1FKOA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkoA05
3E01A 3DRRB 4DSEA 2NUBA 3CIZA 3V1RA 3NL0A 5KFVA 2ZQBA 3I8DA 4CIFA 4NLRA 4IQXA 4K4VA 1WNEA 4RW9A 3AA4A 4AHVA 4RNHA 3KHHA 3FSIA 5KT4A 2VA3A 1HNIA 4NLSA 2W9AA 3NH2A 4FCYA 1EP4B 1FKOB 3VA3A 1IKXA 4RU9A 4WZMA 1Z4UA 1EP4A 4ZP9A 3PV8A 2IJNA 4N47A 2KQ2A 2FVCA 3BQ0A 3PX0A 4W5TA 2R8JA 1D9DA 5F8NA 4FLUA 4Y3CA 4M95A 3RMBA 1DLOA 2F8EX 1C0UB 1LW0A 2R2TA 1JLQA 3O4QA 5HRPA 1RTDA 2YNGA 1N6QB 3VQDA 3QINA 1F21A 3H40A 4B8CA 1RTDB 5KFFA 5I3UB 1IM4A 3HYFA 3KLEA 3M9NB 1SH2A 4H4OB 4ZVEA 3VQ9A 3DYAA 2WHOA 3KLFB 1JLAB 1Q8IA 2J6TA 2LSNA 5KFEA 3CDUA 4ECSA 4XPEA 4JV0A 4HVJA 3EYZA 1ZBHA 2RDIA 3OS0A 1HPZB 4PWDB 3C6UB 1TK5A 1YVFA 3OL8A 1HPZA 1XR5A 3GV5B 4KI6A 1RDDA 4JRPA 1IKYA 5EDWA 4E89A 3HVAA 1JLCA 4CJPA 4KI4A 4R5PA 5EWEA 3MEGA 1EETA 4N41A 4DL2A 1G15A 4DLGA 1RT1B 3P83D 2EX3A 4B9SA 2G8IA 3VQAA 1BQMA 4CHYA 3HVTA 4JS4A 5DQIA 1FK9A 5KFMA 2D7SA 4YFUA 4EP5A 4BWMA 3F73A 3H08A 3EZUA 3WNHA 1B9DA 2J6UA 4HKQA 4CK3A 4M3UA 4O3OA 3H59A 3TAPA 4EYHB 3ZT0A 1REVB 4ID5A 4MK7A 4CESA 3TARA 3AVIA 1KTQA 4CJRA 3UPFA 4CHOA 4KB1A 3V9XA 4DL4A 4CGJA 3OL7A 4DTXA 1RT3A 4ZPCA 1I3AA 1JLGB 2KZZA 1VSJA 2RKIA 2OPQA 1QSYA 1VRTA 2ASLA 3L3UA 2OPQB 5L1JA 5F8HA 2QKBA 2Y1JA 4CJVA 1TL1A 3V81B 1C1BA 2W8LA 1KFDA 3PO5A 4O55A 3H2LA 2YHBA 4QCLA 4QW8A 4YMEA 3D0PA 4CIGA 3OLBA 5C24A 2FC0A 4CFDA 2ALZA 1JXEA 4GW6A 3L2QA 1N56A 4O4GA 3MEDA 4QWDA 5T14A 4TYBA 4XPCA 2XI3A 3BQ2A 2QKKA 3CFRA 1DTTB 4DQPA 4IDKA 4GC7A 2W9BA 2RDJA 3CFOA 4IDKB 5HRRA 2JC0A 4CF9A 4CJTA 2VG6A 3TWHA 3CJ4A 2IC3A 5HROA 4PUOB 2G8UA 1S1WB 4YNQA 2G8VA 2IAJA 4NRUA 5KFZA 1Z25A 4NYFA 5HROB 4J9NA 4HCCA 4O44B 4G1QA 4FJGA 4ED8A 4O44A 1JL1A 1Y97A 3KK1B 4TY9A 4LQ9A 3IRXA 4TQRA 1LWCA 4CJSA 4CJWA 4DSLA 2P1JA 1VSDA 1FXXA 4F4KA 1RAJA 4NLDA 2HHSA 1LAVA 4IRDA 1ZETA 4W5RA 3OHBA 1BCMA 3TAQA 3M9OB 2RPIA 3IG1A 3DRRA 4ED1A 2FBTA 3OL9A 4GMJB 4DTNA 2YKMB 4M3XA 1IKWA 2JEJA 1N5YA 2AGOA 4I2QB 3ULDA 3QGIA 2ZD1B 3AO1A 2UUTA 5HP1A 1JLFB 3OYAA 3MXIA 4RW9B 4F2SA 4LSNB 3OYNA 2A1RA 4J9KA 1SKRA 3OYGA 4LSNA 1GX6A 4RUCA 4FZZA 3VQ5A 1IG9A 4ECTA 4E7LA 4AHUA 3KKSA 2D0AA 2VG7B 4EBCA 4E0DA 3PY8A 4CJEA 4CK2A 4OPKA 5KG2A 4MKBA 4F4ZA 1ITGA 5DG9A 1I39A 3PUFA 2VG7A 4ECUA 3QO9A 2FBVA 3UQSA 1K1SA 4KV8A 1SH0A 3LP3A 1B9FA 3QO9B 5J2MB 3TABA 4RNNA 3MR2A 1RBSA 3OVNA 5CYMB 1RTIA 3KD1E 3V9ZA 3KTQA 5KT5A 4NLQA 3DLGA 2DFFA 2YHAA 3HPOA 3V1QA 3EY1A 3ASMA 4FBUA 1HQUB 2HNZB 3D5MA 4PWDA 3C6UA 1JXLA 4ECRA 2YV0X 1FKPA 3QLHB 4EEYA 3MR6A 4N56A 4W5NA 3K57A 1J5OA 4KHRA 1S1XB 1JKHB 1C6VA 3QIDA 1J5OB 2X78A 2HHWA 2XY7A 1R0AB 1HJRA 3K59A 4FK4A 2OZSA 3GV8B 4KO0A 4DSIA 4K4XA 3PX6A 4TLRA 4KSEB 3MAQA 4CEZA 4WFZA 2PYLA 4FLTA 1B92A 3KJVA 3KOAA 3OHAA 3SQ2A 5CZ2A 3DDKA 2HMIA 3FFIA 2XY6A 3M8PB 3NGYA 2UVUA 4RW6A 5KFOA 5KFNA 4FJIA 1MU2B 4FW1A 2B6AB 4ED6A 1NK9A 1HMVA 3HSTB 2BRKA 4M94A 5HBMB 3HVWA 3ZSWA 4JV1A 3AVJA 3ZT4A 3CJ0A 4FJMA 4URQU 2HHTA 4ZVGA 4B9LA 1QE1B 4LSLB 4ECWA 4J9OA 4K8XA 2BGGA 1K1QA 3DLKA 3BR9A 3F9KA 1CXQA 2I1RA 3QETA 4U7CA 1QS4A 3HVRA 4M3WA 1JLEA 2ASDA 5E41A 2X6NA 1BCOA 3ZSOA 4MK9A 3C94A 5JS2A 1RILA 4O3NA 1IH7A 4FJ5A 1FKOA 5CY4A 1SV5A 2JLEA 4KAZA 4KHMA 2QV6A 2R7YA 1CZBA 3ZSXA 3VQCA 4CF0A 1RT4A 4OGCA 3VQ6A 1SKSA 2GC8A 3O4NA 4KHSA 5KFDA 1N48A 3QGHA 1D5AA 2HNDA 4CEFA 4Y2AA 4FLXA 4BE1A 5KFTA 4OVLA 4YQWA 5KG3A 3KMSA 1DTTA 3N6LA 4FBTA 2Z1HA 4RUAA 5L1LA 2W9BB 1RYSA 4DFMA 3V6JA 4DEZA 3DOKB 4DQIA 2VG6B 3QESA 4DMNA 4M3ZA 2FJVA 4DS4A 4TY8A 3NBPB 1RTHA 3U3YA 5K14B 2HAIA 3JSMB 4G1QB 4ECVA 3D28A 4TXSA 2G8FA 5K14A 4Q0BB 4MKAA 4O3SA 4KKOA 4IG0A 4ECZA 1CXUA 3M8QB 1RT6B 3KNAA 3PW2A 4KKOB 2F96A 3KLGA 3NCIA 4F4WA 1ASVA 1LWCB 2C28A 3MEGB 5J2PB 4KPYA 3PW4A 4QW9A 3AVHA 1BQNA 2FVSA 2OYQA 3T5LA 3V4IA 1KHWA 4KTZA 3MFIA 1S1UB 4CJKA 1C0TB 1RDRA 1BQNB 3HVTB 3KD5E 4BACA 3LANA 3UR0A 3IGVA 3LPTA 2Z1IA 4Y1DA 1TAUA 2VG5B 3HP9A 3H4DA 2XY5A 1D8YA 3IAYA 1KLMB 1WN7A 1ASWA 4RW7B 2ZKUA 2QE5A 1N5YB 4QAGA 3LP2A 1JLBB 1RT7A 4WE1B 4IBNA 3TAGA 3Q8SB 5KFAA 2QXFA 3G0ZA 3RRGA 2B4JA 3LP0A 2DFEA 4OGEA 1TVRB 4J2AA 1XWLA 1JLFA 3OJSA 4Z4EA 5F8LA 4LH5A 4IFVB 3LALA 1D9FA 5DK5A 4CK1A 1TL3A 4Y34A 3DOLB 5HLFA 3SZ2A 4DFJA 4DG1B 3T5JA 5KFUA 2FJXA 3NDKA 2ATLA 1KVCA 4ZTFA 4FM0A 2OA8A 5KTQA 1NJZA 3KLVA 3GIJA 2HVIA 1TL1B 4RW4A 1QSSA 1WNSA 4RNFA 4R8UB 4RW4B 4DLEA 1WSEA 3VN5A 2JGUA 1S1VA 4LD0A 1KVBA 3S3NA 4B9NA 4F4YA 5KI6A 1C1CB 4EP4A 4TN2A 2RN2A 5KT6A 4U6PA 2HHXA 2P51A 3CM6A 4QWEA 4HUEA 1LAWA 4FLVA 5KFQA 3KLFA 5EWFA 4KHUA 2AGQA 3EPIA 2C2DA 2E9RX 3DM2B 2GV9A 3FRZA 1KFSA 5KFHA 1EKEA 4EZ9A 1RBVA 4CJ4A 2OPPB 1X9WA 4B9MA 4Z4FA 4CF8A 2OPRB 1XHZA 1JKHA 3Q8RB 3NAIA 4KO0B 2C2EA 2OPRA 1S1WA 2Z1GA 2BE2A 4M3RA 1NK4A 4AHCA 5DQGA 1R0AA 3AV9A 4IFYB 4CFAA 4M42A 3T3FA 3IS9B 4BE0A 3G6VA 2XI2A 5J1EB 3I0SB 2FVPA 2HMIB 3SQ0A 4FK2A 1NK5A 1RT1A 4DWIA 3K5MA 4E7KA 4I7FA 4FLWA 1FK9B 3AA3A 3TR8A 4FZYA 4CJQA 3QEXA 2DFHA 1SKWA 3EPGA 2I5JB 1CLQA 2C22A 5HBMA 3M9MB 2WK4A 2YNFB 3SI8A 4ZTJA 4TYAA 1RBRA 2JEFA 1JLGA 2W9CA 3VA0A 1RA7A 4CHNA 4F3TA 3PJWA 4NCAA 2IM0A 2WTFA 4X2BA 