4JI7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji7K00
4DV4K 4DR1K 4K0KK 2UUBK 4B3RK 1HNXK 4LF5K 5FLXO 1HR0K 4DV0K 3J7AP 4GKKK 2UXCK 4LF8K 4JYAK 3J81O 1XMOK 4OX9K 4LF6K 4DV6K 4KHPK 2HHHK 4DR3K 3JAMO 2E5LK 4JI2K 1IBMK 4B3TK 4LF4K 2UXDK 1J5EK 4JI0K 4LF9K 4DUYK 4DV2K 4X66K 1N34K 4NXNK 5LL6Z 5IT9O 4DR5K 4B3SK 5BR8K 4CVNE 2VQEK 5LMUK 5AJ3K 4DR2K 4LF7K 4DV1K 3J80O 4LFCK 4DR6K 1HNWK 4B3MK 4JI4K 2F4VK 4DUZK 4JI1K 4V19S 2UU9K 4DR7K 3J7YP 4DV5K 4LFBK 4JI3K 1I94K 4YHHK 1N32K 4CW7B 4DR4K 5A2QO 5LMNK 4X62K 4DV7K 1IBKK 4JV5K 4NXMK 4YY3K 3OTOK 2ZM6K 1IBLK 1N33K 1N36K 1XNRK 1FJGK 4AQYK 4JI8K 4X65K 2VQFK 1XMQK 1XNQK 4JI6K 5IWAK 4X64K 2UUCK 2UUAK 4LFAK 3T1YK 2UXBK 3T1HK 4GKJK 4JI7K 4JI5K 1HNZK 4DV3K
chains in the Genus database with same CATH superfamily
1WSGA 2OCEA 4PUOA 2HB5A 4FWRA 1KLMA 5C15A 2YJFA 3DXKB 1Q9YA 2QXFA 4CERA 1L5UA 1RDUA 3SAGA 1BL3A 4IG3A 3HYFA 4LF8K 5HROA 3DXMB 4GV9A 1NGJA 1WSEA 3MXIA 4KFBA 4DU3A 3H45C 1NK4A 2Z1JA 1BIUA 2OA8A 1L3UA 4AF1A 4IO9L 1V4TA 3DOKA 3UKUB 1HNIA 4O5FA 4BR9A 2V7YA 4LF9K 4H5WA 4PQUA 3I8BA 2I5JA 1HYVA 4X66K 4Z4HA 3SK3A 1N34K 3K9KA 3CD6N 2V52B 4C23A 1OH6A 1TUUA 3OYAA 5AR0A 5EU7A 2VWJA 3RRGA 3NF6A 3F2KA 1UA1A 4Y1DA 4CIFA 2ZJPL 1O13A 4DR6K 2QM1A 1BCOA 4H0XB 1VSIA 2FXUA 2D0OA 3T1AA 1JL1A 3HPGA 2NRRA 2EHGA 4RW7A 1RNHA 2EWSA 1DT9A 2QKBA 2F8SA 4WQ5A 4WF9L 4KI6A 3OYKA 4F3OA 3L0QA 4LD0A 3PV8A 3L8BA 1TGOA 4YORA 5BRHA 2P9PB 3D2EA 4YOTA 1N36K 4KH5A 1WAJA 5CR4A 4ISGA 4Q5VA 3KK2A 4FJLA 1WBBA 3QEVA 3L4QA 1HJOA 2IC3A 3UE5A 1HYSA 2UUAK 4MDAA 2HVIA 2HNYA 1NBWA 3ID6A 4AHSA 2XY6A 1KAZA 4DQRA 4B9QA 4BVPA 3D2FB 2YCHA 3LM2A 2GTDA 2B4JA 2VG6A 3TSQA 3OYHA 4EP4A 1S22A 2ETJA 3RMAA 2QTDA 1NK6A 3DLBA 1RBRA 4MFBA 1EWQA 3CI5A 3J81O 1RTHA 1T05A 4IJNA 3V81A 1WNSA 4HHTA 2W41A 3U9ZA 5J2NA 1VQPN 1BUPA 1CZ9A 3HM8A 3AVNA 4CF2A 2UXDK 2CGJA 2YI1A 1KD1O 2P9SB 1BG3A 3ULEA 1GLDG 2Q3SA 1DTQA 3PUFA 3CJAA 4CEEA 5J1EA 3TTDA 4I9QA 1YTAA 3WXIA 4CZFA 3BZCA 4XEIA 3U4LA 1ESVA 1BDGA 4YNQA 3SQ1A 1KFSA 1QHTA 4Z4CA 1S6QA 3DAWA 5FPMA 4M7XA 3VEOA 4EHUA 4M63C 3G4SN 2HMIA 4CHNA 3OVNA 1BI4A 4DTJA 3TSPA 1M1KO 3LL3A 5KI6A 1WUAA 4FJ9A 3ITHA 1VQNN 3LDSA 1O1WA 1IG8A 4AHCA 5LJVA 4CK1A 1WSIA 5B8HA 4BRHA 4CW7B 1UA0A 4O0IA 1KVBA 5A2QO 4KHWA 1DKGD 4O5BA 1NK9A 3AVFA 3L2QA 4DSLA 1T44A 4BC5A 2O4GA 4O8KA 3MWPA 3WXMB 3SBGA 3PX4A 4W5OA 4FK4A 4DU4A 3IG1A 1JCEA 4WQ4C 4AM7A 2E2QA 1WSHA 1S1XA 4F9OA 1J9AA 3BZKA 2YV0X 4AQYK 2OPRA 1YJWN 4CD1A 5AQIA 1TVRA 2BTFA 4IOXA 4IDHA 5KGXA 3C6AA 4DQQA 3EZWA 3E66A 4HTUA 1TL3A 1MWKA 3T1HK 3TAGA 5KRTA 1BGXT 1LV5A 3WEEB 1ZC6A 4QOZB 3KLIA 4JRPA 4YFUA 4BC2A 3HP9A 4DTMA 4J2DA 1QZ6A 3VQ9A 2QWRA 4H8KA 1RILA 5FLXO 2HBLA 4FJ8A 3RMCA 1C1AA 4GKKK 2KZMA 3GBTA 3LDLA 3VQ6A 4LSLA 3A0IX 3I0RA 4M3UA 4BR2A 2AA4A 4ILGB 3MXJA 4LF6K 3D7EO 1QQMA 3AVMA 4H03B 3VF6A 3EN9A 5AQFA 5KPZA 3CQYA 3KWGA 3BDPA 3OYJA 2HHWA 3VQPA 2KFNA 2HHUA 3DOLA 2YHXA 2Q1NA 3ZSVA 1LWEA 2P9UB 4FK2A 3QO9A 4OKEA 3W3DA 4K43A 4CFDA 5KRSA 4CK3A 3CQXA 2LSNA 4ISEA 2IAJA 1MDUB 3NF9A 5F2RA 3ZETA 1HPMA 1J54A 1NGIA 1Q86O 3C6HA 4XH1A 3CF5L 3NVMA 3O3HA 3AO1A 4V19S 4BRCA 4U7BA 2ZF5O 1I3AA 4FWKA 3FFKB 1SKWA 4DR7K 3KD5E 2F9WA 1SQKA 4KTZA 3IFRA 5AQXA 5LMNK 4BR5A 4DV7K 1D9DA 3LALA 3P1GA 1XI1A 3BY5A 2XRIA 3K5LA 1IKYA 4CJ3A 4ELTA 4KKOA 3OA9A 2WFBA 4CESA 1VRUA 4BRQA 4CZHA 3CFPA 4FM2A 1XNRK 4CEAA 4CK2A 3MEDA 4BRKA 1J6ZA 4JS4A 1X9MA 3O9QA 5T7BA 3MCPA 2D0CA 4CBWA 3WUHA 4CFCA 4WYBA 1T7PA 2YHBA 3RR7A 2HBKA 4H4OA 3K5OA 3BUZB 4FM0A 3ZSYA 3ENOA 3H1QA 3QESA 4G1QA 3LWLA 1VQ7N 1U49A 3C94A 4BDPA 3CFOA 4CF0A 4ISFA 5JMVA 4FLXA 4W5QA 3UKUA 4CGJA 3AGRA 4DTRA 4AH9A 1JCGA 5DMRA 2X78A 3HRGA 3HM9A 4BRFA 3P39A 2YKMA 3VA3A 1VRTA 3CJCA 2IOCA 1A5WA 3PIOL 3PX0A 3VETA 3D2EB 1SS6A 1HKGA 2Z1HA 2P51A 4HTLA 4DUYK 3IMXA 3VGLA 1DGKN 3W0LA 4DQ8A 3V6DA 3O4QA 5JS1A 3SNNA 2NRVA 3B6OA 2BANA 3J7ZO 4BRAA 3EZ5A 4CGDA 4DR5K 4JEPA 2IVNA 1YTUA 1FKOA 4MLEA 1JLAA 4MQ3A 2O4IA 4DMNA 2HHXA 3DWLA 3TAPA 3OY9A 2UYTA 3A5MC 1HKBA 3AVJA 3QFPA 4CJLA 5JVHL 4E3SA 3AO4A 1SZ2A 1YF5L 4NCAA 3KHYA 1QQOA 3K5NA 1TKTA 1HX1A 3FZLA 4BRLA 1IBKK 4BG9A 4CZJA 3AAPA 3MX2A 3D6RA 5J2MA 4DQIA 4E1NA 4NYNA 3A5NC 3SUPA 2ASOA 1TUYA 3CCVN 4KH4A 3CC7N 1S9GA 3V4IA 4K8ZA 1LAVA 3CG7A 3D2FA 3F5TA 5AQNA 3KVGA 3HBTA 3MN6A 3VF4A 4NLCA 3HOTA 3C6TA 3HJFA 1RBUA 2ZJQL 1Q8IA 1IKVA 3PIPL 4JI7K 4IOCL 1EXQA 1QQCA 4ID1A 3S3NA 2IDOA 3LP2A 4CJTA 2GEMA 3AA3A 1VK0A 4BDYA 4GW6A 3TARA 1YVUA 1GLJO 2P9SA 3SUQA 5AZJB 4FVMA 2IS3A 1P8ZA 4Q0BA 4KO0A 4B9LA 3T69A 1E3MA 2JWLA 1OKJA 1REVA 4B8CA 2GWKA 3CHWA 3SJJA 3ZSRA 1KXPA 2VCPA 3E1YA 5JICA 3MEGA 4DB3A 2QKKA 1YIJN 4JN4A 4JKGA 4H5RA 4DFJA 4GVMA 3QIPA 3NGYA 3EE9A 2G8FA 4EFHA 4BRMA 4M3WA 3I0SA 5MLCQ 1NKBA 1RTIA 4E1MA 1NGBA 5LL6Z 1U2VA 1E4GT 2OPPA 1S3XA 4I2QA 1EWRA 3WT0A 5IT9O 3PSFA 4JAXA 4CF1A 2E1YA 4M3XA 3THYA 3A8YA 3V9WA 1VQLN 4KAZA 3Q7BA 4BR4A 3WXLA 3U8XA 4CZLA 4OLAA 4DQSA 4DF4A 