5HBMA

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
554
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 161
structure length 552
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hbmA05
3Q8SB 1I39A 3C6UA 4NLVA 4NLXA 1S9GB 4Q43A 4O3NA 5KT2A 4CF9A 4AILC 4H8KA 3JSMB 4FJMA 2A1SA 3K5NA 5J2NB 1HNVB 4ED6A 3CO9A 2G8VA 2VA2A 1JLFA 4M41A 4O0JA 3RMBA 5KI6A 3IG1A 4F4ZA 2V0NA 5KTQA 2P5OA 3OL6A 2Z1HA 3CFOA 3F9KA 4DS5A 1ZBUA 2DPIA 4IBNA 1K1QA 5KG4A 1S49A 3RB4A 1ZBIA 1HQEA 1BQNB 4CEDA 3MXIA 4CF0A 3SUOA 2YNFB 4M3YA 4TLRA 3RB3A 4FM0A 4LY7A 5KT6A 2DY4A 4DQRA 4M3ZA 1KVCA 3AVAA 3I0RB 2ILYA 2P5GA 1JLAB 3ZSXA 1X9WA 1LWCA 2O4GA 4FS2A 4O0IA 1T05B 4DTRA 3C95A 3SJJA 3M8SA 1IO2A 3LPTA 1BL3A 3QEIA 4EZ9A 4N47A 1RT1B 2ZD1B 3CDUA 3PX0A 3SQ0A 1LAVA 4KE5A 3NBPB 3G6YA 3CDEA 3CM6A 4WFZA 3OL9A 3KLGB 1D5AA 1G15A 4Q5VA 3QIPB 2A1RA 1ZBLA 1JLCB 1ZTTA 4NLDA 5E41A 2XC9A 2IJFA 4YR3A 3OYLA 2XWYA 4R5PB 3VQ4A 3V6DB 3OHAA 4YP3A 1LAWA 4NLOA 3KKRA 4RW7A 1J9AA 1WSFA 1XR6A 3QIDA 3OLAA 3VQPA 5KFLA 3TQ1A 1JLEB 3FRZA 4E1MA 1OS5A 5I42B 1T3NA 1EETA 1Q9XA 5FROA 3Q8QB 1NKEA 3DI6A 1RDBA 2G8WA 1U09A 5KG2A 1CSJA 3V9WA 3FQKA 3OYKA 3HM9A 4I9QA 3AO2A 2VG7A 4IR9A 1W25A 5CZ1A 4ECRA 5D3GA 1KLMA 4O55A 4TY8B 1S0OA 5KFEA 4OPKA 3DLKB 1RDAA 3F73A 1C1BB 3QZ8A 4B8CA 1YT3A 4JV2A 4DTOA 3S3MA 1JLBB 2XCPA 3HPGA 2V9WA 5L9XA 1U45A 4O4GB 4ID1A 5DK5A 3RAQA 3CJ4A 3E01A 4RNFA 4TN2A 1HMVB 2YNIB 1DTTB 2F8EX 4NCGA 5F8GA 2OPQA 2FJXA 4I2QA 4FK2A 4ZP8A 4FLZA 4FJ5A 3PW2A 1Z25A 3BR9A 3OS1A 4MIBA 4YMEA 1CZBA 1B9FA 3L3VA 2OPPA 1IKVB 3TR8A 3ITHA 3AV9A 2FC0A 1JXBA 3PO5A 3KHHA 3OYJA 3GYNA 3NE6A 4FZYA 3GILA 5DQHA 2FLLA 1ZTWA 4ED2A 4DFMA 3H59A 4NLYA 1TK0A 4O3SA 1IKWA 1NHUA 3ICLA 4KAZA 2BRLA 4G1QB 4ECYA 4Q8EA 2C2EA 1SH2A 5I3UB 5C42B 5KT3A 1RT3B 2W9AA 4DQQA 1JXLA 4EBCA 1NK5A 4DU3A 3ZSRA 2JEJA 2WOMA 4IG3A 1S10A 4Y34A 5HRPA 4K4WA 1C0TB 2J6TA 5JS2A 1RTJA 4Z4CA 3LZJA 3ZT3A 1N6QA 5L1IA 3NH2A 1NKBA 4B9LA 3QEWA 3PW7A 1LWFB 4FBTA 1TK5A 1HQUB 2VWKA 3AO1A 4YNQA 3Q8RB 3VQQA 3BJYA 4N41A 1IG9A 3NMAA 1TKZB 2R7YA 3RR8A 3DLBA 4HCCA 2IM1A 4CJ3A 3T5JA 4EBDA 1JLQB 5EWFA 4FJHA 3ZSVA 1IKXB 5KFXA 3CJ2A 4FW2A 4E89A 2AGQA 3DRSA 2JGUA 3NAHA 4RUCA 3EPIA 4YFUA 1X9MA 5HBMA 1RAJA 1N5YA 4GMJB 4MFBB 4B3OB 2WRMA 4U7CA 4URGA 3NKYA 3LP0A 3NGZA 4ZTFA 4OJRA 4CE9A 2W8KA 2IM2A 4M3UA 2D0AA 3DOKB 3TAMB 4XO0A 1FKOB 1S0MA 1ITGA 3HPOA 1TP7A 2Z1GA 3M9OB 3MF5A 3SUPA 1YVUA 3SFGA 1DTQA 3QEXA 1NK4A 2X78A 3DLGA 1BQMB 1S1UA 4RW4A 4DL6A 4I2PA 1NKCA 2W9BB 3S3NA 4ID5B 2E6MA 4CEQA 2WB4A 4RU9A 2R2UA 1BGXT 3GIJA 4N76A 1L3SA 3IS9B 2WHOA 3AVLA 2KZZA 4Q0BA 5HP1A 4DFPA 3G10A 3V81A 3D28A 3UPFA 4CGFA 2QKBA 1VRUB 2O5DA 1KVBA 1VK0A 5CY4A 4Z0UA 2F96A 4TQSA 1TV6A 4O3PA 1Q8IA 3TANA 2QKKA 1SUQB 1EP4A 1S1TA 4IFYA 3G86A 3SI6A 1X9SA 4KB1A 4DG1A 3DRPA 2QV6A 3OHBA 4QWDA 5DG8A 4J9MA 3S9HA 4FM1A 1LWEB 4KSEB 4IG0B 3MXMA 3CVKA 4B9TA 3KLEB 3T5LA 4X2BA 4EYHB 4F4YA 1KCFA 5DMRA 4K4VA 3SUNA 4J9OA 4BE0A 3UR0A 4DTUA 3EZ5A 2WK4A 1SL1A 2HMIB 1NK9A 5KFDA 4O44A 3OSPA 4OGEA 4CHQA 3EZUA 4RW6B 1IM4A 1JKHA 4NYFA 3DLHA 1K6YA 2YHAA 1TKXB 4LH4A 3K5LA 3K59A 5KFYA 2ALZA 3OYMA 3TWHA 3LP1A 1HYVA 2ILZA 3AO5A 3DYAA 1BCOA 4QWEA 4ECZA 2IM3A 4HCBA 4DLGA 4ZMMA 3QGIA 4CJWA 4XPEA 3AVFA 1ZETA 1RT2B 4PY5A 3SUQA 5SWMA 1QAIA 4YR2A 3CFPA 2IAJA 5F8NA 2IS3A 1F21A 1JLGA 4LSNB 3HVWA 4KFBA 3RMCA 4FJJA 4FYDA 2Y1IA 1WSHA 1LW2B 3MEDB 1QUVA 2YNGB 2FVSA 4IKAA 2B4JA 3DOLB 1SH0A 4DF4A 5F8LA 1T03B 1HPZB 4CGHA 4RUAA 4KRFA 3QNOA 3KHRA 1HJRA 4F4WA 2UUTA 4ZPAA 2VG5B 3PW5A 4MK9A 4EO8A 4CEBA 3C6TB 4FBUA 4KO0B 4M45A 1VSKA 3ZSYA 2KZMA 4KHYA 1C1CA 2IC3A 2W8LA 3PVXA 5KT7A 3L8BA 3KK1B 3HHKA 4H4MA 3WNEA 5KFRA 1UWBB 3M9MB 4LQ3A 1BI4A 2OPRA 4J2BA 3KLFA 4MIAA 1NJXA 3T5KA 2XI3A 3M8PA 1L3TA 4CFDA 4RW8B 1RT7B 1SKWA 1EXQA 4YR0A 3UIQA 4CJTA 2QXFA 3MAQA 1S9GA 4ZHRB 4KV8A 2FVRA 4FVMA 1T94A 4DSJA 3OY9A 4ZP9A 4H4OA 3V4IA 1UOCA 4FM2A 4CF2A 4IKFA 1QSYA 4AHVA 1WSEA 4CF1A 3PX4A 3ZSWA 4B9UA 2GIQA 5KFIA 3KLHB 4ECUA 3LP2B 3NF7A 3N6NA 1UAXA 3DMJA 2NUBA 2QE5A 3B6OA 3IN5A 3I0SA 4KBIA 3RR7A 1JLAA 4PUOB 4DL5A 4FW1A 1TKDA 4CJKA 1WN7A 2W9CA 3C94A 4ED3A 1XI1A 1R0AA 4IRCA 1J5OA 1VRTB 4CHPA 1RBVA 3NBPA 1RDRA 3NGDA 1WSIA 5HLFB 1SL0A 2HHSA 2CKWA 1NK0A 3E51A 4BDYA 4BDZA 1C1AA 3P5JA 4DSEA 2RDJA 4J9KA 4IFVA 4DTNA 1XHXA 4PA1A 4KI6A 4CJVA 3WNGA 4ICLA 2O4IA 5C25B 1VSJA 3OYDA 2OPSB 3NF8A 1T7PA 5FDLA 2WONB 3LANA 1Z26A 4MQ3A 3NF9A 3OS2A 3VQ9A 5CYMA 1S6QA 3QERA 3KK2B 3VQEA 4DQPA 3KLIB 3IGNA 3CYMA 1S1VA 2OA8A 4CK2A 3NGIA 3QGGA 1RT5B 3GV7B 1S6PA 1LW0A 3QLHA 3L2RA 2J6SA 1IKYA 5HROA 4BE1A 4NLPA 3D0PA 2B6AB 4PWDB 3ZSOA 3H5UA 1C0UB 2BE2B 1YTAA 2VG6A 2HNYB 1U4BA 1RTDB 4ECVA 2HVHA 5J2PA 4HTUA 2IA6A 2FBTA 5K14A 3KD1E 1S9EA 5EWGA 1REVA 4ED0A 4R8UB 1TL1B 2HWHA 4W5RA 1N48A 4DL7A 4URQU 1HARA 3C6UB 4CEFA 4OL8A 1NJYA 2HHWA 4NYZA 5KT5A 4GC7A 4BDPA 4BE2A 1HMVA 2RF2A 2I5JA 3HPHA 3OYHA 5DQIA 3S3OA 4JUZA 4ZP7A 2UUWA 2YNHA 3B6PA 5DQGA 1JLFB 3QEPA 2G8FA 3IG1B 3V6KA 3OL7A 1WAJA 1LV5A 4KHNA 2R2RA 1EX4A 1U04A 4F50A 1QE1A 4O5BA 4J9NA 4YQWA 1HQEB 3OYNA 5KG7A 