5EU7A

Crystal structure of hiv-1 integrase catalytic core in complex with fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACDWAGIKQEFGVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Preserved HTH-Docking Cleft of HIV-1 Integrase Is Functionally Critical.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Integrase
total genus 48
structure length 143
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5eu7A00
3L2QA 1RBUA 3NF6A 4PY5A 4E1MA 4CJPA 2X74A 4PA1A 4O0IA 3WNEA 4HHTA 4KTZA 4DQQA 1IKWA 1SKRA 3IG1A 2XRIA 5JS1A 1KTQA 1XC9A 3KLGA 2D5RA 4CFCA 3JSMA 4JRPA 1T8EA 1A5VA 4KI6A 4BWMA 1U49A 1RT5A 1S1VA 3AVIA 1ASUA 4WE1A 3VQQA 1S5JA 3K5NA 4RW9A 4OGCA 1ZYQA 4HCCA 5CZ2A 1S1WA 1S9GA 3SQ0A 3WNFA 2HHWA 5CZ1A 5HBMA 3SI6A 4Z4GA 2FC0A 4DTJA 3KLEA 1B9DA 1EKEA 1HNIA 1VSIA 4Z0UA 4BE0A 3RMAA 3NF9A 4M45A 1WSJA 3OYBA 4FLVA 1L3UA 4L8RB 3OYGA 4NYFA 4R5PA 2ITGA 4DTPA 4EP4A 4CECA 1CLQA 4CGDA 1SUQA 3VQBA 4CK1A 3PO5A 3SNNA 1NKEA 4KAZA 3M8PA 3K2PA 4DS4A 4CJQA 3SJJA 1TK5A 4BACA 1GOBA 3OYEA 1X1PA 4LH5A 1A5XA 1RILA 3OYMA 4CJRA 3KD1E 4CEEA 2OPPA 3V9UA 1TL1A 4ZTJA 1KVCA 3OYJA 1NK0A 2QK9A 4DLGA 3KD5E 3DI6A 5SWMA 4FW2A 1Z26A 3K58A 1ZBIA 1SL2A 3NH0A 4DSEA 1KRPA 2HHUA 2G8FA 2YV0X 3P1GA 1EP4A 1RCHA 3LP1A 4CESA 4BDZA 5CYQA 3RR7A 2VWKA 1B92A 1IKXA 4OVLA 4CEZA 4OPJA 3TANA 2IAJA 3QINA 3VQ7A 1QSSA 1BIZA 1FKPA 4JRQA 1DTQA 1UWBA 4CHOA 5HRSA 4DQSA 2QXFA 1NK6A 4FJHA 4FJ7A 1LW2A 2IGIA 3IRXA 4F4KA 2F8SA 3AVCA 1TAUA 3K59A 4M41A 3AVJA 4CF8A 3L3UA 3EZ5A 4DFKA 1SL0A 3HK2A 3NH2A 1XHXA 4FJIA 1RNHA 3DM2A 1WN7A 2P1JA 3V9XA 4DSLA 4N41A 1CXQA 2YKNA 5HRRA 4KO0A 4C8MA 3VQPA 2E6LA 3NHGA 4KI4A 1UA1A 2A1RA 3V1QA 3O3FA 4HUGA 3L2WA 2ETJA 4QOZB 3LZIA 1C0UA 1NKCA 2QKKA 4N47A 4Z4FA 1C6VA 4E7KA 2IS3A 4Y1DA 3CFRA 4J2DA 2Z1GA 1S1TA 1KCFA 1WSEA 3P83D 3VQ9A 3VQEA 2KW4A 4OPKA 3K5LA 4AHUA 4GVMA 2D0CA 3ZSVA 4FJ8A 3OS1A 2Y1JA 4Z4CA 5HP1A 3D45A 1B9FA 5KTQA 4E7HA 4GW6A 2Q3SA 2RKIA 2HHVA 4LD0A 1Q9XA 2FBVA 1HYSA 4KREA 3TARA 1C1BA 4W5QA 4H8KA 3OVNA 3AVKA 3VQDA 4RW7A 3HT3A 4CJLA 1TKTA 3HXMA 1NK4A 3ZCMA 3OYKA 3LAKA 3D0PA 1JL1A 3VN5A 1JLCA 4CEDA 2B5JA 1LW0A 4CHZA 3K5MA 3AO5A 4NCBA 4AHTA 1QTMA 4OGEA 3SUQA 2Z1HA 3SPZA 4FJNA 4HTUA 3QIPA 4FK4A 1HQUA 3AA2A 3AA4A 4CEFA 4CEBA 4CEAA 2YNIA 1VSKA 3OYHA 3KLHA 4NCAA 1SL1A 4DTRA 2QKBA 4IKFA 2Z1IA 3ZSOA 1J53A 1UA0A 4KHWA 1MU2A 2BGGA 2VG5A 1FXXA 4E3SA 3QEVA 4I2PA 4DSFA 1TV6A 1IKYA 3DYAA 1TVRA 4OKJA 3SUNA 1D9FA 2PZSA 1K6YA 4DMNA 1NJZA 1HPZA 2XO7A 1VSHA 3I8DA 4E1NA 5CYMA 1S1XA 4BE2A 4KB1A 3V1OA 1S6PA 1VSLA 4KV8A 3AA3A 4CIGA 3AA5X 3K57A 1ASWA 4FM0A 1ZBLA 3BGRA 1I3AA 4CJ3A 1Q9YA 3RMCA 3L2VA 3OYIA 4E7IA 1SKWA 3RTVA 1BCOA 1C0MA 2Z1JA 5KRSA 3RMDA 2E4LA 4BDPA 4CJTA 1JLBA 4HVJA 5I42A 4IFVA 4OLBA 3K5OA 2WONA 3AVGA 1VSEA 4N56A 1HYVA 2B6AA 2YHAA 4CHQA 1J9AA 2XY8A 4OLAA 1JLGA 4DQIA 4M3ZA 4KRFA 3S3MA 3VQAA 2X78A 4BDYA 4O44A 3M8RA 4QAGA 3NCIA 4DS5A 1RDBA 2ZD1A 1GOAA 3ZSYA 2AJQA 3KKSA 3SUPA 2HNDA 3DRPA 3CFPA 3IS9A 4AILC 3KK3A 3RR8A 4FJJA 4RW4A 3PX6A 1JKHA 1NK8A 1BHLA 1HQEA 4F2RA 4CK2A 3B6PA 2HVHA 4Z4EA 3HVRA 3KK2A 5T7BA 1L3VA 3TAPA 1NK5A 1DTTA 5J2MA 3ASMA 2G8KA 1TL3A 3L2UA 1REVA 3NFAA 3LP0A 3ZT3A 1SV5A 2OZMA 3MAQA 1TAQA 3OYLA 5K14A 4DSKA 4IG3A 3VQ6A 3AO1A 4EP5A 1KVAA 3HPHA 5HRPA 2Y1IA 2G8UA 4F3TA 3ZT1A 4C8LA 4RW6A 3ZSRA 4DG1A 5KRTA 3HPOA 1EETA 1Y97A 2FBXA 2OPQA 1QSLA 1GOCA 3ZSQA 1CZ9A 3B6OA 2YKMA 2PYLA 3C6TA 3V9ZA 4OJRA 1U48A 4B9UA 1U04A 5J2QA 4DTMA 4B9NA 2DTUA 5KGWA 1W0HA 4DU3A 1KFSA 2KFZA 4W5TA 4CF2A 1X9MA 3HM9A 3QEXA 4C8OA 4M3XA 4CGFA 3AVNA 1U4BA 1Q8IA 3PO4A 4B8AB 3OYFA 1NK9A 1S6QA 3IAYA 3MXIA 3EY1A 3T3FA 3MEGA 1JXEA 4O4GA 2GBZA 1RBRA 3U3YA 3DRSA 1X9SA 1T05A 1FK9A 4NYNA 4HUFA 4W5RA 1NJYA 3PUFA 3TAFA 1VSMA 2EX3A 4CHYA 3KJVA 4K8XA 2D0BA 4F8RA 4KTQA 1C1CA 4FJKA 1TK8A 2DFEA 3OY9A 3SUOA 3E01A 4N5SA 3F9KA 4FLZA 3TAEA 4ELVA 2F8TA 4KHQA 4FCYA 2R7YA 4DTNA 1RT2A 3DOLA 4E89A 3O3GA 3OJSA 1T7PA 1HMVA 5SZTA 2FBYA 1VSFA 2YNFA 1RT1A 4ICLA 4OKEA 3OS0A 3DLHA 1IO2A 3QETA 4CIFA 3ULDA 1BI4A 3VA3A 1VRUA 4CJEA 4IFYA 1RDCA 2RPIA 3MEDA 3QEIA 1VRTA 1ZBUA 5JS2A 3SQ1A 4F2SA 4CJUA 3SCXA 3VQ5A 2YNHA 2FBTA 4TSXA 4AHVA 3L2RA 4E7JA 2XY6A 4FVMA 3MXMA 1BI4B 1XWLA 4OKKA 4CFDA 2XHBA 4K8ZA 3TAQA 4CJSA 4J2BA 4B3OA 4CERA 1KLMA 2HMIA 2OA8A 1LWEA 1LV5A 1JLFA 3NF7A 1RTDA 4CGHA 1L3TA 1C1AA 4DFMA 3I0RA 1JLQA 3AVHA 3QIOA 5C24A 1U47A 4DWIA 4BWJA 4CE9A 3DLBA 1DLOA 3PX0A 2PY5A 4DQPA 2B4JA 4DU4A 1BQMA 1LAWA 1R0AA 4B08A 2OYQA 2KZMA 1IKVA 4LSLA 3F73A 1WSHA 4LY7A 2PYJA 5DK5A 3FFIA 4I9QA 1IH7A 3AO2A 3AV9A 2VWJA 4ID1A 2G8VA 3RRGA 4FJGA 2DFFA 2HVIA 1C0TA 1FKOA 1S1UA 4KKOA 2O4IA 3OYDA 3LP2A 3AO3A 1YT3A 4DTSA 1J54A 4ELTA 1CZBA 1QSYA 4H4MA 4M3TA 2ZQBA 3CG7A 4MQ3A 4AHRA 3JYTA 4O5BA 3U3GA 1ZBHA 3HP9A 3HO1A 4IBNA 4I9LA 3KKRA 5J2NA 1XI1A 4BE1A 4CJVA 1LWFA 3ZSZA 3QEWA 1HYZA 1NKBA 3OYNA 3NBPA 2G8WA 3WNHA 3NAEA 4DQRA 3V9SA 4CHPA 1EX4A 1NOYA 1KVBA 1LAVA 3HSTB 3QEPA 2HHXA 3WNGA 1VSDA 4E7LA 1RT4A 1N6QA 2YHBA 2G8HA 1XHZA 3CM6A 1T03A 4E0DA 4J2EA 1QQCA 1S9EA 2KQ2A 3NGYA 3T19A 4PUOA 4CEQA 4KPYA 4CJFA 3ISNC 1RDDA 3V6DA 4CEOA 4JS4A 1RBTA 4M42A 4CJWA 3C6UA 4NCGA 1J5OA 1KLNA 4FK0A 3U6FA 4DU1A 5D3GA 4B8CA 2RN2A 1TKDA 2GUIA 3DRRA 4CF9A 4KHYA 4PQUA 3ZT0A 3NH1A 4CCHA 3S3OA 1TKXA 3ITHA 4CFAA 3ZT4A 3DOKA 1WSIA 3S3NA 1JLEA 3BDPA 1HNVA 3VA0A 1RBSA 1KSPA 3HP6A 1D8YA 1JL2A 3DMJA 3HVTA 2KFNA 4ELUA 4HCBA 4FXDA 4Z4HA 2KTQA 3O4QA 2HHSA 4O55A 4FZYA 1BCMA 2O4GA 4FK2A 4FZZA 1LWCA 1JLAA 2RF2A 2DFHA 1EXQA 4DTUA 3NGZA 3QNNA 2F96A 1ZBFA 5FDLA 4M3WA 1WSFA 3ZSXA 3MXJA 4FJXA 2JGUA 1RT7A 5C42A 3KTQA 2HHTA 4DTXA 4C8KA 4FZXC 3M8SA 3LWMA 2YNGA 4LH4A 2OZSA 3THVA 2X6NA 3MECA 4CGIA 4DSJA 4FJ5A 2G8IA 4H4OA 2D0AA 4CJ4A 1TKZA 1VSJA 4ID5A 3RMBA 4F3OA 1HRHA 4G1QA 3CFOA 1BGXT 1D5AA 1D9DA 4FYDA 4QCLA 2HW3A 4W5OA 3P5JA 1L5UA 2E6MA 1UOCA 1F21A 3G0ZA 4DF8A 1I39A 3L8BA 4DLEA 3OJUA 4CGGA 1QS4A 3AVBA 3TABA 1IG9A 4LSNA 4FLYA 1RBVA 1BISA 4B9TA 1RTHA 5CY4A 4FJ9A 3LZJA 3H08A 4FM2A 1TK0A 3SZ2A 5KI6A 5KGXA 2I5JA 1UAXA 1L3SA 3AO4A 1WNSA 4FLWA 3LANA 3UIQA 1CXUA 4J2AA 4CGJA 2XY7A 4CK3A 3OYAA 1N5YA 3G10A 3LPUA 3TAGA 4EZ9A 1TGOA 3LWLA 4CFBA 4MFBA 3MEEA 3CM5A 3TWHA 3LAMA 5EU7A 4JS5A 2P5OA 4B9LA 4KHSA 3KK1A 4ZTFA 3HL8A 1RDAA 3RRHA 1NK7A 3RWUA 4DF4A 1BIUA 1Z25A 1NJWA 2P51A 1RTJA 2IOCA 4CF0A 3PX4A 2DY4A 5HRNA 1SKSA 1KFDA 3ALYA 4CJKA 3VQ4A 1YVUA 3DLKA 5E41A 4XIUA 1NJXA 4EZ6A 4M3UA 2HNYA 1HJRA 3SV4A 1YTUA 4CJ5A 3CQ8A 3AVAA 4FW1A 3ZSWA 4FLTA 4CHNA 3CYMA 4JLHA 2JLEA 3O4NA 1NOZA 4KTWA 3VQ8A 3OS2A 3HYFA 4AH9A 4GMJB 3O3HA 3HJFA 1A5WA 3TI0A 3QO9A 3NE6A 4IDKA 1BQNA 4RG8A 1WAJA 3L3VA 1QHTA 4I7FA 1QE1A 4AHSA 3AVMA 4DFPA 1WLJA 2IC3A 3PV8A 2WOMA 1U45A 1ASVA 4ZHRA 4Y1CA 3SV3A 3QESA 4Q0BA 2X6SA 3DLGA 4RW8A 2GV9A 4FJMA 4Q5VA 2W42A 4HUEA 4B9SA 2OPSA 1VK0A 4I2QA 1YTAA 3AVFA 4C8NA 3LPTA 4FLUA 3SQ4A 2LSNA 3TAMA 1BL3A 3C94A 3I0SA 2NUBA 4UQGA 1ITGA 4KFBA 3OYCA 4W5NA 2EHGA 3NF8A 3S9HA 2OPRA 3KLIA 3QLHA 5J1EA 3KLFA 3V81A 2VG6A 3SPYA 3DLRA 2BANA 2VG7A 4IG0A 4FM1A 4E19A 5J2PA 5C25A 2BE2A 1RT6A 4N76A 2A1SA 2HNZA 3SQ2A 4CIEA 1X9WA 4DSIA 4KHUA 5FRMA 4O0JA 4FLXA 4PWDA 2KZZA 4FJLA 5FRNA 4M3RA 3LP3A 1RTIA 3HPGA 2IDOA 2P5GA 5HROA 3V9WA 3TR8A 3KIOA 3EYZA 1O1WA 3SYZA 3QNOA 3A2FA 3VQCA 3V1RA 4M3YA 3LALA 2HHQA 4DTOA 3V4IA 4B9VA 3LDSA 4B9MA 2ZE2A 3AVLA 3M8QA 5FROA 1JXBA 2BDPA 5DMRA 1RT3A 4Z4IA 1WSGA 5I3UA 3ZT2A 1WAFA 2XY5A 3PY8A 4YFUA 3QERA 3C95A 4YNQA 4DFJA 1W9HA 3NDKA 4KB0A 3DLEA 3T1AA 2ATQA 3NGIA 4CF1A 5HLFA 2HB5A 1G15A 4KHNA 4AHCA
chains in the Genus database with same CATH superfamily
1RBUA 3NF6A 4PY5A 4BGBA 4E1MA 4PA1A 3WNEA 4HHTA 4KTZA 3W3DA 3H3OB 3IG1A 2XRIA 4B1VA 5JS1A 1XC9A 3KLGA 3FLCO 3THWA 1A5VA 4KI6A 1ASUA 3EO3A 4HCCA 3VETA 1S9GA 2ITMA 4FWPA 4Z4GA 1B9DA 3ATVA 4BE0A 5EXWA 4WFNL 4M45A 4L8RB 4WQ4C 3OYGA 5AQNA 2FSJA 4R5PA 1NJIO 2P9UA 3VERA 4CECA 3W0LA 5M1KA 1SUQA 3VQBA 4B1WB 2VGMA 4WFBL 4KAZA 4MDAA 2O8FA 3BY5A 3SMPA 4BR5A 1GOBA 1RILA 2P9IB 2P9UB 3CXCM 3V9UA 3IDHA 3O1BA 4ZTJA 2O8FB 2EWSA 4K43A 4GV6A 2HHUA 2G8FA 5AQWA 3P1GA 1EP4A 1RCHA 4ILGB 3QMLA 2VWKA 3PLAA 1IKXA 4CEZA 4FJ7A 2HF4A 2HBJA 4F4KA 5BR8K 2I7NA 1TAUA 5BN8A 2F9TA 4DV3K 3V9XA 3AAQA 1WN7A 3ID6A 2FF6A 2YKNA 4BVOA 4K25A 5HRRA 2E6LA 3NHGA 3EEQA 3V1QA 3O3FA 2ETJA 4QOZB 4Z4FA 4E7KA 4BR9A 5AFUA 3LM9A 4J2DA 4OPKA 1S1TA 1KCFA 4AHUA 3ZSVA 4BC2A 3NMUA 3CJ7A 1QQOA 5HP1A 3RSEA 5KTQA 4GW6A 2HHVA 3WQTA 2FBVA 1HJOA 3TARA 4A2AA 3BF3A 3AVKA 5AZJA 4HTLA 3HT3A 4CJLA 3HXMA 4BRCA 1JCGA 3OYKA 2ASOA 3D0PA 1JL1A 4CHZA 5LMNK 3AO5A 4AHTA 3SPZA 4FJNA 4CEFA 1WBDA 4CEBA 4H0TB 3SJHA 3KLHA 4NCAA 1XMQK 4DTRA 1SL1A 3GG4A 3GBTA 4KHWA 1J53A 1MU2A 2A42A 1FXXA 4E3SA 4I2PA 4JN4A 4OKJA 2PZSA 2ZJRL 1V4TA 1NJZA 1HPZA 3VF6A 4E1NA 1S6PA 1VSLA 1ZBLA 1I3AA 1NGCA 1Q9YA 1SKWA 3OYIA 1V4SA 5F1XA 3RMDA 2E4LA 4BDPA 4CJTA 3HTVA 1JCFA 5KPTA 4OX9K 1JLBA 4BY9C 3I33A 1YF5L 2A40A 3AVGA 2GX9A 4N56A 2CGLA 4K42A 3O80A 3S3MA 3CHWA 2V52B 4BROA 2AJQA 3KWGA 