4JI7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 31
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji7K00
4LFAK 5IWAK 2UUBK 4AQYK 4JI4K 4JI1K 4JI7K 1HR0K 4DV5K 4DV4K 4LF8K 1I94K 5A2QO 4V19S 3J7AP 4DV1K 4DV7K 2UXCK 4NXMK 2ZM6K 1IBLK 5AJ3K 1N33K 4DUZK 2E5LK 4X64K 3OTOK 4X65K 4DR5K 5LMNK 2UUAK 4DR1K 4DV3K 1N36K 2UUCK 4JI5K 4LF9K 4LFCK 4JI8K 2F4VK 4LF5K 4K0KK 4JI6K 4B3SK 2VQEK 2UXBK 4B3RK 1IBKK 4DV2K 4CVNE 3J80O 4OX9K 5LL6Z 4DR7K 4DV6K 1XNQK 4GKKK 1J5EK 5LMUK 4DR4K 4JYAK 4JI3K 2UU9K 4JI2K 4X62K 4KHPK 4LFBK 5FLXO 1N32K 4DV0K 4GKJK 4X66K 4LF4K 1HNZK 1XNRK 4DUYK 3JAMO 3J7YP 4NXNK 2UXDK 4YHHK 4B3MK 1N34K 4CW7B 4LF7K 5IT9O 4YY3K 4DR6K 5BR8K 4DR3K 1IBMK 2HHHK 4JV5K 1XMQK 4JI0K 3T1HK 3T1YK 3J81O 1HNXK 1XMOK 4B3TK 4LF6K 4DR2K 1HNWK 1FJGK 2VQFK
chains in the Genus database with same CATH superfamily
1HRHA 4DTMA 2D4WA 3O3HA 2CH6A 1TKDA 2XO7A 1BQMA 3PO4A 1HR0K 1NGFA 3IG1A 3CMEN 1V4TA 3H1VX 2P9LA 2NZTA 3RMCA 4BR4A 1NGGA 4AF1A 4N41A 2Q1NA 3GE1A 3JSMA 3H08A 2Z1IA 4K8XA 4IJNA 3RR8A 4OLBA 4QCLA 1VQMN 3UKUA 2R7YA 2P9IA 4ILHA 3K59A 2O8FA 4E7JA 2DFEA 3EKUA 2YKMA 4CEDA 3C0BA 3V9WA 2GBZA 1NJWA 1WSEA 4DB3A 4H03B 4I9QA 3WEEB 5DK5A 4KHNA 2IVPA 3MN7A 4KI4A 4IOXA 2O8BB 5JICA 2QXFA 1YVUA 2E2QA 5BPNA 4DTOA 4FSVA 4QOZB 3VGLA 1BL3A 3FR0A 1TYQA 4FLWA 4JK7A 2HNDA 5CY4A 4CBXA 4CHOA 1NJIO 4MDAA 2W40A 1W7AA 2OPRA 3T19A 3TWHA 1VK0A 3K57A 2A5XA 5AQUA 5FPMA 1QSYA 5BN8A 1HYZA 4PL8A 1GLBG 3CM5A 3UIQA 3QDKA 2KZMA 4MDBA 2JWKA 3D0PA 1O1WA 1C0MA 4A5BA 1VQPN 1JLAA 1C1AA 3RSEB 1QHTA 4FL9A 3ALYA 1VQ7N 3WUHA 4IZ9A 4DMNA 4A2AA 4B9NA 4FWOA 1YHQN 4DQPA 2RF2A 4FW2A 4CHPA 1WLJA 3M8RA 4IKFA 1NGEA 3VQPA 4BACA 4O8KA 1HX1A 1VQLN 1HKBA 2ZGZA 3I56N 3JXUA 4DSLA 1KD1O 2VG7A 2O8DA 3WQTA 3KLFA 3M6GA 2NUBA 3SAHA 2P9PA 3T1HK 2E8AA 1NKCA 4KH5A 4JRQA 4M3WA 4KV8A 3U4LA 3LDNA 4UY8O 2I7PA 1VQON 3O3FA 2ZF5O 3AVHA 4OKJA 4AQYK 1BI4B 2HMPA 3R6MA 1IO2A 1RTIA 2P9SA 1YVNA 4FWPA 1RFQA 1ZC6A 1QVGM 1CLQA 1HPMA 3ENHA 2HSTA 2QXLA 3DXMA 4CJRA 2HOEA 3O9QA 1SZ2A 4GV6A 1RTHA 3ZX3A 4BGAA 1WBDA 3RR7A 4LSNA 3AA3A 4CD1A 1IBLK 2WONA 3LDQA 2P9IB 3O4QA 4QAGA 4JKGB 1QZ5A 4IEEA 2X74A 1LW0A 2VWBA 3WNEA 1K8AO 2PYJA 2O8DB 2GEMA 2QI2A 1UA0A 1UOCA 4BWMA 2VQEK 3ULEB 1IBKK 3A0IX 4DV2K 2I7NA 2NRHA 3D45A 1TYQB 4RW8A 1BCOA 3LP1A 1WSGA 4JRPA 4IEIA 3DLKA 4FJXA 2CGJA 1NOZA 4O5FA 1QSSA 1JXBA 4EZ6A 4FCYA 4WF9L 4CF9A 3OA9A 2P9SB 3VF6A 3LP3A 4CGJA 2IIRA 3QIOA 4U7BA 1LCUA 1KC8O 3VGKA 3DXMB 3AVIA 1JLQA 3M8SA 3O1WA 4OPKA 1KRPA 1BWFO 1J5OA 3L4QA 4GKJK 2YHBA 4E89A 1S1XA 4WQ4C 4M3UA 2FBYA 3UB5A 1WBBA 4H4MA 2EWSA 2ETJA 4F2RA 3I55N 5FDLA 4O8UA 1ASVA 1N34K 5EX5A 1W9HA 2P1JA 3U9ZA 1NK4A 4KH6A 3MN5A 3ZETB 1EXQA 2E2PA 1U6ZA 1IKVA 3S3NA 4CFBA 3SPZA 5HRPA 4FK0A 3R8EA 3HJFA 3NVKA 2DPNA 3C6UA 3KJVA 2WBNA 3LP0A 5IWAK 4BRHA 4AH9A 4F4KA 2FBVA 1A5XA 3AO1A 2D1KA 3DLBA 5A2QO 1BUPA 1S5JA 2OYQA 2B4JA 3SBTA 3CHWA 1OVQA 5AQLA 3CCVN 5FPEA 1D8YA 3OBWA 3VQ9A 1EX4A 4WFNL 4CK1A 4NCGA 4DG1A 3OYIA 2F8SA 3G71N 1IJJA 3CIPA 3NHGA 4DSIA 2UUCK 4FZXC 2V7ZA 1VSDA 5EOYA 2A1SA 5C12A 3AVCA 1FK9A 1RT5A 3U8XA 4EAHD 4FJ9A 1S1WA 4Z4GA 1W0HA 3VERA 3RVCA 3QFPA 4BRAA 5KI6A 4CFAA 1EETA 1U47A 3LM9A 4EHTA 1DGKN 3NF7A 4BROA 4HUFA 3SPYA 4LSLA 5AQWA 2QWMA 1RT3A 5AQNA 3HOTA 3SQ4A 3MWPA 3HSCA 4DKWA 1NOYA 4XH5A 2GTDA 1SQKA 3THXA 2GUPA 3LDSA 4RW7A 3KKSA 4QS7A 3VEVA 2YJEA 5F2RA 2WC9A 1Q86O 4C8NA 4O5BA 1RT6A 3NFAA 4GMJB 4I9LA 3H3OB 2D0AA 4ELVA 4B3MK 4WQ5A 1HNVA 3ZSYA 2KHOA 3J8AA 2DTUA 3NGIA 2OPPA 1A5VA 4W5NA 2IS3A 1RDAA 4MO4A 3VPZA 1HUXA 2Q36A 4DTRA 4FWLA 3SMPA 3WEEA 3TARA 3AARA 4DSJA 3HTVA 4G1QA 3PX4A 3ZT1A 3L2WA 2HHWA 3L6QA 4CZLA 2YI1A 1HYVA 3A5MC 5GAGP 5C0YA 3VEXA 3P5JA 1J53A 4R79A 1HKGA 5F1XA 4BRGA 4FJIA 4JD2B 4H0YB 1I94K 2HNZA 2IAJA 4DQRA 4BC5A 2B6AA 1RBTA 2KLAA 3HZ6A 4BQLA 2E20A 4BWJA 1UWBA 3NH0A 3R1XA 3VEWA 4EHUA 4RWTA 1RDCA 1OH6A 3VENA 4DTJA 3DAWA 4DS5A 3QEVA 2W6KA 4X65K 4M3TA 1DKGD 2EHGA 4B3OA 2ZGYA 1BA1A 1EO1A 4BE1A 3FZLA 2E6LA 3CFRA 3FZKA 1BISA 1NK5A 5JLHA 1RT7A 1B9FA 1C1CA 2IVNA 3CJAA 4N5SA 2NRXA 4A62A 2OPSA 3KHYA 4ISFA 1SKSA 4DWIA 1LAWA 3HL8A 3OYMA 1L3SA 4FM0A 3K5OA 1RBRA 4JEPA 2HF3A 3PY8A 1CXUA 5JMVA 2G8IA 1T05A 4I7FA 4CJEA 3ZEUA 2QWLA 3KK7A 3LAMA 3VEOA 4FO0A 2Z1GA 4FJ8A 1Z26A 2ASMA 3KVGA 3OYDA 1TVRA 3AVGA 5FPNA 3CC2N 3HM8A 5M1FA 1C0TA 1KAZA 1G99A 1VHXA 4M7YA 4YOVA 1K9MO 3PUFA 5FRMA 5SWMA 3QETA 4B1VA 2CGKA 5AQFA 3TAEA 1I3AA 4BRIA 4RW6A 4C8MA 3CPWM 1Q82O 3AO5A 3AVAA 4DLGA 3QFUA 2FC0A 2IDOA 4Y0WA 1X9JA 2OTJN 2A42A 5EXWA 4QS8A 4DTUA 3VF2A 3CXCM 1JLGA 1XHXA 3UKUB 2ITGA 2FF3B 1BO5O 4QS9A 3SNNA 1LWFA 4V19S 3QEXA 4CZMA 3U9DA 3JS6A 3DMJA 1QQCA 4KTQA 1ASWA 3CQ8A 2Z1HA 3HPOA 2OANA 1NG9A 4HHTA 1EKEA 4ISEA 1C1BA 4IFVA 1LWEA 3AO2A 4JI5K 4LH4A 1JLEA 4AHTA 4JI8K 4IFYA 3A5NC 2P51A 3K5LA 1KQSM 3ITHA 3O5BA 2F8TA 3RRHA 2RE2A 3A5OC 3T69A 1WSFA 3P31A 4BG9A 1SL1A 3CFOA 3MWTA 4FJLA 1BDGA 2BTFA 5AQZA 3OHRA 