3EE8A

Structure of ns1 effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structure of NS1A effector domain from the influenza A/Udorn/72 virus.
pubmed doi rcsb
source organism Influenza a virus (a/udorn/307/1972(h3n2))
molecule tags Viral protein
total genus 33
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ee8A00
3EE8A 3M5RA 3KWGA 3O9QA 3O9RA 3O9TA 3EE9A 4OPAA 3D6RA 2GX9A 3RVCA 3P38A 3O9SA 3O9UA 3L4QA 4OPHA 2KKZA 3KWIA 3P39A 2RHKA 3P31A 3F5TA 3OA9A
chains in the Genus database with same CATH superfamily
1BWFO 1Q9YA 1NGCA 4WFNL 4DV2K 4O5BA 4WYBA 2ETJA 3VF6A 3MXMA 5GIPA 1IKVA 2O8DA 2ATQA 1BISA 2O4IA 4CGIA 5M1FA 1WNSA 3VQ7A 4KTZA 1T6CA 3VTHA 1RBVA 4H0XB 1Q86O 3ZSYA 4ILGB 3TU5A 4WF9L 3OYMA 3CJ9A 1HYVA 1ITGA 2VG5A 3O9RA 2AA4A 1O1WA 1TL1A 3DI6A 4A61A 4JK9A 3AO1A 2P9IB 2QWQA 1ZYQA 2HMIA 4CFBA 3QEWA 1ATSA 4I7FA 1JLAA 4K43A 2D1KA 2FBTA 1T44A 1A5XA 1TKZA 5EVZA 3V6DA 2X78A 3TABA 3S3OA 1XWLA 4CBXA 3HP9A 3OYCA 5KPRA 2NRVA 3SUQA 1HKCA 3WT0A 4E1NA 4FWQA 3H3NO 5JS2A 4BRAA 3KKRA 3CFRA 4KV8A 2HF3A 4H5TA 4CFCA 4CZJA 3O9UA 3LZIA 2YHWA 1TUUA 5I9EB 4LF5K 2VGNA 1VQ9N 3J8AA 3BP8A 1X1PA 2NRRA 4IOCL 2EX3A 1I39A 3M1FA 1VSJA 2E2QA 4Z4GA 4I6MA 4FW2A 3H1VX 4RG8A 4WQ5A 4QOZB 3PY8A 3QIPA 1LCUA 3WNFA 1HPZA 4FLXA 3VQPA 4DS5A 1OH8A 4CJ5A 3R1XA 4YOXA 2E20A 4DTXA 1XNRK 3CC4N 3KZBA 1NJIO 2X6NA 2BANA 5HRSA 5AZJB 3PIPL 5JVGL 4FXDA 5BPNA 1MWMA 4CIFA 2QXLA 1G15A 3QNOA 3U3GA 1RT5A 3L6QA 3NH0A 4BRMA 5LMNK 2GTDA 4DV6K 4YDUC 2ZGZA 3CC2N 4ILHA 4NLCA 4Y0WA 4M41A 4FJIA 1NK4A 4H4OA 3U9ZA 1WN7A 3JAMO 3V9SA 4NLBA 2E88A 4O0IA 1IH7A 3AO4A 3NFAA 4JKGA 4FJ7A 3SMPA 1EWQA 2KFZA 2RN2A 3VERA 5C42A 2VG6A 4ELTA 3M3ZA 4EZ6A 2QEXN 4CBWA 4HWIA 3FGUA 4FM0A 1BA1A 3E1YA 2VWBA 4N5SA 4E3SA 1QSYA 1YTUA 3DAWA 2YX6A 2KTQA 2O8CB 4OLAA 5AQOA 4PKGA 3A5LC 1OH6A 1KAZA 1SQKA 4CZMA 4JYAK 4JI5K 1P8ZA 4H0TB 2AP1A 4CJSA 3KLFA 3VPZA 4FO0A 2HVIA 2ZM6K 5KTQA 3I8DA 4DSFA 4JKDA 4NXNK 3B6PA 4CEZA 5AQVA 2QKKA 1H1VA 5FPEA 5CYQA 3R8EA 3HL8A 4DB3A 1XC9A 1NU0A 3SBGA 4DSLA 1XNQK 4A2BA 2GWJA 3A5NC 4BR4A 1DTQA 2G8KA 4BE1A 5KPTA 2NRWA 2D0OA 3CJCA 3NH1A 1NJWA 4BE2A 4R5PA 3OYKA 4MO5A 1TK8A 3VQCA 1QZ6A 3VQ6A 2XRIA 3J81O 3F2KA 2HBLA 3BDPA 3E9LA 3SMSA 2Q97A 1D9DA 4BQZA 1GLAG 4JN4A 4DSJA 4B3RK 3CCRN 3OW2M 4KFBA 1EX4A 1U47A 1V4SA 2E6LA 1LWCA 1XUPO 1KCFA 4BRKA 2GV9A 1DKGD 4AM7A 4LF6K 4FM1A 1TL3A 2QWPA 1CXUA 3VGKA 1VQNN 1ZBFA 3EL2A 4FSVA 4OGCA 2RF2A 1DGKN 1OKJA 2QWRA 2G8UA 3O9SA 4E89A 1IBLK 3CCQN 1REVA 2ASOA 1VQKN 3ZT1A 3G0ZA 3ZT0A 2IOCA 4N56A 1Q9XA 1S22A 4YDUA 3THXA 1LW0A 2P9UA 1NLVA 4KHPK 3ZETB 2ZGYA 4DU1A 3U6FA 3RRGA 2KZZA 4FZZA 1HQEA 4BE0A 4M3RA 1WUAA 1OVYA 4H4MA 2HVHA 1XHZA 4LFBK 4CW7B 5AQTA 1BI4B 4Y1DA 1T6DA 2B6AA 1X9SA 3HO1A 4FJ9A 4DKWA 3CHWA 2WONA 2Q1NA 3U8XA 1W9HA 1NWKA 3ULDA 1NJYA 2IIRA 4YORA 5FDLA 3HPHA 3N4PA 2A6AA 4ELUA 1NOZA 3BZKA 4JEPA 2WUSA 2X6SA 1B92A 4FJMA 4YOTA 4PUOA 2HW3A 1L3SA 4FJHA 2OPRA 4OKKA 1UOCA 5BRHA 4CEBA 1X3NA 5DM6L 4CZLA 2P9NA 3KKSA 3VGLA 3TAEA 1BDGA 3PX0A 2UUCK 1VHXA 2W40A 5GAHP 3ZX0A 4FYDA 3OS1A 2HHHK 4BROA 4PWDA 3TR8A 1VQPN 1EXQA 4DR5K 2QA4N 1L5UA 3VEZA 4UY8O 2E6MA 1BQMA 3B8AX 3E66A 5C12A 3WEEA 2FXUA 3M6GA 2RPIA 1KRPA 2GEMA 1YJWN 4BY9C 2JWLA 3KLIA 4BR7A 3DXKB 4NXMK 1BHLA 3QFPA 3M8QA 3OYAA 1KD1O 4QS7A 5GADP 1RT2A 1GOAA 4J2BA 3IG1A 3M8SA 3C6HA 1GLEG 4B3SK 3C0BA 3VEVA 4PQUA 1YVNA 2A41A 3OYDA 2W6KA 4CBUA 2X74A 4WQ4C 4DU3A 1RBUA 1K9MO 2DFFA 4CGFA 4CJEA 3SAGA 3QBWA 3VESA 5C24A 4CERA 2YHYA 4FK0A 1SL2A 4OPKA 2IVPA 3KK1A 3RVCA 4LF7K 1MWKA 1YHQN 4XEIA 5GAGP 3L4QA 5HP1A 3NHGA 4KREA 4M45A 1BGXT 5J2QA 3KVGA 1KVCA 1GLFO 1BIZA 3V9WA 4CE9A 4M7YA 1QVFM 5BPMA 4EHTA 4XIUA 4FJ5A 4DQPA 4FOIA 3CQYA 4W5TA 2UXCK 4W5QA 5LJWA 3THWA 3D2FB 2FSKA 2RKIA 1QTMA 1HJOA 4Z94A 5K14A 1NK0A 4W5NA 4E1JA 2B4JA 4FWOA 4CJRA 2D5RA 4K0KK 1RT1A 1T7PA 4FWKA 4BRQA 1YIJN 3QEXA 1KVBA 3TPQA 3WXLA 4M42A 4DR7K 3NMUA 2V7ZA 3CF5L 3HTVA 3WXMB 4PY5A 3A0IX 2HHUA 1SAZA 4F9OA 3P39A 5BN8A 2OZMA 3P4IA 3MEGA 3CI5A 2YV0X 4DLEA 3NAEA 1OH7A 4A2AA 4B9MA 1B9DA 3A2FA 3VQ9A 4CK1A 4U67L 4AQYK 2P9PB 4OPAA 2FSNA 3DWLA 3HBTA 2YHBA 5CY4A 4AILC 4MFBA 1YT3A 1HMVA 1K8KA 3VQ8A 3V81A 1ESVA 4I9QA 3H46O 3U4LA 5KRSA 4BG8A 1X9JA 1BU6O 1Q81O 4JHDB 5J2PA 4IOXA 2BH1A 1KXPA 5DK5A 3EZ5A 4MO4A 4PKIA 1JLQA 1SS6A 1S1VA 1EKEA 2F96A 1KFDA 4B1VA 3AA4A 1N8RO 4DTJA 3NBPA 4WQ4A 1WSIA 3V9ZA 4IEEA 3HT3A 1RBTA 1XMQK 4KHSA 4YOVA 4E7KA 3PX6A 3AO3A 2D4WA 4BRLA 1HNXK 2PFUA 3QMLA 4BDPA 3MDQA 2O8FA 4BWJA 1QS4A 4OLBA 4DV0K 3O4WA 1B9FA 4CZGA 3MN5A 4OPJA 2KZMA 4NYNA 1D4XA 4FPAA 4ICLA 2PYJA 2NRHA 2WTUA 3KTQA 1IKYA 1Q18A 3SJHA 1IKWA 3TAMA 5IWAK 2NUBA 2NRXA 3SV3A 1ZBLA 1KLMA 1C0TA 1RGIA 2PBDA 3K9KA 1VAZA 3LPTA 3SPZA 2GBZA 3ULEA 3AARA 3ZSOA 3MECA 5F2RA 2F7TA 3EE8A 3WNHA 1W2BM 3MCPA 1NGGA 4PKHA 4BR2A 3CERA 4BREA 3MXJA 3O3FA 4EHUA 4JAXA 3ZSVA 5BRDA 3OYJA 3RWUA 4BRCA 4DCHA 1L3UA 1L3TA 1Q8IA 2A3ZA 4I9LA 3UB5A 4IJAA 1NMDA 3QLHA 2P9LB 4QAGA 4CECA 4Z4HA 1IBMK 5FRMA 4BVOA 1QHAA 4KHUA 3BEXA 3QESA 1MA9B 3W0LA 1NJXA 5AZIA 3LALA 3CCUN 3DXMA 3ISNC 4GKKK 1LAVA 3L2WA 4E7IA 1TYQB 3EKSA 3DRPA 1N32K 5JLHA 5M1OA 4FVUA 4JRPA 4CJTA 1Z25A 2H3GX 5AQRA 1GLDG 3F73A 3OYLA 4OGEA 1TAQA 3NGYA 3R6MA 5HL7L 3LWLA 2HF4A 4FVMA 1IBKK 3OYFA 4PL7A 4M3TA 5AQLA 1RDAA 1OH5A 2D0CA 3CIPA 5AQJA 4H8KA 1YXQA 1WLJA 2OZSA 4JKAA 3L2QA 1U49A 4KHQA 3QFUA 1VQ4N 1N33K 2WBNA 4H0PA 3ID6A 3NCIA 4KH6A 4CJ7A 1YITN 2P51A 4JKCA 4H0VB 3EZWA 3SQ4A 5KQ8A 4DR3K 3FZFA 3IS9A 3LP1A 4FPBA 2BUPA 5ADXH 4GMJB 5AQWA 1LV5A 3QO9A 4DFPA 4E7JA 4J2DA 4O0JA 1UAXA 3QDKA 3AVGA 1ASVA 3PSFA 3CQ8A 3AVMA 1CZBA 1T05A 4H5RA 5BREA 3AO5A 3C6TA 3PO4A 4B9NA 4W5RA 5DM7L 4Z4IA 4FCYA 3I33A 4DV3K 2HB5A 4F2SA 4ZTFA 3NVKA 3VEXA 5FPDA 4KPYA 2A42A 4DQSA 2E2PA 4C8MA 3O1BA 4FJGA 3O3GA 1NG9A 4KAZA 1KAYA 4DSKA 3T1HK 5A2QO 4HUGA 4U7BA 4FLYA 4CJ3A 4CFDA 2O8EB 2QXFA 3AY9A 4CEOA 4JD2B 3F9KA 3VQAA 4OPHA 2FC0A 3H3OB 3Q7CA 1WBBA 4A57A 5AQHA 1D5AA 1VQLN 2CH6A 2QI2A 4B1WB 1QSSA 4FOEA 3MWTA 4GKJK 1VQ7N 4CHYA 3JS6A 1J6ZA 1E4GT 3WNGA 4JI2K 1C1BA 1BO5O 3KK3A 1HYZA 2YI1A 4IZ9A 5TKYA 1WSHA 1X3MA 3L2VA 3ID8A 4AHSA 3SYZA 3B6OA 4J2EA 1LWFA 3VMFB 4C8KA 4ISGA 4O4GA 3IFRA 4PHTX 3HZ6A 1NK8A 3KK2A 2P9SB 5AQXA 1HPMA 1YAGA 4DTRA 3AAQA 4B3OA 4DWIA 5AQIA 4B8AB 4E19A 1A5WA 1VSFA 4LFAK 4M3UA 3O8MA 4BDZA 2DY4A 3KLHA 4CHPA 1TK0A 5GINA 4IJNA 1S1TA 4H0OA 2P9IA 3S3NA 2XY6A 2DTUA 3ZSRA 2YKMA 4RW6A 1RFQA 2EWSA 4RW4A 1O13A 1NGFA 1Y97A 4G9ZA 3FLCO 1SZ2A 1U48A 5E84A 1M90O 2UXDK 3VQQA 2E1YA 4HVJA 4NYFA 