3H08A

Crystal structure of the ribonuclease h1 from chlorobium tepidum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
139
Chain Sequence
b'EKTITIYTDGAASGNPGKGGWGALLMYGSSRKEISGYDPATTNNRMELMAAIKGLEALKEPARVQLYSDSAYLVNAMNEGWLKRWVKNGWKKPVENIDLWQEILKLTTLHRVTFHKVKGSDNPYNSRADELARLAIKEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rnh (Ribonuclease H)
publication title Structure, stability, and folding of ribonuclease H1 from the moderately thermophilic chlorobium tepidum: comparison with thermophilic and mesophilic homologues.
pubmed doi rcsb
source organism Chlorobaculum tepidum
molecule tags Hydrolase
total genus 47
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3h08A00
2YNHA 2IC3A 4FCYA 3V1QA 4CJPA 1LWEA 1SUQA 4MFBA 4FYDA 2YNGA 5FROA 4FJ8A 1X1PA 3PX6A 4E7KA 2RKIA 4CEBA 4E19A 3OS0A 4DTRA 3HO1A 4CGHA 1WSGA 2GBZA 3CFOA 1ASWA 1EP4A 4L8RB 4DQRA 4B9UA 3SPYA 2HMIA 4CFBA 4CEDA 1ZBIA 1C0UA 3NF9A 2X74A 1JXBA 4KPYA 4C8MA 1YVUA 2Y1JA 1Q9XA 2KZZA 1C0TA 1XHXA 4CF8A 3HVRA 1SKSA 3LPUA 2XHBA 4DLEA 2A1SA 4QAGA 3SCXA 3NH2A 3DM2A 2BE2A 3QNNA 1CZBA 1VSKA 4YFUA 1IKYA 3PV8A 3K5NA 4DFPA 3HM9A 4CJVA 1NK4A 5JS2A 4CHYA 3KLIA 3WNFA 3OJUA 4UQGA 3OY9A 3QEWA 4LSNA 3OYAA 1BIUA 1K6YA 3QLHA 3QEVA 4F3TA 4CHQA 1MU2A 4Z0UA 1RT3A 3V9SA 1VSLA 1WSIA 3AA3A 1T8EA 3RWUA 3SYZA 1RT1A 2ATQA 2FBVA 4AH9A 5CYQA 4CEZA 4CIEA 3T3FA 4KO0A 3TAEA 4IG0A 1RTJA 3DLBA 3HYFA 1JL2A 1HJRA 1RBRA 3DLGA 4R5PA 1JLBA 4FK0A 4KTWA 4W5RA 4N41A 4IFYA 4IG3A 4JS4A 3KLGA 5I3UA 1X9WA 4AHUA 3K57A 4CK1A 4CJUA 1EKEA 3ALYA 4CGDA 3VQ6A 3M8PA 4AILC 1CZ9A 3NBPA 3QEXA 3OVNA 1NK5A 4CEOA 4RW9A 3WNEA 3HP6A 1RCHA 1FKPA 1L3SA 2FBXA 2HNYA 4FJGA 1ZBFA 4FLUA 2X6NA 2R7YA 1G15A 1RTHA 2Z1IA 2EHGA 4E7LA 1VSFA 3L2RA 1WSHA 2I5JA 3KKRA 4JRPA 4BE0A 3PX4A 3LANA 2XY5A 3OYKA 4CHZA 4DSIA 3QO9A 2GUIA 2OPRA 4KTQA 3P1GA 4HUGA 4DF8A 1YT3A 4FM0A 4CEEA 3OYJA 4CIFA 3D0PA 1NOYA 1NKBA 3UIQA 3AVFA 4ELVA 4K8XA 1BCOA 1HMVA 3SUQA 4QCLA 1IKWA 4B9MA 4B3OA 2RF2A 3CFPA 1S1UA 3AA5X 3HVTA 3T19A 5C42A 5HRSA 1KTQA 1BCMA 4FJHA 1QS4A 1C0MA 4M41A 2O4GA 1KCFA 4DTPA 4J2AA 1FK9A 1S1XA 1VK0A 1VRUA 3AA4A 3AVIA 4HHTA 1C1BA 2G8UA 4BDPA 1F21A 1RNHA 2G8WA 4KRFA 3KK3A 4KTZA 5KGXA 4KV8A 3HPHA 4O44A 4PY5A 1DTQA 1TAQA 2LSNA 3OYHA 4IFVA 2VG5A 3VQDA 4DTXA 1SV5A 3K58A 4B9VA 1KLNA 4PUOA 4CEQA 4OLAA 3SI6A 1UOCA 4DTUA 2G8VA 2YHBA 3CG7A 4N76A 5J2MA 4CEAA 4AHCA 5KTQA 3HT3A 4CJRA 3ULDA 4NCGA 2ZQBA 3L8BA 3ZSOA 1BGXT 4KB1A 4KHNA 4PWDA 3V6DA 4FK4A 1W0HA 1X9SA 2YNIA 1A5XA 4H4MA 1BI4A 1SL0A 3I0SA 4CFAA 2OZMA 3DLEA 2VG7A 3CFRA 3QEIA 3DI6A 4BE1A 4NCBA 2KZMA 1TV6A 4FLVA 4DTMA 1NK6A 2F8TA 3LALA 5HRPA 2P5OA 4KREA 1JLQA 2X78A 3QESA 1TK0A 3AO1A 1NOZA 3LP3A 2RPIA 5HRRA 3NGZA 1NJWA 2KFNA 5FRNA 1JXEA 3HPGA 3I0RA 3M8SA 4K8ZA 3A2FA 4FZYA 3ZT2A 1SL2A 4HCCA 4PA1A 4H8KA 2Y1IA 4ZTJA 3F73A 4KFBA 3AO2A 1TK8A 3LPTA 1HQEA 2BDPA 2KTQA 5FDLA 1FKOA 4AHTA 3OYMA 1CLQA 1QTMA 3VA0A 1RT2A 4OPJA 3BGRA 5DMRA 3QNOA 2OPQA 1L3TA 4MQ3A 4CJFA 3RTVA 5EU7A 2WONA 3CM5A 3KJVA 1EXQA 2Q3SA 4NCAA 3AVBA 4DSJA 2KFZA 4I2QA 4FXDA 1XWLA 2FBYA 5FRMA 2HVIA 2KQ2A 4CJ3A 4EZ9A 4DQIA 3DMJA 4EP4A 5HP1A 4DLGA 1I39A 1U47A 3AV9A 3ZT0A 1RT5A 3OJSA 1U49A 3M8QA 4FJ5A 1BHLA 2D0BA 3DRPA 4LD0A 4CHPA 4CECA 4Z4HA 2F8SA 4CEFA 4DSFA 3ZSQA 4J2EA 4FJXA 4PQUA 3KK2A 3ZSYA 4Q5VA 1J53A 3FFIA 4OLBA 5J2PA 1VSJA 2O4IA 4H4OA 3L2UA 4CJQA 4ZTFA 3K5MA 3NDKA 3OYCA 3VA3A 4Z4EA 3KKSA 1UA1A 4FM2A 2DFFA 4AHVA 4KI6A 4DTSA 1A5WA 1KVAA 3OYIA 1KFDA 3CYMA 5DK5A 4Q0BA 1QHTA 3LP0A 2DY4A 4BE2A 2OA8A 5J1EA 3TI0A 4DFMA 4B9SA 4DU3A 3LWMA 4CGFA 3IG1A 1TL3A 1IH7A 2E6LA 1KVCA 3D45A 2YKMA 3OYDA 2XO7A 3SZ2A 1Z26A 3PY8A 4HCBA 1J9AA 2BGGA 3TAQA 2HNDA 4I7FA 3AO3A 3AVNA 1U04A 1D8YA 2AJQA 1JL1A 3T1AA 4N47A 1BISA 3AO4A 1WAJA 2HVHA 4ICLA 2W42A 3TWHA 3WNHA 1JLEA 2OPSA 4CJ5A 4FJMA 4DG1A 1VSEA 3O4QA 4DU1A 1YTUA 3VQQA 4E3SA 1R0AA 4FJNA 4W5NA 4W5OA 4E7JA 4HUFA 4CK2A 1WLJA 3EYZA 3ASMA 4FM1A 1DTTA 4XIUA 1QSLA 3KTQA 2JGUA 4M3XA 1SL1A 3MEGA 4DMNA 3TANA 2HHTA 4E7IA 1IKVA 3CM6A 3VQAA 4CJTA 3ZSXA 4F3OA 3OYGA 4I2PA 4BACA 3QERA 1NK7A 2B6AA 1C1CA 4IBNA 3PUFA 3DLKA 5J2QA 4FJIA 4RG8A 3LP1A 3DLHA 4J2BA 3L3UA 3G10A 4QOZB 4FZXC 4DFKA 1N5YA 3CQ8A 3P83D 1C6VA 3NF8A 4HUEA 1T05A 1WAFA 2B4JA 3NE6A 3V9WA 1D9DA 3ZSVA 1TGOA 4CF1A 1VRTA 2EX3A 2IGIA 3H08A 3VQCA 4CJLA 4CJKA 2DTUA 3NAEA 3P5JA 2DFHA 4DS4A 1S9EA 4CJWA 1TVRA 3TABA 1REVA 2KW4A 4OKEA 3SQ4A 3RMBA 4RW6A 4CCHA 4FJ9A 1IKXA 3VQPA 1TKZA 2G8KA 2QKKA 1QSSA 3RMCA 3RMAA 3RR7A 3AVJA 2DFEA 2G8HA 4W5TA 4G1QA 3TARA 1S1WA 3ZT3A 3G0ZA 1LW2A 1XI1A 4BDYA 3O3GA 4FZZA 2F96A 4NYFA 4C8NA 4AHRA 4CJEA 3HJFA 3AVHA 4Y1CA 1Y97A 2HHWA 1S1TA 2P1JA 4LH5A 3V1OA 4GMJB 4KHSA 4CF9A 5CZ1A 4OPKA 3AVCA 1ZBUA 4E1MA 1W9HA 3THVA 4OGEA 3VQBA 4FLYA 1NK8A 1B92A 3VQEA 2E6MA 2QXFA 3ZCMA 1ZBLA 4E89A 4CHOA 1T7PA 2QK9A 3OS2A 1NJXA 3PX0A 1GOAA 1JLGA 3SUOA 2JLEA 1RBVA 3HPOA 5KRTA 1VSMA 1NJYA 3AVAA 1KRPA 1IO2A 4DSEA 3NGYA 4DFJA 1L3UA 5C24A 1JLCA 4GW6A 5SWMA 1LW0A 2E4LA 3DYAA 2FC0A 4FLTA 4DTNA 1U45A 4ID1A 3HSTB 3VQ7A 3KLEA 1KLMA 3ZSRA 4CJ4A 1T03A 4Y1DA 1CXQA 4EZ6A 5KRSA 3LAMA 3AVGA 4JRQA 2P51A 1UWBA 2VG6A 3E01A 4F4KA 3MECA 4FW1A 3VQ8A 1BIZA 1NK0A 4F2RA 1XHZA 4CGGA 4OKKA 3SQ1A 4DQPA 1X9MA 2OYQA 3PO4A 3QIPA 5K14A 4KHWA 3V4IA 1LV5A 5D3GA 3OYBA 3LP2A 3ZSZA 2X6SA 4N5SA 2Z1JA 3KLHA 2D5RA 4LH4A 4CFDA 3OYFA 1HYVA 1TL1A 4I9LA 3LZIA 3JYTA 1HRHA 1BQMA 4M3YA 3I8DA 1HQUA 4DTOA 2GV9A 5HROA 1D5AA 3DOLA 3PO5A 1UA0A 4E0DA 1LAWA 1HNIA 3V81A 1NKEA 4IKFA 2BANA 1ZYQA 4CF0A 1RDDA 1RT6A 4O4GA 2YNFA 5CYMA 4AHSA 4EP5A 2VWJA 4BWMA 3SJJA 2HHQA 1BL3A 1ASVA 3SNNA 5SZTA 4C8OA 3DOKA 4B08A 1NK9A 2IAJA 3QIOA 4DQSA 3V9XA 4B9NA 3VQ5A 1HYSA 1RBTA 1B9FA 1JLFA 2B5JA 3ISNC 3NFAA 3IRXA 4FJJA 4OJRA 4KHQA 1J54A 4CHNA 2D0AA 2QKBA 4HTUA 5CZ2A 4KAZA 3NF7A 4DF4A 4JS5A 3MXIA 3MAQA 1GOCA 1BI4B 1BQNA 3LAKA 4CE9A 4N56A 4M45A 3RRGA 4F8RA 2PYLA 1SKRA 2PY5A 2PZSA 2IDOA 3S3OA 1WNSA 3C6TA 1LWCA 3HL8A 2OZSA 4CGJA 1KFSA 1LAVA 4C8KA 1TKXA 4BWJA 3RMDA 2HW3A 1Q8IA 1S5JA 3SUPA 1N6QA 4DWIA 4M3TA 4OKJA 1VSHA 3F9KA 3B6OA 4M3ZA 3NHGA 4DTJA 2WOMA 3AVMA 3TAMA 1HPZA 5J2NA 1U4BA 4Z4FA 3ZT1A 2HHVA 2HHSA 2YHAA 4E7HA 1A5VA 4O55A 3SPZA 1JKHA 1Z25A 5E41A 4FVMA 3QINA 5HRNA 1RTIA 5HLFA 1ZBHA 3OYNA 2RN2A 3AVKA 5C25A 4CK3A 2P5GA 4W5QA 4B9LA 4ZHRA 1TAUA 3MXJA 3MEEA 3ZT4A 4CESA 3EY1A 2NUBA 3WNGA 4BDZA 3V9UA 2IOCA 1WSJA 1HYZA 1WN7A 1JLAA 1NJZA 4JLHA 3B6PA 3TAPA 5HBMA 2PYJA 1FXXA 3C94A 1C1AA 3QETA 3TAGA 1RT7A 4DU4A 2VWKA 2G8IA 3V9ZA 1U48A 2FBTA 5JS1A 2XY6A 2A1RA 1VSDA 1EX4A 3ITHA 3VQ4A 3QEPA 1D9FA 3L2QA 3U6FA 3JSMA 3AO5A 4YNQA 3TAFA 5CY4A 1RBUA 1QE1A 3SQ2A 5T7BA 3V1RA 3DLRA 4ID5A 1HNVA 4B8AB 3RRHA 4B8CA 3BDPA 4F2SA 3HK2A 4WE1A 3C6UA 2IS3A 3S3MA 3OYEA 3MEDA 4CGIA 1RDAA 3ZSWA 3IS9A 3KK1A 1CXUA 1Q9YA 2YKNA 4B9TA 1KSPA 4FLWA 4FW2A 3C95A 4GVMA 4M3RA 3U3GA 4FK2A 4O5BA 1S6QA 2Z1GA 2ZE2A 4O0JA 4KKOA 3SV4A 1O1WA 1TK5A 4KHUA 4HVJA 4E1NA 3M8RA 4M3WA 1WSEA 2HB5A 4DSLA 3K2PA 1S9GA 4M42A 2HHUA 3L3VA 4Z4CA 4NYNA 4DS5A 3AA2A 4M3UA 4Z4IA 3OYLA 3SV3A 1SKWA 1DLOA 4FJLA 4CJSA 2XY7A 1L5UA 4I9QA 3TR8A 3VQ9A 3NF6A 3O3FA 4TSXA 1TKTA 1KVBA 5KGWA 3S3NA 2OPPA 3LZJA 4J2DA 4Z4GA 1IG9A 4IDKA 4KB0A 2ETJA 3OS1A 3NCIA 1XC9A 3SUNA 3U3YA 1WSFA 3KD1E 1S1VA 1VSIA 1TKDA 1RDCA 3K59A 4KI4A 1RBSA 3O4NA 3NH1A 4CFCA 3K5LA 4CIGA 1QSYA 3DRSA 4FJ7A 1B9DA 4KHYA 3K5OA 1UAXA 3AVLA 3KLFA 4FLZA 1RILA 4DQQA 3KD5E 4ELUA 4OGCA 3LDSA 3IAYA 1QQCA 4OVLA 4RW8A 2HHXA 1NKCA 2G8FA 3RR8A 4RW4A 3L2WA 4ELTA 1ASUA 4LSLA 3LWLA 4LY7A 4CERA 2HNZA 1RTDA 3EZ5A 2ITGA 2D0CA 2Z1HA 1L3VA 3O3HA 1S6PA 2YV0X 3NH0A 3L2VA 3KIOA 1EETA 3DRRA 4O0IA 1ITGA 4RW7A 2XY8A 5KI6A 4FLXA 1LWFA 3MXMA 3S9HA 3NGIA 1I3AA 3VN5A 5I42A 4FJKA 2XRIA 1J5OA 1RT4A 3HP9A 4DSKA 4CF2A 1GOBA 4C8LA 3SQ0A 3HXMA 2ZD1A 1RDBA 1YTAA
chains in the Genus database with same CATH superfamily