1ZXOA 3KK3A 2ZGZA 4FJJA 1VQ6N 5JLHA 4F2RA 3O9SA 4KH6A 3HVRA 3FZKA 2J4RA 1WOQA 2NRWA 3ASMA 4LFBK 3CQYA 2OZMA 1T44A 4AM6A 3CCMN 1NGDA 3VQ6A 4F3TA 1KVAA 4AM7A 2O8DA 3FZFA 4DG1A 5KRTA 1EETA 3CIPA 3PSIA 1Y97A 3CCQN 4F9OA 1CZ9A 3V9ZA 1VQKN 4OJRA 1U04A 5J2QA 4B9NA 1H1VA 5KGWA 4O8UA 4A61A 4CF2A 3HM9A 5GADP 2NNWA 1DKGD 4B8AB 2WUSA 1BA1A 2VQEK 3MEGA 2W41A 3UKUB 2Q97A 1FK9A 1IBKK 4B1UB 1VSMA 4CHYA 3KJVA 5F2RA 2D0BA 3UKUA 1TK8A 2DFEA 1OH7A 2UU9K 2P9LB 2NLXA 4ELVA 2FBYA 2YNFA 4OKEA 3OS0A 4NCBA 1IO2A 3AARA 3UKRA 3ULDA 3O4WA 3VA3A 1VRUA 4CZHA 2ZM6K 2RPIA 2Q31A 3G6EN 2O8CB 4IOCL 1VRTA 3CPWM 2ZJQL 1DT9A 2YNHA 4CFDA 1VQLN 2RE2A 3J80O 4DV0K 2IVOA 2P9NA 3Q7CA 2FF3B 4DR2K 4DFMA 1KD1O 4CZGA 3A5NC 1K73O 2PY5A 2OYQA 4O5FA 2QXLA 4LSLA 3F73A 3L4QA 3K9JA 4LY7A 4WFAL 3FFIA 3C65A 2ZGYA 2VWJA 4ID1A 4FJGA 3WUHA 4WQ4A 1W97L 1YT3A 4M3TA 2ZQBA 4MQ3A 3SK3A 4O5BA 2ZF5O 4CZEA 3THXB 1XI1A 4H03B 2QI2A 4GY2B 2A3ZA 3OYNA 2G8WA 4CHPA 1LAVA 3HSTB 2HHXA 3O9TA 1RT4A 1N6QA 3WT0A 4U67L 2HHHK 1XNQK 1T03A 4PUOA 4CEQA 4CJFA 3ISNC 1XC3A 1RDDA 3MX2A 4BRDA 4IEEA 4CEOA 1RBTA 4J8FA 1K8KB 1JCEA 1J5OA 1KLNA 4DU1A 3AGKA 3VEOA 1TKDA 4FVUA 2GUIA 3DRRA 3TPQA 4CZKA 3NH1A 2E8AA 3S3OA 5M1OA 3TTCA 3HSCA 3HVTA 4ELUA 3CJ1A 3JXUA 4IDHA 4Z4HA 3CCJN 1NGGA 3O4QA 1BCMA 4X66K 2RF2A 2F4VK 3FR0A 4WQ5C 1WSFA 2NRVA 2JGUA 1RT7A 3A5LC 4DTXA 5DM7L 2PBDA 3P38A 4KH4A 3IMXA 4LH4A 2G8IA 4BQLA 2X6NA 3MECA 3THVA 2D0AA 4F3OA 4ID5A 5AQOA 3VGKA 4XH4A 4JAXA 3G0ZA 3C0BA 4IWVA 4AF1A 4CGGA 2BUPA 3TABA 1IG9A 4V19S 1RTHA 4H0VB 4FJ9A 3H08A 1Z05A 3SZ2A 3AO4A 4B3MK 3CCVN 1N5YA 3A8YA 3G10A 4FOIA 4B9LA 2O8EA 1NK7A 1KC8O 1OH8A 2YCHA 2IOCA 3PX4A 1SKSA 1KFDA 3DXKB 3DLKA 5BPNA 3SV4A 3DJCA 4YHHK 1XNRK 3CQ8A 4FW1A 2JLEA 4OO1J 4CI6A 3HYFA 4AH9A 2PAVA 4GMJB 3O3HA 4HWIA 2NRTA 3HRGA 1W7AA 1A5WA 4BRIA 4IDKA 1IBLK 4AHSA 3EKUA 3O9QA 1QE1A 3AVMA 3PV8A 4CBUA 2D0OA 3SV3A 3QESA 4FJMA 4WYBA 4B9SA 4I2QA 1VK0A 2E2QA 3AVFA 4MLHA 3LPTA 4FLUA 1HR0K 1BL3A 3C94A 4W5NA 2EHGA 3S9HA 5C10A 3KLIA 4JKGA 5J1EA 3KLFA 2VG6A 3T69A 3DLRA 2Q2RA 4FM1A 3OBWA 2ZWHA 5C25A 4H5TA 1RT6A 1X9WA 4CIEA 4JI0K 4JI2K 5FRNA 4M3RA 5BREA 2P5GA 3H46O 5FLXO 4FWNA 3SYZA 3QNOA 1YITN 3VQCA 4FWQA 1YHQN 2HHQA 3SAHA 4H5NA 3M8QA 4DR3K 2BDPA 4Z4IA 4BRFA 1WSGA 5I3UA 4DB3A 3ZT2A 1BWFO 1WAFA 4XH5A 4YNQA 1NGEA 3NDKA 2UUBK 1QZ5A 3VTIA 4YORA 1KAXA 3NGIA 2GEMA 1GLAG 3NVKA 2NZTA 2HB5A 4JKCA 3CCRN 3OBYA 3RVCA 4DQQA 1C0FA 1IKWA 2P9IA 5GINA 4CD1A 4CFCA 4BWMA 1U49A 1RT5A 3TSPA 3VQQA 1S5JA 3K5NA 3CI5A 4OGCA 5BN9A 1ZYQA 5EX5A 5CZ2A 2OCEA 5LJWA 5CZ1A 3KLEA 1VSIA 1EKEA 4Z0UA 1KAZA 3UB5A 2ITGA 4CGDA 3N4QA 3PO5A 1ATNA 2WTUA 4DS4A 3SJJA 5AZIA 4BACA 1N36K 1A5XA 4BG9A 3OYMA 4CJRA 1BUPA 4JKDA 2OPPA 3ZETB 1NBWA 1KVCA 1U2VA 1NK0A 2D4WA 4DLGA 5SWMA 1Z26A 1ZBIA 4IJAA 3NH0A 1OVQA 3Q7BA 1QSSA 3RSEB 4MDBA 1FKPA 1DTQA 4CHOA 1NK6A 2A5XA 4FJHA 3IRXA 3AVCA 4M41A 3AVJA 1SL0A 2P9SA 3NH2A 4DSLA 2P1JA 4LF6K 5AQLA 1YJNN 1J6ZA 3LZIA 1NKCA 2QKKA 4N47A 3JS6A 1C6VA 1BO5O 2IS3A 2KFZA 3P83D 3VQEA 3ATUA 2D0CA 4FJ8A 1Z6RA 1B9FA 4E7HA 3QICA 4W5QA 3VQDA 3EL2A 3R3LA 4RW7A 5JMVA 1TKTA 1NK4A 1ATRA 1JLCA 1LW0A 4DQ8A 3K5MA 2HBMA 2Z1HA 4HTUA 5KPRA 4CEAA 4CZIA 1VSKA 4IKFA 5AQYA 4CW7B 1UA0A 1TYQB 4X65K 1IKYA 3L6QA 3SUNA 2Q0RA 1K6YA 4DMNA 5CYMA 1TYQA 3BGRA 4E7IA 2UUCK 3LDOA 4FWOA 3RTVA 1S72N 3J7AP 3KZBA 4EHUA 2UXBK 4HVJA 1X3MA 2Q36A 5JVGL 3K5OA 1GLEG 4B1ZA 3MMVA 2WONA 1HYVA 5ELZA 4OLAA 1J9AA 1JLGA 3HOTA 2O8BA 5BPLA 3M8RA 1BOTO 1R59O 1N8RO 1Q81O 2CGJA 3IS9A 3RR8A 1NMNA 4RW4A 3HOSA 4DV1K 5IT9O 1VQNN 5GAHP 3BUZB 1QVFM 5C2FA 3ENOA 1L3VA 1HX1A 1NK5A 4PKHA 2Q0UA 3LP0A 3ZT3A 2PFUA 1NMDA 3OYLA 3HPHA 3ENBA 2OTLN 3ULEA 3SLCA 3CQXA 4C8LA 3HZ6A 3UE5A 1NGBA 4B9UA 4DTMA 3R6MA 4H5WA 4CD3A 3QFUA 3AVNA 2HMPA 4B3RK 4FSVA 3I56N 3OYFA 3MXIA 3C7NA 4O4GA 2GBZA 1RBRA 3EE8A 3U3YA 3DRSA 3O08A 1T3VA 1QQMA 3VOVA 1P8ZA 1JJ2M 4F8RA 1Q7YO 4KTQA 1C1CA 3SAGA 3OY9A 3E01A 5JVHL 4FLZA 3TAEA 3WXJA 1ESVA 1Y64A 2R7YA 3DOLA 1O13A 3O3GA 3OJSA 1YUWA 1VSFA 5C15A 1NG9A 3QETA 1VQPN 4CBWA 4CJEA 4IFYA 4H0YB 4UY8O 1Q86O 1D4XA 3MEDA 3QEIA 5JS2A 1ZBUA 3BF1A 4JD2A 3SQ1A 2WFBA 3SCXA 4TSXA 3MXMA 4FVMA 4OKKA 1QQNA 4J2BA 4B3OA 3O6WA 5AJ3K 1KLMA 2OA8A 2QWLA 1JLFA 1E4FT 3H3NO 3NF7A 1NGHA 4CGHA 5JICA 3PIPL 3DWLA 5AQVA 3DLBA 1DLOA 4DQPA 4DU4A 3DXMB 5DK5A 4FWMA 2FSNA 1IH7A 3AV9A 4WCEL 2DFFA 1FKOA 2GELA 4KKOA 2WBNA 3OYDA 4DTSA 1J54A 3E9OA 5EY4A 4FWSA 3DXMA 3THWB 1ZBSA 4BRLA 3JYTA 1ZBHA 4BE1A 3THYB 3NBPA 4A59A 3NAEA 3V9SA 2ASMA 3H45C 1NOYA 3EZWA 4FWLA 1VSDA 4QS9A 2F9WA 3CM6A 3THYA 3B8AX 1QQCA 2KQ2A 2P9KA 4BRMA 4KPYA 1OKJA 2YHWA 3CJCA 1X9JA 4CJWA 3C6UA 4NCGA 2UYTA 3U6FA 1S3XA 4B8CA 1N33K 3LDNA 4L3QA 4JI8K 3VGLA 1HKBA 3GOIA 1TKXA 4ISFA 3ITHA 4CFAA 3ZT4A 3DOKA 1WSIA 4BRPA 3BDPA 4JI7K 3VA0A 3ZX2A 3HP6A 1W2BM 3DMJA 2KFNA 4FXDA 4IOAL 4E1JA 1HNWK 2W6LA 1RGIA 4O55A 3P4IA 4FZZA 1JLAA 2DFHA 1EXQA 4DV4K 3NGZA 1ZBFA 3PSFA 5FDLA 3G4SN 3BP8A 4FJXA 3KTQA 2FSKA 4YDUC 3M8SA 5TKWA 5AQMA 5AZJB 1C0GA 1HRHA 5FPMA 2F7TA 3CFOA 1D5AA 4H0PA 5BRHA 1D9DA 2HW3A 4W5OA 5LMUK 1E4GT 2E6MA 4BRNA 5HL7L 4DF8A 1SAZA 3L8BA 3OJUA 5AQFA 3DXKA 4FLYA 5CY4A 3LZJA 2H3GX 3CJBA 1TUYA 1L3SA 1WNSA 4FLWA 1LCUA 2XY7A 3TAGA 4CFBA 4GNIA 3GL1A 1YJWN 4K0KK 2P5OA 3KK1A 4ZTFA 3HL8A 1RDAA 3FE1A 3RRHA 3VGMA 1WUAA 4B3TK 4JKHA 3ALYA 2YHXA 5ADXH 4B3SK 3QDKA 1J5EK 2HNYA 4LF9K 1LOTB 1MWKA 4XEIA 5CHIA 4FLTA 4LF7K 3O4NA 4KTWA 4JYAK 5FPEA 1BQNA 1WAJA 3L3VA 2UXCK 5BRFA 4DFPA 5DM6L 1ASVA 4ZHRA 4Q0BA 1BG3A 4RW8A 2W42A 2OPSA 4YOXA 3SQ4A 2LSNA 3CF5L 1FJGK 1ITGA 4KFBA 3D2EA 2QTDA 3QLHA 4YY3K 2W6KA 4IG0A 2Q1NA 3VF2A 2BE2A 4MLEA 5AQHA 4N76A 5FRMA 3D2EB 4FLXA 4PWDA 1VQ4N 2OANA 3HPGA 5FPDA 5HROA 3CERA 1O1WA 1IV0A 3V1RA 3C6HA 3R8EA 2P9PA 4LF4K 2ZE2A 5DMRA 1RT3A 5M1QA 3FZHA 4X64K 3FZLA 1YI2N 3QERA 4DFJA 1W9HA 3DLEA 1RDUA 4CF1A 5M1FA 5AQRA 4AHCA 4KHUA 3L2QA 3KHYA 1SKRA 4BGAA 5M1NA 4DUZK 1SZ2A 1QZ6A 1S1VA 3AVIA 2JWKA 5AQSA 3SQ0A 2HHWA 2VWBA 5HBMA 2FC0A 1HNIA 5C12A 2HBLA 3NF9A 3OYBA 5F0XA 1RFQA 4H5RA 1L3UA 1NNEA 4GV9A 4DTPA 3QFPA 4EP4A 4CK1A 3K2PA 3OYEA 3J81O 1X1PA 2QWPA 1TL1A 3OYJA 1HKGA 2QA4N 2W40A 3DI6A 5GAGP 4FW2A 3K58A 1KRPA 3IUCA 4LC9B 2YV0X 3RR7A 5ADXA 5CYQA 1B92A 4JHDA 4OPJA 2IAJA 4GVEA 3VQ7A 1BIZA 1YJ9N 4DQSA 2QXFA 3U4LA 2IGIA 4CZFA 2F8SA 3IKMA 3K59A 1GLFO 4CF8A 3EZ5A 3L3UA 1XHXA 4DR5K 4FJIA 1RNHA 4U7BA 4IXCA 4KO0A 4QS7A 4C8MA 4KI4A 1UA1A 1OH5A 1C0UA 5AQIA 3E9PA 2Z1GA 1WSEA 3K5LA 3VQ9A 2HF3A 4GVMA 5LJVA 3OS1A 1ZC6A 3MWPA 4BRHA 2Y1JA 4DR4K 4GV3A 2RKIA 1HYSA 1C1BA 2NRZA 4A2BA 4QS8A 3ZCMA 4B1YB 3LAKA 5AQXA 2B5JA 3SUQA 2E5LK 3QIPA 1QVGM 2YNIA 1MWMA 3CETA 1KXPA 3OYHA 4NXNK 3ZSOA 2QWNA 2VG5A 4DV2K 5AQGA 4PKGA 3DYAA 1TVRA 2GWJA 2XO7A 3I8DA 1VSHA 2GUPA 3L4IA 4BE2A 4FM0A 4CIGA 3AA5X 1ASWA 2A41A 4YOUA 1M90O 1NGIA 4BR4A 1BCOA 1C0MA 2Z1JA 3D2FB 5KRSA 4BRAA 1BU6O 4ISEA 4IFVA 3SBTA 1VSEA 2YHAA 5BPMA 4DQIA 4M3ZA 4KRFA 3A5OC 3VQAA 2X78A 4BDYA 4O44A 1EWQA 3NCIA 1GOAA 3KKSA 3SUPA 3DRPA 3CFPA 4AILC 2IVPA 2YJEA 1JKHA 5GIOA 1HQEA 4CK2A 3B6PA 4I6MB 2HVHA 5T7BA 3G71N 2V51B 3R9PA 3MN7A 5J2MA 2G8KA 1RDWX 2YJFA 3L2UA 3NFAA 4H5VA 1SV5A 5K14A 4IG3A 4BRGA 3WEEB 3AO1A 5HRPA 1M1KO 4Y0WA 4FOEA 1HKCA 2HOEA 5JLFA 5EVZA 4BREA 2OPQA 2FBXA 4ILJA 5AQUA 3VEYA 3B6OA 4PL8A 3C6TA 2NRHA 3IFRA 5AQZA 2PYLA 5HOOA 3OW2M 4JKFA 2DTUA 2I7PA 3L0QA 1W0HA 1QHAA 4W5TA 1X9MA 1WBBA 4CGFA 3J7ZO 3PO4A 1S6QA 1XQSC 1OH6A 4JD2B 3QB0A 3T3FA 1JXEA 1X9SA 4Z94A 1T05A 4W5RA 1DGKN 2EX3A 3U9DA 4K8XA 4H0XB 2E1ZA 2VQFK 1VAZA 2F8TA 4FCYA 3BEXA 4E89A 1T7PA 1HMVA 5SZTA 1RT1A 3VMFB 3LDPA 4YOYA 1RDCA 3U8XA 4F2SA 3VQ5A 4E7JA 2FBTA 3JAMO 4K8ZA 1XWLA 2XHBA 4CJSA 5IWAK 3K9KA 2HMIA 5H1SQ 3KWIA 1RTDA 1C1AA 3I0RA 1JLQA 4A5AA 4BWJA 4CE9A 1BQMA 1LAWA 4H0OA 2KZMA 1IKVA 4LFAK 2OTJN 5AR0A 2PYJA 3CCEN 4I9QA 5LL6Z 3AO2A 2G8VA 3VPZA 2HVIA 2VGNA 2YHYA 3LP2A 3AO3A 1HNZK 2O4IA 1CZBA 1QSYA 4H4MA 4AHRA 3U3GA 3HO1A 3HP9A 2QWOA 4IBNA 3CCLN 2QWQA 4I9LA 5J2NA 4MO4A 1BA0A 1LWFA 3G25A 1HPMA 1HYZA 3MN9A 1NKBA 4DQRA 1YVNA 1U2VB 3QEPA 3FGUA 4E7LA 2G8HA 4E0DA 4J2EA 1S9EA 3NGYA 3T19A 1VQMN 3C6AA 1G99A 5E84A 5GIPA 4M42A 4FK0A 2RN2A 4NB4A 4KHYA 3ZT0A 3VEXA 1KQSM 1JLEA 4BC4A 4KH5A 4O8KA 4CBXA 3M5RA 4A62A 1P90A 3TTDA 2KTQA 4IO8A 3MN5A 2HHSA 4FZYA 2O4GA 3FFKB 4FK2A 1LWCA 4DTUA 4JV5K 2F96A 2FXUA 2P9SB 4IOXA 3ZSXA 3MXJA 2ZJPL 4C8KA 4FWKA 3TTFA 4FZXC 3LWMA 2YNGA 4DSJA 1HUXA 2OZSA 4FJ5A 4CGIA 4H4OA 3I55N 4CJ4A 1VSJA 4IEIA 4QCLA 1UOCA 4NO7A 4JI4K 4DLEA 3P31A 1FW6A 1RBVA 4CZLA 4B9TA 1TK0A 1MDUB 4DKWA 5KGXA 2I5JA 1UAXA 1YAGA 3LANA 4J2AA 4CGJA 4FL9A 3OYAA 3LPUA 4JKBA 1TGOA 3MEEA 3CM5A 2D0PA 3TWHA 2E2OA 4C23A 4IFEA 4DF4A 1BIUA 1Z25A 3FZMA 3PIOL 2DY4A 4CJKA 3VQ4A 4XIUA 4EZ6A 4CJ5A 5AQTA 4YOTA 1VQ7N 4CZMA 4CHNA 3CYMA 2HSTA 4JLHA 3VQ8A 4C1NI 3OS2A 1GLBG 2DPNA 5TKYA 3SBGA 1IJJA 1NM1A 4RG8A 1QHTA 4I7FA 5C0YA 4OPHA 3VTHA 1WLJA 2IC3A 4IJNA 4DR7K 3WXLA 3ZLJA 3P39A 1VQ9N 3DLGA 4Q5VA 4EAHD 4JK8A 4C8NA 1K9MO 4BR2A 