2B5JA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r165481
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 133
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b5jA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b5jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b5jA05
3I0RB 4FW2A 4GC6A 1C1CA 1HYSB 1BIUA 4ECUA 3SV4A 3DI6A 1BI4A 1I3AA 1NKBA 2R2SA 1WLJA 1S9GA 1ZYQA 4ZHRB 3QEWA 4DQIA 3DOKA 1RT5A 4IG3A 1N5YB 1DTTA 4TQRA 3MTKA 1DTQA 2A1SA 4H4MA 5CYQA 3MR2A 1HRHA 3KMQA 4I7FA 3SNNA 4CJ4A 2XHBA 2YNHA 5T7BA 3LWLA 4FLYA 3AA3A 3MEGA 2BRKA 3QLHA 1QTMA 3BQ1A 4FCYA 3KK1B 3NF8A 1FKOA 4XIUA 3D28A 4C8OA 5JXSA 3CG7A 4Q45A 4RNMA 1JXEA 2B6AA 1J5OB 2QV6A 3VQ9A 1SL2A 1JLGB 3QIDA 2RPIA 1JKHB 4RW4A 4I2QB 4DWIA 3OL9A 3PW4A 4M3TA 2QK9A 2C2EA 1ZBFA 1JLCA 2V4QA 4KHNA 3WNGA 2ALZA 4KSEB 3IRXB 4WXWA 4I2PB 3OS1A 4Y2CA 3RTVA 1T03A 5J2QB 4B9SA 4M41A 4O4GA 4XO0A 3T3FA 3MEDA 1IH7A 4NLPA 2G8HA 3DDKA 3L2RA 4O3OA 3QZ8A 1R0AB 3SCXA 4ZVEA 3QNNA 1TVRA 1X1PA 4E1MA 3BJYA 2RKIB 4E19A 3NBPA 1BHLA 4DS4A 4CGDA 2W8KA 4AHVA 3C6UB 4K50A 4CF1A 1S97A 4DU4A 1S5JA 4ICLA 3PO5A 4RW8B 3SQ2A 2IDOA 2WK4A 3OYIA 5KG6A 5HLFA 4M3ZA 3OHBA 4CHNA 1TL1B 1LW2B 4NRUA 3CJ3A 2AGOA 1BQNA 4IFVA 3QEXA 1HMVA 3Q8PB 1KLMA 3JSMB 2YNGA 4HYKA 3VQ6A 3IGVA 3NGYA 3K5MA 1RTHB 4Z4GA 4KKOB 3KLFB 4CGFA 3KLIB 5J2NB 2C2DA 3M8QB 2W9CB 4DSFA 1J54A 4KBIA 4HCBA 1NK8A 4KE5A 1IKXB 4GC7A 3SQ0A 2FJWA 3SPZA 3ASMA 2R2UA 2HHWA 1SUQB 4MIBA 3OYKA 1U48A 4IH6A 3DOLA 3OL7A 3CJ4A 3I5CA 5KFPA 3LP0B 4ED6A 3NAHA 3OYCA 2ZE2A 1S1XB 1TL3B 1CXQA 1SV5B 3CFPA 1UWBA 1VRUA 1T7PA 2IMWP 2Z1JA 1W0HA 3P5JA 4FK4A 1F21A 3VQBA 3NAIA 2IC3A 2IM3A 3PY8A 1Q9XA 4N41A 4F4ZA 4Z4IA 3L3VA 4IH7A 3HPHA 3OSNA 1VRTB 4WZMA 2IJNA 5KFIA 3ZSYA 1HNVB 1S6QB 4Q44A 3BSAA 2V4RA 3L3UA 3KK3A 3ZSOA 3T5LA 3BR9A 4WZQA 2PY5A 1NK0A 3MXIA 3FQLA 3TAMB 3KNAA 3V9XA 3SZ2A 4CHZA 2UVUA 1RA7A 1TKZA 5KGXA 4IG0A 2IGIA 4ZMMA 4FW1A 4O3PA 3PUFA 1S1UA 4CEEA 1C6VA 3V9SA 2ILZA 2RF2B 4H4OA 4ECRA 4K4ZA 5HP1A 4FLXA 4MFBA 2HHVA 4DTPA 3V6JA 3RWUA 2IAJB 2OPRB 3DRSB 3QYYA 5DLFA 3WNHA 4QWBA 2RDJA 3AA5X 3BSNA 4F2SA 3UIQA 4CEZA 4BE0A 4CIFA 4E0DA 2W9AA 4Q43A 1JL1A 3PJWA 2R2TA 1LW0A 1LV5A 4R5PA 4JV0A 3DYAB 2R8KA 3H5YA 3NF6A 3IGNA 4DQRA 4ED8A 4FM2A 3VQAA 3TI0A 4FLVA 5JS1A 3V4IA 2IA6A 3OLBA 2PZSA 2FBXA 1U45A 4CIGA 4NLSA 4KFBB 2JEGA 4CK3A 4RW9A 4PWDA 3ICLA 4CEOA 4QAGA 4KAZA 1HNIA 4OGEA 3O4NA 1CSJA 4ECXA 3NCIA 3H5SA 5D3GA 4J9SA 1IKVA 3ULDA 3BREA 1RTIA 1LWFB 4DF4A 3V1OA 3HT3A 1S1VB 1I39A 4F4KA 2OPSB 3H4DA 3QINA 1RILA 3QEVA 4TLRA 4L8RB 1DLOB 3EYZA 5KG2A 5J2MB 4LY7A 2WTFA 4WE1B 2HNZA 4DSJA 4ZP7A 4AH9A 2AWZA 4KB7A 4N5SA 3RB3A 1Z4UA 5HRSA 2FJXA 1BL3A 1L3UA 1EKEA 1FKPB 3NDKA 5DK5A 2DY4A 3QETA 3THVA 1RNHA 3GV8B 3OYNA 3OLAA 4H8KA 2Y1JA 3JYTB 4ZHRA 3MR3A 4R8UB 3O4QA 1N5YA 4ZPDA 4URQU 4PQUB 4YP3A 1ITGA 4FJ8A 4RU9A 1VSHA 5EUHA 3Q8SB 3KLGB 3TAPA 4DTXA 4IH5A 4EEYA 4H54A 4IQXA 4CK1A 3DRRA 4NYZA 2ZD1B 3QGGA 3ZT1A 4M3XA 2HNYA 2D3UA 5CY4A 4CJEA 5FDLB 4CGJA 4RG8A 3HPOA 2D3ZA 3VA0A 3CO9A 3AVAA 5KFGA 2IM1A 5KFOA 2D0AA 4LSNA 4Y34A 2JEIA 3HVWA 3NAEA 1C0UB 5L1IA 3HO1A 4OGCA 3PR4A 5KG4A 4Z4HA 1RCHA 4ECYA 4TN2A 1BQMB 4TSXA 1N4LA 3F9KA 4JUZA 5KTQA 4IR9A 4DSLA 1LWEB 4M95A 2E6MA 3LDSA 1I6JA 3RMDA 1S9FA 5CYMA 3HVTA 3PX6A 3U6FA 1JKHA 4WFZA 4WYLA 3M9MB 3RMCA 4TYAA 4I2QA 2OZSA 2JLEA 2FVRA 2D0BA 4YQWA 4M3RA 3IRXA 1RT4B 4I2PA 1XHZA 3G6YA 2WONA 2R2RA 2JEJA 4F8RA 1TKXA 3V9WA 3ISNC 3OYGA 3OJUA 4ECQA 1QS4A 4ZPBA 3VQSA 4QW9A 1RT6B 2ZQBA 4FZZA 1HYVA 3SI8A 1R0AA 3CJ5A 5KT6A 3O3FA 2CKWA 4NLRA 1MU2A 3OYDA 3CFOA 2E9RX 4FLZA 1EETA 3C6UA 4Z0UA 4B3OB 2CJQA 3DLBA 4DQPA 1JLAB 3G6VA 3H40A 2EHGA 3MXMA 3AO3A 4UQGA 3IAYA 4NCGB 3TABA 3LANA 4KHQA 3M8RA 5DQGA 4J9QA 3QEIA 2O4IA 4DTMA 3OS0A 5EWGA 5KT4A 3K59A 3IN5A 1GX5A 3ZSRA 1X9MA 5DLGA 4FJ7A 4RUAA 2DPJA 3NFAA 2OH2A 4CK2A 3L2UA 1C1AA 1Q9YA 4TYBA 5KI6A 3KLFA 2AU0A 3KLIA 1JX4A 1ZBIA 3I0SB 2HMIA 1TAQA 1K1SA 2FLLA 3NF9A 4CJUA 4QWEA 4Q0BB 2IM2A 3ZT2A 3IS9A 4JV2A 5HBMB 1RDDA 2XO7A 3DLEB 4B8CA 4XPEA 4CF2A 3QIPA 1SUQA 4R0EA 5KG0A 2HHUA 4RNFA 3TARA 1S4FA 4Y2AA 3NGDA 3NGZA 3GIMA 3K2PA 4NLGA 4F3OA 1TP7A 4ZVFA 4NCAA 4F4WA 1S1XA 4PUOA 1QSLA 1FXXA 4O55A 4Z4CA 3GV5B 4B9MA 4CEBA 3ZCMA 4B9LA 1WSHA 3FFIB 1WNSA 3KTQA 3VQQA 2OYQA 2A1RA 1RTDA 4QWDA 4JRQA 4ECTA 2YKNA 3L2QA 3LP1A 3EPGA 1HQEB 3QEPA 3AO5A 4O3NA 1S10A 4F4XA 4HTUA 2HB5A 3TAMA 3OHAA 4LSLA 3A2FA 3OL6A 3VQDA 2XY7A 4FJLA 3RRHA 1C0TB 1KHVA 4C8KA 3QGHA 4QWAA 3PW5A 2RF2A 3K57A 4HKQA 4BWMA 2KFNA 3P1GA 4CEFA 1RDCA 3BDPA 4CGHA 5SWMA 1RTJA 4K4XA 2JEFA 1NJZA 1XI1A 2BANB 5F9LA 2W42A 4CEAA 2IS3A 2R8IA 4J9PA 4J2AA 3O3HA 1NHUA 2Q3SA 5C25A 3DYAA 4G1QA 4EYHB 3QNOA 1FK9A 5DG8A 5CZ1A 3V6DB 4LH5A 4DFMA 2HWHA 4OLBA 5L1LA 3VQ5A 2DPIA 2FJVA 3PJXA 4E7JA 4K4UA 3DRPB 3TVKA 1TV6A 3ALYA 2PYLA 3LPTA 1VSKA 4DF8A 4MH8A 2G8VA 4ZVGA 4B9UA 2BGGA 3OYLA 1ZETA 1HQUB 4RW6B 3SUOA 1RT3A 2G8WA 1QUVA 1RT7A 2XI2A 2X74A 3K58A 1JIHA 3AVCA 2YNFA 3H5UA 3BQ2A 2W7OA 1QAIA 3AA4A 3LAMA 2AX1A 4QCLA 2YKMB 1U4BA 1XC9A 3PHEA 1X9SA 1VSJA 4KO0B 1XHXA 2KQ2A 