3EE8A

Structure of ns1 effector domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
122
structure length
122
Chain Sequence
TPASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAWGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 1
publication title Structure of NS1A effector domain from the influenza A/Udorn/72 virus.
pubmed doi rcsb
source organism Influenza a virus (a/udorn/307/1972(h3n2))
total genus 33
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ee8A00
3RVCA 3O9UA 3O9RA 2KKZA 3EE9A 2RHKA 3O9SA 3P31A 3KWGA 3D6RA 3L4QA 3M5RA 3F5TA 3O9TA 3P39A 3OA9A 3KWIA 3O9QA 2GX9A 3EE8A 4OPHA 3P38A 4OPAA
chains in the Genus database with same CATH superfamily
2QXFA 5F1XA 4RW8A 4K42A 4BRDA 2P9SB 3QIPA 1WUAA 4BRHA 3K5NA 4C8KA 2HHQA 3LAKA 1HYVA 4E0DA 2ZGZA 3ZT1A 3MN6A 1ZC6A 3FLCO 4CJFA 2HHXA 5EY4A 4FVMA 4M3RA 2P9NB 2EX3A 1JL1A 4HVJA 4W5TA 1SKRA 4DF8A 4WQ4C 4CJRA 3C65A 4DSFA 4E1MA 4DV3K 1HNWK 2WC9A 4DR1K 1BUPA 1B9DA 2WTUA 4B9VA 3M6GA 3MEEA 5BRHA 5JMVA 1L3TA 4O0IA 3KKSA 1ZXOA 2G8VA 4AHRA 4BRIA 1T8EA 1P90A 3DLHA 2GWKA 3D2EB 5F0XA 5JVHL 4B9MA 3RTVA 3TTDA 4C1NI 5A2QO 1IJJA 4AHTA 1BA0A 2QWRA 2A41A 1JLFA 3QO9A 3UKUB 3F5TA 4JKDA 1IBKK 5AQZA 4CZMA 3FGUA 3MXJA 5CHIA 4UY8O 4BE2A 1HYSA 4JAXA 3H45C 3NH0A 3CCRN 1K73O 2GUPA 2Q97A 4BRQA 3TSPA 3ID8A 3TPQA 2QTDA 2ZQBA 2W42A 3PSFA 3AVIA 4DU3A 1EXQA 1XMQK 5LJWA 2Q0UA 3B6OA 3TI0A 4M63C 1BISA 4CHZA 4FJNA 2ASPA 3VQEA 3L2WA 4BRPA 5C2DA 4N47A 4FW1A 2QWPA 1ATRA 4XH4A 2G8WA 5EX5A 3RVCA 2P9UA 3O9RA 4H5NA 4XEIA 5EOYA 2DTUA 3OJUA 3H46O 1X9JA 1BQNA 3AVJA 3O1WA 1QVGM 2O8DB 4BY9C 1XHZA 4AHVA 4CIEA 1HQUA 1BHLA 4JI8K 1Y64A 3K2PA 1DTTA 3A5MC 2Y1IA 5HP1A 3QMLA 1NJXA 2P9IA 5GIOA 3AVGA 1ASWA 4LF4K 1RT5A 4PKHA 3OYEA 2LSNA 2IGIA 1LCUA 3MWPA 4AHCA 2XO7A 3K58A 4DMNA 4Z4IA 5AQTA 2ZM6K 3R3LA 4KHWA 5M1FA 2ZWHA 1ITGA 4LF9K 2IVOA 4H0PA 4ID5A 3DLRA 1NK4A 1BOTO 3NF8A 5BPLA 4M7YA 4O8KA 2HHVA 3O9SA 2YHYA 2E8AA 2OZMA 4Y1CA 4G9ZA 3HYFA 1JJ2M 1VSKA 3F2KA 4JRQA 3N4QA 3VEZA 3SMPA 4FK2A 3DRSA 1NK5A 4OKEA 4FLZA 4BROA 3UIQA 3E1YA 2XY5A 5EXWA 1D4XA 2ASMA 1RTJA 3AA5X 2D0CA 3G25A 4BRMA 1KXPA 2IIRA 2QWLA 1ZBIA 1N32K 5FPNA 2D0PA 5GAEP 5E41A 4ISEA 3ULEB 4FJ7A 2YHWA 1UAXA 1S1WA 3LP0A 4JD2B 5JVGL 4DS5A 5DMRA 4EHUA 4DTMA 2HHWA 2YNIA 1YT3A 3H3OB 2P5OA 1ZYQA 1X1PA 4Z0UA 1VQMN 2HBJA 2GV9A 4U7BA 2G8KA 1CZAN 3ENBA 3IFRA 3SUOA 3BUZB 1HJOA 4H5RA 3CCJN 1DGKN 4GMJB 1X9WA 4FM0A 1CZ9A 3ZX3A 3V1OA 1HMVA 3THYB 2WONA 4J2AA 3OBWA 4DR3K 4BVPA 4FJKA 3KKRA 2OYQA 4F3OA 2XY6A 4Y1DA 4I6MA 5AQWA 5LJVA 4FCYA 3OYFA 4WFAL 3O3FA 4GV6A 3O08A 4DUYK 4FWMA 3DM2A 5J2NA 4NB4A 2Q3SA 2ZJQL 2QI2A 4FWPA 2ITGA 3THXA 2EWSA 3CI5A 3V81A 4LSNA 1C1AA 2P9UB 5J2PA 1XMOK 4IOXA 5AQQA 1RTIA 4BRCA 5DM6L 3VGMA 1T3VA 3MK6A 3BGRA 1HNVA 4CF2A 4JI5K 3S3MA 3EEQA 3D0PA 4L3QA 2HHHK 3OYBA 1J54A 1YAGA 4MO5A 1OVQA 2ZD1A 4JHDA 4IG0A 3OYJA 4BR9A 5D3GA 3A8YA 3S9HA 3HP9A 4LF5K 3G10A 1OVYA 3AO1A 1K8KA 3IDHA 2WOMA 4N56A 1VSJA 1VQ8N 1N8RO 4GV3A 4M3UA 1RT3A 2GUIA 3WXLA 1KD1O 3HVTA 3DLLL 2AA4A 1SL1A 2Z1HA 4H0OA 2F96A 2FLOA 2YCHA 2VG6A 1YTUA 3LAMA 4DF4A 1C0UA 2CGLA 1VQ5N 3ZSYA 2HF3A 2CGJA 1ATNA 4JI6K 4DTNA 3V9WA 2VWJA 2CH6A 3FZMA 4GV9A 4CFCA 3AO3A 5AQYA 1V4TA 1JXEA 3SUPA 4O0JA 3FZLA 1RT2A 4CK3A 3GE1A 1VAZA 5ADXH 1T7PA 4CJ7A 1TK0A 3VQAA 2IAJA 1Q9XA 5AFUA 4H03B 4MLHA 4BC5A 1U04A 4A59A 4H0VB 4FLTA 3SAFA 4BRKA 3EKSA 2BANA 4JKGA 3V4IA 4E3SA 3ZT0A 3T1AA 4DWIA 3KWIA 3PLAA 4FWNA 2Q2RA 4OJRA 1X3MA 3EZWA 2A1RA 1Y97A 1K8AO 2KLAA 5HRSA 1JLCA 4R79A 5BPMA 5AQRA 4CJEA 4YY3K 5HLFA 4DSJA 1QS4A 4ILGB 3ZSZA 2RHKA 3OYHA 1JCFA 4CJWA 3NGZA 3LPTA 3D45A 3ZETA 4Z4HA 1REVA 2ZE2A 4CZEA 4JLHA 2HMPA 4DFMA 1QQMA 4BE0A 3I56N 1WSGA 1VQON 3EL2A 4KTWA 3J7YP 1VQPN 3IKMA 2O4IA 4CHQA 4JEPA 3CCMN 5H1SQ 2D0BA 2D1KA 4IZ9A 4DSKA 1KLMA 3ATUA 2CH5A 3RSEA 3O8MA 3A5OC 5KI6A 4FJJA 3SBGA 5AQVA 4LY7A 2V7YA 3IG1A 4OGEA 5HRNA 2I7PA 1HNZK 2OPQA 1I94K 3CCLN 1WBDA 3AA4A 3E9LA 2DPNA 1NJWA 3QERA 5GAGP 1KVAA 3VMFB 1YF5L 1SL0A 3L8BA 3HL8A 4DTJA 4ZHRA 3AA2A 2UXBK 4N5SA 4CJQA 4IFEA 1YJWN 4DFJA 3U9ZA 2GELA 4IFYA 1HKGA 3KIOA 2KFNA 4LH5A 4CEDA 2RF2A 3VF2A 4I7FA 3EZ5A 5KGXA 4IEIA 2Q36A 3LDQA 2HVIA 1ZBLA 1K8KB 3BZCA 4OLBA 2J4RA 2P9PA 3O4QA 2H3GX 3S3OA 4FYDA 2E2NA 3NBPA 4DQSA 4GY2B 2Z1GA 3DLGA 3SV4A 1OH6A 2HNDA 1QSSA 3V9SA 1DLOA 4NYFA 3U8XA 1Z05A 2O8BB 3B8AX 4CZGA 2QKBA 2GEMA 3C6HA 1LV5A 3E66A 3ZT2A 1NGHA 3OS1A 4QS7A 4WFNL 1S5JA 3TAPA 4W5RA 1UA0A 5FDLA 4HHTA 2QM1A 3S41A 4HTLA 3HVRA 3GG4A 3AO5A 3WQUA 4BDPA 3T3FA 1S1UA 3LL3A 4KB0A 4CEAA 2HNYA 3L2UA 4KHUA 3IUCA 1XNRK 3OYDA 1RBTA 1O1WA 5BN9A 1OH7A 1GLDG 4CGGA 3C7NA 1U47A 1C1CA 3TSUA 1S9GA 4B3OA 1KVCA 4CD3A 3OYKA 4CEZA 4ISFA 3V9UA 4JNEA 1NK8A 2DFFA 5AQNA 1BO5O 4KTQA 5BREA 4YOVA 2Z1IA 5GAHP 4JKEA 3ATVA 3ZT3A 1W7AA 4FW2A 3CETA 2YV0X 3J80O 5FRMA 4BDZA 1ESVA 3T1HK 1RCHA 4QS8A 5MLCQ 2QEXN 3C6AA 2YKNA 3P31A 3H1VX 3AARA 5E26A 4EZ9A 3K5MA 3KVGA 2E2PA 2F9TA 4M3ZA 3VQ7A 2YJFA 4OGCA 4FZXC 2QXLA 3RSEB 2DFEA 2E2QA 4IEEA 3VN5A 4E7JA 2VYPA 1ZBUA 4H0XB 4YOUA 3OS0A 4B9TA 1QZ6A 1YHQN 4E1JA 4CBWA 3L4IA 1TGOA 3TR8A 1QSYA 3HM8A 4CHYA 2QK9A 1RDBA 1RDCA 4E1NA 2IOCA 3M8QA 1HX1A 3I0RA 4CK2A 4KAZA 4DV4K 3CF5L 2ATQA 4AF1A 2X6NA 3TTFA 4DQQA 5BN8A 3ZCMA 4DTXA 3PO5A 2PBDA 4WQ4A 2HF4A 2ZJRL 1NK7A 3CFOA 1N5YA 3CCSN 1L3VA 4RW6A 4E19A 4AM6A 1R59O 1L3SA 2AP1A 3RMDA 1IO2A 4FJHA 5C24A 3EKUA 4K43A 3THWA 3KLGA 1QTMA 5ELZA 3C6TA 4GNIA 3HTVA 3ENOA 2F8SA 2Z1JA 2YKMA 3DLKA 3VTIA 4DSLA 4CZFA 3N4PA 2RE2A 4IJNA 4NXMK 3TTCA 3QEIA 1ASVA 4PL8A 2VQEK 4DV5K 2NRHA 1NGAA 4H4OA 2VQFK 1D9DA 3OYLA 3GBTA 2ITMA 3HK2A 3AVAA 1N33K 2E1ZA 4L8RB 2FF6A 5AZIB 1GOCA 1K6YA 4F9OA 3K59A 1RT7A 1OH8A 3CIPA 4CJ4A 3T69A 4BR2A 3ITHA 1TYQA 3L3UA 1VSEA 4C23A 3ZYYX 4M3TA 5AQSA 3J8AA 5GIPA 1NMDA 4DTPA 4I9QA 1WSEA 4DTOA 3AVKA 5JS2A 2BE2A 1NG9A 4YHHK 3M8RA 2OZSA 4BR5A 4YOYA 5HBMA 1FK9A 4AHSA 5LL6Z 1J5EK 4BVOA 3RRGA 4FK4A 1VQ9N 5AQJA 3G4SN 1S22A 2IDOA 1VQKN 3JYTA 3QFPA 2BDPA 3P38A 2JGUA 1TKTA 4C8LA 3LP2A 2QWMA 4NCGA 4B1UB 5M1KA 1BA1A 4AH9A 4H8KA 5BPNA 4DR6K 3HOTA 4FWRA 4V19S 3SAGA 5AZJA 3PV8A 3UE5A 1DKGD 5KRSA 4AM7A 3C0BA 4UQGA 2E1YA 2FSJA 1SKWA 1XNQK 4BREA 4JK9A 5FPMA 1QVFM 3FFIA 3W0LA 4KHPK 3DYAA 3FZFA 2E20A 3L4QA 2QWQA 3AV9A 2KZZA 4BR0A 3M5RA 2V7ZA 3R1XA 4BG8A 3HJFA 3KLHA 4O4GA 3WNGA 4DQPA 3AVCA 3CXCM 4IOAL 3SI6A 3NVMA 3NGYA 1KAZA 3OYCA 4OPHA 4KHYA 2X6SA 3K9JA 1T44A 4X65K 4DG1A 2O8FA 4K8XA 3HI0A 4F3TA 3SQ4A 3RR8A 1GLLO 1WLJA 1R0AA 1S3XA 3MEGA 4FVUA 1WBBA 4BQZA 4WFBL 4F2SA 3LANA 4BDYA 