5HBMA

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
554
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 161
structure length 552
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hbmA05
1HPZA 2ASLA 5EUHA 4CEOA 1IKVA 1VSLA 3CJ2A 4FJGA 4WFYA 3ZT3A 1BHLA 1VRUB 4MFBB 4NRUA 3NE6A 1L3TA 1S9FA 4EBCA 4MK8A 3KLHB 3KD1E 4Z4EA 5F8HA 3I5CA 3AVHA 3QLHB 4DMNA 1UWBA 4K8ZA 5FDLB 5KT7A 4TYAA 1RT4A 2O4GA 5KFMA 3ZT0A 1MMLA 3KHRA 3WNGA 3DYAA 2XY6A 4EYHB 1KSPA 1D8YA 2WRMA 1JKHA 1SH2A 1RT5B 2AQ4A 4J2DA 3CO9A 4CJPA 1R0AB 1LWFB 3JSMB 2G8UA 5J2NB 3S3OA 3KK2B 2NUBA 2I5JA 4CEQA 4F3TA 4WZMA 1BGXT 4CIEA 2W42A 4B9LA 5C5JA 1RTIA 4KKOA 4F4YA 4DU3A 2IC3A 1XR7A 2LSNA 3DMJB 1IKXB 4ZVHA 4ED7A 2XC9A 4CGHA 3V6DA 3DRPA 1RA6A 3KKSA 2D0AA 3UPFA 2FJWA 1SUQA 3DOLA 3OYAA 3NHGA 1JIHA 4DL5A 4R8UB 4FJ8A 3VA3A 3SJJA 1SKRA 4FK2A 2KZMA 4ECUA 3HYFA 3AVBA 3Q8RB 5HP1B 3NF9A 4QWEA 2W8LA 1HQEA 3PW4A 2OPQA 3P5JA 2UUWA 4XIUA 2DFHA 3HVTB 4ED3A 2Z1HA 4B9UA 4DTPA 4K4XA 2RPIA 4PWDA 2WONA 2IAJA 4FZXC 1BQNB 4CJWA 3DLGA 4CHNA 5F9NA 4EP5A 1KVCA 2CKWA 1TL3B 1L3SA 4R5PA 3NH1A 4FJ7A 5T7BA 2V9WA 3RR8A 3KKRA 4DLEA 3AO1A 5KTQA 4Y34A 4IH7A 5KFFA 2B5JB 3AV9A 4H4OB 1J54A 5J1EA 4KHSA 4LSLA 1NHVA 4CGFA 2DY4A 4KI6A 3DRRA 1YVUA 3S3NA 4DSIA 5EWEA 4N47A 1TL1B 1KLNA 4KTQA 4FJ5A 4FK0A 1CSJA 3NF8A 2QKKA 3IRXA 3ISNC 1KFDA 3KMQA 1JLAA 1SL0A 5KFTA 4DQIA 2KQ2A 4IFVA 2FVQA 4Y1DA 4I2QA 4B3OB 4ZVEA 2EHGA 1S9EA 3QEVA 2GIQA 2JGUA 2OA8A 4I2PA 1TKTB 2QK9A 3AVIA 4W5OA 4CHYA 3WNFA 2A1RA 1HYSA 1VSIA 3OL9A 1Q9YA 4J9MA 4HYKA 1BQMA 2V4RA 2XCAA 3TABA 4RW9A 4RW8A 3KJVB 4NLOA 4TY9A 3SCXA 2P5GA 2Z1JA 5F8GA 2KTQA 1QAJA 3VQDA 2QKBA 1FK9A 4IDKB 4KB1A 3L2VA 4CCHA 3AA2A 1T8EA 3DRSA 2FLNA 5HBMB 1KVAA 2ZD1B 4CK3A 1UAXA 2HNYA 4OJRA 3IG1A 2B43A 2YKMB 3V9SA 1Q8IA 4CF2A 3SI8A 5CZ2A 3FSIA 4Z4HA 1TV6A 5DLGA 1CZ9A 3I0SA 4NLDA 1RYRA 4FCYA 3K5LA 3C6UB 3V81B 1S6QA 3NGYA 4DTOA 3KLFB 4IKFA 1REVA 1J5OA 4DSLA 1NKCA 4WYLA 4KRFA 3K5MA 1FKOA 2WK4A 4ECQA 4CJRA 1KHVA 1S10A 1I3AA 4DTXA 2UUTA 3BREA 3QINA 3HO1A 2KZZA 4HUGA 1HPZB 4DTJA 3KK1A 3LALA 1IKVB 3OS2A 1FKPA 3QESA 4CECA 4HCBA 4QOZB 1JLFA 3BQ0A 4AHUA 3LANA 3G6YA 4R0EA 2IMWP 4LD0A 1X9MA 4E0DA 3F9KA 1C0TA 1MU2A 1DTTB 2DTUA 4XPCA 1XC9A 3RRGA 3KNAA 2R2SA 1GOCA 4YR2A 5C24A 1UWBB 4Q8EA 3H2LA 1RT4B 3CFPA 4RUCA 5KGXA 4RW7A 3DYAB 5KRTA 4RZRA 3IS9A 1JKHB 4CJ5A 4YR3A 1S48A 3KHHA 3KLGA 4CGJA 2JEJA 4J2AA 2AU0A 3AVGA 4IR1A 4TY8A 1VSKA 3V1QA 4N41A 4JUZA 5KFSA 3MEGB 2I5JB 3NAHA 3H4BA 1WAFA 1RTIB 4KKOB 4O55A 2IC3B 5DQGA 4F2RA 2R8IA 4NLUA 1C1BA 3O3FA 4I9LA 1ASWA 3AO5A 4MK7A 5KG4A 3V6DB 3DRPB 3NGIA 3QZ7A 1SUQB 3DOLB 5KI6A 1NK0A 4CJLA 3TR8A 4F3OA 5C25A 1TK8A 5E41A 1HQEB 4B9NA 4Q43A 1KLMA 3RB4A 4ZTFA 4Z4GA 3CQ8A 1B92A 4CESA 4Z4CA 3UQSA 1Z26A 1ZETA 2VG6A 5KFRA 4XO0A 1RT7B 3HM9A 2PYJA 3CIZA 1GX6A 3VQ6A 2WONB 4WXWA 1U48A 1Z4UA 3NF7A 4CJKA 3OYMA 3DLGB 3M8QA 4J9QA 3GIIA 4ECWA 4TN2A 4JV2A 1BISA 4YFUA 3T19A 4R5PB 2HMIA 2IA6A 3LPTA 3WNHA 3PO5A 5F8JA 3MFIA 2XY8A 4J2EA 3AO3A 2QE5A 5HRRA 4BDZA 3L8BA 5J1EB 1S9GA 4LSLB 2W7OA 3CDUA 4FLWA 3DRRB 3MR5A 4MIAA 4K4YA 1XHZA 1S1XB 3PO4A 3G0ZA 4DLGA 3MR3A 4CHOA 3RAXA 4TYBA 3NBPA 4MH8A 3HP9A 4K4UA 4FJJA 2DFFA 1WSJA 3ICLA 3QIPB 4AHVA 3OYGA 3D45A 3KTQA 3TAEA 1TKDA 3O4NA 4IFVB 1WSFA 4I2QB 1RT2A 3NAEA 3HT3A 3PX4A 3AO2A 3OL6A 4I2PB 1N4LA 4IR9A 1ZBIA 5KFPA 4DSFA 1L3UA 2G8FA 1HYSB 3BJYA 2E6LA 1O1WA 4Q45A 3QIDA 3PX0A 4ID5A 1BQMB 2BGGA 1WNEA 2IBKA 4RW9B 2X74A 2FJXA 4WE1B 3IN5A 3UDLA 3LZIA 3V9XA 4QW9A 4RU9A 1FK9B 3DRSB 2VWJA 3RR7A 5F9LA 2BQ3A 4O44A 3VQPA 4J9PA 1FXXA 1L5UA 2HNYB 3IG1B 4OL8A 1QUVA 1NOZA 2BRKA 4M41A 1VK0A 4CIGA 4Z0UA 3MF5A 1YT3A 3MXMA 1SL2A 4IH6A 3EYZA 1TV6B 3I0SB 4ICLA 2D3UA 3H5YA 2E9RX 3TAGA 4DTNA 2B6AA 3MR2A 4KI4A 1S6QB 4ZPCA 2HHQA 4FJIA 4ZP9A 3LAMA 4RNHA 1REVB 4MKBA 1J5OB 4O0JA 3LZJA 3MR6A 2GIRA 3ITHA 2FBTA 3VN5A 3OJSA 4I7FA 4KO0B 2C22A 1HYVA 4WYWA 4DEZA 4ELVA 1DLOA 4KPYA 1S1UB 4KFBA 3AVAA 2UVWA 3PV8A 5C42A 4M3ZA 5D3GA 1D5AA 4DWIA 4OKJA 1RBSA 4WZQA 4DQRA 3GIKA 4QWAA 1JLFB 3H4DA 1NNDA 4CK2A 1SV5A 3MTKA 1RCHA 4DTRA 3OHBA 4FLXA 4DS4A 4MK9A 1RTDA 4F4KA 1C0TB 1MU2B 3H59A 1S0OA 4QW8A 4N56A 2HHUA 1W25A 1TKZB 5KT4A 3QEXA 3ZSVA 5C24B 2RN2A 2ATLA 2VWKA 2R8GA 2E9ZA 3KLIB 4F4XA 4DSKA 4RW7B 2Q3SA 3K5OA 2IGIA 4DQQA 3OS1A 4ED1A 5DG8A 3IS9B 4FS1A 1KTQA 2XI3A 5I3UB 3N6LA 3RBDA 4LQ3A 1QHTA 3QERA 5EDWA 4FK4A 2AX0A 4TY8B 1QS4A 4O4GA 4UQGA 4CJTA 4G3IA 4HUEA 2FBYA 2R7YA 3NH0A 3SQ4A 4F8RA 2WB4A 5DGBA 2EC0A 4URSA 3ZT1A 4B8CA 1WSHA 2AGPA 2DPIA 2PYLA 1C1BB 3SUQA 4YMEA 2W9BA 3T5KA 2VG5A 2RDIA 5FRNA 4LY7A 1LW0A 4Q0BA 2YNFA 2R2RA 3D28A 4QWBA 4DG1A 2D5RA 3TVKA 1C0UA 3LP1A 2D7SA 5C25B 4DQPA 3DOKA 1TK5A 1KLMB 4KHQA 4BE1A 5KFQA 1JLBA 1S0MA 2D0CA 3N6MA 3OYFA 2Y1JA 1JLEA 3QZ8A 4E7KA 3VQEA 5HRSA 1YTAA 2XCPA 3GV5B 4IH5A 1IKWA 3LP2A 5J2MA 3VQBA 3AVKA 3OYJA 1RT1A 2XY7A 1KCFA 1ZTTA 2HMIB 4FW1A 1RILA 4EBDA 4J9SA 1BIUA 4HUFA 3C95A 3H5XA 4DU1A 4XPEA 1S9GB 4JV1A 3BGRB 4CK1A 2R2UA 3OY9A 2BANA 5KFNA 2WTFA 1S1VA 3NBPB 1WN7A 1EP4A 4NCAA 3VA0A 3NCIA 1HNIA 3U6FA 1RT2B 