5EU7A

Crystal structure of hiv-1 integrase catalytic core in complex with fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACDWAGIKQEFGVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The Preserved HTH-Docking Cleft of HIV-1 Integrase Is Functionally Critical.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 48
structure length 143
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5eu7A00
4CIEA 3SV3A 4M3WA 2RF2A 1S6PA 4ID5A 3LP1A 1KFDA 1YTAA 3V9ZA 4DTUA 1NK0A 3P83D 4KAZA 1QSSA 1DTQA 4M41A 1RBRA 3SV4A 3RRHA 4QOZB 3AA4A 4M42A 1VSHA 4AHCA 1TAUA 2Z1HA 4HVJA 5KRTA 1L5UA 1QQCA 4PA1A 1Z25A 1NKBA 1YT3A 4E7JA 2E6MA 4DQIA 2I5JA 3OYGA 4KTZA 3WNFA 4FJLA 1F21A 4CEQA 2OPPA 4DSLA 4CJUA 4DLGA 4M3XA 1A5XA 4CHQA 4CK3A 1C1AA 4R5PA 3L2QA 4DLEA 1ZBHA 2XHBA 4CGIA 2VWJA 3LANA 4HCCA 4Z4EA 1VSEA 3MAQA 4M3ZA 1S1UA 2Q3SA 1X9WA 4DTMA 4CEFA 2W42A 3CFRA 4QAGA 3THVA 5HRSA 1U49A 5DMRA 3QESA 1BI4B 1IH7A 3TI0A 3VN5A 2QK9A 3L8BA 3ZSWA 3S3OA 5HLFA 1N5YA 3PO4A 5HP1A 4CESA 4KKOA 1S1TA 4OJRA 3VQ5A 2G8UA 1SKWA 1X1PA 4FK0A 3AVFA 1REVA 3DOKA 2HVIA 4C8NA 1IKXA 3ZT0A 4CJKA 4CJFA 2G8IA 4M3RA 3VQ4A 1RDCA 1L3TA 3KK1A 1HQEA 1WSEA 1HQUA 2HNZA 3SQ1A 1CXQA 4CJQA 3HPOA 4JS5A 4FJ8A 2X6SA 3CM5A 4LSLA 3ZT3A 4Z4FA 3VQ8A 4DMNA 2YV0X 1RTJA 3NF8A 3SUPA 4DQQA 1VSKA 3AVAA 3DLEA 1CLQA 4B9LA 4JLHA 2BGGA 1RDAA 4H8KA 4B8AB 4E89A 3AVGA 4CHNA 5J2PA 3CM6A 3LWLA 2ZQBA 1WAFA 1KVAA 4NCGA 1NJZA 3AA3A 2AJQA 4CJ5A 3LPTA 3DLRA 1D9FA 3VQ6A 1MU2A 4DF4A 4F2SA 4OLBA 4AHRA 4C8MA 1WLJA 1BIZA 2HHVA 3NCIA 1ZBLA 4CF0A 4DU1A 1Y97A 4DTPA 1BQMA 3OS0A 4BE0A 3O4QA 4DSFA 3RMAA 1KLNA 4GW6A 2PYLA 3KKSA 3QLHA 5J1EA 4CIGA 1S9GA 2A1RA 3KLIA 4OPJA 1JLGA 4W5NA 3ISNC 4DFMA 3OJSA 4Z4CA 1BISA 4CGGA 4I2QA 1S9EA 4QCLA 1HNVA 1SV5A 4FJKA 1U45A 4FJHA 3KLGA 3PX4A 2JGUA 2OPQA 3TAEA 1YVUA 2E4LA 1C6VA 1HYSA 4CHOA 2HW3A 3OYHA 1BL3A 3RMDA 5JS1A 5I42A 3SI6A 1WSFA 2WONA 1QHTA 4F8RA 2F8SA 1C0MA 5C42A 3NAEA 4FLXA 3CQ8A 3QEIA 2KTQA 1Q8IA 3DRPA 4OKEA 3HXMA 3NDKA 4DTRA 2HHXA 1RTHA 4GVMA 1RBUA 4EZ6A 3PY8A 1WSJA 3HM9A 1LWCA 3VQCA 3F9KA 2FC0A 1QTMA 1NKEA 2G8FA 4F3TA 3DRRA 4JS4A 3PV8A 4Q0BA 1U4BA 3O3GA 1EKEA 3S3NA 1UA1A 2VG5A 1TV6A 2YNHA 4ICLA 3V6DA 4DSKA 3ZSQA 5CYQA 1KTQA 3LZIA 2FBXA 2HVHA 2X6NA 4M3TA 4JRPA 1TL3A 3SNNA 1VSMA 4ID1A 3KD1E 4LH4A 5HRPA 4H4OA 3HP6A 3M8SA 4CECA 5DK5A 1BIUA 5J2QA 1TL1A 4FJXA 2EHGA 3VA0A 4ELTA 3ZT4A 4AHSA 3CFOA 1L3VA 3WNEA 2PY5A 3V81A 1JLEA 3AO5A 4CGFA 4FLTA 4KHWA 1JLQA 3ALYA 1UWBA 2XY8A 3AVLA 4OPKA 4Q5VA 4AHVA 1TKTA 4O0JA 4CFDA 3I8DA 2G8HA 3RMBA 3MXIA 2HB5A 4CJTA 5HROA 3IS9A 3NBPA 3QINA 4DTNA 1EX4A 4CK1A 3MECA 4DQPA 2BDPA 4KHYA 1VSDA 3OYEA 1LW0A 3TAGA 3OYNA 3PUFA 3ZCMA 1WNSA 2PZSA 4C8KA 3TR8A 2OPSA 4CF9A 4DSEA 4DFJA 4J2EA 1RT2A 3AA5X 1CZBA 1S1VA 3ZSZA 3OYMA 2VWKA 3ZSYA 4XIUA 4M45A 4ZTJA 4KPYA 1RT6A 4KI6A 4CERA 1RILA 2NUBA 4BACA 3C6TA 2ATQA 1NK8A 4B9UA 3OYDA 1ITGA 4FZZA 1Q9XA 3HJFA 1ASUA 2YHBA 4F3OA 4KV8A 3TAQA 4O44A 1VSIA 3TWHA 3HP9A 3QEXA 4B9SA 4B9TA 2KZMA 3V1RA 4IFYA 1QE1A 4FJIA 4FCYA 3HSTB 4AHUA 4CEBA 4LH5A 4FM1A 1DLOA 3H08A 3HVTA 3LALA 2GUIA 2YNFA 3SUQA 4CHYA 2B6AA 3M8QA 3EZ5A 2OA8A 1JLCA 1GOBA 1CZ9A 2XRIA 3K5OA 1JLFA 5EU7A 5KGWA 2OYQA 4IG0A 2DFHA 2B4JA 2D0AA 1BCOA 1CXUA 3QIPA 3VQQA 4B9NA 3NH0A 4O4GA 4DTXA 3KK3A 4CEAA 4HUFA 2ETJA 4OGEA 5J2MA 4KI4A 1BHLA 3E01A 2IOCA 3VQ9A 2A1SA 3DMJA 3T1AA 2HHUA 3LP3A 1TK8A 5K14A 1T7PA 4N56A 2XY6A 1GOAA 1WSGA 5CZ1A 1Z26A 2EX3A 3OY9A 3OYAA 3V4IA 3RRGA 4KB0A 1L3SA 1LAVA 1RT5A 4IDKA 2F96A 4KTQA 1GOCA 2G8KA 1S5JA 3LAKA 3ZT1A 3DLKA 3RR7A 4N5SA 3SUOA 1J53A 3U6FA 1RNHA 3OYBA 4W5TA 4DFPA 4DWIA 4YNQA 4NCBA 3AVBA 3SPYA 3QEWA 4MQ3A 4LY7A 1RT7A 3QEVA 5C24A 4E3SA 1HMVA 1JL1A 1RDDA 1TGOA 3K58A 4IKFA 2IAJA 1Q9YA 4FVMA 4BDYA 4C8LA 4CEOA 4HHTA 3KTQA 3K5NA 3KLHA 2OZSA 2IDOA 4FJ7A 4CE9A 1S1WA 4O5BA 5KGXA 4Z4IA 1RT1A 1IG9A 1I3AA 1TVRA 4ZTFA 4B9MA 2QKBA 1B9DA 4DG1A 1TKXA 2RKIA 2RPIA 3VQ7A 4E1MA 1BI4A 1TAQA 3ZSRA 4ZHRA 1NK7A 1T03A 3HVRA 3KD5E 4CHPA 4F4KA 4PQUA 1QS4A 1EP4A 3I0SA 1VSLA 3G10A 4IG3A 2HNDA 4NYNA 4RW6A 4CJLA 1J54A 4PY5A 2ZD1A 3G0ZA 4GMJB 4AHTA 1S6QA 3OYCA 4Z0UA 3F73A 1K6YA 4E7KA 3V9SA 4DS4A 1UOCA 4CJRA 3DLHA 1W9HA 1ZYQA 2DTUA 4K8ZA 3SCXA 1N6QA 2IGIA 4CFAA 3IAYA 5E41A 3AVCA 4KFBA 1TK5A 2G8WA 1S1XA 3OVNA 2FBVA 3KLEA 1WAJA 1HPZA 3UIQA 4KO0A 3VQEA 4FM2A 4KHSA 1JL2A 3ZT2A 3QIOA 1SKRA 4E1NA 4B08A 4DSJA 1JLBA 1RDBA 3AVIA 3U3GA 4TSXA 4FZXC 2GV9A 1KVCA 4CJVA 1ZBIA 1C0TA 3SYZA 3V1OA 4KTWA 3RTVA 3PX0A 1IKVA 3SUNA 2BANA 3HPHA 4DU4A 1TKDA 4FXDA 1C1BA 5KRSA 1R0AA 1RCHA 1T8EA 2X78A 4BE2A 1VRUA 4CHZA 2VG7A 4EP4A 2FBTA 3SPZA 4FJGA 2IC3A 3K57A 2PYJA 4FLZA 2YKNA 4WE1A 4HUEA 3MEEA 1B9FA 4CFBA 3NE6A 4KHNA 3NGZA 1T05A 4LD0A 3OS1A 4CF8A 3ULDA 1U47A 4FZYA 4M3YA 4FK4A 1UAXA 2X74A 3LP2A 3S3MA 4DTJA 1A5WA 1VK0A 1XWLA 4LSNA 4H4MA 3OJUA 4BDPA 3HK2A 4I7FA 1HJRA 4CK2A 4K8XA 1EETA 4M3UA 4FJ5A 1WSHA 4Z4HA 3SJJA 1KCFA 3OYKA 3AVJA 1SKSA 3EYZA 3VQBA 2D5RA 4CCHA 3L2RA 1U48A 4E0DA 5KI6A 4J2BA 3HT3A 4B9VA 2YNIA 4FM0A 3T3FA 4MFBA 4FJMA 4FYDA 4CGHA 1LV5A 2HMIA 4YFUA 1C1CA 3TANA 1KVBA 4O0IA 4DQRA 2FBYA 2Y1IA 4CGDA 3AVNA 3RR8A 2HNYA 1JXEA 1W0HA 5FRNA 3FFIA 3RMCA 4CF1A 3QEPA 4O55A 1D8YA 2KZZA 1WN7A 3M8PA 1IKYA 2Z1IA 3VQAA 4CGJA 4EP5A 5T7BA 4RG8A 4BE1A 3U3YA 3AO2A 4RW9A 4CEEA 1RTDA 1L3UA 1RBSA 4Y1CA 2P1JA 3AO3A 3DI6A 3L3VA 4HUGA 4B3OA 2XO7A 4FLVA 1FXXA 3NFAA 1LAWA 3NHGA 3KIOA 1NK9A 3ZSVA 2JLEA 3OYFA 1SL2A 1NJXA 2P5OA 1JLAA 5KTQA 5HRNA 3AO4A 4CFCA 4KREA 3K5LA 2DFEA 1XHXA 3NF6A 4OGCA 1G15A 4E7HA 1XI1A 4NYFA 2D0CA 4FLUA 2O4IA 4CIFA 3S9HA 3LAMA 5HRRA 4CJSA 1KSPA 1RBVA 5HBMA 4KB1A 3WNHA 3B6PA 3NF7A 3V9XA 1XHZA 1JKHA 4FK2A 4CJEA 4OKKA 3QNOA 4W5OA 3IG1A 3NH1A 1NOZA 2RN2A 1KLMA 3HYFA 3D45A 3BDPA 3JYTA 3TARA 1X9SA 1HRHA 2ZE2A 1TK0A 4EZ9A 4F2RA 1NOYA 4I9LA 2HHWA 1BQNA 1HYZA 2F8TA 3AA2A 3O3HA 3RWUA 2DY4A 4KHQA 1ZBUA 2O4GA 2D0BA 1HNIA 3DOLA 3AV9A 4C8OA 3ZSOA 3KLFA 4RW4A 3BGRA 5FROA 2XY7A 2R7YA 1QSLA 3K59A 3DM2A 4OVLA 4FJJA 1VSFA 5SZTA 1BGXT 1D9DA 3ITHA 1ZBFA 4E7LA 1LW2A 1RBTA 2E6LA 3VQPA 4W5RA 3ZSXA 3L2UA 3P5JA 3LZJA 3CYMA 3SZ2A 4DQSA 1NJWA 3NF9A 1VRTA 3AVKA 4N76A 1SL0A 4JRQA 1SUQA 4OKJA 3IRXA 4B8CA 3OS2A 2DFFA 2VG6A 3M8RA 1XC9A 4FLYA 4DU3A 4CJWA 2IS3A 3AO1A 3MXJA 4DS5A 4IFVA 3JSMA 4RW8A 2LSNA 3OYJA 5JS2A 3L2WA 4IBNA 3TAMA 3NGYA 5SWMA 3EY1A 1J5OA 1IO2A 1LWFA 3ASMA 3C6UA 3QO9A 4Y1DA 3A2FA 5FDLA 3QNNA 4L8RB 4I9QA 3MEGA 2P5GA 1C0UA 1J9AA 2B5JA 2Y1JA 2YNGA 4DTSA 3B6OA 4CJPA 4CF2A 2HHQA 2G8VA 1A5VA 3CFPA 2XY5A 4FJNA 3TAPA 4HCBA 2GBZA 4I2PA 2YKMA 3SQ4A 1LWEA 3C94A 3LPUA 1NK4A 4J2DA 1JXBA 2WOMA 2OPRA 4DF8A 4KHUA 1YTUA 3KK2A 1X9MA 3DYAA 3LWMA 1U04A 2KQ2A 2P51A 3SQ0A 4DFKA 1QSYA 4J2AA 3LDSA 4Z4GA 1KRPA 3HL8A 4CEDA 5J2NA 3D0PA 2HHTA 4BWJA 3HPGA 3DLGA 2Z1GA 1ASVA 3OYIA 1NJYA 1ASWA 4G1QA 4PUOA 3V9UA 2Z1JA 2KFZA 1I39A 1B92A 3VA3A 4KRFA 1FKPA 3L3UA 5CY4A 3NGIA 4E7IA 4OLAA 3T19A 4W5QA 5I3UA 3PX6A 1EXQA 1RT3A 3P1GA 1FKOA 4AILC 1O1WA 4CEZA 4HTUA 3O4NA 4DTOA 3K5MA 4N47A 2QXFA 4UQGA 3MXMA 3DRSA 3MEDA 3V1QA 4AH9A 1HYVA 4NCAA 1NK6A 3WNGA 3V9WA 4BWMA 3L2VA 4FJ9A 4ELUA 4FLWA 1UA0A 1RT4A 1NK5A 1WSIA 1BCMA 4DSIA 4CJ3A 3C95A 3HO1A 1SL1A 5C25A 4FW2A 3O3FA 3VQDA 1KFSA 2BE2A 1FK9A 1TKZA 4BDZA 3LP0A 3SQ2A 3KJVA 5D3GA 2KFNA 1D5AA 3I0RA 3KKRA 4FW1A 4CJ4A 2OZMA 3PO5A 1RTIA 3K2PA 2KW4A 3OYLA 2ITGA 3TABA 4ELVA 5FRMA 4E19A 3AVHA 2HHSA 1DTTA 4PWDA 3AVMA 4N41A 2QKKA 1IKWA 3DLBA 1VSJA 3TAFA 3CG7A 3NH2A 2YHAA 4RW7A 3QETA 5CYMA 1NKCA 3QERA 5CZ2A
chains in the Genus database with same CATH superfamily
2ZJRL 2QW9A 1S6PA 4ID5A 4M7YA 1YTAA 3KWIA 1NK0A 3FZHA 3P83D 4M41A 3SV4A 4QOZB 3RRHA 4O8UA 1VSHA 3L6QA 1YHQN 1E3MA 4PA1A 1QVFM 4DQIA 1U2VA 3OYGA 4KTZA 3WNFA 3H46O 4LF4K 4M3XA 4R5PA 1ZBHA 1C1AA 4DLEA 4JAXA 4JD2B 2Q3SA 1P90A 4DTMA 1X9WA 4QAGA 1BI4B 1G99A 1IH7A 1N5YA 3PO4A 3L0QA 5HP1A 4KKOA 1BUPA 1SKWA 3I8BA 1IKXA 4PKGA 3WUHA 4B3SK 2G8IA 4M3RA 3VQ4A 1HQEA 1CXQA 2X6SA 1XC3A 3BZKA 4Z4FA 1HPMA 3MN9A 3AVAA 1OH7A 4IXCA 4B9LA 4JLHA 4CHNA 5E26A 1WAFA 4BRLA 1KVAA 4NCGA 3DXKB 3PIOL 3I56N 1D9FA 4DV6K 4OLBA 5HOOA 4YOUA 2Q31A 3NCIA 1ZBLA 4DTPA 3OS0A 4DSFA 3VEZA 4FO0A 3QLHA 4CIGA 2A1RA 1HLUA 3ISNC 4CGGA 5AFUA 4I2QA 1S9EA 2FSNA 1HNVA 4FJHA 3PX4A 2OPQA 3TAEA 3CF5L 1HYSA 2HW3A 3OYHA 3ENOA 3CQ8A 3OHRA 2HHXA 2UU9K 4A62A 3HXMA 3CC7N 1SAZA 4K42A 4YOWA 3HM9A 1LWCA 1BA0A 3AGKA 4JS4A 4Q0BA 1U4BA 1EKEA 2Q0RA 2DPNA 5BPLA 1HNXK 5CYQA 1KTQA 3THYB 1TL3A 3SNNA 1VSMA 4LH4A 5HRPA 3HP6A 1EWQA 2BH1A 4AHSA 2HMPA 4RCHA 2NLXA 2H3GX 2WC9A 3HZ6A 4DV5K 2UUCK 1TKTA 1Q81O 3MECA 3UKUA 1OVQA 3OYNA 3ZCMA 1WNSA 3PSIA 4DFJA 2OTLN 2I7NA 3OYMA 2O8CB 1ATNA 4JEPA 4M45A 1IV0A 1RT6A 4KI6A 3CJ9A 3U9DA 1OVYA 2UXDK 3C6TA 2ATQA 1NK8A 3MMVA 3I33A 4Y0WA 1QQOA 4O44A 3M3ZA 2KZMA 4FJIA 3HSTB 1XNRK 1TYQA 3H08A 1WOQA 4BR7A 3M8QA 3EZ5A 2OYQA 1CXUA 3NH0A 3VEXA 1BHLA 3E01A 2A1SA 3CQYA 1JJ2M 1TK8A 2HHUA 5K14A 4JI4K 3OY9A 3H1QA 4A61A 2YI1A 1C0GA 3ZT1A 3DLKA 