3T7ZA

Structure of methanocaldococcus jannaschii nop n-terminal domain
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
119
structure length
119
Chain Sequence
MIYVTFTPYGAFGVKDNKEVSGLEDIEYKKLFNEEEIPDIMFKLKTQPNKIADELKEEWGDEIKLETLSTEPFNIGEFLRNNLFKVGKELGYFNNYDEFRKKMHYWSTELTKKVIKSYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein Nop 56/58
publication title Structurally Conserved Nop56/58 N-terminal Domain Facilitates Archaeal Box C/D Ribonucleoprotein-guided Methyltransferase Activity.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein binding
total genus 40
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.220 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3t7zA00
3NVKA 5GIOA 2NNWA 5GIPA 4BY9C 3NVMA 3PLAA 3NMUA 3ID6A 5GINA 3T7ZA
chains in the Genus database with same CATH superfamily
4CHZA 4DFKA 1D9DA 3LDOA 1M90O 3AY9A 3CD6N 1NK0A 3VQ5A 5LL6Z 3VQAA 2QEXN 3RSEB 1UA1A 1NK6A 4TSXA 5FLXO 1J6ZA 5HROA 1NMDA 2E8AA 3VTIA 5J2NA 3THWB 4WFAL 4R79A 3H1VX 3MCPA 1D5AA 1J9AA 4I6MB 5GADP 4Z4GA 3KK3A 2QKBA 4FO0A 3SUOA 3WEEA 4LH4A 3K9JA 3OYLA 5DM6L 2O8BB 2YJFA 3PSFA 4DV1K 1U45A 4L8RB 4F4KA 4E1NA 3CFRA 3TTDA 3CCVN 1KAXA 3D2FA 5EXWA 4K0KK 2KKZA 4JD2B 3WXLA 3L2UA 4WQ4C 5AQHA 4LY7A 4JI4K 3PSIA 3TAFA 2NZTA 2UXBK 3P4IA 4CK1A 5I42A 2HHSA 4CK3A 1QQCA 3LP0A 4DTMA 4KHSA 1G15A 2HHVA 3QETA 1TL3A 4DU1A 4JK7A 2RF2A 1NK7A 5F1XA 2AA4A 4Q5VA 3OYFA 1NNEA 3H1QA 1NGFA 4CEEA 3TTFA 1NG9A 1D9FA 4YFUA 1VSJA 4C8OA 4GKJK 1JKHA 3L3UA 2D0PA 5AQRA 2Q97A 3E01A 4JS4A 2B6AA 4GVMA 1GLEG 1VQKN 1VHXA 4BG9A 3OYBA 3LDNA 4KTQA 4CZGA 4IG0A 4DQIA 2ITGA 3D6RA 1F21A 3S41A 3UKUB 4I9QA 1GOBA 1SV5A 2A41A 4BVOA 4FJIA 4NCGA 1NLVA 4QS9A 3GDQA 4N5SA 1TAUA 4CEZA 1NK5A 2W41A 5HL7L 3SBGA 4CECA 2VG5A 2XY7A 2O8DB 1S1XA 2DFFA 2Q1NA 2UXCK 2HSTA 2CGLA 4BACA 2P5GA 2QWLA 2VG7A 5AQYA 5BPNA 1NGHA 2IVNA 4EFHA 3CJBA 4LF9K 3EL2A 4BRFA 1NGDA 4DSIA 1RBVA 1TUYA 4BC4A 3PIOL 3HL8A 3GE1A 5FPEA 5HRRA 1KFDA 3QNNA 3O6WA 5GAHP 1R0AA 1KVCA 4A62A 4DTUA 4CBXA 4K8ZA 1S6QA 4IEEA 3PUFA 3K5NA 2YHAA 4B3MK 4GVEA 3NVKA 4WYBA 3QB0A 3OYKA 3QEIA 5KQ8A 3CERA 4X62K 4Q0BA 2QTDA 3WQUA 4PKHA 5FDLA 4CZMA 3SAFA 1Z25A 3QIOA 1W7AA 2P1JA 2UUBK 2P9SB 4CFDA 3CQYA 2KFNA 4M3XA 3T19A 3M8PA 1ZBHA 5BPLA 4H0XB 2GWKA 3O1WA 4B3SK 3ULDA 2WOMA 3LDLA 4YORA 1EKEA 1JLEA 3T7ZA 3ZT2A 1SAZA 4JI6K 2I7NA 3MN7A 1XUPO 3C7NB 4FWRA 4H5RA 3EE9A 4JN4A 3TAEA 1EP4A 3D2EB 3TU5A 4BWJA 3NF7A 3BDPA 4J2AA 4CGDA 1T7PA 1JLFA 4DQ8A 3QO9A 1YVNA 4O8KA 3EKSA 3CJAA 1BI4A 3SUPA 5KI6A 2YNGA 4JRPA 3GG4A 4FW2A 2P9NB 3HI0A 4I9LA 3J80O 4DUYK 5CZ1A 3CJ7A 2W6KA 1L5UA 1VQ5N 2F8SA 5HP1A 4B9QA 3KWIA 3LWLA 5MLCQ 2QWNA 1RTJA 3ID6A 4DR7K 5JS1A 4CJUA 2LSNA 2QXLA 4BR2A 5C10A 3VEYA 3RRGA 1B92A 3KTQA 3ZETB 3WNEA 1WBBA 3O9TA 1BCOA 3O08A 4BRMA 4IDHA 4DTJA 4KHQA 2E6MA 3CCMN 1X9SA 5LY3A 4JKBA 4OKEA 1U2VA 4CF9A 2NRXA 3B6OA 3DLEA 2ZJQL 1V4SA 4CIFA 2R7YA 4BR5A 4IG3A 3OYNA 1LV5A 1LWEA 1FKOA 3SPZA 3ZSWA 3QDKA 4EZ6A 4FJ5A 4BE0A 2GELA 2IDOA 3BZCA 1KD1O 2OZSA 1IBKK 3MDQA 3THXA 4DQSA 3E9PA 4H5VA 3AVMA 4JI8K 4FJXA 2BTFA 3VA3A 3P39A 2FSKA 4M3WA 1VAZA 2PYLA 4W5QA 3FZLA 3CPWM 4OKKA 4EHUA 4CHYA 3AVBA 2P9KA 1L3TA 3D7EO 5AQOA 1WLJA 4CF0A 2Q31A 4OPAA 2IC3A 4IO9L 2V52B 1C0UA 2RHKA 1RDBA 4HWIA 3VEXA 5B8HA 2GBZA 1S9GA 4YOUA 5M1NA 3O3HA 4FSVA 1C0TA 4GKKK 4CBWA 3LDQA 4CZIA 2J4RA 5GIOA 3PX0A 3WNHA 3OA9A 5M1FA 5AQUA 2F9TA 3HSCA 3JAMO 4CEOA 2VWBA 3AA5X 2DFEA 4CGHA 1XHXA 4BC3A 1GLDG 4IJNA 1W0HA 4FPAA 4DB3A 4RWTA 2ASPA 4IFVA 2WTUA 3A8YA 1SKWA 4FOIA 2CH6A 3N4PA 3EZ5A 3C95A 2QA4N 1S72N 4B9LA 2ZM6K 4Z4HA 1ASVA 3ZSQA 5AZIB 4CZJA 1D4XA 4GW6A 1NKCA 3HZ6A 1BUPA 1YXQA 4PL7A 3LP3A 4B9NA 5I9EB 2WFBA 4PQUA 4A5AA 4CVNE 3ZT3A 1NOZA 1RT7A 1REVA 3RR8A 4FCYA 2GX9A 4BGAA 3TI0A 4PL8A 5AJ3K 4QAGA 2F8TA 4BRQA 3U9ZA 3OYDA 1Z26A 3KJVA 3I8DA 1HJOA 3LALA 1T05A 4OVLA 3SUNA 2YV0X 1WSIA 3PO5A 3CHWA 3CJ9A 3CMEN 5DM7L 2FXUA 3QNOA 2PAVA 5TKYA 1C1CA 2QWOA 3VPZA 2E1ZA 3HP6A 2G8IA 4FWMA 1TYQB 3QFPA 5ELZA 3HM8A 3V1OA 3VQ8A 3AVJA 3H46O 1IKYA 1BDGA 4NO7A 4CJVA 4AHRA 1CZ9A 1OH5A 5AQJA 4DS5A 1YT3A 2YX6A 4ZHRA 3U4LA 4CF2A 4DR6K 4E19A 1Q7YO 4LFAK 5C25A 2Q2RA 5KGWA 1BWFO 2OPSA 4JKDA 3S3MA 3KIOA 1RDWX 1VQPN 1J5OA 3THYA 1XI1A 1BA1A 4NLBA 5DMRA 4EP5A 3G10A 3U8XA 1QE1A 4DV5K 5AQLA 2BANA 3CCLN 2E20A 5HLFA 2W42A 2HHWA 3N4QA 1X9WA 3U3GA 5KPZA 1HYVA 3VETA 4NCAA 1BHLA 3RSEA 2HHHK 3M5RA 3NH1A 4H0TB 5HOOA 2HBLA 5HRNA 3SMPA 3AVLA 2CGJA 4IDKA 1EETA 1S1UA 3AV9A 3DOLA 4RW4A 3THWA 2DY4A 1ZC6A 1GLCG 3H6EA 1X1PA 4CJTA 4IFYA 3VEOA 4I6MA 4LF7K 4BRAA 3OJSA 4YOYA 4DV2K 4M3RA 4FZXC 2A40A 1N33K 3RVCA 2O8BA 3IKMA 3VF6A 4PY5A 2Z1JA 3AARA 5AFUA 2PFUA 4DV6K 4JD2A 2E5LK 3ZSZA 1XWLA 1QSYA 5J2PA 2XRIA 4B1YB 1B9FA 5AQKA 1R59O 2X6SA 4DU4A 4O8UA 3CPEA 2Y1IA 4GV6A 2NRZA 4U67L 2W40A 4KTWA 2PY5A 4NCBA 1Y64A 1E4FT 4RW9A 5CHIA 1TK0A 1L3VA 2O8FB 2KHOA 2ZGYA 1GLBG 4BC5A 5A2QO 2FF6A 4LF8K 4CEBA 3VF2A 4FWKA 4JI1K 1WSGA 3THYB 4HCBA 4W5TA 2I5JA 4NXMK 4CEAA 5EU7A 1QQNA 2XHBA 4Z4CA 4JK8A 4CBUA 3NGIA 3ZYYX 3NF8A 2QWRA 1HYSA 2HB5A 3UKUA 3AVCA 1XHZA 2EWSA 1LWFA 3HSTB 3CCJN 4DTSA 1NJWA 5HBMA 2O8DA 4CD1A 4C8KA 4CZKA 1WSEA 1VSKA 4DTOA 3NHGA 1WBDA 4EP4A 1Z6RA 5BRFA 3LPUA 1T3VA 3F9MA 3K57A 4DCHA 4DHYA 4H4MA 2A1SA 3MXJA 1VQ4N 1ZBSA 1A5WA 3A5NC 5CZ2A 4H0PA 3JYTA 3H3NO 1MWKA 2Q36A 2FBXA 3LM2A 1YAGA 3M6GA 2WUSA 1C1AA 4FWNA 3W0LA 3EKUA 4CZHA 3D45A 4E3SA 4FJMA 3NFAA 3G0ZA 3J81O 3G25A 1L3UA 1OH8A 4Z94A 1RT2A 1UWBA 4CFAA 4WFNL 4BDZA 1KVAA 3AGRA 4JLHA 4LC9B 3E1YA 4EIAA 4WCEL 3OW2M 4AQYK 2GV9A 4UY8O 2AJQA 3WT0A 4CJPA 3WUHA 3O9SA 2IS3A 4MLHA 3ZX3A 4WQ5C 2HBMA 2YNFA 4YOVA 3EE8A 5E84A 2UXDK 3MMVA 4N41A 2E88A 3OYIA 2YCHA 3V9SA 3L6QA 5IWAK 3F9KA 1QHTA 1IJJA 3WXJA 3C6HA 2Z1HA 1MA9B 1KAZA 3C7NA 4JHDB 4A2BA 3D2EA 1IKWA 1GLJO 3RWUA 3NH0A 3HOSA 4HUGA 3CQXA 4A59A 3TSPA 3L3VA 3Q7CA 5J2MA 1SKRA 2RN2A 2P9NA 2D0CA 3VA0A 4HTLA 1S5JA 3NGYA 3LZJA 2B4JA 1QQMA 4YOXA 3HPOA 1QZ6A 3R1XA 1NGBA 1K9MO 4CZLA 1K8KB 1ZYQA 4B1UB 1SL2A 1IKXA 4M3YA 2E2PA 3CCSN 4M7YA 3ULEB 4X65K 3BGRA 3F73A 5M1OA 4DSJA 3VF4A 1IO2A 3ZETA 3DLBA 1NGIA 4DTRA 1NK9A 2VWJA 1QHAA 4ISGA 4JK9A 4K42A 3CMAN 2YHBA 1DTTA 3OBYA 4DLGA 3ID8A 3T1YK 2Z1GA 4B3OA 2ASMA 4DR3K 3SNNA 1VQMN 4F2RA 3SQ0A 3SMSA 2O4IA 3LP2A 2G8KA 5KRTA 4BE1A 3CF5L 1NBWA 1RFQA 4OGEA 4M45A 3MECA 3NE6A 2OPPA 3J8AA 4O5FA 2E2QA 3ASMA 3HP9A 1NU0A 3FR0A 4ELUA 4ILGB 1TAQA 2OANA 3O5BA 3ENBA 1K6YA 4BDPA 4DMNA 4CHOA 2HHUA 5C2DA 5FRMA 4KREA 1GLAG 4BRLA 2FSJA 3DXKB 1YJWN 4BR7A 2JLEA 4BRCA 2D0AA 3T69A 