3K5NA 1RDBA 2YNGA 4L8RB 4C8MA 5L1JA 5DMRA 2KFZA 1RYSA 3H5UA 4DL3A 1RBUA 3RB0A 5J2QA 5KT5A 1QSYA 1T94A 4K4WA 4O3RA 4OGEA 4DSJA 4GVMA 1D1UA 3P1GA 4C8NA 4ID5B 3G10A 4CEDA 4BDPA 3DLEA 4AILC 3CM5A 4KTWA 3HL8A 2J6TA 3QEPA 3BSCA 3FDSA 1NOYA 4O44B 3PY8A 4FBUA 2OZSA 1VSHA 3KIOA 4I9QA 1Z25A 2A1SA 1TGOA 4C8KA 4K50A 2RF2A 3GYNA 5KFHA 4ICLB 2FVRA 2BQRA 2B6AB 4ED8A 1NJXA 3TAMA 4NLWA 3O4QA 4FM2A 1C1CA 5KFWA 1XR5A 1TP7A 3PW7A 2ZQBA 2IS3A 1EETB 4IOBA 1NK8A 3E51A 3ITHB 3BSAA 1LWEA 4I7FB 2FVCA 4O3SA 1GOAA 3VQQA 2XWYA 3HVWA 1DLOB 3HPOA 4KFBB 1BIZA 1S5JA 4ELUA 3PR5B 2AJQA 5D3GB 3L2WA 3ZSOA 4K4SA 5HRPA 1IG9A 1J53A 2X78A 3ZSWA 4DL6A 4RW6A 4TQSA 1SV5B 4NCBA 3SPYA 4PUOA 2VA2A 4BDYA 3AA5X 1RTDB 2VA3A 3V1RA 5KT2A 5KG6A 4Y1CA 3DLRA 1JLGB 3VQAA 3L3UA 3RTVA 4CJFA 2XI2A 3T5HA 3SNNA 1JL2A 4J9LA 3M8RA 2BDPA 3BQ1A 5CYMB 4J9RA 1J9AA 1RTHA 1KVBA 3AO4A 4B9MA 2G8VA 3VQ4A 4NLGA 4HCCA 4AHSA 4E7JA 4NYZA 1EKEA 2YNIA 3UR0A 4O4GB 3KLEA 3TI0A 4YR0A 2IM1A 1K1QA 1JXLA 3T5LA 5CZ1A 1S1WA 4ECZA 3V9ZA 4DU4A 4FLUA 4GMJB 4JS4A 2W9BB 4FJHA 3M9OB 4G1QA 5K14A 2IM0A 1LV5A 2VG5B 2PZSA 1XHXA 3RWUA 2CJQA 4Q0BB 3K2PA 2YNFB 4FZYA 2R2TA 3FQLA 1NKEA 4DG1B 3SQ2A 4KAZA 1C0UB 3LP1B 1WAJA 3NGZA 3DOKB 4IRCA 3L2RA 1Q9XA 1JLBB 4E1NA 5F8IA 1NKBA 1JLEB 3SUPA 4ECSA 4CEAA 5EWFA 1TVRA 4E7IA 1IKWB 3LP2B 3OYLA 3OYIA 3CVKA 2UVRA 3WNEA 1RT1B 3VQ7A 3KD5E 3KMSA 3AVFA 3KLVA 2E4LA 2OPSA 2HHTA 5KG7A 3QEWA 4CJ3A 3OYKA 1UA1A 3Q8SB 2FVSA 5FROA 3KK3A 1A5XA 1RNHA 2HWHA 3M9NB 4DF4A 1YTUA 1S1VB 3QETA 2XGPA 3VQ9A 3F73A 1YVFA 1WSGA 1HNIB 4CJ4A 3RB6A 4NLPA 1QSSA 4O3OA 2Z1IA 1TQLA 3SV4A 3I0RA 3VQ5A 3CDEA 4CERA 5KG0A 4K4VA 2YNGB 4CEEA 1B9FA 3JYTA 3ZT2A 3LDSA 3KHLA 1HYZA 1S49A 4ZHRA 1TK0A 3CWJA 1C0MA 4URQU 5J2QB 4DTUA 1JXEA 3S9HA 4KREA 1RTJA 2OPQB 4QAGA 5KG3A 2R8HA 2XHBA 4U6PA 3DLEB 3CDWA 3HKWA 2B4JA 3AVJA 5L9XA 2V4QA 4KHNA 4CF1A 2W7PA 4PWDB 1K1SA 2IAJB 1QQCA 5L1LA 1VRUA 4KAIA 3LWMA 4CFAA 3PHEA 5L1IA 2BR0A 2E6MA 3EPIA 3OYCA 4NLQA 3VQ8A 1ASVA 3EY1A 3TWHA 4YP3A 2ILZA 3BR9A 4FBTA 3TAMB 1WNSA 3CFOA 3DLBA 1C1CB 2JC0A 2RKIA 4FJXA 3RAQA 5HROA 1U04A 2C2RA 4PQUA 4QPXA 1RT5A 3IRXB 1QE1A 5JUMA 1KFSA 1JLAB 2XO7A 4M3XA 1LWEB 2X6NA 2HVIA 4RUAA 1R0AA 4HKQA 1S1TA 4Y2AA 2OZMA 4ZVGA 1S9EB 2ATQA 3NL0A 3MECA 2HVHA 4IRDA 3DLKA 3NF6A 3H08A 1NK4A 5KFDA 3MXJA 3K58A 4RW6B 4ECXA 4OGCA 4DSEA 4FZZA 1XI1A 2ASJA 4GW6A 3SI6A 3RRHA 4PUOB 1ASUA 4ZPBA 4WFXA 5KFEA 3MXIA 2HB5A 4RW8B 3TAPA 4BWJA 3QO9A 2OPRA 2O4IA 3B6OA 1N5YA 1T3NA 2UVVA 3HPHA 4PA1A 1S0NA 4CIFA 4RNMA 1JLCA 5L1KA 1SH3A 2IM3A 4TXSA 3NH2A 3THVA 4M3TA 1XWLA 4DL2A 3CJ0A 4ZP8A 4DFMA 3OSPA 5KG5A 1UOCA 3T1AA 3I5BA 5KFVA 3TARA 3D5MA 2YNHA 3CYMA 1VSMA 5JS1A 4KHYA 4AHRA 2C2DA 3UIQA 4FYDA 4FLZA 3NAIA 4EO8A 3NMAA 2YNIB 3KLEB 4HHTA 3PZPA 3MEEA 4CJSA 2HNDA 1FKOB 3OYBA 4M3WA 1S1WB 3LAKA 2FLLA 4QWDA 3PJWA 1CXUA 4G1QB 3OYDA 4BE0A 4AH9A 4Q5VA 4Y2CA 3KK1B 5KFKA 3TAFA 4TLRA 4JRPA 1LWCA 2HNZA 4KHWA 1FKPB 3QEIA 2OH2A 1A5WA 4TSXA 1BI4A 4FJ9A 2WOMA 1W9HA 3OYEA 4NLVA 3AVNA 1EXQA 1WSEA 3AVMA 1TAUA 2AGQA 1IH7A 2HHSA 3FQKA 2J6SA 3U3GA 4B08A 4FVMA 1ZBHA 5JS2A 1HQUA 3KHGA 3IGNA 2GBZA 1TVRB 4CGGA 2D3ZA 2IJNA 2V0NA 4KHRA 3G86A 1VSFA 4KHUA 1NHUA 4H8KA 2ASDA 3A2FA 2GV9A 1HJRA 4IDKA 2ITGA 4QCLA 3KLGB 4OPKA 2C2EA 1EX4A 3ZSYA 1LW2A 3V9UA 5KFBA 5CYQA 3E01A 1RDRA 1S97A 3HHKA 1IO2A 1IM4A 2XY5A 3KK3B 4NLXA 4GC7A 2X6SA 1NJWA 2G8KA 1IKYA 1U45A 1QSLA 2DPJA 1BCOA 1SKWA 1G15A 3P83D 4Z4FA 5F8MA 3HJFA 1RDAA 3ZSRA 4DQSA 5KT6A 1BCMA 3DM2A 2XGQA 5DK5A 3GV7B 3JYTB 1NJYA 4ZHRB 5F8NA 5F8LA 4CGIA 3GQCA 2IOCA 4FJLA 1RTJB 5KFJA 1DTQA 1KRPA 2HWIA 2VG6B 5KFIA 3VQCA 1QAIA 4IFYA 3OS0A 3M9MB 4ECTA 4FJMA 1SL1A 4ECVA 3M8QB 2P5OA 2DFEA 2FBXA 3GIMA 1HNVA 2VG7A 2JLEA 3U3YA 1VSEA 1D9FA 1DTTA 2G8IA 1UA0A 3HK2A 5HLFA 4CFCA 3BSNA 3OLAA 5KRSA 2G8WA 1T05A 5JXSA 3V1OA 3EPGA 2ZKUA 2R8JA 4B9SA 1X9WA 4FS2A 1N56A 4CJQA 4M42A 2RKIB 1Y97A 2XRIA 5HROB 3CFRA 3QNNA 3RMAA 4PQUB 5J2PA 3QNOA 3OL8A 4CFDA 4J9KA 1QE1B 3SZ2A 4M3YA 3QYYA 4O3PA 5KGWA 2BE2A 4NRTA 3NGDA 3HP6A 1S1TB 3MEGA 3PJXA 3HXMA 3MECB 3LP3A 3DLKB 4GC6A 2OYQA 2HAIA 1RBTA 4OPJA 4YNQA 1S6PA 3CJ3A 4E7LA 4CFBA 4LH4A 2YHBA 1LAWA 2PY5A 4LH5A 3DDKA 3V9WA 2D41A 3I8DA 3QO9B 3HVAA 5FRMA 2OPRB 3O3HA 1N5YB 2HHXA 3PVXA 3RMCA 4AHTA 4CHPA 1JLCB 4IG0A 3O3GA 1CZBA 4RW4A 2UVUA 2P1JA 4RG8A 4FJNA 3PW5A 2KW4A 3BSOA 2YKNA 2W9AA 1U47A 5KFXA 1RT7A 4BE2A 2FVPA 2YNHB 5DG9A 2IM2A 3AA3A 3LWLA 4FW2A 3VQSA 4CE9A 4HVJA 3DI6A 4CJEA 2AX1A 1NK9A 2HW3A 4NYFA 2ZE2A 4IRKA 3MEEB 2HNDB 4BACA 3ZSZA 1RT3A 4ZVFA 3MFHA 4CF9A 3D0PA 4AHCA 1NJZA 1HMVA 2O5DA 3QGIA 3HVRA 4DTMA 4F2SA 5C42B 1S1XA 3ULDA 4HTUA 1LWCB 2HNZB 1NK6A 2R8KA 1BI4B 3QIPA 4U7CA 2WOMB 4ZTJA 3OHAA 3M8PA 1W0HA 1I39A 5SWMA 3SQ0A 1VRTA 4KV8A 3OYNA 1HQUB 5KFZA 3OJUA 2FJVA 3QGHA 1U49A 4BWMA 4EBEA 1LAVA 4DFKA 2IDOA 1GOBA 3PX6A 3FFIA 4ED2A 4ED0A 4WE1A 4LQ9A 5DLFA 1T7PA 3QGGA 3G6XA 3MEDA 1ZBFA 4OVLA 1LW2B 2I1RA 3V6JA 1ZTWA 1C2PA 3LPUA 4FJKA 4N76A 2FBVA 1ITGA 1S4FA 5CYQB 1C6VA 3E01B 1HRHA 4NLSA 4E3SA 3PR4A 1A5VA 1IKYB 4KBIA 3Q8QB 1ZBLA 2FC0A 4RNOA 