1BIZA 5H1SQ 2QWNA 4ISGA 3ZEUB 3C94A 3TAMA 4BC3A 3WXKA 3TANA 1JCFA 3MXIA 1GLAG 4H5RA 4BR2A 3CC7N 4KPYA 1HNZK 3JAMO 3SUOA 4FJ5A 1VRTA 5ELZA 3RMDA 1NM1A 4HWIA 2HHXA 3LAKA 2PAVA 4CW7B 3OJSA 2VCPA 5I42A 3C6TA 3DJCA 5M1OA 3I0RA 3KLIA 3EY1A 2D0CA 4FWNA 4BDYA 3TR8A 4E1NA 4IXCA 5HROA 3K9KA 3BDPA 3O08A 3DLLL 1KSPA 5CHIA 4LF6K 4DR2K 1YJNN 1VSLA 1QSLA 1FJGK 4BG8A 4NYNA 1T03A 4DFKA 4JS5A 3OS2A 3QMLA 3D2EB 4FWRA 5E41A 4CE9A 5C2DA 3O9TA 4FM2A 1JLBA 1WUAA 4WFAL 4IJAA 2OZMA 3BF1A 4IDHA 2Q2RA 3LPTA 3HSTB 4DTNA 1NMNA 4JKGA 2ZWHA 1WNSA 2KTQA 1V4SA 2Z1JA 3O80A 2F9TA 3JYTA 3CF5L 4CEZA 3QBWA 4FPAA 4ELTA 4CJ3A 4DR5K 4Y1DA 1F21A 5GIPA 5DM7L 4FLXA 4YDUA 4E7LA 3AV9A 4DTXA 2F9WA 1SL0A 1SKWA 1VSFA 4WQ5C 2HVIA 3VN5A 3RMBA 4WQ4A 4H0PA 4FJGA 3VOVA 5GAHP 3ATUA 1C0UA 3LDPA 3O6WA 4NLCA 3QINA 3KIOA 3J80O 3BUZB 4B1UB 3CCJN 1CZ9A 3C6HA 3QESA 4BRDA 3D2EA 3O9RA 1X9SA 5KRSA 4FJHA 1NKEA 3V4IA 1D5AA 4PY5A 1RCHA 3MCPA 4JKAA 3THVA 4CJLA 3V9SA 5HRNA 2XY6A 4XEIA 1KFSA 4H5WA 4CZKA 4CJVA 2WUSA 3ENOA 5CYMA 4BR7A 4H5NA 4K41A 1VRUA 4FWMA 3DLEA 5GADP 5GAEP 1JL2A 4I2QA 2KFZA 5BRDA 3EZWA 3ZSZA 5KPZA 3F9MA 3T1YK 1TAQA 4B9SA 2GUIA 5AQJA 1L3VA 3FE1A 4F3TA 4WE1A 3MAQA 1L3TA 3DI6A 3W3DA 1RTDA 3PSIA 4Q0BA 4B1YB 1VSMA 1U2VA 3FZHA 2P5GA 1TKTA 2HF4A 2PFUA 3CC4N 4KHWA 4J2BA 1RT2A 4JKFA 1YT3A 2IC3A 1BQNA 2X78A 5AQYA 4FVUA 5M1PA 4ELUA 3VEYA 4CGIA 2E5LK 4DU3A 3O8MA 1IG9A 5HBMA 2ATQA 1OH8A 5C15A 4JNEA 3K58A 1U48A 2G8UA 3NGZA 2KW4A 2P9PB 2Q0UA 1XHZA 4B9QA 4DS4A 3CCMN 1SL2A 3O1BA 3TAQA 1OH5A 3H46O 3HT3A 3VF4A 4CHNA 2XY7A 4JKBA 3N4QA 4K25A 2JLEA 2D0BA 5FPDA 4HTUA 3QNOA 2O8CA 4YOXA 3SAFA 3EE8A 1XNQK 4JHDB 1FXXA 2JWLA 1J5EK 3CYMA 4JYAK 4BRQA 2G8VA 3SK3A 2PZSA 4ZHRA 1K8KB 1J9AA 4PUOA 3O9SA 4X62K 4KHPK 3E9LA 1WAFA 2VG6A 3VTIA 4LFBK 3AVNA 5JS2A 2YHWA 4JKCA 4CBUA 4YFUA 4O0JA 3HP6A 5GIOA 4OPHA 3MDQA 5BPMA 4BRPA 4AILC 3DYAA 3ULDA 5J2QA 4CGDA 4H0XB 3DLGA 2NLXA 1QVFM 2O4GA 1KFDA 2D5RA 4CGFA 1BHLA 1NLVA 5C42A 4CJWA 5M1KA 4DF4A 3ZT0A 5JVHL 1H1VA 4CIEA 1X3NA 5D3GA 3FFIA 5J2NA 1HQEA 5HOOA 1B92A 1VQKN 1BU6O 5KRTA 1IKXA 4I2PA 3P4IA 4Z4FA 1WOQA 1P8ZA 1HLUA 3V1RA 1S9GA 4JI7K 3DRPA 2YCHA 4DV4K 1GLLO 3KTQA 3QBXA 4H0VB 3PIOL 3O4WA 5AQSA 3NE6A 4ILGB 4CZFA 3NH2A 4DV1K 2FBTA 4E1MA 3ZSQA 2UXCK 3QEWA 3D2FB 4K42A 5AJ3K 5HLFA 3V9UA 1GLFO 1YTAA 4FJKA 4OPAA 1QTMA 4X64K 5FRNA 3ZSWA 4LC9B 3I8BA 1JJ2M 1S6QA 5BR9A 2V52B 3OS0A 5KTQA 4JKDA 4ICLA 3GOIA 2PBDA 4NCAA 3BF3A 3E9PA 3MECA 1DTQA 4PA1A 1OH7A 3PO5A 3KK1A 4N76A 4MLEA 5CR4A 3MCAB 5HL7L 3TTDA 4GVEA 3NVMA 1YI2N 2QKKA 4DQSA 1JXEA 2O8CB 3TSQA 4GKKK 1VQ6N 4CEQA 3DOLA 5AQRA 3LWMA 1EWRA 3DRRA 3PIPL 2ASOA 4RTFD 4B1WB 3AA2A 3S9HA 3CCEN 3LL3A 5MLCQ 5FLXO 1N32K 3D2FA 3K5NA 3ZSRA 1RGIA 4WCEL 1U49A 4DLEA 1TGOA 2GWKA 3KWIA 1T7PA 1HMVA 4CECA 4PL7A 3J7YP 2UXDK 4GY2B 5AZIA 2FBXA 4LF7K 2E2OA 4R5PA 5BR8K 3K0SA 4PQUA 2Y1JA 1TKZA 1X9MA 4MFBA 3TPQA 3CCRN 5CZ2A 4CERA 3CCQN 1W97L 4CFCA 4LH5A 3TSUA 3G25A 3SQ1A 3TABA 5BRHA 1XMOK 2HHTA 1DEJA 5LJVA 2NRTA 3MXJA 1KCFA 4BRNA 1YJWN 2UUBK 1QQOA 2QWOA 1VSHA 2WFBA 3VQQA 4CZHA 4PKHA 1QS4A 1S22A 4CBWA 4JKHA 3QEPA 1Q81O 5DMRA 3LDLA 4AM6A 3UKRA 1DLOA 3CD6N 4K8ZA 4G9ZA 4FYDA 3GDQA 4OO1J 1OVYA 3EEQA 4BRCA 4HUEA 3OBYA 3SUPA 3V9XA 4BC2A 4NXMK 2RHKA 1W2BM 3L2VA 4FZYA 1VQ4N 4PKGA 1NGJA 1NJYA 3WXJA 4AHCA 4DR1K 4BGBA 3SJJA 2FSJA 3P1GA 4Z94A 5AQGA 3CCLN 4CZEA 1TAUA 3TTCA 4NCBA 3V81A 3THWB 3WXMB 3ZT4A 4DTSA 2AJQA 4DTPA 2AA4A 3IS9A 4E7HA 4CF2A 3ZSOA 3SQ2A 4KFBA 4JD2A 3HXMA 3RMAA 5LL6Z 3NDKA 2PYLA 4J8FA 1CZAN 3CERA 2P9LB 3TSPA 2XY5A 4ID5A 4EZ9A 4KHUA 3VQ8A 3BY5A 3IUCA 3TAGA 4JI2K 1P90A 4FJJA 1X3MA 3AAQA 3TI0A 4KB1A 3IRXA 5C25A 2KQ2A 3L3VA 4LD0A 4DQIA 4W5OA 4LF4K 1QZ6A 3L3UA 4B1ZA 1U04A 3HI0A 1XWLA 5AQKA 3KK2A 4BVPA 1UAXA 1NU0A 4BREA 4YY3K 2PY5A 1FKOA 1REVA 4B9VA 1XMQK 3AVMA 4F3OA 4W5TA 3CJ7A 4HVJA 3H6EA 1NGBA 4JAXA 4WYBA 2HMIA 3LWLA 1BA0A 3HOSA 4CJTA 1Q9YA 5J1EA 2HHUA 5K14A 1WSIA 3K9JA 4ILJA 3VETA 4BVOA 1VQ5N 4B9UA 4RW9A 5ADXA 5BPLA 2X6NA 5E26A 3NGYA 4CI6A 3P83D 5LJWA 5KPTA 4M42A 4OLAA 3HK2A 2ZM6K 4DHYA 3L8BA 1CXQA 5BREA 1N33K 2YHYA 3V6DA 4FWSA 4O44A 1HJOA 2GELA 1KVAA 5ADXH 5LMNK 3F9KA 3FFKB 4BR5A 4O4GA 4WFBL 2NRWA 2W41A 1ZBLA 4LFCK 3C6AA 3DLHA 4A5AA 3EZ5A 4CJ4A 3VA3A 1ZXOA 1CZBA 4JI6K 5T7BA 1TL3A 4GW6A 4FJ7A 2O8BA 1RDDA 3THWA 4CGGA 3P39A 3MX5A 1FKPA 3M8PA 3KD5E 1EP4A 4M7XA 1IH7A 1RILA 2RPIA 3KKRA 4H5VA 3IAYA 4FVMA 4NLBA 4BE2A 4EIAA 3AVFA 2HHQA 3J7ZO 2KZZA 4Q5VA 4JS4A 2QM1A 4F9OA 5FROA 3P38A 3EL2A 4JK8A 4YOUA 3NH1A 3E1YA 3OYNA 4DCHA 5KPRA 1BG3A 3BP8A 2NRZA 1K73O 4TSXA 1B9DA 2BGGA 3RSEA 2IOCA 2OZSA 5KGXA 2P9KB 3EN9A 2YNFA 4DF8A 1SV5A 4BR9A 3HO1A 5HRRA 3ZYYX 4GNIA 4BQZA 1TK5A 2G8KA 3SBGA 3KWGA 4KO0A 5CE3A 1JLFA 4BRKA 4BDPA 3GG4A 2E4LA 4JLHA 1KLNA 1RTJA 3L2UA 1ATSA 3AY9A 4CESA 2OCEA 5KQ8A 2VYPA 1VSKA 4FOEA 4AM7A 3WT0A 2YNGA 1U2VB 3HP9A 4B3TK 4H0OA 3HVTA 3HVRA 4LFAK 4FWKA 4KBOA 4RCHA 3AGKA 