1FKOA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkoA05
3I5CA 3F9KA 1DLOA 1ZBFA 3HPOA 2OYQA 1C1CA 2HW3A 5KFBA 2AX1A 4EBCA 3VA0A 5SZTA 4Q5VA 4EZ6A 1RBUA 3LZJA 4DFKA 1D5AA 1LWCB 3CJ2A 3IN5A 1S0OA 1RDCA 4DL2A 4FLZA 4EZ9A 1S1UA 2W9BA 1S5JA 5FRMA 4TY9A 3PW2A 2PYJA 4E7JA 3VQ9A 2HMIA 4CERA 3PR4A 1S1VA 2XI3A 4DQPA 2HHWA 4BDZA 4O3QA 4LQ3A 4M42A 3KLHB 1Z4UA 3G6XA 2Y1JA 4E7LA 1KSPA 3AA5X 2BGGA 1N4LA 3UQSA 3K59A 3LP2B 1IM4A 3V6HA 1L5UA 4IKAA 3V4IB 4DTJA 4CEAA 1YVFA 3VQEA 3EZUA 3OYHA 2YNFB 5L1IA 5CZ2A 1U48A 3OY9A 1N6QB 3H40A 2XWYA 4XPCA 1S6QA 1QAIA 4QWEA 3LALA 4ECUA 2IAJA 4CJ5A 2VG5B 4WZMA 1GOBA 3WNEA 2F8SA 1RTHA 3TVKA 5KFVA 2UVVA 3MEGA 2XCPA 3PY8A 4Q43A 4IFYB 4CGFA 3QEWA 1QSSA 1RAJA 4TYBA 4BE0A 3GILA 2E9ZA 4PQUA 4H4OA 2WHOA 3BGRA 3DMJA 1HNIA 1TL1A 3S9HA 4B9TA 4M94A 1JLQA 3BSCA 4RW6B 4FYDA 2D3ZA 4FVMA 3WNHA 3HPGA 2QXFA 4FW2A 4CGHA 1SV5A 3RRHA 4E3SA 4DQIA 2ASJA 3OHBA 4DS5A 4KSEB 4NLOA 3KLFB 1JIHA 3NFAA 2OH2A 1TK0A 3U3YA 4J9PA 1LV5A 2AJQA 5KFMA 5SWMA 3OVNA 4DSLA 1FKOA 2C2RA 4KKOB 3V9WA 3TR8A 4E1MA 1DTTB 2X6NA 3ISND 5EUHA 1LWEA 2C22A 5KTQA 2B43A 3JYTB 4K4YA 3SV4A 3KK2A 4G1QA 3QERA 4B9SA 3PX0A 4JS5A 1RDBA 3PX4A 3WNFA 4M3TA 4DF4A 3OYJA 5HRNA 4AILC 3SNNA 4AHUA 1TK5A 5L1KA 4CJKA 1BQMA 4YNQA 4O55A 2BQRA 3FRZA 1Q8IA 1GOCA 3CG7A 1RDRA 2OZMA 3TAPA 4F50A 4ZTFA 4WYLA 1RT4A 3RMAA 1WSHA 2XY6A 4NLVA 4AHRA 4FZXC 1JLEA 5KG0A 2RDIA 4QWCA 2FVRA 2JEGA 2ITGA 2PZSA 1NJXA 3DLKA 1D9DA 5C24A 1RT3B 3ZSWA 1TKXB 4IQXA 5KFIA 5D3GA 3AVKA 5EWFA 1TVRB 1NHVA 3ZCMA 1KRPA 1RA6A 3MFHA 4DFJA 4KHNA 3LANA 3FQKA 3TAFA 2BE2B 4B9LA 2YHAA 2XY8A 2YNGB 4MKBA 3N6NA 2XHBA 4CIGA 3IG1B 3QGHA 1RBRA 2ALZA 5KFEA 4K4TA 4IR1A 2RN2A 2WRMA 3NF6A 1IKWB 1LWCA 1U4BA 2G8HA 3AO4A 4K4ZA 3SPZA 1NK0A 3KD5E 2EX3A 2RF2B 1S6PB 4RW9B 1S49A 3ICLA 1W25A 2IM2A 1D8YA 2G8VA 4YQWA 3LDSA 3KLHA 4KI4A 3K57A 1JXBA 2IDOA 3LP2A 3QYYA 4KHQA 4CJLA 4E7IA 1WSJA 3V4IA 4DU4A 1CZ9A 4C8LA 3CFPA 2KFNA 5KT3A 2YNFA 3DRPB 1N6QA 4IH5A 3AA4A 2VG7B 1N5YB 4AHVA 5KG3A 4CJVA 5KFTA 2VG5A 5JXSA 3BQ1A 1TP7A 4CIEA 4GW6A 2R8IA 3QNOA 1XI1A 4CF1A 4F2SA 3KTQA 1XR5A 4JRPA 3FFIB 4IFYA 3K58A 1QS4A 2UVUA 4IDKB 4GC6A 3PW7A 4E7HA 3DDKA 2V4RA 3N6MA 2C2EA 3C6UB 4KO0B 5C5JA 3DRRB 2BQUA 5KFKA 3L3UA 3K2PA 3RBEA 2ASDA 1QUVA 5F9LA 3HJFA 3I0SB 3RB4A 4NLRA 4CEOA 1KLNA 3E51A 1RTIB 1JKHB 4CF9A 4PUOB 5FDLB 4IBNA 4FK2A 3NF8A 3SQ4A 2UUWA 4URGA 4FJIA 2FLNA 3KKSA 3KLFA 3U3GA 3OL7A 2I1RA 1U09A 2G8FA 4LSLB 3MXJA 3AVNA 4KKOA 3TQ1A 1K1SA 1DTTA 3VQBA 2ZE2B 4K4UA 3QESA 2UVRA 5KFUA 3L3VA 3CIZA 4IG0B 3JYTA 4RG8A 4FLXA 3OS2A 3KJVB 3KKRA 4ID5B 4CJRA 3TAGA 3MECB 3H2LA 4DLGA 3SV3A 3RTVA 4M41A 4J9SA 1JLFB 4XO0A 3DLRA 3V6KA 1QSLA 3H4BA 3QGGA 2P5OA 3CDUA 5JUMA 3ZT4A 3AVAA 2HVIA 4RW4B 1RDDA 3HT3A 4FLVA 3AO1A 3AO5A 3KK1B 4Z0UA 3PO4A 3FDSA 4N41A 3QIPB 4WFYA 5DLGA 1BGXT 1JLAB 5KFOA 1WNEA 1NKBA 4I9LA 3LP0B 1Z25A 4DTXA 1U45A 4FJ8A 3EY1A 1ITGA 3QZ7A 4YFUA 3PZPA 1VSHA 2ZD1B 2OPRB 1WSFA 4CK3A 5DGBA 3V9SA 1RT3A 2YKMB 5F8GA 2EHGA 1TKXA 4EO6A 3ASMA 1C1AA 1L3SA 2BDPA 3CJ5A 3MR5A 4GMJB 1HYZA 4LH5A 3S3OA 3L2UA 1TVRA 1J9AA 2J6TA 3DOLB 3TAMB 5KFDA 3L2WA 2PYLA 5F8IA 2F8EX 5KI6A 2E9TA 4KPYA 4ZPBA 4O4RA 3ZSZA 3GV7B 4CFBA 3OJUA 5FROA 2BE2A 4ZPCA 5CY4A 4UQGA 1S1TB 4WFZA 4U6PA 3AVJA 1S9GB 3AVHA 4IOBA 1A5VA 1ZTWA 2YNGA 3G6VA 3OHAA 3NDKA 1B9FA 2F96A 3OJSA 2LSNA 1CLQA 4WYWA 3IRXB 3IG1A 4CIFA 4CJPA 3RRGA 4J9RA 4FBTA 1IKWA 3DLGB 4Y1DA 3ITHB 4DU3A 4ED8A 4RNHA 4K4VA 1MMLA 4DTSA 2RF2A 1S6PA 3H5SA 4CHZA 3KLGB 1ZTTA 4RW9A 1YT3A 4FM0A 1SL1A 3MXIA 4URQU 4CF2A 2R8JA 5CZ1A 4ZP6A 5KFSA 1TAUA 2IMWP 2D0AA 1C1BB 4DMNA 1JX4A 1HNVB 2PY5A 4ECXA 2KFZA 4OVLA 4ZVFA 1RBTA 3MAQA 3DRPA 4DSEA 3H5UA 2B5JA 3D5MA 2VG7A 4BDYA 4NLWA 3P83D 1N5YA 1G15A 1TK8A 4J9NA 4XIUA 4BDPA 5KFQA 4KTQA 2QK9A 5CYQB 5HP1A 2KQ2A 1C0TB 4AHCA 3I5AA 4Q8FA 4WXWA 5J2NB 4FJXA 3MF5A 1X9MA 4M3UA 3FFIA 1S1XB 4RW7B 4DG1B 4MFBB 4TYAA 3DLBA 4YR3A 4DS4A 4N76A 3C6UA 4KO0A 4FXDA 3DRRA 3NGDA 3ZT3A 3T19A 2XRIA 1NOYA 2FVSA 1YVUA 2OA8A 1TGOA 3I0SA 1RTIA 3LP1B 1JKHA 1NK4A 4OL8A 1BISA 2EC0A 4DTOA 4PUOA 4LQ9A 5FDLA 4YP3A 5DQHA 4J9KA 3CFRA 2I5JB 5KFRA 2Y1IA 5J2QB 4LD0A 5DLFA 1T8EA 4NLPA 1U49A 3O3HA 4OPKA 3ZSOA 2P1JA 4CEBA 3DM2B 4X2BA 3CDEA 4LSLA 4ECZA 2V9WA 2IJFA 3TABA 3SFGA 2ILYA 1IG9A 1D0EA 1RILA 2ZE2A 5KFNA 2IBKA 4ELTA 3LPTA 4KHMA 3ZT2A 3OL6A 3PUFA 4IG0A 3M8PB 4LSNB 3KJVA 3L2RA 3MECA 4NYZA 1NK8A 3V9ZA 3G10A 4K4SA 3CDWA 4KREA 5T7BA 2Q3SA 3AO2A 2V4QA 1JLFA 3OYFA 4KHSA 3VQ6A 1RYRA 3I8DA 3SZ2A 3RB6A 3T5KA 2W8KA 4M3XA 4RW4A 1B9DA 4W5OA 4C8MA 3KK1A 3VQCA 3NL0A 3CO9A 4DQRA 3AA3A 4FJJA 1X9SA 3M9NB 1JL2A 2IOCA 4FLUA 1A5XA 3QIPA 3DLEB 4DSFA 5KFXA 1KHVA 4QWDA 1NK7A 1JLAA 3LP0A 2W7PA 1RA7A 1L3UA 1IKXB 5KFFA 1JL1A 3K5OA 1DTQB 1T7PA 4C8KA 4CJQA 4Z4FA 4ED1A 2ZD1A 2J6SA 2OPRA 2YKNB 3NAHA 2YHBA 2YKMA 4U7CA 1VRUB 3H4DA 3HPHA 4CJEA 2P5GA 4OLBA 4KBIA 1TKZB 5HROB 3Q8RB 4CFCA 1KFSA 1RTJB 3OYKA 1A5WA 3DOLA 3TAMA 2FVPA 4EP4A 3AVCA 5CYMB 1MU2B 2ZQBA 4DTPA 4DLEA 3MR3A 2XY5A 4FJMA 3OLBA 1NK5A 4OGEA 1T94A 1S9GA 1QTMA 1BI4B 