3CJ4A 4B9VA 1RT6A 4CHQA 4CJUA 2W9CA 4K8XA 4KHMA 1LW0B 5KT3A 3B6PA 3DM2B 1N6QA 4M95A 1SH0A 1K6YA 3TANA 2JEGA 3OL7A 4DS5A 4E7HA 3C6TA 4KO0A 5KG2A 4QWCA 3AVCA 4J9NA 1S1UA 4ECYA 1JXBA 4RNNA 5SZTA 5DQIA 5KFOA 3RMBA 3BDPA 5DGAA 4ELTA 2F96A 3LP0A 1DTQB 1GX5A 3SFGA 2OPPA 1T03A 1U4BA 3SQ1A 4IFYB 4OKKA 4DTSA 3AA4A 4IG3A 1X9SA 4J2BA 4NCGA 1D0EA 1HNVB 5J2MB 2VG7B 4ID1A 3GILA 4TQRA 3PW0A 4EO6A 5DG7A 3H5SA 1RBVA 1WLJA 5I42A 5HLFB 4YQWA 1TKZA 4Z4IA 1TKXA 1B9DA 3ZSXA 5KFCA 1T05B 2JEIA 2F8SA 3KLIA 1NK7A 4H4MA 4K4ZA 1RBRA 5DQHA 3DLHA 2YHAA 4X2BA 2BANB 5I3UA 5J2PB 3HPGA 4ECRA 3I5AA 1EP4B 1L3VA 3MAQA 2BE2B 3NFAA 4JS5A 4FLYA 1JLQA 3Q8PB 1I6JA 4JRQA 3T5JA 4KB0A 4LSNA 2AWZA 3V4IA 2JEFA 4B9TA 1S6PB 1HARA 3G6VA 5KFGA 1X1PA 4NYNA 3IGVA 3BQ2A 3GIJA 4DFJA 3ZT4A 4W5RA 2Y1IA 1XR6A 2RDJA 3OVNA 4MFBA 4O3QA 4IG0B 4RW4B 5HRNA 1D9DA 3T3FA 4FM0A 3KLHA 2YKNB 2RF2B 3K59A 4NZ0A 3FRZA 2YV0X 4O5BA 3QLHA 1JL1A 4WXOA 4RNFA 5FDLA 3ZCMA 3TQ1A 3SUNA 4J9OA 4KE5A 3DI6B 1RA7A 3H40A 3HSTB 5T14A 2ZE2B 1KHWA 3KOAA 3NDKA 4N5SA 1JX4A 1OS5A 4EZ6A 4M94A 1QTMA 1RT3B 3K57A 5KFYA 4W5NA 1LWFA 3JSMA 5J2NA 1HMVB 3QIOA 4KB7A 4O4RA 2ILYA 1ZYQA 2JC1A 3KK2A 4OLBA 5KG1A 3BGRA 4OKEA 1ZBUA 2HHWA 4KTZA 1RAJA 4ZMMA 2GC8A 2FLPA 3SPZA 1NK5A 3DMJA 2HHVA 3ASMA 3N6NA 1IKXA 1U09A 4ZPDA 3OLBA 1CXQA 3L2UA 3SFUA 4CHZA 2ALZA 3L3VA 3M8PB 3H98A 1SKSA 3RBEA 4DF8A 1VRTB 4KV8B 4MQ3A 4ED6A 4R8UA 3OYHA 3CG7A 2Z1GA 3ALYA 3EZ5A 4CEFA 4CF8A 1WSIA 3SUOA 5HP1A 4M45A 4MKAA 4H54A 1C1AA 1BL3A 3FFIB 4Y3CA 3AVLA 2BRLA 3HVTA 2E9TA 4E19A 1RTHB 2QV6A 3V6KA 1BQNA 4JLHA 4DL4A 3MEDB 4B8AB 3C94A 4CGDA 2QXFA 4W5QA 2ETJA 1TL3A 4IKAA 3PW2A 3ZSQA 3L2QA 5KFUA 3EZUA 2F8EX 4E1MA 4Q8FA 3SV3A 4F4WA 3IAYA 3GV8B 2IJFA 2D0BA 2B5JA 4M3RA 4NLRA 4OLAA 4H4OA 4PY5A 1RT6B 4C8OA 3ISND 1CLQA 5K14B 3V6HA 2W9CB 1TL1A 2GUIA 3NKYA 4O3NA 1EETA 1VSJA 3CJ5A 4WFZA 4M3UA 1N6QB 4FM1A 2C28A 5KFLA 2WHOA 4EEYA 3C6TB 4C8LA 4B3OA 2WCXA 4W5TA 1TKTA 4DFPA 3LP0B 4CJVA 3RB3A 3CM6A 5KFAA 2OPPB 1T03B 2F8TA 4IG3B 4NLTA 1F21A 4NCGB 3S3MA 3KJVA 4FLVA 2AGOA 4F50A 2J6UA 3PUFA 5I42B 4K4TA 1JLGA 2OPSB 5HBMA 5EWGA 1TKXB 2ZD1A 4MIBA 4Q44A 2W8KA 4F4ZA 4EP4A 4ZP6A 2KFNA 4KSEB 4CEBA 4H4MB 2YKMA 5CYMA 3OSNA 4O0IA 2G8HA 3C6UA 3V81A 4JV0A 4DL7A 3SYZA 3KLFA 5EU7A 4URGA 3RMDA 1TAQA 4ZPAA 3I0RB 4IQXA 4ZP7A 3M8SA 4EZ9A 1RDDA 4NLYA 1N48A 1JLQB 2P51A 4CF0A 4FXDA 1RDCA 4EYIB 2EX3A 4LSNB 2BQUA 1VSDA 4IBNA 5CY4A 3V4IB 4E89A 4CEZA 4FLTA 3TAQA
chains in the Genus database with same CATH superfamily
2ASLA 3X1LB 4LUBA 1WJ9A 5G4DA 4CEOA 1IKVA 4RKUC 3CJ2A 4KIAA 1YLXA 1X4DA 4FJGA 1NPRA 2MSTA 5B0GA 3ZT3A 4BRNA 4NMXA 3C0BA 1A6LA 1UJ5A 1EIYB 2BMBA 3CCVN 1U2FA 2F65A 5AQKA 1RJJA 3AVHA 3I5CA 4CZKA 3QLHB 2VC0A 4DMNA 4TYAA 1GLEG 2O4GA 2ABYA 3IC1A 4P7TA 5KFMA 1MMLA 2ASYA 1FT8A 2XY6A 1IJFB 1SH2A 2RQCA 3W0LA 2MSSA 3TA2A 2L3MA 2CQGA 3GWCA 1GNKA 2G8UA 1KP6A 2NUBA 1BGXT 2W42A 4KKOA 1J5EK 3IO1A 1XIQA 4IO9L 1FKAF 4CZLA 3MCSA 3R8YA 4JI7F 4DBQA 4DL5A 4R8UB 4DR3J 2A1BA 3AVBA 3BPSP 2L08A 4QWEA 3P5JA 3J7AN 5AJ3F 3ZNUA 4QYZJ 2DFHA 3R9LA 3OBWA 2Z1HA 2IVPA 2F4VJ 1NGFA 2NRRA 2BUNA 2CVIA 4PWDA 1CVJA 4CJWA 2DHHA 3DLGA 5F9NA 3QSIA 4J7CA 1TL3B 4I6MB 3KHYA 3G6ES 3HHLD 2QRRA 4FJ7A 3RR8A 2PI5A 3VR1A 3ZX0A 2QL9B 4A5BA 3WXMB 2XMTA 4X4OA 4B3MK 4KHSA 3HDSA 2Q1LA 2DY4A 5HMYA 1WI8A 1C4CA 5CCMA 2AZ3A 2YH1A 3CCZA 4DR6F 2AJ1A 3NF8A 1N52B 3ZTOA 4IQMA 4DQIA 4I4BA 3DN9A 2GIQA 1W2IA 4I2PA 4F3QA 5IT0A 2OCEA 1ROFA 1CQNA 1ESVA 4DV6J 2ADBA 3HD2A 2KRRA 1VSIA 3QBXA 4HYKA 5D4NA 2ZH6A 1PIEA 3KJVB 3LGNA 3J7YP 2YCHA 3SQGB 2QKBA 1T9VA 2DIUA 2OELA 1BG3A 3AB4B 2DHXA 2B43A 2VPZB 4YHHJ 3SI8A 3A1YG 3DLJA 2BM1A 5C7PA 3FSIA 4AFFA 3SSSA 4EFAC 3I0SA 4NEYA 4OLPA 5E3PA 1JWWA 3V81B 4HDHA 3NGYA 4IKFA 1REVA 2E1RA 2Z0GA 4K5RA 3G2XA 4LF5J 4Z7CA 4KRFA 2QLWA 3I55N 2WK4A 4WBFA 4GVBB 4KT0C 1KHVA 1QVGM 2VYPA 3GIRA 1S10A 3DLLL 3GOIA 3LM9A 5LSOA 1IBMK 2K2PA 3QINA 3HO1A 2KZZA 1U0HA 1V3SA 1U1PA 3I33A 3KK1A 3LALA 3O8WA 2KKHA 4UOGA 5HMWA 3DGPA 4DXLA 4JKBA 5EXWA 2H3EB 3U9DA 4QOZB 4X4SA 1JLFA 4FF3A 3FBEA 2KKZA 2J0XA 4K25A 4FKYA 4OJHA 3H3NO 4H4KC 3AJ2A 4LD0A 4B3TK 4YB6A 1V3ZA 1BE4A 1XNQJ 2KM8B 4NXMJ 1DTTB 2K7JA 2DTUA 4XPCA 2QA4N 3NNAA 3KNAA 3PNIA 2YX4A 3HHLB 5HJYA 5C24A 3H2LA 4L76A 2HZVA 4RUCA 5KGXA 5DDQC 3UE5A 4ES3A 3D2WA 5KRTA 2MTLA 1JKHB 4CJ5A 2YBVA 1U0SA 3OTDA 1YJUA 3KLGA 3J81O 4JK7A 4C2MA 1MWKA 1HBMA 2KB2A 1JJ4A 4R79A 2J0QD 5KFSA 3D7EO 5AQMA 3W7BA 5E3CA 1YRTA 3H4BA 2IYGA 1RTIB 2MHNA 2IC3B 2AYEA 4UY8T 2J9CA 2QYCA 3EDRB 4NLUA 3U1LA 2QLFB 2P9KA 1KDNA 3DRPB 3NGIA 5KAKA 1SUQB 3O8MA 4DHYA 4BG9A 1VC5A 3NCRA 2M9KA 3TR8A 4F3OA 1HNZJ 4MT1A 2CRLA 4Q43A 4A46A 4Z4GA 3CQ8A 4CESA 1VQLN 3UQSA 1M5KC 1I94J 5KFRA 3OD2A 3DXBA 3CIZA 1X4BA 3VQ6A 3T1YK 1Z4UA 3OYMA 3QDKA 3A5LC 1BISA 2ZH3A 5DDRC 2GQCA 3T19A 4R5PB 4IO9Q 1NU4A 5E26A 3MFIA 4LMZA 2X1BA 3Q83A 4L3NA 3DRRB 4MIAA 1VLOA 3TW0A 3NEKA 5HK4A 5FPMA 3CERA 3MR3A 1YHQN 3FRYA 4FJJA 1MDUB 2DFFA 5F1XA 3D45A 3KTQA 1TFYA 1CPZA 4C48A 1WOOA 4RUBA 4A8XA 1OSDA 4C97A 2W1BA 3PX4A 1DARA 4HTLA 4L74A 4Z94A 4IR9A 4DSFA 