5HBMA

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
554
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
total genus 161
structure length 552
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hbmA05
1RT5B 1SL0A 2VG5B 4ZVHA 4CJ3A 4WFZA 4IFVB 5EU7A 2BQ3A 2XI2A 4JUZA 5I42B 1JL2A 1UA0A 4DTMA 3SFGA 2OPSA 2D3UA 4CHPA 1S9EA 4J9NA 3UDLA 1LW0A 4M3RA 4AHVA 5KG5A 4FK2A 4Z0UA 1K1QA 3RMCA 1SL2A 3HSTB 4HYKA 2IC3A 1ZBFA 3V81B 4DTSA 3PW2A 4UQGA 3LPUA 1S9GB 3HO1A 1C6VA 3CFRA 2RF2B 3HKWA 1DTTB 2FBTA 3SCXA 1RT3B 3TAPA 1KLNA 1RDAA 4CEFA 4KFBA 3M8SA 4FZZA 4M3WA 1IO2A 4DLEA 3GV8B 2RKIB 5EWFA 3MEGB 3F9KA 5KFJA 4KKOA 4NRTA 4J9PA 4URSA 1HQEB 4I2QB 4DL4A 3ZSZA 2W8LA 1QHTA 3FRZA 3NH0A 4TQSA 3NBPB 4YFUA 3ZT0A 4ZP6A 4J9QA 4HUEA 2R8IA 4EYHB 3KIOA 2V0NA 1S4FA 5FDLB 3TAQA 4E3SA 4K4WA 4RW9A 3OJUA 3L2VA 3KK1A 4ID5A 4Y1CA 4DSJA 4GC6A 4DS4A 1QE1B 2XCPA 1VRUA 2HHXA 2YNFB 1RTDB 1S0MA 2UUWA 4DFJA 4FK0A 3KMQA 3LANA 4B9LA 2WOMA 1C0MA 3QGGA 4LSNB 1GOAA 4ZHRA 4ECQA 3T5KA 3K57A 1TP7A 4C8KA 4CF1A 2DY4A 4KAIA 2ATQA 3ULDA 2ZE2A 3FFIA 4W5NA 3V6DB 3CWJA 4CIGA 4OJRA 3GIJA 3GV7B 4ID1A 1N48A 3ASMA 4ED1A 1C1BA 1S1VB 3QNNA 2YKMB 4RNOA 2WK4A 2W9CA 4RNMA 1A5XA 4EYIB 2Z1JA 3AVCA 1T7PA 4FJJA 2ASLA 3OVNA 5CZ1A 4PY5A 4PUOB 3OYLA 1TKTB 3CFOA 2UVVA 1LWFA 2OPQB 2C28A 4FJLA 4KV8B 3HPHA 4BWMA 4HHTA 4CJQA 2FLNA 3BQ1A 1XR5A 3TVKA 2FVQA 4MH8A 1VSFA 3BQ2A 3QGIA 2R8HA 2DFEA 2HNZB 2JEGA 4ECUA 4ED2A 1NK9A 4I2PA 4RNHA 2XWYA 1VSKA 2OPRA 4RUAA 2BANB 2PYLA 1T05A 1T03A 4DFKA 4DLGA 5DLGA 3RB4A 5CYQB 2IAJA 4DU4A 3DOLB 3KLIB 2D3ZA 3PX4A 3QIPB 4ECXA 2VA3A 1XR7A 3HK2A 3RRHA 1CZ9A 4YR2A 2XO7A 3EZ5A 3CQ8A 3G6XA 1KVCA 1B9FA 4DQSA 4RW8B 3TWHA 4M3YA 3MEDB 1LWEA 1C2PA 4IBNA 3M8QB 2YHBA 3OYNA 3LP1B 1S1WA 3HP6A 1RT5A 2WTFA 1LAWA 4YMEA 1T3NA 5D3GB 4Q44A 5J2MA 3HVRA 1NJZA 4HTUA 3EYZA 3PO5A 2FC0A 4NYNA 2B43A 4KTQA 4YP3A 5I42A 4CCHA 4JRQA 2E9TA 3VQBA 2WRMA 4Z4FA 3NGZA 1C0UB 4CJWA 1ZBHA 4DQIA 3KHLA 3OS2A 3N6NA 4Q5VA 4QOZB 2VG7B 2HNYA 4FS2A 1KCFA 4FJIA 4NLVA 4KRFA 5J2PA 4DSKA 2AWZA 3OYGA 3NHGA 3VQPA 4CF9A 2PZSA 3KLGB 2RF2A 3H5XA 1DTTA 4C8LA 3E51A 3I5CA 4DU3A 1RT3A 4N41A 4E7JA 4IH6A 5F8JA 4I7FB 4AHSA 2W42A 1NNDA 3AVKA 3OSNA 3H5YA 4EZ9A 4KE5A 4AHTA 5C25A 3MEGA 4DF4A 4I2QA 3DLEB 5F8MA 3H2LA 3KK2B 3NGIA 1A5WA 3JYTA 4Q45A 1TL1B 4C8MA 5E41A 3V9XA 2KZMA 3BR9A 5EWGA 1I39A 3NAEA 4GVMA 1XHZA 1JLFB 1TVRB 3AA5X 1HPZA 4OGCA 1RAJA 4JV2A 2YNHB 3GIIA 3AVJA 3GIMA 1REVB 5KFNA 4J9KA 3KOAA 3OYEA 4L8RB 3DI6B 4URGA 1VSEA 4FLZA 1MU2B 4O3QA 4WFYA 4CFCA 4FLVA 1QE1A 2JLEA 5HP1B 4FYDA 4DTUA 5KRSA 1J53A 2V4QA 3CJ5A 2IM2A 4LSNA 3KLHB 2HAIA 1TKXB 4O3NA 5DLFA 1VRTB 3H5UA 1WSHA 4B9TA 2G8WA 2R8JA 3OL7A 3RRGA 3S3NA 1D9FA 4IH5A 4NCBA 3CJ0A 1JLCA 3CJ2A 2OH2A 2Z1GA 4NLTA 4KHSA 3HVAA 4QWAA 2O4GA 3MR5A 5I3UB 3VQ4A 4F2SA 4TY8B 3P5JA 2EHGA 2C2EA 2R2RA 4K4TA 1UWBB 2IM0A 4PUOA 1QS4A 3DRRB 4K8ZA 4MK9A 5KG0A 3AV9A 5HRNA 4CFBA 4F8RA 4RZRA 3PV8A 3KK3B 2OPQA 2HNDA 2YKNB 3ITHB 3PW4A 3P1GA 4E7HA 2YNGB 2CJQA 3QEXA 4B3OB 4NRUA 4G1QA 4K4VA 4E19A 3SJJA 3V9ZA 2XY6A 2P51A 3AVAA 1SKRA 2C2DA 2Z1IA 1L3TA 4LD0A 3VQAA 3ZT1A 3QERA 1BISA 1EETB 2AU0A 4CF2A 4BWJA 4KB7A 4NCAA 2QV6A 1TL3A 3BGRB 3VN5A 2NUBA 1W9HA 4CHZA 3RB6A 1IKYB 5DMRA 4FBUA 5KG3A 1WSGA 3O4QA 5CYQA 3S3OA 4FJNA 2XY7A 2D41A 1S1TB 3DOLA 4E7IA 2X78A 1TV6B 1L5UA 5KFQA 1RBVA 4R8UA 2G8VA 3TQ1A 4F3OA 3M9OB 3IS9B 1JLBB 1F21A 3M8QA 1D8YA 3CDWA 2GC8A 4ZPDA 3MR2A 1N56A 3IGNA 4H4OA 3OL6A 1J5OA 3CFPA 4CGGA 5FRMA 1JLQB 3VA3A 3LWLA 4OLAA 5KT2A 4DTPA 5JS2A 4GW6A 4FLXA 4ZP7A 3VQSA 1NK4A 1TK5A 3BSNA 1C0UA 2RPIA 4OVLA 4NCGB 1SL1A 2B6AA 3CJ4A 2ZD1A 1LWCB 4M95A 5HLFB 2FJXA 4ED6A 3M9MB 4FS1A 2BE2B 3G6VA 2FLPA 2HB5A 4FJ8A 1J54A 3HXMA 4E7LA 3OSPA 4H4MA 3V9SA 1JXLA 2AGPA 4WYWA 2HHTA 4EZ6A 2AJQA 4WFXA 3PW0A 3C94A 2XRIA 1QAIA 5HRPA 2FJWA 3TAGA 3ZSOA 3QLHB 4H54A 3AA2A 4DL7A 3HYFA 1Q9YA 3FDSA 4J9MA 2E9ZA 4CEQA 3QEIA 1U47A 4RW7B 4MIBA 3S9HA 2C2RA 3KHGA 4DTJA 1TL1A 1IKXB 2BRKA 3BSAA 3Q8SB 3N6MA 4CK1A 3VQ6A 3MEEB 3LAKA 1JLFA 3KLFB 1RT4B 3A2FA 1QQCA 4AILC 1ZBUA 2W9AA 4K4ZA 2F8SA 1XI1A 1CLQA 3O4NA 4B9SA 2YNHA 4FJKA 4DTNA 1TQLA 1RTHA 4KTZA 1X9MA 4CEAA 4ED7A 2P5OA 3QETA 4KB0A 1Z26A 3NFAA 2B5JA 4NLPA 1S9FA 3U3YA 2KQ2A 4CERA 5C42A 4J9RA 4CIFA 3OS0A 2OZMA 1KVBA 1N5YA 2AQ4A 3DRPA 4IOBA 3KLHA 1SUQA 1RTIA 4J2EA 1NOZA 3DRSA 1VRTA 4ECRA 4O4GB 3WNHA 2XHBA 1GX5A 4K4YA 4WZMA 5KGWA 2KW4A 4J2BA 1MMLA 3AVHA 4KHUA 1XC9A 4O4RA 3PO4A 5J2QB 5I3UA 1HQUB 2JC0A 4K8XA 4BDZA 1SKSA 5HBMB 4OL8A 4PWDB 4TY8A 5DG7A 4O0IA 1SV5B 4B8AB 4TYBA 1QUVA 1D5AA 4O0JA 1BQNB 3KMSA 1R0AB 3KLEA 4DTOA 1RDCA 2HW3A 1RT2A 1S6QB 5J1EA 4PQUB 4WXOA 2GIQA 1LAVA 4ZPAA 4E0DA 3DRRA 2E6MA 1VSIA 3KK3A 4QWCA 2G8IA 4CGHA 5KFWA 2DFFA 3ITHA 4DSFA 1NJXA 4RNFA 3IG1B 3QEWA 4LH5A 3QGHA 4M41A 4DWIA 4B3OA 4MFBB 3SUPA 1FK9B 2WCXA 1DTQB 3DYAB 2FVSA 1JL1A 4ZTJA 5HROB 4XIUA 5KTQA 1S1XB 3KHHA 3AO1A 3AA3A 1EETA 2G8UA 4NYZA 3HL8A 1RBTA 1QSSA 4OPJA 3MAQA 4IQXA 4B9MA 5CY4A 3BGRA 3M8PB 4CJRA 3QZ7A 3OJSA 1IKYA 1S0OA 3JSMA 3M9NB 1HYSA 3H4DA 1S1TA 4E7KA 3C6TB 4IG3A 