1IKWB 1C0MA 4HUGA 3V81B 3QZ7A 1YVUA 1S6PB 1ASUA 4J9LA 2JC1A 4M94A 3E01A 2W9BB 1IO2A 3AVLA 5K14A 3SUQA 1FKPA 1S9EB 1NJYA 3PO4A 4U7CA 3KLHB 4FYDA 2KW4A 1HPZB 4BWJA 4KB1A 4B9TA 3JYTA 3GV7B 2B5JB 1REVA 1RT1B 3NH0A 4PQUA 4B9NA 4CJQA 3T5JA 5KFCA 1JLFB 4OKEA 4KTZA 4QWCA 5KT5A 3D0PA 3KLEB 3KKRA 3DM2B 1NKEA 5KFUA 1WN7A 1JLEA 2VG6A 4KTWA 2GIRA 3Q8QB 3UQSA 3TR8A 1UOCA 4E3SA 1C0UA 2HNDA 1EP4B 1BQMA 1N6QA 3GIJA 3ISND 3RR7A 4LH4A 4KHSA 1X9WA 1LWEA 4ID5B 3SJJA 3KK2A 1S1TA 3CJ2A 1LWCA 4F50A 1S0OA 3NGIA 3OYBA 3DLGB 4W5NA 5KG7A 4CJFA 4F4YA 5KFVA 4J9NA 3Q8RB 2JC0A 3PVXA 2OPQB 4GVMA 1S48A 4DTUA 4O3RA 5C42B 4KHMA 5J1EA 2XGPA 3PR5B 4NLOA 1XR5A 4DG1B 4X2BA 2IM0A 3BGRB 2YNIB 4K4TA 4NRTA 4TY8B 4PA1A 5F9NA 4ED7A 5F8JA 3TAFA 3OYJA 5KFFA 1A5VA 1RT2A 5F8LA 2VWJA 3TAGA 3MR5A 2WOMB 4ELUA 3VQPA 4CESA 2YHBA 4E1NA 4QPXA 1WAJA 5I3UB 1LAVA 4IKAA 1NK5A 4RW7B 1SKWA 3MEEB 3ZSQA 4ELTA 1XR7A 3IG1B 5HROB 4Q8FA 4EP4A 4OPKA 3FQKA 2W8LA 4RZRA 1C1BB 4HUFA 5DQIA 2D0CA 3M8PA 4DTOA 1C1CB 1HYZA 1TKTB 4NYNA 4Q0BA 3KJVB 5C24A 3DI6B 3HM9A 3LZJA 1Y97A 1S9GB 5I42B 3C6TB 3DOKB 1RT5B 4IG3B 2VG7A 3CIZA 1VSIA 1ZBHA 4KI6A 2XCPA 1RDBA 1DTQB 2G8KA 2J6SA 4H4MB 3RBEA 5CYQB 4CJ3A 5DMRA 1SKSA 3HL8A 1TK0A 4I7FB 3MR6A 5JS2A 4NLTA 1A5WA 3RAQA 3VQ7A 3UPFA 2D5RA 2BQUA 3G10A 4FVMA 5SZTA 4Y1CA 3ZT3A 1FKOB 3UDLA 2P51A 1N56A 5F8HA 4CJVA 2AGPA 4M42A 4BDPA 2UUTA 2IOCA 1RAJA 4CF0A 3M9OB 5J2PB 3DLRA 3HJFA 3GILA 4DL4A 4KREA 2GC8A 4F2RA 4CJWA 1JLBA 4QOZB 3GYNA 1U49A 3V6HA 4RW4B 3DMJA 4CF8A 3BQ0A 1U09A 4MIAA 2V9WA 3K5LA 2IBKA 4W5OA 5KRTA 2R8HA 3I0RA 3WNEA 1HYSA 2QE5A 2VA2A 2WHOA 3OYHA 4FXDA 3CJ0A 1L3SA 1T03B 4Y1DA 1NNDA 4URGA 1KVBA 4LQ3A 2GUIA 3HVAA 3MECB 2ILYA 4O4GB 1B9FA 3MEDB 2AQ4A 1Q8IA 4BDZA 3KOAA 4DS5A 4DU1A 4O5BA 4DTNA 2W7PA 4W5RA 3QESA 4CECA 1TVRB 4CFDA 4HVJA 3NBPB 4ID1A 3TWHA 4KV8B 3CFRA 2HVHA 1C2PA 3CQ8A 4CJSA 5EWEA 3C94A 3T19A 3H08A 3KHHA 1T3NA 3TAEA 4YR0A 2G8IA 4EBEA 2XGQA 3V6DA 3EZ5A 1SL0A 2PYJA 4ZPCA 1BQNB 1JLQB 4O4RA 3KK1A 4IFVB 1HMVB 1JXLA 1KLMB 1J9AA 3DRPA 2YNGB 3B6OA 5EU7A 1J5OA 3CM5A 1G15A 1JLGA 4MKAA 2RDIA 2F8EX 3U3GA 3S3OA 2BR0A 1HQUA 4DSKA 4W5TA 4NLYA 5KG1A 4JV1A 3KMSA 4M3WA 3OSPA 5J2QA 4J9MA 5KFMA 2KZZA 4FBTA 2EC0A 4DL5A 3SQ1A 3NH1A 3DOLB 4K8XA 3RB0A 4KI4A 2HHXA 4ECSA 1QAJA 4E7LA 2ZE2B 3ITHB 2RKIA 4CHOA 1VSMA 2DFFA 3CDUA 4NYFA 1CZBA 5KGWA 1S1WB 3HK2A 4NLVA 1KHWA 4DLEA 2IC3B 3EY1A 2XI3A 1YTAA 3BSCA 4RW8A 3ZSZA 4FJIA 2G8FA 4EP5A 3N6MA 4CJLA 3MFIA 2C22A 3V1RA 1TL1A 5KFTA 4EBCA 5KT2A 2P1JA 1LW2A 2YHAA 3AA2A 3OYMA 4J2BA 4AILC 3N6NA 3PW7A 3LZIA 2R7YA 1NK7A 1NKCA 3JSMA 4AHCA 1RTHA 3KLEA 1TGOA 3AO2A 4KKOA 1D0EA 1NOZA 3CWJA 2DFEA 4DL6A 4M3YA 4FJHA 2ITGA 3LPUA 5J2NA 1TKZB 4IG0B 3NHGA 3M8QA 2FC0A 1QQCA 1S1UB 1IM4A 2W9CA 1RBSA 2FVQA 2XCAA 1GOBA 4BE1A 1IKXA 5HP1B 3NMAA 4DU3A 4MFBB 3BSOA 2ASJA 4ID5A 5KFKA 1ASWA 4J2EA 3AVMA 3SUPA 2X78A 3OYEA 2KTQA 5KFRA 3TAQA 4O44B 3B6PA 2HVIA 3LP0A 1S49A 2FLPA 3H2LA 5HRNA 1LW0B 4HCCA 3T5HA 4OJRA 3WNFA 4R5PB 1TL3A 1SV5A 3OL8A 4KHRA 2HHTA 4TY9A 2LSNA 4NLDA 4M3UA 1BCOA 5C42A 3V4IB 3PV8A 2FVSA 3SFUA 3T1AA 3VQCA 1WSFA 1VRTA 2GBZA 4EO8A 4CJKA 3NE6A 1NJWA 4AHTA 3BGRA 4PWDB 1HNVA 1S6QA 4TY8A 2ATQA 4K4SA 3PX4A 2GV9A 3RMAA 3O3GA 2DFHA 3HYFA 1VSEA 1L3TA 4CHPA 5D3GB 5KFYA 3OYAA 4CF9A 4FS1A 1IKVB 4HUEA 3M8SA 3MXJA 1RTIB 4E7HA 3L2VA 4FLTA 1IKYB 4KPYA 4IRDA 3SV3A 5I3UA 4ZTJA 4OPJA 4DL7A 3CDWA 4RW7A 3AVBA 4IFYB 2IAJA 1U47A 5F8MA 2OPRA 3DRSA 5HROA 4ED3A 1KFSA 3NKYA 2HNZB 3G86A 4YFUA 3SUNA 3QO9B 2BQ3A 2HHSA 3I5BA 1XR6A 1TKTA 1QSYA 5FRMA 3KJVA 1UA0A 4RNOA 2IJFA 5I42A 3VQEA 3C6TA 1ASVA 3PW0A 1QSSA 1KVAA 3NH2A 4J9KA 3VQ8A 2XY6A 2D7SA 4K4VA 1UAXA 4IOBA 3DRRB 4FLWA 1QE1B 4KFBA 4J9RA 4OKKA 2KFZA 2ATLA 4NLWA 4ECWA 2HNYB 3CYMA 4YMEA 5F8NA 2Z1IA 2DTUA 2BRLA 4MK9A 4LSNB 1J53A 4IRCA 5DGBA 4PY5A 5KFWA 2BE2B 1LWFA 5J2PA 1RA6A 3T5KA 2P5GA 4K4WA 3V9ZA 1S1VA 1NOYA 2OPSA 4Z4FA 5CYMB 3HVTB 4HHTA 2X6NA 1VSFA 1DLOA 2OZMA 3DLKB 2R8GA 3L2WA 5DG9A 4CFBA 4JRPA 4CHYA 5J2MA 3VQ4A 2HAIA 3E51A 3NL0A 4WE1A 2XWYA 4ZVHA 1BGXT 3TQ1A 3V1QA 1K6YA 2FLNA 4CFCA 1S0NA 2WONB 3ZSXA 1TKXB 2X6SA 3AVKA 3PZPA 1CZ9A 4RNHA 5L9XA 4RNNA 3MECA 1NK9A 4C8MA 1WAFA 3F73A 1VK0A 3HXMA 4ED0A 4R8UA 1ZTWA 4K8ZA 1KCFA 4DSIA 3OS2A 4FJXA 1MU2B 1KTQA 4EZ6A 3KLGA 4E7KA 4KV8A 4KAIA 1L3VA 5KFZA 1VSDA 1EETB 2C2RA 4DMNA 4EYIB 4B8AB 2ZD1A 5HRPA 3LP3A 1Z26A 5FDLA 1SH3A 1TQLA 4CIEA 4CGIA 1WSJA 3RBDA 2I5JB 4IKFA 2E9ZA 3MF5A 4IR1A 1JLQA 4OVLA 1T05B 4IRKA 2XC9A 4FJMA 4IDKB 4JS5A 1XWLA 4RUCA 3LP2B 3K5NA 1YT3A 4ZP8A 4XPCA 3KIOA 2JGUA 2HMIB 4J9OA 4ZPAA 3D45A 4KHWA 4O0JA 4ZP6A 4M45A 3IS9B 1N48A 1RT4A 2VG5B 2FVPA 2OPPB 3QIPB 4O3QA 1SH2A 2VA3A 4YR2A 5EDWA 3AO4A 3OYFA 5KFJA 3KKSA 4CJTA 4Q5VA 1RT6A 1L5UA 4DL2A 3AVHA 2BDPA 1ZBLA 3KHLA 4GMJB 3S3NA 4CE9A 3FSIA 3ITHA 4WFYA 4DFJA 4DLGA 4PUOB 2F96A 1S1WA 2BQRA 4B3OA 2C28A 4DFPA 4TXSA 1HJRA 1JLAA 5JUMA 3TANA 1D1UA 2F8SA 3V9UA 3MAQA 3I5AA 4NCGA 1UA1A 2AGQA 4ZTFA 4WXOA 3RR8A 1RTDB 4DL3A 2O5DA 1WSGA 2YKNB 4N47A 3LP1B 4BDYA 1Z25A 3AVFA 1U04A 4BACA 4FJKA 1D5AA 1NJXA 4NLQA 2QXFA 