3G6VA 3AVJA 4B8AB 4NLSA 3QINA 4CEZA 3LWMA 1NJZA 3DM2A 3HP9A 2ZKUA 5KFNA 4CFAA 4I7FA 3PX6A 4G1QA 3AO4A 2VWJA 4EO6A 3DRRA 3FSIA 4K50A 3ULDA 5KFSA 4M3RA 2HWIA 3SCXA 1SKRA 1I3AA 3VQBA 2FJWA 3PJXA 5CYQA 4NYNA 4KHMA 3FFIA 5KG1A 4CGDA 3VA0A 2QK9A 5F9LA 3KJVB 2D0BA 1SV5A 2R8JA 1MU2A 4NCBA 3OL8A 2BQ3A 1BHLA 3ZT2A 3LP3A 2HHXA 3H98A 2RDIA 5KFBA 1Y97A 2IM0A 3VN5A 2KW4A 4CJSA 2FLNA 5KFWA 4ELVA 2C28A 4RW7B 1S1WB 5DLGA 5J1EB 3V6HA 4J9RA 4ECQA 2XY8A 4AHRA 1SL2A 3HVAA 3QETA 3O4NA 3NAEA 4CFBA 1XC9A 3CG7A 4QW8A 1EETB 2GUIA 1S1XA 4E7JA 2JEFA 4EBEA 2FVCA 3DI6B 3O3GA 2BGGA 3BQ1A 5KT4A 3DLEA 3VQDA 3PR5B 1KLMB 2C2DA 1XR7A 1YVFA 4RW9A 4FLYA 2PY5A 4KKOA 4ZPBA 2HHVA 2AGPA 2DPJA 4C8MA 5J2QA 2FBVA 2HVIA 4ED7A 4CJEA 4O3QA 1KFDA 5EDWA 1VSFA 2R2TA 3BSNA 4TQRA 1CXQA 4DTPA 3H5YA 1SH3A 3GIMA 2ZE2B 4FJ7A 3E01B 1QSSA 2RKIA 3ISNC 1GOCA 2XHBA 1XWLA 1DLOA 4NCGB 1W9HA 4AHUA 2OPQB 2BDPA 4B9MA 1NNDA 2ATLA 1ASVA 4I2QB 2X74A 3GV8B 3AVIA 4N56A 5KFHA 4TXSA 4QWAA 1WNEA 4NLQA 1NOYA 1FXXA 4EP5A 2IJNA 2OPPB 5F8IA 4CJFA 3EPGA 1VSHA 3ITHB 4O3RA 3TABA 2B5JA 4E1NA 2AU0A 1TVRA 1RTHA 3AVHA 3LWLA 1S9FA 3QYYA 4DEZA 1RDDA 3HK2A 3MEEA 2UVUA 5F8MA 1C6VA 4DQIA 1L5UA 2D3UA 1IKWB 3CM5A 4LSLA 3NFAA 4CIGA 3H2LA 1I6JA 1MMLA 2E9TA 3BREA 2YKMA 1TAQA 1ASUA 1TL3A 3K5MA 4WFXA 2OH2A 2IMWP 4CJQA 4RNMA 1SKSA 3GV5B 3KNAA 3HYFA 4CGGA 1RTIA 1RT6A 2WOMB 1WSJA 4IG3B 3L2QA 1HRHA 1UA0A 4QWBA 3SQ1A 2OZMA 1RTJB 3AA4A 1EKEA 1N6QB 3V1RA 4M94A 3OJUA 2G8UA 2BQRA 4BACA 4R0EA 4U6PA 1FK9A 2HHQA 4M3TA 2BQUA 4KTWA 4E7LA 4IDKA 2XY5A 2BANA 3QESA 5KG3A 4HYKA 1D1UA 3BGRA 3O4QA 4CHNA 1JL1A 4CEAA 1FKPA 3DRSB 3KKSA 3U3YA 1NK7A 4K4SA 2JEGA 5HBMB 3QO9A 5J2MA 4FLTA 1N5YB 3UDLA 1N56A 2HNDA 4F4XA 2E6LA 5HRRA 3V9XA 4ZVGA 1LW2A 2DFEA 5KG0A 3JYTB 4CESA 3HXMA 3NAIA 3KK3A 3QGHA 2FBXA 3MEGA 4FJ8A 4FCYA 4K4TA 2FLPA 3OVNA 5KFZA 3MECA 4IOBA 4W5NA 1ZBFA 3KIOA 4KI4A 2IBKA 4RZRA 1DTQB 4KB0A 3DLGB 1RT4A 1S1UB 4RW4B 1WLJA 4I2PB 3HVTB 4ED8A 4OLBA 3SFUA 3BSAA 3KHLA 3SI8A 4Z4EA 1JX4A 3OLBA 3T3FA 3OYAA 4CK3A 4AHTA 4CHYA 1ZYQA 3N6MA 5C24A 4Q0BB 5HP1B 3RB6A 3TARA 2HNZA 3TVKA 3V81B 5KRTA 3SQ4A 4KREA 2GV9A 2WTFA 4DSIA 1WNSA 4QAGA 4B9NA 2W7PA 4DMNA 2AX0A 4EZ6A 2XGPA 1TV6B 1A5VA 1T8EA 4ZVFA 4G3IA 4MK7A 2GBZA 1EP4B 1S1TB 4IFYB 1RBRA 4EYIB 3PZPA 4DG1B 3DRPB 3OJSA 3RMDA 3ISND 4Y2AA 4DTMA 4RNHA 3LZIA 2W7OA 3TAFA 5KFKA 2AQ4A 3K5OA 3AO3A 2YKNA 5EUHA 4N5SA 3HT3A 4ECWA 2D7SA 4AHCA 5KFTA 1HNIA 3QIOA 3TAPA 4O44B 4FJXA 3HVRA 1TAUA 4CFCA 4CJUA 1CXUA 1JKHB 4LD0A 4MK8A 4J2EA 2HHTA 5F9NA 3L2UA 3AVMA 2JLEA 2Y1JA 3ZSZA 3PO4A 2ASLA 4WZMA 4FJIA 2R8IA 4WE1A 3LP1B 3PR4A 2UVRA 4OVLA 1HYSA 3DYAB 2J6UA 3U3GA 3EYZA 3T1AA 1KVAA 4L8RB 4ZP6A 4Q8FA 5HLFA 4WYWA 2FVPA 2UVWA 3JSMA 5KFUA 4K4UA 5J2NA 1HNVA 2HAIA 4CGJA 2V4QA 5KG5A 4O4RA 5FRNA 4HKQA 2XCAA 3BQ0A 3IRXB 4EEYA 1KSPA 2I1RA 4FJKA 4F3OA 1NJWA 4CEEA 3OYIA 4IH7A 2IAJB 1S97A 1JLGB 3GIIA 4KFBB 5KFFA 3KMSA 1BQNA 4DL3A 1S0NA 5F8JA 2X6NA 4CJLA 2YNFA 5JXSA 5L1KA 4ZVEA 2PZSA 4PQUB 3H08A 4M42A 3SQ2A 4KB7A 3I0RA 2UVVA 2F8TA 2GC8A 1TKTB 1T05A 2XI2A 4E7IA 4RNNA 3SV4A 5KFVA 3HP6A 4Y3CA 2ATQA 3CJ3A 2R8GA 1C1CB 2IC3B 2V4RA 4DSLA 4CHOA 1RT1A 2ZD1A 4H4MB 3OYFA 4JS4A 3PY8A 2R8HA 1BI4B 2OPRB 4CIFA 3KLFB 3KLGA 3QIPA 5EWEA 1JLCA 4NLWA 3VQ5A 1W0HA 2EHGA 3M8PB 4K8ZA 4R5PA 3V6DA 1BCMA 3ZCMA 4XPCA 2P51A 3P1GA 4WZQA 4FJLA 2Z1IA 4KV8B 3NCIA 4Z4IA 4B9VA 4H4OB 1RA6A 4FK0A 1VSIA 4F2RA 4B08A 3PUFA 1JLEA 2YHBA 3V4IB 4JRQA 3M8QB 1WSGA 5I42A 4QWCA 2PYLA 1KTQA 3L3UA 2C2RA 3T5HA 4DSFA 3O3FA 4JV0A 4RNOA 3EY1A 3AA5X 4DL2A 3SPYA 4CCHA 1TGOA 4HUEA 3HJFA 4TYAA 2Q3SA 4CJRA 4KHSA 3DMJB 3CQ8A 1N4LA 3HKWA 3K2PA 4DFKA 3I0SB 4TY8A 4FLWA 1S5JA 1RYRA 3DLKA 2E9RX 5EU7A 3VQ7A 1C1BA 4Y1DA 4J9QA 3KOAA 2W9CB 4Z4FA 3PW4A 3AA2A 5KFGA 1JLBA 1KHVA 4FK4A 4K4YA 1U47A 5T14A 4E0DA 1R0AB 2WCXA 2XO7A 4JV1A 1J5OB 4QOZB 4O4GA 2KTQA 2D3ZA 2KFNA 3KJVA 4IH6A 2HW3A 4IRDA 2YNIA 1DTTA 2HHUA 4IFVB 2F8SA 2XRIA 3RMAA 4C8OA 4NLRA 2P1JA 4ICLB 3MTKA 2RN2A 4FJNA 4J9SA 3K57A 4FZXC 4FJ9A 1S48A 4Y1CA 2XY6A 1IKVA 1S1WA 4ED1A 4I9LA 5J1EA 5FDLB 1QAJA 4FLUA 3TAEA 1JXEA 5CYMB 1S6QB 3K58A 3SYZA 2XGQA 3VQ8A 5DG9A 4JS5A 3T19A 1C2PA 1VSEA 3OS0A 4C8LA 1LWCB 5T7BA 1UA1A 1S1VB 3V9UA 4M95A 3MR2A 1YTUA 4J2DA 1TQLA 1KRPA 3G6XA 1S6PB 4IH5A 4E7KA 1LW0B 5I3UA 1QSLA 1HYZA 3QLHB 2DFHA 3FDSA 1IKYB 5C42A 5HROB 1RT3A 2OZSA 2VG6B 3U6FA 2DFFA 1RDCA 4ELUA 4CJ4A 5J2PB 1JIHA 5K14B 4CEOA 3AVNA 3I5AA 1S9EB 1REVB 1O1WA 1C0TA 3AVKA 1BIUA 4DTSA 3KHGA 3H5SA 3NF6A 2X6SA 2W42A 1U48A 3HSTB 2IGIA 3ASMA 2IOCA 2ZE2A 4NLTA 1L3VA 4TYBA 4BWMA 2KQ2A 1LWFA 1HQUA 3RRHA 1D8YA 2RF2B 2I5JB 1NHVA 3NHGA 4F8RA 1TKZA 1XR5A 4DF8A 5KFQA 1L3UA 4ECSA 2YNHB 3SNNA 4CF8A 4KTQA 3A2FA 4W5TA 2R2SA 1JLQA 1IKXA 2Z1JA 1KHWA 3PW0A 1ZBHA 3VQAA 2FVQA 1TK8A 4Z4HA 1QE1B 4E19A 4QCLA 4MFBA 2VG7B 4B3OA 4WFYA 1Z4UA 5D3GB 3NH0A 4E3SA 4Q44A 4F2SA 5KG6A 5DG7A 3DOKA 3DM2B 3TAMA 1CLQA 1FKOA 4DTXA 4CECA 3QZ7A 4FLXA 4I7FB 4K8XA 3PV8A 3M8RA 4DTJA 3VA3A 3DRRB 4CIEA 4HUGA 4DU4A 4LH5A 2G8HA 1RNHA 1BQMA 5CYQB 4FXDA 3FFIB 4FS1A 2W9BA 4ID5A 