1FKOA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkoA05
4ICLA 4RW4B 4EO6A 1S10A 2XC9A 1L3VA 4JS4A 1HYVA 2X6NA 1KLNA 3MXIA 4DTUA 4M41A 2XCPA 3GIJA 3UIQA 5KG6A 1IKXA 1N48A 4DQIA 1T05A 2W8LA 4WZQA 3GILA 2ZKUA 1JLFA 3OYHA 4NYZA 4J9RA 3MFHA 1HQEB 3THVA 3TAGA 2AGQA 1L3UA 3T5KA 1ZTWA 4DSIA 1SL1A 3NDKA 4RW9B 1IKVB 4ZTJA 3B6OA 1CXUA 2P1JA 1RBVA 5F8JA 2XY6A 4B9TA 1QAIA 4Y2CA 1C0TB 2ILYA 3CJ2A 1TV6B 3QIPB 4CHOA 4JV1A 3NFAA 4FJXA 4CEAA 2YNHA 4O3OA 4AHVA 4Q43A 2E9RX 4Q0BB 3NBPB 4DQSA 2YNHB 1NJZA 1TL3A 4CGHA 5F8GA 2BE2A 4TQSA 3RB6A 1BQNB 4DSLA 2UVRA 1RYRA 4FVMA 3EYZA 4KFBB 1RTHB 3WNFA 5KG5A 4GMJB 1CSJA 2RDJA 4M94A 4EEYA 2IMWP 1X9SA 4CGFA 2DTUA 4R8UA 4K4WA 1SV5B 4CGIA 4HHTA 3PZPA 4TN2A 4WE1B 4FK0A 2C2EA 2KFZA 2DFFA 3JSMB 2VWKA 3PX6A 2IC3A 4J9LA 1TK5A 4URGA 2ASJA 4BE0A 4RNNA 4YNQA 3FFIA 1XWLA 1C0UB 4ZVEA 3CDWA 3NL0A 4OGCA 3DRSA 3JYTB 4JUZA 5J2PB 4KI4A 3QO9B 1XHXA 3OHBA 4NLRA 3MR5A 3LP2A 3QLHA 3V6HA 4F8RA 3MTKA 4ZVHA 1RYSA 3NHGA 1WNEA 2OZSA 4YQWA 2FBYA 4E1NA 1WLJA 3SYZA 5HRNA 4F2SA 4RG8A 2QE5A 2JLEA 4I2PA 3O4QA 5CYMA 1A5WA 1QSYA 2IJNA 5KFIA 1JXBA 3B6PA 4OLAA 1B9FA 2A1RA 2E6MA 2WTFA 1J54A 3V4IB 4QW8A 2Y1JA 3MEDB 1BI4B 3QEXA 3PR5B 3HPOA 1GX6A 3SZ2A 4AHSA 3AO1A 4FJ8A 4OKJA 1VRTA 3U3GA 5KFXA 1TAUA 3MF5A 1TKZB 2FBTA 2X6SA 4DWIA 1VRTB 3I8DA 2AX1A 4DEZA 3SV3A 4IG0A 2UVUA 4KV8B 3SPYA 3KLHB 1TKXA 2W9BB 3RMDA 3BR9A 4NLTA 3M9MB 4NCGA 3AVGA 2KTQA 1IKWB 3ZSYA 3KK2B 3KKSA 4NCGB 2KW4A 4CE9A 1C1BA 3LWLA 4ZTFA 2W8KA 4QWEA 2I5JA 3OYGA 4CFBA 1SL0A 3LWMA 1TL1B 4NLDA 3KMQA 3V6DA 5JS2A 3TAEA 1C1CB 4DL2A 1ZETA 1RBUA 2R2TA 4XIUA 1QQCA 3L8BA 4DMNA 1QSSA 2B6AB 4FXDA 3HT3A 2YKMB 3CO9A 5DQHA 3ZSQA 3E01B 3KLIB 4CHPA 4URQU 1S1VB 5I42B 4URSA 3IAYA 3GV8B 3RAXA 3V9UA 3CFPA 4HVJA 4NZ0A 2R2SA 1KVBA 2RKIA 2PYJA 2WK4A 2HHWA 1SKSA 4DTXA 3D45A 1ZBFA 3KHHA 4K50A 2ATQA 4MFBA 2ZD1A 1VSLA 4J2AA 2Q3SA 3P83D 3SQ0A 4RW7B 5J2NA 4LD0A 3OYEA 4FLVA 3QGGA 4FJ7A 2AQ4A 1ZBHA 3VQ5A 4NYFA 4ECXA 3NF9A 1WSGA 2R7YA 1NOYA 3MXMA 4CERA 4EP4A 4ZP6A 3FRZA 3WNEA 1JXEA 3PR4A 5J2MB 3RBEA 4NLQA 2OPQA 4MKAA 4Z4HA 4CF0A 1LWFA 4CJSA 5FROA 3TWHA 1KRPA 4BDPA 1NJXA 3QGIA 4F4XA 1T03B 2JEIA 4DG1A 1JLBB 4LSNA 1YTAA 2XY8A 3F9KA 1X9WA 3DMJB 1QS4A 3AVLA 4ECRA 3OL9A 3CM6A 4IOBA 2Z1IA 1RT1B 1NK8A 1MMLA 4NLPA 1ZBIA 3SV4A 1HNIB 3NH2A 4FJ9A 1BQMB 4QWCA 2V4RA 3D28A 1KCFA 5EWEA 3M9NB 4E7JA 1LW0A 4OKEA 4H4MA 4PUOB 1LWEA 4NLOA 4TY8B 2FVQA 2R8IA 4CIEA 1U45A 4YR2A 1S9GB 4J9PA 4E7LA 4E19A 2CKWA 4F4YA 1RAJA 1J9AA 4F4ZA 5T7BA 3QEPA 4GC7A 3I0RB 1HRHA 2X78A 5HLFA 3OLAA 1NK0A 4LSLA 5C25A 4ZPDA 1XHZA 1TGOA 1LWCA 3GV7B 1EETB 3LDSA 4E7HA 1T8EA 1DLOB 1N4LA 1JLCA 5KFUA 4Y1DA 4BDZA 5KFTA 4KB0A 4J2EA 3L2VA 4IR9A 3BREA 1S1TB 1BL3A 3V6JA 4HUEA 4K4ZA 1JLCB 2FJWA 4PQUB 3H5XA 1VSEA 3CJ4A 3OYJA 4DQPA 3T19A 4WFZA 1VSIA 5KG7A 4G1QA 4M3WA 4TYAA 1F21A 4FJNA 3OS2A 3SNNA 1FKPA 3KLEA 4O3SA 2XY7A 2GIRA 3DOLA 3EPIA 5HRRA 2FC0A 4H54A 1FKPB 4ED6A 3KLEB 3ZSXA 1RA7A 3MECA 3OSPA 4O4RA 4TSXA 1C0MA 4M3XA 4CK3A 2FVPA 4E89A 1S0NA 4PY5A 3DLKA 3DRPA 2YNIB 3CVKA 3BQ1A 5F8IA 2PYLA 2BDPA 4KI6A 3OYBA 3GIMA 2HNDB 3T3FA 2AJQA 1WSEA 3OL8A 4DTOA 4H4OB 1CLQA 3HPGA 4QPXA 1RTJA 4IKAA 3M8PA 4TYBA 2IBKA 5DLGA 2HB5A 2Z1JA 1GOBA 2ETJA 4FJKA 2BRLA 3K58A 4E7KA 4OVLA 2IS3A 3BGRA 1HPZA 2ZE2B 4FJIA 4KTZA 5HROB 1EP4B 3CJ3A 3BQ2A 4F2RA 3VQEA 1HYSB 4QW9A 4IG3B 2FVRA 1FXXA 2VG5A 3S3OA 4KB1A 3TANA 2VG6B 1S0MA 3G6VA 3S3NA 2IDOA 2BQUA 5K14A 3ZCMA 3OL6A 1KTQA 1WSFA 2HHQA 3VQAA 2V0NA 1MU2A 2V4QA 5D3GB 1EKEA 3SI8A 4KAIA 1N56A 2C28A 1S6PB 3HK2A 4XPCA 4GW6A 1MU2B 4DTPA 4G3IA 4KHYA 4IFYB 1ASUA 3L2RA 4OKKA 4CECA 2YHAA 2XI2A 4CK1A 4EP5A 4X2BA 1FK9A 2ATLA 1HQUB 2PZSA 2VA3A 3OJSA 3HVRA 3VQ8A 1RT2A 3FQLA 2QV6A 4ZMMA 3PVXA 5KG4A 4QWAA 3IGNA 1DTTB 4JRPA 3RTVA 1JKHB 4AH9A 2HWHA 2ALZA 3HXMA 2OPSA 1ASWA 3HP9A 4I2QB 1RT7A 3V81A 4PWDB 5FDLA 3Q8RB 3LALA 1JLAB 1D5AA 1JLGB 2OA8A 2XCAA 3IS9A 2GUIA 1JLQB 3QEWA 3DLGA 5FDLB 4ZVFA 5EWFA 3LP0A 1SKRA 4WXWA 4Q5VA 3DLGB 1HNVA 2WOMB 5KFNA 5F8NA 2YKNB 4CEZA 5C24A 5DGAA 3KTQA 1XC9A 1BIUA 4B9UA 4IKFA 3NGDA 3PW7A 3CQ8A 2BANB 4Z0UA 4KKOB 2BQ3A 2NUBA 5KFCA 4ECQA 3QEVA 1REVB 1Z4UA 2IM3A 2HWIA 1S97A 1U4BA 3KK3B 2IAJB 1U09A 2HHSA 1VSMA 3H5YA 3KLVA 3AA3A 4C8LA 5KI6A 4RW4A 4JLHA 2PY5A 3NF7A 1UAXA 3M8RA 3DM2B 3HP6A 1NKCA 2JEFA 2VA2A 4C8NA 1RDAA 2P5OA 3DDKA 4TQRA 2JGUA 3RR7A 3AVNA 1HQEA 4ID1A 5DK5A 4E7IA 3HKWA 2BGGA 4AILC 3HJFA 1S1WB 1VRUB 2GV9A 4KRFA 3DLBA 1BCOA 1GX5A 4DQRA 5KFBA 1SH2A 4E1MA 4HUGA 4RW9A 1IKVA 3BSOA 1QE1A 4KHMA 1C0TA 1YT3A 4I7FB 4RW6B 2X74A 2B4JA 5L1KA 4ELTA 1QE1B 1TV6A 1Y97A 3L2WA 3T1AA 4J2DA 3QIPA 3CYMA 1B92A 1HMVB 3VQPA 2QKKA 4DU3A 2HNYB 4MKBA 4ZHRB 4Q0BA 2P5GA 1KFDA 3NBPA 4RNMA 4AHRA 4NCAA 4ED8A 4J9SA 3PO4A 4WFXA 3L2UA 1U47A 4FBUA 3ALYA 1RT6B 4WZMA 4M42A 1BQNA 4M45A 1TAQA 3EZ5A 4B9MA 4CJVA 5KFDA 4DSEA 1QSLA 1NKBA 4B9NA 5CY4A 3HVWA 3PY8A 3U3YA 4KFBA 1RTHA 3S3MA 4HCCA 4QOZB 4IR1A 2R8JA 2OPRB 3ZSRA 4FLWA 4CIGA 2IGIA 1SV5A 4QAGA 1TVRA 1U49A 4WE1A 3G6XA 3LAKA 3G0ZA 3H59A 3SUOA 4MK7A 3JSMA 3RMBA 