2B5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 133
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b5jA05
4J9RA 4DEZA 3TARA 1C0TB 2YNFA 5KG4A 5C24B 3AVLA 3GILA 1RBVA 1TKXA 2ASDA 1LV5A 3T3FA 4ELTA 2YNFB 3FSIA 1RTIA 5I42A 1C2PA 4M41A 4CE9A 4B9NA 4MK8A 2W7OA 3LWLA 1TKXB 1U04A 4BWJA 4CHOA 4M3TA 4QWCA 2UVWA 1S1XA 2X6SA 1JXEA 1D8YA 1ASUA 1WSJA 2W9BA 4DF8A 3BR9A 2KZMA 1RTIB 5I42B 1X9SA 2FBXA 4LY7A 2WK4A 2AU0A 1VK0A 2FC0A 1S1XB 3IGVA 3V9WA 4OKKA 2KFZA 4WXWA 2W9BB 4K4WA 1UOCA 4K50A 5F8JA 4J2DA 3VQ7A 4W5TA 3L3UA 3KHRA 3PUFA 4CHZA 4RW7A 3PX6A 4ECYA 2IJFA 2QKBA 3LZJA 3AVJA 4KFBB 1U4BA 3PW2A 3NH0A 4J2AA 4FLYA 4NLTA 4WYWA 2E9TA 2G8KA 1KHWA 3TAFA 4J2EA 1RT5A 4RW7B 1NJZA 1CXUA 3H5SA 1Q9XA 4CJ5A 4ZVGA 2XI2A 2FLPA 4M42A 3PHEA 4ZP7A 1IKYA 1VSLA 1BGXT 4RG8A 4W5RA 2R8JA 1ZTTA 1X9WA 2AQ4A 2WTFA 3BREA 1QQCA 3AVCA 3PW7A 3KMSA 1EP4A 3DRPA 3JSMA 1IKYB 1TKTA 1EKEA 3HYFA 4KRFA 1RTDA 3SV3A 3BQ1A 4OPJA 5DQGA 2HAIA 3OLAA 1ZYQA 4HYKA 3QZ8A 2R8KA 2A1RA 1EP4B 3DRPB 1VSIA 3JSMB 4IH6A 1TKTB 2JEGA 3SZ2A 1SV5A 3AVBA 1HQEA 1RTDB 1BIUA 4MK7A 1RBRA 5F8GA 3H98A 3C6UA 1W0HA 2PY5A 4DSJA 1HMVA 2IAJB 2YKMA 4KSEB 3KK2A 2WOMA 1NK5A 1SV5B 1HQEB 2BQUA 4IG0A 4F3TA 3VN5A 5HP1A 3BSCA 3C6UB 1VRTA 3LP1B 1HMVB 2IDOA 2YKMB 3AVKA 4EEYA 2HB5A 3SPYA 3KK2B 2WOMB 5KFIA 2FBYA 3QESA 4CFDA 5HP1B 3H08A 4NCAA 1VRTB 4LH5A 3CM6A 4AHTA 3QEXA 4UQGA 3MEEA 4MIBA 3M9OB 1VSFA 2AGOA 4OKEA 2QE5A 4FBUA 3H5UA 4J9MA 2R2RA 4KHNA 4EYIB 5DGBA 1UA1A 3OHAA 2J6UA 3NE6A 3MEEB 2W9CA 4FLUA 4Q8FA 2BDPA 2HHVA 2O4GA 2O5DA 2HNDA 4IRDA 3HPOA 5C5JA 1WNEA 3PW5A 2FBTA 4XO0A 2JC0A 4KTWA 5L1KA 2W9CB 5KRSA 3UIQA 5C25A 4J9NA 1YTAA 2HNDB 4IG3A 4BE1A 3QGIA 4XPEA 2HHUA 1HNIA 4RNOA 5C25B 4JRPA 3T5JA 4O0JA 4C8OA 1S9FA 2Z1HA 3OSPA 4W5NA 1BQNA 3DOKB 1IKWA 4HUFA 3G6VA 1HNIB 1CSJA 5E41A 4U6PA 4QWBA 3IS9A 2G8IA 2BE2A 2ETJA 4CJWA 1BQNB 1ZBLA 2QXFA 3RRHA 3C94A 1IKWB 5KFDA 4K8ZA 3QINA 4F50A 1JXBA 1I39A 2X78A 3U3GA 1REVA 3ZSVA 3IS9B 3CJ4A 2C2DA 2BE2B 1I6JA 4B3OA 4Y2AA 4YP3A 1IKVA 5F9NA 4Z0UA 4HHTA 2ZD1A 5J2MA 1ASVA 1REVB 3K58A 4AHSA 3M8QA 2IOCA 3MEDA 5CY4A 4B3OB 3TAQA 3CJ5A 2BQ3A 1IKVB 2ZD1B 5J2MB 2OZMA 4DQRA 3M8QB 4CEEA 3MEDB 1K1SA 4NLVA 1RT3A 2RN2A 1KLNA 3ZT1A 4Y3CA 4KV8A 1S6QA 4NLSA 2OPPA 3CO9A 3KD1E 4CJVA 1RYRA 2PZSA 1RT3B 3M8SA 3QEWA 3O4NA 3HJFA 3D0PA 3QERA 4TYBA 3TR8A 4IFYA 4KKOA 1NJXA 1KSPA 3GQCA 4KV8B 2OPPB 2IA6A 4KB7A 3GV8B 1UAXA 3AO3A 2Z1JA 3BGRA 4IFYB 5DQHA 4KKOB 4Y2CA 4FM1A 4J9PA 2RPIA 4DTPA 2P5OA 1OS5A 1B92A 4IRKA 1VSMA 1VSHA 3BGRB 1Z4UA 4KI4A 3DMJA 4F4WA 4J9LA 4FJIA 5KG6A 3SV4A 1SL1A 3ZT2A 2B43A 4OPKA 1NK8A 2FJXA 3V1QA 3ZSYA 4IKFA 3H40A 5KG7A 4FYDA 2R8HA 3QZ7A 1CZ9A 4TY9A 3V4IA 3FQKA 4R8UA 4RUCA 1LWCA 1S9GA 1BCMA 1TQLA 5JS2A 3PR5B 4DQSA 3PR4A 1VSDA 4NLDA 1BISA 2YNIA 5KFZA 5EWEA 4JUZA 3CG7A 5KFQA 4DL3A 4R8UB 1LWCB 1S9GB 3KLEA 4CIGA 4EO8A 2D3UA 4URGA 1FKOA 1FKPA 4M94A 2YNIB 4CIFA 3OYKA 2KTQA 2YNHA 1TAUA 3RR8A 3OYCA 3NAHA 3KLEB 2G8WA 2IM2A 1JLFA 3SI6A 3ZSWA 1FKOB 1S4FA 1FKPB 1O1WA 2HVHA 3DLKA 3ZT4A 4RNHA 2YNHB 4MQ3A 3KHLA 4B8AB 5K14A 4NYZA 2E6MA 2VA2A 3V9SA 1JLFB 4B9TA 3O3HA 4FJGA 4B9LA 5HROA 3ICLA 1QUVA 3L2RA 4HCBA 1NJYA 3NAIA 5K14B 4OGCA 3SUNA 2J6TA 4Y1CA 3QGGA 1TK0A 4DTOA 4ELVA 4N41A 5HROB 4RW8A 3KHGA 3EZ5A 4M3UA 3GV5B 3T1AA 4DSIA 1QSYA 2C22A 2HNYA 5KT4A 1B9FA 4RW8B 1VSKA 3MECA 3CVKA 5KFBA 4DU4A 5KG1A 3L2QA 4AHCA 4DS4A 1D1UA 4BWMA 1SKWA 1X9MA 1NKCA 2V4QA 4TN2A 3O3GA 2HNYB 2JLEA 2IGIA 5CZ1A 2AGQA 3NL0A 1JX4A 3MECB 5L1LA 1S1VA 2R2SA 4C8MA 4JV1A 3AO5A 1KFSA 3ISND 4KE5A 1HYSA 3RAXA 4QWAA 4CJTA 1ITGA 5DGAA 2WONA 1S1VB 4DMNA 3ISNC 1RA6A 3FDSA 2C28A 3RWUA 4DFMA 4ZTJA 4URQU 3DOLA 1HYSB 3CDUA 2E4LA 1QTMA 3T5LA 1S0NA 4CJ4A 3ZSZA 3Q8QB 4IH5A 2FVCA 1QHTA 4K8XA 5KT6A 3AO2A 2QV6A 5DG8A 3E51A 2ITGA 4Q43A 1RBTA 4PY5A 5KFLA 3N6NA 4WE1A 4CEOA 1RT7A 3B6OA 1Z26A 3RRGA 5FDLA 4QPXA 2NUBA 3HPHA 1JLBB 1JIHA 3D45A 4FJXA 4JS4A 4CGJA 4CFAA 3PX0A 4WE1B 3WNFA 1JLEA 1RT7B 3UPFA 1SH3A 5FDLB 3M8RA 3GV7B 5KFCA 4BE2A 3QIPA 3EZUA 3QNOA 1JLEB 4B8CA 4FJMA 4RNNA 1RT4B 2UVVA 1KTQA 3V81A 3HT3A 5KFPA 1A5WA 3CQ8A 4J2BA 4NLGA 3QIPB 3V9XA 4OVLA 3V1OA 3PY8A 1N4LA 4FLTA 4ED2A 3V81B 5T7BA 3V6KA 4I9QA 3AA2A 3K5LA 4ECXA 1N56A 4R0EA 3BJYA 2B5JA 4KO0A 4LSNA 5KFSA 4X2BA 4AH9A 3LANA 4KTZA 3OL8A 2FBVA 1XR6A 4I2PA 5J2QA 4JLHA 3NGIA 4WXOA 2BRLA 2B5JB 4KO0B 4LSNB 2XCAA 1C0MA 1HJRA 3F9KA 2O4IA 1S1UA 1RBSA 2QKKA 2XY7A 3O3FA 4I2PB 3KLGA 5J2QB 5EWGA 2GUIA 3DYAA 1S1UB 1NKEA 3AO4A 3TAGA 4C8NA 4CERA 1NK0A 3KLGB 2G8VA 2Y1IA 1IKXA 3NHGA 2YV0X 4LQ3A 3DYAB 4FJNA 1FXXA 2OA8A 1IKXB 4O0IA 4FZYA 4FLXA 4C8LA 3P5JA 3GIJA 2R8IA 1RT5B 4ICLA 4I2QA 2X74A 2XO7A 4CGDA 3LZIA 4HVJA 4CECA 4CHQA 1A5VA 4ICLB 4I2QB 4YNQA 1GOAA 4K4YA 1NNDA 3O4QA 1JLGA 1X1PA 3HO1A 3ZSOA 1RT6A 4FM0A 4GVMA 4E1NA 1W9HA 4EYHB 4IQXA 1BIZA 4R5PA 4F2RA 1GOBA 4CJ3A 1C1CA 1JLGB 2R8GA 2XGQA 4PQUA 1T05A 1WNSA 1WLJA 4YFUA 1RT6B 5KFRA 2XI3A 3HVWA 4ZP9A 4PWDA 3DLGA 4B9MA 2CJQA 4ZVHA 4R5PB 3IG1A 4HCCA 3AVFA 2Z1GA 3VQ6A 1C1CB 2HHTA 2YHBA 4PQUB 1T05B 4IKAA 3K2PA 