4JI7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji7K00
4DUZK 5AJ3K 4DV3K 4LF9K 1XNRK 4X66K 4JI0K 3JAMO 5IWAK 2UUBK 2UU9K 4DV7K 4JI7K 4DV1K 4JI5K 2E5LK 1J5EK 4DR7K 4B3RK 4JI1K 4GKKK 4JYAK 2UXDK 4YHHK 4DR6K 1N32K 2VQEK 4LF6K 5A2QO 4B3TK 4DV2K 1XMOK 4LFCK 2ZM6K 1N34K 1IBLK 4LFBK 4LF4K 4B3SK 1XNQK 4DUYK 3T1HK 5LL6Z 1N36K 4NXMK 4LF5K 4DR1K 1I94K 4X64K 4DR3K 3J80O 3J7YP 1HNWK 1HR0K 4JI4K 5BR8K 4LF7K 2UXBK 4DV5K 4JV5K 4DV0K 5LMUK 4DV4K 5IT9O 4V19S 4JI2K 1IBKK 4CVNE 3J81O 4LFAK 4DR4K 4AQYK 4X65K 3T1YK 5FLXO 4KHPK 2F4VK 2UUAK 2UXCK 4JI6K 4CW7B 4K0KK 1XMQK 2HHHK 2UUCK 4NXNK 4B3MK 1N33K 1FJGK 4OX9K 4LF8K 4DV6K 4JI3K 1HNXK 1IBMK 4YY3K 4X62K 5LMNK 1HNZK 4DR2K 4JI8K 3J7AP 2VQFK 4DR5K 3OTOK 4GKJK
chains in the Genus database with same CATH superfamily
4Y1DA 4J2DA 3D2FB 1BDGA 2ZJQL 4L8RB 3BZKA 1QSSA 2O8DA 3NMUA 4KBOA 1ZBSA 2WUSA 1C6VA 1TL1A 3AAPA 1VQ9N 4B3RK 4GKKK 3MCAB 4ELTA 3P38A 4H0VB 4YHHK 1L3UA 4CGDA 3RR8A 4ILHA 5AQKA 1SL0A 4B9MA 4KB0A 2D0OA 1KAXA 2E1YA 2RF2A 4MO5A 2GEMA 4N5SA 1Y97A 3K59A 3ZYYX 3G71N 1NK4A 3THXA 4CCHA 1KD1O 1O1WA 3OVNA 1VSEA 3G25A 1OVQA 4CI6A 4BE0A 1ZBHA 1SL2A 3WNGA 4DQRA 3WUHA 5AZJB 3ZSWA 4M3XA 1C1AA 1YJNN 3CHWA 3CF5L 2F9TA 3O4NA 1KAZA 3SCXA 2UYTA 4B9NA 3OS2A 1X3MA 1DT9A 1J6ZA 3AGKA 2P9IA 4ZTFA 2Q31A 3NFAA 4LH4A 3LWLA 3VPZA 1BQNA 1S1TA 2HF3A 2YNHA 4WQ5C 4DHYA 1N5YA 3EE9A 5AQQA 4CEAA 3TU5A 3O4WA 5M1OA 1Q7YO 5D3GA 2YI1A 4I6MA 4HCCA 4FJ8A 1V4TA 2B4JA 5JLHA 2O4GA 2AP1A 3V6DA 3O9TA 4CGGA 2XHBA 1S22A 2O8EA 3A5NC 1VQMN 4MDAA 3O9QA 2QI2A 4M63C 1NOZA 5AQZA 4DMNA 3SQ4A 3SAFA 5M1KA 1YITN 1NJYA 4FLZA 3H1VX 5B8HA 4CZJA 4GV9A 3AO5A 3NH1A 3TAMA 1LOTB 3WXMB 3TAPA 1RTDA 1RBUA 4CJ4A 1KVBA 5BR9A 5M1NA 4C8KA 3QIOA 4CIFA 4W5NA 4KI6A 3BY5A 2HBMA 4Q5VA 3IKMA 4XH5A 4CEBA 3CC4N 4KH6A 5SZTA 3ZEUB 4K8XA 4IDKA 2OPPA 3VEVA 1BIZA 1JCEA 4EHUA 3EYZA 3FZKA 4DTSA 5AR0A 4NCAA 1HR0K 4JI4K 4GMJB 3MN7A 3CCEN 1ASVA 3IMXA 3PSFA 4CEDA 1CZAN 4C1NK 5AQUA 3TAGA 3OYBA 2DFHA 3DXKA 2HBLA 1JLQA 1VSMA 1JLCA 1ASUA 4B1UB 1NK5A 1IBKK 4W5OA 2OTLN 3ZT1A 2ETJA 4WQ4C 3CC2N 4DSKA 1K8KA 3SV4A 4ISGA 3JYTA 4FW2A 3NBPA 4GY2B 3UKUA 1DTTA 3VETA 2XY5A 3PSIA 1X1PA 3CQXA 4KHQA 1XMQK 4Y0WA 1VSKA 3I0RA 1UWBA 2KFZA 2QKKA 1X9SA 3AVNA 4OX9K 3FZHA 2IGIA 3EN9A 4O0JA 3RRGA 2BGGA 2O8BB 3VQ7A 2YHWA 5AQSA 3H6EA 3C94A 5H1SQ 2DY4A 3HI0A 3L3UA 4CK3A 2P9PA 5BN9A 3MXJA 4IWVA 3P39A 1B9DA 3M5RA 5AQOA 4CIGA 4OPAA 5AQMA 2QEXN 4JI0K 4PL8A 5F2RA 1EX4A 4CJTA 3PUFA 3AVLA 4HUGA 1TYQA 3ASMA 1SKRA 3NF6A 4JKAA 1T05A 5FRMA 2YNGA 1SKSA 4F3TA 4J2AA 2VQEK 4AM6A 3MX2A 4OGEA 1WAJA 3QEIA 3K57A 3L2QA 1KXPA 5FRNA 2D0PA 3O3FA 4FJJA 3L6QA 4YDUC 1NBWA 1RTHA 2Q1NA 4KV8A 3RRHA 4IOAL 3V9SA 3A5OC 2IOCA 4CZFA 4BC3A 4IEIA 4DR3K 2BUPA 3NGIA 4GVMA 2G8WA 1F21A 1U2VA 4DTRA 4KH4A 4JEPA 3D2EB 3EY1A 4KHUA 4BC5A 4BRCA 1DTQA 4N47A 5IT9O 1RCHA 1ATNA 4CJ7A 2P9UA 5M1PA 1WB9A 4KO0A 5KPZA 2Y1IA 3THWB 1NGEA 1QQOA 2FSKA 4H5TA 1S5JA 5FROA 3ZT0A 2P5GA 4K25A 1DLOA 2EWSA 1EWRA 4KHYA 3VOVA 2IVPA 2R7YA 1HYVA 2YKMA 4Z4GA 2HMIA 4M41A 3BF1A 3DAWA 1JLEA 1YI2N 3LWMA 1H1VA 5GADP 5BPMA 3K5MA 1HKCA 4XH4A 3U8XA 4AHTA 3AVJA 2Q36A 3RR7A 5AQTA 1FKOA 2HHVA 1EKEA 4QS9A 1EXQA 4YOUA 4I7FA 4A61A 2E88A 2YHBA 3E66A 2YJFA 4FWMA 4OPHA 3CM5A 4QOZB 4O44A 1FKPA 1XHXA 4ISFA 4DV3K 3BF3A 1XNRK 4CZLA 2WBNA 3SUNA 5BN8A 2FBYA 1QZ5A 2E2OA 3ULDA 5HRNA 1VQNN 4Q0BA 1C1BA 1GLEG 3BEXA 4PKIA 1DEJA 1GLFO 3ENOA 1K9MO 1OH5A 3HTVA 3P31A 4JI1K 3WNFA 1ESVA 3SLCA 3P4IA 3OHRA 5KPTA 2F8SA 5LY3A 2GWKA 4ELVA 4LF6K 2HOEA 3PIPL 1YVUA 2NZTA 1O13A 2RE2A 3KD5E 2HHQA 5CYMA 3DXMA 2GV9A 3ITHA 3T1AA 1N34K 4CJFA 4LF4K 2KZMA 4RTFD 1VQ7N 3OYJA 2VGMA 4CD1A 3KWGA 3RWUA 3AVGA 3TPQA 3L3VA 2GELA 2IC3A 2QWMA 4TSXA 1WOQA 3VQEA 3KK1A 5BREA 3L2WA 3VF6A 4WQ4A 1TUUA 3DJCA 4AH9A 5KTQA 1YAGA 2VWKA 3CMAN 2HVHA 3LP0A 5F1XA 1P90A 1SQKA 1HPZA 4C8MA 3U6FA 3CCRN 3R3LA 5KGWA 2JGUA 3L0QA 3CJ9A 3PX4A 1J53A 4BRAA 4FLVA 3M8SA 4CHYA 1IH7A 5GINA 4KREA 5DM6L 4DTMA 5I3UA 3DOKA 2ITMA 4X65K 3CCSN 1ZBLA 3SV3A 3A8YA 3LDPA 4OVLA 5GAHP 3J7ZO 1WSIA 2DTUA 3Q7BA 3H3NO 4B9VA 5JS1A 2A40A 3L2RA 4BRLA 2IAJA 3TAEA 3G0ZA 3LAKA 1T6DA 4CGJA 4I9QA 2ZE2A 1VK0A 4XH1A 4QS8A 5C24A 3V1OA 4C8NA 4IXCA 3VEZA 4F3OA 4FOIA 3M8RA 4FWSA 2NRVA 2O4IA 3LDLA 2NRWA 2Y1JA 3CD6N 2O8FA 1S6QA 2V7YA 1N6QA 3WQTA 1YHQN 4DKWA 3JAMO 1TL3A 3C7NA 4FK4A 1T6CA 4ID1A 4YDUA 4RW7A 1RDCA 1BISA 2OPRA 4DR7K 2P9NA 2YNIA 4GNIA 4Y1CA 1RFQA 4DR6K 1N32K 1BWFO 1UOCA 4WF9L 5KRSA 3ZSQA 1GLJO 1S72N 1HQUA 4YOVA 3O1BA 3LZIA 1MWMA 4B3TK 1YIJN 2QWQA 1NGHA 4LFCK 3IFRA 4JHDB 3K5OA 4JK7A 1HYZA 4JD2A 4GV6A 3VQ9A 4B9QA 3TWHA 1YF5L 5HP1A 4EP5A 4W5TA 2KTQA 4DSEA 3VQ4A 3ZT4A 2P9KA 4O55A 5GIPA 3AVHA 4C1NI 4CJUA 1QQCA 1KTQA 3F9MA 3V9WA 4DU4A 2I5JA 5CR4A 2HHWA 3SQ2A 3EKUA 1S1XA 2P1JA 3HOSA 3SQ0A 3KLHA 2ASOA 4FWRA 3VQ8A 3T3FA 2HNYA 1KRPA 1TV6A 3J81O 3VQQA 3HK2A 3TSPA 3CFOA 4CD3A 4A57A 3LL3A 5FLXO 1L3TA 1GOCA 