2B5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 133
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b5jA05
2IAJB 1L3SA 3JYTB 2FJXA 2GIQA 4CEQA 1IH7A 1DTQB 3ZT3A 4CERA 4PUOA 2RKIA 4ZVGA 2B5JB 4B9LA 5KFDA 3O4NA 4TQRA 3RMAA 2P5OA 3LP3A 4OGEA 1S6QB 4CECA 4RNMA 3PO4A 4ZTFA 4CFDA 3E51A 4ED1A 1N6QA 5KRSA 4IFVA 5EWFA 4M3RA 4LSLB 3ULDA 1FXXA 3QZ8A 2D0CA 4CJ5A 2YHBA 2VA3A 1BQMA 3B6OA 3VQ5A 3RBDA 4C8LA 2D7SA 4ECYA 2VWKA 4DSEA 2BGGA 4KHQA 2NUBA 3BGRB 2WONA 4WZMA 5F8NA 4CIFA 2O4IA 1LV5A 3LP1B 1C1CB 4U7CA 3OYBA 3RWUA 3OYJA 4M42A 2UVRA 1HNIA 2X74A 2HVHA 1ASWA 4FM0A 2HNYA 3OYMA 3N6MA 4DTMA 3OYNA 1ASVA 2FLNA 4CEBA 4ZPCA 3ZSYA 2KFZA 2FVCA 4CESA 1HMVB 2ALZA 1DTTA 3VQ9A 1LWFA 4CEOA 2I1RA 1RYRA 2HHVA 2XWYA 3NKYA 4I2PB 2Z1IA 4KB1A 1QTMA 1D9DA 4KV8A 4F4WA 4IG0A 3NF8A 3BSAA 3H5UA 1UA1A 4DQQA 4J9KA 2IM3A 4QWAA 2EHGA 4FJ7A 3DOKB 3PX4A 3E01A 1N56A 1LWCA 4KRFA 5DG9A 1C0MA 3CM6A 3TARA 3HPGA 4J9RA 1NK6A 1RYSA 4DG1B 3I5BA 3WNEA 4K4XA 4ED8A 3L2RA 4DSFA 1X9SA 3RRHA 2AQ4A 1SL1A 2ZD1A 3KLGA 2D3ZA 3G6YA 2E9ZA 3VQQA 4M3XA 1RBRA 3HSTB 1JL2A 4E1NA 2PYLA 4F2RA 4KHWA 5HROA 3IRXB 4I2QB 3SI6A 1EP4B 4U6PA 4IH7A 4K4ZA 4B9UA 4ECSA 4KHRA 1SKWA 5J2MA 5SZTA 3C6TB 1RT3B 2FJVA 1C0UB 1L3UA 1D9FA 4B9SA 1RDDA 1HYSA 2W9CB 4CGGA 1T7PA 4ZPAA 1BHLA 5F8IA 1S0OA 4DSIA 3IS9B 3ZSOA 2HNDB 3AO5A 4CIGA 4NCGA 3HPHA 4PQUB 3CJ3A 2DFFA 5J2PB 3KJVB 2G8FA 2G8HA 3AO3A 3TABA 2V9WA 5F8JA 3RMDA 3I8DA 2JEGA 1LW0A 1WLJA 3K5MA 3SUNA 1WAFA 4MIAA 2YNFA 1QAJA 4FLVA 2W8KA 4IG3A 4DU3A 1IKYB 1HYVA 3QEXA 3OS2A 2BE2A 3SZ2A 4M41A 5EWEA 1K6YA 1S4FA 4H54A 3OYLA 4N47A 2R8JA 4DFMA 3M8PB 4O0IA 3CDWA 1Z4UA 1WNSA 4FJXA 3O3FA 4WZQA 3CFPA 3NBPB 1NKEA 2OPQB 4NCBA 1RT4B 3DLKA 4IR9A 3PX6A 1YT3A 5K14A 2R8IA 4ZP8A 4ZVHA 3BSCA 3HVRA 2HB5A 2G8IA 2RF2B 4DQSA 1JKHA 3CO9A 3GIJA 4E1MA 4B9TA 2W9AA 4RW8B 4O3RA 3P83D 3V6DB 4NLWA 1IO2A 3M9OB 3SCXA 1T03B 2VG6A 4TYBA 4KKOB 2EX3A 4HUEA 2VG7B 4CCHA 3PJWA 3RMCA 4RW6A 3HVTA 4EP5A 3QEIA 2FBYA 5L1JA 3K2PA 2YNHB 3MFHA 2KFNA 5C42B 3VQEA 1IKXB 4RW7B 3TAQA 1JLGB 5F8GA 2WB4A 2GBZA 4AHSA 3OHAA 2XC9A 3LP2A 3BQ0A 4Z4FA 1IKWB 4N56A 1QE1A 4C8KA 1GOBA 3OSNA 4Y1DA 1RT6B 1VSHA 4KI6A 4DL4A 3HK2A 4CGIA 1JLAB 3KHLA 4J2EA 2AJQA 1JLQB 1RTJB 4IDKB 2G8UA 3M8QB 2GIRA 4HUFA 4DL5A 4WE1A 4TYAA 1BIUA 2HVIA 2ZE2B 1TKZA 5HRNA 4RW9B 3QO9A 4MK9A 3CWJA 1XWLA 2XHBA 5KT5A 1ITGA 4O4GA 3OSPA 4L8RB 2I5JA 3ITHB 4BE0A 3DLEA 2YNGB 4M3TA 2XGQA 2XY5A 4CJUA 3SUOA 3AO2A 5KFFA 5KG1A 4F8RA 2BRLA 2G8WA 2HHSA 4HCCA 3SQ0A 4Q0BA 5KG0A 1Z25A 4AILC 2VG5B 4HYKA 2C2RA 1CSJA 2HHUA 1RBTA 4DF4A 4KTQA 3KLIA 4HCBA 3OLAA 3AO4A 4H4MB 4URGA 1MU2B 3V9ZA 4OKEA 3RTVA 3K5LA 1JLFB 4GMJB 4XO0A 1S1TB 2WRMA 1RT2A 4M3YA 4ID1A 1VRTB 2WOMA 2X78A 1TK5A 2QKKA 4H4OA 4AHCA 3ZSVA 1RTDB 3FSIA 4E0DA 3AVNA 4FBTA 2Z1HA 3BSOA 1D5AA 3KHRA 3MECA 4CEFA 1U47A 3T5JA 4EBCA 3V1QA 4ZHRB 5C25A 5D3GA 4IQXA 1EX4A 1XC9A 1RTIB 5KG2A 4FK0A 5FDLA 3DLRA 4PWDA 2W9BA 4K4WA 4QCLA 1VSFA 4CHYA 3O4QA 4CK3A 1TKTB 3SFGA 4AHRA 5DK5A 5KFLA 3NAHA 1XHZA 2ATLA 4MKAA 1J53A 3I0RB 3KMSA 2JC0A 3OYFA 4OLBA 4WXWA 1TL1A 4ZVFA 1I6JA 3HXMA 4EEYA 3HYFA 1JLCA 3DRSA 4FJGA 2B6AA 1J5OA 4CF8A 1Z26A 1TVRA 3CIZA 3WNHA 4NLPA 3G6XA 4MFBB 4AHVA 4IKFA 3HVAA 2HMIA 1CLQA 3KHGA 2JLEA 3TAFA 4CJPA 3TAMA 3AVLA 4OVLA 4IOBA 4ZPBA 2OYQA 3UPFA 2UVWA 5I3UB 1C0TA 1VRUB 4DS4A 4DTUA 4CEZA 5J2NB 3BR9A 4F4XA 1B9DA 2QKBA 1EETA 5CYQA 1FKPB 4E7LA 4J2AA 2IM1A 4GVMA 1ZBIA 1TKXA 1TAUA 4J9PA 3DOLB 3KKRA 5KT3A 3RB0A 1HYZA 1YTAA 1VSLA 5DGBA 3ZT0A 1KHVA 4B9MA 2D41A 2GUIA 5KFNA 3NAEA 3FFIA 4TY9A 2PY5A 4DU4A 4TXSA 1NJZA 1S9EA 5F8HA 4FJJA 4CJTA 3MR6A 2W42A 1KLNA 4CJRA 3NE6A 1DLOB 1S1WB 4HHTA 4DTNA 1CXUA 2A1SA 3ZCMA 3V9UA 1TL3B 3S9HA 1HPZA 3KLHA 2HHQA 4QW8A 3C6UB 4AHUA 2BANB 3F9KA 4CE9A 3MEDA 3KK1B 3PO5A 3KK3B 4URQU 1JLEA 3PHEA 4DFPA 4Z4HA 4M3ZA 5KFWA 5KFMA 4FCYA 3SJJA 4KFBA 2FJWA 4PUOB 1HRHA 3G6VA 2RKIB 4QAGA 2HHTA 4R8UA 4FJIA 4BE1A 5KG7A 4JV2A 3NH2A 3TANA 4CGJA 4C8OA 1C1BA 3NH0A 3KK2A 2DY4A 4RW4B 3KLEA 3OL8A 1XR7A 2ETJA 1QUVA 3RB6A 4FBUA 1KVAA 4ECWA 3V6JA 4OL8A 2AX0A 2CKWA 4FS1A 2YHAA 3EY1A 4DSJA 1S1XB 3LAKA 4IFVB 3T5LA 1YTUA 4KBIA 4OPKA 3THVA 1MMLA 4TSXA 4CJ3A 4F4YA 1VSKA 3AVAA 4IRDA 5HBMA 1GX5A 4KAZA 4KTZA 1RDAA 3HP9A 4CJVA 1ZBLA 1SL2A 1S0NA 3AVKA 3OS0A 1BQNA 2UUWA 4G1QA 2OZMA 3JSMA 2E6MA 4YQWA 3M9NB 2C28A 2XCPA 3V81A 3MEEA 4WFYA 2YKNA 1HNIB 4KREA 1WSEA 3I0SA 1ZETA 4W5NA 5KFVA 3QEPA 2FBXA 3DRRA 4FLWA 3GV5B 4CJEA 1IM4A 4K4YA 1XR6A 2IA6A 2FVSA 3RMBA 3NFAA 4O5BA 4C8MA 1J54A 3DRPA 5L9XA 4Y34A 3AVHA 4ECRA 3PW5A 1RT7A 4LQ3A 4KE5A 5JS1A 1S6PA 3LP0A 2JC1A 1RBUA 1LAVA 4EYHB 4YR0A 4WYWA 4B3OB 3EZ5A 4CJWA 4YP3A 1IKVB 1S1UB 1NK9A 2HHWA 1B9FA 4OPJA 4FM1A 3AVCA 3HL8A 1HNVA 3GIIA 5KT2A 5DG8A 1OS5A 2Y1JA 1QHTA 4BACA 4J9NA 1TKDA 2Y1IA 4DQIA 1NK4A 3MXIA 3ASMA 2VWJA 2X6NA 3E01B 3ZSXA 4FLYA 1NK5A 1LWCB 5HLFA 4F4ZA 4BDYA 1UAXA 2IAJA 3T5HA 4NLYA 2AGQA 1DTQA 2A1RA 3LANA 2XI3A 1WNEA 3SV4A 4YFUA 2OPSA 4N76A 1RBVA 2Q3SA 3AVFA 2FBVA 3KLGB 5KG6A 1ZTTA 2QK9A 4AHTA 1KHWA 4LH4A 3MAQA 1YVFA 2P5GA 