4JI7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji7K00
1IBMK 2UXCK 4CW7B 1HR0K 4V19S 4B3MK 2F4VK 4YY3K 4JYAK 1XMOK 4JV5K 5LMUK 2UUAK 4GKJK 4DV7K 1IBLK 4DR5K 4DR6K 3J7AP 2UXBK 5A2QO 2ZM6K 4CVNE 2UUBK 4DV6K 5IWAK 3T1HK 5LL6Z 4DV3K 4KHPK 4DR2K 4YHHK 4LF8K 3OTOK 4LFCK 1FJGK 3T1YK 1HNWK 4JI6K 1HNXK 4DUZK 3J7YP 4DV5K 4LFAK 2UUCK 2UU9K 4JI7K 1I94K 4X64K 4LF6K 4B3RK 4K0KK 2UXDK 1N36K 4GKKK 4JI8K 4DR4K 4JI4K 4DV1K 3JAMO 5FLXO 4LF5K 4LF9K 4B3SK 4AQYK 3J81O 4OX9K 5IT9O 5BR8K 1XNRK 4LFBK 2HHHK 4X66K 1IBKK 4NXNK 4DR7K 1J5EK 2VQEK 4X62K 2VQFK 4DR1K 1N32K 4DUYK 4JI1K 4JI0K 1N33K 1N34K 2E5LK 4DV0K 5AJ3K 4NXMK 5LMNK 1XMQK 4DR3K 4B3TK 4X65K 4LF7K 4JI2K 4DV2K 3J80O 4JI3K 4JI5K 1XNQK 4DV4K 1HNZK 4LF4K
chains in the Genus database with same CATH superfamily
3M8QA 3L3UA 4FVMA 4CESA 1VQMN 1MWMA 4OLBA 2GELA 3VPZA 1UAXA 4WYBA 4BC3A 3OYNA 4BRKA 4C8KA 4C8OA 1WOQA 3LWLA 3CF5L 3LAKA 3H3NO 1WSFA 4CVNE 4IJAA 3TAFA 1GLAG 3E1YA 4RW8A 3PUFA 4BG9A 3OTOK 3WUHA 1YJNN 4FJGA 2WOMA 4KO0A 1VSIA 3U3GA 3ID8A 3SUQA 4N47A 2CGLA 3CPEA 1MA9B 3P5JA 1NGBA 5AQUA 5C12A 5C2FA 1QVGM 2G8IA 4DTPA 2EHGA 1X1PA 4JRPA 2HOEA 1VQKN 4IG0A 3IKMA 1TL1A 3ZETA 3C0BA 3LZJA 2UXDK 3CCUN 4NCGA 4DR4K 2D0BA 3BF1A 4DV1K 4LF5K 4CI6A 3RMDA 4CJEA 1W2BM 4FK4A 3O4NA 2VG5A 3QB0A 4NO7A 1CLQA 4DSEA 4CK2A 1XHZA 2E20A 3LDPA 3OBWA 2HHQA 5GAGP 4GMJB 4M63C 5JLFA 3OYJA 3L2WA 4NLCA 1T8EA 4X62K 3IAYA 2W6LA 3RSEB 1E4GT 4RCHA 1W0HA 1DTTA 4KTWA 1QE1A 2HBMA 1I3AA 4KTZA 4CF2A 2NRZA 4IFYA 4JKFA 3SV4A 4U67L 4FLVA 1NKCA 4AHRA 3Q7CA 5BRFA 2BUPA 3HL8A 4FLWA 5AJ3K 3MEDA 4PA1A 3VEYA 2OPPA 2VGMA 4YOXA 1P90A 4QS9A 4GVMA 5KQDA 2Y1JA 3N4QA 4A2AA 3ZT1A 1MU2A 3I0SA 3MK6A 3NVMA 3RVCA 3HOSA 3V6DA 3SUPA 1K8AO 1HNZK 2E1ZA 4IFVA 4CJ4A 4IO9L 3BF3A 3E9LA 4E7IA 2O8FA 3HVTA 3DXKA 4FLUA 3TWHA 1T6CA 3TAQA 1EETA 5KPTA 3SUNA 3L2VA 4DF8A 2P51A 1VQ5N 4BRAA 1NKBA 3OS1A 3SNNA 4FJJA 1RT5A 2V7ZA 3QNOA 3U6FA 5ADXH 4BGAA 4E3SA 1XHXA 5KGXA 1S6PA 3OYIA 4CF8A 1HPZA 1IKXA 1BIZA 3CQYA 4A2BA 1NM1A 3O3HA 1RDDA 3VQAA 5AQKA 3VQ6A 1TUUA 4CFBA 3CCMN 4CF0A 3KD1E 3CJCA 3ZEUB 3HOTA 1X9MA 3DXMA 1GOCA 3AVBA 4DSIA 4K8ZA 1A5XA 3TARA 4KHWA 5JLHA 3AA5X 4CZGA 1C0FA 2E8AA 4B3RK 2NUBA 4HTLA 3THWA 1VQ7N 4CEZA 1TKXA 1YHQN 3KLIA 4DMNA 2ZJRL 4CGHA 1G15A 1S3XA 2PY5A 3FZFA 1HX1A 3U9DA 1VSEA 1BCMA 4O0JA 4DSLA 3RMAA 3C6AA 3SQ1A 3C6TA 3VQ5A 1RDAA 3TAGA 3T69A 2O8EB 5AFUA 5C24A 4KPYA 3AVLA 4JRQA 4OPJA 4RW7A 4Y0WA 5AQOA 3O9QA 4WQ5A 1QQOA 4MDBA 2P9NA 5LJWA 4BDPA 3TAEA 3SAFA 1W97L 4JAXA 5FROA 1MDUB 1LWFA 5I42A 2YJEA 3VF6A 5AQSA 4KHYA 4IFEA 1GLJO 3QEVA 2LSNA 2DY4A 3EY1A 1D9FA 4OJRA 2EX3A 4BROA 3CMAN 4FO0A 4DQRA 3VERA 3V9XA 5K14A 4CW7B 4ZHRA 1NK7A 1ATNA 3RRHA 3QIOA 1ZYQA 1DGKN 3T19A 4LY7A 3PV8A 2P9KA 2YNFA 3VESA 4BY9C 2RHKA 1ZBLA 1IBLK 2WTUA 1YAGA 2HHUA 4E1JA 4DR6K 2CGJA 4FLXA 4NB4A 3BY5A 4CEEA 4IOCL 4FYDA 3L2UA 2BE2A 4JLHA 3G10A 3K58A 1IO2A 5CY4A 1JL1A 3LDSA 3CJBA 1FJGK 3FGUA 3AVNA 4CZLA 4CHQA 5MLCQ 1WUAA 3C95A 1LV5A 1UOCA 1SKSA 3A0IX 4Y1CA 3BP8A 5I9EB 1YI2N 1NWKA 3MWTA 1JCEA 3VEVA 4DG1A 3ITHA 3QBXA 2XHBA 1CZ9A 3AGKA 4XH5A 1GLDG 4DF4A 4EP5A 4QAGA 4ISFA 2IS3A 1NMDA 2FBVA 4CEDA 3MMVA 3SMSA 1WB9A 4HTUA 2FXUA 3AA3A 5KTQA 4OKEA 1RT6A 3IFRA 4RW4A 1J5EK 4KHNA 4FJHA 3H3OB 1ZBFA 5F1XA 3PX4A 5CR4A 4B1UB 3L2QA 2I7PA 3WNFA 3EL2A 5BPNA 4JNEA 4J2BA 2XRIA 2G8WA 5DM6L 5FRNA 3PY8A 3KWIA 4BG8A 4BGBA 1BI4A 1SAZA 4FCYA 4DU3A 2QEXN 1XI1A 3P4IA 2VWBA 1XMQK 1BUPA 4ILJA 3C6HA 3V4IA 3HP9A 1HPMA 4W5RA 4RWTA 2QWRA 5EX5A 3E66A 3ZSQA 5FPDA 1XNQK 4KHUA 3TANA 1IBMK 3CHWA 1HYVA 2YKMA 3VQ4A 4H0VB 2VWJA 2IIRA 1XUPO 4BRQA 4CJPA 1RILA 3ULEB 3DRRA 3THXA 4JYAK 4QOZB 4O0IA 1XMOK 1NJZA 3PSFA 1H1VA 1RT1A 2A41A 3QICA 1RCHA 2Q97A 1KRPA 4JS5A 2UXBK 4K43A 3LDNA 1O1WA 1CXUA 2KW4A 2NRHA 2OYQA 1E4FT 3ENOA 4DV3K 1HJRA 3WXMB 4CZEA 5KRSA 5C42A 2P9SA 4JK7A 3TAMA 3WNHA 2F9TA 4B1XB 4I6MB 3IDHA 3F9MA 5BN8A 2A3ZA 3SZ2A 5M1KA 1WSIA 3O08A 4FJ9A 3MWPA 3SJHA 3H45C 4BVOA 1E3MA 3M8RA 3SBTA 1BL3A 4BC5A 3DAWA 1NGJA 4QCLA 4PL8A 3VEWA 1FKOA 3WXKA 4OLAA 3HI0A 4FM0A 4FWQA 1BO5O 1QQNA 4FJMA 1RT7A 3CCSN 4LFBK 4L8RB 1OVYA 4GVEA 1S22A 2RE2A 1NGHA 5AQFA 4DSKA 3WQTA 3ZT4A 5EVZA 2FBXA 3PX0A 3MXIA 4WF9L 1VRUA 3CQ8A 3GBTA 3C7NB 4ISEA 2DFFA 4Z4GA 3W0LA 1U45A 1HQUA 3NDKA 4FSVA 1KSPA 1D9DA 1N34K 2E5LK 3K9JA 3A5LC 4NXMK 2X6SA 4I7FA 3KKRA 3CXCM 4B08A 4F2RA 4X65K 4CFCA 2E6LA 4JKGA 4FPBA 4AF1A 2CH6A 3ATVA 2KLAA 2FSKA 3K5LA 3QLHA 1U2VA 3EEQA 1TK8A 5AFUH 3JSMA 4M45A 3CFOA 4BE0A 2HHTA 4CJFA 3OYCA 4DHYA 2HHWA 2XY5A 4OKJA 2PFUA 4H0TB 3P31A 2W42A 4I2QA 4BR0A 3HPOA 4CD1A 3MN6A 3F5TA 4DFKA 2NLXA 3LP1A 4DSFA 4CZMA 4MLEA 5SZTA 3HPHA 4IOXA 3HM9A 3LL3A 1RDUA 4R5PA 1J5OA 5AQZA 1Z05A 1S1WA 2VG6A 1GLFO 4IEEA 1RT2A 1LOTB 2G8HA 2D5RA 3V1OA 1C0MA 3CI5A 4E19A 3KK1A 3DI6A 3TI0A 1NOYA 1SL1A 3LZIA 3CJ7A 3MEGA 5E41A 1JLBA 3MXJA 3L4IA 4LF6K 4A59A 4FJ7A 4B1ZA 3M8PA 3JYTA 1J53A 1GLCG 2P1JA 