1ATNA 3MEEA 1SL1A 2X74A 4H0OA 3CG7A 1DEJA 4BRDA 5J1EA 1SL0A 2NRVA 4LF4K 2VWKA 4YDUC 3O9RA 4CCHA 4B1VA 1JL1A 2KZMA 1NKBA 3TAGA 4JKGB 3KLFA 5LMNK 5AQXA 2F7TA 2A3ZA 4ICLA 3C0BA 3OVNA 3QICA 5JS2A 3FZMA 3SZ2A 4FJGA 1G99A 4CJ5A 5CYMA 2HMIA 5D3GA 5C15A 4J2BA 2HW3A 4KI4A 4Y1CA 5H1SQ 2QWQA 1RBSA 4F3TA 4PWDA 4BVPA 3DJCA 4LF6K 2A6AA 1XMQK 1E4GT 3CI5A 3VQ9A 3ZX2A 2E6LA 4DFPA 3ZSRA 3ZSVA 5AZIA 4E7LA 3IDHA 4A5BA 4DSEA 2HNZA 1HJRA 4BRNA 3OYHA 3QEWA 3MX2A 4KHPK 2ZF5O 4CJ3A 2IAJA 5KRSA 2HHXA 4CF1A 1NGEA 3MWPA 2I7PA 2P9IB 4M41A 5BR9A 1NKEA 2HVHA 4CZFA 2G8VA 5GIPA 4DSKA 3OHRA 5AR0A 1HMVA 2Y1JA 3HK2A 4RG8A 1HR0K 1U47A 4DUZK 4OX9K 3K2PA 3AA2A 5BREA 4FM1A 2D1KA 4CJKA 4IWVA 4J2EA 4JNEA 1N8RO 4LF5K 3KLHA 3P38A 5AQPA 1CXUA 4AHUA 4Z4EA 1RT3A 1TYQA 1C0GA 3OS2A 3K5LA 3CETA 4AILC 2QKKA 3AAQA 3O4WA 2G8UA 1KRPA 4Z0UA 3WXKA 3FZFA 1VSIA 4CK2A 1A5XA 3PX6A 2O8EB 1U6ZA 2ATQA 1WAFA 3MXIA 2ZQBA 3ALYA 1X3NA 3O4NA 3PY8A 3KK7A 4RW7A 1BO5O 2NLXA 3M3ZA 5F2RA 3CM5A 3AAPA 2HMPA 4C8NA 3I0SA 3SI6A 3DLKA 3MWTA 1VRUA 4FW1A 3P31A 4JI3K 2A5XA 2HBJA 3FZHA 5C12A 4M3UA 1X9MA 4M3ZA 2GEMA 3UKRA 5CYQA 4RW8A 4FLZA 4XH5A 4FJ8A 2JGUA 1JXBA 4Z4IA 4FJJA 4Y1DA 1QSSA 2FSNA 3OBWA 4CJ4A 2GUPA 5KPTA 2EX3A 5TKWA 2QWPA 2O4GA 5BN8A 4FLTA 5BRHA 2ASOA 3MK6A 1BA0A 4OJRA 1IBLK 4WQ4A 4JI7K 4E7KA 2QWMA 3P1GA 3TSQA 3DLLL 4ELVA 3WXMB 4YNQA 4IFEA 1Q18A 3V6DA 3L0QA 4M42A 2HBKA 2Q0RA 2G8FA 1UAXA 3RRHA 3H3OB 1UOCA 1TK5A 1J54A 3MEDA 5AQFA 1D8YA 3SJJA 1GLLO 3V81A 1QVGM 4QS8A 4CJWA 3PLAA 2ITMA 3SQ2A 3SAHA 2O8FA 4E1JA 3I55N 1IG9A 1YIJN 4EAHD 5C42A 2NUBA 4KPYA 3NF6A 3OS0A 3UIQA 1LOTB 4ISEA 3K5OA 1T6CA 4K8XA 3P83D 1HPMA 1L3SA 4UQGA 2F96A 3FE1A 3NDKA 4YOWA 4DSFA 4FJHA 1HRHA 3DLHA 4ZTFA 1HQUA 3VTHA 2ZJRL 1HX1A 1JXEA 4PKIA 3V1QA 3VENA 4JRQA 5GAGP 1O13A 1XQSC 4PHTX 4DTPA 1ITGA 3P5JA 3DYAA 1J53A 2Q0UA 4B8AB 4CJFA 4H03B 2P9UB 5FPMA 4DFJA 2Q3SA 3KLEA 4B1ZA 4BRPA 4OLAA 1SKSA 5JICA 2YHXA 3ZCMA 2OA8A 3MAQA 1WUAA 5AQWA 4MQ3A 1HYZA 2DTUA 3IMXA 2OTLN 5ADXA 3OY9A 3CCUN 2QK9A 3BP8A 3ATVA 4G1QA 2CH5A 3O1BA 3VQBA 4PA1A 1LW2A 5EY4A 5FRNA 3M8RA 3MXMA 1LCUA 4I2QA 3ISNC 3R9PA 3TAQA 4KO0A 5LJWA 3QFUA 1RILA 4H0YB 3CCQN 1VQ7N 4IEIA 1T8EA 3AVHA 4FWOA 4GV9A 1RBRA 3ZX0A 3I33A 3RMBA 4FLYA 4I7FA 4DSLA 2P9LB 2RPIA 3V1RA 4DWIA 3BEXA 5AZJB 2KFZA 4B1XB 1JJ2M 1QZ5A 1KCFA 4DR1K 3OYGA 1JCGA 1ZBLA 1JLGA 3V9WA 1BGXT 2IOCA 4FK0A 4AH9A 4JYAK 5EX5A 4MO5A 2IVPA 4KHUA 3UKRB 1QTMA 1I94K 3WXIA 2VYPA 4FL9A 4JHDA 3AVIA 3KWGA 4FK2A 3EEQA 1T6DA 3VEVA 3ZSOA 1N6QA 3SCXA 4O0IA 3AA3A 3F5TA 3ATUA 2ETJA 1C1BA 4CHNA 4CD3A 4AHSA 1HKCA 3QERA 1BU6O 3RMDA 4KBOA 4RCHA 1V4TA 2P9PB 4BROA 1NGGA 5HRPA 1KFSA 5KGXA 4NYFA 4DFMA 5AQSA 5C2FA 1RT5A 1K8KA 1KSPA 1OH6A 2HHTA 2BH1A 3SAGA 4NYNA 1VQ8N 2YKNA 3DM2A 4BREA 5C0YA 3WNGA 4A61A 3ULEA 1U4BA 4H4OA 4O5BA 3VQ7A 4HCCA 1XC3A 1S1WA 3G6EN 2DPNA 3U6FA 5HRSA 4IO8A 1TKDA 1RT1A 3AVKA 2G8HA 5JMVA 1Q9YA 4M7XA 1UA0A 3LPTA 1XC9A 4CF8A 4FZZA 1RNHA 4O44A 4CGGA 2HHQA 4DQRA 1OVYA 3O80A 4H5TA 3Q7BA 4BDYA 1DT9A 3R3LA 2OYQA 3ZLJA 1RDUA 1VQ9N 3V9UA 3SJHA 4WF9L 2ZJPL 4IOCL 2OPQA 1ZBIA 3ZEUB 4FJ7A 1XNQK 1BQMA 4L3QA 5BN9A 4QCLA 2ZGZA 3NVMA 1YJ9N 3L2QA 3VEZA 4KH4A 1LW0A 5JLFA 4KRFA 1S9EA 3OYCA 1H1VA 5AQZA 2O8CB 4DF4A 2GUIA 5E26A 3HOTA 2BDPA 2KTQA 3LM9A 4DKWA 4HUEA 1NJXA 1VSEA 3BZKA 3CC4N 4B1WB 1CZAN 5KQDA 4FM0A 5SZTA 3DXKA 2V7YA 3AVGA 2E2NA 3KZBA 1P90A 3DOKA 3QBXA 3TR8A 1VSFA 4B3RK 4DS4A 1RBTA 1SUQA 3E66A 4AHTA 4BRHA 4FK4A 1RDAA 5E41A 1YUWA 4DR5K 4FLXA 3M8SA 1NMNA 3MCAB 3A5MC 1IBMK 4W5NA 1TKXA 4JKGA 4KHYA 1ZBFA 3AO1A 3FFIA 4DQPA 4BQZA 3GOIA 1RDCA 1S1TA 2HVIA 1X9JA 4JKEA 4FWPA 1JCFA 4OPKA 1QS4A 4DV7K 1VQLN 2OPRA 3DLGA 3TABA 1N32K 2RKIA 4NLCA 3DI6A 1CZBA 4M3TA 1MDUB 1HQEA 1X3MA 3TPQA 4W5OA 1HNWK 1VQON 3J7ZO 1VSHA 1C6VA 4BE2A 3QMLA 5AQVA 4JI5K 2V51B 3HVTA 1S22A 3VQ6A 1WSJA 2HNYA 2YNHA 4AHVA 1S6PA 2DFHA 4BQLA 1ZXOA 2VG6A 1K8AO 3FLCO 3I0RA 5DK5A 1NM1A 3G4SN 2P9IA 1BG3A 1JCEA 3H08A 1OH7A 1RTDA 3F2KA 1BOTO 1ZBUA 4F9OA 2FBYA 1MU2A 4BRGA 1U49A 3VQ4A 1HUXA 1EWQA 4QS7A 2FC0A 2HF4A 3FFKB 1KVBA 1VQNN 1EO1A 1TV6A 3VQQA 3V4IA 3HYFA 4E89A 3ITHA 4CESA 3S9HA 2HF3A 3O3GA 2BE2A 3HVRA 3DAWA 3SQ4A 3IFRA 4BGBA 1RGIA 2OTJN 1Q8IA 5M1KA 1Q86O 2E2OA 1BL3A 4DV3K 1NGAA 3AO4A 4F8RA 4JI2K 1IG8A 3AGKA 2NRTA 2ZWHA 5JLHA 2O8EA 1HKGA 1VSLA 3FGUA 4JEPA 3K5MA 5CR4A 1RTIA 3C6TA 1C0MA 4RW6A 4CGJA 2YI1A 3NMUA 5GINA 2BGGA 2KZZA 5AFUH 4CGIA 4ILJA 1M1KO 4XEIA 3O3FA 1ASWA 5C24A 4OPJA 3LWMA 5AQGA 3QESA 3TANA 4GV3A 2FBTA 3CJ1A 3VQDA 4K25A 4DQQA 3T1HK 3DXMB 3IAYA 2V7ZA 4J2DA 2JWKA 3QEXA 2YJEA 3LAKA 4LH5A 1TKZA 4CHQA 1IV0A 4HVJA 3CC2N 3WQTA 4EHTA 4IOXA 3CCRN 2XY5A 3PX4A 4DG1A 4AM7A 4K41A 3VERA 1MWMA 1BIZA 2VQFK 4KAZA 1Q81O 3LANA 4A2AA 1GOAA 4R5PA 3VEWA 1JLAA 2W6LA 1I39A 2UU9K 4C8MA 1KLMA 3HPGA 4FVMA 3V9XA 4CGFA 4DU3A 3EYZA 4IZ9A 1YJNN 4CI6A 4KKOA 1W9HA 1BQNA 1TGOA 4JKAA 2G8WA 4NXNK 3HXMA 4KHNA 2NNWA 3H45C 5F0XA 4ILHA 5FPNA 3HT3A 3VESA 3QEPA 3KHYA 3R6MA 4AHCA 3T3FA 4MLEA 1GOCA 4CJ7A 3CXCM 4HHTA 3CYMA 3EZWA 3E9LA 4GNIA 4B08A 4H5NA 1W2BM 1QVFM 4FYDA 4E7JA 3BF3A 1KLNA 3M8QA 4ELTA 4EZ9A 1Y97A 1WNSA 3ZSYA 4LFBK 3L2WA 2P51A 3JXUA 4BRKA 3KKRA 3A0IX 5EOYA 1U48A 1P8ZA 4DTXA 4B9MA 2VGMA 5AQTA 3KD5E 1WSHA 4N47A 4B9UA 2YHWA 4BR9A 1NWKA 3J7AP 1DKGD 2D4WA 1LAWA 4JKHA 3QINA 3NF9A 4OLBA 1HNIA 3OYEA 3LP1A 3VGKA 1NOYA 2UYTA 4KFBA 4V19S 3K59A 4XH1A 5KPRA 4C1NK 4FJNA 2F9WA 2P9UA 4CJEA 2OZMA 1RDDA 4DV4K 2D5RA 4WE1A 4KB1A 3RMAA 3KK2A 1FK9A 4BY9C 3E9OA 2E1YA 1OKJA 3VQPA 1EWRA 3WEEB 1KXPA 2D0BA 4X66K 3D2FB 4H0VB 4CEFA 3CFPA 5JVHL 3KD1E 1KAYA 3V9ZA 4O0JA 2Z1IA 3TSUA 3C65A 4FLVA 3B8AX 3A5OC 3O9UA 4DR2K 3W3DA 3NGZA 1T44A 2P9LA 3TAMA 2GWJA 4PUOA 3OJUA 3JS6A 1NGJA 4NB4A 1VK0A 3IG1A 2KQ2A 3HPHA 4MFBA 4WQ5A 3OYAA 1CLQA 5LMUK 1ESVA 2X78A 2RE2A 5AZJA 3MX5A 3CJCA 4FWSA 4ISFA 5FROA 2XO7A 3O9QA 1OVQA 4YOTA 5KTQA 3PIPL 4C1NI 3RR7A 1SQKA 1FKPA 4HUFA 4M63C 3HTVA 4MDAA 2WBNA 1NGCA 3UE5A 5M1PA 1NK8A 3IS9A 3CM6A 3CQ8A 2YKMA 2AP1A 2NRHA 4OO1J 4IBNA 1S1VA 5IT9O 3HM9A 4FWQA 2HOEA 3S3OA 5CE3A 4H8KA 1HNZK 3OS1A 3VGLA 4QOZB 3NBPA 1YTUA 2P9PA 4JAXA 4CFCA 4HTUA 1QSLA 4JKFA 1B9DA 4B9VA 1JLQA 3AO2A 3SPYA 3LDSA 3KVGA 2EHGA 4LFCK 1RT6A 1ATSA 4CW7B 5GAEP 3DRRA 4E1MA 3TAPA 4LSNA 3AVNA 4CJRA 1HPZA 4CIEA 1EXQA 3TARA 1JL2A 1N5YA 4B3TK 3L4IA 5K14A 3CFOA 3TTCA 1YVUA 3A5LC 3DWLA 3HRGA 1CXQA 1DTQA 3U3YA 4OKJA 4FLUA 4B9TA 1EX4A 1WOQA 3NCIA 3L8BA 1IH7A 1QQOA 4KH6A 3WNFA 1ILYA 1HKBA 2QM1A 2A42A 2VCPA 4PKGA 3ZEUA 1RT4A 5I3UA 1XMOK 2P5OA 3ZT1A 4MO4A 3IRXA 3SLCA 