3G10A 1W25A 1U49A 1B9DA 4FZYA 4IRDA 2IA6A 4F2RA 3DOKA 1YTAA 4FJ9A 5KG7A 3IS9A 1OS5A 4CHNA 1JLBA 2G8KA 3OLBA 4BDPA 3SFUA 1Q8IA 5F8IA 2QKKA 3LAMA 2YNIB 1QAJA 2VWJA 3K2PA 1FKOB 1N6QB 4HUGA 4H8KA 1TAQA 1JLQA 4RW4B 3NDKA 4Q0BB 4F4KA 3OLAA 2BQUA 4CHQA 4AHRA 2XC9A 2ITGA 3O3GA 2E9RX 3OHBA 3QINA 3SV3A 1Q9XA 5K14B 1ZTWA 2X74A 3MXJA 1LWCA 3DLGB 3NGYA 2O4IA 4Y1DA 5HLFA 4NYFA 3QYYA 2BE2A 4MK8A 5KFIA 4NLQA 3BSOA 2R7YA 3HPOA 5T14A 3PY8A 5C24B 1HYZA 2DPJA 4CGJA 4DS5A 5KFCA 3D5MA 2HMIB 3L2RA 5JS1A 3I0RB 3RMDA 3DM2A 4BE1A 2ILYA 3OYCA 1TAUA 2ASJA 4CJ4A 3TAFA 3AO4A 1LW2B 3NL0A 1S10A 1RT7B 4ZVGA 3KNAA 3NH2A 4RW7A 2R8KA 3MECB 3LDSA 3U6FA 3ZSYA 4TSXA 1IKXA 4QWBA 4MIAA 4CEBA 2DFHA 5EWEA 2E6LA 2JC1A 3KLFA 4MKAA 4QW9A 4WZQA 4NLWA 4NZ0A 5F8LA 3AA4A 3RR8A 3HVTB 1RDRA 1RT6B 2ALZA 4ELUA 3AVIA 4R5PA 3I0SB 4ECWA 4FW1A 3MTKA 1TK8A 4ZPCA 3PX0A 1S1UB 4C8NA 3SNNA 2KFZA 1Z4UA 3ICLA 4OLBA 2OYQA 4FZXC 2VG5A 5KFPA 1C1CB 4ZMMA 4IFVA 5KGXA 3H59A 2LSNA 3KD1E 2O5DA 2AX0A 1WSEA 3SZ2A 1RDBA 3LZJA 5KFHA 1JLAB 3TABA 1WSFA 3QO9B 5KFDA 4BACA 3UR0A 3G6YA 3MFIA 4F50A 1CSJA 5FROA 4FJ7A 4FJMA 1HQUA 3V81A 3GV5B 1NK6A 5HBMA 1KHVA 3WNEA 1SV5A 4ED0A 3VQDA 2IOCA 2XGPA 1NKCA 4O3OA 4O3RA 1S9GA 3SYZA 4JV0A 1C0TB 3Q8PB 4BDYA 4FLTA 3V9WA 3SUQA 4Z4EA 4QAGA 1RA6A 3OYHA 1Z25A 4KO0B 2P1JA 1D0EA 4CJLA 5HRSA 2KTQA 2RKIA 3TAMB 5F9LA 1DLOB 3IG1A 4K50A 4FLYA 4ECTA 4GMJB 4OPKA 1RTJB 1HQEA 3T1AA 1GOBA 3ZSWA 2IS3A 4MFBA 1IKVB 3N6LA 1FK9A 4IRKA 4KREA 3NBPA 4NLGA 1D9DA 3RR7A 2BR0A 1BQMB 5KG2A 5FDLA 3V6KA 3SPYA 3SPZA 4DSLA 2B4JA 5KFRA 1X9WA 2J6UA 1HNIB 3D28A 4DQPA 4K4SA 4WE1B 1HRHA 1JLEB 4KHRA 1VSHA 3PUFA 4JRPA 2IMWP 4CJFA 4LSLB 2YNFA 1RTDA 4NLYA 2W8KA 1I3AA 5KFVA 5C5JA 2F8TA 5FRNA 2KFNA 2IDOA 2F96A 5KFMA 2JEJA 3KJVB 3OYFA 4E89A 2I5JB 1FKOA 3TAEA 4IG0B 5KFYA 5L1IA 3V6DA 4RW4A 4B9UA 4Q0BA 3HVWA 3CM5A 1S6PB 4DU1A 3LP2B 1KHWA 1HARA 2WHOA 3L2WA 1S1VA 2YKMA 3THVA 3K59A 4JS4A 1S9EB 2XY5A 3DMJB 4IFYB 4HVJA 3H5SA 4KPYA 3DLGA 4M42A 1LW0B 2ATLA 4ECVA 1CXUA 4GC7A 5EUHA 3GILA 1TKTA 2GBZA 3DDKA 4KV8A 1FKPB 3NGDA 4CJPA 3OYBA 3QIOA 4OGEA 3O3HA 1U4BA 2Y1IA 3L2UA 4TYAA 4FBTA 3TARA 4M3TA 3LP0B 2HNZA 4CJ5A 4BE0A 2G8FA 2IJFA 3SUNA 2QE5A 4WXWA 4DFPA 2XY8A 4CHYA 5F8HA 4IR1A 1RT7A 1IH7A 2BANA 3P83D 4OKJA 4KKOB 3IGVA 4U6PA 5CYMB 2HHVA 3KLIA 3QIPA 4N5SA 3CDUA 1QTMA 3ZSXA 3HVTA 3K5OA 3C6UB 3CG7A 1X9SA 1U04A 1WLJA 4RW9B 3EPIA 3SQ4A 4RW8A 3KK1B 3OHAA 2R2UA 3MEDA 3WNGA 4CJKA 1S1UA 3LP1A 3BSCA 4XO0A 5D3GA 4NLXA 3TANA 2J6TA 4DSEA 3RWUA 2WB4A 3HT3A 2FBVA 5CZ2A 4B9NA 1N4LA 3Q8RB 4ED8A 2OPPB 3NCIA 2W9BB 3SI8A 2VG7A 3OYAA 4M3ZA 4QWEA 4N56A 3PVXA 4FK4A 2DTUA 2P5GA 1C1BB 3BREA 5KT3A 3NH1A 3AVNA 1WN7A 4FVMA 1UA1A 4MK7A 2JEIA 3KLGA 2EC0A 1C0TA 3MFHA 2D0AA 4EBCA 3ZSQA 2HHUA 2A1SA 3DLKB 4Q8FA 1GOCA 3V1OA 1SH3A 4I7FA 1VSLA 4Z4CA 5T7BA 3DLBA 2UVWA 4O3PA 1ZBIA 3AVMA 4M3XA 3TAMA 3PR5B 3CYMA 1DLOA 1NHUA 1S48A 4HUFA 2IJNA 5KFSA 5KFFA 1Y97A 1RTJA 4XPCA 4FM1A 3DLEA 4N47A 2XCAA 2JGUA 3KK2A 2QK9A 1ITGA 5DGAA 4KB1A 4RU9A 4F4WA 3MF5A 3SQ1A 4CHOA 3OL8A 1BI4B 2W7OA 3MXIA 1TVRA 5L1JA 4RNNA 1NJWA 3GQCA 2GIRA 2OPRB 4OKKA 1BIZA 4QWDA 3V6HA 3NE6A 1TK0A 1REVA 2IM1A 1U48A 4DTXA 3HM9A 1JLEA 3DI6A 4CFDA 4DEZA 1MU2A 1L3VA 1K6YA 3HP9A 3M8RA 2AGQA 2IAJB 4R0EA 1G15A 5HP1A 4O55A 1LV5A 4HCBA 3H08A 4O5BA 4YNQA 4TN2A 1NK5A 3E01B 1TKXA 4DL6A 3KJVA 3V6JA 3DLHA 4F4ZA 4IG0A 4MQ3A 1RYRA 5F9NA 4CFAA 4O44B 4CJEA 2FVPA 5J2MB 1S6PA 3LP2A 1TGOA 1S5JA 3ISND 4ECZA 4DMNA 3RB0A 1J9AA 4J9OA 3DMJA 2WONB 4IFYA 1NK8A 4BE2A 4URQU 4EO8A 1UWBA 5KT5A 2PYJA 3MR6A 2A1RA 2X6NA 1L3UA 3LALA 1X1PA 4Y2CA 2HNYB 1HNVB 2VWKA 2YKNA 1FKPA 4CEOA 5J2PB 4ICLB 4EBDA 3SV4A 1TKZB 3D45A 2D5RA 4PA1A 3F73A 3U3GA 2YNGA 2IBKA 4B8CA 2BGGA 3SUOA 3AO3A 1ASVA 2IGIA 3LP0A 4FCYA 3LPTA 1C1AA 1RT1B 5L9XA 1T94A 4M45A 2D0BA 3AO2A 4LQ9A 4Z4GA 4DL5A 5C25B 2XGQA 1XR6A 4F4YA 1CZBA 3OS1A 1NK0A 1VSJA 2W7PA 5CYMA 3K5LA 1T8EA 5SWMA 4FJ5A 3JYTB 3AVGA 4KHWA 1S97A 3I8DA 1KRPA 4IKFA 3OY9A 3CM6A 2HWIA 1TV6A 5DQHA 3C6UA 1HPZB 4DG1B 3V4IB 2HHWA 4NLRA 3NKYA 4RUCA 1KVAA 2AX1A 1RBSA 2UVUA 3IN5A 1NKEA 4E1MA 5KRTA 5KFBA 4RW6B 1RCHA 3RMBA 1HJRA 3VQQA 4X2BA 4TLRA 1U45A 3ALYA 3KKSA 3SQ0A 1KLMB 5KI6A 4CJVA 2ILZA 4IRCA 4Y3CA 1SH2A 4CE9A 5F8GA 5L1LA 3HPGA 3RMAA 3K58A 5J2NB 4LH4A 4K4XA 3D0PA 4M3UA 5DG8A 1YVUA 4KHNA 5KG4A 1VSMA 4NCGA 4K4UA 2OPPA 4M94A 4IH7A 2W9BA 1ZBLA 1JLCB 4N76A 3VQ8A 4B9VA 1QSYA 1TKDA 4FLWA 2AGOA 3PJWA 3O3FA 3UIQA 4AHUA 4KSEB 2DPIA 2Q3SA 3DLKA 3ZT2A 4ELTA 4XPEA 1KFSA 1BHLA 3BJYA 3ZSVA 4DL3A 2UUTA 1S49A 2KZZA 2HNDB 3QIDA 3OYMA 1XHXA 4CJSA 3VQ5A 2RN2A 5KFKA 3QLHA 3BDPA 3RTVA 3VQ9A 4CEZA 5JUMA 3T3FA 3OYJA 4I9QA 1JX4A 1VSDA 3L2QA 4DFMA 3GYNA 3ZT4A 4CJUA 3FQLA 4DQRA 3HJFA 4G1QB 1XWLA 3AVBA 1BI4A 3MEEA 4WYLA 4C8OA 1IKWB 1RT4A 4KAZA 2HHQA 3KLVA 3TR8A 4Q43A 4FXDA 1TL3B 5EDWA 3MR3A 4JS5A 4KI4A 3H98A 3EZUA 1BCOA 2GV9A 3KKRA 4YR3A 2ETJA 4AHCA 2BDPA 4OKEA 2X6SA 4W5TA 4IDKB 2F8EX 3AO5A 4YQWA 4O3SA 3HHKA 4CJTA 3K5NA 2VG6B 2ASDA 3E01A 2XI3A 4FLUA 4R8UB 1NOYA 1HMVB 2FBXA 1EP4B 3CJ3A 3GIKA 4Y2AA 4O4GA 