3H08A

Crystal structure of the ribonuclease h1 from chlorobium tepidum
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
144
structure length
139
Chain Sequence
EKTITIYTDGAASGNPGKGGWGALLMYGSSRKEISGYDPATTNNRMELMAAIKGLEALKEPARVQLYSDSAYLVNAMNEGWLKRWVKNGWKKPVENIDLWQEILKLTTLHRVTFHKVKGSDNPYNSRADELARLAIKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Rnh (Ribonuclease H)
publication title Structure, stability, and folding of ribonuclease H1 from the moderately thermophilic chlorobium tepidum: comparison with thermophilic and mesophilic homologues.
pubmed doi rcsb
source organism Chlorobaculum tepidum
total genus 47
structure length 139
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3h08A00
1B9FA 4FLYA 2O4IA 1LAVA 5FROA 1IH7A 4OLAA 2OPPA 5DMRA 5HRNA 4BWJA 1Z25A 4M3RA 4KI4A 1VSFA 1QSSA 4FZXC 4NYFA 1LWFA 3RRGA 4F2RA 2YHBA 2R7YA 1VSIA 4DTNA 5I3UA 1JLBA 4MQ3A 1ZYQA 4CK1A 1BISA 4CEBA 3SUOA 3RMBA 3QESA 1RDCA 3TARA 3AVKA 4F3OA 1TK0A 2P51A 3C94A 3NF8A 4F4KA 3LAMA 4KTQA 4C8LA 4TSXA 4M3YA 4CF8A 2OPQA 4DSJA 1A5XA 3L8BA 3CFRA 4CEDA 4ELUA 1XI1A 2FC0A 3HL8A 3LP3A 4AH9A 1U4BA 4OPKA 3SUQA 5KRTA 4FLTA 4DSKA 3QNOA 3T19A 2YNIA 3QEXA 1KVBA 2KTQA 5J1EA 3K5MA 2WOMA 4CJUA 4IG0A 2PY5A 4B9TA 1C1BA 1XC9A 1WSIA 1TGOA 3LWMA 4QCLA 1B92A 4FJ7A 1RT7A 3TWHA 1NKCA 3DLBA 5FRMA 4KI6A 2HNDA 4DQIA 4I2PA 5DK5A 4FLXA 4DTOA 4CFAA 2G8IA 4FK0A 4DTXA 4N47A 4CEZA 3O3GA 4Z0UA 4H4OA 2AJQA 1KVAA 2YV0X 3LDSA 2OPSA 3V4IA 3OS1A 1WAJA 2KW4A 3NBPA 4E19A 3QETA 2RF2A 1U45A 3O3FA 4DF8A 1S1XA 4BDZA 4JRQA 1QE1A 4DMNA 3HJFA 1GOAA 3QERA 3SYZA 3KKSA 2G8VA 2Z1GA 3RMCA 3CG7A 4DTSA 3I0RA 1FKPA 4N41A 3G10A 4F3TA 4FCYA 2GBZA 4N56A 4M42A 1NK9A 4QAGA 2P5OA 4BWMA 2XRIA 3AA2A 4K8ZA 1ITGA 3KK3A 2XY6A 3RWUA 4CFBA 5J2QA 3MXMA 1VSMA 4I9QA 3HPOA 3ZSYA 4CEOA 4H8KA 4CHPA 4O0IA 3NH1A 3NH2A 2XY7A 3OYCA 4DG1A 5FRNA 4CGJA 2OZMA 1T05A 3DLRA 2XO7A 5CYMA 3ZSXA 3TAGA 2PYLA 1IKYA 3K59A 3OYGA 3MECA 4CHYA 4E7LA 1C0UA 1LWEA 3KJVA 5D3GA 1BCMA 3DLEA 1BQMA 3NE6A 1RBTA 4KTWA 3NH0A 3O4QA 5HROA 4JLHA 4DU1A 4M3WA 2B5JA 1IKXA 1WLJA 3JYTA 4KHSA 4IBNA 1YTAA 3OYHA 1ZBHA 4DQSA 1TKTA 1BL3A 2P5GA 1QHTA 1S1TA 3TAPA 4RW7A 4CJEA 5SWMA 2PYJA 1KFDA 3NFAA 4I2QA 1WNSA 4FK2A 1YTUA 1L3VA 3EYZA 4AHCA 4CEAA 1HQEA 3SI6A 1N5YA 2BANA 4FXDA 4LSNA 4DSFA 2HHWA 3K5NA 3OVNA 3UIQA 3OYLA 2B4JA 4CJ4A 4CEEA 3QO9A 2JGUA 4G1QA 4FM0A 4CGFA 2GUIA 4FLZA 1QQCA 3S3OA 4AHRA 3O3HA 2WONA 2XY5A 2HHTA 3QIOA 3PO4A 3LP2A 3AV9A 1FK9A 3HVRA 5HP1A 1S9GA 3O4NA 3V9UA 2ZD1A 5J2NA 4OJRA 4CJ3A 4IFVA 1LW0A 4CIGA 1REVA 2W42A 4E7HA 3K58A 4EZ6A 1O1WA 2ZE2A 4DU3A 3KIOA 4HUGA 1X1PA 4HCBA 1J9AA 4RG8A 4JS5A 1VK0A 1U47A 3NHGA 2YKMA 2PZSA 1D9FA 5JS2A 4KHYA 3SQ4A 2E4LA 3DYAA 4W5OA 1JLCA 3AVJA 3HYFA 3EZ5A 3D45A 2ETJA 1I39A 2X78A 3PX4A 2HHSA 4CJRA 4KREA 2KFNA 3WNFA 1BGXT 1HQUA 2FBYA 4F8RA 5CYQA 3F73A 1HYSA 3SV3A 1RT3A 4FJMA 1SKSA 1F21A 4O4GA 5KRSA 5J2MA 4CEQA 4PUOA 4CF0A 3M8QA 4NCAA 2F8TA 2HHQA 1RBSA 1WSEA 1RTHA 4Z4EA 1GOCA 4I7FA 2BE2A 5CY4A 3OJSA 4DFMA 5KTQA 3PUFA 3PY8A 1TKDA 1ZBIA 3NGYA 4KPYA 4ZTFA 4FZZA 4AHSA 1J5OA 2VWJA 4PY5A 2O4GA 2X74A 3AVGA 3LANA 4CHQA 1S6PA 1W0HA 3IAYA 3LZIA 3AVFA 4M45A 3CFPA 1SL2A 3B6OA 3M8RA 3KLHA 5HBMA 3V1RA 4FM2A 4GVMA 1A5VA 1LW2A 3I0SA 2E6MA 1WSJA 5KGXA 3LPUA 1ASUA 3OYBA 4IKFA 4NCBA 4FYDA 3DRSA 3MAQA 2HB5A 3NGIA 3OYDA 4HHTA 2RPIA 4DS4A 3SUNA 2HHUA 2RKIA 2KZMA 4OPJA 3PO5A 1S5JA 3IS9A 3L3UA 5K14A 4DSIA 4KHQA 2HHVA 1NK7A 1RDDA 4FLUA 4AILC 1RTIA 3V9XA 3LP1A 1TKZA 3SPYA 1XWLA 1TVRA 2Y1IA 3HO1A 5J2PA 3M8PA 1XHXA 1IO2A 4CE9A 3NDKA 1JXEA 3HVTA 1CXQA 1YVUA 4KHNA 2KQ2A 3ZT0A 3NAEA 2D0BA 3TR8A 1X9SA 1C1AA 4GMJB 3B6PA 1VSEA 4FM1A 2HW3A 4LH4A 3P1GA 4HVJA 3KKRA 3RRHA 2JLEA 1XHZA 3RTVA 1N6QA 4DSLA 1U48A 1FKOA 2FBVA 2IS3A 4FVMA 2X6NA 3ZSOA 4B08A 4CHZA 1ZBUA 3ZSVA 1TK5A 4FJGA 1VRTA 2FBXA 4C8NA 3VQEA 1B9DA 4W5QA 1I3AA 4CK2A 4OKEA 4XIUA 1VSDA 5JS1A 3V9ZA 4BACA 1NKEA 4OVLA 4DSEA 4N5SA 3U3GA 3OYAA 1RT5A 3AVMA 1T8EA 3HK2A 3AVNA 2P1JA 4DFPA 4E7IA 3OYFA 3ZSQA 4OGCA 1NOZA 1RILA 3U6FA 4NYNA 1CLQA 3ULDA 3CYMA 2DFEA 4CJQA 3V9WA 2DFFA 3WNGA 2ITGA 4KHUA 4ZTJA 1NOYA 3L2QA 1HMVA 1RNHA 5C42A 1ZBLA 3ALYA 3K57A 1X9MA 1Y97A 1BI4B 1UOCA 4E89A 5HRPA 4BDPA 4C8MA 4EZ9A 4PA1A 3C6UA 4FLWA 1EXQA 4MFBA 5T7BA 1T03A 3LZJA 2Z1IA 4FJ5A 1HPZA 4EP5A 5EU7A 1WAFA 4C8OA 4J2AA 4W5NA 3OJUA 1R0AA 4K8XA 4FJKA 1VRUA 2NUBA 3VQPA 3PX0A 3AA5X 2KZZA 4JS4A 4CGDA 4FW1A 4HTUA 1HNVA 3KD1E 1RBVA 2HHXA 2KFZA 3C6TA 1D8YA 2FBTA 3DOLA 1RDAA 3MEGA 3NGZA 2OZSA 3D0PA 4HCCA 1EX4A 1S1WA 2RN2A 3DRPA 3T1AA 1Q9XA 1C0TA 1IKWA 1RBRA 3KLFA 2G8FA 4B9VA 1JLEA 3WNHA 3ZT3A 5KGWA 2IGIA 3AO4A 3LALA 1Z26A 1RT6A 3V1QA 3AA4A 3V1OA 1KCFA 4Y1CA 4BE1A 1EKEA 1K6YA 1U04A 4B8AB 1NJXA 4J2BA 3QEWA 1UA0A 1RT4A 1BIZA 3VQQA 5HRSA 1T7PA 1VSLA 1G15A 3AVBA 3TABA 2QK9A 1TAQA 3MXIA 2GV9A 1L3UA 4N76A 3OYKA 1C1CA 4GW6A 4CERA 4CJTA 3VQ6A 2G8UA 3KK2A 4B9UA 4Q0BA 4LSLA 1BHLA 2IOCA 4DQRA 3CM5A 4CECA 3QEVA 3OYNA 4L8RB 2IDOA 3DOKA 1HYVA 4O55A 1DTQA 4RW8A 3ZT4A 3TAQA 4FJ8A 2IC3A 1IKVA 2HVHA 4KTZA 4DLEA 4B8CA 1IG9A 3OYJA 4O5BA 1ZBFA 4RW6A 4HUFA 2YNGA 3TAMA 4FJHA 2HMIA 5FDLA 2EHGA 3QEIA 3VQ7A 1WSHA 1CZ9A 1TK8A 2LSNA 4LH5A 3NF7A 1TL1A 4CF9A 1SKWA 3LPTA 1BQNA 1UAXA 4M3TA 4BE2A 3ASMA 3OYIA 3VA0A 4QOZB 4IG3A 1JKHA 3VQ9A 1EP4A 1CZBA 3MEDA 1NK4A 4LY7A 2VG5A 4CCHA 2QXFA 4YNQA 4I9LA 4M3UA 4PQUA 3V81A 3VQDA 4CJWA 3RR8A 2OA8A 1TV6A 2D0CA 5SZTA 4E7KA 2D5RA 4CGHA 2Y1JA 1LAWA 4J2EA 1SL1A 4J2DA 4PWDA 1S9EA 4FLVA 1YT3A 4H4MA 4CF2A 3QNNA 3TANA 3THVA 3S3MA 4ELTA 1BCOA 4ELVA 1HYZA 1L3SA 4IDKA 1JL2A 3VA3A 3LP0A 5I42A 4DLGA 4CIEA 3NCIA 3HXMA 4B9NA 4DTMA 3DI6A 4B9MA 4KRFA 4JRPA 3TAFA 1GOBA 3MEEA 3G0ZA 1ASWA 4Z4FA 4E7JA 1RCHA 4FW2A 3U3YA 5HLFA 1KVCA 1QSLA 4OKKA 3DRRA 2DFHA 3HPHA 4CK3A 1TKXA 4Z4IA 3SQ1A 1J54A 3KLGA 5E41A 3ZSRA 4O44A 3QEPA 5KI6A 3DMJA 3ZSWA 2VWKA 4CJ5A 4Q5VA 2E6LA 2YHAA 4EP4A 3OY9A 3BGRA 1QSYA 3SJJA 2QKKA 2B6AA 3AVLA 3P83D 3ZSZA 1RDBA 3F9KA 1JLFA 4E3SA 2HVIA 1HRHA 3E01A 1NK5A 4CESA 4M3XA 1SKRA 1RTDA 2F96A 4C8KA 3SPZA 4KB1A 1JLGA 4FJNA 3K5OA 2HNYA 4KKOA 4B9LA 4DWIA 4CGGA 1WSGA 4CJPA 5CZ2A 3WNEA 2XY8A 1EETA 1RBUA 3SQ0A 3ZT1A 3C95A 4E0DA 3VQAA 4DTJA 4CJSA 1VSKA 4CGIA 4CF1A 3RR7A 4E1NA 1QS4A 3AVAA 3IRXA 4RW9A 3FFIA 1DLOA 4ZHRA 5C25A 3S9HA 2VG6A 3PX6A 4DFJA 1JLQA 3V9SA 1RT1A 3TAEA 4W5RA 3VQCA 4Z4GA 1J53A 4IFYA 1U49A 3AO1A 3VQ8A 1NJYA 2Z1JA 1TAUA 4DF4A 3NF6A 1Q9YA 1LWCA 3ZT2A 3AO3A 3KLEA 4CJVA 3QLHA 1VSHA 1HNIA 2D0AA 3HT3A 3EY1A 4W5TA 4UQGA 3HP6A 1UWBA 4E1MA 3K5LA 3M8SA 2DTUA 3QINA 4KFBA 4DTRA 1S1VA 3L3VA 4M41A 4OLBA 2Q3SA 3AA3A 4DS5A 2G8KA 3OS0A 1NK0A 3LAKA 3P5JA 3RMAA 3KLIA 3VQBA 3IG1A 4CHOA 4CJFA 1S6QA 3PV8A 1S1UA 3AVCA 3ITHA 3K2PA 1CXUA 1SV5A 2HNZA 4KV8A 4RW4A 1DTTA 3ISNC 3MXJA 3VQ5A 3SCXA 3L2VA 4AHTA 4LD0A 1NK6A 4FJXA 3S3NA 2Z1HA 4FZYA 3CQ8A 4FK4A 1JL1A 4KO0A 2XHBA 2YNHA 3KD5E 1WSFA 4KHWA 4DFKA 3SUPA 4Z4HA 1JLAA 3AO2A 3SQ2A 3A2FA 4CEFA 3QIPA 2A1SA 3RMDA 3AO5A 1KLNA 4DU4A 1BI4A 4NCGA 4CJKA 3L2RA 3HPGA 3VN5A 1C0MA 2YNFA 2BGGA 4DTPA 3TI0A 3AVHA 1C6VA 1X9WA 2G8HA 3OYMA 1QTMA 1UA1A 4CHNA 4B9SA 4KAZA 1NKBA 4FJIA 1KLMA 4AHVA 4CIFA 4CFCA 4B3OA 4CJLA 3AVIA 2I5JA 2EX3A 1LV5A 3BDPA 1WN7A 4OKJA 3HP9A 1D5AA 4BE0A 3LWLA 2G8WA 3CFOA 4FJJA 1NJWA 1KFSA 4HUEA 1ASVA 1FXXA 3DLHA 5HRRA 1NJZA 2QKBA 3DLKA 4DQQA 1NK8A 2DY4A 3VQ4A 3L2WA 2ZQBA 1SUQA 4ICLA 4WE1A 1KRPA 3OS2A 1SL0A 2F8SA 3ZCMA 4FJLA 4DTUA 4KB0A 3SNNA 3CM6A 4OGEA 3HM9A 3DLGA 5C24A 1BIUA 3H08A 1L3TA 2A1RA 1RT2A 4ID1A 4O0JA 3OYEA 1VSJA 1JXBA 1D9DA 2OPRA 3NF9A 3JSMA 1MU2A 1KSPA 3V6DA 3DM2A 3L2UA 1L5UA 3KTQA 2OYQA 4Y1DA 4AHUA 4CFDA 1W9HA 2YKNA 4Z4CA 1TL3A 4YFUA 4R5PA 1A5WA 3HSTB 4BDYA 3I8DA 1KTQA 2BDPA 1RTJA 1Q8IA 5CZ1A 1HJRA 3SV4A 4FJ9A 3T3FA 2VG7A 4ID5A 2ATQA 2IAJA 2X6SA 3KK1A 3SZ2A 4DQPA 4F2SA 4M3ZA
chains in the Genus database with same CATH superfamily