1S6QA 3M8SA 4TY8B 4HUGA 4FJHA 3K5OA 4CK2A 1JXLA 4JV1A 1JLBA 3CFRA 2JEJA 1HARA 3PV8A 4MK8A 5J2MB 1U48A 5DLFA 4ED0A 3OYKA 4ZVEA 3RAQA 4ED6A 1HYSB 1U09A 4J9SA 3UIQA 2BRKA 1VSMA 4DL2A 2XCAA 4FJ9A 2F8TA 3L3UA 5EWGA 3S3NA 4DTSA 3SFUA 4PY5A 3LP1A 1C1CA 3U3GA 4E3SA 3GV8B 1S1VA 1LW0B 3MR5A 4M3UA 1N5YA 5KFGA 2YNFB 3V4IB 2IC3B 4IG3B 3GIMA 4DEZA 2OPRA 5KFJA 3T1AA 3N6NA 3H5YA 1UA0A 2BE2B 4FM2A 1WAJA 4CIEA 4O3QA 2JGUA 1RT1A 5DGAA 4FJMA 1W25A 4Q8FA 3CVKA 2WTFA 4CFBA 3WNGA 3V1OA 4KO0B 1CXQA 1WSHA 2LSNA 3EZUA 1HMVA 1NNDA 4RUCA 2W7OA 1ZBHA 2D3UA 2BR0A 3GV7B 4EBEA 5DG7A 3QIPB 3CYMA 4K4VA 4O0JA 1BISA 3KMQA 3DLKB 4CGHA 2FVQA 1F21A 4KB0A 4DFJA 4FJ5A 5K14B 4IFYA 2QXFA 4J9LA 2IOCA 3BSNA 5KT7A 3H40A 5C5JA 1JKHB 3DOKA 4NLDA 2ASLA 2C22A 3VQ7A 1HQUA 4E7HA 4NLUA 3RRGA 4JV0A 1L3VA 1RAJA 1R0AA 3KLVA 3NGYA 4K8XA 4YR2A 3FRZA 5KFSA 4RW6B 4ECZA 3V9WA 3S3OA 4NLXA 4IH6A 4ELTA 5JXSA 2OPPA 2X6SA 2WCXA 4LD0A 3DLBA 4KHMA 4F50A 2BDPA 5J1EA 4DTXA 3KLFB 2XRIA 1QE1B 3DM2B 3UQSA 1VSIA 1CZBA 4CEEA 3BQ1A 5E41A 1C0UA 3OY9A 3H5XA 4WE1B 2HWIA 2W9CA 3QNNA 5CYMA 1TKZB 4XPEA 3QO9B 4KI4A 3IS9A 3L2WA 3KNAA 2HNDA 2ITGA 2ATQA 4DQPA 3PW0A 3PW4A 4O4GB 3VQBA 5FROA 3VQ4A 2I5JB 3DLEB 2DFHA 3QESA 4CJ4A 2HW3A 4EYIB 3T19A 1LW2B 2HNZA 2IMWP 2IDOA 1SV5A 1U4BA 5C24B 3LAMA 4I7FB 4HVJA 5J2QB 3NAIA 4LQ9A 4Q0BB 2ZKUA 3OYHA 4NZ0A 3SQ4A 3FQLA 3NL0A 4ECXA 3OYCA 3EPIA 3KLIB 4ECQA 4CF1A 1HQEA 4B9NA 1UWBA 4ICLA 2XY6A 4CF0A 2WHOA 3EYZA 3OYIA 2E9TA 1RT2B 3MR3A 4CF2A 1JL1A 3NBPA 4E89A 4DF8A 3CDUA 2WOMB 4CHZA 3AA2A 1G15A 2OPQA 1NK0A 4H4OB 4NLRA 3SI8A 4CK1A 1S97A 1TK8A 3NDKA 5HRPA 1T05A 1KFSA 1TAQA 3DMJA 3QIDA 4GC6A 3VN5A 3I5AA 5KFRA 3L2UA 2RF2A 3IGVA 1W0HA 5C25B 3BDPA 5KFAA 3V6KA 3UDLA 1NHVA 4N41A 2DTUA 3N6LA 2W9BB 3OYAA 3LDSA 1RBSA 1T03A 1XI1A 4LSNA 2AWZA 5KG5A 1FKOA 1IKXA 2XGPA 5KG3A 4NRUA 1JLGA 5KT4A 3S3MA 1TL1B 3BREA 3VQ8A 3SUPA 2F8EX 2E4LA 3DRSB 4DSLA 3H4DA 1TVRB 3OYGA 3PZPA 1T3NA 1JLAA 3KIOA 2HMIB 1SH2A 4KHNA 3QIOA 2KZMA 5KFPA 3VQSA 4K4SA 4W5RA 4JS5A 4KHUA 3L2VA 3TAMB 3DI6B 1S48A 5FRMA 3HVWA 4CJSA 1TV6B 1C0TB 1RA7A 1QS4A 2C2EA 4J2DA 1QQCA 4J9QA 4E7JA 3ISNC 3OL6A 3V6HA 2ASDA 3VQ6A 4X2BA 2QE5A 5CYQB 4BWJA 5KFOA 1T8EA 4KAIA 2PZSA 1TKXB 3D5MA 2YNIA 4HKQA 4AH9A 4F4KA 2ILYA 3AA4A 2ZQBA 3F73A 2YV0X 4F2SA 1KTQA 3V9SA 1KLMB 4F3TA 3KHHA 3FFIB 3G86A 5EUHA 1RDCA 3QETA 4ZP7A 1VSDA 3TI0A 1T94A 3C94A 1S9EB 2YKMA 2OZSA 3B6PA 4FK4A 2J6SA 3FQKA 4JLHA 4PA1A 3TAEA 1A5VA 2XY8A 5CY4A 3H4BA 5KFCA 1BI4A 3IGNA 1VRTA 3MFIA 2P51A 4NRTA 4RU9A 2KZZA 1Q8IA 1HPZB 3KLHB 1FK9B 5KFHA 3MEDB 3CJ2A 3KKSA 4JRQA 4DTJA 3MXJA 3EPGA 3MEGA 3Q8PB 4GW6A 4KFBB 5F8LA 5KI6A 4ELVA 4BE2A 3U6FA 1S49A 2F96A 3TAPA 4FS2A 3SNNA 4R8UB 4RUAA 4RNHA 1RTHB 4O44A 2XI2A 1RTIA 1QSSA 1SKSA 5FRNA 2R7YA 1C1BB 3RBEA 3KK2B 3ZSZA 3KLEB 4ZTJA 1TKTA 4E7KA 4M94A 3DYAA 1RILA 2FVPA 3MTKA 4OGCA 2XO7A 1S9GB 1BIZA 1XHXA 5KFZA 3LZIA 3I0RA 5HP1A 4M95A 3LPTA 3SPYA 1NK7A 1U45A 4CGFA 5HBMB 5KFYA 2IS3A 5KG4A 3Q8QB 4R5PA 1X9MA 3M9MB 1RT5A 4DTOA 1BQNB 3Q8SB 4G1QB 3JSMB 4DL3A 3DLGA 2KTQA 4IKAA 1REVA 2R8GA 4J9MA 4KPYA 5KT6A 4CJQA 4DWIA 4K50A 4ECUA 3VQCA 1VRUA 4MKBA 3NH1A 3I0SB 5J2NA 1WSIA 4RG8A 3DRRB 1LWEA 1FKPA 2IM0A 4RNNA 4TN2A 1N48A 4NYNA 1N6QB 3DRPB 1RT7B 1TQLA 4KHSA 1KSPA 1S6PB 4CJKA 3RR7A 1BQMB 1QAIA 1X9WA 4B9VA 3KOAA 1O1WA 4K8ZA 4JUZA 1WSFA 5DQIA 5L1IA 1C2PA 1HNVB 4ID5A 5KFTA 4EO6A 3D0PA 5KFEA 2DPIA 3HHKA 2WONB 3SQ2A 4LY7A 3G10A 4EZ6A 1TL3A 4F3OA 2ILZA 1VK0A 3QEWA 5I42A 2D5RA 4TLRA 3VA3A 4NLSA 4IBNA 1U49A 3MXMA 4ED7A 3QLHA 3L3VA 4DL6A 4DTPA 1SUQA 2HNYB 3IG1A 1BCMA 4B8AB 1GOAA 3PX0A 1L5UA 3KTQA 3ZT4A 4FLXA 5F8MA 2OPSB 3K59A 4FVMA 2IM2A 4Y2AA 3DLHA 4Z0UA 4BDZA 3M8RA 4FJ8A 1ASUA 4MIBA 3ISND 1EXQA 4RW4A 3PVXA 1DTTB 1KCFA 3QGHA 1LWFB 4CJFA 3PR4A 5CZ1A 2J6TA 3T3FA 1S1XA 1JLBB 2AX1A 4CFCA 4O55A 4KV8B 3PW2A 4IG0B 4Q45A 1XR5A 5KFQA 4O3PA 3CDEA 3H5SA 1TK0A 3CQ8A 3OS1A 1GOCA 3H98A 2V4QA 4M45A 3HJFA 1SKRA 2GC8A 3LZJA 4I9QA 4FJKA 3QZ7A 3JYTA 3MF5A 4NYFA 1JIHA 3NF7A 1S1VB 3ALYA 2B5JA 2RDJA 4XIUA 4FXDA 3K58A 2ZD1B 1N5YB 5CZ2A 1S9FA 4QOZB 3AVJA 2OPRB 2IGIA 5HROB 3NMAA 4Y1CA 4K4TA 1RT1B 3O3GA 4B8CA 4QWBA 4LSLA 4I9LA 3QERA 4QPXA 2G8VA 1I39A 3LALA 4MH8A 5SWMA 3NGZA 3WNFA 2FVRA 4B3OA 4FZXC 4NLVA 3ZT2A 1IKVA 1S1UA 4Q43A 4E7IA 4NCGB 3AV9A 1HJRA 4CJLA 4QWDA 3C95A 2IBKA 3BGRA 4KSEB 2R8KA 4CFAA 2C2DA 2DFEA 4IFYB 1L3TA 3PJXA 4O4RA 1U04A 3VA0A 2RN2A 1NHUA 3BJYA 1HQUB 4QWCA 4W5OA 2O5DA 1Y97A 1W9HA 3MR2A 1VSJA 1VSEA 4EZ9A 1R0AB 4FW2A 1KVBA 1X1PA 1ZBFA 3CG7A 2UVVA 1D1UA 4YMEA 2E9RX 1EKEA 2OPPB 5KFBA 4NLQA 5F9LA 2UUTA 4OJRA 4H8KA 5J1EB 2WK4A 4TY8A 4Z4IA 4CHOA 4DMNA 4I2PA 4LH5A 3P1GA 2W8LA 4BDPA 2V0NA 3QINA 2FBTA 5CYMB 4RNOA 4CHQA 3TAGA 1NKCA 4DL7A 3KD1E 3UR0A 4ZP6A 1RCHA 3NF9A 4CGDA 4DG1A 4G3IA 4E19A 4FLTA 3PR5B 4Z4CA 1TP7A 2VG6B 3TVKA 2UVUA 2HNZB 2GV9A 4YNQA 4K4UA 3HVTB 2B4JA 1SV5B 4Z4EA 4DQRA 3V4IA 2IC3A 1CZ9A 2HHXA 4KB7A 3K57A 3VQDA 3NGIA 4J2BA 4DU1A 3HP6A 4FZYA 1IG9A 3IRXA 4I2QA 3LP2B 5DLGA 2KW4A 2R2UA 1UOCA 1EP4A 5HRRA 3OJSA 1HQEB 1SH0A 