3OYIA 3PVXA 1SL0A 3PJXA 4Y34A 3SI6A 3VQ5A 4FJ9A 2DY4A 3HKWA 3NGYA 1HQUB 4ELUA 2JEIA 4JRQA 1RT7B 3IRXA 3C6TB 4K4WA 3A2FA 4FS1A 2JGUA 4DTUA 3DLGA 3C95A 1NK6A 4Y2CA 4R8UB 3ITHA 4TXSA 2WB4A 4W5TA 3IAYA 1BL3A 3BREA 2HWIA 3PW5A 3KLGA 3KMQA 3OYGA 3L2QA 3LAKA 4Y3CA 4ZPAA 3KMSA 4M3RA 3THVA 2ZKUA 4B08A 1S1WB 4FJGA 4IRKA 1C1BA 2QV6A 5KFHA 4ED0A 1HNVA 4OGCA 1YTUA 4F4WA 3D0PA 4ZP9A 5KT2A 4MIBA 4B9NA 5CYQA 4I2QB 3CVKA 3V1RA 5EDWA 1C0TA 4QAGA 2WK4A 1TKDA 4CGDA 3NGZA 5J2NA 2HHQA 1SH2A 2HNZB 4Q44A 4ECVA 5F8NA 2G8KA 2R2UA 3TAEA 4TY8B 1S1XA 3NCIA 4RW7A 4DG1A 4MFBA 3K5NA 4EO8A 5KFCA 3LWLA 1BQNB 1RCHA 3KLEB 2E6MA 3HXMA 3HVTB 4NCBA 3VQSA 3SJJA 3PR5B 3OYDA 1WSEA 3LP1A 4M3WA 4Z4EA 1R0AB 2R2RA 3B6PA 2F8TA 5I3UB 1RT2B 5HRPA 4DQQA 2I5JA 2ILZA 4C8NA 5J2QA 5HLFB 3LWMA 4DF8A 4FJHA 1NJWA 2GIQA 3DM2A 3CFOA 4OKJA 3ZSYA 1ZBHA 3V9XA 1S9EB 3D45A 2XGPA 4FZYA 4L8RB 3AVMA 2HHVA 3GV8B 4FW1A 1VSFA 4FCYA 3MEEB 1LWFB 4FM2A 3KK3B 1KLMB 4K8XA 3QEVA 2C28A 3S3NA 5I42B 3M8PA 1NOZA 4CJSA 4LSNA 1Z26A 4MK7A 2YNIB 1VSKA 3SQ2A 3RMBA 2O4IA 4CHQA 2R2TA 1BHLA 3TANA 5FRNA 4E89A 2XI2A 1NNDA 4IKFA 1TV6B 5DG7A 2AQ4A 4JV0A 3NF7A 5J2PB 5KGWA 3TAQA 1NKEA 4Z4CA 4QOZB 2ETJA 2XO7A 4W5RA 4W5NA 5DK5A 4CECA 2Z1GA 4E19A 4DFPA 1UOCA 3DLEA 4Z4HA 4ECWA 4F4YA 3CM5A 1LW2B 4MQ3A 2HNYB 2C2DA 4HUFA 1IKXA 1DTQA 1RDAA 4KB0A 4RW6A 2G8IA 2D5RA 2IM1A 1XR7A 4NCAA 3FQLA 3HSTB 4J9QA 1SH3A 3F73A 3ZSQA 1VRUA 1VSMA 4MK9A 2W42A 4OKKA 4DTRA 3QIOA 3SI8A 1TKZA 5HROA 1C0MA 1RTJA 3RB3A 1S9FA 2B4JA 2R8GA 3LP3A 3P5JA 1FKPB 1XC9A 1UWBB 5J2MB 3NH1A 5CYMA 4CF8A 1MU2A 5E41A 3HP6A 4IRCA 3OYEA 3JSMB 3QEIA 4YR0A 4DL4A 1BI4A 2WONB 4RZRA 2RDJA 2AGOA 3TWHA 4FK4A 2GUIA 4HKQA 3MXMA 4LH4A 3OSPA 2IA6A 1HQUA 4WFXA 5K14B 4CGGA 1RT7A 4ED3A 3C6TA 1I39A 3HK2A 1C0UB 5HRSA 3M8QB 4I2PB 2G8UA 3I0RB 1U04A 1EXQA 4O4GB 4R8UA 3KLIB 2HHSA 1RBSA 5HRRA 2CKWA 2R8HA 3H5YA 4FJKA 4B9MA 4O3RA 3QLHB 4B8CA 3IGVA 4QW8A 5KG5A 3DI6B 3BQ2A 3PW0A 4JUZA 2V0NA 4FJNA 1S1WA 3KIOA 1UAXA 1EP4B 4BE1A 2G8WA 4RW8B 5EU7A 3UPFA 5F8HA 1LW0B 4ID1A 2B6AB 3VN5A 3IS9B 4RNFA 4QPXA 2W9AA 3AV9A 3PW4A 4ED2A 4WXOA 1OS5A 4I2QA 1BIUA 4KTZA 3WNGA 4O3NA 4B9VA 1RT1B 4KI6A 2W8LA 2HNZA 4FJ5A 2Z1HA 4RU9A 4TY8A 5F9NA 3VQAA 3KHHA 1QE1B 4Y2AA 4Z4GA 3OYLA 3DOKB 2W7OA 3K5LA 3OYCA 1VSJA 1BQNA 3BSNA 1IH7A 4O44B 1TKTB 3KLEA 1HYSB 1UA1A 3HVTA 4F4XA 1S97A 4CESA 2HNDB 1R0AA 4CJ4A 2KTQA 1ZBUA 5DG9A 2A1SA 1CXUA 5I3UA 3GIMA 1SKSA 2WCXA 4CFDA 5HLFA 2A1RA 2J6UA 4CJFA 2BRLA 1HQEB 2HB5A 2IC3B 1NK9A 4NCGB 4FS2A 1S9EA 4FBUA 5DMRA 4CGJA 3G86A 3MTKA 3LAMA 1S0NA 5DQGA 4B9UA 3MEEA 1LWFA 3QEPA 3KK3A 1KLMA 1ZYQA 4I7FB 5I42A 1EX4A 1F21A 3HO1A 4OPJA 2YNIA 4IH7A 3SQ1A 2D0CA 3AVFA 1JLGB 2FVQA 2R8KA 4XPEA 3NAIA 2GC8A 2DPIA 2YV0X 5KFWA 1TV6A 4JS4A 2Z1JA 3NBPB 1RBVA 4DL5A 5J2PA 1SUQB 1T05B 5KT7A 4PWDB 1SL2A 4CHOA 3OYBA 4DEZA 4CHYA 5KFYA 2P51A 3P1GA 1FK9B 4ECQA 3HHKA 3AO3A 4DL3A 2WTFA 4KB7A 4IDKA 2FVCA 3GQCA 4ZVEA 3M9OB 4WZQA 3V6JA 3QO9B 2HNYA 3RAXA 4ECRA 3MEDB 5F8LA 4HUGA 3CWJA 4ED6A 4FJ7A 1XR6A 1ZETA 4E0DA 3VQ7A 4DTNA 4MK8A 4Z4IA 3NHGA 3SUQA 3GYNA 3LPUA 1BIZA 1K1QA 4ECYA 2GV9A 2D0BA 3VQ4A 3FSIA 4HHTA 4CEEA 2IS3A 4JLHA 3UR0A 1FKPA 1UWBA 2VA3A 5J2MA 4N56A 5T14A 4H4MB 4QWBA 4AHTA 2GBZA 3B6OA 4CF0A 1VRTB 3MR2A 3JSMA 4DWIA 1TL3B 4ZPDA 3Q8PB 2RPIA 2JEFA 3M8RA 3TI0A 5KG2A 4N5SA 1S0MA 2WONA 2VWKA 4ID5A 1GOAA 3AVIA 1TAQA 1D1UA 2FJWA 3E01B 4IFVB 2QE5A 4J2AA 5K14A 4KB1A 1RTDB 5KG7A 4FZZA 1JLBB 2FC0A 1C0UA 4KAZA 4O0JA 3M8QA 4KTWA 4I2PA 3I0RA 4O4GA 2ATLA 3KLIA 4O3SA 3H08A 4GC7A 3OLAA 1WAJA 4M3YA 4KFBB 4ZVGA 1EKEA 3QLHA 3QINA 4H54A 1FXXA 3DYAB 3H5XA 4NLGA 3DI6A 1ASVA 5KFLA 4IR9A 3VA3A 4FK0A 1VSLA 1ZBLA 1BCMA 3SUNA 2OPPB 2YNHB 1EP4A 3BSOA 4RW8A 1KVAA 1BCOA 4IH6A 3ZSXA 1IKYB 5KT5A 4ZMMA 2QKBA 2UUTA 4DL7A 1L3TA 2NUBA 4QWAA 1LW0A 4CCHA 2B6AA 3IS9A 1ZBIA 4CEQA 4GVMA 5JS2A 2O5DA 5KG1A 5KRSA 1HMVB 5KT6A 3O3GA 4WE1B 1RT1A 3OSNA 3EYZA 2XGQA 4R5PB 4CJWA 1QE1A 4QW9A 3RAQA 5DGAA 3DOKA 5KG6A 2AU0A 3T5JA 2BQ3A 3PHEA 5KGXA 4HUEA 3KHLA 3L8BA 1KVCA 4O44A 1S1TA 4DFMA 1TKTA 3QEXA 1HYSA 3N6LA 5C25B 1QQCA 3QZ8A 1Q9XA 2HNDA 3KLVA 3NAEA 4Q8EA 4ZP7A 1SH0A 3EZ5A 2CJQA 3T1AA 2WOMB 4EBEA 4KRFA 2OPSB 4TQRA 4J2DA 1HQEA 2IC3A 4CHPA 4BACA 3V6DB 5L9XA 4NCGA 1WN7A 1CXQA 1T03B 4URSA 1JLCB 1HJRA 3AA2A 4PA1A 1I6JA 3NKYA 3CJ4A 3SPYA 4J9MA 4ECTA 4I7FA 4NZ0A 3VQQA 4H8KA 4EEYA 1KFDA 4CJTA 4F4KA 4NLUA 2JEJA 4J9OA 3UIQA 1O1WA 3CM6A 1Q9YA 1JLGA 2UVWA 4ICLB 4IG3B 4IRDA 1U47A 3DRSB 3DLHA 4EP5A 3NBPA 3HL8A 2ASLA 3QIDA 4KV8B 1SUQA 1T05A 4PWDA 4TSXA 4ZHRB 4G3IA 4N47A 4CFAA 4DQSA 2HHXA 5L1LA 1WNSA 3QNNA 4CK1A 4O5BA 3V81B 4F8RA 1EETB 1C2PA 1FK9A 1VK0A 4CEFA 2BRKA 1IKVB 4OLAA 2KW4A 3QO9A 4DSJA 1XWLA 3O4NA 3MEDA 4B3OB 4CEZA 1B92A 4O3OA 2FBYA 1X1PA 1JXEA 4FLTA 2OPQB 4E7KA 3OYNA 1W9HA 3SFUA 2HVHA 2ATQA 3BJYA 2DFEA 4OKEA 1REVB 2XCAA 4TLRA 3PX6A 1HPZB 5KG4A 5J1EB 3MFIA 1RT5B 1WLJA 3L2VA 4Q0BB 3AVLA 1TQLA 1GX5A 3HM9A 4H4MA 2FLPA 2RKIB 3ULDA 3KD1E 5KFPA 5L1JA 1VRTA 1KHWA 2IGIA 1TL3A 4OJRA 1D9FA 3SCXA 3OL8A 1S4FA 4CE9A 