5EU7A

Crystal structure of hiv-1 integrase catalytic core in complex with fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACDWAGIKQEFGVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Integrase
publication title The Preserved HTH-Docking Cleft of HIV-1 Integrase Is Functionally Critical.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 48
structure length 143
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5eu7A00
1JL1A 1VSDA 1JLGA 4UQGA 2D0CA 1C1BA 4ID1A 4KAZA 3HO1A 2O4IA 5DMRA 4HTUA 1T8EA 4B9NA 1C1AA 4FJLA 2GV9A 3T19A 1HQUA 3TAFA 4LSLA 3DLEA 4E89A 4GW6A 1IKXA 1LWFA 1RBTA 1TGOA 2ETJA 1HJRA 3ZSZA 1SV5A 3AVHA 4BACA 4ELTA 4ELUA 3OJSA 4J2AA 2YNIA 4B9LA 3AVLA 4CHOA 2A1SA 1JLEA 4BE0A 4DFPA 3QERA 4Q5VA 1T7PA 3ALYA 2QK9A 2YV0X 3VQDA 3TAPA 4F2RA 3LANA 3F73A 3IG1A 2DFEA 4BDYA 3ZSXA 3KK1A 1D9FA 2OPPA 4CJ4A 3QEXA 3JYTA 3NAEA 3IAYA 2RPIA 2BANA 1K6YA 2GBZA 3NGYA 3QEWA 1BL3A 1BIZA 3OS2A 4K8XA 4CECA 1NK9A 1IO2A 1BQNA 2WOMA 1HRHA 4CJPA 4OPKA 5EU7A 4FLWA 3JSMA 1RT4A 2Q3SA 5J2QA 1U45A 4DU1A 2NUBA 3ZSWA 3S9HA 3ZT3A 2FBVA 1Z26A 2OPSA 3SUOA 3PV8A 4CEQA 4EP4A 1TVRA 3LPTA 3DLGA 4O0JA 1TKDA 1J5OA 4O44A 1GOAA 1NJYA 4E7LA 4F4KA 1QS4A 3KLFA 3L2WA 3AA5X 4OKKA 4Z4EA 4IG0A 1S1UA 1NKBA 3QNNA 4DSIA 1LAWA 1RT1A 3KLEA 4CCHA 1JLAA 1JXBA 1RDBA 1VRTA 3L3VA 1CXUA 5KI6A 4CJTA 4KHWA 4F3TA 3SQ4A 2Z1IA 3SCXA 1HQEA 4B3OA 3KK3A 4BWJA 3L2VA 3SV3A 4W5TA 3VQ6A 3G0ZA 1Q9YA 2IS3A 4HUGA 4RW4A 3PX6A 1QQCA 3D45A 4CK2A 4KB0A 2P5GA 1YTUA 2XY6A 4OJRA 1ZBIA 2PY5A 4M42A 2EX3A 4KI6A 4DQRA 1UAXA 4OGCA 3HT3A 3D0PA 3OVNA 4E7HA 3KKSA 3SQ2A 4JS5A 1LW2A 3LALA 3QNOA 1NJZA 2G8FA 1WSHA 3VQAA 3HXMA 2KFZA 4NCGA 4HUFA 1L3VA 2OYQA 3CQ8A 4AHSA 3TWHA 4FZXC 3VQ7A 4ELVA 3KD5E 4W5RA 2W42A 2P5OA 2RF2A 4OLBA 4KHYA 1XHXA 4DTJA 1KLNA 4I2PA 3SYZA 1W0HA 3M8QA 1RT3A 3VQBA 4YNQA 4CJSA 1KFDA 3V4IA 3F9KA 3TARA 3OYNA 1WSJA 1HYVA 2YNFA 4KTQA 1XC9A 3SJJA 1C6VA 1L3TA 3OYLA 3S3NA 3QEPA 2Z1HA 1W9HA 2Z1GA 4CJRA 4CIGA 4OVLA 2D0AA 3MECA 4NYNA 3WNGA 4K8ZA 3HVRA 3RR7A 3L2UA 3HL8A 3PY8A 3DM2A 2A1RA 4CEBA 4Q0BA 4MQ3A 1J54A 1YVUA 4Y1CA 3NCIA 1IKVA 3OYDA 2OZSA 4CEFA 3KKRA 4B9SA 4CJWA 5CYQA 3LZIA 1TAQA 4CGHA 1VSFA 2Z1JA 5CYMA 1HPZA 3U3YA 1TL1A 3AVGA 4ZTJA 1D5AA 4KHSA 4FJXA 1S6QA 4H4MA 4DTXA 4M3UA 3I8DA 3AV9A 3VQ9A 4Z4HA 4FJMA 1S5JA 4CF9A 2RKIA 1A5XA 1VSHA 3QINA 4I2QA 3V1QA 3WNHA 3OYJA 4I9LA 3C94A 3M8PA 5KTQA 2D0BA 3T1AA 4LD0A 4DF4A 3OYMA 4AHUA 3MEEA 3TAQA 4FJ7A 5HRPA 4B9UA 2G8IA 1S1XA 1NKCA 4FW1A 5I3UA 3DRRA 4FJNA 3P83D 4HUEA 4CK1A 4DSLA 4DFJA 4W5OA 4O5BA 1VK0A 2KTQA 4M3TA 4JS4A 1S1VA 3BDPA 2ITGA 3HPOA 3V9ZA 1JLQA 4E0DA 3O3HA 2FC0A 1ZBLA 1RTJA 4KHNA 1VSJA 3LP2A 2X6SA 2RN2A 5HRRA 5C42A 3HSTB 1N6QA 4B8AB 4FJHA 3CFPA 2IDOA 1BI4B 3DLRA 1QSLA 3CFRA 4B9TA 2D5RA 1DLOA 3B6OA 5SWMA 4FLTA 2HHSA 3AO5A 3NE6A 3RMBA 1WNSA 4EZ9A 4EP5A 3O4NA 4CEZA 5KRSA 3RWUA 1B92A 1FK9A 1UOCA 1QHTA 3SI6A 2X74A 2FBYA 5K14A 2HMIA 2HVHA 4QAGA 3OYGA 4PY5A 3L2QA 1BI4A 1KSPA 3AA3A 5CY4A 3ZT4A 4O0IA 3KLGA 4CJVA 4DS5A 4N41A 4CE9A 4N76A 4KREA 4KTZA 4CHZA 3NFAA 1C0MA 2X6NA 4FLVA 2FBXA 2G8WA 3UIQA 4Z4GA 1WSFA 1U04A 1BCOA 3DRSA 3MAQA 4DTSA 1U48A 4HVJA 2BGGA 4QOZB 4WE1A 4OPJA 1BISA 4KHQA 3AVFA 4OGEA 1UA1A 1NK5A 1S9GA 2Y1JA 4J2BA 3OYFA 4M3XA 4M3RA 3C6UA 1SL1A 1SL2A 4CGGA 4CJ5A 3LP3A 3M8RA 3NGZA 5FRNA 3CFOA 1ASVA 1TKZA 4N47A 4KPYA 2DTUA 3LAMA 4FJKA 5HROA 2HVIA 1ZYQA 3AA4A 4C8KA 2JLEA 4B8CA 3NHGA 4Z0UA 4DU4A 1S6PA 2DY4A 4ZHRA 1RCHA 3I0SA 4AHVA 3THVA 4CERA 1EXQA 5I42A 1XHZA 3DYAA 2F96A 1RBSA 2YHBA 4CGFA 2BDPA 2GUIA 4CJKA 1WAFA 1BQMA 4CIEA 2XY7A 3TANA 4IG3A 2VG6A 4GVMA 1CXQA 4CHPA 1TV6A 5KGXA 1G15A 2YKNA 4RW8A 5J2PA 1LAVA 5E41A 3TABA 3RMDA 1QTMA 4FJJA 1SL0A 1EETA 4O4GA 1S1TA 2EHGA 2HB5A 1Y97A 3DLHA 3LAKA 2HHWA 1VRUA 1Z25A 4CF0A 2DFFA 1L3UA 3ZSQA 4W5QA 3OYKA 1HYSA 1SUQA 3ZT2A 3V9WA 5J1EA 3TAEA 4CEOA 1NK4A 1SKSA 4FJGA 1ZBUA 1BCMA 1ZBFA 3SZ2A 3DMJA 1KLMA 4RW6A 4DTRA 3NH2A 1QSSA 1WLJA 4MFBA 4DFMA 1ASUA 4CF1A 3LDSA 1Q8IA 1FXXA 2QKKA 2B5JA 3H08A 3KLHA 5KRTA 4H8KA 2HNDA 2E6MA 4DMNA 2XO7A 3V9SA 4DF8A 1EP4A 3HYFA 2XY5A 1U49A 3VA0A 4FJ9A 3NH1A 4FXDA 3HM9A 4CK3A 4FLXA 4FK0A 3ITHA 4DU3A 3SQ1A 2I5JA 3RRGA 5HRSA 1KVAA 4KO0A 4BWMA 4FM0A 4M3YA 4RW9A 1KCFA 3LPUA 3OYBA 3CYMA 2KQ2A 1ITGA 1JKHA 1X9MA 1EKEA 3LWLA 4FZZA 5HLFA 1GOBA 4IKFA 2E6LA 3NF7A 4Z4CA 4DLGA 4DQQA 2VWJA 3AO4A 4AHTA 4DTNA 4DQPA 1CLQA 1JXEA 5C24A 3V9XA 3OY9A 4NYFA 1XI1A 4CESA 3VA3A 3KD1E 1RILA 2KFNA 4M3ZA 2ATQA 3HP6A 4LSNA 4DQSA 1VSLA 1L5UA 3SUPA 1C0TA 4FZYA 3S3MA 5CZ2A 2XHBA 3HP9A 3K57A 4FJ5A 3L3UA 1RNHA 4CHNA 3IRXA 4RW7A 2QKBA 4QCLA 3OYEA 2QXFA 3EYZA 1QSYA 4KI4A 1JLFA 3P1GA 4YFUA 3FFIA 3AA2A 3KLIA 4CF8A 1RT7A 3ZSYA 1LW0A 3RMCA 4KRFA 1RT2A 4CHQA 2KW4A 3ZCMA 3MEGA 5SZTA 2OPQA 4FK4A 2XY8A 1S9EA 3PUFA 3ISNC 2YNHA 3U6FA 1A5VA 3T3FA 3VN5A 4BDZA 1CZBA 3K5NA 4CJQA 1C0UA 3SQ0A 1D8YA 1RTHA 3AO1A 1J53A 4DSKA 4FLZA 2OZMA 1I39A 4JRQA 1KVBA 4N5SA 2F8SA 2HHTA 3DI6A 1HNIA 3AVJA 3EY1A 3MXIA 3AVCA 1DTTA 1VSKA 1HYZA 3TAGA 4EZ6A 2JGUA 4DTUA 1X9WA 4PA1A 4CFCA 3K2PA 4TSXA 4FLYA 4DS4A 3QEIA 1T05A 4PQUA 2KZMA 3KTQA 5KGWA 2G8KA 1LWEA 5D3GA 3OYIA 3LWMA 3VQCA 4E7KA 3QLHA 4KTWA 1IKYA 4GMJB 1WN7A 2E4LA 2IOCA 2Y1IA 4M3WA 2O4GA 3ULDA 4DQIA 1JL2A 4FCYA 4F8RA 2IAJA 4L8RB 2ZD1A 1RBUA 3SUNA 4RG8A 1MU2A 4AHCA 2VG7A 4PUOA 3LZJA 1N5YA 4C8NA 1NK8A 5FDLA 4LH4A 3ZSVA 3V1OA 4IDKA 3OYAA 5C25A 2X78A 1IKWA 3K5OA 1VSMA 4B9VA 2FBTA 4BDPA 1J9AA 3KIOA 3TAMA 3OYHA 1X9SA 4KKOA 3OJUA 2HHXA 3VQ8A 4CEDA 1RT6A 1BGXT 1A5WA 4FW2A 4C8MA 1NOZA 1B9FA 4HCBA 3OYCA 5FRMA 1S1WA 1JLBA 4M41A 4Z4IA 3ASMA 5HP1A 4E3SA 1WSGA 4FVMA 1RBVA 3P5JA 3AVAA 2AJQA 2YKMA 4J2EA 1R0AA 3ZSRA 4PWDA 1QE1A 4I9QA 4DTMA 5JS1A 2OPRA 1TK8A 4W5NA 1T03A 1NK0A 3NF6A 1RDAA 3O4QA 3DOLA 2B4JA 3MXJA 1FKOA 4O55A 3K58A 1TK5A 1NJXA 1NOYA 4IFYA 4FJIA 1IH7A 3VQQA 4JRPA 3A2FA 4G1QA 4CJFA 3VQEA 1WSEA 4FLUA 1L3SA 2PYJA 4HCCA 3NH0A 2PYLA 4CFAA 2G8UA 2HNYA 4I7FA 3OS0A 3RTVA 3B6PA 5J2NA 3SUQA 3PX4A 1NKEA 4FK2A 3HPHA 1TL3A 4ID5A 4DTPA 3LP0A 1HNVA 4IBNA 4DSJA 1X1PA 3L2RA 4Y1DA 4F2SA 2HW3A 3LP1A 2YHAA 4IFVA 3VQPA 4CFBA 3RR8A 4NCAA 1RDCA 1U47A 1VSIA 3SPYA 3O3GA 3WNFA 2WONA 3AVMA 3QETA 3SPZA 5HRNA 1TAUA 4FYDA 4E1NA 1F21A 1REVA 2HNZA 3KK2A 4CJEA 4BE1A 1KFSA 4BE2A 3E01A 3AO3A 1I3AA 4CJLA 3RMAA 4C8LA 1ZBHA 1NJWA 4CGIA 4E7JA 3AVIA 1LWCA 2HHVA 4LY7A 3NBPA 3WNEA 1BHLA 2KZZA 2LSNA 2G8VA 4H4OA 4DG1A 3IS9A 4CEAA 3EZ5A 3V9UA 1GOCA 4ICLA 1KRPA 3QIPA 1RDDA 3BGRA 3QIOA 3C95A 3HVTA 3V1RA 4CEEA 3VQ4A 1TK0A 3NGIA 3VQ5A 4M45A 1VSEA 2OA8A 1LV5A 5CZ1A 3DOKA 1TKXA 3TI0A 1NK6A 4KB1A 1WSIA 2YNGA 3HPGA 3K5LA 2ZQBA 2F8TA 4AHRA 1FKPA 3KJVA 2IGIA 3G10A 4FM2A 4DSEA 3I0RA 3MEDA 4CJUA 4OKJA 3M8SA 1SKWA 3SNNA 4E7IA 4KFBA 2P51A 2G8HA 4N56A 1RBRA 4B08A 4DFKA 2P1JA 2ZE2A 3QO9A 4AILC 3QESA 4KV8A 3PX0A 3S3OA 3OS1A 1IG9A 1WAJA 3CM6A 3V6DA 3U3GA 1DTQA 1RT5A 3ZSOA 3RRHA 3V81A 2VWKA 5DK5A 4E1MA 4OLAA 3NDKA 1O1WA 2DFHA 4CIFA 5T7BA 3CG7A 4LH5A 1KVCA 4DTOA 4CF2A 3SV4A 3DLKA 2IC3A 2HHUA 2VG5A 3PO4A 1EX4A 3AVNA 1XWLA 2PZSA 2BE2A 3QEVA 1SKRA 5HBMA 4C8OA 3NF9A 1RTDA 4FJ8A 5J2MA 4OKEA 4E19A 4HHTA 5FROA 3AVBA 3TR8A 1U4BA 4Z4FA 3AO2A 1UA0A 4DLEA 1NK7A 3C6TA 3O3FA 2XRIA 4DSFA 4R5PA 4KHUA 5JS2A 1ASWA 3ZT0A 1KTQA 3NF8A 1D9DA 3PO5A 4CFDA 3DLBA 3ZT1A 1JLCA 3L8BA 1C1CA 4NCBA 4JLHA 1HMVA 3K59A 3MXMA 4CGJA 4ZTFA 4B9MA 3AVKA 1TKTA 1YTAA 1UWBA 4CGDA 4CHYA 3HJFA 4AH9A 3K5MA 4FM1A 4F3OA 4J2DA 3CM5A 4DWIA 2HHQA 1BIUA 1RTIA 1CZ9A 1YT3A 4CJ3A 3DRPA 2B6AA 1B9DA 4XIUA 2R7YA 1Q9XA 3HK2A
chains in the Genus database with same CATH superfamily
3HRGA 3W3DA 4FOEA 5DMRA 4E1JA 3L4IA 1HQUA 3C7NA 4C1NI 1WUAA 1RBTA 5F0XA 4BACA 4B9LA 2JWKA 2A40A 4F2RA 1NLVA 3F73A 2VGNA 4JN4A 3QEXA 3BEXA 1K6YA 1BL3A 3OS2A 3UE5A 1OVYA 4K8XA 1YF5L 3CC7N 5EU7A 4FLWA 1U45A 3P39A 1K8AO 1Z26A 2GTDA 1V4TA 4IXCA 4YY3K 3HBTA 3CCEN 1YXQA 1GOAA 1NJYA 1QZ6A 3CCSN 4WQ5C 4IG0A 1NKBA 1LAWA 4CCHA 1JLAA 1VRTA 1U6ZA 3L3VA 1YJ9N 3SQ4A 2Z1IA 1HQEA 1KAYA 4B3OA 4Z94A 5JLFA 4CBWA 4W5TA 3G0ZA 1BDGA 1VQON 3M6GA 4X65K 2EX3A 5CE3A 5FPDA 4JS5A 3QNOA 1NJZA 1WSHA 2KFZA 5LJVA 5AZIB 4NCGA 1L3VA 2UXCK 4AHSA 4CD3A 5HL7L 4NXMK 3DXMA 1N8RO 3EN9A 4JEPA 1I94K 5GAHP 1KLNA 3SYZA 1RT3A 3VQBA 4YNQA 3V4IA 3TARA 3MCPA 2YNFA 4K43A 4IO8A 1E4FT 3SJJA 1C6VA 4FL9A 5BR9A 3OYLA 2Z1HA 1S3XA 1W9HA 4CIGA 1KAXA 3HVRA 3RR7A 3L2UA 3BP8A 2A1RA 3ENOA 4OO1J 2OZSA 3W0LA 4YHHK 5CYQA 2P9PA 1DGKN 1NG9A 3LZIA 1TAQA 1VSFA 1HPZA 3AVGA 1D5AA 3VEOA 1HKBA 4O5FA 3VQ9A 3ZEUB 1S5JA 4CF9A 4XH4A 3OYJA 4I9LA 3ULEB 1Z6RA 3C94A 4C23A 3IFRA 2D0BA 4BRLA 4AHUA 3LL3A 3DRRA 4CK1A 4M3TA 4JS4A 2O8CA 1KXPA 4E0DA 3OA9A 3HSTB 1K8KA 2IDOA 2E1ZA 2E2PA 5AQMA 5FPMA 4FLTA 3VMFB 1WNSA 4EP5A 4CEZA 3H45C 4MO4A 2FBYA 5K14A 3I33A 4QAGA 4IFEA 3OYGA 3AA3A 4IOCL 4A2AA 1VQNN 4KTZA 1C0MA 1WSFA 3RSEB 2RHKA 1VQ9N 4OGEA 1NK5A 5E26A 4JI4K 3D2EA 2CH5A 1IJJA 2OTJN 3C6AA 5HROA 1MA9B 4DU4A 4Z0UA 1QVFM 4CERA 5I42A 2UUCK 5M1OA 3GE1A 2V7YA 