2OANA 3SUOA 1NGJA 1J53A 3DLLL 3BY5A 2ASMA 2ZGYA 1RT7A 5C24A 2HBLA 1TGOA 2O8CA 5BR8K 3K58A 1Q9YA 2O8EB 4CEOA 3KTQA 2I7PA 1OH8A 3WXLA 5AQVA 4Z4IA 4IOCL 4B9MA 4MDAA 1B9DA 4DG1A 2E1ZA 1GLBG 2HOEA 4PQUA 3CHWA 1EP4A 3I0SA 3G10A 4NYNA 3G0ZA 1S6QA 2QWOA 3FR0A 3V9SA 2FLOA 1W9HA 4CFAA 3KLEA 1V4SA 1DEJA 1GLEG 3VMFB 1KAXA 3VTIA 4FWQA 1VQKN 4B08A 1W97L 4BR5A 1J6ZA 2HF3A 2GV9A 1KVCA 4BC5A 2ZWHA 1NGAA 3V1OA 4KTWA 3PX0A 3HPHA 1TKDA 2E2QA 2YHYA 2IVPA 1BOTO 2FBTA 4BR4A 4FLZA 4HUEA 2YHWA 1T05A 4FZYA 1NMNA 3OS1A 3ULDA 4GVEA 2E8AA 3OJUA 4LSNA 1WBBA 3FFKB 4CK2A 4K8XA 4WFAL 3HBTA 1KCFA 3OYKA 1N36K 4CCHA 4B9VA 1MWKA 4FM0A 2J4RA 4FYDA 4YFUA 1SZ2A 5C15A 4BRGA 4DQRA 4CGDA 3FFIA 1ATRA 4CF1A 1ZBSA 2G8KA 2Z1IA 1RTDA 2NRVA 3K0SA 1L3UA 1RBSA 3S41A 3K9KA 3PLAA 3NHGA 3M5RA 4C23A 4WQ5C 4KREA 1N34K 2CH5A 4B1XB 4DR4K 2D0CA 3E9LA 3CJCA 3R6MA 5AQOA 5FPNA 1RBVA 4DV4K 3EKUA 3WNHA 4XH4A 4JK8A 3NH1A 2RN2A 3BDPA 3TARA 4DR6K 1X9SA 1S72N 3O80A 4EZ9A 4F2RA 1BA1A 1BQNA 1HYZA 3AA2A 4KHQA 3IDHA 3T1HK 2D0BA 1HNIA 4C8OA 3RSEB 3QBXA 3KLFA 1RGIA 2NRRA 2JWLA 2R7YA 4BGAA 3DM2A 4FJJA 5SZTA 1BGXT 1V4TA 4AF1A 2ZF5O 3FZKA 2O8DB 3HM8A 4DQSA 1SL0A 4YOVA 2DFFA 2VG6A 4PKHA 5JVGL 5JMVA 2IS3A 3DAWA 4BRKA 3OYJA 2P9IA 3H3OB 5SWMA 4FWLA 3QO9A 3A2FA 3QNNA 5I9EB 3MCPA 2B5JA 1EO1A 4B3TK 4CF2A 4B3MK 2HHQA 3ATVA 4EHUA 4BRDA 1HX1A 4JKBA 3TAPA 2GBZA 4I2PA 5KQDA 1LWEA 3LPUA 4BC4A 2OPRA 3DYAA 3SQ0A 1QSYA 4DFKA 1KRPA 3HL8A 3A5LC 1BDGA 2Z1JA 3VA3A 1VQPN 1FKPA 2CGLA 3H1VX 3L3UA 3NGIA 3O9QA 5I3UA 2E88A 3PX6A 3BEXA 1KAZA 4CI6A 3VPZA 2ITMA 4HTUA 5ELZA 3K5MA 4BREA 3MXMA 2W41A 3D2FA 3L2VA 4FLWA 3T1YK 2ASPA 5B8HA 5LMUK 4PL8A 2IVNA 2PBDA 3O3FA 2BE2A 5C2DA 3SQ2A 3KJVA 4FW1A 3OA9A 5M1NA 2NRZA 5FRMA 4E19A 1S3XA 3AVHA 2HHSA 4PWDA 3WXKA 5AQKA 4RW7A 5CE3A 2UYTA 1NKCA 3LP1A 1KFDA 2E20A 3I55N 3WXMB 1MDUB 4A5AA 2ZJQL 4AHCA 4FVUA 4HVJA 2QWRA 1Z25A 3CCSN 4E7JA 3HRGA 4DSLA 5BPNA 1A5XA 3MDQA 3L2QA 2YHXA 3LM2A 4CGIA 4Z4EA 4HCCA 1GLFO 1S1UA 2QI2A 3WQUA 5CR4A 3QESA 2QK9A 3S3OA 3ZSWA 5HLFA 2G8UA 3AAPA 1QZ6A 4FK0A 3AVFA 5AR0A 4OPAA 4H0OA 4CJFA 1KQSM 4BQZA 1RDCA 1L3TA 3GBTA 3KK1A 1WSEA 1HQUA 2CH6A 4FJ8A 1ZC6A 3CJAA 2F4VK 1RTJA 1YAGA 4R79A 4DQQA 2GTDA 3DLEA 4FWMA 1CLQA 5AQLA 4BQLA 1RDAA 4B8AB 3AVGA 3THWB 2Q97A 2P9SB 4CJ5A 4KH5A 5C10A 4AHRA 4EAHD 4C8MA 1WLJA 4JKAA 3VOVA 4DU1A 4BE0A 3RMAA 3O4QA 3UKRB 3KKSA 5TKYA 4ISFA 4DFMA 3OJSA 4Z4CA 2KLAA 4QCLA 4CD1A 4FJKA 4G9ZA 3MCAB 4FWNA 1CZAN 2E2OA 2UXCK 1C6VA 2RE2A 5I42A 1QHTA 2F8SA 1C0MA 2KTQA 3NDKA 4CBXA 4GVMA 3FZMA 3G71N 4YOXA 5EY4A 1IBKK 5IT9O 1QTMA 2G8FA 4F3TA 3PV8A 3O3GA 5M1FA 4DSKA 2VG5A 1TV6A 2YNHA 4H5TA 4ICLA 3KVGA 4DR1K 2NRTA 4DKWA 3LZIA 5AQNA 2HVHA 3GDQA 4M3TA 4JRPA 4H5VA 4ISEA 3THWA 4WFNL 4H4OA 3SBTA 4FWRA 2P9SA 1YJNN 1H1VA 4O5FA 2VQFK 2EHGA 1VQNN 3QFUA 3CFOA 1I94K 3L4IA 3A5MC 4PKIA 3V81A 1YVNA 1WBDA 4JKGB 1E4GT 1BG3A 3ALYA 5LL6Z 2XY8A 3FZLA 4OPHA 2ZM6K 4EHTA 3HSCA 2O8BB 3RMBA 1HKBA 4H0TB 5AQRA 3MXIA 2HB5A 2P9KB 1MA9B 3EE8A 3LL3A 1VSDA 4H0XB 1LW0A 3OYEA 3C6HA 4C8KA 3E66A 4J2EA 3MN6A 1RT2A 4UY8O 2WUSA 1CZBA 1S1VA 3ZSZA 2VWKA 3ZSYA 3CCMN 1D4XA 4RTFD 4B9UA 4ISGA 1Q9XA 1ASUA 4F3OA 3TWHA 4BRQA 3CCLN 4B9SA 5LY3A 3G6EN 4C1NK 4AHUA 3GOIA 3D2EB 5AQPA 1VQ6N 2YNFA 1CZ9A 2XRIA 3K5OA 1JLFA 3SAFA 4RWTA 2DFHA 2D0AA 3EEQA 3VQQA 3JXUA 3KK3A 4DTXA 4CEAA 4HUFA 4KI4A 1GLJO 3T1AA 3LP3A 1T7PA 4AM7A 4KHPK 2XY6A 1WSGA 3RRGA 1YJ9N 4JK9A 4JNEA 4KTQA 4DV0K 4IEIA 3U6FA 1RNHA 4KH6A 3D6RA 3AVBA 3QFPA 2QXLA 5AQQA 3QEVA 1JL1A 4FVMA 4C8LA 3MWPA 1TUUA 3QB0A 3VERA 5AFUH 5AQXA 4FJ7A 1VQMN 1S1WA 4O5BA 3HTVA 4ZTFA 4JD2A 2QKBA 2E1YA 1TKXA 2RKIA 3D2EA 2RPIA 4E1MA 5LJWA 1BI4A 3KD5E 5KPZA 3SAHA 1WB9A 1VSLA 3O9SA 2ZD1A 4GMJB 1K6YA 4DS4A 1XUPO 4CJRA 5IWAK 4FWSA 2A3ZA 5E41A 1C0FA 2AP1A 3OVNA 5KQ8A 2FBVA 1WAJA 4YDUA 4BROA 4KO0A 3VQEA 4FM2A 4BGBA 3ZT2A 1SKRA 3AVIA 4TSXA 4CJVA 3SYZA 4JKFA 5F0XA 1DGKN 1X9JA 2QM1A 4WF9L 3VENA 1C1BA 3DXKA 4IDHA 5CHIA 1T8EA 3CCEN 3CJBA 5JVHL 1VRUA 2WFBA 3J7ZO 4JI1K 2VG7A 3NMUA 2IC3A 3MEEA 4CFBA 4CF8A 5GAEP 3S3MA 4CBWA 3C0BA 4BDPA 2QWNA 4H4MA 4I7FA 3TSQA 4M3UA 4FJ5A 3TPQA 4WYBA 3CCJN 4E0DA 4J2BA 3HT3A 3Q7CA 4IFEA 3T3FA 4CGHA 1VQ4N 1LV5A 1C1CA 1QZ5A 3TANA 1KVBA 1T3VA 1VHXA 3MWTA 3AVNA 3RR8A 5FRNA 3QEPA 3J7AP 1WN7A 3M8PA 1IKYA 3CCQN 1NGCA 2HF4A 3THYA 2XO7A 2QEXN 1LAWA 3KIOA 3AGRA 3ZSVA 1SL2A 2P5OA 5KTQA 5HRNA 3AO4A 4CFCA 3QMLA 1OH5A 2HHHK 3NF6A 1XI1A 2GX9A 3LAMA 4IZ9A 3S9HA 3C6AA 2YCHA 3JS6A 5FPDA 5BREA 5HBMA 3C7NB 4KB1A 1XHZA 1NJIO 3VF6A 1JKHA 4W5OA 3EE9A 3O08A 1NOZA 1KLMA 3D45A 1TK0A 4I9LA 3O3HA 1QQMA 4JI6K 2DY4A 4CW7B 4K0KK 2O4GA 4FPBA 4GV6A 5AQUA 2AA4A 2D0OA 5HL7L 4BR0A 3K59A 2V51B 3LM9A 2E6LA 3OBWA 4W5RA 3ZSXA 4BRAA 3L2UA 1NJWA 3CYMA 2ZJPL 3AVKA 3MN7A 4NXNK 4JRQA 1SUQA 3A5OC 4OKJA 4N76A 4B8CA 3OS2A 4JI5K 3M8RA 1XC9A 4FLYA 4DU3A 3MXJA 4B1WB 5JS2A 5GIPA 3EY1A 4XEIA 1J5OA 1IO2A 4X65K 4L8RB 4I9QA 3MEGA 2GUPA 4DTSA 1ILYA 3KK7A 2XY5A 4HCBA 1N33K 3C94A 4CZEA 2BTFA 1JXBA 4EFHA 4DF8A 2IVOA 3KK2A 4Z94A 3LWMA 1U04A 2KQ2A 3ZYYX 4CEDA 2HHTA 4M63C 4BWJA 3J8AA 1ASVA 3CERA 1I39A 1EWRA 5AJ3K 4JI7K 2O8EA 3U4LA 3CXCM 3EN9A 4DTOA 2CGJA 4BC2A 4B1YB 3V1QA 4BR2A 3WNGA 3V9WA 4BWMA 4ELUA 2P9LB 3F5TA 5C12A 1WSIA 1BCMA 1ATSA 4DHYA 5H1SQ 1SL1A 5C25A 4FW2A 1KFSA 3VQDA 4BRCA 3P38A 1TKZA 3LP0A 4JKDA 3VTHA 3K2PA 2HBKA 4FOIA 1NGGA 3AVMA 2QKKA 4DR7K 3CQXA 3DLBA 1RDWX 3QICA 3NH2A 5CYMA 4AM6A 3SV3A 2RF2A 2QWMA 3V9ZA 5BN9A 4LFBK 5M1KA 4BVPA 3CJ7A 1DTQA 3AA4A 4M42A 1IJJA 5KRTA 1GLCG 1QQCA 3EKSA 2I5JA 4FJLA 3VEVA 4DLGA 4CHQA 2GWKA 5M1QA 2Q1NA 3LANA 3MAQA 4M3ZA 1T44A 3VGMA 4CEFA 3CFRA 1U49A 3TI0A 3VN5A 3L8BA 1VQ8N 4CESA 1FW6A 1S1TA 2A41A 4CZKA 4OJRA 1X1PA 2HVIA 4B9QA 3H3NO 2W6KA 3ZT0A 1IG8A 4CJKA 3E9PA 3F9MA 4JS5A 4JN4A 4JK7A 3VQ8A 4MO4A 3M1FA 4DMNA 2YV0X 3SUPA 3QDKA 2VCPA 3QBWA 3SJHA 2BGGA 5AZIB 4H8KA 4E89A 4QS7A 4IEEA 3DXMB 4IO9L 4JI3K 3JAMO 3LPTA 3DLRA 3AY9A 2A40A 4F2SA 4BRMA 1WUAA 1BIZA 2HHVA 1Y97A 2OCEA 4GW6A 2PYLA 3KLIA 4OPJA 4K41A 1BISA 3A5NC 5GINA 2CGKA 1U45A 3KLGA 2JGUA 4JI8K 3RSEA 1OKJA 1YVUA 2Q2RA 5BPMA 4HTLA 1Q18A 3SI6A 4F8RA 4CZMA 2O8DA 3NAEA 4FLXA 4B3RK 1Q8IA 1RTHA 5GIOA 1RBUA 1NWKA 4EZ6A 1WSJA 1JCFA 1T6CA 3VQCA 3ID6A 3WQTA 3DRRA 3BF1A 3S3NA 2QTDA 3V6DA 5AZIA 3RVCA 1KAYA 2X6NA 4LFAK 4ID1A 5FLXO 2V7ZA 3DXMA 3IMXA 4A59A 3MK6A 2F9TA 4A57A 1BIUA 5J2QA 3CC4N 4FJXA 4DR5K 1L3VA 4JKHA 3AO5A 4KHWA 1QQNA 1UWBA 3AVLA 1BO5O 4Q5VA 4AHVA 4O0JA 4BRIA 3I8DA 4CJTA 5HROA 4J8FA 4FOEA 1S22A 3QINA 4DTNA 2PFUA 4DQPA 5BN8A 1TUYA 3O5BA 1YJWN 3CCRN 2OPSA 4DSEA 5M1PA 1LCUA 4WQ5A 4XIUA 4ZTJA 4ILGB 4KPYA 1RILA 2NUBA 3TTFA 1IBLK 3HJFA 1NU0A 3MN5A 2YHBA 2KHOA 3TAQA 1VSIA 3VEWA 1E4FT 2FF3B 4B9TA 3V1RA 1QE1A 4DV1K 4FCYA 4FM1A 4LH5A 4H0VB 1DLOA 3LALA 3F2KA 3CETA 3SUQA 4CHYA 2B6AA 5AQIA 2Q36A 3T7ZA 2P9NB 4I6MB 1M90O 2B4JA 4B9NA 4F9OA 4O4GA 5J2MA 2ETJA 4OGEA 3VQ9A 3ZX3A 2VYPA 1QVGM 4IJNA 2NNWA 3WXJA 1Z26A 2EX3A 1L3SA 1RT5A 2HBMA 1NNEA 3RR7A 4LF8K 4N5SA 3EO3A 3OYBA 4DFPA 4DWIA 4NCBA 3B8AX 4E3SA 1HMVA 1RDDA 1HR0K 4IOXA 1Q7YO 2IAJA 1N8RO 3LDNA 3BUZB 4B1UB 4KBOA 4WFBL 4BDYA 5KPTA 3KLHA 2OZSA 1X3MA 1DKGD 4KH4A 4CE9A 5KGXA 2OTJN 3CPWM 1EQYA 1XMOK 3LDQA 1SS6A 4CVNE 1TVRA 4FWOA 3VQ7A 3ZETB 1TAQA 3ZSRA 4BG9A 4ZHRA 4F4KA 4LF7K 4CHPA 1JCGA 4BR9A 2HNDA 2WBNA 4RW6A 2ASOA 4H5RA 4E7KA 3O9TA 4WQ4C 4YOYA 3DLHA 2DTUA 4K8ZA 1N6QA 2GWJA 2IGIA 4O8KA 3IAYA 1U6ZA 3AVCA 4KFBA 1TK5A 1S1XA 4JYAK 4DSJA 4E1NA 3R1XA 1JLBA 4YOTA 4DR2K 3U3GA 4FZXC 1C0TA 3ATUA 3RTVA 1T6DA 3FGUA 2YX6A 3VGKA 4CHZA 3LDPA 5DM6L 1U2VB 4JKCA 4C1NI 4WE1A 1B9FA 3NE6A 4KHNA 3NGZA 4LD0A 3UKRA 1KC8O 1U47A 4CZGA 2X74A 3U8XA 5BR9A 1VK0A 1XWLA 4MLEA 3HK2A 1Y64A 1HJRA 1WSHA 1K9MO 5AQWA 3AVJA 2D5RA 1U48A 5KI6A 4JV5K 4X66K 4MFBA 4FJMA 1GLLO 2VGNA 2FBYA 4LF5K 2QA4N 2A42A 5ADXA 1R59O 5FPEA 3RMCA 4O55A 2KZZA 3GG4A 4RW9A 4Y1CA 1BWFO 2YJEA 3CPEA 3DI6A 4HUGA 4B3OA 1FXXA 3NFAA 4XH5A 3HI0A 1RFQA 1NJXA 3K5LA 2DFEA 1XHXA 4OGCA 4NYFA 4M7XA 2BUPA 2O4IA 3C65A 1K73O 4JKGA 5HRRA 4X64K 1KSPA 4U67L 4GV9A 1Q82O 3NF7A 3G25A 3V9XA 2O8BA 4QS8A 2P9KA 3TSPA 3JYTA 3SK3A 2ZE2A 1NOYA 5F2RA 2HHWA 4FSVA 3FLCO 1XNQK 3RWUA 4H03B 2NRXA 3D7EO 2A5XA 3DOLA 3AV9A 3ZSOA 4RW4A 4DUYK 1HKGA 1Z05A 5FROA 2XY7A 1QSLA 3CCUN 4OVLA 4PHTX 3KWGA 1VSFA 5AQYA 1D9DA 1RBTA 3LZJA 3SZ2A 1NGEA 3NF9A 3A0IX 1VRTA 3WEEB 4CJ7A 3IRXA 1Q86O 4CJWA 4GNIA 3AO1A 4IFVA 3JSMA 4RW8A 2LSNA 2Q0UA 3SAGA 3TAMA 4OX9K 3VESA 1NGIA 5FDLA 4WQ4A 1NMDA 1C0UA 4LF9K 2Y1JA 3B6OA 5KPRA 2G8VA 1A5VA 4FJNA 1QHAA 2YKMA 1NGBA 4KHUA 1YTUA 1ESVA 1VQON 1X9MA 2P51A 3ZX2A 4J2AA 4Z4GA 3UKUB 3HPGA 4PUOA 1NJYA 3OYIA 4DR3K 1ASWA 4G1QA 2P9PB 2KFZA 1J5EK 4A2AA 3VGLA 4E7IA 5AQHA 4BY9C 1VQLN 4W5QA 4OLAA 1GLDG 3O9RA 1RT3A 3P1GA 1VQ5N 1FKOA 3UB5A 1O1WA 1JCEA 3WEEA 2F9WA 5GAGP 1N32K 4AH9A 4NCAA 3ENBA 5BRHA 1NK6A 4FJ9A 3W3DA 1HNZK 1UA0A 3BF3A 1HJOA 1NGFA 4DSIA 3N4QA 1TYQB 4CJ3A 5EXWA 3HO1A 3OBYA 2JWKA 5AQJA 5D3GA 4BDZA 2KFNA 1D5AA 3I0RA 4CJ4A 