2CGLA 4FYDA 4FJ8A 2PFUA 4FWQA 4E19A 3HO1A 1WSGA 3CFOA 3HBTA 4DQRA 2QWMA 4O8UA 2X74A 4KPYA 4C8MA 2Y1JA 1Q9XA 3H1QA 1XHXA 4CF8A 3HVRA 1SKSA 3LPUA 3GOIA 2A1SA 3DM2A 3LDOA 4DFPA 3HM9A 3R6MA 5JS2A 4BC3A 3VEYA 3WNFA 4G9ZA 4LSNA 1BIUA 3QLHA 2NNWA 3RWUA 3SYZA 3FFKB 3ZETA 2YJEA 2FBVA 4BR9A 4B1ZA 1RTJA 1HJRA 1JLBA 4A61A 4FK0A 1X9WA 3M5RA 5I9EB 3K57A 2YI1A 2Q1NA 3M8PA 2YHWA 4AILC 3ZLJA 3OVNA 1NK5A 3HP6A 1FKPA 3SJHA 1BA1A 4FLUA 2I7PA 1G15A 1Q86O 2Z1IA 4IOAL 2CH5A 2I5JA 4JRPA 2UUCK 4XH4A 4YDUC 3J7YP 3AAPA 3QO9A 4KTQA 2PBDA 3P1GA 4DF8A 1NOYA 2QWLA 4CEEA 4CIFA 1NKBA 3VERA 1W7AA 1BCOA 4BRPA 3JS6A 2E88A 1ZXOA 2CGKA 4DR3K 4FJHA 1C0MA 4PKIA 4DTPA 4J2AA 5AQTA 4LFBK 1SZ2A 3W3DA 5FLXO 3CXCM 3AA4A 3AVIA 1C1BA 1F21A 2FSNA 2G8WA 1YUWA 4KTZA 4O44A 1DTQA 1XUPO 2IVPA 4CZGA 2OTJN 1SV5A 3K58A 4U67L 4X64K 2YHBA 3CG7A 4AHCA 4KB1A 2QTDA 3HT3A 4KHNA 3SLCA 3V6DA 2NRRA 1X9SA 2YNIA 4H4MA 2NRHA 4CFAA 1CZAN 2D4WA 1NK6A 4FLVA 4B1XB 3VEZA 4JAXA 2X78A 4H0PA 2O8CB 4YOWA 3AO1A 3NGZA 5KQDA 2KFNA 1JXEA 4K8ZA 1SL2A 4HCCA 4H8KA 3QFUA 2KTQA 1TK8A 2BDPA 1K8KB 3QDKA 2UUBK 2D1KA 2V51B 3OYMA 5M1QA 1IBKK 1RT2A 2GEMA 3QNOA 2OPQA 3RTVA 2Q3SA 4DSJA 5JVGL 4DLGA 3OJSA 5BN8A 2OANA 4WYBA 2QWNA 4JKGB 4PQUA 5BPMA 3KK2A 4OLBA 2O4IA 1N32K 3FZFA 5AZJA 4U7BA 3L2UA 3K5MA 3NDKA 4B1VA 3KKSA 2DFFA 4YOUA 4DTSA 3OYIA 1VHXA 3O80A 3LP0A 2DY4A 2OA8A 3E66A 4QS8A 4DFMA 4DR4K 4JI0K 1IH7A 4BRDA 2XO7A 4C1NI 5GAGP 1YITN 4E1JA 4I7FA 4FOEA 3THWB 4JEPA 2HF3A 3OA9A 4ICLA 1WBDA 3TWHA 4CJ5A 4YOTA 3O4QA 2O8DB 4DU1A 4W5OA 4CK2A 3EYZA 3ASMA 1DT9A 5BRFA 4XIUA 3P39A 3VGLA 5FPEA 4M3XA 4DMNA 3TANA 4JK8A 1K8AO 4IZ9A 4BR5A 4CJTA 3ZSXA 1IJJA 4BACA 1P8ZA 5BRDA 2B6AA 4CZJA 3PUFA 3CMAN 4QS9A 1VQMN 4JI7K 3CQ8A 3P83D 1OH7A 1VQ6N 1WAFA 5AQNA 4BR4A 3BY5A 4CF1A 2DTUA 4XH5A 1NMNA 5BR8K 3FZHA 2DFHA 1JJ2M 1VQPN 4DS4A 4FVUA 1HNXK 2KW4A 3RMBA 4FJ9A 4CCHA 1IKXA 3VQPA 2QKKA 2HMPA 1C0GA 1WBBA 2F9WA 2DFEA 3LDPA 4G1QA 1S1WA 1ATNA 1XI1A 3O3GA 4FZZA 3WT0A 4MLHA 4AHRA 3DLLL 1KAYA 1YAGA 1QQNA 3AVHA 1Y97A 1S1TA 3TSQA 1WB9A 3ZX3A 1NMDA 3THVA 3VQBA 2YCHA 1B92A 1ZBLA 4E89A 3WEEB 1T44A 4PHTX 5KRTA 1VSMA 5AFUH 1XMQK 3O5BA 4DSEA 4DFJA 4FLTA 2FC0A 3VQ7A 1T03A 1CXQA 3LAMA 2P51A 3MWTA 2NRTA 1NK0A 4F2RA 3SAHA 1X9MA 2OYQA 3VF4A 3V4IA 4JI2K 2Z1JA 2VCPA 3KLHA 3LZIA 4LH4A 1HYVA 4M3YA 1HQUA 2GV9A 1YJNN 4E0DA 1UA0A 1LAWA 1HNIA 1N36K 3F2KA 2YNFA 2VWJA 3SJJA 1ASVA 1U2VA 2AA4A 3G25A 3LDLA 3DXKA 3ATVA 1HNWK 5GIOA 2D0AA 5LY3A 4KAZA 4DF4A 3AARA 3MAQA 2FF3B 1BQNA 3LAKA 2PY5A 2IDOA 1WNSA 1VQ7N 1LWCA 2OZSA 1LAVA 1Q8IA 4M3TA 3SUPA 3C65A 3F9KA 3TAMA 2HHSA 5AQKA 2YHAA 4NXNK 3IUCA 3OYNA 1FW6A 2GELA 3ZT4A 4B1UB 5ADXA 2NUBA 2H3GX 1NGEA 3C7NA 4FSVA 4JLHA 3TAPA 5HBMA 2W6LA 3THXA 1U48A 3L2QA 4YNQA 5CY4A 4GY2B 4B1WB 4B8AB 3HK2A 4LF7K 3FR0A 4CD1A 1CXUA 2ZF5O 1Q7YO 3CPWM 3TTFA 3U3GA 1K9MO 1TUUA 2ZE2A 2Z1GA 1MA9B 3SV4A 4XH1A 2HF4A 5AQMA 1DKGD 2YJFA 3N4QA 1S9GA 3G6EN 4Z4IA 4BRGA 3OYLA 3DXMA 1SKWA 2XY7A 4I9QA 4TSXA 4Z4GA 5C10A 2O8BB 4J2DA 3VTIA 1S22A 2ETJA 3OS1A 3VEVA 3SUNA 4Z94A 3U3YA 1WSFA 1S1VA 4KI4A 2WFBA 1B9DA 1YIJN 1UAXA 3AVLA 4KBOA 4DQQA 2NLXA 3KD5E 4LSLA 1YXQA 4LY7A 2FF6A 3ZEUB 2ITGA 2P9NB 4H5WA 3F9MA 4A62A 3H45C 4WQ4A 3DRRA 5DM6L 1J6ZA 3QMLA 2PAVA 4WCEL 4GNIA 3VN5A 4BRAA 4IFEA 3B8AX 1HKGA 4AF1A 3D2EA 4NO7A 4FCYA 3ZX0A 4J8FA 3SBTA 1BA0A 4IO8A 1X1PA 3PX6A 4E7KA 2Q2RA 3BEXA 5M1NA 4B9UA 3SPYA 4CFBA 3P38A 4CEDA 1TYQB 1S3XA 3PLAA 2F4VK 2VQFK 2KZZA 2FSJA 1GLJO 2XHBA 3SAGA 1M90O 3SCXA 2BE2A 4LFAK 1IKYA 3TSUA 3PV8A 2P9KB 1HNZK 4ISEA 3H6EA 3OY9A 3OJUA 3QEWA 1QVFM 4FWOA 1MU2A 1M1KO 5AQXA 1NGDA 3CCMN 1VQ4N 4A5BA 1VSLA 1WSIA 1T8EA 1RT1A 2ATQA 5LMUK 2P9LB 4F9OA 3T3FA 4WQ5C 3DLBA 3CMEN 4BC2A 1NNEA 3TTCA 4W5RA 4N41A 4IG3A 4JS4A 3KLGA 5I3UA 3WXMB 4AHUA 4CJUA 1EKEA 4JI5K 4JI6K 5AQUA 3QEXA 4CEOA 4LF9K 1L3SA 1RCHA 5BR9A 3CCLN 1IV0A 5KPTA 2EHGA 1WSHA 1N33K 4K43A 3PX4A 3KK7A 3LANA 2XY5A 4CHZA 3GBTA 4Y0WA 2OPRA 4CJ7A 3M3ZA 1YT3A 4FM0A 3D0PA 4WQ4C 5EX5A 1BUPA 3LM9A 4EHTA 1S1UA 3HVTA 1QHAA 3D2FA 5JICA 1BCMA 3UKUB 1KCFA 5KPRA 1VRUA 4HHTA 2NRWA 3BZKA 3W0LA 4AQYK 4H5VA 3OYHA 4DV4K 4IFVA 3E9OA 5AQIA 2QA4N 3WXIA 4DTXA 3FZLA 4C23A 4B9VA 4OLAA 4DTUA 2G8VA 1HUXA 5LL6Z 4CEAA 5J2MA 4MO5A 4LF6K 2FXUA 4CJRA 4PWDA 2ZQBA 3L8BA 3ZSOA 2V7ZA 4FK4A 4K25A 4PKHA 1SL0A 3O9SA 3ZETB 3BUZB 1YJ9N 3CFRA 4B3TK 3DI6A 3J7AP 3L0QA 2KZMA 2F8TA 5JLHA 2P5OA 3C6AA 5GADP 3LM2A 4KREA 1NOZA 3K9JA 5GIPA 1HPMA 2HHHK 3M8SA 1BWFO 3A2FA 4FZYA 3ULEA 3ZT2A 3EE9A 4ZTJA 3F73A 3LPTA 3EE8A 1FKOA 1CLQA 3VA0A 2O8FB 3BGRA 5AR0A 4MQ3A 4OO1J 3KJVA 3CCVN 3CM5A 4EAHD 2KFZA 4I2QA 2FBYA 3FE1A 2KQ2A 4EZ9A 4JKDA 4EP4A 1U47A 3AV9A 3QB0A 1YJWN 3M8QA 4CHPA 4LD0A 4CECA 4CEFA 4DSFA 4FJXA 2HBJA 2ASPA 4DKWA 4BGBA 2KLAA 1BO5O 3VA3A 1VQ5N 5AQQA 2ASMA 4FM2A 4AHVA 4CBWA 1A5WA 1KVAA 3VF2A 1KFDA 3CYMA 1QHTA 1HLUA 3UKRA 1HX1A 4M7YA 3D6RA 2NRVA 4BR2A 4JKBA 3O4WA 1TL3A 1SQKA 2YKMA 4HCBA 1Z26A 3PY8A 2BGGA 3TAQA 2HNDA 3AO3A 1U04A 3I8BA 1JL1A 4GKKK 4I6MB 3AO4A 1WAJA 1IBLK 3AGKA 4FJMA 1YTUA 3THYB 1R0AA 3MK6A 4HUFA 4ILHA 5BPNA 1DTTA 1QSLA 3KTQA 2JGUA 1SL1A 4XEIA 4E7IA 3CM6A 3VQAA 1E4GT 3DLKA 4FJIA 4RG8A 5GAHP 4CBUA 1Q82O 1D9DA 3H08A 3NAEA 4NLCA 3P5JA 4FWSA 2EWSA 2E2QA 2E1ZA 1TVRA 4LF8K 3SQ4A 1MWMA 1TKZA 3MX2A 3I55N 3RMCA 1VQLN 4BG8A 3RR7A 3I33A 1NGJA 3TARA 2CH6A 3G0ZA 2QWQA 1LW2A 1KAZA 4BDYA 2F96A 4C8NA 3Q7CA 3JXUA 3HJFA 4Y1CA 2HHWA 2W41A 3RSEB 3CPEA 1VQ8N 4CF9A 4YORA 5CZ1A 3AVCA 1ZBUA 4OPKA 1W9HA 4ISFA 4YOXA 3A0IX 3WUHA 3ENOA 1NJXA 3VESA 4GKJK 3F5TA 1NJIO 3NMUA 2QWPA 2A42A 3HPOA 1NJYA 3AVAA 1XMOK 2BTFA 1L3UA 1JLCA 5BREA 2E4LA 4DTNA 1U45A 1HR0K 4H5RA 3KLEA 1KLMA 3ZSRA 3FZKA 3HSCA 3HTVA 4JRQA 2VG6A 4F4KA 5MLCQ 3MX5A 1KD1O 2WTUA 3VEOA 4OKKA 4DHYA 4DQPA 3QIPA 5IT9O 3MN9A 1LV5A 5D3GA 3ZSZA 4OX9K 2X6SA 3K9KA 1OH8A 2D5RA 3OYFA 5C12A 1TL1A 3JYTA 3I8DA 4DTOA 1D5AA 2AJQA 1NKEA 5B8HA 1BU6O 4CF0A 1RDDA 1RT6A 3C6HA 4EP5A 5CR4A 2HHQA 4C8OA 4B08A 4IO9L 2IAJA 3U9DA 4DQSA 5AQZA 3VQ5A 1HYSA 1NU0A 1RBTA 3ISNC 1JLFA 2B5JA 3NFAA 4FPBA 4OJRA 1J54A 4CHNA 4HTUA 3EO3A 1X9JA 2WC9A 5CHIA 3CCSN 1BI4B 4N56A 4M45A 4BRQA 3QBXA 4CZHA 4F8RA 1GLDG 3MCPA 2PZSA 4KH6A 3S3OA 3C6TA 2HOEA 5C0YA 4CGJA 4LC9B 4BWJA 2HW3A 4PL8A 1BG3A 4DWIA 4OKJA 1VSHA 1RGIA 3NHGA 4DTJA 3JAMO 3R8EA 4DR1K 1JKHA 1Z25A 3QINA 5HLFA 2QWRA 4H5TA 1ZC6A 1TAUA 3VGMA 1HYZA 1JLAA 3T1YK 4B3MK 2PYJA 5EY4A 5BN9A 4NLBA 3TAGA 2G8IA 4JKFA 2FBTA 5JS1A 1VSDA 3VQ4A 1QQMA 1K8KA 5EXWA 4FWLA 3CJ7A 5AQPA 3LDQA 4B8CA 2IS3A 3OYEA 3ENBA 5M1FA 3KK1A 4H0YB 2E2OA 4K0KK 2KKZA 1KSPA 4JI4K 4FK2A 4O5BA 3MN5A 4BVPA 2HB5A 5F0XA 5F2RA 4DSLA 5JLFA 4M42A 2HHUA 3L3VA 4DS5A 3AA2A 4WF9L 4M3UA 2BH1A 4BY9C 4CJSA 1NLVA 1L5UA 3VQ9A 3LZJA 4IDKA 2A5XA 2NRZA 4NXMK 3CHWA 3WXLA 3A5OC 3NCIA 2O8EB 1I94K 3K59A 1JCGA 1RBSA 3NH1A 4CFCA 4B3RK 4FJ7A 4JK9A 1KC8O 3KLFA 1KQSM 4B1YB 4OGCA 3HZ6A 2HHXA 3RR8A 3L2WA 3THWA 3EEQA 1RTDA 4QS7A 3U4LA 2D0CA 3EKUA 1L3VA 3O3HA 1S6PA 5KPZA 3OW2M 3BF3A 3KIOA 3DAWA 1EETA 2P9IB 5AQJA 5TKYA 4O0IA 5KI6A 4BR0A 1LWFA 3NGIA 5I42A 4FJKA 1J5OA 1RT4A 1HJOA 4DV0K 3AY9A 3TU5A 2ZD1A 4L3QA 1YTAA 2YNHA 5A2QO 2IC3A 1SUQA 4DV5K 3G4SN 3MDQA 2RKIA 4CEBA 3VOVA 3OS0A 4CGHA 5AFUA 1EP4A 2GUPA 4L8RB 4A5AA 3M1FA 4X62K 3NF9A 5JVHL 4A57A 3HM8A 3HOSA 4DLEA 4FWKA 3QNNA 1O13A 1CZBA 1T6DA 3VENA 4YFUA 4DV3K 3S41A 3K5NA 4CJVA 1NK4A 3CJAA 4IXCA 3CD6N 4FJ5A 4F3TA 3QEVA 1K6YA 1IBMK 4DR5K 1RT3A 4CZLA 2WUSA 3FZMA 4DQ8A 4CEZA 4CIEA 4H0VB 4IEIA 2YHYA 3CC2N 3HYFA 2GWJA 2ZGYA 4EHUA 1VQ9N 5BRHA 4IFYA 5LJWA 3OBYA 4LF5K 4CK1A 3ALYA 3VQ6A 4FWMA 4RW9A 3WNEA 4FJGA 2FBXA 4B3SK 1ZBFA 2R7YA 4BR7A 4GV6A 1RTHA 4E7LA 4BE0A 4ILJA 4DSIA 5FPDA 4HUGA 3OYJA 3UIQA 3AVFA 4ELVA 4K8XA 4QCLA 1HMVA 3SUQA 1XNQK 4B9MA 3CFPA 3AA5X 2GX9A 2ZGZA 1N8RO 1GLCG 5HRSA 1KTQA 3D7EO 2DPNA 2ZJQL 2O4GA 1FK9A 1VK0A 5GINA 4BRFA 1BOTO 1RNHA 4KRFA 4C1NK 1Q81O 2A41A 4A2AA 3HPHA 4PY5A 2OTLN 5AQWA 1KLNA 2ITMA 4N76A 5C2FA 3ULDA 4NCGA 5CE3A 4JHDB 4CBXA 1W0HA 1A5XA 3M6GA 3I0SA 4H0XB 5AQSA 3DLEA 3BZCA 4BE1A 4NCBA 4DTMA 5AJ3K 5HRPA 4BROA 1DGKN 3QESA 1HKBA 4GVEA 5HRRA 4EIAA 1NJWA 2WBNA 3ID8A 2V7YA 1VQNN 2Y1IA 4MDAA 2RE2A 3AO2A 3SMSA 5EVZA 5FDLA 1W2BM 1L3TA 3L6QA 4CJFA 5EU7A 2WONA 4NCAA 3AVBA 3H1VX 4FXDA 4IOXA 5FRMA 2HVIA 4CJ3A 4DQIA 3DMJA 1GLEG 5HP1A 2UXCK 1QQOA 1I39A 1U49A 3O9TA 3EKSA 3CI5A 4Z4HA 1K73O 2YX6A 5C15A 3ZSYA 2VWBA 5J2PA 1VSJA 3E9LA 4CJQA 4ZTFA 3OYCA 3A5LC 4Z4EA 4Q0BA 5DK5A 5JMVA 1XNRK 1JCEA 4BE2A 4FWPA 2V52B 1SAZA 4OPHA 4B9SA 3U8XA 1S72N 3OYDA 5TKWA 3D45A 1NGHA 2O8BA 3SZ2A 1J9AA 3KZBA 1D8YA 4N47A 1BISA 5AQRA 1U6ZA 2HVHA 4WFBL 2W42A 3WNHA 5AQVA 2OPSA 4BRIA 1VSEA 4W5NA 3VQQA 5LMNK 4E3SA 4FJNA 2W6KA 5FPMA 3ULEB 4YY3K 3O1BA 3MEGA 4YOVA 3MCAB 2HHTA 1V4TA 1Z6RA 4DV6K 3QERA 3ZEUA 1NK7A 1C1CA 4IBNA 3J7ZO 3CQXA 4J2BA 3DLHA 2P9UA 3L3UA 3G10A 4QOZB 3CETA 1N5YA 2P9SA 4HUEA 2D0OA 1T05A 3NE6A 3V9WA 3OHRA 3VEWA 4AM6A 2E8AA 1TGOA 3ZSVA 1VRTA 2IGIA 4CJLA 4IJNA 1S9EA 1Y64A 5H1SQ 3TABA 1REVA 4OKEA 2QXLA 4BC4A 1R59O 2G8KA 3NVMA 4JD2A 5M1KA 3RMAA 4UY8O 2G8HA 3IMXA 1EO1A 1W97L 1WUAA 3VETA 1TYQA 3QBWA 3UKRB 2P1JA 3V1OA 4GMJB 3CC4N 4E1MA 4CZEA 3TPQA 1Q18A 1NK8A 3VQEA 3ZCMA 4CHOA 3PX0A 1GOAA 1JLGA 3SUOA 5AZIA 3CF5L 3ID6A 1IO2A 5C24A 5SWMA 2P9LA 4FO0A 3R9PA 4Y1DA 4EZ6A 4X66K 3RVCA 1BIZA 1XHZA 4CGGA 4FPAA 4JK7A 5K14A 4KHWA 3LP2A 4N5SA 2UYTA 4PKGA 1NGBA 4DV1K 4I9LA 4JKAA 1HRHA 4CZMA 5HROA 3PO5A 3V81A 2OCEA 4O4GA 5CYMA 4AHSA 4CW7B 4BWMA 4NB4A 3SNNA 2Q97A 5SZTA 3DOKA 1NK9A 3QIOA 2HSTA 4BRMA 1B9FA 4LF4K 3UKUA 5M1OA 4KH5A 1OH5A 5CZ2A 4JS5A 3MXIA 1T3VA 4CZFA 3CCQN 1GOCA 1H1VA 3CIPA 4JN4A 1OVYA 3CJ1A 3AGRA 3RRGA 2PYLA 4IDHA 4CD3A 3HL8A 2VGNA 3EZWA 3MN6A 3RMDA 4JYAK 1NGIA 4RWTA 3U9ZA 1DEJA 3HOTA 3AVMA 1U4BA 1HPZA 2HHVA 1A5VA 4O55A 2QI2A 3SPZA 5E41A 5AQFA 4FVMA 5HRNA 1RTIA 2Q0UA 3R3LA 3VF6A 3AVKA 4OPAA 1ATRA 5C25A 4CK3A 4W5QA 4ZHRA 5HOOA 3H3NO 3MEEA 2HBLA 4BDZA 4BGAA 3J81O 4M7XA 2IOCA 1WSJA 3V9UA 1NJZA 4ISGA 3O6WA 1NM1A 3B6PA 2A6AA 2JWKA 3QETA 4GV3A 1RT7A 4DU4A 2VWKA 3V9ZA 2D0PA 2P9PA 3O08A 2A1RA 1EX4A 4CVNE 1D9FA 1RBUA 5T7BA 3V1RA 1HKCA 1HNVA 3BDPA 2O8FA 2QM1A 3C6UA 