3KD5E 4CECA 3EY1A 3K5MA 4O44A 3T19A 4IKAA 4H4OB 3SI6A 5DGBA 1J5OB 5F8NA 3G86A 4JV1A 5J2QA 3ZT3A 4EP4A 4LQ3A 2J6SA 4PWDA 1WSIA 3QNOA 4KI6A 1BQNA 1R0AA 1NJYA 2WONA 4KHMA 5KFGA 2Z1HA 1W0HA 1JKHB 2B6AB 1S6QA 4PQUA 3EPGA 1YTUA 2ZD1B 2IM3A 5KFTA 5DQGA 1KFDA 1HNVA 2HWHA 4J2AA 1RA7A 2V9WA 1D1UA 4ICLA 3V1QA 4Y34A 4CGIA 5KFUA 1TKZA 2RDIA 1UAXA 1U09A 1B92A 4H4MB 2R8GA 4CK2A 3RAXA 1RDDA 3I5AA 3VQCA 1DTQA 3DYAA 4KBIA 1RNHA 5HROA 1RT1A 4EO6A 2ZQBA 3TI0A 1S1XA 3ZCMA 2PY5A 3RBDA 4DTRA 5KFXA 2HVHA 3M8PA 3PX6A 3PJXA 3NF8A 4CK3A 4QPXA 2UVRA 3QEPA 4MKBA 4J9SA 4YR0A 4KTWA 1JXEA 3C6TA 3VA0A 1YVFA 4DSIA 4TQRA 4CESA 2GUIA 4QW8A 3NAIA 4DG1A 2R2SA 4CF8A 3V4IA 1WSJA 1WAFA 1JLGB 5KT7A 4B08A 1WAJA 1RTHB 1NKBA 1I6JA 3L8BA 2C22A 4CEDA 5KFEA 2YNIA 1IM4A 2B5JB 4RW6A 3CDEA 4FJXA 5C42B 3IRXB 1N6QA 3ZSRA 4ZVFA 4CGFA 1KLMA 3T5LA 1N5YB 4QCLA 3OYIA 3DRPB 1L3SA 1SUQB 1RTIB 2G8HA 4DL2A 3DRSB 2OPSB 4W5RA 4CGDA 3LWMA 5J2NA 1JIHA 1BCMA 4W5OA 4HCCA 5K14A 2FVCA 3LP3A 3UPFA 1EKEA 4TY9A 3KTQA 1NHVA 4Z4HA 4F4XA 3NF7A 4EEYA 1CXQA 1ZTTA 2VA2A 2IC3B 1RBUA 1RILA 4ZVEA 3PHEA 3QESA 5C24A 4U7CA 4ZP8A 3KLEB 3L3VA 4F3TA 3PW5A 3PZPA 1RT2B 2HMIA 3QZ8A 5J1EB 4FM2A 4J9LA 2BRLA 4FW2A 3FSIA 4FM0A 3QEVA 3I0RA 2I1RA 3L3UA 4ZPBA 4LY7A 4ECYA 4KFBB 4EP5A 1LW2A 5L1KA 4NLDA 1IG9A 1JXBA 3MECA 1BIUA 4W5QA 2QXFA 3WNFA 2QKBA 4DF8A 1IKWA 3B6PA 2BQRA 5DG9A 3DLRA 1SH0A 1RT6A 3VQ7A 1ASWA 3I0SA 5DQIA 1KSPA 3CO9A 2OZSA 4ID5B 1ASUA 2EX3A 1K1SA 2HVIA 3V1RA 4G3IA 3JSMB 2OA8A 1HYSB 5JXSA 1ZYQA 3UQSA 4I9LA 1VRUB 4IDKA 3H4BA 5DK5A 3S3MA 4KHQA 1C1CA 4IG3B 3OYKA 4ZP9A 5KFOA 2VG6A 3AVFA 3DOKB 5KG1A 2WOMB 1HMVA 1EP4A 5KFAA 4E1NA 2E4LA 3RB3A 1SKWA 4ZHRB 1JLAA 1ZETA 1O1WA 3NF6A 4JLHA 3ISNC 3QO9A 1UOCA 1EX4A 2ZE2B 4HKQA 3FFIB 3MXMA 4ED3A 4KHYA 2FLLA 4Q8EA 3NMAA 4ECSA 3FQKA 3T5JA 5KFZA 4FJHA 2FJVA 2W9CB 4NLOA 2FBYA 4Z4IA 5KFLA 2V4RA 1JKHA 4FJGA 3RBEA 1NK7A 3Q8QB 3LZIA 3PR4A 2YHAA 4ZTFA 4AH9A 4KO0A 2D7SA 5KT4A 1HYVA 3OL9A 2HHSA 2Y1JA 1KTQA 3CIZA 4RG8A 5SZTA 4J2DA 1LWFB 3PW7A 5KG6A 2YV0X 3H40A 1RYSA 4CEEA 4CF0A 1YT3A 4IR9A 3AVLA 2ZKUA 1IKVA 1S0NA 4NLSA 1RBRA 2D0CA 2CKWA 1BQMA 3DM2B 3NF9A 1VK0A 4TXSA 1A5VA 4I2PB 4EBEA 4DQQA 1EXQA 1WNSA 3IAYA 1HNIA 3NAHA 1WNEA 3C95A 2R2TA 3T5HA 3G0ZA 4WE1A 2JEFA 4ELVA 1QSLA 1BGXT 3BQ0A 1T05B 1T03B 4LSLA 3RAQA 1BL3A 3CVKA 2RDJA 3KHRA 4NLUA 3B6OA 1JLGA 2FVRA 4R5PB 3SQ2A 3V9UA 3VQEA 1GX6A 3OYDA 1LWEB 5KT6A 2I5JA 4CIEA 3I5BA 5HRRA 1S1WB 3IRXA 1FXXA
chains in the Genus database with same CATH superfamily
1RT5B 4LREA 2ZH5A 5DDQC 2P9UA 4IFVB 2LU1A 3K9JA 4EHUA 3GE1A 2OSRA 5I42B 3BYPA 3OTDA 3SFGA 5FIIA 2APOA 4CHPA 2IRXA 1F5CA 3P5BP 4QIFA 4FK2A 1JJ2R 3HSTB 3T1YK 1GXLA 1RAIB 1WG4A 5FLXY 3VQTA 1S9GB 3HO1A 3CFRA 2RF2B 3HKWA 1VBYA 1CJTA 3TAPA 1RDAA 1BDGA 1YAGA 2J5AA 4KFBA 3ETOA 1VISA 3M8SA 4FZZA 3SQGB 3CC4S 1VHXA 1RHJB 2Q97A 1IO2A 3H2VE 1BG3A 3VMFB 1U1PA 1VQKS 2FHOB 4URSA 2W8LA 3VAFA 4DV6F 3NH0A 4TQSA 3NBPB 1UAWA 2ZH3A 4ZP6A 4HUEA 3D3CJ 4DV2J 1WG5A 1S4FA 5FDLB 1HW9A 2IBOA 4ZLNA 3SMSA 3OJUA 5EOYA 2LDIA 5AQQA 3KK1A 3G8QA 5IT9O 2CJKA 4YORA 1M5SA 4C2MA 1QE1B 5KPTA 5ETOA 1OY8A 4FWRA 2UUWA 4GKKF 4TLQA 4AM7A 1PIEA 3QGGA 1R8BA 1GOAA 4WKYA 4HDGA 3T5KA 3UKRB 1FJGF 4JI3F 2C2ZB 4C8KA 2GAHC 4WCEL 1Q86T 1WEZA 2ZE2A 2UUAF 1SJ3P 2XMAA 3CCQS 3GV7B 4DU7A 1Y11A 2FC9A 2BUPA 3M05A 3W1YC 3KHYA 3QFPA 1C1BA 5IC6B 4B3SJ 1Q7YO 1S1VB 2YKMB 3O9UA 2WK4A 2W9CA 1A5XA 2Z1JA 3AVCA 4DV7J 4NXNF 4FJJA 2ASLA 1PJ6A 1YJUA 4PY5A 3CXCM 1TKTB 2W24A 3NNCA 2C28A 1KQFB 3HPHA 2YKQA 4HHTA 1OY9A 4PZVA 4CJQA 4JI8K 2OTJS 1RISA 5JVGQ 4MH8A 3QBCA 2CNLB 2CPDA 2FHJD 2IMOA 2MHEA 4BRQA 5A6PA 1IBMK 4BR5A 1HBMA 4NZ6A 1CJKB 2ASPA 4X64J 1WC0A 3ETMA 1TR0A 5DLGA 4Y2IA 3THYA 3MAAA 4CLZA 4ES3A 3KLIB 5LXYA 5LMNF 1VJQA 2O8EA 4HL9A 1R6VA 4YR2A 5D4OA 3CUNA 3CQ8A 2ZITA 2O8CB 1OKJA 3TWHA 5IS2A 4M3YA 4IBNA 3M8QB 1NDPA 1IG8A 3NCPA 1S1WA 2DHAA 1FVQA 4JKDA 1RT5A 1T3NA 2VQEJ 3HVRA 1HNXF 2FC0A 4NYNA 1VBXA 3I87A 5I42A 2BZ2A 1NRKA 3OD2A 3M5RA 2OP5A 4KJIA 1R7IA 3NGZA 1C0UB 1Q1KA 3ATVA 4ENOA 2V8PA 3KHLA 2UXDJ 3N6NA 5ETKA 4O5FA 3R5JB 5BN9A 4DSKA 2AWZA 2HG4A 1U1RA 2PZSA 2RF2A 3H5XA 1BUXA 3E51A 4DU3A 1HKAA 5F1XA 5J1NA 4WQ4C 4IH6A 2CVEA 3FCVA 2W42A 2E44A 3BO4A 1GH8A 2NQPA 5C25A 2CWXA 2O1PA 3C66A 2G0CA 1N33F 5F3TA 1UZHA 1URNA 1CZAN 5F8MA 3WC0A 1YXQA 4OV1A 4Q45A 2XS7A 2AMCB 1I39A 3HTVA 4LRAA 4GVMA 3POTA 3D0IE 4U8VA 4OGCA 4JV2A 2YNHB 2XBPA 4JV5J 2FGOA 3AVJA 1REVB 4J9KA 5T7LB 3UW1A 3M6GA 4CFCA 4FLVA 1QE1A 2JLEA 1QVFM 3QJJA 1Y10A 5HP1B 3EXCX 2UXBJ 5KRSA 1NPPA 1J53A 2V4QA 1MN9A 3WX8A 1UEKA 3TVZA 4C9DA 3KLHB 4M5GA 3J7YP 1TKXB 3UKRA 1VRTB 2YI1A 3FFKB 2G8WA 4JI1J 3NCRA 1TYQB 1RCOB 4NCBA 4WFBL 3AOBA 1XMBA 4JP8A 3MR5A 2RQ4A 1LWXA 1ILYA 1M5HA 3L4IA 2LXUA 4TY8B 3P5JA 1P90A 3AB4B 4DX7A 3KYLA 3HFKA 1SJQA 4UOGA 2M4MA 3CGIA 2HHHJ 2CADA 4ZPTR 1HKGA 2CPFA 3DRRB 1NB7A 1SI9A 3DGPB 5GAHI 4PXBA 2RNEA 1VQ4S 2AEMA 3WXJA 1X4GA 5CHCB 2HGMA 3PW4A 2WZ1A 1HNWF 2CJQA 2JHEA 2P2CB 4E19A 3V9ZA 3BGLA 3FBFA 2NRXA 2C3PA 1UWAA 3V5RA 1M90O 5AJ3F 4CF2A 4BWJA 3MK6A 3KDNA 