2B5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 133
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b5jA05
2BANA 1I6JA 3NHGA 1VRUB 2I5JB 1RDRA 3LWMA 4XO0A 1S1VB 4NLXA 4KSEB 1BQMA 3VQ7A 1WNEA 3MR3A 1TVRA 1S6QB 5HROA 4EBDA 4DL4A 3QO9B 5L1IA 4O0IA 3B6OA 1RTDB 1EX4A 1TV6B 1U49A 3K2PA 2F8EX 1L5UA 4OKEA 4E7LA 3OL7A 2PZSA 4DFKA 4CJWA 4F3OA 1TL1B 2OPPB 4FBTA 4W5NA 2XY8A 4NLOA 4WFZA 3BGRA 1HNIA 2F8TA 3D28A 2RKIA 5KI6A 1N6QA 3TAMA 1JLAB 5HRNA 4H4MB 3CJ5A 4E7JA 1KRPA 3FQLA 4CGFA 1L3SA 1IKVA 4JUZA 4C8KA 4NLPA 3ZT2A 1S9GA 4N76A 1T94A 4JS4A 3LPUA 4RG8A 4AILC 4J9RA 3BR9A 4ZVFA 1JLBB 1RT2A 4RZRA 3OYHA 3QESA 1RYRA 2B6AA 4CEFA 4R5PB 3EPGA 2IDOA 3ZSRA 1C0MA 3KJVB 4MQ3A 5C24A 5EUHA 3F73A 4DTUA 4HYKA 3SFGA 1ASUA 5KTQA 4EBEA 4RW4B 4FJNA 4KHWA 1WSGA 2ATQA 4R0EA 4KRFA 1TQLA 2C28A 3MAQA 1S49A 5KFJA 1R0AB 4GC7A 3M8PA 4K4ZA 4RNNA 4KHNA 2OH2A 4PUOB 4O3NA 4NCBA 5I3UB 4KAIA 5KFEA 2X6SA 4CEQA 2O5DA 2YNIB 2GIQA 4KHUA 3C95A 5KRTA 2O4GA 4MK9A 4QWAA 4CHNA 3VQDA 4CE9A 5FRNA 1C1BB 3MF5A 4Y2CA 1VRTB 4QWDA 3IGVA 1C2PA 3NF6A 3KNAA 3OS1A 1UA1A 3ICLA 2WB4A 3H98A 4CIFA 1RDCA 3I0SB 4CIGA 3VA0A 2ASDA 4LSLB 3DLGB 3ITHA 4CHPA 1NK0A 2FJWA 3H5XA 3OVNA 5KFAA 1Z26A 3PX6A 3KHGA 4OJRA 4E7IA 1NJXA 1IKYB 4DTNA 1NNDA 4FLTA 3MTKA 4YMEA 1JLQB 4ZHRB 2G8HA 1MU2B 3V6KA 3K5MA 4Q0BB 3QGIA 4CJKA 4Z4GA 1EXQA 4CF2A 4QW9A 3FSIA 1JL1A 3V6DA 4I7FB 2OPQA 4WFYA 4HUFA 3G6XA 3LP1A 5KFQA 4CJPA 2WHOA 1JLEA 3QEPA 2WONA 2VA2A 4X2BA 4E89A 2HNDB 4Z4HA 4EP5A 1XHXA 2HHVA 3DRRA 1KCFA 3V9XA 3C6UA 1SKWA 3GIIA 3AVNA 1RT1A 5HLFA 4KHSA 3OHAA 4ZTJA 4OL8A 4NLDA 1G15A 2XY7A 1XR5A 1REVB 3OYAA 4J2AA 3CG7A 4IKFA 3CFOA 4TY8A 5KT6A 3QEXA 3GIMA 4RNMA 4E3SA 4LD0A 4MFBA 1BQMB 3L3UA 4RW8A 4BE0A 3FDSA 4F4WA 1TVRB 1J5OA 5KFVA 5HBMA 2XGPA 2VWKA 4HTUA 4CFAA 4ECYA 4RW6A 3PW5A 4M3UA 5DQGA 1GOAA 5KT4A 2EX3A 3MECA 5KG1A 3UQSA 1I39A 1LW2B 1LAWA 4CF1A 4CJTA 3LAKA 1HNIB 2J6UA 3N6NA 4F50A 2BQRA 5KFMA 4IBNA 1HRHA 2OZMA 3NGIA 2RKIB 3AA2A 1N6QB 3AO4A 3TAMB 2UUTA 3AO5A 4ZP7A 4O5BA 1IKVB 5JXSA 4O0JA 1U45A 4FZYA 1S9GB 2KFNA 5KG5A 1NOYA 4I2PA 4DL2A 3EY1A 2FBXA 1RT2B 4AHSA 4FJ5A 2D3UA 1S48A 2B6AB 3QGGA 4JRPA 4FJXA 5C24B 3MEDA 3NF8A 4L8RB 4FS2A 4I2QA 4C8MA 3JSMA 3HPHA 4DSEA 3NH0A 4K4UA 2HW3A 4EO6A 5KRSA 3DOLA 4RW9B 1S4FA 4CF0A 3KHLA 5KFUA 3KD1E 3AA3A 3UR0A 3M8PB 2DY4A 5J2NA 2JEJA 5KFPA 3VN5A 4UQGA 2FJVA 4M45A 4FYDA 5J2QB 3OSNA 4O3QA 4YR0A 5F8JA 3A2FA 3O4QA 3NE6A 2HWHA 2I1RA 5KFFA 1C6VA 1RT7A 4GMJB 1RT3A 3MXJA 3VA3A 3RR7A 4ECZA 2J6TA 3PO5A 5DQHA 4M3RA 1L3VA 5KFSA 3Q8QB 1U47A 4KFBA 1EKEA 3ITHB 4ED8A 3MEGB 1FKOB 4CJ5A 1ZBUA 3K5NA 1Q8IA 3I0RB 3RB6A 1N48A 4MKAA 3WNFA 4FLZA 4EO8A 5F9NA 1JXEA 3OLBA 2D7SA 2XY6A 1KHVA 1RTJB 3PX0A 3DM2A 5CYMA 4B9UA 4J2DA 2OPQB 1ZBHA 4BWJA 2OPSB 3IS9B 1IG9A 3LP1B 2IOCA 1NOZA 4RNFA 1W25A 4Y1DA 3PW7A 4KO0A 3RMDA 2WONB 4W5OA 3MR2A 4JV1A 3OYNA 3KLFB 4CK1A 5T14A 2ZE2B 4ECUA 3I5BA 3DRRB 4EBCA 1WSJA 3C6UB 3HVAA 5CYQA 1KVAA 4NCGB 4LSNB 1RT1B 4DF4A 5HLFB 3OYDA 1LW0A 4JRQA 1DTTB 4NYFA 3BQ2A 3VQCA 5HRPA 4DSKA 4TY8B 4DL5A 5D3GB 3T5LA 3QLHB 2WRMA 5KFWA 4DFMA 3QEWA 1LWCA 4KHYA 4RNHA 4RW8B 2KQ2A 1L3TA 1C0TB 2HHQA 5KG7A 5KFIA 4AHCA 2O4IA 1SUQA 4WFXA 2F96A 5DG9A 1S9EA 3SUOA 1NJYA 1J5OB 5HBMB 1S10A 4KKOA 3M9OB 1CZ9A 3M9NB 5CY4A 2W8LA 4F4XA 1LWFA 1WSEA 1RTIB 3S9HA 3M8QA 1RT4A 4H8KA 2R2UA 2AGQA 3CDWA 1J53A 4J9PA 2WOMB 2AX0A 4O4GA 1C0UB 4J9SA 4PQUA 5C25B 4GW6A 4CEAA 4CEZA 4WE1A 3CFPA 2YNGB 4NRTA 3RB3A 3O3HA 2IS3A 2XCPA 1C1CA 2EC0A 4PWDA 3OYLA 4J9MA 4IR9A 3UPFA 3PW2A 4KB1A 4Q8EA 4J9QA 1JKHA 4ZP9A 1NK5A 4M42A 3NFAA 4WYWA 4KV8B 4F4KA 4IG0B 4I2PB 4ED2A 4WZMA 4PY5A 3V9ZA 4DS4A 4HHTA 1BCOA 3WNGA 4CJRA 4FJHA 1HMVA 1FK9A 1JLGB 3RMAA 4OVLA 4JS5A 2UVUA 4I2QB 4G1QA 3JSMB 1TGOA 1JXLA 3Q8SB 1WNSA 3MXMA 4NLWA 4LQ3A 3DOLB 1Z4UA 3DDKA 2R8HA 2ZQBA 4DQRA 1SH2A 2AJQA 5DK5A 4AHUA 3KK2A 3DRPA 1TK8A 2HHSA 1S1TB 4DG1B 3KLGA 1NJWA 4XPEA 3DYAA 3O4NA 2XGQA 1L3UA 2DFHA 1VSMA 4DL6A 4WYLA 3V4IA 2RF2A 5HRRA 1RT7B 4YR2A 1KLMA 5HP1B 1BI4A 3OS2A 3Q8PB 1N5YA 1HQUA 3VQ5A 2Y1JA 4IRCA 3VQ9A 3EZUA 4FJ8A 3TVKA 4LY7A 4OLAA 4B9SA 3LP3A 3QNOA 5L1KA 4CFCA 4CF8A 1HARA 2GUIA 3HSTB 1S1UA 4KE5A 1FXXA 1D0EA 2JC0A 2EHGA 1SV5A 5FDLB 1GX5A 3DLEA 3BSOA 2C2RA 1TK5A 1FKPA 2ZKUA 3HVWA 5DG8A 4CGIA 3PO4A 3DM2B 5CYMB 4PA1A 2AQ4A 2DFEA 3AV9A 3V81A 4KPYA 3IAYA 3VQBA 4CJ3A 1JXBA 3L2UA 4OPKA 1A5VA 4KO0B 4HVJA 3H59A 4N47A 5JUMA 3SCXA 4YQWA 4JV0A 3HVRA 3T5JA 3L2RA 3V6JA 3ALYA 3AVFA 1RAJA 3L8BA 4MKBA 3CDEA 5J2PA 4CESA 3SQ4A 5EU7A 4CJEA 2A1SA 3CDUA 1B92A 3MR6A 1X9MA 1S6PA 3ULDA 2DPJA 2KW4A 2HMIA 2IJNA 1N4LA 3PX4A 3DMJA 1HNVB 1CXUA 3NGYA 1LWCB 4F8RA 4FW2A 2G8WA 2VG7A 3LDSA 1KFDA 2IM1A 5F8MA 2D3ZA 1BHLA 4M94A 4FJLA 1JLCA 1LWFB 2IAJA 4DSIA 2YKNA 3M8QB 4FVMA 4TSXA 2QXFA 4DQQA 4J9NA 1IKWA 3LAMA 4IFVA 4DFPA 4EP4A 4CEBA 2AGPA 2YNHB 3KK1A 4O4GB 3CJ4A 4PQUB 3KTQA 5FROA 3KLEB 3B6PA 1JX4A 3BREA 4YR3A 2HHXA 1TAUA 3DLKA 1T3NA 4M3ZA 4GVMA 2B4JA 3CYMA 4CF9A 3M8RA 4F2SA 5F8LA 1RILA 3L2WA 4XIUA 3DLBA 4BDYA 2FVSA 1HYZA 3OYIA 3SV3A 2KZZA 1JKHB 