4J2BA 2HHTA 1SKRA 4LY7A 2GIRA 4EYHB 3E01A 2D41A 4IFVA 1W0HA 4B8AB 4JV2A 2X74A 1RTDA 3NE6A 4BE2A 3AVBA 1RT6B 4CJUA 3ZSVA 2FBXA 2E4LA 4BWJA 1JLBA 2AX0A 4ZVHA 4M3ZA 5KFJA 2XC9A 2X78A 1SKWA 4RUCA 2AGPA 2KZZA 4ZTJA 2W9CB 4K50A 4KFBA 3OYMA 2Z1IA 1VSEA 1WSIA 1K6YA 3VQ8A 1GX6A 1I3AA 3RBDA 2BANB 3IGNA 3DYAA 2VG6B 4FM1A 3ISNC 2B5JB 4EBDA 4HCBA 4KHUA 3CJ0A 4ELVA 3AVGA 4W5QA 3CQ8A 2OPPA 2YNHA 4MH8A 3BDPA 4KHYA 3NMAA 5HP1B 3BR9A 2IJNA 2D7SA 4Y1CA 2JC1A 1IKYA 2E9RX 1UA0A 5KFZA 3RB0A 3Q8QB 5F8JA 4O3PA 3UDLA 2OZSA 5EWGA 2YKNA 1WAFA 1LAWA 3QGIA 1CSJA 4NLSA 4M45A 1J5OB 2XY7A 5C42B 5HBMB 3RMCA 3RMDA 4NLXA 4ED7A 1HMVA 4HTUA 2FLLA 4WE1A 1XHZA 1DLOB 3OS0A 2DFHA 3I5BA 1C6VA 4R5PA 4CJ3A 4K8ZA 4KE5A 1C1CB 3T5HA 1X9WA 1JXLA 1RNHA 4F3TA 4AHSA 2QKKA 4FLYA 3GIIA 4K4XA 1ASUA 4CEDA 3BSAA 5C25A 4J2EA 1S1UB 3O4QA 4NLQA 2W9BB 4ECSA 1KTQA 3GIJA 4MKAA 4ZP8A 3OL9A 3MR6A 4O0IA 2KZMA 2HMIB 1S1VB 4RNNA 4FLWA 3HVRA 2WOMA 3CYMA 1XHXA 2OPSA 4HYKA 3NGIA 3SQ0A 4CK2A 3CJ3A 5DG8A 3V6DA 4JV1A 1Y97A 1T03A 4NRTA 4YR2A 4NRUA 1JLCA 2HWHA 5EWEA 3V1OA 4E1NA 1N56A 3D28A 4J9LA 1RYSA 3RR8A 1IO2A 3T3FA 4F3OA 4TQSA 1S6QB 4DU1A 3HVAA 3KOAA 2AGQA 4DL6A 2E6LA 4RUAA 1YTAA 2IAJB 2DTUA 3O3FA 1ASWA 3K5MA 1LAVA 1RTHB 1NJZA 2X6SA 3MEGB 4AH9A 3M8SA 4ICLA 1S48A 4IG3A 2O4GA 1HARA 1NJYA 3DRSA 1QAJA 3H59A 5JS1A 4KV8A 4PQUB 4H4OB 3BGRB 3DMJB 4ZHRA 1HNIB 1TL1B 2IM0A 1N48A 5KFAA 3V81A 3TARA 2JC0A 5KRTA 1EETA 3ZSRA 2FBVA 3EPGA 4EYIB 1IKVA 1J53A 1JLQB 4M95A 1CZBA 3VQPA 4F4ZA 2VWJA 1SV5B 3NF9A 2DFFA 4B3OA 2R7YA 3G6YA 4R0EA 4BWMA 1VSDA 4TN2A 2R2SA 2OPQA 3KHGA 1FKOB 3S3MA 4DSKA 4FJLA 3PO5A 4NLTA 3BQ0A 1REVA 5KT4A 1RT2A 4NYNA 1LWEB 3M9MB 5KFGA 4RNMA 4F2RA 1HPZA 2FBTA 3KK2B 5J1EA 4G1QB 1RT5A 4Q0BA 5DQIA 1KCFA 4MIAA 2D3UA 2RKIA 4CGIA 1S10A 3SUOA 4NYFA 4PY5A 3RR7A 2DPJA 3GV5B 3V1QA 3PJWA 3Q8SB 4I9QA 3QETA 1HYVA 3HYFA 2IM3A 3V9UA 1BQMB 3KNAA 3GIKA 4YMEA 4RNOA 1T3NA 3EPIA 3LZIA 1RT6A 4KAIA 3H98A 4Q45A 3OS1A 1KVBA 3KHRA 3RWUA 1HRHA 4NLDA 2VA2A 1QSYA 4KHRA 3OYAA 3U6FA 1L3VA 2AWZA 1QHTA 3C94A 3NH2A 4HVJA 2W9CA 1RT4B 4NLYA 3ZT1A 2JLEA 1JLEB 3SUPA 4QCLA 2HHUA 3ALYA 3SYZA 1VSIA 2FJXA 4KHWA 2BANA 2BR0A 4DTMA 3HP9A 3HVWA 2VG6A 3ZT0A 3DLKB 2HAIA 1LW2A 3PV8A 1WSGA 5C24B 3G0ZA 5F8MA 3VQDA 5D3GB 1J54A 1NKCA 3T5LA 4HCCA 4C8OA 1NHUA 3NH0A 4CHNA 1J5OA 5C42A 5HBMA 4DSIA 2FJVA
chains in the Genus database with same CATH superfamily
5LMNK 4FPAA 5DZ7A 3WUHA 1DLOA 1ZBFA 2MHEA 3L3CA 1C1CA 5KFBA 4GRSA 4C0OC 2C1EB 1N36F 4I6YA 3FBCA 1RAAB 4LF9J 3G96A 1MROA 3LZJA 4OYAA 2M9KA 1RBAA 1LWCB 1S1UA 5M1OA 4GV9A 3F44A 4B17A 1B0TA 5FRMA 5D6GA 3QBXA 1EQMA 2RRAA 3VQ9A 4CERA 1GTEA 3U1MA 4CIOA 4DQPA 2HHWA 2BTFA 3E8OA 3MPVA 3KLHB 3G6XA 3G71S 2ZH1A 3UQSA 4WFAL 4DR7F 4MJKA 2F4FA 2V6AA 4DHYA 3VQEA 3EZUA 3OYHA 3HMJG 5CZ2A 4QS7A 2HLTA 2MZTA 1QAIA 4ZVSB 4ECUA 2IAJA 5C0YA 1LOTB 4WZMA 4OI0A 3TVKA 3R27A 2C3PA 2UVVA 2BZ2A 2DGUA 3MMAB 4IFYB 4QYZJ 3VEOA 3FEZA 2LXFA 2NSBA 2XWXA 5DM7L 3THXB 1RWKB 2EWHA 3CD7A 1TL1A 3S9HA 2E5IA 4R0JA 2QM1A 1JLQA 3BSCA 3VVTA 3U7JA 2D3ZA 2DISA 1LCUA 3HPGA 1NSKL 1DGKN 3MUVP 4E3SA 4QBUA 4DS5A 4P75A 4ZJOA 1JIHA 2RQKA 3NFAA 3U3YA 3H7HB 1SS6A 4BC9A 3SQGB 1Z1ZA 2C2RA 2QN6B 4KKOB 3V9WA 4YHHF 3TR8A 4E1MA 2X6NA 5EUHA 2XS7A 1LWEA 4X62F 4UTGA 3O1WA 3DGVA 2XLIA 3NS6A 2ZDOA 3R1LA 2DNNA 3LTOA 5ETOA 2VQFJ 2M2BA 3ZX2A 4B9SA 4JI2K 2CWKA 3H45C 3HFZB 2LQJA 3I8BA 3WNFA 4M3TA 4DF4A 1Q5YA 2MLXA 3HCXA 2DHXA 2WBRA 3T1YJ 4AHUA 4B1VA 1HNZF 2LXUA 2LXIA 1TK5A 4IYQA 1JJ2R 4C9DA 1UPPA 4JI1K 1WHVA 5IT9O 3FRZA 4KH5A 3CG7A 5BYRA 4BRIA 3TJAA 3E2EA 4WKYA 3CJBA 4C8ZA 4X65K 1RT4A 5T7LA 3ENAA 4AHRA 3TOQA 4N8NA 1JLEA 3WC0A 4LFBJ 2PGCA 1PKUA 4PL7A 4YOEA 2RDIA 2XMKA 4DV5K 3DLKA 1U1LA 4E2FB 4C3MA 3QT5A 1TKXB 5KFIA 1R8PA 3KUEA 2Q0UA 3D1OA 5EWFA 2MEWA 5HJYA 1KRPA 3ZCMA 5BRHA 1DHMA 5GAGP 2E44A 2D74B 3MURP 3NWRA 3CF5L 3H1VX 3QMQA 3BYRA 5CXTA 2XMMA 3A3PB 2QL9B 1CJTB 1OJ4A 1HNXJ 3SXLA 2YNGB 5ETTA 3IG1B 3A12A 4P2XA 4YEAA 2CG8A 3ZEUA 3U9ZA 4IR1A 3HZEA 1XIQA 3QJLA 3E66A 5KQ8A 1UWAA 4A8YA 1X5OA 2B4PA 5CYJA 4K4ZA 1IR1A 3ZTPA 2HS0A 4MKVA 1S22A 5DZ6A 1HWJA 4RW9B 3K8WA 3ICLA 1HIYA 4KHPK 2G8VA 4YQWA 2RIJA 3E1YA 1RAGB 2IDOA 4LVOP 2UU9J 4DR4K 4DU4A 1CZ9A 1U2CA 4IFEA 1J5EJ 2VFUA 4LFCK 2DIUA 3KWMA 2YNFA 4HTIA 4FVUA 2VG7B 2C3YA 1CVJA 4AHVA 1I51B 2UV8A 3BQ1A 1RWUA 4FXVA 2R8IA 2KT5A 4F2SA 3KTQA 3OVSA 1PSDA 1QS4A 2MJNA 3DDKA 2V4RA 3N6MA 4KO0B 2BQUA 5KFKA 2E1MC 3W9JA 2OO4A 2GFFA 1S7IA 3I0SB 5LSOA 4CEOA 3E51A 2DCUB 5LXRA 2F8MA 2R4FA 4Y28C 2E1AA 3NOCA 5FDLB 1ZM3A 2F1FA 4IBNA 4FK2A 3HX9A 3AOCA 2UUWA 2HF4A 2QL5B 2VOPA 3PJ9A 3BBCA 3FC9A 5LOQA 4QIVA 4LSLB 2VBXA 1DY3A 3GSIA 5T41A 3QESA 2HBZB 1KAYA 5KFUA 5A76A 3L3VA 3CIZA 3JYTA 5LSRA 4FLXA 2F4VK 5EXWA 4M1KA 4FYYB 3MECB 5FPEA 4BRGA 3RTVA 3RAMA 1HBUB 3JSRA 5EN1A 5JVGQ 4DCPB 3V6KA 4B3RK 3UKRA 3FVYA 3CDUA 3ZT4A 1VC0A 4YOVA 4RW4B 2Q97A 3N5FA 3HT3A 5HN0A 3KK1B 2LCWA 2UV8G 2KH9A 4Z0UA 3GFHA 3AQPA 1VQLN 4NE9C 4WFYA 1IBLK 1BGXT 1JLAB 8ATCB 1NKBA 3O1BA 4I9LA 1RWWB 1U45A 1RSCA 3HHLB 1XTZA 1XMQK 