2Z1IA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1iA00
4I7FA 4F2RA 3SQ1A 3LAMA 1JL2A 1NKCA 1VSHA 3KIOA 5HRSA 3C94A 4N76A 3P5JA 1TKTA 2HNZA 1CXQA 4FVMA 4W5QA 4DU4A 2HNYA 3ZT2A 3QEIA 1REVA 4FLWA 1JLEA 5FRMA 1UA0A 3MEGA 1QQCA 3ZSWA 1ZYQA 4KI6A 4AHSA 1VSKA 1XHXA 4FW2A 4B9TA 5HBMA 1HNVA 2FC0A 1ASVA 1RBTA 4CK2A 4EP4A 3F73A 2D0CA 1TK5A 4BWJA 3AV9A 3IAYA 4GMJB 1X1PA 2Z1JA 3DLKA 3VQEA 4CJWA 3OYGA 3KJVA 2RPIA 1Q9YA 2DY4A 1RTHA 3LPUA 3LAKA 1FKOA 3TABA 2PY5A 1XWLA 3DI6A 4DQQA 3DMJA 4CHNA 3VQQA 1HYZA 2XY8A 3PO5A 4FLVA 1RTIA 5HLFA 3K5LA 1SL2A 4F4KA 1VSDA 3HSTB 1T8EA 3PO4A 1BISA 4CJLA 3S3MA 1U47A 3O4NA 3NH1A 3NHGA 1RNHA 3VQDA 1J9AA 1QS4A 4OGCA 3SZ2A 3KD1E 1TKZA 1IO2A 2Z1GA 4CHZA 3SQ2A 4M45A 4B8CA 5HROA 3THVA 2HHTA 2BGGA 3TAGA 3NFAA 3HVRA 3SPZA 2OA8A 1NJYA 4EZ6A 4ZTFA 4KTWA 3MAQA 1SL1A 1CZ9A 4DTXA 3KTQA 4BE1A 1HJRA 4B08A 4FYDA 2FBYA 4AHVA 5JS1A 2F8SA 3DLEA 2KW4A 1BQMA 4CJTA 4DQPA 3K57A 3KLIA 1SV5A 3NH2A 1NK9A 2OYQA 2KZMA 2GV9A 3FFIA 1VSEA 5C25A 2ETJA 4W5OA 4OPKA 3OYIA 3ULDA 1D9DA 3T3FA 1N6QA 2G8KA 4E0DA 4OKKA 1WNSA 1JLAA 2YHAA 1JLGA 1FK9A 2Q3SA 4EP5A 3NH0A 3HT3A 3NDKA 3TAFA 1ASUA 1J54A 2Y1JA 1NK5A 1WSGA 3C95A 2YNHA 2NUBA 1HYSA 3I0SA 1U4BA 4KKOA 4Y1DA 1J5OA 2VWJA 2LSNA 4DQRA 1DLOA 3LP2A 5EU7A 3MEDA 4HUFA 4DTUA 3RMDA 3DLHA 2W42A 3NCIA 4F2SA 4BDZA 1S9GA 1B9FA 2ZE2A 3BGRA 3NF7A 3HPGA 4CJQA 2P5OA 3K2PA 3VQ6A 3P83D 1S1XA 3EYZA 3AVIA 5SZTA 4AHTA 3TWHA 2P1JA 1NK7A 3CG7A 4CCHA 3RTVA 4CF9A 4M3TA 3PY8A 4FJKA 4CEOA 3VQ4A 4AHUA 2P5GA 2JLEA 4DFKA 1BIUA 4MFBA 3ZSQA 3OYFA 1U45A 3RR7A 5HRNA 1IKYA 1NKBA 1BCOA 3QO9A 1S9EA 4NYFA 3MXMA 1L3VA 1BL3A 3SUPA 4K8XA 4AH9A 1U04A 3QNOA 1NJWA 1JL1A 3DYAA 4KHYA 1F21A 2G8WA 4N47A 1WSEA 3U3GA 4CF2A 1LWCA 3HVTA 1SKWA 1WSFA 2G8UA 4KB0A 5KGWA 2YKMA 3TARA 4BDPA 4DSFA 1WSIA 1TGOA 3VQAA 2F96A 4FM1A 2IOCA 4HUEA 3AA5X 1L3TA 3WNEA 3PX0A 1YTUA 3QEXA 1RBVA 1HMVA 1D8YA 1XI1A 3ZSOA 2QKKA 3T1AA 4RW6A 4JS5A 2OPQA 4AHRA 4E7HA 3OJUA 4B9NA 4HVJA 4FK4A 3KKRA 4I2QA 1QE1A 2A1SA 3JYTA 3LPTA 3RWUA 4YNQA 1NJZA 1S5JA 4W5TA 4ELVA 2E4LA 3VQ5A 5HRRA 1SKRA 3M8SA 4M3UA 3AVJA 4CJRA 1S1VA 2YKNA 4RW8A 1XHZA 1JKHA 3OYHA 3OS2A 1NKEA 4OKEA 3SJJA 4E89A 4CERA 1S1UA 3MEEA 4O44A 3VA3A 3KLFA 3HPHA 3TAQA 1RDAA 3NBPA 4DS4A 1BQNA 3WNHA 3OYJA 1VSIA 2OZSA 4CGGA 4ID1A 3NF9A 3HK2A 2X78A 1VSMA 1VSLA 1A5XA 1YT3A 1BI4A 1KTQA 1JLBA 3IS9A 4IFVA 1N5YA 1KSPA 4CF8A 4FJGA 3DRPA 1U48A 5J2QA 1ZBFA 2FBTA 4KTZA 3NGZA 4LY7A 4NCAA 3OY9A 1RTJA 1CLQA 4FCYA 1Z25A 3UIQA 4J2DA 1TVRA 5J1EA 4HUGA 4M42A 4OGEA 1IH7A 4TSXA 4DF4A 4DSIA 5HP1A 1D9FA 4FK2A 2QXFA 1TKDA 2VWKA 2YNIA 4HCCA 4CIFA 4FLXA 2G8VA 3V9SA 4RW4A 4XIUA 3OYLA 2XY6A 2D0BA 2HW3A 4KPYA 5CYMA 4DTOA 1ITGA 5J2PA 1QSYA 2HHWA 1RBUA 3AVGA 3ASMA 3ZT4A 3OJSA 4CGDA 3K5MA 1X9WA 4FZYA 4C8KA 3SUQA 3AO5A 2IAJA 2IC3A 4ID5A 4DFMA 3VA0A 4FJMA 4CGJA 2HHVA 3DRSA 3CQ8A 1BIZA 4DLGA 1Q9XA 4B9VA 3C6UA 1W0HA 3A2FA 4Z0UA 4KB1A 4CJVA 2KZZA 1UOCA 4O55A 4E7KA 3D45A 4H4MA 4CGIA 3TR8A 3ZT1A 4DSEA 1SL0A 3M8QA 2HVHA 4KAZA 3ALYA 3AA4A 4ZHRA 4KRFA 4CFBA 3OYBA 3SYZA 1UAXA 4C8NA 3QNNA 4RW7A 1G15A 2YNGA 4I9LA 1KFDA 4DU3A 2R7YA 1TV6A 4DSJA 5C42A 1C6VA 1RT2A 4FJ8A 5J2NA 2HHQA 4FLYA 3EZ5A 4B9LA 3ZT3A 3KD5E 4R5PA 1JLQA 1VRTA 3DLRA 3ZSVA 3DOLA 4CJFA 4CGHA 4B9SA 1X9MA 2AJQA 5E41A 3LP3A 1BGXT 4GVMA 5CZ1A 3V81A 1NK8A 4KFBA 4FJIA 3TAEA 2OPSA 2YV0X 3HL8A 3NGYA 3V9WA 3SNNA 2Z1IA 4BE0A 3G0ZA 1GOAA 4QCLA 3AVHA 4IKFA 4FJHA 2E6LA 1EXQA 4Q0BA 3VN5A 4M3ZA 3AVAA 1I39A 4DTRA 1RT1A 2QKBA 4FXDA 4Z4GA 4FJXA 1HQEA 1HRHA 4LH4A 4W5RA 1LW2A 5HRPA 4FM0A 3DRRA 3HO1A 3O3FA 4C8LA 4DSKA 5DK5A 3ZSRA 2RKIA 2RF2A 2HMIA 3SV4A 3RRGA 2X6SA 4KHQA 3HPOA 5J2MA 4IBNA 3AVMA 3ZSYA 1JXEA 3DLGA 4CEBA 3C6TA 4M3XA 1IKVA 3KK2A 2IGIA 1FXXA 4CF1A 1NJXA 3NAEA 3DOKA 3WNGA 4CJEA 1LWFA 4UQGA 3ZT0A 4BDYA 3B6OA 4CEAA 4C8MA 4GW6A 1A5WA 3SI6A 3OYNA 3WNFA 1S6PA 1RILA 4DFJA 2PZSA 4N56A 3F9KA 2OPPA 4KHSA 4K8ZA 1RBSA 5FROA 1WAJA 1KFSA 3OS0A 1QSLA 1DTTA 3TI0A 4DS5A 3AVCA 4E7JA 1IKXA 3TAPA 4M3WA 3AVBA 1HQUA 1CZBA 4FJLA 4DQSA 1JXBA 4CEQA 4CHOA 5KGXA 4KTQA 3M8PA 4CEFA 3ZSXA 3V9ZA 1S1TA 3U6FA 3OS1A 1CXUA 4LD0A 1L3SA 1LW0A 2PYLA 3VQCA 3NF6A 2ZQBA 1VSFA 4QOZB 1RCHA 1Z26A 4CK1A 4JRQA 4HHTA 4FJ5A 5C24A 1I3AA 2BE2A 3CFOA 4C8OA 1RDBA 3S3NA 3K59A 3QESA 2DTUA 1B9DA 3PX4A 2HHSA 1NK4A 2HHUA 1GOCA 4CJ3A 2IDOA 1RT4A 1VSJA 4CK3A 4JS4A 4FZZA 4FLZA 1NK0A 3AO1A 3VQ9A 1UWBA 4DMNA 1XC9A 4J2AA 3OYMA 2HNDA 3SQ0A 4N41A 2O4IA 4DSLA 5KRSA 3AVFA 1IKWA 3L2UA 1WAFA 3OVNA 4B8AB 4PUOA 2QK9A 2DFHA 3KKSA 3LZIA 1EP4A 4KHWA 1C1AA 3T19A 3RR8A 4CFDA 1KVCA 1VK0A 1S1WA 4E3SA 5D3GA 3SUOA 2A1RA 3K58A 4N5SA 4Z4IA 4E1NA 2F8TA 1Y97A 3V9XA 1WSJA 3AVNA 4AHCA 1MU2A 4Q5VA 3TAMA 3MXIA 3LWMA 3LZJA 4F3OA 3ZSZA 1RBRA 1NK6A 3TANA 1RDDA 4CEDA 4NCGA 4O5BA 1B92A 1T05A 4CJUA 4E1MA 2FBXA 1YVUA 5K14A 3PUFA 1TAQA 5JS2A 3ZCMA 4DU1A 1WLJA 2WONA 1KVAA 4OLBA 3S3OA 1C0UA 2G8HA 3QERA 1J53A 3QEPA 3SPYA 3B6PA 3VQBA 5DMRA 4CFCA 1LWEA 4KHUA 3QEWA 1JLCA 4CECA 3HM9A 5CY4A 5KRTA 4DTJA 1IG9A 1ZBHA 2I5JA 3OYAA 3QEVA 1WN7A 4DQIA 3BDPA 2HVIA 2B4JA 4M3YA 4EZ9A 4JRPA 1JLFA 4RW9A 3CM6A 1TL3A 4IDKA 4OKJA 3NE6A 4AILC 1KRPA 1TL1A 3V9UA 4J2EA 3I0RA 2PYJA 1RDCA 4PA1A 3HXMA 4DF8A 1X9SA 1T7PA 2VG6A 4F8RA 2G8FA 2YHBA 3G10A 4PQUA 4W5NA 4E7LA 2GBZA 1BHLA 3KK1A 5SWMA 3KK3A 1WSHA 4DTMA 3AO2A 5FRNA 1Q8IA 3MXJA 3VQPA 1TK8A 4CF0A 3CFPA 2RN2A 1W9HA 5KTQA 4DTNA 2EHGA 4YFUA 3QIOA 2DFEA 2E6MA 2HB5A 3L2WA 2Z1HA 3NGIA 4DLEA 2XHBA 1T03A 4H4OA 4Y1CA 4HCBA 4FK0A 3DM2A 4CHPA 1KLMA 4DG1A 4IFYA 2FBVA 2BDPA 4OLAA 3SV3A 1C1CA 4O0JA 3L2QA 3U3YA 4CFAA 4CEZA 2ATQA 5KI6A 3OYCA 3QINA 2O4GA 1O1WA 4QAGA 1A5VA 4O0IA 3LDSA 1QTMA 3RMAA 1EX4A 4KV8A 1EKEA 2KQ2A 5FDLA 2BANA 4BACA 1KVBA 1UA1A 4DWIA 4OPJA 5I3UA 1HPZA 3QLHA 3E01A 2OPRA 4CJPA 4L8RB 4Z4EA 4E7IA 2VG7A 4KREA 4FLTA 4KI4A 4WE1A 4IG3A 4ZTJA 4ELTA 3HYFA 3L8BA 1L3UA 4IG0A 1GOBA 1QHTA 4B3OA 1TAUA 3AA2A 1BI4B 4OVLA 3V6DA 4FLUA 1FKPA 4DTPA 4FZXC 2XY5A 2ITGA 3K5NA 3CFRA 4DTSA 3NF8A 4G1QA 3OYKA 4PY5A 3L2VA 3SQ4A 3QETA 4BE2A 4B9MA 3IRXA 1HNIA 3LP0A 1RT7A 1LAVA 3LP1A 4F3TA 3MECA 3AA3A 4LH5A 4CJKA 1DTQA 1BCMA 4NYNA 3KLHA 2KFZA 1HYVA 4B9UA 3H08A 4FJ7A 2VG5A 3V4IA 4I9QA 3SUNA 4LSLA 4Z4CA 1R0AA 1NOZA 1ZBUA 2KFNA 4RG8A 2XO7A 3L3UA 4CEEA 3LWLA 4FJNA 4CIGA 3QIPA 4Z4FA 1C0MA 3S9HA 3KLGA 1RT5A 2HHXA 1TK0A 1S6QA 4CJ5A 3P1GA 3ISNC 4ELUA 3OYEA 3RRHA 2XY7A 3CM5A 4CGFA 4I2PA 2XRIA 4PWDA 5CYQA 1C1BA 3LANA 2YNFA 4BWMA 3LALA 3HP9A 1ZBLA 3K5OA 4CE9A 4H8KA 1RT6A 3PX6A 3JSMA 2EX3A 2G8IA 3V1RA 3AVLA 4Z4HA 4FJJA 2OZMA 4FW1A 2GUIA 3EY1A 3L3VA 3VQ8A 4E19A 2B5JA 4CESA 4DFPA 1C0TA 4CJSA 2X74A 2WOMA 1TKXA 1SKSA 4HTUA 2IS3A 3HP6A 4J2BA 3IG1A 5T7BA 1RT3A 4JLHA 1RTDA 1QSSA 4KHNA 3O4QA 4LSNA 3OYDA 3PV8A 3KLEA 1ZBIA 3V1QA 1D5AA 1ASWA 4ICLA 1KCFA 2B6AA 1SUQA 3AVKA 4M41A 3AO4A 4CHQA 3D0PA 3RMCA 1EETA 2D5RA 3AO3A 3V1OA 3O3HA 1KLNA 1YTAA 2ZD1A 4KO0A 2P51A 2DFFA 4O4GA 4M3RA 2X6NA 3I8DA 4NCBA 4CHYA 3M8RA 3ITHA 3L2RA 3RMBA 4CJ4A 4OJRA 3HJFA 4CIEA 2D0AA 3DLBA 4MQ3A 2KTQA 3O3GA 1LAWA 1VRUA 5CZ2A 2Y1IA 2JGUA 3VQ7A 3SCXA 1L5UA 1NOYA 4FJ9A 5I42A 1LV5A 3CYMA 4FM2A 1K6YA 1U49A
chains in the Genus database with same CATH superfamily
2NRXA 3SQ1A 1JL2A 3DWLA 1TKTA 4FVMA 1CXQA 2HBJA 3LL3A 5FRMA 3D2FA 3MEGA 2Q97A 1VSKA 1RBTA 4BC3A 1TK5A 4NXNK 5TKYA 2WC9A 3DLKA 2O8DB 4CJWA 3OYGA 2RPIA 3G6EN 1RTHA 3OBYA 2ZF5O 3CHWA 1IG8A 4FLVA 3L4IA 1T8EA 1NBWA 1X3MA 4RCHA 2CGKA 1RNHA 3VGLA 4BRAA 3SZ2A 1S3XA 1YXQA 4EHTA 3THVA 2YHXA 4I6MB 4EZ6A 4JI6K 1SL1A 4DTXA 4BE1A 2A3ZA 4B08A 2F8SA 4FWMA 4CZLA 3MN9A 2A42A 2OYQA 2PBDA 4JHDB 3FFIA 4DV5K 3ATUA 2FSKA 4DUZK 2UXBK 4IO8A 4M7YA 1NMNA 4JI5K 1MWMA 4YOXA 2E1ZA 4EP5A 4BRCA 1HYSA 4K25A 3LDOA 3LP2A 4DTUA 4HUFA 4F2SA 4OX9K 4BDZA 1S9GA 3NF7A 3VQ6A 3EYZA 1NGJA 4B1WB 2P1JA 4FSVA 1NK7A 4M3TA 3CCUN 4BR4A 1SAZA 4IXCA 3C7NB 3ATVA 3ZSQA 3G71N 1IKYA 1V4SA 3QO9A 1N34K 3CC7N 1U04A 3R6MA 3DAWA 3L6QA 4DV6K 4N47A 2NRRA 4CF2A 1WSFA 4EHUA 2YKMA 3TARA 4BDPA 4CI6A 2NRVA 4DSFA 3VQAA 3H1VX 3QEXA 4FWSA 1D8YA 1XMOK 4JD2B 4JS5A 1ZXOA 3K9JA 4B9NA 1QE1A 1U6ZA 2A1SA 4MDBA 1GLDG 1SKRA 4KH6A 1U2VB 3JAMO 4CJRA 4DR1K 4RW8A 1XHZA 2QI2A 3OYHA 3OS2A 1NKEA 3VEXA 4E89A 4YOWA 2IVOA 3VA3A 3CPWM 3KLFA 3TAQA 5C2DA 3R3LA 4CGGA 3NF9A 3HK2A 1VSMA 5BRDA 1HKGA 1BI4A 1N5YA 3EZWA 4NCAA 4H5WA 5C10A 4FCYA 4M42A 1IH7A 4DF4A 5HP1A 1D9FA 2QW9A 2QXFA 1TKDA 4FLXA 2G8VA 4XIUA 2XY6A 3C6HA 2HW3A 2HHWA 3OJSA 1ZC6A 4ID5A 3VA0A 2E88A 1VQ6N 4BRNA 4K0KK 4DLGA 2BUPA 4Z0UA 4CJVA 4KB1A 4BC5A 3D45A 4H4MA 5AZIA 1SL0A 3M8QA 3ALYA 3AA4A 4CZFA 1NGDA 3P38A 2D1KA 4C8NA 1ILYA 2YNGA 3WUHA 3BY5A 3IMXA 3T1HK 1C6VA 5KPRA 3ZT3A 2F9WA 1JLQA 5AFUA 3ZSVA 4CGHA 5E41A 1BGXT 1YITN 3WXKA 2P9KA 1BA0A 3TU5A 3HL8A 3HRGA 4IKFA 4FWOA 2P9UB 2E6LA 3LM2A 2IVPA 3B8AX 4BR9A 4DTRA 4FXDA 4A2AA 2O8FA 1HRHA 4FM0A 3HO1A 2UUAK 1VQMN 3O3FA 4DSKA 1IV0A 4LF6K 3EO3A 3ZSYA 3KK2A 2IGIA 1FXXA 3I56N 1NJXA 