1VSIA 2X6NA 1K1SA 4M3YA 3V1RA 4E7HA 1DLOA 2FLPA 1S1XA 3TARA 1LV5A 1KLNA 3KK3B 1RA7A 4IOBA 4J9KA 1TKTA 3CJ2A 2FBVA 4CHQA 3SI6A 4M3TA 1WLJA 3BJYA 1XHZA 2UVVA 5F8GA 1QHTA 4DLEA 3LP2A 4QPXA 3PR4A 1NHVA 1KVBA 3QETA 2YKMA 1T03A 2J6SA 2D5RA 1RT6A 4CJSA 4ZTFA 1BISA 1NK4A 3PJWA 4ECXA 3VQEA 3PY8A 3I5AA 2ASJA 3MEEA 3KK2B 4FW1A 3F9KA 4FLUA 4ICLA 4FLVA 3QNNA 4B9TA 1QE1B 1XWLA 4Q8FA 1D9FA 5KT2A 1GOBA 4FM2A 4W5TA 4XPCA 3ZT4A 3V4IB 3H4BA 4YNQA 4ED7A 5KGWA 1Y97A 1LWEA 5I42B 1JLFB 4IH6A 2ILZA 4ECTA 5KFXA 3G6YA 5K14B 3T5KA 2IM3A 5F8HA 4AHTA 3UIQA 3DLRA 1D8YA 3WNHA 4KHRA 3OYMA 2RDIA 3GV8B 3HP9A 3P83D 3BQ1A 3HKWA 4CERA 4QOZB 4MK8A 3CJ0A 1T05B 1BIUA 4CGJA 3HVTA 1SV5B 2BANB 4ED6A 3RMBA 4ZVEA 1J54A 1FKPB 2Z1HA 2DPIA 5DG7A 2KZMA 1ZTTA 1QAJA 3NAIA 5J1EA 1WAJA 3AVAA 3V81B 2R8GA 4TYBA 5HROB 2D0CA 4FLXA 3K5OA 1IH7A 3RWUA 3D45A 4H4OA 1CSJA 3EYZA 4URQU 4ECVA 4Q44A 3KLHA 4OPJA 3K59A 3THVA 3QIPA 4DSFA 2PYLA 1TKDA 4KHQA 2WK4A 3TANA 3I5CA 3BGRB 4DU3A 5J2PB 1QSYA 1S0NA 1S6PB 5DGBA 4IH5A 5C42A 1HYSA 3DOKA 4IDKA 3OS0A 3DI6A 3NH2A 3DMJB 5CZ1A 4K8ZA 2UVWA 3PHEA 2QKBA 4CJ4A 3SJJA 2IGIA 2UVRA 2HNZA 4TN2A 1SH3A 3SNNA 1RCHA 3PW4A 1VSJA 1D1UA 2YNFA 2P51A 1GOCA 3U3GA 1KTQA 4O44A 4ZP8A 1QSSA 3VQPA 1JLCB 2IAJB 5KFNA 4BWMA 4KHMA 1IKWB 4IFVB 2PY5A 3KK1B 2BDPA 4E19A 3HHKA 2C22A 1RDDA 4F4ZA 4TQRA 3CIZA 5J2MA 3H5YA 3CVKA 2XC9A 1XC9A 3ZT3A 3DLHA 3G0ZA 2IM2A 4CJVA 3MXIA 1CZBA 3C6TA 4MIBA 5EDWA 4ED1A 4H54A 5KT7A 3L2VA 3SUPA 4AHVA 1DLOB 3GILA 1ZBIA 1S1XB 5KFTA 3FFIA 2BRLA 1SL1A 3TQ1A 3SYZA 1QUVA 1RYSA 3NGZA 3E01A 3ZSWA 2HVHA 2FVRA 3VQQA 3E51A 3HM9A 2YHAA 2E9TA 2YKMB 1JIHA 3ZSYA 3NDKA 4WXOA 5DLGA 4DQIA 1YTUA 4FM1A 3IG1A 5DQIA 4OGEA 2YHBA 1RA6A 1NK6A 2Z1IA 4DQPA 3DRSA 3TAGA 5KFGA 3MEEB 3ZT0A 1S1WA 1EP4A 3OYKA 3TAPA 1YT3A 2C2EA 3LZJA 3Q8RB 3RAQA 4DFJA 3V6DB 1S9FA 3ZSZA 5C5JA 3AVLA 3HT3A 2XCAA 4DTRA 1BQNA 3IRXA 2W42A 3BSAA 3QINA 4OKKA 4B9NA 1JLEB 1HQEA 1Z25A 4NLTA 4HCBA 4ECWA 4ZPCA 1VRUA 4NLSA 2I5JA 1X9WA 3RMCA 4ZPBA 1HPZA 3BDPA 1S1VA 4Y34A 1ASVA 1ITGA 3HK2A 2F8SA 5SZTA 1YVUA 5EWFA 1IM4A 3CM5A 3PZPA 2VWJA 2IA6A 1VSDA 3QO9A 2WCXA 2HWIA 5KFYA 1RTDA 4DF8A 2B5JA 3QEVA 1TV6A 3NAHA 1BL3A 1B9DA 3HVTB 1ZBFA 4BE2A 1S0OA 5KG3A 1RBRA 3AO2A 2ATLA 4KB7A 4CJQA 2E4LA 3CO9A 4MFBB 3GV5B 3RBEA 4J9LA 4K4SA 2CKWA 5JS2A 4QWBA 4K4XA 1JLAA 4H4OB 3VQAA 4RW6B 3L3VA 5KFLA 4RW7A 5L1JA 1N56A 4URGA 3KLHB 3QIPB 3MR5A 2BE2A 4O3PA 3PV8A 3MECB 4DTOA 4CCHA 1D9DA 1S97A 4IG3A 3KHRA 5FRMA 4FJ7A 4ED0A 3L2QA 5C42B 4R5PA 3CFRA 2WTFA 1XI1A 1HYSB 4DEZA 4DL3A 3RB0A 3KJVA 1JL2A 4DTXA 4QWCA 2FVPA 1K6YA 5EWGA 3PVXA 2BQUA 1F21A 1QQCA 1CLQA 1RTHA 5T7BA 3AVIA 4IH7A 4Y1CA 2B43A 2YNFB 1MMLA 3SPZA 1R0AA 2FJXA 3V1OA 1TKZA 4M41A 4TXSA 4PUOA 4NZ0A 4BE1A 1HJRA 3MEDB 1RNHA 3AVKA 4IQXA 4CK3A 2JGUA 2JEIA 5HRSA 2P5OA 3LP0A 4K4YA 3SPYA 2VA3A 1RBVA 1C1BA 5J2MB 3QZ7A 2BR0A 5J2NB 3OL9A 3GIJA 2RN2A 3I0SA 2GBZA 2AX1A 4NLQA 4LSLA 2JC1A 4ECSA 3FFIB 5KG6A 4EZ9A 2ILYA 3ZSQA 1RBSA 5DGAA 4E1MA 3FQKA 1RT3B 4M3WA 1UOCA 1UWBA 4ZHRA 3E01B 4IFYA 3N6LA 1TAQA 1MU2A 4KB0A 4Q0BA 4B3OA 3NAEA 3GQCA 4Y2AA 4BDPA 4BACA 3HL8A 4KFBB 1RDBA 3IG1B 1U4BA 1SH0A 4URSA 4ECRA 2FVCA 2ETJA 4MK7A 4Z4EA 4DU1A 4LH4A 3ISNC 1T7PA 3ASMA 1VSKA 4CGHA 5KFCA 3GIKA 3LANA 3NGDA 5JS1A 3VQ4A 3G86A 4EYHB 4FLWA 1TK0A 2PYJA 4ZPDA 3OHBA 4U7CA 1REVA 4Q45A 4C8NA 4FS1A 2OPRA 3ISND 4JLHA 2XO7A 1I3AA 1KSPA 1HQEB 4TY9A 3D0PA 4RUAA 4FJ9A 3RBDA 1HPZB 2BRKA 4HUEA 3SQ1A 5CYQB 4E1NA 1SKSA 3T1AA 4LQ9A 3OJSA 2JEGA 3NH1A 4GC6A 3LZIA 3O3FA 2OZSA 4Z4CA 3I8DA 1BCMA 1LW0B 3T3FA 3QIDA 2B5JB 3TABA 2R2SA 2RDJA 3PW0A 2FLNA 4DTPA 1S5JA 2QE5A 4E7KA 5KFRA 5KFHA 5KG0A 3TAFA 1W0HA 1VK0A 2IM0A 1X1PA 3MFHA 1LW2A 4IR1A 2JLEA 3AVHA 4ELTA 1SUQB 1GX6A 3S3MA 1NKEA 1S9EB 4ZVHA 4DMNA 3KLIA 4KTZA 4KKOB 3IGNA 3HXMA 5F8NA 4DTJA 1TP7A 4RW7B 4AH9A 2AWZA 1RT4B 2R2TA 2BE2B 2VG6A 3AO3A 2QKKA 4KTQA 4KAZA 4WXWA 4Q43A 3HP6A 5DLFA 2AU0A 4KI6A 4WE1B 4IG3B 3SQ2A 4TQSA 3K5LA 2W9BA 4NYNA 3HYFA 1UA0A 1VSHA 4CJFA 3RRHA 3TR8A 1UAXA 1C1CB 4PWDB 4Y3CA 2AGOA 4QCLA 3RRGA 2R7YA 4HKQA 4J9OA 3TWHA 2A1RA 4CHZA 3TAQA 1OS5A 1RTHB 4F4YA 1U09A 3VQSA 5DMRA 4RW9A 3PUFA 3ZCMA 3TI0A 3HPOA 1WSFA 3RB4A 1TKZB 1SL2A 1HYVA 1HMVB 1FK9B 4MIAA 4ECQA 4R8UA 3VQ8A 3P1GA 2VG5A 5J2QA 4CEEA 4CECA 4G1QB 5KT5A 2KTQA 4O3OA 3LP0B 4W5RA 4LH5A 4CGGA 4CHYA 4B9LA 4M3XA 3SQ0A 4ZP6A 3NF9A 4CFBA 3V6HA 2IC3A 4O55A 3KHHA 3DRPB 3KLGB 3VQ6A 4I9QA 5SWMA 3DYAB 3AVBA 3QEIA 3MEGA 3WNEA 1FKOA 5L9XA 3T5HA 4FM0A 4ELVA 4ID5A 3I0RA 2RF2B 3SFUA 2QV6A 2HHTA 1KLMB 4HCCA 4MH8A 1BI4B 4FZXC 1UWBB 4N41A 4B9VA 4IFYB 1N5YB 2GIRA 1HQUB 1KFSA 4NYZA 3NCIA 3OYCA 1X9SA 3H40A 1RBUA 4B8CA 4OLBA 1RTJA 4B3OB 2V4RA 2P1JA 2OPSA 3IS9A 4FK4A 2HNYA 4DSJA 1ZETA 4Z0UA 4NLUA 4FZZA 4TLRA 1S1UB 3BQ0A 3OLAA 4Z4FA 3AO1A 4CIEA 4ZMMA 1NK7A 5CZ2A 3KLFA 4RNOA 2ZE2A 3DLEB 2E6LA 3V9SA 4YP3A 2R8JA 4NCGA 3PJXA 4ID1A 4K4TA 3ZSXA 4LSNA 4Z4IA 1ZYQA 4FXDA 3SUQA 3CQ8A 1DTTA 3QYYA 1IO2A 3OYJA 2OPRB 3SI8A 1KVCA 1BGXT 3LWLA 1K1QA 4RUCA 3KD5E 5D3GA 1TL3A 3QLHA 1XR6A 5E41A 3SUNA 1C0TA 