4IG0A 2Q31A 4FLYA 3H45C 1R59O 1K6YA 4ZTJA 2Q3SA 5AQMA 3CQYA 4FM1A 3MK6A 5AQVA 4L3QA 4FLTA 3J7AP 4B8AB 4DU4A 1E4FT 3CI5A 1RT1A 4OGEA 3AO4A 3VGMA 1J6ZA 5EU7A 4CEAA 4FWQA 3K2PA 4J2EA 4DV3K 4IWVA 1HPZA 1VQNN 2XHBA 3MEDA 4RG8A 2YKNA 1SS6A 2F4VK 2ASPA 1RT4A 4UQGA 1TKXA 1KVBA 2HBLA 3K5MA 2HHVA 4BRFA 3QLHA 3WXIA 2J4RA 1HYSA 1IG8A 4OX9K 1NK9A 4CK2A 3M5RA 4O0IA 1YXQA 5AQHA 4FLVA 2BDPA 2H3GX 3U6FA 4JK9A 2QKBA 4JI3K 3NMUA 3C95A 4KI6A 2A41A 1WN7A 3IDHA 1HQUA 3DM2A 3OY9A 3RTVA 3QERA 4IOAL 3OYBA 3SUQA 2KFNA 2KKZA 4J2AA 1RBVA 1JCEA 1K8KA 4MQ3A 3SZ2A 1LV5A 3RWUA 3O9UA 3L4IA 5C10A 2D0PA 4YHHK 3FLCO 1ATNA 1Z6RA 3MN9A 2O8FB 4MLHA 1IBMK 4CZJA 1ATRA 1ZBIA 4BC4A 1S1VA 4GV9A 4M3YA 2RN2A 1ZBHA 4E19A 3CG7A 2F96A 2VWJA 1N8RO 2P9UB 1HNWK 4CGHA 3HM9A 2NRVA 1U4BA 4JI4K 2QWPA 2YJFA 1T3VA 2HB5A 2QW9A 2E1ZA 3MX2A 1WAJA 4KH4A 3G0ZA 3CM6A 3N4PA 4YOTA 3ZCMA 4C8LA 1KVCA 2V51B 4CEFA 1T6CA 5C2FA 1L5UA 1VSIA 1SAZA 1XQSC 4ZTFA 2W6LA 3U3YA 2ZE2A 1NGIA 1ZBFA 3OS1A 1G15A 5M1NA 1WSJA 4K0KK 3ID6A 1EWQA 4B3SK 1J54A 3ZX2A 4DQQA 1RBUA 1YUWA 5CZ1A 3AAPA 3KZBA 1BIUA 3DRSA 3H1QA 1YIJN 2BANA 2VWKA 2X6SA 5HRSA 3ZX0A 5DM6L 3I8DA 2FSNA 3OYCA 3F73A 2A6AA 1QQNA 3L2RA 3CJCA 1SKRA 4BR0A 5AZIB 4YNQA 4IG3A 3IKMA 1S1TA 3SV4A 3SLCA 4KRFA 1L3UA 3RRGA 4XH1A 1IKYA 3CJ9A 4BRMA 1MWMA 1YTUA 4KAZA 1NGHA 1NGCA 3LM2A 4BY9C 2D0OA 1LAVA 3ZT3A 5IT9O 2I5JA 1XI1A 5JVGL 1HNIA 1D4XA 3ID8A 5AQXA 2E6MA 2GWJA 1HJRA 4KHQA 1GOAA 3F5TA 4AHVA 5J2PA 4RW4A 2QEXN 1ZBSA 3QIPA 3OVNA 4KHSA 4Y1CA 3GL1A 3ZSVA 5AFUH 3G6EN 3SI6A 1HNXK 4HCCA 2VG5A 4KTWA 3UKRB 3ZLJA 1IKWA 1S1UA 4AHRA 1QQMA 3A2FA 3MMVA 1R0AA 4J2DA 3SAGA 5LY3A 1QHAA 4JI1K 4CZGA 4DV5K 1XC3A 1RDBA 5EY4A 2DFFA 3OYFA 3I33A 1IV0A 2FSKA 3LALA 3WNHA 1KAXA 5JLFA 3UE5A 3S41A 4CF0A 3U3GA 4EP5A 2FLOA 2O8EB 3H3NO 3VEZA 4CF8A 4B08A 2HBMA 4KHYA 2VGNA 4CIFA 2O4IA 4CZIA 3OTOK 3M3ZA 4I6MB 3KK3A 5F0XA 3LZIA 2ZJQL 2QK9A 1D9FA 2CH5A 3QICA 1GLJO 3HBTA 2YNIA 3PSFA 5TKWA 3VQ5A 1TUYA 2LSNA 1NWKA 1Y64A 4A57A 4KKOA 4Z0UA 3V9ZA 3T7ZA 4OVLA 1HKCA 4B9TA 4CJPA 3WXLA 2VGMA 3OW2M 3Q7BA 1NMDA 3R3LA 4CJ7A 2V7YA 4CEBA 4DV6K 3EKSA 1FW6A 4DFPA 2YV0X 4FK4A 2ZQBA 1O13A 3Q7CA 3CETA 3TAPA 2G8HA 3AVKA 2E1YA 1BOTO 2BH1A 1S72N 3NAEA 5SZTA 4MO5A 3E01A 3TAFA 3C7NA 4C8KA 4H0TB 2A1RA 1T44A 1XNRK 3LZJA 5M1QA 2HHSA 1WB9A 2WTUA 3NBPA 4NXNK 3DWLA 4YDUC 1ZYQA 4CJQA 2ITMA 3FZMA 1WSHA 2BUPA 3DOKA 2WOMA 4U67L 1M1KO 4CEOA 3HPGA 4KREA 2XRIA 4FXDA 4N56A 3EE9A 2DFHA 2HHHK 4FPBA 1NK6A 3SMSA 1S6PA 3DXKA 3V1QA 4FJMA 3CJ1A 3J81O 4CFDA 1GLEG 5C24A 1Y97A 3MEEA 2Q97A 5TKYA 3OYLA 1MDUB 1JL1A 2F7TA 1E4GT 3CMAN 2ZJRL 1S3XA 4B9LA 4AHSA 1JCGA 3AGRA 3B6PA 1TL1A 4FLUA 4CJFA 1X9WA 5AFUA 2A40A 3M1FA 1DTTA 3AA4A 1U45A 4Z4EA 1T6DA 2UUAK 3T1AA 3SJHA 4E3SA 1I39A 2UYTA 1Q7YO 4GV3A 3VA0A 2IGIA 4LF5K 3PX6A 4JN4A 3FZFA 1TK0A 3DXKB 3ZSXA 3NF8A 2UXBK 3VTHA 1GLDG 4IBNA 4LY7A 3VQ4A 3AVBA 4DFJA 3VQAA 4FZZA 2JGUA 2HVHA 1ILYA 3F2KA 4BE0A 4DFMA 4DR7K 4Z4CA 4JHDA 4CIGA 4CK3A 1XC9A 1C0FA 5LMUK 1QE1A 3HPHA 4DR4K 3HYFA 5AQQA 3D6RA 3AA5X 2P9NA 2P9UA 2UU9K 3PV8A 1LW2A 3A8YA 2A3ZA 3VQCA 4BRLA 3PX0A 4W5RA 1YF5L 3EO3A 4XIUA 2QA4N 4NO7A 3QB0A 4X66K 1M90O 3MEGA 1YITN 1NK0A 4C1NK 4E7IA 1GOCA 3ZETA 4M3ZA 4CF1A 2W42A 4AHUA 3EYZA 3PLAA 1ZBUA 1SUQA 4PHTX 2AP1A 2E88A 2P9KA 2ZD1A 3TTFA 4Z4HA 3THYB 1TV6A 5KGWA 5I9EB 4DSKA 1TUUA 4CJSA 1S9EA 4KTZA 4PWDA 3OYKA 3LP2A 5AR0A 1E3MA 3WQUA 4B8CA 1D9DA 4YOYA 2OPQA 4OGCA 4M3XA 2FXUA 4CJUA 4EP4A 1NBWA 4H4OA 4LF8K 1KAYA 4IDKA 5CYQA 1KXPA 2RKIA 4F2SA 4FK2A 3OYEA 4E0DA 1RNHA 3IMXA 3SQ0A 2G8FA 3ASMA 4OKKA 1TK8A 1T8EA 2GV9A 2NRRA 3ENBA 4M63C 3AVLA 4HCBA 4E7KA 3THYA 4C8OA 1NK8A 1GLCG 3I0SA 3A5LC 4YORA 4CD3A 3G10A 1Z25A 5E84A 4L8RB 3D7EO 2XY8A 2E2NA 3WNFA 4B3RK 1EQYA 3WNGA 1BI4A 3W0LA 3OYGA 2YNHA 4IO9L 4CHZA 3LANA 4CVNE 3VQDA 2NNWA 1Q18A 1MWKA 2YHAA 3OYJA 2DY4A 1Q9XA 1MA9B 4OPJA 4C23A 4F8RA 1NKBA 2YX6A 3THXB 3QEIA 3VQEA 3T3FA 3OYHA 2OA8A 4EFHA 5BRFA 2Y1IA 2P9NB 3SYZA 1MU2A 1Q8IA 2G8WA 3C65A 3B8AX 4B1XB 2BE2A 4FJNA 4CJ5A 4KB0A 4DV0K 3L2QA 4OKEA 3BZKA 1YJ9N 3AVJA 3GBTA 4M45A 4N47A 3MN6A 4DUYK 4ID1A 4A2BA 1LOTB 2O8EA 1NJXA 3ULEA 2P5OA 3VQ6A 3S3OA 4DR6K 2Q0RA 3NF6A 1NNEA 1JLCA 1KTQA 4CHQA 3OYAA 4BDZA 3ZT2A 4JV5K 5I3UA 4CEEA 4I6MA 1VSJA 5EVZA 4M41A 3ATVA 4NB4A 3M8QA 1N5YA 3TU5A 3CPEA 3SCXA 3AO3A 1UA1A 3LPUA 5BN9A 2HBKA 3BEXA 4CHYA 2VQFK 4DSEA 1NGDA 2OTLN 1LWCA 3E66A 4B9MA 1XUPO 1RBSA 3B6OA 1C6VA 5HP1A 2CGLA 2HBJA 5AQPA 3CCSN 4C1NI 5AQTA 1BGXT 1KLMA 2ZJPL 2GX9A 5AZJA 3CFPA 4CCHA 1ITGA 5J2MA 4DV7K 3KLHA 5AQIA 3QO9A 3R9PA 3V1OA 1VAZA 1NGAA 1ASUA 4DUZK 4A59A 5KQDA 1N6QA 1VSEA 2QWQA 3DLRA 1VQ8N 4XH4A 3SV3A 1VQ9N 3BZCA 2QWRA 4CJKA 1N36K 2EX3A 4H8KA 4OJRA 3VQ7A 4Z4IA 3CCUN 3C7NB 4LF9K 4M3RA 5B8HA 3O4NA 3KLGA 2HW3A 3IFRA 4O55A 4IOCL 2B5JA 3CJBA 4NYFA 2HNYA 1NK7A 3L0QA 3NCIA 4IFEA 1RDUA 4FW1A 1JKHA 4FOIA 4A61A 3HRGA 3VQBA 3S3MA 1A5WA 3KD1E 4PKIA 1DT9A 4W5QA 3FGUA 1GOBA 5AQOA 5AZJB 4DSFA 2FF6A 3O3GA 3LDOA 3VMFB 1YAGA 1RDWX 3G4SN 3QNNA 4HTLA 3OJUA 3BGRA 2YHXA 3SUNA 1Z05A 3CQXA 4DR3K 4K43A 5GINA 4YOWA 1OKJA 1X1PA 2QTDA 1BCMA 3NF9A 4FLZA 4DQ8A 2IVOA 3VESA 4DU1A 4JI0K 4H5TA 3KLEA 3MXMA 4HUGA 3ISNC 1ESVA 5JS1A 4E1JA 1NJZA 4JKEA 4IO8A 4GVMA 1C0GA 3E9OA