3V1RA 1U4BA 1QSLA 4FWOA 3HZ6A 4KB1A 3EE9A 4CF0A 3MDQA 4YOXA 1B9FA 4XH1A 3ZSVA 2NRVA 4J2BA 2OTJN 4DQ8A 1YUWA 1E4FT 3Q7CA 2OA8A 1YVUA 4J2EA 1LWCA 5IWAK 4Q0BA 4NCBA 3AVLA 1TV6A 3NH1A 3DXMA 1SZ2A 5HOOA 4FLYA 1BL3A 1Q82O 4NXNK 3L2RA 3AAQA 3SPYA 1LW0A 4KRFA 4JV5K 1XQSC 2FXUA 4FWQA 1NGDA 1TK5A 3CC2N 4M3YA 1GOBA 4W5NA 4WYBA 1TK8A 4HCCA 4IFVA 1DTQA 2PFUA 4XH5A 3E01A 1TUYA 5C0YA 3CMAN 3PIOL 5HRPA 3LM2A 1HRHA 2FC0A 2JLEA 1GLCG 3VEOA 2GX9A 3TAGA 4CE9A 1NWKA 2HBKA 1GOAA 3VF4A 4CJTA 4WQ5C 2HHTA 4CF8A 4LF6K 4FWSA 3SV3A 3RR7A 2DFHA 3J81O 3LDPA 1W9HA 4R5PA 2IVNA 1S1VA 4FWLA 3T7ZA 5KPRA 1VQNN 4MLEA 3T1YK 3WNHA 4KI6A 1NJIO 5AQMA 4BWJA 3ZX2A 1U2VA 4C8MA 4PY5A 2PY5A 1HUXA 3MCAB 3CJBA 3AVHA 3HOSA 3VEWA 3NGIA 3BF3A 4IO9L 4H5WA 4B8CA 3VQDA 1I39A 1HQEA 2FBXA 4HCBA 4OO1J 3NCIA 3V6DA 2P9KA 4W5OA 1GLFO 4M3WA 4FJIA 3I8BA 4FZZA 1RBRA 1T03A 3ZT4A 3H3NO 4X62K 3MXIA 3HPOA 1RDWX 3B6PA 3VEXA 1D5AA 3EE8A 1VSFA 5CZ2A 4ZTJA 4CGIA 4JS5A 3KWGA 2G8FA 1ILYA 3VQ5A 3ISNC 3NDKA 1Q9YA 3TSQA 1RDDA 3O4NA 3LP3A 2QWNA 1BCOA 2UUAK 2O8FB 4FLWA 3HBTA 4PL7A 3QESA 4KO0A 3TABA 2P9IB 1S1XA 2P51A 4FL9A 4DV1K 2YNGA 1XI1A 3DLEA 1KAYA 5FPDA 4CGFA 4PKGA 5IT9O 1G15A 3ALYA 1P8ZA 3QDKA 3ZSRA 3ZX0A 4GVMA 1NGIA 4FZYA 3V9XA 4WF9L 4CECA 1VK0A 3GOIA 1M90O 1KLNA 1BU6O 1FXXA 4CFAA 3TAQA 4YDUC 4HUEA 4RW9A 3DXKA 3KK1A 3SUQA 1X9SA 3UKRA 1WSFA 3D2FA 3LWLA 2A3ZA 4K8ZA 3CQ8A 3VQ4A 4NYNA 5J2QA 3DJCA 3U3YA 3T19A 2KW4A 5HL7L 3PX0A 1NKBA 1NKCA 3LP1A 3K0SA 2D0AA 1BI4A 4CVNE 4E7IA 4Q5VA 4B9SA 1Z6RA 3MAQA 4B8AB 4PUOA 2FBTA 3AVMA 4W5QA 2HHSA 3V9ZA 3VQ6A 3AVNA 4ELUA 4CIGA 1QQOA 3O9UA 4Z4GA 1TKZA 2UU9K 3SAHA 1NOZA 1VSMA 3I8DA 3CM5A 1OH5A 1XC3A 3CMEN 3DLBA 4FO0A 3H08A 4KH5A 3A5LC 1E3MA 5DM7L 1J5OA 4CJKA 3LM9A 3OBYA 1UOCA 3ZSQA 3C95A 4E7HA 4CCHA 4I6MB 4YOWA 1J6ZA 4A2AA 4FOIA 1C0GA 3SQ0A 3MN5A 2IVPA 3K5LA 5HROA 3L3VA 5LY3A 2NRWA 1NGJA 2W6KA 5JLHA 4ILHA 1Z26A 5AQFA 3THXB 3HM9A 1BGXT 1HKCA 4JRPA 4YFUA 1JCEA 3IRXA 3EYZA 1NNEA 3QFUA 4NO7A 4J2DA 3K5OA 1XWLA 3MX5A 1KVBA 1YJNN 1JKHA 5CR4A 5CYQA 1ZBSA 4BR4A 2HNZA 3A2FA 3CERA 4RG8A 1SS6A 3LZJA 4CEFA 1NM1A 4JHDB 1S1TA 3R6MA 5C25A 2E88A 1LWEA 4IXCA 1QQCA 3NVKA 4ELTA 3RMCA 3VGLA 1IH7A 4OVLA 5I3UA 4B3RK 2UXDK 3ENHA 4ZTFA 4FWKA 4B3TK 1RBSA 1WN7A 1DEJA 4KBOA 4B9NA 2KZMA 4KKOA 1E4GT 1NBWA 5KQ8A 1RDAA 4CHPA 3WEEA 3J7ZO 1N36K 3HO1A 1IV0A 3CPEA 5AQHA 2W40A 4JKCA 3HPHA 3VETA 2P9LA 1RTDA 3CFRA 3CCQN 1L3UA 2ASOA 3LZIA 3SNNA 5KPTA 4RWTA 1EX4A 4CBUA 1EKEA 1RFQA 1HPZA 5FPEA 5TKWA 1VSIA 4RCHA 4DCHA 3QBXA 4CJUA 1RTHA 2E4LA 2WBNA 3JAMO 4DR4K 3M8SA 3HSCA 4CK1A 4O8UA 3R9PA 5FRNA 4ISGA 4RTFD 1HJRA 3QIOA 4FPBA 2G8IA 4ID1A 2P9NA 4XIUA 5AQUA 3BF1A 4HWIA 3WXJA 5KGWA 4BGAA 1MWKA 5DK5A 1Q8IA 4CZHA 1MU2A 4IWVA 4JKGB 1BI4B 2OPPA 3I55N 4DUZK 1VQ6N 2OCEA 2D4WA 3KK7A 5I9EB 4BWMA 1TUUA 1SQKA 2O8EA 3P83D 1ASUA 1IBMK 3D6RA 1QHTA 1LAWA 1TKXA 3O1BA 4DR7K 4B1XB 2Q0RA 3CHWA 3PX4A 4QS9A 4IOCL 1NK0A 2ZF5O 3ZETB 3JS6A 2KFZA 3D2EA 4CJ3A 4A57A 1NGGA 4DTSA 2KTQA 3DOKA 3U6FA 3SQ1A 4DQIA 4JYAK 3UKUA 1VQ7N 5KTQA 4CFDA 4IKFA 2YHBA 3QNOA 3Q7BA 5M1QA 1MA9B 2W6LA 3VQ8A 3CD6N 1Q81O 4DKWA 4K25A 4CJPA 1KC8O 3G6EN 3D7EO 2Y1JA 1S72N 4FJ9A 3K9KA 3QINA 1LWFA 5C42A 2GBZA 4CJSA 5M1OA 1RNHA 4IDHA 4GW6A 1A5WA 3R8EA 3CC7N 3O3GA 1GLJO 1TAQA 3DRPA 3BP8A 4MQ3A 3VOVA 4CEEA 1LW2A 5BRDA 1XC9A 1MWMA 5TKYA 3WNFA 1JXBA 3NF9A 3VTHA 3QLHA 1ZBFA 3OJSA 3SBTA 5B8HA 4JI7K 3QEXA 4I2QA 4LFCK 4H4MA 2VWBA 3VPZA 3ULDA 2HMIA 4JI4K 2P9PB 3AVFA 2PAVA 5T7BA 3OVNA 3OW2M 3U4LA 3QEWA 5SZTA 4BACA 2BGGA 1YXQA 2P9LB 2FBVA 2RN2A 4Y0WA 3TAEA 2BUPA 3CC4N 2F9WA 1EQYA 1G99A 2R7YA 3ASMA 5AQIA 2FSKA 2PZSA 5ADXA 3TANA 3AGRA 2HB5A 1QZ5A 2D5RA 3KD1E 5K14A 3IAYA 1IKXA 1Q18A 1C0MA 4DS4A 4KHNA 2FSNA 4Z4CA 4F8RA 2ZGYA 5J1EA 1NMNA 5C10A 1HYZA 2NZTA 3CCVN 2HW3A 4B1ZA 4QCLA 1MDUB 4M42A 3VERA 4LFAK 1JCGA 3NHGA 3ZSWA 4FPAA 1D9FA 4H0TB 4PKIA 5CY4A 4YNQA 4HUFA 3C7NB 4I2PA 2UUBK 1S9EA 5M1NA 3RMAA 1JLAA 4OX9K 4DV6K 2O8EB 3SYZA 1YTAA 4CZLA 3OYAA 1HLUA 3TAFA 4EAHD 3OYIA 2OTLN 4RW7A 4MO4A 4CBXA 3L2QA 2E6LA 2V51B 3MN7A 1NGBA 3ULEA 3V1QA 1RT4A 2XRIA 4MDAA 2ZJPL 4JD2A 3ZEUA 5AFUH 4IBNA 4FJLA 4A62A 3RRHA 4DTRA 3M3ZA 3MWTA 3HPGA 4QAGA 4BRFA 1C0TA 1YITN 4QOZB 3M8PA 1SAZA 2E5LK 4B3MK 2B4JA 5SWMA 2EHGA 2HBMA 3PX6A 4JN4A 3SJHA 4CZJA 1RT1A 3H1QA 3NAEA 2KQ2A 3THYA 4ELVA 2O8CA 1A5XA 1W97L 3I0SA 1CXUA 3JXUA 3MXMA 2F7TA 3VQ9A 1SV5A 4GKKK 3KK3A 3EO3A 3AVBA 1JLGA 3FZKA 2UXCK 3P39A 4OLAA 5BR8K 1T6CA 3MECA 2NRRA 4M45A 5C12A 4DB3A 4BG9A 4BRNA 1QE1A 1C6VA 1JLEA 3AY9A 3DOLA 1GLAG 3WXIA 1JLBA 1YVNA 3PUFA 5I42A 3K57A 2NRZA 3OYGA 4Z4EA 5FLXO 4BRAA 2YI1A 4DV7K 2VGNA 4CHOA 1VRUA 3I33A 1HKBA 2IC3A 1VSHA 4IJAA 3THWB 3KZBA 3DI6A 1WSJA 4A2BA 1C0FA 5J2MA 2YHAA 3QICA 5JLFA 3OTOK 2B5JA 1L5UA 2QA4N 4DU1A 4Z4FA 1EWQA 3LWMA 3CJCA 3WXKA 5LMNK 3L6QA 3P5JA 4JK8A 3THVA 1A5VA 1J53A 4HTUA 4Z94A 2VGMA 4LF8K 4C1NK 1HNIA 4DR2K 4EHTA 4LH4A 2FBYA 3A5NC 2NUBA 5F2RA 1NJYA 2OANA 3TAMA 3S3NA 1TYQB 4OPJA 3LDOA 3KLIA 2I5JA 4WQ5A 4CEBA 4CD1A 2JWLA 3F9MA 2VWKA 4A5AA 2RKIA 4B9QA 4CESA 2UUCK 2E6MA 4DSIA 4KREA 1V4SA 5EU7A 3CJ7A 1SL2A 4FJGA 4YOTA 4EP5A 3BEXA 1WB9A 3EN9A 4K0KK 4AQYK 4DU4A 1BG3A 4KPYA 3M1FA 3A0IX 3ZEUB 5AQXA 3HT3A 3CCUN 2YX6A 1GLEG 3OYMA 1CZBA 2A42A 2P5GA 1EO1A 2NLXA 2FF3B 2ETJA 1NKEA 3GDQA 5AZJB 2YNHA 1BIUA 3KK2A 2DY4A 4LD0A 2XY7A 3CQYA 3TWHA 2O8CB 2YJEA 1RBVA 5M1PA 4F4KA 3FZHA 1SKSA 1N6QA 5BR9A 1Q86O 1RILA 4GVEA 3IS9A 4TSXA 3JSMA 2NNWA 4KV8A 4FLUA 1XHXA 1BQMA 4BE1A 4E7LA 1FJGK 4E89A 2YHXA 4B1WB 1EETA 4C8OA 2HOEA 4CERA 1ZBHA 2A6AA 4EIAA 4H0YB 4KTZA 4LFBK 3DWLA 2AJQA 5AR0A 3L2VA 1X3NA 4C8NA 1KFSA 2PYLA 2HHUA 2A40A 3SJJA 4YDUA 1VSDA 1WSHA 2OPSA 3BY5A 4H5VA 5CZ1A 1VRTA 3CJAA 2RPIA 1IKWA 4CEOA 5C2FA 1O13A 3SZ2A 4KH4A 5AQLA 3PY8A 1RBUA 3WQTA 4E7KA 3HXMA 2QKKA 4X66K 4JK7A 1IKYA 3P1GA 3SCXA 4JI1K 1WNSA 4FJMA 3F73A 4KFBA 4DFPA 2F4VK 3BDPA 4MDBA 1VQLN 1T05A 3OA9A 3G71N 1RT6A 3VA0A 5AQPA 1WAJA 4ILJA 1CXQA 3SMSA 2B6AA 3QEPA 5GINA 3DXMB 2O8BA 3SPZA 4N41A 1NK6A 4JKFA 3C6UA 3KLEA 1W2BM 1NU0A 4B3SK 2QWOA 4PQUA 3KTQA 4O44A 1YI2N 4U67L 3O6WA 1ATSA 4CF9A 3SUNA 4B1YB 3WXMB 4N76A 1T6DA 2D0OA 3NMUA 5C15A 3KHYA 3MCPA 2KKZA 4JKAA 4X64K 3CJ1A 4DLGA 3QNNA 5AQOA 1YIJN 1IKVA 3SK3A 4J8FA 3AA3A 2WFBA 2NRXA 1VQ4N 2QW9A 4OKKA 4CZKA 1TL3A 3LDLA 2G8HA 2BTFA 3LDNA 1GLBG 3CCEN 1FKPA 2P1JA 1U6ZA 4O5BA 3CG7A 4PWDA 1K9MO 5E84A 4JI2K 3VEVA 2V52B 3H6EA 4BQLA 4HUGA 4FM2A 1U2VB 4MFBA 3VF6A 1VHXA 3F9KA 4RW4A 3VQCA 3CFPA 4CW7B 5LMUK 3G0ZA 4DTUA 4NLBA 3PIPL 3U9DA 