2CIMA 2MQ8A 2HLTA 4KB7A 1NSKL 2P8IA 1Y00A 1W9HA 3NS6A 3RB6A 2J0SD 5KG3A 3O4QA 4JI0F 1BHNA 4H5WA 4E7IA 5AQRA 2LDYA 1PILA 1RBVA 3HDSA 2O8CA 9ATCB 2G8VA 3M9OB 3IS9B 3PCOB 3M8QA 4A8QA 4N8NA 2HQCA 2N7YA 3VR1A 3MR2A 1HQ2A 1N56A 3IGNA 1YRUA 3TTDA 3OL6A 3G8SA 3VA3A 4L73A 2ZWPA 2KB2A 4OLAA 4DTPA 3BH7B 3CXCR 2XNQA 2QLBB 4ZP7A 2ZJPL 4P6QA 1NK4A 1TK5A 3UCZP 1C0UA 3PIOQ 3AGKA 4OVLA 1H38A 3GSDA 1SL1A 5ETNA 3C2PA 5HLFB 2VFSA 2A18A 2BKNA 2BE2B 3G6VA 2FLPA 2NRVA 2B56A 1H7WA 5DETA 4FP9A 4DUYF 4E7LA 4H4MA 1NGEA 2FC8A 2AGPA 3W9IA 3QT6A 3SAFA 4JI7K 1BLUA 2AJQA 1K0VA 4WFXA 1Q86O 4KQZA 2BUNA 1IJJA 1QAIA 2UUBK 5HRPA 2RHQB 2QTWA 3ZSOA 3QLHB 2LA6A 1B70B 4CH0S 3HFZB 2E9ZA 4ZDNA 3CEDA 3UDVA 4YB5A 5ETTA 3BSAA 1BA0A 1RHUB 4WF9L 3QT7A 3G82B 3KLFB 2QIFA 2EI5A 4DN0A 1X5OA 1N34J 1CLQA 2YNHA 2JJ4D 4MO4A 1R0BG 3K2YA 4ED7A 4KB0A 3MUTP 3NFAA 1X8DA 2MLXA 3BN4A 2YJFA 2B5JA 1S9FA 2KQ2A 1SJ1A 1J6ZA 4BREA 5C42A 4CIFA 3OS0A 3KZBA 1N5YA 3EVMA 5AFUH 4KGMA 2PAVA 3KLHA 3B4MA 5LMUF 4J2EA 1ZZNA 1S99A 3DRSA 1VRTA 2OJ3A 4FF2A 4O4GB 3WNHA 4WZMA 4JI4K 3ISZA 4N77A 1MMLA 3AVHA 3LGHA 4KHUA 1XC9A 4O4RA 1EB0A 4LFCF 4GNIA 4WTYA 1U2VB 1QM9A 2DHHA 3AD7C 4TY8A 4CIOA 1VQPN 4O0IA 2ZZMA 5GADI 4TYBA 4O0JA 1BQNB 1R0AB 5GAGP 1RDCA 1RT2A 1YJWS 2N3LA 2LXIA 5FPNA 2GIQA 4QS7A 3U1LA 2XQCA 3MEKA 1S4EA 3DRRA 2E6MA 1VSIA 2UU9F 3P31A 2ZH1A 4QWCA 3DGPA 4LR7A 3TO8A 4DSFA 1NJXA 1WEXA 3TTCA 3IG1B 4JBCA 5MAOA 2XWXA 5AE1A 1XUPO 3HT0A 2PIIA 2WCXA 1DTQB 4XIUA 2ZWOA 5EX0A 4C23A 3AA3A 4YOXA 5KQDA 4NYZA 1KKHA 1QSSA 1K8KB 1QVFR 4B9MA 4CJRA 3K8WA 4U7BA 2NSCA 4W4MA 1S0OA 1HYSA 3R97A 4LF7F 3C6TB 1JNZB 5CD4H 5K8MA 3CCSN 3ZEUB 5E2QA 4JNEA 3HULA 5LOQA 1EKSA 4FJ9A 3BV8A 5KG7A 3IS9A 2W4DA 1Z05A 3SFUA 1K9MO 4I1TA 3FJ2A 5F8IA 2YNIB 1FKOB 1ZM4A 1N6QB 4HUGA 4WP8A 4RW4B 4Q0BB 2CQHA 3MCSA 4F4KA 1YI2N 2E7WA 2YX6A 3SMPA 1YIJS 1NDKA 4BG9A 4GKJK 3OHBA 1Q9XA 4J37A 3MXJA 3ZTQA 1WSRA 4F9OA 5HLFA 4MDBA 3QYYA 2BE2A 1S76D 4FWPA 4PG5A 5KFIA 4JI2F 4NLQA 5BR8F 3CCES 2DTJA 3BSOA 3HPOA 2HURA 5T14A 2HQ3A 5C24B 1HYZA 4CGJA 3F2KA 5GVQA 1FJGK 2HS4A 3D5MA 4JI3K 2HMIB 1YWXA 1NMDA 2UUAK 3AD9C 3DM2A 2XSFA 1MWMA 3OYCA 3TAFA 3I96A 3AO4A 1GFWB 2W4PA 5IWAK 3ZZUA 3ZETB 1BWVA 4LRFA 3MDQA 3NLCA 5B8HA 3GCWP 2A6MA 1WTFA 1NGGA 2HF4A 3U6FA 1EZZB 3ZSYA 4YB7A 4QWBA 4K5RA 5AQIA 4X65J 2NYIA 3NMRA 4P73A 1O5JA 3G82A 3KLFA 3TJAA 4QW9A 4YOWA 3RR8A 3HVTB 2J0XA 2ALZA 2BEFA 4ECWA 3MTKA 4BC9A 2MXYA 2RS2A 3PX0A 2LMIA 2ZBQA 5CR4A 2KFZA 4OYWA 2OYQA 4FZXC 3NS5A 5KFPA 3LDQA 2V8DA 3H59A 2LSNA 2A1BA 1WSEA 4J9VA 3SZ2A 2NLWA 2P9SB 2WVEA 4IO1A 3QO9B 4OI2A 2VPYB 3G6YA 1VQ5S 1KOHA 1HNZJ 1CSJA 5FROA 4FJ7A 4FJMA 2Y0BB 2M9KA 2CQGA 3BEGB 1NK6A 1ZA2B 5LMNK 3VQDA 2C3MA 2IOCA 2HGNA 1NKCA 4O3OA 3MZIA 3SYZA 4QIVA 1U6FA 1NUEA 4PXDA 1RA6A 4PABA 1E4FT 3M32A 1D0EA 4CO3A 1YJRA 1PG5B 3UN2A 1N5VA 1HNXK 5IT9Y 3IG1A 1I5OB 3NY0A 4ECTA 1RTJB 1HQEA 2E5GA 3T1AA 3O1BA 2Q31A 4OJ3A 1GOBA 3PJ9A 1RAAB 3H3NO 1DRZA 4FWQA 3T1HK 4XDDA 1Q5VA 2KXFA 4F0KA 4NLGA 4BQZA 1D9DA 2GHWA 3WC2A 3HD1A 3AGRA 3L4BC 3GYGA 3NGTA 5F0WA 1K8KA 3QAUA 2J6UA 2PA3A 2E1AA 2LCWA 1RGVA 4WE1B 1HFEL 2HVDA 3I9ZA 1FRMA 3CDAA 2Q43A 2YNFA 5H9EJ 1RTDA 2VHGA 2C3UA 3ZEUA 2EFGA 1R89A 2W8KA 3O9QA 4QIWD 1S59A 1H3DA 3N5FA 1WDTA 2L41A 2IDOA 3ZTRA 3EMTA 5KFMA 2JEJA 1N33K 3KJVB 3U9ZA 1FKOA 4B3MF 3ULEB 4RW4A 2GJ2A 4Q0BA 1QQNA 1B0VA 1ITPA 2HZVA 1KHWA 2DNYA 4CBUA 3THVA 2QA1A 3K59A 1GT8A 4JS4A 4PWWA 3DMJB 4IFYB 4KPYA 1CXUA 4A8FA 3Q7BA 2AIRB 5EUHA 2RQMA 3GILA 3LA0A 3MM7A 1QDUB 4B1YB 4CBWA 1X4DA 4KV8A 1FKPB 2ABYA 2KH9A 4CJPA 3OYBA 1F9FA 2QO3A 4XDCA 1C0FA 2GUPA 2Y1IA 5CXTA 2C2MB 4C6AA 4FBTA 1LOTB 3IP0A 4BE0A 4NASA 2G8FA 1M1HA 2QE5A 5TKWA 4P2SA 2XY8A 4HR2A 5F8HA 2BANA 5AXLA 4AUKA 4LR9A 4OKJA 3D66A 3IGVA 3G71N 3VV2B 1RU1A 3CD6N 3M1VA 3TNVA 2HHVA 3M2UB 1Y5LB 4N5SA 3BF3A 2D74B 5K9FA 3MMBB 3HVTA 2C42A 4DX8H 3C6UB 3CG7A 3A13A 5BRHA 4RW9B 3SQ4A 1SBRA 3QMQA 4N8OA 3MEDA 4JYAJ 1U1OA 2CJYB 1VQ6N 1PKUA 3AOCA 3CDBA 5D4LA 3MN6A 4X4TA 5CZ2A 2PC6A 2Y1LB 2RAQA 2P9SA 5AQWA 1H98A 2VFUA 1N4LA 3FEXB 2C3YA 1T9UA 4OHWA 3FVYA 4M3ZA 1F9HA 4FK4A 3BREA 1Z2ZA 3NH1A 4WPAA 1N8RT 1UA1A 4V19J 3P4UB 3SBMA 4GO7X 1GLJO 1CPZA 5D4PA 3BGFA 4Q8FA 4ZLJA 4I7FA 1VSLA 3ENQA 1D9AA 2UVWA 1ZBIA 1N88A 2ZJRL 3PR5B 2CFXA 3SBGA 3OBIA 1HHTP 2IJNA 4YS2A 1RTJA 4C7QA 3KG4A 4N47A 4AE5A 4LRDA 2DXEA 4KB1A 3HSJA 1K8AT 2BE7D 3SQ1A 3OPKA 3QFHA 2D3O1 3AARA 3GQCA 2LLZA 1NDLA 3V6HA 2MZSA 4LC9B 3OTEA 2VPZB 2XLJA 4DTXA 3HM9A 2IVOA 3DI6A 1Q82T 1L3VA 2I0XA 1K6YA 1A0OB 1Z2LA 2BJ9A 6FDRA 4GO5X 3FEYB 2XNRA 2DITA 1ESVA 2P9NA 4WCEQ 3G8TA 3EE9A 2A6AA 3KJVA 2A2DA 3V6JA 2XMMA 4F4ZA 1RYRA 3CF5L 1UMJA 4K43A 3N5BA 1NBWA 3PDNA 2FVPA 1TGOA 5ADXH 2BOPA 1VBZA 3ISND 4DMNA 4QR2A 3KNGA 4CD1A 3PSFA 3DMJA 3HLUA 1HUXA 3I9V9 4IFYA 4OZLA 2PYJA 2Z8QA 2A1RA 4NI2A 1JXVA 4K42A 1FRIA 4USMA 3NXZA 1FKPA 4CEOA 2F9JA 2MPUA 1G99A 4KGKA 3SV4A 5LMUK 4HTIA 5C0YA 2ROGA 3CD7A 4OYPA 1M1KT 2OEMA 3F73A 4PA1A 2IBKA 3KXDA 1MLAA 5I3PA 2MEWA 3SUOA 3GU0A 2DY9A 2Q1LA 2DR9A 2D0BA 2L3MA 1HBUB 4LQ9A 2HRUA 5BN8A 2XGQA 4YY3K 4ILMA 