4FK0A 5BR9A 3ID8A 5GAGP 3KLEA 4HCBA 4RW4A 1NGFA 3O3GA 3DLKA 4H0VB 1RBVA 1XUPO 4OKJA 2OYQA 4DR4K 2ZWHA 4FJGA 2V51B 3R9PA 1GOAA 3NFAA 1IO2A 1L3TA 2E2PA 4OPKA 2QXLA 4KHNA 4DHYA 4FJ7A 3CCMN 3ISNC 4IEIA 4DU1A 1P90A 1RT7A 4O0JA 4IKFA 3M6GA 3HL8A 4MLHA 1NGDA 2VYPA 5I9EB 4ZTJA 5C42A 3VGMA 2FBVA 5C25A 1Y97A 1RDCA 5CYQA 3OW2M 3QNNA 3ZETB 5JLFA 4JI5K 5AQQA 4DV4K 3DLLL 1TAUA 3E9PA 4ICLA 2UUBK 1HQEA 1F21A 5AQOA 3KD1E 3PX6A 5HBMA 3WQTA 4DSFA 1IV0A 3ZSXA 4IWVA 1XC3A 4RG8A 2P9UA 1K73O 2ATQA 3VTHA 4OPJA 4FWPA 1K8AO 4BQZA 3NGZA 4Y0WA 2D0AA 1HUXA 4I6MA 3CERA 1KSPA 4ILHA 1N5YA 3DLEA 3TSUA 3S9HA 4FOEA 3ZT1A 4IOAL 4B9NA 4PKGA 4XIUA 3QNOA 4B9SA 1QZ5A 1EETA 3FFIA 3CM6A 3O8MA 3SMPA 3LP0A 5EX5A 4FW2A 4YOWA 3OYGA 1TKDA 5KPTA 1YVNA 3AVBA 3MECA 3G10A 4QAGA 3OHRA 4FJMA 1LCUA 1LW2A 4DUZK 3L4IA 2BUPA 5I42A 2NRWA 4FW1A 4B9UA 1HKCA 5CYMA 3HT3A 2KLAA 3RMBA 3R3LA 4BC4A 4FJ5A 4JRQA 2ZGZA 3ALYA 3C7NB 3MN7A 4DSEA 2RHKA 1QTMA 3G25A 3EEQA 4FJKA 3K9JA 1Q7YO 4JS5A 1BWFO 3DM2A 3LANA 3AAQA 3H46O 1JLFA 4DKWA 3VQEA 5CZ2A 3TWHA 1EO1A 4M45A 4CJUA 1FJGK 2P9LB 2FSKA 5HRSA 2OTLN 4NO7A 4A62A 5TKWA 5KPRA 1LWCA 2DTUA 2WC9A 3ASMA 4F2SA 3O9SA 4X64K 4IDKA 3SLCA 4CHQA 5AQGA 5F1XA 3AGKA 3A2FA 5EY4A 3QIOA 4HUFA 1WB9A 3RMDA 4DV3K 4CJ7A 3WNEA 1SAZA 3RVCA 2JLEA 3TAFA 2O8DA 3HZ6A 1JXEA 1E4FT 2P9IA 4K41A 3RWUA 3CCUN 4CGIA 4Z4FA 3LZIA 4WCEL 5HRPA 4WQ5C 1NKCA 4U67L 2HSTA 2QWMA 4CJKA 2F9TA 3FR0A 4CGHA 3V9XA 1GLLO 5LY3A 4E19A 5M1NA 4IO8A 3T19A 1C0MA 1S1UA 3MX5A 4NCGA 4RCHA 3RR8A 3QBWA 3E9LA 3OYIA 1EX4A 3KK1A 3MAQA 5SWMA 1WLJA 4DLGA 5J2PA 1XHXA 2KFZA 3WNGA 4CEBA 4LH4A 5AJ3K 4DR2K 4BWMA 1HPZA 4DQPA 1RDBA 4LFCK 4KHYA 3WXJA 3UKRB 1YHQN 5DM7L 4KRFA 5HLFA 1C1BA 1NGEA 3HPHA 4JI4K 4N5SA 2F4VK 3H3NO 4H4MA 2ZE2A 4FM1A 4NCBA 4CJRA 3GG4A 5HRNA 2P1JA 1FXXA 3CPEA 1U6ZA 3O4NA 1XWLA 3A5OC 4FWQA 2YNGA 1N32K 2FLOA 5KQDA 4BGBA 3T3FA 1SL2A 4JKGB 2GX9A 4B08A 3O9RA 4EZ6A 3WNHA 1CXUA 3CFRA 2JWKA 4OVLA 2QEXN 3FZHA 4J2AA 4C8NA 4B1WB 3EE8A 1U2VB 4Z4EA 3NF7A 1NKEA 1VQ6N 1XNQK 5AZJA 3THYB 2E6LA 4CGGA 1NJWA 1S1VA 4GKJK 2Q2RA 5ELZA 1K8KA 1VSJA 3RTVA 1D4XA 3OS1A 2ASPA 5CY4A 4DF8A 3QB0A 3VQAA 4UY8O 2RPIA 3HOSA 1RCHA 1DEJA 1BQMA 2F8TA 1ZBFA 2EX3A 1S9EA 2XO7A 4FJIA 2UXCK 2O8BA 5AQWA 4I2PA 3O3FA 3AA5X 4ZHRA 1SL0A 3LP3A 4CZGA 1XMOK 1IG9A 4DV6K 2HHHK 3IUCA 3JAMO 1NU0A 3SV3A 1YI2N 2BH1A 4WFBL 2OTJN 5EXWA 4CBXA 4I7FA 3ZSQA 4CEDA 3OBWA 2GWJA 5LJWA 3M8RA 1HJRA 4DS5A 1RTDA 3LP1A 3IDHA 1C1CA 2KW4A 4OGCA 4FJXA 1XC9A 3G6EN 4IBNA 3BP8A 2WTUA 1VSEA 4BG8A 4CHPA 5ADXH 5H1SQ 4IEEA 5LMUK 1ZXOA 4B9TA 1VQ5N 2D0PA 3SQ0A 2A40A 5DK5A 3QICA 5M1KA 3HVTA 5AQMA 1HNWK 4KH6A 3NDKA 3MMVA 3J8AA 1NM1A 3ZX3A 5KQ8A 4BQLA 1S6PA 5K14A 3FZMA 1ATSA 3OBYA 4DSIA 1ILYA 3K0SA 4DFPA 2J4RA 5KGWA 4O8UA 1SKRA 3QLHA 2QW9A 4A61A 1HLUA 3AVLA 1N33K 3VQCA 4I6MB 2RF2A 3SYZA 1T3VA 2D0BA 4TSXA 2KZZA 1RT2A 4FZXC 1R59O 1RT5A 3TAEA 3AO3A 3P31A 3O80A 4X65K 1IJJA 3AA2A 3CJ9A 1NOZA 4IJAA 1HMVA 3CCQN 3FZKA 1ITGA 4CI6A 4BRGA 5BRFA 4KV8A 3O5BA 3K57A 2HBJA 1HNZK 4CD3A 1NK0A 4CZEA 3EO3A 4BRDA 3AARA 4OLBA 4PL7A 4FZZA 5KTQA 3LZJA 1H1VA 1D8YA 2G8KA 4BRPA 3LWMA 1VQ9N 4B3RK 1HNXK 4LF5K 4WFAL 4CHOA 2HBMA 3PY8A 4I9LA 5BPLA 4DV0K 2ZJRL 5AFUA 4F8RA 3VERA 1JL2A 2F96A 3CMAN 4Z94A 3SAFA 5TKYA 2GV9A 4YOYA 3V1RA 2QI2A 4AHVA 1ATRA 2HHVA 4FLYA 3ZYYX 2NRZA 1KLNA 4AILC 3VQQA 3C65A 1RDDA 2G8VA 3HVRA 4GNIA 3R1XA 2FSNA 1Z6RA 3FLCO 1YXQA 1L3SA 4GVEA 3O4WA 1TKZA 3CCSN 4K42A 5BR8K 1NK5A 3DLRA 3BEXA 2AJQA 3C7NA 3S3MA 5JS2A 2ASMA 1C0FA 2O8DB 2P9IB 4FYDA 2YKNA 4A2AA 4CZMA 4FL9A 3VA0A 2DFEA 3ZX2A 1S5JA 3P5JA 4CIGA 1VSLA 2YHAA 3AO2A 2P9LA 1W9HA 2A42A 4LSNA 4RW8A 3NH0A 1TYQB 1SUQA 2A1SA 2FF6A 3L3UA 4O55A 4X62K 4PWDA 2V7ZA 4A5AA 4NXMK 2FBXA 2E6MA 3L2WA 4A59A 3SV4A 4KBOA 1EKEA 2G8WA 1B9FA 3TTFA 4ELUA 1IKWA 3ZX0A 2QWLA 4W5RA 3AO5A 4OKKA 1J5OA 2PYLA 1RT4A 1T03A 3F73A 4RTFD 1NLVA 1XQSC 4Z0UA 4GV3A 4W5NA 2E1ZA 2Q0UA 3BF3A 5CE3A 1G15A 2YNFA 1NK8A 1Y64A 4J2EA 2ZGYA 3ATVA 2HF3A 3AVIA 3NBPA 4NYFA 3O1BA 2G8IA 2X6NA 1KVCA 3F9MA 3PSIA 3E01A 4CJWA 3FGUA 1LAWA 3ZT3A 1JLGA 3EL2A 3SAHA 5DM6L 1X3MA 4PKHA 3KTQA 4GMJB 3LDOA 4DR3K 4H5TA 3U9DA 5EOYA 1V4SA 4LF4K 3KKSA 4EP5A 3UKRA 5E41A 4E1JA 1M90O 3VF2A 2I7PA 3TR8A 3EYZA 1C0GA 4CZKA 3R8EA 3DJCA 2DFFA 4DTNA 1TK8A 4JLHA 2QA4N 2P5OA 3CC4N 2GELA 1Q81O 1JCFA 3HP6A 3HPOA 3CCJN 4DTPA 2GUIA 4DTUA 3MXMA 4H5VA 4IFEA 1K8KB 3QFUA 2VQEK 3L2UA 4E7LA 4YOXA 3ZT2A 3CJ1A 1S1WA 3HO1A 5FPDA 4JK9A 3TPQA 3K59A 1YUWA 2UU9K 4NB4A 2A3ZA 2O8BB 4B9MA 4FJHA 5AQTA 4N41A 4DV5K 2QWPA 3CYMA 4F2RA 2B5JA 4QS9A 3DMJA 1Z26A 5GAEP 4CJFA 5BN9A 1SL1A 2NNWA 3P4IA 4MO5A 1KQSM 5FRMA 4N76A 3M8PA 1IBLK 1FW6A 1W7AA 1WAFA 4M3ZA 3M3ZA 4CFAA 3OYNA 1J53A 3M1FA 4PL8A 4XH5A 4GV6A 3KK3A 4L3QA 3VESA 1BHLA 3LDPA 1W97L 2VQFK 4KTQA 3TAQA 2WUSA 4KTWA 3C0BA 3VEXA 1W0HA 3VEYA 4RW6A 1VQKN 1LWFA 5GAHP 1QE1A 5AZIA 1WOQA 3HXMA 1KAXA 1GLBG 4FWMA 4FZYA 3AY9A 