2B5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase P66 SUBUNIT
total genus 133
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b5jA05
5C42A 2PY5A 5J2QA 5KG0A 4IDKB 1BHLA 2B43A 1J9AA 2D3UA 1WAJA 3DMJA 3T5KA 3TAEA 4X2BA 2IM3A 3OSNA 5KGWA 1TKDA 1S1XB 4LQ3A 4OLBA 2R2SA 1O1WA 3NHGA 3ISNC 5C24B 4EBDA 3QEVA 3ITHA 4KKOB 3CIZA 1TKZA 1RCHA 1I39A 4IFVA 1HPZA 3G6XA 3QNNA 4FJ7A 3RMBA 2YNGB 4M3ZA 3DLGA 3NBPB 2DY4A 3VQSA 4CHPA 1B9FA 1XHXA 1J5OA 4RW4B 2X74A 2OPPB 3FFIB 4ECSA 4FLUA 5I3UB 4ECVA 5F8MA 1WSFA 2G8IA 2W9BA 3GIMA 1TQLA 3V1OA 4Z4CA 3DRPA 3IG1B 5C24A 4EP5A 3MECB 3E51A 3OL7A 1JLCB 3DRRB 2HHTA 4CEQA 1LV5A 4Y1CA 4Z4HA 4AILC 3OYHA 4MFBA 2VG7A 1K1SA 2RF2B 5HP1A 2WCXA 2J6UA 1L3UA 4YP3A 2BDPA 3LP2B 1FKOB 5KFXA 4KB7A 4BDYA 1IG9A 3PW0A 4FJHA 4MK7A 3AO5A 1RT7B 4ID1A 1IH7A 2JEGA 1NK4A 4FJJA 4DTPA 4FLYA 4O44A 3AVLA 3P5JA 4CESA 4AH9A 2X6NA 2HMIB 4QWCA 4FZZA 3HPHA 2KFNA 1C1AA 3VQPA 1SL0A 2OPSB 1TL1A 1XC9A 1JLGA 4O0IA 1JXBA 1UWBB 4O3PA 4IH6A 5KT6A 3AVKA 5I42B 3TAMB 3LPTA 4CJFA 4O0JA 4LSLB 3UDLA 4WE1A 3CJ0A 3KHLA 2GC8A 4QWDA 4CFBA 3DOLA 3VQ4A 4Z4EA 2ZD1B 1ASWA 4FZXC 3EPGA 3ZSYA 2XI2A 4WXOA 5KG2A 4DTUA 2GIRA 4DU4A 1ZBIA 3OVNA 3ZSRA 1QHTA 3FSIA 3KMQA 1X9MA 2FJVA 5KG5A 1QS4A 2OPQA 1TL1B 4IKAA 3MR5A 1D9FA 4NCAA 2J6SA 3K2PA 1CXUA 4IG0B 4J9QA 2YHBA 2XO7A 1DTQA 4TY8A 2FLPA 4I2PB 1ZTTA 2XRIA 3ASMA 2RDJA 2AX1A 1NJZA 3OS1A 3VQ8A 4YR2A 4TXSA 4IH5A 3ICLA 4RUCA 4K8XA 5D3GB 4FJ8A 1LWFB 3RB3A 3VA3A 1RYSA 1SV5A 3U3YA 5J2NA 5KRTA 5F8IA 3KHRA 2E6LA 2YKMB 1NKBA 3D28A 4O3OA 4C8LA 1HMVA 1JX4A 4ZP9A 1RT4A 5F9LA 3KJVA 2AJQA 3GILA 1N5YA 2G8KA 3V6DA 4EYHB 1RILA 5CYQA 2OH2A 1VSMA 3S3OA 3DM2B 3AO3A 4Q0BB 5DG9A 4DSEA 4Y3CA 4ZPCA 3IRXA 1EP4B 4K4SA 3NAHA 4FJ5A 3GQCA 1KVCA 5J2PA 4F4ZA 2HWHA 5T7BA 4B9UA 3I0SA 1I3AA 3L2RA 4OVLA 4N41A 5DMRA 3TANA 1I6JA 3OYKA 5KFUA 3OJUA 3HXMA 4ZP7A 2AWZA 1S1TA 3NCIA 4E1NA 3NAEA 3ZSXA 1D9DA 1ZBLA 3H2LA 1HQEB 3V6KA 3TWHA 4FJMA 1CLQA 3AV9A 1RDRA 3BGRB 5L1KA 1S0NA 3A2FA 4F4XA 2E9TA 2EX3A 2RKIA 3SFUA 3NBPA 4U6PA 5KFWA 4FM1A 2AGPA 3SUOA 2JEFA 4DS4A 4FBUA 3AVCA 2ZE2A 1LAWA 1JLFB 1QSSA 4I2PA 4F4WA 2A1RA 1ZYQA 4BE0A 3DYAB 2ASDA 4HUGA 5DQIA 3QGHA 2BQ3A 4WFXA 2CKWA 4KHNA 2WOMA 1TKZB 4DU3A 1C1BA 4OGEA 4F3TA 3Q8PB 2XHBA 4W5NA 3KLGA 2FJWA 3L2UA 2HNDB 4FLWA 2YHAA 3TAPA 4LQ9A 1NHUA 1BQNA 4DFMA 3I8DA 1LWCA 5HRPA 1XR7A 4E7HA 2D0BA 2F8SA 2P1JA 4E7IA 4QPXA 4KHMA 3GV8B 4CJUA 5KFPA 3JSMA 1SUQB 3PX0A 4FS2A 2JC1A 1RT1A 3OL8A 4RZRA 5KG4A 3WNEA 4CK3A 3NE6A 1D5AA 3PR4A 1W0HA 1Z25A 1J54A 2DTUA 1D0EA 3QEPA 3TARA 3RR7A 5I42A 1C0TA 5FROA 3EPIA 2IS3A 3KK3A 3BSNA 1BQMB 3V9XA 4FJLA 4PA1A 3N6LA 1JLCA 1S9EB 2E9RX 3V1QA 2ZKUA 3KHHA 5KT7A 2FBXA 3KKSA 1K6YA 4M3XA 2I1RA 3K5NA 2GIQA 5JXSA 1RDBA 1YVUA 1LWEB 3ZT1A 2ILYA 3KLEA 3HHKA 1YTAA 4RW7A 4WXWA 4PUOA 3U6FA 4B08A 1KSPA 1S49A 4B3OA 4Y34A 3HT3A 4NLSA 5KFNA 1SKSA 1SV5B 4NYFA 5F8LA 4FVMA 4R5PB 3VQEA 1IKYB 3L8BA 2IM2A 4E0DA 3PJWA 4KKOA 3LP1A 3GV5B 1NOYA 2C28A 5F8GA 1YVFA 4F8RA 4IFVB 4H4MB 1BQMA 2HHXA 4H8KA 1XHZA 3NGDA 4NLTA 1S9EA 3I5CA 2AGQA 2PZSA 4CF2A 1D1UA 2Q3SA 4DQSA 1T8EA 3RMCA 3QLHB 4CK2A 4O3RA 1FXXA 4W5TA 4AHVA 4RUAA 2I5JB 1B9DA 4CHZA 2HNYA 3Q8QB 3DLHA 1RBVA 3AVAA 1TVRA 2HWIA 3CDWA 2CJQA 5EWFA 4KHQA 3JYTB 2B5JA 5E41A 1S48A 1IKWB 3OYAA 3KTQA 3HO1A 4Q0BA 1WSHA 4GW6A 2WONB 5KG7A 2W9BB 4MIBA 2XCPA 2QE5A 3V1RA 2OZSA 4K4TA 3OHAA 4KFBB 2VG6A 3OYIA 3V6HA 3O3HA 4DF4A 2YNHB 1U45A 1RT6B 4J2AA 3OHBA 1U04A 2FBTA 3VQ9A 4K8ZA 1T94A 2HNYB 4GMJB 3OLBA 1T03B 4FK2A 1REVB 4FJIA 1HYSB 3DRSB 1KLMA 4DL7A 2UUWA 4EZ9A 1L5UA 4DTNA 4O55A 3VQQA 4ICLA 4NLVA 3KJVB 1K1QA 2HMIA 3UQSA 2KTQA 4ED2A 4PUOB 4YR3A 1CXQA 4FW2A 4FLZA 1R0AB 2KZMA 4URQU 1NJYA 4ID5A 3KK2A 3CM5A 3AVFA 4LY7A 4O4GA 3LAMA 3S3MA 4DEZA 1NK0A 4E89A 3HVRA 2G8HA 3MECA 2ILZA 2GUIA 4CGDA 4N5SA 5HBMB 1EETB 1VSEA 1SH2A 2OPQB 1HQEA 3QEXA 4DL6A 3AA5X 4M95A 2D41A 2HHVA 2R2TA 2WTFA 1RTHA 3SI6A 2C2EA 3O3FA 4CEAA 2HNZA 1EXQA 2AU0A 3H5SA 3NH1A 3OYJA 1TK5A 4W5RA 4NLRA 4NLUA 1T05B 4DFKA 3HPOA 3ZSQA 1KTQA 3MXIA 3MEDB 3GIIA 1NK9A 5KFKA 3UPFA 3T5HA 1DTTB 4QCLA 4FBTA 5EWEA 3CDEA 4DQRA 4QWAA 1EETA 4YR0A 4J9SA 1JLAB 4IG3B 4C8NA 4DS5A 5J2NB 1RAJA 4DSLA 3MEGA 3G0ZA 1Q8IA 3OS0A 2IA6A 2JEIA 2YKMA 5J2MA 3N6MA 3I0RA 1C0TB 2IJNA 1RTJA 3QO9B 3MR2A 2HVIA 2KFZA 4OKJA 3VQ5A 3VQCA 4DLEA 1ZETA 2FC0A 2ATLA 3OYEA 4ZPAA 3AO2A 2VA3A 2FVRA 5HRSA 3ZSVA 4CGFA 3ZT4A 3V6JA 4DSIA 3DI6B 3KLEB 4DQQA 2YNIA 4LH4A 3Q8SB 1S6PA 1TL3A 3HVTB 1ZBFA 3RMDA 4Z4IA 1WLJA 2LSNA 3TI0A 3H5UA 5KFLA 2DPJA 5KFMA 1JXEA 3IGVA 4ZPBA 4R5PA 5FRNA 1VSDA 2HHSA 3P83D 4GC6A 4NLPA 1HARA 4E3SA 3PV8A 2UVUA 2V4RA 4FW1A 4CJ3A 3VQDA 2ALZA 3HL8A 4NRUA 3QGGA 1S1XA 4ED0A 3LWMA 4IH7A 3B6OA 5KFJA 3AA3A 3PR5B 4EBEA 2Z1GA 5JS2A 4I9QA 1BGXT 2BQUA 4KBIA 2W9AA 1RTIB 1HYZA 4IFYB 3LZIA 3PO4A 3BGRA 4TQRA 3TAFA 2XI3A 2VWJA 2FLLA 4DQIA 5HROA 3QERA 4KV8B 4BE1A 4ZTFA 2E6MA 3RBDA 3ZT0A 3PX6A 2ZE2B 3DRRA 4F4YA 4J9MA 3NF8A 5K14B 3FQLA 4H4OA 4FS1A 2RF2A 5HRRA 1S1TB 1D8YA 2HNDA 5HP1B 1WAFA 3M9OB 4FCYA 4RW9B 1L3SA 5KGXA 1C6VA 