3QZ7A 1CBKA 3CMEN 2OPRB 5DGBA 1WOOA 4JI1F 2XMUA 3HZ6A 2Q3PA 2QMXA 1C1AA 1L3SA 2W7AA 4GMJB 1DRZA 3S3OA 4BRKA 3JSYA 3L2UA 4X65F 3TAMB 3VGVA 2CZVC 3BZQA 5F8IA 3I32A 3GFXA 3JS9A 2VJVA 1QM9A 4ZPBA 1XMOK 3ZSZA 3GV7B 2AYEA 4X4NA 3DXMB 2KKHA 4OYIA 4ZPCA 4OZ0A 4WFZA 3WQPA 4U6PA 3OHAA 3OJSA 1B9FA 2LSNA 1PAEX 2ZM6J 3FUYA 4CIFA 3MOZA 2DXEA 4RNHA 5HVFA 2N3OA 1SQGA 2J0QD 1PC5A 1S6PA 3H5SA 1YGYA 4CHZA 1YT3A 1QVGM 1U8SA 3P8BB 3MXIA 4DUZK 5CZ1A 2IMWP 1OY8A 4F26A 3EJMA 2R7UA 2PY5A 3G8TA 3N0VA 3ET6B 3SMZA 3CGIA 1SIZA 2QSFA 4LSZB 4BDYA 4UZCA 1OYDA 4XIUA 4KTQA 4NYOA 2QK9A 5CYQB 4KHPF 3Q83A 2V51B 2AW0A 1RWMB 1SVDA 3Q8UA 4KJIA 4DG1B 1VDHA 4YR3A 4DS4A 4FXDA 1NGHA 2K7KA 1BWVA 3ULEB 1OVYA 1APSA 2EKYA 3QSIA 2UXCK 3Q22A 5HJXA 4GO5X 3ENVA 1JKHA 1FEHA 4KT0C 2MLYA 3MCSA 4V19X 1VK3A 5E3PA 2YHWA 4PUOA 1N34J 4YP3A 3AB2B 4UW2A 2Y1IA 1ZM4A 2DY1A 4YOXA 2P1JA 1M5HA 4ECZA 2FHMA 1K0TA 2M52A 3TABA 1IG9A 2WVCA 2ZE2A 2IBKA 3PYGA 3MGJA 2WVFA 4BBYA 4KHMA 3PUFA 4IG0A 1UPMB 4OYZA 3IMQJ 1SJ4P 1GMWA 4IO1A 1JCEA 4CO4A 4K4SA 2IVNA 2Q3SA 4WK1A 3AO2A 4QQBA 1Y10A 4WWSA 3ZX3A 3SDEA 1VQ5S 1B3TA 4LF9F 4H5WA 4ZCIA 1RCXB 3JTOA 2WBMA 3HTVA 3FBBA 2BM1A 4ETZA 3VQCA 3GR1A 1IBMK 2F4VF 2GS8A 4DQRA 1BQXA 3MM8B 1IWAA 4FLUA 3VENA 2G2OA 3K0JA 2P9SB 1S12A 3LP0A 1EWRA 4HLBA 2W7PA 1SAZA 3OPKA 1JL1A 1DTQB 1T7PA 4HT5A 5E0OA 4C8KA 4ED1A 2FY8A 2J6SA 1IG8A 2DXFA 1OKJA 1RHKB 2YKMA 5JJBA 1Q81T 1VRUB 5AFUA 4ZITA 3HPHA 1IBLF 4CJEA 4KBIA 1TKZB 2QLBB 3NCQA 3Q8RB 4CFCA 2EBEA 1VQOS 3HF5A 1UKUA 4EP4A 1X31C 1MU2B 1XNQK 4CP5A 2U2FA 1M5VC 4FJMA 1K47A 5A8WB 5F2RA 3CHWA 5LT5A 1NK5A 2BABA 1IBKJ 1Q1KA 1WHXA 4OV1A 2VQEJ 1TL7A 1HQUB 2CA9A 4BHQA 2JEIA 3IRXA 2U1AA 4K4WA 3AJ1A 1YX2A 2E1ZA 2C2ZB 2MTLA 3KJFB 5K8MA 5B0FA 4FS1A 3KG0A 5DDOC 3IFRA 1SIWB 1NK6A 4Y2CA 4R8UB 3ITHA 4NI2A 4DXLA 4JI4J 2GNKA 5HATA 4TXSA 4W5TA 1DQ9A 3ZNUA 3BREA 1G99A 3KMSA 1YWXA 3NCRA 3UW1A 2ZKUA 3D6FB 2EFVA 3W64A 5K8OA 2E7VA 1X5SA 3OUYB 4FJGA 1TELA 1VI7A 3MM5B 2P5VA 4EU0A 4PXDA 2QV6A 5KFHA 2VQFF 1HNVA 1RAFB 4CTAA 4EK2A 3THYB 3NGTA 4H0OA 1F6TA 4DU7A 3CCTA 2X51A 3D0PA 4JBCA 2VDIA 1ZBSA 3ZZUA 4DUZF 2G0IA 1OIAA 3CVKA 3ENQA 1SH2A 2F8HA 4Q44A 5F8NA 7FDRA 2R2UA 2FQQB 1NZAA 4RW7A 2DBBA 4MFBA 2MQNA 5KFCA 4X4RA 2QT7A 3LWLA 3E9LA 4Y00A 3VR1A 3HVTB 5GAHU 4LFBF 4BGAA 2E2NA 4N8OA 1FWPA 1WUAA 4Z4EA 2VFVA 4M3WA 1RWXB 3HKZD 2BUPA 2IRUA 3ELHA 4ILJA 1NXIA 1VQ8N 1VQ7S 4WP3A 2ILZA 5J2QA 1UTAA 2LYVA 1R89A 2YY3A 1NJWA 4MYTA 1WF0A 2GIQA 4CRJA 3VEZA 4DBQA 3V9XA 1S9EB 2XGPA 4RX6A 4L8RB 2UXCF 1Y5IB 1VHIA 2W1BA 1UVIA 1YIJN 3OXLA 3IBWA 2BM0A 1WC6A 1NOZA 1Z26A 1CS4A 1VSKA 3SQ2A 1XEZA 2GHPA 1HNXF 3EXCX 2ZFHA 2PA3A 4OLPA 2VOOA 4IXCA 4N77A 5DG7A 4JV0A 3U02A 3NF7A 5KGWA 2Q36A 2GIFA 3C7NA 3CMAN 4DFPA 2XMWA 2XNQA 3DLEA 2YKQA 4Z4HA 2X3GA 2VC1A 2F7VA 4F4YA 4NXNK 1LW2B 2V8HA 2Y1LB 2Z2ZA 5AQSA 3G2XA 2KM8B 3M1VB 5ETRA 2L48A 2XO6A 1RDAA 2G8IA 4WFBQ 1IBMF 4AFFA 4CZKA 4J9QA 1SH3A 4KH0B 3F73A 4ZDNA 4F3QA 3QFUA 4MK9A 4QYRA 1FCAA 5G4DA 3QIOA 3SI8A 2A0FB 1C0MA 1RTJA 3N4PA 3K9JA 1XC9A 2C2NA 3MMCA 5CYMA 5E41A 3CTRA 3R3TA 3QEIA 3SQOP 4YR0A 1WOPA 2ROGA 4DL4A 3TWHA 2GUIA 3MXMA 5ITHA 5E5NA 3KWGA 1I39A 2FTRA 3HK2A 4IZ9A 4DX7A 3CCWA 3M8QB 1EXQA 3O8WA 4BR4A 1H74A 1RACB 4ZCKA 5CZXA 2NRXA 4FJKA 3QICA 3HSJA 1UZDA 5A8RB 2D0PA 4DJBA 3PW0A 3D2EB 4B1YB 2IVPA 2QWMA 4A46A 2RRNA 3CCSN 2HS4A 3C8YA 3MMVA 1KP6A 3AD7C 4CZJA 1UMJA 5A8KA 1OMSA 1RHQB 2NRZA 4KC5A 2HRTA 3UPFA 2J4RA 4ISGA 1LW0B 2WZ1A 4ID1A 1X3MA 3D2FA 2K8GA 2V68A 5E84A 4NEYA 4I2QA 2ZH2A 3HSZA 4DPWA 2HNZA 2CQ3A 4TY8A 3TR5A 3VQAA 5AQJA 2BW7A 4NMXA 4ERDA 2D3OR 1BQNA 4DL0C 1HR0K 5HO4A 5FPNA 4DV4J 3KLEA 3PSFA 4DUYJ 4O8UA 3Q8YA 4F4XA 1UVKA 3B82A 4U8YA 2GCFA 3MDQA 1KBRA 4P52A 3Q89A 2KTQA 5DG9A 3M2RA 1KD1O 2FJBB 4IOCQ 3EVOA 4J91A 2V69A 1VRQC 1HQEB 2HB5A 2Q0RA 5DMRA 4CGJA 3MAAB 2RQ4A 3LAMA 3HRGA 1M1KT 2IA0A 3QEPA 1KLMA 1ZYQA 3T6JA 3H0PA 1GXUA 5M1KA 2OELA 2XZWA 1F21A 3HO1A 3VF0B 4OPJA 2YNIA 2QW9A 3AVFA 2BW2A 2FVQA 4KH6A 3NAIA 1DEJA 2ZM6F 1H2UX 1H3DA 4LF6J 2IMOA 1NSPA 1RKJA 2BE9B 5J2PA 4USHA 1SUQB 2AKWB 4CHOA 2MDAA 4S0MA 1QHAA 1IVZA 2P51A 3LGNA 1MWYA 4KB7A 4OX6A 4IDKA 2DPNA 1LXNA 3M9OB 3V6JA 2HNYA 3RAXA 5E7OB 4NEZA 3TX8A 1OO0B 5F8LA 5B0CA 4FJ7A 2DK2A 2KHOA 1F2GA 4I68A 1CJVA 1YJ9N 1X60A 3I55N 3LPUA 1K1QA 4ECYA 2D0BA 1TFWA 1CC8A 4CEEA 1EB0A 3X1LB 1UWBA 4N56A 4H4MB 4QWBA 3CC4S 2F9JA 4XAKA 5ETVA 3SAGA 1VRTB 2VWBA 4DWIA 4ZPDA 2VJUA 5EVZA 1PYSB 3A8JA 4N5SA 3O8MA 4YOUA 3AVIA 4GO7X 3EE3A 2DB1A 3DRXA 4J2AA 5LJVA 5CZVA 3US5A 2E2OA 2IYGA 3D6TB 4MYUA 3MAHA 3W3DA 4UOFA 5G0RA 3TTDA 2LEPA 5I4MA 4O3SA 3H08A 1NJIO 4KFBB 1N32J 3QLHA 1JXVA 3C6AA 3H5XA 4NLGA 1YDLA 2HLUA 1OY6A 2CG4A 1ASVA 4DV0J 3R6MA 3WEEB 1TUYA 1EP4A 1IJFB 1GTHA 1HWIA 2AMCB 3RW7A 5C2GA 1IBCB 2ZBIA 4ZMMA 2XM3A 2QKBA 2NUBA 3AD8C 1FE4A 2QLWA 5KOXA 2F7TA 3HJVA 5KT6A 4WE1B 1IN0A 3OSNA 1VJQA 2XGQA 3MD1A 4R5PB 4CJWA 5ETSA 2VPWB 4QW9A 5DGAA 5KG6A 2Q6BA 3G4SS 3PHEA 1VBKA 4QR2A 3L8BA 4O44A 3GL1A 3QEXA 1TKTA 5C25B 3P4IA 1KDNA 1R6YA 3QZ8A 3T41A 4OLOA 1Q9XA 2HNDA 2LECA 