2W7PA 3AVMA 3OL8A 2XY5A 1EETA 3KLVA 1NKCA 2IBKA 1RTIA 4KI4A 1NK9A 4IRKA 2HMIB 3NF7A 2W9CA 2XHBA 2WOMA 2Q3SA 2KFZA 3AA5X 4K8XA 1C0UA 2V9WA 2R8IA 2G8UA 2GV9A 4CJUA 5C25A 2VG7B 1Q9XA 1TKXA 4CEOA 4BDZA 2YNGA 3OJUA 2R8KA 2ZD1A 5KFDA 4E0DA 1S0MA 3KLIB 4F3TA 3OYBA 2D0BA 2DFFA 5KG4A 2HVIA 2YKNB 5L1LA 2XRIA 4CHOA 2VG6B 4K4VA 1T8EA 4KV8A 4IG0A 3NMAA 4FJJA 1RT5A 3KMSA 4NCAA 2FBYA 2W9BB 4YFUA 3DLKB 1LAVA 3QGHA 4O3RA 4CGDA 4ZVGA 2OA8A 4CFDA 2CJQA 1NK8A 1D5AA 1JLGA 2V0NA 4HUGA 5KT3A 2W7OA 4O4RA 2Z1GA 1U04A 2RPIA 3T19A 2FC0A 4QW8A 4IKAA 1A5WA 3BSCA 3D5MA 4U6PA 5KFBA 1DTQA 3H2LA 4DU4A 1TKTB 3U6FA 2DTUA 1RBTA 4QWEA 1W9HA 5KGXA 2G8FA 4JV2A 1J9AA 1S1TA 4DG1A 3BSNA 4R8UB 3LP2B 2VG5B 2NUBA 4F2RA 3NBPA 2E9RX 1CXQA 1T03B 4M95A 1IKXA 1WN7A 1RT6B 2R2RA 1B9FA 3P5JA 4OKJA 3K57A 1SL0A 2FBTA 5HP1A 3MFIA 3RR8A 3SZ2A 2IC3B 1ASWA 3SV4A 4FK2A 1ZTWA 3KOAA 4KTWA 3ZSVA 2XWYA 4ELUA 2FLLA 4I9LA 4ICLB 2BGGA 3S3NA 4O3SA 3AVGA 4K50A 5F9LA 1RDAA 4K4WA 2UUWA 3U3YA 4DSLA 4ID5B 3AVJA 3JYTA 5KFKA 4C8LA 5FDLA 1WSIA 1LWEB 2X74A 2HHWA 3V1QA 3FRZA 3H5SA 3QERA 3KKRA 3NKYA 1NHUA 4EZ6A 5KFOA 4AHRA 3NL0A 2HHUA 3HJFA 1S6QA 3QIOA 3KKSA 2HNYB 3TAEA 5KFZA 4ED3A 1QS4A 2X78A 1WAFA 4DS5A 3RAXA 4NLVA 4WZQA 1TL1A 4DLGA 2OPPA 3ZSOA 4B8AB 3OY9A 3H4DA 2YV0X 4J2BA 5J1EB 2W9AA 3N6MA 4N5SA 2XI3A 1QAIA 1KHWA 2C2DA 1VSEA 4DL7A 5F8IA 3GV7B 3OL6A 4W5QA 4H4MA 1TL3B 3IN5A 1HNVA 4CJLA 1YTAA 3OYGA 4KREA 4DTSA 4DWIA 1BIZA 2E6MA 1EETB 1JLBA 1QSLA 4FJMA 4NLGA 2BQ3A 2Z1JA 2FVQA 3EZ5A 3DOKB 4IDKB 3DI6B 2JEFA 2W9CB 3O3GA 3OYFA 5KG2A 2ALZA 3G6VA 2YNHA 4Q5VA 4RW4A 2G8KA 2QK9A 3KLEA 1TKXB 2HNZB 3V9WA 2HB5A 4FK0A 4FJIA 3KMQA 4DTMA 3OYEA 2ZD1B 4B08A 2D41A 3H5UA 4O44B 3HO1A 4NLRA 2D0AA 4CEDA 5I3UA 1O1WA 1NJZA 1YVFA 4OGCA 2YNIA 2XI2A 3M9MB 1RT5B 1A5XA 3KK3A 3LALA 1Q9YA 4FLYA 3UDLA 1VRTA 2HAIA 4RU9A 3C6TB 4C8OA 3PR5B 3AVCA 3GYNA 3CJ3A 3RTVA 2OYQA 3S3OA 3DLGA 2IJFA 2V4QA 3KIOA 4FCYA 1SKRA 2G8IA 4NRUA 1DTQB 1IKYA 4EEYA 4EYIB 3LPTA 1JLQA 4J2EA 3CWJA 4N56A 3K58A 1VSLA 2G8VA 4B9MA 1QE1A 3ZT1A 3HPGA 3NBPB 3C94A 2ASLA 2LSNA 3QZ8A 4I7FA 2IMWP 1IKXB 4QAGA 4FJGA 4IRDA 3G10A 4KBIA 3AA4A 3CM6A 1U48A 4DQSA 4TYAA 3M8SA 3DRSB 1C1AA 2ITGA 2Y1IA 2HNDA 5I42A 3EPIA 1JLFA 4CK2A 1S1WB 1EP4B 1VSFA 1QTMA 3H08A 5K14A 4NLYA 1NKBA 4FBUA 2GC8A 3OSPA 4ZPAA 4FJKA 5EWEA 2E9ZA 1ZBLA 3V9UA 4G3IA 1WSHA 2W8KA 2P5GA 1BQNB 3IRXB 3JYTB 1XR7A 1T05A
chains in the Genus database with same CATH superfamily
3EXYA 3NHGA 3R2CJ 2I5JB 1RDRA 4P71A 4OX8A 4KSEB 3VQ7A 1WNEA 3I9V9 3MR3A 4DR2J 5HROA 4EBDA 2XWXA 2HFUA 3B6OA 3P6YC 2AF6A 2AJ2A 1S7IA 5JVGQ 5B0DA 2IDEA 1ZA2B 3AOBA 1KXPA 3K2PA 4DR3K 3R3LA 4F3OA 1TL1B 4W5NA 2XY8A 1XNQK 4WCEQ 4QIGA 3CF5Q 2F40A 1RAEB 4JYAK 2F8TA 3AQPA 2KKZA 1SXLA 1JLAB 5AQXA 4U7UD 1VAZA 3ZTRA 3CCRN 3MUTP 3TSUA 4CH7A 1VLYA 2YBVA 3J8AA 4JUZA 3CQYA 3ZLJA 3HZ6A 3ZT2A 1FDBA 1Z1ZA 1S9GA 4N76A 3TZWA 3G8QA 1OQ6A 4UT4A 2OHDA 4Z7YA 2P9UB 4ZVFA 3GJSB 1WDDA 3OYHA 4M5DB 2EWHA 1UVLA 4Y2MA 4JV5J 3EPGA 2IDOA 1C0MA 3GONA 5EUHA 3F73A 5GMEA 2J0SD 1X60A 2V4JA 4XH4A 1FI4A 5E0OA 4A62A 4HL9A 4RW4B 2OGUA 1ELOA 2LECA 3O6QA 1S49A 4BQZA 3OBWA 4DR2K 2AW0A 4CZMA 4U67L 2FSJA 1VQ7N 1N36J 4PUOB 4O3NA 4DR5F 2CJ9A 1R59O 3W9HA 2GIQA 4KHUA 2Q1LA 2R7WA 4QWAA 3SQOP 2QYCA 4CE9A 5FRNA 3MF5A 2E7XA 3CD5A 5CXTA 4CI0B 2HGMA 3KNAA 3OS1A 4F7VA 2WB4A 3H98A 1AYEA 3D6RA 1RDCA 2ERRA 3H1VX 1X3NA 2CPJA 3DLGB 4CHPA 1E6VA 3H5XA 3PX6A 3DDIA 3J7Z5 2WSCC 1IKYB 1NNDA 3MTKA 3LM2A 2RRBA 4UOFA 4IOAL 4MLHA 3MCMA 2V8DA 4Y28C 3K5MA 1VJWA 4IO9Q 4K5SA 4CJKA 2NXUA 4H5RA 3IWXA 3HI9A 4JV5K 2YH0A 2FSKA 1CQMA 2XQCA 4I7FB 2OPQA 2NZCA 5AQGA 3WDOA 1IBMJ 4HUFA 2QMWA 5ETQA 5KFQA 1JLEA 3QEPA 5HMYA 3U9ZA 4Z4HA 2H54B 2DNYA 2HHVA 2UYTA 4OJ3A 3C6UA 2IY5B 3Q8UA 4CLFA 4CNZA 2W6KA 1N36K 7AT1B 1EWRA 4ZTJA 4NLDA 4EGLA 3CJQA 4BGBA 4CIOA 1F60B 3DOMB 3MM8B 1Q1KA 2UP1A 2RUGA 3CFOA 2HK3A 3AAPA 4RNMA 4MFBA 1BQMB 4RW8A 2BMBA 4BE0A 4DKWA 1RK8A 4F4WA 1J5OA 4ZN3A 5HBMA 2OKQA 3W2WA 2HBZB 1QAXA 3R8EA 1JMTA 4MLEA 4RW6A 3PW5A 5DQGA 1YUWA 4IEEA 4I6MA 4BBYA 2Z2ZA 5KT4A 1BUPA 2IHR1 3VCDA 4FXVA 3UQSA 1LAWA 4K42A 3LAKA 2BKOA 1OO0B 1B4SA 4OYMA 2VYPA 3OQ2A 5KFMA 4IBNA 2OZMA 3NGIA 1N6QB 3MDQA 2CQDA 1IBMK 4X62F 2K3KA 1BY9A 3UKRB 1NB7A 1R8CA 1IN0A 1F1BB 1T0TV 3BKUA 5T41A 4I2PA 1WBDA 2RIJA 3UNGC 1GMVA 4AF1A 2D3UA 1SQKA 2B6AB 2CVIA 3KG4A 3A12A 3UDVA 3UVJA 3W3SA 1WC1A 2A41A 4EK2A 2EFNA 4L8RB 4FS2A 5A2QU 1YKWA 3JSMA 3HPHA 3T69A 3HFKA 4L76A 2LFVA 2ZOFA 4PEOA 1B3TA 4PKDB 2XMVA 1S4FA 3SBMA 4DR5J 3K0JA 3KD1E 3AA3A 3M8PB 5J2NA 3POTA 3GJRB 2MQ8A 1Q81O 3VN5A 5K8PA 2FJVA 2IYGA 3H45C 2PAVA 1QY7A 4O3QA 3CULA 1Q5YA 1RT7A 4GMJB 1VYAA 2V34A 2YPZA 1RCOB 2YKOA 3EX7B 1HNXJ 2PFFB 3RR7A 4CH1A 1SIZA 5AQWA 2J6TA 1LKZA 2NRRA 4JI3J 4M3RA 3Q8QB 2HBLA 3IDHA 2P6TA 1U47A 2ZNYA 3TEHB 5A0YA 3MEGB 5DS7A 3NVMA 1KAZA 2QA2A 3I0RB 4MKAA 3GR1A 3SAHA 3MCPA 4I0WA 3OFEA 2XY6A 2QEXN 2I9SA 3S7RA 2R7QA 2LU1A 4LF8F 4BWJA 3IS9B 5JVHL 2P6SA 3G8TA 1OMSA 4RNFA 2HMPA 4KO0A 5GINA 2WONB 3RMDA 4JV1A 1D4XA 5T14A 1NDPA 3I5BA 4DR5K 2J0XA 