1CZ9A 2BQRA 4J2DA 4QWEA 2WOMB 3CJ3A 3DRSA 2V0NA 4BDPA 4IG3A 1RTDA 4OL8A 4RU9A 1F21A 4HCBA 3AA2A 4ELVA 3I0RB 4GVMA 2FVPA 3OYGA 2JEJA 1RDCA 3NAIA 4TLRA 3V9ZA 4EEYA 2OPSA 3GIJA 3K57A 3MEEB 4CEBA 2OPRA 4E7JA 3SQ0A 3AVGA 4PY5A 3K5MA 4JRPA 4ICLB 4KO0A 4MQ3A 4CHNA 1OS5A 4LSLA 1J5OB 4CJTA 3KK3B 4CGHA 2FVSA 2B5JB 4CF0A 4M45A 2VG5B 1JL2A 4I7FB 4MH8A 4CJWA 2AQ4A 3KLHB 4F50A 4I2QB 4NLQA 3NGZA 2BANB 2IC3B 3FQKA 4DTOA 2VA2A 4CFCA 3DDKA 4W5OA 1LW0A 5KT5A 2G8FA 1G15A 3KKRA 4CFAA 1S1UB 4Y2CA 4J9NA 1EX4A 5EWGA 4BE2A 3MAQA 3PW4A 3H4BA 4FM2A 1BQNB 4OKKA 2G8UA 3OYBA 1S4FA 1SH0A 4URSA 3SQ4A 3T1AA 5HROB 3EYZA 1BIUA 4HYKA 5DK5A 1S1WB 2O4GA 4I7FA 1NJXA 2F8EX 3KK2B 2HHQA 4CGJA 3S9HA 4F2RA 2WHOA 4I2QA 1VSKA 4I9LA 5JS1A 3OYNA 4QOZB 1RT1B 4O3SA 1C0MA 1GOBA 2F96A 4KHWA 5KI6A 4ZHRB 2RDIA 2WB4A 3RB0A 1RT5B 4IR1A 3DLGB 5T14A 4KAIA 4WYLA 1JLAA 3UR0A 1RT2B 4DL3A 3DLEB 1TGOA 5CYQB 4Z4FA 4ZVHA 2QKBA 4N76A 1N6QB 3FRZA 3KLFB 1KCFA 2ZD1A 2YNIB 4IR9A 1KHVA 3F9KA 1RTHB 2ETJA 5FRMA 4RG8A 2G8WA 4ZVEA 5KTQA 1JKHB 4ECZA 4ED7A 3BREA 4DTXA 2YNFB 3TVKA 3D0PA 1TL3B 3HVTA 5KFFA 4FJNA 5KFZA 2W9CA 1VSIA 1SH3A 4TY8B 1RA7A 3IGNA 1UAXA 1WN7A 4ECXA 4KREA 1HNVA 5J1EB 2X78A 1ASVA 5CZ1A 3T19A 3IS9A 3THVA 3EZUA 4XIUA 3QIDA 3TQ1A 4DL4A 1RA6A 2YKNB 3QO9A 2HW3A 1WNEA 3V4IA 5KFDA 2I5JA 1QAIA 2IM0A 1RDAA 3M8RA 2B6AA 4GC7A 1N48A 1TK0A 1FK9A 3VQ7A 4HKQA 2R2RA 3MEGB 3KMSA 4J9RA 4H54A 1C2PA 2XGPA 3LAKA 4B9LA 2IDOA 1CZBA 1VK0A 4ZP8A 1VRTA 2V4QA 2KW4A 1RTIA 2D7SA 1X1PA 4HTUA 3F73A 3E01A 3V6DB 1Z4UA 4ZP6A 3NL0A 3SPZA 3CJ5A 4KHRA 3AVJA 1IKWA 1JL1A 2W8LA 5DLFA 4KHSA 4FYDA 4CF8A 1EKEA 1S6QB 3WNFA 4DSJA 3P1GA 4ED8A 3PVXA 1JLQA 4RNHA 5L1IA 4KPYA 1LAVA 2B6AB 1T03A 4IRDA 2IOCA 1TKTA 2FBVA 1T7PA 2EC0A 1RT3A 1BIZA 2XWYA 2R8KA 1GX5A 2X6SA 1T05A 4CHOA 4IBNA 3H59A 3H08A 4KTQA 3V81B 4CEZA 3I5BA 2EHGA 4F2SA 4HHTA 3M8SA 4IRKA 3SCXA 5KT2A 1RNHA 3HSTB 4J9OA 1QUVA 3OYMA 1JLBA 1JKHA 3DMJB 3JSMB 1X9SA 4IQXA 4XPEA 2IC3A 3HPGA 4O3QA 4E1MA 4JUZA 2D5RA 1FKPA 5KRSA 3H4DA 4B9SA 2D0AA 4BACA 4BWJA 5J1EA 4FM0A 2XY8A 3SQ2A 3BR9A 4PWDB 3B6PA 2BRKA 3PW5A 1TK8A 3BSAA 1HJRA 2UVRA 4JV1A 4ELUA 4FXDA 5DG8A 1RBTA 4AHSA 4M94A 3DOKB 2OPRB 4JRQA 3OLAA 3L3UA 3VQ6A 1UWBA 2DPIA 4FJGA 2UUTA 4Z0UA 1TV6B 5F8HA 2PYJA 1BCOA 2D0CA 2VG5A 5KFYA 1NKEA 4IG0A 1MU2B 1S1WA 1HQUA 5C25A 3PJXA 4ECUA 2KQ2A 4KHUA 4JLHA 3PY8A 4KO0B 3SI8A 2C2RA 3QESA 3PZPA 1Q9YA 3K5OA 4J2EA 4M42A 5KFCA 4LSNB 3QLHA 4NLXA 3QIPB 2BR0A 5CYMB 2W7PA 1S9GA 2GBZA 2AGOA 2VWKA 2Y1JA 4WZQA 3HP6A 2Z1JA 3SV4A 4ECRA 4FJKA 4B8AB 2HHUA 4IFYA 1RYRA 2XY5A 1BCMA 4H4OB 1N6QA 5FDLA 1U47A 5CY4A 2WRMA 5F9NA 3PO5A 5KFEA 1HNIA 4DSKA 4KV8A 4NCGB 3CFRA 3DM2A 4KFBA 2Z1HA 1BI4B 4CJ4A 3ITHB 2GV9A 3OL9A 3RRHA 1S1VA 3TAMA 2PYLA 4QWBA 4M3TA 1YTUA 3DYAA 1U4BA 3IN5A 4KTZA 5KFSA 1UOCA 1VRUB 3EZ5A 4NRTA 4ECTA 4WZMA 4K4WA 2JC0A 3GV7B 1S9GB 1REVA 1X9WA 3HKWA 3ULDA 3DLEA 1UA0A 1RTDB 2C2DA 4RNOA 3MF5A 3DLKA 3NH2A 3V9UA 4FLXA 3V4IB 4EO8A 3SUNA 4TYAA 4KSEB 5KG6A 2ATQA 4JS4A 4DFPA 3H98A 1YT3A 2D3ZA 1B92A 4Y1DA 4AHUA 1TAQA 3ZT2A 3KLHA 1TKXB 1SUQA 3SJJA 3MR3A 3NKYA 2KZZA 5F8NA 4RW8B 4N56A 3BJYA 2IAJB 4B9MA 4NYNA 4TSXA 2J6TA 5DQHA 3NH0A 4TY9A 2BE2A 4WFZA 4LD0A 1IKXA 5HLFB 3LP0A 2W9CB 5DG7A 1VSJA 4DL2A 4Y2AA 3ZSWA 4MKBA 3QIPA 2JGUA 1QE1B 1NK6A 3KLGB 4CERA 1JLGB 5SZTA 4LH5A 3Q8RB 2ASJA 1RT4B 4QW8A 4R0EA 1GX6A 3TABA 3O4QA 1DTTA 4RW7B 1HYSA 4KI4A 1N5YB 5FDLB 5J2PB 3WNGA 4CGGA 4R8UB 4CK1A 1NK7A 1KLNA 3OYFA 4CF9A 3NF6A 5KT4A 4N47A 3BDPA 3DLBA 1VRTB 3H40A 1CSJA 3KOAA 3CYMA 4MK9A 1NK8A 3L2QA 2HAIA 3PHEA 4EO6A 4DTSA 3AA4A 2Z1IA 3NF9A 4Q45A 1VSFA 3KLIB 3GIKA 1C1CA 3OYLA 2E4LA 4CJRA 1U49A 1QE1A 4CJVA 4FLTA 3QINA 3VA0A 4ID5B 1Q9XA 3H5XA 4CIFA 1LWCB 1HYVA 1JIHA 4K4VA 1GOCA 1ZBUA 1BL3A 4KAZA 4NCBA 3LZJA 5EUHA 3NFAA 1FKOA 4CEDA 4ED3A 2RKIB 4CJPA 3RRGA 3RTVA 4IRCA 1LW0B 3RB4A 3KLFA 3QZ7A 3S3NA 2YV0X 3AO1A 3K59A 3QETA 4ZVFA 4UQGA 4BDZA 1MU2A 3CFOA 3VQBA 3CFPA 4MK8A 3DOKA 2R7YA 2RPIA 4ZMMA 2R8GA 3OSPA 4NLWA 4HUFA 1C1CB 2XY6A 4B3OB 2OZMA 3GYNA 3T5JA 3HJFA 1L3TA 2FVQA 3BSOA 3QGIA 4K50A 1RT2A 1KLMB 3OS2A 3LP1B 5L1LA 4CJEA 3HM9A 3SZ2A 1ASUA 2YNHA 1WSGA 1KRPA 4KE5A 1JLEB 3NGYA 1IM4A 2QXFA 3O3GA 1XR5A 3ZCMA 1L3VA 3LP0B 1FKPB 4RW6B 1DLOA 1FK9B 4DG1B 3AVIA 4QW9A 2RN2A 3RAQA 5J2MB 3IAYA 2XY7A 3TAGA 4URGA 3LDSA 4Q5VA 2IM1A 4DSFA 4TN2A 4DFJA 4O4GB 4Q8EA 3E01B 1A5XA 4M41A 2FVCA 1HNVB 3IS9B 5J2QB 5KG1A 4PQUA 2WONA 4HVJA 3HYFA 4JV2A 4NLOA 3L3VA 3BQ0A 3PW7A 5D3GA 4CFDA 4G1QB 1WSIA 3V81A 1XI1A 2XCAA 4OPKA 1VRUA 5KFTA 4HCCA 1XR6A 1TKTB 2NUBA 3SNNA 4CJQA 3U3GA 3VN5A 2OPPA 3SPYA 3OYCA 2IGIA 4DMNA 2WK4A 2P5OA 3KK1B 1NHVA 4CIEA 3C6TA 1HPZB 1JLFA 2HB5A 3MEDA 4C8OA 4DQPA 4Q44A 4K4ZA 4CGIA 3MTKA 4FJ9A 4CF1A 5KFGA 4ZVGA 3AVMA 3C6UB 4MFBB 2BE2B 2G8VA 4TYBA 3ZSOA 4DL5A 4CJLA 1IKVB 4M3UA 5C42B 4RW8A 1Z26A 3L2WA 1TAUA 1UA1A 5K14A 2W7OA 3M8QB 5KFBA 1NK5A 3BQ1A 4DF8A 4B9VA 3C6TB 5KFQA 3QYYA 1N56A 4ZPDA 3LP2A 5KFIA 4CCHA 4EZ6A 1S6PB 4OJRA 3DLRA 4MKAA 4AHRA 2BGGA 2JLEA 3NMAA 2XGQA 2P51A 1GOAA 2P5GA 1WSJA 3RR8A 