4KHQA 1NGEA 3OHRA 3VA3A 2X74A 4CI6A 4EP4A 3ID6A 3J7AP 4BC2A 3NF7A 1VSLA 3FR0A 4B9LA 1XUPO 2P9KB 4WCEL 1Q7YO 2VG7A 4F2RA 1S6PA 1Z25A 1TVRA 4LSLA 1X9MA 3AAPA 4FK0A 3SQ2A 1NK9A 5JS1A 1FW6A 4BRGA 1KAXA 1HR0K 2A5XA 2GTDA 3NFAA 4CJ5A 4AHUA 2VCPA 3CQXA 1IBLK 1TAUA 4OKJA 5EVZA 2KHOA 3VQQA 1H1VA 3ZSOA 1KFDA 3DRRA 4BC3A 3OYNA 1QHAA 3KD5E 4KI4A 1NOYA 3CYMA 2GWJA 1WAFA 1N34K 4O55A 1UWBA 3KLFA 5BRFA 1KCFA 3QEVA 3E9OA 1KRPA 2WUSA 3OS2A 3AO2A 3AGKA 3LPUA 4IG3A 1EWRA 1U49A 1BWFO 2P9SA 2CGKA 4CGJA 1DT9A 4H5TA 1IG9A 4BRLA 2XHBA 3DAWA 3MEDA 2PYJA 3DXKB 3O4WA 1F21A 4EZ6A 3UKRB 4BR7A 2G8UA 3D2FB 1QQNA 3VENA 4CHNA 1D8YA 4GKJK 3SLCA 4CEQA 3C94A 3FFKB 3O9TA 3EY1A 4AILC 1M1KO 3PO4A 2BH1A 3QETA 2XY8A 4BC4A 4CFBA 1CLQA 4KH6A 3U3GA 4B08A 4A61A 1OKJA 4DR5K 4FLXA 4DQRA 3HP6A 4JI3K 4LC9B 2OPRA 1NLVA 4NLCA 3QBWA 4I9LA 1BCMA 2O4GA 1JL2A 5AZIA 4CJVA 3QB0A 1J9AA 4OPKA 3GL1A 3VESA 5KRTA 4K41A 1W0HA 3HRGA 1RGIA 3O3HA 4M7XA 1U45A 1RDUA 1C1BA 2E2OA 4PA1A 4B1VA 3MMVA 4KHSA 1TL1A 1TKDA 3VQBA 4JS4A 1LAVA 3VQPA 4CF1A 1KSPA 3RWUA 4CJLA 4JI0K 3LALA 3O9QA 5KPZA 5FROA 4WE1A 4ICLA 1NGFA 1S6QA 3HSTB 4OPAA 4FJ5A 4YORA 5HRRA 3E9PA 4CZIA 3TARA 2X78A 3PSIA 5AQGA 3TU5A 4DV0K 3O80A 5AJ3K 4DSEA 3P4IA 1SUQA 3W3DA 3DMJA 1I3AA 3MN9A 3NF6A 5CE3A 2UYTA 2NRTA 4FSVA 3ZSXA 5CYMA 4B9UA 3O5BA 1U48A 2YNFA 4NCAA 2Q31A 2A1SA 4O5FA 4FXDA 3CJ9A 1KTQA 3ZLJA 3L0QA 1NJZA 2I7NA 3NH2A 4EFHA 3VGKA 4CGHA 4DLEA 2IS3A 4IO8A 4PHTX 1HPMA 3VEYA 3WUHA 1BIZA 3KJVA 4IDKA 2Q1NA 3UB5A 1LOTB 2W41A 4FOEA 3WT0A 2VG5A 3CM6A 1BDGA 4CGDA 3IMXA 4FLVA 1B92A 4DV2K 4LF7K 3OY9A 1UA1A 3MX2A 5JICA 4DFKA 1HNXK 2HSTA 1EP4A 1WOQA 3FE1A 1KQSM 4JKBA 1FKOA 3WEEB 2O8DA 2HBLA 2JWKA 1JLQA 4A5BA 5KQDA 4M41A 3BZKA 1IG8A 4JKHA 2F8TA 1NGCA 5AQKA 3CPWM 3WNEA 3NE6A 3LDSA 1WSIA 4BGBA 4FJ8A 4CIFA 4M3XA 4FM1A 2HVHA 3RMBA 1YJ9N 5GADP 3AO4A 4DHYA 4G1QA 4FJXA
chains in the Genus database with same CATH topology
1C0FA 5F1XA 3QICA 5JLFA 2E2NA 4K42A 2QA4N 4BRDA 4GY2B 2P9SB 1WUAA 3CJCA 3WXKA 4BRHA 1P8ZA 3QDKA 3L6QA 2ZGZA 4JK8A 3ZX0A 3MN6A 1NGIA 3U8XA 1ZC6A 3FLCO 1Z05A 4WF9L 3B8AX 4CZGA 4Z94A 3GOIA 2VGMA 1M90O 2GEMA 1BU6O 3C6HA 5EY4A 4C1NK 3E66A 2P9NB 1NGHA 4YDUC 4EHTA 3DXKA 3A5NC 4QS7A 4WQ4C 5F2RA 3C65A 4WFNL 2OANA 1TYQB 3UKRA 3LDOA 3D2FA 2A3ZA 2QM1A 3S41A 2WC9A 4HTLA 4WQ5A 3DJCA 3GG4A 4CD1A 3WQUA 2JWLA 1BUPA 5HL7L 3F9MA 3LL3A 3M6GA 4A5AA 4B9QA 3IUCA 5BRHA 5JMVA 1Z6RA 1V4SA 5BN9A 1ZXOA 1GLDG 3CJ7A 3C7NA 3TSUA 4BRIA 1P90A 4YOTA 3BEXA 3EN9A 4CD3A 2GWKA 1QQOA 3D2EB 3O9UA 5F0XA 5JVHL 1BG3A 3M1FA 3A0IX 4ISFA 3TTDA 4C1NI 3ZEUB 5AQXA 1IJJA 3CCUN 2YX6A 1GLEG 4JNEA 1BA0A 3SAHA 5AQNA 1BO5O 2QWRA 1XC3A 2A41A 3CMEN 2A42A 5BREA 4YOVA 3UKUB 3F5TA 4FO0A 4JKDA 5GAHP 4JKEA 3ATVA 4KH5A 5AQZA 3A5LC 4CZMA 2NLXA 1EO1A 3FGUA 5DM7L 2FF3B 3CETA 3LM9A 5CHIA 4UY8O 3OBYA 3GDQA 1ESVA 4JAXA 3H45C 5AZJB 3CCRN 1K73O 2GUPA 4QS8A 2Q97A 4I6MB 5MLCQ 4YOWA 2QEXN 4BRQA 3TSPA 3ID8A 3TPQA 1J6ZA 3C6AA 2QTDA 4A2AA 3CQYA 3P31A 3H1VX 3AARA 5E26A 4FOIA 1C0GA 2YJEA 5M1PA 5LJWA 3KVGA 2IVPA 2Q0UA 3MN5A 2E2PA 2F9TA 3FZHA 4M63C 5LY3A 2NRWA 1NGJA 2YJFA 5JLHA 4ILHA 5AQFA 5BR9A 2QXLA 1HKCA 1Q86O 3RSEB 4GVEA 1JCEA 2ASPA 4BRPA 2E2QA 4IEEA 3QFUA 2NNWA 2VYPA 4NO7A 5C2DA 2QWPA 4H0XB 4YOUA 1ATRA 3MX5A 1QZ6A 1YHQN 1YJNN 4E1JA 4XH4A 4CBWA 5EX5A 3L4IA 3RVCA 2P9UA 3O9RA 5CR4A 3HM8A 4H5NA 1ZBSA 4XEIA 4BR4A 2YHXA 5EOYA 4B1WB 3CERA 1SS6A 2HOEA 1NM1A 4JHDB 2A6AA 1HX1A 4EIAA 3H46O 1X9JA 3R6MA 4H0YB 3DWLA 3O1WA 1QVGM 3CF5L 5AR0A 4AF1A 2E88A 1X3NA 4IXCA 3NVKA 2A40A 3TTFA 4BY9C 3VGLA 4YDUA 5BN8A 3ENHA 4FWKA 2PBDA 4WQ4A 1DEJA 1Y64A 4KBOA 1E4GT 1NBWA 5KQ8A 2HF4A 2ZJRL 3J7ZO 3WEEA 3CCSN 4H5VA 3CJAA 4AM6A 3CPEA 1R59O 2AP1A 3A5MC 5AQHA 2W40A 4JKCA 5C2FA 1O13A 4KH4A 5AQLA 3EKUA 4K43A 3QMLA 5ELZA 2P9LA 3VETA 3WQTA 2P9IA 4GNIA 4JK7A 3CCQN 3HTVA 3ENOA 2ASOA 5GIOA 4PKHA 3VTIA 4CZFA 1LCUA 3MWPA 4MDBA 5KPTA 1VQLN 3N4PA 5AQTA 4RWTA 2RE2A 3R3LA 3OA9A 4IJNA 4CBUA 5M1FA 2ZWHA 3G71N 2IVOA 4H0PA 1RFQA 3TTCA 5AQPA 4PL8A 5FPEA 5TKWA 4DCHA 1BOTO 4RCHA 4ILJA 3QBXA 2WBNA 2NRHA 5BPLA 1NGAA 4M7YA 4O8KA 3HSCA 3SMSA 4O8UA 3R9PA 5GINA 3O9SA 4ISGA 3DXMB 4RTFD 2YHYA 2E8AA 4FPBA 4JKFA 3GBTA 2ITMA 4G9ZA 1W2BM 1JJ2M 3F2KA 2E1ZA 2P9NA 3N4QA 2FF6A 2QWOA 5AZIB 3SMPA 3VEZA 4F9OA 5AQUA 3BF1A 4HWIA 3WXJA 4BGAA 3CIPA 1YI2N 1MWKA 3T69A 4BR2A 1TYQA 3O6WA 4CZHA 4U67L 1ATSA 4PKGA 4BROA 3E1YA 4B1YB 4IWVA 4JKGB 1D4XA 2ASMA 3G25A 5EXWA 3WXMB 4BRMA 4C23A 3I55N 1KXPA 1T6DA 2D4WA 1VQ6N 3KK7A 5I9EB 2IIRA 2QWLA 3ZYYX 5AQSA 2D0OA 3J8AA 1TUUA 1SQKA 5FPNA 5GIPA 3NMUA 1NMDA 5C15A 2D0PA 5GAEP 3KHYA 4ISEA 3MCPA 2KKZA 3ULEB 2YHWA 4JKAA 3D6RA 3CJ1A 4JD2B 3O1BA 5AQOA 3SK3A 4EHUA 5JVGL 1YIJN 4J8FA 4B1XB 3H3OB 2WFBA 2NRXA 2Q0RA 1VQ4N 2QW9A 3CHWA 4CZKA 4QS9A 3LDLA 4BR5A 4YOYA 4IOCL 1VQMN 2BTFA 2ZF5O 3LDNA 2HBJA 4U7BA 1GLBG 3JS6A 3ZETB 3D2EA 4BVOA 3CCEN 1U6ZA 4A57A 1CZAN 3ENBA 3IFRA 1NGGA 1VQ9N 5AQJA 3G4SN 1S22A 1VQKN 3BUZB 1HJOA 3QFPA 4H5RA 5E84A 3CCJN 1K9MO 1DGKN 3P38A 3VEVA 2V52B 3H6EA 4BQLA 2QWMA 3ZX3A 3UKUA 1VQ7N 1U2VB 4B1UB 3VF6A 5M1KA 1BA1A 3OBWA 5BPNA 4BVPA 3Q7BA 3HOTA 4FWRA 5M1QA 4NLBA 1MA9B 3SAGA 3U9DA 5AZJA 3PIPL 3CD6N 1NGEA 3OHRA 1DKGD 3UE5A 1Q81O 4AM7A 4I6MA 4CI6A 5AQWA 3ID6A 4DKWA 5LJVA 3C0BA 4K25A 1KC8O 3G6EN 4BC2A 2E1YA 4WFAL 2FSJA 3FR0A 3O08A 4BREA 1XUPO 2P9KB 4JK9A 4WCEL 1Q7YO 3D7EO 5FPMA 4FWMA 1QVFM 1S72N 3W0LA 3K9KA 4NB4A 3FZFA 2ZJQL 2QI2A 4FWPA 2E20A 3L4QA 3AAPA 5M1OA 2EWSA 3CI5A 2QWQA 4IDHA 2P9UB 3R8EA 4BR0A 3CC7N 3M5RA 4IOXA 5AQQA 2V7ZA 3R1XA 1GLJO 4BG8A 4BRCA 5DM6L 3VGMA 1KAXA 1T3VA 3MK6A 4BRGA 3BP8A 2A5XA 3CXCM 2GTDA 3VOVA 4IOAL 5BRDA 2VCPA 1MWMA 3CQXA 3NVMA 4L3QA 5EVZA 2KHOA 1YAGA 1KAZA 4MO5A 5TKYA 1H1VA 4OPHA 3VTHA 4JHDA 4BC3A 3K9JA 1T44A 3SBTA 1QHAA 4BR9A 5B8HA 3A8YA 2GWJA 2VWBA 3VPZA 2P9PB 3HI0A 2PAVA 5BRFA 1OVYA 1GLLO 3OW2M 3E9OA 3U4LA 1K8KA 2WUSA 1S3XA 3IDHA 1YXQA 2P9LB 4Y0WA 1VQ8N 4FVUA 3AGKA 2BUPA 3CC4N 1N8RO 4GV3A 2F9WA 1EQYA 4BQZA 1G99A 4WFBL 3WXLA 1KD1O 3DLLL 2AA4A 5AQIA 1BWFO 4H0OA 2FSKA 2FLOA 2P9SA 2CGKA 5ADXA 3AGRA 1DT9A 2YCHA 4H5TA 1QZ5A 4FWOA 3HZ6A 4BRLA 3EE9A 3DAWA 2CGLA 3MDQA 3DXKB 3O4WA 4YOXA 4XH1A 1VQ5N 2NRVA 2HF3A 2CGJA 2OTJN 1ATNA 1Q18A 1YUWA 4DQ8A 3UKRB 4BR7A 2FSNA 3D2FB 1E4FT 2ZGYA 1QQNA 3Q7CA 3VENA 2CH6A 3SLCA 3FZMA 3O9TA 3FFKB 5C10A 4GV9A 1M1KO 5AQYA 1V4TA 2NZTA 3CCVN 4B1ZA 2BH1A 4BC4A 1MDUB 4KH6A 3DXMA 3FZLA 3VERA 4A61A 1SZ2A 1JCGA 3GE1A 1OKJA 1VAZA 5HOOA 4GV6A 5ADXH 4FPAA 4H0TB 4LC9B 1NLVA 4NLCA 4PKIA 3QBWA 4CJ7A 