4FM1A 4JUZA 1TQLA 1T8EA 2ASJA 2RKIB 1WSHA 1U09A 3DRPB 3OLAA 1S9GA 3I5AA 3K5NA 3DI6B 4J9RA 4H4MB 2IOCA 3V6HA 3HP6A 4OKJA 4E7HA 1QAIA 4I9LA 1RT4B 1BISA 4ZP8A 4F50A 3AVFA 3V9SA 3RTVA 3NF9A 3CYMA 1QSLA 3Q8PB 4FJLA 1T03A 3LP1A 2E9TA 2IA6A 4QWBA 2ILZA 4K50A 2DTUA 1C1AA 3KLIA 2HB5A 3CJ2A 3ALYA 4H4OA 4ZPDA 3KLIB 1X9SA 3V1OA 5FDLA 2O5DA 1J53A 2R8GA 4CGDA 3SFGA 3H5YA 1GOAA 3AVMA 3JSMA 4CHQA 1S6PA 3NH1A 3CDEA 4B3OA 3C6TA 2W8KA 4LQ3A 1A5VA 2ITGA 2W42A 3QZ8A 3NBPA 3RBEA 4DTMA 1SL1A 5J2NA 2G8KA 1TV6B 4B3OB 4CJLA 2AGPA 1GX5A 3KLGB 5KGWA 4W5OA 1TKXB 3CJ5A 1TKTB 3QZ7A 2XHBA 1BIUA 2HNYB 3BREA 2B5JA 3SUPA 3H4BA 1VSHA 3CM5A 4BE2A 3MTKA 4OPJA 1JX4A 3E01B 2FBYA 3CWJA 3ZCMA 5CYQA 3MR5A 1XHXA 4FZXC 3L3VA 3HM9A 1JLBA 2X74A 4IH6A 3GIMA 3HK2A 3NGIA 3VQBA 3NHGA 1CZ9A 4I2QA 2OPSB 4NLGA 1XR6A 5J2QA 1SL0A 3N6NA 2XY8A 2DY4A 2GIQA 3PZPA 3VQSA 5KFWA 2PY5A 4KB7A 1T3NA 3MEEA 3CFPA 3AVGA 4RG8A 3ISND 2AJQA 1ZBLA 3MEEB 3BSNA 3B6PA 5HRNA 2PYJA 1U45A 2D41A 3BJYA 5L1KA 1DLOB 3PHEA 4K4WA 3KHGA 1HYSA 5KG6A 4JLHA 2GUIA 5CYMA 1NOZA 2XGPA 1HYSB 1SUQA 4HYKA 2AX0A 1WAJA 4ZVFA 3M8SA 2R2SA 1C2PA 3DLEB 1RTIB 4NLYA 4PA1A 5DLGA 1U04A 4EYIB 3DLEA 1A5XA 2HNZA 4C8LA 4ELVA 3JYTB 4J9MA 1K6YA 2G8HA 4NLUA 1RBTA 3PO4A 1L5UA 4CEBA 3V9UA 3BDPA 1WSFA 5EUHA 1U49A 4DSKA 2XWYA 4NLXA 4OL8A 3QEWA 3T5KA 5FRNA 3DRSB 1TKZB 4FJJA 3L2VA 2XCPA 2OH2A 3S3MA 2IAJB 4CGGA 1TKZA 3ZSYA 4ED2A 4TY8B 1RYRA 5KFLA 1LV5A 4NCGB 2ZE2A 1L3VA 3LZIA 5J1EA 4Q0BA 5KFKA 4KBIA 3G6XA 1JL2A 1MU2A 3DLBA 4PQUA 4I7FB 3UIQA 1HARA 4JRQA 3O3HA 1S1TA 5KG5A 5KG1A 4O0IA 3GYNA 3H5XA 1IKVB 2B6AA 4J9QA 4CEAA 1LWFB 3WNEA 2CJQA 3FDSA 3HO1A 3DLKB 3IG1B 1S0NA 1ZTWA 1RCHA 2V4RA 1BGXT 2OZMA 4FJKA 1S6QA 1CSJA 3QIOA 1C0MA 3H5SA 1UAXA 1ZYQA 3WNFA 3SV4A 1S4FA 2FLNA 4EO8A 4KRFA 3RMDA 3NAEA 2O4IA 2V9WA 1VSIA 2VWJA 1JXBA 1T7PA 4KAIA 1SV5B 2IM2A 4B8AB 3AA2A 1L3TA 3E51A 3FQKA 4Z4HA 4DG1A 4MFBB 3QEVA 3MXJA 1QAJA 3KMQA 4E7IA 4B9UA 4MFBA 3A2FA 3LZJA 1NK8A 4FJXA 1HNVB 4I2PA 2WONA 4KV8B 3AVNA 5F8IA 2UVVA 5FROA 3TAEA 3KK3A 4FJ7A 3RB0A 3L2UA 1C1CA 2ATQA 5C25A 3G6YA 1ZBUA 2HHUA 2XGQA 5I42B 3PR5B 1LW2A 2F8SA 1RDBA 1S9FA 1RDAA 3ZT1A 3KK2B 4FS1A 1TK0A 4DSJA 3DLGB 5F8GA 4CE9A 4TSXA 3O3FA 3OJUA 1ZBFA 1HQUA 4K4TA 1ZTTA 4KTQA 1NK7A 1OS5A 2OPPA 3T19A 4AH9A 3OYCA 5KT3A 1RDCA 2YKNA 2R8HA 1TKXA 4NLVA 3BSOA 1U47A 3OL6A 3AO3A 2KTQA 5DGAA 5KFBA 4KE5A 3PW0A 4DTSA 3M8QA 1S10A 4IRCA 4B08A 3C95A 4ICLA 3RB4A 4DSFA 1RTJB 1C0TA 4M3YA 3RAQA 5KT2A 4EO6A 2WRMA 2BDPA 4KB0A 3ITHA 2FLPA 2BRLA 4DTRA 3ZSVA 1TVRA 4JV2A 1EXQA 5HP1B 4IKAA 2YNIA 2QK9A 3OYJA 5F9LA 3BGRA 4DL6A 4DQRA 2YNFA 2E9ZA 2HWHA 2YNIB 2KW4A 2OPSA 4Q43A 1KSPA 1IKXB 2W9CB 3KLHB 4CJFA 1RT3B 4IFVA 4E19A 3KLHA 3SQ1A 3HKWA 3GILA 3I5BA 4ZP6A 3CVKA 2E4LA 1C0UA 1LW0B 3RAXA 1GOCA 3MFHA 2XCAA 3DI6A 1HRHA 5J2MA 1S1VB 3GIIA 1SUQB 2VA2A 2D0BA 4BDYA 3FQLA 1HYZA 4HCBA 3AVKA 3S3OA 4K4SA 4J2DA 3OSNA 2HW3A 4GC6A 2ILYA 2W7PA 3JYTA 1KHVA 1S5JA 1NKBA 3SPYA 3MEDB 4I9QA 3RRHA 3V6DB 3GIKA 4E1NA 2WOMB 2UVWA 4CEQA 2XO7A 4CIEA 3PR4A 1IKYB 4CEDA 3TVKA 4C8MA 2HHVA 3WNGA 1UWBA 3OYBA 4DF8A 4G3IA 2CKWA 3S9HA 3OY9A 4Q5VA 3NF7A 1UWBB 1MMLA 1W9HA 4IFYA 4IR9A 1QQCA 3I0RA 2BQUA 4DU3A 4TQSA 4MH8A 1NJXA 4DFKA 4EBEA 3LWLA 3KHLA 3Q8QB 1KLNA 4CEOA 2YNHB 4CERA 4N5SA 1KCFA 1U4BA 4PQUB 2WB4A 3SNNA 4Y2CA 2PZSA 1S0MA 2BANA 4M41A 1RT2A 1YTUA 1HMVB 2BANB 5J2PA 1VSLA 3QIPB 2ETJA 4DU4A 3QNOA 4LSLA 1S1TB 4KREA 1S49A 4ZMMA 3QIPA 4N76A 4ZP7A 4RW8A 1LWFA 4BDZA 4NYNA 5KFCA 4DL5A 3KIOA 4RW7A 3CJ3A 4DL7A 1X1PA 1NK6A 1WAFA 4URGA 1IKWB 4BDPA 4WYLA 2AQ4A 3ICLA 4MIAA 4CJUA 5L9XA 3AO5A 4Q44A 3DRPA 5DMRA 2C2RA 2D5RA 4H4MA 4XIUA 5FRMA 1TL3B 1RBUA 2FLLA 1TP7A 3RWUA 2UVRA 3OS1A 4IH7A 3K2PA 1DTQB 4NCBA 3GV7B 4CHZA 2WONB 3QGGA 1RT5B 4DL3A 1T03B 4R8UA 4YP3A 1NJYA 3KK3B 1RT5A 3KHRA 2BQRA 4Q8EA 2FVQA 3SUOA 4PY5A 4E7JA 4K4ZA 1I6JA 5I42A 4RNOA 4BWJA 1JLAA 2AWZA 3LP1B 5KG7A 2D0CA 3KK2A 1TKDA 4K4UA 4DF4A 3DOKA 3SPZA 1RNHA 4CEEA 4KHYA 1GOBA 4FW2A 1NK0A 1NHVA 3D45A 1ZBIA 3TAMB 1S6PB 4CCHA 4CFBA 4FK0A 4QOZB 4HUFA 4KHQA 3VQ7A 3B6OA 3H98A 3ZT3A 4ELTA 5J2NB 3MXMA 1NNDA 4CGFA 1S1XA 3LPUA 5C42B 1W25A 3BSCA 1QTMA 1RT6A 1EETB 4K4YA 4DFPA 4ECYA 4Q8FA 1TV6A 1YT3A 3NGZA 1BI4A 3CDWA 1JLCB 1BQMB 3CQ8A 3PW7A 4FYDA 4GVMA 1VRUA 4DTUA 2HNYA 1EX4A 3OYMA 4ECQA 4O3PA 3I0SA 4CF1A 1BIZA 5D3GA 4OLAA 3OS2A 4LY7A 4IH5A 3U6FA 3ITHB 2YKMA 1BHLA 1REVA 3LP2B 4O4RA 1KVAA 4CGIA 3SUNA 2ZD1A 5EWGA 4HTUA 4EZ6A 4WZQA 3AVAA 3PJXA 4IOBA 4O5BA 1UOCA 5F9NA 3PW5A 4AHRA 4RNMA 3LAMA 1S0OA 3HXMA 2UUWA 3SUQA 3LDSA 1TAQA 2Q3SA 4IRKA 5EU7A 2R2RA 1L3SA 1J9AA 3VQ4A 2XRIA 5KFJA 1NKCA 3AVBA 4R0EA 2R2UA 3G10A 1X9MA 1VSMA 3VQ8A 2YNGB 1N6QA 3NH0A 2IS3A 2WCXA 3MF5A 2E6LA 5I3UA 4M45A 3KLEB 3SV3A 4ZVHA 1RA6A 1ASUA 4O4GB 2O4GA 4W5QA 4M3TA 3DMJB 3DYAB 2D3ZA 4ID1A 1J54A 3RR7A 1VSEA 4MIBA 5F8MA 3QERA 2FVRA 3RBDA 4I2PB 4UQGA 1TK8A 3P5JA 1NHUA 4DS5A 1NOYA 2J6SA 3ISNC 3OYIA 2HNDB 3AO4A 4OKEA 3BQ1A 2B43A 4PUOA 3CG7A 4L8RB 2RF2A 4ZHRB 5DLFA 3DRSA 5C5JA 3NE6A 4O3QA 1TGOA 3I0RB 1U48A 3TANA 