1RDUA 5HLFA 2YHXA 3H45C 1NGAA 1C1CA 1ILYA 3JSMA 1BA0A 3ZEUB 2G8WA 2BE2A 2A40A 1JCGA 1YF5L 2KKZA 4BGAA 3T19A 3MXIA 1M1KO 4KH5A 1ZBIA 4IFEA 1K8AO 3DOKA 3UKUB 1WSGA 1BUPA 2KHOA 5HRNA 1P90A 4EFHA 4Z4FA 5C25A 1GOCA 3OS0A 2VWJA 3SLCA 3ENBA 4BC4A 1JL2A 3SAFA 2BDPA 3ALYA 3TAFA 3EN9A 4DFKA 4BRGA 3SPYA 3L2UA 4CI6A 4KHWA 3MX5A 3HM8A 1RILA 1TUYA 3OBYA 4CFAA 3PIOL 3O4QA 4OO1J 4FWSA 1VRUA 3WXJA 4CD1A 5EY4A 3ENOA 1S72N 3RR7A 3PO5A 4FWRA 2AJQA 4CZHA 3GOIA 5AZJA 3QEVA 4C8LA 5CZ1A 5AQKA 1FKOA 1BG3A 3C7NB 1JLBA 1NK6A 3HVRA 3DLEA 3K2PA 3VEOA 4O8UA 1U4BA 2WFBA 2XY7A 1JXEA 1F21A 3HPOA 3K5NA 3VETA 3SAHA 4HUEA 4I2QA 1Y64A 1HRHA 3OHRA 4YFUA 2NLXA 3OJUA 4OVLA 4HCCA 1WSEA 1G99A 4FZYA 4M3ZA 2XY8A 4JK8A 1FKPA 2Q36A 3P38A 1BCMA 3WQTA 2G8HA 2D0BA 3CYMA 4A62A 3DRRA 1K73O 2O8CA 5JMVA 1VRTA 1NGBA 1SKWA 3C95A 3SCXA 3MEDA 1T8EA 3AVKA 1IV0A 3VOVA 2DFEA 3LM9A 5BN9A 2VG7A 3AV9A 2HOEA 5AFUH 1ZXOA 3SBTA 3VQ4A 3D6RA 1BL3A 2GUIA 3T1AA 1T03A 4AH9A 4HTUA 3GL1A 3OYEA 3QBXA 4IEIA 4EP4A 1TKTA 2HSTA 2VYPA 4Q0BA 2ITGA 4CK3A 1BCOA 1JLEA 1VSEA 1QQCA 2CGKA 3NGIA 3RSEB 3O1WA 4DHYA 2CGLA 3EE9A 2ITMA 4AHUA 1C0MA 5CHIA 3TARA 4CGDA 3K5OA 5M1PA 2FF3B 5IT9O 4E7HA 3V1RA 4DQ8A 3O08A 3FZKA 1ATRA 4JI1K 4GVEA 4IFYA 2W6LA 1KTQA 3MN7A 3I56N 4DQQA 1S3XA 3ATVA 4CHQA 4CIEA 4UQGA 3FZHA 4LC9B 3OYGA 3L2RA 3O9TA 3RMBA 1HYSA 1HR0K 1HNZK 3O3HA 1TV6A 3LP2A 2VGMA 4M63C 4IKFA 3LP0A 1U2VB 3CQXA 1C6VA 3ZT2A 1XC3A 4KHNA 5E26A 1VQON 5AQUA 3J7YP 3M8RA 4B9LA 3OA9A 3C6AA 1ASUA 1C0GA 2E8AA 5KQDA 3C65A 1YJNN 2IVNA 2HHSA 4O8KA 1K6YA 1R59O 1FW6A 1V4TA 1ZBUA 4BDYA 1BIUA 1DEJA 1HNWK 4F2RA 1C0FA 3ZETA 4YOUA 4B9UA 4IXCA 4CJWA 4F3TA 2VWKA 5C2FA 2IC3A 3PLAA 1Z6RA 3A5MC 2OTJN 4JRQA 1WOQA 3MEEA 3LAKA 4CK2A 3AAPA 3LDNA 1BI4A 1MDUB 1RBRA 5HROA 5TKWA 1RCHA 3VQ5A 4F3OA 3CMEN 1VQ5N 1EP4A 2FBXA 5M1KA 3LM2A 3FZLA 4FLTA 3SZ2A 3D2EB 2KFNA 3IRXA 1GLCG 4BC5A 3VA3A 3THYB 3DLLL 1YVUA 3K5LA 2IVOA 4CEQA 1N34K 3NE6A 4YY3K 3UIQA 1NOYA 2NRZA 5HRPA 2Q31A 3O6WA 1KAXA 1ZBSA 4OKEA 5LY3A 3ZYYX 3FR0A 1RTHA 1I3AA 4ISEA 1NMNA 4L8RB 1ASWA 4KO0A 1XMOK 3HSCA 1D8YA 1RDWX 4N41A 2IDOA 3AVAA 4DUYK 3ATUA 3KLEA 3FFIA 4KTQA 4B9SA 1E4FT 3LPUA 3AA2A 3QIOA 3KD1E 4BACA 1NBWA 1C0UA 1EQYA 3EYZA 1GOBA 3ZSWA 3AVHA 3CG7A 4E7LA 3AGRA 4CESA 2WOMA 3HP6A 3V4IA 3OYIA 3DXKA 3TTCA 1VQ8N 4E1MA 1Q82O 3T1YK 3ZSXA 1QQMA 4CJQA 4K42A 1FK9A 2HHTA 4LH5A 3FE1A 3RRHA 1NKEA 4JI0K 4JLHA 4EIAA 5MLCQ 5AQPA 1SUQA 2XY5A 2CGJA 4GNIA 1QE1A 2HHWA 3CM6A 2ZJQL 4G1QA 3BF1A 4DTOA 1W97L 3AA3A 4QS9A 2D0PA 4K41A 3UKRB 2Q3SA 1VSHA 3DRSA 1JL1A 2O8BB 3K9JA 2W42A 1RT7A 2YNIA 4LY7A 2OCEA 3AO2A 2D0AA 3P31A 3HI0A 3CFOA 5EU7A 4JKEA 4B9QA 1TK5A 4DR4K 2IS3A 2YKNA 1KFSA 5GIOA 2DPNA 4KI6A 4NO7A 3DLGA 4JV5K 2YNFA 4JK7A 4CJ4A 4CHZA 4GVMA 1S1XA 4TSXA 2F8TA 4BRFA 3CFPA 4H0YB 4CZFA 3VGMA 3MN9A 2F9WA 2HBMA 2ZJPL 3ZLJA 3SV4A 2P9KB 3D2FA 3S9HA 3HPGA 4FLWA 1C1AA 3SI6A 4KB0A 5HOOA 5T7BA 4PA1A 4YOWA 3KWGA 4EP5A 3VA0A 4NCBA 3G10A 3O80A 1LAWA 3IKMA 5AQNA 3CCSN 3KIOA 1LOTB 2CH5A 5AQZA 4WE1A 4H5VA 3E9PA 3KLGA 3AVIA 3RTVA 4CHNA 3L8BA 2QM1A 3LDPA 4YNQA 3ASMA 2Q2RA 3LL3A 4MQ3A 3F9MA 3NF6A 2RE2A 3H08A 4WFBL 1NGJA 3LAMA 4DUZK 2FF6A 3IAYA 4PL8A 4RW8A 3JYTA 1WAJA 2QWMA 5JICA 3JXUA 4DFMA 2O8DB 4B3TK 2P5GA 4B3MK 4DFJA 2P9PA 2XO7A 3CPWM 1Z05A 3HM9A 2G8IA 1VK0A 2F4VK 3FZMA 1IKXA 1EWRA 2NNWA 4MLEA 4XH1A 1N36K 2E5LK 3D7EO 3TSQA 3GE1A 4XH5A 2Q0UA 2VCPA 4CEFA 1HLUA 2V7YA 4JHDA 4O55A 1NGIA 3WXIA 3V9UA 5AJ3K 3O9QA 3TAQA 3TANA 2HHXA 4HTLA 2YJFA 2OTLN 3VN5A 3EO3A 3CPEA 3K5MA 5CR4A 1QHTA 1CZ9A 4FM2A 4DTUA 1WBDA 1VSKA 4K8XA 2F8SA 2V51B 4BR5A 2UYTA 5FLXO 1NK7A 1SL1A 3K58A 2ZWHA 2G8FA 3HOTA 3EEQA 3RMDA 2GX9A 3KK7A 4K25A 2E2OA 2FSJA 3NH2A 2A1SA 3TAGA 1UWBA 1U45A 4MDBA 4AM6A 4CF1A 3CCVN 4C8NA 5LJVA 3OYNA 2KLAA 1XHXA 4CF8A 4I6MB 4H5NA 4B1ZA 2PZSA 3V1QA 2OYQA 3J7AP 1RT6A 3QICA 4DTMA 4EZ9A 4IBNA 5CZ2A 1NJZA 2G8VA 3QB0A 3ZT4A 4JI6K 4BGBA 2FBYA 4R79A 3K59A 3ENHA 3MX2A 2B5JA 3SUOA 3OJSA 2HMPA 3O4NA 1HJRA 4FWPA 5AQYA 4X65K 1TAUA 2P9LA 2JLEA 4W5OA 5JLFA 4JS5A 2ASMA 2ZF5O 3PV8A 5SZTA 2R7YA 1N5YA 4GW6A 4CJKA 3O5BA 4J2AA 1WAFA 1HNVA 1VSMA 1LW2A 3AGKA 1TYQA 1S1WA 4AHTA 1NM1A 4JKGB 4CGJA 4H5WA 3HSTB 2ZQBA 4IG0A 3CCJN 1QQNA 2W41A 4DV7K 3GG4A 3S41A 4GV3A 1YTAA 4FWNA 5BRFA 4CVNE 3BUZB 4DV4K 4DMNA 1JKHA 1WSFA 1RDBA 3PUFA 2YNHA 3THVA 4N47A 5LMUK 5E41A 4HUFA 4DG1A 5I42A 1S6PA 4ZHRA 3L4IA 3U9DA 1CXQA 4FL9A 3MN6A 4BR9A 3V1OA 3NGZA 1J5EK 4AHRA 1MU2A 2OPPA 2ZE2A 3KHYA 3HVTA 4DS4A 1NGDA 3MMVA 5CYMA 3P5JA 3IMXA 3VQBA 3P83D 4C1NK 4WCEL 4KI4A 1EO1A 2NZTA 3QETA 4FJ8A 4ID1A 3VEWA 3E01A 4CF2A 1J54A 4MDAA 2WC9A 4X62K 1D9FA 4H03B 1JLGA 1SKSA 2HBKA 3LDSA 1JLFA 4DTSA 1CLQA 2ZD1A 3M5RA 3DLKA 5BPLA 3HOSA 1QSLA 4DF4A 3OBWA 3WQUA 4Q5VA 1ZC6A 4BWMA 3VF2A 4DR1K 1L3VA 4X66K 1NKCA 4BR0A 1TKDA 3CCEN 1TVRA 5BR8K 3MAQA 3OS2A 2O8EA 4JD2A 2JGUA 4HHTA 4CEDA 4JNEA 5HRRA 3LANA 4CZKA 1RDCA 4FJLA 4IG3A 2GELA 2I7PA 4YOYA 4A5AA 3OVNA 3SQ1A 3DMJA 3KD5E 1NGEA 2PYLA 3DLHA 4CZIA 3G71N 3RR8A 3K0SA 3LDOA 3ZX3A 4RCHA 4OJRA 2FLOA 3ZSQA 3THXB 4IO9L 5AQSA 2P9SA 2P9UB 4JS4A 1XQSC 1FJGK 1SL0A 3SUNA 4DR2K 4RTFD 2UU9K 5EXWA 4C8OA 2QWOA 3QNNA 1U6ZA 1HUXA 1HKBA 2KW4A 4KHYA 4CJVA 1R0AA 2QWNA 3IUCA 5AQFA 3SNNA 4CF0A 3NVMA 4HCBA 1JCEA 3TSPA 3CCLN 3SJJA 2E2NA 1KLNA 4RWTA 2Y1JA 3KJVA 1ZBHA 3W3DA 3G4SN 4B9VA 3G25A 4FJXA 2GWKA 5KGXA 3NF9A 4CJLA 3DLRA 4V19S 4CEAA 3WUHA 4Z4EA 1DTTA 3EY1A 4KRFA 1W7AA 2F9TA 4I2PA 1VSLA 3ZEUA 2P9NB 3TAPA 4B1UB 4IDHA 4CF9A 1YUWA 3HYFA 3SQ0A 4FK4A 3OY9A 2E1ZA 3QEIA 2GUPA 4RW9A 3I55N 1LWEA 3J80O 4B08A 5B8HA 3UKUA 1YJ9N 4ELVA 2QK9A 3SUPA 3NDKA 4KB1A 4BRIA 1IG9A 4BRDA 4F8RA 3WEEB 4AHVA 3AVNA 1KQSM 5EOYA 4B1YB 3F5TA 4KBOA 4JI7K 3A8YA 2Z1IA 3G6EN 4FK2A 3A5OC 3LDLA 5F1XA 2I5JA 2EHGA 4FWMA 4ILJA 3U3YA 4CIGA 5EX5A 1TGOA 2ASPA 3C7NA 1ATNA 4DU4A 2Z1GA 1SKRA 3SK3A 5M1NA 4M3XA 3AA5X 4MLHA 1CZAN 2YCHA 4RW7A 4BG9A 4A59A 4M7XA 2Y1IA 1JXBA 3VENA 4AF1A 1WSJA 3TTFA 3L3UA 1J5OA 4M3YA 1BOTO 2QTDA 4JKHA 4BRHA 2UUAK 3AVJA 5ELZA 4NCGA 4JKFA 4J8FA 1RT4A 5ADXA 4GV9A 3VF4A 2J4RA 4FW1A 4GV6A 4QS8A 2NRTA 4CJUA 3LDQA 1NKBA 4IO8A 1S6QA 3CD6N 3C94A 4LH4A 4BC2A 2ZJRL 3BF3A 3T3FA 1GLBG 5JS1A 4FZXC 2QW9A 3ZSZA 4C23A 2V52B 1E3MA 5FPMA 5FPNA 3L3VA 1A5VA 4KH4A 3THWB 1HKGA 2HNYA 2QKBA 2OA8A 4LF8K 4FLVA 5SWMA 4CGGA 1NK5A 4FJNA 3CJAA 4IFVA 1RTJA 3LP3A 3ZT3A 3PSIA 4DSIA 1FXXA 3IDHA 1RNHA 3VQEA 4JI3K 3RSEA 3DM2A 2IAJA 1J9AA 1WB9A 4JKBA 4DTNA 4DQIA 2Q0RA 3CJ7A 4OKJA 3J7ZO 4Z4CA 3Q7BA 3GBTA 3QEPA 3BGRA 