5I3UA 3WNEA 1KCFA 1QS4A 4Y1DA 1IH7A 4PWDB 3DLGB 3IG1B 4IG0B 3M9MB 4DSEA 2FLLA 2OPSA 1U45A 1ZBIA 1RNHA 3Q8RB 3D5MA 3OL6A 5I3UB 1JLCA 4E0DA 3E01A 3NF8A 5CYMA 4ED8A 3AVNA 3WNGA 2OPSB 1QE1A 4M45A 2WB4A 3P83D 3C6TA 1JLCB 1LAVA 3E01B 2D0AA 5CYMB 1K1QA 3HKWA 4ZTFA 4Q8EA 3VQDA 3V9ZA 5L9XA 2KFNA 1QE1B 3RB0A 4DSLA 3TANA 4RW9A 1J9AA 4J9OA 3C6TB 2B4JA 3AO1A 4MH8A 4FJ8A 5SZTA 3H5XA 2Y1JA 1JLAA 3MR5A 4NLYA 2X6NA 1L3UA 5FROA 1U49A 4DL4A 4RW9B 3ITHA 1S0MA 3PO4A 4OLBA 1QAJA 3AA5X 4DTUA 4E7HA 4CGHA 4KTQA 4OJRA 4HTUA 1WSEA 1JLAB 4O44A 4IG3B 1TVRA 4QW9A 3PJXA 1KRPA 1RDBA 2HHQA 1TKZA 3LPTA 4KHWA 2DTUA 2FVRA 1Y97A 3ASMA 4O44B 2R2TA 3CIZA 4ED3A 3CJ3A 5L1IA 4WZQA 5DMRA 4ZP8A 1NK7A 3OYIA 3VQEA 4E7IA 4B9VA 3HL8A 4B9SA 2ZE2A 2VG7A 2W7PA 2ZKUA 3FQLA 4KHUA 3VQPA 4YQWA 4G1QA 3TI0A 3VQSA 2D0BA 1S6PA 1G15A 1K6YA 2HNZA 3I0SA 2ZE2B 2VG7B 3SUOA 4ECRA 2BGGA 4WYLA 3V6HA 3RMAA 4FS1A 4FJ5A 4G1QB 1S6PB 1NOZA 3ZSQA 2BR0A 2HNZB 3I0SB 5HBMA 1B9DA 3KLIA 1TKDA 4CK2A 3CJ0A 3MF5A 3Q8PB 1UA0A 3TABA 3NGZA 3HVAA 1DLOA 4CF1A 1SL0A 3OSNA 5HBMB 3MR2A 3EPGA 1JL1A 4DLEA 3M9NB 3OYMA 3KLIB 1IM4A 5KT3A 3AA3A 4FK0A 3MFHA 3OL7A 2ATLA 3G10A 2WCXA 1DLOB 4KAIA 1S6QB 2IS3A 3KK3A 1R0AA 4FJ7A 1VRUA 1SUQA 2OYQA 2IBKA 4CESA 4CJLA 3OYDA 4W5OA 1DTTA 3K5MA 1L5UA 3OL9A 4WFXA 1RT2A 2BRKA 1BQMA 3NF9A 3KK3B 1R0AB 2HHSA 5KG2A 4O3QA 4O4GA 1VRUB 1NHUA 5KFYA 1SUQB 4NCGA 3MAQA 3KNAA 1DTTB 4DFKA 3U6FA 1RT2B 1BQMB 3HM9A 4CHYA 2JGUA 4NYNA 3BSAA 4CJUA 1RT1A 4O4GB 3OJSA 4CEZA 3CJ2A 4FLVA 1C0UA 1TK8A 4Z4FA 3LALA 1RTJA 3DMJB 4EBDA 1S9EA 2XC9A 4E89A 4U7CA 4DLGA 4FJKA 1RT1B 4H4OA 3T19A 3KK1A 2OH2A 2IM1A 4ZMMA 3SFGA 3HVTA 5DQIA 1C0UB 3SI8A 1N5YA 4NRUA 1S9EB 4FW2A 3OJUA 5DLFA 4JV0A 4CJFA 4M3RA 4GC7A 4IH7A 4H4OB 4EBEA 3KK1B 1RAJA 3HVTB 4JS5A 1N5YB 1W25A 4K4SA 3V4IB 4ZPCA 5JS1A 2FVSA 3TAEA 4K4UA 1WSIA 3SUPA 4OL8A 3ULDA 5KT2A 4E7JA 3QETA 4NLPA 1D9FA 3SPZA 3RMCA 3KKSA 5KT7A 4ECVA 2RKIA 1CZBA 2HHWA 4EBCA 3QEVA 2JEJA 2E9ZA 4FJ9A 3ZCMA 5KFWA 1N6QA 1RDRA 5T14A 2XGPA 4NLQA 4B9UA 3NF6A 4LH4A 3DLEA 5F9LA 4W5QA 3G0ZA 2G8FA 2RKIB 3LP0A 2D41A 2KQ2A 4E3SA 2XY8A 3PV8A 4ED7A 4ED0A 1MMLA 1TL3A 5KFGA 1N6QB 4Q44A 1RYSA 3QEIA 1S10A 3BDPA 2HVIA 2GV9A 3DLKB 3DLEB 3LP2A 4TSXA 4M3WA 3S3MA 3L3VA 4M3YA 2XCPA 4M3XA 3LP0B 3WNHA 4C8KA 1WN7A 2F8EX 4DQQA 4LSLA 3LP2B 1S49A 1EXQA 2VA3A 3AVIA 4KHSA 4O3NA 3I8DA 4NLUA 2OZSA 2EHGA 2XRIA 3ZT0A 4AILC 2P51A 2FJVA 3VQ9A 1NK6A 2W8LA 4LSLB 3HPGA 4FJLA 3NKYA 3UDLA 5KG3A 4IBNA 3AV9A 3DLBA 1SL2A 2ILYA 1TL1A 2VWJA 4QWDA 1L3SA 4FK2A 4PUOA 2I1RA 3G6XA 4Z4GA 1WAJA 1XI1A 2DPJA 3GIIA 1EX4A 3VA0A 4Z4CA 4FW1A 3SFUA 1TL1B 4QOZB 4IDKA 3BQ0A 4E19A 5KFVA 3CFPA 3OVNA 4PUOB 4QW8A 5EWFA 3THVA 2ASLA 4DSKA 3KTQA 5KFFA 2C2RA 3IRXA 3DI6A 2WHOA 3NCIA 2IJNA 4IDKB 1TAQA 3PW4A 4KBIA 3PW0A 2D0CA 2OPQA 1XHZA 4CEAA 4H54A 3CFOA 3NDKA 1C6VA 2WONB 4Z4EA 2ALZA 1WAFA 3IRXB 1RDAA 3DI6B 4J9KA 3PZPA 4N47A 4F4XA 3NMAA 3DOLB 2OPQB 3Q8SB 2KZZA 4YR0A 2R7YA 3QO9A 4IOBA 1NHVA 4K4XA 2DPIA 3LP3A 4WFZA 2GIQA 2HWHA 3DRSA 1D9DA 3QLHA 4RZRA 1WSHA 2WRMA 2AJQA 3IGNA 4GC6A 1XWLA 3SQ1A 4FVMA 3V6DA 3V9UA 4Q45A 3S3NA 5F8LA 3TWHA 4N56A 3L2UA 3GIMA 3SJJA 3H5YA 2G8UA 3DRSB 2P5GA 3QLHB 4CK1A 1HQUA 1IO2A 1NKBA 3V6DB 4E1MA 3LWMA 4K4TA 4DQPA 3QIDA 4KHRA 4MFBA 5J2NA 4DL5A 4DTJA 4I9LA 3H4BA 2JEIA 3N6LA 3HK2A 2DFHA 3KOAA 3SQ4A 3SUQA 3HVRA 3OYFA 1T3NA 4MFBB 5J2NB 3KJVA 1DTQA 4YMEA 2E6LA 1SH2A 2YHAA 2XHBA 2J6SA 3I5BA 5C24A 1KVAA 3DLRA 3NAEA 3KJVB 2RF2A 1DTQB 3AVGA 3RMBA 3LDSA 1HRHA 3VQ5A 1SH0A 2KW4A 3OS1A 4QAGA 2EX3A 2R2UA 2Q3SA 5KFKA 2B6AA 2FJWA 4KPYA 3OYAA 4ZPBA 3BQ2A 2RF2B 1IG9A 2W42A 1U09A 4ZPDA 4CEDA 3I5AA 4XIUA 3DDKA 3CFRA 4DL7A 3ALYA 4IR1A 2B6AB 1TP7A 4CJSA 4FCYA 2IM0A 5KFAA 5KFNA 2AWZA 2GIRA 4CF2A 2HHXA 3IAYA 3TVKA 4QCLA 3EYZA 1NK9A 3QNNA 3LAMA 1D5AA 3AVAA 4KFBA 3VQQA 4K4VA 3A2FA 4YR3A 5HRRA 4E7KA 5KFJA 5KI6A 3IN5A 2D7SA 4ID5A 3S3OA 3UR0A 1FK9A 4CFCA 1VSEA 3L8BA 2CKWA 3VQBA 3MR6A 4CHPA 2ATQA 4H8KA 4ECZA 3VQAA 3HP9A 4ID5B 1FK9B 1Q8IA 5FRNA 5KT5A 5KRTA 4FZZA 4FM2A 4J9SA 2GBZA 4KAZA 4DS5A 2G8HA 2XWYA 4Y34A 3SQ0A 5KGWA 5KFEA 5KFTA 4FK4A 4LD0A 2YKNA 4FLZA 2LSNA 2HMIA 3VQCA 1C1BA 4QWEA 3BSNA 4DTSA 3N6MA 2ASJA 3PX4A 1JLQA 4N76A 2IAJA 1L3VA 5HRPA 2A1SA 3KIOA 2YKNB 4FS2A 4DFPA 2HMIB 1C1BB 4KHYA 1RILA 3ZSXA 3LP1A 3ZT3A 1JLQB 4DSFA 3V1RA 2FLNA 4MK9A 1LAWA 1BI4A 4DWIA 3F73A 4O5BA 2DY4A 1RTHA 3RB3A 3KMQA 3QYYA 2W8KA 1QSLA 3I5CA 4F4YA 1BI4B 4B08A 2E9RX 2F8SA 5EUHA 1RTHB 1GOCA 4KI6A 1ZBUA 1QAIA 3OHBA 4L8RB 4F3OA 3OYHA 1BHLA 3VA3A 3RB6A 1I3AA 3B6PA 3PO5A 3NFAA 1S48A 2VG5A 3RB4A 1S1TA 2Z1IA 1JXLA 3LAKA 5F8HA 4RU9A 3RMDA 4ZVEA 3JYTA 1NK4A 2VG5B 4O3RA 4O3SA 5HLFA 2AX1A 1WSFA 5KG5A 1S1TB 3ITHB 1HYVA 3DOKA 1TV6A 1ZETA 4NZ0A 4Z4HA 2FVQA 5L1JA 4BDYA 3JYTB 2HWIA 3QIOA 1KVCA 1TVRB 4OGEA 4KHQA 4IRCA 4CF0A 5HLFB 3HP6A 1UWBA 4TQSA 1WSGA 2PYJA 1TKZB 1SKRA 4ED1A 1VSJA 2AGPA 4O3PA 1TV6B 1RDCA 1S1WA 1NJWA 2IM3A 4DG1A 4KHMA 3MTKA 1J5OA 1F21A 4ED6A 3DLHA 1UWBB 4DTNA 2VG6A 3PVXA 3OYJA 4ID1A 4I7FA 4E7LA 3V6JA 1S1WB 2IMWP 4EP5A 1CLQA 