3HVAA 4NCGB 4OYAA 1RT1B 5HLFB 4Q2LA 5CR4A 3VAIA 4AQYF 4ZPWR 2W4CA 2FGCA 3I32A 2HKEA 3I56S 2QWLA 4U9RA 4DHVA 5JICA 3NP5A 3QLHB 1MROA 5FD1A 2GAHC 1CBKA 5ELZA 4RUHA 1U1PA 2AJ1A 4U8VA 3AB2B 1HNXK 3M3ZA 5KFIA 1FNXH 4WFXA 3AD7C 1SJ4P 4JI3K 3SUOA 1S5ZA 3ZTPA 2NXJA 1B0VA 1YITS 2ACMA 1S10A 5LJ3Y 2B4VA 3A5LC 1BWFO 1WSEA 3CCZA 1NGEA 3VAGA 3DXKA 5AFUA 3M8QA 2CA9A 4BGAA 1YJWN 2R2UA 4OV1A 3LGHA 4J9PA 1PGZA 1H7WA 3PYEA 4O4GA 2DNQA 4PQUA 3H6EA 5C25B 4GW6A 4CEAA 4CEZA 2MKYA 3OVSA 3K7RA 2A6AA 4NRTA 3RB3A 1C1CA 1CJUA 4PWDA 2EC0A 3FZFA 4LRCA 2DGTA 2XBPA 3K8VA 4Q8EA 3ULEB 3JXOA 2JRSA 1WEXA 4M1KA 1NK5A 2GTDA 2GS8A 2XHCA 1EIYB 4F4KA 4IG0B 3DGVA 4DU8A 4ED2A 3R6MA 4J37A 1CC7A 4NB4A 2GVDA 2YX7A 1HMVA 2VKRA 4OVLA 1TUGB 2UVUA 2VL1A 1JXLA 4KPCA 5LSRA 4DCPB 3MXMA 4GVBA 3E8OA 1RWVB 2YY3A 4DQRA 4JKDA 3L3CA 5DK5A 3BYRA 3KK2A 2KL8A 3DRPA 1TK8A 3KLGA 1B64A 3DYAA 2XGQA 3D68A 3RW6A 2CQ3A 1YIJS 1FRHA 4RBTA 4DL6A 5C2FA 3V4IA 3JSRA 1KLMA 2MQLA 3D67A 4GVEA 1N5YA 2XSJA 2Y1JA 3OVAA 3O5TB 3M2UB 5BPMA 3GFHA 3JSYA 3FGUA 4B9SA 2YHYA 3MGJA 3QNOA 1TFWA 2UUCF 2B8PA 2VFSA 2W1BA 2NRHA 2DISA 2JC0A 3QBXA 2ZH7A 3CPWM 1GX5A 1HI1A 2HQCA 3BEGB 2HOEA 2LKZA 3EGZA 2BM0A 1N52B 1NLKL 3BSOA 5GAHU 2H65B 5FPNA 1VI7A 4RJVA 1RCXB 2KLAA 4CJ3A 1A5VA 3NEKA 4JI1F 5M1NA 3KG0A 1URNA 2IJRA 1KAYA 2XM3A 3HVRA 3IWLA 5CZXA 2FHKA 3HOSA 3ALYA 2DGQA 1NLVA 4PYDA 4MKBA 1RHJB 2CPYA 3IWNC 2RHSB 4CESA 2DGWA 2A1SA 5IT9U 3CDUA 3MR6A 1X9MA 4J5OA 3ULDA 1R3NA 2O66A 4TLQA 3RBXA 4NI2A 3NGYA 4EIAA 1NDKA 2IVMA 4UQTA 1WG5A 2RH3A 2Q3PA 2OLWA 4X65J 3R5DA 3HMJG 3LDSA 2IM1A 2WVDA 2VONA 3DLLL 2R7VA 1BHLA 4M94A 4FJLA 4ANCA 3UW1A 4IFEA 3F9MA 4QIWD 4ILHA 4F02A 2M88A 4CLZA 4DQQA 5AXLA 1WELA 2PT0A 2ZJRL 3BREA 3GL1A 5DM7Q 1T3NA 4M3ZA 2BA9A 4G1IA 3FK4A 4JI0F 2G13A 3CYMA 4F2SA 5FLXU 3NNHA 4BDYA 1IR2A 1NUEA 3SV3A 1JKHB 1VSIA 3MAAA 1LV5A 2BYCA 2VZ9A 3KK3B 4CZHA 1TKTA 3CJ2A 3EO3A 5GIOA 4CHQA 1S22A 2DB1A 3OW2M 3CJKA 3R27A 2VPXB 4A8FA 1KVBA 4U7UK 3QETA 1CULB 3KG1A 2HF4A 2MZQA 4BRNA 4FOEA 4I68A 1VC0A 3H90A 4BC5A 4BRQA 2DNNA 1NK4A 2HLTA 3DNCA 3S6EA 3US5A 4FW1A 3F9KA 4ICLA 2PSZA 2UXDF 3TPQA 3VWSA 3G96A 4B9TA 3CUNA 1IBLF 2ZWOA 3D2FB 2HFOA 4ZVOB 1UTAA 1AUDA 5GMDA 2UUCJ 1F3VA 1ZM3A 2MZTA 1WWHA 2ILZA 4ECTA 3G4SS 4FPBA 3T5KA 5K14B 4HHUA 2F9DA 4AHTA 3RW7A 4C11B 4YUDA 1VQ4S 4QBUA 4HT7A 3P83D 3BQ1A 3OW2R 4CERA 4LRDA 4ZVPB 3TJ9A 1T05B 1BIUA 1SV5B 1Y5LB 4RWXA 2BANB 3RMBA 4ZVEA 1J54A 4CRJA 1SJQA 2W41A 2W40A 1FKPB 1ZTTA 4JI1J 1TL7B 1QAJA 1WAJA 3MMJA 2RU9A 3PXGa 5K5MA 1N8RT 1GTEA 4FLXA 3RWUA 3D54A 2BJDA 4K8RA 2DGOA 4H4OA 3SQGA 1CSJA 2H48B 4XK8C 4M5IA 4Q44A 3KLHA 1VR6A 4ISEA 4KHQA 1SQEA 2WK4A 3BDEA 2WVCA 4A8OA 4DQ8A 2PEBA 1A7GE 3CCJS 5H9EJ 1UWAA 5J2PB 4KY3A 4DPTA 5EX5A 3DI6A 3FZMA 1BO5O 4CJ4A 1QVFR 2UUCK 2IGIA 1OY6A 4ILRA 4CNYA 2P51A 3W66A 1KTQA 1QSSA 1UJ4A 3KUHA 4KHMA 1DY3A 1B0TA 1SIWB 3IM9A 4JI0J 2NR0A 1WC4A 3KK1B 2BDPA 4OX7A 4E19A 2MKHA 2QFIA 3TUPA 1KVJA 2GEMA 4Y0WA 5J2MA 3MX5A 4JI1K 1XC9A 3ZT3A 1NSAA 4WFBQ 3G0ZA 2APOA 1CZBA 1J2VA 3DKDA 5EDWA 1QQMA 4ED1A 1TYQA 4UF4A 1F5AA 1H3DA 5CCLA 3SUPA 4OYXA 3FFIA 2BRLA 4EI2A 3CC4N 4MJKA 4LF6J 4HWIA 2AV5A 3CGIA 4H03B 4OPAA 3E01A 3N9UC 5H9EK 2IVNA 2DO0A 2HVHA 4H5VA 2JNJA 1H74A 1MWQA 5GAHP 1JQGA 1P90A 2YHAA 2YKMB 4PCQA 3NDKA 1X4GA 5EX3A 4DQIA 3GOIA 5DQIA 2Z2MA 4OGEA 4WQ5A 4P10A 4X66F 4U96A 2Z1IA 3DRSA 5T7LA 3SDEB 3TAGA 4PG7A 3MEEB 3ZT0A 3CI5A 3TAPA 5LSOA 4A8WA 1NWKA 1O0PA 3NGRA 1S4EA 4CVNE 3CJBA 2XCAA 1HBMA 1ZA1B 4JI0K 2HFZA 3C2PA 4OJGA 4M7YA 3VAHA 2Q31A 4LIRA 1HQEA 4HCBA 5E3CA 2E5LF 2I5JA 3RMCA 1ASVA 3NG8A 2VOPA 3PZPA 1K0VA 2VWJA 1U1MA 5IFMA 1U26A 5KFYA 2MQNA 4DF8A 2Y0BB 3J80Y 1YXQA 2B5JA 1FDNA 4C7QA 3NAHA 3CCTA 1B9DA 5A8RB 3HSCA 3VMFB 1S0OA 2ZH3A 2YXLA 5KG3A 3NS6A 2ZBQA 3BKFA 3CCMS 2AEFA 4CJQA 3MWBA 3RBEA 2OFHX 1BDGA 2CKWA 5JS2A 3UN2A 1HHQA 2DNOA 1JLAA 4DZDA 2UXDK 4HLBA 4ANDA 4A8KA 1HA1A 1Y11A 4GNIA 4DTOA 4JI4J 3U1MA 3WHIA 1ZZNA 3OR2B 4ED0A 2NXNA 1HKBA 6FDRA 1XI1A 3O9RA 4X84A 3QT7A 3TTCA 4DL3A 3RB0A 4FWLA 4ISFA 4DTXA 4QWCA 1VQNN 3DXBA 2O8EB 1S59A 2CQHA 1F21A 4BRHA 4JAXA 1QTNB 4X4RA 5CABA 2RSQA 5HMZA 3KJFB 3VGVA 6AT1B 1WACA 4BQLA 4M41A 4PUOA 4NZ0A 1HJRA 4WKYA 4C8YA 1RNHA 3AVKA 3A13A 2O8DB 2P5OA 1WBBA 2FJBB 1PC4A 4K4YA 3QZ7A 3D6HB 3W5YA 2BR0A 2QC3A 1HWUA 2JC1A 4ECSA 4EZ9A 5J1PA 1RBSA 2ABYA 2A3ZA 1RT3B 1UOCA 8AT1B 2DD8S 4JKHA 3TO8A 4DU7A 3FZBA 4KB0A 3FEXB 3J7YU 1MWZA 5E5NA 4BREA 2ZZTA 4CO4A 4UZCA 3HL8A 3BN4A 1OY9A 1XK8A 3MDFA 4BG8A 2FQQB 2FVCA 1FWKA 4Z4EA 4FVCA 3FKBA 3ISNC 2J7UA 3BH7B 2FZCB 3UKUA 2B3TB 5KFCA 4OPHA 4CO5A 4FLWA 5JVGL 3M1FA 4ZPDA 2BJ9A 3MM8A 4G1PA 2OPRA 1DQAA 3ISND 1M90T 1LQ9A 2LA4A 1KSPA 2ACYA 2YX1A 4TY9A 1FXDA 1FT8A 3D0PA 2DY9A 4NXMF 4FJ9A 3RBDA 3CF5L 2Z56B 1HPZB 2VHGA 3A5MC 3JXUA 5CYQB 2KO1A 3EUNA 3T1AA 9RUBA 4GC6A 3FR0A 3S8SA 1BCMA 1R6VA 3ET6A 2CGJA 4P7VA 2R2SA 2CADA 4I6AA 4DTPA 2FLNA 4BLGA 2QE5A 3B4DA 5KFHA 5KG0A 3IFRA 4DV2F 3PG9A 4HDGA 2XMWA 1KWMA 2XYPB 2QYGA 3AVHA 1SUQB 3G8SA 1GX6A 5F2RA 1XIQA 4ZCIA 1D3WA 3KLIA 1RBAA 4KKOB 3IGNA 3GCXP 