1FKOA

Crystal structure of nnrti resistant k103n mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
543
structure length
542
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural basis for the resilience of efavirenz (DMP-266) to drug resistance mutations in HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 144
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1fkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fkoA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1fkoA05
4M3XA 4CJWA 3JYTA 1N5YB 4BWMA 3SQ4A 4CGDA 3I5AA 1NKCA 3L3UA 1SKSA 3LP1B 2Z1GA 3NGDA 1QTMA 2D0AA 4Y2AA 4RW7A 4CFCA 1SKWA 1RT3A 4I2QA 3ZT2A 1HJRA 4E7IA 5KGXA 2XY8A 5F8NA 4K4XA 1RNHA 4DQIA 3OYMA 2WCXA 2IS3A 3NCIA 3MEDB 1L3SA 4M3UA 3I8DA 3EZUA 2ETJA 4AH9A 4H4MA 5HRPA 1C0UA 3TAGA 3C6UB 3SUPA 5KT3A 4M95A 3LAKA 3RR7A 4G3IA 1C0TA 4LSLA 1B9DA 4WFYA 3KJVB 3K57A 2OPQA 4EYHB 2E6LA 3LP3A 3IGVA 1R0AA 2FLPA 1RDBA 3DOLB 4K4TA 2LSNA 4EZ9A 1JKHA 4KO0B 4IG0A 3KLHB 2P51A 5HBMB 1KFDA 2KFZA 1LAVA 4ZVFA 5J2MB 1X9MA 4HTUA 3H4BA 3OSPA 3OJUA 3GQCA 3SUOA 2NUBA 2XI3A 3SCXA 3VQEA 3FQKA 2WONB 3O4QA 3DOKA 3PW2A 1A5VA 4TSXA 4ECXA 4PQUA 3HPHA 3L2QA 3CIZA 4K50A 4DL5A 3M8PB 4OGCA 5KG5A 3HM9A 4E7HA 2QV6A 4WE1A 4ELVA 3JSMB 3BDPA 5SWMA 2JEIA 1MU2B 3V1RA 2F8TA 4CJLA 4PY5A 1S97A 4DTSA 2IAJB 3CM6A 3B6PA 3KLGB 4FLUA 1RT2B 2ZD1B 5DG8A 4GVMA 3IN5A 1YTAA 4B3OB 1ASWA 2IC3A 4CF9A 4UQGA 3NH1A 5CY4A 2HNYB 4FJ8A 3TANA 4RW8A 4K8XA 4XO0A 4RU9A 3VQ5A 2E9TA 1VSHA 3K5NA 3V9XA 1JL1A 3ZSQA 4G1QA 2G8IA 1D8YA 2WK4A 2ASLA 4FJNA 3ZT3A 1BIUA 1T94A 4W5QA 4Q8EA 1C1CB 4YFUA 4KV8B 1T3NA 4KFBA 3U3GA 4ZVHA 4CFBA 1TKDA 2GIQA 4KTWA 5KFSA 2FVSA 4R8UA 1RT7B 5DGAA 2OA8A 3F9KA 4CF8A 4KAZA 1LWCA 4FYDA 4KHNA 4ID5A 4NLQA 2W9CA 1HMVA 3MEGB 3G6YA 2XI2A 2C2EA 1TAQA 4Z4GA 2B5JA 3M8SA 3DLEA 3E01B 3KIOA 2YNIB 1RAJA 4NLUA 2ILYA 4CCHA 5FRNA 2GC8A 1RA7A 4LSNA 3OYNA 2OZSA 4PWDB 3SV4A 2IM3A 1BL3A 4FS1A 4J9OA 1TKZB 3NDKA 2G8VA 4KI4A 3MR5A 4FJ5A 1S0MA 1RYRA 4CJ3A 4WFXA 1S9FA 4FZZA 3MECA 3PX4A 4LQ3A 1LW0A 1S1VB 4R5PB 1ZTWA 1TKTA 1RTIB 4MK9A 3CG7A 1JLGA 5KT7A 3PHEA 1B9FA 3AO2A 1ITGA 4CJ5A 2CKWA 4OPKA 1W9HA 4XPCA 4DSFA 4ZTFA 3VQAA 1RBSA 3OYEA 2YKNA 4HCCA 3T19A 2V0NA 2HHWA 4KHRA 4J2EA 5JXSA 5KFAA 3DLRA 1T03A 4ICLB 1RT4A 4DL6A 3IGNA 4W5NA 1SV5B 1N6QB 1RCHA 2IJNA 1YTUA 1QSSA 3S9HA 3MR6A 4OPJA 1ZETA 4QOZB 4CFAA 4EO6A 3OL9A 2R8KA 1VRTA 1S6QB 4ZPCA 3F73A 1JLFB 3O3HA 3QNNA 2P1JA 4RW9B 3FFIB 3OVNA 2DPJA 4J2BA 3H59A 4ID1A 1TL1A 4C8NA 3NBPB 4E1NA 1WNSA 3V81B 4W5TA 4Q0BB 1VSLA 3VQ9A 1QSLA 4I7FA 3DRSB 1S6PA 3G0ZA 3PJXA 4CEQA 4ED3A 2DY4A 1Y97A 3IRXA 2AU0A 4DTJA 2FBTA 5I42B 3SFGA 2HMIA 3KLIB 1D9FA 1TKXA 1IKYB 1EP4A 4MIBA 4YR3A 4ZTJA 3H5SA 3ZT4A 4LD0A 5F9NA 1TVRA 1HQEB 1WSEA 3QNOA 4DSEA 4CHZA 2O5DA 3PW4A 5CZ1A 1GX5A 4LY7A 2FJWA 4J2AA 2G8FA 5DG7A 5KFMA 4W5RA 2WRMA 4RG8A 2G8WA 3CFRA 1JLCA 2HNZA 1UA1A 3I0SB 5HRNA 3RMBA 4CF1A 4NYFA 4N56A 4JS4A 2R8GA 1RTDA 3KHRA 1RT6B 2OPPA 4M94A 4Z4EA 3QIPB 1KHVA 4FLXA 1OS5A 4E19A 4DU3A 5D3GB 5L1KA 1TK0A 1C1BB 3RR8A 4ECTA 2O4IA 3H08A 3BSOA 5KFHA 2KFNA 1F21A 5SZTA 3KKSA 1N5YA 5KFGA 1ASUA 2W8KA 1FKOB 3FSIA 4NRTA 2UVVA 3RMCA 1A5XA 3LP1A 4F4YA 5KFWA 1N4LA 5DK5A 1EX4A 3SUNA 5C24B 3WNFA 2IGIA 4AHCA 1CZ9A 4F8RA 3PO5A 3PW7A 3KK2A 3QGGA 3O3FA 1CZBA 2RN2A 3SJJA 2P5GA 4BE2A 1LWFB 1U04A 4MH8A 4NLYA 3C6UA 4RW4B 2IDOA 5KFRA 4WZQA 5DGBA 3TAPA 3KJVA 4KRFA 3KNAA 3NHGA 3OL8A 4TN2A 3D5MA 3HL8A 1VRUB 3DOLA 4DQRA 4FLYA 3CFOA 4O0JA 3DLBA 4KO0A 4FW2A 3GYNA 4CJ4A 3KK1B 3KLHA 3QLHB 4AHSA 5HBMA 3IAYA 3DLKB 2HHTA 3N6MA 3NF8A 4NLDA 1GX6A 1U4BA 4ZP7A 1HRHA 5KG4A 3ZSOA 2WONA 3NAHA 4CK2A 3LPTA 4LQ9A 4CEEA 4YP3A 1W0HA 1WSIA 4Z4HA 1C0MA 4QAGA 3H40A 2IBKA 3M8PA 1BI4B 4DQQA 4CIFA 1HPZB 5KGWA 1D9DA 1J5OB 3JSMA 3CJ4A 3Q8SB 5T7BA 3L8BA 4FW1A 2Q3SA 3RMAA 1L3UA 4J9PA 1XWLA 4IR1A 3H5UA 2BDPA 2IAJA 2ZKUA 4RNOA 4TXSA 1JXBA 3KLGA 5KG3A 2VG5B 4CJPA 4XIUA 4DL4A 4E89A 1UA0A 2C22A 5F8HA 3LPUA 1RT2A 2ZD1A 3BJYA 3P1GA 1NKEA 2HVIA 1GOCA 1I3AA 4B3OA 4DFPA 3PW0A 3SPZA 2HNYA 2A1SA 2O4GA 2HHUA 3LDSA 4DWIA 2F8EX 3DI6B 4OGEA 4GC7A 4CEOA 3QO9B 3V1OA 4MK7A 5C42B 4DL2A 3AVJA 3VA0A 1C1CA 2QK9A 4Q44A 4KV8A 1S48A 1VRTB 4E7JA 3OYBA 1TQLA 4DS5A 4IBNA 3D28A 1HYSB 4IFVB 5KG2A 4DL7A 4NLWA 4Y34A 4NCGB 3NF9A 4B9LA 3MEEB 1IKWB 3MEGA 4CECA 3V6HA 3HHKA 2D3UA 1JXLA 5DG9A 1D1UA 1LWEB 2E4LA 4ECUA 3E01A 1RTJB 4NCBA 2YNIA 3RB0A 4DG1B 2QE5A 4KHQA 3M8RA 1NKBA 2GUIA 3K2PA 3OYHA 2X6NA 4M3RA 4PWDA 1EP4B 4ELTA 1TKZA 3TABA 4CIGA 1SL1A 4K8ZA 5KT2A 2RKIB 1HQUB 2KZZA 1S1VA 3L2UA 3M8QB 4R5PA 3KMSA 1TGOA 1RTIA 3UDLA 1L3VA 4PA1A 3NGIA 3VQ8A 5KFTA 1S9GB 3TAMB 5KFDA 3AVLA 3D45A 2I5JB 4NLPA 4KHWA 4TQRA 1BQNA 5EDWA 3T5LA 3ISND 3UIQA 1RA6A 2ASDA 3OHAA 3BSCA 3LZIA 3RB3A 5JS2A 4ICLA 5DQHA 1SV5A 4J9LA 1N6QA 3AVCA 5HRRA 3IG1B 3OL6A 1S9EB 4ZMMA 4ECQA 3LALA 3KD5E 3PR4A 1BQMB 1RDAA 4JV2A 3PZPA 5KT6A 1S6QA 3QZ7A 4WFZA 5HRSA 1JLFA 4RW9A 3FFIA 4M41A 4MIAA 3ZT0A 3NBPA 3KMQA 4ED8A 3EPIA 3MR3A 4EBDA 1BHLA 4YR2A 4Q8FA 2BR0A 4DTPA 3V81A 4JV1A 3ITHB 4Q0BA 3AA4A 3LZJA 2YNGB 4TY8B 4O3SA 3DRSA 1VSMA 3V4IB 