3DRPB 3OJSA 1RBRA 1N4LA 5KFVA 1RT5A 3T5LA 4Q8FA 2R8HA 5I3UA 5EU7A 4PWDA 3AVBA 1RBUA 4JV0A 3M9MB 1RT6A 4J9LA 3RWUA 3CWJA 3LWLA 1SL2A 1J53A 1S0MA 3WNHA 4WE1B 4ZTJA 4C8KA 3KLIA 1S10A 4ZHRA 2VG6B 1NKCA 1C1BB 1A5VA 3KD1E 3HP9A 1HNIB 4OGCA 4BWMA 4WFYA 2ZQBA 3BSCA 1BISA 5KT3A 1W25A 5HRNA 1TP7A 5SWMA 4FLVA 4F3OA 2Y1IA 3QEIA 3CG7A 4ECQA 1NNDA 3D5MA 4OKEA 1VSLA 4QAGA 3SUPA 2OA8A 1WSEA 4RW9A 1RBSA 1C0UB 5KFOA 4JS5A 5EDWA 4E7KA 4DU1A 3DI6A 5C5JA 1QSLA 2YNFA 3D45A 4LSNA 1JLEA 5KFRA 1KFDA 3SFGA 2W8KA 4ELTA 3OL6A 1LWFA 4NLYA 4O5BA 3CJ4A 4RW6A 4B9NA 3SUQA 3KD5E 4C8MA 3NDKA 3EY1A 1LW2B 2UVWA 3LP3A 2FBYA 3C94A 4ED1A 4MIAA 4OPJA 5L9XA 2OYQA 3DLKB 4RNMA 5DGAA 1EP4A 1QQCA 4NCGA 1DLOB 4L8RB 1JXLA 2AX0A 5KFHA 3OY9A 3I0SB 3FFIA 1IKYA 3PW2A 1S1VB 1LWEA 2O5DA 4F4KA 4RNNA 1W9HA 4J9KA 4H4MA 4U7CA 2BANA 2E9ZA 3G6VA 2B4JA 2W42A 1JLQB 5CZ2A 3M8PA 2QK9A 3CVKA 3TR8A 4EYIB 3PX4A 3O4NA 2IAJA 4NLDA 4K4UA 4NZ0A 3V9SA 1NJWA 4EP4A 1S97A 4CEEA 4E7LA 1SKWA 3AVHA 2VG7B 1HMVB 3VQAA 1ZBHA 3MFIA 1IKXB 5HLFA 3SV3A 2QV6A 3AVNA 4M3WA 4KHYA 4B9TA 1RT3B 3CM6A 3FDSA 4EBCA 1HRHA 3OYDA 3CO9A 3BQ2A 1Y97A 3SYZA 2HHWA 4CJSA 4O4RA 1QTMA 1TVRB 4DWIA 4AHTA 4RW4A 3M8PB 3QNOA 3QIOA 1IKVA 3HVWA 4M3YA 4CECA 1VSHA 4YQWA 2BRLA 3DOLB 1C0UA 4Z4GA 3L2VA 2DFEA 3TAQA 3CQ8A 1KFSA 3K5LA 3C6UA 3G6YA 2HNZB 2IBKA 1T3NA 4DTJA 3IG1A 4CIGA 4KB0A 4HUEA 3KLVA 4FJXA 4NYZA 3K58A 5KFAA 4KB1A 3AO4A 3RB6A 4XPCA 3G10A 4NLGA 2R8IA 3KK1A 3HVAA 4G1QA 3MEEA 2XC9A 3NGIA 3LANA 4CJKA 1QAJA 5DGBA 4ED6A 4R8UA 4Q43A 1RDDA 4O44B 1MMLA 3ISND 4IOBA 2UVVA 4CEFA 4YNQA 3I5AA 5L1JA 1IO2A 4IDKA 4IKFA 4KI6A 4ECYA 2IJFA 4CE9A 3QZ8A 4YMEA 3KNAA 4M3RA 3T3FA 1KVAA 4DTMA 4OLAA 4XO0A 2IMWP 3ALYA 1R0AA 2QKKA 3UIQA 4DTRA 4B8CA 3V9WA 3MXJA 2ASLA 3PUFA 1HQUB 5C25B 3M8QA 1SL1A 5KG3A 3RBEA 1KVBA 2ITGA 1S1UA 4CHYA 4KTWA 2FJXA 2YKNA 2F8TA 3G86A 2YNGA 1U09A 5HBMA 4G3IA 2HVHA 1A5WA 3NF7A 5CYMA 3KHGA 4AHCA 3N6NA 4CHQA 4DG1A 2DFFA 1S9FA 2A1SA 4FK4A 1DTQB 3KIOA 4K4XA 1KHWA 2C22A 3CJ2A 4J9PA 4K4YA 4KRFA 3CDUA 1S0OA 4FZYA 4ECWA 3ZT3A 4J2BA 3IRXB 3QEWA 2O4IA 5DLGA 3HK2A 3MXMA 1ZTWA 5JUMA 2FLNA 3RAXA 4W5QA 4WYWA 1BI4A 4PQUB 1TV6A 4YFUA 1S6QA 2V9WA 3H5YA 4FK0A 3M9NB 3RMAA 3LPUA 1SKRA 3MR6A 1WNSA 4RNFA 4TQSA 1S5JA 1RT7A 1ITGA 1U48A 3C95A 3JYTA 5DQGA 1LW2A 2R2UA 1RTJB 5F8JA 1JLBB 1NOZA 1QSYA 1XWLA 2R8JA 4CEOA 1TKXA 3SQ1A 4DLGA 3ZSZA 3LALA 4E19A 4CJ5A 2DFHA 3MFHA 4O3NA
chains in the Genus database with same CATH superfamily
1NB2A 3DFEA 5C42A 2E5IA 4CO4A 2RQ4A 4FWNA 2O8BA 4DPXA 4JI3F 1BHLA 3NVMA 2B43A 3DOMB 4BC2A 3MXHP 3DMJA 2CPFA 3TAEA 4NE9C 1YI2N 4JYAF 2V6AA 4JI0K 3ISNC 4NXMJ 4BR5A 4EBDA 5IT4A 1U6BA 3DGVA 3ITHA 4LF9J 3CIZA 1TKZA 1RCHA 1I39A 2KM8B 2FQQB 2LU2A 2BXJA 3W60A 3EVOA 3TRGA 3G82A 2AZ3A 4NMLA 1XHXA 2JL9A 4B1ZA 1B64A 3FSYA 1D9AA 5I3UB 2EC2A 5F8MA 1WSFA 3CHWA 1P1LA 3NLCA 4LR8A 1TQLA 4X62J 1U1OA 4PG6A 4F0MA 4K0KK 3SDEB 3IG1B 1IBCB 4LC9B 4DPUA 1U2FA 3VPZA 1IR2A 1LV5A 5IXUA 4HH0A 1H74A 3GFXA 2J6UA 3WC2A 3FZHA 4BDYA 3PW0A 3LDNA 2QN6B 3AO5A 1RT7B 3ULHA 4ID1A 2JEGA 3LDOA 4YDUC 4FLYA 3D6HB 1RAEB 1Y00A 1F2HA 1H7WA 4B3SF 2NR0A 1M5SA 2HMIB 4FZZA 2G2OA 3C15A 4JKGB 2WVCA 1H2TZ 3ZTOA 5BJRA 3CC7N 4LF2A 1YXQA 5KT6A 2MQPA 1TUYA 3AVKA 3PHTA 1SC4B 2GV1A 5I42B 3TAMB 4CJFA 2MQOA 4O0JA 4FYVB 4LSLB 1OVQA 3CJ0A 1FE0A 2BV3A 2GC8A 4QWDA 1K0TA 4K5RA 2HBJA 4FWOA 2ZD1B 3SAGA 3ZSYA 5KG2A 4DTUA 4GRSA 3G25A 3OVNA 1QVFM 2FJVA 5KG5A 1E6VB 3SCJE 3FBFA 1X5TA 3PIOQ 1NZ8A 1PJ7A 4NCAA 3CF5Q 4M63C 1CXUA 1FKAF 4J9QA 2XO7A 1IBLJ 4P2XA 4I2PB 4OZ1A 4YOEA 4J37A 2HFVA 4AD6A 2N4CA 1KD1T 2HEKA 1DEJA 1J2VA 2P9GA 3OA9A 2W7AA 3DWLA 2QYGA 2KRRA 4LRFA 2EI5A 2L08A 4NASA 2DR8A 1NKBA 2FJEB 1X7VA 3AY0A 2AKWB 5FIIA 1AFIA 2K7JA 1N5YA 1UL3A 1U1NA 1VISA 3KNGA 4EYHB 1UVKA 4BRAA 1VSMA 3D0GE 3MM6B 4DR5K 4DR6F 2DNZA 4RLEA 4C0BA 3ZTSA 4ER8A 4A57A 2B56A 3A0IX 4H0PA 2HWHA 4IDHA 2XNRA 4RWTA 3ILOA 4OVLA 3DXMB 2J7KA 4LF4J 3TANA 5DMRA 1I6JA 4PQAA 1VC5A 3OYKA 2A5XA 2ZKTA 2OUGA 2XNQA 2AWZA 1RWVB 4B17A 2DRAA 4JI6J 3THTA 1ZBLA 2P6SA 3H2LA 5ETMA 1HLWA 1ZA2B 1ZAXA 1WF0A 1CLQA 1ZPWX 5CABA 2HVZA 2ZJPQ 2CG4A 4WP8A 4F4XA 3A2FA 3I32A 2MKSA 1DARA 3TUPA 2W4CA 2NUHA 3GFYA 3SUOA 3ZLJA 2JEFA 4FBUA 2RB7A 2I9SA 3VQTA 4CD3A 4F4WA 1U0SA 5GAEI 1ZYQA 4BE0A 2ASDA 4LFAK 2HKEA 1NBEB 3QQCD 2MZQA 3NCQA 3O1WA 1ELOA 2EVZA 2NRXA 2P5VA 3TU5A 1YHQN 4P10A 3UDVA 4C3LA 1WDTA 3WX8A 2XHBA 2DR6A 2OEJA 4OHXA 2HNDB 2NRVA 2VQFJ 4FLWA 1QQNA 2IY5B 1ACMB 4C2MA 1U0HB 4DFMA 4X4OA 3GU0A 1LWCA 4I4BA 4HACB 4QPXA 2FZCB 1GLLO 1Q7YO 4NEYA 4OO1J 1HWLA 1SUQB 2Y1LB 3ENAA 3PX0A 2JC1A 5KG4A 2DGXA 2U1AA 3PR4A 4ZDNA 2BJDA 1UPMB 1F5CA 1DKGD 5FROA 4PEOA 3KK3A 3BSNA 5M1QA 1BQMB 3V9XA 1PYSB 4H0TB 2E9RX 3KHHA 1TU0B 2C3MA 5FPNA 1KOHA 3MI7X 3AD7C 1KDNA 1K6YA 1Y64A 1X4FA 1Z2LA 5F3ZA 3ENQA 4G6VB 2D74B 1H0HB 3HHKA 4RW7A 1LFWA 4WXWA 3B6BA 3U6FA 5AZIA 3SQGB 3O1LA 5E3PA 5KFNA 1SKSA 5F8LA 1Y3JA 4FVMA 1IKYB 2WBNA 2Z30B 3OTEA 3AAQA 1NOYA 1YVFA 5FLXO 2FHKA 4CBUA 4IFVB 1NH8A 1BQMA 2HHXA 4H8KA 3FGVA 2Q31A 2B9WA 3HHNB 1BHNA 3TEHB 2AGQA 