5HO4A 1Y11A 4LFAF 3PX0A 4ID5A 1BQMB 1WNEA 5M1OA 1BLUA 2RUGA 3MMBA 3UDLA 4QW9A 1HNWF 1FRXA 5BRHA 2ZM6F 3DRSB 3CCMS 3RR7A 2VWJA 1F3FA 4J9PA 1SPBP 3WDOA 1WEZA 4KJIA 5LL6d 3GP9A 4M41A 5B09A 1FO1A 5GAGI 4Z2XA 1X4EA 2E5LF 4ICLA 1FNOA 3TAGA 2CNLB 3CXCM 4KI4A 4X4QA 3SMSA 2KL8A 2QWNA 1JB0C 3ZXWA 3I9V9 5EY4A 4RBUA 4NA3A 2KYXA 4A8KA 3MR6A 3VN5A 2RQMA 3CSKA 4KO0B 2C22A 1HYVA 3O6WA 2UXCK 3W60A 1FXLA 2O8FB 5C15A 2CQ0A 3MMCA 3AVAA 2UVWA 3J80O 5C42A 9ATCB 1CJUA 2PC6A 2OFHX 3W61A 3VERA 2ZHOA 3KG1A 1UPMB 1NNDA 1EB0A 3QATA 3T69A 5DS7A 2RHQB 3D6FB 2OTJN 5B0AA 4GO5X 1C0TB 2V9KA 4N56A 3THWA 3TEGA 2RILA 4QIFA 5GAHU 3IFEA 2E2OA 1TL7A 3LGHA 3OR2B 5D4LA 3IWNC 4KQZA 5GADP 4RW7B 3K5OA 4DQQA 1RAHB 3OS1A 5DG8A 3IS9B 5I3UB 3V2UC 1QHTA 2GTDA 4P74A 1U1QA 3UD5A 2GGPA 2G0JA 2VQFJ 3TJ8A 1H72C 2AX0A 1S7IA 4KH1B 2CDRB 4WQ4A 4CJTA 3Q0AA 2IJRA 4NASA 3ELHA 3LW5C 2FBYA 2R7YA 3NH0A 2LDYA 2WB4A 5DGBA 5I9EB 4URSA 3IR5B 4WP8A 3ZT1A 2NRHA 1C1BB 5IQQA 3SUQA 2W9BA 4DR4J 4JI1F 5FRNA 3MM9A 1HNXF 2QIFA 4XK8C 3A8IA 1GXTA 2OEMA 1FRIA 2R2RA 4DCJB 4FZVA 5H1SQ 2YKQA 4HHUA 3UDEA 3OVSA 2XYPB 5C25B 4DQPA 1FXDA 2Q3PA 5KFQA 1JLBA 3P96A 1HD1A 2Y1JA 2KHOA 4LF9J 1JLEA 3QZ8A 1ZAWA 3SXLA 4E7KA 2VQEK 3HHDA 3UKRA 2XCPA 3GV5B 4E1JA 4QZVB 1U8WA 1RAAB 4DV1F 3EEQA 2QWLA 3TR5A 3VQBA 1URRA 1M1KT 1WC0A 2UU9J 3AVKA 2F7TA 1GH8A 4ES1A 1WTBA 3K9KA 4EBDA 1YIJN 5ETTA 4JV1A 1R0CB 2VASA 3MPVA 4JI6K 3IWLA 4JHDA 5ETOA 5ETLA 3DWLA 4JI7J 2HWTA 2AEFA 1S1VA 3ZZUA 1EP4A 3O1LA 2NXJA 1HNIA 3MCAB 2FHMA 3MPUB 3K5NA 3H0PA 3D4JA 3WEEB 3H5UA 2HSEB 3PRDA 3MMVA 2CADA 2O1PA 1RFQA 2H4YB 4DSJA 3E9PA 4GVMA 1D1UA 2ZZTA 2HGMA 2V2QA 1JJ2M 3Q2SC 5HVFA 2B7CB 4QS7A 3DKDA 4JI0J 2J6TA 2V69A 3BSCA 4FO0A 4FXWA 1NOYA 5ETMA 1YJWN 4OJGA 3PY8A 4TU9A 3F0NA 4J91A 4I9QA 3G87A 1UWAA 3DXMB 4DR1J 4UQTA 2DEJA 1PO6A 2ZBQA 2DNQA 5FPEA 3EX7B 3Q24A 3VHQA 4K50A 1Q53A 4NXNF 2BQRA 4M5IA 4H03B 2YX1A 3ETMA 5KFWA 3UKUB 1K9MO 1VCTA 1TP7A 2D0PA 4X64F 5E0OA 4IOBA 2V63A 3E51A 3ITHB 3BSAA 1LWEA 3CMAS 1YX2A 2XWYA 3HVWA 1DLOB 3HPOA 3SJHA 1LKZA 4ELUA 2J4RA 1Q79A 3DCAA 4K4SA 2E7VA 1IG9A 2X78A 3R6LB 3ZO7A 4M7YA 2OLWA 1SV5B 4PG7A 2ZH7A 4H5RA 1VQKN 4X65J 3WXLA 4JAXA 2B9WA 4UF4A 5KG6A 4HTIA 4OZ1A 3DLRA 1JLGB 3FBBA 4CJFA 2XI2A 1JL2A 3HRGA 3T6BA 5CYJA 2BH1A 4B1UB 3L4IA 3AO4A 4JN4A 4YR0A 4FSVA 1A9NB 2XMWA 3ENVA 1OO0B 3EM1A 1VISA 3VESA 4FLUA 1KC8T 4G1QA 2X1FA 3RWUA 2CJQA 4L73A 3B82A 4Q0BB 4NWBA 3K2PA 4FZYA 3FQLA 3HSJA 4DG1B 1NKEA 2HLTA 2MQQA 1VJQA 1WAJA 4X66K 2I8EA 2JVOA 2E5HA 2R4FA 4C23A 2MKSA 4P7VA 2MHEA 4BRDA 4ZOSA 3J80Y 1NM1A 3LP2B 2AV5A 3OYIA 3CVKA 2UVRA 4DV3K 2AEMA 2VOOA 3LPYA 3AVFA 3G4SS 3A8KA 3F56A 4WQ5A 5KG7A 3QNWB 4H5NA 5AQLA 5J1PA 3Q8SB 3KK3A 5JICA 1YTUA 1VMBA 3VQ9A 4XAKA 3N9UC 1YVFA 4N7TA 4MLHA 4KR0B 4BR5A 1X8DA 3CCES 3CC2S 4G6VB 1TQLA 3SV4A 1AYEA 3I0RA 4A61A 3VQ5A 4CERA 4WQ4C 3ID6A 1FVSA 1S49A 4ZHRA 1C0MA 5J2QB 4KREA 3VGKA 5LMUJ 2OANA 4HHJA 4DR7J 2YWWA 2CJ9A 3TUPA 3FGVA 3TU5A 3BKTA 1TU0B 3K2YA 2WBRA 4CF1A 3WQTA 4PWDB 2CIMA 3MX2A 5L1LA 1OPZA 4CFAA 1HHQA 3RG6A 4NLQA 2IVNA 1KAYA 3PM9A 1FNXH 2ZWPA 1Q18A 5CABA 3TWHA 1VQ9N 3AA9A 5LY3A 1E6YA 3UN5A 4WP3A 2D1KA 3ULHA 1C1CB 3RAQA 2AHOB 4PQUA 4QPXA 1RT5A 3R2DJ 4DV5F 1GLFO 2CPDA 2HBYB 3OUYA 3W9HA 1VQ7S 3LDLA 5LMNK 2OZMA 3DC2A 4LFBK 2RJZA 4CW7B 1UW4A 4YDXA 4YY3F 4C11A 3K58A 4DSEA 4FZZA 3H20A 3SI6A 5AXLA 5CHIA 5AQNA 1ASUA 4ZPBA 2FTRA 3TAPA 1S99A 1WHXA 2JVRA 1VLYA 3NS6A 2O4IA 1N5YA 4FVUA 2UVVA 4FYVB 3HPHA 1M1KO 4DV0J 4CIFA 4X62K 4DUYF 1AZSB 5L1KA 2R7XA 4UW2A 1SH3A 2HHHF 1NSPA 4HH1A 4DV7J 2IDEA 4DL2A 3CJ0A 4DU8A 4DFMA 2YQ0A 1H2VZ 3VGUA 1H73A 5KG5A 3T1AA 1VQNN 3I5BA 3AGRA 4J90A 5C10A 3AFGA 3D5MA 4FKXA 1VQPS 3PSFA 4EMDA 4ZCMA 1VSMA 3CD7A 1R8BA 4KHYA 2QYGA 4AHRA 3B8HA 1Q7YO 4DX5A 4WF9Q 2XB2D 2IHR1 1N32J 4Y65A 1NGHA 3NMAA 2YNIB 3O9TA 2VKZG 3MWPA 1VC0A 1Y9OA 3L7UA 3UCGA 4WCEL 4K42A 3OR1A 3OYBA 3W62A 1S1WB 1IBLJ 4DV4F 1U24A 3MAHA 3W2WB 4ES2A 2W4DA 3KK1B 2IY5B 2EK6A 2DHSA 3NNCA 2UUCK 4MMOA 3CC4N 2JRSA 2E88A 1W9HA 1WSEA 3WXKA 2KT5A 3KHGA 3MX5A 1VI7A 2HAFA 2A40A 2GBZA 4Y2KA 2IJNA 4WFAL 2AA4A 3QBWA 4KY3A 1VSFA 4H8KA 3A2FA 1GEHA 2KJWA 2I7NA 4QCLA 3KLGB 3W3DA 4YB5A 5JMNA 2VV5A 1LW2A 1YKWA 2BUPA 3SIPB 2EXUA 4OPAA 1NG9A 1IO2A 3T9NA 1FA0A 5D0HA 3QT5A 1IM4A 4NLXA 4GC7A 5DDPC 2DHGA 1JK9B 4XEIA 3TOQA 3J7YI 5BREA 1HWUA 1F3VA 2FHJD 1QSLA 2DPJA 5LT5A 2CFXA 3U7JA 2P6TA 1T9TA 1G15A 2XLKA 1P9YA 2ZF5O 3P83D 3ILLA 4Z4FA 3Q22A 2LMIA 1Q5YA 8AT1B 3DM2A 2GIFA 3JYTB 3GG0A 4A2BA 5F8NA 1F9EB 5M1PA 4HWIA 5L38A 1XNRJ 3MM8B 5KFJA 2DEIA 2HWIA 3ILJA 2Q97A 4LR8A 5A2QO 3UWTA 3M9MB 1QHAA 4B1XB 3R1XA 3O5BA 3GIMA 1Y0HA 2VG7A 1KOHA 4A4JA 2MQOA 3K9JA 1D9FA 1YVNA 1UA0A 5HLFA 4CFCA 4YOWA 4G1IA 2X1AA 2YX7A 1MROA 5JXSA 3V1OA 2ZKUA 5EGYA 1VHIA 3MM5B 1GFWB 1X9WA 4FS2A 4CJQA 4M42A 1KC8O 1Y97A 1DRZA 5HROB 3BM7A 3CFRA 1N0UA 3OL8A 5DZ7A 2OKQA 2O3DA 4WQ5C 5M2PA 5LXYA 3MCPA 2B7BB 1FEEA 3L7OA 2Z2LA 4PWWA 5BR8J 2HAIA 3M2RA 1RBTA 4YNQA 2VBWA 4CFBA 2VH7A 2DNRA 2FPHX 3MMBB 2PSZA 3HVAA 4U8VA 2MPUA 2VZ9A 2XS5A 2IA0A 2LEBA 1FFGB 3R5BA 