2YHBA 4CGFA 2GUIA 2ZJRL 1IBLK 5GIPA 1BQMA 2XY7A 3TANA 1U2VA 4IG3A 3FZKA 4CHPA 4RW8A 5E41A 3TABA 5EY4A 5AQPA 2RE2A 4CW7B 3OYKA 4B3TK 1SUQA 3ZT2A 3WXLA 4FJGA 4CEOA 1SKSA 4FWRA 2HOEA 4YDUC 3CJAA 2CGJA 4IZ9A 1QSSA 3WT0A 4CF1A 4BRQA 1Q8IA 2QKKA 4FPAA 4KB0A 4WQ4C 4H8KA 2HNDA 2E6MA 4A2BA 1U49A 1EP4A 3HYFA 4GKKK 4CK3A 3OW2M 4O8UA 4PKIA 5A2QO 3RRGA 4KO0A 4BWMA 3SAGA 5KPZA 3J7YP 3THYA 4NXNK 4M63C 3LPUA 1EKEA 3NF7A 3IMXA 4JKGB 4DQPA 1JXEA 5C24A 3V9XA 1BG3A 3G6EN 3KD1E 1RILA 1M1KO 4MO5A 3KWIA 4DQSA 1VSLA 4K42A 4FPBA 5CZ2A 1RNHA 1K9MO 3H3OB 3P1GA 3HSCA 3KLIA 4K25A 3U9DA 3T69A 2KW4A 2XY8A 2GUPA 3U6FA 4BDZA 2YHWA 3QFPA 3SQ0A 4DSKA 1OH7A 4JRQA 1Q86O 4N5SA 1QVGM 3THWA 3AVJA 4J8FA 1DTTA 1P90A 1HYZA 2IVPA 4IJAA 3TAGA 4EZ6A 2JGUA 3IUCA 3G4SN 4DTUA 4TSXA 3QEIA 1T05A 2NRRA 3KTQA 4DQ8A 4H0TB 3CC2N 3QLHA 2WUSA 3A5NC 4GMJB 3ZX2A 4LF9K 4L8RB 3JXUA 1RBUA 4FWOA 4JV5K 1N5YA 4C8NA 4LF4K 3SMSA 2W6KA 4IDKA 3K5OA 1O13A 3TPQA 2O8BB 1GLLO 4BDPA 4KKOA 3H46O 1RT6A 4FW2A 4C8MA 2HMPA 1VQ5N 1B9FA 1JLBA 4Z4IA 5HP1A 4PKHA 3VEZA 3A5MC 4HTLA 3QB0A 2Q31A 1VQ6N 3U8XA 1TK8A 4W5NA 3NF6A 3O4QA 3DOLA 2B4JA 3NVMA 4IFYA 4CJFA 1L3SA 1GLEG 4YOUA 5J2NA 4I7FA 1NKEA 1XMQK 3B6PA 2VGMA 4FK2A 3HPHA 3EZWA 2VQEK 3LP1A 2YHAA 4CFBA 3RR8A 2AP1A 3O3GA 4LFBK 2FF3B 5AQZA 5KQ8A 3QETA 3SPZA 1NGDA 1REVA 3E01A 1ZBHA 1T6CA 4A57A 5C2DA 1NJWA 4E7JA 1JCEA 3AVIA 1SZ2A 3NBPA 2KZZA 1GOCA 3QMLA 4HWIA 1KRPA 3QIPA 2D1KA 2GX9A 4CEEA 3VQ4A 1TK0A 4B1VA 3VQ5A 1VSEA 2FSKA 3K9KA 1N36K 2OA8A 4WFBL 1NK6A 3DOKA 3F9MA 2O8FA 4X64K 2J4RA 4DSEA 3O9UA 3ENHA 4OKJA 3M8SA 4CZHA 4E7IA 5BRFA 4N56A 1RBRA 4BREA 3OS1A 3SLCA 1IG9A 3CM6A 3V6DA 2UU9K 1DTQA 2ZGZA 4BC3A 3V81A 1IBKK 2VWKA 5DK5A 4OLAA 3NDKA 2DFHA 3PSIA 4WCEL 2AA4A 3THXA 2HHUA 1XMOK 2PZSA 5AQJA 4FJ8A 4HHTA 5FROA 3TR8A 5BREA 3AO2A 1UA0A 4Z4FA 3ATVA 3CD6N 4R5PA 5BPMA 3VOVA 4ILHA 3ZT0A 1D9DA 3EEQA 4CFDA 3J81O 3G25A 4B3MK 3ZT1A 1JLCA 2BTFA 5AFUH 2QWMA 2UXBK 3K5MA 2R7YA 1YT3A 1B9DA 4U7BA 1JL1A 4UQGA 1T44A 4ID1A 1JJ2M 4HTUA 1T8EA 1C1AA 3O08A 3VERA 3T19A 2CGLA 4O8KA 3DLEA 4GW6A 3D7EO 1TGOA 3TSPA 1HJRA 3ZSZA 3WQTA 4ELTA 3SBGA 4M7XA 5C15A 3EKSA 5M1PA 3AVLA 4CHOA 4BE0A 4DFPA 3QERA 3ZSXA 1D9FA 3HOTA 3IAYA 2RPIA 4XH5A 4KH6A 3QEWA 5C0YA 1BIZA 1NK9A 1IO2A 2ZM6K 1GLDG 4CJPA 3DLLL 4JK8A 3JSMA 2Q3SA 4LFCK 5LJWA 2QWRA 3ZSWA 4DU1A 4CI6A 3S9HA 3FFKB 1NGCA 2OPSA 1RGIA 5FLXO 3N4QA 1VAZA 2CH6A 4MLHA 4FVUA 3LPTA 4O0JA 1J5OA 1P8ZA 5B8HA 4GV3A 2E20A 3L0QA 4E7LA 4OX9K 1GLAG 4CD1A 4H5NA 2VQFK 3ATUA 1CXUA 1YAGA 4NLBA 3SCXA 3KK3A 3L2VA 3CCMN 1QQCA 3D45A 2P5GA 5LY3A 2XY6A 1ZBIA 4JHDB 4M42A 4KI6A 2I7PA 4B1UB 1NGHA 1UAXA 4OGCA 3OVNA 3KKSA 1LW2A 1WB9A 1E4GT 1CZAN 2P9KB 3KD5E 1T6DA 2W42A 2P5OA 4OLBA 4KHYA 1XHXA 1NGIA 4YDUA 4I2PA 1S22A 4CZEA 4CJSA 5AZIA 1KFDA 5IT9O 3O9RA 1LCUA 1WSJA 4KTQA 1XC9A 3PLAA 5BN9A 3CQXA 1VQ7N 5BPNA 3DJCA 4OVLA 2D0AA 3MECA 3WNGA 1OH8A 4BC4A 5EXWA 2QWLA 4RCHA 3IDHA 4JKEA 4Y1CA 3VTHA 3D6RA 3I56N 4CJWA 4DV6K 4NB4A 1TL1A 3UKRB 4FJXA 1S6QA 4H4MA 4DTXA 3I8DA 2ASOA 3WNHA 3ID6A 4K0KK 1GLCG 1SAZA 3CCVN 3WEEB 3MEEA 4BVPA 5AQIA 1NM1A 3OBWA 2G8IA 1S1XA 3O1BA 3ZEUA 4HUEA 4QS8A 3SAHA 4W5OA 4DFJA 1VQKN 3BDPA 4U67L 3V9ZA 1JLQA 3ULEA 2QI2A 1H1VA 2E5LK 4KHNA 2NRVA 4DR6K 5C42A 4B8AB 4FJHA 3CFPA 3MN6A 3R3LA 1NGBA 2YX6A 1QSLA 4DV0K 4B9TA 2D5RA 5SWMA 3AO5A 3NE6A 3L4QA 2FSJA 3BF1A 3VF4A 2X74A 3E9PA 5AQSA 2EWSA 3U4LA 4PY5A 3L2QA 5M1KA 3J80O 4O0IA 3KLGA 5DM6L 4N41A 4N76A 4KREA 3NFAA 1HJOA 4FLVA 4Z4GA 3UIQA 3TTCA 2BGGA 1NGAA 2NRXA 1M90O 3G71N 3C6HA 3OYFA 4M3RA 4BRGA 4CZFA 5TKWA 3RSEA 4CJ5A 5FRNA 3M8RA 3NGZA 3CFOA 1TKZA 2IIRA 4KPYA 2W41A 4FJKA 5MLCQ 4PKGA 4CZGA 3AA4A 4C8KA 3NHGA 2DY4A 4AHVA 4XEIA 1YVNA 3DYAA 5AQXA 2F96A 1RBSA 3H1VX 5KPTA 1X9JA 1TV6A 4LF5K 3QBWA 4FJJA 1SL0A 1EETA 4H0VB 4O4GA 4B1YB 1S1TA 5BRHA 3LAKA 2HHWA 1VRUA 1Z25A 4CF0A 1L3UA 4W5QA 3GG4A 2I7NA 1NK4A 1ZBUA 3NH2A 1WLJA 2NZTA 1ASUA 4G9ZA 3KLHA 4IDHA 3VA0A 5AQWA 2ZJPL 4FLXA 4FK0A 3ITHA 4DU3A 2I5JA 1XQSC 1KVAA 3H3NO 4BC5A 3ZX3A 4RW9A 4A62A 3OYBA 3MK6A 4YORA 1X9MA 3LWLA 3QBXA 5M1QA 5HLFA 5AQGA 2E6LA 3KHYA 3HZ6A 5AQVA 4A5BA 4DR2K 3B8AX 4CESA 2KFNA 4WFNL 3LDQA 3CMEN 2W6LA 3T7ZA 4JKGA 3BY5A 4KH4A 2XHBA 4MLEA 3HP9A 3WXKA 4FJ5A 5BPLA 3EL2A 5AQLA 3OHRA 1QSYA 4KI4A 1VQPN 3FFIA 3AA2A 2FSNA 4CF8A 1RT7A 5SZTA 4FK4A 3MEGA 2OPQA 4GKJK 3CCQN 3RVCA 4ISEA 3K5NA 1YHQN 1RTHA 5AR0A 3AO1A 4DR3K 4FLZA 3LM2A 1I39A 1KVBA 5FPNA 2ZJQL 4B3RK 2HHTA 3MXIA 3KK7A 1W2BM 1OVQA 1VSKA 1HUXA 4PA1A 4FLYA 2KZMA 1LWEA 5D3GA 4JKFA 2KKZA 4EIAA 1VQLN 4H5WA 4BR7A 1JL2A 4H5TA 4C1NK 2IAJA 3CJ1A 3MN5A 3I55N 3MX5A 1NK8A 5FDLA 3ZSVA 2A3ZA 4MDBA 1IKWA 2NRWA 3JAMO 4CEDA 3CERA 3UKUB 2PAVA 1R59O 1NOZA 2QM1A 4HCBA 3OYCA 4M41A 4E3SA 1RBVA 2O8BA 3CIPA 4JKBA 4IEIA 4I9QA 3R1XA 4DTMA 4GV9A 3O9TA 1RDAA 3F2KA 3MXJA 3K58A 1NJXA 1FKOA 4AF1A 1NOYA 2A41A 4FJIA 3A2FA 4FLUA 3VQEA 2PYJA 2O8EB 3L6QA 2W40A 4ID5A 1QHAA 4DTPA 3BUZB 1HNVA 1X1PA 5C10A 4IFVA 3VQPA 1RDCA 1U47A 1VSIA 4KHPK 3R6MA 4YOXA 2WONA 5HRNA 4E1NA 1F21A 4BE1A 2HNZA 1KFSA 4BE2A 4CJLA 3AO3A 1WBDA 1EWQA 1LWCA 4LY7A 4DR4K 2G8VA 4ISGA 4B1ZA 4H5RA 3EO3A 1RDDA 3BGRA 3C95A 3V1RA 4BQZA 2NRTA 4M45A 3FLCO 1LV5A 1TKXA 4L3QA 3TI0A 4KB1A 4B3SK 3K5LA 4OPAA 4AHRA 3O80A 3G10A 3I0RA 3MEDA 1XUPO 1SKWA 1GLFO 3CJCA 3ENBA 3CPWM 2P51A 3TTDA 4FWPA 4B08A 2P1JA 4CZJA 3PX0A 4KV8A 3KWGA 1WAJA 4R79A 3GDQA 3U3GA 1YJNN 3DXKB 1O1WA 4OPHA 4CIFA 3LM9A 5F2RA 3HM8A 3SV4A 2IC3A 2VG5A 3WXMB 3AVNA 1XWLA 3QEVA 3NF9A 1J5EK 3FZFA 4DLEA 3C6TA 4DSFA 4FWMA 4KHUA 5JS2A 1ASWA 3NF8A 3PO5A 1NGJA 1LOTB 4WF9L 1BO5O 2IVOA 4BGBA 3L8BA 4NCBA 1HMVA 3MXMA 4PL7A 4CGJA 2Q97A 3AVKA 3GL1A 1TKTA 4CHYA 1UWBA 4LFAK 4F3OA 1X3MA 4J2DA 4H0YB 3CM5A 3A0IX 4DWIA 4CJ3A 1RTIA 3SUQA 2ITMA 3EE8A 3VGKA 1NWKA 1JLGA 3HO1A 4GNIA 5AQRA 4ISFA 2O4IA 4EFHA 4JD2B 4B9NA 3CJBA 2Q0RA 2GV9A 2QWNA 2WC9A 1FJGK 1LWFA 2Q1NA 4RWTA 3FE1A 4ELUA 4J2AA 2NNWA 4AM6A 1QQOA 2D4WA 1BA1A 1C0GA 3TSQA 1JLEA 3P4IA 3ALYA 2F9WA 2YV0X 3GOIA 1IBMK 3LANA 4GV6A 3EKUA 1N32K 4BDYA 2OPPA 3NAEA 3QICA 2BANA 3NGYA 4BRIA 4BR2A 4CECA 2E2NA 4FWNA 4I6MA 3ZT3A 2FBVA 3ZX0A 4CEQA 4JI6K 3DLGA 4LC9B 4O44A 4B1WB 3K9JA 2FXUA 4PL8A 4DUZK 4EHUA 3KLFA 3L2WA 5GAGP 4Z4EA 3Q7CA 1S1UA 4DSIA 4WQ5A 3PIPL 3KLEA 1JXBA 1RDBA 4KHWA 2F4VK 5KI6A 4CJTA 4F3TA 4QS9A 1SS6A 4CBUA 1KAZA 4LF6K 3VQ6A 4B9QA 2IS3A 2WTUA 4CK2A 2ASPA 1NJIO 5AQTA 2PY5A 3SK3A 4LF8K 4DQRA 3HT3A 3DWLA 1QQMA 3LALA 2G8FA 3BZCA 3HXMA 4HUFA 2OYQA 3TWHA 1QZ5A 4JHDA 4BG9A 3M3ZA 2QTDA 4DTJA 3O9QA 3M8QA 3F9KA 2WBNA 3OYNA 2P9KA 1BWFO 1L3TA 1Q82O 4X62K 3S3NA 3QEPA 1GLBG 4CJRA 2VYPA 2DPNA 3PY8A 4Q0BA 5AJ3K 3NCIA 1IKVA 3O4WA 3ZYYX 4B9SA 1DT9A 2Z1JA 5CYMA 4M3UA 3AV9A 4FJMA 1A5XA 1VSHA 3QINA 4I2QA 3V1QA 3VEXA 1NNEA 3TTFA 3J8AA 4M7YA 3M8PA 3T1AA 4LD0A 3UKRA 1K73O 4B9UA 1NKCA 2BH1A 3O9SA 4WYBA 4FJNA 3P83D 2P9IA 4O5BA 4JI7K 5ADXA 2ITGA 3HPOA 3O3HA 4AQYK 2FC0A 5JLHA 3WEEA 1VSJA 3LP2A 2RN2A 1N6QA 2ZF5O 1BI4B 3E1YA 1E3MA 3CFRA 1DLOA 2HHSA 3K0SA 3O4NA 1NMNA 3RWUA 1FK9A 1UOCA 3MMVA 2HVHA 4QS7A 3CQYA 1KSPA 4H0PA 4CJVA 4DS5A 4I6MB 5AQKA 2FBXA 4V19S 1Q81O 1U04A 1XNQK 3DRSA 3MAQA 4DTSA 1U48A 5BR8K 3D2FB 1FW6A 2HF3A 4WE1A 3ZETB 4EHTA 4OPJA 5BN8A 1BISA 4KHQA 2D0PA 1HNWK 2FLOA 2Y1JA 4H03B 1SL1A 1SL2A 4CGGA 3LP3A 3VEYA 4N47A 3LAMA 4H0XB 3AARA 2HVIA 2UXDK 1QQNA 4YOTA 1S6PA 5AQFA 2E1YA 1TYQB 2BDPA 4CJKA 5GINA 4CIEA 2P9NB 4GVMA 1CXQA 5KGXA 2YKNA 5J2PA 1LAVA 2OANA 1QTMA 4B1XB 2EHGA 4BR5A 3P31A 4BR9A 1HYSA 1RFQA 3ZSQA 2ASMA 3V9WA 3ZLJA 3R9PA 3TAEA 1ZBFA 4RW6A 4DTRA 4MFBA 4DFMA 4H0OA 3LDSA 4JKCA 3H08A 3V9SA 5KRTA 4DMNA 2XO7A 4DF8A 1MWKA 4WQ4A 4FJ9A 3NH1A 4XH1A 4FXDA 3HM9A 3SQ1A 5HRSA 3HTVA 4IWVA 4FM0A 2FF6A 5AQOA 2KQ2A 3MDQA 1JKHA 5C2FA 4ILGB 4IKFA 4Z4CA 4DQQA 3NVKA 2VWJA 4AHTA 1CLQA 3OY9A 5LMUK 4NYFA 4M3ZA 2ATQA 4LSNA 4DV2K 1L5UA 2P9IB 3FR0A 4FZYA 3S3MA 1ZC6A 2OTLN 4RW7A 4QCLA 4IOAL 3OYEA 2QXFA 4X66K 4GY2B 3EYZA 1JLFA 1MDUB 2Q0UA 4BROA 3O5BA 4H5VA 1LW0A 4KRFA 4CHQA 1S9EA 1VHXA 3PUFA 3ISNC 3T3FA 4JI2K 1XC3A 1CZBA 3VN5A 4DV3K 4CJQA 1C0UA 5AQYA 5TKYA 1J53A 4FSVA 2F8SA 3DI6A 1HNIA 3EY1A 3WXIA 4CVNE 4F9OA 4JK7A 1Q7YO 4PQUA 2A42A 1ZXOA 4DB3A 4BRKA 4BGAA 4YOVA 2IOCA 3GBTA 4M3WA 3CETA 2O4GA 2A6AA 4DQIA 4FCYA 3SAFA 4RG8A 4AHCA 2VG7A 4CZLA 4PUOA 4DV5K 4BRFA 5GADP 4LH4A 4B9VA 1NGFA 1J9AA 1JCFA 3TAMA 4NO7A 2HHXA 1ZBSA 2ZGYA 2QWPA 4FWLA 1S1WA 2NRZA 4BY9C 2CGKA 4JI5K 1WSGA 4FVMA 3P5JA 3AVAA 4JI0K 2AJQA 2YKMA 4J2EA 1QE1A 2UUBK 5JS1A 3UKUA 1T03A 1NK0A 1W7AA 1TK5A 4JYAK 2VWBA 2YHYA 1IH7A 3VQQA 1WSEA 3NH0A 2HBLA 3PX4A 3VF6A 1TL3A 3LP0A 4F2SA 4IBNA 4DSJA 1VQMN 1HR0K 4JI1K 4NCAA 2P9LB 3SPYA 1Q18A 2O8EA 3BF3A 3WNFA 3KK2A 3VGMA 4C8LA 1I3AA 3RMAA 4CGIA 3JS6A 4CBXA 2P9SB 2HHVA 1BHLA 2LSNA 5JMVA 4JAXA 4DG1A 4CEAA 3F5TA 3EZ5A 3V9UA 2BUPA 2HBJA 5LMNK 1IV0A 3S41A 1WSIA 2E2OA 2KLAA 2YNGA 3HPGA 2ZQBA 2F8TA 4JK9A 2P9UB 2IGIA 5JICA 1N34K 3CXCM 1HPMA 3CCJN 3VENA 4NLCA 3VF2A 3SNNA 2G8HA 4AILC 2ZE2A 3QESA 