4MO4A 1KQSM 3I55S 1T8EA 2BW7A 3RGIA 3RMCA 4ZCIA 4QYZK 2LCWA 2Q6BA 1FXXA 1R0BG 2I5JB 1B9DA 4S0MA 2CNKB 3CDWA 2CJQA 2VD3A 4R79A 5D0EA 4DV0F 4BLGA 3IC1A 2WONB 5LJ5Y 5KG7A 2W9BB 4MIBA 2XCPA 4BRDA 3GSIA 1X5SA 1TL4A 4KFBB 2VG6A 2Z2MA 3OYIA 1K8KB 2ROEA 3BZQA 2QSFA 3V6HA 4V19X 2UUAK 1U45A 3HRGA 1QD1A 4CI6A 4J2AA 2CAJA 1X4BA 1WG5A 2HNYB 2LVWA 3OLBA 4GMJB 4BRGA 4FK2A 4DR5F 3VGLA 1HD1A 4NYPA 2HBQB 1B7FA 4DCHA 1SIWB 4DTNA 2PI5A 4NLVA 4USHA 1K1QA 2HMIA 3UQSA 2E1CA 4BC4A 2EXUA 3O2IA 2BJEA 1LXJA 1ROFA 2CPDA 2CWKA 1SQFA 4I0WA 1DFDA 3KK2A 3D3BJ 3C0BA 3L0QA 1V4TA 2UXCK 2AHOB 1IR0A 2ZJRQ 4DR3K 2YKPA 1IBKK 1NK0A 2KKZA 2OO4A 2ZBCA 2ZM6K 3RSEA 1JCFA 4GVLA 4CLLA 1JMTA 4K2XA 3QEXA 1LNQA 2E7WA 4O0NA 2WTFA 1RTHA 2C2EA 4C48A 2HNZA 1O6XA 4DUYJ 3T41A 5C2DA 3DXSX 5A8RB 3DNCA 2IPOB 2AU0A 1TK5A 4X4TA 1VBKA 4DUTA 4NLUA 1T05B 2YX6A 2M3DA 2RH3A 4DDFA 3OTOF 2EG2A 3BZKA 1Z2ZA 4JKGA 4FBTA 4DQRA 1GAOA 1SAZA 3Q23A 4J9SA 3ETOA 3SEOA 4IG3B 1FX4A 5B09A 3R5DA 2IA6A 2EFOA 2A1BA 4HT5A 4WJBA 5J2MA 3N6MA 2FIUA 1C0TB 2PA8D 3L95X 2OTLS 1B7YB 3MUMP 3QO9B 2KFZA 2DRBA 1S59A 1N33F 1T9TA 5ITHA 3H1VX 3ZXWA 3VQCA 3AO2A 2K1RB 4CGFA 3NMUA 2PIIA 4ZPTR 3V6JA 1VQ9S 2NXNA 4DQQA 2HQIA 1TL3A 1ZBFA 1C0GA 2P9NB 2L48A 4K25A 1JXEA 5L39A 1VSDA 3GR1A 4QJVA 4DU8A 1VQ9N 4WIIA 2GEMA 4CJ3A 4OPHA 5HMWA 2ALZA 4NRUA 1DRZA 2JDJA 1TELA 1DT9A 3AA3A 3O8MA 2V51B 2Z1GA 4YOVA 4I9QA 2BQUA 4A4JA 2W9AA 2DH8A 3PCOB 1HYZA 1SC6A 2J4RA 4UT4A 4TQRA 2XI3A 4KRWA 5HROA 4BE1A 2E6MA 1TL7A 5BREA 3PX6A 5IV3A 3CCUN 1RBOB 4I6MA 4F4YA 2D3O1 1Y3KA 4FZVA 5AXNA 1YUWA 1D8YA 5IFMA 1K0VA 2HPUA 3M9OB 1L3SA 4RW9B 4FCYA 3BN7A 4J2DA 4QWEA 4IG3A 4HACA 1RTDA 2CPYA 2VC1A 4X65K 2MJNA 5HQ8A 4ELVA 3I0RB 2GAHC 2FVPA 1FTRA 4B3MJ 2QA4N 5JLHA 4OI0A 3MEKA 4EEYA 2NNWA 2O8EA 2AJ4A 3JXUA 4A62A 3K57A 4CEBA 3BS9A 2ZBQA 1XC3A 1UVIA 2FGOA 4FNHA 2IRUA 4PY5A 3EVMA 4MQ3A 4AM7A 4CHNA 2GW8A 3ENBA 4FWSA 2OSRA 3CB4A 2CQ3A 1QJHA 2VG5B 3CCJN 3MUVP 3BO2A 4OMFG 2MQ8A 2AYMA 2BJ1A 1XIQA 4F50A 4NLQA 1UVMA 4JI5K 4B3SJ 3CJSA 4V19J 3FQKA 2VGMA 2V2QA 1CS4A 2EK6A 3R7SB 1S1UB 3PEJA 5D4LA 2OAUA 1EIYB 4FM2A 4J91A 1BQNB 1KOOA 4OKKA 4CYUB 1S4FA 1SH0A 3EYZA 1DZ5A 4HYKA 2RQCA 1EQMA 5BN9A 2FPHX 1P8GA 3T69A 5HANA 3C7NB 3BB5A 1YZ6A 3DRYA 3OYNA 2VU5A 2QO3A 2VDIA 3MOZA 2UU9K 3PYEA 2F96A 4KHWA 4ZHRB 2RDIA 3LDPA 4Y28C 5T14A 1WD6A 5JICA 4G9ZA 1JLAA 4DL3A 3DLEB 1UW9A 3EX7B 5GAHP 3VV2B 2QKBA 4N76A 3D2WA 1N6QB 2ABYA 1NHKL 3FRZA 5A2QU 1KCFA 1AXQA 2ZD1A 2YNIB 2V50A 2BVZA 2H65B 3G71N 5FRMA 1WACA 4ZVEA 3ONQA 2O3DA 5KTQA 1JKHB 4ECZA 4ED7A 2C3OA 1IBMF 4NLCA 4CW7B 3BBFA 4CLYA 3J81U 2A41A 2YKQA 3A8KA 4BQLA 3H90A 1TL3B 1U2VB 4JV5F 5KFZA 4IUFA 4TVAB 1HR0J 1RA7A 3IGNA 4ECXA 3IS9A 5T7LA 1Q82O 3QO9A 2HW3A 1WNEA 1V3SA 3M8RA 1N48A 4HKQA 3KMSA 4J9RA 4DV1J 1C2PA 1YAGA 2VBXA 5ETQA 5F0WA 3LAKA 2IDOA 1QDUB 4I6WA 1YRUA 1VRTA 3ZZOA 3JQMA 1RTIA 3UN2A 1B70B 1X1PA 3PLAA 4ES1A 2HQ3A 4OYAA 1FRJA 2LA6A 1JL1A 2FY1A 5KQ8A 3WNFA 4DSJA 3P1GA 1QZ5A 1H3DA 4KPYA 2B6AB 1T03A 4A46A 2IOCA 1VBYA 2N4DA 2FBVA 4RBUA 2ZDOA 4HI1A 4P72A 2CQIA 1GX5A 3MCOA 3Q2TC 4F04B 1XMQK 5IV4A 2N3OA 1G7CB 2FJBB 3SCXA 3F0NA 3HI0A 2QL7B 1RNHA 3MN9A 2BOPA 1IM6A 2IVMA 3OBIA 2NXEA 4DR2K 2W2MP 1QUVA 2UXBF 3OYMA 1XMOF 2GA7A 1N0UA 3DMJB 4CQ1A 1X9SA 4UUXA 3JB9k 4XPEA 1IJEB 3BM7A 3HPGA 5EOYA 4E1MA 2LLZA 4L6V3 1RLCL 3NS6A 3P5TL 2D5RA 2BJ7A 4B9SA 1T9YA 1NLVA 5J1EA 1FD2A 5GAHU 4NEZA 2J9DE 1EWQA 5IOLA 2V67A 1N0VC 3BSAA 4NXNK 1HJRA 2EKNA 1ICEB 1N34J 2UVRA 2UXBK 5IWAK 3PKYA 1YVNA 2KJWA 2YHYA 2IVNA 5E3QA 5H9EK 1J27A 3VQ6A 3GZ7A 1T6DA 1TV6B 4CH7A 3W5XA 2I7NA 3ZFVA 3BV8A 3MUTP 2QWLA 5KFYA 1NKEA 3CCUS 1WC4A 2DT9A 5C25A 4ECUA 4KHUA 2ZZNA 4WFBL 3E8OA 3QESA 1Q9YA 3K5OA 3CMAS 3T6BA 4M42A 2XLKA 2R7TA 4NLXA 2BR0A 2G1HA 5CYMB 2LU1A 2Y1JA 4ZVQB 2DXEA 4WZQA 3AB2B 2LXIA 3R5GA 4FJKA 1DY3A 2HZVA 3NOCA 2YTCA 1CZAN 2HHUA 2XY5A 2ZVIA 1RYRA 1XTZA 4IO9L 2OD4A 1N6QA 1U47A 5BPLA 5KFEA 5JVHQ 4KV8A 3CFRA 3IAM9 5CE3A 2DNMA 1WHVA 4F4AA 3KWMA 3OL9A 1S1VA 2PYLA 1WSVA 4M3TA 4OZ5A 2UYTA 4OYBA 3IN5A 2RS2A 3WC0A 1VRUB 5ETOA 2GWJA 2UU9F 2JC0A 2R7SA 2C2DA 4LIWA 1RXOB 4RNOA 4CT8A 4H4KA 4KSEB 4LRAA 4GKKK 1HNXJ 2CQ1A 4Y1DA 1NCLA 2VWBA 3EKSA 5ADXA 2F4VF 2GQCA 2RHSB 2DNRA 3KG0A 3NVKA 1GNKA 5F8NA 3VEXA 2J0QD 3IFEA 4RW8B 1XNQJ 3BJYA 2ATCB 4U7BA 3SAFA 1NSQA 3ZEUA 3M2UA 3P8BB 3P96A 4TY9A 5FLXY 3NEKA 3N9UC 4ISGA 4RO0A 2B3TB 4LD0A 5JVGL 3LGMA 1HQ2A 3KWIA 3NGSA 1N36J 2W9CB 3NNAA 5LY3A 2D0OA 4MKBA 2JGUA 2CQ0A 4DUZF 2XS5A 1YKWA 4B1VA 4EUVA 1VMBA 2O8DA 4CERA 2ZC4A 2KVIA 4LH5A 4JI7J 1OY9A 1FDDA 1GX6A 5C2GA 1N5YB 5J2PB 3BN4A 1GT8A 4C3MA 4CF9A 2JVOA 3DLBA 2QGFB 1IBMK 1VRTB 3P49B 3OHRA 2BM1A 4HTLA 3M2UB 1CC8A 5GADP 3KOAA 4EO6A 1GTEA 3CC2S 3AA4A 4Q45A 3NF9A 1X4AA 4MO5A 5HJYA 2LXFA 3CCES 3OYLA 3GE9A 4CJVA 3QINA 4X66J 1G99A 1WEZA 2FC8A 2DPNA 1MMNA 3TZXA 4CO1A 1JIHA 3UKUB 1YIJN 4KHPJ 4NCBA 1WF1A 3GR0A 2CVEA 3CQYA 3EDQB 1FKOA 2GNKA 2RKIB 3RRGA 1SQKA 4CJPA 3RB4A 2XYGB 1LCUA 2YV0X 1R6VA 3FCWA 4ZJQA 3K59A 3WT0A 5LMNJ 1TFWA 4A8QA 1WELA 3W62A 1MU2A 3KUEA 4C6AA 