3KHRA 1RBTA 4LQ9A 3CVKA 4MK7A 4MK8A 4LSLB 3I0SA 4WYWA 4KB0A 4OL8A 3GIKA 2E9TA 2FBYA 1W25A 3RAXA 3VA3A 3QGIA 1BI4B 5HBMA 2AJQA 1B92A 3GQCA 3DLEA 4O0IA 1SKRA 3C95A 1IG9A 5KFAA 2FBTA 2ASLA 4MQ3A 4B9VA 1RTJB 1KSPA 2WCXA 1DTTB 4ECVA 4DQQA 4O44A 4KTQA 2VWKA 4KHYA 4F3TA 5C25B 4ELVA 2FVCA 4FM0A 4FK0A 4CERA 4G1QB 2YNHB 1FK9B 3ZSVA 3HVRA 2UVWA 3MEGB 3QLHB 5KFHA 2HW3A 5L1KA 3FFIA 3QIOA 4E89A 4U6PA 2UVRA 2J6TA 2XRIA 2B6AB 1TV6B 5KFEA 4DQSA 2E6LA 2FBVA 1QHTA 2OA8A 1HQEA 4EZ9A 2O4GA 3AV9A 4YNQA 4Y3CA 2F8TA 1ZBUA 4FJGA 3HSTB 1O1WA 4FZYA 1A5XA 1JLCB 4FJ9A 1RT3B 2D41A 3VN5A 1VSLA 3SQ4A 3P83D 1RT7B 4EBDA 4CJRA 3H98A 3QERA 1IKYA 5HRRA 2YV0X 2YNFB 1C0TA 3AO1A 1WNEA 2V0NA 4Z4EA 5KFBA 5KFQA 2Z1HA 1B9DA 1TK5A 1LAWA 1T94A 2UVVA 5KT7A 2J6UA 3LAKA 4IFYA 4AHRA 1BCMA 3H59A 5FRNA 3GIIA 4AHSA 4OKJA 5KG3A 4DTJA 4DTSA 4URSA 1KVCA 3S3MA 3QO9A 2BANA 5DQHA 4ZP9A 1KFDA 2NUBA 2ASDA 1RBVA 2QKKA 4CJPA 3S9HA 4QW8A 3E01B 4LD0A 5K14B 4ED2A 2AX0A 2EX3A 4FJNA 4ICLB 2HHQA 1SH0A 1REVB 4CEDA 5HLFB 5KRSA 1TK8A 4CHQA 3PX0A 4I9QA 3V6KA 4DFKA 3RRGA 1TKDA 3KD5E 1BISA 4KHUA 4FJJA 3AVIA 2WRMA 5KG5A 4FS2A 1CXUA 1QE1A 4N56A 4NCBA 4DTRA 4JLHA 4FBUA 5EWFA 3M9NB 1WSEA 4K4YA 1JLEB 2VG6B 3N6LA 1JXBA 1YTUA 3MFHA 3H5XA 3SI6A 3AVNA 2RN2A 3EPIA 2HNDB 4JS4A 5KFNA 4RW6A 3HP9A 3D5MA 2HWIA 4ED1A 4MKBA 1N6QB 2XY5A 4W5QA 3L8BA 2BE2A 1WSIA 3FRZA 4FZXC 3OJSA 1RDAA 3KK2B 5KFDA 1S1TB 1K1QA 4CEQA 2Y1IA 1JL2A 1S0MA 3U3YA 3H4BA 1LWCB 2YKMA 3DLKA 4DEZA 3HPGA 4KO0A 3KD1E 4NZ0A 2KZMA 1IKWA 4FM1A 3OY9A 3V81A 1S6PA 1UWBB 1VRUB 4TQSA 3CDEA 2W9BA 1RBUA 3I8DA 1S9EA 3ZT4A 3KLHA 4I9LA 5J1EB 1HPZA 4YR3A 1GX6A 2B5JA 3ZSWA 1RT1A 5KFSA 1RYSA 2QKBA 4ECZA 2GIQA 5KFLA 1JLFA 1GOCA 2ETJA 1OS5A 3UR0A 2P5OA 4J2DA 3KK3B 3KLVA 3RMBA 4DSEA 3SPYA 1RDRA 1RT2B 3DM2A 3SFGA 1NHVA 5KFXA 3RB4A 4C8LA 3G6XA 1KLNA 4N76A 3HHKA 1D9DA 4C8NA 2I5JA 1YVFA 5E41A 1RBRA 5DGAA 4NLUA 3SYZA 1EX4A 1T05A 1EP4A 3FDSA 4H4OB 4Q8EA 2XY8A 4AHUA 3AVGA 4WFXA 4IDKA 1NK6A 3LALA 3LP2A 2R8JA 1HARA 4O3SA 4NLXA 4CGGA 3ZT0A 3KHGA 1W9HA 3M8PB 1TAUA 4FJ5A 3DLGA 5C24B 4OLAA 2VG5A 1GOAA 4B08A 2WB4A 5DG7A 2OPPA 1D8YA 5F8GA 5C5JA 2G8UA 5L1JA 4FK2A 2E4LA 2VG7B 4CCHA 2OPQA 5CZ2A 4G3IA 1CLQA 1MMLA 4BE2A 4GW6A 3K5OA 1BIZA 3CM6A 4DG1A 4RW9B 2ZKUA 2YNIA 3NF7A 1D9FA 4FLUA 1HNIB 4E7IA 3G0ZA 5KT3A 1NK4A 3DLHA 1RYRA 5T14A 4CFAA 4EO6A 4CJ5A 2WOMA 3LWMA 3PW2A 1EXQA 1T8EA 3OVNA 2Z1GA 3HP6A 3RB6A 1JLBB 3EZUA 2UUWA 1KRPA 3DMJB 2B4JA 3MEEA 3AVJA 1SL1A 2B43A 3IG1A 5F8IA 3HKWA 4IBNA 1ZTTA 5FROA 4KRFA 1C1BA 2I1RA
chains in the Genus database with same CATH superfamily
3CDBA 4ZLJA 3SV4A 2QMXA 3DI6A 1NKBA 1I3AA 5FPDA 3TU5A 1WLJA 2MKYA 1ZYQA 3Q83A 2M70A 4DB3A 5D4OA 3UI3A 1N5YB 1Z2LA 2LXIA 1DTTA 2ALYB 3MTKA 1HIYA 2V68A 4H4MA 2OMLA 3W0LA 2DNKA 4XDDA 3IWLA 2G2ZA 3UB5A 4UOGA 1Q82T 2HMPA 2ZGZA 1RDWX 1NLKL 2NZTA 3U1MA 1RDUA 4Z2XA 1TL7A 2C3OA 5AQRA 5D0GA 3K9JA 4HTJA 3VAJA 3BQ1A 3NF8A 3HTVA 3M6UA 4BC9A 4XIUA 3D28A 4C8OA 2CXEA 4IFEA 1VYAA 4Q45A 3VQ9A 1E6VB 3QIDA 2IRYA 4DU7A 3GFZA 3UKRA 3CCUN 4RW4A 1SJ3P 3Q86A 3OL9A 1MLAA 4PPDA 3TTFA 1CVJA 5EN1A 2MSSA 3VAMA 5AJ3J 4I2PB 5AJ3F 5JMNA 1K9MO 3PYFA 3FSXA 3OS1A 2D3O1 1ZBTA 3RTVA 2HYIB 1VQ8N 4M41A 3MCSA 4OYIA 3T3FA 1CEZA 3I8BA 1T95A 3UD5A 3H2VE 3QNNA 4E1MA 4J8FA 3NBPA 2Z0GA 2WSCC 2DGWA 3G6ES 5C2FA 5C2GA 4ZVOB 1APSA 4RW8B 1K9MT 3DXKA 3M2RB 5KG6A 3LQVA 5HJXA 1U1LA 4CHNA 1TR0A 2GJFA 2OGUA 3QEXA 4ZJQA 1U0HA 3MAAB 4Z4GA 4WCEL 3BEGB 4OV1A 1VHXA 4PXDA 5J2NB 2YBVA 3BF4A 4XTTA 4C11B 3WXKA 1NK8A 2FJWA 3SPZA 1SUQB 1QUPA 2W2PP 5HQLA 4MIBA 4Z7CA 3I56N 4ANEA 3DOLA 3OL7A 2YJFA 2EK6A 5KFPA 5AXLA 3WUHA 3OYCA 2YTCA 5AFUH 4YOXA 1S1XB 3Q89A 2W4DA 4ZA1A 5B7WA 3W64A 3I55S 1CXQA 1T7PA 4C4WA 3P39A 3VV2B 3I9ZA 1W0HA 4UUXA 3NRBA 1HW8A 2YKPA 1FT8A 1JK9B 1F60B 1F9EB 3L3VA 5F0WA 2OEJA 3BB5A 3OA9A 4WZMA 1VRTB 4CBWA 3D7SB 3B4DA 1S6QB 3RYLA 4HACA 1M1GA 2VICA 2DNZA 2I38A 2MQOA 2IGIA 4ZMMA 1PKUA 1JMTA 2UXCK 4QIFA 3V9SA 1UW9A 2ILZA 4B3MK 3AJ2A 2BXJA 5HP1A 2HHVA 3F9MA 4DTPA 3RWUA 2IAJB 3WX8A 1OVQA 3DRSB 1F3VA 2X7IA 2G0CA 2O01C 3VETA 5HATA 4CIFA 4E0DA 2F4VK 2W9AA 3GE9A 1JL1A 2DCUB 4R5PA 4JV0A 3HZ6A 3QICA 4GNIA 1RZMA 2DNQA 2R8KA 5AXMA 2M9KA 3H5YA 3NF6A 2QFJA 3TI0A 4FLVA 5C10A 2ZBQA 5GAHP 3OLBA 1VQYA 2IDLA 5AT1B 3B78A 4LF5J 4KFBB 2RQCA 4LF5F 4BREA 2Q66A 1YK9A 2KKZA 3MUMP 1HNIA 4OGEA 3O4NA 2LA4A 5IZHA 2DR7A 1AUSL 2CYYA 2LQBA 4ECXA 1XK8A 1E4GT 4K0KK 4J9SA 5AQMA 3ULDA 4KIAA 1LWFB 1TZ0A 3V1OA 3QINA 6FDRA 2A18A 4Z7YA 5M1NA 4UY8O 5KG2A 2GGPA 5E5NA 5EY4A 1V3ZA 5BR8J 5BR8F 2LVWA 4MDAA 2UXDJ 4AFFA 2UXDF 4BVPA 2CADA 3R7NB 2O8EA 3ETOA 1T11A 3P38A 3UE5A 2DGSA 1I94J 4JV5J 1VQ9S 3QETA 1HBMA 4MIWA 1IBLF 3GV8B 4Y00A 3OYNA 2VIHA 1UVIA 5HVFA 4LC9B 1RB0A 1N33K 3MK6A 4RU9A 4ZCIA 4UY8T 3F2KA 5JMVA 4JYAF 4RUHA 3KLGB 2QJ3A 3TAPA 1B3TA 2A2CA 3K2YA 3OFEA 4EEYA 4IQXA 5IV4A 2GNKA 5A0YB 3QGGA 1XERA 5CY4A 2D3UA 3MOJB 2V69A 3CF5L 5FDLB 1D3WA 3VA0A 3VAHA 3UE2A 3TWZA 2D0AA 2C3YA 4GVLA 1C0UB 4DKWA 5L1IA 4JEPA 3PR4A 4PYAA 2UUAK 1RCHA 3R9PA 5AQYA 5HQ8A 1IR0A 4TSXA 3GSIA 3F9KA 4JUZA 3S7RA 