4YY3K 2IVOA 5BRDA 3NAEA 1SZ2A 2O8CA 1U04A 2QXFA 1EQYA 4FWLA 4E0DA 4DLEA 3EN9A 4IOAL 3L4QA 4CJQA 2H3GX 4C23A 4N76A 3C6AA 4Z4FA 1DLOA 2F4VK 2QW9A 5CY4A 2PZSA 4N56A 1BISA 4LD0A 3BUZB 4KV8A 4DF8A 1BI4B 2FF3B 2IIRA 1TK8A 4BC2A 3OTOK 1RCHA 1KTQA 1A5VA 4YDUA 2HNDA 1FXXA 2KLAA 4CZEA 1TUUA 4AF1A 1I3AA 3CIPA 3AVAA 1Q9XA 4BWMA 1N36K 4F2SA 1LWCA 4BR0A 3JSMA 3QBWA 4LSLA 3ENOA 4E7HA 3QEVA 3UB5A 3VQEA 4OGCA 1HNVA 1JLBA 4J8FA 3MN5A 2UUCK 4CE9A 3DRSA 1NJZA 1JLCA 3VMFB 3ZT4A 4CJSA 2CGKA 3AVFA 4ID5A 1N34K 3CC7N 3K0SA 3K9KA 1VRTA 4BG8A 4ZTJA 1DGKN 4FLWA 1U2VB 5AQNA 5AQQA 4GMJB 3C94A 1WAJA 4OPHA 3GL1A 3SQ1A 4KI6A 4BR4A 1S3XA 1FJGK 1VQ6N 2A1RA 3O4QA 1IKVA 3LZIA 3SUQA 2BUPA 2IGIA 4A57A 3HBTA 3U9DA 3ZT0A 1GLFO 2FBVA 3C6UA 3THXB 3ZSXA 5FPDA 1NJYA 1WB9A 2D0OA 4WFBL 1SS6A 3MN9A 3B6PA 1T03A 4X64K 4FM2A 2ZD1A 2QI2A 1FW6A 1VSDA 3AO5A 2P9KB 3RTVA 2YHYA 4KHWA 1C0FA 4JKCA 1RBUA 3QIPA 3RMCA 3THVA 4MDBA 5AQMA 1J5EK 4CJLA 4G9ZA 3GBTA 4FPBA 3DRPA 2KW4A 4B9SA 1WSFA 2VGNA 3VQCA 3EY1A 4F3OA 1Z05A 3MEGA 3SV4A 2NRWA 3VGMA 3G71N 4U7BA 1YF5L 3SBTA 3PV8A 3KLIA 2WC9A 4CEQA 2FLOA 1ATRA 4O55A 4K43A 4FZYA 3MN6A 1KQSM 4YHHK 3NH2A 2XY8A 3L2RA 4C8LA 1HLUA 4Y0WA 4H5WA 4JI0K 1LAVA 1TKTA 3LL3A 1BCMA 4FVUA 3QLHA 2E4LA 3LAMA 4E7IA 1TL1A 4DV0K 3LDPA 3J7YP 3SK3A 5JVGL 4FXDA 1WN7A 4B8CA 4W5RA 1NJIO 4DR4K 1HNXK 4ID1A 3BF1A 2ZE2A 4BRIA 3DXMA 4GY2B 2JWLA 4CIGA 4CEDA 4FOEA 3BY5A 4XIUA 4CFBA 3TWHA 3SV3A 1YI2N 1ASUA 4DTNA 5T7BA 3AA4A 5AQIA 5BPMA 1YTAA 1W97L 1TVRA 2UUAK 5M1QA 3D0PA 3SYZA 3K58A 1VSMA 4FJKA 4IXCA 3R8EA 3PO4A 3HJFA 4XH4A 1K73O 3I8BA 4IJAA 1Q82O 3O8MA 5SWMA 4AM6A 4CHPA 2OCEA 4CERA 3OYMA 1NK4A 4KTZA 4FJLA 1RTHA 1KC8O 2XY6A 2VQEK 3KKSA 4IKFA 5LJVA 3HO1A 1YITN 2PBDA 3A2FA 3OYJA 2B5JA 3M1FA 3I56N 2X6NA 5BR8K 3DMJA 3FZKA 2YNIA 2WONA 4KH5A 3VN5A 4I2PA 3KK1A 3CCEN 3T1AA 1BIUA 4O4GA 1O1WA 2GTDA 5EVZA 4RTFD 1E3MA 1YHQN 2NRRA 2P9SA 4JV5K 3IUCA 5ADXH 3L2VA 3EO3A 1XNRK 3S3NA 4FJ9A 4JS5A 2PYJA 3DLRA 3VOVA 3AO3A 3KLGA 5J2QA 3ENHA 4KB0A
chains in the Genus database with same CATH topology
2Q0RA 3VEOA 4CJ7A 3CXCM 4I6MA 3LDOA 3EZWA 3H3OB 3E9LA 4GNIA 4BRAA 4H5NA 4YOYA 1W2BM 1M90O 1QVFM 2A40A 3AY9A 3BF3A 3CD6N 5AQFA 3RVCA 1GLLO 2QEXN 3RSEB 1QVGM 4QS8A 3IKMA 3VF6A 3PLAA 3AARA 2ITMA 5AFUA 2PFUA 3JXUA 4BRKA 1J6ZA 3SAHA 1NMDA 2E8AA 3VTIA 3A0IX 4JD2A 4E1JA 3I55N 4WFAL 5EOYA 4R79A 1P8ZA 1YIJN 4EAHD 2VGMA 5AQTA 3H1VX 4B1YB 3MCPA 4I6MB 5GADP 5AQKA 1R59O 2YHWA 4BR9A 1NWKA 4FO0A 1DKGD 2D4WA 3CPEA 4O8UA 4JKHA 1LOTB 4GV6A 2NRZA 4ISEA 3WEEA 1T6CA 4U67L 2W40A 3K9JA 3VGKA 1HPMA 5DM6L 2UYTA 2YJFA 1Y64A 3FE1A 4XH1A 1E4FT 5KPRA 4C1NK 4YOWA 2F9WA 2P9UA 3TTDA 5CHIA 3CCVN 1KAXA 2KHOA 3D2FA 5EXWA 2ZGYA 1GLBG 2KKZA 4JD2B 3VTHA 3WXLA 4BC5A 2ZJRL 4WQ4C 1HX1A 4PKIA 2FF6A 5AQHA 3VENA 5GAGP 3VF2A 4BY9C 4FWKA 1O13A 1XQSC 3E9OA 4PHTX 2NZTA 2E1YA 1OKJA 3P4IA 3WEEB 1KXPA 1QQNA 2Q0UA 4JK8A 4JK7A 4CBUA 4H03B 2P9UB 5FPMA 3ZYYX 5F1XA 4B1ZA 4BRPA 2AA4A 3D2FB 4H0VB 5JICA 3H1QA 2QWRA 2YHXA 1NGFA 3TTFA 5JVHL 3UKUA 1KAYA 1WUAA 5AQWA 2D0PA 3TSUA 5AQRA 3C65A 3IMXA 2OTLN 2EWSA 5ADXA 3CCUN 2Q97A 3BP8A 3CCJN 3ATVA 2CH5A 1GLEG 3B8AX 3O1BA 1VQKN 5EY4A 4CD1A 3A5OC 3O9UA 4BG9A 4CZKA 3LDNA 3W3DA 2P9LA 1LCUA 1T44A 2GWJA 3R9PA 1Z6RA 4CZGA 5BRFA 3JS6A 5LJWA 1NGJA 4NB4A 4WQ5A 3QFUA 3CCQN 1T3VA 4H0YB 1VQ7N 1ESVA 3D6RA 2RE2A 3F9MA 4IEIA 3S41A 3MX5A 3UKUB 3CJCA 4FWSA 4ISFA 2A41A 4FWOA 4BVOA 4DCHA 4DHYA 4GV9A 1NLVA 4QS9A 3GDQA 3O9QA 3ZX0A 2W41A 1VQ4N 4YOTA 3I33A 1ZBSA 5HL7L 4C1NI 3SBGA 3PIPL 3A5NC 2Q1NA 1SQKA 2HSTA 2P9LB 4H0PA 2CGLA 4M63C 3H3NO 2QWLA 3HTVA 4MDAA 1MWKA 2Q36A 5AQYA 5BPNA 1NGHA 2IVNA 2WBNA 1NGCA 3BEXA 4EFHA 3LM2A 1YAGA 3M6GA 2WUSA 3CJBA 4FWNA 3UE5A 3EKUA 3EL2A 3W0LA 4CZHA 5AZJB 4BRFA 5M1PA 4B1XB 1NGDA 1QZ5A 1JJ2M 2AP1A 1TUYA 1JCGA 2NRHA 4BC4A 4OO1J 3G25A 3PIOL 4Z94A 3GE1A 5FPEA 4WFNL 5EX5A 4MO5A 2IVPA 4FWQA 3AGRA 2HOEA 3O6WA 3UKRB 5GAHP 3WXIA 5CE3A 4LC9B 2VYPA 3E1YA 4FL9A 3VGLA 4A62A 4CBXA 4EIAA 2P9PA 4JAXA 4JHDA 4WCEL 4IEEA 4JKFA 3KWGA 3OW2M 4UY8O 3WT0A 1T6DA 4GVEA 3VEVA 3KVGA 4WYBA 3NVKA 3WUHA 3O9SA 3QB0A 5KQ8A 1ATSA 3CERA 4MLHA 3ZX3A 4WQ5C 2HBMA 2QTDA 3F5TA 3WQUA 4YOVA 4PKHA 3EE8A 4CZMA 5E84A 3SAFA 3MMVA 2E88A 3ATUA 2YCHA 5GAEP 4CD3A 3L6QA 1HKCA 2P9SB 1BU6O 1IJJA 3WXJA 3CQYA 3C6HA 4KBOA 1MA9B 1KAZA 3C7NA 4RCHA 1V4TA 2P9PB 3L4IA 4BROA 4JHDB 1NGGA 3TTCA 3A5LC 3DWLA 3D2EA 3HRGA 4A2BA 5BPLA 1GLJO 4H0XB 5AQSA 5C2FA 2GWKA 3O1WA 3HOSA 1K8KA 4YORA 3LDLA 3CQXA 4A59A 2BH1A 3TSPA 3SAGA 1VQ8N 3Q7CA 4BREA 5AZJA 5C0YA 1WOQA 3T7ZA 4A61A 3ULEA 1SAZA 2P9NA 2I7NA 3MN7A 1QQOA 1XC3A 3G6EN 1XUPO 2DPNA 3C7NB 4FWRA 3EE9A 4H5RA 4HTLA 4IO8A 4JN4A 4KH6A 4YOXA 1QQMA 1ILYA 1HKBA 1QZ6A 2QM1A 2A42A 3D2EB 5JMVA 2VCPA 4PKGA 3TU5A 4M7XA 3ZEUA 3R1XA 4MO4A 1NGBA 1K9MO 4CZLA 4DQ8A 1OVYA 1K8KB 1YVNA 3O80A 4H5TA 3EKSA 4O8KA 3CJAA 3SLCA 4B1UB 3Q7BA 2IVOA 5BRDA 1DT9A 1SZ2A 4FWLA 1EQYA 2E2PA 3R3LA 3CCSN 3EN9A 4M7YA 3ULEB 3GG4A 4IOAL 2P9NB 3L4QA 5M1OA 3HI0A 2H3GX 1RDUA 3VF4A 4C23A 1VQ9N 3C6AA 3ZETA 3SJHA 3CJ7A 4WF9L 1NGIA 2ZJPL 4IOCL 2QW9A 1VQ5N 1QHAA 4ISGA 4JK9A 3ZEUB 4K42A 4B9QA 3KWIA 4L3QA 5BN9A 3BUZB 2ZGZA 5MLCQ 3CMAN 3NVMA 1YJ9N 2QWNA 3ID6A 3VEZA 4KH4A 5JLFA 2FF3B 2IIRA 2QXLA 3OBYA 4BC2A 1H1VA 3ID8A 5AQZA 4BR2A 2ASMA 5C10A 5E26A 3HOTA 4YDUA 3VEYA 2KLAA 4CZEA 3LM9A 4DKWA 1VQMN 1TUUA 4AF1A 3CIPA 3ZETB 3SMSA 3O9TA 3O08A 4BRMA 4BR0A 3CC4N 3QBWA 3ENOA 4IDHA 3UB5A 4B1WB 1CZAN 3CF5L 1NBWA 5KQDA 3DXKA 2V7YA 5LY3A 1RFQA 4JKBA 2E2NA 3KZBA 1P90A 3CCMN 3QBXA 1U2VA 3J8AA 4O5FA 2NRXA 2E2QA 2ZJQL 3FR0A 1V4SA 4ILGB 4J8FA 2OANA 3E66A 3MN5A 4BRHA 4BR5A 3O5BA 3ENBA 3VMFB 1YUWA 5C2DA 3MCAB 3A5MC 1GLAG 2CGKA 3QDKA 4BRLA 2FSJA 4JKGA 3CC7N 3DXKB 2GELA 3K9KA 1KD1O 4BG8A 1DGKN 3MDQA 1U2VB 5AQNA 3E9PA 4H5VA 5AQQA 4BR7A 1YJWN 4BRCA 4OPHA 3GL1A 2BTFA 3T69A 4BQZA 3GOIA 1ATNA 1X9JA 3P39A 4FWPA 1JCFA 2FSKA 4JKEA 1VQLN 1VAZA 4BR4A 4H0OA 1DEJA 1S3XA 4BRDA 3FZLA 3CPWM 1VQ6N 2NRVA 4NLCA 4YDUC 3O9RA 4EHUA 2P9KA 4B1VA 3D7EO 5AQOA 2Q31A 1MDUB 4OPAA 1X3MA 3TPQA 4JKGB 4IO9L 2V52B 2BUPA 1VQON 4A57A 3HBTA 2F7TA 5AQXA 3U9DA 1GLFO 2RHKA 4HWIA 2A3ZA 3VEXA 3J7ZO 5B8HA 5FPDA 2D0OA 3C0BA 4WFBL 1SS6A 3QICA 3MN9A 3FZMA 4YOUA 5M1NA 1G99A 3QMLA 5AQVA 4FSVA 2V51B 1S22A 5C15A 4CBWA 3LDQA 4CZIA 2QI2A 5H1SQ 2J4RA 2P9KB 2QWQA 5GIOA 3OA9A 4BQLA 1ZXOA 5M1FA 2YHYA 1K8AO 1C0FA 5AQUA 4JKCA 4BVPA 3FLCO 2F9TA 3HSCA 1NM1A 3G4SN 2P9IA 1BG3A 4MDBA 1JCEA 5AQMA 2VWBA 3DJCA 4G9ZA 3GBTA 4FPBA 2A6AA 1E4GT 1BOTO 2VGNA 3F2KA 3CI5A 4F9OA 