2Z1IA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
151
structure length
151
Chain Sequence
b'MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1iA00
3QEXA 3AO1A 3JYTA 1KFSA 4MFBA 1KCFA 4KFBA 4HVJA 4OJRA 2W42A 1NK7A 1TAUA 5EU7A 1NJZA 5DK5A 1VRTA 2B5JA 3ZSWA 4DTMA 4DTNA 3OYEA 2QKKA 2YNIA 1MU2A 4ELVA 3TABA 1EKEA 3OJSA 2ETJA 4KHUA 4OVLA 1NJXA 3ZCMA 1BL3A 3TAPA 3NE6A 3RMBA 3SNNA 3ZSVA 4OLAA 2BDPA 1NK5A 1NKCA 1TKDA 4CIGA 3HT3A 3D0PA 4M3RA 2XY6A 1L5UA 1LW0A 4CJVA 3SZ2A 3K59A 1HNIA 1LWEA 3NF8A 4CFDA 2X78A 4FW2A 3QEWA 1N5YA 4XIUA 3FFIA 3I0RA 2A1RA 4B3OA 3VA3A 1J54A 1YTAA 4OPKA 4JS4A 4AHUA 1QTMA 4EZ9A 4DFMA 1RDAA 1C0MA 1VRUA 2IDOA 1I39A 2RN2A 1BQMA 3SUQA 1XC9A 2XRIA 4CHNA 4LH5A 4CHZA 1QSLA 4H4OA 1RT2A 4O0JA 3DRSA 3DLGA 3HM9A 1XI1A 3HK2A 2RKIA 3KLHA 4W5QA 4CFCA 4FJGA 3AO3A 3O4NA 4LH4A 3MXMA 4FJ9A 4M3YA 1QE1A 1IKXA 3QIPA 2JLEA 3ZSRA 1S5JA 3OYMA 1BI4B 3V1OA 3L2VA 3VQPA 2DFEA 3B6PA 4IDKA 1TV6A 3AVFA 4DU1A 1TL1A 3CM6A 4F2RA 1NK0A 2A1SA 2XY5A 1IH7A 1KTQA 4FZYA 3HSTB 4J2DA 2DFFA 2IOCA 3SV4A 1X9WA 4O5BA 3SUOA 1RT1A 1QQCA 3O3HA 4AILC 3DLKA 3OVNA 2OZSA 3ZT1A 4QAGA 4F2SA 4KHNA 1S1UA 2Z1GA 4CE9A 4KTQA 3KK2A 3ZSZA 4HCCA 4NYFA 1RTHA 3OJUA 1RBUA 4DQSA 4KHYA 5FRMA 1ASUA 3F73A 4KAZA 2KZZA 1U49A 1VSJA 3QNNA 4DS5A 3NF6A 3AVAA 3OYDA 1U45A 3AVGA 1U48A 1T03A 4YFUA 3QLHA 4AHRA 4FM2A 4E7LA 3AV9A 4I7FA 3V9XA 1QS4A 4B08A 1WSHA 2OPQA 3AVLA 1T05A 4UQGA 1SL2A 1KLNA 1S6QA 3RR8A 4FLVA 4FJ8A 1RTDA 4CIFA 4CHOA 4E7JA 2Y1IA 4B9LA 3P1GA 4HUFA 1HMVA 2P51A 3V1RA 4CEEA 1CZ9A 3EY1A 4B9NA 5D3GA 1BQNA 3ISNC 3NAEA 4KKOA 4FLYA 4DSEA 1VSKA 3SV3A 4Q0BA 3ZSYA 4JLHA 2IS3A 2VG7A 4AHCA 4HCBA 1JXBA 2D0CA 3AVCA 4CGIA 1RBVA 3ASMA 1U47A 3BGRA 1N6QA 2VWJA 1J5OA 3S3OA 4BE1A 4B9SA 4Z4FA 4CEBA 4CK2A 4E3SA 4RW4A 3PO4A 1QSSA 3DI6A 1JKHA 3HYFA 5KGXA 3TAGA 4ID5A 1HQUA 1XHXA 4FK4A 3V81A 3LZIA 4M3WA 1TKXA 4M41A 3KLEA 1VSIA 1EX4A 3AVKA 3T1AA 2HB5A 5HLFA 4I9LA 1RT6A 3KIOA 3TANA 1DTTA 1LWCA 4PQUA 3OYHA 3HP9A 3AVJA 3CFRA 1R0AA 4DSFA 4E7KA 3VQBA 4TSXA 4CEFA 1CXQA 1HQEA 5K14A 3QINA 5J2NA 4FJXA 3KLIA 1VK0A 4BDYA 3H08A 3TWHA 4Q5VA 3QNOA 4Z4GA 4Z4CA 1L3UA 2HW3A 3AO5A 3PX0A 1QSYA 3MEEA 4NCAA 2HNZA 2QK9A 4N56A 4QCLA 4DWIA 3NDKA 2O4IA 4C8KA 5KGWA 1WSJA 1B9DA 4LSLA 4J2AA 2HHWA 3IG1A 4CK3A 1UA1A 3RRGA 2KTQA 3V6DA 4C8LA 2G8IA 2YNGA 3HPGA 4KREA 4M3TA 4CGJA 1DLOA 3DLRA 3OYAA 3WNEA 3HVTA 4E19A 1S9GA 4DQQA 3CG7A 1TK8A 2QKBA 4O44A 1SKSA 1SKWA 4DTOA 4GMJB 4KI6A 1KSPA 1A5XA 1RT7A 1X9SA 1T7PA 5SWMA 2OZMA 1UWBA 4E89A 3LWLA 2BGGA 3AVMA 4KTZA 2YHBA 4CJKA 3MEDA 3PX6A 2FBTA 3RMAA 1D8YA 4E1MA 1HYSA 3EZ5A 4DSIA 3A2FA 3K5OA 3C95A 3KK1A 1A5VA 1C0TA 4N47A 1S9EA 4FW1A 4FCYA 4Z4HA 1YT3A 3NHGA 4DSLA 4ID1A 4HUGA 5HBMA 2D5RA 4N5SA 3SYZA 2HVHA 1VSDA 3HPOA 1SV5A 3OY9A 2KQ2A 1TGOA 2RF2A 4JRQA 1L3SA 1IKWA 3RRHA 4F4KA 1YTUA 3HXMA 4CHPA 3L2QA 4FJLA 4J2BA 3P5JA 4FYDA 4KV8A 2B6AA 4DG1A 3OYJA 3MXIA 4HUEA 4B8AB 4PA1A 3QEIA 5DMRA 1L3TA 3CQ8A 3SQ0A 2DFHA 5KI6A 4AHVA 3SPZA 1NK9A 3NCIA 1JLEA 1SL0A 1S1TA 4CECA 4FLXA 1IKVA 5J2PA 5CYQA 3VA0A 2FBVA 2P5GA 2HHVA 1GOAA 1A5WA 4BACA 1RDDA 1RTJA 3MEGA 1ZBLA 4W5OA 4IG3A 1NK4A 3WNFA 4BDPA 3NBPA 2NUBA 4NCGA 2LSNA 3ULDA 4FJJA 4RW6A 5SZTA 1VSHA 2X6SA 1RBSA 3AA5X 3MXJA 3QEPA 4FZZA 3THVA 2F8SA 5J2MA 3DLHA 4CF8A 4H4MA 4K8ZA 3QESA 2HVIA 4AHSA 4DTSA 3LP0A 3QERA 2E4LA 4CIEA 4CFBA 3DM2A 2YNFA 4CGHA 4K8XA 3NF7A 4Z4EA 1TL3A 3DRRA 2Y1JA 3KKRA 1WSEA 4GVMA 2BE2A 1ZYQA 5I3UA 4KHQA 4CJ4A 4ZTFA 4B9TA 2O4GA 3MAQA 2YNHA 3IRXA 4IFYA 3SUNA 3LZJA 4CF0A 1WSIA 4W5NA 4KHSA 2R7YA 3U6FA 5HROA 1WAFA 2X6NA 4C8MA 5FRNA 2E6LA 3L2WA 2P1JA 1RDBA 2XY7A 3O3GA 2G8UA 3HO1A 1G15A 1K6YA 3NH1A 2Q3SA 3SJJA 4L8RB 4Y1DA 5KRTA 4JRPA 3ALYA 3OYFA 3HP6A 1ZBUA 2B4JA 3LPUA 4DLGA 1C1CA 3L2RA 3EYZA 3T3FA 1I3AA 1NK8A 4KO0A 4MQ3A 2E6MA 4LY7A 4E7HA 4CEDA 2GBZA 1KLMA 5C42A 1TVRA 3OYLA 4CJFA 1NJYA 1JL1A 1RNHA 3V1QA 4C8OA 3K5MA 3LDSA 1NOZA 1RCHA 2FBXA 3V9SA 3QETA 3ZT2A 1JLGA 3DLEA 1BCOA 1YVUA 3OYBA 1HNVA 4CGFA 3KJVA 4KB1A 1HYVA 3HVRA 1SL1A 4F8RA 3C6UA 1W0HA 3NGZA 3U3GA 4M3XA 1TK0A 4DQIA 1REVA 1RT3A 1SUQA 3KKSA 4BWJA 4CEQA 4OKEA 1Z26A 4M42A 1S6PA 4Z0UA 4CHYA 3PV8A 4KRFA 2KFNA 2DTUA 1JL2A 1NOYA 3LANA 4CJTA 4DTRA 3NGIA 3SUPA 4FZXC 4R5PA 1J9AA 1S1VA 3AVBA 4G1QA 4KTWA 4CEAA 1BIZA 3V9ZA 4DFJA 1WNSA 4GW6A 4NYNA 4I9QA 1TKZA 3V9WA 4FJ7A 4WE1A 2HMIA 3G10A 3M8PA 4JS5A 3ZT3A 3QEVA 2VG5A 1B9FA 4B9VA 3RMDA 2Z1JA 3ZSXA 3K5NA 4IG0A 2G8HA 1JLFA 4W5TA 3TAFA 3NGYA 4M45A 3S3NA 2YV0X 2KFZA 1EETA 2HHQA 4CJ5A 4YNQA 1UOCA 2ZD1A 3LP2A 3T19A 5E41A 4DU3A 3OYCA 3HJFA 2Z1HA 2KZMA 5KRSA 1IKYA 3VQ9A 1NK6A 5JS1A 1Q8IA 3AA4A 3L2UA 1U4BA 2I5JA 1VSFA 4DTUA 3AVNA 5CZ1A 4DSJA 1Q9YA 3V4IA 4CERA 3AO2A 2G8WA 4E0DA 3NFAA 2HNDA 3LPTA 4CF2A 2G8VA 3VQCA 4FM0A 4PY5A 4BWMA 3ZSOA 1RBRA 2IGIA 1NJWA 2KW4A 1WLJA 2PZSA 4BE2A 4FM1A 1NKEA 3UIQA 2AJQA 3G0ZA 3CFOA 2FC0A 1LAVA 3NH2A 3DOLA 4FJ5A 1JLCA 4CK1A 2P5OA 4DMNA 1UAXA 2ZQBA 2XO7A 5CY4A 3RMCA 3WNHA 4OPJA 1ASVA 3OYNA 4DFPA 4BE0A 1JXEA 3E01A 1EXQA 3SQ4A 3DMJA 1C1AA 2YHAA 2G8KA 4W5RA 3SQ2A 3VQ5A 4FJKA 4FXDA 3QIOA 4IBNA 5J1EA 2QXFA 4DLEA 1U04A 1FXXA 3L3UA 4HHTA 3O4QA 4O55A 3O3FA 3HL8A 5CZ2A 4FLZA 2HHXA 2OYQA 2BANA 1ITGA 3OYGA 2Z1IA 2VWKA 1KVAA 4CJUA 1XHZA 3L3VA 3DYAA 4KB0A 3SPYA 2OPPA 3PX4A 1JLQA 1RBTA 5HRRA 5HRNA 4KI4A 3OS2A 1LV5A 4IFVA 3SI6A 2EX3A 4I2PA 4CGDA 4CJQA 1HRHA 1VSMA 2D0AA 1FKPA 2OPRA 4FJMA 4LD0A 3F9KA 4FJHA 2OPSA 3ITHA 3IS9A 4CJSA 1D9DA 3OYIA 1C1BA 4OGEA 1J53A 1RT5A 4LSNA 2IAJA 3QO9A 4KPYA 4BDZA 1NKBA 3K2PA 3K57A 3U3YA 3SQ1A 3S3MA 5C24A 1RDCA 3TAEA 1XWLA 4CJEA 1IO2A 1D5AA 1O1WA 2YKNA 5CYMA 4DU4A 1RILA 1FK9A 3RWUA 1WSFA 4QOZB 1JLBA 4DTPA 2HHSA 1QHTA 3CYMA 3RR7A 3VQAA 3VQQA 1ZBHA 4ZHRA 1CLQA 3LP3A 3TARA 4FJNA 2X74A 4EP4A 2DY4A 5JS2A 3VQ7A 2PYJA 4H8KA 4HTUA 3ZT4A 4CGGA 3OS0A 2WOMA 1JLAA 1RTIA 1X1PA 4DSKA 4CJRA 3KD1E 4ZTJA 4ELUA 3D45A 1HJRA 3M8SA 1BGXT 4FVMA 3VQEA 1SKRA 2VG6A 3ZSQA 3TAQA 2F8TA 3M8QA 4OKKA 3S9HA 3KD5E 1D9FA 4CFAA 1LAWA 1HYZA 5HP1A 3LWMA 4FLUA 4CJLA 3LALA 2WONA 1GOBA 1WN7A 4ICLA 4CEOA 4CHQA 3OS1A 1KVCA 5J2QA 4DQPA 4E7IA 5KTQA 2FBYA 4RW9A 1X9MA 3P83D 4DF8A 3IAYA 4Z4IA 3K58A 3ZT0A 2PYLA 3JSMA 3C94A 1B92A 2JGUA 4DTJA 1TK5A 1IG9A 4NCBA 4Y1CA 1TKTA 5T7BA 2YKMA 1BCMA 3LP1A 5C25A 4F3OA 4OLBA 2EHGA 4DF4A 1LWFA 1BIUA 4N76A 3KLGA 3M8RA 5HRPA 3PUFA 3L8BA 4FLWA 2PY5A 4CCHA 3MECA 3TAMA 5FROA 4IKFA 1CZBA 4AH9A 2RPIA 3VQ6A 2XHBA 3C6TA 1S1WA 4DTXA 2G8FA 4EP5A 1F21A 4EZ6A 1BISA 1FKOA 1RT4A 4CJPA 3SCXA 3CM5A 3VN5A 3KLFA 4FLTA 4B8CA 3V9UA 1KFDA 2GV9A 4RG8A 3CFPA 1ASWA 1GOCA 5I42A 3PO5A 1T8EA 3WNGA 3PY8A 4M3ZA 4OGCA 1Q9XA 3BDPA 4B9UA 1WAJA 3LAMA 1VSLA 3VQ8A 4CJ3A 4PWDA 2D0BA 1CXUA 5HRSA 3TI0A 3B6OA 2ZE2A 3VQ4A 2HHUA 2ITGA 4ELTA 1DTQA 1C0UA 3AVIA 3TR8A 4J2EA 4M3UA 4B9MA 5FDLA 3OYKA 4PUOA 4I2QA 4AHTA 3I0SA 4RW8A 4KHWA 3LAKA 3VQDA 3AA2A 1C6VA 1HPZA 2HNYA 3DRPA 2XY8A 4O4GA 3DLBA 4RW7A 3NH0A 4F3TA 2ATQA 4O0IA 3I8DA 4CJWA 4CEZA 3KK3A 1BI4A 2OA8A 4OKJA 4FK2A 1LW2A 4FK0A 1Y97A 1WSGA 1ZBIA 1TAQA 1S1XA 3AA3A 3DOKA 4CF9A 3K5LA 4DFKA 4FJIA 1ZBFA 1Z25A 3HPHA 4DS4A 3RTVA 2IC3A 1UA0A 1BHLA 1L3VA 4C8NA 1VSEA 1KRPA 4E1NA 1KVBA 4DQRA 4N41A 3AO4A 2HHTA 2F96A 1W9HA 3NF9A 1EP4A 4CESA 3KTQA 3AVHA 2GUIA 4CF1A
chains in the Genus database with same CATH superfamily
3VPZA 1TUUA 3L0QA 3MN9A 5A2QO 3LL3A 1NK7A 1K73O 4I6MB 2Q0UA 5DK5A 1RGIA 1VRTA 1HUXA 3ZSWA 4DTNA 4BRDA 3THYB 1EKEA 4PHTX 4DR7K 3M6GA 3EZWA 3K9JA 2ZM6K 3TAPA 3SNNA 5AQHA 1NMNA 2BDPA 1NK5A 3HZ6A 4WYBA 1LW0A 3SAHA 4ILGB 1LWEA 3NF8A 2VCPA 3QEWA 4DR6K 2RHKA 3FFIA 1XMQK 1JCFA 1J54A 3AAPA 4OPKA 3FFKB 4AHUA 1QTMA 1VRUA 1JCGA 4CHNA 1RT2A 2P9IB 5EX5A 4CFCA 4LF9K 3O4NA 1QE1A 3QIPA 2V7YA 3H45C 2NRHA 3V1OA 2YI1A 2CGJA 4IDKA 1TV6A 3QDKA 4M63C 4BC2A 2HHTA 2XY5A 1IH7A 3HI0A 3GE1A 1Q86O 1WUAA 2DFFA 3SV4A 1X9WA 4BRNA 3C0BA 3ZT1A 2YHYA 4F2SA 4CE9A 3ZSZA 4HCCA 4NYFA 3GL1A 1ASUA 1VSJA 3QNNA 4DS5A 1U45A 1W2BM 4H5VA 3O1BA 4YFUA 3QLHA 4AHRA 4E7LA 3AV9A 3V9XA 1NGBA 1T05A 2VYPA 4FLVA 4FJ8A 2E2NA 4E7JA 4DCHA 4XH5A 1HMVA 4CD1A 1GLBG 5D3GA 1BQNA 4BRCA 1VSKA 4MO5A 3ZSYA 4A62A 2GUPA 5AJ3K 2VG7A 4AHCA 3CCVN 4HCBA 1XNQK 1JXBA 2NRXA 1N6QA 3FZKA 3BGRA 5GIPA 4DUZK 3P38A 4B1WB 1NBWA 3ZEUA 3HYFA 3TAGA 1X3NA 1HQUA 3RSEA 4FK4A 3G6EN 3CJCA 1VSIA 3QBWA 2HB5A 4PKGA 4I9LA 5HLFA 3KIOA 1DTTA 2HBMA 3HP9A 2O8FB 3LM9A 5BREA 5K14A 1VAZA 3KLIA 4BDYA 5AZJB 4BR4A 1E4GT 3W0LA 4BVOA 3MEEA 4DV5K 2HNZA 1N33K 4AQYK 1WSJA 4J2AA 1YUWA 5KPRA 4A2BA 4FL9A 3V6DA 4C8LA 3HPGA 1X9JA 4CGJA 3WNEA 4DQQA 2QKBA 1TK8A 4QS8A 2YJFA 1SKSA 4H0PA 5FPMA 4DTOA 4OPAA 4KI6A 1A5XA 1T7PA 5SWMA 1NGDA 4E89A 1GLAG 3AVMA 4CJKA 1D8YA 3PX6A 3EZ5A 1Q82O 4RCHA 1S9EA 4C1NI 4LFBK 4HUGA 3UKRB 4N5SA 1VSDA 2KQ2A 2P9KB 2RF2A 1L3SA 5M1PA 3HXMA 3L2QA 4FJLA 3P5JA 3D6RA 4BVPA 1JJ2M 1EQYA 1HNXK 4JAXA 3QEIA 1L3TA 2DFHA 1NK9A 3CIPA 4UY8O 3H3NO 1IKVA 5J2PA 5CYQA 2P5GA 2HHVA 1OKJA 1RTJA 3MEGA 1ZBLA 3WNFA 4NLCA 