1SV5B 2B43A 5L1LA 3AVBA 1MU2B 3LAMA 3OSNA 3CJ5A 2DTUA 4OKKA 3MR6A 1NK6A 3IS9A 3GIKA 3V9SA 4B9SA 4NRTA 1RBTA 3I8DA 3RWUA 1NOZA 4C8NA 4KHRA 4H54A 1RYSA 2GIRA 1B92A 3RRGA 2D0CA 4QW9A 1VRUA 5DLFA 4J2AA 1QHTA 4LQ9A 2VA3A 4M3WA 4C8KA 4ZPDA 4NZ0A 4Z4GA 1SUQA 4M3XA 1KFSA 5KRSA 5KFMA 1S1XB 4DLEA 3KTQA 4XIUA 1LWEA 4EP4A 1JL2A 4ELTA 4IG0A 4AH9A 1B9DA 4NCAA 3KLEA 4DU1A 1RILA 2BRKA 3SPZA 3DLEB 1GOAA 3G0ZA 3BDPA 4NLUA 2ITGA 4RW9B 5JS1A 3JYTA 2HMIA 4KKOB 4OKEA 1C0MA 4DS4A 4OPJA 2ASDA 4W5OA 4RW6A 5J2QB 2C22A 1WAFA 2G8IA 4OLAA 3UQSA 4GC6A 4ECTA 3H40A 1TKXA 4DWIA 3THVA 4K4XA 3HVTA 2RKIB 4NLGA 3WNHA 2FJVA 1DLOB 4E7HA 1BISA 2E4LA 5HRSA 3TAGA 3GQCA 1VSMA 4QPXA 4RG8A 2OYQA 4AHSA 3V9ZA 3AVGA 2AX1A 1GX6A 1RT2A 4F3TA 5KFOA 2RPIA 3DDKA 2LSNA 4KTZA 5SZTA 2B5JB 1RCHA 3IAYA 3MR5A 1TVRB 1RTHB 3I5CA 4LSNA 5JUMA 1X1PA 3V1OA 3LP0B 4O3OA 3MEDA 3OYGA 2YNGA 3RTVA 3CDWA 2IDOA 3DOLA 3MEEB 1T03A 1HPZA 4ZPCA 3TI0A 4JLHA 2FBYA 4UQGA 2R8KA 4ECXA 1ASWA 3AA3A 4IRKA 2VG5A 3OYBA 4LSLB 2JC1A 2PYJA 3KD5E 3BQ2A 2ETJA 5KGXA 3C6TA 2CJQA 2YKMB 4KO0A 4URSA 1D9DA 3PHEA 1TL3B 4K4ZA 3P83D 1IH7A 3ZT4A 1RBSA 4CJ5A 3LDSA 4J9PA 3KK1A 2EX3A 2BR0A 1RA7A 1U49A 1RTIB 1RT6B 2ASJA 1A5WA 1UWBA 1BIZA 3L2VA 3CIZA 5KFAA 3IGVA 3HO1A 5CZ2A 3V1QA 3NH1A 3O3HA 2D41A 5L1JA 4GW6A 3DLRA 5HRNA 3RBEA 3NL0A 1FK9B 4KPYA 4RW8A 1RT7A 4WXOA 3M9NB 4ZHRA 1QTMA 4IDKB 1J54A 4WYLA 3QNNA 2BANB 1GX5A 2E9ZA 5C5JA 3WNFA 3BGRB 3LALA 3MFHA 4CERA 1FKPB 3IRXA 4IR1A 4GVMA 5DGAA 2JEIA 4DFJA 2G8KA 4ZVHA 4ZTJA 4CJPA 3QO9B 5J2MB 3CWJA 3MFIA 3FQLA 3TAQA 1XHZA 3CJ0A 4KHWA 3KLHA 3LP2A 5F8HA 2HNDB 4WXWA 4MKBA 4TY9A 2JC0A 4KHQA 3SZ2A 3D45A 3KK3B 3L2WA 4DSKA 3MEGB 4PQUA 1VSLA 1CZ9A 4CGIA 4HVJA 1D0EA 1TKTA 3MECB 4PUOA 3BSCA 3VQ6A 4NRUA 4DL4A 5KGWA 1D9FA 3LPUA 1QS4A 1RT4B 3AVCA 4CK1A 4HUFA 1S4FA 4DQSA 3RAXA 1A5XA 3HL8A 3QEVA 1VRTA 5KFPA 3KMQA 3ZT1A 4CHZA 3RB0A 3SV3A 5C24B 3D5MA 4FJGA 2KFZA 1Q9YA 2HNZB 3ZSQA 4Q45A 3KLVA 3ZT0A 5C25A 3BSOA 3I5BA 2AGOA 1RBUA 3VQSA 2ZQBA 4F4KA 4KHUA 2OPSA 4Y2CA 3RBDA 2WONA 3PJWA 2YV0X 4J9LA 3V6JA 3OYEA 3M8QA 4OGCA 2HB5A 3CFRA 3KK2A 1GOBA 3NDKA 3KLIA 3H4DA 2D5RA 1VSDA 4FZZA 4FLVA 2YKNB 4TSXA 5KFCA 2AWZA 3Q8PB 2EC0A 4W5QA 3OYCA 3LAKA 1RT5A 4OKJA 5FRMA 4HHTA 1K1SA 5KFJA 3MXJA 1HNIB 3VQCA 1NK8A 2XY7A 4MKAA 3NGYA 1QQCA 4KAIA 2B6AA 4PWDA 4JRPA 1C0UA 2BE2A 3N6LA 1KLNA 3H4BA 2HNYA 4MH8A 2AJQA 1RTDA 4BWJA 1J53A 4IQXA 4R8UA 3H5XA 5DGBA 1TL1A 4WE1B 3ALYA 1HYSB 3MR3A
chains in the Genus database with same CATH superfamily
3DRYA 3C6UA 4NLVA 2BABA 1YBAA 2J0QD 3T69A 2DNGA 3VF4A 2A1SA 5J2NB 3T41A 3ET6A 4ED6A 1V3RA 4TU8A 1IWGA 5DM6L 2VA2A 1JLFA 4AF1A 4C3LA 2E1ZA 3V5RA 3OD2A 5KI6A 2V0NA 5KTQA 4NA3A 2RT3A 3OL6A 5C2GA 2Z1HA 1SC4B 2EK6A 1ZBUA 1D4XA 4CH0S 2VOOA 5B09A 3HOTA 1ZBIA 4CEDA 1BQNB 3MXIA 2J9CA 2DNRA 1KAXA 3RB3A 3GFYA 2DVIA 4F3MA 4M3ZA 3I0RB 3ZSXA 1GNKA 3QRPA 2XLJA 2YHWA 4ETZA 3TNVA 2FD2A 3LPTA 2D9PA 1BL3A 1WJ9A 1U0HA 4N47A 4CZCA 1NMDA 4BR4A 2ZKTA 4J90A 4ZOSA 2P9LB 3SQ0A 5T41A 1LAVA 3ZX2A 1R0BG 1SJ3P 4BGAA 1G15A 2Q0RA 3F44A 2OJ3A 2A1RA 1ZBLA 1ZTTA 3R7NB 1SQFA 4NLDA 3I6PA 3ZTSA 1G99A 3E1YA 2J8AA 4B1WB 1NAQA 3VQ4A 1EIYB 3H1VX 3OHAA 4YP3A 1LAWA 4NLOA 1HBOA 3KKRA 2CPDA 4HT7A 1I3OB 1WF1A 1QVFR 1XR6A 1O6XA 3TQ1A 3RW6A 3K0SA 1OS5A 1T3NA 5FROA 1NKEA 1SS6A 4ZLNA 3HULA 3DI6A 7AT1B 1RDBA 2GMHA 5KG2A 2MTLA 3OYKA 1XMQK 4UTGA 3HBTA 5D3GA 4TY8B 3KVGA 5KFEA 4OPKA 4I0WA 4PG8A 1C1BB 4KQZA 3FEYB 3UCGA 1S72N 2CZ9A 4DTOA 1T9XA 3S3MA 2ZZNA 5B0DA 1WORA 3WIUA 3T6JA 1TZ0A 5LMUJ 1DBDA 2VKRA 3UVJA 2HS3A 4FK2A 4FLZA 4FJ5A 3FMBA 4BRAA 3OS1A 1CZBA 2DD8S 1VQ7N 3AV9A 2IHR1 4Q2LA 4IFEA 3KHHA 4FPIA 5LL6d 3QJJA 1BWFO 4NLBA 4FZYA 2VH7A 2CPJA 1S6UA 5GAEU 3L9ZA 3TPQA 1ZTWA 4AM6A 4HDGA 2BE9B 2JZ5A 4NLYA 2XMMA 2HBLA 3R7SB 1NHUA 4NI2B 3DU5A 2AA4A 2DGVA 5F1XA 2BA9A 3THXA 2C2EA 1WBDA 4ZVQB 2RQKA 1RAEB 2DTJA 4LFBJ 2G2ZA 3PYGA 4EBCA 3ZSRA 2VBZA 4DV3K 1S10A 4Y34A 2J6TA 5JS2A 1NSKL 2RRBA 1N6QA 2A41A 5GAEI 4B9LA 1TUUA 4DR6F 1HQUB 2VWKA 4YNQA 4EAHD 3Q8RB 2O8EB 3NG8A 1IG9A 1F6TA 4DR3J 1DZ5A 1HNZF 3R97A 4FYWB 2R7YA 4ZCIA 4PKGA 4A8KA 2GHPA 2G4BA 5DDRC 2QA2A 2IM1A 3T5JA 3QRQA 3SCLE 3W0LA 3QSIA 3IWLA 1Q8LA 4IUFA 3O6QA 2MHNA 3UO0A 1M5OC 4E89A 3DRSA 1U2RA 3BM7A 2RH3A 3NAHA 3D3BJ 1RAJA 5AQVA 1MWYA 1OPZA 2WRMA 3UDVA 2FC8A 1K0TA 3NGZA 4CE9A 3JQJA 2IM2A 4M3UA 2D0AA 3TAMB 3EKUA 4GKJF 1S0MA 1UPMB 2VUGA 2LEPA 5F41A 1TP7A 2Z4PA 1YK9A 2O3DA 2VQFF 3MF5A 1WC1A 4ANEA 2QYCA 3QEXA 2OLWA 1BQMB 1S1UA 2CWKA 1N32K 1SC6A 3BV8A 2UU9F 4CEQA 4DL0C 5BN8A 1BGXT 3GIJA 1EWRA 2DHAA 2LYVA 3OTOF 4N76A 3BKTA 3BF4A 3DAWA 2WHOA 2F4FA 1O51A 1Q7YO 4Q0BA 1RKIA 1NGDA 2X1FA 3UPFA 3BO4A 2O8CB 4C8ZA 1F9FA 1VCTA 3PACA 1U1MA 2AYBA 5IT4A 4B1YB 2F4VK 4LF4F 4ZK7M 3MDFA 4OYWA 1EP4A 4CZLA 1NWKA 3DRPA 2K2PA 3O2IA 3UNGC 3VF0B 2LXIA 3S9HA 3PIPQ 4FM1A 4KSEB 1DHMA 3ULEA 4B9TA 2OSRA 2RU9A 3T5LA 1FRKA 3RW7A 5DMRA 4K4VA 2HIYA 2F5GA 4YOUA 4DR4K 3OR2B 1NK9A 3M2RB 3G71N 1R3NA 4WWSA 4OLOA 2YJEA 3AT1B 4NYFA 1YVNA 2YHAA 4OX9F 4JI3F 3K5LA 2DR5A 2NUHA 2E2QA 1ZOTA 2ZUGA 3CD5A 3FBCA 5M2RA 