5EU7A

Crystal structure of hiv-1 integrase catalytic core in complex with fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACDWAGIKQEFGVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Preserved HTH-Docking Cleft of HIV-1 Integrase Is Functionally Critical.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Integrase
total genus 48
structure length 143
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5eu7A00
3OYNA 3HM9A 3ZSXA 1C0MA 3K59A 3SQ0A 2DY4A 1IO2A 1J9AA 3G0ZA 5CYMA 4PQUA 2A1SA 2Z1HA 1N5YA 4E7HA 3SUPA 2F8TA 3AA4A 4RW4A 1UA0A 2OZSA 3VQQA 4G1QA 3LWLA 4CFCA 3V9ZA 4CK1A 1EETA 1QSLA 1EXQA 1T7PA 3HP6A 4NCBA 2AJQA 1RT2A 3I0SA 3MEDA 3JYTA 1L3VA 1MU2A 4KB1A 4CJTA 3NE6A 3NGIA 4BWMA 3I8DA 1YTAA 2X78A 2O4IA 3NH2A 3OYCA 4DTNA 1RTHA 3AVAA 4CGJA 2IC3A 3QEXA 4CF8A 5KGWA 3HK2A 3AVKA 4I7FA 2XY5A 1YTUA 2BE2A 1VSJA 3QEVA 4FYDA 3NH0A 4E7KA 3D0PA 1NJWA 3MEEA 1LWFA 4M3UA 4EZ6A 4YFUA 1RNHA 2D0BA 3VQ8A 4CF0A 4FM0A 4B9LA 3VQ4A 1VSFA 4FJNA 4DTUA 3SPZA 5E41A 4E3SA 4KTZA 5JS2A 3O3GA 2FBTA 4RW8A 3V9UA 1NK0A 4CK2A 1S1XA 2YHAA 4FM1A 4BDZA 3SUNA 4B9MA 3OYMA 4PUOA 2VWKA 3V9WA 3BGRA 4Z4CA 4HUEA 3AA3A 4FZXC 3ZT3A 3DLEA 3QEWA 4KHSA 1DLOA 5D3GA 1EP4A 2IGIA 3SJJA 3K5NA 1C1AA 4MFBA 4RW7A 3DRSA 2W42A 3O3HA 4JRPA 3T3FA 1IKXA 3S3OA 4FLWA 1U48A 4QAGA 3P1GA 3WNHA 1O1WA 3NBPA 2HMIA 4CJQA 1VSDA 3TAFA 4AHRA 3NHGA 3RMAA 1KRPA 4FJJA 3OS1A 4AHUA 4I2PA 3THVA 1VRTA 4NYNA 3FFIA 4KI4A 4Z4GA 4CGFA 1JLQA 3PX6A 1NK5A 3IS9A 4FJMA 3CFOA 1IKYA 1DTQA 4CEZA 3QEPA 1X9MA 3ZCMA 2OA8A 4B9UA 2HHUA 3KD1E 5CY4A 3VQAA 1TVRA 4IFVA 5FDLA 4O4GA 3ZSQA 2LSNA 4DU1A 1VSHA 3E01A 4KV8A 4J2DA 2PY5A 3QO9A 4B3OA 1C1CA 3L3UA 3LPUA 4CF9A 4BE0A 3HO1A 4E1MA 4UQGA 4O44A 3SV4A 5I3UA 1VSKA 2D0CA 4CGDA 2Q3SA 1VSIA 3HPOA 3CG7A 1VSEA 4LSNA 3BDPA 5J2MA 4FW2A 1J5OA 1ASVA 1Z25A 2P5OA 4FZZA 4Z0UA 3M8SA 3S3MA 4DU3A 2OPPA 4Z4FA 3NF6A 1D9DA 1WAJA 3LALA 3PUFA 3O3FA 4CJ3A 1RTDA 4ZHRA 3L2VA 1QTMA 3CQ8A 3DLGA 1NJZA 4DSFA 4CHOA 3RRHA 1CZBA 1W0HA 3U6FA 3AO1A 4OPKA 4NCGA 3SZ2A 3LWMA 3EY1A 1KFSA 4FLTA 3IG1A 2VG6A 4CEBA 1KTQA 3LP0A 1NK6A 3CM6A 3UIQA 3KK3A 2HHXA 4LD0A 1BISA 2PZSA 3RR8A 1B9FA 1WLJA 3TAMA 4JS5A 3QNOA 4M42A 4B8AB 3KJVA 4DQIA 4FXDA 4DF8A 3OYIA 3VA0A 2ZQBA 3PY8A 1RBSA 1Q9YA 2HHSA 3T19A 4FLUA 1JL2A 1QHTA 4CEOA 4ID5A 3B6PA 3SI6A 4RW6A 4JLHA 3H08A 3RR7A 1A5VA 1D9FA 4FJ5A 3KK1A 4FJKA 1TK0A 3QNNA 3ZSRA 3ZSZA 2BGGA 3K5OA 4N56A 4CFAA 5FRMA 2G8HA 3KLFA 1L5UA 3L2RA 2HW3A 5DK5A 1BCMA 5C24A 3DMJA 4GMJB 4M45A 3EZ5A 2X6NA 2RF2A 4F8RA 1HYVA 4DLGA 1ITGA 3VQDA 3LZJA 1LV5A 1TK5A 1TV6A 3I0RA 3MXJA 3NF7A 4IKFA 3L2WA 4HUFA 4KHNA 4E19A 3LAKA 1IKWA 1X1PA 1RT5A 4CJ4A 4R5PA 1S6PA 3F73A 2VG7A 2PYLA 3AA2A 1HNVA 3U3YA 1CZ9A 4ZTJA 2FBVA 1TL3A 3AV9A 1ASUA 1EX4A 3QINA 4NYFA 4CHPA 4F2RA 4BE2A 2YNIA 4C8NA 4DQQA 3SUQA 1HQEA 3KK2A 3RMBA 1LW0A 1RDBA 2E6MA 2IOCA 4CFBA 3OYBA 3AO4A 4MQ3A 1NJXA 4DFMA 3ZSOA 5SWMA 1NK8A 1ZBHA 3HSTB 2BDPA 1RT6A 4E7LA 4DG1A 3CFRA 4DTRA 3VQEA 4FLVA 4ZTFA 2PYJA 3KD5E 3DLKA 3OJUA 3QERA 4J2BA 2G8UA 1RBTA 2O4GA 3P83D 2Y1JA 5HROA 4OKKA 3L8BA 2OZMA 1J54A 3K5LA 4KB0A 2XHBA 3OYLA 4FJHA 2NUBA 3ZT2A 4CGIA 3D45A 1RT4A 1WSJA 2IS3A 4OKEA 3NDKA 4E7JA 3WNEA 2KQ2A 4CJLA 5J1EA 3EYZA 4DU4A 1GOAA 3F9KA 1ZYQA 2RN2A 4B9TA 4H8KA 1LWCA 3NF9A 4OGCA 1HQUA 2XY8A 3SQ1A 3KTQA 3WNGA 3SYZA 5JS1A 3T1AA 1RT3A 2HHVA 4IG0A 4DQSA 1QSYA 4DQRA 1TKTA 3O4QA 3MXIA 1QS4A 3K58A 4B9NA 3MECA 3KLGA 1NKEA 3OYDA 4KRFA 1UA1A 3OVNA 2FBYA 2HNZA 3KIOA 4M3RA 4E0DA 3VQ9A 3LPTA 1NKCA 1RCHA 1D8YA 1JXEA 3AVLA 1RBUA 2EHGA 4HUGA 1J53A 5J2QA 3U3GA 4FK4A 4DSLA 4W5QA 1SL2A 1T05A 1G15A 4B08A 1U47A 1DTTA 1EKEA 3V1OA 3OYFA 4PA1A 4FLZA 4FJGA 4RW9A 3DRPA 4FLYA 3V9SA 4W5RA 3QETA 2XY6A 5HRSA 5SZTA 3VQ6A 1REVA 4C8KA 3SPYA 3TANA 2QKBA 1FK9A 4CEDA 4CIFA 2B6AA 4RG8A 4E89A 1SKSA 3S9HA 1BQNA 1TAUA 3RWUA 3ZSYA 4CGHA 3V81A 2GBZA 3G10A 4CHQA 4J2AA 1JL1A 4FCYA 3AVFA 3ZT4A 4C8OA 3NF8A 4M3WA 3HL8A 1IH7A 2YHBA 4EP4A 1JLEA 3AVGA 1VSLA 2WOMA 4OGEA 1JLAA 4C8LA 4QCLA 3MEGA 4LH5A 4CJEA 2E4LA 3RTVA 1U45A 2QKKA 1QSSA 1CXQA 3VQ7A 5HRRA 4CJVA 3AO5A 3DM2A 1JLBA 1R0AA 3AA5X 3KLEA 3AVBA 3CYMA 1XI1A 4KTWA 4B9SA 4HCCA 2KFZA 3QEIA 5CZ2A 1RDDA 4HTUA 4DTMA 2DFEA 4FVMA 3KLHA 2ZD1A 3S3NA 4FJXA 3K57A 2G8IA 1BL3A 2P5GA 3SCXA 3DLBA 1Y97A 3O4NA 3ZT1A 1JXBA 1TKZA 4CJFA 3QIOA 1WN7A 2YKMA 3DRRA 3AO3A 4FW1A 3P5JA 4DTPA 4FJ9A 3SQ2A 2E6LA 2JGUA 3NGZA 1JLGA 3L2UA 3OY9A 4HHTA 1B9DA 5HRNA 1RT1A 1U4BA 1IG9A 4DWIA 3KLIA 1WNSA 3C6TA 4CIEA 3HVTA 3IRXA 3QLHA 4BDPA 1S5JA 3RMCA 3HT3A 2G8VA 3DLRA 4CGGA 3LANA 3JSMA 4CEQA 1ZBFA 3TAGA 3KKSA 1RT7A 3L2QA 4Q0BA 3PX0A 1ASWA 2KW4A 2QK9A 1Q8IA 1TKDA 4OVLA 5FROA 1ZBLA 4DLEA 1NK9A 2YNFA 3OYKA 4AILC 4N5SA 4KHUA 3TABA 4ICLA 3HPGA 3NAEA 4OPJA 4DTXA 4J2EA 1RTIA 4AHCA 2D0AA 4KREA 3RMDA 4ELVA 3HYFA 4GVMA 1JKHA 3L3VA 4ID1A 4F3TA 2F8SA 4E1NA 3V9XA 4QOZB 3ZT0A 1LW2A 1S1VA 2D5RA 1SL1A 3OYAA 2HHTA 3SUOA 4JS4A 4DFKA 2OYQA 1NOZA 1UWBA 2F96A 1B92A 1WSFA 1A5XA 1RBRA 1WSHA 4B8CA 3OS2A 2Y1IA 4CCHA 4KTQA 3MXMA 4DSKA 4N76A 2GUIA 2OPRA 2ITGA 1RDCA 1Q9XA 3LP3A 1UOCA 4KAZA 4CF2A 1ZBIA 3TI0A 4EP5A 3WNFA 5KRSA 2HB5A 5KTQA 4CFDA 1GOBA 2VG5A 3V1QA 1NKBA 4F3OA 1XWLA 1TL1A 4Y1DA 4CIGA 2VWJA 3M8PA 5C25A 3SNNA 2R7YA 3QESA 4O0IA 1IKVA 4ELTA 4O5BA 4DFPA 4I9QA 1HRHA 2IDOA 1TK8A 1GOCA 2IAJA 4KFBA 4BDYA 4AH9A 1L3UA 4W5NA 1QE1A 2YNGA 3ISNC 4IDKA 4TSXA 1L3SA 1D5AA 5KRTA 2HVHA 1KFDA 1HMVA 5J2PA 4LY7A 4CHZA 1SUQA 1HYZA 1RDAA 4E7IA 1TKXA 4N41A 2GV9A 4CF1A 4HVJA 4PWDA 1C0TA 1Z26A 3LZIA 3NGYA 3DOKA 2XY7A 4CJKA 3ZSWA 3K5MA 1RTJA 4OLAA 4DF4A 4O0JA 4FJ7A 3VQPA 4OKJA 1VRUA 1KCFA 4BWJA 4CJ5A 2RPIA 2ETJA 1XHXA 4K8ZA 3OYJA 1BCOA 1JLCA 4C8MA 1S1UA 5FRNA 2DTUA 3A2FA 4CJWA 4DSJA 1S9EA 1YT3A 5HBMA 2HNDA 4OLBA 3LP2A 4AHTA 3HP9A 4KPYA 4PY5A 4CEAA 1L3TA 1BIZA 4KKOA 2DFHA 3PO5A 4F2SA 4NCAA 3NFAA 1VK0A 1K6YA 1BHLA 3LAMA 1RILA 3AVNA 1I3AA 1S9GA 1W9HA 3DYAA 1KVCA 4DS4A 2HHQA 2KTQA 4KHYA 1KVBA 1N6QA 1T03A 4FJLA 4Z4EA 2G8WA 1C6VA 3HXMA 4FK2A 1F21A 1SKRA 3IAYA 3AVHA 3C6UA 5KGXA 3MAQA 4WE1A 1FKPA 1ZBUA 3AVJA 1SL0A 3V6DA 2ATQA 1LAWA 3OYGA 4CEFA 1C0UA 2HHWA 2WONA 4KHQA 3AVMA 3HJFA 4CJUA 1HJRA 3ALYA 1HYSA 5C42A 1XC9A 1QQCA 2ZE2A 4IG3A 4DMNA 3NH1A 1WSGA 1BQMA 3DLHA 4CJRA 4H4MA 1S1TA 4M41A 3ASMA 2P51A 3DI6A 5EU7A 4GW6A 1HPZA 2KZZA 3V1RA 4CEEA 2OPQA 3NCIA 3K2PA 5KI6A 3VA3A 4YNQA 4DS5A 2G8FA 2KFNA 3M8RA 3OYEA 4JRQA 1VSMA 3TAQA 2XO7A 1LWEA 4CHYA 3VN5A 3CFPA 1I39A 4M3ZA 3OYHA 2X74A 5DMRA 4BE1A 1C1BA 2FC0A 4Q5VA 3TWHA 2YKNA 3TARA 4DSIA 4Y1CA 4M3XA 1KVAA 4L8RB 2KZMA 2Z1JA 3HPHA 1BI4A 2Z1IA 1T8EA 1A5WA 1S1WA 3B6OA 4W5TA 4FLXA 4FM2A 3SV3A 1WSIA 5J2NA 4DFJA 3PV8A 1U49A 1YVUA 2B4JA 4CERA 2QXFA 4O55A 1KLMA 4CJSA 2P1JA 2A1RA 2JLEA 1UAXA 2EX3A 3AO2A 4IBNA 4AHVA 1X9WA 4DQPA 1BGXT 5K14A 1NK7A 1CLQA 3CM5A 3M8QA 4M3TA 1FXXA 4KO0A 1U04A 3AVIA 2OPSA 1RBVA 2Z1GA 1FKOA 4N47A 3ZSVA 4W5OA 3OJSA 3HVRA 3TAEA 4CESA 1XHZA 4ELUA 3OS0A 3KKRA 2RKIA 4Z4HA 4F4KA 4I9LA 4OJRA 5HRPA 4CECA 4Z4IA 3LP1A 4IFYA 3DOLA 4M3YA 2I5JA 1SKWA 1SV5A 3QIPA 2X6SA 4LH4A 3SQ4A 3VQ5A 5HP1A 2B5JA 1TAQA 1NK4A 4FJ8A 4KHWA 2G8KA 4HCBA 2FBXA 3RRGA 4EZ9A 1BI4B 4DTSA 1S6QA 2YV0X 4XIUA 4BACA 1KSPA 4FJIA 1LAVA 2HNYA 4CJPA 4FK0A 4CHNA 3TAPA 2DFFA 4H4OA 2YNHA 4DTOA 5I42A 5CYQA 3C95A 3ITHA 1TGOA 3PX4A 1BIUA 5CZ1A 3AVCA 2XRIA 5T7BA 4DSEA 4KI6A 4I2QA 5HLFA 3ULDA 1KLNA 1WAFA 1X9SA 3V4IA 4CE9A 1WSEA 4LSLA 1NJYA 1JLFA 4B9VA 4K8XA 3VQCA 4DTJA 3PO4A 3TR8A 2HVIA 1HNIA 4CK3A 3VQBA 1CXUA 3LDSA 4FZYA 1NOYA 4AHSA 3C94A 2BANA
chains in the Genus database with same CATH superfamily
1ZC6A 3SQ0A 3O1BA 2DY4A 3G0ZA 3ULEA 4FPBA 1DT9A 4PQUA 4EFHA 3LWLA 2J4RA 4XH4A 4CFCA 3CCVN 1EETA 2A3ZA 1GLDG 3FZLA 3I0SA 3JYTA 1L3VA 4KB1A 1MU2A 3SJHA 1W97L 4CJTA 3O8MA 1XMOK 2O8EB 3TSPA 5KPTA 4B3MK 1G99A 3AVKA 4FWMA 5AQZA 3PLAA 2HSTA 3D0PA 1NJWA 2YX6A 5TKYA 3G71N 3I33A 3S41A 4M3UA 4YY3K 1H1VA 4B9LA 2D0BA 3VQ8A 4CF0A 3VQ4A 1VSFA 4FJNA 1NK0A 1HNWK 3O3GA 3IUCA 4BR9A 4JHDB 3PSFA 1S1XA 3SUNA 4B9MA 3OYMA 1S22A 3FZHA 2PBDA 4ILHA 3DLEA 3C7NA 5M1OA 3K5NA 4Y0WA 3DRSA 3A5NC 3O3HA 4JRPA 3S3OA 1EO1A 3WNHA 1HR0K 4AM7A 1K8AO 4AHRA 1KRPA 1VQ8N 1M1KO 5HOOA 1J6ZA 4FL9A 2HBKA 3QEPA 1X9MA 4CEZA 2OA8A 5CY4A 4BR7A 4IFVA 5FDLA 3U8XA 1RGIA 2LSNA 3FGUA 2PY5A 3RSEB 3FZKA 4X62K 3L3UA 4CF9A 1K73O 3N4QA 4JN4A 4E1MA 4O44A 3U4LA 1W2BM 1VSKA 4IJNA 1NG9A 1XNRK 3P38A 1VSIA 3CG7A 3BDPA 5J2MA 4FW2A 4JK7A 1Z25A 2P5OA 3S3MA 4CJ7A 5JLFA 4DU3A 4Z4FA 3IDHA 1WAJA 3PUFA 2QTDA 3CQ8A 3DLGA 4GKJK 3VERA 4DV1K 3VMFB 3JAMO 3LWMA 1GLFO 4FLTA 3CC7N 1MWMA 1SS6A 4PL8A 2HHXA 4IFEA 2PFUA 3A5OC 1QQOA 3KWGA 3VA0A 2ZQBA 2A40A 1RBSA 1Q9YA 2QA4N 4FLUA 1QHTA 5KQDA 3AARA 1TYQB 4MDBA 4JLHA 1D9FA 4YDUC 1VQKN 3QNNA 3MN6A 4BC2A 3CETA 2P9NA 3EKUA 5FRMA 4DR5K 3J7ZO 3G6EN 4ILJA 3J8AA 2NRTA 5C24A 4M45A 3CMEN 4BRDA 3MCPA 1TV6A 3MXJA 4YOUA 3NF7A 4KHNA 5F0XA 1IKWA 4R5PA 2VG7A 1HNVA 1X3MA 4DR3K 3N4PA 4A61A 5BREA 3C7NB 3CCMN 1HJOA 1ASUA 4F2RA 2YNIA 