2O8EB 2OPPA 5HRNA 1Z25A 2YHBA 3A0IX 5I3UA 4WFAL 4CK1A 3AVKA 5AZIB 3SBTA 2UUBK 1QVFM 2HBLA 2Q0RA 4BRCA 3LAMA 1NGAA 4CZJA 4TSXA 4BRPA 4M3YA 4CEDA 4ELUA 5HL7L 1XI1A 2FC0A 4PL7A 3SUQA 2GX9A 5KRTA 5GAGP 2YNIA 1KVBA 3UB5A 3OW2M 4EFHA 4CJUA 1RDUA 1C1BA 3LWMA 3D2EA 1NKCA 5FRMA 4DQIA 4I2PA 2E1YA 5DK5A 3LM2A 4FK0A 3O1BA 4H4OA 2YV0X 2KW4A 1XNQK 2RF2A 4DF8A 4JHDA 3U9ZA 3HRGA 2F7TA 4JRQA 3HJFA 1GLLO 3QFPA 3T7ZA 5AZJA 3E1YA 1HJOA 2GBZA 4M42A 4QAGA 3ZX3A 4FWNA 4K8ZA 5J2QA 2GUPA 4I9QA 3HPOA 1JCGA 4CEOA 3OYCA 4DG1A 2OZMA 1T05A 3DLRA 4IO8A 3ULEA 1IKYA 3K0SA 3OYGA 4E7LA 1C0UA 3KJVA 3QDKA 2D0PA 2ASOA 3NH0A 5HROA 2O8DB 4M3WA 1IKXA 3R9PA 3JYTA 1YTAA 4DQSA 1BL3A 1S1TA 1G99A 1GLEG 3TAPA 1KFDA 4I2QA 4BC2A 4FK2A 1YTUA 1L3VA 2GEMA 5KPZA 1OH6A 1W97L 3K5NA 3OVNA 3DLLL 3QO9A 2GUIA 4AHRA 3O3HA 3OA9A 2XY5A 4YORA 2HHTA 3AV9A 2ZD1A 5AQWA 5TKYA 1LW0A 4CIGA 4E7HA 4DU3A 5BRHA 3NHGA 1WBBA 4KHYA 4BRNA 4W5OA 2ZJPL 4IOCL 3EZ5A 2KFNA 2FBYA 3F73A 3CXCM 4FJMA 2HHQA 1WSEA 1RTHA 3HSCA 4H0XB 5CY4A 1FJGK 2BE2A 4DFMA 1ZBIA 1NGFA 3PUFA 4DCHA 1BWFO 4CHQA 3AVGA 2NNWA 2D0OA 3KLHA 4GVMA 2ZWHA 1LW2A 1WOQA 4NCBA 5KQ8A 3SAFA 1S22A 3SUNA 3IS9A 3MCAB 4KHQA 4B3SK 1RDDA 1BG3A 1TVRA 3WXLA 1IO2A 4DR3K 1C0GA 1YVUA 2KQ2A 3NAEA 2O8FB 4LH4A 4HVJA 1S3XA 5BPMA 4IJNA 1OH7A 1U48A 5GAEP 4DV2K 3ZSOA 3THWB 5AQYA 4BC3A 3AARA 5ADXA 4OKEA 4XIUA 3QFUA 3CPEA 4OVLA 4DSEA 3HK2A 3AVNA 1CZAN 3FZLA 3C0BA 3OYFA 1RILA 4B1UB 3U6FA 3CYMA 2DFEA 2V7YA 3WNGA 2ITGA 3L4IA 1ZBLA 1JCEA 1UOCA 1NGDA 1NGJA 2EWSA 2Z1IA 3CC7N 3CI5A 4EP5A 2FSJA 5AQSA 4J2AA 4W5NA 3OJUA 1VRUA 3GOIA 4KBOA 1BOTO 1BUPA 4JS4A 3KD1E 1HNVA 1RBVA 2HHXA 3C6TA 1YITN 2WTUA 2FBTA 3F2KA 3GL1A 3NGZA 4BRQA 2OZSA 3WXKA 4B9VA 3ZT3A 2IGIA 1NJIO 3AO4A 1Z26A 3SMPA 3AA4A 3SMSA 3V1OA 5JMVA 4BE1A 4B8AB 2F9TA 3AAQA 3R8EA 5BREA 4HTLA 5E26A 1IV0A 1BIZA 4WQ4C 5HRSA 1VSLA 4IOAL 5M1KA 3MXIA 4IZ9A 4GW6A 4CJTA 4YOTA 5CE3A 4Q0BA 4LSLA 1BHLA 2IOCA 3CM5A 3L6QA 3O9TA 4O8UA 4L8RB 4O55A 4A2AA 1HYVA 1HR0K 4RW8A 3QMLA 4KTZA 4H0PA 3TU5A 3ZX0A 3WT0A 3SJHA 1J6ZA 4RW6A 4FWOA 4U67L 4IFEA 3VQ7A 3N4QA 1CZ9A 1TK8A 3CQXA 2LSNA 3NF7A 4RCHA 4DR2K 4BE2A 5BR9A 1MA9B 3ZETB 3UKUA 4HWIA 1EP4A 2VG5A 3CCSN 4YNQA 4JN4A 4H5WA 2KKZA 3V81A 3RR8A 1TV6A 2Y1JA 4CGHA 4J2EA 5AQZA 1YT3A 4H4MA 3TANA 3QNNA 2A40A 3THXB 1BCOA 4B9NA 2OCEA 1NGBA 3TAFA 1GOBA 2W6LA 5M1PA 4E7JA 4KH4A 1KVCA 4OKKA 4CZHA 2DFHA 5AQJA 1OVQA 1TKXA 1JCFA 4IOXA 5KI6A 3WEEB 3DMJA 3OY9A 3SJJA 2E2NA 3A5MC 2WUSA 3M5RA 1HRHA 2ZF5O 3CJCA 3E66A 1NK5A 3M3ZA 4KB1A 3KWIA 1JLGA 4FJNA 4YOWA 4M7YA 3NMUA 2DPNA 4CGGA 1X9JA 3WNEA 4CD1A 2XY8A 3SQ0A 1VSKA 4RW9A 3S9HA 4K25A 4KHPK 2VG6A 1RT1A 3TAEA 4W5RA 3VQCA 1NMNA 1NJYA 2Z1JA 1Q9YA 4RWTA 1O13A 1DEJA 2OTJN 3E9PA 4JKAA 1I94K 4M41A 4DS5A 3LDNA 2QWQA 3OS0A 3LAKA 4NLBA 5AQKA 1SV5A 3MXJA 2P9SA 1NWKA 4AHTA 5KPTA 2FSNA 3TTFA 2YNHA 4DFKA 3J7ZO 3AO2A 3SQ2A 5AQVA 4B9QA 4DU4A 2HBKA 3HPGA 3VN5A 4LFCK 5KQDA 1C6VA 1X9WA 4AM6A 4CHNA 2EX3A 4GY2B 4FWQA 1E4GT 2HBJA 1Z05A 1KFSA 5C0YA 5E84A 1FXXA 1GLBG 4FWPA 1NJZA 2QKBA 3Q7CA 2DY4A 2ZQBA 1SUQA 4ICLA 3CJ9A 4DB3A 3I55N 2HBMA 3BP8A 3GG4A 3CM6A 3HM9A 3P4IA 1BIUA 4FPAA 1L3TA 1ESVA 4O0JA 1JXBA 3EE9A 1MU2A 1RGIA 1E3MA 3A5LC 3CETA 4FSVA 4C8LA 4DV5K 4CFDA 3SV3A 1VQLN 2YKNA 2UUCK 1NLVA 4PKGA 1RTJA 4FJ9A 2VG7A 2ATQA 2D4WA 3VMFB 3KK1A 4HCCA 4LF5K 5FPNA 5JVHL 4FLYA 3ENBA 2BUPA 4DQ8A 4KI4A 1VSFA 4FZXC 4NYFA 1LWFA 1TYQA 4DTNA 2UXCK 3KZBA 5GIPA 3EE8A 3SUOA 3TARA 3L0QA 3C94A 5GADP 3CCUN 2P9PA 4BRDA 5AQHA 4CF8A 4B1WB 3LP3A 3HTVA 3TSUA 1U4BA 4OPKA 4DSKA 3QNOA 4K0KK 3QEXA 5J1EA 5MLCQ 4FWSA 4IG0A 4A57A 1TGOA 2V52B 3DLBA 4KI6A 1BA1A 3CMAN 4DTOA 4CFAA 3MK6A 4DTXA 1WBDA 4X66K 4H5VA 1KVAA 3LDSA 3V4IA 1WAJA 3QETA 4E19A 1U45A 4JKHA 1QE1A 3QERA 3DXKA 3P31A 4CZLA 3CG7A 4N56A 1NK9A 3J7AP 3AA2A 1ITGA 1IBLK 3MXMA 3ZSYA 1T3VA 4H8KA 1T6DA 3NH1A 3TTDA 4LC9B 1U2VB 5D3GA 1BQMA 3SAGA 3NE6A 1RBTA 4JI7K 1QHAA 3JS6A 4EHUA 3D6RA 5M1FA 4BRIA 2E1ZA 2P5GA 2PYJA 4CJEA 5SWMA 4Z94A 3NFAA 5LY3A 3JAMO 2YHWA 4AHCA 4CEAA 1HQEA 2E5LK 2BANA 2W40A 2YX6A 4LSNA 3TTCA 3ZLJA 4LF6K 3AGRA 4BRMA 4FM0A 4FLZA 3S3OA 4O5FA 3QIOA 3PO4A 2J4RA 3FR0A 4WQ5A 1EQYA 3O4NA 5HP1A 4JKCA 3ZEUA 4CJ3A 5BR8K 1REVA 2ZGZA 3K58A 4EZ6A 3THYB 2ZE2A 4RG8A 2PZSA 4CZFA 4JV5K 5JS2A 4AM7A 1BO5O 3C7NA 4BVOA 3SQ4A 3FZHA 2ZJRL 4K43A 3WQUA 4FWRA 1WUAA 1YJ9N 2ETJA 4CJRA 5ELZA 3WNFA 4F8RA 2H3GX 5CYQA 1HYSA 3VTIA 1RT3A 1ZBHA 2PFUA 1SKSA 4PUOA 5J2MA 4NCAA 3DWLA 4CZGA 4I7FA 4YY3K 2KHOA 3K9JA 3O5BA 3PY8A 2P9PB 1IBKK 4FZZA 4AHSA 3IUCA 5AQXA 2VWJA 3VGKA 3LANA 2PBDA 1NBWA 1W0HA 4BRLA 3K9KA 4M45A 3M8RA 3V1RA 3AY9A 1A5VA 1YUWA 3RSEB 3OYBA 4FYDA 1ASUA 2QM1A 3MAQA 3NGIA 1ATNA 3OYDA 2RPIA 4MLEA 3PO5A 4V19S 2VGMA 3EKUA 1RTIA 3V9XA 3SPYA 3CIPA 1NGIA 2Y1IA 5J2PA 1XHXA 4CE9A 4WCEL 1CXQA 3ZT0A 1X9SA 1C1AA 2VGNA 4BC4A 3B6PA 4O8KA 1XHZA 3KKRA 4DSLA 3RTVA 4CHZA 1TK5A 3ZSVA 4FJGA 1VRTA 4C8NA 4OX9K 1IJJA 3MX5A 1B9DA 5JS1A 1K8AO 2CH6A 2YHXA 3OBWA 4N5SA 4DR6K 1ZBSA 4BQZA 4E7IA 2ZJQL 3ZSQA 4FO0A 1N34K 4BR9A 5LL6Z 3T1YK 1CLQA 2W6KA 1XMOK 3MCPA 1OVYA 5GIOA 3IKMA 1VQKN 1Y97A 1BI4B 4CZMA 1XC3A 5BN9A 4C8MA 4PA1A 3C6UA 1EXQA 1MWMA 1HPZA 5EU7A 2E20A 4AF1A 4CVNE 4C8OA 3EN9A 2HSTA 2NUBA 3VQPA 4E1JA 4FW1A 4BRFA 1J5EK 2KFZA 5AQIA 3VEZA 2P9LA 3VF4A 2P9KA 1RDAA 4LF4K 1VQ5N 1EX4A 1S1WA 3DRPA 4CZIA 1C0TA 3KK7A 1IKWA 4JKBA 3KLFA 2G8FA 1JLEA 2AP1A 1ATRA 3G71N 5IWAK 4Y1CA 4EIAA 4J2BA 3QEWA 2YJFA 3C7NB 4L3QA 4IWVA 4DUYK 1TAQA 2GV9A 1L3UA 3OYKA 4H0YB 1Q82O 1C1CA 4JKGA 2G8UA 4BROA 4B9UA 3OYNA 3ZT4A 4FJ8A 1DTQA 4FWKA 3PSFA 3OYJA 1ZBFA 1YJNN 4HUFA 3TAMA 1HUXA 4XH1A 4LFAK 4I6MA 4LH5A 1SKWA 5C2DA 1BQNA 1UAXA 3OYIA 4IG3A 2VWBA 1CZBA 4JI4K 4CCHA 2QXFA 3EKSA 3B8AX 3VQDA 1GLAG 2D0CA 5SZTA 1LAWA 3PIOL 1SL1A 4H5TA 4PWDA 3THVA 4ELVA 4ELTA 3D2EB 1HYZA 5AQPA 3VA3A 4A5AA 3T1HK 1P8ZA 3UE5A 4CIEA 4DTMA 2QWMA 1TUYA 1C0FA 4EHTA 2FF3B 2HMPA 2I7NA 1QSLA 4JHDB 1NGHA 3DRRA 3HPHA 4CK3A 4Z4IA 3TSQA 4NO7A 3SK3A 5AZJB 3ZSRA 3GDQA 4O44A 2JWLA 5C2FA 2OANA 4CJ5A 4Q5VA 3D2FA 1VQ4N 2E6LA 4KH5A 4EP4A 3BGRA 1QSYA 2AA4A 1RDBA 3F9KA 1JLFA 4E3SA 4JD2A 1DGKN 2F96A 5EXWA 3K5OA 2HNYA 3ULEB 4FPBA 4QS7A 4A61A 1EETA 3C95A 2A6AA 4DKWA 3WXJA 4CJSA 4CGIA 2A42A 3IRXA 2ZM6K 4FVUA 4ZHRA 3PX6A 2UUAK 1JLQA 3CCRN 1ATSA 4IFYA 4DF4A 4WF9L 2YCHA 3MN6A 1IBMK 1RDWX 3CMEN 4CJVA 1VSHA 1HNIA 1NGEA 4LFBK 5AQRA 4W5TA 3SAHA 3JXUA 2VQEK 4JNEA 4DR7K 1UWBA 4DV4K 1LCUA 3QINA 2A41A 3AA3A 1N33K 1NK0A 3VQBA 3IG1A 4JKGB 4FL9A 3LDOA 4B3TK 1S1UA 3AVCA 3RR7A 2HNZA 3EL2A 3SCXA 3CD6N 2QWOA 4CJ7A 3S3NA 3QICA 4OO1J 5BN8A 3QBWA 3VEVA 3KD5E 4EAHD 1WSFA 3SLCA 3HI0A 2IIRA 1YF5L 3FE1A 1LOTB 3QIPA 1YJWN 3R1XA 5HOOA 4I6MB 2NLXA 4CJKA 3L2RA 2PAVA 3O9RA 3VGMA 3FZKA 4DTPA 4BREA 1QTMA 1UA1A 1KQSM 4KAZA 1NKBA 1KLMA 3HZ6A 4B3OA 4CJLA 3CJ1A 1NNEA 2I5JA 3MMVA 4WYBA 1WN7A 4OKJA 3ENOA 3CFOA 3J8AA 4YOVA 4YDUA 2O8BA 1NJWA 2ITMA 3DLHA 4F9OA 4DQQA 3UKRA 3VQ4A 3A5NC 4BRAA 3L2WA 4JI0K 2P9UA 1SL0A 3DAWA 3DLGA 5C24A 2F4VK 4JYAK 4NXMK 3JSMA 3ATVA 2P9NA 1L5UA 3DM2A 1VQMN 3KTQA 4GV9A 4Y1DA 4YFUA 1W9HA 5TKWA 1A5WA 3HSTB 3J80O 3I8DA 3D2FB 2JWKA 4FOEA 4ID5A 4F2SA 2IAJA 4DQPA 4M3ZA 1ILYA 1B9FA 1LAVA 5FROA 3DXMA 1IH7A 1T6CA 1XQSC 5DMRA 5JVGL 4F2RA 3RRGA 2W41A 2I7PA 4OPAA 3CC2N 3L4QA 4JKFA 3KWGA 3RMBA 1IG8A 5AQNA 1Q18A 3O08A 4WQ4A 3NF8A 4F4KA 3TSPA 4KTQA 3VEOA 4DSJA 2E8AA 1A5XA 3L8BA 3BUZB 4CD3A 4FLTA 3MWPA 3K5MA 4JI8K 1GLJO 2PY5A 4B9TA 1XC9A 1WSIA 3TWHA 2HNDA 4FLXA 2G8IA 4JK9A 5KPRA 3O3GA 4Z0UA 2OPSA 4KH6A 1D4XA 5AFUA 2P9IA 4BDZA 4DMNA 1GOAA 4K42A 3J81O 3O4WA 1KXPA 4DTSA 4N41A 3G10A 1W7AA 2HF3A 2RE2A 4F3TA 4H03B 2P5OA 4BWMA 2XRIA 3VF2A 2XY6A 3RWUA 4CHPA 4BRGA 4O0IA 3NH2A 2E2PA 4PHTX 3IFRA 5FRNA 2QWNA 4BRHA 2XO7A 5CYMA 4C1NK 4CBWA 4CHYA 1LWEA 4JI3K 1BCMA 1Q86O 3MN7A 3O4QA 4JLHA 4KHSA 1OKJA 1S72N 1TKTA 1QHTA 5IT9O 2A3ZA 3R3LA 3CERA 3C6AA 1Z6RA 2UYTA 3UKUB 3SI6A 4FXDA 1K73O 3CQYA 3VENA 3OYLA 2B4JA 1SS6A 2JGUA 4G1QA 1N8RO 4CGFA 4ISFA 1QQCA 4FWMA 2P9NB 1FK9A 2QXLA 1VQ9N 4B3RK 5J2NA 4OJRA 4IFVA 2W42A 4HUGA 4HCBA 1J9AA 1VK0A 1U47A 3DXMB 4A2BA 2YKMA 3DYAA 1JLCA 3AVJA 3D45A 4WFBL 3PX4A 2X78A 5BRDA 4KREA 2CGJA 1HQUA 4O4GA 4CF0A 2D1KA 3M8QA 1NGCA 2F8TA 1GOCA 3EO3A 5KTQA 1YIJN 3NGYA 4JI6K 4ZTFA 1MDUB 5AJ3K 2O4GA 3IAYA 1XUPO 3CFPA 1SL2A 3B6OA 3I0SA 1FW6A 2E6MA 3EZWA 5F2RA 3LPUA 5KGXA 3DRSA 2KZMA 1U6ZA 1BDGA 4OPJA 2IVPA 4H0VB 5K14A 4DSIA 2HHVA 4FLUA 4AILC 5CHIA 1TKZA 4NB4A 1XWLA 3HO1A 2P9IB 3M8PA 3LDQA 3HVTA 1VQ7N 4KHNA 3H3NO 2D0BA 3TR8A 3MX2A 4GMJB 4FM1A 2HW3A 3RRHA 1N6QA 4LF9K 3O9UA 2IS3A 4FVMA 2O8EA 4B08A 1ZBUA 2NZTA 4BGAA 4W5QA 1I3AA 4JI1K 1VSDA 4CW7B 4BACA 2P9SB 1NKEA 3RVCA 3VESA 3AVMA 1H1VA 4DFPA 2Q36A 4OGCA 4NYNA 5AZIA 1E4FT 5AQTA 3ULDA 2F9WA 1W2BM 2DFFA 4KHUA 4ZTJA 1HMVA 1RNHA 5EOYA 3K57A 5HRPA 4BDPA 4UY8O 3HM8A 4MFBA 5T7BA 1T03A 3LZJA 2NRWA 3OBYA 4XEIA 4NLCA 3H3OB 5LMUK 3AA5X 4YHHK 3W0LA 3CCEN 4H0OA 4DR4K 4HTUA 2QTDA 3VEXA 2NRHA 3MEGA 2RN2A 3SBGA 1VQPN 5KGWA 4DR5K 5H1SQ 4DV3K 1KCFA 4BR5A 1EKEA 1K6YA 1VQ6N 4DV1K 3F9MA 1RT4A 4IXCA 1T7PA 1G15A 3TABA 2QK9A 1KD1O 2ASMA 3O6WA 3VQ6A 1YHQN 4DQRA 3QEVA 3U4LA 2IDOA 2GWKA 4H0TB 1IKVA 4C23A 4DLEA 1NMDA 2Q0UA 4B8CA 4B1VA 4FJHA 1X3NA 2HMIA 5FDLA 1TYQB 3HOSA 3ENHA 2EHGA 3QEIA 1YXQA 4CF9A 4M3TA 3LPTA 1QZ5A 4JI2K 1Y64A 2CH5A 3AAPA 4YOUA 1JKHA 4MO4A 4QS9A 3VQ9A 2VQFK 3MEDA 1NK4A 2ASPA 4I9LA 4PQUA 3VEWA 3IMXA 1GLDG 2HF4A 3LDLA 1SQKA 1S9EA 5AQGA 4IDKA 1JL2A 3LP0A 3R6MA 1BU6O 3CCJN 2CGLA 4KRFA 5C10A 3MEEA 3G0ZA 1ASWA 4Z4FA 1RCHA 3U3YA 3MN9A 3SQ1A 3KLGA 5DM6L 3DXKB 4A59A 1N32K 3ZSWA 2YHAA 4JI5K 3BY5A 2BTFA 5A2QO 3FZMA 4H5NA 2B6AA 3P83D 1NM1A 2FXUA 1NGGA 2HVIA 3E01A 2NRTA 4CESA 1SKRA 5EX5A 2GTDA 1HLUA 3AGKA 4KKOA 3E9LA 4DWIA 3BEXA 1WSGA 4CJPA 3P39A 4BG8A 1XMQK 1RBUA 3WQTA 2QW9A 4DTJA 5CR4A 4E1NA 1QS4A 3AVAA 3PLAA 5C25A 1DLOA 4OPHA 1J53A 3AO1A 3VQ8A 4CZEA 1TAUA 4ISEA 3NF6A 1LWCA 3AO3A 1GLFO 2GWJA 2D0AA 2QWLA 1V4SA 4CBUA 2O8FA 3K5LA 1QQOA 3M8SA 5EY4A 2DTUA 3L3VA 4OLBA 2Q3SA 2G8KA 3THWA 2UU9K 3P5JA 5JLHA 3KLIA 3ZEUB 4KV8A 2V7ZA 1CXUA 3F5TA 4RW4A 3ISNC 3GE1A 3FZFA 2CGKA 4FJXA 2Z1HA 5FPDA 