5HBMA

Crystal structure of a dihydroxycoumarin rnase h active-site inhibitor in complex with hiv-1 reverse transcriptase
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
554
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Dihydroxycoumarin RNase H Active-Site Inhibitor in Complex with HIV-1 Reverse Transcriptase
rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 161
structure length 552
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5hbmA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5hbmA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5hbmA05
4FZXC 3GIKA 4DSLA 3RAQA 2C2RA 2OPPB 3IS9A 4ECUA 4KHQA 4TYBA 3PR5B 1RDCA 4FBTA 1TKTB 5HROA 1TK5A 3QNOA 4FJXA 2YKNB 4HCBA 4CGDA 1YTUA 2FJVA 3PHEA 3MR6A 4J9PA 2PZSA 4XPCA 1TKXB 4DU4A 5J2MB 4IRDA 1JL1A 3OS1A 1G15A 3VQ5A 1EETB 3K5LA 4IBNA 4M3RA 1QSLA 4CF9A 1VRUA 3ZSOA 4URSA 2W9CA 1JKHA 3VQ9A 3NKYA 1XI1A 4HUEA 1LWFB 5I42B 3BSOA 4CJ4A 3V4IA 1X1PA 4NLRA 4K8ZA 4YQWA 1W0HA 2G8HA 3T5LA 5DG7A 3P5JA 4FM0A 3IAYA 3MEDB 4NLOA 5HRRA 4CJ5A 4CGIA 1IKVA 3NH2A 4M3YA 2IM3A 1VSJA 1RA7A 2HB5A 3SV3A 5KG4A 1TQLA 1NK5A 2XGQA 4MKAA 1K1QA 3ZCMA 3BQ0A 4QWEA 3DYAB 4KB0A 3NF6A 4LQ3A 2W7OA 1IKXB 3NGZA 2I1RA 2QE5A 3KJVB 4DMNA 4ED1A 2Z1IA 3RMAA 5CZ1A 1N5YA 4M42A 4DSIA 3MXMA 3LDSA 2JC0A 1C6VA 4ECTA 4CEZA 1U49A 1RBSA 3VQPA 4MQ3A 1WSJA 4RW9B 4NLPA 3NAIA 4LQ9A 4R8UA 2HHWA 1KVBA 3M9MB 3EPIA 3RRHA 4KPYA 4CJTA 4CGHA 3LP0A 3CJ3A 1HMVB 3QERA 4DSKA 3OHAA 2YHAA 4DL3A 2QKBA 1DTQA 3AA4A 2IOCA 4PY5A 3OYAA 4TQRA 4BACA 1JLGA 4LY7A 1JLAA 2BQRA 4CEFA 5T7BA 1HQEB 4WE1A 1VK0A 1RDRA 4F3TA 3RAXA 3A2FA 4IG3A 4J2EA 1U45A 1D8YA 2UVVA 4G3IA 2YNFB 4W5OA 2XO7A 2HWHA 1TK0A 1RT1A 3SQ4A 3H4DA 3MEGA 4CF1A 5F9LA 4F4XA 4BE0A 4ZPBA 1RTHA 2AQ4A 3VQBA 3ZT0A 1NK4A 3P83D 3RB4A 2AJQA 3VQ4A 2WOMB 1A5VA 3V6DB 1NOZA 1NK9A 1CLQA 3DMJB 1IO2A 3RTVA 1NHUA 3KHGA 4PWDA 4F4WA 2Z1GA 1R0AA 1LWCA 3B6PA 3HSTB 4CJPA 3KK1B 1LW2B 4ELVA 2O4GA 2IA6A 1D9DA 3KMSA 1U4BA 2FVPA 4NLSA 4Q0BB 1HMVA 2YNHA 2R8HA 4OPKA 4CFAA 3OYMA 1UA0A 3HVTB 5C25A 3UR0A 3VQAA 3EZUA 2BGGA 3BSNA 1HNIB 1U04A 3CFRA 2XY6A 4PA1A 4Z4HA 1RT5A 4H4MA 3THVA 4K8XA 4FJIA 3KLGB 3Q8RB 5KFIA 4E89A 3QZ8A 4O3SA 4RW7B 1IG9A 3HVTA 5C25B 1IM4A 5KG2A 3LAKA 4OVLA 3K2PA 1NKEA 4O0IA 2G8KA 2YHBA 1N5YB 3TWHA 4RNFA 3ZT2A 3LP1A 4DSEA 4EO8A 4ICLA 4QWBA 3BQ2A 3ISNC 1RNHA 4EZ9A 3JYTB 3JSMB 4CJEA 1OS5A 3V6DA 3AVKA 2AGOA 3I8DA 4AHSA 5HBMA 4ZVEA 2FLNA 4M45A 4FBUA 4CFCA 4CF2A 3KHRA 2KQ2A 1T05A 1T3NA 4KV8A 5CYMA 3K57A 3OLAA 4TLRA 2HMIB 5J2QB 1IKXA 3RBEA 2C28A 3VN5A 1Z25A 3NH0A 3NCIA 3NH1A 2XI2A 5DK5A 3V9ZA 4IG3B 4Y3CA 3DI6B 1XWLA 3Q8SB 3KLFB 4B8CA 4AHVA 4RW6B 4MIBA 2IM1A 3AVAA 4CHOA 2DPJA 4RW4A 5C5JA 2CJQA 3K58A 1ZBHA 4CFDA 4E7HA 4Y1CA 4CIGA 1S9FA 2XY7A 4G1QA 4EYHB 3QLHA 2R8KA 2J6TA 1S0OA 3KK3B 1HYSB 1SKSA 2VG5A 2ZKUA 1C1CB 3L8BA 4W5RA 3RR7A 4BE2A 1TL1A 2XY5A 4N56A 1IH7A 5HBMB 2BE2A 3GV5B 1RDAA 2OZSA 4Z4CA 1BGXT 3ISND 2V9WA 1X9SA 2YNHB 1SH0A 3PR4A 5KFNA 1BHLA 2HHUA 2OA8A 1GOCA 5KFVA 4CHZA 3GIIA 4CF8A 3HT3A 5EDWA 4O4GB 4E1MA 1NK8A 5EWGA 3D28A 4R8UB 3OYCA 4KHMA 3I5AA 1SL0A 4KKOB 2KTQA 3I0SA 4WXOA 4J9LA 1TKZB 3KLEA 3M8SA 4E19A 2OPRA 2RF2A 1BQMB 1BL3A 1RTJB 5F8GA 4URGA 4U6PA 4LD0A 1I3AA 2G8WA 4O3OA 3SQ1A 4YMEA 3I0RA 1B92A 1LV5A 4B9UA 3HHKA 2OPSB 1TGOA 3G10A 1D0EA 5L1IA 5F8LA 4KREA 4KKOA 1KLMB 3OL6A 3F9KA 4WZQA 1TKZA 3KLEB 4DFMA 3FFIA 4ZPDA 3U6FA 4NLGA 3M8PB 4PQUA 1NNDA 4FJGA 1TP7A 4FJNA 4CJLA 2JGUA 4K4WA 4O44B 1QHTA 5KFMA 1ZBFA 3PW4A 5F8IA 4K4TA 3SQ0A 2HNYA 4DF4A 4FS2A 3H2LA 4QW8A 2NUBA 2WB4A 3HM9A 2GC8A 1UOCA 4PQUB 3MTKA 2X74A 1BI4B 3KK2B 3D0PA 4DTRA 5D3GB 4PUOA 1EP4A 1N4LA 3NGIA 2CKWA 2FVCA 2B5JA 4K4XA 1BQMA 4EP4A 3BQ1A 3K5NA 4FZYA 1ZTTA 4N47A 3QEXA 4J9NA 2WK4A 4DL7A 4F2SA 4Q45A 1S1TA 5C24A 3IRXB 2IAJB 2ZD1B 3DLGB 4O55A 1C0MA 3ZSWA 4AHRA 2BANA 3PV8A 1U48A 3OYKA 1L3VA 5FRNA 4YFUA 3PVXA 1A5XA 2VA2A 4CIFA 3T5JA 4K50A 5DGAA 4XIUA 1XR5A 2IJNA 3MEDA 4TY9A 3ICLA 2FLLA 1VSHA 4O44A 4IFVA 1S10A 4I9QA 3V9WA 4KB1A 1HPZB 5C42A 3TABA 4RG8A 1TL3B 4CF0A 3ULDA 5SWMA 4DSJA 4DEZA 4JV1A 4I2QA 3V9UA 4DQPA 3LZIA 4ZTFA 2P1JA 4HTUA 1XR6A 2WHOA 4CJKA 1RT5B 3UDLA 4Q5VA 2VG7B 4N41A 1ZBUA 4IRKA 3OYDA 4ZMMA 2FJWA 3VA3A 4IFVB 4O3PA 4MFBA 3CG7A 4H4OB 1NHVA 2OH2A 2HW3A 4NCBA 3LPUA 1S9EA 4DS5A 5DQIA 2W42A 1TV6A 3N6MA 3IGVA 2JEIA 3H08A 4JRPA 3AVIA 3O3HA 1DLOA 3QIDA 4OKEA 3IRXA 3KLFA 2EHGA 2OPQB 1HNVB 1N56A 5CY4A 1FK9A 2IBKA 3HK2A 3AO2A 4RUCA 5KFXA 4E3SA 3QGIA 3SUQA 1SL2A 1S9GB 2W8KA 1T05B 2UVUA 3I0SB 2UUWA 5J2PA 1RT3B 4E1NA 1FK9B 4Z4IA 4DTMA 1TL3A 4TN2A 3NF9A 3HXMA 1LWEB 4IG0B 1RDDA 3IN5A 2DPIA 5K14B 3OJUA 4X2BA 1RT4B 4W5NA 3WNGA 5I3UA 4I2PB 5KFFA 4OKKA 1FKOA 4DLEA 3NGYA 4F2RA 1REVB 1RBUA 5HRSA 3QNNA 4DFKA 3TAFA 2YKNA 3M8PA 2P51A 3D45A 1LWEA 2D0BA 1T03A 4CJSA 1VSMA 3TAMB 4CHNA 2UUTA 3KLHB 5L1KA 4KI4A 3UIQA 4Z4EA 4CGGA 4IFYA 4O3RA 2KZZA 3TAPA 1JXBA 4E7LA 1KCFA 1HARA 4ECYA 3L2VA 4B8AB 1RTDB 3KK3A 2GUIA 2P5OA 2ASJA 1HYSA 3DRPB 3PJWA 1VRUB 3QINA 3BDPA 3TAMA 4FLXA 4AHUA 3HP6A 5KFSA 3IG1A 3UPFA 2XGPA 3RRGA 4CJRA 4CK3A 2E9RX 4ED3A 1QUVA 3OS2A 1QQCA 