3DYAB 4O3OA 3KK2B 4YR0A 3ULDA 1KVCA 5I42A 2ASJA 4DTNA 3KLIA 2QXFA 2WHOA 1BISA 2IMWP 5KT5A 2BANB 3HPOA 1IKYA 3EZ5A 4KBIA 1HQEA 4W5OA 4YQWA 3PV8A 4TYAA 3N6NA 3NL0A 1CLQA 4KKOB 4KTQA 4IRCA 1RTHA 2BQRA 2ZE2B 1QS4A 5KFQA 2AGQA 4H8KA 3PX0A 4FJHA 4KAIA 3DRPB 4QWDA 3AVIA 3PJWA 3T5KA 2FVPA 5KFBA 3BGRB 3I0SA 1S1WB 2EC0A 1IH7A 1UAXA 3K5LA 3BR9A 4EEYA 3GILA 1RT6A 3QIPA 3RB4A 4IFYB 2PYLA 4FJKA 2W7PA 4DTRA 5I3UB 1X9WA 5D3GA 3RMDA 3CVKA 1C1BA 3DRRB 3BSAA 3QGHA 5KFJA 4FS2A 4HHTA 1SUQB 5JS1A 1WSFA 2D0BA 3VQPA 2D7SA 3B6OA 1SH0A 2ATQA 1SH3A 4QW8A 3TAQA 4EBCA 1FKOA 1XR7A 3S3MA 2FBYA 1Z4UA 3DLGB 3PW5A 4MKBA 1S4FA 5C24A 4CEBA 3TVKA 4DQSA 5DMRA 4Y1CA 4ECZA 4E1MA 2J6UA 5E41A 4JS5A 5KFVA 5KRSA 1HNIB 1LWFA 2BGGA 1EETB 2R8JA 1Q9YA 1KHWA 3HO1A 4RW4A 4ZP9A 5KFZA 5L1IA 3THVA 3LP2B 2YNFB 3QESA 4DQPA 3H4DA 5FDLB 3MXMA 1VRUA 4WXWA 2HHSA 4DF4A 4DSLA 2X78A 3LWLA 4O4GB 4B9NA 2Z1IA 3G6VA 3KK1A 1XI1A 3H5YA 3QLHA 3DLKA 4CJEA 4BE1A 4B8CA 4CHPA 4BDYA 3QEIA 4M3WA 1B92A 4FJLA 4DSKA 2CJQA 4HVJA 4CJSA 1FXXA 4FJMA 3O3GA 3VQBA 1BI4A 4BDPA 2R2RA 1LW2B 3NF6A 1HPZA 2GIRA 1J5OA 3FQLA 5KFYA 4CJQA 4QPXA 5T14A 3CJ2A 2XCAA 1IKXB 5KFLA 3C94A 3WNEA 3SNNA 4O5BA 3HYFA 3OJSA 4IKAA 1WSHA 4RNNA 2VG5A 3VQQA 1BGXT 4DU4A 4Z4CA 1C2PA 1BQNB 4TY9A 2DFEA 2DFFA 4Z4FA 4N5SA 3ZCMA 3G10A 3AA5X 2C2DA 1S0OA 1U45A 1ZBLA 4E7LA 1RT1A 3DI6A 3IS9B 3DMJB 4O3RA 3SI8A 3QO9A 5J1EB 5C42A 3FDSA 3H5XA 3K58A 4HKQA 4DF8A 1J53A 1HYSA 4DS4A 4IFVA 1SKRA 1KCFA 5KFIA 4CJKA 4NCGA 4RZRA 2HNDB 3MEEA 1IKWA 4FVMA 4IR9A 3NAEA 4F4XA 3NE6A 2GV9A 1VSIA 1LWEA 4FLVA 1JLEB 1RTJA 3VQ6A 5EWFA 1TL3B 4DG1A 4Z0UA 1UOCA 3I5BA 4KTZA 1L3TA 5J2QB 2FLLA 2VA2A 4B9TA 1DLOB 4RNFA 4K4SA 1A5WA 2A1RA 5HP1B 4FJIA 2UUTA 4WYLA 2V4RA 4KI6A 4RW6B 5FRMA 2VG6B 2RKIA 1HQUA 4KB1A 3LP0B 1RTHB 2R8IA 3EY1A 2W9AA 4KB7A 5C25B 3M8QA 2F8SA 2VG7B 3NGYA 1Z25A 1NK5A 2BRKA 3AV9A 4QWAA 3HP9A 1S9GA 4CGHA 3TAMA 4MQ3A 1C1AA 2I5JA 5KFNA 1S0NA 4EO8A 2HWIA 5L9XA 2C28A 5KFKA 3VQ7A 3ZSRA 3OYFA 3ICLA 4N76A 2OPRB 3AVKA 1KLMB 4FM1A 4DU1A 3IG1A 1S9EA 1Z26A 3K59A 4ZVEA 1X1PA 4O44B 3KHLA 1BQMA 3C6TA 1HNVB 3V1QA 3NH0A 3VQDA 3KLFB 3AA3A 4NLTA 2BE2B 1ZBHA 1QE1B 1WLJA 2JGUA 3P83D 4OL8A 1JIHA 3ZSXA 2Z1HA 2V4QA 2R2UA 4CHNA 1KFSA 5KG7A 5KI6A 3QERA 4FXDA 4EP5A 3ITHA 2XGPA 2YNGA 4TY8A 4U7CA 3TWHA 3V4IA 3DYAA 4F2SA 3HVTB 2OPSB 1RBRA 2PZSA 5F8GA 3C95A 1HYZA 1T8EA 1WAFA 1NK7A 2BANA 4KHYA 3U3YA 1ASVA 3HVRA 3HXMA 5EWEA 4CHOA 4AHVA 3U6FA 4E0DA 3RAXA 1T05B 3NGZA 4J9MA 4ZVGA 4O3QA 4KKOA 4QWBA 2ZE2A 3CM5A 2AQ4A 4IH5A 4CGJA 3DRPA 1HYVA 1JLAB 2G8KA 4ED1A 4J2DA 3BGRA 4LH4A 1S1WA 3AO5A 3OYIA 5KG1A 1VSDA 1TV6B 2XY6A 1C6VA 4IFYA 4Y1DA 4FM0A 2XY7A 5I3UA 5J2NB 3DRRA 3T3FA 4CGIA 4F2RA 3SYZA 1S1UB 3NF7A 1SUQA 3V9UA 2J6TA 3HP6A 4K4YA 2XCPA 1TK8A 4O3NA 4AHRA 3RBDA 4M3TA 3V6DB 5F8LA 4CF2A 3HVAA 3DLGA 1J9AA 3HPGA 4WYWA 3NMAA 2XC9A 1GOAA 4XPEA 3KHGA 3CJ5A 3L2WA 2IJFA 2ALZA 4FZXC 3K5MA 5K14B 4J9RA 4RNMA 1HNIA 3OL7A 3N6LA 1EETA 4CEDA 5CYQB 1NNDA 1RT1B 1VK0A 4CERA 4ZP6A 3LP2A 2YNFA 4IDKB 2VA3A 1S5JA 3GIMA 2HHVA 1REVB 4JV0A 2FBXA 5FDLA 1S1TB 4M45A 4DSJA 4C8KA 4O4GA 4AILC 3PX6A 2Y1JA 4KHSA 5KG0A 1YVFA 4B8AB 3AO4A 5C5JA 3OYDA 4FLTA 2JEFA 4ELUA 3K5OA 1WSJA 4M3ZA 3UQSA 1XR5A 4IH7A 4AHTA 4CGGA 3DM2B 1LAWA 5EWGA 1VSEA 2RDIA 3PVXA 4NLXA 2OZMA 5KG6A 2JLEA 2R2TA 4URQU 3CDUA 3V6JA 1IKVB 2B6AB 1LW2A 3QZ8A 4TQSA 1NK4A 5J2PB 5DLGA 1WN7A 1IKXA 1BIZA 3ZSYA 4YMEA 1G15A 3L2VA 5CYMB 4ED2A 4DLGA 4BACA 1JLQB 5F8MA 3Q8QB 2UVWA 2YKMB 4C8OA 4ECYA 2HW3A 2XO7A 4HUEA 1JX4A 2KZMA 4ZHRB 3SQ1A 3IS9A 3DMJA 3ZSZA 1EKEA 5J1EA 3M9OB 3OS2A 5DQIA 4NLGA 3NAIA 3C6TB 1NJXA 1RT5B 2AGPA 5KFPA 3AVBA 3E51A 1NK8A 1SL0A 3SQ2A 2BRLA 2VWKA 5DQGA 2HB5A 4I2PB 1NK6A 2C2RA 4F4WA 4DLEA 4KHUA 3GIIA 2HNDA 4IG3B 3H98A 3AVNA 2X6SA 3HT3A 5KFUA 5F9LA 1UWBB 3ALYA 1RBVA 1JLEA 1TL3A 2E6MA 5J2QA 3TARA 3KLEB 3I0RB 1DTTB 1DLOA 1KSPA 1U48A 2E9ZA 5HP1A 4IQXA 1NHVA 3NKYA 2OYQA 2B43A 3VQCA 4RW6A 3BSNA 2VG6A 3GV7B 4RUCA 3LP0A 3HKWA 1NOZA 2KQ2A 5C25A 1ZBFA 4DMNA 3VQ4A 2VG7A 3T1AA 4F3OA 1GOBA 1S1XB 4Q5VA 4EYIB 4L8RB 4FLZA 4H4OB 1IG9A 2FVRA 1NJZA 4URGA 1N48A 1ZBIA 4M42A 2OPRA 2JC1A 4Q43A 1KLMA 2IM0A 4F50A 1WAJA 2JEGA 4O44A 4CFDA 3G6XA 2W9BB 3T5JA 4I9QA 3KK3B 3AVFA 1HNVA 2ITGA 4NYNA 2ZQBA 2KTQA 3H2LA 1RDCA 3KLFA 2J6SA 4CHYA 4FJJA 5CZ2A 2BE2A 1YT3A 1QE1A 2YHAA 1WSGA 4ED0A 1L5UA 3TQ1A 2AWZA 4DFJA 4B08A 1ZTTA 3LWMA 2RF2B 3OYCA 1MMLA 3AA2A 4CJTA 4PUOB 2F96A 3HVTA 4DTOA 3GIJA 2OPSA 3KTQA 4HCBA 2JEJA 3KOAA 2V9WA 3WNHA 3SPYA 2QKKA 3SUQA 4B9UA 1DTQB 2UUWA 1JLBA 1U47A 3VQSA 1QAJA 4FJ7A 1T05A 1KVAA 1IM4A 2OH2A 5KFXA 2ILZA 3M9MB 3PO4A 4Z4IA 2D5RA 2HVHA 1RBTA 4ZPAA 4CJUA 3Q8PB 3CDEA 2RPIA 1NOYA 1JLAA 2WOMB 4N41A 1KLNA 2G8HA 4I9LA 4F3TA 1FK9B 1I39A 4BE0A 4LH5A 1YVUA 4EZ6A 3V9WA 4Q45A 2AX1A 3HSTB 4U6PA 1TV6A 4BDZA 5KFOA 4O4RA 2FBVA 1CXUA 3KKRA 3V9SA 5J2NA 5JUMA 3SQ0A 3OY9A 3QEPA 4KREA 4O3PA 1S1UA 5HROB 4M3YA 3SFUA 4KPYA 5KRTA 4MFBB 2EX3A 3V6DA 4MKAA 2VWJA 4FLWA 4YNQA 4QCLA 2IM2A 4HYKA 3OS1A 4NLRA 4K4ZA 1KTQA 3QIOA 4IOBA 1Q8IA 3CFPA 4DSIA 2ATLA 4ED7A 3CJ0A 4ZP8A 4R0EA 5K14A 3ZSWA 3OLAA 