3ZX2A 1Z05A 4BRGA 4BC3A 1HUXA 4QS7A 2NRWA 5AZIA 1GLDG 3IDHA 4IJNA 3VGMA 4A5BA 4MLEA 4U7BA 1YF5L 3G71N 4FPAA 3SBTA 4BRNA 4DB3A 2HF4A 3MX2A 3FFKB 2ASPA 2ZF5O 4RWTA 1VQNN 2WC9A 1EO1A 3A8YA 2FLOA 1NGEA 4FOIA 3MWPA 2CH6A 1ATRA 3N4PA 2I7PA 2P9IB 5BR9A 4K43A 4CZFA 3MN6A 1KQSM 2QA4N 1S72N 2HF3A 5GIPA 3OHRA 5AR0A 3DAWA 5AZIB 1D4XA 1HLUA 4CZJA 3HZ6A 1BUPA 1YXQA 4Y0WA 3IFRA 4BGBA 4PL7A 1RGIA 2OTJN 5M1KA 1Q86O 4H5WA 2E2OA 1NGAA 3LL3A 4FVUA 5I9EB 2WFBA 4A5AA 1IG8A 3AGKA 2NRTA 2ZWHA 5BREA 3LDPA 5JLHA 2D1KA 1HKGA 4IWVA 3SK3A 5JVGL 4JNEA 1N8RO 1NJIO 3FGUA 4JEPA 2GX9A 3P38A 4BGAA 5AQPA 3BF1A 5CR4A 4PL8A 4BRIA 1TYQA 1C0GA 3DXMA 4GY2B 2JWLA 4BRQA 2YI1A 3CETA 4FOEA 3U9ZA 3AAQA 3O4WA 3NMUA 5GINA 1HJOA 1YI2N 5AFUH 4ILJA 3CHWA 3CJ9A 3FZFA 5AQIA 3WXKA 5BPMA 5DM7L 4XEIA 1M1KO 3CMEN 1W97L 1U6ZA 5M1QA 2FXUA 2PAVA 5TKYA 2QWOA 4IXCA 3R8EA 3VPZA 4GV3A 2E1ZA 1X3NA 5AQGA 3KK7A 4XH4A 3CJ1A 4K25A 1K73O 3I8BA 1BO5O 2NLXA 4FWMA 1TYQB 3M3ZA 3QFPA 4IJAA 3DXMB 5F2RA 3O8MA 1Q82O 5ELZA 3HM8A 2V7ZA 4AM6A 2JWKA 3AAPA 2HMPA 2YJEA 3H46O 1KC8O 1BDGA 3MWTA 4NO7A 3P31A 3CC2N 2A5XA 3WQTA 2HBJA 3FZHA 5AQJA 5C12A 4EHTA 5LJVA 2YX6A 4IOXA 3CCRN 1YITN 4AM7A 4K41A 2PBDA 3VERA 1MWMA 2GEMA 3U4LA 3UKRA 3M1FA 1Q81O 1Q7YO 3I56N 2Q2RA 4XH5A 1BWFO 4A2AA 4JKDA 3VEWA 3FZKA 1RDWX 1VQPN 4KH5A 2FSNA 3OBWA 3CCEN 1BA1A 4NLBA 3U8XA 2GUPA 5KPTA 5TKWA 2GTDA 2QWPA 4IZ9A 5AQLA 5EVZA 5BN8A 4CI6A 4RTFD 5BRHA 2ASOA 2E20A 1YJNN 3CCLN 3MK6A 1BA0A 4JKAA 3N4QA 5KPZA 1YHQN 2NNWA 3VETA 3H45C 2NRRA 3RSEA 5F0XA 3M5RA 2P9SA 4ILHA 5FPNA 4WQ4A 4H0TB 5HOOA 2QWMA 2HBLA 3SMPA 3TSQA 3IUCA 2CGJA 5ADXH 3VESA 3DLLL 3EO3A 3KHYA 3R6MA 3WXMB 4IFEA 1Q18A 1ZC6A 1GLCG 3VOVA 3L0QA 3ENHA 3H6EA 2HBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVK A;  5GIO A;  2NNW A;  5GIP A;  4BY9 C;  3NVM A;  3PLA A;  3NMU A;  3ID6 A;  5GIN A;  3T7Z A; 
#chains in the Genus database with same CATH topology
 4CHZ A;  4DFK A;  1D9D A;  3LDO A;  1M90 O;  3AY9 A;  3CD6 N;  1NK0 A;  3VQ5 A;  5LL6 Z;  3VQA A;  2QEX N;  3RSE B;  1UA1 A;  1NK6 A;  4TSX A;  5FLX O;  1J6Z A;  5HRO A;  1NMD A;  2E8A A;  3VTI A;  5J2N A;  3THW B;  4WFA L;  4R79 A;  3H1V X;  3MCP A;  1D5A A;  1J9A A;  4I6M B;  5GAD P;  4Z4G A;  3KK3 A;  2QKB A;  4FO0 A;  3SUO A;  3WEE A;  4LH4 A;  3K9J A;  3OYL A;  5DM6 L;  2O8B B;  2YJF A;  3PSF A;  4DV1 K;  1U45 A;  4L8R B;  4F4K A;  4E1N A;  3CFR A;  3TTD A;  3CCV N;  1KAX A;  3D2F A;  5EXW A;  4K0K K;  2KKZ A;  4JD2 B;  3WXL A;  3L2U A;  4WQ4 C;  5AQH A;  4LY7 A;  4JI4 K;  3PSI A;  3TAF A;  2NZT A;  2UXB K;  3P4I A;  4CK1 A;  5I42 A;  2HHS A;  4CK3 A;  1QQC A;  3LP0 A;  4DTM A;  4KHS A;  1G15 A;  2HHV A;  3QET A;  1TL3 A;  4DU1 A;  4JK7 A;  2RF2 A;  1NK7 A;  5F1X A;  2AA4 A;  4Q5V A;  3OYF A;  1NNE A;  3H1Q A;  1NGF A;  4CEE A;  3TTF A;  1NG9 A;  1D9F A;  4YFU A;  1VSJ A;  4C8O A;  4GKJ K;  1JKH A;  3L3U A;  2D0P A;  5AQR A;  2Q97 A;  3E01 A;  4JS4 A;  2B6A A;  4GVM A;  1GLE G;  1VQK N;  1VHX A;  4BG9 A;  3OYB A;  3LDN A;  4KTQ A;  4CZG A;  4IG0 A;  4DQI A;  2ITG A;  3D6R A;  1F21 A;  3S41 A;  3UKU B;  4I9Q A;  1GOB A;  1SV5 A;  2A41 A;  4BVO A;  4FJI A;  4NCG A;  1NLV A;  4QS9 A;  3GDQ A;  4N5S A;  1TAU A;  4CEZ A;  1NK5 A;  2W41 A;  5HL7 L;  3SBG A;  4CEC A;  2VG5 A;  2XY7 A;  2O8D B;  1S1X A;  2DFF A;  2Q1N A;  2UXC K;  2HST A;  2CGL A;  4BAC A;  2P5G A;  2QWL A;  2VG7 A;  5AQY A;  5BPN A;  1NGH A;  2IVN A;  4EFH A;  3CJB A;  4LF9 K;  3EL2 A;  4BRF A;  1NGD A;  4DSI A;  1RBV A;  1TUY A;  4BC4 A;  3PIO L;  3HL8 A;  3GE1 A;  5FPE A;  5HRR A;  1KFD A;  3QNN A;  3O6W A;  5GAH P;  1R0A A;  1KVC A;  4A62 A;  4DTU A;  4CBX A;  4K8Z A;  1S6Q A;  4IEE A;  3PUF A;  3K5N A;  2YHA A;  4B3M K;  4GVE A;  3NVK A;  4WYB A;  3QB0 A;  3OYK A;  3QEI A;  5KQ8 A;  3CER A;  4X62 K;  4Q0B A;  2QTD A;  3WQU A;  4PKH A;  5FDL A;  4CZM A;  3SAF A;  1Z25 A;  3QIO A;  1W7A A;  2P1J A;  2UUB K;  2P9S B;  4CFD A;  3CQY A;  2KFN A;  4M3X A;  3T19 A;  3M8P A;  1ZBH A;  5BPL A;  4H0X B;  2GWK A;  3O1W A;  4B3S K;  3ULD A;  2WOM A;  3LDL A;  4YOR A;  1EKE A;  1JLE A;  3T7Z A;  3ZT2 A;  1SAZ A;  4JI6 K;  2I7N A;  3MN7 A;  1XUP O;  3C7N B;  4FWR A;  4H5R A;  3EE9 A;  4JN4 A;  3TAE A;  1EP4 A;  3D2E B;  3TU5 A;  4BWJ A;  3NF7 A;  3BDP A;  4J2A A;  4CGD A;  1T7P A;  1JLF A;  4DQ8 A;  3QO9 A;  1YVN A;  4O8K A;  3EKS A;  3CJA A;  1BI4 A;  3SUP A;  5KI6 A;  2YNG A;  4JRP A;  3GG4 A;  4FW2 A;  2P9N B;  3HI0 A;  4I9L A;  3J80 O;  4DUY K;  5CZ1 A;  3CJ7 A;  2W6K A;  1L5U A;  1VQ5 N;  2F8S A;  5HP1 A;  4B9Q A;  3KWI A;  3LWL A;  5MLC Q;  2QWN A;  1RTJ A;  3ID6 A;  4DR7 K;  5JS1 A;  4CJU A;  2LSN A;  2QXL A;  4BR2 A;  5C10 A;  3VEY A;  3RRG A;  1B92 A;  3KTQ A;  3ZET B;  3WNE A;  1WBB A;  3O9T A;  1BCO A;  3O08 A;  4BRM A;  4IDH A;  4DTJ A;  4KHQ A;  2E6M A;  3CCM N;  1X9S A;  5LY3 A;  4JKB A;  4OKE A;  1U2V A;  4CF9 A;  2NRX A;  3B6O A;  3DLE A;  2ZJQ L;  1V4S A;  4CIF A;  2R7Y A;  4BR5 A;  4IG3 A;  3OYN A;  1LV5 A;  1LWE A;  1FKO A;  3SPZ A;  3ZSW A;  3QDK A;  4EZ6 A;  4FJ5 A;  4BE0 A;  2GEL A;  2IDO A;  3BZC A;  1KD1 O;  2OZS A;  1IBK K;  3MDQ A;  3THX A;  4DQS A;  3E9P A;  4H5V A;  3AVM A;  4JI8 K;  4FJX A;  2BTF A;  3VA3 A;  3P39 A;  2FSK A;  4M3W A;  1VAZ A;  2PYL A;  4W5Q A;  3FZL A;  3CPW M;  4OKK A;  4EHU A;  4CHY A;  3AVB A;  2P9K A;  1L3T A;  3D7E O;  5AQO A;  1WLJ A;  4CF0 A;  2Q31 A;  4OPA A;  2IC3 A;  4IO9 L;  2V52 B;  1C0U A;  2RHK A;  1RDB A;  4HWI A;  3VEX A;  5B8H A;  2GBZ A;  1S9G A;  4YOU A;  5M1N A;  3O3H A;  4FSV A;  1C0T A;  4GKK K;  4CBW A;  3LDQ A;  4CZI A;  2J4R A;  5GIO A;  3PX0 A;  3WNH A;  3OA9 A;  5M1F A;  5AQU A;  2F9T A;  3HSC A;  3JAM O;  4CEO A;  2VWB A;  3AA5 X;  2DFE A;  4CGH A;  1XHX A;  4BC3 A;  1GLD G;  4IJN A;  1W0H A;  4FPA A;  4DB3 A;  4RWT A;  2ASP A;  4IFV A;  2WTU A;  3A8Y A;  1SKW A;  4FOI A;  2CH6 A;  3N4P A;  3EZ5 A;  3C95 A;  2QA4 N;  1S72 N;  4B9L A;  2ZM6 K;  4Z4H A;  1ASV A;  3ZSQ A;  5AZI B;  4CZJ A;  1D4X A;  4GW6 A;  1NKC A;  3HZ6 A;  1BUP A;  1YXQ A;  4PL7 A;  3LP3 A;  4B9N A;  5I9E B;  2WFB A;  4PQU A;  4A5A A;  4CVN E;  3ZT3 A;  1NOZ A;  1RT7 A;  1REV A;  3RR8 A;  4FCY A;  2GX9 A;  4BGA A;  3TI0 A;  4PL8 A;  5AJ3 K;  4QAG A;  2F8T A;  4BRQ A;  3U9Z A;  3OYD A;  1Z26 A;  3KJV A;  3I8D A;  1HJO A;  3LAL A;  1T05 A;  4OVL A;  3SUN A;  2YV0 X;  1WSI A;  3PO5 A;  3CHW A;  3CJ9 A;  3CME N;  5DM7 L;  2FXU A;  