2Q31A 3AAQA 3O9RA 2UU9K 3MEDA 1RDAA 3ZSWA 3IS9A 3CERA 5AZJB 2E1YA 3KWIA 4FLWA 4M3RA 1G99A 5LJVA 4IEEA 2QEXN 4KKOA 1O1WA 3ZYYX 4E1NA 3M8RA 3MWPA 5ELZA 1WSEA 3K2PA 4RCHA 4Z4CA 3SV3A 1DLOA 3CJCA 3TR8A 3O3FA 1TKTA 1IG9A 1XC9A 3OBWA 3KD1E 1TKDA 1RDCA 3EN9A 1NG9A 3O4NA 3CJBA 3K5OA 2NRXA 3LDNA 1V4SA 4FLZA 4BQLA 1SS6A 4ELUA 4OVLA 3WXKA 3I56N 4RW4A 2W40A 4ELTA 1ASUA 4I6MA 2HNZA 3EZ5A 4BRCA 4BRLA 2Z1HA 5AQGA 3THYA 3CCUN 4O8KA 2YV0X 3NH0A 3L2VA 4FLXA 3S9HA 2RHKA 1I3AA 3HP9A 4DSKA 4CF2A 1GOBA 4C8LA 3SQ0A 3HXMA 3MMVA 3V1QA 4CJPA 1LWEA 4MFBA 3A8YA 2YNGA 5FROA 1T6CA 2Q36A 4BC5A 4DTRA 2GBZA 3Q7BA 1ASWA 3VGKA 2HMIA 3EL2A 3ZX2A 3O8MA 3P4IA 1ZBIA 1C0UA 1JXBA 1YVUA 2IVNA 1MWKA 1C0TA 3H3OB 4DUZK 2HBKA 2E2NA 4QAGA 3NH2A 1VSKA 4CHYA 1RFQA 1MDUB 3KLIA 2HBMA 4UQGA 3OYAA 3NVKA 4CHQA 4Z0UA 3SMPA 1YI2N 3V9SA 3AA3A 3VEXA 3RSEA 4CI6A 2VGMA 4AH9A 5CYQA 4BG9A 4KO0A 3TAEA 4IG0A 4BQZA 5M1PA 4MO4A 1JL2A 4EFHA 3DLGA 1RBRA 4R5PA 2KHOA 4KTWA 2O8CA 4JKCA 4M63C 5BPLA 4CGDA 1CZ9A 3NBPA 2F7TA 3QFPA 2E5LK 1OKJA 2HNYA 4MDBA 2X6NA 3SBGA 2VYPA 1VSFA 3L2RA 3KKRA 3FGUA 3OYKA 4JI1K 2GUIA 2ZJPL 1IKWA 2UUAK 4B3OA 1QZ6A 2RF2A 2E20A 1U2VB 3T19A 2JWLA 5C42A 1NBWA 4JKGA 3DXKB 1QS4A 4M41A 2E2PA 2G8UA 1S1XA 1OVQA 1NGCA 3T1HK 4BDPA 3KK3A 5KGXA 4KV8A 1TAQA 2LSNA 3GL1A 2VG5A 4HTLA 3VQDA 4ILGB 3TSPA 4PUOA 4CEQA 3SI6A 1UOCA 4HWIA 3T7ZA 4H03B 5KTQA 3PSFA 1BGXT 3BP8A 1BI4A 2OZMA 2VG7A 3QEIA 1TV6A 2ZJRL 3LALA 2ASOA 3QICA 4IOCL 4BRNA 2ZWHA 3HRGA 1JLQA 1TK0A 3C7NB 2O8DA 3LP3A 2RPIA 3N4PA 3G71N 2I7NA 3HPGA 4YOYA 3I0RA 3THXB 4DV7K 4B9QA 2VQEK 4PA1A 4KFBA 1NWKA 1HQEA 4AHTA 3CQYA 1QTMA 1WOQA 3TTDA 4OPJA 5DMRA 1EWRA 1VAZA 4WFAL 1EXQA 3P31A 1XWLA 3SAFA 3ZT0A 1RT5A 1VQKN 1BHLA 2D0BA 3DRPA 3WXJA 2F8SA 1NGAA 4J2EA 3ZSQA 2ZM6K 1J5EK 4LFCK 4Q5VA 1FJGK 1J53A 1Z05A 3FFIA 3H46O 4KH4A 3DXMB 4H4OA 4BVOA 3VMFB 4JNEA 2NZTA 5ADXH 1UA1A 1RDUA 4DR7K 4KI6A 5FPNA 3IFRA 4BRHA 4FL9A 1VQON 1C0FA 1P90A 4A59A 1X3NA 5J1EA 4JKHA 3TI0A 1NGGA 3LL3A 4DU3A 3LWMA 4CGFA 3IG1A 2E6LA 1KVCA 3UB5A 2QWOA 3AVNA 3WEEA 3T1AA 2O8EA 3FLCO 5AQHA 1JLEA 4YHHK 4DR6K 4DG1A 3HI0A 3CJ9A 3KHYA 4RTFD 5F1XA 4E7JA 3R1XA 1WLJA 4FM1A 1KAXA 1IKVA 4F3OA 3OYGA 4I2PA 5E26A 5J2QA 3LP1A 3ENHA 3D2EB 4FZXC 4DFKA 1EQYA 1C6VA 2P9IA 3NF8A 2YHXA 2B4JA 2EX3A 3VQCA 4CJKA 5AQYA 4IWVA 1LCUA 1ILYA 4CJWA 4GV9A 3DWLA 4RW6A 1LOTB 3WQUA 1E4FT 3WQTA 1QSSA 1YF5L 3AVJA 4W5TA 1GLLO 3ZT3A 1BDGA 1XQSC 3T69A 3DJCA 2GWKA 4NYFA 1GLBG 4CJEA 2UXDK 2IVOA 4LH5A 3L4QA 1E3MA 4KHSA 5EOYA 2GTDA 4OGEA 3IDHA 4FLYA 2QK9A 2E6MA 2F9TA 2QXFA 4WQ5A 1T7PA 3OS2A 4A2BA 2JLEA 4WFNL 1RBVA 3CCEN 1KRPA 3NGYA 4JV5K 4GW6A 1LW0A 3DYAA 4ID1A 3HSTB 3O1WA 1ATSA 4CJ4A 5KRSA 3AVGA 1UWBA 3E01A 5FRNA 3MECA 4FW1A 3VQ8A 2P9UB 4CZIA 3SQ1A 3PO4A 3BF1A 2P9SB 3OYBA 3C0BA 3J80O 3D2FB 4H5NA 4CFDA 1BQMA 3O9QA 3DOLA 4IKFA 3KVGA 2BANA 4PL7A 1JCFA 4JKEA 1ZYQA 1BL3A 4JD2B 1N34K 3E9PA 1XC3A 3V9XA 2IIRA 4B9NA 3VPZA 4IJAA 3IRXA 4FJJA 4KHQA 2QKBA 3NF7A 1TUYA 4CE9A 3CCRN 4O5FA 1SKRA 4DB3A 1ESVA 4R79A 5KQ8A 3K0SA 4DUYK 1KFSA 4C8KA 2AP1A 1TKXA 1S5JA 1N6QA 4V19S 1YVNA 3B6OA 4CZKA 4M3ZA 2WOMA 5J2NA 3PSIA 5AZIB 4JHDA 4Z4FA 3ZT1A 4E7HA 3SK3A 4AM7A 4FOIA 4K42A 3CC7N 3MN7A 1ZBHA 4H0TB 2RN2A 2P5GA 4B9LA 3VTHA 4K41A 2P9NA 3KWGA 3MXJA 4CESA 3EY1A 3WNGA 1WN7A 1GLFO 1FXXA 3C94A 1C1AA 4BREA 3PIPL 2XY6A 3ITHA 3QEPA 3U6FA 3JSMA 3AO5A 5AQOA 3TAFA 1QE1A 3SQ2A 3DLRA 4ID5A 3RRHA 2BUPA 4F2SA 4JI3K 4WE1A 1RDWX 3S3MA 3E1YA 4CGIA 1Q9YA 2YKNA 3A5NC 4B9TA 1OH6A 2QW9A 4FW2A 1QZ5A 3C95A 1EWQA 4GVMA 5AQLA 1ZBSA 1S6QA 4O0JA 3GE1A 1TK5A 4KHUA 4HVJA 4BRKA 4M3WA 1D4XA 4FWRA 4H0OA 2CGJA 5IWAK 4NYNA 2A3ZA 3CCJN 4FJLA 1KXPA 3NF6A 2FSKA 1KVBA 5KGWA 3S3NA 2OPPA 4X65K 1NGFA 3GG4A 4FWNA 4KB0A 3IKMA 3OTOK 2A40A 2P9KA 3L4IA 5HL7L 5E84A 3GDQA 1VSIA 3ATUA 5C2DA 3A5MC 1YHQN 3K5LA 4CIGA 3UE5A 2J4RA 1QVGM 1QSYA 3DRSA 4KHYA 1IG8A 5GAEP 1RILA 2FLOA 4MLEA 3LDSA 3IAYA 1QQCA 4RW8A 1GLAG 1NKCA 2G8FA 4DV2K 3LWLA 4CERA 3O9UA 4YDUA 1X3MA 4DR2K 3J8AA 4KHPK 2Q0RA 5DM7L 2P9PB 1ITGA 4RW7A 2XY8A 3PIOL 2UXBK 3MXMA 4JI8K 2XRIA 4DCHA 1RDBA
chains in the Genus database with same CATH topology
2YNHA 2IC3A 4FCYA 3V1QA 4CJPA 1LWEA 1SUQA 4MFBA 4FYDA 2YNGA 5FROA 4FJ8A 1X1PA 3PX6A 4E7KA 2RKIA 4CEBA 4E19A 3OS0A 4DTRA 3HO1A 4CGHA 1WSGA 2GBZA 3CFOA 1ASWA 1EP4A 4L8RB 4DQRA 4B9UA 3SPYA 2HMIA 4CFBA 4CEDA 1ZBIA 1C0UA 3NF9A 2X74A 1JXBA 4KPYA 4C8MA 1YVUA 2Y1JA 1Q9XA 2KZZA 1C0TA 1XHXA 4CF8A 3HVRA 1SKSA 3LPUA 2XHBA 4DLEA 2A1SA 4QAGA 3SCXA 3NH2A 3DM2A 2BE2A 3QNNA 1CZBA 1VSKA 4YFUA 1IKYA 3PV8A 3K5NA 4DFPA 3HM9A 4CJVA 1NK4A 5JS2A 4CHYA 3KLIA 3WNFA 3OJUA 4UQGA 3OY9A 3QEWA 4LSNA 3OYAA 1BIUA 1K6YA 3QLHA 3QEVA 4F3TA 4CHQA 1MU2A 4Z0UA 1RT3A 3V9SA 1VSLA 1WSIA 3AA3A 1T8EA 3RWUA 3SYZA 1RT1A 2ATQA 2FBVA 4AH9A 5CYQA 4CEZA 4CIEA 3T3FA 4KO0A 3TAEA 4IG0A 1RTJA 3DLBA 3HYFA 1JL2A 1HJRA 1RBRA 3DLGA 4R5PA 1JLBA 4FK0A 4KTWA 4W5RA 4N41A 4IFYA 4IG3A 4JS4A 3KLGA 5I3UA 1X9WA 4AHUA 3K57A 4CK1A 4CJUA 1EKEA 3ALYA 4CGDA 3VQ6A 3M8PA 4AILC 1CZ9A 3NBPA 3QEXA 3OVNA 1NK5A 4CEOA 4RW9A 3WNEA 3HP6A 1RCHA 1FKPA 1L3SA 2FBXA 2HNYA 4FJGA 1ZBFA 4FLUA 2X6NA 2R7YA 1G15A 1RTHA 2Z1IA 2EHGA 4E7LA 1VSFA 3L2RA 1WSHA 2I5JA 3KKRA 4JRPA 4BE0A 3PX4A 3LANA 2XY5A 3OYKA 4CHZA 4DSIA 3QO9A 2GUIA 2OPRA 4KTQA 3P1GA 4HUGA 4DF8A 1YT3A 4FM0A 4CEEA 3OYJA 4CIFA 3D0PA 1NOYA 1NKBA 3UIQA 3AVFA 4ELVA 4K8XA 1BCOA 1HMVA 3SUQA 4QCLA 1IKWA 4B9MA 4B3OA 2RF2A 3CFPA 1S1UA 3AA5X 3HVTA 3T19A 5C42A 5HRSA 1KTQA 1BCMA 4FJHA 1QS4A 1C0MA 4M41A 2O4GA 1KCFA 4DTPA 4J2AA 1FK9A 1S1XA 1VK0A 1VRUA 3AA4A 3AVIA 4HHTA 1C1BA 2G8UA 4BDPA 1F21A 1RNHA 2G8WA 4KRFA 3KK3A 4KTZA 5KGXA 4KV8A 3HPHA 4O44A 4PY5A 1DTQA 1TAQA 2LSNA 3OYHA 4IFVA 2VG5A 3VQDA 4DTXA 1SV5A 3K58A 4B9VA 1KLNA 4PUOA 4CEQA 4OLAA 3SI6A 1UOCA 4DTUA 2G8VA 2YHBA 3CG7A 4N76A 5J2MA 4CEAA 4AHCA 5KTQA 3HT3A 4CJRA 3ULDA 4NCGA 2ZQBA 3L8BA 3ZSOA 1BGXT 4KB1A 4KHNA 4PWDA 3V6DA 4FK4A 1W0HA 1X9SA 2YNIA 1A5XA 4H4MA 1BI4A 1SL0A 3I0SA 4CFAA 2OZMA 3DLEA 2VG7A 3CFRA 3QEIA 3DI6A 4BE1A 4NCBA 2KZMA 1TV6A 4FLVA 4DTMA 1NK6A 2F8TA 3LALA 5HRPA 2P5OA 4KREA 1JLQA 2X78A 3QESA 1TK0A 3AO1A 1NOZA 3LP3A 2RPIA 5HRRA 3NGZA 1NJWA 2KFNA 5FRNA 1JXEA 3HPGA 3I0RA 3M8SA 4K8ZA 3A2FA 4FZYA 3ZT2A 1SL2A 4HCCA 4PA1A 4H8KA 2Y1IA 4ZTJA 3F73A 4KFBA 3AO2A 1TK8A 3LPTA 1HQEA 2BDPA 2KTQA 5FDLA 1FKOA 4AHTA 3OYMA 1CLQA 1QTMA 3VA0A 1RT2A 4OPJA 3BGRA 5DMRA 3QNOA 2OPQA 1L3TA 4MQ3A 4CJFA 3RTVA 5EU7A 2WONA 3CM5A 3KJVA 1EXQA 2Q3SA 4NCAA 3AVBA 4DSJA 2KFZA 4I2QA 4FXDA 1XWLA 2FBYA 5FRMA 2HVIA 2KQ2A 4CJ3A 4EZ9A 4DQIA 3DMJA 4EP4A 5HP1A 4DLGA 1I39A 1U47A 3AV9A 3ZT0A 1RT5A 3OJSA 1U49A 3M8QA 4FJ5A 1BHLA 2D0BA 3DRPA 4LD0A 4CHPA 4CECA 4Z4HA 2F8SA 4CEFA 4DSFA 3ZSQA 4J2EA 4FJXA 4PQUA 3KK2A 3ZSYA 4Q5VA 1J53A 3FFIA 4OLBA 5J2PA 1VSJA 2O4IA 4H4OA 3L2UA 4CJQA 4ZTFA 3K5MA 3NDKA 3OYCA 3VA3A 4Z4EA 3KKSA 1UA1A 4FM2A 2DFFA 4AHVA 4KI6A 4DTSA 1A5WA 1KVAA 3OYIA 1KFDA 3CYMA 5DK5A 4Q0BA 1QHTA 3LP0A 2DY4A 4BE2A 2OA8A 5J1EA 3TI0A 4DFMA 4B9SA 4DU3A 3LWMA 4CGFA 3IG1A 1TL3A 1IH7A 2E6LA 1KVCA 3D45A 2YKMA 3OYDA 2XO7A 3SZ2A 1Z26A 3PY8A 4HCBA 1J9AA 2BGGA 3TAQA 2HNDA 4I7FA 3AO3A 3AVNA 1U04A 1D8YA 2AJQA 1JL1A 3T1AA 4N47A 1BISA 3AO4A 1WAJA 2HVHA 4ICLA 2W42A 3TWHA 3WNHA 1JLEA 2OPSA 4CJ5A 4FJMA 4DG1A 1VSEA 3O4QA 4DU1A 1YTUA 3VQQA 4E3SA 1R0AA 4FJNA 4W5NA 4W5OA 4E7JA 4HUFA 4CK2A 1WLJA 3EYZA 3ASMA 4FM1A 1DTTA 4XIUA 1QSLA 3KTQA 2JGUA 4M3XA 1SL1A 3MEGA 4DMNA 3TANA 2HHTA 4E7IA 1IKVA 3CM6A 3VQAA 4CJTA 3ZSXA 4F3OA 3OYGA 4I2PA 4BACA 3QERA 1NK7A 2B6AA 1C1CA 4IBNA 3PUFA 3DLKA 5J2QA 4FJIA 4RG8A 3LP1A 3DLHA 4J2BA 3L3UA 3G10A 4QOZB 4FZXC 4DFKA 1N5YA 3CQ8A 3P83D 1C6VA 3NF8A 4HUEA 1T05A 1WAFA 2B4JA 3NE6A 3V9WA 1D9DA 3ZSVA 1TGOA 4CF1A 1VRTA 2EX3A 2IGIA 3H08A 3VQCA 4CJLA 4CJKA 2DTUA 3NAEA 3P5JA 2DFHA 4DS4A 1S9EA 4CJWA 1TVRA 3TABA 1REVA 2KW4A 4OKEA 3SQ4A 3RMBA 4RW6A 4CCHA 4FJ9A 1IKXA 3VQPA 1TKZA 2G8KA 2QKKA 1QSSA 3RMCA 3RMAA 3RR7A 3AVJA 2DFEA 2G8HA 4W5TA 4G1QA 3TARA 1S1WA 3ZT3A 3G0ZA 1LW2A 1XI1A 4BDYA 3O3GA 4FZZA 2F96A 4NYFA 4C8NA 4AHRA 4CJEA 3HJFA 3AVHA 4Y1CA 1Y97A 2HHWA 1S1TA 2P1JA 4LH5A 3V1OA 4GMJB 4KHSA 4CF9A 5CZ1A 4OPKA 3AVCA 1ZBUA 4E1MA 1W9HA 3THVA 4OGEA 3VQBA 4FLYA 1NK8A 1B92A 3VQEA 2E6MA 2QXFA 3ZCMA 1ZBLA 4E89A 4CHOA 1T7PA 2QK9A 3OS2A 1NJXA 3PX0A 1GOAA 1JLGA 3SUOA 2JLEA 1RBVA 3HPOA 5KRTA 1VSMA 1NJYA 3AVAA 1KRPA 1IO2A 4DSEA 3NGYA 4DFJA 1L3UA 5C24A 1JLCA 4GW6A 5SWMA 1LW0A 2E4LA 3DYAA 2FC0A 4FLTA 4DTNA 1U45A 4ID1A 3HSTB 3VQ7A 3KLEA 1KLMA 3ZSRA 4CJ4A 1T03A 4Y1DA 1CXQA 4EZ6A 5KRSA 3LAMA 3AVGA 4JRQA 2P51A 1UWBA 2VG6A 3E01A 4F4KA 3MECA 4FW1A 3VQ8A 1BIZA 1NK0A 4F2RA 1XHZA 4CGGA 4OKKA 3SQ1A 4DQPA 1X9MA 2OYQA 3PO4A 3QIPA 5K14A 4KHWA 3V4IA 1LV5A 5D3GA 3OYBA 3LP2A 3ZSZA 2X6SA 4N5SA 2Z1JA 3KLHA 2D5RA 4LH4A 4CFDA 3OYFA 1HYVA 1TL1A 4I9LA 3LZIA 3JYTA 1HRHA 1BQMA 4M3YA 3I8DA 1HQUA 4DTOA 2GV9A 5HROA 1D5AA 3DOLA 3PO5A 1UA0A 4E0DA 1LAWA 1HNIA 3V81A 1NKEA 4IKFA 2BANA 1ZYQA 4CF0A 1RDDA 1RT6A 4O4GA 2YNFA 5CYMA 4AHSA 4EP5A 2VWJA 