3NF6A 2V0NA 1D1UA 1WLJA 5FDLB 3T1AA 3KK1A 3SJJA 1LWEA 3ZSZA 4MK8A 2YNHA 4Y1CA 4QWCA 3K5OA 4WXWA 4ED0A 4F8RA 3I5CA 4J9LA 3FFIB 1WSJA 5DG7A 2V4QA 4ECXA 4ELUA 2ZE2B 4WXOA 3IRXB 2R8IA 4Z4GA 4DTPA 4J9SA 4ZPAA 5KRTA 4FJ9A 3M8RA 4WFYA 3RMCA 2DPIA 3SCXA 4ICLB 3V9WA 4FJ8A 2KFNA 5JS1A 3EZ5A 2VG5A 4IR1A 3OYHA 3RMAA 2IM3A 5CYQB 2IBKA 3MR3A 4DQSA 4AILC 4E3SA 1T94A 3TAFA 1Q9YA 4JS5A 4F2RA 3SFUA 2VWKA 4B9VA 3N6MA 3QEPA 5JXSA 3G86A 2JEGA 1S9GB 3BGRB 3OYFA 3ZT2A 2AX1A 5J2QB 5KG0A 5SZTA 3PX4A 3HJFA 1HNIB 1S9EA 5JUMA 4H8KA 4F3OA 4OLBA 3V6KA 2KZMA 2IJFA 3DOLA 5HLFB 1S9EB 5C24B 2EC0A 3IN5A 2D3UA 4Q45A 1BL3A 1O1WA 3L2RA 4YR2A 1JLQB 5KFGA 3AA5X 2GBZA 5L1IA 3LWMA 4ED3A 1UA0A 4FJHA 1S97A 1HNVA 3ZSRA 2HVHA 4KTWA 1D0EA 2FJWA 4DQQA 1XC9A 3OYKA 2HWIA 4OKKA 1HYVA 1XR7A 5C25B 1Q9XA 4DTJA 2IC3B 3K58A 1QUVA 3AO2A 3NAHA 3QEIA 1FKPB 3QLHA 2KFZA 3MECB 1VK0A 3NF8A 4FXDA 1RTHB 2WOMA 3MECA 3C6TB 3H5UA 2Y1IA 3OYEA 3TAMA 4OJRA 3AVLA 5C42A 2P5OA 3IGNA 3HL8A 4CHPA 4H54A 4Z0UA 2FBXA 4XO0A 4O3RA 2YKNB 4IG0B 3BSAA 5KT7A 3P1GA 5T7BA 4EBDA 2GIRA 3L2WA 5F8JA 2A1SA 4IG3B 5KFYA 1TKTA 3DLHA 4DTOA 2BE2B 4R5PB 1S1UA 4CGHA 4IG3A 3IS9A 4QWAA 3QYYA 3NFAA 1JIHA 1RTJA 4NCGA 3KJVB 4RW6B 5D3GB 2IM1A 2XC9A 4FS2A 3HPGA 1KLMA 3OYDA 2JEIA 4MQ3A 3THVA 4J2EA 3PVXA 3VQQA 4KHNA 5KGXA 1RT7B 4WE1A 3LP0B 5KFRA 2I5JA 5KFPA 5KFIA 4ID5B 1NJWA 1YVUA 1QE1A 1WSGA 2IMWP 5SWMA 4RW8B 4FM2A 4ED7A 1WSIA 2R8KA 4KHWA 3K5LA 4Z4IA 4K8ZA 3LAKA 4B9TA 5DGBA 1JLEB 2F8TA 3HHKA 4NLWA 4FLYA 4E1MA 3NKYA 3KKRA 1KRPA 3V81A 2JC1A 4FVMA 3L8BA 3AVCA 2G8WA 1XI1A 1VRTB 3RB3A 4CF2A 4C8KA 1VSKA 4LH4A 1NKEA 1SH3A 1C1BB 3NGDA 4C8OA 2HHQA 4FJNA 4NLOA 2Z1JA 4DU1A 1T05B 4C8NA 4HHTA 2X6SA 3DMJA 5DQHA 4ZPBA 3GQCA 1QHTA 4FLZA 1UA1A 1T05A 5HRSA 3SYZA 3TQ1A 3QNNA 2IGIA 4AHTA 3O3GA 4YR0A 4F4XA 1DTQA 4J2BA 5DG8A 4URSA 3VQPA 1VSFA 4J9PA 3U3GA 3ZSQA 4HUGA 1SL2A 3DM2A 4CJ3A 3UDLA 3VQEA 4KFBA 3V6DA 2W7OA 5CZ1A 2RF2B 4ZHRA 3OSPA 3T5HA 4KFBB 2BQ3A 3HPHA 4NRTA 4CJ5A 3SI6A 3RR8A 4AHSA 4O0JA 1LW2B 5KRSA 1W0HA 4WYWA 1HQEA 2AU0A 1IO2A 2DPJA 4CECA 2E6MA 1HQEB 1L3UA 4NZ0A 4Z4CA 5KFXA 5KFSA 2IDOA 2P5GA 1N4LA 1LWEB 3OYLA 1A5WA 3DLRA 4NLPA 1S48A 3RB6A 1RT2B 3M8PA 2BR0A 1BI4B 4NYZA 4IKFA 3TI0A 1YTAA 1VRUB 1IKVA 5KG4A 3NMAA 4YR3A 4NLTA 3V4IB 4CFCA 4WFXA 2EHGA 3CO9A 4RZRA 2B5JB 4QPXA 1Z26A 3HT3A 3SQ4A 1S6QB
chains in the Genus database with same CATH superfamily
3FLCO 4GKKF 3H1VX 4A47A 2NUBA 4QOTA 3JXUA 3V1RA 5KFVA 5JVGL 2OO4A 3WX4A 4CIFA 4NLRA 1BUPA 2GELA 4IQXA 1TL5A 5L8RC 6AT1B 2ZH4A 2VKZG 3O5BA 1IQTA 4DV1K 2VA3A 5BN8A 2FD2A 2ZH7A 2IRYA 3FZKA 5AJ3J 3WIUA 1EWQA 4RU9A 1Z4UA 2V4JA 4JI3J 3OTBA 1E6YB 3A8EA 1KAXA 5C12A 4OYOA 4OLPA 1D9DA 4BHQA 1C0UB 1LW0A 2A18A 2R2TA 4ZPVR 5EX0A 2YNGA 1N6QB 2Y0SD 4AQYF 3HYFA 1URNA 4DPWA 3W0LA 4Y00A 1HNXJ 1ZAVA 4OI1A 4USVA 3AGRA 1Y3KA 3KLFB 2GQQA 2HBZB 4O0NA 1JLAB 2J6TA 2LSNA 4K5SA 4ECSA 3SMSA 2E29A 1NZ8A 4HVJA 3EYZA 1Y5NB 3OS0A 4PWDB 1TK5A 4H0YB 1YVFA 3GV5B 4P71A 3I4HX 3NLCA 1RDDA 2H3EB 2KJWA 4DV7K 5EDWA 4E89A 3HVAA 5LJWA 5EWEA 1YHQS 2KRBA 2BM1A 1EETA 4PKGA 3WIVA 1PYSB 4DL2A 1PAEX 4DLGA 4DN0A 3BN7A 2O8BB 1ZM2A 1T9XA 3GMGA 4JKGB 4JS4A 4AQYK 2QLWA 1VQ8N 1M1HA 1B9DA 1BXNA 3N4WA 1S6UA 3AOAA 1FWPA 5BYSA 4CK3A 4DV4F 3TAPA 1R8BA 2A3JA 4TLQA 2EI5A 4RUBA 4DR6F 3R5AA 3TARA 3CC4S 3RYLA 4CESA 1R31A 1VAZA 2GS8A 2WW4A 2YBVA 3VCDA 1CZAN 4ZPCA 2NYIA 2M8DB 1I3AA 1JLGB 2RE1A 2W2QP 2M3DA 4AM7A 2ASLA 3L3UA 3G6EN 1NDKA 3T1YF 2OPQB 5F8HA 2QKBA 3IM8A 3A3OB 1Q0NA 5D78A 1EQYA 4CJVA 1I94J 3V81B 2AYEA 2BBEA 1HKBA 4USWA 2QYGA 3H2LA 3IBWA 5CHIA 3EKSA 1BWEA 2C3OA 1BA0A 4ZJOA 1X4AA 3DGVA 3THTA 1S22A 5HQLA 5F0UA 4CFDA 1UAWA 4U9RA 3S7RA 1N56A 2YH0A 4TYBA 2UUAJ 2KM8B 4XPCA 3BQ2A 2VWBA 2M2BA 3CFRA 3CCQS 3CPWM 2K7JA 2PMZD 4GC7A 2A6MA 3I87A 5HRRA 3D9BA 4CF9A 3MM6A 3MAAB 2G8UA 2BEFA 4Z37A 2G8VA 2IAJA 3DWLA 3MAAA 2KRRA 3NNHA 4O44B 1JNZB 4FJGA 2H3GX 4MDBA 1OY6A 4ED8A 1VC6A 4O44A 2CG8A 1W2BR 1JL1A 5D0RA 4XDDA 4Y2IA 2M9KA 1N5QA 5I3PA 4LSZB 3C6HA 4CJWA 1T6CA 3M2RA 2DY9A 4NLDA 3ETOA 1K8KB 2QT7A 1X31C 3EDQB 3D2EB 1N5VA 2E7XA 4W5RA 5ETRA 1ACMB 2DNPA 1BC6A 2FBTA 4CH7A 1AUDA 1N0UA 4QBUA 2P9IA 3HHEA 3GSIA 2JEJA 2M0GB 1N5YA 4A59A 5HP1A 4GVBA 2HPUA 4JK9A 2VQFF 3OYAA 5LMUJ 3MXIA 4F2SA 4GVBB 1AROP 1N36F 2W24A 4JI5J 4J9KA 3GE1A 2PEBA 4LSNA 2KKHA 2GQ2A 3US5A 1IG9A 2RRBA 5DM6Q 3EO3A 2MHEA 4AHUA 1YJ7A 3PY8A 4CJEA 4CK2A 5M2UA 5KG2A 4MKBA 4F4ZA 5DG9A 4KHPJ 3PUFA 1P8ZA 2FBVA 1NM1A 1K1SA 4KV8A 3ILOA 2DCUB 5J2MB 5FLXY 1XK8A 4F7VA 4OI3A 5CYMB 3E1YA 3KD1E 2DRDA 1Y9OA 5IM0A 2KHDA 2GJIA 5GAEI 5KT5A 3DDNA 1NGCA 3V1QA 1HKAA 5KPZA 3PM9A 2JJ4D 4PWDA 2UUBJ 2YV0X 1FESA 3QLHB 3VZIA 4N56A 1S1XB 3SEOA 4ZLNA 2QSWA 1WELA 3QIDA 2CQIA 1QDUB 2XYGB 5AE1A 3K59A 2ZGZA 1K73O 1Q81O 2I2YA 3NCQA 1WKKA 4YDUA 4KSEB 2PYLA 4EI2A 4FLTA 1B92A 1B4SA 1UEVA 2CUYA 3AY0A 1U1PA 1X8DA 3OT9A 2R3VA 1MU2B 4FW1A 2MGZA 3VWSA 2KN4A 3MD3A 2HQDA 4WPAA 4C11A 4DZDA 4LFBF 3G82A 2OEKA 4M94A 5ADXA 2VUGA 4ZVGA 4LSLB 1E3MA 4CIOA 4ECWA 1HI0P 3R5JB 4K8XA 3SCKE 1K1QA 3BR9A 