3LZJA 2G8VA 4CEOA 4DSKA 2HVIA 1TVRB 3OLBA 4QWDA 5KFVA 4HTUA 5HRPA 1C0UA 5KT6A 2UVWA 4CHYA 3DRRB 5KFLA 3H40A 1WNSA 4ECVA 3JYTA 5KTQA 3QERA 5J2PA 1RCHA 3QO9A 4CF8A 2JEJA 3EZUA 4N5SA 3SQ4A 4N76A 5KT5A 1T3NA 3QZ7A 3GIKA 3NGYA 3LZIA 3TAQA 4FCYA 4CCHA 3ZSOA 4W5OA 4XO0A 4ECSA 1CZ9A 5F9LA 3SFUA 4IFVB 1KLMB 1IO2A 4K4YA 2HHXA 4LY7A 3VN5A 3V4IA 1VSJA 4LQ3A 1RBTA 3FDSA 3MEDA 4Z4IA 1BI4A 1UA1A 1DTQB 1N6QB 3AA4A 3KMSA 5JS1A 5EDWA 2FBVA 2F8SA 4CJLA 1LAWA 4FM2A 1KSPA 3AO3A 3K5LA 1RA6A 3T5HA 1TKZA 2YV0X 5KFGA 2WONB 3D5MA 4BDYA 2DPJA 5KT4A 1R0AB 4R0EA 4KV8A 3G10A 2AGPA 3NAHA 4EYHB 1Z26A 3KLHA 3AVBA 4IQXA 2W9BA 4DU4A 3HM9A 1RT4B 4ZPAA 4CGDA 1IKWA 4KSEB 3KK2A 3RB3A 1A5VA 1K1QA 3CDUA 4DS5A 3KHLA 3G6YA 3RRGA 4Y34A 1RDCA 1TL1A 3QETA 4O3PA 1C1CA 5L9XA 5CZ1A 3Q8QB 3AO4A 3PX0A 4FJGA 2B6AA 4CEQA 5HBMB 5L1JA 4ZVGA 4CEDA 4FLTA 2R8HA 4DU1A 2GC8A 2YKMA 4ZPBA 1LW2B 4XPEA 2Z1HA 3OYMA 3E01A 3PW5A 3KLIA 3BSAA 3HHKA 1S1VA 3O4NA 4AHTA 5I42A 1XR7A 3I5AA 4DFJA 2YHBA 4DTNA 1UOCA 5SWMA 3V9WA 4R5PB 1RBRA 1ITGA 1FKOA 3C6UB 2IM1A 4FLZA 1RDBA 4KHNA 3VQ6A 4OPKA 3DYAB 3PHEA 3K59A 1OS5A 3L2QA 1FKOB 4L8RB 5FRMA 1TK8A 4DL6A 3CFOA 1W9HA 5J1EB 4YP3A 4RW7A 1O1WA 5KGXA 3O3HA 2HMIB 4FJHA 1VSDA 3UDLA 2B5JB 4M3UA 3FSIA 3KLFA 4B9LA 3OS1A 4MIAA 4ED3A 3H08A 3UQSA 3KLFB 5J2MA 3ULDA 2R8GA 3PW0A 4N47A 1NJWA 4KHSA 5JXSA 3IG1B 1VK0A 4KPYA 2WCXA 4NLSA 4E3SA 1T03A 3TABA 3LPTA 4TY9A 2HAIA 1JLBA 5FRNA 1HJRA 1NK5A 4K8XA 4ECWA 4IH6A 3VQ4A 3DMJA 1Q8IA 3KLGA 3OVNA 4DTSA 1N5YB 3TVKA 4CJTA 1RT1A 1S6QB 4FLXA 3TAFA 3MAQA 3KLGB 4ZP7A 1RT3B 1HNIA 1BQMA 3CJ0A 4OGEA 3KK1B 1TKTB 3G86A 3F73A 3V9SA 3C6TB 3KIOA 4BWJA 4M95A 4PUOA 4TY8A 4K4XA 1Z25A 1S9GA 1U04A 2BRKA 4NRTA 4ZP9A 3TARA 3ITHB 1SUQB 2FLPA 2W9AA 3TR8A 4JV2A 3AVHA 2HNZB 3QZ8A 3AVAA 3I0RA 1SH0A 5L1LA 4RNFA 4Z4GA 4RW8B 3K2PA 4O5BA 3NKYA 3RMAA 3N6NA 4FZXC 2KZZA 1EETA 3CM5A 1C2PA 3HVAA 3PUFA 2IM0A 1DLOA 1S1TA 3L3VA 4DFMA 2ILZA 4PQUA 3QNOA 1ASVA 1LAVA 3IRXB 3TAMB 3ZT1A 2XI3A 4DLEA 3VQBA 2RF2B 1NK7A 4RZRA 4FK4A 1Q9XA 1D9DA 3ZSZA 1L3TA 2FLNA 3HSTB 4CJ3A 4AHUA 3AO2A 2DPIA 4CJUA 2XHBA 2D3ZA 1NK4A 1X1PA 3NMAA 4DL3A 1S48A 3QIDA 1K6YA 3QEIA 4CHQA 5KFOA 4IDKB 3LAMA 4FZZA 5EWGA 1S1XB 3Q8SB 2J6SA 4O4GB 1KFSA 3BDPA 4OPJA 3VA3A 3AVJA 4DFKA 2YNIA 3NCIA 3RB4A 2KFNA 2FJVA 1D9FA 5KFZA 4U7CA 1JL2A 2HNDA 3DLEB 4CJPA 1RTIB 5KFYA 4CEFA 4H4OA 4M3RA 4O44A 3KD5E 2WRMA 3DLHA 4J9MA 3ICLA 2D41A 3BSCA 3NF6A 3V1QA 3ZT0A 4E0DA 4O44B 4TLRA 3P5JA 4DS4A 3I0SB 2BR0A 2OH2A 4PA1A 2ZE2A 3SQ2A 5HROA 4RNHA 1EP4A 5T14A 4FJMA 3GYNA 1UA0A 2C2RA 1HYSA 5KFKA 3T5LA 4YFUA 4IG3A 4B3OB 2VG6A 5HP1B 3CFRA 4O0JA 4DF8A 5KFJA 3QINA 5D3GA 3KJVB 1L5UA 1S6PA 5F8HA 2ZQBA 4KAZA 2XO7A 3SJJA 3ASMA 4IRCA 3MEGB 1CXQA 1XI1A 5F9NA 4IFYA 4HYKA 1NHVA 1J53A 1XR6A 3CDEA 3HVTB 4ED2A 2YNGB 3LP1B 1YTUA 3NGIA 4M3ZA 1HQUA 5DG7A 3OY9A 2YNFB 1TP7A 1IH7A 3C94A 4JV0A 4FW2A 3GIIA 3AVCA 4WFYA 4CJ5A 5KFMA 3H2LA 1DTTA 4RUAA 2OPPB 3PW4A 1WSIA 4UQGA 1VSFA 1D8YA 3NF8A 1JKHA 3LP3A 3O3GA 4I2QA 4PWDA 1T94A 4HCBA 2UVVA 1JLAA 3DLRA 1JLGA 3VQQA 1JLQA 4W5QA 4DL7A 4EYIB 1ZTTA 2GIQA 1ZBUA 3NH1A 4DTRA 3EPGA 2XGPA 1RT5B 1NNDA 3N6MA 1EXQA 2WOMA 4O3NA 2YKNA 2EX3A 5KG0A 4ID5B 1J5OA 4QCLA 1UWBB 1I6JA 3M8QB 3SUNA 2BANA 3H4BA 4KKOA 4FLYA 3M8SA 2G8FA 1J5OB 4RNOA 5DQIA 1REVA 1IKYB 4CFCA 3FQKA 3SPZA 1S9FA 2W9CB 3KK3A 2O4GA 2IAJA 4YR3A 3PX4A 1Q9YA 1JLEB 3K5NA 4Z4FA 2VG7B 4O55A 4EBCA 2E4LA 2F8TA 4FBTA 5DG9A 3DM2A 4F4KA 3D0PA 4K4VA 3OYIA 4CF1A 4NLYA 4KO0B 2IM2A 3IN5A 4KREA 2D5RA 1S9EB 4J9OA 3U6FA 1TQLA 2JC0A 5CZ2A 3OYNA 4Z4CA 4OL8A 3Q8PB 1BISA 1S1UB 1W0HA 4B8AB 4O3QA 1S1WA 4DSJA 1VRUA 3MEEB 4KHWA 5F8LA 2E6LA 3ISNC 5KFRA 2FVCA 4FS2A 5EU7A 1T7PA 4KHUA 5J2QA 4I7FA 3MR3A 4RW6A 3KHGA 5KFAA 4ICLB 2XY5A 5J2QB 4NRUA 1HMVA 2AU0A 2HNYA 4ZHRA 1NOZA 1YVUA 4DFPA 2E9ZA 3H5UA 1IKXB 4W5TA 1ZBLA 2D7SA 1T05B 2UUTA 5KFSA 1RT6A 4BACA 2XGQA 1JLFB 5I3UA 4DF4A 3NAEA 5I3UB 2GBZA 4CJQA 1QTMA 2W7PA 4B08A 2F96A 2OPRA 2J6UA 3K5MA 2HHVA 4CFAA 3OS0A 1A5XA 4ZPCA 1L3SA 5KFEA 2RN2A 4WYLA 3MR6A 5KFFA 4FJLA 4ED1A 1D1UA 2J6TA 3DRRA 4C8OA 3OJUA 1TL3B 4TXSA 3RRHA 4DTJA 2BE2B 3NAIA 4ELUA 3MFIA 4M3TA 1QAJA 5KT2A 4FM0A 1SKWA 4LH4A 4NLUA 1S49A 3LANA 4NLGA 3HPHA 2G8WA 5F8MA 4DQQA 4R8UB 1BHLA 3TI0A 4CESA 1RDDA 3HYFA 4O0IA 4IFVA 4CJFA 1KLMA 4FK2A 4FM1A 2IC3B 2DFHA 1XR5A 3V9XA 1NJYA 3FFIB 2D0BA 3RB0A 1DTQA 1N6QA 4J2BA 2DY4A 3DRSB 3CWJA 2FLLA 4ELVA 4Y1CA 1B9DA 3LP2B 3QLHB 3V1RA 2Z1GA 3E51A 3QNNA 2WONA 5KFHA 4Q44A 1R0AA 4ZP8A 4U6PA 4I2PB 5CYMB 4EBDA 4KHRA 1RT4A 1VSKA 3VQ7A 4EO8A 4ECYA 4ECTA 2C22A 3HO1A 2KQ2A 4FJJA 4M3YA 5KG3A 1NHUA 2JEGA 1EX4A 3H5SA 1WAJA 3V6KA 3QESA 3PW2A 2D0CA 2W7OA 5HBMA 4CFDA 4EZ6A 1LW2A 4IG0B 2IA6A 4HUFA 3CJ5A 3VQDA 3OYCA 1TKXB 1U48A 2IJFA 4ECUA 4KTWA 4EZ9A 1BIZA 2LSNA 3SUQA 4R5PA 3OHAA 1G15A 1ZYQA 3S9HA 3RMCA 3C6UA 4YMEA 1YVFA 4MH8A 4QWBA 3DYAA 2R2RA 1LV5A 2OYQA 2E9TA 1VSHA 4FZYA 1X9MA 4KE5A 2ITGA 1C1BB 4Z4EA 4N41A 2I5JB 5J1EA 5HRSA 3V6DB 2HMIA 3TQ1A 2B5JA 4IH7A 4KB7A 1SL2A 2CJQA 1KVAA 3BSNA 2BQRA 4CEBA 4BE1A 