1GLBG 3OTOJ 2W7PA 2MJUA 2JRSA 3MAHA 3NS7B 3K5LA 5HJXA 3JYTB 3M2UA 1H73A 3TUIC 4IKFA 1KQSM 1ZBSA 2HWIA 3I4HX 3C6UA 1CQMA 2QL5B 3V4IB 2VJUA 4NLRA 4RUCA 1KVAA 2AX1A 2UVUA 2EVZA 3J80O 3RW7A 5KRTA 2EK6A 4RW6B 3ZFVA 2G4BA 1DAXA 1NM2A 4X2BA 1U45A 4B1ZA 3SQ0A 6AT1B 4CJVA 3T6BA 5F8GA 5L1LA 4IOAL 3K58A 3H8YA 4LH4A 1N32F 3D0PA 1U0SA 4KHNA 1HLUA 4JK9A 3AODA 4B9VA 4LF7K 4K2JA 2XZWA 4FLWA 2AGOA 1U7LA 1KBRA 5B0DA 3UIQA 4AHUA 3BM7A 4X66K 3JSRA 4LF2A 4KSEB 2B4PA 2J9EA 3O9RA 3CCUS 4F0MA 4LRCA 3ZT2A 1U2RA 1KFSA 4Y28C 3ZXWA 5K8OA 3O8WA 5M1FA 3DDIA 5KFKA 3HRGA 5JUMA 3T3FA 1CJUB 4I9QA 1FF2A 1JX4A 1VSDA 1XQIA 4DV6J 3O4WA 3PTWA 5ELZA 1X60A 3AVBA 1WTBA 2CGKA 4C8OA 2HHQA 5AFUA 1WBDA 3TR8A 3TW0A 5BR8K 1FFWB 5EDWA 4B3TF 4KI4A 2ZF5O 2IDEA 3BDEA 1BXNA 3EEQA 2ETJA 2KM8C 1FNXH 3J7AN 3UVJA 3VVTA 4W5TA 4GKKJ 5C2DA 4B3RF 2VG6B 1SIWB 4FLUA 4R8UB 2M8DB 4WFBQ 3GIKA 1NGFA 3SMZA 1NEEA 1VIOA 3T9ZA 3MCNA 4DJBA 4DR3J 2QYGA 4H4OB 1VC6A 4BC3A 1N5QA 1CVJA 2DR8A 3KUGA 2FJEB 2J6SA 1WSIA 3GCXP 1U26A 3QNOA 4KI6A 2RRBA 1UZDA 1WI6A 3AHPA 2AYBA 2MLZA 2N7CA 2B6AB 4NXNJ 4PQUA 2ZD1B 3PLAA 2IM3A 2CZ9A 5DQGA 1KFDA 3IUCA 1RA7A 2B0GA 4A8KA 4F4AA 4LF1A 2QWPA 4ZVTB 2RDIA 5HQ8A 4CH1A 1U09A 4CK2A 4RCHA 2AV5A 3IC1A 4ES1A 3AAPA 3VQCA 1NGAA 1OVYA 3QBXA 3KUEA 3A8KA 5HROA 3TI0A 2HZCA 5AQZA 3KDOA 2DHXA 5LY3A 3M8PA 2BV3A 4ITSA 1PAEX 3HHLB 2XLIA 4YR0A 5DM7Q 2HF3A 2NRZA 1YVFA 4DSIA 4TQRA 4USJC 1HI8A 3V4IA 1WSJA 3ZX2A 1WAFA 1JLGB 4B08A 4CF8A 1RTHB 1NKBA 1RHKB 4A5AA 2CNOB 4WK1A 5L39A 2UUCJ 3HHDA 3L7OA 4RW6A 1HI1A 4FJXA 4ZCLA 2ZJPQ 3T5LA 4AQYF 3DRPB 2LU2A 2QGFB 1RTIB 1I94F 4Y2KA 1DEJA 2OPSB 4EUVA 1BCMA 3K0JA 2MKIA 5JMVA 1CXQA 2VA2A 1ZBTA 4S0MA 2P9LB 3SCKE 3DWLA 1RILA 1CC7A 4AL7A 4ZP8A 3A5NC 3R5BA 2ZM6J 2RU3A 4DXLA 1MG7A 2KU7A 5H1SV 1WELA 4Z7CA 2L9NA 3CJCA 4J8FA 4M5IA 1KD1O 3I0RA 3HBTA 4WIQA 1TUYA 4B3MK 1S0VA 2ZBPA 3QJPA 3HSCA 1LW2A 4UOFA 2EG2A 5AR0A 5K8NA 1CJUA 3BPDA 1KQSR 3PIPQ 1JXBA 4WF9Q 4BR2A 1FHTA 2DR5A 4IJAA 4DR2F 2ASMA 3WNFA 2BJ7A 4DF8A 4HTLA 1Y3KA 3R1HA 3B6PA 3MDFA 3DLRA 1RT6A 3GJTB 3I0SA 1VK8A 3A5OC 2OZSA 3R5DA 4OX8A 4ID5B 4G3IA 3JSMB 2CQ3A 3FLCO 3OHRA 4I9LA 1NU0A 3IFRA 4D3GA 4KHQA 4NA3A 3OYKA 1F2HA 4OZ0A 1VYAA 2VG6A 2BJ1A 5C2CA 2P9IB 3DOKB 4KPCA 4AD6A 2FTRA 1SKWA 1JLAA 1XMQF 3QWPA 3E3XA 1O1WA 4JLHA 4ETXA 4MYTA 1GK8A 2DIVA 3GFZA 4HKQA 3VENA 3MXMA 4R0JA 1VAZA 2A40A 3GL1A 4Q8EA 4HHUA 3FQKA 3T5JA 3CMES 4X4VA 2R7WA 4CDIA 4FKXA 1BMQB 2FQQB 4Z4IA 2V4RA 4FJGA 2ZBCA 3OR1B 3PR4A 2YHAA 3TWZA 3CCTA 4DR5F 4KO0A 2D7SA 3CC7N 4JI6J 1AUDA 2L08A 4ANEA 3PNIA 1HNWJ 1YX2A 4DUZJ 2LP4A 4LF9F 1WKLA 5G0RB 1E3MA 3PM9A 1UVIA 4CQ1A 5AJ3J 1EQYA 1X31C 1DGKN 4CZKA 4PL7A 4GV3A 5I3QA 2JEFA 3O44A 4LJMA 1BGXT 4JI0J 3CJRA 3TSQA 4LSLA 1GTEA 3RAQA 4FOEA 1RGIA 2EPIA 4BRAA 1IBCB 1JLGA 3I4PA 4NXMJ 4C11B 2EWHA 1AZSB 5FPEA 3IMQJ 5M2RA 2VZ9A 3J7ZT 1YJWN 3QGPA 1U2FA 3VQEA 2I5JA 2MQPA 3A5LC 4CIEA 5HRRA 2B9WA 1PBUA 4EP5A 1RADB 1SL0A 4UOHA 2VG5B 3GONA 3U4LA 3AY9A 4OYIA 3U7JA 2VF3A 3QFWA 4WFNL 3LDNA 2OPSA 2D3UA 1TMMA 1GLDG 4DCHA 4OYZA 2PA8D 1S9EA 2OSQA 3UDLA 2RHSB 1SJ4P 1LW0A 1K73T 3CB4A 4M3RA 5KG5A 4LFBJ 4Z0UA 1OSCA 4CW7B 4KHPF 3RMCA 1SL2A 3KWIA 4HYKA 2AD9A 1HR0F 2P9LA 3TZXA 1VQSA 4DUYJ 2HBMA 3OFFA 2Q2RA 4OHVA 4IOCQ 3J81j 4PKHA 1C6VA 3NWRA 1HHSA 1PJ7A 1DTTB 3EJMA 3W5XA 1XMOK 3TJ9A 4PQAA 5JJBA 1KLNA 5CYJA 2Q3PA 1F60B 2K1RB 2D3OR 3MCOA 3GV8B 1RWWB 3MEGB 3OTCA 4KKOA 4NRTA 4J9PA 4DL4A 3ZSZA 1Q8KA 5LJVA 2V7YA 1QHTA 1SJRA 3FRZA 3SQOP 3CIPA 4YFUA 3ZT0A 4J9QA 4X4UA 1HBNB 4EYHB 3LUYA 3KIOA 4DDFA 1FRHA 1DY3A 4K4WA 1QUPA 3OVSA 3L2VA 3VETA 2Z30B 1FEEA 4ID5A 2AA4A 3QT8A 4GC6A 4DS4A 2HFSA 2PD1A 3BKUA 1S0MA 3A3PB 4K41A 3BZCA 3KMQA 2XMTA 4OYAA 1SVDA 1C0MA 5HMYA 2DYAA 3CETA 1TFYA 1Q81T 4MLHA 4E98A 5HL7Q 3IM9A 4W5NA 2HKEA 1SCJB 4OJRA 3VAGA 3R1LA 4LFCJ 3O1LA 2BX6A 3GG4A 3QNNA 4JAXA 4EYIB 1PC5A 2OHDA 4OI6A 2CPZA 3IR7B 3D54A 3G9CA 3NNHA 4QR0A 2UU9J 3OYLA 1VC0A 4EFAC 4FJLA 4N7TA 4JKHA 2YWGA 2FLNA 3GG0A 2DKOB 1XR5A 3MPVA 1LEOA 1VSFA 2R7RA 2HFZA 2ITMA 3P4IA 1NK9A 5HQLA 4RNHA 3WT0A 2XWYA 2BM0A 2OPRA 5BYSA 5EX5A 2YTCA 3M2RB 4OI0A 2PYLA 4ILLA 2GA7A 4GV6A 2FPHX 1IWGA 2OD6A 2IAJA 3QFUA 2A2CA 3SSRA 2D3ZA 1YRXA 4F0HA 1AZSA 5IT4A 1FXXA 1CZ9A 3EZ5A 3C3LA 2H5JB 4CO1A 4BGBA 4B1UB 3OYNA 1XQSC 5CAAA 3LP1B 4L3NA 4ZVUB 3WX4A 4NYOA 4I56A 1SXLA 3DXKB 5J2MA 1NJZA 4HTUA 4KTQA 1RB0A 3SCIE 2CNKB 3VQBA 2WRMA 1T9YA 4DHYA 4B3TK 4H0PA 3CQYA 1FXRA 4DQIA 3OS2A 1W26A 3ZZYA 3LM2A 2HNYA 4JI2J 1T3VA 1KCFA 3RG6A 1GNKA 4KRFA 5J2PA 4B3RK 2QRRA 3F44A 1R31A 5LJWA 1DTTA 1BWEA 2Z2LA 1I51B 1NZAA 4DL0C 1QTNB 3MGJA 2BE9B 2K1RA 2KG0A 4BBYA 1UFKA 4CZCA 2JWKA 4AHTA 3MEGA 2PMWA 2PMHA 3LO3A 1KWMA 5C7PA 3I31A 2LEPA 2YXLA 4QS9A 4IZ9A 4BRPA 2H4YB 2F7VA 1HBNA 5MLCV 2KZMA 2PFUA 3BR9A 5EWGA 2WB1D 1WF2A 1TVRB 1U6BA 4C97A 4E8UA 1HPZA 1H72C 1F0XA 3GIIA 3CC2S 3AQPA 4YUDA 1VSEA 4FLZA 1MU2B 4FYDA 3U1NA 5D6GA 3H1QA 2NNWA 1WF1A 2LQBA 4CLFA 4UY8T 2HYIB 3MWTA 2GWKA 2BH1A 2QSWA 2HAIA 4O3NA 3ZC4A 3PFEA 2XMJA 2D69A 4FPIA 2GTDA 4DBQA 5LSOA 3OL7A 1VQ8S 3RRGA 4NB4A 2KYXA 4BROA 