5EU7A

Crystal structure of hiv-1 integrase catalytic core in complex with fab
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
153
structure length
143
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACDWAGIKQEFGVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title The Preserved HTH-Docking Cleft of HIV-1 Integrase Is Functionally Critical.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 48
structure length 143
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5eu7A00
3MECA 1NKEA 1IO2A 1ZBHA 3S3MA 1RT6A 4FZXC 4NYNA 4FLVA 3ZSXA 2HW3A 2E4LA 4LH4A 4IDKA 3CQ8A 1BQNA 4O0JA 2HVIA 4DG1A 3QEWA 4BDPA 2HHSA 4CGDA 3SQ2A 2FBTA 3AVAA 3V1RA 4B9NA 4E7JA 2X6NA 1QE1A 4HVJA 3F73A 3MXIA 3ALYA 3OJSA 4OGCA 4FM2A 4K8ZA 2Y1JA 5T7BA 4FLYA 4Z0UA 4IBNA 3HPGA 3DM2A 3V9SA 3OYEA 1Q9XA 1O1WA 3NF8A 1EXQA 1SUQA 1SV5A 1RT5A 2HHVA 4AH9A 1KCFA 2BANA 4JS4A 1ZBLA 3WNFA 2XY7A 4CK3A 3ZT1A 1A5WA 4HUEA 4H4MA 4DF4A 2XY8A 3RMAA 4FJHA 4H8KA 4FJ9A 4OKKA 3NBPA 4IKFA 4FK2A 4AHUA 3QEVA 1EP4A 1LW0A 3NDKA 4M3TA 2I5JA 2DTUA 3M8RA 1BIUA 1SKRA 4BDZA 1D5AA 2OPPA 4CEOA 3LZJA 4N47A 4CJQA 4E19A 4DFJA 2A1RA 1TK5A 3L2UA 1RDAA 4KKOA 1HQEA 3KK2A 4I2PA 2QKKA 4BE0A 2VWKA 4OJRA 4N56A 4B3OA 4YNQA 1RNHA 4M3XA 1WSJA 4DMNA 1J54A 1XWLA 4DFKA 1CZ9A 1HJRA 1C1CA 3AVGA 1WN7A 1NKBA 1QSYA 3THVA 1FKOA 4EP4A 1N6QA 3DLEA 2HB5A 4Q5VA 1N5YA 4Z4GA 1WAFA 2OZMA 3T3FA 1IKWA 3B6PA 3BGRA 4CJUA 1FK9A 1VSHA 2ZE2A 3ZSQA 3KK1A 2D5RA 3LP2A 1IKVA 1TL3A 4OVLA 2G8UA 1JLQA 1GOCA 1L3UA 4CF1A 3UIQA 4G1QA 3WNEA 4FJKA 3DYAA 3QLHA 1TGOA 4KB0A 4I9LA 2KFZA 4OPJA 4KB1A 4DS5A 3ZCMA 4DTOA 4DU1A 4Y1DA 4OPKA 4E1MA 1BIZA 1NOZA 3CFPA 5J2MA 1L5UA 1KTQA 4CJVA 3KJVA 3V9ZA 1TKXA 4FM0A 3L2RA 4FJIA 1HYSA 1D9DA 4JRQA 1BI4B 3HO1A 2OPRA 3VQBA 1RDCA 4CHPA 4RW4A 4CF9A 4B08A 2Z1HA 3FFIA 4ICLA 2BDPA 4M3YA 3KLIA 5CZ1A 3KTQA 2Z1GA 2KTQA 1S1VA 3ZT3A 2HMIA 3RR7A 1RCHA 3JSMA 1KVAA 1TV6A 2ATQA 1NKCA 2IAJA 4B9SA 4KHQA 1HYVA 1HQUA 1UAXA 1RILA 1IH7A 5I42A 4DWIA 4KRFA 1C0TA 4NCGA 4OKJA 4Z4HA 3TAQA 3IS9A 1WSIA 4NCBA 3OYFA 4BDYA 5C42A 4QOZB 5CYMA 3DRRA 1XI1A 1RT7A 4KREA 3LALA 1X9SA 4DTSA 2HNZA 1WLJA 1S1XA 3OS1A 3EYZA 3AO3A 1DLOA 3ISNC 3V6DA 2F96A 3VA3A 4DQRA 1QQCA 4DQQA 4DSEA 1KSPA 4UQGA 3TI0A 4ZTFA 1SKSA 1KFSA 3ZSZA 4C8OA 1ITGA 3AV9A 4CJLA 5SWMA 1RBVA 3EY1A 3SV4A 4KI4A 3IG1A 4F2RA 4DSKA 2VG5A 3C6TA 2Z1IA 2NUBA 3TAMA 5J1EA 5HRRA 4FJMA 3CG7A 2KFNA 4JRPA 1KLNA 3AA5X 3LWMA 2DFHA 4FJGA 1JLCA 2B4JA 3SQ0A 4W5RA 4KPYA 3ULDA 3TAGA 2QKBA 1JLBA 4CE9A 1A5XA 1TK0A 3LP3A 5FRNA 2XY6A 4LSLA 2HHUA 3HPHA 3ZSVA 3NH0A 4EP5A 5HLFA 1BHLA 3V81A 5HBMA 1HRHA 1XHZA 5CYQA 4CK1A 3OYJA 1BISA 4CJFA 3K59A 4CIEA 1TAQA 4M3UA 1B9DA 1KFDA 5KGWA 4HCBA 1S9EA 3H08A 4W5NA 2VG6A 4IG3A 1U4BA 2QK9A 3AVBA 4LH5A 4E3SA 1MU2A 2GBZA 5FROA 3SZ2A 2YV0X 4FLUA 3QINA 3MEEA 4CHOA 1T7PA 4RW6A 4CJ4A 3NFAA 2EX3A 2KW4A 3D45A 1J53A 3LANA 3VQPA 3KK3A 3OS0A 1W0HA 4CJ3A 3SQ1A 2W42A 2P5GA 4CEAA 3AVNA 4O5BA 3OY9A 3VQ6A 4FK4A 2XO7A 2ZQBA 3HJFA 3CFRA 3KKRA 3DOKA 1RDDA 3MXMA 1RTDA 2A1SA 4DS4A 2KZMA 3IRXA 1TKTA 4C8NA 1I39A 1QS4A 3VQ7A 4AHSA 3DLHA 3QIPA 4HUFA 3NF6A 3SCXA 1RDBA 5KGXA 3CM6A 1ASWA 1EX4A 3G10A 4CJPA 3LWLA 4CESA 3PX4A 4L8RB 2X78A 3M8SA 4CGFA 5JS1A 1NK0A 2E6MA 3U3GA 2AJQA 1B9FA 4E7KA 3LAMA 3ASMA 3DRSA 1K6YA 4CHZA 3I0SA 1TL1A 3RRHA 4F4KA 1DTQA 3V9UA 3OYNA 5I3UA 3OYLA 2X74A 3HXMA 1XC9A 1D8YA 1C1AA 1ASVA 4E0DA 1RBSA 3AVMA 1YVUA 3K5NA 3O3FA 1C0MA 4BWJA 2RF2A 1ZBUA 1JLAA 1ASUA 1REVA 4DTNA 1NK5A 2RPIA 4KTZA 3MAQA 4FJJA 4FJ7A 3K5MA 1T03A 4Q0BA 4M3WA 1U45A 1RTHA 3SYZA 1CLQA 4GMJB 4FLXA 4LY7A 5HRSA 3SV3A 2HHWA 1W9HA 2IDOA 3ITHA 4PA1A 3V1OA 4AHRA 4CJKA 3S9HA 4Z4EA 1TVRA 3I8DA 1JL2A 1KRPA 2O4GA 3CFOA 2YHAA 1ZYQA 3G0ZA 3HM9A 3VQ5A 3TAEA 4WE1A 1KVCA 3AO1A 4CHQA 5HROA 3NF7A 2RKIA 1HNIA 4M42A 1ZBFA 4FJ5A 1LAVA 3ZSRA 4CFDA 3OYIA 2GUIA 3NGYA 4R5PA 3OS2A 4E7LA 5HP1A 2YHBA 4KFBA 3VQ4A 4FXDA 3DLKA 4CERA 4FLWA 4FZZA 1WSEA 3K57A 1VSLA 2F8SA 1S6PA 4KI6A 3PUFA 1JLFA 1XHXA 4TSXA 2E6LA 1RT3A 3L2VA 3L2WA 3DOLA 5EU7A 2P1JA 3VQAA 3U3YA 1U48A 3HT3A 1RBRA 1UA1A 2OA8A 5KI6A 4DQPA 3WNGA 3I0RA 3M8PA 3OYCA 1Y97A 4J2BA 3NAEA 1C6VA 4CJEA 2DFEA 3CYMA 2YNFA 4MQ3A 3HPOA 3JYTA 2QXFA 1LWFA 4E89A 4Y1CA 3ZSOA 3QERA 3TWHA 1KVBA 4E7HA 4CK2A 4HUGA 3AO4A 1T8EA 1FKPA 2G8VA 4DSFA 1D9FA 4Z4CA 1BGXT 2IS3A 3S3NA 4BWMA 4W5TA 3T19A 1U49A 1NJWA 4KHYA 4PWDA 5K14A 1QSSA 3SJJA 3OYBA 3D0PA 4JLHA 2FC0A 1J9AA 1VSKA 3KLHA 3HK2A 1YT3A 1CZBA 4DU4A 3QETA 4DFMA 3HVTA 1NK8A 1IKYA 1F21A 3KKSA 5FDLA 4CECA 3DLRA 1S1UA 5DMRA 1QSLA 1Q9YA 1TKDA 3RTVA 3AVJA 3KD5E 4Z4IA 4KTWA 4I7FA 3E01A 1TK8A 3WNHA 1C1BA 2YNIA 4DTPA 4AILC 4LD0A 2GV9A 4LSNA 4CEFA 4K8XA 3LAKA 1S9GA 3LZIA 4FJXA 3O4NA 2HNYA 4FLZA 4KTQA 3K5LA 3OVNA 5CZ2A 3HL8A 5KRTA 4DU3A 4N76A 4FVMA 3BDPA 4FLTA 4IG0A 3DRPA 5KRSA 4B9MA 4DLEA 2OPSA 3SQ4A 4DTJA 1VSIA 1U04A 2IOCA 4BE1A 1X1PA 1UWBA 1YTUA 1GOAA 1JKHA 1RT1A 3NHGA 4CCHA 1JXEA 2ETJA 1WSFA 1VSMA 1DTTA 3L8BA 3AA3A 1Q8IA 1RTIA 3VQEA 4DFPA 1SL0A 4DSLA 4FJNA 3TANA 5J2PA 2KZZA 3EZ5A 1JL1A 2JLEA 3AO2A 3TABA 2O4IA 1S6QA 3LP0A 4CHNA 3MEGA 3L2QA 3QEIA 3QO9A 4EZ9A 4YFUA 3LP1A 3HSTB 1JLEA 4FW2A 5JS2A 3ZT4A 4C8LA 2PYLA 1TKZA 4M3ZA 2YKMA 1VK0A 2FBVA 1WAJA 2R7YA 3DMJA 3QNOA 1NK7A 3OYKA 4KAZA 3VQ8A 4CGIA 1WSGA 4CEZA 5SZTA 1NK6A 1LWEA 3PV8A 1L3VA 1WNSA 4HHTA 3O4QA 4B8CA 3OYAA 1RTJA 3L3VA 4F3OA 3MXJA 2EHGA 3CM5A 5DK5A 4CGJA 3V9WA 3TAFA 4C8KA 3RRGA 4ZHRA 4AHTA 3DLBA 3M8QA 5KTQA 1HPZA 1VRTA 4GVMA 4H4OA 3AVCA 2Y1IA 2G8HA 4N41A 3C6UA 3K5OA 3AVKA 1NJYA 4CFBA 4FZYA 1NJZA 4CJ5A 4FW1A 3SPZA 4FK0A 4CJSA 4KHUA 1S1TA 4QAGA 4FYDA 3NGZA 1SL1A 2G8KA 3KLEA 4RW9A 1EETA 1HNVA 3B6OA 2HHXA 3HP6A 3PX6A 2HVHA 4RW7A 1C0UA 1GOBA 2ZD1A 1BL3A 4E7IA 4GW6A 5J2NA 2HHQA 4M3RA 3OYGA 2BE2A 1CXUA 1VSJA 4CIGA 4FM1A 3PX0A 4FJ8A 3V9XA 1B92A 2FBXA 1NJXA 3TARA 3RR8A 3ZT2A 4EZ6A 4C8MA 1VSEA 5E41A 2DFFA 4M45A 3TAPA 5C25A 2B6AA 4CFAA 1X9WA 4NCAA 2WOMA 2XHBA 4I9QA 3AVHA 4CJRA 4ELUA 4FJLA 2F8TA 1UOCA 3P83D 3VQ9A 3ZSYA 3HVRA 3SUQA 1JLGA 1KLMA 4DQSA 3V1QA 1BCOA 1LAWA 4DLGA 3OJUA 1U47A 1FXXA 4BACA 1RBTA 4KHSA 4F8RA 4FCYA 3K58A 2OZSA 2XRIA 4PY5A 3O3HA 4O0IA 3LDSA 4KHWA 1IG9A 3T1AA 3QEPA 3NE6A 3LPTA 4OLAA 4DTUA 3F9KA 4CF8A 3QIOA 1LW2A 1J5OA 4F3TA 3S3OA 1IKXA 2YKNA 4W5QA 2YNHA 1Z26A 1NOYA 2VG7A 1S1WA 2D0BA 3VA0A 5HRNA 4ID1A 1NK9A 2DY4A 3OYDA 2WONA 4CGGA 2BGGA 3LPUA 4KV8A 4O44A 3NGIA 2Z1JA 2ITGA 1HMVA 3NH1A 2RN2A 4ID5A 1I3AA 5C24A 4MFBA 4CIFA 4ZTJA 1R0AA 4N5SA 3RWUA 3ZSWA 5HRPA 1RBUA 3KLGA 1NK4A 4CJWA 4CF0A 3OYHA 5J2QA 1T05A 4AHCA 3RMBA 1G15A 1BQMA 3VQQA 2G8WA 4DSIA 3AO5A 4CF2A 3MEDA 4I2QA 4O4GA 3C95A 2PZSA 2HNDA 4XIUA 3SUPA 4PQUA 1VRUA 1YTAA 4DTRA 3VQDA 2YNGA 4PUOA 3DLGA 1L3SA 3PO4A 2OPQA 1ZBIA 2D0CA 3HP9A 3TR8A 1RT2A 3KIOA 4IFYA 3NH2A 1TAUA 3SNNA 3O3GA 4CEBA 2X6SA 3SI6A 2Q3SA 4DSJA 3AVLA 5FRMA 2HHTA 4CEDA 4E1NA 2IC3A 4B9LA 1QTMA 2D0AA 2PY5A 2G8IA 3ZT0A 4J2EA 3VQCA 2P51A 1SL2A 3RMDA 2PYJA 1SKWA 4IFVA 4CEEA 4O55A 4BE2A 4CEQA 4OLBA 3AVFA 4NYFA 1WSHA 1BCMA 2FBYA 4OKEA 3AA4A 3C94A 3KLFA 4DTXA 3A2FA 1LV5A 3OYMA 3PY8A 4ELVA 4DQIA 2IGIA 4Z4FA 3SPYA 4B9UA 4J2DA 4F2SA 1VSFA 3RMCA 2XY5A 3HYFA 4DTMA 1X9MA 3VN5A 5D3GA 3U6FA 3KD1E 1HYZA 1RT4A 1L3TA 3DI6A 4CJTA 4B9TA 3V4IA 1EKEA 2KQ2A 4JS5A 4ELTA 3QESA 4CGHA 4HTUA 2B5JA 3NF9A 4B9VA 2P5OA 1LWCA 1CXQA 4OGEA 4CHYA 4AHVA 3SUNA 2G8FA 4QCLA 2OYQA 3PO5A 4KHNA 4KO0A 4B8AB 1QHTA 4J2AA 1UA0A 1A5VA 1S5JA 1VSDA 3P1GA 4DF8A 1Z25A 3AA2A 4RW8A 4CFCA 3SUOA 4W5OA 2LSNA 3QNNA 3QEXA 4HCCA 3L3UA 1BI4A 2JGUA 3AVIA 2VWJA 3K2PA 1JXBA 4RG8A 5CY4A 4M41A 3IAYA 3P5JA 3NCIA
chains in the Genus database with same CATH superfamily
