9ATCB 4CO5A 2YQ1A 4M5JA 2WVEA 1CXQA 2QA2A 1BQNB 3FEZA 2XSJA 2AJFE 5CYQB 3KHRA 3AVNA 5CE3A 3DLHA 3M4XA 1Q86T 1N5SA 1SB6A 2GAHC 4FJ7A 3C66A 1Q7YT 3NOCA 5F8HA 2KT3A 3TEHB 3RMBA 4Y2KA 4CLPA 4I68A 1BDGA 3WX8A 4DX8H 2E1MC 3H5XA 2WOMB 3KZBA 1I51B 2QSWA 3U3YA 4ICLB 3NFAA 4LBHA 3VF0B 2MQQA 1FF2A 1ITPA 2M52A 3F44A 3NGUA 3B8AX 3SUPA 4JS4A 2ILYA 3KLFB 4LRFA 4MIBA 1RWUA 3CDUA 1M1KT 3TUJC 1X9SA 1HYVA 3F41A 3D2WA 2OZSA 1EX8A 2G8WA 3VGKA 2DHSA 4KT0C 5LMNF 2EX3A 3DOLA 1BWVA 4DV6K 2QWPA 3KWIA 3I55N 1S1TA 1TYQB 4HACB 5K5MA 4B8CA 4KHNA 1HA1A 1NU0A 4ZCLA 4Z94A 1RNHA 1HQEB 2OEKA 4KRWA 1NGCA 1VQLS 1ZA1B 4KYZA 1RAAB 2DNKA 4OI4A 4GC7A 1BQNA 1R0CB 1UCNA 2JJ4D 2D3ZA 3O5TB 5F9NA 1PYTA 1FK9A 2KB2A 4DSLA 1RHUB 2MJNA 3OYMA 3J7YP 4URQU 4MYUA 4IEIA 3K5NA 3OSPA 3Q22A 1QDUB 4FJ9A 1Q9XA 5KOWA 2HFVA 2PFDA 4E0DA 2D0CA 2UXCJ 3VTHA 1KBRA 4A47A 3LW5C 1PO6A 4JI7F 2WOMA 4ICLA 2ZUGA 2NRZA 3IG1B 4GO7X 3OBWA 4M94A 3KLFA 4KHPJ 5HLFB 1YX2A 3V81B 1EETB 2CNKB 3HHLC 1RAEB 4KH0B 3ID8A 2PMWA 4DPUA 5AE1A 4CLYA 3PYEA 4F4XA 1TL1A 5JMVA 4LH4A 4LVNP 4FJNA 4ZVTB 1MA9B 1C4CA 2G2ZA 1TYQA 1H98A 4HACA 2JOQA 5H9FJ 4FWSA 2MKJA 1S72N 4CJRA 4WKYA 1P1TA 5KT7A 3G9CA 2DXEA 2B6AA 5C5JA 5EDWA 3GBTA 4OVLA 4LT6A 3M8YA 3W1YC 3HMJG 1BXNA 5CZVA 1NK9A 1FFSB 3OT9A 4BC9A 1VCTA 2E5HA 4DV3J 3O9TA 1PAUB 2PIIA 1NGIA 4ILGB 4MLEA 5SZTA 4X64J 3AA3A 2ASYA 3GIIA 4JNEA 5IFMA 3BF1A 3MX2A 5B0EA 5KFDA 4ZJOA 1ZETA 1VRTB 5M2PA 1RWOB 1WKLA 1AA1B 3V1QA 4C0BA 2E1ZA 4GV3A 4Y6IA 4RNMA 3W7BA 4GKKJ 1TL3B 2XHCA 4G3IA 2RAQA 4KC5A 4C11A 4C9DA 1JXEA 1O5JA 1KWMA 3WXKA 2D9PA 3TI0A 3M1VA 2RD5C 1ASWA 1MROA 4H0OA 5G0RB 4A8XA 2V67A 4CQ1A 3AO4A 4M5NA 3IG1A 3U7JA 3SFGA 5DG9A 1GOBA 4UQTA 1YBUA 2EWHA 2YJEA 1WEYA 3Q8RB 4QR0A 5HLFA 2P6TA 3HPOA 1ZM2A 4WQ4C 2O8EA 1WSIA 1T05B 5ETOA 4CF0A 4HCCA 4IG0B 1KTQA 3DDIA 4JRPA 2ZHBA 1KAYA 3OL9A 2HHWA 2DGOA 3QJJA 2M8DB 3VA0A 2A3ZA 4DV6F 4JN4A 4CO1A 2DH9A 2HBJA 2D0OA 3NS6A 2VPYB 4XDDA 3HVWA 2FBXA 1T9VA 2VH7A 3FQLA 3QNWB 2JEGA 1H73A 4JI8K 3OFGA 4CBUA 3HVRA 4NA2A 2FLLA 2PDAA 1L3UA 2R9LA 3GU0A 1HYSB 3VZHA 2XYHB 1XR7A 3BBFA 2Y8WA 3BO2A 4E7JA 2U2FA 3IN5A 3KK1B 4FXDA 1G2EA 1OVQA 1X5OA 1VRTA 1KN6A 2IA6A 1HNXJ 1CZAN 4ISGA 4KY3A 4A8YA 5LMUK 1WG1A 2WB1D 1TL3A 1FI4A 2ZF5O 3TTDA 4JI4K 1ULRA 3OFFA 1XK8A 5G0RA 3W2VA 1VSHA 1PGZA 3MCPA 3U8XA 2NXNA 3CCQS 2ZH8A 2PY5A 2F7TA 4FWOA 1F5AA 9RUBA 4PXCA 1FXLA 3OHRA 4O3NA 5F3TA 5EY4A 3LAKA 1T05A 4BRPA 3R9PA 1TP7A 2XSFA 4ENOA 4MK8A 5DO2A 4PKIA 5EGYA 3VV2B 4OYIA 1S22A 3AY9A 