1LWEB 3L09A 3LDSA 1I6JA 3RMDA 3HVTA 3QRPA 5EX5A 3A8IA 3ELHA 3FEYB 4WFZA 1OQ6A 1MNEA 4TYAA 4I2QA 3QB0A 1OWXA 2JLEA 2OZSA 4DV0F 1CZAN 1LXNA 3IRXA 4CLLA 3IR7B 2DKOB 1YHQN 2R2RA 4I6WA 2RAQA 3AGRA 4JK8A 1TKXA 4WJBA 1J27A 2UXBK 2E29A 3OBWA 1HYVA 3Q0AA 3PKMA 2R7OA 4NE9C 4B3RK 3R5AA 3HHLA 2HFNA 5CZXA 2Y1RI 1MU2A 1J5EJ 5AFUA 1J5EF 1TYQB 3CFOA 4NA1A 4FLZA 1EETA 1N36K 3DHWC 2CJQA 3OTCA 1AW0A 1JCGA 3G6VA 2RU9A 4UQGA 3M8WA 1BWVA 4NCGB 2E2NA 1FD8A 4JI2F 4YDUC 4FYYB 2R9LA 1RAIB 4FXWA 3OS0A 1U2FA 1PCAA 1WOOA 3P8BB 4WBFA 3HX9A 2PGCA 4FJ7A 3NFAA 4U7UK 4KHPK 3L2UA 1C1AA 2DNYA 1T3VA 4NASA 3M30A 2AU0A 3KLIA 4OPAA 3LDNA 2P9EA 5AQWA 1JX4A 1Z1ZA 1GMWA 1WACA 5FD1A 1K1SA 3NF9A 3P6YC 1QAXA 4KGXB 3ZT2A 5HBMB 4F04B 3EKUA 1R0CB 1RHKB 2XMVA 3TW0A 3BV8A 1UL3A 1S4FA 3NGZA 4L74A 1ZM2A 3K2PA 4DUZK 1ZC6A 3J7AN 2VDIA 4NCAA 1YWXA 4A2AA 4B1YB 1EB0A 1ICEB 2DNHA 4C98A 5CHCB 4BRQA 5DZ6A 1PYTA 3QFHA 2CGJA 1W7WA 4ES1A 3GV5B 4B9LA 3P3DA 1WSHA 3VQQA 3M2UA 2OYQA 1S99A 2VFUA 2IA0A 3CJKB 1PBAA 2UV8G 4DR6J 4QWDA 2GQQA 4DR6F 1FJGK 2YKNA 3FBCA 3L2QA 3LP1A 2B4VA 5I4MA 5HVHA 3EPGA 1HQEB 1VC0A 3CCRN 2Q0UA 4F4XA 4HTUA 4FF2A 2FQQB 4DR7F 1BG3A 2MLYA 3AXKA 3H6EA 2DGUA 4GMKA 3RRHA 2RRBA 1NSPA 3W63A 2MYFA 2CDRB 3K57A 2D4WA 3P1GA 3BDPA 2VONA 2F63A 2ZVIA 3O80A 2QGFB 2NPFA 1RTJA 5SWMA 2JEFA 1XMQK 1XI1A 2BANB 3MCNA 5B0EA 3O9SA 1WUUA 3GJQB 2IS3A 1EQMA 1X8DA 2BM0A 4J2AA 3PLAA 1NHUA 3I31A 4LRAA 4DU8A 3EN9A 4EYHB 1HJOA 4DV3J 2CGLA 4DV3F 4AM7A 1EJ7L 2DO4A 2FJVA 3PJXA 2AKWB 3BPSP 4BVOA 5HMYA 2LU2A 3BR8A 2J8SA 3LPTA 1PILA 1VSKA 2VPZB 4DF8A 2RNEA 2YX7A 4ZVGA 1KD1O 1UZDA 1KVIA 2V2ZA 1WTBA 1RT7A 3PIPL 3K58A 1JIHA 3AVCA 3GP9A 1QAIA 3OUYA 3CJQA 4LF8J 4LF8F 3J80U 3SCJE 2YKMB 1IBKF 2ZJRQ 3JXOA 5BN9A 1RKIA 1VSJA 2V2QA 4JI1J 2IDEA 4C97A 4JI1F 2KQ2A 4LIRA 5D77A 3QZ7A 1YVUA 1KD1T 2P9SB 1SJ1A 1FKPA 5HVGA 1S9EB 1VJQA 1NJYA 4FYDA 3J7YI 4HHHA 4ZS6A 4BWJA 3R8YA 2OAUA 3K89A 3NH0A 4PQUA 2GWJA 1ZM3A 2PFFB 1KNZA 4OKEA 2BBEA 2LFVA 1ZH5A 4J91A 3N5BA 1RQ0A 3DGPA 2CZ4A 1N8RO 3D3CJ 2YWWA 4RPFA 3OPKA 2QC3A 3R9LA 1JLEA 3QFWA 4KTWA 1UVLA 4IO9Q 3VZIA 3Q8QB 2MGZA 3MWTA 3TR8A 1H73A 2ZBCA 2ZH1A 5LT5A 3GIJA 4KHSA 4OX7A 3KK2A 1PYOB 2I6WA 3FGUA 1N8RT 1UEKA 1HWUA 2E7VA 4CLKA 4WFNL 4CM0A 1X9JA 3M05A 2GMJA 5KG7A 4H4KA 4CJFA 1F5AA 1WKLA 2FF6A 5KFVA 2F9JA 2R7VA 4I56A 1MN9A 1YZ7A 4KC5A 5C42B 4KHMA 3VGSA 4NB4A 2BKNA 2XGPA 4NLOA 2Q97A 1Y4ZB 3TRGA 3EICA 1FA0A 5M1QA 2FC9A 4DG1B 1FESA 2JX2A 4K4TA 9ATCB 4TY8B 5AQHA 3TVZA 4PA1A 5F9NA 4ZKAA 4IWVA 5J1NA 3TAFA 3OYJA 1FERA 3TAGA 4JHDA 1H1VA 3MR5A 1LQ9A 3V2UC 5B0GA 5ETLA 4USMA 4F3QA 5K8OA 3ZFVA 2MKHA 5DJBA 4RX6A 1NZ8A 3ZSQA 3PRDA 3T9NA 1U6BA 3UWTA 3EL2A 1WG1A 3FQKA 2W8LA 1FTCA 4FYWB 5DQIA 2D0CA 3CCTA 2XMKA 1C1CB 1HYZA 3AXMA 4NYNA 3O9TA 2ZH5A 4Q0BA 2CQPA 4DV1J 4WIIA 5AZIB 3ZNJ1 1FNOA 5D4LA 4IG3B 3W1YC 4ES2A 1WEXA 1ZBHA 4KI6A 3FBFA 1NDCA 5CYQB 1WHXA 4CJ3A 4CI6A 4B3TJ 1JNZB 5J1PA 3DU5A 2EKNA 7FD1A 2CQ1A 3A8KA 2NXUA 2D5RA 3G2XA 2CPHA 3EX7B 2NPIA 3MX2A 5SZTA 2BJDA 4Y1CA 3JQKA 4NA2A 1PO6A 4OX6A 2QLFB 1RAJA 4ILLA 4KREA 2GIFA 3BEXA 4BRFA 2DTJA 1UFLA 2DO0A 4CF8A 3BQ0A 3DRXA 4FOIA 2J0SD 2V9WA 3RSEB 3K5LA 1DRZA 4B3SJ 3FMBA 2E5LF 4B3SF 2X51A 5B0FA 1HYSA 2VA2A 5IV3A 3CJ0A 1L3SA 1T03B 2GUIA 2ILYA 1VQON 4BDZA 3GMGA 3KOAA 3IMQJ 2P9NB 1OPIA 3CGIA 4W5RA 3QESA 2KJWA 3CCMN 2OKQA 4ID1A 3TNVA 3OXGA 3C94A 3T19A 2FUG9 3TAEA 2QLWA 3V6DA 2PYJA 4M5HA 2YKQA 1JLQB 1HMVB 1YG0A 1KLMB 1J9AA 1ZXOA 2ZJPQ 1J5OA 1HKAA 4MKAA 1WKKA 4CW7B 3D2EB 2ADCA 1HBUA 1YSJA 3GE1A 1WI8A 3IFRA 1TMJA 4RJVA 2HIQA 4NLYA 3E1YA 5CXTA 5HL7Q 4IXCA 4J9MA 3NS7B 4FBTA 4DX5A 1QAJA 3C3LA 4BR4A 2ZE2B 5GAGU 4LVNP 2RKIA 4OX9J 1VSMA 3M1VA 2DFFA 1FD2A 3A5MC 3OTBA 3HK2A 4NLVA 1KHWA 4CYUA 4R25A 3J81j 3QATA 2FXUA 3CXCR 3ZSZA 2JLFA 1WC3A 5AQLA 3AGKA 4DUYK 4YY3J 3V1RA 5KFTA 2YHAA 4NXNJ 2P9UA 2L3MA 4NXNF 2HF3A 4AILC 3LGHA 2GVZA 4OQJA 3PW7A 1NKCA 4K25A 3JSMA 2P9PA 4PXEA 1RTHA 5ETPA 3KLEA 1D0EA 1NOZA 1UW4A 3CWJA 1DY3A 4FJHA 3LPUA 3O5TB 1B64A 4IG0B 4DR4K 3IBCB 3M8QA 5LJVA 5ADZA 1S1UB 1IM4A 1KR4A 2FVQA 2NSBA 1OYDA 2QYGA 1GOBA 3G82A 4DU3A 4MFBB 2ASJA 4ID5A 5KFKA 4MAKA 4J2EA 2HFZA 1S76D 5A8KB 3OYEA 2I2YA 3HI0A 1K73O 2Y3YA 3TAQA 2J9CA 2HVIA 2FF3B 3SEOA 3MXHP 3H2LA 2V8HA 2ZHAA 3CTRA 4OJRA 1WTFA 1TL3A 3NWRA 4KHRA 3AH6A 2HHTA 3QPIA 4TY9A 3VWSA 1B0PA 2M4MA 4NLDA 1RHUB 3V4IB 2FVSA 3A5LC 4EO8A 3IUCA 3ULHA 1K73T 2W01A 2IIRA 3GBTA 3A1YG 2UUBJ 3D54A 2UUBF 1YJ9S 3O3GA 1OY6A 2DRDA 2PDAA 3CMAN 4CF9A 2CA9A 1IKVB 3M8SA 2V51B 3MXJA 5GAGI 1RTIB 4E7HA 1VBXA 1A6LA 2MPUA 1IKYB 3SDEA 3BY5A 3O08A 4X64K 4DV2J 3CDWA 4DV2F 2FJBB 3AVBA 1NRKA 1U47A 2QWQA 5F8MA 4FWQA 1FTRA 4AQYK 1QQNA 4M7YA 1XR6A 1TKTA 1QSYA 1QVGM 2C3MA 4AE5A 3VQEA 3H0PA 1FWKA 2RB7A 1QAYA 1DAXA 3EEQA 1ZAVA 2KB2A 5JJBA 2VFVA 4J9KA 3VQ8A 2HHHF 2XY6A 2GWKA 2PFDA 3OTOJ 1UAXA 3OTOF 3C16A 1NWKA 1H38A 3O4WA 4ECWA 1AXQA 2CVIA 5AQGA 2BRLA 3ZTRA 2DHAA 4P9SA 4MK9A 1J53A 4IRCA 2BUPA 5DGBA 4USJC 2H3EB 4DHVA 4HWIA 3ADAC 1WC5A 1DGKN 3V9ZA 1U1PA 3PHTA 2HBJA 1VSFA 3L2WA 4H5VA 4CHYA 4O0NA 3FNNA 2HAIA 4F0HA 1AA1B 