1XHZA 5KRSA 3OSNA 3GV7B 4J9SA 4KI6A 1WSIA 3HP9A 1LW0A 1RT4A 3SI6A 5JS2A 3NBPB 3AO4A 3CJ2A 1JXEA 2YNGA 4DFPA 3H98A 2IM0A 3CQ8A 2B6AB 4FJHA 1RT6B 4FYDA 5KFBA 2OPRB 2RF2B 3L2RA 3V1QA 5L1LA 1WNSA 5KT6A 1S0NA 4I9LA 1ZBLA 1RT1B 2F8SA 1T03B 4Q8FA 4RNNA 1JKHB 5F8NA 3MEEA 1Z26A 3NAHA 3OHBA 4KTWA 2QKKA 1KTQA 3DOKB 4K4UA 1HNVA 2YNGB 3GQCA 4ED0A 2BQUA 3M8RA 2G8FA 2WCXA 3MR5A 1SUQA 5CYQA 3ITHA 2EC0A 5F8HA 4ECWA 3DI6A 4DQSA 3LP1B 3IG1B 3QZ7A 3C94A 4YR3A 3O3GA 1F21A 4H54A 5J2PB 3AVHA 3OYNA 4R5PB 2XY8A 3S3MA 1SV5B 3HYFA 3NMAA 4ZP8A 1BI4A 4ZPAA 1X9MA 4Q44A 4H4MB 4FLZA 3SCXA 4CECA 4ECVA 2Z1HA 3QLHB 1RCHA 2HHSA 1RT6A 1NKCA 3EYZA 5HLFA 3MXJA 4I7FA 4FCYA 2D3UA 4LSNB 4DLGA 2HVHA 1QAIA 4LH4A 4DF8A 2ATLA 3P1GA 1S6QA 2G8UA 1ZBIA 4HUGA 2HVIA 1A5WA 4MFBB 3TARA 2RN2A 4KBIA 4KAIA 2F8TA 3KKRA 3CYMA 1WAJA 3VQCA 3NF8A 3H40A 1RTIB 4EBDA 3DLKA 3BR9A 2E9TA 1WAFA 2PYLA 3VQQA 4AILC 2ZE2A 2W9BB 1C1BB 3U3GA 3K5MA 5I42A 5CYMB 3Q8PB 1D1UA 3H5YA 3WNHA 1RTJA 4DFJA 4I2QB 4F8RA 5KGXA 4IQXA 2FBYA 3ZT3A 4ED2A 4DL6A 2WONA 4O3NA 2D3ZA 1FXXA 5KTQA 4KE5A 1C1AA 1NOYA 1IKVB 2RKIB 3BSCA 2YKMA 4NYZA 2HHTA 3V6KA 2FLPA 4OPJA 3DRRA 3KIOA 4EYIB 1ZYQA 2V4QA 2QV6A 3O4NA 1J54A 4KHSA 2X78A 2BQ3A 3N6NA 4ZPCA 1N48A 3DMJA 2IDOA 3NHGA 1R0AB 3CWJA 3QEWA 3SYZA 3MEEB 5KT3A 5L1JA 4NLDA 1NK7A 1K6YA 1HQUB 3RMDA 4F4ZA 3DLEB 1IKYB 4JV2A 4DTPA 2XCPA 3RR8A 2UVRA 3SJJA 2XRIA 3QO9B 1EETA 3ZT4A 4CERA 4J9MA 4CFBA 1BIUA 2A1RA 4TQSA 4FLUA 3SUOA 4M3WA 3LWMA 1LW0B 4OKJA 3WNFA 1NK0A 4RW8A 1HQUA 4HVJA 3LWLA 5KFPA 4B08A 4CEEA 1N6QB 1C0UB 3V81B 1S97A 2WOMA 3S9HA 3FRZA 3L2WA 1RDBA 1SKWA 4C8NA 4FVMA 1TK8A 3OL9A 4PWDB 3QEIA 2BR0A 3PW2A 4ZVGA 2D7SA 3KK1A 3OYEA 3DOKA 5KG0A 3TVKA 2BANB 1T7PA 3HL8A 3AVGA 3TANA 3OJSA 4FJ5A 2FVRA 4ED8A 4DL5A 1BISA 2VG6A 5KFDA 3OYIA 2VA3A 1RBTA 4XO0A 2OYQA 3FSIA 4ECSA 3ZT1A 3CDWA 4EP5A 3KK2A 2AWZA 4ID5B 3MECA 3KLGA 4CGJA 4DSFA 2ILYA 4B9SA 3VA0A 2QK9A 4KHRA 4NLWA 2D0AA 4NLTA 1VSDA 5KFCA 4WYWA 4FS1A 3V1RA 1YVUA 3QGGA 4JS5A 5KFHA 3PX0A 4WFZA 1L3UA 3ASMA 4HYKA 2IS3A 3LP0B 4FJKA 4IH7A 3NE6A 3KTQA 3LAMA 1GOBA 1ZETA 4CJUA 3PY8A 1MU2B 1DTTB 5KFWA 2VWJA 3KKSA 3SNNA 3C6UA 1MMLA 3BSAA 1UAXA 2R2SA 3OS0A 2GBZA 4FLVA 4ZP9A 3HPHA 4DTUA 1QTMA 3V6JA 1RAJA 4KHNA 5D3GA 4QWAA 2B6AA 1KVCA 2VG5B 4KFBA 5KFOA 3H59A 1MU2A 2JEJA 5F8JA 4DQIA 1L3SA 2Y1IA 2I5JA 4J9QA 1RT2B 5J2NB 4M3TA 4GC7A 3CJ0A 4RNHA 4IR9A 1QE1A 3T1AA 3VQSA 3LALA 4DTJA 4HHTA 2BDPA 3BGRB 4H4OA 2XI3A 1BIZA 1DTQB 3OYLA 4KHYA 4RW6A 1S9EB 1TV6B 4OLAA 2A1SA 4I7FB 3FQLA 2WONB 2DY4A 3PJXA 1LWCB 2RDJA 5KFAA 2ATQA 1S1VA 3KLVA 3AVNA 2R7YA 3T19A 4J2BA 4FJ7A 1KSPA 4KV8B 3DM2A 1K1SA 4LSLB 4KO0B 3PO5A 1IKWB 4Y2CA 3QIPB 1RBVA 2G8VA 3PX4A 1HNIA 4BDYA 5F8MA 3CFPA 3GYNA 3I5CA 3KLHA 4TYAA 3NAEA 1WSEA 3NBPA 3VQEA 3DLRA 1JIHA 2WRMA 4OL8A 2VWKA 3QETA 5KT5A 4B3OA 3H5SA 1EXQA 3MF5A 3C6TA 3DYAA 4J2AA 1TKTA 1NJWA 1HYVA 1VSFA 2KFZA 1VSLA 3RMBA 5KG7A 1YTAA 3TR8A 2IAJA 4ECQA 5KT4A 2RDIA 3MXIA 1CSJA 1WNEA 1C2PA 1BCMA 1CXUA 1NKBA 3VQ6A 1RA6A 2Q3SA 4UQGA 3F73A 5J1EB 2LSNA 2PY5A 3CJ5A 1C1CA 2E4LA 2HNDA 3MR3A 3LP3A 4AH9A 3I5BA 3I0RB 4EZ6A 4JV0A 3SUNA 4RUAA 5DLFA 3G86A 2GIRA 2W9AA 5C42B 4CGFA 4R5PA 4NLXA 4NLQA 3E01B 1DTTA 3GIMA 1KVAA 3T5KA 4CK1A 4Q8EA 3L2UA 2KFNA 3DOLA 4GVMA 1CZ9A 1S1TB 3NGDA 3CO9A 4FZZA 2ZD1A 3HJFA 1KLNA 3H5UA 1TKDA 2KZMA 3CIZA 4KFBB 1ITGA 1LAWA 2Y1JA 2HNZB 1S6PB 4CEAA 2XWYA 3LPTA 4IR1A 1QSYA 2W9CB 2C22A 1RTHB 1JLQA 5KFEA 4RNMA 4G1QB 3ZSYA 4F3OA 2GV9A 3E51A 1L3TA 1IKYA 3MFIA 2JC1A 1I39A 5KG5A 1GOAA 4FJ9A 4CK2A 2ALZA 2J6SA 1T94A 4HKQA 2GIQA 1Q8IA 2YNIB 3KD1E 4ZVFA 1XHXA 4IKFA 3ZSZA 3AVJA 3JSMA 4O3QA 4JRQA 3CVKA 2F96A 5KFGA 4DTNA 3D5MA 4ID1A 3KHHA 4K4YA 4YP3A 2IC3A 4ED7A 3ZSVA 5E41A 1S1UA 2R8IA 3GILA 3ZSQA 3U3YA 4J9OA 4FM2A 2YNFA 2R2RA 3C95A 5DG8A 4DWIA 3DLBA 4KSEB 3H5XA 3T3FA 2ITGA 1SV5A 3MEGB 3G6YA 4HUFA 5KG1A 4ECXA 2ILZA 1B9DA 2W8LA 3JYTA 3RWUA 4E7JA 3CJ4A 2ZQBA 1X9WA 3V6HA 2HHXA 3NFAA 4CJQA 4B9TA 4GC6A 5KFRA 4U7CA 4ZVHA 4I2PA 1ASVA 2RKIA 4OJRA 1UWBA 2FJXA 2KW4A 4K4SA 5FRMA 1TVRB 4WFXA 1EKEA 4MIAA 2AGPA 5DGBA 4NLYA 4ZP6A 4FJMA 1JLEB 1RYRA 1S9GA 3CFOA 5DLGA 1QAJA 4K4ZA 4KO0A 1J5OB 3TAEA 1KFSA 4ZHRA 1BQNB 5HP1A 3QESA 1WSGA 4YR0A 1JLGB 2FVSA 1WSFA 4AHCA 4O4GA 5F9NA 5KG6A 3AVLA 4B9NA 5C24B 2DFHA 4Z4GA 1TKXA 4IKAA 4CEOA 4KAZA 1REVA 4F50A 5FROA 4N5SA 4M41A 4C8LA 3RMCA 1EX4A 1S1XB 2V4RA 1BQNA 2B43A 5KT7A 4MKBA 4FK0A 1I6JA 3LP2A 5KFZA 4NYNA 2FC0A 5DQGA 4RU9A 1ASUA 3VQ8A 4IFYB 3QEPA 4AHTA 2X6SA 1KLMA 2ZE2B 1HPZA 2W9BA 4FK4A 3L3VA 2PYJA 3DM2B 3CDEA 5KFJA 1S1XA 1IKWA 2BRLA 3O4QA 3M9NB 3C6UB 3FDSA 5EUHA 1JLCB 4MH8A 1XR7A 2R2UA 3MAQA 1HRHA 1S0MA 5I3UB 2C2DA 1XC9A 2BRKA 5T14A 3OSPA 1Z4UA 4CESA 4FW1A 1KHVA 4ZHRB 5HLFB 4W5TA 3HVWA 3AVFA 3BREA 4DQQA 3SPZA 1Q9YA 4YR2A 4KHWA 4OLBA 1TAQA 4PUOB 2B5JB 1S48A 3NF7A 5J2QA 4ZTJA 1WSHA 2R2TA 3DRPA 3AO5A 4KTQA 4HCCA 2FBTA 3OY9A 1S1VB 4KB7A 1S1UB 1QS4A 2HHVA 4ICLB 4F4YA 4MK9A 3PW0A 1CZBA 1UA1A 4RNOA 3KJVA 4IG0A 2AU0A 1JLAB 4B9MA 4MK8A 3AA5X 1NJYA 2IMWP 3DLHA 4E7IA 1JLCA 1RT2A 1U09A 5KG3A 3KHLA 3K59A 3AO3A 3AA3A 3QEVA 1FKOB 3V4IB 3AV9A 