3AO5A 5RUBA 1BCOA 4XDDA 3W61A 4F67A 3LL3A 1K9MT 2Q3PA 4ECZA 2B9EA 4DLGA 4ATNA 7FDRA 4CJWA 2R3VA 3AVFA 3R27A 1RT2B 4BR7A 1PC4A 1F3FA 4FWNA 2OELA 3GWCA 2VPYB 4YR2A 1N8RT 4NA1A 3SSQA 3JAMU 3JQKA 2GAGC 1JLGA 2HURA 4HTJA 2Y1IA 1QUVA 2JFKA 1JXVA 5F8LA 1HPZB 4XAKA 3T1HJ 5BXIA 4F4WA 3FJ2A 2VG5B 1BU6O 3I56N 5CA5A 1OH8A 5CZXA 3ZZOA 4C8YA 4EO8A 3P5TL 1HHTP 2NRZA 1Q1KA 3CD6N 2AJ2A 2ZFHA 3QT6A 1Q5YA 1SQKA 2IC3A 3I31A 2K3IA 3KK1B 1SIZA 3HHKA 2NREA 2NXCA 3M3ZA 1UWBB 1Q78A 3M9MB 4LFCF 1L3KA 4LQ3A 2IVOA 4J2BA 2F9JA 3KLFA 3S41A 1YG0A 1T9WA 4MIAA 1Y0HA 2KHCA 2ASMA 3BBFA 2XI3A 4Q2MA 3Q23A 3M8PA 1L3TA 1YITN 3KWIA 1EXQA 1TL7A 3UIQA 4CJTA 1S9GA 4ZHRB 4JI2F 4DSJA 2DIVA 4I4BA 3OY9A 1VC0A 4BRPA 3V4IA 2LA6A 4FM2A 1QSYA 5E5NA 4PPDA 3LGMA 1CBKA 3K8WA 1FRXA 2Q6CA 3DGPB 1M5HA 3KYLA 2ZM6K 4M5MA 4LF8J 3B6OA 1URNA 3FCHA 3IN5A 1M90O 2BH1A 4P9SA 2E2OA 3MWPA 3BEGB 5HQMA 1RWXB 1JLAA 4C11B 4DL5A 2CJAA 2ZZMA 4FW1A 1WN7A 2HBMA 4RUHA 2QLXA 4ED3A 3HI9A 4BC2A 1XI1A 4IRCA 2DH7A 2DGXA 1RBVA 4RWTA 1RI7A 2APOA 1SL0A 4OX6A 1A7GE 4DSEA 4IFVA 1RWOB 2X3GA 4CP5A 2IJRA 4CJVA 1IJEB 3WNGA 4ICLA 3U9DA 2IYGA 1UJ5A 4WYBA 4AFFA 4FPBA 3OYDA 3OW2M 2RB7A 1NB7A 2KJVA 2FPHX 4WP9A 1FE0A 3OTBA 1UKUA 1TL5A 2XHWA 4RBVA 1KOHA 2IIRA 5I3QA 3NF9A 3U9ZA 3VQ9A 2VIHA 2DNZA 3VAHA 1LFWA 3QERA 4RBUA 3IUCA 4DHYA 1QLNA 4NZ6A 2GEMA 4CLPA 3TUZC 1CJKA 4BR0A 4NXMF 4P2FA 4DR3K 1UVNA 2CXEA 3LF0A 1M1KT 5BYRA 4PWDB 4KGMA 3D0IE 5JVGQ 3H5UA 1C0UB 4WQ5A 2KXNB 2MQ8A 2HNYB 2HVHA 4FO0A 3IR6B 3BN4A 3MM8B 2IA6A 3CMEN 1U7LA 2JOQA 5EWGA 1GEHA 4L74A 3W3DA 1WKKA 1TL1B 4BQZA 4W5RA 1N48A 2HHPA 1YXQA 2FJEB 3QT5A 2AJ4A 3THWB 4NYZA 3IAM9 1WDDA 2IA0A 2I5JA 5AZIA 3S6EA 4ZP7A 1U2FA 2DNLA 2CQCA 4C1NK 2G8FA 2QMUB 2MJUA 2GV1A 1LV5A 3PRBA 3JTOA 4YQWA 4B3RF 5AQJA 3EVOA 5A2QY 2CNLB 1K73T 5DDOC 3CCMN 5JMNA 3QINA 1NJZA 3DM2A 2JSXA 1KP6A 4CYUB 4Z94A 2VJVA 1WOPA 4A8FA 2YX4A 4CFAA 1OWXA 4JHDA 1OJ4A 4QS8A 3PX6A 2N82B 3W9HA 4EO6A 1JJCB 2K8GA 5KFSA 2GJFA 3ULDA 2XMJA 3SCXA 1FI4A 5IT9O 1YKWA 4KH6A 1TELA 3HHLB 1N36F 3VA0A 5F9LA 3IR7B 3B8AX 5HMWA 4U67L 1CC8A 1Y9OA 3OL8A 1WUAA 4OHZA 3J81j 2EG1A 2IM0A 4XH5A 4CJSA 3CT9A 2E5LK 5KFWA 4ELVA 2C28A 4RW7B 2XS2A 2WVFA 3V6HA 4J9RA 4ECQA 1CZAN 5IXUA 4F9OA 5B0CA 3HVAA 5ETPA 4KH1B 4YY3K 1M0SA 3OVBA 4BRFA 4Q7AA 2AEFA 1S1XA 3KJQB 1PBAA 3KDOA 5LJ3Y 4OIXA 3IFRA 3VEZA 3HZ6A 2FVCA 3GL1A 5D78A 1FRMA 4NEZA 3JSYA 3BQ1A 4P72A 5KT4A 3MAAA 4AQYF 1U1LA 4MDBA 2V69A 1XR7A 1BMQB 3UN2A 4ZPBA 3AGKA 2CYYA 4A8XA 1VSFA 2R2TA 4JYAJ 3BSNA 5AQUA 1WHWA 3MAHA 5IQQA 4GVEA 4O23A 4X64F 4DR2K 3GIMA 4FJ7A 4OPHA 2GA7A 1GOCA 3T1HK 4BG9A 1DLOA 4NCGB 4B9MA 1PYOB 2ATLA 5HATA 2X74A 3SMSA 2J7WA 4HH0A 1FXXA 5F8IA 3OPKA 3DOMB 1VSHA 4JKBA 4O3RA 3VERA 3R9LA 4I1TA 2AT1B 3D6MB 2HMPA 2AU0A 3AVHA 3H46O 1URRA 4DX7A 5LSRA 4DEZA 3HK2A 1RDDA 4GO5X 1C6VA 1L5UA 1MMDA 4QR1A 4LSLA 2XLKA 3CI5A 2BXJA 2QWNA 2B9WA 2H9ZA 2DXEA 1SB6A 2VKZG 3EGVA 3HFKA 3S7RA 1TAQA 3Q8VA 2ZWHA 4DHVA 4WFXA 2OH2A 2Y0SD 3VGTA 3GV5B 2PMWA 1RU2A 1K8AO 2KVQE 1RTIA 2WOMB 3AOBA 1WSJA 4IG3B 2XBPA 2HF4A 1EKEA 3G8TA 3V1RA 1KD1O 2DEJA 3OJUA 4R0EA 1FK9A 2CNNB 5CXTA 4JBCA 4LF5J 3OR1B 3C15B 4ED4A 3TUPA 4BG8A 1NU4A 2N7YA 1U2CA 3BGRA 5JVHQ 3NGKA 4A8YA 3EVWA 2QLWA 3U3YA 1NK7A 4K4SA 1NM1A 4UT4A 5HBMB 2VV5A 4FLTA 2F8HA 3UDLA 4GVBA 2CNKB 4MO5A 4H03B 5HRRA 3ZZZA 1LW2A 4DV2F 3OUYA 4CESA 2F9WA 3KK3A 3SBMA 5JVHL 5D4NA 1Q81O 1PILA 4FJ8A 2ZH3A 4FCYA 3CMAS 4K4TA 2FLPA 5BR8F 1ZBFA 3KIOA 2XSJA 3H6EA 4KHPJ 4KB0A 3DLGB 1VBXA 5AQTA 4I2PB 2HFOA 3E2EA 3HVTB 4ED8A 3SFUA 1MWMA 2FSJA 3WC0A 3SI8A 4CLLA 4Z4EA 2HFNA 3EM1A 3QBWA 2RE2A 3OYAA 1I1GA 2PEHA 1VS3A 4BHQA 1BO5O 5AQNA 3RB6A 3R9PA 4NL5A 1VBZA 5KRTA 1WG5A 3SQ4A 2RQ4A 2WTFA 3UCUP 1VQOS 3PXGa 2CG8A 1JCEA 4FOEA 2XGPA 3EUNA 1TV6B 1RUSA 1A5VA 2EK1A 1T8EA 2MZRA 4ZVFA 3VEOA 1HBUA 2J7UA 1RBRA 4EYIB 4DG1B 2HFSA 4Y2AA 4M5JA 4H5WA 2J4RA 1XBWA 3QQCD 2CQHA 1O5JA 7FD1A 2YKNA 4WTOB 5FLXO 2HZVA 3J80O 1P90A 4A57A 4O44B 5SUHA 1JNRB 4QS7A 4DUZJ 5K8OA 1CXUA 1DGKN 2NXNA 4H5TA 1RHMB 4ZVPB 4J2EA 2BVZA 2HHTA 3L2UA 3AVMA 2JLEA 2YPYA 1W97L 3ZSZA 3HX9A 4WZMA 1PYTA 3N28A 4LJMA 3ZTQA 5FLXU 2UUAF 4BR2A 3CCRN 4WE1A 3PR4A 4OVLA 1RWPB 1HYSA 3DYAB 3CCEN 3U3GA 3EYZA 1H98A 3VAJA 1C4AA 5HLFA 3MOZA 1FD2A 2MSSA 2WVCA 3BEXA 4YHHK 5KFUA 2HAIA 4CGJA 2HLTA 4O4RA 5LM7E 2XCAA 3A8YA 2GW8A 1OH7A 2W6LA 3GIIA 1K0VA 4KFBB 1NGHA 5BN9A 4NXNK 1R43A 3KMSA 2PSZA 4NX9A 3GLJA 5F8JA 5BRHA 2YNFA 2DR9A 1CULB 1ZZNA 3DLLQ 3W2WA 1W26A 5LOQA 5JXSA 5L1KA 2HQIA 3TEHB 1VQYA 4ISEA 3MHYA 2PZSA 3BPDA 4M42A 1T6DA 4BRQA 1SJQA 1RWMB 1FRIA 2LFVA 2HS4A 2Q66A 3SV4A 2HRTA 2R7UA 5KFVA 1SPBP 2OKQA 2R8GA 1U26A 1D9AA 1RABB 3TZYA 3OYFA 3PY8A 5BREA 2DNOA 2NRVA 3G96A 4DMZA 4H0PA 4K8ZA 1RADB 4R5PA 3V6DA 3MM5A 3P1GA 4HHJA 5BYQA 2MKSA 2NLWA 3GJQB 1RA6A 2AJFE 4B08A 2W2MP 4JN4A 1NDCA 2V8GA 2PYLA 3L3UA 2G0CA 2DGWA 1UTAA 4RNOA 3CJKA 4IOXA 3EY1A 4DL2A 3GOIA 4CCHA 4HUEA 2KO1A 3DMJB 3K2PA 2VFRA 5IQ6A 1Y64A 3R6LB 3IKMA 5AJ3J 2E9RX 1RGIA 3VQ7A 4B3MJ 2QGFB 4JKAA 4BC5A 3UNYA 4Z4FA 3PW4A 3AA2A 1HI8A 2X1GA 5CHIA 2F1FA 