3CQ8A 4FK4A 3LL3A 3MDQA 3A8YA 1QVGM 4KHWA 3I56N 4Z4HA 1JLAA 3ZX2A 3A2FA 4CEFA 3DJCA 3OHRA 1C0MA 2YHYA 2YNFA 2GELA 3M6GA 3H46O 3TI0A 3AVHA 2G8HA 5LJWA 3PSIA 1V4TA 3P38A 3AVIA 1LV5A 1QZ6A 4BE0A 3LWLA 1P90A 4FJJA 1ASVA 4LF7K 5HRRA 3I33A 1EO1A 3DLKA 1NK8A 5GAHP 3OS2A 3ZCMA 2O8CA 1YI2N 4DV6K 4YOYA 2Q1NA 1K9MO 1RT2A 4GNIA 3OYEA 1VSJA 3VTHA 1HNZK 2IVOA 2OPRA 3NF9A 4DR1K 3L2UA 1TUUA 4AQYK 4AHUA 4BDYA 4Z4CA 1QQMA 1TL3A 4BC5A 4JK7A 1KTQA 1Q8IA 5CZ1A 3SV4A 3T3FA 2QWRA 2X6SA 3SZ2A 4G9ZA 1VQON 3NVMA 2Q31A 3CC4N 2O4IA 1K8KA 4OLAA 4BWJA 4MO5A 4M3RA 1QSSA 4X64K 2R7YA 1VSIA 1JLBA 4MQ3A 1ZYQA 1BISA 4CEBA 1Q81O 4ILJA 2FSKA 3QESA 1RDCA 4F3OA 5FLXO 1TK0A 2P51A 3VGLA 1MWKA 3ZETA 4MDAA 4H5RA 4CBXA 2OPQA 3CFRA 3QB0A 3HL8A 4AH9A 3ID8A 5F1XA 3J7YP 5BPLA 3T19A 1VAZA 2KTQA 2WOMA 5AQMA 3LM9A 4QCLA 3THXA 3G4SN 1B92A 4FJ7A 1RT7A 2KLAA 4FWLA 3CJ7A 4GKKK 4N47A 4CEZA 2P9LB 3CCLN 2P9KB 1DKGD 3MWTA 2AJQA 2VYPA 3IDHA 3OS1A 3NBPA 3O3FA 1S1XA 4B1ZA 4YDUC 3CCVN 4R79A 3SYZA 3KKSA 3WEEA 2Z1GA 3RMCA 4RTFD 1M1KO 2G8VA 3I0RA 1FKPA 4FCYA 4MLHA 3KK3A 4CFBA 1VSMA 1OH8A 3KHYA 2XY7A 4CGJA 1GLCG 4A5BA 3TAGA 3ZSXA 2PYLA 3K59A 3CF5L 3MECA 4U7BA 3DLEA 1SAZA 4KTWA 2Q97A 4DU1A 2B5JA 1WLJA 5C15A 4IBNA 3OYHA 1HKBA 4WFNL 3ZYYX 4IJAA 4PKIA 4RW7A 4MDBA 1HPMA 2NRRA 1WNSA 1YVNA 2YJEA 3EYZA 4JKEA 1N5YA 2O8CB 5AQOA 4DSFA 4GVEA 1KAXA 2HHWA 3UIQA 4BRKA 4CJ4A 1VHXA 2NRZA 4CEEA 4X65K 2QA4N 1KAYA 2WONA 2QWPA 3LP2A 3HVRA 1S9GA 3V9UA 3O80A 2NRVA 4B3MK 3ID6A 1O1WA 3KIOA 1X1PA 4JS5A 1HX1A 1K8KB 3LDPA 5FPMA 3CHWA 1D9FA 2RHKA 2E4LA 3HYFA 1I39A 2HHSA 3KVGA 3E9OA 1BGXT 3TPQA 4IEEA 1F21A 5KRSA 4CEQA 1RBSA 4Z4EA 4YOXA 3OJSA 4JD2B 4KPYA 3C6HA 4DV7K 5DM7L 4DV0K 4LF8K 1J5OA 4PY5A 2X74A 1S6PA 3LZIA 3AVFA 5EVZA 5ADXH 5LJVA 5M1QA 5HBMA 4FM2A 2UXDK 1WSJA 4IKFA 2HB5A 4HHTA 2V51B 1M90O 4DS4A 1SZ2A 2HHUA 2RKIA 2ZGYA 5BRFA 1S5JA 3O9SA 3CJAA 3L3UA 1NK7A 2WFBA 3LP1A 2HHHK 1QQNA 3PIPL 3GBTA 3VPZA 2A5XA 3NDKA 1JXEA 3H45C 5B8HA 1DT9A 4XH5A 4FOIA 1RFQA 1VSEA 4PL8A 3P1GA 2JLEA 1FKOA 2FBVA 2X6NA 4BVPA 5AQFA 2FBXA 3I8BA 3VQEA 4ISGA 3N4PA 3WXMB 4CK2A 3HOTA 3V9ZA 2VCPA 5BPNA 3U3GA 3OYAA 3G6EN 1RT5A 5AQQA 1T8EA 4IEIA 2P1JA 1NOZA 4J8FA 4K41A 4CJQA 3V9WA 2IVNA 3VOVA 1NOYA 3L2QA 5C42A 3ALYA 1X9MA 4ILHA 4E89A 5AQUA 4EZ9A 4FLWA 4IDHA 3H6EA 4FJ5A 4BQLA 1WAFA 5JICA 1R0AA 4K8XA 4FJKA 3PX0A 3U8XA 2KZZA 4CGDA 3VERA 1T44A 1D8YA 3DOLA 2O8BB 3D7EO 4GV6A 4BGBA 3D0PA 3H1QA 3T1AA 1Q9XA 1RBRA 3UKRB 3WNHA 3LALA 2P9UB 1RT6A 3V1QA 3OTOK 3H1VX 1U04A 1NJXA 3FGUA 5LMNK 1UA0A 2OTLN 3VQQA 3AVBA 5FPEA 4CZKA 4N76A 4IO9L 4CERA 3KK2A 4Y0WA 4BG9A 4CECA 3EEQA 1U2VA 2E2QA 4GKJK 3DOKA 3VF6A 3TAQA 2IC3A 3VEYA 1HKCA 2HVHA 1IG9A 4O5BA 2YNGA 5GINA 1WSHA 1ZC6A 2UXBK 1TL1A 5M1NA 4JAXA 3ASMA 3VA0A 4QOZB 1VQ8N 4LY7A 2Q2RA 1JJ2M 4C1NI 4M3UA 4CJWA 2OA8A 3ATUA 4E7KA 2D5RA 4J2DA 3S3MA 4FLVA 4CF2A 4BY9C 1L3SA 5I42A 3O9QA 2FLOA 4DLGA 3NCIA 3THYA 3HXMA 3DI6A 4B9MA 3C65A 4JRPA 4PKHA 3S41A 4FW2A 5HLFA 3BF1A 4DUZK 1J54A 5AFUH 3MN5A 5E41A 3QEPA 2QEXN 2VWKA 4GV3A 2QKKA 3AVLA 3ZSZA 1NU0A 2WBNA 4M3XA 1RTDA 4C8KA 3SPZA 4B9LA 2WC9A 3WUHA 2BH1A 1HNXK 5C12A 5CZ2A 1OH5A 3ZT1A 4E0DA 4QS8A 3VQAA 3CCQN 4WQ5C 5AR0A 4ILGB 4M63C 4CF1A 3RSEA 4XH4A 1TKDA 3FFIA 4DFJA 3V9SA 1Q7YO 1BA0A 3BZKA 4BR2A 3W3DA 2NRXA 4Z4GA 1U49A 3WXIA 4BR4A 3ZT2A 3KLEA 3QLHA 4B1XB 3HT3A 3EY1A 4UQGA 3HP6A 3O8MA 4E1MA 4JEPA 2E2OA 4M7XA 5AQLA 4DHYA 4KFBA 4BR0A 1S1VA 4DTRA 3RMAA 4CHOA 4CJFA 1S6QA 3PV8A 3ITHA 2YI1A 3K2PA 3FFKB 1KC8O 1DTTA 3VQ5A 3FLCO 3L2VA 4LD0A 1NK6A 4A62A 4FZYA 1JL1A 4KO0A 2XHBA 3NVKA 3G25A 3QBXA 3SUPA 3BZCA 1XNRK 2A1SA 5I9EB 3RMDA 3AO5A 3U9DA 1KLNA 1BI4A 1R59O 4JK8A 4NCGA 1NG9A 4B1YB 2BGGA 3Q7BA 3OYMA 1HKGA 4NXNK 4B9SA 3VETA 4FJIA 4AHVA 4CIFA 4CFCA 5JLFA 3BDPA 2O8DA 3M1FA 3HP9A 1D5AA 2G8WA 1VQNN 4BR7A 1EWRA 4HUEA 1KAZA 5M1OA 5F0XA 3HBTA 1WB9A 4WE1A 1KRPA 2E88A 2F8SA 4FJLA 4DTUA 1X3MA 4KB0A 3SNNA 4OGEA 3CJBA 2QI2A 3H08A 2A1RA 4ID1A 3CCMN 3O1WA 3A5OC 3BF3A 2FF6A 4X62K 1D9DA 4CI6A 1KSPA 1HNWK 1N36K 3V6DA 2OYQA 4JKDA 4R5PA 2BDPA 1ZXOA 3T69A 3CPWM 1HJRA 2HOEA 1EWQA 1YAGA
chains in the Genus database with same CATH topology
1B9FA 4FLYA 2O4IA 1LAVA 5FROA 1IH7A 4OLAA 2OPPA 5DMRA 5HRNA 4BWJA 1Z25A 4M3RA 4KI4A 1VSFA 1QSSA 4FZXC 4NYFA 1LWFA 3RRGA 4F2RA 2YHBA 2R7YA 1VSIA 4DTNA 5I3UA 1JLBA 4MQ3A 1ZYQA 4CK1A 1BISA 4CEBA 3SUOA 3RMBA 3QESA 1RDCA 3TARA 3AVKA 4F3OA 1TK0A 2P51A 3C94A 3NF8A 4F4KA 3LAMA 4KTQA 4C8LA 4TSXA 4M3YA 4CF8A 2OPQA 4DSJA 1A5XA 3L8BA 3CFRA 4CEDA 4ELUA 1XI1A 2FC0A 3HL8A 3LP3A 4AH9A 1U4BA 4OPKA 3SUQA 5KRTA 4FLTA 4DSKA 3QNOA 3T19A 2YNIA 3QEXA 1KVBA 2KTQA 5J1EA 3K5MA 2WOMA 4CJUA 4IG0A 2PY5A 4B9TA 1C1BA 1XC9A 1WSIA 1TGOA 3LWMA 4QCLA 1B92A 4FJ7A 1RT7A 3TWHA 1NKCA 3DLBA 5FRMA 4KI6A 2HNDA 4DQIA 4I2PA 5DK5A 4FLXA 4DTOA 4CFAA 2G8IA 4FK0A 4DTXA 4N47A 4CEZA 3O3GA 4Z0UA 4H4OA 2AJQA 1KVAA 2YV0X 3LDSA 2OPSA 3V4IA 3OS1A 1WAJA 2KW4A 3NBPA 4E19A 3QETA 2RF2A 1U45A 3O3FA 4DF8A 1S1XA 4BDZA 4JRQA 1QE1A 4DMNA 3HJFA 1GOAA 3QERA 3SYZA 3KKSA 2G8VA 2Z1GA 3RMCA 3CG7A 4DTSA 3I0RA 1FKPA 4N41A 3G10A 4F3TA 4FCYA 2GBZA 4N56A 4M42A 1NK9A 4QAGA 2P5OA 4BWMA 2XRIA 3AA2A 4K8ZA 1ITGA 3KK3A 2XY6A 3RWUA 4CFBA 5J2QA 3MXMA 1VSMA 4I9QA 3HPOA 3ZSYA 4CEOA 4H8KA 4CHPA 4O0IA 3NH1A 3NH2A 2XY7A 3OYCA 4DG1A 5FRNA 4CGJA 2OZMA 1T05A 3DLRA 2XO7A 5CYMA 3ZSXA 3TAGA 2PYLA 1IKYA 3K59A 3OYGA 3MECA 4CHYA 4E7LA 1C0UA 1LWEA 3KJVA 5D3GA 1BCMA 3DLEA 1BQMA 3NE6A 1RBTA 4KTWA 3NH0A 3O4QA 5HROA 4JLHA 4DU1A 4M3WA 2B5JA 1IKXA 1WLJA 3JYTA 4KHSA 4IBNA 1YTAA 3OYHA 1ZBHA 4DQSA 1TKTA 1BL3A 2P5GA 1QHTA 1S1TA 3TAPA 4RW7A 4CJEA 5SWMA 2PYJA 1KFDA 3NFAA 4I2QA 1WNSA 4FK2A 1YTUA 1L3VA 3EYZA 4AHCA 4CEAA 1HQEA 3SI6A 1N5YA 2BANA 4FXDA 4LSNA 4DSFA 2HHWA 3K5NA 3OVNA 3UIQA 3OYLA 2B4JA 4CJ4A 4CEEA 3QO9A 2JGUA 4G1QA 4FM0A 4CGFA 2GUIA 4FLZA 1QQCA 3S3OA 4AHRA 3O3HA 2WONA 2XY5A 2HHTA 3QIOA 3PO4A 3LP2A 3AV9A 1FK9A 3HVRA 5HP1A 1S9GA 3O4NA 3V9UA 2ZD1A 5J2NA 4OJRA 4CJ3A 4IFVA 1LW0A 4CIGA 1REVA 2W42A 4E7HA 3K58A 4EZ6A 1O1WA 2ZE2A 4DU3A 3KIOA 4HUGA 1X1PA 4HCBA 1J9AA 4RG8A 4JS5A 1VK0A 1U47A 3NHGA 2YKMA 2PZSA 1D9FA 5JS2A 4KHYA 3SQ4A 2E4LA 3DYAA 4W5OA 1JLCA 3AVJA 3HYFA 3EZ5A 3D45A 2ETJA 1I39A 2X78A 3PX4A 2HHSA 4CJRA 4KREA 2KFNA 3WNFA 1BGXT 1HQUA 2FBYA 4F8RA 5CYQA 3F73A 1HYSA 3SV3A 1RT3A 4FJMA 1SKSA 1F21A 4O4GA 5KRSA 5J2MA 4CEQA 4PUOA 4CF0A 3M8QA 4NCAA 2F8TA 2HHQA 1RBSA 1WSEA 1RTHA 4Z4EA 1GOCA 4I7FA 2BE2A 5CY4A 3OJSA 4DFMA 5KTQA 3PUFA 3PY8A 1TKDA 1ZBIA 3NGYA 4KPYA 4ZTFA 4FZZA 4AHSA 1J5OA 2VWJA 4PY5A 2O4GA 2X74A 3AVGA 3LANA 4CHQA 1S6PA 1W0HA 3IAYA 3LZIA 3AVFA 4M45A 3CFPA 1SL2A 3B6OA 3M8RA 3KLHA 5HBMA 3V1RA 4FM2A 4GVMA 1A5VA 1LW2A 3I0SA 2E6MA 1WSJA 5KGXA 3LPUA 1ASUA 3OYBA 4IKFA 4NCBA 4FYDA 3DRSA 3MAQA 2HB5A 3NGIA 3OYDA 4HHTA 2RPIA 4DS4A 3SUNA 2HHUA 2RKIA 2KZMA 4OPJA 3PO5A 1S5JA 3IS9A 3L3UA 5K14A 4DSIA 4KHQA 2HHVA 1NK7A 1RDDA 4FLUA 4AILC 1RTIA 3V9XA 3LP1A 1TKZA 3SPYA 1XWLA 1TVRA 2Y1IA 3HO1A 5J2PA 3M8PA 1XHXA 1IO2A 4CE9A 3NDKA 1JXEA 3HVTA 1CXQA 1YVUA 4KHNA 2KQ2A 3ZT0A 3NAEA 2D0BA 3TR8A 1X9SA 1C1AA 4GMJB 3B6PA 1VSEA 4FM1A 2HW3A 4LH4A 3P1GA 4HVJA 3KKRA 3RRHA 2JLEA 1XHZA 3RTVA 1N6QA 4DSLA 1U48A 1FKOA 2FBVA 2IS3A 4FVMA 2X6NA 3ZSOA 4B08A 4CHZA 1ZBUA 3ZSVA 1TK5A 4FJGA 1VRTA 2FBXA 4C8NA 3VQEA 1B9DA 4W5QA 1I3AA 4CK2A 4OKEA 4XIUA 1VSDA 5JS1A 3V9ZA 4BACA 1NKEA 4OVLA 4DSEA 4N5SA 3U3GA 3OYAA 1RT5A 3AVMA 1T8EA 3HK2A 3AVNA 2P1JA 4DFPA 4E7IA 3OYFA 3ZSQA 4OGCA 1NOZA 1RILA 3U6FA 4NYNA 1CLQA 3ULDA 3CYMA 2DFEA 4CJQA 3V9WA 2DFFA 3WNGA 2ITGA 4KHUA 4ZTJA 1NOYA 3L2QA 1HMVA 1RNHA 5C42A 1ZBLA 3ALYA 3K57A 1X9MA 1Y97A 1BI4B 1UOCA 4E89A 5HRPA 4BDPA 4C8MA 4EZ9A 4PA1A 3C6UA 4FLWA 1EXQA 4MFBA 5T7BA 1T03A 3LZJA 2Z1IA 4FJ5A 1HPZA 4EP5A 5EU7A 1WAFA 4C8OA 4J2AA 4W5NA 3OJUA 1R0AA 4K8XA 4FJKA 1VRUA 2NUBA 3VQPA 3PX0A 3AA5X 2KZZA 4JS4A 4CGDA 4FW1A 4HTUA 1HNVA 3KD1E 1RBVA 2HHXA 2KFZA 3C6TA 1D8YA 2FBTA 3DOLA 1RDAA 3MEGA 3NGZA 2OZSA 3D0PA 4HCCA 1EX4A 1S1WA 2RN2A 3DRPA 3T1AA 1Q9XA 1C0TA 1IKWA 1RBRA 3KLFA 2G8FA 4B9VA 1JLEA 3WNHA 3ZT3A 5KGWA 2IGIA 3AO4A 3LALA 1Z26A 1RT6A 3V1QA 3AA4A 3V1OA 1KCFA 4Y1CA 4BE1A 1EKEA 1K6YA 1U04A 4B8AB 1NJXA 4J2BA 3QEWA 1UA0A 1RT4A 1BIZA 3VQQA 5HRSA 1T7PA 1VSLA 1G15A 3AVBA 3TABA 2QK9A 1TAQA 3MXIA 2GV9A 1L3UA 4N76A 3OYKA 1C1CA 4GW6A 4CERA 4CJTA 3VQ6A 2G8UA 3KK2A 4B9UA 4Q0BA 4LSLA 1BHLA 2IOCA 4DQRA 3CM5A 4CECA 3QEVA 3OYNA 4L8RB 2IDOA 3DOKA 1HYVA 4O55A 1DTQA 4RW8A 3ZT4A 3TAQA 4FJ8A 2IC3A 1IKVA 2HVHA 4KTZA 4DLEA 4B8CA 1IG9A 3OYJA 4O5BA 1ZBFA 4RW6A 4HUFA 2YNGA 3TAMA 4FJHA 2HMIA 5FDLA 2EHGA 3QEIA 3VQ7A 1WSHA 1CZ9A 1TK8A 2LSNA 4LH5A 3NF7A 1TL1A 4CF9A 1SKWA 3LPTA 1BQNA 1UAXA 4M3TA 4BE2A 3ASMA 3OYIA 3VA0A 4QOZB 4IG3A 1JKHA 3VQ9A 1EP4A 1CZBA 3MEDA 1NK4A 4LY7A 2VG5A 4CCHA 2QXFA 4YNQA 4I9LA 4M3UA 4PQUA 3V81A 3VQDA 4CJWA 3RR8A 2OA8A 1TV6A 2D0CA 5SZTA 4E7KA 2D5RA 4CGHA 2Y1JA 1LAWA 4J2EA 1SL1A 4J2DA 4PWDA 1S9EA 4FLVA 1YT3A 4H4MA 4CF2A 3QNNA 3TANA 3THVA 3S3MA 4ELTA 1BCOA 4ELVA 1HYZA 1L3SA 4IDKA 