3T7ZA 3AOBA 2Q0RA 4DHYA 3OSPA 4NLWA 4LF5J 1C1CB 4MYUA 2XY6A 3OT9A 2L9NA 3PFEA 3HJFA 2UXCF 1L3TA 2ZFHA 3MPYA 3QGIA 2ASOA 4DR3F 5CXTA 1N33J 2DHGA 1KLMB 3LP1B 2W40A 3HM9A 3HSDA 1AW0A 3TUIC 2H3GX 2Z8QA 3NGYA 1WBDA 3MPWA 3ZYYX 1WWHA 3AODA 3Q8YA 2WFBA 4FN5A 1L3VA 1FKPB 4MYTA 4YORA 4TKTA 2QMWA 3AVIA 3CTRA 1MN9A 2C2NA 4F02A 5J2MB 3QFHA 1QAYA 5CD4A 1S5ZA 1SJ1A 3IFRA 4URGA 4Q5VA 2R7XA 2IM1A 2YKOA 2JWKA 3GP9A 2A18A 1BC6A 4GVBB 2KH9A 1YLXA 3RSEB 3QB0A 2QLBB 5HI7A 1RBAA 4DN0A 2KG1A 1X3NA 1Q0NA 4P73A 3U9ZA 5J2QB 5KG1A 4FNIA 2IRXA 2Y3YA 2A3JA 4HVJA 5GMKa 2RQMA 4D3GA 2BA9A 1CQMA 4G1QB 1RWXB 4UOFA 3SMSA 3N5FA 5F0XA 4FP9A 5KFTA 3HD2A 2IA0A 1XR6A 5L46A 3O5TB 2PMHA 3MCAB 4ANCA 2OPPA 2DJWA 2IGIA 4L3KA 1NHVA 4CIEA 3UCUP 4LF5K 3A3NB 4DR2F 3MEDA 2J0SD 4DQPA 3VERA 1D3WA 2IYIA 4P71A 4CGIA 3ZNJ1 1K47A 4WQ4A 2I6WA 4FJ9A 1YJ9S 1FRHA 3AVMA 3EMTA 3C6UB 3HD1A 4MFBB 1RISA 1PAUB 2DNQA 4TYBA 4JI5F 4CJLA 4W92B 5C42B 2IHR1 3W2VB 2F65A 2OGUA 1PC5A 1Z26A 3L2WA 3IR5B 2W7OA 4C3KA 3U1NA 2PO4A 4DR1J 1VQ7N 4DF8A 4B9VA 5H1SQ 1B99A 4ZPDA 1PGZA 2N3LA 2IJRA 5G4DA 2QC3A 3EO3A 2L3MA 1HWUA 1HJOA 2MKJA 1K9MT 1S6PB 3OTBA 4CLPA 1ZC6A 2WUSA 2JLEA 5AQXA 5H1SV 2P51A 1LFPA 3NWGA 4RPFA 3D2FA 2M7SA 3SK3A 4FXVA 3Q83A 4Q8FA 4NL5A 1U2RA 5I3UA 4DR2J 3AVBA 1IQTA 2MZSA 2F9DA 1HNZF 3G9CA 4YHHK 1RT6A 3RWUA 4CLUA 3LDLA 3LWLA 1J53A 3QBWA 1NKCA 3M32A 1HNIB 3QRPA 5AQRA 2ZQBA 2ZH6A 1T9WA 1BISA 3IRWP 4OHZA 4MJKA 1NNDA 2G4BA 2CJYB 2LKZA 3ZX3A 1SJRA 3SUPA 1R8HA 1WSEA 5KPZA 4I6YA 4DPTA 4E7KA 3QAUA 2XSJB 5F41A 4B3RF 1YRXA 2P9LA 4B3RJ 3R6LB 3OL6A 5F0UA 1U1LA 4KIAA 2F7TA 3U02A 3NDKA 3MMBA 1MNEA 1JJ2M 4MIAA 4ZVPB 1N5VA 1P1TA 2OYQA 1QQMA 4PRFA 3F5TA 1XNRJ 2R7RA 2JJ4D 4USTA 2P9IB 4K59A 5A8WA 1RBLA 3I0SB 3CIMA 1IKYA 1PILA 3PW2A 1S1VB 4F4KA 2D69A 3CF5L 3KJNB 2IMOA 1W9HA 8AT1B 3LGNA 2NZTA 5CZ2A 1HHTP 3D6TB 4FOEA 1NMDA 2WC9A 3DU5A 1KBRA 4EYIB 2B0GA 3H6EA 3MMBB 4NLDA 4YHHF 1RABB 3HFKA 1NJWA 1S97A 3M8WA 5IT9U 4E7LA 1HMVB 3EZWA 3MFIA 1IKXB 3SV3A 3D0HE 3I55N 4LF8F 1IBLK 2QV6A 3WQPA 1RT3B 1Y5NB 1WEXA 2CJ9A 5AZJB 3OYDA 3NG8A 4PXDA 3ZZ0A 3BQ2A 1TFYA 3VAKA 2YKAA 3HVWA 3CCVS 5LSOA 2MHEA 3W66A 4JI4J 3C14A 3NWRA 1EO1A 1BE4A 3JAMU 1S77D 4DV6K 2AYEA 2IBKA 2BZ2A 4LT6A 4FJXA 4CBXA 4NYZA 4EFAC 3CQXA 3DLLL 3AO4A 2K3IA 2Y8YA 3IAS9 1UPPA 4XPCA 3G10A 2C1EB 4IOAL 4OI6A 4OJ1A 1XERA 4HHUA 3TX0A 5DGBA 3AGRA 3M4XA 1RDDA 3AHPA 2B4PA 4ECYA 2IJFA 4WTYA 2PC6A 2VGNA 3CXCM 2DVIA 3N4QA 3T3FA 1KVAA 4XO0A 2KJVA 3S01A 3B4MA 1H1VA 1R0AA 3UIQA 4DTRA 2ZITA 2ASLA 1JNZB 3J7YP 5KG3A 3RBEA 2QL5B 5BPMA 2FSNA 3IM9A 2UUCJ 3NS5A 2HHHF 2YNGA 1W26A 5HBMA 1X4CA 3EGZA 4CHQA 1I1GA 4DG1A 1GLCG 1FDBA 2A1SA 3P31A 3SMPA 4K4YA 2QXLA 2ZHBA 2AJ0A 1VIXA 2F40A 3G8TA 4OFZA 1UJ4A 2O01C 3R9PA 3ZT3A 3RBXA 3W61A 5AZIB 3QEWA 1CC7A 1HBOB 3HK2A 2LQ8A 1ZTWA 1S72S 1RCXB 2AD9A 3O9UA 1A0OB 3IWXA 1X31C 1FXRA 3A13A 2M52A 1R0CB 1HA1A 1AT1B 3MR6A 4EGLA 3A8JA 3PYFA 3US5A 1U6ZA 1JNRB 4ZA1A 1FJGJ 4WF9L 4DOZA 2E5LJ 1SJFA 1RTJB 3M5RA 4X4SA 2V9KA 3MCPA 4X4NA 3A4TA 3LALA 1JXVA 1H2VZ 4O3NA 2WB1D 5HOOA 1R27B 2MQQA 2D3UA 4WYBA 2VV5A 1NU4A 2HRUA 4CDIA 3OSNA 1S1XB 4LQ3A 2W2OP 4YDDB 1ZXOA 4NO7A 1M1GA 3BKTA 1M5OC 1YITS 4H0YB 3IBWA 4RKUC 4CTAB 3QNNA 4DPWA 4XTTA 1GQEA 4PG4A 2RSQA 3NBPB 3GJTB 2DY4A 4DCPB 3VQSA 1KTVA 4RW4B 3CCTA 2OPPB 3FFIB 3MGJA 2KKHA 3CNQP 4FLUA 2FHMA 3C14B 4KPCA 4ECVA 1S7IA 5E3AA 2G8IA 2M8DB 1UAWA 3CCLN 3DXKA 4EP5A 3G8SA 3E51A 3OL7A 4M63A 2BEFA 4CNYA 4CZKA 1S57A 1VQ5S 4Y1CA 5AQFA 3THYA 4JI7F 1K1SA 3KVGA 2YWGA 2CWXA 2RIJA 2MZTA 5HP1A 1U2CA 2WCXA 1L3UA 2BDPA 1JJHA 2K7KA 4KB7A 1ZH5A 1S7HA 2NRTA 4FJHA 3PNIA 4MK7A 2X51A 2I7PA 1FT8A 4FF2A 2C2MB 3AVLA 2QMUB 4C23A 4Y0FA 2AA4A 4QWCA 1WHWA 1HUXA 4GKKF 4NWBA 4TU9A 9RUBA 4DV3J 4LRCA 2KFNA 1NJIO 1VGYA 3VQPA 3A5NC 1OJ4A 5HMXA 1UWBB 2P8IA 4IH6A 1KQGB 4WQ5A 3CEDA 3O9TA 2O8BB 4H0XB 2DY1A 1KAZA 4WE1A 1UVLA 1LK5A 3PRDA 3KHLA 2PI4A 4L74A 1VHXA 3LO3A 1X9JA 3DOLA 4FZXC 1JB0C 3EPGA 4CM0A 3P39A 1NGHA 2XI2A 1W7AA 2GIRA 3E9OA 2HQDA 2R4FA 1QHTA 2O8CA 1AA1B 4M5IA 1X9MA 3AD9C 1HLUA 1NGIA 1TL1B 2KT2A 5B0FA 3MM8B 1D9FA 2J6SA 4IG0B 2ZNZA 2YHBA 4GNIA 4TY8A 2D9PA 3J7AN 1ZTTA 2XRIA 2AX1A 4GKKJ 4YR2A 2ZGYA 2V4JB 4UTGA 5CH7B 4KC5A 1LWFB 2RQKA 2F5GA 4I64A 3QT5A 5F8IA 3KHRA 3NOGA 1RACB 4HWIA 4BRNA 1TYQA 4DB3A 1JX4A 2P9UB 3GILA 3WIVA 3J7ZO 2G8KA 3V6DA 3PM9A 4OZ0A 3DM2B 3AO3A 4Q0BB 5DG9A 3R1HA 1UKUA 3EE8A 5M1FA 3HLUA 5DRKA 2QTDA 2VOOA 3HHLC 1EP4B 4K4SA 4YY3J 3SBGA 2P9IA 1KVCA 2XS7A 5T7BA 3R9LA 3R7NB 1I3AA 4EFHA 2WVDA 4FL9A 1KQSR 4N41A 3ZO7A 1F3VA 5D6GA 1TL5A 3S41A 1OMSA 5KFUA 5AQUA 3VGUA 4ZP7A 1KQFB 3NCIA 3JAMO 1WOPA 2P9UA 4E1NA 4AM6A 3NAEA 4PXCA 1D9DA 3PFOA 3TWHA 2HS3A 2CPHA 4UUWA 3W2WA 1BG3A 3BKFA 4BBYA 3BGRB 4LBPA 2JSXA 2RKIA 2E29A 1U0HA 1HIYA 2MZ1A 4USKA 4U6PA 5KFWA 3EGNA 3GJRB 3CCQN 5TKYA 1ZM3A 2ZE2A 3HTVA 1S22A 4DR7K 3MD1A 1JLFB 1W7WA 1QSSA 2CZ9A 3ZETA 2A1RA 1SC3B 4B02A 2GAGC 4DMZA 5DQIA 3LA0A 1HKCA 4KGVB 4KHNA 2WOMA 1TKZB 1PAEX 3TTFA 3E1YA 4F3TA 4W5NA 3ZNUA 2UXDJ 1NSPA 3P38A 2YHAA 1VQKN 1NHUA 2QFJA 1T95A 