4GKJK 1GLCG 3A5MC 3THXA 4V19S 1YI2N 3TSPA 3THVA 4CF8A 4BR7A 1OH8A 1BA0A 4AHSA 4DTSA 4G9ZA 5EOYA 4IWVA 3NF7A 4Z4EA 3KKRA 1WSEA 4GVMA 2HF4A 4FWMA 3LZJA 4EIAA 4W5NA 2R7YA 2CGLA 3ULEA 5IWAK 2P1JA 2G8UA 3HO1A 4JRPA 3ALYA 2B4JA 1QQNA 1BWFO 4MQ3A 2E6MA 4CEDA 1KLMA 5C42A 1TVRA 1YXQA 4CJFA 1NJYA 1NMDA 3QETA 3ZT2A 1VQ5N 1BCOA 1BUPA 4LC9B 4KB1A 3FZMA 1GLFO 4M3XA 1TK0A 1REVA 2QXLA 3K0SA 4Z0UA 4FZXC 1S1VA 3AVBA 1WNSA 4I9QA 4K41A 2Q36A 2UXBK 3MX5A 3N4QA 1ESVA 4WE1A 3M8PA 4JS5A 4GV9A 3EEQA 3RMDA 3ZSXA 2G8HA 3VGKA 2QI2A 4CVNE 4JKEA 1EETA 4CJ5A 3LP2A 3KVGA 3N4PA 3OYCA 2Z1HA 5KRSA 1IKYA 1NK6A 1RFQA 4ISFA 4DTUA 3AVNA 3R9PA 4B3SK 4CERA 3NFAA 1N8RO 3F5TA 2G8VA 3ZSOA 2VQEK 1TYQA 3UIQA 2AJQA 4CZLA 1IG8A 2P9SB 4QS7A 4A2AA 4DMNA 2P9NB 4OPJA 1NGFA 1JXEA 4CZEA 2YHAA 2QM1A 4W5RA 3DWLA 3QIOA 2QWNA 4IBNA 4DLEA 1U04A 1FXXA 3O4QA 3M3ZA 3O3FA 5I9EB 5CZ2A 4FLZA 2ITMA 2Z1IA 1KVAA 4CZFA 1JLQA 5EY4A 3NMUA 1RBTA 5HRRA 3OS2A 3SI6A 5AZIB 2D0AA 2OPRA 1FKPA 4BRIA 4PKIA 3CJAA 1QHAA 4DR3K 1NJIO 3DXMA 3QO9A 2O8DA 2QWLA 3BF1A 1YIJN 3U3YA 3CXCM 3HTVA 3TAEA 5C12A 4K0KK 2YKNA 1D5AA 3AY9A 5CYMA 3RWUA 3T1HK 1JLBA 3CYMA 3FE1A 3VQQA 1CLQA 2YHWA 4FPAA 3LP3A 5KPZA 3TARA 4X66K 2DY4A 3ZT4A 2WOMA 1JLAA 3E9OA 1BGXT 4FVMA 2VG6A 4OKKA 3LWMA 3OS1A 4FK0A 2WONA 4M7YA 5J2QA 3QBXA 2NRRA 4RW9A 2D1KA 3KZBA 3VOVA 3ZT0A 2CGKA 3ZX0A 2YCHA 4NCBA 4Y1CA 1TKTA 3QICA 4OLBA 4F3OA 4DF4A 1E3MA 4FLWA 3TAMA 2DPNA 4IKFA 3BZCA 1VQ9N 4JHDB 2RPIA 2XHBA 1S1WA 2G8FA 1F21A 4RWTA 3THWB 3OA9A 4FLTA 4NXMK 1HKCA 3LAMA 2RE2A 3VQ8A 4CJ3A 4ELTA 4DKWA 1C0UA 1YF5L 4Z94A 2F4VK 4M3UA 1NM1A 3J81O 4B9MA 4PUOA 4WQ5C 3VEOA 3LAKA 3O9SA 2P9IA 2XY8A 4O4GA 5CHIA 1ZXOA 2UYTA 3I8DA 1VQ6N 4FK2A 2A40A 1WSGA 1S1XA 4JI4K 3K5LA 4DFKA 1D4XA 4FJIA 1Z25A 3MX2A 1MWMA 4ISGA 4E1NA 2A41A 3AO4A 2F96A 1W9HA 4YHHK 1FJGK 2GUIA 3QEXA 3AO1A 3ATUA 1KFSA 4MFBA 2W42A 4IFEA 3NVMA 1NJZA 3OYEA 2QKKA 4ELVA 4KHUA 2A6AA 1BL3A 4CIGA 3D0PA 1J6ZA 3SAGA 1L5UA 5DM7L 4CJVA 1C0FA 3K59A 5AQVA 3OW2M 4BGBA 1SS6A 2NRVA 4CFDA 2P9LB 3MWTA 1N5YA 4XIUA 4B3OA 1I94K 3PLAA 4C1NK 3MMVA 3CPEA 1C0MA 2IDOA 2RN2A 4WQ4C 3C7NB 3FLCO 2VGMA 1OH5A 1BQMA 3SUQA 2XRIA 4LH5A 1QSLA 2ZWHA 3EKSA 3DLGA 1XI1A 4DV3K 2UUCK 3KLHA 5F0XA 2WC9A 3ZSRA 2IVOA 1KQSM 3OYMA 2HF3A 3CMAN 2O8FA 2DFEA 3AVFA 5ADXH 4DU1A 4JKGB 1TL1A 1BO5O 3CM6A 1IBLK 4IOAL 1KTQA 5AQJA 4J2DA 5AZJA 4IXCA 3SUOA 3CCMN 1LOTB 2D4WA 4BREA 4L3QA 3PSIA 3OJUA 2KLAA 1S3XA 4XH1A 3OTOK 5FRMA 4DR5K 3LDNA 4KAZA 2YJEA 1U49A 5FPEA 4M7XA 3T1YK 1S72N 3M5RA 4BQLA 4FM2A 1WSHA 3TTDA 4BR5A 1SL2A 1S6QA 3RR8A 1KAZA 1NWKA 1N36K 3V1RA 4KKOA 3CCQN 3EE8A 4JKAA 2QW9A 3UKRA 4IOXA 4FWNA 3H6EA 2IIRA 3AVCA 2HBJA 2NRWA 3S3OA 4B9SA 4CK2A 1E4FT 3ATVA 3LZIA 4BR2A 2UUBK 3KLEA 4NXNK 1EX4A 2QWOA 4B1ZA 1U6ZA 2A3ZA 4PQUA 1R0AA 5AQIA 4JKBA 1CXQA 1XNRK 4FJXA 4BR0A 2J4RA 3ENBA 3EE9A 4Z4CA 3AO5A 1T6DA 4NCAA 4N56A 4DWIA 2O4IA 1U2VB 4CK3A 1UA1A 3I33A 2Q1NA 1YHQN 4M3TA 4CJ7A 4JN4A 3CG7A 4O44A 2E5LK 4DV1K 1KSPA 1X9SA 2OZMA 3IMXA 2BGGA 3RMAA 4KTZA 2YHBA 2FBTA 4E1MA 4DSIA 1C0TA 4B3RK 4FWRA 2D0PA 4YOWA 5HBMA 2D5RA 2NRZA 4IDHA 2HVHA 2YHXA 4B3MK 4H0VB 1SV5A 3WEEB 1TGOA 4JRQA 3RRHA 2GTDA 5AQOA 1KAXA 4B8AB 2E88A 4BGAA 4AHVA 3SPZA 1T44A 1JLEA 1IBMK 1S1TA 1GOAA 3HOTA 4BACA 1RDDA 1QZ6A 2I7PA 3NBPA 4WQ4A 1X3MA 4NCGA 2LSNA 3U8XA 3WXIA 3ULDA 2X6SA 3AA5X 1BU6O 1DT9A 2F8SA 3TSQA 3LP0A 4IO9L 1P90A 3QERA 1Q81O 4K8XA 3DRRA 5GIOA 4H5NA 3WT0A 4ZTFA 4B9TA 3SUNA 3HRGA 5AQUA 1WSIA 5HROA 1WAFA 2E2QA 5FRNA 3L2WA 3ID8A 3T69A 2XY7A 3NH1A 4L8RB 3DLLL 3VF4A 1HKBA 5AQLA 2P9SA 4JI2K 4DLGA 2OTJN 4H0XB 3H1QA 5FPNA 3A5OC 2P9NA 1JL1A 3V1QA 5AFUH 4C8OA 3LDSA 2FBXA 3MK6A 2PAVA 3KJVA 1W0HA 3UE5A 3U3GA 4DQIA 1Q18A 1QVGM 3KKSA 4BWJA 4OKEA 4LFAK 3PV8A 2HBLA 1JL2A 2QWMA 1K8KB 4JKDA 3SUPA 1J9AA 4G1QA 1QSYA 2QK9A 5AZIA 4FWQA 3MDQA 1TKZA 5H1SQ 4JK7A 3FZHA 3CC7N 3A5LC 3ZT3A 4B9VA 4XEIA 2GWKA 3U4LA 1EO1A 3TAFA 2ASMA 3F9MA 4ISEA 4YNQA 1UOCA 5E41A 3HJFA 3AAQA 3BF3A 3AA4A 5LY3A 3L2UA 1U4BA 4DSJA 1XQSC 1Q9YA 4BRMA 1EWRA 3O9UA 3AO2A 1YJNN 1IJJA 2Q31A 4CF2A 2QA4N 4KH4A 3A8YA 1RBRA 1NJWA 2QTDA 4BE2A 1NKEA 2HSTA 4EAHD 3CFOA 1VQPN 2V52B 2FC0A 4JV5K 4AF1A 4DR1K 2FF6A 3CC2N 3D2FB 3R1XA 3WNHA 1ASVA 3CPWM 3CCUN 3OYNA 4DR2K 4DR4K 3SQ4A 5JLFA 2G8KA 4FJKA 4FXDA 5J1EA 4HHTA 1T6CA 2UXCK 1YJWN 3HL8A 4DUYK 2BANA 5AQSA 4FO0A 5JLHA 1NLVA 3CHWA 3SPYA 2OPPA 4JHDA 5HRNA 4KI4A 4IFVA 4CJQA 1HRHA 1VSMA 3THWA 1HKGA 1BG3A 3CCLN 1C1BA 2WTUA 2CH6A 4LSNA 3K57A 3SQ1A 5ELZA 1RDCA 3H46O 4CJEA 1IO2A 4WF9L 4QOZB 2HHSA 1QHTA 2Q97A 3R3LA 3RR7A 3VQAA 4ZHRA 3ZX3A 2X74A 4EP4A 2PYJA 4HTUA 4CGGA 4DSKA 3KD1E 1X1PA 4ELUA 4ZTJA 1HJRA 4YY3K 3VQEA 3TAQA 2F8TA 4FLUA 2QWQA 4CJLA 1GOBA 1W97L 1VQNN 3KWGA 4DQPA 1ZBSA 4JI0K 3IAYA 4Z4IA 2PYLA 3CCSN 1IG9A 2YKMA 1BCMA 3DJCA 3LP1A 5TKWA 3KLGA 3M8RA 5HRPA 2E2PA 3PUFA 3WXJA 3L8BA 3OBWA 4CCHA 4KHPK 1G99A 4DB3A 4DV4K 4JKHA 1H1VA 5F1XA 5HOOA 3C6TA 4EZ6A 3J7YP 1BISA 3CM5A 3VN5A 2NNWA 4EHTA 1ASWA 3PY8A 5AQYA 4OGCA 4YOYA 4B9UA 2Q2RA 2QWRA 2P9LA 3VF2A 2V7ZA 4K42A 5HRSA 3IKMA 3TI0A 3J7AP 3J80O 4DV0K 3C7NA 2E8AA 4I2QA 4AHTA 1NG9A 5C0YA 5BN9A 3DLBA 4CZGA 2OA8A 3BUZB 1Y97A 2HOEA 4CF9A 3AA3A 1XC3A 2HBKA 2GX9A 4JKGA 4CD3A 3QFPA 3HPHA 4DS4A 3P4IA 2IVNA 1BHLA 1L3VA 4C8NA 4A5BA 4FOIA 4BRHA 4N41A 2GELA 3NF9A 4CESA 1K9MO 1N32K 5CR4A 3ENHA 4B1YB 3A0IX 3P31A 3CD6N 4KFBA 3O9QA 2FSKA 1TAUA 3HOSA 4DTMA 1MU2A 3PIPL 2O8BB 4QS9A 3OJSA 2ETJA 3I8BA 3ZCMA 1NKCA 4H0OA 4HTLA 1GLLO 1HNIA 5LJVA 4AM6A 4X64K 4CBUA 2X78A 4FW2A 4B1VA 3WXLA 2A1RA 1YTAA 5BR9A 1NGGA 4DFMA 4CI6A 1XC9A 3VEXA 4CHZA 4H4OA 3CJ7A 5AQMA 3DRSA 3AO3A 4LH4A 3MXMA 3SMSA 4M3YA 1IKXA 3I56N 3L2VA 3VQPA 3SBTA 5EXWA 4JYAK 4F2RA 4FZYA 3HSTB 4WCEL 4PL7A 2IOCA 3VEWA 4CZHA 4OO1J 4O5BA 1RT1A 3OVNA 2OZSA 1QQOA 4QAGA 1U2VA 2Z1GA 2E2OA 2YX6A 4KTQA 1RTHA 3D7EO 1RBUA 1TUYA 4KHYA 3F73A 3WXMB 3OYDA 1NGIA 3AVGA 1U48A 1T03A 3B8AX 3IUCA 3SLCA 1IBKK 3FR0A 4I7FA 1QS4A 4B08A 2OPQA 3AVLA 4UQGA 4ILJA 1KLNA 3KK7A 4CIFA 4CHOA 2Y1IA 4B9LA 4HUFA 4B9NA 1CZ9A 1BOTO 3ISNC 3NAEA 3VF6A 2FLOA 1R59O 4Q0BA 1N34K 4GVEA 2IS3A 2UXDK 3WEEA 1YVNA 2D0CA 3FGUA 3MN5A 3QFUA 4CGIA 1RBVA 1U47A 3LDLA 5M1NA 5AQFA 5ADXA 4WFBL 4BE1A 4MDAA 4CEBA 4KH5A 4E3SA 2A42A 1QSSA 5TKYA 2FSJA 4A59A 3V81A 4M3WA 4M41A 5GAGP 3AVKA 3T1AA 1CZAN 1RT6A 3TANA 5M1OA 1LWCA 4KH6A 5BRFA 1HQEA 3QINA 5J2NA 2WBNA 3H08A 3TWHA 4Q5VA 2NZTA 4CZKA 2HW3A 2NRTA 3PX0A 3UKUB 4QCLA 5KGWA 3SAFA 1B9DA 4PL8A 5E26A 3RRGA 1HNWK 4IOCL 2VGNA 2G8IA 2YNGA 2W40A 4KREA 3DLRA 3OYAA 4E19A 4H5RA 2VQFK 3WQTA 1RT7A 4C23A 3BP8A 1WBBA 4MDBA 1VQON 3IFRA 3VETA 1RDUA 5AQRA 1HYSA 3K5OA 3KK1A 5GINA 4N47A 5C15A 4Z4HA 1YT3A 3J7ZO 4ID1A 3SYZA 3E1YA 4A61A 3OY9A 2W41A 4JK9A 4F4KA 1YTUA 4BC3A 4O5FA 4KV8A 5GADP 3OYJA 1VQ7N 2P9PB 5JVGL 4PA1A 4IEEA 5KI6A 3NCIA 3SJHA 1VQMN 4CECA 4FLXA 5KQ8A 3CJ1A 5M1QA 3VA0A 2FBVA 1YJ9N 1A5WA 1QVFM 3TTFA 1K8KA 4W5OA 4IG3A 4IO8A 1NK4A 4BDPA 4JKFA 1OVYA 2W6LA 4RW6A 3U9ZA 5SZTA 1KD1O 1RBSA 3QEPA 4FZZA 1VQKN 3DLHA 1W7AA 3QESA 2GEMA 2E4LA 2OANA 1TL3A 4FWSA 2Y1JA 4B3TK 5I3UA 2O8CA 2O4GA 1J5EK 1ZC6A 3IRXA 4CF0A 4KHSA 3U6FA 2PFUA 4C8MA 4WFAL 3NVKA 2E6LA 3ZX2A 1G15A 3SJJA 4Y1DA 3OYFA 3TSUA 2JWLA 3L2RA 3EYZA 1NK8A 4GKKK 4KO0A 4WFNL 1T3VA 4E7HA 3HM8A 2WUSA 3D2FA 4RTFD 4JKCA 4EFHA 3H1VX 2JWKA 1NOZA 1IV0A 4FWPA 1JLGA 5GAEP 3OYBA 4CGFA 1HYVA 3LDOA 1RT3A 4H0YB 4CEQA 1S6PA 4CHYA 2DTUA 2KFNA 4YDUC 4CJTA 4DTRA 2O8EB 4DFJA 3V9ZA 2HMIA 1MDUB 3G10A 3H3OB 2VG5A 1B9FA 4MO4A 2Z1JA 5FPDA 1HLUA 4IG0A 4BG9A 3JAMO 3DAWA 3MN6A 5BRDA 2YV0X 3R6MA 2HHQA 2AA4A 3WXKA 3T19A 3O8MA 4DU3A 1Q8IA 3QMLA 2I5JA 2KHOA 3IDHA 3V4IA 5AFUA 2G8WA 4MLEA 2HNDA 4FM0A 4PY5A 4H0TB 4BWMA 3VTIA 2IGIA 1HX1A 4JI1K 2PZSA 4FM1A 3G0ZA 3L6QA 5LMUK 2ASPA 1LAVA 2V51B 1NGAA 1P8ZA 3DOLA 4A5AA 1JLCA 4CK1A 4FJ5A 2P5OA 2ZQBA 2XO7A 1NGCA 4DFPA 2Q0RA 3E01A 1C1AA 3SQ2A 5AQZA 2QXFA 3L3UA 4O55A 4O8UA 2HHXA 3HBTA 2OYQA 3OYGA 2VWKA 3MWPA 4KB0A 3PX4A 4FWLA 3CMEN 4CBWA 4I2PA 4CGDA 4CZMA 4FJMA 4LD0A 3F9KA 4FJHA 2OPSA 3ITHA 1WOQA 3IS9A 1K8AO 5BPLA 4IEIA 1NNEA 4OGEA 1RT5A 3SBGA 2IAJA 1BA1A 4BDZA 1NKBA 3K2PA 3HSCA 4JD2B 3S3MA 2GWJA 5C24A 3JS6A 5M1FA 1XWLA 1O1WA 3AARA 4MLHA 4DU4A 1HPMA 1WSFA 4DTPA 1V4SA 4LF7K 1ZBHA 1LCUA 3VTHA 4FJNA 5JS2A 4H8KA 3OS0A 4CJRA 3M8SA 2BH1A 3ZSQA 3M8QA 3S9HA 4BRPA 1LAWA 4HWIA 3VMFB 4CHQA 1WN7A 4E7IA 5KTQA 3CJBA 3P83D 4BR9A 3K58A 1DKGD 1TK5A 3J8AA 4JNEA 5T7BA 1KXPA 2EHGA 1BIUA 2F9WA 4BRFA 5GAHP 5AQGA 2ZJRL 4KBOA 3AGRA 1MA9B 4BRLA 4AH9A 3VQ6A 2O8BA 4DTXA 3SCXA 1FKOA 1RT4A 1SZ2A 1M1KO 3KWIA 4B8CA 1KFDA 4RG8A 3CFPA 1WBDA 1GOCA 3W3DA 4LF8K 3PO5A 1T8EA 3WNGA 1Q9XA 4YDUA 2H3GX 3D2EB 1FW6A 4BQZA 5C2FA 4DV6K 3ZYYX 1OVQA 5BR8K 3B6OA 5E84A 3VQ4A 3K9KA 2HHUA 1DTQA 3AVIA 3TR8A 4GV3A 1GLDG 2O8CB 1JCEA 3OYKA 5JVHL 3I0SA 3U9DA 3VQDA 2HNYA 2P9UB 4FWKA 4RW7A 1XUPO 4F3TA 4Y0WA 4K43A 4CEZA 3KK3A 4F9OA 4OKJA 1TAQA 3SMPA 1ZBFA 3RTVA 1UA0A 1WB9A 3LM2A 