4N77A 1JLBA 4FK4A 2VYPA 5T14A 4E0DA 2WCXA 5ETOA 1J5OB 4QOZB 1Q8BA 4ZVUB 4FNIA 2KG1A 2WW8A 2HW3A 1RB0A 3O08A 2HHUA 4M7XA 3TWZA 1E4GT 2F8SA 3CNQP 2XRIA 4C8OA 2ROGA 4NLRA 3K57A 4U7BA 2IMOA 1S48A 2XY6A 2ASPA 4DR5J 1LK7A 1S1WA 4I9LA 3T7ZA 5J1EA 1F2HA 5T7LA 5FDLB 1QAJA 2I6WA 4FLUA 1VIOA 5TKWA 3FE1A 1KBRA 1S6QB 5LSOA 1BA0A 1JJ2M 5IWAK 2V4JA 4JI8J 5BRFA 2JRSA 3CCTA 4BBYA 1RAFB 1S1VB 3V9UA 4CLFA 2DB1A 4NLCA 1QSLA 2FQQB 3EO3A 1S59A 1IKYB 5C42A 3PLAA 1RT3A 2AKWB 3GONA 4CZFA 3C7NA 3TRGA 2UXCF 2U1AA 5J2PB 3AVNA 3MMAB 1C0TA 3AVKA 1NZ8A 4KY3A 3AODA 1D8ZA 4OZ0A 3GBTA 5ADXA 2ZJRQ 3NF6A 2W7AA 1U48A 2Y8WA 3ZYYX 2VDHA 3ASMA 3RSEB 2IOCA 1VJWA 3OTEA 1FFSB 2NYIA 3GYXB 1N0UA 1NHVA 3ZZPA 3NHGA 1TKZA 1KNZA 4PWUA 4BC7A 4PL7A 2YNHB 4KHPK 1NNEA 3K89A 2R2SA 2CPZA 3GG1A 1WF0A 4ZJOA 1F60B 3C65A 1OY9A 1JNZB 1MROA 4TU7A 1LEOA 1DT9A 1QE1B 4QR0A 3R5DA 3UD3P 3VEXA 5D3GB 1XEZA 1HLUA 3L0QA 1NGGA 4E3SA 2J9DE 1VLYA 4F2SA 1TMMA 5DG7A 1E3MA 1CLQA 1EHWA 1FKOA 3TSPA 3BN7A 4RPFA 1XMQF 4DTJA 2OHDA 3FZBA 3CTRA 4CZKA 4YS2A 2OAUA 1CJTA 4DU4A 3D1QA 2P8IA 4FNHA 3PRVA 4FXDA 3HLUA 1WG1A 3G8SA 3FFIB 4AXJA 3BO3A 2W9BA 4ID5A 4HL9A 4JI5J 3FZKA 2B43A 2WBNA 2XQCA 4DZ6A 4OKKA 3PRDA 3MR6A 3GIKA 3V9SA 4NRTA 4NA2A 4P71A 1EO1A 3R5AA 3RWUA 4C8NA 3IBFB 4J2AA 8ATCB 1VQ9N 3MUMP 3VEVA 3N5FA 2G2YA 4DUZK 3WDOA 3R5CA 5E26A 1FKAF 3SAFA 4Z4GA 1YUWA 4M3XA 1J5EJ 3R1LA 2V5HG 1PSDA 1W2IA 1B64A 3L6QA 2CG4A 1QQMA 1LWEA 4M8LA 1UVKA 4AL5A 2PA3A 1YJVA 3GCWP 2RMLA 1PIEA 1T9VA 2ZBQA 2KJWA 1Q86O 2EXUA 3JQMA 3MCNA 4KKOB 4ZN1A 1SXLA 4OPJA 2UYTA 2ASDA 4JKGA 4W5OA 2WC9A 3UQSA 4NWBA 2XMKA 4GC6A 4ECTA 1TKXA 4DU8A 1V4SA 2XS5A 2MEWA 1YJNN 3WNHA 1TUYA 2NXUA 1FVSA 4E7HA 3TAGA 3ZZYA 2KHOA 4RG8A 2OYQA 1NH7A 3AVGA 1ILYA 3IR5B 2DH8A 3IAYA 1TVRB 2LMIA 3V1OA 1X8DA 3RTVA 4YDUA 3M2UA 4QOTA 3MEEB 1BQXA 4EFAC 3TI0A 4BRKA 4JLHA 2R8KA 1OKJA 2BACA 3D3CJ 4IRKA 4FXVA 4DR6J 2JC1A 3P5BP 1T9YA 5L46A 3BQ2A 2MLYA 2IDLA 1HNZJ 3MXHP 4BRDA 3R7BB 4PG6A 2OD6A 1HKGA 1IH7A 3ZT4A 1RBSA 2WAQD 3LDSA 2O67A 4J9PA 1RA7A 3THYA 1VFJA 1BD6A 2ASJA 3H42A 2J7KA 1BIZA 3PIOL 5HVHA 4L76A 3HO1A 3V1QA 4DCPB 1ESVA 1N32F 5BYSA 2I9SA 2GO9A 2G1HA 3F2KA 4RW8A 1H1VA 2LQJA 3GP9A 5AJ3K 3CC4N 5AQHA 2PGCA 2VQFJ 4B3MK 2BANB 1GX5A 3WNFA 1X4AA 4E2FB 3W5XA 2HS0A 1VQKN 3I33A 2Y9HA 4CERA 1FKPB 2C3PA 2F4VF 3BGLA 2UU9J 4GV3A 1G7CB 5B0BA 4H0OA 1I94K 3MFIA 3FQLA 2MKYA 3OTOJ 4JI0F 9ATCB 5ETSA 5F8HA 4WXWA 4FF3A 4MKBA 1EQMA 5G0RA 3P96A 4FOIA 1YJWS 1QVFM 4FWLA 4PQUA 4OI0A 4HT5A 4HVJA 1FRHA 4DR4F 1TKTA 3MECB 1X60A 3VQ6A 3QGPA 2FY8A 2FJDB 3PHTA 4M5GA 1EKRA 5LXRA 4DL4A 3F56A 1X5PA 2MKKA 4DU7A 3ID8A 1QTNB 2FZGB 3GJTB 5KFPA 3HI0A 3ZT1A 2WFBA 4FWQA 4M5DB 3FGUA 2FSNA 1FCAA 3R3LA 1XTZA 3SV3A 4JK7A 3D5MA 2MDAA 5CABA 5E0OA 1JB0C 1N5TA 3ZSQA 1XNRK 3ZT0A 3CETA 2ZQBA 4F4KA 1HBMB 4Y2CA 1F9HA 4EFHA 3IMQJ 1XQIA 4KH4A 2YV0X 3EMTA 4OX9J 4JI3J 3V6JA 3NY0A 3M8QA 2DRDA 5AXKA 5IT9Y 2Q1NA 4ILGB 1FEHA 2V2QA 1K8KA 3KK2A 5AT1B 3CJBA 5LMNJ 2D5RA 5KFCA 3THPA 3CCSS 4DN9A 4OKJA 1YWXA 5KFJA 2XY7A 4MKAA 3NGYA 2Z8QA 1O8BA 2BUPA 4GV6A 1ZBTA 2BE2A 1U6ZA 1RTDA 2MLXA 1J53A 2KI2A 3I96A 2CH5A 4NB4A 3H5XA 5LJWA 2HZCA 5LXYA 3MR3A 2IYIA 2GNKA 1TL7B 1S9GB 4Q43A 4HI1A 4O3NA 3GJRB 4CW7B 2D4WA 4FJMA 3JSMB 2D69A 1RLCL 5G4DA 3POTB 1Y3KA 5A0YA 1AROP 3KG1A 4M41A 2B4PA 4M63C 4LRFA 4F4ZA 2DNPA 1R89A 2Y3YA 3R5GA 3AAQA 1XJWB 3OTCA 3F9KA 4DS5A 1S7HA 2DPIA 4JI5K 3ETOA 5GAHU 1H74A 3SBGA 5KG4A 1S49A 3RB4A 1KVJA 1NPPA 1HQEA 3SUOA 4W92B 2QSFA 2GVZB 4LY7A 1H6KX 5KT6A 1KVCA 3AVAA 2AJ0A 2Z2LA 5B8HA 2P5GA 1JLAB 2QLJB 5CCMA 4O0IA 2ZM6F 1T05B 4DTRA 1OH6A 1JJHA 3C95A 3M8SA 3CQYA 2HIQA 1ZPVA 4P10A 3G82B 2L08A 2C1EB 1J5EK 3CDUA 1H38A 3CDEA 3CM6A 3KLGB 5GAHI 4YB1P 4CH1A 3FBBA 2D3OR 1D5AA 2ZHAA 2XLIA 3QIPB 3TVZA 1JLCB 2XC9A 4A46A 3OYLA 3SMZA 3LM9A 3IXQA 2BUNA 2V63A 4KH5A 4YB6A 3OLAA 3VQPA 4YOYA 5KFLA 1JLEB 2J0SD 4FXWA 5AQMA 3G6EN 2CPYA 1EETA 1G2EA 2AYMA 4JKFA 3Q8QB 3ZETB 1VQMN 5AQQA 2G8WA 1IR1A 2OFGX 3HM9A 3H45C 4I9QA 2WB1D 2QYGA 3IWNC 2VG7A 2CQ1A 5CZ1A 3BGOP 2YKPA 2Q6BA 1KLMA 1VQ5N 2QM1A 4M7YA 3DLKB 3MCSA 2O1PA 4DR3F 3QZ8A 4B8CA 3WQPA 1GLAG 4JV2A 1RCOB 1KS2A 3OT9A 2IVYA 2BOAA 4LC9B 4QS9A 3I55S 4ILJA 3ETMA 4TNOA 3MPVA 2HVEA 2P9CA 3ZTPA 3E01A 2ZJPQ 2LEAA 1M5PC 2YNIB 1DTTB 2F8EX 5CH7B 5F8GA 2OPQA 5AQZA 4DR6K 3ZFVA 3HSJA 2HQDA 3KG0A 4ID8A 4ZS6A 2FJXA 4I2QA 4NXMJ 1HNZK 4ZP8A 3GR0A 3W2VB 3MPDA 1P8ZA 2I7PA 3PFEA 3KDNA 3TZXA 1B9FA 2GQ2A 3TR8A 2DK2A 3ITHA 3LUYA 1YJ7A 2F9TA 2HBQB 4A8OA 1IJFB 3PO5A 3IWXA 3CJQA 4FVUA 4UZBA 2Y8YA 2JH3A 3NE6A 4A8SA 1LQ9A 3RVCA 5DQHA 3UD4P 3D6TB 2E29A 4ED2A 2RU3A 4DV5J 4KJIA 4O3SA 2VPXB 1IKWA 4KAZA 1FJEB 1C4CA 5A8KB 2W2QP 2OP5A 1B99A 3G8QA 4IDHA 4Q8EA 2V34A 1M5VC 1SH2A 5I3UB 1GFWB 5K8PA 2BMBA 4DQQA 1JXLA 2NQPA 1AFIA 3VALA 1SQEA 2G2OA 1WELA 2UU9K 1KQGB 5HRPA 4K4WA 4C7QA 4B3RJ 3NH2A 4QIFA 2QFJA 3QEWA 5EHHA 4O8UA 4ILRA 3M2VA 2WBRA 1TK5A 4FBTA 4PHTX 3AO1A 2FHJD 3W1YC 1SKUB 3VQQA 4N41A 2QX0A 5ETLA 2QWPA 3W3SA 2NPFA 1N5SA 2GMJA 3NOGA 1FVQA 3J80Y 5CYJA 2E5LF 5EWFA 3ZSVA 1U1RA 3R5JB 5KFXA 3CJ2A 