2BJ8A 1AUSL 5BYQA 4A8XA 4PCQA 3KDNA 3JQJA 4PKDB 2D0BA 2F8SA 1V6HA 3T1HK 3JSMA 3I6PA 4FS2A 2Z2YB 4GO7X 1HBNB 3NE6A 1RUSA 1D5AA 2BUPA 1W0HA 5AFUH 3R97A 5LJ3Y 5JMVA 2EFPA 3RUBL 3DXMA 3E3XA 5I42A 1C0TA 2QWNA 3EPIA 3J80U 3C65A 2XLJA 4FJLA 2UUAF 4PA1A 2DEIA 3N6LA 1SJ4P 2AMCB 2E20A 3V1QA 2ZKUA 1HNXK 5KT7A 1LOUA 2O67A 2FBXA 2MMYA 3AXMA 4OHWA 1HWJA 2VQFF 3K5NA 5C12A 1VQ6N 2DNLA 1YVUA 1DQ8A 1LWEB 3ZT1A 2ILYA 3HFZB 4LR9A 1S49A 4C8ZA 4B3OA 1FTCA 2O8FB 4Y34A 4ANEA 3O4WA 5FLXU 3VQEA 3L8BA 2GMJA 4KKOA 3B54A 1EB0A 1UETA 2B7BB 5F8GA 4DV7F 1N54B 4FYXB 4XH1A 2VL1A 4JI1F 4C8YA 1S9EA 1HKBA 3FMWA 2AEFA 3FRYA 1RFQA 3ID6A 2Q3SA 5T7LB 3VAMA 4MT1A 3MN6A 1GMVA 1YHQS 4RUAA 5B0BA 5GMDA 3D2FB 1EWRA 3RU0A 3J80O 1RBVA 1TVRA 2YQ1A 2CIMA 3O3LA 1KVKA 5E41A 1WHXA 1S48A 1IKWB 2HHPA 5JVHL 2L41A 5D77A 4WFAQ 1B3TA 1M0SA 1X8DA 3MD3A 3V1RA 4K4TA 5KQDA 2DNPA 1YWXA 4JI0F 4X66F 1REGX 4DF4A 3G71S 3GBTA 3RBZA 2XEXA 2E2OA 1U04A 1YBUA 1N36F 3U1MA 2E5LF 4FJIA 1HYSB 2DXDA 2NYHA 4DL7A 3QICA 7FD1A 3PRVA 5FJ4A 3IKMA 5LL6Z 4ZVOB 3C7NA 2MLXA 1RZMA 3KJVB 4HTJA 2E2QA 4ILJA 3AJ2A 2KTQA 4PUOB 3N4PA 1CXQA 2E1MC 1R0AB 2YX7A 3MM9A 1NJYA 5DZ7A 4X64J 3CM5A 3ZZPA 4O4GA 3GB0A 3S3MA 4DEZA 1URRA 4E89A 3HVRA 3NCPA 5A8KA 5HBMB 1VSEA 3H3OB 1NJIT 4WIQA 2V2ZA 4A61A 5K20B 4M95A 4IYQA 2HHVA 1BUPA 4BREA 3O3FA 4CEAA 2FZGB 2IVOA 2HGNA 1HWIA 3QMLA 2GWKA 1EXQA 2CJBA 4ZPWR 4M5GA 3MM5A 3CMES 4WP3A 3L4IA 3HSZA 1OKJA 1KTQA 4C0OC 4B1UB 3MXIA 1WTBA 1NPPA 5KFKA 3T1YF 2QM1A 3M8ZA 2UUCF 1KEKA 1RAHB 4WP9A 5IS2A 2HSEB 4KGKA 4H5TA 4QWAA 2UXDK 5J2NB 2ZH3A 3G0ZA 2UV8G 5C15A 3GE1A 2MSSA 4OZJA 1N88A 2IJNA 3UI3A 2HVIA 1QLNA 2GVZB 4Y2IA 1ZAVA 2Y1RI 3JS9A 1FEHA 3AFGA 4DLEA 3VESA 3VGKA 4P74A 2ATLA 4OLOA 3MTJA 2CUYA 2VA3A 2FVRA 2EFVA 4AYBD 1EARA 3ZSVA 3L4QA 4DSIA 2VPZB 3IR6B 3KLEB 2AJ1A 1YGYA 4DR5J 2NREA 4JKEA 2YNIA 3HVTB 3RMDA 1WLJA 2VQEF 4DX5A 1G4CA 3W7BA 2CZ4A 3TI0A 2PGCA 3H5UA 5KFLA 2DPJA 2FJAB 2B4UA 3IGVA 3M8YA 2G0CA 3TA1A 4P7VA 2V4RA 3OFHA 3M2RB 3QGGA 2MLZA 2Q2RA 4J9VA 1I94F 3B6OA 5KFJA 4EBEA 3FK4A 3M6VA 3VVTA 4KBIA 3AA9A 2OP5A 4IFYB 4WU2A 4MIWA 3QMQA 3BGRA 3TAFA 2VWJA 2FLLA 4DQIA 3QERA 4KV8B 4ZTFA 3DGPB 3KYLA 4GVEA 3CSKA 2XO6A 3OW2M 3M1VB 4J9MA 3WBZA 3NF8A 1T3OA 5K14B 2Q66A 4FS1A 2RF2A 2CADA 5HRRA 3CJ1A 4JKAA 2KDOA 3Q89A 3QFWA 2ZJRL 1WAFA 4CVNE 1C6VA 3DRSA 4FVCA 1M90T 4OL8A 4RU9A 4HCBA 1Q5VA 3QRRA 4NYOA 3I82A 3OYGA 1PIEA 2DHAA 2ZHOA 1WI8A 2AZ1A 1WC3A 4TLRA 4ZCLA 5E5NA 2OPRA 2W2PP 4LFBK 3OVSA 4DR1F 2X1GA 3K5MA 2ASPA 3Q7BA 1GK8A 2VQEK 3JTOA 2FVSA 1RKIA 4CF0A 4M45A 4QIEA 1JL2A 3CCZA 4CO3A 3KLHB 4USWA 4I2QB 3NGZA 1SS6A 2VPXB 4DTOA 3Q0AA 3D7SB 3UR3C 1FJGK 1QQOA 4W5OA 2G8FA 4OX9J 3KKRA 2OMLA 4Y2CA 1RCOB 4J9NA 2FB0A 1EX4A 5EWGA 4I1TA 5IC4B 3G2XA 3TA0A 3OYBA 3SQ4A 1RSCA 3T1AA 5HROB 3ZX2A 3N4WA 5DK5A 1S1WB 2KXFA 4OZ2A 5LJWA 2F8EX 2HHQA 1YJWN 4F2RA 4I2QA 3MM7A 4I9LA 1IQZA 1AB8A 2ZH5A 2CQHA 2PA3A 2HVEA 2WB4A 3MMAA 2LP4A 3G82B 5I4MA 4KAIA 2W2NP 4BCAA 4XAKA 5CZVA 1RT2B 3UD3P 1TGOA 3BR8A 4GV6A 4ZVHA 2GHVC 4WPAA 1Q7YT 2LA4A 4O8UA 2OLWA 2B9YA 3DLJA 3BGUA 4ZCKA 3THPA 2ASYA 1KHVA 1KD1O 4CZGA 1RTHB 5AQKA 4DN9A 3OBYA 5LMUK 2P9EA 4ZN1A 3FE1A 4USVA 4M5NA 3D0PA 1EQYA 3B4DA 4OYZA 1VQNS 3VAIA 5KFFA 4BGAA 4FJNA 4NMXA 4FVUA 1VSIA 3KG4A 5ADZA 1WN7A 1UAXA 3FZLA 4BY9C 1HNVA 5J1EB 2X78A 1ASVA 5BR8F 1APSA 3PIPL 3T19A 3THVA 4N8NA 2AJ2A 2FUG9 4BRQA 3E9PA 3QIDA 2N7YA 4DL4A 3CD7A 2V69A 4JYAK 1RA6A 3U4LA 5FPEA 5KFDA 1VQNN 2IM0A 4GC7A 1TK0A 2M5YA 3DGPA 4H54A 2XGPA 3VF0B 2QLXA 4B9LA 5AFUA 1CZBA 3S6EA 4UY8O 2MEWA 2V4QA 2KW4A 3L9ZA 1PYTA 4ZS6A 1SQGA 3F44A 2LQ5A 4HTUA 3OUYB 3AOCA 3NL0A 3SPZA 2RVJA 3EJMA 4KHRA 3AVJA 1IKWA 5DLFA 4FYDA 4JP8A 4BRIA 2ZBPA 4B9QA 4CF8A 3W0LA 2PE8A 1EKEA 1S6QB 2DHHA 1YRTA 3PVXA 4MKYA 4RNHA 1G2EA 3VALA 1HR0F 5B0AA 1TKTA 5A8RA 2Q3PA 1KNZA 1RT3A 4J9UE 2ZJQL 2XWYA 2R8KA 1GH8A 4B3TJ 1T05A 1NGAA 4IBNA 3ENVA 4YOWA 3H59A 4F67A 1O13A 3V81B 5M1PA 2EHGA 2AT1B 4I69A 2FLOA 2VCPA 4F2SA 1UFKA 1AROP 5KT2A 4OHYA 4FF3A 1Y10A 2HQCA 1HBNA 4CO0A 2GVDB 3JSMB 2U2FA 3NGKA 1EQ0A 3LF0A 1UZHA 1GMWA 4KHPK 2V8GA 4BWJA 2XY8A 3SQ2A 3UKUA 3HFVA 4A8WA 2G9OA 3TOQA 2E66A 3B6PA 2BRKA 3PW5A 3ET6B 5H9FK 1VK3A 3JAMY 1TK8A 1M90O 3VHQA 2HS0A 3ELHA 1Q5YA 2O66A 4NXNJ 4JI1J 3W65A 1T02A 1RBTA 2JWNA 3LPEA 3MPDA 4MTPA 3DOKB 3SXLA 1YZ7A 1EX8A 2HIYA 3OLAA 2VZ9A 3ZX0A 3BBBA 4Z0UA 4FYWB 2VFTA 2PYJA 2VBYA 3FEYB 5D0RA 5LOQA 1BCOA 2D0CA 2XYHB 1S6OA 2UUAJ 4I67A 3D6RA 4UQTA 3J7YU 3VGTA 3THWA 5D4NA 1OYEA 4LSNB 2H48B 4DBQA 3QLHA 2BABA 3EEQA 2W41A 3R5BA 3PXGa 3F41A 2EFGA 1RAFB 3HP6A 1MSWD 2HG4A 4ECRA 3CJBA 4O5FA 2YX1A 3UDEA 4B8AB 3T9NA 3A3PB 4IFYA 5BR9A 4JI2J 5CY4A 5F9NA 4M5LA 2GGPA 1FWPA 4DSKA 4OV1A 4NCGB 2W25A 4KFBA 2Z1HA 1Q8KA 4CJ4A 3RRHA 4GKJJ 4FOIA 3D2EA 3DYAA 2APOA 3POTA 3EZ5A 1RHRB 4RL1A 4L3NA 3KDOA 3GV7B 5A6PA 1X9WA 1REVA 3NGUA 3ULDA 4JOUA 1RAAB 4LF9F 4N8OA 4IFEA 3BGFA 4OYXA 3MHYA 3MF5A 3DLKA 3NH2A 5MAOA 4NA1A 4EO8A 3PYGA 4TYAA 4F0HA 5KG6A 2ATQA 1VJWA 2C2KB 4PAAA 3GOIA 1O0PA 1RE1B 2JVRA 4NX9A 4AHUA 1NMEB 3G87A 4FF4A 4ILRA 