4DWIA 2VGNA 4G9ZA 4OJRA 2XHBA 4CZIA 2E20A 2NUBA 2HVHA 2HMPA 3OYDA 2IIRA 1WBDA 2HF4A 1BCMA 2DPNA 1KAYA 1IBMK 1JLEA 1CLQA 4JI0K 1KVAA 2OZMA 1NMDA 1ZBLA 4L8RB 4YDUA 4BRIA 3U3GA 1L3VA 3DLHA 5C12A 2OANA 3SUOA 4NXNK 1RBSA 3NGIA 4JKBA 2KQ2A 2BDPA 1BU6O 4B3SK 3MEEA 3F9KA 3ZT4A 4CGFA 4FWLA 2PBDA 1I39A 4HWIA 3FZFA 3KJVA 3QEWA 5BPNA 5I3UA 4C8OA 1ZBIA 5JLHA 3OJUA 4WFNL 1WSFA 3DI6A 3ATUA 4DG1A 5C24A 1VSDA 4CJEA 1HNVA 2NRXA 4IFVA 1OVQA 1MA9B 1XHZA 3K5MA 4R79A 3N4QA 4JKFA 2A1RA 5E84A 3U3YA 5GINA 1U4BA 2HHSA 3L2VA 3OS0A 3OJSA 2O8EB 4OGEA 1ATNA 3ENHA 4FLVA 3DRPA 3ZEUA 1UAXA 4BR7A 4H0YB 3QDKA 3SI6A 5GIPA 3AVGA 1TV6A 3VEZA 4F4KA 4PY5A 2YJEA 4JI8K 3THWB 1CXQA 1U48A 3CJ7A 3OS2A 2VGMA 5M1OA 4JKEA 3T7ZA 3BF1A 3DRRA 1TAQA 3VN5A 1S72N 4LFAK 4H0TB 2UXBK 1YT3A 4CIEA 1RT1A 2QWNA 4H5NA 1RBTA 1D5AA 3VOVA 2W6LA 3D0PA 4N47A 1A5VA 3THXA 3CXCM 3MDQA 4HUEA 1N6QA 4FXDA 3JXUA 3NE6A 2G8HA 4OPAA 1OVYA 2QWOA 1U04A 4ID5A 4FLZA 5F0XA 2CGKA 3UB5A 4OX9K 4FOIA 1GOBA 5GIOA 4DTOA 4C1NK 4KHPK 1BA0A 4C8LA 1EP4A 1NGAA 1BISA 3LAKA 4KHUA 1K9MO 4W5TA 1HRHA 2Q0RA 1YITN 3P83D 4FLWA 1QHAA 4FLUA 1EQYA 3WQUA 1QQNA 4CJ5A 5GADP 3DYAA 2Y1IA 2AP1A 2RKIA 3EY1A 2A41A 4Z4IA 3MK6A 3AVHA 4CE9A 2GUPA 2O8CB 1TYQA 3HSCA 4LF7K 3J80O 3TAMA 3E9OA 1VQMN 3V1QA 4CEZA 1B9DA 3QEIA 3WXKA 3NAEA 1JLQA 1X9SA 3D45A 3THVA 1N8RO 1RT6A 4JK8A 4JNEA 4J8FA 4LFBK 4MO4A 4BDZA 3KLGA 1D9FA 4E0DA 3OYLA 4PA1A 4DS4A 1QS4A 4RWTA 2XY5A 1NJYA 1RT3A 1ASUA 3GL1A 1GLFO 2NLXA 1VQ4N 3KLFA 2E88A 3ULDA 1YJNN 3AV9A 3KKRA 2Z1IA 4CECA 3ZSZA 4GY2B 1VSMA 2UUCK 1FK9A 3T1YK 3NVKA 4LC9B 4KHQA 2A5XA 5AQVA 3MWTA 1ZBHA 4DR1K 1NMNA 4B1ZA 2GBZA 3Q7CA 5D3GA 4B1VA 5FPNA 2HNDA 3SPZA 3TU5A 4LY7A 4CJ4A 4QS8A 3L3VA 3FE1A 1FKPA 4WE1A 3K58A 2FF3B 3V9ZA 2WOMA 2Q97A 3HTVA 3O9TA 3V9SA 2E5LK 3AVKA 5AQPA 3LAMA 1BIZA 1NGCA 1NG9A 1RGIA 3CM5A 4DFKA 4WQ4A 1KRPA 4DSJA 4JHDA 4BVOA 5FPEA 2D4WA 1B92A 3VENA 4DTXA 3QBXA 3VQ5A 1MU2A 4FPAA 1ZBUA 4JD2B 4BE0A 3V1OA 4KB0A 2QK9A 3OYCA 3ZCMA 1Q18A 4M7YA 5FROA 4F3TA 5AZIB 4CF9A 1GOCA 4YOUA 3ZSOA 3TANA 5FDLA 3NH2A 1OH8A 4JKCA 3TABA 2D1KA 4BROA 4JI1K 1RFQA 4RW9A 4PHTX 3G0ZA 4BR0A 3TI0A 1G99A 3J7YP 5AQHA 2XY7A 4YOVA 2YNHA 4YHHK 2E2OA 4IG0A 1UOCA 4B1UB 4EHTA 5M1PA 3H6EA 4PKIA 4FLTA 2Y1JA 1WSJA 1KTQA 1WN7A 4XH4A 5AQSA 1VAZA 4JK7A 2ZD1A 2P9KA 2VG7A 4N56A 3RSEB 3QMLA 3HSTB 1DTTA 3O6WA 3I8DA 5AQJA 2IVOA 4EIAA 4E7HA 1ZBSA 1TKXA 4CFBA 2HHQA 3KZBA 5EVZA 2O8FA 1NNEA 3AVAA 4UQGA 3L2RA 1JLBA 4E7IA 4CEQA 3PO5A 1OH7A 1TK0A 3A5LC 2FBYA 3OYFA 3EKUA 3VQ4A 3VQBA 2VG5A 1DLOA 3J7AP 2A6AA 4AHRA 4J2BA 5BN8A 3SCXA 2PFUA 4AHUA 1HYZA 3LPTA 2Q36A 5AQKA 4JKHA 1GLEG 3ZEUB 2NZTA 4M41A 2CH5A 2BE2A 4JI2K 2E2NA 1J5EK 5C0YA 4MDBA 4DV2K 1IKXA 4B8AB 1TK5A 3C6UA 3CIPA 1SKSA 3O1WA 3LDNA 1C0UA 2KTQA 4M3YA 4CVNE 3I33A 1VSKA 2P9NA 2YNIA 5HRRA 1LOTB 3THXB 4HCCA 5JVGL 3QEXA 1GLAG 2W42A 2R7YA 3HI0A 4H0OA 4HVJA 2O8EA 3CPWM 3M8QA 4DFMA 3DXKA 1RTJA 2E4LA 2Z1GA 4BE1A 4FSVA 5BREA 3MCAB 4CF8A 2IVPA 1Z05A 4AM6A 4E7JA 3THWA 4KB1A 3KK7A 2WBNA 1CZAN 3DXMA 4R5PA 1VSFA 3VPZA 4BE2A 3ZLJA 2BGGA 2YHYA 4CHYA 4JV5K 4CJQA 5BRDA 4FWSA 4YY3K 3OTOK 4C8KA 3MN9A 2X74A 2VWKA 3EKSA 3CETA 5HL7L 4HUGA 5CZ1A 4Z4GA 1JLCA 2JGUA 3OYMA 1JJ2M 3SZ2A 2OPSA 4BACA 2RN2A 2HHTA 3IS9A 5C2DA 1T6DA 3G71N 1XMQK 3NF8A 3CQ8A 4OO1J 1X3NA 4OPHA 1IH7A 2G8UA 4FVUA 3H3OB 4ELVA 3S3OA 1BA1A 4EAHD 1GLCG 4K0KK 4LH5A 2YHWA 2NRHA 1JXBA 1C0TA 4CEOA 3HK2A 3O9UA 1HR0K 1HQUA 4KREA 1YAGA 1UWBA 4FWNA 5HP1A 1T8EA 2HW3A 3VTIA 3NMUA 3PO4A 3M8SA 2CH6A 4K25A 4QS7A 1VQ8N 4KHSA 3NHGA 1CZBA 4B1YB 4CBUA 2XY8A 4A2BA 1R0AA 2W6KA 4M42A 2O8CA 3C95A 2PZSA 1Q82O 4FJNA 3QERA 3NCIA 3IRXA 4FPBA 3TTCA 3GOIA 4KI4A 2X6SA 2P9PA 3ZT0A 1U47A 1T6CA 3CCRN 3BGRA 3AA4A 4DCHA 5AQUA 3SMSA 4O4GA 3SJHA 1QSSA 1QSLA 1C6VA 3DLGA 1JKHA 3KIOA 4JKAA 3SQ2A 3AVCA 3QETA 3GE1A 3I56N 4BY9C 4FCYA 5J2QA 3H1VX 2VWBA 5AQLA 1KCFA 3K2PA 1X9JA 3ULEB 2W40A 4CJPA 3SBTA 3CMEN 2DY4A 4B1XB 4KPYA 1W2BM 2H3GX 2PAVA 2DFHA 2I7NA 4A57A 4JI3K 1ZYQA 1NJZA 4DTSA 1I94K 4IXCA 3MN5A 3LPUA 5HOOA 3GDQA 4K8XA 1TL1A 2ITGA 4O44A 1Z25A 3WNFA 1BQNA 1BI4B 1NJXA 5BPMA 2ZM6K 3KWIA 1U45A 4CEFA 1K6YA 4ILJA 5FRNA 1NGHA 4JHDB 4B9VA 2KKZA 2QWQA 2YX6A 3LDQA 4M3RA 5AQRA 1KFDA 5C10A 5M1FA 1X9WA 1NJIO 4C8MA 4JI6K 5IWAK 3PLAA 4FWOA 3U6FA 3VEVA 1ASWA 4AHTA 4A5BA 1QVGM 3R6MA 4CCHA 3B6PA 2CGLA 2HNZA 3ZSWA 4QCLA 1ASVA 4Y1CA 2PY5A 4FO0A 2ZQBA 4C1NI 4DLEA 2IGIA 4H0PA 3QINA 2Q31A 3RRHA 3VQ7A 4JYAK 5AQZA 2HOEA 1A5XA 5C2FA 2WONA 4JKDA 3O08A 4E7KA 4NLBA 1X1PA 4E89A 4IFYA 2OZSA 3JS6A 5SZTA 4JD2A 3I55N 2F7TA 4CJVA 2RE2A 4B3TK 3V9UA 1QVFM 3JSMA 3KLHA 3IAYA 3VEWA 3CCLN 2P9KB 5CHIA 3P38A 2PYJA 3SQ4A 2B6AA 3B8AX 2D5RA 3NH1A 4M3TA 4BGAA 5M1QA 3H08A 3IKMA 3N4PA 4CHZA 1BO5O 4DSKA 3L6QA 2P5GA 2O8FB 4DV1K 3SUNA 4BRNA 2NRTA 3WEEA 5AQYA 1LW0A 1NGGA 1VSHA 4B3MK 4B3OA 1OH5A 3VQ8A 2E8AA 3OYBA 1Q9XA 3LM9A 3DRSA 3OYEA 3QEPA 1YJ9N 2ITMA 2FSJA 3CJBA 3RSEA 3VQDA 1NK7A 2FC0A 1RDAA 4BWJA 1VQON 4CJSA 5AFUH 4EZ9A 1BOTO 3VMFB 1RDWX 3CCEN 3UIQA 3CC2N 3S41A 1MWMA 1QSYA 1VHXA 1NWKA 3VGKA 2OPQA 4ZTFA 2FBTA 4YDUC 5ADXA 3SPYA 1NOYA 4BREA 1S1TA 1SV5A 1KC8O 4FJJA 4IZ9A 2P9NB 3ENBA 4BC3A 3M5RA 3JYTA 5E26A 2KHOA