3S3NA 5HJYA 5JLFA 3CJ0A 3VVUA 1X4EA 4NLTA 4KHSA 4QWAA 2RHKA 3R5GA 3PKYA 3JS9A 3K7RA 3CCLS 4BRCA 4LBHA 5HOOA 2MKSA 2GHVC 5BREA 2RMLA 1WACA 2EHGA 3G25A 1UWBB 4ILGB 2QA4S 2KYZA 4H5TA 4IWVA 2CJBA 4CFBA 4RZRA 2YKNB 1ZOTA 4LF6K 1I94K 4E7HA 2YNGB 4OPAA 2QWLA 3QEXA 6FD1A 2EW9A 4K4VA 3UD4P 3SJJA 3M2VB 4PAAA 1XNQF 2PDAA 3MN7A 3MCAB 2CPYA 1SKRA 4BQLA 4QZVB 1L3TA 3QERA 1T9VA 2J7KA 2PFFB 4KR0B 1EETB 3I32A 2OMLA 1FWLA 2QV6A 1B7FA 1TL3A 8ATCB 3BGRB 3VN5A 2NUBA 1FI4A 1IKYB 3BUZB 1M5PC 1WSGA 4FJNA 1FRLA 2D41A 4U67L 2J76E 4NMLA 1S5ZA 4K0KF 1L5UA 3W8GA 3CF5Q 3ZTPA 2DIUA 2ZJQL 1F21A 2GC8A 2QEXS 2W6LA 3EL2A 2V2KA 1U1KA 3DXKA 2C1EB 3CFPA 2ZKTA 2BJ3A 2PBDA 4ETZA 3T41A 5GAHU 3LWLA 2B8PA 5KT2A 1PBAA 5JS2A 4GW6A 1E6VA 3VQSA 5HSPA 3UFCX 3QT5A 4NCGB 2A3JA 3CJ4A 5JMNA 5CABA 2DNQA 4DV1F 5BRFA 1X4BA 2B4UA 2KRRA 4JK7A 4FS1A 2HB5A 1FO1A 4HTJA 4FO0A 2DPNA 4H0OA 2MKJA 4K2XA 1JXLA 2OLWA 2IVPA 1SS6A 2R7OA 1XMQK 3CCMN 3VEZA 1YJNS 3D67A 1F6TA 4PRFA 3R6MA 4K5SA 2XRIA 3Q8UA 1TUGB 2M88A 3ZYYX 1NJIO 3HOSA 4OJGA 2PI4A 2RRNA 4DV0F 3EVWA 1FW6A 4DL7A 4P74A 3FDSA 4J9MA 1Q9YA 4CEQA 1XNRJ 5GIPA 1RCXB 2DBBA 4DTJA 1B0TA 2ZOMA 4CK1A 3A2FA 1QQCA 1Y7PA 4AILC 1ZBUA 1NSQA 1XI1A 4B9SA 3O4NA 4CEAA 5F41A 1GQEA 2P5OA 3QETA 5C12A 4H4KC 1SJFA 4NLPA 2CJXB 3T1YF 1LCUA 2D0OA 3VAIA 3U3YA 2R7XA 2BW2A 2VCPA 2QLXA 4IOAQ 2VUGA 1RJJA 4LF9K 5ETPA 2H3GX 2R7SA 2VBXA 1FX4A 5LL6d 4KIAA 2WUSA 3HZ6A 4K4YA 1RKJA 4EFHA 2FYXA 2HFUA 2K7JA 4FXVA 4J2BA 4RBVA 3PO4A 2JC0A 3CMAN 5HBMB 4PWDB 2Q66A 3NGKA 2MKHA 5C2FA 1SV5B 4B8AB 5A6WA 3PHTA 3KLEA 3GFHA 1Q0NA 1Y5NB 4DPXA 5LL6Z 1LAVA 4DCPB 2ROPA 3A4TA 4QJVA 2NRTA 4FYXB 2G8IA 5I9EB 3EGZA 5KFWA 5E0OA 4XH1A 4RNFA 2AF6A 2YBVA 2KJWA 2DGXA 1RZMA 1U2CA 3HHEA 1VQ9S 3QEWA 1RKIA 3QGHA 5A8WB 4A8OA 4DWIA 2E66A 1FK9B 3M2VA 3DYAB 1AW0A 3MHYA 2V7ZA 2EFNA 3I55S 3NVKA 3CJKA 2CWKA 4BY9C 1EETA 3D2FB 2G8UA 3HL8A 1RBTA 4JI5F 1HR0K 4OPJA 4P72A 4IQXA 3AOAA 3BGRA 2B9XA 1VQMS 2GS8A 1X9JA 1IKYA 2XZDB 3M9NB 2VIHA 3NNAA 3S1TA 4GVBB 4IG3A 4X62F 4DKWA 2CQIA 3C46A 4IRDA 1N0VC 2QLWA 2EBGA 1YTAA 3J80U 2H48B 1U0HB 5GADU 1OS5A 3CCUN 5CQGA 2P6SA 2HBZB 3OLBA 1Q8IA 4FWNA 1ATSA 1ZPVA 1ICEB 4HDHA 2HBQB 2VWJA 3K2PA 2IPOB 2V4JB 3GTYX 5ETLA 3MTJA 4A4JA 2W2NP 2BKPA 3EWGA 3MD1A 4OZ3A 2RE1A 3OLAA 4JI8F 4GMKA 2FGCA 2VV5A 2V8HA 2ITGA 1GTHA 4ZN1A 2E9RX 2V34A 5H1SQ 1ZTWA 2X74A 4MK8A 3R1XA 1QZ6A 4X4OA 1I3OB 5DM6L 4U95A 3PY8A 1Y4ZB 1SAZA 3P6YC 3FZBA 2YQ1A 2VC1A 3F41A 3L2RA 2VODA 2RDDA 1FNOA 3RMDA 3AJ1A 2ASJA 4CJ4A 4JHDA 1YKWA 4CZGA 3EN9A 4ZPVR 3WQUA 1KNZA 2W2PP 2R8KA 3MECB 2WW8A 1IBLK 5D4NA 1VQ7S 1A6LA 4TSXA 4MIAA 2HBKA 2W4CA 1OJ4A 3VF4A 1HX1A 4NLWA 4NZ0A 2CPEA 5AQPA 3AVIA 1G3OA 3Q23A 2ZH4A 1UVKA 3SNNA 4H5RA 3ICLA 4OLBA 2KJVA 2YQ0A 3OR2B 2GNKA 4BGAA 2IVNA 2UXCK 3DGVA 3C15B 3B78A 1RDBA 2BW7A 2LECA 5EY4A 3Q2TC 1N32J 3MWBA 1MN7A 3EXYA 3GLJA 2OCEA 3IWXA 5HK4A 4KGZB 4OZ2A 3V81A 2V2ZA 5HBMA 1SPBP 3HJVA 1SV5A 2Q6BA 4O3RA 3TUJC 3V9WA 2G1HA 1FJCA 2DXFA 1BA1A 4QAGA 2AYEA 1Z25A 2BTFA 3OXGA 4XEIA 2DNGA 1OYEA 5IT0A 3UDEA 2RKIA 1TTHB 3CCRN 3P49B 3D1HA 4FLYA 3B8AX 1FE0A 1HIYA 2JWNA 1LK5A 5A8WA 2IS3A 3N6LA 4ZVPB 1FK9A 4KREA 2CQ2A 3M1FA 2VQFJ 2BR0A 5KG2A 4CVNE 3SPZA 1J5EJ 3UD3P 3D28A 4QQBA 2NSBA 2VH7A 3MWPA 2WVBA 3CJ8A 4KHRA 3EZOA 2IY5B 4CJFA 4TU9A 4AYBD 4NX9A 1Q7YT 2RT3A 1I3AA 5KFVA 5HQMA 2V63A 2YJEA 4MO5A 3VPZA 1Q18A 1U0HA 3QRQA 4ZCIA 2F8TA 5FRNA 2KI2A 4WU2A 4IG0B 5KFYA 5L1IA 2H5EA 3V6DA 2P9UB 1VBKA 4DV3F 2AZ3A 3AA8A 1AUSL 2P9GA 3GJQB 1N36F 1NXIA 2YH1A 4IQMA 4PG6A 1X3NA 3G87A 4M42A 2ATLA 4ECVA 3Q24A 3UE2A 3SBTA 4LBIA 2GBZA 3S41A 2VU5A 1AROP 3DDKA 2W2QP 2CQDA 1MWKA 3J7AP 1NLKL 4PXEA 5M1PA 1U4BA 3O3HA 1E6YA 2GZOA 4BRIA 3W7BA 4LFAK 2XMKA 3L2UA 4M3TA 3TARA 2XYGB 2HNZA 2Z0GA 2IJFA 3EE3A 4FDFA 3HOTA 3DNCA 1IH7A 2F4VF 4PPDA 3X1LB 4DR6K 2VBWA 2B9YA 5B09A 2MQLA 5F0UA 3BH6B 3QIPA 2LEAA 1VQON 2N4CA 3EM1A 3VEYA 3CDUA 3ZSXA 2QC3A 3FCWA 3K5OA 1WF0A 5HI7A 1U04A 4RW8A 5BR9A 3KK1B 3OHAA 2ZBIA 3WNGA 4CJKA 3O5BA 2E1ZA 4WWSA 3DHXA 5D3GA 3W9HA 1XNQK 3IBWA 4AQYJ 4DSEA 1D09B 3HT3A 3IWNC 2FBVA 3A0IX 4DR4K 2QLJB 2J9DE 4JI7F 3G4SN 1YZ6A 4ISFA 4CYUA 4Z94A 4I69A 3MM6B 2OPPB 4H5NA 5ETVA 3SI8A 4U9RA 2VG7A 3ZNJ1 1S12A 5AZIA 2CPHA 2DTUA 4DV4J 4OZNA 2M8HA 2V9KA 1C1BB 5KT3A 1T02A 4FVMA 1HBOA 3KLGA 1YG0A 2EC0A 1NLVA 5AQJA 2HBJA 1BY9A 1RLDA 2D0AA 3BN7A 3BYRA 3ZSQA 2AP1A 1GOCA 5GAHP 4JKAA 1UKUA 2MZJA 3EX7B 4OYOA 1DJ0A 1FFGB 1N52B 3UO0A 1DBDA 2W7AA 3IO1A 3CYMA 3R8EA 1S48A 5KFFA 3W8PA 4XPCA 1UW9A 3DLEA 1EQ0A 2XCAA 3KK2A 3ENHA 1ITGA 4CTAA 4DR2J 4GV9A 4F4WA 4CHOA 4EAHD 3OL8A 4DV1K 1BI4B 4DV2F 3MXIA 2M2BA 5L1JA 4RNNA 2C3OA 1NJWA 1HBMB 1T95A 2GIRA 2G0JA 2XB2D 1LOUA 2YY3A 3TEHB 1U48A 5THWA 1PAUB 2ZH7A 1F5BA 1RDWX 3THYB 2AGQA 4R0EA 1G15A 2AJ2A 2JFKA 4NLBA 4O5BA 2HMPA 2YKAA 4B1VA 4K8RA 4TN2A 1MNEA 1ELOA 4DV0K 2EFPA 3DLHA 4USIA 4IG0A 5F9NA 2DRBA 1SQEA 3AJ2A 1KC8O 4CJEA 4RO0A 5C15A 5F3ZA 3NCQA 4MJKA 3B82A 3MXHP 5IM0A 2OIHA 3OUYB 1FRKA 3W64A 3FK4A 1FVSA 1H7XA 1J9AA 4A8SA 4OX9K 4LF4J 5E33A 4USWA 4EO8A 3CW2C 4DR5J 3P8BB 3CTRA 4DV7F 