1JL2A 3VA3A 3LP0A 5I42A 4DLGA 4CIEA 3NCIA 3HXMA 4B9NA 4DTMA 3DI6A 4B9MA 4KRFA 4JRPA 3TAFA 1GOBA 3MEEA 3G0ZA 1ASWA 4Z4FA 4E7JA 1RCHA 4FW2A 3U3YA 5HLFA 1KVCA 1QSLA 4OKKA 3DRRA 2DFHA 3HPHA 4CK3A 1TKXA 4Z4IA 3SQ1A 1J54A 3KLGA 5E41A 3ZSRA 4O44A 3QEPA 5KI6A 3DMJA 3ZSWA 2VWKA 4CJ5A 4Q5VA 2E6LA 2YHAA 4EP4A 3OY9A 3BGRA 1QSYA 3SJJA 2QKKA 2B6AA 3AVLA 3P83D 3ZSZA 1RDBA 3F9KA 1JLFA 4E3SA 2HVIA 1HRHA 3E01A 1NK5A 4CESA 4M3XA 1SKRA 1RTDA 2F96A 4C8KA 3SPZA 4KB1A 1JLGA 4FJNA 3K5OA 2HNYA 4KKOA 4B9LA 4DWIA 4CGGA 1WSGA 4CJPA 5CZ2A 3WNEA 2XY8A 1EETA 1RBUA 3SQ0A 3ZT1A 3C95A 4E0DA 3VQAA 4DTJA 4CJSA 1VSKA 4CGIA 4CF1A 3RR7A 4E1NA 1QS4A 3AVAA 3IRXA 4RW9A 3FFIA 1DLOA 4ZHRA 5C25A 3S9HA 2VG6A 3PX6A 4DFJA 1JLQA 3V9SA 1RT1A 3TAEA 4W5RA 3VQCA 4Z4GA 1J53A 4IFYA 1U49A 3AO1A 3VQ8A 1NJYA 2Z1JA 1TAUA 4DF4A 3NF6A 1Q9YA 1LWCA 3ZT2A 3AO3A 3KLEA 4CJVA 3QLHA 1VSHA 1HNIA 2D0AA 3HT3A 3EY1A 4W5TA 4UQGA 3HP6A 1UWBA 4E1MA 3K5LA 3M8SA 2DTUA 3QINA 4KFBA 4DTRA 1S1VA 3L3VA 4M41A 4OLBA 2Q3SA 3AA3A 4DS5A 2G8KA 3OS0A 1NK0A 3LAKA 3P5JA 3RMAA 3KLIA 3VQBA 3IG1A 4CHOA 4CJFA 1S6QA 3PV8A 1S1UA 3AVCA 3ITHA 3K2PA 1CXUA 1SV5A 2HNZA 4KV8A 4RW4A 1DTTA 3ISNC 3MXJA 3VQ5A 3SCXA 3L2VA 4AHTA 4LD0A 1NK6A 4FJXA 3S3NA 2Z1HA 4FZYA 3CQ8A 4FK4A 1JL1A 4KO0A 2XHBA 2YNHA 3KD5E 1WSFA 4KHWA 4DFKA 3SUPA 4Z4HA 1JLAA 3AO2A 3SQ2A 3A2FA 4CEFA 3QIPA 2A1SA 3RMDA 3AO5A 1KLNA 4DU4A 1BI4A 4NCGA 4CJKA 3L2RA 3HPGA 3VN5A 1C0MA 2YNFA 2BGGA 4DTPA 3TI0A 3AVHA 1C6VA 1X9WA 2G8HA 3OYMA 1QTMA 1UA1A 4CHNA 4B9SA 4KAZA 1NKBA 4FJIA 1KLMA 4AHVA 4CIFA 4CFCA 4B3OA 4CJLA 3AVIA 2I5JA 2EX3A 1LV5A 3BDPA 1WN7A 4OKJA 3HP9A 1D5AA 4BE0A 3LWLA 2G8WA 3CFOA 4FJJA 1NJWA 1KFSA 4HUEA 1ASVA 1FXXA 3DLHA 5HRRA 1NJZA 2QKBA 3DLKA 4DQQA 1NK8A 2DY4A 3VQ4A 3L2WA 2ZQBA 1SUQA 4ICLA 4WE1A 1KRPA 3OS2A 1SL0A 2F8SA 3ZCMA 4FJLA 4DTUA 4KB0A 3SNNA 3CM6A 4OGEA 3HM9A 3DLGA 5C24A 1BIUA 3H08A 1L3TA 2A1RA 1RT2A 4ID1A 4O0JA 3OYEA 1VSJA 1JXBA 1D9DA 2OPRA 3NF9A 3JSMA 1MU2A 1KSPA 3V6DA 3DM2A 3L2UA 1L5UA 3KTQA 2OYQA 4Y1DA 4AHUA 4CFDA 1W9HA 2YKNA 4Z4CA 1TL3A 4YFUA 4R5PA 1A5WA 3HSTB 4BDYA 3I8DA 1KTQA 2BDPA 1RTJA 1Q8IA 5CZ1A 1HJRA 3SV4A 4FJ9A 3T3FA 2VG7A 4ID5A 2ATQA 2IAJA 2X6SA 3KK1A 3SZ2A 4DQPA 4F2SA 4M3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9F A;  4FLY A;  2O4I A;  1LAV A;  5FRO A;  1IH7 A;  4OLA A;  2OPP A;  5DMR A;  5HRN A;  4BWJ A;  1Z25 A;  4M3R A;  4KI4 A;  1VSF A;  1QSS A;  4FZX C;  4NYF A;  1LWF A;  3RRG A;  4F2R A;  2YHB A;  2R7Y A;  1VSI A;  4DTN A;  5I3U A;  1JLB A;  4MQ3 A;  1ZYQ A;  4CK1 A;  1BIS A;  4CEB A;  3SUO A;  3RMB A;  3QES A;  1RDC A;  3TAR A;  3AVK A;  4F3O A;  1TK0 A;  2P51 A;  3C94 A;  3NF8 A;  4F4K A;  3LAM A;  4KTQ A;  4C8L A;  4TSX A;  4M3Y A;  4CF8 A;  2OPQ A;  4DSJ A;  1A5X A;  3L8B A;  3CFR A;  4CED A;  4ELU A;  1XI1 A;  2FC0 A;  3HL8 A;  3LP3 A;  4AH9 A;  1U4B A;  4OPK A;  3SUQ A;  5KRT A;  4FLT A;  4DSK A;  3QNO A;  3T19 A;  2YNI A;  3QEX A;  1KVB A;  2KTQ A;  5J1E A;  3K5M A;  2WOM A;  4CJU A;  4IG0 A;  2PY5 A;  4B9T A;  1C1B A;  1XC9 A;  1WSI A;  1TGO A;  3LWM A;  4QCL A;  1B92 A;  4FJ7 A;  1RT7 A;  3TWH A;  1NKC A;  3DLB A;  5FRM A;  4KI6 A;  2HND A;  4DQI A;  4I2P A;  5DK5 A;  4FLX A;  4DTO A;  4CFA A;  2G8I A;  4FK0 A;  4DTX A;  4N47 A;  4CEZ A;  3O3G A;  4Z0U A;  4H4O A;  2AJQ A;  1KVA A;  2YV0 X;  3LDS A;  2OPS A;  3V4I A;  3OS1 A;  1WAJ A;  2KW4 A;  3NBP A;  4E19 A;  3QET A;  2RF2 A;  1U45 A;  3O3F A;  4DF8 A;  1S1X A;  4BDZ A;  4JRQ A;  1QE1 A;  4DMN A;  3HJF A;  1GOA A;  3QER A;  3SYZ A;  3KKS A;  2G8V A;  2Z1G A;  3RMC A;  3CG7 A;  4DTS A;  3I0R A;  1FKP A;  4N41 A;  3G10 A;  4F3T A;  4FCY A;  2GBZ A;  4N56 A;  4M42 A;  1NK9 A;  4QAG A;  2P5O A;  4BWM A;  2XRI A;  3AA2 A;  4K8Z A;  1ITG A;  3KK3 A;  2XY6 A;  3RWU A;  4CFB A;  5J2Q A;  3MXM A;  1VSM A;  4I9Q A;  3HPO A;  3ZSY A;  4CEO A;  4H8K A;  4CHP A;  4O0I A;  3NH1 A;  3NH2 A;  2XY7 A;  3OYC A;  4DG1 A;  5FRN A;  4CGJ A;  2OZM A;  1T05 A;  3DLR A;  2XO7 A;  5CYM A;  3ZSX A;  3TAG A;  2PYL A;  1IKY A;  3K59 A;  3OYG A;  3MEC A;  4CHY A;  4E7L A;  1C0U A;  1LWE A;  3KJV A;  5D3G A;  1BCM A;  3DLE A;  1BQM A;  3NE6 A;  1RBT A;  4KTW A;  3NH0 A;  3O4Q A;  5HRO A;  4JLH A;  4DU1 A;  4M3W A;  2B5J A;  1IKX A;  1WLJ A;  3JYT A;  4KHS A;  4IBN A;  1YTA A;  3OYH A;  1ZBH A;  4DQS A;  1TKT A;  1BL3 A;  2P5G A;  1QHT A;  1S1T A;  3TAP A;  4RW7 A;  4CJE A;  5SWM A;  2PYJ A;  1KFD A;  3NFA A;  4I2Q A;  1WNS A;  4FK2 A;  1YTU A;  1L3V A;  3EYZ A;  4AHC A;  4CEA A;  1HQE A;  3SI6 A;  1N5Y A;  2BAN A;  4FXD A;  4LSN A;  4DSF A;  2HHW A;  3K5N A;  3OVN A;  3UIQ A;  3OYL A;  2B4J A;  4CJ4 A;  4CEE A;  3QO9 A;  2JGU A;  4G1Q A;  4FM0 A;  4CGF A;  2GUI A;  4FLZ A;  1QQC A;  3S3O A;  4AHR A;  3O3H A;  2WON A;  2XY5 A;  2HHT A;  3QIO A;  3PO4 A;  3LP2 A;  3AV9 A;  1FK9 A;  3HVR A;  5HP1 A;  1S9G A;  3O4N A;  3V9U A;  2ZD1 A;  5J2N A;  4OJR A;  4CJ3 A;  4IFV A;  1LW0 A;  4CIG A;  1REV A;  2W42 A;  4E7H A;  3K58 A;  4EZ6 A;  1O1W A;  2ZE2 A;  4DU3 A;  3KIO A;  4HUG A;  1X1P A;  4HCB A;  1J9A A;  4RG8 A;  4JS5 A;  1VK0 A;  1U47 A;  3NHG A;  2YKM A;  2PZS A;  1D9F A;  5JS2 A;  4KHY A;  3SQ4 A;  2E4L A;  3DYA A;  4W5O A;  1JLC A;  3AVJ A;  3HYF A;  3EZ5 A;  3D45 A;  2ETJ A;  1I39 A;  2X78 A;  3PX4 A;  2HHS A;  4CJR A;  4KRE A;  2KFN A;  3WNF A;  1BGX T;  1HQU A;  2FBY A;  4F8R A;  5CYQ A;  3F73 A;  1HYS A;  3SV3 A;  1RT3 A;  4FJM A;  1SKS A;  1F21 A;  4O4G A;  5KRS A;  5J2M A;  4CEQ A;  4PUO A;  4CF0 A;  3M8Q A;  4NCA A;  2F8T A;  2HHQ A;  1RBS A;  1WSE A;  1RTH A;  4Z4E A;  1GOC A;  4I7F A;  2BE2 A;  5CY4 A;  3OJS A;  4DFM A;  5KTQ A;  3PUF A;  3PY8 A;  1TKD A;  1ZBI A;  3NGY A;  4KPY A;  4ZTF A;  4FZZ A;  4AHS A;  1J5O A;  2VWJ A;  4PY5 A;  2O4G A;  2X74 A;  3AVG A;  3LAN A;  4CHQ A;  1S6P A;  1W0H A;  3IAY A;  3LZI A;  3AVF A;  4M45 A;  3CFP A;  1SL2 A;  3B6O A;  3M8R A;  3KLH A;  5HBM A;  3V1R A;  4FM2 A;  4GVM A;  1A5V A;  1LW2 A;  3I0S A;  2E6M A;  1WSJ A;  5KGX A;  3LPU A;  1ASU A;  3OYB A;  4IKF A;  4NCB A;  4FYD A;  3DRS A;  3MAQ A;  2HB5 A;  3NGI A;  3OYD A;  4HHT A;  2RPI A;  4DS4 A;  3SUN A;  2HHU A;  2RKI A;  2KZM A;  4OPJ A;  3PO5 A;  1S5J A;  3IS9 A;  3L3U A;  5K14 A;  4DSI A;  4KHQ A;  2HHV A;  1NK7 A;  1RDD A;  4FLU A;  4AIL C;  1RTI A;  3V9X A;  3LP1 A;  1TKZ A;  3SPY A;  1XWL A;  1TVR A;  2Y1I A;  3HO1 A;  5J2P A;  3M8P A;  1XHX A;  1IO2 A;  4CE9 A;  3NDK A;  1JXE A;  3HVT A;  1CXQ A;  1YVU A;  4KHN A;  2KQ2 A;  3ZT0 A;  3NAE A;  2D0B A;  3TR8 A;  1X9S A;  1C1A A;  4GMJ B;  3B6P A;  1VSE A;  4FM1 A;  2HW3 A;  4LH4 A;  3P1G A;  4HVJ A;  3KKR A;  3RRH A;  2JLE A;  1XHZ A;  3RTV A;  1N6Q A;  4DSL A;  1U48 A;  1FKO A;  2FBV A;  2IS3 A;  4FVM A;  2X6N A;  3ZSO A;  4B08 A;  4CHZ A;  1ZBU A;  3ZSV A;  1TK5 A;  4FJG A;  1VRT A;  2FBX A;  4C8N A;  3VQE A;  1B9D A;  4W5Q A;  1I3A A;  4CK2 A;  4OKE A;  4XIU A;  1VSD A;  5JS1 A;  3V9Z A;  4BAC A;  1NKE A;  4OVL A;  4DSE A;  4N5S A;  3U3G A;  3OYA A;  1RT5 A;  3AVM A;  1T8E A;  3HK2 A;  3AVN A;  2P1J A;  4DFP A;  4E7I A;  3OYF A;  3ZSQ A;  4OGC A;  1NOZ A;  1RIL A;  3U6F A;  4NYN A;  1CLQ A;  3ULD A;  3CYM A;  2DFE A;  4CJQ A;  3V9W A;  2DFF A;  3WNG A;  2ITG A;  4KHU A;  4ZTJ A;  1NOY A;  3L2Q A;  1HMV A;  1RNH A;  5C42 A;  1ZBL A;  3ALY A;  3K57 A;  1X9M A;  1Y97 A;  1BI4 B;  1UOC A;  4E89 A;  5HRP A;  4BDP A;  4C8M A;  4EZ9 A;  4PA1 A;  3C6U A;  4FLW A;  1EXQ A;  4MFB A;  5T7B A;  1T03 A;  3LZJ A;  2Z1I A;  4FJ5 A;  1HPZ A;  4EP5 A;  5EU7 A;  1WAF A;  4C8O A;  4J2A A;  4W5N A;  3OJU A;  1R0A A;  4K8X A;  4FJK A;  1VRU A;  2NUB A;  3VQP A;  3PX0 A;  3AA5 X;  2KZZ A;  4JS4 A;  4CGD A;  4FW1 A;  4HTU A;  1HNV A;  3KD1 E;  1RBV A;  2HHX A;  2KFZ A;  3C6T A;  1D8Y A;  2FBT A;  3DOL A;  1RDA A;  3MEG A;  3NGZ A;  2OZS A;  3D0P A;  4HCC A;  1EX4 A;  1S1W A;  2RN2 A;  3DRP A;  3T1A A;  1Q9X A;  1C0T A;  1IKW A;  1RBR A;  3KLF A;  2G8F A;  4B9V A;  1JLE A;  3WNH A;  3ZT3 A;  5KGW A;  2IGI A;  3AO4 A;  3LAL A;  1Z26 A;  1RT6 A;  3V1Q A;  3AA4 A;  3V1O A;  1KCF A;  4Y1C A;  4BE1 A;  1EKE A;  1K6Y A;  1U04 A;  4B8A B;  1NJX A;  4J2B A;  3QEW A;  1UA0 A;  1RT4 A;  1BIZ A;  3VQQ A;  5HRS A;  1T7P A;  1VSL A;  1G15 A;  3AVB A;  3TAB A;  2QK9 A;  1TAQ A;  3MXI A;  2GV9 A;  1L3U A;  4N76 A;  3OYK A;  1C1C A;  4GW6 A;  4CER A;  4CJT A;  3VQ6 A;  2G8U A;  3KK2 A;  4B9U A;  4Q0B A;  4LSL A;  1BHL A;  2IOC A;  4DQR A;  3CM5 A;  4CEC A;  3QEV A;  3OYN A;  4L8R B;  2IDO A;  3DOK A;  1HYV A;  4O55 A;  1DTQ A;  4RW8 A;  3ZT4 A;  3TAQ A;  4FJ8 A;  2IC3 A;  1IKV A;  2HVH A;  4KTZ A;  4DLE A;  4B8C A;  1IG9 A;  3OYJ A;  4O5B A;  1ZBF A;  4RW6 A;  4HUF A;  2YNG A;  3TAM A;  4FJH A;  2HMI A;  5FDL A;  2EHG A;  3QEI A;  3VQ7 A;  1WSH A;  1CZ9 A;  1TK8 A;  2LSN A;  4LH5 A;  3NF7 A;  1TL1 A;  4CF9 A;  1SKW A;  3LPT