1RTIA 3VEOA 2KW4A 4ELVA 3ZLJA 4N41A 1IKWA 3TAFA 1OH6A 3CCVN 4X62K 3CD6N 4DV3K 5CZ2A 3QERA 4CIEA 2D4WA 2NRWA 4M3WA 3VETA 4KAZA 5MLCQ 4DTUA 1VAZA 5AQZA 2P9PA 1HNWK 4BRPA 4CD3A 1QSSA 3R8EA 3CMAN 1RBRA 3J7YP 3MX5A 3IUCA 2Z1HA 1TAUA 1L5UA 1NKBA 1YT3A 2E6MA 5LMNK 1F21A 4CEQA 4QS9A 2OPPA 3MX2A 2VQEK 4CJUA 4DV2K 4CK3A 5JLHA 3ZX0A 1YIJN 2XHBA 5M1OA 2UXBK 2VWJA 1VSEA 2ZGZA 1Z6RA 1BU6O 4IO8A 2W42A 3THVA 4LC9B 5HRSA 4BC3A 5DMRA 3O4WA 1KXPA 3VQ5A 3DOKA 1REVA 4C8NA 2KKZA 2HNZA 3SQ1A 4CJQA 4YY3K 3HPOA 3CM5A 2QWQA 4LSLA 3ZT3A 4NB4A 3ZEUB 4EIAA 3IFRA 3NF8A 1VSKA 5J2PA 3THXB 1LOTB 3CM6A 2ZQBA 3LWLA 4BVOA 1NJZA 3AA3A 2AJQA 5JLFA 3KHYA 3VQ6A 1MU2A 4DF4A 5BRDA 1YF5L 4CF0A 3C7NA 3GE1A 1XMQK 1BQMA 5A2QO 1KLNA 1HKCA 1VQ9N 5J1EA 1S9GA 4WCEL 1JLGA 4W5NA 4DQ8A 3ULEB 1SV5A 3NVKA 2P9UB 5AQTA 4BG8A 2E4LA 4CHOA 3RMDA 1BL3A 2UUAK 5JS1A 1WSFA 2WONA 4CZHA 4MO5A 2GEMA 5C42A 3H45C 3QEIA 4NLCA 4OKEA 3DRPA 4DTRA 1SQKA 4CZIA 1KD1O 3PY8A 3HOTA 3F9KA 2FC0A 5GADP 3ZEUA 1NKEA 3CMEN 1UA1A 4B1ZA 2D1KA 3ZSQA 3O6WA 5BRFA 2E5LK 2FBXA 3THXA 4BRFA 3KD1E 2QWPA 5LJVA 3M8SA 4CECA 3AARA 5JICA 4FWPA 5DK5A 1YUWA 4AQYK 1TL1A 3T69A 3VA0A 4ELTA 3ZT4A 3CJ1A 3WNEA 2PY5A 5EX5A 1JLEA 2W40A 4CGFA 4FLTA 4GY2B 1JLQA 4OPKA 1K8KB 4CFDA 1GLAG 2E2NA 2FF6A 4GKKK 2G8HA 2W6LA 3ULEA 3R9PA 4U7BA 2P9UA 3IS9A 3G4SN 3NBPA 4CZLA 4KHYA 1EX4A 4CK1A 2BDPA 3TAGA 1NGDA 3PUFA 4H0PA 1W7AA 2PZSA 3TR8A 3O1WA 4CF9A 3N4PA 3AA5X 3R3LA 2NRHA 2VWBA 1VQ7N 4H0YB 4CERA 5F1XA 4K43A 3WT0A 4BACA 4FZZA 3OYDA 1ITGA 4KV8A 3HP9A 3J80O 3QEXA 4IFYA 3NVMA 3GL1A 2P9LA 4CEBA 3J81O 2V52B 3HVTA 2GUIA 3U9ZA 2P9IB 2OA8A 1JLCA 1GOBA 5KGWA 5EU7A 3SLCA 4IG0A 1NBWA 1BCOA 3QIPA 1K8AO 4B1VA 2IOCA 3DMJA 1W2BM 1K8KA 4IOAL 4N56A 1GOAA 5CZ1A 3OYAA 4KB0A 3V4IA 4ILHA 1LAVA 4IDKA 2F96A 1GOCA 1S5JA 4JKEA 1NM1A 3LAKA 4YORA 4W5TA 4YNQA 1IBMK 3SPYA 3QEWA 4MQ3A 4LY7A 4IKFA 1RDUA 4HHTA 1FJGK 3K5NA 2IDOA 2D0PA 3PSFA 1RT1A 1IG9A 1HUXA 1I3AA 3D2FB 3KZBA 1X3NA 4DUZK 4ILJA 1T03A 1NK7A 1M1KO 3HVRA 3ENHA 1QS4A 4XH1A 4IG3A 4BRHA 3HOSA 4CJLA 1J54A 4PY5A 3A8YA 4AHTA 3OYCA 4Z0UA 3F73A 3CIPA 4FWKA 1UOCA 2FXUA 1ZYQA 3SCXA 3PIPL 3H6EA 2G8WA 4FL9A 3FZFA 1HPZA 3UIQA 4KHSA 1JL2A 3QIOA 1RDBA 5E84A 1ZBIA 1P8ZA 3LDOA 1O13A 1IKVA 3SUNA 2BANA 4DU4A 4FXDA 3SMSA 5KRSA 1R0AA 1RCHA 2X78A 4BE2A 4EP4A 3BP8A 5GAHP 3SPZA 4FJGA 5DM7L 4BRNA 3K57A 2PYJA 2YKNA 3DJCA 3VEYA 4A2BA 4FK4A 4NO7A 4M3YA 1NG9A 1UAXA 5EOYA 3LP2A 5C0YA 3M6GA 4DTJA 1MWMA 1A5WA 3O8MA 1YITN 3DWLA 4JHDB 1EETA 4Z4HA 3SJJA 1SKSA 3EYZA 3VQBA 3L2RA 4CZJA 2YNIA 4IWVA 2QWLA 2HMIA 3SMPA 2FSJA 4O0IA 2Y1IA 3Q7BA 4H5NA 2HNYA 1JXEA 1W0HA 5FPMA 1D8YA 5AQMA 3L4QA 5AQFA 3VQAA 4CGJA 3AAQA 4EP5A 4BE1A 5T7BA 4RG8A 3U3YA 3AO2A 3EZWA 4CEEA 3TSUA 4OO1J 4K25A 2P1JA 3AO3A 3L3VA 3K9JA 4FLVA 1NK9A 4LFCK 2JLEA 4PL7A 3OYFA 1JLAA 2O8FB 2WTUA 4MDBA 1G15A 4E7HA 4FLUA 1NGHA 1ZXOA 4CIFA 2A6AA 4CJSA 3IKMA 3B6PA 4FK2A 5C2FA 4CJEA 4OKKA 3QNOA 4JHDA 3IG1A 3HYFA 1HRHA 2GELA 2F8TA 4YHHK 3FE1A 1ZBUA 4GKJK 4L3QA 2IIRA 3BGRA 4HWIA 4NLBA 2VGMA 3ITHA 1ZBFA 4E7LA 1LW2A 3LDLA 3VF4A 3VQPA 3OW2M 3P5JA 4LF6K 2RHKA 3E1YA 4FPAA 3O1BA 5AQSA 4DS5A 3UE5A 1XQSC 3BZCA 3P39A 3L2WA 4IBNA 3OTOK 2P9NA 2EWSA 3NGYA 2O8FA 4I6MA 1LWFA 3ASMA 3C6UA 4Y1DA 3CC2N 2P5GA 1J9AA 5AZJB 2YNGA 4CJPA 4GV3A 3CFPA 1YI2N 2V7YA 3SQ4A 1NK4A 4J2DA 2WOMA 4V19S 4NXMK 3TTDA 3LDSA 5J2NA 3EL2A 3D0PA 3P4IA 4MLHA 3DLGA 2Z1GA 3VF2A 3V9UA 3SBGA 4A5BA 1B92A 4KRFA 1NLVA 1DT9A 5CY4A 3T19A 4DB3A 3P31A 1EXQA 4H5WA 5TKWA 4IJAA 4AILC 2NZTA 4YDUC 3W0LA 4E1JA 4CEZA 3O4NA 1YXQA 2UUBK 3O9UA 4N47A 2QXFA 4UQGA 3DRSA 3MEDA 4DCHA 1HYVA 3ID8A 2FSKA 3ZETA 1RT4A 3TU5A 1NK5A 2F7TA 3WXIA 4CBUA 5ADXH 3C95A 4JI2K 1FK9A 5EVZA 3KKRA 4JI0K 2OZMA 3PO5A 2E2PA 2HBJA 3TABA 3OYLA 2ITGA 3TTCA 5AZJA 4DV7K 4CZFA 1DTTA 2PAVA 2YJFA 2HSTA 3CI5A 3E9OA 5AQGA 1VSJA 3CG7A 2YHAA 3QETA
chains in the Genus database with same CATH topology
4CIEA 3SV3A 4M3WA 2RF2A 1S6PA 4ID5A 3LP1A 1KFDA 1YTAA 3V9ZA 4DTUA 1NK0A 3P83D 4KAZA 1QSSA 1DTQA 4M41A 1RBRA 3SV4A 3RRHA 4QOZB 3AA4A 4M42A 1VSHA 4AHCA 1TAUA 2Z1HA 4HVJA 5KRTA 1L5UA 1QQCA 4PA1A 1Z25A 1NKBA 1YT3A 4E7JA 2E6MA 4DQIA 2I5JA 3OYGA 4KTZA 3WNFA 4FJLA 1F21A 4CEQA 2OPPA 4DSLA 4CJUA 4DLGA 4M3XA 1A5XA 4CHQA 4CK3A 1C1AA 4R5PA 3L2QA 4DLEA 1ZBHA 2XHBA 4CGIA 2VWJA 3LANA 4HCCA 4Z4EA 1VSEA 3MAQA 4M3ZA 1S1UA 2Q3SA 1X9WA 4DTMA 4CEFA 2W42A 3CFRA 4QAGA 3THVA 5HRSA 1U49A 5DMRA 3QESA 1BI4B 1IH7A 3TI0A 3VN5A 2QK9A 3L8BA 3ZSWA 3S3OA 5HLFA 1N5YA 3PO4A 5HP1A 4CESA 4KKOA 1S1TA 4OJRA 3VQ5A 2G8UA 1SKWA 1X1PA 4FK0A 3AVFA 1REVA 3DOKA 2HVIA 4C8NA 1IKXA 3ZT0A 4CJKA 4CJFA 2G8IA 4M3RA 3VQ4A 1RDCA 1L3TA 3KK1A 1HQEA 1WSEA 1HQUA 2HNZA 3SQ1A 1CXQA 4CJQA 3HPOA 4JS5A 4FJ8A 2X6SA 3CM5A 4LSLA 3ZT3A 4Z4FA 3VQ8A 4DMNA 2YV0X 1RTJA 3NF8A 3SUPA 4DQQA 1VSKA 3AVAA 3DLEA 1CLQA 4B9LA 4JLHA 2BGGA 1RDAA 4H8KA 4B8AB 4E89A 3AVGA 4CHNA 5J2PA 3CM6A 3LWLA 2ZQBA 1WAFA 1KVAA 4NCGA 1NJZA 3AA3A 2AJQA 4CJ5A 3LPTA 3DLRA 1D9FA 3VQ6A 1MU2A 4DF4A 4F2SA 4OLBA 4AHRA 4C8MA 1WLJA 1BIZA 2HHVA 3NCIA 1ZBLA 4CF0A 4DU1A 1Y97A 4DTPA 1BQMA 3OS0A 4BE0A 3O4QA 4DSFA 3RMAA 1KLNA 4GW6A 2PYLA 3KKSA 3QLHA 5J1EA 4CIGA 1S9GA 2A1RA 3KLIA 4OPJA 1JLGA 4W5NA 3ISNC 4DFMA 3OJSA 4Z4CA 1BISA 4CGGA 4I2QA 1S9EA 4QCLA 1HNVA 1SV5A 4FJKA 1U45A 4FJHA 3KLGA 3PX4A 2JGUA 2OPQA 3TAEA 1YVUA 2E4LA 1C6VA 1HYSA 4CHOA 2HW3A 3OYHA 1BL3A 3RMDA 5JS1A 5I42A 3SI6A 1WSFA 2WONA 1QHTA 4F8RA 2F8SA 1C0MA 5C42A 3NAEA 4FLXA 3CQ8A 3QEIA 2KTQA 1Q8IA 3DRPA 4OKEA 3HXMA 3NDKA 4DTRA 2HHXA 1RTHA 4GVMA 1RBUA 4EZ6A 3PY8A 1WSJA 3HM9A 1LWCA 3VQCA 3F9KA 2FC0A 1QTMA 1NKEA 2G8FA 4F3TA 3DRRA 4JS4A 3PV8A 4Q0BA 1U4BA 3O3GA 1EKEA 3S3NA 1UA1A 2VG5A 1TV6A 2YNHA 4ICLA 3V6DA 4DSKA 3ZSQA 5CYQA 1KTQA 3LZIA 2FBXA 2HVHA 2X6NA 4M3TA 4JRPA 1TL3A 3SNNA 1VSMA 4ID1A 3KD1E 4LH4A 5HRPA 4H4OA 3HP6A 3M8SA 4CECA 5DK5A 1BIUA 5J2QA 1TL1A 4FJXA 2EHGA 3VA0A 4ELTA 3ZT4A 4AHSA 3CFOA 1L3VA 3WNEA 2PY5A 3V81A 1JLEA 3AO5A 4CGFA 4FLTA 4KHWA 1JLQA 3ALYA 1UWBA 2XY8A 3AVLA 4OPKA 4Q5VA 4AHVA 1TKTA 4O0JA 4CFDA 3I8DA 2G8HA 3RMBA 3MXIA 2HB5A 4CJTA 5HROA 3IS9A 3NBPA 3QINA 4DTNA 1EX4A 4CK1A 3MECA 4DQPA 2BDPA 4KHYA 1VSDA 3OYEA 1LW0A 3TAGA 3OYNA 3PUFA 3ZCMA 1WNSA 2PZSA 4C8KA 3TR8A 2OPSA 4CF9A 4DSEA 4DFJA 4J2EA 1RT2A 3AA5X 1CZBA 1S1VA 3ZSZA 3OYMA 2VWKA 3ZSYA 4XIUA 4M45A 4ZTJA 4KPYA 1RT6A 4KI6A 4CERA 1RILA 2NUBA 4BACA 3C6TA 2ATQA 1NK8A 4B9UA 3OYDA 1ITGA 4FZZA 1Q9XA 3HJFA 1ASUA 2YHBA 4F3OA 4KV8A 3TAQA 4O44A 1VSIA 3TWHA 3HP9A 3QEXA 4B9SA 4B9TA 2KZMA 3V1RA 4IFYA 1QE1A 4FJIA 4FCYA 3HSTB 4AHUA 4CEBA 4LH5A 4FM1A 1DLOA 3H08A 3HVTA 3LALA 2GUIA 2YNFA 3SUQA 4CHYA 2B6AA 3M8QA 3EZ5A 2OA8A 1JLCA 1GOBA 1CZ9A 2XRIA 3K5OA 1JLFA 5EU7A 5KGWA 2OYQA 4IG0A 2DFHA 2B4JA 2D0AA 1BCOA 1CXUA 3QIPA 3VQQA 4B9NA 3NH0A 4O4GA 4DTXA 3KK3A 4CEAA 4HUFA 2ETJA 4OGEA 5J2MA 4KI4A 1BHLA 3E01A 2IOCA 3VQ9A 2A1SA 3DMJA 3T1AA 2HHUA 3LP3A 1TK8A 5K14A 1T7PA 4N56A 2XY6A 1GOAA 1WSGA 5CZ1A 1Z26A 2EX3A 3OY9A 3OYAA 3V4IA 3RRGA 4KB0A 1L3SA 1LAVA 1RT5A 4IDKA 2F96A 4KTQA 1GOCA 2G8KA 1S5JA 3LAKA 3ZT1A 3DLKA 3RR7A 4N5SA 3SUOA 1J53A 3U6FA 1RNHA 3OYBA 4W5TA 4DFPA 4DWIA 4YNQA 4NCBA 3AVBA 3SPYA 3QEWA 4MQ3A 4LY7A 1RT7A 3QEVA 5C24A 4E3SA 1HMVA 1JL1A 1RDDA 1TGOA 3K58A 4IKFA 2IAJA 1Q9YA 4FVMA 4BDYA 4C8LA 4CEOA 4HHTA 3KTQA 3K5NA 3KLHA 2OZSA 2IDOA 4FJ7A 4CE9A 1S1WA 4O5BA 5KGXA 4Z4IA 1RT1A 1IG9A 1I3AA 1TVRA 4ZTFA 4B9MA 2QKBA 1B9DA 4DG1A 1TKXA 2RKIA 2RPIA 3VQ7A 4E1MA 1BI4A 1TAQA 3ZSRA 4ZHRA 1NK7A 1T03A 3HVRA 3KD5E 4CHPA 4F4KA 4PQUA 1QS4A 1EP4A 3I0SA 1VSLA 3G10A 4IG3A 2HNDA 4NYNA 4RW6A 4CJLA 1J54A 4PY5A 2ZD1A 3G0ZA 4GMJB 4AHTA 1S6QA 3OYCA 4Z0UA 3F73A 1K6YA 4E7KA 3V9SA 4DS4A 1UOCA 4CJRA 3DLHA 1W9HA 1ZYQA 2DTUA 4K8ZA 3SCXA 1N6QA 2IGIA 4CFAA 3IAYA 5E41A 3AVCA 4KFBA 1TK5A 2G8WA 1S1XA 3OVNA 2FBVA 3KLEA 1WAJA 1HPZA 3UIQA 4KO0A 3VQEA 4FM2A 4KHSA 1JL2A 3ZT2A 3QIOA 1SKRA 4E1NA 4B08A 4DSJA 1JLBA 1RDBA 3AVIA 3U3GA 4TSXA 4FZXC 2GV9A 1KVCA 4CJVA 1ZBIA 1C0TA 3SYZA 3V1OA 4KTWA 3RTVA 3PX0A 1IKVA 3SUNA 2BANA 3HPHA 4DU4A 1TKDA 4FXDA 1C1BA 5KRSA 1R0AA 1RCHA 1T8EA 2X78A 4BE2A 1VRUA 4CHZA 2VG7A 4EP4A 2FBTA 3SPZA 4FJGA 2IC3A 3K57A 2PYJA 4FLZA 2YKNA 4WE1A 4HUEA 3MEEA 1B9FA 4CFBA 3NE6A 4KHNA 3NGZA 1T05A 4LD0A 3OS1A 4CF8A 3ULDA 1U47A 4FZYA 4M3YA 4FK4A 1UAXA 2X74A 3LP2A 3S3MA 4DTJA 1A5WA 1VK0A 1XWLA 4LSNA 4H4MA 3OJUA 4BDPA 3HK2A 4I7FA 1HJRA 4CK2A 4K8XA 1EETA 4M3UA 4FJ5A 1WSHA 4Z4HA 3SJJA 1KCFA 3OYKA 3AVJA 1SKSA 3EYZA 3VQBA 2D5RA 4CCHA 3L2RA 1U48A 4E0DA 5KI6A 4J2BA 3HT3A 4B9VA 2YNIA 4FM0A 3T3FA 4MFBA 4FJMA 4FYDA 4CGHA 1LV5A 2HMIA 4YFUA 1C1CA 3TANA 1KVBA 4O0IA 4DQRA 2FBYA 2Y1IA 4CGDA 3AVNA 3RR8A 2HNYA 1JXEA 1W0HA 5FRNA 3FFIA 3RMCA 4CF1A 3QEPA 4O55A 1D8YA 2KZZA 1WN7A 3M8PA 1IKYA 2Z1IA 3VQAA 4CGJA 4EP5A 5T7BA 4RG8A 4BE1A 3U3YA 3AO2A 4RW9A 4CEEA 1RTDA 1L3UA 1RBSA 4Y1CA 2P1JA 3AO3A 3DI6A 3L3VA 4HUGA 4B3OA 2XO7A 4FLVA 1FXXA 3NFAA 1LAWA 3NHGA 3KIOA 1NK9A 3ZSVA 2JLEA 3OYFA 1SL2A 1NJXA 2P5OA 1JLAA 