4UQGA 1LWFA 4BDYA 2O8EB 3TSUA 2Q36A 3WNFA 1S6PA 4PKHA 2ZJPL 3J8AA 4BRDA 5GADP 3D7EO 1E4GT 2WUSA 1DTTA 1DGKN 4DR4K 5AQYA 4CHOA 5KGXA 5AZJA 4CEFA 4YOUA 2HSTA 1K8KB 5M1OA 2P9LB 3OS1A 3VQCA 3CCQN 4X62K 3J7AP 3CERA 3PLAA 1B9DA 2VQFK 4B3SK 3UE5A 5EOYA 1GOCA 3LDNA 4CK3A 4FLZA 4G9ZA 1X3NA 3VQ9A 4DMNA 1UWBA 1XC9A 2Q0UA 1K9MO 4DSLA 5KRSA 4KHPK 3A8YA 4IJNA 2DFHA 4YDUC 1EP4A 5KQ8A 4CFDA 3SUOA 2A1RA 1JCFA 5KPZA 4AHCA 4BG8A 3LZJA 3ZSZA 1IJJA 2H3GX 1NK6A 4NCGA 4O5BA 1B92A 2VGMA 5M1NA 2A5XA 4MLEA 4CJUA 3LDPA 3H45C 3P4IA 4KBOA 4BRFA 2QWMA 5K14A 4CBUA 1WBDA 1KXPA 3BF3A 5JS2A 2WONA 1KVAA 3I8BA 5KPTA 3S3OA 2G8HA 3QERA 1J53A 3SPYA 3B6PA 1JLCA 4CECA 1IG9A 2JWLA 4IZ9A 3J80O 1WN7A 4DQIA 2P9NA 3E9OA 1QZ5A 4M3YA 3F2KA 2HMPA 3T7ZA 3CC2N 1WBBA 2O8CA 2PYJA 1N32K 3HXMA 1X9SA 3AY9A 2G8FA 3U4LA 4CZJA 4GKKK 1BHLA 3KK3A 1HNZK 2YJEA 1NGIA 4DTMA 1RFQA 4A5AA 5FRNA 1OH8A 3VQPA 3GBTA 3ULEA 3QIOA 4MO5A 3L2WA 4Y1CA 3DM2A 2FLOA 4PKIA 2ASPA 3U3YA 4CFAA 1O1WA 1A5VA 4O0IA 4IEEA 1QTMA 3RMAA 4JI3K 3UKRA 4B3RK 4OPJA 2HBLA 2O8BA 4L8RB 4PKGA 4E7IA 4AF1A 4ELTA 4DTSA 2V7YA 3OYKA 3QETA 4BE2A 3J7ZO 4DV4K 1HNIA 1RT7A 4F3TA 1NNEA 1DTQA 1BCMA 4H03B 3CMAN 2KFZA 2NRWA 3O80A 1VQKN 4NB4A 4F9OA 1ZBUA 3CPEA 3KHYA 3QIPA 4LF8K 4Z4FA 3H3NO 3VETA 5LMUK 2YI1A 1NGGA 3A5NC 3D6RA 1E3MA 2XY7A 4CGFA 3E1YA 2XRIA 3FGUA 1C1BA 1ZBLA 1RT6A 3HI0A 5GINA 4CW7B 4Z4HA 3SK3A 4FW1A 3L3VA 3VQ8A 4JKFA 3HSCA 4CJSA 2X74A 5LL6Z 3HP6A 1VQLN 3LM9A 2W41A 1QSSA 1MWKA 3KLEA 3O9SA 3UKUB 3SBTA 1ASWA 4FWKA 4CZEA 3D0PA 1IBMK 1BWFO 5GAGP 2D5RA 2NRZA 2P51A 2DFFA 2X6NA 3M8RA 4CJ4A 2F7TA 3O3GA 4FWRA 1VRUA 1L5UA 2JGUA 5AJ3K 1NOYA 1LV5A 3CJAA 1U49A 4I7FA 5IT9O 3EKSA 3CCSN 4N76A 3P5JA 4DU4A 1JLEA 2WBNA 4EIAA 1XHXA 5HBMA 3J81O 3O1BA 4JI0K 4BR5A 1VQ5N 4LC9B 1TYQA 3ZETA 4JN4A 1X1PA 1OKJA 3OTOK 5BR9A 2DY4A 2CH6A 1N36K 3LAKA 1FKOA 3TABA 1I94K 2UU9K 4DQQA 2PY5A 1T6CA 2P9SA 3DMJA 1O13A 3K5LA 3CIPA 1OH5A 4CJLA 4H5TA 3O4NA 3VQDA 1QS4A 4OGCA 1K8AO 1M90O 3KD1E 1IO2A 2Z1GA 5HROA 1VHXA 3TAGA 3HVRA 4BROA 3BF1A 2OA8A 3VMFB 4FYDA 4AHVA 5JS1A 3KLIA 4DKWA 1NK9A 4ISFA 4W5OA 1VSEA 1D9DA 2ETJA 3ULDA 1H1VA 4YHHK 2G8KA 4OKKA 1WNSA 4MLHA 1JLGA 1ATNA 1FK9A 4FL9A 3HT3A 3NDKA 2V51B 4DHYA 1WSGA 4B1UB 2VWJA 3H6EA 1NJIO 3SLCA 5EU7A 3THWA 3NCIA 3CCJN 1SZ2A 4CJQA 3K2PA 1S1XA 4JI8K 3A5LC 4CBXA 1W7AA 1BA1A 4CCHA 5M1KA 3PY8A 3VQ4A 1BIUA 3OYFA 3RR7A 1NKBA 1GLEG 2YJFA 1OH7A 2Q31A 2A41A 3R1XA 1VQON 1LWCA 4J2EA 4KB0A 5KGWA 1WSIA 4FM1A 1L3TA 5FLXO 3PX0A 1YTUA 5AQUA 1T3VA 4JKGB 4RW6A 2OPQA 4AHRA 3JS6A 3OJUA 4HVJA 3RWUA 3LPTA 4ELVA 3DXKB 4WQ4C 3VQ5A 5HRRA 1WOQA 3VF6A 4NXMK 4BVPA 1S1UA 4O44A 1RDAA 3VERA 4FWLA 4IOAL 4BQZA 2OZSA 4RWTA 5BREA 3DLLL 3DXMA 3O9TA 1XNRK 1VSLA 3ZX0A 1U48A 2FBTA 4CD1A 1NGEA 4BREA 4TSXA 1RDUA 4FK2A 3A0IX 2YNIA 4HCCA 3TTCA 1ITGA 4M7XA 3ASMA 2KLAA 2KKZA 4XEIA 3MCAB 4DFMA 3D2EA 2CGJA 4FJMA 3SAHA 2HHVA 3NVKA 4FOIA 4B9VA 2KZZA 3I33A 5JLFA 3ZT1A 4DSEA 2QM1A 4KAZA 4ZHRA 4CFBA 1UAXA 2P9IB 3CF5L 5C42A 4FJ8A 3EZ5A 3SMPA 5HOOA 5AQGA 1VRTA 4CJFA 1VQ7N 4B9SA 1JCGA 1GLBG 4GNIA 2YHYA 4FJIA 5BN8A 3TAEA 4ISEA 3V9WA 3SAFA 1GOAA 3AVHA 4FJHA 1QZ6A 3VN5A 3GE1A 3AVAA 4H0PA 2QKBA 4LH4A 4W5RA 3SAGA 3MWTA 1GLCG 2ZGZA 3HPOA 5J2MA 3VESA 4IBNA 3AVMA 4M3XA 1IKVA 3CCRN 3IUCA 1C0FA 4ILHA 1MDUB 4CF1A 4CJEA 1RGIA 3ZT0A 4CEAA 4H5RA 4FO0A 2P9PB 5F0XA 2O8DA 1A5WA 2QWOA 3OYNA 3SI6A 4NLCA 3FZKA 4JAXA 4DS5A 1VQ9N 4E7JA 1IKXA 4M3WA 3FFKB 1HQUA 4JYAK 1QQNA 4DQSA 4CEQA 4GV9A 3CJ7A 4GVEA 3MN6A 2PYLA 3NF6A 3W3DA 1Z26A 4FJ5A 4HHTA 2BE2A 1EWQA 1RDBA 3K59A 4I6MA 2HHUA 5DM7L 4FZZA 2IDOA 2FF6A 4FWPA 3SQ0A 2O4IA 4QS8A 1EQYA 5FPDA 3HBTA 4B8AB 4PUOA 5M1PA 1C1AA 4JHDA 3T19A 3RR8A 1EWRA 1VK0A 4Z4IA 1FJGK 5AR0A 4N5SA 3VEVA 4E1NA 3V9XA 5EY4A 2GX9A 2P9KB 3S41A 5AQIA 1KAYA 3HZ6A 1T05A 1P90A 5KQDA 3PUFA 1TAQA 2VYPA 3ZCMA 3MX5A 4BVOA 1XMQK 4OLBA 1C0UA 3MWPA 4UY8O 1GLFO 3VQBA 1LWEA 4JKHA 1ZBHA 2I5JA 4IDHA 3C7NA 4HWIA 4A59A 1ATSA 4A5BA 3QEVA 1T6DA 4JKDA 3BDPA 2HVIA 2B4JA 3KWGA 4EZ9A 4JRPA 2GEMA 3CM6A 1TL3A 4IDKA 4OKJA 3NE6A 1OVYA 1KRPA 2UXDK 3I0RA 1RDCA 4DF8A 1FW6A 5AQRA 2ZGYA 3WT0A 2YHBA 4PQUA 3G25A 4JD2A 2NRTA 3AARA 3BEXA 1WSHA 3FZFA 3AO2A 1JJ2M 3CFPA 1U2VA 1W9HA 2EHGA 4JI1K 2DFEA 2HB5A 3NGIA 2Z1HA 4DLEA 4FK0A 4RTFD 4HCBA 4CHPA 1KLMA 2HF3A 5BN9A 2BDPA 4OLAA 4H0XB 3C0BA 1C1CA 3L2QA 5KI6A 3QINA 2O4GA 4FPBA 4QAGA 3LDSA 3FZLA 4DWIA 2AA4A 2D0PA 3QLHA 4Z4EA 2VG7A 4LF5K 4FLTA 4BRGA 5JVGL 4IG3A 3HYFA 1L3UA 1QHTA 4B3OA 3AA2A 1YUWA 4GKJK 4DTPA 3GL1A 2ITGA 3CFRA 1EO1A 3GOIA 4IJAA 1SS6A 3QBXA 3MECA 4NYNA 4B9UA 3H08A 2QWRA 3V4IA 4I9QA 4O8KA 3SUNA 4Z4CA 3QFPA 2CGLA 4CEEA 2FSNA 1RT5A 5C15A 4CJ5A 4YOTA 4B9QA 3P1GA 4ELUA 2E20A 3C6AA 1CZAN 3O9UA 5CYQA 3LANA 2JWKA 4CE9A 5AQPA 2QWQA 3ZYYX 3V1RA 3ZEUB 2E2OA 4YOYA 1GLLO 4AM7A 1C0TA 2ZM6K 2WOMA 5HL7L 4HTUA 2IS3A 4J2BA 3IG1A 1RT3A 3O08A 4BY9C 3DJCA 2E1YA 4JKAA 1NGFA 4ICLA 1KCFA 2P9UA 3THXB 3AO3A 3O3HA 4LF4K 4BG9A 4KO0A 2OTLN 4NCBA 4M3RA 2J4RA 3O1WA 3RMBA 1QQOA 3HJFA 2D0AA 3DLBA 3L0QA 4CD3A 1LAWA 2Y1IA 3CYMA 4F2RA 3LAMA 1N8RO 4CZGA 3UKRB 4LF9K 4W5QA 2HNYA 3ZT2A 1Y64A 4FLWA 1YHQN 1UA0A 1ZYQA 2O8EA 1T44A 4FW2A 4GV6A 4B9TA 1HNVA 4EP4A 2D0CA 3K9KA 4BWJA 3AV9A 1YJ9N 5ELZA 3KZBA 3VQEA 2QXLA 5AQQA 4YY3K 3ENBA 5F2RA 3DI6A 2UUBK 4CHNA 3ZLJA 5TKWA 1HYZA 3PO5A 2D4WA 4XH5A 3IKMA 1RTIA 5HLFA 1SL2A 1NWKA 1VSDA 3PO4A 3S3MA 3NHGA 5EVZA 4WFBL 1J9AA 2ZJRL 3O9QA 3M1FA 1YJWN 4CHZA 3SQ2A 2DPNA 4E1JA 5GIPA 3GDQA 2HHTA 2KHOA 3SPZA 2PFUA 1NJYA 3MCPA 4KTWA 3OBWA 2FBYA 3GG4A 3DLEA 1P8ZA 1BQMA 2KW4A 3RSEB 4DQPA 3K57A 3NH2A 3OW2M 3U9DA 3MK6A 2V52B 5BPLA 2KZMA 4DV3K 5C25A 3OYIA 4OPKA 5AQWA 1Q7YO 3T3FA 1N6QA 4E0DA 1C0GA 1JLAA 4OO1J 3NH0A 4OPHA 4WCEL 4JNEA 1J54A 2Y1JA 3ZX3A 1NK5A 2YNHA 4IEIA 2NUBA 1NU0A 3I0SA 1U4BA 4KKOA 2LSNA 4DQRA 1DLOA 1DEJA 3N4QA 3SBGA 3PIOL 3BGRA 1B9FA 2ZE2A 3HM8A 3HPGA 4BRMA 4CJ7A 4O5FA 3AVIA 2OTJN 3QMLA 4CF9A 2GTDA 4CEOA 4GY2B 2JLEA 3KK7A 4LFCK 4BR2A 4MFBA 1U45A 4U67L 2HF4A 4NYFA 3E66A 4DQ8A 4K8XA 3QNOA 1JL1A 2G8WA 2QTDA 3U3GA 3HVTA 3F9MA 2F96A 2IOCA 4HUEA 3VF4A 3AA5X 3OA9A 4JK9A 1N33K 1XI1A 3ZSOA 3E9PA 3T1AA 1WUAA 2QKKA 3Q7BA 4K41A 3WXJA 4AQYK 3WXMB 4FK4A 4I2QA 1R59O 4YNQA 1NJZA 1IBKK 4CZIA 4M3UA 1DKGD 3U8XA 1S1VA 1JKHA 1XQSC 4CERA 3O5BA 1GLAG 5CHIA 3P31A 3HPHA 3TSPA 3NBPA 4DS4A 1VSIA 4DV2K 1QVGM 2X78A 4LF7K 1KTQA 4IFVA 1KSPA 5AQJA 4CF8A 4KTZA 2WFBA 4LY7A 3OY9A 2QEXN 5JVHL 4J2DA 3T69A 4O8UA 3THYB 5AQXA 4DR6K 2VWKA 4CIFA 3CXCM 4BGBA 4RW4A 3OYLA 4JK8A 3VTHA 2D0BA 5CYMA 5J2PA 4DB3A 3ZT4A 3K5MA 5BR8K 1X9WA 4WFAL 4C8KA 3SUQA 3AO5A 2IAJA 4BRHA 1Q82O 1JCEA 4CGJA 1BIZA 4KH5A 3C6UA 1W0HA 1D4XA 4O55A 4E7KA 3TR8A 1BUPA 5C2FA 3CCMN 2E2QA 3SMSA 3OYBA 2V7ZA 1X9JA 4I9LA 1KFDA 4DU3A 1TUUA 1RT2A 5J2NA 4B9LA 3UKUA 5H1SQ 3DOLA 4YORA 4C23A 4NO7A 1YF5L 1X9MA 5GAEP 5CZ1A 3WQUA 3WEEB 2BTFA 1NK8A 4KFBA 4B1VA 4IFEA 2OPSA 3M6GA 5BPNA 2Z1IA 4BE0A 3G0ZA 3SNNA 3CCLN 4QCLA 4Q0BA 3CCVN 4M3ZA 1RT1A 4Z4GA 4JI7K 1HQEA 1LW2A 4Y0WA 3ZSRA 2HMIA 1BDGA 4PHTX 3HOSA 3SV4A 3RRGA 2X6SA 4H5NA 5BRFA 4KHQA 4WFNL 5JMVA 3DOKA 5AQFA 1KC8O 4X64K 2W6LA 4B1XB 3D2FB 4C8MA 4GW6A 1RILA 4DFJA 1S72N 2PZSA 3F9KA 2OPPA 3ID6A 4K8ZA 1WAJA 3R8EA 4BC2A 3VGKA 3OS0A 2D0OA 3TI0A 1QSLA 4H0YB 1CZBA 1ESVA 2I7PA 2VWBA 3ZSXA 3V9ZA 3VTIA 4FVUA 1OVQA 4LD0A 1LW0A 3N4PA 2ZQBA 1VSFA 1RCHA 4CK1A 4JRQA 1VQ4N 5C24A 3CFOA 2DTUA 3PSFA 3O6WA 1XNQK 4WQ5A 5FPMA 2NNWA 5E26A 3PX4A 1NK4A 5AQVA 1RT4A 1VSJA 4JS4A 1LOTB 3HOTA 4BR7A 1NK0A 3AO1A 1BOTO 4J2AA 2OANA 3OYMA 2HNDA 4B1YB 3AVFA 3EE8A 1WAFA 3FR0A 4KHWA 1HPMA 2F9TA 3CETA 5AQMA 1S1WA 4E3SA 5D3GA 1Y97A 1WSJA 3C65A 5C0YA 2ZJQL 4MO4A 1MU2A 4Q5VA 3TAMA 3O4WA 2QWPA 3VENA 3LWMA 2W40A 1RDDA 2ZWHA 1HX1A 1Z05A 2VQEK 2UYTA 4DR3K 4DV1K 2FBXA 2HHHK 3VEOA 1YVUA 3T1YK 3EN9A 4DCHA 1HKBA 1ATRA 2NRHA 3ENOA 3HTVA 3QEPA 5DMRA 3HM9A 1OH6A 3A5MC 4PL8A 3BZKA 3EEQA 4JV5K 2E2NA 4CZHA 4RW9A 3TTDA 4PA1A 5LJVA 4LFAK 1T7PA 4WQ4A 2YX6A 3CQYA 1VQ8N 4JKGA 4W5NA 1NGBA 4E7LA 3KK1A 3FZMA 4FOEA 3DXKA 1TK8A 4CF0A 2RN2A 5KTQA 4DTNA 4YFUA 3AAPA 5M1QA 5CR4A 2QWLA 2HBKA 4BRKA 1KAZA 4CEZA 2ATQA 2FXUA 4CZMA 4YOVA 2UXCK 5FPEA 2KQ2A 5FDLA 4B3MK 5I3UA 3E01A 2OPRA 3CMEN 2E2PA 4WE1A 3L8BA 3WQTA 4OVLA 1BI4B 3MMVA 3V6DA 1FKPA 5EX5A 3K5NA 4G1QA 3A5OC 3L2VA 3R9PA 3UB5A 3LP1A 3AA3A 4FJ7A 3AAQA 1HKCA 1R0AA 1Z6RA 4WF9L 3LWLA 3FLCO 4EFHA 1C0MA 3EE9A 3BZCA 5GIOA 1TK0A 3ISNC 3WXLA 3CM5A 3CJ1A 4HTLA 4I2PA 3EL2A 1NG9A 4PWDA 2YNFA 2VCPA 2P9IA 4BWMA 5AZIB 3PX6A 3JSMA 4FPAA 4FWNA 2G8IA 3AVLA 2GUIA 3BUZB 2GUPA 3EY1A 4E19A 1LCUA 2VGNA 1TKXA 4XH4A 1SKSA 2PAVA 2UUCK 3O4QA 5C12A 3OYDA 3PV8A 3V1QA 4PL7A 1D5AA 3AVKA 1SUQA 4M41A 3AO4A 4CHQA 3RMCA 1KLNA 3V1OA 5BRHA 3WXIA 5GAHP 3ITHA 4CIEA 3VQ7A 4X65K 5I42A 4GVMA 2O8FB 1NGAA 1NKCA 5M1FA 1VSHA 3KIOA 5HRSA 3C94A 1NGHA 2HNZA 4BRPA 3QEIA 1REVA 4KI6A 1QQCA 3ZSWA 4AHSA 2P9PA 2FC0A 1ASVA 4CK2A 3F73A 3VEYA 4IO9L 4NLBA 3IAYA 