1RBSA 2P51A 4IH5A 5KFWA 1WAFA 3P1GA 5SZTA 3IG1A 1S0OA 4DL5A 1S4FA 2RKIB 5CYQA 2ASDA 4C8KA 3OYLA 3V1OA 4Y3CA 3VQSA 1D0EA 3I5CA 3EY1A 1JX4A 5CYQB 1N5YA 3KKRA 4B8CA 1IG9A 4MFBB 2ZD1B 3O3FA 4CF9A 1S6QA 4WXOA 5J2NB 1NKEA 2HVHA 4WYWA 1RT3A 3KNAA 3KK1A 1IM4A 4KBIA 1I3AA 1TKTA 3RAQA 4IRDA 3OYAA 3C6TA 5DQGA 4F4WA 4FW1A 2UUWA 4B9VA 3OYFA 2FVSA 3WNGA 4CF2A 3OYDA 2OPQB 4ECZA 3GV5B 2D0AA 2G8HA 2R2UA 5KT3A 3ITHA 3AVKA 4MQ3A 1SUQA 4RU9A 1LWFB 4N56A 3AVIA 1NK6A 3VQCA 4ED0A 4C8MA 2HNZA 3OYKA 3SUPA 4DG1B 4RW8A 4LSNB 4NYNA 3SQ1A 3DI6A 3OSNA 1HYZA 1SH3A 2I1RA 3H4DA 4CGJA 3UR0A 3DI6B 4HKQA 4F3OA 2QXFA 3RWUA 2JC1A 3A2FA 4Q45A 2XWYA 4KHQA 3GQCA 1LW0B 2RPIA 3TAPA 4CJKA 4H4MB 4CHNA 4CJWA 1LWEB 3IRXA 3TAMA 2F8EX 4GVMA 2HW3A 2B43A 2D3UA 2RF2A 1RNHA 3AA5X 3MXJA 4FS1A 2FJXA 4I9QA 4I9LA 3PJXA 3CG7A 1WSHA 4EBEA 4FLUA 5HLFB 4IRKA 1WSJA 1QUVA 4LSLB 5C25B 3C95A 4IDKA 1LWCB 3T5JA 3I5BA 1S1XA 4CJ4A 1QHTA 4O4GA 4NLXA 3RBDA 4IBNA 4Q8FA 4K8ZA 3KD1E 5C42A 5EUHA 3ZT3A 2Y1IA 3QIOA 3QGHA 3DLEA 2QK9A 5C42B 5C5JA 1RTIA 1KHWA 4NLWA 5L1IA 4Q8EA 4G1QB 4K4TA 4K4SA 5KFPA 4CK2A 4ED7A 2OZMA 1BCMA 3ZSVA 2AWZA 5KT7A 2RDIA 3I0SA 3DOLB 2IOCA 3AVMA 4GC6A 1GOAA 4BE2A 2AGOA 3ZT2A 4J9QA 4CGGA 2O4IA 3MECB 5KRSA 5JUMA 3AV9A 2V9WA 3DLKB 1JIHA 3DRPB 4B3OA 3SCXA 3CIZA 3SFGA 5HP1A 2G8UA 3BJYA 4H8KA 3AA2A 5KGWA 2FBXA 3KJVA 2WHOA 3BQ0A 1C1AA 2KZMA 2DFEA 1RTJB 2A1SA 3MEGA 3SI6A 3M8PB 2G8KA 1JXLA 3K5OA 3QYYA 4O3RA 3K57A 4NLVA 3BGRB 5DGBA 3HVTA 1S5JA 1HPZB 2YNGA 3LP1A 4CJEA 4CIFA 4DLGA 2YNFA 1RTDA 2G8IA 4W5RA 4DSFA 3IGVA 2AX0A 4DTMA 1RILA 3WNHA 2VG5B 1RTDB 4J9NA 1RDRA 2W42A 3NH0A 2OPPA 5K14B 3N6LA 4NCBA 5KG2A 3RR8A 2XRIA 3AVFA 5E41A 3KOAA 3PV8A 2QKBA 2C2DA 3NE6A 3OL7A 3L3UA 1TKDA 4FJ5A 4MK8A 1HARA 4CJRA 1RT5A 2EC0A 3M9OB 4J9KA 3UPFA 4K4UA 1FK9B 3KHRA 4ID5A 3NGZA 1UWBA 4F3TA 4Y2AA 3M8QA 5KG1A 1NK9A 2ASLA 4RUCA 3ZSWA 4W5NA 1K1SA 1RT2B 5KFQA 2EHGA 1KHVA 3HL8A 1IKYA 2HHUA 2W9CA 4AHCA 1JL1A 2OPSB 4KTQA 1JLEA 4CHZA 1RT7B 3V81B 2O5DA 2VG7A 4F50A 4JRQA 4DL4A 1C6VA 3V9ZA 3IS9B 4FYDA 3PO5A 3ISND 5KRTA 3LP0B 1I39A 1BGXT 1HNVB 3LPUA 2R8KA 4KO0A 4OJRA 5C24B 4MIBA 1WN7A 4LH5A 4B9SA 1S9EA 5DMRA 4JS5A 1CZBA 1TK0A 3VA0A 1S1UA 3H98A 5DLFA 4BWMA 3PJWA 3MEEA 3AO5A 1KVCA 1W25A 3MR2A 4LQ9A 2WB4A 3ZT4A 5DG8A 2HHTA 4CEEA 3DOKA 1GOCA 4OLBA 2VWJA 3VQ9A 4YR0A 4MK9A 3DOKB
chains in the Genus database with same CATH superfamily
1S10A 1UEVA 3CJTA 3E66A 1H72C 4Y0FA 3UE2A 3C19A 3HF5A 2XCPA 3GIJA 5KG6A 1HIYA 1TMJA 1N48A 2QZ8A 2GVDB 1JLFA 5BR9A 1BD6A 2HBLA 3QRRA 4JYAF 3VTHA 1X0PA 2WTUA 2OEKA 4LF8F 2DNRA 4DR3F 3LPYA 1QAIA 4OYBA 4ZVQB 4GRSA 2DGOA 2ILYA 4AM7A 1ZS6A 1N32F 4K2XA 1V5VA 4CEAA 3R9PA 4Q43A 3VWSA 4DQ8A 1JNZB 2FJAB 1XMOJ 1TL3A 3FZ2A 2L48A 6FD1A 5F8GA 3GB0A 3ULEA 5HANA 1W7AA 1QD1A 4USUA 3BO2A 2V63A 2RDJA 1OSDA 3SAFA 4BR0A 3SCJE 2IMWP 4HHTA 5AZIB 1TU0B 2DFFA 2IC3A 4URGA 1YVNA 3QT8A 4RNNA 1FJGJ 2D9PA 3FFIA 2PMHA 1HR0J 5M1OA 3JYTB 5J2PB 4ETZA 2HSTA 3QO9B 1Q7LB 1ZOTA 3OHBA 2I7PA 5DS7A 3MTKA 4Z7YA 1RYSA 3O08A 2OZSA 2E7VA 1WLJA 4P2FA 4RG8A 5C2FA 2HVZA 3QPIA 2QE5A 4N8OA 2R7VA 1A5WA 1QSYA 2IJNA 4TVAB 1B9FA 2E6MA 5IT9U 2MLZA 2Y1JA 3O3LA 2NUHA 3QEXA 4MLEA 5IXUA 2DHHA 3OTCA 3TO8A 1Z2LA 3U3GA 3RJMB 1RWOB 1NGJA 2MZ1A 2YQ1A 2PSZA 1H73A 1T95A 2X6SA 1VRTB 1PJ7A 3I8DA 2U1AA 1E6VA 1P8GA 3QT5A 2ZHAA 4DV2K 2KLAA 5AZJA 3T1HK 3FKBA 3OVSA 4MYUA 1VC5A 3AVGA 2AIRB 1HA1A 5D4NA 3FCHA 1X9JA 1IJFB 3KKSA 4NCGB 4N77A 1H1VA 4ZTFA 2G2ZA 4C3KA 2MKJA 3V4MA 3OYGA 2HQCA 4LBHA 3J80U 4AFFA 2F65A 4DL2A 2PFFB 4DMNA 1F3VA 2CPYA 4L74A 3MTJA 3CCUN 4EHUA 3ENBA 3HT3A 1GLAG 2YKMB 3CO9A 2DXDA 3ZSQA 3E01B 3KLIB 3FNNA 1E6YB 2SXLA 3UKRA 3MN6A 4URSA 2RH3A 3GV8B 4RUHA 4NL5A 4NZ0A 2R2SA 3FK4A 5L9NA 2RKIA 2PYJA 3OVAA 1SKSA 4IUFA 1YKWA 2GFFA 5LMUJ 3HOSA 5C12A 1CC8A 2HZVA 2MKYA 4MFBA 1VSLA 5J2NA 4FLVA 3NGSA 1H3DA 5EX5A 1VMBA 1BLUA 5KPTA 1MMNA 1XNQF 4ECXA 4ILGB 1AZSA 4IOCL 3MXMA 2CPIA 4PG7A 2X1AA 3WEEB 4M7XA 4WFBL 3WNEA 1YLXA 5J2MB 3UCUP 4MKAA 5LMNJ 3THWB 4Z4HA 1YG0A 4DV0K 1FX4A 1I94K 3ET6A 1XERA 5AXLA 4F4XA 2VH7A 4DG1A 1QVGR 4JI5K 2B4UA 1HD0A 2VQEK 4C1NI 1FO1A 3CM6A 2QG9B 3LGHA 1MMLA 1ZBIA 1HNIB 3NH2A 2AZ3A 4JP8A 3PG9A 1RXOB 2KJVA 4H03B 5EWEA 3M9NB 4E7JA 3SQGB 2DHXA 4F36A 5H9FK 4H4MA 3GL1A 1LWEA 4NLOA 2P9NA 4TY8B 2CG8A 4YR2A 4F25A 1ZA1B 3THPA 1HHSA 2ZVSA 4F4YA 2MQ8A 3AOBA 2EBGA 2ZM6K 1NLKL 2DNQA 2PE8A 1S0VA 1BWVA 3WIUA 1NK0A 3HHLD 2Q2RA 4LSLA 2CPDA 3ZETA 1TGOA 1UETA 1EETB 2FUG9 3NG8A 1IQTA 5KFTA 4ANCA 4IR9A 1BHNA 2UXBJ 4J9VA 4K4ZA 4OZ1A 3AB2B 1NMDA 4WK1A 3DRYA 3M32B 1KQSM 4TYAA 3SSRA 2E1YA 3DWLA 4JKDA 4JD2B 3UDCA 3TTFA 3A8IA 1TFYA 1U2RA 4QJVA 2ZH4A 1KEKA 3T1YF 3EPIA 2AP6A 5HRRA 5K9FA 1U8WA 4NI2B 1JJ4A 4H54A 2AEJA 1SB6A 4Y65A 1RKJA 4EHTA 2QWPA 3MDQA 2G0IA 4P9SA 3MECA 3OSPA 4O4RA 4WU2A 3G8SA 4F04B 2RRAA 1YIJS 4DV5K 4W90B 4M3XA 4LF6J 4B9QA 2F9WA 2M9KA 1CS4B 1N36K 1T9UA 1U1NA 4LF4F 3BQ1A 4KI6A 3VEWA 1G6BA 2AJ0A 1D4XA 2HNDB 2VGMA 1RAIB 2QJ3A 4CLTA 3UD3P 1WSEA 3WUHA 4H4OB 2UUAJ 2ZH8A 2VQFK 1CLQA 3ZX2A 4NWBA 2QGFB 