5KTQA 5HRNA 3AO4A 4CFCA 4KREA 3K5LA 2DFEA 1XHXA 3NF6A 4OGCA 1G15A 4E7HA 1XI1A 4NYFA 2D0CA 4FLUA 2O4IA 4CIFA 3S9HA 3LAMA 5HRRA 4CJSA 1KSPA 1RBVA 5HBMA 4KB1A 3WNHA 3B6PA 3NF7A 3V9XA 1XHZA 1JKHA 4FK2A 4CJEA 4OKKA 3QNOA 4W5OA 3IG1A 3NH1A 1NOZA 2RN2A 1KLMA 3HYFA 3D45A 3BDPA 3JYTA 3TARA 1X9SA 1HRHA 2ZE2A 1TK0A 4EZ9A 4F2RA 1NOYA 4I9LA 2HHWA 1BQNA 1HYZA 2F8TA 3AA2A 3O3HA 3RWUA 2DY4A 4KHQA 1ZBUA 2O4GA 2D0BA 1HNIA 3DOLA 3AV9A 4C8OA 3ZSOA 3KLFA 4RW4A 3BGRA 5FROA 2XY7A 2R7YA 1QSLA 3K59A 3DM2A 4OVLA 4FJJA 1VSFA 5SZTA 1BGXT 1D9DA 3ITHA 1ZBFA 4E7LA 1LW2A 1RBTA 2E6LA 3VQPA 4W5RA 3ZSXA 3L2UA 3P5JA 3LZJA 3CYMA 3SZ2A 4DQSA 1NJWA 3NF9A 1VRTA 3AVKA 4N76A 1SL0A 4JRQA 1SUQA 4OKJA 3IRXA 4B8CA 3OS2A 2DFFA 2VG6A 3M8RA 1XC9A 4FLYA 4DU3A 4CJWA 2IS3A 3AO1A 3MXJA 4DS5A 4IFVA 3JSMA 4RW8A 2LSNA 3OYJA 5JS2A 3L2WA 4IBNA 3TAMA 3NGYA 5SWMA 3EY1A 1J5OA 1IO2A 1LWFA 3ASMA 3C6UA 3QO9A 4Y1DA 3A2FA 5FDLA 3QNNA 4L8RB 4I9QA 3MEGA 2P5GA 1C0UA 1J9AA 2B5JA 2Y1JA 2YNGA 4DTSA 3B6OA 4CJPA 4CF2A 2HHQA 2G8VA 1A5VA 3CFPA 2XY5A 4FJNA 3TAPA 4HCBA 2GBZA 4I2PA 2YKMA 3SQ4A 1LWEA 3C94A 3LPUA 1NK4A 4J2DA 1JXBA 2WOMA 2OPRA 4DF8A 4KHUA 1YTUA 3KK2A 1X9MA 3DYAA 3LWMA 1U04A 2KQ2A 2P51A 3SQ0A 4DFKA 1QSYA 4J2AA 3LDSA 4Z4GA 1KRPA 3HL8A 4CEDA 5J2NA 3D0PA 2HHTA 4BWJA 3HPGA 3DLGA 2Z1GA 1ASVA 3OYIA 1NJYA 1ASWA 4G1QA 4PUOA 3V9UA 2Z1JA 2KFZA 1I39A 1B92A 3VA3A 4KRFA 1FKPA 3L3UA 5CY4A 3NGIA 4E7IA 4OLAA 3T19A 4W5QA 5I3UA 3PX6A 1EXQA 1RT3A 3P1GA 1FKOA 4AILC 1O1WA 4CEZA 4HTUA 3O4NA 4DTOA 3K5MA 4N47A 2QXFA 4UQGA 3MXMA 3DRSA 3MEDA 3V1QA 4AH9A 1HYVA 4NCAA 1NK6A 3WNGA 3V9WA 4BWMA 3L2VA 4FJ9A 4ELUA 4FLWA 1UA0A 1RT4A 1NK5A 1WSIA 1BCMA 4DSIA 4CJ3A 3C95A 3HO1A 1SL1A 5C25A 4FW2A 3O3FA 3VQDA 1KFSA 2BE2A 1FK9A 1TKZA 4BDZA 3LP0A 3SQ2A 3KJVA 5D3GA 2KFNA 1D5AA 3I0RA 3KKRA 4FW1A 4CJ4A 2OZMA 3PO5A 1RTIA 3K2PA 2KW4A 3OYLA 2ITGA 3TABA 4ELVA 5FRMA 4E19A 3AVHA 2HHSA 1DTTA 4PWDA 3AVMA 4N41A 2QKKA 1IKWA 3DLBA 1VSJA 3TAFA 3CG7A 3NH2A 2YHAA 4RW7A 3QETA 5CYMA 1NKCA 3QERA 5CZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIE A;  3SV3 A;  4M3W A;  2RF2 A;  1S6P A;  4ID5 A;  3LP1 A;  1KFD A;  1YTA A;  3V9Z A;  4DTU A;  1NK0 A;  3P83 D;  4KAZ A;  1QSS A;  1DTQ A;  4M41 A;  1RBR A;  3SV4 A;  3RRH A;  4QOZ B;  3AA4 A;  4M42 A;  1VSH A;  4AHC A;  1TAU A;  2Z1H A;  4HVJ A;  5KRT A;  1L5U A;  1QQC A;  4PA1 A;  1Z25 A;  1NKB A;  1YT3 A;  4E7J A;  2E6M A;  4DQI A;  2I5J A;  3OYG A;  4KTZ A;  3WNF A;  4FJL A;  1F21 A;  4CEQ A;  2OPP A;  4DSL A;  4CJU A;  4DLG A;  4M3X A;  1A5X A;  4CHQ A;  4CK3 A;  1C1A A;  4R5P A;  3L2Q A;  4DLE A;  1ZBH A;  2XHB A;  4CGI A;  2VWJ A;  3LAN A;  4HCC A;  4Z4E A;  1VSE A;  3MAQ A;  4M3Z A;  1S1U A;  2Q3S A;  1X9W A;  4DTM A;  4CEF A;  2W42 A;  3CFR A;  4QAG A;  3THV A;  5HRS A;  1U49 A;  5DMR A;  3QES A;  1BI4 B;  1IH7 A;  3TI0 A;  3VN5 A;  2QK9 A;  3L8B A;  3ZSW A;  3S3O A;  5HLF A;  1N5Y A;  3PO4 A;  5HP1 A;  4CES A;  4KKO A;  1S1T A;  4OJR A;  3VQ5 A;  2G8U A;  1SKW A;  1X1P A;  4FK0 A;  3AVF A;  1REV A;  3DOK A;  2HVI A;  4C8N A;  1IKX A;  3ZT0 A;  4CJK A;  4CJF A;  2G8I A;  4M3R A;  3VQ4 A;  1RDC A;  1L3T A;  3KK1 A;  1HQE A;  1WSE A;  1HQU A;  2HNZ A;  3SQ1 A;  1CXQ A;  4CJQ A;  3HPO A;  4JS5 A;  4FJ8 A;  2X6S A;  3CM5 A;  4LSL A;  3ZT3 A;  4Z4F A;  3VQ8 A;  4DMN A;  2YV0 X;  1RTJ A;  3NF8 A;  3SUP A;  4DQQ A;  1VSK A;  3AVA A;  3DLE A;  1CLQ A;  4B9L A;  4JLH A;  2BGG A;  1RDA A;  4H8K A;  4B8A B;  4E89 A;  3AVG A;  4CHN A;  5J2P A;  3CM6 A;  3LWL A;  2ZQB A;  1WAF A;  1KVA A;  4NCG A;  1NJZ A;  3AA3 A;  2AJQ A;  4CJ5 A;  3LPT A;  3DLR A;  1D9F A;  3VQ6 A;  1MU2 A;  4DF4 A;  4F2S A;  4OLB A;  4AHR A;  4C8M A;  1WLJ A;  1BIZ A;  2HHV A;  3NCI A;  1ZBL A;  4CF0 A;  4DU1 A;  1Y97 A;  4DTP A;  1BQM A;  3OS0 A;  4BE0 A;  3O4Q A;  4DSF A;  3RMA A;  1KLN A;  4GW6 A;  2PYL A;  3KKS A;  3QLH A;  5J1E A;  4CIG A;  1S9G A;  2A1R A;  3KLI A;  4OPJ A;  1JLG A;  4W5N A;  3ISN C;  4DFM A;  3OJS A;  4Z4C A;  1BIS A;  4CGG A;  4I2Q A;  1S9E A;  4QCL A;  1HNV A;  1SV5 A;  4FJK A;  1U45 A;  4FJH A;  3KLG A;  3PX4 A;  2JGU A;  2OPQ A;  3TAE A;  1YVU A;  2E4L A;  1C6V A;  1HYS A;  4CHO A;  2HW3 A;  3OYH A;  1BL3 A;  3RMD A;  5JS1 A;  5I42 A;  3SI6 A;  1WSF A;  2WON A;  1QHT A;  4F8R A;  2F8S A;  1C0M A;  5C42 A;  3NAE A;  4FLX A;  3CQ8 A;  3QEI A;  2KTQ A;  1Q8I A;  3DRP A;  4OKE A;  3HXM A;  3NDK A;  4DTR A;  2HHX A;  1RTH A;  4GVM A;  1RBU A;  4EZ6 A;  3PY8 A;  1WSJ A;  3HM9 A;  1LWC A;  3VQC A;  3F9K A;  2FC0 A;  1QTM A;  1NKE A;  2G8F A;  4F3T A;  3DRR A;  4JS4 A;  3PV8 A;  4Q0B A;  1U4B A;  3O3G A;  1EKE A;  3S3N A;  1UA1 A;  2VG5 A;  1TV6 A;  2YNH A;  4ICL A;  3V6D A;  4DSK A;  3ZSQ A;  5CYQ A;  1KTQ A;  3LZI A;  2FBX A;  2HVH A;  2X6N A;  4M3T A;  4JRP A;  1TL3 A;  3SNN A;  1VSM A;  4ID1 A;  3KD1 E;  4LH4 A;  5HRP A;  4H4O A;  3HP6 A;  3M8S A;  4CEC A;  5DK5 A;  1BIU A;  5J2Q A;  1TL1 A;  4FJX A;  2EHG A;  3VA0 A;  4ELT A;  3ZT4 A;  4AHS A;  3CFO A;  1L3V A;  3WNE A;  2PY5 A;  3V81 A;  1JLE A;  3AO5 A;  4CGF A;  4FLT A;  4KHW A;  1JLQ A;  3ALY A;  1UWB A;  2XY8 A;  3AVL A;  4OPK A;  4Q5V A;  4AHV A;  1TKT A;  4O0J A;  4CFD A;  3I8D A;  2G8H A;  3RMB A;  3MXI A;  2HB5 A;  4CJT A;  5HRO A;  3IS9 A;  3NBP A;  3QIN A;  4DTN A;  1EX4 A;  4CK1 A;  3MEC A;  4DQP A;  2BDP A;  4KHY A;  1VSD A;  3OYE A;  1LW0 A;  3TAG A;  3OYN A;  3PUF A;  3ZCM A;  1WNS A;  2PZS A;  4C8K A;  3TR8 A;  2OPS A;  4CF9 A;  4DSE A;  4DFJ A;  4J2E A;  1RT2 A;  3AA5 X;  1CZB A;  1S1V A;  3ZSZ A;  3OYM A;  2VWK A;  3ZSY A;  4XIU A;  4M45 A;  4ZTJ A;  4KPY A;  1RT6 A;  4KI6 A;  4CER A;  1RIL A;  2NUB A;  4BAC A;  3C6T A;  2ATQ A;  1NK8 A;  4B9U A;  3OYD A;  1ITG A;  4FZZ A;  1Q9X A;  3HJF A;  1ASU A;  2YHB A;  4F3O A;  4KV8 A;  3TAQ A;  4O44 A;  1VSI A;  3TWH A;  3HP9 A;  3QEX A;  4B9S A;  4B9T A;  2KZM A;  3V1R A;  4IFY A;  1QE1 A;  4FJI A;  4FCY A;  3HST B;  4AHU A;  4CEB A;  4LH5 A;  4FM1 A;  1DLO A;  3H08 A;  3HVT A;  3LAL A;  2GUI A;  2YNF A;  3SUQ A;  4CHY A;  2B6A A;  3M8Q A;  3EZ5 A;  2OA8 A;  1JLC A;  1GOB A;  1CZ9 A;  2XRI A;  3K5O A;  1JLF A;  5EU7 A;  5KGW A;  2OYQ A;  4IG0 A;  2DFH A;  2B4J A;  2D0A A;  1BCO A;  1CXU A;  3QIP A;  3VQQ A;  4B9N A;  3NH0 A;  4O4G A;  4DTX A;  3KK3 A;  4CEA A;  4HUF A;  2ETJ A;  4OGE A;  5J2M A;  4KI4 A;  1BHL A;  3E01 A;  2IOC A;  3VQ9 A;  2A1S A;  3DMJ A;  3T1A A;  2HHU A;  3LP3 A;  1TK8 A;  5K14 A;  1T7P A;  4N56 A;  2XY6 A;  1GOA A;  1WSG A;  5CZ1 A;  1Z26 A;  2EX3 A;  3OY9 A;  3OYA A;  3V4I A;  3RRG A;  4KB0 A;  1L3S A;  1LAV A;  1RT5 A;  4IDK A;  2F96 A;  4KTQ A;  1GOC A;  2G8K A;  1S5J A;  3LAK A;  3ZT1 A;  3DLK A;  3RR7 A;  4N5S A;  3SUO A;  1J53 A;  3U6F A;  1RNH A;  3OYB A;  4W5T A;  4DFP A;  4DWI A;  4YNQ A;  4NCB A;  3AVB A;  3SPY A;  3QEW A;  4MQ3 A;  4LY7 A;  1RT7 A;  3QEV A;  5C24 A;  4E3S A;  1HMV A;  1JL1 A;  1RDD A;  1TGO A;  3K58 A;  4IKF A;  2IAJ A;  1Q9Y A;  4FVM A;  4BDY A;  4C8L A;  4CEO A;  4HHT A;  3KTQ A;  3K5N A;  3KLH A;  2OZS A;  2IDO A;  4FJ7 A;  4CE9 A;  1S1W A;  4O5B A;  5KGX A;  4Z4I A;  1RT1 A;  1IG9 A;  1I3A A;  1TVR A;  4ZTF A;  4B9M A;  2QKB A;  1B9D A;  4DG1 A;  1TKX A;  2RKI A;  2RPI A;  3VQ7 A;  4E1M A;  1BI4 A;  1TAQ A;  3ZSR A;  4ZHR A;  1NK7 A;  1T03 A;  3HVR A;  3KD5 E;  4CHP A;  4F4K A;  4PQU A;  1QS4 A;  1EP4 A;  3I0S A;  1VSL A;  3G10 A;  4IG3 A;  2HND A;  4NYN A;  4RW6 A;  4CJL A;  1J54 A;  4PY5 A;  2ZD1 A;  3G0Z A;  4GMJ B;  4AHT A;  1S6Q A;  3OYC A;  4Z0U A;  3F73 A;  1K6Y A;  4E7K A;  3V9S A;  4DS4 A;  1UOC A;  4CJR A;  3DLH A;  1W9H A;  1ZYQ A;  2DTU A;  4K8Z A;  3SCX A;  1N6Q A;  2IGI A;  4CFA A;  3IAY A;  5E41 A;  3AVC A;  4KFB A;  1TK5 A;  2G8W A;  1S1X A;  3OVN A;  2FBV A;  3KLE A;  1WAJ A;  1HPZ A;  3UIQ A;  4KO0 A;  3VQE A;  4FM2 A;  4KHS A;  1JL2 A;  3ZT2 A;  3QIO A;  1SKR A;  4E1N A;  4B08 A;  4DSJ A;  1JLB A;  1RDB A;  3AVI A;  3U3G A;  4TSX A;  4FZX C;  2GV9 A;  1KVC A;  4CJV A;  1ZBI A;  1C0T A;  3SYZ A;  3V1O A;  4KTW A;  3RTV A;  3PX0 A;  1IKV A;  3SUN A;  2BAN A;  3HPH A;  4DU4 A;  1TKD A;  4FXD A;  1C1B A;  5KRS A;  1R0A A;  1RCH A;  1T8E A;  2X78 A;  4BE2 A;  1VRU A;  4CHZ A;  2VG7 A;  4EP4 A;  2FBT A;  3SPZ A;  4FJG A;  2IC3 A;  3K57 A;  2PYJ A;  4FLZ A;  2YKN A;  4WE1 A;  4HUE A;  3MEE A;  1B9F A;  4CFB A;  3NE6 A;  4KHN A;  3NGZ A;  1T05 A;  4LD0 A;  3OS1 A;  4CF8 A;  3ULD A;  1U47 A;  4FZY A;  4M3Y A;  4FK4 A;  1UAX A;  2X74 A;  3LP2 A;  3S3M A;  4DTJ A;  1A5W A;  1VK0 A;  1XWL A;  4LSN A;  4H4M A;  3OJU A;  4BDP A;  3HK2 A;  4I7F A;  1HJR A;  4CK2 A;  4K8X A;  1EET A;  4M3U A;  4FJ5 A;  1WSH A;  4Z4H A;  3SJJ A;  1KCF A;  3OYK A;  3AVJ A;  1SKS A;  3EYZ A;  3VQB A;  2D5R A;  4CCH A;  3L2R A;  1U48 A;  4E0D A;  5KI6 A;  4J2B A;  3HT3 A;  4B9V A;  