3QNO A;  2PAV A;  5TKY A;  1C1C A;  2QWO A;  3VPZ A;  2E1Z A;  3HP6 A;  2G8I A;  4FWM A;  1TYQ B;  3QFP A;  5ELZ A;  3HM8 A;  3V1O A;  3VQ8 A;  3AVJ A;  3H46 O;  1IKY A;  1BDG A;  4NO7 A;  4CJV A;  4AHR A;  1CZ9 A;  1OH5 A;  5AQJ A;  4DS5 A;  1YT3 A;  2YX6 A;  4ZHR A;  3U4L A;  4CF2 A;  4DR6 K;  4E19 A;  1Q7Y O;  4LFA K;  5C25 A;  2Q2R A;  5KGW A;  1BWF O;  2OPS A;  4JKD A;  3S3M A;  3KIO A;  1RDW X;  1VQP N;  1J5O A;  3THY A;  1XI1 A;  1BA1 A;  4NLB A;  5DMR A;  4EP5 A;  3G10 A;  3U8X A;  1QE1 A;  4DV5 K;  5AQL A;  2BAN A;  3CCL N;  2E20 A;  5HLF A;  2W42 A;  2HHW A;  3N4Q A;  1X9W A;  3U3G A;  5KPZ A;  1HYV A;  3VET A;  4NCA A;  1BHL A;  3RSE A;  2HHH K;  3M5R A;  3NH1 A;  4H0T B;  5HOO A;  2HBL A;  5HRN A;  3SMP A;  3AVL A;  2CGJ A;  4IDK A;  1EET A;  1S1U A;  3AV9 A;  3DOL A;  4RW4 A;  3THW A;  2DY4 A;  1ZC6 A;  1GLC G;  3H6E A;  1X1P A;  4CJT A;  4IFY A;  3VEO A;  4I6M A;  4LF7 K;  4BRA A;  3OJS A;  4YOY A;  4DV2 K;  4M3R A;  4FZX C;  2A40 A;  1N33 K;  3RVC A;  2O8B A;  3IKM A;  3VF6 A;  4PY5 A;  2Z1J A;  3AAR A;  5AFU A;  2PFU A;  4DV6 K;  4JD2 A;  2E5L K;  3ZSZ A;  1XWL A;  1QSY A;  5J2P A;  2XRI A;  4B1Y B;  1B9F A;  5AQK A;  1R59 O;  2X6S A;  4DU4 A;  4O8U A;  3CPE A;  2Y1I A;  4GV6 A;  2NRZ A;  4U67 L;  2W40 A;  4KTW A;  2PY5 A;  4NCB A;  1Y64 A;  1E4F T;  4RW9 A;  5CHI A;  1TK0 A;  1L3V A;  2O8F B;  2KHO A;  2ZGY A;  1GLB G;  4BC5 A;  5A2Q O;  2FF6 A;  4LF8 K;  4CEB A;  3VF2 A;  4FWK A;  4JI1 K;  1WSG A;  3THY B;  4HCB A;  4W5T A;  2I5J A;  4NXM K;  4CEA A;  5EU7 A;  1QQN A;  2XHB A;  4Z4C A;  4JK8 A;  4CBU A;  3NGI A;  3ZYY X;  3NF8 A;  2QWR A;  1HYS A;  2HB5 A;  3UKU A;  3AVC A;  1XHZ A;  2EWS A;  1LWF A;  3HST B;  3CCJ N;  4DTS A;  1NJW A;  5HBM A;  2O8D A;  4CD1 A;  4C8K A;  4CZK A;  1WSE A;  1VSK A;  4DTO A;  3NHG A;  1WBD A;  4EP4 A;  1Z6R A;  5BRF A;  3LPU A;  1T3V A;  3F9M A;  3K57 A;  4DCH A;  4DHY A;  4H4M A;  2A1S A;  3MXJ A;  1VQ4 N;  1ZBS A;  1A5W A;  3A5N C;  5CZ2 A;  4H0P A;  3JYT A;  3H3N O;  1MWK A;  2Q36 A;  2FBX A;  3LM2 A;  1YAG A;  3M6G A;  2WUS A;  1C1A A;  4FWN A;  3W0L A;  3EKU A;  4CZH A;  3D45 A;  4E3S A;  4FJM A;  3NFA A;  3G0Z A;  3J81 O;  3G25 A;  1L3U A;  1OH8 A;  4Z94 A;  1RT2 A;  1UWB A;  4CFA A;  4WFN L;  4BDZ A;  1KVA A;  3AGR A;  4JLH A;  4LC9 B;  3E1Y A;  4EIA A;  4WCE L;  3OW2 M;  4AQY K;  2GV9 A;  4UY8 O;  2AJQ A;  3WT0 A;  4CJP A;  3WUH A;  3O9S A;  2IS3 A;  4MLH A;  3ZX3 A;  4WQ5 C;  2HBM A;  2YNF A;  4YOV A;  3EE8 A;  5E84 A;  2UXD K;  3MMV A;  4N41 A;  2E88 A;  3OYI A;  2YCH A;  3V9S A;  3L6Q A;  5IWA K;  3F9K A;  1QHT A;  1IJJ A;  3WXJ A;  3C6H A;  2Z1H A;  1MA9 B;  1KAZ A;  3C7N A;  4JHD B;  4A2B A;  3D2E A;  1IKW A;  1GLJ O;  3RWU A;  3NH0 A;  3HOS A;  4HUG A;  3CQX A;  4A59 A;  3TSP A;  3L3V A;  3Q7C A;  5J2M A;  1SKR A;  2RN2 A;  2P9N A;  2D0C A;  3VA0 A;  4HTL A;  1S5J A;  3NGY A;  3LZJ A;  2B4J A;  1QQM A;  4YOX A;  3HPO A;  1QZ6 A;  3R1X A;  1NGB A;  1K9M O;  4CZL A;  1K8K B;  1ZYQ A;  4B1U B;  1SL2 A;  1IKX A;  4M3Y A;  2E2P A;  3CCS N;  4M7Y A;  3ULE B;  4X65 K;  3BGR A;  3F73 A;  5M1O A;  4DSJ A;  3VF4 A;  1IO2 A;  3ZET A;  3DLB A;  1NGI A;  4DTR A;  1NK9 A;  2VWJ A;  1QHA A;  4ISG A;  4JK9 A;  4K42 A;  3CMA N;  2YHB A;  1DTT A;  3OBY A;  4DLG A;  3ID8 A;  3T1Y K;  2Z1G A;  4B3O A;  2ASM A;  4DR3 K;  3SNN A;  1VQM N;  4F2R A;  3SQ0 A;  3SMS A;  2O4I A;  3LP2 A;  2G8K A;  5KRT A;  4BE1 A;  3CF5 L;  1NBW A;  1RFQ A;  4OGE A;  4M45 A;  3MEC A;  3NE6 A;  2OPP A;  3J8A A;  4O5F A;  2E2Q A;  3ASM A;  3HP9 A;  1NU0 A;  3FR0 A;  4ELU A;  4ILG B;  1TAQ A;  2OAN A;  3O5B A;  3ENB A;  1K6Y A;  4BDP A;  4DMN A;  4CHO A;  2HHU A;  5C2D A;  5FRM A;  4KRE A;  1GLA G;  4BRL A;  2FSJ A;  3DXK B;  1YJW N;  4BR7 A;  2JLE A;  4BRC A;  2D0A A;  3T69 A;  1ATN A;  3MEE A;  1SL1 A;  2X74 A;  4H0O A;  3CG7 A;  1DEJ A;  4BRD A;  5J1E A;  1SL0 A;  2NRV A;  4LF4 K;  2VWK A;  4YDU C;  3O9R A;  4CCH A;  4B1V A;  1JL1 A;  2KZM A;  1NKB A;  3TAG A;  4JKG B;  3KLF A;  5LMN K;  5AQX A;  2F7T A;  2A3Z A;  4ICL A;  3C0B A;  3OVN A;  3QIC A;  5JS2 A;  3FZM A;  3SZ2 A;  4FJG A;  1G99 A;  4CJ5 A;  5CYM A;  2HMI A;  5D3G A;  5C15 A;  4J2B A;  2HW3 A;  4KI4 A;  4Y1C A;  5H1S Q;  2QWQ A;  1RBS A;  4F3T A;  4PWD A;  4BVP A;  3DJC A;  4LF6 K;  2A6A A;  1XMQ K;  1E4G T;  3CI5 A;  3VQ9 A;  3ZX2 A;  2E6L A;  4DFP A;  3ZSR A;  3ZSV A;  5AZI A;  4E7L A;  3IDH A;  4A5B A;  4DSE A;  2HNZ A;  1HJR A;  4BRN A;  3OYH A;  3QEW A;  3MX2 A;  4KHP K;  2ZF5 O;  4CJ3 A;  2IAJ A;  5KRS A;  2HHX A;  4CF1 A;  1NGE A;  3MWP A;  2I7P A;  2P9I B;  4M41 A;  5BR9 A;  1NKE A;  2HVH A;  4CZF A;  2G8V A;  5GIP A;  4DSK A;  3OHR A;  5AR0 A;  1HMV A;  2Y1J A;  3HK2 A;  4RG8 A;  1HR0 K;  1U47 A;  4DUZ K;  4OX9 K;  3K2P A;  3AA2 A;  5BRE A;  4FM1 A;  2D1K A;  4CJK A;  4IWV A;  4J2E A;  4JNE A;  1N8R O;  4LF5 K;  3KLH A;  3P38 A;  5AQP A;  1CXU A;  4AHU A;  4Z4E A;  1RT3 A;  1TYQ A;  1C0G A;  3OS2 A;  3K5L A;  3CET A;  4AIL C;  2QKK A;  3AAQ A;  3O4W A;  2G8U A;  1KRP A;  4Z0U A;  3WXK A;  3FZF A;  1VSI A;  4CK2 A;  1A5X A;  3PX6 A;  2O8E B;  1U6Z A;  2ATQ A;  1WAF A;  3MXI A;  2ZQB A;  3ALY A;  1X3N A;  3O4N A;  3PY8 A;  3KK7 A;  4RW7 A;  1BO5 O;  2NLX A;  3M3Z A;  5F2R A;  3CM5 A;  3AAP A;  2HMP A;  4C8N A;  3I0S A;  3SI6 A;  3DLK A;  3MWT A;  1VRU A;  4FW1 A;  3P31 A;  4JI3 K;  2A5X A;  2HBJ A;  3FZH A;  5C12 A;  4M3U A;  1X9M A;  4M3Z A;  2GEM A;  3UKR A;  5CYQ A;  4RW8 A;  4FLZ A;  4XH5 A;  4FJ8 A;  2JGU A;  1JXB A;  4Z4I A;  4FJJ A;  4Y1D A;  1QSS A;  2FSN A;  3OBW A;  4CJ4 A;  2GUP A;  5KPT A;  2EX3 A;  5TKW A;  2QWP A;  2O4G A;  5BN8 A;  4FLT A;  5BRH A;  2ASO A;  3MK6 A;  1BA0 A;  4OJR A;  1IBL K;  4WQ4 A;  4JI7 K;  4E7K A;  2QWM A;  3P1G A;  3TSQ A;  3DLL L;  4ELV A;  3WXM B;  4YNQ A;  4IFE A;  1Q18 A;  3V6D A;  3L0Q A;  4M42 A;  2HBK A;  2Q0R A;  2G8F A;  1UAX A;  3RRH A;  3H3O B;  1UOC A;  1TK5 A;  1J54 A;  3MED A;  5AQF A;  1D8Y A;  3SJJ A;  1GLL O;  3V81 A;  1QVG M;  4QS8 A;  4CJW A;  3PLA A;  2ITM A;  3SQ2 A;  3SAH A;  2O8F A;  4E1J A;  3I55 N;  1IG9 A;  1YIJ N;  4EAH D;  5C42 A;  2NUB A;  4KPY A;  3NF6 A;  3OS0 A;  3UIQ A;  1LOT B;  4ISE A;  3K5O A;  1T6C A;  4K8X A;  3P83 D;  1HPM A;  1L3S A;  4UQG A;  2F96 A;  3FE1 A;  3NDK A;  4YOW A;  4DSF A;  4FJH A;  1HRH A;  3DLH A;  4ZTF A;  1HQU A;  3VTH A;  2ZJR L;  