4A61A 3VESA 1FTRA 1JXVA 1VQLS 3AXMA 1PILA 2O8CA 4CBXA 5AQRA 2PMHA 3AOCA 2AU0A 1MG7A 4CO1A 2D3OR 2IDLA 2W9BA 4NYNA 1VIXA 3G9CA 1SJRA 2D0PA 3VF0B 2C1EB 3SCIE 1T6DA 2BBEA 3H42A 3H8YA 3QMQA 2QT7A 2E7WA 2H51B 2QW9A 1OJ4A 3J80O 2ZH6A 5D4NA 3ZCMA 3GJTB 2O8FB 3RB4A 1VQMS 3ENHA 2HVDA 1HYVA 4MIAA 2ZGYA 4D3GA 4ECQA 1KD1T 1QUPA 4CECA 4G1QB 3W62A 2KTQA 4O3OA 4CGGA 3PIPQ 3O9UA 4ZP6A 3NF9A 1BU6O 2WVBA 5A6WA 1YBUA 4O55A 2HPUA 5AQYA 3OHRA 1REGX 2ZH5A 1DAXA 2AYEA 5GAHI 3QEIA 2VD3A 3MEGA 2FSNA 3NGUA 1E6YB 4ELVA 3I0RA 2RF2B 1SKUB 2H1YA 2CZ4A 1A6LA 1UWBB 1RACB 2GW8A 4B9VA 2OELA 1HQUB 2VJUA 4NYZA 4USIA 1RBUA 4B8CA 5M2PA 4M5JA 4C97A 3T1HF 4DPXA 3C15B 2P1JA 4N7TA 5AQSA 3IS9A 4FK4A 4DSJA 3BQ0A 4S0MA 4QYRA 4YB5A 3AO1A 4ZMMA 4BVPA 1U8WA 1QHAA 2GQCA 5BR8F 1YDLA 4BRIA 4NCGA 1WOSA 2YTCA 1TMJA 4K4TA 5D4LA 1SJ3P 2NUUG 4U7BA 5LL6Z 5KPRA 3CQ8A 2K06A 3R3TA 5AFUH 3SI8A 2GA7A 1BGXT 3ISZA 2QLFB 1K1QA 3QLHA 1XR6A 1IBKF 5E41A 3SUNA 2YPYA 2E1AA 4L75A 2E1RA 2V8GA 2V8VA 3WEEB 4EMDA 1NKCA 1IR0A 1YG0A 5DZ7A 2DGSA 3OR1B 3ZC4A 2KFZA 3NCQA 3AA5X 3FC9A 4CJUA 5C25A 1TKXA 1HKCA 1WUAA 4CEOA 1T9UA 4M5HA 3D2EB 2R8KA 4E0DA 5AQVA 2D0BA 2HS4A 4AT1B 2VG6B 1Z2ZA 1S72S 4K4VA 1T8EA 4USHA 4IG0A 4DB3A 5ETKA 1Q7LB 2UUBJ 4JN4A 5K8MA 4NCAA 4LBPA 2FBYA 3Q89A 4YFUA 3DLKB 2YX6A 3MMVA 4NXMK 2OA8A 3J7YP 2NXCA 5D8HB 1D5AA 3GFXA 1DJ0A 1VC5A 3PTWA 1X5PA 1VHIA 3IBWA 2RPIA 5CH7B 4F3MA 2FC0A 4WKRA 4QW8A 1PJ7A 1A5WA 2DTUA 3QB0A 4OX6A 4QWEA 1W9HA 5KGXA 2G8FA 1NCLA 3KHYA 3PYDA 1J9AA 5C12A 3GDQA 2VG5B 1Q0NA 1H2VZ 1CXQA 1TR0A 2CPXA 5A76A 1WN7A 2E88A 3R5BA 1K8KB 3A0IX 3OTCA 1PCAA 1ZTWA 3M2UA 2FLLA 1NBWA 2ZWPA 3AVGA 4CZJA 4K50A 2KFYA 1MA9B 1U0HA 4K4WA 4DSLA 1KP6A 2K7KA 4ETXA 2DCLA 2GHWA 1YI2S 2BKPA 2UUBK 1OSCA 2HHWA 3W2VB 3V1QA 3FRZA 3DU5A 2NZ4A 3QERA 3NKYA 2V52B 4JK8A 4KQZA 3EVWA 3AHPA 1B7YB 2FUG9 1NH7A 1MN7A 1S6QA 3Q8VA 2A0FB 3DXMB 3KKSA 2FJAB 3T9ZA 1YJNN 4PG8A 4WPAA 5IM0B 4KHPJ 1NH8A 3RAXA 3PM9A 4ZDNA 5D0EA 3VF2A 1NDLA 5H9FJ 3TJ8A 1W2BM 2OPPA 4B8AB 4DV6F 3A8IA 3CCWA 3OY9A 3H4DA 2K2PA 4CP5A 4J2BA 4A57A 2CQCA 3N6MA 2HZVA 1QAIA 2C2DA 5C15A 5M1KA 4DL7A 4OFZA 1V4SA 1SZ2A 4J7CA 3OL6A 4YB1P 4H4MA 4W5QA 1TL3B 3WZ0A 3MMBB 2I8EA 3MPUB 2CIMA 1H2UX 4A8QA 1QD1A 1CVJA 1WDTA 1RAIB 4DWIA 2ZH8A 2F65A 1EETB 1JLBA 1UL3A 1FW6A 1NMDA 5KQDA 3DJCA 3J7A1 2WBRA 3L4QA 3FMBA 3DOKB 2ZC3A 2W9CB 4BS2A 2HBMA 3G6VA 1FJGF 2JWKA 4WQ4C 3G71S 4Q5VA 2G8KA 2D0OA 2JVRA 3D4JA 5MAOA 3SEOA 4FJIA 3OYEA 2ZD1B 3OUYB 4B08A 1CJTB 1W2BR 5M1OA 5A2QY 2MQMA 2QL5B 5F0WA 1X3MA 2UXCF 2DR7A 2GJIA 5I3UA 3PFOA 5K20B 1ROFA 4KHPK 1NJZA 5H9FK 3WIUA 3M9MB 1A5XA 3HT0A 3N0VA 2RDDA 3KK3A 2VV5A 3OXLA 5GAEU 2ASPA 3LALA 2EK6A 2IIRA 2HAIA 2XZTB 3PR5B 2KVQE 3CJ3A 1PC5A 1CULA 3H46O 2VGNA 2V4QA 4AE5A 2NPIA 3KIOA 2XS7A 4B3RF 3ID8A 1U6ZA 2NRZA 2J7KA 3VEXA 4A2AA 3GE9A 3H2VE 4EYIB 1JJ2R 4DV5F 3LPTA 1JLQA 4J2EA 2CG4A 3K58A 3SMZA 4C8ZA 4QS7A 2WBNA 2RB7A 2HBJA 2ZUAA 1RGIA 2PMZD 3ZT1A 4H4KC 1WOQA 3HPGA 4MIWA 3CCVN 3D2FA 3MI7X 4Q7AA 5F0UA 4P2FA 3MWTA 2BUNA 4YDUA 4DQSA 4FN5A 1ZC6A 5LSLA 3K9KA 4DCHA 2RE1A 4V19J 3ENQA 2MZ1A 1EP4B 2UXBF 5K14A 2V94A 1NKBA 4CZCA 3CD6S 3OXGA 4G3IA 4C0BA 3VVUA 2HYIB 1XQSC 3HKZD 1T05A 1VQ9S 4NASA 2DHHA 5AQLA 1V3SA 2BANA 4RUBA 4C98A 4EU0A 1T6CA 1VRUB 4XO0A 1S1VB 2KJWA 3ZFVA 2D1KA 3C6AA 2FJDB 3GYGA 1TL7A 1HLWA 1TVRA 4WU3A 1XBWA 3GFYA 4B1YB 4KGXB 1K0TA 4RBVA 1TV6B 1U49A 3Q0AA 2CNNB 2PI5A 4ZIVA 4E7LA 3W3DA 1NPKA 1J5EF 4FBTA 3VAJA 1WHYA 4OYBA 5IC6B 3HHLC 5EY4A 2VKZG 2L48A 3A3PB 2F5GA 4ZLJA 1N5TA 2BM1A 1P8ZA 2GZOA 5C7PA 5KI6A 1F9FA 3TAMA 4DR1F 3CJ5A 4E7JA 1KRPA 3HHLD 3KWMA 3BH6B 2EPIA 2NSCA 4C8KA 3EGWB 4V1Ak 1MWMA 1FO1A 1VQPS 1T94A 2L9DA 4FZVA 4LR9A 4AILC 1PYSB 3BR9A 3C3LA 4UZBA 1FF2A 2EKNA 1PBUA 1FJGJ 5DDOC 4CEFA 2NCKL 4R5PB 3ZSRA 2WTUA 1KEKA 3KJVB 1S0VA 3DRYA 3MD1A 3M1VB 4HYKA 5L46A 4KHWA 4FF4A 3CCUN 4KRFA 2UXCJ 1Q7YT 1TQLA 2C28A 3D1HA 1M0SA 3P4UB 3ZZOA 1R0AB 4GC7A 4WIQA 3IBCB 4ZS6A 2OH2A 2R7XA 3J7YI 1G6BA 2QA4N 4KAIA 3UN5A 5HJXA 1NNEA 2W2MP 4MK9A 3PJ9A 3C8YA 1C1BB 4Y2CA 2KXFA 4FWPA 1HJOA 3P31A 3IGVA 5IV4A 3NF6A 4B3RJ 3ICLA 2XSFA 5G0RA 1RWOB 2RHQB 3A8EA 5I4MA 3I0SB 1KC8T 3VA0A 2ASDA 2JZ5A 2MMYA 2W4DA 2F4VJ 1NK0A 4NEZA 3K89A 2VICA 5E33A 1EKRA 3KHGA 4I6WA 1YF5L 3VGKA 4YMEA 3PRBA 4OZ5A 1XNRJ 2G8HA 1FRKA 2DGVA 4A48A 1FJGK 1X4BA 1F2GA 1GAOA 2NNWA 3G6XA 2UXBJ 2J9DE 1RP5A 3PSIA 4PKIA 2H5JB 5A2QO 2VA2A 2UXCK 4HR2A 4ZLNA 1CS4B 4EP5A 1XHXA 2OTJS 5AQMA 4OJ1A 1SKWA 2HWTA 3GIIA 3I9ZA 2OANA 3ZX2A 2E1YA 1YJUA 3I6PA 2XZWA 4KHSA 1G15A 1XR5A 1REVB 4N8OA 4YEAA 2B7CB 1GLFO 3SMSA 3CG7A 4TY8A 2OD6A 4CLTA 2X3DA 2G0JA 2PC6A 4F67A 3L3UA 2ADBA 5AQTA 3IMXA 4B3RK 5IT9Y 4CZEA 3TU5A 3G25A 1J5EJ 4LMZA 3BO4A 5KFVA 3WXIA 2XGPA 2YHXA 4M3UA 5BN8A 3EGNA 4DUYF 2EX3A 5KG1A 5MLCQ 1XNRK 1I39A 4DR1J 1LW2B 4CJTA 5GAEP 3HLUA 3OR2A 5AQPA 5B7WA 3E3XA 1BXNA 2PDAA 1JCFA 4FOIA 1R0CB 4ZP7A 2UXBK 2O8EA 1Q82T 4O0JA 1U45A 2MYFA 4HT5A 2A2CA 1S9GB 5EX0A 4JI8F 4KRWA 4WFBL 5FLXY 3QATA 1MSWD 3M5RA 2Y3YA 4DUZJ 4FJ5A 1S48A 4CZIA 4USMA 2MGZA 4OZ0A 5LJVA 