4NCAA 2XY5A 5HLFB 4C8MA 1VSJA 4F4ZA 5CYQA 3OLBA 4KB0A 3BQ1A 3WNGA 2XRIA 5KFCA 4FK4A 4IDKA 4HUFA 4NLSA 1REVA 4CHQA 3LANA 4Y2CA 3EPGA 1EXQA 1S1TA 1NJWA 1FKPB 3BQ2A 2IA6A 2YNHB 4DFKA 3TAEA 3TI0A 4OKKA 2AX0A 5F8JA 3AVGA 2AGOA 3JYTB 3QEWA 4FM2A 4GMJB 2P5OA 3QINA 3V6KA 2Y1IA 1CXQA 5DLFA 2PY5A 3DM2A 3QIDA 4FBTA 3O4NA 2R7YA 1D0EA 2BQUA 3HVWA 3OHBA 1NK0A 4RW7B 4WXOA 1QQCA 2W42A 1RT3B 1CSJA 1IKVA 4AHUA 2B6AA 4NRUA 4I2QB 1D5AA 4ED6A 2W7OA 5J2PA 3RAQA 2HHXA 3CDWA 2EHGA 2HHQA 5CYMA 4OKEA 4H4MB 4X2BA 1JLQA 4JUZA 4RNHA 4CESA 1C0UB 2IOCA 3QGIA 4EBEA 2GBZA 2YKMA 3CJ3A 4OVLA 4CGFA 1C0TB 4LSLB 1BCOA 3MFIA 4C8LA 2OPQB 4TLRA 4ECWA 1R0AB 4NLOA 5FROA 1J54A 4ZHRA 4CF0A 3PY8A 4DEZA 4CJFA 1JKHB 4IG0B 4CE9A 2UVRA 3T5HA 4B9VA 2R2SA 1X9SA 4QWCA 4FJ9A 1QAIA 1RT5A 2RDJA 2KW4A 2FC0A 4J9NA 3SI6A 2DFHA 3MTKA 4KE5A 3ZSVA 3I5CA 2DTUA 3PUFA 4I2PA 1U49A 3DOKB 3UPFA 3GV8B 1IO2A 3TR8A 3NH2A 4PQUB 3RRHA 4IG3A 2Z1JA 2YV0X 1UWBA 3A2FA 4WE1B 3QYYA 1VSFA 4GW6A 4ECVA 1JL2A 3TAFA 3L2RA 3AVHA 4DTXA 2HAIA 4ECSA 3KLEA 1ZBUA 3I0RA 1DTTA 3KLVA 1JLBB 2AJQA 1RYSA 1SH2A 3DDKA 4N47A 3ASMA 2IM1A 2XGQA 1HARA 3AO1A 1SL2A 3HK2A 4K4UA 4JRPA 2IC3B 4HUGA 3CYMA 4NZ0A 5EUHA 3MR2A 3MEDA 4RW8B 4DTUA 3SZ2A 1S1XA 4FJGA 4O55A 1N56A 4FBUA 4MK8A 4G1QB 4URSA 4H4OA 1I6JA 3MXJA 3D0PA 1VSKA 4FJXA 2JC0A 4B9SA 1RBUA 4KFBB 2HWHA 1S49A 5EU7A 4DTMA 3KHHA 3BREA 4Y3CA 3RBEA 3V9ZA 4R8UB 4CEAA 5KTQA 1LWCB 1TAUA 4ID5B 4OKJA 2FLNA 4B9MA 2W9CB 1HMVB 5J2MA 3SV3A 3M9NB 4CJRA 3OYLA 4NLVA 4ZPDA 2W9BA 3KK3A 4KSEB 1S10A 5F8IA 2XWYA 2B5JB 1W25A 3DLEB 3QETA 5KFEA 3MXIA 4CIEA 1K6YA 2XHBA 3LAMA 2D0CA 1XHZA 4LSNB 3L3VA 1TK5A 4F4KA 2RF2A 3FRZA 1WNEA 3OYAA 1U09A 4PUOA 3PR5B 1LV5A 2D41A 1QUVA 3MECB 1MU2A 4E7KA 3G86A 4IKFA 3EYZA 1LW0B 1DTQA 4FCYA 2G8UA 1BCMA 5L1LA 1O1WA 2I1RA 1TKTB 3DLHA 4JRQA 4EP4A 1JLGB 3RTVA 3BQ0A 4TYBA 2W8LA 1K1QA 4OLAA 3AVAA 4H54A 4J9SA 1RILA 1NHUA 2YKNB 3UR0A 1T03B 1RT4B 1QSYA 3OYGA 2WOMA 3RB6A 1ZYQA 1FK9A 3P5JA 4CJVA 2PYJA 4BWJA 4CEZA 1T7PA 4FK0A 3RWUA 3CWJA 4JLHA 2R8HA 2WB4A 3MFHA 1RT7A 1TL1B 1QHTA 3MAQA 3QEXA 3VN5A 2DPIA 3S3NA 5HROA 2E9RX 4I7FB 1S6PB 2FJXA 2BQ3A 4CK3A 3CQ8A 3IRXB 4MFBA 2X74A 4CEFA 4K4VA 4O0IA 3VA3A 4FK2A 2HMIB 4ECRA 1RDDA 3AVMA 1TKXB 3NFAA 4QWEA 1NJYA 2FVQA 2YHBA 1TVRB 1RDRA 4IRDA 4FZYA 2UVUA 3OYJA 4WZMA 1XC9A 3OS0A 3KD1E 3AO3A 5KT4A 3QEVA 2FJVA 4QW9A 4DFMA 4RUAA 1JXEA 4J9KA 2D3ZA 5HLFA 3Q8RB 4DL3A 3OYKA 3ZT1A 4J9QA 1JLCB 1KRPA 5L1JA 2HNZB 4E3SA 3MF5A 4GC6A 1XHXA 4IH6A 1NK9A 4CK1A 1XR6A 1Q9XA 3OSNA 5KFFA 1K1SA 3GV5B 4K4WA 1RTDB 2OPPB 2FVCA 4KHMA 3ISNC 1FKPA 3HJFA 4OJRA 3RRGA 4IRKA 2YNHA 2QKBA 3CO9A 3S3OA 1KVBA 2B4JA 1TP7A 2WTFA 4NYZA 4OLBA 4ZPBA 3GIKA
chains in the Genus database with same CATH superfamily
4M3XA 1VQ4N 2IVYA 1F5CA 3C14B 2GO9A 2POKA 1YK9A 5A2QU 1NKCA 4N8OA 3TZWA 1SKSA 2Z1GA 1HNZJ 1RT3A 1J6ZA 3HSZA 3NGSA 2EXUA 4K4XA 1RNHA 1RJJA 2KJVA 3OYMA 3NOCA 3VF0B 2DITA 1VGYA 2WCXA 3NCIA 4M3UA 4FWPA 4FP9A 2QWQA 5BYSA 1FJGF 4LF9K 5HRPA 3TAGA 2XWXA 2KJWA 4C1NK 4H03B 4WFYA 5D4LA 4EYHB 2E6LA 2FLPA 3DFEA 1RDBA 2VPYB 3ZX2A 1VC6A 4IG0A 3M5RA 5ETOA 4LFAJ 3KLHB 2KU7A 4YHHF 1KFDA 4ZOSA 1SJQA 4ZVFA 2YPYA 3W60A 3LGNA 2HQDA 2XI3A 4HACB 4A5BA 3FQKA 2CJBA 2ALYB 4EGLA 1U8WA 4ECXA 2ROEA 3HPHA 1B4SA 4JI1J 3CIZA 3RBZA 1PIEA 4CZJA 3QATA 3L4BC 4OGCA 5KG5A 4ISEA 2QV6A 3JSMB 4MAKA 3BDPA 4USUA 1DARA 4M5MA 4DR4K 1NH7A 4DV0F 2QMWA 4DTSA 4Z2XA 1FRHA 3EKSA 1NBEB 3I8BA 1XEZA 2ZD1B 4DR6F 3IN5A 4B3OB 2MQLA 2PE8A 4RBTA 3TANA 5LMUF 4P10A 4BR7A 4Y0WA 4HHHA 4XO0A 1VSHA 3V9XA 1JL1A 3HZEA 2G8IA 3M05A 3SBMA 3ULHA 1YJTA 3ZT3A 1BIUA 4W5QA 4QS8A 1UVNA 1GMWA 1C1CB 4YFUA 4ZVHA 1GLEG 1KXPA 4KTWA 3FBEA 2LDIA 2QWPA 4R8UA 1RT7B 4MKYA 3J7AN 4QR1A 2MYFA 4PYDA 4CF8A 3WT0A 2UXDJ 4USTA 4FPRA 4DUYF 3A5OC 2EK6A 2HMPA 1VOMA 4EU0A 2FJAB 3M8SA 3IR6B 3KWGA 1PG5B 3CCTA 3WXIA 3UE5A 2ILYA 2GC8A 4QR2A 4CLYA 3HD1A 3WHIA 2R9LA 4LSNA 3W2WB 2IM3A 1BL3A 3DHXA 3OR2B 3MWBA 1TKZB 1HI0P 3SDEA 3PCOB 1S9FA 3MECA 5AQUA 1N34F 4ZVQB 1GLBG 4R5PB 1ZTWA 4GKKJ 2AJ1A 3CMAN 2X7IA 3CG7A 1JLGA 5KT7A 3FCWA 3CD6S 1CJVA 3DOMA 4OPKA 4XPCA 4DSFA 2AF6A 1RBSA 2HHWA 2BJ3A 4KHRA 5KFAA 2ZH8A 3HI9A 3A3OB 3IGNA 1R59O 1FWKA 1MMNA 2HAFA 1SV5B 3K8WA 4BR0A 2E1CA 3MR6A 1ZETA 2MKSA 3CCLS 4DCPB 5I3QA 2V6AA 3O3HA 3OVNA 1IBKK 2YWKA 2QG9B 4ID1A 2VQEF 2W6KA 5AT1B 4I64A 4DV7J 3QICA 3M6XA 4OZ5A 1QSLA 1YZ6A 4I7FA 1S6PA 3G0ZA 4CEQA 2R7SA 3O44A 3C2PA 3D4JA 4CZHA 5I42B 3KLIB 1TKXA 2HIQA 4ZTJA 2RSQA 2NYHA 1TVRA 5F9NA 2HBQB 4CM0A 4CHZA 4OHXA 2A3JA 2QLFB 5A8KA 4JKDA 4CJ7A 2CGLA 5GMKa 1HWKA 2G8FA 5DG7A 3PYEA 3PACA 4C0HA 4DZ6A 2KXNB 2WRMA 4RG8A 3TX8A 3T1YK 4NOHA 5CHIA 3IR5B 2O1PA 1X5TA 4C11B 4PR6A 3LDLA 1NPKA 4N56A 1Y3KA 2EFNA 2DGWA 3WXLA 2ZH9A 3KHRA 4FLXA 1OS5A 1TK0A 1FVSA 2ZNYA 3RR8A 3ET6A 1FTCA 3MCOA 3W8PA 3H08A 1HHSA 1UPPA 3TZXA 4B3RF 4U8VA 3KKSA 2O66A 1N5YA 4AXIA 1IBLF 1RKIA 3HKZD 2W8KA 1FKOB 3FSIA 1WI8A 1A5XA 3LP1A 3IWXA 3TQEA 4CWBA 5C24B 1WHVA 2KDOA 1CZ9A 5HQ8A 1HI1A 2RN2A 3UKRA 4YB7A 1KAZA 4OIXA 3SJJA 3HDSA 3BBFA 1FJGJ 2EPIA 5LM7E 1YJWN 4MH8A 2KVQE 1IBMK 4MDAA 5AQVA 2IJRA 