2P9SA 4TYBA 1GLBG 2HQ3A 3L6QA 1X7VA 2FD2A 1NH8A 1P1LA 3JXOA 1Q5VA 2V51B 3BGRA 2ZNYA 2ZE2B 3MCNA 1I1GA 2DH9A 1EP4B 2QFJA 5T7LA 2ASPA 1HYSB 1F0XA 2ZEJA 1Z6RA 4QOTA 5BR8F 3TANA 2VPYB 1S0MA 3S3NA 4ZIWA 3W5ZA 1KTQA 2CNOB 2HHQA 3UI3A 3DXKB 3MM9A 1WACA 4PKDB 4JNEA 1N56A 4GW6A 4G3IA 4YDUC 4ILLA 4IFYB 1KKHA 4JI0F 3HDSA 4CECA 3M1VB 1WG4A 2XZTB 2XI2A 2NLXA 4EP5A 4X2BA 1FK9A 2KU7A 1RT2A 1YJTA 1P6TA 3ETMA 3PVXA 4A2BA 4KIAA 3IGNA 3UN5A 3RTVA 4FWQA 4QZVB 2ALZA 1ITPA 3B4MA 3PIOQ 1RT7A 5FDLA 2E20A 1NRKA 3BUZB 1JLAB 1D5AA 2QW9A 4PZVA 3H0PA 3LP0A 3MURP 2FJBB 2JDJA 3CC2N 4CEZA 4AQYJ 1HBNA 4IKFA 3CW2C 3D2EB 3QICA 3BYPA 1ZXOA 3VENA 3L4IA 1Z4UA 2F9DA 2IM3A 3NNHA 5CHIA 1KVKA 1SAZA 2IAJB 2MHEA 3BO4A 3IO1A 1VSMA 3AA3A 4X62K 2UUCJ 4JLHA 2P9KA 4PXCA 1RHJB 3CC4N 4NEZA 1H7XA 2JL9A 1OIAA 2YBVA 3DDKA 3PEJA 5IZHA 3GFXA 1SIZA 2BE9B 2B56A 4ID1A 1PGZA 4UOHA 4KRFA 2AJFE 4DPXA 1WC4A 4E1MA 4HUGA 4RW9A 1IKVA 1N5SA 1QE1A 2VD3A 4LFBK 2D69A 2MY8A 1HBUB 5L1KA 1K47A 1Y97A 3AJ1A 2BH1A 3L2WA 3T1AA 3CJQA 5B7WA 3VQPA 3NMRA 4DU3A 4ZHRB 2FLOA 2JVOA 1KFDA 3TA1A 3TVYA 1EX8A 4OLOA 3GPAA 1R3NA 4BVPA 2O8CB 3X3UA 4WZMA 2P9LA 3G4SN 4DV3K 2F8MA 4M42A 1MROA 2W01A 4CJVA 1NKBA 2F4VF 5CY4A 1FDAA 3GZ7A 2CQIA 3U3YA 4KFBA 1RTHA 4QOZB 4IR1A 2OPRB 3ZSRA 3W2WB 4CLWA 1M5VC 1CBKA 1U49A 2HHHK 3CCUS 3LAKA 3ENWA 3RMBA 4C98A 2G8VA 3ZEUB 3CMAN 4B1ZA 2HIYA 1Q81O 5KFLA 3KDOA 3H40A 1WNSA 4ECVA 2P9PA 5KTQA 1RCHA 4CF8A 2NZTA 3PYFA 2JEJA 2NRXA 4JV5K 4PXDA 5ELZA 5KT5A 3AODA 1VLYA 2DHGA 3QZ7A 1T3NA 1HNWK 2CPJA 3LZIA 4P6QA 4FCYA 4CCHA 4X4PA 4W5OA 1NJIO 1OH6A 1B70B 4ZCIA 3LDLA 2HGLA 4IFVB 3MOZA 1KLMB 4K4YA 3TJ9A 2RQMA 1U7LA 1QY7A 3V4IA 3D2FB 1NDCA 2CG4A 3FDSA 5C2CA 2EWSA 2FSKA 1RE1B 1UA1A 1K8AT 1DTQB 3MK6A 4CLYA 4HTJA 5EDWA 2FBVA 2UUBJ 2OSRA 2Y1LB 1LAWA 1Q81T 1UP1A 1TKZA 2YV0X 2WONB 3AB4B 4BDYA 1R0AB 1HLWA 1RJJA 2DNMA 2C3PA 1Z26A 1UWAA 3KLHA 1F1BB 3ZLJA 1NHKL 4H5VA 1NJIT 4CGDA 3NCQA 1ULRA 2VB6A 4C3MA 3RB3A 3CDUA 4MT1A 3L95X 3MM6B 1RDCA 2CQCA 4DR2J 5DM6L 2CGJA 2X7IA 5L9XA 3Q8QB 2B6AA 4OYIA 1CULA 2R8HA 4D3HA 4U7BA 2Z1HA 3K8WA 3BSAA 2A3JA 1S1VA 4AHTA 2YHBA 5SWMA 3V9WA 1SS6A 1RAEB 5F3TA 5B0FA 4CT9A 4FLZA 4KHNA 3DGPB 4L8RB 5KPRA 3P4UB 4KH0B 4YP3A 3VF0B 2MQOA 4CZJA 4FJHA 2B5JB 2BBEA 4DV1F 4M3UA 1ZM2A 2LQJA 2J9DE 1NGHA 2CVIA 2V4JB 3VGTA 3H08A 1X4EA 2NXNA 3UQSA 3KK7A 4QIFA 3HHLB 4YUDA 5JXSA 1VK0A 3O8MA 5B0DA 4KPYA 3D6HB 4B3RF 3TABA 4CZIA 3BKTA 1QQNA 2VPWB 2XSJB 3VESA 4P7VA 1HJRA 4K8XA 4ECWA 2FYXA 3VQ4A 3KLGA 2B0GA 3OVNA 3HZ6A 5MLCQ 4UTGA 4CJTA 1RT1A 4FLXA 3MAQA 4OYMA 3BZCA 3QFWA 1WUAA 3IKMA 2A6MA 1S5ZA 5IWAK 1HKCA 2L41A 1LOUA 4MLHA 2CPEA 4RJVA 2W4PA 1U04A 2KFYA 3LDPA 4EGLA 3EKSA 4BRPA 1YRTA 2IHR1 1VQ9N 3CUNA 3TR8A 4KHPK 2M8DB 4ANEA 3QZ8A 3AVAA 5L1LA 1R8PA 3F9MA 4RNFA 4Z4GA 5D0HA 4YB5A 3FZHA 4F7VA 4DR1J 4OHXA 2IJRA 4FZXC 4RBUA 1IBKF 5AQHA 2BUNA 2NPIA 3SMZA 4QYZJ 3PUFA 2KKHA 1HBOB 1DLOA 2XQCA 3E9PA 3FC9A 4D3GA 3A5LC 4I4BA 4DFMA 5JVGL 1RWUA 1U1LA 4PQUA 5IT0A 1LAVA 4ZVRB 2O8EA 5L8RC 1AA1B 4OI2A 1A7GE 2FHKA 4YOUA 1NK7A 1SPBP 4HHUA 4FK4A 1Q9XA 1PJ5A 4JKGB 2DPNA 4X65J 2GVZA 1X1PA 2KHCA 1K6YA 3QEIA 2NS1B 3LAMA 2Z2ZA 4LF9J 1OKJA 2ASMA 2PFDA 3AQOA 3TEHB 3AVJA 3C14B 2LKZA 2UZAA 4RWTA 3RB4A 1N54B 4J90A 3CC2S 2GAGC 3ENVA 4U7CA 1JL2A 3VF6A 2E5LJ 2UP1A 4OV6A 5KFYA 2Z0GA 3VGMA 4O44A 3KD5E 4XDCA 3DLHA 3NF6A 2Z56B 4X4SA 4TLRA 3P5JA 3QMQA 2O66A 3NWGA 2BR0A 5HN0A 3IFRA 1YBUA 4L73A 4FPAA 3ZX0A 5K8OA 5HROA 3LQVA 3GJTB 1JB0C 1FI4A 5KFKA 3T5LA 1ZM4A 3CC4S 2QMUB 3Q7CA 4G1IA 5MLCV 1VQNS 1QVGM 5HP1B 1FFGB 3KJQB 1ICEB 2YH1A 2EG2A 3M30B 5D3GA 5M2UA 4DUYJ 2A6OA 1S6PA 4OV1A 4KAZA 2ZDPA 4A8KA 2GQQA 2YKPA 3ZZPA 1HBMA 3ASMA 4IRCA 3MEGB 1RK8A 4A8OA 2D1CA 4USHA 2N3OA 1AUSL 2ACYA 1NHVA 5K5MA 1XR6A 4KR0B 2C2KB 3WC0A 2YNGB 3U8XA 1Q4RA 3NGIA 5ADXH 5DG7A 3VR1A 2W6KA 3FZKA 2YNFB 3P5BP 2YQ0A 3AGKA 3BPSP 3C94A 2L9DA 1PG5B 2ZH9A 1M1KO 1DTTA 4UQGA 3R3TA 3JQKA 3NF8A 1JKHA 2F9JA 3AY0A 3O3GA 3G4SS 5B0EA 1T94A 4HCBA 5GMEA 4A8YA 1S3XA 3VQQA 4JI6K 1JLQA 4W5QA 4DL7A 4EYIB 2XMJA 4A5AA 2GIQA 1LEOA 2MEWA 3EPGA 5AJ3K 1GK8A 3N6MA 3MD1A 3DXSX 4A46A 3FBBA 2FF6A 2N7CA 2XMMA 2ZGZA 5ETOA 2EVZA 2JOQA 5CE3A 4QCLA 1I6JA 3BYRA 3SUNA 1F5CA 3H4BA 4FLYA 8AT1B 2PI4A 4B3TK 1J5OB 3CMAS 4DR5K 1JMTA 1YJ7A 4CFCA 3FQKA 1CEZA 2QWOA 3C16A 1S9FA 3KK3A 4YR3A 1M1KT 2VG7B 4L3NA 3NGUA 4IOXA 2W25A 4H4KA 4FBTA 4BRFA 3DM2A 2X3GA 4DV2F 1XMBA 3T1HF 4NLYA 1X60A 3LM9A 1WEXA 2KT5A 5GAHU 3IN5A 3AA8A 4KREA 4J9OA 2GQCA 3PRBA 5CZ2A 1H0HB 2W41A 4ISEA 1JNRB 4X66J 3MZIA 1S1WA 4IOAL 4KHWA 4UY8T 5EU7A 3ZTOA 1IUJA 4AT1B 2UXCJ 4KHUA 1WWHA 2HBKA 3RRKA 3P96A 4GVLA 1U1OA 3TW0A 1VISA 3OXFA 3N01A 3B8HA 1FRHA 3MR3A 3D6FB 3QAUA 5KFAA 5IQQA 2XY5A 3TZWA 5J2QB 3RSEA 2Q0UA 4NRUA 2AU0A 2HNYA 3AT1B 4LR7A 3DOMA 2CADA 2E9ZA 3H5UA 1ZBLA 1Q8BA 1RT6A 1H2VZ 2XGQA 1JLFB 1HNZJ 4RKUC 3NNCA 5HO4A 5LSOA 3CCRN 2B4VA 4USIA 5I3UB 2GBZA 1RHUB 3OPKA 3MAHA 2ZFHA 2W7PA 1QTMA 3IXQA 2VF3A 4CYUA 3FFKB 2J6UA 1TFWA 4CO4A 3ZZRA 3MOJB 4CFAA 4XK8C 3TA0A 3BBFA 2MGZA 5KFEA 2VOPA 3PFOA 4WYLA 