chains in the Genus database with same CATH topology
4DV4K 4DR1K 4K0KK 2UUBK 4B3RK 1HNXK 4LF5K 5FLXO 1HR0K 4DV0K 3J7AP 4GKKK 2UXCK 4LF8K 4JYAK 3J81O 1XMOK 4OX9K 4LF6K 4DV6K 4KHPK 2HHHK 4DR3K 3JAMO 2E5LK 4JI2K 1IBMK 4B3TK 4LF4K 2UXDK 1J5EK 4JI0K 4LF9K 4DUYK 4DV2K 4X66K 1N34K 4NXNK 5LL6Z 5IT9O 4DR5K 4B3SK 5BR8K 4CVNE 2VQEK 5LMUK 5AJ3K 4DR2K 4LF7K 4DV1K 3J80O 4LFCK 4DR6K 1HNWK 4B3MK 4JI4K 2F4VK 4DUZK 4JI1K 4V19S 2UU9K 4DR7K 3J7YP 4DV5K 4LFBK 4JI3K 1I94K 4YHHK 1N32K 4CW7B 4DR4K 5A2QO 5LMNK 4X62K 4DV7K 1IBKK 4JV5K 4NXMK 4YY3K 3OTOK 2ZM6K 1IBLK 1N33K 1N36K 1XNRK 1FJGK 4AQYK 4JI8K 4X65K 2VQFK 1XMQK 1XNQK 4JI6K 5IWAK 4X64K 2UUCK 2UUAK 4LFAK 3T1YK 2UXBK 3T1HK 4GKJK 4JI7K 4JI5K 1HNZK 4DV3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 K;  4DR1 K;  4K0K K;  2UUB K;  4B3R K;  1HNX K;  4LF5 K;  5FLX O;  1HR0 K;  4DV0 K;  3J7A P;  4GKK K;  2UXC K;  4LF8 K;  4JYA K;  3J81 O;  1XMO K;  4OX9 K;  4LF6 K;  4DV6 K;  4KHP K;  2HHH K;  4DR3 K;  3JAM O;  2E5L K;  4JI2 K;  1IBM K;  4B3T K;  4LF4 K;  2UXD K;  1J5E K;  4JI0 K;  4LF9 K;  4DUY K;  4DV2 K;  4X66 K;  1N34 K;  4NXN K;  5LL6 Z;  5IT9 O;  4DR5 K;  4B3S K;  5BR8 K;  4CVN E;  2VQE K;  5LMU K;  5AJ3 K;  4DR2 K;  4LF7 K;  4DV1 K;  3J80 O;  4LFC K;  4DR6 K;  1HNW K;  4B3M K;  4JI4 K;  2F4V K;  4DUZ K;  4JI1 K;  4V19 S;  2UU9 K;  4DR7 K;  3J7Y P;  4DV5 K;  4LFB K;  4JI3 K;  1I94 K;  4YHH K;  1N32 K;  4CW7 B;  4DR4 K;  5A2Q O;  5LMN K;  4X62 K;  4DV7 K;  1IBK K;  4JV5 K;  4NXM K;  4YY3 K;  3OTO K;  2ZM6 K;  1IBL K;  1N33 K;  1N36 K;  1XNR K;  1FJG K;  4AQY K;  4JI8 K;  4X65 K;  2VQF K;  1XMQ K;  1XNQ K;  4JI6 K;  5IWA K;  4X64 K;  2UUC K;  2UUA K;  4LFA K;  3T1Y K;  2UXB K;  3T1H K;  4GKJ K;  4JI7 K;  4JI5 K;  1HNZ K;  4DV3 K; 
#chains in the Genus database with same CATH topology
 1WSG A;  2OCE A;  4PUO A;  2HB5 A;  4FWR A;  1KLM A;  5C15 A;  2YJF A;  3DXK B;  1Q9Y A;  2QXF A;  4CER A;  1L5U A;  1RDU A;  3SAG A;  1BL3 A;  4IG3 A;  3HYF A;  4LF8 K;  5HRO A;  3DXM B;  4GV9 A;  1NGJ A;  1WSE A;  3MXI A;  4KFB A;  4DU3 A;  3H45 C;  1NK4 A;  2Z1J A;  1BIU A;  2OA8 A;  1L3U A;  4AF1 A;  4IO9 L;  1V4T A;  3DOK A;  3UKU B;  1HNI A;  4O5F A;  4BR9 A;  2V7Y A;  4LF9 K;  4H5W A;  4PQU A;  3I8B A;  2I5J A;  1HYV A;  4X66 K;  4Z4H A;  3SK3 A;  1N34 K;  3K9K A;  3CD6 N;  2V52 B;  4C23 A;  1OH6 A;  1TUU A;  3OYA A;  5AR0 A;  5EU7 A;  2VWJ A;  3RRG A;  3NF6 A;  3F2K A;  1UA1 A;  4Y1D A;  4CIF A;  2ZJP L;  1O13 A;  4DR6 K;  2QM1 A;  1BCO A;  4H0X B;  1VSI A;  2FXU A;  2D0O A;  3T1A A;  1JL1 A;  3HPG A;  2NRR A;  2EHG A;  4RW7 A;  1RNH A;  2EWS A;  1DT9 A;  2QKB A;  2F8S A;  4WQ5 A;  4WF9 L;  4KI6 A;  3OYK A;  4F3O A;  3L0Q A;  4LD0 A;  3PV8 A;  3L8B A;  1TGO A;  4YOR A;  5BRH A;  2P9P B;  3D2E A;  4YOT A;  1N36 K;  4KH5 A;  1WAJ A;  5CR4 A;  4ISG A;  4Q5V A;  3KK2 A;  4FJL A;  1WBB A;  3QEV A;  3L4Q A;  1HJO A;  2IC3 A;  3UE5 A;  1HYS A;  2UUA K;  4MDA A;  2HVI A;  2HNY A;  1NBW A;  3ID6 A;  4AHS A;  2XY6 A;  1KAZ A;  4DQR A;  4B9Q A;  4BVP A;  3D2F B;  2YCH A;  3LM2 A;  2GTD A;  2B4J A;  2VG6 A;  3TSQ A;  3OYH A;  4EP4 A;  1S22 A;  2ETJ A;  3RMA A;  2QTD A;  1NK6 A;  3DLB A;  1RBR A;  4MFB A;  1EWQ A;  3CI5 A;  3J81 O;  1RTH A;  1T05 A;  4IJN A;  3V81 A;  1WNS A;  4HHT A;  2W41 A;  3U9Z A;  5J2N A;  1VQP N;  1BUP A;  1CZ9 A;  3HM8 A;  3AVN A;  4CF2 A;  2UXD K;  2CGJ A;  2YI1 A;  1KD1 O;  2P9S B;  1BG3 A;  3ULE A;  1GLD G;  2Q3S A;  1DTQ A;  3PUF A;  3CJA A;  4CEE A;  5J1E A;  3TTD A;  4I9Q A;  1YTA A;  3WXI A;  4CZF A;  3BZC A;  4XEI A;  3U4L A;  1ESV A;  1BDG A;  4YNQ A;  3SQ1 A;  1KFS A;  1QHT A;  4Z4C A;  1S6Q A;  3DAW A;  5FPM A;  4M7X A;  3VEO A;  4EHU A;  4M63 C;  3G4S N;  2HMI A;  4CHN A;  3OVN A;  1BI4 A;  4DTJ A;  3TSP A;  1M1K O;  3LL3 A;  5KI6 A;  1WUA A;  4FJ9 A;  3ITH A;  1VQN N;  3LDS A;  1O1W A;  1IG8 A;  4AHC A;  5LJV A;  4CK1 A;  1WSI A;  5B8H A;  4BRH A;  4CW7 B;  1UA0 A;  4O0I A;  1KVB A;  5A2Q O;  4KHW A;  1DKG D;  4O5B A;  1NK9 A;  3AVF A;  3L2Q A;  4DSL A;  1T44 A;  4BC5 A;  2O4G A;  4O8K A;  3MWP A;  3WXM B;  3SBG A;  3PX4 A;  4W5O A;  4FK4 A;  4DU4 A;  3IG1 A;  1JCE A;  4WQ4 C;  4AM7 A;  2E2Q A;  1WSH A;  1S1X A;  4F9O A;  1J9A A;  3BZK A;  2YV0 X;  4AQY K;  2OPR A;  1YJW N;  4CD1 A;  5AQI A;  1TVR A;  2BTF A;  4IOX A;  4IDH A;  5KGX A;  3C6A A;  4DQQ A;  3EZW A;  3E66 A;  4HTU A;  1TL3 A;  1MWK A;  3T1H K;  3TAG A;  5KRT A;  1BGX T;  1LV5 A;  3WEE B;  1ZC6 A;  4QOZ B;  3KLI A;  4JRP A;  4YFU A;  4BC2 A;  3HP9 A;  4DTM A;  4J2D A;  1QZ6 