4FJXA 1KQKA 2VQEJ 3CCSN 2V4JB 2P9KB 2O8DA 5LXYA 3O80A 3TTDA 4JKGB 3KYLA 4EO6A 5KRSA 1C0FA 3DOLA 4RW9B 4CF0A 1X4FA 3KHLA 3H1QA 5IQ6A 5HATA 2DY4A 1J5EK 2JEJA 5KFPA 4IYQA 3E2EA 2KB2A 5E26A 4NO7A 4PG6A 5CA5A 3HCXA 3VEVA 3QFPA 2DGXA 4YR0A 1HUXA 2CXEA 2CQ0A 3PEJA 2HWHA 2I1RA 1C6VA 3AJ2A 4WYBA 2DIUA 2KRBA 4OZJA 1RT3A 3MXJA 1NGDA 4TVAB 2KG0A 4DR1K 3M6UA 2YKPA 4FPAA 1H98A 1O6XA 5C2GA 5DQHA 1SC6A 2D74B 4M5MA 4P2SA 4QOTA 3TP2A 4LC9B 5LL6d 1K8AT 4PWUA 2LU2A 3A3NB 2Z2LA 5KAKA 1Q8IA 2IYIA 3RB6A 1N48A 3CO0P 3W5XA 3AGKA 5TKWA 5F9NA 1DGKN 2YWHA 2D7SA 3W9JA 1RTJB 3DM2A 4QU6A 4C3KA 2OPQB 4NE9C 1ZBHA 2OPSB 3AA8A 1IG9A 2B4PA 1HL6A 5AXKA 4FL9A 2DR5A 4JKEA 4C9DA 2ZE2B 4ECUA 4EBCA 3FNNA 3IUCA 3C6UB 5CYQA 1EO1A 1SAZA 4DF4A 1GH8A 3VPZA 2MSSA 2IFXA 3BQ2A 1SJ1A 3C16A 1J6ZA 4DSKA 3A3OB 1R8HA 4DL5A 3U02A 2WRMA 4B3TF 4DFMA 1VQSA 1LWCA 1E4FT 4RW8B 1WKKA 4AHCA 1SUQA 2LQBA 2F96A 5DG9A 1NJYA 4XDDA 1J5OB 2C2KB 4MDAA 4JKCA 1U2CA 5HBMB 4KKOA 2MSTA 4GKJF 3M9NB 3SBTA 1LWFA 1GEHA 4H8KA 4I6MB 5M1QA 2AGQA 2KU7A 4ZITA 3T9NA 5AE1A 2HZCA 3B54A 4J9SA 2LQ8A 4PL8A 5HO4A 2YNGB 2ZBCA 1M5PC 1UPPA 1U1KA 3O3HA 2C2NA 2IS3A 2IIHA 4CLUA 3OYLA 5BN9A 4J9MA 3FSYA 4IR9A 1YRTA 3UPFA 1SBRA 3PW2A 2ALYB 4KB1A 5JMNA 4ZP9A 4M42A 2YI1A 4H0OA 3NFAA 4I2PB 4PY5A 3O08A 3V9ZA 3BGFA 1NZAA 3LQVA 4HHTA 1AZSA 1BCOA 5CZVA 3HBTA 3WNGA 1GXTA 4FJHA 1JLGB 3UVJB 3Q7BA 3O8MA 4JS5A 5IT9O 4BC3A 4WK3A 4G1QA 3JSMB 1X4HA 2BJ7A 3QRPA 2MQQA 1P6TA 3DDKA 1SH2A 2AJQA 4AHUA 4I56A 2HHSA 1NJWA 1XMBA 1L3UA 1E6YA 2DFHA 4WYLA 3OD2A 3MMAA 4B1ZA 2RF2A 5HRRA 1RT7B 2J0WA 2CG8A 2MB0B 3ZX0A 3OS2A 3Q8PB 3FZ2A 1HQUA 3VQ5A 2HGNA 1U1LA 5JLHA 3MN5A 4FJ8A 3F41A 4LY7A 4OLAA 4CLYA 4IQMA 1HFEL 1VHFA 1VHXA 3LP3A 1VCTA 5L1KA 3VTHA 4ZOSA 4FWQA 4CF8A 4X4NA 2GUIA 3HSTB 2GQ2A 1DFDA 1D0EA 2RQ4A 5M1PA 3HD1A 3D6FB 2B9XA 2N3OA 5FDLB 2Y1LB 1I94F 3RU0A 3DAWA 4AUKA 1TK5A 3HVWA 5DG8A 3F44A 3H0PA 4PA1A 2E1PA 4FKYA 2AQ4A 4FWMA 2DFEA 3AV9A 2FJEB 3L2UA 4OPKA 4BR4A 3D6TB 4KO0B 3CPEA 2X3GA 4L73A 2KVIA 4DV0F 3H59A 5JUMA 4YQWA 3D1QA 1ZOTA 2PFDA 3B82A 4KGZB 4GY2B 3SCLE 3AVFA 1RHRB 3WEEA 4B3TJ 3CDEA 2KT2A 4BRPA 1VQ6S 1B92A 2DPJA 1N4LA 3TZYA 4OLPA 1MROB 2NYHA 2QEXS 4GKJJ 2E2NA 1RTZA 1KFDA 5DM6Q 3D2EA 4CD3A 1M5OC 5GAEI 3M2VB 3DXKB 1G4CA 4BC7A 3M8QB 4LREA 4P9SA 4TSXA 2QXFA 4J9NA 2NS1B 1IKWA 2DCUB 4EP4A 2AGPA 2YNHB 4O4GB 2LMIA 4PQUB 2YJFA 5FROA 3KLEB 1JX4A 5MLCV 4YR3A 2HHXA 3DLKA 3TA2A 1K44A 2O1PA 4GVMA 2B4JA 4CF9A 3M8RA 5BRHA 1RILA 3O9TA 3DLBA 1C0GA 2FVSA 2KKHA 1IVZA 1WHXA 3PIPL 2HHPA 1K1SA 4M3YA 4E7HA 1DLOA 1XEZA 1S1XA 4A8MP 3J81j 3HSGA 4IOBA 2B7BB 2JH3A 1RKIA 4KGMA 2DH9A 1XUPO 1WLJA 4B3TK 3Q83A 3BJYA 1HHSA 2GVDB 2VFTA 4CYUB 4DV3J 3FGVA 2X51A 4QPXA 3PR4A 4QR0A 1NHVA 1U0SA 5FPEA 2J6SA 2YHWA 2D5RA 3DN9A 2Z57B 2DTJA 4WFNQ 3ILLA 3CB4A 4DX6A 2BZ2A 4GKJK 1JCGA 1K8KA 1UPMB 3KK2B 1S79A 3ZZ0A 4CM0A 4FLVA 3UD5A 1U1NA 3HI0A 4DZ6A 3LO3A 4CBUA 2DHGA 4IO1A 4YY3F 4ZKAA 4XPCA 3VEOA 3V4IB 1EX8A 3H4BA 4YNQA 1QLNA 2XSJB 1YITN 5I42B 1RAAB 1GTHA 4Q2MA 3UR3C 4OYPA 3JS6A 4YOEA 3G6YA 5F8HA 3TUZC 3X3UA 3QT5A 5BPNA 3H20A 1D8YA 3WNHA 4KC5A 2RDIA 1HKGA 1X5TA 3HP9A 1HKAA 3HJVA 2G0CA 2JLFA 2FYXA 1RXOB 4QOZB 3TA0A 1YTYA 4MK8A 1YVNA 5AQQA 2B56A 3CCES 2CGLA 4OI1A 1X4AA 1VRQC 4DCJB 4F9OA 2HGLA 4WFAQ 4ZVQB 2Z1HA 2DPIA 2JVOA 2KZMA 3F2KA 2KG1A 3J81O 5AJ3F 2EFQA 3NAIA 3D9BA 4ZVRB 4DV0J 4DV3K 4CO3A 2R8GA 2F7TA 3E1YA 1PG5B 4C0HA 3K5OA 1IH7A 4A5AA 4RCHA 2V63A 2QTDA 5I3PA 1QDUB 3MMBA 2R4FA 4OPJA 1KQSR 1U24A 3QIPA 4DV7F 3I5CA 3BGRB 3VETA 3J7ZT 3OFHA 2XB2D 1RSCA 3O2IA 1QSYA 3EE8A 3LDLA 1HYSA 3DOKA 3OS0A 2H3GX 2ZJQL 4KR0B 3SJJA 2ZBIA 2UVRA 5ETOA 3UWTA 1KDNA 1VSJA 2YCHA 1D1UA 1NM1A 1YIJN 3U3GA 1CJTA 3O1LA 4WP8A 3HRGA 5KFNA 2CZ9A 1HW8A 3MPVA 1XMOJ 2BVZA 3EMTA 3ID6A 1R43A 1UKUA 3FEZA 3C66A 2C22A 1RDDA 4F4ZA 4TQRA 2FXUA 3CVKA 1UW9A 4DV0K 2IM2A 4CJVA 4ZJOA 4MIBA 5BJRA 2EI5A 5KOWA 4H54A 4NXNF 5KT7A 3HX9A 4AHVA 3S01A 4PKHA 3MAAB 1SL1A 1HBOB 3TQ1A 3L4IA 1QVGR 2WW4A 4B17A 1G7CB 3VERA 2IRYA 3VENA 3DHWC 4WF9Q 3NCPA 2F9JA 2F4FA 3E51A 1HX1A 3I33A 2QN6B 5C0YA 3ZSYA 5DLGA 1YTUA 4QIVA 4JBCA 3A8KA 1RA6A 2DT9A 1VQ8S 4DQPA 4JYAF 5F0XA 3JQKA 5TKYA 1PYTA 4YY3J 1EP4A 1T11A 3OYKA 4F36A 2B8QA 4F3QA 1FD2A 3SK3A 2C2EA 1MN9A 2MLXA 3LZJA 3Q8RB 2CNKB 3TW0A 1RISA 3RAQA 2W01A 3AVLA 2H5EA 4PPDA 3HT3A 3TEGA 4DTRA 1XMOK 2ROGA 3QINA 4OKKA 1IJFB 4YHHJ 1VRUA 4NLSA 4C1NI 1S1VA 4Y34A 4WTOB 3HK2A 3IR5B 4X64J 2F8SA 1YVUA 1OH6A 1FRLA 3AXKA 1FE4A 2IA6A 1BOTO 1OIAA 2WCXA 1NMEB 1IJJA 1TV6A 1RWWB 1LEOA 5AJ3J 1BL3A 2RS8A 1ZBFA 1BD6A 4DR2F 2CH6A 3AO2A 2ATLA 4KB7A 2VU5A 3CO9A 2ZWHA 4DR6J 2L9NA 5AQJA 5DDRC 4J9LA 3O44A 2X1GA 2RJZA 1ICEB 3IKMA 3P3DA 4DV7J 3MMCA 4QWBA 4FXWA 1X4EA 4H4OB 3SQGB 4DPOA 3VQAA 3UD3P 3BUZB 3BYPA 1N56A 3CJAA 3QJJA 3KLHB 4ITSA 3U4LA 3MR5A 4ILJA 4D3HA 3MECB 4YY3K 4YDDB 2ZITA 1S97A 3WXKA 4NMLA 1FDAA 2N7YA 2ZOGA 4NOHA 4R5PA 1FNOA 4DEZA 2W7AA 3KJVA 1JL2A 2FVPA 4LVNP 2R3VA 1WC5A 2BABA 3MUMP 1QQCA 1CLQA 1RTHA 1A0OB 2MXYA 2NZTA 2ZHAA 2P9LA 3AVIA 4X64K 3VGTA 3NOCA 1MMLA 3SPZA 