A;  1BQN A;  1UAX A;  4M3T A;  4BE2 A;  3ASM A;  3OYI A;  3VA0 A;  4QOZ B;  4IG3 A;  1JKH A;  3VQ9 A;  1EP4 A;  1CZB A;  3MED A;  1NK4 A;  4LY7 A;  2VG5 A;  4CCH A;  2QXF A;  4YNQ A;  4I9L A;  4M3U A;  4PQU A;  3V81 A;  3VQD A;  4CJW A;  3RR8 A;  2OA8 A;  1TV6 A;  2D0C A;  5SZT A;  4E7K A;  2D5R A;  4CGH A;  2Y1J A;  1LAW A;  4J2E A;  1SL1 A;  4J2D A;  4PWD A;  1S9E A;  4FLV A;  1YT3 A;  4H4M A;  4CF2 A;  3QNN A;  3TAN A;  3THV A;  3S3M A;  4ELT A;  1BCO A;  4ELV A;  1HYZ A;  1L3S A;  4IDK A;  1JL2 A;  3VA3 A;  3LP0 A;  5I42 A;  4DLG A;  4CIE A;  3NCI A;  3HXM A;  4B9N A;  4DTM A;  3DI6 A;  4B9M A;  4KRF A;  4JRP A;  3TAF A;  1GOB A;  3MEE A;  3G0Z A;  1ASW A;  4Z4F A;  4E7J A;  1RCH A;  4FW2 A;  3U3Y A;  5HLF A;  1KVC A;  1QSL A;  4OKK A;  3DRR A;  2DFH A;  3HPH A;  4CK3 A;  1TKX A;  4Z4I A;  3SQ1 A;  1J54 A;  3KLG A;  5E41 A;  3ZSR A;  4O44 A;  3QEP A;  5KI6 A;  3DMJ A;  3ZSW A;  2VWK A;  4CJ5 A;  4Q5V A;  2E6L A;  2YHA A;  4EP4 A;  3OY9 A;  3BGR A;  1QSY A;  3SJJ A;  2QKK A;  2B6A A;  3AVL A;  3P83 D;  3ZSZ A;  1RDB A;  3F9K A;  1JLF A;  4E3S A;  2HVI A;  1HRH A;  3E01 A;  1NK5 A;  4CES A;  4M3X A;  1SKR A;  1RTD A;  2F96 A;  4C8K A;  3SPZ A;  4KB1 A;  1JLG A;  4FJN A;  3K5O A;  2HNY A;  4KKO A;  4B9L A;  4DWI A;  4CGG A;  1WSG A;  4CJP A;  5CZ2 A;  3WNE A;  2XY8 A;  1EET A;  1RBU A;  3SQ0 A;  3ZT1 A;  3C95 A;  4E0D A;  3VQA A;  4DTJ A;  4CJS A;  1VSK A;  4CGI A;  4CF1 A;  3RR7 A;  4E1N A;  1QS4 A;  3AVA A;  3IRX A;  4RW9 A;  3FFI A;  1DLO A;  4ZHR A;  5C25 A;  3S9H A;  2VG6 A;  3PX6 A;  4DFJ A;  1JLQ A;  3V9S A;  1RT1 A;  3TAE A;  4W5R A;  3VQC A;  4Z4G A;  1J53 A;  4IFY A;  1U49 A;  3AO1 A;  3VQ8 A;  1NJY A;  2Z1J A;  1TAU A;  4DF4 A;  3NF6 A;  1Q9Y A;  1LWC A;  3ZT2 A;  3AO3 A;  3KLE A;  4CJV A;  3QLH A;  1VSH A;  1HNI A;  2D0A A;  3HT3 A;  3EY1 A;  4W5T A;  4UQG A;  3HP6 A;  1UWB A;  4E1M A;  3K5L A;  3M8S A;  2DTU A;  3QIN A;  4KFB A;  4DTR A;  1S1V A;  3L3V A;  4M41 A;  4OLB A;  2Q3S A;  3AA3 A;  4DS5 A;  2G8K A;  3OS0 A;  1NK0 A;  3LAK A;  3P5J A;  3RMA A;  3KLI A;  3VQB A;  3IG1 A;  4CHO A;  4CJF A;  1S6Q A;  3PV8 A;  1S1U A;  3AVC A;  3ITH A;  3K2P A;  1CXU A;  1SV5 A;  2HNZ A;  4KV8 A;  4RW4 A;  1DTT A;  3ISN C;  3MXJ A;  3VQ5 A;  3SCX A;  3L2V A;  4AHT A;  4LD0 A;  1NK6 A;  4FJX A;  3S3N A;  2Z1H A;  4FZY A;  3CQ8 A;  4FK4 A;  1JL1 A;  4KO0 A;  2XHB A;  2YNH A;  3KD5 E;  1WSF A;  4KHW A;  4DFK A;  3SUP A;  4Z4H A;  1JLA A;  3AO2 A;  3SQ2 A;  3A2F A;  4CEF A;  3QIP A;  2A1S A;  3RMD A;  3AO5 A;  1KLN A;  4DU4 A;  1BI4 A;  4NCG A;  4CJK A;  3L2R A;  3HPG A;  3VN5 A;  1C0M A;  2YNF A;  2BGG A;  4DTP A;  3TI0 A;  3AVH A;  1C6V A;  1X9W A;  2G8H A;  3OYM A;  1QTM A;  1UA1 A;  4CHN A;  4B9S A;  4KAZ A;  1NKB A;  4FJI A;  1KLM A;  4AHV A;  4CIF A;  4CFC A;  4B3O A;  4CJL A;  3AVI A;  2I5J A;  2EX3 A;  1LV5 A;  3BDP A;  1WN7 A;  4OKJ A;  3HP9 A;  1D5A A;  4BE0 A;  3LWL A;  2G8W A;  3CFO A;  4FJJ A;  1NJW A;  1KFS A;  4HUE A;  1ASV A;  1FXX A;  3DLH A;  5HRR A;  1NJZ A;  2QKB A;  3DLK A;  4DQQ A;  1NK8 A;  2DY4 A;  3VQ4 A;  3L2W A;  2ZQB A;  1SUQ A;  4ICL A;  4WE1 A;  1KRP A;  3OS2 A;  1SL0 A;  2F8S A;  3ZCM A;  4FJL A;  4DTU A;  4KB0 A;  3SNN A;  3CM6 A;  4OGE A;  3HM9 A;  3DLG A;  5C24 A;  1BIU A;  3H08 A;  1L3T A;  2A1R A;  1RT2 A;  4ID1 A;  4O0J A;  3OYE A;  1VSJ A;  1JXB A;  1D9D A;  2OPR A;  3NF9 A;  3JSM A;  1MU2 A;  1KSP A;  3V6D A;  3DM2 A;  3L2U A;  1L5U A;  3KTQ A;  2OYQ A;  4Y1D A;  4AHU A;  4CFD A;  1W9H A;  2YKN A;  4Z4C A;  1TL3 A;  4YFU A;  4R5P A;  1A5W A;  3HST B;  4BDY A;  3I8D A;  1KTQ A;  2BDP A;  1RTJ A;  1Q8I A;  5CZ1 A;  1HJR A;  3SV4 A;  4FJ9 A;  3T3F A;  2VG7 A;  4ID5 A;  2ATQ A;  2IAJ A;  2X6S A;  3KK1 A;  3SZ2 A;  4DQP A;  4F2S A;  4M3Z A; 
#chains in the Genus database with same CATH topology
 2O8E B;  2OPP A;  5HRN A;  1Z25 A;  2YHB A;  3A0I X;  5I3U A;  4WFA L;  4CK1 A;  3AVK A;  5AZI B;  3SBT A;  2UUB K;  1QVF M;  2HBL A;  2Q0R A;  4BRC A;  3LAM A;  1NGA A;  4CZJ A;  4TSX A;  4BRP A;  4M3Y A;  4CED A;  4ELU A;  5HL7 L;  1XI1 A;  2FC0 A;  4PL7 A;  3SUQ A;  2GX9 A;  5KRT A;  5GAG P;  2YNI A;  1KVB A;  3UB5 A;  3OW2 M;  4EFH A;  4CJU A;  1RDU A;  1C1B A;  3LWM A;  3D2E A;  1NKC A;  5FRM A;  4DQI A;  4I2P A;  2E1Y A;  5DK5 A;  3LM2 A;  4FK0 A;  3O1B A;  4H4O A;  2YV0 X;  2KW4 A;  1XNQ K;  2RF2 A;  4DF8 A;  4JHD A;  3U9Z A;  3HRG A;  2F7T A;  4JRQ A;  3HJF A;  1GLL O;  3QFP A;  3T7Z A;  5AZJ A;  3E1Y A;  1HJO A;  2GBZ A;  4M42 A;  4QAG A;  3ZX3 A;  4FWN A;  4K8Z A;  5J2Q A;  2GUP A;  4I9Q A;  3HPO A;  1JCG A;  4CEO A;  3OYC A;  4DG1 A;  2OZM A;  1T05 A;  3DLR A;  4IO8 A;  3ULE A;  1IKY A;  3K0S A;  3OYG A;  4E7L A;  1C0U A;  3KJV A;  3QDK A;  2D0P A;  2ASO A;  3NH0 A;  5HRO A;  2O8D B;  4M3W A;  1IKX A;  3R9P A;  3JYT A;  1YTA A;  4DQS A;  1BL3 A;  1S1T A;  1G99 A;  1GLE G;  3TAP A;  1KFD A;  4I2Q A;  4BC2 A;  4FK2 A;  1YTU A;  1L3V A;  2GEM A;  5KPZ A;  1OH6 A;  1W97 L;  3K5N A;  3OVN A;  3DLL L;  3QO9 A;  2GUI A;  4AHR A;  3O3H A;  3OA9 A;  2XY5 A;  4YOR A;  2HHT A;  3AV9 A;  2ZD1 A;  5AQW A;  5TKY A;  1LW0 A;  4CIG A;  4E7H A;  4DU3 A;  5BRH A;  3NHG A;  1WBB A;  4KHY A;  4BRN A;  4W5O A;  2ZJP L;  4IOC L;  3EZ5 A;  2KFN A;  2FBY A;  3F73 A;  3CXC M;  4FJM A;  2HHQ A;  1WSE A;  1RTH A;  3HSC A;  4H0X B;  5CY4 A;  1FJG K;  2BE2 A;  4DFM A;  1ZBI A;  1NGF A;  3PUF A;  4DCH A;  1BWF O;  4CHQ A;  3AVG A;  2NNW A;  2D0O A;  3KLH A;  4GVM A;  2ZWH A;  1LW2 A;  1WOQ A;  4NCB A;  5KQ8 A;  3SAF A;  1S22 A;  3SUN A;  3IS9 A;  3MCA B;  4KHQ A;  4B3S K;  1RDD A;  1BG3 A;  1TVR A;  3WXL A;  1IO2 A;  4DR3 K;  1C0G A;  1YVU A;  2KQ2 A;  3NAE A;  2O8F B;  4LH4 A;  4HVJ A;  1S3X A;  5BPM A;  4IJN A;  1OH7 A;  1U48 A;  5GAE P;  4DV2 K;  3ZSO A;  3THW B;  5AQY A;  4BC3 A;  3AAR A;  5ADX A;  4OKE A;  4XIU A;  3QFU A;  3CPE A;  4OVL A;  4DSE A;  3HK2 A;  3AVN A;  1CZA N;  3FZL A;  3C0B A;  3OYF A;  1RIL A;  4B1U B;  3U6F A;  3CYM A;  2DFE A;  2V7Y A;  3WNG A;  2ITG A;  3L4I A;  1ZBL A;  1JCE A;  1UOC A;  1NGD A;  1NGJ A;  2EWS A;  2Z1I A;  3CC7 N;  3CI5 A;  4EP5 A;  2FSJ A;  5AQS A;  4J2A A;  4W5N A;  3OJU A;  1VRU A;  3GOI A;  4KBO A;  1BOT O;  1BUP A;  4JS4 A;  3KD1 E;  1HNV A;  1RBV A;  2HHX A;  3C6T A;  1YIT N;  2WTU A;  2FBT A;  3F2K A;  3GL1 A;  3NGZ A;  4BRQ A;  2OZS A;  3WXK A;  4B9V A;  3ZT3 A;  2IGI A;  1NJI O;  3AO4 A;  1Z26 A;  3SMP A;  3AA4 A;  3SMS A;  3V1O A;  5JMV A;  4BE1 A;  4B8A B;  2F9T A;  3AAQ A;  3R8E A;  5BRE A;  4HTL A;  5E26 A;  1IV0 A;  1BIZ A;  4WQ4 C;  5HRS A;  1VSL A;  4IOA L;  5M1K A;  3MXI A;  4IZ9 A;  4GW6 A;  4CJT A;  4YOT A;  5CE3 A;  4Q0B A;  4LSL A;  1BHL A;  2IOC A;  3CM5 A;  3L6Q A;  3O9T A;  4O8U A;  4L8R B;  4O55 A;  4A2A A;  1HYV A;  1HR0 K;  4RW8 A;  3QML A;  4KTZ A;  4H0P A;  3TU5 A;  3ZX0 A;  3WT0 A;  3SJH A;  1J6Z A;  4RW6 A;  4FWO A;  4U67 L;  4IFE A;  3VQ7 A;  3N4Q A;  1CZ9 A;  1TK8 A;  3CQX A;  2LSN A;  3NF7 A;  4RCH A;  4DR2 K;  4BE2 A;  5BR9 A;  1MA9 B;  3ZET B;  3UKU A;  4HWI A;  1EP4 A;  2VG5 A;  3CCS N;  4YNQ A;  4JN4 A;  4H5W A;  2KKZ A;  3V81 A;  3RR8 A;  1TV6 A;  2Y1J A;  4CGH A;  4J2E A;  5AQZ A;  1YT3 A;  4H4M A;  3TAN A;  3QNN A;  2A40 A;  3THX B;  1BCO A;  4B9N A;  2OCE A;  1NGB A;  3TAF A;  1GOB A;  2W6L A;  5M1P A;  4E7J A;  4KH4 A;  1KVC A;  4OKK A;  4CZH A;  2DFH A;  5AQJ A;  1OVQ A;  1TKX A;  1JCF A;  4IOX A;  5KI6 A;  3WEE B;  3DMJ A;  3OY9 A;  3SJJ A;  2E2N A;  3A5M C;  2WUS A;  3M5R A;  1HRH A;  2ZF5 O;  3CJC A;  3E66 A;  1NK5 A;  3M3Z A;  4KB1 A;  3KWI A;  1JLG A;  4FJN A;  4YOW A;  4M7Y A;  3NMU A;  2DPN A;  4CGG A;  1X9J A;  3WNE A;  4CD1 A;  2XY8 A;  3SQ0 A;  1VSK A;  4RW9 A;  3S9H A;  4K25 A;  4KHP K;  2VG6 A;  1RT1 A;  3TAE A;  4W5R A;  3VQC A;  1NMN A;  1NJY A;  2Z1J A;  1Q9Y A;  4RWT A;  1O13 A;  1DEJ A;  2OTJ N;  3E9P A;  4JKA A;  1I94 K;  4M41 A;  4DS5 A;  3LDN A;  2QWQ A;  3OS0 A;  3LAK A;  4NLB A;  5AQK A;  1SV5 A;  3MXJ A;  2P9S A;  1NWK A;  4AHT A;  5KPT A;  2FSN A;  3TTF A;  2YNH A;  4DFK A;  3J7Z O;  3AO2 A;  3SQ2 A;  5AQV A;  4B9Q A;  4DU4 A;  2HBK A;  3HPG A;  3VN5 A;  4LFC K;  5KQD A;  1C6V A;  1X9W A;  4AM6 A;  4CHN A;  2EX3 A;  4GY2 B;  4FWQ A;  1E4G T;  2HBJ A;  1Z05 A;  1KFS A;  5C0Y A;  5E84 A;  1FXX A;  1GLB G;  4FWP A;  1NJZ A;  2QKB A;  3Q7C A;  2DY4 A;  2ZQB A;  1SUQ A;  4ICL A;  3CJ9 A;  4DB3 A;  3I55 N;  2HBM A;  3BP8 A;  3GG4 A;  3CM6 A;  3HM9 A;  3P4I A;  1BIU A;  4FPA A;  1L3T A;  1ESV A;  4O0J A;  1JXB A;  3EE9 A;  1MU2 A;  1RGI A;  1E3M A;  3A5L C;  3CET A;  4FSV A;  4C8L A;  4DV5 K;  4CFD A;  3SV3 A;  1VQL N;  2YKN A;  2UUC K;  1NLV A;  4PKG A;  1RTJ A;  4FJ9 A;  2VG7 A;  2ATQ A;  2D4W A;  3VMF B;  3KK1 A;  4HCC A;  4LF5 K;  5FPN A;  5JVH L;  4FLY A;  3ENB A;  