A;  3VQ9 A;  2QWR A;  4H8K A;  1RIL A;  5FLX O;  2HBL A;  4FJ8 A;  3RMC A;  1C1A A;  4GKK K;  2KZM A;  3GBT A;  3LDL A;  3VQ6 A;  4LSL A;  3A0I X;  3I0R A;  4M3U A;  4BR2 A;  2AA4 A;  4ILG B;  3MXJ A;  4LF6 K;  3D7E O;  1QQM A;  3AVM A;  4H03 B;  3VF6 A;  3EN9 A;  5AQF A;  5KPZ A;  3CQY A;  3KWG A;  3BDP A;  3OYJ A;  2HHW A;  3VQP A;  2KFN A;  2HHU A;  3DOL A;  2YHX A;  2Q1N A;  3ZSV A;  1LWE A;  2P9U B;  4FK2 A;  3QO9 A;  4OKE A;  3W3D A;  4K43 A;  4CFD A;  5KRS A;  4CK3 A;  3CQX A;  2LSN A;  4ISE A;  2IAJ A;  1MDU B;  3NF9 A;  5F2R A;  3ZET A;  1HPM A;  1J54 A;  1NGI A;  1Q86 O;  3C6H A;  4XH1 A;  3CF5 L;  3NVM A;  3O3H A;  3AO1 A;  4V19 S;  4BRC A;  4U7B A;  2ZF5 O;  1I3A A;  4FWK A;  3FFK B;  1SKW A;  4DR7 K;  3KD5 E;  2F9W A;  1SQK A;  4KTZ A;  3IFR A;  5AQX A;  5LMN K;  4BR5 A;  4DV7 K;  1D9D A;  3LAL A;  3P1G A;  1XI1 A;  3BY5 A;  2XRI A;  3K5L A;  1IKY A;  4CJ3 A;  4ELT A;  4KKO A;  3OA9 A;  2WFB A;  4CES A;  1VRU A;  4BRQ A;  4CZH A;  3CFP A;  4FM2 A;  1XNR K;  4CEA A;  4CK2 A;  3MED A;  4BRK A;  1J6Z A;  4JS4 A;  1X9M A;  3O9Q A;  5T7B A;  3MCP A;  2D0C A;  4CBW A;  3WUH A;  4CFC A;  4WYB A;  1T7P A;  2YHB A;  3RR7 A;  2HBK A;  4H4O A;  3K5O A;  3BUZ B;  4FM0 A;  3ZSY A;  3ENO A;  3H1Q A;  3QES A;  4G1Q A;  3LWL A;  1VQ7 N;  1U49 A;  3C94 A;  4BDP A;  3CFO A;  4CF0 A;  4ISF A;  5JMV A;  4FLX A;  4W5Q A;  3UKU A;  4CGJ A;  3AGR A;  4DTR A;  4AH9 A;  1JCG A;  5DMR A;  2X78 A;  3HRG A;  3HM9 A;  4BRF A;  3P39 A;  2YKM A;  3VA3 A;  1VRT A;  3CJC A;  2IOC A;  1A5W A;  3PIO L;  3PX0 A;  3VET A;  3D2E B;  1SS6 A;  1HKG A;  2Z1H A;  2P51 A;  4HTL A;  4DUY K;  3IMX A;  3VGL A;  1DGK N;  3W0L A;  4DQ8 A;  3V6D A;  3O4Q A;  5JS1 A;  3SNN A;  2NRV A;  3B6O A;  2BAN A;  3J7Z O;  4BRA A;  3EZ5 A;  4CGD A;  4DR5 K;  4JEP A;  2IVN A;  1YTU A;  1FKO A;  4MLE A;  1JLA A;  4MQ3 A;  2O4I A;  4DMN A;  2HHX A;  3DWL A;  3TAP A;  3OY9 A;  2UYT A;  3A5M C;  1HKB A;  3AVJ A;  3QFP A;  4CJL A;  5JVH L;  4E3S A;  3AO4 A;  1SZ2 A;  1YF5 L;  4NCA A;  3KHY A;  1QQO A;  3K5N A;  1TKT A;  1HX1 A;  3FZL A;  4BRL A;  1IBK K;  4BG9 A;  4CZJ A;  3AAP A;  3MX2 A;  3D6R A;  5J2M A;  4DQI A;  4E1N A;  4NYN A;  3A5N C;  3SUP A;  2ASO A;  1TUY A;  3CCV N;  4KH4 A;  3CC7 N;  1S9G A;  3V4I A;  4K8Z A;  1LAV A;  3CG7 A;  3D2F A;  3F5T A;  5AQN A;  3KVG A;  3HBT A;  3MN6 A;  3VF4 A;  4NLC A;  3HOT A;  3C6T A;  3HJF A;  1RBU A;  2ZJQ L;  1Q8I A;  1IKV A;  3PIP L;  4JI7 K;  4IOC L;  1EXQ A;  1QQC A;  4ID1 A;  3S3N A;  2IDO A;  3LP2 A;  4CJT A;  2GEM A;  3AA3 A;  1VK0 A;  4BDY A;  4GW6 A;  3TAR A;  1YVU A;  1GLJ O;  2P9S A;  3SUQ A;  5AZJ B;  4FVM A;  2IS3 A;  1P8Z A;  4Q0B A;  4KO0 A;  4B9L A;  3T69 A;  1E3M A;  2JWL A;  1OKJ A;  1REV A;  4B8C A;  2GWK A;  3CHW A;  3SJJ A;  3ZSR A;  1KXP A;  2VCP A;  3E1Y A;  5JIC A;  3MEG A;  4DB3 A;  2QKK A;  1YIJ N;  4JN4 A;  4JKG A;  4H5R A;  4DFJ A;  4GVM A;  3QIP A;  3NGY A;  3EE9 A;  2G8F A;  4EFH A;  4BRM A;  4M3W A;  3I0S A;  5MLC Q;  1NKB A;  1RTI A;  4E1M A;  1NGB A;  5LL6 Z;  1U2V A;  1E4G T;  2OPP A;  1S3X A;  4I2Q A;  1EWR A;  3WT0 A;  5IT9 O;  3PSF A;  4JAX A;  4CF1 A;  2E1Y A;  4M3X A;  3THY A;  3A8Y A;  3V9W A;  1VQL N;  4KAZ A;  3Q7B A;  4BR4 A;  3WXL A;  3U8X A;  4CZL A;  4OLA A;  4DQS A;  4DF4 A;  4FK0 A;  5BR9 A;  3ID8 A;  5GAG P;  3KLE A;  4HCB A;  4RW4 A;  1NGF A;  3O3G A;  3DLK A;  4H0V B;  1RBV A;  1XUP O;  4OKJ A;  2OYQ A;  4DR4 K;  2ZWH A;  4FJG A;  2V51 B;  3R9P A;  1GOA A;  3NFA A;  1IO2 A;  1L3T A;  2E2P A;  4OPK A;  2QXL A;  4KHN A;  4DHY A;  4FJ7 A;  3CCM N;  3ISN C;  4IEI A;  4DU1 A;  1P90 A;  1RT7 A;  4O0J A;  4IKF A;  3M6G A;  3HL8 A;  4MLH A;  1NGD A;  2VYP A;  5I9E B;  4ZTJ A;  5C42 A;  3VGM A;  2FBV A;  5C25 A;  1Y97 A;  1RDC A;  5CYQ A;  3OW2 M;  3QNN A;  3ZET B;  5JLF A;  4JI5 K;  5AQQ A;  4DV4 K;  3DLL L;  1TAU A;  3E9P A;  4ICL A;  2UUB K;  1HQE A;  1F21 A;  5AQO A;  3KD1 E;  3PX6 A;  5HBM A;  3WQT A;  4DSF A;  1IV0 A;  3ZSX A;  4IWV A;  1XC3 A;  4RG8 A;  2P9U A;  1K73 O;  2ATQ A;  3VTH A;  4OPJ A;  4FWP A;  1K8A O;  4BQZ A;  3NGZ A;  4Y0W A;  2D0A A;  1HUX A;  4I6M A;  3CER A;  1KSP A;  4ILH A;  1N5Y A;  3DLE A;  3TSU A;  3S9H A;  4FOE A;  3ZT1 A;  4IOA L;  4B9N A;  4PKG A;  4XIU A;  3QNO A;  4B9S A;  1QZ5 A;  1EET A;  3FFI A;  3CM6 A;  3O8M A;  3SMP A;  3LP0 A;  5EX5 A;  4FW2 A;  4YOW A;  3OYG A;  1TKD A;  5KPT A;  1YVN A;  3AVB A;  3MEC A;  3G10 A;  4QAG A;  3OHR A;  4FJM A;  1LCU A;  1LW2 A;  4DUZ K;  3L4I A;  2BUP A;  5I42 A;  2NRW A;  4FW1 A;  4B9U A;  1HKC A;  5CYM A;  3HT3 A;  2KLA A;  3RMB A;  3R3L A;  4BC4 A;  4FJ5 A;  4JRQ A;  2ZGZ A;  3ALY A;  3C7N B;  3MN7 A;  4DSE A;  2RHK A;  1QTM A;  3G25 A;  3EEQ A;  4FJK A;  3K9J A;  1Q7Y O;  4JS5 A;  1BWF O;  3DM2 A;  3LAN A;  3AAQ A;  3H46 