1UWBB 4ICLB 3VQPA 2PYJA 1NJWA 3ZSWA 3C6TA 4C8NA 1RT3A 4DS5A 2AU0A 1NOYA 4KO0A 3TQ1A 4B08A 4ED2A 4N5SA 4TQSA 2AGOA 5KFXA 4Y2CA 3SQ1A 3QIPA 4PQUA 5J2PA 3KJVA 2CJQA 4WYLA 4RNFA 3U3YA 4O3SA 3OL7A 5JUMA 4KHYA 1T05B 1RDBA 2FLLA 3DMJB 1J9AA 4WXOA 4FLUA 5JS2A 3I5CA 3K5NA 1S5JA 3DDKA 3AA5X 2R2TA 2R2RA 1IKYA 4O3NA 3CFOA 2OH2A 5L1KA 5EU7A 4FK2A 3KD5E 4CHPA 4FJLA 2V4RA 4LSNB 3QYYA 4ECVA 3D45A 4NYZA 4YR3A 3M8PA 5KFUA 1FKOB 2JEIA 3OL9A 1WN7A 4BWMA 1B92A 3QGIA 2VA2A 3A2FA 4FYDA 3HT3A 1RA6A 4Z4GA 3KLFA 3PUFA 3NCIA 1RT4A 3DM2A 3QEVA 1C1AA 4FW1A 4DLGA 1JX4A 2KQ2A 3MECB 3AVMA 1ZYQA 3IAYA 4J9OA 3NHGA 5D3GB 1KVCA 4HTUA 5FDLB 3CJ4A 4RW8A 3V6DA 4DFKA 3GILA 4PWDB 4O3OA 4XPCA 2Z1JA 5KFIA 5L1LA 3SYZA 3BQ2A 2O4GA 3RB3A 4KKOA 1QSLA 2VG7A 1LW2A 1A5WA 3RAXA 1QSYA 2YNHA 5C24A 2YNIB 5C42A 2W7PA 4I7FA 2AGPA 5J2QA 4CEAA 4RW7A 3NF6A 3L8BA 3TR8A 1WSJA 1A5XA 4WFZA 1JLCB 1IKWA 2B6AB 1J5OB 3Q8RB 2D0AA 1S10A 2YKMB 1KFDA 3AVGA 1NJYA 1RT6A 3NGDA 2P1JA 4JS4A 4ED3A 2JEFA 1JLQA 1RTJA 3LPUA 4IDKA 3GYNA 3M8QA 5HRSA 3PW7A 1JXEA 5KGWA 3H2LA 1Q9YA 2ZE2A 5F9NA 4IRCA 1BI4B 3CM5A 1SL0A 4RW9A 2QV6A 5DMRA 4WFXA 3ITHA 3HKWA 1EETB 3CJ5A 2BQUA 5KTQA 2YNGA 4UQGA 4W5QA 3QGGA 3V9XA 3RB4A 5KRTA 3IN5A 4Q8EA 3MEGB 4NLGA 2E6LA 2FC0A 1N4LA 4OKKA 1I3AA 2J6UA 1TGOA 4CF9A 4Q5VA 4DLEA 4O44B 4FZZA 3OYDA 2VG5A 1GX6A 3V1RA 3ZT1A 3HO1A 2HWHA 4H4MA 3DYAB 3OJUA 4JRPA 1MU2A 4CHNA 2BQ3A 1JLFA 4URSA 5HP1B 5DQHA 1S1TA 1Q9XA 1D0EA 3H59A 3OYEA 4QWEA 1K1SA 2B43A 3OHBA 4R5PB 1RTDA 2D0BA 1RT5B 4MQ3A 4OLAA 4EBDA 3LWLA 1JLEB 1BL3A 3GIKA 3DLGB 1REVB 2F8SA 3DI6A 4ZHRA 3GQCA 2EC0A 1TV6A 1C6VA 4FJNA 2R8HA 3D28A 3CJ0A 3OLBA 1LWEB 3SUQA 2R2SA 5KGXA 1NOZA 4FLZA 1BCOA 3OVNA 3SPZA 4Q44A 4DSKA 4ELUA 4CEDA 5DQGA 4ECTA 3SV3A 4ZMMA 2IJFA 2RPIA 2FLPA 4ZPDA 1KLMA 1S0MA 3P5JA 4MK7A 1JXBA 4IR1A 4M3WA 3LWMA 4EP4A 4MFBA 4ID5B 3AO1A 1ZBUA 1KRPA 3V81B 4R0EA 1NJXA 4NCAA 5I3UA 3AVBA 3MEEB 3AVIA 3VQAA 3T5KA 4KTWA 5KFKA 2YKNB 1FK9A 5I42B 2HAIA 4NLOA 4ZP9A 1NK8A 4OKJA 3QLHB 1SUQB 3IG1B 3ICLA 1ZTWA 2G8KA 3TWHA 2BQRA 4NLTA 4DTRA 3RR8A 5T7BA 1RTHA 3DOLA 4W5TA 1YVUA 2RDIA 3LP0B 4QW9A 2DPJA 4IRKA 3O3HA 1NKBA 3G0ZA 3HM9A 4GC7A 1RNHA 3ZSRA 5EDWA 1LAWA 1WSGA 2OA8A 3L2QA 4RZRA 4EO8A 3H08A 3ZSQA 1S9GA 1BGXT 1K1QA 1D8YA 3FDSA 1DLOA 5T14A 3QNOA 1S1WA 4Y3CA 4IH5A 3AA3A 1SH3A 2IJNA 2Z1GA 2XY7A 3C6UA 2BANA 2ASJA 1RDRA 3KK1A 5HLFB 3KK3A 3HPOA 3PY8A
chains in the Genus database with same CATH superfamily
1L3SA 1RKJA 2BJ8A 1DTQB 5LXYA 1OYEA 1KC8T 3HFVA 2B5JB 1QAXA 4DV5J 3O4NA 3DRXA 4ZLJA 4BGAA 4TQRA 4NXMJ 3RMAA 2P5OA 4F0KA 1VGYA 3FBEA 4FPAA 4OGEA 3GDQA 4BRLA 3S7RA 3TWZA 3NGRA 3GLJA 4CYUB 1WWHA 4ED1A 3BZCA 1MROB 3TYTA 3QZ8A 3SSRA 3ENWA 1UVLA 4C48A 4BC9A 1IQZA 4PR6A 4ECYA 4DSEA 2A6AA 1KC8O 5T41A 5K8NA 1JK9B 4A62A 3TPQA 3UKRB 3ZZYA 3E3XA 4C1NI 2OTLS 1GLJO 3OYJA 2IRUA 4O8UA 4YDUC 3CSKA 5ETMA 2F4VF 4J9VA 2HNYA 3FGVA 1KQGB 3OYMA 3UWTA 2GGPA 2LXUA 4O23A 2FF6A 4DTMA 1YLXA 3J7AN 1ASVA 3MX5A 4OHZA 2KFZA 3TZYA 3R6LB 1DQ8A 1RDUA 3FUYA 3MUVP 1HMVB 2SXLA 1NGFA 3CJTA 2M4MA 3CJRA 4BRCA 1LWFA 3ULEA 1RYRA 2XWYA 3WC2A 4L6V3 2CQ4A 3LPEA 2Z1IA 4JK7A 4XDCA 4IG0A 3BSAA 3H5UA 4DQQA 3IR5B 2H51B 2EBEA 3RSEA 1NMNA 4KRFA 1Y00A 2DEIA 1C0MA 2J76E 1H74A 4J9RA 1NK6A 3I5BA 3WNEA 4K4XA 4DX5A 3MK6A 3VGKA 1RWOB 3MN7A 3L2RA 4DSFA 1KS2A 4LF4J 2QSWA 4PKDB 2AQ4A 3CD6N 4XEIA 2ZD1A 5HJXA 3BO2A 4AL5A 4JI2K 4M3XA 1N32F 2MHEA 1RBRA 2YXLA 3RW6A 2E1ZA 4LUBA 2FJAB 3IRXB 4I2QB 4BLGA 3MEKA 3SI6A 4K4ZA 2HFVA 1MWZA 4ECSA 2OELA 2YWEA 5J2MA 3JS9A 5IM0A 1RDDA 1ZH5A 1KVJA 3G82B 4CIGA 4NCGA 2HSTA 4PQUB 4YY3J 5C0YA 2F4VK 5J2PB 3QGPA 3I56S 4Q2MA 2B7BB 2JEGA 2DNMA 5MAOA 1QAJA 4IG3A 2FJDB 3QEXA 1YAGA 3D1OA 4JKAA 1XMQF 2W2PP 4ZJLA 2R8JA 2EKNA 3GCXP 4WZQA 5D15A 4FF1A 2VOOA 3RVCA 1O51A 1RT4B 3FKBA 2J9DE 1N34K 1IN0A 4P75A 3PX6A 1S5ZA 2HGLA 4ISGA 1BY9A 4ZP8A 2QL9B 1VYAA 1VK8A 2LKZA 3BSCA 3HVRA 2DY9A 3DWLA 1W7WA 2IYGA 6AT1B 3R1HA 4LFCF 3NCQA 2W9AA 4CLLA 2MB0B 3V6DB 4NLWA 1QVGM 2XMUA 1HUXA 5CYJA 1M0SA 4OFZA 3NGKA 3SCXA 2VG6A 2QWPA 4TYBA 3H3OB 5AXMA 4DPWA 4EP5A 5L1JA 3K2PA 4DX7A 1BU6O 3C7NB 2KFNA 5C42B 1YVNA 1JLGB 5F8GA 5I3PA 5M1QA 3OV7A 2XC9A 3LP2A 2F65A 1AW0A 3VHQA 1IKWB 4C8KA 4DL4A 4CGIA 3AOCA 4J2EA 1JLQB 5HN0A 4IDKB 2LEPA 3TU5A 2GIRA 2GIFA 2HHHF 2HF4A 1BIUA 1TKZA 5THWA 4CLZA 3EX7B 3LPYA 1SQGA 2XHBA 5KT5A 1ITGA 2AJFE 4AT1B 3IA0A 3DLEA 1VQMS 2A40A 2YNGB 4PL8A 4CLSA 3VGVA 1PGZA 4E2FB 2XY5A 3AO2A 5KG1A 1R0BG 1R8AA 2BRLA 2G8WA 3M8YA 2VHGA 5KG0A 3FSXA 2VG5B 2C2RA 4L74A 1X4BA 2JRSA 3VVUA 3GR1A 1EQ0A 2J7KA 1KQKA 3OLAA 3GOIA 3AO4A 4JI2J 2D1CA 2VKRA 4OHYA 2DIUA 3V9ZA 4I0WA 4OKEA 2YQ1A 4AL7A 2F4FA 4DV2J 2M7SA 2WRMA 3T9NA 3CCES 4M3YA 1VRTB 2X1GA 3PLAA 2X78A 3U02A 4IYQA 4H4OA 2GQ2A 2M9KA 2C1EB 1RTDB 1GNKA 1TZ0A 1UWAA 4FWMA 3ZZOA 4PRFA 2A2CA 1HFEL 4FBTA 3T6BA 1X4AA 3BSOA 1D5AA 1H72C 1KDNA 5LJ3Y 4BCAA 2VPWB 1N33F 1U47A 1X8DA 3T5JA 4ZHRB 2HRTA 5C25A 5E33A 2P9EA 4IQXA 2ROEA 1SJ1A 1M1KT 1EX4A 2V2KA 1FNXH 4K4WA 1HBUB 1VSFA 4DPOA 2O66A 3EE8A 1X4DA 2V94A 2ZWHA 4I4BA 4MLEA 