4JKGB 2UXCK 4CBXA 2G8VA 1RT7A 3M8QA 4CE9A 1SZ2A 1C0FA 1A5XA 3RMCA 3HXMA 2G8HA 3C6AA 1TKXA 1YJWN 1VSIA 3CCUN 1GLDG 1TKDA 5E84A 1R59O 1YXQA 3ULEA 3L2UA 4NLCA 4BRNA 4IO8A 1EO1A 1YTAA 4BG9A 3P83D 1NG9A 1ZC6A 4JI8K 1RT5A 2A41A 1ILYA 5TKWA 3U4LA 1Z05A 2VQFK 3AVBA 3IS9A 1EETA 1X9WA 4YOYA 2ZGZA 3PO5A 1C1CA 4F2SA 1NK7A 3NHGA 3M1FA 1BCMA 4B1WB 1K73O 2H3GX 2E2NA 4HCBA 1BGXT 1QSYA 4JI5K 3RSEB 1HKGA 3O3HA 2E5LK 2HHUA 1CZBA 3VGMA 3HZ6A 4JYAK 4DWIA 2UXDK 1RBRA 3ATUA 4JRQA 3NGZA 2VWBA 2QW9A 1RDUA 3THXB 1WSEA 3BGRA 4B1YB 2RPIA 3DLBA 1SL1A 3E9LA 1VAZA 3DLLL 3O9UA 1NNEA 1XNQK 3HRGA 1L3SA 2OPQA 4BE1A 5ELZA 3UB5A 5I9EB 3CJAA 2YJEA 4LF5K 2YX6A 2HNDA 2KLAA 3J7YP 1QZ6A 3EEQA 3V9XA 1D8YA 3SJHA 4H5VA 3EO3A 3C6UA 3MN5A 5J1EA 3LP2A 3U9ZA 4A2BA 4WCEL 5HOOA 4IJNA 3JSMA 4BDYA 3VQ6A 3CCLN 3ZSOA 4H0XB 2P9IB 4AHRA 2UXBK 4DV5K 1HLUA 5AQNA 4JV5K 4CF0A 3HP6A 4DV4K 1LWCA 2ZQBA 3ZLJA 4AHCA 3QEPA 3G10A 4FSVA 3ATVA 4IOXA 1KSPA 4E7IA 1I39A 3HPGA 2HF4A 4KHPK 4J2BA 4I6MB 4K42A 4JKFA 3QBWA 3AO4A 2P51A 3A2FA 3OYGA 4E7HA 4W5RA 4FK2A 4LY7A 4M3RA 1KFSA 1RBTA 1ZBUA 3OYDA 1VQ5N 4CERA 3OS0A 4NCBA 2VG7A 1QE1A 2Q97A 2O8EB 3H1QA 4X62K 4BRFA 4LC9B 3CCQN 3FZFA 3O08A 5J2PA 3FZMA 2HHSA 5HBMA 4JRPA 1SUQA 4DR5K 3HM9A 4I2QA 4BGBA 4CZMA 5AJ3K 1S1VA 2ZJRL 3ID8A 4CFDA 3KK2A 3ZETA 1NK9A 3NF7A 3LP3A 3FZLA 3OYIA 4DV7K 2XRIA 4JS5A 1WNSA 3LDSA 2FSNA 5CYQA 3FR0A 4BR9A 3MEGA 1C0UA 3QLHA 2NRRA 3DOLA 5TKYA 5JVGL 3MWTA 4GV3A 1U6ZA 4PA1A 4Z94A 2YHXA 3F73A 4UQGA 1KCFA 3VERA 4GW6A 1JL2A 4O5BA 5AZJA 5EY4A 3FFIA 4FZZA 2QA4N 3ENHA 2BE2A 2I7PA 4MLHA 1I94K 1JCGA 3SPYA 5CE3A 1ITGA 4ELUA 5AQRA 2A1SA 3MEDA 2F8TA 3CG7A 4CJWA 2W6KA 2PBDA 3QB0A 3IG1A 4KPYA 1QVGM 4RW6A 1HJOA 4CK1A 3S9HA 3CMEN 1NMDA 5LMUK 3BUZB 2HB5A 4AF1A 1EQYA 1JXEA 5FPNA 4JK9A 5F0XA 3UKUB 1QQNA 1VQLN 4WE1A 4AQYK 3LM2A 3S3MA 3ALYA 2VCPA 4K41A 4JI6K 4CW7B 1VSFA 3AVAA 5AQPA 4M3WA 2GBZA 3L4QA 2G8FA 4KHWA 3AA5X 2VG6A 4ID5A 3AA4A 4Z4CA 2NRHA 3DM2A 3F5TA 4FLUA 1B9FA 2PFUA 3HVRA 3EE8A 4AHUA 3WXIA 2QXFA 4O0IA 5KQ8A 3HT3A 1XUPO 1UA1A 4B1ZA 3V1RA 4CJPA 4M3ZA 2ASPA 3DRRA 1TYQB 2GX9A 4ZHRA 4E1NA 4CJQA 3NCIA 4DTXA 1RNHA 2KHOA 3SBGA 3SBTA 4DB3A 2PYJA 4O5FA 4DV1K 4DSJA 1RDAA 2A3ZA 3OYEA 2O8CB 3OYCA 2IIRA 4KHSA 4FVUA 3TR8A 4H03B 4XEIA 3N4PA 3CJBA 2BH1A 3H45C 1LW0A 4PUOA 3C6HA 1T03A 5EOYA 1Q81O 4BWMA 2XO7A 4CEFA 4H4MA 5C2FA 1XMOK 3VTIA 2JWKA 2NRXA 4BREA 1OH6A 1S9GA 3EKSA 4FJKA 3VN5A 3THVA 1U2VB 3MXMA 1FXXA 4LSNA 5C10A 3ZT2A 1HRHA 1S3XA 3BDPA 5AQJA 3AV9A 4OKEA 1WSGA 1WSJA 1Z26A 4FW1A 4JKCA 1EP4A 1ZXOA 4CEQA 1CXUA 3MN9A 2P9UB 3LAMA 4BG8A 4EZ6A 3MX5A 4JKDA 3QMLA 1MDUB 3S3OA 1CXQA 3OYAA 4Z4HA 4V19S 2DPNA 2WTUA 2FC0A 1IV0A 1TGOA 1WLJA 4E7KA 4CESA 1RILA 3CJ1A 3FGUA 4DR4K 4H5NA 4OKKA 1Z6RA 1RTIA 3CQ8A 3DLGA 2F4VK 3QICA 3MMVA 2E4LA 1IKWA 3LP1A 1NGBA 1K8AO 3GL1A 1N33K 2D0CA 3CCVN 3CC7N 4HTLA 3HSTB 3WEEA 1NK8A 3AVMA 4CF9A 1IBMK 3OS1A 2HBKA 5LMNK 3OY9A 3C95A 1HX1A 5CHIA 2IVOA 5AFUH 1IJJA 2J4RA 4LF9K 5AFUA 1KC8O 4PKHA 4E7JA 4X66K 5IWAK 1ZYQA 1R0AA 4PKGA 2E1ZA 4QS7A 4C23A 4KAZA 1KQSM 1DGKN 2AJQA 1MA9B 4BRKA 2QTDA 3BZCA 3TTFA 3QO9A 3MWPA 3GBTA 5DMRA 3V9UA 1U48A 4HHTA 4CJVA 4BY9C 2OZMA 2QWRA 3MDQA 3KHYA 2DFFA 3OYFA 4IEEA 2GWJA 3CJCA 3SMSA 1KLNA 3D2EA 1YTUA 2X6SA 4IJAA 4FJLA 1BI4A 3ID6A 4FOEA 5LL6Z 1N36K 3F9KA 2W6LA 2AA4A 1NJXA 1P8ZA 4JAXA 4CZKA 4DU3A 4E19A 1RT3A 2WC9A 4M45A 3WXJA 4CJRA 3CETA 4B9TA 1CZ9A 1TK0A 4LF7K 3KKRA 4A5BA 4CZGA 4B9LA 3NGYA 5ADXH 4FLTA 5BRHA 1X9MA 4FVMA 3KLGA 3J8AA 3S41A 3LPTA 4RW4A 4AHSA 1L5UA 3SUOA 2FF3B 3OBWA 4J8FA 2RHKA 3VQDA 3OA9A 2CH5A 1QSLA 1M90O 3IAYA 5AQIA 1JCFA 3CCMN 2A5XA 2F96A 5AQYA 3GOIA 3O4QA 3R6MA 2HHHK 5EVZA 1D4XA 5BPNA 4B3MK 5KPRA 4B8AB 4DSIA 4N76A 4JNEA 4M42A 3MN6A 5HL7L 3CPWM 4NCGA 3KZBA 3H46O 3MK6A 4CEZA 4FK0A 3VA0A 2E2QA 3V9ZA 4A62A 4B3OA 4EAHD 1OVYA 3DLEA 1U47A 3AVIA 1XC9A 3KK3A 1QVFM 4BQLA 3C7NB 4DUZK 4U7BA 5K14A 3FLCO 3VF4A 4OLBA 2E20A 1IKXA 3M6GA 2HBJA 2P9NB 1N8RO 1BO5O 4DFPA 4CGHA 2P9SA 1C0GA 1W0HA 4RWTA 4OPJA 4CHOA 3F2KA 1S9EA 4FWNA 1XQSC 4DQPA 4CHPA 2Q0UA 3DYAA 1Q82O 2IS3A 4PQUA 1KLMA 1DKGD 1LAWA 4JD2B 4G1QA 3AVCA 3KLIA 4MQ3A 1KFDA 4JLHA 3ZSVA 1VSDA 1SV5A 4EFHA 3K0SA 2P9KB 3MAQA 1TK8A 4DR1K 3TARA 1JXBA 3WNHA 3H3OB 4EZ9A 2A1RA 1NGAA 2D0BA 1HNWK 3KWIA 1BA0A 4BWJA 1T3VA 3I55N 4N41A 1WSHA 3W0LA 4F8RA 4DQQA 4FXDA 5LJVA 3L4IA 5J2MA 3CERA 1OH7A 4BR7A 3LDQA 3QFUA 2B6AA 1BOTO 3ZX3A 3SAHA 1C0MA 2D5RA 3U3YA 4Z4EA 1G99A 3T1YK 3P1GA 4BGAA 1JKHA 3I33A 1Q9YA 1M1KO 1VQ6N 5AQXA 1OH8A 3KKSA 4CZHA 5M1QA 4DTUA 2Z1GA 1A5WA 4N56A 1GLBG 1J9AA 3NF8A 4NXNK 1RT6A 1VQPN 4H0YB 3LALA 4IO9L 2NRTA 3ULEB 3PX6A 2RKIA 2Z1HA 4DV6K 4PY5A 1ATRA 3MECA 4DTOA 3LZJA 1RBSA 2FF6A 4IZ9A 1BCOA 3RMBA 2FBTA 3J7AP 1BU6O 1W2BM 3VGLA 1XC3A 1S1UA 3VESA 1A5VA 3HVTA 3UKRA 2E6MA 3JXUA 4DTNA 1NU0A 1LV5A 3HL8A 2V7ZA 4DLEA 4JHDA 3SUPA 4CF8A 4CFAA 1NJWA 1FK9A 5JMVA 3CI5A 3VEXA 3VQAA 4B9UA 