O;  1JLF A;  4DKW A;  3VQE A;  5CZ2 A;  3TWH A;  1EO1 A;  4M45 A;  4CJU A;  1FJG K;  2P9L B;  2FSK A;  5HRS A;  2OTL N;  4NO7 A;  4A62 A;  5TKW A;  5KPR A;  1LWC A;  2DTU A;  2WC9 A;  3ASM A;  4F2S A;  3O9S A;  4X64 K;  4IDK A;  3SLC A;  4CHQ A;  5AQG A;  5F1X A;  3AGK A;  3A2F A;  5EY4 A;  3QIO A;  4HUF A;  1WB9 A;  3RMD A;  4DV3 K;  4CJ7 A;  3WNE A;  1SAZ A;  3RVC A;  2JLE A;  3TAF A;  2O8D A;  3HZ6 A;  1JXE A;  1E4F T;  2P9I A;  4K41 A;  3RWU A;  3CCU N;  4CGI A;  4Z4F A;  3LZI A;  4WCE L;  5HRP A;  4WQ5 C;  1NKC A;  4U67 L;  2HST A;  2QWM A;  4CJK A;  2F9T A;  3FR0 A;  4CGH A;  3V9X A;  1GLL O;  5LY3 A;  4E19 A;  5M1N A;  4IO8 A;  3T19 A;  1C0M A;  1S1U A;  3MX5 A;  4NCG A;  4RCH A;  3RR8 A;  3QBW A;  3E9L A;  3OYI A;  1EX4 A;  3KK1 A;  3MAQ A;  5SWM A;  1WLJ A;  4DLG A;  5J2P A;  1XHX A;  2KFZ A;  3WNG A;  4CEB A;  4LH4 A;  5AJ3 K;  4DR2 K;  4BWM A;  1HPZ A;  4DQP A;  1RDB A;  4LFC K;  4KHY A;  3WXJ A;  3UKR B;  1YHQ N;  5DM7 L;  4KRF A;  5HLF A;  1C1B A;  1NGE A;  3HPH A;  4JI4 K;  4N5S A;  2F4V K;  3H3N O;  4H4M A;  2ZE2 A;  4FM1 A;  4NCB A;  4CJR A;  3GG4 A;  5HRN A;  2P1J A;  1FXX A;  3CPE A;  1U6Z A;  3O4N A;  1XWL A;  3A5O C;  4FWQ A;  2YNG A;  1N32 K;  2FLO A;  5KQD A;  4BGB A;  3T3F A;  1SL2 A;  4JKG B;  2GX9 A;  4B08 A;  3O9R A;  4EZ6 A;  3WNH A;  1CXU A;  3CFR A;  2JWK A;  4OVL A;  2QEX N;  3FZH A;  4J2A A;  4C8N A;  4B1W B;  3EE8 A;  1U2V B;  4Z4E A;  3NF7 A;  1NKE A;  1VQ6 N;  1XNQ K;  5AZJ A;  3THY B;  2E6L A;  4CGG A;  1NJW A;  1S1V A;  4GKJ K;  2Q2R A;  5ELZ A;  1K8K A;  1VSJ A;  3RTV A;  1D4X A;  3OS1 A;  2ASP A;  5CY4 A;  4DF8 A;  3QB0 A;  3VQA A;  4UY8 O;  2RPI A;  3HOS A;  1RCH A;  1DEJ A;  1BQM A;  2F8T A;  1ZBF A;  2EX3 A;  1S9E A;  2XO7 A;  4FJI A;  2UXC K;  2O8B A;  5AQW A;  4I2P A;  3O3F A;  3AA5 X;  4ZHR A;  1SL0 A;  3LP3 A;  4CZG A;  1XMO K;  1IG9 A;  4DV6 K;  2HHH K;  3IUC A;  3JAM O;  1NU0 A;  3SV3 A;  1YI2 N;  2BH1 A;  4WFB L;  2OTJ N;  5EXW A;  4CBX A;  4I7F A;  3ZSQ A;  4CED A;  3OBW A;  2GWJ A;  5LJW A;  3M8R A;  1HJR A;  4DS5 A;  1RTD A;  3LP1 A;  3IDH A;  1C1C A;  2KW4 A;  4OGC A;  4FJX A;  1XC9 A;  3G6E N;  4IBN A;  3BP8 A;  2WTU A;  1VSE A;  4BG8 A;  4CHP A;  5ADX H;  5H1S Q;  4IEE A;  5LMU K;  1ZXO A;  4B9T A;  1VQ5 N;  2D0P A;  3SQ0 A;  2A40 A;  5DK5 A;  3QIC A;  5M1K A;  3HVT A;  5AQM A;  1HNW K;  4KH6 A;  3NDK A;  3MMV A;  3J8A A;  1NM1 A;  3ZX3 A;  5KQ8 A;  4BQL A;  1S6P A;  5K14 A;  3FZM A;  1ATS A;  3OBY A;  4DSI A;  1ILY A;  3K0S A;  4DFP A;  2J4R A;  5KGW A;  4O8U A;  1SKR A;  3QLH A;  2QW9 A;  4A61 A;  1HLU A;  3AVL A;  1N33 K;  3VQC A;  4I6M B;  2RF2 A;  3SYZ A;  1T3V A;  2D0B A;  4TSX A;  2KZZ A;  1RT2 A;  4FZX C;  1R59 O;  1RT5 A;  3TAE A;  3AO3 A;  3P31 A;  3O80 A;  4X65 K;  1IJJ A;  3AA2 A;  3CJ9 A;  1NOZ A;  4IJA A;  1HMV A;  3CCQ N;  3FZK A;  1ITG A;  4CI6 A;  4BRG A;  5BRF A;  4KV8 A;  3O5B A;  3K57 A;  2HBJ A;  1HNZ K;  4CD3 A;  1NK0 A;  4CZE A;  3EO3 A;  4BRD A;  3AAR A;  4OLB A;  4PL7 A;  4FZZ A;  5KTQ A;  3LZJ A;  1H1V A;  1D8Y A;  2G8K A;  4BRP A;  3LWM A;  1VQ9 N;  4B3R K;  1HNX K;  4LF5 K;  4WFA L;  4CHO A;  2HBM A;  3PY8 A;  4I9L A;  5BPL A;  4DV0 K;  2ZJR L;  5AFU A;  4F8R A;  3VER A;  1JL2 A;  2F96 A;  3CMA N;  4Z94 A;  3SAF A;  5TKY A;  2GV9 A;  4YOY A;  3V1R A;  2QI2 A;  4AHV A;  1ATR A;  2HHV A;  4FLY A;  3ZYY X;  2NRZ A;  1KLN A;  4AIL C;  3VQQ A;  3C65 A;  1RDD A;  2G8V A;  3HVR A;  4GNI A;  3R1X A;  2FSN A;  1Z6R A;  3FLC O;  1YXQ A;  1L3S A;  4GVE A;  3O4W A;  1TKZ A;  3CCS N;  4K42 A;  5BR8 K;  1NK5 A;  3DLR A;  3BEX A;  2AJQ A;  3C7N A;  3S3M A;  5JS2 A;  2ASM A;  1C0F A;  2O8D B;  2P9I B;  4FYD A;  2YKN A;  4A2A A;  4CZM A;  4FL9 A;  3VA0 A;  2DFE A;  3ZX2 A;  1S5J A;  3P5J A;  4CIG A;  1VSL A;  2YHA A;  3AO2 A;  2P9L A;  1W9H A;  2A42 A;  4LSN A;  4RW8 A;  3NH0 A;  1TYQ B;  1SUQ A;  2A1S A;  2FF6 A;  3L3U A;  4O55 A;  4X62 K;  4PWD A;  2V7Z A;  4A5A A;  4NXM K;  2FBX A;  2E6M A;  3L2W A;  4A59 A;  3SV4 A;  4KBO A;  1EKE A;  2G8W A;  1B9F A;  3TTF A;  4ELU A;  1IKW A;  3ZX0 A;  2QWL A;  4W5R A;  3AO5 A;  4OKK A;  1J5O A;  2PYL A;  1RT4 A;  1T03 A;  3F73 A;  4RTF D;  1NLV A;  1XQS C;  4Z0U A;  4GV3 A;  4W5N A;  2E1Z A;  2Q0U A;  3BF3 A;  5CE3 A;  1G15 A;  2YNF A;  1NK8 A;  1Y64 A;  4J2E A;  2ZGY A;  3ATV A;  2HF3 A;  3AVI A;  3NBP A;  4NYF A;  3O1B A;  2G8I A;  2X6N A;  1KVC A;  3F9M A;  3PSI A;  3E01 A;  4CJW A;  3FGU A;  1LAW A;  3ZT3 A;  1JLG A;  3EL2 A;  3SAH A;  5DM6 L;  1X3M A;  4PKH A;  3KTQ A;  4GMJ B;  3LDO A;  4DR3 K;  4H5T A;  3U9D A;  5EOY A;  1V4S A;  4LF4 K;  3KKS A;  4EP5 A;  3UKR A;  5E41 A;  4E1J A;  1M90 O;  3VF2 A;  2I7P A;  3TR8 A;  3EYZ A;  1C0G A;  4CZK A;  3R8E A;  3DJC A;  2DFF A;  4DTN A;  1TK8 A;  4JLH A;  2QA4 N;  2P5O A;  