4DV1K 3CJBA 4C1NI 4OX9K 3GDQA 3RMCA 5AQGA 3I8BA 3M8PA 4CZEA 3CXCM 5AQMA 3ZCMA 1UA1A 4ISFA 1EETA 3QINA 3LZJA 4X64K 1K8KB 4JI8K 3CCMN 1JLCA 3VTIA 3D0PA 4E0DA 1RTDA 1IJJA 1RBSA 2DFHA 1I94K 3L0QA 4Y1CA 3SQ2A 1U2VA 3HRGA 4LSLA 1RT3A 2A5XA 4EAHD 2A1RA 4FJJA 1S9GA 1KSPA 4WFAL 3CJ1A 2Z1HA 2HHVA 4KKOA 4IDKA 2KQ2A 3LWMA 3R9PA 5JVHL 4DQRA 3HK2A 3PX4A 3UE5A 2HNDA 2YJEA 2O8FB 1U04A 3T7ZA 4DSEA 5LL6Z 4BQLA 2OANA 4IOAL 1GLLO 3TSUA 4AHCA 5BR9A 4ZTJA 4Z0UA 2BTFA 2P5OA 4LSNA 1YI2N 4QCLA 5M1QA 4FWLA 1KVAA 2BGGA 5KRTA 3OYHA 1GLJO 1VQ6N 1S5JA 3CMAN 1DLOA 5C0YA 5C2DA 3D2EA 3ULEB 3OYBA 4B9TA 2VQEK 3N4QA 4L3QA 4CGHA 3THYA 1X9MA 3CM5A 1NGHA 3R3LA 4LD0A 4K8ZA 4BVPA 4FLZA 1J53A 3D45A 3DJCA 1W0HA 2VQFK 1SV5A 5GAEP 2E4LA 3MCAB 4KTWA 3HXMA 3VEYA 1VSDA 4DF8A 4XH4A 4LFCK 2IGIA 1BQNA 2I7NA 1HQUA 5AZIB 1VQMN 1OVQA 3ZX2A 5J2NA 5CE3A 4CEEA 3CETA 1VSIA 3MWPA 3DXMB 3K57A 2LSNA 2HHQA 1IG8A 3P1GA 2O4GA 3NF7A 5KGWA 5I3UA 3BY5A 4O44A 4CD3A 4CJFA 5KPZA 4F4KA 3C6UA 2XHBA 3EKUA 2P1JA 3I0SA 2YNGA 3RMAA 5AR0A 5C15A 4A5BA 3KWIA 3V9XA 4NCAA 4BRPA 2FBVA 1X9WA 2UXBK 1Z26A 4CHOA 1XI1A 4FJKA 5AQQA 3WNEA 5DMRA 1T3VA 2OPSA 3TI0A 1NNEA 4M3WA 2PAVA 1HX1A 1JJ2M 4LF4K 2HNZA 3WXKA 4BRNA 3AVLA 3T69A 1N6QA 4DV5K 5AFUA 4IWVA 5F0XA 5FROA 1QZ5A 3AVBA 3UKRA 4DR6K 2JWKA 1UA0A 1NK9A 4O5FA 3ITHA 4BC3A 5C10A 5FRNA 4LF9K 2O8BA 1S1UA 1QVGM 4B8CA 2PY5A 3VQDA 2OPQA 4JI4K 3HJFA 3NF8A 2HBJA 1S9EA 3H1QA 5J1EA 3OTOK 3QERA 1JCFA 3FFKB 5J2MA 3DOLA 1KC8O 1IO2A 4NB4A 4CJPA 3TTDA 3BZCA 1HNIA 2UUBK 4DLGA 1Q7YO 5H1SQ 5KI6A 3DLBA 1DT9A 3AVFA 4WQ5C 4FLUA 3E9OA 4YHHK 2P9KA 4DTPA 3I0RA 4B1XB 1TKXA 1RDDA 2Z1JA 4GY2B 4ID5A 3CC7N 3DYAA 2QWLA 4N76A 1RTIA 1QQOA 5D3GA 3MK6A 3AVCA 5HBMA 3TWHA 3S3MA 2RHKA 3H6EA 4CCHA 2YHAA
chains in the Genus database with same CATH topology
1BWFO 4GVEA 1NGCA 4WFNL 3MN7A 4WYBA 3I56N 4JNEA 4CZKA 1S3XA 3ATVA 3FZHA 4LC9B 4A2AA 4U67L 3O9TA 3VF6A 2GELA 2I7PA 2P9PB 4OPAA 2FSNA 3DWLA 4YOYA 3HBTA 4A5AA 5GIPA 2VGMA 1K8KA 1NGEA 4CZIA 4M63C 1ESVA 3G71N 3H46O 3U4LA 1U2VB 3LDOA 5M1FA 3CQXA 4BG8A 3ZX3A 1X9JA 1BU6O 4RCHA 1Q81O 2FLOA 4JHDB 1XC3A 4IOXA 5E26A 2BH1A 1T6CA 2P9SA 2P9UB 5AQUA 1XQSC 4H0XB 5AQSA 3VTHA 1Q86O 1KXPA 3OA9A 3C6AA 1C0GA 2E8AA 4MO4A 4RTFD 4ILGB 5KQDA 3C65A 5EXWA 3TU5A 4PKIA 4WF9L 1SS6A 1YJNN 2IVNA 3CJ9A 2QWOA 4O8KA 1U6ZA 1HUXA 1R59O 3O9RA 1HKBA 2AA4A 1V4TA 4A61A 4JK9A 1DEJA 4B1VA 2P9IB 1N8RO 2QWQA 4WQ4A 4IEEA 2QWNA 3IUCA 1C0FA 5AQFA 3ZETA 1ATSA 3NVMA 4YOUA 4IXCA 4YOVA 1JCEA 4K43A 3TSPA 2D1KA 5C2FA 3CCLN 3PLAA 1T44A 1Z6RA 2E2NA 2D4WA 3A5MC 4BRLA 2OTJN 2PFUA 5EVZA 1WOQA 4RWTA 3QMLA 3W3DA 3G4SN 4CBXA 3G25A 3AAPA 3MDQA 3LDNA 1MDUB 5KPRA 2GWKA 2NRVA 1HKCA 3WT0A 4FWQA 3H3NO 3O4WA 5TKWA 4CZGA 3MN5A 4BRAA 3CMEN 1VQ5N 5M1KA 2HF3A 3LM2A 3FZLA 4H5TA 1D4XA 4FPAA 3D2EB 3WUHA 4CZJA 2NRHA 1GLCG 3O9UA 4BC5A 1Q18A 3SJHA 2F9TA 1TUUA 2YHWA 3DLLL 3ZEUA 2P9NB 5I9EB 2NRXA 4B1UB 2IVOA 2VGNA 1RGIA 2PBDA 3K9KA 4IDHA 3J8AA 1VAZA 1YUWA 1VQ9N 3ULEA 3AARA 2NRZA 5F2RA 2F7TA 3EE8A 1W2BM 2Q31A 2E1ZA 3BP8A 3MCPA 1KAXA 1ZBSA 3O6WA 2NRRA 1NGGA 2GUPA 4IOCL 4PKHA 4BR2A 5LY3A 3M1FA 3ZYYX 3I55N 2E2QA 3FR0A 4ISEA 4I6MA 3CERA 3H1VX 4BREA 4WQ5A 3UKUA 5B8HA 1YJ9N 3HSCA 1LCUA 4EHUA 4JAXA 5BRDA 1RDWX 4BRIA 4BRCA 4BRDA 4DCHA 3WEEB 2A3ZA 3R1XA 3ATUA 3UB5A 4YOXA 4IJAA 1NMDA 2P9LB 1KQSM 5EOYA 2E20A 1E4FT 4B1YB 3F5TA 1QHAA 4BVOA 3CC4N 3KZBA 4KBOA 1NJIO 3BEXA 1MA9B 3W0LA 1NBWA 1EQYA 3A8YA 5AZIA 5AZJB 3PIPL 5JVGL 3G6EN 3CCUN 5BPNA 3AGRA 1MWMA 3A5OC 2QXLA 3DXMA 3LDLA 5F1XA 3DXKA 3TTCA 1TYQB 3L6QA 1Q82O 3EKSA 1VQ8N 4BRMA 5JLHA 2GTDA 4YDUC 5M1OA 4FVUA 2ZGZA 4FWMA 4ILJA 1QQMA 4ILHA 3CC2N 4K42A 2H3GX 4NLCA 4Y0WA 5AQRA 1GLDG 5EX5A 3FE1A 2ASPA 3C7NA 3U9ZA 1ATNA 3R6MA 4NLBA 4EIAA 5HL7L 2E88A 2HF4A 4JKGA 3SK3A 5MLCQ 3SMPA 5AQPA 5M1NA 2CGJA 4PL7A 4GNIA 4MLHA 5AQLA 1CZAN 2YCHA 4BG9A 4A59A 3CIPA 4M7XA 2ZJQL 3VENA 4AF1A 5AQJA 3TTFA 3BF1A 3VERA 1W97L 4QS9A 1YXQA 3M3ZA 2D0PA 1BOTO 2QEXN 2QTDA 4K41A 4CBWA 4JKHA 4BRHA 3UKRB 4HWIA 3FGUA 4JKAA 1BA1A 3E1YA 2VWBA 3QFUA 2WBNA 4JKFA 4J8FA 3DAWA 2YX6A 5ELZA 1VQ4N 4H0PA 5ADXA 4GV9A 3ID6A 5AQOA 2J4RA 4KH6A 3VF4A 4GV6A 4QS8A 4PKGA 2NRTA 3K9JA 3LDQA 4CJ7A 4IO8A 3A5LC 1KAZA 1SQKA 4CZMA 3CD6N 1YITN 3P31A 4BC2A 3HI0A 4JKCA 2ZJRL 4IO9L 3BF3A 1P8ZA 4H0TB 4H0VB 1GLBG 2AP1A 3EZWA 4JKEA 4FO0A 3VPZA 4B9QA 5KQ8A 3FZFA 2QW9A 4FPBA 2BUPA 2DPNA 4C23A 5GIOA 4JKDA 2V52B 4NO7A 5ADXH 5FPMA 5AQWA 4JK7A 5FPNA 5AQVA 4KH4A 3QDKA 1HKGA 1H1VA 5FPEA 4BRFA 4H0YB 4CZFA 3R8EA 3VGMA 4DB3A 4H5RA 5BREA 3SBGA 3MN9A 5DM7L 2F9WA 2HBMA 4A2BA 2ZJPL 2GWJA 2P9KB 3I33A 3D2FA 3A5NC 4BR4A 3NVKA 3VEXA 5KPTA 2NRWA 3CJAA 2D0OA 5FPDA 2A42A 3CJCA 2E2PA 3O1BA 5HOOA 4YOWA 3KWGA 4MO5A 3IDHA 1QZ6A 3O80A 3RSEA 1KAYA 3IKMA 5AQNA 3CCSN 3F2KA 2HBLA 4JKBA 3E9LA 1LOTB 3SMSA 2Q97A 4U7BA 4BQZA 2CH5A 1GLAG 5AQZA 4JN4A 2Q0RA 3CJ7A 4H5VA 3AY9A 3E9PA 3J7ZO 3Q7BA 4JD2B 4OPHA 3GBTA 3H3OB 3Q7CA 3CCRN 4A57A 2QM1A 3LDPA 5AQHA 3CJBA 2CH6A 2QI2A 4B1WB 4C1NI 3OW2M 1VQLN 1V4SA 4FOEA 3MWTA 3GDQA 5AQGA 2Q2RA 3I8BA 3LL3A 1VQ7N 3F9MA 4CZEA 1XUPO 1J6ZA 3JS6A 1E4GT 4BRKA 2RE2A 4WFBL 3CXCM 5AQMA 1BO5O 1DKGD 1NGJA 2FF6A 4PL8A 4AM7A 2YI1A 4ISFA 2QWMA 5JICA 4IZ9A 3JXUA 5TKYA 1K8KB 1X3MA 3ID8A 3CCMN 3VMFB 3VTIA 2QWPA 4ISGA 3VGKA 1VQNN 3EL2A 3IFRA 4FSVA 2P9PA 4PHTX 3CPWM 1DGKN 1OKJA 1Z05A 2QWRA 3HZ6A 3O9SA 2P9SB 1IJJA 3CCQN 3FZMA 2NNWA 2ASOA 4MLEA 4XH1A 5AQXA 1HPMA 3L0QA 1YAGA 1VQKN 3D7EO 3TSQA 3GE1A 4XH5A 2Q0UA 3AAQA 2VCPA 1U2VA 1HLUA 2V7YA 3HRGA 4JHDA 1NGIA 3WXIA 1S22A 4YDUA 2A5XA 5AQIA 2P9UA 4EAHD 3O9QA 1NLVA 3O8MA 4WFAL 3CJ1A 3ZETB 2ZGYA 4HTLA 2YJFA 5GINA 2OTLN 4IJNA 4H0OA 3EO3A 1WUAA 1OVYA 2P9IA 3CPEA 3R9PA 5JVHL 5CR4A 1RFQA 2EWSA 5AQTA 3UE5A 2YJEA 1O13A 1NGFA 3T7ZA 4IOAL 4BQLA 2OANA 1T6DA 4G9ZA 1GLLO 3FLCO 3TSUA 4DKWA 2V51B 3CHWA 1SZ2A 5BR9A 4BR5A 2Q1NA 2UYTA 5E84A 3U8XA 2BTFA 1NWKA 1M90O 2E1YA 2IIRA 4YORA 2ZWHA 3HOTA 1RDUA 3N4PA 2A6AA 2YHXA 1YI2N 3H45C 1NGAA 5M1QA 1ILYA 4FWLA 1BA0A 2WUSA 4JEPA 2GX9A 3KK7A 4K25A 3ZEUB 1GLJO 2A40A 2E2OA 2FSJA 4YOTA 1VQ6N 3CMAN 5C0YA 4MDBA 4AM6A 5C2DA 1JCGA 1YF5L 2KKZA 3D2EA 3ULEB 5BRHA 4BGAA 1X3NA 3CCVN 5LJVA 2KLAA 3N4QA 4L3QA 5DM6L 1M1KO 3R3LA 1NGHA 4CZLA 2P9NA 3VGLA 4KH5A 4BVPA 4I6MB 4IFEA 4H5NA 1K8AO 1BDGA 3UKUB 1BUPA 2KHOA 4B1ZA 1P90A 4EFHA 2W40A 5GAHP 3ZX0A 3DJCA 3QICA 3SLCA 5GAEP 3ENBA 3MCAB 4BC4A 4BROA 1VQPN 3SAFA 3VEYA 3EN9A 3QB0A 4XH4A 4BGBA 4BRGA 4R79A 2QA4N 2I7NA 4CI6A 3MX5A 3HM8A 3VEZA 3ENHA 3MX2A 4UY8O 1TUYA 