1X3NA 2Q3SA 3VMFB 4DU1A 4QAGA 4MO4A 4BDPA 3KD1E 4KTQA 4Z0UA 4BVPA 4BC4A 4FM1A 3QINA 5AZIA 4E7LA 1NGGA 2KFNA 3AAQA 3HPHA 3TSQA 4CF2A 3QEWA 1W7AA 3CIPA 2O8DB 2ZM6K 2G8UA 3RVCA 3P5JA 2WOMA 1IBLK 4YOWA 3T19A 1JLGA 3A0IX 3LDNA 1UA0A 1HJRA 3T1HK 5E26A 4CHQA 4KHNA 3CQYA 1HYSA 3V1QA 3HYFA 5C2DA 3THYA 4C8LA 4KFBA 2Z1IA 4DSFA 3HO1A 3VTHA 4DFJA 1B92A 3QBXA 2RN2A 4YFUA 1UAXA 1D9FA 5BR8K 4EHTA 2EX3A 3CFRA 4IFEA 2YCHA 5C25A 1GLCG 1U04A 2QWPA 4H0PA 4MDBA 1NGFA 1RDDA 3JS6A 2OPSA 4M3TA 4KTZA 3T7ZA 4CJKA 4DS4A 2CGKA 3QEVA 2P9LA 5LJWA 4CZIA 1RDWX 2FBVA 2X78A 2G8IA 2HMPA 1NGDA 2XY7A 1VHXA 4QCLA 5I42A 4LD0A 1FW6A 4Z4FA 5JICA 4O8UA 3KIOA 3A5LC 5J2QA 5BRFA 1FJGK 2BTFA 1NOYA 3ZSXA 3OYLA 4BROA 3ZT3A 2HSTA 1WUAA 3ZSYA 3K9KA 4IKFA 4ILGB 1NGJA 3O9RA 2YHYA 4B1XB 1VQON 1SS6A 2CH6A 3SPZA 3RSEA 1IKVA 1JLAA 3HM8A 3ZETB 1ZBIA 4IDHA 4E1JA 3TTCA 5AQFA 3VEOA 5KI6A 4HVJA 3QFPA 3WT0A 1J54A 1JJ2M 2OA8A 4JKHA 4AILC 3TI0A 2BANA 4FLYA 3B6OA 3D2FA 4M3UA 1TKZA 3ISNC 2HW3A 2HVIA 2W41A 5FPEA 3V81A 2D1KA 4CHZA 4FJ5A 2VWJA 4MFBA 4IG3A 4IBNA 3A5MC 1CLQA 4FZXC 4BDZA 4JK8A 4M7YA 5CY4A 4CEEA 1ZBFA 4DV2K 1T44A 3O5BA 1Q18A 4FWQA 3RTVA 1D9DA 3O80A 3ZSRA 4BR2A 4NXMK 4CFBA 1VSJA 4YORA 1U49A 4HWIA 3O6WA 3J80O 2VG5A 2OZSA 3PIOL 1HQEA 3OYNA 3SJJA 3AVKA 4CJLA 3G6EN 4GVEA 1NKBA 2ITGA 3IUCA 4FM2A 3NH0A 2D4WA 3KK7A 4I9LA 3L8BA 3AA3A 4NYNA 1LCUA 1W9HA 1QTMA 1GLLO 3QDKA 5BRDA 2ASMA 4CVNE 3ZCMA 4LFAK 3HP9A 4BE2A 4CJSA 1NKEA 4ICLA 3DLKA 1IKYA 5HRPA 4DF4A 1J5OA 2KW4A 5AQWA 1IO2A 4BR4A 3S3NA 2B5JA 3DXKB 5M1FA 4WYBA 3FE1A 4YOXA 3E9OA 3GDQA 3QERA 4DQ8A 4LF8K 1NK6A 4DFKA 1QQMA 4BACA 4OJRA 1K8KB 4JI3K 4RG8A 3QEXA 4NO7A 2BDPA 4F4KA 1HNZK 1WN7A 1HNIA 4IOCL 4Z4IA 1WBDA 4K8ZA 2CGLA 2YKNA 5C42A 4BC2A 4NB4A 3BP8A 3KTQA 1NGIA 3R8EA 4BRQA 1BQMA 4RCHA 1LWEA 4YOTA 4BVOA 4JKBA 5FPDA 1Z25A 2UUBK 5FPMA 3LPUA 3PO4A 2P9PB 1D5AA 3E9PA 1E4FT 3CJ7A 1J5EK 2QWOA 4L3QA 2QWNA 4KTWA 2HHXA 4OPKA 4CEOA 4UY8O 3RMDA 4FWPA 2V51B 1HMVA 4LSLA 4B08A 1WBBA 1NWKA 4F9OA 1XI1A 4AHVA 3K5NA 5FDLA 5A2QO 1HUXA 4A59A 4FWOA 3CFPA 2YV0X 4E0DA 1TK5A 3NE6A 3ZX2A 3VF2A 4DF8A 3ZEUA 3MXIA 4PWDA 4FJGA 4DSLA 3NVMA 3FFKB 4NLBA 1RGIA 1VSHA 3NF9A 2PYLA 2YHAA 2EHGA 3PLAA 1JLFA 3OYMA 2NRZA 4BRHA 4BRDA 1SAZA 1KAYA 3CPEA 3AA2A 5EU7A 3OYHA 1IG9A 2Z1JA 3VEWA 3I56N 3CXCM 1TAUA 4DQSA 3B6PA 5GAGP 4CF1A 4JI2K 1T7PA 2KZZA 3R1XA 5AQLA 2QXLA 3AARA 3NDKA 4HUFA 3KLEA 3QIPA 4DTJA 1BG3A 2A6AA 4CJ3A 2E2PA 4K0KK 3QESA 5JS2A 4H5RA 4FWKA 3WEEB 3TAQA 3O1WA 1U45A 4DG1A 3NVKA 3PX0A 4BRIA 1TUYA 3SK3A 4XIUA 4DCHA 3Q7CA 3G4SN 3AO2A 4FJ9A 1L3VA 4YY3K 4B8CA 5JLFA 1GLAG 3OJUA 4PL7A 3VGKA 4F2RA 4AM7A 2O8BA 5HLFA 3M3ZA 2XY6A 2O8CA 3I0SA 3OTOK 2CGJA 1BIUA 3UE5A 2FBXA 3D45A 2OCEA 1X9JA 2Q2RA 3KJVA 3V4IA 3RMAA 4MLEA 1XHZA 3K9JA 2HNZA 1XWLA 2UU9K 3SNNA 4JI7K 4R5PA 4ILJA 1VRUA 3D0PA 3MEEA 4H5WA 4HTUA 4HUEA 2WFBA 2G8KA 1JLBA 4OO1J 3SZ2A 3AVFA 4WQ5A 3I8BA 2GUPA 1BI4B 3LM9A 3T69A 3C65A 1YVNA 1LW2A 1HPMA 3VQ5A 1GOAA 2F7TA 2FLOA 5KQDA 2D0AA 4B3SK 3EL2A 4A2AA 3CM6A 3ZSZA 1TKTA 5C15A 1E3MA 5AQGA 4RW8A 2W40A 3SUQA 3ZX0A 3AO1A 4W5QA 1Q9XA 4KKOA 5SWMA 1IG8A 1RT2A 2GUIA 2IVNA 3QNOA 1NLVA 3DXMB 1QS4A 4C8OA 3WXKA 4DQIA 4OLAA 1GOBA 3K2PA 1NJIO 4FJNA 3KVGA 3DWLA 3IRXA 3CCJN 3TSUA 2W42A 3W3DA 4FO0A 5EX5A 1YT3A 4IFVA 3THWA 4BRGA 2A42A 2JLEA 4FLWA 1K6YA 3SQ1A 4IG0A 1YJ9N 4KI4A 3AO3A 4FJMA 2NNWA 4R79A 2FXUA 1NM1A 4M7XA 3UIQA 4B9SA 5ADXA 3PY8A 1TAQA 2ZD1A 1NGCA 2I7NA 5CZ2A 2QK9A 3K58A 1HNVA 4H0OA 3EZ5A 5KRTA 3TABA 3H08A 3GG4A 2IDOA 1S1WA 4FJXA 2ZF5O 3VQBA 5T7BA 1W97L 3OYKA 3K5LA 4WFNL 4FZYA 2E8AA 5AQVA 3DLRA 1NJZA 5GIOA 4DS5A 2P9SB 2OYQA 4FPAA 1QHTA 1LAVA 2F9WA 1U4BA 4CZEA 1NK0A 2V52B 3DI6A 4H8KA 2O8FB 2OANA 3DRPA 1S6PA 3I8DA 1G15A 1ASWA 3PV8A 4FYDA 3EZWA 2LSNA 1VQ4N 1MU2A 4FJHA 1RT1A 3O9SA 3C0BA 4K43A 1C0TA 4LFBK 3LANA 5GAEP 1JL1A 4YNQA 2OTJN 4G9ZA 2KQ2A 3L2VA 4I2PA 4CGFA 3U3GA 3HSCA 2ZGYA 3LDOA 4BRPA 3O3GA 1BHLA 3DRSA 4PHTX 3B8AX 4FPBA 3VENA 4WFBL 4E89A 1V4SA 4BR0A 1Q86O 3HPOA 4A5AA 1SKWA 3SAGA 4FCYA 3SMPA 3VEYA 3HJFA 1E4GT 4LH5A 4RW9A 4WFAL 2QWLA 5JVHL 3U9DA 1RBVA 4BRMA 3DMJA 4DTPA 3WXLA 2Q0RA 4H4OA 3TAFA 1ATSA 2QM1A 4CK2A 1EWQA 1KVAA 2ZWHA 4O4GA 4IFYA 3SYZA 2ZJPL 3HBTA 3R9PA 1WAFA 4U67L 4FJIA 3E01A 1RT4A 2WONA 4CJ5A 3TTDA 4CECA 5BPLA 5KGXA 4EIAA 3NH2A 4DR2K 3VA3A 1VRTA 3WQUA 3E1YA 3UKRB 4NYFA 3SI6A 3GE1A 2VGNA 1WSFA 3OBYA 2GTDA 4BR5A 3AGRA 2E6LA 1NKCA 4J2EA 1I3AA 4DFMA 5DM7L 1QHAA 4O8KA 3CYMA 2XY8A 2NLXA 1VSLA 3IDHA 4EP4A 1BUPA 4E1MA 1KVCA 4DLGA 5AZIB 4FL9A 4M3YA 4FWLA 4JN4A 1HKBA 2JWLA 1LWFA 4KB1A 2PZSA 1Q8IA 1RTJA 5AQHA 3OJSA 3NAEA 4CIEA 3AY9A 3VQCA 3N4QA 3M8PA 1BL3A 4DUYK 3THYB 2QKBA 3VQPA 4X64K 5E41A 3D7EO 2X6NA 3C6TA 2VYPA 1YUWA 4CHNA 5HRSA 4CBWA 4CBUA 4CJEA 4CFCA 4DV0K 2P9LB 1T8EA 4CGIA 2PAVA 2DFEA 2HHTA 3MCPA 4OKJA 3KLFA 4JS4A 3DLHA 2P5OA 2ATQA 1RDBA 1Y64A 2NUBA 4ZTJA 4FLXA 1NMNA 2UUAK 3QNNA 4KRFA 1BA1A 1OKJA 4E3SA 3ENBA 1VQKN 5MLCQ 5C0YA 4B1VA 4FJ7A 2X74A 2UUCK 3TANA 2FSJA 4JKGA 4ISEA 5CZ1A 3WNEA 5EXWA 3OW2M 1VQ8N 4OGCA 5J2NA 4FM0A 1REVA 3HOTA 5HRRA 1HNXK 5DK5A 1MWKA 2YNFA 3O8MA 4H0TB 4KH5A 1TVRA 2KKZA 4JKEA 5C12A 3QETA 2PY5A 5HROA 4BQZA 4GKJK 3D6RA