3CC4 N;  2GEL A;  1Q81 O;  1JCF A;  3HP6 A;  3HPO A;  3CCJ N;  4DTP A;  2GUI A;  4DTU A;  3MXM A;  4H5V A;  4IFE A;  1K8K B;  3QFU A;  2VQE K;  3L2U A;  4E7L A;  4YOX A;  3ZT2 A;  3CJ1 A;  1S1W A;  3HO1 A;  5FPD A;  4JK9 A;  3TPQ A;  3K59 A;  1YUW A;  2UU9 K;  4NB4 A;  2A3Z A;  2O8B B;  4B9M A;  4FJH A;  5AQT A;  4N41 A;  4DV5 K;  2QWP A;  3CYM A;  4F2R A;  2B5J A;  4QS9 A;  3DMJ A;  1Z26 A;  5GAE P;  4CJF A;  5BN9 A;  1SL1 A;  2NNW A;  3P4I A;  4MO5 A;  1KQS M;  5FRM A;  4N76 A;  3M8P A;  1IBL K;  1FW6 A;  1W7A A;  1WAF A;  4M3Z A;  3M3Z A;  4CFA A;  3OYN A;  1J53 A;  3M1F A;  4PL8 A;  4XH5 A;  4GV6 A;  3KK3 A;  4L3Q A;  3VES A;  1BHL A;  3LDP A;  1W97 L;  2VQF K;  4KTQ A;  3TAQ A;  2WUS A;  4KTW A;  3C0B A;  3VEX A;  1W0H A;  3VEY A;  4RW6 A;  1VQK N;  1LWF A;  5GAH P;  1QE1 A;  5AZI A;  1WOQ A;  3HXM A;  1KAX A;  1GLB G;  4FWM A;  4FZY A;  3AY9 A;  4DWI A;  2VGN A;  4G9Z A;  4OJR A;  2XHB A;  4CZI A;  2E20 A;  2NUB A;  2HVH A;  2HMP A;  3OYD A;  2IIR A;  1WBD A;  2HF4 A;  1BCM A;  2DPN A;  1KAY A;  1IBM K;  1JLE A;  1CLQ A;  4JI0 K;  1KVA A;  2OZM A;  1NMD A;  1ZBL A;  4L8R B;  4YDU A;  4BRI A;  3U3G A;  1L3V A;  3DLH A;  5C12 A;  2OAN A;  3SUO A;  4NXN K;  1RBS A;  3NGI A;  4JKB A;  2KQ2 A;  2BDP A;  1BU6 O;  4B3S K;  3MEE A;  3F9K A;  3ZT4 A;  4CGF A;  4FWL A;  2PBD A;  1I39 A;  4HWI A;  3FZF A;  3KJV A;  3QEW A;  5BPN A;  5I3U A;  4C8O A;  1ZBI A;  5JLH A;  3OJU A;  4WFN L;  1WSF A;  3DI6 A;  3ATU A;  4DG1 A;  5C24 A;  1VSD A;  4CJE A;  1HNV A;  2NRX A;  4IFV A;  1OVQ A;  1MA9 B;  1XHZ A;  3K5M A;  4R79 A;  3N4Q A;  4JKF A;  2A1R A;  5E84 A;  3U3Y A;  5GIN A;  1U4B A;  2HHS A;  3L2V A;  3OS0 A;  3OJS A;  2O8E B;  4OGE A;  1ATN A;  3ENH A;  4FLV A;  3DRP A;  3ZEU A;  1UAX A;  4BR7 A;  4H0Y B;  3QDK A;  3SI6 A;  5GIP A;  3AVG A;  1TV6 A;  3VEZ A;  4F4K A;  4PY5 A;  2YJE A;  4JI8 K;  3THW B;  1CXQ A;  1U48 A;  3CJ7 A;  3OS2 A;  2VGM A;  5M1O A;  4JKE A;  3T7Z A;  3BF1 A;  3DRR A;  1TAQ A;  3VN5 A;  1S72 N;  4LFA K;  4H0T B;  2UXB K;  1YT3 A;  4CIE A;  1RT1 A;  2QWN A;  4H5N A;  1RBT A;  1D5A A;  3VOV A;  2W6L A;  3D0P A;  4N47 A;  1A5V A;  3THX A;  3CXC M;  3MDQ A;  4HUE A;  1N6Q A;  4FXD A;  3JXU A;  3NE6 A;  2G8H A;  4OPA A;  1OVY A;  2QWO A;  1U04 A;  4ID5 A;  4FLZ A;  5F0X A;  2CGK A;  3UB5 A;  4OX9 K;  4FOI A;  1GOB A;  5GIO A;  4DTO A;  4C1N K;  4KHP K;  1BA0 A;  4C8L A;  1EP4 A;  1NGA A;  1BIS A;  3LAK A;  4KHU A;  1K9M O;  4W5T A;  1HRH A;  2Q0R A;  1YIT N;  3P83 D;  4FLW A;  1QHA A;  4FLU A;  1EQY A;  3WQU A;  1QQN A;  4CJ5 A;  5GAD P;  3DYA A;  2Y1I A;  2AP1 A;  2RKI A;  3EY1 A;  2A41 A;  4Z4I A;  3MK6 A;  3AVH A;  4CE9 A;  2GUP A;  2O8C B;  1TYQ A;  3HSC A;  4LF7 K;  3J80 O;  3TAM A;  3E9O A;  1VQM N;  3V1Q A;  4CEZ A;  1B9D A;  3QEI A;  3WXK A;  3NAE A;  1JLQ A;  1X9S A;  3D45 A;  3THV A;  1N8R O;  1RT6 A;  4JK8 A;  4JNE A;  4J8F A;  4LFB K;  4MO4 A;  4BDZ A;  3KLG A;  1D9F A;  4E0D A;  3OYL A;  4PA1 A;  4DS4 A;  1QS4 A;  4RWT A;  2XY5 A;  1NJY A;  1RT3 A;  1ASU A;  3GL1 A;  1GLF O;  2NLX A;  1VQ4 N;  3KLF A;  2E88 A;  3ULD A;  1YJN N;  3AV9 A;  3KKR A;  2Z1I A;  4CEC A;  3ZSZ A;  4GY2 B;  1VSM A;  2UUC K;  1FK9 A;  3T1Y K;  3NVK A;  4LC9 B;  4KHQ A;  2A5X A;  5AQV A;  3MWT A;  1ZBH A;  4DR1 K;  1NMN A;  4B1Z A;  2GBZ A;  3Q7C A;  5D3G A;  4B1V A;  5FPN A;  2HND A;  3SPZ A;  3TU5 A;  4LY7 A;  4CJ4 A;  4QS8 A;  3L3V A;  3FE1 A;  1FKP A;  4WE1 A;  3K58 A;  2FF3 B;  3V9Z A;  2WOM A;  2Q97 A;  3HTV A;  3O9T A;  3V9S A;  2E5L K;  3AVK A;  5AQP A;  3LAM A;  1BIZ A;  1NGC A;  1NG9 A;  1RGI A;  3CM5 A;  4DFK A;  4WQ4 A;  1KRP A;  4DSJ A;  4JHD A;  4BVO A;  5FPE A;  2D4W A;  1B92 A;  3VEN A;  4DTX A;  3QBX A;  3VQ5 A;  1MU2 A;  4FPA A;  1ZBU A;  4JD2 B;  4BE0 A;  3V1O A;  4KB0 A;  2QK9 A;  3OYC A;  3ZCM A;  1Q18 A;  4M7Y A;  5FRO A;  4F3T A;  5AZI B;  4CF9 A;  1GOC A;  4YOU A;  3ZSO A;  3TAN A;  5FDL A;  3NH2 A;  1OH8 A;  4JKC A;  3TAB A;  2D1K A;  4BRO A;  4JI1 K;  1RFQ A;  4RW9 A;  4PHT X;  3G0Z A;  4BR0 A;  3TI0 A;  1G99 A;  3J7Y P;  5AQH A;  2XY7 A;  4YOV A;  2YNH A;  4YHH K;  2E2O A;  4IG0 A;  1UOC A;  4B1U B;  4EHT A;  5M1P A;  3H6E A;  4PKI A;  4FLT A;  2Y1J A;  1WSJ A;  1KTQ A;  1WN7 A;  4XH4 A;  5AQS A;  1VAZ A;  4JK7 A;  2ZD1 A;  2P9K A;  2VG7 A;  4N56 A;  3RSE B;  3QML A;  3HST B;  1DTT A;  3O6W A;  3I8D A;  5AQJ A;  2IVO A;  4EIA A;  4E7H A;  1ZBS A;  1TKX A;  4CFB A;  2HHQ A;  3KZB A;  5EVZ A;  2O8F A;  1NNE A;  3AVA A;  4UQG A;  3L2R A;  1JLB A;  4E7I A;  4CEQ A;  3PO5 A;  1OH7 A;  1TK0 A;  3A5L C;  2FBY A;  3OYF A;  3EKU A;  3VQ4 A;  3VQB A;  2VG5 A;  1DLO A;  3J7A P;  2A6A A;  4AHR A;  4J2B A;  5BN8 A;  3SCX A;  2PFU A;  4AHU A;  1HYZ A;  3LPT A;  2Q36 A;  5AQK A;  4JKH A;  1GLE G;  3ZEU B;  2NZT A;  4M41 A;  