4GMJB 2Z1JA 3KJVA 1Q9YA 3LPUA 5FPNA 1YJNN 1XWLA 3AGRA 3VQQA 2QWNA 2XY8A 5AZJB 4F4KA 3HSTB 1WB9A 1BISA 3E9LA 1U47A 4EAHD 3NH1A 3KVGA 1XC3A 1TKZA 4WYBA 4M63C 4M45A 4B8CA 4A61A 4B1ZA 4JK7A 2BGGA 3NFAA 4C1NI 4A62A 1QVFM 4ZTFA 2GELA 4ISGA 3MAQA 1CZ9A 3KTQA 1HJRA 3CC4N 3M5RA 4BR0A 1IBLK 4CJTA 1SV5A 4DR5K 4IOXA 4U7BA 2GV9A 5AQHA 4FWQA 2BH1A 4ILGB 2YHAA 2Q3SA 1G99A 3TAFA 1ASUA 3C95A 3CJ9A 4Y1DA 3OHRA 1J5OA 1NGCA 3DLHA 3MEDA 3RMDA 2W42A 3FE1A 2P5OA 4MDAA 3MN7A 4H0OA 1Q18A 3P83D 5AQKA 1VQPN 5SZTA 3VPZA 4AHTA 3TWHA 3CG7A 3MN5A 3RTVA 4FJKA 2P5GA 4AHUA 4DFKA 2WTUA 3H3OB 1Q81O 5HRNA 2Q0RA 1BCOA 2P9NB 1S9EA 1YVNA 3MXMA 1L3VA 1K73O 1BL3A 3SUPA 4AH9A 2Q2RA 1NJWA 3LDLA 3DYAA 4KHYA 1F21A 2O8CB 2A6AA 1WSEA 2G8UA 1SKWA 5AQSA 1TGOA 3WNEA 1NM1A 1RBVA 3JXUA 1HMVA 3ZX2A 5ADXH 3P39A 4E7HA 3KKRA 3JYTA 1S5JA 4W5TA 2E4LA 3CQXA 3M8SA 3AVJA 3ULEB 2YKNA 5LMNK 4OKEA 3SJJA 3QB0A 1SQKA 3MEEA 4JKCA 1BQNA 3NVMA 1ZBSA 3WNHA 4CZKA 3OYJA 4ID1A 2F4VK 3KWIA 2NZTA 1YI2N 5JLHA 1A5XA 1YT3A 4BRQA 1JLBA 3IS9A 2O8BB 4FJGA 3DRPA 3PIPL 1ZBFA 5J2QA 3NGZA 1RTJA 3Q7CA 1W97L 1CLQA 1Z25A 2FF3B 3UIQA 1TVRA 5J1EA 3ENHA 4HUGA 4OGEA 1BG3A 4H5VA 4DSIA 4XH1A 1K8KA 5LJWA 3V9SA 2P9LA 4OPAA 4KPYA 1QHAA 4DTOA 2HOEA 1QSYA 1RBUA 3AVGA 2RHKA 4CGDA 5I9EB 4FZYA 2IC3A 3DRSA 3CQ8A 1Q9XA 5AQZA 1HR0K 3A2FA 3U9ZA 1UOCA 4YDUA 1M1KO 1HNXK 4CGIA 2HVHA 3ZEUA 4L3QA 4KRFA 1HJOA 1W2BM 5BPMA 3SYZA 3QNNA 4RW7A 1G15A 4C1NK 2R7YA 1TV6A 4JKEA 4DSJA 3FZHA 3F5TA 2HHQA 1XUPO 3RVCA 3VOVA 4FLYA 3CD6N 3KD5E 4R5PA 3DLRA 2AJQA 3LP3A 3O9RA 2ITMA 3V81A 3THXA 2YV0X 3NGYA 4JEPA 5LY3A 1BU6O 2NLXA 3CI5A 1EXQA 2AP1A 1I39A 4FJXA 1YAGA 5HRPA 3DRRA 4C8LA 5DK5A 4DUYK 2RKIA 2RF2A 4QS9A 2GWJA 4A57A 3EKUA 1JXEA 3DLGA 4CEBA 3C6TA 3NAEA 3WNGA 5AQOA 3B6OA 2RE2A 1HLUA 5AQTA 5EXWA 4N56A 3BP8A 1TYQB 4KHSA 1RBSA 5FROA 1KFSA 5MLCQ 3ZETB 3AVCA 3TAPA 3AVBA 4BC4A 4FJLA 5A2QO 1JXBA 3VF2A 4KTQA 3M8PA 3H46O 3IFRA 3U6FA 1S1TA 4DV0K 2P9SB 1CXUA 1L3SA 4QOZB 1I3AA 4KH4A 5E84A 3S3NA 4C8OA 5AQNA 4DR2K 3QESA 4A2BA 1Q86O 2HHSA 3LDQA 1QQMA 4CJ3A 2E5LK 3O8MA 1VQNN 4X66K 4N41A 2HBMA 2Q1NA 3H1QA 3RSEA 5AQLA 1IKWA 3L2UA 3OVNA 2QK9A 1RDWX 5B8HA 2A40A 3KKSA 3LZIA 1KVCA 3K58A 4BGAA 2QA4N 3TPQA 2F8TA 3AVNA 3ID8A 2ASOA 2YCHA 3MXIA 1HUXA 3VGMA 4F3OA 1RBRA 3TANA 4CEDA 4E1MA 3VEZA 2GWKA 3I55N 4DU1A 1WLJA 4JKBA 4K43A 4CFCA 3THWB 4KHUA 3QEWA 4IWVA 5CY4A 5KRTA 4DTJA 4BRIA 2FSJA 4R79A 3K0SA 3OYAA 4IOCL 2E8AA 1JLFA 4H0VB 1BO5O 4AILC 1J6ZA 1TL1A 1TUYA 3V9UA 4CBWA 3AGKA 5F1XA 2VG6A 4F8RA 4J8FA 3G10A 2GBZA 5SWMA 2W6KA 3QFUA 2I7NA 1Q8IA 3MXJA 5DM6L 1YIJN 3MDQA 3IDHA 2ASMA 1V4TA 4K42A 3QICA 2E6MA 4V19S 2XHBA 3QDKA 2OCEA 1KAXA 4H4OA 1T03A 4JI2K 4DG1A 4IFYA 2FBVA 1NLVA 1MA9B 1KD1O 4GV3A 3SV3A 3VEWA 3W0LA 4O0JA 3NMUA 3OYCA 3TTFA 1KQSM 5AFUH 1EX4A 4KV8A 1EKEA 2BANA 4BACA 1KVBA 1UA1A 4WQ5C 4H0TB 4JI4K 1HPZA 4CJPA 4KREA 4KI4A 3DXMB 3G4SN 4ZTJA 4LFBK 4IG0A 1GOBA 1TAUA 4FLUA 4FZXC 2XY5A 3THYA 4PY5A 3NF8A 3SQ4A 4DV7K 1DT9A 4B9MA 3TSQA 3IRXA 3LP0A 4BQLA 1LAVA 4LH5A 4CJKA 3KLHA 1E4FT 2IIRA 1HYVA 1HNWK 2VG5A 4B3TK 3MX2A 4LSLA 1NOZA 2KFNA 4RG8A 5JICA 3L3UA 2XO7A 4FJNA 4CIGA 1GLJO 3S9HA 5IWAK 3KLGA 3CJCA 1S22A 2HHXA 5ADXA 1S6QA 4CVNE 3D2EB 2YHWA 3OYEA 3RRHA 1NMDA 2IVNA 3LALA 3HP9A 2EWSA 3K5OA 3SJHA 4H8KA 2EX3A 3PSIA 3L4QA 4FJJA 2OZMA 2B5JA 4CESA 4DFPA 3CCEN 3WEEA 4Z94A 4KHNA 5T7BA 1RTDA 4JLHA 4LSNA 1ZBIA 4AM6A 4DR7K 5CE3A 2B6AA 3J7YP 3QBWA 4QS7A 1EETA 3M3ZA 1YTAA 2ZD1A 4ILJA 4O4GA 3I8DA 4CHYA 3L2RA 4OJRA 2KTQA 3CJBA 4MQ3A 4BRLA 5CZ2A 3SCXA 4FJ9A 2CH5A 4FM2A 1K6YA 1J5EK 1VAZA
chains in the Genus database with same CATH topology
4I7FA 4F2RA 3SQ1A 3LAMA 1JL2A 1NKCA 1VSHA 3KIOA 5HRSA 3C94A 4N76A 3P5JA 1TKTA 2HNZA 1CXQA 4FVMA 4W5QA 4DU4A 2HNYA 3ZT2A 3QEIA 1REVA 4FLWA 1JLEA 5FRMA 1UA0A 3MEGA 1QQCA 3ZSWA 1ZYQA 4KI6A 4AHSA 1VSKA 1XHXA 4FW2A 4B9TA 5HBMA 1HNVA 2FC0A 1ASVA 1RBTA 4CK2A 4EP4A 3F73A 2D0CA 1TK5A 4BWJA 3AV9A 3IAYA 4GMJB 1X1PA 2Z1JA 3DLKA 3VQEA 4CJWA 3OYGA 3KJVA 2RPIA 1Q9YA 2DY4A 1RTHA 3LPUA 3LAKA 1FKOA 3TABA 2PY5A 1XWLA 3DI6A 4DQQA 3DMJA 4CHNA 3VQQA 1HYZA 2XY8A 3PO5A 4FLVA 1RTIA 5HLFA 3K5LA 1SL2A 4F4KA 1VSDA 3HSTB 1T8EA 3PO4A 1BISA 4CJLA 3S3MA 1U47A 3O4NA 3NH1A 3NHGA 1RNHA 3VQDA 1J9AA 1QS4A 4OGCA 3SZ2A 3KD1E 1TKZA 1IO2A 2Z1GA 4CHZA 3SQ2A 4M45A 4B8CA 5HROA 3THVA 2HHTA 2BGGA 3TAGA 3NFAA 3HVRA 3SPZA 2OA8A 1NJYA 4EZ6A 4ZTFA 4KTWA 3MAQA 1SL1A 1CZ9A 4DTXA 3KTQA 4BE1A 1HJRA 4B08A 4FYDA 2FBYA 4AHVA 5JS1A 2F8SA 3DLEA 2KW4A 1BQMA 4CJTA 4DQPA 3K57A 3KLIA 1SV5A 3NH2A 1NK9A 2OYQA 2KZMA 2GV9A 3FFIA 1VSEA 5C25A 2ETJA 4W5OA 4OPKA 3OYIA 3ULDA 1D9DA 3T3FA 1N6QA 2G8KA 4E0DA 4OKKA 1WNSA 1JLAA 2YHAA 1JLGA 1FK9A 2Q3SA 4EP5A 3NH0A 3HT3A 3NDKA 3TAFA 1ASUA 1J54A 2Y1JA 1NK5A 1WSGA 3C95A 2YNHA 2NUBA 1HYSA 3I0SA 1U4BA 4KKOA 4Y1DA 1J5OA 2VWJA 2LSNA 4DQRA 1DLOA 3LP2A 5EU7A 3MEDA 4HUFA 4DTUA 3RMDA 3DLHA 2W42A 3NCIA 4F2SA 4BDZA 1S9GA 1B9FA 2ZE2A 3BGRA 3NF7A 3HPGA 4CJQA 2P5OA 3K2PA 3VQ6A 3P83D 1S1XA 3EYZA 3AVIA 5SZTA 4AHTA 3TWHA 2P1JA 1NK7A 3CG7A 4CCHA 3RTVA 4CF9A 4M3TA 3PY8A 4FJKA 4CEOA 3VQ4A 4AHUA 2P5GA 2JLEA 4DFKA 1BIUA 4MFBA 3ZSQA 3OYFA 1U45A 3RR7A 5HRNA 1IKYA 1NKBA 1BCOA 3QO9A 1S9EA 4NYFA 3MXMA 1L3VA 1BL3A 3SUPA 4K8XA 4AH9A 1U04A 3QNOA 1NJWA 1JL1A 3DYAA 4KHYA 1F21A 2G8WA 4N47A 1WSEA 3U3GA 4CF2A 1LWCA 3HVTA 1SKWA 1WSFA 2G8UA 4KB0A 5KGWA 2YKMA 3TARA 4BDPA 4DSFA 1WSIA 1TGOA 3VQAA 2F96A 4FM1A 2IOCA 4HUEA 3AA5X 1L3TA 3WNEA 3PX0A 1YTUA 3QEXA 1RBVA 1HMVA 1D8YA 1XI1A 3ZSOA 2QKKA 3T1AA 4RW6A 4JS5A 2OPQA 4AHRA 4E7HA 3OJUA 4B9NA 4HVJA 4FK4A 3KKRA 4I2QA 1QE1A 2A1SA 3JYTA 3LPTA 3RWUA 4YNQA 1NJZA 1S5JA 4W5TA 4ELVA 2E4LA 3VQ5A 5HRRA 1SKRA 3M8SA 4M3UA 3AVJA 4CJRA 1S1VA 2YKNA 4RW8A 1XHZA 1JKHA 3OYHA 3OS2A 1NKEA 4OKEA 3SJJA 4E89A 4CERA 1S1UA 3MEEA 4O44A 3VA3A 3KLFA 3HPHA 3TAQA 1RDAA 3NBPA 4DS4A 1BQNA 3WNHA 3OYJA 1VSIA 2OZSA 4CGGA 4ID1A 3NF9A 3HK2A 2X78A 1VSMA 1VSLA 1A5XA 1YT3A 1BI4A 1KTQA 1JLBA 3IS9A 4IFVA 1N5YA 1KSPA 4CF8A 4FJGA 3DRPA 1U48A 5J2QA 1ZBFA 2FBTA 4KTZA 3NGZA 4LY7A 4NCAA 3OY9A 1RTJA 1CLQA 4FCYA 1Z25A 3UIQA 4J2DA 1TVRA 5J1EA 4HUGA 4M42A 4OGEA 1IH7A 4TSXA 4DF4A 4DSIA 5HP1A 1D9FA 4FK2A 2QXFA 1TKDA 2VWKA 2YNIA 4HCCA 4CIFA 4FLXA 2G8VA 3V9SA 4RW4A 4XIUA 3OYLA 2XY6A 2D0BA 2HW3A 4KPYA 5CYMA 4DTOA 1ITGA 5J2PA 1QSYA 2HHWA 1RBUA 3AVGA 3ASMA 3ZT4A 3OJSA 4CGDA 3K5MA 1X9WA 4FZYA 4C8KA 3SUQA 3AO5A 2IAJA 2IC3A 4ID5A 4DFMA 3VA0A 4FJMA 4CGJA 2HHVA 3DRSA 3CQ8A 1BIZA 4DLGA 1Q9XA 4B9VA 3C6UA 1W0HA 3A2FA 4Z0UA 4KB1A 4CJVA 2KZZA 1UOCA 4O55A 4E7KA 3D45A 4H4MA 4CGIA 3TR8A 3ZT1A 4DSEA 1SL0A 3M8QA 2HVHA 4KAZA 3ALYA 3AA4A 4ZHRA 4KRFA 4CFBA 3OYBA 3SYZA 1UAXA 4C8NA 3QNNA 4RW7A 1G15A 2YNGA 4I9LA 1KFDA 4DU3A 2R7YA 1TV6A 4DSJA 5C42A 1C6VA 1RT2A 4FJ8A 5J2NA 2HHQA 4FLYA 3EZ5A 4B9LA 3ZT3A 3KD5E 4R5PA 1JLQA 1VRTA 3DLRA 3ZSVA 3DOLA 4CJFA 4CGHA 4B9SA 1X9MA 2AJQA 5E41A 3LP3A 1BGXT 4GVMA 5CZ1A 3V81A 1NK8A 4KFBA 4FJIA 3TAEA 2OPSA 2YV0X 3HL8A 3NGYA 3V9WA 3SNNA 2Z1IA 4BE0A 3G0ZA 1GOAA 4QCLA 3AVHA 4IKFA 4FJHA 2E6LA 1EXQA 4Q0BA 3VN5A 4M3ZA 3AVAA 1I39A 4DTRA 1RT1A 2QKBA 4FXDA 4Z4GA 4FJXA 1HQEA 1HRHA 4LH4A 4W5RA 1LW2A 5HRPA 4FM0A 3DRRA 3HO1A 3O3FA 4C8LA 4DSKA 5DK5A 3ZSRA 2RKIA 2RF2A 2HMIA 3SV4A 3RRGA 2X6SA 4KHQA 3HPOA 5J2MA 4IBNA 3AVMA 3ZSYA 1JXEA 3DLGA 4CEBA 3C6TA 4M3XA 1IKVA 3KK2A 2IGIA 1FXXA 4CF1A 1NJXA 3NAEA 3DOKA 3WNGA 4CJEA 1LWFA 4UQGA 3ZT0A 4BDYA 3B6OA 4CEAA 4C8MA 4GW6A 1A5WA 3SI6A 3OYNA 3WNFA 1S6PA 1RILA 4DFJA 2PZSA 4N56A 3F9KA 2OPPA 4KHSA 4K8ZA 1RBSA 5FROA 1WAJA 1KFSA 3OS0A 1QSLA 1DTTA 3TI0A 4DS5A 3AVCA 4E7JA 1IKXA 3TAPA 4M3WA 3AVBA 1HQUA 1CZBA 4FJLA 4DQSA 1JXBA 4CEQA 4CHOA 5KGXA 4KTQA 3M8PA 4CEFA 3ZSXA 3V9ZA 1S1TA 3U6FA 3OS1A 1CXUA 4LD0A 1L3SA 1LW0A 2PYLA 3VQCA 3NF6A 2ZQBA 1VSFA 4QOZB 1RCHA 1Z26A 4CK1A 4JRQA 4HHTA 4FJ5A 5C24A 1I3AA 2BE2A 3CFOA 4C8OA 1RDBA 3S3NA 3K59A 3QESA 2DTUA 1B9DA 3PX4A 2HHSA 1NK4A 2HHUA 1GOCA 4CJ3A 2IDOA 1RT4A 1VSJA 4CK3A 4JS4A 4FZZA 4FLZA 1NK0A 3AO1A 3VQ9A 1UWBA 4DMNA 1XC9A 4J2AA 3OYMA 2HNDA 3SQ0A 4N41A 2O4IA 4DSLA 5KRSA 3AVFA 1IKWA 3L2UA 1WAFA 3OVNA 4B8AB 4PUOA 2QK9A 2DFHA 3KKSA 3LZIA 1EP4A 4KHWA 1C1AA 3T19A 3RR8A 4CFDA 1KVCA 1VK0A 1S1WA 4E3SA 5D3GA 3SUOA 2A1RA 3K58A 4N5SA 4Z4IA 4E1NA 2F8TA 1Y97A 3V9XA 1WSJA 3AVNA 4AHCA 1MU2A 4Q5VA 3TAMA 3MXIA 3LWMA 3LZJA 4F3OA 3ZSZA 1RBRA 1NK6A 3TANA 1RDDA 4CEDA 4NCGA 4O5BA 1B92A 1T05A 4CJUA 4E1MA 2FBXA 1YVUA 5K14A 3PUFA 1TAQA 5JS2A 3ZCMA 4DU1A 1WLJA 2WONA 1KVAA 4OLBA 3S3OA 1C0UA 2G8HA 3QERA 1J53A 3QEPA 3SPYA 3B6PA 3VQBA 5DMRA 4CFCA 1LWEA 4KHUA 3QEWA 1JLCA 4CECA 3HM9A 5CY4A 5KRTA 4DTJA 1IG9A 1ZBHA 2I5JA 3OYAA 3QEVA 1WN7A 4DQIA 3BDPA 2HVIA 2B4JA 4M3YA 4EZ9A 4JRPA 1JLFA 4RW9A 3CM6A 1TL3A 4IDKA 4OKJA 3NE6A 4AILC 1KRPA 1TL1A 3V9UA 4J2EA 3I0RA 2PYJA 1RDCA 4PA1A 3HXMA 4DF8A 1X9SA 1T7PA 2VG6A 4F8RA 2G8FA 2YHBA 3G10A 4PQUA 4W5NA 4E7LA 2GBZA 1BHLA 3KK1A 5SWMA 3KK3A 1WSHA 4DTMA 3AO2A 