2F9WA 2B9XA 1CEZA 2E1YA 4C2MA 4FSVA 3MCNA 4CZIA 4WZQA 3KJVA 1N0VC 1AT1B 3M6WA 2V50A 1VRUB 1Q16B 1PO6A 1UPMB 4KO0A 4FW2A 3P5TL 1RWVB 3KK1B 4LF9F 3ELHA 2XG8A 4AHSA 3TSPA 4UY8O 1F9HA 2LXIA 4NLDA 2VFSA 3A5NC 3C6AA 1U4BA 1OH5A 2OIHA 3ZSOA 2LLZA 2LU1A 4HHJA 3AY0A 2ZUGA 1UVKA 4YP3A 1W0HA 2IBKA 3KUEA 3HSCA 3PM9A 2DEJA 2WVEA 4JEPA 3M32B 3CCUN 5LL6d 2GA7A 3RG6A 1VQ7N 3ULEA 2Q3SA 3QSIA 1XWLA 4J9PA 4X4PA 4DV0J 5D0EA 4H5WA 3VENA 4TXSA 9RUBA 4XIUA 1UA0A 3D0HE 1VBKA 3LPUA 3BJYA 4DR6J 1T11A 1I3AA 2BKPA 3PW0A 5F0XA 3P6YC 3SPZA 2A1SA 1AW0A 1KONA 4OGEA 4GC7A 1R8PA 2YBVA 3V1OA 2V9KA 4RX6A 5ETLA 4WPAA 1YSJA 4Q44A 4KV8A 3MM7B 3VERA 1RAHB 2G4BA 4DS5A 1QAYA 4DMZA 3UDVA 1Q4RA 1U0HB 4NXNK 1NMEB 4NLWA 5E5NA 4OI4A 4HEA9 4WCEL 3NF9A 4LF4K 3CNQP 3MEEB 1IKWB 3MEGA 4ZPWR 3V6HA 2G13A 4QYRA 2A0FB 4BREA 5DG9A 2HBJA 4ES1A 2B4VA 1D1UA 1LWEB 2E4LA 2YNIA 2DRDA 2QE5A 2RB7A 4KHQA 4UY8T 4LBPA 4BR9A 3OYHA 5HATA 3PYFA 3BN7A 5A8RA 3H45C 4EUVA 3IFEA 3TABA 1H0HB 3ZEUA 3NMUA 1N33F 1F6TA 3JS6A 5AQGA 1N34J 3M8QB 4U67Q 2P9UB 1GT8A 1F5AA 2MQ8A 3UDLA 4FWQA 2YY3A 2FGCA 1S9GB 1KKHA 2I5JB 4NLPA 1A7GE 3GSIA 4H5VA 4CLFA 1FVQA 3EICA 3GJSB 3BPDA 3EZOA 3R1XA 1MN7A 1GLCG 5CAAA 4C23A 5HRRA 3IG1B 2WC9A 4C48A 3W8GA 2CA9A 1D8ZA 4ZIWA 1MNEA 4RW9A 2ZWPA 3FFIA 4MIAA 2XMWA 1HKCA 4P7TA 3ZT0A 3NBPA 3KMQA 3EPIA 3PRVA 2CNLB 4ED8A 4YR2A 1U2CA 5HMWA 4BVOA 3LZJA 4IJNA 3DRSA 3DYAB 2XULA 4O3OA 5CXTA 3SQGA 4YR0A 6AT1B 1P9YA 2ASJA 4DTNA 2VYPA 2QXFA 5KT5A 2NR0A 4HLBA 1KAYA 3C7NB 5CCMA 4L3QA 2O3DA 4LJMA 4JKEA 2VJUA 4KKOB 2VV5A 1QS4A 2AGQA 3CCMN 1O5JA 3DRPB 4GRSA 4LREA 3ZTSA 5A6WA 1U25A 3PLAA 2CRLA 4PABA 2EC0A 1IH7A 1DQAA 4JI7K 2C3PA 4UOHA 3LOUA 4EEYA 2Q36A 3WXKA 2EC2A 4WIQA 4UY85 2KG1A 1QAXA 2UUAF 1AB8A 5AXNA 3RMDA 1X0FA 2C3OA 3CVKA 3DRRB 2OLWA 3BSAA 1D3WA 3O9TA 1W2IA 5JS1A 2D0BA 1KQKA 3VQPA 1DZ5A 1SH3A 3NY0A 3M8WA 2AP6A 2VBZA 2FBYA 4WKYA 1HA1A 3UCGA 2J6UA 5E41A 2NUUG 5KQ8A 2QWNA 1H3DA 3MMAB 1HNIB 1LWFA 4LSZB 2HGMA 2MHNA 2MZRA 1B7FA 3UN5A 2O8FA 2QWMA 5K20B 4USIA 2IVFB 4P2SA 4ZIVA 1P90A 1KQSM 1PC4A 1VMBA 4PWUA 2YKPA 2X78A 2VODA 3BF3A 3CIPA 2CNKB 4OHVA 3ZC4A 3H5YA 1VQOS 1IBMF 4CJEA 4G6VB 2JLGA 5ADZA 4JP8A 5C0YA 3QEIA 1B92A 4FJLA 1SPBP 2FJBB 2NRRA 1SVDA 2JNJA 4FJMA 1YXQA 1AA1B 2BA9A 2BJ9A 4OI1A 3MUTP 5KFYA 3CJ8A 4X4SA 3P5BP 4LF8F 3GFZA 2B7BB 5KFLA 2Y1LB 2HS4A 2DVIA 3CPWM 2Q6CA 3T9ZA 2G2YA 4BC2A 4RNNA 2VG5A 2OANA 2ZF5O 1BGXT 2OD4A 4DR2F 2DFEA 2DFFA 3TUZC 3GCXP 1X8DA 3ZCMA 3NS7B 1HUXA 1MWYA 2VDIA 1S72S 5L46A 3WC2A 2QT7A 1L3KA 1T9UA 4USJC 3K58A 4L6V3 1F9FA 4DF8A 1R27B 2EVZA 2B56A 4ZCLA 4YOUA 3CSKA 1I1GA 4IFVA 1SKRA 2HBRB 4LMZA 1W26A 2MTLA 4RUBA 4IR9A 4BR2A 1R7IA 2FZKB 4FDFA 3I31A 4B1VA 2GV9A 2Z56B 2FSJA 3R5BA 1T02A 3PYGA 4FLVA 4Q2LA 1CC7A 1TL3B 4DG1A 4KTZA 2C2NA 1EB0A 4EHUA 3G6EN 1XC3A 2HBYB 2P9GA 3B78A 4RNFA 5AQYA 1Y5LB 5B0AA 4LF4F 1FI4A 1VIOA 4KI6A 4DV6K 4WQ4C 2DY9A 2AV5A 4BRMA 2VG6B 1N33J 1HQUA 2YH0A 4OV1A 4F04B 2W9AA 5C25B 2VG7B 2HEKA 2MQMA 3H3OB 3HP9A 5E3RA 4QWAA 2ZJRL 1RADB 1S0NA 1XERA 2BJDA 5L9XA 4GVBA 3OR1A 5HVFA 3VQ7A 3MPDA 1R8CA 1NEEA 1B0PA 1VQMN 1KLMB 1QVFR 2Z8QA 4DU1A 2MZQA 1Z26A 1ILYA 3MN7A 3EXYA 1X1PA 2VU5A 1BQMA 2MZJA 2DNMA 3IDHA 2QLWA 2IFXA 3NH0A 2MJNA 4FF1A 3R6MA 3AA3A 1KS2A 1ITPA 1JIHA 2BE9B 2FDNA 3T1HF 1XN9A 3B8AX 3MX2A 1IJFB 4CHNA 2PDAA 4EP5A 3FEZA 3O08A 4ETXA 2CPHA 1UZDA 4U7CA 3TRGA 3FGVA 4USMA 2OPSB 1RBRA 2PZSA 1CJTA 3CC4N 3AD8C 4CTAB 1HYZA 3A5LC 2BANA 5F0UA 3U3YA 4ZLNA 2HZVA 4AHVA 3JS9A 3VAGA 2NRTA 1VQLS 1NSQA 4ZVGA 2GEMA 2MQPA 4CP5A 2R7RA 3ZETB 3M3ZA 2QSWA 4NPOA 2DK2A 2CIMA 3KG1A 4YS2A 1R0BG 1H7XA 4ED1A 4DV4F 4J2DA 5E3AA 3BGRA 2W6LA 2UXCJ 4CH7A 2IA0A 3WZ0A 1FE0A 3W62A 3D2FA 4NEYA 1C0GA 1VQ9N 1WACA 3BKUA 2OELA 2UUAJ 5AQNA 2C2KB 4F2RA 4LF6J 1NMNA 4DX5A 1W97L 4YDUC 4O3NA 3AARA 3RBDA 1VQ5S 2A2DA 1XTZA 4N7TA 5FLXY 2LVWA 1UKUA 3O9RA 4GY2B 4TLQA 1GOAA 4NX9A 1FE4A 2WVFA 3KHGA 4I6MA 3CJ5A 5GAHI 1Q5VA 3RAMA 4DCOB 4V19X 5E7OB 2D0OA 5CCLA 2XMVA 3K5MA 5K14B 4OYOA 4J9RA 1Y3JA 2J76E 1NNDA 1VK0A 1QQMA 2GVZB 3MPWA 2R3VA 3LP2A 4IDKB 2K3KA 4A8MP 2P9KA 1H7WA 3IAS9 2HHVA 2FSKA 3U02A 4PXDA 1SXLA 2KRRA 2DRAA 2Y1JA 3M4XA 1GLJO 3OYDA 3T9NA 3R7SB 2FYXA 2CPEA 2KT5A 4ELUA 5M2RA 3MCAB 3UQSA 1XR5A 1S57A 3R2DJ 4B3SJ 1HHTP 3EVWA 4IH7A 1GLDG 4ZVSB 2PFDA 3F56A 2IY5B 1NU0A 1RAFB 3OVBA 4ITSA 1FRKA 3GE9A 2KT2A 3QZ8A 1NK4A 1NPPA 2FD2A 1FDBA 4LF8J 1IKXA 1PYOB 1CG2A 4ANCA 1A9NB 3GJTB 1UJ5A 4BCAA 4EFAC 5CQGA 1X4EA 1JLQB 3OPKA 5IC4B 3AFGA 5GIOA 2UVWA 2GNKA 3HHLA 5GAGI 3D6HB 4UOCA 5B09A 3RUBL 4DR2J 2E2NA 3LA0A 5BR9A 2HW3A 2CJAA 2XO7A 1U8SA 4HUEA 3P39A 3THWA 4ISGA 1G6BA 5T7LB 2CDRB 3DMJA 2IRXA 1V5IB 3DNCA 5DQIA 3NAIA 3THPA 2PA3A 2GQQA 1O51A 2JOQA 2NS1B 1NK8A 1SL0A 3SQ2A 1QDUB 2V69A 2EFPA 3B4MA 4I2PB 3GL1A 4DLEA 1UEVA 2NQPA 3H1VX 4ED5A 5KFUA 3KXDA 2PD1A 1NGBA 1JLEA 2HVEA 4ZLLA 2OO4A 2BJ8A 3GP9A 2W01A 4G1IA 1SC3B 2HVZA 1DTTB 3NP5A 3EE8A 2QEXN 4LF4J 1NHVA 3NKYA 3Q83A 1VI7A 4AXJA 1WDTA 3LP0A 2V4JA 2A3ZA 5HL7Q 4DMNA 3VQ4A 3T1AA 3U1LA 1GOBA 2GUPA 2F3JA 4Q5VA 5KPTA 2A42A 3HZ6A 1NBWA 2ZC4A 4DL0C 4RBUA 4URGA 3MM5A 1X4FA 