1NLVA 1NKEA 5IT9O 1WBBA 4WQ5C 3ZSXA 4IDKA 1BQNA 3J80O 1OVYA 1J6ZA 4IO9L 3AVAA 4B9NA 1VHXA 2X6NA 4XH4A 3N4PA 3O1BA 5EOYA 3VF4A 1EXQA 1RT5A 1KXPA 1NWKA 4JS4A 1A5WA 4H4MA 4K25A 2XY8A 4FJHA 4OKKA 2F9TA 4WQ5A 1EP4A 1BIUA 2OPPA 4N47A 4CJQA 4E19A 1JCEA 1C0GA 4FWPA 1RDAA 1HQEA 1E4GT 4I2PA 5AQHA 3LDNA 4B9QA 4DFKA 1J54A 1QSYA 3I8BA 1C1CA 3AVGA 1WN7A 1OH6A 4EP4A 3D2FA 4Z4GA 2JWKA 2OZMA 4X66K 1BA0A 3J7AP 1HJOA 2ZE2A 1VSHA 3ZSQA 2D5RA 3LP2A 1TL3A 4NLCA 4BRGA 3BUZB 4CF1A 4G1QA 3UIQA 2O8CB 3DYAA 4C1NI 1GLJO 4CZMA 3J7ZO 4OPJA 2E2OA 4B1VA 1ZXOA 4Y1DA 2ZF5O 4BR5A 5J2MA 3MX2A 3KJVA 3TTFA 1HYSA 4FM0A 3L2RA 4OX9K 3HO1A 4CZJA 2PAVA 3VQBA 2UUBK 1NGBA 4K42A 5AQTA 4B08A 3FFIA 1RCHA 3JSMA 4B9SA 1HQUA 4DWIA 1C0TA 4NCBA 3CJCA 3AGRA 1XI1A 3WXIA 4GVEA 1WLJA 1S1XA 3EYZA 1BA1A 5BN9A 3PIPL 3WUHA 4DQRA 1KSPA 5LJVA 4C8OA 1VQ4N 3AV9A 1RBVA 3EY1A 2O8DA 4PKGA 1Q81O 4DSKA 5J1EA 2Z1IA 3BZKA 4FJMA 3A5MC 3UE5A 3O80A 1JLCA 3SQ0A 4YORA 1IBKK 3ULDA 3TAGA 1JLBA 4U67L 1TK0A 2AP1A 3LP3A 2OCEA 4FWMA 4LSLA 3HPHA 3IFRA 3NH0A 4LF9K 1XHZA 5CYQA 4CJFA 3K59A 1KFDA 3H08A 1U4BA 4LH5A 2NRWA 4E3SA 2GBZA 3D2FB 5FROA 3B8AX 2CGJA 2YV0X 4FOIA 3U4LA 4CHOA 1T7PA 4RW6A 3UB5A 3D45A 1BDGA 2W42A 4JI1K 3OY9A 4DV1K 3VQ6A 5TKWA 3CFRA 3KKRA 5KQDA 3MXMA 4LF7K 1WBDA 3R6MA 2QXLA 4F9OA 3QIPA 4RWTA 4HUFA 1WB9A 1RDBA 4A59A 3I33A 3AARA 3BZCA 4CESA 3PX4A 4CGFA 1CZAN 2NRZA 4E7KA 3HSCA 1TL1A 4EAHD 1DTQA 1P90A 3OYLA 1XC9A 4CVNE 1RBSA 2E1ZA 1YVUA 1ZBUA 2RPIA 1OH7A 4FJJA 1T03A 1U45A 3CCLN 5KPTA 1Q7YO 1CLQA 2IDOA 4PA1A 4A57A 4MLHA 1NGDA 3I8DA 1M1KO 3CFOA 2WUSA 3KK7A 4C1NK 5F2RA 3VQ5A 1DT9A 2Q36A 4CHQA 5HROA 4QS9A 4QS8A 5AQLA 1LAVA 3ZSRA 3OYIA 4FJ5A 2O8DB 4FLWA 2GWJA 3K57A 2BTFA 4R79A 2F8SA 3T1YK 5M1PA 1XHXA 3L2VA 1RT3A 1XNRK 3L2WA 1EWRA 4DR3K 1U48A 1UA1A 4DCHA 3I0RA 2ZGYA 3M8PA 3OYCA 3CC4N 4J2BA 3NAEA 1N33K 5M1KA 3HPOA 3JYTA 1KD1O 4E89A 1KVBA 3JXUA 5E84A 5M1FA 1D9FA 1HX1A 4A5AA 4JKCA 1QSSA 3G6EN 3D0PA 5ADXH 3HK2A 1CZBA 4IEIA 1IKYA 1F21A 1QQNA 1NGFA 2IVPA 4I7FA 3UKRA 1RDUA 4YOUA 2H3GX 4CEFA 1S9GA 4KTQA 5AQOA 3OVNA 5CZ2A 1M90O 4FVMA 1WOQA 3AY9A 4B9MA 3DRPA 1QZ5A 2QA4N 2NRVA 1HNXK 1X1PA 1YTUA 1MWMA 3MN9A 3L8BA 2ETJA 1WSFA 1HKBA 3OTOK 5J2PA 2KZZA 2JLEA 4M63C 3L2QA 3QO9A 1W7AA 4FW2A 5AQPA 2UXCK 2YKMA 3O9TA 3QNOA 3VQ8A 4CGIA 3O9RA 1LWEA 1WNSA 4JHDA 4HHTA 4F3OA 1RTJA 3MXJA 4CGJA 5DK5A 4CZHA 1EWQA 1N8RO 3RRGA 1BOTO 2F4VK 3DLBA 4B1XB 1IBLK 3AVKA 3E66A 1IJJA 4CFBA 1GLFO 4CZFA 4FWQA 4FOEA 3NGZA 2HHXA 4RW7A 1C0UA 3SK3A 5JICA 2ZD1A 4WF9L 3J81O 4GW6A 1BG3A 1QVFM 1HUXA 3OYGA 4FM1A 4XH1A 2FBXA 5BRHA 4EZ6A 4C8MA 2DFFA 3CJ1A 1TUUA 2VQEK 2UXBK 2XHBA 1K8AO 3P83D 3VQ9A 4DV6K 3ZEUB 3V1QA 4DLGA 4GKKK 4PY5A 5AQIA 4KHWA 3LDPA 3M1FA 4O8KA 1IG9A 5FPDA 3TTDA 1VQ6N 3UKRB 4DTUA 4BQZA 3QIOA 3SBTA 2YNHA 1Z26A 2J4RA 3O9SA 2D0BA 2VGNA 3OYDA 2WONA 2BGGA 2FSNA 4KV8A 4O44A 3NGIA 2Z1JA 1OH8A 4FWKA 5GAEP 4ILJA 3CCQN 2RN2A 3OHRA 1I3AA 1R0AA 1HLUA 3ZSWA 5HRPA 3EKUA 1HNWK 4MO4A 3L4QA 1T05A 4AHCA 3W3DA 3MK6A 4DSIA 3M5RA 1XC3A 3HOTA 2O8BA 4PQUA 4IFEA 3CIPA 3VQDA 5DM7L 5BR8K 4IO8A 2D0CA 4CW7B 3F5TA 4CEDA 4E1NA 4JHDB 3PSIA 2QWMA 5H1SQ 2PYJA 4CEEA 2GTDA 4O55A 1YI2N 1BCMA 3BEXA 4Z4FA 1JCFA 4J2DA 3I56N 2I7NA 4F2SA 2XY5A 3HYFA 2QM1A 3KD1E 1RT4A 1VQNN 3CI5A 2QWPA 3DI6A 3V4IA 2E1YA 4HTUA 3PIOL 1YJ9N 2P5OA 1LOTB 4AHVA 3PO5A 3T69A 4GY2B 4B8AB 3P1GA 1VSDA 2P9IA 2GUPA 3SUOA 3QEXA 1YJWN 4FO0A 2JGUA 4Y0WA 3MDQA 3K2PA 3EN9A 4DSEA 3MECA 4KH5A 4BRIA 1IV0A 4FZXC 4BRAA 2HW3A 1ATRA 3CQ8A 3ZLJA 4O0JA 1D4XA 3QEWA 2HHSA 4CGDA 3F73A 2A3ZA 3ALYA 4FL9A 4OGCA 4K8ZA 5T7BA 3DM2A 3OYEA 3NF8A 3VF2A 2HHVA 3QDKA 4AH9A 2GX9A 4DR4K 3JS6A 5M1NA 3G71N 2E2PA 3GOIA 2I7PA 2QWNA 1U6ZA 2NZTA 4BQLA 3AAQA 4JI5K 3FZMA 4FK2A 4CBXA 1LW0A 3P31A 4M3TA 2O8BB 1SKRA 3LZJA 3C7NA 4DFJA 3DXKA 3VGMA 3KK2A 4BC3A 4N56A 3IKMA 1NGEA 2FXUA 1XWLA 4CBUA 5AQYA 3THVA 4DKWA 4JI6K 4Q5VA 4FWNA 3T3FA 3BGRA 4OPHA 4A62A 3KK1A 1IKVA 4OVLA 1JLQA 1GOCA 3C6HA 1L3UA 1YAGA 1K9MO 1TGOA 4I9LA 4A5BA 2KFZA 1DKGD 2UYTA 4KB1A 5ADXA 4DTOA 4OPKA 2P9IB 1L5UA 1KTQA 3V9ZA 1Q86O 2IIRA 4FJIA 4JRQA 2OPRA 4CHPA 3HI0A 4NXMK 4CF9A 2Z1HA 1K8KA 4BY9C 3ZT3A 2HMIA 3CCUN 3RR7A 2ATQA 3VEVA 4KHQA 1IH7A 5I42A 1HKCA 4OKJA 4Z4HA 1WSIA 3P39A 4QOZB 3H3OB 4CBWA 4JYAK 1X9SA 4JI0K 3OS1A 3AO3A 1DLOA 2QTDA 3E1YA 4LF6K 1YF5L 2F96A 5AQJA 3VA3A 1QQCA 1IG8A 1SKSA 4DV2K 3ZSZA 2E2QA 2QWRA 3ID8A 5LMUK 3SV4A 3IG1A 2VG5A 4B1YB 1HR0K 3TAMA 1MWKA 1KLNA 5F1XA 3HM8A 3HBTA 4FJGA 2B4JA 4YY3K 5JVGL 3TSUA 4KPYA 3VESA 1K73O 4CE9A 5AQXA 4ISFA 1U2VA 3QFPA 3C7NB 4FWSA 4JKDA 2HHUA 4CD1A 3V81A 3DXKB 3TTCA 1HRHA 4BC5A 3CMEN 1TAQA 5KGWA 2QK9A 3AVBA 4JI3K 3SZ2A 4FLUA 4CJ4A 3NFAA 2P9KA 3LANA 3P4IA 3VQPA 3OS0A 4CEAA 5LJWA 4WYBA 4O5BA 5CHIA 3ULEA 1JJ2M 2ZQBA 3HJFA 1RTDA 1RDDA 1QS4A 3VQ7A 4AHSA 3FFKB 3CM6A 4CJPA 2JWLA 5AQVA 5JS1A 1NK0A 2E6MA 1HPMA 1B9FA 3LDQA 1K8KB 5AQNA 5I3UA 3OYNA 1TUYA 3DLLL 3HXMA 5I9EB 1TYQA 2E8AA 1W97L 3ENBA 5AQQA 2V52B 3GBTA 3O3FA 4LF8K 1NK5A 4KTZA 3LDLA 3K5MA 1ILYA 4FLXA 3SV3A 2HHWA 3CPEA 4LF5K 1W9HA 2F9WA 3BP8A 3LM9A 4JKBA 4Z4EA 1TVRA 1LCUA 3O5BA 2O4GA 1KRPA 2YHAA 4BRMA 3G0ZA 3THWA 1QQOA 1HNIA 3SJJA 4CFDA 1H1VA 2GUIA 4R5PA 3DLKA 4DHYA 4BREA 3PUFA 1T3VA 4H0TB 4JNEA 2E2NA 3U3YA 1U2VB 4BRDA 4AQYK 3EL2A 1RBRA 5KI6A 4O8UA 5JLHA 3NVKA 4EHTA 2HSTA 1C6VA 4JKFA 4CJEA 2YNFA 5CE3A 3QERA 3LM2A 1QVGM 4CK2A 3CC7N 3OW2M 4Z4CA 2IS3A 1NJWA 1U49A 4PWDA 5AZIB 3N4QA 5K14A 2P9KB 2FC0A 1J9AA 1VSKA 3ULEB 2ZWHA 3QETA 5FDLA 5C2FA 4GKJK 3DLRA 4LC9B 5LL6Z 3RTVA 1TK8A 2HBLA 1X9JA 2D0OA 3LAKA 3LZIA 3T1HK 4IOAL 5BRFA 3W0LA 2HBJA 4X65K 4DU3A 3NMUA 4FLTA 4IG0A 3WT0A 4JKHA 1VSIA 2YJEA 1TYQB 1UWBA 2WFBA 1VSMA 1DTTA 4BRHA 1VQPN 1ATNA 1RTIA 3VQEA 4DSLA 3VEOA 1GLLO 3TANA 3EZ5A 1S6QA 4BRCA 2A40A 5GIOA 3CCMN 3U8XA 3HSTB 1JLEA 3ZT4A 1TKZA 1VQON 3C65A 3THWB 3EO3A 3OYKA 3DWLA 5SZTA 1L3VA 1T44A 3VPZA 1Q18A 2W6KA 3O4QA 2F7TA 3CM5A 3MN6A 4N41A 2CGKA 3K5OA 4LF4K 4FZYA 4FW1A 4CJSA 1S1TA 4FYDA 2IVOA 4KH4A 1EETA 4RW9A 3R8EA 3HP6A 4BR9A 1O13A 2FLOA 1DEJA 5F0XA 4H0OA 4DR2K 2BE2A 1X3NA 4FJ8A 4MDBA 3V9XA 1MA9B 3HOSA 3ZT2A 4BGAA 1XMOK 4CFAA 1X9WA 1P8ZA 4IXCA 4FJLA 2F8TA 3MN7A 3HVRA 4DQSA 3GG4A 1BCOA 3SAHA 4YOVA 2YI1A 5EY4A 4IJNA 3T1AA 3QEPA 3NE6A 4PL8A 3CMAN 3VF6A 3CCJN 1V4SA 3PSFA 1J5OA 3E9PA 1IKXA 4M7YA 4W5QA 4AM7A 5HL7L 4ID1A 4MDAA 4CGGA 3LPUA 4G9ZA 3NH1A 4CIFA 3VGKA 2DPNA 4NLBA 4CJWA 2NNWA 1BQMA 2QWLA 4CF2A 4I2QA 4YHHK 3A5OC 2FSJA 3RVCA 2ZGZA 4DTRA 2A41A 3DLGA 2OPQA 4MO5A 1ZBIA 3ZEUA 4IFYA 1TAUA 5FRMA 2Q3SA 3D2EA 3AVLA 1IBMK 2D0AA 2PY5A 3VEWA 4DR5K 1NMDA 1SL2A 3RMDA 1EQYA 3O08A 4BE2A 4CEQA 3CCRN 1NG9A 3PY8A 3C94A 4DTXA 2HBKA 4H5VA 2Q1NA 1E3MA 3MX5A 1BU6O 3SPYA 1FW6A 3IMXA 1X9MA 3FGUA 1OKJA 5D3GA 1HYZA 4B9TA 3VGLA 2P9SA 4JS5A 5CR4A 3QESA 5BPLA 3NF9A 3ENOA 3THYA 4CHYA 1CXQA 4OGEA 1KQSM 2WBNA 2G8FA 4KHNA 1UA0A 1S5JA 4DF8A 1Z25A 4HCCA 2NRTA 4I6MA 2O8EA 4FPAA 3GE1A 1VAZA 3A8YA 1QZ6A 5AQGA 3AVIA 3NCIA 4H03B 1IO2A 1ZBHA 3S3MA 1RT6A 3ENHA 4DUYK 4NYNA 4FLVA 3FR0A 2E4LA 4BDPA 3SQ2A 2FBTA 3V1RA 4E7JA 3Q7BA 2ZJRL 1QE1A 1SAZA 1BO5O 5AJ3K 1VQ9N 4FM2A 4IDHA 4JI4K 4CZLA 3CJ9A 1O1WA 5FLXO 3CXCM 1Q9XA 1S22A 3H45C 1KCFA 1Z6RA 3A0IX 2BANA 3EE8A 3SAGA 3LDOA 2XY7A 3ZT1A 4HUEA 3RMAA 4FJ9A 3CCVN 3QEVA 5FPEA 3BF1A 2P9PA 5BN8A 3K9KA 3O6WA 5HOOA 4CEOA 4BRKA 1BUPA 1KC8O 1NM1A 4KKOA 3WXKA 3D2EB 2VWKA 4OJRA 4YNQA 1GLAG 4J8FA 1WSJA 1HJRA 1DGKN 1FKOA 3H3NO 4CJ7A 4H5TA 1N5YA 4B3SK 1WAFA 3B6PA 2YHYA 3ID6A 1FK9A 4WFAL 4BR2A 4BC2A 4PHTX 5BRDA 3WNEA 4FPBA 3VTHA 3QLHA 2P9SB 5GAHP 4KB0A 3THYB 4IZ9A 4DU1A 4E1MA 3SAFA 4BRQA 3CFPA 3WQUA 2A6AA 4CJVA 1TKXA 5C10A 1D9DA 4I6MB 2O8EB 2BDPA 4M3YA 4EIAA 4ICLA 4BR0A 3KTQA 2Z1GA 2KTQA 4PKHA 1KVAA 1NBWA 1UAXA 1RILA 2W40A 4AM6A 4X64K 3TAQA 3IS9A 4JK8A 4BDYA 5JMVA 1RT7A 3LALA 3U9DA 2HNZA 4WCEL 1VQ8N 1KAYA 3QICA 4UQGA 3TI0A 4ZTFA 5M1OA 4X62K 2OTJN 4JKEA 4CJLA 4CZEA 5SWMA 4KI4A 4OPAA 4B3RK 2NUBA 1QHAA 5HRRA 2KFNA 4JRPA 5AQSA 2DFHA 3TSPA 4WQ4A 2P9PB 1I94K 5FRNA 1R59O 3MWTA 5AZJB 3ZSVA 5HLFA 4UY8O 1BHLA 5HBMA 4CK1A 1G99A 1BISA 3OYJA 4DB3A 4CIEA 1B9DA 2VG6A 4IG3A 4Z94A 1RDWX 2CGLA 4O5FA 3KZBA 3L0QA 2EX3A 2KW4A 3ZETA 4FWLA 3KK3A 4JI7K 3AVNA 3BY5A 4FK4A 2XO7A 3L4IA 3VTIA 1TKTA 2QWQA 4C8NA 1YIJN 1I39A 3DLHA 3NF6A 4HWIA 3SCXA 5KGXA 4JV5K 1EX4A 4L8RB 2X78A 1GLBG 3C0BA 3U3GA 2AJQA 3VEYA 3LAMA 3ASMA 4F4KA 3TU5A 3H6EA 3V9UA 4DR6K 1D8YA 2QW9A 2HMPA 3AVMA 2VWBA 3VERA 1ZBSA 2RF2A 4BWJA 1JLAA 1REVA 3MAQA 4FJ7A 3CCSN 1RTHA 3SYZA 4GMJB 4LY7A 3ATUA 4AHRA 3S9HA 2IVNA 1KAXA 4YOTA 4JI2K 1KVCA 4M42A 1YHQN 4B1UB 2UUAK 2YHBA 1Y64A 3CERA 4CERA 1VQKN 1WSEA 1W2BM 3DAWA 1VSLA 1JLFA 1BWFO 1NGCA 3DOLA 3VQAA 3H46O 3MWPA 4DQPA 3WNGA 1Y97A 2Q31A 2DFEA 1NGAA 1LWFA 2D1KA 4JAXA 4Y1CA 5M1QA 5GADP 3JAMO 4E7HA 1T8EA 3AO4A 1FKPA 2G8VA 2P9LA 3FZLA 1BGXT 3S3NA 4XEIA 3T19A 3VEZA 4LFAK 4KHYA 3EZWA 4ILGB 3ZETB 1NGGA 3OYBA 3O1WA 1EO1A 4DU4A 4DFMA 1NK8A 4CECA 3F2KA 5DMRA 4BGBA 3G25A 2EWSA 4H0YB 3KD5E 4KTWA 1VQ5N 4DTPA 2YNIA 3SBGA 4LD0A 2GV9A 4K8XA 3UKUB 4CZKA 3SLCA 3HL8A 4BRNA 4N76A 1C0FA 5KRSA 4JEPA 4DLEA 1V4TA 1XMQK 3SQ4A 4DTJA 1GLCG 1U04A 1ZC6A 4BE1A 2NLXA 4RTFD 1GOAA 5C12A 5KPRA 1JXEA 2NRXA 4DFPA 4FJNA 4BVOA 1JL1A 4DV3K 5B8HA 3AO2A 3TABA 3LP0A 3QEIA 5AQRA 5AZIA 4C8LA 3F9MA 2PYLA 2FBVA 1WAJA 2R7YA 3SJHA 2E20A 1NK7A 2P9UA 5JLFA 1WSGA 3GL1A 3KHYA 4CEZA 3MMVA 3TSQA 3OYAA 3L3VA 3V9WA 4BR4A 3K9JA 4AHTA 2E5LK 5KTQA 4H4OA 2Y1IA 2G8HA 3AVCA 3C6UA 1NJYA 4C23A 4V19S 1NJZA 1ESVA 4ISGA 4CJ5A 4FK0A 4QAGA 5JVHL 1SL1A 2W6LA 3B6OA 3PX6A 2HVHA 1GOBA 1BL3A 4M3RA 1CXUA 1VSJA 4CIGA 1GLDG 4H5NA 1NU0A 1VSEA 4M45A 2P9LB 3TAPA 2B6AA 2WOMA 4I9QA 3AVHA 5BPNA 1NGIA 4CJRA 4YOWA 3ZSYA 1KLMA 4OO1J 1LAWA 4GV3A 1U47A 4BACA 4KHSA 4F8RA 5GAGP 1T6CA 4FCYA 3QFUA 4BVPA 4LFCK 2ZJQL 4IJAA 3F9KA 1LW2A 2CH5A 2ASMA 2YKNA 3EEQA 3P38A 4F3TA 1S1WA 3VA0A 3FZHA 5HRNA 2ITGA 1HMVA 1YUWA 2HOEA 2ASOA 1RFQA 4IWVA 3DJCA 1RBUA 3TPQA 1G15A 4KBOA 3AO5A 2PZSA 3C95A 4XIUA 3SUPA 1XQSC 2OTLN 1VRUA 1YTAA 4JK7A 4PUOA 1L3SA 4BRLA 1WUAA 3PO4A 3HP9A 3TR8A 3AGKA 2P9UB 3SNNA 2X6SA 3FE1A 4DSJA 2HHTA 4B9LA 2G8IA 5LMNK 2D0PA 3VQCA 1VQMN 1SKWA 3THXA 2UU9K 4OLBA 3AVFA 4NYFA 1WSHA 3AA4A 5AQWA 5LY3A 4DQIA 1XUPO 1N34K 4B9UA 3RSEA 3OBWA 1VSFA 2YJFA 3VN5A 3U6FA 2Q2RA 5GINA 1L3TA 