3WNGA 4CGGA 1RFQA 2ZF5O 3ZX0A 2D0OA 4BRNA 1VQPN 1RBUA 5HRNA 3S3NA 2XO7A 2I7NA 5BRDA 2WBNA 1VQ8N 3AGRA 2KZMA 4EAHD 3NGYA 3PSIA 1B9DA 1KAYA 5GAHP 4M3TA 1SL2A 4H4MA 1YIJN 2ZWHA 4GV6A 2GEMA 3RTVA 4CZJA 3OYKA 4DTJA 1EX4A 3J8AA 3LDLA 1Q81O 4KBOA 4W5NA 1X9JA 3C94A 3DXKB 3O9RA 5BREA 4KHSA 4L3QA 4G9ZA 1BISA 4MO5A 1VQON 3DLBA 1BG3A 4LF4K 1QQCA 2E88A 1GLBG 3NGZA 1Q18A 1IG8A 2HBJA 4M3ZA 2Q3SA 3EZ5A 4CJKA 3L3VA 1NK0A 2A40A 3TSPA 3G25A 3SI6A 1KLMA 1L3TA 1Z26A 2ZJQL 3C7NA 1GOBA 4PL7A 3ZCMA 4OPKA 3WT0A 3G0ZA 4DV6K 3DOKA 2BH1A 1VSLA 3V81A 4E7HA 3CCRN 1BIUA 3CM6A 1RBVA 4FW1A 4DUZK 3QNNA 4DS5A 3THWB 5FRMA 2QK9A 1RBSA 2CGKA 3OYGA 3GE1A 4FJXA 4R79A 3H08A 1LCUA 1ZXOA 3AVIA 2ITMA 1HKCA 1VHXA 3H46O 4KB0A 3P39A 4IOAL 4ILHA 3CYMA 4J2EA 4H5NA 2NRXA 3AA2A 2OTLN 4OO1J 1WSHA 5AQIA 4IDKA 1NGDA 2KQ2A 3AO3A 4FWSA 4CK3A 4J2AA 2V51B 3OBYA 1KFSA 2P9NB 3I8BA 1TYQA 3UIQA 2NRRA 2Y1IA 5AZJA 4DR1K 2FF3B 1HKBA 3KVGA 5CHIA 4PKIA 3JS6A 3KK7A 1RDWX 1HQEA 4FVUA 4WCEL 4M3XA 3UKRB 3CCLN 3BEXA 1HYZA 3ENBA 5KPZA 3DLLL 3KLGA 4AHUA 4H0XB 4JI2K 4CZHA 2P9KB 2X6NA 3F73A 3AVCA 3THYA 3KTQA 2ASMA 5CZ2A 4RTFD 4HUEA 4FM2A 2NRVA 3AY9A 4Z94A 3I55N 1RNHA 2VG7A 5C0YA 4BWMA 3TTCA 4E89A 2YCHA 3C65A 1TK5A 3LALA 4AHSA 2QW9A 4O4GA 2HHSA 4CJ3A 1RTHA 3ZX3A 1SL0A 4B9VA 1IKWA 2AA4A 1YJ9N 2P9UB 3L2RA 1OH5A 1QSYA 1QSSA 1K6YA 3O4QA 5AQJA 3HBTA 4WFAL 4H5WA 3SK3A 4FWPA 3VMFB 2IVNA 4C8LA 4KHPK 4LSNA 3K9KA 3O5BA 3CCVN 3KWGA 3TTFA 3TAPA 3ZSWA 1HNXK 2KFZA 4JKAA 5DM7L 1OVQA 3P1GA 4NCBA 4FZXC 3ASMA 1QVFM 4FWRA 3KK2A 3CJ9A 4FLZA 4QS7A 4IBNA 1KLNA 4IZ9A 4JN4A 4RW6A 3D0PA 1OH6A 3JAMO 3IG1A 1KVCA 3T1AA 1FW6A 5IT9O 5DK5A 1ZBUA 3P83D 2VGNA 4CZFA 4LC9B 1TAQA 1T7PA 5CYQA 3MX5A 3WXIA 4LSLA 4KI6A 4DSJA 3A5NC 3SAGA 1TKZA 1EKEA 3ZT0A 1NKEA 1I39A 1BI4B 4BRGA 5T7BA 4F9OA 4DQIA 4DU4A 5TKWA 5HRRA 1TGOA 2W40A 1KQSM 2OPQA 1NJYA 4JI0K 1XC9A 3WXLA 3CJ1A 1N33K 4A57A 4Z4CA 1SS6A 2H3GX 5M1QA 3MX2A 4H4OA 2IVPA 1NU0A 3P38A 3T7ZA 3NF8A 4WQ4A 3THXB 4EZ9A 4JD2A 2QWQA 1NJWA 3J80O 4BRIA 1CZBA 2RF2A 3J7AP 5E84A 1ESVA 4CIGA 4KHQA 2X78A 2QA4N 3QETA 4OGCA 3O1BA 2GUIA 2E1YA 2DFHA 2F4VK 1YJWN 3B6OA 2XY6A 1Q86O 3WEEA 3ZLJA 2QXFA 3EKSA 4LH5A 2HSTA 2P9SB 4DQ8A 1ATSA 4O8KA 3VEZA 2DPNA 4CHNA 3QEIA 1SV5A 4KB1A 2QWPA 2CH5A 1TK0A 3M8SA 3HSCA 3OYEA 3RRGA 3UKRA 4FJIA 2E2PA 1BU6O 1BQNA 4YHHK 1YF5L 5M1PA 3T1YK 5HP1A 2GX9A 4PHTX 4ZTJA 3OYMA 4M3UA 3L0QA 2YJFA 1OH7A 1HLUA 1NGFA 2UUCK 3FE1A 3DM2A 1A5WA 1KVBA 3J7ZO 1J9AA 2A42A 1L5UA 1V4TA 3D6RA 4M3WA 3G6EN 1FKPA 3FZMA 5J2QA 3BZKA 4IKFA 3BGRA 5HRPA 2JWLA 3HSTB 3LDOA 4FJLA 4K25A 4OPHA 5AQHA 3AVKA 2P9UA 1UA0A 3KD5E 4B9SA 1C0TA 3FR0A 2BGGA 3TR8A 3N4PA 2RN2A 2ATQA 2IDOA 1VRTA 4JI1K 3LANA 3R6MA 3ZSZA 1U47A 2A1SA 3E01A 2YHBA 3CFPA 1U4BA 4JKGB 4CEBA 4ZTFA 3LP3A 2E2QA 3VQEA 4AHTA 5AQLA 3HP6A 3VOVA 2HMIA 1U2VB 2A1RA 4A5AA 4BR9A 3IMXA 3NH1A 3ATUA 1WSGA 3TABA 2YNIA 2ZQBA 4ILGB 4BR4A 4JI3K 4K41A 5BPMA 5GIOA 3OYDA 4N56A 5JMVA 1NNEA 5AQRA 2UXCK 2QWNA 3VQ9A 5CYMA 4DTNA 3CQXA 2QKBA 3C6UA 2WONA 5AQNA 4B3MK 1W7AA 3O3FA 2B4JA 4YORA 3VGLA 1J54A 4ID5A 4FJKA 4XIUA 3K2PA 5I3UA 1ASWA 2Z1HA 1NJIO 5A2QO 3MCPA 4BDZA 2VCPA 3DRSA 1TV6A 5IWAK 2XY7A 3K59A 5LL6Z 4W5TA 3SQ0A 2O8DB 4KTQA 5C15A 3UKUA 4OPAA 4FL9A 5LY3A 4CECA 2YNGA 4K42A 1IV0A 5GAEP 5J1EA 3AO2A 5AQQA 4DQPA 4FJ5A 3S9HA 4H0OA 2IC3A 4BE1A 1EP4A 5TKYA 1Q7YO 3PO5A 4CBUA 2Z1IA 3KK3A 2NRWA 1X9SA 3ZSOA 1BA0A 5J2NA 5AQVA 4CGJA 5EOYA 4M3RA 2NNWA 1UWBA 4AQYK 4CEQA 3GDQA 4CK1A 4CBXA 4CJ7A 4KI4A 1XNRK 1VSMA 4I9LA 3OYBA 4IDHA 4H5RA 3KIOA 3SUOA 2KKZA 4X66K 4DR7K 1JLEA 4OGEA 3AVMA 3NF7A 1YITN 1U6ZA 3D2FB 1NGGA 2OTJN 5CE3A 2GUPA 3DWLA 3OJUA 3OHRA 1NGEA 4W5QA 3QINA 1NK9A 3CG7A 2HNYA 4XH1A 3PIOL 3VQ7A 2FBTA 3VTHA 4PUOA 3CERA 4LD0A 4M7YA 5EU7A 5FPNA 4BR7A 4KH6A 4MLHA 1B9FA 3D2EA 1EO1A 4DV2K 4BR5A 1JXEA 1FXXA 3NHGA 4DV4K 1K73O 1S1TA 5BR9A 2HHXA 4B8CA 3TU5A 1JCFA 4IO8A 3V9UA 5AQPA 2QM1A 5E26A 1M1KO 3DLEA 1IH7A 4DV7K 2OPSA 5C2DA 1WBBA 4GY2B 4FOIA 3K5OA 4Z4EA 1LW2A 2G8UA 1S1XA 4FWNA 4FWOA 4CJRA 3L8BA 4PKGA 3OY9A 1NBWA 4M42A 4GV3A 5ELZA 3LAMA 3OYLA 2FSJA 2UUBK 3HTVA 4H03B 1N8RO 3OJSA 4B9QA 3T1HK 1BA1A 2GTDA 4CGIA 3O1WA 3V1RA 4ISGA 1HYSA 4MQ3A 4Z4HA 4CJQA 4PKHA 1BGXT 4LF8K 1YVNA 1ZBSA 4LFCK 1DEJA 4DKWA 2XY8A 3FFIA 4KH5A 5AQXA 2VYPA 3RR8A 1EXQA 4BE2A 1K8KA 3JXUA 5SWMA 1S9GA 3E9PA 4YOVA 2A6AA 1I94K 4BQZA 5HBMA 1WSJA 1NG9A 2D0CA 3FLCO 1LWCA 3A2FA 2ZD1A 4JI8K 4PWDA 4HVJA 5FLXO 1TYQB 5EXWA 1JLCA 2E6MA 5AZJB 2HBLA 3J81O 3NE6A 3I0RA 5AQMA 5BR8K 5FDLA 3EZWA 3F2KA 3TTDA 4FLYA 5BN9A 3HT3A 4E7JA 2QTDA 2FSNA 1RTDA 2Q0UA 1JXBA 5J2MA 2BANA 4RG8A 4DFJA 3QEPA 4FK0A 4F3TA 4BDYA 3K5MA 2O8DA 1C1BA 2HF4A 2WUSA 3O9TA 1NJXA 2F9WA 1Z25A 3CIPA 1XC3A 1KAXA 3OYAA 4JKEA 3AA4A 4O44A 1U48A 4I2PA 3SPZA 3DLRA 1KD1O 1X3MA 4YDUA 4H5VA 4JHDB 3NH0A 2GV9A 3THYB 1T03A 1ZBHA 4CEFA 2Q1NA 3O8MA 4UY8O 4B9UA 4CJ5A 4BC2A 4RW9A 4DR3K 4GV9A 3NF9A 4Y1DA 