3L95X 4OZNA 2JC1A 5A8WB 2KLAA 1HBNA 2CAJA 3DC2A 1WAJA 2U2FA 3FZMA 2JEGA 2CZ4A 1KC8O 4O44A 1UVLA 2Q3PA 1DAXA 3A1YG 4G1PA 1K8KA 4FF3A 5FLXU 3IKMA 4CHYA 3I9V9 4FJJA 2BE2A 1QE1A 1UJ6A 3CETA 1L5UA 2AWZA 3J81O 1ZTTA 4Y28C 3T1HJ 5H9FJ 2GGPB 3H6EA 3OYCA 2VPWB 4K5RA 1OVYA 4CJTA 4PUOB 2ZC3A 1WEYA 1Q1KA 2F96A 4DTOA 3GIJA 2OUGA 4DR7F 3IBFB 1PYSB 2LXUA 2WZ1A 3CCJN 3WNHA 3SPYA 4B9UA 3J80O 1JLBA 3MR7A 4BQZA 1QTNB 1T05A 4LVNP 1KVAA 2E1AA 4DQ8A 3QMQA 3M9MB 3PO4A 2MKCA 4Z4IA 3VCDA 3P8BB 5K8NA 4CJUA 4ZPAA 3Q8PB 2AKWB 4ZPVR 1T3OA 1PBUA 4MYTA 1NOYA 2OSQA 1K0VA 2WOMB 4N41A 4F3TA 4LR9A 4R79A 1FK9B 4DV4J 4LH5A 1WUAA 3KHYA 2LYVA 2FBVA 1KNZA 1FHTA 3V9SA 4R25A 2QL7B 3UNGC 2V7YA 2BACA 3CW2C 3EJMA 1SJFA 3J7YI 3CD6N 2KT3A 4KPYA 2HIYA 4H0OA 2ZH1A 3RW6A 4MFBB 1KC8T 1CPZA 3UNYA 5GINA 3V6DA 1GXLA 3QJLA 1A6LA 5GADI 3MM9A 4FLWA 4GV6A 2PO4A 2M2BA 3LPEA 2R7WA 4RKUC 3VGVA 2FSNA 3CCLN 2RNEA 4UUXA 3M8YA 3MMBB 3TNVA 2XBPA 2R7QA 1PILA 3VAFA 4NCAA 2HOEA 1TUVA 4C8MA 4A8WA 1NU4A 4F4ZA 3OLBA 2DR9A 3G87A 4X64K 2M5YA 1T6DA 3D9BA 4NLSA 3GTYX 1XUPO 3LANA 5IV4A 3QT5A 1FKPB 1DFDA 2CH6A 3BQ2A 2IA6A 4NLBA 5HQLA 4E1JA 3TI0A 1GLLO 5CHCB 5F8JA 3VHQA 6FD1A 3JYTB 2XMKA 5L8RC 2XZWA 4PPZA 3A8JA 5CZXA 3DM2A 3QIDA 1W7WA 3O4NA 3LPYA 1D0EA 1YJ7A 4CI6A 4WXOA 2W42A 1IKVA 1M5HA 1TU0B 4NRUA 1D5AA 5AXMA 1VFJA 3ID6A 2W7OA 2HBZB 2O67A 1LWXA 5AXLA 3RAQA 5AQMA 3CDWA 2KB2A 3HJVA 4B1ZA 3CJRA 3J7A1 4H4MB 1C0UB 2JL9A 2GBZA 2YKMA 2BJEA 4CGFA 1C0TB 4C4WA 2QLBB 2CPFA 1FT8A 4A8KA 4J9VA 1EARA 4F3QA 1VK3A 4TLRA 1MMDA 2NXCA 2O8DB 2QWLA 1X5PA 4CJFA 1JKHB 1Y0HA 2HF4A 2R2SA 4FJ9A 1VRQC 4YB1P 2RDJA 3AXMA 4PKIA 2ZNZA 1GLFO 2J0WA 2YH1A 1NGJA 4AUKA 2CXEA 3PUFA 3OBIA 1IO2A 3NH2A 2VDHA 4IG3A 2Z1JA 2OTLN 1LFWA 1F2GA 3W9JA 2DNPA 2AEJA 3A2FA 4WE1B 1FXDA 3QYYA 4JOUA 1VSFA 1VHXA 1JL2A 2GAGC 3KLEA 2DNNA 3I0RA 3CC7S 1JLBB 2AJQA 1Y5NB 3DDKA 4N47A 3ASMA 2XGQA 3P31A 1RTZA 2IYGA 3V2UC 4ES3A 4LBIA 1OY8A 2VCPA 4NZ0A 5EUHA 4RW8B 4ED4A 3L09A 1FD2A 1S1XA 1DURA 4RPFA 3MXJA 3MUVP 2CPYA 1TTHB 2E5IA 2JC0A 1RBUA 4DV5K 3UWTA 4JV5J 1HKAA 4DTMA 3BREA 1VQ8N 2W4CA 3RBEA 3WIUA 1G7CB 3D68A 4DV1K 1TAUA 5KTQA 1LWCB 5EX3A 4ID5B 3BO3A 1WOQA 2W9CB 5J2MA 3M9NB 2QYCA 4CJRA 2W9BA 3MM6B 4IO9Q 4J9UE 1OWXA 5D78A 5AQTA 2B5JB 1RHKB 3U7JA 5F1XA 4F0HA 2RDDA 3W5XA 3JTPA 3LAMA 5ETNA 1FFGB 2VUGA 4FXWA 1JJ2R 1WBBA 2Z57B 3QAEA 3GFYA 2W25A 4DR7J 5M1KA 4UOGA 1YBUA 3GONA 1LW0B 4JI0K 2MMYA 4U7BA 2FJEB 1BCMA 4PXCA 5L1LA 3LUYA 1OH6A 4HWIA 4H0PA 2WSCC 3MCMA 1RDWX 1CS4B 4J9SA 4J5OA 5LY3A 4JKBA 1T03B 1QSYA 4XH1A 1WG4A 3ETOA 4JKHA 1X4DA 4YY3F 4BWJA 4CEZA 2ZBRA 1G2EA 3SIPB 1RXOB 1T9XA 3O5TB 4JLHA 3C16B 2EBGA 1NDLA 4HH0A 3OW2R 1ZM4A 1IVZA 4O8UA 3ILLA 1QHTA 3VN5A 3W61A 2DPIA 3QRPA 2CWXA 3KJNB 4HI1A 3IRXB 4K4VA 2DGVA 2VPZB 1RDDA 2BYCA 4KPCA 3NFAA 2LQBA 3D6MB 4NE9C 2LECA 4MT1A 2YHBA 2YHWA 3U8XA 1RDRA 4IRDA 1M90O 1N32F 4WZMA 4W4MA 1XC9A 2CZ9A 1X7VA 2ABYA 5KT4A 3QEVA 3H25A 2O8BB 2CQ2A 1YGYA 5HLFA 3EL2A 2D3OR 1JJ2M 3BH7B 3ZT1A 1FXLA 2BABA 2HNZB 2F8HA 3J81Y 4GC6A 3OSNA 2DNYA 1VQSA 2OPPB 3EDRB 3TUJC 4A48A 3RRGA 5C2GA 5LJWA 1TL7A 3HHEA 4NYZA 3J80Y 4OLBA 1LXJA 4X64F 3GIKA 2QWRA 2LXFA 4BRHA 2E1RA 4JKGA 3SQ4A 4CGDA 3I5AA 4C6AA 3L3UA 2KG0A 4Y2AA 1QZ6A 4RW7A 3UR3C 2FC9A 4CH1A 2I7NA 2Y0SD 4I2QA 1HJRA 1HR0K 4P52A 1CLFA 2NRHA 3SJHA 3OVSA 2VICA 2IS3A 3M30B 3PRDA 3I8DA 3EZUA 4ZJQA 2ETJA 4H5TA 1FEHA 5IS2A 1IBCB 3OFGA 3SUPA 4USHA 2H1YA 5KT3A 1J5EF 3LAKA 4G3IA 4A59A 2GX9A 4CLSA 5D4OA 4QZVB 3S1TA 1KVIA 1NJIO 1FCAA 1M5OC 1YAGA 2K7KA 1WTBA 1R0AA 4ALZA 3FRYA 2D1CA 1M90T 4BRQA 5ETQA 3AY9A 3OFFA 5AQLA 2WFBA 2P9PB 2AD9A 1LAVA 5J2MB 1Q0NA 3M1VB 4HTUA 3H4BA 3OSPA 3OJUA 2RQ4A 2LFVA 2NUBA 3SCXA 3VQEA 1NGAA 2NREA 2OFGX 1XMQF 2WONB 3DOKA 3PW2A 1WHXA 3UW1A 4PQUA 3L2QA 1P8GA 2PSZA 4K50A 3FZ2A 3M8PB 5AZJB 1AZSA 1S4EA 1RBLA 3CD5A 2HBMA 5F3ZA 3BUZB 2VGMA 1S97A 2Q0RA 2IAJB 3KLGB 3CMQA 1RT2B 2ZEJA 4GVMA 3AQOA 3P38A 3NH1A 4LR8A 2CJ9A 2W7AA 1MWMA 3QFHA 2HQCA 4RU9A 4A4JA 3BGUA 2V7ZA 3MAAA 1H72C 5DDQC 1D8YA 2VF3A 2WK4A 4CD3A 2ASLA 4Q8EA 1XIQA 1E6VB 1YJNS 3U3GA 2DNZA 4X62K 2GIQA 3AOBA 5KFSA 1RAEB 4EK2A 3TU5A 5BR8K 1U24A 3TTFA 2V2ZA 5DGAA 4B3MJ 1NJIT 1SZ2A 5HAOA 2P9NB 3RSEA 3QRRA 3LGHA 5THWA 1N36K 1HMVA 3KJFB 1B99A 4ZVTB 5B0FA 4OLPA 1TAQA 2C2EA 3DLEA 3E01B 3KIOA 2ZBPA 1VHFA 5MAOA 4CCHA 2ZWOA 2I6WA 3OYNA 4DV1F 4PWDB 1URRA 1S72N 4LF5J 2XMJA 4FS1A 3NDKA 2AZ1A 4RCHA 3PFEA 5CA5A 1WBDA 2WW4A 1MROB 2QW9A 4WFXA 4FZZA 2K7JA 4OI0A 2QA4G 3R7BB 2ASMA 1NB2A 3FBBA 2DRBA 2IIRA 1RTIB 4MK9A 1BUXA 3E8OA 1QM9A 3UE2A 3PHEA 3H8YA 4CJ5A 3VEWA 1YJVA 3GBTA 4X4OA 2NRZA 2PGCA 3F41A 2RMLA 3T19A 2V0NA 3DXMB 5LXRA 4NI2B 4JI0F 4DL6A 3VTHA 2VPXB 1SCJB 3GFXA 4YY3J 1UJ4A 4OYMA 1RWUA 2E29A 2HLUA 2QWOA 2LQ8A 1KN6A 2XO6A 4DV3K 3OL9A 4HDGA 3FNNA 2XLJA 3ZXWA 3HSJA 4J2BA 1TL1A 2Z2MA 4E1NA 3V81B 1ZM9A 1NG9A 3TVZA 1SC4B 3H0PA 3D3CJ 4UW2A 1Q7YO 4YOXA 2ZH4A 5EN1A 3FR0A 4DN9A 3CCVN 4DTJA 1OQ3A 5I4MA 2H3GX 2VFTA 3SFGA 1HD1A 1P27B 1IKYB 1EP4A 3KJQB 4YR3A 4BRKA 3ZT4A 3W7BA 1U0SA 1TYQB 3QNOA 2MY8A 5AQQA 3O1WA 3CC2N 1R8BA 4CLPA 3AH6A 1N32J 4IOCL 1R31A 1VYAA 