2EFVA 1UVJA 4CFCA 2O8DB 1C0FA 1S0NA 4GV3A 3VCDA 5D6GA 3KDNA 2WONB 3Q7BA 3AJ1A 4NYOA 3LDLA 3A12A 3MECA 4JKGB 3F73A 1VK0A 4X66K 4DN0A 4ZPVR 1ZTWA 2CQIA 4DSIA 3OS2A 5LMUK 2W2NP 4N7TA 4EZ6A 2NZCA 4E7KA 4KV8A 1L3VA 1G6BA 5KFZA 2C2RA 4DMNA 4LF6J 1YZ6A 4LF6F 3D0HE 5HRPA 2HBLA 4CO0A 3QRRA 2OCEA 1V3RA 2E1CA 4ZCMA 1TQLA 1EKSA 4IKFA 2PT0A 3MF5A 1CJTA 2AYEA 2VDHA 1Q5YA 2BOAA 2DRBA 3GJRB 1ZA2B 4I6MB 4GVBB 2A5XA 4RWWA 2P9CA 5LL6d 1VQNS 4FNHA 4L3NA 4JS5A 2C2KB 1Q86O 3POTA 4M5IA 4QYRA 4IUFA 4KHWA 2C2ZB 2JH3A 3MD3A 3QFPA 2VJVA 3W62A 3PYEA 1P8ZA 3QIPB 3DDIA 4PG6A 3TJAA 5KFJA 4CJTA 1RT6A 3N79A 2VODA 1ZBLA 4DV6K 2FB0A 4A5AA 3FSIA 2E1AA 1Q86T 4DLGA 1Q18A 4A61A 2F96A 1NPRA 1S1WA 3Q8UA 2O8CA 2BQRA 3T1YK 1HNZK 4TXSA 1PC4A 1FCAA 2F8SA 4KYZA 5IOLA 1UA1A 4UY85 4H0XB 3CJBA 4ZTFA 4WXOA 3QT7A 5MLCQ 3NMRA 2KXNB 2BA9A 2H4YB 2JFDA 2X3GA 4ZK7M 1R6VA 2PC6A 2ROGA 2ZGYA 4FJKA 2KVIA 1FRKA 4PRFA 4NLQA 3SCLE 5JVHL 2FYXA 1EQ0A 1NGAA 3K8WA 3I0SA 4WYWA 1S72N 4CO2A 1Q16B 2HQDA 1NPPA 2XS7A 3VA3A 4JKDA 1P90A 3SBMA 3GQCA 2G1HA 4O0IA 2I8EA 2FBTA 1DTTB 4DQQA 2NXNA 5KOXA 2VWKA 1NGFA 2FVCA 5ETMA 2BOPA 4CERA 4G1QB 3WQUA 3CCWA 4YS2A 5SUHA 4FPAA 3HVRA 1RWUA 4HTIA 2V2VA 2HW3A 2DH7A 3IKMA 1FX2A 2XS2A 2R7WA 2YY3A 1NCLA 3AJDA 2UVRA 2XRIA 2NRWA 1EZZB 4C0HA 1X5TA 1TV6B 2HQIA 4ILRA 1YJWS 4P2SA 2IVPA 1HBOB 1V5VA 2OA8A 4UZBA 4F25A 2O4GA 4E98A 4BR2A 3G6EN 2CQBA 4DR5J 2V67A 4DR5F 4FJ9A 2D41A 3SQ4A 3HRGA 4H5WA 2VF3A 2HFUA 4EBDA 4PEOA 4WKRA 6AT1B 3SAGA 4Q2LA 5KFQA 3E9LA 1TK5A 1LAWA 3A13A 1UKUA 5KT7A 4IFYA 3R7SB 2VQEJ 5FRNA 2VQEF 5EX3A 1KVCA 1UCNA 1U1OA 3QO9A 5DQHA 4G1IA 1RACB 4F0KA 1KFDA 4ZP9A 3UDEA 2FHKA 4QS9A 2AW0A 2PSZA 3CC7S 2FPHX 2BMBA 4CT8A 2QRRA 4QR1A 5GAEI 4CO4A 2DGXA 3S1TA 2PA8D 1VC6A 1GMUA 3L0QA 2Q1LA 1UP1A 3V6KA 3L95X 1C4AA 4KHUA 4FJJA 4I68A 1KVJA 5DO2A 5LXRA 4FS2A 1QE1A 5BPLA 4N56A 2PEBA 1PJ5A 2FZKB 4BC4A 3A0IX 2VGNA 1QLNA 3H5XA 1H6KX 2HNDB 5G0RB 4NYPA 3HP9A 2QWOA 4ED1A 2ZJRL 3L8BA 2EG1A 2FHJA 3WX4A 4DZDA 3CIPA 3CJ7A 4JKAA 2BYCA 5KFDA 1FWPA 3U3YA 4M8LA 5T7LB 3D6TB 4WQ4C 4DEZA 1O13A 3HPGA 4JI8K 4WYBA 3HMJG 5ADXH 4CNZA 3FCWA 3KD1E 2H9ZA 4NZ0A 1W2BR 5K20B 3D0IE 2E66A 4I4BA 1B7YB 3V81A 3CC2S 1S6PA 3KJFB 3DCAA 4P73A 3CDEA 3MEKA 2J4RA 2W9BA 4MJKA 4ATNA 4FF4A 1ATRA 5IWAK 1HR0J 1HR0F 3HKZD 1BWFO 4YR3A 4M5GA 2C3UA 1GX6A 1IQTA 2NREA 4ECZA 3VGKA 3LO3A 5I3PA 2G2OA 3DOMB 1Y5LB 3UR0A 2P5OA 4J2DA 2FD2A 3KLVA 4DSEA 2CDQA 2PE8A 1RSCA 3ZX2A 1RT2B 2AT1B 2XZDB 4N76A 1D9DA 2NUHA 4C8NA 2RJZA 3CJ8A 1YVFA 3ZETA 1XC3A 3ONQA 4K7QA 4YOTA 3W9IA 2YWFA 2QA2A 4L76A 2UUCJ 1WB9A 3VMFB 5U47A 1X3MA 3D7EO 2F40A 3DDNA 3F0NA 2E5GA 3LALA 2R8JA 3R3TA 1GTHA 2QLXA 2AYMA 4AT1B 1NMEB 1TAUA 2W2MP 2ACYA 3BPDA 4MYUA 4LFBK 4B08A 5DG7A 4KH0B 1RBAA 1D8YA 5F8GA 5C5JA 2D0OA 4GY2B 4IEIA 5L1JA 1Y0HA 4BS2A 3QDKA 2OPQA 5CZ2A 4G3IA 3GJTB 1CLQA 2GVDA 2CUYA 3GONA 2ATCB 3U4LA 1BIZA 2M52A 1HPMA 2RU3A 3L3CA 3NF7A 2OSQA 3G8TA 1HNIB 3O8WA 3DLHA 1RYRA 4RL1A 1AZSA 2Z57B 3VEOA 3VGMA 1U8WA 3PW2A 2GZOA 3OVNA 1MSWD 4OPHA 2QYCA 1AYEA 3HP6A 2VBWA 2MKJA 3RB6A 1JLBB 1KRPA 2GX9A 2B4JA 2MB0B 3UO0A 2WFBA 1FE0A 2Y0BB 3HKWA 1H2TZ 3GFXA 4E2FB 3GIRA 2XG8A 2I1RA 3I0RB 1HKCA 2O8EB 3EGZA 2HQGA 3A3NB 4RU2A 1BIUA 4GKJK 2HLTA 1CJKA 3QEWA 4FWRA 1FRLA 3DOKA 2PI4A 5FLXU 1LEOA 2KXFA 4TQRA 2XMAA 3LPEA 4IJNA 5D8HB 2OTLS 3OTDA 3R6LB 2PIIA 1RADB 4DR3J 1VJWA 4V19S 4CJ4A 4TKTA 4AL7A 3LWLA 4FLYA 1WC6A 2BACA 4LF7J 2BRKA 5LM7E 1RU2A 3UN2A 5T41A 2HFSA 4LBIA 1FKOA 3CMEN 2QV6A 4WTOB 1SL2A 2B7BB 4X4OA 2LDIA 3VF6A 3MN9A 4MLEA 2LEBA 2VFSA 3RW7A 4I2QB 3PW4A 5D0EA 1IV0A 2ZH8A 1VQMS 1IUJA 2R7TA 2V4QA 4ID8A 3WNGA 3VAKA 4KSEB 4DQ8A 1VQKN 2A2DA 3MI7X 3IRXB 3EO3A 3FFKB 2F5GA 3DXMB 4A8MP 2UU9J 2UU9F 3LF0A 4U67L 1IH7A 4NLPA 2ZH2A 4KBOA 5DDRC 3QZ8A 1NU4A 3VEYA 1VQ5S 2MHNA 3BBFA 3NXZA 2HQCA 3CQYA 2B56A 3H45C 1MW7A 1WC4A 4NI2A 4E19A 4EAHD 4AHVA 4LF1A 4K50A 4CF1A 3A5NC 1K0TA 1I94K 2FJEB 4ZN3A 3D67A 4JV5K 3ULEA 4ICLA 2M8DB 4QIVA 1CBKA 1W97L 2IDOA 2B51A 4L3QA 2ADBA 3R1XA 1S3XA 1TL1B 1LW2B 3CJ3A 3N4QA 4GV6A 3Q8PB 4I6YA 3VQ6A 3IGVA 1UJ5A 4ANCA 4KKOB 2O66A 1K8KA 3KLIB 4K2JA 1HUXA 2C2DA 2PBDA 5HL7L 2VL1A 3R3LA 2W9CB 5FPNA 4PAAA 1J54A 1PG5B 1QY7A 4KBIA 1CULB 2Z2ZA 1FKAF 1IKXB 2NRTA 3VGVA 3KWMA 4P72A 3H3OB 1X4DA 3ASMA 3KZBA 1FFWB 3AARA 5B0BA 1U48A 5AZJA 4IH6A 3IP0A 2LU1A 4OLOA 4BC5A 3L4IA 2VPXB 3CJTA 2HOEA 2VYPA 3ID8A 1D9AA 4EFAC 3NOGA 1SV5B 2R7UA 2IMWP 3P5JA 2PEHA 4FK4A 3NAIA 2IM3A 3PY8A 1Q9XA 2J8AA 3SSRA 5HSPA 4YHHK 3M2UB 2KHDA 1Y3JA 4IH7A 4OIXA 2V4JB 5KFIA 3GTYX 1HNVB 4PG5A 4Q44A 1RI7A 3BSAA 3ZSOA 4ZJOA 1LK7A 2EBEA 3ILJA 1NK0A 2FJDB 3NGSA 3ZNUA 4Z94A 3MXIA 1NUEA 3KNAA 3SZ2A 2UVUA 1TKZA 3W61A 2KFYA 4WK1A 2KYZA 4ECRA 1ACMB 4GKKK 1HA1A 5DLFA 3WNHA 4QWBA 2MSTA 4F2SA 4CEZA 2IY5B 5C0YA 3OV7A 3HSGA 2QA1A 2R2TA 1LV5A 3MM7A 4CDIA 2A6MA 1SKUB 3RAMA 3WQTA 2ZOMA 4A8OA 2Z8QA 4FVCA 2AF6A 4LR7A 5EXWA 1Y64A 4QR2A 2PZSA 1K47A 4LF4J 4P10A 3ZLJA 2JEGA 4OZ0A 3THYB 4PWDA 3QBXA 4J7CA 2VGMA 4X4PA 1CSJA 3H5SA 5D3GA 1QZ5A 1K0VA 2IYIA 3BREA 4DF4A 3HT3A 1S1VB 2O8FA 2Q36A 4TLRA 4H5RA 