2GWKA 2YWGA 2AGQA 2JGUA 2EVZA 4RUCA 1YI2S 4YY3F 1RZMA 1RLDA 1NBEB 1N5YA 3H8YA 4DX5A 4GMJB 4LRCA 3HFVA 3NKYA 3MMBB 4OJRA 3MM9B 3DOKB 4XO0A 1ITGA 5IM0B 4HDHA 4BQLA 4BROA 3TO8A 4H0TB 2Z1GA 1YRXA 2HQCA 1JCGA 3FUYA 3M9OB 4QYRA 2YCHA 1SAZA 2P9KB 3SUPA 2WW4A 1YVUA 5HL7L 1DTQA 2X78A 2KN4A 1YJRA 1HNWK 1NKCA 2JLGA 3S3NA 1PC5A 1RAHB 1YHQN 2B3TB 2WB4A 4RU9A 2JWLA 1UZHA 4Y6IA 2VFVA 5LMNK 1XN9A 2RJZA 1L3SA 3BZQA 3IS9B 3AVLA 2E20A 3QICA 2DR8A 4DR2F 1ZPWX 4QIEA 1UZDA 4AQYJ 5U47A 3T1HF 3CCQN 5KAKA 4CGFA 1VRUB 2K06A 2JHEA 3MCAB 2BKPA 1AT1B 3U1LA 1VK0A 2F96A 2R7TA 1LXNA 4JKHA 3SI6A 5HOOA 4IFYA 1GT8A 2QV6A 1W7WA 1U1KA 4J9MA 3TZZA 3FEXB 1FXDA 2MQMA 4X64J 3MXMA 1DQ8A 4U8VA 2XTJP 4EYHB 3I8BA 1KCFA 3SUNA 4J9OA 3LA0A 4DR1K 2W2PP 3HJVA 4GY2B 2WUSA 3BR8A 4LVNP 4OFZA 2HMIB 5I9EB 1C0FA 1HIYA 1LNQA 1T95A 4UW2A 4CHQA 4RW6B 2ZUAA 1VBKA 4I69A 2GHWA 3K59A 5KFYA 2BYCA 4FPRA 3LP1A 3M6VA 2ILZA 4F26A 4RCHA 4YOVA 3I82A 4OZ2A 5ITHA 4HCBA 2OIHA 1GLJO 4XPEA 4ZPVR 4DV1J 2ITMA 4B1UB 3MEKA 1ZETA 4ED5A 5HSPA 3SUQA 3MCOA 4DOZA 3CFPA 3L4QA 3D6RA 4FYDA 3I9V9 2FB0A 1LW2B 4IKAA 4FWSA 3CF5Q 3N0VA 3KHRA 3C19A 3T9ZA 2DO0A 2UUTA 3PW5A 2NYHA 4MK9A 3MM6A 2GQCA 3HHNB 3C6TB 2N3OA 2P9SA 4KO0B 3ZSYA 2KZMA 2CQDA 4QIGA 1G6BA 1C1CA 3QRRA 2PD1A 3L8BA 4L75A 2FZCB 2MHEA 2Y1LB 2R7SA 5BRDA 1FTCA 4CH7A 1CVJA 1NJXA 5C2CA 2MQOA 4P7VA 1U8SA 3SSRA 4DV2J 4U95A 4Y00A 4IOCL 3W9IA 2OTLS 4CZMA 1HBUB 2OCEA 4ZP9A 2BJ3A 4LREA 2GX9A 1LOTB 2FDNA 1GLBG 3ZLJA 4IKFA 5KPZA 3MMJA 1WSEA 2LQ8A 2MZQA 1HX1A 3ZSWA 4B9UA 3CHWA 1IBLJ 4AXIA 8RUCA 3LP2B 3NF7A 4AYBD 3N6NA 1MMNA 3HFZB 2RQCA 4KBIA 4IOAQ 2FJAB 3UR3C 1P9YA 5D6GA 1HNXF 1KTVA 4CJKA 2W9CA 3C94A 4AE5A 4DCJB 1B7FA 1R0AA 3AAPA 5H1SV 3DXMB 5H9FJ 1OIAA 2R7QA 4CHPA 2ZH9A 5TKYA 3QFPA 1RDRA 5HLFB 4DV5K 4J9KA 3WC2A 1R0CB 1XHXA 5C25B 2Q1LA 1NRKA 1VSJA 3SCKE 3ILLA 1FWPA 4YHHF 4C2MA 3VAFA 2CQ2A 5DDPC 2WONB 2I38A 1RHQB 3OS2A 2CWXA 3W2WB 4B3RK 1M1GA 4AT1B 4F0MA 2E1MC 4JB8B 4DQPA 4IZ9A 1T02A 1RWUA 3CYMA 4NXNF 3NGIA 2EPIA 4M5NA 1FNMA 3QGGA 1FJGK 3BY5A 5IC4B 3QLHA 2J6SA 2EW9A 5HROA 3D0PA 4LUBA 2B6AB 3NVMA 1WEYA 3UE5A 3EVMA 1U4BA 1R31A 5K14A 2A6OA 2COLA 3KD1E 1S9EA 1REVA 4H0VB 4R8UB 1RSCA 2HWHA 2M9KA 3H7HB 4ANDA 2ZBRA 2AP1A 1E6YB 2XMWA 5KT5A 2W01A 1HMVA 2RF2A 4DUTA 3G9CA 4WK3A 1VC6A 1Y7PA 3B6PA 4BRLA 3QEPA 4HVZA 1U8WA 4Y2IA 3WUHA 1RQ0A 2B4UA 3IG1B 4ILHA 3V6KA 4WF9L 4KHNA 1TYQA 2YY3A 1ATSA 1U04A 4F50A 2ZVIA 3DCAA 4J9NA 2Q31A 2MPUA 3A0IX 3G6VA 1P1LA 3AVJA 4B8AB 4RUBA 4NLSA 4AQYK 4YB7A 3AFGA 2K1RB 3P45B 3HP9A 4KGVB 4FDFA 3QSYB 4G1QA 1WSRA 4CRJA 1DARA 4A2BA 1SKRA 1I3AA 5CYQA 4G1IA 3CPWR 2QI2A 2NZ4A 5KG1A 1M1HA 4CGDA 3AJDA 3EDRB 2ZF5O 4WTYA 1K9MO 2JX2A 1SV5A 2D0BA 4CBUA 3J81O 5L9NA 2F9DA 2BQ3A 1BHLA 3GJSB 1VI7A 6AT1B 2RDIA 4JI6F 5KFBA 3VEYA 5IFMA 1VQ8S 1LK5A 5JMVA 1NJIT 4ZVRB 4X4RA 2R7WA 3UB5A 3BBBA 1S1WB 4OZNA 5DLGA 2Z2MA 3QT7A 5J1EB 4AHRA 3JXOA 3OV7A 3W62A 3O4NA 4CFBA 2CPFA 4A8QA 1UEKA 4EBEA 1DY3A 1B70B 3DLEA 2KG0A 3HHLC 3R6GB 5IWAF 1KC8T 4OX8A 1FD8A 4W90B 3GG4A 1YVFA 2MKCA 4DV1K 4RW9A 2P9NA 4FLYA 1V5IB 1M90T 2ZH4A 3KZBA 3UKUB 3C7NB 4LF2A 2F8MA 2AGPA 4C8MA 5I3PA 5J2QA 2FBVA 2HPUA 2HVIA 4ED7A 3EXCX 4O3QA 1UMJA 4ZLPA 3SDEA 2GGPB 2JL9A 4O8KA 2XZTB 4MYTA 2A42A 2MGZB 4OJ1A 3JSRA 1W9HA 2KM8B 3D68A 2D1CA 3D6FB 3GV8B 1IVZA 3AVIA 3VGUA 4N56A 1O13A 4OHVA 2OPPB 3EPGA 1QY7A 3UKRA 3QPIA 3HRGA 2UXCJ 3TABA 2B5JA 2J8SA 3VTHA 1H73A 2CPHA 1ZM3A 5EXWA 3DXKB 4G65A 1S9FA 3QYYA 3ULHA 4WPAA 3H2VE 5E33A 4DQIA 2O8DB 2D3UA 2GVDA 3MN9A 1B3TA 3FC9A 2ZH1A 2XM3A 4FF2A 2I2YA 1I6JA 4O5FA 3BREA 4Y0FA 2YKMA 2EG2A 1HWUA 1ASUA 5B0AA 1TL3A 3G25A 4CJQA 1SKSA 3FKBA 3RUBL 3HYFA 1RT6A 2JWNA 2QEXN 1UA0A 4QWBA 3SQ1A 2OZMA 1RTJB 1IBLK 2H54B 3W60A 2W4PA 4OX7A 2ZWOA 2BQRA 4BACA 3Q8UA 1E6VA 4KTWA 4E7LA 1NDLA 1JJ2R 1XMQJ 2MZTA 2XY5A 3WXMB 1NPRA 4KBOA 3M05A 4YUDA 2O01C 2QL7B 3NWRA 3MZIA 2ZOFA 2AEMA 1S72S 3FZFA 1DEJA 3CCWA 4CHNA 4UOFA 3KKSA 4DN0A 5IV4A 3M32A 5ETQA 1KAZA 4XH4A 2ZVSA 4LT6A 2HNDA 2B9XA 3GFXA 1M1KO 5D4PA 2HRUA 3K7RA 3NAIA 2W41A 3O6WA 4USKA 3ILIA 3QGHA 4DV7J 2ACMA 3MEGA 2ZJQL 4JKGB 1CS4B 3VGKA 1T9UA 2H4YB 4IOBA 2MQLA 4RZRA 1Y5NB 1SJFA 1RT4A 1ULRA 2MY8A 4RW4B 1ZA2B 1VQ7S 4Z7YA 4XEIA 2GX8A 3VHQA 1JX4A 3KUEA 3T3FA 4CK3A 4AHTA 4KRWA 5HVFA 4OJHA 5C24A 1RHRB 2F40A 5HJXA 1R27B 2G0JA 1RK8A 5HP1B 3B82A 3V81B 3E8OA 4X66K 1X4DA 2GV9A 4YDDB 3PKMA 3A3OB 2W7PA 1U25A 1KOOA 3CC7N 4EZ6A 5MLCV 3NGSA 4MK7A 1VQNN 2HWTA 2VGMA 2GBZA 1S1TB 3PZPA 1K73O 1S79A 4RNHA 1GTHA 2MZ1A 2VJUA 4BR9A 2W7OA 2RUGA 2AQ4A 3TJ9A 2V8VA 5A8RA 1XQSC 3S01A 4A8MP 2H65B 1F2GA 2QL9B 3HT3A 4WFAQ 2HAFA 4LSZB 4USMA 4JI7F 5KFTA 2RD5C 1HNIA 3QIOA 1R8CA 2K7KA 4WFNQ 5D77A 2XZWA 3HVRA 4DV4K 3HZGA 3SK3A 4CJUA 2B56A 1RWNB 1JKHB 3IFEA 4L6V3 3J7AN 2OD4A 2E88A 1WF2A 2ASLA 3DFEA 3M8WA 4FJIA 4H0YB 4WU2A 3NP5A 1UFLA 2R8IA 4A62A 1F5AA 2J6UA 5HANA 2ZBPA 3RBXA 3HTVA 4USHA 4L8RB 3MR7A 4Q8FA 2VB6A 4WYWA 3VZHA 4HTLA 5J2NA 2D0PA 2V4QA 5KG5A 2VICA 1ELOA 3BQ0A 2I1RA 4FJKA 4F3OA 1NJWA 4B3MF 4MLEA 4IH7A 2IAJB 2ZGYA 1FA0A 3D7SB 4P2XA 1D09B 1XMBA 