3DHWC 3FUYA 2I1RA 1YUWA 3TUZC 3HVRA 1QS4A 2I8EA 2PGCA 2X6NA 3KHYA 1BCOA 4M7YA 1XTZA 2BVZA 2J7UA 3VAIA 1RILA 1FF2A 3KK7A 2DH9A 3SSQA 3J7AP 1FKOA 2QWRA 1SV5A 2JLEA 1Q8KA 2QXLA 3ZSXA 3VQCA 4D3GA 5L39A 2MKSA 3NY0A 1NPKA 4CF0A 3THXB 3JTPA 2UU9K 4UZBA 5K8MA 1GLFO 2D9PA 4X4RA 3QGHA 2HQFA 4YQWA 1W2BM 2NREA 4FBTA 5AFUH 5AQQA 4DDFA 5L1LA 1P27B 3W64A 2W9BB 1X9JA 3FSYA 4DFMA 2HFVA 2DT9A 2HMPA 7FD1A 3KUGA 4DMNA 1DQAA 1RTHA 4JI0J 5K14B 3THWA 4Y65A 4FF2A 4OI2A 4ECVA 4TXSA 5K14A 1U6FA 3THWB 4DKWA 4Q0BB 4MKAA 3VEOA 1R3NA 2BKOA 3VAMA 3M8QB 1RT6B 5ETLA 4X66J 5GAGU 3KNAA 2F96A 1OO0B 3HM8A 4H4KC 3NCIA 3C15B 1ASVA 1LWCB 2C28A 5J2PB 1FCAA 4YS2A 5E7OB 3V4IA 4FWPA 2BA9A 4BACA 3FBCA 3IGVA 1Q5YA 1UETA 3IR7B 4Y1DA 1TAUA 1D3WA 1ZM9A 2UXDF 4HH1A 4ILMA 1IJEB 4I67A 1WN7A 3BYPA 2QE5A 1N5YB 4OYAA 3Q89A 2J4RA 2NPIA 1VMBA 2J76E 4WE1B 2RS8A 2RUGA 2F7TA 3TAGA 2UUCJ 1N33F 2R7TA 2B4JA 3LP0A 4N8OA 2LDYA 1XWLA 3OJSA 5F8LA 3G71N 1OVYA 2Q1LA 3ENWA 1PG5B 1D9FA 5DK5A 1TL3A 1GNKA 5K8NA 1W26A 5HLFA 3T5JA 2YX1A 3OBWA 5AQPA 2AJ1A 3KLVA 2HVIA 3AY9A 3J8AA 3WXJA 3OFHA 4RNFA 2C3UA 3EJMA 1RADB 3VN5A 4CI6A 2B4UA 5KI6A 1C1CB 1M5VC 3BPSP 3P31A 2QA1A 4LJMA 2P51A 5IV4A 1S6OA 2XLKA 4BGAA 3QBCA 2WSEC 3GSDA 4YY3F 4HUEA 1URRA 4H0PA 2YI1A 5FLXU 1ZM3A 4PABA 2KI2A 3EPIA 2C2DA 5EGYA 4NMLA 5AQGA 2I9SA 4LMZA 3K2YA 5KFHA 1U1RA 3MGJA 4KH1B 4DR6K 1YJWN 4CF8A 4JI4K 5HJYA 1R0AA 4E98A 4M42A 3VV2B 3J80U 3T3FA 2ZJQL 3IS9B 4BE0A 3G6VA 2XI2A 3I0SB 1NK5A 3BS9A 3CUNA 2BKPA 4NL5A 4USKA 4KBOA 4B3TJ 1DHMA 3EPGA 2I5JB 1VDHA 1IWAA 4ZVSB 2DIVA 2ASMA 3GFYA 3GIRA 3SI8A 2JEFA 3VA0A 4F3TA 2JVOA 4J8FA 2GMHA 3D54A 2HVDA 2QWOA 1T8EA 1X5PA 3ELHA 1X4FA 3BKTA 2XMTA 2R4FA 1GEHA 3I5AA 3K5NA 2HWTA 4KJIA 1YITN 4H4MB 4DV5F 1HNWF 1H38A 2IOCA 3Q24A 4UUXA 4KH6A 2EBGA 3IAM9 3FGUA 3HDSA 1BISA 2DNLA 5AJ3F 3NF9A 1RWNB 1JJ4A 3Q8PB 1FE4A 4H5TA 3WXIA 1R8PA 4RWXA 3LP1A 5IOLA 2F8MA 3EVOA 2DK2A 2PO4A 2IA6A 4QWBA 3FC9A 4K50A 1OIAA 4XH5A 2HB5A 3UVJB 1GLDG 3ALYA 3SJHA 1JCFA 3ILIA 1NJIO 2VJVA 5LL6d 5FDLA 2ATCB 2AF6A 2DY1A 3H5YA 2VGNA 4F04B 3MCAB 3UKUB 4OX6A 1RGIA 5IQ6A 4QIGA 2QLXA 3MN7A 3C6TA 2POKA 2W42A 1QUPA 4RLEA 4MKYA 2G8KA 2PN6A 3VVUA 3BF1A 3N4QA 1RJJA 3H90A 4C0BA 1TKXB 2CNOB 4JI2K 1AW0A 2M52A 2CH5A 3D6MB 2ZWHA 3CJ5A 4J9UE 1N32K 5MAOA 1FRXA 3BREA 3C0BA 3RZAA 1VC0A 4BC4A 1YJRA 4OPJA 1JX4A 4H4KA 3E01B 2FBYA 3CCRN 3ZCMA 3CETA 3L3VA 2EPIA 2P9CA 3GIMA 1D8ZA 4GVEA 2ACYA 3NHGA 2LLZA 4I2QA 4UQTA 5D77A 1RXOB 4A5BA 4O5FA 2J7KA 1XR6A 4BG9A 5HOOA 2PY5A 1YJ9S 3C19A 3M2UB 1CJTA 3R6MA 1RU1A 3UB5A 4RG8A 4JK7A 1ZBLA 3X1LB 1MN9A 5DM6L 2VOPA 3SCIE 4LF2A 3TJ8A 3F56A 4WFNL 3CCEN 2D41A 2UXDK 1WOQA 4LF4F 5G4DA 2PFFB 3CHWA 4K4WA 3KHGA 2HVZA 4JLHA 3ZX3A 1KAYA 1NOZA 3ULEA 1HYSB 4HYKA 4L6V3 1WAJA 1JXVA 1NU4A 4ZVFA 1XNQF 3J7YI 3VALA 4EYIB 3DLEA 3CCVN 4AE5A 3C46A 2VPWB 2MY8A 1K6YA 4NLUA 4DR2J 1SXLA 1RBTA 3BH7B 2KVQE 4FYXB 3ZETB 3V9UA 3T1HJ 3BDPA 1WSFA 1U49A 3W9JA 1HNXK 4RL1A 2FPHX 4NO7A 3O1BA 4B3MF 5FRNA 1J5EJ 3L2VA 1WTFA 3G8QA 5BR9A 4PR6A 4H5VA 2CFXA 1LV5A 3IR5B 3VF2A 1FA0A 3BBBA 4LR9A 3FNNA 4EHUA 1GMVA 3LZIA 5GAHU 2N3LA 5KFKA 2QTDA 1SC3B 3HCXA 3UIQA 5C7PA 3O3HA 2P9UA 4P2SA 4DL0C 2Q6BA 1YJNN 3JQKA 1KVJA 3TSUA 4O0IA 2B6AA 4DV0K 3ZO7A 4JKHA 2CJQA 2HAFA 2V4RA 2DD8S 1UJ5A 2NUUG 3POTB 1HBOB 1FD8A 3RGIA 1FJ7A 1NMEB 1UAXA 1ZYQA 1WG5A 3IO1A 2KG1A 3GZ7A 4BR0A 4ES3A 5K8OA 3EM1A 1WG4A 1K9MT 2ACMA 2I0XA 4QS7A 3MM7B 3R7SB 5EN1A 4ZIVA 1VBXA 4B9UA 4QPTA 2MKKA 1N0VC 4BR7A 1KTVA 3CJ9A 3OTOK 1YIJS 5A8RB 4KV8B 3AVNA 3VGTA 3CCMN 5F8IA 3IRWP 3KK3A 4OFZA 2ATQA 1ZBUA 1IBLK 5CABA 2HHUA 2MMYA 1RDBA 1RDAA 4FDFA 3KK2B 4FS1A 1F60B 1RBLA 4DX8H 1ZBFA 4OI4A 5T7LA 2OTLN 3NRBA 3T69A 1OS5A 3T19A 2C2ZB 5KT3A 3A12A 4YOTA 4E2FB 2KTQA 3SCJE 3G71S 3C8YA 1CVJA 3KG1A 2GVZA 2YQ1A 5JICA 3CC7N 2QA4N 3CJ7A 1C0TA 5ITHA 1M5OC 4EO6A 4IXCA 4LRAA 2LA6A 4P75A 2FLPA 2BRLA 2DRAA 1FNOA 2LDIA 1EXQA 1P1LA 3BGOP 4M5LA 3BGRA 2HK3A 1VQ6S 2YNIB 2EWHA 4M5NA 4DV2J 2DB1A 3H0PA 1KVKA 2OPSA 1M90T 4C6AA 2FHJA 2E44A 2VQEK 1CLFA 1RLCL 4LF6J 1FDAA 3I5BA 2EVZA 4ZP6A 2CJYB 3M2VB 2HHPA 1FFSB 3RAXA 3MFHA 2XCAA 1ROFA 1Y10A 2CIMA 3GIIA 4KGVB 3DDIA 1ZH5A 4TVAB 2VA2A 1HA1A 3FQLA 2MZTA 3AVKA 4CZJA 3S3OA 3VEVA 2IVFB 3C16A 4GC6A 2CVIA 4CZKA 1S5JA 3C16B 1R89A 3AXKA 1MG7A 4B3TK 2WAQD 2UVWA 4CEQA 3BB5A 4CZEA 3S01A 4CIEA 3PR4A 4IOCQ 2X1AA 4H0TB 2HHVA 1X3MA 3WNGA 4G3IA 5LMNJ 3OY9A 5AQJA 4IR9A 3GJSB 3C2PA 1WKLA 1FO1A 5C10A 4TQSA 4MH8A 3W5XA 3K8VA 3MDFA 4DFKA 4EBEA 3LWLA 1BWVA 2H5JB 4CEOA 2MLYA 1U4BA 2YCHA 3N4PA 2WB4A 2Z8QA 3ZXWA 3DLJA 3RJMB 3BBCA 2BANB 1PILA 1RLDA 5J2PA 2E5GA 3K0SA 2ETJA 3CMAN 2EEYA 4KPCA 4KREA 4OHXA 2MZ1A 4MYUA 5AQTA 4BDZA 4NYNA 3M05A 3R5GA 3Q0AA 3KIOA 3BEXA 1NK6A 3HT0A 4G1IA 4I6YA 3I82A 2Q43A 4MIAA 4OHVA 3KFWX 5AQYA 4BR4A 3DRPA 3O9QA 1NLVA 2C2RA 2FC8A 2D5RA 2PFUA 3ZZUA 3CEDA 1F5AA 2V4JB 4XIUA 2RDDA 1P9YA 5FRMA 3W60A 5C2CA 2FLLA 2ZF5O 4PWWA 3NWGA 3CCUN 2NSBA 4LRBA 3M6GA 2VQFJ 4IH7A 4NCBA 4QS8A 2MQMA 3VERA 3ATUA 3MMCB 4LT6A 1NSQA 3QGGA 5HQMA 3G4SN 4JI2J 1T03B 2J7WA 