3CIPA 1TKXB 4OQJA 4XDDA 3SJJA 3CCWA 1LKZA 4QR0A 3MR3A 3L7OA 3VVUA 2KZZA 4HDHA 4P2FA 1BA0A 2O1PA 4NYNA 1V9OA 5DQHA 3NH0A 4ES2A 2BE2A 1Q8LA 3CJ9A 3I8BA 1IKXA 1WC1A 2QG9B 1FVQA 2YY3A 4RBVA 5AQPA 5DG7A 4DL2A 4KY3A 4JNEA 4L73A 1T0TV 1AYEA 1B0VA 1RWNB 3KLGB 2H54B 1JLGB 3LDQA 1K44A 3MPUB 3Q8RB 3TZWA 1S6UA 2F9WA 1YIJS 1RAOA 3GWCA 4IEIA 5EGYA 4ENOA 1SCJB 4N47A 1WKJA 2Z4PA 4OHVA 3H40A 5CHIA 2XLIA 1CSJA 1KONA 3PHEA 1RHJB 3CMEN 3CI5A 3ENWA 3KLIB 4JI8K 2O8CB 3MM9B 2OFHX 3O9QA 3H5XA 4CIFA 1LWCB 1HYVA 4DV7J 3FMBA 1Q1KA 1BL3A 1VBXA 4PKIA 4IRCA 3W9HA 2HMPA 3HHLD 2DNHA 2H9ZA 2HWTA 4BDZA 3VQBA 1O5JA 4MK8A 3DOKA 2R7YA 2RPIA 5GAHI 1PSDA 1RTZA 4CLWA 4H0OA 1VQYA 1KVIA 1VQ8S 5HSPA 2HK2A 4IOXA 4RR5A 4DQ8A 4UOHA 1KC8T 2FGCA 1FRMA 4B3OB 3QGPA 3RYLA 1OH6A 4MDBA 4DX8H 3A8IA 4IO9Q 4K50A 2KVQE 4QU6A 4AQYF 2A6MA 4QR1A 1ASUA 3O3GA 3LP0B 4RW6B 2DH9A 1UEUA 2FHOB 1VBZA 2FHJA 3X3UA 4TN2A 2KYXA 1Q86O 3EZOA 5B08A 4PZVA 4JV2A 4YEAA 2YVSA 1P9YA 3BQ0A 1U1RA 4CFDA 3V81A 1XI1A 2XCAA 2DNGA 1OQ3A 1TKTB 3K89A 4YDXA 3CCMN 1FNOA 4CJQA 3GONA 3RW6A 3G96A 4DMNA 2WK4A 2P5OA 4BRFA 3KK1B 1YSJA 3C6TA 3GG1A 1HPZB 4C8OA 2DH7A 2ZNYA 2HIQA 4LFCJ 1X5OA 4WKRA 3J80Y 3MX2A 1SI9A 4OX8A 2PEHA 4G65A 2P9PB 4HDGA 2VHGA 1PYOB 2CZVC 4ZVGA 3ZSOA 3EXCX 3UWTA 4DV4J 2HAFA 2MY7A 1Q53A 5K14A 1CBKA 2YHXA 1WG1A 2OTLN 1KAXA 3L7PA 1ZM9A 3W2WB 3BQ1A 1CJKB 3UVJA 1N56A 1VS3A 3A12A 3U9DA 3LP2A 4ZLLA 4EZ6A 3WXKA 4OJRA 4LUBA 4K42A 3ADAC 1A9NB 3TEGA 4U95A 2XSFA 3G8QA 1SQEA 1N5TA 2Z58B 4DR4F 4EU0A 1GOAA 1KKHA 3BY5A 3DRPB 2ITMA 2QMXA 3OJSA 2F9JA 3W2VA 2Q36A 2K2PA 5E3CA 3CDAA 3P6YC 1WBBA 5CA5A 1CJTB 4JV0A 4RBTA 3B8AX 1BY9A 2DNKA 1F2GA 1SL2A 5BRDA 4ZTJA 4WE1B 1S10A 3AY9A 2VH7A 2IIRA 2XB2D 4QIWD 1F60B 2XULA 5THWA 2AYGA 1VFJA 1NDLA 4BWMA 3BF3A 2BM0A 1I3OB 4DV3K 2WSEC 7AT1B 5HO4A 5LMNF 2DGWA 3H2UB 3OXGA 5HRNA 4FLVA 4F3OA 3CG7A 3D5MA 4USMA 3S1TA 4QAGA 2OA8A 4A8FA 5KFOA 5EDWA 3MDQA 3R6GB 5GAGI 5C5JA 4UY8T 1QSLA 2OEMA 3MCMA 2YNFA 3D45A 3OPKA 1KFDA 4ELTA 3SSRA 3ZZUA 3O8WA 4NLYA 4O5BA 5G0RB 4RW6A 2JZ5A 1FCAA 3KD5E 4LFAF 1PBAA 2QJ3A 4M1KA 1LW2B 2YX4A 3C94A 1Q82T 3OTDA 3PSIA 3DLKB 1QUPA 3ULEB 5LXYA 2J8SA 5DGAA 5KPTA 4IZ9A 4L8RB 1VQ6S 3R1LA 5KFHA 4A8MP 3FFIA 3D54A 4P52A 1LWEA 2X1AA 3WXLA 2J7UA 3M6WA 2BW2A 4HHHA 2BANA 1JCEA 2V2VA 1E4GT 3M8PA 3F56A 3CVKA 3CD6S 4K5SA 5DZ6A 3PX4A 3HSGA 4JYAJ 3NGRA 4ILMA 1D4XA 3ZEUB 4AUKA 4KH0B 2GX8A 1SKWA 2A2DA 3AVHA 2VG7B 4LF6K 3GG0A 2NRHA 3VQAA 4WCEQ 4AL5A 1HNZK 3R5JB 3VGSA 2R7OA 2AF6A 3CC7S 4P75A 1FF2A 2BACA 1HNZJ 4JI2F 4EBCA 1Y97A 3HZ6A 1QTMA 4LFBF 2QEXN 4AHTA 5B7WA 4FPRA 3M30B 3M8PB 1X60A 4OV6A 4LREA 3N0VA 4Z4GA 3L2VA 2RHKA 1IUJA 3CUNA 1U8WA 5AXKA 4LVOP 1N32J 3UB5A 1QVGM 2HNZB 4IOCQ 4JHDA 4KB0A 3KLVA 3AAPA 1DHMA 5KFAA 3ISZA 3CETA 4E2FB 3KK1A 5L9NA 1CULB 3LANA 4CJKA 5E84A 1TUUA 1HKAA 4O44B 1MMLA 4JN4A 5A8WB 4IOBA 2UVVA 4YNQA 3I5AA 4IKFA 1IO2A 3O9SA 4KI6A 2Z57B 1NM2A 5K8MA 4YMEA 3KNAA 5GIPA 4OLAA 8RUCA 1LK7A 4KH6A 1R3NA 1CQNA 3CMAN 3AD8C 3MXJA 5DDOC 3PUFA 2BKOA 1GXTA 5C25B 3M8QA 1SL1A 3WUHA 3ILJA 2GIFA 1XNQK 4KTWA 2YKNA 3G86A 2HYIB 1U09A 1S79A 2VQFK 3CW2C 3NF7A 4KHPF 3KHGA 3QDKA 3TA2A 5T41A 4DV0J 2DFFA 1IN0A 1S9FA 3TUZC 3KIOA 1KHWA 4LF8K 3CJ2A 4J9PA 4KT0C 2KL8A 3CDUA 4BRCA 1S0OA 4FZYA 4FPAA 2E5HA 1NDKA 4J2BA 3IRXB 2DHSA 3DAWA 4AT1B 3IMXA 2O4IA 3TPQA 5IT9Y 3MMVA 5A76A 2K06A 4PQUB 3VR1A 1FI4A 2V9WA 3H5YA 1WOSA 4FK0A 2FC9A 1RHMB 4X84A 3RMAA 3B82A 1T9XA 2I8EA 3RW7A 5G0RA 1U48A 1OPZA 1VAZA 3C95A 4JV5J 3JYTA 2R2UA 5E0OA 1Y0HA 4RTFD 2R8JA 3O44A 3SQ1A 1TKXA 4YB7A 2LEPA 3RRKA 3ZSZA 4EK2A 4ISFA 2DFHA 3MFHA 4NPOA 2NYIA 2PY5A 1ZM2A 5A2QY 5KG0A 4RJVA 2PN6A 4IDKB 1OPIA 4C4WA 2HSTA 2BYCA 4DI6A 4X2BA 4QS8A 3OUYA 2RRNA 5KGWA 1TKDA 2QA2A 4OLBA 2R2SA 4YOUA 1B0PA 3R5CA 3MURP 1O1WA 3NHGA 4ED4A 4F3MA 5C24B 4FXWA 3GFZA 5GAEP 4IFVA 4HR2A 1ZA1B 2BKNA 3E2EA 2MQMA 3G6XA 1Y4ZB 2FXUA 1ZM4A 5DS7A 4FJ7A 4GO5X 4M3ZA 4CHPA 4Z7YA 4CZHA 2VIHA 1J5OA 1EJ7L 3OTOJ 4ZLNA 2QWMA 2MDAA 4IOCL 2ZUGA 4ECSA 1E3MA 2H4YB 4CO2A 4CZFA 3V1OA 4H03B 3IXQA 3TTDA 1VOMA 4M5JA 1HBOA 3J81Y 2HHTA 4B3TK 4RU2A 5D4PA 3VF4A 3UCGA 4AILC 3OYHA 4MFBA 2VG7A 4DR7F 2UP1A 2W01A 4H0VB 5LXRA 4WFAL 2BX6A 2QRRA 2V8HA 1NK4A 4FJJA 4U67L 3CD6N 4AH9A 3OFEA 2P9SA 2I2YA 3D67A 4A48A 1SL0A 2OPSB 1XC9A 4L72B 1N34K 1NMNA 4O0IA 1JXBA 4JAXA 4O3PA 2H1YA 3DCAA 3LPTA 2CPEA 2XBPA 2YXLA 3D2EB 3UDLA 3BEGB 3TJAA 2G13A 2X7IA 1FJGF 5EVZA 4QU7A 3VQ4A 1ASWA 2EFNA 2UUBK 3W9JA 4LF6F 2Y8WA 4H5NA 3MN7A 4DU4A 2EKYA 2G0IA 1ZBIA 4DJBA 1I5OB 3FSIA 2KRBA 3GSDA 3W1YC 4QS7A 1QS4A 2JX2A 4IKAA 3W3SA 2E1AA 4OI2A 3K2PA 4XH5A 4LFAJ 4CZMA 1MWQA 2Q6CA 4DV1K 2FLPA 2ZOMA 3ASMA 3MCNA 4CD1A 1R7IA 3ZZTA 3CJ8A 1URNA 2IFXA 3ICLA 3MAAA 4RUCA 2MKCA 4CJ7A 4K8XA 4FJ8A 3RB3A 3VA3A 4BR4A 1RYSA 1SV5A 5KRTA 2YKMB 2CPXA 3G4SN 4Y6IA 3TSQA 1MROB 1HMVA 2QTWA 1RT4A 2VICA 5F9LA 3KJVA 2AJQA 2HK3A 5CYJA 3FBCA 1G3OA 2RT3A 1HBMA 2QLWA 5CYQA 4IO1A 2XMVA 2PD1A 3S3OA 2EWHA 3BZCA 5GIOA 3IRXA 3BYRA 3SCKE 3ATUA 4FJ5A 4JI7K 3LM2A 3GQCA 3TJ9A 5KOXA 2PFUA 4M5DB 1O8BA 3R3TA 3I0SA 