1MDUB 3M6GA 4B9VA 4H5WA 3QBXA 3SUNA 3QBWA 4QCLA 2OYQA 4KO0A 4J2AA 1QHTA 1A5VA 5AQZA 1HNZK 3AA2A 5IWAK 4W5OA 4PL7A 3QNNA 4DR1K 3L3UA 1BI4A 5AFUH 4ILHA 1GLEG 3CPWM 1JXBA 4RG8A 5CY4A 4M41A 3P5JA 2YHWA 4BROA 4K41A 2UUCK 5GIPA 4CZGA 4LH4A 2HVIA 4DG1A 4BRPA 1J5EK 4HVJA 3MXIA 4ISEA 4DV0K 1N36K 3OJSA 2QI2A 2HBMA 3O9UA 3WQTA 2Y1JA 4FLYA 1OVQA 4Z0UA 3CQYA 2CH6A 4IBNA 3HPGA 3V9SA 4K0KK 4IOXA 3CCEN 1SUQA 1SV5A 3R9PA 4LFBK 1ZBLA 4GV6A 3WNFA 4CK3A 2PFUA 5FPNA 2VYPA 4DF4A 3HTVA 4H8KA 3NBPA 2P9NA 4IKFA 4AHUA 4NO7A 3NDKA 3J7YP 4L3QA 2I5JA 1Z05A 3KWIA 4CZIA 3M8RA 2DTUA 4BDZA 1D5AA 3OA9A 3QMLA 2O8FA 4RCHA 3E9LA 2A1RA 1TK5A 3L2UA 2RHKA 3U9ZA 2QKKA 4DV5K 4BE0A 4B3OA 5AQMA 3VMFB 1RNHA 4M3XA 4DMNA 1CZ9A 2FSKA 5TKYA 1NKBA 3CETA 3THXB 4DV4K 1N6QA 3DLEA 2HB5A 3CC2N 3IUCA 2FF6A 2NRHA 4FVUA 1IKWA 4PKIA 1X3MA 2OANA 1VQLN 2FF3B 4CJUA 3RSEB 2NRRA 4JD2A 3ZYYX 1QQMA 3CQXA 2G8UA 2HHHK 3ZX3A 4FJKA 2GEMA 4GNIA 4DS5A 3ZCMA 3SMPA 1BIZA 1NOZA 5MLCQ 1S72N 4IOCL 1BI4B 1RDCA 4RW4A 2A5XA 2AA4A 3KLIA 5CZ1A 1S1VA 3VEXA 3D7EO 3EKSA 1TV6A 1NKCA 2IAJA 3CF5L 2PBDA 4JKAA 4BR7A 1HYVA 4KRFA 4B1WB 4FWOA 4BG9A 4NCGA 3S41A 2HF3A 5AQFA 3OYFA 3R1XA 5C42A 5CYMA 3DRRA 2RE2A 3KVGA 2WTUA 3MCAB 4DTSA 4KREA 3OBYA 3ISNC 3M3ZA 3V6DA 1SS6A 3AAPA 4H5RA 3MN5A 4DQQA 1KFSA 1OH5A 4WFBL 1ITGA 4CI6A 2GELA 4F2RA 5C0YA 4DQ8A 3C6TA 3CG7A 3WXLA 2P9NB 3AA5X 3LWMA 1NMNA 4W5RA 2QKBA 2BUPA 2ITMA 4K43A 1A5XA 4JN4A 3CD6N 2O8FB 2XY6A 3CJAA 1HKGA 4M7XA 4EP5A 1Q82O 1T6DA 2VGMA 4M3UA 2QEXN 4HCBA 1S9EA 4W5NA 2YX6A 3GDQA 3R3LA 4KHPK 1MU2A 4AF1A 3QINA 3MEEA 3D6RA 3VOVA 1J53A 4JD2B 1W0HA 4CJ3A 3SQ1A 2P5GA 1NJIO 5C15A 3FLCO 3DOKA 4IEEA 3ZX2A 2A1SA 3O4WA 4DS4A 2KZMA 3IRXA 1E4FT 3WEEA 4A2AA 5A2QO 1ASWA 3LWLA 3G10A 4BG8A 3M8SA 5FPMA 3DRSA 4CHZA 1K6YA 5AZJA 3I0SA 3RRHA 3L6QA 2QWOA 3DXMA 5BR9A 2VCPA 2X74A 3O8MA 1C1AA 1ASVA 3FZFA 4E0DA 3K0SA 3K5NA 4DTNA 1C0MA 1ASUA 3A5LC 4DR7K 4Q0BA 4JI8K 4M3WA 3HRGA 5HRSA 4XH5A 4JK9A 3ITHA 3WXMB 3V1OA 5E26A 4CJKA 2BH1A 1JL2A 3WXJA 1ZYQA 3HM9A 3TAEA 4WE1A 3AO1A 3NF7A 2RKIA 4FSVA 1ZBFA 4NB4A 5HP1A 3NGYA 3OS2A 4E7LA 3CJBA 4KFBA 3VQ4A 4FXDA 4FZZA 4H0VB 1S6PA 4KI6A 4TSXA 2E6LA 2YCHA 5EU7A 2P1JA 4NXNK 3G4SN 3HT3A 3VENA 1YXQA 2GWKA 2OA8A 3I55N 3ZX0A 1YVNA 4DUZK 3CYMA 4MQ3A 1JCGA 2QXFA 3ATVA 3ZSOA 4WQ4C 1N32K 3TWHA 4EHUA 4YOXA 4HUGA 3O9QA 5ELZA 4DSFA 4CD3A 4BWMA 4W5TA 3J8AA 5AQKA 2KLAA 4JLHA 2ZJPL 3KLHA 1YT3A 5DM6L 3HVTA 3KKSA 4B3TK 1S1UA 1QSLA 1Q9YA 5AFUA 1TKDA 2YHXA 3AVJA 4Z4IA 3WEEB 5BREA 3E01A 3WNHA 1C1BA 4AILC 4FJXA 4LSNA 3VETA 3O4NA 2HNYA 4FLZA 3K5LA 5KRTA 4B3MK 1YJNN 3BDPA 1FJGK 2OPSA 2V7YA 2E88A 3DXMB 3E9OA 2IOCA 1JKHA 1RT1A 3NHGA 4CCHA 1SL0A 3AA3A 1Q8IA 4GV9A 2O4IA 5EVZA 3T7ZA 4CHNA 3MEGA 4EZ9A 4YFUA 3LP1A 2VQFK 5JS2A 4M3ZA 2ZM6K 1VK0A 3DMJA 3A5NC 4KAZA 1NK6A 5AQUA 3PV8A 1SZ2A 4B8CA 3Q7CA 1ATSA 2EHGA 2Q0RA 3TAFA 4A61A 4C8KA 4ZHRA 3M8QA 3MCPA 1HPZA 1VRTA 2WC9A 4GVMA 4YDUC 3UKUA 5KQ8A 3SPZA 3HZ6A 4KHUA 4B1ZA 2HF4A 4H0XB 2G8KA 4H0PA 3KLEA 2Q97A 1HNVA 3BF3A 1VQ7N 4DV7K 4JKGA 4WFNL 2Q0UA 3FZKA 4E7IA 5J2NA 2HHQA 3PX0A 1B92A 1NJXA 3TARA 3RR8A 5E41A 4FWRA 3NVMA 5AR0A 5C25A 4NCAA 1YITN 2KKZA 4ELUA 5C2DA 1UOCA 4YDUA 4YOYA 3SUQA 1JLGA 4KH6A 1NGHA 3OJUA 1FXXA 1RBTA 2OZSA 3K58A 2XRIA 1RGIA 3O3HA 4O0IA 3LDSA 3LPTA 4OLAA 5BPMA 4CF8A 3H1QA 3S3OA 1NOYA 3IDHA 2VG7A 3C6AA 1XNQK 1NK9A 2DY4A 2UXDK 2KHOA 4ID5A 5C24A 3QB0A 4MFBA 4ZTJA 4N5SA 3RWUA 5EX5A 3KLGA 1NK4A 5J2QA 4CF0A 3OYHA 3RMBA 3VQQA 2G8WA 4O4GA 3MEDA 3EE9A 1S3XA 2HNDA 2A42A 1KAZA 2YNGA 1RT2A 3KIOA 3NH2A 3CHWA 3O3GA 4CEBA 3SI6A 4A2BA 2IC3A 1QTMA 3ZT0A 4J2EA 2P51A 4IFVA 3PLAA 2FBYA 4OKEA 3SMSA 3KLFA 3A2FA 1LV5A 3OYMA 4ELVA 2IGIA 5KPZA 4MLEA 4BRFA 3RMCA 4DTMA 4JKGB 4U7BA 1NNEA 1NGJA 5EXWA 1SQKA 4EFHA 4QS7A 2O8CA 4CJTA 1EKEA 2ASPA 2KQ2A 2W41A 3LL3A 4ELTA 4CGHA 2B5JA 4BC4A 2V51B 1LWCA 3CJ7A 3H1VX 2V7ZA 4RW8A 4CFCA 2LSNA 2D4WA 4E1JA 4HTLA 3KWGA 2VWJA 3IAYA
chains in the Genus database with same CATH topology
3MECA 1NKEA 1IO2A 1ZBHA 3S3MA 1RT6A 4FZXC 4NYNA 4FLVA 3ZSXA 2HW3A 2E4LA 4LH4A 4IDKA 3CQ8A 1BQNA 4O0JA 2HVIA 4DG1A 3QEWA 4BDPA 2HHSA 4CGDA 3SQ2A 2FBTA 3AVAA 3V1RA 4B9NA 4E7JA 2X6NA 1QE1A 4HVJA 3F73A 3MXIA 3ALYA 3OJSA 4OGCA 4FM2A 4K8ZA 2Y1JA 5T7BA 4FLYA 4Z0UA 4IBNA 3HPGA 3DM2A 3V9SA 3OYEA 1Q9XA 1O1WA 3NF8A 1EXQA 1SUQA 1SV5A 1RT5A 2HHVA 4AH9A 1KCFA 2BANA 4JS4A 1ZBLA 3WNFA 2XY7A 4CK3A 3ZT1A 1A5WA 4HUEA 4H4MA 4DF4A 2XY8A 3RMAA 4FJHA 4H8KA 4FJ9A 4OKKA 3NBPA 4IKFA 4FK2A 4AHUA 3QEVA 1EP4A 1LW0A 3NDKA 4M3TA 2I5JA 2DTUA 3M8RA 1BIUA 1SKRA 4BDZA 1D5AA 2OPPA 4CEOA 3LZJA 4N47A 4CJQA 4E19A 4DFJA 2A1RA 1TK5A 3L2UA 1RDAA 4KKOA 1HQEA 3KK2A 4I2PA 2QKKA 4BE0A 2VWKA 4OJRA 4N56A 4B3OA 4YNQA 1RNHA 4M3XA 1WSJA 4DMNA 1J54A 1XWLA 4DFKA 1CZ9A 1HJRA 1C1CA 3AVGA 1WN7A 1NKBA 1QSYA 3THVA 1FKOA 4EP4A 1N6QA 3DLEA 2HB5A 4Q5VA 1N5YA 4Z4GA 1WAFA 2OZMA 3T3FA 1IKWA 3B6PA 3BGRA 4CJUA 1FK9A 1VSHA 2ZE2A 3ZSQA 3KK1A 2D5RA 3LP2A 1IKVA 1TL3A 4OVLA 2G8UA 1JLQA 1GOCA 1L3UA 4CF1A 3UIQA 4G1QA 3WNEA 4FJKA 3DYAA 3QLHA 1TGOA 4KB0A 4I9LA 2KFZA 4OPJA 4KB1A 4DS5A 3ZCMA 4DTOA 4DU1A 4Y1DA 4OPKA 4E1MA 1BIZA 1NOZA 3CFPA 5J2MA 1L5UA 1KTQA 4CJVA 3KJVA 3V9ZA 1TKXA 4FM0A 3L2RA 4FJIA 1HYSA 1D9DA 4JRQA 1BI4B 3HO1A 2OPRA 3VQBA 1RDCA 4CHPA 4RW4A 4CF9A 4B08A 2Z1HA 3FFIA 4ICLA 2BDPA 4M3YA 3KLIA 5CZ1A 3KTQA 2Z1GA 2KTQA 1S1VA 3ZT3A 2HMIA 3RR7A 1RCHA 3JSMA 1KVAA 1TV6A 2ATQA 1NKCA 2IAJA 4B9SA 4KHQA 1HYVA 1HQUA 1UAXA 1RILA 1IH7A 5I42A 4DWIA 4KRFA 1C0TA 4NCGA 4OKJA 4Z4HA 3TAQA 3IS9A 1WSIA 4NCBA 3OYFA 4BDYA 5C42A 4QOZB 5CYMA 3DRRA 1XI1A 1RT7A 4KREA 3LALA 1X9SA 4DTSA 2HNZA 1WLJA 1S1XA 3OS1A 3EYZA 3AO3A 1DLOA 3ISNC 3V6DA 2F96A 3VA3A 4DQRA 1QQCA 4DQQA 4DSEA 1KSPA 4UQGA 3TI0A 4ZTFA 1SKSA 1KFSA 3ZSZA 4C8OA 1ITGA 3AV9A 4CJLA 5SWMA 1RBVA 3EY1A 3SV4A 4KI4A 3IG1A 4F2RA 4DSKA 2VG5A 3C6TA 2Z1IA 2NUBA 3TAMA 5J1EA 5HRRA 4FJMA 3CG7A 2KFNA 4JRPA 1KLNA 3AA5X 3LWMA 2DFHA 4FJGA 1JLCA 2B4JA 3SQ0A 4W5RA 4KPYA 3ULDA 3TAGA 2QKBA 1JLBA 4CE9A 1A5XA 1TK0A 3LP3A 5FRNA 2XY6A 4LSLA 2HHUA 3HPHA 3ZSVA 3NH0A 4EP5A 5HLFA 1BHLA 3V81A 5HBMA 1HRHA 1XHZA 5CYQA 4CK1A 3OYJA 1BISA 4CJFA 3K59A 4CIEA 1TAQA 4M3UA 1B9DA 1KFDA 5KGWA 4HCBA 1S9EA 3H08A 4W5NA 2VG6A 4IG3A 1U4BA 2QK9A 3AVBA 4LH5A 4E3SA 1MU2A 2GBZA 5FROA 3SZ2A 2YV0X 4FLUA 3QINA 3MEEA 4CHOA 1T7PA 4RW6A 4CJ4A 3NFAA 2EX3A 2KW4A 3D45A 1J53A 3LANA 3VQPA 3KK3A 3OS0A 1W0HA 4CJ3A 3SQ1A 2W42A 2P5GA 4CEAA 3AVNA 4O5BA 3OY9A 3VQ6A 4FK4A 2XO7A 2ZQBA 3HJFA 3CFRA 3KKRA 3DOKA 1RDDA 3MXMA 1RTDA 2A1SA 4DS4A 2KZMA 3IRXA 1TKTA 4C8NA 1I39A 1QS4A 3VQ7A 4AHSA 3DLHA 3QIPA 4HUFA 3NF6A 3SCXA 1RDBA 5KGXA 3CM6A 1ASWA 1EX4A 3G10A 4CJPA 3LWLA 4CESA 3PX4A 4L8RB 2X78A 3M8SA 4CGFA 5JS1A 1NK0A 2E6MA 3U3GA 2AJQA 1B9FA 4E7KA 3LAMA 3ASMA 3DRSA 1K6YA 4CHZA 3I0SA 1TL1A 3RRHA 4F4KA 1DTQA 3V9UA 3OYNA 5I3UA 3OYLA 2X74A 3HXMA 1XC9A 1D8YA 1C1AA 1ASVA 4E0DA 1RBSA 3AVMA 1YVUA 3K5NA 3O3FA 1C0MA 4BWJA 2RF2A 1ZBUA 1JLAA 1ASUA 1REVA 4DTNA 1NK5A 2RPIA 4KTZA 3MAQA 4FJJA 4FJ7A 3K5MA 1T03A 4Q0BA 4M3WA 1U45A 1RTHA 3SYZA 1CLQA 4GMJB 4FLXA 4LY7A 5HRSA 3SV3A 2HHWA 1W9HA 2IDOA 3ITHA 4PA1A 3V1OA 4AHRA 4CJKA 3S9HA 4Z4EA 1TVRA 3I8DA 1JL2A 1KRPA 2O4GA 3CFOA 2YHAA 1ZYQA 3G0ZA 3HM9A 3VQ5A 3TAEA 4WE1A 1KVCA 3AO1A 4CHQA 5HROA 3NF7A 2RKIA 1HNIA 4M42A 1ZBFA 4FJ5A 1LAVA 3ZSRA 4CFDA 3OYIA 2GUIA 3NGYA 4R5PA 3OS2A 4E7LA 5HP1A 2YHBA 4KFBA 3VQ4A 4FXDA 3DLKA 4CERA 4FLWA 4FZZA 1WSEA 3K57A 1VSLA 2F8SA 1S6PA 4KI6A 3PUFA 1JLFA 1XHXA 4TSXA 2E6LA 1RT3A 3L2VA 3L2WA 3DOLA 5EU7A 2P1JA 3VQAA 3U3YA 1U48A 3HT3A 1RBRA 1UA1A 2OA8A 5KI6A 4DQPA 3WNGA 3I0RA 3M8PA 3OYCA 1Y97A 4J2BA 3NAEA 1C6VA 4CJEA 2DFEA 3CYMA 2YNFA 4MQ3A 3HPOA 3JYTA 2QXFA 1LWFA 4E89A 4Y1CA 3ZSOA 3QERA 3TWHA 1KVBA 4E7HA 4CK2A 4HUGA 3AO4A 1T8EA 1FKPA 2G8VA 4DSFA 1D9FA 4Z4CA 1BGXT 2IS3A 3S3NA 4BWMA 4W5TA 3T19A 1U49A 1NJWA 4KHYA 4PWDA 5K14A 1QSSA 3SJJA 3OYBA 3D0PA 4JLHA 2FC0A 1J9AA 1VSKA 3KLHA 3HK2A 1YT3A 1CZBA 4DU4A 3QETA 4DFMA 3HVTA 1NK8A 1IKYA 1F21A 3KKSA 5FDLA 4CECA 3DLRA 1S1UA 5DMRA 1QSLA 1Q9YA 1TKDA 3RTVA 3AVJA 3KD5E 4Z4IA 4KTWA 4I7FA 3E01A 1TK8A 3WNHA 1C1BA 2YNIA 4DTPA 4AILC 4LD0A 2GV9A 4LSNA 4CEFA 4K8XA 3LAKA 1S9GA 3LZIA 4FJXA 3O4NA 2HNYA 4FLZA 4KTQA 3K5LA 3OVNA 5CZ2A 3HL8A 5KRTA 4DU3A 4N76A 4FVMA 3BDPA 4FLTA 4IG0A 3DRPA 5KRSA 4B9MA 4DLEA 2OPSA 3SQ4A 4DTJA 1VSIA 1U04A 2IOCA 4BE1A 1X1PA 1UWBA 1YTUA 1GOAA 1JKHA 1RT1A 3NHGA 4CCHA 1JXEA 2ETJA 1WSFA 1VSMA 1DTTA 3L8BA 3AA3A 1Q8IA 1RTIA 3VQEA 4DFPA 1SL0A 4DSLA 4FJNA 3TANA 5J2PA 2KZZA 3EZ5A 1JL1A 2JLEA 3AO2A 3TABA 2O4IA 1S6QA 3LP0A 4CHNA 3MEGA 3L2QA 3QEIA 3QO9A 4EZ9A 4YFUA 3LP1A 3HSTB 1JLEA 4FW2A 5JS2A 3ZT4A 4C8LA 2PYLA 1TKZA 4M3ZA 2YKMA 1VK0A 2FBVA 1WAJA 2R7YA 3DMJA 3QNOA 1NK7A 3OYKA 4KAZA 3VQ8A 4CGIA 1WSGA 4CEZA 5SZTA 1NK6A 1LWEA 3PV8A 1L3VA 1WNSA 4HHTA 3O4QA 4B8CA 3OYAA 1RTJA 3L3VA 4F3OA 3MXJA 2EHGA 3CM5A 5DK5A 4CGJA 3V9WA 3TAFA 4C8KA 3RRGA 4ZHRA 4AHTA 3DLBA 3M8QA 5KTQA 1HPZA 1VRTA 4GVMA 4H4OA 3AVCA 2Y1IA 