3MFIA 2W9AA 4DF4A 3I0RA 4DG1B 1HYZA 1XR5A 3U3YA 1J5OB 3TAPA 2PYLA 2F8TA 4F4KA 4FXDA 2VG6B 4O4RA 3KLVA 1JKHA 4I7FB 1RCHA 1RDDA 4XPCA 3H2LA 4NLOA 3CWJA 4WZMA 1RBUA 2XY6A 3MXMA 4JRQA 3I0RB 4DL2A 4DQIA 3BSOA 3CYMA 4CJQA 1JKHB 3OS0A 1KHVA 5HRSA 1XR7A 4CF8A 5CYQA 4FZXC 4EZ9A 1L3TA 3M8PA 4CGGA 3DRRA 3P1GA 4G3IA 1KLMA 4CJRA 1GX6A 2UUTA 1MU2A 3CM5A 1T7PA 2RDJA 3ZSRA 5CYQB 1D0EA 4ZHRA 2D3ZA 3M8PB 3KKRA 3RBDA 1T8EA 2HW3A 3DRRB 4YR2A 4RUAA 3RBEA 1KLMB 2D5RA 1MU2B 1TK5A 1LW0A 4ZPAA 4ZHRB 4NRTA 4TY8A 3RTVA 2RDIA 2F96A 3G86A 4AHRA 2ZQBA 3OYGA 3VQ4A 3SNNA 3RAQA 4OKJA 1S97A 1LW0B 2UVUA 5F8IA 3KD5E 3OY9A 4TY8B 3T5KA 4JV2A 4NCGB 1LWFA 5HRNA 2AX0A 5D3GA 5DLGA 2FVPA 4ECWA 2YNGA 4J9QA 3OS2A 4FJJA 4PA1A 4TQRA 3SCXA 1LWFB 4F2SA 2ILZA 4NCBA 1RTJB 1YT3A 1TGOA 1RA7A 5JUMA 5KFOA 5D3GB 1N48A 4FJHA 4GW6A 2YNGB 3HHKA 3NBPA 4FLWA 4AHVA 3CDEA 4NYFA 1BL3A 2P1JA 1KVBA 3HXMA 5DG9A 4FBTA 3GIKA 4K4ZA 1XC9A 1S5JA 4ECQA 3VQ8A 4CCHA 3NBPB 3SYZA 4M95A 4CHNA 4CJEA 4ECSA 2QK9A 3TQ1A 4IR9A 1C1AA 3CDWA 4MKAA 1U48A 4URSA 3MEGA 1CXQA 2V9WA 3L2WA 3EY1A 4BDZA 2DFFA 4DL6A 5KFUA 1GX5A 1YVFA 4DTMA 3GYNA 4CF9A 3FRZA 3MEGB 4M3ZA 4N5SA 4DFJA 5JXSA 2UVRA 4Z4IA 3QEPA 3K59A 1HARA 3H4DA 1ZBHA 2I5JA 4NLRA 4F4ZA 1A5XA 4EZ6A 3NGDA 4RNFA 1Z25A 1TL3B 5DK5A 4ZP6A 1SKSA 4CK3A 2DFEA 5J2PA 1YVUA 4NLWA 4RW4A 3EPIA 4DTRA 3MXIA 3RR7A 2I5JB 4CFBA 3OYNA 4TXSA 4MKBA 1HPZA 5KGXA 5J1EA 3MXJA 1QSSA 4CJPA 4HUGA 1KFDA 5J2PB 1U47A 1EETA 4RW4B 2VWKA 3D28A 3DM2A 1HPZB 5J1EB 5KFMA 3H59A 4O3OA 4H4MA 2XY5A 3AVMA 3KHHA 3KLFA 1ASWA 4CGFA 1EETB 1XHXA 4O55A 4EO6A 5F8MA 3K5NA 5F8NA 4ECTA 1J53A 3DM2B 4CJKA 3OYEA 1ZTWA 4BE0A 4H4MB 4NLXA 3KLFB 4AHUA 4CEFA 3KLHA 5KTQA 1Q9YA 3K57A 4CEBA 3T5HA 3K5OA 5SWMA 5EDWA 4LQ9A 5KFHA 3MR3A 3KLHB 5CZ2A 1T94A 4ELUA 1LW2A 4Q0BA 4IFVA 2BANA 3LPUA 3NGYA 4Q5VA 4KB1A 2UUWA 5DG7A 4ECUA 1YTUA 4WFYA 4BDPA 3UQSA 4EP4A 3FFIA 1LW2B 4RW6A 1LWEA 4Q0BB 4IFVB 2C2EA 2BANB 2EC0A 4CGIA 5KFXA 1ZBFA 2OPRA 4CIEA 4DU3A 1BCOA 4CEQA 3QGHA 4RNMA 2V4RA 3NH1A 3FFIB 3QO9B 4RW6B 2IC3A 1HNVA 1LWEB 4DTXA 4KB0A 2BQRA 1JLBA 1JL2A 3G6YA 2OPRB 3NH2A 4HKQA 3OYLA 2JC1A 4ZVFA 3OYBA 1NOYA 1J54A 4DU1A 4TYAA 2IC3B 4MIAA 1HNVB 5C42A 1S0OA 3AA4A 3PJWA 3AVHA 1HQUB 2V0NA 4TLRA 5KG0A 4BACA 2GC8A 1T03A 1RT4A 3S9HA 5C42B 3TAMA 4F8RA 4KREA 3OLBA 2JEFA 5EU7A 1C0TA 3C95A 3NF7A 3HSTB 1T03B 5FRMA 4HUEA 3L2VA 4GMJB 3TAMB 3SQ2A 4OLAA
chains in the Genus database with same CATH superfamily
4DEZA 4BRGA 4RUHA 1C0TB 3TARA 1NH7A 2EK1A 2GWJA 5KG4A 3CI5A 1Y00A 7FD1A 1QVFR 1FFSB 1YUWA 3MWBA 1FWLA 3MUVP 4MLEA 2YNFB 1C2PA 4MK8A 4BWJA 4CHOA 4IZ9A 1IXKA 4GRSA 2I0XA 2ZNYA 4A8OA 4MLHA 1XIQA 3MMVA 5FLXY 3AAWB 2FBXA 5EVZA 4HTLA 1Q79A 4DX7A 2WZ1A 1VK0A 3AAQA 1M5KC 2PMZD 1VQPS 3DWLA 4K50A 4O8KA 1WC3A 2A10A 1VLYA 1LK7A 1W2BR 2GX9A 2V8VA 4RW7A 3PX6A 4NZ6A 2EBEA 4KFBB 4FWOA 1U4BA 3PW2A 3NH0A 3NP5A 4K7QA 2FSJA 5AXKA 1HHTP 2CQBA 3M8ZA 4J2EA 4KGZB 4DX8H 4CT8A 3BF1A 1Q9XA 4CJ5A 4OZ5A 4ZVGA 4ID8A 2FLPA 1M5SA 1BGXT 5K20B 4RG8A 2KVQE 2FB0A 4IXCA 1ZTTA 3NCQA 5C2DA 4OYZA 2EXUA 4H4KA 2WTFA 1N52B 1VBYA 2I7NA 1BOTO 3P5TL 1CC7A 4KRFA 2ZJRQ 2QEXN 2HAIA 3AY9A 3A5LC 3QZ8A 3W5ZA 4BRQA 2AP6A 2GGPB 4F26A 3DRPB 4YOXA 3JSMB 2IDEA 2JLFA 3AVBA 1HQEA 1RTDB 4M8LA 1H0HB 1P1TA 3H98A 3C6UA 2M0GB 2PO4A 2PY5A 4FNIA 3Q24A 4UUXA 3MMBB 3R9PA 2BQUA 4IG0A 2VGMA 3ENBA 4H0VB 4F3TA 2DGWA 1VRTA 4C8YA 2IDOA 1ITPA 3AVKA 3SPYA 3KK2B 3MM9B 5DS7A 1J5EF 2FBYA 4OHZA 1V6HA 3M2RA 3H08A 3W0LA 2HZVA 4UQGA 3BGLA 4KR0B 2DPNA 4KH0B 4OKEA 2PIIA 2R2RA 4LF6K 2XWXA 3GFYA 1YJWN 1ATNA 2W9CA 2DGXA 2YWEA 4FLUA 4Q8FA 2O4GA 1BWEA 2O5DA 4PG5A 1QZ5A 4WKRA 3MPWA 4DBQA 2WBMA 5L1KA 3UIQA 4J9NA 1VBXA 2KT3A 3EGNA 5JLFA 1M90O 1XK8A 2BW7A 2P9EA 3CO0P 1XMQJ 2MJUA 1WELA 2GCFA 3MGJA 4P75A 3K0JA 4AF1A 4QBUA 1BQNA 2ZH1A 3AXKA 7FDRA 2XSFA 3G6VA 3QJLA 4DV1K 1HNIB 1S7IA 1CSJA 2RE2A 4CT9A 2V51B 3VF6A 1X5TA 4LF9F 4U6PA 3THPA 2G8IA 1OY8A 3TUPA 4JD2A 1HI8A 3K89A 3V2UC 4OYIA 1ZBLA 1IKWB 2X78A 3TJ9A 2F40A 4DHYA 3VALA 1NLKL 4UZCA 3IS9B 1X8DA 2VC1A 1X5PA 4Y2AA 3C8YA 1IKVA 5F9NA 2K7JA 1LOTB 3FCWA 1REVB 4AHSA 5ADZA 1WBBA 1HNZF 3M8QA 4KBOA 5JVHL 5DJBA 1UFLA 4B3OB 2HHHJ 2BQ3A 2HSTA 3N79A 4Y65A 1M0SA 2NCKL 1AXQA 4BC5A 3MEDB 1K1SA 4JV5K 1NLVA 2RN2A 3ZT1A 2CH5A 4KV8A 4NLSA 2DHXA 4ATNA 3MM6B 2PZSA 2Z8QA 2HFVA 1ATSA 2C3MA 4TYBA 3TR8A 5C10A 2FGOA 4QS8A 1KSPA 2YX4A 2KJWA 5CAAA 2IA6A 3R2CJ 4PHTX 4QS9A 1RAIB 2R7QA 1UAXA 1F2HA 3AGKA 1TUWA 4IFYB 5DQHA 4KKOB 1JK9B 1KBRA 1KQGB 3WX8A 4P2XA 2RT3A 4YB5A 2E1YA 1B92A 2AJ2A 2LYVA 1R8AA 4DB3A 2ZM6K 3CJ9A 2Q0UA 2YXLA 3ZT2A 2FJXA 3QFWA 4LFBF 1HKAA 4IKFA 2MZJA 1DFDA 5HK4A 1TFWA 4AXIA 4ES3A 5KG7A 3MMAB 1UVJA 1K8AT 3QZ7A 1YJVA 3W2VB 1CZ9A 4TY9A 1FWPA 3FSXA 2C2KB 3AB4B 2XMUA 1LWCA 4BC7A 5JS2A 3PR5B 3IBFB 2YHXA 3PR4A 4GY2B 1AROP 4JUZA 5KFQA 3ZNUA 4R8UB 3MCOA 2ZBQA 4P2FA 2YNIB 1WDDA 3NGUA 3QPIA 4LVNP 4MAKA 2PI5A 5FPNA 3KLEB 1JQGA 1NSKL 3UCZP 2HQFA 5CE3A 3AOCA 1UAWA 2XYPB 4LF8J 3CJKB 4JI4J 2E6MA 2F1FA 1MMNA 4B9LA 3OFEA 3OTOJ 2AEMA 1NJYA 5LM7E 5K14B 4OGCA 5AQHA 