1FE0A 4MKAA 2JC0A 1NGDA 4OLBA 1I6JA 1HIYA 3MD3A 3HXMA 4EEYA 3HYFA 4FJGA 1J5OA 1WC5A 3FBFA 1Z26A 1ZM4A 3C16B 3CIZA 2HVDA 3G6XA 4AHVA 3HVAA 1M1KO 2HMIA 4KH6A 1X4FA 5H9EK 2FGOA 1PYSB 3VAFA 3CD5A 4YDXA 2DXDA 2E2QA 1N34J 5GMEA 1C0TA 3CCJN 2CPZA 5GAHP 4CEZA 1F6TA 1B9DA 2QWOA 4OPHA 3PYEA 1Y64A 4M5MA 1K9MO 4J9PA 4CZHA 1TFWA 1YZ6A 2J5AA 3EKSA 4EHUA 3RB0A 1HYZA 4LC9B 5E84A 2GHWA 4OZ5A 4NLBA 1V9OA 5F8HA 2DIVA 1N33K 2QWNA 3SBGA 3C15A 4JKGB 3CMEN 4CDIA 1CXUA 2W40A 3MTJA 5FLXU 3ZCMA 1O0PA 1HPZA 2HHQA 1WHWA 5LSLA 4A8YA 2GO9A 4MIWA 1Z05A 4RKUC 3F9KA 2OD4A 4L3NA 4URQU 2DPNA 3EKUA 4FCYA 1H98A 3SJJA 4KH1B 1HRHA 3W2VB 3G6VA 2HHTA 3D9BA 2DR5A 2W4DA 3IR6B 4BE1A 5KG7A 1FEEA 3NH2A 5HQMA 3W61A 1C1BA 3KK2A 3OL8A 5A8KA 4FBUA 2ETJA 3TEGA 2CJBA 1H2VZ 1Q95G 3V6JA 4OL8A 2YHAA 1B0PA 5AQNA 4OZNA 3DXKA 5FLXO 3H2UB 3EMTA 4QU7A 3T5LA 4OPKA 2R7QA 2MQPA 2E2PA 4F4YA 4QIWD 3G96A 3AVAA 4NYOA 1VQ7N 4KAZA 1VFJA 5GIOA 2KJWA 1RHMB 1S0NA 2XG8A 1BQNA 2XMKA 1TR0A 2XMVA 4G1QA 1QHAA 2P9NA 2WAQD 4DB3A 1E4FT 4B17A 1U6FA 3LDPA 2IRXA 4NO7A 2XCPA 3V81A 5C2DA 4BC2A 1SZ2A 4WFYA 4WP9A 2KXNB 4DR4K 1O8BA 5KFVA 2OSRA 1TELA 3PYDA 1YJRA 2YCHA 1CJVB 4KRWA 4LR9A 4I68A 5K8OA 3DRPA 5L9XA 3NVKA 3PW5A 4KE5A 2DHAA 3V4MA 1S6PA 1LAVA 1F5AA 4DR7F 4B3OB 4DR3F 1P8GA 4CJWA 4XDDA 1PBAA 2HHWA 4OPJA 1UZDA 4A8XA 1ZAXA 3MN9A 4DPYA 5AZIA 3CERA 5DG8A 1Y5LB 4DQIA 3Q83A 1E6VA 5IT0A 3QNWB 4HT7A 1XQSC 1YWXA 1NJIT 5H9EJ 2NRZA 4J7CA 4GKKF 4Q7AA 2IAJA 2HBMA 2HKEA 3E66A 3QPIA 2V7ZA 3LANA 2XI3A 2GAHC 4JI6F 2XYPB 4YFUA 4N76A 2HQGA 1RBVA 1E6YB 3KLGB 5KG6A 2QK9A 4ILLA 4LH4A 1R8BA 4P52A 1HWIA 4DU7A 1S0VA 4A8MP 1S6QA 3ENQA 3ILIA 4FJHA 2QL7B 1N5VA 1U0HB 4QYRA 3HOSA 2CPIA 4FWKA 2PIIA 3MM9B 4WCEQ 1NJIO 1RUSA 1U48A 4ED0A 5DO2A 2QMUB 3GL1A 4J9SA 4RX6A 2NSBA 2RH3A 2BTFA 2O01C 2XCAA 4HR2A 3OXFA 5AE2A 2WC9A 2KXFA 2V6AA 3DDIA 2H5IB 2K1RA 3MPYA 1C1CA 2HVEA 1FT8A 1NMEB 3MMVA 4I6AA 5D0GA 2YNFB 3V4IB 1K73O 4DR7K 3TZXA 3IDHA 4DEZA 1S72S 4DR3K 3T1AA 3N6NA 2VD3A 4NA2A 1YZ7A 1WAJA 2QI2A 4CIEA 1HI1A 2MTLA 3FVYA 1FFGB 1W25A 4P74A 4CFBA 2DNOA 1Y0HA 5KAKA 1CXQA 1ZPWX 2W7OA 4DR6K 3US5A 2D3UA 4JYAF 2GCFA 3IMXA 4GKKK 2O3DA 3W9HA 2NXEA 1RABB 4CGHA 3KJQB 4BRNA 1PYOB 1WD6A 5K14B 5ETSA 3IWXA 4ETXA 4JI6K 4I6YA 1AZSA 2IOCA 3GJQB 2B9YA 3U4LA 4CZIA 3SMSA 1VR6A 5DRKA 2E5IA 2ZZNA 3AOAA 2C22A 4W98A 4E1JA 4ZN1A 3C19A 3FEXB 3Q86A 1HBOB 2GVDB 3MCOA 4DR4J 3O9UA 1A6LA 3MMBA 3ENVA 3A8JA 3CCJS 3NEKA 2B9WA 4DQ8A 9ATCB 4ZA1A 5B0AA 3K2YA 1RBLA 2WSCC 3VZIA 2OGUA 2XRIA 1QE1B 4P6QA 3GIRA 3UQSA 2P9KA 2VPYB 5HQLA 1F3FA 3BQ1A 2DHSA 4YB5A 1C0UA 1R8HA 3OY9A 3H5XA 4WE1B 2HWIA 5FPMA 2FQQB 1N5SA 3BP8A 4KI4A 3KNAA 2HNDA 2ITGA 1N8RT 2ZM6F 3KG1A 4DQPA 2CPFA 4IWVA 3QESA 1V3SA 1R27B 4CJ4A 3EGWB 4EYIB 4FSVA 1LW2B 3CDAA 2LVWA 2KYXA 1KQFB 1SV5A 2KHCA 3LAMA 4I7FB 4MYUA 4HVJA 3NAIA 2AJ0A 5E7OB 4JYAK 2ZKUA 2Z2MA 4GY2B 3OYHA 3SQ4A 3NL0A 3PEJA 4J8FA 3OFFA 2DCUB 3OYCA 4KHPJ 1HQEA 5CA5A 4B9NA 1X0FA 4J90A 1PILA 2BE7D 3WX4A 1VQ6S 2DXEA 4RU2A 2CQBA 2UUCF 3EYZA 3OYIA 1RT2B 3NBPA 3NGTA 4ED5A 1HW8A 2NXUA 3M6VA 3SI8A 4CK1A 1TK8A 2HRUA 1HNZJ 5JMVA 1T05A 4DZ6A 2VASA 4KGKA 4GC6A 3I5AA 3AB4B 2BVZA 3HF5A 3BDPA 5KFAA 5G0RB 3V6KA 4U9RA 4N41A 1NHVA 4OI1A 4CZMA 1SJ4P 1SC4B 2W9BB 3UVJB 3EICA 2H9ZA 4BC3A 3OYAA 1RBSA 4YN3B 1T03A 1ZA2B 4LSNA 4DR7J 2DT9A 2FHJD 2F1FA 1OY6A 3QT5A 2XGPA 3NS7B 5KG3A 4A8KA 1VISA 5KT4A 4UZBA 5GAGU 1Q79A 3QRQA 3BREA 2ZM6K 2Z8QA 2MLZA 1S3XA 2F8EX 2E4LA 3BV8A 4LFAF 1HBNA 4J5OA 4BVOA 5D8HB 3M30B 3OYGA 2A5XA 3MN6A 1T3NA 4DR6J 1SH2A 3ZNUA 1DFDA 3VQSA 4JS5A 4KHUA 2RQKA 3TAMB 4GKKJ 2X51A 5FRMA 4J2DA 4J9QA 2HGNA 2ASDA 3N9UC 5CYQB 4BWJA 5KQDA 2V7YA 7FDRA 5IT9Y 5FD1A 5KFOA 1T8EA 1ESVA 1SC3B 1F2HA 1EHWA 2PZSA 1TKXB 4HKQA 3R5JB 2UUCK 4B3SF 2ILYA 2LQ5A 1IWGA 4H5WA 3AA4A 2JLGA 2VFTA 3L6QA 1KLMB 4F3TA 3ENOA 2NREA 3KHHA 3FFIB 3QETA 5GADP 2JVRA 3IXQA 5ETLA 3TI0A 1F9FA 5ETOA 3DOMA 2Q6BA 1SJRA 3B6PA 4FK4A 1NM2A 3FQKA 2HBRB 1YQHA 3O08A 2BKOA 1A5VA 4YOWA 3WBZA 5KFCA 2KT2A 2MPUA 4NRTA 4RU9A 5ETKA 3AJDA 5K9FA 3WEEB 3CJ2A 4JRQA 4DTJA 1RU1A 2KHOA 2QT7A 3U6FA 1VDHA 4M5HA 2LQ9A 4JI7J 4RUAA 4RNHA 2XI2A 1RTIA 4WU3A 3PEHA 2J0SD 5L39A 3RBEA 3BUZB 5CZXA 4LFAK 2Z58B 2POKA 4M94A 3PKMA 2KL8A 3MTKA 4A57A 4JYAJ 1BIZA 1IJFB 3VENA 5FLXY 4M95A 1RQ0A 3SPYA 3I82A 3ISZA 4K41A 4A61A 3C14B 4CGFA 5HBMB 4WQ4C 5KFYA 5LSRA 1FNMA 3Q8QB 4BRKA 4M63C 2NLXA 4Z2XA 1Z2LA 4F3QA 4DL3A 2KTQA 1JNRB 4KPYA 5DETA 1U8WA 3WXLA 3NH1A 3T1YF 1LWEA 2V4JB 2IM0A 3E9PA 4LBIA 2H4WB 1TUVA 2CA9A 3MURP 2Z57B 2WVFA 5MLCQ 1KN6A 4MDBA 4FPRA 2BJ3A 4B9VA 4F25A 2RAQA 3CJ8A 4JI3F 3D2FA 2P9UA 2VB6A 1HNVB 5KFTA 2DHHA 3T41A 3D0PA 5KFEA 2YWWA 3HHKA 5AXKA 4LY7A 1PIEA 4EZ6A 2VIHA 4W92B 3FE1A 2CJ9A 4C6AA 2VPXB 4K2XA 4OZ2A 4F3OA 1VK0A 5I42A 4NLSA 4IBNA 3R3TA 4LBHA 3KG0A 2MLYA 4ED7A 3SQGB 1IBKK 3M32A 3C8YA 3QLHA 4ISFA 3U1NA 2HNYB 3PX0A 1L5UA 3KTQA 3ZT4A 5F8MA 2OPSB 3K59A 4P2FA 5BREA 4BRGA 1BD6A 1Q7YT 3MDFA 4MIBA 3ISND 4RW4A 3PVXA 3BO3A 1KCFA 2CYYA 4OJ1A 1LWFB 2UUCJ 2FPHX 2A42A 5CZ1A 2XZDB 3T3FA 1JLBB 2BEFA 3TSPA 