2BUP A;  4DQ8 A;  4KI4 A;  1VSF A;  4FZX C;  4NYF A;  1LWF A;  1TYQ A;  4DTN A;  2UXC K;  3KZB A;  5GIP A;  3EE8 A;  3SUO A;  3TAR A;  3L0Q A;  3C94 A;  5GAD P;  3CCU N;  2P9P A;  4BRD A;  5AQH A;  4CF8 A;  4B1W B;  3LP3 A;  3HTV A;  3TSU A;  1U4B A;  4OPK A;  4DSK A;  3QNO A;  4K0K K;  3QEX A;  5J1E A;  5MLC Q;  4FWS A;  4IG0 A;  4A57 A;  1TGO A;  2V52 B;  3DLB A;  4KI6 A;  1BA1 A;  3CMA N;  4DTO A;  4CFA A;  3MK6 A;  4DTX A;  1WBD A;  4X66 K;  4H5V A;  1KVA A;  3LDS A;  3V4I A;  1WAJ A;  3QET A;  4E19 A;  1U45 A;  4JKH A;  1QE1 A;  3QER A;  3DXK A;  3P31 A;  4CZL A;  3CG7 A;  4N56 A;  1NK9 A;  3J7A P;  3AA2 A;  1ITG A;  1IBL K;  3MXM A;  3ZSY A;  1T3V A;  4H8K A;  1T6D A;  3NH1 A;  3TTD A;  4LC9 B;  1U2V B;  5D3G A;  1BQM A;  3SAG A;  3NE6 A;  1RBT A;  4JI7 K;  1QHA A;  3JS6 A;  4EHU A;  3D6R A;  5M1F A;  4BRI A;  2E1Z A;  2P5G A;  2PYJ A;  4CJE A;  5SWM A;  4Z94 A;  3NFA A;  5LY3 A;  3JAM O;  2YHW A;  4AHC A;  4CEA A;  1HQE A;  2E5L K;  2BAN A;  2W40 A;  2YX6 A;  4LSN A;  3TTC A;  3ZLJ A;  4LF6 K;  3AGR A;  4BRM A;  4FM0 A;  4FLZ A;  3S3O A;  4O5F A;  3QIO A;  3PO4 A;  2J4R A;  3FR0 A;  4WQ5 A;  1EQY A;  3O4N A;  5HP1 A;  4JKC A;  3ZEU A;  4CJ3 A;  5BR8 K;  1REV A;  2ZGZ A;  3K58 A;  4EZ6 A;  3THY B;  2ZE2 A;  4RG8 A;  2PZS A;  4CZF A;  4JV5 K;  5JS2 A;  4AM7 A;  1BO5 O;  3C7N A;  4BVO A;  3SQ4 A;  3FZH A;  2ZJR L;  4K43 A;  3WQU A;  4FWR A;  1WUA A;  1YJ9 N;  2ETJ A;  4CJR A;  5ELZ A;  3WNF A;  4F8R A;  2H3G X;  5CYQ A;  1HYS A;  3VTI A;  1RT3 A;  1ZBH A;  2PFU A;  1SKS A;  4PUO A;  5J2M A;  4NCA A;  3DWL A;  4CZG A;  4I7F A;  4YY3 K;  2KHO A;  3K9J A;  3O5B A;  3PY8 A;  2P9P B;  1IBK K;  4FZZ A;  4AHS A;  3IUC A;  5AQX A;  2VWJ A;  3VGK A;  3LAN A;  2PBD A;  1NBW A;  1W0H A;  4BRL A;  3K9K A;  4M45 A;  3M8R A;  3V1R A;  3AY9 A;  1A5V A;  1YUW A;  3RSE B;  3OYB A;  4FYD A;  1ASU A;  2QM1 A;  3MAQ A;  3NGI A;  1ATN A;  3OYD A;  2RPI A;  4MLE A;  3PO5 A;  4V19 S;  2VGM A;  3EKU A;  1RTI A;  3V9X A;  3SPY A;  3CIP A;  1NGI A;  2Y1I A;  5J2P A;  1XHX A;  4CE9 A;  4WCE L;  1CXQ A;  3ZT0 A;  1X9S A;  1C1A A;  2VGN A;  4BC4 A;  3B6P A;  4O8K A;  1XHZ A;  3KKR A;  4DSL A;  3RTV A;  4CHZ A;  1TK5 A;  3ZSV A;  4FJG A;  1VRT A;  4C8N A;  4OX9 K;  1IJJ A;  3MX5 A;  1B9D A;  5JS1 A;  1K8A O;  2CH6 A;  2YHX A;  3OBW A;  4N5S A;  4DR6 K;  1ZBS A;  4BQZ A;  4E7I A;  2ZJQ L;  3ZSQ A;  4FO0 A;  1N34 K;  4BR9 A;  5LL6 Z;  3T1Y K;  1CLQ A;  2W6K A;  1XMO K;  3MCP A;  1OVY A;  5GIO A;  3IKM A;  1VQK N;  1Y97 A;  1BI4 B;  4CZM A;  1XC3 A;  5BN9 A;  4C8M A;  4PA1 A;  3C6U A;  1EXQ A;  1MWM A;  1HPZ A;  5EU7 A;  2E20 A;  4AF1 A;  4CVN E;  4C8O A;  3EN9 A;  2HST A;  2NUB A;  3VQP A;  4E1J A;  4FW1 A;  4BRF A;  1J5E K;  2KFZ A;  5AQI A;  3VEZ A;  2P9L A;  3VF4 A;  2P9K A;  1RDA A;  4LF4 K;  1VQ5 N;  1EX4 A;  1S1W A;  3DRP A;  4CZI A;  1C0T A;  3KK7 A;  1IKW A;  4JKB A;  3KLF A;  2G8F A;  1JLE A;  2AP1 A;  1ATR A;  3G71 N;  5IWA K;  4Y1C A;  4EIA A;  4J2B A;  3QEW A;  2YJF A;  3C7N B;  4L3Q A;  4IWV A;  4DUY K;  1TAQ A;  2GV9 A;  1L3U A;  3OYK A;  4H0Y B;  1Q82 O;  1C1C A;  4JKG A;  2G8U A;  4BRO A;  4B9U A;  3OYN A;  3ZT4 A;  4FJ8 A;  1DTQ A;  4FWK A;  3PSF A;  3OYJ A;  1ZBF A;  1YJN N;  4HUF A;  3TAM A;  1HUX A;  4XH1 A;  4LFA K;  4I6M A;  4LH5 A;  1SKW A;  5C2D A;  1BQN A;  1UAX A;  3OYI A;  4IG3 A;  2VWB A;  1CZB A;  4JI4 K;  4CCH A;  2QXF A;  3EKS A;  3B8A X;  3VQD A;  1GLA G;  2D0C A;  5SZT A;  1LAW A;  3PIO L;  1SL1 A;  4H5T A;  4PWD A;  3THV A;  4ELV A;  4ELT A;  3D2E B;  1HYZ A;  5AQP A;  3VA3 A;  4A5A A;  3T1H K;  1P8Z A;  3UE5 A;  4CIE A;  4DTM A;  2QWM A;  1TUY A;  1C0F A;  4EHT A;  2FF3 B;  2HMP A;  2I7N A;  1QSL A;  4JHD B;  1NGH A;  3DRR A;  3HPH A;  4CK3 A;  4Z4I A;  3TSQ A;  4NO7 A;  3SK3 A;  5AZJ B;  3ZSR A;  3GDQ A;  4O44 A;  2JWL A;  5C2F A;  2OAN A;  4CJ5 A;  4Q5V A;  3D2F A;  1VQ4 N;  2E6L A;  4KH5 A;  4EP4 A;  3BGR A;  1QSY A;  2AA4 A;  1RDB A;  3F9K A;  1JLF A;  4E3S A;  4JD2 A;  1DGK N;  2F96 A;  5EXW A;  3K5O A;  2HNY A;  3ULE B;  4FPB A;  4QS7 A;  4A61 A;  1EET A;  3C95 A;  2A6A A;  4DKW A;  3WXJ A;  4CJS A;  4CGI A;  2A42 A;  3IRX A;  2ZM6 K;  4FVU A;  4ZHR A;  3PX6 A;  2UUA K;  1JLQ A;  3CCR N;  1ATS A;  4IFY A;  4DF4 A;  4WF9 L;  2YCH A;  3MN6 A;  1IBM K;  1RDW X;  3CME N;  4CJV A;  1VSH A;  1HNI A;  1NGE A;  4LFB K;  5AQR A;  4W5T A;  3SAH A;  3JXU A;  2VQE K;  4JNE A;  4DR7 K;  1UWB A;  4DV4 K;  1LCU A;  3QIN A;  2A41 A;  3AA3 A;  1N33 K;  1NK0 A;  3VQB A;  3IG1 A;  4JKG B;  4FL9 A;  3LDO A;  4B3T K;  1S1U A;  3AVC A;  3RR7 A;  2HNZ A;  3EL2 A;  3SCX A;  3CD6 N;  2QWO A;  4CJ7 A;  3S3N A;  3QIC A;  4OO1 J;  5BN8 A;  3QBW A;  3VEV A;  3KD5 E;  4EAH D;  1WSF A;  3SLC A;  3HI0 A;  2IIR A;  1YF5 L;  3FE1 A;  1LOT B;  3QIP A;  1YJW N;  3R1X A;  5HOO A;  4I6M B;  2NLX A;  4CJK A;  3L2R A;  2PAV A;  3O9R A;  3VGM A;  3FZK A;  4DTP A;  4BRE A;  1QTM A;  1UA1 A;  1KQS M;  4KAZ A;  1NKB A;  1KLM A;  3HZ6 A;  4B3O A;  4CJL A;  3CJ1 A;  1NNE A;  2I5J A;  3MMV A;  4WYB A;  1WN7 A;  4OKJ A;  3ENO A;  3CFO A;  3J8A A;  4YOV A;  4YDU A;  2O8B A;  1NJW A;  2ITM A;  3DLH A;  4F9O A;  4DQQ A;  3UKR A;  3VQ4 A;  3A5N C;  4BRA A;  3L2W A;  4JI0 K;  2P9U A;  1SL0 A;  3DAW A;  3DLG A;  5C24 A;  2F4V K;  4JYA K;  4NXM K;  3JSM A;  3ATV A;  2P9N A;  1L5U A;  3DM2 A;  1VQM N;  3KTQ A;  4GV9 A;  4Y1D A;  4YFU A;  1W9H A;  5TKW A;  1A5W A;  3HST B;  3J80 O;  3I8D A;  3D2F B;  2JWK A;  4FOE A;  4ID5 A;  4F2S A;  2IAJ A;  4DQP A;  4M3Z A;  1ILY A;  1B9F A;  1LAV A;  5FRO A;  3DXM A;  1IH7 A;  1T6C A;  1XQS C;  5DMR A;  5JVG L;  4F2R A;  3RRG A;  2W41 A;  2I7P A;  4OPA A;  3CC2 N;  3L4Q A;  4JKF A;  3KWG A;  3RMB A;  1IG8 A;  5AQN A;  1Q18 A;  3O08 A;  4WQ4 A;  3NF8 A;  4F4K A;  3TSP A;  4KTQ A;  3VEO A;  4DSJ A;  2E8A A;  1A5X A;  3L8B A;  3BUZ B;  4CD3 A;  4FLT A;  3MWP A;  3K5M A;  4JI8 K;  1GLJ O;  2PY5 A;  4B9T A;  1XC9 A;  1WSI A;  3TWH A;  2HND A;  4FLX A;  2G8I A;  4JK9 A;  5KPR A;  3O3G A;  4Z0U A;  2OPS A;  4KH6 A;  1D4X A;  5AFU A;  2P9I A;  4BDZ A;  4DMN A;  1GOA A;  4K42 A;  3J81 O;  3O4W A;  1KXP A;  4DTS A;  4N41 A;  3G10 A;  1W7A A;  2HF3 A;  2RE2 A;  4F3T A;  4H03 B;  2P5O A;  4BWM A;  2XRI A;  3VF2 A;  2XY6 A;  3RWU A;  4CHP A;  4BRG A;  4O0I A;  3NH2 A;  2E2P A;  4PHT X;  3IFR A;  5FRN A;  2QWN A;  4BRH A;  2XO7 A;  5CYM A;  4C1N K;  4CBW A;  4CHY A;  1LWE A;  4JI3 K;  1BCM A;  1Q86 O;  3MN7 A;  3O4Q A;  4JLH A;  4KHS A;  1OKJ A;  1S72 N;  1TKT A;  1QHT A;  5IT9 O;  2A3Z A;  3R3L A;  3CER A;  3C6A A;  1Z6R A;  2UYT A;  3UKU B;  3SI6 A;  4FXD A;  1K73 O;  3CQY A;  3VEN A;  3OYL A;  2B4J A;  1SS6 A;  2JGU A;  4G1Q A;  1N8R O;  4CGF A;  4ISF A;  1QQC A;  4FWM A;  2P9N B;  1FK9 A;  2QXL A;  1VQ9 N;  4B3R K;  5J2N A;  4OJR A;  4IFV A;  2W42 A;  4HUG A;  4HCB A;  1J9A A;  1VK0 A;  1U47 A;  3DXM B;  4A2B A;  2YKM A;  3DYA A;  1JLC A;  3AVJ A;  3D45 A;  4WFB L;  3PX4 A;  2X78 A;  5BRD A;  4KRE A;  2CGJ A;  1HQU A;  4O4G A;  4CF0 A;  2D1K A;  3M8Q A;  1NGC A;  2F8T A;  1GOC A;  3EO3 A;  5KTQ A;  1YIJ N;  3NGY A;  4JI6 K;  4ZTF A;  1MDU B;  5AJ3 K;  2O4G A;  3IAY A;  1XUP O;  3CFP A;  1SL2 A;  3B6O A;  3I0S A;  1FW6 A;  2E6M A;  3EZW A;  5F2R A;  3LPU A;  5KGX A;  3DRS A;  2KZM A;  1U6Z A;  1BDG A;  4OPJ A;  2IVP A;  4H0V B;  5K14 A;  4DSI A;  2HHV A;  4FLU A;  4AIL C;  5CHI A;  1TKZ A;  4NB4 A;  1XWL A;  3HO1 A;  2P9I B;  3M8P A;  3LDQ A;  3HVT A;  1VQ7 N;  4KHN A;  3H3N O;  2D0B A;  3TR8 A;  3MX2 A;  4GMJ B;  4FM1 A;  2HW3 A;  3RRH A;  1N6Q A;  4LF9 K;  3O9U A;  2IS3 A;  4FVM A;  2O8E A;  4B08 A;  1ZBU A;  2NZT A;  4BGA A;  4W5Q A;  1I3A A;  4JI1 K;  1VSD A;  4CW7 B;  4BAC A;  2P9S B;  1NKE A;  3RVC A;  3VES A;  3AVM A;  1H1V A;  4DFP A;  2Q36 A;  4OGC A;  4NYN A;  5AZI A;  1E4F T;  5AQT A;  3ULD A;  2F9W A;  1W2B M;  2DFF A;  4KHU A;  4ZTJ A;  1HMV A;  1RNH A;  5EOY A;  3K57 A;  5HRP A;  4BDP A;  4UY8 O;  3HM8 A;  4MFB A;  5T7B A;  1T03 A;  3LZJ A;  2NRW A;  3OBY A;  4XEI A;  4NLC A;  3H3O B;  5LMU K;  3AA5 X;  4YHH K;  3W0L A;  3CCE N;  4H0O A;  4DR4 K;  4HTU A;  2QTD A;  3VEX A;  2NRH A;  3MEG A;  2RN2 A;  3SBG A;  1VQP N;  5KGW A;  4DR5 K;  5H1S Q;  4DV3 K;  1KCF A;  4BR5 A;  1EKE A;  1K6Y A;  1VQ6 N;  4DV1 K;  3F9M A;  1RT4 A;  4IXC A;  1T7P A;  1G15 A;  3TAB A;  2QK9 A;  1KD1 O;  2ASM A;  3O6W A;  3VQ6 A;  1YHQ N;  4DQR A;  3QEV A;  3U4L A;  2IDO A;  2GWK A;  4H0T B;  1IKV A;  4C23 A;  4DLE A;  1NMD A;  2Q0U A;  4B8C A;  4B1V A;  4FJH A;  1X3N A;  2HMI A;  5FDL A;  1TYQ B;  3HOS A;  3ENH A;  2EHG A;  3QEI A;  1YXQ A;  4CF9 A;  4M3T A;  3LPT A;  1QZ5 A;  4JI2 K;  1Y64 A;  2CH5 A;  3AAP A;  4YOU A;  1JKH A;  4MO4 A;  4QS9 A;  3VQ9 A;  2VQF K;  3MED A;  1NK4 A;  2ASP A;  4I9L A;  4PQU