4YNQA 1J5OA 4C8OA 1KHWA 3QYYA 1GX6A 4ED6A 1Q9XA 4M3UA 4Y2AA 3NL0A 5KT2A 3DLKB 1JXLA 4ID5A 4WZMA 2ETJA 1ASWA 4XPEA 2JEGA 4TSXA 3DLEA 1NJXA 3PX6A 4FXDA 5J2MA 2DFFA 4DQRA 4WFYA 3KMQA 5L9XA 3OL7A 2F8EX 1SUQB 5CYQB 1J9AA 5K14A 3SPYA 3SFGA 5DMRA 4NLUA 2W7PA 3QGHA 1RILA 4IH6A 2I5JB 4CHPA 3OYJA 4RW8B 5JXSA 2AX0A 3C6TB 1C0UA 3V81A 2C2EA 3SZ2A 3KLIA 4FM1A 4NLVA 1FKPB 4IH5A 1JL2A 4IRCA 1QSSA 3TAQA 5HRPA 4FJJA 3PW5A 2BE2B 4IOBA 4MK7A 2O5DA 1CXQA 3HPOA 4R0EA 2FBVA 3HVRA 2IM2A 1EP4B 1UWBB 5KFTA 3IGNA 3BJYA 4LSLA 4FJ8A 1TVRA 3V9XA 2VG6B 5J1EA 3KLIB 4CJVA 5SZTA 1S6PA 1ZTWA 1FKPA 1VRTA 3TAGA 5FDLB 3AVCA 1HQEA 4WE1B 4NRTA 1LAVA 3RBDA 3S3NA 3AVBA 1GX5A 3V9SA 3DLGA 4CEDA 4CEBA 3HKWA 3OYHA 4FJLA 4Q0BA 1QE1B 5EWEA 2HNYB 4DL4A 4K4VA 1YVFA 5KFQA 1WN7A 1D5AA 3OVNA 4BDZA 2X6NA 3RB3A 2O4IA 3PO4A 3S3OA 4Z4FA 5FDLA 2P5GA 4NRUA 4M3ZA 4CJFA 2B4JA 3SV4A 1LWFA 1JLFB 4CCHA 4FLTA 3AA2A 2XCAA 3CM6A 2HMIA 4N76A 3OLBA 1TAUA 4LH5A 3QIPA 3HVAA 4JLHA 3MR2A 4J2DA 4O5BA 2IC3B 4DG1A 3K5OA 1S49A 1S1WA 1S4FA 2V0NA 4GMJB 5KFKA 1WLJA 2D41A 1C0TA 4TXSA 1JLBA 2DFEA 4Z0UA 4DU3A 4BDPA 4JS4A 3L3UA 3KD5E 2OZMA 2FBXA 4Y34A 3DRRB 3GV8B 4OGEA 1SH3A 4FK2A 3E01A 1HJRA 4BE1A 4LSNA 5DQHA 1VRTB 2IJFA 4CJ3A 2AGQA 2XHBA 4DG1B 4NCGA 5KFYA 3SFUA 4FW2A 4EBEA 1VSKA 3UQSA 5JS1A 1RT7A 3OYFA 4RW7A 1W9HA 5HROB 5KFLA 4ECZA 3RB0A 4M3XA 3LANA 1RBRA 3VQ7A 1TL1B 3GIJA 2HNDB 3B6OA 3M9OB 3RB6A 1RTIA 2YV0X 4JUZA 3M8QA 4IDKA 5KFUA 4O0JA 3NDKA 4DTXA 4BWJA 2WTFA 4J9RA 1L5UA 2QXFA 1RT7B 1JLFA 4C8MA 1VSEA 2UVWA 4FLYA 2E6MA 3SI8A 1RYSA 3CDUA 3EPGA 3DRSA 3G0ZA 4QWCA 3AO1A 4RW4B 3HO1A 3KOAA 4M95A 3ZSRA 3O3FA 4E0DA 3WNEA 4ZP7A 2Z1JA 3ZSXA 1NJZA 4QW9A 1B9FA 4B9LA 5J2NA 1DLOB 4E7KA 1KFDA 4B3OB 1C0TB 2XC9A 4Q43A 2R8JA 1SH2A 3VQDA 2ASDA 1BCOA 4TY8A 3T5HA 1HYZA 4H8KA 3DRSB 4L8RB 4ELUA 1O1WA 4RW9A 2E9ZA 4CEQA 1W25A 3HPGA 1JLQB 2FVQA 2OPSA 4URQU 3MECB 3AVMA 4CHQA 1C1BA 4KRFA 3KNAA 1NK6A 2E6LA 1SKRA 3TQ1A 2DTUA 4DTOA 4CJWA 4GW6A 4QAGA 4DS4A 4TY8B 3LZJA 3EY1A 3CM5A 5KRTA 5DG9A 4Y1DA 3DDKA 1LW2A 2HWIA 4W5QA 3ALYA 1T8EA 4M94A 4BWMA 1S6QB 2YKMB 1U47A 4KTZA 1JX4A 3H4BA 1N6QA 1Y97A 4B9VA 3L2QA 5HP1B 3EZ5A 4O4RA 2JLEA 1D9FA 3G6XA 3DOLB 3FQKA 1S5JA 2JEFA 4EBCA 3PZPA 1YT3A 5KI6A 3V1OA 4CHYA 2J6UA 2VG7A 4OGCA 3PUFA 3G6VA 4CIEA 3IS9B 2OPPA 5JUMA 4J9KA 1SL1A 3QIOA 3FFIB 2R8GA 4NZ0A 5HRNA 3QO9A 4NYFA 2HNZA 4EEYA 4DU1A 3LP2B 3OYGA 4NCGB 2IGIA 4WYLA 2HHQA 4FLWA 2ASLA 4QCLA 4C8KA 1VSIA 4CE9A 2OPQA 2HAIA 1KRPA 3BGRA 4F4KA 4RZRA 2AX1A 4DL2A 3SUPA 4NCAA 2RPIA 3PW7A 3SQ2A 3ITHB 5EWFA 2YNIA 5KGWA 2D0CA 1S1WB 3M8QB 4IDKB 3Q8QB 4ELTA 5EU7A 1JLBB 4WXWA 4KHUA 3OL8A 4ECRA 2EX3A 4EO6A 4QWDA 1RT3A 4DTSA 1RTDA 4QPXA 5CZ2A 3MFHA 3OYBA 2D5RA 1JLEA 4QOZB 1J53A 3TI0A 2G8IA 3N6LA
chains in the Genus database with same CATH superfamily
4FZXC 4OI2A 4P73A 2ATCB 1N0VC 1HNWF 2OPPB 2HG4A 4CLYA 4EIAA 4M5MA 3GG1A 3VF6A 1TKTB 1FRXA 2J76E 1WSVA 2B4VA 2YKNB 3U7JA 5ITHA 5K9FA 2KJVA 4OI4A 3MR6A 1UEVA 3AJ1A 4J9PA 2PZSA 2ZZNA 2G9OA 4DU4A 2XMAA 4K2JA 1JL1A 1MWZA 3OS1A 3VQ5A 2YQ1A 3K5LA 4M3RA 1QSLA 3BGUA 4OZ0A 1PC5A 3VQ9A 1MROB 2CZ9A 1I51B 2HSEB 4N7TA 3C15A 1U1KA 4CJ4A 4KH6A 3WXIA 3T41A 1NU0A 2GHWA 4FF2A 1D8ZA 1Q82T 4K8ZA 1NGDA 1Y7PA 1HNXF 3ZTOA 1W0HA 4CI6A 1QZ6A 2G8HA 4GKJF 4PG6A 5HRRA 1VBZA 4M3YA 2CJBA 4OZNA 1RA7A 5KG4A 5D0RA 2XGQA 1K1QA 4ZVPB 3DYAB 4KB0A 4QR0A 3BM7A 3NGZA 3DXMA 3F44A 1GH8A 1F5AA 2G13A 1JNRB 5B7WA 1N5YA 2BEFA 1HBUA 4FKXA 2OMLA 4DSIA 1YIJN 3LDSA 3L4QA 1K8KA 1T0TV 4Q2MA 2QGFB 2NXCA 3KWMA 5SUHA 1K8AO 2LEAA 1WSJA 2MQMA 2HHWA 2HQGA 3M9MB 1HBUB 4CJTA 3GCXP 3CJ3A 3QERA 2NQPA 1U1MA 3UVJB 4DSKA 2X1BA 2YHAA 2QC3A 2Y8YA 1S57A 3R1HA 2YKQA 3UCZP 2JWNA 1JLAA 1Q7YT 4LY7A 4KJIA 2HZAA 1HQEB 4WE1A 3ZNJ1 1QQMA 2YWWA 2FSJA 4NA1A 4IG3A 3SSRA 4C7QA 1B64A 4J91A 2FSNA 1FD2A 2UVVA 1WC5A 1E6VA 4DI6A 1RCOB 1N34K 4JKHA 4BE0A 2HHHJ 2OEJA 1QQNA 3G9CA 2JWLA 3VQBA 2RHQB 4YOTA 4DMZA 2DK2A 2HLUA 3JQMA 3TEHB 2WOMB 5HOOA 4BGAA 1WF2A 1B7YB 1IBMF 1WD6A 3RSEB 4NYPA 1LWCA 3B6PA 2OTJN 2O4GA 2ZH2A 7FDRA 2NRWA 1U4BA 1EAYC 5DDQC 2P9PB 5I3PA 2YNHA 2VBXA 1UL3A 2FYXA 1UA0A 2E2OA 3HVTB 3AQOA 5HL7Q 4QYZJ 1HNIB 4CLPA 4FF3A 4Z4HA 1RT5A 3R1LA 5CD4A 5AXKA 3NGSA 1WC4A 5KFIA 2QW9A 4WFNL 2VH7A 4FYXB 3W2VB 4ES3A 2VDIA 5E3CA 1R0CB 1ZH5A 1IM4A 2EWHA 4O0NA 3OFFA 4OVLA 3TJ8A 1NKEA 2HQ3A 2G8KA 3DWLA 3UWTA 4RNFA 3FRYA 2ZOGA 5U47A 4CH0S 3ZT2A 1ZAXA 3BQ2A 3U02A 1RNHA 4EZ9A 3C14B 3VAMA 3JYTB 1IR0A 3UN3A 3JSMB 4L72B 3AARA 3V6DA 1T6DA 3AVKA 3UW1A 2KXHA 5HBMA 4ZVEA 3GFZA 4AHSA 3ZZUA 4OYMA 2AIRB 4I1TA 2R7UA 4M45A 4FBUA 2W2PP 4CF2A 3KHRA 1T05A 2EI5A 3UR3C 2O8DB 1NJIT 4KV8A 4Y0FA 2J9EA 3J81Y 2N3LA 4LREA 3ZETA 3RBEA 2A40A 2C28A 5AQOA 1Z25A 3NCIA 3NH1A 4D3HA 3K9JA 1A9NB 3LGHA 5DK5A 3V9ZA 4Y3CA 3Q8SB 3KLFB 3QFPA 5A8WA 5B0BA 2GX8A 4AHVA 2M3DA 4DCPB 1JXVA 4MIBA 2IM1A 1PBUA 4RW4A 3M2UA 4FWPA 5C5JA 2CJQA 4E7HA 3MHYA 4Y1CA 3L7OA 1X4BA 3SQGA 4DU8A 3FUYA 2GGPB 3R2CJ 3BBCA 1S9FA 2J8SA 1Q1KA 4EYHB 2V2KA 2LQ9A 3QLHA 4OZLA 4NXNF 2J6TA 4PEOA 1HBMA 2MKKA 1RDWX 5E84A 3FNNA 2ZKUA 1C1CB 3L8BA 4LF5F 3VEOA 4BE2A 1TL1A 1WHWA 4G1PA 3MOZA 