2HK2A 5B0BA 1BIUA 2ETJA 2QRRA 1T0TV 2D41A 4ZVSB 1OH5A 2RN2A 2HHSA 3MM8B 4B9SA 4CZLA 3SDEB 1HNIB 1XJWB 1S5ZA 2V0NA 1JMTA 3WQPA 3QDKA 3OYKA 1WUAA 2FJVA 3OR2B 5AE2A 3KK1A 3P4UB 2C2ZB 4NRTA 4W5NA 4X4NA 4X62K 4QAGA 3A2FA 5KG6A 2PSZA 4XTTA 5E33A 4ISEA 3WDOA 1YHQN 3N4PA 4KB7A 2GV1A 2BJ3A 1JXLA 4A5BA 2VFSA 3C15B 3K0SA 4DCHA 2BABA 1R8PA 2D3O1 4WQ5A 4CT9A 4UT4A 3HLUA 4DSKA 2A6AA 2QTWA 1DTQB 2QXLA 2V5HG 4CJFA 2OPPA 5EWFA 1SZ2A 1N33J 3MXMA 2MEWA 4B08A 2PFFB 3TTFA 4Z37A 1C0GA 1BOTO 4DUZK 3QT6A 3GIJA 3MCSA 3CDEA 2MJUA 3TRGA 4GV6A 4LF4K 1R8BA 3VESA 3L3UA 4BACA 1NGAA 3DI6B 2G8UA 3T41A 3CVKA 3QEPA 2OTJS 2VASA 3MM8A 4BG8A 3SDEA 1HNIA 4QS7A 3CCTA 4CLUA 4ZJQA 4KTZA 5JVHQ 5I4MA 4QCLA 3PY8A 4USJC 3THXB 3HO1A 3OR2A 3V9SA 4NLGA 4CGGA 1VQNN 3H42A 3DLRA 1YBAA 3WXIA 1UKUA 4ZCKA 5LMUF 3FUYA 2UVWA 1XR5A 6FDRA 4JOUA 3LA0A 3FBBA 4PXBA 3CD5A 4JI4F 1DZ5A 3C15A 2VBWA 4X4OA 1HW9A 3U1MA 3GR0A 2APOA 2C1EB 5AZIB 2HHHJ 2GQCA 3BDPA 1LCUA 4OZ0A 4CJPA 3P6YC 3R7SB 4ZVRB 4QU7A 4CO4A 3DXMA 1DTQA 4IFVB 5C42A 4TYAA 5J2NB 2CQBA 3CCWA 4ZVQB 1WC5A 1MN9A 2WW4A 5GIOA 2DH7A 3SAHA 2XS5A 3JQMA 1OMSA 1RBTA 4F4WA 3VQ4A 3ATVA 1IBLJ 2ZM6J 2QA4N 2E6MA 3BGFA 2GJ2A 4DU3A 4JV5J 4H0TB 4WE1B 1D8YA 4GNIA 3L0QA 2EEYA 4KGXB 1CEZA 1VHFA 3UN2A 2QA4G 4JEPA 1RTIA 3RW7A 5C12A 3THXA 1IBMK 4ER8A 3CMEN 3G71N 3VHQA 3LUYA 4BE0A 3JTOA 4DR7F 4QIEA 4RBVA 5MLCQ 2P9UB 4C3MA 1PILA 3S7RA 3VQTA 4BRQA 4DR1K 1L3TA 1MLAA 1VGYA 4B1UB 1RWMB 1Y5NB 4AFFA 2MYFA 4MKYA 5AZIA 1KD1T 4CEQA 1X60A 3A3PB 2F65A 3AA9A 3SUNA 2BYCA 1M90T 3CJBA 5J2NA 1JJ4A 4UOHA 3TPQA 1M1HA 1HFEL 4AHRA 2ZBIA 4BWMA 3D6MB 3TX0A 2Z2LA 3OVAA 4DUZF 3G10A 2X6SA 3UKUB 5AQHA 2EI5A 4OZNA 4YOYA 5K8NA 2LYVA 3SSRA 3AFGA 4RU9A 2DCUB 1XNQJ 4CD1A 2MPUA 5F1XA 1NGJA 2V94A 1ATNA 3HI0A 2YWWA 1F1BB 2ATLA 2QFIA 5M2UA 4IKFA 3B6BA 4UY8O 2WAQD 1BIZA 2NNWA 4WE1A 2W7OA 4PKGA 1XHZA 2RKIA 2GVDB 5KI6A 3MD1A 4NX9A 1BWFO 2ZZTA 5D4OA 3KLEB 2Z30B 2BQ3A 3WQTA 3LGMA 2PT0A 4OYBA 1B9DA 3TUZC 4W98A 3QGGA 3SV4A 3CQYA 3POTA 2OZMA 3MMBB 3UCUP 1BQMB 3AO1A 2MQOA 2QWMA 1SKSA 1MWQA 1N6QB 2R8KA 4E1NA 3PEJA 4J9MA 4J2EA 1RAHB 3BH7B 2KN4A 2MHNA 1NEEA 4M63C 4LF9K 5E3QA 2PC6A 1R8AA 4AILC 2CG4A 4FLYA 1DQ8A 3BBBA 3NH1A 1N5VA 7FD1A 4F9OA 4HHTA 3ETOA 3CIZA 4CFBA 2VUGA 3DGPB 3GPAA 4IOBA 5M1KA 5ETTA 1S6QA 2UVRA 1RAGB 5LMNJ 3ISNC 2EFQA 3DOKB 5DDPC 2MKCA 4K4UA 2R2TA 2G0JA 3MAAB 3TX8A 3ZT0A 5J1NA 3GJQB 1RABB 4J9PA 2CZ9A 5D4LA 3U9ZA 3I5AA 4F25A 4M5DB 3KMSA 2CA9A 1U09A 1U2FA 1BMQB 1RWVB 2A40A 4PQAA 