1RBTA 3RMBA 3DJCA 2D1KA 4LF7K 2E2OA 2PBDA 4CBWA 1EWRA 1BWFO 4HWIA 1MWKA 1HNIA 1K9MO 3GL1A 3VQ8A 2KTQA 3HXMA 1NMNA 1S6QA 2ZJPL 1ZBIA 2HVIA 4FZYA 2QKKA 1HR0K 1P8ZA 4V19S 2RKIA 2QWOA 1NOZA 3HJFA 3D2FA 1TKTA 4DTMA 3MAQA 3AAQA 4C8MA 5FPEA 1C0GA 1QHAA 2G8KA 3QFUA 3NH2A 2OA8A 3AO5A 3MN9A 2NRTA 1BHLA 1U49A 1VAZA 5JVHL 1GOAA 3S3OA 4BQLA 4Q0BA 1NLVA 3ZT3A 4FWLA 2EWSA 1HRHA 4E1MA 3NF6A 4IG3A 4FM1A 3G4SN 3LP0A 1YVUA 5C10A 3EO3A 4DQQA 2PZSA 2P5GA 2O8BA 4MFBA 1T6DA 3BZCA 4JI4K 4UQGA 3ZSVA 1LAWA 3O80A 3MCAB 2KZZA 3ZSRA 1RTIA 4B8AB 1IJJA 1RBRA 4QS8A 3OS0A 5GINA 2JLEA 3GG4A 5JICA 2Z1GA 4O5FA 3QDKA 5KPRA 1IKYA 1NGAA 4XH4A 5KGWA 4KAZA 2QI2A 5AQWA 2YHYA 4YFUA 4CF1A 2O8CA 3TSQA 4CFDA 1YT3A 4JD2B 3SQ4A 2P9PA 3CM5A 4YOTA 3KLFA 1S72N 4HCCA 3U4LA 1C1AA 2KHOA 2Q31A 4YNQA 1JJ2M 1T44A 4FJ8A 3VQCA 5KRTA 1Q9XA 3DRPA 4MO4A 3SYZA 3QEXA 4AM7A 3WEEB 5AZIA 1LWEA 3HVRA 2P5OA 2IVOA 4WFBL 5AQYA 4B9TA 2WC9A 4HUGA 3VTIA 3QERA 3O6WA 2B5JA 1L3VA 3V9ZA 1JLQA 3R9PA 2V52B 1JLGA 3EKUA 1N6QA 1Q8IA 4H0PA 2ZM6K 2FLOA 3R3LA 2HBKA 3QFPA 2G8FA 2OPRA 4JHDA 4YOYA 4FPAA 2IGIA 1IKVA 3FZKA 5AR0A 4CGDA 3PX6A 1S1VA 1TKDA 2PAVA 3M3ZA 1VSKA 2P9LA 3VQPA 1KCFA 2HHVA 1S5JA 4JKHA 1OH8A 2Q2RA 4B1WB 4CHPA 1QS4A 3VA3A 3MXMA 1HKGA 3SCXA 2ITGA 5JVGL 1WNSA 2ZGYA 4K0KK 4O5BA 4GKKK 3H1VX 5B8HA 3EYZA 1KXPA 3RR7A 2Q0RA 1QZ6A 4FK2A 4CHZA 2I5JA 4LF9K 3TSUA 4OX9K 1C0UA 2QWMA 4BR2A 1C6VA 1A5VA 1VQ6N 5GIPA 3KLEA 2VQFK 4HUFA 1J6ZA 3PIPL 2F7TA 3MN7A 1VSFA 4CCHA 4BREA 1HMVA 2P9IA 3ZSXA 5GADP 1XQSC 4HHTA 4CJLA 1QTMA 1T3VA 1LAVA 3ID6A 3VETA 3B8AX 2HF3A 1Q9YA 1SKRA 4DV0K 3QO9A 3VQQA 4JS4A 2HW3A 1DT9A 1GLEG 1SQKA 1U04A 3L6QA 4FZZA 4TSXA 4CJTA 3O4WA 2R7YA 2BDPA 4AHCA 4BRHA 2V7YA 4O8UA 3SMPA 4CFAA 4FXDA 1NK8A 4B3OA 3NBPA 3OW2M 1KAZA 4A62A 4DU1A 4YY3K 1NGCA 3ZX2A 3W3DA 4JV5K 2UUAK 2JWKA 1EWQA 2FC0A 2IOCA 1VQ9N 3AVAA 3H6EA 3UKUB 3NAEA 1T05A 1QZ5A 5HL7L 1JCGA 3A5MC 4B9NA 3LDQA 2F96A 3HO1A 1WBDA 4GNIA 3OYHA 3VA0A 2F8TA 5KQ8A 1DLOA 4JKCA 1RDBA 1JKHA 4N76A 3R1XA 4BC4A 4ELUA 4AHVA 3VQDA 3LM9A 5JS1A 1TAUA 4A61A 3CCJN 4E0DA 1XWLA 4Z0UA 3D7EO 3L4QA 3EE8A 2D0AA 2B6AA 2ZGZA 1NGIA 4W5OA 4B9LA 3I56N 1WLJA 3G71N 2X74A 4NXNK 4H0YB 3D45A 1X3NA 4CJWA 4WE1A 1UA1A 4WQ4C 2BTFA 3E9OA 4IJNA 1YXQA 2YHXA 3CFRA 4U7BA 1N32K 3GOIA 4CHOA 3OS2A 3CCEN 3QESA 4J8FA 3WXJA 4PQUA 3CMEN 1BQMA 4BRLA 3D2EB 3WQUA 3NGIA 2OCEA 4Z4FA 1RDCA 2FF6A 3PLAA 4WQ5C 2ZE2A 2NZTA 4DLEA 3RSEA 4KV8A 1YTAA 4BRCA 2UYTA 3EE9A 3UB5A 4E7KA 2ASPA 3QBWA 4C1NI 3FZLA 1F21A 4BRDA 4J2DA 3S3MA 2ASOA 4JKBA 1YUWA 1BCOA 2W6KA 2GWJA 3NCIA 3CPWM 2HNDA 4CZKA 1OKJA 3UE5A 1DKGD 4CIFA 5EY4A 1KTQA 4DCHA 1O13A 3IUCA 4GKJK 5HROA 4ICLA 4IXCA 4EIAA 2DTUA 3S41A 4DR5K 1S9EA 3U8XA 3KJVA 3DOLA 3U9ZA 4OKKA 4C8NA 4DWIA 4CE9A 2WFBA 3ISNC 3M6GA 4AM6A 1JL2A 3SPYA 4KFBA 3VQBA 3H1QA 1S1UA 1K8KB 3ZYYX 2GBZA 3WNEA 3OVNA 3U3YA 5J2PA 3VF2A 4KH4A 4CJUA 4JKDA 1VK0A 1ASUA 2YNHA 3PO4A 1ASVA 4H8KA 4AH9A 3J7YP 1DTQA 3ENHA 2QWLA 4EHUA 1R59O 1D8YA 2RPIA 3MN5A 2UU9K 4JK9A 4M7XA 4EP4A 3SAHA 2D4WA 1VSDA 1TL3A 1N36K 1L3UA 3V9SA 3ZEUA 2AJQA 4EFHA 4M41A 2Z1JA 1M90O 5HRSA 3VENA 1LW0A 4B3SK 4EZ6A 4ELTA 3HPGA 4KKOA 2HNZA 4FW2A 4DB3A 1VQLN 3R8EA 3MDQA 4DQSA 4DLGA 2OANA 3DLGA 4B1VA 4HCBA 4CF9A 3VEOA 4WFNL 5D3GA 1RTJA 1EQYA 3K57A 3LPTA 4GW6A 1W9HA 3AVJA 3VN5A 4DTUA 5M1OA 1RGIA 3M1FA 2O8EA 3MECA 3DLHA 4BVPA 4NCAA 3SLCA 2FBYA 2YKNA 4B3TK 5AQTA 1CZAN 5KI6A 4B9MA 2YV0X 3AAPA 4BRPA 3QEWA 3SBGA 3IRXA 3CD6N 4BRMA 1V4SA 3V9WA 4Z4IA 2OZSA 1VSHA 1WN7A 1WAJA 3HRGA 4KRFA 3ULDA 1SKWA 4AILC 4C23A 4N5SA 4FLTA 3O9UA 4B1YB 4F2SA 1JLAA 4C1NK 2PYLA 4DS4A 5DMRA 1REVA 3ZSYA 5C25A 1HUXA 3CC2N 2YX6A 4BACA 1VQ4N 3VGMA 5HLFA 2A5XA 4JEPA 5LJVA 5M1NA 4LH4A 2O8BB 4N41A 1N5YA 3AARA 1HJOA 4FWKA 3O3GA 3HK2A 4CEAA 2JGUA 2O4IA 5F2RA 4G1QA 1TUYA 4X64K 4YOUA 5JS2A 3AVHA 3M5RA 2G8VA 4YOWA 3HYFA 3B6PA 2HVHA 2D0PA 3LP2A 3DYAA 3EN9A 1B92A 2O8CB 1ILYA 4NYFA 5H1SQ 1KC8O 2AP1A 3F9KA 1Q82O 2HB5A 3AV9A 3AVFA 1D4XA 4I9QA 3HM8A 2P9PB 3MEEA 4JK8A 3KHYA 1QSLA 1BDGA 1SZ2A 1ITGA 3DMJA 4DTOA 1BOTO 5AZIB 1Y64A 5ADXA 1KFDA 3QIPA 1KVAA 4Q5VA 4F3OA 3A5OC 1QHTA 4CJSA 3FZHA 2YHWA 3VGKA 3QMLA 1Y97A 4DFMA 4CD3A 1VQNN 1ZC6A 1L3SA 3NMUA 2IAJA 4CGFA 4JI5K 3DLKA 4NYNA 4MDAA 3CJAA 3O9SA 5M1FA 3OYFA 4BWJA 3K5NA 1D5AA 4DTRA 1NK6A 1RT3A 1G99A 5HOOA 4M3YA 3OA9A 3ZETB 4A5BA 4FJNA 2YI1A 3AO4A 1NK4A 3K0SA 5LMUK 1SUQA 4FOEA 2O4GA 1R0AA 1VSJA 1X9WA 1C1CA 5AQGA 2P9LB 2VWKA 4FWMA 3VEXA 1ATRA 4IEIA 3CC4N 3ULEA 3I33A 4E1NA 3KLHA 4CERA 2PYJA 4DR2K 1HNVA 4CJVA 4F4KA 1CXQA 3SV3A 2KFNA 4NLBA 1HNWK 4OVLA 2QXLA 4JI6K 4IWVA 3RMCA 3CC7N 1RT4A 4DV5K 4CHYA 3LPUA 4PY5A 3SJJA 4LFAK 4KREA 3LM2A 1Z6RA 4JI7K 4H5TA 3SQ2A 1WAFA 2GWKA 4I6MA 3A8YA 2W41A 3LWMA 4DFPA 3ALYA 4DTXA 3BUZB 3VF4A 3CETA 5BPLA 4YDUC 4XEIA 3ZT2A 2HMPA 2P9IB 4CZIA 5F0XA 1JLFA 1NK5A 2O8FB 1YTUA 2HHHK 3I8DA 1IBKK 1QQMA 2VQEK 2E2NA 3NVKA 3FFKB 2J4RA 2YHAA 4ID1A 4O55A 5CZ1A 4ELVA 4F8RA 3THVA 1IG9A 3AVGA 3T3FA 1WSEA 4CIEA 4CEOA 4E7LA 4EHTA 3HZ6A 4DUYK 4BRFA 3Q7BA 3V1QA 2DFEA 3KZBA 2E4LA 3CCQN 3AO1A 3IS9A 5BRHA 1GLLO 1FK9A 4DTSA 5LMNK 2ETJA 4K8XA 2Q36A 3BDPA 2OZMA 3NFAA 5FPMA 2F8SA 3KKSA 3RWUA 3DXMB 3TPQA 1TVRA