1SJ3P 3TNVA 1W2BR 5GAHP 4JI8F 4RG8A 3SBMA 3IFRA 3MOZA 4MYTA 3PW5A 1Y64A 2ZWOA 1RWNB 2LQ5A 2YKNA 1JCGA 2D1CA 2QN6B 2FVPA 4IEEA 3ZZRA 5H9FJ 3AA3A 4KH5A 2QMUB 5M1KA 4OX9F 4TLQA 4BRCA 1DGKN 4YEAA 5CD4A 3MEEB 1HFEL 2HNDB 1RT3A 4M5GA 4NZ7A 2ZH5A 2Y1LB 4CF9A 1YI2S 3M6VA 3TYTA 1HMVA 2PBDA 3GDQA 5CH7B 5C42B 2ALYB 1CJUB 2YKAA 5G0RA 2DH9A 4PKGA 4JOUA 5BXIA 1IV0A 2O8CB 2DRDA 1D8ZA 3EGNA 2OAUA 2CNOB 2E2PA 1S57A 4GKKJ 2W2QP 4F9OA 5GIPA 2BYCA 2DR8A 3SQ0A 2FYXA 4KV8A 3TZZA 2WSFC 2UV8A 1OY9A 4BWMA 1V9OA 1LAVA 1EZZB 4DFKA 3CD0A 2MYFA 3FFIA 2F9WA 5E3QA 4WCEQ 2EWHA 3U4LA 4LF6J 3K0SA 2COLA 1J6ZA 3QGGA 3TSQA 4K41A 5DO2A 1ZBFA 3O5TB 1ZTWA 4CZEA 1SZ2A 4N76A 5CYQB 1E6VA 4DZ6A 4ZCIA 1WC5A 3QICA 4I6AA 3OTOF 1A5VA 1IKYB 1X5PA 4KBIA 5TKYA 2FC0A 2M8HA 1UP1A 1WUAA 1OVQA 2DPNA 1G4CA 1UVLA 4YOVA 5DETA 4C4WA 1QVFR 1K6YA 1WF1A 1TL5A 3OL7A 2ZUGA 2CJBA 4WFBQ 4WFAQ 4QWCA 1YWXA 3AVCA 3I9ZA 4J9NA 4P73A 2KJVA 1S1UA 4ECYA 3O9SA 2HSTA 2QL7B 3BDPA 4CZHA 4ELTA 2F96A 2NSCA 3NWRA 2OPPA 1T03A 3NXZA 1TUYA 4DTSA 3AA4A 4IG3A 4J2BA 1D0EA 2F4FA 3D6TB 2BKPA 4GKJF 4ID1A 4TQRA 2KLAA 4EO6A 1F1BB 2QM1A 4OJ1A 2UV8G 3KDOA 5IXUA 3BZCA 4DUZF 1NDLA 1FRHA 4K4ZA 4M5MA 2ZHBA 1YJVA 3ET6B 4BGBA 1H6KX 3R7NB 5DQHA 3HOTA 1YUWA 3HPGA 4ECRA 3T1HK 2IRXA 1EP4B 1L3VA 3MAQA 1OQ3A 3JB9k 2BE2B 2DNZA 2C42A 1GLCG 2QEXS 2NYHA 3C65A 2A3ZA 4B3RF 1BQXA 3CB4A 2CQDA 2E1MC 1JLQA 3Q8PB 4OZ2A 1T11A 1WDDA 2KI2A 5HMZA 5GADI 2W25A 1PAEX 4QR2A 4JI3J 2C2ZB 5AQUA 3THXA 3VEVA 3V4IA 1RHQB 1HARA 2CZVC 2E2NA 2M3DA 2MZTA 4BRMA 3BQ2A 4RBTA 4IOAL 4TU7A 1WOPA 2ZVIA 2QTWA 4RW4B 5HRNA 1LQ9A 2A3JA 3CNQP 3DRXA 2HK3A 1WELA 3OVAA 4NZ0A 3ZZOA 1RWXB 4FWPA 3IA0A 4RX6A 3DI6B 1RA7A 3HSTB 1VK3A 6FD1A 2DR7A 5A2QY 3KOAA 1LK7A 2ZUAA 1OS5A 2ZNZA 2AIRB 4M94A 4NI2B 2LU1A 5B0EA 4O4RA 3KK2A 5KG1A 4OKEA 2ASMA 2A10A 4KTZA 1RAJA 1ILYA 3SPZA 1IN0A 2PA8D 3JXOA 4JKGB 3ASMA 2YJFA 4J5OA 1FDBA 3ONQA 2DH7A 3OBYA 1CXQA 3L2UA 2VB6A 4M5DA 1C4AA 2ALZA 2H5JB 5K8PA 3L3VA 1VQ4S 3RBEA 1ATRA 3RSEB 1FJGF 3EE9A 3OYHA 3RU0A 4L3QA 2OHDA 3GTYX 4CZCA 4MKAA 3HCXA 2OP5A 2XMAA 1SIZA 3AVLA 3HVTA 3CCJN 5AJ3K 3D1QA 4DL4A 4B8AB 5E84A 4J9VA 3PW2A 3C14B 3L2QA 4USTA 3MPDA 3DOMB 2WVEA 4F4WA 3GV8B 4QBUA 3R7BB 1VQ6N 5IM0A 2W4CA 4NLRA 1OY6A 4H4OA 3L7PA 1RT6B 2V8HA 3HZ6A 3RVCA 3V6HA 1WF2A 1SVDA 3UCUP 3NKYA 4OO1J 4O3NA 4NLCA 3CJ5A 4K0KJ 1V6HA 4G9ZA 4FM1A 1P9QC 2WHOA 4EEYA 1N88A 2V5HG 5DDOC 3C6TB 1CBKA 1RGVA 4AL5A 4DR6K 1HI8A 2WCXA 2E5JA 4W5TA 4IEIA 3J81U 3QMLA 2V94A 3PJ9A 5IC4B 2HVEA 2PGCA 1AUDA 1SI9A 1YJNN 4BREA 1CJKA 2UUAJ 4DUTA 4ILJA 3H2VE 4N8OA 4EU0A 1MN7A 4ZK7M 4LFCF 2RS8A 3BN7A 1FE4A 2AGOA 1H7WA 3AQPA 3M1FA 3DHWC 4ZLPA 3M3ZA 5HBMA 1TKXB 2ZD1A 3QPIA 3NGKA 3L3CA 2WUSA 4F4ZA 2WSEC 1VQMS 2KFNA 2GELA 2YKMA 3H1QA 3HD1A 3L95X 1WI6A 2QT7A 3THPA 4JV0A 5EN1A 4AQYF 3M2VB 4DPWA 3RMDA 3I0RB 1P8GA 4IQXA 3M8SA 3R1HA 4NLYA 2W4PA 3ZETB 2R7OA 2GO8A 1X3MA 4OQJA 4JI5J 2R7SA 1RDCA 4LSNB 5BPMA 1CJTB 1NSKL 2VCPA 1XUPO 4CEZA 4E89A 3TAQA 3OFHA 1FI4A 3CETA 5EUHA 3R5AA 2QSWA 1K0VA 3CI5A 1RACB 2JFDA 3ZYYX 1U2RA 2D4WA 1WBDA 1BHLA 4OX7A 1VBXA 1PBAA 3BF4A 3JQKA 4NRUA 2P9IB 1UJ6A 4U7UD 1UAWA 3NE6A 2B51A 4DR5F 1S9FA 4EK2A 4PXBA 4MK8A 4Q7AA 2E7XA 3KLHB 4Z4EA 4CD3A 1VQ5N 4BR9A 5KT7A 1E6YB 1EKSA 3M2UA 3CCSN 3TA0A 3C16B 4EYHB 1KSPA 2H48B 1RT5B 2MJUA 5JLFA 1P6TA 5DM6L 1HQ2A 3OUYB 1YITN 4CJPA 1LWFB 2VL1A 3JSMB 5J2NB 3BBBA 4IOAQ 4F3TA 4CEQA 4WZMA 4B9LA 4JYAF 4DU3A 1XR7A 2LSNA 2VF3A 3DMJB 4JI4F 1RXOB 4ED7A 4GRSA 2VJVA 4CGHA 1OSCA 3LM2A 3HZGA 4JI8J 2C3YA 2RRAA 2BXJA 2R9LA 4MJKA 5EHHA 3AD9C 4AF1A 3A4TA 3SJJA 4IO8A 1SJFA 5HP1B 5FPDA 2W8LA 4JI2F 1HQEA 2LP4A 3AOBA 1UVIA 1DEJA 3BYPA 3LL3A 3BB5A 4B9UA 3V5RA 4USWA 4K4XA 2OTLS 1H7XA 3J80U 2FC9A 3J7AP 2XWXA 4EP5A 4RBVA 5ETVA 2XO6A 2E7WA 2NRTA 2GHVC 3OXGA 1M90T 3NH1A 5T7BA 3P39A 1HBUA 2V9WA 1VIOA 2DR9A 4UT4A 1ZZNA 2CG8A 1CULA 2QGFB 4IH7A 2B5JB 2KXFA 3AV9A 4FPIA 1BO5O 2VBZA 4LSLA 2JHEA 1NHVA 4KI6A 1YVUA 5EWEA 2ZEJA 1OY8A 1K73T 3CULA 3CC2N 1TL1B 1KLNA 4K7QA 4FK0A 2AW0A 5D6GA 3ISNC 1KFDA 1OMSA 3KMQA 2C2NA 2YVSA 4MLEA 2A5XA 5KFTA 3FEZA 4I2QA 5IV4A 2IVYA 4ZVEA 1J2VA 1S9EA 3QEVA 2JGUA 1NNEA 4CHYA 4F04B 3WNFA 2A1RA 4KH6A 1HYSA 1EQMA 1DT9A 3TUJC 2V4RA 2XCAA 4NLOA 4TY9A 4M1KA 5BRFA 5F8GA 1Q1KA 3R8EA 4LFAK 3U27A 2OEKA 1T8EA 3AA2A 2P9PA 3NS5A 3J81j 2CQIA 1FD8A 3SCKE 2FLNA 4Y2MA 3OFEA 1HNWK 2NUHA 4LF2A 1UAXA 2ZM6K 4CLSA 3IG1A 3S41A 3V9SA 3CCVS 3UNGC 5CZ2A 2ZC3A 4MDAA 2ATCB 4PRFA 1GLLO 4NLDA 4CZIA 2XMKA 3N79A 4DTOA 1M1GA 1MMNA 4YOXA 2QMWA 2EFOA 2E5LK 1J5OA 1IJEB 4WYLA 3AOCA 4HACB 3UFCX 3K5MA 1FKOA 3JAMY 3BBFA 4BRPA 3DXSX 1HPZB 1DURA 2V8VA 1SAZA 4OI3A 2OUGA 2Z56B 3OS2A 3QESA 3G8QA 2ZFHA 2B8QA 3KYLA 4AHUA 1FWKA 3N4QA 3OTBA 3G6YA 3AGKA 4P6QA 4R0EA 2IMWP 1X9MA 5F2RA 2MZJA 2L41A 3Q8YA 3SDEA 3F9KA 1T9YA 2C2MB 3RRGA 1FE0A 3E9OA 3BR8A 4YR2A 5GAEU 1UWBB 1RT4B 3CFPA 1Q4RA 1NGJA 3DYAB 4EHUA 2W2MP 4PAAA 4KBOA 1SC4B 2J7WA 1AFJA 4YR3A 1S48A 3KHHA 1FX2A 1KD1O 3SK3A 2D0OA 2NYIA 4IR1A 4TY8A 1VSKA 1YSJA 4ZJLA 2VU5A 3WC2A 5M2RA 2I5JB 1S3XA 3LA0A 3NAHA 4MAKA 2V2KA 