5FRNA 1Q8IA 3MXJA 3VQPA 1TK8A 4CF0A 3CFPA 2RN2A 1W9HA 5KTQA 4DTNA 2EHGA 4YFUA 3QIOA 2DFEA 2E6MA 2HB5A 3L2WA 2Z1HA 3NGIA 4DLEA 2XHBA 1T03A 4H4OA 4Y1CA 4HCBA 4FK0A 3DM2A 4CHPA 1KLMA 4DG1A 4IFYA 2FBVA 2BDPA 4OLAA 3SV3A 1C1CA 4O0JA 3L2QA 3U3YA 4CFAA 4CEZA 2ATQA 5KI6A 3OYCA 3QINA 2O4GA 1O1WA 4QAGA 1A5VA 4O0IA 3LDSA 1QTMA 3RMAA 1EX4A 4KV8A 1EKEA 2KQ2A 5FDLA 2BANA 4BACA 1KVBA 1UA1A 4DWIA 4OPJA 5I3UA 1HPZA 3QLHA 3E01A 2OPRA 4CJPA 4L8RB 4Z4EA 4E7IA 2VG7A 4KREA 4FLTA 4KI4A 4WE1A 4IG3A 4ZTJA 4ELTA 3HYFA 3L8BA 1L3UA 4IG0A 1GOBA 1QHTA 4B3OA 1TAUA 3AA2A 1BI4B 4OVLA 3V6DA 4FLUA 1FKPA 4DTPA 4FZXC 2XY5A 2ITGA 3K5NA 3CFRA 4DTSA 3NF8A 4G1QA 3OYKA 4PY5A 3L2VA 3SQ4A 3QETA 4BE2A 4B9MA 3IRXA 1HNIA 3LP0A 1RT7A 1LAVA 3LP1A 4F3TA 3MECA 3AA3A 4LH5A 4CJKA 1DTQA 1BCMA 4NYNA 3KLHA 2KFZA 1HYVA 4B9UA 3H08A 4FJ7A 2VG5A 3V4IA 4I9QA 3SUNA 4LSLA 4Z4CA 1R0AA 1NOZA 1ZBUA 2KFNA 4RG8A 2XO7A 3L3UA 4CEEA 3LWLA 4FJNA 4CIGA 3QIPA 4Z4FA 1C0MA 3S9HA 3KLGA 1RT5A 2HHXA 1TK0A 1S6QA 4CJ5A 3P1GA 3ISNC 4ELUA 3OYEA 3RRHA 2XY7A 3CM5A 4CGFA 4I2PA 2XRIA 4PWDA 5CYQA 1C1BA 3LANA 2YNFA 4BWMA 3LALA 3HP9A 1ZBLA 3K5OA 4CE9A 4H8KA 1RT6A 3PX6A 3JSMA 2EX3A 2G8IA 3V1RA 3AVLA 4Z4HA 4FJJA 2OZMA 4FW1A 2GUIA 3EY1A 3L3VA 3VQ8A 4E19A 2B5JA 4CESA 4DFPA 1C0TA 4CJSA 2X74A 2WOMA 1TKXA 1SKSA 4HTUA 2IS3A 3HP6A 4J2BA 3IG1A 5T7BA 1RT3A 4JLHA 1RTDA 1QSSA 4KHNA 3O4QA 4LSNA 3OYDA 3PV8A 3KLEA 1ZBIA 3V1QA 1D5AA 1ASWA 4ICLA 1KCFA 2B6AA 1SUQA 3AVKA 4M41A 3AO4A 4CHQA 3D0PA 3RMCA 1EETA 2D5RA 3AO3A 3V1OA 3O3HA 1KLNA 1YTAA 2ZD1A 4KO0A 2P51A 2DFFA 4O4GA 4M3RA 2X6NA 3I8DA 4NCBA 4CHYA 3M8RA 3ITHA 3L2RA 3RMBA 4CJ4A 4OJRA 3HJFA 4CIEA 2D0AA 3DLBA 4MQ3A 2KTQA 3O3GA 1LAWA 1VRUA 5CZ2A 2Y1IA 2JGUA 3VQ7A 3SCXA 1L5UA 1NOYA 4FJ9A 5I42A 1LV5A 3CYMA 4FM2A 1K6YA 1U49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7F A;  4F2R A;  3SQ1 A;  3LAM A;  1JL2 A;  1NKC A;  1VSH A;  3KIO A;  5HRS A;  3C94 A;  4N76 A;  3P5J A;  1TKT A;  2HNZ A;  1CXQ A;  4FVM A;  4W5Q A;  4DU4 A;  2HNY A;  3ZT2 A;  3QEI A;  1REV A;  4FLW A;  1JLE A;  5FRM A;  1UA0 A;  3MEG A;  1QQC A;  3ZSW A;  1ZYQ A;  4KI6 A;  4AHS A;  1VSK A;  1XHX A;  4FW2 A;  4B9T A;  5HBM A;  1HNV A;  2FC0 A;  1ASV A;  1RBT A;  4CK2 A;  4EP4 A;  3F73 A;  2D0C A;  1TK5 A;  4BWJ A;  3AV9 A;  3IAY A;  4GMJ B;  1X1P A;  2Z1J A;  3DLK A;  3VQE A;  4CJW A;  3OYG A;  3KJV A;  2RPI A;  1Q9Y A;  2DY4 A;  1RTH A;  3LPU A;  3LAK A;  1FKO A;  3TAB A;  2PY5 A;  1XWL A;  3DI6 A;  4DQQ A;  3DMJ A;  4CHN A;  3VQQ A;  1HYZ A;  2XY8 A;  3PO5 A;  4FLV A;  1RTI A;  5HLF A;  3K5L A;  1SL2 A;  4F4K A;  1VSD A;  3HST B;  1T8E A;  3PO4 A;  1BIS A;  4CJL A;  3S3M A;  1U47 A;  3O4N A;  3NH1 A;  3NHG A;  1RNH A;  3VQD A;  1J9A A;  1QS4 A;  4OGC A;  3SZ2 A;  3KD1 E;  1TKZ A;  1IO2 A;  2Z1G A;  4CHZ A;  3SQ2 A;  4M45 A;  4B8C A;  5HRO A;  3THV A;  2HHT A;  2BGG A;  3TAG A;  3NFA A;  3HVR A;  3SPZ A;  2OA8 A;  1NJY A;  4EZ6 A;  4ZTF A;  4KTW A;  3MAQ A;  1SL1 A;  1CZ9 A;  4DTX A;  3KTQ A;  4BE1 A;  1HJR A;  4B08 A;  4FYD A;  2FBY A;  4AHV A;  5JS1 A;  2F8S A;  3DLE A;  2KW4 A;  1BQM A;  4CJT A;  4DQP A;  3K57 A;  3KLI A;  1SV5 A;  3NH2 A;  1NK9 A;  2OYQ A;  2KZM A;  2GV9 A;  3FFI A;  1VSE A;  5C25 A;  2ETJ A;  4W5O A;  4OPK A;  3OYI A;  3ULD A;  1D9D A;  3T3F A;  1N6Q A;  2G8K A;  4E0D A;  4OKK A;  1WNS A;  1JLA A;  2YHA A;  1JLG A;  1FK9 A;  2Q3S A;  4EP5 A;  3NH0 A;  3HT3 A;  3NDK A;  3TAF A;  1ASU A;  1J54 A;  2Y1J A;  1NK5 A;  1WSG A;  3C95 A;  2YNH A;  2NUB A;  1HYS A;  3I0S A;  1U4B A;  4KKO A;  4Y1D A;  1J5O A;  2VWJ A;  2LSN A;  4DQR A;  1DLO A;  3LP2 A;  5EU7 A;  3MED A;  4HUF A;  4DTU A;  3RMD A;  3DLH A;  2W42 A;  3NCI A;  4F2S A;  4BDZ A;  1S9G A;  1B9F A;  2ZE2 A;  3BGR A;  3NF7 A;  3HPG A;  4CJQ A;  2P5O A;  3K2P A;  3VQ6 A;  3P83 D;  1S1X A;  3EYZ A;  3AVI A;  5SZT A;  4AHT A;  3TWH A;  2P1J A;  1NK7 A;  3CG7 A;  4CCH A;  3RTV A;  4CF9 A;  4M3T A;  3PY8 A;  4FJK A;  4CEO A;  3VQ4 A;  4AHU A;  2P5G A;  2JLE A;  4DFK A;  1BIU A;  4MFB A;  3ZSQ A;  3OYF A;  1U45 A;  3RR7 A;  5HRN A;  1IKY A;  1NKB A;  1BCO A;  3QO9 A;  1S9E A;  4NYF A;  3MXM A;  1L3V A;  1BL3 A;  3SUP A;  4K8X A;  4AH9 A;  1U04 A;  3QNO A;  1NJW A;  1JL1 A;  3DYA A;  4KHY A;  1F21 A;  2G8W A;  4N47 A;  1WSE A;  3U3G A;  4CF2 A;  1LWC A;  3HVT A;  1SKW A;  1WSF A;  2G8U A;  4KB0 A;  5KGW A;  2YKM A;  3TAR A;  4BDP A;  4DSF A;  1WSI A;  1TGO A;  3VQA A;  2F96 A;  4FM1 A;  2IOC A;  4HUE A;  3AA5 X;  1L3T A;  3WNE A;  3PX0 A;  1YTU A;  3QEX A;  1RBV A;  1HMV A;  1D8Y A;  1XI1 A;  3ZSO A;  2QKK A;  3T1A A;  4RW6 A;  4JS5 A;  2OPQ A;  4AHR A;  4E7H A;  3OJU A;  4B9N A;  4HVJ A;  4FK4 A;  3KKR A;  4I2Q A;  1QE1 A;  2A1S A;  3JYT A;  3LPT A;  3RWU A;  4YNQ A;  1NJZ A;  1S5J A;  4W5T A;  4ELV A;  2E4L A;  3VQ5 A;  5HRR A;  1SKR A;  3M8S A;  4M3U A;  3AVJ A;  4CJR A;  1S1V A;  2YKN A;  4RW8 A;  1XHZ A;  1JKH A;  3OYH A;  3OS2 A;  1NKE A;  4OKE A;  3SJJ A;  4E89 A;  4CER A;  1S1U A;  3MEE A;  4O44 A;  3VA3 A;  3KLF A;  3HPH A;  3TAQ A;  1RDA A;  3NBP A;  4DS4 A;  1BQN A;  3WNH A;  3OYJ A;  1VSI A;  2OZS A;  4CGG A;  4ID1 A;  3NF9 A;  3HK2 A;  2X78 A;  1VSM A;  1VSL A;  1A5X A;  1YT3 A;  1BI4 A;  1KTQ A;  1JLB A;  3IS9 A;  4IFV A;  1N5Y A;  1KSP A;  4CF8 A;  4FJG A;  3DRP A;  1U48 A;  5J2Q A;  1ZBF A;  2FBT A;  4KTZ A;  3NGZ A;  4LY7 A;  4NCA A;  3OY9 A;  1RTJ A;  1CLQ A;  4FCY A;  1Z25 A;  3UIQ A;  4J2D A;  1TVR A;  5J1E A;  4HUG A;  4M42 A;  4OGE A;  1IH7 A;  4TSX A;  4DF4 A;  4DSI A;  5HP1 A;  1D9F A;  4FK2 A;  2QXF A;  1TKD A;  2VWK A;  2YNI A;  4HCC A;  4CIF A;  4FLX A;  2G8V A;  3V9S A;  4RW4 A;  4XIU A;  3OYL A;  2XY6 A;  2D0B A;  2HW3 A;  4KPY A;  5CYM A;  4DTO A;  1ITG A;  5J2P A;  1QSY A;  2HHW A;  1RBU A;  3AVG A;  3ASM A;  3ZT4 A;  3OJS A;  4CGD A;  3K5M A;  1X9W A;  4FZY A;  4C8K A;  3SUQ A;  3AO5 A;  2IAJ A;  2IC3 A;  4ID5 A;  4DFM A;  3VA0 A;  4FJM A;  4CGJ A;  2HHV A;  3DRS A;  3CQ8 A;  1BIZ A;  4DLG A;  1Q9X A;  4B9V A;  3C6U A;  1W0H A;  3A2F A;  4Z0U A;  4KB1 A;  4CJV A;  2KZZ A;  1UOC A;  4O55 A;  4E7K A;  3D45 A;  4H4M A;  4CGI A;  3TR8 A;  3ZT1 A;  4DSE A;  1SL0 A;  3M8Q A;  2HVH A;  4KAZ A;  3ALY A;  3AA4 A;  4ZHR A;  4KRF A;  4CFB A;  3OYB A;  3SYZ A;  1UAX A;  4C8N A;  3QNN A;  4RW7 A;  1G15 A;  2YNG A;  4I9L A;  1KFD A;  4DU3 A;  2R7Y A;  1TV6 A;  4DSJ A;  5C42 A;  1C6V A;  1RT2 A;  4FJ8 A;  5J2N A;  2HHQ A;  4FLY A;  3EZ5 A;  4B9L A;  3ZT3 A;  3KD5 E;  4R5P A;  1JLQ A;  1VRT A;  3DLR A;  3ZSV A;  3DOL A;  4CJF A;  4CGH A;  4B9S A;  1X9M A;  2AJQ A;  5E41 A;  3LP3 A;  1BGX T;  4GVM A;  5CZ1 A;  3V81 A;  1NK8 A;  4KFB A;  4FJI A;  3TAE A;  2OPS A;  2YV0 X;  3HL8 A;  3NGY A;  3V9W A;  3SNN A;  2Z1I A;  4BE0 A;  3G0Z A;  1GOA A;  4QCL A;  3AVH A;  4IKF A;  4FJH A;  2E6L A;  1EXQ A;  4Q0B A;  3VN5 A;  4M3Z A;  3AVA A;  1I39 A;  4DTR A;  1RT1 A;  2QKB A;  4FXD A;  4Z4G A;  4FJX A;  1HQE A;  1HRH A;  4LH4 A;  4W5R A;  1LW2 A;  5HRP A;  4FM0 A;  3DRR A;  3HO1 A;  3O3F A;  4C8L A;  4DSK A;  5DK5 A;  3ZSR A;  2RKI A;  2RF2 A;  2HMI A;  3SV4 A;  3RRG A;  2X6S A;  4KHQ A;  3HPO A;  5J2M A;  4IBN A;  3AVM A;  3ZSY A;  1JXE A;  3DLG A;  4CEB A;  3C6T A;  4M3X A;  1IKV A;  3KK2 A;  2IGI A;  1FXX A;  4CF1 A;  1NJX A;  3NAE A;  3DOK A;  3WNG A;  4CJE A;  1LWF A;  4UQG A;  3ZT0 A;  4BDY A;  3B6O A;  4CEA A;  4C8M A;  4GW6 A;  1A5W A;  3SI6 A;  3OYN A;  3WNF A;  1S6P A;  1RIL A;  4DFJ A;  2PZS A;  4N56 A;  3F9K A;  2OPP A;  4KHS A;  4K8Z A;  1RBS A;  5FRO A;  1WAJ A;  1KFS A;  3OS0 A;  1QSL A;  1DTT A;  3TI0 A;  4DS5 A;  3AVC A;  4E7J A;  1IKX A;  3TAP A;  4M3W A;  3AVB A;  1HQU A;  1CZB A;  4FJL A;  4DQS A;  1JXB A;  4CEQ A;  4CHO A;  5KGX A;  4KTQ A;  3M8P A;  4CEF A;  3ZSX A;  3V9Z A;  1S1T A;  3U6F A;  3OS1 A;  1CXU A;  4LD0 A;  1L3S A;  1LW0 A;  2PYL A;  3VQC A;  3NF6 A;  2ZQB A;  1VSF A;  4QOZ B;  1RCH A;  1Z26 A;  4CK1 A;  4JRQ A;  4HHT A;  4FJ5 A;  5C24 A;  1I3A A;  2BE2 A;  3CFO A;  4C8O A;  1RDB A;  3S3N A;  3K59 A;  3QES A;  2DTU A;  1B9D A;  3PX4 A;  2HHS A;  1NK4 A;  2HHU A;  1GOC A;  4CJ3 A;  2IDO A;  1RT4 A;  1VSJ A;  4CK3 A;  4JS4 A;  4FZZ A;  4FLZ A;  1NK0 A;  3AO1 A;  3VQ9 A;  1UWB A;  4DMN A;  1XC9 A;  4J2A A;  3OYM A;  2HND A;  3SQ0 A;  4N41 A;  2O4I A;  4DSL A;  5KRS A;  3AVF A;  1IKW A;  3L2U A;  1WAF A;  3OVN A;  4B8A B;  4PUO A;  2QK9 A;  2DFH A;  3KKS A;  3LZI A;  1EP4 A;  4KHW A;  1C1A A;  3T19 A;  3RR8 A;  4CFD A;  1KVC A;  1VK0 A;  1S1W A;  4E3S A;  5D3G A;  3SUO A;  2A1R A;  3K58 A;  4N5S A;  4Z4I A;  4E1N A;  2F8T A;  1Y97 A;  3V9X A;  1WSJ A;  3AVN A;  4AHC A;  1MU2 A;  4Q5V A;  3TAM A;  3MXI A;  3LWM A;  3LZJ A;  4F3O A;  3ZSZ A;  1RBR A;  1NK6 A;  3TAN A;  1RDD A;  4CED A;  