5GMDA 4OZ5A 2DRAA 1SBRA 2KYZA 3DRRA 4LFAK 4C8OA 3OJUA 1TL3B 4BRAA 3M6WA 4DV0F 3CCJN 4TXSA 2FGCA 4FN5A 4X4RA 4ELUA 1I94F 3ULEB 3BKUA 3C46A 4JI5F 1HUXA 2VQEF 4FWSA 1S49A 3HPHA 2A2DA 5AQQA 2LVWA 1NMEB 1RDDA 4PG4A 4O0IA 2YPYA 4FK2A 4FM1A 2C2OB 2IC3B 3PEHA 3SDEA 3V9XA 1NJYA 4JKAA 3OUYA 5D77A 4PEOA 3T69A 3FFIB 1XJWB 3TX8A 4Y28C 1N6QA 4J2BA 2K3IA 5A2QO 4DCHA 5HMWA 2ZM6F 1HQ2A 4YEAA 4U67Q 2JSXA 3RW6A 3OXGA 3U1LA 5KFHA 2V9KA 4DR4J 2H5JB 4FPBA 4EBDA 3UNGC 1K9MO 2QTDA 4PKHA 4JAXA 4FJJA 4M3YA 4CQ1A 3MM5A 4RL1A 3C7NA 2FDNA 1NHUA 1NAQA 1EX4A 5THWA 2D0CA 1RBLA 4WU3A 2W7OA 3NXZA 4HI1A 5HBMA 4WP3A 4CFDA 3QBWA 2NXUA 4OI3A 1E6VB 1MN7A 4DV5F 4I69A 1UFLA 5AZJB 4ECUA 4IZ9A 4EZ9A 3O44A 1XMOK 1N36F 5CH7B 3IM9A 1WOPA 5MAOA 4H5TA 4R5PA 3OHAA 1ZYQA 2ABYA 3NNAA 3RMCA 2RRBA 2OKQA 1YVFA 4MH8A 5IV4A 3UCZP 1M5SA 2OYQA 4ZJQA 1VQ4N 5AE3A 2E66A 2J7WA 1WOOA 2VQFF 2JNJA 4DCOB 4OZ3A 4QYRA 5D15A 4K42A 5EXWA 3ZNUA 4IH7A 2CJQA 5LOQA 2VWBA 3BSNA 2BQRA 2NPFA 2IDLA 3BGLA 2MQMA 1QHAA 3HBTA 2I2YA 2VDIA 3UKRB 1FJGK 3CC7N 3IG1A 1HR0K 2DGVA 1S0OA 2DNOA 4DL5A 2RKIB 5CYQA 2ASDA 5JVHL 3OYLA 4WQ4A 3MMAA 4Y3CA 4NXMJ 1KC8T 2G1DA 3IAM9 3EY1A 1N5YA 3KKRA 4B8CA 4MFBB 1BA0A 3O3FA 4CF9A 1S6QA 5J2NB 1NKEA 1HKBA 2HVHA 4WYWA 3EZOA 2KN4A 2GA7A 1A6LA 3EMTA 1AZSB 3BH6B 4IRDA 3C6TA 5DQGA 4RR5A 3GE1A 2WSCC 2FVSA 4CF2A 4E8UA 5C10A 2O3DA 4ECZA 4P2SA 1Z1ZA 2R2UA 2AZ1A 2DGUA 4HT7A 3VQTA 4WF9Q 2M4MA 2B7CB 4RU9A 4U7UD 4RPFA 4A5BA 2MY7A 4DG1B 5G4DA 1ZBSA 2XNRA 7FD1A 2IFXA 1KTVA 1RSCA 2WW8A 3DI6B 5DZ6A 5BXIA 4WCEQ 1T44A 2KXFA 4CO5A 2EWHA 2HK3A 4H4MB 3RBXA 1LWEB 3IRXA 3TAMA 2VU5A 2P9NB 4GVMA 1P27B 1XQIA 4A8MP 2XEXA 2BM1A 1RNHA 3H1QA 5GAHP 4I9QA 2IYIA 3UD4P 2DNKA 1Q8KA 3CG7A 1RWPB 4ZS6A 3NVKA 3ILJA 5E33A 4LSLB 3K5PA 3ZETB 2KH9A 4CJ4A 4X62F 1QHTA 4O4GA 3GJRB 3MGJA 3H42A 4BQZA 3CCEN 5HSPA 3KD1E 3UKUA 4OPAA 2CPFA 5F0WA 3K7RA 3QGHA 3DLEA 3HHLC 3FZBA 2EG1A 3M1FA 3TA2A 5KFPA 4WIIA 3PJ9A 4DMZA 5KT7A 4I6AA 2J0SD 2RDIA 3AVMA 5CAAA 2GELA 4BE2A 2V2KA 3ZT2A 4J9QA 3VEOA 4LFBF 2O4IA 3MECB 2CAJA 3CXCR 2NREA 3CMES 1OY9A 4OHYA 2DGTA 4LT6A 5LMNK 5EHHA 3TP2A 1VDHA 3SCXA 1KVJA 3RUBL 4JK9A 1BG3A 2B7BB 3AA2A 5KGWA 1GLLO 1VQYA 2QWMA 4DV3F 2EEYA 3D3BJ 2FBXA 1C1AA 3D6MB 4PL8A 1W7WA 5JICA 3N5BA 2P9SB 3F56A 3QYYA 2CWXA 3S7RA 3ZXWA 3K57A 4NLVA 3BGRB 3AA9A 1UTAA 5F0UA 2VHGA 2QM1A 3VEXA 4CJEA 1KD1O 5A8WA 2FQQB 4OZJA 3W5XA 4DBQA 2HHHF 5TKYA 5T7LB 4DSFA 1ZZNA 4X4TA 2GTDA 3WNHA 1RTDB 4W4MA 1RDRA 1WC0A 4JI4J 2KG1A 2PN6A 2IVMA 5KG2A 1WHYA 3MM9B 5A8RA 3PV8A 2VC0A 3EXYA 4JV5F 1M5HA 3NE6A 1OH5A 4P74A 3CCRS 3MCPA 2JH3A 1HNWF 3ENOA 4FJ5A 3QWUA 2J0WA 1RT5A 2R3VA 4J9KA 2UXBK 2MZTA 2QMXA 1FK9B 3KHRA 4ID5A 2NQPA 5A0YB 3VGVA 1PKUA 2NCKL 1AUDA 2Z4PA 5KG1A 3I33A 3JQJA 5KPZA 1RT2B 5KFQA 1X5PA 1KHVA 1R0BG 2CQHA 1NO8A 2EPIA 4F3MA 4M5HA 2RT3A 4M5GA 4KH6A 3M8YA 2W9CA 1G4CA 1JLEA 4EMDA 1RT7B 1RHKB 2AJ2A 2A10A 1YK9A 3W3SA 2QLBB 1C6VA 3CETA 1PO6A 3PO5A 1Y10A 1NUEA 5EVZA 3LP0B 5DDQC 3ZNJ1 3EVWA 2KKZA 5K8NA 4B9SA 4USMA 2CQGA 2UUAK 3NY0A 3EE3A 3VA0A 3J7Z5 1D9AA 1DQAA 4LF5J 3PJWA 3AO5A 1KVCA 1WEZA 2NZCA 1BC6A 4WFAL 3JXUA 3W9JA 2VDHA 4MK9A 2RMLA 4ICLA 3CERA 2P9KB 2XC9A 2BE7D 5HQMA 3ENAA 1TUGB 2DYAA 2G0JA 5LL6Z 1UL3A 4M41A 4PYAA 1WUUA 1KAZA 1R6VA 3JS9A 2OI2A 5FD1A 2W8LA 2OTLS 1R0CB 2ZKUA 1OY8A 2V34A 4NYZA 3MFHA 3J81U 1TMMA 4FOIA 3ONQA 1L3UA 4MO4A 3T5KA 3NRBA 2ZH5A 1SL1A 3M05A 1Y11A 4RW9B 3PDNA 1IKVB 4G1PA 4ZTJA 4B9TA 5F8JA 1IR1A 1HW8A 2CNNB 1U2VA 2ACMA 2CIMA 2WBNA 4CHOA 3NFAA 1VOMA 3ZTRA 1X8DA 2XM3A 5IM0A 2QWNA 2E9RX 2HF3A 1NJZA 2BJDA 1N33K 2P9LB 3ZZOA 4C0HA 4BCAA 1MROB 4YB1P 3WQUA 3BEGB 3H3NO 3P45B 4DSLA 3VAFA 3I56N 1KVIA 4E98A 2GHWA 3EYZA 4KFBB 1RTHB 2Q31A 1LKZA 3NOGA 3WNFA 4LF8J 1CSJA 2VFVA 4EEYA 4Y6IA 3EE8A 5IWAF 1KOHA 4FK0A 1AYEA 5LXYA 2VWKA 5AQKA 1RDUA 4OX8A 3KXDA 5GADP 2ZVIA 2BOAA 3J81j 3CC7S 3D68A 4ZVEA 3NL0A 3CJ8A 4JUZA 1NB7A 5L39A 4NLRA 4KHPF 3LP2A 3QLHA 4PG6A 1XMQK 5AXKA 4E1NA 2UUCK 4DX5A 5HRNA 4NO7A 2JLEA 4I2PA 3SCKE 4WWSA 2QFIA 1LFWA 1WF1A 2OIHA 1FX2A 4C8YA 2WTFA 4PHTX 1J54A 1PBUA 3V4IB 2BKPA 2J9DA 2O8FA 3BF3A 2QA1A 3E2EA 1UVLA 2DISA 4JK8A 3TSPA 4X64K 2M7SA 3NVMA 4NXNK 3SZ2A 4AHSA 3AO1A 4OKJA 1VRTA 2FHOB 4YOTA 1V5IB 1TAUA 4LIRA 1B0TA 1DURA 1TKZB 4DWIA 2FBTA 2XLIA 4IG0A 2UVUA 1ATNA 3KLHB 1UJ4A 5ETNA 4NCGA 2RU9A 3W1YC 2YH0A 2HOEA 1FDNA 2KW4A 1IWAA 4UUWA 2DY1A 1TL5A 5IS2A 3Q7BA 2HRUA 3PYEA 1LK7A 1BQXA 4CFBA 3LWMA 3V6DA 1Y64A 1A9NB 3L8BA 2B6AB 3BBBA 2QMWA 4FXDA 3J80O 1CULB 2CZVC 3VTIA 1D8ZA 3SBMA 1VK3A 1VQON 1GMVA 4IO9L 1S1VB 1VQLN 3IAYA 2VICA 4FWNA 1QQOA 3CCES 2Q66A 3V9UA 4HVJA 4O0NA 3R3LA 2B4OA 3R5BA 2HHWA 4DTXA 3D45A 1ZBFA 2HS3A 2XB2D 3KHHA 4K50A 2FTRA 4OZLA 3D2WA 5CXTA 4M7YA 3TYTA 2Q3SA 2M0GB 4NMLA 3SQ0A 2CQ3A 3B78A 3IBFB 3QGGA 4BR7A 5A76A 3D9BA 1JJ2R 4NYFA 4BRDA 5FPNA 1Y3KA 1MLAA 3RBEA 3MMCB 2C2MB 2OMOA 5ETTA 4CJSA 1HWJA 4A61A 2GHPA 2UUBK 1NJXA 2IVNA 4WFBQ 1NLVA 3HTVA 1T11A 4PG5A 4LSNA 4LMZA 4NYPA 5GIOA 4LJMA 4ZLNA 3AVLA 2LXUA 2OMLA 4ECRA 3OL9A 4IOBA 4JI6F 1RT1B 3VF4A 4LF2A 