5AZIB 1VQMN 3OBYA 3ZX2A 3B8AX 5CE3A 3E66A 2HMPA 3WEEA 5C12A 2FXUA 3PIOL 3CETA 3M6GA 4OO1J 4FWPA 4FWSA 3MWPA 5AQYA 3DXMB 2P9LA 2GEMA 3WXJA 1YJWN 2JWLA 4BY9C 5JLFA 4CD1A 5EY4A 3ENOA 4BR7A 2ASMA 2ZF5O 3DXKB 1S72N 3QFPA 1IG8A 4FWRA 1KD1O 4CZHA 3GOIA 4QS7A 3O5BA 5AZJA 5GADP 5AQKA 4CD3A 5KPZA 1BG3A 3C7NB 3EKUA 3C6HA 1GLEG 3AGKA 3C0BA 1TYQA 3VEOA 3VEVA 4O8UA 1NM1A 1YVNA 5AR0A 2A41A 4JKGB 5C15A 2WFBA 4A5BA 4CBUA 3KWIA 4BRPA 4H5WA 3VETA 3SAHA 4WQ4C 3CCJN 5AQQA 1QQNA 1Y64A 2W41A 3GG4A 1K9MO 1T3VA 3OHRA 3S41A 4GV3A 2NLXA 4FWNA 5BRFA 3SAGA 3QBWA 3BUZB 1G99A 2PAVA 1HX1A 1JJ2M 3VESA 2YHYA 3WXKA 1VQON 4JK8A 4BRNA 2IVPA 3RVCA 2Q36A 3P38A 3T69A 3WQTA 1MWKA 1YHQN 4XEIA 5AFUA 5GAGP 3L4QA 4IWVA 5F0XA 1QZ5A 3UKRA 4A62A 1K73O 2JWKA 3L4IA 4O5FA 3U9DA 4FL9A 4BC3A 3MN6A 3KVGA 5C10A 5JMVA 1NGBA 1GLFO 1QVGM 4BR9A 3VOVA 4M7YA 3LM9A 1QVFM 5BN9A 5BPMA 2HBJA 4EHTA 3KHYA 2HOEA 5AFUH 4FOIA 1ZXOA 1NGDA 3H1QA 3MMVA 1JCFA 3FFKB 3CQYA 3SBTA 3IMXA 3D6RA 1KC8O 4NB4A 3TTDA 4C1NK 5LJWA 4WCEL 1EO1A 3GL1A 2NZTA 1Q7YO 5H1SQ 3D2FB 3QBXA 1DT9A 2FSKA 4IEIA 4WQ5C 3VEWA 2HSTA 1HJOA 2VYPA 4Z94A 4MDAA 2WC9A 4E1JA 4H03B 2HBKA 3E9OA 2CGKA 2P9KA 3RSEB 4FWOA 3M5RA 4FWKA 4BRQA 1YIJN 4B1XB 5BPLA 3HOSA 3TPQA 3WXLA 3OBWA 3WQUA 1ZC6A 3O1WA 4GY2B 3VF2A 4DHYA 2CGLA 3CC7N 3EE9A 3NMUA 2QWLA 2ITMA 4BR0A 2V7ZA 5CHIA 3CF5L 1QQOA 3HTVA 5M1PA 2FF3B 3CCEN 3MK6A 3WXMB 3A0IX 1SAZA 4F9OA 3P39A 4DQ8A 2RHKA 5BN8A 3H6EA 3O08A 3FZKA 3P4IA 1ATRA 4JD2A 3CI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE8 A;  3M5R A;  3KWG A;  3O9Q A;  3O9R A;  3O9T A;  3EE9 A;  4OPA A;  3D6R A;  2GX9 A;  3RVC A;  3P38 A;  3O9S A;  3O9U A;  3L4Q A;  4OPH A;  2KKZ A;  3KWI A;  3P39 A;  2RHK A;  3P31 A;  3F5T A;  3OA9 A; 
#chains in the Genus database with same CATH topology
 1BWF O;  1Q9Y A;  1NGC A;  4WFN L;  4DV2 K;  4O5B A;  4WYB A;  2ETJ A;  3VF6 A;  3MXM A;  5GIP A;  1IKV A;  2O8D A;  2ATQ A;  1BIS A;  2O4I A;  4CGI A;  5M1F A;  1WNS A;  3VQ7 A;  4KTZ A;  1T6C A;  3VTH A;  1RBV A;  4H0X B;  1Q86 O;  3ZSY A;  4ILG B;  3TU5 A;  4WF9 L;  3OYM A;  3CJ9 A;  1HYV A;  1ITG A;  2VG5 A;  3O9R A;  2AA4 A;  1O1W A;  1TL1 A;  3DI6 A;  4A61 A;  4JK9 A;  3AO1 A;  2P9I B;  2QWQ A;  1ZYQ A;  2HMI A;  4CFB A;  3QEW A;  1ATS A;  4I7F A;  1JLA A;  4K43 A;  2D1K A;  2FBT A;  1T44 A;  1A5X A;  1TKZ A;  5EVZ A;  3V6D A;  2X78 A;  3TAB A;  3S3O A;  1XWL A;  4CBX A;  3HP9 A;  3OYC A;  5KPR A;  2NRV A;  3SUQ A;  1HKC A;  3WT0 A;  4E1N A;  4FWQ A;  3H3N O;  5JS2 A;  4BRA A;  3KKR A;  3CFR A;  4KV8 A;  2HF3 A;  4H5T A;  4CFC A;  4CZJ A;  3O9U A;  3LZI A;  2YHW A;  1TUU A;  5I9E B;  4LF5 K;  2VGN A;  1VQ9 N;  3J8A A;  3BP8 A;  1X1P A;  2NRR A;  4IOC L;  2EX3 A;  1I39 A;  3M1F A;  1VSJ A;  2E2Q A;  4Z4G A;  4I6M A;  4FW2 A;  3H1V X;  4RG8 A;  4WQ5 A;  4QOZ B;  3PY8 A;  3QIP A;  1LCU A;  3WNF A;  1HPZ A;  4FLX A;  3VQP A;  4DS5 A;  1OH8 A;  4CJ5 A;  3R1X A;  4YOX A;  2E20 A;  4DTX A;  1XNR K;  3CC4 N;  3KZB A;  1NJI O;  2X6N A;  2BAN A;  5HRS A;  5AZJ B;  3PIP L;  5JVG L;  4FXD A;  5BPN A;  1MWM A;  4CIF A;  2QXL A;  1G15 A;  3QNO A;  3U3G A;  1RT5 A;  3L6Q A;  3NH0 A;  4BRM A;  5LMN K;  2GTD A;  4DV6 K;  4YDU C;  2ZGZ A;  3CC2 N;  4ILH A;  4NLC A;  4Y0W A;  4M41 A;  4FJI A;  1NK4 A;  4H4O A;  3U9Z A;  1WN7 A;  3JAM O;  3V9S A;  4NLB A;  2E88 A;  4O0I A;  1IH7 A;  3AO4 A;  3NFA A;  4JKG A;  4FJ7 A;  3SMP A;  1EWQ A;  2KFZ A;  2RN2 A;  3VER A;  5C42 A;  2VG6 A;  4ELT A;  3M3Z A;  4EZ6 A;  2QEX N;  4CBW A;  4HWI A;  3FGU A;  4FM0 A;  1BA1 A;  3E1Y A;  2VWB A;  4N5S A;  4E3S A;  1QSY A;  1YTU A;  3DAW A;  2YX6 A;  2KTQ A;  2O8C B;  4OLA A;  5AQO A;  4PKG A;  3A5L C;  1OH6 A;  1KAZ A;  1SQK A;  4CZM A;  4JYA K;  4JI5 K;  1P8Z A;  4H0T B;  2AP1 A;  4CJS A;  3KLF A;  3VPZ A;  4FO0 A;  2HVI A;  2ZM6 K;  5KTQ A;  3I8D A;  4DSF A;  4JKD A;  4NXN K;  3B6P A;  4CEZ A;  5AQV A;  2QKK A;  1H1V A;  5FPE A;  5CYQ A;  3R8E A;  3HL8 A;  4DB3 A;  1XC9 A;  1NU0 A;  3SBG A;  4DSL A;  1XNQ K;  4A2B A;  2GWJ A;  3A5N C;  4BR4 A;  1DTQ A;  2G8K A;  4BE1 A;  5KPT A;  2NRW A;  2D0O A;  3CJC A;  3NH1 A;  1NJW A;  4BE2 A;  4R5P A;  3OYK A;  4MO5 A;  1TK8 A;  3VQC A;  1QZ6 A;  3VQ6 A;  2XRI A;  3J81 O;  3F2K A;  2HBL A;  3BDP A;  3E9L A;  3SMS A;  2Q97 A;  1D9D A;  4BQZ A;  1GLA G;  4JN4 A;  4DSJ A;  4B3R K;  3CCR N;  3OW2 M;  4KFB A;  1EX4 A;  1U47 A;  1V4S A;  2E6L A;  1LWC A;  1XUP O;  1KCF A;  4BRK A;  2GV9 A;  1DKG D;  4AM7 A;  4LF6 K;  4FM1 A;  1TL3 A;  2QWP A;  1CXU A;  3VGK A;  1VQN N;  1ZBF A;  3EL2 A;  4FSV A;  4OGC A;  2RF2 A;  1DGK N;  1OKJ A;  2QWR A;  2G8U A;  3O9S A;  4E89 A;  1IBL K;  3CCQ N;  1REV A;  2ASO A;  1VQK N;  3ZT1 A;  3G0Z A;  3ZT0 A;  2IOC A;  4N56 A;  1Q9X A;  1S22 A;  4YDU A;  3THX A;  1LW0 A;  2P9U A;  1NLV A;  4KHP K;  3ZET B;  2ZGY A;  4DU1 A;  3U6F A;  3RRG A;  2KZZ A;  4FZZ A;  1HQE A;  4BE0 A;  4M3R A;  1WUA A;  1OVY A;  4H4M A;  2HVH A;  1XHZ A;  4LFB K;  4CW7 B;  5AQT A;  1BI4 B;  4Y1D A;  1T6D A;  2B6A A;  1X9S A;  3HO1 A;  4FJ9 A;  4DKW A;  3CHW A;  2WON A;  2Q1N A;  3U8X A;  1W9H A;  1NWK A;  3ULD A;  1NJY A;  2IIR A;  4YOR A;  5FDL A;  3HPH A;  3N4P A;  2A6A A;  4ELU A;  1NOZ A;  3BZK A;  4JEP A;  2WUS A;  2X6S A;  1B92 A;  4FJM A;  4YOT A;  4PUO A;  2HW3 A;  1L3S A;  4FJH A;  2OPR A;  4OKK A;  1UOC A;  5BRH A;  4CEB A;  1X3N A;  5DM6 L;  4CZL A;  2P9N A;  3KKS A;  3VGL A;  3TAE A;  1BDG A;  3PX0 A;  2UUC K;  1VHX A;  2W40 A;  5GAH P;  3ZX0 A;  4FYD A;  3OS1 A;  2HHH K;  4BRO A;  4PWD A;  3TR8 A;  1VQP N;  1EXQ A;  4DR5 K;  2QA4 N;  1L5U A;  3VEZ A;  4UY8 O;  2E6M A;  1BQM A;  3B8A X;  3E66 A;  5C12 A;  3WEE A;  2FXU A;  3M6G A;  2RPI A;  1KRP A;  2GEM A;  1YJW N;  4BY9 C;  2JWL A;  3KLI A;  4BR7 A;  3DXK B;  4NXM K;  1BHL A;  3QFP A;  3M8Q A;  3OYA A;  1KD1 O;  4QS7 A;  5GAD P;  1RT2 A;  1GOA A;  4J2B A;  3IG1 A;  3M8S A;  3C6H A;  1GLE G;  4B3S K;  3C0B A;  3VEV A;  4PQU A;  1YVN A;  2A41 A;  3OYD A;  2W6K A;  4CBU A;  2X74 A;  4WQ4 C;  4DU3 A;  1RBU A;  1K9M O;  2DFF A;  4CGF A;  4CJE A;  3SAG A;  3QBW A;  3VES A;  5C24 A;  4CER A;  2YHY A;  4FK0 A;  1SL2 A;  4OPK A;  2IVP A;  3KK1 A;  3RVC A;  4LF7 K;  1MWK A;  1YHQ N;  4XEI A;  5GAG P;  3L4Q A;  5HP1 A;  3NHG A;  4KRE A;  4M45 A;  1BGX T;  5J2Q A;  3KVG A;  1KVC A;  1GLF O;  1BIZ A;  3V9W A;  4CE9 A;  4M7Y A;  1QVF M;  5BPM A;  4EHT A;  4XIU