3DGVA 4C7QA 2QLXA 3ZTPA 4F2RA 3M2RB 2VHGA 2HLUA 4KHPF 1ASWA 2UUBJ 3V6DB 1BUXA 3C15A 3NVKA 3DOLB 2LECA 4JI1K 1HNXK 2GQQA 4IXCA 1TMMA 1I3OB 5B08A 3BGFA 4ZA1A 1KLMA 4KGXB 1DQAA 2YHYA 4LF8F 1B92A 1IBKK 2K1RB 1ZETA 4QJVA 3D9BA 4XO0A 5EX5A 3HM9A 3MCMA 1EKRA 4PQAA 2O8DB 2WONB 1JCEA 1U48A 4CJKA 2WVDA 4TN2A 4YFUA 2P9UA 2GAHC 2IA6A 4DV1K 2DGSA 2BOPA 3H45C 2XY8A 2QE5A 2H5EA 5HRRA 5J1EB 2DNGA 3CDUA 2ASPA 3MR5A 4DV2F 2DGQA 1XHZA 1GTHA 2DGXA 2CH6A 4ED4A 1RAEB 3CJQA 3AOAA 4CYUB 4CHOA 1XMQK 3CJKB 4ZLLA 4WU3A 4TYBA 2RQKA 3HP9A 4TVAB 4K4UA 1TKDA 3O4NA 4IFVB 2W6KA 3FZHA 3S7RA 2GEMA 5FIIA 4P2MA 3NCQA 5AQGA 1GLDG 2N82B 3E2EA 2H5IB 2P9GA 4DCOB 2E6LA 4Q45A 1EQ0A 4CBXA 2BGGA 2F8MA 3ENAA 1N36K 4RW9B 2FJXA 2UXDJ 4FPAA 3LZIA 3V9XA 1EWRA 2W7AA 1YDLA 1FK9B 4RU9A 1RWWB 1RKJA 3KWIA 1HPMA 4C98A 2B4OA 1N34J 3P6YC 2ZKTA 2HNYB 1PGZA 4OL8A 1QUVA 5CZXA 3BUZB 1VK0A 4Z0UA 3OBIA 1PJ7A 1S5ZA 2B9EA 3MM6B 3MXMA 4LIWA 4LT6A 4IH6A 1SL2A 2FXUA 1TV6B 2E9RX 4OI1A 2D3UA 3CCUN 3DRYA 4V1Ak 4DTNA 1S6QB 2UXBJ 4FJIA 3MMAA 4NXNK 4RNHA 1EO1A 4NPOA 4D3GA 3PXGa 2JNJA 2ZJPQ 5GAHI 3LZJA 4A2AA 5JJBA 2GIRA 3MOJB 4IOXA 2KG1A 4X64K 1ZBSA 1Z2LA 1S1UB 4KFBA 4LFCJ 3PV8A 4LF7J 4M3ZA 5D3GA 4DWIA 3W5YA 1D5AA 5KQDA 3UVJA 3GIKA 3FJ2A 3H4DA 4CK2A 3ZNJ1 1KOOA 4CT9A 1NPPA 5L9NA 5T7LA 1RTDA 4OZ0A 3FZKA 4F4KA 2M7SA 1MU2B 1S76D 4QW8A 1U2VA 4PXEA 4BCAA 5KT4A 3F5TA 1NZ8A 4ER8A 1I51B 2VWKA 4F4XA 1G2EA 3M4XA 4U96A 1DJ0A 4G65A 3PIOL 1IBKJ 1MW7A 1QS4A 4O4GA 2OEJA 4HUEA 4JV5K 3SQ4A 2W2NP 3HLUA 4F8RA 2CH5A 1RCOB 3FBCA 1SJ1A 2AGPA 2CQ4A 3THXB 1Y4ZB 1CQMA 2L9NA 3B6BA 1NDPA 2V51B 4CIOA 1OIAA 4LY7A 1K0TA 4ZIVA 1YHQS 2YNFA 4C3KA 2G1HA 1VHXA 3LP1A 1FVQA 2DR5A 2AJ4A 2BJ7A 3DOKA 1XMQJ 3DXKA 1DBDA 4XH5A 3P4IA 3N6MA 1AUSL 2Z57B 2N7CA 2RE2A 3IKMA 2BEFA 1YJTA 3VQEA 1YTAA 3TEHB 3GMGA 1VQ8N 1G3OA 2YQ1A 1RT1A 2XY7A 3VGSA 1KCFA 1ZTTA 2HMIB 3PIPL 4FW1A 5ETSA 2CNNB 4Y00A 3VEXA 1N36J 1BIUA 1PG5B 2KXNB 2HRTA 3C95A 3H5XA 4DU1A 3F41A 1S9GB 2V4JA 4CK1A 3M32A 3OY9A 2BANA 1U1OA 4C3LA 2WTFA 1V5VA 3NBPB 4IOCQ 3VA0A 3NCIA 4JD2A 1FF2A 2MKKA 2VKRA 4JI2J 1RT2B 2OD4A 5L1JA 1RYSA 1WG5A 2P9SA 4DL3A 3AJDA 3RB0A 2FQQB 3HULA 3CCQN 1QSYA 1T94A 2MMYA 2LEAA 2K7KA 4O3RA 2BZ2A 3P1GA 4C8NA 3K7RA 3EE8A 3G10A 1HWIA 1ZM2A 3CM5A 4KTWA 3PSIA 3FDSA 1JNZB 1MWMA 4IJAA 4O44B 2FSNA 1VSHA 2OTJS 4P75A 2A1SA 2V52B 5JLHA 3ZZZA 4C8KA 4PABA 2CPZA 4DR3F 3GYNA 1H74A 5KFHA 4PPDA 1ULRA 2FVRA 3S6EA 4BRLA 3AH6A 1KR4A 2B6AB 4ED8A 3O4QA 4FM2A 1BDGA 3MN6A 2F4VF 1YBAA 2P8IA 4OYMA 3H90A 1W2BM 4I7FB 4O3SA 3VQQA 2JL9A 2DNLA 4DV5K 5D0RA 3FZBA 5MAOA 4TNOA 3PR5B 2DB1A 1AT1B 2E5IA 1WTFA 3GONA 3ZSWA 3GFZA 3CCWA 4RW6A 4TQSA 2E1PA 3PTWA 5A8WA 2VA2A 4YY3K 4JKAA 4J37A 3A3NB 3AA5X 4BDYA 3V1RA 5KT2A 1CG2A 1UFLA 1KAZA 3ZEUA 1GMWA 2HVDA 1D4XA 5BPNA 3MM7B 2VUGA 2QFIA 2ZH9A 3W66A 2K8GA 3MD1A 1CC8A 3QWUA 3M8RA 2BDPA 4DUYK 2HHHK 3BQ1A 4J9RA 1RTHA 1HBOA 2GX8A 4I56A 4B9MA 2N3LA 4DV6F 2MKIA 1T95A 1OYDA 1JCFA 2PMWA 3UR0A 5A2QU 1T9XA 4WKYA 2CPFA 1O8BA 1KKHA 2ZVSA 1FHTA 1SQFA 1BA0A 1WEXA 1YIJS 2XSJA 5CZ1A 1U2CA 2O8BA 4DU4A 2P9CA 2GVDB 2VFRA 2HQ3A 5C2GA 5AQRA 5JVGL 3M9OB 1LV5A 2JH3A 3SMZA 3R97A 3TX0A 2VG5B 4ILRA 1K44A 2PZSA 4AL6A 3CDAA 4YHHF 3PKYA 4DV4K 2HK2A 1KVKA 1HX1A 3SQ2A 4IO1A 2WBMA 1C0UB 5A8RB 2VFSA 3UR3C 1FRKA 1VQSA 4LF5F 4ECSA 2DK2A 4HEA9 2AP6A 2IRYA 5HVGA 1TVRA 1FJEB 4CQ1A 2RHSB 1IKWB 3DFEA 3OTEA 4LVOP 1YJ9N 1QVFM 3M30B 2Y8YA 3KMSA 5I3PA 2E66A 2E4LA 3QFUA 2OPSA 1YJWS 3ENWA 3MCOA 4CJ3A 4A8SA 3OYKA 1UA1A 3TSPA 2K3IA 5FROA 4UZCA 1XNQF 4IDHA 2HBQB 3O3LA 4DF4A 5BN8A 3ATVA 4JNEA 1E3MA 2XGPA 2MGZB 3W64A 1Q82T 1WSGA 3EO3A 3D3CJ 1WWHA 3ZX3A 5AQTA 2Z1IA 2WB1D 5KG0A 2CQBA 2XS7A 2YNGB 3VEYA 3OA9A 1B9FA 4TKTA 4BRKA 4BY9C 2ROPA 1FWLA 2CAJA 3CWJA 1NJIO 3GLJA 3DU5A 2CA9A 3S9HA 1RTJA 9RUBA 4U6PA 3DLEB 5K9FA 3KJNB 3AVJA 2V4QA 4KHNA 3PYDA 2BKNA 4PG8A 4OMFG 1K1SA 3ENQA 4JP8A 1QQCA 1OQ6A 1AW0A 3CIMA 2A18A 3LWMA 2BR0A 1VQKS 5C12A 2KU7A 2BJ9A 2HZAA 3EY1A 4YP3A 3HSDA 3TA1A 1HNZF 3TAMB 5GVQA 1LXNA 2JC0A 2HFVA 2Z2MA 3HFKA 1U04A 1I94F 1QE1A 1KFSA 3C8YA 2XG8A 4LVNP 1TR0A 1R0AA 3BGLA 4CVNE 1S1TA 4RR5A 2M4MA 2MQ8A 2I0XA 1S9EB 3MECA 3DLKA 2B4PA 3H08A 1QQMA 1CJVA 2HF4A 3G71N 4OGCA 4DR2J 2ASJA 4PUOB 4CLFA 3B6OA 1S72N 2X3DA 3V4MA 1NB2A 4FYXB 3M8WA 4J8FA 4PA1A 1S0NA 1N33J 3DDIA 2XNQA 5SUHA 4RNMA 1JLCA 1N5TA 4TXSA 3VQTA 2E1ZA 1XWLA 5GAEP 4ZP8A 2BJ3A 1HKGA 1BWEA 5K8NA 1VS3A 5KFVA 3HZEA 4H5TA 2HFZA 1W7AA 1EHWA 5A8KA 5JS1A 5C0YA 4U8YA 1FX4A 5IOLA 3UIQA 4FLZA 4PXCA 2VDHA 3F2KA 3FMWA 3KLEB 1NXIA 3G96A 4HHTA 1MWYA 4CJSA 3WIVA 5MLCQ 1FKOB 1RP5A 4OX9K 4FL9A 4LF4K 1XQSC 2CGLA 2DXFA 2CPEA 4L75A 3OYDA 4BE0A 3FGUA 1R8HA 1NGIA 4Q5VA 4AH9A 3W9JA 5KFKA 4TLRA 1LWCA 2HNZA 1RSCA 1NSQA 2OH2A 4BS2A 3W1YC 2UP1A 3MUMP 4NMLA 2WOMA 4H4KA 4U7UK 3AVMA 1Z2ZA 2XLIA 2AGQA 1L3KA 3FQKA 3U3GA 4B08A 4A8MP 3C3LA 5JS2A 1R8PA 2XS2A 3DHXA 3SSRA 4PKDB 1LFPA 1MN9A 2NZCA 3IGNA 3WX8A 4QU6A 2DO0A 4OX8A 4ID8A 1TMJA 1R43A 2V0NA 4MKVA 4O5FA 2XTJP 4A62A 1FDNA 1NHUA 1EWQA 2ASDA 3WHIA 4IDKA 3AAPA 4HR2A 3I31A 3DAWA 3ZSYA 2W01A 