1H72C 2BV3A 1R0AA 2DNZA 1VQ5S 4HHHA 4TXSA 3MZIA 3VEYA 2KHOA 3Q7CA 1VBXA 4OHVA 5AJ3K 3MEDB 3HDSA 4Z94A 4CK3A 2JGUA 5BRDA 2JFDA 4NXNJ 3AY0A 5ETRA 2VA3A 1C1BA 5J2MB 4GRSA 3DWLA 3BP8A 3IRWP 3IR6B 2EFPA 4DV7K 3E66A 1TYQB 4O23A 3BF3A 3I0SA 1DZ5A 4NLQA 1MMNA 2EFOA 3FFIB 2V51B 3ZSQA 1MWYA 4CLLA 5G4DA 3E01B 4IFYA 1NGBA 3N6LA 3BGUA 4DDFA 3CHWA 2ATCB 4JD2A 3L09A 4BRLA 4B3OA 4J9UE 3GQCA 2VGMA 4Y2AA 4LBHA 1Y9OA 4KFBB 3VGLA 4URSA 2PN6A 3CCJN 1N32F 3VZHA 2ETJA 4MK7A 3CEDA 4DU1A 1JJ4A 3L7PA 1QJHA 3JAMO 2P9NA 1VSKA 3GIKA 3CC4S 3BKTA 3G86A 1ZPWX 1DARA 3GG4A 3CXCR 1REVA 4C8NA 4FS1A 1HR0F 1I3AA 1HQEB 4NXNK 5B0AA 3GPAA 4RUAA 4PWWA 2M7SA 2BRKA 5IV3A 2LP4A 1GNKA 2PFUA 5HN0A 3DDNA 1BWEA 4Y65A 5E3PA 3O3FA 4R25A 3UDEA 2OZSA 4OJHA 4CI6A 2BH1A 4PYAA 3QIDA 2B5JB 1OVQA 4HI1A 3TABA 2ZH9A 2RDJA 1HPMA 1RU1A 4MKVA 1S5JA 2LVWA 4BR2A 2C42A 2V8PA 1X1PA 1O51A 3N79A 3MFHA 1O5JA 1LW2A 2MJUA 3X1LB 4ELTA 1S9EB 2J0QD 4TKTA 4L3NA 2R7RA 3RGIA 3K17A 3HXMA 2J9EA 4GVLA 3CIPA 5F8NA 2Z4PA 4B9QA 3MM6B 1TP7A 2AWZA 3JB9k 4BC2A 1RT4B 2R2TA 2QRRA 2WW8A 3G2XA 1V5IB 3PCOB 2QKKA 4KTQA 4RPFA 1QM9A 4KAZA 2B9WA 3HP6A 3SQ2A 4C4WA 3CCQN 4CJFA 3LH2S 3B78A 1X31C 1OVYA 2XNRA 3CJRA 4QCLA 3RRGA 5A8WA 5AXMA 3ENVA 4J9OA 4BG9A 2A1RA 4DX7A 4O5FA 1N8RO 2P9KA 2BW7A 2V67A 4K0KJ 4JKGA 4RW9A 1ZXOA 3PUFA 3CERA 5H1SQ 3HSDA 2VQFJ 1WSFA 2AT1B 3KJQB 1DQ8A 5CYJA 2FF6A 3VQ8A 2QJ3A 4U67Q 5KT5A 2P9PB 5DDQC 4FSVA 4W5RA 2KM8C 1W26A 4CHYA 2LXIA 3TWZA 4M3XA 3SCJE 1Q16B 3QBWA 4YDXA 4CFBA 2QWOA 3BZCA 3V6HA 2OUGA 4QS9A 1A9NB 3C65A 4CDIA 2ZF5O 1SPBP 1JK9B 3VGSA 1HNXF 1QZ6A 3EEQA 4FM0A 4JI3F 4HCCA 1R6YA 3N5BA 1RBOB 1Y00A 9ATCB 4UUWA 3PKYA 3HULA 3W64A 2QWMA 1N32J 1RTJA 4IOAQ 4K59A 3ENBA 5A8KA 2VOOA 2OPSA 2HNYA 2ZOMA 1ZETA 3NGTA 4NLUA 4Z37A 2H4WB 3OLAA 4K0KK 1NK7A 3CCLS 2IVYA 2ZE2A 2VPZB 3DLEB 1HI8A 3V9SA 3R5GA 1HR0J 3PJXA 2Y0SD 4QR2A 3UKUB 2VQFK 3ZSXA 4FXDA 3SUQA 4F0KA 1IO2A 2D9PA 2OPRB 1WSRA 3QJPA 2CQIA 1KVCA 2O8BA 2ZGZA 2V5HG 2FTRA 1S7HA 2HEKA 3NGSA 2W2NP 2JWLA 3B8AX 2W7PA 4I67A 2DPNA 3O9QA 3ET6B 1HBNA 4JKFA 2IBOA 1NK9A 2HMIB 2W25A 1WF2A 1Y10A 2XHBA 3CIMA 2Q3SA 2V9WA 3D1OA 2GV9A 2VG7B 2YWWA 5B8HA 1GXUA 1N32K 2YNGA 3OJUA 5KFDA 2CUYA 3W5ZA 4QYZJ 3KLIB 3D7SB 3LGMA 3OYBA 5KG4A 2CQ1A 2YKNB 2O8CB 2M52A 4WK1A 2AA4A 2XRIA 3M30A 1UJ6A 4KH4A 5AZJB 4AM7A 3LA0A 3NMAA 4FJJA 1TFYA 2RMLA 2V2VA 3C19A 3AJ1A 1HR0K 2W9BB 2QMUB 4J91A 3QGHA 1XJWB 4CFDA 1F9HA 2VUGA 3T41A 1JLGA 1YRUA 3P96A 3LF0A 4HUGA 2Z1GA 2BJ1A 2LA6A 4H5NA 3ENAA 2HURA 2C2OB 2CVEA 3N4WA 3BSCA 2K7JA 4U6PA 1U02A 2EXUA 5LY3A 1ZBSA 2RQKA 1GFWB 3BSNA 3MCSA 3LP2B 2NUBA 4JB8B 2B0GA 1T03B 4IUFA 1IKXA 1RT6B 2VFRA 4OKJA 1GMUA 4K41A 1FJEB 3SZ2A 1Q8KA 1QQOA 8RUCA 4ELUA 3M32A 3AARA 2MDAA 4QYZK 1R8AA 4ZVTB 3KVGA 2FIUA 2CPHA 4O3SA 2HQIA 3GFZA 4ID8A 5F9LA 2C3MA 3E9PA 2XHWA 3FJ2A 4C8LA 3TX0A 4ZK7M 5FDLA 2Z58B 2X74A 2HQGA 3MCAB 4I4BA 4CBWA 4WQ5C 3H5SA 2GELA 1UEVA 3KKRA 3TSPA 1VQLN 4EZ6A 1G1XA 3QSYB 3A8JA 1VQKS 2HHUA 1TZ0A 2CAJA 3HHNB 2HHHJ 3CC7S 3QSIA 2D9OA 3DGPA 3MOZA 5HQ8A 1H73A 5U47A 2CNOB 4ED3A 1WAFA 3J7AP 1JB0C 4NLVA 5JVHQ 5HK4A 4LRAA 1UFWA 1WOOA 1JCEA 5GAGU 4FWNA 2BACA 5J1EB 1FWLA 2L08A 5BR9A 1S77D 3TVZA 2LEBA 3QWPA 1VSEA 4OV6A 5F8IA 3ZZTA 1VQMN 1LOTB 3OYGA 3U9DA 3CJ1A 3Q23A 3GR0A 2E6MA 3SAFA 3H2UB 1QSLA 3EZOA 1M1HA 3M2VA 4LF1A 4X65F 3L7OA 4M5GA 2FVQA 1ESVA 3EZ5A 2RE2A 2JEFA 5IS2A 4GO7X 2GWJA 2YNHA 3C7NA 4K25A 2KN4A 2ZKTA 2QK9A 3KLEA 1TKXB 2A2DA 5F3TA 1M90O 2HB5A 2LQ9A 3KMQA 3LDNA 2UU9J 2ZH2A 2V8HA 5I3QA 3K2YA 2A18A 3L4BC 4NEYA 2L41A 2N4CA 2GFFA 3KFWX 4Y00A 1O1WA 1NXIA 1YVFA 4OGCA 4M63C 2YNIA 3TQEA 4CQ1A 3MAHA 1CLFA 3GCWP 4PR6A 4H4KA 3ZETA 3UDLA 1R27B 1VRTA 4RU9A 4E98A 4CYUA 2MY7A 2Q6BA 1WOPA 2FY8A 4C8OA 2Q66A 1D09B 4KH6A 4CH0S 1YJVA 2A6MA 2OYQA 3PSFA 1IUJA 4AL7A 4LRFA 5HVFA 5CCMA 4FCYA 3THXB 2G8IA 5D77A 3HZEA 2FLOA 2P9SA 1CQNA 2OI2A 4LJMA 5H1SV 1K73O 2G8VA 4B9MA 2P9CA 1HWLA 3C94A 2ASLA 3QZ8A 3I4PA 4DBQA 2IMWP 4FJGA 2F9WA 2GGPB 5F1XA 1ZPVA 1TL5A 3N01A 3AA4A 4TYAA 1V5VA 4JI7F 2F8HA 1VK8A 1C1AA 2ITGA 2HNDA 5I42A 4CK2A 1S1WB 1VSFA 2UU9K 4USKA 2FB0A 2J7WA 4HEA9 4MT1A 3WC2A 4FBUA 3OSPA 3A1YG 4Y2IA 4FJKA 2KT5A 1U0HB 3V9UA 1I51B 2W8KA 1BQNB 5IC4B 1XR7A 1KD1O 3HHLA 2F8MA 1I6JA 2Y8YA 3HD2A 3AAQA 4IOCQ 4NLXA 1TUYA 4ERDA 1WHVA 2DK2A 2UV8G 5LMUJ 2NREA 1S72N 1NGAA 1S6QB 2A40A 3QO9B 2ZHOA 5L1IA 4CLPA 1EX4A 3L6QA 2WAQD 2RQMA 2F8EX 1L5UA 4OKEA 3OL7A 4DFKA 4CJWA 1WSVA 2OPPB 2QI2A 2QIFA 1KOHA 5DM6L 2V2ZA 3BGRA 1QZ5A 1HNIA 4JP8A 2CH5A 4PG5A 2RKIA 4FP9A 5HRNA 4H4MB 5CHCB 2DHXA 2FY1A 4CGFA 1L3SA 3M6GA 1IKVA 4BRDA 1IQZA 4NLPA 2WC9A 3ZEUA 1UW4A 4NLCA 4OZ2A 4B1XB 2NQPA 4J9RA 1JLBB 1RT2A 4RZRA 1RQ0A 2DNPA 3QESA 4MO4A 2ZHBA 2LEPA 3ZXWA 5AQKA 1J27A 3DLLQ 5C24A 4JI2J 2V7YA 3BBBA 4KBOA 3G6ES 3SFGA 1ASUA 1XC3A 4FJNA 2ATQA 1B70B 4R0EA 3MAQA 2KYXA 1XERA 2ASYA 5LMUK 4CWBA 4K4ZA 2P8IA 4KHNA 3CJSA 1X5OA 5I3UB 4WFNL 3QAUA 3M2RB 4CEQA 1H6KX 2J4RA 4E8UA 1HBOA 3DFEA 2C3PA 4DUTA 3QPIA 3VQDA 2I7NA 3D2WA 1S76D 3R2DJ 4GV3A 4X4PA 4LF6F 4CO2A 4CIFA 2CPFA 1RWNB 4CIGA 