3OBWA 1DGKN 1HQEA 2E2OA 3RMBA 5C10A 4X64K 3C65A 5A2QO 1NJXA 1NK8A 1Q82O 4O5FA 4OPAA 5GAEP 2BDPA 4E7LA 3CFRA 3VQEA 4KH6A 4KHPK 3OJUA 2O4GA 2Y1JA 3BEXA 2XHBA 4B1XB 3OYLA 1RT4A 2IS3A 1WSJA 3D45A 4CJLA 4DU4A 1VQMN 3F9KA 4IEIA 2VQFK 1LWCA 4ILGB 3UKUA 3EN9A 2W6KA 4LF5K 3WNGA 5AFUH 1QSYA 4DQRA 1TKTA 1VQ7N 3O4QA 5FPEA 3SAGA 4B9NA 4AM6A 5AQFA 4A5BA 4KRFA 2FBYA 3ULEB 4E0DA 1NKCA 1RCHA 4IO9L 5J2QA 2Q2RA 1N8RO 1SL2A 4DSLA 4B08A 4CD3A 1U47A 1EKEA 4PA1A 2VWBA 2P9IB 2QWRA 1FK9A 4CEDA 2B6AA 4M7YA 1BQNA 1C0GA 2FSJA 1LOTB 3AVFA 3ZT4A 1YI2N 1IH7A 5JICA 1VSLA 4AQYK 1GLBG 4OGEA 1JLAA 4C8LA 4QCLA 2O8BB 4LH5A 1QSSA 3VQ7A 4JKEA 1IJJA 4B9SA 2E5LK 1VQ9N 1VQLN 3R3LA 5LJWA 2NRHA 3KLHA 4FVMA 4GKKK 5C15A 3O4WA 1Y97A 1JXBA 4RWTA 3VEXA 3QIOA 1P8ZA 1YJNN 1QZ6A 2ZJPL 1OVQA 2FXUA 4DTPA 4FWOA 3NGZA 1JLGA 1B9DA 1RT1A 1U4BA 2HHQA 4CIEA 1WNSA 2CH6A 5LMNK 2IVOA 4CGGA 3E9OA 4JKFA 1ZBFA 3L2QA 4FWRA 4YOWA 4FOIA 4OVLA 1KC8O 4DLEA 4GY2B 4BGBA 2YNFA 3OYKA 4KHUA 4ICLA 4J2EA 2D0AA 3RMDA 4ELVA 4ID1A 1JCFA 4E1NA 3V9XA 1S1VA 4AF1A 4H0TB 3SUOA 5HL7L 1C0FA 2F96A 1B92A 1WSFA 1X9JA 3P4IA 4KTQA 3OS2A 2Y1IA 4FWQA 2GUIA 3QBWA 3RSEA 3ATVA 4KAZA 2RE2A 2HOEA 5BPMA 3UKRB 5KRSA 1NKBA 3SNNA 4Y1DA 5C25A 5EY4A 1HLUA 2R7YA 3QESA 4O0IA 4DFPA 2FSNA 4I9QA 2IAJA 3VEOA 3VEVA 1L3UA 1QE1A 1L3SA 4WQ4C 3D6RA 1HMVA 4LY7A 1HYZA 4HVJA 1C0TA 3CJAA 2XY7A 4DHYA 3VEWA 3K5MA 1GLLO 1RTJA 4WQ4A 4OLAA 2QM1A 4DF4A 1NGEA 5JMVA 4CJ5A 4KH4A 2ASPA 2HBJA 2DTUA 4LF6K 1YT3A 4OLBA 3LP2A 3MMVA 4NCAA 1ZBSA 1VK0A 4Z94A 1RILA 1NMNA 3DYAA 3C0BA 4DQ8A 4EHTA 2KTQA 3THYB 4FJLA 2YHYA 4HWIA 1IBLK 4Z4EA 2G8WA 4H0VB 4FK2A 1F21A 4H5VA 5BRDA 4LFCK 1C0UA 4KHQA 5C42A 5LJVA 2F7TA 3DLHA 2F9TA 1S1TA 2WTUA 1TUYA 1BO5O 5C2FA 5KI6A 3VA3A 4DS5A 4YNQA 3CJBA 3M8RA 3M6GA 1VSMA 4DUYK 4I6MA 4DR4K 4CHYA 3B8AX 5AQNA 2ZJQL 4M3ZA 2X74A 4JI8K 4GVEA 3TARA 5LMUK 2GWKA 4IO8A 3H3NO 1KVAA 3CQXA 3HRGA 3LDOA 1A5WA 1S1WA 2E20A 3B6OA 1N34K 4FLXA 5BPNA 1WSIA 3AAQA 4DFJA 3O5BA 3PV8A 1YVUA 2B4JA 2HF4A 4IBNA 1BGXT 5K14A 1NK7A 1BWFO 1NWKA 1RBVA 4N47A 3HVRA 3TAEA 4ELUA 2QW9A 4JNEA 3KKRA 4JKGB 4PKGA 2RKIA 3LDQA 4I9LA 4OJRA 4M3YA 2X6SA 4LH4A 5AZIB 4DR1K 1TAQA 2Q1NA 4FJ8A 2FBXA 3WXLA 4JI7K 3J80O 5AR0A 4H5RA 3CQYA 3TAPA 1S3XA 3CJ7A 3MX2A 1YF5L 1TGOA 1WBBA 1N36K 2A41A 3NMUA 3VGLA 1RDUA 4CE9A 4LSLA 1JLFA 3VQCA 3TR8A 1CXUA 4FZYA 3HM9A 4BRFA 2O8CA 5F2RA 1IO2A 1J9AA 4CZHA 1MA9B 2IVNA 1XMQK 2KHOA 2WC9A 1YAGA 3SUPA 2QWMA 1XNQK 1IG8A 3AA4A 2OZSA 5BPLA 1MWKA 1EXQA 3NGIA 2X78A 3ZX2A 4QS8A 2FSKA 5KGWA 3R9PA 1HKBA 4I7FA 1YTUA 2BE2A 1VSJA 1W7AA 4FYDA 3OBYA 3MEEA 1LWFA 3BF3A 1Q18A 4EZ6A 4FM0A 1RNHA 2ASOA 3VEYA 4K42A 4CK2A 4IXCA 3E1YA 3BGRA 4WQ5C 1YUWA 2Q0UA 4H0XB 2IGIA 3SJJA 1YIJN 1IKXA 5EXWA 1HNZK 3DXKB 4CJQA 5AZIA 3ZX3A 4FPAA 4I2PA 4Z4GA 3EEQA 4CGFA 1JLQA 5FLXO 4FJMA 3FFKB 3CFOA 1IKYA 2HHUA 3G4SN 3O9QA 2WFBA 3DXMA 2WBNA 4J2DA 1HUXA 1XQSC 3LPUA 3C6HA 2D0CA 3L4IA 2KKZA 1J5OA 1HKCA 1D9DA 1QTMA 4ZHRA 3L2VA 4CHOA 3RRHA 1W0HA 3U6FA 1QZ5A 3AO1A 3TSQA 4OPKA 1KFSA 3IG1A 4WFBL 3CPEA 3GDQA 1KAZA 4H0YB 2QWLA 1EWQA 3RR8A 1WLJA 3TAMA 4M42A 4B8AB 5C2DA 3OYIA 3T7ZA 2F4VK 3T19A 1JL2A 3CC2N 1NGHA 2DPNA 3DXMB 1JJ2M 1WBDA 3K5OA 2G8HA 1L5UA 2HW3A 3O9SA 3UB5A 3EZ5A 2RF2A 4DLGA 3VQDA 3WXIA 3I0RA 3L2WA 2E2QA 4E19A 4CZEA 1X1PA 1RT5A 4JK9A 4CJ4A 3F73A 3OW2M 3AA2A 2VCPA 3TSUA 3AV9A 3O6WA 4NYFA 4CHPA 1GLJO 2Q31A 1LW0A 4H0OA 3AO4A 2QEXN 4K0KK 4CVNE 3HSTB 4FLVA 2PYJA 3DLKA 3QERA 3QBXA 1J5EK 2G8UA 3P83D 4OKKA 3L8BA 5GIOA 1J54A 3K5LA 3ID6A 2E88A 4CGIA 4E7JA 2F8SA 3NDKA 3WNEA 2KQ2A 1ZYQA 3UKRA 2RN2A 4OGCA 2XY8A 2GUPA 1RT3A 4IG0A 4CZFA 3MXIA 5AQJA 5GINA 2HNZA 3KIOA 4M3RA 3D2EA 3CJ9A 3H46O 3HSCA 4IDHA 1JXEA 3AVLA 1G15A 1DTTA 3V1OA 4FLZA 2P9NB 4RW9A 3DRPA 4FLYA 2JWKA 3QETA 3J7YP 3VF2A 2QKBA 4WCEL 3U9DA 4JI4K 1Z05A 1SKSA 3RWUA 2OTJN 4FVUA 3LDLA 4CHQA 1JL1A 4JKCA 4MLHA 2CH5A 4C8OA 4EP4A 3D2FB 3THXB 4JV5K 3O1WA 4WFNL 3MEGA 1U45A 3RTVA 2QKKA 1CXQA 4CJVA 1NM1A 2AP1A 1R0AA 3KLEA 1XI1A 3AVBA 3CYMA 2KFZA 4KTWA 4BRNA 3QEIA 1KAYA 4YOYA 5FPMA 4DTMA 3SLCA 3S3NA 3K57A 2P5GA 1NLVA 3ZT1A 4DR6K 3QFUA 5E84A 3R6MA 5DM7L 4DUZK 4FW1A 3ZEUA 3DLLL 3CXCM 1BOTO 5BN9A 3SQ2A 4X66K 1YXQA 2JGUA 3VENA 3L2UA 3KHYA 2F9WA 4RTFD 1IG9A 4DWIA 3HVTA 3QLHA 1JCEA 3HT3A 4BR4A 2G8VA 3DLRA 3JSMA 4CEQA 4B3TK 3TAGA 3KKSA 2GWJA 4IOXA 1ASWA 2KW4A 1Q8IA 1TKDA 3H6EA 5FROA 2UYTA 3VTHA 3HPGA 4PL7A 1RTIA 4GVMA 4QOZB 2W6LA 1HX1A 3WUHA 1SQKA 5JLHA 4JS4A 4DFKA 3BZCA 1A5XA 1RBRA 1WSHA 4B8CA 4YHHK 3MXMA 4DSKA 3ZYYX 4IJAA 1UOCA 3ATUA 3VPZA 4CFDA 1GOBA 1OVYA 3V1QA 2HBMA 4F3OA 1TL1A 4CIGA 3QDKA 4A59A 4ELTA 4OX9K 2V7ZA 3J7AP 3CI5A 2GELA 4LFAK 4BDYA 4AH9A 2P9LB 4IOCL 4IDKA 2YNGA 4TSXA 4BROA 5KRTA 5J2PA 1RDAA 3JXUA 3A0IX 4E7IA 1TKXA 3THXA 2A6AA 4CF1A 2EWSA 1Z26A 4CJKA 4O0JA 2CGKA 4ISFA 2RPIA 1JLCA 1S1UA 4DR7K 3CCLN 4PY5A 4KPYA 1L3TA 1BIZA 4KKOA 3PO5A 3AVNA 1W9HA 3I55N 4DS4A 4KHYA 1KVBA 1N6QA 1T03A 2P9SA 3AGRA 3HM8A 1SKRA 1Y64A 3AVHA 3HTVA 3C6UA 1GLAG 4L3QA 5KGXA 1YHQN 2QWOA 5BR8K 2VYPA 2ATQA 1Q7YO 3CCQN 2HHWA 2P9SB 3HJFA 1HYSA 3NH1A 1WSGA 1NGJA 1ATNA 4H4MA 4M41A 2P51A 4GW6A 1VQON 2FF3B 5I9EB 3OYEA 1OH8A 3TAQA 4NXNK 1TYQA 1VQNN 3CFPA 5CHIA 3OYHA 4DSIA 4Y1CA 2Z1JA 3CJ1A 3HPHA 2Z1IA 4FM2A 3WQUA 5M1NA 2I7PA 3KZBA 2QXFA 1KLMA 2A42A 2P1JA 3LDPA 4GNIA 3CM5A 2GX9A 1U04A 3CCSN 1QVGM 4F4KA 4NO7A 4Z4IA 3LP1A 4IFYA 3DOLA 3TTCA 4OPHA 3SQ4A 4H5WA 4FSVA 5HP1A 2GTDA 2G8KA 5AJ3K 4HCBA 1BI4B 1S6QA 3CCRN 4FJIA 2HNYA 3KVGA 1IBMK 3J81O 4DTOA 5BRFA 5CYQA 3C95A 3ITHA 2P9LA 5HLFA 1K8KA 5E26A 1QQMA 4CK3A 3VQBA 1WOQA 3LDSA 1NOYA 4AHSA 2D1KA 4YOXA 4O8UA 3OYNA 3ZSXA 3K59A 1DEJA 1HNXK 2CGLA 4GV3A 2OCEA 2A1SA 1N5YA 4E7HA 4FWLA 4RW4A 1UA0A 2RHKA 2YHXA 4BRPA 4NCBA 1QSLA 2AJQA 1RT2A 1O13A 4BWMA 2O4IA 3OYCA 4DTNA 1RTHA 4FOEA 3WEEB 2I7NA 2UUAK 4C23A 4CGJA 3IKMA 5AQSA 3QEXA 1YJ9N 3AY9A 4CF8A 3WQTA 3CJCA 4GV9A 2NRRA 2VQEK 4H5NA 4E7KA 2YHWA 2UUCK 1NGDA 4YFUA 4B1WB 3BZKA 4DTUA 3QICA 5E41A 4KTZA 5JS2A 2FBTA 4RW8A 3V9UA 3CIPA 4LF8K 4FM1A 2YHAA 2V52B 4PUOA 3V9WA 4Z4CA 4HUEA 3TU5A 3QEWA 4BQZA 5AZJB 5BN8A 1DLOA 3VF4A 4KHSA 1EP4A 4RW7A 2W42A 4LF7K 4A5AA 4FLWA 3WXMB 4QAGA 3P1GA 1SZ2A 3CERA 1QQNA 1VSDA 3L0QA 2D4WA 3NHGA 3RMAA 3OS1A 4AHUA 5EOYA 1VRTA 2OANA 2Q36A 3GE1A 1NK5A 3IS9A 2ZJRL 1KQSM 1DTQA 3ZCMA 1OKJA 1TVRA 4O4GA 4M63C 1VSHA 4KV8A 3OA9A 1NGCA 5GAGP 3HO1A 3SV4A 5I3UA 4CGDA 2Q3SA 1VSEA 4FZZA 2ITMA 1ASVA 3OHRA 3L4QA 4Z0UA 4FWNA 5EVZA 1VHXA 2OPPA 4A62A 1ESVA 3LALA 3O3FA 4DSFA 2P9PB 3O9RA 3VTIA 3Q7BA 3T1YK 2UU9K 3WXJA 3SZ2A 4WQ5A 3EY1A 5F1XA 2P9PA 3UIQA 1NK6A 2ZM6K 1BISA 2PZSA 1B9FA 1YVNA 2YJFA 3KJVA 1V4TA 4CBWA 4CW7B 3CC4N 4MDAA 4CEOA 3EE8A 4ID5A 2O8CB 4FJ5A 1A5VA 4FJKA 1TK0A 2UXDK 3ZSZA 5AQIA 2QI2A 4DV3K 3KLFA 3ENBA 3L2RA 5M1QA 3EL2A 3DMJA 1Q86O 4GMJB 4NLCA 2X6NA 5TKWA 3LZJA 1NGBA 1TK5A 4QS7A 2NRZA 4C1NI 3LAKA 1S6PA 3R8EA 4YOVA 3U3YA 4ZTJA 4BG9A 4JD2A 3CCEN 4JI2K 3QINA 2OTLN 4BE2A 5AQHA 4C8NA 4DQQA 3SUQA 3KK2A 4A2BA 3DJCA 4BRKA 4DFMA 3ZSOA 5SWMA 1ZBHA 5KQ8A 4DG1A 4PHTX 4ZTFA 5AQGA 1RBTA 5HROA 2BUPA 2OZMA 3A5LC 3P31A 4EIAA 4OKEA 2O8BA 5J1EA 3EYZA 4JEPA 5M1FA 1GOAA 4BRIA 4B9TA 4H8KA 3NF9A 1HQUA 3SQ1A 3KTQA 1MDUB 3SYZA 5IT9O 3T1AA 4O8KA 4DQSA 1M90O 3THWB 3MECA 4I6MB 1NKEA 3OYDA 1UA1A 4JAXA 4K25A 3CHWA 3VQ9A 5AQWA 1RBUA 4HUGA 3U3GA 4LF4K 1T05A 4PKIA 4JI0K 2BTFA 3OYFA 1BA1A 2QXLA 4W5RA 2ASMA 5SZTA 1REVA 4BR0A 4C8KA 3SPYA 3THWA 3VOVA 3TANA 4RG8A 4E89A 1Q81O 3S9HA 3ZSYA 4CGHA 3V81A 3G10A 1P90A 3THYA 4ISEA 3NF8A 4M3WA 2YHBA 1JLEA 3LM2A 3AVGA 2WOMA 3WXKA 5AQMA 5HRRA 4MO4A 3KWIA 3AO5A 5AQLA 5AQOA 1JLBA 3AA5X 4CZIA 2ZF5O 2NRXA 5CZ2A 4HTUA 3P39A 2ZD1A 4FJXA 3SAHA 1BL3A 2G8IA 3DLBA 1KD1O 3M1FA 2YKMA 3FE1A 2E1YA 4FWSA 3DRRA 4FJ9A 3D7EO 2E8AA 1VQ5N 2E6LA 3IFRA 3OY9A 3C6AA 4UY8O 3KLIA 4BDPA 3C6TA 3A5MC 1S5JA 3EKSA 3LANA 4LC9B 1RT7A 1NU0A 3UE5A 2IVPA 4AILC 1OH7A 2UUBK 3BUZB 4F3TA 3HYFA 1JKHA 3L3VA 4G9ZA 3ZT0A 3GBTA 2D5RA 1SL1A 3OYAA 2HHTA 1YJWN 1UWBA 4CCHA 4N76A 5GAHP 3ENOA 2OPRA 4YDUA 3QB0A 4B1YB 3HOTA 4DV6K 1Q9XA 3LP3A 4MO5A 3TI0A 3WNFA 3FR0A 2NRWA 3TTDA 5KTQA 2E2PA 3PSIA 4E1JA 2VWJA 4KH5A 5BRHA 4O5BA 4KFBA 1CZAN 3ISNC 4XH1A 2O8DA 1X3NA 2HVHA 2ZWHA 4CHZA 3QFPA 3CPWM 3E66A 2V7YA 1D4XA 4U7BA 5AZJA 1HKGA 3LZIA 3DOKA 4JKAA 3ZSWA 1E4GT 2HHHK 3ZETB 3VQPA 3FZFA 1NGIA 2ETJA 1XHXA 2FF6A 1BCOA 4JKGA 3FLCO 3A2FA 2H3GX 1S9EA 2BH1A 4BRCA 4CEAA 4F2SA 2DFHA 4FWKA 1K6YA 1BHLA 4JI5K 1KVCA 2D0PA 4DV7K 3CD6N 1C6VA 4DB3A 5AQXA 3IAYA 4K43A 1T6DA 5AQQA 1BDGA 3MAQA 1ZBUA 3AVJA 3R1XA 3LDNA 4CEFA 4JI3K 3MK6A 2WONA 4J8FA 3HOSA 3KK7A 3AVMA 4JHDA 4B3RK 4CJUA 1U2VA 4FWPA 2ZE2A 4IG3A 5B8HA 4B1VA 4CJRA 4B1ZA 3DI6A 5EU7A 2P9IA 1HPZA 2KZZA 4CZLA 2P9KB 4A57A 3W3DA 2AA4A 2KFNA 4BC3A 4JRQA 4V19S 3WEEA 2XO7A 3H1QA 1LWEA 1I39A 5DMRA 4BE1A 1C1BA 3SBGA 1NMDA 2KZMA 4L8RB 1K9MO 1BI4A 1T8EA 1NGAA 3MN9A 3SV3A 5J2NA 1U49A 3K0SA 5FPNA 3UKUB 4CERA 2JLEA 4BRAA 2EX3A 3AO2A 3EZWA 4AHVA 4CBXA 1VQ6N 4M3TA 