4RWTA 5KPZA 3NF8A 3SPYA 3V81A 4DV7K 2BANA 2VG7A 3BZKA 2VCPA 5J2PA 2AP1A 3S41A 3UKRB 4DSIA 3AY9A 2KZZA 4FJLA 4M63C 3LP3A 1RTIA 3MX5A 2IDOA 2KLAA 3TR8A 1SS6A 3EYZA 3DLLL 3CD6N 3A2FA 4FO0A 3LALA 3U9ZA 3ZEUA 4DTOA 3ZYYX 3AVLA 5AQQA 1JXBA 3VEZA 2O8CA 3T1AA 5BRDA 5HLFA 3ID8A 3CC7N 1G15A 2V7ZA 4CJPA 2X74A 4JNEA 4O0IA 3C7NB 1KTQA 3JSMA 2D5RA 1T8EA 2QW9A 4JRPA 4G9ZA 5C2DA 4WE1A 4RTFD 4RW9A 1S1WA 1HNXK 3ZX3A 3WNFA 3SI6A 4DTJA 4DR1K 3RMAA 1WSJA 4FLVA 1YXQA 4NYFA 3OHRA 1CLQA 3SNNA 1NKEA 3M8PA 1E3MA 4CJQA 3THXA 4EHTA 1TK5A 4LH5A 3KVGA 1VQ8N 3K0SA 4CEEA 3KD1E 2QK9A 3QBXA 3AGRA 4BR7A 3KD5E 1SL2A 4DSEA 4BDZA 5A2QO 4CESA 3LP1A 3MCAB 4OVLA 2D1KA 3TANA 3QINA 4BQZA 4JRQA 1UWBA 5HRSA 1K8KA 5GAEP 1LW2A 3H1VX 4JKAA 3HK2A 4DFKA 5CE3A 3ZX0A 3DM2A 3SMSA 4N41A 1CXQA 3VQPA 2P9KB 2A1RA 1S22A 4EFHA 4HUGA 2IVNA 3L2WA 1EQYA 2UUAK 4Y1DA 3CFRA 4AQYK 5BR9A 2KW4A 3F5TA 3CMEN 2QWMA 3O8MA 4CJ7A 3E9LA 4KHPK 4Z4CA 4CVNE 3D45A 2Q3SA 4LD0A 1Q9XA 4KREA 3E66A 4H8KA 3OVNA 3CPEA 3VEWA 4LF8K 3VN5A 3WQUA 3VENA 4CEDA 3F9MA 3EN9A 3OTOK 1QTMA 3HBTA 4OGEA 2NRRA 3ENHA 1HQUA 3AA2A 3AA4A 4R79A 4FK4A 3CC2N 4M7YA 4A57A 2O8EB 3M6GA 2QKBA 4MO5A 2Z1IA 4FWRA 2BGGA 3QEVA 4DSFA 1TV6A 1WB9A 1D9FA 1HLUA 1S1XA 4KB1A 3V1OA 4KV8A 3K57A 3AA3A 1EWRA 4CJ3A 3RMCA 3L2VA 4JEPA 3E1YA 5I42A 4OLBA 4JI5K 5I9EB 3LDLA 2CH5A 1NLVA 3MCPA 3WEEA 2B6AA 4CHQA 2XY8A 4WQ5A 3T1YK 4QAGA 4DS5A 1RDBA 2ZD1A 3ZSYA 5FPNA 1GLCG 2HNDA 4DHYA 3PX6A 1NK8A 1BHLA 2A6AA 1T6DA 4Z4EA 3KK2A 3TAPA 1DTTA 1TL3A 4IZ9A 1REVA 4DR6K 3CCSN 3MAQA 1TAQA 4DSKA 4EP5A 1DEJA 2G8UA 2Y1IA 2V7YA 3ZT1A 4RW6A 3ZSRA 3BZCA 4PL7A 3CC4N 1GLJO 4JKGB 3HPOA 3O1WA 1QSLA 1GOCA 3ZSQA 2YKMA 3CMAN 1U48A 2UXDK 4IO9L 1KFSA 4DU3A 3QEXA 4JK7A 4C8OA 4M3XA 1U4BA 1Q8IA 1NK9A 4BC3A 3IAYA 3M3ZA 1K8AO 3EY1A 4X62K 2QWRA 4ILHA 4B9QA 4HUFA 4NYNA 4YOVA 1NJYA 3PUFA 3QBWA 2O8DB 3TAFA 3WXKA 4FJKA 1IG8A 3SUOA 4N5SA 3F9KA 1NGFA 3TU5A 2BH1A 4KHQA 3J8AA 3EE9A 4DTNA 2P9PB 1Q18A 1RT2A 3DLHA 4ICLA 4CIFA 2BTFA 1BI4A 4KBOA 2VYPA 5AZIB 4C1NK 2E88A 4CJUA 4WF9L 3L2RA 1U6ZA 4AHVA 2XY6A 3LM2A 3LDQA 1BI4B 3TAQA 4GKKK 1CZAN 4CERA 5AFUH 1LWEA 1LV5A 1KAYA 3GE1A 1L3TA 3AVHA 3QIOA 5C24A 1U47A 4DWIA 4KB0A 3PX0A 3J7YP 2B4JA 1R0AA 4B08A 2P9LA 1GLDG 4JI1K 1WSHA 5CR4A 3ZETA 3RRGA 4EIAA 1NWKA 3VESA 1C0TA 1S1UA 5KQ8A 2E2PA 4DV5K 4JI6K 4ELTA 3CG7A 2E1YA 3WXMB 3F2KA 4FPBA 2E20A 3MN6A 3KKRA 2P9NB 2YX6A 4GKJK 2GWKA 4CJVA 3ZSZA 3QEWA 3WNHA 4NLCA 1EX4A 3SAFA 1KVBA 2KHOA 2E2NA 4XH1A 3WNGA 2YHBA 1XHZA 3MDQA 3CJAA 3V6DA 5KQDA 4JS4A 3N4PA 5M1PA 3NVMA 1Q82O 1YIJN 2CH6A 5D3GA 4PQUA 5AQKA 4CF9A 4CCHA 3EKSA 4PKIA 3HM8A 3S3NA 1HNVA 4OPAA 3A0IX 1RBSA 4YOWA 2RHKA 3CCUN 1KSPA 1XMOK 1D8YA 1JL2A 4FPAA 2KKZA 4JHDB 4JKEA 4HCBA 3I8BA 3QNNA 2ASPA 4M3WA 4K41A 1N32K 5C42A 2HHTA 3LL3A 4BVPA 3GDQA 3M1FA 3T7ZA 1I94K 1TKZA 3RMBA 5AQPA 4G1QA 1BGXT 1XUPO 4FYDA 3P5JA 1NGAA 1L5UA 1F21A 1I39A 3MWTA 2O8BB 1QS4A 3AVBA 4ISGA 4LSNA 1BISA 3O9UA 2CGKA 3OA9A 2FLOA 4FM2A 3TSUA 3VEVA 4LFCK 5KI6A 3VF4A 1VHXA 3DAWA 3UIQA 1CXUA 5E26A 5MLCQ 3CJ9A 3R1XA 4CK3A 4EZ9A 3LWLA 4MFBA 4DUYK 5B8HA 3H6EA 3LAMA 5EU7A 4JS5A 1IBMK 2HBKA 4KHSA 3RWUA 1N34K 4YDUA 3ULEB 3KK7A 1NJWA 2P51A 4BR0A 1RTJA 4PHTX 4CF0A 3D6RA 5HRNA 1YVUA 5E41A 1NJXA 4M3UA 4DV6K 1HJRA 3O5BA 5EOYA 1YTUA 2NRXA 3T1HK 3AVAA 3WXIA 3ZSWA 1NOZA 4RCHA 3D2FA 4NLBA 1X3NA 3HJFA 3TI0A 4BC5A 3QO9A 3NE6A 4BRKA 2JWLA 4I6MA 2QEXN 3D7EO 2WOMA 1U45A 1VQ5N 3ZEUB 4Y1CA 1ILYA 3MK6A 1EO1A 1GLLO 2X6SA 2WC9A 4BG8A 2GV9A 1VQON 1NU0A 4HUEA 1YTAA 4M7XA 3TAMA 3I0SA 2NUBA 4JK9A 4B1XB 4UQGA 3OYCA 2OPRA 5AQJA 1MA9B 4E19A 3O9RA 2GTDA 4BRQA 3A5MC 2A1SA 2HNZA 2QM1A 3SQ2A 4O0JA 1OVYA 3H1QA 3AAPA 3V9WA 4NXMK 3KIOA 5LY3A 1ATSA 4M3YA 4CZJA 3V4IA 4B9VA 3LDSA 1BDGA 2YI1A 4B9MA 5FROA 3TSQA 2XY5A 3PY8A 4YFUA 3C95A 1TUUA 1T6CA 4DCHA 1SQKA 1NGJA 4JI3K 4LF5K 4A5BA 3HI0A 2ATQA 2IIRA 4KHNA 2AA4A
chains in the Genus database with same CATH topology
3L2QA 1RBUA 3NF6A 4PY5A 4E1MA 4CJPA 2X74A 4PA1A 4O0IA 3WNEA 4HHTA 4KTZA 4DQQA 1IKWA 1SKRA 3IG1A 2XRIA 5JS1A 1KTQA 1XC9A 3KLGA 2D5RA 4CFCA 3JSMA 4JRPA 1T8EA 1A5VA 4KI6A 4BWMA 1U49A 1RT5A 1S1VA 3AVIA 1ASUA 4WE1A 3VQQA 1S5JA 3K5NA 4RW9A 4OGCA 1ZYQA 4HCCA 5CZ2A 1S1WA 1S9GA 3SQ0A 3WNFA 2HHWA 5CZ1A 5HBMA 3SI6A 4Z4GA 2FC0A 4DTJA 3KLEA 1B9DA 1EKEA 1HNIA 1VSIA 4Z0UA 4BE0A 3RMAA 3NF9A 4M45A 1WSJA 3OYBA 4FLVA 1L3UA 4L8RB 3OYGA 4NYFA 4R5PA 2ITGA 4DTPA 4EP4A 4CECA 1CLQA 4CGDA 1SUQA 3VQBA 4CK1A 3PO5A 3SNNA 1NKEA 4KAZA 3M8PA 3K2PA 4DS4A 4CJQA 3SJJA 1TK5A 4BACA 1GOBA 3OYEA 1X1PA 4LH5A 1A5XA 1RILA 3OYMA 4CJRA 3KD1E 4CEEA 2OPPA 3V9UA 1TL1A 4ZTJA 1KVCA 3OYJA 1NK0A 2QK9A 4DLGA 3KD5E 3DI6A 5SWMA 4FW2A 1Z26A 3K58A 1ZBIA 1SL2A 3NH0A 4DSEA 1KRPA 2HHUA 2G8FA 2YV0X 3P1GA 1EP4A 1RCHA 3LP1A 4CESA 4BDZA 5CYQA 3RR7A 2VWKA 1B92A 1IKXA 4OVLA 4CEZA 4OPJA 3TANA 2IAJA 3QINA 3VQ7A 1QSSA 1BIZA 1FKPA 4JRQA 1DTQA 1UWBA 4CHOA 5HRSA 4DQSA 2QXFA 1NK6A 4FJHA 4FJ7A 1LW2A 2IGIA 3IRXA 4F4KA 2F8SA 3AVCA 1TAUA 3K59A 4M41A 3AVJA 4CF8A 3L3UA 3EZ5A 4DFKA 1SL0A 3HK2A 3NH2A 1XHXA 4FJIA 1RNHA 3DM2A 1WN7A 2P1JA 3V9XA 4DSLA 4N41A 1CXQA 2YKNA 5HRRA 4KO0A 4C8MA 3VQPA 2E6LA 3NHGA 4KI4A 1UA1A 2A1RA 3V1QA 3O3FA 4HUGA 3L2WA 2ETJA 4QOZB 3LZIA 1C0UA 1NKCA 2QKKA 4N47A 4Z4FA 1C6VA 4E7KA 2IS3A 4Y1DA 3CFRA 4J2DA 2Z1GA 1S1TA 1KCFA 1WSEA 3P83D 3VQ9A 3VQEA 2KW4A 4OPKA 3K5LA 4AHUA 4GVMA 2D0CA 3ZSVA 4FJ8A 3OS1A 2Y1JA 4Z4CA 5HP1A 3D45A 1B9FA 5KTQA 4E7HA 4GW6A 2Q3SA 2RKIA 2HHVA 4LD0A 1Q9XA 2FBVA 1HYSA 4KREA 3TARA 1C1BA 4W5QA 4H8KA 3OVNA 3AVKA 3VQDA 4RW7A 3HT3A 4CJLA 1TKTA 3HXMA 1NK4A 3ZCMA 3OYKA 3LAKA 3D0PA 1JL1A 3VN5A 1JLCA 4CEDA 2B5JA 1LW0A 4CHZA 3K5MA 3AO5A 4NCBA 4AHTA 1QTMA 4OGEA 3SUQA 2Z1HA 3SPZA 4FJNA 4HTUA 3QIPA 4FK4A 1HQUA 3AA2A 3AA4A 4CEFA 4CEBA 4CEAA 2YNIA 1VSKA 3OYHA 3KLHA 4NCAA 1SL1A 4DTRA 2QKBA 4IKFA 2Z1IA 3ZSOA 1J53A 1UA0A 4KHWA 1MU2A 2BGGA 2VG5A 1FXXA 4E3SA 3QEVA 4I2PA 4DSFA 1TV6A 1IKYA 3DYAA 1TVRA 4OKJA 3SUNA 1D9FA 2PZSA 1K6YA 4DMNA 1NJZA 1HPZA 2XO7A 1VSHA 3I8DA 4E1NA 5CYMA 1S1XA 4BE2A 4KB1A 3V1OA 1S6PA 1VSLA 4KV8A 3AA3A 4CIGA 3AA5X 3K57A 1ASWA 4FM0A 1ZBLA 3BGRA 1I3AA 4CJ3A 1Q9YA 3RMCA 3L2VA 3OYIA 4E7IA 1SKWA 3RTVA 1BCOA 1C0MA 2Z1JA 5KRSA 3RMDA 2E4LA 4BDPA 4CJTA 1JLBA 4HVJA 5I42A 4IFVA 4OLBA 3K5OA 2WONA 3AVGA 1VSEA 4N56A 1HYVA 2B6AA 2YHAA 4CHQA 1J9AA 2XY8A 4OLAA 1JLGA 4DQIA 4M3ZA 4KRFA 3S3MA 3VQAA 2X78A 4BDYA 4O44A 3M8RA 4QAGA 3NCIA 4DS5A 1RDBA 2ZD1A 1GOAA 3ZSYA 2AJQA 3KKSA 3SUPA 2HNDA 3DRPA 3CFPA 3IS9A 4AILC 3KK3A 3RR8A 4FJJA 4RW4A 3PX6A 1JKHA 1NK8A 1BHLA 1HQEA 4F2RA 4CK2A 3B6PA 2HVHA 4Z4EA 3HVRA 3KK2A 5T7BA 1L3VA 3TAPA 1NK5A 1DTTA 5J2MA 3ASMA 2G8KA 1TL3A 3L2UA 1REVA 3NFAA 3LP0A 3ZT3A 1SV5A 2OZMA 3MAQA 1TAQA 3OYLA 5K14A 4DSKA 4IG3A 3VQ6A 3AO1A 4EP5A 1KVAA 3HPHA 5HRPA 2Y1IA 2G8UA 4F3TA 3ZT1A 4C8LA 4RW6A 3ZSRA 4DG1A 5KRTA 3HPOA 1EETA 1Y97A 2FBXA 2OPQA 1QSLA 1GOCA 3ZSQA 1CZ9A 3B6OA 2YKMA 2PYLA 3C6TA 3V9ZA 4OJRA 1U48A 4B9UA 1U04A 5J2QA 4DTMA 4B9NA 2DTUA 5KGWA 1W0HA 4DU3A 1KFSA 2KFZA 4W5TA 4CF2A 1X9MA 3HM9A 3QEXA 4C8OA 4M3XA 4CGFA 3AVNA 1U4BA 1Q8IA 3PO4A 4B8AB 3OYFA 1NK9A 1S6QA 3IAYA 3MXIA 3EY1A 3T3FA 3MEGA 1JXEA 4O4GA 2GBZA 1RBRA 3U3YA 3DRSA 1X9SA 1T05A 1FK9A 4NYNA 4HUFA 4W5RA 1NJYA 3PUFA 3TAFA 1VSMA 2EX3A 4CHYA 3KJVA 4K8XA 2D0BA 4F8RA 4KTQA 1C1CA 4FJKA 1TK8A 2DFEA 3OY9A 3SUOA 3E01A 4N5SA 3F9KA 4FLZA 3TAEA 4ELVA 2F8TA 4KHQA 4FCYA 2R7YA 4DTNA 1RT2A 3DOLA 4E89A 3O3GA 3OJSA 1T7PA 1HMVA 5SZTA 2FBYA 1VSFA 2YNFA 1RT1A 4ICLA 4OKEA 3OS0A 3DLHA 1IO2A 3QETA 4CIFA 3ULDA 1BI4A 3VA3A 1VRUA 4CJEA 4IFYA 1RDCA 2RPIA 3MEDA 3QEIA 1VRTA 1ZBUA 5JS2A 3SQ1A 4F2SA 4CJUA 3SCXA 3VQ5A 2YNHA 2FBTA 4TSXA 4AHVA 3L2RA 4E7JA 2XY6A 4FVMA 3MXMA 1BI4B 1XWLA 4OKKA 4CFDA 2XHBA 4K8ZA 3TAQA 4CJSA 4J2BA 4B3OA 4CERA 1KLMA 2HMIA 2OA8A 1LWEA 1LV5A 1JLFA 3NF7A 1RTDA 4CGHA 1L3TA 1C1AA 4DFMA 3I0RA 1JLQA 3AVHA 3QIOA 5C24A 1U47A 4DWIA 4BWJA 4CE9A 3DLBA 1DLOA 3PX0A 2PY5A 4DQPA 2B4JA 4DU4A 1BQMA 1LAWA 1R0AA 4B08A 2OYQA 2KZMA 1IKVA 4LSLA 3F73A 1WSHA 4LY7A 2PYJA 5DK5A 3FFIA 4I9QA 1IH7A 3AO2A 3AV9A 2VWJA 4ID1A 2G8VA 3RRGA 4FJGA 2DFFA 2HVIA 1C0TA 1FKOA 1S1UA 4KKOA 2O4IA 3OYDA 3LP2A 3AO3A 1YT3A 4DTSA 1J54A 4ELTA 1CZBA 1QSYA 4H4MA 4M3TA 2ZQBA 3CG7A 4MQ3A 4AHRA 3JYTA 4O5BA 3U3GA 1ZBHA 3HP9A 3HO1A 4IBNA 4I9LA 3KKRA 5J2NA 1XI1A 4BE1A 4CJVA 1LWFA 3ZSZA 3QEWA 1HYZA 1NKBA 3OYNA 3NBPA 2G8WA 3WNHA 3NAEA 4DQRA 3V9SA 4CHPA 1EX4A 1NOYA 1KVBA 1LAVA 3HSTB 3QEPA 2HHXA 3WNGA 1VSDA 4E7LA 1RT4A 1N6QA 2YHBA 2G8HA 1XHZA 3CM6A 1T03A 4E0DA 4J2EA 1QQCA 1S9EA 2KQ2A 3NGYA 3T19A 4PUOA 4CEQA 4KPYA 4CJFA 3ISNC 1RDDA 3V6DA 4CEOA 4JS4A 1RBTA 4M42A 4CJWA 3C6UA 4NCGA 1J5OA 1KLNA 4FK0A 3U6FA 4DU1A 5D3GA 4B8CA 2RN2A 1TKDA 2GUIA 3DRRA 4CF9A 4KHYA 4PQUA 3ZT0A 3NH1A 4CCHA 3S3OA 1TKXA 3ITHA 4CFAA 3ZT4A 3DOKA 1WSIA 3S3NA 1JLEA 3BDPA 1HNVA 3VA0A 1RBSA 1KSPA 3HP6A 1D8YA 1JL2A 3DMJA 3HVTA 2KFNA 4ELUA 4HCBA 4FXDA 4Z4HA 2KTQA 3O4QA 2HHSA 4O55A 4FZYA 1BCMA 2O4GA 4FK2A 4FZZA 