A;  4FJ5 A;  4DQP A;  4FOI A;  3CQY A;  4W5T A;  2UXC K;  4W5Q A;  5LJW A;  3THW A;  3D2F B;  2FSK A;  2RKI A;  1QTM A;  1HJO A;  4Z94 A;  5K14 A;  1NK0 A;  4W5N A;  4E1J A;  2B4J A;  4FWO A;  4CJR A;  2D5R A;  4K0K K;  1RT1 A;  1T7P A;  4FWK A;  4BRQ A;  1YIJ N;  3QEX A;  1KVB A;  3TPQ A;  3WXL A;  4M42 A;  4DR7 K;  3NMU A;  2V7Z A;  3CF5 L;  3HTV A;  3WXM B;  4PY5 A;  3A0I X;  2HHU A;  1SAZ A;  4F9O A;  3P39 A;  5BN8 A;  2OZM A;  3P4I A;  3MEG A;  3CI5 A;  2YV0 X;  4DLE A;  3NAE A;  1OH7 A;  4A2A A;  4B9M A;  1B9D A;  3A2F A;  3VQ9 A;  4CK1 A;  4U67 L;  4AQY K;  2P9P B;  4OPA A;  2FSN A;  3DWL A;  3HBT A;  2YHB A;  5CY4 A;  4AIL C;  4MFB A;  1YT3 A;  1HMV A;  1K8K A;  3VQ8 A;  3V81 A;  1ESV A;  4I9Q A;  3H46 O;  3U4L A;  5KRS A;  4BG8 A;  1X9J A;  1BU6 O;  1Q81 O;  4JHD B;  5J2P A;  4IOX A;  2BH1 A;  1KXP A;  5DK5 A;  3EZ5 A;  4MO4 A;  4PKI A;  1JLQ A;  1SS6 A;  1S1V A;  1EKE A;  2F96 A;  1KFD A;  4B1V A;  3AA4 A;  1N8R O;  4DTJ A;  3NBP A;  4WQ4 A;  1WSI A;  3V9Z A;  4IEE A;  3HT3 A;  1RBT A;  1XMQ K;  4KHS A;  4YOV A;  4E7K A;  3PX6 A;  3AO3 A;  2D4W A;  4BRL A;  1HNX K;  2PFU A;  3QML A;  4BDP A;  3MDQ A;  2O8F A;  4BWJ A;  1QS4 A;  4OLB A;  4DV0 K;  3O4W A;  1B9F A;  4CZG A;  3MN5 A;  4OPJ A;  2KZM A;  4NYN A;  1D4X A;  4FPA A;  4ICL A;  2PYJ A;  2NRH A;  2WTU A;  3KTQ A;  1IKY A;  1Q18 A;  3SJH A;  1IKW A;  3TAM A;  5IWA K;  2NUB A;  2NRX A;  3SV3 A;  1ZBL A;  1KLM A;  1C0T A;  1RGI A;  2PBD A;  3K9K A;  1VAZ A;  3LPT A;  3SPZ A;  2GBZ A;  3ULE A;  3AAR A;  3ZSO A;  3MEC A;  5F2R A;  2F7T A;  3EE8 A;  3WNH A;  1W2B M;  3MCP A;  1NGG A;  4PKH A;  4BR2 A;  3CER A;  4BRE A;  3MXJ A;  3O3F A;  4EHU A;  4JAX A;  3ZSV A;  5BRD A;  3OYJ A;  3RWU A;  4BRC A;  4DCH A;  1L3U A;  1L3T A;  1Q8I A;  2A3Z A;  4I9L A;  3UB5 A;  4IJA A;  1NMD A;  3QLH A;  2P9L B;  4QAG A;  4CEC A;  4Z4H A;  1IBM K;  5FRM A;  4BVO A;  1QHA A;  4KHU A;  3BEX A;  3QES A;  1MA9 B;  3W0L A;  1NJX A;  5AZI A;  3LAL A;  3CCU N;  3DXM A;  3ISN C;  4GKK K;  1LAV A;  3L2W A;  4E7I A;  1TYQ B;  3EKS A;  3DRP A;  1N32 K;  5JLH A;  5M1O A;  4FVU A;  4JRP A;  4CJT A;  1Z25 A;  2H3G X;  5AQR A;  1GLD G;  3F73 A;  3OYL A;  4OGE A;  1TAQ A;  3NGY A;  3R6M A;  5HL7 L;  3LWL A;  2HF4 A;  4FVM A;  1IBK K;  3OYF A;  4PL7 A;  4M3T A;  5AQL A;  1RDA A;  1OH5 A;  2D0C A;  3CIP A;  5AQJ A;  4H8K A;  1YXQ A;  1WLJ A;  2OZS A;  4JKA A;  3L2Q A;  1U49 A;  4KHQ A;  3QFU A;  1VQ4 N;  1N33 K;  2WBN A;  4H0P A;  3ID6 A;  3NCI A;  4KH6 A;  4CJ7 A;  1YIT N;  2P51 A;  4JKC A;  4H0V B;  3EZW A;  3SQ4 A;  5KQ8 A;  4DR3 K;  3FZF A;  3IS9 A;  3LP1 A;  4FPB A;  2BUP A;  5ADX H;  4GMJ B;  5AQW A;  1LV5 A;  3QO9 A;  4DFP A;  4E7J A;  4J2D A;  4O0J A;  1UAX A;  3QDK A;  3AVG A;  1ASV A;  3PSF A;  3CQ8 A;  3AVM A;  1CZB A;  1T05 A;  4H5R A;  5BRE A;  3AO5 A;  3C6T A;  3PO4 A;  4B9N A;  4W5R A;  5DM7 L;  4Z4I A;  4FCY A;  3I33 A;  4DV3 K;  2HB5 A;  4F2S A;  4ZTF A;  3NVK A;  3VEX A;  5FPD A;  4KPY A;  2A42 A;  4DQS A;  2E2P A;  4C8M A;  3O1B A;  4FJG A;  3O3G A;  1NG9 A;  4KAZ A;  1KAY A;  4DSK A;  3T1H K;  5A2Q O;  4HUG A;  4U7B A;  4FLY A;  4CJ3 A;  4CFD A;  2O8E B;  2QXF A;  3AY9 A;  4CEO A;  4JD2 B;  3F9K A;  3VQA A;  4OPH A;  2FC0 A;  3H3O B;  3Q7C A;  1WBB A;  4A57 A;  5AQH A;  1D5A A;  1VQL N;  2CH6 A;  2QI2 A;  4B1W B;  1QSS A;  4FOE A;  3MWT A;  4GKJ K;  1VQ7 N;  4CHY A;  3JS6 A;  1J6Z A;  1E4G T;  3WNG A;  4JI2 K;  1C1B A;  1BO5 O;  3KK3 A;  1HYZ A;  2YI1 A;  4IZ9 A;  5TKY A;  1WSH A;  1X3M A;  3L2V A;  3ID8 A;  4AHS A;  3SYZ A;  3B6O A;  4J2E A;  1LWF A;  3VMF B;  4C8K A;  4ISG A;  4O4G A;  3IFR A;  4PHT X;  3HZ6 A;  1NK8 A;  3KK2 A;  2P9S B;  5AQX A;  1HPM A;  1YAG A;  4DTR A;  3AAQ A;  4B3O A;  4DWI A;  5AQI A;  4B8A B;  4E19 A;  1A5W A;  1VSF A;  4LFA K;  4M3U A;  3O8M A;  4BDZ A;  2DY4 A;  3KLH A;  4CHP A;  1TK0 A;  5GIN A;  4IJN A;  1S1T A;  4H0O A;  2P9I A;  3S3N A;  2XY6 A;  2DTU A;  3ZSR A;  2YKM A;  4RW6 A;  1RFQ A;  2EWS A;  4RW4 A;  1O13 A;  1NGF A;  1Y97 A;  4G9Z A;  3FLC O;  1SZ2 A;  1U48 A;  5E84 A;  1M90 O;  2UXD K;  3VQQ A;  2E1Y A;  4HVJ A;  4NYF A;  1RDU A;  5HLF A;  2YHX A;  3H45 C;  1NGA A;  1C1C A;  1ILY A;  3JSM A;  1BA0 A;  3ZEU B;  2G8W A;  2BE2 A;  2A40 A;  1JCG A;  1YF5 L;  2KKZ A;  4BGA A;  3T19 A;  3MXI A;  1M1K O;  4KH5 A;  1ZBI A;  4IFE A;  1K8A O;  3DOK A;  3UKU B;  1WSG A;  1BUP A;  2KHO A;  5HRN A;  1P90 A;  4EFH A;  4Z4F A;  5C25 A;  1GOC A;  3OS0 A;  2VWJ A;  3SLC A;  3ENB A;  4BC4 A;  1JL2 A;  3SAF A;  2BDP A;  3ALY A;  3TAF A;  3EN9 A;  4DFK A;  4BRG A;  3SPY A;  3L2U A;  4CI6 A;  4KHW A;  3MX5 A;  3HM8 A;  1RIL A;  1TUY A;  3OBY A;  4CFA A;  3PIO L;  3O4Q A;  4OO1 J;  4FWS A;  1VRU A;  3WXJ A;  4CD1 A;  5EY4 A;  3ENO A;  1S72 N;  3RR7 A;  3PO5 A;  4FWR A;  2AJQ A;  4CZH A;  3GOI A;  5AZJ A;  3QEV A;  4C8L A;  5CZ1 A;  5AQK A;  1FKO A;  1BG3 A;  3C7N B;  1JLB A;  1NK6 A;  3HVR A;  3DLE A;  3K2P A;  3VEO A;  4O8U A;  1U4B A;  2WFB A;  2XY7 A;  1JXE A;  1F21 A;  3HPO A;  3K5N A;  3VET A;  3SAH A;  4HUE A;  4I2Q A;  1Y64 A;  1HRH A;  3OHR A;  4YFU A;  2NLX A;  3OJU A;  4OVL A;  4HCC A;  1WSE A;  1G99 A;  4FZY A;  4M3Z A;  2XY8 A;  4JK8 A;  1FKP A;  2Q36 A;  3P38 A;  1BCM A;  3WQT A;  2G8H A;  2D0B A;  3CYM A;  4A62 A;  3DRR A;  1K73 O;  2O8C A;  5JMV A;  1VRT A;  1NGB A;  1SKW A;  3C95 A;  3SCX A;  3MED A;  1T8E A;  3AVK A;  1IV0 A;  3VOV A;  2DFE A;  3LM9 A;  5BN9 A;  2VG7 A;  3AV9 A;  2HOE A;  5AFU H;  1ZXO A;  3SBT A;  3VQ4 A;  3D6R A;  1BL3 A;  2GUI A;  3T1A A;  1T03 A;  4AH9 A;  4HTU A;  3GL1 A;  3OYE A;  3QBX A;  4IEI A;  4EP4 A;  1TKT A;  2HST A;  2VYP A;  4Q0B A;  2ITG A;  4CK3 A;  1BCO A;  1JLE A;  1VSE A;  1QQC A;  2CGK A;  3NGI A;  3RSE B;  3O1W A;  4DHY A;  2CGL A;  3EE9 A;  2ITM A;  4AHU A;  1C0M A;  5CHI A;  3TAR A;  4CGD A;  3K5O A;  5M1P A;  2FF3 B;  5IT9 O;  4E7H A;  3V1R A;  4DQ8 A;  3O08 A;  3FZK A;  1ATR A;  4JI1 K;  4GVE A;  4IFY A;  2W6L A;  1KTQ A;  3MN7 A;  3I56 N;  4DQQ A;  1S3X A;  3ATV A;  4CHQ A;  4CIE A;  4UQG A;  3FZH A;  4LC9 B;  3OYG A;  3L2R A;  3O9T A;  3RMB A;  1HYS A;  1HR0 K;  1HNZ K;  3O3H A;  1TV6 A;  3LP2 A;  2VGM A;  4M63 C;  4IKF A;  3LP0 A;  1U2V B;  3CQX A;  1C6V A;  3ZT2 A;  1XC3 A;  4KHN A;  5E26 A;  1VQO N;  5AQU A;  3J7Y P;  3M8R A;  4B9L A;  3OA9 A;  3C6A A;  1ASU A;  