chains in the Genus database with same CATH topology
1IBMK 2UXCK 4CW7B 1HR0K 4V19S 4B3MK 2F4VK 4YY3K 4JYAK 1XMOK 4JV5K 5LMUK 2UUAK 4GKJK 4DV7K 1IBLK 4DR5K 4DR6K 3J7AP 2UXBK 5A2QO 2ZM6K 4CVNE 2UUBK 4DV6K 5IWAK 3T1HK 5LL6Z 4DV3K 4KHPK 4DR2K 4YHHK 4LF8K 3OTOK 4LFCK 1FJGK 3T1YK 1HNWK 4JI6K 1HNXK 4DUZK 3J7YP 4DV5K 4LFAK 2UUCK 2UU9K 4JI7K 1I94K 4X64K 4LF6K 4B3RK 4K0KK 2UXDK 1N36K 4GKKK 4JI8K 4DR4K 4JI4K 4DV1K 3JAMO 5FLXO 4LF5K 4LF9K 4B3SK 4AQYK 3J81O 4OX9K 5IT9O 5BR8K 1XNRK 4LFBK 2HHHK 4X66K 1IBKK 4NXNK 4DR7K 1J5EK 2VQEK 4X62K 2VQFK 4DR1K 1N32K 4DUYK 4JI1K 4JI0K 1N33K 1N34K 2E5LK 4DV0K 5AJ3K 4NXMK 5LMNK 1XMQK 4DR3K 4B3TK 4X65K 4LF7K 4JI2K 4DV2K 3J80O 4JI3K 4JI5K 1XNQK 4DV4K 1HNZK 4LF4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM K;  2UXC K;  4CW7 B;  1HR0 K;  4V19 S;  4B3M K;  2F4V K;  4YY3 K;  4JYA K;  1XMO K;  4JV5 K;  5LMU K;  2UUA K;  4GKJ K;  4DV7 K;  1IBL K;  4DR5 K;  4DR6 K;  3J7A P;  2UXB K;  5A2Q O;  2ZM6 K;  4CVN E;  2UUB K;  4DV6 K;  5IWA K;  3T1H K;  5LL6 Z;  4DV3 K;  4KHP K;  4DR2 K;  4YHH K;  4LF8 K;  3OTO K;  4LFC K;  1FJG K;  3T1Y K;  1HNW K;  4JI6 K;  1HNX K;  4DUZ K;  3J7Y P;  4DV5 K;  4LFA K;  2UUC K;  2UU9 K;  4JI7 K;  1I94 K;  4X64 K;  4LF6 K;  4B3R K;  4K0K K;  2UXD K;  1N36 K;  4GKK K;  4JI8 K;  4DR4 K;  4JI4 K;  4DV1 K;  3JAM O;  5FLX O;  4LF5 K;  4LF9 K;  4B3S K;  4AQY K;  3J81 O;  4OX9 K;  5IT9 O;  5BR8 K;  1XNR K;  4LFB K;  2HHH K;  4X66 K;  1IBK K;  4NXN K;  4DR7 K;  1J5E K;  2VQE K;  4X62 K;  2VQF K;  4DR1 K;  1N32 K;  4DUY K;  4JI1 K;  4JI0 K;  1N33 K;  1N34 K;  2E5L K;  4DV0 K;  5AJ3 K;  4NXM K;  5LMN K;  1XMQ K;  4DR3 K;  4B3T K;  4X65 K;  4LF7 K;  4JI2 K;  4DV2 K;  3J80 O;  4JI3 K;  4JI5 K;  1XNQ K;  4DV4 K;  1HNZ K;  4LF4 K; 
#chains in the Genus database with same CATH topology
 3M8Q A;  3L3U A;  4FVM A;  4CES A;  1VQM N;  1MWM A;  4OLB A;  2GEL A;  3VPZ A;  1UAX A;  4WYB A;  4BC3 A;  3OYN A;  4BRK A;  4C8K A;  4C8O A;  1WOQ A;  3LWL A;  3CF5 L;  3LAK A;  3H3N O;  1WSF A;  4CVN E;  4IJA A;  3TAF A;  1GLA G;  3E1Y A;  4RW8 A;  3PUF A;  4BG9 A;  3OTO K;  3WUH A;  1YJN N;  4FJG A;  2WOM A;  4KO0 A;  1VSI A;  3U3G A;  3ID8 A;  3SUQ A;  4N47 A;  2CGL A;  3CPE A;  1MA9 B;  3P5J A;  1NGB A;  5AQU A;  5C12 A;  5C2F A;  1QVG M;  2G8I A;  4DTP A;  2EHG A;  1X1P A;  4JRP A;  2HOE A;  1VQK N;  4IG0 A;  3IKM A;  1TL1 A;  3ZET A;  3C0B A;  3LZJ A;  2UXD K;  3CCU N;  4NCG A;  4DR4 K;  2D0B A;  3BF1 A;  4DV1 K;  4LF5 K;  4CI6 A;  3RMD A;  4CJE A;  1W2B M;  4FK4 A;  3O4N A;  2VG5 A;  3QB0 A;  4NO7 A;  1CLQ A;  4DSE A;  4CK2 A;  1XHZ A;  2E20 A;  3LDP A;  3OBW A;  2HHQ A;  5GAG P;  4GMJ B;  4M63 C;  5JLF A;  3OYJ A;  3L2W A;  4NLC A;  1T8E A;  4X62 K;  3IAY A;  2W6L A;  3RSE B;  1E4G T;  4RCH A;  1W0H A;  1DTT A;  4KTW A;  1QE1 A;  2HBM A;  1I3A A;  4KTZ A;  4CF2 A;  2NRZ A;  4IFY A;  4JKF A;  3SV4 A;  4U67 L;  4FLV A;  1NKC A;  4AHR A;  3Q7C A;  5BRF A;  2BUP A;  3HL8 A;  4FLW A;  5AJ3 K;  3MED A;  4PA1 A;  3VEY A;  2OPP A;  2VGM A;  4YOX A;  1P90 A;  4QS9 A;  4GVM A;  5KQD A;  2Y1J A;  3N4Q A;  4A2A A;  3ZT1 A;  1MU2 A;  3I0S A;  3MK6 A;  3NVM A;  3RVC A;  3HOS A;  3V6D A;  3SUP A;  1K8A O;  1HNZ K;  2E1Z A;  4IFV A;  4CJ4 A;  4IO9 L;  3BF3 A;  3E9L A;  4E7I A;  2O8F A;  3HVT A;  3DXK A;  4FLU A;  3TWH A;  1T6C A;  3TAQ A;  1EET A;  5KPT A;  3SUN A;  3L2V A;  4DF8 A;  2P51 A;  1VQ5 N;  4BRA A;  1NKB A;  3OS1 A;  3SNN A;  4FJJ A;  1RT5 A;  2V7Z A;  3QNO A;  3U6F A;  5ADX H;  4BGA A;  4E3S A;  1XHX A;  5KGX A;  1S6P A;  3OYI A;  4CF8 A;  1HPZ A;  1IKX A;  1BIZ A;  3CQY A;  4A2B A;  1NM1 A;  3O3H A;  1RDD A;  3VQA A;  5AQK A;  3VQ6 A;  1TUU A;  4CFB A;  3CCM N;  4CF0 A;  3KD1 E;  3CJC A;  3ZEU B;  3HOT A;  1X9M A;  3DXM A;  1GOC A;  3AVB A;  4DSI A;  4K8Z A;  1A5X A;  3TAR A;  4KHW A;  5JLH A;  3AA5 X;  4CZG A;  1C0F A;  2E8A A;  4B3R K;  2NUB A;  4HTL A;  3THW A;  1VQ7 N;  4CEZ A;  1TKX A;  1YHQ N;  3KLI A;  4DMN A;  2ZJR L;  4CGH A;  1G15 A;  1S3X A;  2PY5 A;  3FZF A;  1HX1 A;  3U9D A;  1VSE A;  1BCM A;  4O0J A;  4DSL A;  3RMA A;  3C6A A;  3SQ1 A;  3C6T A;  3VQ5 A;  1RDA A;  3TAG A;  3T69 A;  2O8E B;  5AFU A;  5C24 A;  4KPY A;  3AVL A;  4JRQ A;  4OPJ A;  4RW7 A;  4Y0W A;  5AQO A;  3O9Q A;  4WQ5 A;  1QQO A;  4MDB A;  2P9N A;  5LJW A;  4BDP A;  3TAE A;  3SAF A;  1W97 L;  4JAX A;  5FRO A;  1MDU B;  1LWF A;  5I42 A;  2YJE A;  3VF6 A;  5AQS A;  4KHY A;  4IFE A;  1GLJ O;  3QEV A;  2LSN A;  2DY4 A;  3EY1 A;  1D9F A;  4OJR A;  2EX3 A;  4BRO A;  3CMA N;  4FO0 A;  4DQR