5HBMA

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
554
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 161
structure length 552
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hbmA05
3VQQA 1BIZA 2HHUA 1Q9YA 3T19A 1MU2A 3NGDA 3KK3A 4CJVA 3WNFA 4M3TA 3QEXA 1HQEA 2WB4A 3V9ZA 1NK6A 1HNVB 3DLBA 2O4IA 2BQRA 4RW4A 2DTUA 3V4IA 4H8KA 4F4YA 1LWEA 3JYTB 1T03A 2PZSA 4O3PA 4TQSA 1JLFA 5HRNA 4ZVHA 4CHQA 3D0PA 4KB0A 1U49A 4LQ3A 4TSXA 1BI4B 4IRDA 4KKOB 5KFTA 4PWDB 4O3OA 4KTWA 3AO3A 1BQNB 3V1RA 4JLHA 3CM5A 4HCCA 5I3UA 1RTIA 1WNEA 3OLAA 4I7FA 3QZ8A 2D7SA 4OKJA 1S0NA 1JXEA 3NE6A 1RDRA 3QESA 1RA6A 5KT6A 2E9TA 3I0RA 3CO9A 3L2QA 5KFDA 4FS2A 4DSKA 4HKQA 3DRPA 4KSEB 1RTJA 3KK1B 1W25A 3LWMA 1IG9A 3NFAA 2G8IA 4DG1A 4ZPAA 3Q8RB 3BSNA 1YVFA 2FLNA 3OVNA 2FLLA 1IKVA 1S4FA 4CEZA 1SH3A 4OVLA 4I2QB 3RMDA 1KFSA 2OPPB 4ELTA 3Q8PB 4Z4CA 2D41A 1N5YB 4DS4A 3LP2B 5KFAA 3OHBA 1NK8A 3DLEB 4J2AA 3V6JA 4FJLA 2W8KA 5KG5A 4LH4A 3NF7A 4EEYA 2D0BA 3VQ8A 4B3OB 1JXLA 4YR2A 3B6PA 1B92A 3LP3A 2AX0A 3AA2A 5J2QA 4Z4FA 5L1JA 2IDOA 4DL7A 3JSMA 3UQSA 4URGA 3NL0A 4DTRA 4R8UB 3ISND 3LALA 3H4BA 1WAJA 1C0TA 3PW0A 4O55A 4NCGB 1LWCB 5C42B 3FFIB 4O3SA 3BQ1A 3QIDA 4DLGA 3BGRB 4J2EA 2VWKA 3MXMA 4FW2A 3RMAA 4W5RA 3O3HA 3OYFA 5KG4A 5F8MA 4F8RA 1RT1B 1TP7A 4DEZA 1WSIA 4WFZA 4Y3CA 4ELUA 3PVXA 4HHTA 2VG6A 1S1XB 3CG7A 2HHXA 2VG5B 2B5JB 3NAHA 1U4BA 4H4OB 3H4DA 5KFUA 3LDSA 3KJVA 1UA1A 1LW2B 3NCIA 3TWHA 2R2SA 2F8EX 4R5PB 1KVAA 1IKYB 3EYZA 4TY8B 2OPSA 2DPJA 4GW6A 4DFKA 3BSAA 3TR8A 4AHVA 1NJZA 4FJ8A 3H40A 2F8SA 3UIQA 4KO0A 2J6TA 5D3GB 3SFGA 2R8GA 1RILA 5DG8A 2PYLA 4CGIA 1RDBA 4K4SA 1VSMA 2OZSA 3PW2A 1WLJA 4EP5A 4CEDA 3CQ8A 2YNHA 4ECZA 3K57A 2E9ZA 2DPIA 2YNGB 4KE5A 1JX4A 3QIOA 1HARA 4LSLA 5K14B 4FBTA 5HP1A 4RW7B 2W42A 1RT5B 2FVCA 2Y1JA 4RW8A 3BJYA 4K8XA 1ZBUA 2OPQB 2IBKA 4AHUA 4CCHA 4M3XA 3OYEA 1SL1A 4K4UA 2DFEA 3DMJA 1TK0A 4CF8A 4XPEA 1S0MA 3OS1A 1LWFB 4IFVB 5FDLB 4FW1A 4FK4A 2C22A 4E7HA 4BWMA 5F8GA 1NOYA 2RF2A 2XCAA 3CFRA 3AA4A 1JLEA 5KG2A 4K4YA 1KFDA 2HHTA 1RBVA 4JS4A 1S97A 4DU1A 3DLRA 3NH2A 3RBEA 4DF4A 1NK9A 4M95A 1GOAA 1K1QA 4RNOA 3V6HA 1R0AA 2KQ2A 3GV8B 2AJQA 2V4QA 1LAWA 2QKBA 1Z25A 4CEOA 1J54A 4KHYA 4W5NA 4CHNA 5KFCA 1S6QA 1F21A 4KAZA 2KZZA 5KFKA 1QSYA 3C6TA 4DTXA 3S3OA 3KHRA 3K5OA 3L8BA 5CYMB 4RUCA 1HRHA 3KIOA 3ALYA 3F9KA 1RDCA 5F8LA 3OL8A 3U6FA 3OL7A 2XRIA 3HSTB 3ZSOA 1N56A 1J5OA 2ITGA 3I8DA 2HMIA 5DGBA 3N6LA 5C25A 1BIUA 4N76A 3OL6A 1U45A 1WSGA 2KZMA 2Z1HA 4CEFA 1RT7B 3RB3A 3PY8A 4NLYA 3OHAA 4MKBA 1ZTWA 2E9RX 3HXMA 1UA0A 5KG7A 4DQSA 4J9QA 3E01A 1S9FA 5KFLA 4NZ0A 3MECB 2BE2A 3QNOA 3KK2B 3DLGB 3QO9A 3S9HA 4RUAA 1NJYA 2P5OA 4KB1A 2F8TA 3KLFB 4OPJA 3VQ7A 1REVA 1XR6A 3ZT4A 5JS2A 2IMWP 3TARA 2OZMA 1QHTA 4NLVA 3G6YA 1TKTB 3QLHB 2XC9A 3PJWA 3U3YA 3K5LA 2Z1IA 3KHLA 2HVIA 1ASUA 3TAMA 2ETJA 3IG1B 5KG6A 1QSLA 2D3UA 4NRUA 3DRSA 4IH5A 4QCLA 3I5AA 3DRRA 4Q44A 4C8MA 3K58A 4ELVA 1A5WA 4OL8A 1RDDA 3VN5A 1RT6A 2YNIB 3KLHA 4FJXA 1QSSA 1YT3A 3IRXB 3SV3A 4KB7A 4BDPA 4ZP9A 1RYSA 4FJKA 1X1PA 4O44A 1TV6B 2FJVA 4HUFA 5DG9A 2CJQA 1L3UA 2GIQA 3DDKA 3GQCA 3SI8A 3KD5E 3DI6A 1NKCA 4UQGA 1S9GA 3KLEA 4J9LA 4NLGA 4W5QA 4F4KA 4CK1A 4CK2A 4CIEA 4DSLA 1U09A 3NBPB 2OPRA 2XY7A 3CJ2A 5J2NB 4ECUA 3MEGB 2HNYA 3O3FA 3EPGA 2W9BB 3CDUA 4RNFA 4LY7A 3FSIA 4KHNA 4DFJA 1T3NA 4PQUA 4CK3A 3OS2A 4IKAA 3RRHA 4IFYB 3RB0A 4DTJA 1K1SA 3O3GA 5J2MB 3DOLB 3D45A 3MR5A 1TK8A 5KFPA 4ZTJA 2HVHA 4FLZA 3P83D 5HBMB 3ZSXA 4FJMA 5I42B 3PJXA 3AA5X 5F8JA 5F8NA 1NKEA 4KI6A 1HNVA 4Y2AA 4O4GA 4DU4A 3ASMA 4J9OA 4ZP8A 1C1CA 2WHOA 3HP6A 4WXWA 3H5UA 3TABA 5KFMA 4NCAA 3MEEB 1KTQA 5C5JA 3PW5A 3CDEA 1BI4A 4KKOA 4PWDA 2VA2A 4EBCA 4JV1A 4CGHA 4DTSA 4IR1A 4KFBB 3QINA 1HQUB 3MAQA 1CXQA 2X78A 4M94A 4IRCA 1LV5A 1T7PA 1S1WB 1S9EA 3PR5B 1FKPB 1BHLA 2Z1GA 4FZYA 3RWUA 2EC0A 3H98A 4ED6A 3TI0A 3MEDB 4ZHRB 4KV8B 4CJRA 4FJNA 4ID5B 3KK1A 1WSEA 4DTNA 4YP3A 3DOKA 4CJQA 1C1BB 1RNHA 4CJPA 5DQIA 4ECVA 5FRMA 5HRPA 1HYZA 1HPZB 4RW9B 2P5GA 3G0ZA 4IDKB 4HCBA 2W7OA 4LSNB 2OH2A 1VSLA 4Q0BB 4I2QA 1VRUB 1RBSA 3I5CA 2OPPA 3LWLA 1W0HA 2W9CB 4IR9A 4PY5A 2JEGA 4FM1A 4CF9A 3BQ2A 3LP2A 2DFFA 1NHUA 3AO2A 1FK9A 3DLEA 3GYNA 1KHVA 2HW3A 1JL2A 5F8HA 1NJXA 5F8IA 2WRMA 3AVLA 1K6YA 4ED1A 3VQ6A 3M8PA 3H59A 4B3OA 4RNHA 3VQ9A 2G8KA 2YV0X 3DYAB 1S5JA 5KGXA 3SUOA 1DTTB 3ZSRA 1VSHA 2OYQA 3TAGA 1YTUA 4NLQA 2VG7B 4XPCA 3T5LA 1RA7A 3QGGA 3LP0A 2JGUA 1C2PA 3HJFA 1JLQB 3KLIB 4CJLA 4NRTA 5C42A 4WYLA 4IH7A 3PR4A 5KFFA 1GOCA 4M3YA 2XO7A 3PW4A 3FFIA 3QEIA 2VWJA 1RT2A 4FJ5A 3BGRA 3OYKA 4NLWA 5DQHA 4O3RA 2FBXA 5EDWA 3MTKA 1RT1A 2R2UA 3ZT1A 3ZSQA 1S1XA 2IC3A 2VG5A 4Y2CA 3L2VA 2B5JA 4FLTA 4H4OA 3KKRA 3PX6A 4DSJA 1NHVA 2G8FA 1A5XA 4AILC 5KT2A 3MR3A 4YMEA 1IKYA 3SPYA 4TY8A 4I9QA 5T14A 4J9KA 3TAEA 3UPFA 5DLGA 3OYLA 2YKNB 1HYSB 1GOBA 2WOMA 5SWMA 4E7JA 4B08A 5D3GA 3HPGA 4JUZA 3L2WA 3SNNA 3DLKA 2X6SA 3AVKA 3OSPA 1JLCB 1WSHA 1IKWB 3K59A 1IH7A 2YNGA 1C0UB 3KMSA 4F3TA 1SV5A 5HRRA 4Z4GA 5K14A 2AU0A 2J6UA 4E7KA 4MK8A 1ASVA 3V1OA 1RTDB 1DLOB 4RW7A 1CZBA 4O0IA 1RDAA 3KHGA 