4CJ7A 3ZSOA 1HKGA 2QEXN 3T1YK 5T7BA 3QDKA 3CG7A 4DTOA 4CF2A 1EX4A 5AZJB 5HBMA 3ID8A 3VEVA 1RTDA 5J2MA 3DXKA 3N4PA 1U4BA 4LF7K 3O3FA 2XRIA 2YJFA 4CZIA 4BR4A 1C1CA 5GIOA 4JLHA 3J7AP 4B9MA 2PFUA 3HJFA 1WBBA 3MX2A 3C7NB 2HHQA 1Q9XA 4XIUA 3DRPA 4E19A 3VPZA 4GVEA 3CCUN 3HK2A 1VSDA 3H1QA 4KAZA 2D0CA 1C1BA 4FJLA 1HX1A 3TAFA 4LSLA 4BRCA 4E89A 3VESA 1IKXA 3VTIA 4A59A 2ETJA 5EX5A 1SV5A 3AVHA 5CR4A 3A5OC 3OJSA 2YNIA 2A1SA 1NGGA 1G99A 4JD2A 4Q5VA 1T7PA 2QK9A 3VQDA 3TAPA 5I9EB 3IG1A 2DFEA 2O8DA 3KK1A 4CJ4A 3JYTA 4BRAA 2GELA 4JI3K 2GBZA 1BQNA 2WOMA 1HRHA 3LDLA 3UB5A 4OPKA 2F7TA 5AQUA 1RT4A 2IVNA 5J2QA 3U9ZA 2NUBA 1HNZK 4BRHA 3SUOA 3PV8A 4EP4A 1TVRA 4FWSA 1TKDA 5ELZA 1BUPA 2VCPA 4BRDA 4F4KA 1QS4A 3AA5X 4OKKA 3QNNA 3M1FA 1RT1A 5H1SQ 3MCAB 3CMAN 2F9TA 4BWJA 3SV3A 1Q9YA 4HUGA 4RW4A 3PX6A 1YTUA 4OJRA 1MWMA 3DXMB 3HI0A 3MWPA 1RDWX 1HLUA 3D0PA 4E7HA 3SQ2A 3VQAA 4FWQA 3CQ8A 4FZXC 5FPEA 4YOWA 4CZMA 4DCHA 3VQ7A 4ELVA 4W5RA 4MDAA 2RF2A 2WFBA 1JCGA 3P38A 1Z05A 1W0HA 2GEMA 2D0OA 1HYVA 3WQUA 2KHOA 3AAPA 1KQSM 4DR1K 2P9PB 2H3GX 2B6AA 2Z1GA 4NYNA 4K8ZA 1NMDA 3HL8A 3DM2A 4CEBA 4MQ3A 1J54A 1YVUA 4CZKA 3OYDA 4CEFA 3KKRA 1EQYA 3TSUA 3H6EA 4CGHA 3U3YA 4ZTJA 4DHYA 4KHSA 5C12A 3E66A 1V4SA 1BU6O 1RDUA 4Z4HA 1ATRA 2RKIA 3O6WA 3CCRN 2O8CB 1NU0A 2HBMA 5KTQA 4FJ7A 4DF4A 3OYMA 3TAQA 5HRPA 5EVZA 4FW1A 5I3UA 1K8KB 3PSFA 4FO0A 1IG8A 1YJWN 2HHHK 4DSLA 2KTQA 1VK0A 1S1VA 1ATNA 1RTJA 1ZBLA 5IWAK 2X6SA 3R8EA 1HKCA 5HRRA 5DM7L 4UY8O 4FOIA 3DLRA 2O8DB 3WXJA 3B6OA 4A61A 1GLJO 3RMBA 3MWTA 4EZ9A 5KRSA 1B92A 1QHTA 3SI6A 2HMIA 1BI4A 3DAWA 5CY4A 3ZT4A 4IEEA 3AGRA 4CE9A 1VQ8N 4CHZA 3D2EB 2X6NA 2UYTA 4JNEA 2HBKA 2G8WA 3SMPA 2OCEA 3C0BA 1BCOA 4HVJA 2QW9A 4QOZB 5M1NA 3AVFA 3CPEA 4JKHA 1UA1A 2V7ZA 1S9GA 4J2BA 3E9OA 4M3XA 4BC2A 3C6UA 1J6ZA 1D4XA 2GWJA 1ASVA 3LDOA 2DTUA 1EWRA 3D2FA 3WUHA 3NMUA 5AQHA 1SQKA 4EAHD 3ZETA 1ZYQA 5HOOA 1U2VB 3CHWA 1Y64A 2JLEA 4B8CA 3FZMA 1RCHA 2HSTA 3I0SA 4ZHRA 3THVA 4DR5K 1EXQA 1XHZA 4DUYK 3A8YA 1WAFA 2VG6A 5EOYA 2UUAK 1G15A 1C0FA 4BRMA 4JI8K 5AFUA 1TYQA 3RMDA 1WOQA 5CHIA 3E9LA 2HB5A 1Y97A 2PBDA 2P9NA 3DLHA 3C65A 2DFFA 3J7ZO 3QFUA 1HNXK 1VQ4N 5AQNA 5J1EA 4KBOA 1BCMA 3SZ2A 3DMJA 1KLMA 3THYB 1FXXA 1OKJA 2B5JA 1X3NA 2XY5A 2V51B 1YIJN 4M3YA 2E2QA 3O1WA 1KCFA 5E84A 3CYMA 1ITGA 4FZZA 3EE9A 2GWKA 5M1FA 1GOBA 4IO9L 4BVOA 4DLGA 4PHTX 3AO4A 4DTNA 2V52B 3KVGA 4RTFD 1XI1A 3VA3A 2QWQA 3OBYA 4JKDA 3HP6A 3AAQA 1S72N 2E8AA 4IOXA 3SUPA 1C0TA 4DV4K 1NGEA 4KH5A 1N33K 4DV1K 3K57A 3L3UA 4CHNA 2QKBA 3IRXA 4YFUA 3ZSYA 3A5LC 3RMCA 1RT2A 3ZCMA 1NBWA 2JWLA 3AY9A 3THWB 2YNHA 5LL6Z 1A5VA 3HOSA 3CF5L 1D8YA 5F1XA 2OZMA 3VEWA 3AVCA 4K41A 3T1HK 3MN9A 1X9WA 4CFCA 3K2PA 4DS4A 5KGWA 2G8KA 3OYIA 3LWMA 3VQCA 4E7KA 4KTWA 1IKYA 1WN7A 2E4LA 3FZLA 5BRDA 5KQDA 2Y1IA 3ULDA 4BRNA 2YCHA 4BQLA 4F8RA 3CJ7A 2ZD1A 4BG8A 3SUNA 1MU2A 3FZHA 3LZJA 1W97L 3V1OA 3OYAA 5C25A 2X78A 1VSMA 2FBTA 3KIOA 3OYHA 1X9SA 3BZKA 3OJUA 2ZWHA 3VQ8A 2A5XA 2NRHA 1BGXT 1A5WA 3SBTA 5FRMA 2YHXA 3ASMA 3OTOK 1T3VA 2QXLA 1EO1A 4AM7A 1R0AA 3ZSRA 4PWDA 5JVGL 2OPRA 4FWKA 4O55A 4YOYA 4JRPA 4G1QA 4HCCA 2PYLA 5AQQA 4CFAA 2G8UA 2HNYA 3RTVA 3OS0A 3KZBA 1ILYA 2YI1A 3L2RA 4Y1DA 2HW3A 1XNRK 5ADXH 2E88A 3FGUA 3AVMA 1TAUA 4BR0A 4FYDA 1KD1O 4DR7K 4CJEA 1YI2N 5JVHL 2Q36A 4JKAA 2QWOA 2P9LA 1BA0A 3WNEA 3I8BA 2O8FB 4H4OA 3IS9A 4A5AA 3O8MA 4ICLA 3CI5A 3QIOA 3HVTA 4IJNA 2Q2RA 3PIOL 3NGIA 5CZ1A 2P9SA 3M5RA 3VETA 1FKPA 3KJVA 3IKMA 4BRPA 4FM2A 1ATSA 4CJUA 1BOTO 4ILJA 4DKWA 1DKGD 3TU5A 4KFBA 1TUUA 4DFKA 3THXB 3QO9A 1ESVA 3S3OA 5GAEP 2P9UA 1TUYA 2HF4A 1RT5A 3RRHA 4E1MA 3Q7BA 3SJHA 3MN7A 4LH5A 1KVCA 3CC4N 1YUWA 2QA4N 3DLKA 3PO4A 2BE2A 1SKRA 4C8OA 5KPRA 4OKEA 3LDPA 2NLXA 1DEJA 3AVBA 2YJEA 1NK7A 3CCLN 3AGKA 3CJ9A 1KTQA 3DLBA 5AZJA 3K59A 4ZTFA 1OH6A 1YTAA 4CGDA 4WFAL 4AH9A 4FM1A 4DV7K 3LDNA 1YITN 4Y0WA 1BIUA 1CZ9A 3VGLA 1OH5A 1KC8O
chains in the Genus database with same CATH topology
1JL1A 1VSDA 1JLGA 4UQGA 2D0CA 1C1BA 4ID1A 4KAZA 3HO1A 2O4IA 5DMRA 4HTUA 1T8EA 4B9NA 1C1AA 4FJLA 2GV9A 3T19A 1HQUA 3TAFA 4LSLA 3DLEA 4E89A 4GW6A 1IKXA 1LWFA 1RBTA 1TGOA 2ETJA 1HJRA 3ZSZA 1SV5A 3AVHA 4BACA 4ELTA 4ELUA 3OJSA 4J2AA 2YNIA 4B9LA 3AVLA 4CHOA 2A1SA 1JLEA 4BE0A 4DFPA 3QERA 4Q5VA 1T7PA 3ALYA 2QK9A 2YV0X 3VQDA 3TAPA 4F2RA 3LANA 3F73A 3IG1A 2DFEA 4BDYA 3ZSXA 3KK1A 1D9FA 2OPPA 4CJ4A 3QEXA 3JYTA 3NAEA 3IAYA 2RPIA 2BANA 1K6YA 2GBZA 3NGYA 3QEWA 1BL3A 1BIZA 3OS2A 4K8XA 4CECA 1NK9A 1IO2A 1BQNA 2WOMA 1HRHA 4CJPA 4OPKA 5EU7A 4FLWA 3JSMA 1RT4A 2Q3SA 5J2QA 1U45A 4DU1A 2NUBA 3ZSWA 3S9HA 3ZT3A 2FBVA 1Z26A 2OPSA 3SUOA 3PV8A 4CEQA 4EP4A 1TVRA 3LPTA 3DLGA 4O0JA 1TKDA 1J5OA 4O44A 1GOAA 1NJYA 4E7LA 4F4KA 1QS4A 3KLFA 3L2WA 3AA5X 4OKKA 4Z4EA 4IG0A 1S1UA 1NKBA 3QNNA 4DSIA 1LAWA 1RT1A 3KLEA 4CCHA 1JLAA 1JXBA 1RDBA 1VRTA 3L3VA 1CXUA 5KI6A 4CJTA 4KHWA 4F3TA 3SQ4A 2Z1IA 3SCXA 1HQEA 4B3OA 3KK3A 4BWJA 3L2VA 3SV3A 4W5TA 3VQ6A 3G0ZA 1Q9YA 2IS3A 4HUGA 4RW4A 3PX6A 1QQCA 3D45A 4CK2A 4KB0A 2P5GA 1YTUA 2XY6A 4OJRA 1ZBIA 2PY5A 4M42A 2EX3A 4KI6A 4DQRA 1UAXA 4OGCA 3HT3A 3D0PA 3OVNA 4E7HA 3KKSA 3SQ2A 4JS5A 1LW2A 3LALA 3QNOA 1NJZA 2G8FA 1WSHA 3VQAA 3HXMA 2KFZA 4NCGA 4HUFA 1L3VA 2OYQA 3CQ8A 4AHSA 3TWHA 4FZXC 3VQ7A 4ELVA 3KD5E 4W5RA 2W42A 2P5OA 2RF2A 4OLBA 4KHYA 1XHXA 4DTJA 1KLNA 4I2PA 3SYZA 1W0HA 3M8QA 1RT3A 3VQBA 4YNQA 4CJSA 1KFDA 3V4IA 3F9KA 3TARA 3OYNA 1WSJA 1HYVA 2YNFA 4KTQA 1XC9A 3SJJA 1C6VA 1L3TA 3OYLA 3S3NA 3QEPA 2Z1HA 1W9HA 2Z1GA 4CJRA 4CIGA 4OVLA 2D0AA 3MECA 4NYNA 3WNGA 4K8ZA 3HVRA 3RR7A 3L2UA 3HL8A 3PY8A 3DM2A 2A1RA 4CEBA 4Q0BA 4MQ3A 1J54A 1YVUA 4Y1CA 3NCIA 1IKVA 3OYDA 2OZSA 4CEFA 3KKRA 4B9SA 4CJWA 5CYQA 3LZIA 1TAQA 4CGHA 1VSFA 2Z1JA 5CYMA 1HPZA 3U3YA 1TL1A 3AVGA 4ZTJA 1D5AA 4KHSA 4FJXA 1S6QA 4H4MA 4DTXA 4M3UA 3I8DA 3AV9A 3VQ9A 4Z4HA 4FJMA 1S5JA 4CF9A 2RKIA 1A5XA 1VSHA 3QINA 4I2QA 3V1QA 3WNHA 3OYJA 4I9LA 3C94A 3M8PA 5KTQA 2D0BA 3T1AA 4LD0A 4DF4A 3OYMA 4AHUA 3MEEA 3TAQA 4FJ7A 5HRPA 4B9UA 2G8IA 1S1XA 1NKCA 4FW1A 5I3UA 3DRRA 4FJNA 3P83D 4HUEA 4CK1A 4DSLA 4DFJA 4W5OA 4O5BA 1VK0A 2KTQA 4M3TA 4JS4A 1S1VA 3BDPA 2ITGA 3HPOA 3V9ZA 1JLQA 4E0DA 3O3HA 2FC0A 1ZBLA 1RTJA 4KHNA 1VSJA 3LP2A 2X6SA 2RN2A 5HRRA 5C42A 3HSTB 1N6QA 4B8AB 4FJHA 3CFPA 2IDOA 1BI4B 3DLRA 1QSLA 3CFRA 4B9TA 2D5RA 1DLOA 3B6OA 5SWMA 4FLTA 2HHSA 3AO5A 3NE6A 3RMBA 1WNSA 4EZ9A 4EP5A 3O4NA 4CEZA 5KRSA 3RWUA 1B92A 1FK9A 1UOCA 1QHTA 3SI6A 2X74A 2FBYA 5K14A 2HMIA 2HVHA 4QAGA 3OYGA 4PY5A 3L2QA 1BI4A 1KSPA 3AA3A 5CY4A 3ZT4A 4O0IA 3KLGA 4CJVA 4DS5A 4N41A 4CE9A 4N76A 4KREA 4KTZA 4CHZA 3NFAA 1C0MA 2X6NA 4FLVA 2FBXA 2G8WA 3UIQA 4Z4GA 1WSFA 1U04A 1BCOA 3DRSA 3MAQA 4DTSA 1U48A 4HVJA 2BGGA 4QOZB 4WE1A 4OPJA 1BISA 4KHQA 3AVFA 4OGEA 1UA1A 1NK5A 1S9GA 2Y1JA 4J2BA 3OYFA 4M3XA 4M3RA 3C6UA 1SL1A 1SL2A 4CGGA 4CJ5A 3LP3A 3M8RA 3NGZA 5FRNA 3CFOA 1ASVA 1TKZA 4N47A 4KPYA 2DTUA 3LAMA 4FJKA 5HROA 2HVIA 1ZYQA 3AA4A 4C8KA 2JLEA 4B8CA 3NHGA 4Z0UA 4DU4A 1S6PA 2DY4A 4ZHRA 1RCHA 3I0SA 4AHVA 3THVA 4CERA 1EXQA 5I42A 1XHZA 3DYAA 2F96A 1RBSA 2YHBA 4CGFA 2BDPA 2GUIA 4CJKA 1WAFA 1BQMA 4CIEA 2XY7A 3TANA 4IG3A 2VG6A 4GVMA 1CXQA 4CHPA 1TV6A 5KGXA 1G15A 2YKNA 4RW8A 5J2PA 1LAVA 5E41A 3TABA 3RMDA 1QTMA 4FJJA 1SL0A 1EETA 4O4GA 1S1TA 2EHGA 2HB5A 1Y97A 3DLHA 3LAKA 2HHWA 1VRUA 1Z25A 4CF0A 2DFFA 1L3UA 3ZSQA 4W5QA 3OYKA 1HYSA 1SUQA 3ZT2A 3V9WA 5J1EA 3TAEA 4CEOA 1NK4A 1SKSA 4FJGA 1ZBUA 1BCMA 1ZBFA 3SZ2A 3DMJA 1KLMA 4RW6A 4DTRA 3NH2A 1QSSA 1WLJA 4MFBA 4DFMA 1ASUA 4CF1A 3LDSA 1Q8IA 1FXXA 2QKKA 2B5JA 3H08A 3KLHA 5KRTA 4H8KA 2HNDA 2E6MA 4DMNA 2XO7A 3V9SA 4DF8A 1EP4A 3HYFA 2XY5A 1U49A 3VA0A 4FJ9A 3NH1A 4FXDA 3HM9A 4CK3A 4FLXA 4FK0A 3ITHA 4DU3A 3SQ1A 2I5JA 3RRGA 5HRSA 1KVAA 4KO0A 4BWMA 4FM0A 4M3YA 4RW9A 1KCFA 3LPUA 3OYBA 3CYMA 2KQ2A 1ITGA 1JKHA 1X9MA 1EKEA 3LWLA 4FZZA 5HLFA 1GOBA 4IKFA 2E6LA 3NF7A 4Z4CA 4DLGA 4DQQA 2VWJA 3AO4A 4AHTA 4DTNA 4DQPA 1CLQA 1JXEA 5C24A 3V9XA 3OY9A 4NYFA 1XI1A 4CESA 3VA3A 3KD1E 1RILA 2KFNA 4M3ZA 2ATQA 3HP6A 4LSNA 4DQSA 1VSLA 1L5UA 3SUPA 1C0TA 4FZYA 3S3MA 5CZ2A 2XHBA 3HP9A 3K57A 4FJ5A 3L3UA 1RNHA 4CHNA 3IRXA 4RW7A 2QKBA 4QCLA 3OYEA 2QXFA 3EYZA 1QSYA 4KI4A 1JLFA 3P1GA 4YFUA 3FFIA 3AA2A 3KLIA 4CF8A 1RT7A 3ZSYA 1LW0A 3RMCA 4KRFA 1RT2A 4CHQA 2KW4A 3ZCMA 3MEGA 5SZTA 2OPQA 4FK4A 2XY8A 1S9EA 3PUFA 3ISNC 2YNHA 3U6FA 1A5VA 3T3FA 3VN5A 4BDZA 1CZBA 3K5NA 4CJQA 1C0UA 3SQ0A 1D8YA 1RTHA 3AO1A 1J53A 4DSKA 4FLZA 2OZMA 1I39A 4JRQA 1KVBA 4N5SA 2F8SA 2HHTA 3DI6A 1HNIA 3AVJA 3EY1A 3MXIA 3AVCA 1DTTA 1VSKA 1HYZA 3TAGA 4EZ6A 2JGUA 4DTUA 1X9WA 4PA1A 4CFCA 3K2PA 4TSXA 4FLYA 4DS4A 3QEIA 1T05A 4PQUA 2KZMA 3KTQA 5KGWA 2G8KA 1LWEA 5D3GA 3OYIA 3LWMA 3VQCA 4E7KA 3QLHA 4KTWA 1IKYA 4GMJB 1WN7A 2E4LA 2IOCA 2Y1IA 4M3WA 2O4GA 3ULDA 4DQIA 1JL2A 4FCYA 4F8RA 2IAJA 4L8RB 2ZD1A 1RBUA 3SUNA 4RG8A 1MU2A 4AHCA 2VG7A 4PUOA 3LZJA 1N5YA 4C8NA 1NK8A 5FDLA 4LH4A 3ZSVA 3V1OA 4IDKA 3OYAA 5C25A 2X78A 1IKWA 3K5OA 1VSMA 4B9VA 2FBTA 4BDPA 1J9AA 3KIOA 3TAMA 3OYHA 1X9SA 