1R6YA 4DTOA 5DM6Q 2L08A 4N41A 4H5VA 4BRDA 3TSQA 2CZ9A 1FW6A 4ZK7M 3L09A 3T1AA 1YQHA 1KOHA 4B3RF 2BZ2A 1RWNB 1VSKA 3MECA 3KUEA 2J0XA 4DU4A 5KG1A 3BH7B 4F3MA 4TN2A 4J91A 2QW9A 2IGIA 3U02A 5CZ1A 1JX4A 3Q7BA 3W3SA 3NMUA 2V8PA 3A3NB 5B09A 1Y5NB 2GFFA 2W24A 2QLFB 2DO4A 2ZGZA 1KQSM 4DV0K 4YORA 3RAXA 4QWAA 5BR8J 4K8RA 3CCUS 4JI1F 2DXEA 3D7EO 4DMNA 2CQ1A 1NB7A 2UXCK 4DV5J 2QLXA 4DZ6A 3DOLA 2E4LA 1FWKA 4UF4A 5BJRA 2FVCA 1HKCA 1RQ0A 5KPZA 4OHXA 2OJ3A 1QDUB 3AO2A 2DNHA 2D1KA 1G2EA 4HACB 2ZH9A 2IDLA 1T95A 4PY5A 4DXLA 1UL3A 1RT7A 4N77A 1Z26A 4CH1A 5FDLA 4QPXA 4CJ7A 5HMWA 2NUBA 3MK6A 1W7WA 2GHPA 3J80Y 3OPKA 4CGJA 4LFCF 3PX0A 1NGHA 3WNFA 2MSTA 1IWAA 4K2XA 2HFUA 4P72A 2CDRB 3GV7B 2DEJA 2MHNA 1PJ7A 4BY9C 2PSZA 3QIPA 1XQSC 1JLEB 4FJMA 3CJ8A 2HRYA 2UVVA 3V81A 2EC2A 2RQCA 4J2BA 4NLGA 4LC9B 2RSQA 2ZITA 3U27A 4ED2A 1S5ZA 3AA2A 3K5LA 3DXKB 4WF9L 4HDHA 3DAWA 3BS9A 3BJYA 2B5JA 2G4BA 2KDOA 4IOAQ 4AH9A 3OL8A 3ZC4A 4I2PA 4L76A 1LCUA 1WEYA 1HWKA 2IBOA 4A46A 4KO0B 1C0MA 1HJRA 2CA9A 2E1AA 2V2ZA 3J7ZO 3KLGA 2ASOA 4JKBA 5J2QB 2JWLA 5EWGA 3HLUA 2OSRA 1X4BA 3H90A 1DEJA 2XMMA 3LO3A 1SXLA 1C4AA 4C8NA 3WXJA 4DR4K 1QZ6A 3RZAA 2ROPA 3US5A 2V94A 4PWUA 1A7GE 2DTJA 2YV0X 3PM9A 4DUZJ 1QLNA 3DYAB 2DVIA 4KGKA 3CCJS 4OYOA 1E6VA 1IKXB 2XHWA 4FLXA 2R8IA 3ILOA 1AZSA 2LXUA 4C0BA 4BR0A 2X74A 4L3NA 2QA4N 1LXNA 2V8HA 3P4IA 4G6VB 3NCPA 4CO1A 4CHQA 2CPYA 2FHJD 1GOAA 3O4QA 1JLGA 2IVOA 2F9JA 1RT6A 2O67A 1ZC6A 4I69A 1GTEA 3M32A 3BEXA 1KEKA 2XNQA 2W2NP 4PQUA 3ZFVA 1WNSA 2HKEA 5KFRA 1IBLJ 1NCLA 4ZP9A 4AQYF 3MPDA 2CJQA 4ZVHA 5CQGA 4R5PB 1FDDA 3MR7A 3VQ6A 2HHTA 1RBOB 4JEPA 3DCAA 2A18A 4IKAA 4PL8A 1VQYA 4V19X 1QS4A 4Y1DA 3PFOA 4ZLNA 3MM7A 2BXJA 1U7LA 2RVJA 4IG0B 4X4NA 4DSEA 4PG8A 2OPSA 1KQFB 3UDVA 3D5MA 5A2QY 1KDNA 3J81O 1YIJN 2Z2LA 1RGVA 3EVOA 5CZXA 2HVZA 3T9ZA 2XQCA 1O6XA 4ZPWR 3JXUA 2VIHA 3O9QA 2UV8G 1OSDA 3J81U 4QR0A 3PHTA 5DO2A 3C65A 1X0PA 2D0AA 2GELA 4QU7A 1YI2S 4Q8EA 4X4TA 1UETA 3RB0A 3TANA 2DNGA 4J9OA 3C6TB 2B4JA 2WVBA 3RGIA 2AIRB 1D4XA 3WT0A 3OBYA 1HUXA 5FLXO 3NEKA 1JLAA 3W9IA 4NLYA 3HBTA 1U49A 2C2NA 4RW9B 1S0MA 5GAEP 1TL7B 5FLXU 2FUG9 4DTUA 1VQPN 4CGHA 4RO0A 2DXDA 3D6TB 1AFJA 1R89A 1TVRA 4QW9A 1S3XA 4NLBA 3OA9A 3DOMA 1TKZA 4B3TJ 1MMDA 3LW5C 2HK3A 2GWKA 2YHYA 3ASMA 2NSCA 2NRXA 3BKFA 3FLCO 4FYXB 4MIWA 4A8QA 5L1IA 2FZCB 3G82A 4LF7K 4PZVA 3ENHA 5AFUA 4B9SA 2E8AA 1QAYA 4U95A 3WXLA 4YQWA 3CSKA 1FHTA 2JL9A 2CQ0A 2HPUA 1K6YA 5AQJA 3I0SA 1CJKA 3H3OB 2ZE2B 1WHVA 2NREA 4WYLA 3CCRS 1FNMA 2A3ZA 4FS1A 1RWPB 2ZOGA 4UY85 3HHLD 2F9WA 4KH1B 4BC2A 2CNKB 1S6PB 3CCWA 1B9DA 1DQ9A 3C6HA 3MF5A 2D4WA 4MYTA 4DV2F 2FC9A 2FGCA 4MKYA 3E1YA 2QMWA 3MR2A 3M9NB 3H42A 3BH6B 2SXLA 4LFAJ 3PACA 4FK0A 4WWSA 1NDPA 4FF3A 3CCLS 1R0AA 4FJ7A 3B8HA 2CG8A 1GQEA 4CJLA 4W5OA 2Q66A 4FYWB 2BRKA 1S72S 3T1HK 3KK3B 3L6QA 2U2FA 4O4GA 1VRUB 3QMLA 2Z2MA 3QT8A 3NS7B 1YHQS 3UVJA 4CHYA 2MKYA 3OJSA 4YOVA 2Z56B 3IO1A 4A4JA 4NI2B 1T6DA 1B7YB 4DCOB 3QSIA 2YKOA 1N5QA 1UW4A 4DLGA 3THTA 4RBVA 3SCJE 3KK1A 5K8NA 1C0UB 4UUWA 1QVGM 2ZH2A 1N33J 4C0OC 1S9EB 3OJUA 2QM1A 2QWQA 4M3RA 3C15A 4I68A 4FPAA 3PLAA 1RAJA 3HVTB 1OVQA 4JS5A 4JI0K 4EHUA 7AT1B 4YHHF 3VAIA 1N5YB 5AQSA 4K4SA 2G2YA 5SUHA 2FVSA 4C97A 2MLYA 3NNHA 2A40A 3QETA 1Y9OA 3OFHA 1TYQA 1EKSA 4ZVOB 3MPUB 1SAZA 1QQMA 3QDKA 1X5SA 1DHMA 2BABA 4RX6A 4DCHA 5B08A 1N88A 4B9UA 3NF6A 4LH4A 4XH5A 2OSQA 2RKIB 2D41A 1FRXA 2XY8A 1EJ7L 1N6QB 4DDFA 2F8HA 3QEIA 2HVIA 3BDPA 2J7KA 3VGTA 3LP2A 2W1BA 4M3WA 2Y0SD 2DGVA 4M3YA 4M3XA 3LP0B 2LVWA 4FF2A 1V5VA 4LF5J 4PG4A 2F8EX 3L9ZA 5KOWA 4K43A 4O3NA 3PEHA 2V50A 2OZSA 3MHYA 1HD1A 4LJMA 3HPGA 3NKYA 3W2WB 3T1YK 3AV9A 2ZH4A 2ZJRL 1SL2A 2HBJA 1H2VZ 2ILYA 1TL1A 4ISFA 4QWDA 1L3SA 3IP0A 2R4FA 1WAJA 3A5NC 3MX5A 1G7CB 1EX4A 4OHWA 4Z4CA 2EG1A 4JNEA 1U6BA 4JI7J 1FJGF 4JI5F 4E19A 2HQGA 3KTQA 4DZDA 2VQEF 1VQ5N 2HZCA 3SMZA 3IRXA 2VQFK 3DI6A 3M3ZA 3QWUA 2IJNA 1TAQA 3M6VA 4K59A 4PKHA 3PW0A 1XHZA 3NDKA 1C6VA 1MROA 1H2UX 1RWXB 3MN6A 2WSEC 5CABA 3DOLB 5AZJB 2B9YA 2DY9A 3Q8SB 1VFJA 2FJEB 3P45B 4YR0A 1WI8A 3PTWA 2E5JA 4Y2IA 3EE9A 2GIQA 3QLHA 1UPPA 2WRMA 1JJHA 5E2QA 1XWLA 2DHAA 3SQ1A 1DAXA 4N56A 1E6YB 4CTAA 4LRBA 4BRAA 5D0HA 3ZZOA 3L2UA 1J27A 3QT7A 3OUYA 1NKBA 4HH0A 3V6DB 1GMWA 1GLCG 3QIDA 1D3WA 2LQ9A 4MFBA 5J2NA 3HX9A 4DTJA 3H4BA 2JEIA 2C42A 2QRRA 5DZ7A 3ULHA 3KOAA 3SUQA 2KT5A 2D74B 1HBNA 4Y00A 3J8AA 1DTQA 1HBUB 2JVOA 1F5CA 1SH2A 4G1IA 3LGMA 1BG3A 5C24A 1KVAA 1K44A 2JJ4D 4RUBA 3NAEA 4CZEA 3KJVB 2QX0A 3VQ5A 2NYHA 4X4SA 5KFKA 1Q82O 1X4FA 5GADI 4ZPBA 2RF2B 3B4MA 1HL6A 3WXMB 1U09A 1OKJA 2FSKA 3DDKA 4ENOA 1TUYA 2B6AB 1N32K 4DMZA 1TP7A 3I4PA 3R97A 4CJSA 4JKDA 5IZHA 4DV6F 3D4JA 3W64A 3J7YP 2VB6A 2O8EA 2YWHA 3IAYA 2MXYA 3JSBA 3TVKA 4QCLA 1NK9A 1VQ8S 1S6UA 1RZMA 3QNNA 3T9NA 3AVAA 1WG4A 5LJWA 3R1HA 2VDIA 2XMVA 1GLFO 2DNRA 4GVEA 2BJ1A 1G6BA 3O9TA 5KI6A 3IN5A 4LIRA 3S3OA 3CPWM 3HSGA 4CFCA 3M2VA 4JK9A 3CCUN 3VPZA 4DCJB 5CD4H 3TYTA 3MR6A 1Q82T 3P4UB 3Q23A 3VQAA 4H8KA 1DT9A 3A8YA 4HT5A 1TUVA 2V4JB 4FZZA 1WKKA 5ETSA 1MWZA 2VODA 3PYGA 2FC8A 4WIQA 