3GOIA 3AGKA 4BC5A 1VSEA 2ZJPL 1KVBA 4FPBA 4LFCK 3KTQA 4GW6A 3JYTA 4JI5K 1KCFA 4LF6K 4HVJA 3JXUA 4OJRA 5EU7A 2B5JA 4JI7K 2YNIA 3C6HA 3ZETB 3TABA 1C0GA 4OVLA 1NJXA 1NU0A 3NE6A 5BPNA 2F9TA 3RMBA 5MLCQ 3ZSVA 4O8KA 4OLAA 1TKDA 3WQUA 3P39A 3HT3A 4M3RA 2XY6A 1NGEA 4IJNA 4IZ9A 3SZ2A 4YOTA 3Q7CA 1YITN 2E1YA 3E9PA 3I0RA 3VA3A 4JS4A 3TTCA 4EZ9A 2BUPA 3LDPA 1RDAA 3A5NC 4PKHA 1I39A 3KHYA 2OTLN 4O0JA 3HK2A 3HM9A 2RKIA 3VERA 2ZF5O 3DXKA 4W5QA 4FJ9A 4FJGA 2JLEA 3G25A 1S5JA 3C6AA 1ATSA 1BI4B 4U7BA 3B6PA 4FSVA 5DM6L 1QZ5A 1QQMA 1NK0A 2A1SA 5KPTA 3O80A 1HNZK 4X65K 1QQCA 3O3HA 4AILC 4JI6K 3DLKA 3UKUA 4KHNA 1S1UA 3KK2A 4BROA 4DQSA 2KZZA 4BG8A 3NF6A 3AVAA 3RVCA 4JEPA 4NLBA 2E20A 1EWQA 3C65A 3PIOL 1RTDA 3P1GA 3E66A 2FF3B 2P51A 4CEEA 4DV7K 3EY1A 3VEVA 4FLYA 4DSEA 2IVPA 3VESA 3SV3A 4JLHA 4JI3K 3VGMA 5AR0A 3ASMA 3G71N 2VWJA 1J5OA 4Z4FA 2QEXN 3PO4A 4RW4A 2QWPA 2P9PA 3DI6A 1OH7A 1JKHA 5KGXA 4LF5K 1OH6A 4ID5A 1XHXA 3SK3A 1TKXA 3FZFA 2E1ZA 3OYHA 3CFRA 3AVJA 4DSFA 4E7KA 5EVZA 3VQBA 4TSXA 4CEFA 2D0OA 3LDQA 1SQKA 1VK0A 4H03B 3QNOA 4Z4GA 1L3UA 4DV2K 3NDKA 3EO3A 4C8KA 2HHWA 3E9LA 4LSLA 4H5TA 3IG1A 2KTQA 5FLXO 2ZGZA 3O4WA 3PSFA 1DLOA 3HVTA 4CZJA 1S9GA 3M1FA 4K25A 2OCEA 5AQXA 3TU5A 1SKWA 4GMJB 1VQLN 3ZLJA 1UWBA 3LWLA 1ILYA 5LL6Z 3MEDA 4BRQA 4YOVA 3A2FA 3CQYA 3C95A 1A5VA 4FW1A 4FCYA 3NHGA 3CERA 4DSLA 3HPOA 5AQNA 1IKWA 1ATNA 3VENA 4CHPA 1MWKA 4J2BA 4FYDA 4A57A 3G4SN 2B6AA 4DG1A 3O9RA 3MXIA 4HUEA 3ZEUB 4BY9C 5DMRA 4U67L 3CQ8A 3O08A 3SQ0A 3RSEB 4DQ8A 1SL0A 5LMNK 3O9TA 4B9QA 4YORA 4FWOA 2NUBA 4NO7A 4FJJA 3OBYA 1GLJO 2O8EA 1VSHA 3MXJA 3T7ZA 4BRGA 5J2MA 4H4MA 4K8ZA 2HVIA 3BZKA 3CI5A 3ID6A 4CIEA 4CFBA 3DM2A 2YNFA 4CGHA 4BRKA 3R8EA 1ZYQA 2BE2A 4KHQA 4CJ4A 4B1UB 3MAQA 1KAYA 2YNHA 4IFYA 1VQ4N 2X6NA 2FSNA 1RDBA 3O3GA 1K6YA 2Q3SA 4B1XB 5KRTA 3HP6A 2UUAK 1ZBUA 3LPUA 4OPHA 5F2RA 1C1CA 3T3FA 1I3AA 4LY7A 3FZLA 2GBZA 3OYLA 1RNHA 3K5MA 1RCHA 3V9SA 3CCRN 2AP1A 3DLEA 1Z6RA 1YVUA 1HNVA 2ZGYA 3WUHA 5CE3A 2HHHK 3Q7BA 3HVRA 1SL1A 4F8RA 3C6UA 4I6MA 4CBXA 3NGZA 1SUQA 3MN7A 1HR0K 5AQKA 3THYA 1Z26A 4M42A 4AM7A 1Q7YO 3DXKB 4KRFA 1NOYA 3LANA 3NGIA 4R5PA 4CEAA 4KTWA 3THXB 1BIZA 5KQDA 4NYNA 1NGHA 1BDGA 3V9WA 4FJ7A 4J8FA 5JICA 3QEVA 4NB4A 3K5NA 1JLFA 4W5TA 1ATRA 3MCPA 3NGYA 4JD2A 4M45A 3S3NA 2KFZA 2I7NA 2ZD1A 2KZMA 2A5XA 3VQ9A 3CCEN 5JS1A 4YOXA 1VSFA 5CZ1A 4FVUA 4E0DA 4GY2B 3LPTA 5AQWA 3ULEB 3VQCA 1VQ8N 2KW4A 1WLJA 3GBTA 2WFBA 3VGLA 4GV6A 1RDWX 5BRHA 3NH2A 3ENOA 1UAXA 3RMCA 5CY4A 3F2KA 1XMOK 2F7TA 4BE0A 1EXQA 3DMJA 1S22A 2PBDA 3VQ5A 1Y64A 3TPQA 1ITGA 3I55N 4JK8A 4CJUA 1DEJA 1XHZA 4CZIA 5BN8A 3L3VA 3DYAA 4LF4K 2FXUA 1LV5A 2EX3A 4H5WA 1O13A 3BY5A 4CJSA 5C2DA 1D9DA 4E1JA 2KKZA 3OYIA 1J53A 1KC8O 4KPYA 3EKUA 3UB5A 1V4TA 3D2EA 4ILHA 2NLXA 5BPMA 4BRAA 1RILA 1FK9A 3VEZA 5HL7L 2EWSA 3GG4A 2CH5A 3L4QA 3VQ7A 2P9UA 3O1WA 3CETA 1RTIA 4FOEA 3D45A 3VEYA 1TYQB 1SKRA 4JI8K 4R79A 1D9FA 4CFAA 3KD5E 1HYZA 5HP1A 1Z05A 3O6WA 3LALA 4ICLA 4CEOA 1VHXA 1KVCA 2FBYA 1X9MA 4DF8A 3CJ9A 4OX9K 2UU9K 5B8HA 4GNIA 3JSMA 3C94A 3O5BA 1B92A 2JGUA 4DTJA 2BTFA 5C25A 3OHRA 1LWFA 4N76A 4BC4A 1DGKN 3EL2A 3GDQA 3QB0A 3CC4N 2PY5A 1GLEG 5AQQA 3MECA 5FROA 1CZBA 3CCJN 3ZETA 2VWBA 4EP5A 4CJPA 3KLFA 4EHUA 4CW7B 3BEXA 3V9UA 2GV9A 1M90O 2ZJQL 5I42A 3DXMB 2P9KA 2O8DB 1YAGA 4M3ZA 3L4IA 2W6KA 3BDPA 1WAJA 1VSLA 3S41A 5IT9O 4IJAA 4PWDA 2D0BA 1CXUA 2HMPA 5C10A 4DHYA 2ZE2A 2ASOA 2ITGA 4J2EA 5AQTA 5FDLA 5M1KA 3EN9A 1NGJA 4RW8A 4KHWA 3AA2A 3MCAB 1C6VA 1HPZA 3DRPA 4YOUA 3NH0A 1HJOA 2ATQA 4O0IA 4CJWA 4WQ5A 1BI4A 5JMVA 1SAZA 1LW2A 4X62K 1ZBIA 3DOKA 3CF5L 5LJWA 2IC3A 3CQXA 5AQPA 1KRPA 4DQRA 4XH4A 1EP4A 3AVHA 4CF1A
chains in the Genus database with same CATH topology
3QEXA 3AO1A 3JYTA 1KFSA 4MFBA 1KCFA 4KFBA 4HVJA 4OJRA 2W42A 1NK7A 1TAUA 5EU7A 1NJZA 5DK5A 1VRTA 2B5JA 3ZSWA 4DTMA 4DTNA 3OYEA 2QKKA 2YNIA 1MU2A 4ELVA 3TABA 1EKEA 3OJSA 2ETJA 4KHUA 4OVLA 1NJXA 3ZCMA 1BL3A 3TAPA 3NE6A 3RMBA 3SNNA 3ZSVA 4OLAA 2BDPA 1NK5A 1NKCA 1TKDA 4CIGA 3HT3A 3D0PA 4M3RA 2XY6A 1L5UA 1LW0A 4CJVA 3SZ2A 3K59A 1HNIA 1LWEA 3NF8A 4CFDA 2X78A 4FW2A 3QEWA 1N5YA 4XIUA 3FFIA 3I0RA 2A1RA 4B3OA 3VA3A 1J54A 1YTAA 4OPKA 4JS4A 4AHUA 1QTMA 4EZ9A 4DFMA 1RDAA 1C0MA 1VRUA 2IDOA 1I39A 2RN2A 1BQMA 3SUQA 1XC9A 2XRIA 4CHNA 4LH5A 4CHZA 1QSLA 4H4OA 1RT2A 4O0JA 3DRSA 3DLGA 3HM9A 1XI1A 3HK2A 2RKIA 3KLHA 4W5QA 4CFCA 4FJGA 3AO3A 3O4NA 4LH4A 3MXMA 4FJ9A 4M3YA 1QE1A 1IKXA 3QIPA 2JLEA 3ZSRA 1S5JA 3OYMA 1BI4B 3V1OA 3L2VA 3VQPA 2DFEA 3B6PA 4IDKA 1TV6A 3AVFA 4DU1A 1TL1A 3CM6A 4F2RA 1NK0A 2A1SA 2XY5A 1IH7A 1KTQA 4FZYA 3HSTB 4J2DA 2DFFA 2IOCA 3SV4A 1X9WA 4O5BA 3SUOA 1RT1A 1QQCA 3O3HA 4AILC 3DLKA 3OVNA 2OZSA 3ZT1A 4QAGA 4F2SA 4KHNA 1S1UA 2Z1GA 4CE9A 4KTQA 3KK2A 3ZSZA 4HCCA 4NYFA 1RTHA 3OJUA 1RBUA 4DQSA 4KHYA 5FRMA 1ASUA 3F73A 4KAZA 2KZZA 1U49A 1VSJA 3QNNA 4DS5A 3NF6A 3AVAA 3OYDA 1U45A 3AVGA 1U48A 1T03A 4YFUA 3QLHA 4AHRA 4FM2A 4E7LA 3AV9A 4I7FA 3V9XA 1QS4A 4B08A 1WSHA 2OPQA 3AVLA 1T05A 4UQGA 1SL2A 1KLNA 1S6QA 3RR8A 4FLVA 4FJ8A 1RTDA 4CIFA 4CHOA 4E7JA 2Y1IA 4B9LA 3P1GA 4HUFA 1HMVA 2P51A 3V1RA 4CEEA 1CZ9A 3EY1A 4B9NA 5D3GA 1BQNA 3ISNC 3NAEA 4KKOA 4FLYA 4DSEA 1VSKA 3SV3A 4Q0BA 3ZSYA 4JLHA 2IS3A 2VG7A 4AHCA 4HCBA 1JXBA 2D0CA 3AVCA 4CGIA 1RBVA 3ASMA 1U47A 3BGRA 1N6QA 2VWJA 1J5OA 3S3OA 4BE1A 4B9SA 4Z4FA 4CEBA 4CK2A 4E3SA 4RW4A 3PO4A 1QSSA 3DI6A 1JKHA 3HYFA 5KGXA 3TAGA 4ID5A 1HQUA 1XHXA 4FK4A 3V81A 3LZIA 4M3WA 1TKXA 4M41A 3KLEA 1VSIA 1EX4A 3AVKA 3T1AA 2HB5A 5HLFA 4I9LA 1RT6A 3KIOA 3TANA 1DTTA 1LWCA 4PQUA 3OYHA 3HP9A 3AVJA 3CFRA 1R0AA 4DSFA 4E7KA 3VQBA 4TSXA 4CEFA 1CXQA 1HQEA 5K14A 3QINA 5J2NA 4FJXA 3KLIA 1VK0A 4BDYA 3H08A 3TWHA 4Q5VA 3QNOA 4Z4GA 4Z4CA 1L3UA 2HW3A 3AO5A 3PX0A 1QSYA 3MEEA 4NCAA 2HNZA 2QK9A 4N56A 4QCLA 4DWIA 3NDKA 2O4IA 4C8KA 5KGWA 1WSJA 1B9DA 4LSLA 4J2AA 2HHWA 3IG1A 4CK3A 1UA1A 3RRGA 2KTQA 3V6DA 4C8LA 2G8IA 2YNGA 3HPGA 4KREA 4M3TA 4CGJA 1DLOA 3DLRA 3OYAA 3WNEA 3HVTA 4E19A 1S9GA 4DQQA 3CG7A 1TK8A 2QKBA 4O44A 1SKSA 1SKWA 4DTOA 4GMJB 4KI6A 1KSPA 1A5XA 1RT7A 1X9SA 1T7PA 5SWMA 2OZMA 1UWBA 4E89A 3LWLA 2BGGA 3AVMA 4KTZA 2YHBA 4CJKA 3MEDA 3PX6A 2FBTA 3RMAA 1D8YA 4E1MA 1HYSA 3EZ5A 4DSIA 3A2FA 3K5OA 3C95A 3KK1A 1A5VA 1C0TA 4N47A 1S9EA 4FW1A 4FCYA 4Z4HA 1YT3A 3NHGA 4DSLA 4ID1A 4HUGA 5HBMA 2D5RA 4N5SA 3SYZA 2HVHA 1VSDA 3HPOA 1SV5A 3OY9A 2KQ2A 1TGOA 2RF2A 4JRQA 1L3SA 1IKWA 3RRHA 4F4KA 1YTUA 3HXMA 4CHPA 3L2QA 4FJLA 4J2BA 3P5JA 4FYDA 4KV8A 2B6AA 4DG1A 3OYJA 3MXIA 4HUEA 4B8AB 4PA1A 3QEIA 5DMRA 1L3TA 3CQ8A 3SQ0A 2DFHA 5KI6A 4AHVA 3SPZA 1NK9A 3NCIA 1JLEA 1SL0A 1S1TA 4CECA 4FLXA 1IKVA 5J2PA 5CYQA 3VA0A 2FBVA 2P5GA 2HHVA 1GOAA 1A5WA 4BACA 1RDDA 1RTJA 3MEGA 1ZBLA 4W5OA 4IG3A 1NK4A 3WNFA 4BDPA 3NBPA 2NUBA 4NCGA 2LSNA 3ULDA 4FJJA 4RW6A 5SZTA 1VSHA 2X6SA 1RBSA 3AA5X 3MXJA 3QEPA 4FZZA 3THVA 2F8SA 5J2MA 3DLHA 4CF8A 4H4MA 4K8ZA 3QESA 2HVIA 4AHSA 4DTSA 3LP0A 3QERA 2E4LA 4CIEA 4CFBA 3DM2A 2YNFA 4CGHA 4K8XA 3NF7A 4Z4EA 1TL3A 3DRRA 2Y1JA 3KKRA 1WSEA 4GVMA 2BE2A 1ZYQA 5I3UA 4KHQA 4CJ4A 4ZTFA 4B9TA 2O4GA 3MAQA 2YNHA 3IRXA 4IFYA 3SUNA 3LZJA 4CF0A 1WSIA 4W5NA 4KHSA 2R7YA 3U6FA 5HROA 1WAFA 2X6NA 4C8MA 5FRNA 2E6LA 3L2WA 2P1JA 1RDBA 2XY7A 3O3GA 2G8UA 3HO1A 1G15A 1K6YA 3NH1A 2Q3SA 3SJJA 4L8RB 4Y1DA 5KRTA 4JRPA 3ALYA 3OYFA 3HP6A 1ZBUA 2B4JA 3LPUA 4DLGA 1C1CA 3L2RA 3EYZA 3T3FA 1I3AA 1NK8A 4KO0A 4MQ3A 2E6MA 4LY7A 4E7HA 4CEDA 2GBZA 1KLMA 5C42A 1TVRA 3OYLA 4CJFA 1NJYA 1JL1A 1RNHA 3V1QA 4C8OA 3K5MA 3LDSA 1NOZA 1RCHA 2FBXA 3V9SA 3QETA 3ZT2A 1JLGA 3DLEA 1BCOA 1YVUA 3OYBA 1HNVA 4CGFA 3KJVA 4KB1A 1HYVA 3HVRA 1SL1A 4F8RA 3C6UA 1W0HA 3NGZA 3U3GA 4M3XA 1TK0A 4DQIA 1REVA 1RT3A 1SUQA 3KKSA 4BWJA 4CEQA 4OKEA 1Z26A 4M42A 1S6PA 4Z0UA 4CHYA 3PV8A 4KRFA 2KFNA 2DTUA 1JL2A 1NOYA 3LANA 4CJTA 4DTRA 3NGIA 3SUPA 4FZXC 4R5PA 1J9AA 1S1VA 3AVBA 4G1QA 4KTWA 4CEAA 1BIZA 3V9ZA 4DFJA 1WNSA 4GW6A 4NYNA 4I9QA 1TKZA 3V9WA 4FJ7A 4WE1A 2HMIA 3G10A 3M8PA 4JS5A 3ZT3A 3QEVA 2VG5A 1B9FA 4B9VA 3RMDA 2Z1JA 3ZSXA 3K5NA 4IG0A 2G8HA 1JLFA 4W5TA 3TAFA 3NGYA 4M45A 3S3NA 2YV0X 2KFZA 1EETA 2HHQA 4CJ5A 4YNQA 1UOCA 2ZD1A 3LP2A 3T19A 5E41A 4DU3A 3OYCA 3HJFA 2Z1HA 2KZMA 5KRSA 1IKYA 3VQ9A 1NK6A 5JS1A 1Q8IA 3AA4A 3L2UA 1U4BA 2I5JA 1VSFA 4DTUA 3AVNA 5CZ1A 4DSJA 1Q9YA 3V4IA 4CERA 3AO2A 2G8WA 4E0DA 3NFAA 2HNDA 3LPTA 4CF2A 2G8VA 3VQCA 4FM0A 4PY5A 4BWMA 3ZSOA 1RBRA 2IGIA 1NJWA 2KW4A 1WLJA 2PZSA 4BE2A 4FM1A 1NKEA 3UIQA 2AJQA 3G0ZA 3CFOA 2FC0A 1LAVA 3NH2A 3DOLA 4FJ5A 1JLCA 4CK1A 2P5OA 4DMNA 1UAXA 2ZQBA 2XO7A 5CY4A 3RMCA 3WNHA 4OPJA 1ASVA 3OYNA 4DFPA 4BE0A 1JXEA 3E01A 1EXQA 3SQ4A 3DMJA 1C1AA 2YHAA 2G8KA 4W5RA 3SQ2A 3VQ5A 4FJKA 4FXDA 3QIOA 4IBNA 5J1EA 2QXFA 4DLEA 1U04A 1FXXA 3L3UA 4HHTA 3O4QA 4O55A 3O3FA 3HL8A 5CZ2A 4FLZA 2HHXA 2OYQA 2BANA 1ITGA 3OYGA 2Z1IA 2VWKA 1KVAA 4CJUA 1XHZA 3L3VA 3DYAA 4KB0A 3SPYA 2OPPA 3PX4A 1JLQA 1RBTA 5HRRA 5HRNA 4KI4A 3OS2A 1LV5A 4IFVA 3SI6A 2EX3A 4I2PA 4CGDA 4CJQA 1HRHA 