5KFFA 4YDXA 4DQ8A 1N32J 1BQNA 4FZVA 2X6NA 3VENA 1KWMA 4ZVEA 1I94F 4PQUB 2BZ2A 3SQ2A 4KB7A 3I0RA 2UVVA 1R8PA 2GC8A 1TKTB 2E7WA 2XI2A 5C10A 3AGRA 2M70A 4Z2XA 4QZVB 5K8NA 1RHUB 3W8PA 4Y3CA 1JJ4A 1R6YA 2VC0A 4H4MB 2JNJA 2F4VJ 4NOHA 1EARA 4JS4A 3DHWC 1K8AT 1BI4B 2OPRB 1EQYA 3W5ZA 2Q97A 4JV5K 5EWEA 4JI0J 2H5EA 1FW6A 5KOXA 1SI9A 1KD1T 1VBYA 2DNNA 2EKYA 3LDNA 2BW2A 2CJBA 5C0YA 1Q79A 3J7ZT 3BZKA 4WZQA 3UD5A 2Z1IA 4FJLA 4KV8B 1IBKK 2DNYA 4B9VA 3CE8A 4DR4J 1HWKA 5DM7Q 4H4OB 4FK0A 1XNRF 2H3GX 3G71S 2YHBA 2CQPA 3M8QB 1V4TA 3JS9A 3MOJB 1KTQA 3T5HA 1W7AA 1FEEA 4X4OA 3DDNA 2E44A 2ZH6A 3CJCA 1X3MA 1Q16B 2B4OA 2Q3SA 4KHSA 2XNRA 4HHHA 3CQ8A 3HKWA 5DM7L 3I0SB 3AY0A 4TY8A 1RYRA 1VQPN 1C1BA 4FPAA 3SBTA 2JWKA 2UXCK 5KFGA 2VCPA 4K4YA 2KTQA 5F0XA 1LCUA 3HCXA 4DB3A 4OLPA 5EX3A 2LVWA 2QN6B 3RMAA 4H5RA 3U1NA 5A6PA 4K0KK 4ZKAA 1CQNA 5F0WA 3I56S 3CPEA 1OYEA 2RN2A 1EJ7L 4FZXC 2EEYA 4ED1A 3CD6S 1AFJA 4AD6A 2QLBB 1FRJA 5CYMB 3KFWX 2XGQA 5DG9A 4JI5F 3DN9A 2QJ3A 3T19A 1VSEA 2KVIA 4C8LA 4NASA 2CDQA 5T7BA 3MR2A 4NI2A 4J2DA 2VBXA 1YITS 3R3TA 3LQVA 1S6PB 4I68A 4IH5A 1LW0B 4W4MA 1NB2A 3MDQA 4Y2KA 2LDYA 1UEUA 2WSCC 2Z56B 4A8WA 4GO7X 2FYXA 1RAIB 2VG6B 2DFFA 1RDCA 4CBWA 2KKHA 2WZ1A 4WFBL 2UXDK 4DTSA 1J5EF 3KHGA 3MUVP 2RNEA 5HVGA 3ZNJ1 2C2KB 1X5SA 2ZE2A 2HBZB 1L3VA 4TYBA 1HQUA 4RR5A 4DV7K 3NVKA 2O8EA 2ZM6J 4DF8A 3CXCR 5KFQA 3TA2A 4JOUA 4U8YA 2LLZA 2UP1A 4CF8A 1RBOB 5E3PA 3NGTA 1VRQC 1GQEA 2LP4A 1DRZA 1JWWA 3N79A 3VVTA 3D2FB 1ZBHA 3VQAA 1D3WA 4QJVA 2FTRA 1ZXOA 2FVQA 1PCAA 4P52A 1TK8A 3U7JA 3VCDA 2VG7B 4CO0A 5DDQC 4MO4A 4Q44A 4JP8A 1MG7A 5KG6A 5CE3A 3TAMA 5ETRA 4Y65A 4CECA 4FLXA 4I7FB 4K8XA 3PV8A 2VFUA 3M30B 4AUKA 3FFKB 3DRRB 4HUGA 1FO1A 2W1BA 4LF7F 4LH5A 2G8HA 1BQMA 2DGOA 2O8BB 4WK1A 2RHKA 1MU2B 2HBJA 1X4GA 2DTUA 2M7SA 2CFXA 3CJ9A 1WHXA 3T1YF 1NOZA 3MN7A 4H54A 2CVIA 2GIRA 2ASOA 3B8HA 2LXUA 1QHTA 2O8CA 4LQ9A 2GELA 2VA3A 4DV0J 4BY9C 2QRRA 1IR0A 1KFSA 5KFMA 2ASYA 4XIUA 3CMES 1EZZB 2NNWA 2AF6A 4EP4A 3D2WA 1R6VA 2DGSA 4ZJQA 1H2UX 3ENVA 2UV8A 4DU1A 3KNGA 4PKDB 2IRXA 3M6UA 2OANA 3RRKA 2XMUA 1T9TA 1GOAA 3G0ZA 1OQ3A 3OR2A 4OKEA 3M2RA 1V3ZA 3CCUN 3QWUA 4DS4A 3ENWA 2HBRB 2VQEK 2C22A 3KJNB 3C14B 3L09A 3HKZD 3H40A 1TUGB 3BF1A 1NLKL 1RKJA 2PI4A 2I7NA 2RKIB 5JLFA 3AB2B 3F5TA 1UWAA 2A2DA 3MN6A 3ENHA 3WHIA 3CCMS 3B54A 2DJWA 2P9UB 1YBTA 1RT2A 5DRKA 4F3TA 2AZ3A 2LSNA 5SZTA 4PAAA 4C4WA 4YOTA 1X3NA 1RTHB 5GAGP 5JUMA 5H9EK 4FYVB 1X1PA 3VPZA 4BREA 3OYGA 2FHKA 4JI0K 1HPZA 1HD1A 3O44A 3VVUA 4DPXA 4WIQA 1VGYA 5AXMA 2IVPA 4CLZA 2VG5A 2PYJA 2ETJA 5EX0A 2OMOA 1WUUA 1QM9A 2ZNYA 2E5LJ 3DJCA 1YSJA 1NHKL 5CZVA 1NMNA 3KK1A 2YHXA 4MIWA 2E1AA 1UWBA 4YY3J 5KFAA 5E7OB 4YEAA 4QYZK 1AYEA 3CCJN 2KB2A 1HNWF 3O3HA 5L1JA 4GW6A 4NYPA 4WQ4C 3RBEA 5EGYA 3KWMA 2N7CA 5ETVA 4KPYA 4OV1A 3JAMO 3BS9A 5LMNF 3V2UC 3R2CJ 2DY9A 3M9NB 4H5NA 1C0GA 3PYDA 4ZHRA 4IDKB 4A5BA 4WCEQ 2M8DB 4H4KA 1NGFA 4K8RA 2QWRA 3AJ1A 3Q86A 4OYMA 3LALA 4HHUA 2ADCA 2P6SA 4C3KA 4IR1A 2XMTA 2D3O1 4OI3A 2NXEA 5DGAA 2JEIA 4DFJA 2G8KA 4ZVHA 3FSYA 3QO9B 5J2MB 1YTYA 4KHWA 3DGPA 3J7Z5 2YI1A 3KWGA 2YKOA 2A2CA 3HF5A 4WCEL 4DR2J 3HM8A 3CDBA 3D45A 4ES3A 3L2WA 2PA8D 2CQ0A 3O9UA 3DDIA 4DR1F 4C11A 2OUGA 5KGWA 3O8WA 2RE1A 1D9FA 2HF3A 4HUFA 4C6AA 3AOCA 4CJ7A 3JB9k 4QIWD 1F5BA 2DIUA 3QEVA 2WTUA 2NS1B 2HZAA 4LR7A 2CQ4A 3RB0A 3OVSA 5KPTA 4AL7A 1Y11A 3FEZA 1CJVB 3FBEA 2HNZB 1BLUA 2Q43A 2XULA 2LDIA 4Q45A 3KLVA 3I5BA 2AGOA 1S76D 4MMOA 4C1NI 3VWSA 3VESA 2HQGA 4KHUA 4LR8A 2PFDA 2V8DA 3NRBA 4X4SA 1HQ2A 3M8YA 3PTWA 4DX6A 3C16B 1AZSB 3D9BA 4OGCA 2KT3A 5LJVA 5BR9A 1U0SA 2QG9B 3AHPA 1VSDA 4FLVA 4TSXA 3J7YP 4ZDNA 3J81Y 4W5QA 3OYCA 2J0WA 4GRSA 3Q0AA 1ZA1B 3MXJA 1VHIA 3VQCA 3CJAA 3MI7X 4XTTA 4KAIA 4PWDA 4M5LA 4JRPA 1C0UA 3N6LA 1KLNA 2HNYA 4BWJA 3MM8A 4IQXA 3G4SN 5D8HB 4BS2A 1TL1A 2OSQA 3ALYA 4CD3A 3Q8SB 5AXLA 5LY3A 2A6MA 3THWA 4NLXA 2V51B 3K17A 5KT2A 4CF9A 2PDAA 2D1KA 1X0PA 1NUEA 4H8KA 3K5NA 5M1QA 1HNVB 4K5RA 4ERDA 5M2UA 4C0BA 1ZAWA 4F4AA 2HFVA 4O0JA 3FSXA 2P9PB 2P5OA 1DURA 1XNQJ 4ER8A 3CFOA 1ZAXA 3BYPA 3IBCB 2OTJN 3NNCA 4CF0A 4M3YA 4TLRA 3MMCB 2O66A 3OTDA 2P9GA 2DY4A 2ROEA 1OH5A 2ILYA 4CYUA 1QAXA 1YQHA 2O4GA 4UY8T 4QIVA 3SJJA 1HBNB 4DV0K 4LVOP 5AR0A 2POKA 2LQ5A 1RT1B 2R42A 2ZD1B 1LKZA 2M5YA 2G13A 2KRRA 4KH0B 3HHLA 2AZ1A 3GSDA 3OL9A 2OI2A 2XYHB 2E1YA 1HWLA 2HSEB 3QAUA 1AUDA 4HACB 5E41A 1U1OA 3HSCA 2HGMA 2IJFA 5GAHP 2XWYA 4DV5F 2C2ZB 3OVAA 5LJ5Y 4RW7A 2H5IB 1HNXJ 1WSFA 3IBWA 3EGNA 2FZKB 3FRZA 5B0FA 5I42B 2J9DA 1IXKA 2FF6A 1BA1A 3BH7B 1Z2ZA 1SJRA 1CSJA 3V9WA 3CCRS 3BB5A 2B9YA 2AD9A 1BHNA 3AO2A 3CCES 4IR9A 1W25A 3PFOA 1JCFA 4O55A 4U67Q 3C3LA 1RDAA 3F73A 4USIA 4YHHJ 1FJGF 2QSWA 4KGZB 5JLHA 2I0XA 1WTFA 1YT3A 3N01A 2RUSA 2KHDA 3M1VB 3IRWP 1CQMA 1DQ9A 1Q82T 3LDPA 1KVKA 4DPOA 2V9WA 5L9XA 3M6WA 1U45A 4O4GB 1OQ6A 3WT0A 4ID1A 4DDFA 3RAQA 3AD8C 4RNFA 2QW9A 1I5OB 1HMVB 3OA9A 1HWJA 4NCGA 5HO4A 4NXNJ 4ZVTB 1IR2A 4X4TA 1T44A 1PG5B 1Z25A 3OFHA 3FK4A 4MIBA 3W9JA 1QAYA 1AB8A 1IKVB 3DOMA 4NO7A 4JKCA 1TYQB 3QDKA 3AQPA 2FC0A 2H1YA 3IAS9 4GKKJ 3H25A 