2G8HA 4N41A 3C6UA 3K5OA 3AVKA 1NJYA 4CFBA 4FZYA 1NJZA 4CJ5A 4FW1A 3SPZA 4FK0A 4CJSA 4KHUA 1S1TA 4QAGA 4FYDA 3NGZA 1SL1A 2G8KA 3KLEA 4RW9A 1EETA 1HNVA 3B6OA 2HHXA 3HP6A 3PX6A 2HVHA 4RW7A 1C0UA 1GOBA 2ZD1A 1BL3A 4E7IA 4GW6A 5J2NA 2HHQA 4M3RA 3OYGA 2BE2A 1CXUA 1VSJA 4CIGA 4FM1A 3PX0A 4FJ8A 3V9XA 1B92A 2FBXA 1NJXA 3TARA 3RR8A 3ZT2A 4EZ6A 4C8MA 1VSEA 5E41A 2DFFA 4M45A 3TAPA 5C25A 2B6AA 4CFAA 1X9WA 4NCAA 2WOMA 2XHBA 4I9QA 3AVHA 4CJRA 4ELUA 4FJLA 2F8TA 1UOCA 3P83D 3VQ9A 3ZSYA 3HVRA 3SUQA 1JLGA 1KLMA 4DQSA 3V1QA 1BCOA 1LAWA 4DLGA 3OJUA 1U47A 1FXXA 4BACA 1RBTA 4KHSA 4F8RA 4FCYA 3K58A 2OZSA 2XRIA 4PY5A 3O3HA 4O0IA 3LDSA 4KHWA 1IG9A 3T1AA 3QEPA 3NE6A 3LPTA 4OLAA 4DTUA 3F9KA 4CF8A 3QIOA 1LW2A 1J5OA 4F3TA 3S3OA 1IKXA 2YKNA 4W5QA 2YNHA 1Z26A 1NOYA 2VG7A 1S1WA 2D0BA 3VA0A 5HRNA 4ID1A 1NK9A 2DY4A 3OYDA 2WONA 4CGGA 2BGGA 3LPUA 4KV8A 4O44A 3NGIA 2Z1JA 2ITGA 1HMVA 3NH1A 2RN2A 4ID5A 1I3AA 5C24A 4MFBA 4CIFA 4ZTJA 1R0AA 4N5SA 3RWUA 3ZSWA 5HRPA 1RBUA 3KLGA 1NK4A 4CJWA 4CF0A 3OYHA 5J2QA 1T05A 4AHCA 3RMBA 1G15A 1BQMA 3VQQA 2G8WA 4DSIA 3AO5A 4CF2A 3MEDA 4I2QA 4O4GA 3C95A 2PZSA 2HNDA 4XIUA 3SUPA 4PQUA 1VRUA 1YTAA 4DTRA 3VQDA 2YNGA 4PUOA 3DLGA 1L3SA 3PO4A 2OPQA 1ZBIA 2D0CA 3HP9A 3TR8A 1RT2A 3KIOA 4IFYA 3NH2A 1TAUA 3SNNA 3O3GA 4CEBA 2X6SA 3SI6A 2Q3SA 4DSJA 3AVLA 5FRMA 2HHTA 4CEDA 4E1NA 2IC3A 4B9LA 1QTMA 2D0AA 2PY5A 2G8IA 3ZT0A 4J2EA 3VQCA 2P51A 1SL2A 3RMDA 2PYJA 1SKWA 4IFVA 4CEEA 4O55A 4BE2A 4CEQA 4OLBA 3AVFA 4NYFA 1WSHA 1BCMA 2FBYA 4OKEA 3AA4A 3C94A 3KLFA 4DTXA 3A2FA 1LV5A 3OYMA 3PY8A 4ELVA 4DQIA 2IGIA 4Z4FA 3SPYA 4B9UA 4J2DA 4F2SA 1VSFA 3RMCA 2XY5A 3HYFA 4DTMA 1X9MA 3VN5A 5D3GA 3U6FA 3KD1E 1HYZA 1RT4A 1L3TA 3DI6A 4CJTA 4B9TA 3V4IA 1EKEA 2KQ2A 4JS5A 4ELTA 3QESA 4CGHA 4HTUA 2B5JA 3NF9A 4B9VA 2P5OA 1LWCA 1CXQA 4OGEA 4CHYA 4AHVA 3SUNA 2G8FA 4QCLA 2OYQA 3PO5A 4KHNA 4KO0A 4B8AB 1QHTA 4J2AA 1UA0A 1A5VA 1S5JA 1VSDA 3P1GA 4DF8A 1Z25A 3AA2A 4RW8A 4CFCA 3SUOA 4W5OA 2LSNA 3QNNA 3QEXA 4HCCA 3L3UA 1BI4A 2JGUA 3AVIA 2VWJA 3K2PA 1JXBA 4RG8A 5CY4A 4M41A 3IAYA 3P5JA 3NCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEC A;  1NKE A;  1IO2 A;  1ZBH A;  3S3M A;  1RT6 A;  4FZX C;  4NYN A;  4FLV A;  3ZSX A;  2HW3 A;  2E4L A;  4LH4 A;  4IDK A;  3CQ8 A;  1BQN A;  4O0J A;  2HVI A;  4DG1 A;  3QEW A;  4BDP A;  2HHS A;  4CGD A;  3SQ2 A;  2FBT A;  3AVA A;  3V1R A;  4B9N A;  4E7J A;  2X6N A;  1QE1 A;  4HVJ A;  3F73 A;  3MXI A;  3ALY A;  3OJS A;  4OGC A;  4FM2 A;  4K8Z A;  2Y1J A;  5T7B A;  4FLY A;  4Z0U A;  4IBN A;  3HPG A;  3DM2 A;  3V9S A;  3OYE A;  1Q9X A;  1O1W A;  3NF8 A;  1EXQ A;  1SUQ A;  1SV5 A;  1RT5 A;  2HHV A;  4AH9 A;  1KCF A;  2BAN A;  4JS4 A;  1ZBL A;  3WNF A;  2XY7 A;  4CK3 A;  3ZT1 A;  1A5W A;  4HUE A;  4H4M A;  4DF4 A;  2XY8 A;  3RMA A;  4FJH A;  4H8K A;  4FJ9 A;  4OKK A;  3NBP A;  4IKF A;  4FK2 A;  4AHU A;  3QEV A;  1EP4 A;  1LW0 A;  3NDK A;  4M3T A;  2I5J A;  2DTU A;  3M8R A;  1BIU A;  1SKR A;  4BDZ A;  1D5A A;  2OPP A;  4CEO A;  3LZJ A;  4N47 A;  4CJQ A;  4E19 A;  4DFJ A;  2A1R A;  1TK5 A;  3L2U A;  1RDA A;  4KKO A;  1HQE A;  3KK2 A;  4I2P A;  2QKK A;  4BE0 A;  2VWK A;  4OJR A;  4N56 A;  4B3O A;  4YNQ A;  1RNH A;  4M3X A;  1WSJ A;  4DMN A;  1J54 A;  1XWL A;  4DFK A;  1CZ9 A;  1HJR A;  1C1C A;  3AVG A;  1WN7 A;  1NKB A;  1QSY A;  3THV A;  1FKO A;  4EP4 A;  1N6Q A;  3DLE A;  2HB5 A;  4Q5V A;  1N5Y A;  4Z4G A;  1WAF A;  2OZM A;  3T3F A;  1IKW A;  3B6P A;  3BGR A;  4CJU A;  1FK9 A;  1VSH A;  2ZE2 A;  3ZSQ A;  3KK1 A;  2D5R A;  3LP2 A;  1IKV A;  1TL3 A;  4OVL A;  2G8U A;  1JLQ A;  1GOC A;  1L3U A;  4CF1 A;  3UIQ A;  4G1Q A;  3WNE A;  4FJK A;  3DYA A;  3QLH A;  1TGO A;  4KB0 A;  4I9L A;  2KFZ A;  4OPJ A;  4KB1 A;  4DS5 A;  3ZCM A;  4DTO A;  4DU1 A;  4Y1D A;  4OPK A;  4E1M A;  1BIZ A;  1NOZ A;  3CFP A;  5J2M A;  1L5U A;  1KTQ A;  4CJV A;  3KJV A;  3V9Z A;  1TKX A;  4FM0 A;  3L2R A;  4FJI A;  1HYS A;  1D9D A;  4JRQ A;  1BI4 B;  3HO1 A;  2OPR A;  3VQB A;  1RDC A;  4CHP A;  4RW4 A;  4CF9 A;  4B08 A;  2Z1H A;  3FFI A;  4ICL A;  2BDP A;  4M3Y A;  3KLI A;  5CZ1 A;  3KTQ A;  2Z1G A;  2KTQ A;  1S1V A;  3ZT3 A;  2HMI A;  3RR7 A;  1RCH A;  3JSM A;  1KVA A;  1TV6 A;  2ATQ A;  1NKC A;  2IAJ A;  4B9S A;  4KHQ A;  1HYV A;  1HQU A;  1UAX A;  1RIL A;  1IH7 A;  5I42 A;  4DWI A;  4KRF A;  1C0T A;  4NCG A;  4OKJ A;  4Z4H A;  3TAQ A;  3IS9 A;  1WSI A;  4NCB A;  3OYF A;  4BDY A;  5C42 A;  4QOZ B;  5CYM A;  3DRR A;  1XI1 A;  1RT7 A;  4KRE A;  3LAL A;  1X9S A;  4DTS A;  2HNZ A;  1WLJ A;  1S1X A;  3OS1 A;  3EYZ A;  3AO3 A;  1DLO A;  3ISN C;  3V6D A;  2F96 A;  3VA3 A;  4DQR A;  1QQC A;  4DQQ A;  4DSE A;  1KSP A;  4UQG A;  3TI0 A;  4ZTF A;  1SKS A;  1KFS A;  3ZSZ A;  4C8O A;  1ITG A;  3AV9 A;  4CJL A;  5SWM A;  1RBV A;  3EY1 A;  3SV4 A;  4KI4 A;  3IG1 A;  4F2R A;  4DSK A;  2VG5 A;  3C6T A;  2Z1I A;  2NUB A;  3TAM A;  5J1E A;  5HRR A;  4FJM A;  3CG7 A;  2KFN A;  4JRP A;  1KLN A;  3AA5 X;  3LWM A;  2DFH A;  4FJG A;  1JLC A;  2B4J A;  3SQ0 A;  4W5R A;  4KPY A;  3ULD A;  3TAG A;  2QKB A;  1JLB A;  4CE9 A;  1A5X A;  1TK0 A;  3LP3 A;  5FRN A;  2XY6 A;  4LSL A;  2HHU A;  3HPH A;  3ZSV A;  3NH0 A;  4EP5 A;  5HLF A;  1BHL A;  3V81 A;  5HBM A;  1HRH A;  1XHZ A;  5CYQ A;  4CK1 A;  3OYJ A;  1BIS A;  4CJF A;  3K59 A;  4CIE A;  1TAQ A;  4M3U A;  1B9D A;  1KFD A;  5KGW A;  4HCB A;  1S9E A;  3H08 A;  4W5N A;  2VG6 A;  4IG3 A;  1U4B A;  2QK9 A;  3AVB A;  4LH5 A;  4E3S A;  1MU2 A;  2GBZ A;  5FRO A;  3SZ2 A;  2YV0 X;  4FLU A;  3QIN A;  3MEE A;  4CHO A;  1T7P A;  4RW6 A;  4CJ4 A;  3NFA A;  2EX3 A;  2KW4 A;  3D45 A;  1J53 A;  3LAN A;  3VQP A;  3KK3 A;  3OS0 A;  1W0H A;  4CJ3 A;  3SQ1 A;  2W42 A;  2P5G A;  4CEA A;  3AVN A;  4O5B A;  3OY9 A;  3VQ6 A;  4FK4 A;  2XO7 A;  2ZQB A;  3HJF A;  3CFR A;  3KKR A;  3DOK A;  1RDD A;  3MXM A;  1RTD A;  2A1S A;  4DS4 A;  2KZM A;  3IRX A;  1TKT A;  4C8N A;  1I39 A;  1QS4 A;  3VQ7 A;  4AHS A;  3DLH A;  3QIP A;  4HUF A;  3NF6 A;  3SCX A;  1RDB A;  5KGX A;  3CM6 A;  1ASW A;  1EX4 A;  3G10 A;  4CJP A;  3LWL A;  4CES A;  3PX4 A;  4L8R B;  2X78 A;  3M8S A;  4CGF A;  5JS1 A;  1NK0 A;  2E6M A;  3U3G A;  2AJQ A;  1B9F A;  4E7K A;  3LAM A;  3ASM A;  3DRS A;  1K6Y A;  4CHZ A;  3I0S A;  1TL1 A;  3RRH A;  4F4K A;  1DTQ A;  3V9U A;  3OYN A;  5I3U A;  3OYL A;  2X74 A;  3HXM A;  1XC9 A;  1D8Y A;  1C1A A;  1ASV A;  4E0D A;  1RBS A;  3AVM A;  1YVU A;  3K5N A;  3O3F A;  1C0M A;  4BWJ A;  2RF2 A;  1ZBU A;  1JLA A;  1ASU A;  1REV A;  4DTN A;  1NK5 A;  2RPI A;  4KTZ A;  3MAQ A;  4FJJ A;  4FJ7 A;  3K5M A;  1T03 A;  4Q0B A;  4M3W A;  1U45 A;  1RTH A;  3SYZ A;  1CLQ A;  4GMJ B;  4FLX A;  4LY7 A;  5HRS A;  3SV3 A;  2HHW A;  1W9H A;  2IDO A;  3ITH A;  4PA1 A;  3V1O A;  4AHR A;  4CJK A;  3S9H A;  4Z4E A;  1TVR A;  3I8D A;  1JL2 A;  1KRP A;  2O4G A;  3CFO A;  2YHA A;  1ZYQ A;  3G0Z A;  3HM9 A;  3VQ5 A;  3TAE A;  4WE1 A;  1KVC A;  3AO1 A;  4CHQ A;  5HRO A;  3NF7 A;  2RKI A;  1HNI A;  4M42 A;  1ZBF A;  4FJ5 A;  1LAV A;  3ZSR A;  4CFD A;  3OYI A;  2GUI A;  3NGY A;  4R5P A;  3OS2 A;  4E7L A;  5HP1 A;  2YHB A;  4KFB A;  3VQ4 A;  4FXD A;  3DLK A;  4CER A;  4FLW A;  4FZZ A;  1WSE A;  3K57 A;  1VSL A;  2F8S A;  1S6P A;  4KI6 A;  3PUF A;  1JLF A;  1XHX A;  4TSX A;  2E6L A;  1RT3 A;  3L2V A;  3L2W A;  3DOL A;  5EU7 A;  2P1J A;  3VQA A;  3U3Y A;  1U48 A;  3HT3 A;  1RBR A;  1UA1 A;  2OA8 A;  5KI6 A;  4DQP A;  3WNG A;  3I0R A;  3M8P A;  3OYC A;  1Y97 A;  4J2B A;  3NAE A;  1C6V A;  4CJE A;  2DFE A;  3CYM A;  2YNF A;  4MQ3 A;  3HPO A;  3JYT A;  2QXF A;  1LWF A;  4E89 A;  4Y1C A;  3ZSO A;  3QER A;  3TWH A;  1KVB A;  4E7H A;  4CK2 A;  4HUG A;  3AO4 A;  1T8E A;  1FKP A;  2G8V A;  4DSF A;  1D9F A;  4Z4C A;  1BGX T;  2IS3 A;  3S3N A;  4BWM A;  4W5T A;  3T19 A;  1U49 A;  1NJW A;  4KHY A;  4PWD A;  5K14 A;  1QSS A;  3SJJ A;  3OYB A;  3D0P A;  4JLH A;  2FC0 A;  1J9A A;  1VSK A;  3KLH A;  3HK2 A;  1YT3 A;  1CZB A;  4DU4 A;  3QET A;  4DFM A;  3HVT A;  1NK8 A;  1IKY A;  1F21 A;  3KKS A;  5FDL A;  4CEC A;  3DLR A;  1S1U A;  5DMR A;  1QSL A;  1Q9Y A;  1TKD A;  3RTV A;  3AVJ A;  3KD5 E;  4Z4I A;  4KTW A;  4I7F A;  3E01 A;  1TK8 A;  3WNH A;  1C1B A;  2YNI A;  4DTP A;  4AIL C;  4LD0 A;  2GV9 A;  4LSN A;  4CEF A;  4K8X A;  3LAK A;  1S9G A;  3LZI A;  4FJX A;  3O4N A;  2HNY A;  4FLZ A;  4KTQ A;  3K5L A;  3OVN A;  5CZ2 A;  3HL8 A;  5KRT A;  4DU3 A;  4N76 A;  4FVM A;  3BDP A;  4FLT A;  4IG0 A;  3DRP A;  5KRS A;  4B9M A;  4DLE A;  2OPS A;  3SQ4 A;  4DTJ A;  1VSI A;  1U04 A;  2IOC A;  4BE1 A;  1X1P A;  1UWB A;  1YTU A;  1GOA A;  1JKH A;  1RT1 A;  3NHG A;  4CCH A;  1JXE A;  2ETJ A;  1WSF A;  1VSM A;  1DTT A;  3L8B A;  3AA3 A;  1Q8I A;  1RTI A;  3VQE A;  4DFP A;  1SL0 A;  4DSL A;  4FJN A;  3TAN A;  5J2P A;  2KZZ A;  3EZ5 A;  1JL1 A;  2JLE A;  3AO2 A;  3TAB A;  2O4I A;  