1Q82O 3AAQA 5AFUA 3C7NB 4H03B 4MLHA 5AZIA 3QB0A 4BC5A 5M1NA 3GL1A 3VESA 4A59A 4K41A 4H0VB 1XQSC 2FXUA 3HRGA 4FWQA 1NGDA 3CC2N 4CZLA 3SAFA 4BRKA 1HLUA 3EKSA 1RGIA 4WYBA 4JKGA 4M7XA 4EAHD 1RDUA 2PFUA 4XH5A 1TUYA 2E2OA 2OTLN 4B1VA 3MMVA 5C0YA 4MO4A 4CBXA 3CMAN 3PIOL 2V51B 3KWIA 3LM2A 1NGBA 3MN7A 4FWNA 2Q2RA 3ULEA 3PLAA 1X3MA 3EZWA 3O9QA 1K8AO 2KLAA 1GLCG 4MDAA 2GX9A 4JD2A 3VEOA 3ZEUA 1NGFA 5KPZA 2ZJPL 4R79A 4OPAA 1NWKA 4YORA 2HBKA 5BPMA 5AFUH 5AQRA 3E9PA 4ILGB 4CZIA 2RHKA 4A62A 3VF4A 3M3ZA 3MWTA 4WQ5C 1JCFA 4FWSA 5AQGA 4BRFA 3ZETA 3TU5A 1YITN 3O80A 3LDPA 4CZEA 2IVNA 2HMPA 3P4IA 4FWLA 3T7ZA 1SAZA 5KPRA 1VQNN 4MLEA 1QQMA 3W3DA 2HBMA 4JN4A 3SJHA 3MN9A 4CZJA 3I56N 5CE3A 5AQMA 2UYTA 1NJIO 2NRTA 3H1QA 4FSVA 3ZX2A 1VQON 3EL2A 3O5BA 1U2VA 1VQPN 2Q31A 3IKMA 1HUXA 4JEPA 4O5FA 3MCAB 3CJBA 5H1SQ 3CCMN 1W97L 3HOSA 3CJ9A 3VEWA 2D1KA 4IZ9A 3ATUA 3BF3A 4IO9L 3L0QA 4H5WA 2CH5A 2I7NA 3JXUA 4EFHA 2F7TA 3VGKA 3RSEA 3O8MA 3A5OC 4OO1J 3SBGA 3EO3A 2P9KA 5AQVA 1GLFO 4IO8A 4PHTX 2V7YA 1HPMA 3VEYA 3WUHA 3FZKA 3I8BA 2I7PA 3P39A 1T6CA 3H3NO 2Q1NA 3UB5A 1LOTB 3CCLN 2NRRA 5C12A 2W41A 4FOEA 3WT0A 1RDWX 3E9LA 4DB3A 1BDGA 2DPNA 3IMXA 4BG9A 4BRNA 3VEXA 3EE8A 3AY9A 5GAGP 3MX2A 1YF5L 1GLAG 3VMFB 3WXIA 5JICA 1YVNA 3KWGA 1ILYA 2HSTA 1WOQA 3FE1A 1KQSM 4JKBA 2NRZA 3TSQA 3WEEB 2HBLA 2JWKA 4A5BA 4IFEA 5KQDA 1YJWN 3U9ZA 4BRAA 2YI1A 2GELA 2QWNA 2VGNA 1HKGA 3I33A 1HKBA 3HBTA 1IG8A 4JKHA 3VF2A 1NGCA 5AQKA 4PL7A 3CPWM 4IJAA 3KZBA 4IEIA 2Q36A 2P9IB 3LDQA 4BGBA 4FL9A 1K8KB 1YJ9N 5GADP 5FPDA 1KAYA 4DHYA 2J4RA 2P9PA 2H3GX 4A2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVC A;  3O9U A;  3O9R A;  2KKZ A;  3EE9 A;  2RHK A;  3O9S A;  3P31 A;  3KWG A;  3D6R A;  3L4Q A;  3M5R A;  3F5T A;  3O9T A;  3P39 A;  3OA9 A;  3KWI A;  3O9Q A;  2GX9 A;  3EE8 A;  4OPH A;  3P38 A;  4OPA A; 
#chains in the Genus database with same CATH topology
 2QXF A;  5F1X A;  4RW8 A;  4K42 A;  4BRD A;  2P9S B;  3QIP A;  1WUA A;  4BRH A;  3K5N A;  4C8K A;  2HHQ A;  3LAK A;  1HYV A;  4E0D A;  2ZGZ A;  3ZT1 A;  3MN6 A;  1ZC6 A;  3FLC O;  4CJF A;  2HHX A;  5EY4 A;  4FVM A;  4M3R A;  2P9N B;  2EX3 A;  1JL1 A;  4HVJ A;  4W5T A;  1SKR A;  4DF8 A;  4WQ4 C;  4CJR A;  3C65 A;  4DSF A;  4E1M A;  4DV3 K;  1HNW K;  2WC9 A;  4DR1 K;  1BUP A;  1B9D A;  2WTU A;  4B9V A;  3M6G A;  3MEE A;  5BRH A;  5JMV A;  1L3T A;  4O0I A;  3KKS A;  1ZXO A;  2G8V A;  4AHR A;  4BRI A;  1T8E A;  1P90 A;  3DLH A;  2GWK A;  3D2E B;  5F0X A;  5JVH L;  4B9M A;  3RTV A;  3TTD A;  4C1N I;  5A2Q O;  1IJJ A;  4AHT A;  1BA0 A;  2QWR A;  2A41 A;  1JLF A;  3QO9 A;  3UKU B;  3F5T A;  4JKD A;  1IBK K;  5AQZ A;  4CZM A;  3FGU A;  3MXJ A;  5CHI A;  4UY8 O;  4BE2 A;  1HYS A;  4JAX A;  3H45 C;  3NH0 A;  3CCR N;  1K73 O;  2GUP A;  2Q97 A;  4BRQ A;  3TSP A;  3ID8 A;  3TPQ A;  2QTD A;  2ZQB A;  2W42 A;  3PSF A;  3AVI A;  4DU3 A;  1EXQ A;  1XMQ K;  5LJW A;  2Q0U A;  3B6O A;  3TI0 A;  4M63 C;  1BIS A;  4CHZ A;  4FJN A;  2ASP A;  3VQE A;  3L2W A;  4BRP A;  5C2D A;  4N47 A;  4FW1 A;  2QWP A;  1ATR A;  4XH4 A;  2G8W A;  5EX5 A;  3RVC A;  2P9U A;  3O9R A;  4H5N A;  4XEI A;  5EOY A;  2DTU A;  3OJU A;  3H46 O;  1X9J A;  1BQN A;  3AVJ A;  3O1W A;  1QVG M;  2O8D B;  4BY9 C;  1XHZ A;  4AHV A;  4CIE A;  1HQU A;  1BHL A;  4JI8 K;  1Y64 A;  3K2P A;  1DTT A;  3A5M C;  2Y1I A;  5HP1 A;  3QML A;  1NJX A;  2P9I A;  5GIO A;  3AVG A;  1ASW A;  4LF4 K;  1RT5 A;  4PKH A;  3OYE A;  2LSN A;  2IGI A;  1LCU A;  3MWP A;  4AHC A;  2XO7 A;  3K58 A;  4DMN A;  4Z4I A;  5AQT A;  2ZM6 K;  3R3L A;  4KHW A;  5M1F A;  2ZWH A;  1ITG A;  4LF9 K;  2IVO A;  4H0P A;  4ID5 A;  3DLR A;  1NK4 A;  1BOT O;  3NF8 A;  5BPL A;  4M7Y A;  4O8K A;  2HHV A;  3O9S A;  2YHY A;  2E8A A;  2OZM A;  4Y1C A;  4G9Z A;  3HYF A;  1JJ2 M;  1VSK A;  3F2K A;  4JRQ A;  3N4Q A;  3VEZ A;  3SMP A;  4FK2 A;  3DRS A;  1NK5 A;  4OKE A;  4FLZ A;  4BRO A;  3UIQ A;  3E1Y A;  2XY5 A;  5EXW A;  1D4X A;  2ASM A;  1RTJ A;  3AA5 X;  2D0C A;  3G25 A;  4BRM A;  1KXP A;  2IIR A;  2QWL A;  1ZBI A;  1N32 K;  5FPN A;  2D0P A;  5GAE P;  5E41 A;  4ISE A;  3ULE B;  4FJ7 A;  2YHW A;  1UAX A;  1S1W A;  3LP0 A;  4JD2 B;  5JVG L;  4DS5 A;  5DMR A;  4EHU A;  4DTM A;  2HHW A;  2YNI A;  1YT3 A;  3H3O B;  2P5O A;  1ZYQ A;  1X1P A;  4Z0U A;  1VQM N;  2HBJ A;  2GV9 A;  4U7B A;  2G8K A;  1CZA N;  3ENB A;  3IFR A;  3SUO A;  3BUZ B;  1HJO A;  4H5R A;  3CCJ N;  1DGK N;  4GMJ B;  1X9W A;  4FM0 A;  1CZ9 A;  3ZX3 A;  3V1O A;  1HMV A;  3THY B;  2WON A;  4J2A A;  3OBW A;  4DR3 K;  4BVP A;  4FJK A;  3KKR A;  2OYQ A;  4F3O A;  2XY6 A;  4Y1D A;  4I6M A;  5AQW A;  5LJV A;  4FCY A;  3OYF A;  4WFA L;  3O3F A;  4GV6 A;  3O08 A;  4DUY K;  4FWM A;  3DM2 A;  5J2N A;  4NB4 A;  2Q3S A;  2ZJQ L;  2QI2 A;  4FWP A;  2ITG A;  3THX A;  2EWS A;  3CI5 A;  3V81 A;  4LSN A;  1C1A A;  2P9U B;  5J2P A;  1XMO K;  4IOX A;  5AQQ A;  1RTI A;  4BRC A;  5DM6 L;  3VGM A;  1T3V A;  3MK6 A;  3BGR A;  1HNV A;  4CF2 A;  4JI5 K;  3S3M A;  3EEQ A;  3D0P A;  4L3Q A;  2HHH K;  3OYB A;  1J54 A;  1YAG A;  4MO5 A;  1OVQ A;  2ZD1 A;  4JHD A;  4IG0 A;  3OYJ A;  4BR9 A;  5D3G A;  3A8Y A;  3S9H A;  3HP9 A;  4LF5 K;  3G10 A;  1OVY A;  3AO1 A;  1K8K A;  3IDH A;  2WOM A;  4N56 A;  1VSJ A;  1VQ8 N;  1N8R O;  4GV3 A;  4M3U A;  1RT3 A;  2GUI A;  3WXL A;  1KD1 O;  3HVT A;  3DLL L;  2AA4 A;  1SL1 A;  2Z1H A;  4H0O A;  2F96 A;  2FLO A;  2YCH A;  2VG6 A;  1YTU A;  3LAM A;  4DF4 A;  1C0U A;  2CGL A;  1VQ5 N;  3ZSY A;  2HF3 A;  2CGJ A;  1ATN A;  4JI6 K;  4DTN A;  3V9W A;  2VWJ A;  2CH6 A;  3FZM A;  4GV9 A;  4CFC A;  3AO3 A;  5AQY A;  1V4T A;  1JXE A;  3SUP A;  4O0J A;  3FZL A;  1RT2 A;  4CK3 A;  3GE1 A;  1VAZ A;  5ADX H;  1T7P A;  4CJ7 A;  1TK0 A;  3VQA A;  2IAJ A;  1Q9X A;  5AFU A;  4H03 B;  4MLH A;  4BC5 A;  1U04 A;  4A59 A;  4H0V B;  4FLT A;  3SAF A;  4BRK A;  3EKS A;  2BAN A;  4JKG A;  3V4I A;  4E3S A;  3ZT0 A;  3T1A A;  4DWI A;  3KWI A;  3PLA A;  4FWN A;  2Q2R A;  4OJR A;  1X3M A;  3EZW A;  2A1R A;  1Y97 A;  1K8A O;  2KLA A;  5HRS A;  1JLC A;  4R79 A;  5BPM A;  5AQR A;  4CJE A;  4YY3 K;  5HLF A;  4DSJ A;  1QS4 A;  4ILG B;  3ZSZ A;  2RHK A;  3OYH A;  1JCF A;  4CJW A;  3NGZ A;  3LPT A;  3D45 A;  3ZET A;  4Z4H A;  1REV A;  2ZE2 A;  4CZE A;  4JLH A;  2HMP A;  4DFM A;  1QQM A;  4BE0 A;  3I56 N;  1WSG A;  1VQO N;  3EL2 A;  4KTW A;  3J7Y P;  1VQP N;  3IKM A;  2O4I A;  4CHQ A;  4JEP A;  3CCM N;  5H1S Q;  2D0B