1HX1 A;  1JXE A;  4PKI A;  3V1Q A;  3VEN A;  4JRQ A;  5GAG P;  1O13 A;  1XQS C;  4PHT X;  4DTP A;  1ITG A;  3P5J A;  3DYA A;  1J53 A;  2Q0U A;  4B8A B;  4CJF A;  4H03 B;  2P9U B;  5FPM A;  4DFJ A;  2Q3S A;  3KLE A;  4B1Z A;  4BRP A;  4OLA A;  1SKS A;  5JIC A;  2YHX A;  3ZCM A;  2OA8 A;  3MAQ A;  1WUA A;  5AQW A;  4MQ3 A;  1HYZ A;  2DTU A;  3IMX A;  2OTL N;  5ADX A;  3OY9 A;  3CCU N;  2QK9 A;  3BP8 A;  3ATV A;  4G1Q A;  2CH5 A;  3O1B A;  3VQB A;  4PA1 A;  1LW2 A;  5EY4 A;  5FRN A;  3M8R A;  3MXM A;  1LCU A;  4I2Q A;  3ISN C;  3R9P A;  3TAQ A;  4KO0 A;  5LJW A;  3QFU A;  1RIL A;  4H0Y B;  3CCQ N;  1VQ7 N;  4IEI A;  1T8E A;  3AVH A;  4FWO A;  4GV9 A;  1RBR A;  3ZX0 A;  3I33 A;  3RMB A;  4FLY A;  4I7F A;  4DSL A;  2P9L B;  2RPI A;  3V1R A;  4DWI A;  3BEX A;  5AZJ B;  2KFZ A;  4B1X B;  1JJ2 M;  1QZ5 A;  1KCF A;  4DR1 K;  3OYG A;  1JCG A;  1ZBL A;  1JLG A;  3V9W A;  1BGX T;  2IOC A;  4FK0 A;  4AH9 A;  4JYA K;  5EX5 A;  4MO5 A;  2IVP A;  4KHU A;  3UKR B;  1QTM A;  1I94 K;  3WXI A;  2VYP A;  4FL9 A;  4JHD A;  3AVI A;  3KWG A;  4FK2 A;  3EEQ A;  1T6D A;  3VEV A;  3ZSO A;  1N6Q A;  3SCX A;  4O0I A;  3AA3 A;  3F5T A;  3ATU A;  2ETJ A;  1C1B A;  4CHN A;  4CD3 A;  4AHS A;  1HKC A;  3QER A;  1BU6 O;  3RMD A;  4KBO A;  4RCH A;  1V4T A;  2P9P B;  4BRO A;  1NGG A;  5HRP A;  1KFS A;  5KGX A;  4NYF A;  4DFM A;  5AQS A;  5C2F A;  1RT5 A;  1K8K A;  1KSP A;  1OH6 A;  2HHT A;  2BH1 A;  3SAG A;  4NYN A;  1VQ8 N;  2YKN A;  3DM2 A;  4BRE A;  5C0Y A;  3WNG A;  4A61 A;  3ULE A;  1U4B A;  4H4O A;  4O5B A;  3VQ7 A;  4HCC A;  1XC3 A;  1S1W A;  3G6E N;  2DPN A;  3U6F A;  5HRS A;  4IO8 A;  1TKD A;  1RT1 A;  3AVK A;  2G8H A;  5JMV A;  1Q9Y A;  4M7X A;  1UA0 A;  3LPT A;  1XC9 A;  4CF8 A;  4FZZ A;  1RNH A;  4O44 A;  4CGG A;  2HHQ A;  4DQR A;  1OVY A;  3O80 A;  4H5T A;  3Q7B A;  4BDY A;  1DT9 A;  3R3L A;  2OYQ A;  3ZLJ A;  1RDU A;  1VQ9 N;  3V9U A;  3SJH A;  4WF9 L;  2ZJP L;  4IOC L;  2OPQ A;  1ZBI A;  3ZEU B;  4FJ7 A;  1XNQ K;  1BQM A;  4L3Q A;  5BN9 A;  4QCL A;  2ZGZ A;  3NVM A;  1YJ9 N;  3L2Q A;  3VEZ A;  4KH4 A;  1LW0 A;  5JLF A;  4KRF A;  1S9E A;  3OYC A;  1H1V A;  5AQZ A;  2O8C B;  4DF4 A;  2GUI A;  5E26 A;  3HOT A;  2BDP A;  2KTQ A;  3LM9 A;  4DKW A;  4HUE A;  1NJX A;  1VSE A;  3BZK A;  3CC4 N;  4B1W B;  1CZA N;  5KQD A;  4FM0 A;  5SZT A;  3DXK A;  2V7Y A;  3AVG A;  2E2N A;  3KZB A;  1P90 A;  3DOK A;  3QBX A;  3TR8 A;  1VSF A;  4B3R K;  4DS4 A;  1RBT A;  1SUQ A;  3E66 A;  4AHT A;  4BRH A;  4FK4 A;  1RDA A;  5E41 A;  1YUW A;  4DR5 K;  4FLX A;  3M8S A;  1NMN A;  3MCA B;  3A5M C;  1IBM K;  4W5N A;  1TKX A;  4JKG A;  4KHY A;  1ZBF A;  3AO1 A;  3FFI A;  4DQP A;  4BQZ A;  3GOI A;  1RDC A;  1S1T A;  2HVI A;  1X9J A;  4JKE A;  4FWP A;  1JCF A;  4OPK A;  1QS4 A;  4DV7 K;  1VQL N;  2OPR A;  3DLG A;  3TAB A;  1N32 K;  2RKI A;  4NLC A;  3DI6 A;  1CZB A;  4M3T A;  1MDU B;  1HQE A;  1X3M A;  3TPQ A;  4W5O A;  1HNW K;  1VQO N;  3J7Z O;  1VSH A;  1C6V A;  4BE2 A;  3QML A;  5AQV A;  4JI5 K;  2V51 B;  3HVT A;  1S22 A;  3VQ6 A;  1WSJ A;  2HNY A;  2YNH A;  4AHV A;  1S6P A;  2DFH A;  4BQL A;  1ZXO A;  2VG6 A;  1K8A O;  3FLC O;  3I0R A;  5DK5 A;  1NM1 A;  3G4S N;  2P9I A;  1BG3 A;  1JCE A;  3H08 A;  1OH7 A;  1RTD A;  3F2K A;  1BOT O;  1ZBU A;  4F9O A;  2FBY A;  1MU2 A;  4BRG A;  1U49 A;  3VQ4 A;  1HUX A;  1EWQ A;  4QS7 A;  2FC0 A;  2HF4 A;  3FFK B;  1KVB A;  1VQN N;  1EO1 A;  1TV6 A;  3VQQ A;  3V4I A;  3HYF A;  4E89 A;  3ITH A;  4CES A;  3S9H A;  2HF3 A;  3O3G A;  2BE2 A;  3HVR A;  3DAW A;  3SQ4 A;  3IFR A;  4BGB A;  1RGI A;  2OTJ N;  1Q8I A;  5M1K A;  1Q86 O;  2E2O A;  1BL3 A;  4DV3 K;  1NGA A;  3AO4 A;  4F8R A;  4JI2 K;  1IG8 A;  3AGK A;  2NRT A;  2ZWH A;  5JLH A;  2O8E A;  1HKG A;  1VSL A;  3FGU A;  4JEP A;  3K5M A;  5CR4 A;  1RTI A;  3C6T A;  1C0M A;  4RW6 A;  4CGJ A;  2YI1 A;  3NMU A;  5GIN A;  2BGG A;  2KZZ A;  5AFU H;  4CGI A;  4ILJ A;  1M1K O;  4XEI A;  3O3F A;  1ASW A;  5C24 A;  4OPJ A;  3LWM A;  5AQG A;  3QES A;  3TAN A;  4GV3 A;  2FBT A;  3CJ1 A;  3VQD A;  4K25 A;  4DQQ A;  3T1H K;  3DXM B;  3IAY A;  2V7Z A;  4J2D A;  2JWK A;  3QEX A;  2YJE A;  3LAK A;  4LH5 A;  1TKZ A;  4CHQ A;  1IV0 A;  4HVJ A;  3CC2 N;  3WQT A;  4EHT A;  4IOX A;  3CCR N;  2XY5 A;  3PX4 A;  4DG1 A;  4AM7 A;  4K41 A;  3VER A;  1MWM A;  1BIZ A;  2VQF K;  4KAZ A;  1Q81 O;  3LAN A;  4A2A A;  1GOA A;  4R5P A;  3VEW A;  1JLA A;  2W6L A;  1I39 A;  2UU9 K;  4C8M A;  1KLM A;  3HPG A;  4FVM A;  3V9X A;  4CGF A;  4DU3 A;  3EYZ A;  4IZ9 A;  1YJN N;  4CI6 A;  4KKO A;  1W9H A;  1BQN A;  1TGO A;  4JKA A;  2G8W A;  4NXN K;  3HXM A;  4KHN A;  2NNW A;  3H45 C;  5F0X A;  4ILH A;  5FPN A;  3HT3 A;  3VES A;  3QEP A;  3KHY A;  3R6M A;  4AHC A;  3T3F A;  4MLE A;  1GOC A;  4CJ7 A;  3CXC M;  4HHT A;  3CYM A;  3EZW A;  3E9L A;  4GNI A;  4B08 A;  4H5N A;  1W2B M;  1QVF M;  4FYD A;  4E7J A;  3BF3 A;  1KLN A;  3M8Q A;  4ELT A;  4EZ9 A;  1Y97 A;  1WNS A;  3ZSY A;  4LFB K;  3L2W A;  2P51 A;  3JXU A;  4BRK A;  3KKR A;  3A0I X;  5EOY A;  1U48 A;  1P8Z A;  4DTX A;  4B9M A;  2VGM A;  5AQT A;  3KD5 E;  1WSH A;  4N47 A;  4B9U A;  2YHW A;  4BR9 A;  1NWK A;  3J7A P;  1DKG D;  2D4W A;  1LAW A;  4JKH A;  3QIN A;  3NF9 A;  4OLB A;  1HNI A;  3OYE A;  3LP1 A;  3VGK A;  1NOY A;  2UYT A;  4KFB A;  4V19 S;  3K59 A;  4XH1 A;  5KPR A;  4C1N K;  4FJN A;  2F9W A;  2P9U A;  4CJE A;  2OZM A;  1RDD A;  4DV4 K;  2D5R A;  4WE1 A;  4KB1 A;  3RMA A;  3KK2 A;  1FK9 A;  4BY9 C;  3E9O A;  2E1Y A;  1OKJ A;  3VQP A;  1EWR A;  3WEE B;  1KXP A;  2D0B A;  4X66 K;  3D2F B;  4H0V B;  4CEF A;  3CFP A;  5JVH L;  3KD1 E;  1KAY A;  3V9Z A;  4O0J A;  2Z1I A;  3TSU A;  3C65 A;  4FLV A;  3B8A X;  3A5O C;  3O9U A;  4DR2 K;  3W3D A;  3NGZ A;  1T44 A;  2P9L A;  3TAM A;  2GWJ A;  4PUO A;  3OJU A;  3JS6 A;  1NGJ A;  4NB4 A;  1VK0 A;  3IG1 A;  2KQ2 A;  3HPH A;  4MFB A;  4WQ5 A;  3OYA A;  1CLQ A;  5LMU K;  1ESV A;  2X78 A;  2RE2 A;  5AZJ A;  3MX5 A;  3CJC A;  4FWS A;  4ISF A;  5FRO A;  2XO7 A;  3O9Q A;  1OVQ A;  4YOT A;  5KTQ A;  3PIP L;  4C1N I;  3RR7 A;  1SQK A;  1FKP A;  4HUF A;  4M63 C;  3HTV A;  4MDA A;  2WBN A;  1NGC A;  3UE5 A;  5M1P A;  1NK8 A;  3IS9 A;  3CM6 A;  3CQ8 A;  2YKM A;  2AP1 A;  2NRH A;  4OO1 J;  4IBN A;  1S1V A;  5IT9 O;  3HM9 A;  4FWQ A;  2HOE A;  3S3O A;  5CE3 A;  4H8K A;  1HNZ K;  3OS1 A;  3VGL A;  4QOZ B;  3NBP A;  1YTU A;  2P9P A;  4JAX A;  