1C0G A;  2E8A A;  5KQD A;  3C65 A;  1YJN N;  2IVN A;  2HHS A;  4O8K A;  1K6Y A;  1R59 O;  1FW6 A;  1V4T A;  1ZBU A;  4BDY A;  1BIU A;  1DEJ A;  1HNW K;  4F2R A;  1C0F A;  3ZET A;  4YOU A;  4B9U A;  4IXC A;  4CJW A;  4F3T A;  2VWK A;  5C2F A;  2IC3 A;  3PLA A;  1Z6R A;  3A5M C;  2OTJ N;  4JRQ A;  1WOQ A;  3MEE A;  3LAK A;  4CK2 A;  3AAP A;  3LDN A;  1BI4 A;  1MDU B;  1RBR A;  5HRO A;  5TKW A;  1RCH A;  3VQ5 A;  4F3O A;  3CME N;  1VQ5 N;  1EP4 A;  2FBX A;  5M1K A;  3LM2 A;  3FZL A;  4FLT A;  3SZ2 A;  3D2E B;  2KFN A;  3IRX A;  1GLC G;  4BC5 A;  3VA3 A;  3THY B;  3DLL L;  1YVU A;  3K5L A;  2IVO A;  4CEQ A;  1N34 K;  3NE6 A;  4YY3 K;  3UIQ A;  1NOY A;  2NRZ A;  5HRP A;  2Q31 A;  3O6W A;  1KAX A;  1ZBS A;  4OKE A;  5LY3 A;  3ZYY X;  3FR0 A;  1RTH A;  1I3A A;  4ISE A;  1NMN A;  4L8R B;  1ASW A;  4KO0 A;  1XMO K;  3HSC A;  1D8Y A;  1RDW X;  4N41 A;  2IDO A;  3AVA A;  4DUY K;  3ATU A;  3KLE A;  3FFI A;  4KTQ A;  4B9S A;  1E4F T;  3LPU A;  3AA2 A;  3QIO A;  3KD1 E;  4BAC A;  1NBW A;  1C0U A;  1EQY A;  3EYZ A;  1GOB A;  3ZSW A;  3AVH A;  3CG7 A;  4E7L A;  3AGR A;  4CES A;  2WOM A;  3HP6 A;  3V4I A;  3OYI A;  3DXK A;  3TTC A;  1VQ8 N;  4E1M A;  1Q82 O;  3T1Y K;  3ZSX A;  1QQM A;  4CJQ A;  4K42 A;  1FK9 A;  2HHT A;  4LH5 A;  3FE1 A;  3RRH A;  1NKE A;  4JI0 K;  4JLH A;  4EIA A;  5MLC Q;  5AQP A;  1SUQ A;  2XY5 A;  2CGJ A;  4GNI A;  1QE1 A;  2HHW A;  3CM6 A;  2ZJQ L;  4G1Q A;  3BF1 A;  4DTO A;  1W97 L;  3AA3 A;  4QS9 A;  2D0P A;  4K41 A;  3UKR B;  2Q3S A;  1VSH A;  3DRS A;  1JL1 A;  2O8B B;  3K9J A;  2W42 A;  1RT7 A;  2YNI A;  4LY7 A;  2OCE A;  3AO2 A;  2D0A A;  3P31 A;  3HI0 A;  3CFO A;  5EU7 A;  4JKE A;  4B9Q A;  1TK5 A;  4DR4 K;  2IS3 A;  2YKN A;  1KFS A;  5GIO A;  2DPN A;  4KI6 A;  4NO7 A;  3DLG A;  4JV5 K;  2YNF A;  4JK7 A;  4CJ4 A;  4CHZ A;  4GVM A;  1S1X A;  4TSX A;  2F8T A;  4BRF A;  3CFP A;  4H0Y B;  4CZF A;  3VGM A;  3MN9 A;  2F9W A;  2HBM A;  2ZJP L;  3ZLJ A;  3SV4 A;  2P9K B;  3D2F A;  3S9H A;  3HPG A;  4FLW A;  1C1A A;  3SI6 A;  4KB0 A;  5HOO A;  5T7B A;  4PA1 A;  4YOW A;  3KWG A;  4EP5 A;  3VA0 A;  4NCB A;  3G10 A;  3O80 A;  1LAW A;  3IKM A;  5AQN A;  3CCS N;  3KIO A;  1LOT B;  2CH5 A;  5AQZ A;  4WE1 A;  4H5V A;  3E9P A;  3KLG A;  3AVI A;  3RTV A;  4CHN A;  3L8B A;  2QM1 A;  3LDP A;  4YNQ A;  3ASM A;  2Q2R A;  3LL3 A;  4MQ3 A;  3F9M A;  3NF6 A;  2RE2 A;  3H08 A;  4WFB L;  1NGJ A;  3LAM A;  4DUZ K;  2FF6 A;  3IAY A;  4PL8 A;  4RW8 A;  3JYT A;  1WAJ A;  2QWM A;  5JIC A;  3JXU A;  4DFM A;  2O8D B;  4B3T K;  2P5G A;  4B3M K;  4DFJ A;  2P9P A;  2XO7 A;  3CPW M;  1Z05 A;  3HM9 A;  2G8I A;  1VK0 A;  2F4V K;  3FZM A;  1IKX A;  1EWR A;  2NNW A;  4MLE A;  4XH1 A;  1N36 K;  2E5L K;  3D7E O;  3TSQ A;  3GE1 A;  4XH5 A;  2Q0U A;  2VCP A;  4CEF A;  1HLU A;  2V7Y A;  4JHD A;  4O55 A;  1NGI A;  3WXI A;  3V9U A;  5AJ3 K;  3O9Q A;  3TAQ A;  3TAN A;  2HHX A;  4HTL A;  2YJF A;  2OTL N;  3VN5 A;  3EO3 A;  3CPE A;  3K5M A;  5CR4 A;  1QHT A;  1CZ9 A;  4FM2 A;  4DTU A;  1WBD A;  1VSK A;  4K8X A;  2F8S A;  2V51 B;  4BR5 A;  2UYT A;  5FLX O;  1NK7 A;  1SL1 A;  3K58 A;  2ZWH A;  2G8F A;  3HOT A;  3EEQ A;  3RMD A;  2GX9 A;  3KK7 A;  4K25 A;  2E2O A;  2FSJ A;  3NH2 A;  2A1S A;  3TAG A;  1UWB A;  1U45 A;  4MDB A;  4AM6 A;  4CF1 A;  3CCV N;  4C8N A;  5LJV A;  3OYN A;  2KLA A;  1XHX A;  4CF8 A;  4I6M B;  4H5N A;  4B1Z A;  2PZS A;  3V1Q A;  2OYQ A;  3J7A P;  1RT6 A;  3QIC A;  4DTM A;  4EZ9 A;  4IBN A;  5CZ2 A;  1NJZ A;  2G8V A;  3QB0 A;  3ZT4 A;  4JI6 K;  4BGB A;  2FBY A;  4R79 A;  3K59 A;  3ENH A;  3MX2 A;  2B5J A;  3SUO A;  3OJS A;  2HMP A;  3O4N A;  1HJR A;  4FWP A;  5AQY A;  4X65 K;  1TAU A;  2P9L A;  2JLE A;  4W5O A;  5JLF A;  4JS5 A;  2ASM A;  2ZF5 O;  3PV8 A;  5SZT A;  2R7Y A;  1N5Y A;  4GW6 A;  4CJK A;  3O5B A;  4J2A A;  1WAF A;  1HNV A;  1VSM A;  1LW2 A;  3AGK A;  1TYQ A;  1S1W A;  4AHT A;  1NM1 A;  4JKG B;  4CGJ A;  4H5W A;  3HST B;  2ZQB A;  4IG0 A;  3CCJ N;  1QQN A;  2W41 A;  4DV7 K;  3GG4 A;  3S41 A;  4GV3 A;  1YTA A;  4FWN A;  5BRF A;  4CVN E;  3BUZ B;  4DV4 K;  4DMN A;  1JKH A;  1WSF A;  1RDB A;  3PUF A;  2YNH A;  3THV A;  4N47 A;  5LMU K;  5E41 A;  4HUF A;  4DG1 A;  5I42 A;  1S6P A;  4ZHR A;  3L4I A;  3U9D A;  1CXQ A;  4FL9 A;  3MN6 A;  4BR9 A;  3V1O A;  3NGZ A;  1J5E K;  4AHR A;  1MU2 A;  2OPP A;  2ZE2 A;  3KHY A;  3HVT A;  4DS4 A;  1NGD A;  3MMV A;  5CYM A;  3P5J A;  3IMX A;  3VQB A;  3P83 D;  4C1N K;  4WCE L;  4KI4 A;  1EO1 A;  2NZT A;  3QET A;  4FJ8 A;  4ID1 A;  3VEW A;  3E01 A;  4CF2 A;  1J54 A;  4MDA A;  2WC9 A;  4X62 K;  1D9F A;  4H03 B;  1JLG A;  1SKS A;  2HBK A;  3LDS A;  1JLF A;  4DTS A;  1CLQ A;  2ZD1 A;  3M5R A;  3DLK A;  5BPL A;  3HOS A;  1QSL A;  4DF4 A;  3OBW A;  3WQU A;  4Q5V A;  1ZC6 A;  4BWM A;  3VF2 A;  4DR1 K;  1L3V A;  4X66 K;  1NKC A;  4BR0 A;  1TKD A;  3CCE N;  1TVR A;  5BR8 K;  3MAQ A;  3OS2 A;  2O8E A;  4JD2 A;  2JGU A;  4HHT A;  4CED A;  4JNE A;  5HRR A;  3LAN A;  4CZK A;  1RDC A;  4FJL A;  4IG3 A;  2GEL A;  2I7P A;  4YOY A;  4A5A A;  3OVN A;  3SQ1 A;  3DMJ A;  3KD5 E;  1NGE A;  2PYL A;  3DLH A;  4CZI A;  3G71 N;  3RR8 A;  3K0S A;  3LDO A;  3ZX3 A;  4RCH A;  4OJR A;  2FLO A;  3ZSQ A;  3THX B;  4IO9 L;  5AQS A;  2P9S A;  2P9U B;  4JS4 A;  1XQS C;  1FJG K;  1SL0 A;  3SUN A;  4DR2 K;  4RTF D;  2UU9 K;  5EXW A;  4C8O A;  2QWO A;  3QNN A;  1U6Z A;  1HUX A;  1HKB A;  2KW4 A;  4KHY A;  4CJV A;  1R0A A;  2QWN A;  3IUC A;  5AQF A;  3SNN A;  4CF0 A;  3NVM A;  4HCB A;  1JCE A;  3TSP A;  3CCL N;  3SJJ A;  2E2N A;  1KLN A;  4RWT A;  2Y1J A;  3KJV A;  1ZBH A;  3W3D A;  3G4S N;  4B9V A;  3G25 A;  4FJX A;  2GWK A;  5KGX A;  3NF9 A;  4CJL A;  3DLR A;  4V19 S;  4CEA A;  3WUH A;  4Z4E A;  1DTT A;  3EY1 A;  4KRF A;  1W7A A;  2F9T A;  4I2P A;  1VSL A;  3ZEU A;  2P9N B;  3TAP A;  4B1U B;  4IDH A;  4CF9 A;  1YUW A;  3HYF A;  3SQ0 A;  4FK4 A;  3OY9 A;  2E1Z A;  3QEI A;  2GUP A;  4RW9 A;  3I55 N;  1LWE A;  3J80 O;  4B08 A;  5B8H A;  3UKU A;  1YJ9 N;  4ELV A;  2QK9 A;  3SUP A;  3NDK A;  4KB1 A;  4BRI A;  1IG9 A;  4BRD A;  4F8R A;  3WEE B;  4AHV A;  3AVN A;  1KQS M;  5EOY A;  4B1Y B;  3F5T A;  4KBO A;  4JI7 K;  3A8Y A;  2Z1I A;  3G6E N;  4FK2 A;  3A5O C;  3LDL A;  5F1X A;  2I5J A;  2EHG A;  4FWM A;  4ILJ A;  3U3Y A;  4CIG A;  5EX5 A;  1TGO A;  2ASP A;  3C7N A;  1ATN A;  4DU4 A;  2Z1G A;  1SKR A;  3SK3 A;  5M1N