1S6Q A;  3LP0 A;  4CHN A;  3MEG A;  3L2Q A;  3QEI A;  3QO9 A;  4EZ9 A;  4YFU A;  3LP1 A;  3HST B;  1JLE A;  4FW2 A;  5JS2 A;  3ZT4 A;  4C8L A;  2PYL A;  1TKZ A;  4M3Z A;  2YKM A;  1VK0 A;  2FBV A;  1WAJ A;  2R7Y A;  3DMJ A;  3QNO A;  1NK7 A;  3OYK A;  4KAZ A;  3VQ8 A;  4CGI A;  1WSG A;  4CEZ A;  5SZT A;  1NK6 A;  1LWE A;  3PV8 A;  1L3V A;  1WNS A;  4HHT A;  3O4Q A;  4B8C A;  3OYA A;  1RTJ A;  3L3V A;  4F3O A;  3MXJ A;  2EHG A;  3CM5 A;  5DK5 A;  4CGJ A;  3V9W A;  3TAF A;  4C8K A;  3RRG A;  4ZHR A;  4AHT A;  3DLB A;  3M8Q A;  5KTQ A;  1HPZ A;  1VRT A;  4GVM A;  4H4O A;  3AVC A;  2Y1I A;  2G8H A;  4N41 A;  3C6U A;  3K5O A;  3AVK A;  1NJY A;  4CFB A;  4FZY A;  1NJZ A;  4CJ5 A;  4FW1 A;  3SPZ A;  4FK0 A;  4CJS A;  4KHU A;  1S1T A;  4QAG A;  4FYD A;  3NGZ A;  1SL1 A;  2G8K A;  3KLE A;  4RW9 A;  1EET A;  1HNV A;  3B6O A;  2HHX A;  3HP6 A;  3PX6 A;  2HVH A;  4RW7 A;  1C0U A;  1GOB A;  2ZD1 A;  1BL3 A;  4E7I A;  4GW6 A;  5J2N A;  2HHQ A;  4M3R A;  3OYG A;  2BE2 A;  1CXU A;  1VSJ A;  4CIG A;  4FM1 A;  3PX0 A;  4FJ8 A;  3V9X A;  1B92 A;  2FBX A;  1NJX A;  3TAR A;  3RR8 A;  3ZT2 A;  4EZ6 A;  4C8M A;  1VSE A;  5E41 A;  2DFF A;  4M45 A;  3TAP A;  5C25 A;  2B6A A;  4CFA A;  1X9W A;  4NCA A;  2WOM A;  2XHB A;  4I9Q A;  3AVH A;  4CJR A;  4ELU A;  4FJL A;  2F8T A;  1UOC A;  3P83 D;  3VQ9 A;  3ZSY A;  3HVR A;  3SUQ A;  1JLG A;  1KLM A;  4DQS A;  3V1Q A;  1BCO A;  1LAW A;  4DLG A;  3OJU A;  1U47 A;  1FXX A;  4BAC A;  1RBT A;  4KHS A;  4F8R A;  4FCY A;  3K58 A;  2OZS A;  2XRI A;  4PY5 A;  3O3H A;  4O0I A;  3LDS A;  4KHW A;  1IG9 A;  3T1A A;  3QEP A;  3NE6 A;  3LPT A;  4OLA A;  4DTU A;  3F9K A;  4CF8 A;  3QIO A;  1LW2 A;  1J5O A;  4F3T A;  3S3O A;  1IKX A;  2YKN A;  4W5Q A;  2YNH A;  1Z26 A;  1NOY A;  2VG7 A;  1S1W A;  2D0B A;  3VA0 A;  5HRN A;  4ID1 A;  1NK9 A;  2DY4 A;  3OYD A;  2WON A;  4CGG A;  2BGG A;  3LPU A;  4KV8 A;  4O44 A;  3NGI A;  2Z1J A;  2ITG A;  1HMV A;  3NH1 A;  2RN2 A;  4ID5 A;  1I3A A;  5C24 A;  4MFB A;  4CIF A;  4ZTJ A;  1R0A A;  4N5S A;  3RWU A;  3ZSW A;  5HRP A;  1RBU A;  3KLG A;  1NK4 A;  4CJW A;  4CF0 A;  3OYH A;  5J2Q A;  1T05 A;  4AHC A;  3RMB A;  1G15 A;  1BQM A;  3VQQ A;  2G8W A;  4DSI A;  3AO5 A;  4CF2 A;  3MED A;  4I2Q A;  4O4G A;  3C95 A;  2PZS A;  2HND A;  4XIU A;  3SUP A;  4PQU A;  1VRU A;  1YTA A;  4DTR A;  3VQD A;  2YNG A;  4PUO A;  3DLG A;  1L3S A;  3PO4 A;  2OPQ A;  1ZBI A;  2D0C A;  3HP9 A;  3TR8 A;  1RT2 A;  3KIO A;  4IFY A;  3NH2 A;  1TAU A;  3SNN A;  3O3G A;  4CEB A;  2X6S A;  3SI6 A;  2Q3S A;  4DSJ A;  3AVL A;  5FRM A;  2HHT A;  4CED A;  4E1N A;  2IC3 A;  4B9L A;  1QTM A;  2D0A A;  2PY5 A;  2G8I A;  3ZT0 A;  4J2E A;  3VQC A;  2P51 A;  1SL2 A;  3RMD A;  2PYJ A;  1SKW A;  4IFV A;  4CEE A;  4O55 A;  4BE2 A;  4CEQ A;  4OLB A;  3AVF A;  4NYF A;  1WSH A;  1BCM A;  2FBY A;  4OKE A;  3AA4 A;  3C94 A;  3KLF A;  4DTX A;  3A2F A;  1LV5 A;  3OYM A;  3PY8 A;  4ELV A;  4DQI A;  2IGI A;  4Z4F A;  3SPY A;  4B9U A;  4J2D A;  4F2S A;  1VSF A;  3RMC A;  2XY5 A;  3HYF A;  4DTM A;  1X9M A;  3VN5 A;  5D3G A;  3U6F A;  3KD1 E;  1HYZ A;  1RT4 A;  1L3T A;  3DI6 A;  4CJT A;  4B9T A;  3V4I A;  1EKE A;  2KQ2 A;  4JS5 A;  4ELT A;  3QES A;  4CGH A;  4HTU A;  2B5J A;  3NF9 A;  4B9V A;  2P5O A;  1LWC A;  1CXQ A;  4OGE A;  4CHY A;  4AHV A;  3SUN A;  2G8F A;  4QCL A;  2OYQ A;  3PO5 A;  4KHN A;  4KO0 A;  4B8A B;  1QHT A;  4J2A A;  1UA0 A;  1A5V A;  1S5J A;  1VSD A;  3P1G A;  4DF8 A;  1Z25 A;  3AA2 A;  4RW8 A;  4CFC A;  3SUO A;  4W5O A;  2LSN A;  3QNN A;  3QEX A;  4HCC A;  3L3U A;  1BI4 A;  2JGU A;  3AVI A;  2VWJ A;  3K2P A;  1JXB A;  4RG8 A;  5CY4 A;  4M41 A;  3IAY A;  3P5J A;  3NCI A; 
#chains in the Genus database with same CATH topology
 1NLV A;  1NKE A;  5IT9 O;  1WBB A;  4WQ5 C;  3ZSX A;  4IDK A;  1BQN A;  3J80 O;  1OVY A;  1J6Z A;  4IO9 L;  3AVA A;  4B9N A;  1VHX A;  2X6N A;  4XH4 A;  3N4P A;  3O1B A;  5EOY A;  3VF4 A;  1EXQ A;  1RT5 A;  1KXP A;  1NWK A;  4JS4 A;  1A5W A;  4H4M A;  4K25 A;  2XY8 A;  4FJH A;  4OKK A;  2F9T A;  4WQ5 A;  1EP4 A;  1BIU A;  2OPP A;  4N47 A;  4CJQ A;  4E19 A;  1JCE A;  1C0G A;  4FWP A;  1RDA A;  1HQE A;  1E4G T;  4I2P A;  5AQH A;  3LDN A;  4B9Q A;  4DFK A;  1J54 A;  1QSY A;  3I8B A;  1C1C A;  3AVG A;  1WN7 A;  1OH6 A;  4EP4 A;  3D2F A;  4Z4G A;  2JWK A;  2OZM A;  4X66 K;  1BA0 A;  3J7A P;  1HJO A;  2ZE2 A;  1VSH A;  3ZSQ A;  2D5R A;  3LP2 A;  1TL3 A;  4NLC A;  4BRG A;  3BUZ B;  4CF1 A;  4G1Q A;  3UIQ A;  2O8C B;  3DYA A;  4C1N I;  1GLJ O;  4CZM A;  3J7Z O;  4OPJ A;  2E2O A;  4B1V A;  1ZXO A;  4Y1D A;  2ZF5 O;  4BR5 A;  5J2M A;  3MX2 A;  3KJV A;  3TTF A;  1HYS A;  4FM0 A;  3L2R A;  4OX9 K;  3HO1 A;  4CZJ A;  2PAV A;  3VQB A;  2UUB K;  1NGB A;  4K42 A;  5AQT A;  4B08 A;  3FFI A;  1RCH A;  3JSM A;  4B9S A;  1HQU A;  4DWI A;  1C0T A;  4NCB A;  3CJC A;  3AGR A;  1XI1 A;  3WXI A;  4GVE A;  1WLJ A;  1S1X A;  3EYZ A;  1BA1 A;  5BN9 A;  3PIP L;  3WUH A;  4DQR A;  1KSP A;  5LJV A;  4C8O A;  1VQ4 N;  3AV9 A;  1RBV A;  3EY1 A;  2O8D A;  4PKG A;  1Q81 O;  4DSK A;  5J1E A;  2Z1I A;  3BZK A;  4FJM A;  3A5M C;  3UE5 A;  3O80 A;  1JLC A;  3SQ0 A;  4YOR A;  1IBK K;  3ULD A;  3TAG A;  1JLB A;  4U67 L;  1TK0 A;  2AP1 A;  3LP3 A;  2OCE A;  4FWM A;  4LSL A;  3HPH A;  3IFR A;  3NH0 A;  4LF9 K;  1XHZ A;  5CYQ A;  4CJF A;  3K59 A;  1KFD A;  3H08 A;  1U4B A;  4LH5 A;  2NRW A;  4E3S A;  2GBZ A;  3D2F B;  5FRO A;  3B8A X;  2CGJ A;  2YV0 X;  4FOI A;  3U4L A;  4CHO A;  1T7P A;  4RW6 A;  3UB5 A;  3D45 A;  1BDG A;  2W42 A;  4JI1 K;  3OY9 A;  4DV1 K;  3VQ6 A;  5TKW A;  3CFR A;  3KKR A;  5KQD A;  3MXM A;  4LF7 K;  1WBD A;  3R6M A;  2QXL A;  4F9O A;  3QIP A;  4RWT A;  4HUF A;  1WB9 A;  1RDB A;  4A59 A;  3I33 A;  3AAR A;  3BZC A;  4CES A;  3PX4 A;  4CGF A;  1CZA N;  2NRZ A;  4E7K A;  3HSC A;  1TL1 A;  4EAH D;  1DTQ A;  1P90 A;  3OYL A;  1XC9 A;  4CVN E;  1RBS A;  2E1Z A;  1YVU A;  1ZBU A;  2RPI A;  1OH7 A;  4FJJ A;  1T03 A;  1U45 A;  3CCL N;  5KPT A;  1Q7Y O;  1CLQ A;  2IDO A;  4PA1 A;  4A57 A;  4MLH A;  1NGD A;  3I8D A;  1M1K O;  3CFO A;  2WUS A;  3KK7 A;  4C1N K;  5F2R A;  3VQ5 A;  1DT9 A;  2Q36 A;  4CHQ A;  5HRO A;  4QS9 A;  4QS8 A;  5AQL A;  1LAV A;  3ZSR A;  3OYI A;  4FJ5 A;  2O8D B;  4FLW A;  2GWJ A;  3K57 A;  2BTF A;  4R79 A;  2F8S A;  3T1Y K;  5M1P A;  1XHX A;  3L2V A;  1RT3 A;  1XNR K;  3L2W A;  1EWR A;  4DR3 K;  1U48 A;  1UA1 A;  4DCH A;  3I0R A;  2ZGY A;  3M8P A;  3OYC A;  3CC4 N;  4J2B A;  3NAE A;  1N33 K;  5M1K A;  3HPO A;  3JYT A;  1KD1 O;  4E89 A;  1KVB A;  3JXU A;  5E84 A;  5M1F A;  1D9F A;  1HX1 A;  4A5A A;  4JKC A;  1QSS A;  3G6E N;  3D0P A;  5ADX H;  3HK2 A;  1CZB A;  4IEI A;  1IKY A;  1F21 A;  1QQN A;  1NGF A;  2IVP A;  4I7F A;  3UKR A;  1RDU A;  4YOU A;  2H3G X;  4CEF A;  1S9G A;  4KTQ A;  5AQO A;  3OVN A;  5CZ2 A;  1M90 O;  4FVM A;  1WOQ A;  3AY9 A;  4B9M A;  3DRP A;  1QZ5 A;  2QA4 N;  2NRV A;  1HNX K;  1X1P A;  1YTU A;  1MWM A;  3MN9 A;  3L8B A;  2ETJ A;  1WSF A;  1HKB A;  3OTO K;  5J2P A;  2KZZ A;  2JLE A;  4M63 C;  3L2Q A;  3QO9 A;  1W7A A;  4FW2 A;  5AQP A;  2UXC K;  2YKM A;  3O9T A;  3QNO A;  3VQ8 A;  4CGI A;  3O9R A;  1LWE A;  1WNS A;  4JHD A;  4HHT A;  4F3O A;  1RTJ A;  3MXJ A;  4CGJ A;  5DK5 A;  4CZH A;  1EWQ A;  1N8R O;  3RRG A;  1BOT O;  2F4V K;  3DLB A;  4B1X B;  1IBL K;  3AVK A;  3E66 A;  1IJJ A;  4CFB A;  1GLF O;  4CZF A;  4FWQ A;  4FOE A;  3NGZ A;  2HHX A;  4RW7 A;  1C0U A;  3SK3 A;  5JIC A;  2ZD1 A;  4WF9 L;  3J81 O;  4GW6 A;  1BG3 A;  1QVF M;  1HUX A;  3OYG A;  4FM1 A;  4XH1 A;  2FBX A;  5BRH A;  4EZ6 A;  4C8M A;  2DFF A;  3CJ1 A;  1TUU A;  2VQE K;  2UXB K;  2XHB A;  1K8A O;  3P83 D;  3VQ9 A;  4DV6 K;  3ZEU B;  3V1Q A;  4DLG A;  4GKK K;  4PY5 A;  5AQI A;  4KHW A;  3LDP A;  3M1F A;  4O8K A;  1IG9 A;  5FPD A;  3TTD A;  1VQ6 N;  3UKR B;  4DTU A;  4BQZ A;  3QIO A;  3SBT A;  2YNH A;  1Z26 A;  2J4R A;  3O9S A;  2D0B A;  2VGN A;  3OYD A;  2WON A;  2BGG A;  2FSN A;  4KV8 A;  4O44 A;  3NGI A;  2Z1J A;  1OH8 A;  4FWK A;  5GAE P;  4ILJ A;  3CCQ N;  2RN2 A;  3OHR A;  1I3A A;  1R0A A;  1HLU A;  3ZSW A;  5HRP A;  3EKU A;  1HNW K;  4MO4 A;  3L4Q A;  1T05 A;  4AHC A;  3W3D A;  3MK6 A;  4DSI A;  3M5R A;  1XC3 A;  3HOT A;  2O8B A;  4PQU A;  4IFE A;  3CIP A;  3VQD A;  5DM7 L;  5BR8 K;  4IO8 A;  2D0C A;  4CW7 B;  3F5T A;  4CED A;  4E1N A;  4JHD B;  3PSI A;  2QWM A;  5H1S Q;  2PYJ A;  4CEE A;  2GTD A;  4O55 A;  1YI2 N;  1BCM A;  3BEX A;  4Z4F A;  1JCF A;  4J2D A;  3I56 N;  2I7N A;  4F2S A;  2XY5 A;  3HYF A;  2QM1 A;  3KD1 E;  1RT4 A;  1VQN N;  3CI5 A;  2QWP A;  3DI6 A;  3V4I A;  2E1Y A;  4HTU A;  3PIO L;  1YJ9 N;  2P5O A;  1LOT B;  4AHV A;  3PO5 A;  3T69 A;  4GY2 B;  4B8A B;  3P1G A;  1VSD A;  2P9I A;  2GUP A;  3SUO A;  3QEX A;  1YJW N;  4FO0 A;  2JGU