4CFC A;  4HTU A;  1QSL A;  4JKF A;  1B9D A;  4B9V A;  1JLQ A;  3AO2 A;  3SPY A;  3LDS A;  3KVG A;  2EHG A;  4LFC K;  1RT6 A;  1ATS A;  4CW7 B;  5GAE P;  3DRR A;  4E1M A;  3TAP A;  4LSN A;  3AVN A;  4CJR A;  1HPZ A;  4CIE A;  1EXQ A;  3TAR A;  1JL2 A;  1N5Y A;  4B3T K;  3L4I A;  5K14 A;  3CFO A;  3TTC A;  1YVU A;  3A5L C;  3DWL A;  3HRG A;  1CXQ A;  1DTQ A;  3U3Y A;  4OKJ A;  4FLU A;  4B9T A;  1EX4 A;  1WOQ A;  3NCI A;  3L8B A;  1IH7 A;  1QQO A;  4KH6 A;  3WNF A;  1ILY A;  1HKB A;  2QM1 A;  2A42 A;  2VCP A;  4PKG A;  3ZEU A;  1RT4 A;  5I3U A;  1XMO K;  2P5O A;  3ZT1 A;  4MO4 A;  3IRX A;  3SLC A;  4YY3 K;  2IVO A;  5BRD A;  3NAE A;  1SZ2 A;  2O8C A;  1U04 A;  2QXF A;  1EQY A;  4FWL A;  4E0D A;  4DLE A;  3EN9 A;  4IOA L;  3L4Q A;  4CJQ A;  2H3G X;  4C23 A;  4N76 A;  3C6A A;  4Z4F A;  1DLO A;  2F4V K;  2QW9 A;  5CY4 A;  2PZS A;  4N56 A;  1BIS A;  4LD0 A;  3BUZ B;  4KV8 A;  4DF8 A;  1BI4 B;  2FF3 B;  2IIR A;  1TK8 A;  4BC2 A;  3OTO K;  1RCH A;  1KTQ A;  1A5V A;  4YDU A;  2HND A;  1FXX A;  2KLA A;  4CZE A;  1TUU A;  4AF1 A;  1I3A A;  3CIP A;  3AVA A;  1Q9X A;  4BWM A;  1N36 K;  4F2S A;  1LWC A;  4BR0 A;  3JSM A;  3QBW A;  4LSL A;  3ENO A;  4E7H A;  3QEV A;  3UB5 A;  3VQE A;  4OGC A;  1HNV A;  1JLB A;  4J8F A;  3MN5 A;  2UUC K;  4CE9 A;  3DRS A;  1NJZ A;  1JLC A;  3VMF B;  3ZT4 A;  4CJS A;  2CGK A;  3AVF A;  4ID5 A;  1N34 K;  3CC7 N;  3K0S A;  3K9K A;  1VRT A;  4BG8 A;  4ZTJ A;  1DGK N;  4FLW A;  1U2V B;  5AQN A;  5AQQ A;  4GMJ B;  3C94 A;  1WAJ A;  4OPH A;  3GL1 A;  3SQ1 A;  4KI6 A;  4BR4 A;  1S3X A;  1FJG K;  1VQ6 N;  2A1R A;  3O4Q A;  1IKV A;  3LZI A;  3SUQ A;  2BUP A;  2IGI A;  4A57 A;  3HBT A;  3U9D A;  3ZT0 A;  1GLF O;  2FBV A;  3C6U A;  3THX B;  3ZSX A;  5FPD A;  1NJY A;  1WB9 A;  2D0O A;  4WFB L;  1SS6 A;  3MN9 A;  3B6P A;  1T03 A;  4X64 K;  4FM2 A;  2ZD1 A;  2QI2 A;  1FW6 A;  1VSD A;  3AO5 A;  2P9K B;  3RTV A;  2YHY A;  4KHW A;  1C0F A;  4JKC A;  1RBU A;  3QIP A;  3RMC A;  3THV A;  4MDB A;  5AQM A;  1J5E K;  4CJL A;  4G9Z A;  3GBT A;  4FPB A;  3DRP A;  2KW4 A;  4B9S A;  1WSF A;  2VGN A;  3VQC A;  3EY1 A;  4F3O A;  1Z05 A;  3MEG A;  3SV4 A;  2NRW A;  3VGM A;  3G71 N;  4U7B A;  1YF5 L;  3SBT A;  3PV8 A;  3KLI A;  2WC9 A;  4CEQ A;  2FLO A;  1ATR A;  4O55 A;  4K43 A;  4FZY A;  3MN6 A;  1KQS M;  4YHH K;  3NH2 A;  2XY8 A;  3L2R A;  4C8L A;  1HLU A;  4Y0W A;  4H5W A;  4JI0 K;  1LAV A;  1TKT A;  3LL3 A;  1BCM A;  4FVU A;  3QLH A;  2E4L A;  3LAM A;  4E7I A;  1TL1 A;  4DV0 K;  3LDP A;  3J7Y P;  3SK3 A;  5JVG L;  4FXD A;  1WN7 A;  4B8C A;  4W5R A;  1NJI O;  4DR4 K;  1HNX K;  4ID1 A;  3BF1 A;  2ZE2 A;  4BRI A;  3DXM A;  4GY2 B;  2JWL A;  4CIG A;  4CED A;  4FOE A;  3BY5 A;  4XIU A;  4CFB A;  3TWH A;  3SV3 A;  1YI2 N;  1ASU A;  4DTN A;  5T7B A;  3AA4 A;  5AQI A;  5BPM A;  1YTA A;  1W97 L;  1TVR A;  2UUA K;  5M1Q A;  3D0P A;  3SYZ A;  3K58 A;  1VSM A;  4FJK A;  4IXC A;  3R8E A;  3PO4 A;  3HJF A;  4XH4 A;  1K73 O;  3I8B A;  4IJA A;  1Q82 O;  3O8M A;  5SWM A;  4AM6 A;  4CHP A;  2OCE A;  4CER A;  3OYM A;  1NK4 A;  4KTZ A;  4FJL A;  1RTH A;  1KC8 O;  2XY6 A;  2VQE K;  3KKS A;  4IKF A;  5LJV A;  3HO1 A;  1YIT N;  2PBD A;  3A2F A;  3OYJ A;  2B5J A;  3M1F A;  3I56 N;  2X6N A;  5BR8 K;  3DMJ A;  3FZK A;  2YNI A;  2WON A;  4KH5 A;  3VN5 A;  4I2P A;  3KK1 A;  3CCE N;  3T1A A;  1BIU A;  4O4G A;  1O1W A;  2GTD A;  5EVZ A;  4RTF D;  1E3M A;  1YHQ N;  2NRR A;  2P9S A;  4JV5 K;  3IUC A;  5ADX H;  3L2V A;  3EO3 A;  1XNR K;  3S3N A;  4FJ9 A;  4JS5 A;  2PYJ A;  3DLR A;  3VOV A;  3AO3 A;  3KLG A;  5J2Q A;  3ENH A;  4KB0 A; 
#chains in the Genus database with same CATH homology
 2Q0R A;  3VEO A;  4CJ7 A;  3CXC M;  4I6M A;  3LDO A;  3EZW A;  3H3O B;  3E9L A;  4GNI A;  4BRA A;  4H5N A;  4YOY A;  1W2B M;  1M90 O;  1QVF M;  2A40 A;  3AY9 A;  3BF3 A;  3CD6 N;  5AQF A;  3RVC A;  1GLL O;  2QEX N;  3RSE B;  1QVG M;  4QS8 A;  3IKM A;  3VF6 A;  3PLA A;  3AAR A;  2ITM A;  5AFU A;  2PFU A;  3JXU A;  4BRK A;  1J6Z A;  3SAH A;  1NMD A;  2E8A A;  3VTI A;  3A0I X;  4JD2 A;  4E1J A;  3I55 N;  4WFA L;  5EOY A;  4R79 A;  1P8Z A;  1YIJ N;  4EAH D;  2VGM A;  5AQT A;  3H1V X;  4B1Y B;  3MCP A;  4I6M B;  5GAD P;  5AQK A;  1R59 O;  2YHW A;  4BR9 A;  1NWK A;  4FO0 A;  1DKG D;  2D4W A;  3CPE A;  4O8U A;  4JKH A;  1LOT B;  4GV6 A;  2NRZ A;  4ISE A;  3WEE A;  1T6C A;  4U67 L;  2W40 A;  3K9J A;  3VGK A;  1HPM A;  5DM6 L;  2UYT A;  2YJF A;  1Y64 A;  3FE1 A;  4XH1 A;  1E4F T;  5KPR A;  4C1N K;  4YOW A;  2F9W A;  2P9U A;  3TTD A;  5CHI A;  3CCV N;  1KAX A;  2KHO A;  3D2F A;  5EXW A;  2ZGY A;  1GLB G;  2KKZ A;  4JD2 B;  3VTH A;  3WXL A;  4BC5 A;  2ZJR L;  4WQ4 C;  1HX1 A;  4PKI A;  2FF6 A;  5AQH A;  3VEN A;  5GAG P;  3VF2 A;  4BY9 C;  4FWK A;  1O13 A;  1XQS C;  3E9O A;  4PHT X;  2NZT A;  2E1Y A;  1OKJ A;  3P4I A;  3WEE B;  1KXP A;  1QQN A;  2Q0U A;  4JK8 A;  4JK7 A;  4CBU A;  4H03 B;  2P9U B;  5FPM A;  3ZYY X;  5F1X A;  4B1Z A;  4BRP A;  2AA4 A;  3D2F B;  4H0V B;  5JIC A;  3H1Q A;  2QWR A;  2YHX A;  1NGF A;  3TTF A;  5JVH L;  3UKU A;  1KAY A;  1WUA A;  5AQW A;  2D0P A;  3TSU A;  5AQR A;  3C65 A;  3IMX A;  2OTL N;  2EWS A;  5ADX A;  3CCU N;  2Q97 A;  3BP8 A;  3CCJ N;  3ATV A;  2CH5 A;  1GLE G;  3B8A X;  3O1B A;  1VQK N;  5EY4 A;  4CD1 A;  3A5O C;  3O9U A;  4BG9 A;  4CZK A;  3LDN A;  3W3D A;  2P9L A;  1LCU A;  1T44 A;  2GWJ A;  3R9P A;  1Z6R A;  4CZG A;  5BRF A;  3JS6 A;  5LJW A;  1NGJ A;  4NB4 A;  4WQ5 A;  3QFU A;  3CCQ N;  1T3V A;  4H0Y B;  1VQ7 N;  1ESV A;  3D6R A;  2RE2 A;  3F9M A;  4IEI A;  3S41 A;  3MX5 A;  3UKU B;  3CJC A;  4FWS A;  4ISF A;  2A41 A;  4FWO A;  4BVO A;  4DCH A;  4DHY A;  4GV9 A;  1NLV A;  4QS9 A;  3GDQ A;  3O9Q A;  3ZX0 A;  2W41 A;  1VQ4 N;  4YOT A;  3I33 A;  1ZBS A;  5HL7 L;  4C1N I;  3SBG A;  3PIP L;  3A5N C;  2Q1N A;  1SQK A;  2HST A;  2P9L B;  4H0P A;  2CGL A;  4M63 C;  3H3N O;  2QWL A;  3HTV A;  4MDA A;  1MWK A;  2Q36 A;  5AQY A;  5BPN A;  1NGH A;  2IVN A;  2WBN A;  1NGC A;  3BEX A;  4EFH A;  3LM2 A;  1YAG A;  3M6G A;  2WUS A;  3CJB A;  4FWN A;  3UE5 A;  3EKU A;  3EL2 A;  3W0L A;  4CZH A;  5AZJ B;  4BRF A;  5M1P A;  4B1X B;  1NGD A;  1QZ5 A;  1JJ2 M;  2AP1 A;  1TUY A;  1JCG A;  2NRH A;  4BC4 A;  4OO1 J;  3G25 A;  3PIO L;  4Z94 A;  3GE1 A;  5FPE A;  4WFN L;  5EX5 A;  4MO5 A;  2IVP A;  4FWQ A;  3AGR A;  2HOE A;  3O6W A;  3UKR B;  5GAH P;  3WXI A;  5CE3 A;  4LC9 