A;  4M3X A;  3AA5 X;  4MLH A;  1CZA N;  2YCH A;  4RW7 A;  4BG9 A;  4A59 A;  4M7X A;  2Y1I A;  1JXB A;  3VEN A;  4AF1 A;  1WSJ A;  3TTF A;  3L3U A;  1J5O A;  4M3Y A;  1BOT O;  2QTD A;  4JKH A;  4BRH A;  2UUA K;  3AVJ A;  5ELZ A;  4NCG A;  4JKF A;  4J8F A;  1RT4 A;  5ADX A;  4GV9 A;  3VF4 A;  2J4R A;  4FW1 A;  4GV6 A;  4QS8 A;  2NRT A;  4CJU A;  3LDQ A;  1NKB A;  4IO8 A;  1S6Q A;  3CD6 N;  3C94 A;  4LH4 A;  4BC2 A;  2ZJR L;  3BF3 A;  3T3F A;  1GLB G;  5JS1 A;  4FZX C;  2QW9 A;  3ZSZ A;  4C23 A;  2V52 B;  1E3M A;  5FPM A;  5FPN A;  3L3V A;  1A5V A;  4KH4 A;  3THW B;  1HKG A;  2HNY A;  2QKB A;  2OA8 A;  4LF8 K;  4FLV A;  5SWM A;  4CGG A;  1NK5 A;  4FJN A;  3CJA A;  4IFV A;  1RTJ A;  3LP3 A;  3ZT3 A;  3PSI A;  4DSI A;  1FXX A;  3IDH A;  1RNH A;  3VQE A;  4JI3 K;  3RSE A;  3DM2 A;  2IAJ A;  1J9A A;  1WB9 A;  4JKB A;  4DTN A;  4DQI A;  2Q0R A;  3CJ7 A;  4OKJ A;  3J7Z O;  4Z4C A;  3Q7B A;  3GBT A;  3QEP A;  3BGR A;  4DV1 K;  3CJB A;  4C1N I;  4OX9 K;  3GDQ A;  3RMC A;  5AQG A;  3I8B A;  3M8P A;  4CZE A;  3CXC M;  5AQM A;  3ZCM A;  1UA1 A;  4ISF A;  1EET A;  3QIN A;  3LZJ A;  4X64 K;  1K8K B;  4JI8 K;  3CCM N;  1JLC A;  3VTI A;  3D0P A;  4E0D A;  1RTD A;  1IJJ A;  1RBS A;  2DFH A;  1I94 K;  3L0Q A;  4Y1C A;  3SQ2 A;  1U2V A;  3HRG A;  4LSL A;  1RT3 A;  2A5X A;  4EAH D;  2A1R A;  4FJJ A;  1S9G A;  1KSP A;  4WFA L;  3CJ1 A;  2Z1H A;  2HHV A;  4KKO A;  4IDK A;  2KQ2 A;  3LWM A;  3R9P A;  5JVH L;  4DQR A;  3HK2 A;  3PX4 A;  3UE5 A;  2HND A;  2YJE A;  2O8F B;  1U04 A;  3T7Z A;  4DSE A;  5LL6 Z;  4BQL A;  2OAN A;  4IOA L;  1GLL O;  3TSU A;  4AHC A;  5BR9 A;  4ZTJ A;  4Z0U A;  2BTF A;  2P5O A;  4LSN A;  1YI2 N;  4QCL A;  5M1Q A;  4FWL A;  1KVA A;  2BGG A;  5KRT A;  3OYH A;  1GLJ O;  1VQ6 N;  1S5J A;  3CMA N;  1DLO A;  5C0Y A;  5C2D A;  3D2E A;  3ULE B;  3OYB A;  4B9T A;  2VQE K;  3N4Q A;  4L3Q A;  4CGH A;  3THY A;  1X9M A;  3CM5 A;  1NGH A;  3R3L A;  4LD0 A;  4K8Z A;  4BVP A;  4FLZ A;  1J53 A;  3D45 A;  3DJC A;  1W0H A;  2VQF K;  1SV5 A;  5GAE P;  2E4L A;  3MCA B;  4KTW A;  3HXM A;  3VEY A;  1VSD A;  4DF8 A;  4XH4 A;  4LFC K;  2IGI A;  1BQN A;  2I7N A;  1HQU A;  5AZI B;  1VQM N;  1OVQ A;  3ZX2 A;  5J2N A;  5CE3 A;  4CEE A;  3CET A;  1VSI A;  3MWP A;  3DXM B;  3K57 A;  2LSN A;  2HHQ A;  1IG8 A;  3P1G A;  2O4G A;  3NF7 A;  5KGW A;  5I3U A;  3BY5 A;  4O44 A;  4CD3 A;  4CJF A;  5KPZ A;  4F4K A;  3C6U A;  2XHB A;  3EKU A;  2P1J A;  3I0S A;  2YNG A;  3RMA A;  5AR0 A;  5C15 A;  4A5B A;  3KWI A;  3V9X A;  4NCA A;  4BRP A;  2FBV A;  1X9W A;  2UXB K;  1Z26 A;  4CHO A;  1XI1 A;  4FJK A;  5AQQ A;  3WNE A;  5DMR A;  1T3V A;  2OPS A;  3TI0 A;  1NNE A;  4M3W A;  2PAV A;  1HX1 A;  1JJ2 M;  4LF4 K;  2HNZ A;  3WXK A;  4BRN A;  3AVL A;  3T69 A;  1N6Q A;  4DV5 K;  5AFU A;  4IWV A;  5F0X A;  5FRO A;  1QZ5 A;  3AVB A;  3UKR A;  4DR6 K;  2JWK A;  1UA0 A;  1NK9 A;  4O5F A;  3ITH A;  4BC3 A;  5C10 A;  5FRN A;  4LF9 K;  2O8B A;  1S1U A;  1QVG M;  4B8C A;  2PY5 A;  3VQD A;  2OPQ A;  4JI4 K;  3HJF A;  3NF8 A;  2HBJ A;  1S9E A;  3H1Q A;  5J1E A;  3OTO K;  3QER A;  1JCF A;  3FFK B;  5J2M A;  3DOL A;  1KC8 O;  1IO2 A;  4NB4 A;  4CJP A;  3TTD A;  3BZC A;  1HNI A;  2UUB K;  4DLG A;  1Q7Y O;  5H1S Q;  5KI6 A;  3DLB A;  1DT9 A;  3AVF A;  4WQ5 C;  4FLU A;  3E9O A;  4YHH K;  2P9K A;  4DTP A;  3I0R A;  4B1X B;  1TKX A;  1RDD A;  2Z1J A;  4GY2 B;  4ID5 A;  3CC7 N;  3DYA A;  2QWL A;  4N76 A;  1RTI A;  1QQO A;  5D3G A;  3MK6 A;  3AVC A;  5HBM A;  3TWH A;  3S3M A;  2RHK A;  3H6E A;  4CCH A;  2YHA A; 
#chains in the Genus database with same CATH homology
 1BWF O;  4GVE A;  1NGC A;  4WFN L;  3MN7 A;  4WYB A;  3I56 N;  4JNE A;  4CZK A;  1S3X A;  3ATV A;  3FZH A;  4LC9 B;  4A2A A;  4U67 L;  3O9T A;  3VF6 A;  2GEL A;  2I7P A;  2P9P B;  4OPA A;  2FSN A;  3DWL A;  4YOY A;  3HBT A;  4A5A A;  5GIP A;  2VGM A;  1K8K A;  1NGE A;  4CZI A;  4M63 C;  1ESV A;  3G71 N;  3H46 O;  3U4L A;  1U2V B;  3LDO A;  5M1F A;  3CQX A;  4BG8 A;  3ZX3 A;  1X9J A;  1BU6 O;  4RCH A;  1Q81 O;  2FLO A;  4JHD B;  1XC3 A;  4IOX A;  5E26 A;  2BH1 A;  1T6C A;  2P9S A;  2P9U B;  5AQU A;  1XQS C;  4H0X B;  5AQS A;  3VTH A;  1Q86 O;  1KXP A;  3OA9 A;  3C6A A;  1C0G A;  2E8A A;  4MO4 A;  4RTF D;  4ILG B;  5KQD A;  3C65 A;  5EXW A;  3TU5 A;  4PKI A;  4WF9 L;  1SS6 A;  1YJN N;  2IVN A;  3CJ9 A;  2QWO A;  4O8K A;  1U6Z A;  1HUX A;  1R59 O;  3O9R A;  1HKB A;  2AA4 A;  1V4T A;  4A61 A;  4JK9 A;  1DEJ A;  4B1V A;  2P9I B;  1N8R O;  2QWQ A;  4WQ4 A;  4IEE A;  2QWN A;  3IUC A;  1C0F A;  5AQF A;  3ZET A;  1ATS A;  3NVM A;  4YOU A;  4IXC A;  4YOV A;  1JCE A;  4K43 A;  3TSP A;  2D1K A;  5C2F A;  3CCL N;  3PLA A;  1T44 A;  1Z6R A;  2E2N A;  2D4W A;  3A5M C;  4BRL A;  2OTJ N;  2PFU A;  5EVZ A;  1WOQ A;  4RWT A;  3QML A;  3W3D A;  3G4S N;  4CBX A;  3G25 A;  3AAP A;  3MDQ A;  3LDN A;  1MDU B;  5KPR A;  2GWK A;  2NRV A;  1HKC A;  3WT0 A;  4FWQ A;  3H3N O;  3O4W A;  5TKW A;  4CZG A;  3MN5 A;  4BRA A;  3CME N;  1VQ5 N;  5M1K A;  2HF3 A;  3LM2 A;  3FZL A;  4H5T A;  1D4X A;  4FPA A;  3D2E B;  3WUH A;  4CZJ A;  2NRH A;  1GLC G;  3O9U A;  4BC5 A;  1Q18 A;  3SJH A;  2F9T A;  1TUU A;  2YHW A;  3DLL L;  3ZEU A;  2P9N B;  5I9E B;  2NRX A;  4B1U B;  2IVO A;  2VGN A;  1RGI A;  2PBD A;  3K9K A;  4IDH A;  3J8A A;  1VAZ A;  1YUW A;  1VQ9 N;  3ULE A;  3AAR A;  2NRZ A;  5F2R A;  2F7T A;  3EE8 A;  1W2B M;  2Q31 A;  2E1Z A;  3BP8 A;  3MCP A;  1KAX A;  1ZBS A;  3O6W A;  2NRR A;  1NGG A;  2GUP A;  4IOC L;  4PKH A;  4BR2 A;  5LY3 A;  3M1F A;  3ZYY X;  3I55 N;  2E2Q A;  3FR0 A;  4ISE A;  4I6M A;  3CER A;  3H1V X;  4BRE A;  4WQ5 A;  3UKU A;  5B8H A;  1YJ9 N;  3HSC A;  1LCU A;  4EHU A;  4JAX A;  5BRD A;  1RDW X;  4BRI A;  4BRC A;  4BRD A;  4DCH A;  3WEE B;  2A3Z A;  3R1X A;  3ATU A;  3UB5 A;  4YOX A;  4IJA A;  1NMD A;  2P9L B;  1KQS M;  5EOY A;  2E20 A;  1E4F T;  4B1Y B;  3F5T A;  1QHA A;  4BVO A;  3CC4 N;  3KZB A;  4KBO A;  1NJI O;  3BEX A;  1MA9 B;  3W0L A;  1NBW A;  1EQY A;  3A8Y A;  5AZI A;  5AZJ B;  3PIP L;  5JVG L;  3G6E N;  3CCU N;  5BPN A;  3AGR A;  1MWM A;  3A5O C;  2QXL A;  3DXM A;  3LDL A;  5F1X A;  3DXK A;  3TTC A;  1TYQ B;  3L6Q A;  1Q82 O;  3EKS A;  1VQ8 N;  4BRM A;  5JLH A;  2GTD A;  4YDU C;  5M1O A;  4FVU A;  2ZGZ A;  4FWM A;  4ILJ A;  1QQM A;  4ILH A;  3CC2 N;  4K42 A;  2H3G X;  4NLC A;  4Y0W A;  5AQR A;  1GLD G;  