4O55A 4Y2IA 3AHPA 4IG0B 2YH0A 1XR5A 5KFQA 3B8AX 4G1PA 3HI9A 1IG8A 2F7TA 1GK8A 3LTOA 1FERA 4IEEA 3T1YK 3C3LA 1UJ5A 2YX1A 4RBVA 3RSEB 3R9PA 1QZ6A 1WHXA 4FJKA 3KG4A 3JYTA 2X3DA 4OQJA 3MUTP 3OW2R 3CMAN 1S1VB 3QATA 4FXDA 2ZD1B 1DURA 1F2GA 4QOZB 1SIWB 2GQQA 1G6BA 1U8SA 2DISA 2PI5A 4JI3K 4IO8A 4K4TA 4CZJA 4U67Q 4DL0C 4LSLA 4KGXB 1UTAA 4QPXA 1N0UA 2G8VA 4LFAJ 2NPFA 1Q81O 3LALA 4MH8A 1D09B 2UUAJ 5SWMA 3R5AA 4FZXC 1VAZA 3ZT2A 1IKVA 4Q43A 2B3TB 4NCGB 6FD1A 3ZTQA 2MQLA 3A3PB 3LH2S 3ENAA 4KSEB 4JI0K 2C2DA 1HD1A 3HZEA 3PJXA 4X4PA 4A4JA 1ATSA 2FXUA 2OLWA 2UXBF 3A8KA 2CQ2A 2A41A 3A5LC 2XHWA 3BJYA 3QT8A 2NUUG 2FHJA 3R3LA 3LDOA 2LQJA 4EZ9A 2X1FA 1KVBA 4CW7B 1X1PA 2DGQA 4X4QA 2DNZA 1ZBFA 1EKEA 2Q0UA 2HS4A 1YUWA 2IY5B 3WIUA 2XLKA 1V5IB 1FRKA 4OJRA 4H8KA 4JI1J 5J1EB 4DV1F 3LF0A 2W01A 1EQYA 3KVGA 4Z4IA 1VOMA 2J8AA 4WK1A 2FC8A 4LH5A 3TTCA 3RU0A 5IV4A 2HWTA 4HI1A 3NRBA 5CYMB 4CHQA 2CDRB 3UR0A 4ZP6A 1TU0B 3Q0AA 1CJKA 4EHTA 5KPTA 3CTRA 4DG1A 4E19A 1FX4A 3PR5B 1TP7A 3W3DA 2VG6B 3CCUN 2HNZB 4K4UA 1VQKN 3PG9A 4JB8B 1IBKJ 4Z4EA 1MG7A 4IO1A 2IC3A 1U02A 1VQYA 2N7YA 4K43A 3HP6A 1S99A 1IG9A 5DLGA 3G6EN 3LP2B 1UOCA 4DPXA 2KXHA 2H65B 1Q8KA 4GVBA 2DHXA 1IWAA 4BRQA 1SH0A 4LR7A 4FO0A 4OX9F 5AQXA 4ETZA 1NJWA 2AU0A 5M1FA 1RCXB 4B08A 1JJ2M 1NDLA 4N5SA 4UOCA 3IFRA 3NWGA 3SQ1A 3QB0A 1WF1A 3ZETA 2CJQA 4WYLA 1RAAB 4TU9A 4O3SA 4KHYA 1T44A 3T1YJ 2FLLA 3DMJB 1J9AA 4RLEA 3I5CA 1V5VA 4O3NA 1IKYA 2PMZD 3CFOA 2OH2A 5L1KA 5EU7A 3A1YG 5DM7L 1QTNB 4YR3A 2HVZA 4JI3J 3A2FA 2CXEA 3I4HX 3PUFA 3NCIA 2YX6A 3SJHA 3OUYB 1FJGK 2DH8A 1K8AT 4UTGA 2ZJPL 3AVMA 1ZYQA 4DMZA 4OPAA 2C3MA 3ZZUA 4C9DA 4JI0J 4HTUA 4GVLA 1FJ7A 4DFKA 4HHJA 1N5TA 3G87A 2IBOA 2Z1JA 4IOCL 5KFIA 2O4GA 2VG7A 4OX9K 2QLXA 1ZBSA 5C24A 2AP6A 3NNHA 5J2QA 5T7LA 3NF6A 4ZVUB 4A46A 3TR8A 1RADB 1TUGB 4ENOA 3OVAA 1J5OB 4FPBA 1S10A 1I94F 1KFDA 3NGDA 4JS4A 1G7CB 4ED3A 4C97A 3M8QA 5CAAA 1JXEA 4FZVA 5HVFA 2ZE2A 2XNQA 4AL6A 4IRCA 5F9NA 4C11A 3JSBA 4RW9A 2QV6A 3NWRA 1NGIA 1MWKA 4WFXA 2O8CA 3ITHA 3HKWA 4H4KC 4RL1A 2GWKA 2BQUA 4UQGA 2BXJA 3QGGA 1VJQA 5KRTA 2XYGB 2FC0A 1N4LA 3EWGA 4WIQA 4OKKA 3AT1B 3ELHA 4Y65A 4DLEA 5D4PA 2CWXA 4O44B 4Q5VA 1TUYA 4YOTA 4DI6A 2FTRA 4USKA 4DR5F 1NO8A 2O8DB 4FN5A 5B0GA 2ZITA 5GMDA 4JRPA 1MU2A 2EFVA 2MJNA 4CHNA 1GMWA 3O5TB 4LRCA 2BQ3A 2OMLA 1NGJA 3CMAS 3SEOA 5HP1B 1S1TA 1Q9XA 3C15B 1H2TZ 2W2QP 1XNRF 2BOPA 3VF2A 1YITN 2VFSA 2CJAA 2DGSA 4R5PB 4CTAA 2W25A 4OLAA 2CAJA 3UD4P 1P1TA 3M7VA 3UR3C 2C42A 4FYYB 2EXUA 2ACMA 1REVB 3HM8A 1WDDA 1TFYA 2P9SB 2ASPA 2FZCB 4C0HA 1RWUA 1JXVA 3ZTRA 3ZX0A 3ZC4A 4NXNK 4OYOA 2ZBQA 4USMA 5KOXA 5A8KB 5KGXA 3D1QA 1NOZA 2DNYA 2Y8WA 4FWLA 1V4SA 3SCLE 4X4UA 3DXKB 2KO1A 2BM1A 3FK4A 3HZ6A 5DZ7A 3AB2B 4QYZK 3LA0A 3SV3A 2IJFA 2RPIA 2FLPA 3RAMA 3HSGA 1HHQA 2PA3A 5CZVA 4LFBJ 3LWMA 1URRA 4ID5B 2P9NB 1VCTA 3AO1A 5BN8A 4C98A 4BRAA 3VEXA 1FWLA 2FGCA 3V81B 1QVFM 5DJBA 1X5SA 3AVBA 1C4AA 1FJGJ 5GMKa 4DR5K 2HAIA 2JOQA 3PFOA 3G71N 4OKJA 5ETQA 3NLCA 3ILOA 5JVHL 4HH1A 2FJBB 1SUQB 3IG1B 1CULA 4UW2A 3FZFA 3TWHA 3VGLA 2MJUA 3IBCB 4N77A 4B3TF 4NYPA 4IRKA 1XNRK 3CJBA 2MKKA 1NKBA 3OHRA 1RNHA 2BZ2A 3ZSRA 3AA9A 3ZZ0A 1DQ9A 4YHHF 3CJ1A 4EO8A 3ZSQA 4P2XA 3CCUS 4A47A 1K1QA 1X5TA 1XC3A 4Y3CA 1NH8A 1WEXA 5HOOA 2D1KA 3FZHA 3MAAB 3OTCA 2BANA 4XK8C 2BUNA 3HX9A 3KK1A 3T6JA 3G6ES 3KK3A 2IAJB 2XQCA 2GIQA 4CEQA 1TTHB 1OSDA 3BZQA 2BA9A 2RKIA 4P73A 2YQ3A 4ZVGA 3OR2B 2Q1NA 2DJWA 1C4CA 2VPZB 3NMUA 4BG8A 1NLVA 1GLAG 5AQOA 1S6QB 4LF7F 1S7HA 4IOAL 4RNMA 2BH1A 4ZTFA 3CJCA 2HG4A 5KRSA 4ZKAA 3J7ZT 4IFVA 3JQJA 3F5TA 3ULDA 5ETNA 2D0CA 1AFIA 2FHKA 2YHBA 2VA3A 1BQMA 1FESA 2CQ1A 3VQ5A 1HX1A 2BGGA 1ZZFA 1WKLA 1QQMA 3CCTA 4KBOA 2R9LA 4YOUA 4FP9A 3BGRB 5EX0A 5F8NA 3W5XA 1LV5A 1C1CB 4U7CA 3RWUA 2OEJA 5JMNA 3H25A 4B3TK 4FNIA 3J7ZO 5B0BA 8ATCB 5HSPA 2LEBA 5LOQA 4HHHA 4ZIWA 5AQVA 2HIYA 4YHHK 4AFFA 1WG5A 4HVZA 3X1LB 5IC6B 3CJQA 4YDUA 2VC0A 2DKOB 3EDRB 3OYNA 4NXNJ 1ZAVA 3VCDA 1BG3A 2FVCA 3A0IX 2HK2A 5E2QA 4CM0A 3ZEUB 1Q1KA 4ES1A 3N0VA 3UB5A 1XNQF 3JSYA 3MZIA 4CEOA 3K7RA 2HBKA 3BDEA 3S41A 4KB1A 4WFAQ 1QTMA 1D9DA 2FDNA 1UA1A 2CQCA 2JNJA 5BRHA 3A5MC 4J9KA 2IM3A 3LDNA 1WC1A 4XH4A 4FJ7A 1F3VA 3PX4A 1N56A 1LWCA 4LF7K 5DG9A 2RHKA 2AYGA 1OQ6A 4MAKA 3CM6A 4GRSA 3HPGA 1RYSA 3MMAA 4X4TA 1U1PA 4DR5J 3RRHA 1SL1A 3O9RA 2Z2LA 4YORA 2ZZTA 3G6YA 3D2EA 2EPIA 2PYLA 3GPAA 1PO6A 3HFZB 3CCWA 2BJ1A 3SBTA 2P2CB 5ADXH 1EP4B 4U6PA 1RDWX 4IH7A 4B9UA 3J81Y 2P9KB 3C6TB 1T9YA 2AJ4A 9RUBA 1C0UB 2MGZB 4B9SA 4MJKA 3H45C 1HYSA 1T7PA 1W26A 2FZKB 5F8IA 1U1NA 1BHLA 2E20A 5AQTA 2C3OA 3ZSOA 2HNDB 2MSTA 4I67A 3CJ3A 3KJVB 2UP1A 2G8HA 1X9JA 2NXNA 3RMDA 2A6OA 5ADZA 2Q36A 3QJLA 1LW0A 3K5MA 4QQBA 2WSEC 5C7PA 1WAFA 5CE3A 4UQTA 4MIAA 4RPFA 2W8KA 4NLCA 1U1MA 4DU3A 1LK7A 3OTBA 1HYVA 2BE2A 1YITS 1NDCA 3H46O 2R7UA 2P9PA 3ZZPA 4XTTA 3TZWA 1YHQS 2OJ3A 3WUHA 3CC4S 3O6WA 4DFMA 3CDWA 3O3FA 5E3AA 3NBPB 3TVZA 2NRHA 3D4JA 3BF4A 3ET6B 2WW8A 1WC6A 2C2NA 4JHDB 4CWBA 4A8QA 5J1NA 3NOCA 1P9YA 3M2RA 3GJTB 1JKHA 4DQSA 3CO9A 3W5ZA 3BBFA 4RW8B 4CLKA 3K8VA 