1KCFA 4CI6A 2QT7A 4OGEA 5HP1A 3OXGA 3SQ0A 2NXEA 2ZNYA 3VQSA 3TA0A 5JS1A 2GVDA 3FVYA 2SXLA 2FZGB 4FLXA 3KLEA 4L72B 2BEFA 5KT6A 1YJNS 1ZOTA 3BS9A 2KJVA 4JI7J 3AA2A 4LF7K 3CJAA 3CCJN 2E5GA 4ZMMA 1KR4A 4CJSA 5HJYA 4RUAA 2EHGA 1LW0B 4FZZA 3OLBA 2P9LA 1H0HB 1VHIA 2O66A 2E29A 1VI7A 1BWEA 4RUHA 2RDJA 3GFHA 3O6WA 2D4WA 2RRBA 4AHSA 4XH1A 1EB0A 2HWIA 4PPDA 4R25A 1W7WA 3AAPA 2NRVA 4KE5A 3FBEA 2NXJA 1WLJA 2AJ1A 2FJBB 3R3LA 4Q8FA 3DOKA 2OI2A 2MKIA 5KFSA 3MAAA 1A5XA 1J54A 3WC0A 1F9FA 4LRBA 5D0RA 4ZITA 1VC6A 4M5DA 5CY4A 4RWXA 2F4VF 4UZBA 3CJ1A 4WJBA 4DL6A 2DBBA 2HWHA 4C3LA 1VQ9N 4TSXA 1V4TA 2FHJA 3CO9A 2E7VA 3HXMA 3NGIA 1RT7B 1HWLA 2W9BB 4JI3K 1F3VA 5JICA 1BE4A 5JJBA 2EG2A 3VALA 4MK9A 2YVSA 4F26A 2J9DA 2F1FA 2AD9A 1LW0A 3TUIC 1Y4ZB 2GIRA 2UUAJ 3WBZA 2EWSA 4DR3K 1ZBIA 5F9LA 4LF9F 5E3AA 4UY85 3FSYA 3IMXA 5EX0A 3Q8PB 2G8FA 3ISZA 4C8MA 3LM9A 1L3SA 4DR6F 4H0VB 4HL9A 1T9UA 3PSFA 1CJTB 1UL3A 1RHKB 2IVNA 1WUUA 4BC5A 4PUOB 1R89A 7FDRA 4QOZB 4NMXA 2HBRB 4I6AA 4TYBA 1SC3B 3T9ZA 2VQEK 3R3TA 4M3RA 1MNEA 5J2QB 2JVRA 5KFHA 3ENVA 4QS8A 2W2QP 5FROA 2XLJA 1WOOA 1X8DA 2V34A 2V4JB 2VBYA 3PYDA 5KFFA 3FZHA 2IAJB 3TVZA 1EWQA 1BHNA 4L74A 1PKUA 1RYSA 5KPTA 3C8YA 3MPYA 1EZZB 3OL6A 1X1PA 1CLQA 4F2RA 2C2OB 3VN5A 1FKAF 1P27B 3QIOA 3H20A 1RT7A 1XNRK 4ZA1A 1JNZB 2BM1A 3H6EA 1SUQB 2RH3A 2W9BA 2XLKA 1GLCG 3BF4A 1HL6A 3GLJA 4GVMA 2DGVA 4O23A 3AGKA 4I69A 4RW6B 3P1GA 3LGNA 3QESA 3TYTA 2E44A 2NYIA 4CGDA 4LFAK 4LBPA 3UR3C 2QTDA 4IJAA 1RLCL 2NCKL 3UN5A 4FM1A 3TZYA 1G4CA 4DV7K 1FD2A 2V52B 3R8EA 1WF1A 3BREA 1RKJA 3S8SA 4NYNA 4JKBA 2F8TA 1CJTA 4CK2A 4CJ3A 2AGPA 5GIPA 2BBEA 2BOAA 4NZ6A 4PKDB 2OLWA 4XAKA 2ZHOA 3TOQA 4M7XA 4FCYA 5C25B 3OW2R 3D0IE 2G4BA 3O80A 3OTOK 5J2QA 1OO0B 3VQDA 4DBQA 2W8LA 1LXNA 2XWYA 4CE9A 4NLWA 3FK4A 3P8BB 3JYTB 2V4JA 4H8KA 2HBZB 1I94K 2O8FB 2IAJA 3RYLA 3SMSA 2W2PP 3OYGA 4X4UA 1UW9A 2MZQA 4O44B 1R3NA 2D1KA 1IBKF 4HHUA 2AZ3A 4JI0F 2VGMA 4E2FB 1VBXA 2W9CA 4PA1A 3M3ZA 3L09A 1UTAA 1SUQA 3CG7A 4FJLA 4U8YA 4FK4A 4JI3F 4ID5A 3IAS9 5AQTA 4NB4A 2UVVA 1SQFA 2K2PA 4XO0A 3H5YA 4HUGA 2IMWP 1ZAVA 1IQZA 1M5VC 3SBMA 3OFEA 2F8MA 2DNNA 2Q3SA 3BUZB 4U6PA 4FWPA 2VBXA 4MO4A 3AAWB 1YGYA 4ZPVR 4PG6A 1VQ6N 4OQJA 3D4JA 3MR7A 2LQBA 5J2PA 3G96A 2QYCA 4IBNA 1VDHA 4BRKA 4AHCA 5C25A 4RWTA 2MXYA 3ITHB 4ZCIA 3L2RA 3KJNB 4ZP6A 3KLGB 3KMQA 4FF2A 1LW2B 2N3OA 5BN9A 4YMEA 1TK0A 4BRNA 5KFBA 2XBPA 1CZ9A 1RCOB 5HMXA 1B92A 3P39A 4BRMA 2BE2B 4IRDA 3GYNA 1IV0A 4O44A 2R8GA 4K41A 4GVEA 4NLPA 1URRA 