A;  3VER A;  3V9X A;  5K14 A;  4CW7 B;  4ZHR A;  1NK7 A;  1ATN A;  3RRH A;  3QIO A;  1ZYQ A;  1DGK N;  3T19 A;  4LY7 A;  3PV8 A;  2P9K A;  2YNF A;  3VES A;  4BY9 C;  2RHK A;  1ZBL A;  1IBL K;  2WTU A;  1YAG A;  2HHU A;  4E1J A;  4DR6 K;  2CGJ A;  4FLX A;  4NB4 A;  3BY5 A;  4CEE A;  4IOC L;  4FYD A;  3L2U A;  2BE2 A;  4JLH A;  3G10 A;  3K58 A;  1IO2 A;  5CY4 A;  1JL1 A;  3LDS A;  3CJB A;  1FJG K;  3FGU A;  3AVN A;  4CZL A;  4CHQ A;  5MLC Q;  1WUA A;  3C95 A;  1LV5 A;  1UOC A;  1SKS A;  3A0I X;  4Y1C A;  3BP8 A;  5I9E B;  1YI2 N;  1NWK A;  3MWT A;  1JCE A;  3VEV A;  4DG1 A;  3ITH A;  3QBX A;  2XHB A;  1CZ9 A;  3AGK A;  4XH5 A;  1GLD G;  4DF4 A;  4EP5 A;  4QAG A;  4ISF A;  2IS3 A;  1NMD A;  2FBV A;  4CED A;  3MMV A;  3SMS A;  1WB9 A;  4HTU A;  2FXU A;  3AA3 A;  5KTQ A;  4OKE A;  1RT6 A;  3IFR A;  4RW4 A;  1J5E K;  4KHN A;  4FJH A;  3H3O B;  1ZBF A;  5F1X A;  3PX4 A;  5CR4 A;  4B1U B;  3L2Q A;  2I7P A;  3WNF A;  3EL2 A;  5BPN A;  4JNE A;  4J2B A;  2XRI A;  2G8W A;  5DM6 L;  5FRN A;  3PY8 A;  3KWI A;  4BG8 A;  4BGB A;  1BI4 A;  1SAZ A;  4FCY A;  4DU3 A;  2QEX N;  1XI1 A;  3P4I A;  2VWB A;  1XMQ K;  1BUP A;  4ILJ A;  3C6H A;  3V4I A;  3HP9 A;  1HPM A;  4W5R A;  4RWT A;  2QWR A;  5EX5 A;  3E66 A;  3ZSQ A;  5FPD A;  1XNQ K;  4KHU A;  3TAN A;  1IBM K;  3CHW A;  1HYV A;  2YKM A;  3VQ4 A;  4H0V B;  2VWJ A;  2IIR A;  1XUP O;  4BRQ A;  4CJP A;  1RIL A;  3ULE B;  3DRR A;  3THX A;  4JYA K;  4QOZ B;  4O0I A;  1XMO K;  1NJZ A;  3PSF A;  1H1V A;  1RT1 A;  2A41 A;  3QIC A;  1RCH A;  2Q97 A;  1KRP A;  4JS5 A;  2UXB K;  4K43 A;  3LDN A;  1O1W A;  1CXU A;  2KW4 A;  2NRH A;  2OYQ A;  1E4F T;  3ENO A;  4DV3 K;  1HJR A;  3WXM B;  4CZE A;  5KRS A;  5C42 A;  2P9S A;  4JK7 A;  3TAM A;  3WNH A;  2F9T A;  4B1X B;  4I6M B;  3IDH A;  3F9M A;  5BN8 A;  2A3Z A;  3SZ2 A;  5M1K A;  1WSI A;  3O08 A;  4FJ9 A;  3MWP A;  3SJH A;  3H45 C;  4BVO A;  1E3M A;  3M8R A;  3SBT A;  1BL3 A;  4BC5 A;  3DAW A;  1NGJ A;  4QCL A;  4PL8 A;  3VEW A;  1FKO A;  3WXK A;  4OLA A;  3HI0 A;  4FM0 A;  4FWQ A;  1BO5 O;  1QQN A;  4FJM A;  1RT7 A;  3CCS N;  4LFB K;  4L8R B;  1OVY A;  4GVE A;  1S22 A;  2RE2 A;  1NGH A;  5AQF A;  4DSK A;  3WQT A;  3ZT4 A;  5EVZ A;  2FBX A;  3PX0 A;  3MXI A;  4WF9 L;  1VRU A;  3CQ8 A;  3GBT A;  3C7N B;  4ISE A;  2DFF A;  4Z4G A;  3W0L A;  1U45 A;  1HQU A;  3NDK A;  4FSV A;  1KSP A;  1D9D A;  1N34 K;  2E5L K;  3K9J A;  3A5L C;  4NXM K;  2X6S A;  4I7F A;  3KKR A;  3CXC M;  4B08 A;  4F2R A;  4X65 K;  4CFC A;  2E6L A;  4JKG A;  4FPB A;  4AF1 A;  2CH6 A;  3ATV A;  2KLA A;  2FSK A;  3K5L A;  3QLH A;  1U2V A;  3EEQ A;  1TK8 A;  5AFU H;  3JSM A;  4M45 A;  3CFO A;  4BE0 A;  2HHT A;  4CJF A;  3OYC A;  4DHY A;  2HHW A;  2XY5 A;  4OKJ A;  2PFU A;  4H0T B;  3P31 A;  2W42 A;  4I2Q A;  4BR0 A;  3HPO A;  4CD1 A;  3MN6 A;  3F5T A;  4DFK A;  2NLX A;  3LP1 A;  4DSF A;  4CZM A;  4MLE A;  5SZT A;  3HPH A;  4IOX A;  3HM9 A;  3LL3 A;  1RDU A;  4R5P A;  1J5O A;  5AQZ A;  1Z05 A;  1S1W A;  2VG6 A;  1GLF O;  4IEE A;  1RT2 A;  1LOT B;  2G8H A;  2D5R A;  3V1O A;  1C0M A;  3CI5 A;  4E19 A;  3KK1 A;  3DI6 A;  3TI0 A;  1NOY A;  1SL1 A;  3LZI A;  3CJ7 A;  3MEG A;  5E41 A;  1JLB A;  3MXJ A;  3L4I A;  4LF6 K;  4A59 A;  4FJ7 A;  4B1Z A;  3M8P A;  3JYT A;  1J53 A;  1GLC G;  2P1J A;  3WNG A;  4CGG A;  1RFQ A;  2ZF5 O;  3ZX0 A;  2D0O A;  4BRN A;  1VQP N;  1RBU A;  5HRN A;  3S3N A;  2XO7 A;  2I7N A;  5BRD A;  2WBN A;  1VQ8 N;  3AGR A;  2KZM A;  4EAH D;  3NGY A;  3PSI A;  1B9D A;  1KAY A;  5GAH P;  4M3T A;  1SL2 A;  4H4M A;  1YIJ N;  2ZWH A;  4GV6 A;  2GEM A;  3RTV A;  4CZJ A;  3OYK A;  4DTJ A;  1EX4 A;  3J8A A;  3LDL A;  1Q81 O;  4KBO A;  4W5N A;  1X9J A;  3C94 A;  3DXK B;  3O9R A;  5BRE A;  4KHS A;  4L3Q A;  4G9Z A;  1BIS A;  4MO5 A;  1VQO N;  3DLB A;  1BG3 A;  4LF4 K;  1QQC A;  2E88 A;  1GLB G;  3NGZ A;  1Q18 A;  1IG8 A;  2HBJ A;  4M3Z A;  2Q3S A;  3EZ5 A;  4CJK A;  3L3V A;  1NK0 A;  2A40 A;  3TSP A;  3G25 A;  3SI6 A;  1KLM A;  1L3T A;  1Z26 A;  2ZJQ L;  3C7N A;  1GOB A;  4PL7 A;  3ZCM A;  4OPK A;  3WT0 A;  3G0Z A;  4DV6 K;  3DOK A;  2BH1 A;  1VSL A;  3V81 A;  4E7H A;  3CCR N;  1BIU A;  3CM6 A;  1RBV A;  4FW1 A;  4DUZ K;  3QNN A;  4DS5 A;  3THW B;  5FRM A;  2QK9 A;  1RBS A;  2CGK A;  3OYG A;  3GE1 A;  4FJX A;  4R79 A;  3H08 A;  1LCU A;  1ZXO A;  3AVI A;  2ITM A;  1HKC A;  1VHX A;  3H46 O;  4KB0 A;  3P39 A;  4IOA L;  4ILH A;  3CYM A;  4J2E A;  4H5N A;  2NRX A;  3AA2 A;  2OTL N;  4OO1 J;  1WSH A;  5AQI A;  4IDK A;  1NGD A;  2KQ2 A;  3AO3 A;  4FWS A;  4CK3 A;  4J2A A;  2V51 B;  3OBY A;  1KFS A;  2P9N B;  3I8B A;  1TYQ A;  3UIQ A;  2NRR A;  2Y1I A;  5AZJ A;  4DR1 K;  2FF3 B;  1HKB A;  3KVG A;  5CHI A;  4PKI A;  3JS6 A;  3KK7 A;  1RDW X;  1HQE A;  4FVU A;  4WCE L;  4M3X A;  3UKR B;  3CCL N;  3BEX A;  1HYZ A;  3ENB A;  5KPZ A;  3DLL L;  3KLG A;  4AHU A;  4H0X B;  4JI2 K;  4CZH A;  2P9K B;  2X6N A;  3F73 A;  3AVC A;  3THY A;  3KTQ A;  2ASM A;  5CZ2 A;  4RTF D;  4HUE A;  4FM2 A;  2NRV A;  3AY9 A;  4Z94 A;  3I55 N;  1RNH A;  2VG7 A;  5C0Y A;  4BWM A;  3TTC A;  4E89 A;  2YCH A;  3C65 A;  1TK5 A;  3LAL A;  4AHS A;  2QW9 A;  4O4G A;  2HHS A;  4CJ3 A;  1RTH A;  3ZX3 A;  1SL0 A;  4B9V A;  1IKW A;  2AA4 A;  1YJ9 N;  2P9U B;  3L2R A;  1OH5 A;  1QSY A;  1QSS A;  1K6Y A;  3O4Q A;  5AQJ A;  3HBT A;  4WFA L;  4H5W A;  3SK3 A;  4FWP A;  3VMF B;  2IVN A;  4C8L A;  4KHP K;  4LSN A;  3K9K A;  3O5B A;  3CCV N;  3KWG A;  3TTF A;  3TAP A;  3ZSW A;  1HNX K;  2KFZ A;  4JKA A;  5DM7 L;  1OVQ A;  3P1G A;  4NCB A;  4FZX C;  3ASM A;  1QVF M;  4FWR A;  3KK2 A;  3CJ9 A;  4FLZ A;  4QS7 A;  4IBN A;  1KLN A;  4IZ9 A;  4JN4 A;  4RW6 A;  3D0P A;  1OH6 A;  3JAM O;  3IG1 A;  1KVC A;  3T1A A;  1FW6 A;  5IT9 O;  5DK5 A;  1ZBU A;  3P83 D;  2VGN A;  4CZF A;  4LC9 B;  1TAQ A;  1T7P A;  5CYQ A;  3MX5 A;  3WXI A;  4LSL A;  4KI6 A;  4DSJ A;  3A5N C;  3SAG A;  1TKZ A;  1EKE A;  3ZT0 A;  1NKE A;  1I39 A;  1BI4 B;  4BRG A;  5T7B A;  4F9O A;  4DQI A;  4DU4 A;  5TKW A;  5HRR A;  1TGO A;  2W40 A;  1KQS M;  2OPQ A;  1NJY A;  4JI0 K;  1XC9 A;  3WXL A;  3CJ1 A;  1N33 K;  4A57 A;  4Z4C A;  1SS6 A;  2H3G X;  5M1Q A;  3MX2 A;  4H4O A;  2IVP A;  1NU0 A;  3P38 A;  3T7Z A;  3NF8 A;  4WQ4 A;  3THX B;  4EZ9 A;  4JD2 A;  2QWQ A;  1NJW A;  3J80 O;  4BRI A;  1CZB A;  2RF2 A;  3J7A P;  5E84 A;  1ESV A;  4CIG A;  4KHQ A;  2X78 A;  2QA4 N;  3QET A;  4OGC A;  3O1B A;  2GUI A;  2E1Y A;  2DFH A;  2F4V K;  1YJW N;  3B6O A;  2XY6 A;  1Q86 O;  3WEE A;  3ZLJ A;  2QXF A;  3EKS A;  4LH5 A;  2HST A;  2P9S B;  4DQ8 A;  1ATS A;  4O8K A;  3VEZ A;  2DPN A;  4CHN A;  3QEI A;  1SV5 A;  4KB1 A;  2QWP A;  2CH5 A;  1TK0 A;  3M8S A;  3HSC A;  3OYE A;  3RRG A;  3UKR A;  4FJI A;  2E2P A;  1BU6 O;  1BQN A;  4YHH K;  1YF5 L;  5M1P A;  3T1Y K;  5HP1 A;  2GX9 A;  4PHT X;  4ZTJ A;  3OYM A;  4M3U A;  3L0Q A;  2YJF A;  1OH7 A;  1HLU A;  1NGF A;  2UUC K;  3FE1 A;  3DM2 A;  1A5W A;  1KVB A;  3J7Z O;  1J9A A;  2A42 A;  1L5U A;  1V4T A;  3D6R A;  4M3W A;  3G6E N;  1FKP A;  3FZM A;  5J2Q A;  3BZK A;  4IKF A;  3BGR A;  5HRP A;  2JWL A;  3HST B;  3LDO A;  4FJL A;  4K25 A;  4OPH A;  5AQH A;  3AVK A;  2P9U A;  1UA0 A;  3KD5 E;  4B9S A;  1C0T A;  3FR0 A;  2BGG A;  3TR8 A;  3N4P A;  2RN2 A;  2ATQ A;  2IDO A;  1VRT A;  4JI1 K;  3LAN A;  3R6M A;  3ZSZ A;  1U47 A;  2A1S A;  3E01 A;  2YHB A;  3CFP A;  1U4B A;  4JKG B;  4CEB A;  4ZTF A;  3LP3 A;  2E2Q A;  3VQE A;  4AHT A;  5AQL A;  3HP6 A;  3VOV A;  2HMI A;  1U2V B;  2A1R A;  4A5A A;  4BR9 A;  3IMX A;  3NH1 A;  3ATU A;  1WSG A;  3TAB A;  2YNI A;  2ZQB A;  4ILG B;  4BR4 A;  4JI3 K;  4K41 A;  5BPM A;  5GIO A;  3OYD A;  4N56 A;  5JMV A;  1NNE A;  5AQR A;  2UXC K;  2QWN A;  3VQ9 A;  5CYM A;  4DTN A;  3CQX A;  2QKB A;  3C6U A;  2WON A;  5AQN A;  4B3M K;  1W7A A;  3O3F A;  2B4J A;  4YOR A;  3VGL A;  1J54 A;  4ID5 A;  4FJK A;  4XIU A;  3K2P A;  5I3U A;  1ASW A;  2Z1H A;  1NJI O;  5A2Q O;  3MCP A;  4BDZ A;  2VCP A;  3DRS A;  1TV6 A;  5IWA K;  2XY7 A;  3K59 A;  5LL6 Z;  4W5T A;  3SQ0 A;  2O8D B;  4KTQ A;  5C15 A;  3UKU A;  4OPA A;  4FL9 A;  5LY3 A;  4CEC A;  2YNG A;  4K42 A;  1IV0 A;  5GAE P;  5J1E A;  3AO2 A;  5AQQ A;  4DQP A;  4FJ5 A;  3S9H A;  4H0O A;  2IC3 A;  4BE1 A;  1EP4 A;  5TKY A;  1Q7Y O;  3PO5 A;  4CBU A;  2Z1I A;  3KK3 A;  2NRW A;  1X9S A;  3ZSO A;  1BA0 A;  5J2N A;  5AQV A;  4CGJ A;  5EOY A;  4M3R A;  2NNW A;  1UWB A;  4AQY K;  4CEQ A;  3GDQ A;  4CK1 A;  4CBX A;  4CJ7 A;  4KI4 A;  1XNR K;  1VSM A;  4I9L A;  3OYB A;  4IDH A;  4H5R A;  3KIO A;  3SUO A;  2KKZ A;  4X66 K;  4DR7 K;  1JLE A;  4OGE A;  3AVM A;  3NF7 A;  1YIT N;  1U6Z A;  3D2F B;  1NGG A;  2OTJ N;  5CE3 A;  2GUP A;  3DWL A;  3OJU A;  3OHR A;  1NGE A;  4W5Q A;  3QIN A;  1NK9 A;  3CG7 A;  2HNY A;  4XH1 A;  3PIO L;  3VQ7 A;  2FBT A;  3VTH A;  4PUO A;  3CER A;  4LD0 A;  4M7Y A;  5EU7 A;  5FPN A;  4BR7 A;  4KH6 A;  4MLH A;  1B9F A;  3D2E A;  1EO1 A;  4DV2 K;  4BR5 A;  1JXE A;  1FXX A;  3NHG A;  4DV4 K;  1K73 O;  1S1T A;  5BR9 A;  2HHX A;  4B8C A;  3TU5 A;  1JCF A;  4IO8 A;  3V9U A;  5AQP A;  2QM1 A;  5E26 A;  1M1K O;  3DLE A;  1IH7 A;  4DV7 K;  2OPS A;  5C2D A;  1WBB A;  4GY2 B;  4FOI A;  3K5O A;  4Z4E A;  1LW2 A;  2G8U A;  1S1X A;  4FWN A;  4FWO A;  4CJR A;  3L8B A;  4PKG A;  3OY9 A;  1NBW A;  4M42 A;  4GV3 A;  5ELZ A;  3LAM A;  3OYL A;  2FSJ A;  2UUB K;  3HTV A;  4H03 B;  1N8R O;  3OJS A;  4B9Q A;  3T1H K;  1BA1 A;  2GTD A;  4CGI A;  3O1W A;  3V1R A;  4ISG A;  1HYS A;  4MQ3 A;  4Z4H A;  4CJQ A;  4PKH A;  1BGX T;  4LF8 K;  1YVN A;  1ZBS A;  4LFC K;  1DEJ A;  4DKW A;  2XY8 A;  3FFI A;  4KH5 A;  5AQX A;  2VYP A;  3RR8 A;  1EXQ A;  