2QO3A 3IWNC 4PG8A 1GH8A 3O9RA 3EZ5A 4OIXA 3A3OB 8RUCA 2WOMB 4O23A 4RO0A 1RABB 4C11A 2OPSB 1Q82T 3BEXA 4OX9J 5HAOA 1HR0F 4BACA 4NCGA 1WHYA 1CXQA 2Y8WA 5CH7B 1JLCB 3AA2A 3O6QA 5BJRA 2A6MA 1N5TA 3HOTA 3UKUA 2LP4A 4NZ0A 4H8KA 4EEYA 2ZBPA 2O8DA 3KHYA 4NLUA 2X1BA 4QOTA 2VQEF 3RVCA 5GMKa 3CM6A 5EY4A 2V8DA 1JLGA 5DRKA 4PEOA 4WF9L 3D6RA 1EQYA 4LR8A 3J80U 5B09A 2ZH3A 4K59A 3DRSB 3VPZA 3DLHA 4KRWA 4EP5A 2N3LA 4F02A 4JI4F 4JI3K 3TYTA 3LL3A 4DQSA 3QNNA 2E88A 4O5BA 3R1HA 5K5MA 1FD2A 2FB0A 4CEFA 2VB6A 4OLAA 4ISEA 2JVOA 1FDBA 2JOQA 2O66A 2GV1A 1CULB 4CLZA 2KW4A 1LEOA 2OJ3A 1XWLA 5CCMA 3MXHP 1RP5A 4B9QA 4OJHA 4O3OA 3W2VA 3LW5C 1SQKA 3WBZA 4DR2K 4E7KA 2A42A 1KVJA 3BJYA 2DFEA 4ILRA 1EWQA 3EGWB 4TLRA 3TUPA 1YK9A 3PX6A 2EFPA 5J1EB 1SBRA 3BGLA 4DU8A 4IEIA 1H73A 1T11A 5D15A 3QFWA 2PBDA 3CETA 3KD1E 5L1JA 4BG9A 2MSTA 3UWTA 2W4CA 4OJRA 3OL8A 3T9ZA 2OANA 4K0KJ 1KQFB 2EKNA 3L7PA 4EYHB 5KAKA 4G1PA 4FNHA 2X74A 5BR9A 1WELA 1RTDA 1FWKA 2G0JA 2HQ3A 5D0EA 4BWJA 3M6GA 1S0VA 1VC6A 2XC9A 1SKWA 1TMMA 4RUCA 1IJEB 1EAYC 1DQ8A 4PR6A 4ZTJA 1U2VA 1FRHA 3OYMA 2Z1IA 1U1RA 3QWPA 2Z57B 4EFHA 1K6YA 1GX6A 3TU5A 1I3AA 2BANB 3DYAA 2BJ3A 3TVZA 1PJ6A 3MCNA 5JMVA 4EBDA 4HCBA 1R8HA 3MEKA 4KQZA 2MQQA 3BDPA 1AYEA 2BJ7A 3AVGA 4W5QA 4MH8A 4LREA 4KHYA 2PEHA 3M8YA 2JC1A 2E9RX 1BU6O 2BJDA 3Q8QB 3P96A 5EWGA 3I6PA 3QGIA 4NLSA 4LF1A 2XY7A 2HGNA 2MKCA 2FPHX 2Z4PA 4ED7A 4JI5J 2A3ZA 1DLOB 4FWRA 1C1CB 3VQTA 1S77D 1WKKA 2L9WA 3AFGA 4W98A 4AHSA 5THWA 1MROB 3TTCA 2IBOA 3D0HE 3SBGA 1ASUA 3LUYA 4CEDA 3J7ZT 4J2EA 1NRKA 1S1UB 3MR6A 2HHHK 3R2CJ 5IM0A 4FLWA 4RU2A 5C12A 1ZZFA 4HYKA 1VQ6N 4C3KA 2KHCA 5DG8A 3V6DA 3BBFA 1B0VA 4FP9A 1HHQA 3DRYA 2RB7A 2RDDA 3L6QA 4Y2IA 2I6WA 3ILLA 2PFUA 5ADXA 4DU1A 3LM9A 3HVAA 4TLQA 2IAJB 4TU9A 3O3FA 1D4XA 3VEVA 3FMBA 2R7VA 1RAOA 4A8OA 4AL5A 1WBBA 2PA8D 3NNCA 3D7EO 4MO4A 1ESVA 1PJ7A 2B56A 2V50A 5DJBA 2MQLA 4IG3A 2IPOB 2KT2A 2QWNA 4P7TA 3H59A 3VEWA 5JS1A 4KV8A 2JFDA 4W4MA 4PHTX 1TL1B 3CCVS 2YKOA 2JC0A 5KRTA 1EETA 4EYIB 1J53A 1JLQB 1R7IA 2Y8YA 3VAFA 4J37A 3AY9A 1UVMA 3TJ9A 1LK7A 4TN2A 4DR6J 3MM7A 4LVNP 2OPQA 4JI3F 4FJLA 4DSKA 3PO5A 3DJCA 1S59A 1REVA 2ZBCA 1SB6A 1LWEB 3EEQA 3B4DA 5AQLA 1A9NB 1QAXA 4F2RA 3W9IA 4LFAJ 1RT5A 3UD4P 1Z6RA 5DQIA 3AXMA 1UAWA 4DV3J 3LM2A 3K2YA 1KQSR 4RPFA 4CGIA 4CLUA 1S10A 2MMYA 2V2ZA 4FPIA 4JKCA 2XHCA 3V1QA 3PJWA 2NRHA 5C2DA 2IM3A 4DUYF 4JEPA 3NEKA 3V9UA 2DYAA 3ZZPA 4CO5A 4XEIA 1F5CA 1PAUB 2OTLS 1HHSA 2LFVA 4KAIA 5RUBA 3H98A 4PYAA 1QSYA 4IEEA 3OYAA 1RDUA 4C8YA 3GJRB 2W9CA 3HI0A 1RT4B 5T7LB 1EKRA 3CJAA 1JLEB 1I94K 4LRDA 3SUPA 2HHUA 4QIEA 2Q6CA 1VSIA 1KR4A 2M7SA 4KHWA 4DTMA 5ETQA 1FJGK 2UUCJ 3DLKB 2HAIA 4CDIA 1KVKA 3QPIA 2QJ3A 1Z2LA 1ITPA 3VQDA 1H98A 5A2QY 2HSEB 3I9V9 2HG4A 2LA6A 5HVGA 2CJYB 3T5LA 4HCCA 4C8OA 1VR6A 3NH0A 1PJ5A 1J5OA 4EIAA 4LF6F 1ROFA 4DSIA 4B3SK 4OJ1A 3QBWA 4DUTA 1LKZA 3F9KA 3TVYA 1FO1A 3TZXA 3HPOA 1BLUA 3NGUA 4G1IA 2HW3A 1H1VA 3PXGa 3VA0A 5SZTA 3M8ZA 5IT9U 5GIPA 4Q5VA 3ZEUB 4X66K 5F3TA 5GADP 4XH1A 4DFKA 2B9WA 3SSRA 1D5AA 2BKPA 1QVGR 3IN5A 2FXUA 4FLZA 2B9XA 3JAMY 2BA9A 2Q31A 4TY9A 1P27B 2PYJA 3FE1A 5LMUJ 2GW8A 1HKCA 1S1VA 4LR9A 5BYQA 2VL1A 3D1HA 2RRBA 4M42A 3FR0A 4NASA 2CXEA 4DCJB 2JWLA 2BGGA 3K59A 4PXBA 4M5LA 1M5PC 1AUDA 4WU2A 3J81Y 4DTJA 4AL6A 2IFXA 2PO4A 2W40A 2YNFB 1V4SA 1U48A 2HHHF 4XPCA 1S6QA 3QNWB 1RHMB 1T0TV 4OHYA 4F67A 2J0SD 4CJ5A 3VMFB 3LDOA 1GOBA 3WNEA 5J1PA 4F0MA 4DR1K 5KFVA 1YQHA 3OBYA 2XCPA 1CLFA 2ZH6A 5F3ZA 4Q43A 4CGFA 1QSSA 3CT9A 3KYLA 1JJ2M 2O8BA 2P8IA 2X7IA 4I67A 3F56A 4WCEQ 4ZJLA 5JVGL 3GILA 5BR8K 2Z2YB 4F0KA 1J6ZA 2QEXN 4AXIA 4M94A 3W60A 2MKSA 1UL3A 2Z0GA 2E5JA 2HFNA 1D3WA 2J9DA 1VQMS 6AT1B 2GHWA 2QXFA 3NCPA 4DQIA 5AQIA 3OHBA 3P6YC 2KG0A 4KSEB 1NM2A 2OH2A 1F9HA 1TK0A 4J9PA 4PXCA 4C23A 4DSLA 1FKOA 1HKAA 3S41A 4P9SA 3CD5A 3ISND 2RH3A 2PEBA 3JYTB 3KK2A 3H3OB 2OMOA 3PX0A 1FEEA 4JS5A 1TZ0A 1HD1A 3U4LA 1MNEA 3RZAA 4D3HA 5E2QA 4NA3A 3FRYA 1N54B 3AT1B 1NM1A 1RHJB 2Z8QA 3UKRB 4DR5K 1FFGB 2P9UA 1WC4A 3B54A 2QWOA 1BQMA 1F2HA 1ZA1B 1HA1A 3H42A 1W2BR 4UUXA 3CD6S 1YHQS 1GOCA 1VJWA 4P2SA 5IV3A 2OZMA 3MOJB 3TAPA 2DNHA 4F50A 3EZWA 1WSHA 2XY6A 4OX9F 4FZXC 6FDRA 5C10A 2CQDA 5KG0A 3D54A 2QGFB 3W1YC 2FVRA 5IWAK 1LK5A 2PZSA 1YITS 4PG4A 3O80A 5CA5A 4IQXA 2P6SA 2GEMA 1MA9B 5AQFA 5AQKA 2JLGA 4M5KA 1EHWA 2X1GA 1E4FT 3VF2A 1I94F 2RHKA 3HHLD 4DFJA 2C3OA 4H03B 3PNIA 3TAFA 2POKA 4CO2A 1BG3A 4B9LA 1ZXOA 2GELA 2YHAA 3BKFA 2WSEC 2VPYB 2BMBA 2H9ZA 1XMBA 1MMNA 2G9OA 2W6LA 2VBZA 4YDUA 5KFEA 2MKIA 3TZWA 4DZDA 3H3NO 3UVJA 1S7HA 2RN2A 1T9YA 4FO0A 3B78A 1U4BA 2ZZTA 3SPZA 3L7OA 2H3EB 1NK0A 1XC3A 5BPMA 1RQ0A 1S6PB 3PRVA 2XSFA 4LF7J 1P90A 5A2QO 1W25A 1VAZA 5HVHA 3LDSA 4KI4A 1JXBA 2FZCB 3LP2A 4X66F 2NRVA 3NS7B 4YS2A 5GAEU 4CJLA 1KNZA 3V4IA 2X1AA 4C8LA 1VQ9S 2KFNA 5KT3A 3GMGA 2AV5A 1N6QA 4OX7A 5KG3A 3SIPB 3GP9A 3OTOK 4CJVA 2IRYA 3ILOA 1FX4A 4OZLA 3A8KA 3QNOA 1XI1A 2YKPA 4JKAA 4HACA 1V4TA 3K58A 5EX0A 3KZBA 3CD0A 3D9BA 3PW7A 3GE1A 3R3LA 2WTUA 3JAMO 3MMJA 3DWLA 2Z30B 3K2PA 2GQCA 5JVHQ 3RBEA 