4KKOA 3OJUA 2HHXA 3VQ8A 4CEDA 1RT6A 1BGXT 1A5WA 4FW2A 4C8MA 1NOZA 1B9FA 4HCBA 3OYCA 5FRMA 1S1WA 1JLBA 4M41A 4Z4IA 3ASMA 5HP1A 4E3SA 1WSGA 4FVMA 1RBVA 3P5JA 3AVAA 2AJQA 2YKMA 4J2EA 1R0AA 3ZSRA 4PWDA 1QE1A 4I9QA 4DTMA 5JS1A 2OPRA 1TK8A 4W5NA 1T03A 1NK0A 3NF6A 1RDAA 3O4QA 3DOLA 2B4JA 3MXJA 1FKOA 4O55A 3K58A 1TK5A 1NJXA 1NOYA 4IFYA 4FJIA 1IH7A 3VQQA 4JRPA 3A2FA 4G1QA 4CJFA 3VQEA 1WSEA 4FLUA 1L3SA 2PYJA 4HCCA 3NH0A 2PYLA 4CFAA 2G8UA 2HNYA 4I7FA 3OS0A 3RTVA 3B6PA 5J2NA 3SUQA 3PX4A 1NKEA 4FK2A 3HPHA 1TL3A 4ID5A 4DTPA 3LP0A 1HNVA 4IBNA 4DSJA 1X1PA 3L2RA 4Y1DA 4F2SA 2HW3A 3LP1A 2YHAA 4IFVA 3VQPA 4CFBA 3RR8A 4NCAA 1RDCA 1U47A 1VSIA 3SPYA 3O3GA 3WNFA 2WONA 3AVMA 3QETA 3SPZA 5HRNA 1TAUA 4FYDA 4E1NA 1F21A 1REVA 2HNZA 3KK2A 4CJEA 4BE1A 1KFSA 4BE2A 3E01A 3AO3A 1I3AA 4CJLA 3RMAA 4C8LA 1ZBHA 1NJWA 4CGIA 4E7JA 3AVIA 1LWCA 2HHVA 4LY7A 3NBPA 3WNEA 1BHLA 2KZZA 2LSNA 2G8VA 4H4OA 4DG1A 3IS9A 4CEAA 3EZ5A 3V9UA 1GOCA 4ICLA 1KRPA 3QIPA 1RDDA 3BGRA 3QIOA 3C95A 3HVTA 3V1RA 4CEEA 3VQ4A 1TK0A 3NGIA 3VQ5A 4M45A 1VSEA 2OA8A 1LV5A 5CZ1A 3DOKA 1TKXA 3TI0A 1NK6A 4KB1A 1WSIA 2YNGA 3HPGA 3K5LA 2ZQBA 2F8TA 4AHRA 1FKPA 3KJVA 2IGIA 3G10A 4FM2A 4DSEA 3I0RA 3MEDA 4CJUA 4OKJA 3M8SA 1SKWA 3SNNA 4E7IA 4KFBA 2P51A 2G8HA 4N56A 1RBRA 4B08A 4DFKA 2P1JA 2ZE2A 3QO9A 4AILC 3QESA 4KV8A 3PX0A 3S3OA 3OS1A 1IG9A 1WAJA 3CM6A 3V6DA 3U3GA 1DTQA 1RT5A 3ZSOA 3RRHA 3V81A 2VWKA 5DK5A 4E1MA 4OLAA 3NDKA 1O1WA 2DFHA 4CIFA 5T7BA 3CG7A 4LH5A 1KVCA 4DTOA 4CF2A 3SV4A 3DLKA 2IC3A 2HHUA 2VG5A 3PO4A 1EX4A 3AVNA 1XWLA 2PZSA 2BE2A 3QEVA 1SKRA 5HBMA 4C8OA 3NF9A 1RTDA 4FJ8A 5J2MA 4OKEA 4E19A 4HHTA 5FROA 3AVBA 3TR8A 1U4BA 4Z4FA 3AO2A 1UA0A 4DLEA 1NK7A 3C6TA 3O3FA 2XRIA 4DSFA 4R5PA 4KHUA 5JS2A 1ASWA 3ZT0A 1KTQA 3NF8A 1D9DA 3PO5A 4CFDA 3DLBA 3ZT1A 1JLCA 3L8BA 1C1CA 4NCBA 4JLHA 1HMVA 3K59A 3MXMA 4CGJA 4ZTFA 4B9MA 3AVKA 1TKTA 1YTAA 1UWBA 4CGDA 4CHYA 3HJFA 4AH9A 3K5MA 4FM1A 4F3OA 4J2DA 3CM5A 4DWIA 2HHQA 1BIUA 1RTIA 1CZ9A 1YT3A 4CJ3A 3DRPA 2B6AA 1B9DA 4XIUA 2R7YA 1Q9XA 3HK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JL1 A;  1VSD A;  1JLG A;  4UQG A;  2D0C A;  1C1B A;  4ID1 A;  4KAZ A;  3HO1 A;  2O4I A;  5DMR A;  4HTU A;  1T8E A;  4B9N A;  1C1A A;  4FJL A;  2GV9 A;  3T19 A;  1HQU A;  3TAF A;  4LSL A;  3DLE A;  4E89 A;  4GW6 A;  1IKX A;  1LWF A;  1RBT A;  1TGO A;  2ETJ A;  1HJR A;  3ZSZ A;  1SV5 A;  3AVH A;  4BAC A;  4ELT A;  4ELU A;  3OJS A;  4J2A A;  2YNI A;  4B9L A;  3AVL A;  4CHO A;  2A1S A;  1JLE A;  4BE0 A;  4DFP A;  3QER A;  4Q5V A;  1T7P A;  3ALY A;  2QK9 A;  2YV0 X;  3VQD A;  3TAP A;  4F2R A;  3LAN A;  3F73 A;  3IG1 A;  2DFE A;  4BDY A;  3ZSX A;  3KK1 A;  1D9F A;  2OPP A;  4CJ4 A;  3QEX A;  3JYT A;  3NAE A;  3IAY A;  2RPI A;  2BAN A;  1K6Y A;  2GBZ A;  3NGY A;  3QEW A;  1BL3 A;  1BIZ A;  3OS2 A;  4K8X A;  4CEC A;  1NK9 A;  1IO2 A;  1BQN A;  2WOM A;  1HRH A;  4CJP A;  4OPK A;  5EU7 A;  4FLW A;  3JSM A;  1RT4 A;  2Q3S A;  5J2Q A;  1U45 A;  4DU1 A;  2NUB A;  3ZSW A;  3S9H A;  3ZT3 A;  2FBV A;  1Z26 A;  2OPS A;  3SUO A;  3PV8 A;  4CEQ A;  4EP4 A;  1TVR A;  3LPT A;  3DLG A;  4O0J A;  1TKD A;  1J5O A;  4O44 A;  1GOA A;  1NJY A;  4E7L A;  4F4K A;  1QS4 A;  3KLF A;  3L2W A;  3AA5 X;  4OKK A;  4Z4E A;  4IG0 A;  1S1U A;  1NKB A;  3QNN A;  4DSI A;  1LAW A;  1RT1 A;  3KLE A;  4CCH A;  1JLA A;  1JXB A;  1RDB A;  1VRT A;  3L3V A;  1CXU A;  5KI6 A;  4CJT A;  4KHW A;  4F3T A;  3SQ4 A;  2Z1I A;  3SCX A;  1HQE A;  4B3O A;  3KK3 A;  4BWJ A;  3L2V A;  3SV3 A;  4W5T A;  3VQ6 A;  3G0Z A;  1Q9Y A;  2IS3 A;  4HUG A;  4RW4 A;  3PX6 A;  1QQC A;  3D45 A;  4CK2 A;  4KB0 A;  2P5G A;  1YTU A;  2XY6 A;  4OJR A;  1ZBI A;  2PY5 A;  4M42 A;  2EX3 A;  4KI6 A;  4DQR A;  1UAX A;  4OGC A;  3HT3 A;  3D0P A;  3OVN A;  4E7H A;  3KKS A;  3SQ2 A;  4JS5 A;  1LW2 A;  3LAL A;  3QNO A;  1NJZ A;  2G8F A;  1WSH A;  3VQA A;  3HXM A;  2KFZ A;  4NCG A;  4HUF A;  1L3V A;  2OYQ A;  3CQ8 A;  4AHS A;  3TWH A;  4FZX C;  3VQ7 A;  4ELV A;  3KD5 E;  4W5R A;  2W42 A;  2P5O A;  2RF2 A;  4OLB A;  4KHY A;  1XHX A;  4DTJ A;  1KLN A;  4I2P A;  3SYZ A;  1W0H A;  3M8Q A;  1RT3 A;  3VQB A;  4YNQ A;  4CJS A;  1KFD A;  3V4I A;  3F9K A;  3TAR A;  3OYN A;  1WSJ A;  1HYV A;  2YNF A;  4KTQ A;  1XC9 A;  3SJJ A;  1C6V A;  1L3T A;  3OYL A;  3S3N A;  3QEP A;  2Z1H A;  1W9H A;  2Z1G A;  4CJR A;  4CIG A;  4OVL A;  2D0A A;  3MEC A;  4NYN A;  3WNG A;  4K8Z A;  3HVR A;  3RR7 A;  3L2U A;  3HL8 A;  3PY8 A;  3DM2 A;  2A1R A;  4CEB A;  4Q0B A;  4MQ3 A;  1J54 A;  1YVU A;  4Y1C A;  3NCI A;  1IKV A;  3OYD A;  2OZS A;  4CEF A;  3KKR A;  4B9S A;  4CJW A;  5CYQ A;  3LZI A;  1TAQ A;  4CGH A;  1VSF A;  2Z1J A;  5CYM A;  1HPZ A;  3U3Y A;  1TL1 A;  3AVG A;  4ZTJ A;  1D5A A;  4KHS A;  4FJX A;  1S6Q A;  4H4M A;  4DTX A;  4M3U A;  3I8D A;  3AV9 A;  3VQ9 A;  4Z4H A;  4FJM A;  1S5J A;  4CF9 A;  2RKI A;  1A5X A;  1VSH A;  3QIN A;  4I2Q A;  3V1Q A;  3WNH A;  3OYJ A;  4I9L A;  3C94 A;  3M8P A;  5KTQ A;  2D0B A;  3T1A A;  4LD0 A;  4DF4 A;  3OYM A;  4AHU A;  3MEE A;  3TAQ A;  4FJ7 A;  5HRP A;  4B9U A;  2G8I A;  1S1X A;  1NKC A;  4FW1 A;  5I3U A;  3DRR A;  4FJN A;  3P83 D;  4HUE A;  4CK1 A;  4DSL A;  4DFJ A;  4W5O A;  4O5B A;  1VK0 A;  2KTQ A;  4M3T A;  4JS4 A;  1S1V A;  3BDP A;  2ITG A;  3HPO A;  3V9Z A;  1JLQ A;  4E0D A;  3O3H A;  2FC0 A;  1ZBL A;  1RTJ A;  4KHN A;  1VSJ A;  3LP2 A;  2X6S A;  2RN2 A;  5HRR A;  5C42 A;  3HST B;  1N6Q A;  4B8A B;  4FJH A;  3CFP A;  2IDO A;  1BI4 B;  3DLR A;  1QSL A;  3CFR A;  4B9T A;  2D5R A;  1DLO A;  3B6O A;  5SWM A;  4FLT A;  2HHS A;  3AO5 A;  3NE6 A;  3RMB A;  1WNS A;  4EZ9 A;  4EP5 A;  3O4N A;  4CEZ A;  5KRS A;  3RWU A;  1B92 A;  1FK9 A;  1UOC A;  1QHT A;  3SI6 A;  2X74 A;  2FBY A;  5K14 A;  2HMI A;  2HVH A;  4QAG A;  3OYG A;  4PY5 A;  3L2Q A;  1BI4 A;  1KSP A;  3AA3 A;  5CY4 A;  3ZT4 A;  4O0I A;  3KLG A;  4CJV A;  4DS5 A;  4N41 A;  4CE9 A;  4N76 A;  4KRE A;  4KTZ A;  4CHZ A;  3NFA A;  1C0M A;  2X6N A;  4FLV A;  2FBX A;  2G8W A;  3UIQ A;  4Z4G A;  1WSF A;  1U04 A;  1BCO A;  3DRS A;  3MAQ A;  4DTS A;  1U48 A;  4HVJ A;  2BGG A;  4QOZ B;  4WE1 A;  4OPJ A;  1BIS A;  4KHQ A;  3AVF A;  4OGE A;  1UA1 A;  1NK5 A;  1S9G A;  2Y1J A;  4J2B A;  3OYF A;  4M3X A;  4M3R A;  3C6U A;  1SL1 A;  1SL2 A;  4CGG A;  4CJ5 A;  3LP3 A;  3M8R A;  3NGZ A;  5FRN A;  3CFO A;  1ASV A;  1TKZ A;  4N47 A;  4KPY A;  2DTU A;  3LAM A;  4FJK A;  5HRO A;  2HVI A;  1ZYQ A;  3AA4 A;  4C8K A;  2JLE A;  4B8C A;  3NHG A;  4Z0U A;  4DU4 A;  1S6P A;  2DY4 A;  4ZHR A;  1RCH A;  3I0S A;  4AHV A;  3THV A;  4CER A;  1EXQ A;  5I42 A;  1XHZ A;  3DYA A;  2F96 A;  1RBS A;  2YHB A;  4CGF A;  2BDP A;  2GUI A;  4CJK A;  1WAF A;  1BQM A;  4CIE A;  2XY7 A;  3TAN A;  4IG3 A;  2VG6 A;  4GVM A;  1CXQ A;  4CHP A;  1TV6 A;  5KGX A;  1G15 A;  2YKN A;  4RW8 A;  5J2P A;  1LAV A;  5E41 A;  3TAB A;  3RMD A;  1QTM A;  4FJJ A;  1SL0 A;  1EET A;  4O4G A;  1S1T A;  2EHG A;  2HB5 A;  1Y97 A;  3DLH A;  3LAK A;  2HHW A;  1VRU A;  1Z25 A;  4CF0 A;  2DFF A;  1L3U A;  3ZSQ A;  4W5Q A;  3OYK A;  1HYS A;  1SUQ A;  3ZT2 A;  3V9W A;  5J1E A;  3TAE A;  4CEO A;  1NK4 A;  1SKS A;  4FJG A;  1ZBU A;  1BCM A;  1ZBF A;  3SZ2 A;  3DMJ A;  1KLM A;  4RW6 A;  4DTR A;  3NH2 A;  1QSS A;  1WLJ A;  4MFB A;  4DFM A;  1ASU A;  4CF1 A;  3LDS A;  1Q8I A;  1FXX A;  2QKK A;  2B5J A;  3H08 A;  3KLH A;  5KRT A;  4H8K A;  2HND A;  2E6M A;  4DMN A;  2XO7 A;  3V9S A;  4DF8 A;  1EP4 A;  3HYF A;  2XY5 A;  1U49 A;  3VA0 A;  4FJ9 A;  3NH1 A;  4FXD A;  3HM9 A;  4CK3 A;  4FLX A;  4FK0 A;  3ITH A;  4DU3 A;  3SQ1 A;  2I5J A;  3RRG A;  5HRS A;  1KVA A;  4KO0 A;  4BWM A;  4FM0 A;  4M3Y A;  4RW9 A;  1KCF A;  3LPU A;  3OYB A;  3CYM A;  2KQ2 A;  1ITG A;  1JKH A;  1X9M A;  1EKE A;  3LWL A;  4FZZ A;  5HLF A;  1GOB A;  4IKF A;  2E6L A;  3NF7 A;  4Z4C A;  4DLG A;  4DQQ A;  2VWJ A;  3AO4 A;  4AHT A;  4DTN A;  4DQP A;  1CLQ A;  1JXE A;  5C24 A;  3V9X A;  3OY9 A;  4NYF A;  1XI1 A;  4CES A;  3VA3 A;  3KD1 E;  1RIL A;  2KFN A;  4M3Z A;  2ATQ A;  3HP6 A;  4LSN A;  4DQS A;  1VSL A;  1L5U A;  3SUP A;  1C0T A;  4FZY A;  3S3M A;  5CZ2 A;  2XHB A;  3HP9 A;  3K57 A;  4FJ5 A;  3L3U A;  1RNH A;  4CHN A;  3IRX A;  4RW7 A;  2QKB A;  4QCL A;  3OYE A;  2QXF A;  3EYZ A;  1QSY A;  4KI4 A;  1JLF A;  3P1G A;  4YFU A;  3FFI A;  3AA2 A;  3KLI A;  4CF8 A;  1RT7 A;  3ZSY A;  1LW0 A;  3RMC A;  4KRF A;  1RT2 A;  4CHQ A;  2KW4 A;  3ZCM A;  3MEG A;  5SZT A;  2OPQ A;  4FK4 A;  2XY8 A;  1S9E A;  3PUF A;  3ISN C;  2YNH A;  3U6F A;  1A5V A;  3T3F A;  3VN5 A;  4BDZ A;  1CZB A;  3K5N A;  4CJQ A;  1C0U A;  3SQ0 A;  1D8Y A;  1RTH A;  3AO1 A;  1J53 A;  4DSK A;  4FLZ A;  2OZM A;  1I39 A;  4JRQ A;  1KVB A;  4N5S A;  2F8S A;  2HHT A;  3DI6 A;  1HNI A;  3AVJ A;  3EY1 A;  3MXI A;  3AVC A;  1DTT A;  1VSK A;  1HYZ A;  3TAG A;  4EZ6 A;  2JGU A;  4DTU