chains in the Genus database with same CATH topology
4DUZK 5AJ3K 4DV3K 4LF9K 1XNRK 4X66K 4JI0K 3JAMO 5IWAK 2UUBK 2UU9K 4DV7K 4JI7K 4DV1K 4JI5K 2E5LK 1J5EK 4DR7K 4B3RK 4JI1K 4GKKK 4JYAK 2UXDK 4YHHK 4DR6K 1N32K 2VQEK 4LF6K 5A2QO 4B3TK 4DV2K 1XMOK 4LFCK 2ZM6K 1N34K 1IBLK 4LFBK 4LF4K 4B3SK 1XNQK 4DUYK 3T1HK 5LL6Z 1N36K 4NXMK 4LF5K 4DR1K 1I94K 4X64K 4DR3K 3J80O 3J7YP 1HNWK 1HR0K 4JI4K 5BR8K 4LF7K 2UXBK 4DV5K 4JV5K 4DV0K 5LMUK 4DV4K 5IT9O 4V19S 4JI2K 1IBKK 4CVNE 3J81O 4LFAK 4DR4K 4AQYK 4X65K 3T1YK 5FLXO 4KHPK 2F4VK 2UUAK 2UXCK 4JI6K 4CW7B 4K0KK 1XMQK 2HHHK 2UUCK 4NXNK 4B3MK 1N33K 1FJGK 4OX9K 4LF8K 4DV6K 4JI3K 1HNXK 1IBMK 4YY3K 4X62K 5LMNK 1HNZK 4DR2K 4JI8K 3J7AP 2VQFK 4DR5K 3OTOK 4GKJK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ K;  5AJ3 K;  4DV3 K;  4LF9 K;  1XNR K;  4X66 K;  4JI0 K;  3JAM O;  5IWA K;  2UUB K;  2UU9 K;  4DV7 K;  4JI7 K;  4DV1 K;  4JI5 K;  2E5L K;  1J5E K;  4DR7 K;  4B3R K;  4JI1 K;  4GKK K;  4JYA K;  2UXD K;  4YHH K;  4DR6 K;  1N32 K;  2VQE K;  4LF6 K;  5A2Q O;  4B3T K;  4DV2 K;  1XMO K;  4LFC K;  2ZM6 K;  1N34 K;  1IBL K;  4LFB K;  4LF4 K;  4B3S K;  1XNQ K;  4DUY K;  3T1H K;  5LL6 Z;  1N36 K;  4NXM K;  4LF5 K;  4DR1 K;  1I94 K;  4X64 K;  4DR3 K;  3J80 O;  3J7Y P;  1HNW K;  1HR0 K;  4JI4 K;  5BR8 K;  4LF7 K;  2UXB K;  4DV5 K;  4JV5 K;  4DV0 K;  5LMU K;  4DV4 K;  5IT9 O;  4V19 S;  4JI2 K;  1IBK K;  4CVN E;  3J81 O;  4LFA K;  4DR4 K;  4AQY K;  4X65 K;  3T1Y K;  5FLX O;  4KHP K;  2F4V K;  2UUA K;  2UXC K;  4JI6 K;  4CW7 B;  4K0K K;  1XMQ K;  2HHH K;  2UUC K;  4NXN K;  4B3M K;  1N33 K;  1FJG K;  4OX9 K;  4LF8 K;  4DV6 K;  4JI3 K;  1HNX K;  1IBM K;  4YY3 K;  4X62 K;  5LMN K;  1HNZ K;  4DR2 K;  4JI8 K;  3J7A P;  2VQF K;  4DR5 K;  3OTO K;  4GKJ K; 
#chains in the Genus database with same CATH topology
 4Y1D A;  4J2D A;  3D2F B;  1BDG A;  2ZJQ L;  4L8R B;  3BZK A;  1QSS A;  2O8D A;  3NMU A;  4KBO A;  1ZBS A;  2WUS A;  1C6V A;  1TL1 A;  3AAP A;  1VQ9 N;  4B3R K;  4GKK K;  3MCA B;  4ELT A;  3P38 A;  4H0V B;  4YHH K;  1L3U A;  4CGD A;  3RR8 A;  4ILH A;  5AQK A;  1SL0 A;  4B9M A;  4KB0 A;  2D0O A;  1KAX A;  2E1Y A;  2RF2 A;  4MO5 A;  2GEM A;  4N5S A;  1Y97 A;  3K59 A;  3ZYY X;  3G71 N;  1NK4 A;  3THX A;  4CCH A;  1KD1 O;  1O1W A;  3OVN A;  1VSE A;  3G25 A;  1OVQ A;  4CI6 A;  4BE0 A;  1ZBH A;  1SL2 A;  3WNG A;  4DQR A;  3WUH A;  5AZJ B;  3ZSW A;  4M3X A;  1C1A A;  1YJN N;  3CHW A;  3CF5 L;  2F9T A;  3O4N A;  1KAZ A;  3SCX A;  2UYT A;  4B9N A;  3OS2 A;  1X3M A;  1DT9 A;  1J6Z A;  3AGK A;  2P9I A;  4ZTF A;  2Q31 A;  3NFA A;  4LH4 A;  3LWL A;  3VPZ A;  1BQN A;  1S1T A;  2HF3 A;  2YNH A;  4WQ5 C;  4DHY A;  1N5Y A;  3EE9 A;  5AQQ A;  4CEA A;  3TU5 A;  3O4W A;  5M1O A;  1Q7Y O;  5D3G A;  2YI1 A;  4I6M A;  4HCC A;  4FJ8 A;  1V4T A;  2B4J A;  5JLH A;  2O4G A;  2AP1 A;  3V6D A;  3O9T A;  4CGG A;  2XHB A;  1S22 A;  2O8E A;  3A5N C;  1VQM N;  4MDA A;  3O9Q A;  2QI2 A;  4M63 C;  1NOZ A;  5AQZ A;  4DMN A;  3SQ4 A;  3SAF A;  5M1K A;  1YIT N;  1NJY A;  4FLZ A;  3H1V X;  5B8H A;  4CZJ A;  4GV9 A;  3AO5 A;  3NH1 A;  3TAM A;  1LOT B;  3WXM B;  3TAP A;  1RTD A;  1RBU A;  4CJ4 A;  1KVB A;  5BR9 A;  5M1N A;  4C8K A;  3QIO A;  4CIF A;  4W5N A;  4KI6 A;  3BY5 A;  2HBM A;  4Q5V A;  3IKM A;  4XH5 A;  4CEB A;  3CC4 N;  4KH6 A;  5SZT A;  3ZEU B;  4K8X A;  4IDK A;  2OPP A;  3VEV A;  1BIZ A;  1JCE A;  4EHU A;  3EYZ A;  3FZK A;  4DTS A;  5AR0 A;  4NCA A;  1HR0 K;  4JI4 K;  4GMJ B;  3MN7 A;  3CCE N;  1ASV A;  3IMX A;  3PSF A;  4CED A;  1CZA N;  4C1N K;  5AQU A;  3TAG A;  3OYB A;  2DFH A;  3DXK A;  2HBL A;  1JLQ A;  1VSM A;  1JLC A;  1ASU A;  4B1U B;  1NK5 A;  1IBK K;  4W5O A;  2OTL N;  3ZT1 A;  2ETJ A;  4WQ4 C;  3CC2 N;  4DSK A;  1K8K A;  3SV4 A;  4ISG A;  3JYT A;  4FW2 A;  3NBP A;  4GY2 B;  3UKU A;  1DTT A;  3VET A;  2XY5 A;  3PSI A;  1X1P A;  3CQX A;  4KHQ A;  1XMQ K;  4Y0W A;  1VSK A;  3I0R A;  1UWB A;  2KFZ A;  2QKK A;  1X9S A;  3AVN A;  4OX9 K;  3FZH A;  2IGI A;  3EN9 A;  4O0J A;  3RRG A;  2BGG A;  2O8B B;  3VQ7 A;  2YHW A;  5AQS A;  3H6E A;  3C94 A;  5H1S Q;  2DY4 A;  3HI0 A;  3L3U A;  4CK3 A;  2P9P A;  5BN9 A;  3MXJ A;  4IWV A;  3P39 A;  1B9D A;  3M5R A;  5AQO A;  4CIG A;  4OPA A;  5AQM A;  2QEX N;  4JI0 K;  4PL8 A;  5F2R A;  1EX4 A;  4CJT A;  3PUF A;  3AVL A;  4HUG A;  1TYQ A;  3ASM A;  1SKR A;  3NF6 A;  4JKA A;  1T05 A;  5FRM A;  2YNG A;  1SKS A;  4F3T A;  4J2A A;  2VQE K;  4AM6 A;  3MX2 A;  4OGE A;  1WAJ A;  3QEI A;  3K57 A;  3L2Q A;  1KXP A;  5FRN A;  2D0P A;  3O3F A;  4FJJ A;  3L6Q A;  4YDU