3DRXA 4B1XB 1U1QA 3W61A 3NOCA 2E1MC 2XWYA 3SDEB 3CD5A 1CVJA 4Y34A 4H0PA 5KFEA 3CT9A 3IM8A 4CM2A 2ZWHA 4A5BA 2YKNA 1NO8A 3DDIA 2LSNA 2E7XA 4K0KK 1T3OA 3J80O 1C1BA 1Y7PA 3BSNA 4I6AA 2IAJA 1DY3A 1GAOA 1XMQF 4IYQA 1VQOS 1G4CA 1NDCA 5IT4A 3J80U 3LDLA 4OJ1A 4DFPA 4CBWA 3P39A 4KHYA 2AHOB 3LP1A 2E20A 3V1RA 2FLNA 2UV8A 2J0WA 1VHXA 2KKZA 4A62A 4DWIA 3CDAA 4DR2J 1BWVA 4O5BA 1V3ZA 1ZA1B 3CJ7A 3IA0A 2W8KA 4ZJOA 4NMLA 4F4YA 1BI4B 1T02A 4TVAB 4DR5F 1N34J 5BN8A 2F8SA 4RBUA 4L75A 1U02A 2ZGYA 2DH8A 1GOCA 4DR1K 3EGZA 5CHCB 1RWUA 1ZBUA 2HHHF 1YZ6A 3OYHA 3WIVA 4OYBA 3I33A 4A8SA 1I3AA 3NFAA 4DR3K 3RB4A 1BMQB 4NOHA 2Z1IA 2RH3A 3OXLA 3G71S 4XH4A 4OHYA 1FJCA 4L3KA 3O5BA 4B3MK 3JYTA 1M5VC 2GMHA 2VG5B 3RG6A 4O3SA 3M1FA 5DM6L 2N7YA 3EUNA 4BDYA 3CIMA 1TVRB 4KHQA 5HLFB 5JICA 2HIQA 1UCNA 1AUSL 5GAEI 3DOMB 1TKZB 2PYJA 4P2SA 1VDHA 4ED1A 2H3GX 1S1WA 3A12A 4YOUA 4G9ZA 2DHHA 2IM3A 3LUYA 3N4PA 4ED6A 4GO5X 2ZC4A 2KLAA 4CZKA 4I7FA 4E7LA 3B8AX 1IJJA 3MFIA 3IAM9 1XR5A 3U3YA 3A8IA 3TAPA 4FXDA 4QQBA 1SVDA 4O4RA 4W98A 1RCHA 5LMNK 1ZZFA 2RQ4A 3MXMA 2LEBA 4X4RA 3I0RB 5BRDA 2NXJA 3OS0A 5HRSA 1ZS6A 4EZ9A 1NRKA 3SLCA 5BRFA 4CGGA 3DRRA 4ED4A 3O44A 4G3IA 3R5GA 2Z2YB 1P8GA 1GX6A 2RDJA 2RUSA 3K9KA 3ENQA 4QU6A 3KKRA 2QWMA 3RBDA 4GKKK 4ILMA 2CQGA 5A2QO 1TK5A 3M30A 3PRVA 4P74A 3I55N 1XNRK 1NPRA 1FI4A 5AQPA 4TY8A 5HO4A 3RTVA 3GR1A 2F96A 3G86A 5A2QU 2ZQBA 2BJ9A 3VQ4A 4DV7J 5IS2A 4ANEA 2UVUA 2CJKA 2MZQA 4KHPJ 5F8IA 2V67A 3EWGA 4LF8F 1P90A 4JI4F 2KXNB 6FDRA 1X9JA 3MUMP 2FVPA 4ECWA 3KDNA 3ZX2A 2CZ4A 5D4NA 1KR4A 3GLJA 4CRJA 3QJPA 1MG7A 2LQ5A 3L7UA 1TGOA 5JUMA 2JNJA 3DGPA 4DX6A 5D3GB 1N48A 4FJHA 4GW6A 2EW9A 2MQ8A 4OLPA 2DCUB 2O3DA 2P1JA 1KVBA 2VZ9A 3H6EA 3KVGA 4IOAL 1XC9A 3VQ8A 2QG9B 3VVTA 4CCHA 3SYZA 4X84A 4WTYA 4CHNA 2LP4A 3MCSA 1WHWA 5AQUA 5L9NA 1C1AA 3G2XA 4KH4A 3MEGA 3L2WA 2R7SA 3ZZZA 1OH5A 1WOQA 4YB1P 3BO4A 3AFGA 5KFUA 4DL6A 3D6FB 1GX5A 4JK8A 1WOPA 1TMMA 1NU0A 5BR8F 4CF9A 3FRZA 2NYIA 2GMLA 4N5SA 3J7A1 5JXSA 4F7VA 2A1BA 4DV5F 2UVRA 3NXZA 2A42A 2I5JA 4F4ZA 2FLOA 4BROA 1VQ9S 3OR2A 5AQXA 2O8BA 1SKSA 2DFEA 2CNNB 3ZYYX 3VGSA 3EPIA 3D0HE 1YAGA 3RR7A 1SJRA 3CW2C 4CFBA 5F0WA 2D0PA 1GFWB 5F3TA 3E9OA 3EE8A 2VWKA 2HEKA 3F56A 3D28A 1RKJA 1BE4A 3DM2A 2BUNA 2CRLA 1ZA2B 1ASWA 2NZTA 3FGUA 2K3KA 5F8MA 1S72N 1RLDA 3LF0A 1APSA 3CJSA 4DV3J 3VTIA 1T6CA 1ZTWA 2O8DA 2MHEA 3CNQP 3EJMA 3KLFB 2I2YA 3KLHA 5THWA 2BMBA 4CEBA 1YHQN 5IWAJ 5SWMA 5EDWA 2W40A 4X4VA 2F9DA 2HGNA 3WUHA 1RWOB 4AL6A 1SC4B 5T7LB 4ELUA 1LW2A 2GO9A 5F2RA 4Q5VA 3NGYA 3KHYA 3BM7A 3EXCX 4ECUA 1RHRB 1KWMA 1Y0HA 3UQSA 3HD2A 3BGFA 5AQQA 4EP4A 1ZBTA 1Q81O 2HFOA 3X3UA 1MWYA 2AJ4A 1Y3JA 3EXYA 3ZXWA 4B17A 2BANB 4PPZA 2DB1A 4F4AA 5LJVA 2LKZA 2OPRA 4KC5A 2QJ3A 3BBFA 4DU3A 3P3DA 2JLGA 4CEQA 1WSRA 1BDGA 4QJVA 3AA8A 1JLBA 3G6YA 1X3NA 1CJVA 1CULA 3NH2A 4HKQA 3OYLA 2JC1A 3OYBA 3THWA 4KH5A 1RHUB 4JV5F 1GLDG 5C42A 1S0OA 4TNOA 3LDOA 4DUZF 1YJ9S 1T03A 2BE9B 2CVIA 2AZ1A 5E0OA 2JSXA 4OPHA 2VJVA 5ETOA 3OLBA 1HWUA 2JEFA 3C95A 4A57A 3HSTB 1HBNB 2G0CA 4WK3A 3CF5Q 1VYAA 2CIMA 3IR5B 3ULEA 2KB2A 4GMJB 3TAMB 1GK8A 1HNZK 4J9RA 2M5YA 3R1XA 5C24B 2COLA 2Q97A 3AVLA 1RBVA 1TKXA 3FRYA 2LU2A 3T3FA 5M1QA 1Q1KA 4DL0C 2DNKA 4B9NA 2W7OA 1H3DA 1U04A 2WTUA 3L7PA 1S1XA 1IBLF 1JXEA 3KJFB 1D8YA 4YEAA 1ASUA 2W9BA 5K5MA 4DF8A 3BO2A 4DCPB 2KHOA 2K8GA 1RTIB 5I42B 1X9SA 2ASMA 3TTCA 1VQKS 4GKJK 5AQWA 4C4WA 3JQKA 5JMNA 2QLWA 2E88A 2KFZA 4BCAA 1Q8LA 2IIHA 5F8JA 1HW9A 4ETZA 2HBKA 3L3UA 4CHZA 4DR6J 4ECYA 2IJFA 4DQ8A 5D0EA 2QZ8A 2QKBA 2QFIA 3ZNJ1 1U0HB 2G8KA 1KHWA 3TAFA 1NJZA 4B9QA 5DM7Q 4C3LA 3H5SA 4DI6A 3EM1A 3EEQA 5AQOA 4CI6A 3GB0A 3PHEA 3K8VA 1IKYA 1V5IB 2AYMA 2QIFA 1VSLA 4W5RA 3DNCA 2R8JA 2E5GA 2DNZA 3BREA 4CO4A 1WUAA 2F7TA 2Y0BB 4ZVRB 2PAVA 1EP4A 1TKTA 2MQLA 2G9OA 4ZCMA 3SV3A 1FRJA 1K73T 1SCJB 2XTJP 5DQGA 3W62A 1ZYQA 2E1CA 2R8KA 1FE4A 1VSIA 2B56A 2IY5B 1SV5A 1BIUA 4IOCQ 2KL8A 3U9DA 1HMVA 2IAJB 4B3TF 1YRXA 3FZFA 2YKMA 4FKXA 5M2UA 2FY8A 1NK5A 2ZDOA 3OTCA 5HP1A 4ZN3A 3LP1B 4M5HA 1VQ4S 4JI8J 4NPOA 4A59A 4OX9J 5LJ3Y 2WOMB 4DU7A 4H0YB 5IC6B 1WC6A 4NCAA 3Q89A 1WTBA 4AFFA 4MIBA 3M9OB 2C2MB 3JTPA 4R0JA 2AGOA 3HHNB 4CVNE 4DV0F 5ETTA 4K25A 4KHNA 4EYIB 3CETA 5AJ3K 5DGBA 5HI7A 3BBCA 3OHAA 3NE6A 3MEEB 4WTOB 2HNDA 4IRDA 3DHXA 2JWNA 4ZJLA 3WHIA 2FBTA 2UYTA 2LMIA 2JC0A 1YTAA 4BR9A 4LFAF 1OVYA 2E5HA 4BE1A 3QGIA 2VD3A 3WDOA 1VQ8N 4XPEA 2KHCA 1TTHB 1HNXK 2IRYA 2D1CA 5C25B 3ZZPA 1OIAA 4WPAA 4C8OA 3NOGA 2GW8A 1PGZA 2ZJPQ 4FL9A 4HUFA 2QO3A 4NE9C 5E41A 2P9SA 1DZ5A 4QWBA 2BE2A 4CJWA 3G25A 2QXFA 1B3TA 3C94A 1ZPWX 5KFDA 4RWTA 4JI1K 4F04B 3CCQS 2D9PA 4KY3A 2C2DA 4Z0UA 2ZD1A 3OVSA 4ZKAA 1HWLA 2FXUA 2DITA 3W60A 2WSCC 3K58A 3ZETA 5B0AA 1MSWD 3GP9A 5CA5A 2X1AA 5J2MB 3A4TA 3M2UB 1N33F 1OY6A 4ITSA 4WKYA 3DU6A 4RCHA 4CEEA 2M8HA 3FMBA 1SQKA 1RT3A 5E3CA 3MN9A 1KLNA 3WBZA 4Y3CA 5LSRA 4LFCK 1U1KA 3CO9A 3KD1E 2GA7A 4XAKA 5B0BA 2NXNA 5GAGU 3M8SA 4DV4J 1VAZA 3QEWA 4I6MB 3HJFA 1HX1A 4YY3J 5U47A 3BUZB 2DBBA 2ZH7A 2V2KA 2OPPB 5KOXA 1DARA 1VQSA 4KB7A 2J8AA 1FXRA 2Z1JA 