A;  2D1K A;  4IZ9 A;  4DSK A;  1KLM A;  3ATU A;  2CH5 A;  3RSE A;  3O8M A;  3A5O C;  5KI6 A;  4FJJ A;  3SBG A;  5AQV A;  4LY7 A;  2V7Y A;  3IG1 A;  4OGE A;  5HRN A;  2I7P A;  1HNZ K;  2OPQ A;  1I94 K;  3CCL N;  1WBD A;  3AA4 A;  3E9L A;  2DPN A;  1NJW A;  3QER A;  5GAG P;  1KVA A;  3VMF B;  1YF5 L;  1SL0 A;  3L8B A;  3HL8 A;  4DTJ A;  4ZHR A;  3AA2 A;  2UXB K;  4N5S A;  4CJQ A;  4IFE A;  1YJW N;  4DFJ A;  3U9Z A;  2GEL A;  4IFY A;  1HKG A;  3KIO A;  2KFN A;  4LH5 A;  4CED A;  2RF2 A;  3VF2 A;  4I7F A;  3EZ5 A;  5KGX A;  4IEI A;  2Q36 A;  3LDQ A;  2HVI A;  1ZBL A;  1K8K B;  3BZC A;  4OLB A;  2J4R A;  2P9P A;  3O4Q A;  2H3G X;  3S3O A;  4FYD A;  2E2N A;  3NBP A;  4DQS A;  4GY2 B;  2Z1G A;  3DLG A;  3SV4 A;  1OH6 A;  2HND A;  1QSS A;  3V9S A;  1DLO A;  4NYF A;  3U8X A;  1Z05 A;  2O8B B;  3B8A X;  4CZG A;  2QKB A;  2GEM A;  3C6H A;  1LV5 A;  3E66 A;  3ZT2 A;  1NGH A;  3OS1 A;  4QS7 A;  4WFN L;  1S5J A;  3TAP A;  4W5R A;  1UA0 A;  5FDL A;  4HHT A;  2QM1 A;  3S41 A;  4HTL A;  3HVR A;  3GG4 A;  3AO5 A;  3WQU A;  4BDP A;  3T3F A;  1S1U A;  3LL3 A;  4KB0 A;  4CEA A;  2HNY A;  3L2U A;  4KHU A;  3IUC A;  1XNR K;  3OYD A;  1RBT A;  1O1W A;  5BN9 A;  1OH7 A;  1GLD G;  4CGG A;  3C7N A;  1U47 A;  1C1C A;  3TSU A;  1S9G A;  4B3O A;  1KVC A;  4CD3 A;  3OYK A;  4CEZ A;  4ISF A;  3V9U A;  4JNE A;  1NK8 A;  2DFF A;  5AQN A;  1BO5 O;  4KTQ A;  5BRE A;  4YOV A;  2Z1I A;  5GAH P;  4JKE A;  3ATV A;  3ZT3 A;  1W7A A;  4FW2 A;  3CET A;  2YV0 X;  3J80 O;  5FRM A;  4BDZ A;  1ESV A;  3T1H K;  1RCH A;  4QS8 A;  5MLC Q;  2QEX N;  3C6A A;  2YKN A;  3P31 A;  3H1V X;  3AAR A;  5E26 A;  4EZ9 A;  3K5M A;  3KVG A;  2E2P A;  2F9T A;  4M3Z A;  3VQ7 A;  2YJF A;  4OGC A;  4FZX C;  2QXL A;  3RSE B;  2DFE A;  2E2Q A;  4IEE A;  3VN5 A;  4E7J A;  2VYP A;  1ZBU A;  4H0X B;  4YOU A;  3OS0 A;  4B9T A;  1QZ6 A;  1YHQ N;  4E1J A;  4CBW A;  3L4I A;  1TGO A;  3TR8 A;  1QSY A;  3HM8 A;  4CHY A;  2QK9 A;  1RDB A;  1RDC A;  4E1N A;  2IOC A;  3M8Q A;  1HX1 A;  3I0R A;  4CK2 A;  4KAZ A;  4DV4 K;  3CF5 L;  2ATQ A;  4AF1 A;  2X6N A;  3TTF A;  4DQQ A;  5BN8 A;  3ZCM A;  4DTX A;  3PO5 A;  2PBD A;  4WQ4 A;  2HF4 A;  2ZJR L;  1NK7 A;  3CFO A;  1N5Y A;  3CCS N;  1L3V A;  4RW6 A;  4E19 A;  4AM6 A;  1R59 O;  1L3S A;  2AP1 A;  3RMD A;  1IO2 A;  4FJH A;  5C24 A;  3EKU A;  4K43 A;  3THW A;  3KLG A;  1QTM A;  5ELZ A;  3C6T A;  4GNI A;  3HTV A;  3ENO A;  2F8S A;  2Z1J A;  2YKM A;  3DLK A;  3VTI A;  4DSL A;  4CZF A;  3N4P A;  2RE2 A;  4IJN A;  4NXM K;  3TTC A;  3QEI A;  1ASV A;  4PL8 A;  2VQE K;  4DV5 K;  2NRH A;  1NGA A;  4H4O A;  2VQF K;  1D9D A;  3OYL A;  3GBT A;  2ITM A;  3HK2 A;  3AVA A;  1N33 K;  2E1Z A;  4L8R B;  2FF6 A;  5AZI B;  1GOC A;  1K6Y A;  4F9O A;  3K59 A;  1RT7 A;  1OH8 A;  3CIP A;  4CJ4 A;  3T69 A;  4BR2 A;  3ITH A;  1TYQ A;  3L3U A;  1VSE A;  4C23 A;  3ZYY X;  4M3T A;  5AQS A;  3J8A A;  5GIP A;  1NMD A;  4DTP A;  4I9Q A;  1WSE A;  4DTO A;  3AVK A;  5JS2 A;  2BE2 A;  1NG9 A;  4YHH K;  3M8R A;  2OZS A;  4BR5 A;  4YOY A;  5HBM A;  1FK9 A;  4AHS A;  5LL6 Z;  1J5E K;  4BVO A;  3RRG A;  4FK4 A;  1VQ9 N;  5AQJ A;  3G4S N;  1S22 A;  2IDO A;  1VQK N;  3JYT A;  3QFP A;  2BDP A;  3P38 A;  2JGU A;  1TKT A;  4C8L A;  3LP2 A;  2QWM A;  4NCG A;  4B1U B;  5M1K A;  1BA1 A;  4AH9 A;  4H8K A;  5BPN A;  4DR6 K;  3HOT A;  4FWR A;  4V19 S;  3SAG A;  5AZJ A;  3PV8 A;  3UE5 A;  1DKG D;  5KRS A;  4AM7 A;  3C0B A;  4UQG A;  2E1Y A;  2FSJ A;  1SKW A;  1XNQ K;  4BRE A;  4JK9 A;  5FPM A;  1QVF M;  3FFI A;  3W0L A;  4KHP K;  3DYA A;  3FZF A;  2E20 A;  3L4Q A;  2QWQ A;  3AV9 A;  2KZZ A;  4BR0 A;  3M5R A;  2V7Z A;  3R1X A;  4BG8 A;  3HJF A;  3KLH A;  4O4G A;  3WNG A;  4DQP A;  3AVC A;  3CXC M;  4IOA L;  3SI6 A;  3NVM A;  3NGY A;  1KAZ A;  3OYC A;  4OPH A;  4KHY A;  2X6S A;  3K9J A;  1T44 A;  4X65 K;  4DG1 A;  2O8F A;  4K8X A;  3HI0 A;  4F3T A;  3SQ4 A;  3RR8 A;  1GLL O;  1WLJ A;  1R0A A;  1S3X A;  3MEG A;  4FVU A;  1WBB A;  4BQZ A;  4WFB L;  4F2S A;  3LAN A;  4BDY A;  3V1R A;  1U4B A;  1QSL A;  4FWO A;  3HZ6 A;  4KB1 A;  3EE9 A;  4CF0 A;  3MDQ A;  4YOX A;  1B9F A;  4XH1 A;  3ZSV A;  2NRV A;  4J2B A;  2OTJ N;  4DQ8 A;  1YUW A;  1E4F T;  3Q7C A;  2OA8 A;  1YVU A;  4J2E A;  1LWC A;  5IWA K;  4Q0B A;  4NCB A;  3AVL A;  1TV6 A;  3NH1 A;  3DXM A;  1SZ2 A;  5HOO A;  4FLY A;  1BL3 A;  1Q82 O;  4NXN K;  3L2R A;  3AAQ A;  3SPY A;  1LW0 A;  4KRF A;  4JV5 K;  1XQS C;  2FXU A;  4FWQ A;  1NGD A;  1TK5 A;  3CC2 N;  4M3Y A;  1GOB A;  4W5N A;  4WYB A;  1TK8 A;  4HCC A;  4IFV A;  1DTQ A;  2PFU A;  4XH5 A;  3E01 A;  1TUY A;  5C0Y A;  3CMA N;  3PIO L;  5HRP A;  3LM2 A;  1HRH A;  2FC0 A;  2JLE A;  1GLC G;  3VEO A;  2GX9 A;  3TAG A;  4CE9 A;  1NWK A;  2HBK A;  1GOA A;  3VF4 A;  4CJT A;  4WQ5 C;  2HHT A;  4CF8 A;  4LF6 K;  4FWS A;  3SV3 A;  3RR7 A;  2DFH A;  3J81 O;  3LDP A;  1W9H A;  4R5P A;  2IVN A;  1S1V A;  4FWL A;  3T7Z A;  5KPR A;  1VQN N;  4MLE A;  3T1Y K;  3WNH A;  4KI6 A;  1NJI O;  5AQM A;  4BWJ A;  3ZX2 A;  1U2V A;  4C8M A;  4PY5 A;  2PY5 A;  1HUX A;  3MCA B;  3CJB A;  3AVH A;  3HOS A;  3VEW A;  3NGI A;  3BF3 A;  4IO9 L;  4H5W A;  4B8C A;  3VQD A;  1I39 A;  1HQE A;  2FBX A;  4HCB A;  4OO1 J;  3NCI A;  3V6D A;  2P9K A;  4W5O A;  1GLF O;  4M3W A;  4FJI A;  3I8B A;  4FZZ A;  1RBR A;  1T03 A;  3ZT4 A;  3H3N O;  4X62 K;  3MXI A;  3HPO A;  1RDW X;  3B6P A;  3VEX A;  1D5A A;  3EE8 A;  1VSF A;  5CZ2 A;  4ZTJ A;  4CGI A;  4JS5 A;  3KWG A;  2G8F A;  1ILY A;  3VQ5 A;  3ISN C;  3NDK A;  1Q9Y A;  3TSQ A;  1RDD A;  3O4N A;  3LP3 A;  2QWN A;  1BCO A;  2UUA K;  2O8F B;  4FLW A;  3HBT A;  4PL7 A;  3QES A;  4KO0 A;  3TAB A;  2P9I B;  1S1X A;  2P51 A;  4FL9 A;  4DV1 K;  2YNG A;  1XI1 A;  3DLE A;  1KAY A;  5FPD A;  4CGF A;  4PKG A;  5IT9 O;  1G15 A;  3ALY A;  1P8Z A;  3QDK A;  3ZSR A;  3ZX0 A;  4GVM A;  1NGI A;  4FZY A;  3V9X A;  4WF9 L;  4CEC A;  1VK0 A;  3GOI A;  1M90 O;  1KLN A;  1BU6 O;  1FXX A;  4CFA A;  3TAQ A;  4YDU C;  4HUE A;  4RW9 A;  3DXK A;  3KK1 A;  3SUQ A;  1X9S A;  3UKR A;  1WSF A;  3D2F A;  3LWL A;  2A3Z A;  4K8Z A;  3CQ8 A;  3VQ4 A;  4NYN A;  5J2Q A;  3DJC A;  3U3Y A;  3T19 A;  2KW4 A;  5HL7 L;  3PX0 A;  1NKB A;  1NKC A;  3LP1 A;  3K0S A;  2D0A A;  1BI4 A;  4CVN E;  4E7I A;  4Q5V A;  4B9S A;  1Z6R A;  3MAQ A;  4B8A B;  4PUO A;  2FBT A;  3AVM A;  4W5Q A;  2HHS A;  3V9Z A;  3VQ6 A;  3AVN A;  4ELU A;  4CIG A;  1QQO