2YNI A;  4FM0 A;  3T3F A;  4MFB A;  4FJM A;  4FYD A;  4CGH A;  1LV5 A;  2HMI A;  4YFU A;  1C1C A;  3TAN A;  1KVB A;  4O0I A;  4DQR A;  2FBY A;  2Y1I A;  4CGD A;  3AVN A;  3RR8 A;  2HNY A;  1JXE A;  1W0H A;  5FRN A;  3FFI A;  3RMC A;  4CF1 A;  3QEP A;  4O55 A;  1D8Y A;  2KZZ A;  1WN7 A;  3M8P A;  1IKY A;  2Z1I A;  3VQA A;  4CGJ A;  4EP5 A;  5T7B A;  4RG8 A;  4BE1 A;  3U3Y A;  3AO2 A;  4RW9 A;  4CEE A;  1RTD A;  1L3U A;  1RBS A;  4Y1C A;  2P1J A;  3AO3 A;  3DI6 A;  3L3V A;  4HUG A;  4B3O A;  2XO7 A;  4FLV A;  1FXX A;  3NFA A;  1LAW A;  3NHG A;  3KIO A;  1NK9 A;  3ZSV A;  2JLE A;  3OYF A;  1SL2 A;  1NJX A;  2P5O A;  1JLA A;  5KTQ A;  5HRN A;  3AO4 A;  4CFC A;  4KRE A;  3K5L A;  2DFE A;  1XHX A;  3NF6 A;  4OGC A;  1G15 A;  4E7H A;  1XI1 A;  4NYF A;  2D0C A;  4FLU A;  2O4I A;  4CIF A;  3S9H A;  3LAM A;  5HRR A;  4CJS A;  1KSP A;  1RBV A;  5HBM A;  4KB1 A;  3WNH A;  3B6P A;  3NF7 A;  3V9X A;  1XHZ A;  1JKH A;  4FK2 A;  4CJE A;  4OKK A;  3QNO A;  4W5O A;  3IG1 A;  3NH1 A;  1NOZ A;  2RN2 A;  1KLM A;  3HYF A;  3D45 A;  3BDP A;  3JYT A;  3TAR A;  1X9S A;  1HRH A;  2ZE2 A;  1TK0 A;  4EZ9 A;  4F2R A;  1NOY A;  4I9L A;  2HHW A;  1BQN A;  1HYZ A;  2F8T A;  3AA2 A;  3O3H A;  3RWU A;  2DY4 A;  4KHQ A;  1ZBU A;  2O4G A;  2D0B A;  1HNI A;  3DOL A;  3AV9 A;  4C8O A;  3ZSO A;  3KLF A;  4RW4 A;  3BGR A;  5FRO A;  2XY7 A;  2R7Y A;  1QSL A;  3K59 A;  3DM2 A;  4OVL A;  4FJJ A;  1VSF A;  5SZT A;  1BGX T;  1D9D A;  3ITH A;  1ZBF A;  4E7L A;  1LW2 A;  1RBT A;  2E6L A;  3VQP A;  4W5R A;  3ZSX A;  3L2U A;  3P5J A;  3LZJ A;  3CYM A;  3SZ2 A;  4DQS A;  1NJW A;  3NF9 A;  1VRT A;  3AVK A;  4N76 A;  1SL0 A;  4JRQ A;  1SUQ A;  4OKJ A;  3IRX A;  4B8C A;  3OS2 A;  2DFF A;  2VG6 A;  3M8R A;  1XC9 A;  4FLY A;  4DU3 A;  4CJW A;  2IS3 A;  3AO1 A;  3MXJ A;  4DS5 A;  4IFV A;  3JSM A;  4RW8 A;  2LSN A;  3OYJ A;  5JS2 A;  3L2W A;  4IBN A;  3TAM A;  3NGY A;  5SWM A;  3EY1 A;  1J5O A;  1IO2 A;  1LWF A;  3ASM A;  3C6U A;  3QO9 A;  4Y1D A;  3A2F A;  5FDL A;  3QNN A;  4L8R B;  4I9Q A;  3MEG A;  2P5G A;  1C0U A;  1J9A A;  2B5J A;  2Y1J A;  2YNG A;  4DTS A;  3B6O A;  4CJP A;  4CF2 A;  2HHQ A;  2G8V A;  1A5V A;  3CFP A;  2XY5 A;  4FJN A;  3TAP A;  4HCB A;  2GBZ A;  4I2P A;  2YKM A;  3SQ4 A;  1LWE A;  3C94 A;  3LPU A;  1NK4 A;  4J2D A;  1JXB A;  2WOM A;  2OPR A;  4DF8 A;  4KHU A;  1YTU A;  3KK2 A;  1X9M A;  3DYA A;  3LWM A;  1U04 A;  2KQ2 A;  2P51 A;  3SQ0 A;  4DFK A;  1QSY A;  4J2A A;  3LDS A;  4Z4G A;  1KRP A;  3HL8 A;  4CED A;  5J2N A;  3D0P A;  2HHT A;  4BWJ A;  3HPG A;  3DLG A;  2Z1G A;  1ASV A;  3OYI A;  1NJY A;  1ASW A;  4G1Q A;  4PUO A;  3V9U A;  2Z1J A;  2KFZ A;  1I39 A;  1B92 A;  3VA3 A;  4KRF A;  1FKP A;  3L3U A;  5CY4 A;  3NGI A;  4E7I A;  4OLA A;  3T19 A;  4W5Q A;  5I3U A;  3PX6 A;  1EXQ A;  1RT3 A;  3P1G A;  1FKO A;  4AIL C;  1O1W A;  4CEZ A;  4HTU A;  3O4N A;  4DTO A;  3K5M A;  4N47 A;  2QXF A;  4UQG A;  3MXM A;  3DRS A;  3MED A;  3V1Q A;  4AH9 A;  1HYV A;  4NCA A;  1NK6 A;  3WNG A;  3V9W A;  4BWM A;  3L2V A;  4FJ9 A;  4ELU A;  4FLW A;  1UA0 A;  1RT4 A;  1NK5 A;  1WSI A;  1BCM A;  4DSI A;  4CJ3 A;  3C95 A;  3HO1 A;  1SL1 A;  5C25 A;  4FW2 A;  3O3F A;  3VQD A;  1KFS A;  2BE2 A;  1FK9 A;  1TKZ A;  4BDZ A;  3LP0 A;  3SQ2 A;  3KJV A;  5D3G A;  2KFN A;  1D5A A;  3I0R A;  3KKR A;  4FW1 A;  4CJ4 A;  2OZM A;  3PO5 A;  1RTI A;  3K2P A;  2KW4 A;  3OYL A;  2ITG A;  3TAB A;  4ELV A;  5FRM A;  4E19 A;  3AVH A;  2HHS A;  1DTT A;  4PWD A;  3AVM A;  4N41 A;  2QKK A;  1IKW A;  3DLB A;  1VSJ A;  3TAF A;  3CG7 A;  3NH2 A;  2YHA A;  4RW7 A;  3QET A;  5CYM A;  1NKC A;  3QER A;  5CZ2 A; 
#chains in the Genus database with same CATH topology
 2ZJR L;  2QW9 A;  1S6P A;  4ID5 A;  4M7Y A;  1YTA A;  3KWI A;  1NK0 A;  3FZH A;  3P83 D;  4M41 A;  3SV4 A;  4QOZ B;  3RRH A;  4O8U A;  1VSH A;  3L6Q A;  1YHQ N;  1E3M A;  4PA1 A;  1QVF M;  4DQI A;  1U2V A;  3OYG A;  4KTZ A;  3WNF A;  3H46 O;  4LF4 K;  4M3X A;  4R5P A;  1ZBH A;  1C1A A;  4DLE A;  4JAX A;  4JD2 B;  2Q3S A;  1P90 A;  4DTM A;  1X9W A;  4QAG A;  1BI4 B;  1G99 A;  1IH7 A;  1N5Y A;  3PO4 A;  3L0Q A;  5HP1 A;  4KKO A;  1BUP A;  1SKW A;  3I8B A;  1IKX A;  4PKG A;  3WUH A;  4B3S K;  2G8I A;  4M3R A;  3VQ4 A;  1HQE A;  1CXQ A;  2X6S A;  1XC3 A;  3BZK A;  4Z4F A;  1HPM A;  3MN9 A;  3AVA A;  1OH7 A;  4IXC A;  4B9L A;  4JLH A;  4CHN A;  5E26 A;  1WAF A;  4BRL A;  1KVA A;  4NCG A;  3DXK B;  3PIO L;  3I56 N;  1D9F A;  4DV6 K;  4OLB A;  5HOO A;  4YOU A;  2Q31 A;  3NCI A;  1ZBL A;  4DTP A;  3OS0 A;  4DSF A;  3VEZ A;  4FO0 A;  3QLH A;  4CIG A;  2A1R A;  1HLU A;  3ISN C;  4CGG A;  5AFU A;  4I2Q A;  1S9E A;  2FSN A;  1HNV A;  4FJH A;  3PX4 A;  2OPQ A;  3TAE A;  3CF5 L;  1HYS A;  2HW3 A;  3OYH A;  3ENO A;  3CQ8 A;  3OHR A;  2HHX A;  2UU9 K;  4A62 A;  3HXM A;  3CC7 N;  1SAZ A;  4K42 A;  4YOW A;  3HM9 A;  1LWC A;  1BA0 A;  3AGK A;  4JS4 A;  4Q0B A;  1U4B A;  1EKE A;  2Q0R A;  2DPN A;  5BPL A;  1HNX K;  5CYQ A;  1KTQ A;  3THY B;  1TL3 A;  3SNN A;  1VSM A;  4LH4 A;  5HRP A;  3HP6 A;  1EWQ A;  2BH1 A;  4AHS A;  2HMP A;  4RCH A;  2NLX A;  2H3G X;  2WC9 A;  3HZ6 A;  4DV5 K;  2UUC K;  1TKT A;  1Q81 O;  3MEC A;  3UKU A;  1OVQ A;  3OYN A;  3ZCM A;  1WNS A;  3PSI A;  4DFJ A;  2OTL N;  2I7N A;  3OYM A;  2O8C B;  1ATN A;  4JEP A;  4M45 A;  1IV0 A;  1RT6 A;  4KI6 A;  3CJ9 A;  3U9D A;  1OVY A;  2UXD K;  3C6T A;  2ATQ A;  1NK8 A;  3MMV A;  3I33 A;  4Y0W A;  1QQO A;  4O44 A;  3M3Z A;  2KZM A;  4FJI A;  3HST B;  1XNR K;  1TYQ A;  3H08 A;  1WOQ A;  4BR7 A;  3M8Q A;  3EZ5 A;  2OYQ A;  1CXU A;  3NH0 A;  3VEX A;  1BHL A;  3E01 A;  2A1S A;  3CQY A;  1JJ2 M;  1TK8 A;  2HHU A;  5K14 A;  4JI4 K;  3OY9 A;  3H1Q A;  4A61 A;  2YI1 A;  1C0G A;  3ZT1 A;  3DLK A;  2OAN A;  3SUO A;  1NGJ A;  1J53 A;  3DLL L;  3BY5 A;  2ASM A;  2ZGY A;  1RT7 A;  5C24 A;  2HBL A;  1TGO A;  2O8C A;  5BR8 K;  3K58 A;  1Q9Y A;  2O8E B;  4CEO A;  3KTQ A;  2I7P A;  1OH8 A;  3WXL A;  5AQV A;  4Z4I A;  4IOC L;  4B9M A;  4MDA A;  1B9D A;  4DG1 A;  2E1Z A;  1GLB G;  2HOE A;  4PQU A;  3CHW A;  1EP4 A;  3I0S A;  3G10 A;  4NYN A;  3G0Z A;  1S6Q A;  2QWO A;  3FR0 A;  3V9S A;  2FLO A;  1W9H A;  4CFA A;  3KLE A;  1V4S A;  1DEJ A;  1GLE G;  3VMF B;  1KAX A;  3VTI A;  4FWQ A;  1VQK N;  4B08 A;  1W97 L;  4BR5 A;  1J6Z A;  2HF3 A;  2GV9 A;  1KVC A;  4BC5 A;  2ZWH A;  1NGA A;  3V1O A;  4KTW A;  3PX0 A;  3HPH A;  1TKD A;  2E2Q A;  2YHY A;  2IVP A;  1BOT O;  2FBT A;  4BR4 A;  4FLZ A;  4HUE A;  2YHW A;  1T05 A;  4FZY A;  1NMN A;  3OS1 A;  3ULD A;  4GVE A;  2E8A A;  3OJU A;  4LSN A;  1WBB A;  3FFK B;  4CK2 A;  4K8X A;  4WFA L;  3HBT A;  1KCF A;  3OYK A;  1N36 K;  4CCH A;  4B9V A;  1MWK A;  4FM0 A;  2J4R A;  4FYD A;  4YFU A;  1SZ2 A;  5C15 A;  4BRG A;  4DQR A;  4CGD A;  3FFI A;  1ATR A;  4CF1 A;  1ZBS A;  2G8K A;  2Z1I A;  1RTD A;  2NRV A;  3K0S A;  1L3U A;  1RBS A;  3S41 A;  3K9K A;  3PLA A;  3NHG A;  3M5R A;  4C23 A;  4WQ5 C;  4KRE A;  1N34 K;  2CH5 A;  4B1X B;  4DR4 K;  2D0C A;  3E9L A;  3CJC A;  3R6M A;  5AQO A;  5FPN A;  1RBV A;  4DV4 K;  3EKU A;  3WNH A;  4XH4 A;  4JK8 A;  3NH1 A;  2RN2 A;  3BDP A;  3TAR A;  4DR6 K;  1X9S A;  1S72 N;  3O80 A;  4EZ9 A;  4F2R A;  1BA1 A;  1BQN A;  1HYZ A;  3AA2 A;  4KHQ A;  3IDH A;  3T1H K;  2D0B A;  1HNI A;  4C8O A;  3RSE B;  3QBX A;  3KLF A;  1RGI A;  2NRR A;  2JWL A;  2R7Y A;  4BGA A;  3DM2 A;  4FJJ A;  5SZT A;  1BGX T;  1V4T A;  4AF1 A;  2ZF5 O;  3FZK A;  2O8D B;  3HM8 A;  4DQS A;  1SL0 A;  4YOV A;  2DFF A;  2VG6 A;  4PKH A;  5JVG L;  5JMV A;  2IS3 A;  3DAW A;  4BRK A;  3OYJ A;  2P9I A;  3H3O B;  5SWM A;  4FWL A;  3QO9 A;  3A2F A;  3QNN A;  5I9E B;  3MCP A;  2B5J A;  1EO1 A;  4B3T K;  4CF2 A;  4B3M K;  2HHQ A;  3ATV A;  4EHU A;  4BRD A;  1HX1 A;  4JKB A;  3TAP A;  2GBZ A;  4I2P A;  5KQD A;  1LWE A;  3LPU A;  4BC4 A;  2OPR A;  3DYA A;  3SQ0 A;  1QSY A;  4DFK A;  1KRP A;  3HL8 A;  3A5L C;  1BDG A;  2Z1J A;  3VA3 A;  1VQP N;  1FKP A;  2CGL A;  3H1V X;  3L3U A;  3NGI A;  3O9Q A;  5I3U A;  2E88 A;  3PX6 A;  3BEX A;  1KAZ A;  4CI6 A;  3VPZ A;  2ITM A;  4HTU A;  5ELZ A;  3K5M A;  4BRE A;  3MXM A;  2W41 A;  3D2F A;  3L2V A;  4FLW A;  3T1Y K;  2ASP A;  5B8H A;  5LMU K;  4PL8 A;  2IVN A;  2PBD A;  3O3F A;  2BE2 A;  5C2D A;  3SQ2 A;  3KJV A;  4FW1 A;  3OA9 A;  5M1N A;  2NRZ A;  5FRM A;  4E19 A;  1S3X A;  3AVH A;  2HHS A;  4PWD A;  3WXK A;  5AQK A;  4RW7 A;  5CE3 A;  2UYT A;  1NKC A;  3LP1 A;  1KFD A;  2E20 A;  3I55 N;  3WXM B;  1MDU B;  4A5A A;  2ZJQ L;  4AHC A;  4FVU A;  4HVJ A;  2QWR A;  1Z25 A;  3CCS N;  4E7J A;  3HRG A;  4DSL A;  5BPN A;  1A5X A;  3MDQ A;  3L2Q A;  2YHX A;  3LM2 A;  4CGI A;  4Z4E A;  4HCC A;  1GLF O;  1S1U A;  2QI2 A;  3WQU A;  5CR4 A;  3QES A;  2QK9 A;  3S3O A;  3ZSW A;  5HLF A;  2G8U A;  3AAP