2XY8A 3V6DA 3THVA 4EZ9A 4IG0A 1KVCA 4HYKA 1L5UA 4K4ZA 3KLGB 3IGNA 2DY4A 4QWEA 2IJFA 4J2DA 2RKIB 5KFNA 1VRTB 1VSKA 1TKDA 1LWFA 1N48A 5FDLA 1NKBA 1EP4B 4MK7A 3HT3A 1D9FA 5EWFA 2D0AA 4FLWA 5C24A 3VQEA 4RW4B 4FJ7A 2IM2A 3V4IB 4OPKA 4DQRA 1LWEB 4CF1A 1I6JA 1JLFB 4K4TA 2P1JA 4CJWA 3ITHB 4KAIA 3KLVA 3CYMA 4MIBA 4B9SA 5KFIA 1RTIB 3AVCA 1ASWA 3HKWA 4C8LA 1TKXA 4MQ3A 3A2FA 4KI4A 3SQ2A 1NK7A 4U6PA 5JS1A 4U7CA 3I0RB 2UVWA 5KFWA 1RT3A 1SL0A 3ZT3A 5CYMA 4ZP7A 4ED0A 1TL3B 1J9AA 1A5VA 4DL6A 1T05A 1RBRA 1VSDA 3VQBA 5KFYA 4KHQA 3SZ2A 1KHWA 4BWJA 4NYNA 1NK0A 3M8QB 2OA8A 1WSFA 1IKVB 1JLAB 5J1EA 2QE5A 1EKEA 3P5JA 1WSJA 5L1KA 2ZE2A 3IS9B 4ED7A 1GX5A 3KNAA 5KRTA 3V9XA 2BDPA 2IM1A 4NLUA 3QZ7A 5KFBA 1JKHB 4H4MB 4E3SA 1FKOB 2V9WA 5KFOA 1LW0B 3MECA 1SKRA 4DTOA 3DLGA 3OYMA 4Q8EA 1JXBA 1HNIB 3KLFA 4CJKA 3QERA 4FZXC 4FZZA 3JSMB 4E89A 2V4RA 3PUFA 4KHSA 3BREA 4C8NA 1TKTA 3HVTB 2B43A 4AHRA 4H54A 3S3NA 4FM0A 3G6XA 4F50A 3OY9A 3IG1A 2HNZA 4NYZA 3L3UA 3RMBA 4CJ5A 5KT4A 4FS1A 3MXJA 4CGGA 4F4WA 1RTHB 4KHMA 2BR0A 3OJSA 1XR7A 3QGHA 3HPHA 2QKKA 4IQXA 4PUOA 3PO4A 1T94A 3SCXA 1UWBB 3LANA 3IRXA 2JEIA 4HVJA 4DWIA 1BQMB 4GC6A 4LH5A 1TV6A 4Z0UA 3LZIA 1S6PB 5DLFA 2VG6B 4K4XA 2JC0A 4ZTFA 4YFUA 5T7BA 2ZQBA 4M3WA 5KT7A 1KLMB 3KJVB 1VSFA 3Q8QB 3SYZA 1TAQA 4KTZA 3NBPA 4CIGA 3SUNA 4ZPDA 2OPSB 2FBTA 1ZBFA 4MFBB 1C0MA 5J2NA 2GC8A 1S0OA 3AVFA 3TVKA 2W9BA 2I5JA 4O4RA 4KO0B 3F73A 1ZTTA 1S10A 3T5KA 2HB5A 3OYNA 3NDKA 4CHZA 3GIIA 1EETB 1HJRA 3HPOA 4E19A 2WONA 2YKMA 2ILYA 4QAGA 3QIPB 4ZPCA 3FRZA 1JL1A 1S48A 5J2MA 3LP1A 3UDLA 5CY4A 4XIUA 3DOLA 4CHYA 5HP1B 1GX6A 1D1UA 4B9VA 3PO5A 3ZT0A 2C2RA 1B9DA 4J9RA 1C6VA 4IG3A 5HLFA 4ZVGA 1XHZA 4C8OA 4DL5A 2BGGA 4BE0A 4YR0A 1L3VA 2XY5A 3DMJB 1UOCA 2O5DA 4KBIA 3V81A 3I0SA 3L3VA 3IAYA 2O4GA 4HUGA 4J9MA 2ATLA 5KFHA 3HVAA 3OYAA 1SL2A 3O4QA 5EU7A 2WK4A 3C95A 2IA6A 1HQUA 3DM2B 1QE1B 3QETA 3HL8A 3LAMA 3K5NA 1FKPA 4DF8A 3C6UA 5J2PA 4ZP6A 3FQLA 4Q5VA 2G8WA 3MEDA 4ZHRA 3MR2A 1QUVA 2BQ3A 4K50A 2BANB 1SUQB 2XWYA 3CWJA 4CJ4A 1S1UA 1DTQA 2UUTA 1HPZA 1TKZA 4CEQA 3OYHA 3C6TB 4LSNA 5KFVA 2XGPA 4DL4A 1S1TA 1VRUA 2R8JA 3T5JA 3OYIA 4EBDA 2AGOA 2W9CA 5F9NA 3SJJA 4CEBA 2FBYA 2JEFA 1ZYQA 3VQDA 4NLOA 3GIKA 5KFEA 4PA1A 4ICLB 4Z4IA 2FC0A 3TANA 4DTMA 2ZD1B 2HMIB 4OGEA 1ZBLA 2FVQA 5C25B 4WYWA 3DYAA 4C8KA 2GV9A 2E4LA 3V9UA 1G15A 3KD1E 2VG7A 1OS5A 2HWIA 3SI6A 4TLRA 4GVMA 5KG0A 4HTUA 4GMJB 4CEEA 1JLQA 3PV8A 3T5HA 3E01B 4AHSA 3L2RA 2BE2B 1NNDA 1HYVA 4QW9A 4F2SA 3JYTA 1LAVA 2DFHA 4CJSA 2AX1A 4B8AB 1REVB 3UR0A 4NYFA 1Q9XA 1QS4A 3AVBA 3TAFA 4DSEA 4G3IA 1JLBB 3B6OA 3ZSWA 1UAXA 4EYIB 4EO8A 1X9WA 1CZ9A 4TN2A 3V6KA 2ASLA 1BQNA 5CZ1A 4DU3A 4CFDA 3ICLA 2PY5A 1S1VB 2GIRA 3LPTA 2E6LA 3DRSB 2F96A 3DRRB 5DMRA 1N4LA 4NLRA 3SFUA 4ZMMA 3TQ1A 3NGYA 1IKXB 1D0EA 2GUIA 4YNQA 4K8ZA 2UUWA 3HVWA 4CIFA 3OS0A 1YVUA 2HHQA 4DL3A 4O0JA 4B9NA 4IRKA 4BE2A 3OYGA 3FQKA 4O44B 2YKNA 2GBZA 4FLXA 3K5MA 1HYSA 3D28A 3RR7A 3OYDA 2RPIA 3DI6B 4QWDA 2A1SA 1S9GB 4M45A 5DG7A 2I1RA 4B8CA 1RT4B 3CFOA 5HRSA 3RTVA 3FDSA 3HP9A 1ZBIA 4Z4HA 3CFPA 4RNMA 3HO1A 1N5YA 2OPRB 2FBVA 4EO6A 3G86A 4N47A 4CJTA 1SKWA 5L1IA 2FVPA 4FCYA 4FK2A 2B6AB 1SKSA 1JLCA 4JV2A 4WE1B 1IKWA 2HNYB 3CJ0A 3ISNC 1C0UA 1HMVB 3VQPA 3QNNA 4O3QA 2QK9A 4Q43A 3SQ1A 1RTDA 1DLOA 4AHTA 2HNDB 5KT5A 1TL1B 2EX3A 3TAQA 3BR9A 1FXXA 4CGFA 4R8UA 5DK5A 4CE9A 4JS5A 4PQUB 2QV6A 3VQAA 4DSFA 4FK0A 4BDZA 4CEAA 4NCGA 4RW6B 2RKIA 1LWCA 1VRTA 4RZRA 2RDJA 1VSJA 4ZVFA 1XI1A 1EP4A 1N6QB 4CF2A 2HAIA 2UVRA 4G1QB 4TYBA 3VQCA 1D8YA 2IAJB 2XHBA 3NH0A 2PYJA 3H2LA 4O4GB 1NK4A 4DTPA 1RBUA 2C28A 3M9OB 1C1CB 2CKWA 3CJ4A 5KG1A 2IGIA 1S49A 5E41A 1JLGB 1QQCA 3K2PA 5FRNA 3ITHA 2AQ4A 3NAIA 2D3ZA 1TK5A 2YNFB 3GIJA 4TQRA 1LW2A 1SH0A 4QWAA 1VSEA 2WCXA 4OLAA 2BRLA 1YTAA 4R5PA 5HROB 2A1RA 1S9EB 4KHWA 4I2PB 3HM9A 5EWEA 5EWGA 4ECRA 4E1NA 4ZPBA 4DL2A 3PZPA 3CM6A 4TXSA 1U04A 4IKFA 1TL3A 1VSIA 3ZT2A 3MF5A 1XHXA 4J9PA 3VQSA 3C94A 2BQUA 2IS3A 2YHBA 3DOKB 2R8IA 4B9UA 5DQGA 3M8QA 4J9SA 1JLAA 3ZSVA 4FBUA 3M8RA 1J53A 4WZMA 4CJUA 4CFAA 1TGOA 4CJFA 3SV4A 2XY6A 2V0NA 3IS9A 4IOBA 4DFMA 5KGWA 1NJWA 1RT5A 4W5TA 4EZ6A 3NGZA 1FK9B 4DQPA 1JKHA 2OPQA 4NLTA 4H4MA 2XI2A 4URSA 1U48A 5CYQB 1QTMA 5KFXA 1KVBA 2Y1IA 4QOZB 1FKOA 4ECSA 4AHCA 4DMNA 1LW0A 3M8PB 2IM3A 2FJWA 3RAQA 3MFHA 3VQ4A 3SUPA 1KSPA 4QWBA 5KFQA 5CZ2A 4J2BA 1VK0A 4ECTA 4IFVA 3HHKA 4E7LA 3H5SA 1HNIA 1TVRB 3SPZA 4N56A 3H08A 3G6VA 3MXIA 3M8SA 4E7IA 3SUQA 1MU2B 4BDYA 3KK3B 4WFXA 4JV0A 4HUEA 3LP0B 3HVTA 1KRPA 1HQEB 1I39A 3AVGA 3WNGA 4I9LA 3EPIA 3AA3A 4CERA 4ED3A 4CJ3A 1T03B 2C2EA 1RBTA 1CLQA 4KHUA 1EXQA 3AO1A 1Z4UA 1RT2B 4E0DA 1RTHA 2AGPA 2XCPA 1NOZA 1UWBA 4CFBA 3GV5B 5I3UB 4XO0A 2IJNA 4I7FB 2IOCA 3DLHA 1BQMA 4DQQA 2X6NA 3D5MA 4Q8FA 3SQ4A 1S6PA 2W9AA 4KRFA 2AGQA 4MKAA 4JRQA 5KFSA 2IC3B 1W9HA 3WNHA 3OYBA 5KFJA 1KLMA 3I5BA 1ITGA 2D0CA 3NHGA 5JXSA 3DRPB 2R2TA 4MIAA 1RTJB 1BISA 3N6NA 1WN7A 3E51A 2JLEA 3IGVA 3NF9A 4MFBA 4DG1B 1L3SA 2KFNA 2WOMB 1KLNA 3OYJA 2ATQA 5KFZA 5KFGA 4DLEA 3DLKB 1EETA 2FVSA 1RT7A 2R8KA 3AVAA 4F3OA 5KTQA 