B;  2VYP A;  3E1Y A;  4FL9 A;  3VGL A;  4A62 A;  4CBX A;  4EIA A;  2P9P A;  4JAX A;  4JHD A;  4WCE L;  4IEE A;  4JKF A;  3KWG A;  3OW2 M;  4UY8 O;  3WT0 A;  1T6D A;  4GVE A;  3VEV A;  3KVG A;  4WYB A;  3NVK A;  3WUH A;  3O9S A;  3QB0 A;  5KQ8 A;  1ATS A;  3CER A;  4MLH A;  3ZX3 A;  4WQ5 C;  2HBM A;  2QTD A;  3F5T A;  3WQU A;  4YOV A;  4PKH A;  3EE8 A;  4CZM A;  5E84 A;  3SAF A;  3MMV A;  2E88 A;  3ATU A;  2YCH A;  5GAE P;  4CD3 A;  3L6Q A;  1HKC A;  2P9S B;  1BU6 O;  1IJJ A;  3WXJ A;  3CQY A;  3C6H A;  4KBO A;  1MA9 B;  1KAZ A;  3C7N A;  4RCH A;  1V4T A;  2P9P B;  3L4I A;  4BRO A;  4JHD B;  1NGG A;  3TTC A;  3A5L C;  3DWL A;  3D2E A;  3HRG A;  4A2B A;  5BPL A;  1GLJ O;  4H0X B;  5AQS A;  5C2F A;  2GWK A;  3O1W A;  3HOS A;  1K8K A;  4YOR A;  3LDL A;  3CQX A;  4A59 A;  2BH1 A;  3TSP A;  3SAG A;  1VQ8 N;  3Q7C A;  4BRE A;  5AZJ A;  5C0Y A;  1WOQ A;  3T7Z A;  4A61 A;  3ULE A;  1SAZ A;  2P9N A;  2I7N A;  3MN7 A;  1QQO A;  1XC3 A;  3G6E N;  1XUP O;  2DPN A;  3C7N B;  4FWR A;  3EE9 A;  4H5R A;  4HTL A;  4IO8 A;  4JN4 A;  4KH6 A;  4YOX A;  1QQM A;  1ILY A;  1HKB A;  1QZ6 A;  2QM1 A;  2A42 A;  3D2E B;  5JMV A;  2VCP A;  4PKG A;  3TU5 A;  4M7X A;  3ZEU A;  3R1X A;  4MO4 A;  1NGB A;  1K9M O;  4CZL A;  4DQ8 A;  1OVY A;  1K8K B;  1YVN A;  3O80 A;  4H5T A;  3EKS A;  4O8K A;  3CJA A;  3SLC A;  4B1U B;  3Q7B A;  2IVO A;  5BRD A;  1DT9 A;  1SZ2 A;  4FWL A;  1EQY A;  2E2P A;  3R3L A;  3CCS N;  3EN9 A;  4M7Y A;  3ULE B;  3GG4 A;  4IOA L;  2P9N B;  3L4Q A;  5M1O A;  3HI0 A;  2H3G X;  1RDU A;  3VF4 A;  4C23 A;  1VQ9 N;  3C6A A;  3ZET A;  3SJH A;  3CJ7 A;  4WF9 L;  1NGI A;  2ZJP L;  4IOC L;  2QW9 A;  1VQ5 N;  1QHA A;  4ISG A;  4JK9 A;  3ZEU B;  4K42 A;  4B9Q A;  3KWI A;  4L3Q A;  5BN9 A;  3BUZ B;  2ZGZ A;  5MLC Q;  3CMA N;  3NVM A;  1YJ9 N;  2QWN A;  3ID6 A;  3VEZ A;  4KH4 A;  5JLF A;  2FF3 B;  2IIR A;  2QXL A;  3OBY A;  4BC2 A;  1H1V A;  3ID8 A;  5AQZ A;  4BR2 A;  2ASM A;  5C10 A;  5E26 A;  3HOT A;  4YDU A;  3VEY A;  2KLA A;  4CZE A;  3LM9 A;  4DKW A;  1VQM N;  1TUU A;  4AF1 A;  3CIP A;  3ZET B;  3SMS A;  3O9T A;  3O08 A;  4BRM A;  4BR0 A;  3CC4 N;  3QBW A;  3ENO A;  4IDH A;  3UB5 A;  4B1W B;  1CZA N;  3CF5 L;  1NBW A;  5KQD A;  3DXK A;  2V7Y A;  5LY3 A;  1RFQ A;  4JKB A;  2E2N A;  3KZB A;  1P90 A;  3CCM N;  3QBX A;  1U2V A;  3J8A A;  4O5F A;  2NRX A;  2E2Q A;  2ZJQ L;  3FR0 A;  1V4S A;  4ILG B;  4J8F A;  2OAN A;  3E66 A;  3MN5 A;  4BRH A;  4BR5 A;  3O5B A;  3ENB A;  3VMF B;  1YUW A;  5C2D A;  3MCA B;  3A5M C;  1GLA G;  2CGK A;  3QDK A;  4BRL A;  2FSJ A;  4JKG A;  3CC7 N;  3DXK B;  2GEL A;  3K9K A;  1KD1 O;  4BG8 A;  1DGK N;  3MDQ A;  1U2V B;  5AQN A;  3E9P A;  4H5V A;  5AQQ A;  4BR7 A;  1YJW N;  4BRC A;  4OPH A;  3GL1 A;  2BTF A;  3T69 A;  4BQZ A;  3GOI A;  1ATN A;  1X9J A;  3P39 A;  4FWP A;  1JCF A;  2FSK A;  4JKE A;  1VQL N;  1VAZ A;  4BR4 A;  4H0O A;  1DEJ A;  1S3X A;  4BRD A;  3FZL A;  3CPW M;  1VQ6 N;  2NRV A;  4NLC A;  4YDU C;  3O9R A;  4EHU A;  2P9K A;  4B1V A;  3D7E O;  5AQO A;  2Q31 A;  1MDU B;  4OPA A;  1X3M A;  3TPQ A;  4JKG B;  4IO9 L;  2V52 B;  2BUP A;  1VQO N;  4A57 A;  3HBT A;  2F7T A;  5AQX A;  3U9D A;  1GLF O;  2RHK A;  4HWI A;  2A3Z A;  3VEX A;  3J7Z O;  5B8H A;  5FPD A;  2D0O A;  3C0B A;  4WFB L;  1SS6 A;  3QIC A;  3MN9 A;  3FZM A;  4YOU A;  5M1N A;  1G99 A;  3QML A;  5AQV A;  4FSV A;  2V51 B;  1S22 A;  5C15 A;  4CBW A;  3LDQ A;  4CZI A;  2QI2 A;  5H1S Q;  2J4R A;  2P9K B;  2QWQ A;  5GIO A;  3OA9 A;  4BQL A;  1ZXO A;  5M1F A;  2YHY A;  1K8A O;  1C0F A;  5AQU A;  4JKC A;  4BVP A;  3FLC O;  2F9T A;  3HSC A;  1NM1 A;  3G4S N;  2P9I A;  1BG3 A;  4MDB A;  1JCE A;  5AQM A;  2VWB A;  3DJC A;  4G9Z A;  3GBT A;  4FPB A;  2A6A A;  1E4G T;  1BOT O;  2VGN A;  3F2K A;  3CI5 A;  4F9O A;  3ZX2 A;  1Z05 A;  4BRG A;  4BC3 A;  1HUX A;  4QS7 A;  2NRW A;  5AZI A;  1GLD G;  3IDH A;  4IJN A;  3VGM A;  4A5B A;  4MLE A;  4U7B A;  1YF5 L;  3G71 N;  4FPA A;  3SBT A;  4BRN A;  4DB3 A;  2HF4 A;  3MX2 A;  3FFK B;  2ASP A;  2ZF5 O;  4RWT A;  1VQN N;  2WC9 A;  1EO1 A;  3A8Y A;  2FLO A;  1NGE A;  4FOI A;  3MWP A;  2CH6 A;  1ATR A;  3N4P A;  2I7P A;  2P9I B;  5BR9 A;  4K43 A;  4CZF A;  3MN6 A;  1KQS M;  2QA4 N;  1S72 N;  2HF3 A;  5GIP A;  3OHR A;  5AR0 A;  3DAW A;  5AZI B;  1D4X A;  1HLU A;  4CZJ A;  3HZ6 A;  1BUP A;  1YXQ A;  4Y0W A;  3IFR A;  4BGB A;  4PL7 A;  1RGI A;  2OTJ N;  5M1K A;  1Q86 O;  4H5W A;  2E2O A;  1NGA A;  3LL3 A;  4FVU A;  5I9E B;  2WFB A;  4A5A A;  1IG8 A;  3AGK A;  2NRT A;  2ZWH A;  5BRE A;  3LDP A;  5JLH A;  2D1K A;  1HKG A;  4IWV A;  3SK3 A;  5JVG L;  4JNE A;  1N8R O;  1NJI O;  3FGU A;  4JEP A;  2GX9 A;  3P38 A;  4BGA A;  5AQP A;  3BF1 A;  5CR4 A;  4PL8 A;  4BRI A;  1TYQ A;  1C0G A;  3DXM A;  4GY2 B;  2JWL A;  4BRQ A;  2YI1 A;  3CET A;  4FOE A;  3U9Z A;  3AAQ A;  3O4W A;  3NMU A;  5GIN A;  1HJO A;  1YI2 N;  5AFU H;  4ILJ A;  3CHW A;  3CJ9 A;  3FZF A;  5AQI A;  3WXK A;  5BPM A;  5DM7 L;  4XEI A;  1M1K O;  3CME N;  1W97 L;  1U6Z A;  5M1Q A;  2FXU A;  2PAV A;  5TKY A;  2QWO A;  4IXC A;  3R8E A;  3VPZ A;  4GV3 A;  2E1Z A;  1X3N A;  5AQG A;  3KK7 A;  4XH4 A;  3CJ1 A;  4K25 A;  1K73 O;  3I8B A;  1BO5 O;  2NLX A;  4FWM A;  1TYQ B;  3M3Z A;  3QFP A;  4IJA A;  3DXM B;  5F2R A;  3O8M A;  1Q82 O;  5ELZ A;  3HM8 A;  2V7Z A;  4AM6 A;  2JWK A;  3AAP A;  2HMP A;  2YJE A;  3H46 O;  1KC8 O;  1BDG A;  3MWT A;  4NO7 A;  3P31 A;  3CC2 N;  2A5X A;  3WQT A;  2HBJ A;  3FZH A;  5AQJ A;  5C12 A;  4EHT A;  5LJV A;  2YX6 A;  4IOX A;  3CCR N;  1YIT N;  4AM7 A;  4K41 A;  2PBD A;  3VER A;  1MWM A;  2GEM A;  3U4L A;  3UKR A;  3M1F A;  1Q81 O;  1Q7Y O;  3I56 N;  2Q2R A;  4XH5 A;  1BWF O;  4A2A A;  4JKD A;  3VEW A;  3FZK A;  1RDW X;  1VQP N;  4KH5 A;  2FSN A;  3OBW A;  3CCE N;  1BA1 A;  4NLB A;  3U8X A;  2GUP A;  5KPT A;  5TKW A;  2GTD A;  2QWP A;  4IZ9 A;  5AQL A;  5EVZ A;  5BN8 A;  4CI6 A;  4RTF D;  5BRH A;  2ASO A;  2E20 A;  1YJN N;  3CCL N;  3MK6 A;  1BA0 A;  4JKA A;  3N4Q A;  5KPZ A;  1YHQ N;  2NNW A;  3VET A;  3H45 C;  2NRR A;  3RSE A;  5F0X A;  3M5R A;  2P9S A;  4ILH A;  5FPN A;  4WQ4 A;  4H0T B;  5HOO A;  2QWM A;  2HBL A;  3SMP A;  3TSQ A;  3IUC A;  2CGJ A;  5ADX H;  3VES A;  3DLL L;  3EO3 A;  3KHY A;  3R6M A;  3WXM B;  4IFE A;  1Q18 A;  1ZC6 A;  1GLC G;  3VOV A;  3L0Q A;  3ENH A;  3H6E A;  2HBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...