4BE2 A;  1K8K A;  3JXU A;  5SWM A;  1S9G A;  3E9P A;  4YOV A;  2A6A A;  1I94 K;  4BQZ A;  5HBM A;  1WSJ A;  1NG9 A;  2D0C A;  3FLC O;  1LWC A;  3A2F A;  2ZD1 A;  4JI8 K;  4PWD A;  4HVJ A;  5FLX O;  1TYQ B;  5EXW A;  1JLC A;  2E6M A;  5AZJ B;  2HBL A;  3J81 O;  3NE6 A;  3I0R A;  5AQM A;  5BR8 K;  5FDL A;  3EZW A;  3F2K A;  3TTD A;  4FLY A;  5BN9 A;  3HT3 A;  4E7J A;  2QTD A;  2FSN A;  1RTD A;  2Q0U A;  1JXB A;  5J2M A;  2BAN A;  4RG8 A;  4DFJ A;  3QEP A;  4FK0 A;  4F3T A;  4BDY A;  3K5M A;  2O8D A;  1C1B A;  2HF4 A;  2WUS A;  3O9T A;  1NJX A;  2F9W A;  1Z25 A;  3CIP A;  1XC3 A;  1KAX A;  3OYA A;  4JKE A;  3AA4 A;  4O44 A;  1U48 A;  4I2P A;  3SPZ A;  3DLR A;  1KD1 O;  1X3M A;  4YDU A;  4H5V A;  4JHD B;  3NH0 A;  2GV9 A;  3THY B;  1T03 A;  1ZBH A;  4CEF A;  2Q1N A;  3O8M A;  4UY8 O;  4B9U A;  4CJ5 A;  4BC2 A;  4RW9 A;  4DR3 K;  4GV9 A;  3NF9 A;  4Y1D A;  1RBT A;  3RMB A;  3DJC A;  2D1K A;  4LF7 K;  2E2O A;  2PBD A;  4CBW A;  1EWR A;  1BWF O;  4HWI A;  1MWK A;  1HNI A;  1K9M O;  3GL1 A;  3VQ8 A;  2KTQ A;  3HXM A;  1NMN A;  1S6Q A;  2ZJP L;  1ZBI A;  2HVI A;  4FZY A;  2QKK A;  1HR0 K;  1P8Z A;  4V19 S;  2RKI A;  2QWO A;  1NOZ A;  3HJF A;  3D2F A;  1TKT A;  4DTM A;  3MAQ A;  3AAQ A;  4C8M A;  5FPE A;  1C0G A;  1QHA A;  2G8K A;  3QFU A;  3NH2 A;  2OA8 A;  3AO5 A;  3MN9 A;  2NRT A;  1BHL A;  1U49 A;  1VAZ A;  5JVH L;  1GOA A;  3S3O A;  4BQL A;  4Q0B A;  1NLV A;  3ZT3 A;  4FWL A;  2EWS A;  1HRH A;  4E1M A;  3NF6 A;  4IG3 A;  4FM1 A;  3G4S N;  3LP0 A;  1YVU A;  5C10 A;  3EO3 A;  4DQQ A;  2PZS A;  2P5G A;  2O8B A;  4MFB A;  1T6D A;  3BZC A;  4JI4 K;  4UQG A;  3ZSV A;  1LAW A;  3O80 A;  3MCA B;  2KZZ A;  3ZSR A;  1RTI A;  4B8A B;  1IJJ A;  1RBR A;  4QS8 A;  3OS0 A;  5GIN A;  2JLE A;  3GG4 A;  5JIC A;  2Z1G A;  4O5F A;  3QDK A;  5KPR A;  1IKY A;  1NGA A;  4XH4 A;  5KGW A;  4KAZ A;  2QI2 A;  5AQW A;  2YHY A;  4YFU A;  4CF1 A;  2O8C A;  3TSQ A;  4CFD A;  1YT3 A;  4JD2 B;  3SQ4 A;  2P9P A;  3CM5 A;  4YOT A;  3KLF A;  1S72 N;  4HCC A;  3U4L A;  1C1A A;  2KHO A;  2Q31 A;  4YNQ A;  1JJ2 M;  1T44 A;  4FJ8 A;  3VQC A;  5KRT A;  1Q9X A;  3DRP A;  4MO4 A;  3SYZ A;  3QEX A;  4AM7 A;  3WEE B;  5AZI A;  1LWE A;  3HVR A;  2P5O A;  2IVO A;  4WFB L;  5AQY A;  4B9T A;  2WC9 A;  4HUG A;  3VTI A;  3QER A;  3O6W A;  2B5J A;  1L3V A;  3V9Z A;  1JLQ A;  3R9P A;  2V52 B;  1JLG A;  3EKU A;  1N6Q A;  1Q8I A;  4H0P A;  2ZM6 K;  2FLO A;  3R3L A;  2HBK A;  3QFP A;  2G8F A;  2OPR A;  4JHD A;  4YOY A;  4FPA A;  2IGI A;  1IKV A;  3FZK A;  5AR0 A;  4CGD A;  3PX6 A;  1S1V A;  1TKD A;  2PAV A;  3M3Z A;  1VSK A;  2P9L A;  3VQP A;  1KCF A;  2HHV A;  1S5J A;  4JKH A;  1OH8 A;  2Q2R A;  4B1W B;  4CHP A;  1QS4 A;  3VA3 A;  3MXM A;  1HKG A;  3SCX A;  2ITG A;  5JVG L;  1WNS A;  2ZGY A;  4K0K K;  4O5B A;  4GKK K;  3H1V X;  5B8H A;  3EYZ A;  1KXP A;  3RR7 A;  2Q0R A;  1QZ6 A;  4FK2 A;  4CHZ A;  2I5J A;  4LF9 K;  3TSU A;  4OX9 K;  1C0U A;  2QWM A;  4BR2 A;  1C6V A;  1A5V A;  1VQ6 N;  5GIP A;  3KLE A;  2VQF K;  4HUF A;  1J6Z A;  3PIP L;  2F7T A;  3MN7 A;  1VSF A;  4CCH A;  4BRE A;  1HMV A;  2P9I A;  3ZSX A;  5GAD P;  1XQS C;  4HHT A;  4CJL A;  1QTM A;  1T3V A;  1LAV A;  3ID6 A;  3VET A;  3B8A X;  2HF3 A;  1Q9Y A;  1SKR A;  4DV0 K;  3QO9 A;  3VQQ A;  4JS4 A;  2HW3 A;  1DT9 A;  1GLE G;  1SQK A;  1U04 A;  3L6Q A;  4FZZ A;  4TSX A;  4CJT A;  3O4W A;  2R7Y A;  2BDP A;  4AHC A;  4BRH A;  2V7Y A;  4O8U A;  3SMP A;  4CFA A;  4FXD A;  1NK8 A;  4B3O A;  3NBP A;  3OW2 M;  1KAZ A;  4A62 A;  4DU1 A;  4YY3 K;  1NGC A;  3ZX2 A;  3W3D A;  4JV5 K;  2UUA K;  2JWK A;  1EWQ A;  2FC0 A;  2IOC A;  1VQ9 N;  3AVA A;  3H6E A;  3UKU B;  3NAE A;  1T05 A;  1QZ5 A;  5HL7 L;  1JCG A;  3A5M C;  4B9N A;  3LDQ A;  2F96 A;  3HO1 A;  1WBD A;  4GNI A;  3OYH A;  3VA0 A;  2F8T A;  5KQ8 A;  1DLO A;  4JKC A;  1RDB A;  1JKH A;  4N76 A;  3R1X A;  4BC4 A;  4ELU A;  4AHV A;  3VQD A;  3LM9 A;  5JS1 A;  1TAU A;  4A61 A;  3CCJ N;  4E0D A;  1XWL A;  4Z0U A;  3D7E O;  3L4Q A;  3EE8 A;  2D0A A;  2B6A A;  2ZGZ A;  1NGI A;  4W5O A;  4B9L A;  3I56 N;  1WLJ A;  3G71 N;  2X74 A;  4NXN K;  4H0Y B;  3D45 A;  1X3N A;  4CJW A;  4WE1 A;  1UA1 A;  4WQ4 C;  2BTF A;  3E9O A;  4IJN A;  1YXQ A;  2YHX A;  3CFR A;  4U7B A;  1N32 K;  3GOI A;  4CHO A;  3OS2 A;  3CCE N;  3QES A;  4J8F A;  3WXJ A;  4PQU A;  3CME N;  1BQM A;  4BRL A;  3D2E B;  3WQU A;  3NGI A;  2OCE A;  4Z4F A;  1RDC A;  2FF6 A;  3PLA A;  4WQ5 C;  2ZE2 A;  2NZT A;  4DLE A;  3RSE A;  4KV8 A;  1YTA A;  4BRC A;  2UYT A;  3EE9 A;  3UB5 A;  4E7K A;  2ASP A;  3QBW A;  4C1N I;  3FZL A;  1F21 A;  4BRD A;  4J2D A;  3S3M A;  2ASO A;  4JKB A;  1YUW A;  1BCO A;  2W6K A;  2GWJ A;  3NCI A;  3CPW M;  2HND A;  4CZK A;  1OKJ A;  3UE5 A;  1DKG D;  4CIF A;  5EY4 A;  1KTQ A;  4DCH A;  1O13 A;  3IUC A;  4GKJ K;  