3AVMA 3Q7BA 2XO7A 2YH0A 1C0UA 4CGIA 3CSKA 2FVCA 2ASLA 5JVGL 4KGVB 1VQ7N 2Y3YA 1U1RA 1P8ZA 1GT8A 2DVIA 3OYEA 3ZSXA 4L76A 3R5CA 3QZ7A 1ACMB 3TAPA 2MZTA 3AXMA 2AT1B 2OD6A 1JLAB 3C65A 2DHHA 2O8DB 1RT6A 3V9ZA 2E1RA 1H6KX 4DV7F 4O0IA 1RDCA 3H1VX 3N0VA 4NLBA 2CQIA 3IO1A 1IR2A 1Q8BA 3PDNA 1RUSA 4AT1B 5HRRA 3OW2M 4BVPA 3AAQA 4IOAL 3ITHA 4QOTA 2IDLA 3KLGA 4FLZA 1LQ9A 2I5JA 1S99A 2VWKA 1U6ZA 1LW2A 4WCEQ 5KPZA 3G0ZA 2A2CA 5B09A 4CEEA 1SL2A 2BE2A 1Q0NA 3VVUA 3SJHA 5F8LA 2G13A 3BGUA 2ZWPA 2FSNA 1BCOA 2YI1A 5BREA 1Q16B 5HSPA 4X84A 4MKVA 4DR7J 4IG3A 4N77A 2X78A 2E66A 5DETA 2GMJA 3ZTSA 3FE1A 2P51A 3JQJA 2DNRA 1X0PA 3GCWP 1JJ2R 3RB4A 2R7TA 3EGWB 1JLAA 2HYIB 3RAXA 2Q0RA 2VB6A 2O8DA 2XRIA 3ZZOA 1PJ5A 2XY5A 5KG1A 2JC0A 5ETKA 4R0JA 3NOGA 2M5YA 4DV5K 4J9UE 2E20A 2HVEA 4QPXA 3T9NA 3BQ0A 3HI9A 1GLAG 3RZAA 2V2KA 4NEYA 4AQYF 1YZ7A 1VBKA 2XS2A 3DXBA 4BC3A 4A5AA 2ZWOA 3G4SS 1FRLA 1ZTWA 1RT1A 4DX6A 1NJZA 2M70A 3NGDA 4JKAA 4JD2B 1RBRA 4BRDA 4P7VA 3BDEA 4P2FA 1YVNA 3BZCA 2B9WA 3CGIA 1EXQA 1HLUA 2EFNA 4CFAA 1YJ9N 2G8KA 2KL8A 1VBZA 1EQ0A 4WFYA 1MWZA 2FF3B 3V1OA 2OCEA 3S41A 1U45A 3DNCA 4B3SJ 4Y34A 3RW6A 5B8HA 4FZXC 1TKZB 4YDUC 5HBMB 1H7WA 2QLWA 1X5TA 2H48B 4YOEA 1AW0A 4NXMK 3LWLA 2HIQA 5HL7L 2P6SA 2HVHA 3CCVS 3IMQJ 2BJ9A 2ZDOA 1N8RO 4OJ3A 3SUOA 4A62A 2HPUA 1QM9A 4TNOA 4NCGB 3A5MC 4CZCA 3WXLA 2LKZA 4I9QA 3TWZA 2RDDA 3JSRA 4FXWA 3FNNA 5F8NA 3QYYA 5L1JA 4CI0B 5LY3A 5I3QA 2KO1A 5LL6d 1NJIT 3JS9A 2CQGA 1NWKA 3CQ8A 4I6WA 1F0XA 3AVKA 2W7AA 3ZZZA 1OH7A 4DL5A 5D0HA 2QWQA 1GMWA 3GQCA 5AQZA 2K3KA 4C8NA 4JD2A 1Q8LA 1OH6A 1WDTA 3CCMS 5GINA 4CO2A 2WVCA 1RP5A 4X4TA 2E2PA 1S7IA 2D5RA 3FZMA 4FLUA 4PY5A 2CGJA 5D0EA 1P9YA 3AA4A 4OV1A 3QPIA 1OYDA 1NSPA 1TKZA 1VIXA 1WAFA 5HBMA 4E19A 4Y65A 4KB0A 2KHDA 3O08A 2R3VA 4Y3CA 1EP4B 4NI2A 2VFVA 2O8BA 1CQNA 2ASPA 3PV8A 4I67A 2UUBK 2CJAA 5HVGA 1RILA 4LF6K 2NLWA 4YQWA 3VGLA 3JXUA 1SJQA 1NZAA 2HNYB 5KG2A 4OZ1A 3WT0A 3IM9A 4WFAL 2QL9B 3J8AA 3MZIA 2VKZG 1U8WA 2XTJP 4OJRA 4NCGA 5FPEA 2H1YA 1TL4A 2E5IA 3EKSA 1NMDA 4YR2A 2W4DA 3GWCA 2YWGA 4USIA 1SH2A 3TAGA 3TAFA 3CHWA 2ZJRL 1XI1A 5BR8F 3NBPA 2GQQA 2MZRA 4DHVA 3SCIE 1SJ1A 4DFPA 4ZHRA 4HHJA 3WXJA 2F4VJ 1Q81O 3AH6A 1A5WA 2EG1A 1RU1A 1EO1A 2HNDB 3ZTOA 2YBVA 2R2RA 2WVFA 2MLZA 5KFWA 2B9YA 1AZSA 4M3XA 1N88A 4EI2A 3DXKA 1NDLA 4OX7A 1S1VA 2IJFA 1Z2LA 2L9DA 4USUA 1W2IA 4JS5A 3VENA 3UB5A 5IXUA 1G1XA 2CZVC 3NF6A 1YJWN 4PWWA 4S0MA 3DCAA 1RT4B 1CJKB 2J6TA 1EP4A 3AD8C 1VQ5S 4GC6A 4CZKA 1GTEA 4DR6J 2V4QA 2HNYA 