A;  3O9U A;  4Z4G A;  1TKZ A;  2UU9 K;  3SAH A;  1NOZ A;  1VSM A;  3I8D A;  3CM5 A;  1OH5 A;  1XC3 A;  3CME N;  3DLB A;  4FO0 A;  3H08 A;  4KH5 A;  3A5L C;  1E3M A;  5DM7 L;  1J5O A;  4CJK A;  3LM9 A;  3OBY A;  1UOC A;  3ZSQ A;  3C95 A;  4E7H A;  4CCH A;  4I6M B;  4YOW A;  1J6Z A;  4A2A A;  4FOI A;  1C0G A;  3SQ0 A;  3MN5 A;  2IVP A;  3K5L A;  5HRO A;  3L3V A;  5LY3 A;  2NRW A;  1NGJ A;  2W6K A;  5JLH A;  4ILH A;  1Z26 A;  5AQF A;  3THX B;  3HM9 A;  1BGX T;  1HKC A;  4JRP A;  4YFU A;  1JCE A;  3IRX A;  3EYZ A;  1NNE A;  3QFU A;  4NO7 A;  4J2D A;  3K5O A;  1XWL A;  3MX5 A;  1KVB A;  1YJN N;  1JKH A;  5CR4 A;  5CYQ A;  1ZBS A;  4BR4 A;  2HNZ A;  3A2F A;  3CER A;  4RG8 A;  1SS6 A;  3LZJ A;  4CEF A;  1NM1 A;  4JHD B;  1S1T A;  3R6M A;  5C25 A;  2E88 A;  1LWE A;  4IXC A;  1QQC A;  3NVK A;  4ELT A;  3RMC A;  3VGL A;  1IH7 A;  4OVL A;  5I3U A;  4B3R K;  2UXD K;  3ENH A;  4ZTF A;  4FWK A;  4B3T K;  1RBS A;  1WN7 A;  1DEJ A;  4KBO A;  4B9N A;  2KZM A;  4KKO A;  1E4G T;  1NBW A;  5KQ8 A;  1RDA A;  4CHP A;  3WEE A;  3J7Z O;  1N36 K;  3HO1 A;  1IV0 A;  3CPE A;  5AQH A;  2W40 A;  4JKC A;  3HPH A;  3VET A;  2P9L A;  1RTD A;  3CFR A;  3CCQ N;  1L3U A;  2ASO A;  3LZI A;  3SNN A;  5KPT A;  4RWT A;  1EX4 A;  4CBU A;  1EKE A;  1RFQ A;  1HPZ A;  5FPE A;  5TKW A;  1VSI A;  4RCH A;  4DCH A;  3QBX A;  4CJU A;  1RTH A;  2E4L A;  2WBN A;  3JAM O;  4DR4 K;  3M8S A;  3HSC A;  4CK1 A;  4O8U A;  3R9P A;  5FRN A;  4ISG A;  4RTF D;  1HJR A;  3QIO A;  4FPB A;  2G8I A;  4ID1 A;  2P9N A;  4XIU A;  5AQU A;  3BF1 A;  4HWI A;  3WXJ A;  5KGW A;  4BGA A;  1MWK A;  5DK5 A;  1Q8I A;  4CZH A;  1MU2 A;  4IWV A;  4JKG B;  1BI4 B;  2OPP A;  3I55 N;  4DUZ K;  1VQ6 N;  2OCE A;  2D4W A;  3KK7 A;  5I9E B;  4BWM A;  1TUU A;  1SQK A;  2O8E A;  3P83 D;  1ASU A;  1IBM K;  3D6R A;  1QHT A;  1LAW A;  1TKX A;  3O1B A;  4DR7 K;  4B1X B;  2Q0R A;  3CHW A;  3PX4 A;  4QS9 A;  4IOC L;  1NK0 A;  2ZF5 O;  3ZET B;  3JS6 A;  2KFZ A;  3D2E A;  4CJ3 A;  4A57 A;  1NGG A;  4DTS A;  2KTQ A;  3DOK A;  3U6F A;  3SQ1 A;  4DQI A;  4JYA K;  3UKU A;  1VQ7 N;  5KTQ A;  4CFD A;  4IKF A;  2YHB A;  3QNO A;  3Q7B A;  5M1Q A;  1MA9 B;  2W6L A;  3VQ8 A;  3CD6 N;  1Q81 O;  4DKW A;  4K25 A;  4CJP A;  1KC8 O;  3G6E N;  3D7E O;  2Y1J A;  1S72 N;  4FJ9 A;  3K9K A;  3QIN A;  1LWF A;  5C42 A;  2GBZ A;  4CJS A;  5M1O A;  1RNH A;  4IDH A;  4GW6 A;  1A5W A;  3R8E A;  3CC7 N;  3O3G A;  1GLJ O;  1TAQ A;  3DRP A;  3BP8 A;  4MQ3 A;  3VOV A;  4CEE A;  1LW2 A;  5BRD A;  1XC9 A;  1MWM A;  5TKY A;  3WNF A;  1JXB A;  3NF9 A;  3VTH A;  3QLH A;  1ZBF A;  3OJS A;  3SBT A;  5B8H A;  4JI7 K;  3QEX A;  4I2Q A;  4LFC K;  4H4M A;  2VWB A;  3VPZ A;  3ULD A;  2HMI A;  4JI4 K;  2P9P B;  3AVF A;  2PAV A;  5T7B A;  3OVN A;  3OW2 M;  3U4L A;  3QEW A;  5SZT A;  4BAC A;  2BGG A;  1YXQ A;  2P9L B;  2FBV A;  2RN2 A;  4Y0W A;  3TAE A;  2BUP A;  3CC4 N;  2F9W A;  1EQY A;  1G99 A;  2R7Y A;  3ASM A;  5AQI A;  2FSK A;  2PZS A;  5ADX A;  3TAN A;  3AGR A;  2HB5 A;  1QZ5 A;  2D5R A;  3KD1 E;  5K14 A;  3IAY A;  1IKX A;  1Q18 A;  1C0M A;  4DS4 A;  4KHN A;  2FSN A;  4Z4C A;  4F8R A;  2ZGY A;  5J1E A;  1NMN A;  5C10 A;  1HYZ A;  2NZT A;  3CCV N;  2HW3 A;  4B1Z A;  4QCL A;  1MDU B;  4M42 A;  3VER A;  4LFA K;  1JCG A;  3NHG A;  3ZSW A;  4FPA A;  1D9F A;  4H0T B;  4PKI A;  5CY4 A;  4YNQ A;  4HUF A;  3C7N B;  4I2P A;  2UUB K;  1S9E A;  5M1N A;  3RMA A;  1JLA A;  4OX9 K;  4DV6 K;  2O8E B;  3SYZ A;  1YTA A;  4CZL A;  3OYA A;  1HLU A;  3TAF A;  4EAH D;  3OYI A;  2OTL N;  4RW7 A;  4MO4 A;  4CBX A;  3L2Q A;  2E6L A;  2V51 B;  3MN7 A;  1NGB A;  3ULE A;  3V1Q A;  1RT4 A;  2XRI A;  4MDA A;  2ZJP L;  4JD2 A;  3ZEU A;  5AFU H;  4IBN A;  4FJL A;  4A62 A;  3RRH A;  4DTR A;  3M3Z A;  3MWT A;  3HPG A;  4QAG A;  4BRF A;  1C0T A;  1YIT N;  4QOZ B;  3M8P A;  1SAZ A;  2E5L K;  4B3M K;  2B4J A;  5SWM A;  2EHG A;  2HBM A;  3PX6 A;  4JN4 A;  3SJH A;  4CZJ A;  1RT1 A;  3H1Q A;  3NAE A;  2KQ2 A;  3THY A;  4ELV A;  2O8C A;  1A5X A;  1W97 L;  3I0S A;  1CXU A;  3JXU A;  3MXM A;  2F7T A;  3VQ9 A;  1SV5 A;  4GKK K;  3KK3 A;  3EO3 A;  3AVB A;  1JLG A;  3FZK A;  2UXC K;  3P39 A;  4OLA A;  5BR8 K;  1T6C A;  3MEC A;  2NRR A;  4M45 A;  5C12 A;  4DB3 A;  4BG9 A;  4BRN A;  1QE1 A;  1C6V A;  1JLE A;  3AY9 A;  3DOL A;  1GLA G;  3WXI A;  1JLB A;  1YVN A;  3PUF A;  5I42 A;  3K57 A;  2NRZ A;  3OYG A;  4Z4E A;  5FLX O;  4BRA A;  2YI1 A;  4DV7 K;  2VGN A;  4CHO A;  1VRU A;  3I33 A;  1HKB A;  2IC3 A;  1VSH A;  4IJA A;  3THW B;  3KZB A;  3DI6 A;  1WSJ A;  4A2B A;  1C0F A;  5J2M A;  2YHA A;  3QIC A;  5JLF A;  3OTO K;  2B5J A;  1L5U A;  2QA4 N;  4DU1 A;  4Z4F A;  1EWQ A;  3LWM A;  3CJC A;  3WXK A;  5LMN K;  3L6Q A;  3P5J A;  4JK8 A;  3THV A;  1A5V A;  1J53 A;  4HTU A;  4Z94 A;  2VGM A;  4LF8 K;  4C1N K;  1HNI A;  4DR2 K;  4EHT A;  4LH4 A;  2FBY A;  3A5N C;  2NUB A;  5F2R A;  1NJY A;  2OAN A;  3TAM A;  3S3N A;  1TYQ B;  4OPJ A;  3LDO A;  3KLI A;  2I5J A;  4WQ5 A;  4CEB A;  4CD1 A;  2JWL A;  3F9M A;  2VWK A;  4A5A A;  2RKI A;  4B9Q A;  4CES A;  2UUC K;  2E6M A;  4DSI A;  4KRE A;  1V4S A;  5EU7 A;  3CJ7 A;  1SL2 A;  4FJG A;  4YOT A;  4EP5 A;  3BEX A;  1WB9 A;  3EN9 A;  4K0K K;  4AQY K;  4DU4 A;  1BG3 A;  4KPY A;  3M1F A;  3A0I X;  3ZEU B;  5AQX A;  3HT3 A;  3CCU N;  2YX6 A;  1GLE G;  3OYM A;  1CZB A;  2A42 A;  2P5G A;  1EO1 A;  2NLX A;  2FF3 B;  2ETJ A;  1NKE A;  3GDQ A;  5AZJ B;  2YNH A;  1BIU A;  3KK2 A;  2DY4 A;  4LD0 A;  2XY7 A;  3CQY A;  3TWH A;  2O8C B;  2YJE A;  1RBV A;  5M1P A;  4F4K A;  3FZH A;  1SKS A;  1N6Q A;  5BR9 A;  1Q86 O;  1RIL A;  4GVE A;  3IS9 A;  4TSX A;  3JSM A;  2NNW A;  4KV8 A;  4FLU A;  1XHX A;  1BQM A;  4BE1 A;  4E7L A;  1FJG K;  4E89 A;  2YHX A;  4B1W B;  1EET A;  4C8O A;  2HOE A;  4CER A;  1ZBH A;  2A6A A;  4EIA A;  4H0Y B;  4KTZ A;  4LFB K;  3DWL A;  2AJQ A;  5AR0 A;  3L2V A;  1X3N A;  4C8N A;  1KFS A;  2PYL A;  2HHU A;  2A40 A;  3SJJ A;  4YDU A;  1VSD A;  1WSH A;  2OPS A;  3BY5 A;  4H5V A;  5CZ1 A;  1VRT A;  3CJA A;  2RPI A;  1IKW A;  4CEO A;  5C2F A;  1O13 A;  3SZ2 A;  4KH4 A;  5AQL A;  3PY8 A;  1RBU A;  3WQT A;  4E7K A;  3HXM A;  2QKK A;  4X66 K;  4JK7 A;  1IKY A;  3P1G A;  3SCX A;  4JI1 K;  1WNS A;  4FJM A;  3F73 A;  4KFB A;  4DFP A;  2F4V K;  3BDP A;  4MDB A;  1VQL N;  1T05 A;  3OA9 A;  3G71 N;  1RT6 A;  3VA0 A;  5AQP A;  1WAJ A;  4ILJ A;  1CXQ A;  3SMS A;  