3DJCA

Crystal structure of pantothenate kinase from legionella pneumophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
LILCIDVGNSHIYGGVFDGDEIKLRFRHTSKVSTSDELGIFLKSVLRENNCSPETIRKIAICSVVPQVDYSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQNIIVIDFGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTAKLPSVEIIKTESVVGRSTIESIQSGVYYGVLGACKELIQRIHHEAFNGDQILILATGGFASLFDKQGLYDHLVPDLVLQGIRLAAMMNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Pantothenate Kinase from Legionella Pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Transferase
total genus 75
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA01
5LJVA 1BA0A 3FZMA 3CQXA 1BOTO 1BU6O 1JCGA 2P9IB 4MLHA 3KVGA 2F9WA 3VEOA 4BR5A 4EAHD 2J4RA 4JN4A 3GE1A 3ENOA 3W0LA 1QHAA 1WUAA 3I8BA 4H0XB 3HTVA 3LDOA 3BF1A 4FSVA 1TYQB 5AQGA 3L6QA 4B1YB 3ZX3A 3H1QA 2P9IA 2Q36A 4BRIA 2FF3B 3SK3A 3RSEB 3O6WA 2E1ZA 1G99A 2YCHA 1HLUA 5LJWA 1TYQA 5EX5A 3SJHA 3H3OB 3VF4A 1BWFO 3WXJA 1ATSA 3AY9A 3MN6A 4DHYA 3FR0A 1NLVA 3QBWA 3RSEA 3UE5A 3AAQA 3M6GA 1NGGA 3EKSA 5BRFA 2AA4A 2QW9A 1YUWA 3ZEUB 1RDWX 5AQWA 4B1UB 3A5OC 4M7XA 4CBUA 3VF2A 2FF6A 5BN9A 4RCHA 2QWNA 4FWPA 5AQLA 5BR9A 4FWMA 1YAGA 3ZEUA 5AFUH 4FWNA 3U4LA 1KAXA 4H0YB 5EXWA 1KAYA 2D4WA 5AQSA 3VGLA 5JICA 1NWKA 3QICA 1ATNA 4EFHA 4BRHA 3QB0A 2CH5A 3D7EO 4BC5A 2E2QA 4BQLA 1IG8A 3VERA 2IVPA 3WUHA 4BR9A 3CQYA 4O5FA 3BP8A 5KPRA 3CJ1A 1MDUB 1K8KB 4RWTA 2QWQA 4K42A 2I7PA 4FPBA 1HKGA 2NLXA 4ISGA 4K25A 1S3XA 3ID8A 4A62A 3FGUA 2ZGZA 4B1VA 1EQYA 2D1KA 3W3DA 4BRPA 1BUPA 3FZFA 3R8EA 1K8KA 1NMDA 1JCEA 3A8YA 3EL2A 2BTFA 4O8KA 2QWOA 4IJAA 3A0IX 3IFRA 1NM1A 4B1ZA 4WQ5C 3U9DA 3M3ZA 5BPNA 5EY4A 5AQUA 5AZIB 2IVNA 3FE1A 2HF3A 5BRDA 3VESA 3SLCA 5AQOA 1QZ5A 3MN7A 3QMLA 5AR0A 2ASOA 3CIPA 5ADXH 2E1YA 5AZIA 3KZBA 3VEZA 1X9JA 2NZTA 5AQYA 4BRQA 2D0PA 1RFQA 3HSCA 3O1BA 3FZHA 4M63C 3A5LC 5KPTA 4CZEA 2FSJA 2E2OA 2Q0RA 4IWVA 1SZ2A 4BC4A 3CJAA 4XH1A 2FLOA 