1VSMA 2D0AA 1FKPA 2OPRA 4FJMA 4LD0A 3F9KA 4FJHA 2OPSA 3ITHA 3IS9A 4CJSA 1D9DA 3OYIA 1C1BA 4OGEA 1J53A 1RT5A 4LSNA 2IAJA 3QO9A 4KPYA 4BDZA 1NKBA 3K2PA 3K57A 3U3YA 3SQ1A 3S3MA 5C24A 1RDCA 3TAEA 1XWLA 4CJEA 1IO2A 1D5AA 1O1WA 2YKNA 5CYMA 4DU4A 1RILA 1FK9A 3RWUA 1WSFA 4QOZB 1JLBA 4DTPA 2HHSA 1QHTA 3CYMA 3RR7A 3VQAA 3VQQA 1ZBHA 4ZHRA 1CLQA 3LP3A 3TARA 4FJNA 2X74A 4EP4A 2DY4A 5JS2A 3VQ7A 2PYJA 4H8KA 4HTUA 3ZT4A 4CGGA 3OS0A 2WOMA 1JLAA 1RTIA 1X1PA 4DSKA 4CJRA 3KD1E 4ZTJA 4ELUA 3D45A 1HJRA 3M8SA 1BGXT 4FVMA 3VQEA 1SKRA 2VG6A 3ZSQA 3TAQA 2F8TA 3M8QA 4OKKA 3S9HA 3KD5E 1D9FA 4CFAA 1LAWA 1HYZA 5HP1A 3LWMA 4FLUA 4CJLA 3LALA 2WONA 1GOBA 1WN7A 4ICLA 4CEOA 4CHQA 3OS1A 1KVCA 5J2QA 4DQPA 4E7IA 5KTQA 2FBYA 4RW9A 1X9MA 3P83D 4DF8A 3IAYA 4Z4IA 3K58A 3ZT0A 2PYLA 3JSMA 3C94A 1B92A 2JGUA 4DTJA 1TK5A 1IG9A 4NCBA 4Y1CA 1TKTA 5T7BA 2YKMA 1BCMA 3LP1A 5C25A 4F3OA 4OLBA 2EHGA 4DF4A 1LWFA 1BIUA 4N76A 3KLGA 3M8RA 5HRPA 3PUFA 3L8BA 4FLWA 2PY5A 4CCHA 3MECA 3TAMA 5FROA 4IKFA 1CZBA 4AH9A 2RPIA 3VQ6A 2XHBA 3C6TA 1S1WA 4DTXA 2G8FA 4EP5A 1F21A 4EZ6A 1BISA 1FKOA 1RT4A 4CJPA 3SCXA 3CM5A 3VN5A 3KLFA 4FLTA 4B8CA 3V9UA 1KFDA 2GV9A 4RG8A 3CFPA 1ASWA 1GOCA 5I42A 3PO5A 1T8EA 3WNGA 3PY8A 4M3ZA 4OGCA 1Q9XA 3BDPA 4B9UA 1WAJA 3LAMA 1VSLA 3VQ8A 4CJ3A 4PWDA 2D0BA 1CXUA 5HRSA 3TI0A 3B6OA 2ZE2A 3VQ4A 2HHUA 2ITGA 4ELTA 1DTQA 1C0UA 3AVIA 3TR8A 4J2EA 4M3UA 4B9MA 5FDLA 3OYKA 4PUOA 4I2QA 4AHTA 3I0SA 4RW8A 4KHWA 3LAKA 3VQDA 3AA2A 1C6VA 1HPZA 2HNYA 3DRPA 2XY8A 4O4GA 3DLBA 4RW7A 3NH0A 4F3TA 2ATQA 4O0IA 3I8DA 4CJWA 4CEZA 3KK3A 1BI4A 2OA8A 4OKJA 4FK2A 1LW2A 4FK0A 1Y97A 1WSGA 1ZBIA 1TAQA 1S1XA 3AA3A 3DOKA 4CF9A 3K5LA 4DFKA 4FJIA 1ZBFA 1Z25A 3HPHA 4DS4A 3RTVA 2IC3A 1UA0A 1BHLA 1L3VA 4C8NA 1VSEA 1KRPA 4E1NA 1KVBA 4DQRA 4N41A 3AO4A 2HHTA 2F96A 1W9HA 3NF9A 1EP4A 4CESA 3KTQA 3AVHA 2GUIA 4CF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QEX A;  3AO1 A;  3JYT A;  1KFS A;  4MFB A;  1KCF A;  4KFB A;  4HVJ A;  4OJR A;  2W42 A;  1NK7 A;  1TAU A;  5EU7 A;  1NJZ A;  5DK5 A;  1VRT A;  2B5J A;  3ZSW A;  4DTM A;  4DTN A;  3OYE A;  2QKK A;  2YNI A;  1MU2 A;  4ELV A;  3TAB A;  1EKE A;  3OJS A;  2ETJ A;  4KHU A;  4OVL A;  1NJX A;  3ZCM A;  1BL3 A;  3TAP A;  3NE6 A;  3RMB A;  3SNN A;  3ZSV A;  4OLA A;  2BDP A;  1NK5 A;  1NKC A;  1TKD A;  4CIG A;  3HT3 A;  3D0P A;  4M3R A;  2XY6 A;  1L5U A;  1LW0 A;  4CJV A;  3SZ2 A;  3K59 A;  1HNI A;  1LWE A;  3NF8 A;  4CFD A;  2X78 A;  4FW2 A;  3QEW A;  1N5Y A;  4XIU A;  3FFI A;  3I0R A;  2A1R A;  4B3O A;  3VA3 A;  1J54 A;  1YTA A;  4OPK A;  4JS4 A;  4AHU A;  1QTM A;  4EZ9 A;  4DFM A;  1RDA A;  1C0M A;  1VRU A;  2IDO A;  1I39 A;  2RN2 A;  1BQM A;  3SUQ A;  1XC9 A;  2XRI A;  4CHN A;  4LH5 A;  4CHZ A;  1QSL A;  4H4O A;  1RT2 A;  4O0J A;  3DRS A;  3DLG A;  3HM9 A;  1XI1 A;  3HK2 A;  2RKI A;  3KLH A;  4W5Q A;  4CFC A;  4FJG A;  3AO3 A;  3O4N A;  4LH4 A;  3MXM A;  4FJ9 A;  4M3Y A;  1QE1 A;  1IKX A;  3QIP A;  2JLE A;  3ZSR A;  1S5J A;  3OYM A;  1BI4 B;  3V1O A;  3L2V A;  3VQP A;  2DFE A;  3B6P A;  4IDK A;  1TV6 A;  3AVF A;  4DU1 A;  1TL1 A;  3CM6 A;  4F2R A;  1NK0 A;  2A1S A;  2XY5 A;  1IH7 A;  1KTQ A;  4FZY A;  3HST B;  4J2D A;  2DFF A;  2IOC A;  3SV4 A;  1X9W A;  4O5B A;  3SUO A;  1RT1 A;  1QQC A;  3O3H A;  4AIL C;  3DLK A;  3OVN A;  2OZS A;  3ZT1 A;  4QAG A;  4F2S A;  4KHN A;  1S1U A;  2Z1G A;  4CE9 A;  4KTQ A;  3KK2 A;  3ZSZ A;  4HCC A;  4NYF A;  1RTH A;  3OJU A;  1RBU A;  4DQS A;  4KHY A;  5FRM A;  1ASU A;  3F73 A;  4KAZ A;  2KZZ A;  1U49 A;  1VSJ A;  3QNN A;  4DS5 A;  3NF6 A;  3AVA A;  3OYD A;  1U45 A;  3AVG A;  1U48 A;  1T03 A;  4YFU A;  3QLH A;  4AHR A;  4FM2 A;  4E7L A;  3AV9 A;  4I7F A;  3V9X A;  1QS4 A;  4B08 A;  1WSH A;  2OPQ A;  3AVL A;  1T05 A;  4UQG A;  1SL2 A;  1KLN A;  1S6Q A;  3RR8 A;  4FLV A;  4FJ8 A;  1RTD A;  4CIF A;  4CHO A;  4E7J A;  2Y1I A;  4B9L A;  3P1G A;  4HUF A;  1HMV A;  2P51 A;  3V1R A;  4CEE A;  1CZ9 A;  3EY1 A;  4B9N A;  5D3G A;  1BQN A;  3ISN C;  3NAE A;  4KKO A;  4FLY A;  4DSE A;  1VSK A;  3SV3 A;  4Q0B A;  3ZSY A;  4JLH A;  2IS3 A;  2VG7 A;  4AHC A;  4HCB A;  1JXB A;  2D0C A;  3AVC A;  4CGI A;  1RBV A;  3ASM A;  1U47 A;  3BGR A;  1N6Q A;  2VWJ A;  1J5O A;  3S3O A;  4BE1 A;  4B9S A;  4Z4F A;  4CEB A;  4CK2 A;  4E3S A;  4RW4 A;  3PO4 A;  1QSS A;  3DI6 A;  1JKH A;  3HYF A;  5KGX A;  3TAG A;  4ID5 A;  1HQU A;  1XHX A;  4FK4 A;  3V81 A;  3LZI A;  4M3W A;  1TKX A;  4M41 A;  3KLE A;  1VSI A;  1EX4 A;  3AVK A;  3T1A A;  2HB5 A;  5HLF A;  4I9L A;  1RT6 A;  3KIO A;  3TAN A;  1DTT A;  1LWC A;  4PQU A;  3OYH A;  3HP9 A;  3AVJ A;  3CFR A;  1R0A A;  4DSF A;  4E7K A;  3VQB A;  4TSX A;  4CEF A;  1CXQ A;  1HQE A;  5K14 A;  3QIN A;  5J2N A;  4FJX A;  3KLI A;  1VK0 A;  4BDY A;  3H08 A;  3TWH A;  4Q5V A;  3QNO A;  4Z4G A;  4Z4C A;  1L3U A;  2HW3 A;  3AO5 A;  3PX0 A;  1QSY A;  3MEE A;  4NCA A;  2HNZ A;  2QK9 A;  4N56 A;  4QCL A;  4DWI A;  3NDK A;  2O4I A;  4C8K A;  5KGW A;  1WSJ A;  1B9D A;  4LSL A;  4J2A A;  2HHW A;  3IG1 A;  4CK3 A;  1UA1 A;  3RRG A;  2KTQ A;  3V6D A;  4C8L A;  2G8I A;  2YNG A;  3HPG A;  4KRE A;  4M3T A;  4CGJ A;  1DLO A;  3DLR A;  3OYA A;  3WNE A;  3HVT A;  4E19 A;  1S9G A;  4DQQ A;  3CG7 A;  1TK8 A;  2QKB A;  4O44 A;  1SKS A;  1SKW A;  4DTO A;  4GMJ B;  4KI6 A;  1KSP A;  1A5X A;  1RT7 A;  1X9S A;  1T7P A;  5SWM A;  2OZM A;  1UWB A;  4E89 A;  3LWL A;  2BGG A;  3AVM A;  4KTZ A;  2YHB A;  4CJK A;  3MED A;  3PX6 A;  2FBT A;  3RMA A;  1D8Y A;  4E1M A;  1HYS A;  3EZ5 A;  4DSI A;  3A2F A;  3K5O A;  3C95 A;  3KK1 A;  1A5V A;  1C0T A;  4N47 A;  1S9E A;  4FW1 A;  4FCY A;  4Z4H A;  1YT3 A;  3NHG A;  4DSL A;  4ID1 A;  4HUG A;  5HBM A;  2D5R A;  4N5S A;  3SYZ A;  2HVH A;  1VSD A;  3HPO A;  1SV5 A;  3OY9 A;  2KQ2 A;  1TGO A;  2RF2 A;  4JRQ A;  1L3S A;  1IKW A;  3RRH A;  4F4K A;  1YTU A;  3HXM A;  4CHP A;  3L2Q A;  4FJL A;  4J2B A;  3P5J A;  4FYD A;  4KV8 A;  2B6A A;  4DG1 A;  3OYJ A;  3MXI A;  4HUE A;  4B8A B;  4PA1 A;  3QEI A;  5DMR A;  1L3T A;  3CQ8 A;  3SQ0 A;  2DFH A;  5KI6 A;  4AHV A;  3SPZ A;  1NK9 A;  3NCI A;  1JLE A;  1SL0 A;  1S1T A;  4CEC A;  4FLX A;  1IKV A;  5J2P A;  5CYQ A;  3VA0 A;  2FBV A;  2P5G A;  2HHV A;  1GOA A;  1A5W A;  4BAC A;  1RDD A;  1RTJ A;  3MEG A;  1ZBL A;  4W5O A;  4IG3 A;  1NK4 A;  3WNF A;  4BDP A;  3NBP A;  2NUB A;  4NCG A;  2LSN A;  3ULD A;  4FJJ A;  4RW6 A;  5SZT A;  1VSH A;  2X6S A;  1RBS A;  3AA5 X;  3MXJ A;  3QEP A;  4FZZ A;  3THV A;  2F8S A;  5J2M A;  3DLH A;  4CF8 A;  4H4M A;  4K8Z A;  3QES A;  2HVI A;  4AHS A;  4DTS A;  3LP0 A;  3QER A;  2E4L A;  4CIE A;  4CFB A;  3DM2 A;  2YNF A;  4CGH A;  4K8X A;  3NF7 A;  4Z4E A;  1TL3 A;  3DRR A;  2Y1J A;  3KKR A;  1WSE A;  4GVM A;  2BE2 A;  1ZYQ A;  5I3U A;  4KHQ A;  4CJ4 A;  4ZTF A;  4B9T A;  2O4G A;  3MAQ A;  2YNH A;  3IRX A;  4IFY A;  3SUN A;  3LZJ A;  4CF0 A;  1WSI A;  4W5N A;  4KHS A;  2R7Y A;  3U6F A;  5HRO A;  1WAF A;  2X6N A;  4C8M A;  5FRN A;  2E6L A;  3L2W A;  2P1J A;  1RDB A;  2XY7 A;  3O3G A;  2G8U A;  3HO1 A;  1G15 A;  1K6Y A;  3NH1 A;  2Q3S A;  3SJJ A;  4L8R B;  4Y1D A;  5KRT A;  4JRP A;  3ALY A;  3OYF A;  3HP6 A;  1ZBU A;  2B4J A;  3LPU A;  4DLG A;  1C1C A;  3L2R A;  3EYZ A;  3T3F A;  1I3A A;  1NK8 A;  4KO0 A;  4MQ3 A;  2E6M A;  4LY7 A;  4E7H A;  4CED A;  2GBZ A;  1KLM A;  5C42 A;  1TVR A;  3OYL A;  4CJF A;  1NJY A;  1JL1 A;  1RNH A;  3V1Q A;  4C8O A;  3K5M A;  3LDS A;  1NOZ A;  1RCH A;  2FBX A;  3V9S A;  3QET A;  3ZT2 A;  1JLG A;  3DLE A;  1BCO A;  1YVU A;  3OYB A;  1HNV A;  4CGF A;  3KJV A;  4KB1 A;  1HYV A;  3HVR A;  1SL1 A;  4F8R A;  3C6U A;  1W0H A;  3NGZ A;  3U3G A;  4M3X A;  1TK0 A;  4DQI A;  1REV A;  1RT3 A;  1SUQ A;  3KKS A;  4BWJ A;  4CEQ A;  4OKE A;  1Z26 A;  4M42 A;  1S6P A;  4Z0U A;  4CHY A;  3PV8 A;  4KRF A;  2KFN A;  2DTU A;  1JL2 A;  1NOY A;  3LAN A;  4CJT A;  4DTR A;  3NGI A;  3SUP A;  4FZX C;  4R5P A;  1J9A A;  1S1V A;  3AVB A;  4G1Q A;  4KTW A;  4CEA A;  1BIZ A;  3V9Z A;  4DFJ A;  1WNS A;  4GW6 A;  4NYN A;  4I9Q A;  1TKZ A;  3V9W A;  4FJ7 A;  4WE1 A;  2HMI A;  3G10 A;  3M8P A;  4JS5 A;  3ZT3 A;  3QEV A;  2VG5 A;  1B9F A;  4B9V A;  3RMD A;  2Z1J A;  3ZSX A;  3K5N A;  4IG0 A;  2G8H A;  1JLF A;  4W5T A;  3TAF A;  3NGY A;  4M45 A;  3S3N A;  2YV0 X;  2KFZ A;  1EET A;  2HHQ A;  4CJ5 A;  4YNQ A;  1UOC A;  2ZD1 A;  3LP2 A;  3T19 A;  5E41 A;  4DU3 A;  3OYC A;  3HJF A;  2Z1H A;  2KZM A;  5KRS A;  1IKY A;  3VQ9 A;  1NK6 A;  5JS1 A;  1Q8I A;  3AA4 A;  3L2U A;  1U4B A;  2I5J A;  1VSF A;  4DTU A;  3AVN A;  5CZ1 A;  4DSJ A;  1Q9Y A;  3V4I A;  4CER A;  3AO2 A;  2G8W A;  4E0D A;  3NFA A;  2HND A;  3LPT A;  4CF2 A;  2G8V A;  3VQC A;  4FM0 A;  4PY5 A;  4BWM A;  3ZSO A;  1RBR A;  2IGI A;  1NJW A;  2KW4 A;  1WLJ A;  2PZS A;  4BE2 A;  4FM1 A;  1NKE A;  