C;  1NBW A;  1RTH A;  2Q1N A;  4KV8 A;  3RRH A;  4IOA L;  3V9S A;  3A5O C;  2IOC A;  4CZF A;  4BC3 A;  4IEI A;  4DR3 K;  2BUP A;  3NGI A;  4GVM A;  2G8W A;  1F21 A;  1U2V A;  4DTR A;  4KH4 A;  4JEP A;  3D2E B;  3EY1 A;  4KHU A;  4BC5 A;  4BRC A;  1DTQ A;  4N47 A;  5IT9 O;  1RCH A;  1ATN A;  4CJ7 A;  2P9U A;  5M1P A;  1WB9 A;  4KO0 A;  5KPZ A;  2Y1I A;  3THW B;  1NGE A;  1QQO A;  2FSK A;  4H5T A;  1S5J A;  5FRO A;  3ZT0 A;  2P5G A;  4K25 A;  1DLO A;  2EWS A;  1EWR A;  4KHY A;  3VOV A;  2IVP A;  2R7Y A;  1HYV A;  2YKM A;  4Z4G A;  2HMI A;  4M41 A;  3BF1 A;  3DAW A;  1JLE A;  1YI2 N;  3LWM A;  1H1V A;  5GAD P;  5BPM A;  3K5M A;  1HKC A;  4XH4 A;  3U8X A;  4AHT A;  3AVJ A;  2Q36 A;  3RR7 A;  5AQT A;  1FKO A;  2HHV A;  1EKE A;  4QS9 A;  1EXQ A;  4YOU A;  4I7F A;  4A61 A;  2E88 A;  2YHB A;  3E66 A;  2YJF A;  4FWM A;  4OPH A;  3CM5 A;  4QOZ B;  4O44 A;  1FKP A;  1XHX A;  4ISF A;  4DV3 K;  3BF3 A;  1XNR K;  4CZL A;  2WBN A;  3SUN A;  5BN8 A;  2FBY A;  1QZ5 A;  2E2O A;  3ULD A;  5HRN A;  1VQN N;  4Q0B A;  1C1B A;  1GLE G;  3BEX A;  4PKI A;  1DEJ A;  1GLF O;  3ENO A;  1K9M O;  1OH5 A;  3HTV A;  3P31 A;  4JI1 K;  3WNF A;  1ESV A;  3SLC A;  3P4I A;  3OHR A;  5KPT A;  2F8S A;  5LY3 A;  2GWK A;  4ELV A;  4LF6 K;  2HOE A;  3PIP L;  1YVU A;  2NZT A;  1O13 A;  2RE2 A;  3KD5 E;  2HHQ A;  5CYM A;  3DXM A;  2GV9 A;  3ITH A;  3T1A A;  1N34 K;  4CJF A;  4LF4 K;  2KZM A;  4RTF D;  1VQ7 N;  3OYJ A;  2VGM A;  4CD1 A;  3KWG A;  3RWU A;  3AVG A;  3TPQ A;  3L3V A;  2GEL A;  2IC3 A;  2QWM A;  4TSX A;  1WOQ A;  3VQE A;  3KK1 A;  5BRE A;  3L2W A;  3VF6 A;  4WQ4 A;  1TUU A;  3DJC A;  4AH9 A;  5KTQ A;  1YAG A;  2VWK A;  3CMA N;  2HVH A;  3LP0 A;  5F1X A;  1P90 A;  1SQK A;  1HPZ A;  4C8M A;  3U6F A;  3CCR N;  3R3L A;  5KGW A;  2JGU A;  3L0Q A;  3CJ9 A;  3PX4 A;  1J53 A;  4BRA A;  4FLV A;  3M8S A;  4CHY A;  1IH7 A;  5GIN A;  4KRE A;  5DM6 L;  4DTM A;  5I3U A;  3DOK A;  2ITM A;  4X65 K;  3CCS N;  1ZBL A;  3SV3 A;  3A8Y A;  3LDP A;  4OVL A;  5GAH P;  3J7Z O;  1WSI A;  2DTU A;  3Q7B A;  3H3N O;  4B9V A;  5JS1 A;  2A40 A;  3L2R A;  4BRL A;  2IAJ A;  3TAE A;  3G0Z A;  3LAK A;  1T6D A;  4CGJ A;  4I9Q A;  2ZE2 A;  1VK0 A;  4XH1 A;  4QS8 A;  5C24 A;  3V1O A;  4C8N A;  4IXC A;  3VEZ A;  4F3O A;  4FOI A;  3M8R A;  4FWS A;  2NRV A;  2O4I A;  3LDL A;  2NRW A;  2Y1J A;  3CD6 N;  2O8F A;  1S6Q A;  2V7Y A;  1N6Q A;  3WQT A;  1YHQ N;  4DKW A;  3JAM O;  1TL3 A;  3C7N A;  4FK4 A;  1T6C A;  4ID1 A;  4YDU A;  4RW7 A;  1RDC A;  1BIS A;  2OPR A;  4DR7 K;  2P9N A;  2YNI A;  4GNI A;  4Y1C A;  1RFQ A;  4DR6 K;  1N32 K;  1BWF O;  1UOC A;  4WF9 L;  5KRS A;  3ZSQ A;  1GLJ O;  1S72 N;  1HQU A;  4YOV A;  3O1B A;  3LZI A;  1MWM A;  4B3T K;  1YIJ N;  2QWQ A;  1NGH A;  4LFC K;  3IFR A;  4JHD B;  3K5O A;  4JK7 A;  1HYZ A;  4JD2 A;  4GV6 A;  3VQ9 A;  4B9Q A;  3TWH A;  1YF5 L;  5HP1 A;  4EP5 A;  4W5T A;  2KTQ A;  4DSE A;  3VQ4 A;  3ZT4 A;  2P9K A;  4O55 A;  5GIP A;  3AVH A;  4C1N I;  4CJU A;  1QQC A;  1KTQ A;  3F9M A;  3V9W A;  4DU4 A;  2I5J A;  5CR4 A;  2HHW A;  3SQ2 A;  3EKU A;  1S1X A;  2P1J A;  3HOS A;  3SQ0 A;  3KLH A;  2ASO A;  4FWR A;  3VQ8 A;  3T3F A;  2HNY A;  1KRP A;  1TV6 A;  3J81 O;  3VQQ A;  3HK2 A;  3TSP A;  3CFO A;  4CD3 A;  4A57 A;  3LL3 A;  5FLX O;  1L3T A;  1GOC A;  4JKG B;  2UXC K;  4CBX A;  2G8V A;  1RT7 A;  3M8Q A;  4CE9 A;  1SZ2 A;  1C0F A;  1A5X A;  3RMC A;  3HXM A;  2G8H A;  3C6A A;  1TKX A;  1YJW N;  1VSI A;  3CCU N;  1GLD G;  1TKD A;  5E84 A;  1R59 O;  1YXQ A;  3ULE A;  3L2U A;  4NLC A;  4BRN A;  4IO8 A;  1EO1 A;  1YTA A;  4BG9 A;  3P83 D;  1NG9 A;  1ZC6 A;  4JI8 K;  1RT5 A;  2A41 A;  1ILY A;  5TKW A;  3U4L A;  1Z05 A;  2VQF K;  3AVB A;  3IS9 A;  1EET A;  1X9W A;  4YOY A;  2ZGZ A;  3PO5 A;  1C1C A;  4F2S A;  1NK7 A;  3NHG A;  3M1F A;  1BCM A;  4B1W B;  1K73 O;  2H3G X;  2E2N A;  4HCB A;  1BGX T;  1QSY A;  4JI5 K;  3RSE B;  1HKG A;  3O3H A;  2E5L K;  2HHU A;  1CZB A;  3VGM A;  3HZ6 A;  4JYA K;  4DWI A;  2UXD K;  1RBR A;  3ATU A;  4JRQ A;  3NGZ A;  2VWB A;  2QW9 A;  1RDU A;  3THX B;  1WSE A;  3BGR A;  4B1Y B;  2RPI A;  3DLB A;  1SL1 A;  3E9L A;  1VAZ A;  3DLL L;  3O9U A;  1NNE A;  1XNQ K;  3HRG A;  1L3S A;  2OPQ A;  4BE1 A;  5ELZ A;  3UB5 A;  5I9E B;  3CJA A;  2YJE A;  4LF5 K;  2YX6 A;  2HND A;  2KLA A;  3J7Y P;  1QZ6 A;  3EEQ A;  3V9X A;  1D8Y A;  3SJH A;  4H5V A;  3EO3 A;  3C6U A;  3MN5 A;  5J1E A;  3LP2 A;  3U9Z A;  4A2B A;  4WCE L;  5HOO A;  4IJN A;  3JSM A;  4BDY A;  3VQ6 A;  3CCL N;  3ZSO A;  4H0X B;  2P9I B;  4AHR A;  2UXB K;  4DV5 K;  1HLU A;  5AQN A;  4JV5 K;  4CF0 A;  3HP6 A;  4DV4 K;  1LWC A;  2ZQB A;  3ZLJ A;  4AHC A;  3QEP A;  3G10 A;  4FSV A;  3ATV A;  4IOX A;  1KSP A;  4E7I A;  1I39 A;  3HPG A;  2HF4 A;  4KHP K;  4J2B A;  4I6M B;  4K42 A;  4JKF A;  3QBW A;  3AO4 