2B6A A;  3QEP A;  5GIN A;  3DXM B;  2O8B A;  3SPZ A;  4N41 A;  1NK6 A;  4JKF A;  3C6U A;  3KLE A;  1W2B M;  1NU0 A;  4B3S K;  2QWO A;  4PQU A;  3KTQ A;  4O44 A;  1YI2 N;  4U67 L;  3O6W A;  1ATS A;  4CF9 A;  3SUN A;  4B1Y B;  3WXM B;  4N76 A;  1T6D A;  2D0O A;  3NMU A;  5C15 A;  3KHY A;  3MCP A;  2KKZ A;  4JKA A;  4X64 K;  3CJ1 A;  4DLG A;  3QNN A;  5AQO A;  1YIJ N;  1IKV A;  3SK3 A;  4J8F A;  3AA3 A;  2WFB A;  2NRX A;  1VQ4 N;  2QW9 A;  4OKK A;  4CZK A;  1TL3 A;  3LDL A;  2G8H A;  2BTF A;  3LDN A;  1GLB G;  3CCE N;  1FKP A;  2P1J A;  1U6Z A;  4O5B A;  3CG7 A;  4PWD A;  1K9M O;  5E84 A;  4JI2 K;  3VEV A;  2V52 B;  3H6E A;  4BQL A;  4HUG A;  4FM2 A;  1U2V B;  4MFB A;  3VF6 A;  1VHX A;  3F9K A;  4RW4 A;  3VQC A;  3CFP A;  4CW7 B;  5LMU K;  3G0Z A;  4DTU A;  4NLB A;  3PIP L;  3U9D A;  4KHQ A;  1NGE A;  3OHR A;  3VA3 A;  2X74 A;  4CI6 A;  4EP4 A;  3ID6 A;  3J7A P;  4BC2 A;  3NF7 A;  1VSL A;  3FR0 A;  4B9L A;  1XUP O;  2P9K B;  4WCE L;  1Q7Y O;  2VG7 A;  4F2R A;  1S6P A;  1Z25 A;  1TVR A;  4LSL A;  1X9M A;  3AAP A;  4FK0 A;  3SQ2 A;  1NK9 A;  5JS1 A;  1FW6 A;  4BRG A;  1KAX A;  1HR0 K;  2A5X A;  2GTD A;  3NFA A;  4CJ5 A;  4AHU A;  2VCP A;  3CQX A;  1IBL K;  1TAU A;  4OKJ A;  5EVZ A;  2KHO A;  3VQQ A;  1H1V A;  3ZSO A;  1KFD A;  3DRR A;  4BC3 A;  3OYN A;  1QHA A;  3KD5 E;  4KI4 A;  1NOY A;  3CYM A;  2GWJ A;  1WAF A;  1N34 K;  4O55 A;  1UWB A;  3KLF A;  5BRF A;  1KCF A;  3QEV A;  3E9O A;  1KRP A;  2WUS A;  3OS2 A;  3AO2 A;  3AGK A;  3LPU A;  4IG3 A;  1EWR A;  1U49 A;  1BWF O;  2P9S A;  2CGK A;  4CGJ A;  1DT9 A;  4H5T A;  1IG9 A;  4BRL A;  2XHB A;  3DAW A;  3MED A;  2PYJ A;  3DXK B;  3O4W A;  1F21 A;  4EZ6 A;  3UKR B;  4BR7 A;  2G8U A;  3D2F B;  1QQN A;  3VEN A;  4CHN A;  1D8Y A;  4GKJ K;  3SLC A;  4CEQ A;  3C94 A;  3FFK B;  3O9T A;  3EY1 A;  4AIL C;  1M1K O;  3PO4 A;  2BH1 A;  3QET A;  2XY8 A;  4BC4 A;  4CFB A;  1CLQ A;  4KH6 A;  3U3G A;  4B08 A;  4A61 A;  1OKJ A;  4DR5 K;  4FLX A;  4DQR A;  3HP6 A;  4JI3 K;  4LC9 B;  2OPR A;  1NLV A;  4NLC A;  3QBW A;  4I9L A;  1BCM A;  2O4G A;  1JL2 A;  5AZI A;  4CJV A;  3QB0 A;  1J9A A;  4OPK A;  3GL1 A;  3VES A;  5KRT A;  4K41 A;  1W0H A;  3HRG A;  1RGI A;  3O3H A;  4M7X A;  1U45 A;  1RDU A;  1C1B A;  2E2O A;  4PA1 A;  4B1V A;  3MMV A;  4KHS A;  1TL1 A;  1TKD A;  3VQB A;  4JS4 A;  1LAV A;  3VQP A;  4CF1 A;  1KSP A;  3RWU A;  4CJL A;  4JI0 K;  3LAL A;  3O9Q A;  5KPZ A;  5FRO A;  4WE1 A;  4ICL A;  1NGF A;  1S6Q A;  3HST B;  4OPA A;  4FJ5 A;  4YOR A;  5HRR A;  3E9P A;  4CZI A;  3TAR A;  2X78 A;  3PSI A;  5AQG A;  3TU5 A;  4DV0 K;  3O80 A;  5AJ3 K;  4DSE A;  3P4I A;  1SUQ A;  3W3D A;  3DMJ A;  1I3A A;  3MN9 A;  3NF6 A;  5CE3 A;  2UYT A;  2NRT A;  4FSV A;  3ZSX A;  5CYM A;  4B9U A;  3O5B A;  1U48 A;  2YNF A;  4NCA A;  2Q31 A;  2A1S A;  4O5F A;  4FXD A;  3CJ9 A;  1KTQ A;  3ZLJ A;  3L0Q A;  1NJZ A;  2I7N A;  3NH2 A;  4EFH A;  3VGK A;  4CGH A;  4DLE A;  2IS3 A;  4IO8 A;  4PHT X;  1HPM A;  3VEY A;  3WUH A;  1BIZ A;  3KJV A;  4IDK A;  2Q1N A;  3UB5 A;  1LOT B;  2W41 A;  4FOE A;  3WT0 A;  2VG5 A;  3CM6 A;  1BDG A;  4CGD A;  3IMX A;  4FLV A;  1B92 A;  4DV2 K;  4LF7 K;  3OY9 A;  1UA1 A;  3MX2 A;  5JIC A;  4DFK A;  1HNX K;  2HST A;  1EP4 A;  1WOQ A;  3FE1 A;  1KQS M;  4JKB A;  1FKO A;  3WEE B;  2O8D A;  2HBL A;  2JWK A;  1JLQ A;  4A5B A;  5KQD A;  4M41 A;  3BZK A;  1IG8 A;  4JKH A;  2F8T A;  1NGC A;  5AQK A;  3CPW M;  3WNE A;  3NE6 A;  3LDS A;  1WSI A;  4BGB A;  4FJ8 A;  4CIF A;  4M3X A;  4FM1 A;  2HVH A;  3RMB A;  1YJ9 N;  5GAD P;  3AO4 A;  4DHY A;  4G1Q A;  4FJX A; 
#chains in the Genus database with same CATH homology
 1C0F A;  5F1X A;  3QIC A;  5JLF A;  2E2N A;  4K42 A;  2QA4 N;  4BRD A;  4GY2 B;  2P9S B;  1WUA A;  3CJC A;  3WXK A;  4BRH A;  1P8Z A;  3QDK A;  3L6Q A;  2ZGZ A;  4JK8 A;  3ZX0 A;  3MN6 A;  1NGI A;  3U8X A;  1ZC6 A;  3FLC O;  1Z05 A;  4WF9 L;  3B8A X;  4CZG A;  4Z94 A;  3GOI A;  2VGM A;  1M90 O;  2GEM A;  1BU6 O;  3C6H A;  5EY4 A;  4C1N K;  3E66 A;  2P9N B;  1NGH A;  4YDU C;  4EHT A;  3DXK A;  3A5N C;  4QS7 A;  4WQ4 C;  5F2R A;  3C65 A;  4WFN L;  2OAN A;  1TYQ B;  3UKR A;  3LDO A;  3D2F A;  2A3Z A;  2QM1 A;  3S41 A;  2WC9 A;  4HTL A;  4WQ5 A;  3DJC A;  3GG4 A;  4CD1 A;  3WQU A;  2JWL A;  1BUP A;  5HL7 L;  3F9M A;  3LL3 A;  3M6G A;  4A5A A;  4B9Q A;  3IUC A;  5BRH A;  5JMV A;  1Z6R A;  1V4S A;  5BN9 A;  1ZXO A;  1GLD G;  3CJ7 A;  3C7N A;  3TSU A;  4BRI A;  1P90 A;  4YOT A;  3BEX A;  3EN9 A;  4CD3 A;  2GWK A;  1QQO A;  3D2E B;  3O9U A;  5F0X A;  5JVH L;  1BG3 A;  3M1F A;  3A0I X;  4ISF A;  3TTD A;  4C1N I;  3ZEU B;  5AQX A;  1IJJ A;  3CCU N;  2YX6 A;  1GLE G;  4JNE A;  1BA0 A;  3SAH A;  5AQN A;  1BO5 O;  2QWR A;  1XC3 A;  2A41 A;  3CME N;  2A42 A;  5BRE A;  4YOV A;  3UKU B;  3F5T A;  4FO0 A;  4JKD A;  5GAH P;  4JKE A;  3ATV A;  4KH5 A;  5AQZ A;  3A5L C;  4CZM A;  2NLX A;  1EO1 A;  3FGU A;  5DM7 L;  2FF3 B;  3CET A;  3LM9 A;  5CHI A;  4UY8 O;  3OBY A;  3GDQ A;  1ESV A;  4JAX A;  3H45 C;  5AZJ B;  3CCR N;  1K73 O;  2GUP A;  4QS8 A;  2Q97 A;  4I6M B;  5MLC Q;  4YOW A;  2QEX N;  4BRQ A;  3TSP A;  3ID8 A;  3TPQ A;  1J6Z A;  3C6A A;  2QTD A;  4A2A A;  3CQY A;  3P31 A;  3H1V X;  3AAR A;  5E26 A;  4FOI A;  1C0G A;  2YJE A;  5M1P A;  5LJW A;  3KVG A;  2IVP A;  2Q0U A;  3MN5 A;  2E2P A;  2F9T A;  3FZH A;  4M63 C;  5LY3 A;  2NRW A;  1NGJ A;  2YJF A;  5JLH A;  4ILH A;  5AQF A;  5BR9 A;  2QXL A;  1HKC A;  1Q86 O;  3RSE B;  4GVE A;  1JCE A;  2ASP A;  4BRP A;  2E2Q A;  4IEE A;  3QFU A;  2NNW A;  2VYP A;  4NO7 A;  5C2D A;  2QWP A;  4H0X B;  4YOU A;  1ATR A;  3MX5 A;  1QZ6 A;  1YHQ N;  1YJN N;  4E1J A;  4XH4 A;  4CBW A;  5EX5 A;  3L4I A;  3RVC A;  2P9U A;  3O9R A;  5CR4 A;  3HM8 A;  4H5N A;  1ZBS A;  4XEI A;  4BR4 A;  2YHX A;  5EOY A;  4B1W B;  3CER A;  1SS6 A;  2HOE A;  1NM1 A;  4JHD B;  2A6A A;  1HX1 A;  4EIA A;  3H46 O;  1X9J A;  3R6M A;  4H0Y B;  3DWL A;  3O1W A;  1QVG M;  3CF5 L;  5AR0 A;  4AF1 A;  2E88 A;  1X3N A;  4IXC A;  3NVK A;  2A40 A;  3TTF A;  4BY9 C;  3VGL A;  4YDU A;  5BN8 A;  3ENH A;  4FWK A;  2PBD A;  4WQ4 A;  1DEJ A;  1Y64 A;  4KBO A;  1E4G T;  1NBW A;  5KQ8 A;  2HF4 A;  2ZJR L;  3J7Z O;  3WEE A;  3CCS N;  4H5V A;  3CJA A;  4AM6 A;  3CPE A;  1R59 O;  2AP1 A;  3A5M C;  5AQH A;  2W40 A;  4JKC A;  5C2F A;  1O13 A;  4KH4 A;  5AQL A;  3EKU A;  4K43 A;  3QML A;  5ELZ A;  2P9L A;  3VET A;  