1LWCA 1JLAA 2RF2A 2DFHA 1EXQA 4DTUA 3NGZA 3QNNA 2F96A 1ZBFA 5FDLA 4M3WA 1WSFA 3ZSXA 3MXJA 4FJXA 2JGUA 1RT7A 5C42A 3KTQA 2HHTA 4DTXA 4C8KA 4FZXC 3M8SA 3LWMA 2YNGA 4LH4A 2OZSA 3THVA 2X6NA 3MECA 4CGIA 4DSJA 4FJ5A 2G8IA 4H4OA 2D0AA 4CJ4A 1TKZA 1VSJA 4ID5A 3RMBA 4F3OA 1HRHA 4G1QA 3CFOA 1BGXT 1D5AA 1D9DA 4FYDA 4QCLA 2HW3A 4W5OA 3P5JA 1L5UA 2E6MA 1UOCA 1F21A 3G0ZA 4DF8A 1I39A 3L8BA 4DLEA 3OJUA 4CGGA 1QS4A 3AVBA 3TABA 1IG9A 4LSNA 4FLYA 1RBVA 1BISA 4B9TA 1RTHA 5CY4A 4FJ9A 3LZJA 3H08A 4FM2A 1TK0A 3SZ2A 5KI6A 5KGXA 2I5JA 1UAXA 1L3SA 3AO4A 1WNSA 4FLWA 3LANA 3UIQA 1CXUA 4J2AA 4CGJA 2XY7A 4CK3A 3OYAA 1N5YA 3G10A 3LPUA 3TAGA 4EZ9A 1TGOA 3LWLA 4CFBA 4MFBA 3MEEA 3CM5A 3TWHA 3LAMA 5EU7A 4JS5A 2P5OA 4B9LA 4KHSA 3KK1A 4ZTFA 3HL8A 1RDAA 3RRHA 1NK7A 3RWUA 4DF4A 1BIUA 1Z25A 1NJWA 2P51A 1RTJA 2IOCA 4CF0A 3PX4A 2DY4A 5HRNA 1SKSA 1KFDA 3ALYA 4CJKA 3VQ4A 1YVUA 3DLKA 5E41A 4XIUA 1NJXA 4EZ6A 4M3UA 2HNYA 1HJRA 3SV4A 1YTUA 4CJ5A 3CQ8A 3AVAA 4FW1A 3ZSWA 4FLTA 4CHNA 3CYMA 4JLHA 2JLEA 3O4NA 1NOZA 4KTWA 3VQ8A 3OS2A 3HYFA 4AH9A 4GMJB 3O3HA 3HJFA 1A5WA 3TI0A 3QO9A 3NE6A 4IDKA 1BQNA 4RG8A 1WAJA 3L3VA 1QHTA 4I7FA 1QE1A 4AHSA 3AVMA 4DFPA 1WLJA 2IC3A 3PV8A 2WOMA 1U45A 1ASVA 4ZHRA 4Y1CA 3SV3A 3QESA 4Q0BA 2X6SA 3DLGA 4RW8A 2GV9A 4FJMA 4Q5VA 2W42A 4HUEA 4B9SA 2OPSA 1VK0A 4I2QA 1YTAA 3AVFA 4C8NA 3LPTA 4FLUA 3SQ4A 2LSNA 3TAMA 1BL3A 3C94A 3I0SA 2NUBA 4UQGA 1ITGA 4KFBA 3OYCA 4W5NA 2EHGA 3NF8A 3S9HA 2OPRA 3KLIA 3QLHA 5J1EA 3KLFA 3V81A 2VG6A 3SPYA 3DLRA 2BANA 2VG7A 4IG0A 4FM1A 4E19A 5J2PA 5C25A 2BE2A 1RT6A 4N76A 2A1SA 2HNZA 3SQ2A 4CIEA 1X9WA 4DSIA 4KHUA 5FRMA 4O0JA 4FLXA 4PWDA 2KZZA 4FJLA 5FRNA 4M3RA 3LP3A 1RTIA 3HPGA 2IDOA 2P5GA 5HROA 3V9WA 3TR8A 3KIOA 3EYZA 1O1WA 3SYZA 3QNOA 3A2FA 3VQCA 3V1RA 4M3YA 3LALA 2HHQA 4DTOA 3V4IA 4B9VA 3LDSA 4B9MA 2ZE2A 3AVLA 3M8QA 5FROA 1JXBA 2BDPA 5DMRA 1RT3A 4Z4IA 1WSGA 5I3UA 3ZT2A 1WAFA 2XY5A 3PY8A 4YFUA 3QERA 3C95A 4YNQA 4DFJA 1W9HA 3NDKA 4KB0A 3DLEA 3T1AA 2ATQA 3NGIA 4CF1A 5HLFA 2HB5A 1G15A 4KHNA 4AHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2Q A;  1RBU A;  3NF6 A;  4PY5 A;  4E1M A;  4CJP A;  2X74 A;  4PA1 A;  4O0I A;  3WNE A;  4HHT A;  4KTZ A;  4DQQ A;  1IKW A;  1SKR A;  3IG1 A;  2XRI A;  5JS1 A;  1KTQ A;  1XC9 A;  3KLG A;  2D5R A;  4CFC A;  3JSM A;  4JRP A;  1T8E A;  1A5V A;  4KI6 A;  4BWM A;  1U49 A;  1RT5 A;  1S1V A;  3AVI A;  1ASU A;  4WE1 A;  3VQQ A;  1S5J A;  3K5N A;  4RW9 A;  4OGC A;  1ZYQ A;  4HCC A;  5CZ2 A;  1S1W A;  1S9G A;  3SQ0 A;  3WNF A;  2HHW A;  5CZ1 A;  5HBM A;  3SI6 A;  4Z4G A;  2FC0 A;  4DTJ A;  3KLE A;  1B9D A;  1EKE A;  1HNI A;  1VSI A;  4Z0U A;  4BE0 A;  3RMA A;  3NF9 A;  4M45 A;  1WSJ A;  3OYB A;  4FLV A;  1L3U A;  4L8R B;  3OYG A;  4NYF A;  4R5P A;  2ITG A;  4DTP A;  4EP4 A;  4CEC A;  1CLQ A;  4CGD A;  1SUQ A;  3VQB A;  4CK1 A;  3PO5 A;  3SNN A;  1NKE A;  4KAZ A;  3M8P A;  3K2P A;  4DS4 A;  4CJQ A;  3SJJ A;  1TK5 A;  4BAC A;  1GOB A;  3OYE A;  1X1P A;  4LH5 A;  1A5X A;  1RIL A;  3OYM A;  4CJR A;  3KD1 E;  4CEE A;  2OPP A;  3V9U A;  1TL1 A;  4ZTJ A;  1KVC A;  3OYJ A;  1NK0 A;  2QK9 A;  4DLG A;  3KD5 E;  3DI6 A;  5SWM A;  4FW2 A;  1Z26 A;  3K58 A;  1ZBI A;  1SL2 A;  3NH0 A;  4DSE A;  1KRP A;  2HHU A;  2G8F A;  2YV0 X;  3P1G A;  1EP4 A;  1RCH A;  3LP1 A;  4CES A;  4BDZ A;  5CYQ A;  3RR7 A;  2VWK A;  1B92 A;  1IKX A;  4OVL A;  4CEZ A;  4OPJ A;  3TAN A;  2IAJ A;  3QIN A;  3VQ7 A;  1QSS A;  1BIZ A;  1FKP A;  4JRQ A;  1DTQ A;  1UWB A;  4CHO A;  5HRS A;  4DQS A;  2QXF A;  1NK6 A;  4FJH A;  4FJ7 A;  1LW2 A;  2IGI A;  3IRX A;  4F4K A;  2F8S A;  3AVC A;  1TAU A;  3K59 A;  4M41 A;  3AVJ A;  4CF8 A;  3L3U A;  3EZ5 A;  4DFK A;  1SL0 A;  3HK2 A;  3NH2 A;  1XHX A;  4FJI A;  1RNH A;  3DM2 A;  1WN7 A;  2P1J A;  3V9X A;  4DSL A;  4N41 A;  1CXQ A;  2YKN A;  5HRR A;  4KO0 A;  4C8M A;  3VQP A;  2E6L A;  3NHG A;  4KI4 A;  1UA1 A;  2A1R A;  3V1Q A;  3O3F A;  4HUG A;  3L2W A;  2ETJ A;  4QOZ B;  3LZI A;  1C0U A;  1NKC A;  2QKK A;  4N47 A;  4Z4F A;  1C6V A;  4E7K A;  2IS3 A;  4Y1D A;  3CFR A;  4J2D A;  2Z1G A;  1S1T A;  1KCF A;  1WSE A;  3P83 D;  3VQ9 A;  3VQE A;  2KW4 A;  4OPK A;  3K5L A;  4AHU A;  4GVM A;  2D0C A;  3ZSV A;  4FJ8 A;  3OS1 A;  2Y1J A;  4Z4C A;  5HP1 A;  3D45 A;  1B9F A;  5KTQ A;  4E7H A;  4GW6 A;  2Q3S A;  2RKI A;  2HHV A;  4LD0 A;  1Q9X A;  2FBV A;  1HYS A;  4KRE A;  3TAR A;  1C1B A;  4W5Q A;  4H8K A;  3OVN A;  3AVK A;  3VQD A;  4RW7 A;  3HT3 A;  4CJL A;  1TKT A;  3HXM A;  1NK4 A;  3ZCM A;  3OYK A;  3LAK A;  3D0P A;  1JL1 A;  3VN5 A;  1JLC A;  4CED A;  2B5J A;  1LW0 A;  4CHZ A;  3K5M A;  3AO5 A;  4NCB A;  4AHT A;  1QTM A;  4OGE A;  3SUQ A;  2Z1H A;  3SPZ A;  4FJN A;  4HTU A;  3QIP A;  4FK4 A;  1HQU A;  3AA2 A;  3AA4 A;  4CEF A;  4CEB A;  4CEA A;  2YNI A;  1VSK A;  3OYH A;  3KLH A;  4NCA A;  1SL1 A;  4DTR A;  2QKB A;  4IKF A;  2Z1I A;  3ZSO A;  1J53 A;  1UA0 A;  4KHW A;  1MU2 A;  2BGG A;  2VG5 A;  1FXX A;  4E3S A;  3QEV A;  4I2P A;  4DSF A;  1TV6 A;  1IKY A;  3DYA A;  1TVR A;  4OKJ A;  3SUN A;  1D9F A;  2PZS A;  1K6Y A;  4DMN A;  1NJZ A;  1HPZ A;  2XO7 A;  1VSH A;  3I8D A;  4E1N A;  5CYM A;  1S1X A;  4BE2 A;  4KB1 A;  3V1O A;  1S6P A;  1VSL A;  4KV8 A;  3AA3 A;  4CIG A;  3AA5 X;  3K57 A;  1ASW A;  4FM0 A;  1ZBL A;  3BGR A;  1I3A A;  4CJ3 A;  1Q9Y A;  3RMC A;  3L2V A;  3OYI A;  4E7I A;  1SKW A;  3RTV A;  1BCO A;  1C0M A;  2Z1J A;  5KRS A;  3RMD A;  2E4L A;  4BDP A;  4CJT A;  1JLB A;  4HVJ A;  5I42 A;  4IFV A;  4OLB A;  3K5O A;  2WON A;  3AVG A;  1VSE A;  4N56 A;  1HYV A;  2B6A A;  2YHA A;  4CHQ A;  1J9A A;  2XY8 A;  4OLA A;  1JLG A;  4DQI A;  4M3Z A;  4KRF A;  3S3M A;  3VQA A;  2X78 A;  4BDY A;  4O44 A;  3M8R A;  4QAG A;  3NCI A;  4DS5 A;  1RDB A;  2ZD1 A;  1GOA A;  3ZSY A;  2AJQ A;  3KKS A;  3SUP A;  2HND A;  3DRP A;  3CFP A;  3IS9 A;  4AIL C;  3KK3 A;  3RR8 A;  4FJJ A;  4RW4 A;  3PX6 A;  1JKH A;  1NK8 A;  1BHL A;  1HQE A;  4F2R A;  4CK2 A;  3B6P A;  2HVH A;  4Z4E A;  3HVR A;  3KK2 A;  5T7B A;  1L3V A;  3TAP A;  1NK5 A;  1DTT A;  5J2M A;  3ASM A;  2G8K A;  1TL3 A;  3L2U A;  1REV A;  3NFA A;  3LP0 A;  3ZT3 A;  1SV5 A;  2OZM A;  3MAQ A;  1TAQ A;  3OYL A;  5K14 A;  4DSK A;  4IG3 A;  3VQ6 A;  3AO1 A;  4EP5 A;  1KVA A;  3HPH A;  5HRP A;  2Y1I A;  2G8U A;  4F3T A;  3ZT1 A;  4C8L A;  4RW6 A;  3ZSR A;  4DG1 A;  5KRT A;  3HPO A;  1EET A;  1Y97 A;  2FBX A;  2OPQ A;  1QSL A;  1GOC A;  3ZSQ A;  1CZ9 A;  3B6O A;  2YKM A;  2PYL A;  3C6T A;  3V9Z A;  4OJR A;  1U48 A;  4B9U A;  1U04 A;  5J2Q A;  4DTM A;  4B9N A;  2DTU A;  5KGW A;  1W0H A;  4DU3 A;  1KFS A;  2KFZ A;  4W5T A;  4CF2 A;  1X9M A;  3HM9 A;  3QEX A;  4C8O A;  4M3X A;  4CGF A;  3AVN A;  1U4B A;  1Q8I A;  3PO4 A;  4B8A B;  3OYF A;  1NK9 A;  1S6Q A;  3IAY A;  3MXI A;  3EY1 A;  3T3F A;  3MEG A;  1JXE A;  4O4G A;  2GBZ A;  1RBR A;  3U3Y A;  3DRS A;  1X9S A;  1T05 A;  1FK9 A;  4NYN A;  4HUF A;  4W5R A;  1NJY A;  3PUF A;  3TAF A;  1VSM A;  2EX3 A;  4CHY A;  3KJV A;  4K8X A;  2D0B A;  4F8R A;  4KTQ A;  1C1C A;  4FJK A;  1TK8 A;  2DFE A;  3OY9 A;  3SUO A;  3E01 A;  4N5S A;  3F9K A;  4FLZ A;  3TAE A;  4ELV A;  2F8T A;  4KHQ A;  4FCY A;  2R7Y A;  4DTN A;  1RT2 A;  3DOL A;  4E89 A;  3O3G A;  3OJS A;  1T7P A;  1HMV A;  5SZT A;  2FBY A;  1VSF A;  2YNF A;  1RT1 A;  4ICL A;  4OKE A;  3OS0 A;  3DLH A;  1IO2 A;  3QET A;  4CIF A;  3ULD A;  1BI4 A;  3VA3 A;  1VRU A;  4CJE A;  4IFY A;  1RDC A;  2RPI A;  3MED A;  3QEI A;  1VRT A;  1ZBU A;  5JS2 A;  3SQ1 A;  4F2S A;  4CJU A;  3SCX A;  3VQ5 A;  2YNH A;  2FBT A;  4TSX A;  4AHV A;  3L2R A;  4E7J A;  2XY6 A;  4FVM A;  3MXM A;  1BI4 B;  1XWL A;  4OKK A;  4CFD A;  2XHB A;  4K8Z A;  3TAQ A;  4CJS A;  4J2B A;  4B3O A;  4CER A;  1KLM A;  2HMI A;  2OA8 A;  1LWE A;  1LV5 A;  1JLF A;  3NF7 A;  1RTD A;  4CGH A;  1L3T A;  1C1A A;  4DFM A;  3I0R A;  1JLQ A;  3AVH A;  3QIO A;  5C24 A;  1U47 A;  4DWI A;  4BWJ A;  4CE9 A;  3DLB A;  1DLO A;  3PX0 A;  2PY5 A;  4DQP A;  2B4J A;  4DU4 A;  1BQM A;  1LAW A;  1R0A A;  4B08 A;  2OYQ A;  2KZM A;  1IKV A;  4LSL A;  3F73 A;  1WSH A;  4LY7 A;  2PYJ A;  5DK5 A;  3FFI A;  4I9Q A;  1IH7 A;  3AO2 A;  3AV9 A;  2VWJ A;  4ID1 A;  2G8V A;  3RRG A;  4FJG A;  2DFF A;  2HVI A;  1C0T A;  1FKO A;  1S1U A;  4KKO A;  2O4I A;  3OYD A;  3LP2 A;  3AO3 A;  1YT3 A;  4DTS A;  1J54 A;  4ELT A;  1CZB A;  1QSY A;  4H4M A;  4M3T A;  2ZQB A;  3CG7 A;  4MQ3 A;  4AHR A;  3JYT A;  4O5B A;  3U3G A;  1ZBH A;  3HP9 A;  3HO1 A;  4IBN A;  4I9L A;  3KKR A;  5J2N A;  1XI1 A;  4BE1 A;  4CJV A;  1LWF A;  3ZSZ A;  3QEW A;  1HYZ A;  1NKB A;  3OYN A;  3NBP A;  2G8W A;  3WNH A;  3NAE A;  4DQR A;  3V9S A;  4CHP A;  1EX4 A;  1NOY A;  1KVB A;  1LAV A;  3HST B;  3QEP A;  2HHX A;  3WNG A;  1VSD A;  4E7L A;  1RT4 A;  1N6Q A;  2YHB A;  2G8H A;  1XHZ A;  3CM6 A;  1T03 A;  4E0D A;  4J2E A;  