1FXXA 3OJSA 2Z1GA 4W5OA 4XEIA 4B1UB 3FZMA 4Z4HA 1OH5A 1I94K 4BC5A 5HRPA 4CECA 1U2VB 5ADXH 1SKWA 3E9LA 2B5JA 1NK4A 3ZETA 5AQYA 3RRGA 4DTSA 4XIUA 2YV0X 2YI1A 3ZEUB 4FK0A 4CHNA 2DFFA 2YNHA 2FLOA 1BIUA 5CZ1A 5T7BA 2XRIA 4DSEA 3PX4A 2O8DB 3LM9A 3O80A 3ULDA 1WAFA 1X9SA 3V4IA 4BR2A 2JWLA 1NJYA 1V4SA 4B9VA 4K8XA 4DTJA 3PO4A 4EHUA 1ILYA 2HVIA 1BA0A 5M1KA 2W40A 2Q0RA 2BANA 4NB4A 4IOAL 1C0MA 4A2AA 4BQLA 4BRMA 5CYMA 3W0LA 2Z1HA 2F8TA 3VQQA 4G1QA 3V9ZA 4CK1A 1T7PA 3HP6A 3MEDA 3NE6A 4BRHA 3I8DA 1YTAA 2VGMA 3NH2A 3PIOL 3AVAA 2IC3A 2NLXA 5C12A 3HK2A 4CBUA 2XY5A 4YORA 1HPMA 3QEVA 3NH0A 4QS9A 1GLEG 3OTOK 4BVOA 3SPZA 3TTFA 4E3SA 2W41A 4LFBK 3ZX0A 4BDZA 4BC4A 2VWKA 3AA3A 4FZXC 3ZT3A 5D3GA 1C1AA 4H5TA 4MFBA 4CD1A 3T3FA 4MLEA 1U48A 1O1WA 4GV6A 1Z6RA 3NBPA 2HMIA 5CE3A 3TAFA 3MWPA 4FJJA 3MN5A 3THVA 1NNEA 4NYNA 3FFIA 4KI4A 1T44A 3PX6A 1T3VA 5AFUA 4B9UA 2GEMA 2NZTA 4BY9C 3KD1E 2UXBK 3VQAA 2P9UA 5FPDA 5CR4A 3ZSQA 4DU1A 5IWAK 3E01A 3QO9A 1WB9A 4B3OA 1C1CA 4BE0A 4UQGA 3BF1A 4BGAA 3G25A 4IEEA 3HPOA 4LSNA 4CI6A 3M8SA 3NF6A 4CJ3A 1EWRA 1RTDA 1NJZA 1CZBA 1RDWX 4JK8A 5ADXA 3JS6A 1TUUA 4NCGA 4H03B 2VG6A 4CEBA 1KTQA 3LP0A 3CM6A 4JKBA 3KK3A 5AQKA 3Q7CA 4DCHA 2O8EA 4LD0A 4DV2K 1QVFM 3L6QA 4JS5A 3QNOA 4DQIA 4FXDA 4DF8A 1ATSA 3PY8A 5AQVA 2HHSA 1NGGA 4XH5A 3SI6A 3B6PA 3CCJN 4RW6A 3H08A 1QHAA 3RR7A 3KK1A 2P9UB 3ZSRA 2BGGA 1XC3A 2P9KA 4N56A 4CFAA 1JCGA 4DV0K 1OH6A 3MN7A 3O9UA 5DK5A 3AGKA 3DWLA 1BCMA 4F8RA 1HYVA 1ITGA 1LV5A 4IKFA 4HUFA 1R59O 2NNWA 4FJ7A 2PYLA 2A5XA 2E2NA 1XUPO 1CZ9A 2FBVA 1TL3A 1EX4A 1RDBA 5LY3A 2E6MA 2IOCA 4CFBA 3OYBA 4MQ3A 2VGNA 1RT6A 3O08A 3HZ6A 4DTRA 3KD5E 4J2BA 3SMPA 4BRLA 3M3ZA 3MDQA 4YOTA 4R79A 4JI6K 2QWPA 4KB0A 1NGFA 3F2KA 3QMLA 5JVHL 4FJHA 2NUBA 3WT0A 3ZT2A 1DKGD 3D2FA 3DXKA 5H1SQ 3SK3A 5BR9A 3VEZA 5JS1A 2HHVA 4CZKA 1QS4A 3K58A 4IZ9A 3KLGA 2UXCK 3OVNA 4WFAL 4B3SK 3MX5A 4CZJA 3LPTA 3K9KA 1WUAA 1D8YA 3H45C 2EHGA 3E9PA 1J53A 4FK4A 2QWQA 4W5QA 1T6CA 3D2EB 4FJGA 4IWVA 1BU6O 5C0YA 3CF5L 3V9SA 2XY6A 5HRSA 3VQ6A 4CIFA 4HTLA 1TAUA 4PKHA 5DM6L 2GBZA 4J2AA 3F9MA 4FCYA 5AQUA 3HL8A 4CJEA 2E4LA 4WYBA 4LF9K 3A8YA 1VAZA 3HBTA 3VESA 4K41A 3DM2A 4HCCA 4NLBA 1E4FT 2Q97A 1RDDA 1ZXOA 2DFEA 4BR5A 5AQTA 3I56N 3SCXA 1NBWA 3BY5A 3O4NA 1TKZA 4CJFA 3IMXA 1WN7A 4CZGA 2QWNA 3AO3A 4DV4K 3P5JA 4HHTA 5HRNA 4JKHA 3IRXA 1VQPN 3RMCA 4JI1K 1YITN 2V51B 4Q0BA 3PX0A 2QK9A 1ZBLA 2O8FA 1NK9A 4N5SA 3TABA 3NAEA 4OPJA 1S72N 4DTXA 4OO1J 4FO0A 4AHCA 4KREA 3GG4A 1LW2A 5LL6Z 5JVGL 3TPQA 3CMAN 2OYQA 1NOZA 3M5RA 4RCHA 4BREA 3F5TA 3RVCA 2ITGA 1RDCA 3AAPA 4CF2A 3ZLJA 1ZBIA 4EP5A 2ZGYA 2HB5A 4NXMK 2VG5A 4DR2K 1XWLA 1BG3A 3M8PA 5KPRA 1IKVA 1ATRA 3VGKA 1HRHA 2IDOA 1TK8A 1GOCA 5MLCQ 3CCUN 3O9TA 2YJEA 4W5NA 3NVKA 1K8KB 1D5AA 1KFDA 1SUQA 3SMSA 3ID8A 4N41A 1EQYA 2GV9A 4PWDA 2D0OA 2IIRA 3NGYA 1BUPA 2YCHA 4JD2B 4OKJA 1VRUA 3LL3A 1KCFA 5AQPA 4BWJA 1IBKK 5AQRA 4K8ZA 3OYJA 4C8MA 5FRNA 4CJWA 1FW6A 4DSJA 1KAXA 5HBMA 3BP8A 2HNDA 4AHTA 3HP9A 3T69A 3ENHA 4CZMA 3NFAA 1SAZA 3T1HK 3LAMA 1I3AA 1S9GA 4M7XA 3NVMA 3HXMA 1NJIO 4JKDA 5GIPA 4WE1A 1FKPA 1SL0A 3V6DA 1LAWA 3OYGA 4ISGA 4WF9L 2E1ZA 3EE9A 3PIPL 3SBTA 1HJRA 3ALYA 1U6ZA 4DKWA 1XC9A 1QQCA 4DMNA 3VF6A 1BQMA 2ZGZA 3ASMA 2KLAA 5M1PA 3V1RA 4CEEA 2OPQA 3SAFA 3NCIA 2CGJA 1IV0A 3K2PA 5GADP 2G8FA 1N33K 3H3OB 3K9JA 3EO3A 1E3MA 4F9OA 3VN5A 3U9ZA 2FC0A 4Q5VA 3TWHA 2YKNA 1N32K 3HI0A 2HF3A 4M3XA 4DV5K 5KPZA 4W5TA 4C1NK 3DAWA 1FJGK 4O55A 4CJSA 2A1RA 1RFQA 1UAXA 4DQPA 4EAHD 1X9WA 1CLQA 3GL1A 3M8QA 3VGMA 4KO0A 3AVIA 2OPSA 1FKOA 3ZSVA 4BRQA 1XHZA 4CESA 1GLCG 3OS0A 5EX5A 2I5JA 1SV5A 4KBOA 3QIPA 3MWTA 3VQ5A 3H1VX 4H0PA 4KHWA 2HMPA 2HBLA 3MCAB 4B9QA 4EZ9A 4BRGA 4BACA 4U67L 4BVPA 1KSPA 1LAVA 4CJPA 1KXPA 4H4OA 3I8BA 3GOIA 5I42A 2WUSA 4BG8A 4KI6A 3AVCA 4JYAK 4I2QA 1KLNA 1VQ4N 1WSEA 1LCUA 1HNIA 2O8FB 2PAVA 3VETA 2NRVA 3C94A 5ELZA 4X65K
chains in the Genus database with same CATH topology
3OYNA 3HM9A 3ZSXA 1C0MA 3K59A 3SQ0A 2DY4A 1IO2A 1J9AA 3G0ZA 5CYMA 4PQUA 2A1SA 2Z1HA 1N5YA 4E7HA 3SUPA 2F8TA 3AA4A 4RW4A 1UA0A 2OZSA 3VQQA 4G1QA 3LWLA 4CFCA 3V9ZA 4CK1A 1EETA 1QSLA 1EXQA 1T7PA 3HP6A 4NCBA 2AJQA 1RT2A 3I0SA 3MEDA 3JYTA 1L3VA 1MU2A 4KB1A 4CJTA 3NE6A 3NGIA 4BWMA 3I8DA 1YTAA 2X78A 2O4IA 3NH2A 3OYCA 4DTNA 1RTHA 3AVAA 4CGJA 2IC3A 3QEXA 4CF8A 5KGWA 3HK2A 3AVKA 4I7FA 2XY5A 1YTUA 2BE2A 1VSJA 3QEVA 4FYDA 3NH0A 4E7KA 3D0PA 1NJWA 3MEEA 1LWFA 4M3UA 4EZ6A 4YFUA 1RNHA 2D0BA 3VQ8A 4CF0A 4FM0A 4B9LA 3VQ4A 1VSFA 4FJNA 4DTUA 3SPZA 5E41A 4E3SA 4KTZA 5JS2A 3O3GA 2FBTA 4RW8A 3V9UA 1NK0A 4CK2A 1S1XA 2YHAA 4FM1A 4BDZA 3SUNA 4B9MA 3OYMA 4PUOA 2VWKA 3V9WA 3BGRA 4Z4CA 4HUEA 3AA3A 4FZXC 3ZT3A 3DLEA 3QEWA 4KHSA 1DLOA 5D3GA 1EP4A 2IGIA 3SJJA 3K5NA 1C1AA 4MFBA 4RW7A 3DRSA 2W42A 3O3HA 4JRPA 3T3FA 1IKXA 3S3OA 4FLWA 1U48A 4QAGA 3P1GA 3WNHA 1O1WA 3NBPA 2HMIA 4CJQA 1VSDA 3TAFA 4AHRA 3NHGA 3RMAA 1KRPA 4FJJA 3OS1A 4AHUA 4I2PA 3THVA 1VRTA 4NYNA 3FFIA 4KI4A 4Z4GA 4CGFA 1JLQA 3PX6A 1NK5A 3IS9A 4FJMA 3CFOA 1IKYA 1DTQA 4CEZA 3QEPA 1X9MA 3ZCMA 2OA8A 4B9UA 2HHUA 3KD1E 5CY4A 3VQAA 1TVRA 4IFVA 5FDLA 4O4GA 3ZSQA 2LSNA 4DU1A 1VSHA 3E01A 4KV8A 4J2DA 2PY5A 3QO9A 4B3OA 1C1CA 3L3UA 3LPUA 4CF9A 4BE0A 3HO1A 4E1MA 4UQGA 4O44A 3SV4A 5I3UA 1VSKA 2D0CA 4CGDA 2Q3SA 1VSIA 3HPOA 3CG7A 1VSEA 4LSNA 3BDPA 5J2MA 4FW2A 1J5OA 1ASVA 1Z25A 2P5OA 4FZZA 4Z0UA 3M8SA 3S3MA 4DU3A 2OPPA 4Z4FA 3NF6A 1D9DA 1WAJA 3LALA 3PUFA 3O3FA 4CJ3A 1RTDA 4ZHRA 3L2VA 1QTMA 3CQ8A 3DLGA 1NJZA 4DSFA 4CHOA 3RRHA 1CZBA 1W0HA 3U6FA 3AO1A 4OPKA 4NCGA 3SZ2A 3LWMA 3EY1A 1KFSA 4FLTA 3IG1A 2VG6A 4CEBA 1KTQA 3LP0A 1NK6A 3CM6A 3UIQA 3KK3A 2HHXA 4LD0A 1BISA 2PZSA 3RR8A 1B9FA 1WLJA 3TAMA 4JS5A 3QNOA 4M42A 4B8AB 3KJVA 4DQIA 4FXDA 4DF8A 3OYIA 3VA0A 2ZQBA 3PY8A 1RBSA 1Q9YA 2HHSA 3T19A 4FLUA 1JL2A 1QHTA 4CEOA 4ID5A 3B6PA 3SI6A 4RW6A 4JLHA 3H08A 3RR7A 1A5VA 1D9FA 4FJ5A 3KK1A 4FJKA 1TK0A 3QNNA 3ZSRA 3ZSZA 2BGGA 3K5OA 4N56A 4CFAA 5FRMA 2G8HA 3KLFA 1L5UA 3L2RA 2HW3A 5DK5A 1BCMA 5C24A 3DMJA 4GMJB 4M45A 3EZ5A 2X6NA 2RF2A 4F8RA 1HYVA 4DLGA 1ITGA 3VQDA 3LZJA 1LV5A 1TK5A 1TV6A 3I0RA 3MXJA 3NF7A 4IKFA 3L2WA 4HUFA 4KHNA 4E19A 3LAKA 1IKWA 1X1PA 1RT5A 4CJ4A 4R5PA 1S6PA 3F73A 2VG7A 2PYLA 3AA2A 1HNVA 3U3YA 1CZ9A 4ZTJA 2FBVA 1TL3A 3AV9A 1ASUA 1EX4A 3QINA 4NYFA 4CHPA 4F2RA 4BE2A 2YNIA 4C8NA 4DQQA 3SUQA 1HQEA 3KK2A 3RMBA 1LW0A 1RDBA 2E6MA 2IOCA 4CFBA 3OYBA 3AO4A 4MQ3A 1NJXA 4DFMA 3ZSOA 5SWMA 1NK8A 1ZBHA 3HSTB 2BDPA 1RT6A 4E7LA 4DG1A 3CFRA 4DTRA 3VQEA 4FLVA 4ZTFA 2PYJA 3KD5E 3DLKA 3OJUA 3QERA 4J2BA 2G8UA 1RBTA 2O4GA 3P83D 2Y1JA 5HROA 4OKKA 3L8BA 2OZMA 1J54A 3K5LA 4KB0A 2XHBA 3OYLA 4FJHA 2NUBA 3ZT2A 4CGIA 3D45A 1RT4A 1WSJA 2IS3A 4OKEA 3NDKA 4E7JA 3WNEA 2KQ2A 4CJLA 5J1EA 3EYZA 4DU4A 1GOAA 3F9KA 1ZYQA 2RN2A 4B9TA 4H8KA 1LWCA 3NF9A 4OGCA 1HQUA 2XY8A 3SQ1A 3KTQA 3WNGA 3SYZA 5JS1A 3T1AA 1RT3A 2HHVA 4IG0A 4DQSA 1QSYA 4DQRA 1TKTA 3O4QA 3MXIA 1QS4A 3K58A 4B9NA 3MECA 3KLGA 1NKEA 3OYDA 4KRFA 1UA1A 3OVNA 2FBYA 2HNZA 3KIOA 4M3RA 4E0DA 3VQ9A 3LPTA 1NKCA 1RCHA 1D8YA 1JXEA 3AVLA 1RBUA 2EHGA 4HUGA 1J53A 5J2QA 3U3GA 4FK4A 4DSLA 4W5QA 1SL2A 1T05A 1G15A 4B08A 1U47A 1DTTA 1EKEA 3V1OA 3OYFA 4PA1A 4FLZA 4FJGA 4RW9A 3DRPA 4FLYA 3V9SA 4W5RA 3QETA 2XY6A 5HRSA 5SZTA 3VQ6A 1REVA 4C8KA 3SPYA 3TANA 2QKBA 1FK9A 4CEDA 4CIFA 2B6AA 4RG8A 4E89A 1SKSA 3S9HA 1BQNA 1TAUA 3RWUA 3ZSYA 4CGHA 3V81A 2GBZA 3G10A 4CHQA 4J2AA 1JL1A 4FCYA 3AVFA 3ZT4A 4C8OA 3NF8A 4M3WA 3HL8A 1IH7A 2YHBA 4EP4A 1JLEA 3AVGA 1VSLA 2WOMA 4OGEA 1JLAA 4C8LA 4QCLA 3MEGA 4LH5A 4CJEA 2E4LA 3RTVA 1U45A 2QKKA 1QSSA 1CXQA 3VQ7A 5HRRA 4CJVA 3AO5A 3DM2A 1JLBA 1R0AA 3AA5X 3KLEA 3AVBA 3CYMA 1XI1A 4KTWA 4B9SA 4HCCA 2KFZA 3QEIA 5CZ2A 1RDDA 4HTUA 4DTMA 2DFEA 4FVMA 3KLHA 2ZD1A 3S3NA 4FJXA 3K57A 2G8IA 1BL3A 2P5GA 3SCXA 3DLBA 1Y97A 3O4NA 3ZT1A 1JXBA 1TKZA 4CJFA 3QIOA 1WN7A 2YKMA 3DRRA 3AO3A 4FW1A 3P5JA 4DTPA 4FJ9A 3SQ2A 2E6LA 2JGUA 3NGZA 1JLGA 3L2UA 3OY9A 4HHTA 1B9DA 5HRNA 1RT1A 1U4BA 1IG9A 4DWIA 3KLIA 1WNSA 3C6TA 4CIEA 3HVTA 3IRXA 3QLHA 4BDPA 1S5JA 3RMCA 3HT3A 2G8VA 3DLRA 4CGGA 3LANA 3JSMA 4CEQA 1ZBFA 3TAGA 3KKSA 1RT7A 3L2QA 4Q0BA 3PX0A 1ASWA 2KW4A 2QK9A 1Q8IA 1TKDA 4OVLA 5FROA 1ZBLA 4DLEA 1NK9A 2YNFA 3OYKA 4AILC 4N5SA 4KHUA 3TABA 4ICLA 3HPGA 3NAEA 4OPJA 4DTXA 4J2EA 1RTIA 4AHCA 2D0AA 4KREA 3RMDA 4ELVA 3HYFA 4GVMA 1JKHA 3L3VA 4ID1A 4F3TA 2F8SA 4E1NA 3V9XA 4QOZB 3ZT0A 1LW2A 1S1VA 2D5RA 1SL1A 3OYAA 2HHTA 3SUOA 4JS4A 4DFKA 2OYQA 1NOZA 1UWBA 2F96A 1B92A 1WSFA 1A5XA 1RBRA 1WSHA 4B8CA 3OS2A 2Y1IA 4CCHA 4KTQA 3MXMA 4DSKA 4N76A 2GUIA 2OPRA 2ITGA 1RDCA 1Q9XA 3LP3A 1UOCA 4KAZA 4CF2A 1ZBIA 3TI0A 4EP5A 3WNFA 5KRSA 2HB5A 5KTQA 4CFDA 1GOBA 2VG5A 3V1QA 1NKBA 4F3OA 1XWLA 1TL1A 4Y1DA 4CIGA 2VWJA 3M8PA 5C25A 3SNNA 2R7YA 3QESA 4O0IA 1IKVA 4ELTA 4O5BA 4DFPA 4I9QA 1HRHA 2IDOA 1TK8A 1GOCA 2IAJA 4KFBA 4BDYA 4AH9A 1L3UA 4W5NA 1QE1A 2YNGA 3ISNC 4IDKA 4TSXA 1L3SA 1D5AA 5KRTA 2HVHA 1KFDA 1HMVA 5J2PA 4LY7A 4CHZA 1SUQA 1HYZA 1RDAA 4E7IA 1TKXA 