2ASDA 2FSJA 5F9LA 1RKIA 2RU9A 2NUUG 2DD8S 1JKHB 3VAIA 1QLNA 4K41A 4DHVA 4PUOB 4M8LA 3HHNB 4OJGA 3J81O 2HF3A 1PYOB 1S4EA 3D66A 4HDHA 3KKSA 4ZPVR 1Q5VA 3FEXB 3U3GA 1NGAA 2EFOA 4P72A 5BR8F 3W8GA 1R59O 3AVNA 4GKJJ 2W25A 3VQBA 2ZE2B 3MWPA 1OWXA 2M88A 4JV5K 2BV3A 4IG0B 2O8FA 4RG8A 3OS2A 2GA7A 4ID5B 3C16A 4CJRA 4ID8A 2VF3A 4LF8K 2DHSA 2W2OP 4OPHA 1RISA 1LFPA 2AEJA 2K2PA 2NSCA 1N5SA 5D0HA 2DNMA 3SDEB 3H4BA 2P5OA 2OGUA 2V34A 1WEXA 2BX6A 1F9FA 3EXYA 5ETPA 4L3NA 2HBLA 4L74A 3FDSA 1WACA 2JNJA 1RLDA 3ONQA 3QT8A 1WNEA 3A4TA 4DV2J 2G2YA 1Y00A 3LP0B 2K7JA 3I4HX 1Z25A 2AT1B 4DX8H 3EY1A 4DR5F 2W2PP 4DPTA 5BXIA 1KN6A 2XULA 1I5OB 2ZJQQ 4ES1A 2GWJA 4ZVTB 1VISA 1UW9A 2YKMB 5F8GA 2EHGA 3R5CA 4JYAK 3QRRA 3CJ5A 3KJQB 4IO8A 3CJ1A 1RZMA 3L2WA 4R25A 2P9LA 2PYLA 2F8EX 5AE1A 4KPYA 5IWAF 2QWQA 3PRBA 3OJUA 1RWVB 2BE2A 5CAAA 5CY4A 5CD4H 1S6UA 1X8DA 4FL9A 3AVJA 4F7VA 2GQQA 2NPIA 3AVHA 1A5VA 2CVIA 2UXBK 1TL7B 3DLLQ 4HH0A 2F96A 1CLQA 3CCRN 4WYWA 5ETMA 3IRXB 4CJPA 4YDDB 3NRBA 5I3QA 1VYAA 3C65A 5AQQA 2VBWA 3CJRA 3ITHB 4NI2B 4DU3A 2I8EA 2RF2A 1HHTP 1ZTTA 3OW2R 4I6WA 4KBOA 2ASMA 5LM7E 2CYYA 5TKWA 4GNIA 3SBMA 4URQU 2CNKB 3Q7CA 5KFSA 3OR1A 3ULHA 4C3LA 2E66A 2D0AA 3CCQN 4DV3F 1JX4A 4UOGA 1HNVB 3C14A 4ECXA 4CTAB 3JXUA 4DDFA 1NZ8A 1X9JA 3GTYX 2NXEA 2FIUA 4BC7A 3DRPA 3H5UA 2B5JA 3D5MA 3ETOA 4NLWA 3TTFA 3CCUS 1SXLA 3HI9A 1TK8A 4J9NA 4BDPA 1XJWB 5KFQA 5HP1A 1F5BA 4Q8FA 4ILHA 1S5ZA 4FJXA 3D0IE 3MF5A 1X9MA 4M3UA 2V7ZA 2M0GB 3G82A 2RHQB 1T9XA 2HRYA 1N36J 4RW7B 4CW7B 2ZUAA 4MFBB 5AR0A 3BYPA 4XTTA 4N76A 1GAOA 2VV5A 3C6UA 3LGHA 3DRRA 4LC9B 2Q1NA 2XRIA 3W66A 4Z7YA 3R6GB 3OTOF 2OA8A 1YVNA 2XEXA 3M5RA 1RTIA 4IJAA 2CPXA 1BISA 2K3IA 2EC0A 1H7XA 2O01C 1RK8A 3T69A 4J9KA 5KFRA 1AB8A 5J2QB 3IWLA 1HNWK 3L0QA 1T8EA 4DR7J 4NLPA 1U49A 3D4JA 1URRA 2A41A 3DDNA 2Q1LA 4CEBA 2N7YA 4B3TK 2IJFA 1CZAN 1NDPA 1DBDA 2NCKL 1YXQA 4WFBL 4JP8A 3BO4A 3KJVA 4B1XB 2F65A 2ABYA 3V4MA 1M0SA 2R7OA 2PFFB 1CS4B 4NYZA 1AUSL 4KREA 2B7CB 1OQ3A 2HPUA 4OHWA 1RYRA 1HI0P 1GLCG 3N79A 1FXDA 4JV5F 3HT0A 4OO1J 1B9DA 1NNEA 3K17A 3C7NB 5AQPA 3TNVA 3CO9A 1SC4B 5GVQA 3M9NB 1JL2A 1UEUA 4LF8F 3DLEB 3EGVA 5LMUF 4DSFA 1CC7A 4U7UD 3R6LB 5KFXA 2LVWA 4Q2LA 2EW9A 4BROA 3W2WA 1Y3KA 4WP9A 4Z4FA 1QDUB 3CEDA 2ZD1A 4ATNA 3TSUA 4FPRA 4YHHJ 3M2VA 2DGOA 2YKNB 2BOAA 4I6AA 3FEYB 8AT1B 4NZ7A 4U7CA 4X62J 1TUGB 1AFJA 4JKDA 3VGTA 3FNNA 3U27A 2P5GA 1M1GA 4OLBA 2K1RA 3B8AX 3IA0A 1RTJB 3JXOA 1HI8A 3AAPA 2QLJB 3DOLA 3I82A 1X4CA 3MMCB 1U25A 2CDQA 1UJ6A 5CYMB 3RU0A 3GIRA 1RU1A 2ZQBA 1S76D 2J9EA 2XY5A 3ZFVA 4JI7J 1HNZJ 3R7NB 4NO7A 1S9GA 1QZ5A 1AZSA 1SL0A 4JYAF 4Y34A 1GLAG 1DAXA 2EPIA 3SI6A 1U1NA 2B9YA 4ELUA 2MZ1A 1SC6A 3EX7B 4ANCA 3A2FA 3UDVA 3DLGA 3C95A 4AXJA 4C0HA 5L38A 2HWIA 1VFJA 3PW5A 3CCLN 3EKSA 3LAKA 4U7BA 4ZPAA 3NP5A 1CEZA 4B08A 3GJQB 3FZHA 1P9YA 2MYFA 3O4WA 4IRKA 1C1BA 4F3MA 2XTJP 5A8KB 1BMQB 4AQYK 1Q7LB 5B0AA 2IJRA 1S3XA 2CZ9A 1NBEB 3BV8A 5AZIA 4B1WB 4KGXB 4IO9Q 1KS2A 2ZJPQ 4CVNE 4ZP9A 2JWKA 4MIBA 2HQIA 3D2FB 4L75A 4B9NA 1GMUA 2GGPA 4I2QB 3V1RA 5EDWA 1C0TA 4R79A 1HBNA 2IDEA 2WK4A 2A2CA 4CGDA 4IWVA 2HNZB 3CJQA 2G8KA 4TY8B 2YI1A 3HZGA 1S1XA 4DZ6A 2PD1A 3K5NA 4EO8A 3WIUA 4ZCMA 2AJ4A 1BQNB 2FHOB 3CE8A 5F0WA 4M63C 3KLEB 2E6MA 3VQSA 4CH0S 4WK3A 3PR5B 5LMNJ 5E3QA 2DHHA 3M2RB 1RT2B 4CBWA 5LJWA 3KVGA 1NAQA 3LWMA 1ZAXA 2HGMA 2XG8A 3DM2A 4OKJA 3ZSYA 2GX8A 4MLHA 5GAGI 1U0HA 1FRMA 1RFQA 3AVMA 4G9ZA 2HKEA 2HHVA 3GV8B 1RWNB 3I87A 2PAVA 2B4VA 2XMTA 1KLMB 2DNKA 4K8XA 3ZETA 3M8PA 3P39A 2F40A 2W4DA 3S01A 4MK7A 3ZZTA 1ZA2B 2YNIB 4UQTA 5HMZA 1HNWF 4RWXA 5AQVA 3RMBA 5HK4A 3LOUA 4CHQA 1B4SA 1U0SA 4P2FA 4BC2A 4B3TF 3BGUA 4H0TB 3QGPA 3IM8A 4BR2A 5J2PB 1NEEA 1NKEA 1VC5A 2HMPA 3IDHA 1KD1T 1NDLA 1R8CA 4W5RA 4U96A 4BRHA 4CECA 2KVIA 2KDOA 4LF4K 2Z1GA 2L41A 4H5TA 4FNIA 1JCFA 1JMTA 2HNYB 2Y9HA 2DITA 4OHVA 4OI6A 5AQUA 1G1XA 2CQBA 3O9QA 4QZVB 1CJVB 2D5RA 2IM1A 4B02A 1XR7A 4NCAA 2XZDB 3HSTB 4FOIA 3ZSQA 2R7WA 3TA2A 5HANA 1FHTA 1JJHA 3QFPA 4AL7A 1YSJA 2R8GA 1UWBB 3G87A 4KGMA 4DI6A 3SAFA 1O0PA 4NOHA 3HP6A 4IRCA 5DO2A 4YORA 2KXHA 2UUAK 1YLXA 4EGLA 3BS9A 1BI4A 4RZRA 2RDJA 3QJPA 3Q0AA 1JB0C 3OSPA 2JVRA 4WFXA 1BO5O 1NPKA 4CGGA 4ED3A 2RE2A 5HMXA 4JI2J 2OTJN 5G0RB 4TVAB 3O9TA 2ZWPA 4EWTA 3BN7A 4X64K 1RBSA 4ZLNA 2HWTA 2CKWA 5HRRA 3MUMP 4JI6K 1RGIA 2OMLA 3IBFB 4I4BA 3QLHB 4QW8A 5A0YA 5KG5A 2HIQA 4JI1J 2HK3A 3BQ2A 1WTBA 1OH6A 4FJNA 2Q79A 2NNWA 1UAXA 1TFYA 1EP4B 3R1XA 4A8WA 2E5HA 4X65J 5EU7A 2B8PA 3MPYA 4OYXA 2DIVA 4DV5J 3AV9A 2KRBA 1OS5A 2DR7A 3WNGA 2DR9A 1T44A 4F25A 4KI6A 2W8LA 4CD3A 1V6HA 3A8IA 4ILMA 3J7YU 4Y2AA 3LDLA 3OYLA 4Z4GA 1NJIT 3K5LA 4FKXA 2UUBK 3OYCA 1ILYA 3P5BP 1HWKA 5HL7L 3BSNA 3A0IX 1T9UA 1REGX 4O44B 1TKTB 3LO3A 1S97A 4ZJQA 2HNDB 3WXMB 4CJ4A 2YQ0A 1EO1A 3NGSA 3BKTA 1I3OB 2AJ1A 3GFZA 5I3UA 2PMWA 1SKSA 5BN9A 3M8WA 2WCXA 1RWPB 2J0XA 4C11B 3Q24A 2DEIA 1ZC6A 1WF1A 1MN7A 4NCGB 2ZHAA 4FBUA 2HBQB 4JI0K 3MTKA 4K25A 4B9UA 2CFXA 3MEEA 1LWFA 3UKUB 5GAEP 5I42A 1EX4A 3O08A 4KHPJ 2O8DB 3EKUA 3DXSX 4IH7A 3SQ1A 4DR4J 2W6KA 3CF5Q 