1QQC A;  1S9E A;  2KQ2 A;  3NGY A;  3T19 A;  4PUO A;  4CEQ A;  4KPY A;  4CJF A;  3ISN C;  1RDD A;  3V6D A;  4CEO A;  4JS4 A;  1RBT A;  4M42 A;  4CJW A;  3C6U A;  4NCG A;  1J5O A;  1KLN A;  4FK0 A;  3U6F A;  4DU1 A;  5D3G A;  4B8C A;  2RN2 A;  1TKD A;  2GUI A;  3DRR A;  4CF9 A;  4KHY A;  4PQU A;  3ZT0 A;  3NH1 A;  4CCH A;  3S3O A;  1TKX A;  3ITH A;  4CFA A;  3ZT4 A;  3DOK A;  1WSI A;  3S3N A;  1JLE A;  3BDP A;  1HNV A;  3VA0 A;  1RBS A;  1KSP A;  3HP6 A;  1D8Y A;  1JL2 A;  3DMJ A;  3HVT A;  2KFN A;  4ELU A;  4HCB A;  4FXD A;  4Z4H A;  2KTQ A;  3O4Q A;  2HHS A;  4O55 A;  4FZY A;  1BCM A;  2O4G A;  4FK2 A;  4FZZ A;  1LWC A;  1JLA A;  2RF2 A;  2DFH A;  1EXQ A;  4DTU A;  3NGZ A;  3QNN A;  2F96 A;  1ZBF A;  5FDL A;  4M3W A;  1WSF A;  3ZSX A;  3MXJ A;  4FJX A;  2JGU A;  1RT7 A;  5C42 A;  3KTQ A;  2HHT A;  4DTX A;  4C8K A;  4FZX C;  3M8S A;  3LWM A;  2YNG A;  4LH4 A;  2OZS A;  3THV A;  2X6N A;  3MEC A;  4CGI A;  4DSJ A;  4FJ5 A;  2G8I A;  4H4O A;  2D0A A;  4CJ4 A;  1TKZ A;  1VSJ A;  4ID5 A;  3RMB A;  4F3O A;  1HRH A;  4G1Q A;  3CFO A;  1BGX T;  1D5A A;  1D9D A;  4FYD A;  4QCL A;  2HW3 A;  4W5O A;  3P5J A;  1L5U A;  2E6M A;  1UOC A;  1F21 A;  3G0Z A;  4DF8 A;  1I39 A;  3L8B A;  4DLE A;  3OJU A;  4CGG A;  1QS4 A;  3AVB A;  3TAB A;  1IG9 A;  4LSN A;  4FLY A;  1RBV A;  1BIS A;  4B9T A;  1RTH A;  5CY4 A;  4FJ9 A;  3LZJ A;  3H08 A;  4FM2 A;  1TK0 A;  3SZ2 A;  5KI6 A;  5KGX A;  2I5J A;  1UAX A;  1L3S A;  3AO4 A;  1WNS A;  4FLW A;  3LAN A;  3UIQ A;  1CXU A;  4J2A A;  4CGJ A;  2XY7 A;  4CK3 A;  3OYA A;  1N5Y A;  3G10 A;  3LPU A;  3TAG A;  4EZ9 A;  1TGO A;  3LWL A;  4CFB A;  4MFB A;  3MEE A;  3CM5 A;  3TWH A;  3LAM A;  5EU7 A;  4JS5 A;  2P5O A;  4B9L A;  4KHS A;  3KK1 A;  4ZTF A;  3HL8 A;  1RDA A;  3RRH A;  1NK7 A;  3RWU A;  4DF4 A;  1BIU A;  1Z25 A;  1NJW A;  2P51 A;  1RTJ A;  2IOC A;  4CF0 A;  3PX4 A;  2DY4 A;  5HRN A;  1SKS A;  1KFD A;  3ALY A;  4CJK A;  3VQ4 A;  1YVU A;  3DLK A;  5E41 A;  4XIU A;  1NJX A;  4EZ6 A;  4M3U A;  2HNY A;  1HJR A;  3SV4 A;  1YTU A;  4CJ5 A;  3CQ8 A;  3AVA A;  4FW1 A;  3ZSW A;  4FLT A;  4CHN A;  3CYM A;  4JLH A;  2JLE A;  3O4N A;  1NOZ A;  4KTW A;  3VQ8 A;  3OS2 A;  3HYF A;  4AH9 A;  4GMJ B;  3O3H A;  3HJF A;  1A5W A;  3TI0 A;  3QO9 A;  3NE6 A;  4IDK A;  1BQN A;  4RG8 A;  1WAJ A;  3L3V A;  1QHT A;  4I7F A;  1QE1 A;  4AHS A;  3AVM A;  4DFP A;  1WLJ A;  2IC3 A;  3PV8 A;  2WOM A;  1U45 A;  1ASV A;  4ZHR A;  4Y1C A;  3SV3 A;  3QES A;  4Q0B A;  2X6S A;  3DLG A;  4RW8 A;  2GV9 A;  4FJM A;  4Q5V A;  2W42 A;  4HUE A;  4B9S A;  2OPS A;  1VK0 A;  4I2Q A;  1YTA A;  3AVF A;  4C8N A;  3LPT A;  4FLU A;  3SQ4 A;  2LSN A;  3TAM A;  1BL3 A;  3C94 A;  3I0S A;  2NUB A;  4UQG A;  1ITG A;  4KFB A;  3OYC A;  4W5N A;  2EHG A;  3NF8 A;  3S9H A;  2OPR A;  3KLI A;  3QLH A;  5J1E A;  3KLF A;  3V81 A;  2VG6 A;  3SPY A;  3DLR A;  2BAN A;  2VG7 A;  4IG0 A;  4FM1 A;  4E19 A;  5J2P A;  5C25 A;  2BE2 A;  1RT6 A;  4N76 A;  2A1S A;  2HNZ A;  3SQ2 A;  4CIE A;  1X9W A;  4DSI A;  4KHU A;  5FRM A;  4O0J A;  4FLX A;  4PWD A;  2KZZ A;  4FJL A;  5FRN A;  4M3R A;  3LP3 A;  1RTI A;  3HPG A;  2IDO A;  2P5G A;  5HRO A;  3V9W A;  3TR8 A;  3KIO A;  3EYZ A;  1O1W A;  3SYZ A;  3QNO A;  3A2F A;  3VQC A;  3V1R A;  4M3Y A;  3LAL A;  2HHQ A;  4DTO A;  3V4I A;  4B9V A;  3LDS A;  4B9M A;  2ZE2 A;  3AVL A;  3M8Q A;  5FRO A;  1JXB A;  2BDP A;  5DMR A;  1RT3 A;  4Z4I A;  1WSG A;  5I3U A;  3ZT2 A;  1WAF A;  2XY5 A;  3PY8 A;  4YFU A;  3QER A;  3C95 A;  4YNQ A;  4DFJ A;  1W9H A;  3NDK A;  4KB0 A;  3DLE A;  3T1A A;  2ATQ A;  3NGI A;  4CF1 A;  5HLF A;  2HB5 A;  1G15 A;  4KHN A;  4AHC A; 
#chains in the Genus database with same CATH topology
 1RBU A;  3NF6 A;  4PY5 A;  4BGB A;  4E1M A;  4PA1 A;  3WNE A;  4HHT A;  4KTZ A;  3W3D A;  3H3O B;  3IG1 A;  2XRI A;  4B1V A;  5JS1 A;  1XC9 A;  3KLG A;  3FLC O;  3THW A;  1A5V A;  4KI6 A;  1ASU A;  3EO3 A;  4HCC A;  3VET A;  1S9G A;  2ITM A;  4FWP A;  4Z4G A;  1B9D A;  3ATV A;  4BE0 A;  5EXW A;  4WFN L;  4M45 A;  4L8R B;  4WQ4 C;  3OYG A;  5AQN A;  2FSJ A;  4R5P A;  1NJI O;  2P9U A;  3VER A;  4CEC A;  3W0L A;  5M1K A;  1SUQ A;  3VQB A;  4B1W B;  2VGM A;  4WFB L;  4KAZ A;  4MDA A;  2O8F A;  3BY5 A;  3SMP A;  4BR5 A;  1GOB A;  1RIL A;  2P9I B;  2P9U B;  3CXC M;  3V9U A;  3IDH A;  3O1B A;  4ZTJ A;  2O8F B;  2EWS A;  4K43 A;  4GV6 A;  2HHU A;  2G8F A;  5AQW A;  3P1G A;  1EP4 A;  1RCH A;  4ILG B;  3QML A;  2VWK A;  3PLA A;  1IKX A;  4CEZ A;  4FJ7 A;  2HF4 A;  2HBJ A;  4F4K A;  5BR8 K;  2I7N A;  1TAU A;  5BN8 A;  2F9T A;  4DV3 K;  3V9X A;  3AAQ A;  1WN7 A;  3ID6 A;  2FF6 A;  2YKN A;  4BVO A;  4K25 A;  5HRR A;  2E6L A;  3NHG A;  3EEQ A;  3V1Q A;  3O3F A;  2ETJ A;  4QOZ B;  4Z4F A;  4E7K A;  4BR9 A;  5AFU A;  3LM9 A;  4J2D A;  4OPK A;  1S1T A;  1KCF A;  4AHU A;  3ZSV A;  4BC2 A;  3NMU A;  3CJ7 A;  1QQO A;  5HP1 A;  3RSE A;  5KTQ A;  4GW6 A;  2HHV A;  3WQT A;  2FBV A;  1HJO A;  3TAR A;  4A2A A;  3BF3 A;  3AVK A;  5AZJ A;  4HTL A;  3HT3 A;  4CJL A;  3HXM A;  4BRC A;  1JCG A;  3OYK A;  2ASO A;  3D0P A;  1JL1 A;  4CHZ A;  5LMN K;  3AO5 A;  4AHT A;  3SPZ A;  4FJN A;  4CEF A;  1WBD A;  4CEB A;  4H0T B;  3SJH A;  3KLH A;  4NCA A;  1XMQ K;  4DTR A;  1SL1 A;  3GG4 A;  3GBT A;  4KHW A;  1J53 A;  1MU2 A;  2A42 A;  1FXX A;  4E3S A;  4I2P A;  4JN4 A;  4OKJ A;  2PZS A;  2ZJR L;  1V4T A;  1NJZ A;  1HPZ A;  3VF6 A;  4E1N A;  1S6P A;  1VSL A;  1ZBL A;  1I3A A;  1NGC A;  1Q9Y A;  1SKW A;  3OYI A;  1V4S A;  5F1X A;  3RMD A;  2E4L A;  4BDP A;  4CJT A;  3HTV A;  1JCF A;  5KPT A;  4OX9 K;  1JLB A;  4BY9 C;  3I33 A;  1YF5 L;  2A40 A;  3AVG A;  2GX9 A;  4N56 A;  2CGL A;  4K42 A;  3O80 A;  3S3M A;  3CHW A;  2V52 B;  4BRO A;  2AJQ A;  3KWG A;  1ZXO A;  3KK3 A;  2ZGZ A;  4FJJ A;  1VQ6 N;  5JLH A;  4F2R A;  3O9S A;  4KH6 A;  3HVR A;  3FZK A;  2J4R A;  1WOQ A;  2NRW A;  3ASM A;  4LFB K;  3CQY A;  2OZM A;  1T44 A;  4AM6 A;  3CCM N;  1NGD A;  3VQ6 A;  4F3T A;  1KVA A;  4AM7 A;  2O8D A;  3FZF A;  4DG1 A;  5KRT A;  1EET A;  3CIP A;  3PSI A;  1Y97 A;  3CCQ N;  4F9O A;  1CZ9 A;  3V9Z A;  1VQK N;  4OJR A;  1U04 A;  5J2Q A;  4B9N A;  1H1V A;  5KGW A;  4O8U A;  4A61 A;  4CF2 A;  3HM9 A;  5GAD P;  2NNW A;  1DKG D;  4B8A B;  2WUS A;  1BA1 A;  2VQE K;  3MEG A;  2W41 A;  3UKU B;  2Q97 A;  1FK9 A;  1IBK K;  4B1U B;  1VSM A;  4CHY A;  3KJV A;  5F2R A;  2D0B A;  3UKU A;  1TK8 A;  2DFE A;  1OH7 A;  2UU9 K;  2P9L B;  2NLX A;  4ELV A;  2FBY A;  2YNF A;  4OKE A;  3OS0 A;  4NCB A;  1IO2 A;  3AAR A;  3UKR A;  3ULD A;  3O4W A;  3VA3 A;  1VRU A;  4CZH A;  2ZM6 K;  2RPI A;  2Q31 A;  3G6E N;  2O8C B;  4IOC L;  1VRT A;  3CPW M;  2ZJQ L;  1DT9 A;  2YNH A;  4CFD A;  1VQL N;  2RE2 A;  3J80 O;  4DV0 K;  2IVO A;  2P9N A;  3Q7C A;  2FF3 B;  4DR2 K;  4DFM A;  1KD1 O;  4CZG A;  3A5N C;  1K73 O;  2PY5 A;  2OYQ A;  4O5F A;  2QXL A;  4LSL A;  3F73 A;  3L4Q A;  3K9J A;  4LY7 A;  4WFA L;  3FFI A;  3C65 A;  2ZGY A;  2VWJ A;  4ID1 A;  4FJG A;  3WUH A;  4WQ4 A;  1W97 L;  1YT3 A;  4M3T A;  2ZQB A;  4MQ3 A;  3SK3 A;  4O5B A;  2ZF5 O;  4CZE A;  3THX B;  1XI1 A;  4H03 B;  2QI2 A;  4GY2 B;  2A3Z A;  3OYN A;  2G8W A;  4CHP A;  1LAV A;  3HST B;  2HHX A;  3O9T A;  1RT4 A;  1N6Q A;  3WT0 A;  4U67 L;  2HHH K;  1XNQ K;  1T03 A;  4PUO A;  4CEQ A;  4CJF A;  3ISN C;  1XC3 A;  1RDD A;  3MX2 A;  4BRD A;  4IEE A;  4CEO A;  1RBT A;  4J8F A;  1K8K B;  1JCE A;  1J5O A;  1KLN A;  4DU1 A;  3AGK A;  3VEO A;  1TKD A;  4FVU A;  2GUI A;  3DRR A;  3TPQ A;  4CZK A;  3NH1 A;  2E8A A;  3S3O A;  5M1O A;  3TTC A;  3HSC A;  3HVT A;  4ELU A;  3CJ1 A;  3JXU A;  4IDH A;  4Z4H A;  3CCJ N;  1NGG A;  3O4Q A;  1BCM A;  4X66 K;  2RF2 A;  2F4V K;  3FR0 A;  4WQ5 C;  1WSF A;  2NRV A;  2JGU A;  1RT7 A;  3A5L C;  4DTX A;  5DM7 L;  2PBD A;  3P38 A;  4KH4 A;  3IMX A;  4LH4 A;  2G8I A;  4BQL A;  2X6N A;  3MEC A;  3THV A;  2D0A A;  4F3O A;  4ID5 A;  5AQO A;  3VGK A;  4XH4 A;  4JAX A;  3G0Z A;  3C0B A;  4IWV A;  4AF1 A;  4CGG A;  2BUP A;  3TAB A;  1IG9 A;  4V19 S;  1RTH A;  4H0V B;  4FJ9 A;  3H08 A;  1Z05 A;  3SZ2 A;  3AO4 A;  4B3M K;  3CCV N;  1N5Y A;  3A8Y A;  3G10 A;  4FOI A;  4B9L A;  2O8E A;  1NK7 A;  1KC8 O;  1OH8 A;  2YCH A;  2IOC A;  3PX4 A;  1SKS A;  1KFD A;  3DXK B;  3DLK A;  5BPN A;  3SV4 A;  3DJC A;  4YHH K;  1XNR K;  3CQ8 A;  4FW1 A;  2JLE A;  4OO1 J;  4CI6 A;  3HYF A;  4AH9 A;  2PAV A;  4GMJ B;  3O3H A;  4HWI A;  2NRT A;  3HRG A;  1W7A A;  1A5W A;  4BRI A;  4IDK A;  1IBL K;  4AHS A;  3EKU A;  3O9Q A;  1QE1 A;  3AVM A;  3PV8 A;  4CBU A;  2D0O A;  3SV3 A;  3QES A;  4FJM A;  4WYB A;  4B9S A;  4I2Q A;  1VK0 A;  2E2Q A;  3AVF A;  4MLH A;  3LPT A;  4FLU A;  1HR0 K;  1BL3 A;  3C94 A;  4W5N A;  2EHG A;  3S9H A;  5C10 A;  3KLI A;  4JKG A;  5J1E A;  3KLF A;  2VG6 A;  3T69 A;  3DLR