3QIPA 4QW8A 4KTQA 3QEWA 3RBDA 3EZUA 4B9TA 2XGQA 3KK2A 3V1QA 4FM2A 1SV5B 4WFYA 5J2QB 3V9SA 4JRPA 3CDWA 2ASJA 2C2DA 4DQIA 3NH1A 1CXUA 4BE1A 3V6DB 4TYAA 3M9NB 4IG0B 1RAJA 3QLHA 1C0TB 4URQU 3WNEA 4CJEA 3BDPA 4IH6A 4LD0A 4OKKA 1XWLA 4K4VA 4OGCA 3AVNA 5KT3A 3NAEA 4M3UA 4GC7A 5KRSA 2YNIA 1XC9A 1X9MA 4OLBA 5C24B 1QAJA 4LQ9A 4FJHA 4DS5A 4O5BA 4RNNA 3DM2A 2G8UA 1QE1A 4ED2A 1BCOA 4CFCA 3RRGA 1BGXT 2KW4A 2R7YA 2FJXA 2IM0A 2UVVA 2Q3SA 4CF0A 4QPXA 1Y97A 4O3NA 4OKEA 3EZ5A 2BANA 1SUQA 3VA0A 3HK2A 1EX4A 3CJ5A 3KHHA 1BL3A 1TKXB 1IM4A 3CVKA 2JEJA 1L3TA 2QXFA 3MEGA 3H5YA 1CSJA 3NF6A 3QGIA 1RT3B 3OLBA 4KREA 5F9LA 2ALZA 4CGJA 2P51A 2ILZA 4ECXA 4YQWA 1T05B 3NF8A 1C1AA 5DGAA 1WAFA 2G8VA 2W7PA 4FJIA 3T1AA 4EBEA 4ICLA 4MK9A 2YNHB 4Y1DA 5J1EB 3EY1A 4IFYA 3CIZA 4ED8A 3P1GA 2ZD1A 3MFIA 4CESA 4LSLB 2ZE2B 3H5XA 2RN2A 1TAUA 4M3RA 4RW8B 4Q45A 5L9XA 1T8EA 3T3FA 3ZCMA 3GIMA 3AO5A 4FLYA 5HBMA 2AWZA 4N5SA 4Z4EA 4X2BA 1TQLA 4R0EA 5I42A 2YHAA 3OL9A 4FLVA 2ASDA 2FLPA 4K4WA 2J6SA 4DFPA 1D9DA 4N41A 2HHVA 1SH2A 3M9MB 5KFRA 3MEEA 3PHEA 1JLBA 3LPUA 3S3MA 1RCHA 2RF2B 3ZSYA 4FJ9A 2EHGA 4ECWA 3BQ0A 1JLEB 4CHOA 4IBNA 5SZTA 1S1VA 4KFBA 2HNZB 3LZJA 2X74A 5L1LA 3GV7B 1S1WA 4YR3A 4CECA 2KTQA 4ECYA 4TY9A 2D5RA 3L2UA 4NLXA 5KG3A 2R2RA 1IKXA 4ZVEA 1XR5A 3U3GA 1R0AB 2BRKA 4KV8A 3N6MA 4ID5A 4PUOB 1O1WA 2HWHA 3RMCA 4RU9A 3AV9A 3KTQA 4NLSA 1C1BA 4ECQA 1S6QB 3RB4A 4RG8A 4RW9A 3Q8SB 4IDKA 1ZBHA 4FLUA 4Q0BA 2NUBA 1RT4A 2B4JA 3NMAA 2HHSA 2JC1A 3AVMA 3AO4A 3OJUA 2B6AA 5JUMA 3KKSA 2VA3A 4WE1A 3PX0A 4WZQA 1J5OB 3V9WA 1HMVA 2E6MA 1MMLA 2I5JB 4AH9A 4L8RB 4CHPA 2HNDA 1DTTA 1TL1A 4J9NA 1JIHA 1I3AA 4CGDA 2WONB 2YKMB 4M41A 5EUHA 4F2RA 1KCFA 1Z26A 4ID1A 3ULDA 4B9LA 2WTFA 3KLIA 4RW6A 3LP1B 3QO9B 1NK5A 4DSIA 4B9MA 3SQ0A 3ZSZA 3NGIA 3AVIA 2W8LA 3QEPA 1IO2A 4FJJA 1N6QA 4KPYA 3QEVA 4IG3B 4Y34A 4G1QA 5HLFB 3G10A 4DTUA 2IAJA 3KMQA 1RYRA 3TAMB 1X9SA 3RB6A 3CJ3A 4OJRA 3V81B 3TAPA 2ZKUA 3BSOA 2UVUA 1JLGA 3I0SB 2KFZA 2YNFA 1D5AA 1RT6B 4NLPA 3KLHB 3VA3A 3PW7A 3MR6A 5HROA 4MH8A 1QAIA 4I2PA 3IN5A 3C6UB 5J2PB 3HVRA 3BSCA 2FVRA 3AVJA 5FROA 4F4ZA 1B9FA 3VQ5A 3RR8A 4F4XA 4EP4A 3GILA 4KHRA 4W5OA 3KLEB 2R8HA 1BCMA 3AVHA 2RDIA 3O4NA 1S1UB 4BACA 1DTQB 2LSNA 4WXOA 1TKZB 2G8HA 3LAKA 4NLDA 4Y1CA 1S1TB 3HYFA 1ZETA 4FJGA 4QWCA 4M42A 3QYYA 3RAXA 1U47A 3OSNA 2HHWA 3NKYA 3PX4A 1WNSA 2Z1JA 5CYQA 1Q8IA 4FYDA 4FXDA 4NCBA 3KOAA 3KLGA 4EYHB 5KI6A 4E1MA 4FVMA 4M3ZA 2XI3A 3OYCA 1TVRA
chains in the Genus database with same CATH superfamily
3VQQA 1VIOA 2HSEB 3R7NB 3NGDA 3LM2A 3O6WA 3OR2A 2W2PP 4JP8A 2YVSA 2DTUA 2W2NP 2QIFA 3O1BA 1YI2S 3QNWB 1VQPN 1Q81O 1JLFA 2XMAA 1U1PA 4FP9A 1HBUA 1A6LA 2LQ8A 1BI4B 3T9NA 4PWDB 1FX4A 4KTWA 3AO3A 4HHJA 1JWWA 4JLHA 2GA7A 5LT5A 1WNEA 2ZH9A 3VGMA 4OKJA 2UUBJ 4CLFA 4LRDA 2E44A 3O9RA 3NE6A 5KT6A 3I0RA 3CO9A 2AYEA 5IT4A 2ZEJA 4H4KA 3OXLA 2MMYA 4A8OA 5F3TA 4LFAF 1RTJA 5C7PA 1CULA 4FXWA 4I64A 4ZPAA 3UVJB 4YOEA 2FLLA 1RK8A 2DGQA 5KPTA 1IQZA 1R59O 1R6YA 3CE8A 1SH3A 3DDIA 1KFSA 3MCPA 5AQVA 3BGUA 1XMOJ 3H90A 1X8DA 2D41A 3ENBA 4XH4A 1N5YB 1U1RA 4LF4F 1I94K 5KFAA 4JI0K 3C6AA 2C3PA 3TA2A 5KG5A 2P6TA 4FWKA 5GADP 2RHSB 4OZNA 3NF7A 3ILJA 3VQ8A 4B3OB 3PYDA 2PFFB 3B6PA 2PMWA 3MUVP 3CCWA 2DR9A 2DVIA 3UKRB 5J2QA 5L1JA 4HTJA 1TFYA 4RUHA 2IVOA 1RHUB 2ZKTA 2F65A 2ZOGA 4JI8K 3GCXP 5HANA 4R8UB 2QM1A 4EI2A 2CH5A 2FHMA 4GO7X 3JXOA 4NCGB 1LWCB 2WW8A 3LUYA 5LJVA 3FFIB 5THWA 4O3SA 1NZ8A 4XAKA 3QIDA 4YN3B 3J81j 5HQLA 3RMAA 2M0GB 5KG4A 2FC9A 1EO1A 4DR7J 1TP7A 1GLAG 1WTFA 1FJGJ 4OHVA 3R6MA 4DV6J 1G99A 2CNLB 1FE4A 3H4DA 1BG3A 3K5PA 5HMYA 2NLWA 1VQKS 1KVAA 3OTCA 2Y1LB 3J7YU 3FEZA 3DRXA 2WAQD 2VBWA 1DJ0A 3RG6A 4GW6A 2JHEA 5FPDA 1OJ4A 4FF3A 2Z56B 3Q8YA 1VQYA 2F8SA 3NS5A 4Q7AA 1BO5O 1CJUB 1U25A 4CGIA 2HAFA 2QC3A 2KJVA 4IOAQ 1Q78A 1P90A 1S76D 4OQJA 4ILGB 2YNGB 3LGNA 3QT6A 2YY3A 4LSLA 1FKAF 4FBTA 5HP1A 1VK8A 3R8EA 3ADAC 1RT5B 2FVCA 2VC1A 1H0HB 5ETTA 4DUYK 4F26A 1X0PA 2HWTA 2FGOA 3QSIA 4LF9K 5LOQA 2UU9J 1J5EF 2P9EA 4C23A 3OXGA 2HPUA 2E29A 4OYWA 4GKKK 4ATNA 3D3BJ 4ES1A 4DX7A 3MM7A 2GHWA 5F8GA 1IV0A 1S6UA 3QQCD 1R7IA 1JLEA 4YB6A 1UFWA 1J6ZA 4JS4A 1GXUA 2JH3A 3MCOA 2XSJB 3RBEA 1KDNA 2VYPA 2ZHBA 4ILRA 3E9LA 2KQ2A 4JI2F 1QAXA 4FNHA 4WFAL 4H5WA 3P45B 3PIOL 2AKWB 1NU0A 3EWGA 4USHA 3WBZA 4KHYA 5IT9Y 5T7LB 1RHQB 2VH7A 2YH0A 3H2UB 3S3OA 4OHYA 5HOOA 3MX2A 2GCFA 5CE3A 3K5OA 5B0BA 3QMLA 1HRHA 2CJKA 1GH8A 2QWOA 2RH3A 2F9WA 4AL6A 1N34J 2FLOA 5ETLA 1EIYB 3MK6A 3U6FA 5FLXO 3VCDA 3HSTB 5E26A 2MDAA 2NRTA 2P9IB 4N76A 4BRDA 2MTLA 1HNZK 1OWXA 2KZMA 6FDRA 2E9RX 3E01A 4NZ0A 2BE2A 4GVBB 4DMZA 3DLGB 4ZLNA 4RUAA 2F8TA 1EAYC 3KLFB 1REVA 3CCTA 5JS2A 2IMWP 3TARA 5TKYA 2XMMA 3UKUB 3BGFA 3VEXA 3G6YA 1S77D 3IR6B 3CCUN 4ZN3A 3D67A 2Z1IA 2CJAA 5LJ3Y 2CQCA 2K2PA 3DRSA 4IH5A 2ZNZA 2UXDJ 1HUXA 3V4MA 4ELVA 1A5WA 2DGVA 1HW9A 2W40A 5AQSA 2YNIB 3ZTPA 2GJIA 1QSSA 3IRXB 4KB7A 4DOZA 3O2IA 4BREA 5AQWA 2FDNA 5DM6L 4KR0B 1TV6B 2FJVA 4LF5J 4HUFA 3DDKA 5AQYA 1R8AA 3SI8A 1MG7A 1S9GA 2Z8QA 4NLGA 4F4KA 3P8BB 4CK1A 3B6BA 4DSLA 3EGZA 2LA6A 3CJ2A 2H51B 