3UIQ A;  2AJQ A;  3G0Z A;  3CFO A;  2FC0 A;  1LAV A;  3NH2 A;  3DOL A;  4FJ5 A;  1JLC A;  4CK1 A;  2P5O A;  4DMN A;  1UAX A;  2ZQB A;  2XO7 A;  5CY4 A;  3RMC A;  3WNH A;  4OPJ A;  1ASV A;  3OYN A;  4DFP A;  4BE0 A;  1JXE A;  3E01 A;  1EXQ A;  3SQ4 A;  3DMJ A;  1C1A A;  2YHA A;  2G8K A;  4W5R A;  3SQ2 A;  3VQ5 A;  4FJK A;  4FXD A;  3QIO A;  4IBN A;  5J1E A;  2QXF A;  4DLE A;  1U04 A;  1FXX A;  3L3U A;  4HHT A;  3O4Q A;  4O55 A;  3O3F A;  3HL8 A;  5CZ2 A;  4FLZ A;  2HHX A;  2OYQ A;  2BAN A;  1ITG A;  3OYG A;  2Z1I A;  2VWK A;  1KVA A;  4CJU A;  1XHZ A;  3L3V A;  3DYA A;  4KB0 A;  3SPY A;  2OPP A;  3PX4 A;  1JLQ A;  1RBT A;  5HRR A;  5HRN A;  4KI4 A;  3OS2 A;  1LV5 A;  4IFV A;  3SI6 A;  2EX3 A;  4I2P A;  4CGD A;  4CJQ A;  1HRH A;  1VSM A;  2D0A A;  1FKP A;  2OPR A;  4FJM A;  4LD0 A;  3F9K A;  4FJH A;  2OPS A;  3ITH A;  3IS9 A;  4CJS A;  1D9D A;  3OYI A;  1C1B A;  4OGE A;  1J53 A;  1RT5 A;  4LSN A;  2IAJ A;  3QO9 A;  4KPY A;  4BDZ A;  1NKB A;  3K2P A;  3K57 A;  3U3Y A;  3SQ1 A;  3S3M A;  5C24 A;  1RDC A;  3TAE A;  1XWL A;  4CJE A;  1IO2 A;  1D5A A;  1O1W A;  2YKN A;  5CYM A;  4DU4 A;  1RIL A;  1FK9 A;  3RWU A;  1WSF A;  4QOZ B;  1JLB A;  4DTP A;  2HHS A;  1QHT A;  3CYM A;  3RR7 A;  3VQA A;  3VQQ A;  1ZBH A;  4ZHR A;  1CLQ A;  3LP3 A;  3TAR A;  4FJN A;  2X74 A;  4EP4 A;  2DY4 A;  5JS2 A;  3VQ7 A;  2PYJ A;  4H8K A;  4HTU A;  3ZT4 A;  4CGG A;  3OS0 A;  2WOM A;  1JLA A;  1RTI A;  1X1P A;  4DSK A;  4CJR A;  3KD1 E;  4ZTJ A;  4ELU A;  3D45 A;  1HJR A;  3M8S A;  1BGX T;  4FVM A;  3VQE A;  1SKR A;  2VG6 A;  3ZSQ A;  3TAQ A;  2F8T A;  3M8Q A;  4OKK A;  3S9H A;  3KD5 E;  1D9F A;  4CFA A;  1LAW A;  1HYZ A;  5HP1 A;  3LWM A;  4FLU A;  4CJL A;  3LAL A;  2WON A;  1GOB A;  1WN7 A;  4ICL A;  4CEO A;  4CHQ A;  3OS1 A;  1KVC A;  5J2Q A;  4DQP A;  4E7I A;  5KTQ A;  2FBY A;  4RW9 A;  1X9M A;  3P83 D;  4DF8 A;  3IAY A;  4Z4I A;  3K58 A;  3ZT0 A;  2PYL A;  3JSM A;  3C94 A;  1B92 A;  2JGU A;  4DTJ A;  1TK5 A;  1IG9 A;  4NCB A;  4Y1C A;  1TKT A;  5T7B A;  2YKM A;  1BCM A;  3LP1 A;  5C25 A;  4F3O A;  4OLB A;  2EHG A;  4DF4 A;  1LWF A;  1BIU A;  4N76 A;  3KLG A;  3M8R A;  5HRP A;  3PUF A;  3L8B A;  4FLW A;  2PY5 A;  4CCH A;  3MEC A;  3TAM A;  5FRO A;  4IKF A;  1CZB A;  4AH9 A;  2RPI A;  3VQ6 A;  2XHB A;  3C6T A;  1S1W A;  4DTX A;  2G8F A;  4EP5 A;  1F21 A;  4EZ6 A;  1BIS A;  1FKO A;  1RT4 A;  4CJP A;  3SCX A;  3CM5 A;  3VN5 A;  3KLF A;  4FLT A;  4B8C A;  3V9U A;  1KFD A;  2GV9 A;  4RG8 A;  3CFP A;  1ASW A;  1GOC A;  5I42 A;  3PO5 A;  1T8E A;  3WNG A;  3PY8 A;  4M3Z A;  4OGC A;  1Q9X A;  3BDP A;  4B9U A;  1WAJ A;  3LAM A;  1VSL A;  3VQ8 A;  4CJ3 A;  4PWD A;  2D0B A;  1CXU A;  5HRS A;  3TI0 A;  3B6O A;  2ZE2 A;  3VQ4 A;  2HHU A;  2ITG A;  4ELT A;  1DTQ A;  1C0U A;  3AVI A;  3TR8 A;  4J2E A;  4M3U A;  4B9M A;  5FDL A;  3OYK A;  4PUO A;  4I2Q A;  4AHT A;  3I0S A;  4RW8 A;  4KHW A;  3LAK A;  3VQD A;  3AA2 A;  1C6V A;  1HPZ A;  2HNY A;  3DRP A;  2XY8 A;  4O4G A;  3DLB A;  4RW7 A;  3NH0 A;  4F3T A;  2ATQ A;  4O0I A;  3I8D A;  4CJW A;  4CEZ A;  3KK3 A;  1BI4 A;  2OA8 A;  4OKJ A;  4FK2 A;  1LW2 A;  4FK0 A;  1Y97 A;  1WSG A;  1ZBI A;  1TAQ A;  1S1X A;  3AA3 A;  3DOK A;  4CF9 A;  3K5L A;  4DFK A;  4FJI A;  1ZBF A;  1Z25 A;  3HPH A;  4DS4 A;  3RTV A;  2IC3 A;  1UA0 A;  1BHL A;  1L3V A;  4C8N A;  1VSE A;  1KRP A;  4E1N A;  1KVB A;  4DQR A;  4N41 A;  3AO4 A;  2HHT A;  2F96 A;  1W9H A;  3NF9 A;  1EP4 A;  4CES A;  3KTQ A;  3AVH A;  2GUI A;  4CF1 A; 
#chains in the Genus database with same CATH topology
 3VPZ A;  1TUU A;  3L0Q A;  3MN9 A;  5A2Q O;  3LL3 A;  1NK7 A;  1K73 O;  4I6M B;  2Q0U A;  5DK5 A;  1RGI A;  1VRT A;  1HUX A;  3ZSW A;  4DTN A;  4BRD A;  3THY B;  1EKE A;  4PHT X;  4DR7 K;  3M6G A;  3EZW A;  3K9J A;  2ZM6 K;  3TAP A;  3SNN A;  5AQH A;  1NMN A;  2BDP A;  1NK5 A;  3HZ6 A;  4WYB A;  1LW0 A;  3SAH A;  4ILG B;  1LWE A;  3NF8 A;  2VCP A;  3QEW A;  4DR6 K;  2RHK A;  3FFI A;  1XMQ K;  1JCF A;  1J54 A;  3AAP A;  4OPK A;  3FFK B;  4AHU A;  1QTM A;  1VRU A;  1JCG A;  4CHN A;  1RT2 A;  2P9I B;  5EX5 A;  4CFC A;  4LF9 K;  3O4N A;  1QE1 A;  3QIP A;  2V7Y A;  3H45 C;  2NRH A;  3V1O A;  2YI1 A;  2CGJ A;  4IDK A;  1TV6 A;  3QDK A;  4M63 C;  4BC2 A;  2HHT A;  2XY5 A;  1IH7 A;  3HI0 A;  3GE1 A;  1Q86 O;  1WUA A;  2DFF A;  3SV4 A;  1X9W A;  4BRN A;  3C0B A;  3ZT1 A;  2YHY A;  4F2S A;  4CE9 A;  3ZSZ A;  4HCC A;  4NYF A;  3GL1 A;  1ASU A;  1VSJ A;  3QNN A;  4DS5 A;  1U45 A;  1W2B M;  4H5V A;  3O1B A;  4YFU A;  3QLH A;  4AHR A;  4E7L A;  3AV9 A;  3V9X A;  1NGB A;  1T05 A;  2VYP A;  4FLV A;  4FJ8 A;  2E2N A;  4E7J A;  4DCH A;  4XH5 A;  1HMV A;  4CD1 A;  1GLB G;  5D3G A;  1BQN A;  4BRC A;  1VSK A;  4MO5 A;  3ZSY A;  4A62 A;  2GUP A;  5AJ3 K;  2VG7 A;  4AHC A;  3CCV N;  4HCB A;  1XNQ K;  1JXB A;  2NRX A;  1N6Q A;  3FZK A;  3BGR A;  5GIP A;  4DUZ K;  3P38 A;  4B1W B;  1NBW A;  3ZEU A;  3HYF A;  3TAG A;  1X3N A;  1HQU A;  3RSE A;  4FK4 A;  3G6E N;  3CJC A;  1VSI A;  3QBW A;  2HB5 A;  4PKG A;  4I9L A;  5HLF A;  3KIO A;  1DTT A;  2HBM A;  3HP9 A;  2O8F B;  3LM9 A;  5BRE A;  5K14 A;  1VAZ A;  3KLI A;  4BDY A;  5AZJ B;  4BR4 A;  1E4G T;  3W0L A;  4BVO A;  3MEE A;  4DV5 K;  2HNZ A;  1N33 K;  4AQY K;  1WSJ A;  4J2A A;  1YUW A;  5KPR A;  4A2B A;  4FL9 A;  3V6D A;  4C8L A;  3HPG A;  1X9J A;  4CGJ A;  3WNE A;  4DQQ A;  2QKB A;  1TK8 A;  4QS8 A;  2YJF A;  1SKS A;  4H0P A;  5FPM A;  4DTO A;  4OPA A;  4KI6 A;  1A5X A;  1T7P A;  5SWM A;  1NGD A;  4E89 A;  1GLA G;  3AVM A;  4CJK A;  1D8Y A;  3PX6 A;  3EZ5 A;  1Q82 O;  4RCH A;  1S9E A;  4C1N I;  4LFB K;  4HUG A;  3UKR B;  4N5S A;  1VSD A;  2KQ2 A;  2P9K B;  2RF2 A;  1L3S A;  5M1P A;  3HXM A;  3L2Q A;  4FJL A;  3P5J A;  3D6R A;  4BVP A;  1JJ2 M;  1EQY A;  1HNX K;  4JAX A;  3QEI A;  1L3T A;  2DFH A;  1NK9 A;  3CIP A;  4UY8 O;  3H3N O;  1IKV A;  5J2P A;  5CYQ A;  2P5G A;  2HHV A;  1OKJ A;  1RTJ A;  3MEG A;  1ZBL A;  3WNF A;  4NLC A;  4GKJ K;  1GLC G;  3A5M C;  3THX A;  4V19 S;  1YI2 N;  3TSP A;  3THV A;  4CF8 A;  4BR7 A;  1OH8 A;  1BA0 A;  4AHS A;  4DTS A;  4G9Z A;  5EOY A;  4IWV A;  3NF7 A;  4Z4E A;  3KKR A;  1WSE A;  4GVM A;  2HF4 A;  4FWM A;  3LZJ A;  4EIA A;  4W5N A;  2R7Y A;  2CGL A;  3ULE A;  5IWA K;  2P1J A;  2G8U A;  3HO1 A;  4JRP A;  3ALY A;  2B4J A;  1QQN A;  1BWF O;  4MQ3 A;  2E6M A;  4CED A;  1KLM A;  5C42 A;  1TVR A;  1YXQ A;  4CJF A;  1NJY A;  1NMD A;  3QET A;  3ZT2 A;  1VQ5 N;  1BCO A;  1BUP A;  4LC9 B;  4KB1 A;  3FZM A;  1GLF O;  4M3X A;  1TK0 A;  1REV A;  2QXL A;  3K0S A;  4Z0U A;  4FZX C;  1S1V A;  3AVB A;  1WNS A;  4I9Q A;  4K41 A;  2Q36 A;  2UXB K;  3MX5 A;  3N4Q A;  1ESV A;  4WE1 A;  3M8P A;  4JS5 A;  4GV9 A;  3EEQ A;  3RMD A;  3ZSX A;  2G8H A;  3VGK A;  2QI2 A;  4CVN E;  4JKE A;  1EET A;  4CJ5 A;  3LP2 A;  3KVG A;  3N4P A;  3OYC A;  2Z1H A;  5KRS A;  1IKY A;  1NK6 A;  1RFQ A;  4ISF A;  4DTU A;  3AVN A;  3R9P A;  4B3S K;  4CER A;  3NFA A;  1N8R O;  3F5T A;  2G8V A;  3ZSO A;  2VQE K;  1TYQ A;  3UIQ A;  2AJQ A;  4CZL A;  1IG8 A;  2P9S B;  4QS7 A;  4A2A A;  4DMN A;  2P9N B;  4OPJ A;  1NGF A;  1JXE A;  4CZE A;  2YHA A;  2QM1 A;  4W5R A;  3DWL A;  3QIO A;  2QWN A;  4IBN A;  4DLE A;  1U04 A;  1FXX A;  3O4Q A;  3M3Z A;  3O3F A;  5I9E B;  5CZ2 A;  4FLZ A;  2ITM A;  2Z1I A;  1KVA A;  4CZF A;  1JLQ A;  5EY4 A;  3NMU A;  1RBT A;  5HRR A;  3OS2 A;  3SI6 A;  5AZI B;  2D0A A;  2OPR A;  1FKP A;  4BRI A;  4PKI A;  3CJA A;  1QHA A;  4DR3 K;  1NJI O;  3DXM A;  3QO9 A;  2O8D A;  2QWL A;  3BF1 A;  1YIJ N;  3U3Y A;  3CXC M;  3HTV A;  3TAE A;  5C12 A;  4K0K K;  2YKN A;  1D5A A;  3AY9 A;  5CYM A;  3RWU A;  3T1H K;  1JLB A;  3CYM A;  3FE1 A;  3VQQ A;  1CLQ A;  2YHW A;  4FPA A;  3LP3 A;  5KPZ A;  3TAR A;  4X66 K;  2DY4 A;  3ZT4 A;  2WOM A;  1JLA A;  3E9O A;  1BGX T;  4FVM A;  2VG6 A;  4OKK A;  3LWM A;  3OS1 A;  4FK0 A;  2WON A;  4M7Y A;  5J2Q A;  3QBX A;  2NRR A;  4RW9 A;  2D1K A;  3KZB A;  3VOV A;  3ZT0 A;  2CGK A;  3ZX0 A;  2YCH A;  4NCB A;  4Y1C A;  1TKT A;  3QIC A;  4OLB A;  4F3O A;  4DF4 A;  1E3M A;  4FLW A;  3TAM A;  2DPN A;  4IKF A;  3BZC A;  1VQ9 N;  4JHD B;  2RPI A;  2XHB A;  1S1W A;  2G8F A;  1F21 A;  4RWT A;  3THW B;  3OA9 A;  4FLT A;  4NXM K;  1HKC A;  3LAM A;  2RE2 A;  3VQ8 A;  4CJ3 A;  4ELT A;  4DKW A;  1C0U A;  1YF5 L;  4Z94 A;  2F4V K;  4M3U A;  1NM1 A;  3J81 O;  4B9M A;  4PUO A;  4WQ5 C;  3VEO A;  3LAK A;  3O9S A;  2P9I A;  2XY8 A;  4O4G A;  5CHI A;  1ZXO A;  2UYT A;  3I8D A;  1VQ6 N;  4FK2 A;  2A40 A;  1WSG A;  1S1X A;  4JI4 K;  3K5L A;  4DFK A;  1D4X A;  4FJI A;  1Z25 A;  3MX2 A;  1MWM A;  4ISG A;  4E1N A;  2A41 A;  3AO4 A;  2F96 A;  1W9H A;  4YHH K;  1FJG K;  2GUI A;  3QEX A;  3AO1 A;  3ATU A;  1KFS A;  4MFB A;  2W42 