4LSLB 2VBYA 3ITHA 3TA1A 1RUSA 5KFAA 1V3RA 4OO1J 3GB0A 3ILOA 4OJRA 1CJVB 4E7IA 4X65K 4DTNA 4FLTA 3HF5A 4C3LA 4JI6F 3UB5A 3MPWA 1M5KC 1JLQB 4ZHRB 4V19S 4B3MJ 5GAGP 1MU2B 3SSQA 3V6KA 4Q0BB 4JI7J 1EXQA 4NMXA 3PFEA 4QW9A 3OBYA 2P2CB 4WFYA 4JI2K 3LP1A 1UZDA 3AAWB 3BF4A 4CJPA 2WHOA 2A10A 3IFEA 3R6GB 4LF9J 4X2BA 4E89A 1BHNA 4WFAL 3VGMA 4H0YB 1NGIA 4QJVA 3BPDA 2CPEA 3DRRA 3V9XA 4OHWA 3AVNA 4FYXB 3OHAA 2XY7A 1QVFM 2XMTA 3OYAA 2L9WA 4FVUA 4DI6A 3NVKA 1RGVA 1JNRB 5DO2A 4KGVB 2D4WA 2XYHB 3QEXA 2JX2A 4DXLA 3GIMA 4E3SA 4H5TA 1ZZFA 2M70A 3UNYA 7FDRA 2IA0A 1TVRB 1V4TA 3ENWA 1P1LA 1T9YA 3P38A 4LVOP 4HTUA 4CFAA 4ECYA 5ETLA 3K9JA 1T9TA 2M9KA 4DX8H 3MECA 2C2ZB 4B3MK 1FRMA 3M8ZA 4JI7K 2BQRA 1M1GA 2XLIA 4PZVA 4ED5A 3AO4A 3TAMB 2UUTA 3AO5A 2DGUA 4JI4F 1WC6A 3R1LA 5JXSA 1NDCA 4BC9A 2E5IA 4FZYA 2KFNA 3BR8A 1IBCB 1AA1B 1NOYA 2QWNA 2FBXA 1GQEA 4AHSA 1RWUA 1O13A 4JRPA 2VPYB 1R0BG 1I3OB 3MEDA 1HQ2A 3QWUA 4I2QA 1OPZA 4ED4A 1HWKA 4K4UA 1WUUA 4WF9L 1RAFB 5ETVA 4UOCA 1NU0A 1L3KA 3CD6N 1KVIA 5KFUA 3UR0A 2PO4A 4OYOA 3R7NB 1VQ9N 2GAGC 3I55S 1EZZB 4FYDA 1NG9A 2XEXA 5F8JA 1DBDA 3A2FA 1GLJO 4B3SJ 3NE6A 4OLOA 5KFFA 1WF1A 3G82A 4OI2A 1MW7A 4PXDA 2QLBB 3J81U 1KKHA 3C14A 4ECZA 3R5CA 2QM1A 3PO5A 5G0RB 2LQJA 4AXIA 1L3VA 4JI6J 1GMWD 3R5JB 2C2MB 2W24A 4M5LA 4KFBA 1EKEA 4ED8A 4CZGA 2ZH1A 2MQOA 1ZBUA 3WBZA 2JFKA 2EKYA 2VJVA 4FLZA 1PBAA 2QA4S 4U8YA 4EO8A 1JXEA 3OLBA 1KHVA 4JOUA 5CYMA 3QGPA 2P9IB 5AQIA 2Z30B 2IOCA 4BVOA 1XMQF 3PW7A 5B0FA 4W5OA 3AA9A 3OYNA 2MEWA 3KLFB 4LF5F 4CK1A 4AYBD 2RRAA 2AZ3A 1WSJA 3R7BB 1LK5A 1KVAA 1RHKB 3CSKA 1FE0A 4BR9A 3ZZYA 1Y7PA 4LSNB 1KBRA 4M5KA 1NGCA 3VOVA 3OYDA 1F6TA 4JRQA 2U2FA 5HQLA 5IT0A 5HRPA 4B3SK 4G65A 2HZAA 4TY8B 4LF6K 5D3GB 3BGOP 2L3MA 3T5LA 3P5BP 5KFWA 1KNZA 3QEWA 4KHYA 4RNHA 2KQ2A 1L3TA 1S99A 2HHQA 4UY85 2H5IB 2O4IA 2YWFA 3EVMA 5AQUA 1S9EA 4YS2A 1P1TA 3GIRA 4JI6K 2LQ5A 4CT8A 3M9OB 5CY4A 3VEZA 4KH5A 2W8LA 2X1FA 1VC6A 3QT8A 3MM6A 5AZIA 4GKKJ 1RT4A 2QWPA 2F63A 4LR8A 2G2OA 1FVQA 4LFCJ 1C0UB 4USWA 3THTA 3KJNB 3W61A 5HMXA 4FYWB 1OQ3A 2HBKA 3RUBL 2EFGA 1KN6A 4B1UB 1KQFB 3VZIA 4J9QA 1Q86O 2XMJA 3UCZP 4OI3A 3FSXA 4X4OA 4WZMA 4K2XA 1FCAA 2DIVA 3CMES 4CJRA 4OQJA 2MGZB 3D0IE 3CJ8A 3ZTQA 4DR7J 4FYVB 1TGOA 2P9PA 2OTJN 1WNSA 1U2VA 4NLWA 3DOLB 1Z4UA 4DR3J 2R8HA 4IDHA 3OFGA 3M8YA 1XNQJ 4DV4F 3QAEA 3ZYYX 3CC2S 1Z2LA 1S1TB 4DG1B 5CAAA 4MYUA 3O4NA 3RZAA 4GKKK 3NRBA 4G6VB 4LFCK 4LFAJ 1HNZF 4JI4K 1U8SA 1HBUB 4IRCA 3VQ9A 1BUXA 2BUPA 3EZUA 1WB9A 2BE7D 3VHQA 4PRFA 1Q7YO 5GAGI 1NRKA 3H7HB 4P75A 4CFCA 2AJ0A 1HARA 1VS3A 2PBDA 2EHGA 2RHKA 5BREA 5B0GA 2KHCA 2M0GB 3DLEA 5B08A 1HD0A 1XMQJ 1IQTA 4YDUC 1KTVA 2ZKUA 3PO4A 4CGIA 3GTYX 3DM2B 1GLEG 4LF5J 2CWKA 3V81A 3LUYA 3AGRA 4ANEA 4KPYA 4DR7K 1YJ9S 2RRNA 3VQBA 2DR8A 3MM5A 1KC8O 4WCEL 3SCXA 2EC2A 3L2RA 3V6JA 1WORA 1RAJA 2CFXA 3L8BA 3NNAA 3SAGA 4DPWA 4A47A 3SQ4A 5EU7A 2FHOB 1S6PA 3C16B 4RO0A 2HMIA 2IJNA 2MQPA 3DMJA 1FX4A 3EJMA 1HNVB 3Q24A 4LFAK 3BB5A 1LWCB 3V2UC 4X4TA 4I64A 3SIPB 2VG7A 4FPRA 3OA9A 3T1YJ 4BR7A 2D3ZA 2HRUA 3GJQB 3WXMB 1JLCA 1LWFB 1RAGB 3D0HE 2IAJA 1YHQS 2A6OA 2YKNA 3MWPA 3IMQJ 2PA8D 2W4PA 2ZZNA 1Y0HA 3LAMA 4IFVA 4NA1A 3C0BA 2X1BA 3IO1A 4CEBA 2Z2YB 5AZJA 3CJ4A 5LOQA 1K73T 2AEJA 3BY5A 2DJWA 2KJVA 3B6PA 1XMQK 1N0UA 2B9YA 4F04B 1TAUA 3DC2A 1H0HB 4ZVUB 4LF5K 5F8LA 3WQUA 4XIUA 2UUBF 1IWGA 3NWGA 4A46A 2X6NA 3ZZUA 3V1RA 3ILJA 3TARA 1YQHA 4NLBA 1G2EA 1KAXA 4H0VB 1KLNA 2MKCA 3JAMU 1RA7A 2VB6A 3SI6A 1AZSB 1QHTA 5F8GA 1UCNA 4DLEA 3LP2A 1YRXA 1FDDA 1T03A 3IC1A 1Q8BA 4ZIWA 4DV4J 1FJ7A 1RT6A 3W0LA 3GP9A 2RNEA 1CPZA 4ZTFA 4CLKA 4ZCLA 1BISA 4BR5A 4L6V3 1Q82O 4ECXA 3PY8A 3I5AA 4O8KA 2AZ1A 4IO9L 3TTFA 3T1YK 1VJQA 4FLUA 2ADCA 2FD2A 1HNZJ 2I7PA 5LMNJ 3BPSP 2H3EB 4HI2A 4UW2A 4LIWA 4IEIA 4YN3B 1GOBA 4FM2A 3MMAB 4W5TA 3ZT4A 3KK7A 1SCJB 4L3QA 1WTFA 2GX8A 1Q53A 3SJHA 3J7AN 5EGYA 1JLFB 1YJTA 4IH6A 2QMXA 3THPA 1UEUA 2RQCA 2EK1A 2VBZA 3QFWA 3UIQA 4ILLA 2ZVSA 2Q79A 3S1TA 2LDYA 3CJ0A 3RAMA 3O3LA 4DOZA 3HVTA 4ED6A 4IZ9A 3W1YC 4QR1A 5DG7A 4KHPF 4OZ1A 5J1EA 3AVAA 4EFAC 2D0CA 3JS9A 4BRFA 3CJ7A 1U2FA 3LOUA 2NRXA 3DU6A 4DV4K 1NJIT 3M4XA 4HTIA 4ECVA 3W9IA 3K59A 3THVA 4OIXA 1K8AO 1TKDA 1GLCG 3TANA 2GVZB 2QXLA 4DU3A 3MX2A 3W7BA 4B02A 1HNZK 5LMNK 2OTLS 1N54B 5DGBA 4IH5A 5C42A 3HTVA 3W8GA 4F0HA 2AP1A 3NH2A 3FCHA 2QLWA 5CZ1A 4K8ZA 2UVWA 2DNHA 2HS0A 1SH3A 3SNNA 1RCHA 2E20A 2YNFA 2VF3A 1EQYA 5ITHA 1GOCA 1BMQB 1E3MA 4BWMA 1YSJA 6FD1A 1ITPA 1IKWB 4JK7A 2PY5A 2O3DA 2FF3B 2JOQA 1ZM9A 3CIZA 3SMPA 2Q0RA 4USUA 2Y1RI 5HJYA 4PKGA 3DCAA 1E4GT 1TELA 2Y9HA 2DO4A 3L2VA 4AD6A 1YBTA 1DLOB 4XTTA 3GILA 1S1XB 5KFTA 4C23A 5HQMA 4C2MA 3THXA 3SYZA 1T9VA 1RYSA 1SC1B 2E66A 3NGZA 1MMDA 4K43A 2CDRB 3ZSWA 3VQQA 1TUWA 3VVTA 5B09A 2DVIA 2FHJD 2A42A 4WXOA 1HIYA 3HSZA 4AFFA 2AKWB 1W7AA 4FM1A 3IG1A 2GGPA 5C2DA 1NK6A 4L74A 2A1BA 1CC8A 3TSQA 2J5AA 1S1WA 1VQ6N 1V3ZA 1KOOA 2OEJA 1N34F 4ZPVR 4HTLA 1UJ5A 3QRQA 4DFJA 3V6DB 3UO0A 3ZSZA 2DNLA 3PHTA 2YKQA 1BQNA 1IM6A 2W42A 3BSAA 4B9NA 4EHUA 4YOWA 1Z25A 4NLTA 2HG4A 3N4QA 2J8SA