1HBUA 2GHPA 1CJUB 1YJVA 3L2RA 1ZOTA 2RUSA 3HI9A 3CCEN 1F1BB 4QPTA 3HXMA 4DV6F 1XNRK 4HI2A 4F25A 4DR4J 5C0YA 2VODA 3L4BC 1U1PA 1T11A 3ZSXA 4N77A 5AQMA 4UZBA 3CJRA 2PFFB 1W2BR 1VLOA 4FJMA 4DUYF 1RDRA 3UN3A 4J7CA 5L1KA 1S0NA 1PO6A 3SFUA 4F3QA 3NBPA 2CFXA 1F5BA 3UE2A 4DS4A 4M5HA 3AVCA 3M1VA 9ATCB 1LAWA 2OI2A 4I2PA 1IJFB 4HUGA 3R1XA 1R6YA 3QGHA 1PKUA 2MQLA 1CG2A 5SUHA 5E2QA 1BD6A 5M2RA 2CQBA 1WDDA 3IA0A 5A0YB 2KM8C 5IZHA 4DU3A 2AJFE 3BPDA 5IC6B 2AV5A 1PC4A 2FJWA 1E6YB 3G6EN 1MLAA 2Y0BB 3BUZB 2VF3A 2KB2A 3TAPA 1BUXA 3OFGA 1BQNA 1FFWB 4KBOA 3IBCB 5LMNK 2GVZA 3I8DA 1DGKN 3CJQA 4YN3B 4ITSA 3D0IE 4E7IA 4CH1A 3H20A 4CJUA 4LFCF 1X4HA 5EY4A 3THWB 3E66A 3OL8A 4CLKA 4RZRA 2LECA 2XS2A 3WNEA 1V5IB 1GFWB 4X66K 4HTIA 1HBUB 1XJWB 1Z25A 1NU0A 1J54A 2J9DA 4C9DA 3FEXB 2DTUA 1JJCB 3QEPA 2R42A 2GQQA 2IS3A 1NGDA 4LBHA 3FCHA 3NY0A 3TTCA 4BR9A 4TU8A 2NRZA 4LF5F 1R8PA 3KKSA 4WCEL 4MLHA 3BF4A 1AZSB 2I1RA 2N7CA 2GIQA 3KLEA 4FWLA 1YTAA 3HBTA 3BKUA 4CI0B 4B08A 4B3MK 5E33A 4PG5A 3Q22A 3KZBA 2XMWA 2NZ4A 3HT3A 3NMRA 1T3VA 1SV5B 3AARA 3QFPA 4R5PB 1CJVA 3C16A 2IM2A 2YWFA 3PJWA 5ETKA 3GV5B 2C28A 4F8RA 4PKHA 3HT0A 3CJKA 4H4MB 2R3VA 4NLTA 4B3TF 2MZRA 1HNWF 3I5CA 4FDFA 5FPDA 3QBCA 4CK2A 3UVJB 4O3RA 1WOQA 4W5TA 4AHVA 2QWQA 3SBMA 4BRHA 4U9RA 3ID8A 4CHZA 3DLHA 3LPYA 4FO0A 2RMLA 3AVAA 2HWIA 3QT8A 4LIRA 5EWFA 4BRLA 3JYTB 4JB8B 4X64K 2B5JA 3KTQA 2GFFA 3OYAA 4P7TA 3HO1A 4Q0BA 4GW6A 3BEXA 1NM1A 2OZSA 5HL7Q 6AT1B 2IBOA 2DR9A 2XWXA 4CP5A 3O3HA 5DM6Q 1SBRA 2ZJQQ 4RUHA 1RT6B 1P90A 3OHBA 2OANA 2P9SB 3VQ9A 4K8ZA 3ILLA 2YI1A 2QA4G 5IT9O 2KO1A 3C15B 1KLMA 4EZ9A 2NLXA 2X1FA 1V3ZA 2XHCA 4JK9A 4O55A 3VQQA 4ICLA 2VBZA 3G4SS 4YR3A 2C3PA 2JFKA 1OSDA 3P3DA 2KZMA 2DYAA 3L3CA 4URQU 1KN6A 4ID5A 4A8OA 3AVFA 4ZJOA 1W97L 3J8AA 1V3RA 3PG9A 2CGJA 2G8HA 1VQ5N 3I31A 2ADCA 2GUIA 2GMHA 3CCVN 1EETB 2AEMA 1SH2A 2OPQB 1HQEA 4P9SA 4DL6A 3CJTA 3RAMA 3AA5X 2R2TA 2EPIA 3R2DJ 5GAEU 2KT3A 2GX9A 4FKXA 3H25A 3HCXA 3T1YJ 1VQOS 3H5SA 2R7QA 3NH1A 4NB4A 2XMKA 2PAVA 3A5MC 2MGZB 5AJ3K 4G1PA 1X5PA 1CPZA 3UNGC 3CC2N 3KG1A 2PMWA 1UJ6A 3MEDB 4WBFA 3UPFA 2XHWA 4LJMA 3T5HA 1H7XA 2P9CA 4CYUA 2OKQA 4QCLA 4AXJA 5EWEA 1VQ4S 5K5MA 4ETXA 5I9EB 1EETA 1NH7A 4YR0A 2A40A 1JLAB 5BR8J 1FERA 4C8NA 5DDRC 3MEGA 3OS0A 5MLCQ 2YKMA 2HFSA 1J5EF 3I0RA 4RCHA 5BYRA 3S7RA 3D68A 5L8RC 4OKJA 5HK4A 2NCKL 1ZETA 2FC0A 3OYEA 3MN5A 3NNHA 1B4SA 2M70A 1RHQB 2KLAA 4K41A 1NGCA 3DI6B 3BBCA 2C3UA 4CZEA 4LH4A 3Q8SB 4OJ3A 4P2SA 1KC8O 1FWLA 5JJBA 2LSNA 3VTIA 5KFMA 1OY8A 3RJMB 4ZPBA 5FRNA 2Q79A 4GC6A 5K9FA 1KP6A 1RHUB 2UVUA 3RVCA 3VQDA 2J76E 3HL8A 1RLDA 3X1LB 2BBEA 1S1XA 4ED0A 3CD0A 1K8AO 3W5ZA 3OR1B 4IH7A 5JS2A 1BGXT 1O51A 5BRFA 2ASMA 2HOEA 1H6KX 1RTIB 3OW2R 3LZIA 3PO4A 2FYXA 2LQ9A 5C10A 2BUNA 2O8EB 3T1YK 4EHUA 3OTOK 4XK8C 2DGOA 2ZE2B 4DR6K 3L6QA 4CBWA 1RGVA 2C2OB 4OIXA 2ROGA 2ZZTA 1Z05A 1T9VA 1NBWA 3D3CJ 3I87A 5KGXA 5AQWA 1CZ9A 2BQRA 2WOMB 3CJ3A 4KH1B 4ED5A 2RNEA 4ZVUB 2MQNA 1XNQF 3D1QA 2GJFA 3AA2A 1SJQA 2E1PA 4GVMA 1RP5A 6FD1A 1OH8A 1RDCA 3IWLA 2Q0UA 2ZOGA 2B51A 1RAIB 3HSCA 2E7VA 3SQ0A 2QA4S 4ICLB 2CG8A 4X64F 4JRPA 2ERRA 4F26A 1OS5A 2P2CB 1J5OB 4CJTA 3KK3B 1VCTA 2LQJA 2BOAA 2E5JA 4CGHA 4PYDA 2B5JB 3C66A 2Z56B 4MH8A 5CD4H 1VQ7S 2AQ4A 2YWHA 3H3NO 2CH6A 2ZWPA 1ZZNA 1ZS6A 2Y0SD 3O6WA 1XQSC 3LGHA 1Y5IB 2IC3B 2ZBIA 3PJ9A 2UXBJ 2VA2A 3DDKA 1RDUA 4CLTA 2X1BA 4JKBA 1G15A 1IR1A 4Z7CA 1X3MA 4BE2A 4Q2MA 1ESVA 1JK9B 4I6AA 1XQIA 3QFUA 1RB0A 3DLLQ 4URSA 1IG8A 1AUDA 1LEOA 1BIUA 1VQ8N 3D1OA 5CQGA 2O4GA 4I7FA 1NJXA 5AJ3F 1FFSB 4DV0K 3FKBA 4CGJA 4B3SK 3VZIA 4CZIA 1VSKA 1QM9A 4AL6A 4QOZB 4O3SA 3KWGA 1GOBA 1G1XA 5M1NA 3HHEA 3RB0A 1YJNN 1RT5B 2X3GA 3KFWX 3EE3A 4BVPA 1SVDA 2ZH4A 2KT5A 1DQAA 3IP0A 3TZZA 3HOSA 1AFJA 4IR9A 2JH3A 3F9KA 1C0FA 3FZFA 2ETJA 1TMJA 4RG8A 3MPVA 2GVDA 5AQTA 3BREA 2PDAA 2CRLA 1MG7A 2YNFB 3TVKA 3K5PA 2YH1A 1U1KA 3THXB 2ZEJA 1VYAA 2M9KA 3D6MB 3MMAB 4YB5A 1EKRA 2DBBA 3NCRA 4BHQA 2HBRB 1SH3A 4DU7A 4KREA 5CZ1A 4YB1P 2HBLA 1Q81O 3EZUA 2Q1LA 1SZ2A 2OTJN 5GADI 4LF4K 5I3PA 3V4IA 4LF7J 2F63A 1RDAA 2C2ZB 2B6AA 2CQGA 2OEKA 4BRPA 2ZWOA 3VQ7A 3MEGB 4A5BA 2MB0B 4FF1A 3DXBA 3EGWB 4CTAA 1S76D 2OCEA 4KGXB 2YJEA 4JI3K 3TP2A 3O1BA 2D7SA 3MMJA 4X65J 2WZ1A 2E2NA 3MDFA 5RUBA 3E01A 2HVDA 1Z4UA 4JI8F 4ZP6A 2CNNB 3FZKA 2V34A 4LF4F 1NDPA 4X4VA 4U7UK 3ZZYA 3QNWB 1X0PA 4X4RA 3IBFB 3LTOA 5CR4A 1LAVA 2BJ9A 5EX0A 4IRDA 1N32K 2GCFA 4Y0WA 1BIZA 2X6SA 3DN9A 5AQVA 4KTQA 3I5BA 1GMUA 2MXYA 3M3ZA 4I56A 4IRKA 1VQON 4ZITA 2V4JA 1ATRA 1HL6A 4UOCA 2DNYA 3HSTB 4J9OA 2CPJA 1GLEG 4AFFA 2UU9J 2XQCA 1JLBA 1Y7PA 4O23A 2IC3A 4JUZA 4X4QA 1JCGA 2XZDB 1FKPA 5KRSA 1PBUA 3H4DA 1P8ZA 5DJBA 4BACA 3PIOL 4FM0A 3KKFA 2CGLA 5EHHA 3Q8UA 4ILLA 3SSQA 4M5KA 3HM8A 2Q97A 2GQ2A 1TUWA 3GCWP 4JV1A 4DV3F 1CS4B 4ELUA 4BR2A 2D0PA 2LEBA 2M0GB 4M94A 4JRQA 2QX0A 3JSRA 3PKMA 1UWBA 2QLFB 2DPIA 4BC5A 4FJGA 3IUCA 3PYDA 5F8HA 2W4DA 2L9WA 2MGZA 1OVYA 2VG5A 1MU2B 1YF5L 1S1WA 1N5QA 4ZPVR 1HQUA 2XTJP 5AJ3J 4DR1K 5LMUJ 4JLHA 3PY8A 4LMZA 3SI8A 2C2RA 5IM0A 2UXCJ 2DIVA 1RHKB 3CCSN 4ZN3A