3VTIA 3M9OB 1T03B 4B3TJ 3D6FB 2DNNA 4CCHA 5CHIA 3QEIA 2FBYA 3CW2C 1VHFA 4TKTA 3VQEA 1X4EA 1XTZA 4RW7B 4YHHJ 3QAEA 2GBZA 4OX7A 1Q78A 3G71S 4Z4FA 3AAPA 3OSNA 3MM7A 1VSHA 3HK2A 3DC2A 2RD5C 5HL7Q 2KG0A 1Y9OA 4TYAA 2HVIA 5AQJA 4UOGA 3LW5C 1GLBG 3CWJA 3HD1A 4O4GA 2HQCA 2VGMA 3S6EA 3TTFA 1Q4RA 4ZPWR 3JS6A 2JX2A 2XLJA 4CJUA 5KFFA 1HLWA 3BF3A 1HKAA 2UXCF 5GAEU 4NI2A 4USTA 3R97A 2HHSA 3EJMA 4Q0BA 4MKYA 1CSJA 2YQ0A 2HHUA 1F0XA 2HFOA 4DV7F 4DF4A 3Q8UA 1D9AA 1RI7A 4IZ9A 2UXDF 1NZ8A 3RTVA 3K5LA 2NZ4A 1WACA 3GWCA 4F26A 1SVDA 4A2AA 1TK5A 2ZC3A 1KD1O 5KQ8A 2ZHOA 3HI0A 4E0DA 4LF5F 3EVMA 3KHRA 4CEFA 1Z1ZA 1VI7A 4EBCA 2P6TA 3CHWA 1RTIB 4FK0A 4BRMA 3IWNC 2RRNA 3CT9A 4C1NK 1VC6A 2RILA 3O4QA 4CZFA 1WEZA 2YKPA 1P9QC 3N79A 2E5GA 1PJ6A 4X84A 3W1YC 3OYFA 1S7IA 2NCKL 1TL1A 2AEMA 1VC0A 1QLNA 2BOAA 1H0HB 1QD1A 3DRSA 3RJMB 2AA4A 1TVRA 5EGYA 1WG4A 8RUCA 4NLPA 3EXYA 2JLEA 2JL9A 4ZJOA 3TAFA 2E5LF 4OVLA 2OYQA 1Q7LB 2IRYA 4LF2A 3I4PA 4DHYA 4DV7K 2YBVA 1EETA 2NQPA 5C15A 3QT6A 1U1OA 5BR8F 4J2AA 2IM1A 2HBYB 2UXDK 3BM7A 1TMJA 1NWKA 3SXLA 1VSLA 1KHVA 2YX4A 3E9OA 2RU9A 4AXIA 3NAEA 3CMQA 2XULA 3GP9A 2LECA 4OLPA 5AXLA 1ROFA 4TXSA 1NJZA 3M3ZA 1KEKA 3D2FB 1S9EA 1D3WA 2W2MP 4LF8F 4LF5K 2RUGA 2W42A 4CJRA 1DLOB 1S1WB 4OHWA 4HHTA 3RW7A 3KLHA 3BYPA 1T9TA 2UUBJ 3PO5A 2YWHA 2DYAA 4DU8A 5A8RA 1KQSR 2WZ1A 1FFSB 4PUOB 2P9IB 4QAGA 2OSQA 3AJ1A 3I8BA 2XEXA 4FJIA 2MZSA 2LQBA 1OVYA 3Q7CA 4CGJA 1SC6A 4C8OA 4RW4B 2H4YB 4HTLA 3KLEA 1XR7A 2CKWA 4ZPVR 3BPDA 1UVNA 4MT1A 3LAKA 4S0MA 5AR0A 5IOLA 3TA2A 3LUYA 2BKPA 4CNYA 2E5LK 3H90A 3D7EO 1MMLA 1UVJA 4IRDA 1GX5A 1RDAA 2V34A 3HP9A 1ZBLA 4USWA 3AVKA 1VK3A 2UUWA 4KJIA 2NZCA 2C28A 5E3RA 3AODA 3MEEA 2PN6A 1HNIB 3BEXA 3I0SA 5EXWA 2FBXA 3DRRA 4FLWA 3GV5B 1N0VC 2G2ZA 1MDUB 1ZZNA 2EK1A 4H0PA 4NA3A 4C8MA 5IT4A 1J54A 4LF8K 2LU1A 1RT7A 4LQ3A 1TYQA 4NPOA 4WYWA 1U26A 2ZBIA 4YP3A 1IKVB 2QEXN 3B54A 4FM1A 2H1YA 5EHHA 4TU8A 1PSDA 5AXNA 3P4UB 4JNEA 1VBKA 2VF3A 2G1HA 5K8MA 1NHKL 2Y1JA 5LL6d 4PCQA 2MKCA 4F3MA 3MXIA 2AYBA 3O9TA 3JTOA 1FF2A 2JJ4D 5H1SV 3E01B 3ZSXA 1NK5A 3I9ZA 4BDYA 1UAXA 1NGGA 4DXLA 3SCJE 3OBYA 4DV7J 1FX2A 2Q3SA 4C2MA 3AVFA 1ZTTA 1KHWA 2U1AA 1YVFA 2UXDJ 2GA7A 3M8SA 4Z94A 1OY9A 1HBMA 3AAWB 3NXZA 4BC7A 4DUZJ 4HUGA 2MY8A 3IBFB 3THTA 1VQSA 1D8ZA 1D4XA 1FRLA 4HL9A 2QW9A 4BRPA 4V19X 2YHYA 2ADBA 2BRKA 4LF5J 2F9JA 2F9TA 2VKZG 1UEUA 4FJ9A 2F8TA 1VHXA 3L3UA 2QX0A 4DTSA 1W7AA 2IVNA 4Y28C 3LP1A 3UKUA 1NSKL 5IC4B 2EFNA 2KG1A 1N5YA 1AXQA 3SAGA 5M1KA 3RZAA 2IC3B 3ZTOA 2CG8A 2OPRA 3DAWA 3H5YA 1C0GA 3DXMB 4QOTA 4HTIA 1RT1A 4KPCA 4MMOA 5DGAA 4CH1A 3PFEA 1S59A 2VBZA 4FJMA 2Z30B 1ATNA 4Q8FA 3VGSA 1Y5IB 2CG4A 3J7Z5 3MN5A 4FOIA 2RE1A 1BWFO 3H7HB 1KTVA 4ZLPA 3P31A 2M70A 3GV7B 4EBEA 3CYMA 3A13A 2E5LJ 4YOXA 4K4VA 3KMQA 3DLKB 5B0CA 1GLLO 1NNEA 4DFJA 4FJ5A 4IFYA 2ZUGA 3TX8A 1DKGD 3WXJA 2QXFA 3GBTA 2HFUA 2EG2A 5B08A 4JI8F 5KT7A 3H40A 2I38A 5C5JA 3X3UA 5E0OA 3DOKA 1RACB 3VQ7A 4ER8A 1HQUA 4FL9A 3HSZA 4QIFA 2VBYA 2CZ9A 4NLUA 3RRGA 3MPDA 3HFKA 1RAJA 1R0AA 1FFWB 2O67A 2U2FA 4PWWA 4K8XA 3MI7X 2CJXB 3FRZA 5KFSA 4RW6B 3V9WA 3S3OA 2HEKA 4Y2MA 1LOTB 4ZDNA 2XSJB 2JDJA 2OAUA 5F3TA 2KT5A 2YHXA 1VQNN 3ONQA 5JVGQ 4ALZA 3DLBA 4KHMA 4F50A 3FEYB 3CIMA 1U1RA 3FNNA 5FPEA 2MXYA 4CEEA 5E41A 4JKHA 3TUPA 2W9CA 3RG6A 2MQQA 3QO9B 2PEHA 2NNWA 3TP2A 2ATQA 3PW0A 3PW4A 3QWUA 5FROA 2I5JB 2QLJB 2DFHA 2FSJA 1HI8A 4USVA 2JSXA 5D4OA 2HW3A 3QJJA 3T19A 4WTOB 3QMLA 4JK9A 3QMQA 2IDOA 4EFHA 5C24B 2CQHA 1UVKA 2GEMA 2R3VA 5J2QB 2GS8A 4LQ9A 5T7LB 2KFYA 2R4FA 2ZH5A 2KB2A 2K3KA 3M5RA 4DV5F 3KLIB 4CF1A 4NXMF 5ETPA 4JD2B 1DEJA 1UWBA 6FDRA 4KGVB 4CF0A 2F63A 1YJVA 2YWGA 1ZBTA 1RCOB 2GVZA 1V6HA 4CF2A 4C11B 3CDUA 3OPKA 4OYIA 2WOMB 3CPWM 2OPQA 1R31A 2NXCA 5IWAF 2CJYB 3H1VX 3SSQA 3MM6A 4PZVA 1S6OA 4BROA 1ILYA 3EVWA 5AJ3F 4P72A 1N54B 2RF2A 2AJ1A 3IGVA 1IBLF 3NOGA 4CP5A 3CXCM 3UDLA 4ILRA 2DTUA 2DTJA 3N6LA 2MKJA 2L08A 3LDSA 4BGBA 3C66A 3W3SA 2AWZA 3G9CA 4OJHA 4UZCA 1XN9A 4LRBA 1HA1A 1FKOA 2DGVA 1M1GA 4A8SA 1UPMB 3J80U 2AMCB 3S3MA 2NSCA 3VQ8A 4BC4A 4DSLA 4CTAB 1YJUA 1T6DA 3IKMA 2E1AA 1SXLA 4U7UK 1V3RA 1JLAA 2RS8A 3KIOA 4QIVA 5B0DA 4KHNA 3JTNA 1LXJA 2MSSA 5A8WA 3L2VA 3TSUA 1R8PA 3JQMA 2A3JA 3W0LA 1QS4A 1UPPA 1F1BB 5BR9A 3CCVN 3ISNC 3V6HA 3CJKB 3D7SB 4X2BA 2QEXS 4RCHA 2KRRA 2QE5A 3LL3A 4JI4K 1UVIA 3P5BP 3HSJA 4KAIA 3IO1A 5E3QA 3D5MA 1WKKA 5HAOA 3KWIA 2ADCA 1ZM3A 4DV3F 1Y10A 2ZQBA 3LGHA 4LF4F 2YV0X 3T69A 5IWAK 2CZ4A 1XIQA 2W6LA 5EUHA 1RDCA 1B3TA 1VSDA 3VESA 1K8KB 1T94A 2YTCA 3C94A 2OZSA 4K0KK 3ZXWA 3FZBA 3VF6A 1PC4A 1UJ4A 5AJ3K 3QRPA 1RGIA 2CVIA 2EW9A 4QJVA 4ZVSB 2XY8A 3D67A 3VR1A 3H4BA 1IBLK 3EE9A 1RK8A 2P51A 1OH5A 2A1BA 2O8FB 4X65J 1Q8IA 1FJCA 2WBMA 3GE1A 3ZFVA 4H5VA 3MEDB 4CLWA 4R25A 3KKSA 2R7RA 3EPGA 1EKRA 3Q8PB 2VZ9A 4KFBB 2XMJA 3JXOA 4OI3A 1S49A 1XQIA 2F96A 1FKAF 4FS2A 3SNNA 4OX8A 4R8UB 3K89A 1JCEA 5FRNA 5L9NA 3ZSZA 4LVNP 2O8BA 1TL7A 4PXCA 3I55N 1RU2A 4YUDA 1ZM9A 3M2VA 1HHTP 1NK7A 1H1VA 5KG4A 3M9MB 3GSIA 4LF9J 4K5SA 3CUNA 1NCLA 3MM8A 3JSMB 4YB6A 2P9LA 3DLGA 3QQCD 