2VQEJ 5LXYA 5CD4A 3KUEA 3EPGA 1HBNB 3K2YA 2GQQA 1G2EA 3CDUA 1VOMA 1YUWA 1IWAA 3DXKA 4H0VB 2PSZA 4PPZA 4B3SF 3NOGA 3AAQA 4E98A 4DFJA 3BZCA 2BW7A 2CH6A 3WEEB 5GMEA 3R1XA 4IKAA 3RRHA 1K1SA 3EUNA 2VV5A 2B7BB 4R0JA 4PWWA 1U1LA 3TEGA 1Y0HA 3POTB 4ZTJA 7FDRA 5HBMB 2VWBA 4OMFG 3L7OA 2DGSA 4KI6A 1X9JA 2NZ4A 4Y2AA 4D3GA 4DU4A 1V4SA 3BN4A 4DV3J 4J9OA 4ZP8A 3MXHP 2WHOA 3HP6A 3PXGa 3TABA 4LF1A 2OEJA 2MKJA 4MLEA 5C5JA 1LXNA 1YITS 5IWAK 2UUBF 2CJYB 4MIWA 4KKOA 1CQMA 4A8KA 4FPBA 4UOHA 3ONQA 3QINA 2GNKA 1VDHA 1LV5A 5AXMA 1VQNS 1BHLA 4ZVSB 4HLBA 1VQPS 2MQQA 2KHCA 3VENA 5EGYA 1X31C 3ZZTA 4C97A 3KK1A 5A8WB 1WSEA 4DTNA 2CFXA 3O8MA 4G6VB 4CJPA 5DQIA 1QUPA 4K7QA 3G71N 1FRXA 1XMOF 3TQEA 2FF6A 1YRTA 2IYGA 2I7PA 4ILJA 3VGKA 4HCBA 4B3RK 4LJMA 5TKWA 4AQYJ 4UY8T 3A5LC 3LWLA 3UN2A 2ZBIA 3W2VB 2W9CB 2GMHA 4IR9A 2JEGA 2C3YA 4CF9A 3BQ2A 3LP2A 2DFFA 1NHUA 2YWWA 1FK9A 4Q2MA 1PSDA 2CGKA 5ETOA 2HKEA 5F8HA 5KAKA 5F8IA 4H0PA 4CW7B 4I0WA 3A5NC 1VQSA 5E3AA 4F04B 1GFWB 1E6YA 3CNQP 3VQ9A 2RS8A 3ILIA 5KGXA 3SUOA 1VSHA 2OYQA 4O23A 1YTUA 1Y4ZB 3M32B 3O80A 1RA7A 3QGGA 1C2PA 4BVPA 1JLQB 8ATCB 1U7LA 3KLIB 4OZLA 2B8QA 2F63A 4CJLA 5C42A 4WYLA 3IFEA 4IH7A 5KFFA 3OT9A 3FZHA 4QS9A 3D2EA 1HNWJ 1BLUA 3OYKA 3EVOA 2MPUA 2N7YA 4O3RA 2ZWOA 4CP5A 3D1OA 1M1GA 4DV6F 1OH5A 2KXNB 4LRAA 2R7RA 3KJQB 3ZT1A 1S1XA 4J90A 2XWXA 2MJUA 2B5JA 2OD4A 4FLTA 4PG6A 4BR7A 1A5XA 4AILC 4GNIA 2BX6A 4AL7A 3GG4A 2BTFA 1VGYA 1IKYA 2GQ2A 3SPYA 3E8OA 1R8PA 3TAEA 4J9KA 2E1AA 4OI6A 3UPFA 3T41A 1N54B 2J0QD 5CABA 2G2ZA 4P2FA 4WP9A 3J8AA 2WSCC 4B08A 1OH6A 3SJHA 2FHKA 4B1WB 3L2WA 2ADCA 2WVEA 3S1TA 4KT0C 2VASA 2HLTA 2X6SA 3G82B 3SQOP 1JLCB 1IKWB 1IH7A 1XJWB 3NGKA 4Z37A 1WKJA 2J6UA 4ZKAA 3DAWA 4RW7A 4B1YB 3ZZPA 3G96A 2UU9F 4RCHA 1GLFO 3ZX3A 4Y00A 4DZDA 5L9NA 4IG0A 3QFPA 5BRDA 2GUPA 4QWEA 3D68A 1KD1O 3DU5A 4JHDA 4WTOB 2Q0RA 4O5FA 4NEYA 2N4CA 4ZCIA 1A0OB 3FSXA 4D3HA 1NSAA 4JKGA 2HFZA 2NSCA 4M5LA 2V8HA 3EZWA 1H7WA 1QZ5A 2HGNA 4ZDNA 2OIHA 1WHYA 2IM2A 4OPKA 1IJFB 4DCOB 4MTPA 1F3FA 2BEFA 1XMQJ 3P4IA 3ENWA 1JLFB 1M90T 1WI8A 1HFEL 3BPSP 3OW2M 1BWFO 1WDTA 4MIBA 4B9SA 4FPAA 4BC7A 2W7AA 5H1SQ 4WP3A 3DXSX 1Q18A 3A2FA 4KI4A 1NK7A 3DOMA 3VVTA 4CWBA 3EXYA 3I0RB 2U1AA 3A3PB 2XM3A 1N34F 5KFWA 3FMBA 2OJ3A 4ED0A 5GAHP 1NPKA 5M1NA 4DL6A 4ES2A 1RBRA 1VSDA 1SI9A 4FWOA 4B3MF 1WSFA 5J1EA 3CMEN 2QJ3A 3S6EA 3P5JA 2IDEA 1Q0NA 3CCJN 3VEOA 1GX5A 3J80U 3N5FA 5FPNA 3VALA 3SAHA 4TNOA 2W4DA 3ULHA 4IO9Q 4DUZJ 5D77A 4N8OA 2Z2MA 5AQUA 2VQFJ 3MECA 1SKRA 5EN1A 2DHGA 2JWNA 1ZBTA 4Q8EA 2P9PB 2EVZA 3PM9A 5IWAJ 1FDNA 3QERA 4FZXC 4HI2A 4E89A 2V4RA 3PUFA 4CBUA 3R2DJ 1RAOA 1TKTA 3CTRA 2A41A 4AHRA 2CPZA 2XZTB 1WACA 2G0IA 2UXDF 2NNWA 3R3TA 3M1FA 5I9EB 5C12A 4FS1A 1BMQB 4H5TA 3H2VE 1RTHB 2IIHA 1XMBA 4UW2A 4PUOA 4LF5F 5U47A 3LANA 1F1BB 4DWIA 3MI7X 4Z0UA 3D0IE 1S6PB 5DLFA 1QJHA 4ZTFA 4YFUA 2ZQBA 3IXQA 3S8SA 1VSFA 2PI4A 5MAOA 2VQEF 1PYTA 3SYZA 1VBYA 1TAQA 2QA4N 4CIGA 1ITPA 4DR2J 1C4AA 3BV8A 4RPFA 5T41A 3AVFA 5HN0A 2DNYA 2JZ5A 1NGDA 3AD7C 1S10A 3N9UC 3WXLA 1EQYA 3T5KA 3RUBL 1GXLA 3GIIA 5D0EA 1EETB 2CNNB 2YKMA 4QAGA 3VEZA 1YJRA 1VFJA 1VBKA 1JL1A 1EZZB 2KKZA 1YVNA 4XIUA 4CHYA 3OXFA 4W98A 5HP1B 4WFBQ 2CQDA 2C2RA 1BD6A 1B9DA 2B8PA 4J9RA 1C6VA 4H0TB 4XH1A 3MM9A 4DL5A 4BE0A 2QI2A 1HR0F 1L3VA 2DGWA 2NXJA 2V52B 4KBIA 4F0MA 2QMUB 2P9LA 4N8NA 4LF7K 1APSA 2AJ1A 4ANEA 3I0SA 4DCPB 5KFHA 4DPTA 4HWIA 3E66A 5EX5A 3P3DA 3SCJE 3C95A 1PKUA 4P9SA 2V7ZA 1HQUA 1ULRA 1AFJA 1QE1B 3K5NA 1R0CB 5EX0A 2DNLA 3UE2A 1M5VC 4DF8A 4ZP6A 5J2PA 4XEIA 2HRTA 4RWXA 4Q5VA 1LCUA 3MR2A 2ZJQQ 1SJ1A 2HZCA 2A0FB 2BQ3A 4K50A 1VISA 1SUQB 2XWYA 2Q0UA 4F0HA 3MD3A 4CJ4A 3M6XA 1S1UA 3WX8A 3GJRB 2ZNYA 2ZDPA 4FWMA 4AQYF 3OYHA 3M6VA 5JLFA 1S1TA 2BM1A 4I6AA 1CLFA 2JEFA 3VQDA 4NLOA 1V3ZA 2CQGA 4RR5A 1T6CA 3GIKA 1KVIA 3TANA 2Q79A 3G71S 1NGJA 4OGEA 3OW2R 1RFQA 2YKPA 1YBUA 4M7XA 2BUNA 2VG7A 1VK3A 1MWMA 2HWIA 3ISZA 5KQ8A 1L3KA 4CQ1A 4K5RA 5IM0B 3E01B 1UVJA 1J2VA 3P5TL 2BE2B 4QW9A 3N4WA 1HNWF 2I8EA 2KVIA 5IXUA 2AF6A 2DFHA 2FD2A 2AYMA 4DDFA 1RKJA 3VF2A 4B8AB 2PEBA 1REVB 1FRJA 5AFUA 2OAUA 3AVBA 4G3IA 5LSRA 1JLBB 5BJRA 3ZSWA 3J7YI 1UAXA 3BYPA 1SQFA 3V6KA 2ASLA 4CFDA 2PY5A 2DXDA 3FZLA 2GIRA 2E6LA 3DRSB 4BCAA 4HTLA 2JLGA 3H46O 1KQSM 3NGYA 5D0RA 4Y2KA 4K8ZA 5ETRA 1AXQA 1FO1A 3UD4P 4DPOA 2WBNA 1YVUA 3PKMA 2JVOA 4N7TA 4FWPA 4B9NA 4IRKA 2J8SA 2MEWA 1MMDA 4FLXA 5BRFA 1HD1A 3VPZA 4FNIA 3OYDA 2BMBA 4QWDA 1S9GB 2XNQA 2B4OA 2WBRA 3TRGA 1SC6A 2I1RA 4B8CA 3C14B 1Q86T 1ZBIA 3HP9A 4Z4HA 3TTFA 3HO1A 2Q31A 4C3LA 4CJTA 1SKWA 4WFNL 4EFAC 4FK2A 4JV2A 4WE1B 4Z7CA 3EDRB 2CZ4A 2J8AA 1C0UA 1RWVB 1DZ5A 3H6EA 1TL1B 2EX3A 2C2NA 3OBYA 3ID6A 3J80Y 4B3MK 4CE9A 3U4LA 3H42A 3VQAA 2ZBCA 3WQPA 4DPUA 4DSFA 3DNCA 2E8AA 1IWGA 3VF4A 4AL5A 4RZRA 3UFCX 2F4VK 3TA0A 1PYSB 4ZVFA 1Y5NB 1EP4A 1MN7A 4F02A 2PA3A 1KTVA 2DJWA 3U9DA 2LQ9A 3M7VA 3K17A 4M5DA 2HQGA 2XHBA 1S72N 5D6GA 2PYJA 1KR4A 1XMQF 3I6PA 2C28A 4USTA 3M9OB 3CJ4A 4DR3J 2FJEB 5E41A 2BKPA 2ITMA 3CCEN 2O67A 4CT8A 3GSDA 3UDCA 1SH0A 2DHSA 2BRLA 2LCWA 2Y0BB 3Q23A 2A1RA 