4BWMA 3SJJA 2HHQA 1BL3A 1ASVA 3SNNA 5SZTA 4C8OA 3DOKA 4B08A 1NK9A 2IAJA 3QIOA 4DQSA 3V9XA 4B9NA 3VQ5A 1HYSA 1RBTA 1B9FA 1JLFA 2B5JA 3ISNC 3NFAA 3IRXA 4FJJA 4OJRA 4KHQA 1J54A 4CHNA 2D0AA 2QKBA 4HTUA 5CZ2A 4KAZA 3NF7A 4DF4A 4JS5A 3MXIA 3MAQA 1GOCA 1BI4B 1BQNA 3LAKA 4CE9A 4N56A 4M45A 3RRGA 4F8RA 2PYLA 1SKRA 2PY5A 2PZSA 2IDOA 3S3OA 1WNSA 3C6TA 1LWCA 3HL8A 2OZSA 4CGJA 1KFSA 1LAVA 4C8KA 1TKXA 4BWJA 3RMDA 2HW3A 1Q8IA 1S5JA 3SUPA 1N6QA 4DWIA 4M3TA 4OKJA 1VSHA 3F9KA 3B6OA 4M3ZA 3NHGA 4DTJA 2WOMA 3AVMA 3TAMA 1HPZA 5J2NA 1U4BA 4Z4FA 3ZT1A 2HHVA 2HHSA 2YHAA 4E7HA 1A5VA 4O55A 3SPZA 1JKHA 1Z25A 5E41A 4FVMA 3QINA 5HRNA 1RTIA 5HLFA 1ZBHA 3OYNA 2RN2A 3AVKA 5C25A 4CK3A 2P5GA 4W5QA 4B9LA 4ZHRA 1TAUA 3MXJA 3MEEA 3ZT4A 4CESA 3EY1A 2NUBA 3WNGA 4BDZA 3V9UA 2IOCA 1WSJA 1HYZA 1WN7A 1JLAA 1NJZA 4JLHA 3B6PA 3TAPA 5HBMA 2PYJA 1FXXA 3C94A 1C1AA 3QETA 3TAGA 1RT7A 4DU4A 2VWKA 2G8IA 3V9ZA 1U48A 2FBTA 5JS1A 2XY6A 2A1RA 1VSDA 1EX4A 3ITHA 3VQ4A 3QEPA 1D9FA 3L2QA 3U6FA 3JSMA 3AO5A 4YNQA 3TAFA 5CY4A 1RBUA 1QE1A 3SQ2A 5T7BA 3V1RA 3DLRA 4ID5A 1HNVA 4B8AB 3RRHA 4B8CA 3BDPA 4F2SA 3HK2A 4WE1A 3C6UA 2IS3A 3S3MA 3OYEA 3MEDA 4CGIA 1RDAA 3ZSWA 3IS9A 3KK1A 1CXUA 1Q9YA 2YKNA 4B9TA 1KSPA 4FLWA 4FW2A 3C95A 4GVMA 4M3RA 3U3GA 4FK2A 4O5BA 1S6QA 2Z1GA 2ZE2A 4O0JA 4KKOA 3SV4A 1O1WA 1TK5A 4KHUA 4HVJA 4E1NA 3M8RA 4M3WA 1WSEA 2HB5A 4DSLA 3K2PA 1S9GA 4M42A 2HHUA 3L3VA 4Z4CA 4NYNA 4DS5A 3AA2A 4M3UA 4Z4IA 3OYLA 3SV3A 1SKWA 1DLOA 4FJLA 4CJSA 2XY7A 1L5UA 4I9QA 3TR8A 3VQ9A 3NF6A 3O3FA 4TSXA 1TKTA 1KVBA 5KGWA 3S3NA 2OPPA 3LZJA 4J2DA 4Z4GA 1IG9A 4IDKA 4KB0A 2ETJA 3OS1A 3NCIA 1XC9A 3SUNA 3U3YA 1WSFA 3KD1E 1S1VA 1VSIA 1TKDA 1RDCA 3K59A 4KI4A 1RBSA 3O4NA 3NH1A 4CFCA 3K5LA 4CIGA 1QSYA 3DRSA 4FJ7A 1B9DA 4KHYA 3K5OA 1UAXA 3AVLA 3KLFA 4FLZA 1RILA 4DQQA 3KD5E 4ELUA 4OGCA 3LDSA 3IAYA 1QQCA 4OVLA 4RW8A 2HHXA 1NKCA 2G8FA 3RR8A 4RW4A 3L2WA 4ELTA 1ASUA 4LSLA 3LWLA 4LY7A 4CERA 2HNZA 1RTDA 3EZ5A 2ITGA 2D0CA 2Z1HA 1L3VA 3O3HA 1S6PA 2YV0X 3NH0A 3L2VA 3KIOA 1EETA 3DRRA 4O0IA 1ITGA 4RW7A 2XY8A 5KI6A 4FLXA 1LWFA 3MXMA 3S9HA 3NGIA 1I3AA 3VN5A 5I42A 4FJKA 2XRIA 1J5OA 1RT4A 3HP9A 4DSKA 4CF2A 1GOBA 4C8LA 3SQ0A 3HXMA 2ZD1A 1RDBA 1YTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNH A;  2IC3 A;  4FCY A;  3V1Q A;  4CJP A;  1LWE A;  1SUQ A;  4MFB A;  4FYD A;  2YNG A;  5FRO A;  4FJ8 A;  1X1P A;  3PX6 A;  4E7K A;  2RKI A;  4CEB A;  4E19 A;  3OS0 A;  4DTR A;  3HO1 A;  4CGH A;  1WSG A;  2GBZ A;  3CFO A;  1ASW A;  1EP4 A;  4L8R B;  4DQR A;  4B9U A;  3SPY A;  2HMI A;  4CFB A;  4CED A;  1ZBI A;  1C0U A;  3NF9 A;  2X74 A;  1JXB A;  4KPY A;  4C8M A;  1YVU A;  2Y1J A;  1Q9X A;  2KZZ A;  1C0T A;  1XHX A;  4CF8 A;  3HVR A;  1SKS A;  3LPU A;  2XHB A;  4DLE A;  2A1S A;  4QAG A;  3SCX A;  3NH2 A;  3DM2 A;  2BE2 A;  3QNN A;  1CZB A;  1VSK A;  4YFU A;  1IKY A;  3PV8 A;  3K5N A;  4DFP A;  3HM9 A;  4CJV A;  1NK4 A;  5JS2 A;  4CHY A;  3KLI A;  3WNF A;  3OJU A;  4UQG A;  3OY9 A;  3QEW A;  4LSN A;  3OYA A;  1BIU A;  1K6Y A;  3QLH A;  3QEV A;  4F3T A;  4CHQ A;  1MU2 A;  4Z0U A;  1RT3 A;  3V9S A;  1VSL A;  1WSI A;  3AA3 A;  1T8E A;  3RWU A;  3SYZ A;  1RT1 A;  2ATQ A;  2FBV A;  4AH9 A;  5CYQ A;  4CEZ A;  4CIE A;  3T3F A;  4KO0 A;  3TAE A;  4IG0 A;  1RTJ A;  3DLB A;  3HYF A;  1JL2 A;  1HJR A;  1RBR A;  3DLG A;  4R5P A;  1JLB A;  4FK0 A;  4KTW A;  4W5R A;  4N41 A;  4IFY A;  4IG3 A;  4JS4 A;  3KLG A;  5I3U A;  1X9W A;  4AHU A;  3K57 A;  4CK1 A;  4CJU A;  1EKE A;  3ALY A;  4CGD A;  3VQ6 A;  3M8P A;  4AIL C;  1CZ9 A;  3NBP A;  3QEX A;  3OVN A;  1NK5 A;  4CEO A;  4RW9 A;  3WNE A;  3HP6 A;  1RCH A;  1FKP A;  1L3S A;  2FBX A;  2HNY A;  4FJG A;  1ZBF A;  4FLU A;  2X6N A;  2R7Y A;  1G15 A;  1RTH A;  2Z1I A;  2EHG A;  4E7L A;  1VSF A;  3L2R A;  1WSH A;  2I5J A;  3KKR A;  4JRP A;  4BE0 A;  3PX4 A;  3LAN A;  2XY5 A;  3OYK A;  4CHZ A;  4DSI A;  3QO9 A;  2GUI A;  2OPR A;  4KTQ A;  3P1G A;  4HUG A;  4DF8 A;  1YT3 A;  4FM0 A;  4CEE A;  3OYJ A;  4CIF A;  3D0P A;  1NOY A;  1NKB A;  3UIQ A;  3AVF A;  4ELV A;  4K8X A;  1BCO A;  1HMV A;  3SUQ A;  4QCL A;  1IKW A;  4B9M A;  4B3O A;  2RF2 A;  3CFP A;  1S1U A;  3AA5 X;  3HVT A;  3T19 A;  5C42 A;  5HRS A;  1KTQ A;  1BCM A;  4FJH A;  1QS4 A;  1C0M A;  4M41 A;  2O4G A;  1KCF A;  4DTP A;  4J2A A;  1FK9 A;  1S1X A;  1VK0 A;  1VRU A;  3AA4 A;  3AVI A;  4HHT A;  1C1B A;  2G8U A;  4BDP A;  1F21 A;  1RNH A;  2G8W A;  4KRF A;  3KK3 A;  4KTZ A;  5KGX A;  4KV8 A;  3HPH A;  4O44 A;  4PY5 A;  1DTQ A;  1TAQ A;  2LSN A;  3OYH A;  4IFV A;  2VG5 A;  3VQD A;  4DTX A;  1SV5 A;  3K58 A;  4B9V A;  1KLN A;  4PUO A;  4CEQ A;  4OLA A;  3SI6 A;  1UOC A;  4DTU A;  2G8V A;  2YHB A;  3CG7 A;  4N76 A;  5J2M A;  4CEA A;  4AHC A;  5KTQ A;  3HT3 A;  4CJR A;  3ULD A;  4NCG A;  2ZQB A;  3L8B A;  3ZSO A;  1BGX T;  4KB1 A;  4KHN A;  4PWD A;  3V6D A;  4FK4 A;  1W0H A;  1X9S A;  2YNI A;  1A5X A;  4H4M A;  1BI4 A;  1SL0 A;  3I0S A;  4CFA A;  2OZM A;  3DLE A;  2VG7 A;  3CFR A;  3QEI A;  3DI6 A;  4BE1 A;  4NCB A;  2KZM A;  1TV6 A;  4FLV A;  4DTM A;  1NK6 A;  2F8T A;  3LAL A;  5HRP A;  2P5O A;  4KRE A;  1JLQ A;  2X78 A;  3QES A;  1TK0 A;  3AO1 A;  1NOZ A;  3LP3 A;  2RPI A;  5HRR A;  3NGZ A;  1NJW A;  2KFN A;  5FRN A;  1JXE A;  3HPG A;  3I0R A;  3M8S A;  4K8Z A;  3A2F A;  4FZY A;  3ZT2 A;  1SL2 A;  4HCC A;  4PA1 A;  4H8K A;  2Y1I A;  4ZTJ A;  3F73 A;  4KFB A;  3AO2 A;  1TK8 A;  3LPT A;  1HQE A;  2BDP A;  2KTQ A;  5FDL A;  1FKO A;  4AHT A;  3OYM A;  1CLQ A;  1QTM A;  3VA0 A;  1RT2 A;  4OPJ A;  3BGR A;  5DMR A;  3QNO A;  2OPQ A;  1L3T A;  4MQ3 A;  4CJF A;  3RTV A;  5EU7 A;  2WON A;  3CM5 A;  3KJV A;  1EXQ A;  2Q3S A;  4NCA A;  3AVB A;  4DSJ A;  2KFZ A;  4I2Q A;  4FXD A;  1XWL A;  2FBY A;  5FRM A;  2HVI A;  2KQ2 A;  4CJ3 A;  4EZ9 A;  4DQI A;  3DMJ A;  4EP4 A;  5HP1 A;  4DLG A;  1I39 A;  1U47 A;  3AV9 A;  3ZT0 A;  1RT5 A;  3OJS A;  1U49 A;  3M8Q A;  4FJ5 A;  1BHL A;  2D0B A;  3DRP A;  4LD0 A;  4CHP A;  4CEC A;  4Z4H A;  2F8S A;  4CEF A;  4DSF A;  3ZSQ A;  4J2E A;  4FJX A;  4PQU A;  3KK2 A;  3ZSY A;  4Q5V A;  1J53 A;  3FFI A;  4OLB A;  5J2P A;  1VSJ A;  2O4I A;  4H4O A;  3L2U A;  4CJQ A;  4ZTF A;  3K5M A;  3NDK A;  3OYC A;  3VA3 A;  4Z4E A;  3KKS A;  1UA1 A;  4FM2 A;  2DFF A;  4AHV A;  4KI6 A;  4DTS A;  1A5W A;  1KVA A;  3OYI A;  1KFD A;  3CYM A;  5DK5 A;  4Q0B A;  1QHT A;  3LP0 A;  2DY4 A;  4BE2 A;  2OA8 A;  5J1E A;  3TI0 A;  4DFM A;  4B9S A;  4DU3 A;  3LWM A;  4CGF A;  3IG1 A;  1TL3 A;  1IH7 A;  2E6L A;  1KVC A;  3D45 A;  2YKM A;  3OYD A;  2XO7 A;  3SZ2 A;  1Z26 A;  3PY8 A;  4HCB A;  1J9A A;  2BGG A;  3TAQ A;  2HND A;  4I7F A;  3AO3 A;  3AVN A;  1U04 A;  1D8Y A;  2AJQ A;  1JL1 A;  3T1A A;  4N47 A;  1BIS A;  3AO4 A;  1WAJ A;  2HVH A;  4ICL A;  2W42 A;  3TWH A;  3WNH A;  1JLE A;  2OPS A;  4CJ5 A;  4FJM A;  4DG1 A;  1VSE A;  3O4Q A;  4DU1 A;  1YTU A;  3VQQ A;  4E3S A;  1R0A A;  4FJN A;  4W5N A;  4W5O A;  4E7J A;  4HUF A;  4CK2 A;  1WLJ A;  3EYZ A;  3ASM A;  4FM1 A;  1DTT A;  4XIU A;  1QSL A;  3KTQ A;  2JGU A;  4M3X A;  1SL1 A;  3MEG A;  4DMN A;  3TAN A;  2HHT A;  4E7I A;  1IKV A;  3CM6 A;  3VQA A;  4CJT A;  3ZSX A;  4F3O A;  3OYG A;  4I2P A;  4BAC A;  3QER A;  1NK7 A;  2B6A A;  1C1C A;  4IBN A;  3PUF A;  3DLK A;  5J2Q A;  4FJI A;  4RG8 A;  3LP1 A;  3DLH A;  4J2B A;  3L3U A;  3G10 A;  4QOZ B;  4FZX C;  4DFK A;  1N5Y A;  3CQ8 A;  3P83 D;  1C6V A;  3NF8 A;  4HUE A;  1T05 A;  1WAF A;  2B4J A;  3NE6 A;  3V9W A;  1D9D A;  3ZSV A;  1TGO A;  4CF1 A;  1VRT A;  2EX3 A;  2IGI A;  3H08 A;  3VQC A;  4CJL A;  4CJK A;  2DTU A;  3NAE A;  3P5J A;  2DFH A;  4DS4 A;  1S9E A;  4CJW A;  1TVR A;  3TAB A;  1REV A;  2KW4 A;  4OKE A;  3SQ4 A;  3RMB A;  4RW6 A;  4CCH A;  4FJ9 A;  1IKX A;  3VQP A;  1TKZ A;  2G8K A;  2QKK A;  1QSS A;  3RMC A;  3RMA A;  3RR7 A;  3AVJ A;  2DFE A;  2G8H A;  4W5T A;  4G1Q A;  3TAR A;  1S1W A;  3ZT3 A;  3G0Z A;  1LW2 A;  1XI1 A;  4BDY A;  3O3G A;  4FZZ A;  2F96 A;  4NYF A;  4C8N A;  4AHR A;  4CJE A;  3HJF A;  3AVH A;  4Y1C A;  1Y97 A;  2HHW A;  1S1T A;  2P1J A;  4LH5 A;  3V1O A;  4GMJ B;  4KHS A;  4CF9 A;  5CZ1 A;  4OPK A;  3AVC A;  1ZBU A;  4E1M A;  1W9H A;  3THV A;  4OGE A;  3VQB A;  4FLY A;  1NK8 A;  1B92 A;  3VQE A;  2E6M A;  2QXF A;  3ZCM A;  1ZBL A;  4E89 A;  4CHO A;  1T7P A;  2QK9 A;  3OS2 A;  1NJX A;  3PX0 A;  1GOA A;  1JLG A;  3SUO A;  2JLE A;  1RBV A;  3HPO A;  5KRT A;  1VSM A;  1NJY A;  3AVA A;  1KRP A;  1IO2 A;  4DSE A;  3NGY A;  4DFJ A;  1L3U A;  5C24 A;  1JLC A;  4GW6 A;  5SWM A;  1LW0 A;  2E4L A;  3DYA A;  2FC0 A;  4FLT A;  4DTN A;  1U45 A;  4ID1 A;  3HST B;  3VQ7 A;  3KLE A;  1KLM A;  3ZSR A;  4CJ4 A;  1T03 A;  4Y1D A;  1CXQ A;  4EZ6 A;  5KRS A;  3LAM A;  3AVG A;  4JRQ A;  2P51 A;  1UWB A;  2VG6 A;  3E01 A;  4F4K A;  3MEC A;  4FW1 A;  3VQ8 A;  1BIZ A;  1NK0 A;  4F2R A;  1XHZ A;  4CGG A;  4OKK