A;  4Y0W A;  3MDQ A;  3K2P A;  3EN9 A;  4DSE A;  3MEC A;  4KH5 A;  4BRI A;  1IV0 A;  4FZX C;  4BRA A;  2HW3 A;  1ATR A;  3CQ8 A;  3ZLJ A;  4O0J A;  1D4X A;  3QEW A;  2HHS A;  4CGD A;  3F73 A;  2A3Z A;  3ALY A;  4FL9 A;  4OGC A;  4K8Z A;  5T7B A;  3DM2 A;  3OYE A;  3NF8 A;  3VF2 A;  2HHV A;  3QDK A;  4AH9 A;  2GX9 A;  4DR4 K;  3JS6 A;  5M1N A;  3G71 N;  2E2P A;  3GOI A;  2I7P A;  2QWN A;  1U6Z A;  2NZT A;  4BQL A;  3AAQ A;  4JI5 K;  3FZM A;  4FK2 A;  4CBX A;  1LW0 A;  3P31 A;  4M3T A;  2O8B B;  1SKR A;  3LZJ A;  3C7N A;  4DFJ A;  3DXK A;  3VGM A;  3KK2 A;  4BC3 A;  4N56 A;  3IKM A;  1NGE A;  2FXU A;  1XWL A;  4CBU A;  5AQY A;  3THV A;  4DKW A;  4JI6 K;  4Q5V A;  4FWN A;  3T3F A;  3BGR A;  4OPH A;  4A62 A;  3KK1 A;  1IKV A;  4OVL A;  1JLQ A;  1GOC A;  3C6H A;  1L3U A;  1YAG A;  1K9M O;  1TGO A;  4I9L A;  4A5B A;  2KFZ A;  1DKG D;  2UYT A;  4KB1 A;  5ADX A;  4DTO A;  4OPK A;  2P9I B;  1L5U A;  1KTQ A;  3V9Z A;  1Q86 O;  2IIR A;  4FJI A;  4JRQ A;  2OPR A;  4CHP A;  3HI0 A;  4NXM K;  4CF9 A;  2Z1H A;  1K8K A;  4BY9 C;  3ZT3 A;  2HMI A;  3CCU N;  3RR7 A;  2ATQ A;  3VEV A;  4KHQ A;  1IH7 A;  5I42 A;  1HKC A;  4OKJ A;  4Z4H A;  1WSI A;  3P39 A;  4QOZ B;  3H3O B;  4CBW A;  4JYA K;  1X9S A;  4JI0 K;  3OS1 A;  3AO3 A;  1DLO A;  2QTD A;  3E1Y A;  4LF6 K;  1YF5 L;  2F96 A;  5AQJ A;  3VA3 A;  1QQC A;  1IG8 A;  1SKS A;  4DV2 K;  3ZSZ A;  2E2Q A;  2QWR A;  3ID8 A;  5LMU K;  3SV4 A;  3IG1 A;  2VG5 A;  4B1Y B;  1HR0 K;  3TAM A;  1MWK A;  1KLN A;  5F1X A;  3HM8 A;  3HBT A;  4FJG A;  2B4J A;  4YY3 K;  5JVG L;  3TSU A;  4KPY A;  3VES A;  1K73 O;  4CE9 A;  5AQX A;  4ISF A;  1U2V A;  3QFP A;  3C7N B;  4FWS A;  4JKD A;  2HHU A;  4CD1 A;  3V81 A;  3DXK B;  3TTC A;  1HRH A;  4BC5 A;  3CME N;  1TAQ A;  5KGW A;  2QK9 A;  3AVB A;  4JI3 K;  3SZ2 A;  4FLU A;  4CJ4 A;  3NFA A;  2P9K A;  3LAN A;  3P4I A;  3VQP A;  3OS0 A;  4CEA A;  5LJW A;  4WYB A;  4O5B A;  5CHI A;  3ULE A;  1JJ2 M;  2ZQB A;  3HJF A;  1RTD A;  1RDD A;  1QS4 A;  3VQ7 A;  4AHS A;  3FFK B;  3CM6 A;  4CJP A;  2JWL A;  5AQV A;  5JS1 A;  1NK0 A;  2E6M A;  1HPM A;  1B9F A;  3LDQ A;  1K8K B;  5AQN A;  5I3U A;  3OYN A;  1TUY A;  3DLL L;  3HXM A;  5I9E B;  1TYQ A;  2E8A A;  1W97 L;  3ENB A;  5AQQ A;  2V52 B;  3GBT A;  3O3F A;  4LF8 K;  1NK5 A;  4KTZ A;  3LDL A;  3K5M A;  1ILY A;  4FLX A;  3SV3 A;  2HHW A;  3CPE A;  4LF5 K;  1W9H A;  2F9W A;  3BP8 A;  3LM9 A;  4JKB A;  4Z4E A;  1TVR A;  1LCU A;  3O5B A;  2O4G A;  1KRP A;  2YHA A;  4BRM A;  3G0Z A;  3THW A;  1QQO A;  1HNI A;  3SJJ A;  4CFD A;  1H1V A;  2GUI A;  4R5P A;  3DLK A;  4DHY A;  4BRE A;  3PUF A;  1T3V A;  4H0T B;  4JNE A;  2E2N A;  3U3Y A;  1U2V B;  4BRD A;  4AQY K;  3EL2 A;  1RBR A;  5KI6 A;  4O8U A;  5JLH A;  3NVK A;  4EHT A;  2HST A;  1C6V A;  4JKF A;  4CJE A;  2YNF A;  5CE3 A;  3QER A;  3LM2 A;  1QVG M;  4CK2 A;  3CC7 N;  3OW2 M;  4Z4C A;  2IS3 A;  1NJW A;  1U49 A;  4PWD A;  5AZI B;  3N4Q A;  5K14 A;  2P9K B;  2FC0 A;  1J9A A;  1VSK A;  3ULE B;  2ZWH A;  3QET A;  5FDL A;  5C2F A;  4GKJ K;  3DLR A;  4LC9 B;  5LL6 Z;  3RTV A;  1TK8 A;  2HBL A;  1X9J A;  2D0O A;  3LAK A;  3LZI A;  3T1H K;  4IOA L;  5BRF A;  3W0L A;  2HBJ A;  4X65 K;  4DU3 A;  3NMU A;  4FLT A;  4IG0 A;  3WT0 A;  4JKH A;  1VSI A;  2YJE A;  1TYQ B;  1UWB A;  2WFB A;  1VSM A;  1DTT A;  4BRH A;  1VQP N;  1ATN A;  1RTI A;  3VQE A;  4DSL A;  3VEO A;  1GLL O;  3TAN A;  3EZ5 A;  1S6Q A;  4BRC A;  2A40 A;  5GIO A;  3CCM N;  3U8X A;  3HST B;  1JLE A;  3ZT4 A;  1TKZ A;  1VQO N;  3C65 A;  3THW B;  3EO3 A;  3OYK A;  3DWL A;  5SZT A;  1L3V A;  1T44 A;  3VPZ A;  1Q18 A;  2W6K A;  3O4Q A;  2F7T A;  3CM5 A;  3MN6 A;  4N41 A;  2CGK A;  3K5O A;  4LF4 K;  4FZY A;  4FW1 A;  4CJS A;  1S1T A;  4FYD A;  2IVO A;  4KH4 A;  1EET A;  4RW9 A;  3R8E A;  3HP6 A;  4BR9 A;  1O13 A;  2FLO A;  1DEJ A;  5F0X A;  4H0O A;  4DR2 K;  2BE2 A;  1X3N A;  4FJ8 A;  4MDB A;  3V9X A;  1MA9 B;  3HOS A;  3ZT2 A;  4BGA A;  1XMO K;  4CFA A;  1X9W A;  1P8Z A;  4IXC A;  4FJL A;  2F8T A;  3MN7 A;  3HVR A;  4DQS A;  3GG4 A;  1BCO A;  3SAH A;  4YOV A;  2YI1 A;  5EY4 A;  4IJN A;  3T1A A;  3QEP A;  3NE6 A;  4PL8 A;  3CMA N;  3VF6 A;  3CCJ N;  1V4S A;  3PSF A;  1J5O A;  3E9P A;  1IKX A;  4M7Y A;  4W5Q A;  4AM7 A;  5HL7 L;  4ID1 A;  4MDA A;  4CGG A;  3LPU A;  4G9Z A;  3NH1 A;  4CIF A;  3VGK A;  2DPN A;  4NLB A;  4CJW A;  2NNW A;  1BQM A;  2QWL A;  4CF2 A;  4I2Q A;  4YHH K;  3A5O C;  2FSJ A;  3RVC A;  2ZGZ A;  4DTR A;  2A41 A;  3DLG A;  2OPQ A;  4MO5 A;  1ZBI A;  3ZEU A;  4IFY A;  1TAU A;  5FRM A;  2Q3S A;  3D2E A;  3AVL A;  1IBM K;  2D0A A;  2PY5 A;  3VEW A;  4DR5 K;  1NMD A;  1SL2 A;  3RMD A;  1EQY A;  3O08 A;  4BE2 A;  4CEQ A;  3CCR N;  1NG9 A;  3PY8 A;  3C94 A;  4DTX A;  2HBK A;  4H5V A;  2Q1N A;  1E3M A;  3MX5 A;  1BU6 O;  3SPY A;  1FW6 A;  3IMX A;  1X9M A;  3FGU A;  1OKJ A;  5D3G A;  1HYZ A;  4B9T A;  3VGL A;  2P9S A;  4JS5 A;  5CR4 A;  3QES A;  5BPL A;  3NF9 A;  3ENO A;  3THY A;  4CHY A;  1CXQ A;  4OGE A;  1KQS M;  2WBN A;  2G8F A;  4KHN A;  1UA0 A;  1S5J A;  4DF8 A;  1Z25 A;  4HCC A;  2NRT A;  4I6M A;  2O8E A;  4FPA A;  3GE1 A;  1VAZ A;  3A8Y A;  1QZ6 A;  5AQG A;  3AVI A;  3NCI A;  4H03 B;  1IO2 A;  1ZBH A;  3S3M A;  1RT6 A;  3ENH A;  4DUY K;  4NYN A;  4FLV A;  3FR0 A;  2E4L A;  4BDP A;  3SQ2 A;  2FBT A;  3V1R A;  4E7J A;  3Q7B A;  2ZJR L;  1QE1 A;  1SAZ A;  1BO5 O;  5AJ3 K;  1VQ9 N;  4FM2 A;  4IDH A;  4JI4 K;  4CZL A;  3CJ9 A;  1O1W A;  5FLX O;  3CXC M;  1Q9X A;  1S22 A;  3H45 C;  1KCF A;  1Z6R A;  3A0I X;  2BAN A;  3EE8 A;  3SAG A;  3LDO A;  2XY7 A;  3ZT1 A;  4HUE A;  3RMA A;  4FJ9 A;  3CCV N;  3QEV A;  5FPE A;  3BF1 A;  2P9P A;  5BN8 A;  3K9K A;  3O6W A;  5HOO A;  4CEO A;  4BRK A;  1BUP A;  1KC8 O;  1NM1 A;  4KKO A;  3WXK A;  3D2E B;  2VWK A;  4OJR A;  4YNQ A;  1GLA G;  4J8F A;  1WSJ A;  1HJR A;  1DGK N;  1FKO A;  3H3N O;  4CJ7 A;  4H5T A;  1N5Y A;  4B3S K;  1WAF A;  3B6P A;  2YHY A;  3ID6 A;  1FK9 A;  4WFA L;  4BR2 A;  4BC2 A;  4PHT X;  5BRD A;  3WNE A;  4FPB A;  3VTH A;  3QLH A;  2P9S B;  5GAH P;  4KB0 A;  3THY B;  4IZ9 A;  4DU1 A;  4E1M A;  3SAF A;  4BRQ A;  3CFP A;  3WQU A;  2A6A A;  4CJV A;  1TKX A;  5C10 A;  1D9D A;  4I6M B;  2O8E B;  2BDP A;  4M3Y A;  4EIA A;  4ICL A;  4BR0 A;  3KTQ A;  2Z1G A;  2KTQ A;  4PKH A;  1KVA A;  1NBW A;  1UAX A;  1RIL A;  2W40 A;  4AM6 A;  4X64 K;  3TAQ A;  3IS9 A;  4JK8 A;  4BDY A;  5JMV A;  1RT7 A;  3LAL A;  3U9D A;  2HNZ A;  4WCE L;  1VQ8 N;  1KAY A;  3QIC A;  4UQG A;  3TI0 A;  4ZTF A;  5M1O A;  4X62 K;  2OTJ N;  4JKE A;  4CJL A;  4CZE A;  5SWM A;  4KI4 A;  4OPA A;  4B3R K;  2NUB A;  1QHA A;  5HRR A;  2KFN A;  4JRP A;  5AQS A;  2DFH A;  3TSP A;  4WQ4 A;  2P9P B;  1I94 K;  5FRN A;  1R59 O;  3MWT A;  5AZJ B;  3ZSV A;  5HLF A;  4UY8 O;  1BHL A;  5HBM A;  4CK1 A;  1G99 A;  1BIS A;  3OYJ A;  4DB3 A;  4CIE A;  1B9D A;  2VG6 A;  4IG3 A;  4Z94 A;  1RDW X;  2CGL A;  4O5F A;  3KZB A;  3L0Q A;  2EX3 A;  2KW4 A;  3ZET A;  4FWL A;  3KK3 A;  4JI7 K;  3AVN A;  3BY5 A;  4FK4 A;  2XO7 A;  3L4I A;  3VTI A;  1TKT A;  2QWQ A;  4C8N A;  1YIJ N;  1I39 A;  3DLH A;  3NF6 A;  4HWI A;  3SCX A;  5KGX A;  4JV5 K;  1EX4 A;  4L8R B;  2X78 A;  1GLB G;  3C0B A;  3U3G A;  2AJQ A;  3VEY A;  3LAM A;  3ASM A;  4F4K A;  3TU5 A;  3H6E A;  3V9U A;  4DR6 K;  1D8Y A;  2QW9 A;  2HMP A;  3AVM A;  2VWB A;  3VER A;  1ZBS A;  2RF2 A;  4BWJ A;  1JLA A;  1REV A;  3MAQ A;  4FJ7 A;  3CCS N;  1RTH A;  3SYZ A;  4GMJ B;  4LY7 A;  3ATU A;  4AHR A;  3S9H A;  2IVN A;  1KAX A;  4YOT A;  4JI2 K;  1KVC A;  4M42 A;  1YHQ N;  4B1U B;  2UUA K;  2YHB A;  1Y64 A;  3CER A;  4CER A;  1VQK N;  1WSE A;  1W2B M;  3DAW A;  1VSL A;  1JLF A;  1BWF O;  1NGC A;  3DOL A;  3VQA A;  3H46 O;  3MWP A;  4DQP A;  3WNG A;  1Y97 A;  2Q31 A;  2DFE A;  1NGA A;  1LWF A;  2D1K A;  4JAX A;  4Y1C A;  5M1Q A;  5GAD P;  3JAM O;  4E7H A;  1T8E A;  3AO4 A;  1FKP A;  2G8V A;  2P9L A;  3FZL A;  1BGX T;  3S3N A;  4XEI A;  3T19 A;  3VEZ A;  4LFA K;  4KHY A;  3EZW A;  4ILG B;  3ZET B;  1NGG A;  3OYB A;  3O1W A;  1EO1 A;  4DU4 A;  4DFM A;  1NK8 A;  4CEC A;  3F2K A;  5DMR A;  4BGB A;  3G25 A;  2EWS A;  4H0Y B;  3KD5 E;  4KTW A;  1VQ5 N;  4DTP A;  2YNI A;  3SBG A;  4LD0 A;  2GV9 A;  4K8X A;  3UKU B;  4CZK A;  3SLC A;  3HL8 A;  4BRN A;  4N76 A;  1C0F A;  5KRS A;  4JEP A;  4DLE A;  1V4T A;  1XMQ K;  3SQ4 A;  4DTJ A;  1GLC G;  1U04 A;  1ZC6 A;  4BE1 A;  2NLX A;  4RTF D;  1GOA A;  5C12 A;  5KPR A;  1JXE A;  2NRX A;  4DFP A;  4FJN A;  4BVO A;  1JL1 A;  4DV3 K;  5B8H A;  3AO2 A;  3TAB A;  3LP0 A;  3QEI A;  5AQR A;  5AZI A;  4C8L A;  3F9M A;  2PYL A;  2FBV A;  1WAJ A;  2R7Y A;  3SJH A;  2E20 A;  1NK7 A;  2P9U A;  5JLF A;  1WSG A;  3GL1 A;  3KHY A;  4CEZ A;  3MMV A;  3TSQ A;  3OYA A;  3L3V A;  3V9W A;  4BR4 A;  3K9J A;  4AHT