4NCG A;  4O5B A;  1B92 A;  1T05 A;  4CJU A;  4E1M A;  2FBX A;  1YVU A;  5K14 A;  3PUF A;  1TAQ A;  5JS2 A;  3ZCM A;  4DU1 A;  1WLJ A;  2WON A;  1KVA A;  4OLB A;  3S3O A;  1C0U A;  2G8H A;  3QER A;  1J53 A;  3QEP A;  3SPY A;  3B6P A;  3VQB A;  5DMR A;  4CFC A;  1LWE A;  4KHU A;  3QEW A;  1JLC A;  4CEC A;  3HM9 A;  5CY4 A;  5KRT A;  4DTJ A;  1IG9 A;  1ZBH A;  2I5J A;  3OYA A;  3QEV A;  1WN7 A;  4DQI A;  3BDP A;  2HVI A;  2B4J A;  4M3Y A;  4EZ9 A;  4JRP A;  1JLF A;  4RW9 A;  3CM6 A;  1TL3 A;  4IDK A;  4OKJ A;  3NE6 A;  4AIL C;  1KRP A;  1TL1 A;  3V9U A;  4J2E A;  3I0R A;  2PYJ A;  1RDC A;  4PA1 A;  3HXM A;  4DF8 A;  1X9S A;  1T7P A;  2VG6 A;  4F8R A;  2G8F A;  2YHB A;  3G10 A;  4PQU A;  4W5N A;  4E7L A;  2GBZ A;  1BHL A;  3KK1 A;  5SWM A;  3KK3 A;  1WSH A;  4DTM A;  3AO2 A;  5FRN A;  1Q8I A;  3MXJ A;  3VQP A;  1TK8 A;  4CF0 A;  3CFP A;  2RN2 A;  1W9H A;  5KTQ A;  4DTN A;  2EHG A;  4YFU A;  3QIO A;  2DFE A;  2E6M A;  2HB5 A;  3L2W A;  2Z1H A;  3NGI A;  4DLE A;  2XHB A;  1T03 A;  4H4O A;  4Y1C A;  4HCB A;  4FK0 A;  3DM2 A;  4CHP A;  1KLM A;  4DG1 A;  4IFY A;  2FBV A;  2BDP A;  4OLA A;  3SV3 A;  1C1C A;  4O0J A;  3L2Q A;  3U3Y A;  4CFA A;  4CEZ A;  2ATQ A;  5KI6 A;  3OYC A;  3QIN A;  2O4G A;  1O1W A;  4QAG A;  1A5V A;  4O0I A;  3LDS A;  1QTM A;  3RMA A;  1EX4 A;  4KV8 A;  1EKE A;  2KQ2 A;  5FDL A;  2BAN A;  4BAC A;  1KVB A;  1UA1 A;  4DWI A;  4OPJ A;  5I3U A;  1HPZ A;  3QLH A;  3E01 A;  2OPR A;  4CJP A;  4L8R B;  4Z4E A;  4E7I A;  2VG7 A;  4KRE A;  4FLT A;  4KI4 A;  4WE1 A;  4IG3 A;  4ZTJ A;  4ELT A;  3HYF A;  3L8B A;  1L3U A;  4IG0 A;  1GOB A;  1QHT A;  4B3O A;  1TAU A;  3AA2 A;  1BI4 B;  4OVL A;  3V6D A;  4FLU A;  1FKP A;  4DTP A;  4FZX C;  2XY5 A;  2ITG A;  3K5N A;  3CFR A;  4DTS A;  3NF8 A;  4G1Q A;  3OYK A;  4PY5 A;  3L2V A;  3SQ4 A;  3QET A;  4BE2 A;  4B9M A;  3IRX A;  1HNI A;  3LP0 A;  1RT7 A;  1LAV A;  3LP1 A;  4F3T A;  3MEC A;  3AA3 A;  4LH5 A;  4CJK A;  1DTQ A;  1BCM A;  4NYN A;  3KLH A;  2KFZ A;  1HYV A;  4B9U A;  3H08 A;  4FJ7 A;  2VG5 A;  3V4I A;  4I9Q A;  3SUN A;  4LSL A;  4Z4C A;  1R0A A;  1NOZ A;  1ZBU A;  2KFN A;  4RG8 A;  2XO7 A;  3L3U A;  4CEE A;  3LWL A;  4FJN A;  4CIG A;  3QIP A;  4Z4F A;  1C0M A;  3S9H A;  3KLG A;  1RT5 A;  2HHX A;  1TK0 A;  1S6Q A;  4CJ5 A;  3P1G A;  3ISN C;  4ELU A;  3OYE A;  3RRH A;  2XY7 A;  3CM5 A;  4CGF A;  4I2P A;  2XRI A;  4PWD A;  5CYQ A;  1C1B A;  3LAN A;  2YNF A;  4BWM A;  3LAL A;  3HP9 A;  1ZBL A;  3K5O A;  4CE9 A;  4H8K A;  1RT6 A;  3PX6 A;  3JSM A;  2EX3 A;  2G8I A;  3V1R A;  3AVL A;  4Z4H A;  4FJJ A;  2OZM A;  4FW1 A;  2GUI A;  3EY1 A;  3L3V A;  3VQ8 A;  4E19 A;  2B5J A;  4CES A;  4DFP A;  1C0T A;  4CJS A;  2X74 A;  2WOM A;  1TKX A;  1SKS A;  4HTU A;  2IS3 A;  3HP6 A;  4J2B A;  3IG1 A;  5T7B A;  1RT3 A;  4JLH A;  1RTD A;  1QSS A;  4KHN A;  3O4Q A;  4LSN A;  3OYD A;  3PV8 A;  3KLE A;  1ZBI A;  3V1Q A;  1D5A A;  1ASW A;  4ICL A;  1KCF A;  2B6A A;  1SUQ A;  3AVK A;  4M41 A;  3AO4 A;  4CHQ A;  3D0P A;  3RMC A;  1EET A;  2D5R A;  3AO3 A;  3V1O A;  3O3H A;  1KLN A;  1YTA A;  2ZD1 A;  4KO0 A;  2P51 A;  2DFF A;  4O4G A;  4M3R A;  2X6N A;  3I8D A;  4NCB A;  4CHY A;  3M8R A;  3ITH A;  3L2R A;  3RMB A;  4CJ4 A;  4OJR A;  3HJF A;  4CIE A;  2D0A A;  3DLB A;  4MQ3 A;  2KTQ A;  3O3G A;  1LAW A;  1VRU A;  5CZ2 A;  2Y1I A;  2JGU A;  3VQ7 A;  3SCX A;  1L5U A;  1NOY A;  4FJ9 A;  5I42 A;  1LV5 A;  3CYM A;  4FM2 A;  1K6Y A;  1U49 A; 
#chains in the Genus database with same CATH topology
 2NRX A;  3SQ1 A;  1JL2 A;  3DWL A;  1TKT A;  4FVM A;  1CXQ A;  2HBJ A;  3LL3 A;  5FRM A;  3D2F A;  3MEG A;  2Q97 A;  1VSK A;  1RBT A;  4BC3 A;  1TK5 A;  4NXN K;  5TKY A;  2WC9 A;  3DLK A;  2O8D B;  4CJW A;  3OYG A;  2RPI A;  3G6E N;  1RTH A;  3OBY A;  2ZF5 O;  3CHW A;  1IG8 A;  4FLV A;  3L4I A;  1T8E A;  1NBW A;  1X3M A;  4RCH A;  2CGK A;  1RNH A;  3VGL A;  4BRA A;  3SZ2 A;  1S3X A;  1YXQ A;  4EHT A;  3THV A;  2YHX A;  4I6M B;  4EZ6 A;  4JI6 K;  1SL1 A;  4DTX A;  4BE1 A;  2A3Z A;  4B08 A;  2F8S A;  4FWM A;  4CZL A;  3MN9 A;  2A42 A;  2OYQ A;  2PBD A;  4JHD B;  3FFI A;  4DV5 K;  3ATU A;  2FSK A;  4DUZ K;  2UXB K;  4IO8 A;  4M7Y A;  1NMN A;  4JI5 K;  1MWM A;  4YOX A;  2E1Z A;  4EP5 A;  4BRC A;  1HYS A;  4K25 A;  3LDO A;  3LP2 A;  4DTU A;  4HUF A;  4F2S A;  4OX9 K;  4BDZ A;  1S9G A;  3NF7 A;  3VQ6 A;  3EYZ A;  1NGJ A;  4B1W B;  2P1J A;  4FSV A;  1NK7 A;  4M3T A;  3CCU N;  4BR4 A;  1SAZ A;  4IXC A;  3C7N B;  3ATV A;  3ZSQ A;  3G71 N;  1IKY A;  1V4S A;  3QO9 A;  1N34 K;  3CC7 N;  1U04 A;  3R6M A;  3DAW A;  3L6Q A;  4DV6 K;  4N47 A;  2NRR A;  4CF2 A;  1WSF A;  4EHU A;  2YKM A;  3TAR A;  4BDP A;  4CI6 A;  2NRV A;  4DSF A;  3VQA A;  3H1V X;  3QEX A;  4FWS A;  1D8Y A;  1XMO K;  4JD2 B;  4JS5 A;  1ZXO A;  3K9J A;  4B9N A;  1QE1 A;  1U6Z A;  2A1S A;  4MDB A;  1GLD G;  1SKR A;  4KH6 A;  1U2V B;  3JAM O;  4CJR A;  4DR1 K;  4RW8 A;  1XHZ A;  2QI2 A;  3OYH A;  3OS2 A;  1NKE A;  3VEX A;  4E89 A;  4YOW A;  2IVO A;  3VA3 A;  3CPW M;  3KLF A;  3TAQ A;  5C2D A;  3R3L A;  4CGG A;  3NF9 A;  3HK2 A;  1VSM A;  5BRD A;  1HKG A;  1BI4 A;  1N5Y A;  3EZW A;  4NCA A;  4H5W A;  5C10 A;  4FCY A;  4M42 A;  1IH7 A;  4DF4 A;  5HP1 A;  1D9F A;  2QW9 A;  2QXF A;  1TKD A;  4FLX A;  2G8V A;  4XIU A;  2XY6 A;  3C6H A;  2HW3 A;  2HHW A;  3OJS A;  1ZC6 A;  4ID5 A;  3VA0 A;  2E88 A;  1VQ6 N;  4BRN A;  4K0K K;  4DLG A;  2BUP A;  4Z0U A;  4CJV A;  4KB1 A;  4BC5 A;  3D45 A;  4H4M A;  5AZI A;  1SL0 A;  3M8Q A;  3ALY A;  3AA4 A;  4CZF A;  1NGD A;  3P38 A;  2D1K A;  4C8N A;  1ILY A;  2YNG A;  3WUH A;  3BY5 A;  3IMX A;  3T1H K;  1C6V A;  5KPR A;  3ZT3 A;  2F9W A;  1JLQ A;  5AFU A;  3ZSV A;  4CGH A;  5E41 A;  1BGX T;  1YIT N;  3WXK A;  2P9K A;  1BA0 A;  3TU5 A;  3HL8 A;  3HRG A;  4IKF A;  4FWO A;  2P9U B;  2E6L A;  3LM2 A;  2IVP A;  3B8A X;  4BR9 A;  4DTR A;  4FXD A;  4A2A A;  2O8F A;  1HRH A;  4FM0 A;  3HO1 A;  2UUA K;  1VQM N;  3O3F A;  4DSK A;  1IV0 A;  4LF6 K;  3EO3 A;  3ZSY A;  3KK2 A;  2IGI A;  1FXX A;  3I56 N;  1NJX A;  4UQG A;  1LWF A;  4BDY A;  2O8E B;  3TSU A;  2Q36 A;  3WNF A;  1S6P A;  4PKH A;  2ZJP L;  3J8A A;  4BRD A;  5GAD P;  3D7E O;  1E4G T;  2WUS A;  1DTT A;  1DGK N;  4DR4 K;  5AQY A;  4CHO A;  5KGX A;  5AZJ A;  4CEF A;  4YOU A;  2HST A;  1K8K B;  5M1O A;  2P9L B;  3OS1 A;  3VQC A;  3CCQ N;  4X62 K;  3J7A P;  3CER A;  3PLA A;  1B9D A;  2VQF K;  4B3S K;  3UE5 A;  5EOY A;  1GOC A;  3LDN A;  4CK3 A;  4FLZ A;  4G9Z A;  1X3N A;  3VQ9 A;  4DMN A;  1UWB A;  1XC9 A;  2Q0U A;  1K9M O;  4DSL A;  5KRS A;  4KHP K;  3A8Y A;  4IJN A;  2DFH A;  4YDU C;  1EP4 A;  5KQ8 A;  4CFD A;  3SUO A;  2A1R A;  1JCF A;  5KPZ A;  4AHC A;  4BG8 A;  3LZJ A;  3ZSZ A;  1IJJ A;  2H3G X;  1NK6 A;  4NCG A;  4O5B A;  1B92 A;  2VGM A;  5M1N A;  2A5X A;  4MLE A;  4CJU A;  3LDP A;  3H45 C;  3P4I A;  4KBO A;  4BRF A;  2QWM A;  5K14 A;  4CBU A;  1WBD A;  1KXP A;  3BF3 A;  5JS2 A;  2WON A;  1KVA A;  3I8B A;  5KPT A;  3S3O A;  2G8H A;  3QER A;  1J53 A;  3SPY A;  3B6P A;  1JLC A;  4CEC A;  1IG9 A;  2JWL A;  4IZ9 A;  3J80 O;  1WN7 A;  4DQI A;  2P9N A;  3E9O A;  1QZ5 A;  4M3Y A;  3F2K A;  2HMP A;  3T7Z A;  3CC2 N;  1WBB A;  2O8C A;  2PYJ A;  1N32 K;  3HXM A;  1X9S A;  3AY9 A;  2G8F A;  3U4L A;  4CZJ A;  4GKK K;  1BHL A;  3KK3 A;  1HNZ K;  2YJE A;  1NGI A;  4DTM A;  1RFQ A;  4A5A A;  5FRN A;  1OH8 A;  3VQP A;  3GBT A;  3ULE A;  3QIO A;  4MO5 A;  3L2W A;  4Y1C A;  3DM2 A;  2FLO A;  4PKI A;  2ASP A;  3U3Y A;  4CFA A;  1O1W A;  1A5V A;  4O0I A;  4IEE A;  1QTM A;  3RMA A;  4JI3 K;  3UKR A;  4B3R K;  4OPJ A;  2HBL A;  2O8B A;  4L8R B;  4PKG A;  4E7I A;  4AF1 A;  4ELT A;  4DTS A;  2V7Y A;  3OYK A;  3QET A;  4BE2 A;  3J7Z O;  4DV4 K;  1HNI A;  1RT7 A;  4F3T A;  1NNE A;  1DTQ A;  1BCM A;  4H03 B;  3CMA N;  2KFZ A;  2NRW A;  3O80 A;  1VQK N;  4NB4 A;  4F9O A;  1ZBU A;  3CPE A;  3KHY A;  3QIP A;  4LF8 K;  4Z4F A;  3H3N O;  3VET A;  5LMU K;  2YI1 A;  1NGG A;  3A5N C;  3D6R A;  1E3M A;  2XY7 A;  4CGF A;  3E1Y A;  2XRI A;  3FGU A;  1C1B A;  1ZBL A;  1RT6 A;  3HI0 A;  5GIN A;  4CW7 B;  4Z4H A;  3SK3 A;  4FW1 A;  3L3V A;  3VQ8 A;  4JKF A;  3HSC A;  4CJS A;  2X74 A;  5LL6 Z;  3HP6 A;  1VQL N;  3LM9 A;  2W41 A;  1QSS A;  1MWK A;  3KLE A;  3O9S A;  3UKU B;  3SBT A;  1ASW A;  4FWK A;  4CZE A;  3D0P A;  1IBM K;  1BWF O;  5GAG P;  2D5R A;  2NRZ A;  2P51 A;  2DFF A;  2X6N A;  3M8R A;  4CJ4 A;  2F7T A;  3O3G A;  4FWR A;  1VRU A;  1L5U A;  2JGU A;  5AJ3 K;  1NOY A;  1LV5 A;  3CJA A;  1U49 A;  4I7F A;  5IT9 O;  3EKS A;  3CCS N;  4N76 A;  3P5J A;  4DU4 A;  1JLE A;  2WBN A;  4EIA A;  1XHX A;  5HBM A;  3J81 O;  3O1B A;  4JI0 K;  4BR5 A;  1VQ5 N;  4LC9 B;  1TYQ A;  3ZET A;  4JN4 A;  1X1P A;  1OKJ A;  