1KP6A 4WQ4A 2AF6A 2Y0SD 3DRYA 3VQCA 1VRUA 4DV3K 4PYAA 1MSWD 4JK8A 2PI4A 4LF4K 5J2NA 5AQSA 3NS6A 2D9OA 1NDPA 4IFEA 4NYNA 2KVIA 3O80A 2KVQE 4PWUA 4FWRA 3M1VA 1FD8A 2B8PA 3NNCA 2OANA 3AXKA 4H0YB 4CO4A 4CJKA 1BQMB 2RRAA 3DHWC 2EWHA 2OEMA 3EN9A 4JUZA 4FXVA 5L1IA 1C2PA 2C2MB 3G10A 1RAGB 2L3MA 2WVBA 2VUGA 3MM5B 1VQNS 5U47A 4NE9C 1TL3A 2QYCA 2Y3YA 2ILZA 3LDLA 5TKYA 3QEWA 4QS9A 1RJJA 4TLRA 3T7ZA 3UN3A 2BJDA 2AIRB 2V68A 3CQYA 4DL6A 3F2KA 2QZ8A 2WUSA 5A2QU 4FLXA 2Q0RA 3ID6A 4FVMA 2ABYA 3DLHA 5KOWA 4JI4J 4CLUA 1ASUA 5BXIA 5K5MA 3OTOJ 4FWSA 2G13A 3QGHA 3PR4A 2ZH1A 3MMJA 1S1XA 1C0FA 1RWKB 5AQHA 4Q45A 5IWAJ 1OWXA 5GADU 1IJEB 4JI2F 2E7XA 1U1QA 1NBEB 3OS1A 1GOCA 4F67A 3VEYA 4K0KJ 3JB9k 2GV1A 3HJFA 5A2QO 5AJ3J 4DV2F 1VC5A 2WB1D 2NRRA 2GC8A 2V2VA 4ED4A 3MUMP 4M5GA 4ZK7M 4U67L 2UU9F 1IBLJ 3QZ7A 3B4DA 1X0PA 3ALYA 2B5JA 4M7XA 3K58A 5JJBA 4IJNA 2E44A 5C2FA 1RHKB 3K0JA 1UJ6A 4MO5A 3AVJA 4A2BA 3D2EB 2V51B 2BX6A 1WDTA 2CQDA 2RQ4A 4CT9A 4Y1CA 2EKYA 4CYUA 4QWBA 4DV6K 1KWMA 3QERA 3NGZA 2X7IA 3IP0A 3KK7A 4BRIA 1S1UA 4E7IA 3IUCA 3P3DA 1HJRA 3L4QA 2QA1A 2IBKA 1MWQA 1YSJA 1SJFA 3UKRA 1XK8A 5CCMA 3PXGa 3PACA 1JWWA 7AT1B 1FVQA 1N5QA 3VA0A 1K44A 3M05A 1VLYA 1NHUA 5H9FK 5AQPA 2O5DA 3AH6A 1YRUA 1W9HA 1SS6A 1N34F 4UY8O 5GAEP 2G0CA 3CGIA 4FW2A 2XO6A 4DV3J 2DGTA 2VQEK 2RNEA 1FDBA 3DKDA 4V19S 5KPZA 4YMEA 3FBBA 2OPPB 3THWB 2B8QA 2HQ3A 4NLQA 3B6BA 3BZKA 2QMXA 3CCVS 4DV2K 2WK4A 1U2RA 2FIUA 1U2CA 2UU9K 4DMNA 4KH4A 1LFPA 1HWKA 4YOEA 1MMNA 2QO3A 2V0NA 3DXSX 2FYXA 2MKIA 2FBTA 1S76D 3M2RB 3KD1E 2MHNA 3RGIA 1H7WA 3NF9A 2JFKA 2HOEA 4G3IA 3THXB 4LF1A 1GAOA 4Z4CA 4PEOA 2W4PA 1GXTA 2GV9A 1CVJA 3M6WA 2B4JA 4M5NA 3DLLL 2GUPA 3THPA 3NCRA 1CZ9A 4KB7A 3K57A 1J2VA 3VQDA 3KXDA 3NGIA 3CF5L 4DU1A 3IRXA 4I2QA 4CLFA 4CO0A 4KT0C 3UI3A 4NA1A 2Y8YA 4ICLB 2DR6A 2VQFK 3ZSWA 4DS5A 2Q1LA 2I6WA 1NOYA 4KO0A 3GG4A 3VAJA 4CZLA 3SAHA 2DNLA 3QIPA 2VL1A 4PQUA 5J2PA 4RNFA 3U3YA 4PPDA 5L38A 5I9EB 3H3NO 1S5JA 3I55S 3DDKA 2FF3B 1WI6A 2VBWA 1PKUA 4DV0F 3O1WA 1GQEA 2CPYA 2RVJA 2E66A 3PSFA 3KD5E 2XTJP 4FJLA 3J7A1 2G1DA 3KUHA 1WJ9A 1WN7A 3GMGA 5H1SQ 3QGIA 2IVOA 2GWJA 2HBZB 3CI5A 3PKYA 3Q7BA 5IV3A 1RA6A 4DV6J 1FRIA 4Z4GA 1FD2A 2C2ZB 1RT4A 2XYHB 3QEVA 4NOHA 1QY7A 1C1AA 4FW1A 4DLGA 1FVSA 4RWWA 1G4CA 5MLCV 3S1TA 4J9OA 2MMYA 4JOUA 2DNHA 4DN9A 4TLQA 1Q82T 3CJ4A 3V6DA 2WVEA 4DV4J 4GO7X 1DY3A 4OYXA 4O3OA 2W4CA 2ITMA 4XPCA 4Q2LA 1YBUA 5L1LA 3SYZA 3NGSA 3RAXA 2G4BA 5H9FJ 3C7NA 2YNIB 5C42A 3J80Y 1RZMA 1GMVA 1F60B 4MYTA 4CEAA 1S4EA 4ITSA 1CQNA 2F8HA 3TW0A 3KJNB 4OO1J 2HZVA 2VQEJ 2I8EA 2IVFB 2ZC4A 1A5XA 2V67A 2G2OA 1IKWA 2YKMB 3AVGA 2P1JA 3VMFB 3DN9A 1RWXB 2JEFA 4QZVB 1JLQA 1Q82O 4IDKA 4FF3A 1OIAA 1Q9YA 2E2OA 1SL0A 2UU9J 3POTB 1BI4B 3MPUB 3OR1B 5HMZA 4DV0K 2LDIA 4BREA 4CZKA 5AQMA 1EETB 2YNGA 3MMCB 3V9XA 3IN5A 4Q8EA 3MEGB 1HHSA 1X5OA 2J0WA 3M2UA 2ZJRL 1TGOA 4A8WA 1DT9A 3EL2A 1EKSA 4H4KA 3D6HB 1RHQB 3LM2A 2ACYA 3TJ9A 3OYDA 2RIJA 2VG5A 1GX6A 1RWNB 2MQ8A 3HHDA 2HWHA 2G0IA 3PRBA 3DYAB 3OJUA 5IT9U 3SAFA 4ANDA 2F7VA 3RBXA 2GX8A 1BA1A 3FR0A 1YJWN 3OYEA 1T95A 1HLUA 4QWEA 4GMKA 1K9MT 2JZ5A 2VQFJ 2PGCA 3QSYB 1RTDA 3ZZTA 1RT5B 3G8TA 4EBDA 2GELA 2VFRA 1BL3A 2E2NA 3GZ7A 3M6UA 1KXPA 2WVDA 5AFUA 2ZH2A 2ROPA 2R7VA 5LMUF 3FCHA 4ZHRA 3MCSA 2EC0A 1TV6A 1C6VA 4FJNA 1B4SA 3D28A 5IT9O 3CJ0A 3FC9A 2R2SA 3FCVA 5M2RA 3VF0B 3O2IA 1NPPA 1E4GT 3KFWX 4DN0A 2ZF5O 2VH7A 4X66F 1BWVA 1FWPA 3SIPB 3OVNA 4Q44A 4H0VB 3SPZA 3P39A 4OX6A 2GW8A 5DQGA 4ECTA 4DR4F 4ZMMA 3MR7A 4PHTX 4MK7A 2E1MC 2FUG9 1PC5A 4L3KA 2F5GA 1GTHA 2BJ9A 4M5IA 1WF2A 4I6MB 1ZBUA 2R7OA 2E7WA 3CD6S 1HNXF 4XH5A 1ZOTA 2YI1A 1VBYA 1X4CA 1FXRA 4B3RF 3MEEB 2M5YA 2MEWA 2XLIA 4KTWA 5A6WA 1FK9A 3KZBA 1IJJA 1OQ3A 3F41A 5E5NA 1ZTWA 2G8KA 2W1BA 2BQRA 4H0OA 2VC1A 4W5TA 4BVPA 2RDIA 3HSCA 4OMFG 4CLTA 3R1XA 3FJ2A 1CPZA 1WOPA 1FTRA 4KIAA 2QSFA 1MW7A 3G0ZA 1KAXA 2OA8A 1HNWF 4RZRA 3BN4A 3IMQJ 1FHTA 3H08A 5ADXA 3TQEA 4DUTA 4WF9Q 3R7SB 3MWPA 1MA9B 3GONA 3Q89A 2J0XA 3FDSA 4KHPF 1M5VC 5T14A 5LMUK 1KKHA 4JKGA 2JHEA 2Z56B 4V1Ak 1SC1B 2IJNA 3R2DJ 1FDDA 2ZJQL 1YIJN 3SK3A 4CBWA 1B0TA 4NEYA 5A2QY 2FJXA 1IH7A 4RWTA 4DV0J 3ZT3A 3LGNA 4CERA 3W2VA 2IHR1 4X66K 3CJ9A 2RJZA 3O9SA 1HNZF 4B9LA 5KFDA 2ZH6A 1X3MA 2BV3A 5DZ6A 4FVCA 1BQXA 3TVYA 4CECA 3OTDA 1HBMB 2PFFB 4GKJJ 4BQLA 4CFDA 3D1HA 3E51A 4QU6A 1YJTA 1N6QA 5EWFA 2B9XA 1FXXA 5LJ5Y 1HNXK 4QPTA 1H6KX 4OZ1A 2QA2A 4AXJA 4B3RK 1VQPN 3HHLC 3B6OA 3VGUA 4C8LA 2D7SA 2VWKA 5HMXA 1XMOJ 4M5JA 1YDLA 4KHQA 2CPJA 2NUBA 4TVAB 2KI2A 1FXDA 5G4DA 2O4IA 3LP1B 3KNGA 3UKUB 2HPUA 3ILLA 3RBZA 5DM6Q 2UVRA 4DR6F 3O8MA 3PIOL 3WT0A 3V2UC 2HVHA 1ASWA 1HNWK 4Z7YA 4KQZA 3N6MA 4ILGB 2FLNA 2CIMA 3GJSB 4KHPK 4ZPCA 1LNQA 4L73A 3HCXA 1DTTA 3QBXA 3QAUA 3VQ9A 2MKYA 1K73T 2HHVA 1EJ7L 3NKYA 4I2PB 4KV8A 2VDIA 1YBTA 2ASYA 4FYWB 1HNZK 2PBDA 1WOQA 1NEEA 4QWAA 4H5TA 2YX7A 3DOKB 2RMLA 2EG1A 3IFEA 1R43A 1YX2A 2PO4A 4X62J 4GVEA 3TOQA 4HI2A 3I32A 2YKQA 1BLUA 3Q8YA 4ED8A 1SJQA 1X9SA 1E6YA 4USUA 3KLGA 2D3ZA 2DRAA 3MCPA 3HSTB 2B7CB 1JL2A 4E1NA 5AQLA 4KHWA 5HROA 2V2ZA 