A;  3SQ1 A;  4DQP A;  1X9M A;  2OYQ A;  3PO4 A;  3QIP A;  5K14 A;  4KHW A;  3V4I A;  1LV5 A;  5D3G A;  3OYB A;  3LP2 A;  3ZSZ A;  2X6S A;  4N5S A;  2Z1J A;  3KLH A;  2D5R A;  4LH4 A;  4CFD A;  3OYF A;  1HYV A;  1TL1 A;  4I9L A;  3LZI A;  3JYT A;  1HRH A;  1BQM A;  4M3Y A;  3I8D A;  1HQU A;  4DTO A;  2GV9 A;  5HRO A;  1D5A A;  3DOL A;  3PO5 A;  1UA0 A;  4E0D A;  1LAW A;  1HNI A;  3V81 A;  1NKE A;  4IKF A;  2BAN A;  1ZYQ A;  4CF0 A;  1RDD A;  1RT6 A;  4O4G A;  2YNF A;  5CYM A;  4AHS A;  4EP5 A;  2VWJ A;  4BWM A;  3SJJ A;  2HHQ A;  1BL3 A;  1ASV A;  3SNN A;  5SZT A;  4C8O A;  3DOK A;  4B08 A;  1NK9 A;  2IAJ A;  3QIO A;  4DQS A;  3V9X A;  4B9N A;  3VQ5 A;  1HYS A;  1RBT A;  1B9F A;  1JLF A;  2B5J A;  3ISN C;  3NFA A;  3IRX A;  4FJJ A;  4OJR A;  4KHQ A;  1J54 A;  4CHN A;  2D0A A;  2QKB A;  4HTU A;  5CZ2 A;  4KAZ A;  3NF7 A;  4DF4 A;  4JS5 A;  3MXI A;  3MAQ A;  1GOC A;  1BI4 B;  1BQN A;  3LAK A;  4CE9 A;  4N56 A;  4M45 A;  3RRG A;  4F8R A;  2PYL A;  1SKR A;  2PY5 A;  2PZS A;  2IDO A;  3S3O A;  1WNS A;  3C6T A;  1LWC A;  3HL8 A;  2OZS A;  4CGJ A;  1KFS A;  1LAV A;  4C8K A;  1TKX A;  4BWJ A;  3RMD A;  2HW3 A;  1Q8I A;  1S5J A;  3SUP A;  1N6Q A;  4DWI A;  4M3T A;  4OKJ A;  1VSH A;  3F9K A;  3B6O A;  4M3Z A;  3NHG A;  4DTJ A;  2WOM A;  3AVM A;  3TAM A;  1HPZ A;  5J2N A;  1U4B A;  4Z4F A;  3ZT1 A;  2HHV A;  2HHS A;  2YHA A;  4E7H A;  1A5V A;  4O55 A;  3SPZ A;  1JKH A;  1Z25 A;  5E41 A;  4FVM A;  3QIN A;  5HRN A;  1RTI A;  5HLF A;  1ZBH A;  3OYN A;  2RN2 A;  3AVK A;  5C25 A;  4CK3 A;  2P5G A;  4W5Q A;  4B9L A;  4ZHR A;  1TAU A;  3MXJ A;  3MEE A;  3ZT4 A;  4CES A;  3EY1 A;  2NUB A;  3WNG A;  4BDZ A;  3V9U A;  2IOC A;  1WSJ A;  1HYZ A;  1WN7 A;  1JLA A;  1NJZ A;  4JLH A;  3B6P A;  3TAP A;  5HBM A;  2PYJ A;  1FXX A;  3C94 A;  1C1A A;  3QET A;  3TAG A;  1RT7 A;  4DU4 A;  2VWK A;  2G8I A;  3V9Z A;  1U48 A;  2FBT A;  5JS1 A;  2XY6 A;  2A1R A;  1VSD A;  1EX4 A;  3ITH A;  3VQ4 A;  3QEP A;  1D9F A;  3L2Q A;  3U6F A;  3JSM A;  3AO5 A;  4YNQ A;  3TAF A;  5CY4 A;  1RBU A;  1QE1 A;  3SQ2 A;  5T7B A;  3V1R A;  3DLR A;  4ID5 A;  1HNV A;  4B8A B;  3RRH A;  4B8C A;  3BDP A;  4F2S A;  3HK2 A;  4WE1 A;  3C6U A;  2IS3 A;  3S3M A;  3OYE A;  3MED A;  4CGI A;  1RDA A;  3ZSW A;  3IS9 A;  3KK1 A;  1CXU A;  1Q9Y A;  2YKN A;  4B9T A;  1KSP A;  4FLW A;  4FW2 A;  3C95 A;  4GVM A;  4M3R A;  3U3G A;  4FK2 A;  4O5B A;  1S6Q A;  2Z1G A;  2ZE2 A;  4O0J A;  4KKO A;  3SV4 A;  1O1W A;  1TK5 A;  4KHU A;  4HVJ A;  4E1N A;  3M8R A;  4M3W A;  1WSE A;  2HB5 A;  4DSL A;  3K2P A;  1S9G A;  4M42 A;  2HHU A;  3L3V A;  4Z4C A;  4NYN A;  4DS5 A;  3AA2 A;  4M3U A;  4Z4I A;  3OYL A;  3SV3 A;  1SKW A;  1DLO A;  4FJL A;  4CJS A;  2XY7 A;  1L5U A;  4I9Q A;  3TR8 A;  3VQ9 A;  3NF6 A;  3O3F A;  4TSX A;  1TKT A;  1KVB A;  5KGW A;  3S3N A;  2OPP A;  3LZJ A;  4J2D A;  4Z4G A;  1IG9 A;  4IDK A;  4KB0 A;  2ETJ A;  3OS1 A;  3NCI A;  1XC9 A;  3SUN A;  3U3Y A;  1WSF A;  3KD1 E;  1S1V A;  1VSI A;  1TKD A;  1RDC A;  3K59 A;  4KI4 A;  1RBS A;  3O4N A;  3NH1 A;  4CFC A;  3K5L A;  4CIG A;  1QSY A;  3DRS A;  4FJ7 A;  1B9D A;  4KHY A;  3K5O A;  1UAX A;  3AVL A;  3KLF A;  4FLZ A;  1RIL A;  4DQQ A;  3KD5 E;  4ELU A;  4OGC A;  3LDS A;  3IAY A;  1QQC A;  4OVL A;  4RW8 A;  2HHX A;  1NKC A;  2G8F A;  3RR8 A;  4RW4 A;  3L2W A;  4ELT A;  1ASU A;  4LSL A;  3LWL A;  4LY7 A;  4CER A;  2HNZ A;  1RTD A;  3EZ5 A;  2ITG A;  2D0C A;  2Z1H A;  1L3V A;  3O3H A;  1S6P A;  2YV0 X;  3NH0 A;  3L2V A;  3KIO A;  1EET A;  3DRR A;  4O0I A;  1ITG A;  4RW7 A;  2XY8 A;  5KI6 A;  4FLX A;  1LWF A;  3MXM A;  3S9H A;  3NGI A;  1I3A A;  3VN5 A;  5I42 A;  4FJK A;  2XRI A;  1J5O A;  1RT4 A;  3HP9 A;  4DSK A;  4CF2 A;  1GOB A;  4C8L A;  3SQ0 A;  3HXM A;  2ZD1 A;  1RDB A;  1YTA A; 
#chains in the Genus database with same CATH topology
 2CGL A;  4FYD A;  4FJ8 A;  2PFU A;  4FWQ A;  4E19 A;  3HO1 A;  1WSG A;  3CFO A;  3HBT A;  4DQR A;  2QWM A;  4O8U A;  2X74 A;  4KPY A;  4C8M A;  2Y1J A;  1Q9X A;  3H1Q A;  1XHX A;  4CF8 A;  3HVR A;  1SKS A;  3LPU A;  3GOI A;  2A1S A;  3DM2 A;  3LDO A;  4DFP A;  3HM9 A;  3R6M A;  5JS2 A;  4BC3 A;  3VEY A;  3WNF A;  4G9Z A;  4LSN A;  1BIU A;  3QLH A;  2NNW A;  3RWU A;  3SYZ A;  3FFK B;  3ZET A;  2YJE A;  2FBV A;  4BR9 A;  4B1Z A;  1RTJ A;  1HJR A;  1JLB A;  4A61 A;  4FK0 A;  1X9W A;  3M5R A;  5I9E B;  3K57 A;  2YI1 A;  2Q1N A;  3M8P A;  2YHW A;  4AIL C;  3ZLJ A;  3OVN A;  1NK5 A;  3HP6 A;  1FKP A;  3SJH A;  1BA1 A;  4FLU A;  2I7P A;  1G15 A;  1Q86 O;  2Z1I A;  4IOA L;  2CH5 A;  2I5J A;  4JRP A;  2UUC K;  4XH4 A;  4YDU C;  3J7Y P;  3AAP A;  3QO9 A;  4KTQ A;  2PBD A;  3P1G A;  4DF8 A;  1NOY A;  2QWL A;  4CEE A;  4CIF A;  1NKB A;  3VER A;  1W7A A;  1BCO A;  4BRP A;  3JS6 A;  2E88 A;  1ZXO A;  2CGK A;  4DR3 K;  4FJH A;  1C0M A;  4PKI A;  4DTP A;  4J2A A;  5AQT A;  4LFB K;  1SZ2 A;  3W3D A;  5FLX O;  3CXC M;  3AA4 A;  3AVI A;  1C1B A;  1F21 A;  2FSN A;  2G8W A;  1YUW A;  4KTZ A;  4O44 A;  1DTQ A;  1XUP O;  2IVP A;  4CZG A;  2OTJ N;  1SV5 A;  3K58 A;  4U67 L;  4X64 K;  2YHB A;  3CG7 A;  4AHC A;  4KB1 A;  2QTD A;  3HT3 A;  4KHN A;  3SLC A;  3V6D A;  2NRR A;  1X9S A;  2YNI A;  4H4M A;  2NRH A;  4CFA A;  1CZA N;  2D4W A;  1NK6 A;  4FLV A;  4B1X B;  3VEZ A;  4JAX A;  2X78 A;  4H0P A;  2O8C B;  4YOW A;  3AO1 A;  3NGZ A;  5KQD A;  2KFN A;  1JXE A;  4K8Z A;  1SL2 A;  4HCC A;  4H8K A;  3QFU A;  2KTQ A;  1TK8 A;  2BDP A;  1K8K B;  3QDK A;  2UUB K;  2D1K A;  2V51 B;  3OYM A;  5M1Q A;  1IBK K;  1RT2 A;  2GEM A;  3QNO A;  2OPQ A;  3RTV A;  2Q3S A;  4DSJ A;  5JVG L;  4DLG A;  3OJS A;  5BN8 A;  2OAN A;  4WYB A;  2QWN A;  4JKG B;  4PQU A;  5BPM A;  3KK2 A;  4OLB A;  2O4I A;  1N32 K;  3FZF A;  5AZJ A;  4U7B A;  3L2U A;  3K5M A;  3NDK A;  4B1V A;  3KKS A;  2DFF A;  4YOU A;  4DTS A;  3OYI A;  1VHX A;  3O80 A;  3LP0 A;  2DY4 A;  2OA8 A;  3E66 A;  4QS8 A;  4DFM A;  4DR4 K;  4JI0 K;  1IH7 A;  4BRD A;  2XO7 A;  4C1N I;  5GAG P;  1YIT N;  4E1J A;  4I7F A;  4FOE A;  3THW B;  4JEP A;  2HF3 A;  3OA9 A;  4ICL A;  1WBD A;  3TWH A;  4CJ5 A;  4YOT A;  3O4Q A;  2O8D B;  4DU1 A;  4W5O A;  4CK2 A;  3EYZ A;  3ASM A;  1DT9 A;  5BRF A;  4XIU A;  3P39 A;  3VGL A;  5FPE A;  4M3X A;  4DMN A;  3TAN A;  4JK8 A;  1K8A O;  4IZ9 A;  4BR5 A;  4CJT A;  3ZSX A;  1IJJ A;  4BAC A;  1P8Z A;  5BRD A;  2B6A A;  4CZJ A;  3PUF A;  3CMA N;  4QS9 A;  1VQM N;  4JI7 K;  3CQ8 A;  3P83 D;  1OH7 A;  1VQ6 N;  1WAF A;  5AQN A;  4BR4 A;  3BY5 A;  4CF1 A;  2DTU A;  4XH5 A;  1NMN A;  5BR8 K;  3FZH A;  2DFH A;  1JJ2 M;  1VQP N;  4DS4 A;  4FVU A;  1HNX K;  2KW4 A;  3RMB A;  4FJ9 A;  4CCH A;  1IKX A;  3VQP A;  2QKK A;  2HMP A;  1C0G A;  1WBB A;  2F9W A;  2DFE A;  3LDP A;  4G1Q A;  1S1W A;  1ATN A;  1XI1 A;  3O3G A;  4FZZ A;  3WT0 A;  4MLH A;  4AHR A;  3DLL L;  1KAY A;  1YAG A;  1QQN A;  3AVH A;  1Y97 A;  1S1T A;  3TSQ A;  1WB9 A;  3ZX3 A;  1NMD A;  3THV A;  3VQB A;  2YCH A;  1B92 A;  1ZBL A;  4E89 A;  3WEE B;  1T44 A;  4PHT X;  5KRT A;  1VSM A;  5AFU H;  1XMQ K;  3O5B A;  4DSE A;  4DFJ A;  4FLT A;  2FC0 A;  3VQ7 A;  1T03 A;  1CXQ A;  3LAM A;  2P51 A;  3MWT A;  2NRT A;  1NK0 A;  4F2R A;  3SAH A;  1X9M A;  2OYQ A;  3VF4 A;  3V4I A;  4JI2 K;  2Z1J A;  2VCP A;  3KLH A;  3LZI A;  4LH4 A;  1HYV A;  4M3Y A;  1HQU A;  2GV9 A;  1YJN N;  4E0D A;  1UA0 A;  1LAW A;  1HNI A;  1N36 K;  3F2K A;  2YNF A;  2VWJ A;  3SJJ A;  1ASV A;  1U2V A;  2AA4 A;  3G25 A;  3LDL A;  3DXK A;  3ATV A;  1HNW K;  5GIO A;  2D0A A;  5LY3 A;  4KAZ A;  4DF4 A;  3AAR A;  3MAQ A;  2FF3 B;  1BQN A;  3LAK A;  2PY5 A;  2IDO A;  1WNS A;  1VQ7 N;  1LWC A;  2OZS A;  1LAV A;  1Q8I A;  4M3T A;  3SUP A;  3C65 A;  3F9K A;  3TAM A;  2HHS A;  5AQK A;  2YHA A;  4NXN K;  3IUC A;  3OYN A;  1FW6 A;  2GEL A;  3ZT4 A;  4B1U B;  5ADX A;  2NUB A;  2H3G X;  1NGE A;  3C7N A;  4FSV A;  4JLH A;  3TAP A;  5HBM A;  2W6L A;  3THX A;  1U48 A;  3L2Q A;  4YNQ A;  5CY4 A;  4GY2 B;  4B1W B;  4B8A B;  3HK2 A;  4LF7 K;  3FR0 A;  4CD1 A;  1CXU A;  2ZF5 O;  1Q7Y O;  3CPW M;  3TTF A;  3U3G A;  1K9M O;  1TUU A;  2ZE2 A;  2Z1G A;  1MA9 B;  3SV4 A;  4XH1 A;  2HF4 A;  5AQM A;  1DKG D;  2YJF A;  3N4Q A;  1S9G A;  3G6E N;  4Z4I A;  4BRG A;  3OYL A;  3DXM A;  1SKW A;  2XY7 A;  4I9Q A;  4TSX A;  4Z4G A;  5C10 A;  2O8B B;  4J2D A;  3VTI A;  1S22 A;  2ETJ A;  3OS1 A;  3VEV A;  3SUN A;  4Z94 A;  3U3Y A;  1WSF A;  1S1V A;  4KI4 A;  2WFB A;  1B9D A;  1YIJ N;  1UAX A;  3AVL A;  4KBO A;  4DQQ A;  2NLX A;  3KD5 E;  4LSL A;  1YXQ A;  4LY7 A;  2FF6 A;  3ZEU B;  2ITG A;  2P9N B;  4H5W A;  3F9M A;  4A62 A;  3H45 C;  4WQ4 A;  3DRR A;  5DM6 L;  1J6Z A;  3QML A;  2PAV A;  4WCE L;  4GNI A;  3VN5 A;  4BRA A;  4IFE A;  3B8A X;  1HKG A;  4AF1 A;  3D2E A;  4NO7 A;  4FCY A;  3ZX0 A;  4J8F A;  3SBT A;  1BA0 A;  4IO8 A;  1X1P A;  3PX6 A;  4E7K