3OTO K;  5BR9 A;  2DY4 A;  2CH6 A;  1N36 K;  3LAK A;  1FKO A;  3TAB A;  1I94 K;  2UU9 K;  4DQQ A;  2PY5 A;  1T6C A;  2P9S A;  3DMJ A;  1O13 A;  3K5L A;  3CIP A;  1OH5 A;  4CJL A;  4H5T A;  3O4N A;  3VQD A;  1QS4 A;  4OGC A;  1K8A O;  1M90 O;  3KD1 E;  1IO2 A;  2Z1G A;  5HRO A;  1VHX A;  3TAG A;  3HVR A;  4BRO A;  3BF1 A;  2OA8 A;  3VMF B;  4FYD A;  4AHV A;  5JS1 A;  3KLI A;  4DKW A;  1NK9 A;  4ISF A;  4W5O A;  1VSE A;  1D9D A;  2ETJ A;  3ULD A;  1H1V A;  4YHH K;  2G8K A;  4OKK A;  1WNS A;  4MLH A;  1JLG A;  1ATN A;  1FK9 A;  4FL9 A;  3HT3 A;  3NDK A;  2V51 B;  4DHY A;  1WSG A;  4B1U B;  2VWJ A;  3H6E A;  1NJI O;  3SLC A;  5EU7 A;  3THW A;  3NCI A;  3CCJ N;  1SZ2 A;  4CJQ A;  3K2P A;  1S1X A;  4JI8 K;  3A5L C;  4CBX A;  1W7A A;  1BA1 A;  4CCH A;  5M1K A;  3PY8 A;  3VQ4 A;  1BIU A;  3OYF A;  3RR7 A;  1NKB A;  1GLE G;  2YJF A;  1OH7 A;  2Q31 A;  2A41 A;  3R1X A;  1VQO N;  1LWC A;  4J2E A;  4KB0 A;  5KGW A;  1WSI A;  4FM1 A;  1L3T A;  5FLX O;  3PX0 A;  1YTU A;  5AQU A;  1T3V A;  4JKG B;  4RW6 A;  2OPQ A;  4AHR A;  3JS6 A;  3OJU A;  4HVJ A;  3RWU A;  3LPT A;  4ELV A;  3DXK B;  4WQ4 C;  3VQ5 A;  5HRR A;  1WOQ A;  3VF6 A;  4NXM K;  4BVP A;  1S1U A;  4O44 A;  1RDA A;  3VER A;  4FWL A;  4IOA L;  4BQZ A;  2OZS A;  4RWT A;  5BRE A;  3DLL L;  3DXM A;  3O9T A;  1XNR K;  1VSL A;  3ZX0 A;  1U48 A;  2FBT A;  4CD1 A;  1NGE A;  4BRE A;  4TSX A;  1RDU A;  4FK2 A;  3A0I X;  2YNI A;  4HCC A;  3TTC A;  1ITG A;  4M7X A;  3ASM A;  2KLA A;  2KKZ A;  4XEI A;  3MCA B;  4DFM A;  3D2E A;  2CGJ A;  4FJM A;  3SAH A;  2HHV A;  3NVK A;  4FOI A;  4B9V A;  2KZZ A;  3I33 A;  5JLF A;  3ZT1 A;  4DSE A;  2QM1 A;  4KAZ A;  4ZHR A;  4CFB A;  1UAX A;  2P9I B;  3CF5 L;  5C42 A;  4FJ8 A;  3EZ5 A;  3SMP A;  5HOO A;  5AQG A;  1VRT A;  4CJF A;  1VQ7 N;  4B9S A;  1JCG A;  1GLB G;  4GNI A;  2YHY A;  4FJI A;  5BN8 A;  3TAE A;  4ISE A;  3V9W A;  3SAF A;  1GOA A;  3AVH A;  4FJH A;  1QZ6 A;  3VN5 A;  3GE1 A;  3AVA A;  4H0P A;  2QKB A;  4LH4 A;  4W5R A;  3SAG A;  3MWT A;  1GLC G;  2ZGZ A;  3HPO A;  5J2M A;  3VES A;  4IBN A;  3AVM A;  4M3X A;  1IKV A;  3CCR N;  3IUC A;  1C0F A;  4ILH A;  1MDU B;  4CF1 A;  4CJE A;  1RGI A;  3ZT0 A;  4CEA A;  4H5R A;  4FO0 A;  2P9P B;  5F0X A;  2O8D A;  1A5W A;  2QWO A;  3OYN A;  3SI6 A;  4NLC A;  3FZK A;  4JAX A;  4DS5 A;  1VQ9 N;  4E7J A;  1IKX A;  4M3W A;  3FFK B;  1HQU A;  4JYA K;  1QQN A;  4DQS A;  4CEQ A;  4GV9 A;  3CJ7 A;  4GVE A;  3MN6 A;  2PYL A;  3NF6 A;  3W3D A;  1Z26 A;  4FJ5 A;  4HHT A;  2BE2 A;  1EWQ A;  1RDB A;  3K59 A;  4I6M A;  2HHU A;  5DM7 L;  4FZZ A;  2IDO A;  2FF6 A;  4FWP A;  3SQ0 A;  2O4I A;  4QS8 A;  1EQY A;  5FPD A;  3HBT A;  4B8A B;  4PUO A;  5M1P A;  1C1A A;  4JHD A;  3T19 A;  3RR8 A;  1EWR A;  1VK0 A;  4Z4I A;  1FJG K;  5AR0 A;  4N5S A;  3VEV A;  4E1N A;  3V9X A;  5EY4 A;  2GX9 A;  2P9K B;  3S41 A;  5AQI A;  1KAY A;  3HZ6 A;  1T05 A;  1P90 A;  5KQD A;  3PUF A;  1TAQ A;  2VYP A;  3ZCM A;  3MX5 A;  4BVO A;  1XMQ K;  4OLB A;  1C0U A;  3MWP A;  4UY8 O;  1GLF O;  3VQB A;  1LWE A;  4JKH A;  1ZBH A;  2I5J A;  4IDH A;  3C7N A;  4HWI A;  4A59 A;  1ATS A;  4A5B A;  3QEV A;  1T6D A;  4JKD A;  3BDP A;  2HVI A;  2B4J A;  3KWG A;  4EZ9 A;  4JRP A;  2GEM A;  3CM6 A;  1TL3 A;  4IDK A;  4OKJ A;  3NE6 A;  1OVY A;  1KRP A;  2UXD K;  3I0R A;  1RDC A;  4DF8 A;  1FW6 A;  5AQR A;  2ZGY A;  3WT0 A;  2YHB A;  4PQU A;  3G25 A;  4JD2 A;  2NRT A;  3AAR A;  3BEX A;  1WSH A;  3FZF A;  3AO2 A;  1JJ2 M;  3CFP A;  1U2V A;  1W9H A;  2EHG A;  4JI1 K;  2DFE A;  2HB5 A;  3NGI A;  2Z1H A;  4DLE A;  4FK0 A;  4RTF D;  4HCB A;  4CHP A;  1KLM A;  2HF3 A;  5BN9 A;  2BDP A;  4OLA A;  4H0X B;  3C0B A;  1C1C A;  3L2Q A;  5KI6 A;  3QIN A;  2O4G A;  4FPB A;  4QAG A;  3LDS A;  3FZL A;  4DWI A;  2AA4 A;  2D0P A;  3QLH A;  4Z4E A;  2VG7 A;  4LF5 K;  4FLT A;  4BRG A;  5JVG L;  4IG3 A;  3HYF A;  1L3U A;  1QHT A;  4B3O A;  3AA2 A;  1YUW A;  4GKJ K;  4DTP A;  3GL1 A;  2ITG A;  3CFR A;  1EO1 A;  3GOI A;  4IJA A;  1SS6 A;  3QBX A;  3MEC A;  4NYN A;  4B9U A;  3H08 A;  2QWR A;  3V4I A;  4I9Q A;  4O8K A;  3SUN A;  4Z4C A;  3QFP A;  2CGL A;  4CEE A;  2FSN A;  1RT5 A;  5C15 A;  4CJ5 A;  4YOT A;  4B9Q A;  3P1G A;  4ELU A;  2E20 A;  3C6A A;  1CZA N;  3O9U A;  5CYQ A;  3LAN A;  2JWK A;  4CE9 A;  5AQP A;  2QWQ A;  3ZYY X;  3V1R A;  3ZEU B;  2E2O A;  4YOY A;  1GLL O;  4AM7 A;  1C0T A;  2ZM6 K;  2WOM A;  5HL7 L;  4HTU A;  2IS3 A;  4J2B A;  3IG1 A;  1RT3 A;  3O08 A;  4BY9 C;  3DJC A;  2E1Y A;  4JKA A;  1NGF A;  4ICL A;  1KCF A;  2P9U A;  3THX B;  3AO3 A;  3O3H A;  4LF4 K;  4BG9 A;  4KO0 A;  2OTL N;  4NCB A;  4M3R A;  2J4R A;  3O1W A;  3RMB A;  1QQO A;  3HJF A;  2D0A A;  3DLB A;  3L0Q A;  4CD3 A;  1LAW A;  2Y1I A;  3CYM A;  4F2R A;  3LAM A;  1N8R O;  4CZG A;  3UKR B;  4LF9 K;  4W5Q A;  2HNY A;  3ZT2 A;  1Y64 A;  4FLW A;  1YHQ N;  1UA0 A;  1ZYQ A;  2O8E A;  1T44 A;  4FW2 A;  4GV6 A;  4B9T A;  1HNV A;  4EP4 A;  2D0C A;  3K9K A;  4BWJ A;  3AV9 A;  1YJ9 N;  5ELZ A;  3KZB A;  3VQE A;  2QXL A;  5AQQ A;  4YY3 K;  3ENB A;  5F2R A;  3DI6 A;  2UUB K;  4CHN A;  3ZLJ A;  5TKW A;  1HYZ A;  3PO5 A;  2D4W A;  4XH5 A;  3IKM A;  1RTI A;  5HLF A;  1SL2 A;  1NWK A;  1VSD A;  3PO4 A;  3S3M A;  3NHG A;  5EVZ A;  4WFB L;  1J9A A;  2ZJR L;  3O9Q A;  3M1F A;  1YJW N;  4CHZ A;  3SQ2 A;  2DPN A;  4E1J A;  5GIP A;  3GDQ A;  2HHT A;  2KHO A;  3SPZ A;  2PFU A;  1NJY A;  3MCP A;  4KTW A;  3OBW A;  2FBY A;  3GG4 A;  3DLE A;  1P8Z A;  1BQM A;  2KW4 A;  3RSE B;  4DQP A;  3K57 A;  3NH2 A;  3OW2 M;  3U9D A;  3MK6 A;  2V52 B;  5BPL A;  2KZM A;  4DV3 K;  5C25 A;  3OYI A;  4OPK A;  5AQW A;  1Q7Y O;  3T3F A;  1N6Q A;  4E0D A;  1C0G A;  1JLA A;  4OO1 J;  3NH0 A;  4OPH A;  4WCE L;  4JNE A;  1J54 A;  2Y1J A;  3ZX3 A;  1NK5 A;  2YNH A;  4IEI A;  2NUB A;  1NU0 A;  3I0S A;  1U4B A;  4KKO A;  2LSN A;  4DQR A;  1DLO A;  1DEJ A;  3N4Q A;  3SBG A;  3PIO L;  3BGR A;  1B9F A;  2ZE2 A;  3HM8 A;  3HPG A;  4BRM A;  4CJ7 A;  4O5F A;  3AVI A;  2OTJ N;  3QML A;  4CF9 A;  2GTD A;  4CEO A;  4GY2 B;  2JLE A;  3KK7 A;  4LFC K;  4BR2 A;  4MFB A;  1U45 A;  4U67 L;  2HF4 A;  4NYF A;  3E66 A;  4DQ8 A;  4K8X A;  3QNO A;  1JL1 A;  2G8W A;  2QTD A;  3U3G A;  3HVT A;  3F9M A;  2F96 A;  2IOC A;  4HUE A;  3VF4 A;  3AA5 X;  3OA9 A;  4JK9 A;  1N33 K;  1XI1 A;  3ZSO A;  3E9P A;  3T1A A;  1WUA A;  2QKK A;  3Q7B A;  4K41 A;  3WXJ A;  4AQY K;  3WXM B;  4FK4 A;  4I2Q A;  1R59 O;  4YNQ A;  1NJZ A;  1IBK K;  4CZI A;  4M3U A;  1DKG D;  3U8X A;  1S1V A;  1JKH A;  1XQS C;  4CER A;  3O5B A;  1GLA G;  5CHI A;  3P31 A;  3HPH A;  3TSP A;  3NBP A;  4DS4 A;  1VSI A;  4DV2 K;  1QVG M;  2X78 A;  4LF7 K;  1KTQ A;  4IFV A;  1KSP A;  5AQJ A;  4CF8 A;  4KTZ A;  2WFB A;  4LY7 A;  3OY9 A;  2QEX N;  5JVH L;  4J2D A;  3T69 A;  4O8U A;  3THY B;  5AQX A;  4DR6 K;  2VWK A;  4CIF A;  3CXC M;  4BGB A;  4RW4 A;  3OYL A;  4JK8 A;  3VTH A;  2D0B A;  5CYM A;  5J2P A;  4DB3 A;  3ZT4 A;  3K5M A;  5BR8 K;  1X9W A;  4WFA L;  4C8K A;  3SUQ A;  3AO5 A;  2IAJ A;  4BRH A;  1Q82 O;  1JCE A;  4CGJ A;  1BIZ A;  4KH5 A;  3C6U A;  1W0H A;  1D4X A;  4O55 A;  4E7K A;  3TR8 A;  1BUP A;  5C2F A;  3CCM N;  2E2Q A;  3SMS A;  3OYB A;  2V7Z A;  1X9J A;  4I9L A;  1KFD A;  4DU3 A;  1TUU A;  1RT2 A;  5J2N A;  4B9L A;  3UKU A;  5H1S Q;  3DOL A;  4YOR A;  4C23 A;  4NO7 A;  1YF5 L;  1X9M A;  5GAE P;  5CZ1 A;  3WQU A;  3WEE B;  2BTF A;  1NK8 A;  4KFB A;  4B1V A;  4IFE A;  2OPS A;  3M6G A;  5BPN A;  2Z1I A;  4BE0 A;  3G0Z A;  3SNN A;  3CCL N;  4QCL A;  4Q0B A;  3CCV N;  4M3Z A;  1RT1 A;  4Z4G A;  4JI7 K;  1HQE A;  1LW2 A;  4Y0W A;  3ZSR A;  2HMI A;  1BDG A;  4PHT X;  3HOS A;  3SV4 A;  3RRG A;  2X6S A;  4H5N A;  5BRF A;  4KHQ A;  4WFN L;  5JMV A;  3DOK A;  5AQF A;  1KC8 O;  4X64 K;  2W6L A;  4B1X B;  3D2F B;  4C8M A;  4GW6 A;  1RIL A;  4DFJ A;  1S72 N;  2PZS A;  3F9K A;  2OPP A;  3ID6 A;  4K8Z A;  1WAJ A;  3R8E A;  4BC2 A;  3VGK A;  3OS0 A;  2D0O A;  3TI0 A;  1QSL A;  4H0Y B;  1CZB A;  1ESV A;  2I7P A;  2VWB A;  3ZSX A;  3V9Z A;  3VTI A;  4FVU A;  1OVQ A;  4LD0 A;  1LW0 A;  3N4P A;  2ZQB A;  1VSF A;  1RCH A;  4CK1 A;  4JRQ A;  1VQ4 N;  5C24 A;  3CFO A;  2DTU A;  3PSF A;  3O6W A;  1XNQ K;  4WQ5 A;  5FPM A;  2NNW A;  5E26 A;  3PX4 A;  1NK4 A;  5AQV A;  1RT4 A;  1VSJ A;  4JS4 A;  1LOT B;  3HOT A;  4BR7 A;  1NK0 A;  3AO1 A;  1BOT O;  4J2A A;  2OAN A;  3OYM A;  2HND A;  4B1Y B;  3AVF A;  3EE8 A;  1WAF A;  3FR0 A;  4KHW A;  1HPM A;  2F9T A;  3CET A;  5AQM A;  1S1W A;  4E3S A;  5D3G A;  1Y97 A;  1WSJ A;  3C65 A;  5C0Y A;  2ZJQ L;  4MO4 A;  1MU2 A;  4Q5V A;  3TAM A;  3O4W A;  2QWP A;  3VEN A;  3LWM A;  2W40 A;  1RDD A;  2ZWH A;  1HX1 A;  1Z05 A;  2VQE K;  2UYT A;  4DR3 K;  4DV1 K;  2FBX A;  2HHH K;  3VEO