2Z1IA 1SAZA 3DRPB 4FVMA 5T7BA 2Z58B 1HMVB 2UUCF 2VZ9A 4WYWA 1I3OB 1VQ8N 4WP3A 3JXOA 4WYBA 3TEGA 4KHMA 4O0NA 4DTUA 3FCVA 3R5AA 1RTHB 4P71A 1U2VA 2XGPA 3WNEA 1VQMS 5HAOA 3VGTA 4X66J 4YB1P 4WU3A 2ZBRA 1EHWA 3ZC4A 1T95A 5KFGA 2HNDA 2HURA 1YI2N 1H3DA 8AT1B 3C6AA 1R7IA 2EC2A 2L3MA 4F8RA 1NK4A 3HHLD 5D0GA 2D7SA 2CNNB 1X9MA 2KHOA 5F8GA 2RU9A 4IO9Q 3OTEA 4CYUA 4ZLJA 1S6UA 3VF2A 4IR1A 2FY8A 4IDKB 2YX7A 3AVLA 4FJIA 4F4AA 1U04A 2CZ4A 2NZTA 1CJKA 2J0XA 1XHXA 2C2DA 1S97A 4ZDNA 3HFVA 1QS4A 1V3ZA 3LPUA 3MPVA 1O0PA 3N6NA 4C23A 1VQOS 2RUSA 2C2RA 1BGXT 1YK9A 1YJTA 1NBEB 2AX1A 5ETNA 2HHQA 3TVKA 2WBMA 5IOLA 4MAKA 4KHQA 2IRXA 4TQSA 1HMVA 5DJBA 1E6VB 3EVOA 4ANCA 5FPMA 3GILA 3LF0A 3MM5B 3N01A 4A8OA 4RZRA 4ZOSA 2GVZB 2KI2A 3C14B 4RWWA 3D28A 5L8RC 1S1XA 3PRDA 3MM9A 2FUG9 1VQPN 2VQFF 1S7HA 4IEEA 4O3OA 5L39A 1IBKJ 3OS0A 4NYPA 1ZXOA 4AE5A 3KKFA 4OFZA 2CWKA 3H98A 1SKUB 3R2CJ 3IGVA 1X9WA 3C95A 4BR7A 3V6HA 1APSA 2VOPA 2N3LA 2RQ4A 4U8VA 4OHWA 3U9DA 2M0GB 3HZ6A 1V5VA 2I2YA 3Q8SB 3C46A 1IM4A 3ZT4A 2ZH2A 2OTLS 4LR7A 2H9ZA 4F3MA 1M0SA 4F4ZA 4HTLA 1PJ6A 3KIOA 4F0HA 2NRTA 1UPPA 2R7SA 4U67Q 1U1OA 2BKNA 4EZ6A 4F7VA 3LDQA 1K8KA 1FRXA 4ES3A 2FLPA 5LJ5Y 2Q36A 3UVJB 4FOEA 4OPAA 4JYAJ 4FYXB 4MQ3A 3D54A 4Y2AA 1Q82O 1XMOK 4DCJB 1E6VA 3ZZUA 4A8MP 3MM5A 4IH7A 4CLKA 1NJIO 4GO5X 2JC1A 1B0VA 2GVZA 5KAKA 2HQ3A 1RT5B 3C14A 4CERA 2EKYA 5DDQC 4JRQA 5CYJA 4ZJLA 4FWRA 2XZDB 4BDYA 1VSDA 5JUMA 1UP1A 3T5JA 1RBVA 3LPEA 4DTSA 4U7CA 1K6YA 3Q23A 3F2KA 3T1YK 2OYQA 4J8FA 5KQDA 4QYZK 3VGSA 2OPSA 3HOSA 1J27A 2EBEA 1CJVB 3GE9A 5CYMB 2OP5A 3CJKB 2QXFA 2UXDF 4O8KA 2ROPA 1IUJA 2IRUA 2G1DA 2DGTA 1KONA 1S1UB 1VK3A 4JHDB 2DIUA 1QUPA 4Y00A 2DY4A 1HNVB 4C48A 1SI9A 2NSBA 2YX4A 4QS9A 1U7LA 3L9ZA 4YR3A 4OHXA 5EVZA 3QEWA 3KD1E 1SL1A 4C3KA 1TKDA 4W5RA 4I0WA 1GAOA 2ZKTA 1KDNA 1NXIA 1S5JA 2F9DA 4M7YA 2BX6A 3QRQA 4HUFA 4HHHA 3GG4A 3AA8A 3UVJA 3SI8A 3AQOA 3UCZP 2DNHA 2MZ1A 1NPKA 3HSDA 4X4SA 1ITGA 5KFYA 3GR1A 2F8HA 2RQKA 2DGXA 3QSIA 1WG5A 3TNVA 3MOZA 1IR0A 4I1TA 3CMAS 2XY6A 2R2UA 1S3XA 3DYAA 2HBQB 4QPTA 4RUBA 1RT5A 3K17A 3MUVP 2Z2ZA 3N79A 1WSVA 1U48A 1FVSA 3R5JB 1YLXA 1WBDA 2BGGA 3M8PB 4PXDA 2BUPA 1RTDA 1HWJA 2C2NA 3E1YA 4AM6A 3RVCA 1TMJA 3EL2A 1UETA 2DNYA 4BCAA 2JVOA 2Z57B 4CLWA 4JI2K 4U7BA 1T02A 5CYMA 1UMJA 3SLCA 2ZH4A 1UJ6A 3BO3A 1ICEB 2OAUA 1FJGK 3NEKA 4DCPB 1S1UA 1U24A 4JHDA 2AJ2A 4IXCA 3CJ0A 4BRCA 3ENHA 4NASA 4H0PA 4RL1A 2Q31A 4ZS6A 2CQDA 3MDQA 4KGKA 4FWMA 3PM9A 4W92B 3VAFA 3DHXA 4M42A 4FLTA 2QWNA 