4DR7J 3O9SA 4KYZA 2JVRA 4DTPA 3JTNA 3EMTA 1VSMA 1VSHA 3BGRB 3DMJA 4OZ0A 3HZ6A 4LREA 2IVPA 2ZBCA 4FJIA 4LF5F 2B43A 1XNQK 1E3MA 1NK8A 5HANA 4J90A 3G71N 2W2QP 1AA1B 4PXEA 1T9XA 1QJHA 2LFVA 3MTJA 2P9NA 4NL5A 4CLLA 2MQNA 3KG4A 4ER8A 2F8MA 4JHDA 1DKGD 4CD3A 1S9GA 1BCMA 1QD1A 2LDIA 4NLDA 4GVBA 3CERA 5EWEA 4DL3A 4JI7F 1Y5IB 4URGA 1FKOA 4CIFA 3GOIA 2YNHA 1TAUA 2RU3A 1FRIA 3OFFA 4IO1A 3SI6A 1RXOB 3ZSWA 1O1WA 1S4FA 1FKPB 2HVHA 3DLKA 3KG0A 3POTB 2ACMA 3KHLA 3G4SS 4PYAA 2B9WA 1RAGB 4QIEA 6FD1A 1HKGA 2VA2A 1JLFB 4E1JA 2H9ZA 1PJ5A 2EWSA 5HROA 4C48A 2NZCA 1QUVA 2RB7A 3L2RA 3KZBA 2FHJA 2O8BB 4DPUA 4Y1CA 4F02A 4ELVA 4BVPA 1VC6A 1BD6A 3IR7B 2DHGA 4ZA1A 3UN5A 2Z57B 2C22A 4RW8B 1X3MA 5KFBA 1U1OA 5IT9Y 1D1UA 4BWMA 1JNZB 1NKCA 4H0XB 2HNYB 3AODA 5D0RA 2AGQA 3NL0A 4JV1A 3AO5A 3W8GA 3VAJA 3D1OA 3QT6A 1FX2A 4CJTA 3F9MA 4CNYA 1ITGA 3FBEA 1S1VB 2XO6A 3T6JA 5AQRA 3FDSA 3RWUA 4DFMA 2CPHA 2AT1B 4LRAA 1UFWA 1HYSB 3CQYA 2MKIA 1QTMA 3T5LA 1S0NA 2OTLS 3MXHP 3TEHB 4CJ4A 3Q8QB 2O8FA 5BYRA 1R0BG 2CPFA 2QV6A 4NASA 2ITGA 2RUGA 1AT1B 2DR6A 1YG0A 1IVZA 4WE1A 4CEOA 3B6OA 3VEYA 2XHCA 3RRGA 2CJYB 3HPHA 1JLBB 1Q7YO 5IV4A 4FJXA 5AQKA 4LBHA 2QLJB 2BW2A 3UPFA 1KD1T 3DU5A 3DLJA 1FTRA 3I32A 4O0NA 1HR0J 3EZUA 4RNNA 3MAAA 4ED5A 3PXGa 1HNWJ 1PKUA 3Q83A 5JVGQ 5KFPA 1A5WA 3CQ8A 2PA8D 1HFEL 3V9XA 1YX2A 4JKFA 4OZNA 4FLTA 3C46A 4J5OA 5T7BA 1SJFA 2P9CA 1NWKA 4PL7A 1OMSA 2HVEA 3L4BC 2BKOA 4EMDA 3FMWA 1ZH5A 2NRWA 3HHLA 4FVCA 2D3OR 3HSCA 4X2BA 3LANA 4KTZA 3EVWA 1XR6A 1Q7YT 4ZLLA 4DV2K 3FBCA 3W9JA 1YJWS 4OQJA 4LSNB 2XY7A 2V2VA 1RAHB 3I31A 1FRMA 5AQLA 2CPXA 4DUYJ 4U9RA 1S1UB 1NKEA 3AO4A 3HOSA 5HN0A 4NXMJ 3TAGA 5FPMA 4DPYA 5LOQA 1VGYA 4DR2F 4XK8C 1OSCA 3C7NB 1VQ6S 1YJTA 2UXDK 4FJNA 2EFVA 1TFYA 3U1LA 1N34F 2EFPA 5MLCQ 2BEFA 1UPMB 2OEJA 4FZYA 3P5JA 3GIJA 1KS2A 4ICLA 3C2PA 4I2QA 1CS4B 3HKZD 1FT8A 5B0GA 1YRTA 4CGDA 3LZIA 4C9DA 4K5RA 1CJTB 3M1VA 3PRBA 1A5VA 3P31A 3PCOB 1NPPA 4QIVA 1X1PA 3M6WA 2AF6A 3HO1A 5BPMA 2AJ1A 3O8WA 1N5VA 1VOMA 4EYHB 4IQXA 1I94J 3E66A 1BIZA 3PYDA 1VLOA 2GMJA 3A1YG 4NA3A 1C1CA 2O01C 1MWMA 4JKGA 2K06A 2UU9J 4YFUA 4ZCLA 1WLJA 3HVWA 4PWDA 4B9MA 1EQ0A 3IG1A 4HCCA 2V9KA 2PA3A 1OPIA 4BR5A 1T05B 2JWKA 5I3UA 4OV1A 3DLGB 2P9PB 1RHMB 1U45A 1ZBIA 1RNHA 3R6GB 3Q8RB 2KYXA 4KPCA 4CO5A 4X4QA 3UO0A 4PG7A 2IPOB 4EU0A 1JLCA 4E0DA 2VC0A 3CULA 3E01A 5CYMA 4ED8A 2UP1A 2CQPA 4FDFA 2PN6A 1QE1A 2GHVC 3RSEB 1ZXOA 3P83D 3UR3C 1U2VA 1SQGA 2N82B 3RU0A 1NDLA 1R43A 2CXEA 4ZTFA 3V9ZA 4X66K 3M6GA 3AQOA 1OO0B 4DSLA 4X4UA 5A76A 4CYUA 2OUGA 2HS3A 4FJ8A 5DDRC 3AJ2A 5SZTA 4C11B 3PSIA 2EBGA 1IBMK 3VVUA 3F2KA 1SJ3P 3N9UC 1BHNA 3PO4A 4OLBA 2ADBA 1M1KO 1V9OA 4X4OA 5BRHA 3TUIC 1WSEA 4O44A 2ZEJA 1DJ0A 2XZWA 3R6LB 3ZZTA 3O1BA 1ZAVA 2PFDA 2P9LA 2DTUA 2FVRA 3ATUA 4JI5K 4DV7F 5E7OB 5DMRA 3OYIA 3VQEA 2W7PA 1NU4A 4GV6A 2XMKA 3CC7N 3TI0A 3VQSA 3D1QA 4JI3J 4RL1A 5LSLA 2HNZA 3ZZYA 1SKUB 2VG7B 3SUOA 4ECRA 3I82A 1KQKA 3THXB 4HI2A 4AL7A 4BRPA 2VYPA 3ZZRA 2ZZNA 2MKCA 2PEHA 2P9UB 4G1QB 4LBPA 4CD1A 1M1KT 3SCKE 3ZSQA 2BM0A 3ENAA 4HHUA 1KOOA 1NZ8A 5HBMA 4HH1A 3KLIA 5A8KB 1TKDA 4USTA 2GS8A 3LA0A 3Q8PB 4CF1A 3OSNA 2WBNA 3MFHA 3OL7A 2O8CB 1DLOB 2JDJA 2IS3A 5CCLA 1Q16B 3O08A 2GJIA 1SUQA 2IBKA 3W8PA 1DTTA 3K5MA 2QYGA 2UUAJ 4Q2LA 3TUZC 1L5UA 3ZTSA 3NF9A 5IQ6A 3H20A 2HHSA 1WEZA 4X64J 3KNAA 1RISA 2IFXA 2DK2A 1RT2B 3HFKA 3RBZA 1BQMB 4NYNA 5FJ4A 2Y3YA 2NZ4A 2NS1B 2P9KA 3R5DA 3LALA 3KG1A 3SBTA 1RTJA 3DMJB 4A8FA 4NYOA 2C3YA 3CF5L 3SIPB 3JXOA 3ZLJA 5IQQA 2K1RB 2GHWA 1RT1B 4H4OA 1UVMA 2A0FB 3G9CA 2LEAA 5DQIA 3DRYA 3SI8A 4NRUA 4FW2A 2HFSA 4M63C 2R7OA 4JV0A 5IFMA 1G1XA 2PEBA 3W66A 1VCTA 4ILJA 3GFXA 5AE2A 1W25A 1GEHA 3TAEA 4JHDB 1WSIA 1N0UA 2YKQA 3SUPA 1OYDA 1Z2ZA 4OL8A 2N4CA 2OTJS 4D3HA 2EKNA 3KKSA 5IT0A 5KT7A 4ECVA 1CZBA 4EBCA 3QEVA 2JEJA 2W25A 1PBAA 2Q36A 5T14A 2XGPA 3DLEA 1FCAA 3KJQB 2RRNA 5TKWA 3G0ZA 4WQ4C 2GVDB 1JJ4A 3PV8A 1MMLA 4Q44A 1RYSA 4ILHA 1S10A 2XS5A 3DLKB 3S3MA 2Z58B 5DM7L 1M5PC 4BGBA 3OVBA 1NGBA 3VR1A 5M1OA 2VA3A 3AVIA 3FVYA 4KHSA 3QRPA 5C2FA 2H51B 1XMQK 3SQGB 2FJVA 4LSLB 1U6FA 2V5HG 3UDLA 1MWQA 1R8CA 3FEXB 1IM6A 3D2FB 2LQJA 5AQYA 1WACA 1ICEB 4PQAA 5B0FA 4JYAK 4FK2A 3G6XA 2XNRA 2DPJA 3GIIA 1F5BA 4IOCL 3MM8B 2OI2A 1CQNA 1HIYA 2IRXA 1HBMB 3GG0A 4PUOB 5EWFA 3THVA 2ASLA 1Y4ZB 2AYBA 3H1VX 1NJIO 2C2RA 3QMQA 2HHHK 3ET6A 4IDKB 4WP3A 3PW4A 5GINA 4KBIA 2B8PA 2U1AA 2D0CA 1RWKB 3WEEB 3CFOA 2ALZA 4H5NA 1QTNB 1RDAA 2WFBA 1WC4A 3UKRB 3K5PA 2RE1A 4B1YB 3ID6A 4F4XA 3IWXA 2OANA 2OPQB 2H65B 2QA4S 2R7YA 3QO9A 2DPIA 3LP3A 2W4PA 4OI2A 2HWHA 3KUGA 3DRSA 1D9DA 3JQMA 4CM0A 3NCRA 4FVMA 4Q45A 2FTRA 3TWHA 1HW8A 1IV0A 3NNAA 2CGLA 4CK1A 4USJC 1M1HA 1CJUB 2OIHA 4E1MA 3C3LA 3DXBA 3H7HB 1FXDA 2LDYA 3E2EA 3FNNA 1QY7A 1NJIT 4PKIA 1B7FA 5EGYA 4I9LA 1DQ8A 3KUHA 3HK2A 3ZEUB 2B4UA 4NEYA 3OYFA 2CQDA 3NS5A 2CQ3A 1FKAF 3AHPA 4YMEA 1PO6A 2DGQA 1LKZA 2MSSA 2ZJPL 3I4HX 4KIAA 3I5BA 5B0CA 2WC9A 3DLRA 3F0NA 4USKA 3SXLA 1U1PA 3AVGA 3IC1A 1YIJS 3RMBA 1SH0A 2KW4A 3TJAA 4KQZA 4QAGA 2R2UA 4KPYA 3AD8C 3CTRA 3ONQA 4JKCA 