3KK3B 3AAPA 2FVQA 1N32J 2WVDA 1YKWA 3CJKB 1JLAA 3KK2A 1UVNA 2XMWA 3DOKA 3SPZA 1WKJA 1CJKA 1ZBIA 3TAMB 1FFGB 2LXFA 3OTCA 1NNDA 3PIPL 3GJTB 4FVUA 1JJ2R 1S1XA 2LP4A 3LPUA 5C42B 1HLWA 1W25A 3TWZA 3TX0A 4K4YA 4DFPA 4ECYA 3ONQA 3NGZA 4CI0B 1JLCB 3CQ8A 1MNEA 2K8GA 2LQBA 3AB4B 3PW7A 4CZIA 4PG8A 1VRUA 2HNYA 1EX4A 2YWWA 1U02A 4X4PA 4KYZA 3I0SA 4IQMA 5D3GA 2CPZA 4DR3J 1BQXA 1BHLA 2MKHA 1VHIA 3OTOF 3KUHA 4DR7K 1FTRA 3MM5B 1YBTA 4ANEA 3L7PA 2E88A 1F2GA 2R7SA 4DCPB 1JJCB 4HTUA 4O5BA 2KT2A 4X84A 2XSJB 4KGZB 3U02A 1S0OA 2UUWA 3MWPA 3E9OA 1FJGJ 4KHPF 2X1FA 1GFWB 4IRKA 5EU7A 2CDRB 2YPYA 2R2RA 2XRIA 1Q95G 1OJ4A 5HI7A 1OPZA 4ILHA 2YNGB 1N6QA 2IS3A 4ZLLA 1Q7YT 4ZVHA 1B99A 1ASUA 1V4SA 4NMXA 3GBTA 4ID1A 1T6DA 1DZ5A 5EXWA 3TPQA 2IIRA 3RR7A 1PCAA 3D6FB 3O6QA 3NEKA 1VSEA 4A8YA 5F8MA 3LF0A 2JVRA 1XMOK 1QZ5A 3P5JA 1NGBA 4UTGA 4BROA 2F9JA 3AO4A 4GRSA 1YRUA 3BQ1A 4OKEA 2P6TA 4LUBA 1VQKS 4O3QA 1O5JA 2Z0GA 3TANA 1DGKN 2BZ2A 2K2PA 2N82B 3Q23A 3T1AA 1P6TA 4EIAA 2ASOA 4JV5K 4MK8A 4QWCA 5AT1B 2P9PB 3EKUA 4CLZA 5GAEU 3IFRA 2AZ1A 5AZIA 2XYHB 3O1LA 2NRVA 3QFUA 4J9LA 3F0NA 1WSJA 4DR6J 3H25A 3QMQA 5DG7A 4ECXA 3UFCX 3PACA 4WXOA 5KOWA 1JB0C 1NG9A 4DPYA 3I9V9 1NBEB 3CD5A 2B4OA 4H0VB 3LDPA 4UW2A 4DCHA 4FJ9A 2RHQB 3PHTA 3I33A 4M5GA 3D3CJ 4OX9F 2YH1A 5CZXA 1X5SA 2MSTA 2DR6A 2ZWOA 1OYDA 1RGVA 4QYZJ 3SFUA 5FPDA 4B9VA 3QEPA 3J7A1 3G86A 2JEGA 2AEMA 4C7QA 4A46A 3PX4A 2UUCF 4H8KA 3V6KA 4UY8O 5HLFB 1HNZF 2EC0A 2BW7A 1RHKB 2CNNB 3U9DA 1BL3A 3G96A 1JLQB 1NHKL 3Q7CA 3AA5X 1RB0A 4U7UK 3ID8A 2PDAA 5D4NA 1UA0A 1T9YA 5HANA 1XMQK 3ZSRA 3ULEB 2V2ZA 2LQJA 5E0OA 4KTWA 5CYJA 4A4JA 3OYKA 1XN9A 2GIFA 4CD1A 2HWIA 4OKKA 1U8SA 1Q9XA 3D6HB 3QLHA 3ZTOA 1VQMS 1UVLA 3NF8A 1PSDA 3H1QA 2V8HA 2KHCA 3H5UA 3OYEA 2ZH9A 5C42A 2HS3A 3HL8A 3LL3A 4WF9L 2ZHBA 4ZVTB 2YKNB 4YY3J 3P1GA 4EBDA 3N9UC 1HKGA 3CJSA 4NXMF 3ENAA 2YX4A 3TW0A 1YF5L 4IO1A 2VBWA 2DNOA 1SAZA 3MUMP 4R5PB 2VQEJ 2C2KB 1UMJA 1FE0A 2UXBF 3I4PA 4ZVPB 4LFCK 5AQOA 1JIHA 1RTJA 1P9QC 2RH3A 3KJVB 5D3GB 2GZOA 2XC9A 3OYDA 4CTAB 1LOTB 3HFKA 3MCSA 4MQ3A 3CF5L 4F26A 3VQQA 3M5RA 2XO6A 1N5SA 3LP0B 4OV6A 2KL8A 4HEA9 5B0EA 1Y5IB 4K0KJ 5KFIA 4WFNQ 4ID5B 2IMWP 5SWMA 2HBRB 4S0MA 2KT3A 1NH8A 2R8KA 4KHWA 4C3LA 5DM7Q 3D67A 5DGBA 1JLEB 5DDPC 5AXMA 4A48A 3AGKA 4NLWA 4E1MA 3NKYA 3MN9A 2V7ZA 2P9EA 2GHVC 4RX6A 3L8BA 2G8WA 4M63C 5LMNK 1VSKA 2AP6A 4C8OA 2HHQA 1CS4B 1MDUB 1IBMK 3TYTA 4PEOA 1T05B 2R7RA 5G0RB 4ZPBA 1QHTA 4FLZA 5HRSA 3TQ1A 3ZNJ1 4YR0A 1DTQA 4YHHK 1F5BA 2RHKA 3MMVA 5T41A 3ZSQA 2HFUA 1RHMB 4HUGA 3UDLA 5C2GA 1WSVA 2RF2B 3MUVP 1JJHA 4U8VA 1LW2B 5KRSA 1QHAA 1HQEA 1IO2A 5CD4H 2P9LB 3GU0A 1IWGA 1HBUA 4CECA 1IQZA 2OTJS 4FWMA 2XMAA 4V19J 4Z4CA 2Q6CA 2ZBPA 2YX7A 4WU3A 1WEYA 3K9KA 1S48A 2BR0A 1SJ1A 4QZVB 4ZPWR 2MGZB 2B9XA 4IKFA 3TA1A 5KG4A 1T9WA 4NLCA 4CQ1A 1H74A 2G1HA 4RZRA 4JI3F 4H0OA 2ZDOA 3HSDA 5K8PA 3E01A 3FZLA 2V9KA 3RRKA 1A6LA 4DSEA 1FTCA 1YG0A 3LDQA 3NL0A 3SIPB 2DGUA 4DR5K 3J7YP 2OD4A 4K25A 1PAUB 4ANDA 4FCYA 1EP4B 2GA7A 1VQYA 2CJ9A 1FKOB 3VA3A 3MEKA 1X60A 4WZMA 1EP4A 4DV4K 1S72S 4DV7F 4W5TA 1HBNB 3IKMA 1GLAG 3C6AA 3I8BA 4M95A 2B9EA 2F8EX 2FLOA 2QWNA 4YOYA 2D1KA 1RTDA 3PG9A 3MM8B 4CYUB 3QINA 1Y4ZB 3H40A 4B8CA 2DEJA 2JNJA 4ZDNA 2K7KA 3C7NB 1RTDB 5I3UB 3KLEA 2APOA 3D4JA 4CLTA 5ETVA 3P45B 1YAGA 3IAS9 3M9NB 2Y8YA 3CF5Q 4LF4J 4ZVEA 2WHOA 3QAUA 2VBXA 3UKUA 2R7OA 5L46A 4M5MA 1U1NA 2DKOB 1Z2ZA 2J9DE 3ZETA 4WCEL 5LXRA 4OZNA 2ZJPL 4RWTA 2CPYA 1ZA2B 3TZXA 1VQON 2N7CA 4R5PA 3EE9A 3F9MA 3MEGA 2V69A 3SAGA 3QFPA 2VCPA 4XAKA 2XTJP 2OTLS 1RT1B 4B9SA 2EX3A 3VQAA 4CHYA 3HVTA 2DGSA 2ZBQA 2NPFA 3CIPA 4KGXB 4YFUA 1BLUA 2ZEJA 3F73A 3H08A 2JHEA 3WNHA 4DJBA 5LY3A 4HKQA 2CQ2A 4O3OA 3H59A 4EYHB 1REVB 2Z4PA 4ID5A 3FK4A 1Q8LA 1VQ5S 1SC6A 1FJCA 3V9XA 3TEGA 3WUHA 4CGJA 1NSPA 3OL7A 4DTXA 1XQIA 8ATCB 2WFBA 2KZZA 3K17A 1QVGR 4AM6A 2RUSA 5L1JA 2Y1JA 3S1TA 2O8CA 2W8LA 3PO5A 4O55A 8AT1B 2EK1A 4X4UA 4QCLA 3D0PA 4RPFA 5C24A 2FC0A 3WBZA 2DNMA 1OH5A 2FF6A 3L2QA 3MEDA 4QWDA 2E5LJ 2CPJA 2V8VA 4WU2A 3MMCA 3WQUA 1XMBA 2XI3A 4CLWA 4ZK7M 5LMUK 4IDKA 2XS7A 3A8KA 2RDJA 1F9EB 3R5CA 1O6XA 4LF5F 5B0BA 2VG6A 2L9NA 3CJ4A 2ABYA 1WUUA 1Z25A 5KFZA 4ZOSA 1VYAA 2EG1A 4HCCA 1DT9A 1MMNA 1SJ4P 3ZTPA 5H9EK 3CE8A 3JSRA 1MWYA 4TY9A 2CJKA 4IJAA 1YJWS 2OIHA 3IRXA 1YBAA 1CULB 2VL1A 5E3CA 4DSLA 2P1JA 3FBBA 3TTDA 4U95A 3HD1A 5HAOA 4IRDA 3CCWA 2KXNB 2CGLA 4LF5K 1FI4A 2FDNA 4RR5A 2RPIA 4B3RJ 3OL9A 4GMJB 1YZ6A 4PL7A 3ENBA 4J5OA 1IKWA 1VQPN 2Y1RI 5C0YA 1TYQA 4BG8A 2VPYB 2HLUA 2AGOA 4I2QB 1Q79A 1SC1B 3VGUA 1F2HA 2DIUA 1VK3A 2JFKA 3W5ZA 4CD3A 3G8TA 3NOGA 4DHVA 1M1GA 4RW9B 4NI2B 5IZHA 3OYNA 2FJEB 2A1RA 2OSRA 1GX6A 2E8AA 4RUCA 3BYRA 4M63A 3QAEA 4E0DA 4CZFA 4ZVQB 1ITGA 1XMQJ 3UQSA 5D4LA 1HL6A 1PJ7A 4HI2A 4RNNA 2BTFA 3MR2A 1RBSA 3AJ2A 3OVNA 3U4LA 1YHQN 2ZM6J 1N34F 1WOPA 3KTQA 1VHFA 1UW9A 2VQFK 3PRDA 3P3DA 2YHAA 3CIMA 3ASMA 1VOMA 4FBUA 2HNZB 4ECRA 4OPHA 3K57A 4KT0C 1J5OA 1WTBA 1JKHB 5BJRA 4B02A 1U25A 1J5OB 3G87A 1HJRA 3EN9A 3N5BA 1NJIT 2OZSA 2ZM6F 1XMOF 2X1GA 1F1BB 4K4XA 