1DLOB 3EYZA 1MWMA 3BKFA 3EGVA 3H1VX 2HNZA 4DSJA 4AH9A 2AWZA 4LFAK 2CQ4A 1ZAXA 4N5SA 2FJXA 4BC7A 1FKPB 2DNGA 3LDOA 2X3DA 3THVA 3FZKA 1RNHA 2Y1LB 3QQCD 3R2CJ 2FSJA 3Q7CA 3A8EA 4TVAB 2ZM6J 2DT9A 3OLAA 4H8KA 2DEIA 4ZHRA 3MR3A 2VC1A 1WF0A 4PQUB 1SIWB 1SJ4P 1VSHA 5EUHA 4IH5A 1V6HA 3DRRA 3ENAA 5M2RA 2HNYA 3HPOA 2B7CB 3AVAA 4KR0B 4V1Ak 1QQMA 2IM1A 5KFOA 2MGZB 3M6WA 4DCHA 3NAEA 1CJVA 3R5CA 4Z4HA 2F65A 4ECYA 1P8GA 3PTWA 3QBWA 4IR9A 3M32B 4M95A 2E6MA 4YEAA 5CYMA 4QU6A 5BRFA 3U6FA 4JI6J 4JI6F 3H25A 4P74A 1TFWA 4FWMA 2V34A 5E26A 3THWA 2D0BA 2HHPA 4YQWA 2ZBPA 3CNQP 4OI0A 1ULRA 1RT4B 1XHZA 3R1LA 2YPZA 2JEJA 2NQPA 4OFZA 1TMMA 3DRYA 3OJUA 4ECQA 1QS4A 4ZPBA 4S0MA 2ZQBA 4GRSA 1WBBA 5H1SQ 2V8PA 5KT6A 4USWA 1GEHA 2CKWA 4N8OA 5FPMA 2CH5A 4JI4J 2XLJA 3C6UA 4JI4F 5DM7Q 2L9NA 2QMWA 4DV7F 4P7VA 3MXMA 3IAYA 4DPYA 2P9LA 3TABA 3LANA 4KHQA 3M8RA 5DQGA 2G2YA 4LFCJ 1MWYA 4LFCF 2K7JA 4X4UA 3HSJA 3K59A 1FNMA 3R2DJ 2NRXA 5M1OA 1FVQA 1Y5IB 4O23A 2D1CA 1Q9YA 4A8YA 1XMOK 4JI5J 1SCJB 4JI5F 1EQYA 1WOSA 1ZBIA 2ZZTA 1TAQA 2ITMA 1WC1A 3THXB 2XMUA 2FLLA 3UVJA 4I64A 4NL5A 4Q0BB 4DPWA 3FLCO 4MO4A 1R6YA 2XO7A 1WC0A 4CF2A 4XPEA 3HT0A 4LR9A 2HHUA 5E3CA 4H0YB 3QFUA 2PO4A 3R1HA 3SMSA 3TARA 4RBTA 1VQ7S 5AQTA 4NLGA 4F3OA 1TP7A 2CQHA 1MWZA 4ZVFA 4PUOA 4DCJB 4O55A 2VU5A 2MDAA 1U1KA 2VASA 4P7TA 4Z4CA 1B99A 2X1GA 4ZVSB 1TL4A 3C19A 3WDOA 3FFIB 2COLA 1N34F 2GA7A 1UVMA 3KVGA 2A1RA 1RTDA 1R89A 4JI0F 5MAOA 2VQFF 2XM3A 3AQPA 4OYZA 5BYQA 2M88A 2VKZG 2DGQA 3MCAB 3D6RA 2FDNA 3A3PB 2D1KA 4O3NA 1S10A 2HB5A 3TAMA 3OHAA 5BPMA 1WHYA 1MROB 1FWLA 2YX6A 2YQ1A 3GG1A 4FJLA 5CCLA 1KHVA 3QGHA 4QWAA 4HH0A 2RF2A 1YX2A 1CS4B 4ZVTB 3DWLA 4CBXA 3KJQB 4K4XA 2AA4A 1SQKA 1NJZA 2WBNA 1SJRA 3VEWA 2MQNA 2A6OA 2RQKA 1GT8A 1Q4RA 2QZ8A 5FIIA 4DV1K 3PNIA 5IT9U 5C25A 3DYAA 3BDEA 3QT8A 2AD9A 3BH7B 1FK9A 3V6DB 4LH5A 1RLCL 3NGTA 2HWHA 5IT0A 5L1LA 3VQ5A 2AZ3A 4K5SA 4KH4A 4B3TK 1SJFA 2EWHA 2IVFB 2M3DA 3M2VA 2GAGC 3ALYA 2DD8S 5CHIA 2KRBA 4MH8A 3ET6B 2EK1A 4P6QA 3TYTA 5IQ6A 2W7AA 4DR1K 1HBUB 2WZ1A 1F6TA 3J7Z5 3SUOA 1QUVA 1KS2A 2D3OR 3VVUA 2XI2A 3MPDA 3PXGa 4J9UE 4NO7A 1KP6A 4BRCA 2YNFA 1G7CB 3TA2A 3AA4A 3LAMA 2DCLA 1V9OA 2KT5A 2AEJA 2MQ8A 3E66A 2WW4A 3PHEA 3A3OB 2RIJA 5H9EJ 4KO0B 1UPPA 3FJ2A 3FE1A 1XHXA 1IKWB 4KGKA 1C0MA 3RGIA 1FDBA 1X4GA 4J9LA 3M1VB 1ASUA 4ZVPB 4M94A 3CD6N 3E01A 5K14A 4OMFG 3ZC4A 4ETZA 3CCLS 3PO4A 4U7CA 3KLHB 1GTEA 2LKZA 4JNEA 3P45B 3J80Y 4B9TA 3JYTA 3O44A 3BZCA 3BBBA 2XMMA 1RT1B 2YCHA 1BWEA 1CJUA 4I67A 1QVGR 4YOWA 5KT5A 3KLEB 4NLBA 2DXFA 1FNXH 5DZ7A 1NKEA 2VG6A 4QIEA 1R8BA 2BZ2A 3JAMU 2A1BA 2FGOA 4M5LA 4WWSA 4CD3A 3THTA 1UEUA 4HLBA 3ISND 3G82B 5DDPC 4CZIA 1VIXA 5BYRA 2JOQA 3ZZ0A 4ID5B 5D0RA 3SJJA 2AJ1A 3E2EA 3T1HJ 2N3OA 4K2XA 4M5MA 1WELA 3GDQA 1LWCA 2ZUAA 4OJHA 3ZZPA 3NGIA 3OYBA 2RSQA 2Q79A 3JS6A 3KHYA 4F0MA 4QOTA 4J9NA 3Q8RB 2JC0A 3PVXA 1GMVA 3UCZP 3DXSX 2H4WB 3WIUA 4O3RA 1U2VB 1S7HA 4HH1A 3NG8A 1RGIA 3GB0A 2SXLA 4X2BA 4OX9K 2IM0A 3KXDA 2YNIB 3FSYA 4ZITA 4C8YA 3P96A 3CJ1A 1VQ6S 4KPCA 4HL9A 2O8BA 3CPEA 3TUPA 3CERA 4DL0C 4BC3A 1T44A 1QTNB 4YY3K 2BEFA 4ELUA 4A2BA 4CESA 1RWVB 1WAJA 5HMXA 3C15B 2K06A 4IKAA 1NK5A 3MEEB 3G96A 4F02A 4ELTA 1IJJA 2GJIA 3IG1B 4PZVA 2RS2A 4BLGA 1BUPA 1NGBA 2AJ0A 2HZAA 3GJSB 1H7XA 4OPKA 1HHSA 1C1BB 2HF4A 1VQPN 3JSYA 1TKTB 2MLXA 3MMBA 2QTWA 3V4MA 3HM9A 1S22A 2XB2D 1VRQC 1E6YA 1S9GB 3FZBA 1RT5B 2I7PA 4KJIA 2P9IB 2YX1A 2VG7A 1RDBA 3FZFA 1DTQB 3F56A 4LBHA 4HVZA 2XMWA 3K9KA 2GQCA 5DMRA 3MCPA 3WXMB 3C16B 3WXLA 1N0UA 3LM9A 3ENBA 4I7FB 3MR6A 2CFXA 7FDRA 4X4SA 5JS2A 3VQ7A 3TEGA 3MTJA 2VPWB 3K5PA 3TSQA 1HHQA 4M42A 3AD7C 2IOCA 4DOZA 4CF0A 3HJFA 3DLRA 2R3VA 3T6BA 1KEKA 1WG4A 3CHWA 2HVZA 3TJ8A 1OO0B 3PRVA 1ZA1B 2MZJA 1AB8A 5DM6Q 2J7KA 2KVQE 4FKXA 2IBKA 2EFOA 5KRTA 3KWGA 2DR8A 1YJNS 3WNEA 2QE5A 1MMDA 1NNDA 4URGA 4LQ3A 3MECB 4O4GB 2F9WA 3D6HB 5HMWA 3MEDB 1DQ9A 4DV2K 4DU1A 4O5BA 1XTZA 5E3AA 2W7PA 1TVRB 2CZVC 4HVJA 2G9OA 3JTNA 2M7SA 4KV8B 1FDDA 1IJEB 2C3PA 3MM8B 4WF9Q 4PL8A 3ENWA 3SAFA 4YR0A 3N01A 3O9QA 2G8IA 1VBYA 3MMJA 2XGQA 1F2HA 1DURA 3EDQB 1BQNB 2F8MA 2GHVC 5A2QU 4IFVB 1JXLA 4QIWD 3DRPA 2YNGB 3B6OA 5ETSA 2VWBA 4WP8A 4JI7J 3CM5A 1E6VA 2RDIA 3UD3P 3U3GA 5JICA 4EU0A 3AAQA 3S3OA 1HQUA 4FPBA 4DSKA 4W5TA 1YJTA 3QNWB 4PPZA 2CG4A 1N54B 3F5TA 4M3WA 3OSPA 2DBBA 4O5FA 2EC0A 5CR4A 3NH1A 5ETTA 3KJNB 1I3OB 4DCOB 4ECSA 2DJWA 1FJEB 2DGVA 1H2UX 2LMIA 1WUAA 4CHOA 3CCUS 3DHXA 1KWMA 4NYFA 1CZBA 5KGWA 1S1WB 2O8CB 4CM2A 3Q2TC 3KFWX 2IC3B 3EY1A 1YTAA 3BSCA 2ZNYA 4RW8A 2WVBA 3OVBA 4FJIA 3D1HA 4EP5A 3M2RA 3N6MA 5I3QA 2C22A 2RHKA 5GMDA 2HSTA 2UXCJ 2UXCF 3LZIA 1P1LA 3EE8A 4B3MF 2NRZA 3MAAA 4CZHA 1TGOA 3AO2A 3ILIA 2MZSA 3CEDA 4DL6A 4ER8A 2K1RA 2ITGA 5J2NA 1OJ4A 3OR1B 3P4IA 2F4VJ 1QQCA 2FC0A 4FWLA 2F4VF 4C11A 1OH8A 1DZ5A 4PQAA 2R7QA 1IBMJ 4LRCA 3NMAA 4GO5X 3OHRA 4X4QA 4BY9C 3I87A 1IWAA 3GSDA 4NPOA 2GO9A 1IWGA 4WPAA 5KFRA 4JI3K 2F4FA 3VERA 1NB7A 1S49A 2FLPA 1GLCG 5HRNA 1LW0B 2KT2A 4HCCA 1RWPB 3PRBA 1VOMA 2ZWHA 1URNA 5CH7B 2JWNA 2ASMA 2EXUA 5IC6B 1B0TA 1WEZA 4M3UA 1Q0NA 2WSEC 3VR1A 