A;  3VEW A;  3IMX A;  1GLD G;  2HF4 A;  3LDL A;  1SQK A;  1S9E A;  5AQG A;  4IDK A;  1JL2 A;  3LP0 A;  3R6M A;  1BU6 O;  3CCJ N;  2CGL A;  4KRF A;  5C10 A;  3MEE A;  3G0Z A;  1ASW A;  4Z4F A;  1RCH A;  3U3Y A;  3MN9 A;  3SQ1 A;  3KLG A;  5DM6 L;  3DXK B;  4A59 A;  1N32 K;  3ZSW A;  2YHA A;  4JI5 K;  3BY5 A;  2BTF A;  5A2Q O;  3FZM A;  4H5N A;  2B6A A;  3P83 D;  1NM1 A;  2FXU A;  1NGG A;  2HVI A;  3E01 A;  2NRT A;  4CES A;  1SKR A;  5EX5 A;  2GTD A;  1HLU A;  3AGK A;  4KKO A;  3E9L A;  4DWI A;  3BEX A;  1WSG A;  4CJP A;  3P39 A;  4BG8 A;  1XMQ K;  1RBU A;  3WQT A;  2QW9 A;  4DTJ A;  5CR4 A;  4E1N A;  1QS4 A;  3AVA A;  3PLA A;  5C25 A;  1DLO A;  4OPH A;  1J53 A;  3AO1 A;  3VQ8 A;  4CZE A;  1TAU A;  4ISE A;  3NF6 A;  1LWC A;  3AO3 A;  1GLF O;  2GWJ A;  2D0A A;  2QWL A;  1V4S A;  4CBU A;  2O8F A;  3K5L A;  1QQO A;  3M8S A;  5EY4 A;  2DTU A;  3L3V A;  4OLB A;  2Q3S A;  2G8K A;  3THW A;  2UU9 K;  3P5J A;  5JLH A;  3KLI A;  3ZEU B;  4KV8 A;  2V7Z A;  1CXU A;  3F5T A;  4RW4 A;  3ISN C;  3GE1 A;  3FZF A;  2CGK A;  4FJX A;  2Z1H A;  5FPD A;  3CQ8 A;  4FK4 A;  3LL3 A;  3MDQ A;  3A8Y A;  1QVG M;  4KHW A;  3I56 N;  4Z4H A;  1JLA A;  3ZX2 A;  3A2F A;  4CEF A;  3DJC A;  3OHR A;  1C0M A;  2YHY A;  2YNF A;  2GEL A;  3M6G A;  3H46 O;  3TI0 A;  3AVH A;  2G8H A;  5LJW A;  3PSI A;  1V4T A;  3P38 A;  3AVI A;  1LV5 A;  1QZ6 A;  4BE0 A;  3LWL A;  1P90 A;  4FJJ A;  1ASV A;  4LF7 K;  5HRR A;  3I33 A;  1EO1 A;  3DLK A;  1NK8 A;  5GAH P;  3OS2 A;  3ZCM A;  2O8C A;  1YI2 N;  4DV6 K;  4YOY A;  2Q1N A;  1K9M O;  1RT2 A;  4GNI A;  3OYE A;  1VSJ A;  3VTH A;  1HNZ K;  2IVO A;  2OPR A;  3NF9 A;  4DR1 K;  3L2U A;  1TUU A;  4AQY K;  4AHU A;  4BDY A;  4Z4C A;  1QQM A;  1TL3 A;  4BC5 A;  4JK7 A;  1KTQ A;  1Q8I A;  5CZ1 A;  3SV4 A;  3T3F A;  2QWR A;  2X6S A;  3SZ2 A;  4G9Z A;  1VQO N;  3NVM A;  2Q31 A;  3CC4 N;  2O4I A;  1K8K A;  4OLA A;  4BWJ A;  4MO5 A;  4M3R A;  1QSS A;  4X64 K;  2R7Y A;  1VSI A;  1JLB A;  4MQ3 A;  1ZYQ A;  1BIS A;  4CEB A;  1Q81 O;  4ILJ A;  2FSK A;  3QES A;  1RDC A;  4F3O A;  5FLX O;  1TK0 A;  2P51 A;  3VGL A;  1MWK A;  3ZET A;  4MDA A;  4H5R A;  4CBX A;  2OPQ A;  3CFR A;  3QB0 A;  3HL8 A;  4AH9 A;  3ID8 A;  5F1X A;  3J7Y P;  5BPL A;  3T19 A;  1VAZ A;  2KTQ A;  2WOM A;  5AQM A;  3LM9 A;  4QCL A;  3THX A;  3G4S N;  1B92 A;  4FJ7 A;  1RT7 A;  2KLA A;  4FWL A;  3CJ7 A;  4GKK K;  4N47 A;  4CEZ A;  2P9L B;  3CCL N;  2P9K B;  1DKG D;  3MWT A;  2AJQ A;  2VYP A;  3IDH A;  3OS1 A;  3NBP A;  3O3F A;  1S1X A;  4B1Z A;  4YDU C;  3CCV N;  4R79 A;  3SYZ A;  3KKS A;  3WEE A;  2Z1G A;  3RMC A;  4RTF D;  1M1K O;  2G8V A;  3I0R A;  1FKP A;  4FCY A;  4MLH A;  3KK3 A;  4CFB A;  1VSM A;  1OH8 A;  3KHY A;  2XY7 A;  4CGJ A;  1GLC G;  4A5B A;  3TAG A;  3ZSX A;  2PYL A;  3K59 A;  3CF5 L;  3MEC A;  4U7B A;  3DLE A;  1SAZ A;  4KTW A;  2Q97 A;  4DU1 A;  2B5J A;  1WLJ A;  5C15 A;  4IBN A;  3OYH A;  1HKB A;  4WFN L;  3ZYY X;  4IJA A;  4PKI A;  4RW7 A;  4MDB A;  1HPM A;  2NRR A;  1WNS A;  1YVN A;  2YJE A;  3EYZ A;  4JKE A;  1N5Y A;  2O8C B;  5AQO A;  4DSF A;  4GVE A;  1KAX A;  2HHW A;  3UIQ A;  4BRK A;  4CJ4 A;  1VHX A;  2NRZ A;  4CEE A;  4X65 K;  2QA4 N;  1KAY A;  2WON A;  2QWP A;  3LP2 A;  3HVR A;  1S9G A;  3V9U A;  3O80 A;  2NRV A;  4B3M K;  3ID6 A;  1O1W A;  3KIO A;  1X1P A;  4JS5 A;  1HX1 A;  1K8K B;  3LDP A;  5FPM A;  3CHW A;  1D9F A;  2RHK A;  2E4L A;  3HYF A;  1I39 A;  2HHS A;  3KVG A;  3E9O A;  1BGX T;  3TPQ A;  4IEE A;  1F21 A;  5KRS A;  4CEQ A;  1RBS A;  4Z4E A;  4YOX A;  3OJS A;  4JD2 B;  4KPY A;  3C6H A;  4DV7 K;  5DM7 L;  4DV0 K;  4LF8 K;  1J5O A;  4PY5 A;  2X74 A;  1S6P A;  3LZI A;  3AVF A;  5EVZ A;  5ADX H;  5LJV A;  5M1Q A;  5HBM A;  4FM2 A;  2UXD K;  1WSJ A;  4IKF A;  2HB5 A;  4HHT A;  2V51 B;  1M90 O;  4DS4 A;  1SZ2 A;  2HHU A;  2RKI A;  2ZGY A;  5BRF A;  1S5J A;  3O9S A;  3CJA A;  3L3U A;  1NK7 A;  2WFB A;  3LP1 A;  2HHH K;  1QQN A;  3PIP L;  3GBT A;  3VPZ A;  2A5X A;  3NDK A;  1JXE A;  3H45 C;  5B8H A;  1DT9 A;  4XH5 A;  4FOI A;  1RFQ A;  1VSE A;  4PL8 A;  3P1G A;  2JLE A;  1FKO A;  2FBV A;  2X6N A;  4BVP A;  5AQF A;  2FBX A;  3I8B A;  3VQE A;  4ISG A;  3N4P A;  3WXM B;  4CK2 A;  3HOT A;  3V9Z A;  2VCP A;  5BPN A;  3U3G A;  3OYA A;  3G6E N;  1RT5 A;  5AQQ A;  1T8E A;  4IEI A;  2P1J A;  1NOZ A;  4J8F A;  4K41 A;  4CJQ A;  3V9W A;  2IVN A;  3VOV A;  1NOY A;  3L2Q A;  5C42 A;  3ALY A;  1X9M A;  4ILH A;  4E89 A;  5AQU A;  4EZ9 A;  4FLW A;  4IDH A;  3H6E A;  4FJ5 A;  4BQL A;  1WAF A;  5JIC A;  1R0A A;  4K8X A;  4FJK A;  3PX0 A;  3U8X A;  2KZZ A;  4CGD A;  3VER A;  1T44 A;  1D8Y A;  3DOL A;  2O8B B;  3D7E O;  4GV6 A;  4BGB A;  3D0P A;  3H1Q A;  3T1A A;  1Q9X A;  1RBR A;  3UKR B;  3WNH A;  3LAL A;  2P9U B;  1RT6 A;  3V1Q A;  3OTO K;  3H1V X;  1U04 A;  1NJX A;  3FGU A;  5LMN K;  1UA0 A;  2OTL N;  3VQQ A;  3AVB A;  5FPE A;  4CZK A;  4N76 A;  4IO9 L;  4CER A;  3KK2 A;  4Y0W A;  4BG9 A;  4CEC A;  3EEQ A;  1U2V A;  2E2Q A;  4GKJ K;  3DOK A;  3VF6 A;  3TAQ A;  2IC3 A;  3VEY A;  1HKC A;  2HVH A;  1IG9 A;  4O5B A;  2YNG A;  5GIN A;  1WSH A;  1ZC6 A;  2UXB K;  1TL1 A;  5M1N A;  4JAX A;  3ASM A;  3VA0 A;  4QOZ B;  1VQ8 N;  4LY7 A;  2Q2R A;  1JJ2 M;  4C1N I;  4M3U A;  4CJW A;  2OA8 A;  3ATU A;  4E7K A;  2D5R A;  4J2D A;  3S3M A;  4FLV A;  4CF2 A;  4BY9 C;  1L3S A;  5I42 A;  3O9Q A;  2FLO A;  4DLG A;  3NCI A;  3THY A;  3HXM A;  3DI6 A;  4B9M A;  3C65 A;  4JRP A;  4PKH A;  3S41 A;  4FW2 A;  5HLF A;  3BF1 A;  4DUZ K;  1J54 A;  5AFU H;  3MN5 A;  5E41 A;  3QEP A;  2QEX N;  2VWK A;  4GV3 A;  2QKK A;  3AVL A;  3ZSZ A;  1NU0 A;  2WBN A;  4M3X A;  1RTD A;  4C8K A;  3SPZ A;  4B9L A;  2WC9 A;  3WUH A;  2BH1 A;  1HNX K;  5C12 A;  5CZ2 A;  1OH5 A;  3ZT1 A;  4E0D A;  4QS8 A;  3VQA A;  3CCQ N;  4WQ5 C;  5AR0 A;  4ILG B;  4M63 C;  4CF1 A;  3RSE A;  4XH4 A;  1TKD A;  3FFI A;  4DFJ A;  3V9S A;  1Q7Y O;  1BA0 A;  3BZK A;  4BR2 A;  3W3D A;  2NRX A;  4Z4G A;  1U49 A;  3WXI A;  4BR4 A;  3ZT2 A;  3KLE A;  3QLH A;  4B1X B;  3HT3 A;  3EY1 A;  4UQG A;  3HP6 A;  3O8M A;  4E1M A;  4JEP A;  2E2O A;  4M7X A;  5AQL A;  4DHY A;  4KFB A;  4BR0 A;  1S1V A;  4DTR A;  3RMA A;  4CHO A;  4CJF A;  1S6Q A;  3PV8 A;  3ITH A;  2YI1 A;  3K2P A;  3FFK B;  1KC8 O;  1DTT A;  3VQ5 A;  3FLC O;  3L2V A;  4LD0 A;  1NK6 A;  4A62 A;  4FZY A;  1JL1 A;  4KO0 A;  2XHB A;  3NVK A;  3G25 A;  3QBX A;  3SUP A;  3BZC A;  1XNR K;  2A1S A;  5I9E B;  3RMD A;  3AO5 A;  3U9D A;  1KLN A;  1BI4 A;  1R59 O;  4JK8 A;  4NCG A;  1NG9 A;  4B1Y B;  2BGG A;  3Q7B A;  3OYM A;  1HKG A;  4NXN K;  4B9S A;  3VET A;  4FJI A;  4AHV A;  4CIF A;  4CFC A;  5JLF A;  3BDP A;  2O8D A;  3M1F A;  3HP9 A;  1D5A A;  2G8W A;  1VQN N;  4BR7 A;  1EWR A;  4HUE A;  1KAZ A;  5M1O A;  5F0X A;  3HBT A;  1WB9 A;  4WE1 A;  1KRP A;  2E88 A;  2F8S A;  4FJL A;  4DTU A;  1X3M A;  4KB0 A;  3SNN A;  4OGE A;  3CJB A;  2QI2 A;  3H08 A;  2A1R A;  4ID1 A;  3CCM N;  3O1W A;  3A5O C;  3BF3 A;  2FF6 A;  4X62 K;  1D9D A;  4CI6 A;  1KSP A;  1HNW K;  1N36 K;  3V6D A;  2OYQ A;  4JKD A;  4R5P A;  2BDP A;  1ZXO A;  3T69 A;  3CPW M;  1HJR A;  2HOE A;  1EWQ A;  1YAG A; 
#chains in the Genus database with same CATH homology
 1B9F A;  4FLY A;  2O4I A;  1LAV A;  5FRO A;  1IH7 A;  4OLA A;  2OPP A;  5DMR A;  5HRN A;  4BWJ A;  1Z25 A;  4M3R A;  4KI4 A;  1VSF A;  1QSS A;  4FZX C;  4NYF A;  1LWF A;  3RRG A;  4F2R A;  2YHB A;  2R7Y A;  1VSI A;  4DTN A;  5I3U A;  1JLB A;  4MQ3 A;  1ZYQ A;  4CK1 A;  1BIS A;  4CEB A;  3SUO A;  3RMB A;  3QES A;  1RDC A;  3TAR A;  3AVK A;  4F3O A;  1TK0 A;  2P51 A;  3C94 A;  3NF8 A;  4F4K A;  3LAM A;  4KTQ A;  4C8L A;  4TSX A;  4M3Y A;  4CF8 A;  2OPQ A;  4DSJ A;  1A5X A;  3L8B A;  3CFR A;  4CED A;  4ELU A;  1XI1 A;  2FC0 A;  3HL8 A;  3LP3 A;  4AH9 A;  1U4B A;  4OPK A;  3SUQ A;  5KRT A;  4FLT A;  4DSK A;  3QNO A;  3T19 A;  2YNI A;  3QEX A;  1KVB A;  2KTQ A;  5J1E A;  3K5M A;  2WOM A;  4CJU A;  4IG0 A;  2PY5 A;  4B9T A;  1C1B A;  1XC9 A;  1WSI A;  1TGO A;  3LWM A;  4QCL A;  1B92 A;  4FJ7 A;  1RT7 A;  3TWH A;  1NKC A;  3DLB A;  5FRM A;  4KI6 A;  2HND A;  4DQI A;  4I2P A;  5DK5 A;  4FLX A;  4DTO A;  4CFA A;  2G8I A;  4FK0 A;  4DTX A;  4N47 A;  4CEZ A;  3O3G A;  4Z0U A;  4H4O A;  2AJQ A;  1KVA A;  2YV0 X;  3LDS A;  2OPS A;  3V4I A;  3OS1 A;  1WAJ A;  2KW4 A;  3NBP A;  4E19 A;  3QET A;  2RF2 A;  1U45 A;  3O3F A;  4DF8 A;  1S1X A;  4BDZ A;  4JRQ A;  1QE1 A;  4DMN A;  3HJF A;  1GOA A;  3QER A;  3SYZ A;  3KKS A;  2G8V A;  2Z1G A;  3RMC A;  3CG7 A;  4DTS A;  3I0R A;  1FKP A;  4N41 A;  3G10 A;  4F3T A;  4FCY A;  2GBZ A;  4N56 A;  4M42 A;  1NK9 A;  4QAG A;  2P5O A;  4BWM A;  2XRI A;  3AA2 A;  4K8Z A;  1ITG A;  3KK3 A;  2XY6 A;  3RWU A;  4CFB A;  5J2Q A;  3MXM A;  1VSM A;  4I9Q A;  3HPO A;  3ZSY A;  4CEO A;  4H8K A;  4CHP A;  4O0I A;  