3BQ2A 2AMCB 4GMKA 5L46A 3ILJA 5IXUA 1TMJA 4ZPDA 4CEDA 4PXDA 1RAFB 1UJ5A 3T69A 4O8UA 1IBKJ 4FCYA 1P9QC 1SB6A 5IT9O 2LQBA 4DOZA 2CNLB 4GNIA 4FO0A 2RQMA 5IT9U 4JI8F 4UOHA 4K4VA 3A2FA 4OX9F 3JS6A 4JI6J 2MZ1A 3U1MA 3A8KA 2D7SA 1F9FA 3UR0A 1FK9A 8ATCB 2MQQA 3CD6S 3L8BA 2EK6A 4LF8K 2QWPA 4JI4K 4CHPA 2YTCA 4KJIA 4ECZA 4C1NK 3O9UA 3GPAA 1YJUA 3OTOK 4ID5B 1A6LA 5FD1A 5HQMA 4OO1J 5KT5A 2XMTA 2V8GA 2OTLN 1JB0C 2KRBA 4J9SA 2RIJA 2VPYB 4ILLA 1MDUB 3I9ZA 1RSCA 4QYZJ 4FZVA 4IJAA 2GBZA 2DR8A 3SQOP 3VEXA 2DRDA 5C7PA 5KGWA 3DKDA 3R5BA 3F44A 3E9LA 3EX7B 4LD0A 3LQVA 2HMIA 3IBWA 3TA1A 2DIUA 1GMUA 1REGX 2L48A 1FJ7A 2DKOB 4U67Q 3OR1A 4H5TA 5A0YB 1JLQB 1VJWA 2UUCJ 2GEMA 2DNMA 3K9JA 3F73A 5BR8K 3KWIA 2MGZA 2DY4A 1RTHA 3ATVA 3C66A 3E8OA 2GVZA 4B08A 4DV5K 2W7AA 3TR5A 2E9RX 5BPNA 5H9EJ 5EUHA 1VQNN 2ZFHA 3VGKA 4L74A 2YWGA 3MN5A 2HBRB 3KJNB 3LDPA 1PYTA 1NGGA 1I3OB 1RB0A 2APOA 2IYGA 3CGIA 3W65A 4F25A 2PE8A 3C0BA 3U7JA 2JFKA 3QBXA 1ROFA 1MW7A 3Q8UA 3LAKA 1X31C 5BXIA 3UD3P 5ETVA 4AD6A 4ZVEA 5G0RA 4OZ3A 3S41A 4O3RA 4OMFG 1T9WA 1R31A 2AX1A 1S1TB 4DV4F 1HYVA 1EWRA 5ETMA 2YWFA 4YY3F 2FVQA 5L1JA 2CPIA 1VQ6N 3QIOA 1KVCA 1O0PA 3HP6A 1FDAA 4TQSA 2VBXA 3PKMA 3QJJA 3C16A 5LMUJ 1TV6B 1RDCA 2HK2A 2QWOA 2CWKA 4DPOA 4DG1A 4KHMA 2RHKA 1FEEA 1J5EJ 1WJ9A 3KWMA 2BJ7A 1UWBB 4DTNA 2ZC3A 4JYAJ 3I56N 2ATCB 4YDDB 3V6JA 2IMWP 3HZEA 3HMJG 1PYSB 4DF4A 3RBXA 1VBKA 1J5OB 2PYLA 2VG6B 1ZBSA 2BTFA 2X1BA 1XMOJ 2XY6A 1U6ZA 3D2EA 4DQIA 1VR6A 3ID8A 3JQJA 3CYMA 4CJQA 4W4MA 1JJ2M 1JKHB 4MO4A 4RWXA 1M90T 2M52A 4FZXC 5CYQA 3EO3A 2QA2A 1QM9A 1LQ9A 2FJDB 3SK3A 2DYAA 3SBGA 3WC0A 1WDTA 4OI0A 4C98A 1D0EA 4ZHRA 2D3ZA 2F5GA 2ASPA 3M8PB 2HRTA 4DUZK 4YR2A 2LA6A 1YK9A 1KLMB 3CDBA 2YJEA 1GMVA 1MU2B 4GKJF 4LF9J 3TJ8A 1IR0A 5AT1B 3OYGA 1BUPA 4C6AA 5M1FA 2DNLA 3SNNA 2DGUA 5L39A 4GO7X 4OKJA 1S97A 1LW0B 2RILA 2MYFA 3GFZA 1DQAA 3T5KA 5E3AA 1LWFA 1U1RA 4NXNJ 2AX0A 2F4FA 4BG9A 4L73A 2MQMA 2YNGA 5KQDA 3OS2A 2HURA 3HSJA 2J7WA 2P9IA 4BREA 1VQ5S 5JVGL 4TQRA 4ISGA 3C14A 1RTJB 3PSFA 9ATCB 1IBLK 2RHSB 3IDHA 3NBPA 4FLWA 3UNGC 1KC8O 2ZOFA 1VI7A 3HXMA 1B0PA 4OYXA 4FBTA 3AH6A 1S5JA 5A8RB 4ECQA 2DT9A 5F1XA 2PD1A 4CZJA 4CJEA 4YDUC 5I3PA 4RU2A 4ETXA 1SC1B 2CJ9A 3TQ1A 2B4PA 5F3ZA 2KG0A 3CDWA 1U48A 1CXQA 2V9WA 3H25A 4EAHD 1WC5A 1YVFA 3WZ0A 4AM7A 4DTMA 2MPUA 3GYNA 4M3ZA 4C3KA 1EAYC 2FDNA 4JN4A 3R6MA 5LXRA 1JJ2R 1UZDA 1HARA 3TU5A 4FWPA 1ZBHA 3NGDA 1KC8T 4RNFA 1HKBA 5J2PA 1N5SA 4NLWA 4OFZA 4H03B 3ZX0A 2HF3A 1O8BA 5C2CA 4LFBJ 4HR2A 2Z2ZA 1OWXA 3VV2B 4MKBA 1HPZA 2FPHX 5AJ3F 4CJPA 3NS6A 4AXJA 2CDQA 4HWIA 4HUGA 5GMKa 2YI1A 4RW4B 4R79A 3ETMA 4JKEA 1K8KB 3R3TA 1PJ6A 4ILGB 3BF3A 4B3TK 3IMQJ 5GVQA 5J1EB 4EFAC 4H4MA 5D77A 2XY5A 2XLKA 4F67A 4YS2A 1EETB 3NGSA 4ECTA 2WB1D 3DXMA 3TW0A 3U9ZA 4CJKA 2VPZB 3IWNC 2LCWA 1HNXF 5GAHU 4N8NA 4NLXA 5AXMA 3MEKA 3E9PA 1RBLA 1HNWF 2FIUA 4AHUA 1FERA 1N8RO 4HLBA 1SQEA 2Y9HA 2KN4A 1E4FT 4OZ2A 3KYLA 4Q0BA 5A6WA 2RS8A 5EN1A 3OD2A 3J7AP 5AZIA 4ZIVA 5H1SV 3VGUA 3A3PB 4C8ZA 2BYCA 3FFIA 2G2ZA 4RW6A 4IFVB 2C2EA 2HMPA 1ULRA 2VUGA 4CGIA 4NB4A 4LFAK 1BCOA 3QGHA 1FD2A 2XSJA 5A8WB 4FF1A 3QO9B 1Q5VA 2IC3A 1ZAXA 1HNVA 1LWEB 2BQRA 1JL2A 4DUYF 3VHQA 1DURA 3K7RA 4FN5A 4BVOA 1Q8BA 3TZZA 1T9YA 3UD5A 4WIIA 3MM5B 4B3RJ 4ZVFA 3Q2TC 5E3RA 2ABYA 4NXMF 1NOYA 2OTJN 3AA4A 1Y10A 4S0MA 2V0NA 1S4EA 5KG0A 3DXSX 1RT4A 3L3CA 4J9UE 4OPAA 8AT1B 4KREA 4X62J 5EU7A 1C0TA 3NF7A 3G8TA 1VQ7N 1UWAA 2VFSA 2RU9A 5GADP 4HUEA 3IBCB 3OBWA 1R8PA 4YUDA 1GLLO 2YNFA 1GH8A 2F4VJ 3GILA 1BC6A 1N33K 3VENA 1LV5A 3MDQA 1I94F 3FSIA 2HSEB 2E44A 5LL6Z 2OD4A 3LWLA 3AOAA 3FC9A 1T0TV 3PYFA 4Y0WA 5G4DA 2UU9F 1XNQF 2KZMA 1WF2A 3O2IA 4FPIA 4LY7A 2X7IA 3A5OC 4BG8A 4M5LA 2DO0A 5GAEU 2FC0A 3IGVA 3LPEA 3V9WA 4C7QA 4K4WA 3AJDA 4CZIA 4J2DA 4W5TA 4EUVA 3PUFA 2VWBA 3EGWB 4IFEA 2VBZA 2C2ZB 3AVJA 4CLFA 4J2AA 4FLYA 4NLTA 2RRBA 5IM0A 2E9TA 1RT5A 4RW7B 3FKBA 2JX2A 2VBWA 3D6RA 5T41A 4K42A 4BRLA 1RHKB 2QA1A 4LF5K 2AQ4A 2C2OB 5ETRA 1QQCA 4E98A 3AVCA 2GGPA 3KMSA 3DRPA 3JSMA 1C4CA 2Y8WA 1PSDA 2XLJA 1RTDA 3J7ZT 3BQ1A 3EZWA 4OPJA 2R7TA 4HYKA 1LNQA 4G65A 1WSVA 2A1RA 4IH6A 1VK3A 1X4EA 2JFDA 3SZ2A 3MMBA 4MK7A 1RBRA 5F8GA 4OHVA 1W7AA 3NLCA 1W0HA 1I1GA 2E5LJ 3FZBA 4KSEB 2LECA 3CJCA 3KK2A 3MM9A 4JI7K 1HQEB 3VN5A 1NGFA 3BSCA 3C6UB 4IO8A 3R5CA 5AQNA 4EEYA 5K8OA 4CFDA 3QAEA 2KO1A 1VRTB 1FA0A 1WEXA 4WP8A 4JI3F 3NRBA 3I55S 4AHTA 1X4DA 2KI2A 3QEXA 2YHWA 1JMTA 2QE5A 4FBUA 4Z37A 4BC4A 4J9MA 3M2RB 3WX4A 3BYPA 2NRTA 4P6QA 2ZBPA 3IFEA 1P27B 5M2PA 1VHFA 1W97L 2HGMA 4XEIA 4QYRA 4FKYA 3PW5A 2PI4A 1O51A 4KTWA 2W9CB 5KRSA 4A8YA 3GJRB 4Z7CA 3B82A 3D2WA 4RBTA 5H9FJ 4AQYJ 1HNIA 2MDAA 3T5JA 2M3DA 2J9EA 3DC2A 2Z1HA 4W5NA 2UUAF 1IKWA 3CD6N 4K41A 4X64F 3IS9A 1S79A 4CW7B 3BR8A 3I8BA 1BQNB 4B3SJ 3RRHA 5HMZA 2NRHA 4K8ZA 2P8IA 3QINA 4F50A 3U3GA 1REVA 2ZH3A 4W90B 2NRZA 5HJYA 3CJ4A 3BN4A 4B3OA 1XUPO 4JD2B 2J4RA 4WQ5A 4HHTA 2NSBA 2I6WA 3BEGB 4U7UK 1QHAA 4J9VA 4CLWA 2VFRA 1SJ1A 2IOCA 3MEDA 2XZDB 5CY4A 1IKVB 3M6UA 2Y8YA 2JOQA 2FHKA 3M8QB 2M2BA 3HHLC 3MM6A 2CFXA 1U25A 2ZDPA 