3SV4A 4FJ9A 5AJ3F 3VV2B 4QWCA 4M5KA 1SVDA 2P9GA 3Q22A 3T9ZA 3R5DA 4CIEA 3KG0A 3HFZB 3BF1A 4J9PA 1VBZA 4E7LA 4E19A 1GTHA 3CULA 4B3TF 1PILA 4BLGA 4FVUA 4DR5F 3SQOP 3M6VA 2DB1A 4B1VA 3O2IA 4DR2K 5T7BA 2I6WA 1HRHA 2CQDA 2AYMA 3NOCA 5C25A 1VBYA 2DJWA 2OD4A 3GV7B 5F2RA 3LDSA 4M8LA 1DLOB 3CJ9A 4BDZA 3I96A 4KB0A 4J2EA 2YKQA 1JLCB 2FJWA 4PQUB 1VSEA 2C3OA 3OYJA 3CJ7A 4MTPA 1EAYC 3T19A 4JD2A 2O8EB 2QYGA 1FXDA 4GMKA 4YY3J 3FBFA 1XTZA 1U0SA 4FJNA 3OS2A 4LC9B 1KAXA 2PMZD 2V2QA 2GIRA 2JLFA 3AXMA 5H1SQ 2GVZB 1SQFA 3KLEB 1RCXB 4JN4A 4TSXA 1DY3A 4CK3A 3ATUA 2V8PA 4BG9A 2MTLA 3DLKA 2X1GA 2VODA 3CVKA 3LPEA 3GIMA 3CB4A 3T3FA 2J8SA 1VQ7S 3M8PA 1U02A 2IBKA 2HB5A 4FJKA 2RAQA 4MJKA 2IS3A 3FZMA 5E3AA 3T1YJ 3D4JA 3ELHA 5HROB 1KQKA 4CLPA 3CJ3A 2DH7A 1QJHA 3GR0A 4YN3B 2EFOA 1GMUA 4KB1A 2ZH6A 4DR6J 3G6VA 3QGPA 1URRA 3VGSA 5K14A 4LFAF 3L3CA 2H51B 3OL6A 1WSFA 3WC2A 3VQAA 4LF4J 2V0NA 2V4QA 4JKHA 5D3GB 4DR1K 3FEXB 1NPPA 4CBUA 2C28A 1S6PB 2JRSA 4XPCA 4BC5A 4CLUA 5B09A 1HBMB 3EVMA 2HPUA 4QYZK 3LDQA 2BTFA 4XTTA 3VVTA 3HD2A 4OKKA 1KP6A 2G4BA 1B3TA 2W2QP 2UU9J 1FF2A 4P72A 1T0TV 1I51B 3NCRA 4UW2A 3HVRA 2QV6A 4F26A 2G2YA 3ZTSA 4QWAA 1DTTB 3FR0A 2GMLA 1JKHB 2LCWA 1T3OA 1G1XA 3HP9A 2BABA 1CJUA 2JWNA 4K2JA 4QU7A 3NS6A 4UQTA 2GUIA 1JLQB 3I56S 4L3KA 4LF9K 4ZVFA 1BXNA 5EWFA 1C0FA 2B8PA 1SKRA 5LL6d 5KFNA 3ILLA 1R7IA 5F8NA 5C24A 5DGAA 3H2UB 1XC9A 4V19X 4B9UA 2E5LK 3OTDA 1Q16B 3CQ8A 3EUNA 5GAGU 3K17A 3IWNC 4CZGA 3C16B 1U4BA 3KK3B 5JJBA 5BRFA 1FXRA 1U09A 2R7XA 1LQ9A 4BQLA 2OD6A 3MMJA 4C8LA 1LXJA 4ZK7M 3VEYA 4RW4A 1GAOA 3U4LA 4DV4J 4RBVA 3M8RA 3DM2B 1NKCA 5BYQA 3AFGA 3G25A 2D0PA 4C8NA 1RDAA 3VHQA 1XMOF 4V1Ak 4QQBA 1HQEA 4DUYK 2BJ8A 1S1WB 2E7XA 4I56A 1T9YA 4WTOB 2E2QA 2AEFA 1BCOA 3R5CA 1GX5A 2IIRA 3R1XA 3A0IX 4KHMA 3PKYA 2XBPA 4MMOA 2LP4A 1C0TA 2RD5C 1QVFM 2FJDB 4ELTA 1TV6A 2P6SA 2NSBA 2HLUA 1FJEB 3RSEB 3OFGA 1NDLA 2HNYB 3DOMB 4CZHA 2P5GA 3NBPA 4RNMA 4AHRA 4NCAA 1HR0F 3PO4A 4WFXA 3L2UA 1U47A 2HGMA 1RT6B 2CJ9A 3EZ5A 5KFDA 4DSEA 4OYXA 5C15A 3I55N 3PY8A 3GTYX 2LXFA 1GLDG 2ZF5O 1PAEX 2X51A 3S3MA 2J7KA 4CYUB 4KH1B 5CYJA 2H5EA 4FF1A 1WG1A 3U1MA 1GLEG 1SV5A 1VJQA 1RHRB 4CIOA 4QAGA 4WE1A 3WX8A 2A42A 2YJEA 2D74B 3LZJA 2MGZB 2ZWHA 4QWDA 4WJBA 2V6AA 2UVWA 3GMGA 4CHYA 3DRRB 1HNXJ 3OV7A 1RUSA 4CLZA 4N5SA 3S1TA 4P73A 3IM8A 1ZA2B 2EC2A 4ZITA 1HKAA 4WIQA 2BM0A 3TAQA 3NGYA 2F4VJ 5K8MA 3VAMA 1EZZB 2NUUG 3WXLA 2D3OR 2HBJA 4O8UA 4AL6A 1CZ9A 1NU4A 5F9LA 4CTAB 3SDEB 4Z37A 1VSJA 4LQ3A 2C1EB 5E7OB 3OUYB 1DFDA 2Q1NA 4X66K 5CHCB 1N6QB 1TYQA 5JS1A 2UXCK 2DRDA 3Q24A 2HZCA 3IUCA 1N5VA 1HI1A 1DJ0A 3K5LA 3CD6N 2P9EA 2XMKA 3OA9A 4BGBA 1A0OB 2QLXA 2AGPA 4EYHB 2W9BA 1UMJA 1IBCB 2FZGB 4ZLJA 2QLWA 3K9KA 1OPIA 4GO5X 1IKWA 3KK2A 1A5VA 1OPZA 1K1QA 1HNZK 2XMUA 4QIEA 4DS5A 3MM5B 3RRGA 3C7NB 3EO3A 5ADXA 4NMXA 1TL1A 3O1BA 1C1CA 3CF5L 2BMBA 4DZDA 3EE9A 4LF7J 3AO4A 5EY4A 4CEQA 5HBMB 3M8WA 4OYOA 4H0PA 4CEDA 5M2PA 4DU1A 4GV3A 2BW2A 4ZPBA 4ZN3A 3CCTA 1Q18A 3D6RA 3PW5A 4MO5A 3HHKA 5DM6Q 1FW6A 1XR7A 3I5AA 5LMNF 5CA5A 4DFJA 4DTNA 9ATCB 3JQMA 2YX4A 4R5PB 2FIUA 3KWGA 1ITGA 4WBFA 2HS0A 1RDBA 2W2MP 4HEA9 3K59A 3PHEA 1JCGA 3L2QA 1FKOB 5FRMA 1TK8A 3WDOA 1KQSR 1Q1KA 3CFOA 3R27A 1W9HA 4RW7A 1O1WA 5KGXA 3O3HA 1OH8A 2AEMA 3UDLA 3FSIA 1WC1A 3QFUA 3BDEA 1S72N 1W2IA 3KLFB 4N47A 3R1HA 1NJWA 3QSYB 3W2VA 2XYHB 3IG1B 2EK1A 3TUPA 2IRXA 4ISGA 3ZO7A 4NLSA 2MJNA 2NYIA 2DNYA 3CJ1A 4BRMA 3MMAB 1H74A 5FPMA 3DMJA 2HFOA 2KHDA 1N5YB 2CQ0A 3TVKA 1S6QB 1MWQA 3DNCA 1BY9A 4BHQA 4UZBA 4J7CA 1BQMA 1REGX 3Q89A 3MHYA 3KUHA 2UXBF 2OAUA 2HFNA 3G86A 3F73A 3WIVA 3C6TB 4M95A 4PUOA 1UJ5A 2E5GA 2PT0A 4K4XA 4AXIA 3VAHA 3WXMB 1Z25A 1S9GA 5IT4A 4NRTA 3TARA 4WCEL 5TKWA 3HSCA 2FLPA 5GAGP 2XS2A 4CO0A 3I0RA 1NSQA 5E3PA 3TTDA 3TVZA 3N6NA 3CM5A 1C2PA 3LGNA 4MKVA 1V4SA 2IM0A 1FHTA 3P6YC 1FNMA 4RX6A 3SMPA 2XYPB 3AJ2A 1ASVA 1TL7A 1SJ3P 1FESA 3IRXB 3TAMB 4DLEA 3VQBA 5FPEA 2UUAF 3D3CJ 9RUBA 1WF2A 2B8QA 3AHPA 4U96A 3BZKA 3HSTB 4CJ3A 4AHUA 2DPIA 4CJUA 2XHBA 3IAS9 3J7ZO 4U7UK 3B8AX 4FZZA 5EWGA 5AQNA 4O4GB 2WW4A 1KFSA 3BDPA 4DHYA 2DKOB 2HVEA 3ETOA 4DFKA 3W8PA 2YNIA 2ZH3A 3C8YA 1FWLA 3UKUB 3NCIA 1VQ6N 1D9FA 2MZJA 5LJWA 3DLEB 4NXMK 2N82B 4CEFA 1Q86O 4M3RA 1DHMA 2WRMA 4JI2J 4J9MA 1DRZA 3CQXA 3BSCA 3V1QA 4E0DA 1LXNA 1YX2A 4FF2A 4ED4A 3BN7A 4WP8A 4FXVA 3J7ZT 4FJMA 3GYNA 3FE1A 1C4AA 4FO0A 2BV3A 2VG6A 3N4WA 4FP9A 1DQ9A 3T41A 2BJEA 4MKYA 3ID6A 1D09B 3QINA 4RWWA 1N33F 1XBWA 5F8HA 1FXLA 1IJJA 2BJ9A 4UOCA 4UT4A 3F41A 1XI1A 3CEDA 5F9NA 1Q86T 2AW0A 1HI0P 1RGVA 1J53A 3CDEA 1OMSA 1YTUA 1VQMS 4EFHA 5A8WB 2KVIA 1TP7A 3RBZA 3SAGA 1IH7A 4CZKA 4JV0A 1EB0A 3AVCA 4WFYA 2YXLA 5KFMA 4O8KA 4RUAA 1Q82T 1Q78A 1NZAA 1VSFA 4CT8A 3LP3A 5A8RB 1M1GA 1XN9A 1Q79A 3DLRA 5HI7A 3I55S 1XMQF 2BW7A 2N7YA 2UUCF 3NH1A 1GXTA 2XHCA 4DTRA 2HBYB 4KPCA 1RT5B 1NNDA 2PC6A 3IRWP 2YKNA 4RO0A 4ID5B 1J5OA 3PSIA 3CCLS 2YWFA 3M8SA 2G8FA 1HWLA 1ZAXA 4RNOA 5DQIA 1REVA 4ANDA 4X64F 2HFVA 2RU3A 1RKIA 3L4BC 3SPZA 4ZCKA 4NXNF 2W9CB 3D54A 3PX4A 1YIJN 1JLEB 4GV6A 2JWKA 4B3SJ 2E4LA 