A;  2Q2R A;  4FM1 A;  3OBW A;  2ZWH A;  5C25 A;  4H5T A;  1RT6 A;  1X9W A;  4CIE A;  4JI0 K;  4JI2 K;  5FRN A;  4M3R A;  5BRE A;  2P5G A;  3H46 O;  5FLX O;  4FWN A;  3SYZ A;  3QNO A;  1YIT N;  3VQC A;  4FWQ A;  1YHQ N;  2HHQ A;  3SAH A;  4H5N A;  3M8Q A;  4DR3 K;  2BDP A;  4Z4I A;  4BRF A;  1WSG A;  5I3U A;  4DB3 A;  3ZT2 A;  1BWF O;  1WAF A;  4XH5 A;  4YNQ A;  1NGE A;  3NDK A;  2UUB K;  1QZ5 A;  3VTI A;  4YOR A;  1KAX A;  3NGI A;  2GEM A;  1GLA G;  3NVK A;  2NZT A;  2HB5 A;  4JKC A;  3CCR N;  3OBY A;  3RVC A;  4DQQ A;  1C0F A;  1IKW A;  2P9I A;  5GIN A;  4CD1 A;  4CFC A;  4BWM A;  1U49 A;  1RT5 A;  3TSP A;  3VQQ A;  1S5J A;  3K5N A;  3CI5 A;  4OGC A;  5BN9 A;  1ZYQ A;  5EX5 A;  5CZ2 A;  2OCE A;  5LJW A;  5CZ1 A;  3KLE A;  1VSI A;  1EKE A;  4Z0U A;  1KAZ A;  3UB5 A;  2ITG A;  4CGD A;  3N4Q A;  3PO5 A;  1ATN A;  2WTU A;  4DS4 A;  3SJJ A;  5AZI A;  4BAC A;  1N36 K;  1A5X A;  4BG9 A;  3OYM A;  4CJR A;  1BUP A;  4JKD A;  2OPP A;  3ZET B;  1NBW A;  1KVC A;  1U2V A;  1NK0 A;  2D4W A;  4DLG A;  5SWM A;  1Z26 A;  1ZBI A;  4IJA A;  3NH0 A;  1OVQ A;  3Q7B A;  1QSS A;  3RSE B;  4MDB A;  1FKP A;  1DTQ A;  4CHO A;  1NK6 A;  2A5X A;  4FJH A;  3IRX A;  3AVC A;  4M41 A;  3AVJ A;  1SL0 A;  2P9S A;  3NH2 A;  4DSL A;  2P1J A;  4LF6 K;  5AQL A;  1YJN N;  1J6Z A;  3LZI A;  1NKC A;  2QKK A;  4N47 A;  3JS6 A;  1C6V A;  1BO5 O;  2IS3 A;  2KFZ A;  3P83 D;  3VQE A;  3ATU A;  2D0C A;  4FJ8 A;  1Z6R A;  1B9F A;  4E7H A;  3QIC A;  4W5Q A;  3VQD A;  3EL2 A;  3R3L A;  4RW7 A;  5JMV A;  1TKT A;  1NK4 A;  1ATR A;  1JLC A;  1LW0 A;  4DQ8 A;  3K5M A;  2HBM A;  2Z1H A;  4HTU A;  5KPR A;  4CEA A;  4CZI A;  1VSK A;  4IKF A;  5AQY A;  4CW7 B;  1UA0 A;  1TYQ B;  4X65 K;  1IKY A;  3L6Q A;  3SUN A;  2Q0R A;  1K6Y A;  4DMN A;  5CYM A;  1TYQ A;  3BGR A;  4E7I A;  2UUC K;  3LDO A;  4FWO A;  3RTV A;  1S72 N;  3J7A P;  3KZB A;  4EHU A;  2UXB K;  4HVJ A;  1X3M A;  2Q36 A;  5JVG L;  3K5O A;  1GLE G;  4B1Z A;  3MMV A;  2WON A;  1HYV A;  5ELZ A;  4OLA A;  1J9A A;  1JLG A;  3HOT A;  2O8B A;  5BPL A;  3M8R A;  1BOT O;  1R59 O;  1N8R O;  1Q81 O;  2CGJ A;  3IS9 A;  3RR8 A;  1NMN A;  4RW4 A;  3HOS A;  4DV1 K;  5IT9 O;  1VQN N;  5GAH P;  3BUZ B;  1QVF M;  5C2F A;  3ENO A;  1L3V A;  1HX1 A;  1NK5 A;  4PKH A;  2Q0U A;  3LP0 A;  3ZT3 A;  2PFU A;  1NMD A;  3OYL A;  3HPH A;  3ENB A;  2OTL N;  3ULE A;  3SLC A;  3CQX A;  4C8L A;  3HZ6 A;  3UE5 A;  1NGB A;  4B9U A;  4DTM A;  3R6M A;  4H5W A;  4CD3 A;  3QFU A;  3AVN A;  2HMP A;  4B3R K;  4FSV A;  3I56 N;  3OYF A;  3MXI A;  3C7N A;  4O4G A;  2GBZ A;  1RBR A;  3EE8 A;  3U3Y A;  3DRS A;  3O08 A;  1T3V A;  1QQM A;  3VOV A;  1P8Z A;  1JJ2 M;  4F8R A;  1Q7Y O;  4KTQ A;  1C1C A;  3SAG A;  3OY9 A;  3E01 A;  5JVH L;  4FLZ A;  3TAE A;  3WXJ A;  1ESV A;  1Y64 A;  2R7Y A;  3DOL A;  1O13 A;  3O3G A;  3OJS A;  1YUW A;  1VSF A;  5C15 A;  1NG9 A;  3QET A;  1VQP N;  4CBW A;  4CJE A;  4IFY A;  4H0Y B;  4UY8 O;  1Q86 O;  1D4X A;  3MED A;  3QEI A;  5JS2 A;  1ZBU A;  3BF1 A;  4JD2 A;  3SQ1 A;  2WFB A;  3SCX A;  4TSX A;  3MXM A;  4FVM A;  4OKK A;  1QQN A;  4J2B A;  4B3O A;  3O6W A;  5AJ3 K;  1KLM A;  2OA8 A;  2QWL A;  1JLF A;  1E4F T;  3H3N O;  3NF7 A;  1NGH A;  4CGH A;  5JIC A;  3PIP L;  3DWL A;  5AQV A;  3DLB A;  1DLO A;  4DQP A;  4DU4 A;  3DXM B;  5DK5 A;  4FWM A;  2FSN A;  1IH7 A;  3AV9 A;  4WCE L;  2DFF A;  1FKO A;  2GEL A;  4KKO A;  2WBN A;  3OYD A;  4DTS A;  1J54 A;  3E9O A;  5EY4 A;  4FWS A;  3DXM A;  3THW B;  1ZBS A;  4BRL A;  3JYT A;  1ZBH A;  4BE1 A;  3THY B;  3NBP A;  4A59 A;  3NAE A;  3V9S A;  2ASM A;  3H45 C;  1NOY A;  3EZW A;  4FWL A;  1VSD A;  4QS9 A;  2F9W A;  3CM6 A;  3THY A;  3B8A X;  1QQC A;  2KQ2 A;  2P9K A;  4BRM A;  4KPY A;  1OKJ A;  2YHW A;  3CJC A;  1X9J A;  4CJW A;  3C6U A;  4NCG A;  2UYT A;  3U6F A;  1S3X A;  4B8C A;  1N33 K;  3LDN A;  4L3Q A;  4JI8 K;  3VGL A;  1HKB A;  3GOI A;  1TKX A;  4ISF A;  3ITH A;  4CFA A;  3ZT4 A;  3DOK A;  1WSI A;  4BRP A;  3BDP A;  4JI7 K;  3VA0 A;  3ZX2 A;  3HP6 A;  1W2B M;  3DMJ A;  2KFN A;  4FXD A;  4IOA L;  4E1J A;  1HNW K;  2W6L A;  1RGI A;  4O55 A;  3P4I A;  4FZZ A;  1JLA A;  2DFH A;  1EXQ A;  4DV4 K;  3NGZ A;  1ZBF A;  3PSF A;  5FDL A;  3G4S N;  3BP8 A;  4FJX A;  3KTQ A;  2FSK A;  4YDU C;  3M8S A;  5TKW A;  5AQM A;  5AZJ B;  1C0G A;  1HRH A;  5FPM A;  2F7T A;  3CFO A;  1D5A A;  4H0P A;  5BRH A;  1D9D A;  2HW3 A;  4W5O A;  5LMU K;  1E4G T;  2E6M A;  4BRN A;  5HL7 L;  4DF8 A;  1SAZ A;  3L8B A;  3OJU A;  5AQF A;  3DXK A;  4FLY A;  5CY4 A;  3LZJ A;  2H3G X;  3CJB A;  1TUY A;  1L3S A;  1WNS A;  4FLW A;  1LCU A;  2XY7 A;  3TAG A;  4CFB A;  4GNI A;  3GL1 A;  1YJW N;  4K0K K;  2P5O A;  3KK1 A;  4ZTF A;  3HL8 A;  1RDA A;  3FE1 A;  3RRH A;  3VGM A;  1WUA A;  4B3T K;  4JKH A;  3ALY A;  2YHX A;  5ADX H;  4B3S K;  3QDK A;  1J5E K;  2HNY A;  4LF9 K;  1LOT B;  1MWK A;  4XEI A;  5CHI A;  4FLT A;  4LF7 K;  3O4N A;  4KTW A;  4JYA K;  5FPE A;  1BQN A;  1WAJ A;  3L3V A;  2UXC K;  5BRF A;  4DFP A;  5DM6 L;  1ASV A;  4ZHR A;  4Q0B A;  1BG3 A;  4RW8 A;  2W42 A;  2OPS A;  4YOX A;  3SQ4 A;  2LSN A;  3CF5 L;  1FJG K;  1ITG A;  4KFB A;  3D2E A;  2QTD A;  3QLH A;  4YY3 K;  2W6K A;  4IG0 A;  2Q1N A;  3VF2 A;  2BE2 A;  4MLE A;  5AQH A;  4N76 A;  5FRM A;  3D2E B;  4FLX A;  4PWD A;  1VQ4 N;  2OAN A;  3HPG A;  5FPD A;  5HRO A;  3CER A;  1O1W A;  1IV0 A;  3V1R A;  3C6H A;  3R8E A;  2P9P A;  4LF4 K;  2ZE2 A;  5DMR A;  1RT3 A;  5M1Q A;  3FZH A;  4X64 K;  3FZL A;  1YI2 N;  3QER A;  4DFJ A;  1W9H A;  3DLE A;  1RDU A;  4CF1 A;  5M1F A;  5AQR A;  4AHC A;  4KHU A;  3L2Q A;  3KHY A;  1SKR A;  4BGA A;  5M1N A;  4DUZ K;  1SZ2 A;  1QZ6 A;  1S1V A;  3AVI A;  2JWK A;  5AQS A;  3SQ0 A;  2HHW A;  2VWB A;  5HBM A;  2FC0 A;  1HNI A;  5C12 A;  2HBL A;  3NF9 A;  3OYB A;  5F0X A;  1RFQ A;  4H5R A;  1L3U A;  1NNE A;  4GV9 A;  4DTP A;  3QFP A;  4EP4 A;  4CK1 A;  3K2P A;  3OYE A;  3J81 O;  1X1P A;  2QWP A;  1TL1 A;  3OYJ A;  1HKG A;  2QA4 N;  2W40 A;  3DI6 A;  5GAG P;  4FW2 A;  3K58 A;  1KRP A;  3IUC A;  4LC9 B;  2YV0 X;  3RR7 A;  5ADX A;  5CYQ A;  1B92 A;  4JHD A;  4OPJ A;  2IAJ A;  4GVE A;  3VQ7 A;  1BIZ A;  1YJ9 N;  4DQS A;  2QXF A;  3U4L A;  2IGI A;  4CZF A;  2F8S A;  3IKM A;  3K59 A;  1GLF O;  4CF8 A;  3EZ5 A;  3L3U A;  1XHX A;  4DR5 K;  4FJI A;  1RNH A;  4U7B A;  4IXC A;  4KO0 A;  4QS7 A;  4C8M A;  4KI4 A;  1UA1 A;  1OH5 A;  1C0U A;  5AQI A;  3E9P A;  2Z1G A;  1WSE A;  3K5L A;  3VQ9 A;  2HF3 A;  4GVM A;  5LJV A;  3OS1 A;  1ZC6 A;  3MWP A;  4BRH A;  2Y1J A;  4DR4 K;  4GV3 A;  2RKI A;  1HYS A;  1C1B A;  2NRZ A;  4A2B A;  4QS8 A;  3ZCM A;  4B1Y B;  3LAK A;  5AQX A;  2B5J A;  3SUQ A;  2E5L K;  3QIP A;  1QVG M;  2YNI A;  1MWM A;  3CET A;  1KXP A;  3OYH A;  4NXN K;  3ZSO A;  2QWN A;  2VG5 A;  4DV2 K;  5AQG A;  4PKG A;  3DYA A;  1TVR A;  2GWJ A;  2XO7 A;  3I8D A;  1VSH A;  2GUP A;  3L4I A;  4BE2 A;  4FM0 A;  4CIG A;  3AA5 X;  1ASW A;  2A41 A;  4YOU A;  1M90 O;  1NGI A;  4BR4 A;  1BCO A;  1C0M A;  2Z1J A;  3D2F B;  5KRS A;  4BRA A;  1BU6 O;  4ISE A;  4IFV A;  3SBT A;  1VSE A;  2YHA A;  5BPM A;  4DQI A;  4M3Z A;  4KRF A;  3A5O C;  3VQA A;  2X78 A;  4BDY A;  4O44 A;  1EWQ A;  3NCI A;  1GOA A;  3KKS A;  3SUP A;  3DRP A;  3CFP A;  4AIL C;  2IVP A;  2YJE A;  1JKH A;  5GIO A;  1HQE A;  4CK2 A;  3B6P A;  4I6M B;  2HVH A;  5T7B A;  3G71 N;  2V51 B;  3R9P A;  3MN7 A;  5J2M A;  2G8K A;  1RDW X;  2YJF A;  3L2U A;  3NFA A;  4H5V A;  1SV5 A;  5K14 A;  4IG3 A;  4BRG A;  3WEE B;  3AO1 A;  5HRP A;  1M1K O;  4Y0W A;  4FOE A;  1HKC A;  2HOE A;  5JLF A;  5EVZ A;  4BRE A;  2OPQ A;  2FBX A;  4ILJ A;  5AQU A;  3VEY A;  3B6O A;  4PL8 A;  3C6T A;  2NRH A;  3IFR A;  5AQZ A;  2PYL A;  5HOO A;  3OW2 M;  4JKF A;  2DTU A;  2I7P A;  3L0Q A;  1W0H A;  1QHA A;  4W5T A;  1X9M A;  1WBB A;  4CGF A;  3J7Z O;  3PO4 A;  1S6Q A;  1XQS C;  1OH6 A;  4JD2 B;  3QB0 A;  3T3F A;  1JXE A;  1X9S A;  4Z94 A;  1T05 A;  4W5R A;  1DGK N;  2EX3 A;  3U9D A;  4K8X A;  4H0X B;  2E1Z A;  2VQF K;  1VAZ A;  2F8T A;  4FCY A;  3BEX A;  4E89 A;  1T7P A;  1HMV A;  5SZT A;  1RT1 A;  3VMF B;  3LDP A;  4YOY A;  1RDC A;  3U8X A;  4F2S A;  3VQ5 A;  4E7J A;  2FBT A;  3JAM O;  4K8Z A;  1XWL A;  2XHB A;  4CJS A;  5IWA K;  3K9K A;  2HMI A;  5H1S Q;  3KWI A;  1RTD A;  1C1A A;  3I0R A;  1JLQ A;  4A5A A;  4BWJ A;  4CE9 A;  1BQM A;  1LAW A;  4H0O A;  2KZM A;  1IKV A;  4LFA K;  2OTJ N;  5AR0 A;  2PYJ A;  3CCE N;  4I9Q A;  5LL6 Z;  3AO2 A;  2G8V A;  3VPZ A;  2HVI A;  2VGN A;  2YHY A;  3LP2 A;  3AO3 A;  1HNZ K;  2O4I A;  1CZB A;  1QSY A;  4H4M A;  4AHR A;  3U3G A;  3HO1 A;  3HP9 A;  2QWO A;  4IBN A;  3CCL N;  2QWQ A;  4I9L A;  5J2N A;  4MO4 A;  1BA0 A;  1LWF A;  3G25 A;  1HPM A;  1HYZ A;  3MN9 A;  1NKB A;  4DQR A;  1YVN A;  1U2V B;  3QEP A;  3FGU A;  4E7L