A;  4IFE A;  3NVM A;  1NJZ A;  3OYE A;  2QKK A;  4ELV A;  4KHU A;  2A6A A;  1BL3 A;  4CIG A;  3D0P A;  1J6Z A;  3SAG A;  1L5U A;  5DM7 L;  4CJV A;  1C0F A;  3K59 A;  5AQV A;  3OW2 M;  4BGB A;  1SS6 A;  2NRV A;  4CFD A;  2P9L B;  3MWT A;  1N5Y A;  4XIU A;  4B3O A;  1I94 K;  3PLA A;  4C1N K;  3MMV A;  3CPE A;  1C0M A;  2IDO A;  2RN2 A;  4WQ4 C;  3C7N B;  3FLC O;  2VGM A;  1OH5 A;  1BQM A;  3SUQ A;  2XRI A;  4LH5 A;  1QSL A;  2ZWH A;  3EKS A;  3DLG A;  1XI1 A;  4DV3 K;  2UUC K;  3KLH A;  5F0X A;  2WC9 A;  3ZSR A;  2IVO A;  1KQS M;  3OYM A;  2HF3 A;  3CMA N;  2O8F A;  2DFE A;  3AVF A;  5ADX H;  4DU1 A;  4JKG B;  1TL1 A;  1BO5 O;  3CM6 A;  1IBL K;  4IOA L;  1KTQ A;  5AQJ A;  4J2D A;  5AZJ A;  4IXC A;  3SUO A;  3CCM N;  1LOT B;  2D4W A;  4BRE A;  4L3Q A;  3PSI A;  3OJU A;  2KLA A;  1S3X A;  4XH1 A;  3OTO K;  5FRM A;  4DR5 K;  3LDN A;  4KAZ A;  2YJE A;  1U49 A;  5FPE A;  4M7X A;  3T1Y K;  1S72 N;  3M5R A;  4BQL A;  4FM2 A;  1WSH A;  3TTD A;  4BR5 A;  1SL2 A;  1S6Q A;  3RR8 A;  1KAZ A;  1NWK A;  1N36 K;  3V1R A;  4KKO A;  3CCQ N;  3EE8 A;  4JKA A;  2QW9 A;  3UKR A;  4IOX A;  4FWN A;  3H6E A;  2IIR A;  3AVC A;  2HBJ A;  2NRW A;  3S3O A;  4B9S A;  4CK2 A;  1E4F T;  3ATV A;  3LZI A;  4BR2 A;  2UUB K;  3KLE A;  4NXN K;  1EX4 A;  2QWO A;  4B1Z A;  1U6Z A;  2A3Z A;  4PQU A;  1R0A A;  5AQI A;  4JKB A;  1CXQ A;  1XNR K;  4FJX A;  4BR0 A;  2J4R A;  3ENB A;  3EE9 A;  4Z4C A;  3AO5 A;  1T6D A;  4NCA A;  4N56 A;  4DWI A;  2O4I A;  1U2V B;  4CK3 A;  1UA1 A;  3I33 A;  2Q1N A;  1YHQ N;  4M3T A;  4CJ7 A;  4JN4 A;  3CG7 A;  4O44 A;  2E5L K;  4DV1 K;  1KSP A;  1X9S A;  2OZM A;  3IMX A;  2BGG A;  3RMA A;  4KTZ A;  2YHB A;  2FBT A;  4E1M A;  4DSI A;  1C0T A;  4B3R K;  4FWR A;  2D0P A;  4YOW A;  5HBM A;  2D5R A;  2NRZ A;  4IDH A;  2HVH A;  2YHX A;  4B3M K;  4H0V B;  1SV5 A;  3WEE B;  1TGO A;  4JRQ A;  3RRH A;  2GTD A;  5AQO A;  1KAX A;  4B8A B;  2E88 A;  4BGA A;  4AHV A;  3SPZ A;  1T44 A;  1JLE A;  1IBM K;  1S1T A;  1GOA A;  3HOT A;  4BAC A;  1RDD A;  1QZ6 A;  2I7P A;  3NBP A;  4WQ4 A;  1X3M A;  4NCG A;  2LSN A;  3U8X A;  3WXI A;  3ULD A;  2X6S A;  3AA5 X;  1BU6 O;  1DT9 A;  2F8S A;  3TSQ A;  3LP0 A;  4IO9 L;  1P90 A;  3QER A;  1Q81 O;  4K8X A;  3DRR A;  5GIO A;  4H5N A;  3WT0 A;  4ZTF A;  4B9T A;  3SUN A;  3HRG A;  5AQU A;  1WSI A;  5HRO A;  1WAF A;  2E2Q A;  5FRN A;  3L2W A;  3ID8 A;  3T69 A;  2XY7 A;  3NH1 A;  4L8R B;  3DLL L;  3VF4 A;  1HKB A;  5AQL A;  2P9S A;  4JI2 K;  4DLG A;  2OTJ N;  4H0X B;  3H1Q A;  5FPN A;  3A5O C;  2P9N A;  1JL1 A;  3V1Q A;  5AFU H;  4C8O A;  3LDS A;  2FBX A;  3MK6 A;  2PAV A;  3KJV A;  1W0H A;  3UE5 A;  3U3G A;  4DQI A;  1Q18 A;  1QVG M;  3KKS A;  4BWJ A;  4OKE A;  4LFA K;  3PV8 A;  2HBL A;  1JL2 A;  2QWM A;  1K8K B;  4JKD A;  3SUP A;  1J9A A;  4G1Q A;  1QSY A;  2QK9 A;  5AZI A;  4FWQ A;  3MDQ A;  1TKZ A;  5H1S Q;  4JK7 A;  3FZH A;  3CC7 N;  3A5L C;  3ZT3 A;  4B9V A;  4XEI A;  2GWK A;  3U4L A;  1EO1 A;  3TAF A;  2ASM A;  3F9M A;  4ISE A;  4YNQ A;  1UOC A;  5E41 A;  3HJF A;  3AAQ A;  3BF3 A;  3AA4 A;  5LY3 A;  3L2U A;  1U4B A;  4DSJ A;  1XQS C;  1Q9Y A;  4BRM A;  1EWR A;  3O9U A;  3AO2 A;  1YJN N;  1IJJ A;  2Q31 A;  4CF2 A;  2QA4 N;  4KH4 A;  3A8Y A;  1RBR A;  1NJW A;  2QTD A;  4BE2 A;  1NKE A;  2HST A;  4EAH D;  3CFO A;  1VQP N;  2V52 B;  2FC0 A;  4JV5 K;  4AF1 A;  4DR1 K;  2FF6 A;  3CC2 N;  3D2F B;  3R1X A;  3WNH A;  1ASV A;  3CPW M;  3CCU N;  3OYN A;  4DR2 K;  4DR4 K;  3SQ4 A;  5JLF A;  2G8K A;  4FJK A;  4FXD A;  5J1E A;  4HHT A;  1T6C A;  2UXC K;  1YJW N;  3HL8 A;  4DUY K;  2BAN A;  5AQS A;  4FO0 A;  5JLH A;  1NLV A;  3CHW A;  3SPY A;  2OPP A;  4JHD A;  5HRN A;  4KI4 A;  4IFV A;  4CJQ A;  1HRH A;  1VSM A;  3THW A;  1HKG A;  1BG3 A;  3CCL N;  1C1B A;  2WTU A;  2CH6 A;  4LSN A;  3K57 A;  3SQ1 A;  5ELZ A;  1RDC A;  3H46 O;  4CJE A;  1IO2 A;  4WF9 L;  4QOZ B;  2HHS A;  1QHT A;  2Q97 A;  3R3L A;  3RR7 A;  3VQA A;  4ZHR A;  3ZX3 A;  2X74 A;  4EP4 A;  2PYJ A;  4HTU A;  4CGG A;  4DSK A;  3KD1 E;  1X1P A;  4ELU A;  4ZTJ A;  1HJR A;  4YY3 K;  3VQE A;  3TAQ A;  2F8T A;  4FLU A;  2QWQ A;  4CJL A;  1GOB A;  1W97 L;  1VQN N;  3KWG A;  4DQP A;  1ZBS A;  4JI0 K;  3IAY A;  4Z4I A;  2PYL A;  3CCS N;  1IG9 A;  2YKM A;  1BCM A;  3DJC A;  3LP1 A;  5TKW A;  3KLG A;  3M8R A;  5HRP A;  2E2P A;  3PUF A;  3WXJ A;  3L8B A;  3OBW A;  4CCH A;  4KHP K;  1G99 A;  4DB3 A;  4DV4 K;  4JKH A;  1H1V A;  5F1X A;  5HOO A;  3C6T A;  4EZ6 A;  3J7Y P;  1BIS A;  3CM5 A;  3VN5 A;  2NNW A;  4EHT A;  1ASW A;  3PY8 A;  5AQY A;  4OGC A;  4YOY A;  4B9U A;  2Q2R A;  2QWR A;  2P9L A;  3VF2 A;  2V7Z A;  4K42 A;  5HRS A;  3IKM A;  3TI0 A;  3J7A P;  3J80 O;  4DV0 K;  3C7N A;  2E8A A;  4I2Q A;  4AHT A;  1NG9 A;  5C0Y A;  5BN9 A;  3DLB A;  4CZG A;  2OA8 A;  3BUZ B;  1Y97 A;  2HOE A;  4CF9 A;  3AA3 A;  1XC3 A;  2HBK A;  2GX9 A;  4JKG A;  4CD3 A;  3QFP A;  3HPH A;  4DS4 A;  3P4I A;  2IVN A;  1BHL A;  1L3V A;  4C8N A;  4A5B A;  4FOI A;  4BRH A;  4N41 A;  2GEL A;  3NF9 A;  4CES A;  1K9M O;  1N32 K;  5CR4 A;  3ENH A;  4B1Y B;  3A0I X;  3P31 A;  3CD6 N;  4KFB A;  3O9Q A;  2FSK A;  1TAU A;  3HOS A;  4DTM A;  1MU2 A;  3PIP L;  2O8B B;  4QS9 A;  3OJS A;  2ETJ A;  3I8B A;  3ZCM A;  1NKC A;  4H0O A;  4HTL A;  1GLL O;  1HNI A;  5LJV A;  4AM6 A;  4X64 K;  4CBU A;  2X78 A;  4FW2 A;  4B1V A;  3WXL A;  2A1R A;  1YTA A;  5BR9 A;  1NGG A;  4DFM A;  4CI6 A;  1XC9 A;  3VEX A;  4CHZ A;  4H4O A;  3CJ7 A;  5AQM A;  3DRS A;  3AO3 A;  4LH4 A;  3MXM A;  3SMS A;  4M3Y A;  1IKX A;  3I56 N;  3L2V A;  3VQP A;  3SBT A;  5EXW A;  4JYA K;  4F2R A;  4FZY A;  3HST B;  4WCE L;  4PL7 A;  2IOC A;  3VEW A;  4CZH A;  4OO1 J;  4O5B A;  1RT1 A;  3OVN A;  2OZS A;  1QQO A;  4QAG A;  1U2V A;  2Z1G A;  2E2O A;  2YX6 A;  4KTQ A;  1RTH A;  3D7E O;  1RBU A;  1TUY A;  4KHY A;  3F73 A;  3WXM B;  3OYD A;  1NGI A;  3AVG A;  1U48 A;  1T03 A;  3B8A X;  3IUC A;  3SLC A;  1IBK K;  3FR0 A;  4I7F A;  1QS4 A;  4B08 A;  2OPQ A;  3AVL A;  4UQG A;  4ILJ A;  1KLN A;  3KK7 A;  4CIF A;  4CHO A;  2Y1I A;  4B9L A;  4HUF A;  4B9N A;  1CZ9 A;  1BOT O;  3ISN C;  3NAE A;  3VF6 A;  2FLO A;  1R59 O;  4Q0B A;  1N34 K;  4GVE A;  2IS3 A;  2UXD K;  3WEE A;  1YVN A;  2D0C A;  3FGU A;  3MN5 A;  3QFU A;  4CGI A;  1RBV A;  1U47 A;  3LDL A;  5M1N A;  5AQF A;  5ADX A;  4WFB L;  4BE1 A;  4MDA A;  4CEB A;  4KH5 A;  4E3S A;  2A42 A;  1QSS A;  5TKY A;  2FSJ A;  4A59 A;  3V81 A;  4M3W A;  4M41 A;  5GAG P;  3AVK A;  3T1A A;  1CZA N;  1RT6 A;  3TAN A;  5M1O A;  1LWC A;  4KH6 A;  5BRF A;  1HQE A;  3QIN A;  5J2N A;  2WBN A;  3H08 A;  3TWH A;  4Q5V A;  2NZT A;  4CZK A;  2HW3 A;  2NRT A;  3PX0 A;  3UKU B;  4QCL A;  5KGW A;  3SAF A;  1B9D A;  4PL8 A;  5E26 A;  3RRG A;  1HNW K;  4IOC L;  2VGN A;  2G8I A;  2YNG A;  2W40 A;  4KRE A;  3DLR A;  3OYA A;  4E19 A;  4H5R A;  2VQF K;  3WQT A;  1RT7 A;  4C23 A;  3BP8 A;  1WBB A;  4MDB A;  1VQO N;  3IFR A;  3VET A;  1RDU A;  5AQR A;  1HYS A;  3K5O A;  3KK1 A;  5GIN A;  4N47 A;  5C15 A;  4Z4H A;  1YT3 A;  3J7Z O;  4ID1 A;  3SYZ A;  3E1Y A;  4A61 A;  3OY9 A;  2W41 A;  4JK9 A;  4F4K A;  1YTU A;  4BC3 A;  4O5F A;  4KV8 A;  5GAD P;  3OYJ A;  1VQ7 N;  2P9P B;  5JVG L;  4PA1 A;  4IEE A;  5KI6 A;  3NCI A;  3SJH A;  1VQM N;  4CEC A;  4FLX A;  5KQ8 A;  3CJ1 A;  5M1Q A;  3VA0 A;  2FBV A;  1YJ9 N;  1A5W A;  1QVF M;  3TTF A;  1K8K A;  4W5O A;  4IG3 A;  4IO8 A;  1NK4 A;  4BDP A;  4JKF A;  1OVY A;  2W6L A;  4RW6 A;  3U9Z A;  5SZT A;  1KD1 O;  1RBS A;  3QEP A;  4FZZ A;  1VQK N;  3DLH A;  1W7A A;  3QES A;  2GEM A;  2E4L A;  2OAN A;  1TL3 A;  4FWS A;  2Y1J A;  4B3T K;  5I3U A;  2O8C A;  2O4G A;  1J5E K;  1ZC6 A;  3IRX A;  4CF0 A;  4KHS A;  3U6F A;  2PFU A;  4C8M A;  4WFA L;  3NVK A;  2E6L A;  3ZX2 A;  1G15 A;  3SJJ A;  4Y1D A;  3OYF A;  3TSU A;  2JWL A;  3L2R A;  3EYZ A;  1NK8 A;  4GKK K;  4KO0 A;  4WFN L;  1T3V A;  4E7H A;  3HM8 A;  2WUS A;  3D2F A;  4RTF D;  4JKC A;  4EFH A;  3H1V X;  2JWK A;  1NOZ A;  1IV0 A;  4FWP A;  1JLG A;  5GAE P;  3OYB A;  4CGF A;  1HYV A;  3LDO A;  1RT3 A;  4H0Y B;  4CEQ A;  1S6P A;  4CHY A;  2DTU A;  2KFN A;  4YDU C;  4CJT A;  4DTR A;  2O8E B;  4DFJ A;  3V9Z A;  2HMI A;  1MDU B;  3G10 A;  3H3O B;  2VG5 A;  1B9F A;  4MO4 A;  2Z1J A;  5FPD A;  1HLU A;  4IG0 A;  4BG9 A;  3JAM O;  3DAW A;  3MN6 A;  5BRD A;  2YV0 X;  3R6M A;  2HHQ A;  2AA4 A;  3WXK A;  3T19 A;  3O8M A;  4DU3 A;  1Q8I A;  3QML A;  2I5J A;  2KHO A;  3IDH A;  3V4I A;  5AFU A;  2G8W A;  4MLE A;  2HND A;  4FM0 A;  4PY5 A;  4H0T B;  4BWM A;  3VTI A;  2IGI A;  1HX1 A;  4JI1 K;  2PZS A;  4FM1 A;  3G0Z A;  3L6Q A;  5LMU K;  2ASP A;  1LAV A;  2V51 B;  1NGA A;  1P8Z A;  3DOL A;  4A5A A;  1JLC A;  4CK1 A;  4FJ5 A;  2P5O A;  2ZQB A;  2XO7 A;  1NGC A;  4DFP