1JXBA 2GMLA 3DNCA 3TSQA 3CMQA 4WQ5C 2QWQA 1R7IA 1UP1A 3GYNA 3TW0A 3GILA 2BJ8A 1HPMA 3I4HX 4DFMA 4OI2A 1XMOK 1FERA 3PSIA 4G1QB 4YN3B 4ECYA 3CC2S 4NPOA 5AQOA 1DFDA 4F7VA 3MCMA 2OEMA 3U8XA 2CADA 4A59A 4OI1A 3TQEA 3H3OB 2YWKA 1NK5A 2ACYA 2I8EA 2JEJA 2WOMA 4IG3A 2W24A 2ERRA 3LZJA 4LRBA 4OZLA 3QMLA 3ZT3A 3GZ7A 4IO1A 5L1IA 2ZC4A 2EWSA 3SAGA 2J0XA 2YBVA 1RDUA 2WVEA 3LGHA 1LWFB 3OR1A 3C15A 3SCIE 1MWQA 3BJYA 1NDKA 2MQQA 3NMAA 3RR8A 4HCCA 3VAKA 2HGNA 4ISGA 4CJ3A 4EBDA 3EKSA 1JLQB 4FJHA 1IKXB 4FW2A 4BGBA 5M1NA 3QT8A 3RGIA 5HBMA 4FF4A 4I6MB 2OEKA 4MFBB 3C6AA 4B3OB 4U7CA 1Q7LB 3EJMA 4URGA 3LP0A 4ZTFA 4ZJLA 2W8KA 4JI6J 1B0PA 1U1NA 4C9DA 2IRUA 2QA1A 1FDBA 4ZPTR 4QBUA 4M5HA 3NS6A 2Z2YB 1VQLN 4DV1F 4P2SA 3ZZRA 1YJTA 3DLGA 2EBGA 2RVJA 3IMXA 5ELZA 4EIAA 2C2OB 4I2PA 1BG3A 2BM0A 4OJGA 2R2UA 3VV2B 2HFZA 2QWMA 1BC6A 4N8OA 2KZZA 4DPTA 5IWAJ 5A2QU 4USWA 2Q36A 4OV6A 4DFPA 3BP8A 2HK3A 1KVBA 2O8FB 2RDDA 2V6AA 2AYGA 3TVYA 2H5JB 2BJ1A 1TV6A 4O3PA 2VODA 2FJBB 4DPYA 1IJJA 2QKKA 3GE9A 1SUQB 1X4FA 3G86A 1X9SA 3LM2A 4DG1A 2PI5A 5DG8A 1B0TA 2YQ0A 3EE3A 4R25A 3D2EB 3HD1A 3N4PA 4IG0B 1VQ4N 1RBLA 3KLEB 3LPYA 4X2BA 3UR0A 3TU5A 1IG8A 2OEJA 3EZ5A 1SCJB 1SL1A 2XG8A 2UV8G 1CLFA 4O44A 3OSPA 4OGEA 1AW0A 3D66A 3VOVA 4BRNA 3EN9A 1IM4A 3SLCA 1XNQK 2DR7A 4WKRA 3TA0A 1UL3A 2MKIA 2VD3A 3O3LA 3TR5A 4USJC 3P39A 3OYMA 1JQGA 3DYAA 1E6VB 1U1PA 4EI2A 1CC7A 3HHLD 3TEGA 1IBLF 4QWEA 4JD2B 2IM3A 3VTIA 4PEOA 2DXFA 2LU1A 3QGIA 4U96A 1WG4A 2WBMA 4IYQA 2JVOA 3KUGA 4PY5A 4D3GA 1U2VB 2Q2RA 5C12A 5F8NA 5GINA 4LSNB 4KFBA 3RMCA 4V19X 5CD4A 4I56A 2RHSB 3MEDB 4DI6A 2YNGB 2FVSA 2B4JA 3DOLB 3SIPB 1T03B 4CGHA 1N33K 1CULA 3MD3A 2XWXA 2E1PA 1YJ9N 1VK3A 5M2PA 4V19J 1CJUB 1PJ6A 1YIJN 1F3VA 4CEBA 1WDTA 1HNXK 3UE2A 4M45A 5F3TA 5AQKA 1VQ9S 4KHYA 4IO9L 1H2TZ 3M4XA 2OGUA 5KFRA 1SJ4P 2QMWA 3C46A 3DU6A 3RYLA 1S7IA 2E2PA 1N52B 4UY85 3WEEB 1KKHA 5M1FA 4A61A 4CFDA 4F3QA 1RT7B 1SKWA 2CQIA 4FYXB 2QXFA 4FVMA 4CM2A 4DUYK 2EFNA 2UUBK 2GQQA 4OO1J 5C2FA 2E2NA 3CPWM 4X66F 1NEEA 3MPUB 1UOCA 4ENOA 2GUPA 2V2VA 4CF1A 3PX4A 2LEBA 2DHXA 2X1AA 2ZGZA 2GIQA 2H48B 2KLAA 4GV9A 5KFIA 3KLHB 2BJ9A 4ZIVA 3UI3A 3V4MA 3MD1A 1EKSA 2D9OA 3B6BA 3DMJA 2NUBA 1YJNS 2QE5A 3MX5A 3KKFA 3K9KA 5HN0A 5A8WB 3RR7A 1FX2A 3M1FA 1BY9A 2P9IB 2ZBCA 4PUOB 1PJ5A 1TKDA 1R8BA 2HKEA 1IWAA 4GKKK 1A9NB 3MM7B 1CG2A 4DV4F 2VGNA 3D1HA 4WKYA 1J5OA 1V5VA 1VRTB 3NBPA 1WSIA 3NXZA 3Q8YA 4X65F 4J9UE 3ZEUB 4PABA 1NK0A 3E51A 3D7EO 4BDYA 4E8UA 3S1TA 4DTNA 4PA1A 4KI6A 2QFIA 4JI7J 4B1VA 2O4IA 5KOWA 3RG6A 3UDCA 4F25A 1F9EB 3W66A 4X4VA 2OPSB 3NF8A 3ENQA 5FDLA 5FPNA 3LANA 4BCAA 3AD9C 4R0JA 4MQ3A 2OFHX 1S6QA 3G87A 3DC2A 3GYGA 4C97A 2DBBA 2A40A 3VQEA 1OPIA 3KLIB 3IGNA 1GLLO 1FWLA 3CJTA 4BRMA 1F5CA 1S1VA 4CK2A 2R7XA 4MKYA 4BC3A 3SQGB 1RT5B 3O5BA 2CJYB 3FZ2A 3HT0A 4CLKA 1IKYA 2V7ZA 3CC4S 4BE1A 3QATA 4PCQA 3ZSOA 4B3TK 1S99A 3A8IA 4ECVA 5J2PA 5AQLA 3MMAA 1VQKS 3UDEA 4ED0A 3HSGA 1VQ6N 2LXFA 4DL7A 4LF9J 3DXSX 4URQU 1HARA 4CDIA 3C6UB 3RSEA 4CEFA 4JI6K 4OL8A 1NJYA 1I94J 4GC7A 2G0IA 4BDPA 4JV5F 4BE2A 1WHVA 3GMGA 1TUWA 3CCVN 5AE1A 3HPHA 3F41A 1MWKA 3ET6B 3L7OA 5DQIA 2CGLA 3S3OA 4JUZA 1UW4A 2YNHA 5DQGA 1JLFB 5AQRA 3TP2A 3EX7B 4R79A 3N5BA 1IBKF 2V8PA 3OL7A 2PMZD 3N4WA 1WAJA 1WB9A 2QA4N 3CJRA 2R2RA 1CPZA 1QE1A 4O5BA 1P8GA 3OYNA 1RU1A 4ILMA 2ZHBA 3ZNUA 4A2AA 2CH6A 3C6HA 4CEZA 4S0MA 2CVEA 1Y5IB 1NPKA 3WX8A 2ZKUA 4X62K 5IC6B 1RAGB 1AXQA 2C3UA 2A3ZA 4RKUC 5AFUA 4B3SJ 2VWJA 2DEIA 2C2MB 1XNRJ 4I6YA 1T0TV 1U0HB 4OYXA 3PJXA 1T11A 2GFFA 1X31C 3FFIA 3NCPA 1HR0F 1RHKB 1RE1B 3O8MA 3EGZA 4E98A 1TU0B 2R8JA 2YX1A 3Q2SC 1YZ6A 2C2NA 3ZT2A 2B7BB 3LP3A 3AY9A 2RAQA 1MA9B 5D15A 5BJRA 2KW4A 1Y3JA 2XS7A 1HBOB 4JI1J 3D67A 3ZX0A 2DCLA 1Z05A 2XY8A 1SL2A 4K0KF 3QETA 3NAEA 3EWGA 2G9OA 1ZC6A 4A48A 3F9MA 2FGOA 1XC9A 1HI0P 3NGRA 1U1QA 1HUXA 4K2XA 1SJ1A 3CCLN 2JEFA 1Y10A 4P73A 3DI6B 4RWWA 4WJBA 2EI5A 2UXBK 2DNKA 3DWLA 1YRUA 1GMWD 1P27B 1HHSA 3QFUA 3O9TA 4EMDA 2C2DA 2BKOA 1WC3A 2QA4G 5KPRA 2PY5A 4KKOA 3O80A 1G3OA 3EE9A 3JAMY 2HHVA 1KFDA 5EDWA 5HMXA 2AMCB 1VHFA 4DTPA 4X4UA 3H1QA 3H5YA 1SH3A 1NM2A 2ZE2B 1QSSA 4BR5A 1XWLA 2UXDF 4AHUA 2BDPA 2ZH7A 1NNDA 2E66A 3UVJB 2DR6A 1ASVA 4BRHA 5KFHA 4QWAA 4NLQA 3DHXA 4EP5A 4DV7F 4UQTA 3NOCA 1NZAA 2KT2A 4WQ4A 5C15A 1NGBA 3SQOP 1TVRA 1X4HA 3LWLA 4PYDA 2GZOA 4MT1A 2FHMA 1PBUA 2XO6A 2ATCB 4HTIA 3MEEA 3PCOB 4JNEA 2AW0A 3W65A 3TSUA 3CM5A 2PAVA 3M5RA 3NCRA 2YH1A 3THXB 4CIGA 1V3SA 1MMLA 1T3VA 4MTPA 3K2YA 3NS7B 3K5MA 2VASA 4RNMA 2KM8C 5EOYA 5GAGU 1OSDA 2V8HA 2DRAA 3IP0A 4CZHA 4DR7J 1F1BB 3NEKA 3L2QA 3HHDA 2HVDA 2ZH8A 3UFCX 3G6ES 2VONA 3CJSA 1N6QB 1VQMS 4LF6J 4IJAA 2G8UA 3H90A 6FD1A 4LRAA 2HHQA 4M3TA 1HL6A 5AZJA 3WXJA 1FJ7A 2DPNA 1VQ5S 3BYRA 4EHUA 2BANA 1O0PA 1ZM2A 2ZC3A 3QESA 4HYKA 1FHTA 2NPIA 2IFXA 1D1UA 3KHYA 5IT0A 4LF7J 1ZH5A 4ILLA 2LQBA 1JL1A 5GAGI 4CEAA 1FKPA 3DRSB 1Y5LB 4WP8A 2QT7A 2JEGA 5L38A 3QWPA 3A8EA 4F4XA 2E6LA 3V9XA 4ZVGA 4ZIWA 2DFEA 3T1YJ 2IBOA 3PIOQ 4JI7K 2AJ1A 2CJXB 1RP5A 3PIPL 3AXKA 2R4FA 3MECA 4W5NA 2XZDB 1MN9A 4KI4A 2IBKA 1IN0A 3Q2TC