chains in the Genus database with same CATH topology
4LFAK 5IWAK 2UUBK 4AQYK 4JI4K 4JI1K 4JI7K 1HR0K 4DV5K 4DV4K 4LF8K 1I94K 5A2QO 4V19S 3J7AP 4DV1K 4DV7K 2UXCK 4NXMK 2ZM6K 1IBLK 5AJ3K 1N33K 4DUZK 2E5LK 4X64K 3OTOK 4X65K 4DR5K 5LMNK 2UUAK 4DR1K 4DV3K 1N36K 2UUCK 4JI5K 4LF9K 4LFCK 4JI8K 2F4VK 4LF5K 4K0KK 4JI6K 4B3SK 2VQEK 2UXBK 4B3RK 1IBKK 4DV2K 4CVNE 3J80O 4OX9K 5LL6Z 4DR7K 4DV6K 1XNQK 4GKKK 1J5EK 5LMUK 4DR4K 4JYAK 4JI3K 2UU9K 4JI2K 4X62K 4KHPK 4LFBK 5FLXO 1N32K 4DV0K 4GKJK 4X66K 4LF4K 1HNZK 1XNRK 4DUYK 3JAMO 3J7YP 4NXNK 2UXDK 4YHHK 4B3MK 1N34K 4CW7B 4LF7K 5IT9O 4YY3K 4DR6K 5BR8K 4DR3K 1IBMK 2HHHK 4JV5K 1XMQK 4JI0K 3T1HK 3T1YK 3J81O 1HNXK 1XMOK 4B3TK 4LF6K 4DR2K 1HNWK 1FJGK 2VQFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA K;  5IWA K;  2UUB K;  4AQY K;  4JI4 K;  4JI1 K;  4JI7 K;  1HR0 K;  4DV5 K;  4DV4 K;  4LF8 K;  1I94 K;  5A2Q O;  4V19 S;  3J7A P;  4DV1 K;  4DV7 K;  2UXC K;  4NXM K;  2ZM6 K;  1IBL K;  5AJ3 K;  1N33 K;  4DUZ K;  2E5L K;  4X64 K;  3OTO K;  4X65 K;  4DR5 K;  5LMN K;  2UUA K;  4DR1 K;  4DV3 K;  1N36 K;  2UUC K;  4JI5 K;  4LF9 K;  4LFC K;  4JI8 K;  2F4V K;  4LF5 K;  4K0K K;  4JI6 K;  4B3S K;  2VQE K;  2UXB K;  4B3R K;  1IBK K;  4DV2 K;  4CVN E;  3J80 O;  4OX9 K;  5LL6 Z;  4DR7 K;  4DV6 K;  1XNQ K;  4GKK K;  1J5E K;  5LMU K;  4DR4 K;  4JYA K;  4JI3 K;  2UU9 K;  4JI2 K;  4X62 K;  4KHP K;  4LFB K;  5FLX O;  1N32 K;  4DV0 K;  4GKJ K;  4X66 K;  4LF4 K;  1HNZ K;  1XNR K;  4DUY K;  3JAM O;  3J7Y P;  4NXN K;  2UXD K;  4YHH K;  4B3M K;  1N34 K;  4CW7 B;  4LF7 K;  5IT9 O;  4YY3 K;  4DR6 K;  5BR8 K;  4DR3 K;  1IBM K;  2HHH K;  4JV5 K;  1XMQ K;  4JI0 K;  3T1H K;  3T1Y K;  3J81 O;  1HNX K;  1XMO K;  4B3T K;  4LF6 K;  4DR2 K;  1HNW K;  1FJG K;  2VQF K; 
#chains in the Genus database with same CATH topology
 1HRH A;  4DTM A;  2D4W A;  3O3H A;  2CH6 A;  1TKD A;  2XO7 A;  1BQM A;  3PO4 A;  1HR0 K;  1NGF A;  3IG1 A;  3CME N;  1V4T A;  3H1V X;  2P9L A;  2NZT A;  3RMC A;  4BR4 A;  1NGG A;  4AF1 A;  4N41 A;  2Q1N A;  3GE1 A;  3JSM A;  3H08 A;  2Z1I A;  4K8X A;  4IJN A;  3RR8 A;  4OLB A;  4QCL A;  1VQM N;  3UKU A;  2R7Y A;  2P9I A;  4ILH A;  3K59 A;  2O8F A;  4E7J A;  2DFE A;  3EKU A;  2YKM A;  4CED A;  3C0B A;  3V9W A;  2GBZ A;  1NJW A;  1WSE A;  4DB3 A;  4H03 B;  4I9Q A;  3WEE B;  5DK5 A;  4KHN A;  2IVP A;  3MN7 A;  4KI4 A;  4IOX A;  2O8B B;  5JIC A;  2QXF A;  1YVU A;  2E2Q A;  5BPN A;  4DTO A;  4FSV A;  4QOZ B;  3VGL A;  1BL3 A;  3FR0 A;  1TYQ A;  4FLW A;  4JK7 A;  2HND A;  5CY4 A;  4CBX A;  4CHO A;  1NJI O;  4MDA A;  2W40 A;  1W7A A;  2OPR A;  3T19 A;  3TWH A;  1VK0 A;  3K57 A;  2A5X A;  5AQU A;  5FPM A;  1QSY A;  5BN8 A;  1HYZ A;  4PL8 A;  1GLB G;  3CM5 A;  3UIQ A;  3QDK A;  2KZM A;  4MDB A;  2JWK A;  3D0P A;  1O1W A;  1C0M A;  4A5B A;  1VQP N;  1JLA A;  1C1A A;  3RSE B;  1QHT A;  4FL9 A;  3ALY A;  1VQ7 N;  3WUH A;  4IZ9 A;  4DMN A;  4A2A A;  4B9N A;  4FWO A;  1YHQ N;  4DQP A;  2RF2 A;  4FW2 A;  4CHP A;  1WLJ A;  3M8R A;  4IKF A;  1NGE A;  3VQP A;  4BAC A;  4O8K A;  1HX1 A;  1VQL N;  1HKB A;  2ZGZ A;  3I56 N;  3JXU A;  4DSL A;  1KD1 O;  2VG7 A;  2O8D A;  3WQT A;  3KLF A;  3M6G A;  2NUB A;  3SAH A;  2P9P A;  3T1H K;  2E8A A;  1NKC A;  4KH5 A;  4JRQ A;  4M3W A;  4KV8 A;  3U4L A;  3LDN A;  4UY8 O;  2I7P A;  1VQO N;  3O3F A;  2ZF5 O;  3AVH A;  4OKJ A;  4AQY K;  1BI4 B;  2HMP A;  3R6M A;  1IO2 A;  1RTI A;  2P9S A;  1YVN A;  4FWP A;  1RFQ A;  1ZC6 A;  1QVG M;  1CLQ A;  1HPM A;  3ENH A;  2HST A;  2QXL A;  3DXM A;  4CJR A;  2HOE A;  3O9Q A;  1SZ2 A;  4GV6 A;  1RTH A;  3ZX3 A;  4BGA A;  1WBD A;  3RR7 A;  4LSN A;  3AA3 A;  4CD1 A;  1IBL K;  2WON A;  3LDQ A;  2P9I B;  3O4Q A;  4QAG A;  4JKG B;  1QZ5 A;  4IEE A;  2X74 A;  1LW0 A;  2VWB A;  3WNE A;  1K8A O;  2PYJ A;  2O8D B;  2GEM A;  2QI2 A;  1UA0 A;  1UOC A;  4BWM A;  2VQE K;  3ULE B;  1IBK K;  3A0I X;  4DV2 K;  2I7N A;  2NRH A;  3D45 A;  1TYQ B;  4RW8 A;  1BCO A;  3LP1 A;  1WSG A;  4JRP A;  4IEI A;  3DLK A;  4FJX A;  2CGJ A;  1NOZ A;  4O5F A;  1QSS A;  1JXB A;  4EZ6 A;  4FCY A;  4WF9 L;  4CF9 A;  3OA9 A;  2P9S B;  3VF6 A;  3LP3 A;  4CGJ A;  2IIR A;  3QIO A;  4U7B A;  1LCU A;  1KC8 O;  3VGK A;  3DXM B;  3AVI A;  1JLQ A;  3M8S A;  3O1W A;  4OPK A;  1KRP A;  1BWF O;  1J5O A;  3L4Q A;  4GKJ K;  2YHB A;  4E89 A;  1S1X A;  4WQ4 C;  4M3U A;  2FBY A;  3UB5 A;  1WBB A;  4H4M A;  2EWS A;  2ETJ A;  4F2R A;  3I55 N;  5FDL A;  4O8U A;  1ASV A;  1N34 K;  5EX5 A;  1W9H A;  2P1J A;  3U9Z A;  1NK4 A;  4KH6 A;  3MN5 A;  3ZET