4N41A 2GV9A 4CF1A 4HVJA 4PWDA 1C0TA 1Z26A 3LZIA 3NGYA 3DOKA 2XY7A 4CJKA 3ZSWA 3K5MA 1RTJA 4OLAA 4DF4A 4O0JA 4FJ7A 3VQPA 4OKJA 1VRUA 1KCFA 4BWJA 4CJ5A 2RPIA 2ETJA 1XHXA 4K8ZA 3OYJA 1BCOA 1JLCA 4C8MA 1S1UA 5FRNA 2DTUA 3A2FA 4CJWA 4DSJA 1S9EA 1YT3A 5HBMA 2HNDA 4OLBA 3LP2A 4AHTA 3HP9A 4KPYA 4PY5A 4CEAA 1L3TA 1BIZA 4KKOA 2DFHA 3PO5A 4F2SA 4NCAA 3NFAA 1VK0A 1K6YA 1BHLA 3LAMA 1RILA 3AVNA 1I3AA 1S9GA 1W9HA 3DYAA 1KVCA 4DS4A 2HHQA 2KTQA 4KHYA 1KVBA 1N6QA 1T03A 4FJLA 4Z4EA 2G8WA 1C6VA 3HXMA 4FK2A 1F21A 1SKRA 3IAYA 3AVHA 3C6UA 5KGXA 3MAQA 4WE1A 1FKPA 1ZBUA 3AVJA 1SL0A 3V6DA 2ATQA 1LAWA 3OYGA 4CEFA 1C0UA 2HHWA 2WONA 4KHQA 3AVMA 3HJFA 4CJUA 1HJRA 3ALYA 1HYSA 5C42A 1XC9A 1QQCA 2ZE2A 4IG3A 4DMNA 3NH1A 1WSGA 1BQMA 3DLHA 4CJRA 4H4MA 1S1TA 4M41A 3ASMA 2P51A 3DI6A 5EU7A 4GW6A 1HPZA 2KZZA 3V1RA 4CEEA 2OPQA 3NCIA 3K2PA 5KI6A 3VA3A 4YNQA 4DS5A 2G8FA 2KFNA 3M8RA 3OYEA 4JRQA 1VSMA 3TAQA 2XO7A 1LWEA 4CHYA 3VN5A 3CFPA 1I39A 4M3ZA 3OYHA 2X74A 5DMRA 4BE1A 1C1BA 2FC0A 4Q5VA 3TWHA 2YKNA 3TARA 4DSIA 4Y1CA 4M3XA 1KVAA 4L8RB 2KZMA 2Z1JA 3HPHA 1BI4A 2Z1IA 1T8EA 1A5WA 1S1WA 3B6OA 4W5TA 4FLXA 4FM2A 3SV3A 1WSIA 5J2NA 4DFJA 3PV8A 1U49A 1YVUA 2B4JA 4CERA 2QXFA 4O55A 1KLMA 4CJSA 2P1JA 2A1RA 2JLEA 1UAXA 2EX3A 3AO2A 4IBNA 4AHVA 1X9WA 4DQPA 1BGXT 5K14A 1NK7A 1CLQA 3CM5A 3M8QA 4M3TA 1FXXA 4KO0A 1U04A 3AVIA 2OPSA 1RBVA 2Z1GA 1FKOA 4N47A 3ZSVA 4W5OA 3OJSA 3HVRA 3TAEA 4CESA 1XHZA 4ELUA 3OS0A 3KKRA 2RKIA 4Z4HA 4F4KA 4I9LA 4OJRA 5HRPA 4CECA 4Z4IA 3LP1A 4IFYA 3DOLA 4M3YA 2I5JA 1SKWA 1SV5A 3QIPA 2X6SA 4LH4A 3SQ4A 3VQ5A 5HP1A 2B5JA 1TAQA 1NK4A 4FJ8A 4KHWA 2G8KA 4HCBA 2FBXA 3RRGA 4EZ9A 1BI4B 4DTSA 1S6QA 2YV0X 4XIUA 4BACA 1KSPA 4FJIA 1LAVA 2HNYA 4CJPA 4FK0A 4CHNA 3TAPA 2DFFA 4H4OA 2YNHA 4DTOA 5I42A 5CYQA 3C95A 3ITHA 1TGOA 3PX4A 1BIUA 5CZ1A 3AVCA 2XRIA 5T7BA 4DSEA 4KI6A 4I2QA 5HLFA 3ULDA 1KLNA 1WAFA 1X9SA 3V4IA 4CE9A 1WSEA 4LSLA 1NJYA 1JLFA 4B9VA 4K8XA 3VQCA 4DTJA 3PO4A 3TR8A 2HVIA 1HNIA 4CK3A 3VQBA 1CXUA 3LDSA 4FZYA 1NOYA 4AHSA 3C94A 2BANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYN A;  3HM9 A;  3ZSX A;  1C0M A;  3K59 A;  3SQ0 A;  2DY4 A;  1IO2 A;  1J9A A;  3G0Z A;  5CYM A;  4PQU A;  2A1S A;  2Z1H A;  1N5Y A;  4E7H A;  3SUP A;  2F8T A;  3AA4 A;  4RW4 A;  1UA0 A;  2OZS A;  3VQQ A;  4G1Q A;  3LWL A;  4CFC A;  3V9Z A;  4CK1 A;  1EET A;  1QSL A;  1EXQ A;  1T7P A;  3HP6 A;  4NCB A;  2AJQ A;  1RT2 A;  3I0S A;  3MED A;  3JYT A;  1L3V A;  1MU2 A;  4KB1 A;  4CJT A;  3NE6 A;  3NGI A;  4BWM A;  3I8D A;  1YTA A;  2X78 A;  2O4I A;  3NH2 A;  3OYC A;  4DTN A;  1RTH A;  3AVA A;  4CGJ A;  2IC3 A;  3QEX A;  4CF8 A;  5KGW A;  3HK2 A;  3AVK A;  4I7F A;  2XY5 A;  1YTU A;  2BE2 A;  1VSJ A;  3QEV A;  4FYD A;  3NH0 A;  4E7K A;  3D0P A;  1NJW A;  3MEE A;  1LWF A;  4M3U A;  4EZ6 A;  4YFU A;  1RNH A;  2D0B A;  3VQ8 A;  4CF0 A;  4FM0 A;  4B9L A;  3VQ4 A;  1VSF A;  4FJN A;  4DTU A;  3SPZ A;  5E41 A;  4E3S A;  4KTZ A;  5JS2 A;  3O3G A;  2FBT A;  4RW8 A;  3V9U A;  1NK0 A;  4CK2 A;  1S1X A;  2YHA A;  4FM1 A;  4BDZ A;  3SUN A;  4B9M A;  3OYM A;  4PUO A;  2VWK A;  3V9W A;  3BGR A;  4Z4C A;  4HUE A;  3AA3 A;  4FZX C;  3ZT3 A;  3DLE A;  3QEW A;  4KHS A;  1DLO A;  5D3G A;  1EP4 A;  2IGI A;  3SJJ A;  3K5N A;  1C1A A;  4MFB A;  4RW7 A;  3DRS A;  2W42 A;  3O3H A;  4JRP A;  3T3F A;  1IKX A;  3S3O A;  4FLW A;  1U48 A;  4QAG A;  3P1G A;  3WNH A;  1O1W A;  3NBP A;  2HMI A;  4CJQ A;  1VSD A;  3TAF A;  4AHR A;  3NHG A;  3RMA A;  1KRP A;  4FJJ A;  3OS1 A;  4AHU A;  4I2P A;  3THV A;  1VRT A;  4NYN A;  3FFI A;  4KI4 A;  4Z4G A;  4CGF A;  1JLQ A;  3PX6 A;  1NK5 A;  3IS9 A;  4FJM A;  3CFO A;  1IKY A;  1DTQ A;  4CEZ A;  3QEP A;  1X9M A;  3ZCM A;  2OA8 A;  4B9U A;  2HHU A;  3KD1 E;  5CY4 A;  3VQA A;  1TVR A;  4IFV A;  5FDL A;  4O4G A;  3ZSQ A;  2LSN A;  4DU1 A;  1VSH A;  3E01 A;  4KV8 A;  4J2D A;  2PY5 A;  3QO9 A;  4B3O A;  1C1C A;  3L3U A;  3LPU A;  4CF9 A;  4BE0 A;  3HO1 A;  4E1M A;  4UQG A;  4O44 A;  3SV4 A;  5I3U A;  1VSK A;  2D0C A;  4CGD A;  2Q3S A;  1VSI A;  3HPO A;  3CG7 A;  1VSE A;  4LSN A;  3BDP A;  5J2M A;  4FW2 A;  1J5O A;  1ASV A;  1Z25 A;  2P5O A;  4FZZ A;  4Z0U A;  3M8S A;  3S3M A;  4DU3 A;  2OPP A;  4Z4F A;  3NF6 A;  1D9D A;  1WAJ A;  3LAL A;  3PUF A;  3O3F A;  4CJ3 A;  1RTD A;  4ZHR A;  3L2V A;  1QTM A;  3CQ8 A;  3DLG A;  1NJZ A;  4DSF A;  4CHO A;  3RRH A;  1CZB A;  1W0H A;  3U6F A;  3AO1 A;  4OPK A;  4NCG A;  3SZ2 A;  3LWM A;  3EY1 A;  1KFS A;  4FLT A;  3IG1 A;  2VG6 A;  4CEB A;  1KTQ A;  3LP0 A;  1NK6 A;  3CM6 A;  3UIQ A;  3KK3 A;  2HHX A;  4LD0 A;  1BIS A;  2PZS A;  3RR8 A;  1B9F A;  1WLJ A;  3TAM A;  4JS5 A;  3QNO A;  4M42 A;  4B8A B;  3KJV A;  4DQI A;  4FXD A;  4DF8 A;  3OYI A;  3VA0 A;  2ZQB A;  3PY8 A;  1RBS A;  1Q9Y A;  2HHS A;  3T19 A;  4FLU A;  1JL2 A;  1QHT A;  4CEO A;  4ID5 A;  3B6P A;  3SI6 A;  4RW6 A;  4JLH A;  3H08 A;  3RR7 A;  1A5V A;  1D9F A;  4FJ5 A;  3KK1 A;  4FJK A;  1TK0 A;  3QNN A;  3ZSR A;  3ZSZ A;  2BGG A;  3K5O A;  4N56 A;  4CFA A;  5FRM A;  2G8H A;  3KLF A;  1L5U A;  3L2R A;  2HW3 A;  5DK5 A;  1BCM A;  5C24 A;  3DMJ A;  4GMJ B;  4M45 A;  3EZ5 A;  2X6N A;  2RF2 A;  4F8R A;  1HYV A;  4DLG A;  1ITG A;  3VQD A;  3LZJ A;  1LV5 A;  1TK5 A;  1TV6 A;  3I0R A;  3MXJ A;  3NF7 A;  4IKF A;  3L2W A;  4HUF A;  4KHN A;  4E19 A;  3LAK A;  1IKW A;  1X1P A;  1RT5 A;  4CJ4 A;  4R5P A;  1S6P A;  3F73 A;  2VG7 A;  2PYL A;  3AA2 A;  1HNV A;  3U3Y A;  1CZ9 A;  4ZTJ A;  2FBV A;  1TL3 A;  3AV9 A;  1ASU A;  1EX4 A;  3QIN A;  4NYF A;  4CHP A;  4F2R A;  4BE2 A;  2YNI A;  4C8N A;  4DQQ A;  3SUQ A;  1HQE A;  3KK2 A;  3RMB A;  1LW0 A;  1RDB A;  2E6M A;  2IOC A;  4CFB A;  3OYB A;  3AO4 A;  4MQ3 A;  1NJX A;  4DFM A;  3ZSO A;  5SWM A;  1NK8 A;  1ZBH A;  3HST B;  2BDP A;  1RT6 A;  4E7L A;  4DG1 A;  3CFR A;  4DTR A;  3VQE A;  4FLV A;  4ZTF A;  2PYJ A;  3KD5 E;  3DLK A;  3OJU A;  3QER A;  4J2B A;  2G8U A;  1RBT A;  2O4G A;  3P83 D;  2Y1J A;  5HRO A;  4OKK A;  3L8B A;  2OZM A;  1J54 A;  3K5L A;  4KB0 A;  2XHB A;  3OYL A;  4FJH A;  2NUB A;  3ZT2 A;  4CGI A;  3D45 A;  1RT4 A;  1WSJ A;  2IS3 A;  4OKE A;  3NDK A;  4E7J A;  3WNE A;  2KQ2 A;  4CJL A;  5J1E A;  3EYZ A;  4DU4 A;  1GOA A;  3F9K A;  1ZYQ A;  2RN2 A;  4B9T A;  4H8K A;  1LWC A;  3NF9 A;  4OGC A;  1HQU A;  2XY8 A;  3SQ1 A;  3KTQ A;  3WNG A;  3SYZ A;  5JS1 A;  3T1A A;  1RT3 A;  2HHV A;  4IG0 A;  4DQS A;  1QSY A;  4DQR A;  1TKT A;  3O4Q A;  3MXI A;  1QS4 A;  3K58 A;  4B9N A;  3MEC A;  3KLG A;  1NKE A;  3OYD A;  4KRF A;  1UA1 A;  3OVN A;  2FBY A;  2HNZ A;  3KIO A;  4M3R A;  4E0D A;  3VQ9 A;  3LPT A;  1NKC A;  1RCH A;  1D8Y A;  1JXE A;  3AVL A;  1RBU A;  2EHG A;  4HUG A;  1J53 A;  5J2Q A;  3U3G A;  4FK4 A;  4DSL A;  4W5Q A;  1SL2 A;  1T05 A;  1G15 A;  4B08 A;  1U47 A;  1DTT A;  1EKE A;  3V1O A;  3OYF A;  4PA1 A;  4FLZ A;  4FJG A;  4RW9 A;  3DRP A;  4FLY A;  3V9S A;  4W5R A;  3QET A;  2XY6 A;  5HRS A;  5SZT A;  3VQ6 A;  1REV A;  4C8K A;  3SPY A;  3TAN A;  2QKB A;  1FK9 A;  4CED A;  4CIF A;  2B6A A;  4RG8 A;  4E89 A;  1SKS A;  3S9H A;  1BQN A;  1TAU A;  3RWU A;  3ZSY A;  4CGH A;  3V81 A;  2GBZ A;  3G10 A;  4CHQ A;  4J2A A;  1JL1 A;  4FCY A;  3AVF A;  3ZT4 A;  4C8O A;  3NF8 A;  4M3W A;  3HL8 A;  1IH7 A;  2YHB A;  4EP4 A;  1JLE A;  3AVG A;  1VSL A;  2WOM A;  4OGE A;  1JLA A;  4C8L A;  4QCL A;  3MEG A;  4LH5 A;  4CJE A;  2E4L A;  3RTV A;  1U45 A;  2QKK A;  1QSS A;  1CXQ A;  3VQ7 A;  5HRR A;  4CJV A;  3AO5 A;  3DM2 A;  1JLB A;  1R0A A;  3AA5 X;  3KLE A;  3AVB A;  3CYM A;  1XI1 A;  4KTW A;  4B9S A;  4HCC A;  2KFZ A;  3QEI A;  5CZ2 A;  1RDD A;  4HTU A;  4DTM A;  2DFE A;  4FVM A;  3KLH A;  2ZD1 A;  3S3N A;  4FJX A;  3K57 A;  2G8I A;  1BL3 A;  2P5G A;  3SCX A;  3DLB A;  1Y97 A;  3O4N A;  3ZT1 A;  1JXB A;  1TKZ A;  4CJF A;  3QIO A;  1WN7 A;  2YKM A;  3DRR A;  3AO3 A;  4FW1 A;  3P5J A;  4DTP A;  4FJ9 A;  3SQ2 A;  2E6L A;  2JGU A;  3NGZ A;  1JLG A;  3L2U A;  3OY9 A;  4HHT A;  1B9D A;  5HRN A;  1RT1 A;  1U4B A;  1IG9 A;  4DWI A;  3KLI A;  1WNS A;  3C6T A;  4CIE A;  3HVT A;  3IRX A;  3QLH A;  4BDP A;  1S5J A;  3RMC A;  3HT3 A;  2G8V A;  3DLR A;  4CGG A;  3LAN A;  3JSM A;  4CEQ A;  1ZBF A;  3TAG A;  3KKS A;  1RT7 A;  3L2Q A;  4Q0B A;  3PX0 A;  1ASW A;  2KW4 A;  2QK9 A;  1Q8I A;  1TKD A;  4OVL A;  5FRO A;  1ZBL A;  4DLE A;  1NK9 A;  2YNF A;  3OYK A;  4AIL C;  4N5S A;  4KHU A;  3TAB A;  4ICL A;  3HPG A;  3NAE A;  4OPJ A;  4DTX A;  4J2E A;  1RTI A;  4AHC A;  2D0A A;  4KRE A;  3RMD A;  4ELV A;  3HYF A;  4GVM A;  1JKH A;  3L3V A;  4ID1 A;  4F3T A;  2F8S A;  4E1N A;  3V9X A;  4QOZ B;  3ZT0 A;  1LW2 A;  1S1V A;  2D5R A;  1SL1 A;  3OYA A;  2HHT A;  3SUO A;  4JS4 A;  4DFK A;  2OYQ A;  1NOZ A;  1UWB A;  2F96 A;  1B92 A;  1WSF A;  1A5X A;  1RBR A;  1WSH A;  4B8C A;  3OS2 A;  2Y1I A;  4CCH A;  4KTQ A;  3MXM A;  