5AR0A 1VBYA 3QFWA 3UCGA 4ZPDA 1Y10A 6FD1A 2UU9J 2GX8A 4AQYJ 4B17A 4C8YA 3J7Z5 4OLPA 4OYOA 4BR9A 1LWFB 1XMOF 3UD4P 2JLFA 1TAQA 3CJ5A 2FB0A 2KJWA 3A12A 2W8KA 1S10A 4RNOA 5CZ1A 1VSLA 1WC4A 1RDRA 3PO5A 3S3NA 1UOCA 2MB0B 2KZMA 1ZZFA 3CCEN 4W90B 1S9GB 2V2QA 2ZEJA 3CQXA 5BYRA 4CJVA 3HRGA 3QRPA 5C2CA 2LSNA 2RE2A 1DURA 4BWJA 2ZH1A 4ECSA 5IT0A 3G8SA 1Z26A 4OX9K 5EWEA 3LGHA 1JLGB 3C2PA 4BQZA 2Z0GA 1MDUB 5CHIA 4DS4A 3CYMA 2UUWA 2I38A 3HD1A 1N36K 2IOCA 1UFWA 3HHNB 3KTQA 2OEMA 1NCLA 1RI7A 2VA3A 4FJ5A 3ZTRA 2V8VA 2C3OA 3IA0A 2Y8YA 2UYTA 4QW8A 1S57A 1W25A 4JI1F 2J9EA 5BR9A 1YIJN 4RW7B 4M5LA 4U7UK 3QJLA 3HHKA 2OPQB 3CCRN 2PZSA 1LOTB 1KVCA 2PGCA 4ZPTR 3BEGB 4FKYA 3PW0A 2HK3A 1TK8A 1ZPVA 1LWFA 5GAHU 1QVGR 4HCBA 2NXCA 3P96A 2D69A 1ZBUA 1WSEA 2FGOA 2PA3A 2HSTA 4MLHA 4J37A 3CC4N 1SIZA 4YY3F 4CK1A 3MOJB 2YX1A 4TLQA 3THWB 1S9GA 1X4HA 2DKOB 3P31A 2HVDA 1Y97A 2I6WA 1BA1A 4MJKA 2FIUA 1I6JA 1TVRA 1EKRA 3S1TA 3OYNA 4KO0B 5C2GA 3OD2A 2DFEA 2AGQA 4DMNA 3GCXP 4OYMA 3NGYA 2RHKA 3A1YG 2KLAA 2ASMA 3W60A 1JKHA 1VSIA 1JLGA 2EW9A 2GW8A 4K4WA 2M9KA 5AE3A 2ZWHA 4ECWA 3TWHA 2CDQA 4O5BA 4ED2A 2E5LJ 4ERDA 1S9EA 3Q86A 3QETA 4YOXA 2KTQA 1TUVA 2MHEA 3M2VA 1SJRA 2QC3A 3TW0A 1DT9A 3WXMB 3H2LA 4CHOA 1CPZA 2HAIA 4N7TA 1KQGB 5DLGA 1F9HA 4QIWD 2YQ0A 4FJXA 3GFXA 2EFPA 5BYSA 2Z2MA 3CC7S 1GOCA 2VHGA 4ZPCA 2QG9B 4MKBA 3SQOP 1XMQF 4JK7A 3AVJA 5BR8J 3CJSA 5IWAF 4U7UD 4KHYA 2D3OR 2HMIB 2NPFA 4WFBQ 3E9PA 1LFWA 3OYIA 1PBAA 5AFUH 4BY9C 4DL0C 5BPNA 3PSIA 1WSHA 1H2VZ 1W9HA 1FRMA 2A6OA 3HHLB 3MM7B 1WOPA 4YUDA 4C8LA 1NGGA 3EUNA 2VJVA 1UAWA 3THWA 4TY9A 1IKXA 3KVGA 1EKEA 3CCUS 3M1FA 3V4IB 3GP9A 4FK2A 3VEOA 5SWMA 3UDLA 2X1AA 3ISND 3N28A 4CLTA 3BKUA 4OX9F 2YKMA 4KHPK 2ACMA 4LQ3A 5DM6L 2W1BA 3MEDA 3H08A 3BP8A 3D6RA 4C7QA 1XERA 3Q0AA 3N4QA 1GLDG 4CF9A 2E1AA 3TA1A 2V50A 3CPWR 5KFIA 2CGKA 3PJ9A 1HBNB 3OYFA 2R7YA 1MWKA 3BZQA 2KRRA 4AL5A 4CJWA 5H9FK 1HWKA 4NWBA 2DXFA 1RDDA 5CA5A 3IP0A 5I3UB 5BXIA 2UUCJ 3J81Y 4AHVA 5B0AA 1ZBHA 4DHYA 4A8FA 2GMLA 4OKEA 3EPGA 4DV3K 4X64K 4I6MB 2HMIA 3K59A 3EXCX 3PX0A 3RJMB 2B4UA 1BUXA 2AKWB 3PIPL 4KI6A 4WTYA 2QV6A 2H5IB 3HHLA 3MM7A 1KXPA 3DLBA 1UW4A 4OPKA 1DRZA 4JI8J 2J6SA 3V4IA 4K0KJ 5DG7A 3HKWA 4LJMA 2D74B 4B3OA 3LP0B 3MWBA 4JV0A 3SXLA 2YKAA 3S9HA 4USWA 3RSEB 2BJEA 3MMAA 2DXDA 4LVOP 4FF1A 1IKYB 3W9IA 3Q83A 2ZJPQ 2G0CA 2KW4A 3W9HA 3KUHA 3IS9A 4MIAA 2M8HA 3L7UA 2GIQA 4DQ8A 1HBNA 2GGPB 1KVAA 3KJVA 4YN3B 2IVPA 3FFIB 4DDFA 2BRLA 3G82B 2Y0SD 4P72A 4ES2A 4ECXA 3EE8A 