3N4QA 4W5RA 3GB0A 1OIAA 3CFRA 2XM3A 2XMTA 1JLCA 3BGLA 1HKBA 1UVIA 3NGKA 3M8ZA 4CF1A 4KBOA 4CT8A 4F7VA 5HN0A 2GWJA 1RTDA 1YJRA 4KH1B 3QIPB 1KHVA 3HFZB 4BC3A 1BOTO 4E19A 5AQZA 3HD2A 2ZHAA 5L1KA 1RFQA 1N5VA 2RE2A 1MA9B 3ILJA 4MDBA 5KFHA 5LSOA 2WBMA 5SZTA 2HK2A 2R7OA 2GX8A 1AZSB 5KFGA 1I94K 2RS8A 3ZTPA 1ASUA 4C3MA 3ZX0A 3GR0A 3RMCA 2CVEA 3PIOQ 3NVKA 2ZM6K 4LFBK 1EX4A 2HHPA 4Y0FA 2L9NA 4DZDA 2FGOA 3PO5A 3PW7A 3KK2A 1QJHA 1CZBA 5MLCQ 3SAHA 3ZYYX 2EBEA 1Q7YT 4BE2A 5ETTA 3KDNA 1WF1A 2K3IA 3BKTA 3C6UA 2MHEA 1J5EJ 5KFRA 2DCUB 3OTOK 4LT6A 1HR0F 4JI2F 3D0GE 4BS2A 3QBWA 5GADP 4KRFA 1HBUB 4AE5A 3ZNUA 1VQ5N 1FDDA 3DOLA 3NWRA 3DLBA 5IT9Y 4CJ4A 1RHQB 4J7CA 3CJSA 3B82A 3QLHB 1RACB 5HBMA 3IAYA 3DLKB 1RP5A 5BPMA 5CZVA 3MHYA 1M5KC 1GX6A 4ZLJA 8ATCB 1DBDA 3PKMA 4ZP7A 1HRHA 5KG4A 2XMUA 2H5EA 1XMQJ 4Z4HA 4LRAA 3QRQA 1ZPWX 3H40A 4H5NA 1BI4B 2QO3A 4CIFA 3QNWB 1HPZB 1KOOA 1D9DA 1J5OB 1RWWB 3CJ4A 3MN6A 4KHPK 1OSDA 3L8BA 3NNHA 1SI9A 1AROP 3BM7A 4CLUA 1U1PA 1MLAA 2FLOA 1JXBA 1YDLA 5MLCV 1KTVA 2IRYA 3R5GA 4E89A 2Q2RA 1OVQA 4YDDB 3CCSN 3CMEN 2G0JA 4DJBA 2GELA 3VV2B 3HCXA 2HNYA 1S6OA 2DT9A 3BGFA 2E5LK 2O4GA 2HFZA 2V2KA 1DQ8A 4DWIA 4WF9Q 1O8BA 1DJ0A 5M2PA 3QO9B 4MK7A 5M1FA 5C42B 3L0QA 2B51A 4DL2A 2R7TA 3VA0A 2QK9A 5A2QO 1RBAA 5BRFA 2L9WA 4OZJA 4DL7A 4WQ5A 5IWAF 2C1EB 1HNZK 4Y34A 2B4UA 4NCGB 4CBWA 3HHKA 4ILGB 1JXLA 4ZJOA 1R89A 2NRXA 1RTJB 3R5CA 2QA4S 3RB0A 3K2PA 2YJEA 2X6NA 1EP4B 5FPEA 4Z7CA 1X4BA 3BS9A 4GVLA 4ELTA 2P9IA 2DR7A 4K8ZA 4I0WA 5KT2A 2UUCJ 1WWHA 1ZAVA 3CCQS 5ETRA 1EWQA 2X1GA 3H2UB 5I9EB 1S1VA 3HOSA 3L2UA 3KMSA 4CLLA 4LFAK 1YX2A 4YN3B 1U1RA 3HHLC 5AFUH 3C66A 1U6FA 1BQNA 3T5LA 2XMMA 4P7VA 2CQHA 2CQCA 5JS2A 5HQMA 4ICLA 5DQHA 4A46A 3BR8A 4JI1K 1N6QA 4DUTA 1S9EB 4ZMMA 1T95A 4S0MA 1NCLA 1ZH5A 1NNEA 2BOPA 2N3OA 1S6QA 3QZ7A 1JLFA 1HWUA 4M41A 4U8YA 1Z05A 3O1LA 5KPZA 2BR0A 1K9MO 3UN2A 2SXLA 4Z94A 2D9OA 4Q0BA 1YKWA 2YNGB 4JKCA 5DJBA 4ERDA 1FW6A 3V4IB 3KK2B 4DV3F 4B1YB 5TKYA 1NSKL 1EKRA 2C42A 4QBUA 4KBIA 4CZGA 1WKJA 5AXKA 1HQEA 1VQ6S 1N52B 3NLCA 4TYAA 2O8CB 4HTJA 4KTQA 3THXB 3JB9k 2CQ4A 2BQRA 3POTA 5E3PA 3OQ2A 3PX0A 4M1KA 5IT9U 4FJHA 2DJWA 1RGVA 1IR1A 3AVIA 3PJWA 2UXDK 2L48A 5DETA 1PGZA 1ZA1B 3T5KA 3I0SA 1CC8A 3WEEB 1UAXA 2NZ4A 3BR9A 2GJFA 3ZTOA 1F9EB 1RT6A 1Y7PA 2YKQA 3R5DA 4IFYB 4FJKA 3VGKA 5D3GA 2HZAA 1OO0B 4CYUB 1C1BA 1QY7A 4HHTA 3N0VA 1WSFA 2D7SA 2OTJS 3B6OA 5IQ6A 2ATQA 1VLOA 1CJKA 4U7UK 5EOYA 3TAQA 4EBCA 2O01C 3S3MA 4HHUA 4GKKK 5FD1A 1Z4UA 3DLGB 4TU9A 3WQTA 1RE1B 4MKBA 3TVKA 4PXBA 4B9QA 5DM6L 1K9MT 1YUWA 5M2UA 2ZM6F 2BGGA 4LFBF 4DU8A 2R8JA 3Q24A 1KHWA 2PEHA 4RW4A 5KFZA 4JI2J 4W92B 2B4PA 2QMUB 4DN0A 3O9SA 4DQPA 3EVOA 4WXWA 1CULB 2GV1A 4ER8A 5IQQA 3BBBA 3G6VA 4FWRA 3FCVA 1XI1A 3THYA 4DV7K 4LRFA 5EHHA 3ZZZA 3OTOF 1FWLA 3ZNJ1 1S7HA 3C46A 2RHQB 4UT4A 5U47A 2VKRA 2V8GA 3JSBA 4F0MA 3VQBA 2DGSA 1FESA 1LW2B 5G0RB 4I68A 4W98A 1U1KA 4CJQA 1NDKA 2E66A 2AT1B 2KN4A 2P6SA 2UU9F 4CI0B 1HWIA 1C4AA 4JHDB 1WSHA 4LFCF 4YB5A 1YHQS 5FPDA 4DU4A 3OBYA 3MCPA 2JJ4D 5ADXA 3A3PB 3AAPA 4PL7A 1BQNB 1TL5A 1DKGD 3E9PA 1X60A 5DZ7A 2C2DA 3AA5X 4RO0A 1S0OA 2OCEA 3O8WA 1YBTA 3MMCB 4XEIA 1RT1A 3DI6A 3IS9B 2AYBA 1AUSL 5A0YB 4DPTA 3M2VB 1VQPS 4UF4A 5BRHA 1WB9A 2M7SA 2E5LF 1HYSA 4PHTX 5IWAJ 1E6YA 4RZRA 1YF5L 2HNDB 3OT9A 1T9TA 4DB3A 3DXKB 2JFDA 4N8NA 3C15A 1U02A 3NE6A 3KNGA 1RK8A 2XS7A 1UOCA 3I5BA 2XSFA 1HNXK 3VEYA 1QHAA 5J2QB 1FJGK 4NWBA 2EG1A 1DLOB 2IDLA 5M1NA 1NGIA 3PG9A 3BH6B 5HP1B 2BX6A 1UEUA 4FJIA 3QAUA 4M5HA 2V4RA 3QQCD 4XH5A 4RW6B 3SCJE 2RKIA 4WQ4A 4KB1A 2R8IA 2VC1A 4H0TB 3NGYA 1Z25A 1NK5A 2BRKA 4DU7A 4GNIA 4CGHA 3TAMA 5KFNA 4EO8A 1CJUA 4A8FA 3N28A 2GMHA 3ZSRA 3OYFA 1VAZA 3AAWB 3AVKA 3CC7N 3LM9A 4FM1A 4LFAF 4G9ZA 4PCQA 3K59A 4ZVEA 4AQYF 3W3SA 3O8MA 4OX6A 1AUDA 3N4WA 4USVA 1HNVB 1M5VC 3VQDA 3VQTA 1ZBHA 4DV0K 3DGPB 1KEKA 3CGIA 5F41A 2R2UA 1KFSA 1CZAN 1Y9OA 3ITHA 2XGPA 3EZWA 4TY8A 4DR6K 4CO1A 1WC0A 3IMQJ 3HVTB 3QWPA 2EKYA 4X65J 4DV3J 2V2VA 1T8EA 5A2QY 1NK7A 5HMZA 4TU8A 4RWWA 3HVRA 1SBRA 2RRAA 5EWEA 1BA1A 3BF4A 4KY3A 3RAXA 3BV8A 3CQYA 4CZLA 4O3QA 1BO5O 3TX0A 2N82B 4QWBA 2P9EA 3Q23A 3B4DA 2ZE2A 1RAOA 1TR0A 3R1LA 2OEMA 2AQ4A 1RWOB 4FWKA 4IH5A 1YWXA 4BRLA 2EFGA 1JLAB 1NO8A 2X51A 2Z0GA 3D2EB 2BKOA 1S1WA 3AO5A 3OYIA 2C2ZB 2A6OA 5LSRA 4DPXA 4Y1DA 2FQQB 2RQCA 2XY7A 3WX8A 5I3UA 5J2NB 3KUGA 4E98A 2R7VA 4CGIA 2F5GA 2YX1A 2PI5A 3SYZA 3CJ1A 4NZ6A 3BY5A 2GWKA 2P2CB 3NF7A 1SUQA 3HP6A 3QFWA 1LKZA 4YDUA 1GQEA 1DY3A 4A8SA 1N34K 1FDNA 2NXUA 2ZFHA 3ENVA 4CF2A 1WC5A 3FC9A 3EN9A 4WYBA 2XC9A 4XPEA 3VMFB 3P49B 2VOOA 2HHHJ 3N5FA 4WCEQ 2IJFA 2CYYA 2A1BA 1UFWA 2FHMA 5AQSA 1S5ZA 1EETA 4L3NA 2MLYA 4LFBJ 4CEDA 1HBOA 5CYQB 1RT1B 2ZITA 5EX5A 1IR0A 2DEIA 2JH3A 2D0PA 2YNFA 3A8EA 2NPFA 1TMJA 1S5JA 3GIMA 2VBYA 1REVB 2QLJB 5FDLA 1U6ZA 2QJ3A 5B0DA 4O4GA 3AOCA 4ZPTR 2P9SB 2ZH2A 4K7QA 4KHSA 5B0EA 4B8AB 5AZIB 4DXLA 5C5JA 3VGUA 1HQ2A 3D67A 2FF6A 4FLTA 2RRNA 3K7RA 1VBZA 3K5OA 4M3ZA 2BEFA 4TU7A 4ZVOB 2RAQA 3A8KA 1WKKA 5KG6A 2JLEA 4URQU 3CDUA 5M1OA 4BLGA 5DLGA 1WN7A 4JI8F 2UU9J 4WF9L 1BIZA 2Z2YB 1V9OA 3SBGA 1NZ8A 4DR3F 