B;  1EXQ A;  2E2P A;  1U6Z A;  1IKV A;  3S3N A;  4CFB A;  3SPZ A;  5HRP A;  4FK0 A;  3R8E A;  3HJF A;  3NVK A;  2DPN A;  3C6U A;  3KJV A;  2WBN A;  3LP0 A;  5IWA K;  4BRH A;  4AH9 A;  4F4K A;  2FBV A;  1A5X A;  3AO1 A;  2D1K A;  3DLB A;  5A2Q O;  1BUP A;  1S5J A;  2OYQ A;  2B4J A;  3SBT A;  3CHW A;  1OVQ A;  5AQL A;  3CCV N;  5FPE A;  1D8Y A;  3OBW A;  3VQ9 A;  1EX4 A;  4WFN L;  4CK1 A;  4NCG A;  4DG1 A;  3OYI A;  2F8S A;  3G71 N;  1IJJ A;  3CIP A;  3NHG A;  4DSI A;  2UUC K;  4FZX C;  2V7Z A;  1VSD A;  5EOY A;  2A1S A;  5C12 A;  3AVC A;  1FK9 A;  1RT5 A;  3U8X A;  4EAH D;  4FJ9 A;  1S1W A;  4Z4G A;  1W0H A;  3VER A;  3RVC A;  3QFP A;  4BRA A;  5KI6 A;  4CFA A;  1EET A;  1U47 A;  3LM9 A;  4EHT A;  1DGK N;  3NF7 A;  4BRO A;  4HUF A;  3SPY A;  4LSL A;  5AQW A;  2QWM A;  1RT3 A;  5AQN A;  3HOT A;  3SQ4 A;  3MWP A;  3HSC A;  4DKW A;  1NOY A;  4XH5 A;  2GTD A;  1SQK A;  3THX A;  2GUP A;  3LDS A;  4RW7 A;  3KKS A;  4QS7 A;  3VEV A;  2YJE A;  5F2R A;  2WC9 A;  1Q86 O;  4C8N A;  4O5B A;  1RT6 A;  3NFA A;  4GMJ B;  4I9L A;  3H3O B;  2D0A A;  4ELV A;  4B3M K;  4WQ5 A;  1HNV A;  3ZSY A;  2KHO A;  3J8A A;  2DTU A;  3NGI A;  2OPP A;  1A5V A;  4W5N A;  2IS3 A;  1RDA A;  4MO4 A;  3VPZ A;  1HUX A;  2Q36 A;  4DTR A;  4FWL A;  3SMP A;  3WEE A;  3TAR A;  3AAR A;  4DSJ A;  3HTV A;  4G1Q A;  3PX4 A;  3ZT1 A;  3L2W A;  2HHW A;  3L6Q A;  4CZL A;  2YI1 A;  1HYV A;  3A5M C;  5GAG P;  5C0Y A;  3VEX A;  3P5J A;  1J53 A;  4R79 A;  1HKG A;  5F1X A;  4BRG A;  4FJI A;  4JD2 B;  4H0Y B;  1I94 K;  2HNZ A;  2IAJ A;  4DQR A;  4BC5 A;  2B6A A;  1RBT A;  2KLA A;  3HZ6 A;  4BQL A;  2E20 A;  4BWJ A;  1UWB A;  3NH0 A;  3R1X A;  3VEW A;  4EHU A;  4RWT A;  1RDC A;  1OH6 A;  3VEN A;  4DTJ A;  3DAW A;  4DS5 A;  3QEV A;  2W6K A;  4X65 K;  4M3T A;  1DKG D;  2EHG A;  4B3O A;  2ZGY A;  1BA1 A;  1EO1 A;  4BE1 A;  3FZL A;  2E6L A;  3CFR A;  3FZK A;  1BIS A;  1NK5 A;  5JLH A;  1RT7 A;  1B9F A;  1C1C A;  2IVN A;  3CJA A;  4N5S A;  2NRX A;  4A62 A;  2OPS A;  3KHY A;  4ISF A;  1SKS A;  4DWI A;  1LAW A;  3HL8 A;  3OYM A;  1L3S A;  4FM0 A;  3K5O A;  1RBR A;  4JEP A;  2HF3 A;  3PY8 A;  1CXU A;  5JMV A;  2G8I A;  1T05 A;  4I7F A;  4CJE A;  3ZEU A;  2QWL A;  3KK7 A;  3LAM A;  3VEO A;  4FO0 A;  2Z1G A;  4FJ8 A;  1Z26 A;  2ASM A;  3KVG A;  3OYD A;  1TVR A;  3AVG A;  5FPN A;  3CC2 N;  3HM8 A;  5M1F A;  1C0T A;  1KAZ A;  1G99 A;  1VHX A;  4M7Y A;  4YOV A;  1K9M O;  3PUF A;  5FRM A;  5SWM A;  3QET A;  4B1V A;  2CGK A;  5AQF A;  3TAE A;  1I3A A;  4BRI A;  4RW6 A;  4C8M A;  3CPW M;  1Q82 O;  3AO5 A;  3AVA A;  4DLG A;  3QFU A;  2FC0 A;  2IDO A;  4Y0W A;  1X9J A;  2OTJ N;  2A42 A;  5EXW A;  4QS8 A;  4DTU A;  3VF2 A;  3CXC M;  1JLG A;  1XHX A;  3UKU B;  2ITG A;  2FF3 B;  1BO5 O;  4QS9 A;  3SNN A;  1LWF A;  4V19 S;  3QEX A;  4CZM A;  3U9D A;  3JS6 A;  3DMJ A;  1QQC A;  4KTQ A;  1ASW A;  3CQ8 A;  2Z1H A;  3HPO A;  2OAN A;  1NG9 A;  4HHT A;  1EKE A;  4ISE A;  1C1B A;  4IFV A;  1LWE A;  3AO2 A;  4JI5 K;  4LH4 A;  1JLE A;  4AHT A;  4JI8 K;  4IFY A;  3A5N C;  2P51 A;  3K5L A;  1KQS M;  3ITH A;  3O5B A;  2F8T A;  3RRH A;  2RE2 A;  3A5O C;  3T69 A;  1WSF A;  3P31 A;  4BG9 A;  1SL1 A;  3CFO A;  3MWT A;  4FJL A;  1BDG A;  2BTF A;  5AQZ A;  3OHR A;  1BIZ A;  5H1S Q;  2QWN A;  4ISG A;  3ZEU B;  3C94 A;  3TAM A;  4BC3 A;  3WXK A;  3TAN A;  1JCF A;  3MXI A;  1GLA G;  4H5R A;  4BR2 A;  3CC7 N;  4KPY A;  1HNZ K;  3JAM O;  3SUO A;  4FJ5 A;  1VRT A;  5ELZ A;  3RMD A;  1NM1 A;  4HWI A;  2HHX A;  3LAK A;  2PAV A;  4CW7 B;  3OJS A;  2VCP A;  5I42 A;  3C6T A;  3DJC A;  5M1O A;  3I0R A;  3KLI A;  3EY1 A;  2D0C A;  4FWN A;  4BDY A;  3TR8 A;  4E1N A;  4IXC A;  5HRO A;  3K9K A;  3BDP A;  3O08 A;  3DLL L;  1KSP A;  5CHI A;  4LF6 K;  4DR2 K;  1YJN N;  1VSL A;  1QSL A;  1FJG K;  4BG8 A;  4NYN A;  1T03 A;  4DFK A;  4JS5 A;  3OS2 A;  3QML A;  3D2E B;  4FWR A;  5E41 A;  4CE9 A;  5C2D A;  3O9T A;  4FM2 A;  1JLB A;  1WUA A;  4WFA L;  4IJA A;  2OZM A;  3BF1 A;  4IDH A;  2Q2R A;  3LPT A;  3HST B;  4DTN A;  1NMN A;  4JKG A;  2ZWH A;  1WNS A;  2KTQ A;  1V4S A;  2Z1J A;  3O80 A;  2F9T A;  3JYT A;  3CF5 L;  4CEZ A;  3QBW A;  4FPA A;  4ELT A;  4CJ3 A;  4DR5 K;  4Y1D A;  1F21 A;  5GIP A;  5DM7 L;  4FLX A;  4YDU A;  4E7L A;  3AV9 A;  4DTX A;  2F9W A;  1SL0 A;  1SKW A;  1VSF A;  4WQ5 C;  2HVI A;  3VN5 A;  3RMB A;  4WQ4 A;  4H0P A;  4FJG A;  3VOV A;  5GAH P;  3ATU A;  1C0U A;  3LDP A;  3O6W A;  4NLC A;  3QIN A;  3KIO A;  3J80 O;  3BUZ B;  4B1U B;  3CCJ N;  1CZ9 A;  3C6H A;  3QES A;  4BRD A;  3D2E A;  3O9R A;  1X9S A;  5KRS A;  4FJH A;  1NKE A;  3V4I A;  1D5A A;  4PY5 A;  1RCH A;  3MCP A;  4JKA A;  3THV A;  4CJL A;  3V9S A;  5HRN A;  2XY6 A;  4XEI A;  1KFS A;  4H5W A;  4CZK A;  4CJV A;  2WUS A;  3ENO A;  5CYM A;  4BR7 A;  4H5N A;  4K41 A;  1VRU A;  