A;  2Q2R A;  3BEX A;  5M1N A;  4B9U A;  3SPY A;  4CFB A;  3P38 A;  4CED A;  1TYQ B;  1S3X A;  3PLA A;  2F4V K;  2VQF K;  2KZZ A;  2FSJ A;  1GLJ O;  2XHB A;  3SAG A;  1M90 O;  3SCX A;  2BE2 A;  4LFA K;  1IKY A;  3TSU A;  3PV8 A;  2P9K B;  1HNZ K;  4ISE A;  3H6E A;  3OY9 A;  3OJU A;  3QEW A;  1QVF M;  4FWO A;  1MU2 A;  1M1K O;  5AQX A;  1NGD A;  3CCM N;  1VQ4 N;  4A5B A;  1VSL A;  1WSI A;  1T8E A;  1RT1 A;  2ATQ A;  5LMU K;  2P9L B;  4F9O A;  3T3F A;  4WQ5 C;  3DLB A;  3CME N;  4BC2 A;  1NNE A;  3TTC A;  4W5R A;  4N41 A;  4IG3 A;  4JS4 A;  3KLG A;  5I3U A;  3WXM B;  4AHU A;  4CJU A;  1EKE A;  4JI5 K;  4JI6 K;  5AQU A;  3QEX A;  4CEO A;  4LF9 K;  1L3S A;  1RCH A;  5BR9 A;  3CCL N;  1IV0 A;  5KPT A;  2EHG A;  1WSH A;  1N33 K;  4K43 A;  3PX4 A;  3KK7 A;  3LAN A;  2XY5 A;  4CHZ A;  3GBT A;  4Y0W A;  2OPR A;  4CJ7 A;  3M3Z A;  1YT3 A;  4FM0 A;  3D0P A;  4WQ4 C;  5EX5 A;  1BUP A;  3LM9 A;  4EHT A;  1S1U A;  3HVT A;  1QHA A;  3D2F A;  5JIC A;  1BCM A;  3UKU B;  1KCF A;  5KPR A;  1VRU A;  4HHT A;  2NRW A;  3BZK A;  3W0L A;  4AQY K;  4H5V A;  3OYH A;  4DV4 K;  4IFV A;  3E9O A;  5AQI A;  2QA4 N;  3WXI A;  4DTX A;  3FZL A;  4C23 A;  4B9V A;  4OLA A;  4DTU A;  2G8V A;  1HUX A;  5LL6 Z;  4CEA A;  5J2M A;  4MO5 A;  4LF6 K;  2FXU A;  4CJR A;  4PWD A;  2ZQB A;  3L8B A;  3ZSO A;  2V7Z A;  4FK4 A;  4K25 A;  4PKH A;  1SL0 A;  3O9S A;  3ZET B;  3BUZ B;  1YJ9 N;  3CFR A;  4B3T K;  3DI6 A;  3J7A P;  3L0Q A;  2KZM A;  2F8T A;  5JLH A;  2P5O A;  3C6A A;  5GAD P;  3LM2 A;  4KRE A;  1NOZ A;  3K9J A;  5GIP A;  1HPM A;  2HHH K;  3M8S A;  1BWF O;  3A2F A;  4FZY A;  3ULE A;  3ZT2 A;  3EE9 A;  4ZTJ A;  3F73 A;  3LPT A;  3EE8 A;  1FKO A;  1CLQ A;  3VA0 A;  2O8F B;  3BGR A;  5AR0 A;  4MQ3 A;  4OO1 J;  3KJV A;  3CCV N;  3CM5 A;  4EAH D;  2KFZ A;  4I2Q A;  2FBY A;  3FE1 A;  2KQ2 A;  4EZ9 A;  4JKD A;  4EP4 A;  1U47 A;  3AV9 A;  3QB0 A;  1YJW N;  3M8Q A;  4CHP A;  4LD0 A;  4CEC A;  4CEF A;  4DSF A;  4FJX A;  2HBJ A;  2ASP A;  4DKW A;  4BGB A;  2KLA A;  1BO5 O;  3VA3 A;  1VQ5 N;  5AQQ A;  2ASM A;  4FM2 A;  4AHV A;  4CBW A;  1A5W A;  1KVA A;  3VF2 A;  1KFD A;  3CYM A;  1QHT A;  1HLU A;  3UKR A;  1HX1 A;  4M7Y A;  3D6R A;  2NRV A;  4BR2 A;  4JKB A;  3O4W A;  1TL3 A;  1SQK A;  2YKM A;  4HCB A;  1Z26 A;  3PY8 A;  2BGG A;  3TAQ A;  2HND A;  3AO3 A;  1U04 A;  3I8B A;  1JL1 A;  4GKK K;  4I6M B;  3AO4 A;  1WAJ A;  1IBL K;  3AGK A;  4FJM A;  1YTU A;  3THY B;  1R0A A;  3MK6 A;  4HUF A;  4ILH A;  5BPN A;  1DTT A;  1QSL A;  3KTQ A;  2JGU A;  1SL1 A;  4XEI A;  4E7I A;  3CM6 A;  3VQA A;  1E4G T;  3DLK A;  4FJI A;  4RG8 A;  5GAH P;  4CBU A;  1Q82 O;  1D9D A;  3H08 A;  3NAE A;  4NLC A;  3P5J A;  4FWS A;  2EWS A;  2E2Q A;  2E1Z A;  1TVR A;  4LF8 K;  3SQ4 A;  1MWM A;  1TKZ A;  3MX2 A;  3I55 N;  3RMC A;  1VQL N;  4BG8 A;  3RR7 A;  3I33 A;  1NGJ A;  3TAR A;  2CH6 A;  3G0Z A;  2QWQ A;  1LW2 A;  1KAZ A;  4BDY A;  2F96 A;  4C8N A;  3Q7C A;  3JXU A;  3HJF A;  4Y1C A;  2HHW A;  2W41 A;  3RSE B;  3CPE A;  1VQ8 N;  4CF9 A;  4YOR A;  5CZ1 A;  3AVC A;  1ZBU A;  4OPK A;  1W9H A;  4ISF A;  4YOX A;  3A0I X;  3WUH A;  3ENO A;  1NJX A;  3VES A;  4GKJ K;  3F5T A;  1NJI O;  3NMU A;  2QWP A;  2A42 A;  3HPO A;  1NJY A;  3AVA A;  1XMO K;  2BTF A;  1L3U A;  1JLC A;  5BRE A;  2E4L A;  4DTN A;  1U45 A;  1HR0 K;  4H5R A;  3KLE A;  1KLM A;  3ZSR A;  3FZK A;  3HSC A;  3HTV A;  4JRQ A;  2VG6 A;  4F4K A;  5MLC Q;  3MX5 A;  1KD1 O;  2WTU A;  3VEO A;  4OKK A;  4DHY A;  4DQP A;  3QIP A;  5IT9 O;  3MN9 A;  1LV5 A;  5D3G A;  3ZSZ A;  4OX9 K;  2X6S A;  3K9K A;  1OH8 A;  2D5R A;  3OYF A;  5C12 A;  1TL1 A;  3JYT A;  3I8D A;  4DTO A;  1D5A A;  2AJQ A;  1NKE A;  5B8H A;  1BU6 O;  4CF0 A;  1RDD A;  1RT6 A;  3C6H A;  4EP5 A;  5CR4 A;  2HHQ A;  4C8O A;  4B08 A;  4IO9 L;  2IAJ A;  3U9D A;  4DQS A;  5AQZ A;  3VQ5 A;  1HYS A;  1NU0 A;  1RBT A;  3ISN C;  1JLF A;  2B5J A;  3NFA A;  4FPB A;  4OJR A;  1J54 A;  4CHN A;  4HTU A;  3EO3 A;  1X9J A;  2WC9 A;  5CHI A;  3CCS N;  1BI4 B;  4N56 A;  4M45 A;  4BRQ A;  3QBX A;  4CZH A;  4F8R A;  1GLD G;  3MCP A;  2PZS A;  4KH6 A;  3S3O A;  3C6T A;  2HOE A;  5C0Y A;  4CGJ A;  4LC9 B;  4BWJ A;  2HW3 A;  4PL8 A;  1BG3 A;  4DWI A;  4OKJ A;  1VSH A;  1RGI A;  3NHG A;  4DTJ A;  3JAM O;  3R8E A;  4DR1 K;  1JKH A;  1Z25 A;  3QIN A;  5HLF A;  2QWR A;  4H5T A;  1ZC6 A;  1TAU A;  3VGM A;  1HYZ A;  1JLA A;  3T1Y K;  4B3M K;  2PYJ A;  5EY4 A;  5BN9 A;  4NLB A;  3TAG A;  2G8I A;  4JKF A;  2FBT A;  5JS1 A;  1VSD A;  3VQ4 A;  1QQM A;  1K8K A;  5EXW A;  4FWL A;  3CJ7 A;  5AQP A;  3LDQ A;  4B8C A;  2IS3 A;  3OYE A;  3ENB A;  5M1F A;  3KK1 A;  4H0Y B;  2E2O A;  4K0K K;  2KKZ A;  1KSP A;  4JI4 K;  4FK2 A;  4O5B A;  3MN5 A;  4BVP A;  2HB5 A;  5F0X A;  5F2R A;  4DSL A;  5JLF A;  4M42 A;  2HHU A;  3L3V A;  4DS5 A;  3AA2 A;  4WF9 L;  4M3U A;  2BH1 A;  4BY9 C;  4CJS A;  1NLV A;  1L5U A;  3VQ9 A;  3LZJ A;  4IDK A;  2A5X A;  2NRZ A;  4NXM K;  3CHW A;  3WXL A;  3A5O C;  3NCI A;  2O8E B;  1I94 K;  3K59 A;  1JCG A;  1RBS A;  3NH1 A;  4CFC A;  4B3R K;  4FJ7 A;  4JK9 A;  1KC8 O;  3KLF A;  1KQS M;  4B1Y B;  4OGC A;  3HZ6 A;  2HHX A;  3RR8 A;  3L2W A;  3THW A;  3EEQ A;  1RTD A;  4QS7 A;  3U4L A;  2D0C A;  3EKU A;  1L3V A;  3O3H A;  1S6P A;  5KPZ A;  3OW2 M;  3BF3 A;  3KIO A;  3DAW A;  1EET A;  2P9I B;  5AQJ A;  5TKY A;  4O0I A;  5KI6 A;  4BR0 A;  1LWF A;  3NGI A;  5I42 A;  4FJK A;  1J5O A;  1RT4 A;  1HJO A;  4DV0 K;  3AY9 A;  3TU5 A;  2ZD1 A;  4L3Q A;  1YTA A;  2YNH A;  5A2Q O;  2IC3 A;  1SUQ A;  4DV5 K;  3G4S N;  3MDQ A;  2RKI A;  4CEB A;  3VOV A;  3OS0 A;  4CGH A;  5AFU A;  1EP4 A;  2GUP A;  4L8R B;  4A5A A;  3M1F A;  4X62 K;  3NF9 A;  5JVH L;  4A57 A;  3HM8 A;  3HOS A;  4DLE A;  4FWK A;  3QNN A;  1O13 A;  1CZB A;  1T6D A;  3VEN A;  4YFU A;  4DV3 K;  3S41 A;  3K5N A;  4CJV A;  1NK4 A;  3CJA A;  4IXC A;  3CD6 N;  4FJ5 A;  4F3T A;  3QEV A;  1K6Y A;  1IBM K;  4DR5 K;  1RT3 A;  4CZL A;  2WUS A;  3FZM A;  4DQ8 A;  4CEZ A;  4CIE A;  4H0V B;  4IEI A;  2YHY A;  3CC2 N;  3HYF A;  2GWJ A;  2ZGY A;  4EHU A;  1VQ9 N;  5BRH A;  4IFY A;  5LJW A;  3OBY A;  4LF5 K;  4CK1 A;  3ALY A;  3VQ6 A;  4FWM A;  4RW9 A;  3WNE A;  4FJG A;  2FBX A;  4B3S K;  1ZBF A;  2R7Y A;  4BR7 A;  4GV6 A;  1RTH A;  4E7L A;  4BE0 A;  4ILJ A;  4DSI A;  5FPD A;  4HUG A;  3OYJ A;  3UIQ A;  3AVF A;  4ELV A;  4K8X A;  4QCL A;  1HMV A;  3SUQ A;  1XNQ K;  4B9M A;  3CFP A;  3AA5 X;  2GX9 A;  2ZGZ A;  1N8R O;  1GLC G;  5HRS A;  1KTQ A;  3D7E O;  2DPN A;  2ZJQ L;  2O4G A;  1FK9 A;  1VK0 A;  5GIN A;  4BRF A;  1BOT O;  1RNH A;  4KRF A;  4C1N K;  1Q81 O;  2A41 A;  4A2A A;  3HPH A;  4PY5 A;  2OTL N;  5AQW A;  1KLN A;  2ITM A;  4N76 A;  5C2F A;  3ULD A;  4NCG A;  5CE3 A;  4JHD B;  4CBX A;  1W0H A;  1A5X A;  3M6G A;  3I0S A;  4H0X B;  5AQS A;  3DLE A;  3BZC A;  4BE1 A;  4NCB A;  4DTM A;  5AJ3 K;  5HRP A;  4BRO A;  1DGK N;  3QES A;  1HKB A;  4GVE A;  5HRR A;  4EIA A;  1NJW A;  2WBN A;  3ID8 A;  2V7Y A;  1VQN N;  2Y1I A;  4MDA A;  2RE2 A;  3AO2 A;  3SMS A;  5EVZ A;  5FDL A;  1W2B M;  1L3T A;  3L6Q A;  4CJF A;  5EU7 A;  2WON A;  4NCA A;  3AVB A;  3H1V X;  4FXD A;  4IOX A;  5FRM A;  2HVI A;  4CJ3 A;  4DQI A;  3DMJ A;  1GLE G;  5HP1 A;  2UXC K;  1QQO A;  1I39 A;  1U49 A;  3O9T A;  3EKS A;  3CI5 A;  4Z4H A;  1K73 O;  2YX6 A;  5C15 A;  3ZSY A;  2VWB A;  5J2P A;  1VSJ A;  3E9L A;  4CJQ A;  4ZTF A;  3OYC A;  3A5L C;  4Z4E A;  4Q0B A;  5DK5 A;  5JMV A;  1XNR K;  1JCE A;  4BE2 A;  4FWP A;  2V52 B;  1SAZ A;  4OPH A;  4B9S A;  3U8X A;  1S72 N;  3OYD A;  5TKW A;  3D45 A;  1NGH A;  2O8B A;  3SZ2 A;  1J9A A;  3KZB A;  1D8Y A;  4N47 A;  1BIS A;  5AQR A;  1U6Z A;  2HVH A;  4WFB L;  2W42 A;  3WNH A;  5AQV A;  2OPS A;  4BRI A;  1VSE A;  4W5N A;  3VQQ A;  5LMN K;  4E3S A;  4FJN A;  2W6K A;  5FPM A;  3ULE B;  4YY3 K;  3O1B A;  3MEG A;  4YOV A;  3MCA B;  2HHT A;  1V4T A;  1Z6R A;  4DV6 K;  3QER A;  3ZEU A;  1NK7 A;  1C1C A;  4IBN A;  3J7Z O;  3CQX A;  4J2B A;  3DLH A;  2P9U A;  3L3U A;  3G10 A;  4QOZ B;  3CET A;  1N5Y A;  2P9S A;  4HUE A;  2D0O A;  1T05 A;  3NE6 A;  3V9W A;  3OHR A;  3VEW A;  4AM6 A;  2E8A A;  1TGO A;  3ZSV A;  1VRT A;  2IGI A;  4CJL A;  4IJN A;  1S9E A;  1Y64 A;  5H1S Q;  3TAB A;  1REV A;  4OKE A;  2QXL A;  4BC4 A;  1R59 O;  2G8K A;  3NVM A;  4JD2 A;  5M1K A;  3RMA A;  4UY8 O;  2G8H A;  3IMX A;  1EO1 A;  1W97 L;  1WUA A;  3VET A;  1TYQ A;  3QBW A;  3UKR B;  2P1J A;  3V1O A;  4GMJ B;  3CC4 N;  4E1M A;  4CZE A;  3TPQ A;  1Q18 A;  1NK8 A;  3VQE A;  3ZCM A;  4CHO A;  3PX0 A;  1GOA A;  1JLG A;  3SUO A;  5AZI A;  3CF5 L;  3ID6 A;  1IO2 A;  5C24 A;  5SWM A;  2P9L A;  4FO0 A;  3R9P A;  4Y1D A;  4EZ6 A;  4X66 K;  3RVC A;  1BIZ A;  1XHZ A;  4CGG A;  4FPA A;  4JK7 A;  5K14 A;  4KHW A;  3LP2 A;  4N5S A;  2UYT A;  4PKG A;  1NGB A;  4DV1 K;  4I9L A;  