A;  1QZ6 A;  4FK0 A;  3AVF A;  5AR0 A;  4OPA A;  4H0O A;  4CJF A;  1KQS M;  4BQZ A;  1RDC A;  1L3T A;  3GBT A;  3KK1 A;  1WSE A;  1HQU A;  2CH6 A;  4FJ8 A;  1ZC6 A;  3CJA A;  2F4V K;  1RTJ A;  1YAG A;  4R79 A;  4DQQ A;  2GTD A;  3DLE A;  4FWM A;  1CLQ A;  5AQL A;  4BQL A;  1RDA A;  4B8A B;  3AVG A;  3THW B;  2Q97 A;  2P9S B;  4CJ5 A;  4KH5 A;  5C10 A;  4AHR A;  4EAH D;  4C8M A;  1WLJ A;  4JKA A;  3VOV A;  4DU1 A;  4BE0 A;  3RMA A;  3O4Q A;  3UKR B;  3KKS A;  5TKY A;  4ISF A;  4DFM A;  3OJS A;  4Z4C A;  2KLA A;  4QCL A;  4CD1 A;  4FJK A;  4G9Z A;  3MCA B;  4FWN A;  1CZA N;  2E2O A;  2UXC K;  1C6V A;  2RE2 A;  5I42 A;  1QHT A;  2F8S A;  1C0M A;  2KTQ A;  3NDK A;  4CBX A;  4GVM A;  3FZM A;  3G71 N;  4YOX A;  5EY4 A;  1IBK K;  5IT9 O;  1QTM A;  2G8F A;  4F3T A;  3PV8 A;  3O3G A;  5M1F A;  4DSK A;  2VG5 A;  1TV6 A;  2YNH A;  4H5T A;  4ICL A;  3KVG A;  4DR1 K;  2NRT A;  4DKW A;  3LZI A;  5AQN A;  2HVH A;  3GDQ A;  4M3T A;  4JRP A;  4H5V A;  4ISE A;  3THW A;  4WFN L;  4H4O A;  3SBT A;  4FWR A;  2P9S A;  1YJN N;  1H1V A;  4O5F A;  2VQF K;  2EHG A;  1VQN N;  3QFU A;  3CFO A;  1I94 K;  3L4I A;  3A5M C;  4PKI A;  3V81 A;  1YVN A;  1WBD A;  4JKG B;  1E4G T;  1BG3 A;  3ALY A;  5LL6 Z;  2XY8 A;  3FZL A;  4OPH A;  2ZM6 K;  4EHT A;  3HSC A;  2O8B B;  3RMB A;  1HKB A;  4H0T B;  5AQR A;  3MXI A;  2HB5 A;  2P9K B;  1MA9 B;  3EE8 A;  3LL3 A;  1VSD A;  4H0X B;  1LW0 A;  3OYE A;  3C6H A;  4C8K A;  3E66 A;  4J2E A;  3MN6 A;  1RT2 A;  4UY8 O;  2WUS A;  1CZB A;  1S1V A;  3ZSZ A;  2VWK A;  3ZSY A;  3CCM N;  1D4X A;  4RTF D;  4B9U A;  4ISG A;  1Q9X A;  1ASU A;  4F3O A;  3TWH A;  4BRQ A;  3CCL N;  4B9S A;  5LY3 A;  3G6E N;  4C1N K;  4AHU A;  3GOI A;  3D2E B;  5AQP A;  1VQ6 N;  2YNF A;  1CZ9 A;  2XRI A;  3K5O A;  1JLF A;  3SAF A;  4RWT A;  2DFH A;  2D0A A;  3EEQ A;  3VQQ A;  3JXU A;  3KK3 A;  4DTX A;  4CEA A;  4HUF A;  4KI4 A;  1GLJ O;  3T1A A;  3LP3 A;  1T7P A;  4AM7 A;  4KHP K;  2XY6 A;  1WSG A;  3RRG A;  1YJ9 N;  4JK9 A;  4JNE A;  4KTQ A;  4DV0 K;  4IEI A;  3U6F A;  1RNH A;  4KH6 A;  3D6R A;  3AVB A;  3QFP A;  2QXL A;  5AQQ A;  3QEV A;  1JL1 A;  4FVM A;  4C8L A;  3MWP A;  1TUU A;  3QB0 A;  3VER A;  5AFU H;  5AQX A;  4FJ7 A;  1VQM N;  1S1W A;  4O5B A;  3HTV A;  4ZTF A;  4JD2 A;  2QKB A;  2E1Y A;  1TKX A;  2RKI A;  3D2E A;  2RPI A;  4E1M A;  5LJW A;  1BI4 A;  3KD5 E;  5KPZ A;  3SAH A;  1WB9 A;  1VSL A;  3O9S A;  2ZD1 A;  4GMJ B;  1K6Y A;  4DS4 A;  1XUP O;  4CJR A;  5IWA K;  4FWS A;  2A3Z A;  5E41 A;  1C0F A;  2AP1 A;  3OVN A;  5KQ8 A;  2FBV A;  1WAJ A;  4YDU A;  4BRO A;  4KO0 A;  3VQE A;  4FM2 A;  4BGB A;  3ZT2 A;  1SKR A;  3AVI A;  4TSX A;  4CJV A;  3SYZ A;  4JKF A;  5F0X A;  1DGK N;  1X9J A;  2QM1 A;  4WF9 L;  3VEN A;  1C1B A;  3DXK A;  4IDH A;  5CHI A;  1T8E A;  3CCE N;  3CJB A;  5JVH L;  1VRU A;  2WFB A;  3J7Z O;  4JI1 K;  2VG7 A;  3NMU A;  2IC3 A;  3MEE A;  4CFB A;  4CF8 A;  5GAE P;  3S3M A;  4CBW A;  3C0B A;  4BDP A;  2QWN A;  4H4M A;  4I7F A;  3TSQ A;  4M3U A;  4FJ5 A;  3TPQ A;  4WYB A;  3CCJ N;  4E0D A;  4J2B A;  3HT3 A;  3Q7C A;  4IFE A;  3T3F A;  4CGH A;  1VQ4 N;  1LV5 A;  1C1C A;  1QZ5 A;  3TAN A;  1KVB A;  1T3V A;  1VHX A;  3MWT A;  3AVN A;  3RR8 A;  5FRN A;  3QEP A;  3J7A P;  1WN7 A;  3M8P A;  1IKY A;  3CCQ N;  1NGC A;  2HF4 A;  3THY A;  2XO7 A;  2QEX N;  1LAW A;  3KIO A;  3AGR A;  3ZSV A;  1SL2 A;  2P5O A;  5KTQ A;  5HRN A;  3AO4 A;  4CFC A;  3QML A;  1OH5 A;  2HHH K;  3NF6 A;  1XI1 A;  2GX9 A;  3LAM A;  4IZ9 A;  3S9H A;  3C6A A;  2YCH A;  3JS6 A;  5FPD A;  5BRE A;  5HBM A;  3C7N B;  4KB1 A;  1XHZ A;  1NJI O;  3VF6 A;  1JKH A;  4W5O A;  3EE9 A;  3O08 A;  1NOZ A;  1KLM A;  3D45 A;  1TK0 A;  4I9L A;  3O3H A;  1QQM A;  4JI6 K;  2DY4 A;  4CW7 B;  4K0K K;  2O4G A;  4FPB A;  4GV6 A;  5AQU A;  2AA4 A;  2D0O A;  5HL7 L;  4BR0 A;  3K59 A;  2V51 B;  3LM9 A;  2E6L A;  3OBW A;  4W5R A;  3ZSX A;  4BRA A;  3L2U A;  1NJW A;  3CYM A;  2ZJP L;  3AVK A;  3MN7 A;  4NXN K;  4JRQ A;  1SUQ A;  3A5O C;  4OKJ A;  4N76 A;  4B8C A;  3OS2 A;  4JI5 K;  3M8R A;  1XC9 A;  4FLY A;  4DU3 A;  3MXJ A;  4B1W B;  5JS2 A;  5GIP A;  3EY1 A;  4XEI A;  1J5O A;  1IO2 A;  4X65 K;  4L8R B;  4I9Q A;  3MEG A;  2GUP A;  4DTS A;  1ILY A;  3KK7 A;  2XY5 A;  4HCB A;  1N33 K;  3C94 A;  4CZE A;  2BTF A;  1JXB A;  4EFH A;  4DF8 A;  2IVO A;  3KK2 A;  4Z94 A;  3LWM A;  1U04 A;  2KQ2 A;  3ZYY X;  4CED A;  2HHT A;  4M63 C;  4BWJ A;  3J8A A;  1ASV A;  3CER A;  1I39 A;  1EWR A;  5AJ3 K;  4JI7 K;  2O8E A;  3U4L A;  3CXC M;  3EN9 A;  4DTO A;  2CGJ A;  4BC2 A;  4B1Y B;  3V1Q A;  4BR2 A;  3WNG A;  3V9W A;  4BWM A;  4ELU A;  2P9L B;  3F5T A;  5C12 A;  1WSI A;  1BCM A;  1ATS A;  4DHY A;  5H1S Q;  1SL1 A;  5C25 A;  4FW2 A;  1KFS A;  3VQD A;  4BRC A;  3P38 A;  1TKZ A;  3LP0 A;  4JKD A;  3VTH A;  3K2P A;  2HBK A;  4FOI A;  1NGG A;  3AVM A;  2QKK A;  4DR7 K;  3CQX A;  3DLB A;  1RDW X;  3QIC A;  3NH2 A;  5CYM A;  4AM6 A;  3SV3 A;  2RF2 A;  2QWM A;  3V9Z A;  5BN9 A;  4LFB K;  5M1K A;  4BVP A;  3CJ7 A;  1DTQ A;  3AA4 A;  4M42 A;  1IJJ A;  5KRT A;  1GLC G;  1QQC A;  3EKS A;  2I5J A;  4FJL A;  3VEV A;  4DLG A;  4CHQ A;  2GWK A;  5M1Q A;  2Q1N A;  3LAN A;  3MAQ A;  4M3Z A;  1T44 A;  3VGM A;  4CEF A;  3CFR A;  1U49 A;  3TI0 A;  3VN5 A;  3L8B A;  1VQ8 N;  4CES A;  1FW6 A;  1S1T A;  2A41 A;  4CZK A;  4OJR A;  1X1P A;  2HVI A;  4B9Q A;  3H3N O;  2W6K A;  3ZT0 A;  1IG8 A;  4CJK A;  3E9P A;  3F9M A;  4JS5 A;  4JN4 A;  4JK7 A;  3VQ8 A;  4MO4 A;  3M1F A;  4DMN A;  2YV0 X;  3SUP A;  3QDK A;  2VCP A;  3QBW A;  3SJH A;  2BGG A;  5AZI B;  4H8K A;  4E89 A;  4QS7 A;  4IEE A;  3DXM B;  4IO9 L;  4JI3 K;  3JAM O;  3LPT A;  3DLR A;  3AY9 A;  2A40 A;  4F2S A;  4BRM A;  1WUA A;  1BIZ A;  2HHV A;  1Y97 A;  2OCE A;  4GW6 A;  2PYL A;  3KLI A;  4OPJ A;  4K41 A;  1BIS A;  3A5N C;  5GIN A;  2CGK A;  1U45 A;  3KLG A;  2JGU A;  4JI8 K;  3RSE A;  1OKJ A;  1YVU A;  2Q2R A;  5BPM A;  4HTL A;  1Q18 A;  3SI6 A;  4F8R A;  4CZM A;  2O8D A;  3NAE A;  4FLX A;  4B3R K;  1Q8I A;  1RTH A;  5GIO A;  1RBU A;  1NWK A;  4EZ6 A;  1WSJ A;  1JCF A;  1T6C A;  3VQC A;  3ID6 A;  3WQT A;  3DRR A;  3BF1 A;  3S3N A;  2QTD A;  3V6D A;  5AZI A;  3RVC A;  1KAY A;  2X6N A;  4LFA K;  4ID1 A;  5FLX O;  2V7Z A;  3DXM A;  3IMX A;  4A59 A;  3MK6 A;  2F9T A;  4A57 A;  1BIU A;  5J2Q A;  3CC4 N;  4FJX A;  4DR5 K;  1L3V A;  4JKH A;  3AO5 A;  4KHW A;  1QQN A;  1UWB A;  3AVL A;  1BO5 O;  4Q5V A;  4AHV A;  4O0J A;  4BRI A;  3I8D A;  4CJT A;  5HRO A;  4J8F A;  4FOE A;  1S22 A;  3QIN A;  4DTN A;  2PFU A;  4DQP A;  5BN8 A;  1TUY A;  3O5B A;  1YJW N;  3CCR N;  2OPS A;  4DSE A;  5M1P A;  1LCU A;  4WQ5 A;  4XIU A;  4ZTJ A;  4ILG B;  4KPY A;  1RIL A;  2NUB A;  3TTF A;  1IBL K;  3HJF A;  1NU0 A;  3MN5 A;  2YHB A;  2KHO A;  3TAQ A;  1VSI A;  3VEW A;  1E4F T;  2FF3 B;  4B9T A;  3V1R A;  1QE1 A;  4DV1 K;  4FCY A;  4FM1 A;  4LH5 A;  4H0V B;  1DLO A;  3LAL A;  3F2K A;  3CET A;  3SUQ A;  4CHY A;  2B6A A;  5AQI A;  2Q36 A;  3T7Z A;  2P9N B;  4I6M B;  1M90 O;  2B4J A;  4B9N A;  4F9O A;  4O4G A;  5J2M A;  2ETJ A;  4OGE A;  3VQ9 A;  3ZX3 A;  2VYP A;  1QVG M;  4IJN A;  2NNW A;  3WXJ A;  1Z26 A;  2EX3 A;  1L3S A;  1RT5 A;  2HBM A;  1NNE A;  3RR7 A;  4LF8 K;  4N5S A;  3EO3 A;  3OYB A;  4DFP A;  4DWI A;  4NCB A;  3B8A X;  4E3S A;  1HMV A;  1RDD A;  1HR0 K;  4IOX A;  1Q7Y O;  2IAJ A;  1N8R O;  3LDN A;  3BUZ B;  4B1U B;  4KBO A;  4WFB L;  4BDY A;  5KPT A;  3KLH A;  2OZS A;  1X3M A;  1DKG D;  4KH4 A;  4CE9 A;  5KGX A;  2OTJ N;  3CPW M;  1EQY A;  1XMO K;  3LDQ A;  1SS6 A;  4CVN E;  1TVR A;  4FWO A;  3VQ7 A;  3ZET B;  1TAQ A;  3ZSR A;  4BG9 A;  4ZHR A;  4F4K A;  4LF7 K;  4CHP A;  1JCG A;  4BR9 A;  2HND A;  2WBN A;  4RW6 A;  2ASO A;  4H5R A;  4E7K A;  3O9T A;  4WQ4 C;  4YOY A;  3DLH A;  2DTU A;  4K8Z A;  1N6Q A;  2GWJ A;  2IGI A;  4O8K A;  3IAY A;  1U6Z A;  3AVC A;  4KFB A;  1TK5 A;  1S1X A;  4JYA K;  4DSJ A;  4E1N A;  3R1X A;  1JLB A;  4YOT A;  4DR2 K;  3U3G A;  4FZX C;  1C0T A;  3ATU A;  3RTV A;  1T6D A;  3FGU A;  2YX6 A;  3VGK A;  4CHZ A;  3LDP A;  5DM6 L;  1U2V B;  4JKC A;  4C1N I;  4WE1 A;  1B9F A;  3NE6 A;  4KHN A;  3NGZ A;  4LD0 A;  3UKR A;  1KC8 O;  1U47 A;  4CZG A;  2X74 A;  3U8X A;  5BR9 A;  1VK0 A;  1XWL A;  4MLE A;  3HK2 A;  1Y64 A;  1HJR A;  1WSH A;  1K9M O;  5AQW A;  3AVJ A;  2D5R A;  1U48 A;  5KI6 A;  4JV5 K;  4X66 K;  4MFB A;  4FJM A;  1GLL O;  2VGN A;  2FBY A;  4LF5 K;  2QA4 N;  2A42 A;  5ADX A;  1R59 O;  5FPE A;  3RMC A;  4O55 A;  2KZZ A;  3GG4 A;  4RW9 A;  4Y1C A;  1BWF O;  2YJE A;  3CPE A;  3DI6 A;  4HUG A;  4B3O A;  1FXX A;  3NFA A;  4XH5 A;  3HI0 A;  1RFQ A;  1NJX A;  3K5L A;  2DFE A;  1XHX A;  4OGC A;  4NYF A;  4M7X A;  2BUP A;  2O4I A;  3C65 A;  1K73 O;  4JKG A;  5HRR A;  4X64 K;  1KSP A;  4U67 L;  