1N52B 1S6PB 5LSLA 3V6JA 2YPYA 4Z4HA 3AJ1A 2OIHA 1HNWF 3MFIA 1FEEA 1UFLA 4I6MA 1BI4B 4E7LA 4J9KA 2ALYB 1JX4A 5KT5A 4N8OA 1JLQA 2RDIA 5HATA 3DWLA 2P2CB 3F5TA 4WQ4A 1HNXK 4O3SA 3SQ4A 3OHBA 2GWJA 4DF8A 3N5BA 2UXCF 2XMUA 3I55S 3NKYA 4A2BA 3QLHB 3ZNJ1 4BBYA 2WTFA 2XMJA 3OYJA 1YTUA 3S3MA 3RWUA 4A8KA 2B4JA 1F6TA 3G2XA 3DRXA 1OVYA 3LP0A 3IBWA 1DARA 3TSUA 2C42A 3PLAA 2HMPA 3O9UA 1UWAA 2HNZB 3RSEA 3QAUA 2ATQA 2IYIA 1IKYA 4M45A 2XLIA 2J9DE 3W5YA 4DU8A 3BY5A 4BE1A 4DL2A 4JKHA 5HI7A 2H5EA 3CPWM 1YJRA 3QO9B 2JRSA 4CW7B 2H4YB 4CECA 3G82A 3ILIA 5ELZA 1JLFB 2MQMA 1HBUB 4I4BA 4J9RA 1S6PA 3B82A 4CBWA 1P1LA 4DPTA 1MSWD 4DV3F 5KG0A 2CYYA 5EWGA 2C22A 1HNZF 3QBXA 2CJQA 2IPOB 1S1WA 1B70B 5A8KA 4GKKF 3SUQA 1FD8A 2PO4A 2W7PA 4QJVA 3QLHA 4Y1DA 1HX1A 1KSPA 2MLXA 3KK7A 1H2UX 1S72S 1G99A 5FPDA 2Q1NA 1X5SA 1PC4A 4WIIA 1QQMA 4DV4F 4CT8A 2UXDJ 1VIOA 2HFUA 4PWDB 3T6BA 2AIRB 2HNZA 3HSCA 2QEXN 1WEXA 1N33K 3AOCA 1RHJB 3J7ZT 4CJEA 4ZLPA 3D7SB 2JEFA 1RT3B 4B3MJ 2GX9A 2QIFA 3K5LA 2QO3A 3MMJA 3U6FA 3MEEA 2OA8A 1IKVB 3HDSA 1HKCA 4O3QA 3NP5A 1SJFA 4G1QB 1KOHA 3MWPA 3HZEA 2I7NA 4JI5F 2XO6A 4U95A 3M32A 1HKBA 4DMZA 4HUEA 4I9LA 1LWCA 2VDIA 3UD3P 3DM2A 4PG4A 4ECQA 2J8AA 3ZEUB 5DQGA 2KG0A 1NHVA 4ED4A 1JCFA 1WF2A 2J7KA 2Z1HA 5JVGQ 3CB4A 2FJAB 4BHQA 1P6TA 2I7PA 2QX0A 5LXRA 4XK8C 4DR5J 2QM1A 5IM0B 3EVMA 4ANEA 1S79A 2N7YA 5A0YB 4W5OA 2V69A 1RWNB 2MQNA 1FKOB 1B99A 2HHHK 5BPMA 3BQ2A 2OANA 3ATUA 2V9KA 3RR7A 4PWDA 4B02A 2CIMA 4EBCA 1I5OB 1VJQA 2ZGZA 2M7SA 3V5RA 2A1SA 3SV3A 1LK7A 3TANA 1LFPA 2AYEA 4WK3A 4D3HA 4TY8A 4Q45A 2XZWA 2M3DA 1KC8O 4CGFA 2O4GA 1YG0A 3SBGA 4IUFA 4B9LA 4Y1CA 3HD2A 1IKVA 5DM7Q 4G1QA 4C8ZA 3OY9A 1IBLK 4Z0UA 2ZM6K 4J9VA 2PA8D 3B8HA 1U1PA 5D8HB 3LH2S 1A9NB 2ABYA 3QICA 3OHAA 4JV5K 4J9SA 3IXQA 4QWBA 3H2VE 3I31A 4M5IA 3H4DA 4FXVA 4RW9B 3Q8UA 3M7VA 5GVQA 3HZGA 1K47A 2M2BA 4IO1A 4A2AA 4BRHA 2VBZA 3KUEA 4ETXA 1IQTA 3AY0A 2KQ2A 3EJMA 2DNGA 5L9XA 3V4MA 5IM0A 2LQJA 3T7ZA 4IQXA 3OTDA 3H59A 3KFWX 1FT8A 5KFLA 5A0YA 1LWXA 1UVNA 4F0KA 2O4IA 2GHVC 4PL7A 2RHSB 2G2OA 3L3CA 4E7KA 4E7IA 4K5SA 4ITSA 3M6GA 3VAGA 1RFQA 1T6DA 4ED8A 3U27A 2FVSA 2MDAA 4CHYA 3GV8B 2HW3A 2YHXA 3N6MA 1NSQA 4B1YB 2YY3A 5B0CA 1XNQK 4USHA 4USKA 1N0UA 1YHQS 3QGHA 4JI1J 4TLRA 3NF9A 4NYFA 1X31C 3LDNA 1F3FA 1CC8A 3MR2A 2YKOA 1C1AA 2W6LA 4EMDA 3B4DA 3OTBA 4M1KA 3SQGB 3Q8VA 3QRRA 2OPRA 1QTMA 2W25A 1VQKN 2YNIB 2DR6A 1FEHA 3UO0A 3K2PA 1G7CB 4RW9A 1RDBA 4N8NA 1JB0C 3CC2N 5A6PA 4GMJB 3BB5A 4P73A 1NRKA 2XZTB 3NWGA 