3NH1 A;  3NH2 A;  2XY7 A;  3OYC A;  4DG1 A;  5FRN A;  4CGJ A;  2OZM A;  1T05 A;  3DLR A;  2XO7 A;  5CYM A;  3ZSX A;  3TAG A;  2PYL A;  1IKY A;  3K59 A;  3OYG A;  3MEC A;  4CHY A;  4E7L A;  1C0U A;  1LWE A;  3KJV A;  5D3G A;  1BCM A;  3DLE A;  1BQM A;  3NE6 A;  1RBT A;  4KTW A;  3NH0 A;  3O4Q A;  5HRO A;  4JLH A;  4DU1 A;  4M3W A;  2B5J A;  1IKX A;  1WLJ A;  3JYT A;  4KHS A;  4IBN A;  1YTA A;  3OYH A;  1ZBH A;  4DQS A;  1TKT A;  1BL3 A;  2P5G A;  1QHT A;  1S1T A;  3TAP A;  4RW7 A;  4CJE A;  5SWM A;  2PYJ A;  1KFD A;  3NFA A;  4I2Q A;  1WNS A;  4FK2 A;  1YTU A;  1L3V A;  3EYZ A;  4AHC A;  4CEA A;  1HQE A;  3SI6 A;  1N5Y A;  2BAN A;  4FXD A;  4LSN A;  4DSF A;  2HHW A;  3K5N A;  3OVN A;  3UIQ A;  3OYL A;  2B4J A;  4CJ4 A;  4CEE A;  3QO9 A;  2JGU A;  4G1Q A;  4FM0 A;  4CGF A;  2GUI A;  4FLZ A;  1QQC A;  3S3O A;  4AHR A;  3O3H A;  2WON A;  2XY5 A;  2HHT A;  3QIO A;  3PO4 A;  3LP2 A;  3AV9 A;  1FK9 A;  3HVR A;  5HP1 A;  1S9G A;  3O4N A;  3V9U A;  2ZD1 A;  5J2N A;  4OJR A;  4CJ3 A;  4IFV A;  1LW0 A;  4CIG A;  1REV A;  2W42 A;  4E7H A;  3K58 A;  4EZ6 A;  1O1W A;  2ZE2 A;  4DU3 A;  3KIO A;  4HUG A;  1X1P A;  4HCB A;  1J9A A;  4RG8 A;  4JS5 A;  1VK0 A;  1U47 A;  3NHG A;  2YKM A;  2PZS A;  1D9F A;  5JS2 A;  4KHY A;  3SQ4 A;  2E4L A;  3DYA A;  4W5O A;  1JLC A;  3AVJ A;  3HYF A;  3EZ5 A;  3D45 A;  2ETJ A;  1I39 A;  2X78 A;  3PX4 A;  2HHS A;  4CJR A;  4KRE A;  2KFN A;  3WNF A;  1BGX T;  1HQU A;  2FBY A;  4F8R A;  5CYQ A;  3F73 A;  1HYS A;  3SV3 A;  1RT3 A;  4FJM A;  1SKS A;  1F21 A;  4O4G A;  5KRS A;  5J2M A;  4CEQ A;  4PUO A;  4CF0 A;  3M8Q A;  4NCA A;  2F8T A;  2HHQ A;  1RBS A;  1WSE A;  1RTH A;  4Z4E A;  1GOC A;  4I7F A;  2BE2 A;  5CY4 A;  3OJS A;  4DFM A;  5KTQ A;  3PUF A;  3PY8 A;  1TKD A;  1ZBI A;  3NGY A;  4KPY A;  4ZTF A;  4FZZ A;  4AHS A;  1J5O A;  2VWJ A;  4PY5 A;  2O4G A;  2X74 A;  3AVG A;  3LAN A;  4CHQ A;  1S6P A;  1W0H A;  3IAY A;  3LZI A;  3AVF A;  4M45 A;  3CFP A;  1SL2 A;  3B6O A;  3M8R A;  3KLH A;  5HBM A;  3V1R A;  4FM2 A;  4GVM A;  1A5V A;  1LW2 A;  3I0S A;  2E6M A;  1WSJ A;  5KGX A;  3LPU A;  1ASU A;  3OYB A;  4IKF A;  4NCB A;  4FYD A;  3DRS A;  3MAQ A;  2HB5 A;  3NGI A;  3OYD A;  4HHT A;  2RPI A;  4DS4 A;  3SUN A;  2HHU A;  2RKI A;  2KZM A;  4OPJ A;  3PO5 A;  1S5J A;  3IS9 A;  3L3U A;  5K14 A;  4DSI A;  4KHQ A;  2HHV A;  1NK7 A;  1RDD A;  4FLU A;  4AIL C;  1RTI A;  3V9X A;  3LP1 A;  1TKZ A;  3SPY A;  1XWL A;  1TVR A;  2Y1I A;  3HO1 A;  5J2P A;  3M8P A;  1XHX A;  1IO2 A;  4CE9 A;  3NDK A;  1JXE A;  3HVT A;  1CXQ A;  1YVU A;  4KHN A;  2KQ2 A;  3ZT0 A;  3NAE A;  2D0B A;  3TR8 A;  1X9S A;  1C1A A;  4GMJ B;  3B6P A;  1VSE A;  4FM1 A;  2HW3 A;  4LH4 A;  3P1G A;  4HVJ A;  3KKR A;  3RRH A;  2JLE A;  1XHZ A;  3RTV A;  1N6Q A;  4DSL A;  1U48 A;  1FKO A;  2FBV A;  2IS3 A;  4FVM A;  2X6N A;  3ZSO A;  4B08 A;  4CHZ A;  1ZBU A;  3ZSV A;  1TK5 A;  4FJG A;  1VRT A;  2FBX A;  4C8N A;  3VQE A;  1B9D A;  4W5Q A;  1I3A A;  4CK2 A;  4OKE A;  4XIU A;  1VSD A;  5JS1 A;  3V9Z A;  4BAC A;  1NKE A;  4OVL A;  4DSE A;  4N5S A;  3U3G A;  3OYA A;  1RT5 A;  3AVM A;  1T8E A;  3HK2 A;  3AVN A;  2P1J A;  4DFP A;  4E7I A;  3OYF A;  3ZSQ A;  4OGC A;  1NOZ A;  1RIL A;  3U6F A;  4NYN A;  1CLQ A;  3ULD A;  3CYM A;  2DFE A;  4CJQ A;  3V9W A;  2DFF A;  3WNG A;  2ITG A;  4KHU A;  4ZTJ A;  1NOY A;  3L2Q A;  1HMV A;  1RNH A;  5C42 A;  1ZBL A;  3ALY A;  3K57 A;  1X9M A;  1Y97 A;  1BI4 B;  1UOC A;  4E89 A;  5HRP A;  4BDP A;  4C8M A;  4EZ9 A;  4PA1 A;  3C6U A;  4FLW A;  1EXQ A;  4MFB A;  5T7B A;  1T03 A;  3LZJ A;  2Z1I A;  4FJ5 A;  1HPZ A;  4EP5 A;  5EU7 A;  1WAF A;  4C8O A;  4J2A A;  4W5N A;  3OJU A;  1R0A A;  4K8X A;  4FJK A;  1VRU A;  2NUB A;  3VQP A;  3PX0 A;  3AA5 X;  2KZZ A;  4JS4 A;  4CGD A;  4FW1 A;  4HTU A;  1HNV A;  3KD1 E;  1RBV A;  2HHX A;  2KFZ A;  3C6T A;  1D8Y A;  2FBT A;  3DOL A;  1RDA A;  3MEG A;  3NGZ A;  2OZS A;  3D0P A;  4HCC A;  1EX4 A;  1S1W A;  2RN2 A;  3DRP A;  3T1A A;  1Q9X A;  1C0T A;  1IKW A;  1RBR A;  3KLF A;  2G8F A;  4B9V A;  1JLE A;  3WNH A;  3ZT3 A;  5KGW A;  2IGI A;  3AO4 A;  3LAL A;  1Z26 A;  1RT6 A;  3V1Q A;  3AA4 A;  3V1O A;  1KCF A;  4Y1C A;  4BE1 A;  1EKE A;  1K6Y A;  1U04 A;  4B8A B;  1NJX A;  4J2B A;  3QEW A;  1UA0 A;  1RT4 A;  1BIZ A;  3VQQ A;  5HRS A;  1T7P A;  1VSL A;  1G15 A;  3AVB A;  3TAB A;  2QK9 A;  1TAQ A;  3MXI A;  2GV9 A;  1L3U A;  4N76 A;  3OYK A;  1C1C A;  4GW6 A;  4CER A;  4CJT A;  3VQ6 A;  2G8U A;  3KK2 A;  4B9U A;  4Q0B A;  4LSL A;  1BHL A;  2IOC A;  4DQR A;  3CM5 A;  4CEC A;  3QEV A;  3OYN A;  4L8R B;  2IDO A;  3DOK A;  1HYV A;  4O55 A;  1DTQ A;  4RW8 A;  3ZT4 A;  3TAQ A;  4FJ8 A;  2IC3 A;  1IKV A;  2HVH A;  4KTZ A;  4DLE A;  4B8C A;  1IG9 A;  3OYJ A;  4O5B A;  1ZBF A;  4RW6 A;  4HUF A;  2YNG A;  3TAM A;  4FJH A;  2HMI A;  5FDL A;  2EHG A;  3QEI A;  3VQ7 A;  1WSH A;  1CZ9 A;  1TK8 A;  2LSN A;  4LH5 A;  3NF7 A;  1TL1 A;  4CF9 A;  1SKW A;  3LPT A;  1BQN A;  1UAX A;  4M3T A;  4BE2 A;  3ASM A;  3OYI A;  3VA0 A;  4QOZ B;  4IG3 A;  1JKH A;  3VQ9 A;  1EP4 A;  1CZB A;  3MED A;  1NK4 A;  4LY7 A;  2VG5 A;  4CCH A;  2QXF A;  4YNQ A;  4I9L A;  4M3U A;  4PQU A;  3V81 A;  3VQD A;  4CJW A;  3RR8 A;  2OA8 A;  1TV6 A;  2D0C A;  5SZT A;  4E7K A;  2D5R A;  4CGH A;  2Y1J A;  1LAW A;  4J2E A;  1SL1 A;  4J2D A;  4PWD A;  1S9E A;  4FLV A;  1YT3 A;  4H4M A;  4CF2 A;  3QNN A;  3TAN A;  3THV A;  3S3M A;  4ELT A;  1BCO A;  4ELV A;  1HYZ A;  1L3S A;  4IDK A;  1JL2 A;  3VA3 A;  3LP0 A;  5I42 A;  4DLG A;  4CIE A;  3NCI A;  3HXM A;  4B9N A;  4DTM A;  3DI6 A;  4B9M A;  4KRF A;  4JRP A;  3TAF A;  1GOB A;  3MEE A;  3G0Z A;  1ASW A;  4Z4F A;  4E7J A;  1RCH A;  4FW2 A;  3U3Y A;  5HLF A;  1KVC A;  1QSL A;  4OKK A;  3DRR A;  2DFH A;  3HPH A;  4CK3 A;  1TKX A;  4Z4I A;  3SQ1 A;  1J54 A;  3KLG A;  5E41 A;  3ZSR A;  4O44 A;  3QEP A;  5KI6 A;  3DMJ A;  3ZSW A;  2VWK A;  4CJ5 A;  4Q5V A;  2E6L A;  2YHA A;  4EP4 A;  3OY9 A;  3BGR A;  1QSY A;  3SJJ A;  2QKK A;  2B6A A;  3AVL A;  3P83 D;  3ZSZ A;  1RDB A;  3F9K A;  1JLF A;  4E3S A;  2HVI A;  1HRH A;  3E01 A;  1NK5 A;  4CES A;  4M3X A;  1SKR A;  1RTD A;  2F96 A;  4C8K A;  3SPZ A;  4KB1 A;  1JLG A;  4FJN A;  3K5O A;  2HNY A;  4KKO A;  4B9L A;  4DWI A;  4CGG A;  1WSG A;  4CJP A;  5CZ2 A;  3WNE A;  2XY8 A;  1EET A;  1RBU A;  3SQ0 A;  3ZT1 A;  3C95 A;  4E0D A;  3VQA A;  4DTJ A;  4CJS A;  1VSK A;  4CGI A;  4CF1 A;  3RR7 A;  4E1N A;  1QS4 A;  3AVA A;  3IRX A;  4RW9 A;  3FFI A;  1DLO A;  4ZHR A;  5C25 A;  3S9H A;  2VG6 A;  3PX6 A;  4DFJ A;  1JLQ A;  3V9S A;  1RT1 A;  3TAE A;  4W5R A;  3VQC A;  4Z4G A;  1J53 A;  4IFY A;  1U49 A;  3AO1 A;  3VQ8 A;  1NJY A;  2Z1J A;  1TAU A;  4DF4 A;  3NF6 A;  1Q9Y A;  1LWC A;  3ZT2 A;  3AO3 A;  3KLE A;  4CJV A;  3QLH A;  1VSH A;  1HNI A;  2D0A A;  3HT3 A;  3EY1 A;  4W5T A;  4UQG A;  3HP6 A;  1UWB A;  4E1M A;  3K5L A;  3M8S A;  2DTU A;  3QIN A;  4KFB A;  4DTR A;  1S1V A;  3L3V A;  4M41 A;  4OLB A;  2Q3S A;  3AA3 A;  4DS5 A;  2G8K A;  3OS0 A;  1NK0 A;  3LAK A;  3P5J A;  3RMA A;  3KLI A;  3VQB A;  3IG1 A;  4CHO A;  4CJF A;  1S6Q A;  3PV8 A;  1S1U A;  3AVC A;  3ITH A;  3K2P A;  1CXU A;  1SV5 A;  2HNZ A;  4KV8 A;  4RW4 A;  1DTT A;  3ISN C;  3MXJ A;  3VQ5 A;  3SCX A;  3L2V A;  4AHT A;  4LD0 A;  1NK6 A;  4FJX A;  3S3N A;  2Z1H A;  4FZY A;  3CQ8 A;  4FK4 A;  1JL1 A;  4KO0 A;  2XHB A;  2YNH A;  3KD5 E;  1WSF A;  4KHW A;  4DFK A;  3SUP A;  4Z4H A;  1JLA A;  3AO2 A;  3SQ2 A;  3A2F A;  4CEF A;  3QIP A;  2A1S A;  3RMD A;  3AO5 A;  1KLN A;  4DU4 A;  1BI4 A;  4NCG A;  4CJK A;  3L2R A;  3HPG A;  3VN5 A;  1C0M A;  2YNF A;  2BGG A;  4DTP A;  3TI0 A;  3AVH A;  1C6V A;  1X9W A;  2G8H A;  3OYM A;  1QTM A;  1UA1 A;  4CHN A;  4B9S A;  4KAZ A;  1NKB A;  4FJI A;  1KLM A;  4AHV A;  4CIF A;  4CFC A;  4B3O A;  4CJL A;  3AVI A;  2I5J A;  2EX3 A;  1LV5 A;  3BDP A;  1WN7 A;  4OKJ A;  3HP9 A;  1D5A A;  4BE0 A;  3LWL A;  2G8W A;  3CFO A;  4FJJ A;  1NJW A;  1KFS A;  4HUE A;  1ASV A;  1FXX A;  3DLH A;  5HRR A;  1NJZ A;  2QKB A;  3DLK A;  4DQQ A;  1NK8 A;  2DY4 A;  3VQ4 A;  3L2W A;  2ZQB A;  1SUQ A;  4ICL A;  4WE1 A;  1KRP A;  3OS2 A;  1SL0 A;  2F8S A;  3ZCM A;  4FJL A;  4DTU A;  4KB0 A;  3SNN A;  3CM6 A;  4OGE A;  3HM9 A;  3DLG A;  5C24 A;  1BIU A;  3H08 A;  1L3T A;  2A1R A;  1RT2 A;  4ID1 A;  4O0J A;  3OYE A;  1VSJ A;  1JXB A;  1D9D A;  2OPR A;  3NF9 A;  3JSM A;  1MU2 A;  1KSP A;  3V6D A;  3DM2 A;  3L2U A;  1L5U A;  3KTQ A;  2OYQ A;  4Y1D A;  4AHU A;  4CFD A;  1W9H A;  2YKN A;  4Z4C A;  1TL3 A;  4YFU A;  4R5P A;  1A5W A;  3HST B;  4BDY A;  3I8D A;  1KTQ A;  2BDP A;  1RTJ A;  1Q8I A;  5CZ1 A;  1HJR A;  3SV4 A;  4FJ9 A;  3T3F A;  2VG7 A;  4ID5 A;  2ATQ A;  2IAJ A;  2X6S A;  3KK1 A;  3SZ2 A;  4DQP A;  4F2S A;  4M3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...