1NDPA 3L2VA 1PSDA 2BW7A 2ZHOA 4LFCJ 4FF4A 4UZCA 4C8OA 3SMPA 5BRDA 2GW8A 1U1NA 5B0BA 3DLLL 1BD6A 4P9SA 4FWOA 4A57A 3LDNA 4ZHRB 4USKA 1MW7A 2GTDA 3TTCA 1FRLA 2DGTA 4K2XA 5J1EA 1KBRA 4V1Ak 4J37A 4PG6A 4CH0S 1FEEA 3G2XA 4MIWA 1NJXA 4J90A 3MPUB 3ATUA 3AVBA 3M6UA 4F26A 1LNQA 1FA0A 2E5LJ 5DQGA 3C8YA 4IEEA 1NK6A 2C2RA 3GIIA 2DGQA 3G71S 2X6SA 2E5GA 1T44A 4IZ9A 5ELZA 1S76D 1UL3A 1UWBB 3ALYA 4OPHA 1RBVA 4C0OC 2J9DA 5JICA 1OPIA 2E9ZA 4M63A 4IQXA 1K73O 4AYBD 1RCXB 1VQ4S 2OYQA 3VQCA 5F3TA 3AGRA 5IM0B 2ZH5A 1FXRA 3QT7A 2RE1A 3HKWA 1NOZA 3ENQA 1ZBFA 1FERA 1HNXF 4BR5A 2CFXA 4F3OA 1M1KO 5FIIA 1U2VB 4L8RB 2F1FA 4H4OB 2E7VA 4LF7F 1YVNA 4M5GA 1UVJA 2FVRA 3JAMU 3W1YC 4MJKA 3SXLA 4ZVUB 3ID8A 4HI2A 2XS5A 2OPRA 2JWKA 3FUYA 2IM0A 1JNRB 5H1SQ 2HVDA 4C3LA 4AQYJ 4CFDA 3G6XA 4FXVA 4NYNA 3H2LA 1RDCA 3KLFA 1RDUA 2J6SA 4DV2J 1IWGA 1WSGA 3J7ZO 4B08A 3OUYA 3LWMA 3U1NA 2YJFA 4X4QA 3AA2A 5ETVA 1OSCA 2EWHA 4CNZA 4KIAA 3KTQA 3KOAA 3W2VA 2V9WA 5LMNF 4WKRA 1DTQB 4KH0B 3DN9A 5TKWA 2FXUA 2RD5C 2LA4A 2V8HA 3R6LB 4QU7A 1ZBTA 1N88A 4OJ3A 2XSJA 4F02A 2Y8YA 2M8DB 1K73T 2ZH6A 4Z37A 2DHGA 3CDEA 2RPIA 1NZAA 1KLNA 3M2RB 2J7UA 3PSIA 4JN4A 3V9WA 3GCWP 1M1KT 4Q45A 1TV6A 1Y64A 4O4RA 5H1SV 4I1TA 3WQPA 3MX5A 3I32A 1LFPA 1TL4A 2W2QP 3QPIA 3TR5A 3BYPA 1WSVA 2QSFA 3SQ0A 4EFHA 3Q0AA 4U95A 1S1UA 2XLKA 2IVOA 4K43A 1YI2N 4M3YA 2GQCA 4ZCIA 3SFUA 1N33K 1QVGR 2WVDA 5KRTA 3PTWA 3K9JA 5I3PA 2W2MP 3D1OA 2QL5B 4IXCA 2KKHA 2VWJA 3R1HA 5L9NA 4BRFA 4NLRA 4LRBA 1BQXA 1GXUA 1KTQA 5C12A 1Q8IA 3CFPA 3J7ZT 5T41A 2ATLA 2XNQA 3CJ0A 2CGKA 1SQGA 4K2JA 5B0CA 2XY5A 1Q79A 3BQ1A 5CABA 3WNGA 2XRIA 4NMXA 4JI3F 2JVOA 3TJ8A 3CE8A 4CHQA 2DXEA 5IZHA 1EXQA 1S1TA 1BHNA 2AYGA 3IO1A 3THTA 3VAJA 5AQRA 3QDKA 4DFKA 4LR7A 3TAEA 2BMBA 2HQ3A 2GHPA 4OKKA 2AX0A 2ZJRQ 3QINA 3B54A 6FDRA 1CXQA 5DLFA 2PY5A 1Z6RA 2R7YA 3HVWA 3OHBA 2ACYA 4CO0A 1RT3B 5HO4A 2B6AA 3OBWA 4ED6A 1FX2A 3S7RA 5J2PA 2P8IA 1XK8A 4JI8J 1PJ7A 1KQFB 2M52A 3A3NB 2HHXA 4UUWA 1CVJA 1BC6A 4DR3J 2YHXA 2HHQA 3HF5A 5CYMA 4NO7A 1G99A 3M6VA 4JUZA 4RNHA 4OJHA 2UXCK 4OVLA 1SJ4P 1QVGM 3EO3A 3Q7BA 3MFIA 1U1LA 4FYWB 2ZGYA 5FROA 1J54A 2UUAK 1KWMA 1KVJA 3NNAA 3PY8A 1T0TV 3R3TA 4CF0A 3WC0A 4IG0B 3VTIA 1AYEA 4LF6K 3Q86A 4B9VA 3QBXA 1IM6A 1QAIA 5GVQA 1RT5A 1HHQA 2K1RA 4FOEA 4J9NA 3SI6A 1RI7A 4NYOA 2CUYA 1U49A 2V63A 4LIRA 3RRHA 2O8EA 2DB1A 4HTLA 1HLWA 3J7Z5 1REGX 1NGFA 4O8KA 4ILRA 3NGUA 3LH2S 1X3NA 4FF2A 4JI5F 3KG0A 4ECVA 2WTUA 3AVHA 4C97A 4DTXA 2HAIA 1YG0A 2VIHA 3N4PA 3OHRA 2HK3A 2FF3B 5BYRA 3IRWP 5HJYA 5LXYA 5IOLA 1HARA 3MM8A 1FNXH 2MGZA 2GVDA 3GLJA 4JRPA 1MWKA 4Y2MA 4HUGA 5K8PA 1WTFA 1X3MA 3MEDA 1HNXJ 1TUGB 5D15A 4O0NA 4FBUA 2H3EB 3OFHA 4F0KA 4LF7J 5AE1A 3D0PA 1UTAA 3UCZP 3NXZA 2KO1A 1NRKA 2HWHA 3UD4P 4B3SK 5EU7A 5JVGL 1QQOA 2V51B 1HKGA 2ZVIA 4Y3CA 3D6FB 4R8UB 1NAQA 4M5KA 5A6PA 2VB6A 1H6KX 3DAWA 4OKJA 4DPUA 2N7CA 4B9MA 1TZ0A 4NLVA 2PMZD 3KK3A 3QBCA 1S10A 5F8IA 4LF8K 2KI2A 1QLNA 3MN5A 3QETA 1S12A 3MXIA 4CIEA 2CADA 1ZPVA 2XHBA 5D8HB 3BP8A 1XHZA 2IVPA 4LSNB 1TK5A 2J0SD 4F4KA 2RF2A 2GZOA 3O3LA 4L76A 2BXJA 1WNEA 3OYAA 1FO1A 4DR2K 3SDEB 2VQFJ 4BHQA 3IM9A 3MECB 2UXBJ 3G86A 2NRVA 4JD2A 4IKFA 5LMNJ 4FNIA 3CCZA 4OX9J 1O1WA 4CQ1A 3DLHA 4JRQA 1RHJB 4EP4A 1JLGB 3R27A 2Z58B 5B8HA 3BQ0A 2P5VA 2OP5A 2ZOMA 3VALA 1RU1A 4OYZA 1CJVB 3DOMB 3PRBA 2NYIA 3AVAA 2Y8WA 4H54A 1NHUA 3UR0A 3EX7B 3G82A 4OV6A 1TFYA 3OYGA 4FKYA 3H1QA 3M2UA 3P5JA 3TTDA 5D0HA 3I96A 4CLWA 1Q8BA 1GEHA 2VGNA 2GMLA 3CQXA 1ELOA 3HTVA 2WB4A 2K06A 2FJDB 4WQ5C 1LQ9A 2FHJD 4NXMJ 1PAUB 1JB0C 4CZCA 3TSUA 2ZOGA 5HROA 1YITS 2E9RX 2LDYA 4I7FB 1UCNA 1S6PB 3ZO7A 4CK3A 3CQ8A 3W66A 4XK8C 1EQ0A 5LL6Z 1N54B 4B1XB 4O0IA 3NOGA 4FK2A 2EEYA 1TKXB 2L08A 2H5IB 3BKFA 1TVRB 3KYLA 4FZYA 2XNRA 1P1TA 5CD4A 2HBKA 5A8KB 3OS0A 2RRBA 2FJVA 4BRDA 2QI2A 4DFMA 3BPSP 1JXEA 2HGNA 1RWXB 1KAXA 2DCLA 3Q8RB 4DL3A 5B7WA 2JWNA 1VQNN 3MF5A 4IH6A 5K8OA 4JI3J 5JMVA 2KYZA 5KFFA 5FLXO 3GV5B 4FPBA 4K4WA 1ZZNA 2UP1A 2OEKA 2YNHA 3DCAA 3CO9A 2QKBA 1KVBA 3T1HK 3V4MA 3I87A 1TP7A 5H9FK 3ET6B 4RLEA 1W2BR 1H73A 1VQ6N 3I4HX 1LCUA 2LP4A 1N5YB 2GMJA 3CULA 2OMOA 2W1BA 4OJGA 3ENHA 3LP1B 3R6GB 3NGDA 1QTMA 2V34A 4RU2A 2AEMA 1SKWA 2YVSA 3H90A 3UCUP 4E7IA 5KGXA 4WJBA 2CPIA 2X3DA 1O6XA 3UKRB 3MEDB 1L3SA 1BLUA 1KQSR 3K8VA 3SBTA 4DV4K 4I6YA 3WBZA 4M95A 3RR7A 1C0FA 2B9WA 2HSTA 4LSLA 1B9DA 3BN4A 3UKUA 3IBWA 3KJVB 2OPQA 3LP3A 3IGVA 5HMXA 3VVUA 4JYAK 3FSYA 4K4TA 2LSNA 2ZJPL 1WHYA 4KO0B 1XNQF 1KQGB 3RRKA 2DXFA 2KFZA 2UXCF 1Q78A 4X4RA 2MPUA 2WSFC 4FWNA 5GAEU 1A5VA 3CPWR 2BE7D 4X4NA 1NDCA 4DL5A 4LF6F 2P9LA 3HM9A 1WOOA 4CD1A 4ELVA 1Y4ZB 5SWMA 4L73A 4JI5J 3ULEB 2F8TA 4RJVA 2AMCB 5KOXA 4PY5A 3W5YA 5GAEP 1W2BM 3CM6A 3B6PA 4IOAL 4FLUA 3QJJA 3W9HA 4F3MA 1RABB 1YTAA 3ZZYA 2IC3A 4UQGA 4W90B 5CY4A 2G2OA 2HQIA 4K8XA 4OO1J 3VQ5A 4WP9A 3K5NA 4X66F 4RWTA 3GMGA 3CJKA 4QIFA 3O6QA 3ZSQA 4G1QA 2QL9B 2ZBCA 3W3DA 2A41A 2OKQA 4FJNA 3SCLE 4KV8B 4KFBA 1ULRA 1TKDA 1S22A 1PJ5A 2NZCA 2FVSA 1V4SA 2OA8A 5AJ3J 1D9AA 4H0VB 3F9KA 4KAZA 4FYDA 4KHNA 3Q89A 2RJZA 4ZVRB 3TWZA 3MEGB 1ATRA 3G6YA 5RUBA 4ILMA 1DRZA 2GHVC 4B3SF 