4FWM A;  3DLE A;  5GAD P;  5GAE P;  1JL2 A;  4I2Q A;  2KFZ A;  5BRD A;  3EZW A;  3ZSZ A;  5KPZ A;  3F9M A;  3T1Y K;  1TAQ A;  4B9S A;  2GUI A;  5AQJ A;  1L3V A;  3FE1 A;  4F3T A;  4WE1 A;  3MAQ A;  1L3T A;  3DI6 A;  3W3D A;  1RTD A;  3PSI A;  4Q0B A;  4B1Y B;  1VSM A;  1U2V A;  3FZH A;  2P5G A;  1TKT A;  2HF4 A;  2PFU A;  3CC4 N;  4KHW A;  4J2B A;  1RT2 A;  4JKF A;  1YT3 A;  2IC3 A;  1BQN A;  2X78 A;  5AQY A;  4FVU A;  5M1P A;  4ELU A;  3VEY A;  4CGI A;  2E5L K;  4DU3 A;  3O8M A;  1IG9 A;  5HBM A;  2ATQ A;  1OH8 A;  5C15 A;  4JNE A;  3K58 A;  1U48 A;  2G8U A;  3NGZ A;  2KW4 A;  2P9P B;  2Q0U A;  1XHZ A;  4B9Q A;  4DS4 A;  3CCM N;  1SL2 A;  3O1B A;  3TAQ A;  1OH5 A;  3H46 O;  3HT3 A;  3VF4 A;  4CHN A;  2XY7 A;  4JKB A;  3N4Q A;  4K25 A;  2JLE A;  2D0B A;  5FPD A;  4HTU A;  3QNO A;  2O8C A;  4YOX A;  3SAF A;  3EE8 A;  1XNQ K;  4JHD B;  1FXX A;  2JWL A;  1J5E K;  3CYM A;  4JYA K;  4BRQ A;  2G8V A;  3SK3 A;  2PZS A;  4ZHR A;  1K8K B;  1J9A A;  4PUO A;  3O9S A;  4X62 K;  4KHP K;  3E9L A;  1WAF A;  2VG6 A;  3VTI A;  4LFB K;  3AVN A;  5JS2 A;  2YHW A;  4JKC A;  4CBU A;  4YFU A;  4O0J A;  3HP6 A;  5GIO A;  4OPH A;  3MDQ A;  5BPM A;  4BRP A;  4AIL C;  3DYA A;  3ULD A;  5J2Q A;  4CGD A;  4H0X B;  3DLG A;  2NLX A;  1QVF M;  2O4G A;  1KFD A;  2D5R A;  4CGF A;  1BHL A;  1NLV A;  5C42 A;  4CJW A;  5M1K A;  4DF4 A;  3ZT0 A;  5JVH L;  1H1V A;  4CIE A;  1X3N A;  5D3G A;  3FFI A;  5J2N A;  1HQE A;  5HOO A;  1B92 A;  1VQK N;  1BU6 O;  5KRT A;  1IKX A;  4I2P A;  3P4I A;  4Z4F A;  1WOQ A;  1P8Z A;  1HLU A;  3V1R A;  1S9G A;  4JI7 K;  3DRP A;  2YCH A;  4DV4 K;  1GLL O;  3KTQ A;  3QBX A;  4H0V B;  3PIO L;  3O4W A;  5AQS A;  3NE6 A;  4ILG B;  4CZF A;  3NH2 A;  4DV1 K;  2FBT A;  4E1M A;  3ZSQ A;  2UXC K;  3QEW A;  3D2F B;  4K42 A;  5AJ3 K;  5HLF A;  3V9U A;  1GLF O;  1YTA A;  4FJK A;  4OPA A;  1QTM A;  4X64 K;  5FRN A;  3ZSW A;  4LC9 B;  3I8B A;  1JJ2 M;  1S6Q A;  5BR9 A;  2V52 B;  3OS0 A;  5KTQ A;  4JKD A;  4ICL A;  3GOI A;  2PBD A;  4NCA A;  3BF3 A;  3E9P A;  3MEC A;  1DTQ A;  4PA1 A;  1OH7 A;  3PO5 A;  3KK1 A;  4N76 A;  4MLE A;  5CR4 A;  3MCA B;  5HL7 L;  3TTD A;  4GVE A;  3NVM A;  1YI2 N;  2QKK A;  4DQS A;  1JXE A;  2O8C B;  3TSQ A;  4GKK K;  1VQ6 N;  4CEQ A;  3DOL A;  5AQR A;  3LWM A;  1EWR A;  3DRR A;  3PIP L;  2ASO A;  4RTF D;  4B1W B;  3AA2 A;  3S9H A;  3CCE N;  3LL3 A;  5MLC Q;  5FLX O;  1N32 K;  3D2F A;  3K5N A;  3ZSR A;  1RGI A;  4WCE L;  1U49 A;  4DLE A;  1TGO A;  2GWK A;  3KWI A;  1T7P A;  1HMV A;  4CEC A;  4PL7 A;  3J7Y P;  2UXD K;  4GY2 B;  5AZI A;  2FBX A;  4LF7 K;  2E2O A;  4R5P A;  5BR8 K;  3K0S A;  4PQU A;  2Y1J A;  1TKZ A;  1X9M A;  4MFB A;  3TPQ A;  3CCR N;  5CZ2 A;  4CER A;  3CCQ N;  1W97 L;  4CFC A;  4LH5 A;  3TSU A;  3G25 A;  3SQ1 A;  3TAB A;  5BRH A;  1XMO K;  2HHT A;  1DEJ A;  5LJV A;  2NRT A;  3MXJ A;  1KCF A;  4BRN A;  1YJW N;  2UUB K;  1QQO A;  2QWO A;  1VSH A;  2WFB A;  3VQQ A;  4CZH A;  4PKH A;  1QS4 A;  1S22 A;  4CBW A;  4JKH A;  3QEP A;  1Q81 O;  5DMR A;  3LDL A;  4AM6 A;  3UKR A;  1DLO A;  3CD6 N;  4K8Z A;  4G9Z A;  4FYD A;  3GDQ A;  4OO1 J;  1OVY A;  3EEQ A;  4BRC A;  4HUE A;  3OBY A;  3SUP A;  3V9X A;  4BC2 A;  4NXM K;  2RHK A;  1W2B M;  3L2V A;  4FZY A;  1VQ4 N;  4PKG A;  1NGJ A;  1NJY A;  3WXJ A;  4AHC A;  4DR1 K;  4BGB A;  3SJJ A;  2FSJ A;  3P1G A;  4Z94 A;  5AQG A;  3CCL N;  4CZE A;  1TAU A;  3TTC A;  4NCB A;  3V81 A;  3THW B;  3WXM B;  3ZT4 A;  4DTS A;  2AJQ A;  4DTP A;  2AA4 A;  3IS9 A;  4E7H A;  4CF2 A;  3ZSO A;  3SQ2 A;  4KFB A;  4JD2 A;  3HXM A;  3RMA A;  5LL6 Z;  3NDK A;  2PYL A;  4J8F A;  1CZA N;  3CER A;  2P9L B;  3TSP A;  2XY5 A;  4ID5 A;  4EZ9 A;  4KHU A;  3VQ8 A;  3BY5 A;  3IUC A;  3TAG A;  4JI2 K;  1P90 A;  4FJJ A;  1X3M A;  3AAQ A;  3TI0 A;  4KB1 A;  3IRX A;  5C25 A;  2KQ2 A;  3L3V A;  4LD0 A;  4DQI A;  4W5O A;  4LF4 K;  1QZ6 A;  3L3U A;  4B1Z A;  1U04 A;  3HI0 A;  1XWL A;  5AQK A;  3KK2 A;  4BVP A;  1UAX A;  1NU0 A;  4BRE A;  4YY3 K;  2PY5 A;  1FKO A;  1REV A;  4B9V A;  1XMQ K;  3AVM A;  4F3O A;  4W5T A;  3CJ7 A;  4HVJ A;  3H6E A;  1NGB A;  4JAX A;  4WYB A;  2HMI A;  3LWL A;  1BA0 A;  3HOS A;  4CJT A;  1Q9Y A;  5J1E A;  2HHU A;  5K14 A;  1WSI A;  3K9J A;  4ILJ A;  3VET A;  4BVO A;  1VQ5 N;  4B9U A;  4RW9 A;  5ADX A;  5BPL A;  2X6N A;  5E26 A;  3NGY A;  4CI6 A;  3P83 D;  5LJW A;  5KPT A;  4M42 A;  4OLA A;  3HK2 A;  2ZM6 K;  4DHY A;  3L8B A;  1CXQ A;  5BRE A;  1N33 K;  2YHY A;  3V6D A;  4FWS A;  4O44 A;  1HJO A;  2GEL A;  1KVA A;  5ADX H;  5LMN K;  3F9K A;  3FFK B;  4BR5 A;  4O4G A;  4WFB L;  2NRW A;  2W41 A;  1ZBL A;  4LFC K;  3C6A A;  3DLH A;  4A5A A;  3EZ5 A;  4CJ4 A;  3VA3 A;  1ZXO A;  1CZB A;  4JI6 K;  5T7B A;  1TL3 A;  4GW6 A;  4FJ7 A;  2O8B A;  1RDD A;  3THW A;  4CGG A;  3P39 A;  3MX5 A;  1FKP A;  3M8P