2MKIA 4CP5A 4TLRA 4IOXA 2OGUA 4WKYA 2O8BA 3CJRA 2RRNA 2XY6A 3PDNA 2HQIA 3NGYA 5KFOA 2JRSA 4FJIA 2V34A 2QLFB 2BJDA 2B6AB 3TZWA 2FYXA 3HSTB 3BGUA 3ZT4A 4FJMA 1N5TA 3CJ0A 3CSKA 4LF9F 1QE1B 2WZ1A 5L38A 2ZJRQ 5E84A 4YHHJ 4GMKA 3POTA 5A8WA 2VKRA 3HZGA 2BGGA 2G2OA 4LF6F 1MSWD 4CZMA 4P52A 4DR3K 3ZEUB 3DLKA 3FKBA 1TUWA 1TFWA 1CXQA 3G8SA 5ETOA 4RU2A 4WJBA 4C1NI 2CPEA 1BUXA 3PSFA 1X5TA 4QJVA 2N4CA 1FXRA 2F63A 4WBFA 4I1TA 4QU7A 1VQNN 2DXEA 3C3LA 2HHHJ 4OX7A 4O3NA 1IH7A 4DUTA 4G65A 2H9ZA 1YI2N 1RWXB 5ETNA 2B7CB 3A3PB 3FEXB 5CY4A 3J81U 5D4OA 1M5KC 5DS7A 1YI2S 2QV6A 2R7YA 4KGKA 1CC8A 1LNQA 5A8RA 4CWBA 4X64K 2E1ZA 4I6MA 1IN0A 4OGCA 2ZWPA 2MPUA 2GC8A 3D1QA 1YGYA 2NZ4A 4FLXA 4BE1A 5KFTA 4OVLA 5KG3A 1Y5LB 3KMSA 2VDHA 3N6LA 2Z1HA 1M90O 3FCWA 4ANCA 4CBUA 3TSQA 4TY8A 1DEJA 3HBTA 4DHYA 2RD5C 1KOOA 3OUYB 1Q82O 2VYPA 2HAIA 5GIPA 4IWVA 3UE5A 1CULA 3T1YK 4O3SA 3G4SS 3LO3A 2RU3A 3J81j 3W65A 3VHQA 3KLGA 3P8BB 4KPYA 3PW4A 4QW9A 3AVHA 2FVSA 3T5LA 1UPPA 1Y00A 2UXCF 4KTZA 1KQSR 1HWIA 1RDRA 1FNMA 3R8EA 3KD5E 4X4VA 2BV3A 2Z1IA 4A8OA 4GV6A 2DNGA 2H4YB 4RW7B 4DR5J 3VZHA 5DDOC 1JLBB 5FIIA 1RWKB 4IBNA 3GFZA 3Q8SB 5KFAA 4P2FA 3KWGA 2IIHA 3QT5A 2WVCA 3VF0B 4J2AA 4EFHA 4FWQA 2E2QA 2J5AA 3CPEA 2O3DA 3LALA 1V3ZA 3ZTQA 1KQFB 4Y34A 3DOLB 3JS9A 4DFJA 1E6YA 2BW2A 3O3LA 1FDNA 2FJXA 4X4NA 2HFZA 5AQXA 4FM0A 2OA8A 2D69A 1NJZA 4FXWA 1TL1B 1EAYC 3RAMA 2COLA 2W2MP 4R8UB 2A5XA 1WSEA 2JGUA 1S1VA 4LRDA 3S3NA 4F4YA 3AA9A 4EP4A 2DNHA 1B0TA 2E1MC 3UD3P 4U6PA 2HHXA 1U1OA 9RUBA 1X4CA 3CM6A 5LSOA 1VBZA 3L0QA 4QWEA 5IV3A 5KFQA 3NGSA 5EWFA 1SBRA 2KXHA 4F0KA 3HZEA 2AGQA 2DGXA 3DM2B 3UCGA 3J7ZO 4DPTA 1FXLA 4OJGA 4Q2MA 4NA2A 4CM2A 4ZVUB 4AXIA 4EZ9A 2OPPB 4B9MA 5F1XA 2OPRB 1F0XA 1X7VA 3DCAA 3Q8RB 2EG2A 4CLYA 4GV3A 2EFQA 4P10A 3U8XA 2GJ2A 2C2EA 2BE2A 2NYHA 4M1KA 3AV9A 4IFYB 4Y6IA 3ZZPA 5J1EB 3NWRA 2CPHA 5C15A 4DWIA 1VIOA 2W1BA 4CO5A 3NGTA 4E7KA 4USJC 3IA0A 4FLWA 1FK9B 5FPMA 3AQOA 2AJ0A 1R7IA 3AA3A 4PXCA 2OKQA 3KDOA 2BJEA 3CCQN 2HZAA 4U67Q 4WQ5C 2QMXA 3EMTA 4DV5J 3Q83A 3IWNC 2NXJA 2E2NA 4ZN3A 4NLBA 1OSCA 2L48A 4CLFA 4ZTJA 1VFJA 5E3PA 1H7WA 1PKUA 4JI8J 3CCZA 1JLGA 3BDEA 4NASA 1CC7A 1NNEA 4MYTA 2IM0A 2WTFA 2O8FB 2BX6A 4FM1A 1U0HB 1IM6A 1XNRK 3R9PA 2ASJA 1YTYA 3CCRS 3CDBA 2X51A 4LBIA 5ELZA 4GV9A 3DGPA 4J9RA 2HBQB 5AQHA 2WVEA 4JI6K 3M6XA 3HP6A 3V6HA 1R8CA 2LXIA 2ZGYA 3THXA 5RUBA 2J9EA 3MCOA 1P90A 4NYOA 1EO1A 1ICEB 2DGOA 1KKHA 4FJLA 2E9TA 1DJ0A 3W2VA 4USIA 2ILZA 1C1AA 1GLJO 1DRZA 4RWWA 2PMHA 1I94F 4YDDB 4ZPDA 5F0XA 3MM9A 3NNCA 2O5DA 2ZHOA 2R8GA 1GOAA 3JS6A 1S6PA 3NH1A 3UCUP 4F36A 2W8KA 1A5VA 3TU5A 4DTMA 5J2NA 2VFTA 2AGPA 1KBRA 4R25A 3ENQA 3KLGB 2KFYA 3LPYA 1XJWB 2XMUA 1TKTB 2ZH5A 2DPNA 3C15A 4X62F 4A8FA 5E26A 2B5JA 4CLLA 3SUPA 1QVGM 2O8DB 4JHDB 3CWJA 3BN4A 2FIUA 1JLBA 2X74A 2QLBB 1E6VB 2GEMA 5JLFA 2H4WB 3RU0A 2W7AA 3DU6A 2EW9A 3HK2A 3VQBA 1HHSA 4GO7X 4BC3A 1NH7A 2F4VF 4X66F 1SL0A 3N6NA 2OD6A 3KWIA 2ZH1A 1ZBSA 3VQSA 4RBUA 4X62J 2FY8A 3ENOA 4K0KF 3CFPA 3AVGA 3ISND 2AJQA 1YJUA 1MW7A 1KN6A 3B6PA 5HRNA 2ZKTA 3NGKA 5L1KA 2IFXA 1AB8A 3B82A 4X4OA 3A5LC 4L72B 4C3MA 5EOYA 3PHEA 1JCGA 5BYRA 4F3MA 2ZH2A 5KG6A 5CYMA 3CCSS 2XGPA 3N01A 1V6HA 4DV6J 4CVNE 3AAWB 3CJKA 2K06A 2M8HA 4W4MA 4L3QA 2DR8A 4FWLA 1KDNA 3PEHA 1RTIB 4OZ0A 2IMOA 2D9OA 2CDQA 1U04A 5M2PA 3JYTB 4OPAA 2NLXA 3PO4A 3TTFA 1G6BA 3GYXB 4BRHA 3QRQA 2LQ8A 3SDEB 2FHMA 2KHOA 5EUHA 4DSKA 2WBNA 4DV0F 3QEWA 7FDRA 1UCNA 3DRSB 4FJJA 1CJUB 2U2FA 2B8QA 2OH2A 4CO1A 3S3MA 3ZSYA 1RYRA 3M6UA 2K1RB 5KFLA 3OTOJ 4NXNK 4NCGB 2RRAA 1DQ9A 2NXEA 5AQSA 5DDRC 3T6BA 3L95X 4JI7J 3G6XA 1JL2A 3DLBA 3H7HB 4PQUA 4I7FB 3KZBA 1HARA 3W66A 1S1TA 5KG5A 3MN6A 1FJGF 4WFAQ 3H5XA 4WK3A 1LWFB 3HO1A 3DKDA 1S0NA 4LBPA 1BGXT 3PNIA 4WIQA 1BO5O 2XYPB 1CSJA 5JMVA 2ZZNA 3CJCA 3MI7X 2FHKA 4PZVA 3SV4A 1NDPA 2ZDPA 3BO2A 2WSCC 3DGPB 3GFHA 3LQVA 3GDQA 3I32A 2GHWA 3NNAA 1WF1A 4KAIA 2IM2A 3FQKA 3CPWR 4DG1A 4MFBB 3QEVA 5AQUA 3O4WA 1Q7YO 1K8AO 2CNLB 4Y0FA 1EWRA 3DRYA 4MFBA 3R7NB 3EGWB 1SVDA 2XQCA 1RTZA 2WONA 1TU0B 2QEXS 3PYDA 2UVVA 5FROA 3TAEA 3MM8A 4CYUA 3L2UA 4OHYA 2XGQA 5I42B 3PR5B 4OZ1A 5HVFA 1LW2A 2F8SA 3D0IE 1TK0A 4DSJA 3DLGB 2RQ4A 3IUCA 3IFEA 3OJUA 1GLBG 1FXDA 4M7XA 3VGVA 2RU9A 2JH3A 5ETQA 4C48A 3W8GA 5ETSA 1NK7A 3ID6A 4AH9A 4HH0A 4L73A 1RDCA 2HGMA 3HJVA 1TKXA 2R8HA 2ZVIA 2D74B 2W01A 5DGAA 1RBAA 4KE5A 3PW0A 2CQPA 1OH8A 4H5RA 2HSTA 3SK3A 1WDTA 2QFJA 3CDAA 4B08A 3O1WA 3C14A 3PRVA 5HVHA 2MSSA 3AB2B 4I0WA 5KT2A 1WG1A 4B3SK 2MYFA 2VC0A 1BOTO 2XG8A 1XUPO 3GFXA 3CCMS 3BZCA 3D7EO 1S4EA 5IFMA 4JV2A 2VU5A 1FW6A 3FJ2A 5F9LA 3D2FB 3ZC4A 4BC2A 1RZMA 3NVKA 3FMBA 1FRJA 3KLHB 2W41A 4IFVA 3MD1A 2PI4A 2Y3YA 3KLHA 4DR2F 3SQ1A 1HW9A 4E1JA 1VJQA 2YWFA 4UOFA 4YB7A 2UUAK 2CZ4A 4LVNP 2JLGA 1J5EF 3JTNA 3EGNA 1I1GA 2PSZA 5KPTA 1EX8A 3GCXP 5CH7B 4JI1F 5BPMA 1NKBA 3SPYA 3MEDB 3GJRB 3R3LA 2LA4A 3RRHA 3GIKA 3E2EA 3IWLA 1PJ5A 2HIQA 2FTRA 3CC2N 4A5AA 1NSKL 4JEPA 4LIRA 2E5LF 2DNZA 1BU6O 3CW2C 1KQSM 2P9LA 4J7CA 3A3NB 5D15A 5DJBA 4DF8A 4P72A 1V5VA 4JI8K 4V19X 4MLEA 3I0RA 