4GV9 A;  1Q82 O;  3NF7 A;  3G25 A;  3V9X A;  2O8B A;  4QS8 A;  2P9K A;  3TSP A;  3JYT A;  3SK3 A;  2ZE2 A;  1NOY A;  5F2R A;  2HHW A;  4FSV A;  3FLC O;  1XNQ K;  3RWU A;  4H03 B;  2NRX A;  3D7E O;  2A5X A;  3DOL A;  3AV9 A;  3ZSO A;  4RW4 A;  4DUY K;  1HKG A;  1Z05 A;  5FRO A;  2XY7 A;  1QSL A;  3CCU N;  4OVL A;  4PHT X;  3KWG A;  1VSF A;  5AQY A;  1D9D A;  1RBT A;  3LZJ A;  3SZ2 A;  1NGE A;  3NF9 A;  3A0I X;  1VRT A;  3WEE B;  4CJ7 A;  3IRX A;  1Q86 O;  4CJW A;  4GNI A;  3AO1 A;  4IFV A;  3JSM A;  4RW8 A;  2LSN A;  2Q0U A;  3SAG A;  3TAM A;  4OX9 K;  3VES A;  1NGI A;  5FDL A;  4WQ4 A;  1NMD A;  1C0U A;  4LF9 K;  2Y1J A;  3B6O A;  5KPR A;  2G8V A;  1A5V A;  4FJN A;  1QHA A;  2YKM A;  1NGB A;  4KHU A;  1YTU A;  1ESV A;  1VQO N;  1X9M A;  2P51 A;  3ZX2 A;  4J2A A;  4Z4G A;  3UKU B;  3HPG A;  4PUO A;  1NJY A;  3OYI A;  4DR3 K;  1ASW A;  4G1Q A;  2P9P B;  2KFZ A;  1J5E K;  4A2A A;  3VGL A;  4E7I A;  5AQH A;  4BY9 C;  1VQL N;  4W5Q A;  4OLA A;  1GLD G;  3O9R A;  1RT3 A;  3P1G A;  1VQ5 N;  1FKO A;  3UB5 A;  1O1W A;  1JCE A;  3WEE A;  2F9W A;  5GAG P;  1N32 K;  4AH9 A;  4NCA A;  3ENB A;  5BRH A;  1NK6 A;  4FJ9 A;  3W3D A;  1HNZ K;  1UA0 A;  3BF3 A;  1HJO A;  1NGF A;  4DSI A;  3N4Q A;  1TYQ B;  4CJ3 A;  5EXW A;  3HO1 A;  3OBY A;  2JWK A;  5AQJ A;  5D3G A;  4BDZ A;  2KFN A;  1D5A A;  3I0R A;  4CJ4 A;  1RTI A;  3VEO A;  2KW4 A;  4ELV A;  3ZLJ A;  4N41 A;  1IKW A;  3TAF A;  1OH6 A;  3CCV N;  4X62 K;  3CD6 N;  4DV3 K;  5CZ2 A;  3QER A;  4CIE A;  2D4W A;  2NRW A;  4M3W A;  3VET A;  4KAZ A;  5MLC Q;  4DTU A;  1VAZ A;  5AQZ A;  2P9P A;  1HNW K;  4BRP A;  4CD3 A;  1QSS A;  3R8E A;  3CMA N;  1RBR A;  3J7Y P;  3MX5 A;  3IUC A;  2Z1H A;  1TAU A;  1L5U A;  1NKB A;  1YT3 A;  2E6M A;  5LMN K;  1F21 A;  4CEQ A;  4QS9 A;  2OPP A;  3MX2 A;  2VQE K;  4CJU A;  4DV2 K;  4CK3 A;  5JLH A;  3ZX0 A;  1YIJ N;  2XHB A;  5M1O A;  2UXB K;  2VWJ A;  1VSE A;  2ZGZ A;  1Z6R A;  1BU6 O;  4IO8 A;  2W42 A;  3THV A;  4LC9 B;  5HRS A;  4BC3 A;  5DMR A;  3O4W A;  1KXP A;  3VQ5 A;  3DOK A;  1REV A;  4C8N A;  2KKZ A;  2HNZ A;  3SQ1 A;  4CJQ A;  4YY3 K;  3HPO A;  3CM5 A;  2QWQ A;  4LSL A;  3ZT3 A;  4NB4 A;  3ZEU B;  4EIA A;  3IFR A;  3NF8 A;  1VSK A;  5J2P A;  3THX B;  1LOT B;  3CM6 A;  2ZQB A;  3LWL A;  4BVO A;  1NJZ A;  3AA3 A;  2AJQ A;  5JLF A;  3KHY A;  3VQ6 A;  1MU2 A;  4DF4 A;  5BRD A;  1YF5 L;  4CF0 A;  3C7N A;  3GE1 A;  1XMQ K;  1BQM A;  5A2Q O;  1KLN A;  1HKC A;  1VQ9 N;  5J1E A;  1S9G A;  4WCE L;  1JLG A;  4W5N A;  4DQ8 A;  3ULE B;  1SV5 A;  3NVK A;  2P9U B;  5AQT A;  4BG8 A;  2E4L A;  4CHO A;  3RMD A;  1BL3 A;  2UUA K;  5JS1 A;  1WSF A;  2WON A;  4CZH A;  4MO5 A;  2GEM A;  5C42 A;  3H45 C;  3QEI A;  4NLC A;  4OKE A;  3DRP A;  4DTR A;  1SQK A;  4CZI A;  1KD1 O;  3PY8 A;  3HOT A;  3F9K A;  2FC0 A;  5GAD P;  3ZEU A;  1NKE A;  3CME N;  1UA1 A;  4B1Z A;  2D1K A;  3ZSQ A;  3O6W A;  5BRF A;  2E5L K;  2FBX A;  3THX A;  4BRF A;  3KD1 E;  2QWP A;  5LJV A;  3M8S A;  4CEC A;  3AAR A;  5JIC A;  4FWP A;  5DK5 A;  1YUW A;  4AQY K;  1TL1 A;  3T69 A;  3VA0 A;  4ELT A;  3ZT4 A;  3CJ1 A;  3WNE A;  2PY5 A;  5EX5 A;  1JLE A;  2W40 A;  4CGF A;  4FLT A;  4GY2 B;  1JLQ A;  4OPK A;  1K8K B;  4CFD A;  1GLA G;  2E2N A;  2FF6 A;  4GKK K;  2G8H A;  2W6L A;  3ULE A;  3R9P A;  4U7B A;  2P9U A;  3IS9 A;  3G4S N;  3NBP A;  4CZL A;  4KHY A;  1EX4 A;  4CK1 A;  2BDP A;  3TAG A;  1NGD A;  3PUF A;  4H0P A;  1W7A A;  2PZS A;  3TR8 A;  3O1W A;  4CF9 A;  3N4P A;  3AA5 X;  3R3L A;  2NRH A;  2VWB A;  1VQ7 N;  4H0Y B;  4CER A;  5F1X A;  4K43 A;  3WT0 A;  4BAC A;  4FZZ A;  3OYD A;  1ITG A;  4KV8 A;  3HP9 A;  3J80 O;  3QEX A;  4IFY A;  3NVM A;  3GL1 A;  2P9L A;  4CEB A;  3J81 O;  2V52 B;  3HVT A;  2GUI A;  3U9Z A;  2P9I B;  2OA8 A;  1JLC A;  1GOB A;  5KGW A;  5EU7 A;  3SLC A;  4IG0 A;  1NBW A;  1BCO A;  3QIP A;  1K8A O;  4B1V A;  2IOC A;  3DMJ A;  1W2B M;  1K8K A;  4IOA L;  4N56 A;  1GOA A;  5CZ1 A;  3OYA A;  4KB0 A;  3V4I A;  4ILH A;  1LAV A;  4IDK A;  2F96 A;  1GOC A;  1S5J A;  4JKE A;  1NM1 A;  3LAK A;  4YOR A;  4W5T A;  4YNQ A;  1IBM K;  3SPY A;  3QEW A;  4MQ3 A;  4LY7 A;  4IKF A;  1RDU A;  4HHT A;  1FJG K;  3K5N A;  2IDO A;  2D0P A;  3PSF A;  1RT1 A;  1IG9 A;  1HUX A;  1I3A A;  3D2F B;  3KZB A;  1X3N A;  4DUZ K;  4ILJ A;  1T03 A;  1NK7 A;  1M1K O;  3HVR A;  3ENH A;  1QS4 A;  4XH1 A;  4IG3 A;  4BRH A;  3HOS A;  4CJL A;  1J54 A;  4PY5 A;  3A8Y A;  4AHT A;  3OYC A;  4Z0U A;  3F73 A;  3CIP A;  4FWK A;  1UOC A;  2FXU A;  1ZYQ A;  3SCX A;  3PIP L;  3H6E A;  2G8W A;  4FL9 A;  3FZF A;  1HPZ A;  3UIQ A;  4KHS A;  1JL2 A;  3QIO A;  1RDB A;  5E84 A;  1ZBI A;  1P8Z A;  3LDO A;  1O13 A;  1IKV A;  3SUN A;  2BAN A;  4DU4 A;  4FXD A;  3SMS A;  5KRS A;  1R0A A;  1RCH A;  2X78 A;  4BE2 A;  4EP4 A;  3BP8 A;  5GAH P;  3SPZ A;  4FJG A;  5DM7 L;  4BRN A;  3K57 A;  2PYJ A;  2YKN A;  3DJC A;  3VEY A;  4A2B A;  4FK4 A;  4NO7 A;  4M3Y A;  1NG9 A;  1UAX A;  5EOY A;  3LP2 A;  5C0Y A;  3M6G A;  4DTJ A;  1MWM A;  1A5W A;  3O8M A;  1YIT N;  3DWL A;  4JHD B;  1EET A;  4Z4H A;  3SJJ A;  1SKS A;  3EYZ A;  3VQB A;  3L2R A;  4CZJ A;  2YNI A;  4IWV A;  2QWL A;  2HMI A;  3SMP A;  2FSJ A;  4O0I A;  2Y1I A;  3Q7B A;  4H5N A;  2HNY A;  1JXE A;  1W0H A;  5FPM A;  1D8Y A;  5AQM A;  3L4Q A;  5AQF A;  3VQA A;  4CGJ A;  3AAQ A;  4EP5 A;  4BE1 A;  5T7B A;  4RG8 A;  3U3Y A;  3AO2 A;  3EZW A;  4CEE A;  3TSU A;  4OO1 J;  4K25 A;  2P1J A;  3AO3 A;  3L3V A;  3K9J A;  4FLV A;  1NK9 A;  4LFC K;  2JLE A;  4PL7 A;  3OYF A;  1JLA A;  2O8F B;  2WTU A;  4MDB A;  1G15 A;  4E7H A;  4FLU A;  1NGH A;  1ZXO A;  4CIF A;  2A6A A;  4CJS A;  3IKM A;  3B6P A;  4FK2 A;  5C2F A;  4CJE A;  4OKK A;  3QNO A;  4JHD A;  3IG1 A;  3HYF A;  1HRH A;  2GEL A;  2F8T A;  4YHH K;  3FE1 A;  1ZBU A;  4GKJ K;  4L3Q A;  2IIR A;  3BGR A;  4HWI A;  4NLB A;  2VGM A;  3ITH A;  1ZBF A;  4E7L A;  1LW2 A;  3LDL A;  3VF4 A;  3VQP A;  3OW2 M;  3P5J A;  4LF6 K;  2RHK A;  3E1Y A;  4FPA A;  3O1B A;  5AQS A;  4DS5 A;  3UE5 A;  1XQS C;  3BZC A;  3P39 A;  3L2W A;  4IBN A;  3OTO K;  2P9N A;  2EWS A;  3NGY A;  2O8F A;  4I6M A;  1LWF A;  3ASM A;  3C6U A;  4Y1D A;  3CC2 N;  2P5G A;  1J9A A;  5AZJ B;  2YNG A;  4CJP A;  4GV3 A;  3CFP A;  1YI2 N;  2V7Y A;  3SQ4 A;  1NK4 A;  4J2D A;  2WOM A;  4V19 S;  4NXM K;  3TTD A;  3LDS A;  5J2N A;  3EL2 A;  3D0P A;  3P4I A;  4MLH A;  3DLG A;  2Z1G A;  3VF2 A;  3V9U A;  3SBG A;  4A5B A;  1B92 A;  4KRF A;  1NLV A;  1DT9 A;  5CY4 A;  3T19 A;  4DB3 A;  3P31 A;  1EXQ A;  4H5W A;  5TKW A;  4IJA A;  4AIL C;  2NZT A;  4YDU C;  3W0L A;  4E1J A;  4CEZ A;  3O4N A;  1YXQ A;  2UUB K;  3O9U A;  4N47 A;  2QXF A;  4UQG A;  3DRS A;  3MED A;  4DCH A;  1HYV A;  3ID8 A;  2FSK A;  3ZET A;  1RT4 A;  3TU5 A;  1NK5 A;  2F7T A;  3WXI A;  4CBU A;  5ADX H;  3C95 A;  4JI2 K;  1FK9 A;  5EVZ A;  3KKR A;  4JI0 K;  2OZM A;  3PO5 A;  2E2P A;  2HBJ A;  3TAB A;  3OYL A;  2ITG A;  3TTC A;  5AZJ A;  4DV7 K;  4CZF A;  1DTT A;  2PAV A;  2YJF A;  2HST A;  3CI5 A;  3E9O A;  5AQG A;  1VSJ A;  3CG7 A;  2YHA A;  3QET A; 
#chains in the Genus database with same CATH homology
 4CIE A;  3SV3 A;  4M3W A;  2RF2 A;  1S6P A;  4ID5 A;  3LP1 A;  1KFD A;  1YTA A;  3V9Z A;  4DTU A;  1NK0 A;  3P83 D;  4KAZ A;  1QSS A;  1DTQ A;  4M41 A;  1RBR A;  3SV4 A;  3RRH A;  4QOZ B;  3AA4 A;  4M42 A;  1VSH A;  4AHC A;  1TAU A;  2Z1H A;  4HVJ A;  5KRT A;  1L5U A;  1QQC A;  4PA1 A;  1Z25 A;  1NKB A;  1YT3 A;  4E7J A;  2E6M A;  4DQI A;  2I5J A;  3OYG A;  4KTZ A;  3WNF A;  4FJL A;  1F21 A;  4CEQ A;  2OPP A;  4DSL A;  4CJU A;  4DLG A;  4M3X A;  1A5X A;  4CHQ A;  4CK3 A;  1C1A A;  4R5P A;  3L2Q A;  4DLE A;  1ZBH A;  2XHB A;  4CGI A;  2VWJ A;  3LAN A;  4HCC A;  4Z4E A;  1VSE A;  3MAQ A;  4M3Z A;  1S1U A;  2Q3S A;  1X9W A;  4DTM A;  4CEF A;  2W42 A;  3CFR A;  4QAG A;  3THV A;  5HRS A;  1U49 A;  5DMR A;  3QES A;  1BI4 B;  1IH7 A;  3TI0 A;  3VN5 A;  2QK9 A;  3L8B A;  3ZSW A;  3S3O A;  5HLF A;  1N5Y A;  3PO4 A;  5HP1 A;  4CES A;  4KKO A;  1S1T A;  4OJR A;  3VQ5 A;  2G8U A;  1SKW A;  1X1P A;  4FK0 A;  3AVF A;  1REV A;  3DOK A;  2HVI A;  4C8N A;  1IKX A;  3ZT0 A;  4CJK A;  4CJF A;  2G8I A;  4M3R A;  3VQ4 A;  1RDC A;  1L3T A;  3KK1 A;  1HQE A;  1WSE A;  1HQU A;  2HNZ A;  3SQ1 A;  1CXQ A;  4CJQ A;  3HPO A;  4JS5 A;  4FJ8 A;  2X6S A;  3CM5 A;  4LSL A;  3ZT3 A;  4Z4F A;  3VQ8 A;  4DMN A;  2YV0 X;  1RTJ A;  3NF8 A;  3SUP A;  4DQQ A;  1VSK A;  3AVA A;  3DLE A;  1CLQ A;  4B9L A;  4JLH A;  2BGG A;  1RDA A;  4H8K A;  4B8A B;  4E89 A;  3AVG A;  4CHN A;  5J2P A;  3CM6 A;  3LWL A;  2ZQB A;  1WAF A;  1KVA A;  4NCG A;  1NJZ A;  3AA3 A;  2AJQ A;  4CJ5 A;  3LPT A;  3DLR A;  1D9F A;  3VQ6 A;  1MU2 A;  4DF4 A;  4F2S A;  4OLB A;  4AHR A;  4C8M A;  1WLJ A;  1BIZ A;  2HHV A;  3NCI A;  