5KFBA 3MWTA 4YORA 4OYAA 5GINA 3SCLE 1PCAA 1QZ6A 3VVUA 4CLYA 5L8RC 1VQ9S 2G8KA 2MB0B 4FOEA 5ETNA 3NMRA 1BCOA 4DI6A 1BA1A 3OTOK 4ZVQB 3HJFA 2U1AA 3ZSRA 1BHNA 5KT6A 4DQSA 5HOOA 5B0FA 4I69A 5F8LA 1HHSA 2VQFF 2IOCA 3R5JB 4FJLA 3CIPA 1TUUA 4YS2A 3VQCA 4IFYA 4CM2A 3OS0A 3VMFB 2AJ0A 3VGTA 3WQUA 2DKOB 4LBPA 4YOTA 4DR4F 2FBXA 1HNVA 2JLEA 3EL2A 2JLGA 2J9EA 2ZJQQ 4NYOA 1JJHA 2G8IA 3IBWA 1HW9A 3BSNA 1T05A 1REGX 2DD8S 3BGUA 2R8JA 4B9SA 3BKUA 4V19S 4I64A 4BRHA 3CCLN 1VQNS 5THWA 2RKIB 4AXIA 4USKA 4LF9F 4DUZK 2P9LA 5J2PA 1E4FT 4J9KA 3SZ2A 2B4VA 1IQZA 1G6BA 4FWKA 4PKHA 4DKWA 5AQHA 4NRTA 3NGDA 2UU9F 3T9ZA 5AZJA 3PJXA 5LJWA 1FD2A 3JAMU 4NA1A 3VAMA 3LP3A 3AAQA 4GC6A 4B3RK 3FR0A 3D6HB 3NOGA 1ZC6A 4NO7A 4LH4A 1LAWA 4DZDA 4LH5A 2AKWB 4LF4J 2D41A 4WPAA 3QO9B 2OPRB 2HHXA 3PVXA 4AHTA 4JKHA 1O5JA 4CHPA 1NBWA 3CC4S 4K5SA 3O3GA 2GCFA 2UVUA 2P9EA 2BW2A 3HJVA 1ICEB 2KW4A 4WIIA 4UY85 3VTHA 3G82B 5KFXA 1RT7A 1YK9A 2YNHB 3C19A 1X31C 5DG9A 2H54B 2IM2A 3MTJA 3LWLA 3TTDA 3VQSA 4CE9A 2NCKL 1Q82O 5LSRA 2AP1A 3Q7BA 1NK9A 2HW3A 3MDFA 4QYRA 3UDVA 2ZE2A 4JI0F 3K89A 2I9SA 1FW6A 1UVJA 1SC3B 1F5BA 3MAAB 3MFHA 3ENHA 1XN9A 1NJZA 3SMPA 3HVRA 4DR1F 1PILA 1S1XA 3W2VA 1ACMB 4HTUA 3IMXA 2R8KA 2BABA 3R5GA 1BI4B 2GV1A 3BDEA 1NZAA 2Y0BB 8ATCB 3OHAA 5SWMA 3M1VB 3OYNA 3BYRA 1TZ0A 1HQUB 4X4NA 2MZRA 5KFZA 3D0HE 1U2VB 2VDIA 4CZGA 1FJGK 4LBHA 3PX6A 3R3TA 2HQIA 4JB8B 2JJ4D 2NR0A 2G2OA 5CZVA 5F0UA 1NEEA 4PHTX 1GMVA 1T7PA 1S7HA 3A5NC 2V2VA 4K43A 3MEDA 1WDTA 2FD2A 2NREA 2OGUA 3V6JA 1C2PA 2NXEA 3C7NA 5AXMA 3CPWR 1ITGA 1C6VA 3E01B 4NLSA 1B4SA 2LA4A 4X65F 4BGAA 3TZXA 2HIQA 1ZBLA 4CH7A 2KVQE 3ADAC 4KGKA 4LJMA 3W63A 4DX8H 4CHQA 4CJUA 1HBNA 1KONA 4KHMA 4C9DA 2VPWB 1N6QA 2APOA 3TANA 2D69A 2P2CB 2GW8A 2LEPA 4RNNA 3ENBA 1VDHA 4OI4A 5DGAA 1ZZFA 3LP0A 1DTQB 3ENOA 5H1SV 1M5SA 1T6CA 1X9SA 1HWKA 3AY9A 2KT2A 1J5EJ 5KPZA 2OIHA 1GMWD 1NH8A 5KPTA 1VGYA 2BVZA 3D2FB 2MDAA 1KS2A 3H5SA 1RBVA 5IWAK 1TKZA 4Z4IA 1U1KA 2D9PA 3FZMA 3ZSXA 2Q43A 2Y0SD 1IG8A 4ZPWR 2G9OA 1NK7A 4PYAA 4H4MA 4P71A 2O8EB 1RBRA 2EFVA 4UUXA 3SAFA 3DLHA 3K8VA 2BANB 3U02A 1B3TA 4XTTA 5T41A 5JVHL 3JSRA 1ITPA 2YPZA 3NFAA 3CC7N 2C3OA 2RUSA 4AQYK 4FLYA 5LSLA 1XK8A 3LO3A 4WKRA 2P9SB 4FXVA 5AZIB 3BPDA 2JEFA 1NGGA 1M5OC 1S6PB 1GAOA 2N4CA 3Q23A 2Y9HA 2XHWA 4B3MJ 3M6GA 4KH4A 3MUTP 2WZ1A 4W5RA 1PC5A 2GFFA 3QT8A 3OVNA 1F6TA 1QDUB 2GX9A 4IG0B 1UW9A 3UW1A 2BKOA 5JMVA 1F9FA 1D9DA 4BBYA 3T3FA 1CC7A 2F1FA 4DR5K 1RK8A 4BR0A 2YV0X 1DFDA 3QLHA 4O5BA 4YDDB 3FE1A 4WXOA 1VYAA 1ZBTA 3RGIA 5LMUF 4DR7F 1FRJA 4KE5A 2CDQA 3ULEB 1U1LA 1T0TV 2XHCA 5T14A 1KHWA 3RBXA 1MWQA 1OPIA 2CWKA 3EXYA 4RJVA 5IC6B 2YHXA 4KB7A 2ILYA 2JC1A 1F60B 2EBEA 2YH0A 1NK5A 3N6NA 2E1CA 3PACA 1U09A 4ZPDA 4Z7YA 1Q86T 4ZVRB 1N8RT 3M8PB 3H98A 4JI4K 4DF8A 1VRTB 4KH0B 1NCLA 4C3MA 3VV2B 4R8UA 2QWQA 3ALYA 2G0IA 4CF8A 3SUOA 1RAFB 4HH0A 3AD8C 4WYBA 2AZ1A 4H54A 3HSCA 4F36A 4P72A 4Y3CA 2F9JA 3OFGA 4LREA 2E9TA 1RTHB 1IBMJ 1XMBA 2QV6A 3VOVA 1T02A 2RVJA 1KQFB 6FDRA 1F2HA 4JLHA 3IXQA 3VENA 4DX6A 4CGDA 1Q78A 2QXFA 4W5QA 1TL3A 4I6MA 3FZLA 4M8LA 4Q8FA 1QUPA 4DV0F 2IJFA 2WVFA 4AM6A 4F0HA 4B3TJ 1HR0K 4DV7F 4C8OA 1UVNA 1YGYA 2ZHAA 4DQ8A 5IWAJ 2W9CB 3MWBA 3M5RA 2B4UA 3LQVA 2DNYA 1VSJA 3POTB 4WFZA 1BWFO 4JKEA 4CO1A 3FEXB 2F40A 3NGSA 3P5BP 3LDQA 3BH7B 4ZPVR 4C8LA 4CT8A 1RBOB 1N32F 3VF0B 4C8YA 3WQPA 5DM7Q 1J27A 2QG9B 1IBLF 2F8TA 1YJ7A 3QT7A 5A0YB 3VF4A 4NCGB 3S3MA 2G4BA 1U02A 3KJVA 1UFWA 1UETA 2WVBA 4FLVA 3SQGA 2J6UA 3PUFA 2KO1A 1Z1ZA 1QAXA 3GYXB 1T44A 7FD1A 5I42B 3PDNA 2OPSB 4MIWA 2RRNA 2ZBRA 4ISEA 4LIRA 4JKFA 4EP4A 4ZP6A 4CEBA 2CQHA 2ZH1A 5CYMA 4FYWB 4O0IA 1F9HA 3V81A 3WBZA 1WKKA 3PEHA 3SYZA 3G8TA 4CLKA 5E3AA 3GCXP 3T1YJ 4EZ9A 2CVEA 2P9NB 2YKPA 2A6OA 2P51A 4FXDA 1N5QA 1QZ5A 4F0KA 2BQUA 1VSDA 2HS0A 4O0NA 4FLTA 2XEXA 3IBCB 3E8OA 3TVYA 3IM9A 2I2YA 4B17A 3W8PA 3R1LA 2IMOA 4NB4A 2BBEA 1VSLA 4WFYA 3U1MA 2OI2A 1V3RA 2NRZA 2CQCA 4MFBB 3TO8A 1L3TA 2XMMA 2D74B 3ZZTA 4EBCA 3O6QA 3ZX2A 5JVHQ 2HMPA 4W4MA 4A8OA 4PCQA 5F8HA 3HHLA 2HURA 3UI3A 2J5AA 5FDLB 1XNRF 1HJOA 1KQGB 2RNEA 4P10A 1RWKB 2QTDA 3WNGA 4UOCA 1D8YA 1IM6A 2WRMA 1JKHA 5B0CA 3CCJS 2AQ4A 4ZCKA 4OFZA 2W24A 3HTVA 4J2DA 2H1YA 1R0AB 3TX8A 5AT1B 4C6AA 3J7ZT 1RTIA 4F4YA 1WORA 2IC3A 5FJ4A 4ERDA 1VQ6S 2GNKA 2C3PA 3CJ9A 3HI0A 1IKXB 2DO4A 1YJRA 4ZVHA 3EVMA 1QM9A 1Y10A 1WOQA 3DRPA 2D0AA 3UPFA 1AXQA 1SUQA 2VWBA 2KZMA 1SKRA 4FK2A 4ECUA 3HYFA 2M5YA 4DB3A 3Q8RB 4C1NK 3N5BA 3NF9A 1FNMA 3M7VA 2OPQA 2EBGA 4ILHA 4CO5A 2VGNA 2RDDA 4ED3A 2UXCJ 5BR8F 3E3XA 4DTPA 4ZJQA 5F0XA 3BGOP 1YJNS 2RPIA 4LF8K 2IAJA 4PEOA 4FZXC 1BQNB 2QWMA 2F8HA 3FVYA 1XMOK 2CKWA 2JSXA 1L3SA 4R5PA 2GHWA 4GMKA 3PYFA 3VAHA 3KKRA 4DLEA 3AO1A 5KTQA 4Y34A 5KFFA 1H98A 3DRRA 3S3NA 4UY8O 4O23A 4DSIA 1MNEA 2UUCF 2Q1NA 5LXRA 4FJ5A 3CPEA 2V8PA 1JLAA 1NGEA 3R3LA 1UCNA 2CPJA 4YN3B 1U1MA 2KQ2A 2LLZA 4Y1DA 3WXJA 4B3OB 3TPQA 3QFPA 4WF9L 3TJAA 3AARA 1TKTB 1PJ5A 4IYQA 2QK9A 4Q2MA 5AQFA 1R0BG 3KVGA 4J9MA 3HFVA 1Q9YA 3NGRA 4M7XA 1BQMA 4H0VB 3SCXA 2P5GA 2Z1JA 2CPXA 2KTQA 4XH4A 2CQ3A 4IDKB 1KNZA 