A;  1X9W A;  4PA1 A;  4CFC A;  3K2P A;  4TSX A;  4FLY A;  4DS4 A;  3QEI A;  1T05 A;  4PQU A;  2KZM A;  3KTQ A;  5KGW A;  2G8K A;  1LWE A;  5D3G A;  3OYI A;  3LWM A;  3VQC A;  4E7K A;  3QLH A;  4KTW A;  1IKY A;  4GMJ B;  1WN7 A;  2E4L A;  2IOC A;  2Y1I A;  4M3W A;  2O4G A;  3ULD A;  4DQI A;  1JL2 A;  4FCY A;  4F8R A;  2IAJ A;  4L8R B;  2ZD1 A;  1RBU A;  3SUN A;  4RG8 A;  1MU2 A;  4AHC A;  2VG7 A;  4PUO A;  3LZJ A;  1N5Y A;  4C8N A;  1NK8 A;  5FDL A;  4LH4 A;  3ZSV A;  3V1O A;  4IDK A;  3OYA A;  5C25 A;  2X78 A;  1IKW A;  3K5O A;  1VSM A;  4B9V A;  2FBT A;  4BDP A;  1J9A A;  3KIO A;  3TAM A;  3OYH A;  1X9S A;  4KKO A;  3OJU A;  2HHX A;  3VQ8 A;  4CED A;  1RT6 A;  1BGX T;  1A5W A;  4FW2 A;  4C8M A;  1NOZ A;  1B9F A;  4HCB A;  3OYC A;  5FRM A;  1S1W A;  1JLB A;  4M41 A;  4Z4I A;  3ASM A;  5HP1 A;  4E3S A;  1WSG A;  4FVM A;  1RBV A;  3P5J A;  3AVA A;  2AJQ A;  2YKM A;  4J2E A;  1R0A A;  3ZSR A;  4PWD A;  1QE1 A;  4I9Q A;  4DTM A;  5JS1 A;  2OPR A;  1TK8 A;  4W5N A;  1T03 A;  1NK0 A;  3NF6 A;  1RDA A;  3O4Q A;  3DOL A;  2B4J A;  3MXJ A;  1FKO A;  4O55 A;  3K58 A;  1TK5 A;  1NJX A;  1NOY A;  4IFY A;  4FJI A;  1IH7 A;  3VQQ A;  4JRP A;  3A2F A;  4G1Q A;  4CJF A;  3VQE A;  1WSE A;  4FLU A;  1L3S A;  2PYJ A;  4HCC A;  3NH0 A;  2PYL A;  4CFA A;  2G8U A;  2HNY A;  4I7F A;  3OS0 A;  3RTV A;  3B6P A;  5J2N A;  3SUQ A;  3PX4 A;  1NKE A;  4FK2 A;  3HPH A;  1TL3 A;  4ID5 A;  4DTP A;  3LP0 A;  1HNV A;  4IBN A;  4DSJ A;  1X1P A;  3L2R A;  4Y1D A;  4F2S A;  2HW3 A;  3LP1 A;  2YHA A;  4IFV A;  3VQP A;  4CFB A;  3RR8 A;  4NCA A;  1RDC A;  1U47 A;  1VSI A;  3SPY A;  3O3G A;  3WNF A;  2WON A;  3AVM A;  3QET A;  3SPZ A;  5HRN A;  1TAU A;  4FYD A;  4E1N A;  1F21 A;  1REV A;  2HNZ A;  3KK2 A;  4CJE A;  4BE1 A;  1KFS A;  4BE2 A;  3E01 A;  3AO3 A;  1I3A A;  4CJL A;  3RMA A;  4C8L A;  1ZBH A;  1NJW A;  4CGI A;  4E7J A;  3AVI A;  1LWC A;  2HHV A;  4LY7 A;  3NBP A;  3WNE A;  1BHL A;  2KZZ A;  2LSN A;  2G8V A;  4H4O A;  4DG1 A;  3IS9 A;  4CEA A;  3EZ5 A;  3V9U A;  1GOC A;  4ICL A;  1KRP A;  3QIP A;  1RDD A;  3BGR A;  3QIO A;  3C95 A;  3HVT A;  3V1R A;  4CEE A;  3VQ4 A;  1TK0 A;  3NGI A;  3VQ5 A;  4M45 A;  1VSE A;  2OA8 A;  1LV5 A;  5CZ1 A;  3DOK A;  1TKX A;  3TI0 A;  1NK6 A;  4KB1 A;  1WSI A;  2YNG A;  3HPG A;  3K5L A;  2ZQB A;  2F8T A;  4AHR A;  1FKP A;  3KJV A;  2IGI A;  3G10 A;  4FM2 A;  4DSE A;  3I0R A;  3MED A;  4CJU A;  4OKJ A;  3M8S A;  1SKW A;  3SNN A;  4E7I A;  4KFB A;  2P51 A;  2G8H A;  4N56 A;  1RBR A;  4B08 A;  4DFK A;  2P1J A;  2ZE2 A;  3QO9 A;  4AIL C;  3QES A;  4KV8 A;  3PX0 A;  3S3O A;  3OS1 A;  1IG9 A;  1WAJ A;  3CM6 A;  3V6D A;  3U3G A;  1DTQ A;  1RT5 A;  3ZSO A;  3RRH A;  3V81 A;  2VWK A;  5DK5 A;  4E1M A;  4OLA A;  3NDK A;  1O1W A;  2DFH A;  4CIF A;  5T7B A;  3CG7 A;  4LH5 A;  1KVC A;  4DTO A;  4CF2 A;  3SV4 A;  3DLK A;  2IC3 A;  2HHU A;  2VG5 A;  3PO4 A;  1EX4 A;  3AVN A;  1XWL A;  2PZS A;  2BE2 A;  3QEV A;  1SKR A;  5HBM A;  4C8O A;  3NF9 A;  1RTD A;  4FJ8 A;  5J2M A;  4OKE A;  4E19 A;  4HHT A;  5FRO A;  3AVB A;  3TR8 A;  1U4B A;  4Z4F A;  3AO2 A;  1UA0 A;  4DLE A;  1NK7 A;  3C6T A;  3O3F A;  2XRI A;  4DSF A;  4R5P A;  4KHU A;  5JS2 A;  1ASW A;  3ZT0 A;  1KTQ A;  3NF8 A;  1D9D A;  3PO5 A;  4CFD A;  3DLB A;  3ZT1 A;  1JLC A;  3L8B A;  1C1C A;  4NCB A;  4JLH A;  1HMV A;  3K59 A;  3MXM A;  4CGJ A;  4ZTF A;  4B9M A;  3AVK A;  1TKT A;  1YTA A;  1UWB A;  4CGD A;  4CHY A;  3HJF A;  4AH9 A;  3K5M A;  4FM1 A;  4F3O A;  4J2D A;  3CM5 A;  4DWI A;  2HHQ A;  1BIU A;  1RTI A;  1CZ9 A;  1YT3 A;  4CJ3 A;  3DRP A;  2B6A A;  1B9D A;  4XIU A;  2R7Y A;  1Q9X A;  3HK2 A; 
#chains in the Genus database with same CATH topology
 3HRG A;  3W3D A;  4FOE A;  5DMR A;  4E1J A;  3L4I A;  1HQU A;  3C7N A;  4C1N I;  1WUA A;  1RBT A;  5F0X A;  4BAC A;  4B9L A;  2JWK A;  2A40 A;  4F2R A;  1NLV A;  3F73 A;  2VGN A;  4JN4 A;  3QEX A;  3BEX A;  1K6Y A;  1BL3 A;  3OS2 A;  3UE5 A;  1OVY A;  4K8X A;  1YF5 L;  3CC7 N;  5EU7 A;  4FLW A;  1U45 A;  3P39 A;  1K8A O;  1Z26 A;  2GTD A;  1V4T A;  4IXC A;  4YY3 K;  3HBT A;  3CCE N;  1YXQ A;  1GOA A;  1NJY A;  1QZ6 A;  3CCS N;  4WQ5 C;  4IG0 A;  1NKB A;  1LAW A;  4CCH A;  1JLA A;  1VRT A;  1U6Z A;  3L3V A;  1YJ9 N;  3SQ4 A;  2Z1I A;  1HQE A;  1KAY A;  4B3O A;  4Z94 A;  5JLF A;  4CBW A;  4W5T A;  3G0Z A;  1BDG A;  1VQO N;  3M6G A;  4X65 K;  2EX3 A;  5CE3 A;  5FPD A;  4JS5 A;  3QNO A;  1NJZ A;  1WSH A;  2KFZ A;  5LJV A;  5AZI B;  4NCG A;  1L3V A;  2UXC K;  4AHS A;  4CD3 A;  5HL7 L;  4NXM K;  3DXM A;  1N8R O;  3EN9 A;  4JEP A;  1I94 K;  5GAH P;  1KLN A;  3SYZ A;  1RT3 A;  3VQB A;  4YNQ A;  3V4I A;  3TAR A;  3MCP A;  2YNF A;  4K43 A;  4IO8 A;  1E4F T;  3SJJ A;  1C6V A;  4FL9 A;  5BR9 A;  3OYL A;  2Z1H A;  1S3X A;  1W9H A;  4CIG A;  1KAX A;  3HVR A;  3RR7 A;  3L2U A;  3BP8 A;  2A1R A;  3ENO A;  4OO1 J;  2OZS A;  3W0L A;  4YHH K;  5CYQ A;  2P9P A;  1DGK N;  1NG9 A;  3LZI A;  1TAQ A;  1VSF A;  1HPZ A;  3AVG A;  1D5A A;  3VEO A;  1HKB A;  4O5F A;  3VQ9 A;  3ZEU B;  1S5J A;  4CF9 A;  4XH4 A;  3OYJ A;  4I9L A;  3ULE B;  1Z6R A;  3C94 A;  4C23 A;  3IFR A;  2D0B A;  4BRL A;  4AHU A;  3LL3 A;  3DRR A;  4CK1 A;  4M3T A;  4JS4 A;  2O8C A;  1KXP A;  4E0D A;  3OA9 A;  3HST B;  1K8K A;  2IDO A;  2E1Z A;  2E2P A;  5AQM A;  5FPM A;  4FLT A;  3VMF B;  1WNS A;  4EP5 A;  4CEZ A;  3H45 C;  4MO4 A;  2FBY A;  5K14 A;  3I33 A;  4QAG A;  4IFE A;  3OYG A;  3AA3 A;  4IOC L;  4A2A A;  1VQN N;  4KTZ A;  1C0M A;  1WSF A;  3RSE B;  2RHK A;  1VQ9 N;  4OGE A;  1NK5 A;  5E26 A;  4JI4 K;  3D2E A;  2CH5 A;  1IJJ A;  2OTJ N;  3C6A A;  5HRO A;  1MA9 B;  4DU4 A;  4Z0U A;  1QVF M;  4CER A;  5I42 A;  2UUC K;  5M1O A;  3GE1 A;  2V7Y A;  2YHB A;  4CGF A;  2GUI A;  2ZJR L;  1IBL K;  5GIP A;  1BQM A;  2XY7 A;  3TAN A;  1U2V A;  4IG3 A;  3FZK A;  4CHP A;  4RW8 A;  5E41 A;  3TAB A;  5EY4 A;  5AQP A;  2RE2 A;  4CW7 B;  3OYK A;  4B3T K;  1SUQ A;  3ZT2 A;  3WXL A;  4FJG A;  4CEO A;  1SKS A;  4FWR A;  2HOE A;  4YDU C;  3CJA A;  2CGJ A;  4IZ9 A;  1QSS A;  3WT0 A;  4CF1 A;  4BRQ A;  1Q8I A;  2QKK A;  4FPA A;  4KB0 A;  4WQ4 C;  4H8K A;  2HND A;  2E6M A;  4A2B A;  1U49 A;  1EP4 A;  3HYF A;  4GKK K;  4CK3 A;  3OW2 M;  4O8U A;  4PKI A;  5A2Q O;  3RRG A;  4KO0 A;  4BWM A;  3SAG A;  5KPZ A;  3J7Y P;  3THY A;  4NXN K;  4M63 C;  3LPU A;  1EKE A;  3NF7 A;  3IMX A;  4JKG B;  4DQP A;  1JXE A;  5C24 A;  3V9X A;  1BG3 A;  3G6E N;  3KD1 E;  1RIL A;  1M1K O;  4MO5 A;  3KWI A;  4DQS A;  1VSL A;  4K42 A;  4FPB A;  5CZ2 A;  1RNH A;  1K9M O;  3H3O B;  3P1G A;  3HSC A;  3KLI A;  4K25 A;  3U9D A;  3T69 A;  2KW4 A;  2XY8 A;  2GUP A;  3U6F A;  4BDZ A;  2YHW A;  3QFP A;  3SQ0 A;  4DSK A;  1OH7 A;  4JRQ A;  1Q86 O;  4N5S A;  1QVG M;  3THW A;  3AVJ A;  4J8F A;  1DTT A;  1P90 A;  1HYZ A;  2IVP A;  4IJA A;  3TAG A;  4EZ6 A;  2JGU A;  3IUC A;  3G4S N;  4DTU A;  4TSX A;  3QEI A;  1T05 A;  2NRR A;  3KTQ A;  4DQ8 A;  4H0T B;  3CC2 N;  3QLH A;  2WUS A;  3A5N C;  4GMJ B;  3ZX2 A;  4LF9 K;  4L8R B;  3JXU A;  1RBU A;  4FWO A;  4JV5 K;  1N5Y A;  4C8N A;  4LF4 K;  3SMS A;  2W6K A;  4IDK A;  3K5O A;  1O13 A;  3TPQ A;  2O8B B;  1GLL O;  4BDP A;  4KKO A;  3H46 O;  1RT6 A;  4FW2 A;  4C8M A;  2HMP A;  1VQ5 N;  1B9F A;  1JLB A;  4Z4I A;  5HP1 A;  4PKH A;  3VEZ A;  3A5M C;  4HTL A;  3QB0 A;  2Q31 A;  1VQ6 N;  3U8X A;  1TK8 A;  4W5N A;  3NF6 A;  3O4Q A;  3DOL A;  2B4J A;  3NVM A;  4IFY A;  4CJF A;  1L3S A;  1GLE G;  4YOU A;  5J2N A;  4I7F A;  1NKE A;  1XMQ K;  3B6P A;  2VGM A;  4FK2 A;  3HPH A;  3EZW A;  2VQE K;  3LP1 A;  2YHA A;  4CFB A;  3RR8 A;  2AP1 A;  3O3G A;  4LFB K;  2FF3 B;  5AQZ A;  5KQ8 A;  3QET A;  3SPZ A;  1NGD A;  1REV A;  3E01 A;  1ZBH A;  1T6C A;  4A57 A;  5C2D A;  1NJW A;  4E7J A;  1JCE A;  3AVI A;  1SZ2 A;  3NBP A;  2KZZ A;  1GOC A;  3QML A;  4HWI A;  1KRP A;  3QIP A;  2D1K A;  2GX9 A;  4CEE A;  3VQ4 A;  1TK0 A;  4B1V A;  3VQ5 A;  1VSE A;  2FSK A;  3K9K A;  1N36 K;  2OA8 A;  4WFB L;  1NK6 A;  3DOK A;  3F9M A;  2O8F A;  4X64 K;  2J4R A;  4DSE A;  3O9U A;  3ENH A;  4OKJ A;  3M8S A;  4CZH A;  4E7I A;  5BRF A;  4N56 A;  1RBR A;  4BRE A;  3OS1 A;  3SLC A;  1IG9 A;  3CM6 A;  3V6D A;  2UU9 K;  1DTQ A;  2ZGZ A;  4BC3 A;  3V81 A;  1IBK K;  2VWK A;  5DK5 A;  4OLA A;  3NDK A;  2DFH A;  3PSI A;  4WCE L;  2AA4 A;  3THX A;  2HHU A;  1XMO K;  2PZS A;  5AQJ A;  4FJ8 A;  4HHT A;  5FRO A;  3TR8 A;  5BRE A;  3AO2 A;  1UA0 A;  4Z4F A;  3ATV A;  3CD6 N;  4R5P A;  5BPM A;  3VOV A;  4ILH A;  3ZT0 A;  1D9D A;  3EEQ A;  4CFD A;  3J81 O;  3G25 A;  4B3M K;  3ZT1 A;  1JLC A;  2BTF A;  5AFU H;  2QWM A;  2UXB K;  3K5M A;  2R7Y A;  1YT3 A;  1B9D A;  4U7B A;  1JL1 A;  4UQG A;  1T44 A;  4ID1 A;  1JJ2 M;  4HTU A;  1T8E A;  1C1A A;  3O08 A;  3VER A;  3T19 A;  2CGL A;  