A;  2P51 A;  3A2F A;  3OYG A;  4E7H A;  4W5R A;  4FK2 A;  4LY7 A;  4M3R A;  1KFS A;  1RBT A;  1ZBU A;  3OYD A;  1VQ5 N;  4CER A;  3OS0 A;  4NCB A;  2VG7 A;  1QE1 A;  2Q97 A;  2O8E B;  3H1Q A;  4X62 K;  4BRF A;  4LC9 B;  3CCQ N;  3FZF A;  3O08 A;  5J2P A;  3FZM A;  2HHS A;  5HBM A;  4JRP A;  1SUQ A;  4DR5 K;  3HM9 A;  4I2Q A;  4BGB A;  4CZM A;  5AJ3 K;  1S1V A;  2ZJR L;  3ID8 A;  4CFD A;  3KK2 A;  3ZET A;  1NK9 A;  3NF7 A;  3LP3 A;  3FZL A;  3OYI A;  4DV7 K;  2XRI A;  4JS5 A;  1WNS A;  3LDS A;  2FSN A;  5CYQ A;  3FR0 A;  4BR9 A;  3MEG A;  1C0U A;  3QLH A;  2NRR A;  3DOL A;  5TKY A;  5JVG L;  3MWT A;  4GV3 A;  1U6Z A;  4PA1 A;  4Z94 A;  2YHX A;  3F73 A;  4UQG A;  1KCF A;  3VER A;  4GW6 A;  1JL2 A;  4O5B A;  5AZJ A;  5EY4 A;  3FFI A;  4FZZ A;  2QA4 N;  3ENH A;  2BE2 A;  2I7P A;  4MLH A;  1I94 K;  1JCG A;  3SPY A;  5CE3 A;  1ITG A;  4ELU A;  5AQR A;  2A1S A;  3MED A;  2F8T A;  3CG7 A;  4CJW A;  2W6K A;  2PBD A;  3QB0 A;  3IG1 A;  4KPY A;  1QVG M;  4RW6 A;  1HJO A;  4CK1 A;  3S9H A;  3CME N;  1NMD A;  5LMU K;  3BUZ B;  2HB5 A;  4AF1 A;  1EQY A;  1JXE A;  5FPN A;  4JK9 A;  5F0X A;  3UKU B;  1QQN A;  1VQL N;  4WE1 A;  4AQY K;  3LM2 A;  3S3M A;  3ALY A;  2VCP A;  4K41 A;  4JI6 K;  4CW7 B;  1VSF A;  3AVA A;  5AQP A;  4M3W A;  2GBZ A;  3L4Q A;  2G8F A;  4KHW A;  3AA5 X;  2VG6 A;  4ID5 A;  3AA4 A;  4Z4C A;  2NRH A;  3DM2 A;  3F5T A;  4FLU A;  1B9F A;  2PFU A;  3HVR A;  3EE8 A;  4AHU A;  3WXI A;  2QXF A;  4O0I A;  5KQ8 A;  3HT3 A;  1XUP O;  1UA1 A;  4B1Z A;  3V1R A;  4CJP A;  4M3Z A;  2ASP A;  3DRR A;  1TYQ B;  2GX9 A;  4ZHR A;  4E1N A;  4CJQ A;  3NCI A;  4DTX A;  1RNH A;  2KHO A;  3SBG A;  3SBT A;  4DB3 A;  2PYJ A;  4O5F A;  4DV1 K;  4DSJ A;  1RDA A;  2A3Z A;  3OYE A;  2O8C B;  3OYC A;  2IIR A;  4KHS A;  4FVU A;  3TR8 A;  4H03 B;  4XEI A;  3N4P A;  3CJB A;  2BH1 A;  3H45 C;  1LW0 A;  4PUO A;  3C6H A;  1T03 A;  5EOY A;  1Q81 O;  4BWM A;  2XO7 A;  4CEF A;  4H4M A;  5C2F A;  1XMO K;  3VTI A;  2JWK A;  2NRX A;  4BRE A;  1OH6 A;  1S9G A;  3EKS A;  4FJK A;  3VN5 A;  3THV A;  1U2V B;  3MXM A;  1FXX A;  4LSN A;  5C10 A;  3ZT2 A;  1HRH A;  1S3X A;  3BDP A;  5AQJ A;  3AV9 A;  4OKE A;  1WSG A;  1WSJ A;  1Z26 A;  4FW1 A;  4JKC A;  1EP4 A;  1ZXO A;  4CEQ A;  1CXU A;  3MN9 A;  2P9U B;  3LAM A;  4BG8 A;  4EZ6 A;  3MX5 A;  4JKD A;  3QML A;  1MDU B;  3S3O A;  1CXQ A;  3OYA A;  4Z4H A;  4V19 S;  2DPN A;  2WTU A;  2FC0 A;  1IV0 A;  1TGO A;  1WLJ A;  4E7K A;  4CES A;  1RIL A;  3CJ1 A;  3FGU A;  4DR4 K;  4H5N A;  4OKK A;  1Z6R A;  1RTI A;  3CQ8 A;  3DLG A;  2F4V K;  3QIC A;  3MMV A;  2E4L A;  1IKW A;  3LP1 A;  1NGB A;  1K8A O;  3GL1 A;  1N33 K;  2D0C A;  3CCV N;  3CC7 N;  4HTL A;  3HST B;  3WEE A;  1NK8 A;  3AVM A;  4CF9 A;  1IBM K;  3OS1 A;  2HBK A;  5LMN K;  3OY9 A;  3C95 A;  1HX1 A;  5CHI A;  2IVO A;  5AFU H;  1IJJ A;  2J4R A;  4LF9 K;  5AFU A;  1KC8 O;  4PKH A;  4E7J A;  4X66 K;  5IWA K;  1ZYQ A;  1R0A A;  4PKG A;  2E1Z A;  4QS7 A;  4C23 A;  4KAZ A;  1KQS M;  1DGK N;  2AJQ A;  1MA9 B;  4BRK A;  2QTD A;  3BZC A;  3TTF A;  3QO9 A;  3MWP A;  3GBT A;  5DMR A;  3V9U A;  1U48 A;  4HHT A;  4CJV A;  4BY9 C;  2OZM A;  2QWR A;  3MDQ A;  3KHY A;  2DFF A;  3OYF A;  4IEE A;  2GWJ A;  3CJC A;  3SMS A;  1KLN A;  3D2E A;  1YTU A;  2X6S A;  4IJA A;  4FJL A;  1BI4 A;  3ID6 A;  4FOE A;  5LL6 Z;  1N36 K;  3F9K A;  2W6L A;  2AA4 A;  1NJX A;  1P8Z A;  4JAX A;  4CZK A;  4DU3 A;  4E19 A;  1RT3 A;  2WC9 A;  4M45 A;  3WXJ A;  4CJR A;  3CET A;  4B9T A;  1CZ9 A;  1TK0 A;  4LF7 K;  3KKR A;  4A5B A;  4CZG A;  4B9L A;  3NGY A;  5ADX H;  4FLT A;  5BRH A;  1X9M A;  4FVM A;  3KLG A;  3J8A A;  3S41 A;  3LPT A;  4RW4 A;  4AHS A;  1L5U A;  3SUO A;  2FF3 B;  3OBW A;  4J8F A;  2RHK A;  3VQD A;  3OA9 A;  2CH5 A;  1QSL A;  1M90 O;  3IAY A;  5AQI A;  1JCF A;  3CCM N;  2A5X A;  2F96 A;  5AQY A;  3GOI A;  3O4Q A;  3R6M A;  2HHH K;  5EVZ A;  1D4X A;  5BPN A;  4B3M K;  5KPR A;  4B8A B;  4DSI A;  4N76 A;  4JNE A;  4M42 A;  3MN6 A;  5HL7 L;  3CPW M;  4NCG A;  3KZB A;  3H46 O;  3MK6 A;  4CEZ A;  4FK0 A;  3VA0 A;  2E2Q A;  3V9Z A;  4A62 A;  4B3O A;  4EAH D;  1OVY A;  3DLE A;  1U47 A;  3AVI A;  1XC9 A;  3KK3 A;  1QVF M;  4BQL A;  3C7N B;  4DUZ K;  4U7B A;  5K14 A;  3FLC O;  3VF4 A;  4OLB A;  2E20 A;  1IKX A;  3M6G A;  2HBJ A;  2P9N B;  1N8R O;  1BO5 O;  4DFP A;  4CGH A;  2P9S A;  1C0G A;  1W0H A;  4RWT A;  4OPJ A;  4CHO A;  3F2K A;  1S9E A;  4FWN A;  1XQS C;  4DQP A;  4CHP A;  2Q0U A;  3DYA A;  1Q82 O;  2IS3 A;  4PQU A;  1KLM A;  1DKG D;  1LAW A;  4JD2 B;  4G1Q A;  3AVC A;  3KLI A;  4MQ3 A;  1KFD A;  4JLH A;  3ZSV A;  1VSD A;  1SV5 A;  4EFH A;  3K0S A;  2P9K B;  3MAQ A;  1TK8 A;  4DR1 K;  3TAR A;  1JXB A;  3WNH A;  3H3O B;  4EZ9 A;  2A1R A;  1NGA A;  2D0B A;  1HNW K;  3KWI A;  1BA0 A;  4BWJ A;  1T3V A;  