A;  2Q0R A;  3E01 A;  1C1A A;  3SQ2 A;  5AQZ A;  2QXF A;  3L3U A;  4O55 A;  4O8U A;  2HHX A;  3HBT A;  2OYQ A;  3OYG A;  2VWK A;  3MWP A;  4KB0 A;  3PX4 A;  4FWL A;  3CME N;  4CBW A;  4I2P A;  4CGD A;  4CZM A;  4FJM A;  4LD0 A;  3F9K A;  4FJH A;  2OPS A;  3ITH A;  1WOQ A;  3IS9 A;  1K8A O;  5BPL A;  4IEI A;  1NNE A;  4OGE A;  1RT5 A;  3SBG A;  2IAJ A;  1BA1 A;  4BDZ A;  1NKB A;  3K2P A;  3HSC A;  4JD2 B;  3S3M A;  2GWJ A;  5C24 A;  3JS6 A;  5M1F A;  1XWL A;  1O1W A;  3AAR A;  4MLH A;  4DU4 A;  1HPM A;  1WSF A;  4DTP A;  1V4S A;  4LF7 K;  1ZBH A;  1LCU A;  3VTH A;  4FJN A;  5JS2 A;  4H8K A;  3OS0 A;  4CJR A;  3M8S A;  2BH1 A;  3ZSQ A;  3M8Q A;  3S9H A;  4BRP A;  1LAW A;  4HWI A;  3VMF B;  4CHQ A;  1WN7 A;  4E7I A;  5KTQ A;  3CJB A;  3P83 D;  4BR9 A;  3K58 A;  1DKG D;  1TK5 A;  3J8A A;  4JNE A;  5T7B A;  1KXP A;  2EHG A;  1BIU A;  2F9W A;  4BRF A;  5GAH P;  5AQG A;  2ZJR L;  4KBO A;  3AGR A;  1MA9 B;  4BRL A;  4AH9 A;  3VQ6 A;  2O8B A;  4DTX A;  3SCX A;  1FKO A;  1RT4 A;  1SZ2 A;  1M1K O;  3KWI A;  4B8C A;  1KFD A;  4RG8 A;  3CFP A;  1WBD A;  1GOC A;  3W3D A;  4LF8 K;  3PO5 A;  1T8E A;  3WNG A;  1Q9X A;  4YDU A;  2H3G X;  3D2E B;  1FW6 A;  4BQZ A;  5C2F A;  4DV6 K;  3ZYY X;  1OVQ A;  5BR8 K;  3B6O A;  5E84 A;  3VQ4 A;  3K9K A;  2HHU A;  1DTQ A;  3AVI A;  3TR8 A;  4GV3 A;  1GLD G;  2O8C B;  1JCE A;  3OYK A;  5JVH L;  3I0S A;  3U9D A;  3VQD A;  2HNY A;  2P9U B;  4FWK A;  4RW7 A;  1XUP O;  4F3T A;  4Y0W A;  4K43 A;  4CEZ A;  3KK3 A;  4F9O A;  4OKJ A;  1TAQ A;  3SMP A;  1ZBF A;  3RTV A;  1UA0 A;  1WB9 A;  3LM2 A;  3GOI A;  3AGK A;  4BC5 A;  1VSE A;  2ZJP L;  1KVB A;  4FPB A;  4LFC K;  3KTQ A;  4GW6 A;  3JYT A;  4JI5 K;  1KCF A;  4LF6 K;  4HVJ A;  3JXU A;  4OJR A;  5EU7 A;  2B5J A;  4JI7 K;  2YNI A;  3C6H A;  3ZET B;  3TAB A;  1C0G A;  4OVL A;  1NJX A;  1NU0 A;  3NE6 A;  5BPN A;  2F9T A;  3RMB A;  5MLC Q;  3ZSV A;  4O8K A;  4OLA A;  1TKD A;  3WQU A;  3P39 A;  3HT3 A;  4M3R A;  2XY6 A;  1NGE A;  4IJN A;  4IZ9 A;  3SZ2 A;  4YOT A;  3Q7C A;  1YIT N;  2E1Y A;  3E9P A;  3I0R A;  3VA3 A;  4JS4 A;  3TTC A;  4EZ9 A;  2BUP A;  3LDP A;  1RDA A;  3A5N C;  4PKH A;  1I39 A;  3KHY A;  2OTL N;  4O0J A;  3HK2 A;  3HM9 A;  2RKI A;  3VER A;  2ZF5 O;  3DXK A;  4W5Q A;  4FJ9 A;  4FJG A;  2JLE A;  3G25 A;  1S5J A;  3C6A A;  1ATS A;  1BI4 B;  4U7B A;  3B6P A;  4FSV A;  5DM6 L;  1QZ5 A;  1QQM A;  1NK0 A;  2A1S A;  5KPT A;  3O80 A;  1HNZ K;  4X65 K;  1QQC A;  3O3H A;  4AIL C;  4JI6 K;  3DLK A;  3UKU A;  4KHN A;  1S1U A;  3KK2 A;  4BRO A;  4DQS A;  2KZZ A;  4BG8 A;  3NF6 A;  3AVA A;  3RVC A;  4JEP A;  4NLB A;  2E20 A;  1EWQ A;  3C65 A;  3PIO L;  1RTD A;  3P1G A;  3E66 A;  2FF3 B;  2P51 A;  4CEE A;  4DV7 K;  3EY1 A;  3VEV A;  4FLY A;  4DSE A;  2IVP A;  3VES A;  3SV3 A;  4JLH A;  4JI3 K;  3VGM A;  5AR0 A;  3ASM A;  3G71 N;  2VWJ A;  1J5O A;  4Z4F A;  2QEX N;  3PO4 A;  4RW4 A;  2QWP A;  2P9P A;  3DI6 A;  1OH7 A;  1JKH A;  5KGX A;  4LF5 K;  1OH6 A;  4ID5 A;  1XHX A;  3SK3 A;  1TKX A;  3FZF A;  2E1Z A;  3OYH A;  3CFR A;  3AVJ A;  4DSF A;  4E7K A;  5EVZ A;  3VQB A;  4TSX A;  4CEF A;  2D0O A;  3LDQ A;  1SQK A;  1VK0 A;  4H03 B;  3QNO A;  4Z4G A;  1L3U A;  4DV2 K;  3NDK A;  3EO3 A;  4C8K A;  2HHW A;  3E9L A;  4LSL A;  4H5T A;  3IG1 A;  2KTQ A;  5FLX O;  2ZGZ A;  3O4W A;  3PSF A;  1DLO A;  3HVT A;  4CZJ A;  1S9G A;  3M1F A;  4K25 A;  2OCE A;  5AQX A;  3TU5 A;  1SKW A;  4GMJ B;  1VQL N;  3ZLJ A;  1UWB A;  3LWL A;  1ILY A;  5LL6 Z;  3MED A;  4BRQ A;  4YOV A;  3A2F A;  3CQY A;  3C95 A;  1A5V A;  4FW1 A;  4FCY A;  3NHG A;  3CER A;  4DSL A;  3HPO A;  5AQN A;  1IKW A;  1ATN A;  3VEN A;  4CHP A;  1MWK A;  4J2B A;  4FYD A;  4A57 A;  3G4S N;  2B6A A;  4DG1 A;  3O9R A;  3MXI A;  4HUE A;  3ZEU B;  4BY9 C;  5DMR A;  4U67 L;  3CQ8 A;  3O08 A;  3SQ0 A;  3RSE B;  4DQ8 A;  1SL0 A;  5LMN K;  3O9T A;  4B9Q A;  4YOR A;  4FWO A;  2NUB A;  4NO7 A;  4FJJ A;  3OBY A;  1GLJ O;  2O8E A;  1VSH A;  3MXJ A;  3T7Z A;  4BRG A;  5J2M A;  4H4M A;  4K8Z A;  2HVI A;  3BZK A;  3CI5 A;  3ID6 A;  4CIE A;  4CFB A;  3DM2 A;  2YNF A;  4CGH A;  4BRK A;  3R8E A;  1ZYQ A;  2BE2 A;  4KHQ A;  4CJ4 A;  4B1U B;  3MAQ A;  1KAY A;  2YNH A;  4IFY A;  1VQ4 N;  2X6N A;  2FSN A;  1RDB A;  3O3G A;  1K6Y A;  2Q3S A;  4B1X B;  5KRT A;  3HP6 A;  2UUA K;  1ZBU A;  3LPU A;  4OPH A;  5F2R A;  1C1C A;  3T3F A;  1I3A A;  4LY7 A;  3FZL A;  2GBZ A;  3OYL A;  1RNH A;  3K5M A;  1RCH A;  3V9S A;  3CCR N;  2AP1 A;  3DLE A;  1Z6R A;  1YVU A;  1HNV A;  2ZGY A;  3WUH A;  5CE3 A;  2HHH K;  3Q7B A;  3HVR A;  1SL1 A;  4F8R A;  3C6U A;  4I6M A;  4CBX A;  3NGZ A;  1SUQ A;  3MN7 A;  1HR0 K;  5AQK A;  3THY A;  1Z26 A;  4M42 A;  4AM7 A;  1Q7Y O;  3DXK B;  4KRF A;  1NOY A;  3LAN A;  3NGI A;  4R5P A;  4CEA A;  4KTW A;  3THX B;  1BIZ A;  5KQD A;  4NYN A;  1NGH A;  1BDG A;  3V9W A;  4FJ7 A;  4J8F A;  5JIC A;  3QEV A;  4NB4 A;  3K5N A;  1JLF A;  4W5T A;  1ATR A;  3MCP A;  3NGY A;  4JD2 A;  4M45 A;  3S3N A;  2KFZ A;  2I7N A;  2ZD1 A;  2KZM A;  2A5X A;  3VQ9 A;  3CCE N;  5JS1 A;  4YOX A;  1VSF A;  5CZ1 A;  4FVU A;  4E0D A;  4GY2 B;  3LPT A;  5AQW A;  3ULE B;  3VQC A;  1VQ8 N;  2KW4 A;  1WLJ A;  3GBT A;  2WFB A;  3VGL A;  4GV6 A;  1RDW X;  5BRH A;  3NH2 A;  3ENO A;  1UAX A;  3RMC A;  5CY4 A;  3F2K A;  1XMO K;  2F7T A;  4BE0 A;  1EXQ A;  3DMJ A;  1S22 A;  2PBD A;  3VQ5 A;  1Y64 A;  3TPQ A;  1ITG A;  3I55 N;  4JK8 A;  4CJU A;  1DEJ A;  1XHZ A;  4CZI A;  5BN8 A;  3L3V A;  3DYA A;  4LF4 K;  2FXU A;  1LV5 A;  2EX3 A;  4H5W A;  1O13 A;  3BY5 A;  4CJS A;  5C2D A;  1D9D A;  4E1J A;  2KKZ A;  3OYI A;  1J53 A;  1KC8 O;  4KPY A;  3EKU A;  3UB5 A;  1V4T A;  3D2E A;  4ILH A;  2NLX A;  5BPM A;  4BRA A;  1RIL A;  1FK9 A;  3VEZ A;  5HL7 L;  2EWS A;  3GG4 A;  2CH5 A;  3L4Q A;  3VQ7 A;  2P9U A;  3O1W A;  3CET A;  1RTI A;  4FOE A;  3D45 A;  3VEY A;  1TYQ B;  1SKR A;  4JI8 K;  4R79 A;  1D9F A;  4CFA A;  3KD5 E;  1HYZ A;  5HP1 A;  1Z05 A;  3O6W A;  3LAL A;  4ICL A;  4CEO A;  1VHX A;  1KVC A;  2FBY A;  1X9M A;  4DF8 A;  3CJ9 A;  4OX9 K;  2UU9 K;  5B8H A;  4GNI A;  3JSM A;  3C94 A;  3O5B A;  1B92 A;  2JGU A;  4DTJ A;  2BTF A;  5C25 A;  3OHR A;  1LWF A;  4N76 A;  4BC4 A;  1DGK N;  3EL2 A;  3GDQ A;  3QB0 A;  3CC4 N;  2PY5 A;  1GLE G;  5AQQ A;  3MEC A;  5FRO A;  1CZB A;  3CCJ N;  3ZET A;  2VWB A;  4EP5 A;  4CJP A;  3KLF A;  4EHU A;  4CW7 B;  3BEX A;  3V9U A;  2GV9 A;  1M90 O;  2ZJQ L;  5I42 A;  3DXM B;  2P9K A;  2O8D B;  1YAG A;  4M3Z A;  3L4I A;  2W6K A;  3BDP A;  1WAJ A;  1VSL A;  3S41 A;  5IT9 O;  4IJA A;  4PWD A;  2D0B A;  1CXU A;  2HMP A;  5C10 A;  4DHY A;  2ZE2 A;  2ASO A;  2ITG A;  4J2E A;  5AQT A;  5FDL A;  5M1K A;  3EN9 A;  1NGJ A;  4RW8 A;  4KHW A;  3AA2 A;  3MCA B;  1C6V A;  1HPZ A;  3DRP A;  4YOU A;  3NH0 A;  1HJO A;  2ATQ A;  4O0I A;  4CJW A;  4WQ5 A;  1BI4 A;  5JMV A;  1SAZ A;  1LW2 A;  4X62 K;  1ZBI A;  3DOK A;  3CF5 L;  5LJW A;  2IC3 A;  3CQX A;  5AQP A;  1KRP A;  4DQR A;  4XH4 A;  1EP4 A;  3AVH A;  4CF1 A; 
#chains in the Genus database with same CATH homology
 3QEX A;  3AO1 A;  3JYT A;  1KFS A;  4MFB A;  1KCF A;  4KFB A;  4HVJ A;  4OJR A;  2W42 A;  1NK7 A;  1TAU A;  5EU7 A;  1NJZ A;  5DK5 A;  1VRT A;  2B5J A;  3ZSW A;  4DTM A;  4DTN A;  3OYE A;  2QKK A;  2YNI A;  1MU2 A;  4ELV A;  3TAB A;  1EKE A;  3OJS A;  2ETJ A;  4KHU A;  4OVL A;  1NJX A;  3ZCM A;  1BL3 A;  3TAP A;  3NE6 A;  3RMB A;  3SNN A;  3ZSV A;  4OLA A;  2BDP A;  1NK5 A;  1NKC A;  1TKD A;  4CIG A;  3HT3 A;  3D0P A;  4M3R A;  2XY6 A;  1L5U A;  1LW0 A;  4CJV A;  3SZ2 A;  3K59 A;  1HNI A;  1LWE A;  3NF8 A;  4CFD A;  2X78 A;  4FW2 A;  3QEW A;  1N5Y A;  4XIU A;  3FFI A;  3I0R A;  2A1R A;  4B3O A;  3VA3 A;  1J54 A;  1YTA A;  4OPK A;  4JS4 A;  4AHU A;  1QTM A;  4EZ9 A;  4DFM A;  1RDA A;  1C0M A;  1VRU A;  2IDO A;  1I39 A;  2RN2 A;  1BQM A;  3SUQ A;  1XC9 A;  2XRI A;  4CHN A;  4LH5 A;  4CHZ A;  1QSL A;  4H4O A;  1RT2 A;  4O0J A;  3DRS A;  3DLG A;  3HM9 A;  1XI1 A;  3HK2 A;  2RKI A;  3KLH A;  4W5Q A;  4CFC A;  4FJG A;  3AO3 A;  3O4N A;  4LH4 A;  3MXM A;  4FJ9 A;  4M3Y A;  1QE1 A;  1IKX A;  3QIP A;  2JLE A;  3ZSR A;  1S5J A;  3OYM A;  1BI4 B;  3V1O A;  3L2V A;  3VQP A;  2DFE A;  3B6P A;  4IDK A;  1TV6 A;  3AVF A;  4DU1 A;  1TL1 A;  3CM6 A;  4F2R A;  1NK0 A;  2A1S A;  2XY5 A;  1IH7 A;  1KTQ A;  4FZY A;  3HST B;  4J2D A;  2DFF A;  2IOC A;  3SV4 A;  1X9W A;  4O5B A;  3SUO A;  1RT1 A;  1QQC A;  3O3H A;  4AIL C;  3DLK A;  3OVN A;  2OZS A;  3ZT1 A;  4QAG A;  4F2S A;  4KHN A;  1S1U A;  2Z1G A;  4CE9 A;  4KTQ A;  3KK2 A;  3ZSZ A;  4HCC A;  4NYF A;  1RTH A;  3OJU A;  1RBU A;  4DQS A;  4KHY A;  5FRM A;  1ASU A;  3F73 A;  4KAZ A;  2KZZ A;  1U49 A;  1VSJ A;  3QNN A;  4DS5 A;  3NF6 A;  3AVA A;  3OYD A;  1U45 