1ZBL A;  4CF0 A;  4DU1 A;  1Y97 A;  4DTP A;  1BQM A;  3OS0 A;  4BE0 A;  3O4Q A;  4DSF A;  3RMA A;  1KLN A;  4GW6 A;  2PYL A;  3KKS A;  3QLH A;  5J1E A;  4CIG A;  1S9G A;  2A1R A;  3KLI A;  4OPJ A;  1JLG A;  4W5N A;  3ISN C;  4DFM A;  3OJS A;  4Z4C A;  1BIS A;  4CGG A;  4I2Q A;  1S9E A;  4QCL A;  1HNV A;  1SV5 A;  4FJK A;  1U45 A;  4FJH A;  3KLG A;  3PX4 A;  2JGU A;  2OPQ A;  3TAE A;  1YVU A;  2E4L A;  1C6V A;  1HYS A;  4CHO A;  2HW3 A;  3OYH A;  1BL3 A;  3RMD A;  5JS1 A;  5I42 A;  3SI6 A;  1WSF A;  2WON A;  1QHT A;  4F8R A;  2F8S A;  1C0M A;  5C42 A;  3NAE A;  4FLX A;  3CQ8 A;  3QEI A;  2KTQ A;  1Q8I A;  3DRP A;  4OKE A;  3HXM A;  3NDK A;  4DTR A;  2HHX A;  1RTH A;  4GVM A;  1RBU A;  4EZ6 A;  3PY8 A;  1WSJ A;  3HM9 A;  1LWC A;  3VQC A;  3F9K A;  2FC0 A;  1QTM A;  1NKE A;  2G8F A;  4F3T A;  3DRR A;  4JS4 A;  3PV8 A;  4Q0B A;  1U4B A;  3O3G A;  1EKE A;  3S3N A;  1UA1 A;  2VG5 A;  1TV6 A;  2YNH A;  4ICL A;  3V6D A;  4DSK A;  3ZSQ A;  5CYQ A;  1KTQ A;  3LZI A;  2FBX A;  2HVH A;  2X6N A;  4M3T A;  4JRP A;  1TL3 A;  3SNN A;  1VSM A;  4ID1 A;  3KD1 E;  4LH4 A;  5HRP A;  4H4O A;  3HP6 A;  3M8S A;  4CEC A;  5DK5 A;  1BIU A;  5J2Q A;  1TL1 A;  4FJX A;  2EHG A;  3VA0 A;  4ELT A;  3ZT4 A;  4AHS A;  3CFO A;  1L3V A;  3WNE A;  2PY5 A;  3V81 A;  1JLE A;  3AO5 A;  4CGF A;  4FLT A;  4KHW A;  1JLQ A;  3ALY A;  1UWB A;  2XY8 A;  3AVL A;  4OPK A;  4Q5V A;  4AHV A;  1TKT A;  4O0J A;  4CFD A;  3I8D A;  2G8H A;  3RMB A;  3MXI A;  2HB5 A;  4CJT A;  5HRO A;  3IS9 A;  3NBP A;  3QIN A;  4DTN A;  1EX4 A;  4CK1 A;  3MEC A;  4DQP A;  2BDP A;  4KHY A;  1VSD A;  3OYE A;  1LW0 A;  3TAG A;  3OYN A;  3PUF A;  3ZCM A;  1WNS A;  2PZS A;  4C8K A;  3TR8 A;  2OPS A;  4CF9 A;  4DSE A;  4DFJ A;  4J2E A;  1RT2 A;  3AA5 X;  1CZB A;  1S1V A;  3ZSZ A;  3OYM A;  2VWK A;  3ZSY A;  4XIU A;  4M45 A;  4ZTJ A;  4KPY A;  1RT6 A;  4KI6 A;  4CER A;  1RIL A;  2NUB A;  4BAC A;  3C6T A;  2ATQ A;  1NK8 A;  4B9U A;  3OYD A;  1ITG A;  4FZZ A;  1Q9X A;  3HJF A;  1ASU A;  2YHB A;  4F3O A;  4KV8 A;  3TAQ A;  4O44 A;  1VSI A;  3TWH A;  3HP9 A;  3QEX A;  4B9S A;  4B9T A;  2KZM A;  3V1R A;  4IFY A;  1QE1 A;  4FJI A;  4FCY A;  3HST B;  4AHU A;  4CEB A;  4LH5 A;  4FM1 A;  1DLO A;  3H08 A;  3HVT A;  3LAL A;  2GUI A;  2YNF A;  3SUQ A;  4CHY A;  2B6A A;  3M8Q A;  3EZ5 A;  2OA8 A;  1JLC A;  1GOB A;  1CZ9 A;  2XRI A;  3K5O A;  1JLF A;  5EU7 A;  5KGW A;  2OYQ A;  4IG0 A;  2DFH A;  2B4J A;  2D0A A;  1BCO A;  1CXU A;  3QIP A;  3VQQ A;  4B9N A;  3NH0 A;  4O4G A;  4DTX A;  3KK3 A;  4CEA A;  4HUF A;  2ETJ A;  4OGE A;  5J2M A;  4KI4 A;  1BHL A;  3E01 A;  2IOC A;  3VQ9 A;  2A1S A;  3DMJ A;  3T1A A;  2HHU A;  3LP3 A;  1TK8 A;  5K14 A;  1T7P A;  4N56 A;  2XY6 A;  1GOA A;  1WSG A;  5CZ1 A;  1Z26 A;  2EX3 A;  3OY9 A;  3OYA A;  3V4I A;  3RRG A;  4KB0 A;  1L3S A;  1LAV A;  1RT5 A;  4IDK A;  2F96 A;  4KTQ A;  1GOC A;  2G8K A;  1S5J A;  3LAK A;  3ZT1 A;  3DLK A;  3RR7 A;  4N5S A;  3SUO A;  1J53 A;  3U6F A;  1RNH A;  3OYB A;  4W5T A;  4DFP A;  4DWI A;  4YNQ A;  4NCB A;  3AVB A;  3SPY A;  3QEW A;  4MQ3 A;  4LY7 A;  1RT7 A;  3QEV A;  5C24 A;  4E3S A;  1HMV A;  1JL1 A;  1RDD A;  1TGO A;  3K58 A;  4IKF A;  2IAJ A;  1Q9Y A;  4FVM A;  4BDY A;  4C8L A;  4CEO A;  4HHT A;  3KTQ A;  3K5N A;  3KLH A;  2OZS A;  2IDO A;  4FJ7 A;  4CE9 A;  1S1W A;  4O5B A;  5KGX A;  4Z4I A;  1RT1 A;  1IG9 A;  1I3A A;  1TVR A;  4ZTF A;  4B9M A;  2QKB A;  1B9D A;  4DG1 A;  1TKX A;  2RKI A;  2RPI A;  3VQ7 A;  4E1M A;  1BI4 A;  1TAQ A;  3ZSR A;  4ZHR A;  1NK7 A;  1T03 A;  3HVR A;  3KD5 E;  4CHP A;  4F4K A;  4PQU A;  1QS4 A;  1EP4 A;  3I0S A;  1VSL A;  3G10 A;  4IG3 A;  2HND A;  4NYN A;  4RW6 A;  4CJL A;  1J54 A;  4PY5 A;  2ZD1 A;  3G0Z A;  4GMJ B;  4AHT A;  1S6Q A;  3OYC A;  4Z0U A;  3F73 A;  1K6Y A;  4E7K A;  3V9S A;  4DS4 A;  1UOC A;  4CJR A;  3DLH A;  1W9H A;  1ZYQ A;  2DTU A;  4K8Z A;  3SCX A;  1N6Q A;  2IGI A;  4CFA A;  3IAY A;  5E41 A;  3AVC A;  4KFB A;  1TK5 A;  2G8W A;  1S1X A;  3OVN A;  2FBV A;  3KLE A;  1WAJ A;  1HPZ A;  3UIQ A;  4KO0 A;  3VQE A;  4FM2 A;  4KHS A;  1JL2 A;  3ZT2 A;  3QIO A;  1SKR A;  4E1N A;  4B08 A;  4DSJ A;  1JLB A;  1RDB A;  3AVI A;  3U3G A;  4TSX A;  4FZX C;  2GV9 A;  1KVC A;  4CJV A;  1ZBI A;  1C0T A;  3SYZ A;  3V1O A;  4KTW A;  3RTV A;  3PX0 A;  1IKV A;  3SUN A;  2BAN A;  3HPH A;  4DU4 A;  1TKD A;  4FXD A;  1C1B A;  5KRS A;  1R0A A;  1RCH A;  1T8E A;  2X78 A;  4BE2 A;  1VRU A;  4CHZ A;  2VG7 A;  4EP4 A;  2FBT A;  3SPZ A;  4FJG A;  2IC3 A;  3K57 A;  2PYJ A;  4FLZ A;  2YKN A;  4WE1 A;  4HUE A;  3MEE A;  1B9F A;  4CFB A;  3NE6 A;  4KHN A;  3NGZ A;  1T05 A;  4LD0 A;  3OS1 A;  4CF8 A;  3ULD A;  1U47 A;  4FZY A;  4M3Y A;  4FK4 A;  1UAX A;  2X74 A;  3LP2 A;  3S3M A;  4DTJ A;  1A5W A;  1VK0 A;  1XWL A;  4LSN A;  4H4M A;  3OJU A;  4BDP A;  3HK2 A;  4I7F A;  1HJR A;  4CK2 A;  4K8X A;  1EET A;  4M3U A;  4FJ5 A;  1WSH A;  4Z4H A;  3SJJ A;  1KCF A;  3OYK A;  3AVJ A;  1SKS A;  3EYZ A;  3VQB A;  2D5R A;  4CCH A;  3L2R A;  1U48 A;  4E0D A;  5KI6 A;  4J2B A;  3HT3 A;  4B9V A;  2YNI A;  4FM0 A;  3T3F A;  4MFB A;  4FJM A;  4FYD A;  4CGH A;  1LV5 A;  2HMI A;  4YFU A;  1C1C A;  3TAN A;  1KVB A;  4O0I A;  4DQR A;  2FBY A;  2Y1I A;  4CGD A;  3AVN A;  3RR8 A;  2HNY A;  1JXE A;  1W0H A;  5FRN A;  3FFI A;  3RMC A;  4CF1 A;  3QEP A;  4O55 A;  1D8Y A;  2KZZ A;  1WN7 A;  3M8P A;  1IKY A;  2Z1I A;  3VQA A;  4CGJ A;  4EP5 A;  5T7B A;  4RG8 A;  4BE1 A;  3U3Y A;  3AO2 A;  4RW9 A;  4CEE A;  1RTD A;  1L3U A;  1RBS A;  4Y1C A;  2P1J A;  3AO3 A;  3DI6 A;  3L3V A;  4HUG A;  4B3O A;  2XO7 A;  4FLV A;  1FXX A;  3NFA A;  1LAW A;  3NHG A;  3KIO A;  1NK9 A;  3ZSV A;  2JLE A;  3OYF A;  1SL2 A;  1NJX A;  2P5O A;  1JLA A;  5KTQ A;  5HRN A;  3AO4 A;  4CFC A;  4KRE A;  3K5L A;  2DFE A;  1XHX A;  3NF6 A;  4OGC A;  1G15 A;  4E7H A;  1XI1 A;  4NYF A;  2D0C A;  4FLU A;  2O4I A;  4CIF A;  3S9H A;  3LAM A;  5HRR A;  4CJS A;  1KSP A;  1RBV A;  5HBM A;  4KB1 A;  3WNH A;  3B6P A;  3NF7 A;  3V9X A;  1XHZ A;  1JKH A;  4FK2 A;  4CJE A;  4OKK A;  3QNO A;  4W5O A;  3IG1 A;  3NH1 A;  1NOZ A;  2RN2 A;  1KLM A;  3HYF A;  3D45 A;  3BDP A;  3JYT A;  3TAR A;  1X9S A;  1HRH A;  2ZE2 A;  1TK0 A;  4EZ9 A;  4F2R A;  1NOY A;  4I9L A;  2HHW A;  1BQN A;  1HYZ A;  2F8T A;  3AA2 A;  3O3H A;  3RWU A;  2DY4 A;  4KHQ A;  1ZBU A;  2O4G A;  2D0B A;  1HNI A;  3DOL A;  3AV9 A;  4C8O A;  3ZSO A;  3KLF A;  4RW4 A;  3BGR A;  5FRO A;  2XY7 A;  2R7Y A;  1QSL A;  3K59 A;  3DM2 A;  4OVL A;  4FJJ A;  1VSF A;  5SZT A;  1BGX T;  1D9D A;  3ITH A;  1ZBF A;  4E7L A;  1LW2 A;  1RBT A;  2E6L A;  3VQP A;  4W5R A;  3ZSX A;  3L2U A;  3P5J A;  3LZJ A;  3CYM A;  3SZ2 A;  4DQS A;  1NJW A;  3NF9 A;  1VRT A;  3AVK A;  4N76 A;  1SL0 A;  4JRQ A;  1SUQ A;  4OKJ A;  3IRX A;  4B8C A;  3OS2 A;  2DFF A;  2VG6 A;  3M8R A;  1XC9 A;  4FLY A;  4DU3 A;  4CJW A;  2IS3 A;  3AO1 A;  3MXJ A;  4DS5 A;  4IFV A;  3JSM A;  4RW8 A;  2LSN A;  3OYJ A;  5JS2 A;  3L2W A;  4IBN A;  3TAM A;  3NGY A;  5SWM A;  3EY1 A;  1J5O A;  1IO2 A;  1LWF A;  3ASM A;  3C6U A;  3QO9 A;  4Y1D A;  3A2F A;  5FDL A;  3QNN A;  4L8R B;  4I9Q A;  3MEG A;  2P5G A;  1C0U A;  1J9A A;  2B5J A;  2Y1J A;  2YNG A;  4DTS A;  3B6O A;  4CJP A;  4CF2 A;  2HHQ A;  2G8V A;  1A5V A;  3CFP A;  2XY5 A;  4FJN A;  3TAP A;  4HCB A;  2GBZ A;  4I2P A;  2YKM A;  3SQ4 A;  1LWE A;  3C94 A;  3LPU A;  1NK4 A;  4J2D A;  1JXB A;  2WOM A;  2OPR A;  4DF8 A;  4KHU A;  1YTU A;  3KK2 A;  1X9M A;  3DYA A;  3LWM A;  1U04 A;  2KQ2 A;  2P51 A;  3SQ0 A;  4DFK A;  1QSY A;  4J2A A;  3LDS A;  4Z4G A;  1KRP A;  3HL8 A;  4CED A;  5J2N A;  3D0P A;  2HHT A;  4BWJ A;  3HPG A;  3DLG A;  2Z1G A;  1ASV A;  3OYI A;  1NJY A;  1ASW A;  4G1Q A;  4PUO A;  3V9U A;  2Z1J A;  2KFZ A;  1I39 A;  1B92 A;  3VA3 A;  4KRF A;  1FKP A;  3L3U A;  5CY4 A;  3NGI A;  4E7I A;  4OLA A;  3T19 A;  4W5Q A;  5I3U A;  3PX6 A;  1EXQ A;  1RT3 A;  3P1G A;  1FKO A;  4AIL C;  1O1W A;  4CEZ A;  4HTU A;  3O4N A;  4DTO A;  3K5M A;  4N47 A;  2QXF A;  4UQG A;  3MXM A;  3DRS A;  3MED A;  3V1Q A;  4AH9 A;  1HYV A;  4NCA A;  1NK6 A;  3WNG A;  3V9W A;  4BWM A;  3L2V A;  4FJ9 A;  4ELU A;  4FLW A;  1UA0 A;  1RT4 A;  1NK5 A;  1WSI A;  1BCM A;  4DSI A;  4CJ3 A;  3C95 A;  3HO1 A;  1SL1 A;  5C25 A;  4FW2 A;  3O3F A;  3VQD A;  1KFS A;  2BE2 A;  1FK9 A;  1TKZ A;  4BDZ A;  3LP0 A;  3SQ2 A;  3KJV A;  5D3G A;  2KFN A;  1D5A A;  3I0R A;  3KKR A;  4FW1 A;  4CJ4 A;  2OZM A;  3PO5 A;  1RTI A;  3K2P A;  2KW4 A;  3OYL A;  2ITG A;  3TAB A;  4ELV A;  5FRM A;  4E19 A;  3AVH A;  2HHS A;  1DTT A;  4PWD A;  3AVM A;  4N41 A;  2QKK A;  1IKW A;  3DLB A;  1VSJ A;  3TAF A;  3CG7 A;  3NH2 A;  2YHA A;  4RW7 A;  3QET A;  5CYM A;  1NKC A;  3QER A;  5CZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...