4JI7F 2QC3A 4ZCMA 1U0HA 2EFOA 4HT5A 2C3YA 3MM9A 1SKWA 2CQIA 3IM8A 1RT3B 1RHRB 1L3UA 1D9FA 4AE5A 2W9CB 4ZPAA 2KDOA 2XS2A 2DFFA 2G8FA 5LMUJ 3AO3A 3TABA 2V8DA 4ANCA 2V9WA 1QQNA 3QFWA 4KC5A 3TJAA 1WLJA 3SUNA 2JWLA 5B7WA 2YNFA 1UL3A 1YJWS 3LQVA 3OS2A 4DX6A 3WX8A 4X66J 2GX9A 4M41A 1ZAWA 5EWEA 1K6YA 1EWQA 3HD2A 5CR4A 2HMPA 1S4FA 3QSIA 4H54A 3OYLA 4OYBA 4N47A 3A5OC 3M8PB 4O0IA 1R59O 1Z4UA 4EIAA 4CD3A 3DGPA 3CFPA 4DOZA 2OFGX 4BS2A 4UY85 2OPQB 2Q66A 1HNXJ 4IR9A 3TSQA 4B3RJ 1ATRA 1YT3A 1G3OA 3N4QA 5K14A 2R8IA 3A12A 4ZVHA 1Q53A 3VVTA 1T3VA 2G8IA 1WSRA 2RF2B 1AUSL 4J91A 3JSRA 4E1MA 1GLFO 4O3RA 3P83D 3HHEA 1BMQB 1IO2A 4JI7K 1WTFA 2GVDA 2GJ2A 4KKOB 1I3OB 1UW9A 4HUEA 3O44A 3PJWA 3WIVA 3HVTA 5HL7L 2YNHB 2BABA 4RTFD 1VIOA 4LBPA 1AA1B 1HNWJ 3CMES 3FSYA 4ZVOB 4LVOP 4AHSA 1NGBA 3OHAA 3W7BA 1QE1A 4CQ1A 1SQKA 1RT6B 4Y1DA 3VGTA 1JLAB 2AJQA 1RTJB 1H2UX 5A8WB 4HUFA 3TA0A 4DL5A 4WE1A 2RQCA 3THYB 4P2SA 5HRNA 1HWLA 4MK9A 4EK2A 2CUYA 4L8RB 1UEVA 4F0MA 3TUJC 1FDNA 4ISEA 4M3TA 3A5NC 2Y0BB 4WWSA 3SUOA 4B1YB 1EARA 4X4RA 2ZJPQ 1RXOB 2I0XA 4F8RA 1NU0A 5EX5A 4F36A 1VQ7S 1Z25A 1B7FA 2LA6A 3O8WA 4HYKA 1W97L 4KTQA 4HCBA 1YIJS 2BKNA 4H4MB 4URGA 1W2BR 4JKCA 2A2DA 2ATCB 3K0SA 4ZVRB 1JLFB 4GMJB 2DRBA 4XO0A 3IWLA 1RT2A 3BPSP 1UMJA 4M1KA 2XS5A 2HBLA 1LXNA 2WTUA 3H8YA 3FSIA 2E1CA 2UUAF 3E2EA 1HPMA 4FWQA 3D0IE 5CD4H 3CJSA 3UNYA 2Z1HA 1QDUB 3MECA 3KKFA 2UV8A 2JFDA 5EOYA 4M5KA 1WORA 1NSQA 1OKJA 2FLOA 3V1QA 4NZ7A 4EMDA 5D3GA 1XC9A 5KG2A 3PYGA 4ZLLA 5FDLA 2WW4A 4FPIA 3DLRA 3SCIE 4PWDA 2W9BA 1B99A 3UVJA 4QCLA 2KU7A 2XMMA 2OIHA 5D78A 2NRXA 4AHRA 5KFLA 3NAHA 1NGAA 1J53A 1I1GA 4FXWA 4WXWA 3FZLA 3HKZD 4ZVFA 2RS2A 5AZJA 1JLCA 2B6AA 2ZEJA 4CF8A 3M30A 3WNHA 4MFBB 3MXHP 2P9LB 2XSFA 4JI1F 1CLQA 3KHGA 3W65A 1EAYC 3TAMA 3P49B 4IOBA 3UPFA 2UVWA 5I3UB 2D4WA 1VRUB 1MN7A 4CLYA 5J2NB 1WUUA 4WFBL 3BR9A 5D0EA 4BR0A 5CYQA 4JI5J 2DGXA 4JKBA 2Y9HA 4GVMA 1S57A 1TKXA 2DNRA 1J27A 1RAEB 2PA8D 3M1VB 3DOLB 2ZNYA 5DGBA 1U2FA 2D41A 5KPRA 1U2VB 1BXNA 1IBKF 3FFIA 5AQFA 2UUAK 2PY5A 2W24A 2OEKA 4DR2F 3L4BC 5AQGA 2V8VA 1ZM2A 1IVZA 3MR6A 4ATNA 4U8VA 1GXUA 2M2BA 2WSFC 2HQFA 2HF3A 4DTNA 1DAXA 4DBQA 1VRQC 2VDHA 2RQMA 1OO0B 3V9UA 1TL3B 3S9HA 4QW8A 1HR0K 5SUHA 3C6UB 4AHUA 4CT8A 2M8DB 3WEEA 4B3MJ 1JLEA 4F9OA 3PHEA 1JJ2R 1WOOA 5KFMA 1LWXA 2FJWA 2NYIA 3D66A 3NCPA 3TR5A 5LMNJ 3LDQA 2F40A 4K25A 1H73A 3TANA 3NH0A 1YI2N 1YK9A 4EAHD 3GFHA 3RB6A 3LM9A 4ECWA 2CPDA 2AX0A 4FS1A 2B4UA 1S1XB 4JI1K 4KBIA 3THVA 3Q23A 2HZCA 4CJ3A 2NRTA 1SI9A 1Q5VA 1KAYA 1OMSA 2Z0GA 2I7PA 3C14A 1BWEA 5HBMA 2RUSA 4ZPTR 2C3PA 4CO1A 1NMDA 2LFVA 5M2PA 2NLWA 2OZMA 1LK5A 2E6MA 3L7UA 4D3GA 1GMUA 5AQWA 4HH0A 1GH8A 4FDFA 3GFXA 3CCEN 1QM9A 1VQ5N 1WSEA 3QEPA 3HDSA 4CJEA 1IM4A 2V4JA 5ETVA 4K4YA 1XR6A 2FVSA 2QFIA 1OJ4A 4BR4A 3RMBA 4DR2K 4Z37A 1O5JA 3NFAA 4O5BA 2GGPB 4JI0F 1IV0A 1TUUA 2VONA 3LP0A 2JC1A 1RBUA 3M8WA 4YR0A 3EZ5A 3R6MA 1SCJB 4ZS6A 1S1UB 3Q2TC 3PNIA 1UP1A 1B9FA 3ULEB 4AM7A 3HL8A 1HNVA 4IOAQ 4C23A 5KT2A 5BN9A 1NG9A 1EX8A 4BACA 4J9NA 4CI0B 1TKDA 1GMWD 1NK4A 3NMRA 5LM7E 1HWJA 1NUEA 3ASMA 2CQ0A 3T9ZA 4ES2A 1IUJA 3C0BA 4NWBA 3O1LA 3VEZA 1Q81T 4YDDB 3SQGA 1X3NA 2PD1A 2O8EA 2DEJA 1WNEA 4M7YA 3P45B 2OPSA 3W64A 5JICA 2LLZA 2FBVA 3M1FA 1HQ2A 4AHTA 4BR7A 2CRLA 1A9NB 3JQKA 2CQ3A 3MAQA 1S6UA 1NDKA 3HTVA 4HEA9 2XB2D 3BR8A 3K5OA 4CK2A 1JXLA 3FZKA 4JV1A 1JLBA 2JEJA 1HARA 2CH5A 5D4NA 5J2MB 3W62A 4C4WA 5DLFA 5IM0B 1RWMB 2CPEA 4YB7A 4ZVEA 3OYKA 4ED6A 3HT0A 3QBWA 1U09A 3QFHA 1VSMA 4AQYF 2D0OA 2Z4PA 3CCZA 3D0HE 1CJUA 3RUBL 1FXLA 5EWGA 2C2KB 4PG8A 3SFUA 4PY5A 2IYIA 2YY3A 3U3GA 1RAFB 3TUIC 3GV8B 1HR0J 1S1VA 3D3CJ 3O1BA 3MR5A 3MCNA 2FD2A 1HWUA 4IG3B 2GNKA 1VS3A 4FM2A 1FO1A 4O3QA 4A48A 3WXMB 1TMMA 2IMOA 3CVKA 3CC2N 3QBCA 2WTFA 3WXIA 3WNGA 3V1OA 5C10A 1U6ZA 4KO0B 3B4MA 1WSHA 4HHUA 2L41A 4WBFA 4BBYA 1NSPA 1UZHA 3QT7A 3ZZRA 2BR0A 5DG7A 3QIPB 1SIZA 2W2NP 1F21A 4KR0B 4M5LA 5BYQA 3J81U 2NPIA 2RHSB 4J9LA 4LFBF 3BSNA 4I56A 1FE4A 4HACA 2BACA 4M8LA 5JVGL 3UFCX 4IO9L 2HHPA 1LKZA 2MZTA 4NLDA 2ASLA 2OTJN 1QVFR 3DXBA 1TUWA 3FZ2A 4JV0A 1FJGF 2HS3A 4X4NA 2KM8B 4RWXA 3ZNJ1 3NGYA 2DK2A 2ZDPA 4YR2A 4ECZA 4WP3A 1IBMF 2J0QD 5JXSA 2WCXA 4EUVA 4LD0A 4DR2J 3FMBA 2HZAA 1BC6A 2ZOMA 2P8IA 3RYLA 4AQYK 3J81O 2DNKA 2BDPA 5J1EA 2YJEA 4DTXA 3CCQN 5A6PA 5HVHA 4ZVPB 2L9WA 2YKOA 4HDHA 5HMWA 3FFKB 1CZBA 2MZRA 4QIGA 3W2WA 3EVOA 3QNNA 5CYMA 1TKZB 1G99A 4XPEA 1N32K 3IS9A 1XERA 2D9PA 3L2WA 1P1LA 1B64A 3VQBA 4BG9A 3DLEB 2B4VA 3AA8A 1Q8BA 1MWYA 3VEOA 3UNGC 3AQOA 2HNZA 3MD1A 2KM8C 4CH7A 1U4BA 3CCRN 2MKSA 3QJPA 2DO4A 4OI6A 4ZN3A 1B70B 4DR1F 1CLFA 4NZ0A 4ECXA 4ECQA 5GAGI 4PG6A 2GO8A 4DCJB 3AD7C 4LFBK 5BJRA 1UVMA 5AE3A 2E9TA 3MR3A 1JL1A 4E89A 4H5RA 2PDAA 2OI2A 3AA2A 1NK0A 2WVCA 1AT1B 4H4OB 1YI2S 1S97A 1LQ9A 3NDKA 1VQ9N 4WU2A 2N82B 5HRPA 1P6TA 1TAQA 3DMJA 1XMQK 5A76A 1IBMK 3QIDA 3M2UB 3F9MA 3B82A 3VN5A 2RT3A 2XNRA 4WJBA 1W0HA 5C25B 3OD2A 2R7XA 2LCWA 3NP5A 1K0VA 8AT1B 2L9DA 5KG5A 5F0WA 1R7IA 1IKXA 5AQKA 5B0FA 3W9JA 1S72N 1VQ5S 4LFCK 4NXNF 4CO5A 2LMIA 4LREA