3I55 N;  4N41 A;  1WSH A;  3W0L A;  4F8R A;  4DQQ A;  4FXD A;  5LJV A;  3L4I A;  5J2M A;  3CER A;  1OH7 A;  4BR7 A;  3LDQ A;  3QFU A;  2B6A A;  1BOT O;  3ZX3 A;  3SAH A;  1C0M A;  2D5R A;  3U3Y A;  4Z4E A;  1G99 A;  3T1Y K;  3P1G A;  4BGA A;  1JKH A;  3I33 A;  1Q9Y A;  1M1K O;  1VQ6 N;  5AQX A;  1OH8 A;  3KKS A;  4CZH A;  5M1Q A;  4DTU A;  2Z1G A;  1A5W A;  4N56 A;  1GLB G;  1J9A A;  3NF8 A;  4NXN K;  1RT6 A;  1VQP N;  4H0Y B;  3LAL A;  4IO9 L;  2NRT A;  3ULE B;  3PX6 A;  2RKI A;  2Z1H A;  4DV6 K;  4PY5 A;  1ATR A;  3MEC A;  4DTO A;  3LZJ A;  1RBS A;  2FF6 A;  4IZ9 A;  1BCO A;  3RMB A;  2FBT A;  3J7A P;  1BU6 O;  1W2B M;  3VGL A;  1XC3 A;  1S1U A;  3VES A;  1A5V A;  3HVT A;  3UKR A;  2E6M A;  3JXU A;  4DTN A;  1NU0 A;  1LV5 A;  3HL8 A;  2V7Z A;  4DLE A;  4JHD A;  3SUP A;  4CF8 A;  4CFA A;  1NJW A;  1FK9 A;  5JMV A;  3CI5 A;  3VEX A;  3VQA A;  4B9U A;  1X3N A;  2Q3S A;  3VMF B;  4DU1 A;  4QAG A;  4MO4 A;  4BDP A;  3KD1 E;  4KTQ A;  4Z0U A;  4BVP A;  4BC4 A;  4FM1 A;  3QIN A;  5AZI A;  4E7L A;  1NGG A;  2KFN A;  3AAQ A;  3HPH A;  3TSQ A;  4CF2 A;  3QEW A;  1W7A A;  3CIP A;  2O8D B;  2ZM6 K;  2G8U A;  3RVC A;  3P5J A;  2WOM A;  1IBL K;  4YOW A;  3T19 A;  1JLG A;  3A0I X;  3LDN A;  1UA0 A;  1HJR A;  3T1H K;  5E26 A;  4CHQ A;  4KHN A;  3CQY A;  1HYS A;  3V1Q A;  3HYF A;  5C2D A;  3THY A;  4C8L A;  4KFB A;  2Z1I A;  4DSF A;  3HO1 A;  3VTH A;  4DFJ A;  1B92 A;  3QBX A;  2RN2 A;  4YFU A;  1UAX A;  1D9F A;  5BR8 K;  4EHT A;  2EX3 A;  3CFR A;  4IFE A;  2YCH A;  5C25 A;  1GLC G;  1U04 A;  2QWP A;  4H0P A;  4MDB A;  1NGF A;  1RDD A;  3JS6 A;  2OPS A;  4M3T A;  4KTZ A;  3T7Z A;  4CJK A;  4DS4 A;  2CGK A;  3QEV A;  2P9L A;  5LJW A;  4CZI A;  1RDW X;  2FBV A;  2X78 A;  2G8I A;  2HMP A;  1NGD A;  2XY7 A;  1VHX A;  4QCL A;  5I42 A;  4LD0 A;  1FW6 A;  4Z4F A;  5JIC A;  4O8U A;  3KIO A;  3A5L C;  5J2Q A;  5BRF A;  1FJG K;  2BTF A;  1NOY A;  3ZSX A;  3OYL A;  4BRO A;  3ZT3 A;  2HST A;  1WUA A;  3ZSY A;  3K9K A;  4IKF A;  4ILG B;  1NGJ A;  3O9R A;  2YHY A;  4B1X B;  1VQO N;  1SS6 A;  2CH6 A;  3SPZ A;  3RSE A;  1IKV A;  1JLA A;  3HM8 A;  3ZET B;  1ZBI A;  4IDH A;  4E1J A;  3TTC A;  5AQF A;  3VEO A;  5KI6 A;  4HVJ A;  3QFP A;  3WT0 A;  1J54 A;  1JJ2 M;  2OA8 A;  4JKH A;  4AIL C;  3TI0 A;  2BAN A;  4FLY A;  3B6O A;  3D2F A;  4M3U A;  1TKZ A;  3ISN C;  2HW3 A;  2HVI A;  2W41 A;  5FPE A;  3V81 A;  2D1K A;  4CHZ A;  4FJ5 A;  2VWJ A;  4MFB A;  4IG3 A;  4IBN A;  3A5M C;  1CLQ A;  4FZX C;  4BDZ A;  4JK8 A;  4M7Y A;  5CY4 A;  4CEE A;  1ZBF A;  4DV2 K;  1T44 A;  3O5B A;  1Q18 A;  4FWQ A;  3RTV A;  1D9D A;  3O80 A;  3ZSR A;  4BR2 A;  4NXM K;  4CFB A;  1VSJ A;  4YOR A;  1U49 A;  4HWI A;  3O6W A;  3J80 O;  2VG5 A;  2OZS A;  3PIO L;  1HQE A;  3OYN A;  3SJJ A;  3AVK A;  4CJL A;  3G6E N;  4GVE A;  1NKB A;  2ITG A;  3IUC A;  4FM2 A;  3NH0 A;  2D4W A;  3KK7 A;  4I9L A;  3L8B A;  3AA3 A;  4NYN A;  1LCU A;  1W9H A;  1QTM A;  1GLL O;  3QDK A;  5BRD A;  2ASM A;  4CVN E;  3ZCM A;  4LFA K;  3HP9 A;  4BE2 A;  4CJS A;  1NKE A;  4ICL A;  3DLK A;  1IKY A;  5HRP A;  4DF4 A;  1J5O A;  2KW4 A;  5AQW A;  1IO2 A;  4BR4 A;  3S3N A;  2B5J A;  3DXK B;  5M1F A;  4WYB A;  3FE1 A;  4YOX A;  3E9O A;  3GDQ A;  3QER A;  4DQ8 A;  4LF8 K;  1NK6 A;  4DFK A;  1QQM A;  4BAC A;  4OJR A;  1K8K B;  4JI3 K;  4RG8 A;  3QEX A;  4NO7 A;  2BDP A;  4F4K A;  1HNZ K;  1WN7 A;  1HNI A;  4IOC L;  4Z4I A;  1WBD A;  4K8Z A;  2CGL A;  2YKN A;  5C42 A;  4BC2 A;  4NB4 A;  3BP8 A;  3KTQ A;  1NGI A;  3R8E A;  4BRQ A;  1BQM A;  4RCH A;  1LWE A;  4YOT A;  4BVO A;  4JKB A;  5FPD A;  1Z25 A;  2UUB K;  5FPM A;  3LPU A;  3PO4 A;  2P9P B;  1D5A A;  3E9P A;  1E4F T;  3CJ7 A;  1J5E K;  2QWO A;  4L3Q A;  2QWN A;  4KTW A;  2HHX A;  4OPK A;  4CEO A;  4UY8 O;  3RMD A;  4FWP A;  2V51 B;  1HMV A;  4LSL A;  4B08 A;  1WBB A;  1NWK A;  4F9O A;  1XI1 A;  4AHV A;  3K5N A;  5FDL A;  5A2Q O;  1HUX A;  4A59 A;  4FWO A;  3CFP A;  2YV0 X;  4E0D A;  1TK5 A;  3NE6 A;  3ZX2 A;  3VF2 A;  4DF8 A;  3ZEU A;  3MXI A;  4PWD A;  4FJG A;  4DSL A;  3NVM A;  3FFK B;  4NLB A;  1RGI A;  1VSH A;  3NF9 A;  2PYL A;  2YHA A;  2EHG A;  3PLA A;  1JLF A;  3OYM A;  2NRZ A;  4BRH A;  4BRD A;  1SAZ A;  1KAY A;  3CPE A;  3AA2 A;  5EU7 A;  3OYH A;  1IG9 A;  2Z1J A;  3VEW A;  3I56 N;  3CXC M;  1TAU A;  4DQS A;  3B6P A;  5GAG P;  4CF1 A;  4JI2 K;  1T7P A;  2KZZ A;  3R1X A;  5AQL A;  2QXL A;  3AAR A;  3NDK A;  4HUF A;  3KLE A;  3QIP A;  4DTJ A;  1BG3 A;  2A6A A;  4CJ3 A;  2E2P A;  4K0K K;  3QES A;  5JS2 A;  4H5R A;  4FWK A;  3WEE B;  3TAQ A;  3O1W A;  1U45 A;  4DG1 A;  3NVK A;  3PX0 A;  4BRI A;  1TUY A;  3SK3 A;  4XIU A;  4DCH A;  3Q7C A;  3G4S N;  3AO2 A;  4FJ9 A;  1L3V A;  4YY3 K;  4B8C A;  5JLF A;  1GLA G;  3OJU A;  4PL7 A;  3VGK A;  4F2R A;  4AM7 A;  2O8B A;  5HLF A;  