1M90T 3LALA 4LF5J 1HNVB 2VGNA 2VWKA 5AE2A 2OFHX 2J4RA 4F3QA 2QYCA 3SK3A 4EBDA 2GQ2A 3E66A 3LDOA 2IJRA 4M5HA 2D5RA 5D15A 1P6TA 2BGGA 1MWZA 1C1AA 1R8CA 1C4CA 4M45A 4DR7K 1RHQB 3AO2A 2H54B 2CQCA 5KOXA 3FSYA 5C25B 1EWQA 2N4DA 4X64F 5G4DA 1CZBA 3OS1A 1YUWA 3MI7X 2E5LJ 1YDLA 4OHZA 2L48A 4FJ5A 1S97A 2QJ3A 4FPBA 2OGUA 2DNNA 3POTB 3CM6A 1XBWA 1TV6A 1OO0B 4GKJF 2HHWA 1XIQA 5IOLA 4DPOA 4X84A 1O0PA 4E1MA 3QJLA 2CYYA 5KFBA 1RCHA 5K20B 3RMBA 2E7XA 3VQQA 3HI9A 4M8LA 4YHHJ 3KKSA 3L6QA 1SB6A 5AQMA 4Y3CA 1UP1A 3M6VA 4CE9A 4JI5K 1UCNA 3TUZC 4DI6A 2X1FA 2XM3A 2YHYA 5J2NB 1NGJA 5U47A 4OYBA 3KJQB 1YVUA 3MM6A 1R6YA 2OPPA 2ZZTA 5A2QO 1ZBLA 4KHPJ 5M1KA 2O66A 2UXDF 3E1YA 1ZM9A 3VQ8A 4RWWA 5IWAF 1Z6RA 5GADP 1W2IA 4X62K 4ZN3A 4I6MA 2F9TA 3MPUB 3THWA 4A8XA 4BC7A 4H4KA 3D0GE 2G9OA 4HH1A 4DV5J 3R6LB 1ATRA 4PKIA 3HF5A 2B51A 1BHLA 2NS1B 3ZSVA 1S49A 3P39A 2KZZA 3QIDA 2JWLA 3OYMA 5IQQA 1UPPA 2CJAA 4CEZA 5HO4A 1WORA 3GYNA 2NXUA 4NE9C 1WC5A 1XWLA 3IRWP 4UY85 1BI4A 2ZGZA 3MEEA 4WYLA 1RT4A 5E3RA 4NMXA 3CPEA 2QMUB 4IEIA 4IDHA 4Q43A 3JQKA 3MR3A 4LF8K 3Q2SC 3H98A 3LW5C 3MPWA 1BCOA 1PCAA 2GV9A 1NDCA 3QQCD 4YR3A 4AHCA 2H65B 4IDKB 1FJ7A 2H5IB 4YQWA 2UXBF 5EN1A 3HHKA 4CO0A 4CJTA 3K5NA 3OTBA 3ZZRA 1HMVB 1HA1A 1EP4B 3A3NB 3CJ3A 5HANA 4Y2AA 2YWKA 4LR8A 3G96A 4IKAA 1M5VC 3G86A 4JV1A 5J2QA 4EP4A 4LQ3A 4ZKAA 3OUYA 2A6OA 5CZVA 2YPYA 1R3NA 4PEOA 3ELHA 3O08A 3T1HF 5B0AA 4KHMA 5KFGA 1QD1A 1S6QA 3DJCA 4YDUA 1IWAA 2FJDB 3D68A 1HNVA 4J2AA 1Q7LB 4ZK7M 2MQNA 4EU0A 3CC2N 2V9WA 2AYMA 3DLLL 3NVMA 2OELA 4Y34A 1KVJA 3L09A 3IR6B 4H4MB 2J0QD 2Y8YA 1VFJA 1FT8A 1RNHA 1S1XA 5JVGL 2UV8G 3US5A 2A3ZA 4FF4A 5KFXA 1K9MT 4NL5A 2NYHA 4DZDA 1P9QC 1NH8A 2O01C 1VQ8N 3PX6A 4OQJA 1G2EA 3NF8A 4P9SA 2P9PA 3QEPA 4USVA 1JXEA 2LA4A 3L7UA 5JVHQ 3CNQP 1IBKK 3CCLN 4QW8A 2RD5C 3CCZA 1CULA 5KT7A 1FRXA 1WAJA 4NEZA 1JJ4A 2XTJP 1LKZA 1TU0B 5B0EA 5M1OA 2B5JB 3D6MB 3CDEA 1RQ0A 4CO5A 5C42B 3IRXB 3ZSRA 2XEXA 4ZVFA 3H90A 1N5YB 4E2FB 4QCLA 5AT1B 1EAYC 4HT7A 4I68A 2G8HA 1UFLA 3DRSB 1OPZA 4CGDA 5J2NA 4MT1A 2Q6CA 4W5OA 5K14A 2FVCA 3BBBA 2DNKA 3BF4A 3ID6A 1NHVA 4CO4A 3RU0A 3NF7A 1NGBA 3L95X 1Q78A 2IC3B 9RUBA 4CZLA 2OFGX 4WP9A 3L3VA 4F3TA 4DCOB 1Y9OA 3PZPA 1RT2B 5ITHA 2DGSA 4J9LA 1NGCA 2BRLA 3DN9A 3FSIA 4FW2A 2I1RA 3L3UA 5AQGA 3WXKA 5E3QA 5DS7A 2F3JA 4ECYA 2KDOA 2CZ4A 1M1GA 1HL6A 1YRTA 4NLDA 4OLPA 4DV3K 1WWHA 3D1OA 5FLXO 4OFZA 2R4FA 1AFJA 3MOJB 1N36K 4P2FA 2QXFA 2QKBA 3IR5B 7AT1B 1SQFA 3VQ7A 1N34F 1NNEA 4QIGA 2FHKA 1ASWA 5BPMA 4AFFA 2DGUA 2COLA 1RBLA 2P9KB 1K1SA 2OEKA 1HYSB 5JXSA 4IDKA 3H4BA 2MQOA 1F1BB 1C1CA 3PYEA 4ZP9A 3KJNB 4Z2XA 2M52A 2DGVA 5KG1A 1T11A 1HMVA 1G1XA 3OBYA 1EP4A 2I7PA 4E1NA 1VLOA 3W61A 2DJWA 2ZEJA 2F4VK 5ETQA 3O9TA 1UOCA 1EHWA 2M0GB 1EX4A 1ZXOA 4BR4A 4KHYA 3M6WA 2DEJA 3DAWA 5B0GA 4ECSA 2DH8A 3GZ7A 5H9FJ 1FNMA 2GCFA 2E7VA 2DEIA 2FBYA 4C1NK 2A5XA 3CO0P 5KFLA 4H0YB 4WQ5C 4AH9A 2K06A 1AT1B 4CNYA 5KT4A 2HQDA 4I67A 4RG8A 3CIZA 5SZTA 3NEKA 5AQLA 1VMBA 4B02A 1P9YA 3PW7A 3DCAA 3IAS9 4CF0A 1RWUA 1YT3A 4Q7AA 1IKVA 1RU2A 1S0NA 4NYPA 3FZFA 4O0NA 3ZZ0A 4LSZB 1BQMA 3DM2B 4F25A 2VB6A 1KONA 4TXSA 1A5VA 4I2PB 1EXQA 3AY0A 1WNSA 3L0QA 1HNIA 4F7VA 3VEXA 2X3DA 3G0ZA 1TUWA 2WBMA 2XSJA 3BQ0A 1T05B 4OLOA 4P2MA 4YN3B 3CCJN 4WYBA 4RWTA 2RDJA 3VGMA 3D1QA 2DRAA 4K0KJ 3I33A 1T9TA 1HI0P 2W40A 2MKKA 3OXLA 3OBWA 2B4VA 4PG4A 3V9UA 1GX6A 1J27A 4P10A 3QDKA 1K0TA 3IRXA 3VGVA 3W3SA 4UUXA 2Z56B 5E26A 4CJ3A 4ZVHA 1NGHA 4CO2A 1JQGA 2BQ3A 2EG1A 4DV2K 2VICA 4QR1A 1UA0A 1JL2A 2E5HA 4KY3A 1LFPA 1RE1B 3F5TA 4J9NA 1DQ9A 1LQ9A 3ZO7A 4AHVA 2HRYA 1K1QA 5DM6Q 1O8BA 2IC3A 3PIOL 1FDAA 3MM5B 4UTGA 4YY3F 1KAXA 3PW2A 3FE1A 3JQJA 3HSGA 1X0FA 4YB6A 1TL4A 2ADCA 5D0HA 4FWMA 2V6AA 1OVQA 2UYTA 2FBTA 1RT3B 1U6ZA 1U8WA 1IR1A 3M32B 2V94A 4NO7A 1NM1A 4DR1J 1KR4A 2HS0A 4UUWA 4M3WA 3CERA 3L4QA 3BS9A 4F26A 3MN9A 4QYZJ 4CZMA 5EWFA 3F9KA 1RXOB 1R8HA 2O67A 2DNZA 1HQEB 4I2QB 4B3SK 1U8SA 1TUVA 4X65F 1EJ7L 4DV7K 2FDNA 1GAOA 2C2OB 3TAQA 1YVNA 5ADZA 4H0TB 1BC6A 3AQOA 2P9KA 4Y1CA 4DSJA 3T1YJ 2DT9A 2HHXA 4TVAB 2YNFB 1RTDB 3CHWA 3LANA 4X66F 1FCAA 4B9LA 2G2YA 1IR0A 3H46O 4LSNB 2DHGA 4AXJA 2PE8A 4ECQA 3CCVS 1DZ5A 2RE2A 3BGOP 2E5IA 2DB1A 4CF1A 2DY4A 4X64K 4NEYA 2ATQA 2G1DA 3ULDA 5T41A 1H2VZ 4CIGA 3GIJA 1RAEB 1KQGB 3ASMA 4ED1A 2M3DA 1LNQA 1VQ7N 4NWBA 4RNMA 2YHXA 2JVOA 4EHTA 2D4WA 4RJVA 1T7PA 3BY5A 3T9NA 5CZ1A 2XYHB 3FZKA 4PUOB 2YX7A 3CFOA 3MM7B 2UZAA 1H1VA 1TELA 2BJDA 4KV8B 2VQEK 1R27B 4BWMA 5EHHA 4M5KA 2YH0A 3CPWR 3HKZD 2FVQA 3P38A 3BQ2A 2AKWB 2JEGA 4A48A 2UXDK 4I2PA 2Y0SD 4NPOA 5HMXA 4TU7A 2VOPA 1VSKA 2R7TA 3RBXA 1CC8A 4HEA9 3GB0A 1X5SA 2BANB 4U96A 1S57A 1T05A 4DFKA 4BVOA 3M1VB 4DU4A 1YJ9N 3DOLB 3PX4A 2JDJA 2FSJA 3WEEA 2EFOA 3EZWA 3RRHA 1CQNA 2XO7A 4A8MP 3C8YA 3G6XA 1B9FA 4DQSA 2NCKL 1P1TA 3B6BA 4IOXA 3ILLA 3MEDB 1C2PA 2KRBA 2YHBA 1SC4B 3THTA 2WTFA 2QWMA 2QXLA 1VCTA 4Q44A 4V19S 3PO5A 1RP5A 4JI8J 2B43A 2B4OA 3PXGa 4CCHA 3D3BJ 2RILA 4CLPA 3A8IA 4JV5K 1A7GE 3VF0B 4CJWA 2ZHOA 1IBMJ 3LTOA 2IIHA 2W2MP 3MM5A 3CT9A 3CSKA 2BKOA 2VBZA 2DY1A 4FJIA 2UXBK 