5HRO A;  4ICL A;  4IXC A;  4EIA A;  2DTU A;  3S41 A;  4DR5 K;  1S9E A;  3U8X A;  3KJV A;  3DOL A;  3U9Z A;  4OKK A;  4C8N A;  4DWI A;  4CE9 A;  2WFB A;  3ISN C;  3M6G A;  4AM6 A;  1JL2 A;  3SPY A;  4KFB A;  3VQB A;  3H1Q A;  1S1U A;  1K8K B;  3ZYY X;  2GBZ A;  3WNE A;  3OVN A;  3U3Y A;  5J2P A;  3VF2 A;  4KH4 A;  4CJU A;  4JKD A;  1VK0 A;  1ASU A;  2YNH A;  3PO4 A;  1ASV A;  4H8K A;  4AH9 A;  3J7Y P;  1DTQ A;  3ENH A;  2QWL A;  4EHU A;  1R59 O;  1D8Y A;  2RPI A;  3MN5 A;  2UU9 K;  4JK9 A;  4M7X A;  4EP4 A;  3SAH A;  2D4W A;  1VSD A;  1TL3 A;  1N36 K;  1L3U A;  3V9S A;  3ZEU A;  2AJQ A;  4EFH A;  4M41 A;  2Z1J A;  1M90 O;  5HRS A;  3VEN A;  1LW0 A;  4B3S K;  4EZ6 A;  4ELT A;  3HPG A;  4KKO A;  2HNZ A;  4FW2 A;  4DB3 A;  1VQL N;  3R8E A;  3MDQ A;  4DQS A;  4DLG A;  2OAN A;  3DLG A;  4B1V A;  4HCB A;  4CF9 A;  3VEO A;  4WFN L;  5D3G A;  1RTJ A;  1EQY A;  3K57 A;  3LPT A;  4GW6 A;  1W9H A;  3AVJ A;  3VN5 A;  4DTU A;  5M1O A;  1RGI A;  3M1F A;  2O8E A;  3MEC A;  3DLH A;  4BVP A;  4NCA A;  3SLC A;  2FBY A;  2YKN A;  4B3T K;  5AQT A;  1CZA N;  5KI6 A;  4B9M A;  2YV0 X;  3AAP A;  4BRP A;  3QEW A;  3SBG A;  3IRX A;  3CD6 N;  4BRM A;  1V4S A;  3V9W A;  4Z4I A;  2OZS A;  1VSH A;  1WN7 A;  1WAJ A;  3HRG A;  4KRF A;  3ULD A;  1SKW A;  4AIL C;  4C23 A;  4N5S A;  4FLT A;  3O9U A;  4B1Y B;  4F2S A;  1JLA A;  4C1N K;  2PYL A;  4DS4 A;  5DMR A;  1REV A;  3ZSY A;  5C25 A;  1HUX A;  3CC2 N;  2YX6 A;  4BAC A;  1VQ4 N;  3VGM A;  5HLF A;  2A5X A;  4JEP A;  5LJV A;  5M1N A;  4LH4 A;  2O8B B;  4N41 A;  1N5Y A;  3AAR A;  1HJO A;  4FWK A;  3O3G A;  3HK2 A;  4CEA A;  2JGU A;  2O4I A;  5F2R A;  4G1Q A;  1TUY A;  4X64 K;  4YOU A;  5JS2 A;  3AVH A;  3M5R A;  2G8V A;  4YOW A;  3HYF A;  3B6P A;  2HVH A;  2D0P A;  3LP2 A;  3DYA A;  3EN9 A;  1B92 A;  2O8C B;  1ILY A;  4NYF A;  5H1S Q;  1KC8 O;  2AP1 A;  3F9K A;  1Q82 O;  2HB5 A;  3AV9 A;  3AVF A;  1D4X A;  4I9Q A;  3HM8 A;  2P9P B;  3MEE A;  4JK8 A;  3KHY A;  1QSL A;  1BDG A;  1SZ2 A;  1ITG A;  3DMJ A;  4DTO A;  1BOT O;  5AZI B;  1Y64 A;  5ADX A;  1KFD A;  3QIP A;  1KVA A;  4Q5V A;  4F3O A;  3A5O C;  1QHT A;  4CJS A;  3FZH A;  2YHW A;  3VGK A;  3QML A;  1Y97 A;  4DFM A;  4CD3 A;  1VQN N;  1ZC6 A;  1L3S A;  3NMU A;  2IAJ A;  4CGF A;  4JI5 K;  3DLK A;  4NYN A;  4MDA A;  3CJA A;  3O9S A;  5M1F A;  3OYF A;  4BWJ A;  3K5N A;  1D5A A;  4DTR A;  1NK6 A;  1RT3 A;  1G99 A;  5HOO A;  4M3Y A;  3OA9 A;  3ZET B;  4A5B A;  4FJN A;  2YI1 A;  3AO4 A;  1NK4 A;  3K0S A;  5LMU K;  1SUQ A;  4FOE A;  2O4G A;  1R0A A;  1VSJ A;  1X9W A;  1C1C A;  5AQG A;  2P9L B;  2VWK A;  4FWM A;  3VEX A;  1ATR A;  4IEI A;  3CC4 N;  3ULE A;  3I33 A;  4E1N A;  3KLH A;  4CER A;  2PYJ A;  4DR2 K;  1HNV A;  4CJV A;  4F4K A;  1CXQ A;  3SV3 A;  2KFN A;  4NLB A;  1HNW K;  4OVL A;  2QXL A;  4JI6 K;  4IWV A;  3RMC A;  3CC7 N;  1RT4 A;  4DV5 K;  4CHY A;  3LPU A;  4PY5 A;  3SJJ A;  4LFA K;  4KRE A;  3LM2 A;  1Z6R A;  4JI7 K;  4H5T A;  3SQ2 A;  1WAF A;  2GWK A;  4I6M A;  3A8Y A;  2W41 A;  3LWM A;  4DFP A;  3ALY A;  4DTX A;  3BUZ B;  3VF4 A;  3CET A;  5BPL A;  4YDU C;  4XEI A;  3ZT2 A;  2HMP A;  2P9I B;  4CZI A;  5F0X A;  1JLF A;  1NK5 A;  2O8F B;  1YTU A;  2HHH K;  3I8D A;  1IBK K;  1QQM A;  2VQE K;  2E2N A;  3NVK A;  3FFK B;  2J4R A;  2YHA A;  4ID1 A;  4O55 A;  5CZ1 A;  4ELV A;  4F8R A;  3THV A;  1IG9 A;  3AVG A;  3T3F A;  1WSE A;  4CIE A;  4CEO A;  4E7L A;  4EHT A;  3HZ6 A;  4DUY K;  4BRF A;  3Q7B A;  3V1Q A;  2DFE A;  3KZB A;  2E4L A;  3CCQ N;  3AO1 A;  3IS9 A;  5BRH A;  1GLL O;  1FK9 A;  4DTS A;  5LMN K;  2ETJ A;  4K8X A;  2Q36 A;  3BDP A;  2OZM A;  3NFA A;  5FPM A;  2F8S A;  3KKS A;  3RWU A;  3DXM B;  3TPQ A;  1TVR A; 
#chains in the Genus database with same CATH homology
 1IBM K;  2UXC K;  4CW7 B;  1HR0 K;  4V19 S;  4B3M K;  2F4V K;  4YY3 K;  4JYA K;  1XMO K;  4JV5 K;  5LMU K;  2UUA K;  4GKJ K;  4DV7 K;  1IBL K;  4DR5 K;  4DR6 K;  3J7A P;  2UXB K;  5A2Q O;  2ZM6 K;  4CVN E;  2UUB K;  4DV6 K;  5IWA K;  3T1H K;  5LL6 Z;  4DV3 K;  4KHP K;  4DR2 K;  4YHH K;  4LF8 K;  3OTO K;  4LFC K;  1FJG K;  3T1Y K;  1HNW K;  4JI6 K;  1HNX K;  4DUZ K;  3J7Y P;  4DV5 K;  4LFA K;  2UUC K;  2UU9 K;  4JI7 K;  1I94 K;  4X64 K;  4LF6 K;  4B3R K;  4K0K K;  2UXD K;  1N36 K;  4GKK K;  4JI8 K;  4DR4 K;  4JI4 K;  4DV1 K;  3JAM O;  5FLX O;  4LF5 K;  4LF9 K;  4B3S K;  4AQY K;  3J81 O;  4OX9 K;  5IT9 O;  5BR8 K;  1XNR K;  4LFB K;  2HHH K;  4X66 K;  1IBK K;  4NXN K;  4DR7 K;  1J5E K;  2VQE K;  4X62 K;  2VQF K;  4DR1 K;  1N32 K;  4DUY K;  4JI1 K;  4JI0 K;  1N33 K;  1N34 K;  2E5L K;  4DV0 K;  5AJ3 K;  4NXM K;  5LMN K;  1XMQ K;  4DR3 K;  4B3T K;  4X65 K;  4LF7 K;  4JI2 K;  4DV2 K;  3J80 O;  4JI3 K;  4JI5 K;  1XNQ K;  4DV4 K;  1HNZ K;  4LF4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...