2XY5A 4N56A 2PSZA 3UKRA 4Z4CA 1OY9A 2V9WA 3DHXA 3K9KA 3BKFA 2DXEA 1CJUB 1CJVB 2Q0UA 2H3EB 2OLWA 2VASA 3GP9A 5L46A 1Q4RA 1ZA1B 4LF4K 2JDJA 4E1MA 3PACA 4WIIA 3W9JA 3OYCA 3MM8B 3ZX2A 3IFRA 1MSWD 2E2QA 1SL0A 4YDXA 3MN9A 3W5YA 3POTA 4WXOA 1MN9A 1TKZB 3KLEA 3SXLA 5BR8K 1U2CA 5IC6B 1XJWB 1FXLA 1AUSL 3ELHA 1Q16B 2Y8WA 4YMEA 5M1OA 3HHKA 1V3SA 3G10A 1D0EA 4I6MA 2PC6A 5L1IA 5KPTA 1AA1B 1TKZA 3KLEB 4DFMA 2YI1A 4NLGA 1MWKA 3M8PB 2HKEA 2HK3A 4PQUA 1KD1O 4U7UD 3DXKA 3BKTA 1QHTA 3SLCA 1RUSA 2XZTB 5F8IA 4PXEA 4K4TA 1CJUA 4FS2A 3H2LA 2DHGA 3PG9A 1WEXA 2WSFC 4JK8A 4DTRA 4CO5A 4JI3J 1G99A 5D3GB 1EP4A 1N4LA 1VGYA 2CQ4A 4KGZB 2B5JA 3ZYYX 3CJ9A 1DHMA 3ILJA 1U1LA 4N47A 5CHIA 3IBFB 5BJRA 3QEXA 3TA0A 1FX4A 5C24A 2IAJB 2YWGA 2ZD1B 3DLGB 3UDVA 4AHRA 3K8WA 3MAAA 2DNPA 1L3VA 3OYKA 5LM7E 3ID6A 5FRNA 4XDDA 1A5XA 2ACYA 2QEXN 3IBCB 2IJNA 3MEDA 2CNOB 2MJNA 3IM8A 4FNHA 4IOCL 5HQLA 4O44A 4RWWA 1CJTB 3M1VB 1HPZB 3CPWM 2HGNA 4DSJA 4DEZA 4JV1A 3LZIA 4ZTFA 2WVDA 1XMQJ 4F9OA 1XR6A 2ASPA 1RT5B 4OX8A 3E9OA 3PRBA 4OHVA 3OYDA 4ZMMA 4O3PA 2O8DA 2LYVA 3OHRA 4D3GA 4O8KA 4DQ8A 4JI4J 2OH2A 2G2OA 1P6TA 1TV6A 2WVCA 2FUG9 3N6MA 3IGVA 2JEIA 2QTWA 3VF4A 3O80A 4FOIA 3IRXA 3KLFA 2K7JA 2OPQB 4DUYF 2IBKA 3PYGA 1Q81T 1HHSA 5KFXA 2B4OA 4CLFA 3TUJC 3ZEUB 4OFZA 2P9PA 3GTYX 1T05B 2UVUA 2B4UA 4B3TF 2J8AA 4Z4IA 3D2WA 4NX9A 1VMBA 2N7CA 5K14B 4X2BA 3D0IE 2VODA 2UV8G 4DLEA 4CZIA 1Z2ZA 1R6VA 5HRSA 5DDOC 3TAFA 4LF9J 3OFHA 1T03A 3TAMB 4ANDA 4WQ5A 3OTCA 5A2QO 3KLHB 2DY1A 4KI4A 2PA8D 1O5JA 1VQ8N 4E7LA 3HSJA 3VVUA 3DC2A 1B3TA 1YBAA 2WTUA 4B8AB 3PJWA 1CEZA 3TAMA 1CLFA 5GADI 3HFKA 4NEYA 4AHUA 3WEEA 2PE8A 4F26A 1NLKL 2EG2A 2FB0A 2YQ0A 2HHHK 3MTJA 1BWEA 1Q81O 4CK3A 4ED3A 3TJ9A 2U2FA 2XSJB 2WAQD 2P9SB 2E5LJ 1TZ0A 3CCWA 3VGSA 3OS2A 4P10A 2NYIA 3GV7B 4JI8J 3P45B 2CA9A 3HP9A 1LW0A 5HK4A 4XAKA 1VQMS 3CJ2A 4AF1A 3I55N 2XULA 2P9IA 2IM0A 3NCPA 3ZNUA 2W1BA 1VOMA 4E1JA 1FE0A 4FJHA 4C8YA 2OPRB 1LXNA 3V1QA 4IO8A 3EICA 2C3OA 1RISA 2VOOA 4I9LA 4DUZF 1RTZA 3CULA 2F8SA 2EK1A 3ENOA 1T03B 4Q8FA 2VPXB 3UNGC 2P9KB 3MEEA 2RRBA 2VCPA 3HULA 2QKKA 2F9DA 3GQCA 2G8FA 3B6BA 5HL7L 2WCXA 7AT1B 3MAHA 4CO1A 4KR0B 2VIHA 4DV7K 4Y28C 1X4AA 5EY4A 2G1DA 5HQ8A 4I69A 3DI6A 3QZ7A 2Q0RA 4YOYA 3R7BB 4LF2A 2ABYA 3MWTA 1GXTA 4HR2A 1SV5B 1DY3A 4J5OA 1PC4A 2KI2A 1ZAWA 5ETTA 4PKHA 4ZP8A 4ZPAA 4H4MB 3I6PA 4DPWA 1RU2A 4ZKAA 1X5PA 2P9IB 3R5JB 2VBZA 2HFOA 4I7FA 1U6BA 1QAIA 4PYAA 3CCMS 1FXDA 2RMLA 4B3MF 4JD2A 4OLPA 4CLUA 4HUGA 1FJGF 2H3GX 4CZGA 4CLSA 3CJ1A 5EN1A 2F8TA 3L95X 1Q0NA 3GJSB 4ZJQA 1S4EA 2HPUA 4BR5A 3H40A 4NYOA 3FZKA 1RTIB 1Z1ZA 1GLLO 1LCUA 1DARA 1WAFA 2ZE2A 2W9BB 3SCJE 3K5MA 2VGMA 3NGKA 3CC4S 2LQ8A 4KRWA 1RBAA 3KG4A 1RTJA 3CC7N 4F8RA 4IQXA 2ZM6K 4ZN1A 4DL6A 4O3NA 2D3ZA 4X66F 1NOYA 3CF5Q 2C3UA 2YKMA 4TLQA 5GAHU 3KIOA 4EYIB 1Y5IB 2Z8QA 2BQ3A 2Q6CA 1S99A 1YBTA 4PXDA 1YJWN 4MIWA 3NHGA 3QEWA 3W3SA 1VI7A 2V8HA 1NZAA 1PG5B 2KXNB 4JV2A 4CO2A 2XCPA 3RR8A 2V4JA 1IBLF 4CERA 4J9MA 3BGLA 4DPUA 1PBAA 1XNQJ 5ADXA 1HKGA 4FLUA 5A8RB 3CCJS 4DN9A 3I56N 5E2QA 4LBPA 3GU0A 2VQFK 3D3BJ 2A6MA 1RDBA 3CCMN 2BZ2A 4ZVGA 2D7SA 1N33J 1M5PC 1HR0F 2OEMA 3OXFA 3DOKA 4X4RA 3G25A 4K41A 3TANA 3OJSA 4DV3K 4DL5A 2VA3A 4B9QA 1F2GA 1RBTA 2CGLA 2OFGX 3IA0A 2C2NA 3CDWA 2L41A 4S0MA 2V51B 1KVJA 2ILYA 4DR7F 2IDLA 2DEJA 3H3NO 3PDNA 5E3PA 3BDEA 1V6HA 3QJPA 4CYUB 5KFCA 3LUYA 3TZXA 1UTAA 1B7FA 2IVFB 2IYIA 4MJKA 5CA5A 2BE7D 1MWYA 4WFZA 1L3UA 3ASMA 3DXKB 3LP0B 4FJKA 1H0HB 2E5IA 4ER8A 3VAHA 3KTQA 1GOBA 3LAMA 3J7YU 1Q8BA 3JAMO 1PYTA 1MU2B 3G82B 5AZIA 2V69A 3BSAA 2AF6A 2HBLA 2FGOA 2GBZA 2SXLA 4FLVA 4ZP9A 3NRBA 3WIVA 1GMWD 1WG1A 2FZCB 2QLJB 4QWAA 4NLBA 3B4DA 1TUVA 2V34A 3U1LA 3G4SN 2A2DA 3AY0A 4J9QA 5J2NB 1QY7A 4Y00A 4FYYB 2FC9A 1NLVA 1QE1A 1K44A 4DTJA 1N52B 4Y65A 2F9JA 4AL6A 4P6QA 4PYDA 4DR6J 2UUAF 4Z94A 3FQLA 4YDDB 5KFAA 3WX8A 1QAYA 2B8QA 3KLVA 5C2FA 3T7ZA 3U9DA 1UVJA 1VYAA 4NASA 2N3OA 1KSPA 4KV8B 3DM2A 1EWRA 2X1AA 4Y2CA 3QIPB 4IJNA 2G8VA 1FHTA 4FP9A 4OYAA 1HUXA 3EGNA 1GMUA 2C2KB 4TYAA 3D66A 4BHQA 5MAOA 3NAEA 3CEDA 1JIHA 2WRMA 3MDQA 5H9EK 4ED5A 4B3OA 2QL7B 4GVBB 2N4DA 1EXQA 3MF5A 3C6TA 1YI2N 2NSBA 1U7LA 1HYVA 4A48A 1E3MA 4L3QA 1VR6A 2VFTA 2KFZA 1PSDA 2CQ1A 1WC3A 1YTAA 2AEJA 1T9YA 2CPDA 1SQKA 3TNVA 1TL7B 4HI1A 2RDIA 4DV6K 1BCMA 3VQ6A 3F73A 3GSIA 5J1EB 4FL9A 2LSNA 3CJ5A 4CM0A 4L73A 4AH9A 3N79A 3I5BA 1V4TA 3I0RB 3QMQA 2HHHF 5EX0A 3W65A 4QQBA 2GIRA 3J80Y 5C42B 2W9AA 3A5NC 4L75A 4NLQA 2EFGA 3GIMA 1FFSB 6FDRA 1LFPA 4JBCA 2QMUB 3DOLA 2HS0A 4EWTA 5HMXA 3E9LA 3M32B 2K2PA 3R7NB 5AQIA 3JAMU 1KLNA 5F3TA 2DO0A 2J0SD 4A46A 5G0RB 1T95A 4NMLA 2Y1JA 4BRNA 1S6PB 4IR1A 1U1OA 2W9CB 2C22A 4JI8K 1OJ4A 3ZZOA 3A8JA 1HPMA 1IKYA 3M6VA 4NXMK 2JC1A 5KG5A 1GOAA 4FJ9A 5FPNA 2GQQA 5M2RA 2ALZA 3AXKA 1T94A 3HFVA 2UXDK 3KDOA 5B0CA 4CBXA 3OR1A 3T9NA 1XHXA 2CPYA 3CCVN 2Q1LA 4JI8F 5EOYA 4CDIA 2ZM6F 5DM7L 2EPIA 2NZCA 3HHLC 3J7Z5 2FQQB 2I7PA 2KM8B 3SDEA 4DTNA 3VALA 1SVDA 2WC9A 1VBKA 4USKA 1HBNB 4K42A 2R8IA 3ZSQA 4DV7J 4J9OA 4HTLA 3S8SA 1E6VB 3AD8C 3Q8VA 2V5HG 5DG8A 4DWIA 4YDUA 5HO4A 3T3FA 4B3RJ 4ITSA 5GADU 2HVDA 3G6YA 4HUFA 4WTYA 