2RQKA 2AP1A 5EX3A 3AD7C 2FSNA 4DU3A 1RI7A 3B78A 2PFDA 1NJXA 4OJ3A 3Q86A 2IJRA 3KHLA 3AXMA 4DR4K 1WHWA 5IC4B 4N5SA 1Q8BA 5B8HA 1R6YA 4Y2CA 1S0MA 4JYAK 3M32B 4M41A 1RT2A 2N4DA 1HMVB 3CJQA 2VICA 2QA4G 2YX6A 4OI6A 3O5TB 3OFFA 3ZTRA 5DDQC 2P9UB 1S49A 2DHAA 3U7JA 3BY5A 5LJVA 1EKSA 1H73A 2I38A 2VZ9A 1U1KA 5IWAJ 3THYA 1HBOA 4RW7A 3CJ3A 4DL7A 1S5ZA 1QLNA 1KEKA 1EJ7L 2GHPA 1IKWB 3MWTA 5AE2A 3SXLA 1HNWJ 3NGRA 1F3FA 2AQ4A 3ICLA 2P9KB 3CQYA 1ZAXA 3CCES 4O23A 4LC9B 5DMRA 2DYAA 4A8KA 1VR6A 3FZFA 3PSIA 4B3MK 2LXUA 4UUWA 3FCVA 1RBUA 2UXBK 4ATNA 4ZLPA 3WQPA 1TP7A 3OS1A 2BUPA 3ZZOA 5IWAF 2WONB 4HDGA 3Q7BA 4DL3A 4JI5F 4R8UA 5M1NA 4YP3A 3KHRA 2OI2A 3RW7A 4E7JA 4OMFG 1I6JA 4AF1A 4BC5A 3A1YG 2AWZA 4U8YA 5M1FA 3TSPA 1HR0F 2MB0B 1TKDA 3BUZB 4CEEA 4KHYA 1FJEB 1NHVA 5LL6Z 4A62A 4FO0A 3V5RA 5AFUA 1DURA 3JAMO 4CCHA 4HUFA 2E5JA 4KHQA 3VQ7A 4YN3B 2CWKA 1S12A 1CQNA 1YITS 2CGKA 1SB6A 1EETB 3F41A 2CQGA 1TV6A 2HYIB 3CDWA 4B3RF 2NRWA 1IBKK 4FYDA 2G0CA 2CQCA 3OYMA 1HQ2A 1FNXH 2J9CA 1NMDA 1BIZA 2NXNA 2Z2ZA 4IH5A 2F1FA 4PWUA 1REVA 2X3DA 1WB9A 3LP2B 1KVAA 2BACA 4DV6K 1U6ZA 1FKAF 4CGIA 4C11B 9ATCB 2DO4A 4M8LA 2ZD1A 4EZ6A 4CO0A 3AVAA 5F9NA 3PW5A 4A8MP 4DV7J 3LAMA 1WF2A 4NA3A 3EE8A 3SUQA 3GR1A 1XMQF 2KYZA 3O9SA 1BG3A 4HACB 4LR8A 2DR7A 2Q3SA 2OCEA 1WC3A 2OJ3A 2HBLA 2ZC3A 3AVBA 1PC4A 4FNHA 1LK5A 4EK2A 2QYCA 1VSMA 4JKEA 2YJFA 2D1CA 1BE4A 1AUSL 3OR2A 1RA6A 3ZNUA 3DXBA 3ZYYX 1TK8A 4I2PB 2KKZA 2PD1A 4DS5A 4JD2B 3ISNC 4MMOA 3OYIA 2UUAF 3NE6A 3R6LB 3I0RB 1IV0A 1ZA1B 1D1UA 4NXNJ 2QSFA 4ZCLA 4F0MA 5BRHA 1UEUA 2V2KA 3J80Y 2DXDA 2R7UA 2MZSA 4CLSA 5GAHP 1T44A 2XLIA 2V4QA 2ZE2B 2R8IA 5LMUF 4W92B 1C4CA 2V52B 2C1EB 5KRTA 4DZ6A 3KWMA 3RMCA 3SCXA 3DXKB 3V9WA 4FJ8A 3ZZRA 5AQZA 5ETMA 2W6LA 2NQPA 4HWIA 2IBKA 4Y28C 4DX7A 2VH7A 5U47A 2VONA 1O13A 4E3SA 4L75A 1U2FA 4ZA1A 3TAFA 4B1UB 1Q9YA 4F2RA 3BO4A 1N32F 4JP8A 1S9GB 2M4MA 2L9WA 4IOAL 2AX1A 5GMKa 2LECA 1DY3A 3J80O 2HQ3A 3HJFA 1HW8A 1HNIB 1SJ3P 2VOOA 1HX1A 4OLBA 2KZMA 2IJFA 3DOLA 5C24B 3JQMA 3ZX0A 2D3UA 4HT5A 1O1WA 4YR2A 2FHOB 5KFGA 2XLJA 2GBZA 1UEKA 3MAHA 1WOSA 2DITA 4ED3A 4FJHA 4KHPK 1VCTA 1DFDA 4BRFA 2JWNA 1Q7LB 1YRTA 1RHUB 2HVHA 1D0EA 3F2KA 4DQQA 4WKRA 1Q4RA 1G3OA 1KP6A 3KYLA 1KC8T 4KGMA 1VQ6N 4N77A 5B0CA 1HIYA 4B3SJ 4H5WA 3KXDA 4DTJA 3K58A 2YKQA 3NAHA 2C3PA 1ZS6A 3MECB 4ZVOB 2LEBA 1G1XA 2DHGA 2CJBA 2WOMA 1HHQA 2ZFHA 2Y1IA 1RSCA 5B08A 1BMQB 4OJRA 5TKWA 3H46O 3IGNA 4CHPA 2UUBK 4WQ4C 2Q66A 4Z0UA 1BD6A 2EFVA 1Y7PA 3ENVA 5CA5A 3PYFA 5CCMA 1PBUA 3BO3A 2HGNA 2JLFA 3NS6A 4DTOA 2BE2B 3GP9A 5BXIA 1ATSA 2P9NB 1S1UA 2QWLA 1FHTA 2UV8G 4CGHA 3IS9A 4QWAA 2NUHA 2N7YA 4NCGA 2LKZA 1Q16B 2IM1A 1SJQA 4RJVA 4FS2A 1KLMA 2FZGB 5KAKA 1WOOA 3G82B 2JEIA 1VQ4N 4J2EA 4YB5A 1RWWB 3ZFVA 3OXFA 4GKJF 2VFVA 4ID8A 2SXLA 4QR2A 2I5JA 5KFPA 4JKDA 1NJWA 1FT8A 1YVUA 4RW8B 4A8SA 2YKPA 4OZ2A 4FM2A 4ED7A 2HEKA 3K5LA 4HACA 4LFBJ 3OXGA 2D0OA 2O1PA 1KR4A 1T0TV 3O80A 3HHKA 4V1Ak 1RFQA 3V81A 2EBEA 4FVMA 3AAQA 1XI1A 4P73A 2BJ7A 3TA0A 4LH4A 2U1AA 1NKEA 2Q1NA 1C1BB 3QJLA 3U27A 2R7VA 4BGBA 4L74A 5B7WA 4C8NA 4HHTA 4PAAA 5A6PA 4ZCIA 1T05A 3T6JA 4CNYA 3SYZA 2HSEB 3QNNA 2C3MA 2IGIA 3N5FA 5LM7E 3VGKA 1XIQA 1WUAA 2HFOA 1VSFA 4J9PA 3P38A 3CERA 1SL2A 3DM2A 3R2DJ 1R8AA 2QRRA 2PA8D 4OZLA 3FZMA 4A2AA 2H5EA 3K89A 3OSPA 3H3NO 4CJ5A 3GCWP 4NRTA 3HPHA 2F4FA 2V5HG 3FFKB 4BRCA 2A42A 3OUYA 4LFAF 2HBMA 1F5CA 4K0KK 3Q22A 1HQEB 1UZDA 5I3QA 1L3UA 5AZIB 2Q2RA 1T3OA 5KFSA 4F25A 1CEZA 2NXCA 4DV1F 3QJPA 3O08A 4FKXA 1BI4B 4LF1A 4B17A 3TI0A 4QIEA 1Z1ZA 1IKVA 5AZJA 3BEGB 4CFCA 2DNRA 2M5YA 1HWKA 3MMAB 2B5JB 1Z26A 1A0OB 2P9IB 3DXMA 3VGMA 1S6QB 1RISA 3CIZA 2Z57B 1MROB 2ZQBA 2RHSB 3I8DA 2O8FA 4JI0K 1QM9A 4NPOA 4PKHA 4I69A 2E5HA 1WNEA 2UXDJ 3AA4A 3MURP 2WUSA 4AHVA 1VQPS 4CH1A 2Z2LA 1VBYA 1UVIA 3KHHA 3FSIA 1HNIA 4NLSA 2O67A 3NH2A 3O44A 3PRBA 4IO9L 4J90A 4ZP9A 2IJNA 4N47A 2KQ2A 3U1LA 2FVCA 3NCRA 2H65B 3BBFA 4FLUA 1B3TA 1ZXOA 1WF0A 5GADU 3O4QA 5HRPA 3HOTA 3VQDA 4DBQA 1TELA 5KFFA 1IM4A 3VGSA 4H4OB 2GGPB 4LFCF 3VQ9A 3FVYA 2IVOA 4XK8C 2QA4S 3MM9B 5KFEA 4LREA 3P4UB 5AXLA 3CDUA 4C0OC 2AMCB 4XPEA 3Q2SC 2M70A 2GAGC 1ZBHA 1G7CB 2RDIA 1HPZB 2V67A 3JAMU 1H3DA 1CPZA 3C6UB 2YPZA 1Q53A 3AD9C 4NA1A 1XR5A 5GMEA 1IKYA 1PO6A 3EWGA 3WX8A 1JLCA 4KI4A 4N41A 1RWPB 1G15A 4DV0J 1BQMA 3SAFA 5DQIA 2O8DA 2D7SA 3MPWA 4AL7A 3EZUA 3W8PA 3VMFB 2YHXA 2V6AA 1VI7A 3BR8A 2J6UA 2F4VJ 3MM5A 2IYIA 1E6VA 4PPDA 1GMWD 4BC7A 1GLCG 3ZT0A 1HR0K 3R9LA 4MK7A 2CPIA 4OYZA 3AVIA 3AD8C 3CGIA 3ZZZA 4CJRA 3UD4P 2YWGA 4KB1A 3ZX2A 1A9NB 4USHA 1RT3A 2V7YA 2W2NP 2W2PP 4BRDA 1S79A 5K5MA 3KG0A 3ZTSA 3BP8A 5LT5A 3EX7B 4LF7K 1TL1A 4CLUA 1RUSA 3A5MC 4LF5J 3HHLC 2OLWA 1QJHA 1CS4A 1IBLJ 1NRKA 2DO0A 2ALZA 1JXEA 3OR1A 3UI3A 4DV3K 3UKRB 2DNNA 2A0FB 4OZJA 4GW6A 4JYAF 5T14A 4PG4A 2QKKA 2X7IA 2RSQA 1DTTB 2WC9A 3HFZB 3O9TA 4FYWB 3FBFA 2W9BA 1KWMA 3TRGA 4IDKB 1UW4A 5C2DA 1GMWA 3BM7A 2PI5A 2FZCB 3WQTA 3TWHA 5HROA 5AQNA 2KH9A 4PXEA 4YNQA 1GTEA 1LXJA 4NRUA 4NYFA 5HROB 2VODA 3PTWA 3UNYA 4G1QA 2LMIA 1VQOS 2LQ5A 3KK1B 3MUTP 