4JKA A;  1HRH A;  4CZM A;  5HRO A;  3PO5 A;  3V81 A;  2OCE A;  4O4G A;  5CYM A;  4AHS A;  4CW7 B;  4BWM A;  4NB4 A;  3SNN A;  2Q97 A;  5SZT A;  3DOK A;  1NK9 A;  3QIO A;  2HST A;  4BRM A;  1B9F A;  4LF4 K;  3UKU A;  5M1O A;  4KH5 A;  1OH5 A;  5CZ2 A;  4JS5 A;  3MXI A;  1T3V A;  4CZF A;  3CCQ N;  1GOC A;  1H1V A;  3CIP A;  4JN4 A;  1OVY A;  3CJ1 A;  3AGR A;  3RRG A;  2PYL A;  4IDH A;  4CD3 A;  3HL8 A;  2VGN A;  3EZW A;  3MN6 A;  3RMD A;  4JYA K;  1NGI A;  4RWT A;  3U9Z A;  1DEJ A;  3HOT A;  3AVM A;  1U4B A;  1HPZ A;  2HHV A;  1A5V A;  4O55 A;  2QI2 A;  3SPZ A;  5E41 A;  5AQF A;  4FVM A;  5HRN A;  1RTI A;  2Q0U A;  3R3L A;  3VF6 A;  3AVK A;  4OPA A;  1ATR A;  5C25 A;  4CK3 A;  4W5Q A;  4ZHR A;  5HOO A;  3H3N O;  3MEE A;  2HBL A;  4BDZ A;  4BGA A;  3J81 O;  4M7X A;  2IOC A;  1WSJ A;  3V9U A;  1NJZ A;  4ISG A;  3O6W A;  1NM1 A;  3B6P A;  2A6A A;  2JWK A;  3QET A;  4GV3 A;  1RT7 A;  4DU4 A;  2VWK A;  3V9Z A;  2D0P A;  2P9P A;  3O08 A;  2A1R A;  1EX4 A;  4CVN E;  1D9F A;  1RBU A;  5T7B A;  3V1R A;  1HKC A;  1HNV A;  3BDP A;  2O8F A;  2QM1 A;  3C6U A;  2Q31 A;  3AAQ A;  3O9R A;  2UU9 K;  3MED A;  1RDA A;  3ZSW A;  3IS9 A;  3CER A;  5AZJ B;  2E1Y A;  3KWI A;  4FLW A;  4M3R A;  1G99 A;  5LJV A;  4IEE A;  2QEX N;  4KKO A;  1O1W A;  3ZYY X;  4E1N A;  3M8R A;  3MWP A;  5ELZ A;  1WSE A;  3K2P A;  4RCH A;  4Z4C A;  3SV3 A;  1DLO A;  3CJC A;  3TR8 A;  3O3F A;  1TKT A;  1IG9 A;  1XC9 A;  3OBW A;  3KD1 E;  1TKD A;  1RDC A;  3EN9 A;  1NG9 A;  3O4N A;  3CJB A;  3K5O A;  2NRX A;  3LDN A;  1V4S A;  4FLZ A;  4BQL A;  1SS6 A;  4ELU A;  4OVL A;  3WXK A;  3I56 N;  4RW4 A;  2W40 A;  4ELT A;  1ASU A;  4I6M A;  2HNZ A;  3EZ5 A;  4BRC A;  4BRL A;  2Z1H A;  5AQG A;  3THY A;  3CCU N;  4O8K A;  2YV0 X;  3NH0 A;  3L2V A;  4FLX A;  3S9H A;  2RHK A;  1I3A A;  3HP9 A;  4DSK A;  4CF2 A;  1GOB A;  4C8L A;  3SQ0 A;  3HXM A;  3MMV A;  3V1Q A;  4CJP A;  1LWE A;  4MFB A;  3A8Y A;  2YNG A;  5FRO A;  1T6C A;  2Q36 A;  4BC5 A;  4DTR A;  2GBZ A;  3Q7B A;  1ASW A;  3VGK A;  2HMI A;  3EL2 A;  3ZX2 A;  3O8M A;  3P4I A;  1ZBI A;  1C0U A;  1JXB A;  1YVU A;  2IVN A;  1MWK A;  1C0T A;  3H3O B;  4DUZ K;  2HBK A;  2E2N A;  4QAG A;  3NH2 A;  1VSK A;  4CHY A;  1RFQ A;  1MDU B;  3KLI A;  2HBM A;  4UQG A;  3OYA A;  3NVK A;  4CHQ A;  4Z0U A;  3SMP A;  1YI2 N;  3V9S A;  3AA3 A;  3VEX A;  3RSE A;  4CI6 A;  2VGM A;  4AH9 A;  5CYQ A;  4BG9 A;  4KO0 A;  3TAE A;  4IG0 A;  4BQZ A;  5M1P A;  4MO4 A;  1JL2 A;  4EFH A;  3DLG A;  1RBR A;  4R5P A;  2KHO A;  4KTW A;  2O8C A;  4JKC A;  4M63 C;  5BPL A;  4CGD A;  1CZ9 A;  3NBP A;  2F7T A;  3QFP A;  2E5L K;  1OKJ A;  2HNY A;  4MDB A;  2X6N A;  3SBG A;  2VYP A;  1VSF A;  3L2R A;  3KKR A;  3FGU A;  3OYK A;  4JI1 K;  2GUI A;  2ZJP L;  1IKW A;  2UUA K;  4B3O A;  1QZ6 A;  2RF2 A;  2E20 A;  1U2V B;  3T19 A;  2JWL A;  5C42 A;  1NBW A;  4JKG A;  3DXK B;  1QS4 A;  4M41 A;  2E2P A;  2G8U A;  1S1X A;  1OVQ A;  1NGC A;  3T1H K;  4BDP A;  3KK3 A;  5KGX A;  4KV8 A;  1TAQ A;  2LSN A;  3GL1 A;  2VG5 A;  4HTL A;  3VQD A;  4ILG B;  3TSP A;  4PUO A;  4CEQ A;  3SI6 A;  1UOC A;  4HWI A;  3T7Z A;  4H03 B;  5KTQ A;  3PSF A;  1BGX T;  3BP8 A;  1BI4 A;  2OZM A;  2VG7 A;  3QEI A;  1TV6 A;  2ZJR L;  3LAL A;  2ASO A;  3QIC A;  4IOC L;  4BRN A;  2ZWH A;  3HRG A;  1JLQ A;  1TK0 A;  3C7N B;  2O8D A;  3LP3 A;  2RPI A;  3N4P A;  3G71 N;  2I7N A;  3HPG A;  4YOY A;  3I0R A;  3THX B;  4DV7 K;  4B9Q A;  2VQE K;  4PA1 A;  4KFB A;  1NWK A;  1HQE A;  4AHT A;  3CQY A;  1QTM A;  1WOQ A;  3TTD A;  4OPJ A;  5DMR A;  1EWR A;  1VAZ A;  4WFA L;  1EXQ A;  3P31 A;  1XWL A;  3SAF A;  3ZT0 A;  1RT5 A;  1VQK N;  1BHL A;  2D0B A;  3DRP A;  3WXJ A;  2F8S A;  1NGA A;  4J2E A;  3ZSQ A;  2ZM6 K;  1J5E K;  4LFC K;  4Q5V A;  1FJG K;  1J53 A;  1Z05 A;  3FFI A;  3H46 O;  4KH4 A;  3DXM B;  4H4O A;  4BVO A;  3VMF B;  4JNE A;  2NZT A;  5ADX H;  1UA1 A;  1RDU A;  4DR7 K;  4KI6 A;  5FPN A;  3IFR A;  4BRH A;  4FL9 A;  1VQO N;  1C0F A;  1P90 A;  4A59 A;  1X3N A;  5J1E A;  4JKH A;  3TI0 A;  1NGG A;  3LL3 A;  4DU3 A;  3LWM A;  4CGF A;  3IG1 A;  2E6L A;  1KVC A;  3UB5 A;  2QWO A;  3AVN A;  3WEE A;  3T1A A;  2O8E A;  3FLC O;  5AQH A;  1JLE A;  4YHH K;  4DR6 K;  4DG1 A;  3HI0 A;  3CJ9 A;  3KHY A;  4RTF D;  5F1X A;  4E7J A;  3R1X A;  1WLJ A;  4FM1 A;  1KAX A;  1IKV A;  4F3O A;  3OYG A;  4I2P A;  5E26 A;  5J2Q A;  3LP1 A;  3ENH A;  3D2E B;  4FZX C;  4DFK A;  1EQY A;  1C6V A;  2P9I A;  3NF8 A;  2YHX A;  2B4J A;  2EX3 A;  3VQC A;  4CJK A;  5AQY A;  4IWV A;  1LCU A;  1ILY A;  4CJW A;  4GV9 A;  3DWL A;  4RW6 A;  1LOT B;  3WQU A;  1E4F T;  3WQT A;  1QSS A;  1YF5 L;  3AVJ A;  4W5T A;  1GLL O;  3ZT3 A;  1BDG A;  1XQS C;  3T69 A;  3DJC A;  2GWK A;  4NYF A;  1GLB G;  4CJE A;  2UXD K;  2IVO A;  4LH5 A;  3L4Q A;  1E3M A;  4KHS A;  5EOY A;  2GTD A;  4OGE A;  3IDH A;  4FLY A;  2QK9 A;  2E6M A;  2F9T A;  2QXF A;  4WQ5 A;  1T7P A;  3OS2 A;  4A2B A;  2JLE A;  4WFN L;  1RBV A;  3CCE N;  1KRP A;  3NGY A;  4JV5 K;  4GW6 A;  1LW0 A;  3DYA A;  4ID1 A;  3HST B;  3O1W A;  1ATS A;  4CJ4 A;  5KRS A;  3AVG A;  1UWB A;  3E01 A;  5FRN A;  3MEC A;  4FW1 A;  3VQ8 A;  2P9U B;  4CZI A;  3SQ1 A;  3PO4 A;  3BF1 A;  2P9S B;  3OYB A;  3C0B A;  3J80 O;  3D2F B;  4H5N A;  4CFD A;  1BQM A;  3O9Q A;  3DOL A;  4IKF A;  3KVG A;  2BAN A;  4PL7 A;  1JCF A;  4JKE A;  1ZYQ A;  1BL3 A;  4JD2 B;  1N34 K;  3E9P A;  1XC3 A;  3V9X A;  2IIR A;  4B9N A;  3VPZ A;  4IJA A;  3IRX A;  4FJJ A;  4KHQ A;  2QKB A;  3NF7 A;  1TUY A;  4CE9 A;  3CCR N;  4O5F A;  1SKR A;  4DB3 A;  1ESV A;  4R79 A;  5KQ8 A;  3K0S A;  4DUY K;  1KFS A;  4C8K A;  2AP1 A;  1TKX A;  1S5J A;  1N6Q A;  4V19 S;  1YVN A;  3B6O A;  4CZK A;  4M3Z A;  2WOM A;  5J2N A;  3PSI A;  5AZI B;  4JHD A;  4Z4F A;  3ZT1 A;  4E7H A;  3SK3 A;  4AM7 A;  4FOI A;  4K42 A;  3CC7 N;  3MN7 A;  1ZBH A;  4H0T B;  2RN2 A;  2P5G A;  4B9L A;  3VTH A;  4K41 A;  2P9N A;  3KWG A;  3MXJ A;  4CES A;  3EY1 A;  3WNG A;  1WN7 A;  1GLF O;  1FXX A;  3C94 A;  1C1A A;  4BRE A;  3PIP L;  2XY6 A;  3ITH A;  3QEP A;  3U6F A;  3JSM A;  3AO5 A;  5AQO A;  3TAF A;  1QE1 A;  3SQ2 A;  3DLR A;  4ID5 A;  3RRH A;  2BUP A;  4F2S A;  4JI3 K;  4WE1 A;  1RDW X;  3S3M A;  3E1Y A;  4CGI A;  1Q9Y A;  2YKN A;  3A5N C;  4B9T A;  1OH6 A;  2QW9 A;  4FW2 A;  1QZ5 A;  3C95 A;  1EWQ A;  4GVM A;  5AQL A;  1ZBS A;  1S6Q A;  4O0J A;  3GE1 A;  1TK5 A;  4KHU A;  4HVJ A;  4BRK A;  4M3W A;  1D4X A;  4FWR A;  4H0O A;  2CGJ A;  5IWA K;  4NYN A;  2A3Z A;  3CCJ N;  4FJL A;  1KXP A;  3NF6 A;  2FSK A;  1KVB A;  5KGW A;  3S3N A;  2OPP A;  4X65 K;  1NGF A;  3GG4 A;  4FWN A;  4KB0 A;  3IKM A;  3OTO K;  2A40 A;  2P9K A;  3L4I A;  5HL7 L;  5E84 A;  3GDQ A;  1VSI A;  3ATU A;  5C2D A;  3A5M C;  1YHQ N;  3K5L A;  4CIG A;  3UE5 A;  2J4R A;  1QVG M;  1QSY A;  3DRS A;  4KHY A;  1IG8 A;  5GAE P;  1RIL A;  2FLO A;  4MLE A;  3LDS A;  3IAY A;  1QQC A;  4RW8 A;  1GLA G;  1NKC A;  2G8F A;  4DV2 K;  3LWL A;  4CER A;  3O9U A;  4YDU A;  1X3M A;  4DR2 K;  3J8A A;  4KHP K;  2Q0R A;  5DM7 L;  2P9P B;  1ITG A;  4RW7 A;  2XY8 A;  3PIO L;  2UXB K;  3MXM A;  4JI8 K;  2XRI A;  4DCH A;  1RDB A; 
#chains in the Genus database with same CATH homology
 2YNH A;  2IC3 A;  4FCY A;  3V1Q A;  4CJP A;  1LWE A;  1SUQ A;  4MFB A;  4FYD A;  2YNG A;  5FRO A;  4FJ8 A;  1X1P A;  3PX6 A;  4E7K A;  2RKI A;  4CEB A;  4E19 A;  3OS0 A;  4DTR A;  3HO1 A;  4CGH A;  1WSG A;  2GBZ A;  3CFO A;  1ASW A;  1EP4 A;  4L8R B;  4DQR A;  4B9U A;  3SPY A;  2HMI A;  4CFB A;  4CED A;  1ZBI A;  1C0U A;  3NF9 A;  2X74 A;  1JXB A;  4KPY A;  4C8M A;  1YVU A;  2Y1J A;  1Q9X A;  2KZZ A;  1C0T A;  1XHX A;  4CF8 A;  3HVR A;  1SKS A;  3LPU A;  2XHB A;  4DLE A;  2A1S A;  4QAG A;  3SCX A;  3NH2 A;  3DM2 A;  2BE2 A;  3QNN A;  1CZB A;  1VSK A;  4YFU A;  1IKY A;  3PV8 A;  3K5N A;  4DFP A;  3HM9 A;  4CJV A;  1NK4 A;  5JS2 A;  4CHY A;  3KLI A;  3WNF A;  3OJU A;  4UQG A;  3OY9 A;  3QEW A;  4LSN A;  3OYA A;  1BIU A;  1K6Y A;  3QLH A;  3QEV A;  4F3T A;  4CHQ A;  1MU2 A;  4Z0U A;  1RT3 A;  3V9S A;  1VSL A;  1WSI A;  3AA3 A;  1T8E A;  3RWU A;  3SYZ A;  1RT1 A;  2ATQ A;  2FBV A;  4AH9 A;  5CYQ A;  4CEZ A;  4CIE A;  3T3F A;  4KO0 A;  3TAE A;  4IG0 A;  1RTJ A;  3DLB A;  3HYF A;  1JL2 A;  1HJR A;  1RBR A;  3DLG A;  4R5P A;  1JLB A;  4FK0 A;  4KTW A;  4W5R A;  4N41 A;  4IFY A;  4IG3 A;  4JS4 A;  3KLG A;  5I3U A;  1X9W A;  4AHU A;  3K57 A;  4CK1 A;  4CJU A;  1EKE A;  3ALY A;  4CGD A;  3VQ6 A;  3M8P A;  4AIL C;  1CZ9 A;  3NBP A;  3QEX A;  3OVN A;  1NK5 A;  4CEO A;  4RW9 A;  3WNE A;  3HP6 A;  1RCH A;  1FKP A;  1L3S A;  2FBX A;  2HNY A;  4FJG A;  1ZBF A;  4FLU A;  2X6N A;  2R7Y A;  1G15 A;  1RTH A;  2Z1I A;  2EHG A;  4E7L A;  1VSF A;  3L2R A;  1WSH A;  2I5J A;  3KKR A;  4JRP A;  4BE0 A;  3PX4 A;  3LAN A;  2XY5 A;  3OYK A;  4CHZ A;  