1JLGB 2R8KA 4XPEA 3J8AA 2DO4A 2ZOMA 4OJ3A 4LFCJ 4JS4A 1WEZA 2BH1A 1RBVA 4DL5A 5ETLA 1C0FA 4NLBA 1U6FA 3HHDA 2YHXA 3FLCO 3AO3A 2WTFA 1UZHA 1YI2N 1VQLS 2FVCA 3VEXA 1OPIA 4ECRA 1NGFA 3AA9A 4PABA 2WW4A 4HUGA 2OEMA 3CCMN 1XR6A 3W2VB 4Z4IA 4O5FA 1QAYA 2GHVC 3CMES 4LF4F 1VBXA 1GNKA 2HK2A 2GV9A 2O3DA 1NPPA 5A6PA 1WTFA 1LQ9A 1SQEA 2IS3A 4JLHA 4JKFA 2X3DA 1FKPA 5D4NA 2EEYA 2VA3A 5J2MA 1LNQA 1JJ4A 3JSMA 5CE3A 2RPIA 2GJFA 3CC7S 1SJ3P 4IQMA 3TI0A 1GLLO 4YDXA 5LJ3Y 2VODA 5FPMA 1LFWA 2VWKA 2QFIA 1FFSB 1HFEL 4FYXB 2F4VJ 2MZQA 2QE5A 3UN2A 4FSVA 3QJJA 1RTDB 1NU4A 4FZZA 4O0JA 3QT6A 3T1HK 2G2ZA 2QYCA 3KLIA 4B3RJ 1U2VB 4G65A 2UUAF 1WAJA 4WU3A 5BPLA 3DYAB 4YOYA 3DI6A 1RAIB 2V2QA 5KFLA 4IR9A 3NGRA 4CQ1A 1TL4A 1IBLJ 2ASPA 3CQXA 3SUNA 4OHXA 1NPRA 4RW8A 2LQ5A 2ZC3A 4X64F 5KT5A 2AD9A 4PWUA 2NXNA 4CNZA 1NBWA 3AAQA 4AM7A 4DV6K 1XMQJ 4DL7A 4CI0B 4CCHA 3IS9A 3UE5A 1ZBIA 1AROP 2JDJA 2VONA 1T02A 3CJCA 5KG1A 2UZAA 5KRSA 3MN9A 4LRAA 1RT1A 1UFLA 1VMBA 5EGYA 1AFIA 2LEAA 4BC4A 5C15A 3M05A 2XHWA 3RAQA 4XDDA 2AU0A 1KQKA 3T5JA 2FHJD 1XMOJ 3EGNA 2YWKA 4ZKAA 1HYSA 2GO9A 3EICA 5CHCB 1FJ7A 1HBMA 3MWTA 4EMDA 2Q43A 4GMKA 3OFFA 3PFEA 4Q8EA 1SH0A 3EUNA 1JNZB 5IM0B 2CJQA 4FVCA 4EBEA 3BGOP 2MQMA 4CLLA 5HQMA 3CXCR 2VPZB 2Z2MA 1VQNN 4ZOSA 3OTEA 1OSCA 3FJ2A 1H7WA 4BY9C 3H1QA 3V6DB 5L9XA 3CQYA 3OFGA 4URSA 1U6ZA 1XQIA 4LJMA 2FJAB 3UCZP 1FNOA 1YJTA 4HT7A 3NKYA 4PG5A 4DPYA 4UUWA 2IIRA 4JI7F 4DUZJ 2M5YA 5GINA 2JEJA 4J9OA 3R9LA 1NSAA 2ZVIA 1O1WA 4RL1A 1FRJA 4NZ6A 4O0NA 1P9QC 3ET6A 2BJ8A 2UVWA 5M1QA 3VETA 4JI0F 4IG3B 3MCOA 3GE9A 4CI6A 4JAXA 2VBYA 2D3O1 4KV8B 4TSXA 5D78A 4G3IA 4Y2MA 4N47A 4CFAA 2XYHB 5L1LA 1WNSA 4CK1A 3BZCA 2HVDA 2HFZA 4F8RA 1NMEB 1EETB 2DGVA 1FK9A 3BUZB 3CNQP 3X3UA 2CAJA 3HOSA 3H2VE 2DKOB 3R9PA 3OD2A 5AQRA 4GVBA 3QO9A 4PYDA 3O4NA 3UCUP 2MJUA 2KT3A 2FBYA 1X1PA 2ZGYA 3MM7B 2OPQB 1NLKL 2UXCJ 2HVHA 4OKEA 1REVB 2CQPA 4F04B 2XCAA 4ED5A 5KG4A 1RT5B 3NG8A 1WLJA 3R2DJ 1UJ4A 2CVEA 5KFPA 1KHWA 2CH6A 1TL3A 2DT9A 4CZEA 4JKGA 1S4FA 4WYBA 2QA1A 2H48B 3IFEA 4J2BA 4LY7A 2JFKA 2MQ8A 2V8GA 3E01A 3TEGA 4IFVA 2CGJA 4JV2A 5LMNF 2XLKA 2KU7A 3ZSVA 2E4LA 2FSNA 1JLBA 4ZVHA 3QRPA 2X78A 2H4YB 1HWLA 5AJ3K 3U1LA 2AGPA 1WHWA 1PYTA 2W9CB 4K50A 2HZVA 2VYPA 3IM9A 3VQ8A 2DVIA 3AD9C 3MM8A 4H0YB 3IGNA 1IBMJ 2XB2D 4FM1A 1YJNN 1Q86O 2ASYA 1HLWA 4KHUA 4FYWB 4FWPA 4YB5A 3A5OC 3T1HF 1P1LA 2DGWA 2IJNA 1R8AA 1IKYA 1UA0A 5F8JA 3UDLA 1WAFA 4ES2A 1J5OB 2QRRA 1O51A 2ZGZA 1HMVA 4WKRA 1FJEB 2FLLA 2O67A 4RBTA 4QJVA 3CPEA 3OS0A 2O8EA 3H8YA 1ZBTA 2GMHA 1RNHA 4DV6F 2KXFA 2IVFB 4FLYA 3GIIA 1WC5A 1XNQJ 2W41A 2WVBA 2OFGX 4NLQA 4ECSA 1V5VA 4MKAA 4ZP8A 4WCEL 3AY0A 4ZS6A 4O0IA 3VZHA 1HW9A 3HSCA 4PPDA 3FZMA 1S1VB 2IYIA 4PG7A 2X1FA 1VQ8S 5AQXA 4PG6A 3SQ0A 1H72C 2V8PA 4JV1A 1Y97A 1T03A 3JB9k 4NRTA 2HFSA 2HWHA 3DOMA 1PIEA 5EWEA 4J9LA 4RUHA 3RR8A 4FF2A 4CZCA 3T3FA 1YIJS 1S6QB 1D09B 4WQ5A 2ADBA 1KWMA 4DL6A 1NCLA 4MKYA 1KQSM 4CLSA 4BR7A 1FX2A 2NRRA 1O13A 1NJZA 4LT6A 1ZAVA 4JI2F 2O4GA 4FWQA 2FC9A 4JHDA 2O8BB 4KH1B 2M8DB 3B6BA 2J7UA 1N48A 4TNOA 4ZCLA 3NMUA 3V81A 3TARA 1GEHA 3CMAS 2FBVA 4BVOA 4ZVOB 1CZBA 1V9OA 2H5EA 4MLEA 2PFDA 3HBTA 1LXJA 3G8SA 2EXUA 4L73A 1KVIA 3NF9A 2DFFA 4B3OA 2R7YA 4AD6A 5K9FA 3G6YA 2DR5A 4PZVA 1FKOB 5JLHA 3BQ0A 4ZA1A 1OYEA 1BUXA 1VQKN 3CC7N 2XMJA 4DV5F 4LIWA 3DDIA 1K8AO 2MQPA 3KK2B 3EZOA 1UP1A 4Q0BA 2I0XA 3BB5A 1IR2A 2W24A 4MIAA 3C15A 2WVEA 2D3UA 2RKIA 3VESA 2C3MA 4M63A 3P38A 3SUOA 4PY5A 4QIGA 1KTVA 4OYBA 5IC4B 3GV5B 4BVPA 4X4UA 2DTJA 2P9UB 3QETA 1HYVA 3HYFA 3GCWP 1BQMB 4YMEA 1T3NA 3EPIA 3I96A 1TTHB 3V5RA 4Q45A 3OS1A 1S79A 1HRHA 4NLDA 1YF5L 4CLFA 2VA2A 4CZLA 3A1YG 4KHRA 4CO3A 4JN4A 4FZVA 3NH2A 1SJQA 1YJUA 2PN6A 2JLEA 1CG2A 2VC0A 1MWZA 4BRDA 4QCLA 4CBXA 4NLCA 3M6XA 5LJ5Y 2BR0A 5M1PA 2GVDA 5F1XA 1MG7A 1IWGA 1LW2A 3L4QA 1WSGA 4WIQA 1YAGA 5F8MA 3LQVA 3CCSS 4NXNJ 4WPAA 2JSXA 1HKGA 5AJ3F 2RE1A 4B3MK 2G1DA 4HTLA 1HQ2A 4DR4F 3G6EN 2AZ1A 1YJ7A 3EM1A 4USTA 2CQIA 2MKJA 4OI1A 3GBTA 5C42A 5HBMA 4LFCF 2MZRA 1ULRA 3NLCA 2FJVA 2NZ4A 2P9EA 4P10A 4H0PA 5B0DA 4JI8K 3B8HA 1GT8A 2OYQA 4BRQA 2AX1A 2B7BB 4EBCA 2YH1A 2DNQA 1Q7YO 1FNXH 1S6OA 4EZ6A 4FF4A 3UVJB 2CZ4A 4USMA 2QMWA 3HHEA 1S0OA 1RDCA 4DL2A 4EZ9A 1PO6A 3PTWA 4ZK7M 3CCJN 2GX9A 2HMIA 1JK9B 2XI3A 5JVHL 4KGVB 4O3QA 3FFKB 1V3ZA 4HVZA 1Z4UA 1KSPA 4E7LA 3AA5X 4DV7K 2BYCA 5CHIA 1NB7A 3LP2B 2NYHA 1EQ0A 1IM4A 4IKAA 3V4IB 4LRCA 4CLKA 4AM6A 1Y3JA 2EFQA 2ZH4A 2DGSA 4A48A 1EARA 3OY9A 1N6QB 2MSSA 3H40A 4CLTA 4QWEA 2OAUA 3ID6A 3FSXA 3IAM9 1VQSA 1RTHA 1KXPA 4BCAA 2YCHA 3MEGA 2V4JA 4IDHA 4HACB 1NSQA 3IUCA 3AB4B 3QEWA 3H20A 4C1NI 1RAJA 3IKMA 4TYBA 2XZTB 4BE0A 2VCPA 1W2BM 4H4OA 3BGRA 3DMJA 4B3RF 1HL6A 3J7YP 4GKKK 1ZM9A 3WQUA 2VIHA 4RW6B 1H0HB 4P71A 4BRMA 4FYDA 2V52B 2YX7A 4CJ7A 1WSRA 1E6YA 4A8KA 3G8QA 4C48A 1UVNA 2E5LK 2AF6A 5A2QU 1W7WA 1YRXA 4WJBA 4BRAA 4L3KA 4NLOA 4UF4A 2CPFA 1HR0J 2EVZA 3OVNA 3MM9A 1XMQF 1YJ9S 3I55S 5KTQA 2B43A 2O8FB 4K4YA 4ZVRB 4G1QA 1DFDA 3C16B 5H9EK 3VGUA 2DR8A 1BWFO 1RDBA 1U1MA 2IRXA 5AXMA 5C7PA 3CJTA 