A;  2G8H A;  4E0D A;  4J2E A;  1S9E A;  3NGY A;  3T19 A;  1VQM N;  3C6A A;  1G99 A;  5E84 A;  5GIP A;  4M42 A;  4FK0 A;  2RN2 A;  4NB4 A;  4KHY A;  3ZT0 A;  3VEX A;  1KQS M;  1JLE A;  4BC4 A;  4KH5 A;  4O8K A;  4CBX A;  3M5R A;  4A62 A;  1P90 A;  3TTD A;  2KTQ A;  4IO8 A;  3MN5 A;  2HHS A;  4FZY A;  2O4G A;  3FFK B;  4FK2 A;  1LWC A;  4DTU A;  4JV5 K;  2F96 A;  2FXU A;  2P9S B;  4IOX A;  3ZSX A;  3MXJ A;  2ZJP L;  4C8K A;  4FWK A;  3TTF A;  4FZX C;  3LWM A;  2YNG A;  4DSJ A;  1HUX A;  2OZS A;  4FJ5 A;  4CGI A;  4H4O A;  3I55 N;  4CJ4 A;  1VSJ A;  4IEI A;  4QCL A;  1UOC A;  4NO7 A;  4JI4 K;  4DLE A;  3P31 A;  1FW6 A;  1RBV A;  4CZL A;  4B9T A;  1TK0 A;  1MDU B;  4DKW A;  5KGX A;  2I5J A;  1UAX A;  1YAG A;  3LAN A;  4J2A A;  4CGJ A;  4FL9 A;  3OYA A;  3LPU A;  4JKB A;  1TGO A;  3MEE A;  3CM5 A;  2D0P A;  3TWH A;  2E2O A;  4C23 A;  4IFE A;  4DF4 A;  1BIU A;  1Z25 A;  3FZM A;  3PIO L;  2DY4 A;  4CJK A;  3VQ4 A;  4XIU A;  4EZ6 A;  4CJ5 A;  5AQT A;  4YOT A;  1VQ7 N;  4CZM A;  4CHN A;  3CYM A;  2HST A;  4JLH A;  3VQ8 A;  4C1N I;  3OS2 A;  1GLB G;  2DPN A;  5TKY A;  3SBG A;  1IJJ A;  1NM1 A;  4RG8 A;  1QHT A;  4I7F A;  5C0Y A;  4OPH A;  3VTH A;  1WLJ A;  2IC3 A;  4IJN A;  4DR7 K;  3WXL A;  3ZLJ A;  3P39 A;  1VQ9 N;  3DLG A;  4Q5V A;  4EAH D;  4JK8 A;  4C8N A;  1K9M O;  4BR2 A;  4RWT A;  5KPZ A;  3NF8 A;  3SPY A;  3V81 A;  4DV7 K;  2BAN A;  2VG7 A;  3BZK A;  2VCP A;  5J2P A;  2AP1 A;  3S41 A;  3UKR B;  4DSI A;  3AY9 A;  2KZZ A;  4FJL A;  4M63 C;  3LP3 A;  1RTI A;  3MX5 A;  2IDO A;  2KLA A;  3TR8 A;  1SS6 A;  3EYZ A;  3DLL L;  3CD6 N;  3A2F A;  4FO0 A;  3LAL A;  3U9Z A;  3ZEU A;  4DTO A;  3ZYY X;  3AVL A;  5AQQ A;  1JXB A;  3VEZ A;  2O8C A;  3T1A A;  5BRD A;  5HLF A;  3ID8 A;  3CC7 N;  1G15 A;  2V7Z A;  4CJP A;  2X74 A;  4JNE A;  4O0I A;  3C7N B;  1KTQ A;  3JSM A;  2D5R A;  1T8E A;  2QW9 A;  4JRP A;  4G9Z A;  5C2D A;  4WE1 A;  4RTF D;  4RW9 A;  1S1W A;  1HNX K;  3ZX3 A;  3WNF A;  3SI6 A;  4DTJ A;  4DR1 K;  3RMA A;  1WSJ A;  4FLV A;  1YXQ A;  4NYF A;  3OHR A;  1CLQ A;  3SNN A;  1NKE A;  3M8P A;  1E3M A;  4CJQ A;  3THX A;  4EHT A;  1TK5 A;  4LH5 A;  3KVG A;  1VQ8 N;  3K0S A;  4CEE A;  3KD1 E;  2QK9 A;  3QBX A;  3AGR A;  4BR7 A;  3KD5 E;  1SL2 A;  4DSE A;  4BDZ A;  5A2Q O;  4CES A;  3LP1 A;  3MCA B;  4OVL A;  2D1K A;  3TAN A;  3QIN A;  4BQZ A;  4JRQ A;  1UWB A;  5HRS A;  1K8K A;  5GAE P;  1LW2 A;  3H1V X;  4JKA A;  3HK2 A;  4DFK A;  5CE3 A;  3ZX0 A;  3DM2 A;  3SMS A;  4N41 A;  1CXQ A;  3VQP A;  2P9K B;  2A1R A;  1S22 A;  4EFH A;  4HUG A;  2IVN A;  3L2W A;  1EQY A;  2UUA K;  4Y1D A;  3CFR A;  4AQY K;  5BR9 A;  2KW4 A;  3F5T A;  3CME N;  2QWM A;  3O8M A;  4CJ7 A;  3E9L A;  4KHP K;  4Z4C A;  4CVN E;  3D45 A;  2Q3S A;  4LD0 A;  1Q9X A;  4KRE A;  3E66 A;  4H8K A;  3OVN A;  3CPE A;  3VEW A;  4LF8 K;  3VN5 A;  3WQU A;  3VEN A;  4CED A;  3F9M A;  3EN9 A;  3OTO K;  1QTM A;  3HBT A;  4OGE A;  2NRR A;  3ENH A;  1HQU A;  3AA2 A;  3AA4 A;  4R79 A;  4FK4 A;  3CC2 N;  4M7Y A;  4A57 A;  2O8E B;  3M6G A;  2QKB A;  4MO5 A;  2Z1I A;  4FWR A;  2BGG A;  3QEV A;  4DSF A;  1TV6 A;  1WB9 A;  1D9F A;  1HLU A;  1S1X A;  4KB1 A;  3V1O A;  4KV8 A;  3K57 A;  3AA3 A;  1EWR A;  4CJ3 A;  3RMC A;  3L2V A;  4JEP A;  3E1Y A;  5I42 A;  4OLB A;  4JI5 K;  5I9E B;  3LDL A;  2CH5 A;  1NLV A;  3MCP A;  3WEE A;  2B6A A;  4CHQ A;  2XY8 A;  4WQ5 A;  3T1Y K;  4QAG A;  4DS5 A;  1RDB A;  2ZD1 A;  3ZSY A;  5FPN A;  1GLC G;  2HND A;  4DHY A;  3PX6 A;  1NK8 A;  1BHL A;  2A6A A;  1T6D A;  4Z4E A;  3KK2 A;  3TAP A;  1DTT A;  1TL3 A;  4IZ9 A;  1REV A;  4DR6 K;  3CCS N;  3MAQ A;  1TAQ A;  4DSK A;  4EP5 A;  1DEJ A;  2G8U A;  2Y1I A;  2V7Y A;  3ZT1 A;  4RW6 A;  3ZSR A;  3BZC A;  4PL7 A;  3CC4 N;  1GLJ O;  4JKG B;  3HPO A;  3O1W A;  1QSL A;  1GOC A;  3ZSQ A;  2YKM A;  3CMA N;  1U48 A;  2UXD K;  4IO9 L;  1KFS A;  4DU3 A;  3QEX A;  4JK7 A;  4C8O A;  4M3X A;  1U4B A;  1Q8I A;  1NK9 A;  4BC3 A;  3IAY A;  3M3Z A;  1K8A O;  3EY1 A;  4X62 K;  2QWR A;  4ILH A;  4B9Q A;  4HUF A;  4NYN A;  4YOV A;  1NJY A;  3PUF A;  3QBW A;  2O8D B;  3TAF A;  3WXK A;  4FJK A;  1IG8 A;  3SUO A;  4N5S A;  3F9K A;  1NGF A;  3TU5 A;  2BH1 A;  4KHQ A;  3J8A A;  3EE9 A;  4DTN A;  2P9P B;  1Q18 A;  1RT2 A;  3DLH A;  4ICL A;  4CIF A;  2BTF A;  1BI4 A;  4KBO A;  2VYP A;  5AZI B;  4C1N K;  2E88 A;  4CJU A;  4WF9 L;  3L2R A;  1U6Z A;  4AHV A;  2XY6 A;  3LM2 A;  3LDQ A;  1BI4 B;  3TAQ A;  4GKK K;  1CZA N;  4CER A;  5AFU H;  1LWE A;  1LV5 A;  1KAY A;  3GE1 A;  1L3T A;  3AVH A;  3QIO A;  5C24 A;  1U47 A;  4DWI A;  4KB0 A;  3PX0 A;  3J7Y P;  2B4J A;  1R0A A;  4B08 A;  2P9L A;  1GLD G;  4JI1 K;  1WSH A;  5CR4 A;  3ZET A;  3RRG A;  4EIA A;  1NWK A;  3VES A;  1C0T A;  1S1U A;  5KQ8 A;  2E2P A;  4DV5 K;  4JI6 K;  4ELT A;  3CG7 A;  2E1Y A;  3WXM B;  3F2K A;  4FPB A;  2E20 A;  3MN6 A;  3KKR A;  2P9N B;  2YX6 A;  4GKJ K;  2GWK A;  4CJV A;  3ZSZ A;  3QEW A;  3WNH A;  4NLC A;  1EX4 A;  3SAF A;  1KVB A;  2KHO A;  2E2N A;  4XH1 A;  3WNG A;  2YHB A;  1XHZ A;  3MDQ A;  3CJA A;  3V6D A;  5KQD A;  4JS4 A;  3N4P A;  5M1P A;  3NVM A;  1Q82 O;  1YIJ N;  2CH6 A;  5D3G A;  4PQU A;  5AQK A;  4CF9 A;  4CCH A;  3EKS A;  4PKI A;  3HM8 A;  3S3N A;  1HNV A;  4OPA A;  3A0I X;  1RBS A;  4YOW A;  2RHK A;  3CCU N;  1KSP A;  1XMO K;  1D8Y A;  1JL2 A;  4FPA A;  2KKZ A;  4JHD B;  4JKE A;  4HCB A;  3I8B A;  3QNN A;  2ASP A;  4M3W A;  4K41 A;  1N32 K;  5C42 A;  2HHT A;  3LL3 A;  4BVP A;  3GDQ A;  3M1F A;  3T7Z A;  1I94 K;  1TKZ A;  3RMB A;  5AQP A;  4G1Q A;  1BGX T;  1XUP O;  4FYD A;  3P5J A;  1NGA A;  1L5U A;  1F21 A;  1I39 A;  3MWT A;  2O8B B;  1QS4 A;  3AVB A;  4ISG A;  4LSN A;  1BIS A;  3O9U A;  2CGK A;  3OA9 A;  2FLO A;  4FM2 A;  3TSU A;  3VEV A;  4LFC K;  5KI6 A;  3VF4 A;  1VHX A;  3DAW A;  3UIQ A;  1CXU A;  5E26 A;  5MLC Q;  3CJ9 A;  3R1X A;  4CK3 A;  4EZ9 A;  3LWL A;  4MFB A;  4DUY K;  5B8H A;  3H6E A;  3LAM A;  5EU7 A;  4JS5 A;  1IBM K;  2HBK A;  4KHS A;  3RWU A;  1N34 K;  4YDU A;  3ULE B;  3KK7 A;  1NJW A;  2P51 A;  4BR0 A;  1RTJ A;  4PHT X;  4CF0 A;  3D6R A;  5HRN A;  1YVU A;  5E41 A;  1NJX A;  4M3U A;  4DV6 K;  1HJR A;  3O5B A;  5EOY A;  1YTU A;  2NRX A;  3T1H K;  3AVA A;  3WXI A;  3ZSW A;  1NOZ A;  4RCH A;  3D2F A;  4NLB A;  1X3N A;  3HJF A;  3TI0 A;  4BC5 A;  3QO9 A;  3NE6 A;  4BRK A;  2JWL A;  4I6M A;  2QEX N;  3D7E O;  2WOM A;  1U45 A;  1VQ5 N;  3ZEU B;  4Y1C A;  1ILY A;  3MK6 A;  1EO1 A;  1GLL O;  2X6S A;  2WC9 A;  4BG8 A;  2GV9 A;  1VQO N;  1NU0 A;  4HUE A;  1YTA A;  4M7X A;  3TAM A;  3I0S A;  2NUB A;  4JK9 A;  4B1X B;  4UQG A;  3OYC A;  2OPR A;  5AQJ A;  1MA9 B;  4E19 A;  3O9R A;  2GTD A;  4BRQ A;  3A5M C;  2A1S A;  2HNZ A;  2QM1 A;  3SQ2 A;  4O0J A;  1OVY A;  3H1Q A;  3AAP A;  3V9W A;  4NXM K;  3KIO A;  5LY3 A;  1ATS A;  4M3Y A;  4CZJ A;  3V4I A;  4B9V A;  3LDS A;  1BDG A;  2YI1 A;  4B9M A;  5FRO A;  3TSQ A;  2XY5 A;  3PY8 A;  4YFU A;  3C95 A;  1TUU A;  1T6C A;  4DCH A;  1SQK A;  1NGJ A;  4JI3 K;  4LF5 K;  4A5B A;  3HI0 A;  2ATQ A;  2IIR A;  4KHN A;  2AA4 A; 
#chains in the Genus database with same CATH homology
 3L2Q A;  1RBU A;  3NF6 A;  4PY5 A;  4E1M A;  4CJP A;  2X74 A;  4PA1 A;  4O0I A;  3WNE A;  4HHT A;  4KTZ A;  4DQQ A;  1IKW A;  1SKR A;  3IG1 A;  2XRI A;  5JS1 A;  1KTQ A;  1XC9 A;  3KLG A;  2D5R A;  4CFC A;  3JSM A;  4JRP A;  1T8E A;  1A5V A;  4KI6 A;  4BWM A;  1U49 A;  1RT5 A;  1S1V A;  3AVI A;  1ASU A;  4WE1 A;  3VQQ A;  1S5J A;  3K5N A;  4RW9 A;  4OGC A;  1ZYQ A;  4HCC A;  5CZ2 A;  1S1W A;  1S9G A;  3SQ0 A;  3WNF A;  2HHW A;  5CZ1 A;  5HBM A;  3SI6 A;  4Z4G A;  2FC0 A;  4DTJ A;  3KLE A;  1B9D A;  1EKE A;  1HNI A;  1VSI A;  4Z0U A;  4BE0 A;  3RMA A;  3NF9 A;  4M45 A;  1WSJ A;  3OYB A;  4FLV A;  1L3U A;  4L8R B;  3OYG A;  4NYF A;  4R5P A;  2ITG A;  4DTP A;  4EP4 A;  4CEC A;  1CLQ A;  4CGD A;  1SUQ A;  3VQB A;  4CK1 A;  3PO5 A;  3SNN A;  1NKE A;  4KAZ A;  3M8P A;  3K2P A;  4DS4 A;  4CJQ A;  3SJJ A;  1TK5 A;  4BAC A;  1GOB A;  3OYE A;  1X1P A;  4LH5 A;  1A5X A;  1RIL A;  3OYM A;  4CJR A;  3KD1 E;  4CEE A;  2OPP A;  3V9U A;  1TL1 A;  4ZTJ A;  1KVC A;  3OYJ A;  1NK0 A;  2QK9 A;  4DLG A;  3KD5 E;  3DI6 A;  5SWM A;  4FW2 A;  1Z26 A;  3K58 A;  1ZBI A;  1SL2 A;  3NH0 A;  4DSE A;  1KRP A;  2HHU A;  2G8F A;  2YV0 X;  3P1G A;  1EP4 A;  1RCH A;  3LP1 A;  4CES A;  4BDZ A;  5CYQ A;  3RR7 A;  2VWK A;  1B92 A;  1IKX A;  4OVL A;  4CEZ A;  4OPJ A;  3TAN A;  2IAJ A;  3QIN A;  3VQ7 A;  1QSS A;  1BIZ A;  1FKP A;  4JRQ A;  1DTQ A;  1UWB A;  4CHO A;  5HRS A;  4DQS A;  2QXF A;  1NK6 A;  4FJH A;  4FJ7 A;  1LW2 A;  2IGI A;  3IRX A;  4F4K A;  2F8S A;  3AVC A;  1TAU A;  3K59 A;  4M41 A;  3AVJ A;  4CF8 A;  3L3U A;  3EZ5 A;  4DFK A;  1SL0 A;  3HK2 A;  3NH2 A;  1XHX A;  4FJI A;  1RNH A;  