2YNIB 3MOZA 2C3MA 3GWCA 5FRNA 1RA7A 1GK8A 2CJXB 2IHR1 5A8RB 1VBXA 2DBBA 4PZVA 3B6BA 4KI4A 3MR5A 3QWUA 4DR5F 2OAUA 4FJ5A 1S0MA 3ZEUB 4CJ3A 3R8YA 2M0GB 1PAEX 3PX4A 4LQ3A 4FL9A 4FWSA 1TKTA 3CCEN 4PG5A 1RWKB 1B9FA 2ZH7A 3KFWX 1ITGA 5BN8A 2D69A 2CKWA 2M8HA 4OI3A 4ZTFA 2XB2D 4FYXB 3I33A 2YKNA 3OYEA 4HCCA 4J2EA 5JXSA 2N7YA 4IJAA 4M7YA 1RT4A 4GKJK 3L7UA 1RCHA 2IJNA 3S9HA 1NGCA 1F3FA 2ZUAA 3IC1A 4EO6A 1VRTA 1VR6A 5KAKA 1UP1A 4ZPCA 2YX4A 3F73A 3QNNA 4ZJLA 4RW9B 4YOWA 5E3QA 3FFIB 1ATSA 2F65A 2DPJA 3H59A 4C8NA 3NBPB 3MMVA 2H54B 3LF0A 4W5TA 4CO4A 2UUBF 3DRSB 2CGJA 1X5OA 2DY4A 4ED3A 2CG8A 1OY6A 1Y97A 3SQGB 2G1DA 1VLYA 2HMIA 1XNRJ 2V2QA 1D9FA 4MIBA 3H5SA 3AAQA 4LD0A 1WSEA 1YLXA 4ZS6A 4DSEA 1T3VA 1BWFO 2O5DA 3K2YA 1GX5A 4LY7A 5DZ6A 1SIWB 4OFZA 4J2AA 1ZS6A 4JV5K 4WFAL 1T9VA 3GYXB 1XQSC 3ZZRA 3G6ES 5KFMA 4NZ7A 2G8WA 3LQVA 1UA1A 5HRNA 1NXIA 3RMBA 4NYFA 2XHCA 3KUHA 1WG1A 4JS4A 2R8GA 2M70A 1S79A 2FHKA 3MK6A 1VC5A 2XS2A 2ZWHA 2IMOA 1T9WA 3HULA 2MJUA 4ECTA 3UVJA 3L6QA 3BO4A 1WC4A 2Z2ZA 3OD2A 4DX6A 3BSOA 1TUUA 2L41A 2KFNA 1UEKA 4DR7K 3C14A 2DNRA 4B02A 4GO5X 4ILHA 2UVVA 4F4YA 5CE3A 1EQYA 1BXNA 2HFSA 3QMLA 3SUNA 4A47A 3WNFA 5AQKA 3UI3A 1WEZA 4F8RA 3QGGA 3O3FA 2A40A 2P9CA 1HNWF 4K5SA 2P5GA 2J5AA 2VWBA 1LWFB 1U04A 3VESA 2VOPA 4NLYA 2IDOA 4A8OA 4MLHA 1BE4A 2O8FB 2B9YA 5DGBA 3TAPA 5EY4A 3TZZA 3NHGA 1CBKA 3OL8A 4TN2A 3D5MA 3HL8A 2QMXA 4OHYA 3SCIE 4O0JA 3N9UC 2ZZMA 1EIYB 1XNQJ 3AT1B 5CYJA 3KLHA 4OQJA 2DHHA 3AD7C 1EQMA 2DHAA 4WFNQ 4K41A 4HACA 4JYAF 4LQ9A 4WFBL 4CEEA 3VEOA 1HWJA 3H42A 2DR5A 2YWWA 2HG4A 2Q0UA 5KGWA 3JSMA 3Q8SB 3D3BJ 5T7BA 1F1BB 1L3UA 3RMAA 4HVZA 3CI5A 4IR1A 3H5UA 2BDPA 1UAWA 5KG3A 2VG5B 4CJPA 5F8HA 3DJCA 2ZD1A 3P1GA 1NKEA 4B3TF 2HVIA 1GOCA 1RISA 4B3OA 2JX2A 2HHUA 1ZAWA 4NA3A 4A61A 4X66J 1NLVA 3VEVA 4CEOA 2MKYA 3CCRN 1C1CA 3H2VE 1S48A 4QPTA 5HVGA 1VRTB 3IAM9 2FB0A 1TQLA 3D2WA 2V8DA 3D1QA 4IBNA 3ZTRA 4IFVB 3CCWA 2W4DA 1PKUA 4CECA 4WP8A 3NCRA 2D3UA 1P6TA 3CERA 1DHMA 5AE2A 4DG1B 3MDFA 2HGLA 3IMXA 3W2WA 2JZ5A 3EGVA 3OR2A 3QB0A 1TKZA 4CIGA 4DR5J 1JJHA 1HQUB 2HFVA 2KZZA 4R5PA 4M7XA 4YUDA 2Y1RI 4ZN3A 2CPZA 1L3VA 3TUPA 3NGIA 3VQ8A 1FRXA 2W2NP 5KFDA 3AVLA 3G71N 2HWTA 4KHWA 4GVBB 1WSRA 4TQRA 2QRRA 3OR1B 1XMOF 5EDWA 1N8RO 3AGKA 3UIQA 3S8SA 3OHAA 3BSCA 3LZIA 3RB3A 1FRMA 1XBWA 5HJXA 2IBOA 4OHWA 2L3MA 1SV5A 4P75A 5AR0A 1ICEB 2APOA 2AJFE 3PR4A 1BQMB 3OXFA 2CQBA 4QQBA 4FYVB 5KT6A 3VAIA 2V94A 5HRSA 3NRBA 4PRFA 4GKJF 4EBDA 1BHLA 4DTPA 4Q8FA 1EHWA 1FD8A 4ZN1A 4LF1A 5KOWA 2PT0A 1R43A 2UUBJ 5C2DA 1SQEA 1CJTB 2DO0A 5I42A 2BZ2A 3KLIA 3DLJA 2WHOA 3T6JA 2IMWP 3HPOA 2BANB 3A12A 4M63C 3FGUA 1Q8LA 4IUFA 4YQWA 3NL0A 3N6NA 2YKAA 1CLQA 1V6HA 2IIHA 4IRCA 3QJPA 4H8KA 3ZZOA 3GR1A 2E2QA 5AQPA 3ADAC 4B3MK 1BY9A 4QWDA 5KFBA 3BGRB 2QEXS 1GTHA 2I8EA 4C11A 4WK1A 1MWQA 4MMOA 3D2FB 3HRGA 4JV5F 3R8EA 3RB4A 3FEXB 3FJ2A 1N8RT 1R3NA 3ZLJA 4LF5K 4KGMA 4FS2A 5GIPA 4D3GA 5JLHA 4C0BA 4OHZA 3DWLA 3CF5L 4QW8A 1FKOA 1XR7A 2NLWA 2OSRA 3EDQB 4P6QA 4UOFA 2NXNA 3W64A 1S4FA 5C24A 4Y00A 2GAHC 4QOTA 4I6MB 1IWAA 4ECZA 1F0XA 4JS5A 5KFVA 4CZFA 1HNWJ 1AXQA 4KT0C 1DEJA 3I55S 1EO1A 4CRJA 4M5DA 1GMVA 4CO2A 2GJIA 2GS8A 3HO1A 4YY3K 1GMWD 4ZP9A 1G4CA 4C9DA 3THVA 3LP2B 2P9KB 2YWEA 2YX6A 3QESA 2NPIA 3MXMA 1VRUA 2HHSA 3CCJS 4FYYB 3VEZA 3LWLA 2Z1IA 1LOUA 3KK1A 2H48B 2IVMA 3FBCA 4BE1A 4B8CA 3VZHA 1NHKL 1X4CA 1HX1A 3VGMA 1EWRA 2ZJQQ 2ZDOA 4BDYA 4Z7YA 4M3WA 4DSKA 2CJQA 2EKNA 4X4TA 4JYAJ 4JK7A 4A8XA 2DO4A 3O3GA 5AQHA 2BTFA 4BDPA 1N32K 3NF6A 2GIRA 3FQLA 2HKEA 3M32A 2QZ8A 4WIIA 5T14A 2XCAA 2UV8G 1IKXB 3NGRA 3SNNA 1JCFA 3HYFA 4Y65A 3E3XA 2X1BA 3DXBA 1RHRB 1RUSA 3R7NB 4DCJB 2WUSA 3VQQA 3P45B 4Z4CA 4B3TJ 2E2OA 2IYIA 3HHLB 4TY9A 3PIPL 4FO0A 3THWB 1U45A 1ZBLA 1KDNA 5HK4A 3DMJB 2VFRA 4O3RA 3BZQA 3H5XA 3MM7A 3ZZTA 1J53A 1EAYC 5JVHL 4DS4A 4IOCQ 4CO5A 1U0HA 5D4NA 2F4VJ 4Y2IA 1X4HA 1KCFA 4CJKA 1N5QA 3MEEA 2VKZG 1IKWA 4FVMA 4F4XA 1GFWB 3CHWA 1VSIA 2CQ3A 2R42A 1LWEA 3L3CA 1JLEB 3VQ6A 5EWFA 4Z0UA 5ETSA 4DR1F 1Q86O 4B9TA 2CNNB 1J5EK 3VAKA 2JWLA 3G9CA 4OZ1A 5LOQA 2EFQA 3LP0B 2V4JB 2BVZA 3EY1A 3M8QA 2P9UA 4JI6F 2XLIA 3AV9A 4JBCA 1B64A 1S9GA 2YWHA 4JI4F 5E26A 2LQ5A 1C1AA 2I5JA 2CQ1A 1URNA 2C28A 5KFKA 1XMOJ 5DDOC 4YOVA 1WELA 2ASPA 4DUZF 1RHMB 4I6WA 3ICLA 3IBCB 4N76A 1HLUA 1ZXOA 3MM5B 1XMQK 3EXCX 1IJJA 1HBNB 2GCFA 4CW7B 1PYTA 3O5BA 1H38A 3IG1A 3D1HA 3RZAA 4O44B 4YEAA 3OTEA 1FJEB 1YZ7A 1K8KB 2HFOA 1JQGA 4AT1B 4NLTA 2BE2B 2Z30B 1QE1B 3A8YA 1WLJA 1IQTA 3P83D 3ZSXA 2W40A 4KGZB 4GKJJ 1RB0A 2Z1HA 2VC0A 5KG7A 3AB2B 5KI6A 5IC6B 2ZVSA 3CJTA 2IPOB 3TWHA 3DYAA 4OYIA 4F2SA 3OXGA 1WAFA 1OPZA 3SMZA 4M5DB 1ASVA 2WAQD 3HXMA 1GNKA 4CHOA 3C7NA 3U6FA 1T05B 2OTLS 1Q86T 4KKOA 3US5A 2KHCA 2KRBA 3CM5A 2MZ1A 3DRPA 2ZH3A 5FPMA 3MGJA 4YHHJ 2DGXA 3DDNA 2J9EA 2RQKA 3IR7B 5BJRA 1BMQB 4ZK7M 2V68A 1JK9B 1B7YB 4B3MF 4PPDA 3DRRA 5C2CA 3T3FA 1B70B 2GQ2A 2UUCK 2J6TA 2KM8C 2XCPA 2YHYA 3LW5C 1U1QA 4M3TA 1G3OA 3V6DB 5F8LA 1VQ8S 1ZM2A 3HVAA 3UDCA 3MM9B 2IRUA 3HPGA 4WYWA 4LF5F 5M1QA 2JFKA 2J0XA 1JMTA 3PXGa 1JCEA 3IA0A 3L2WA 1LEOA 3CD0A 4QS9A 5LMUJ 4RNMA 3MMAA 4DR4F