A;  3KD5 E;  1EP4 A;  4M7X A;  1IH7 A;  1RIL A;  2RPI A;  3KKR A;  4H5V A;  3IAY A;  4FVM A;  4NLB A;  4BE2 A;  4EIA A;  3AVF A;  2HHQ A;  3J7Z O;  2KZZ A;  4Q5V A;  4JS4 A;  2QM1 A;  4F9O A;  5FRO A;  3P38 A;  3EL2 A;  4JK8 A;  4YOU A;  3NH1 A;  3E1Y A;  3OYN A;  4DCH A;  5KPR A;  1BG3 A;  3BP8 A;  2NRZ A;  1K73 O;  4TSX A;  1B9D A;  2BGG A;  3RSE A;  2IOC A;  2OZS A;  5KGX A;  2P9K B;  3EN9 A;  2YNF A;  4DF8 A;  1SV5 A;  4BR9 A;  3HO1 A;  5HRR A;  3ZYY X;  4GNI A;  4BQZ A;  1TK5 A;  2G8K A;  3SBG A;  3KWG A;  4KO0 A;  5CE3 A;  1JLF A;  4BRK A;  4BDP A;  3GG4 A;  2E4L A;  4JLH A;  1KLN A;  1RTJ A;  3L2U A;  1ATS A;  3AY9 A;  4CES A;  2OCE A;  5KQ8 A;  2VYP A;  1VSK A;  4FOE A;  4AM7 A;  3WT0 A;  2YNG A;  1U2V B;  3HP9 A;  4B3T K;  4H0O A;  3HVT A;  3HVR A;  4LFA K;  4FWK A;  4KBO A;  4RCH A;  3AGK A;  4IG0 A;  2Q31 A;  4FLY A;  3H45 C;  1R59 O;  1K6Y A;  4ZTJ A;  2Q3S A;  5AQM A;  3CQY A;  4FM1 A;  3MK6 A;  5AQV A;  4L3Q A;  4FLT A;  3J7A P;  4B8A B;  4DU4 A;  1E4F T;  3CI5 A;  1RT1 A;  4OGE A;  3AO4 A;  3VGM A;  1J6Z A;  5EU7 A;  4CEA A;  4FWQ A;  3K2P A;  4J2E A;  4DV3 K;  4IWV A;  1HPZ A;  1VQN N;  2XHB A;  3MED A;  4RG8 A;  2YKN A;  1SS6 A;  2F4V K;  2ASP A;  1RT4 A;  4UQG A;  1TKX A;  1KVB A;  2HBL A;  3K5M A;  2HHV A;  4BRF A;  3QLH A;  3WXI A;  2J4R A;  1HYS A;  1IG8 A;  4OX9 K;  1NK9 A;  4CK2 A;  3M5R A;  4O0I A;  1YXQ A;  5AQH A;  4FLV A;  2BDP A;  2H3G X;  3U6F A;  4JK9 A;  2QKB A;  4JI3 K;  3NMU A;  3C95 A;  4KI6 A;  2A41 A;  1WN7 A;  3IDH A;  1HQU A;  3DM2 A;  3OY9 A;  3RTV A;  3QER A;  4IOA L;  3OYB A;  3SUQ A;  2KFN A;  2KKZ A;  4J2A A;  1RBV A;  1JCE A;  1K8K A;  4MQ3 A;  3SZ2 A;  1LV5 A;  3RWU A;  3O9U A;  3L4I A;  5C10 A;  2D0P A;  4YHH K;  3FLC O;  1ATN A;  1Z6R A;  3MN9 A;  2O8F B;  4MLH A;  1IBM K;  4CZJ A;  1ATR A;  1ZBI A;  4BC4 A;  1S1V A;  4GV9 A;  4M3Y A;  2RN2 A;  1ZBH A;  4E19 A;  3CG7 A;  2F96 A;  2VWJ A;  1N8R O;  2P9U B;  1HNW K;  4CGH A;  3HM9 A;  2NRV A;  1U4B A;  4JI4 K;  2QWP A;  2YJF A;  1T3V A;  2HB5 A;  2QW9 A;  2E1Z A;  3MX2 A;  1WAJ A;  4KH4 A;  3G0Z A;  3CM6 A;  3N4P A;  4YOT A;  3ZCM A;  4C8L A;  1KVC A;  2V51 B;  4CEF A;  1T6C A;  5C2F A;  1L5U A;  1VSI A;  1SAZ A;  1XQS C;  4ZTF A;  2W6L A;  3U3Y A;  2ZE2 A;  1NGI A;  1ZBF A;  3OS1 A;  1G15 A;  5M1N A;  1WSJ A;  4K0K K;  3ID6 A;  1EWQ A;  4B3S K;  1J54 A;  3ZX2 A;  4DQQ A;  1RBU A;  1YUW A;  5CZ1 A;  3AAP A;  3KZB A;  1BIU A;  3DRS A;  3H1Q A;  1YIJ N;  2BAN A;  2VWK A;  2X6S A;  5HRS A;  3ZX0 A;  5DM6 L;  3I8D A;  2FSN A;  3OYC A;  3F73 A;  2A6A A;  1QQN A;  3L2R A;  3CJC A;  1SKR A;  4BR0 A;  5AZI B;  4YNQ A;  4IG3 A;  3IKM A;  1S1T A;  3SV4 A;  3SLC A;  4KRF A;  1L3U A;  3RRG A;  4XH1 A;  1IKY A;  3CJ9 A;  4BRM A;  1MWM A;  1YTU A;  4KAZ A;  1NGH A;  1NGC A;  3LM2 A;  4BY9 C;  2D0O A;  1LAV A;  3ZT3 A;  5IT9 O;  2I5J A;  1XI1 A;  5JVG L;  1HNI A;  1D4X A;  3ID8 A;  5AQX A;  2E6M A;  2GWJ A;  1HJR A;  4KHQ A;  1GOA A;  3F5T A;  4AHV A;  5J2P A;  4RW4 A;  2QEX N;  1ZBS A;  3QIP A;  3OVN A;  4KHS A;  4Y1C A;  3GL1 A;  3ZSV A;  5AFU H;  3G6E N;  3SI6 A;  1HNX K;  4HCC A;  2VG5 A;  4KTW A;  3UKR B;  3ZLJ A;  1IKW A;  1S1U A;  4AHR A;  1QQM A;  3A2F A;  3MMV A;  1R0A A;  4J2D A;  3SAG A;  5LY3 A;  1QHA A;  4JI1 K;  4CZG A;  4DV5 K;  1XC3 A;  1RDB A;  5EY4 A;  2DFF A;  3OYF A;  3I33 A;  1IV0 A;  2FSK A;  3LAL A;  3WNH A;  1KAX A;  5JLF A;  3UE5 A;  3S41 A;  4CF0 A;  3U3G A;  4EP5 A;  2FLO A;  2O8E B;  3H3N O;  3VEZ A;  4CF8 A;  4B08 A;  2HBM A;  4KHY A;  2VGN A;  4CIF A;  2O4I A;  4CZI A;  3OTO K;  3M3Z A;  4I6M B;  3KK3 A;  5F0X A;  3LZI A;  2ZJQ L;  2QK9 A;  1D9F A;  2CH5 A;  3QIC A;  1GLJ O;  3HBT A;  2YNI A;  3PSF A;  5TKW A;  3VQ5 A;  1TUY A;  2LSN A;  1NWK A;  1Y64 A;  4A57 A;  4KKO A;  4Z0U A;  3V9Z A;  3T7Z A;  4OVL A;  1HKC A;  4B9T A;  4CJP A;  3WXL A;  2VGM A;  3OW2 M;  3Q7B A;  1NMD A;  3R3L A;  4CJ7 A;  2V7Y A;  4CEB A;  4DV6 K;  3EKS A;  1FW6 A;  4DFP A;  2YV0 X;  4FK4 A;  2ZQB A;  1O13 A;  3Q7C A;  3CET A;  3TAP A;  2G8H A;  3AVK A;  2E1Y A;  1BOT O;  2BH1 A;  1S72 N;  3NAE A;  5SZT A;  4MO5 A;  3E01 A;  3TAF A;  3C7N A;  4C8K A;  4H0T B;  2A1R A;  1T44 A;  1XNR K;  3LZJ A;  5M1Q A;  2HHS A;  1WB9 A;  2WTU A;  3NBP A;  4NXN K;  3DWL A;  4YDU C;  1ZYQ A;  4CJQ A;  2ITM A;  3FZM A;  1WSH A;  2BUP A;  3DOK A;  2WOM A;  4U67 L;  1M1K O;  4CEO A;  3HPG A;  4KRE A;  2XRI A;  4FXD A;  4N56 A;  3EE9 A;  2DFH A;  2HHH K;  4FPB A;  1NK6 A;  3SMS A;  1S6P A;  3DXK A;  3V1Q A;  4FJM A;  3CJ1 A;  3J81 O;  4CFD A;  1GLE G;  5C24 A;  1Y97 A;  3MEE A;  2Q97 A;  5TKY A;  3OYL A;  1MDU B;  1JL1 A;  2F7T A;  1E4G T;  3CMA N;  2ZJR L;  1S3X A;  4B9L A;  4AHS A;  1JCG A;  3AGR A;  3B6P A;  1TL1 A;  4FLU A;  4CJF A;  1X9W A;  5AFU A;  2A40 A;  3M1F A;  