4DSK A;  4N76 A;  2GUI A;  2OPR A;  2ITG A;  1RDC A;  1Q9X A;  3LP3 A;  1UOC A;  4KAZ A;  4CF2 A;  1ZBI A;  3TI0 A;  4EP5 A;  3WNF A;  5KRS A;  2HB5 A;  5KTQ A;  4CFD A;  1GOB A;  2VG5 A;  3V1Q A;  1NKB A;  4F3O A;  1XWL A;  1TL1 A;  4Y1D A;  4CIG A;  2VWJ A;  3M8P A;  5C25 A;  3SNN A;  2R7Y A;  3QES A;  4O0I A;  1IKV A;  4ELT A;  4O5B A;  4DFP A;  4I9Q A;  1HRH A;  2IDO A;  1TK8 A;  1GOC A;  2IAJ A;  4KFB A;  4BDY A;  4AH9 A;  1L3U A;  4W5N A;  1QE1 A;  2YNG A;  3ISN C;  4IDK A;  4TSX A;  1L3S A;  1D5A A;  5KRT A;  2HVH A;  1KFD A;  1HMV A;  5J2P A;  4LY7 A;  4CHZ A;  1SUQ A;  1HYZ A;  1RDA A;  4E7I A;  1TKX A;  4N41 A;  2GV9 A;  4CF1 A;  4HVJ A;  4PWD A;  1C0T A;  1Z26 A;  3LZI A;  3NGY A;  3DOK A;  2XY7 A;  4CJK A;  3ZSW A;  3K5M A;  1RTJ A;  4OLA A;  4DF4 A;  4O0J A;  4FJ7 A;  3VQP A;  4OKJ A;  1VRU A;  1KCF A;  4BWJ A;  4CJ5 A;  2RPI A;  2ETJ A;  1XHX A;  4K8Z A;  3OYJ A;  1BCO A;  1JLC A;  4C8M A;  1S1U A;  5FRN A;  2DTU A;  3A2F A;  4CJW A;  4DSJ A;  1S9E A;  1YT3 A;  5HBM A;  2HND A;  4OLB A;  3LP2 A;  4AHT A;  3HP9 A;  4KPY A;  4PY5 A;  4CEA A;  1L3T A;  1BIZ A;  4KKO A;  2DFH A;  3PO5 A;  4F2S A;  4NCA A;  3NFA A;  1VK0 A;  1K6Y A;  1BHL A;  3LAM A;  1RIL A;  3AVN A;  1I3A A;  1S9G A;  1W9H A;  3DYA A;  1KVC A;  4DS4 A;  2HHQ A;  2KTQ A;  4KHY A;  1KVB A;  1N6Q A;  1T03 A;  4FJL A;  4Z4E A;  2G8W A;  1C6V A;  3HXM A;  4FK2 A;  1F21 A;  1SKR A;  3IAY A;  3AVH A;  3C6U A;  5KGX A;  3MAQ A;  4WE1 A;  1FKP A;  1ZBU A;  3AVJ A;  1SL0 A;  3V6D A;  2ATQ A;  1LAW A;  3OYG A;  4CEF A;  1C0U A;  2HHW A;  2WON A;  4KHQ A;  3AVM A;  3HJF A;  4CJU A;  1HJR A;  3ALY A;  1HYS A;  5C42 A;  1XC9 A;  1QQC A;  2ZE2 A;  4IG3 A;  4DMN A;  3NH1 A;  1WSG A;  1BQM A;  3DLH A;  4CJR A;  4H4M A;  1S1T A;  4M41 A;  3ASM A;  2P51 A;  3DI6 A;  5EU7 A;  4GW6 A;  1HPZ A;  2KZZ A;  3V1R A;  4CEE A;  2OPQ A;  3NCI A;  3K2P A;  5KI6 A;  3VA3 A;  4YNQ A;  4DS5 A;  2G8F A;  2KFN A;  3M8R A;  3OYE A;  4JRQ A;  1VSM A;  3TAQ A;  2XO7 A;  1LWE A;  4CHY A;  3VN5 A;  3CFP A;  1I39 A;  4M3Z A;  3OYH A;  2X74 A;  5DMR A;  4BE1 A;  1C1B A;  2FC0 A;  4Q5V A;  3TWH A;  2YKN A;  3TAR A;  4DSI A;  4Y1C A;  4M3X A;  1KVA A;  4L8R B;  2KZM A;  2Z1J A;  3HPH A;  1BI4 A;  2Z1I A;  1T8E A;  1A5W A;  1S1W A;  3B6O A;  4W5T A;  4FLX A;  4FM2 A;  3SV3 A;  1WSI A;  5J2N A;  4DFJ A;  3PV8 A;  1U49 A;  1YVU A;  2B4J A;  4CER A;  2QXF A;  4O55 A;  1KLM A;  4CJS A;  2P1J A;  2A1R A;  2JLE A;  1UAX A;  2EX3 A;  3AO2 A;  4IBN A;  4AHV A;  1X9W A;  4DQP A;  1BGX T;  5K14 A;  1NK7 A;  1CLQ A;  3CM5 A;  3M8Q A;  4M3T A;  1FXX A;  4KO0 A;  1U04 A;  3AVI A;  2OPS A;  1RBV A;  2Z1G A;  1FKO A;  4N47 A;  3ZSV A;  4W5O A;  3OJS A;  3HVR A;  3TAE A;  4CES A;  1XHZ A;  4ELU A;  3OS0 A;  3KKR A;  2RKI A;  4Z4H A;  4F4K A;  4I9L A;  4OJR A;  5HRP A;  4CEC A;  4Z4I A;  3LP1 A;  4IFY A;  3DOL A;  4M3Y A;  2I5J A;  1SKW A;  1SV5 A;  3QIP A;  2X6S A;  4LH4 A;  3SQ4 A;  3VQ5 A;  5HP1 A;  2B5J A;  1TAQ A;  1NK4 A;  4FJ8 A;  4KHW A;  2G8K A;  4HCB A;  2FBX A;  3RRG A;  4EZ9 A;  1BI4 B;  4DTS A;  1S6Q A;  2YV0 X;  4XIU A;  4BAC A;  1KSP A;  4FJI A;  1LAV A;  2HNY A;  4CJP A;  4FK0 A;  4CHN A;  3TAP A;  2DFF A;  4H4O A;  2YNH A;  4DTO A;  5I42 A;  5CYQ A;  3C95 A;  3ITH A;  1TGO A;  3PX4 A;  1BIU A;  5CZ1 A;  3AVC A;  2XRI A;  5T7B A;  4DSE A;  4KI6 A;  4I2Q A;  5HLF A;  3ULD A;  1KLN A;  1WAF A;  1X9S A;  3V4I A;  4CE9 A;  1WSE A;  4LSL A;  1NJY A;  1JLF A;  4B9V A;  4K8X A;  3VQC A;  4DTJ A;  3PO4 A;  3TR8 A;  2HVI A;  1HNI A;  4CK3 A;  3VQB A;  1CXU A;  3LDS A;  4FZY A;  1NOY A;  4AHS A;  3C94 A;  2BAN A; 
#chains in the Genus database with same CATH topology
 1ZC6 A;  3SQ0 A;  3O1B A;  2DY4 A;  3G0Z A;  3ULE A;  4FPB A;  1DT9 A;  4PQU A;  4EFH A;  3LWL A;  2J4R A;  4XH4 A;  4CFC A;  3CCV N;  1EET A;  2A3Z A;  1GLD G;  3FZL A;  3I0S A;  3JYT A;  1L3V A;  4KB1 A;  1MU2 A;  3SJH A;  1W97 L;  4CJT A;  3O8M A;  1XMO K;  2O8E B;  3TSP A;  5KPT A;  4B3M K;  1G99 A;  3AVK A;  4FWM A;  5AQZ A;  3PLA A;  2HST A;  3D0P A;  1NJW A;  2YX6 A;  5TKY A;  3G71 N;  3I33 A;  3S41 A;  4M3U A;  4YY3 K;  1H1V A;  4B9L A;  2D0B A;  3VQ8 A;  4CF0 A;  3VQ4 A;  1VSF A;  4FJN A;  1NK0 A;  1HNW K;  3O3G A;  3IUC A;  4BR9 A;  4JHD B;  3PSF A;  1S1X A;  3SUN A;  4B9M A;  3OYM A;  1S22 A;  3FZH A;  2PBD A;  4ILH A;  3DLE A;  3C7N A;  5M1O A;  3K5N A;  4Y0W A;  3DRS A;  3A5N C;  3O3H A;  4JRP A;  3S3O A;  1EO1 A;  3WNH A;  1HR0 K;  4AM7 A;  1K8A O;  4AHR A;  1KRP A;  1VQ8 N;  1M1K O;  5HOO A;  1J6Z A;  4FL9 A;  2HBK A;  3QEP A;  1X9M A;  4CEZ A;  2OA8 A;  5CY4 A;  4BR7 A;  4IFV A;  5FDL A;  3U8X A;  1RGI A;  2LSN A;  3FGU A;  2PY5 A;  3RSE B;  3FZK A;  4X62 K;  3L3U A;  4CF9 A;  1K73 O;  3N4Q A;  4JN4 A;  4E1M A;  4O44 A;  3U4L A;  1W2B M;  1VSK A;  4IJN A;  1NG9 A;  1XNR K;  3P38 A;  1VSI A;  3CG7 A;  3BDP A;  5J2M A;  4FW2 A;  4JK7 A;  1Z25 A;  2P5O A;  3S3M A;  4CJ7 A;  5JLF A;  4DU3 A;  4Z4F A;  3IDH A;  1WAJ A;  3PUF A;  2QTD A;  3CQ8 A;  3DLG A;  4GKJ K;  3VER A;  4DV1 K;  3VMF B;  3JAM O;  3LWM A;  1GLF O;  4FLT A;  3CC7 N;  1MWM A;  1SS6 A;  4PL8 A;  2HHX A;  4IFE A;  2PFU A;  3A5O C;  1QQO A;  3KWG A;  3VA0 A;  2ZQB A;  2A40 A;  1RBS A;  1Q9Y A;  2QA4 N;  4FLU A;  1QHT A;  5KQD A;  3AAR A;  1TYQ B;  4MDB A;  4JLH A;  1D9F A;  4YDU C;  1VQK N;  3QNN A;  3MN6 A;  4BC2 A;  3CET A;  2P9N A;  3EKU A;  5FRM A;  4DR5 K;  3J7Z O;  3G6E N;  4ILJ A;  3J8A A;  2NRT A;  5C24 A;  4M45 A;  3CME N;  4BRD A;  3MCP A;  1TV6 A;  3MXJ A;  4YOU A;  3NF7 A;  4KHN A;  5F0X A;  1IKW A;  4R5P A;  2VG7 A;  1HNV A;  1X3M A;  4DR3 K;  3N4P A;  4A61 A;  5BRE A;  3C7N B;  3CCM N;  1HJO A;  1ASU A;  4F2R A;  2YNI A;  3OBW A;  1DGK N;  1HQE A;  2E2O A;  3RMB A;  5C10 A;  4X64 K;  3C65 A;  5A2Q O;  1NJX A;  1NK8 A;  1Q82 O;  4O5F A;  4OPA A;  5GAE P;  2BDP A;  4E7L A;  3CFR A;  3VQE A;  4KH6 A;  4KHP K;  3OJU A;  2O4G A;  2Y1J A;  3BEX A;  2XHB A;  4B1X B;  3OYL A;  1RT4 A;  2IS3 A;  1WSJ A;  3D45 A;  4CJL A;  4DU4 A;  1VQM N;  3F9K A;  4IEI A;  2VQF K;  1LWC A;  4ILG B;  3UKU A;  3EN9 A;  2W6K A;  4LF5 K;  3WNG A;  5AFU H;  1QSY A;  4DQR A;  1TKT A;  1VQ7 N;  3O4Q A;  5FPE A;  3SAG A;  4B9N A;  4AM6 A;  5AQF A;  4A5B A;  4KRF A;  2FBY A;  3ULE B;  4E0D A;  1NKC A;  1RCH A;  4IO9 L;  5J2Q A;  2Q2R A;  1N8R O;  1SL2 A;  4DSL A;  4B08 A;  4CD3 A;  1U47 A;  1EKE A;  4PA1 A;  2VWB A;  2P9I B;  2QWR A;  1FK9 A;  4CED A;  2B6A A;  4M7Y A;  1BQN A;  1C0G A;  2FSJ A;  1LOT B;  3AVF A;  3ZT4 A;  1YI2 N;  1IH7 A;  5JIC A;  1VSL A;  4AQY K;  1GLB G;  4OGE A;  1JLA A;  4C8L A;  4QCL A;  2O8B B;  4LH5 A;  1QSS A;  3VQ7 A;  4JKE A;  1IJJ A;  4B9S A;  2E5L K;  1VQ9 N;  1VQL N;  3R3L A;  5LJW A;  2NRH A;  3KLH A;  4FVM A;  4GKK K;  5C15 A;  3O4W A;  1Y97 A;  1JXB A;  4RWT A;  3VEX A;  3QIO A;  1P8Z A;  1YJN N;  1QZ6 A;  2ZJP L;  1OVQ A;  2FXU A;  4DTP A;  4FWO A;  3NGZ A;  1JLG A;  1B9D A;  1RT1 A;  1U4B A;  2HHQ A;  4CIE A;  1WNS A;  2CH6 A;  5LMN K;  2IVO A;  4CGG A;  3E9O A;  4JKF A;  1ZBF A;  3L2Q A;  4FWR A;  4YOW A;  4FOI A;  4OVL A;  1KC8 O;  4DLE A;  4GY2 B;  4BGB A;  2YNF A;  3OYK A;  4KHU A;  4ICL A;  4J2E A;  2D0A A;  3RMD A;  4ELV A;  4ID1 A;  1JCF A;  4E1N A;  3V9X A;  1S1V A;  4AF1 A;  4H0T B;  3SUO A;  5HL7 L;  1C0F A;  2F96 A;  1B92 A;  1WSF A;  1X9J A;  3P4I A;  4KTQ A;  3OS2 A;  2Y1I A;  4FWQ A;  2GUI A;  3QBW A;  3RSE A;  3ATV A;  4KAZ A;  2RE2 A;  2HOE A;  5BPM A;  3UKR B;  5KRS A;  1NKB A;  3SNN A;  4Y1D A;  5C25 A;  5EY4 A;  1HLU A;  2R7Y A;  3QES A;  4O0I A;  4DFP A;  2FSN A;  4I9Q A;  2IAJ A;  3VEO A;  3VEV A;  1L3U A;  1QE1 A;  1L3S A;  4WQ4 C;  3D6R A;  1HMV A;  4LY7 A;  1HYZ A;  4HVJ A;  1C0T A;  3CJA A;  2XY7 A;  4DHY A;  3VEW A;  3K5M A;  1GLL O;  1RTJ A;  4WQ4 A;  4OLA A;  2QM1 A;  4DF4 A;  1NGE A;  5JMV A;  4CJ5 A;  4KH4 A;  2ASP A;  2HBJ A;  2DTU A;  4LF6 K;  1YT3 A;  4OLB A;  3LP2 A;  3MMV A;  4NCA A;  1ZBS A;  1VK0 A;  4Z94 A;  1RIL A;  1NMN A;  3DYA A;  3C0B A;  4DQ8 A;  4EHT A;  2KTQ A;  3THY B;  4FJL A;  2YHY A;  4HWI A;  1IBL K;  4Z4E A;  2G8W A;  4H0V B;  4FK2 A;  1F21 A;  4H5V A;  5BRD A;  4LFC K;  1C0U A;  4KHQ A;  5C42 A;  5LJV A;  2F7T A;  3DLH A;  2F9T A;  1S1T A;  2WTU A;  1TUY A;  1BO5 O;  5C2F A;  5KI6 A;  3VA3 A;  4DS5 A;  4YNQ A;  3CJB A;  3M8R A;  3M6G A;  1VSM A;  4DUY K;  4I6M A;  4DR4 K;  4CHY A;  3B8A X;  5AQN A;  2ZJQ L;  4M3Z A;  2X74 A;  4JI8 K;  4GVE A;  3TAR A;  5LMU K;  2GWK A;  4IO8 A;  3H3N O;  1KVA A;  3CQX A;  3HRG A;  3LDO A;  1A5W A;  1S1W A;  2E20 A;  3B6O A;  1N34 K;  4FLX A;  5BPN A;  1WSI A;  3AAQ A;  4DFJ A;  3O5B A;  3PV8 A;  1YVU A;  2B4J A;  2HF4 A;  4IBN A;  1BGX T;  5K14 A;  1NK7 A;  1BWF O;  1NWK A;  1RBV