4O8K A;  3DLE A;  4GW6 A;  3D7E O;  1TGO A;  3TSP A;  1HJR A;  3ZSZ A;  3WQT A;  4ELT A;  3SBG A;  4M7X A;  5C15 A;  3EKS A;  5M1P A;  3AVL A;  4CHO A;  4BE0 A;  4DFP A;  3QER A;  3ZSX A;  1D9F A;  3HOT A;  3IAY A;  2RPI A;  4XH5 A;  4KH6 A;  3QEW A;  5C0Y A;  1BIZ A;  1NK9 A;  1IO2 A;  2ZM6 K;  1GLD G;  4CJP A;  3DLL L;  4JK8 A;  3JSM A;  2Q3S A;  4LFC K;  5LJW A;  2QWR A;  3ZSW A;  4DU1 A;  4CI6 A;  3S9H A;  3FFK B;  1NGC A;  2OPS A;  1RGI A;  5FLX O;  3N4Q A;  1VAZ A;  2CH6 A;  4MLH A;  4FVU A;  3LPT A;  4O0J A;  1J5O A;  1P8Z A;  5B8H A;  4GV3 A;  2E20 A;  3L0Q A;  4E7L A;  4OX9 K;  1GLA G;  4CD1 A;  4H5N A;  2VQF K;  3ATU A;  1CXU A;  1YAG A;  4NLB A;  3SCX A;  3KK3 A;  3L2V A;  3CCM N;  1QQC A;  3D45 A;  2P5G A;  5LY3 A;  2XY6 A;  1ZBI A;  4JHD B;  4M42 A;  4KI6 A;  2I7P A;  4B1U B;  1NGH A;  1UAX A;  4OGC A;  3OVN A;  3KKS A;  1LW2 A;  1WB9 A;  1E4G T;  1CZA N;  2P9K B;  3KD5 E;  1T6D A;  2W42 A;  2P5O A;  4OLB A;  4KHY A;  1XHX A;  1NGI A;  4YDU A;  4I2P A;  1S22 A;  4CZE A;  4CJS A;  5AZI A;  1KFD A;  5IT9 O;  3O9R A;  1LCU A;  1WSJ A;  4KTQ A;  1XC9 A;  3PLA A;  5BN9 A;  3CQX A;  1VQ7 N;  5BPN A;  3DJC A;  4OVL A;  2D0A A;  3MEC A;  3WNG A;  1OH8 A;  4BC4 A;  5EXW A;  2QWL A;  4RCH A;  3IDH A;  4JKE A;  4Y1C A;  3VTH A;  3D6R A;  3I56 N;  4CJW A;  4DV6 K;  4NB4 A;  1TL1 A;  3UKR B;  4FJX A;  1S6Q A;  4H4M A;  4DTX A;  3I8D A;  2ASO A;  3WNH A;  3ID6 A;  4K0K K;  1GLC G;  1SAZ A;  3CCV N;  3WEE B;  3MEE A;  4BVP A;  5AQI A;  1NM1 A;  3OBW A;  2G8I A;  1S1X A;  3O1B A;  3ZEU A;  4HUE A;  4QS8 A;  3SAH A;  4W5O A;  4DFJ A;  1VQK N;  3BDP A;  4U67 L;  3V9Z A;  1JLQ A;  3ULE A;  2QI2 A;  1H1V A;  2E5L K;  4KHN A;  2NRV A;  4DR6 K;  5C42 A;  4B8A B;  4FJH A;  3CFP A;  3MN6 A;  3R3L A;  1NGB A;  2YX6 A;  1QSL A;  4DV0 K;  4B9T A;  2D5R A;  5SWM A;  3AO5 A;  3NE6 A;  3L4Q A;  2FSJ A;  3BF1 A;  3VF4 A;  2X74 A;  3E9P A;  5AQS A;  2EWS A;  3U4L A;  4PY5 A;  3L2Q A;  5M1K A;  3J80 O;  4O0I A;  3KLG A;  5DM6 L;  4N41 A;  4N76 A;  4KRE A;  3NFA A;  1HJO A;  4FLV A;  4Z4G A;  3UIQ A;  3TTC A;  2BGG A;  1NGA A;  2NRX A;  1M90 O;  3G71 N;  3C6H A;  3OYF A;  4M3R A;  4BRG A;  4CZF A;  5TKW A;  3RSE A;  4CJ5 A;  5FRN A;  3M8R A;  3NGZ A;  3CFO A;  1TKZ A;  2IIR A;  4KPY A;  2W41 A;  4FJK A;  5MLC Q;  4PKG A;  4CZG A;  3AA4 A;  4C8K A;  3NHG A;  2DY4 A;  4AHV A;  4XEI A;  1YVN A;  3DYA A;  5AQX A;  2F96 A;  1RBS A;  3H1V X;  5KPT A;  1X9J A;  1TV6 A;  4LF5 K;  3QBW A;  4FJJ A;  1SL0 A;  1EET A;  4H0V B;  4O4G A;  4B1Y B;  1S1T A;  5BRH A;  3LAK A;  2HHW A;  1VRU A;  1Z25 A;  4CF0 A;  1L3U A;  4W5Q A;  3GG4 A;  2I7N A;  1NK4 A;  1ZBU A;  3NH2 A;  1WLJ A;  2NZT A;  1ASU A;  4G9Z A;  3KLH A;  4IDH A;  3VA0 A;  5AQW A;  2ZJP L;  4FLX A;  4FK0 A;  3ITH A;  4DU3 A;  2I5J A;  1XQS C;  1KVA A;  3H3N O;  4BC5 A;  3ZX3 A;  4RW9 A;  4A62 A;  3OYB A;  3MK6 A;  4YOR A;  1X9M A;  3LWL A;  3QBX A;  5M1Q A;  5HLF A;  5AQG A;  2E6L A;  3KHY A;  3HZ6 A;  5AQV A;  4A5B A;  4DR2 K;  3B8A X;  4CES A;  2KFN A;  4WFN L;  3LDQ A;  3CME N;  2W6L A;  3T7Z A;  4JKG A;  3BY5 A;  4KH4 A;  2XHB A;  4MLE A;  3HP9 A;  3WXK A;  4FJ5 A;  5BPL A;  3EL2 A;  5AQL A;  3OHR A;  1QSY A;  4KI4 A;  1VQP N;  3FFI A;  3AA2 A;  2FSN A;  4CF8 A;  1RT7 A;  5SZT A;  4FK4 A;  3MEG A;  2OPQ A;  4GKJ K;  3CCQ N;  3RVC A;  4ISE A;  3K5N A;  1YHQ N;  1RTH A;  5AR0 A;  3AO1 A;  4DR3 K;  4FLZ A;  3LM2 A;  1I39 A;  1KVB A;  5FPN A;  2ZJQ L;  4B3R K;  2HHT A;  3MXI A;  3KK7 A;  1W2B M;  1OVQ A;  1VSK A;  1HUX A;  4PA1 A;  4FLY A;  2KZM A;  1LWE A;  5D3G A;  4JKF A;  2KKZ A;  4EIA A;  1VQL N;  4H5W A;  4BR7 A;  1JL2 A;  4H5T A;  4C1N K;  2IAJ A;  3CJ1 A;  3MN5 A;  3I55 N;  3MX5 A;  1NK8 A;  5FDL A;  3ZSV A;  2A3Z A;  4MDB A;  1IKW A;  2NRW A;  3JAM O;  4CED A;  3CER A;  3UKU B;  2PAV A;  1R59 O;  1NOZ A;  2QM1 A;  4HCB A;  3OYC A;  4M41 A;  4E3S A;  1RBV A;  2O8B A;  3CIP A;  4JKB A;  4IEI A;  4I9Q A;  3R1X A;  4DTM A;  4GV9 A;  3O9T A;  1RDA A;  3F2K A;  3MXJ A;  3K58 A;  1NJX A;  1FKO A;  4AF1 A;  1NOY A;  2A41 A;  4FJI A;  3A2F A;  4FLU A;  3VQE A;  2PYJ A;  2O8E B;  3L6Q A;  2W40 A;  4ID5 A;  1QHA A;  4DTP A;  3BUZ B;  1HNV A;  1X1P A;  5C10 A;  4IFV A;  3VQP A;  1RDC A;  1U47 A;  1VSI A;  4KHP K;  3R6M A;  4YOX A;  2WON A;  5HRN A;  4E1N A;  1F21 A;  4BE1 A;  2HNZ A;  1KFS A;  4BE2 A;  4CJL A;  3AO3 A;  1WBD A;  1EWQ A;  1LWC A;  4LY7 A;  4DR4 K;  2G8V A;  4ISG A;  4B1Z A;  4H5R A;  3EO3 A;  1RDD A;  3BGR A;  3C95 A;  3V1R A;  4BQZ A;  2NRT A;  4M45 A;  3FLC O;  1LV5 A;  1TKX A;  4L3Q A;  3TI0 A;  4KB1 A;  4B3S K;  3K5L A;  4OPA A;  4AHR A;  3O80 A;  3G10 A;  3I0R A;  3MED A;  1XUP O;  1SKW A;  1GLF O;  3CJC A;  3ENB A;  3CPW M;  2P51 A;  3TTD A;  4FWP A;  4B08 A;  2P1J A;  4CZJ A;  3PX0 A;  4KV8 A;  3KWG A;  1WAJ A;  4R79 A;  3GDQ A;  3U3G A;  1YJN N;  3DXK B;  1O1W A;  4OPH A;  4CIF A;  3LM9 A;  5F2R A;  3HM8 A;  3SV4 A;  2IC3 A;  2VG5 A;  3WXM B;  3AVN A;  1XWL A;  3QEV A;  3NF9 A;  1J5E K;  3FZF A;  4DLE A;  3C6T A;  4DSF A;  4FWM A;  4KHU A;  5JS2 A;  1ASW A;  3NF8 A;  3PO5 A;  1NGJ A;  1LOT B;  4WF9 L;  1BO5 O;  2IVO A;  4BGB A;  3L8B A;  4NCB A;  1HMV A;  3MXM A;  4PL7 A;  4CGJ A;  2Q97 A;  3AVK A;  3GL1 A;  1TKT A;  4CHY A;  1UWB A;  4LFA K;  4F3O A;  1X3M A;  4J2D A;  4H0Y B;  3CM5 A;  3A0I X;  4DWI A;  4CJ3 A;  1RTI A;  3SUQ A;  2ITM A;  3EE8 A;  3VGK A;  1NWK A;  1JLG A;  3HO1 A;  4GNI A;  5AQR A;  4ISF A;  2O4I A;  4EFH A;  4JD2 B;  4B9N A;  3CJB A;  2Q0R A;  2GV9 A;  2QWN A;  2WC9 A;  1FJG K;  1LWF A;  2Q1N A;  4RWT A;  3FE1 A;  4ELU A;  4J2A A;  2NNW A;  4AM6 A;  1QQO A;  2D4W A;  1BA1 A;  1C0G A;  3TSQ A;  1JLE A;  3P4I A;  3ALY A;  2F9W A;  2YV0 X;  3GOI A;  1IBM K;  3LAN A;  4GV6 A;  3EKU A;  1N32 K;  4BDY A;  2OPP A;  3NAE A;  3QIC A;  2BAN A;  3NGY A;  4BRI A;  4BR2 A;  4CEC A;  2E2N A;  4FWN A;  4I6M A;  3ZT3 A;  2FBV A;  3ZX0 A;  4CEQ A;  4JI6 K;  3DLG A;  4LC9 B;  4O44 A;  4B1W B;  3K9J A;  2FXU A;  4PL8 A;  4DUZ K;  4EHU A;  3KLF A;  3L2W A;  5GAG P;  4Z4E A;  3Q7C A;  1S1U A;  4DSI A;  4WQ5 A;  3PIP L;  3KLE A;  1JXB A;  1RDB A;  4KHW A;  2F4V K;  5KI6 A;  4CJT A;  4F3T A;  4QS9 A;  1SS6 A;  4CBU A;  1KAZ A;  4LF6 K;  3VQ6 A;  4B9Q A;  2IS3 A;  2WTU A;  4CK2 A;  2ASP A;  1NJI O;  5AQT A;  2PY5 A;  3SK3 A;  4LF8 K;  4DQR A;  3HT3 A;  3DWL A;  1QQM A;  3LAL A;  2G8F A;  3BZC A;  3HXM A;  4HUF A;  2OYQ A;  3TWH A;  1QZ5 A;  4JHD A;  4BG9 A;  3M3Z A;  2QTD A;  4DTJ A;  3O9Q A;  3M8Q A;  3F9K A;  2WBN A;  3OYN A;  2P9K A;  1BWF O;  1L3T A;  1Q82 O;  4X62 K;  3S3N A;  3QEP A;  1GLB G;  4CJR A;  2VYP A;  2DPN A;  3PY8 A;  4Q0B A;  5AJ3 K;  3NCI A;  1IKV A;  3O4W A;  3ZYY X;  4B9S A;  1DT9 A;  2Z1J A;  5CYM A;  4M3U A;  3AV9 A;  4FJM A;  1A5X A;  1VSH A;  3QIN A;  4I2Q A;  3V1Q A;  3VEX A;  1NNE A;  3TTF A;  3J8A A;  4M7Y A;  3M8P A;  3T1A A;  4LD0 A;  3UKR A;  1K73 O;  4B9U A;  1NKC A;  2BH1 A;  3O9S A;  4WYB A;  4FJN A;  3P83 D;  2P9I A;  4O5B A;  4JI7 K;  5ADX A;  2ITG A;  3HPO A;  3O3H A;  4AQY K;  2FC0 A;  5JLH A;  3WEE A;  1VSJ A;  3LP2 A;  2RN2 A;  1N6Q A;  2ZF5 O;  1BI4 B;  3E1Y A;  1E3M A;  3CFR A;  1DLO A;  2HHS A;  3K0S A;  3O4N A;  1NMN A;  3RWU A;  1FK9 A;  1UOC A;  3MMV A;  2HVH A;  4QS7 A;  3CQY A;  1KSP A;  4H0P A;  4CJV A;  4DS5 A;  4I6M B;  5AQK A;  2FBX A;  4V19 S;  1Q81 O;  1U04 A;  1XNQ K;  3DRS A;  3MAQ A;  4DTS A;  1U48 A;  5BR8 K;  3D2F B;  1FW6 A;  2HF3 A;  4WE1 A;  3ZET B;  4EHT A;  4OPJ A;  5BN8 A;  1BIS A;  4KHQ A;  2D0P A;  1HNW K;  2FLO A;  2Y1J A;  4H03 B;  1SL1 A;  1SL2 A;  4CGG A;  3LP3 A;  3VEY A;  4N47 A;  3LAM A;  4H0X B;  3AAR A;  2HVI A;  2UXD K;  1QQN A;  4YOT A;  1S6P A;  5AQF A;  2E1Y A;  1TYQ B;  2BDP A;  4CJK A;  5GIN A;  4CIE A;  2P9N B;  4GVM A;  1CXQ A;  5KGX A;  2YKN A;  5J2P A;  1LAV A;  2OAN A;  1QTM A;  4B1X B;  2EHG A;  4BR5 A;  3P31 A;  4BR9 A;  1HYS A;  1RFQ A;  3ZSQ A;  2ASM A;  3V9W A;  3ZLJ A;  3R9P A;  3TAE A;  1ZBF A;  4RW6 A;  4DTR A;  4MFB A;  4DFM A;  4H0O A;  3LDS A;  4JKC A;  3H08 A;  3V9S A;  5KRT A;  4DMN A;  2XO7 A;  4DF8 A;  1MWK A;  4WQ4 A;  4FJ9 A;  3NH1 A;  4XH1 A;  4FXD A;  3HM9 A;  3SQ1 A;  5HRS A;  3HTV A;  4IWV A;  4FM0 A;  2FF6 A;  5AQO A;  2KQ2 A;  3MDQ A;  1JKH A;  5C2F A;  4ILG B;  4IKF A;  4Z4C A;  4DQQ A;  3NVK A;  2VWJ A;  4AHT A;  1CLQ A;  3OY9 A;  5LMU K;  4NYF A;  4M3Z A;  2ATQ A;  4LSN A;  4DV2 K;  1L5U A;  2P9I B;  3FR0 A;  4FZY A;  3S3M A;  1ZC6 A;  2OTL N;  4RW7 A;  4QCL A;  4IOA L;  3OYE A;  2QXF A;  4X66 K;  4GY2 B;  3EYZ A;  1JLF A;  1MDU B;  2Q0U A;  4BRO A;  3O5B A;  4H5V A;  1LW0 A;  4KRF A;  4CHQ A;  1S9E A;  1VHX A;  3PUF A;  3ISN C;  3T3F A;  4JI2 K;  1XC3 A;  1CZB A;  3VN5 A;  4DV3 K;  4CJQ A;  