3AAQA 3OYGA 3NHGA 2E29A 2GMHA 3VQPA 2OMOA 2Z58B 3JAMU 4C8LA 3OW2R 1RT3A 4LRBA 4N41A 2GW8A 4E7JA 3DU5A 4ID8A 2ZVSA 5F8JA 4I7FB 1RWPB 4JI1K 4AHSA 1NPKA 2XMVA 1VHFA 3R3TA 3H5YA 4EZ9A 4KE5A 1NMNA 4BC4A 1EARA 4I2QA 1YJTA 3H2LA 4ZLLA 4OHYA 1VIXA 1X4FA 1ZM2A 2YVSA 3JTOA 5EGYA 1A5WA 2GVZA 1VC5A 3VTHA 5E41A 1FWKA 1H6KX 3ZZPA 1Y5IB 3NAEA 4A8WA 3AA5X 1NMEB 2HHHK 2QG9B 1O6XA 3Q86A 1RAJA 3UE5A 2HK2A 3GIMA 3OYEA 4F3MA 2WSCC 3Q7CA 1RK8A 3DI6B 4URGA 4XAKA 4O3QA 4WFYA 2Q36A 3GSIA 3EE8A 1RABB 3R8YA 4DTUA 1HJOA 2WVCA 2P9NB 1AXQA 2AJ1A 4FOIA 3CJ5A 3MMCA 2IM2A 4LSNA 3THXB 3WXIA 1OQ6A 5DLFA 4ES2A 1GEHA 1WSHA 3BBCA 1IR2A 2R8JA 1XERA 3PFOA 2DNHA 4QU7A 1JLCA 3CJ2A 2OH2A 2HFNA 2K7KA 2O4GA 2XMWA 2W1BA 3O2IA 2OO4A 5I3UB 3KUHA 3J7A1 4F2SA 4DPYA 3UDCA 3UCUP 1OIAA 3KKFA 4ZPWR 5GMKa 2IFXA 2HLUA 2R2RA 5BPLA 3GR0A 2YKPA 2IM0A 4NI2B 4J7CA 4PUOA 1QS4A 2HQFA 4K8ZA 4JD2B 1BOTO 3AV9A 3PV8A 2ZWHA 3KK3B 2QL9B 4OJ1A 2HNDA 2EKYA 1ZC6A 2E20A 3ZX3A 3M8ZA 1B7YB 2CQ4A 2Y9HA 3H20A 4G1QA 1VQYA 4DCJB 2Z1IA 3SAGA 3LPEA 2CDQA 3VQAA 2CQBA 3ZT1A 2AU0A 2QT7A 2W2OP 3LQVA 1X4AA 2N3OA 4MTPA 4NCAA 1M0SA 3BEXA 2HBYB 4CHZA 1OY6A 2JSXA 4FBUA 2Z4PA 1YBTA 3S3OA 2F4FA 1S1TB 3DOLA 2CDRB 3MMAA 4BRHA 2X78A 4Z7YA 5EVZA 2E1CA 1U1MA 3MCMA 5KFQA 4ED4A 4F3OA 1JLBB 1XTZA 1D8YA 3CDWA 4ZPDA 1FKAF 4WQ4A 1H2UX 2P9EA 4PPZA 2DNMA 4P7TA 1J5OA 1FTRA 4CGGA 3G71S 3CD6S 1JLQB 5L38A 1JCEA 3K89A 4PG7A 2VD3A 4M7YA 4FLXA 5ETSA 1N34K 3BSNA 1QAXA 4USTA 2RPIA 2NZCA 3H3OB 3DDNA 5M1NA 3E8OA 4M95A 3VAHA 2F1FA 3M9MB 3D9BA 1J54A 2N82B 5D77A 1R59O 1Q8LA 4LT6A 2X1GA 1TL7B 1FDNA 3V9SA 3IFEA 3ILOA 3LGMA 3DXMA 2KXNB 2HHTA 4WU3A 3M3ZA 3NWGA 2AJ0A 4OX7A 3MCPA 2NXNA 4HACB 2FSNA 1UFWA 1KAYA 3G2XA 3PW0A 3C94A 3R2DJ 4OYMA 1V3RA 2NXJA 3IKMA 2FJWA 3KG1A 2V2VA 3KWMA 5AXKA 3QEIA 2DNPA 5HATA 4RW7B 4MIBA 4QPTA 3OTOF 2C2RA 1IKXB 2BRKA 1FRJA 4NZ7A 5BYRA 3LAKA 2DGOA 2W9AA 2F8SA 3Q22A 4FJKA 4DTNA 4KTZA 1X9MA 2L9DA 2Q0RA 1Z26A 2LFVA 1QAYA 2G0IA 4QYRA 4J9UE 4CERA 4O23A 4J9RA 2PGCA 3UVJB 5DJBA 2BA9A 4ZCKA 2AQ4A 1RWVB 2J8AA 1U1NA 1SUQA 3THXA 3L7PA 1NOZA 1PYSB 3OVBA 4JI7J 1OYDA 4UZCA 2VC0A 1KD1T 1XMOF 2XHBA 4C0BA 4CZHA 4B1WB 5KGWA 2DR7A 3CC4N 2O8BA 2UUBJ 1CG2A 1V6HA 1VQKN 4FNHA 5I3UA 1HQUB 2DHSA 2HAFA 1C0GA 4K8XA 3FSXA 3F0NA 3K17A 4OL8A 2E2QA 2CQ0A 1REGX 1D5AA 1SC3B 4DTOA 3A1YG 4Y2MA 4IYQA 3SDEB 1ZPWX 3LOUA 2J9CA 5IFMA 5J1EA 4PQUB 3WQTA 2QTDA 4ZPAA 4B1XB 3O80A 1ZAVA 4JD2A 3W0LA 3KK3A 1F2GA 3PSIA 2DFFA 3K5PA 2D0PA 1MWYA 4LH5A 3AJDA 4M41A 3VF2A 4IO8A 2MQQA 3ZLJA 3Q89A 3SUPA 2FVSA 4OI1A 2A0FB 2WBNA 5HROB 3W63A 1SKUB 2QN6B 4MDAA 1AA1B 5FD1A 3MAQA 2ZUAA 2R7QA 3M8PB 4JI4J 3QZ7A 3OJSA 1VK3A 3CCQN 3UWTA 3V4MA 4ZIWA 1S1TA 2Q79A 4MYUA 4WQ5A 1PJ5A 3GDQA 3ZZTA 3H6EA 3BKTA 3G10A 5GINA 2RSQA 1U49A 5AQOA 4ZJOA 1B9DA 4FZYA 2QZ8A 1EWRA 2CH6A 1JLBA 2G8KA 2JFDA 4BDPA 1MMDA 3C6AA 3LAMA 4DR3F 1IQZA 4FWKA 1TAQA 1JLQA 3SXLA 2OTJN 3QBWA 1JK9B 4X65K 2BQUA 4BR9A 4CHQA 5A2QU 5LT5A 4B9QA 1WEYA 3O3GA 1IQTA 3C6HA 1HWIA 1FDBA 1O51A 3DLGB 2O4IA 3DLLQ 5JLHA 4CLSA 1RHMB 3W2WB 3E9OA 4M63C 1OQ3A 1BO5O 1NAQA 2V8VA 5AQKA 1D3WA 3ONQA 3MM8B 3HI0A 3VGLA 1TL7A 3M30A 4PL8A 2DPJA 2AZ1A 4OV6A 4DS5A 2MZTA 5KFCA 3VALA 2E1YA 5JS1A 4HACA 3I0RB 4UF4A 3HFVA 4DOZA 2PSZA 1HNZK 1LW2B 3NL0A 1WI8A 1RT7B 1KDNA 3KNAA 2OI2A 3NH2A 4RW7A 3LDSA 1WKKA 4JKFA 1IKXA 3TOQA 4CEBA 4R79A 3MOZA 4CLLA 4TKTA 2J7UA 4MKAA 4ILHA 3FZ2A 2C2KB 4Y00A 3OFEA 3IXQA 4GKJJ 3D6HB 1RT6B 3CCWA 4R5PA 3I0SB 5EXWA 4FW1A 4NA1A 3WBZA 5AQUA 4ZPCA 1WOOA 1RACB 2B7CB 2DNLA 4C8NA 1GLAG 1XN9A 3ENAA 2ASYA 1ZS6A 2HK3A 2QLFB 2UUCF 2RQKA 1T44A 4IFVA 5KGXA 4ZIVA 3ZNUA 3QPIA 3KD1E 2AX0A 4RBTA 3G6ES 1FJGJ 4C0OC 4JI3J 3LZJA 1JLAB 3TABA 3TSPA 4LBPA 1WSFA 2UUAJ 3TP2A 3HZEA 3UR0A 3EKSA 3MFIA 3TQEA 4F50A 4HI1A 5IWAJ 4R25A 2J7WA 2ZDPA 1FERA 2R7VA 1HQUA 3CQXA 3GV5B 5H9EK 4P7VA 4EIAA 3C7NB 3QWUA 1KHVA 5DZ7A 4ED0A 5IXUA 4ZA1A 4LVNP 2XGPA 3I56S 4A5BA 1S9GA 2GHPA 3SDEA 2ZM6F 2B7BB 4JV0A 1C0TB 4Z4EA 4L6V3 4ERDA 3AH6A 4K25A 4KO0B 2V51B 2P1JA 1IJFB 4RLEA 1NO8A 3SQGA 4CJLA 5HRSA 2KTQA 3DU6A 1UJ4A 1DLOB 4RBUA 2OTLS 4OPKA 1T9WA 2QL7B 4IRKA 3NBPA 4DU8A 3RR7A 2FZCB 2HVEA 5M1QA 5FDLA 1HD1A 4I0WA 1Q53A 2VFRA 2CGLA 1U24A 1U25A 1X9WA 3W5ZA 4DQPA 4L75A 4CWBA 2DGTA 2VFVA 1JLEB 1VSHA 3PUFA 2E1PA 1YJVA 4JRPA 1S79A 4LSLB 5LMNJ 4NLYA 3C14B 2VASA 2OKQA 8AT1B 4BRKA 5C5JA 1KP6A 3KJFB 2KFNA 4QU6A 2F96A 2DO0A 5GAEI 4O8KA 3FBBA 4DN9A 2I5JB 3S8SA 2M70A 2WSEC 1HNXJ 1VQ4N 3R5AA 1VS3A 2GIFA 1T3OA 3LP2B 4LF6F 4W92B 1HARA 4NA2A 3MMJA 1S1VA 4RR5A 2YKMA 3M6UA 4BC5A 4FL9A 3T1HJ 4OI4A 2GGPB 1S9EB 4A47A 3H5SA 3DLGA 3L9ZA 1LW0B 3CI5A 4JYAK 3OFHA 3W2WA 3X3UA 1TKTA 1G4CA 4F36A 4JI6F 3MM8A 1RI7A 1XJWB 1JCGA 2VBYA 2MLYA 4OGEA 2JOQA 4WFAL 2DNOA 3EO3A 4DUZF 2AW0A 4TYAA 2NZTA 3LP0B 4CJ5A 3GIRA 5FLXU 1RT7A 1CJKA 1N33J 4YOUA 3P83D 3QICA 4KKOB 1DHMA 5A0YB 4U6PA 2HQGA 4QBUA 3KLIA 1FESA 1Q16B 2IRYA 2D9PA 5DM7L 2JZ5A 1X9SA 5HMWA 4NXMF 1WLJA 1WC4A 2XMUA 1ZA1B 1S7HA 2QWOA 3EGWB 3O5TB 2ALYB 4JN4A 4RX6A 3VESA 2G2ZA 3BZKA 1RWKB 2IRUA 3NG8A 3D6FB 2W9BB 4LFBF 2GX9A