A;  1YVU A;  3T1Y K;  3EN9 A;  4DCH A;  1HKB A;  1ATR A;  2NRH A;  3ENO A;  3HTV A;  3QEP A;  5DMR A;  3HM9 A;  1OH6 A;  3A5M C;  4PL8 A;  3BZK A;  3EEQ A;  4JV5 K;  2E2N A;  4CZH A;  4RW9 A;  3TTD A;  4PA1 A;  5LJV A;  4LFA K;  1T7P A;  4WQ4 A;  2YX6 A;  3CQY A;  1VQ8 N;  4JKG A;  4W5N A;  1NGB A;  4E7L A;  3KK1 A;  3FZM A;  4FOE A;  3DXK A;  1TK8 A;  4CF0 A;  2RN2 A;  5KTQ A;  4DTN A;  4YFU A;  3AAP A;  5M1Q A;  5CR4 A;  2QWL A;  2HBK A;  4BRK A;  1KAZ A;  4CEZ A;  2ATQ A;  2FXU A;  4CZM A;  4YOV A;  2UXC K;  5FPE A;  2KQ2 A;  5FDL A;  4B3M K;  5I3U A;  3E01 A;  2OPR A;  3CME N;  2E2P A;  4WE1 A;  3L8B A;  3WQT A;  4OVL A;  1BI4 B;  3MMV A;  3V6D A;  1FKP A;  5EX5 A;  3K5N A;  4G1Q A;  3A5O C;  3L2V A;  3R9P A;  3UB5 A;  3LP1 A;  3AA3 A;  4FJ7 A;  3AAQ A;  1HKC A;  1R0A A;  1Z6R A;  4WF9 L;  3LWL A;  3FLC O;  4EFH A;  1C0M A;  3EE9 A;  3BZC A;  5GIO A;  1TK0 A;  3ISN C;  3WXL A;  3CM5 A;  3CJ1 A;  4HTL A;  4I2P A;  3EL2 A;  1NG9 A;  4PWD A;  2YNF A;  2VCP A;  2P9I A;  4BWM A;  5AZI B;  3PX6 A;  3JSM A;  4FPA A;  4FWN A;  2G8I A;  3AVL A;  2GUI A;  3BUZ B;  2GUP A;  3EY1 A;  4E19 A;  1LCU A;  2VGN A;  1TKX A;  4XH4 A;  1SKS A;  2PAV A;  2UUC K;  3O4Q A;  5C12 A;  3OYD A;  3PV8 A;  3V1Q A;  4PL7 A;  1D5A A;  3AVK A;  1SUQ A;  4M41 A;  3AO4 A;  4CHQ A;  3RMC A;  1KLN A;  3V1O A;  5BRH A;  3WXI A;  5GAH P;  3ITH A;  4CIE A;  3VQ7 A;  4X65 K;  5I42 A;  4GVM A;  2O8F B;  1NGA A;  1NKC A;  5M1F A;  1VSH A;  3KIO A;  5HRS A;  3C94 A;  1NGH A;  2HNZ A;  4BRP A;  3QEI A;  1REV A;  4KI6 A;  1QQC A;  3ZSW A;  4AHS A;  2P9P A;  2FC0 A;  1ASV A;  4CK2 A;  3F73 A;  3VEY A;  4IO9 L;  4NLB A;  3IAY A;  4GMJ B;  2Z1J A;  3KJV A;  1Q9Y A;  3LPU A;  5FPN A;  1YJN N;  1XWL A;  3AGR A;  3VQQ A;  2QWN A;  2XY8 A;  5AZJ B;  4F4K A;  3HST B;  1WB9 A;  1BIS A;  3E9L A;  1U47 A;  4EAH D;  3NH1 A;  3KVG A;  1XC3 A;  1TKZ A;  4WYB A;  4M63 C;  4M45 A;  4B8C A;  4A61 A;  4B1Z A;  4JK7 A;  2BGG A;  3NFA A;  4C1N I;  4A62 A;  1QVF M;  4ZTF A;  2GEL A;  4ISG A;  3MAQ A;  1CZ9 A;  3KTQ A;  1HJR A;  3CC4 N;  3M5R A;  4BR0 A;  1IBL K;  4CJT A;  1SV5 A;  4DR5 K;  4IOX A;  4U7B A;  2GV9 A;  5AQH A;  4FWQ A;  2BH1 A;  4ILG B;  2YHA A;  2Q3S A;  1G99 A;  3TAF A;  1ASU A;  3C95 A;  3CJ9 A;  4Y1D A;  3OHR A;  1J5O A;  1NGC A;  3DLH A;  3MED A;  3RMD A;  2W42 A;  3FE1 A;  2P5O A;  4MDA A;  3MN7 A;  4H0O A;  1Q18 A;  3P83 D;  5AQK A;  1VQP N;  5SZT A;  3VPZ A;  4AHT A;  3TWH A;  3CG7 A;  3MN5 A;  3RTV A;  4FJK A;  2P5G A;  4AHU A;  4DFK A;  2WTU A;  3H3O B;  1Q81 O;  5HRN A;  2Q0R A;  1BCO A;  2P9N B;  1S9E A;  1YVN A;  3MXM A;  1L3V A;  1K73 O;  1BL3 A;  3SUP A;  4AH9 A;  2Q2R A;  1NJW A;  3LDL A;  3DYA A;  4KHY A;  1F21 A;  2O8C B;  2A6A A;  1WSE A;  2G8U A;  1SKW A;  5AQS A;  1TGO A;  3WNE A;  1NM1 A;  1RBV A;  3JXU A;  1HMV A;  3ZX2 A;  5ADX H;  3P39 A;  4E7H A;  3KKR A;  3JYT A;  1S5J A;  4W5T A;  2E4L A;  3CQX A;  3M8S A;  3AVJ A;  3ULE B;  2YKN A;  5LMN K;  4OKE A;  3SJJ A;  3QB0 A;  1SQK A;  3MEE A;  4JKC A;  1BQN A;  3NVM A;  1ZBS A;  3WNH A;  4CZK A;  3OYJ A;  4ID1 A;  2F4V K;  3KWI A;  2NZT A;  1YI2 N;  5JLH A;  1A5X A;  1YT3 A;  4BRQ A;  1JLB A;  3IS9 A;  2O8B B;  4FJG A;  3DRP A;  3PIP L;  1ZBF A;  5J2Q A;  3NGZ A;  1RTJ A;  3Q7C A;  1W97 L;  1CLQ A;  1Z25 A;  2FF3 B;  3UIQ A;  1TVR A;  5J1E A;  3ENH A;  4HUG A;  4OGE A;  1BG3 A;  4H5V A;  4DSI A;  4XH1 A;  1K8K A;  5LJW A;  3V9S A;  2P9L A;  4OPA A;  4KPY A;  1QHA A;  4DTO A;  2HOE A;  1QSY A;  1RBU A;  3AVG A;  2RHK A;  4CGD A;  5I9E B;  4FZY A;  2IC3 A;  3DRS A;  3CQ8 A;  1Q9X A;  5AQZ A;  1HR0 K;  3A2F A;  3U9Z A;  1UOC A;  4YDU A;  1M1K O;  1HNX K;  4CGI A;  2HVH A;  3ZEU A;  4L3Q A;  4KRF A;  1HJO A;  1W2B M;  5BPM A;  3SYZ A;  3QNN A;  4RW7 A;  1G15 A;  4C1N K;  2R7Y A;  1TV6 A;  4JKE A;  4DSJ A;  3FZH A;  3F5T A;  2HHQ A;  1XUP O;  3RVC A;  3VOV A;  4FLY A;  3CD6 N;  3KD5 E;  4R5P A;  3DLR A;  2AJQ A;  3LP3 A;  3O9R A;  2ITM A;  3V81 A;  3THX A;  2YV0 X;  3NGY A;  4JEP A;  5LY3 A;  1BU6 O;  2NLX A;  3CI5 A;  1EXQ A;  2AP1 A;  1I39 A;  4FJX A;  1YAG A;  5HRP A;  3DRR A;  4C8L A;  5DK5 A;  4DUY K;  2RKI A;  2RF2 A;  4QS9 A;  2GWJ A;  4A57 A;  3EKU A;  1JXE A;  3DLG A;  4CEB A;  3C6T A;  3NAE A;  3WNG A;  5AQO A;  3B6O A;  2RE2 A;  1HLU A;  5AQT A;  5EXW A;  4N56 A;  3BP8 A;  1TYQ B;  4KHS A;  1RBS A;  5FRO A;  1KFS A;  5MLC Q;  3ZET B;  3AVC A;  3TAP A;  3AVB A;  4BC4 A;  4FJL A;  5A2Q O;  1JXB A;  3VF2 A;  4KTQ A;  3M8P A;  3H46 O;  3IFR A;  3U6F A;  1S1T A;  4DV0 K;  2P9S B;  1CXU A;  1L3S A;  4QOZ B;  1I3A A;  4KH4 A;  5E84 A;  3S3N A;  4C8O A;  5AQN A;  4DR2 K;  3QES A;  4A2B A;  1Q86 O;  2HHS A;  3LDQ A;  1QQM A;  4CJ3 A;  2E5L K;  3O8M A;  1VQN N;  4X66 K;  4N41 A;  2HBM A;  2Q1N A;  3H1Q A;  3RSE A;  5AQL A;  1IKW A;  3L2U A;  3OVN A;  2QK9 A;  1RDW X;  5B8H A;  2A40 A;  3KKS A;  3LZI A;  1KVC A;  3K58 A;  4BGA A;  2QA4 N;  3TPQ A;  2F8T A;  3AVN A;  3ID8 A;  2ASO A;  2YCH A;  3MXI A;  1HUX A;  3VGM A;  4F3O A;  1RBR A;  3TAN A;  4CED A;  4E1M A;  3VEZ A;  2GWK A;  3I55 N;  4DU1 A;  1WLJ A;  4JKB A;  4K43 A;  4CFC A;  3THW B;  4KHU A;  3QEW A;  4IWV A;  5CY4 A;  5KRT A;  4DTJ A;  4BRI A;  2FSJ A;  4R79 A;  3K0S A;  3OYA A;  4IOC L;  2E8A A;  1JLF A;  4H0V B;  1BO5 O;  4AIL C;  1J6Z A;  1TL1 A;  1TUY A;  3V9U A;  4CBW A;  3AGK A;  5F1X A;  2VG6 A;  4F8R A;  4J8F A;  3G10 A;  2GBZ A;  5SWM A;  2W6K A;  3QFU A;  2I7N A;  1Q8I A;  3MXJ A;  5DM6 L;  1YIJ N;  3MDQ A;  3IDH A;  2ASM A;  1V4T A;  4K42 A;  3QIC A;  2E6M A;  4V19 S;  2XHB A;  3QDK A;  2OCE A;  1KAX A;  4H4O A;  1T03 A;  4JI2 K;  4DG1 A;  4IFY A;  2FBV A;  1NLV A;  1MA9 B;  1KD1 O;  4GV3 A;  3SV3 A;  3VEW A;  3W0L A;  4O0J A;  3NMU A;  3OYC A;  3TTF A;  1KQS M;  5AFU H;  1EX4 A;  4KV8 A;  1EKE A;  2BAN A;  4BAC A;  1KVB A;  1UA1 A;  4WQ5 C;  4H0T B;  4JI4 K;  1HPZ A;  4CJP A;  4KRE A;  4KI4 A;  3DXM B;  3G4S N;  4ZTJ A;  4LFB K;  4IG0 A;  1GOB A;  1TAU A;  4FLU A;  4FZX C;  2XY5 A;  3THY A;  4PY5 A;  3NF8 A;  3SQ4 A;  4DV7 K;  1DT9 A;  4B9M A;  3TSQ A;  3IRX A;  3LP0 A;  4BQL A;  1LAV A;  4LH5 A;  4CJK A;  3KLH A;  1E4F T;  2IIR A;  1HYV A;  1HNW K;  2VG5 A;  4B3T K;  3MX2 A;  4LSL A;  1NOZ A;  2KFN A;  4RG8 A;  5JIC A;  3L3U A;  2XO7 A;  4FJN A;  4CIG A;  1GLJ O;  3S9H A;  5IWA K;  3KLG A;  3CJC A;  1S22 A;  2HHX A;  5ADX A;  1S6Q A;  4CVN E;  3D2E B;  2YHW A;  3OYE A;  3RRH A;  1NMD A;  2IVN A;  3LAL A;  3HP9 A;  2EWS A;  3K5O A;  3SJH A;  4H8K A;  2EX3 A;  3PSI A;  3L4Q A;  4FJJ A;  2OZM A;  2B5J A;  4CES A;  4DFP A;  3CCE N;  3WEE A;  4Z94 A;  4KHN A;  5T7B A;  1RTD A;  4JLH A;  4LSN A;  1ZBI A;  4AM6 A;  4DR7 K;  5CE3 A;  2B6A A;  3J7Y P;  3QBW A;  4QS7 A;  1EET A;  3M3Z A;  1YTA A;  2ZD1 A;  4ILJ A;  4O4G A;  3I8D A;  4CHY A;  3L2R A;  4OJR A;  2KTQ A;  3CJB A;  4MQ3 A;  4BRL A;  5CZ2 A;  3SCX A;  4FJ9 A;  2CH5 A;  4FM2 A;  1K6Y A;  1J5E K;  1VAZ A; 
#chains in the Genus database with same CATH homology
 4I7F A;  4F2R A;  3SQ1 A;  3LAM A;  1JL2 A;  1NKC A;  1VSH A;  3KIO A;  5HRS A;  3C94 A;  4N76 A;  3P5J A;  1TKT A;  2HNZ A;  1CXQ A;  4FVM A;  4W5Q A;  4DU4 A;  2HNY A;  3ZT2 A;  3QEI A;  1REV A;  4FLW A;  1JLE A;  5FRM A;  1UA0 A;  3MEG A;  1QQC A;  3ZSW A;  1ZYQ A;  4KI6 A;  4AHS A;  1VSK A;  1XHX A;  4FW2 A;  4B9T A;  5HBM A;  1HNV A;  2FC0 A;  1ASV A;  1RBT A;  4CK2 A;  4EP4 A;  3F73 A;  2D0C A;  1TK5 A;  4BWJ A;  3AV9 A;  3IAY A;  4GMJ B;  1X1P A;  2Z1J A;  3DLK A;  3VQE A;  4CJW A;  3OYG A;  3KJV A;  2RPI A;  1Q9Y A;  2DY4 A;  1RTH A;  3LPU A;  3LAK A;  1FKO A;  3TAB A;  2PY5 A;  1XWL A;  3DI6 A;  4DQQ A;  3DMJ A;  4CHN A;  3VQQ A;  1HYZ A;  2XY8 A;  3PO5 A;  4FLV A;  1RTI A;  5HLF A;  3K5L A;  1SL2 A;  4F4K A;  1VSD A;  3HST B;  1T8E A;  3PO4 A;  1BIS A;  4CJL A;  3S3M A;  1U47 A;  3O4N A;  3NH1 A;  3NHG A;  1RNH A;  3VQD A;  1J9A A;  1QS4 A;  4OGC A;  3SZ2 A;  3KD1 E;  1TKZ A;  1IO2 A;  2Z1G A;  4CHZ A;  3SQ2 A;  4M45 A;  4B8C A;  5HRO A;  3THV A;  2HHT A;  2BGG A;  3TAG A;  3NFA A;  3HVR A;  3SPZ A;  2OA8 A;  1NJY A;  4EZ6 A;  4ZTF A;  4KTW A;  3MAQ A;  1SL1 A;  1CZ9 A;  4DTX A;  3KTQ A;  4BE1 A;  1HJR A;  4B08 A;  4FYD A;  2FBY A;  4AHV A;  5JS1 A;  2F8S A;  3DLE A;  2KW4 A;  1BQM A;  4CJT A;  4DQP A;  3K57 A;  3KLI A;  1SV5 A;  3NH2 A;  1NK9 A;  2OYQ A;  2KZM A;  2GV9 A;  3FFI A;  1VSE A;  5C25 A;  2ETJ A;  4W5O A;  4OPK A;  3OYI A;  3ULD A;  1D9D A;  3T3F A;  1N6Q A;  2G8K A;  4E0D A;  4OKK A;  1WNS A;  1JLA A;  2YHA A;  1JLG A;  1FK9 A;  2Q3S A;  4EP5 A;  3NH0 A;  3HT3 A;  3NDK A;  3TAF A;  1ASU A;  1J54 A;  2Y1J A;  1NK5 A;  1WSG A;  3C95 A;  2YNH A;  2NUB A;  1HYS A;  3I0S A;  1U4B A;  