1C0U A;  5AQY A;  5TKY A;  1J53 A;  4FSV A;  2F8S A;  3DI6 A;  1HNI A;  3EY1 A;  3WXI A;  4CVN E;  4F9O A;  4JK7 A;  1Q7Y O;  4PQU A;  2A42 A;  1ZXO A;  4DB3 A;  4BRK A;  4BGA A;  4YOV A;  2IOC A;  3GBT A;  4M3W A;  3CET A;  2O4G A;  2A6A A;  4DQI A;  4FCY A;  3SAF A;  4RG8 A;  4AHC A;  2VG7 A;  4CZL A;  4PUO A;  4DV5 K;  4BRF A;  5GAD P;  4LH4 A;  4B9V A;  1NGF A;  1J9A A;  1JCF A;  3TAM A;  4NO7 A;  2HHX A;  1ZBS A;  2ZGY A;  2QWP A;  4FWL A;  1S1W A;  2NRZ A;  4BY9 C;  2CGK A;  4JI5 K;  1WSG A;  4FVM A;  3P5J A;  3AVA A;  4JI0 K;  2AJQ A;  2YKM A;  4J2E A;  1QE1 A;  2UUB K;  5JS1 A;  3UKU A;  1T03 A;  1NK0 A;  1W7A A;  1TK5 A;  4JYA K;  2VWB A;  2YHY A;  1IH7 A;  3VQQ A;  1WSE A;  3NH0 A;  2HBL A;  3PX4 A;  3VF6 A;  1TL3 A;  3LP0 A;  4F2S A;  4IBN A;  4DSJ A;  1VQM N;  1HR0 K;  4JI1 K;  4NCA A;  2P9L B;  3SPY A;  1Q18 A;  2O8E A;  3BF3 A;  3WNF A;  3KK2 A;  3VGM A;  4C8L A;  1I3A A;  3RMA A;  4CGI A;  3JS6 A;  4CBX A;  2P9S B;  2HHV A;  1BHL A;  2LSN A;  5JMV A;  4JAX A;  4DG1 A;  4CEA A;  3F5T A;  3EZ5 A;  3V9U A;  2BUP A;  2HBJ A;  5LMN K;  1IV0 A;  3S41 A;  1WSI A;  2E2O A;  2KLA A;  2YNG A;  3HPG A;  2ZQB A;  2F8T A;  4JK9 A;  2P9U B;  2IGI A;  5JIC A;  1N34 K;  3CXC M;  1HPM A;  3CCJ N;  3VEN A;  4NLC A;  3VF2 A;  3SNN A;  2G8H A;  4AIL C;  2ZE2 A;  3QES A;  4CJ7 A;  3ZSO A;  1HKG A;  2QEX N;  3T1Y K;  5T7B A;  3QDK A;  3CG7 A;  4DTO A;  4CF2 A;  1EX4 A;  5AZJ B;  5HBM A;  3ID8 A;  3VEV A;  1RTD A;  5J2M A;  3DXK A;  3N4P A;  1U4B A;  4LF7 K;  3O3F A;  2XRI A;  2YJF A;  4CZI A;  4BR4 A;  1C1C A;  5GIO A;  4JLH A;  3J7A P;  4B9M A;  2PFU A;  3HJF A;  1WBB A;  3MX2 A;  3C7N B;  2HHQ A;  1Q9X A;  4XIU A;  3DRP A;  4E19 A;  3VPZ A;  4GVE A;  3CCU N;  3HK2 A;  1VSD A;  3H1Q A;  4KAZ A;  2D0C A;  1C1B A;  4FJL A;  1HX1 A;  3TAF A;  4LSL A;  4BRC A;  4E89 A;  3VES A;  1IKX A;  3VTI A;  4A59 A;  2ETJ A;  5EX5 A;  1SV5 A;  3AVH A;  5CR4 A;  3A5O C;  3OJS A;  2YNI A;  2A1S A;  1NGG A;  1G99 A;  4JD2 A;  4Q5V A;  1T7P A;  2QK9 A;  3VQD A;  3TAP A;  5I9E B;  3IG1 A;  2DFE A;  2O8D A;  3KK1 A;  4CJ4 A;  3JYT A;  4BRA A;  2GEL A;  4JI3 K;  2GBZ A;  1BQN A;  2WOM A;  1HRH A;  3LDL A;  3UB5 A;  4OPK A;  2F7T A;  5AQU A;  1RT4 A;  2IVN A;  5J2Q A;  3U9Z A;  2NUB A;  1HNZ K;  4BRH A;  3SUO A;  3PV8 A;  4EP4 A;  1TVR A;  4FWS A;  1TKD A;  5ELZ A;  1BUP A;  2VCP A;  4BRD A;  4F4K A;  1QS4 A;  3AA5 X;  4OKK A;  3QNN A;  3M1F A;  1RT1 A;  5H1S Q;  3MCA B;  3CMA N;  2F9T A;  4BWJ A;  3SV3 A;  1Q9Y A;  4HUG A;  4RW4 A;  3PX6 A;  1YTU A;  4OJR A;  1MWM A;  3DXM B;  3HI0 A;  3MWP A;  1RDW X;  1HLU A;  3D0P A;  4E7H A;  3SQ2 A;  3VQA A;  4FWQ A;  3CQ8 A;  4FZX C;  5FPE A;  4YOW A;  4CZM A;  4DCH A;  3VQ7 A;  4ELV A;  4W5R A;  4MDA A;  2RF2 A;  2WFB A;  1JCG A;  3P38 A;  1Z05 A;  1W0H A;  2GEM A;  2D0O A;  1HYV A;  3WQU A;  2KHO A;  3AAP A;  1KQS M;  4DR1 K;  2P9P B;  2H3G X;  2B6A A;  2Z1G A;  4NYN A;  4K8Z A;  1NMD A;  3HL8 A;  3DM2 A;  4CEB A;  4MQ3 A;  1J54 A;  1YVU A;  4CZK A;  3OYD A;  4CEF A;  3KKR A;  1EQY A;  3TSU A;  3H6E A;  4CGH A;  3U3Y A;  4ZTJ A;  4DHY A;  4KHS A;  5C12 A;  3E66 A;  1V4S A;  1BU6 O;  1RDU A;  4Z4H A;  1ATR A;  2RKI A;  3O6W A;  3CCR N;  2O8C B;  1NU0 A;  2HBM A;  5KTQ A;  4FJ7 A;  4DF4 A;  3OYM A;  3TAQ A;  5HRP A;  5EVZ A;  4FW1 A;  5I3U A;  1K8K B;  3PSF A;  4FO0 A;  1IG8 A;  1YJW N;  2HHH K;  4DSL A;  2KTQ A;  1VK0 A;  1S1V A;  1ATN A;  1RTJ A;  1ZBL A;  5IWA K;  2X6S A;  3R8E A;  1HKC A;  5HRR A;  5DM7 L;  4UY8 O;  4FOI A;  3DLR A;  2O8D B;  3WXJ A;  3B6O A;  4A61 A;  1GLJ O;  3RMB A;  3MWT A;  4EZ9 A;  5KRS A;  1B92 A;  1QHT A;  3SI6 A;  2HMI A;  1BI4 A;  3DAW A;  5CY4 A;  3ZT4 A;  4IEE A;  3AGR A;  4CE9 A;  1VQ8 N;  4CHZ A;  3D2E B;  2X6N A;  2UYT A;  4JNE A;  2HBK A;  2G8W A;  3SMP A;  2OCE A;  3C0B A;  1BCO A;  4HVJ A;  2QW9 A;  4QOZ B;  5M1N A;  3AVF A;  3CPE A;  4JKH A;  1UA1 A;  2V7Z A;  1S9G A;  4J2B A;  3E9O A;  4M3X A;  4BC2 A;  3C6U A;  1J6Z A;  1D4X A;  2GWJ A;  1ASV A;  3LDO A;  2DTU A;  1EWR A;  3D2F A;  3WUH A;  3NMU A;  5AQH A;  1SQK A;  4EAH D;  3ZET A;  1ZYQ A;  5HOO A;  1U2V B;  3CHW A;  1Y64 A;  2JLE A;  4B8C A;  3FZM A;  1RCH A;  2HST A;  3I0S A;  4ZHR A;  3THV A;  4DR5 K;  1EXQ A;  1XHZ A;  4DUY K;  3A8Y A;  1WAF A;  2VG6 A;  5EOY A;  2UUA K;  1G15 A;  1C0F A;  4BRM A;  4JI8 K;  5AFU A;  1TYQ A;  3RMD A;  1WOQ A;  5CHI A;  3E9L A;  2HB5 A;  1Y97 A;  2PBD A;  2P9N A;  3DLH A;  3C65 A;  2DFF A;  3J7Z O;  3QFU A;  1HNX K;  1VQ4 N;  5AQN A;  5J1E A;  4KBO A;  1BCM A;  3SZ2 A;  3DMJ A;  1KLM A;  3THY B;  1FXX A;  1OKJ A;  2B5J A;  1X3N A;  2XY5 A;  2V51 B;  1YIJ N;  4M3Y A;  2E2Q A;  3O1W A;  1KCF A;  5E84 A;  3CYM A;  1ITG A;  4FZZ A;  3EE9 A;  2GWK A;  5M1F A;  1GOB A;  4IO9 L;  4BVO A;  4DLG A;  4PHT X;  3AO4 A;  4DTN A;  2V52 B;  3KVG A;  4RTF D;  1XI1 A;  3VA3 A;  2QWQ A;  3OBY A;  4JKD A;  3HP6 A;  3AAQ A;  1S72 N;  2E8A A;  4IOX A;  3SUP A;  1C0T A;  4DV4 K;  1NGE A;  4KH5 A;  1N33 K;  4DV1 K;  3K57 A;  3L3U A;  4CHN A;  2QKB A;  3IRX A;  4YFU A;  3ZSY A;  3A5L C;  3RMC A;  1RT2 A;  3ZCM A;  1NBW A;  2JWL A;  3AY9 A;  3THW B;  2YNH A;  5LL6 Z;  1A5V A;  3HOS A;  3CF5 L;  1D8Y A;  5F1X A;  2OZM A;  3VEW A;  3AVC A;  4K41 A;  3T1H K;  3MN9 A;  1X9W A;  4CFC A;  3K2P A;  4DS4 A;  5KGW A;  2G8K A;  3OYI A;  3LWM A;  3VQC A;  4E7K A;  4KTW A;  1IKY A;  1WN7 A;  2E4L A;  3FZL A;  5BRD A;  5KQD A;  2Y1I A;  3ULD A;  4BRN A;  2YCH A;  4BQL A;  4F8R A;  3CJ7 A;  2ZD1 A;  4BG8 A;  3SUN A;  1MU2 A;  3FZH A;  3LZJ A;  1W97 L;  3V1O A;  3OYA A;  5C25 A;  2X78 A;  1VSM A;  2FBT A;  3KIO A;  3OYH A;  1X9S A;  3BZK A;  3OJU A;  2ZWH A;  3VQ8 A;  2A5X A;  2NRH A;  1BGX T;  1A5W A;  3SBT A;  5FRM A;  2YHX A;  3ASM A;  3OTO K;  1T3V A;  2QXL A;  1EO1 A;  4AM7 A;  1R0A A;  3ZSR A;  4PWD A;  5JVG L;  2OPR A;  4FWK A;  4O55 A;  4YOY A;  4JRP A;  4G1Q A;  4HCC A;  2PYL A;  5AQQ A;  4CFA A;  2G8U A;  2HNY A;  3RTV A;  3OS0 A;  3KZB A;  1ILY A;  2YI1 A;  3L2R A;  4Y1D A;  2HW3 A;  1XNR K;  5ADX H;  2E88 A;  3FGU A;  3AVM A;  1TAU A;  4BR0 A;  4FYD A;  1KD1 O;  4DR7 K;  4CJE A;  1YI2 N;  5JVH L;  2Q36 A;  4JKA A;  2QWO A;  2P9L A;  1BA0 A;  3WNE A;  3I8B A;  2O8F B;  4H4O A;  3IS9 A;  4A5A A;  3O8M A;  4ICL A;  3CI5 A;  3QIO A;  3HVT A;  4IJN A;  2Q2R A;  3PIO L;  3NGI A;  5CZ1 A;  2P9S A;  3M5R A;  3VET A;  1FKP A;  3KJV A;  3IKM A;  4BRP A;  4FM2 A;  1ATS A;  4CJU A;  1BOT O;  4ILJ A;  4DKW A;  1DKG D;  3TU5 A;  4KFB A;  1TUU A;  4DFK A;  3THX B;  3QO9 A;  1ESV A;  3S3O A;  5GAE P;  2P9U A;  1TUY A;  2HF4 A;  1RT5 A;  3RRH A;  4E1M A;  3Q7B A;  3SJH A;  3MN7 A;  4LH5 A;  1KVC A;  3CC4 N;  1YUW A;  2QA4 N;  3DLK A;  3PO4 A;  2BE2 A;  1SKR A;  4C8O A;  5KPR A;  4OKE A;  3LDP A;  2NLX A;  1DEJ A;  3AVB A;  2YJE A;  1NK7 A;  3CCL N;  3AGK A;  3CJ9 A;  1KTQ A;  3DLB A;  5AZJ A;  3K59 A;  4ZTF A;  1OH6 A;  1YTA A;  4CGD A;  4WFA L;  4AH9 A;  4FM1 A;  4DV7 K;  3LDN A;  1YIT N;  4Y0W A;  1BIU A;  1CZ9 A;  3VGL A;  1OH5 A;  1KC8 O; 
#chains in the Genus database with same CATH homology
 1JL1 A;  1VSD A;  1JLG A;  4UQG A;  2D0C A;  1C1B A;  4ID1 A;  4KAZ A;  3HO1 A;  2O4I A;  5DMR A;  4HTU A;  1T8E A;  4B9N A;  1C1A A;  4FJL A;  2GV9 A;  3T19 A;  1HQU A;  3TAF A;  4LSL A;  3DLE A;  4E89 A;  4GW6 A;  1IKX A;  1LWF A;  1RBT A;  1TGO A;  2ETJ A;  1HJR A;  3ZSZ A;  1SV5 A;  3AVH A;  4BAC A;  4ELT A;  4ELU A;  3OJS A;  4J2A A;  2YNI A;  4B9L A;  3AVL A;  4CHO A;  2A1S A;  1JLE A;  4BE0 A;  4DFP A;  3QER A;  4Q5V A;  1T7P A;  3ALY A;  2QK9 A;  2YV0 X;  3VQD A;  3TAP A;  4F2R A;  3LAN A;  3F73 A;  3IG1 A;  2DFE A;  4BDY A;  3ZSX A;  3KK1 A;  1D9F A;  2OPP A;  4CJ4 A;  3QEX A;  3JYT A;  3NAE A;  3IAY A;  2RPI A;  2BAN A;  1K6Y A;  2GBZ A;  3NGY A;  3QEW A;  1BL3 A;  1BIZ A;  3OS2 A;  4K8X A;  4CEC A;  1NK9 A;  1IO2 A;  1BQN A;  2WOM A;  1HRH A;  4CJP A;  4OPK A;  5EU7 A;  4FLW A;  3JSM A;  1RT4 A;  2Q3S A;  5J2Q A;  1U45 A;  4DU1 A;  2NUB A;  3ZSW A;  3S9H A;  3ZT3 A;  2FBV A;  1Z26 A;  2OPS A;  3SUO A;  3PV8 A;  4CEQ A;  4EP4 A;  1TVR A;  3LPT A;  3DLG A;  4O0J A;  1TKD A;  1J5O A;  4O44 A;  1GOA A;  1NJY A;  4E7L A;  4F4K A;  1QS4 A;  3KLF A;  3L2W A;  3AA5 X;  4OKK A;  4Z4E A;  4IG0 A;  1S1U A;  1NKB A;  3QNN A;  4DSI A;  1LAW A;  1RT1 A;  3KLE A;  4CCH A;  1JLA A;  1JXB A;  1RDB A;  1VRT A;  3L3V A;  1CXU A;  5KI6 A;  4CJT A;  4KHW A;  4F3T A;  3SQ4 A;  2Z1I A;  3SCX A;  1HQE A;  4B3O A;  3KK3 A;  4BWJ A;  3L2V A;  3SV3 A;  4W5T A;  3VQ6 A;  3G0Z A;  1Q9Y A;  2IS3 A;  4HUG A;  4RW4 A;  3PX6 A;  1QQC A;  3D45 A;  4CK2 A;  4KB0 A;  2P5G A;  1YTU A;  2XY6 A;  4OJR A;  1ZBI A;  2PY5 A;  4M42 A;  2EX3 A;  4KI6 A;  4DQR A;  1UAX A;  4OGC A;  3HT3 