4X4OA 1X31C 3FSXA 2F8TA 2L3MA 4F4KA 3D0PA 1NBEB 4C0OC 2LEAA 4BS2A 3PCOB 4OI4A 3EX7B 3BGUA 1RTZA 2D5RA 2XO6A 3U6FA 1TQLA 3OYNA 2CJAA 1YAGA 1W0HA 1RU2A 4B1UB 1VRUA 2CQ1A 5KFRA 2ZH7A 1T7PA 2J9EA 3P3DA 5J2QA 3CD6S 4I7FA 2MLYA 3HZGA 6FDRA 2EK6A 4IOAQ 1JWWA 4ICLB 3Q83A 1E4FT 1HMVA 4OJGA 4DV2J 3KHYA 1DZ5A 4ZVTB 3UN3A 4PKIA 2CJXB 5I3UA 2OJ3A 1EJ7L 3TEGA 5AQPA 1QDUB 4B08A 4LREA 1RISA 2KXHA 4ED5A 2A40A 1ZAWA 1U2VB 4UUXA 4K5SA 3SAHA 5I3PA 5IM0B 2WZ1A 3GSIA 3WXKA 1BA1A 2CNLB 1HW9A 2ZBPA 1IV0A 2QL9B 2IVYA 2UUBF 1T6CA 1RABB 2EFVA 4Z7CA 3DU5A 3I9V9 4M3TA 2L9WA 3QB0A 2MZSA 1SKWA 3SBTA 3U1NA 2DIVA 2RQKA 4LH4A 4ZVSB 4NLGA 2DD8S 2G8WA 3LL3A 1VHFA 4H4KC 1S72S 4HR2A 5AQYA 3TNVA 2DFHA 2Y9HA 4B3MJ 2I7NA 2K3KA 4CO1A 2D0BA 3RB0A 5DDOC 5BYRA 2HVDA 2DY4A 3CWJA 2AF6A 5AQJA 5AQXA 2FLLA 4I6MB 1WB9A 4DR2F 1TUWA 2WVBA 5B0AA 3LP2B 3QLHB 2XS5A 5M1FA 1O6XA 1I94J 4ZN1A 3QNNA 2YVSA 5DDRC 3OBWA 4OI6A 2F3JA 4I2PB 2PMWA 4KHRA 1RT4A 1DBDA 3KVGA 1VSKA 2VZ9A 2PDAA 3VQ7A 3R5GA 2BACA 5CD4A 2C22A 2O8FB 4ZVPB 4GV9A 2MMYA 4OX9J 3DJCA 5H9FJ 5KG3A 5C7PA 2O8BA 2E5HA 3IFEA 2ZZNA 2JEGA 3QESA 3MPUB 1DEJA 3SK3A 4NPOA 1LW2A 2VKRA 3AH6A 5I3QA 4A48A 4IG0B 3VQDA 1FRLA 3HHDA 1SJRA 3ZFVA 3EGNA 3JS6A 3SUQA 1W2BR 3GSDA 2F7VA 4LRDA 1F5BA 3C6UA 2QRRA 4YMEA 4QWBA 5IQ6A 2CA9A 2EFPA 1VSHA 2O67A 4FZYA 2H5IB 4KE5A 2ITGA 4Z4EA 5J1EA 3V6DB 2HMIA 1ZPWX 3GU0A 2RS2A 4YS2A 4M5IA 3GCWP 1IBLJ 2KVQE 1RBSA 4BE1A 3QWPA 3O1WA 1RWMB 1WAFA 2GWJA 4DUZK 3CE8A 4PPDA 1NZ8A 1VQ6S 1N36J 4DCPB 5IV3A 2M52A 3BEXA 4C8KA 3HT0A 4DR1F 1YTYA 1JX4A 4I6YA 3HHEA 4WXOA 3TRGA 3BPDA 2OCEA 4DXLA 2EXUA 3ID8A 5JVHQ 4P71A 3KK1A 1IM4A 1I3AA 3GYGA 4K7QA 4CLKA 1X5TA 3DLLQ 4C48A 3OYDA 2D0AA 2AYGA 5B0GA 2GX9A 4MQ3A 1SUQA 3MWTA 4XAKA 1W26A 2P9UA 4ED0A 3KKFA 2Z58B 4C8MA 2YI1A 3CIPA 2HNZA 3OYKA 2LDYA 4RW8A 4LSNB 3SQ1A 1LFPA 3DI6A 3AD9C 2QX0A 1HYZA 1SH3A 3H4DA 1UVNA 3TR5A 2XLJA 4HKQA 4LF9F 3RWUA 2K7JA 3HCXA 2CQBA 3EN9A 3HULA 2RPIA 4I0WA 2M2BA 1F2GA 1HD1A 4ZJLA 4CH0S 2B43A 3HMJG 2E5LF 3UW1A 2DTJA 3H45C 4LFCJ 5M1QA 3AA5X 2GAHC 4FS1A 2FJXA 4FSVA 3KDNA 3PJXA 2XMAA 3KUGA 1X3NA 2F9TA 3AAWB 4ES2A 1N8RO 1O13A 2VKZG 4IRKA 3MAAA 1VQ5N 5C25B 3C95A 3ZTQA 1S1XA 2YTCA 4NLXA 4DV6J 4Q8FA 3NEKA 4F9OA 1WSRA 4QIGA 3CSKA 5C42B 5C5JA 1KHWA 4NLWA 4DX8H 3M6UA 4ILRA 4K4SA 4DUYF 1S57A 2Q3PA 1GLFO 3OTBA 2PA8D 4WQ4C 2IMOA 4N7TA 1RB0A 3CGIA 2ERRA 4RU2A 3M3ZA 2ZWOA 4CZFA 1N8RT 2ADCA 1K8KB 5KRSA 2DNZA 2F63A 3UB5A 3DLKB 3QRQA 2MQLA 3F0NA 1RGIA 4B3OA 3SFGA 1UEKA 2C42A 1PYOB 5HQ8A 4JI3J 2G8UA 4H8KA 2FY8A 2MSTA 3KJVA 4W98A 2DK2A 3MN7A 3GOIA 3F2KA 3M8PB 3SI6A 4DV7J 2A18A 1GH8A 2HQGA 4BRCA 4W92B 5DGBA 2RHSB 4U8YA 3OTOJ 3LP1A 1P9YA 3PYDA 4PL7A 2NLWA 5B0BA 4DLGA 1U0HA 1RTDA 4C1NK 2DGWA 3IGVA 3WXIA 4KYZA 4DTMA 1RILA 2C3UA 1B64A 1AT1B 2W42A 2OFGX 1WG5A 3P38A 1WC3A 5K14B 1FDBA 3U7JA 3OVBA 3VZIA 2UV8G 2QKBA 1E4GT 2C2DA 4BGAA 2PFUA 3MDFA 3MPWA 3OL7A 2UXDJ 1EKRA 1HX1A 3NLCA 4CJRA 1XEZA 2YY3A 5A0YA 3HI0A 1R8CA 3UPFA 4K4UA 4EIAA 3A3PB 1VAZA 3NGZA 2NZ4A 4FWPA 4F3TA 3M8QA 2ASLA 3ZSWA 1WTBA 2MQNA 2ASYA 2EHGA 2W4CA 4YY3K 1QZ5A 1B4SA 4X66F 1R59O 2HHUA 2O8DA 2QWRA 4AHCA 1JL1A 4OZ0A 4DN9A 2UXCF 1TZ0A 4YOYA 1CJUB 4CHZA 2O5DA 4F50A 3IMXA 1YHQN 3GLJA 4NLBA 2DNNA 3HSGA 4JV5J 1N34J 2YQ3A 1SQGA 3LPUA 1MNEA 4KO0A 5LJ3Y 2HZAA 1UFWA 3GBTA 5C24B 2YCHA 5GVQA 3QFPA 5DMRA 2F40A 4QS9A 3AAQA 3AARA 1WOQA 1HNZF 1S1UA 3H98A 3MEEA 4DU8A 3MR2A 4WQ5A 5A8KB 2AV5A 4LQ9A 4FDFA 2NRHA 2BVZA 1RWNB 3AAPA 5DJBA 1GOCA 1YZ6A 4OLBA 3T1YK 3OD2A 3HSJA 3QSIA 1X4BA 3VQ9A 1FFSB 3DOKB 1NSPA 4RW4B 1VQNN 1HYVA 5FLXO 3THXA 4WFAQ 1M5OC 3MXIA 5F41A 4DTUA 4DR6K 3UIQA 4BRGA 1T05A 4CLFA 2BZ2A 4CWBA 4WZQA 2H4WB 4Q2MA 1HQEB 3TAGA 2Z30B 1ZTWA 4DSIA 2DY9A 2LU2A 1QUPA 4BR9A 3ZC4A 3J81O 4AYBD 2G13A 2I9SA 3NDKA 2I38A 3W62A 1CXUA 4GKKK 2XY6A 4Y2CA 3R6GB 5I4MA 1C0TB 1HKGA 2LDIA 4RBTA 3CJ2A 2UU9K 3P5TL 1TV6B 2NXJA 4JV1A 4FJXA 4ZVOB 2Q36A 3MPYA 2E88A 4QR1A 3S01A 5FPDA 3NBPB 3HSDA 2PGCA 2H3EB 2YNHB 3TU5A 4LSZB 4DR7J 4FYYB 4CGHA 2FPHX 1H38A 2BE2A 4LUBA 4FZVA 4TQSA 1H2TZ 3L0QA 2PD1A 5CZVA 5CABA 4JB8B 3EKUA 4EWTA 2UVRA 1MDUB 3FUYA 4LR9A 1RYRA 1N0VC 5KG5A 4GMJB 1S4EA 4CGFA 2DTUA 4TLQA 4R8UA 4BRIA 3MMBA 1SV5B 3PZPA 4WE1B 1FRXA 2M8HA 3PX6A 3AY9A 3I8BA 1NDKA 1TK5A 2OTJN 4M63A 3BH7B 3UFCX 4YNQA 1XWLA 2F7TA 3DRSA 2B9XA 4GY2B 3J7YU 1N5TA 4KI4A 1UPMB 3OTEA 3V6HA 5F1XA 3NHGA 1WNEA 4BR2A 2FBYA 1PAUB 3SYZA 4F2SA 4DV4K 4ZA1A 1N88A 3O4QA 3O9QA 5CYMA 1JXBA 3B6PA 4OLAA 2A1RA 4PXEA 2WVCA 4OHZA 4DL0C 2ZJPL 3HRGA 2DEJA 5FLXY 2YHXA 4OX6A 4A47A 2BA9A 1RQ0A 5JLHA 1TYQB 1WI6A 5LSRA 4FJ8A 1K73O 4DI6A 1S79A 4QS8A 3GONA 3MF5A 4A2AA 1NPKA 1YWXA 4DEZA 3QATA 2XZWA 3SPYA 3J81Y 1TKXA 2W9BB 2QSFA 3BR9A 4NLTA 2PIIA 3H6EA 4JI1K 3H25A 1KQFB 1L3KA 2E1CA 4QR0A 1IKWB 3ZSYA 3KK2B 3OR1A 1KDNA 2XYGB 2WSEC 4KGMA 4NXMF 1V6HA 1YDLA 1FEHA 4CE9A 3HFVA 4UOFA 1TL1B 2MZQA 4NLDA 3KMQA 5JS2A 3TAEA 2RHQB 1S76D 1C1CB 1ZETA 1UJ6A 2R2TA 1QSSA 2E1MC 1K73T 1VQ5S 4FWKA 1APSA 3MCMA 3MN9A 4CHPA 2GJ2A 4URQU 2KJWA 1NSKL 1HNXK 4YHHJ 3RAXA 