A;  2E5L K;  5KTQ A;  4H4O A;  2Y1I A;  2G8H A;  3AVC A;  3C6U A;  1NJY A;  4C23 A;  4V19 S;  1NJZ A;  1ESV A;  4ISG A;  4CJ5 A;  4FK0 A;  4QAG A;  5JVH L;  1SL1 A;  2W6L A;  3B6O A;  3PX6 A;  2HVH A;  1GOB A;  1BL3 A;  4M3R A;  1CXU A;  1VSJ A;  4CIG A;  1GLD G;  4H5N A;  1NU0 A;  1VSE A;  4M45 A;  2P9L B;  3TAP A;  2B6A A;  2WOM A;  4I9Q A;  3AVH A;  5BPN A;  1NGI A;  4CJR A;  4YOW A;  3ZSY A;  1KLM A;  4OO1 J;  1LAW A;  4GV3 A;  1U47 A;  4BAC A;  4KHS A;  4F8R A;  5GAG P;  1T6C A;  4FCY A;  3QFU A;  4BVP A;  4LFC K;  2ZJQ L;  4IJA A;  3F9K A;  1LW2 A;  2CH5 A;  2ASM A;  2YKN A;  3EEQ A;  3P38 A;  4F3T A;  1S1W A;  3VA0 A;  3FZH A;  5HRN A;  2ITG A;  1HMV A;  1YUW A;  2HOE A;  2ASO A;  1RFQ A;  4IWV A;  3DJC A;  1RBU A;  3TPQ A;  1G15 A;  4KBO A;  3AO5 A;  2PZS A;  3C95 A;  4XIU A;  3SUP A;  1XQS C;  2OTL N;  1VRU A;  1YTA A;  4JK7 A;  4PUO A;  1L3S A;  4BRL A;  1WUA A;  3PO4 A;  3HP9 A;  3TR8 A;  3AGK A;  2P9U B;  3SNN A;  2X6S A;  3FE1 A;  4DSJ A;  2HHT A;  4B9L A;  2G8I A;  5LMN K;  2D0P A;  3VQC A;  1VQM N;  1SKW A;  3THX A;  2UU9 K;  4OLB A;  3AVF A;  4NYF A;  1WSH A;  3AA4 A;  5AQW A;  5LY3 A;  4DQI A;  1XUP O;  1N34 K;  4B9U A;  3RSE A;  3OBW A;  1VSF A;  2YJF A;  3VN5 A;  3U6F A;  2Q2R A;  5GIN A;  1L3T A;  1MDU B;  3M6G A;  4B9V A;  4H5W A;  3QBX A;  3SUN A;  3QBW A;  4QCL A;  2OYQ A;  4KO0 A;  4J2A A;  1QHT A;  1A5V A;  5AQZ A;  1HNZ K;  3AA2 A;  5IWA K;  4W5O A;  4PL7 A;  3QNN A;  4DR1 K;  3L3U A;  1BI4 A;  5AFU H;  4ILH A;  1GLE G;  3CPW M;  1JXB A;  4RG8 A;  5CY4 A;  4M41 A;  3P5J A;  2YHW A;  4BRO A;  4K41 A;  2UUC K;  5GIP A;  4CZG A;  4LH4 A;  2HVI A;  4DG1 A;  4BRP A;  1J5E K;  4HVJ A;  3MXI A;  4ISE A;  4DV0 K;  1N36 K;  3OJS A;  2QI2 A;  2HBM A;  3O9U A;  3WQT A;  2Y1J A;  4FLY A;  1OVQ A;  4Z0U A;  3CQY A;  2CH6 A;  4IBN A;  3HPG A;  3V9S A;  4K0K K;  4IOX A;  3CCE N;  1SUQ A;  1SV5 A;  3R9P A;  4LFB K;  1ZBL A;  4GV6 A;  3WNF A;  4CK3 A;  2PFU A;  5FPN A;  2VYP A;  4DF4 A;  3HTV A;  4H8K A;  3NBP A;  2P9N A;  4IKF A;  4AHU A;  4NO7 A;  3NDK A;  3J7Y P;  4L3Q A;  2I5J A;  1Z05 A;  3KWI A;  4CZI A;  3M8R A;  2DTU A;  4BDZ A;  1D5A A;  3OA9 A;  3QML A;  2O8F A;  4RCH A;  3E9L A;  2A1R A;  1TK5 A;  3L2U A;  2RHK A;  3U9Z A;  2QKK A;  4DV5 K;  4BE0 A;  4B3O A;  5AQM A;  3VMF B;  1RNH A;  4M3X A;  4DMN A;  1CZ9 A;  2FSK A;  5TKY A;  1NKB A;  3CET A;  3THX B;  4DV4 K;  1N6Q A;  3DLE A;  2HB5 A;  3CC2 N;  3IUC A;  2FF6 A;  2NRH A;  4FVU A;  1IKW A;  4PKI A;  1X3M A;  2OAN A;  1VQL N;  2FF3 B;  4CJU A;  3RSE B;  2NRR A;  4JD2 A;  3ZYY X;  1QQM A;  3CQX A;  2G8U A;  2HHH K;  3ZX3 A;  4FJK A;  2GEM A;  4GNI A;  4DS5 A;  3ZCM A;  3SMP A;  1BIZ A;  1NOZ A;  5MLC Q;  1S72 N;  4IOC L;  1BI4 B;  1RDC A;  4RW4 A;  2A5X A;  2AA4 A;  3KLI A;  5CZ1 A;  1S1V A;  3VEX A;  3D7E O;  3EKS A;  1TV6 A;  1NKC A;  2IAJ A;  3CF5 L;  2PBD A;  4JKA A;  4BR7 A;  1HYV A;  4KRF A;  4B1W B;  4FWO A;  4BG9 A;  4NCG A;  3S41 A;  2HF3 A;  5AQF A;  3OYF A;  3R1X A;  5C42 A;  5CYM A;  3DRR A;  2RE2 A;  3KVG A;  2WTU A;  3MCA B;  4DTS A;  4KRE A;  3OBY A;  3ISN C;  3M3Z A;  3V6D A;  1SS6 A;  3AAP A;  4H5R A;  3MN5 A;  4DQQ A;  1KFS A;  1OH5 A;  4WFB L;  1ITG A;  4CI6 A;  2GEL A;  4F2R A;  5C0Y A;  4DQ8 A;  3C6T A;  3CG7 A;  3WXL A;  2P9N B;  3AA5 X;  3LWM A;  1NMN A;  4W5R A;  2QKB A;  2BUP A;  2ITM A;  4K43 A;  1A5X A;  4JN4 A;  3CD6 N;  2O8F B;  2XY6 A;  3CJA A;  1HKG A;  4M7X A;  4EP5 A;  1Q82 O;  1T6D A;  2VGM A;  4M3U A;  2QEX N;  4HCB A;  1S9E A;  4W5N A;  2YX6 A;  3GDQ A;  3R3L A;  4KHP K;  1MU2 A;  4AF1 A;  3QIN A;  3MEE A;  3D6R A;  3VOV A;  1J53 A;  4JD2 B;  1W0H A;  4CJ3 A;  3SQ1 A;  2P5G A;  1NJI O;  5C15 A;  3FLC O;  3DOK A;  4IEE A;  3ZX2 A;  2A1S A;  3O4W A;  4DS4 A;  2KZM A;  3IRX A;  1E4F T;  3WEE A;  4A2A A;  5A2Q O;  1ASW A;  3LWL A;  3G10 A;  4BG8 A;  3M8S A;  5FPM A;  3DRS A;  4CHZ A;  1K6Y A;  5AZJ A;  3I0S A;  3RRH A;  3L6Q A;  2QWO A;  3DXM A;  5BR9 A;  2VCP A;  2X74 A;  3O8M A;  1C1A A;  1ASV A;  3FZF A;  4E0D A;  3K0S A;  3K5N A;  4DTN A;  1C0M A;  1ASU A;  3A5L C;  4DR7 K;  4Q0B A;  4JI8 K;  4M3W A;  3HRG A;  5HRS A;  4XH5 A;  4JK9 A;  3ITH A;  3WXM B;  3V1O A;  5E26 A;  4CJK A;  2BH1 A;  1JL2 A;  3WXJ A;  1ZYQ A;  3HM9 A;  3TAE A;  4WE1 A;  3AO1 A;  3NF7 A;  2RKI A;  4FSV A;  1ZBF A;  4NB4 A;  5HP1 A;  3NGY A;  3OS2 A;  4E7L A;  3CJB A;  4KFB A;  3VQ4 A;  4FXD A;  4FZZ A;  4H0V B;  1S6P A;  4KI6 A;  4TSX A;  2E6L A;  2YCH A;  5EU7 A;  2P1J A;  4NXN K;  3G4S N;  3HT3 A;  3VEN A;  1YXQ A;  2GWK A;  2OA8 A;  3I55 N;  3ZX0 A;  1YVN A;  4DUZ K;  3CYM A;  4MQ3 A;  1JCG A;  2QXF A;  3ATV A;  3ZSO A;  4WQ4 C;  1N32 K;  3TWH A;  4EHU A;  4YOX A;  4HUG A;  3O9Q A;  5ELZ A;  4DSF A;  4CD3 A;  4BWM A;  4W5T A;  3J8A A;  5AQK A;  2KLA A;  4JLH A;  2ZJP L;  3KLH A;  1YT3 A;  5DM6 L;  3HVT A;  3KKS A;  4B3T K;  1S1U A;  1QSL A;  1Q9Y A;  5AFU A;  1TKD A;  2YHX A;  3AVJ A;  4Z4I A;  3WEE B;  5BRE A;  3E01 A;  3WNH A;  1C1B A;  4AIL C;  4FJX A;  4LSN A;  3VET A;  3O4N A;  2HNY A;  4FLZ A;  3K5L A;  5KRT A;  4B3M K;  1YJN N;  3BDP A;  1FJG K;  2OPS A;  2V7Y A;  2E88 A;  3DXM B;  3E9O A;  2IOC A;  1JKH A;  1RT1 A;  3NHG A;  4CCH A;  1SL0 A;  3AA3 A;  1Q8I A;  4GV9 A;  2O4I A;  5EVZ A;  3T7Z A;  4CHN A;  3MEG A;  4EZ9 A;  4YFU A;  3LP1 A;  2VQF K;  5JS2 A;  4M3Z A;  2ZM6 K;  1VK0 A;  3DMJ A;  3A5N C;  4KAZ A;  1NK6 A;  5AQU A;  3PV8 A;  1SZ2 A;  4B8C A;  3Q7C A;  1ATS A;  2EHG A;  2Q0R A;  3TAF A;  4A61 A;  4C8K A;  4ZHR A;  3M8Q A;  3MCP A;  1HPZ A;  1VRT A;  2WC9 A;  4GVM A;  4YDU C;  3UKU A;  5KQ8 A;  3SPZ A;  3HZ6 A;  4KHU A;  4B1Z A;  2HF4 A;  4H0X B;  2G8K A;  4H0P A;  3KLE A;  2Q97 A;  1HNV A;  3BF3 A;  1VQ7 N;  4DV7 K;  4JKG A;  4WFN L;  2Q0U A;  3FZK A;  4E7I A;  5J2N A;  2HHQ A;  3PX0 A;  1B92 A;  1NJX A;  3TAR A;  3RR8 A;  5E41 A;  4FWR A;  3NVM A;  5AR0 A;  5C25 A;  4NCA A;  1YIT N;  2KKZ A;  4ELU A;  5C2D A;  1UOC A;  4YDU A;  4YOY A;  3SUQ A;  1JLG A;  4KH6 A;  1NGH A;  3OJU A;  1FXX A;  1RBT A;  2OZS A;  3K58 A;  2XRI A;  1RGI A;  3O3H A;  4O0I A;  3LDS A;  3LPT A;  4OLA A;  5BPM A;  4CF8 A;  3H1Q A;  3S3O A;  1NOY A;  3IDH A;  2VG7 A;  3C6A A;  1XNQ K;  1NK9 A;  2DY4 A;  2UXD K;  2KHO A;  4ID5 A;  5C24 A;  3QB0 A;  4MFB A;  4ZTJ A;  4N5S A;  3RWU A;  5EX5 A;  3KLG A;  1NK4 A;  5J2Q A;  4CF0 A;  3OYH A;  3RMB A;  3VQQ A;  2G8W A;  4O4G A;  3MED A;  3EE9 A;  1S3X A;  2HND A;  2A42 A;  1KAZ A;  2YNG A;  1RT2 A;  3KIO A;  3NH2 A;  3CHW A;  3O3G A;  4CEB A;  3SI6 A;  4A2B A;  2IC3 A;  1QTM A;  3ZT0 A;  4J2E A;  2P51 A;  4IFV A;  3PLA A;  2FBY A;  4OKE A;  3SMS A;  3KLF A;  3A2F A;  1LV5 A;  3OYM A;  4ELV A;  2IGI A;  5KPZ A;  4MLE A;  4BRF A;  3RMC A;  4DTM A;  4JKG B;  4U7B A;  1NNE A;  1NGJ A;  5EXW A;  1SQK A;  4EFH A;  4QS7 A;  2O8C A;  4CJT A;  1EKE A;  2ASP A;  2KQ2 A;  2W41 A;  3LL3 A;  4ELT A;  4CGH A;  2B5J A;  4BC4 A;  2V51 B;  1LWC A;  3CJ7 A;  3H1V X;  2V7Z A;  4RW8 A;  4CFC A;  2LSN A;  2D4W A;  4E1J A;  4HTL A;  3KWG A;  2VWJ A;  3IAY A; 
#chains in the Genus database with same CATH homology
 3MEC A;  1NKE A;  1IO2 A;  1ZBH A;  3S3M A;  1RT6 A;  4FZX C;  4NYN A;  4FLV A;  3ZSX A;  2HW3 A;  2E4L A;  4LH4 A;  4IDK A;  3CQ8 A;  1BQN A;  4O0J A;  2HVI A;  4DG1 A;  3QEW A;  4BDP A;  2HHS A;  4CGD A;  3SQ2 A;  2FBT A;  3AVA A;  3V1R A;  4B9N A;  4E7J A;  2X6N A;  1QE1 A;  4HVJ A;  3F73 A;  3MXI A;  3ALY A;  3OJS A;  4OGC A;  4FM2 A;  4K8Z A;  2Y1J A;  5T7B A;  4FLY A;  4Z0U A;  4IBN A;  3HPG A;  3DM2 A;  3V9S A;  3OYE A;  1Q9X A;  1O1W A;  3NF8 A;  1EXQ A;  1SUQ A;  1SV5 A;  1RT5 A;  2HHV A;  4AH9 A;  1KCF A;  2BAN A;  4JS4 A;  1ZBL A;  3WNF A;  2XY7 A;  4CK3 A;  3ZT1 A;  1A5W A;  4HUE A;  4H4M A;  4DF4 A;  2XY8 A;  3RMA A;  4FJH A;  4H8K A;  4FJ9 A;  4OKK A;  3NBP A;  4IKF A;  4FK2 A;  4AHU A;  3QEV A;  1EP4 A;  1LW0 A;  3NDK A;  4M3T A;  2I5J A;  2DTU A;  3M8R A;  1BIU A;  1SKR A;  4BDZ A;  1D5A A;  2OPP A;  4CEO A;  3LZJ A;  4N47 A;  4CJQ A;  4E19 A;  4DFJ A;  2A1R A;  1TK5 A;  3L2U A;  1RDA A;  4KKO A;  1HQE A;  3KK2 A;  4I2P A;  2QKK A;  4BE0 A;  2VWK A;  4OJR A;  4N56 A;  4B3O A;  4YNQ A;  1RNH A;  4M3X A;  1WSJ A;  4DMN A;  1J54 A;  1XWL A;  4DFK A;  1CZ9 A;  1HJR A;  1C1C A;  3AVG A;  1WN7 A;  1NKB A;  1QSY A;  3THV A;  1FKO A;  4EP4 A;  1N6Q A;  3DLE A;  2HB5 A;  4Q5V A;  1N5Y A;  4Z4G A;  1WAF A;  2OZM A;  3T3F A;  1IKW A;  3B6P A;  3BGR A;  4CJU A;  1FK9 A;  1VSH A;  2ZE2 A;  3ZSQ A;  3KK1 A;  2D5R A;  3LP2 A;  1IKV A;  1TL3 A;  4OVL A;  2G8U A;  1JLQ A;  1GOC A;  1L3U A;  4CF1 A;  3UIQ A;  4G1Q A;  3WNE A;  4FJK A;  3DYA A;  3QLH A;  1TGO A;  4KB0 A;  4I9L A;  2KFZ A;  4OPJ A;  4KB1 A;  4DS5 A;  3ZCM A;  4DTO A;  4DU1 A;  4Y1D A;  