A;  4N47 A;  3HVR A;  3TAE A;  4ELU A;  2QW9 A;  4JNE A;  3KKR A;  4JKG B;  4PKG A;  2RKI A;  3LDQ A;  4I9L A;  4OJR A;  4M3Y A;  2X6S A;  4LH4 A;  5AZI B;  4DR1 K;  1TAQ A;  2Q1N A;  4FJ8 A;  2FBX A;  3WXL A;  4JI7 K;  3J80 O;  5AR0 A;  4H5R A;  3CQY A;  3TAP A;  1S3X A;  3CJ7 A;  3MX2 A;  1YF5 L;  1TGO A;  1WBB A;  1N36 K;  2A41 A;  3NMU A;  3VGL A;  1RDU A;  4CE9 A;  4LSL A;  1JLF A;  3VQC A;  3TR8 A;  1CXU A;  4FZY A;  3HM9 A;  4BRF A;  2O8C A;  5F2R A;  1IO2 A;  1J9A A;  4CZH A;  1MA9 B;  2IVN A;  1XMQ K;  2KHO A;  2WC9 A;  1YAG A;  3SUP A;  2QWM A;  1XNQ K;  1IG8 A;  3AA4 A;  2OZS A;  5BPL A;  1MWK A;  1EXQ A;  3NGI A;  2X78 A;  3ZX2 A;  4QS8 A;  2FSK A;  5KGW A;  3R9P A;  1HKB A;  4I7F A;  1YTU A;  2BE2 A;  1VSJ A;  1W7A A;  4FYD A;  3OBY A;  3MEE A;  1LWF A;  3BF3 A;  1Q18 A;  4EZ6 A;  4FM0 A;  1RNH A;  2ASO A;  3VEY A;  4K42 A;  4CK2 A;  4IXC A;  3E1Y A;  3BGR A;  4WQ5 C;  1YUW A;  2Q0U A;  4H0X B;  2IGI A;  3SJJ A;  1YIJ N;  1IKX A;  5EXW A;  1HNZ K;  3DXK B;  4CJQ A;  5AZI A;  3ZX3 A;  4FPA A;  4I2P A;  4Z4G A;  3EEQ A;  4CGF A;  1JLQ A;  5FLX O;  4FJM A;  3FFK B;  3CFO A;  1IKY A;  2HHU A;  3G4S N;  3O9Q A;  2WFB A;  3DXM A;  2WBN A;  4J2D A;  1HUX A;  1XQS C;  3LPU A;  3C6H A;  2D0C A;  3L4I A;  2KKZ A;  1J5O A;  1HKC A;  1D9D A;  1QTM A;  4ZHR A;  3L2V A;  4CHO A;  3RRH A;  1W0H A;  3U6F A;  1QZ5 A;  3AO1 A;  3TSQ A;  4OPK A;  1KFS A;  3IG1 A;  4WFB L;  3CPE A;  3GDQ A;  1KAZ A;  4H0Y B;  2QWL A;  1EWQ A;  3RR8 A;  1WLJ A;  3TAM A;  4M42 A;  4B8A B;  5C2D A;  3OYI A;  3T7Z A;  2F4V K;  3T19 A;  1JL2 A;  3CC2 N;  1NGH A;  2DPN A;  3DXM B;  1JJ2 M;  1WBD A;  3K5O A;  2G8H A;  1L5U A;  2HW3 A;  3O9S A;  3UB5 A;  3EZ5 A;  2RF2 A;  4DLG A;  3VQD A;  3WXI A;  3I0R A;  3L2W A;  2E2Q A;  4E19 A;  4CZE A;  1X1P A;  1RT5 A;  4JK9 A;  4CJ4 A;  3F73 A;  3OW2 M;  3AA2 A;  2VCP A;  3TSU A;  3AV9 A;  3O6W A;  4NYF A;  4CHP A;  1GLJ O;  2Q31 A;  1LW0 A;  4H0O A;  3AO4 A;  2QEX N;  4K0K K;  4CVN E;  3HST B;  4FLV A;  2PYJ A;  3DLK A;  3QER A;  3QBX A;  1J5E K;  2G8U A;  3P83 D;  4OKK A;  3L8B A;  5GIO A;  1J54 A;  3K5L A;  3ID6 A;  2E88 A;  4CGI A;  4E7J A;  2F8S A;  3NDK A;  3WNE A;  2KQ2 A;  1ZYQ A;  3UKR A;  2RN2 A;  4OGC A;  2XY8 A;  2GUP A;  1RT3 A;  4IG0 A;  4CZF A;  3MXI A;  5AQJ A;  5GIN A;  2HNZ A;  3KIO A;  4M3R A;  3D2E A;  3CJ9 A;  3H46 O;  3HSC A;  4IDH A;  1JXE A;  3AVL A;  1G15 A;  1DTT A;  3V1O A;  4FLZ A;  2P9N B;  4RW9 A;  3DRP A;  4FLY A;  2JWK A;  3QET A;  3J7Y P;  3VF2 A;  2QKB A;  4WCE L;  3U9D A;  4JI4 K;  1Z05 A;  1SKS A;  3RWU A;  2OTJ N;  4FVU A;  3LDL A;  4CHQ A;  1JL1 A;  4JKC A;  4MLH A;  2CH5 A;  4C8O A;  4EP4 A;  3D2F B;  3THX B;  4JV5 K;  3O1W A;  4WFN L;  3MEG A;  1U45 A;  3RTV A;  2QKK A;  1CXQ A;  4CJV A;  1NM1 A;  2AP1 A;  1R0A A;  3KLE A;  1XI1 A;  3AVB A;  3CYM A;  2KFZ A;  4KTW A;  4BRN A;  3QEI A;  1KAY A;  4YOY A;  5FPM A;  4DTM A;  3SLC A;  3S3N A;  3K57 A;  2P5G A;  1NLV A;  3ZT1 A;  4DR6 K;  3QFU A;  5E84 A;  3R6M A;  5DM7 L;  4DUZ K;  4FW1 A;  3ZEU A;  3DLL L;  3CXC M;  1BOT O;  5BN9 A;  3SQ2 A;  4X66 K;  1YXQ A;  2JGU A;  3VEN A;  3L2U A;  3KHY A;  2F9W A;  4RTF D;  1IG9 A;  4DWI A;  3HVT A;  3QLH A;  1JCE A;  3HT3 A;  4BR4 A;  2G8V A;  3DLR A;  3JSM A;  4CEQ A;  4B3T K;  3TAG A;  3KKS A;  2GWJ A;  4IOX A;  1ASW A;  2KW4 A;  1Q8I A;  1TKD A;  3H6E A;  5FRO A;  2UYT A;  3VTH A;  3HPG A;  4PL7 A;  1RTI A;  4GVM A;  4QOZ B;  2W6L A;  1HX1 A;  3WUH A;  1SQK A;  5JLH A;  4JS4 A;  4DFK A;  3BZC A;  1A5X A;  1RBR A;  1WSH A;  4B8C A;  4YHH K;  3MXM A;  4DSK A;  3ZYY X;  4IJA A;  1UOC A;  3ATU A;  3VPZ A;  4CFD A;  1GOB A;  1OVY A;  3V1Q A;  2HBM A;  4F3O A;  1TL1 A;  4CIG A;  3QDK A;  4A59 A;  4ELT A;  4OX9 K;  2V7Z A;  3J7A P;  3CI5 A;  2GEL A;  4LFA K;  4BDY A;  4AH9 A;  2P9L B;  4IOC L;  4IDK A;  2YNG A;  4TSX A;  4BRO A;  5KRT A;  5J2P A;  1RDA A;  3JXU A;  3A0I X;  4E7I A;  1TKX A;  3THX A;  2A6A A;  4CF1 A;  2EWS A;  1Z26 A;  4CJK A;  4O0J A;  2CGK A;  4ISF A;  2RPI A;  1JLC A;  1S1U A;  4DR7 K;  3CCL N;  4PY5 A;  4KPY A;  1L3T A;  1BIZ A;  4KKO A;  3PO5 A;  3AVN A;  1W9H A;  3I55 N;  4DS4 A;  4KHY A;  1KVB A;  1N6Q A;  1T03 A;  2P9S A;  3AGR A;  3HM8 A;  1SKR A;  1Y64 A;  3AVH A;  3HTV A;  3C6U A;  1GLA G;  4L3Q A;  5KGX A;  1YHQ N;  2QWO A;  5BR8 K;  2VYP A;  2ATQ A;  1Q7Y O;  3CCQ N;  2HHW A;  2P9S B;  3HJF A;  1HYS A;  3NH1 A;  1WSG A;  1NGJ A;  1ATN A;  4H4M A;  4M41 A;  2P51 A;  4GW6 A;  1VQO N;  2FF3 B;  5I9E B;  3OYE A;  1OH8 A;  3TAQ A;  4NXN K;  1TYQ A;  1VQN N;  3CFP A;  5CHI A;  3OYH A;  4DSI A;  4Y1C A;  2Z1J A;  3CJ1 A;  3HPH A;  2Z1I A;  4FM2 A;  3WQU A;  5M1N A;  2I7P A;  3KZB A;  2QXF A;  1KLM A;  2A42 A;  2P1J A;  3LDP A;  4GNI A;  3CM5 A;  2GX9 A;  1U04 A;  3CCS N;  1QVG M;  4F4K A;  4NO7 A;  4Z4I A;  3LP1 A;  4IFY A;  3DOL A;  3TTC A;  4OPH A;  3SQ4 A;  4H5W A;  4FSV A;  5HP1 A;  2GTD A;  2G8K A;  5AJ3 K;  4HCB A;  1BI4 B;  1S6Q A;  3CCR N;  4FJI A;  2HNY A;  3KVG A;  1IBM K;  3J81 O;  4DTO A;  5BRF A;  5CYQ A;  3C95 A;  3ITH A;  2P9L A;  5HLF A;  1K8K A;  5E26 A;  1QQM A;  4CK3 A;  3VQB A;  1WOQ A;  3LDS A;  1NOY A;  4AHS A;  2D1K A;  4YOX A;  4O8U A;  3OYN A;  3ZSX A;  3K59 A;  1DEJ A;  1HNX K;  2CGL A;  4GV3 A;  2OCE A;  2A1S A;  1N5Y A;  4E7H A;  4FWL A;  4RW4 A;  1UA0 A;  2RHK A;  2YHX A;  4BRP A;  4NCB A;  1QSL A;  2AJQ A;  1RT2 A;  1O13 A;  4BWM A;  2O4I A;  3OYC A;  4DTN A;  1RTH A;  4FOE A;  3WEE B;  2I7N A;  2UUA K;  4C23 A;  4CGJ A;  3IKM A;  5AQS A;  3QEX A;  1YJ9 N;  3AY9 A;  4CF8 A;  3WQT A;  3CJC A;  4GV9 A;  2NRR A;  2VQE K;  4H5N A;  4E7K A;  2YHW A;  2UUC K;  1NGD A;  4YFU A;  4B1W B;  3BZK A;  4DTU A;  3QIC A;  5E41 A;  4KTZ A;  5JS2 A;  2FBT A;  4RW8 A;  3V9U A;  3CIP A;  4LF8 K;  4FM1 A;  2YHA A;  2V52 B;  4PUO A;  3V9W A;  4Z4C A;  4HUE A;  3TU5 A;  3QEW A;  4BQZ A;  5AZJ B;  5BN8 A;  1DLO A;  3VF4 A;  4KHS A;  1EP4 A;  4RW7 A;  2W42 A;  4LF7 K;  4A5A A;  4FLW A;  3WXM B;  4QAG A;  3P1G A;  1SZ2 A;  3CER A;  1QQN A;  1VSD A;  3L0Q A;  2D4W A;  3NHG A;  3RMA A;  3OS1 A;  4AHU A;  5EOY A;  1VRT A;  2OAN A;  2Q36 A;  3GE1 A;  1NK5 A;  3IS9 A;  2ZJR L;  1KQS M;  1DTQ A;  3ZCM A;  1OKJ A;  1TVR A;  4O4G A;  4M63 C;  1VSH A;  4KV8 A;  3OA9 A;  1NGC A;  5GAG P;  3HO1 A;  3SV4 A;  5I3U A;  4CGD A;  2Q3S A;  1VSE A;  4FZZ A;  2ITM A;  1ASV A;  3OHR A;  3L4Q A;  4Z0U A;  4FWN A;  5EVZ A;  1VHX A;  2OPP A;  4A62 A;  1ESV A;  3LAL A;  3O3F A;  4DSF A;  2P9P B;  3O9R A;  3VTI A;  3Q7B A;  3T1Y K;  2UU9 K;  3WXJ A;  3SZ2 A;  4WQ5 A;  3EY1 A;  5F1X A;  2P9P A;  3UIQ A;  1NK6 A;  2ZM6 K;  1BIS A;  2PZS A;  1B9F A;  1YVN A;  2YJF A;  3KJV A;  1V4T A;  4CBW A;  4CW7 B;  3CC4 N;  4MDA A;  4CEO A;  3EE8 A;  4ID5 A;  2O8C B;  4FJ5 A;  1A5V A;  4FJK A;  1TK0 A;  2UXD K;  3ZSZ A;  5AQI A;  2QI2 A;  4DV3 K;  3KLF A;  3ENB A;  3L2R A;  5M1Q A;  3EL2 A;  3DMJ A;  1Q86 O;  4GMJ B;  4NLC A;  2X6N A;  5TKW A;  3LZJ A;  1NGB A;  1TK5 A;  4QS7 A;  2NRZ A;  4C1N I;  3LAK A;  1S6P A;  3R8E A;  4YOV A;  3U3Y A;  4ZTJ A;  4BG9 A;  4JD2 A;  3CCE N;  4JI2 K;  3QIN A;  2OTL N;  4BE2 A;  5AQH A;  4C8N A;  4DQQ A;  3SUQ A;  3KK2 A;  4A2B A;  3DJC A;  4BRK A;  4DFM A;  3ZSO A;  5SWM A;  1ZBH A;  5KQ8 A;  4DG1 A;  4PHT X;  4ZTF A;  5AQG A;  1RBT A;  5HRO A;  2BUP A;  2OZM A;  3A5L C;  3P31 A;  4EIA A;  4OKE A;  2O8B A;  5J1E A;  3EYZ A;  4JEP A;  5M1F A;  1GOA A;  4BRI A;  4B9T A;  4H8K A;  3NF9 A;  1HQU A;  3SQ1 A;  3KTQ A;  1MDU B;  3SYZ A;  5IT9 O;  3T1A A;  4O8K A;  4DQS A;  1M90 O;  3THW B;  3MEC A;  4I6M B;  1NKE A;  3OYD A;  1UA1 A;  4JAX A;  4K25 A;  3CHW A;  3VQ9 A;  5AQW A;  1RBU A;  4HUG A;  3U3G A;  4LF4 K;  1T05 A;  4PKI A;  4JI0 K;  2BTF A;  3OYF A;  1BA1 A;  2QXL A;  4W5R A;  2ASM A;  5SZT A;  1REV A;  4BR0 A;  4C8K A;  3SPY A;  3THW A;  3VOV A;  3TAN A;  4RG8 A;  4E89 A;  1Q81 O;  3S9H A;  3ZSY A;  4CGH A;  3V81 A;  3G10 A;  1P90 A;  3THY A;  4ISE A;  3NF8 A;  4M3W A;  2YHB A;  1JLE A;  3LM2 A;  3AVG A;  2WOM A;  3WXK A;  5AQM A;  5HRR A;  4MO4 A;  3KWI A;  3AO5 A;  5AQL A;  5AQO A;  1JLB A;  3AA5 X;  4CZI A;  2ZF5 O;  2NRX A;  5CZ2 A;  4HTU A;  3P39 A;  2ZD1 A;  4FJX A;  3SAH A;  1BL3 A;  2G8I A;  3DLB A;  1KD1 O;  3M1F A;  2YKM A;  3FE1 A;  2E1Y A;  4FWS A;  3DRR A;  4FJ9 A;  3D7E O;  2E8A A;  1VQ5 N;  2E6L A;  3IFR A;  3OY9 A;  3C6A A;  4UY8 O;  3KLI A;  4BDP A;  3C6T A;  3A5M C;  1S5J A;  3EKS A;  3LAN A;  4LC9 B;  1RT7 A;  1NU0 A;  3UE5 A;  2IVP A;  4AIL C;  1OH7 A;  2UUB K;  3BUZ B;  4F3T A;  3HYF A;  1JKH A;  3L3V A;  4G9Z A;  3ZT0 A;  3GBT A;  2D5R A;  1SL1 A;  3OYA A;  2HHT A;  1YJW N;  1UWB A;  4CCH A;  4N76 A;  5GAH P;  3ENO A;  2OPR A;  4YDU A;  3QB0 A;  4B1Y B;  3HOT A;  4DV6 