2CQHA 5E7OB 2QFIA 5EWEA 1BWEA 2AEFA 4ZPBA 3MGJA 4TXSA 3NNHA 4IKFA 1TL3A 2RD5C 3KWGA 4A57A 3C94A 2BQUA 2YHBA 3UCZP 1NJIO 2RNEA 1O51A 1B0PA 3W9JA 3M8QA 1AZSB 1ILYA 1JLAA 2N82B 3JTNA 3M8RA 2EK1A 3LGHA 2XY6A 3IS9A 4IOBA 4DUZF 7AT1B 1NJWA 5KGWA 1NPRA 4OJGA 3NNAA 3NGZA 2C2KB 1YZ6A 3I9V9 2VQFF 1FK9B 4HEA9 4IQMA 2OPQA 4URSA 5LMUJ 5CYQB 1UMJA 1QTMA 1R27B 4QOZB 4ECSA 3CB4A 1GMVA 4DMNA 3RBXA 3RAQA 4NO7A 1VHIA 1E6YB 1PAEX 4QWBA 3GL1A 1VK0A 2R7UA 3N4QA 3HHKA 3SPZA 1HNIA 2CG8A 4N56A 3CCJS 2XZWA 4FVUA 3W65A 1O0PA 3CHWA 4B1VA 3KK3B 4WFXA 2GHPA 2ASOA 1YIJS 2DRBA 4JV0A 2RQ4A 4DV7F 1IXKA 3FGUA 3L4BC 3AA3A 3PRDA 3NGRA 1T03B 2H54B 4KHUA 4ANCA 1LK7A 3ZTRA 4X62K 3OUYA 2V94A 2XCPA 2DT9A 2AP1A 1HR0K 1KNZA 1UWBA 4WJBA 3PRBA 4XO0A 4DR5K 3H3OB 1TR0A 3VAJA 4DQQA 5JVGQ 4BG8A 4KRFA 4ID8A 1G7CB 5JMNA 1MWZA 4NEZA 1W9HA 1NWKA 3EE9A 1OKJA 3QT5A 4C8YA 1Q79A 1UKUA 3I5BA 3RW6A 2J0WA 2QTWA 4MIAA 4DR2F 4OYXA 4YDDB 3AAPA 3NWGA 2FIUA 2KFYA 4YHHF 2MZRA 4AXIA 1FNXH 2LFVA 3ZZ0A 2KFNA 2M4MA 1YTYA 1HLUA 5LM7E 3EDQB 2ATQA 1WOSA 4ZITA 4DLEA 2I0XA 2QA4S 1RT7A 2R8KA 1Y5LB 4PR6A 3MTJA 3CULA 2W25A 1KQSR 3RBDA 3QEWA 1FVSA 1B3TA 2NLXA 3KK2A 2HS3A 2DITA 2W41A 4UZBA 3SQGA 1B99A 4BGAA 3A13A 3NH1A 2NXNA 1GTEA 2CJBA 3BYRA 3M9NB 3U1NA 4IG0B 1RAJA 2MY7A 3QLHA 1HKGA 2LDIA 1WDDA 4QR0A 1WI6A 3BDPA 3QB0A 4JHDB 1XWLA 4ANDA 2QWNA 2A6MA 1LXJA 1SIZA 2ZM6F 4BR0A 1FFSB 4IJNA 1CEZA 1RISA 4WQ4C 1YJ9S 4KC5A 1XC9A 4LQ9A 1YGYA 3HHEA 3MAAB 3UN3A 1TUYA 3DM2A 4Y2IA 1QQNA 1F9EB 4BC9A 2XHCA 1RWKB 5HJXA 5DDPC 4AFFA 2ZZMA 4UT4A 5J1NA 2GELA 4U8VA 5AQNA 1Y97A 2JOQA 4OLOA 1WEXA 2GO9A 1T9UA 3D2WA 3HK2A 1IBMJ 3ZETB 2GEMA 1FTRA 3CVKA 4DV4K 3MEGA 3DOMB 2ZHOA 3H5YA 3W61A 1FW6A 4KREA 3M2UA 2E88A 3A8JA 3OR1A 3O44A 4RL1A 1QLNA 2RDDA 1RE1B 2W7PA 1QHAA 3IR5B 3AB2B 1IBKF 1X3MA 1HA1A 5J1EB 3ATUA 3EY1A 4IFYA 3CIZA 4ED8A 2B3TB 1RXOB 2ZD1A 2NYIA 3CPWR 1VC0A 4A8XA 2FY1A 1BY9A 4Q45A 5L9XA 1T8EA 3V5RA 3AO5A 2G4BA 3K8VA 4Y28C 1TQLA 4R0EA 4FLVA 2ASDA 2CQ4A 4K4WA 2J6SA 3OHRA 1QM9A 3T9ZA 1EWRA 4IO1A 3S3MA 2RF2B 4DPWA 2BW2A 1DBDA 3K8WA 4IBNA 3HI0A 1YAGA 4KFBA 3KWIA 3GV7B 4YR3A 3DJCA 4ECYA 3E1YA 3ZO7A 4WPAA 4NLXA 5KG3A 1SS6A 1IKXA 1XR5A 1TL7B 2BRKA 1JCFA 3L7PA 3N6MA 3HT0A 4ID5A 4PUOB 4WU3A 4CLTA 3LW5C 1HHTP 3I55N 3AV9A 4NLSA 3D54A 1D8ZA 3FBCA 2B9EA 3SSRA 4RW9A 1GAOA 3T7ZA 3TUPA 2M3DA 3U02A 3AB4B 4YY3J 5I3PA 1RUSA 2JC1A 3VZHA 2B9WA 4CO5A 2HZAA 3AOAA 4WZQA 2G0JA 1J5OB 1HMVA 4B17A 2E6MA 1MMLA 3D0HE 4CHPA 2E7VA 1DTTA 4J9NA 3NMUA 2DEJA 3IAS9 2JFDA 4CLLA 2YKMB 4M41A 4F2RA 1KCFA 2GW8A 4ID1A 3GJQB 4DSIA 2ABYA 1WBDA 3A1YG 1NCLA 3SQ0A 3NGIA 4P73A 3U1MA 2HURA 2R7QA 3QFHA 3FZ2A 3IP0A 3ENVA 4ZA1A 2KT3A 4Y34A 4DR3F 3KMQA 4RJVA 4BBYA 1X9SA 2AEMA 4USKA 4LVOP 3BPDA 3HHLC 1JLGA 3I0SB 2K3KA 4UUXA 2W4PA 4PHTX 3CEDA 1RT6B 2PO4A 3RW7A 3SSSA 3KLHB 1NXIA 2E5IA 3VA3A 2FUG9 2GWKA 1S72S 4GO5X 2FB0A 2Q1LA 4ZIVA 5IQQA 1QAIA 1XBWA 3CCZA 4I2PA 1GLLO 1FI4A 1RU2A 1TZ0A 5J2PB 3AVJA 2PEHA 2CA9A 4LRBA 2HRUA 3VQ5A 3CCES 3GILA 4KHRA 2NCKL 2ERRA 3Q24A 3GB0A 4YS2A 4WQ5C 2A2CA 3A8YA 1S1UB 1JJ2M 4IEIA 3N5BA 1FVQA 1GQEA 1BUXA 2B9YA 3LAKA 4I6YA 3LO3A 4Y1CA 1S1TB 4LVNP 4ES3A 1A9NB 5LMUF 3B82A 1GLJO 3RAXA 1BU6O 3OSNA 4PRFA 2HHWA 2DR5A 4YHHK 3VAKA 4JI7K 1NH8A 1WNSA 2Z1JA 4BS2A 3P4UB 4DBQA 5LJWA 3KLGA 4EYHB 4E1MA 1RABB 2E2NA 1GLBG 5HL7L 2FZCB 4MO5A 5K8OA 4YEAA 4CTAB 1NEEA 1MU2A 1SB6A 2QMWA 3OBIA 2O8CA 2FJAB 3C16A 3QEXA 1HQEA 2UUAF 3V9ZA 4G65A 1HNVB 3CCLN 4RW4A 1KS2A 4B9QA 4O3PA 2N4DA 3KJNB 4TQSA 3N79A 3TZYA 2HBRB 4KB0A 4LQ3A 4TSXA 3UD3P 4IRDA 1FD2A 5KFTA 5I3UA 3C19A 3KG1A 5AE1A 4DV4J 3OLAA 4I7FA 3R2CJ 2CZ9A 1ZAVA 1JXEA 1HWUA 3NNCA 4IJAA 3IBWA 1RDRA 4OX6A 3PTWA 1BHNA 4K25A 2E9TA 4I6WA 5AQJA 4P2MA 4CBXA 4AF1A 5A0YA 4DSKA 4HKQA 3DRPA 3QFUA 1N32K 1W25A 2V69A 1M0SA 1M5KC 2EI5A 3I33A 4W4MA 4QIVA 2HBLA 2FLNA 3OVNA 2I9SA 3MMBA 1VS3A 4I2QB 2NRZA 4IOXA 2YPYA 2OPPB 4ELTA 1U1MA 3Q8PB 4Z4CA 1O6XA 1V6HA 1RP5A 2LXIA 2YTCA 4P52A 2V2QA 4MDAA 4YOUA 2W8KA 5ITHA 4WQ4A 1HWJA 1JXLA 4YR2A 3LP3A 2X7IA 4GVEA 4Z4FA 4DL7A 3UQSA 3U1LA 3CD5A 5B09A 3MM8B 3PYEA 4X4NA 5DM7Q 3H4BA 2H48B 1WAJA 2ZUAA 4WCEQ 1C0TA 3PW0A 4O55A 4JI4J 1T11A 2HRYA 2JVRA 1Q82T 2ZWHA 3TSPA 2VFRA 2XEXA 1GEHA 4IDHA 4CI6A 2CPIA 1IR0A 2EFVA 4FW2A 4M5DB 1IBLF 2YKQA 2MGZB 2P9SA 3OYFA 1WKLA 3JTPA 4F8RA 4OX8A 1RT1B 4LFCJ 3QRPA 2DNKA 4Y3CA 4ELUA 3PVXA 4HHTA 6AT1B 4UF4A 3AJ1A 3HSDA 3CI5A 1U4BA 4H4OB 1N33K 5HQ8A 3LDSA 3KJVA 3C66A 1IBMF 1T9XA 3NCIA 3TWHA 2CQBA 4TY8B 2OPSA 4KHPJ 2YWHA 1PJ6A 3TR8A 4AHVA 3JAMU 1HNXJ 3H40A 3UIQA 4KO0A 3CD6N 2AZ3A 5D3GB 2R8GA 2MZSA 5DG8A 3VEVA 3J7YP 1WLJA 5CA5A 3NP5A 5I4MA 1BDGA 3ZXWA 4CEDA 3CQXA 2HQIA 2YNHA 3BKFA 4ECZA 3OTOK 3K57A 2E9ZA 2QL7B 4W90B 4JV5K 2DPIA 3ZZOA 1JX4A 1WOQA 5K14B 4NA3A 1WORA 4RW8A 3CXCR 4LF6J 3BJYA 4MAKA 4K8XA 5E0OA 2OPQB 2MZTA 2CIMA 3TZZA 3MCNA 5A8RA 1YWXA 3MMCB 4OFZA 1HW8A 1RI7A 3LDOA 4CF8A 3OS1A 1LWFB 4FO0A 2W24A 5AJ3K 4FW1A 4E7HA 1NOYA 1JJ2R 2VJUA 1V4TA 3BGOP 3MMAA 2HBJA 3VR1A 3MM5B 3THPA 4K0KK 2YHXA 1KFDA 3O6QA 2HHTA 1RBVA 2XTJP 4KGMA 1WG1A 2PI5A 