4OPK A;  4E1M A;  1BIZ A;  1NOZ A;  3CFP A;  5J2M A;  1L5U A;  1KTQ A;  4CJV A;  3KJV A;  3V9Z A;  1TKX A;  4FM0 A;  3L2R A;  4FJI A;  1HYS A;  1D9D A;  4JRQ A;  1BI4 B;  3HO1 A;  2OPR A;  3VQB A;  1RDC A;  4CHP A;  4RW4 A;  4CF9 A;  4B08 A;  2Z1H A;  3FFI A;  4ICL A;  2BDP A;  4M3Y A;  3KLI A;  5CZ1 A;  3KTQ A;  2Z1G A;  2KTQ A;  1S1V A;  3ZT3 A;  2HMI A;  3RR7 A;  1RCH A;  3JSM A;  1KVA A;  1TV6 A;  2ATQ A;  1NKC A;  2IAJ A;  4B9S A;  4KHQ A;  1HYV A;  1HQU A;  1UAX A;  1RIL A;  1IH7 A;  5I42 A;  4DWI A;  4KRF A;  1C0T A;  4NCG A;  4OKJ A;  4Z4H A;  3TAQ A;  3IS9 A;  1WSI A;  4NCB A;  3OYF A;  4BDY A;  5C42 A;  4QOZ B;  5CYM A;  3DRR A;  1XI1 A;  1RT7 A;  4KRE A;  3LAL A;  1X9S A;  4DTS A;  2HNZ A;  1WLJ A;  1S1X A;  3OS1 A;  3EYZ A;  3AO3 A;  1DLO A;  3ISN C;  3V6D A;  2F96 A;  3VA3 A;  4DQR A;  1QQC A;  4DQQ A;  4DSE A;  1KSP A;  4UQG A;  3TI0 A;  4ZTF A;  1SKS A;  1KFS A;  3ZSZ A;  4C8O A;  1ITG A;  3AV9 A;  4CJL A;  5SWM A;  1RBV A;  3EY1 A;  3SV4 A;  4KI4 A;  3IG1 A;  4F2R A;  4DSK A;  2VG5 A;  3C6T A;  2Z1I A;  2NUB A;  3TAM A;  5J1E A;  5HRR A;  4FJM A;  3CG7 A;  2KFN A;  4JRP A;  1KLN A;  3AA5 X;  3LWM A;  2DFH A;  4FJG A;  1JLC A;  2B4J A;  3SQ0 A;  4W5R A;  4KPY A;  3ULD A;  3TAG A;  2QKB A;  1JLB A;  4CE9 A;  1A5X A;  1TK0 A;  3LP3 A;  5FRN A;  2XY6 A;  4LSL A;  2HHU A;  3HPH A;  3ZSV A;  3NH0 A;  4EP5 A;  5HLF A;  1BHL A;  3V81 A;  5HBM A;  1HRH A;  1XHZ A;  5CYQ A;  4CK1 A;  3OYJ A;  1BIS A;  4CJF A;  3K59 A;  4CIE A;  1TAQ A;  4M3U A;  1B9D A;  1KFD A;  5KGW A;  4HCB A;  1S9E A;  3H08 A;  4W5N A;  2VG6 A;  4IG3 A;  1U4B A;  2QK9 A;  3AVB A;  4LH5 A;  4E3S A;  1MU2 A;  2GBZ A;  5FRO A;  3SZ2 A;  2YV0 X;  4FLU A;  3QIN A;  3MEE A;  4CHO A;  1T7P A;  4RW6 A;  4CJ4 A;  3NFA A;  2EX3 A;  2KW4 A;  3D45 A;  1J53 A;  3LAN A;  3VQP A;  3KK3 A;  3OS0 A;  1W0H A;  4CJ3 A;  3SQ1 A;  2W42 A;  2P5G A;  4CEA A;  3AVN A;  4O5B A;  3OY9 A;  3VQ6 A;  4FK4 A;  2XO7 A;  2ZQB A;  3HJF A;  3CFR A;  3KKR A;  3DOK A;  1RDD A;  3MXM A;  1RTD A;  2A1S A;  4DS4 A;  2KZM A;  3IRX A;  1TKT A;  4C8N A;  1I39 A;  1QS4 A;  3VQ7 A;  4AHS A;  3DLH A;  3QIP A;  4HUF A;  3NF6 A;  3SCX A;  1RDB A;  5KGX A;  3CM6 A;  1ASW A;  1EX4 A;  3G10 A;  4CJP A;  3LWL A;  4CES A;  3PX4 A;  4L8R B;  2X78 A;  3M8S A;  4CGF A;  5JS1 A;  1NK0 A;  2E6M A;  3U3G A;  2AJQ A;  1B9F A;  4E7K A;  3LAM A;  3ASM A;  3DRS A;  1K6Y A;  4CHZ A;  3I0S A;  1TL1 A;  3RRH A;  4F4K A;  1DTQ A;  3V9U A;  3OYN A;  5I3U A;  3OYL A;  2X74 A;  3HXM A;  1XC9 A;  1D8Y A;  1C1A A;  1ASV A;  4E0D A;  1RBS A;  3AVM A;  1YVU A;  3K5N A;  3O3F A;  1C0M A;  4BWJ A;  2RF2 A;  1ZBU A;  1JLA A;  1ASU A;  1REV A;  4DTN A;  1NK5 A;  2RPI A;  4KTZ A;  3MAQ A;  4FJJ A;  4FJ7 A;  3K5M A;  1T03 A;  4Q0B A;  4M3W A;  1U45 A;  1RTH A;  3SYZ A;  1CLQ A;  4GMJ B;  4FLX A;  4LY7 A;  5HRS A;  3SV3 A;  2HHW A;  1W9H A;  2IDO A;  3ITH A;  4PA1 A;  3V1O A;  4AHR A;  4CJK A;  3S9H A;  4Z4E A;  1TVR A;  3I8D A;  1JL2 A;  1KRP A;  2O4G A;  3CFO A;  2YHA A;  1ZYQ A;  3G0Z A;  3HM9 A;  3VQ5 A;  3TAE A;  4WE1 A;  1KVC A;  3AO1 A;  4CHQ A;  5HRO A;  3NF7 A;  2RKI A;  1HNI A;  4M42 A;  1ZBF A;  4FJ5 A;  1LAV A;  3ZSR A;  4CFD A;  3OYI A;  2GUI A;  3NGY A;  4R5P A;  3OS2 A;  4E7L A;  5HP1 A;  2YHB A;  4KFB A;  3VQ4 A;  4FXD A;  3DLK A;  4CER A;  4FLW A;  4FZZ A;  1WSE A;  3K57 A;  1VSL A;  2F8S A;  1S6P A;  4KI6 A;  3PUF A;  1JLF A;  1XHX A;  4TSX A;  2E6L A;  1RT3 A;  3L2V A;  3L2W A;  3DOL A;  5EU7 A;  2P1J A;  3VQA A;  3U3Y A;  1U48 A;  3HT3 A;  1RBR A;  1UA1 A;  2OA8 A;  5KI6 A;  4DQP A;  3WNG A;  3I0R A;  3M8P A;  3OYC A;  1Y97 A;  4J2B A;  3NAE A;  1C6V A;  4CJE A;  2DFE A;  3CYM A;  2YNF A;  4MQ3 A;  3HPO A;  3JYT A;  2QXF A;  1LWF A;  4E89 A;  4Y1C A;  3ZSO A;  3QER A;  3TWH A;  1KVB A;  4E7H A;  4CK2 A;  4HUG A;  3AO4 A;  1T8E A;  1FKP A;  2G8V A;  4DSF A;  1D9F A;  4Z4C A;  1BGX T;  2IS3 A;  3S3N A;  4BWM A;  4W5T A;  3T19 A;  1U49 A;  1NJW A;  4KHY A;  4PWD A;  5K14 A;  1QSS A;  3SJJ A;  3OYB A;  3D0P A;  4JLH A;  2FC0 A;  1J9A A;  1VSK A;  3KLH A;  3HK2 A;  1YT3 A;  1CZB A;  4DU4 A;  3QET A;  4DFM A;  3HVT A;  1NK8 A;  1IKY A;  1F21 A;  3KKS A;  5FDL A;  4CEC A;  3DLR A;  1S1U A;  5DMR A;  1QSL A;  1Q9Y A;  1TKD A;  3RTV A;  3AVJ A;  3KD5 E;  4Z4I A;  4KTW A;  4I7F A;  3E01 A;  1TK8 A;  3WNH A;  1C1B A;  2YNI A;  4DTP A;  4AIL C;  4LD0 A;  2GV9 A;  4LSN A;  4CEF A;  4K8X A;  3LAK A;  1S9G A;  3LZI A;  4FJX A;  3O4N A;  2HNY A;  4FLZ A;  4KTQ A;  3K5L A;  3OVN A;  5CZ2 A;  3HL8 A;  5KRT A;  4DU3 A;  4N76 A;  4FVM A;  3BDP A;  4FLT A;  4IG0 A;  3DRP A;  5KRS A;  4B9M A;  4DLE A;  2OPS A;  3SQ4 A;  4DTJ A;  1VSI A;  1U04 A;  2IOC A;  4BE1 A;  1X1P A;  1UWB A;  1YTU A;  1GOA A;  1JKH A;  1RT1 A;  3NHG A;  4CCH A;  1JXE A;  2ETJ A;  1WSF A;  1VSM A;  1DTT A;  3L8B A;  3AA3 A;  1Q8I A;  1RTI A;  3VQE A;  4DFP A;  1SL0 A;  4DSL A;  4FJN A;  3TAN A;  5J2P A;  2KZZ A;  3EZ5 A;  1JL1 A;  2JLE A;  3AO2 A;  3TAB A;  2O4I A;  1S6Q A;  3LP0 A;  4CHN A;  3MEG A;  3L2Q A;  3QEI A;  3QO9 A;  4EZ9 A;  4YFU A;  3LP1 A;  3HST B;  1JLE A;  4FW2 A;  5JS2 A;  3ZT4 A;  4C8L A;  2PYL A;  1TKZ A;  4M3Z A;  2YKM A;  1VK0 A;  2FBV A;  1WAJ A;  2R7Y A;  3DMJ A;  3QNO A;  1NK7 A;  3OYK A;  4KAZ A;  3VQ8 A;  4CGI A;  1WSG A;  4CEZ A;  5SZT A;  1NK6 A;  1LWE A;  3PV8 A;  1L3V A;  1WNS A;  4HHT A;  3O4Q A;  4B8C A;  3OYA A;  1RTJ A;  3L3V A;  4F3O A;  3MXJ A;  2EHG A;  3CM5 A;  5DK5 A;  4CGJ A;  3V9W A;  3TAF A;  4C8K A;  3RRG A;  4ZHR A;  4AHT A;  3DLB A;  3M8Q A;  5KTQ A;  1HPZ A;  1VRT A;  4GVM A;  4H4O A;  3AVC A;  2Y1I A;  2G8H A;  4N41 A;  3C6U A;  3K5O A;  3AVK A;  1NJY A;  4CFB A;  4FZY A;  1NJZ A;  4CJ5 A;  4FW1 A;  3SPZ A;  4FK0 A;  4CJS A;  4KHU A;  1S1T A;  4QAG A;  4FYD A;  3NGZ A;  1SL1 A;  2G8K A;  3KLE A;  4RW9 A;  1EET A;  1HNV A;  3B6O A;  2HHX A;  3HP6 A;  3PX6 A;  2HVH A;  4RW7 A;  1C0U A;  1GOB A;  2ZD1 A;  1BL3 A;  4E7I A;  4GW6 A;  5J2N A;  2HHQ A;  4M3R A;  3OYG A;  2BE2 A;  1CXU A;  1VSJ A;  4CIG A;  4FM1 A;  3PX0 A;  4FJ8 A;  3V9X A;  1B92 A;  2FBX A;  1NJX A;  3TAR A;  3RR8 A;  3ZT2 A;  4EZ6 A;  4C8M A;  1VSE A;  5E41 A;  2DFF A;  4M45 A;  3TAP A;  5C25 A;  2B6A A;  4CFA A;  1X9W A;  4NCA A;  2WOM A;  2XHB A;  4I9Q A;  3AVH A;  4CJR A;  4ELU A;  4FJL A;  2F8T A;  1UOC A;  3P83 D;  3VQ9 A;  3ZSY A;  3HVR A;  3SUQ A;  1JLG A;  1KLM A;  4DQS A;  3V1Q A;  1BCO A;  1LAW A;  4DLG A;  3OJU A;  1U47 A;  1FXX A;  4BAC A;  1RBT A;  4KHS A;  4F8R A;  4FCY A;  3K58 A;  2OZS A;  2XRI A;  4PY5 A;  3O3H A;  4O0I A;  3LDS A;  4KHW A;  1IG9 A;  3T1A A;  3QEP A;  3NE6 A;  3LPT A;  4OLA A;  4DTU A;  3F9K A;  4CF8 A;  3QIO A;  1LW2 A;  1J5O A;  4F3T A;  3S3O A;  1IKX A;  2YKN A;  4W5Q A;  2YNH A;  1Z26 A;  1NOY A;  2VG7 A;  1S1W A;  2D0B A;  3VA0 A;  5HRN A;  4ID1 A;  1NK9 A;  2DY4 A;  3OYD A;  2WON A;  4CGG A;  2BGG A;  3LPU A;  4KV8 A;  4O44 A;  3NGI A;  2Z1J A;  2ITG A;  1HMV A;  3NH1 A;  2RN2 A;  4ID5 A;  1I3A A;  5C24 A;  4MFB A;  4CIF A;  4ZTJ A;  1R0A A;  4N5S A;  3RWU A;  3ZSW A;  5HRP A;  1RBU A;  3KLG A;  1NK4 A;  4CJW A;  4CF0 A;  3OYH A;  5J2Q A;  1T05 A;  4AHC A;  3RMB A;  1G15 A;  1BQM A;  3VQQ A;  2G8W A;  4DSI A;  3AO5 A;  4CF2 A;  3MED A;  4I2Q A;  4O4G A;  3C95 A;  2PZS A;  2HND A;  4XIU A;  3SUP A;  4PQU A;  1VRU A;  1YTA A;  4DTR A;  3VQD A;  2YNG A;  4PUO A;  3DLG A;  1L3S A;  3PO4 A;  2OPQ A;  1ZBI A;  2D0C A;  3HP9 A;  3TR8 A;  1RT2 A;  3KIO A;  4IFY A;  3NH2 A;  1TAU A;  3SNN A;  3O3G A;  4CEB A;  2X6S A;  3SI6 A;  2Q3S A;  4DSJ A;  3AVL A;  5FRM A;  2HHT A;  4CED A;  4E1N A;  2IC3 A;  4B9L A;  1QTM A;  2D0A A;  2PY5 A;  2G8I A;  3ZT0 A;  4J2E A;  3VQC A;  2P51 A;  1SL2 A;  3RMD A;  2PYJ A;  1SKW A;  4IFV A;  4CEE A;  4O55 A;  4BE2 A;  4CEQ A;  4OLB A;  3AVF A;  4NYF A;  1WSH A;  1BCM A;  2FBY A;  4OKE A;  3AA4 A;  3C94 A;  3KLF A;  4DTX A;  3A2F A;  1LV5 A;  3OYM A;  3PY8 A;  4ELV A;  4DQI A;  2IGI A;  4Z4F A;  3SPY A;  4B9U A;  4J2D A;  4F2S A;  1VSF A;  3RMC A;  2XY5 A;  3HYF A;  4DTM A;  1X9M A;  3VN5 A;  5D3G A;  3U6F A;  3KD1 E;  1HYZ A;  1RT4 A;  1L3T A;  3DI6 A;  4CJT A;  4B9T A;  3V4I A;  1EKE A;  2KQ2 A;  4JS5 A;  4ELT A;  3QES A;  4CGH A;  4HTU A;  2B5J A;  3NF9 A;  4B9V A;  2P5O A;  1LWC A;  1CXQ A;  4OGE A;  4CHY A;  4AHV A;  3SUN A;  2G8F A;  4QCL A;  2OYQ A;  3PO5 A;  4KHN A;  4KO0 A;  4B8A B;  1QHT A;  4J2A A;  1UA0 A;  1A5V A;  1S5J A;  1VSD A;  3P1G A;  4DF8 A;  1Z25 A;  3AA2 A;  4RW8 A;  4CFC A;  3SUO A;  4W5O A;  2LSN A;  3QNN A;  3QEX A;  4HCC A;  3L3U A;  1BI4 A;  2JGU A;  3AVI A;  2VWJ A;  3K2P A;  1JXB A;  4RG8 A;  5CY4 A;  4M41 A;  3IAY A;  3P5J A;  3NCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...