1Y00A 4K0KJ 2YI1A 3PV8A 4K0KF 3SFUA 3EKSA 1SZ2A 1VRTA 1IR2A 1NJWA 4CJKA 1HI1A 3I56S 1S6QA 4RCHA 2XYHB 2BJ9A 3CT9A 3PX4A 2XMTA 3G9CA 2FZCB 3RMAA 1VSEA 1L3TA 4CHPA 1O8BA 2WB1D 1YUWA 3VF2A 4FS1A 2MKKA 1GK8A 4FLTA 1HFEL 3B6BA 2NS1B 4KPYA 5I3UA 3CJSA 3T41A 4ZTJA 1KN6A 4OPJA 3R7BB 4DL7A 1JCFA 1X7VA 4IFYB 2IAJA 2HVDA 3DRSA 1A0OB 1BXNA 1YRUA 1N33J 1CLFA 1N33F 3E9OA 3QO9B 1WSRA 1C4CA 2HHSA 5AE2A 5IM0A 4W98A 3OVAA 5FRMA 1UA0A 1FO1A 3MPUB 1EIYB 4RNOA 2IJFA 4CNYA 5I42A 4WU3A 3C6TA 2J9EA 1ASVA 3J80O 3GYGA 3PW0A 1QSSA 3OBIA 2HBZB 3B8AX 3NH2A 3BH6B 3S01A 1T6CA 4XH5A 4EIAA 2QX0A 1QE1B 4KFBA 4OKKA 2KFZA 1HNWK 3OBYA 5A6PA 1GLAG 3CYMA 4QQBA 3I6PA 4LSNB 3IBWA 5KQ8A 1EX8A 1TTHB 5KFWA 3C14A 3OTEA 1LWFA 1RA6A 2P5GA 3CJ9A 1NOYA 4Z4FA 4ED4A 2QLJB 2UXBF 3EGNA 2QWMA 4PKHA 2OZMA 4CFBA 3E51A 3NL0A 3NLCA 4B3RF 5TKWA 2BH1A 3W66A 1K6YA 2FLNA 5ETVA 1N36J 1N36F 3AVKA 3PZPA 1CZ9A 3EJMA 2LXUA 1G4CA 4CWBA 2DRAA 5M2PA 5CAAA 4H5NA 2E8AA 3IWNC 2EPIA 4FJXA 3C2PA 3KLGA 3HI9A 4KAIA 2O67A 1VSDA 1WOQA 2VBZA 3NCPA 4EYIB 4B8AB 5A0YA 4KHPJ 4KHPF 2KHOA 1HNXK 5FDLA 1SH3A 1WSJA 1QD1A 4JOUA 1DARA 2VBXA 4IR1A 2HEKA 2EW9A 4ETXA 4LF9K 2QSWA 3W8PA 2JVOA 3VESA 3WBZA 1XWLA 2LQJA 3KUEA 1U24A 3L6QA 2IVYA 2HMIB 1GLFO 1BY9A 4ZPAA 4J9OA 2XTJP 2NSCA 4DUZJ 4DUZF 1FXLA 1R8AA 3IS9B 1HWLA 2FVPA 3MDQA 1H0HB 4O3QA 1K8AO 2HRTA 3NGUA 4YR2A 2CAJA 1U2CA 3KKSA 1L5UA 5DM7L 3KHLA 4GMJB 3S3NA 1FJGJ 2GVDB 4GO7X 1FJGF 4DFJA 3K17A 5GADI 3JTPA 1QVFM 4OI3A 4LRBA 4JB8B 1H7WA 3MAQA 2IMOA 2VHGA 4IDHA 4NCGA 1X60A 1K8AT 1YHQS 4DL3A 1YF5L 1WSGA 5C7PA 2GAHC 1GLLO 5F3ZA 5DS7A 2XQCA 4K41A 3MM5B 4FF3A 1NJXA 1RBTA 5GAGP 1XMQJ 1XMQF 2HKEA 4LSLB 2B4OA 4LBPA 2XNQA 3AD9C 4HI1A 4OL8A 2D69A 3CCSN 3GIKA 2E9TA 4DDFA 2E5HA 2L9WA 5HBMA 2AJQA 2UUCK 1CJKB 3C95A 4V19X 1IG9A 5KFAA 2ASLA 2LEAA 4C0BA 4GVEA 4O44A 1X4AA 4KTQA 4KHYA 3MWPA 1U02A 5F0UA 4Z37A 2ZH4A 4NEZA 2OP5A 1FX4A 4FK0A 1ZAWA 2H51B 2QWRA 3ZSVA 5BXIA 4JD2B 2VUGA 1FXRA 3QIOA 2MZ1A 3CJKA 2OFGX 3TZYA 4RWTA 1HBNB 2KKHA 4A46A 5AQJA 1VQ5N 1ZBSA 1NH8A 4QJVA 1NGJA 5KFEA 2QTDA 2C2OB 1HQEA 5C2DA 4L72B 5AE3A 1Q5VA 2F8TA 3KNGA 4Y3CA 3OW2M 5I9EB 4FJGA 3HSTB 4UT4A 1O1WA 2APOA 1HW9A 1A5XA 1RT3B 3WXJA 3UNYA 1W2BM 1HQ2A 2B9YA 3NWGA 3P83D 1WD6A 1VFJA 3GFYA 2QLBB 2GX8A 4CJRA 4BRNA 3QERA 2YV0X 4WK3A 1RU1A 1WNEA 4ZPWR 2CPIA 3OR2B 4KH5A 4FOEA 5KG3A 1VS3A 2QWLA 4URSA 3S3MA 4MLHA 1BO5O 5E7OB 1IBCB 2BANA 1YJRA 3B4MA 4M5JA 1GLEG 5HOOA 5AXNA 2NUBA 1RBVA 2G0JA 4LMZA 4CJPA 1FRHA 4QW8A 3I96A 1RWNB 3CCRS 2N3LA 5E3PA 2WC9A 1IBLJ 3AAPA 3QT5A 4ZIWA 4ICLB 2HHQA 2ZHBA 2ZDOA 2IHR1 3FBBA 1REVB 3ZZOA 1RUSA 5KRSA 4CHQA 1RWMB 2HZCA 3HFVA 4AYBD 1Q8BA 4JYAJ 5RUBA 3O9UA 3RRGA 1BISA 1JJHA 2RRNA 2OANA 3AVIA 5KG5A 3D1QA 1IR1A 1CXUA 4NCBA 5D4NA 4JLHA 3PEJA 4DR3K 1RWXB 1OYEA 5K9FA 1WSEA 4YOUA 3OFFA 2UZAA 1JXBA 4EWTA 4LF7K 3AVNA 4WCEQ 3EPIA 4CO1A 2O1PA 3D5MA 4PHTX 3U1NA 3EMTA 2OD6A 3BZKA 1N6QB 3D3BJ 2G4BA 2VFRA 4FZXC 3OJSA 3MHYA 2FY1A 2DNLA 3DLJA 3AOAA 4FWOA 1S1TB 2CPDA 4CEQA 2Y1IA 5AZJB 2N7YA 2DGTA 1Z2ZA 2YKMA 2WVEA 4DR2K 4KRWA 4DV0J 2H54B 2KM8B 2QG9B 5LMNK 3ZZUA 4FM1A 3OY9A 2P9SA 3LOUA 2E7XA 1RBUA 1RAGB 1S9EA 3ZT4A 4I9LA 2GQ2A 3ZEUA 5J1EB 3BF1A 1S4EA 3W9HA 3HJVA 3TX0A 4J37A 2DHXA 1HHTP 1BE4A 4LJMA 1OS5A 1V5IB 3VGUA 4DV4K 1OH6A 2F3JA 3VTHA 1WF1A 1NDKA 3RMBA 1YIJN 2R7SA 2HS0A 2BJEA 1RDRA 1R8PA 4JI2J 3B54A 1K44A 4C8LA 3G6XA 4CBUA 4X4NA 2OFHX 5E41A 1OMSA 2B9XA 3M4XA 1SB6A 4ILGB 1M1KO 5L8RC 2XY8A 3AVGA 3MX5A 3IR5B 4IDKA 1UEVA 3LP2A 3TZXA 3LL3A 3T7ZA 3UW1A 4CGGA 2DHGA 4U7UD 1EAYC 3M8PB 1YLXA 3EE3A 2EVZA 5C24B 1X0FA 4UQTA 2OPPA 1CQMA 3CO0P 1QQOA 3IAS9 5B0CA 2G8UA 3TPQA 1RBOB 2E4LA 1M1KT 1GXTA 3CCZA 4BE2A 1M5VC 1HLUA 3C0BA 2IJRA 4YB6A 2GJ2A 4DG1A 3U1LA 2DNPA 2GUPA 4FF1A 3NNAA 2J9DE 2DIVA 4CFAA 2BKOA 2IRXA 3MMAB 4CJ5A 4B17A 2OTJS 3HDSA 3LWMA 1EXQA 1T8EA 3OFGA 3U9DA 4CJ7A 2HWTA 2HRUA 2GMHA 2O8FB 3H7HB 3AA9A 1PAUB 1YRTA 4YN3B 3DMJB 3J7YU 3AVJA 1SL1A 3Q2SC 5F8IA 3L9ZA 4DR7J 4A48A 2D9PA 3O1WA 1TFYA 4FW2A 4GC6A 1C1CA 4CLFA 4E8UA 1JJ4A 5AZIA 4Y65A 2R2SA 4ZHRB 4DQIA 3ENOA 4IG3A 4Q7AA 2H5EA 1Z05A 3A4TA 2RHQB 2A1SA 4LRFA 1ZZFA 5CYQA 5GAEP 3GYXB 1HRHA 3PACA 4X62K 3W5YA 1MWQA 4BQZA 3ZXWA 2XHBA 5T7BA 4RWXA 4DV5K 3QLHA 5FLXY 2DXEA 1VI7A 3KK1B 2GMLA 3GL1A 1CJVB 4M1KA 3CF5Q 3QSIA 3CG7A 4LF4K 4CLTA 1YITN 5DM6L 1JLGB 2VV5A 5BRDA 3TSUA 2KRRA 4PKIA 1SIZA 3NY0A 1F1BB 4DWIA 3T6JA 1HI0P 4M3TA 2QK9A 3THWB 4BCAA 2C2EA 1ZBFA 1JLCA 4DPXA 4FO0A 3RSEA 2ALZA 1Y11A 3A8YA 4U95A 5D0HA 4WIQA 3JQMA 1R59O 3QSYB 2CPJA 4OLPA 1T03A 5J2QB 3HM8A 4B9SA 1IBKJ 5GIPA 3CD5A 3W2WB 3OXFA 4WF9L 3SQOP 3SCXA 4DUYJ 4ZVEA 4DUYF 1X1PA 3M6XA 8ATCB 4O8UA 3U02A 2MXYA 4DS4A 4CGDA 2LLZA 4BR5A 3C6UB 2AZ1A 4ZJLA 3AOBA 5AR0A 3ZTPA 1S97A 1S5JA 4JP8A 2UV8A 2P9LB 2ZM6K 2WK4A 3OYIA 5HLFA 4EMDA 1VMBA 4DR4J 4DR4F 2AGOA 2J7UA 5M1FA 1HMVA 1VQOS 1KLMA 1S0VA 3K5MA 3C66A 4FYXB 3HHLD 1XEZA 1OY8A 4CGFA 5F41A 3D2EA 1D09B 5H9FK 3D2FB 2H5IB 1ATNA 2I9SA 3UR3C 2DIUA 4TU7A 4GC7A 2W4PA 4PKGA 4X4RA 5A8WB 2HHWA 2MKCA 3UNGC 3H20A 3OQ2A 3PEHA 2V2KA 3I5CA 3LP0B 1YI2N 