4CCHA 2YTCA 3DRSA 3D1HA 4GKKF 1KVAA 3GR0A 4EAHD 3PG9A 1TTHB 4CK3A 4OJRA 2QI2A 5L39A 1Q8IA 3SCIE 4H0PA 1E4GT 5D8HB 1VQ5S 4Z4HA 5DLGA 3U8XA 3C6UB 2ZGYA 4OZLA 3KLFB 2CPYA 3CCSS 4BRAA 2VQEJ 1Q86O 1Y5NB 1N8RO 5GAEI 1NKCA 4D3HA 4LF6F 5GIOA 4M5LA 1S77D 4CJRA 3ZTSA 1YITS 4B3SK 1I3AA 2O8FA 1CLFA 3BREA 4HUGA 4DTJA 5FPNA 1HKBA 1IKVB 3JS9A 1FKPA 4HCBA 3CO0P 2ZDOA 4AYBD 3BQ0A 5EOYA 4JI6J 2ERRA 1SIWB 4XH1A 3LANA 2XQCA 2RS2A 5CXTA 2M88A 5DJBA 3PYGA 3KG4A 4OJ3A 4E0DA 1C0TA 2W40A 3D0IE 3GYGA 2YWGA 3CHWA 3O08A 4QIWD 1RTZA 2A2DA 4RW7A 1YRUA 3IS9A 4ZVSB 1M5HA 5H9EK 3A0IX 4J2AA 1KVIA 1RWVB 1QQOA 2AU0A 1R7IA 3V1QA 4N41A 3QFHA 1WAFA 4KKOB 3JTOA 2E5GA 1ZA1B 1XMOJ 1X5TA 5DQGA 2NXUA 1C1BA 3M05A 3O3FA 3D67A 4I9LA 4MK7A 3GFXA 2ZH2A 4CLWA 1NK0A 4CJLA 3N4WA 3SEOA 1G1XA 2O67A 3MI7X 5C25A 1TK8A 2ZJRQ 4FPRA 4HHHA 3RB4A 2VPYB 4CM0A 1WG4A 4Z4CA 1MSWD 1Z26A 4RL1A 1P1TA 2VG6A 1RT7B 4RWTA 4W92B 2PYJA 1GX6A 2RT3A 4JI3F 4WXWA 1IVZA 3DLGB 1B7FA 1FTCA 3M8QA 3VCDA 4AE5A 4ECWA 4JV2A 2NS1B 2AYBA 4A8FA 2OMOA 2KM8C 3LPTA 2NXCA 2KHCA 2Z58B 4J2EA 3AO3A 2VFTA 2IDLA 4BDZA 3HHLC 2XM3A 3L8BA 3H25A 2HFOA 2W7OA 4FLWA 1S1XB 1SB6A 5BR9A 4X4RA 4IFEA 1NM2A 3G0ZA 5LOQA 2V2ZA 2GQ2A 3KZBA 4EHTA 2H4WB 3OYGA 3TAEA 3G25A 1WSFA 3I32A 4OZ5A 2DBBA 4QR1A 2RIJA 3AO2A 1Q7LB 3WEEA 2XLJA 4I2PB 3I96A 3OHRA 2M8DB 1ZBIA 1L3UA 2G8FA 1O1WA 3QIDA 2IBKA 4C0BA 3IN5A 1R31A 1FWPA 3O1WA 4B3SJ 2W2PP 3QMQA 5F9LA 4YOEA 3VQPA 4NA2A 1L5UA 2NPFA 3ZTQA 1FXXA 1VBKA 3MN5A 3WUHA 5CAAA 3VAGA 2IFXA 1OYEA 3DXMA 4A47A 3SAGA 1X4AA 2YKOA 3MF5A 4QIEA 3TWZA 2ITMA 4X66J 3J7ZO 2IVMA 3EYZA 3I0SB 3MR2A 4DR3K 4FWOA 2F3JA 2U2FA 3BN4A 3UKUA 1REVB 4USMA 2DXEA 3JXUA 2VBXA 3VWSA 4A8WA 3B8AX 3ITHA 2BJ1A 2FBTA 2V6AA 4ZLJA 4QYZK 2IPOB 4WU2A 1NGDA 4DV3J 2F4VK 4DEZA 4ANCA 2E29A 3IP0A 1DLOA 4KPYA 1U0HB 3M8ZA 4OZ3A 1FDDA 1FDAA 4U9RA 4WP9A 1RBSA 1IWGA 1UEKA 4DQRA 3DGPB 2E44A 4JBCA 3ID8A 1NGCA 3FEYB 4QWAA 1JLFB 1ZA2B 1SV5A 3MTKA 4MK9A 5D4OA 1CZAN 4K0KF 3H59A 4A5AA 2HHUA 1W25A 1TKZB 5ETKA 3ZSVA 5C24B 1SJRA 1EQYA 2ATLA 4WFBL 2QZ8A 4Z37A 4CZFA 4DSKA 2Q3SA 1SC6A 4OYWA 1KTQA 3VVTA 4FS1A 2HBJA 3EMTA 3N6LA 3RBDA 2Z30B 1T3VA 4Y6IA 2UUAF 3BZKA 3QERA 4LRDA 1HBMB 1U6FA 5EDWA 1PJ6A 4FK4A 2HFSA 2LDIA 4OV1A 1BC6A 3HI9A 2CJYB 4DV6K 3QJPA 4YUDA 1DY3A 2ZH8A 1WSHA 2DPIA 1IR2A 3NY0A 5IFMA 5AR0A 1M5PC 1N54B 4YMEA 2H65B 3T5KA 3N4PA 2P9KB 2RDIA 2EFNA 3HX9A 1SQGA 1LW0A 2J0WA 5ADXA 4Q0BA 1MWZA 3GJRB 3CD5A 3BO4A 4QWBA 4BLGA 4DG1A 2QL5B 4YHHK 2B0GA 3U1NA 3JSBA 1ZAVA 1VR6A 2D7SA 3DJCA 3BH6B 4BROA 4BE1A 2D0CA 1S0MA 4JK9A 3D6MB 2HQGA 4WTOB 3IRWP 4JI5F 2Q2RA 2XBPA 5LMNJ 4QIGA 4FPBA 4LFBJ 4E98A 4LF5K 4IH5A 3LP2A 5J2MA 2DIVA 3GE1A 3OYJA 3KKFA 3UNYA 3FC9A 3W5XA 4HUFA 3ZLJA 1X3NA 3FFKB 2R2UA 5A76A 4X62J 2DGTA 2HBZB 5HMXA 5KFNA 1F0XA 2KHDA 3CCUS 1WN7A 4NCAA 2BOAA 4OI0A 1XNQK 4NXMK 1V4SA 2QFJA 1D3WA 2R7UA 5CE3A 2Q6CA 3RUBL 4DMZA 1K47A 1RDBA 2HIYA 4C8MA 5DMRA 1TUWA 1RBUA 3EICA 5J2QA 5KT5A 4X4UA 4ID5B 4BDPA 4AILC 2SXLA 4HTJA 3HL8A 1BU6O 1VJWA 1P27B 4FBUA 2OZSA 3KIOA 3QGPA 1Z25A 4ATNA 1K8KA 2UUCJ 3PYEA 3HSZA 4OZJA 2RF2A 1QY7A 3NP5A 3I56N 3N5FA 3CMEN 4ICLB 1V5IB 3R9PA 5AFUA 4NYPA 1C1CA 1RABB 3PW7A 2ZQBA 2IS3A 1HNZK 3QJLA 1DQ8A 2G0CA 1TFWA 5D15A 2FVCA 1I94K 4ENOA 3T7ZA 3MMCB 3B4MA 5K8MA 1BIZA 1S5JA 1UEUA 3ZSOA 5HRPA 2E2QA 4GV3A 1GK8A 4DL6A 4GV6A 3WIUA 3RRKA 4NCBA 2AD9A 2GJ2A 3JTNA 4UUWA 4USVA 3IAM9 1X4HA 1VOMA 5CCLA 1O0PA 4Y1CA 2MXYA 3THWB 2EVZA 3KWMA 1AZSA 1T9UA 1UZHA 3RTVA 2CJXB 3CD6N 1TL7B 4ISGA 5CYMB 3QJJA 1TUVA 2Y1RI 2G8VA 2Q66A 4NLGA 2XMVA 2HHPA 2GGPB 4HCCA 1VQ8S 2RHKA 4E7JA 2J76E 4NYZA 1EKEA 2CZ4A 2YNIA 4F7VA 1GLJO 3P49B 4WTYA 4OLOA 1K1QA 5LJ5Y 4BC7A 2KN4A 1UMJA 3T5LA 4CDIA 1S1WA 4ECZA 3FUYA 2B9XA 2KRBA 2J0SD 4GMJB 3W2WA 2W9BB 5HVHA 4AXJA 1R6VA 3MM9B 2VFUA 1SKUB 2R2TA 2BACA 2LQ9A 2NZTA 4KAZA 5IS2A 3Q86A 3CPWM 3NGZA 1Q9XA 1QD1A 2CQ1A 1JLBB 2LFVA 1JLEB 1ELOA 3SUPA 2CJKA 3CCQS 4CEAA 2ZOGA 3UKRB 4FOIA 3W8GA 4I67A 3CJCA 3N0VA 3BO2A 2HS4A 3VQ7A 5AQWA 3N01A 4M63A 2HHTA 2NRXA 2I38A 2B56A 4JHDB 4PZVA 2FVSA 1A5XA 1RNHA 1HWLA 1S1VB 2J7KA 3QETA 3IM8A 2GZOA 2GVZA 3F73A 1K9MT 4JK8A 1HNIB 4V19X 4CJ4A 3RB6A 2G1DA 3NG8A 3O44A 1M5VC 1IXKA 2DT9A 4K4VA 2CPHA 1ZH5A 1M0SA 3I4HX 4CEEA 3AD7C 3JYTA 1HYZA 2V7ZA 1TK0A 1WF0A 4URQU 4DTUA 2YHWA 3BEGB 3MM8A 2OPQB 4QAGA 3L09A 3T6JA 5EVZA 2VQFK 1RQ0A 1NLVA 3CDWA 4YOUA 2FY1A 3F44A 2W7PA 4LF1A 4BR2A 2IAJB 3NGUA 3FSYA 1VRUA 3HBTA 4KAIA 3LGMA 4R0JA 2UUBF 4C0HA 3PHEA 1YG0A 5L1IA 3H1VX 2E6MA 3EPIA 1ASVA 4Q2LA 4DR4K 4PL7A 5FLXO 4LRAA 1R8AA 2HZCA 3BR9A 3EUNA 5HQ8A 1Q95G 1WNSA 3MM5A 1OH5A 3DLBA 3CFOA 5HAOA 2RU9A 4FJXA 5ETPA 5HROA 5GMDA 3EXCX 2GA7A 5JUMA 4B9QA 1JLAB 1LWEB 4PG4A 2L9WA 4LF9K 2HVIA 1X9JA 1WHWA 4HKQA 3T41A 3VGLA 1NWKA 4L72B 4Y2AA 2ATQA 2VICA 2HVHA 3R6GB 3NF6A 1DHMA 1NK4A 3FCWA 2UU9K 5KFDA 3FCVA 4BVOA 4ZVTB 4ECXA 2JX2A 3HFZB 1XI1A 2MKYA 4GW6A 1I1GA 3QSYB 1FERA 3CGIA 1T3NA 3H3OB 4HLBA 1EJ7L 2EG1A 2G2ZA 1SCJB 2IM3A 3EGVA 4JI7K 3IR7B 3THVA 3O9UA 1ZM3A 2PEHA 3OSPA 1UOCA 3EVWA 3TARA 2DRBA 4OHVA 1T3OA 5AQVA 3CYMA