3WQT A;  2P9I A;  4GNI A;  4JK7 A;  3CCQ N;  3HTV A;  3ENO A;  2ASO A;  5GIO A;  4PKH A;  3VTI A;  4CZF A;  1LCU A;  3MWP A;  4MDB A;  5KPT A;  1VQL N;  3N4P A;  5AQT A;  4RWT A;  2RE2 A;  3R3L A;  3OA9 A;  4IJN A;  4CBU A;  5M1F A;  2ZWH A;  3G71 N;  2IVO A;  4H0P A;  1RFQ A;  3TTC A;  5AQP A;  4PL8 A;  5FPE A;  5TKW A;  4DCH A;  1BOT O;  4RCH A;  4ILJ A;  3QBX A;  2WBN A;  2NRH A;  5BPL A;  1NGA A;  4M7Y A;  4O8K A;  3HSC A;  3SMS A;  4O8U A;  3R9P A;  5GIN A;  3O9S A;  4ISG A;  3DXM B;  4RTF D;  2YHY A;  2E8A A;  4FPB A;  4JKF A;  3GBT A;  2ITM A;  4G9Z A;  1W2B M;  1JJ2 M;  3F2K A;  2E1Z A;  2P9N A;  3N4Q A;  2FF6 A;  2QWO A;  5AZI B;  3SMP A;  3VEZ A;  4F9O A;  5AQU A;  3BF1 A;  4HWI A;  3WXJ A;  4BGA A;  3CIP A;  1YI2 N;  1MWK A;  3T69 A;  4BR2 A;  1TYQ A;  3O6W A;  4CZH A;  4U67 L;  1ATS A;  4PKG A;  4BRO A;  3E1Y A;  4B1Y B;  4IWV A;  4JKG B;  1D4X A;  2ASM A;  3G25 A;  5EXW A;  3WXM B;  4BRM A;  4C23 A;  3I55 N;  1KXP A;  1T6D A;  2D4W A;  1VQ6 N;  3KK7 A;  5I9E B;  2IIR A;  2QWL A;  3ZYY X;  5AQS A;  2D0O A;  3J8A A;  1TUU A;  1SQK A;  5FPN A;  5GIP A;  3NMU A;  1NMD A;  5C15 A;  2D0P A;  5GAE P;  3KHY A;  4ISE A;  3MCP A;  2KKZ A;  3ULE B;  2YHW A;  4JKA A;  3D6R A;  3CJ1 A;  4JD2 B;  3O1B A;  5AQO A;  3SK3 A;  4EHU A;  5JVG L;  1YIJ N;  4J8F A;  4B1X B;  3H3O B;  2WFB A;  2NRX A;  2Q0R A;  1VQ4 N;  2QW9 A;  3CHW A;  4CZK A;  4QS9 A;  3LDL A;  4BR5 A;  4YOY A;  4IOC L;  1VQM N;  2BTF A;  2ZF5 O;  3LDN A;  2HBJ A;  4U7B A;  1GLB G;  3JS6 A;  3ZET B;  3D2E A;  4BVO A;  3CCE N;  1U6Z A;  4A57 A;  1CZA N;  3ENB A;  3IFR A;  1NGG A;  1VQ9 N;  5AQJ A;  3G4S N;  1S22 A;  1VQK N;  3BUZ B;  1HJO A;  3QFP A;  4H5R A;  5E84 A;  3CCJ N;  1K9M O;  1DGK N;  3P38 A;  3VEV A;  2V52 B;  3H6E A;  4BQL A;  2QWM A;  3ZX3 A;  3UKU A;  1VQ7 N;  1U2V B;  4B1U B;  3VF6 A;  5M1K A;  1BA1 A;  3OBW A;  5BPN A;  4BVP A;  3Q7B A;  3HOT A;  4FWR A;  5M1Q A;  4NLB A;  1MA9 B;  3SAG A;  3U9D A;  5AZJ A;  3PIP L;  3CD6 N;  1NGE A;  3OHR A;  1DKG D;  3UE5 A;  1Q81 O;  4AM7 A;  4I6M A;  4CI6 A;  5AQW A;  3ID6 A;  4DKW A;  5LJV A;  3C0B A;  4K25 A;  1KC8 O;  3G6E N;  4BC2 A;  2E1Y A;  4WFA L;  2FSJ A;  3FR0 A;  3O08 A;  4BRE A;  1XUP O;  2P9K B;  4JK9 A;  4WCE L;  1Q7Y O;  3D7E O;  5FPM A;  4FWM A;  1QVF M;  1S72 N;  3W0L A;  3K9K A;  4NB4 A;  3FZF A;  2ZJQ L;  2QI2 A;  4FWP A;  2E20 A;  3L4Q A;  3AAP A;  5M1O A;  2EWS A;  3CI5 A;  2QWQ A;  4IDH A;  2P9U B;  3R8E A;  4BR0 A;  3CC7 N;  3M5R A;  4IOX A;  5AQQ A;  2V7Z A;  3R1X A;  1GLJ O;  4BG8 A;  4BRC A;  5DM6 L;  3VGM A;  1KAX A;  1T3V A;  3MK6 A;  4BRG A;  3BP8 A;  2A5X A;  3CXC M;  2GTD A;  3VOV A;  4IOA L;  5BRD A;  2VCP A;  1MWM A;  3CQX A;  3NVM A;  4L3Q A;  5EVZ A;  2KHO A;  1YAG A;  1KAZ A;  4MO5 A;  5TKY A;  1H1V A;  4OPH A;  3VTH A;  4JHD A;  4BC3 A;  3K9J A;  1T44 A;  3SBT A;  1QHA A;  4BR9 A;  5B8H A;  3A8Y A;  2GWJ A;  2VWB A;  3VPZ A;  2P9P B;  3HI0 A;  2PAV A;  5BRF A;  1OVY A;  1GLL O;  3OW2 M;  3E9O A;  3U4L A;  1K8K A;  2WUS A;  1S3X A;  3IDH A;  1YXQ A;  2P9L B;  4Y0W A;  1VQ8 N;  4FVU A;  3AGK A;  2BUP A;  3CC4 N;  1N8R O;  4GV3 A;  2F9W A;  1EQY A;  4BQZ A;  1G99 A;  4WFB L;  3WXL A;  1KD1 O;  3DLL L;  2AA4 A;  5AQI A;  1BWF O;  4H0O A;  2FSK A;  2FLO A;  2P9S A;  2CGK A;  5ADX A;  3AGR A;  1DT9 A;  2YCH A;  4H5T A;  1QZ5 A;  4FWO A;  3HZ6 A;  4BRL A;  3EE9 A;  3DAW A;  2CGL A;  3MDQ A;  3DXK B;  3O4W A;  4YOX A;  4XH1 A;  1VQ5 N;  2NRV A;  2HF3 A;  2CGJ A;  2OTJ N;  1ATN A;  1Q18 A;  1YUW A;  4DQ8 A;  3UKR B;  4BR7 A;  2FSN A;  3D2F B;  1E4F T;  2ZGY A;  1QQN A;  3Q7C A;  3VEN A;  2CH6 A;  3SLC A;  3FZM A;  3O9T A;  3FFK B;  5C10 A;  4GV9 A;  1M1K O;  5AQY A;  1V4T A;  2NZT A;  3CCV N;  4B1Z A;  2BH1 A;  4BC4 A;  1MDU B;  4KH6 A;  3DXM A;  3FZL A;  3VER A;  4A61 A;  1SZ2 A;  1JCG A;  3GE1 A;  1OKJ A;  1VAZ A;  5HOO A;  4GV6 A;  5ADX H;  4FPA A;  4H0T B;  4LC9 B;  1NLV A;  4NLC A;  4PKI A;  3QBW A;  4CJ7 A;  1Q82 O;  3AAQ A;  5AFU A;  3C7N B;  4H03 B;  4MLH A;  5AZI A;  3QB0 A;  4BC5 A;  5M1N A;  3GL1 A;  3VES A;  4A59 A;  4K41 A;  4H0V B;  1XQS C;  2FXU A;  3HRG A;  4FWQ A;  1NGD A;  3CC2 N;  4CZL A;  3SAF A;  4BRK A;  1HLU A;  3EKS A;  1RGI A;  4WYB A;  4JKG A;  4M7X A;  4EAH D;  1RDU A;  2PFU A;  4XH5 A;  1TUY A;  2E2O A;  2OTL N;  4B1V A;  3MMV A;  5C0Y A;  4MO4 A;  4CBX A;  3CMA N;  3PIO L;  2V51 B;  3KWI A;  3LM2 A;  1NGB A;  3MN7 A;  4FWN A;  2Q2R A;  3ULE A;  3PLA A;  1X3M A;  3EZW A;  3O9Q A;  1K8A O;  2KLA A;  1GLC G;  4MDA A;  2GX9 A;  4JD2 A;  3VEO A;  3ZEU A;  1NGF A;  5KPZ A;  2ZJP L;  4R79 A;  4OPA A;  1NWK A;  4YOR A;  2HBK A;  5BPM A;  5AFU H;  5AQR A;  3E9P A;  4ILG B;  4CZI A;  2RHK A;  4A62 A;  3VF4 A;  3M3Z A;  3MWT A;  4WQ5 C;  1JCF A;  4FWS A;  5AQG A;  4BRF A;  3ZET A;  3TU5 A;  1YIT N;  3O80 A;  3LDP A;  4CZE A;  2IVN A;  2HMP A;  3P4I A;  4FWL A;  3T7Z A;  1SAZ A;  5KPR A;  1VQN N;  4MLE A;  1QQM A;  3W3D A;  2HBM A;  4JN4 A;  3SJH A;  3MN9 A;  4CZJ A;  3I56 N;  5CE3 A;  5AQM A;  2UYT A;  1NJI O;  2NRT A;  3H1Q A;  4FSV A;  3ZX2 A;  1VQO N;  3EL2 A;  3O5B A;  1U2V A;  1VQP N;  2Q31 A;  3IKM A;  1HUX A;  4JEP A;  4O5F A;  3MCA B;  3CJB A;  5H1S Q;  3CCM N;  1W97 L;  3HOS A;  3CJ9 A;  3VEW A;  2D1K A;  4IZ9 A;  3ATU A;  3BF3 A;  4IO9 L;  3L0Q A;  4H5W A;  2CH5 A;  2I7N A;  3JXU A;  4EFH A;  2F7T A;  3VGK A;  3RSE A;  3O8M A;  3A5O C;  4OO1 J;  3SBG A;  3EO3 A;  2P9K A;  5AQV A;  1GLF O;  4IO8 A;  4PHT X;  2V7Y A;  1HPM A;  3VEY A;  3WUH A;  3FZK A;  3I8B A;  2I7P A;  3P39 A;  1T6C A;  3H3N O;  2Q1N A;  3UB5 A;  1LOT B;  3CCL N;  2NRR A;  5C12 A;  2W41 A;  4FOE A;  3WT0 A;  1RDW X;  3E9L A;  4DB3 A;  1BDG A;  2DPN A;  3IMX A;  4BG9 A;  4BRN A;  3VEX A;  3EE8 A;  3AY9 A;  5GAG P;  3MX2 A;  1YF5 L;  1GLA G;  3VMF B;  3WXI A;  5JIC A;  1YVN A;  3KWG A;  1ILY A;  2HST A;  1WOQ A;  3FE1 A;  1KQS M;  4JKB A;  2NRZ A;  3TSQ A;  3WEE B;  2HBL A;  2JWK A;  4A5B A;  4IFE A;  5KQD A;  1YJW N;  3U9Z A;  4BRA A;  2YI1 A;  2GEL A;  2QWN A;  2VGN A;  1HKG A;  3I33 A;  1HKB A;  3HBT A;  1IG8 A;  4JKH A;  3VF2 A;  1NGC A;  5AQK A;  4PL7 A;  3CPW M;  4IJA A;  3KZB A;  4IEI A;  2Q36 A;  2P9I B;  3LDQ A;  4BGB A;  4FL9 A;  1K8K B;  1YJ9 N;  5GAD P;  5FPD A;  1KAY A;  4DHY A;  2J4R A;  2P9P A;  2H3G X;  4A2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...