1H2TZ 3PJ9A 4GVLA 4FZVA 5M1PA 4PL8A 2OGUA 4ECXA 2ZWHA 2ZGYA 5FPDA 1P9YA 4A47A 5GAHP 3W63A 2ZQBA 1X9WA 1ITPA 1YJUA 2FHJA 2F5GA 4JI4F 3NFAA 4DHVA 2NRVA 4B9TA 5KFRA 1VQ4N 3UCGA 4OJRA 3OFGA 3GJQB 3C15B 1XK8A 1PGZA 4K4SA 5FRMA 4JHDA 3BEXA 1HR0K 4J90A 1JLEB 2MLYA 2XHWA 1U0HB 2GZOA 3C0BA 4QIEA 1GFWB 4A2BA 2XS2A 4I68A 4YB5A 2ZZTA 3CFOA 3H8YA 1HNZJ 3QJJA 4ZHRA 3MPDA 3TUPA 4YR0A 1R8BA 5F9NA 5KG6A 2MZTA 1B4SA 3KUGA 4Z4GA 4IKAA 4CEOA 3H20A 4KAZA 3KXDA 4PKGA 4CO3A 4CZFA 3CCJN 1J5EJ 4ZS6A 2UXBF 1I6JA 2E20A 1NDKA 4NYNA 4JI2J 1CULB 3F5TA 1CQNA 2J0QD 4UOCA 4DR4F 4AHTA 4WFAL 4CZHA 4WJBA 1KLMA 1HPZA 4HTIA 3VERA 1NPRA 2PYJA 3DM2B 3EMTA 2C1EB 3CW2C 4X4PA 3O4QA 3LDPA 1YRUA 3AFGA 4PZVA 4MH8A 2YWHA 1XR7A 1S0MA 2C2DA 4EFHA 5T14A 3OSPA 5DETA 2E5GA 3MAAB 4PCQA 3E1YA 2YPYA 2VB6A 3HVWA 3TSUA 4DQQA 2V7YA 3BO2A 1NGAA 1OYEA 2ZJRL 1Q9YA 2NRRA 2CG4A 5E26A 1N33K 2IMOA 3N4WA 3CMES 4BQZA 4ZTJA 3LDLA 4PQAA 1WOOA 5A76A 1PYOB 4KTQA 4J37A 4OJHA 2FBTA 3GIRA 1Q7YO 2V50A 4B1VA 1D3WA 1F5CA 2AW0A 1YSJA 1BMQB 1UVMA 3BZKA 3AA9A 1BXNA 1RI7A 3G8TA 4DR3K 3KJVA 3A5MC 4MK8A 1RKIA 1NJYA 2CQDA 2IMWP 5AQVA 2PFDA 1JJ2R 4QU7A 1QQOA 6AT1B 2CZVC 3NNHA 1FX2A 2HS4A 2N4CA 1H74A 1J5OA 2E7WA 4EFAC 3QYYA 1XMOK 1U1RA 4M3UA 3J8AA 2CPIA 4Y2AA 3ULEA 3O2IA 4G6VB 5KT2A 3DLKB 3EEQA 1FJGJ 2ZH9A 1R3NA 4WZMA 3NCQA 4CLLA 1UP1A 4USWA 1SQFA 2QWOA 2GNKA 3UDEA 2OTJS 3KMQA 1AZSB 5L9XA 2F8EX 5HJYA 4MTPA 2B56A 3OL7A 3CJRA 1HIYA 2L48A 2VFVA 3HD1A 3SPYA 4JI0K 1NDPA 1RILA 1N54B 1S72N 3QICA 3OYJA 5AJ3J 3PLAA 2MKCA 4HHUA 3P6YC 2YX6A 2UUCJ 3PRVA 2AKWB 3KLIA 3P39A 5BN9A 4FM1A 2L9NA 3RBXA 1FKPB 2BACA 1QSSA 4FJJA 3EGVA 4WPAA 4JP8A 2QLFB 5MLCQ 2OUGA 4X4QA 2QA1A 1G6BA 2XYPB 2IM2A 1EP4B 2XMWA 4JI0J 2YKPA 3IGNA 4LSLA 4ZOSA 2VZ9A 1TVRA 4FJ8A 2PO4A 1SZ2A 3IR6B 3KLIB 5SZTA 2DGWA 1FKPA 1VRTA 2H5IB 2O67A 5EHHA 1IJEB 4CEDA 4Q0BA 2CFXA 3G71N 2HNYB 1FVSA 4DL4A 3M2VA 3W2WA 2VFUA 5F0UA 5AQMA 4NZ6A 2X6NA 2LMIA 3OPKA 2B4JA 2FC8A 2E5LF 3SV4A 1LWFA 3D6TB 5HI7A 2IJRA 1JLFB 3SEOA 4CCHA 3AA2A 1SJ3P 2HEKA 4YEAA 1TAUA 2QSFA 4JLHA 3ADAC 1ATNA 4MMOA 2UUBF 3NOGA 2HFSA 3K5OA 1S4FA 3UD3P 3DNCA 1WLJA 4DV5J 4TXSA 4JS4A 3R5GA 3KD5E 2OZMA 4TU9A 5AFUA 2HZVA 2ZNZA 2QTDA 1FEEA 2J4RA 1SH3A 2UUCF 3E01A 4FK2A 5GIOA 4BE1A 3EE8A 1Q82O 1B0TA 4DG1B 1VDHA 4X65K 1T9TA 5JVHQ 4P2FA 2W6KA 1W9HA 4DR6F 3H3OB 1VQMN 5ETLA 2RHSB 2C2ZB 1RBRA 4PR6A 3H46O 1TL1B 2P9NB 3GIJA 2VQEJ 1IBKJ 3NDKA 4BRMA 1L5UA 2PFUA 1J2VA 4B1UB 2L9DA 1FDNA 3CHWA 1U2FA 2E6MA 5K20B 1WF1A 3EPGA 1UKUA 2AEMA 4W90B 4QWCA 4IYQA 3ZSXA 1NJZA 4B9LA 3O08A 5B0EA 1DLOB 4E7KA 3R6LB 2C3MA 1C0TB 5M2PA 2GA7A 1NH7A 1SH2A 4CNZA 4RWTA 4ZPVR 1BCOA 4TY8A 3T5HA 3ZETB 2Q43A 3DRSB 3Q23A 4ZITA 3GR1A 3MCOA 5K8MA 3FMWA 1JLQB 2FVQA 4URQU 4JK7A 3WX4A 3RU0A 5HQMA 3BPDA 2QZ8A 2J7WA 4CJWA 5AE2A 2HRYA 3V2UC 1YG0A 2BMBA 4GV3A 1UVNA 2PFFB 1IN0A 4DV5K 3LGMA 1T8EA 4M94A 4BWMA 2DEIA 1F9HA 1U47A 3LDNA 1BY9A 5TKWA 1N6QA 3BEGB 5F2RA 4M5JA 1VHIA 2P9SA 2YXLA 1J5EK 4Z7CA 2JFKA 4IOAL 3FQKA 2CZ4A 4ID8A 2J6UA 5ETQA 3PCOB 5EVZA 3AQPA 1O8BA 4CIEA 3IS9B 4J9KA 1SL1A 4JHDB 4F0KA 1EB0A 4ETZA 4DUZJ 4PWUA 3QGPA 2HNZA 4NA3A 2V67A 3M05A 3O8MA 3SK3A 3TW0A 3JTOA 4DR4J 4QCLA 2WW8A 4MLHA 1VSIA 1CC7A 2JRSA 2KRRA 2MQ8A 2JSXA 2CG8A 1V3ZA 2H9ZA 1KRPA 3R5BA 2RPIA 3PW7A 5M1FA 5EWFA 3P38A 1SJFA 2XNRA 3Q8QB 3OR1B 3KVGA 4X64F 3AA8A 4ELTA 3LGNA 4ZDNA 6FD1A 2UXCJ 4IQMA 4IUFA 3OL8A 4C23A 2EX3A 4QWDA 5DDRC 5CZ2A 1JLEA 1L3KA 3B54A 3W7BA 3IWXA 2VD3A 4J9VA 1GLBG 2HURA 2ZH6A 3WXKA 3IS9A 4C2MA 2OSQA 4ECUA 4KHQA 4W4MA 3QFWA 2QM1A 4H0VB 4YY3J 1OH5A 4FBTA 2OMOA 1NUEA 4I56A 3QNOA 4CGDA 1YTUA 2RH3A 2D4WA 4MDAA 1IVZA 1REGX 3OR2A 4NI2A 2CH6A 1NGFA 4XPCA 5J1NA 4UZBA 2AJ0A 4LF8F 2LU2A 1G15A 1EETB 4GNIA 3W61A 4IBNA 1Q86T 2W9CA 5JLHA 4YB7A 4LSZB 2JFDA 4NWBA 2F4FA 1SB6A 3PIPQ 5I42B 1FNMA 5DDPC 3TU5A 1X4GA 3KG1A 2Z0GA 2EXUA 4ZVOB 1X1PA 4WP8A 1WACA 5DG7A 3P5JA 4RPFA 4NLOA 2F40A 2CGKA 4X64J 1KONA 4CGIA 4CJ5A 3NH2A 1N36F 1VSJA 3SV3A 4DR7J 1ZPWX 4M5KA 2OCEA 2UXBJ 2DR8A 1ZZFA 2ZM6J 3CJKA 3RMAA 2HFNA 4AXIA 5CZ1A 3EGWB 3ZEUA 4M42A 2DY9A 3A8YA 4BRAA 5A8KB 4ECTA 1HR0J 2UXDF 1U49A 3VQPA 1SJRA 2MHEA 2J0WA 2HHPA 2HWTA 2PT0A 2FHJD 4RW9B 4NLPA 1K47A 3NAIA 4LQ9A 2FGCA 3ID8A 2ZEJA 3PSFA 3EPIA 2NSCA 1GLEG 4KPYA 2QN6B 1NB7A 1HMVB 4P7TA 3HMJG 3OHAA 4FDFA 4LF8J 3OYAA 4TQRA 4BACA 4CEFA 4ZK7M 3SCLE 1VK0A 1RDRA 4CO4A 5IWAK 2VONA 3RAXA 3A2FA 1QDUB 3VEWA 5AXNA 4J2EA 1U45A 2C3PA 1Q5VA 3CC4N 4W5OA 3THWB 3FVYA 1TK0A 2RUSA 3O44A 3SQ4A 2GVDB 3H4DA 3MEGA 3MGJA 3P5TL 2P9LA 4EGLA 1VQ6S 3ZT0A 4W92B 4IOXA 1NK4A 4M5GA 3D2FA 4OYOA 1HBOA 4ZCLA 4BY9C 5CD4H 2IVPA 4RL1A 1JJCB 3IFEA 1A5VA 1NOZA 3ZX0A 4CZMA 2GAHC 3CQXA 2Z1GA 3HSTB 4RJVA 2DGUA 1VQLS 2P9UB 4JI6F 4ELVA 2IA6A 2FVPA 4Z2XA 2CPZA 4NLSA 4Q0BB 2DKOB 1FDDA 1UJ5A 4C4WA 3VESA 1XMQF 3F41A 3VQAA 2ZH8A 4C1NI 4CIOA 1V3RA 3CFRA 3NXZA 3PYDA 3Q83A 1NSKL 5A8RA 2HZCA 4K8XA 3CIMA 2VKZG 3Q8RB 1B0PA 3AT1B 4E89A 3QZ8A 4NA2A 1F3FA 3D7EO 1RAAB 1VISA 4TVAB 4O3SA 2Q97A 1IG9A 3MM5B 1ACMB 5C25B 2ZBRA 5KG2A 4OX9J 1VQ5N 5M2UA 2IPOB 4O0IA 2RHKA 2YHBA 3TWHA 4P52A 1SXLA 2GGPA 1Z6RA 1M0SA 