4ERDA 3CCVN 5C10A 4ZS6A 3V6HA 3OUYB 3IFRA 2JLFA 3MWPA 2ZDOA 4DI6A 5ETNA 4C0OC 2V4QA 1Q81T 1LAWA 4KH5A 3HJVA 1Z25A 4H0YB 1J54A 4CEOA 2PE8A 2NXEA 2Z57B 4K43A 3SLCA 4CHNA 4DV1F 1HBMA 4YOYA 3PFOA 1NUEA 2KZZA 3PG9A 3IA0A 3SEOA 4YY3F 2VDIA 3L8BA 1LQ9A 3KIOA 1N88A 2V68A 3I4PA 1RDCA 3I55S 3OL8A 2MQLA 3PJ9A 1P8ZA 2XRIA 2MZ1A 5HATA 3ZSOA 3I8DA 5JVHQ 3AY0A 1I5OB 1M1HA 3OL6A 3OFEA 4C6AA 3HHLA 1RT7B 2DGXA 3OHAA 3HXMA 1CJKA 4N77A 1UA0A 3GU0A 2RMLA 5HMWA 1ROFA 4J9QA 2E1YA 1S9FA 3S41A 4A8YA 3AA9A 3TX0A 4X66K 3ELHA 3QNOA 3KK2B 3S9HA 5BR8F 2DO0A 4KB1A 4ED4A 4OPJA 3SQGB 2KDOA 3UN5A 2QWRA 4WK3A 2AV5A 3QLHB 2XC9A 2V5HG 3K5LA 2HSTA 2HVIA 1QSLA 4NASA 2N7CA 2CQ0A 4ILLA 2G13A 4WQ5A 4C8MA 4CVNE 3W5ZA 3OTDA 2HZVA 4A8MP 1LOUA 1RDDA 3VN5A 2ZJQL 3QBCA 2L41A 2UUAK 3BKTA 5AXKA 4L72B 2G2OA 5AQPA 1YT3A 2PMHA 3SV3A 3MPUB 3C46A 4ILHA 4B02A 3IDHA 4CH1A 1X1PA 4EHUA 1FRHA 5ADXA 3W2WA 1TMJA 1IUJA 2GIQA 3KVGA 2QL9B 4J9LA 4W5QA 4DV2J 1Z2ZA 4CK2A 4CIEA 4YOVA 3RBZA 1I3OB 2XY7A 5J2NB 3MEGB 1Q7YT 3FNNA 3O3FA 2M8HA 4CBWA 2F3JA 3M2UB 5LL6d 1G4CA 3HSCA 4LY7A 2A3JA 3OR1B 5D0HA 1MLAA 1PJ5A 1T3NA 2RRNA 5K5MA 1C0FA 4IFYB 3WQUA 3MR5A 2EWHA 4OYBA 3MM6B 1KN6A 5D78A 4U67Q 4FLZA 1UP1A 4Z94A 2KXHA 1O5JA 3ZSXA 3HM8A 3AA5X 2E5JA 4Y6IA 4O4GA 3UR3C 1KWMA 3ENHA 1C1CA 3SAFA 4WXWA 3H5UA 5KFMA 3LDNA 3CDEA 3PKYA 1YLXA 1BI4A 4PWDA 1OQ3A 4EBCA 1ZPWX 1VQ7N 3R3LA 1OPZA 4WKYA 4KFBB 2P6SA 3X1LB 2X78A 1T7PA 3CCLS 4IRCA 3J7ZO 1VQ4S 1FKPB 2ASMA 1SAZA 4DPXA 2Z1GA 3RWUA 5CYJA 5HMZA 3H98A 5AFUH 2J7WA 1IBLK 3MHYA 4FJNA 4CJRA 3GIRA 4ID5B 2CADA 2UXBK 3MDQA 1H72C 4CJQA 1RNHA 1HPZB 4RW9B 3G0ZA 5BPNA 1D9AA 2LXFA 4LSNB 1LK5A 1VSLA 2KU7A 1VQLN 3GE9A 2N3OA 3JAMY 4CJ7A 4DV5K 4PY5A 4FM1A 3HHNB 1BE4A 3QDKA 3GYNA 1KHVA 2V50A 2HW3A 1EARA 1JL2A 5AJ3J 1VC5A 1K6YA 4ED1A 4CH7A 3NCRA 3CF5L 3JXUA 5K8NA 3VTHA 2GO8A 2OELA 4B3OA 3GFHA 2Z30B 3DYAB 1XUPO 1DTTB 1MA9B 4NZ7A 3KG4A 3O8WA 5AQQA 1EWQA 1NGHA 2M70A 1UVMA 2JDJA 2HMPA 1N36K 2OHDA 2MJNA 4XDDA 2JFKA 3HJFA 2O8EA 4BY9C 3I87A 3M3ZA 1HKAA 2A6AA 4NRTA 4TU8A 3PR4A 2XO7A 3PW4A 3FFIA 4DQ8A 1W7AA 4OX9F 2P5VA 2VWJA 4OYPA 1UZHA 2OO4A 4ZVRB 4LFCF 1ZM9A 4NLWA 5DQHA 2FBXA 3C0BA 3AGRA 2R2UA 2QSFA 4KQZA 5HK4A 4DCJB 3O9QA 3H7HB 2CPDA 3AGKA 3HOSA 4DSJA 1U1KA 1NHVA 3MMVA 2QG9B 4KHPF 3ZX0A 2B4VA 2E2QA 4L6V3 3HHLD 4U9RA 2M7SA 4PL8A 4HHUA 2QYGA 2HHHK 4WYBA 5DLGA 3OYLA 4ZCLA 4X64K 4CZMA 2WOMA 4E7JA 2DPNA 2EK6A 5IT9O 2V8DA 3HPGA 4FWRA 4NXMJ 1K73O 4OPHA 4DV1K 1SJ3P 1FFGB 4CIOA 3OSPA 4PG7A 1WSHA 3N01A 2YNGA 3CGIA 4F3TA 4Z4GA 2AU0A 1ASVA 3CD6S 1RDAA 3VAMA 3K89A 1SJRA 4QZVB 5DO2A 3V6DA 1RAGB 2DB1A 1KVCA 4HYKA 3TUZC 4K4ZA 3KLGB 1UETA 3O3LA 2DY4A 1YI2N 4F25A 2RQCA 2IJFA 1WF1A 2NREA 4J2DA 2RKIB 1TKDA 1VSKA 1NGGA 3U7JA 1N48A 1I51B 1TUUA 2LMIA 2O8CB 4CZLA 3LQVA 1P6TA 5EWFA 2P8IA 5BR8K 3MWTA 4RW4B 4DQRA 1DQ8A 5SUHA 5JVGL 3IMQJ 1QY7A 4I67A 2XSJA 1UVIA 2V51B 1NB7A 4K4TA 3SXLA 4KAIA 4CO0A 1V5IB 2NRVA 1KAYA 1X4EA 2QFJA 4DU7A 5KFIA 5IV3A 2UZAA 3VAIA 3HKWA 3LH2S 4C8LA 1TKXA 2HGLA 5T7LA 3GZ7A 3CJ1A 1UEUA 2J7UA 2V2KA 3F5TA 5B0GA 1OYDA 5AXNA 1A5VA 2R7XA 1JJ4A 1TTHB 2NR0A 3IC1A 2NZTA 3VQBA 3SZ2A 2FQQB 1NK0A 2CQIA 1OVYA 2PT0A 4LC9B 1MWYA 4LFBJ 2KT5A 1EKEA 2Y1RI 5L1KA 4HT5A 1VHXA 2P9IA 2ZE2A 2IM1A 4NLUA 2ZH2A 4KGKA 1AFIA 1JKHB 3SBMA 3QAEA 5KFOA 4JAXA 2L9NA 4GVBA 3DLGA 3HFVA 4TU7A 1X4HA 2CXEA 3KLFA 4CJKA 4FZZA 3BREA 1UPPA 2EWSA 3HVTB 1WD6A 1YHQS 4FM0A 2CRLA 3G6XA 1WHWA 2HNZA 2VBXA 4NYZA 4CJ5A 4DR1K 2ZJPQ 4ZN1A 3MXJA 3R6GB 3DXMA 2BR0A 3ENAA 1BUPA 2PC6A 2E1ZA 5CHCB 1T94A 3BO3A 3MOZA 4QOTA 3NRBA 1VQMN 2E1MC 3IRXA 2X1GA 4HVJA 1DEJA 4A8FA 4GC6A 4LH5A 1TV6A 4UY8O 4HVZA 4DV2F 5AQLA 4C48A 4CNZA 1KLMB 1SJ4P 3KJVB 3TX8A 1FNOA 1NDCA 3Q8QB 3LM9A 3W64A 3S7RA 1HWIA 4QIWD 2OPSB 2FBTA 2WFBA 3D1HA 1NU4A 3TVKA 3BEGB 1HBNA 3OFHA 2CJXB 4O4RA 4KO0B 1ZTTA 2JL9A 3A3NB 4YOWA 3ILLA 2HB5A 3OYNA 3NDKA 3HPOA 5I3QA 2ILYA 4OYAA 3L6QA 4RX6A 3WEEA 4FPIA 4ZPCA 3CJBA 3A12A 8RUCA 1M1KT 1S48A 3UDLA 2K7KA 2RILA 3H3NO 1GX6A 1D1UA 2DHXA 3POTA 3PO5A 3AARA 3GG1A 4NXNJ 4P7TA 3VAGA 4EFHA 4IG3A 3B4DA 2AT1B 5HLFA 4QIFA 1XHZA 4YR0A 4JI5J 1I1GA 2O5DA 3SIPB 1IJJA 2ZZNA 3MN7A 4C4WA 3AOBA 1HBOB 4DV0J 2BABA 2O4GA 1NBEB 3PACA 3HVAA 3OYAA 3PYGA 3M8YA 1SL2A 5AQOA 5EU7A 4CH0S 2HFUA 3BO4A 1SQKA 2IA6A 2QLXA 3LAMA 2UUCK 2O8FB 3F56A 4OX9K 4DB3A 3IKMA 3VMFB 3FQLA 1Y11A 3UB5A 1K8AO 2MYFA 2O1PA 2YX7A 3OVAA 1VQ7S 2KG0A 1U6FA 3VZIA 3OBWA 1U0HA 2OTJS 2F9JA 1E6VA 1IR2A 4GKJJ 1HWKA 1P9YA 2WVDA 3IBFB 2D9PA 4X65F 4FF4A 4LBIA 2PMZD 4EBDA 2AGOA 2W9CA 2FBYA 5AXLA 1UJ4A 4NI2A 1U1OA 1HHQA 4BQZA 4PA1A 1K44A 4DTMA 3AT1B 3FJ2A 1ZBLA 2FVQA 4WYWA 2CPEA 2GV9A 1VQLS 3L95X 3VGUA 4JYAK 3ZYYX 4PG5A 2VPWB 1YJTA 1X3NA 3BBFA 1VIXA 4C1NI 4GVMA 2G9OA 1XNRF 4LF2A 1JLQA 3T5HA 1M90O 2HBQB 1NNDA 4DR6J 1VQ8N 3DCAA 1LAVA 1QVGM 3P6YC 2EKYA 2DNNA 2F8HA 2UYTA 4NYFA 1Q9XA 1QS4A 3FK4A 1U2RA 4DSEA 1YDLA 3TAFA 2J4RA 2EFNA 2O01C 4Y2MA 5CZ1A 4DU3A 1S1VB 1KEKA 1WJ9A 4W92B 2MQMA 1FWPA 2F96A 1WSRA 5DMRA 4JNEA 3I4HX 4NLRA 1OVQA 3DKDA 4USMA 3FCHA 2UUWA 2E1RA 2KXFA 3ZX2A 2XLIA 