4DSI A;  3QO9 A;  2GUI A;  2OPR A;  4KTQ A;  3P1G A;  4HUG A;  4DF8 A;  1YT3 A;  4FM0 A;  4CEE A;  3OYJ A;  4CIF A;  3D0P A;  1NOY A;  1NKB A;  3UIQ A;  3AVF A;  4ELV A;  4K8X A;  1BCO A;  1HMV A;  3SUQ A;  4QCL A;  1IKW A;  4B9M A;  4B3O A;  2RF2 A;  3CFP A;  1S1U A;  3AA5 X;  3HVT A;  3T19 A;  5C42 A;  5HRS A;  1KTQ A;  1BCM A;  4FJH A;  1QS4 A;  1C0M A;  4M41 A;  2O4G A;  1KCF A;  4DTP A;  4J2A A;  1FK9 A;  1S1X A;  1VK0 A;  1VRU A;  3AA4 A;  3AVI A;  4HHT A;  1C1B A;  2G8U A;  4BDP A;  1F21 A;  1RNH A;  2G8W A;  4KRF A;  3KK3 A;  4KTZ A;  5KGX A;  4KV8 A;  3HPH A;  4O44 A;  4PY5 A;  1DTQ A;  1TAQ A;  2LSN A;  3OYH A;  4IFV A;  2VG5 A;  3VQD A;  4DTX A;  1SV5 A;  3K58 A;  4B9V A;  1KLN A;  4PUO A;  4CEQ A;  4OLA A;  3SI6 A;  1UOC A;  4DTU A;  2G8V A;  2YHB A;  3CG7 A;  4N76 A;  5J2M A;  4CEA A;  4AHC A;  5KTQ A;  3HT3 A;  4CJR A;  3ULD A;  4NCG A;  2ZQB A;  3L8B A;  3ZSO A;  1BGX T;  4KB1 A;  4KHN A;  4PWD A;  3V6D A;  4FK4 A;  1W0H A;  1X9S A;  2YNI A;  1A5X A;  4H4M A;  1BI4 A;  1SL0 A;  3I0S A;  4CFA A;  2OZM A;  3DLE A;  2VG7 A;  3CFR A;  3QEI A;  3DI6 A;  4BE1 A;  4NCB A;  2KZM A;  1TV6 A;  4FLV A;  4DTM A;  1NK6 A;  2F8T A;  3LAL A;  5HRP A;  2P5O A;  4KRE A;  1JLQ A;  2X78 A;  3QES A;  1TK0 A;  3AO1 A;  1NOZ A;  3LP3 A;  2RPI A;  5HRR A;  3NGZ A;  1NJW A;  2KFN A;  5FRN A;  1JXE A;  3HPG A;  3I0R A;  3M8S A;  4K8Z A;  3A2F A;  4FZY A;  3ZT2 A;  1SL2 A;  4HCC A;  4PA1 A;  4H8K A;  2Y1I A;  4ZTJ A;  3F73 A;  4KFB A;  3AO2 A;  1TK8 A;  3LPT A;  1HQE A;  2BDP A;  2KTQ A;  5FDL A;  1FKO A;  4AHT A;  3OYM A;  1CLQ A;  1QTM A;  3VA0 A;  1RT2 A;  4OPJ A;  3BGR A;  5DMR A;  3QNO A;  2OPQ A;  1L3T A;  4MQ3 A;  4CJF A;  3RTV A;  5EU7 A;  2WON A;  3CM5 A;  3KJV A;  1EXQ A;  2Q3S A;  4NCA A;  3AVB A;  4DSJ A;  2KFZ A;  4I2Q A;  4FXD A;  1XWL A;  2FBY A;  5FRM A;  2HVI A;  2KQ2 A;  4CJ3 A;  4EZ9 A;  4DQI A;  3DMJ A;  4EP4 A;  5HP1 A;  4DLG A;  1I39 A;  1U47 A;  3AV9 A;  3ZT0 A;  1RT5 A;  3OJS A;  1U49 A;  3M8Q A;  4FJ5 A;  1BHL A;  2D0B A;  3DRP A;  4LD0 A;  4CHP A;  4CEC A;  4Z4H A;  2F8S A;  4CEF A;  4DSF A;  3ZSQ A;  4J2E A;  4FJX A;  4PQU A;  3KK2 A;  3ZSY A;  4Q5V A;  1J53 A;  3FFI A;  4OLB A;  5J2P A;  1VSJ A;  2O4I A;  4H4O A;  3L2U A;  4CJQ A;  4ZTF A;  3K5M A;  3NDK A;  3OYC A;  3VA3 A;  4Z4E A;  3KKS A;  1UA1 A;  4FM2 A;  2DFF A;  4AHV A;  4KI6 A;  4DTS A;  1A5W A;  1KVA A;  3OYI A;  1KFD A;  3CYM A;  5DK5 A;  4Q0B A;  1QHT A;  3LP0 A;  2DY4 A;  4BE2 A;  2OA8 A;  5J1E A;  3TI0 A;  4DFM A;  4B9S A;  4DU3 A;  3LWM A;  4CGF A;  3IG1 A;  1TL3 A;  1IH7 A;  2E6L A;  1KVC A;  3D45 A;  2YKM A;  3OYD A;  2XO7 A;  3SZ2 A;  1Z26 A;  3PY8 A;  4HCB A;  1J9A A;  2BGG A;  3TAQ A;  2HND A;  4I7F A;  3AO3 A;  3AVN A;  1U04 A;  1D8Y A;  2AJQ A;  1JL1 A;  3T1A A;  4N47 A;  1BIS A;  3AO4 A;  1WAJ A;  2HVH A;  4ICL A;  2W42 A;  3TWH A;  3WNH A;  1JLE A;  2OPS A;  4CJ5 A;  4FJM A;  4DG1 A;  1VSE A;  3O4Q A;  4DU1 A;  1YTU A;  3VQQ A;  4E3S A;  1R0A A;  4FJN A;  4W5N A;  4W5O A;  4E7J A;  4HUF A;  4CK2 A;  1WLJ A;  3EYZ A;  3ASM A;  4FM1 A;  1DTT A;  4XIU A;  1QSL A;  3KTQ A;  2JGU A;  4M3X A;  1SL1 A;  3MEG A;  4DMN A;  3TAN A;  2HHT A;  4E7I A;  1IKV A;  3CM6 A;  3VQA A;  4CJT A;  3ZSX A;  4F3O A;  3OYG A;  4I2P A;  4BAC A;  3QER A;  1NK7 A;  2B6A A;  1C1C A;  4IBN A;  3PUF A;  3DLK A;  5J2Q A;  4FJI A;  4RG8 A;  3LP1 A;  3DLH A;  4J2B A;  3L3U A;  3G10 A;  4QOZ B;  4FZX C;  4DFK A;  1N5Y A;  3CQ8 A;  3P83 D;  1C6V A;  3NF8 A;  4HUE A;  1T05 A;  1WAF A;  2B4J A;  3NE6 A;  3V9W A;  1D9D A;  3ZSV A;  1TGO A;  4CF1 A;  1VRT A;  2EX3 A;  2IGI A;  3H08 A;  3VQC A;  4CJL A;  4CJK A;  2DTU A;  3NAE A;  3P5J A;  2DFH A;  4DS4 A;  1S9E A;  4CJW A;  1TVR A;  3TAB A;  1REV A;  2KW4 A;  4OKE A;  3SQ4 A;  3RMB A;  4RW6 A;  4CCH A;  4FJ9 A;  1IKX A;  3VQP A;  1TKZ A;  2G8K A;  2QKK A;  1QSS A;  3RMC A;  3RMA A;  3RR7 A;  3AVJ A;  2DFE A;  2G8H A;  4W5T A;  4G1Q A;  3TAR A;  1S1W A;  3ZT3 A;  3G0Z A;  1LW2 A;  1XI1 A;  4BDY A;  3O3G A;  4FZZ A;  2F96 A;  4NYF A;  4C8N A;  4AHR A;  4CJE A;  3HJF A;  3AVH A;  4Y1C A;  1Y97 A;  2HHW A;  1S1T A;  2P1J A;  4LH5 A;  3V1O A;  4GMJ B;  4KHS A;  4CF9 A;  5CZ1 A;  4OPK A;  3AVC A;  1ZBU A;  4E1M A;  1W9H A;  3THV A;  4OGE A;  3VQB A;  4FLY A;  1NK8 A;  1B92 A;  3VQE A;  2E6M A;  2QXF A;  3ZCM A;  1ZBL A;  4E89 A;  4CHO A;  1T7P A;  2QK9 A;  3OS2 A;  1NJX A;  3PX0 A;  1GOA A;  1JLG A;  3SUO A;  2JLE A;  1RBV A;  3HPO A;  5KRT A;  1VSM A;  1NJY A;  3AVA A;  1KRP A;  1IO2 A;  4DSE A;  3NGY A;  4DFJ A;  1L3U A;  5C24 A;  1JLC A;  4GW6 A;  5SWM A;  1LW0 A;  2E4L A;  3DYA A;  2FC0 A;  4FLT A;  4DTN A;  1U45 A;  4ID1 A;  3HST B;  3VQ7 A;  3KLE A;  1KLM A;  3ZSR A;  4CJ4 A;  1T03 A;  4Y1D A;  1CXQ A;  4EZ6 A;  5KRS A;  3LAM A;  3AVG A;  4JRQ A;  2P51 A;  1UWB A;  2VG6 A;  3E01 A;  4F4K A;  3MEC A;  4FW1 A;  3VQ8 A;  1BIZ A;  1NK0 A;  4F2R A;  1XHZ A;  4CGG A;  4OKK A;  3SQ1 A;  4DQP A;  1X9M A;  2OYQ A;  3PO4 A;  3QIP A;  5K14 A;  4KHW A;  3V4I A;  1LV5 A;  5D3G A;  3OYB A;  3LP2 A;  3ZSZ A;  2X6S A;  4N5S A;  2Z1J A;  3KLH A;  2D5R A;  4LH4 A;  4CFD A;  3OYF A;  1HYV A;  1TL1 A;  4I9L A;  3LZI A;  3JYT A;  1HRH A;  1BQM A;  4M3Y A;  3I8D A;  1HQU A;  4DTO A;  2GV9 A;  5HRO A;  1D5A A;  3DOL A;  3PO5 A;  1UA0 A;  4E0D A;  1LAW A;  1HNI A;  3V81 A;  1NKE A;  4IKF A;  2BAN A;  1ZYQ A;  4CF0 A;  1RDD A;  1RT6 A;  4O4G A;  2YNF A;  5CYM A;  4AHS A;  4EP5 A;  2VWJ A;  4BWM A;  3SJJ A;  2HHQ A;  1BL3 A;  1ASV A;  3SNN A;  5SZT A;  4C8O A;  3DOK A;  4B08 A;  1NK9 A;  2IAJ A;  3QIO A;  4DQS A;  3V9X A;  4B9N A;  3VQ5 A;  1HYS A;  1RBT A;  1B9F A;  1JLF A;  2B5J A;  3ISN C;  3NFA A;  3IRX A;  4FJJ A;  4OJR A;  4KHQ A;  1J54 A;  4CHN A;  2D0A A;  2QKB A;  4HTU A;  5CZ2 A;  4KAZ A;  3NF7 A;  4DF4 A;  4JS5 A;  3MXI A;  3MAQ A;  1GOC A;  1BI4 B;  1BQN A;  3LAK A;  4CE9 A;  4N56 A;  4M45 A;  3RRG A;  4F8R A;  2PYL A;  1SKR A;  2PY5 A;  2PZS A;  2IDO A;  3S3O A;  1WNS A;  3C6T A;  1LWC A;  3HL8 A;  2OZS A;  4CGJ A;  1KFS A;  1LAV A;  4C8K A;  1TKX A;  4BWJ A;  3RMD A;  2HW3 A;  1Q8I A;  1S5J A;  3SUP A;  1N6Q A;  4DWI A;  4M3T A;  4OKJ A;  1VSH A;  3F9K A;  3B6O A;  4M3Z A;  3NHG A;  4DTJ A;  2WOM A;  3AVM A;  3TAM A;  1HPZ A;  5J2N A;  1U4B A;  4Z4F A;  3ZT1 A;  2HHV A;  2HHS A;  2YHA A;  4E7H A;  1A5V A;  4O55 A;  3SPZ A;  1JKH A;  1Z25 A;  5E41 A;  4FVM A;  3QIN A;  5HRN A;  1RTI A;  5HLF A;  1ZBH A;  3OYN A;  2RN2 A;  3AVK A;  5C25 A;  4CK3 A;  2P5G A;  4W5Q A;  4B9L A;  4ZHR A;  1TAU A;  3MXJ A;  3MEE A;  3ZT4 A;  4CES A;  3EY1 A;  2NUB A;  3WNG A;  4BDZ A;  3V9U A;  2IOC A;  1WSJ A;  1HYZ A;  1WN7 A;  1JLA A;  1NJZ A;  4JLH A;  3B6P A;  3TAP A;  5HBM A;  2PYJ A;  1FXX A;  3C94 A;  1C1A A;  3QET A;  3TAG A;  1RT7 A;  4DU4 A;  2VWK A;  2G8I A;  3V9Z A;  1U48 A;  2FBT A;  5JS1 A;  2XY6 A;  2A1R A;  1VSD A;  1EX4 A;  3ITH A;  3VQ4 A;  3QEP A;  1D9F A;  3L2Q A;  3U6F A;  3JSM A;  3AO5 A;  4YNQ A;  3TAF A;  5CY4 A;  1RBU A;  1QE1 A;  3SQ2 A;  5T7B A;  3V1R A;  3DLR A;  4ID5 A;  1HNV A;  4B8A B;  3RRH A;  4B8C A;  3BDP A;  4F2S A;  3HK2 A;  4WE1 A;  3C6U A;  2IS3 A;  3S3M A;  3OYE A;  3MED A;  4CGI A;  1RDA A;  3ZSW A;  3IS9 A;  3KK1 A;  1CXU A;  1Q9Y A;  2YKN A;  4B9T A;  1KSP A;  4FLW A;  4FW2 A;  3C95 A;  4GVM A;  4M3R A;  3U3G A;  4FK2 A;  4O5B A;  1S6Q A;  2Z1G A;  2ZE2 A;  4O0J A;  4KKO A;  3SV4 A;  1O1W A;  1TK5 A;  4KHU A;  4HVJ A;  4E1N A;  3M8R A;  4M3W A;  1WSE A;  2HB5 A;  4DSL A;  3K2P A;  1S9G A;  4M42 A;  2HHU A;  3L3V A;  4Z4C A;  4NYN A;  4DS5 A;  3AA2 A;  4M3U A;  4Z4I A;  3OYL A;  3SV3 A;  1SKW A;  1DLO A;  4FJL A;  4CJS A;  2XY7 A;  1L5U A;  4I9Q A;  3TR8 A;  3VQ9 A;  3NF6 A;  3O3F A;  4TSX A;  1TKT A;  1KVB A;  5KGW A;  3S3N A;  2OPP A;  3LZJ A;  4J2D A;  4Z4G A;  1IG9 A;  4IDK A;  4KB0 A;  2ETJ A;  3OS1 A;  3NCI A;  1XC9 A;  3SUN A;  3U3Y A;  1WSF A;  3KD1 E;  1S1V A;  1VSI A;  1TKD A;  1RDC A;  3K59 A;  4KI4 A;  1RBS A;  3O4N A;  3NH1 A;  4CFC A;  3K5L A;  4CIG A;  1QSY A;  3DRS A;  4FJ7 A;  1B9D A;  4KHY A;  3K5O A;  1UAX A;  3AVL A;  3KLF A;  4FLZ A;  1RIL A;  4DQQ A;  3KD5 E;  4ELU A;  4OGC A;  3LDS A;  3IAY A;  1QQC A;  4OVL A;  4RW8 A;  2HHX A;  1NKC A;  2G8F A;  3RR8 A;  4RW4 A;  3L2W A;  4ELT A;  1ASU A;  4LSL A;  3LWL A;  4LY7 A;  4CER A;  2HNZ A;  1RTD A;  3EZ5 A;  2ITG A;  2D0C A;  2Z1H A;  1L3V A;  3O3H A;  1S6P A;  2YV0 X;  3NH0 A;  3L2V A;  3KIO A;  1EET A;  3DRR A;  4O0I A;  1ITG A;  4RW7 A;  2XY8 A;  5KI6 A;  4FLX A;  1LWF A;  3MXM A;  3S9H A;  3NGI A;  1I3A A;  3VN5 A;  5I42 A;  4FJK A;  2XRI A;  1J5O A;  1RT4 A;  3HP9 A;  4DSK A;  4CF2 A;  1GOB A;  4C8L A;  3SQ0 A;  3HXM A;  2ZD1 A;  1RDB A;  1YTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...