K;  1Q9X A;  3LP3 A;  4MO5 A;  3TI0 A;  3WNF A;  3FR0 A;  2NRW A;  3TTD A;  5KTQ A;  2E2P A;  3PSI A;  4E1J A;  2VWJ A;  4KH5 A;  5BRH A;  4O5B A;  4KFB A;  1CZA N;  3ISN C;  4XH1 A;  2O8D A;  1X3N A;  2HVH A;  2ZWH A;  4CHZ A;  3QFP A;  3CPW M;  3E66 A;  2V7Y A;  1D4X A;  4U7B A;  5AZJ A;  1HKG A;  3LZI A;  3DOK A;  4JKA A;  3ZSW A;  1E4G T;  2HHH K;  3ZET B;  3VQP A;  3FZF A;  1NGI A;  2ETJ A;  1XHX A;  2FF6 A;  1BCO A;  4JKG A;  3FLC O;  3A2F A;  2H3G X;  1S9E A;  2BH1 A;  4BRC A;  4CEA A;  4F2S A;  2DFH A;  4FWK A;  1K6Y A;  1BHL A;  4JI5 K;  1KVC A;  2D0P A;  4DV7 K;  3CD6 N;  1C6V A;  4DB3 A;  5AQX A;  3IAY A;  4K43 A;  1T6D A;  5AQQ A;  1BDG A;  3MAQ A;  1ZBU A;  3AVJ A;  3R1X A;  3LDN A;  4CEF A;  4JI3 K;  3MK6 A;  2WON A;  4J8F A;  3HOS A;  3KK7 A;  3AVM A;  4JHD A;  4B3R K;  4CJU A;  1U2V A;  4FWP A;  2ZE2 A;  4IG3 A;  5B8H A;  4B1V A;  4CJR A;  4B1Z A;  3DI6 A;  5EU7 A;  2P9I A;  1HPZ A;  2KZZ A;  4CZL A;  2P9K B;  4A57 A;  3W3D A;  2AA4 A;  2KFN A;  4BC3 A;  4JRQ A;  4V19 S;  3WEE A;  2XO7 A;  3H1Q A;  1LWE A;  1I39 A;  5DMR A;  4BE1 A;  1C1B A;  3SBG A;  1NMD A;  2KZM A;  4L8R B;  1K9M O;  1BI4 A;  1T8E A;  1NGA A;  3MN9 A;  3SV3 A;  5J2N A;  1U49 A;  3K0S A;  5FPN A;  3UKU B;  4CER A;  2JLE A;  4BRA A;  2EX3 A;  3AO2 A;  3EZW A;  4AHV A;  4CBX A;  1VQ6 N;  4M3T A;  1FXX A;  3OJS A;  2Z1G A;  4W5O A;  4XEI A;  4B1U B;  3FZM A;  4Z4H A;  1OH5 A;  1I94 K;  4BC5 A;  5HRP A;  4CEC A;  1U2V B;  5ADX H;  1SKW A;  3E9L A;  2B5J A;  1NK4 A;  3ZET A;  5AQY A;  3RRG A;  4DTS A;  4XIU A;  2YV0 X;  2YI1 A;  3ZEU B;  4FK0 A;  4CHN A;  2DFF A;  2YNH A;  2FLO A;  1BIU A;  5CZ1 A;  5T7B A;  2XRI A;  4DSE A;  3PX4 A;  2O8D B;  3LM9 A;  3O80 A;  3ULD A;  1WAF A;  1X9S A;  3V4I A;  4BR2 A;  2JWL A;  1NJY A;  1V4S A;  4B9V A;  4K8X A;  4DTJ A;  3PO4 A;  4EHU A;  1ILY A;  2HVI A;  1BA0 A;  5M1K A;  2W40 A;  2Q0R A;  2BAN A;  4NB4 A;  4IOA L;  1C0M A;  4A2A A;  4BQL A;  4BRM A;  5CYM A;  3W0L A;  2Z1H A;  2F8T A;  3VQQ A;  4G1Q A;  3V9Z A;  4CK1 A;  1T7P A;  3HP6 A;  3MED A;  3NE6 A;  4BRH A;  3I8D A;  1YTA A;  2VGM A;  3NH2 A;  3PIO L;  3AVA A;  2IC3 A;  2NLX A;  5C12 A;  3HK2 A;  4CBU A;  2XY5 A;  4YOR A;  1HPM A;  3QEV A;  3NH0 A;  4QS9 A;  1GLE G;  3OTO K;  4BVO A;  3SPZ A;  3TTF A;  4E3S A;  2W41 A;  4LFB K;  3ZX0 A;  4BDZ A;  4BC4 A;  2VWK A;  3AA3 A;  4FZX C;  3ZT3 A;  5D3G A;  1C1A A;  4H5T A;  4MFB A;  4CD1 A;  3T3F A;  4MLE A;  1U48 A;  1O1W A;  4GV6 A;  1Z6R A;  3NBP A;  2HMI A;  5CE3 A;  3TAF A;  3MWP A;  4FJJ A;  3MN5 A;  3THV A;  1NNE A;  4NYN A;  3FFI A;  4KI4 A;  1T44 A;  3PX6 A;  1T3V A;  5AFU A;  4B9U A;  2GEM A;  2NZT A;  4BY9 C;  3KD1 E;  2UXB K;  3VQA A;  2P9U A;  5FPD A;  5CR4 A;  3ZSQ A;  4DU1 A;  5IWA K;  3E01 A;  3QO9 A;  1WB9 A;  4B3O A;  1C1C A;  4BE0 A;  4UQG A;  3BF1 A;  4BGA A;  3G25 A;  4IEE A;  3HPO A;  4LSN A;  4CI6 A;  3M8S A;  3NF6 A;  4CJ3 A;  1EWR A;  1RTD A;  1NJZ A;  1CZB A;  1RDW X;  4JK8 A;  5ADX A;  3JS6 A;  1TUU A;  4NCG A;  4H03 B;  2VG6 A;  4CEB A;  1KTQ A;  3LP0 A;  3CM6 A;  4JKB A;  3KK3 A;  5AQK A;  3Q7C A;  4DCH A;  2O8E A;  4LD0 A;  4DV2 K;  1QVF M;  3L6Q A;  4JS5 A;  3QNO A;  4DQI A;  4FXD A;  4DF8 A;  1ATS A;  3PY8 A;  5AQV A;  2HHS A;  1NGG A;  4XH5 A;  3SI6 A;  3B6P A;  3CCJ N;  4RW6 A;  3H08 A;  1QHA A;  3RR7 A;  3KK1 A;  2P9U B;  3ZSR A;  2BGG A;  1XC3 A;  2P9K A;  4N56 A;  4CFA A;  1JCG A;  4DV0 K;  1OH6 A;  3MN7 A;  3O9U A;  5DK5 A;  3AGK A;  3DWL A;  1BCM A;  4F8R A;  1HYV A;  1ITG A;  1LV5 A;  4IKF A;  4HUF A;  1R59 O;  2NNW A;  4FJ7 A;  2PYL A;  2A5X A;  2E2N A;  1XUP O;  1CZ9 A;  2FBV A;  1TL3 A;  1EX4 A;  1RDB A;  5LY3 A;  2E6M A;  2IOC A;  4CFB A;  3OYB A;  4MQ3 A;  2VGN A;  1RT6 A;  3O08 A;  3HZ6 A;  4DTR A;  3KD5 E;  4J2B A;  3SMP A;  4BRL A;  3M3Z A;  3MDQ A;  4YOT A;  4R79 A;  4JI6 K;  2QWP A;  4KB0 A;  1NGF A;  3F2K A;  3QML A;  5JVH L;  4FJH A;  2NUB A;  3WT0 A;  3ZT2 A;  1DKG D;  3D2F A;  3DXK A;  5H1S Q;  3SK3 A;  5BR9 A;  3VEZ A;  5JS1 A;  2HHV A;  4CZK A;  1QS4 A;  3K58 A;  4IZ9 A;  3KLG A;  2UXC K;  3OVN A;  4WFA L;  4B3S K;  3MX5 A;  4CZJ A;  3LPT A;  3K9K A;  1WUA A;  1D8Y A;  3H45 C;  2EHG A;  3E9P A;  1J53 A;  4FK4 A;  2QWQ A;  4W5Q A;  1T6C A;  3D2E B;  4FJG A;  4IWV A;  1BU6 O;  5C0Y A;  3CF5 L;  3V9S A;  2XY6 A;  5HRS A;  3VQ6 A;  4CIF A;  4HTL A;  1TAU A;  4PKH A;  5DM6 L;  2GBZ A;  4J2A A;  3F9M A;  4FCY A;  5AQU A;  3HL8 A;  4CJE A;  2E4L A;  4WYB A;  4LF9 K;  3A8Y A;  1VAZ A;  3HBT A;  3VES A;  4K41 A;  3DM2 A;  4HCC A;  4NLB A;  1E4F T;  2Q97 A;  1RDD A;  1ZXO A;  2DFE A;  4BR5 A;  5AQT A;  3I56 N;  3SCX A;  1NBW A;  3BY5 A;  3O4N A;  1TKZ A;  4CJF A;  3IMX A;  1WN7 A;  4CZG A;  2QWN A;  3AO3 A;  4DV4 K;  3P5J A;  4HHT A;  5HRN A;  4JKH A;  3IRX A;  1VQP N;  3RMC A;  4JI1 K;  1YIT N;  2V51 B;  4Q0B A;  3PX0 A;  2QK9 A;  1ZBL A;  2O8F A;  1NK9 A;  4N5S A;  3TAB A;  3NAE A;  4OPJ A;  1S72 N;  4DTX A;  4OO1 J;  4FO0 A;  4AHC A;  4KRE A;  3GG4 A;  1LW2 A;  5LL6 Z;  5JVG L;  3TPQ A;  3CMA N;  2OYQ A;  1NOZ A;  3M5R A;  4RCH A;  4BRE A;  3F5T A;  3RVC A;  2ITG A;  1RDC A;  3AAP A;  4CF2 A;  3ZLJ A;  1ZBI A;  4EP5 A;  2ZGY A;  2HB5 A;  4NXM K;  2VG5 A;  4DR2 K;  1XWL A;  1BG3 A;  3M8P A;  5KPR A;  1IKV A;  1ATR A;  3VGK A;  1HRH A;  2IDO A;  1TK8 A;  1GOC A;  5MLC Q;  3CCU N;  3O9T A;  2YJE A;  4W5N A;  3NVK A;  1K8K B;  1D5A A;  1KFD A;  1SUQ A;  3SMS A;  3ID8 A;  4N41 A;  1EQY A;  2GV9 A;  4PWD A;  2D0O A;  2IIR A;  3NGY A;  1BUP A;  2YCH A;  4JD2 B;  4OKJ A;  1VRU A;  3LL3 A;  1KCF A;  5AQP A;  4BWJ A;  1IBK K;  5AQR A;  4K8Z A;  3OYJ A;  4C8M A;  5FRN A;  4CJW A;  1FW6 A;  4DSJ A;  1KAX A;  5HBM A;  3BP8 A;  2HND A;  4AHT A;  3HP9 A;  3T69 A;  3ENH A;  4CZM A;  3NFA A;  1SAZ A;  3T1H K;  3LAM A;  1I3A A;  1S9G A;  4M7X A;  3NVM A;  3HXM A;  1NJI O;  4JKD A;  5GIP A;  4WE1 A;  1FKP A;  1SL0 A;  3V6D A;  1LAW A;  3OYG A;  4ISG A;  4WF9 L;  2E1Z A;  3EE9 A;  3PIP L;  3SBT A;  1HJR A;  3ALY A;  1U6Z A;  4DKW A;  1XC9 A;  1QQC A;  4DMN A;  3VF6 A;  1BQM A;  2ZGZ A;  3ASM A;  2KLA A;  5M1P A;  3V1R A;  4CEE A;  2OPQ A;  3SAF A;  3NCI A;  2CGJ A;  1IV0 A;  3K2P A;  5GAD P;  2G8F A;  1N33 K;  3H3O B;  3K9J A;  3EO3 A;  1E3M A;  4F9O A;  3VN5 A;  3U9Z A;  2FC0 A;  4Q5V A;  3TWH A;  2YKN A;  1N32 K;  3HI0 A;  2HF3 A;  4M3X A;  4DV5 K;  5KPZ A;  4W5T A;  4C1N K;  3DAW A;  1FJG K;  4O55 A;  4CJS A;  2A1R A;  1RFQ A;  1UAX A;  4DQP A;  4EAH D;  1X9W A;  1CLQ A;  3GL1 A;  3M8Q A;  3VGM A;  4KO0 A;  3AVI A;  2OPS A;  1FKO A;  3ZSV A;  4BRQ A;  1XHZ A;  4CES A;  1GLC G;  3OS0 A;  5EX5 A;  2I5J A;  1SV5 A;  4KBO A;  3QIP A;  3MWT A;  3VQ5 A;  3H1V X;  4H0P A;  4KHW A;  2HMP A;  2HBL A;  3MCA B;  4B9Q A;  4EZ9 A;  4BRG A;  4BAC A;  4U67 L;  4BVP A;  1KSP A;  1LAV A;  4CJP A;  1KXP A;  4H4O A;  3I8B A;  3GOI A;  5I42 A;  2WUS A;  4BG8 A;  4KI6 A;  3AVC A;  4JYA K;  4I2Q A;  1KLN A;  1VQ4 N;  1WSE A;  1LCU A;  1HNI A;  2O8F B;  2PAV A;  3VET A;  2NRV A;  3C94 A;  5ELZ A;  4X65 K; 
#chains in the Genus database with same CATH homology
 3OYN A;  3HM9 A;  3ZSX A;  1C0M A;  3K59 A;  3SQ0 A;  2DY4 A;  1IO2 A;  1J9A A;  3G0Z A;  5CYM A;  4PQU A;  2A1S A;  2Z1H A;  1N5Y A;  4E7H A;  3SUP A;  2F8T A;  3AA4 A;  4RW4 A;  1UA0 A;  2OZS A;  3VQQ A;  4G1Q A;  3LWL A;  4CFC A;  3V9Z A;  4CK1 A;  1EET A;  1QSL A;  1EXQ A;  1T7P A;  3HP6 A;  4NCB A;  2AJQ A;  1RT2 A;  3I0S A;  3MED A;  3JYT A;  1L3V A;  1MU2 A;  4KB1 A;  4CJT A;  3NE6 A;  3NGI A;  4BWM A;  3I8D A;  1YTA A;  2X78 A;  2O4I A;  3NH2 A;  3OYC A;  4DTN A;  1RTH A;  3AVA A;  4CGJ A;  2IC3 A;  3QEX A;  4CF8 A;  5KGW A;  3HK2 A;  3AVK A;  4I7F A;  2XY5 A;  1YTU A;  2BE2 A;  1VSJ A;  3QEV A;  4FYD A;  3NH0 A;  4E7K A;  3D0P A;  1NJW A;  3MEE A;  1LWF A;  4M3U A;  4EZ6 A;  4YFU A;  1RNH A;  2D0B A;  3VQ8 A;  4CF0 A;  4FM0 A;  4B9L A;  3VQ4 A;  1VSF A;  4FJN A;  4DTU A;  3SPZ A;  5E41 A;  4E3S A;  4KTZ A;  5JS2 A;  3O3G A;  2FBT A;  4RW8 A;  3V9U A;  1NK0 A;  4CK2 A;  1S1X A;  2YHA A;  4FM1 A;  4BDZ A;  3SUN A;  4B9M A;  3OYM A;  4PUO A;  2VWK A;  3V9W A;  3BGR A;  4Z4C A;  4HUE A;  3AA3 A;  4FZX C;  3ZT3 A;  3DLE A;  3QEW A;  4KHS A;  1DLO A;  5D3G A;  1EP4 A;  2IGI A;  3SJJ A;  3K5N A;  1C1A A;  4MFB A;  4RW7 A;  3DRS A;  2W42 A;  3O3H A;  4JRP A;  3T3F A;  1IKX A;  3S3O A;  4FLW A;  1U48 A;  4QAG A;  3P1G A;  3WNH A;  1O1W A;  3NBP A;  2HMI A;  4CJQ A;  1VSD A;  3TAF A;  4AHR A;  3NHG A;  3RMA A;  1KRP A;  4FJJ A;  3OS1 A;  4AHU A;  4I2P A;  3THV A;  1VRT A;  4NYN A;  3FFI A;  4KI4 A;  4Z4G A;  4CGF A;  1JLQ A;  3PX6 A;  1NK5 A;  3IS9 A;  4FJM A;  3CFO A;  1IKY A;  1DTQ A;  4CEZ A;  3QEP A;  1X9M A;  3ZCM A;  2OA8 A;  4B9U A;  2HHU A;  3KD1 E;  