4EUVA 3IMQJ 1KVBA 5J1PA 3G71N 2WK4A 5GIPA 4IO9Q 1SI9A 4DB3A 2D4WA 3S41A 2ATQA 2MKHA 3M2UA 2ZD1A 5EX3A 3P83D 3CHWA 4RW7B 2ZDOA 3OYEA 2ATCB 1IR2A 4FJ7A 2IPOB 2AQ4A 1ZBHA 2ZH2A 1NOYA 1WDDA 4EP4A 3MMCA 4M5DA 4LIWA 6AT1B 1Q95G 2ZNZA 3AQPA 3FRZA 1H7WA 3NGRA 2OHDA 1R8AA 2P8IA 2OPQA 3W2VB 4X4UA 4FYWB 1CZAN 2ZC3A 2DITA 1ELOA 2JEIA 2WBRA 1YTAA 3UDEA 4NZ7A 3IWXA 3F9KA 3DMJB 1QS4A 3W0LA 5LJVA 3RAMA 4GNIA 1BQMB 2V4RA 3GJQB 3HLUA 4YDXA 4OKEA 2MDAA 2ZWPA 4UF4A 4PUOB 2FVQA 2R8IA 3G8QA 1U45A 1S9GB 4KJIA 4A62A 4FKXA 1RAJA 3QBCA 3KYLA 2VPZB 3FJ2A 3I0RB 4LF7K 4OHVA 3OLAA 1WDTA 2V68A 1AW0A 5L38A 4LRAA 4ZPDA 1LWCA 1W2BM 1T8EA 1Q7YO 1GFWB 1N4LA 1JLCA 5KFUA 4Y1DA 4QS7A 2W24A 2HMPA 3GDQA 4C11B 3BREA 4HUEA 1NGIA 1TL7B 4DQPA 4WFZA 1F9HA 1VSIA 5KG7A 4M3WA 4X4NA 1R89A 2BKOA 3SNNA 3KLEA 4CVNE 1YRXA 4U9RA 4ZCMA 2FC0A 1FKPB 4ED6A 3ZSXA 3EXCX 4C2MA 2AA4A 1YHQS 1C0MA 2FVPA 5D0EA 4ILJA 5C2GA 4PY5A 3TUIC 3R7SB 3DRPA 2YNIB 5F8IA 2NRVA 2BDPA 4OYPA 1OJ4A 3NP5A 4ZVUB 2AJQA 2R7TA 3OL8A 3NS7B 4X4VA 3GFZA 1YGYA 1E3MA 4L76A 5LXRA 2MXYA 2Z1JA 5KOXA 1NG9A 2MKSA 3N28A 1VBKA 3K58A 5EGYA 2GWKA 3CO0P 1YJ9N 4FJIA 4KTZA 3W9IA 1GXLA 3BQ2A 3PXGa 5M1KA 4F2RA 3M2VA 3J8AA 2JHEA 1YBAA 2FVRA 3S3OA 1PIEA 2VG6B 2IDOA 3I4HX 3FCWA 4GVEA 2H1YA 1UKUA 4A59A 3ZCMA 4OYAA 2K2PA 1O0PA 2OEMA 3IWLA 1EKEA 4KAIA 2J0XA 5EX0A 4AE5A 3HK2A 2D3O1 3J7AP 3J7YP 4YOXA 1MU2B 1NBWA 3BP8A 4DTPA 2G9OA 1NWKA 1SC3B 2FC8A 1R8BA 3L2RA 2YHAA 4CK1A 1NPRA 5GAEU 2ATLA 3JSRA 3OJSA 4R79A 1OSCA 2L9NA 2EI5A 2Y8WA 3VGUA 4ZMMA 1WBBA 2H9ZA 1M90O 4JRPA 5AE1A 3Q8YA 2HWHA 1ASWA 2V5HG 3HX9A 3V81A 4LFAJ 4K0KJ 2OANA 2CDRB 1NB2A 3Q8RB 3LALA 4Y2MA 2OA8A 3IS9A 2E5IA 2QA4G 1XIQA 1OVQA 4HL9A 3SXLA 4WXWA 4Q5VA 3DLGB 3MCSA 1FNOA 1HNVA 3U9DA 3H20A 2GUPA 2YKNB 4ERDA 1UW9A 4XEIA 1WBDA 1BIUA 5GAHI 2HIQA 1HJOA 1CJTA 2EFGA 1RFQA 3NGDA 4AL5A 3VVUA 2OTJS 2NUBA 5KFCA 4JI2K 4PG8A 1ZAVA 1REVB 3DHWC 1TUUA 1S97A 3EGWB 3CMEN 1M90T 1H6KX 1Y7PA 1KR4A 3MD3A 4FWRA 2PY5A 3HP6A 2VA2A 2A6AA 2J7UA 4B1YB 4KC5A 4JI8J 4TQRA 1HPMA 2IBOA 1J5EJ 5IC4B 1OYEA 1B7FA 1AFIA 4E7IA 4GKJJ 4AILC 3POTA 5E5NA 5J1NA 3HZEA 1VRUB 4KGVB 2A41A 4DQRA 4QBUA 1SH2A 4C6AA 1NGGA 3BSOA 4ES1A 2HAFA 3CCSN 2LLZA 3PYGA 1YT3A 1WI8A 4I7FB 1S7HA 2B4JA 3EL2A 1J2VA 4BVOA 2NYHA 4CBXA 4J2DA 3QIPA 2GMHA 3UO0A 3CYMA 1HMVB 2IYGA 1DARA 4MKBA 4Q0BA 3R1LA 2JJ4D 3VGKA 1DQ8A 4DUZF 3E9LA 5E3RA 4J9SA 4NYOA 4EK2A 4FBUA 1U1PA 1BQNA 2C3MA 4B9MA 2COLA 3HVWA 2DEIA 1VR6A 1MWYA 2FHJA 1X0FA 4Q2LA 3T7ZA 5EOYA 3DDNA 2QXLA 4JKFA 1PCAA 1VQSA 4FLWA 2DR8A 1B99A 4TU9A 2IGIA 3DU6A 1VHXA 2AP1A 3CCZA 3G0ZA 3M6XA 4E2FB 3JSMA 4DSKA 2WC9A 3N79A 1ATSA 1TVRB 5KFVA 5AXNA 3JTPA 1C0UA 1YJUA 3VETA 2QN6B 1NGFA 5IFMA 3QERA 3A5NC 3G71S 3EZUA 2E29A 4L75A 1B7YB 4N76A 3GFYA 2VONA 4B3SK 1CJKA 4CTAA 4ECSA 1WF0A 5U47A 3GE9A 1KQGB 4ZOSA 1YRUA 3L7OA 1RAHB 3VAGA 4ATNA 1IO2A 2HHXA 4UY85 4LY7A 3VN5A 2RE2A 3IR5B 1RBTA 4ZIVA 2GZOA 3MEDA 5BN9A 4Z4IA 1BI4A 2M3DA 2MB0B 1GTEA 2MKKA 2EBEA 5BPLA 2G2OA 2R4FA 2F8SA 4CJLA 1S7IA 4FM2A 3LTOA 4PR6A 1FD8A 5FIIA 1U2FA 3HSZA 3JAMO 2QI2A 3L7PA 5KQDA 4KV8A 4IQXA 2OTLN 2QSWA 2QA4N 3FEZA 4L3QA 1RT4B 1UVIA 3Q23A 2HWTA 1RLCL 1RBAA 1K0VA 4S0MA 1S59A 4DZ6A 1IJEB 1WHXA 2CZ9A 3GJSB 2O8BB 3H8YA 4CNYA 3LM2A 4FXWA 3QETA 3U27A 4O3PA 2Q43A 2R7UA 4YOWA 3K2YA 5CZ1A 4FJGA 2WSFC 5L1JA 3TTCA 4ZVGA 4ZLLA 4FLTA 1NGEA 3ZX3A 2GC8A 1LW2B 3OYMA 1LK5A 5DO2A 3O4NA 3CF5Q 1EIYB 2LEBA 5I42A 8RUCA 3X1LB 1FKOA 3C6UB 1K9MT 3IBCB 3VQ6A 4OQJA 4OPKA 3G8TA 4DL6A 3C6HA 4FKYA 2KRRA 1HL6A 5AFUH 5J1EB 2HMIB 1VSDA 4R0JA 3G82A 1EWRA 3KLFA 4B9LA 1WC6A 4MIAA 4ED3A 4JKEA 4HTLA 2YKAA 4LBIA 1IBMJ 4B3MK 5GAEP 3U9ZA 4KHSA 2CXEA 2OO4A 2FXUA 5ITHA 1T9VA 2WCXA 1MWMA 2FC9A 1T03A 2CNKB 3WQPA 5F3ZA 3GG4A 1IR0A 4TY9A 1JLBA 3J7AN 5FRNA 1NK5A 4IH6A 4CM2A 3DLLL 1Q8IA 4N8NA 1CG2A 5GMKa 4DTSA 5LY3A 1CLFA 2IA0A 3E8OA 3HI9A 3TAFA 2CGKA 1CC7A 1KXPA 4TKTA 3CJ0A 2H54B 3UCGA 3KK1B 1YJ9S 2P5VA 5D8HB 3KIOA 5GADI 4O5FA 1VJWA 3JAMY 5H9EJ 1XC3A 1QAXA 4OX9K 1SUQB 3WT0A 4YY3F 3VAKA 4K8RA 1H2UX 1Z05A 2P9UB 3UVJA 4IO8A 4JV2A 1V3RA 4DPTA 2HNZB 2Z2YB 4RW8B 5C0YA 1HHQA 3NKYA 3ILIA 2KZZA 1YI2N 1NU0A 3THTA 2P9CA 2RE1A 4CLSA 1S1TA 3L3VA 2HBZB 3VEZA 4XH5A 1OH7A 4H5RA 3ZT1A 2XI3A 5E26A 1CJVA 3EWGA 1Q8LA 2XWXA 4RZRA 1F5AA 3TX0A 3ZSZA 2FLNA 3GFHA 3CT9A 1P90A 2D3ZA 3MAAB 3NMAA 4DL3A 3QIDA 1IBLK 4CHQA 3WZ0A 2CJKA 2NRWA 1S1XB 3Q8SB 2J6SA 1T6DA 4DDFA 3O9UA 4B17A 2FJVA 4DR6F 5LMUK 3H3OB 2Q1LA 1VQPN 2OUGA 4DPWA 4FYVB 4CJPA 2E2NA 1FD2A 5AQTA 2E1ZA 2W6LA 3AJDA 3VAJA 2D41A 2ZGYA 3ZT0A 2CH5A 3OFHA 3OW2R 2DO0A 4C3LA 2C3YA 4H0OA 2MYFA 4PA1A 2F8HA 4GKKF 1FA0A 4RNHA 4HTIA 5T14A 4DHVA 2UU9F 3R6LB 1UA0A 5ETRA 3I4PA 2C2RA 3OFFA 4YFUA 4IG3A 2PBDA 1XNRJ 4B3OB 1FEEA 4BBYA 2G1HA 4RTFD 4R25A 2XTJP 3KJVB 4H0VB 4IXCA 2XO7A 5CD4H 2IDEA 1OQ6A 1WORA 3L7UA 4DX6A 2WVEA 3QDKA 1YJVA 3L9ZA 5AQZA 3CCSS 4ED2A 3LP1B 3OBYA 2IY5B 2HQDA 1FTRA 2YX6A 1HQUA 1FE4A 2KRBA 3CD5A 1U0HB 1QVFR 4E1JA 4LFCK 2ZHBA 4FW2A 2VCPA 4I1TA 4CJ5A 3GG0A 1WSIA 3JTOA 1J6ZA 1BUXA 1D8YA 5LT5A 3LO3A