2CH5 A;  2BE2 A;  4JI2 K;  2E2N A;  1J5E K;  5C0Y A;  4MDB A;  4DV2 K;  1IKX A;  4B8A B;  1TK5 A;  3C6U A;  3CIP A;  1SKS A;  3O1W A;  3LDN A;  1C0U A;  2KTQ A;  4M3Y A;  4CVN E;  3I33 A;  1VSK A;  2P9N A;  2YNI A;  5HRR A;  1LOT B;  3THX B;  4HCC A;  5JVG L;  3QEX A;  1GLA G;  2W42 A;  2R7Y A;  3HI0 A;  4H0O A;  4HVJ A;  2O8E A;  3CPW M;  3M8Q A;  4DFM A;  3DXK A;  1RTJ A;  2E4L A;  2Z1G A;  4BE1 A;  4FSV A;  5BRE A;  3MCA B;  4CF8 A;  2IVP A;  1Z05 A;  4AM6 A;  4E7J A;  3THW A;  4KB1 A;  3KK7 A;  2WBN A;  1CZA N;  3DXM A;  4R5P A;  1VSF A;  3VPZ A;  4BE2 A;  3ZLJ A;  2BGG A;  2YHY A;  4CHY A;  4JV5 K;  4CJQ A;  5BRD A;  4FWS A;  4YY3 K;  3OTO K;  4C8K A;  3MN9 A;  2X74 A;  2VWK A;  3EKS A;  3CET A;  5HL7 L;  4HUG A;  5CZ1 A;  4Z4G A;  1JLC A;  2JGU A;  3OYM A;  1JJ2 M;  3SZ2 A;  2OPS A;  4BAC A;  2RN2 A;  2HHT A;  3IS9 A;  5C2D A;  1T6D A;  3G71 N;  1XMQ K;  3NF8 A;  3CQ8 A;  4OO1 J;  1X3N A;  4OPH A;  1IH7 A;  2G8U A;  4FVU A;  3H3O B;  4ELV A;  3S3O A;  1BA1 A;  4EAH D;  1GLC G;  4K0K K;  4LH5 A;  2YHW A;  2NRH A;  1JXB A;  1C0T A;  4CEO A;  3HK2 A;  3O9U A;  1HR0 K;  1HQU A;  4KRE A;  1YAG A;  1UWB A;  4FWN A;  5HP1 A;  1T8E A;  2HW3 A;  3VTI A;  3NMU A;  3PO4 A;  3M8S A;  2CH6 A;  4K25 A;  4QS7 A;  1VQ8 N;  4KHS A;  3NHG A;  1CZB A;  4B1Y B;  4CBU A;  2XY8 A;  4A2B A;  1R0A A;  2W6K A;  4M42 A;  2O8C A;  3C95 A;  2PZS A;  1Q82 O;  4FJN A;  3QER A;  3NCI A;  3IRX A;  4FPB A;  3TTC A;  3GOI A;  4KI4 A;  2X6S A;  2P9P A;  3ZT0 A;  1U47 A;  1T6C A;  3CCR N;  3BGR A;  3AA4 A;  4DCH A;  5AQU A;  3SMS A;  4O4G A;  3SJH A;  1QSS A;  1QSL A;  1C6V A;  3DLG A;  1JKH A;  3KIO A;  4JKA A;  3SQ2 A;  3AVC A;  3QET A;  3GE1 A;  3I56 N;  4BY9 C;  4FCY A;  5J2Q A;  3H1V X;  2VWB A;  5AQL A;  1KCF A;  3K2P A;  1X9J A;  3ULE B;  2W40 A;  4CJP A;  3SBT A;  3CME N;  2DY4 A;  4B1X B;  4KPY A;  1W2B M;  2H3G X;  2PAV A;  2DFH A;  2I7N A;  4A57 A;  4JI3 K;  1ZYQ A;  1NJZ A;  4DTS A;  1I94 K;  4IXC A;  3MN5 A;  3LPU A;  5HOO A;  3GDQ A;  4K8X A;  1TL1 A;  2ITG A;  4O44 A;  1Z25 A;  3WNF A;  1BQN A;  1BI4 B;  1NJX A;  5BPM A;  2ZM6 K;  3KWI A;  1U45 A;  4CEF A;  1K6Y A;  4ILJ A;  5FRN A;  1NGH A;  4JHD B;  4B9V A;  2KKZ A;  2QWQ A;  2YX6 A;  3LDQ A;  4M3R A;  5AQR A;  1KFD A;  5C10 A;  5M1F A;  1X9W A;  1NJI O;  4C8M A;  4JI6 K;  5IWA K;  3PLA A;  4FWO A;  3U6F A;  3VEV A;  1ASW A;  4AHT A;  4A5B A;  1QVG M;  3R6M A;  4CCH A;  3B6P A;  2CGL A;  2HNZ A;  3ZSW A;  4QCL A;  1ASV A;  4Y1C A;  2PY5 A;  4FO0 A;  2ZQB A;  4C1N I;  4DLE A;  2IGI A;  4H0P A;  3QIN A;  2Q31 A;  3RRH A;  3VQ7 A;  4JYA K;  5AQZ A;  2HOE A;  1A5X A;  5C2F A;  2WON A;  4JKD A;  3O08 A;  4E7K A;  4NLB A;  1X1P A;  4E89 A;  4IFY A;  2OZS A;  3JS6 A;  5SZT A;  4JD2 A;  3I55 N;  2F7T A;  4CJV A;  2RE2 A;  4B3T K;  3V9U A;  1QVF M;  3JSM A;  3KLH A;  3IAY A;  3VEW A;  3CCL N;  2P9K B;  5CHI A;  3P38 A;  2PYJ A;  3SQ4 A;  2B6A A;  3B8A X;  2D5R A;  3NH1 A;  4M3T A;  4BGA A;  5M1Q A;  3H08 A;  3IKM A;  3N4P A;  4CHZ A;  1BO5 O;  4DSK A;  3L6Q A;  2P5G A;  2O8F B;  4DV1 K;  3SUN A;  4BRN A;  2NRT A;  3WEE A;  5AQY A;  1LW0 A;  1NGG A;  1VSH A;  4B3M K;  4B3O A;  1OH5 A;  3VQ8 A;  2E8A A;  3OYB A;  1Q9X A;  3LM9 A;  3DRS A;  3OYE A;  3QEP A;  1YJ9 N;  2ITM A;  2FSJ A;  3CJB A;  3RSE A;  3VQD A;  1NK7 A;  2FC0 A;  1RDA A;  4BWJ A;  1VQO N;  4CJS A;  5AFU H;  4EZ9 A;  1BOT O;  3VMF B;  1RDW X;  3CCE N;  3UIQ A;  3CC2 N;  3S41 A;  1MWM A;  1QSY A;  1VHX A;  1NWK A;  3VGK A;  2OPQ A;  4ZTF A;  2FBT A;  4YDU C;  5ADX A;  3SPY A;  1NOY A;  4BRE A;  1S1T A;  1SV5 A;  1KC8 O;  4FJJ A;  4IZ9 A;  2P9N B;  3ENB A;  4BC3 A;  3M5R A;  3JYT A;  5E26 A;  2KHO A; 
#chains in the Genus database with same CATH homology
 4DV4 K;  4DR1 K;  4K0K K;  2UUB K;  4B3R K;  1HNX K;  4LF5 K;  5FLX O;  1HR0 K;  4DV0 K;  3J7A P;  4GKK K;  2UXC K;  4LF8 K;  4JYA K;  3J81 O;  1XMO K;  4OX9 K;  4LF6 K;  4DV6 K;  4KHP K;  2HHH K;  4DR3 K;  3JAM O;  2E5L K;  4JI2 K;  1IBM K;  4B3T K;  4LF4 K;  2UXD K;  1J5E K;  4JI0 K;  4LF9 K;  4DUY K;  4DV2 K;  4X66 K;  1N34 K;  4NXN K;  5LL6 Z;  5IT9 O;  4DR5 K;  4B3S K;  5BR8 K;  4CVN E;  2VQE K;  5LMU K;  5AJ3 K;  4DR2 K;  4LF7 K;  4DV1 K;  3J80 O;  4LFC K;  4DR6 K;  1HNW K;  4B3M K;  4JI4 K;  2F4V K;  4DUZ K;  4JI1 K;  4V19 S;  2UU9 K;  4DR7 K;  3J7Y P;  4DV5 K;  4LFB K;  4JI3 K;  1I94 K;  4YHH K;  1N32 K;  4CW7 B;  4DR4 K;  5A2Q O;  5LMN K;  4X62 K;  4DV7 K;  1IBK K;  4JV5 K;  4NXM K;  4YY3 K;  3OTO K;  2ZM6 K;  1IBL K;  1N33 K;  1N36 K;  1XNR K;  1FJG K;  4AQY K;  4JI8 K;  4X65 K;  2VQF K;  1XMQ K;  1XNQ K;  4JI6 K;  5IWA K;  4X64 K;  2UUC K;  2UUA K;  4LFA K;  3T1Y K;  2UXB K;  3T1H K;  4GKJ K;  4JI7 K;  4JI5 K;  1HNZ K;  4DV3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...