4DCPB 5JLHA 2QN6B 5F2RA 1SC3B 3NAHA 2ZE2A 1N32K 1UWBA 3AY9A 1GMWD 2L48A 5DETA 3MAHA 2YHYA 2GTDA 4JN4A 2EEYA 3VQBA 1RAFB 4N41A 2AIRB 4OYOA 4Z4IA 4NWBA 4IO1A 3OSNA 2HAFA 2W2OP 2IJNA 1KAXA 4RBVA 4DZ6A 1U1NA 2A42A 4X64J 2FSNA 4X64F 3C7NB 3KK3A 3WHIA 3BR9A 4BRDA 1KQSM 3KWIA 4WZQA 1N0VC 3WEEA 4PXBA 3QJLA 4AQYJ 4AQYF 3FZMA 3FQLA 3TAMB 1XJWB 4CHZA 1RA7A 5KGXA 4IG0A 1U6ZA 3VF0B 3W5XA 4FW1A 4O3PA 5L9NA 4WFAL 3PUFA 1S1UA 2Z56B 1T9UA 2KHCA 2QSFA 3SMZA 2RF2B 4YDDB 4MFBA 5ETOA 2OPRB 5JVGQ 3NVKA 5A8KA 3AA5X 3UIQA 2DISA 4BE0A 4OYXA 3HULA 2HGNA 1VK8A 1NEEA 1NGEA 5EX0A 4ED5A 3PJWA 3PJ9A 3ID6A 4EHTA 3DYAB 3D6MB 4EUVA 3C46A 4ZN1A 1FVSA 3IGNA 4DQRA 4TLQA 4ED8A 5JS1A 4C3KA 3V4IA 2IA6A 3M8YA 2FBXA 2BM1A 2HBQB 5KOWA 1VHIA 1XNRK 5IS2A 4CK3A 2P5VA 3ICLA 2DK2A 4CEOA 3W2VB 1P27B 4Y0WA 4KAZA 3AA8A 3TTCA 1IKVA 1RTIA 1VK3A 4B1ZA 1KQGB 1I39A 2MLZA 2OPSB 3CCEN 1RILA 3QEVA 1Q78A 1XQSC 1KBRA 4X66J 4X66F 2P9KA 5J2MB 1X3NA 4LY7A 5C15A 8RUCA 2WTFA 4WE1B 2MKSA 1SQGA 2X1FA 4ZP7A 4BC2A 3L4BC 3HHEA 4CH0S 5LMUJ 5LMUF 1HL6A 2E5LJ 3RB3A 4OI6A 3ZTQA 1TUYA 2CJ9A 1L3UA 1EKEA 1ILYA 3NDKA 4HI2A 5DK5A 3CCQN 2DY4A 4BRLA 3CMAS 3BS9A 4DPTA 2Y1JA 5F3TA 1GLBG 3EVWA 3JYTB 5TKYA 4R8UB 1WOPA 2N7CA 3O6QA 3BGFA 4D3HA 4BQLA 1U6FA 4YP3A 1ITGA 3ZYYX 4ILMA 2V8VA 4DTXA 1IQZA 1YKWA 3NGKA 2H48B 4NYZA 3FZ2A 2ZD1B 4M3XA 1LNQA 4CJEA 3BM7A 1VDHA 4RG8A 2D3ZA 3CO9A 5KFGA 2O3DA 2CJBA 3RU0A 1YBUA 3HVWA 4C23A 5KG4A 3WXIA 1GXUA 1U7LA 3PDNA 4ISEA 4TN2A 4YDXA 1WG5A 2LCWA 5EHHA 4IO8A 1NHKL 4DSLA 2C1EB 3EVMA 2OD4A 1S9FA 4A8KA 4KGZB 1V4SA 1JKHA 1RTZA 3HHLC 4WYLA 3M9MB 3ENHA 4IYQA 3R27A 1VQ6N 4DV6J 4DV6F 4FNIA 1A9NB 4M3RA 4I6AA 5HANA 2QEXS 3G6YA 5K8MA 2HS4A 2WONA 4PL7A 3T1YJ 3T1YF 3V9WA 1HNZF 4JKGA 3OT9A 2ZH6A 5H9EK 1R0AA 3O3FA 1UZHA 4DN9A 3FZLA 3HBTA 4NLRA 4WKYA 2E9RX 1RKJA 1B7FA 4NA3A 4Z0UA 4B3OB 2KG1A 1WEYA 1Y5NB 1JLAB 3H40A 2EHGA 4W4MA 1HD0A 3G71N 2E2QA 4J9QA 2O4IA 2N4DA 4DTMA 3L7OA 1DFDA 4F26A 2ZH9A 4NXMK 5EWGA 1R7IA 3BGLA 5DLGA 4I6MA 3AHPA 4GVBA 2DPJA 4CK2A 4TYBA 5KI6A 3KLFA 1PJ7A 2PI5A 2WW8A 3JB9k 4CJUA 3TQEA 4YDUA 4QWEA 2IM2A 3MMBB 4JV2A 3DLEB 5H1SV 3IO1A 3QIPA 1WSVA 5KG0A 3T1HK 3GIMA 2Z58B 3BO4A 5THWA 3J8AA 1M5PC 5AQPA 2EKYA 4F4WA 5A8RB 3GOIA 3PYGA 3G4SS 4NLCA 4F67A 3U7JA 1BUXA 1YJNN 3VAFA 2E1MC 1RJJA 4B9MA 3ZCMA 3M5RA 3VAIA 3KTQA 1DT9A 2DY1A 5FLXO 5CCMA 2EBGA 2Q43A 4G1PA 4ECTA 4HR2A 2J5AA 5CYJA 4LR8A 2OEMA 4AF1A 1VQ4N 2HURA 4CD1A 1RAAB 1LFPA 1Y7PA 1MWKA 4CZLA 5BR9A 4QIGA 4LSZB 4G6VB 5C2CA 3QJJA 3OL6A 1Q82O 4FSVA 2NUUG 1C0TB 4C8KA 3CSKA 2E1PA 4P2FA 4HKQA 3AQOA 1YRXA 1SAZA 4BWMA 2KFNA 4A8QA 2UYTA 4CEFA 1RDCA 2VJUA 4CGHA 1PGZA 2NYIA 4LVOP 4DJBA 2XEXA 4CEAA 2R8IA 1GXLA 4J9PA 3MM9B 4CT9A 4WQ5C 3B82A 3BKUA 3O3HA 2Q3SA 3MPYA 1J6ZA 3R97A 3BUZB 1SC4B 3HSZA 4Y2IA 4G1QA 1S72S 4LT6A 5C12A 3N9UC 3DAWA 3JXUA 4NEYA 4OLBA 2HHHJ 3DRPB 3TVKA 3EE9A 5HAOA 4OJ3A 1TV6A 3ZX3A 1HBOA 5IT9Y 4CLSA 1X5PA 3EUNA 4MKYA 2MY8A 2E1ZA 1KQKA 2BGGA 4JI8J 1JXVA 1UAWA 4JI8F 2CPYA 2V5HG 3VAGA 3OYLA 1HQUB 4RW6B 2XHWA 1U8SA 1MA9B 1XNQK 2H5JB 4ISFA 3IXQA 3BQ2A 3ZTOA 5IWAJ 5IWAF 3QMQA 4QCLA 1XC9A 1X9SA 5AQOA 3QBCA 4C8ZA 4CQ1A 1BMQB 4HUGA 3FC9A 2QA4N 4OHZA 2JC1A 2ZOGA 3AVLA 3SUQA 2ASPA 2QIFA 2KW4A 1HPZB 1VR6A 2U1AA 3GFHA 3GV7B 4DXLA 3NP5A 2B5JB 3VGTA 3SBGA 4B9NA 3T5JA 5KFCA 3X1LB 1JLFB 2D0PA 3WC0A 1NG9A 4KTZA 5CA5A 3D0PA 3KKRA 3DM2B 1WN7A 4CZJA 2QT7A 2K1RB 4H4KC 3CCJS 4NMXA 1VGYA 4E3SA 3DFEA 2HNDA 5G0RA 1BLUA 1OY9A 1EP4B 1BQMA 4LFBJ 3RR7A 4LH4A 4LFBF 3IM9A 1FF2A 1VCTA 4JI7K 1HX1A 1MMNA 3DXBA 4BG8A 3OXLA 5T7LA 1NLVA 2JRSA 3VALA 2LXFA 3JAMY 3VEXA 2EFPA 4H0VB 3TUZC 3DLGB 4HDHA 2YJEA 4W5NA 1H74A 3LTOA 4F4YA 2Q31A 2HBRB 3R5GA 3NEKA 3J7ZO 1S48A 4C0OC 1TUWA 1UFWA 3PR5B 1T9VA 4QYZJ 2JNJA 4P52A 2HQFA 2Y0SD 1XR5A 2YQ0A 3MCOA 2VC0A 4B1XB 4NRTA 3DOMA 2B9EA 3IDHA 1REGX 1C0GA 4ED7A 5F8JA 1G3OA 5KFFA 1RT2A 5L39A 2J76E 2VWJA 5LSLA 1M90O 3NMUA 2WOMB 1YBAA 3J7ZT 2YHBA 4QPXA 2FIUA 5I3UB 4GKJJ 4GKJF 4C3LA 2CJXB 1LAVA 5GAEU 2W6LA 5F0XA 1LKZA 4JBCA 3JTOA 1Y3KA 4RTFD 4EP4A 4RZRA 3MMCA 3J81U 4HUFA 5IM0B 4CLPA 1RAOA 3DI6B 1M90T 3HZEA 1IBMK 5I42B 3C6TB 1X5OA 3CIZA 1VSIA 2EFQA 2JHEA 2XCPA 3MURP 2J6SA 4H4MB 3CD7A 2RE1A 1SKSA 4YB5A 3HL8A 1R0BG 1TK0A 1T6DA 4NLTA 3PYDA 1A5WA 4HHUA 3RAQA 2ZJQQ 1RBLA 1D8ZA 1TL7B 2CNKB 2CNOB 3SK3A 3G10A 4FVMA 3EVOA 5F8HA 5D4PA 4CJVA 2HSEB 3C14B 2UUTA 5EOYA 1ZZNA 4DL4A 4F2RA 4BHQA 1QVFR 2BABA 1JLBA 3AY0A 4QOZB 5GINA 3UKRB 4OV6A 3V6HA 3ENVA 4RW4B 2LP4A 2DNRA 3GG4A 1I1GA 2OO4A 3WC2A 2ZITA 2R8HA 2NRVA 3I0RA 3P5BP 5KPTA 2WHOA 3OYHA 2MMYA 4K5RA 2W6KA 1ZM4A 4Y1DA 4CZKA 5K5MA 1I94F 1KVBA 4JV5F 3HVAA 3S6EA 4DS5A 3AB4B 4DTNA 1F3FA 4X65K 1M1HA 3NBPB 3DN9A 1F0XA 2CG8A 5K8NA 2HVHA 3CQ8A 1UPMB 4CJSA 5EWEA 3KHHA 3DXKB 4J5OA 3QAEA 4EBEA 3EZ5A 4JKCA 3BO2A 3LA0A 4ZPCA 4O4RA 2AJ4A 1U0HB 3TTDA 4A8WA 1CQNA 3JSRA 2PFUA 1FFGB 4BRAA 3I55N 4MTPA 2ROPA 1WDDA 2MZQA 1O0PA 1U1QA 3BP8A 3ZTSA 5A2QY 4A8XA 2M0GB 1NU0A 5CQGA 1XQIA 1IG8A 3DXMA 4F3MA 5CE3A 4DL5A 3DOLB 2DNOA 4K8XA 3OW2R 4YHHJ 3CMES 4YHHF 4KI4A 5ELZA 4UF4A 2DXDA 3LW5C