5ETSA 2B9XA 4B3TJ 3K5MA 3LL3A 3D28A 4A59A 1Z05A 4NXMF 3RR7A 3J7Z5 4M45A 3CERA 5DG7A 1RT4B 3O9SA 4CD3A 5FPMA 3H8YA 4RNMA 4FOEA 2FBVA 4EO6A 2QX0A 2FF3B 4CO3A 1Y5IB 3FRYA 2B6AB 1SKSA 1JLCA 3NS7B 4YUDA 1IKWA 1ICEB 3T6BA 2IIRA 2QK9A 2HS4A 2QLJB 4PG4A 4QBUA 4AHTA 1VQ9N 2NQPA 5A6WA 4QR1A 4H5NA 4CGFA 2HBZB 5CCMA 4JS5A 1YRUA 4FK0A 5BYQA 2B0GA 4RW6B 1UPMB 1MSWD 2FY8A 5L46A 1UJ5A 1RSCA 1YITN 1XI1A 4CF2A 2R7OA 2HAIA 2UVRA 4G1QB 4TYBA 3VQCA 1D8YA 4HR2A 2IAJB 3NCPA 4ILMA 3H2LA 4O4GB 4QU7A 2DNHA 3US5A 1VQNN 2HLUA 1C1CB 2CKWA 2IGIA 2PA8D 4JI6F 1JK9B 1S49A 3K2PA 1W2IA 4JI1K 4TQRA 4DR4K 1LW2A 1OY9A 5F0XA 1YTAA 3EZOA 2EFGA 1AYEA 3T1HJ 3HM9A 4E1NA 1M5SA 4DL2A 2FJBB 1U04A 1GLEG 3MF5A 4OHWA 1RCOB 3KKFA 3VQSA 3UCGA 4LFBF 2R8IA 5D8HB 3CETA 5HAOA 5DQGA 2YQ0A 2DGOA 3SAGA 4EU0A 2Q2RA 2VPYB 1NMEB 3EMTA 1WKKA 1J53A 2XULA 1VQ5S 4DFMA 4W5TA 4EZ6A 3L4IA 4DQPA 2XI2A 2WUSA 4BRQA 2KB2A 2Y1IA 3RSEA 3FZKA 2P9PA 5KFQA 4ISEA 4O8UA 4YB5A 1VJQA 1SBRA 4E7LA 1TVRB 2RRBA 1Y10A 2KM8C 3GMGA 4S0MA 4E7IA 4BDYA 2E5LJ 3O1WA 3MDFA 1Q4RA 3DC2A 1NGFA 2O8EB 1I39A 5JJBA 4JI3J 1EKSA 2D74B 2EXUA 2A18A 3WNGA 3EPIA 4CERA 1AUSL 3W7BA 4ED3A 2C2EA 4PYDA 2MB0B 2XS2A 1EXQA 2DHAA 1ZS6A 4E0DA 1RTHA 2AGPA 3AJ2A 3FBBA 2D1KA 4NX9A 4CFBA 3TU5A 3GV5B 1OPIA 3L9ZA 3AOCA 1URRA 3MMJA 1FCAA 1FXLA 2QMXA 3ET6B 3DLHA 3SQ4A 1IM6A 1S6PA 2GX8A 3J81Y 3WNHA 3FBFA 4A48A 2YWGA 1LWXA 1M5PC 1WWHA 2FZKB 5JXSA 4BLGA 4NMLA 2DRDA 3GSIA 2KKHA 2E5HA 3CD7A 2UXCF 5LMNJ 1VQMS 4I56A 1MDUB 1QVGR 4DG1B 3TOQA 2ZH1A 1PILA 3MURP 3C2PA 5GAEU 3RZAA 4X4PA 4QPTA 2WOMB 1S6OA 3OYJA 5KFZA 2CVEA 1EETA 2GZOA 1RAAB 1XNQJ 3THWB 2DRAA 3TZXA 3EZUA 4X65K 3Q22A 4NXNF 3V9SA 4L3QA 3CDWA 5EVZA 1X4DA 1KAXA 3V6DB 3O5TB 2YJFA 2CNKB 1ZA2B 4CJEA 1Q53A 4DV0F 2BJ8A 2ATCB 4K4VA 4OGCA 5KT3A 3NAEA 3EE8A 1N5VA 2E1CA 3HZGA 3WDOA 4GC7A 3MN5A 1XNRK 3PIPL 5CR4A 1WB9A 2HIYA 1QAJA 4FJHA 5M2RA 4RNNA 3DLLL 1QE1A 4ED2A 2VODA 4CFCA 2UV8G 1BGXT 2RQKA 1R8BA 2HBYB 3T1YJ 1Q86O 2KW4A 1LKZA 2FJXA 2IM0A 2BXJA 3LPYA 1WOOA 4AXJA 4BRCA 1WBBA 4WFAQ 4QPXA 4LF8J 4QQBA 1H98A 4O3NA 3KDNA 2BJ3A 3OTBA 3PIOQ 1SUQA 3VA0A 3ZZYA 3CJ5A 3TWZA 4DZ6A 1TKXB 5B0EA 2JEJA 3ENQA 3TVYA 3GYGA 4FF1A 1CSJA 3NF6A 4A2BA 2QTDA 2OD6A 1XTZA 5K9FA 3X3UA 2ILZA 4ECXA 4CT9A 1K9MO 2HQFA 4QYZK 4AM6A 3VAFA 2PAVA 3AODA 4KYZA 2H4YB 4Y1DA 4CLYA 3QPIA 3P1GA 2LU2A 4LIWA 2ZE2B 1F5BA 1PYOB 1T9VA 4M3RA 1R6VA 2AJFE 3M6UA 3D7SB 2BKOA 2H65B 4FLYA 4DR6F 4Z4EA 1NRKA 2H5JB 2NUHA 2OMLA 3HULA 5I42A 2YHAA 5IM0A 3IR7B 3FE1A 3HBTA 2ADBA 2Q6BA 2M8DB 3J80O 4YDUC 2XZDB 2H3GX 2D3OR 1OMSA 3EICA 3MEEA 1JLBA 3LPUA 3ZSYA 4DU8A 4ECWA 1F5CA 3R7SB 5A2QU 4IOCQ 2HNZB 2WC9A 4DN9A 1S1WA 2KTQA 1VQ8S 4OYIA 4TY9A 2Z0GA 4ZVPB 1S59A 3DXMB 5A6PA 3M1VA 4ZVEA 3U3GA 3PSFA 1R0AB 4B3TF 2VFVA 4KV8A 4J9UE 6FD1A 1RJJA 5G0RA 4IZ9A 4C8ZA 5DZ6A 4JI6K 1S6QB 2D0PA 3RB4A 3R5JB 3VQTA 1YRXA 4FKXA 1N0VC 4IDKA 3KUGA 1I94J 2XBPA 4JI0J 1P9QC 1U02A 4PXBA 2B4JA 3C14A 2GWJA 5E84A 3NMAA 2HHSA 3QJLA 5BREA 3VHQA 3KKSA 4WE1A 2BJ9A 1NH7A 4JI8J 3WHIA 4LFAK 1MN9A 4FZVA 1YSJA 4YB1P 4A8SA 4LRFA 1TL1A 4CGDA 1FXRA 3CJRA 2EBEA 4A62A 1Z26A 3ULDA 2CVIA 2WTFA 3Q83A 1RWOB 3QO9B 3AVIA 4LF4K 4FJJA 4E2FB 3AD9C 1VQ9S 4YOXA 4IG3B 5HLFB 1VQ6N 3MEKA 1EKRA 3TAMB 1GLDG 3RB6A 2KO1A 3CJ3A 3TAPA 3W0LA 2ZKUA 3BSOA 2X3DA 2KFZA 2VOPA 1E3MA 1Q8BA 3A5MC 3W63A 4K8RA 1D5AA 4NLPA 1SQEA 4V19S 2DNGA 1GXTA 3JS9A 1IR1A 3WXJA 4P2SA 3IN5A 3HVRA 3BSCA 4F4ZA 1B9FA 4M5JA 4YOTA 1SIWB 4OI2A 1UJ6A 5AE2A 2Y0SD 2HF4A 4BRIA 3KLEB 5H9EK 3VEWA 3F2KA 5HVGA 1BCMA 2RDIA 3AVHA 1YX2A 2EPIA 1RHRB 1RHKB 1AZSA 1U0HB 3K9KA 1E6VB 2RB7A 4JKBA 1X4AA 1OO0B 3W8GA 5IQ6A 1XN9A 2P9UA 4DUYJ 4HI1A 3HYFA 3QYYA 4LF9J 2UXCK 3ZZUA 3PX4A 4NI2B 3DN9A 4LR8A 5CYQA 2J9CA 3CJQA 4DXLA 5GIOA 3KOAA 3LTOA 5KI6A 2E5LF 4JOUA 4GKKJ 4OZ2A 5AQHA 4OJ3A 2HHUA 3ATVA 1Q9YA 3KK3A 5D4LA 4CJVA 3WNFA 1NSPA 4A47A 3I31A 2WB4A 4PZVA 3DLBA 4K59A 1FRKA 2BQRA 4X4RA 3V4IA 2A5XA 1LWEA 1T03A 2ZGZA 2PZSA 5H1SV 2IY5B 2RUSA 4UOCA 4JBCA 3G8SA 2LA4A 3IWLA 2QEXN 4BR5A 4ZVHA 4DR7F 4CHQA 1U49A 4BR9A 1FJGF 4O3OA 3D6FB 5ETKA 1V9OA 4WU2A 1J5EK 3CM5A 1NB2A 3ZNJ1 1RTIA 3PLAA 2D7SA 2QA4G 2VPZB 2LEBA 4GRSA 2MKIA 3Q7CA 3QESA 1RA6A 2B56A 1OH8A 5KFDA 4FS2A 1P1TA 4KSEB 4PKDB 1QZ6A 2CPYA 5FIIA 3LWMA 1LFWA 3NS6A 3EEQA 4V19J 3D2FA 2NXUA 2G8IA 2F5GA 2MQOA 1Z6RA 1S4FA 1HNZJ 4JI2K 4BR4A 1DFDA 4BQLA 3RMDA 7FD1A 2YQ1A 1XNQF 2VONA 1EB0A 4A46A 1NGEA 3OHBA 3A4TA 3DLEB 3V6JA 3FCVA 1VQON 2MKSA 3LDQA 1OSCA 2XSFA 3BH6B 1CC8A 3AA2A 1S3XA 3KHYA 4M1KA 2IDOA 1RHJB 4NB4A 3ZTSA 3JSMA 3GFXA 3WIUA 2VFUA 4DTRA 3DRYA 2J7KA 1NAQA 4J5OA 3H1QA 3U27A 3SMPA 1ZXOA 1O8BA 2C2OB 3FMWA 4ETZA 4FSVA 3BGRB 1K47A 1HI0P 4RO0A 2D0OA 4KGXB 3T1YF 3MAAA 5F8MA 4CLUA 1BOTO 2PBDA 4DEZA 1WSIA 4WFZA 4PKHA 1ZOTA 3D0GE 5A2QY 1CC7A 2IFXA 1ZM4A 3CG7A 4LF8F 4USJC 2VG5B 3NAHA 3MCSA 3CJKA 2FXUA 1DY3A 1IN0A 5C2GA 5KFUA 1UA1A 1QTNB 3R5AA 1LW2B 1VHFA 2BBEA 3TEHB 1W97L 1UFLA 4LBPA 3EYZA 2DHHA 1B7FA 4RKUC 3ZETA 3TW0A 3BSAA 2P9NB 2DNZA 4FJ8A 5C0YA 2PYLA 4YDUA 1RDBA 2MKKA 1VSMA 3PW2A 1K0VA 2VPXB 2NPFA 