1DTT A;  3AA4 A;  1U45 A;  4Z4E A;  1T6D A;  2UUA K;  3T1A A;  3SJH A;  4E3S A;  1I39 A;  2UYT A;  1Q7Y O;  4GV3 A;  3VA0 A;  2IGI A;  4LF5 K;  3PX6 A;  4JN4 A;  3FZF A;  1TK0 A;  3DXK B;  3ZSX A;  3NF8 A;  2UXB K;  3VTH A;  1GLD G;  4IBN A;  4LY7 A;  3VQ4 A;  3AVB A;  4DFJ A;  3VQA A;  4FZZ A;  2JGU A;  2HVH A;  1ILY A;  3F2K A;  4BE0 A;  4DFM A;  4DR7 K;  4Z4C A;  4JHD A;  4CIG A;  4CK3 A;  1XC9 A;  1C0F A;  5LMU K;  1QE1 A;  3HPH A;  4DR4 K;  3HYF A;  5AQQ A;  3D6R A;  3AA5 X;  2P9N A;  2P9U A;  2UU9 K;  3PV8 A;  1LW2 A;  3A8Y A;  2A3Z A;  3VQC A;  4BRL A;  3PX0 A;  4W5R A;  1YF5 L;  3EO3 A;  4XIU A;  2QA4 N;  4NO7 A;  3QB0 A;  4X66 K;  1M90 O;  3MEG A;  1YIT N;  1NK0 A;  4C1N K;  4E7I A;  1GOC A;  3ZET A;  4M3Z A;  4CF1 A;  2W42 A;  4AHU A;  3EYZ A;  3PLA A;  1ZBU A;  1SUQ A;  4PHT X;  2AP1 A;  2E88 A;  2P9K A;  2ZD1 A;  3TTF A;  4Z4H A;  3THY B;  1TV6 A;  5KGW A;  5I9E B;  4DSK A;  1TUU A;  4CJS A;  1S9E A;  4KTZ A;  4PWD A;  3OYK A;  3LP2 A;  5AR0 A;  1E3M A;  3WQU A;  4B8C A;  1D9D A;  4YOY A;  2OPQ A;  4OGC A;  4M3X A;  2FXU A;  4CJU A;  4EP4 A;  1NBW A;  4H4O A;  4LF8 K;  1KAY A;  4IDK A;  5CYQ A;  1KXP A;  2RKI A;  4F2S A;  4FK2 A;  3OYE A;  4E0D A;  1RNH A;  3IMX A;  3SQ0 A;  2G8F A;  3ASM A;  4OKK A;  1TK8 A;  1T8E A;  2GV9 A;  2NRR A;  3ENB A;  4M63 C;  3AVL A;  4HCB A;  4E7K A;  3THY A;  4C8O A;  1NK8 A;  1GLC G;  3I0S A;  3A5L C;  4YOR A;  4CD3 A;  3G10 A;  1Z25 A;  5E84 A;  4L8R B;  3D7E O;  2XY8 A;  2E2N A;  3WNF A;  4B3R K;  1EQY A;  3WNG A;  1BI4 A;  3W0L A;  3OYG A;  2YNH A;  4IO9 L;  4CHZ A;  3LAN A;  4CVN E;  3VQD A;  2NNW A;  1Q18 A;  1MWK A;  2YHA A;  3OYJ A;  2DY4 A;  1Q9X A;  1MA9 B;  4OPJ A;  4C23 A;  4F8R A;  1NKB A;  2YX6 A;  3THX B;  3QEI A;  3VQE A;  3T3F A;  3OYH A;  2OA8 A;  4EFH A;  5BRF A;  2Y1I A;  2P9N B;  3SYZ A;  1MU2 A;  1Q8I A;  2G8W A;  3C65 A;  3B8A X;  4B1X B;  2BE2 A;  4FJN A;  4CJ5 A;  4KB0 A;  4DV0 K;  3L2Q A;  4OKE A;  3BZK A;  1YJ9 N;  3AVJ A;  3GBT A;  4M45 A;  4N47 A;  3MN6 A;  4DUY K;  4ID1 A;  4A2B A;  1LOT B;  2O8E A;  1NJX A;  3ULE A;  2P5O A;  3VQ6 A;  3S3O A;  4DR6 K;  2Q0R A;  3NF6 A;  1NNE A;  1JLC A;  1KTQ A;  4CHQ A;  3OYA A;  4BDZ A;  3ZT2 A;  4JV5 K;  5I3U A;  4CEE A;  4I6M A;  1VSJ A;  5EVZ A;  4M41 A;  3ATV A;  4NB4 A;  3M8Q A;  1N5Y A;  3TU5 A;  3CPE A;  3SCX A;  3AO3 A;  1UA1 A;  3LPU A;  5BN9 A;  2HBK A;  3BEX A;  4CHY A;  2VQF K;  4DSE A;  1NGD A;  2OTL N;  1LWC A;  3E66 A;  4B9M A;  1XUP O;  1RBS A;  3B6O A;  1C6V A;  5HP1 A;  2CGL A;  2HBJ A;  5AQP A;  3CCS N;  4C1N I;  5AQT A;  1BGX T;  1KLM A;  2ZJP L;  2GX9 A;  5AZJ A;  3CFP A;  4CCH A;  1ITG A;  5J2M A;  4DV7 K;  3KLH A;  5AQI A;  3QO9 A;  3R9P A;  3V1O A;  1VAZ A;  1NGA A;  1ASU A;  4DUZ K;  4A59 A;  5KQD A;  1N6Q A;  1VSE A;  2QWQ A;  3DLR A;  1VQ8 N;  4XH4 A;  3SV3 A;  1VQ9 N;  3BZC A;  2QWR A;  4CJK A;  1N36 K;  2EX3 A;  4H8K A;  4OJR A;  3VQ7 A;  4Z4I A;  3CCU N;  3C7N B;  4LF9 K;  4M3R A;  5B8H A;  3O4N A;  3KLG A;  2HW3 A;  3IFR A;  4O55 A;  4IOC L;  2B5J A;  3CJB A;  4NYF A;  2HNY A;  1NK7 A;  3L0Q A;  3NCI A;  4IFE A;  1RDU A;  4FW1 A;  1JKH A;  4FOI A;  4A61 A;  3HRG A;  3VQB A;  3S3M A;  1A5W A;  3KD1 E;  4PKI A;  1DT9 A;  4W5Q A;  3FGU A;  1GOB A;  5AQO A;  5AZJ B;  4DSF A;  2FF6 A;  3O3G A;  3LDO A;  3VMF B;  1YAG A;  1RDW X;  3G4S N;  3QNN A;  4HTL A;  3OJU A;  3BGR A;  2YHX A;  3SUN A;  1Z05 A;  3CQX A;  4DR3 K;  4K43 A;  5GIN A;  4YOW A;  1OKJ A;  1X1P A;  2QTD A;  1BCM A;  3NF9 A;  4FLZ A;  4DQ8 A;  2IVO A;  3VES A;  4DU1 A;  4JI0 K;  4H5T A;  3KLE A;  3MXM A;  4HUG A;  3ISN C;  1ESV A;  5JS1 A;  4E1J A;  1NJZ A;  4JKE A;  4IO8 A;  4GVM A;  1C0G A;  3E9O A; 
#chains in the Genus database with same CATH homology
 4LFA K;  5IWA K;  2UUB K;  4AQY K;  4JI4 K;  4JI1 K;  4JI7 K;  1HR0 K;  4DV5 K;  4DV4 K;  4LF8 K;  1I94 K;  5A2Q O;  4V19 S;  3J7A P;  4DV1 K;  4DV7 K;  2UXC K;  4NXM K;  2ZM6 K;  1IBL K;  5AJ3 K;  1N33 K;  4DUZ K;  2E5L K;  4X64 K;  3OTO K;  4X65 K;  4DR5 K;  5LMN K;  2UUA K;  4DR1 K;  4DV3 K;  1N36 K;  2UUC K;  4JI5 K;  4LF9 K;  4LFC K;  4JI8 K;  2F4V K;  4LF5 K;  4K0K K;  4JI6 K;  4B3S K;  2VQE K;  2UXB K;  4B3R K;  1IBK K;  4DV2 K;  4CVN E;  3J80 O;  4OX9 K;  5LL6 Z;  4DR7 K;  4DV6 K;  1XNQ K;  4GKK K;  1J5E K;  5LMU K;  4DR4 K;  4JYA K;  4JI3 K;  2UU9 K;  4JI2 K;  4X62 K;  4KHP K;  4LFB K;  5FLX O;  1N32 K;  4DV0 K;  4GKJ K;  4X66 K;  4LF4 K;  1HNZ K;  1XNR K;  4DUY K;  3JAM O;  3J7Y P;  4NXN K;  2UXD K;  4YHH K;  4B3M K;  1N34 K;  4CW7 B;  4LF7 K;  5IT9 O;  4YY3 K;  4DR6 K;  5BR8 K;  4DR3 K;  1IBM K;  2HHH K;  4JV5 K;  1XMQ K;  4JI0 K;  3T1H K;  3T1Y K;  3J81 O;  1HNX K;  1XMO K;  4B3T K;  4LF6 K;  4DR2 K;  1HNW K;  1FJG K;  2VQF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...