5EX5 A;  3FE1 A;  2ASP A;  3C7N A;  3U9Z A;  1ATN A;  3R6M A;  4NLB A;  4EIA A;  5HL7 L;  2E88 A;  2HF4 A;  4JKG A;  3SK3 A;  5MLC Q;  3SMP A;  5AQP A;  5M1N A;  2CGJ A;  4PL7 A;  4GNI A;  4MLH A;  5AQL A;  1CZA N;  2YCH A;  4BG9 A;  4A59 A;  3CIP A;  4M7X A;  2ZJQ L;  3VEN A;  4AF1 A;  5AQJ A;  3TTF A;  3BF1 A;  3VER A;  1W97 L;  4QS9 A;  1YXQ A;  3M3Z A;  2D0P A;  1BOT O;  2QEX N;  2QTD A;  4K41 A;  4CBW A;  4JKH A;  4BRH A;  3UKR B;  4HWI A;  3FGU A;  4JKA A;  1BA1 A;  3E1Y A;  2VWB A;  3QFU A;  2WBN A;  4JKF A;  4J8F A;  3DAW A;  2YX6 A;  5ELZ A;  1VQ4 N;  4H0P A;  5ADX A;  4GV9 A;  3ID6 A;  5AQO A;  2J4R A;  4KH6 A;  3VF4 A;  4GV6 A;  4QS8 A;  4PKG A;  2NRT A;  3K9J A;  3LDQ A;  4CJ7 A;  4IO8 A;  3A5L C;  1KAZ A;  1SQK A;  4CZM A;  3CD6 N;  1YIT N;  3P31 A;  4BC2 A;  3HI0 A;  4JKC A;  2ZJR L;  4IO9 L;  3BF3 A;  1P8Z A;  4H0T B;  4H0V B;  1GLB G;  2AP1 A;  3EZW A;  4JKE A;  4FO0 A;  3VPZ A;  4B9Q A;  5KQ8 A;  3FZF A;  2QW9 A;  4FPB A;  2BUP A;  2DPN A;  4C23 A;  5GIO A;  4JKD A;  2V52 B;  4NO7 A;  5ADX H;  5FPM A;  5AQW A;  4JK7 A;  5FPN A;  5AQV A;  4KH4 A;  3QDK A;  1HKG A;  1H1V A;  5FPE A;  4BRF A;  4H0Y B;  4CZF A;  3R8E A;  3VGM A;  4DB3 A;  4H5R A;  5BRE A;  3SBG A;  3MN9 A;  5DM7 L;  2F9W A;  2HBM A;  4A2B A;  2ZJP L;  2GWJ A;  2P9K B;  3I33 A;  3D2F A;  3A5N C;  4BR4 A;  3NVK A;  3VEX A;  5KPT A;  2NRW A;  3CJA A;  2D0O A;  5FPD A;  2A42 A;  3CJC A;  2E2P A;  3O1B A;  5HOO A;  4YOW A;  3KWG A;  4MO5 A;  3IDH A;  1QZ6 A;  3O80 A;  3RSE A;  1KAY A;  3IKM A;  5AQN A;  3CCS N;  3F2K A;  2HBL A;  4JKB A;  3E9L A;  1LOT B;  3SMS A;  2Q97 A;  4U7B A;  4BQZ A;  2CH5 A;  1GLA G;  5AQZ A;  4JN4 A;  2Q0R A;  3CJ7 A;  4H5V A;  3AY9 A;  3E9P A;  3J7Z O;  3Q7B A;  4JD2 B;  4OPH A;  3GBT A;  3H3O B;  3Q7C A;  3CCR N;  4A57 A;  2QM1 A;  3LDP A;  5AQH A;  3CJB A;  2CH6 A;  2QI2 A;  4B1W B;  4C1N I;  3OW2 M;  1VQL N;  1V4S A;  4FOE A;  3MWT A;  3GDQ A;  5AQG A;  2Q2R A;  3I8B A;  3LL3 A;  1VQ7 N;  3F9M A;  4CZE A;  1XUP O;  1J6Z A;  3JS6 A;  1E4G T;  4BRK A;  2RE2 A;  4WFB L;  3CXC M;  5AQM A;  1BO5 O;  1DKG D;  1NGJ A;  2FF6 A;  4PL8 A;  4AM7 A;  2YI1 A;  4ISF A;  2QWM A;  5JIC A;  4IZ9 A;  3JXU A;  5TKY A;  1K8K B;  1X3M A;  3ID8 A;  3CCM N;  3VMF B;  3VTI A;  2QWP A;  4ISG A;  3VGK A;  1VQN N;  3EL2 A;  3IFR A;  4FSV A;  2P9P A;  4PHT X;  3CPW M;  1DGK N;  1OKJ A;  1Z05 A;  2QWR A;  3HZ6 A;  3O9S A;  2P9S B;  1IJJ A;  3CCQ N;  3FZM A;  2NNW A;  2ASO A;  4MLE A;  4XH1 A;  5AQX A;  1HPM A;  3L0Q A;  1YAG A;  1VQK N;  3D7E O;  3TSQ A;  3GE1 A;  4XH5 A;  2Q0U A;  3AAQ A;  2VCP A;  1U2V A;  1HLU A;  2V7Y A;  3HRG A;  4JHD A;  1NGI A;  3WXI A;  1S22 A;  4YDU A;  2A5X A;  5AQI A;  2P9U A;  4EAH D;  3O9Q A;  1NLV A;  3O8M A;  4WFA L;  3CJ1 A;  3ZET B;  2ZGY A;  4HTL A;  2YJF A;  5GIN A;  2OTL N;  4IJN A;  4H0O A;  3EO3 A;  1WUA A;  1OVY A;  2P9I A;  3CPE A;  3R9P A;  5JVH L;  5CR4 A;  1RFQ A;  2EWS A;  5AQT A;  3UE5 A;  2YJE A;  1O13 A;  1NGF A;  3T7Z A;  4IOA L;  4BQL A;  2OAN A;  1T6D A;  4G9Z A;  1GLL O;  3FLC O;  3TSU A;  4DKW A;  2V51 B;  3CHW A;  1SZ2 A;  5BR9 A;  4BR5 A;  2Q1N A;  2UYT A;  5E84 A;  3U8X A;  2BTF A;  1NWK A;  1M90 O;  2E1Y A;  2IIR A;  4YOR A;  2ZWH A;  3HOT A;  1RDU A;  3N4P A;  2A6A A;  2YHX A;  1YI2 N;  3H45 C;  1NGA A;  5M1Q A;  1ILY A;  4FWL A;  1BA0 A;  2WUS A;  4JEP A;  2GX9 A;  3KK7 A;  4K25 A;  3ZEU B;  1GLJ O;  2A40 A;  2E2O A;  2FSJ A;  4YOT A;  1VQ6 N;  3CMA N;  5C0Y A;  4MDB A;  4AM6 A;  5C2D A;  1JCG A;  1YF5 L;  2KKZ A;  3D2E A;  3ULE B;  5BRH A;  4BGA A;  1X3N A;  3CCV N;  5LJV A;  2KLA A;  3N4Q A;  4L3Q A;  5DM6 L;  1M1K O;  3R3L A;  1NGH A;  4CZL A;  2P9N A;  3VGL A;  4KH5 A;  4BVP A;  4I6M B;  4IFE A;  4H5N A;  1K8A O;  1BDG A;  3UKU B;  1BUP A;  2KHO A;  4B1Z A;  1P90 A;  4EFH A;  2W40 A;  5GAH P;  3ZX0 A;  3DJC A;  3QIC A;  3SLC A;  5GAE P;  3ENB A;  3MCA B;  4BC4 A;  4BRO A;  1VQP N;  3SAF A;  3VEY A;  3EN9 A;  3QB0 A;  4XH4 A;  4BGB A;  4BRG A;  4R79 A;  2QA4 N;  2I7N A;  4CI6 A;  3MX5 A;  3HM8 A;  3VEZ A;  3ENH A;  3MX2 A;  4UY8 O;  1TUY A;  5AZI B;  1VQM N;  3OBY A;  3ZX2 A;  3B8A X;  5CE3 A;  3E66 A;  2HMP A;  3WEE A;  5C12 A;  2FXU A;  3PIO L;  3CET A;  3M6G A;  4OO1 J;  4FWP A;  4FWS A;  3MWP A;  5AQY A;  3DXM B;  2P9L A;  2GEM A;  3WXJ A;  1YJW N;  2JWL A;  4BY9 C;  5JLF A;  4CD1 A;  5EY4 A;  3ENO A;  4BR7 A;  2ASM A;  2ZF5 O;  3DXK B;  1S72 N;  3QFP A;  1IG8 A;  4FWR A;  1KD1 O;  4CZH A;  3GOI A;  4QS7 A;  3O5B A;  5AZJ A;  5GAD P;  5AQK A;  4CD3 A;  5KPZ A;  1BG3 A;  3C7N B;  3EKU A;  3C6H A;  1GLE G;  3AGK A;  3C0B A;  1TYQ A;  3VEO A;  3VEV A;  4O8U A;  1NM1 A;  1YVN A;  5AR0 A;  2A41 A;  4JKG B;  5C15 A;  2WFB A;  4A5B A;  4CBU A;  3KWI A;  4BRP A;  4H5W A;  3VET A;  3SAH A;  4WQ4 C;  3CCJ N;  5AQQ A;  1QQN A;  1Y64 A;  2W41 A;  3GG4 A;  1K9M O;  1T3V A;  3OHR A;  3S41 A;  4GV3 A;  2NLX A;  4FWN A;  5BRF A;  3SAG A;  3QBW A;  3BUZ B;  1G99 A;  2PAV A;  1HX1 A;  1JJ2 M;  3VES A;  2YHY A;  3WXK A;  1VQO N;  4JK8 A;  4BRN A;  2IVP A;  3RVC A;  2Q36 A;  3P38 A;  3T69 A;  3WQT A;  1MWK A;  1YHQ N;  4XEI A;  5AFU A;  5GAG P;  3L4Q A;  4IWV A;  5F0X A;  1QZ5 A;  3UKR A;  4A62 A;  1K73 O;  2JWK A;  3L4I A;  4O5F A;  3U9D A;  4FL9 A;  4BC3 A;  3MN6 A;  3KVG A;  5C10 A;  5JMV A;  1NGB A;  1GLF O;  1QVG M;  4BR9 A;  3VOV A;  4M7Y A;  3LM9 A;  1QVF M;  5BN9 A;  5BPM A;  2HBJ A;  4EHT A;  3KHY A;  2HOE A;  5AFU H;  4FOI A;  1ZXO A;  1NGD A;  3H1Q A;  3MMV A;  1JCF A;  3FFK B;  3CQY A;  3SBT A;  3IMX A;  3D6R A;  1KC8 O;  4NB4 A;  3TTD A;  4C1N K;  5LJW A;  4WCE L;  1EO1 A;  3GL1 A;  2NZT A;  1Q7Y O;  5H1S Q;  3D2F B;  3QBX A;  1DT9 A;  2FSK A;  4IEI A;  4WQ5 C;  3VEW A;  2HST A;  1HJO A;  2VYP A;  4Z94 A;  4MDA A;  2WC9 A;  4E1J A;  4H03 B;  2HBK A;  3E9O A;  2CGK A;  2P9K A;  3RSE B;  4FWO A;  3M5R A;  4FWK A;  4BRQ A;  1YIJ N;  4B1X B;  5BPL A;  3HOS A;  3TPQ A;  3WXL A;  3OBW A;  3WQU A;  1ZC6 A;  3O1W A;  4GY2 B;  3VF2 A;  4DHY A;  2CGL A;  3CC7 N;  3EE9 A;  3NMU A;  2QWL A;  2ITM A;  4BR0 A;  2V7Z A;  5CHI A;  3CF5 L;  1QQO A;  3HTV A;  5M1P A;  2FF3 B;  3CCE N;  3MK6 A;  3WXM B;  3A0I X;  1SAZ A;  4F9O A;  3P39 A;  4DQ8 A;  2RHK A;  5BN8 A;  3H6E A;  3O08 A;  3FZK A;  3P4I A;  1ATR A;  4JD2 A;  3CI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...