2ZDPA 1YGYA 1H2VZ 3SMSA 2ZBQA 2AYMA 3VGKA 3I8DA 4WWSA 2ZC3A 4FWRA 3MEKA 4CFCA 2NZ4A 3CCVS 1T3NA 4N8OA 5BYQA 1RE1B 1K9MO 2HMIB 4GO5X 1IKXA 2B8PA 3D6MB 5LSLA 5M1QA 3VN5A 1GLAG 3MM8A 2AJ1A 1WHYA 1CZAN 4BR7A 1RP5A 5AJ3F 3UE2A 4WBFA 4B8CA 1KAZA 1NGBA 1LOUA 1R27B 1B99A 3AGRA 4ISEA 1VQ6N 1I94K 3DGVA 2QWNA 4CHOA 4WFAQ 3OVBA 2VC1A 4JOUA 5B0FA 1ESVA 3P4UB 5EX3A 2D1CA 4DXLA 2BW2A 3O9UA 5JMNA 2RNEA 2GEMA 2N7YA 3KK3B 2JWKA 1HYSB 2VG5A 1WTFA 1KKHA 4HACA 3DDIA 2JVOA 2DRDA 2YTCA 4HH0A 1WG4A 1IH7A 1VQKN 1V9OA 1RBLA 1F0XA 1BGXT 3ISND 3Q8UA 2O8EB 1X9SA 2EFOA 3Q0AA 1BHLA 2NPIA 4CHZA 3GIIA 1IBMJ 4DX5A 3NMUA 3QAEA 4JI7F 4CF8A 1AZSA 3HT3A 2VF3A 4O4GB 1NK8A 4I6WA 5EWGA 3D28A 4LF6J 3NVMA 3I5AA 4C8ZA 3NS5A 1NCLA 4KKOB 5LJ5Y 4J9LA 1TFWA 3T1HK 3M8SA 1HI0P 1BL3A 1RTJB 1VBYA 3O9QA 4URGA 2W2OP 4YS2A 3QRPA 2G8WA 4O3OA 4DDFA 1CULA 1U0HA 1NWKA 2B0GA 2NR0A 4P9SA 5F0WA 2OPSB 5F8LA 2CNLB 4LRFA 1KLMB 3OL6A 4WZQA 3FFIA 4FPAA 4IOAQ 2DXFA 5I3QA 3D68A 4FJGA 1QVFM 2P6SA 4XTTA 2JGUA 4N8NA 4E98A 4K4WA 3W64A 4QYRA 3PW4A 2NZTA 1U02A 3SQ0A 2ZOMA 3I4HX 4DV1J 4NXMF 4DR5J 3A1YG 2GC8A 1VQYA 1BU6O 3KK2B 1Q8KA 3D0PA 4X66J 1YF5L 3RG6A 1T9VA 2AP6A 4PUOA 4OQJA 3NGIA 5AQNA 2QWPA 2BTFA 5AQYA 3TA1A 1BQMA 1R0BG 4EP4A 4H0YB 3BQ1A 4AUKA 4OX7A 4BBYA 4PHTX 2K06A 5K8PA 5BR8F 1HLWA 3GDQA 4H5VA 1MW7A 3G87A 3PV8A 4UY85 3JS9A 4YFUA 2HYIB 2VA2A 4K50A 3OXLA 1VSHA 3TZYA 3R6MA 4F0MA 3HHEA 1NSPA 3UD4P 5BPMA 1JK9B 4ZPWR 2WHOA 3UDLA 2VG7B 3VA3A 1YI2S 3CG7A 3TX0A 2O01C 2GHPA 4WK1A 4K5RA 5G0RA 1NHVA 1E4FT 2HW3A 4NCBA 3LPUA 1HI1A 2P6TA 2W42A 3MUMP 4A4JA 1FI4A 4GKKJ 2WZ1A 5BR9A 3GZ7A 2EHGA 3CGIA 2B3TB 2CRLA 3MM9B 1WORA 1SC4B 4F25A 1UFWA 2PEHA 4CD1A 4RTFD 4QZVB 2W8KA 1TELA 3I0SB 2EWSA 1NU4A 4M5NA 5KQDA 3AY9A 4LFBF 3NF9A 4OHXA 2BKOA 4OYPA 3O1WA 1RDDA 3IN5A 4IOCQ 4FOEA 3WBZA 2Z2LA 4W5NA 4BRGA 1HQ2A 1OMSA 3MXHP 3WNGA 4Y6IA 2P8IA 1FKOA 2M52A 3IO1A 1RBUA 5ETNA 2M8HA 3H90A 3QNNA 4DFKA 2YKNA 4LBIA 2D0BA 4OV1A 5L1KA 2DO4A 4Z4EA 2HBRB 4CZLA 3ZTQA 3IWNC 4ALZA 4IFYA 1X5OA 3NEKA 3TQEA 3Q24A 1OQ6A 3L2VA 3KK3A 2P5OA 2KXFA 1T6CA 3DRPB 3MN7A 3QINA 1HNZK 4MKYA 1W97L 1S12A 2CPEA 2F9TA 2KVQE 3UPFA 1PIEA 3RRGA 2JOQA 4CJRA 5D77A 4RO0A 3H1QA 4ZCKA 2DH9A 1N32J 4K0KJ 1WC0A 3SSQA 1NPKA 1RWUA 1QUVA 4K5SA 5KRSA 3M6GA 4KI6A 2Z58B 4HI2A 3QQCD 4UTGA 3SI6A 3ULHA 3PIOL 1JXEA 5GAEU 4DFPA 2X1GA 3MMAB 4B1ZA 3CQ8A 1RFQA 1NGJA 1WNSA 3A12A 1ZBLA 1RT1B 4K0KK 1N32K 4RNNA 2MZQA 2MQPA 2EBGA 4L74A 3VEXA 3NAHA 5IWAJ 4YOUA 5D78A 4KTWA 4BGBA 1KTQA 5IT9Y 4K4UA 4ED0A 2BQUA 4Q2LA 5LJ3Y 3MR5A 1FESA 3K7RA 4X64K 2M8DB 2JLGA 1HA1A 5EXWA 3BBFA 5M1NA 2HGLA 2EC0A 5AQZA 4DQSA 3LP1B 3IG1B 1JB0C 3BS9A 4H54A 2CPFA 3AVHA 5BRDA 1YZ7A 4CO0A 4JI7K 1NDCA 1IUJA 3ILLA 3SAHA 2LQ5A 2XY8A 1M1HA 2DNMA 2LXFA 3IMQJ 3HYFA 3NMAA 2HBYB 4Q44A 1XIQA 1UWAA 2A3JA 1G7CB 4ES1A 2LU1A 1RCHA 4WIQA 2HHSA 1RT6A 3HHLB 3EYZA 2FY8A 2D3UA 2HVHA 2CVIA 2UUAK 3VZIA 4RX6A 2ATLA 1S6QA 3FBFA 2G8UA 1ZBIA 2HVIA 5T41A 2KH9A 2CDRB 2RN2A 4JKCA 2KT2A 1RWXB 3VQCA 3T69A 4OX9K 5FLXU 5HMZA 2CNKB 3DLKA 2YH0A 3BR9A 2BOAA 3VQQA 3WXMB 2RU3A 1C1BB 3U3GA 3Q8PB 3DXSX 1XNQF 4I2QB 2COLA 2OKQA 2MKHA 4B3TJ 5AZIB 2BUNA 1T3OA 3D7SB 3JB9k 3ILIA 2EEYA 5KTQA 1PAUB 1IKVB 2IFXA 3MPUB 4JV5J 4BRDA 2HHTA 4OPJA 1CJVA 1GK8A 3O4NA 4LF7K 2AT1B 2X78A 1N48A 1U1QA 3UKUB 2VL1A 5C10A 3CWJA 2KVIA 1KP6A 4NLDA 1NK7A 2AHOB 2MLXA 4B3SF 4LF6K 4DTPA 4OPHA 1KDNA 4FKYA 3QO9B 3CNQP 1HKCA 2HQDA 4B3MK 2H51B 4BR9A 3ZTPA 5C2GA 5AQKA 3WNFA 3HTVA 1FD8A 1VFJA 2C3YA 3DN9A 3QRRA 5KFPA 1VC6A 4FVMA 1HW8A 5A0YA 2E88A 1NGIA 1FCAA 2ZZMA 2D9PA 2FZGB 5LT5A 3AB4B 1W2BR 5AQXA 3OYEA 1XEZA 4P72A 5KG0A 1RHJB 2BANB 1W2BM 2GWJA 4LR7A 4DOZA 4FJ5A 4ZIWA 4ED8A 2QLBB 3OYIA 3DLLL 4XO0A 4JKDA 3FSIA 3MM6A 4P74A 1IBLJ 1IBMK 1WG5A 4EP5A 2CJ9A 5GADP 2HFZA 4ILGB 4B9SA 4WU2A 2WFBA 3MCSA 2V2VA 4JKEA 2D0AA 2DGSA 2HBQB 2RQMA 3G6ES 1YITS 3V1RA 3HHNB 4ILJA 5KFHA 3PX0A 4OZ2A 2U1AA 2IS3A 2V63A 4K2XA 2EK6A 1PCAA 5ETKA 3EXCX 3CD5A 3ET6B 4M63C 4JI3F 3IAM9 4PG7A 4CTAA 3VETA 4CJUA 5KFWA 3SNNA 3KKSA 2R2SA 3QRQA 4DTUA 1SPBP 1KD1T 1RAJA 3J80U 3CJSA 3L6QA 1HL6A 5I4MA 5C7PA 5KFOA 3H59A 2E7VA 3UFCX 5F8JA 3AJDA 2Y1IA 1RT2B 1VQOS 4M3TA 3M2RA 5HJXA 2UYTA 4HLBA 3CJ0A 2BE9B 4IR9A 3T1AA 2M70A 3VQSA 4HHTA 1X3NA 1QD1A 4H4OA 4Y2IA 3OYLA 4KHYA 1S9EB 3RVCA 4OLAA 1WKJA 4I7FB 1K0VA 2G2YA 1HNWK 2DY4A 1LWCB 1LOTB 2RDJA 2FHKA 1KOHA 4AM6A 2RJZA 3GJRB 4B17A 4FJ7A 1IXKA 2KG1A 2B4PA 1IKWB 3NGRA 2GHVC 3VV2B 3PX4A 4KGVB 1HNIA 1B0VA 1G3OA 3I5CA 3J80O 3FBCA 1WSEA 2NCKL 3VQEA 4OL8A 4IXCA 4OO1J 2MEWA 3QETA 2E1AA 3DYAA 3IR5B 4USIA 3U9ZA 2VHGA 1VSFA 1E6YA 2ASMA 1VSLA 3FFKB 5KG7A 5FD1A 1VRQC 3VCDA 3UI3A 4DR2J 2BKPA 3M2RB 4OX6A 1UETA 2NRHA 1WNEA 2LLZA 4YY3K 2OTLN 4XH1A 1BO5O 4MKVA 4LBHA 1RKJA 2E4LA 2HNDA 2FJBB 3MR3A 3MPWA 3VVTA 1VQNS 5AQUA 4EZ6A 4WYBA 3ONQA 4GKKK 3UB5A 2CADA 3SUNA 2A41A 1R8AA 4R5PA 5IXUA 1VIXA 1S6OA 1YJ9S 4NLXA 5B09A 1DTTA 4XEIA 2DNRA 4Q8EA 1Y4ZB 2YWFA 3HLUA 1S72S 4OHYA 2MZ1A 2CPHA 1CG2A 2QFIA 4FZZA 2RSQA 1TKDA 4IWVA 4XK8C 2XSJA 3QBCA 1ITGA 5L8RC 2CNNB 3HM8A 2HNZB 2ITMA 2QLWA 3H2UB 3Q2TC 1APSA 1RTHB 1JLQA 4LR9A 