3O5TB 3LGNA 1X0FA 2OELA 4OX8A 3QICA 1WI6A 3FR0A 1S6QA 1RYRA 1F9EB 2GIFA 3O4NA 4IFYA 4KKOA 1NJXA 4KV8B 3H1QA 4DN0A 3GV8B 1UKUA 4LF4J 2VV5A 1XMBA 4FM1A 4F3QA 2RPIA 2UXDF 2L9DA 3UN3A 4BQZA 4IRKA 1PG5B 3MAHA 1RI7A 2VPWB 5M2RA 1EQMA 1Z4UA 4F4WA 1RU1A 2QTWA 4J9LA 5ETPA 3Q2SC 1JXVA 1V4TA 3OVAA 5BYSA 1MN9A 3MMAA 5AQZA 3N4WA 5E33A 3W2VA 3BO3A 2W6LA 5HQLA 5LSOA 3WQPA 4FYDA 3VAFA 3CCMN 2R8HA 1TU0B 2YJFA 3V4IA 3FQKA 4R8UA 4LT6A 4BHQA 3NWGA 4DR2K 2YNIA 5EX3A 5KFZA 3CG7A 2EVZA 2XBPA 4FWLA 1LWCB 1X4HA 3KLEA 4FWMA 1K0VA 4CIGA 1YRUA 1H74A 2DH9A 1N34K 2ZZTA 4M94A 2NXCA 3TEGA 2AD9A 4K2JA 2YQ3A 3CJKA 3RR8A 1FRKA 3NAHA 4HT7A 2IM2A 2VU5A 2YKPA 4H5WA 4RNHA 2RJZA 3N0VA 2QFJA 2NXEA 4B8AB 3CCEN 5K14A 4NYZA 2BKNA 2MKKA 3L95X 4B9TA 2PC6A 4FJGA 3MD1A 3ICLA 5DRKA 1HWIA 3TVZA 2QSFA 4BGAA 4QIWD 3VEVA 3FZLA 2Q6BA 4X66F 2K7KA 2UUBJ 3J7AN 3AT1B 4DJBA 3WIUA 4M3UA 4QR2A 4BRHA 1S99A 3MPYA 2YY3A 1AB8A 1IBMF 5BPLA 2Q79A 3BKTA 3CVKA 4WU2A 1JWWA 2NPIA 3J7YU 4AHCA 3DN9A 1S57A 2R3VA 3CD7A 4DS4A 1DGKN 1X9MA 1UFKA 2V4QA 2AYEA 4U67L 3GE9A 4CLSA 3MECB 4HEA9 2R2SA 1FRLA 5ETKA 5L38A 3R8YA 1KFSA 2OGUA 3DFEA 4N8OA 3IFRA 2ZHBA 2Q3PA 3KFWX 5DGAA 1X7VA 3UCUP 3HTVA 2IVMA 2X51A 4ZTJA 5CCMA 2GZOA 5ETQA 3CDUA 1HI0P 4HACA 1PIEA 4IH5A 1HD0A 3FGVA 5KT6A 3PYEA 3CCZA 1LFPA 4ZITA 4CLTA 4U8YA 4Q43A 1WG1A 3IXQA 3TX8A 2DNYA 2OMOA 4X65J 3FEZA 2YH0A 3R1LA 4JS4A 2HBYB 2CPJA 1NM2A 4JI6F 5DDPC 1JLEA 1RT7B 2PMHA 4OLOA 2OD6A 2FF3B 4PPDA 5FDLB 1GLBG 4DV7K 3NVMA 4FWNA 4KHPK 3M8RA 4PXBA 1GT8A 1FJGJ 4BE2A 2IIRA 3HI9A 5KPTA 2P6TA 1RT4B 1BA1A 2M8DB 1S76D 2NNWA 3JSRA 3W7BA 2VQEJ 4A8MP 1UW9A 3HFVA 5D4OA 3DXKA 4PCQA 3QIPB 5CD4A 1K0TA 1BUXA 4OVLA 4O5FA 2WVEA 2DIVA 3V1OA 2UXBJ 2HBQB 2X3GA 2ASYA 3V81B 3V6KA 2MKJA 1N56A 4R0EA 2QXLA 4KO0A 4DHVA 3RVCA 2W41A 3JS9A 5J2QA 4JLHA 3NGIA 1EO1A 2BRLA 2G13A 1H1VA 4ZPVR 2B5JB 2XCAA 2GQCA 1RBSA 3O3FA 4ANDA 3CJRA 1F5AA 4I2PB 1SIZA 3NGKA 4GV3A 2KM8B 3CXCM 1CPZA 3SBMA 2UUCF 3TOQA 2M4MA 2GUIA 3DYAA 1IJEB 1U2FA 4LVOP 3IAS9 3KLGB 3BP8A 3R9LA 4BQLA 1IKXA 4ALZA 3NHGA 2E29A 1V4SA 4P10A 3OFGA 2DR5A 3H46O 5HJXA 2G2OA 2GQ2A 2R42A 5ELZA 4C8LA 5IM0B 1RT5B 2YX1A 4HI1A 2ZWPA 2XO7A 1RUSA 3GCXP 2P9GA 1E6VB 4HVJA 4D3GA 4CECA 4A47A 1HPMA 4OJGA 1AZSB 4K4YA 3VETA 2G1HA 2FZKB 4GVMA 2P2CB 4M63A 5A6PA 4R5PA 4NA1A 3PJ9A 4A2AA 2IYIA 1GOBA 1NGJA 1JLGB 2OLWA 3GU0A 2R8GA 3IKMA 2XGQA 3FUYA 4DV6J 5FPEA 1RT6B 2A3JA 4DV3K 4RKUC 1NDKA 3A8EA 3M32B 3AVFA 4ISEA 4BRNA 4UOGA 2YHBA 4PQUB 5LMUF 1KCFA 1IN0A 5IWAK 3GFHA 3M9MB 1GXTA 3O8MA 4JYAF 3GE1A 4LSZB 5AQMA 1C0GA 2DR7A 3MM7B 3R7BB 3NF8A 5F0UA 3AVNA 1KONA 4WQ4A 1VJQA 3GZ7A 2WUSA 2OPSB 1WF1A 3HF5A 2V7ZA 5ETNA 2H4YB 5I9EB 3D3CJ 2Q6CA 2WB4A 2M7SA 3C6TA 1XMOF 3R8EA 3IR6B 3HKWA 3VQDA 1EIYB 2KFNA 4LR9A 4PYDA 4RW9A 1TL7A 3CC2N 3CXCR 4MH8A 2Y1JA 4FXWA 1L3UA 2DNNA 4EIAA 5JMVA 3SMPA 4BC9A 1QAJA 2PFUA 5IV3A 4OJRA 4HTUA 1JLAB 1N36J 1A0OB 3PJXA 2CNOB 3GMGA 1H73A 1RDBA 5K9FA 3CIPA 3LPTA 2Y1LB 4KHWA 4P7TA 1UP1A 1S7HA 2VPXB 3CMEN 3H45C 3HL8A 2ZE2A 2ZKUA 4DR5J 3VQPA 2JZ5A 4NXNF 1GLJO 3G82B 4E2FB 2D3O1 2D0BA 1S6PA 2MLZA 1GTHA 4H0OA 2BGGA 5C15A 3RMAA 4LF1A 4FJ5A 1RHJB 1FFGB 2BH1A 1NOZA 2OP5A 2BR0A 3I0SB 1CJKB 5AQTA 3EVMA 2HHPA 4JI2J 4CK2A 5E84A 3V5RA 3NGZA 1SL0A 4NO7A 3EPGA 5E5NA 3OYMA 5GMDA 2H1YA 2HAFA 1IM4A 4DR6K 2N7CA 3AA3A 1RHQB 3TRGA 2ATLA 1K8AO 2WCXA 3BZCA 1T3VA 1S6QB 3Q22A 3KK3A 4UT4A 1VRUA 3TWZA 2NLWA 2OYQA 3OYDA 3CJTA 4MDAA 4WFXA 3QGPA 1ESVA 4CZMA 2OEMA 2GJ2A 2KKHA 1R0AB 4N7TA 5KG2A 1NHUA 2PGCA 2I9SA 4NCGA 4DFKA 4NI2A 3U6FA 1W2IA 4WCEQ 3J81j 3VCDA 3HM9A 3I87A 2JGUA 3BSAA 1IG8A 4CJUA 4O4GB 1NB2A 3CJ2A 4LBIA 1GXUA 1C0UA 4Z4FA 2HZAA 3OTOF 4EBDA 1S9EA 2JH3A 4E89A 4Q2MA 3UVJB 3VAGA 4PAAA 4I6WA 5D78A 4FJKA 4J7CA 4NA2A 3T19A 4ZMMA 3SEOA 3SFGA 3HVTA 4XH1A 2QLBB 4OI3A 1N5YA 1U1LA 4F0KA 1M1GA 1MA9B 3MOZA 5DLFA 3MN7A 1GLEG 2BE7D 2NXUA 4IH7A 3FJ2A 4EBEA 3VMFB 1LK5A 3KK1B 3D3BJ 1RTZA 4U8VA 3VZIA 5AQFA 1UJ4A 2BOPA 3JB9k 3V4IB 4ZPCA 2L3MA 4JI8K 5JS1A 2KXFA 3C15B 4OX9K 1G3OA 2E7VA 3LTOA 3ULDA 4NLPA 1SQFA 1D9FA 3RMCA 2HLTA 1NSQA 2RKIA 3HHEA 3ILIA 1XERA 4ZN1A 5KFWA 4BR4A 1N6QA 1RDRA 2KT2A 3CUNA 1TR0A 5F9LA 2QI2A 1TYQB 4W5QA 4ERDA 4BBYA 3QRRA 2G8FA 3IMXA 3LP0A 4M5KA 4ED7A 4ED0A 1PAUB 5MLCV 2GV9A 3AQPA 4TSXA 4LMZA 3LPYA 2XCPA 2KRRA 2F63A 2B4OA 3WNHA 1WN7A 1RWMB 2MZSA 1YBUA 4IJNA 1U24A 1YBTA 4DQQA 1VQLN 3AXMA 4G1PA 3LP2B 4I6YA 1S49A 3W2WA 3ZTOA 3D6HB 2YQ1A 4LR8A 1VBZA 1XBWA 4ZVPB 4NLUA 3E3XA 2EHGA 2XRIA 1OQ3A 4AILC 3VQ9A 4WK1A 2W8LA 1MN7A 2E2NA 3SAGA 2QWNA 4FJLA 3ZTQA 3AOBA 3HI0A 1SIWB 3DLBA 3ENWA 5AE1A 2RMLA 3W5YA 2VWJA 2PBDA 2I1RA 2HFNA 4Z4GA 2WVDA 3IM9A 2OKQA 1XI1A 4X62F 3VA0A 2VKRA 1YF5L 4FW1A 3SFUA 1TL1B 3NY0A 1JCGA 3CFPA 2CH6A 1ACMB 4OZLA 3CMAS 4B1ZA 3NVKA 1SS6A 4HTIA 2FF6A 2NRVA 5ETLA 2F4VF 1T9TA 5AZJA 4H54A 2VICA 5I4MA 5HL7Q 2V8DA 3IRXB 3DI6B 2C3OA 1N0VC 2K2PA 1Y64A 4LF6J 2KZZA 1E6YA 2B0GA 4UY8O 1MROB 1NHVA 4IOBA 4K4XA 1U8WA 1U26A 4RZRA 3HT0A 1GLAG 3IGNA 4GC6A 3V6DA 3V9UA 5KQ8A 4KGXB 4FYVB 4DV4K 3D6MB 3FK4A 1CLFA 4YY3K