A;  3AVG A;  1U48 A;  1T03 A;  4YFU A;  3QLH A;  4AHR A;  4FM2 A;  4E7L A;  3AV9 A;  4I7F A;  3V9X A;  1QS4 A;  4B08 A;  1WSH A;  2OPQ A;  3AVL A;  1T05 A;  4UQG A;  1SL2 A;  1KLN A;  1S6Q A;  3RR8 A;  4FLV A;  4FJ8 A;  1RTD A;  4CIF A;  4CHO A;  4E7J A;  2Y1I A;  4B9L A;  3P1G A;  4HUF A;  1HMV A;  2P51 A;  3V1R A;  4CEE A;  1CZ9 A;  3EY1 A;  4B9N A;  5D3G A;  1BQN A;  3ISN C;  3NAE A;  4KKO A;  4FLY A;  4DSE A;  1VSK A;  3SV3 A;  4Q0B A;  3ZSY A;  4JLH A;  2IS3 A;  2VG7 A;  4AHC A;  4HCB A;  1JXB A;  2D0C A;  3AVC A;  4CGI A;  1RBV A;  3ASM A;  1U47 A;  3BGR A;  1N6Q A;  2VWJ A;  1J5O A;  3S3O A;  4BE1 A;  4B9S A;  4Z4F A;  4CEB A;  4CK2 A;  4E3S A;  4RW4 A;  3PO4 A;  1QSS A;  3DI6 A;  1JKH A;  3HYF A;  5KGX A;  3TAG A;  4ID5 A;  1HQU A;  1XHX A;  4FK4 A;  3V81 A;  3LZI A;  4M3W A;  1TKX A;  4M41 A;  3KLE A;  1VSI A;  1EX4 A;  3AVK A;  3T1A A;  2HB5 A;  5HLF A;  4I9L A;  1RT6 A;  3KIO A;  3TAN A;  1DTT A;  1LWC A;  4PQU A;  3OYH A;  3HP9 A;  3AVJ A;  3CFR A;  1R0A A;  4DSF A;  4E7K A;  3VQB A;  4TSX A;  4CEF A;  1CXQ A;  1HQE A;  5K14 A;  3QIN A;  5J2N A;  4FJX A;  3KLI A;  1VK0 A;  4BDY A;  3H08 A;  3TWH A;  4Q5V A;  3QNO A;  4Z4G A;  4Z4C A;  1L3U A;  2HW3 A;  3AO5 A;  3PX0 A;  1QSY A;  3MEE A;  4NCA A;  2HNZ A;  2QK9 A;  4N56 A;  4QCL A;  4DWI A;  3NDK A;  2O4I A;  4C8K A;  5KGW A;  1WSJ A;  1B9D A;  4LSL A;  4J2A A;  2HHW A;  3IG1 A;  4CK3 A;  1UA1 A;  3RRG A;  2KTQ A;  3V6D A;  4C8L A;  2G8I A;  2YNG A;  3HPG A;  4KRE A;  4M3T A;  4CGJ A;  1DLO A;  3DLR A;  3OYA A;  3WNE A;  3HVT A;  4E19 A;  1S9G A;  4DQQ A;  3CG7 A;  1TK8 A;  2QKB A;  4O44 A;  1SKS A;  1SKW A;  4DTO A;  4GMJ B;  4KI6 A;  1KSP A;  1A5X A;  1RT7 A;  1X9S A;  1T7P A;  5SWM A;  2OZM A;  1UWB A;  4E89 A;  3LWL A;  2BGG A;  3AVM A;  4KTZ A;  2YHB A;  4CJK A;  3MED A;  3PX6 A;  2FBT A;  3RMA A;  1D8Y A;  4E1M A;  1HYS A;  3EZ5 A;  4DSI A;  3A2F A;  3K5O A;  3C95 A;  3KK1 A;  1A5V A;  1C0T A;  4N47 A;  1S9E A;  4FW1 A;  4FCY A;  4Z4H A;  1YT3 A;  3NHG A;  4DSL A;  4ID1 A;  4HUG A;  5HBM A;  2D5R A;  4N5S A;  3SYZ A;  2HVH A;  1VSD A;  3HPO A;  1SV5 A;  3OY9 A;  2KQ2 A;  1TGO A;  2RF2 A;  4JRQ A;  1L3S A;  1IKW A;  3RRH A;  4F4K A;  1YTU A;  3HXM A;  4CHP A;  3L2Q A;  4FJL A;  4J2B A;  3P5J A;  4FYD A;  4KV8 A;  2B6A A;  4DG1 A;  3OYJ A;  3MXI A;  4HUE A;  4B8A B;  4PA1 A;  3QEI A;  5DMR A;  1L3T A;  3CQ8 A;  3SQ0 A;  2DFH A;  5KI6 A;  4AHV A;  3SPZ A;  1NK9 A;  3NCI A;  1JLE A;  1SL0 A;  1S1T A;  4CEC A;  4FLX A;  1IKV A;  5J2P A;  5CYQ A;  3VA0 A;  2FBV A;  2P5G A;  2HHV A;  1GOA A;  1A5W A;  4BAC A;  1RDD A;  1RTJ A;  3MEG A;  1ZBL A;  4W5O A;  4IG3 A;  1NK4 A;  3WNF A;  4BDP A;  3NBP A;  2NUB A;  4NCG A;  2LSN A;  3ULD A;  4FJJ A;  4RW6 A;  5SZT A;  1VSH A;  2X6S A;  1RBS A;  3AA5 X;  3MXJ A;  3QEP A;  4FZZ A;  3THV A;  2F8S A;  5J2M A;  3DLH A;  4CF8 A;  4H4M A;  4K8Z A;  3QES A;  2HVI A;  4AHS A;  4DTS A;  3LP0 A;  3QER A;  2E4L A;  4CIE A;  4CFB A;  3DM2 A;  2YNF A;  4CGH A;  4K8X A;  3NF7 A;  4Z4E A;  1TL3 A;  3DRR A;  2Y1J A;  3KKR A;  1WSE A;  4GVM A;  2BE2 A;  1ZYQ A;  5I3U A;  4KHQ A;  4CJ4 A;  4ZTF A;  4B9T A;  2O4G A;  3MAQ A;  2YNH A;  3IRX A;  4IFY A;  3SUN A;  3LZJ A;  4CF0 A;  1WSI A;  4W5N A;  4KHS A;  2R7Y A;  3U6F A;  5HRO A;  1WAF A;  2X6N A;  4C8M A;  5FRN A;  2E6L A;  3L2W A;  2P1J A;  1RDB A;  2XY7 A;  3O3G A;  2G8U A;  3HO1 A;  1G15 A;  1K6Y A;  3NH1 A;  2Q3S A;  3SJJ A;  4L8R B;  4Y1D A;  5KRT A;  4JRP A;  3ALY A;  3OYF A;  3HP6 A;  1ZBU A;  2B4J A;  3LPU A;  4DLG A;  1C1C A;  3L2R A;  3EYZ A;  3T3F A;  1I3A A;  1NK8 A;  4KO0 A;  4MQ3 A;  2E6M A;  4LY7 A;  4E7H A;  4CED A;  2GBZ A;  1KLM A;  5C42 A;  1TVR A;  3OYL A;  4CJF A;  1NJY A;  1JL1 A;  1RNH A;  3V1Q A;  4C8O A;  3K5M A;  3LDS A;  1NOZ A;  1RCH A;  2FBX A;  3V9S A;  3QET A;  3ZT2 A;  1JLG A;  3DLE A;  1BCO A;  1YVU A;  3OYB A;  1HNV A;  4CGF A;  3KJV A;  4KB1 A;  1HYV A;  3HVR A;  1SL1 A;  4F8R A;  3C6U A;  1W0H A;  3NGZ A;  3U3G A;  4M3X A;  1TK0 A;  4DQI A;  1REV A;  1RT3 A;  1SUQ A;  3KKS A;  4BWJ A;  4CEQ A;  4OKE A;  1Z26 A;  4M42 A;  1S6P A;  4Z0U A;  4CHY A;  3PV8 A;  4KRF A;  2KFN A;  2DTU A;  1JL2 A;  1NOY A;  3LAN A;  4CJT A;  4DTR A;  3NGI A;  3SUP A;  4FZX C;  4R5P A;  1J9A A;  1S1V A;  3AVB A;  4G1Q A;  4KTW A;  4CEA A;  1BIZ A;  3V9Z A;  4DFJ A;  1WNS A;  4GW6 A;  4NYN A;  4I9Q A;  1TKZ A;  3V9W A;  4FJ7 A;  4WE1 A;  2HMI A;  3G10 A;  3M8P A;  4JS5 A;  3ZT3 A;  3QEV A;  2VG5 A;  1B9F A;  4B9V A;  3RMD A;  2Z1J A;  3ZSX A;  3K5N A;  4IG0 A;  2G8H A;  1JLF A;  4W5T A;  3TAF A;  3NGY A;  4M45 A;  3S3N A;  2YV0 X;  2KFZ A;  1EET A;  2HHQ A;  4CJ5 A;  4YNQ A;  1UOC A;  2ZD1 A;  3LP2 A;  3T19 A;  5E41 A;  4DU3 A;  3OYC A;  3HJF A;  2Z1H A;  2KZM A;  5KRS A;  1IKY A;  3VQ9 A;  1NK6 A;  5JS1 A;  1Q8I A;  3AA4 A;  3L2U A;  1U4B A;  2I5J A;  1VSF A;  4DTU A;  3AVN A;  5CZ1 A;  4DSJ A;  1Q9Y A;  3V4I A;  4CER A;  3AO2 A;  2G8W A;  4E0D A;  3NFA A;  2HND A;  3LPT A;  4CF2 A;  2G8V A;  3VQC A;  4FM0 A;  4PY5 A;  4BWM A;  3ZSO A;  1RBR A;  2IGI A;  1NJW A;  2KW4 A;  1WLJ A;  2PZS A;  4BE2 A;  4FM1 A;  1NKE A;  3UIQ A;  2AJQ A;  3G0Z A;  3CFO A;  2FC0 A;  1LAV A;  3NH2 A;  3DOL A;  4FJ5 A;  1JLC A;  4CK1 A;  2P5O A;  4DMN A;  1UAX A;  2ZQB A;  2XO7 A;  5CY4 A;  3RMC A;  3WNH A;  4OPJ A;  1ASV A;  3OYN A;  4DFP A;  4BE0 A;  1JXE A;  3E01 A;  1EXQ A;  3SQ4 A;  3DMJ A;  1C1A A;  2YHA A;  2G8K A;  4W5R A;  3SQ2 A;  3VQ5 A;  4FJK A;  4FXD A;  3QIO A;  4IBN A;  5J1E A;  2QXF A;  4DLE A;  1U04 A;  1FXX A;  3L3U A;  4HHT A;  3O4Q A;  4O55 A;  3O3F A;  3HL8 A;  5CZ2 A;  4FLZ A;  2HHX A;  2OYQ A;  2BAN A;  1ITG A;  3OYG A;  2Z1I A;  2VWK A;  1KVA A;  4CJU A;  1XHZ A;  3L3V A;  3DYA A;  4KB0 A;  3SPY A;  2OPP A;  3PX4 A;  1JLQ A;  1RBT A;  5HRR A;  5HRN A;  4KI4 A;  3OS2 A;  1LV5 A;  4IFV A;  3SI6 A;  2EX3 A;  4I2P A;  4CGD A;  4CJQ A;  1HRH A;  1VSM A;  2D0A A;  1FKP A;  2OPR A;  4FJM A;  4LD0 A;  3F9K A;  4FJH A;  2OPS A;  3ITH A;  3IS9 A;  4CJS A;  1D9D A;  3OYI A;  1C1B A;  4OGE A;  1J53 A;  1RT5 A;  4LSN A;  2IAJ A;  3QO9 A;  4KPY A;  4BDZ A;  1NKB A;  3K2P A;  3K57 A;  3U3Y A;  3SQ1 A;  3S3M A;  5C24 A;  1RDC A;  3TAE A;  1XWL A;  4CJE A;  1IO2 A;  1D5A A;  1O1W A;  2YKN A;  5CYM A;  4DU4 A;  1RIL A;  1FK9 A;  3RWU A;  1WSF A;  4QOZ B;  1JLB A;  4DTP A;  2HHS A;  1QHT A;  3CYM A;  3RR7 A;  3VQA A;  3VQQ A;  1ZBH A;  4ZHR A;  1CLQ A;  3LP3 A;  3TAR A;  4FJN A;  2X74 A;  4EP4 A;  2DY4 A;  5JS2 A;  3VQ7 A;  2PYJ A;  4H8K A;  4HTU A;  3ZT4 A;  4CGG A;  3OS0 A;  2WOM A;  1JLA A;  1RTI A;  1X1P A;  4DSK A;  4CJR A;  3KD1 E;  4ZTJ A;  4ELU A;  3D45 A;  1HJR A;  3M8S A;  1BGX T;  4FVM A;  3VQE A;  1SKR A;  2VG6 A;  3ZSQ A;  3TAQ A;  2F8T A;  3M8Q A;  4OKK A;  3S9H A;  3KD5 E;  1D9F A;  4CFA A;  1LAW A;  1HYZ A;  5HP1 A;  3LWM A;  4FLU A;  4CJL A;  3LAL A;  2WON A;  1GOB A;  1WN7 A;  4ICL A;  4CEO A;  4CHQ A;  3OS1 A;  1KVC A;  5J2Q A;  4DQP A;  4E7I A;  5KTQ A;  2FBY A;  4RW9 A;  1X9M A;  3P83 D;  4DF8 A;  3IAY A;  4Z4I A;  3K58 A;  3ZT0 A;  2PYL A;  3JSM A;  3C94 A;  1B92 A;  2JGU A;  4DTJ A;  1TK5 A;  1IG9 A;  4NCB A;  4Y1C A;  1TKT A;  5T7B A;  2YKM A;  1BCM A;  3LP1 A;  5C25 A;  4F3O A;  4OLB A;  2EHG A;  4DF4 A;  1LWF A;  1BIU A;  4N76 A;  3KLG A;  3M8R A;  5HRP A;  3PUF A;  3L8B A;  4FLW A;  2PY5 A;  4CCH A;  3MEC A;  3TAM A;  5FRO A;  4IKF A;  1CZB A;  4AH9 A;  2RPI A;  3VQ6 A;  2XHB A;  3C6T A;  1S1W A;  4DTX A;  2G8F A;  4EP5 A;  1F21 A;  4EZ6 A;  1BIS A;  1FKO A;  1RT4 A;  4CJP A;  3SCX A;  3CM5 A;  3VN5 A;  3KLF A;  4FLT A;  4B8C A;  3V9U A;  1KFD A;  2GV9 A;  4RG8 A;  3CFP A;  1ASW A;  1GOC A;  5I42 A;  3PO5 A;  1T8E A;  3WNG A;  3PY8 A;  4M3Z A;  4OGC A;  1Q9X A;  3BDP A;  4B9U A;  1WAJ A;  3LAM A;  1VSL A;  3VQ8 A;  4CJ3 A;  4PWD A;  2D0B A;  1CXU A;  5HRS A;  3TI0 A;  3B6O A;  2ZE2 A;  3VQ4 A;  2HHU A;  2ITG A;  4ELT A;  1DTQ A;  1C0U A;  3AVI A;  3TR8 A;  4J2E A;  4M3U A;  4B9M A;  5FDL A;  3OYK A;  4PUO A;  4I2Q A;  4AHT A;  3I0S A;  4RW8 A;  4KHW A;  3LAK A;  3VQD A;  3AA2 A;  1C6V A;  1HPZ A;  2HNY A;  3DRP A;  2XY8 A;  4O4G A;  3DLB A;  4RW7 A;  3NH0 A;  4F3T A;  2ATQ A;  4O0I A;  3I8D A;  4CJW A;  4CEZ A;  3KK3 A;  1BI4 A;  2OA8 A;  4OKJ A;  4FK2 A;  1LW2 A;  4FK0 A;  1Y97 A;  1WSG A;  1ZBI A;  1TAQ A;  1S1X A;  3AA3 A;  3DOK A;  4CF9 A;  3K5L A;  4DFK A;  4FJI A;  1ZBF A;  1Z25 A;  3HPH A;  4DS4 A;  3RTV A;  2IC3 A;  1UA0 A;  1BHL A;  1L3V A;  4C8N A;  1VSE A;  1KRP A;  4E1N A;  1KVB A;  4DQR A;  4N41 A;  3AO4 A;  2HHT A;  2F96 A;  1W9H A;  3NF9 A;  1EP4 A;  4CES A;  3KTQ A;  3AVH A;  2GUI A;  4CF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...