1JCFA 4RNMA 1MWQA 4YUDA 4G1QB 3ZSYA 2XHCA 4AXJA 1L3TA 4X84A 3MFIA 4OI3A 2BW7A 4BC7A 4P71A 1UZHA 5E3AA 2R7RA 4NO7A 1R7IA 2J6SA 4KY3A 2Z2ZA 3K0JA 1S3XA 4Y0WA 4DR2F 3UN2A 3AVJA 4OPAA 1A7GE 2E7XA 2J7UA 1X5TA 3W66A 4BRPA 3C66A 3BF3A 2DNLA 2MKSA 5KFGA 2DCUB 2HIQA 2DGXA 1AXQA 3MN5A 3OTBA 1S1UA 3SAFA 4CP5A 4H0XB 1VBXA 5CZXA 2YNFA 2R2RA 1P1TA 1EQYA 2ITGA 3D0GE 1HBNA 4CM2A 1U2RA 5FIIA 2IHR1 2ILZA 4I4BA 5D4OA 4ATNA 2MPUA 2XBPA 3RWUA 4LR8A 1T9WA 4E7JA 3CJ4A 3O1BA 3GWCA 3CJ7A 4KGKA 4RLEA 4GC6A 4R0JA 4DR1F 3MCAB 2RKIA 1UWBA 2MHNA 1T02A 4CZCA 2PAVA 3MMJA 4DCJB 1DURA 2AGPA 2UZAA 2WBRA 1F60B 4NLYA 2ZH7A 4I64A 5DM7Q 3GE1A 1RLCL 5IQ6A 2QL5B 4PG8A 3W2WB 2F8HA 2E1CA 1KFSA 1BQNB 5AR0A 3PRDA 2H65B 2KT5A 4M5HA 1JLGB 3NS7B 2FVSA 4WF9L 4O4GA 5C12A 2VUGA 5C24B 2EKYA 1TKXA 4LF6F 2MDAA 1RHUB 4N5SA 2YX4A 3LTOA 4M41A 4DKWA 4V19S 2B43A 3J81U 2DITA 2AA4A 4HACB 5GAGU 3VGTA 3VAJA 3LP2A 3W1YC 4Y2MA 2K7KA 4DV0F 1ASUA 3VQ8A 1X0PA 1S76D 1GT8A 2CPXA 1KC8O 1CJTA 5HMYA 1WOQA 1FWKA 2DGVA 5KFJA 1S1XA 2QA4N 2KM8C 3CJCA 5EUHA 3CMAN 3TR5A 1SIZA 2R2UA 1HRHA 5I3UB 1YRTA 5LMNJ 1Z4UA 5IV3A 4CESA 3CD7A 3DHWC 3GJTB 2KL8A 1HWKA 4USMA 3HHLA 3CT9A 1VQPN 5HLFB 1YJRA 1NZ8A 1JCEA 3N4QA 3TTDA 4H5NA 4YR2A 3WHIA 4KHWA 1BHNA 2B5JB 1YLXA 4JB8B 2E8AA 5AQPA 1S48A 3BBBA 4QIVA 4WQ5C 2R2TA 3AO5A 2DYAA 3M30B 2LCWA 5H9EJ 3OY9A 1S1VB 3IBWA 2JH3A 1OVYA 3MMCA 2HHVA 2UU9K 1QZ5A 4LF5K 4LFBJ 3GFHA 3LOUA 3PW0A 4ZLPA 2ERRA 1CZBA 1HX1A 3I56S 2UUAJ 1UA1A 2GO9A 5F1XA 1EARA 4IG0A 4E7IA 3LF0A 2PDAA 3EXYA 2GAGC 2G0JA 5KG3A 3KHLA 3K59A 3R8EA 3AA3A 3Q86A 2VPWB 1U1PA 3CMEN 1HD1A 3V4IB 3AOBA 4YNQA 1KHWA 4ED6A 2GVDA 1Q9XA 4MO5A 4A57A 1VK8A 5IV4A 5AQHA 4EMDA 3NL0A 1VIOA 3ISZA 2LQBA 5IZHA 1JXLA 3CCQN 4ID5A 1MMNA 4DV5F 2JEGA 4OIXA 4GVEA 3VPZA 2H48B 1FDBA 1HI8A 2DISA 4BRFA 5J2MA 4CW7B 4ILLA 4DQRA 2A6OA 3M2UB 1A6LA 3SFGA 5DMRA 2I5JB 4CHPA 2CXEA 2NREA 4JD2B 3D6FB 5HMWA 5AQJA 3O6WA 3F9MA 1HWLA 3SZ2A 4A8YA 3OXGA 4BG9A 4BCAA 1D09B 4IH5A 1JL2A 2ZH5A 5HANA 3TAQA 5HRPA 1T3VA 2BE2B 3DCAA 1ZAVA 2O5DA 4IOBA 3HPOA 1VQKS 4R0EA 2DBBA 1UWBB 3JSBA 4ZIVA 4X65F 3CTRA 2OO4A 3BJYA 3V9XA 3P96A 4DR5K 2D3OR 4O8UA 4NXNJ 4DR6K 3TAGA 4I6AA 1VQSA 3HOTA 3M8YA 2HQCA 7FD1A 2IIRA 1ICEB 3OR2B 1GX5A 3FSYA 2RQCA 1AW0A 3FSXA 3NWRA 1XMOF 5EWEA 4WFBL 3FGUA 3AHPA 2CWKA 2WSEC 4F4AA 1OO0B 5KFQA 1GLCG 1NBWA 2O4IA 5FDLA 3PHTA 1U6FA 4M3ZA 3TX8A 4CJFA 4F0HA 3CERA 1NDLA 3BO3A 3OTOF 1T44A 1KQKA 1VLOA 1X8DA 3DLJA 4CBUA 4J2DA 1ATSA 4DUYK 2AJ4A 4O5BA 3ENBA 4DR4K 4B1XB 2GO8A 4GMJB 5KFKA 2D41A 2OANA 4DU3A 2XMJA 1Q78A 1NAQA 1K73O 4Y34A 3BF4A 1RAEB 3RJMB 2LXIA 4A61A 1HJRA 4JYAJ 3T6JA 4CJ3A 1QAXA 1ZS6A 3MZIA 2DNKA 1DRZA 5KFYA 3SFUA 2XS5A 4FW2A 2XMVA 1WTBA 4BC2A 3NVKA 3ATVA 1RT7A 3OYFA 1ZA2B 4FPBA 2HNDB 4I6YA 2ZJRQ 1RTIA 3PIOQ 1J5EF 2XZDB 4O0JA 5J1PA 3AODA 4BWJA 2QXFA 1JWWA 4DR2K 2QLXA 4C8MA 4CNYA 2XSFA 3HZGA 4FLYA 1RWOB 3M4XA 3DXMB 3B8AX 3AO1A 1H7XA 4F3QA 3NS6A 1R59O 4E0DA 3S01A 4QW9A 3QFHA 2A2CA 4DPXA 2E29A 2QI2A 2UUBK 2R8JA 3ZZPA 2LP4A 5D0GA 1HYZA 4H0OA 3R3TA 3SIPB 2G0IA 2QWLA 2R9LA 4ELUA 9ATCB 4J9UE 4A59A 3D3CJ 2LDYA 2QMXA 2OPSA 3MECB 1SJ1A 2YWEA 2EG1A 3VGUA 3KNAA 1WBBA 1NK6A 2E6LA 2DTUA 2FPHX 1FT8A 2VICA 3LZJA 3CM5A 3DU6A 2PA3A 5KRTA 5DG9A 3DDKA 3J7YP 2HWIA 5IWAF 3ALYA 4DV2J 4HHHA 4GO7X 1YJWS 1EQ0A 1OQ3A 1O13A 4MO4A 3W5ZA 2GMJA 4B9VA 5AXLA 5HP1B 3ZFVA 3EZ5A 1N88A 5LMUJ 2DRBA 4WU3A 3DOLB 2JEFA 4EBCA 1K0TA 1XQSC 5TKYA 4HH1A 2VG7A 1RSCA 4OGCA 2HS3A 3PUFA 1CPZA 2OPPA 4CI0B 3QIOA 4DV7F 1EX8A 3FFIB 2R8GA 4QS7A 2F63A 4QPTA 1IR1A 8AT1B 5HRNA 3C7NB 4NYFA 1KQSR 4ED4A 4DU1A 2HRTA 4PKDB 1S7IA 2HHQA 1DAXA 5FLXO 3T1YJ 3C8YA 1N8RT 1R8PA 1CC8A 2OPQA 5GMEA 4CD3A 2HAIA 1URNA 4F4KA 3SUPA 2O8FA 2GUPA 3Q7CA 1LFWA 2CAJA 2V7ZA 3ITHB 5BN8A 1FRLA 3UCUP 2YNIA 2RVJA 5GAEI 2D0CA 1PO6A 1QVFR 2XLJA 3MPVA 2F9WA 5T7LA 5EU7A 1ZC6A 2LA4A 2XWXA 4HT5A 1XNRF 1S22A 4WXWA 1FWPA 2OD6A 2Q79A 2B9XA 2V8PA 4M8LA 4EO6A 1RT3A 3CJAA 4PG5A 4DTSA 1YWXA 1RTDA 4QPXA 1HFEL 3MFHA 3OYBA 3VENA 1NMEB 1FJGK 1OPIA 3R7SB 5GMKa 2QRRA 1J53A 2E5HA 4PAAA 2G8IA 3N6LA 1RWNB 3IC1A 1IG8A 2C2RA 2V2ZA 3UO0A 3AGKA 1Z05A 4M5IA 1IWGA 4TYBA 3J7YI 1RAGB 4FYWB 4OJ3A 5D4NA 4M7XA 4HCBA 5FPMA 3CPEA 2KN4A 1RWWB 1KR4A 5A6WA 3U8XA 4PWWA 1YKWA 3PEJA 5J2MB 2JX2A 3PTWA 3HZEA 4GKKF 1VRUA 4URSA 1JKHA 4F3MA 3TSQA 1LWFB 3BSOA 3V4IA 4BROA 5IM0A 5AZJB 1KBRA 2F4VJ 1W7WA 3IMXA 3CDAA 4NLRA 5ELZA 3T5LA 3M1FA 4FM0A 3IAYA 3Q22A 3MEDB 2XLIA 1A0OB 1IKVA 1TQLA 2FD2A 3THPA 4MKAA 4KC5A 3ZCMA 2KLAA 1H2UX 1TYQA 2W2QP 4LQ3A 1XNQK 1IKXB 5GAGI 4JI7J 2CPJA 4ED1A 2Z1IA 3KJFB 2IA0A 2O8CB 3LQVA 5FJ4A 1BC6A 4JV5K 1UAWA 3W62A 3MXMA 4DPYA 2JC0A 2F65A 1PAEX 3QFUA 4CEZA 2HRUA 1PJ6A 4IEEA 2VBWA 4FWLA 2NRTA 3SQGB 1RHQB 1H7WA 2OIHA 2GW8A 3RRHA 5BR8J 4A8SA 3LP0A 2VBYA 3CCUS 1ILYA 3DJCA 2YVSA 5JLFA 3OA9A 4PPZA 2I2YA 1MNEA 4OZ5A 3AA4A 2IOCA 2P2CB 2YWKA 2ZWOA 3SSSA 2BKNA 3Q89A 4U9RA 5C2CA 4DV1F 4TU7A 2Q3PA 2R42A 1D8YA 3ENWA 2XO7A 1HWUA 2M4MA 2B51A 3BY5A 5F9LA 4ZPBA 1IBKK 2NXEA 3KDNA 1UMJA 2E2PA 1SS6A 4EK2A 1W26A 3P83D 3RB4A 2NRXA 3VOVA 3CCRS 3CB4A 3VQ4A 4MYTA 3V6DB 3A8EA 2I9SA 