4CYUA 1G6BA 2RQCA 5HRNA 2FY1A 1XMOF 2PMZD 3UI3A 3UR3C 3EE8A 4MO5A 3JAMU 5L1KA 2AYGA 2A5XA 1A0OB 3PKMA 5AQMA 4CJKA 3W0LA 4YNQA 2BQRA 4DPUA 1GMWD 1XNRK 2GAGC 2VD3A 4DV1K 1O6XA 3GJTB 3DLLL 4WYLA 3RMAA 3J81U 4CT8A 2OHDA 4ZVUB 3ZTSA 2HFVA 2ITGA 2V67A 2IIHA 5DM6Q 1D9DA 3J7Z5 2YX6A 3SLCA 5DDPC 1QJHA 5SUHA 2P9LB 4X4TA 2YJEA 1RA6A 3MHYA 1HPMA 2PT0A 3WXJA 3SAHA 2BE2B 3CDBA 1KOHA 2AP6A 1TUUA 4W90B 5M2UA 1T95A 1WOSA 4NXMK 4HDGA 1Q8KA 3N6NA 4B3MF 1FRLA 5D0GA 3BO2A 3M6UA 4Z2XA 3AJ2A 1U1KA 2WRMA 3NF6A 1W2IA 3DHXA 2I7NA 4ENOA 3KD5E 3MCPA 3SBTA 2RF2B 3A3NB 4JI8F 1S49A 3ETMA 2M70A 3SCJE 2HQGA 2YQ3A 2IM2A 1Q79A 1XBWA 3I4PA 2ZNYA 3K57A 2VFRA 2ERRA 3OR1B 1O5JA 2NRTA 1QY7A 3H25A 2QXLA 3WZ0A 3QYYA 3C14B 1VS3A 3DRPB 2MY8A 2LA4A 3AA4A 2DNPA 1XUPO 3WXKA 2VG5A 5JXSA 4OZ3A 3L7UA 5D4OA 4DV7F 1KONA 1XR5A 1HD0A 3KDNA 4PKGA 3G82B 1B99A 4LF2A 1DARA 2C2EA 4MTPA 3C6UB 4HHJA 3JTNA 5C5JA 2WBNA 3DRRB 3JTPA 3L3UA 4HHUA 4RWTA 3A5NC 3DNCA 1QUVA 3EWGA 2PI4A 1WOQA 3O9SA 2OSQA 1RTIB 2PDAA 2V8VA 4CF9A 2J76E 1IXKA 1M5SA 4ZVPB 1BC6A 4I0WA 1JJCB 2FLNA 3KLFA 3PYFA 3OL7A 2QA4N 1HBOA 1U09A 2GJ2A 3D1QA 2J7KA 1OQ6A 1Y9OA 1DTTA 3RSEA 2C2OB 3HLUA 1Q4RA 4U67Q 1T6DA 3MTJA 4L6V3 3KJVB 1FTCA 3TAGA 4Z37A 4DLGA 2CWXA 3SV3A 1Y5NB 2OEJA 4XK8C 4M41A 3MWBA 4J9SA 3DLRA 3LDQA 1DJ0A 2FC8A 2YX4A 3IMXA 1XNQF 2ZJRQ 5JUMA 2O8CA 2DR6A 2ZNZA 4FLVA 3AO1A 3MM6B 4U9RA 3NNAA 4GVEA 3R5JB 2VFSA 2DNLA 4N7TA 3ZO7A 2KB2A 4DTXA 3OW2M 2HS3A 4FJ8A 3W2WB 4YFUA 4JI3J 1VSHA 2OI2A 2ZD1B 2O1PA 3M2VB 2AIRB 3R5AA 3GYXB 2FGOA 3V9SA 1RT3A 2MB0B 1XNRF 3ASMA 2AEMA 1NO8A 2UXDK 3JS6A 2K1RB 2AYBA 2IVYA 1YRTA 4YB1P 4DR3K 1TVRA 1J9AA 1FTRA 3DOLB 3W5XA 5KFDA 1PBUA 1KKHA 4O4RA 1IR0A 4DR2J 3QAEA 2GMLA 4CFBA 1YKWA 5FROA 1G2EA 4AT1B 1MSWD 4OZ1A 1S1TB 4IO9L 1S9GB 2ZJPL 2P9KA 3G25A 1AZSB 2HIYA 1ZTWA 3G6VA 2Y0SD 1GMVA 4WP8A 2EC2A 5FD1A 3RRGA 3EMTA 4J9RA 4FBTA 1IKWA 3DLGB 2KLAA 5KPRA 2W2QP 1MMLA 2F3JA 2MGZA 2Z56B 2E2QA 3B4MA 4NXMF 4V1Ak 1SL1A 4FM0A 2YWHA 4CF2A 4ZP6A 1RE1B 3MCAB 1VQ6S 2ZOGA 1C1BB 4GY2B 4DMNA 1NGBA 2KFZA 4ZVFA 5AZIB 1RBTA 1K0VA 4DSEA 3O3LA 1N5YA 3AGKA 3N4QA 3TA1A 3SCKE 1M90O 2GGPB 2KQ2A 1F9EB 1C0TB 3I5AA 1HBNB 3FCWA 3VWSA 3DXKA 3FFIA 3ZC4A 1S1XB 1EKSA 4CH7A 4TYAA 3DLBA 3BZKA 4YY3K 3EDRB 2DHAA 3NGDA 3ENHA 1QUPA 3T19A 2HAFA 3S6EA 5AXKA 4YDUC 2FVSA 1YVUA 3FMWA 1TR0A 1NDCA 1NK4A 4OL8A 4DPOA 1R6VA 1WBDA 4DTOA 1VOMA 3O6WA 1YBTA 2HBYB 5D4LA 5AE2A 2MZSA 4NXNF 5DLFA 3GONA 2BVZA 4HR2A 2XMVA 3ZSOA 3DM2B 4X2BA 1NG9A 4USIA 2DO0A 1DT9A 1U0HB 1U2RA 2ILYA 1D0EA 2HHHJ 3LPTA 3ZETB 3OL6A 3ZT2A 3A5LC 3M8PB 5HSPA 5F0XA 1NK8A 3NS5A 3ADAC 3CDWA 3VGLA 2M3DA 2V4QA 1JLFA 3K5PA 2OKQA 2CPIA 4KHSA 5GADI 2XNRA 3RB6A 3BF3A 2W8KA 4M3XA 3KK7A 3VV2B 4FWNA 2LU1A 3NL0A 4A2AA 3I56N 2DRDA 5KPTA 5F0UA 4FJJA 4X4QA 3L4IA 1URNA 3QIPA 1X4DA 2W4PA 4ED4A 3WT0A 4QWDA 3MDFA 1NK7A 3KFWX 3FZBA 2VDHA 2XMAA 4UY8O 1FJCA 2YPZA 5IQ6A 1RA7A 5KFFA 1NB2A 3W63A 3BH6B 2QWLA 2YHBA 4GVLA 1BHNA 3H4DA 3OYKA 2FHKA 3MPDA 1QQNA 5H9FK 1GLBG 3TSPA 1ACMB 3AVCA 4MIWA 4IOAQ 1HX1A 3CIMA 2GO8A 1T94A 2YXLA 1QTMA 1BI4B 3PVXA 3PJXA 4K8RA 4EFAC 3D68A 2UXDF 4P6QA 4FJ9A 2DY4A 1QD1A 3HKWA 4DR3F 2QWPA 1VK8A 2HQFA 2JGUA 1VQYA 3KUGA 3M4XA 3VAHA 2WB4A 4RJVA 1BL3A 3FGUA 2KFYA 4BGBA 3KLGA 5D4PA 3KMQA 3OYGA 3L2QA 5L8RC 1X0PA 5A0YB 5DDQC 4Y3CA 1UJ5A 4NA2A 3OFHA 4M3RA 4CZFA 3THVA 4X4PA 5B0GA 1D9AA 1LOUA 1C0GA 4CBUA 1I1GA 4A8MP 2LQ9A 4L76A 4H0XB 4ED0A 1WKLA 4OGCA 1I94J 3D6MB 4A61A 1BDGA 1YTUA 4F4WA 4HHHA 1P8ZA 2E2PA 3LDNA 1FJGJ 4K43A 2E1YA 4GV3A 2DH7A 1RHRB 4QAGA 1SPBP 5HMYA 2HHQA 5J2NA 4BC3A 4ECVA 4LF5K 3TAEA 3LGMA 4F36A 3NCIA 3D6HB 4WQ4C 3CCEN 2OUGA 3M32A 1BY9A 1H2TZ 1RCHA 2VUGA 3S8SA 3HXMA 4B3SJ 4NCBA 1N33K 2HHPA 3SJJA 1WSEA 3LP1A 2QEXS 3MN7A 3ATUA 5I3UB 2WSFC 2J9CA 1BUPA 3MMBA 4FWOA 4DQQA 3OQ2A 2I5JA 4C8NA 3BP8A 4DF8A 4FJHA 5CR4A 4YY3F 4CNYA 4X66J 2H1YA 4HWIA 3WHIA 1ZBHA 3D45A 3VAKA 3F0NA 3EE9A 4FW1A 3ZXWA 1UVLA 1VSFA 3NXZA 3MEEB 3EVMA 1LWFB 4FM2A 2WC9A 2VGNA 4BC5A 1Z05A 3UNGC 2C28A 5I42B 4CJSA 4LSNA 3SEOA 4QIWD 1SI9A 2VKRA 2O4IA 3ZTOA 2R2TA 1BHLA 1R8BA 5FRNA 2XI2A 3EL2A 4KH4A 4IKFA 5EX5A 2AQ4A 1MWKA 3TAQA 2XO7A 3VZIA 9RUBA 4PPZA 1S72S 3M30A 4OFZA 1ZM2A 1UOCA 4DR1J 4OMFG 3L09A 2ACMA 5LY3A 2LEBA 2Y0BB 4MQ3A 3TZZA 4J90A 4WIIA 3ZNJ1 4DX6A 2V9KA 1IKXA 2IVMA 5BR8J 3TWZA 1T3VA 2E1PA 4FDFA 4KB0A 2RILA 2XSJA 2ZF5O 3GG4A 2ZKTA 2R7XA 3FQLA 2UP1A 1G3OA 2W42A 2CDRB 5HROA 4K42A 4QR1A 1WJ9A 3BF4A 3LP3A 1FKPB 5J2MB 4CT9A 4JK7A 3UB5A 4LF9K 1FRXA 3AARA 1N52B 2NPFA 3JSMB 1ZH5A 4USUA 3W62A 5CQGA 2AGOA 2KHDA 1VBYA 1K9MT 2EWSA 3EDQB 2E8AA 1RT7A 3C6TA 4ER8A 4NWBA 1G4CA 5HRSA 2CQ4A 4L3QA 2G8UA 1FFWB 3P3DA 3KLIB 2HHSA 2R8HA 4DR5J 3PFOA 3H5YA 1VHXA 4B9MA 4O3RA 4B8CA 2MXYA 1VQ4N 3IGVA 4I6MA 3AGRA 3DI6B 2KKZA 2AHOB 3VF6A 1Y64A 2V0NA 2B4OA 1S1WA 3KIOA 1IQTA 1VQPN 3THPA 4BE1A 5IXUA 4RW8B 3U1NA 4QYZK 1H38A 1X0FA 3HD1A 4JK8A 5IWAJ 3VN5A 3IS9B 2W9AA 4OI3A 4ED2A 2B51A 2ZWHA 4CH1A 3C19A 1BIUA 3ZZ0A 4QU6A 4O3NA 1KQGB 5HQ8A 4B9VA 1RT1B 2YVSA 2QI2A 3GR0A 3J7AP 4RU9A 2E7XA<