4PL8A 3QQCD 4OZ5A 1Q86T 3UO0A 3FSXA 1RU2A 4CJSA 2GO9A 2MKJA 3NOCA 1VSDA 2KU7A 1FXXA 4F4KA 1KXPA 5AZJB 1RAJA 2CQBA 2HHSA 3F44A 4XH4A 4LIWA 1LAVA 1DARA 1ZETA 4DR4J 4CJ7A 3TAQA 3M9OB 3MPVA 2B0GA 1S0VA 4M3XA 1HKCA 2DGVA 2GO8A 2MEWA 3ULDA 3QGIA 3QSYB 2ZD1B 2HLTA 5HMZA 1JLFB 3L7UA 5A6WA 3LUYA 5D4PA 4NZ7A 3ENHA 1FX4A 3OYGA 4OJ1A 4X65F 5J1NA 3AHPA 1EHWA 4ECTA 4E7LA 1RWUA 3H2UB 1IUJA 4QQBA 3KKSA 4GKJK 2VG7B 4EBCA 2BOPA 1H72C 1LQ9A 4OPKA 1NGIA 1I39A 3R1LA 5E2QA 3QO9A 4ECUA 2E1PA 3CI5A 4ZJLA 3LP3A 4B3MJ 3QO9B 3TABA 2W4DA 2QZ8A 1AXQA 4C97A 2BE7D 5KPRA 3V9ZA 3G6ES 2F9WA 4NLQA 3QFHA 2YHWA 3DLGA 2M88A 3HPOA 4FF1A 2XBPA 1HQUB 2H51B 3D5MA 3LGHA 5AQMA 3DLLQ 2ZVSA 3J81Y 3UDVA 1KS2A 4Z7CA 4YEAA 2KB2A 2CNKB 1C6VA 4WP8A 1OKJA 3MPYA 2X78A 4USMA 2XY7A 1R0AB 2XNRA 2XS2A 4FK4A 4YHHF 1V4TA 3MCPA 1VQLN 3M30B 3GV8B 3ZLJA 4KO0A 4DSIA 3CNQP 3K9JA 3SAHA 3ULHA 3M30A 1K0VA 3KJVA 3KOAA 3OHAA 4A8QA 5CZ2A 3DDKA 2HMIA 2NNWA 1EB0A 3M8PB 1SI9A 2UVUA 4RW6A 3VQTA 3WXKA 3MOZA 3MZIA 4F3QA 2RIJA 1NK9A 5CQGA 4DB3A 4DR2K 1SC4B 5HBMB 1IBMF 4JV1A 3AVJA 2HHTA 4B9LA 2YTCA 4J9OA 4N8NA 5AE3A 1J5EK 1OQ6A 4JI4F 1NGHA 3F9KA 3E66A 3CC2S 2AJ2A 4U7CA 1EARA 2ASDA 4BRLA 3VGLA 1GH8A 2FXUA 3ZSOA 3A8IA 3KG4A 1AZSB 4FJ5A 3M8YA 3EL2A 3SQGB 4IDHA 2YJEA 4KAZA 1Q78A 4KHMA 1CZBA 4DUZK 3WEEA 4TKTA 3EXYA 1RT4A 2A3ZA 2CVEA 4PKDB 2QA2A 2GX8A 1SKSA 3O4NA 5KFDA 1N48A 3SMPA 4J37A 3G25A 1OWXA 1VRQC 4RUAA 3K5PA 2XMVA 4A8XA 3V6JA 4DEZA 3DOKB 4DQIA 2VG6B 3QESA 4M3ZA 4JAXA 2FJVA 4DS4A 3NBPB 3U3YA 3GG4A 2NR0A 3JSMB 1TMMA 1YIJN 1N33K 1X3NA 4LF7F 3U1NA 4ECZA 1CXUA 3I96A 3SMZA 3PW2A 3A0IX 1E4GT 2N3OA 4BR5A 3QSIA 1BQNA 1Z6RA 1HNZK 2VFSA 3MFIA 1S1UB 1C0TB 1BQNB 2V8DA 3LANA 3UR0A 3L6QA 2GVZB 3W62A 2VG5B 3HP9A 3RBZA 2EFPA 2XY5A 3IAYA 2C2NA 1KLMB 1EIYB 1ASWA 2WBRA 3LW5C 4QAGA 1CG2A 1NGGA 3LP2A 1AYEA 3QB0A 3QICA 1BHNA 2QXFA 3G0ZA 4CO4A 2DFEA 1TVRB 3B4DA 3B4MA 1JLFA 4HLBA 4LH5A 1NDLA 2GQCA 4TU9A 4IFVB 4IOAQ 3BF3A 4ISFA 3SZ2A 4DG1B 1HWJA 2ZZMA 3NDKA 1WWHA 1KVCA 2LU1A 4A8WA 5KTQA 2YKAA 4YOEA 4RW4A 1WNSA 1VLYA 1ESVA 2FSKA 2YKOA 1EQ0A 3C7NA 1FDBA 1PBAA 4BBYA 2QLJB 3T1YJ 1RAOA 1S76D 1F9FA 2BYCA 3MCMA 5EY4A 4OX9K 1RQ0A 2F4VK 1LAWA 4FLVA 1W7AA 1VQ8S 4MTPA 2KT5A 4KHUA 3HOSA 3HHNB 2HQCA 3IP0A 2OAUA 1KFSA 3JSYA 4Q7AA 4JI6J 4Z4FA 4LF6K 2HBKA 3QPIA 2UV8A 3D0HE 4JOUA 3D66A 1U1QA 4IO9Q 1UTAA 3NAIA 4CRJA 2VD3A 4FKYA 2OPRA 1S1WA 3BZKA 1TR0A 2QM1A 4M3RA 4BRIA 5HO4A 2Z58B 1NGEA 4AQYJ 4CFAA 4Z7YA 1XNQJ 1W97L 2RMLA 2ZBIA 4MLHA 3DXSX 3D0GE 3PLAA 1QQOA 3SQ0A 4FK2A 5AQRA 3A8JA 3TR8A 2MQOA 3VEYA 4CJQA 3QEXA 2DFHA 3EUNA 1VGYA 4JB8B 4QYZK 3BGFA 1CLQA 4B1XB 1O8BA 3QATA 2WK4A 4FF4A 3DXMB 4AUKA 4TYAA 2I7PA 3L4IA 1RBRA 4BCAA 1R0CB 2I7NA 5TKYA 3B8AX 1RA7A 1ULRA 3GWCA 1KC8O 1ZZNA 1IBCB 3PJWA 1SIZA 3KJQB 1V3RA 1RP5A 1NXIA 4X2BA 4JUZA 2O8EB 2HURA 2RKIB 2MQNA 1KD1O 1U09A 3HI9A 3OLAA 1HJOA 1IBKF 2AJ4A 1RKJA 2V8PA 5A2QU 3OD2A 2FQQB 2A2DA 4OKJA 2RNEA 4K2JA 4DMZA 2X3GA 4ZP8A 3FE1A 3CYMA 1QSLA 2FGCA 1QAXA 4JD2A 1NPPA 4DR7F 3HTVA 2DTUA 5KOXA 2E5IA 3MM6B 4H4OA 2GGPA 3V1OA 5HMWA 4DV5K 3HX9A 4F0HA 4AYBD 4DPXA 4CGDA 1FEHA 2GNKA 5F3ZA 4LFCJ 3M3ZA 4B3OA 1QVFR 2ITGA 3QZ8A 3S41A 1SL1A 2AYBA 1SQGA 1G2EA 4CJLA 4K7QA 3PYEA 4ENOA 1WC0A 2BOAA 5JJBA 1K73T 3L4BC 1H2UX 5KGWA 4JI5K 4W5OA 5K9FA 1VISA 5D6GA 2F9DA 1XNRJ 3D2EA 3QZ7A 2XHBA 2LQ9A 2XEXA 3QWUA 2HS4A 2QWPA 3TZZA 3H4BA 3AQPA 4DUYK 4BE2A 3MTKA 3THYB 2QEXN 2ZNYA 3S6EA 4M5JA 1TFYA 2AT1B 4I6WA 5M1OA 1YBUA 2ZOMA 1RWVB 2ZH8A 4YORA 1R27B 2GWJA 2O01C 1ZZFA 2FZKB 4ZLJA 2HRYA 5J2QA 2CYYA 2GIQA 3PZPA 1NZAA 2K3KA 1NB7A 2QIFA 3AA8A 4GKJJ 1T3NA 4JI2F 2QGFB 3BSNA 1U45A 3CO0P 2ROEA 1DLOB 1EQMA 1WEXA 1WDDA 3T7ZA 4DXLA 4B3SF 2GUIA 1H2TZ 4YDXA 4ISGA 2EFNA 5BYQA 1SUQA 3VF6A 1X5OA 2AX0A 3UR3C 3OHRA 3CCVS 2R2SA 1C2PA 1FWKA 4C0HA 4NLYA 2B8PA 1BY9A 2PT0A 1HWLA 1A5XA 4JKFA 4J9MA 4Y2KA 1K9MO 2G8HA 1U8WA 2DHSA 1L5UA 1C0GA 5D0GA 1C0FA 2XWYA 2PIIA 4OL8A 3T5KA 1TKZB 2MJUA 5CR4A 2G0JA 5AXNA 2P9NA 3CD0A 2CZVC 4IFEA 3I6PA 2LCWA 4JV5J 5AQLA 1X4GA 2DNKA 5E3RA 1MU2A 2QMWA 5GAGI 2RILA 2O66A 2H48B 4K8RA 4JRQA 4BREA 4DU8A 1LEOA 2PC6A 1CJVA 5KG1A 4J91A 2BJ8A 3DXKA 3GYNA 1RDUA 4FN5A 5EX5A 4UOCA 2MTLA 5LMNF 3WNEA 2EFOA 3LGNA 3FDSA 3DLKB 3IG1B 1EKRA 1RCOB 1ZTWA 5BPLA 2RJZA 2QTWA 1YLXA 4CLKA 1C0MA 3CJAA 3H5SA 2RVJA 3WNFA 1S4FA 3NG8A 4EO8A 4CLPA 3UD5A 4AFFA 2W40A 3H8YA 4HHUA 3NAEA 2VWJA 1JXBA 1SV5B 4B8AB 1L3TA 4BVOA 3MXJA 4OYIA 1TUUA 1QAJA 2LVWA 3KMQA 4E7IA 3A2FA 2FHJD 4ILJA 3BKFA 4ERDA 5ADXH 4I2PA 3TR5A 3ET6A 4NB4A 4P2MA 5E3QA 1HI1A 4WQ4A 1HNZJ 3U9ZA 3NCPA 1WHXA 3PIPQ 4FJ7A 3RB0A 3IXQA 4ETZA 1C1CA 2MKCA 3G6YA 4PKIA 3W9IA 1HBMA 3MMJA 2LFVA 3BKUA 2MQPA 3BGLA 3PCOB 3ZT1A 3OTEA 5A76A 4FWRA 5F8GA 4TSXA 3O3FA 3VTHA 5HVGA 1UJ4A 2K3IA 1HQUA 4K4TA 4PG6A 3CQXA 4CZGA 1W7WA 2UUCK 4KTQA 1O51A 2D3OR 4WP3A 3OYCA 4PCQA 1VQ7S 4ZJQA 1K47A 4NLVA 2R7WA 1U47A 2BJ9A 3OL6A 3PJ9A 3CD6N 3WC2A 4YY3K 1WC5A 3VESA 2ZJRL 4DTSA 3M8QA 5I4MA 5A2QO 1S10A 4IRCA 3CCLS 2MQLA 3C95A 3C65A 4DSFA 3RB4A 5KQDA 2GV1A 3E8OA 3E9LA 7AT1B