5CY4 A;  3VQA A;  1TVR A;  4IFV A;  5FDL A;  4O4G A;  3ZSQ A;  2LSN A;  4DU1 A;  1VSH A;  3E01 A;  4KV8 A;  4J2D A;  2PY5 A;  3QO9 A;  4B3O A;  1C1C A;  3L3U A;  3LPU A;  4CF9 A;  4BE0 A;  3HO1 A;  4E1M A;  4UQG A;  4O44 A;  3SV4 A;  5I3U A;  1VSK A;  2D0C A;  4CGD A;  2Q3S A;  1VSI A;  3HPO A;  3CG7 A;  1VSE A;  4LSN A;  3BDP A;  5J2M A;  4FW2 A;  1J5O A;  1ASV A;  1Z25 A;  2P5O A;  4FZZ A;  4Z0U A;  3M8S A;  3S3M A;  4DU3 A;  2OPP A;  4Z4F A;  3NF6 A;  1D9D A;  1WAJ A;  3LAL A;  3PUF A;  3O3F A;  4CJ3 A;  1RTD A;  4ZHR A;  3L2V A;  1QTM A;  3CQ8 A;  3DLG A;  1NJZ A;  4DSF A;  4CHO A;  3RRH A;  1CZB A;  1W0H A;  3U6F A;  3AO1 A;  4OPK A;  4NCG A;  3SZ2 A;  3LWM A;  3EY1 A;  1KFS A;  4FLT A;  3IG1 A;  2VG6 A;  4CEB A;  1KTQ A;  3LP0 A;  1NK6 A;  3CM6 A;  3UIQ A;  3KK3 A;  2HHX A;  4LD0 A;  1BIS A;  2PZS A;  3RR8 A;  1B9F A;  1WLJ A;  3TAM A;  4JS5 A;  3QNO A;  4M42 A;  4B8A B;  3KJV A;  4DQI A;  4FXD A;  4DF8 A;  3OYI A;  3VA0 A;  2ZQB A;  3PY8 A;  1RBS A;  1Q9Y A;  2HHS A;  3T19 A;  4FLU A;  1JL2 A;  1QHT A;  4CEO A;  4ID5 A;  3B6P A;  3SI6 A;  4RW6 A;  4JLH A;  3H08 A;  3RR7 A;  1A5V A;  1D9F A;  4FJ5 A;  3KK1 A;  4FJK A;  1TK0 A;  3QNN A;  3ZSR A;  3ZSZ A;  2BGG A;  3K5O A;  4N56 A;  4CFA A;  5FRM A;  2G8H A;  3KLF A;  1L5U A;  3L2R A;  2HW3 A;  5DK5 A;  1BCM A;  5C24 A;  3DMJ A;  4GMJ B;  4M45 A;  3EZ5 A;  2X6N A;  2RF2 A;  4F8R A;  1HYV A;  4DLG A;  1ITG A;  3VQD A;  3LZJ A;  1LV5 A;  1TK5 A;  1TV6 A;  3I0R A;  3MXJ A;  3NF7 A;  4IKF A;  3L2W A;  4HUF A;  4KHN A;  4E19 A;  3LAK A;  1IKW A;  1X1P A;  1RT5 A;  4CJ4 A;  4R5P A;  1S6P A;  3F73 A;  2VG7 A;  2PYL A;  3AA2 A;  1HNV A;  3U3Y A;  1CZ9 A;  4ZTJ A;  2FBV A;  1TL3 A;  3AV9 A;  1ASU A;  1EX4 A;  3QIN A;  4NYF A;  4CHP A;  4F2R A;  4BE2 A;  2YNI A;  4C8N A;  4DQQ A;  3SUQ A;  1HQE A;  3KK2 A;  3RMB A;  1LW0 A;  1RDB A;  2E6M A;  2IOC A;  4CFB A;  3OYB A;  3AO4 A;  4MQ3 A;  1NJX A;  4DFM A;  3ZSO A;  5SWM A;  1NK8 A;  1ZBH A;  3HST B;  2BDP A;  1RT6 A;  4E7L A;  4DG1 A;  3CFR A;  4DTR A;  3VQE A;  4FLV A;  4ZTF A;  2PYJ A;  3KD5 E;  3DLK A;  3OJU A;  3QER A;  4J2B A;  2G8U A;  1RBT A;  2O4G A;  3P83 D;  2Y1J A;  5HRO A;  4OKK A;  3L8B A;  2OZM A;  1J54 A;  3K5L A;  4KB0 A;  2XHB A;  3OYL A;  4FJH A;  2NUB A;  3ZT2 A;  4CGI A;  3D45 A;  1RT4 A;  1WSJ A;  2IS3 A;  4OKE A;  3NDK A;  4E7J A;  3WNE A;  2KQ2 A;  4CJL A;  5J1E A;  3EYZ A;  4DU4 A;  1GOA A;  3F9K A;  1ZYQ A;  2RN2 A;  4B9T A;  4H8K A;  1LWC A;  3NF9 A;  4OGC A;  1HQU A;  2XY8 A;  3SQ1 A;  3KTQ A;  3WNG A;  3SYZ A;  5JS1 A;  3T1A A;  1RT3 A;  2HHV A;  4IG0 A;  4DQS A;  1QSY A;  4DQR A;  1TKT A;  3O4Q A;  3MXI A;  1QS4 A;  3K58 A;  4B9N A;  3MEC A;  3KLG A;  1NKE A;  3OYD A;  4KRF A;  1UA1 A;  3OVN A;  2FBY A;  2HNZ A;  3KIO A;  4M3R A;  4E0D A;  3VQ9 A;  3LPT A;  1NKC A;  1RCH A;  1D8Y A;  1JXE A;  3AVL A;  1RBU A;  2EHG A;  4HUG A;  1J53 A;  5J2Q A;  3U3G A;  4FK4 A;  4DSL A;  4W5Q A;  1SL2 A;  1T05 A;  1G15 A;  4B08 A;  1U47 A;  1DTT A;  1EKE A;  3V1O A;  3OYF A;  4PA1 A;  4FLZ A;  4FJG A;  4RW9 A;  3DRP A;  4FLY A;  3V9S A;  4W5R A;  3QET A;  2XY6 A;  5HRS A;  5SZT A;  3VQ6 A;  1REV A;  4C8K A;  3SPY A;  3TAN A;  2QKB A;  1FK9 A;  4CED A;  4CIF A;  2B6A A;  4RG8 A;  4E89 A;  1SKS A;  3S9H A;  1BQN A;  1TAU A;  3RWU A;  3ZSY A;  4CGH A;  3V81 A;  2GBZ A;  3G10 A;  4CHQ A;  4J2A A;  1JL1 A;  4FCY A;  3AVF A;  3ZT4 A;  4C8O A;  3NF8 A;  4M3W A;  3HL8 A;  1IH7 A;  2YHB A;  4EP4 A;  1JLE A;  3AVG A;  1VSL A;  2WOM A;  4OGE A;  1JLA A;  4C8L A;  4QCL A;  3MEG A;  4LH5 A;  4CJE A;  2E4L A;  3RTV A;  1U45 A;  2QKK A;  1QSS A;  1CXQ A;  3VQ7 A;  5HRR A;  4CJV A;  3AO5 A;  3DM2 A;  1JLB A;  1R0A A;  3AA5 X;  3KLE A;  3AVB A;  3CYM A;  1XI1 A;  4KTW A;  4B9S A;  4HCC A;  2KFZ A;  3QEI A;  5CZ2 A;  1RDD A;  4HTU A;  4DTM A;  2DFE A;  4FVM A;  3KLH A;  2ZD1 A;  3S3N A;  4FJX A;  3K57 A;  2G8I A;  1BL3 A;  2P5G A;  3SCX A;  3DLB A;  1Y97 A;  3O4N A;  3ZT1 A;  1JXB A;  1TKZ A;  4CJF A;  3QIO A;  1WN7 A;  2YKM A;  3DRR A;  3AO3 A;  4FW1 A;  3P5J A;  4DTP A;  4FJ9 A;  3SQ2 A;  2E6L A;  2JGU A;  3NGZ A;  1JLG A;  3L2U A;  3OY9 A;  4HHT A;  1B9D A;  5HRN A;  1RT1 A;  1U4B A;  1IG9 A;  4DWI A;  3KLI A;  1WNS A;  3C6T A;  4CIE A;  3HVT A;  3IRX A;  3QLH A;  4BDP A;  1S5J A;  3RMC A;  3HT3 A;  2G8V A;  3DLR A;  4CGG A;  3LAN A;  3JSM A;  4CEQ A;  1ZBF A;  3TAG A;  3KKS A;  1RT7 A;  3L2Q A;  4Q0B A;  3PX0 A;  1ASW A;  2KW4 A;  2QK9 A;  1Q8I A;  1TKD A;  4OVL A;  5FRO A;  1ZBL A;  4DLE A;  1NK9 A;  2YNF A;  3OYK A;  4AIL C;  4N5S A;  4KHU A;  3TAB A;  4ICL A;  3HPG A;  3NAE A;  4OPJ A;  4DTX A;  4J2E A;  1RTI A;  4AHC A;  2D0A A;  4KRE A;  3RMD A;  4ELV A;  3HYF A;  4GVM A;  1JKH A;  3L3V A;  4ID1 A;  4F3T A;  2F8S A;  4E1N A;  3V9X A;  4QOZ B;  3ZT0 A;  1LW2 A;  1S1V A;  2D5R A;  1SL1 A;  3OYA A;  2HHT A;  3SUO A;  4JS4 A;  4DFK A;  2OYQ A;  1NOZ A;  1UWB A;  2F96 A;  1B92 A;  1WSF A;  1A5X A;  1RBR A;  1WSH A;  4B8C A;  3OS2 A;  2Y1I A;  4CCH A;  4KTQ A;  3MXM A;  4DSK A;  4N76 A;  2GUI A;  2OPR A;  2ITG A;  1RDC A;  1Q9X A;  3LP3 A;  1UOC A;  4KAZ A;  4CF2 A;  1ZBI A;  3TI0 A;  4EP5 A;  3WNF A;  5KRS A;  2HB5 A;  5KTQ A;  4CFD A;  1GOB A;  2VG5 A;  3V1Q A;  1NKB A;  4F3O A;  1XWL A;  1TL1 A;  4Y1D A;  4CIG A;  2VWJ A;  3M8P A;  5C25 A;  3SNN A;  2R7Y A;  3QES A;  4O0I A;  1IKV A;  4ELT A;  4O5B A;  4DFP A;  4I9Q A;  1HRH A;  2IDO A;  1TK8 A;  1GOC A;  2IAJ A;  4KFB A;  4BDY A;  4AH9 A;  1L3U A;  4W5N A;  1QE1 A;  2YNG A;  3ISN C;  4IDK A;  4TSX A;  1L3S A;  1D5A A;  5KRT A;  2HVH A;  1KFD A;  1HMV A;  5J2P A;  4LY7 A;  4CHZ A;  1SUQ A;  1HYZ A;  1RDA A;  4E7I A;  1TKX A;  4N41 A;  2GV9 A;  4CF1 A;  4HVJ A;  4PWD A;  1C0T A;  1Z26 A;  3LZI A;  3NGY A;  3DOK A;  2XY7 A;  4CJK A;  3ZSW A;  3K5M A;  1RTJ A;  4OLA A;  4DF4 A;  4O0J A;  4FJ7 A;  3VQP A;  4OKJ A;  1VRU A;  1KCF A;  4BWJ A;  4CJ5 A;  2RPI A;  2ETJ A;  1XHX A;  4K8Z A;  3OYJ A;  1BCO A;  1JLC A;  4C8M A;  1S1U A;  5FRN A;  2DTU A;  3A2F A;  4CJW A;  4DSJ A;  1S9E A;  1YT3 A;  5HBM A;  2HND A;  4OLB A;  3LP2 A;  4AHT A;  3HP9 A;  4KPY A;  4PY5 A;  4CEA A;  1L3T A;  1BIZ A;  4KKO A;  2DFH A;  3PO5 A;  4F2S A;  4NCA A;  3NFA A;  1VK0 A;  1K6Y A;  1BHL A;  3LAM A;  1RIL A;  3AVN A;  1I3A A;  1S9G A;  1W9H A;  3DYA A;  1KVC A;  4DS4 A;  2HHQ A;  2KTQ A;  4KHY A;  1KVB A;  1N6Q A;  1T03 A;  4FJL A;  4Z4E A;  2G8W A;  1C6V A;  3HXM A;  4FK2 A;  1F21 A;  1SKR A;  3IAY A;  3AVH A;  3C6U A;  5KGX A;  3MAQ A;  4WE1 A;  1FKP A;  1ZBU A;  3AVJ A;  1SL0 A;  3V6D A;  2ATQ A;  1LAW A;  3OYG A;  4CEF A;  1C0U A;  2HHW A;  2WON A;  4KHQ A;  3AVM A;  3HJF A;  4CJU A;  1HJR A;  3ALY A;  1HYS A;  5C42 A;  1XC9 A;  1QQC A;  2ZE2 A;  4IG3 A;  4DMN A;  3NH1 A;  1WSG A;  1BQM A;  3DLH A;  4CJR A;  4H4M A;  1S1T A;  4M41 A;  3ASM A;  2P51 A;  3DI6 A;  5EU7 A;  4GW6 A;  1HPZ A;  2KZZ A;  3V1R A;  4CEE A;  2OPQ A;  3NCI A;  3K2P A;  5KI6 A;  3VA3 A;  4YNQ A;  4DS5 A;  2G8F A;  2KFN A;  3M8R A;  3OYE A;  4JRQ A;  1VSM A;  3TAQ A;  2XO7 A;  1LWE A;  4CHY A;  3VN5 A;  3CFP A;  1I39 A;  4M3Z A;  3OYH A;  2X74 A;  5DMR A;  4BE1 A;  1C1B A;  2FC0 A;  4Q5V A;  3TWH A;  2YKN A;  3TAR A;  4DSI A;  4Y1C A;  4M3X A;  1KVA A;  4L8R B;  2KZM A;  2Z1J A;  3HPH A;  1BI4 A;  2Z1I A;  1T8E A;  1A5W A;  1S1W A;  3B6O A;  4W5T A;  4FLX A;  4FM2 A;  3SV3 A;  1WSI A;  5J2N A;  4DFJ A;  3PV8 A;  1U49 A;  1YVU A;  2B4J A;  4CER A;  2QXF A;  4O55 A;  1KLM A;  4CJS A;  2P1J A;  2A1R A;  2JLE A;  1UAX A;  2EX3 A;  3AO2 A;  4IBN A;  4AHV A;  1X9W A;  4DQP A;  1BGX T;  5K14 A;  1NK7 A;  1CLQ A;  3CM5 A;  3M8Q A;  4M3T A;  1FXX A;  4KO0 A;  1U04 A;  3AVI A;  2OPS A;  1RBV A;  2Z1G A;  1FKO A;  4N47 A;  3ZSV A;  4W5O A;  3OJS A;  3HVR A;  3TAE A;  4CES A;  1XHZ A;  4ELU A;  3OS0 A;  3KKR A;  2RKI A;  4Z4H A;  4F4K A;  4I9L A;  4OJR A;  5HRP A;  4CEC A;  4Z4I A;  3LP1 A;  4IFY A;  3DOL A;  4M3Y A;  2I5J A;  1SKW A;  1SV5 A;  3QIP A;  2X6S A;  4LH4 A;  3SQ4 A;  3VQ5 A;  5HP1 A;  2B5J A;  1TAQ A;  1NK4 A;  4FJ8 A;  4KHW A;  2G8K A;  4HCB A;  2FBX A;  3RRG A;  4EZ9 A;  1BI4 B;  4DTS A;  1S6Q A;  2YV0 X;  4XIU A;  4BAC A;  1KSP A;  4FJI A;  1LAV A;  2HNY A;  4CJP A;  4FK0 A;  4CHN A;  3TAP A;  2DFF A;  4H4O A;  2YNH A;  4DTO A;  5I42 A;  5CYQ A;  3C95 A;  3ITH A;  1TGO A;  3PX4 A;  1BIU A;  5CZ1 A;  3AVC A;  2XRI A;  5T7B A;  4DSE A;  4KI6 A;  4I2Q A;  5HLF A;  3ULD A;  1KLN A;  1WAF A;  1X9S A;  3V4I A;  4CE9 A;  1WSE A;  4LSL A;  1NJY A;  1JLF A;  4B9V A;  4K8X A;  3VQC A;  4DTJ A;  3PO4 A;  3TR8 A;  2HVI A;  1HNI A;  4CK3 A;  3VQB A;  1CXU A;  3LDS A;  4FZY A;  1NOY A;  4AHS A;  3C94 A;  2BAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...