A;  3D0P A;  3OVN A;  4E7H A;  3KKS A;  3SQ2 A;  4JS5 A;  1LW2 A;  3LAL A;  3QNO A;  1NJZ A;  2G8F A;  1WSH A;  3VQA A;  3HXM A;  2KFZ A;  4NCG A;  4HUF A;  1L3V A;  2OYQ A;  3CQ8 A;  4AHS A;  3TWH A;  4FZX C;  3VQ7 A;  4ELV A;  3KD5 E;  4W5R A;  2W42 A;  2P5O A;  2RF2 A;  4OLB A;  4KHY A;  1XHX A;  4DTJ A;  1KLN A;  4I2P A;  3SYZ A;  1W0H A;  3M8Q A;  1RT3 A;  3VQB A;  4YNQ A;  4CJS A;  1KFD A;  3V4I A;  3F9K A;  3TAR A;  3OYN A;  1WSJ A;  1HYV A;  2YNF A;  4KTQ A;  1XC9 A;  3SJJ A;  1C6V A;  1L3T A;  3OYL A;  3S3N A;  3QEP A;  2Z1H A;  1W9H A;  2Z1G A;  4CJR A;  4CIG A;  4OVL A;  2D0A A;  3MEC A;  4NYN A;  3WNG A;  4K8Z A;  3HVR A;  3RR7 A;  3L2U A;  3HL8 A;  3PY8 A;  3DM2 A;  2A1R A;  4CEB A;  4Q0B A;  4MQ3 A;  1J54 A;  1YVU A;  4Y1C A;  3NCI A;  1IKV A;  3OYD A;  2OZS A;  4CEF A;  3KKR A;  4B9S A;  4CJW A;  5CYQ A;  3LZI A;  1TAQ A;  4CGH A;  1VSF A;  2Z1J A;  5CYM A;  1HPZ A;  3U3Y A;  1TL1 A;  3AVG A;  4ZTJ A;  1D5A A;  4KHS A;  4FJX A;  1S6Q A;  4H4M A;  4DTX A;  4M3U A;  3I8D A;  3AV9 A;  3VQ9 A;  4Z4H A;  4FJM A;  1S5J A;  4CF9 A;  2RKI A;  1A5X A;  1VSH A;  3QIN A;  4I2Q A;  3V1Q A;  3WNH A;  3OYJ A;  4I9L A;  3C94 A;  3M8P A;  5KTQ A;  2D0B A;  3T1A A;  4LD0 A;  4DF4 A;  3OYM A;  4AHU A;  3MEE A;  3TAQ A;  4FJ7 A;  5HRP A;  4B9U A;  2G8I A;  1S1X A;  1NKC A;  4FW1 A;  5I3U A;  3DRR A;  4FJN A;  3P83 D;  4HUE A;  4CK1 A;  4DSL A;  4DFJ A;  4W5O A;  4O5B A;  1VK0 A;  2KTQ A;  4M3T A;  4JS4 A;  1S1V A;  3BDP A;  2ITG A;  3HPO A;  3V9Z A;  1JLQ A;  4E0D A;  3O3H A;  2FC0 A;  1ZBL A;  1RTJ A;  4KHN A;  1VSJ A;  3LP2 A;  2X6S A;  2RN2 A;  5HRR A;  5C42 A;  3HST B;  1N6Q A;  4B8A B;  4FJH A;  3CFP A;  2IDO A;  1BI4 B;  3DLR A;  1QSL A;  3CFR A;  4B9T A;  2D5R A;  1DLO A;  3B6O A;  5SWM A;  4FLT A;  2HHS A;  3AO5 A;  3NE6 A;  3RMB A;  1WNS A;  4EZ9 A;  4EP5 A;  3O4N A;  4CEZ A;  5KRS A;  3RWU A;  1B92 A;  1FK9 A;  1UOC A;  1QHT A;  3SI6 A;  2X74 A;  2FBY A;  5K14 A;  2HMI A;  2HVH A;  4QAG A;  3OYG A;  4PY5 A;  3L2Q A;  1BI4 A;  1KSP A;  3AA3 A;  5CY4 A;  3ZT4 A;  4O0I A;  3KLG A;  4CJV A;  4DS5 A;  4N41 A;  4CE9 A;  4N76 A;  4KRE A;  4KTZ A;  4CHZ A;  3NFA A;  1C0M A;  2X6N A;  4FLV A;  2FBX A;  2G8W A;  3UIQ A;  4Z4G A;  1WSF A;  1U04 A;  1BCO A;  3DRS A;  3MAQ A;  4DTS A;  1U48 A;  4HVJ A;  2BGG A;  4QOZ B;  4WE1 A;  4OPJ A;  1BIS A;  4KHQ A;  3AVF A;  4OGE A;  1UA1 A;  1NK5 A;  1S9G A;  2Y1J A;  4J2B A;  3OYF A;  4M3X A;  4M3R A;  3C6U A;  1SL1 A;  1SL2 A;  4CGG A;  4CJ5 A;  3LP3 A;  3M8R A;  3NGZ A;  5FRN A;  3CFO A;  1ASV A;  1TKZ A;  4N47 A;  4KPY A;  2DTU A;  3LAM A;  4FJK A;  5HRO A;  2HVI A;  1ZYQ A;  3AA4 A;  4C8K A;  2JLE A;  4B8C A;  3NHG A;  4Z0U A;  4DU4 A;  1S6P A;  2DY4 A;  4ZHR A;  1RCH A;  3I0S A;  4AHV A;  3THV A;  4CER A;  1EXQ A;  5I42 A;  1XHZ A;  3DYA A;  2F96 A;  1RBS A;  2YHB A;  4CGF A;  2BDP A;  2GUI A;  4CJK A;  1WAF A;  1BQM A;  4CIE A;  2XY7 A;  3TAN A;  4IG3 A;  2VG6 A;  4GVM A;  1CXQ A;  4CHP A;  1TV6 A;  5KGX A;  1G15 A;  2YKN A;  4RW8 A;  5J2P A;  1LAV A;  5E41 A;  3TAB A;  3RMD A;  1QTM A;  4FJJ A;  1SL0 A;  1EET A;  4O4G A;  1S1T A;  2EHG A;  2HB5 A;  1Y97 A;  3DLH A;  3LAK A;  2HHW A;  1VRU A;  1Z25 A;  4CF0 A;  2DFF A;  1L3U A;  3ZSQ A;  4W5Q A;  3OYK A;  1HYS A;  1SUQ A;  3ZT2 A;  3V9W A;  5J1E A;  3TAE A;  4CEO A;  1NK4 A;  1SKS A;  4FJG A;  1ZBU A;  1BCM A;  1ZBF A;  3SZ2 A;  3DMJ A;  1KLM A;  4RW6 A;  4DTR A;  3NH2 A;  1QSS A;  1WLJ A;  4MFB A;  4DFM A;  1ASU A;  4CF1 A;  3LDS A;  1Q8I A;  1FXX A;  2QKK A;  2B5J A;  3H08 A;  3KLH A;  5KRT A;  4H8K A;  2HND A;  2E6M A;  4DMN A;  2XO7 A;  3V9S A;  4DF8 A;  1EP4 A;  3HYF A;  2XY5 A;  1U49 A;  3VA0 A;  4FJ9 A;  3NH1 A;  4FXD A;  3HM9 A;  4CK3 A;  4FLX A;  4FK0 A;  3ITH A;  4DU3 A;  3SQ1 A;  2I5J A;  3RRG A;  5HRS A;  1KVA A;  4KO0 A;  4BWM A;  4FM0 A;  4M3Y A;  4RW9 A;  1KCF A;  3LPU A;  3OYB A;  3CYM A;  2KQ2 A;  1ITG A;  1JKH A;  1X9M A;  1EKE A;  3LWL A;  4FZZ A;  5HLF A;  1GOB A;  4IKF A;  2E6L A;  3NF7 A;  4Z4C A;  4DLG A;  4DQQ A;  2VWJ A;  3AO4 A;  4AHT A;  4DTN A;  4DQP A;  1CLQ A;  1JXE A;  5C24 A;  3V9X A;  3OY9 A;  4NYF A;  1XI1 A;  4CES A;  3VA3 A;  3KD1 E;  1RIL A;  2KFN A;  4M3Z A;  2ATQ A;  3HP6 A;  4LSN A;  4DQS A;  1VSL A;  1L5U A;  3SUP A;  1C0T A;  4FZY A;  3S3M A;  5CZ2 A;  2XHB A;  3HP9 A;  3K57 A;  4FJ5 A;  3L3U A;  1RNH A;  4CHN A;  3IRX A;  4RW7 A;  2QKB A;  4QCL A;  3OYE A;  2QXF A;  3EYZ A;  1QSY A;  4KI4 A;  1JLF A;  3P1G A;  4YFU A;  3FFI A;  3AA2 A;  3KLI A;  4CF8 A;  1RT7 A;  3ZSY A;  1LW0 A;  3RMC A;  4KRF A;  1RT2 A;  4CHQ A;  2KW4 A;  3ZCM A;  3MEG A;  5SZT A;  2OPQ A;  4FK4 A;  2XY8 A;  1S9E A;  3PUF A;  3ISN C;  2YNH A;  3U6F A;  1A5V A;  3T3F A;  3VN5 A;  4BDZ A;  1CZB A;  3K5N A;  4CJQ A;  1C0U A;  3SQ0 A;  1D8Y A;  1RTH A;  3AO1 A;  1J53 A;  4DSK A;  4FLZ A;  2OZM A;  1I39 A;  4JRQ A;  1KVB A;  4N5S A;  2F8S A;  2HHT A;  3DI6 A;  1HNI A;  3AVJ A;  3EY1 A;  3MXI A;  3AVC A;  1DTT A;  1VSK A;  1HYZ A;  3TAG A;  4EZ6 A;  2JGU A;  4DTU A;  1X9W A;  4PA1 A;  4CFC A;  3K2P A;  4TSX A;  4FLY A;  4DS4 A;  3QEI A;  1T05 A;  4PQU A;  2KZM A;  3KTQ A;  5KGW A;  2G8K A;  1LWE A;  5D3G A;  3OYI A;  3LWM A;  3VQC A;  4E7K A;  3QLH A;  4KTW A;  1IKY A;  4GMJ B;  1WN7 A;  2E4L A;  2IOC A;  2Y1I A;  4M3W A;  2O4G A;  3ULD A;  4DQI A;  1JL2 A;  4FCY A;  4F8R A;  2IAJ A;  4L8R B;  2ZD1 A;  1RBU A;  3SUN A;  4RG8 A;  1MU2 A;  4AHC A;  2VG7 A;  4PUO A;  3LZJ A;  1N5Y A;  4C8N A;  1NK8 A;  5FDL A;  4LH4 A;  3ZSV A;  3V1O A;  4IDK A;  3OYA A;  5C25 A;  2X78 A;  1IKW A;  3K5O A;  1VSM A;  4B9V A;  2FBT A;  4BDP A;  1J9A A;  3KIO A;  3TAM A;  3OYH A;  1X9S A;  4KKO A;  3OJU A;  2HHX A;  3VQ8 A;  4CED A;  1RT6 A;  1BGX T;  1A5W A;  4FW2 A;  4C8M A;  1NOZ A;  1B9F A;  4HCB A;  3OYC A;  5FRM A;  1S1W A;  1JLB A;  4M41 A;  4Z4I A;  3ASM A;  5HP1 A;  4E3S A;  1WSG A;  4FVM A;  1RBV A;  3P5J A;  3AVA A;  2AJQ A;  2YKM A;  4J2E A;  1R0A A;  3ZSR A;  4PWD A;  1QE1 A;  4I9Q A;  4DTM A;  5JS1 A;  2OPR A;  1TK8 A;  4W5N A;  1T03 A;  1NK0 A;  3NF6 A;  1RDA A;  3O4Q A;  3DOL A;  2B4J A;  3MXJ A;  1FKO A;  4O55 A;  3K58 A;  1TK5 A;  1NJX A;  1NOY A;  4IFY A;  4FJI A;  1IH7 A;  3VQQ A;  4JRP A;  3A2F A;  4G1Q A;  4CJF A;  3VQE A;  1WSE A;  4FLU A;  1L3S A;  2PYJ A;  4HCC A;  3NH0 A;  2PYL A;  4CFA A;  2G8U A;  2HNY A;  4I7F A;  3OS0 A;  3RTV A;  3B6P A;  5J2N A;  3SUQ A;  3PX4 A;  1NKE A;  4FK2 A;  3HPH A;  1TL3 A;  4ID5 A;  4DTP A;  3LP0 A;  1HNV A;  4IBN A;  4DSJ A;  1X1P A;  3L2R A;  4Y1D A;  4F2S A;  2HW3 A;  3LP1 A;  2YHA A;  4IFV A;  3VQP A;  4CFB A;  3RR8 A;  4NCA A;  1RDC A;  1U47 A;  1VSI A;  3SPY A;  3O3G A;  3WNF A;  2WON A;  3AVM A;  3QET A;  3SPZ A;  5HRN A;  1TAU A;  4FYD A;  4E1N A;  1F21 A;  1REV A;  2HNZ A;  3KK2 A;  4CJE A;  4BE1 A;  1KFS A;  4BE2 A;  3E01 A;  3AO3 A;  1I3A A;  4CJL A;  3RMA A;  4C8L A;  1ZBH A;  1NJW A;  4CGI A;  4E7J A;  3AVI A;  1LWC A;  2HHV A;  4LY7 A;  3NBP A;  3WNE A;  1BHL A;  2KZZ A;  2LSN A;  2G8V A;  4H4O A;  4DG1 A;  3IS9 A;  4CEA A;  3EZ5 A;  3V9U A;  1GOC A;  4ICL A;  1KRP A;  3QIP A;  1RDD A;  3BGR A;  3QIO A;  3C95 A;  3HVT A;  3V1R A;  4CEE A;  3VQ4 A;  1TK0 A;  3NGI A;  3VQ5 A;  4M45 A;  1VSE A;  2OA8 A;  1LV5 A;  5CZ1 A;  3DOK A;  1TKX A;  3TI0 A;  1NK6 A;  4KB1 A;  1WSI A;  2YNG A;  3HPG A;  3K5L A;  2ZQB A;  2F8T A;  4AHR A;  1FKP A;  3KJV A;  2IGI A;  3G10 A;  4FM2 A;  4DSE A;  3I0R A;  3MED A;  4CJU A;  4OKJ A;  3M8S A;  1SKW A;  3SNN A;  4E7I A;  4KFB A;  2P51 A;  2G8H A;  4N56 A;  1RBR A;  4B08 A;  4DFK A;  2P1J A;  2ZE2 A;  3QO9 A;  4AIL C;  3QES A;  4KV8 A;  3PX0 A;  3S3O A;  3OS1 A;  1IG9 A;  1WAJ A;  3CM6 A;  3V6D A;  3U3G A;  1DTQ A;  1RT5 A;  3ZSO A;  3RRH A;  3V81 A;  2VWK A;  5DK5 A;  4E1M A;  4OLA A;  3NDK A;  1O1W A;  2DFH A;  4CIF A;  5T7B A;  3CG7 A;  4LH5 A;  1KVC A;  4DTO A;  4CF2 A;  3SV4 A;  3DLK A;  2IC3 A;  2HHU A;  2VG5 A;  3PO4 A;  1EX4 A;  3AVN A;  1XWL A;  2PZS A;  2BE2 A;  3QEV A;  1SKR A;  5HBM A;  4C8O A;  3NF9 A;  1RTD A;  4FJ8 A;  5J2M A;  4OKE A;  4E19 A;  4HHT A;  5FRO A;  3AVB A;  3TR8 A;  1U4B A;  4Z4F A;  3AO2 A;  1UA0 A;  4DLE A;  1NK7 A;  3C6T A;  3O3F A;  2XRI A;  4DSF A;  4R5P A;  4KHU A;  5JS2 A;  1ASW A;  3ZT0 A;  1KTQ A;  3NF8 A;  1D9D A;  3PO5 A;  4CFD A;  3DLB A;  3ZT1 A;  1JLC A;  3L8B A;  1C1C A;  4NCB A;  4JLH A;  1HMV A;  3K59 A;  3MXM A;  4CGJ A;  4ZTF A;  4B9M A;  3AVK A;  1TKT A;  1YTA A;  1UWB A;  4CGD A;  4CHY A;  3HJF A;  4AH9 A;  3K5M A;  4FM1 A;  4F3O A;  4J2D A;  3CM5 A;  4DWI A;  2HHQ A;  1BIU A;  1RTI A;  1CZ9 A;  1YT3 A;  4CJ3 A;  3DRP A;  2B6A A;  1B9D A;  4XIU A;  2R7Y A;  1Q9X A;  3HK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...