5IV4A 3CQ8A 4KH0B 2GX9A 3BH7B 4PCQA 4KE5A 4H4KC 3QIOA 3VGLA 3OFGA 5L38A 4QS8A 4IEEA 4FL9A 1YIJN 4AHUA 3UNGC 3RSEB 3FZMA 2FC8A 2K1RB 3OYEA 1SL1A 4ZPWR 1TK0A 2XNRA 4BVOA 1S0MA 1JMTA 3IO1A 2GGPA 4B3SK 5FDLB 2C22A 4L3NA 4HACB 2BOAA 2ZJRL 4BWMA 2RF2A 1WOPA 3CFRA 3C15B 3KUHA 2KRBA 2FPHX 3E3XA 4ZVTB 2NRRA 3BR8A 1S97A 2DO4A 4DU1A 3DGVA 3NH2A 4DF4A 3ZEUB 3NMRA 4PYAA 2V4JA 3ETOA 1K1QA 4RNOA 1TL7A 4UOFA 3GV8B 2A3ZA 2QKBA 4B3RJ 5AR0A 4JI0F 3ZFVA 1Q8KA 5KFCA 1P1LA 4ZLPA 1FXDA 4HDGA 1KQKA 3RVCA 2UUBK 4X4QA 1PG5B 1ZC6A 5CYMB 3TNVA 1GNKA 4LIRA 3F9KA 3LGMA 1F9HA 5F8LA 4JI8F 4F3QA 4NA1A 3OL7A 3LDPA 2MKYA 4F67A 4PL7A 1N56A 1J5OA 1NSKL 2HF3A 2ITGA 2QWQA 2YWEA 4CO1A 4DL0C 2RJZA 3TJ8A 4NMXA 4FDFA 4EK2A 1RGVA 4EUVA 1WSGA 2Z1HA 5KOWA 4MKBA 3TA1A 1XMOK 1D4XA 2ALYB 5FJ4A 3WXMB 2VKRA 5A76A 5KG7A 2P9GA 3SMZA 3HFZB 4NZ6A 1YJ7A 1NJYA 2P5OA 5IC4B 1MW7A 4RBTA 2XB2D 4PKIA 3HDSA 1XR6A 4OHZA 2J9EA 3J7AN 4BC5A 2OZMA 1QHTA 3O5BA 4NLVA 1YJ9N 4DV3F 4MDBA 3PJWA 3U3YA 3KHLA 3IG1B 2J5AA 2XS7A 1OIAA 2XS5A 4Q44A 4U7UD 2RHQB 4ER8A 3SSQA 2P9KB 4X4VA 1IBCB 1RT6A 3F0NA 5CHIA 1UAWA 3KLHA 1VQ6S 4ZP9A 2Q6CA 1RYSA 1NO8A 4FJKA 3MN6A 4O44A 5DG9A 2CJQA 4U7UK 4DR7K 2DNRA 1SJQA 4DN0A 1T3VA 1FJGK 5K20B 3GQCA 4RBUA 1PCAA 3DI6A 1NKCA 2DR8A 3HFKA 1H1VA 3ZTOA 2M5YA 3EM1A 4DV6K 3THYA 3TUIC 3FUYA 1U09A 3NBPB 2OPRA 2AIRB 1WF0A 1Q8LA 4C0HA 2HIQA 4ECUA 3K0SA 3H20A 2VDHA 2HNYA 4LF9F 3FGVA 2K8GA 1W26A 2W9BB 1Y00A 3W1YC 3G6EN 2DNMA 5K8PA 3Q7BA 2LU1A 2C3MA 3W5YA 1HQ2A 2BJ7A 4CLKA 3GFYA 3OVSA 5M1QA 4PQUA 4CK3A 3D6TB 4FPRA 4DTJA 2IDLA 5D0GA 1C4CA 3O3GA 2Z2ZA 5J2MB 1H7XA 3DOLB 1TK8A 4ZPTR 2HVHA 3NG8A 4CTAA 3P83D 2GVZA 2QYCA 4FJMA 5I42B 3AY9A 3PJXA 5F8JA 1NKEA 1HNVA 3N0VA 1SC4B 5F0UA 5IC6B 5EXWA 3NOCA 2QT7A 2UU9K 4NCAA 3MEEB 4USIA 1BWVA 1UWAA 2VA2A 3KXDA 2IRXA 4CGHA 4DTSA 5GAEI 2FSNA 3SCIE 1OQ6A 3MAQA 1CXQA 4M94A 4IUFA 1S1WB 1S9EA 2FHOB 2DK2A 3BO2A 4FZYA 2QEXS 1HWLA 3M1VB 3MEDB 4ZHRB 4KV8B 1FD8A 3PDNA 5G0RB 1HNZF 4YP3A 3DOKA 2Q36A 4ECVA 3DGPB 3VWSA 5FRMA 1HYZA 2V8GA 5E3QA 2P5GA 4IDKB 2W7OA 3Q8VA 4I2QA 1VRUB 2OPPA 1OY8A 1FF2A 2KN4A 3AO2A 2YPZA 4Y65A 4ED5A 3EJMA 4WFNQ 1NJXA 2WRMA 2COLA 1WG4A 1N34K 3VQ6A 3M8PA 2G8KA 2YV0X 4JD2B 3G9CA 3ZSRA 4NLQA 3MM8A 3T5LA 2Z58B 4CD1A 3LP0A 2JGUA 1X4GA 1VQOS 1U8SA 5AQGA 2W6KA 4IFEA 4M3YA 4AD6A 3PFEA 2H5IB 3IWNC 1FE0A 4ISGA 1RT2A 1JCGA 4FJ5A 1X4BA 2MGZA 5EDWA 2O8DB 3ZZRA 5HSPA 3GDQA 1RT1A 4HTIA 2ZHAA 3NEKA 3ZSQA 2V67A 3L2VA 3CPWM 4H4OA 2YX6A 1JJCB 1MROB 3W66A 1YJUA 2EKNA 2RUGA 4OJHA 4G1PA 2UXDK 2DTJA 5AZJA 2BM0A 2OMOA 4YMEA 4TY8A 5T14A 1RLCL 2YKNB 1R8HA 1HYSB 2MY8A 1GOBA 1F5AA 1GMUA 3VESA 2CQ3A 2XMUA 2NRWA 2J9DA 5SWMA 3WUHA 4LF5K 5HI7A 3GYXB 1FWLA 2GIFA 5D3GA 1J27A 3DLKA 3NY0A 2WSFC 2V7YA 5GAGU 1F2HA 2KM8B 4WKRA 3AVKA 3NGSA 3K59A 1P27B 1HKBA 2P9UB 1RLDA 5K14A 2VQEK 4E7KA 2MXYA 1RTDB 1DLOB 1CZBA 3MPVA 4EAHD 3PYFA 4EZ9A 5IWAF 2YBVA 4AT1B 4LUBA 3JTOA 5LSLA 4LF7J 4L74A 3MMCA 1VRTB 1LWFA 3IUCA 5JMVA 4MK7A 3L0QA 2XO6A 5AT1B 3P39A 4AE5A 2D9OA 1D9FA 2JWKA 4H0XB 4FYVB 2D0AA 3MM5A 3VTIA 3VQEA 2ACMA 4FJ7A 3V4IB 1AT1B 1LWEB 5D4PA 1I6JA 4M63C 1FT8A 3DDNA 4CJWA 3ITHB 4FF2A 4DV3K 3KLVA 3CYMA 1V5VA 4B3RF 3AXMA 1Q7YO 1RTIB 3AVCA 4CLZA 1ASWA 2DIUA 2GS8A 3GP9A 4MQ3A 3SQ2A 1VR6A 2ASYA 2WVFA 2Q1NA 4U7CA 3P38A 3RRKA 2UVWA 4BC4A 2CAJA 2YX4A 3J7ZT 1NLVA 4DX6A 1J9AA 3IM9A 2ZBPA 1T05A 3BBBA 2ACYA 4A8WA 4KHQA 5KFYA 4IOAL 3D2FB 3DHWC 1KHWA 4BWJA 4EHTA 2OA8A 2L08A 2XLJA 1FRLA 3M30A 1W2BR 1WSJA 4IXCA 1SPBP 4RBVA 3KNAA 5KRTA 2BDPA 3TJ9A 3U8XA 4USUA 2DEIA 3QZ7A 5JLHA 4H4MB 4AQYK 1B70B 2V9KA 4GV3A 3A0IX 4LR7A 1FKOB 2V9WA 1LW0B 1NBWA 2VBZA 4TKTA 3JSMB 1QQMA 4KHSA 4C8NA 4A8QA 2I38A 4H54A 3S3NA 5AZIB 1S99A 2YCHA 4IO8A 2RHKA 5KT4A 1UW4A 2VHGA 1ACMB 4BRPA 3CCQN 1XR7A 3QGHA 2ROGA 3HPHA 1GMWA 4IQXA 3SCXA 1X60A 4DCHA 1HNWK 3CQYA 4P7VA 4KGZB 2JEIA 1HI8A 3G8TA 5DETA 1BQMB 3LZIA 1BQXA 4K4XA 2IMOA 1TUWA 2VU5A 3CJKB 4BR2A 2JJ4D 5KT7A 3F9MA 2VKZG 2QZ8A 1EQMA 2KLAA 3WQTA 2XYPB 1VI7A 3R5DA 4MFBB 5J2NA 2GC8A 1S0OA 3GWCA 2R7TA 3R5BA 5EOYA 2NS1B 2QWMA 2I5JA 3F73A 4B3MJ 1MMNA 2GMLA 4HH0A 3W62A 1CS4B 2V34A 3QIPB 3CC7S 2F4VJ 5HQMA 4CYUB 3CJCA 3JAMO 1K73T 5CY4A 3LP1A 4CLPA 4DKWA 1FWKA 4B9VA 2R3VA 3G6ES 1ZPVA 3MM6A 3M4XA 4LBHA 4BRGA 4JB8B 2NPIA 4U95A 4DX5A 2ZUGA 5A8KA 4IOCL 2XY5A 2WBMA 1B0VA 3V81A 2QWPA 2GGPB 3CJ7A 4RU2A 2BVZA 3L3VA 1RQ0A 4EWTA 2HOEA 4HUGA 4J9MA 2ATLA 1XQSC 3O4QA 2WK4A 5IZHA 3BZQA 1H74A 1N5TA 1KVKA 2EBGA 1FKPA 4BRKA 4O8KA 4WBFA 2V4JB 2KHOA 3OPKA 1ZM3A 2DR6A 1QUVA 1XMQK 2E7XA 4ZCMA 1U1QA 1XIQA 2BANB 4KGVB 3CWJA 4ZOSA 4ETXA 3H0PA 1RBLA 2UUTA 1HPZA 1TKZA 1E4FT 2MZJA 4LSNA 5C2DA 5KFVA 4DL4A 3KFWX 2R8JA 5ETQA 4CEBA 1U26A 2FHJA 1SC3B 2F1FA 4OHXA 2YJEA 4ICLB 4Z4IA 2FC0A 2MLYA 4PAAA 5CCLA 3M2VB 2KG1A 2HQDA 3DYAA 3I9ZA 2QO3A 2E4LA 1JNRB 1Q5VA 3KD1E 1OS5A 4BHQA 2ZGYA 3CDAA 4TLRA 5CH7B 4FYYB 4RLEA 5KG0A 4HTUA 4GMJB 3DFEA 3PV8A 1RWXB 2H4WB 2ZWPA 3PEJA 5CD4H 4U8YA 2WTUA 3L2RA 1NLKL 1HYVA 3M05A 4F2SA 4DUZK 2N3LA 3JYTA 2OUGA 4X62J 4GMKA 4CJSA 2AX1A 1HR0J 2CPHA 2VQFK 4DR5J