3M3Z A;  2XY6 A;  2O8C A;  3I0S A;  3OTO K;  2CGJ A;  1BIU A;  3UE5 A;  2FBX A;  3D45 A;  2OCE A;  1X9J A;  2Q2R A;  3KJV A;  3V4I A;  3RMA A;  4MLE A;  1XHZ A;  3K9J A;  2HNZ A;  1XWL A;  2UU9 K;  3SNN A;  4JI7 K;  4R5P A;  4ILJ A;  1VRU A;  3D0P A;  3MEE A;  4H5W A;  4HTU A;  4HUE A;  2WFB A;  2G8K A;  1JLB A;  4OO1 J;  3SZ2 A;  3AVF A;  4WQ5 A;  3I8B A;  2GUP A;  1BI4 B;  3LM9 A;  3T69 A;  3C65 A;  1YVN A;  1LW2 A;  1HPM A;  3VQ5 A;  1GOA A;  2F7T A;  2FLO A;  5KQD A;  2D0A A;  4B3S K;  3EL2 A;  4A2A A;  3CM6 A;  3ZSZ A;  1TKT A;  5C15 A;  1E3M A;  5AQG A;  4RW8 A;  2W40 A;  3SUQ A;  3ZX0 A;  3AO1 A;  4W5Q A;  1Q9X A;  4KKO A;  5SWM A;  1IG8 A;  1RT2 A;  2GUI A;  2IVN A;  3QNO A;  1NLV A;  3DXM B;  1QS4 A;  4C8O A;  3WXK A;  4DQI A;  4OLA A;  1GOB A;  3K2P A;  1NJI O;  4FJN A;  3KVG A;  3DWL A;  3IRX A;  3CCJ N;  3TSU A;  2W42 A;  3W3D A;  4FO0 A;  5EX5 A;  1YT3 A;  4IFV A;  3THW A;  4BRG A;  2A42 A;  2JLE A;  4FLW A;  1K6Y A;  3SQ1 A;  4IG0 A;  1YJ9 N;  4KI4 A;  3AO3 A;  4FJM A;  2NNW A;  4R79 A;  2FXU A;  1NM1 A;  4M7X A;  3UIQ A;  4B9S A;  5ADX A;  3PY8 A;  1TAQ A;  2ZD1 A;  1NGC A;  2I7N A;  5CZ2 A;  2QK9 A;  3K58 A;  1HNV A;  4H0O A;  3EZ5 A;  5KRT A;  3TAB A;  3H08 A;  3GG4 A;  2IDO A;  1S1W A;  4FJX A;  2ZF5 O;  3VQB A;  5T7B A;  1W97 L;  3OYK A;  3K5L A;  4WFN L;  4FZY A;  2E8A A;  5AQV A;  3DLR A;  1NJZ A;  5GIO A;  4DS5 A;  2P9S B;  2OYQ A;  4FPA A;  1QHT A;  1LAV A;  2F9W A;  1U4B A;  4CZE A;  1NK0 A;  2V52 B;  3DI6 A;  4H8K A;  2O8F B;  2OAN A;  3DRP A;  1S6P A;  3I8D A;  1G15 A;  1ASW A;  3PV8 A;  4FYD A;  3EZW A;  2LSN A;  1VQ4 N;  1MU2 A;  4FJH A;  1RT1 A;  3O9S A;  3C0B A;  4K43 A;  1C0T A;  4LFB K;  3LAN A;  5GAE P;  1JL1 A;  4YNQ A;  2OTJ N;  4G9Z A;  2KQ2 A;  3L2V A;  4I2P A;  4CGF A;  3U3G A;  3HSC A;  2ZGY A;  3LDO A;  4BRP A;  3O3G A;  1BHL A;  3DRS A;  4PHT X;  3B8A X;  4FPB A;  3VEN A;  4WFB L;  4E89 A;  1V4S A;  4BR0 A;  1Q86 O;  3HPO A;  4A5A A;  1SKW A;  3SAG A;  4FCY A;  3SMP A;  3VEY A;  3HJF A;  1E4G T;  4LH5 A;  4RW9 A;  4WFA L;  2QWL A;  5JVH L;  3U9D A;  1RBV A;  4BRM A;  3DMJ A;  4DTP A;  3WXL A;  2Q0R A;  4H4O A;  3TAF A;  1ATS A;  2QM1 A;  4CK2 A;  1EWQ A;  1KVA A;  2ZWH A;  4O4G A;  4IFY A;  3SYZ A;  2ZJP L;  3HBT A;  3R9P A;  1WAF A;  4U67 L;  4FJI A;  3E01 A;  1RT4 A;  2WON A;  4CJ5 A;  3TTD A;  4CEC A;  5BPL A;  5KGX A;  4EIA A;  3NH2 A;  4DR2 K;  3VA3 A;  1VRT A;  3WQU A;  3E1Y A;  3UKR B;  4NYF A;  3SI6 A;  3GE1 A;  2VGN A;  1WSF A;  3OBY A;  2GTD A;  4BR5 A;  3AGR A;  2E6L A;  1NKC A;  4J2E A;  1I3A A;  4DFM A;  5DM7 L;  1QHA A;  4O8K A;  3CYM A;  2XY8 A;  2NLX A;  1VSL A;  3IDH A;  4EP4 A;  1BUP A;  4E1M A;  1KVC A;  4DLG A;  5AZI B;  4FL9 A;  4M3Y A;  4FWL A;  4JN4 A;  1HKB A;  2JWL A;  1LWF A;  4KB1 A;  2PZS A;  1Q8I A;  1RTJ A;  5AQH A;  3OJS A;  3NAE A;  4CIE A;  3AY9 A;  3VQC A;  3N4Q A;  3M8P A;  1BL3 A;  4DUY K;  3THY B;  2QKB A;  3VQP A;  4X64 K;  5E41 A;  3D7E O;  2X6N A;  3C6T A;  2VYP A;  1YUW A;  4CHN A;  5HRS A;  4CBW A;  4CBU A;  4CJE A;  4CFC A;  4DV0 K;  2P9L B;  1T8E A;  4CGI A;  2PAV A;  2DFE A;  2HHT A;  3MCP A;  4OKJ A;  3KLF A;  4JS4 A;  3DLH A;  2P5O A;  2ATQ A;  1RDB A;  1Y64 A;  2NUB A;  4ZTJ A;  4FLX A;  1NMN A;  2UUA K;  3QNN A;  4KRF A;  1BA1 A;  1OKJ A;  4E3S A;  3ENB A;  1VQK N;  5MLC Q;  5C0Y A;  4B1V A;  4FJ7 A;  2X74 A;  2UUC K;  3TAN A;  2FSJ A;  4JKG A;  4ISE A;  5CZ1 A;  3WNE A;  5EXW A;  3OW2 M;  1VQ8 N;  4OGC A;  5J2N A;  4FM0 A;  1REV A;  3HOT A;  5HRR A;  1HNX K;  5DK5 A;  1MWK A;  2YNF A;  3O8M A;  4H0T B;  4KH5 A;  1TVR A;  2KKZ A;  4JKE A;  5C12 A;  3QET A;  2PY5 A;  5HRO A;  4BQZ A;  4GKJ K;  3D6R A; 
#chains in the Genus database with same CATH homology
 4DUZ K;  5AJ3 K;  4DV3 K;  4LF9 K;  1XNR K;  4X66 K;  4JI0 K;  3JAM O;  5IWA K;  2UUB K;  2UU9 K;  4DV7 K;  4JI7 K;  4DV1 K;  4JI5 K;  2E5L K;  1J5E K;  4DR7 K;  4B3R K;  4JI1 K;  4GKK K;  4JYA K;  2UXD K;  4YHH K;  4DR6 K;  1N32 K;  2VQE K;  4LF6 K;  5A2Q O;  4B3T K;  4DV2 K;  1XMO K;  4LFC K;  2ZM6 K;  1N34 K;  1IBL K;  4LFB K;  4LF4 K;  4B3S K;  1XNQ K;  4DUY K;  3T1H K;  5LL6 Z;  1N36 K;  4NXM K;  4LF5 K;  4DR1 K;  1I94 K;  4X64 K;  4DR3 K;  3J80 O;  3J7Y P;  1HNW K;  1HR0 K;  4JI4 K;  5BR8 K;  4LF7 K;  2UXB K;  4DV5 K;  4JV5 K;  4DV0 K;  5LMU K;  4DV4 K;  5IT9 O;  4V19 S;  4JI2 K;  1IBK K;  4CVN E;  3J81 O;  4LFA K;  4DR4 K;  4AQY K;  4X65 K;  3T1Y K;  5FLX O;  4KHP K;  2F4V K;  2UUA K;  2UXC K;  4JI6 K;  4CW7 B;  4K0K K;  1XMQ K;  2HHH K;  2UUC K;  4NXN K;  4B3M K;  1N33 K;  1FJG K;  4OX9 K;  4LF8 K;  4DV6 K;  4JI3 K;  1HNX K;  1IBM K;  4YY3 K;  4X62 K;  5LMN K;  1HNZ K;  4DR2 K;  4JI8 K;  3J7A P;  2VQF K;  4DR5 K;  3OTO K;  4GKJ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...