4KKO A;  4Y1D A;  1J5O A;  2VWJ A;  2LSN A;  4DQR A;  1DLO A;  3LP2 A;  5EU7 A;  3MED A;  4HUF A;  4DTU A;  3RMD A;  3DLH A;  2W42 A;  3NCI A;  4F2S A;  4BDZ A;  1S9G A;  1B9F A;  2ZE2 A;  3BGR A;  3NF7 A;  3HPG A;  4CJQ A;  2P5O A;  3K2P A;  3VQ6 A;  3P83 D;  1S1X A;  3EYZ A;  3AVI A;  5SZT A;  4AHT A;  3TWH A;  2P1J A;  1NK7 A;  3CG7 A;  4CCH A;  3RTV A;  4CF9 A;  4M3T A;  3PY8 A;  4FJK A;  4CEO A;  3VQ4 A;  4AHU A;  2P5G A;  2JLE A;  4DFK A;  1BIU A;  4MFB A;  3ZSQ A;  3OYF A;  1U45 A;  3RR7 A;  5HRN A;  1IKY A;  1NKB A;  1BCO A;  3QO9 A;  1S9E A;  4NYF A;  3MXM A;  1L3V A;  1BL3 A;  3SUP A;  4K8X A;  4AH9 A;  1U04 A;  3QNO A;  1NJW A;  1JL1 A;  3DYA A;  4KHY A;  1F21 A;  2G8W A;  4N47 A;  1WSE A;  3U3G A;  4CF2 A;  1LWC A;  3HVT A;  1SKW A;  1WSF A;  2G8U A;  4KB0 A;  5KGW A;  2YKM A;  3TAR A;  4BDP A;  4DSF A;  1WSI A;  1TGO A;  3VQA A;  2F96 A;  4FM1 A;  2IOC A;  4HUE A;  3AA5 X;  1L3T A;  3WNE A;  3PX0 A;  1YTU A;  3QEX A;  1RBV A;  1HMV A;  1D8Y A;  1XI1 A;  3ZSO A;  2QKK A;  3T1A A;  4RW6 A;  4JS5 A;  2OPQ A;  4AHR A;  4E7H A;  3OJU A;  4B9N A;  4HVJ A;  4FK4 A;  3KKR A;  4I2Q A;  1QE1 A;  2A1S A;  3JYT A;  3LPT A;  3RWU A;  4YNQ A;  1NJZ A;  1S5J A;  4W5T A;  4ELV A;  2E4L A;  3VQ5 A;  5HRR A;  1SKR A;  3M8S A;  4M3U A;  3AVJ A;  4CJR A;  1S1V A;  2YKN A;  4RW8 A;  1XHZ A;  1JKH A;  3OYH A;  3OS2 A;  1NKE A;  4OKE A;  3SJJ A;  4E89 A;  4CER A;  1S1U A;  3MEE A;  4O44 A;  3VA3 A;  3KLF A;  3HPH A;  3TAQ A;  1RDA A;  3NBP A;  4DS4 A;  1BQN A;  3WNH A;  3OYJ A;  1VSI A;  2OZS A;  4CGG A;  4ID1 A;  3NF9 A;  3HK2 A;  2X78 A;  1VSM A;  1VSL A;  1A5X A;  1YT3 A;  1BI4 A;  1KTQ A;  1JLB A;  3IS9 A;  4IFV A;  1N5Y A;  1KSP A;  4CF8 A;  4FJG A;  3DRP A;  1U48 A;  5J2Q A;  1ZBF A;  2FBT A;  4KTZ A;  3NGZ A;  4LY7 A;  4NCA A;  3OY9 A;  1RTJ A;  1CLQ A;  4FCY A;  1Z25 A;  3UIQ A;  4J2D A;  1TVR A;  5J1E A;  4HUG A;  4M42 A;  4OGE A;  1IH7 A;  4TSX A;  4DF4 A;  4DSI A;  5HP1 A;  1D9F A;  4FK2 A;  2QXF A;  1TKD A;  2VWK A;  2YNI A;  4HCC A;  4CIF A;  4FLX A;  2G8V A;  3V9S A;  4RW4 A;  4XIU A;  3OYL A;  2XY6 A;  2D0B A;  2HW3 A;  4KPY A;  5CYM A;  4DTO A;  1ITG A;  5J2P A;  1QSY A;  2HHW A;  1RBU A;  3AVG A;  3ASM A;  3ZT4 A;  3OJS A;  4CGD A;  3K5M A;  1X9W A;  4FZY A;  4C8K A;  3SUQ A;  3AO5 A;  2IAJ A;  2IC3 A;  4ID5 A;  4DFM A;  3VA0 A;  4FJM A;  4CGJ A;  2HHV A;  3DRS A;  3CQ8 A;  1BIZ A;  4DLG A;  1Q9X A;  4B9V A;  3C6U A;  1W0H A;  3A2F A;  4Z0U A;  4KB1 A;  4CJV A;  2KZZ A;  1UOC A;  4O55 A;  4E7K A;  3D45 A;  4H4M A;  4CGI A;  3TR8 A;  3ZT1 A;  4DSE A;  1SL0 A;  3M8Q A;  2HVH A;  4KAZ A;  3ALY A;  3AA4 A;  4ZHR A;  4KRF A;  4CFB A;  3OYB A;  3SYZ A;  1UAX A;  4C8N A;  3QNN A;  4RW7 A;  1G15 A;  2YNG A;  4I9L A;  1KFD A;  4DU3 A;  2R7Y A;  1TV6 A;  4DSJ A;  5C42 A;  1C6V A;  1RT2 A;  4FJ8 A;  5J2N A;  2HHQ A;  4FLY A;  3EZ5 A;  4B9L A;  3ZT3 A;  3KD5 E;  4R5P A;  1JLQ A;  1VRT A;  3DLR A;  3ZSV A;  3DOL A;  4CJF A;  4CGH A;  4B9S A;  1X9M A;  2AJQ A;  5E41 A;  3LP3 A;  1BGX T;  4GVM A;  5CZ1 A;  3V81 A;  1NK8 A;  4KFB A;  4FJI A;  3TAE A;  2OPS A;  2YV0 X;  3HL8 A;  3NGY A;  3V9W A;  3SNN A;  2Z1I A;  4BE0 A;  3G0Z A;  1GOA A;  4QCL A;  3AVH A;  4IKF A;  4FJH A;  2E6L A;  1EXQ A;  4Q0B A;  3VN5 A;  4M3Z A;  3AVA A;  1I39 A;  4DTR A;  1RT1 A;  2QKB A;  4FXD A;  4Z4G A;  4FJX A;  1HQE A;  1HRH A;  4LH4 A;  4W5R A;  1LW2 A;  5HRP A;  4FM0 A;  3DRR A;  3HO1 A;  3O3F A;  4C8L A;  4DSK A;  5DK5 A;  3ZSR A;  2RKI A;  2RF2 A;  2HMI A;  3SV4 A;  3RRG A;  2X6S A;  4KHQ A;  3HPO A;  5J2M A;  4IBN A;  3AVM A;  3ZSY A;  1JXE A;  3DLG A;  4CEB A;  3C6T A;  4M3X A;  1IKV A;  3KK2 A;  2IGI A;  1FXX A;  4CF1 A;  1NJX A;  3NAE A;  3DOK A;  3WNG A;  4CJE A;  1LWF A;  4UQG A;  3ZT0 A;  4BDY A;  3B6O A;  4CEA A;  4C8M A;  4GW6 A;  1A5W A;  3SI6 A;  3OYN A;  3WNF A;  1S6P A;  1RIL A;  4DFJ A;  2PZS A;  4N56 A;  3F9K A;  2OPP A;  4KHS A;  4K8Z A;  1RBS A;  5FRO A;  1WAJ A;  1KFS A;  3OS0 A;  1QSL A;  1DTT A;  3TI0 A;  4DS5 A;  3AVC A;  4E7J A;  1IKX A;  3TAP A;  4M3W A;  3AVB A;  1HQU A;  1CZB A;  4FJL A;  4DQS A;  1JXB A;  4CEQ A;  4CHO A;  5KGX A;  4KTQ A;  3M8P A;  4CEF A;  3ZSX A;  3V9Z A;  1S1T A;  3U6F A;  3OS1 A;  1CXU A;  4LD0 A;  1L3S A;  1LW0 A;  2PYL A;  3VQC A;  3NF6 A;  2ZQB A;  1VSF A;  4QOZ B;  1RCH A;  1Z26 A;  4CK1 A;  4JRQ A;  4HHT A;  4FJ5 A;  5C24 A;  1I3A A;  2BE2 A;  3CFO A;  4C8O A;  1RDB A;  3S3N A;  3K59 A;  3QES A;  2DTU A;  1B9D A;  3PX4 A;  2HHS A;  1NK4 A;  2HHU A;  1GOC A;  4CJ3 A;  2IDO A;  1RT4 A;  1VSJ A;  4CK3 A;  4JS4 A;  4FZZ A;  4FLZ A;  1NK0 A;  3AO1 A;  3VQ9 A;  1UWB A;  4DMN A;  1XC9 A;  4J2A A;  3OYM A;  2HND A;  3SQ0 A;  4N41 A;  2O4I A;  4DSL A;  5KRS A;  3AVF A;  1IKW A;  3L2U A;  1WAF A;  3OVN A;  4B8A B;  4PUO A;  2QK9 A;  2DFH A;  3KKS A;  3LZI A;  1EP4 A;  4KHW A;  1C1A A;  3T19 A;  3RR8 A;  4CFD A;  1KVC A;  1VK0 A;  1S1W A;  4E3S A;  5D3G A;  3SUO A;  2A1R A;  3K58 A;  4N5S A;  4Z4I A;  4E1N A;  2F8T A;  1Y97 A;  3V9X A;  1WSJ A;  3AVN A;  4AHC A;  1MU2 A;  4Q5V A;  3TAM A;  3MXI A;  3LWM A;  3LZJ A;  4F3O A;  3ZSZ A;  1RBR A;  1NK6 A;  3TAN A;  1RDD A;  4CED A;  4NCG A;  4O5B A;  1B92 A;  1T05 A;  4CJU A;  4E1M A;  2FBX A;  1YVU A;  5K14 A;  3PUF A;  1TAQ A;  5JS2 A;  3ZCM A;  4DU1 A;  1WLJ A;  2WON A;  1KVA A;  4OLB A;  3S3O A;  1C0U A;  2G8H A;  3QER A;  1J53 A;  3QEP A;  3SPY A;  3B6P A;  3VQB A;  5DMR A;  4CFC A;  1LWE A;  4KHU A;  3QEW A;  1JLC A;  4CEC A;  3HM9 A;  5CY4 A;  5KRT A;  4DTJ A;  1IG9 A;  1ZBH A;  2I5J A;  3OYA A;  3QEV A;  1WN7 A;  4DQI A;  3BDP A;  2HVI A;  2B4J A;  4M3Y A;  4EZ9 A;  4JRP A;  1JLF A;  4RW9 A;  3CM6 A;  1TL3 A;  4IDK A;  4OKJ A;  3NE6 A;  4AIL C;  1KRP A;  1TL1 A;  3V9U A;  4J2E A;  3I0R A;  2PYJ A;  1RDC A;  4PA1 A;  3HXM A;  4DF8 A;  1X9S A;  1T7P A;  2VG6 A;  4F8R A;  2G8F A;  2YHB A;  3G10 A;  4PQU A;  4W5N A;  4E7L A;  2GBZ A;  1BHL A;  3KK1 A;  5SWM A;  3KK3 A;  1WSH A;  4DTM A;  3AO2 A;  5FRN A;  1Q8I A;  3MXJ A;  3VQP A;  1TK8 A;  4CF0 A;  3CFP A;  2RN2 A;  1W9H A;  5KTQ A;  4DTN A;  2EHG A;  4YFU A;  3QIO A;  2DFE A;  2E6M A;  2HB5 A;  3L2W A;  2Z1H A;  3NGI A;  4DLE A;  2XHB A;  1T03 A;  4H4O A;  4Y1C A;  4HCB A;  4FK0 A;  3DM2 A;  4CHP A;  1KLM A;  4DG1 A;  4IFY A;  2FBV A;  2BDP A;  4OLA A;  3SV3 A;  1C1C A;  4O0J A;  3L2Q A;  3U3Y A;  4CFA A;  4CEZ A;  2ATQ A;  5KI6 A;  3OYC A;  3QIN A;  2O4G A;  1O1W A;  4QAG A;  1A5V A;  4O0I A;  3LDS A;  1QTM A;  3RMA A;  1EX4 A;  4KV8 A;  1EKE A;  2KQ2 A;  5FDL A;  2BAN A;  4BAC A;  1KVB A;  1UA1 A;  4DWI A;  4OPJ A;  5I3U A;  1HPZ A;  3QLH A;  3E01 A;  2OPR A;  4CJP A;  4L8R B;  4Z4E A;  4E7I A;  2VG7 A;  4KRE A;  4FLT A;  4KI4 A;  4WE1 A;  4IG3 A;  4ZTJ A;  4ELT A;  3HYF A;  3L8B A;  1L3U A;  4IG0 A;  1GOB A;  1QHT A;  4B3O A;  1TAU A;  3AA2 A;  1BI4 B;  4OVL A;  3V6D A;  4FLU A;  1FKP A;  4DTP A;  4FZX C;  2XY5 A;  2ITG A;  3K5N A;  3CFR A;  4DTS A;  3NF8 A;  4G1Q A;  3OYK A;  4PY5 A;  3L2V A;  3SQ4 A;  3QET A;  4BE2 A;  4B9M A;  3IRX A;  1HNI A;  3LP0 A;  1RT7 A;  1LAV A;  3LP1 A;  4F3T A;  3MEC A;  3AA3 A;  4LH5 A;  4CJK A;  1DTQ A;  1BCM A;  4NYN A;  3KLH A;  2KFZ A;  1HYV A;  4B9U A;  3H08 A;  4FJ7 A;  2VG5 A;  3V4I A;  4I9Q A;  3SUN A;  4LSL A;  4Z4C A;  1R0A A;  1NOZ A;  1ZBU A;  2KFN A;  4RG8 A;  2XO7 A;  3L3U A;  4CEE A;  3LWL A;  4FJN A;  4CIG A;  3QIP A;  4Z4F A;  1C0M A;  3S9H A;  3KLG A;  1RT5 A;  2HHX A;  1TK0 A;  1S6Q A;  4CJ5 A;  3P1G A;  3ISN C;  4ELU A;  3OYE A;  3RRH A;  2XY7 A;  3CM5 A;  4CGF A;  4I2P A;  2XRI A;  4PWD A;  5CYQ A;  1C1B A;  3LAN A;  2YNF A;  4BWM A;  3LAL A;  3HP9 A;  1ZBL A;  3K5O A;  4CE9 A;  4H8K A;  1RT6 A;  3PX6 A;  3JSM A;  2EX3 A;  2G8I A;  3V1R A;  3AVL A;  4Z4H A;  4FJJ A;  2OZM A;  4FW1 A;  2GUI A;  3EY1 A;  3L3V A;  3VQ8 A;  4E19 A;  2B5J A;  4CES A;  4DFP A;  1C0T A;  4CJS A;  2X74 A;  2WOM A;  1TKX A;  1SKS A;  4HTU A;  2IS3 A;  3HP6 A;  4J2B A;  3IG1 A;  5T7B A;  1RT3 A;  4JLH A;  1RTD A;  1QSS A;  4KHN A;  3O4Q A;  4LSN A;  3OYD A;  3PV8 A;  3KLE A;  1ZBI A;  3V1Q A;  1D5A A;  1ASW A;  4ICL A;  1KCF A;  2B6A A;  1SUQ A;  3AVK A;  4M41 A;  3AO4 A;  4CHQ A;  3D0P A;  3RMC A;  1EET A;  2D5R A;  3AO3 A;  3V1O A;  3O3H A;  1KLN A;  1YTA A;  2ZD1 A;  4KO0 A;  2P51 A;  2DFF A;  4O4G A;  4M3R A;  2X6N A;  3I8D A;  4NCB A;  4CHY A;  3M8R A;  3ITH A;  3L2R A;  3RMB A;  4CJ4 A;  4OJR A;  3HJF A;  4CIE A;  2D0A A;  3DLB A;  4MQ3 A;  2KTQ A;  3O3G A;  1LAW A;  1VRU A;  5CZ2 A;  2Y1I A;  2JGU A;  3VQ7 A;  3SCX A;  1L5U A;  1NOY A;  4FJ9 A;  5I42 A;  1LV5 A;  3CYM A;  4FM2 A;  1K6Y A;  1U49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...