1HQ2A 1R6VA 4EHUA 4DPWA 2P9KB 5A2QY 2ITGA 1AFIA 3ID6A 3ZTQA 2EFGA 2K3IA 1YJ7A 2V2ZA 1QAIA 1U0HB 3H45C 3HPHA 3W2WB 3GSIA 4ELVA 3THPA 5LMNK 2GV9A 4F0MA 4LF7J 4IOCQ 3VQ8A 1NLKL 1FNOA 4NA1A 1B64A 2PFUA 4K4VA 3KK2B 3FZFA 3ZZPA 2BXJA 3CERA 4USTA 1VQNS 5DG8A 1F2HA 5RUBA 3RBZA 1X4EA 4EIAA 2WSCC 1WSFA 5GADU 5AQRA 2FDNA 2R2SA 5H1SQ 1XMQJ 2A18A 4W5QA 4AHUA 4M63A 1YF5L 3VEYA 5IWAJ 4F2SA 3SQGA 3P49B 1ESVA 2CPYA 1WWHA 3NE6A 4CEAA 1IVZA 2HGLA 4Q2LA 3DDNA 1NPPA 3WX4A 2YNIA 4H4MA 3WUHA 1Q79A 2NZ4A 4H0YB 1WTFA 3VOVA 4JI7K 3WZ0A 3K9JA 3BN7A 4YHHF 4FVUA 3LAMA 5KG3A 2ITMA 3GONA 2NREA 2DGWA 4G1PA 3W0LA 2BJ8A 4BG9A 2PMZD 2O3DA 3M8ZA 2QA4S 2RJZA 4CDIA 4CZMA 5F0WA 1NG9A 1HD1A 1D4XA 3CMQA 4WFAQ 3W2WA 4ISFA 2BJ1A 1R27B 4GKJF 4EP5A 2KM8C 4B1XB 3NDKA 1HARA 4ZPAA 1R8CA 4YOUA 2GZOA 3CMES 1EQYA 3EVWA 1WOSA 3G71S 1E3MA 3KK2A 2D1CA 2P9EA 4M3UA 1YITN 4HVZA 4KAZA 4OHVA 2LEAA 1U0SA 1CS4B 3D9BA 2OUGA 4KB1A 4WPAA 4ILJA 2K7JA 1IG8A 3QQCD 2Q2RA 4F3OA 4K43A 2FBTA 3Q8YA 3D66A 1FK9B 3M30A 3AB2B 4WU2A 1NK6A 4DR2F 3HSGA 3R97A 3VF6A 3CJ2A 1DJ0A 4X4QA 4PQUA 2F9WA 1I39A 3OBYA 3CPEA 4IR9A 3UWTA 4DQRA 2BZ2A 2VPZB 3PUFA 1HI1A 2KYZA 4EK2A 1GLJO 3T1HF 3F56A 3IFEA 1HLWA 3K9KA 1RSCA 1QSYA 1DHMA 2UUAK 3TR5A 1AUSL 1T94A 1WHXA 3MAHA 5HMWA 1N4LA 3EZUA 1VC0A 3UE5A 3F0NA 2RB7A 3IUCA 3WNHA 4HT5A 3UDCA 3ZZRA 3CJQA 1BG3A 3OJSA 2YX6A 5GMDA 4PG5A 4J2DA 3DN9A 3FC9A 3E01B 1TL1B 2F4FA 1TZ0A 2ZH5A 2FZKB 2WVBA 4LSZB 2IBKA 1IBCB 1CS4A 3P5TL 1N5QA 2BTFA 2B6AB 4HI1A 2X3DA 1IWAA 3V9WA 5HO4A 5T14A 3FZKA 1CVJA 1HYZA 1KAZA 4H5WA 1M5SA 1HNWJ 4KJIA 1HBMB 1MW7A 4ID8A 4CF1A 2JWNA 1NM1A 3DFEA 2ZD1B 3SEOA 3OTOJ 4I7FA 4MFBB 3VR1A 5DMRA 3ETMA 5BRHA 2X1FA 2HQDA 2CPDA 3DLKA 2N4CA 4CEZA 3EO3A 3AARA 4C11B 4PKHA 3KDOA 7AT1B 4PXEA 3KJFB 3BF3A 3PHEA 3M1VB 3FBFA 1MROB 2DHGA 4M3WA 2J0QD 4B9VA 1UEKA 1IH7A 4E3SA 4DWIA 1QSLA 3KNAA 4DQSA 4FDFA 2NRWA 1NJWA 2UXBJ 2JWKA 2ZOMA 1TR0A 4CFDA 3RAMA 5L9NA 3NGTA 4ED1A 2O8EB 3C0BA 1NLVA 2I1RA 3EICA 3HP6A 2B4PA 1G3OA 3E01A 3UN3A 2HQIA 2YNFB 3L2WA 5AQVA 1U02A 2ZJQQ 3FMBA 3HBTA 2D0PA 2N7CA 3SQ1A 3I5CA 3CD6N 3IC1A 4WFNQ 3CCJS 3DDKA 2HHXA 1B4SA 2GFFA 3ULHA 2KH9A 4DV0J 2OELA 2ZZNA 3MM6B 2AX0A 5CABA 4F3TA 3ZNUA 1UZDA 3HL8A 1TUYA 1WBBA 3IR5B 4ED7A 1T9WA 1M5OC 3PKMA 4LUBA 1EWRA 3TA2A 4EUVA 1UVKA 4K8XA 1HBMA 3L8BA 4NZ7A 1N32J 1MMDA 1F21A 2ZD1A 1K9MT 3E9LA 2VKRA 5J2MA 2QLXA 4DLEA 1HNZJ 4MFBA 2PEBA 2CQ2A 3WIUA 2OO4A 1NDCA 2WRMA 1FHTA 2FHJD 1NO8A 5DDRC 2GJFA 2LFVA 4O4GA 4ES1A 3W2VB 2UUAF <