3DM2 A;  1WN7 A;  2P1J A;  3V9X A;  4DSL A;  4N41 A;  1CXQ A;  2YKN A;  5HRR A;  4KO0 A;  4C8M A;  3VQP A;  2E6L A;  3NHG A;  4KI4 A;  1UA1 A;  2A1R A;  3V1Q A;  3O3F A;  4HUG A;  3L2W A;  2ETJ A;  4QOZ B;  3LZI A;  1C0U A;  1NKC A;  2QKK A;  4N47 A;  4Z4F A;  1C6V A;  4E7K A;  2IS3 A;  4Y1D A;  3CFR A;  4J2D A;  2Z1G A;  1S1T A;  1KCF A;  1WSE A;  3P83 D;  3VQ9 A;  3VQE A;  2KW4 A;  4OPK A;  3K5L A;  4AHU A;  4GVM A;  2D0C A;  3ZSV A;  4FJ8 A;  3OS1 A;  2Y1J A;  4Z4C A;  5HP1 A;  3D45 A;  1B9F A;  5KTQ A;  4E7H A;  4GW6 A;  2Q3S A;  2RKI A;  2HHV A;  4LD0 A;  1Q9X A;  2FBV A;  1HYS A;  4KRE A;  3TAR A;  1C1B A;  4W5Q A;  4H8K A;  3OVN A;  3AVK A;  3VQD A;  4RW7 A;  3HT3 A;  4CJL A;  1TKT A;  3HXM A;  1NK4 A;  3ZCM A;  3OYK A;  3LAK A;  3D0P A;  1JL1 A;  3VN5 A;  1JLC A;  4CED A;  2B5J A;  1LW0 A;  4CHZ A;  3K5M A;  3AO5 A;  4NCB A;  4AHT A;  1QTM A;  4OGE A;  3SUQ A;  2Z1H A;  3SPZ A;  4FJN A;  4HTU A;  3QIP A;  4FK4 A;  1HQU A;  3AA2 A;  3AA4 A;  4CEF A;  4CEB A;  4CEA A;  2YNI A;  1VSK A;  3OYH A;  3KLH A;  4NCA A;  1SL1 A;  4DTR A;  2QKB A;  4IKF A;  2Z1I A;  3ZSO A;  1J53 A;  1UA0 A;  4KHW A;  1MU2 A;  2BGG A;  2VG5 A;  1FXX A;  4E3S A;  3QEV A;  4I2P A;  4DSF A;  1TV6 A;  1IKY A;  3DYA A;  1TVR A;  4OKJ A;  3SUN A;  1D9F A;  2PZS A;  1K6Y A;  4DMN A;  1NJZ A;  1HPZ A;  2XO7 A;  1VSH A;  3I8D A;  4E1N A;  5CYM A;  1S1X A;  4BE2 A;  4KB1 A;  3V1O A;  1S6P A;  1VSL A;  4KV8 A;  3AA3 A;  4CIG A;  3AA5 X;  3K57 A;  1ASW A;  4FM0 A;  1ZBL A;  3BGR A;  1I3A A;  4CJ3 A;  1Q9Y A;  3RMC A;  3L2V A;  3OYI A;  4E7I A;  1SKW A;  3RTV A;  1BCO A;  1C0M A;  2Z1J A;  5KRS A;  3RMD A;  2E4L A;  4BDP A;  4CJT A;  1JLB A;  4HVJ A;  5I42 A;  4IFV A;  4OLB A;  3K5O A;  2WON A;  3AVG A;  1VSE A;  4N56 A;  1HYV A;  2B6A A;  2YHA A;  4CHQ A;  1J9A A;  2XY8 A;  4OLA A;  1JLG A;  4DQI A;  4M3Z A;  4KRF A;  3S3M A;  3VQA A;  2X78 A;  4BDY A;  4O44 A;  3M8R A;  4QAG A;  3NCI A;  4DS5 A;  1RDB A;  2ZD1 A;  1GOA A;  3ZSY A;  2AJQ A;  3KKS A;  3SUP A;  2HND A;  3DRP A;  3CFP A;  3IS9 A;  4AIL C;  3KK3 A;  3RR8 A;  4FJJ A;  4RW4 A;  3PX6 A;  1JKH A;  1NK8 A;  1BHL A;  1HQE A;  4F2R A;  4CK2 A;  3B6P A;  2HVH A;  4Z4E A;  3HVR A;  3KK2 A;  5T7B A;  1L3V A;  3TAP A;  1NK5 A;  1DTT A;  5J2M A;  3ASM A;  2G8K A;  1TL3 A;  3L2U A;  1REV A;  3NFA A;  3LP0 A;  3ZT3 A;  1SV5 A;  2OZM A;  3MAQ A;  1TAQ A;  3OYL A;  5K14 A;  4DSK A;  4IG3 A;  3VQ6 A;  3AO1 A;  4EP5 A;  1KVA A;  3HPH A;  5HRP A;  2Y1I A;  2G8U A;  4F3T A;  3ZT1 A;  4C8L A;  4RW6 A;  3ZSR A;  4DG1 A;  5KRT A;  3HPO A;  1EET A;  1Y97 A;  2FBX A;  2OPQ A;  1QSL A;  1GOC A;  3ZSQ A;  1CZ9 A;  3B6O A;  2YKM A;  2PYL A;  3C6T A;  3V9Z A;  4OJR A;  1U48 A;  4B9U A;  1U04 A;  5J2Q A;  4DTM A;  4B9N A;  2DTU A;  5KGW A;  1W0H A;  4DU3 A;  1KFS A;  2KFZ A;  4W5T A;  4CF2 A;  1X9M A;  3HM9 A;  3QEX A;  4C8O A;  4M3X A;  4CGF A;  3AVN A;  1U4B A;  1Q8I A;  3PO4 A;  4B8A B;  3OYF A;  1NK9 A;  1S6Q A;  3IAY A;  3MXI A;  3EY1 A;  3T3F A;  3MEG A;  1JXE A;  4O4G A;  2GBZ A;  1RBR A;  3U3Y A;  3DRS A;  1X9S A;  1T05 A;  1FK9 A;  4NYN A;  4HUF A;  4W5R A;  1NJY A;  3PUF A;  3TAF A;  1VSM A;  2EX3 A;  4CHY A;  3KJV A;  4K8X A;  2D0B A;  4F8R A;  4KTQ A;  1C1C A;  4FJK A;  1TK8 A;  2DFE A;  3OY9 A;  3SUO A;  3E01 A;  4N5S A;  3F9K A;  4FLZ A;  3TAE A;  4ELV A;  2F8T A;  4KHQ A;  4FCY A;  2R7Y A;  4DTN A;  1RT2 A;  3DOL A;  4E89 A;  3O3G A;  3OJS A;  1T7P A;  1HMV A;  5SZT A;  2FBY A;  1VSF A;  2YNF A;  1RT1 A;  4ICL A;  4OKE A;  3OS0 A;  3DLH A;  1IO2 A;  3QET A;  4CIF A;  3ULD A;  1BI4 A;  3VA3 A;  1VRU A;  4CJE A;  4IFY A;  1RDC A;  2RPI A;  3MED A;  3QEI A;  1VRT A;  1ZBU A;  5JS2 A;  3SQ1 A;  4F2S A;  4CJU A;  3SCX A;  3VQ5 A;  2YNH A;  2FBT A;  4TSX A;  4AHV A;  3L2R A;  4E7J A;  2XY6 A;  4FVM A;  3MXM A;  1BI4 B;  1XWL A;  4OKK A;  4CFD A;  2XHB A;  4K8Z A;  3TAQ A;  4CJS A;  4J2B A;  4B3O A;  4CER A;  1KLM A;  2HMI A;  2OA8 A;  1LWE A;  1LV5 A;  1JLF A;  3NF7 A;  1RTD A;  4CGH A;  1L3T A;  1C1A A;  4DFM A;  3I0R A;  1JLQ A;  3AVH A;  3QIO A;  5C24 A;  1U47 A;  4DWI A;  4BWJ A;  4CE9 A;  3DLB A;  1DLO A;  3PX0 A;  2PY5 A;  4DQP A;  2B4J A;  4DU4 A;  1BQM A;  1LAW A;  1R0A A;  4B08 A;  2OYQ A;  2KZM A;  1IKV A;  4LSL A;  3F73 A;  1WSH A;  4LY7 A;  2PYJ A;  5DK5 A;  3FFI A;  4I9Q A;  1IH7 A;  3AO2 A;  3AV9 A;  2VWJ A;  4ID1 A;  2G8V A;  3RRG A;  4FJG A;  2DFF A;  2HVI A;  1C0T A;  1FKO A;  1S1U A;  4KKO A;  2O4I A;  3OYD A;  3LP2 A;  3AO3 A;  1YT3 A;  4DTS A;  1J54 A;  4ELT A;  1CZB A;  1QSY A;  4H4M A;  4M3T A;  2ZQB A;  3CG7 A;  4MQ3 A;  4AHR A;  3JYT A;  4O5B A;  3U3G A;  1ZBH A;  3HP9 A;  3HO1 A;  4IBN A;  4I9L A;  3KKR A;  5J2N A;  1XI1 A;  4BE1 A;  4CJV A;  1LWF A;  3ZSZ A;  3QEW A;  1HYZ A;  1NKB A;  3OYN A;  3NBP A;  2G8W A;  3WNH A;  3NAE A;  4DQR A;  3V9S A;  4CHP A;  1EX4 A;  1NOY A;  1KVB A;  1LAV A;  3HST B;  3QEP A;  2HHX A;  3WNG A;  1VSD A;  4E7L A;  1RT4 A;  1N6Q A;  2YHB A;  2G8H A;  1XHZ A;  3CM6 A;  1T03 A;  4E0D A;  4J2E A;  1QQC A;  1S9E A;  2KQ2 A;  3NGY A;  3T19 A;  4PUO A;  4CEQ A;  4KPY A;  4CJF A;  3ISN C;  1RDD A;  3V6D A;  4CEO A;  4JS4 A;  1RBT A;  4M42 A;  4CJW A;  3C6U A;  4NCG A;  1J5O A;  1KLN A;  4FK0 A;  3U6F A;  4DU1 A;  5D3G A;  4B8C A;  2RN2 A;  1TKD A;  2GUI A;  3DRR A;  4CF9 A;  4KHY A;  4PQU A;  3ZT0 A;  3NH1 A;  4CCH A;  3S3O A;  1TKX A;  3ITH A;  4CFA A;  3ZT4 A;  3DOK A;  1WSI A;  3S3N A;  1JLE A;  3BDP A;  1HNV A;  3VA0 A;  1RBS A;  1KSP A;  3HP6 A;  1D8Y A;  1JL2 A;  3DMJ A;  3HVT A;  2KFN A;  4ELU A;  4HCB A;  4FXD A;  4Z4H A;  2KTQ A;  3O4Q A;  2HHS A;  4O55 A;  4FZY A;  1BCM A;  2O4G A;  4FK2 A;  4FZZ A;  1LWC A;  1JLA A;  2RF2 A;  2DFH A;  1EXQ A;  4DTU A;  3NGZ A;  3QNN A;  2F96 A;  1ZBF A;  5FDL A;  4M3W A;  1WSF A;  3ZSX A;  3MXJ A;  4FJX A;  2JGU A;  1RT7 A;  5C42 A;  3KTQ A;  2HHT A;  4DTX A;  4C8K A;  4FZX C;  3M8S A;  3LWM A;  2YNG A;  4LH4 A;  2OZS A;  3THV A;  2X6N A;  3MEC A;  4CGI A;  4DSJ A;  4FJ5 A;  2G8I A;  4H4O A;  2D0A A;  4CJ4 A;  1TKZ A;  1VSJ A;  4ID5 A;  3RMB A;  4F3O A;  1HRH A;  4G1Q A;  3CFO A;  1BGX T;  1D5A A;  1D9D A;  4FYD A;  4QCL A;  2HW3 A;  4W5O A;  3P5J A;  1L5U A;  2E6M A;  1UOC A;  1F21 A;  3G0Z A;  4DF8 A;  1I39 A;  3L8B A;  4DLE A;  3OJU A;  4CGG A;  1QS4 A;  3AVB A;  3TAB A;  1IG9 A;  4LSN A;  4FLY A;  1RBV A;  1BIS A;  4B9T A;  1RTH A;  5CY4 A;  4FJ9 A;  3LZJ A;  3H08 A;  4FM2 A;  1TK0 A;  3SZ2 A;  5KI6 A;  5KGX A;  2I5J A;  1UAX A;  1L3S A;  3AO4 A;  1WNS A;  4FLW A;  3LAN A;  3UIQ A;  1CXU A;  4J2A A;  4CGJ A;  2XY7 A;  4CK3 A;  3OYA A;  1N5Y A;  3G10 A;  3LPU A;  3TAG A;  4EZ9 A;  1TGO A;  3LWL A;  4CFB A;  4MFB A;  3MEE A;  3CM5 A;  3TWH A;  3LAM A;  5EU7 A;  4JS5 A;  2P5O A;  4B9L A;  4KHS A;  3KK1 A;  4ZTF A;  3HL8 A;  1RDA A;  3RRH A;  1NK7 A;  3RWU A;  4DF4 A;  1BIU A;  1Z25 A;  1NJW A;  2P51 A;  1RTJ A;  2IOC A;  4CF0 A;  3PX4 A;  2DY4 A;  5HRN A;  1SKS A;  1KFD A;  3ALY A;  4CJK A;  3VQ4 A;  1YVU A;  3DLK A;  5E41 A;  4XIU A;  1NJX A;  4EZ6 A;  4M3U A;  2HNY A;  1HJR A;  3SV4 A;  1YTU A;  4CJ5 A;  3CQ8 A;  3AVA A;  4FW1 A;  3ZSW A;  4FLT A;  4CHN A;  3CYM A;  4JLH A;  2JLE A;  3O4N A;  1NOZ A;  4KTW A;  3VQ8 A;  3OS2 A;  3HYF A;  4AH9 A;  4GMJ B;  3O3H A;  3HJF A;  1A5W A;  3TI0 A;  3QO9 A;  3NE6 A;  4IDK A;  1BQN A;  4RG8 A;  1WAJ A;  3L3V A;  1QHT A;  4I7F A;  1QE1 A;  4AHS A;  3AVM A;  4DFP A;  1WLJ A;  2IC3 A;  3PV8 A;  2WOM A;  1U45 A;  1ASV A;  4ZHR A;  4Y1C A;  3SV3 A;  3QES A;  4Q0B A;  2X6S A;  3DLG A;  4RW8 A;  2GV9 A;  4FJM A;  4Q5V A;  2W42 A;  4HUE A;  4B9S A;  2OPS A;  1VK0 A;  4I2Q A;  1YTA A;  3AVF A;  4C8N A;  3LPT A;  4FLU A;  3SQ4 A;  2LSN A;  3TAM A;  1BL3 A;  3C94 A;  3I0S A;  2NUB A;  4UQG A;  1ITG A;  4KFB A;  3OYC A;  4W5N A;  2EHG A;  3NF8 A;  3S9H A;  2OPR A;  3KLI A;  3QLH A;  5J1E A;  3KLF A;  3V81 A;  2VG6 A;  3SPY A;  3DLR A;  2BAN A;  2VG7 A;  4IG0 A;  4FM1 A;  4E19 A;  5J2P A;  5C25 A;  2BE2 A;  1RT6 A;  4N76 A;  2A1S A;  2HNZ A;  3SQ2 A;  4CIE A;  1X9W A;  4DSI A;  4KHU A;  5FRM A;  4O0J A;  4FLX A;  4PWD A;  2KZZ A;  4FJL A;  5FRN A;  4M3R A;  3LP3 A;  1RTI A;  3HPG A;  2IDO A;  2P5G A;  5HRO A;  3V9W A;  3TR8 A;  3KIO A;  3EYZ A;  1O1W A;  3SYZ A;  3QNO A;  3A2F A;  3VQC A;  3V1R A;  4M3Y A;  3LAL A;  2HHQ A;  4DTO A;  3V4I A;  4B9V A;  3LDS A;  4B9M A;  2ZE2 A;  3AVL A;  3M8Q A;  5FRO A;  1JXB A;  2BDP A;  5DMR A;  1RT3 A;  4Z4I A;  1WSG A;  5I3U A;  3ZT2 A;  1WAF A;  2XY5 A;  3PY8 A;  4YFU A;  3QER A;  3C95 A;  4YNQ A;  4DFJ A;  1W9H A;  3NDK A;  4KB0 A;  3DLE A;  3T1A A;  2ATQ A;  3NGI A;  4CF1 A;  5HLF A;  2HB5 A;  1G15 A;  4KHN A;  4AHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...