1NK9A 1DFDA 1CLQA 3KHGA 4F4WA 2DHHA 1LW2B 3FK4A 1IBKF 1XMBA 3R9LA 1D9DA 4UY8T 4ZJOA 3OTOK 4HHJA 1HMVA 4OPKA 2RS8A 4O5FA 5LL6d 2ZJPL 1K73T 3OYMA 3J7ZO 4OYBA 5C25A 1WWHA 2BGGA 3KHYA 3BSNA 1YIJS 2W41A 2XY6A 5K5MA 4BRIA 1FEHA 1UW9A 5EX5A 2KYXA 4LF1A 4FJIA 4X4NA 2ZH4A 2D69A 4BR0A 1X4DA 4RW7B 3M3ZA 2QO3A 3ENAA 1C4AA 2XM3A 2ZNYA 1Q5YA 4U67Q 1UCNA 2R7QA 1AB8A 4OYZA 5DJBA 1PYSB 2FSKA 2RQKA 4YOXA 1KXPA 2QXLA 3MCMA 3QB0A 3LP1A 4DSEA 1WOSA 3LL3A 2D9OA 4QWBA 4NOHA 3ISNC 4OI6A 4JI5K 1WBDA 2Q2RA 4EHUA 5AE3A 1OS5A 5ADXH 4BC4A 3CCQS 4IO9L 2R4FA 2FLNA 2KQ2A 1NPPA 1FDAA 1WF0A 2BUPA 3K57A 4TLRA 1FKAF 4RU2A 5BREA 2RS2A 1UZDA 3RYLA 3T1HF 3NH0A 1FE4A 3CMAS 4J8FA 3VF2A 4X65J 1M5OC 1XWLA 1KVKA 1IJFB 2OD4A 3R5CA 3GG4A 2E1ZA 3CCLS 4RW6B 2GQCA 3AVAA 2Z4PA 3W8PA 2DPJA 1ZPVA 3JTNA 1ZBHA 1PKUA 2GIFA 5DZ7A 4CIGA 3VWSA 1NXIA 4G1QA 2R8KA 1UFLA 3EKSA 2WSCC 3BPSP 3VF0B 1V4SA 3RR7A 3EL2A 3OW2R 5AQQA 5HBMB 2AYGA 2HK2A 2OZSA 4WF9Q 1HLUA 1TUGB 2ZVIA 2YNHB 3PYEA 3QAUA 2HHUA 2OA8A 4ZLLA 1OH6A 1GOCA 4GV6A 1E6YB 4JI1K 4U7BA 1G4CA 5EDWA 4B1WB 2V52B 4C97A 3CC7S 2KTQA 3I0SA 3J7A1 4LJMA 4X4UA 4E19A 2OPRA 1RK8A 1CS4B 2K1RB 5F8GA 4U6PA 4LD0A 2W2MP 4MLEA 1HNZF 2IVMA 4J7CA 1B92A 3AD9C 1LV5A 4B9UA 4CT9A 4B02A 4KREA 3F9KA 5E5NA 2RRAA 4A8WA 4ZPDA 3MX5A 3U6FA 4C11B 1X31C 4OYIA 1NNDA 5AE1A 1TP7A 5D0HA 2A6AA 4FJNA 4C98A 2ASOA 4ZCMA 4C0OC 1JCGA 1OPZA 5LL6Z 4L76A 1ZBFA 1N5SA 3MI7X 2GVZA 3C19A 3TTFA 4B3RK 2L9WA 3E66A 2NUBA 1DZ5A 3NLCA 2F8MA 2WB4A 3HM9A 2V68A 1UOCA 2X74A 5IS2A 1BI4B 4X4OA 2P9KA 3DFEA 3JQKA 4I0WA 2HVZA 4BS2A 2CKWA 5BYSA 4K4XA 4B3RF 4HDGA 2I8EA 3K5NA 4ZN3A 4FZYA 2EFNA 4J9NA 4OMFG 2WK4A 3NNAA 4F2SA 3EVWA 1WB9A 4Q45A 2DGTA 1GTHA 4UUWA 5E0OA 3IRXB 4ZLJA 3ZSWA 2R7OA 1GQEA 3PVXA 1S77D 4CIFA 1BA1A 3T5JA 1XR5A 4TY9A 3ICLA 3BYRA 1S10A 3NMRA 4JI2F 4BC5A 3V9WA 3THYB 1RB0A 4KB1A 5C42A 4CF0A 3V9UA 4DQPA 1V5IB 4OHWA 2QSWA 5AQLA 4C6AA 3P3DA 4HTUA 4GRSA 4CJKA 4XDCA 1VK3A 4FNIA 4Q5VA 2AZ1A 2BA9A 4N41A 1ZBUA 3ETMA 4IRKA 1H3DA 2FJWA 1MN7A 4MFBA 4ZVSB 2F3JA 4H4OB 1O51A 2VJUA 4X62K 2L3MA 1S9EA 4CZEA 3OV7A 3H08A 1T9XA 2ZOFA 3K89A 4JRPA 1DLOA 3CIPA 4GKJJ 3IWLA 1Q18A 2H54B 4OKEA 1JJ4A 1HNVB 1N56A 1UPMB 5CY4A 3W60A 1UVIA 3HK2A 4H0TB 4WQ4A 5KPRA 1I94F 4TKTA 4FXVA 4RUCA 2GS8A 3SUQA 4LIRA 1UW4A 1WELA 3GBTA 1SL2A 1S9GB 3GE9A 4PKIA 2UUWA 5J2PA 2A0FB 4E1NA 1FK9B 1YHQS 4RBVA 2YCHA 4DTMA 2KU7A 4TN2A 1AYEA 2MTLA 5HATA 1WDDA 3ZXWA 3HXMA 4IG0B 3G82A 3HBTA 1M5KC 2E1RA 2B9YA 3L4IA 1RT4B 3M32A 2B7CB 3VEYA 2A1BA 2NLXA 4I2PB 5KFFA 1Q86O 1UVLA 3NGYA 1REVB 1YJ9N 3OBYA 3M2VB 1TTHB 3I55S 4P2MA 3M8PA 3D45A 1LWEA 2F1FA 1EKSA 2C42A 2UUTA 3LDOA 5CCLA 2NRZA 2DNNA 4YOWA 2UXCF 1ATRA 4O3RA 2KZZA 2DGOA 2HFUA 3BP8A 2AV5A 2VOPA 1FNOA 4ECYA 2GUIA 1HYSA 1VRUB 3BDPA 5HN0A 4FLXA 1N33F 1U25A 2RE2A 4WFBQ 5CZVA 2J9DA 2XGPA 2YX1A 4JKBA 1IR2A 3MM7B 5DZ6A 1D4XA 2NS1B 3C6AA 4LF7J 1QQCA 2XMTA 3MPYA 3OSNA 4J9SA 1OY8A 5ETRA 1WSIA 1RT4A 3TZZA 5F41A 3VGVA 3FZ2A 3NBPB 3BH7B 2YNGA 3JS6A 1EIYB 3H98A 2B6AB 1RT6B 5KFBA 1C0FA 3L2RA 2VQEK 3MWPA 1LK5A 3OBIA 2CVEA 2ZC4A 2CGJA 1OSDA 4G65A 2O8CA 1JKHB 4DBQA 4PXBA 4AL5A 1Z26A 3R5AA 3DOKB 1HNVA 2YNGB 3M8RA 2RILA 2JVRA 3MUVP 3L3CA 3X1LB 4JI3K 3J7AP 3ZTRA 5HAOA 4WKRA 5KPZA 4YR3A 3O3GA 5J2PB 3OYNA 2HIYA 3QJLA 1VQ7N 3TVYA 3S3MA 3L7UA 2PBDA 4NXMJ 1BUPA 4KH1B 1P27B 3M8WA 1X9MA 4IDHA 3LH2S 4CECA 3M7VA 4BRKA 2Z1HA 2UXDJ 1XBWA 3QLHB 1FJ7A 3MMAA 2E66A 3THXA 3THWA 2LKZA 1HBMB 4OYWA 1WDTA 1XNRK 1Q53A 5HLFA 3MXJA 1VC5A 2DVIA 4LSNB 4C0BA 3QWPA 4DF8A 4WQ4C 5LXYA 3P1GA 4H5TA 1HBOB 4MFBB 1EHWA 2DJWA 2HFVA 4CVNE 3KKRA 2BJ3A 3CYMA 3QNWB 4X66K 4GY2B 4JI4K 1NSQA 3S1TA 4ZVRB 2E9TA 2PYLA 3OT9A 5LJVA 5I42A 5E3QA 1OY6A 4CQ1A 1D1UA 3H5YA 3VAGA 3WNHA 4DFJA 1PJ7A 1YBUA 5KGXA 2FBYA 3ZT3A 3CCRN 4O23A 2WONA 3EJMA 3O3LA 4DV6J 1FXXA 3CXCR 4KE5A 4NB4A 2RKIB 3BSCA 1RAHB 3GLJA 1HHTP 4FSVA 1FFGB 2V4QA 2QV6A 1J54A 3KNGA 5AQTA 4DUYJ 2IDOA 1Y11A 2X3GA 3SYZA 4DZ6A 3CCTA 5KT3A 2BXJA 5L1JA 3H6EA 4F4ZA 3AOAA 2WUSA 4HDHA 4JNEA 4DX6A 2UVRA 1P90A 1EETA 1YZ6A 3W5XA 1U24A 3ZZTA 2A1RA 4TQSA 4M3WA 3EZOA 3LWMA 3FLCO 4OKJA 1M5HA 3KJNB 1HQUA 2A42A 4HVJA 4B08A 4CEEA 3RRKA 2QYCA 3V81B 1S97A 1XNRJ 2WOMA 5FPEA 3D1QA 3S9HA 3SCIE 1XN9A 3QEIA 5F3ZA 1N0UA 1FRKA 2FLOA 5LJWA 1NG9A 1OYDA 3SCKE 1ZZNA 1Y0HA 1FF2A 1T7PA 2YX7A 3HL8A 3BV8A 3BB5A 3AVGA 1MDUB 2FVRA 1BISA 2VG6A 4ANEA 3VEVA 1R8CA 2QMWA 2OYQA 2PI4A 2MJUA 4ECSA 1RCXB 2E5JA 3ZT1A 2KFYA 3ZLJA 4H4KC 3MECA 3KLGA 4DSFA 1NH8A 3VA0A 2QK9A 5DM6Q 4BR2A 4M1KA 3OTEA 1XMQK 4GMKA 5HVFA 1FO1A 4ILRA 4FVCA 3CF5L 1IWAA 1VSDA 1P8GA 4WYWA 4FS1A 4LRDA 5BRFA 1HHQA 3QGGA 1SI9A 2UXBK 4NI2B 2PMZD 2MQLA 2EC2A 3NE6A 2CQIA 2P9GA 1H38A 3WUHA 2PIIA 1N8RO 1ZETA 4QR2A 5GMDA 3PY8A 1DTTB 3JQJA 2VWJA 3C6UA 1UAXA 3V6JA 3CD0A 2WVFA 2BX6A 3L7PA 3C6HA 1S0VA 3LDQA 3D6HB 2RQ4A 4DQIA 1L3SA 3D0HE 3K0SA 3VAIA 4GC7A 2YBVA 2BDPA 1BIZA 1JQGA 1DTQB 4RW6A 2M2BA 1TV6B 2WONB 3PJXA 4WTOB 2V8GA 2APOA 2ATQA 2A10A 3BYPA 2JLFA 3AVNA 4Q7AA 3T19A 2LFVA 4LF9K 1K1SA 2IIHA 2W4DA 2G2ZA 2CJYB 2Z2MA 2AJFE 2ROGA 5F8MA 3CFPA 4NZ7A 3KLHA 1VQ9S 3I87A 1TFYA 2OSRA 1TL7A 3OVAA