1OKJA 1WOQA 2FSNA 1X3NA 4H5WA 3DXKB 2GTDA 5AQZA 3GL1A 1NGDA 2P9UB 5JLHA 2F9TA 5BPLA 2ASPA 5AQKA 3VPZA 3ZX0A 1T6CA 2PBDA 3H6EA 3D2FB 3MMVA 1R59O 3DXKA 1GLBG 3HM8A 2P9UA 2A41A 4IXCA 4FWKA 3VETA 1T44A 2ITMA 2A3ZA 4A61A 2AP1A 1NGHA 4H5RA 3DJCA 3DXMB 4BRNA 4FL9A 3D2FA 2FXUA 2WUSA 3DWLA 3R9PA 2E2PA 3OHRA 2CH6A 3HBTA 3VOVA 4YDUC 4BR0A 5CE3A 2YHWA 3LM9A 4BVPA 4DCHA 3L0QA 3DXMA 5AZJB 4BROA 4PL7A 4CZLA 3HZ6A 2CGJA 2YI1A 3DAWA 4C23A 1SQKA 5AQFA 2YJEA 4H5NA 2I7NA 3IUCA 3QDKA 1NGIA 2VCPA 5EOYA 1HKCA 2FSKA 4EHUA 1NGAA 1D4XA 5AZJA 1DEJA 2Q2RA 4NB4A 1C0FA 5AQHA 2E88A 2YJFA 3P4IA 3A5NC 4FWSA 3H1VX 5AQVA 1H1VA 1NGCA 4AM7A 5E26A 2D0OA 3O80A 1QQMA 4BR7A 2QWPA 1NGFA 1DKGD 2Q31A 1NBWA 3B8AX 3CJ9A 2HOEA 4BGAA 4K43A 5AQXA 4CI6A 4XEIA 3U9ZA 4EHTA 3GDQA 1NGBA 3G25A 3WQTA 2P9SB 3GG4A 3AAPA 4WYBA 4CZFA 3LM2A 3ULEB 1HX1A 2QWLA 4B9QA 3LDLA 2QWRA 4A2AA 4CZHA 4BREA 4JNEA 2DPNA 3O1WA 4FWRA 4IO8A 2P9SA 3FFKB 1ZC6A 3FZKA 1LCUA 1YVNA 3BEXA 4HWIA 3ENHA 1QQNA 3ULEA 2GUPA 2EWSA 3CERA 1BG3A 3VF6A 3EO3A 4CD1A 2V52B 1DGKN 1HKBA 3CI5A 4BR4A 2PAVA 1P8ZA 5AQJA 2KHOA 1QZ6A 2P9NB 2ZWHA 3C0BA 5F1XA 3IMXA 3FLCO 4B1WB 1MA9B 4GY2B 1U2VB 5AQNA 1Z05A 2P9NA 2YHXA 3VEVA 1MWMA 5E84A 4E1JA 3MK6A 3LDPA 4WQ4C 2UYTA 3CETA 4QS9A 5LY3A 1U2VA 4CZGA 2NRHA 5BREA 3H3NO 2IVOA 2ZF5O 3EZWA 5AQPA 5F0XA 1XC3A 4IZ9A 5TKYA 4H0OA 4HTLA 5I9EB 3I33A 3JS6A 4Z94A 3CHWA 3ATUA 4BC3A 4BRAA 4BGBA 2VYPA 1C0GA 3F9MA 4J8FA 4WQ5A 4BR2A 1E4FT 4GNIA 3IDHA 1IJJA 4CZKA 3R6MA 4NO7A 4DB3A 4CJ7A 4CZIA 4Y0WA 4ISFA 5B8HA 4FWQA 4BRKA 5FPMA 1S22A 1GLCG 4BG8A 2GWJA 5BN8A 1BA1A 1JCFA 4PKGA 2IIRA 4B1XB 1KAZA 3SMSA 1E4GT 4FWOA 3WQUA 1YXQA 5AQQA 4CZJA 1SAZA 1ZBSA 5AQTA 1BO5O 3O4WA 1ESVA 1V4SA 5AQIA 4BQZA 1GLEG 2Q0UA 1Y64A 3H45C 3M1FA 4H5TA 3O5BA 5FPNA 4CBXA 3WT0A 2E2NA 3O8MA 4IJNA 3S41A 2V7YA 1GLFO 3CJCA 3EKUA 4FOIA 4FPAA 2H3GX 3SMPA 4BG9A 4I6MB 4PL8A 3QFPA 4M7YA 4QS8A 5KQDA 4XH5A 1Z6RA 3CJ7A 2OANA 1HJOA 2P9PB 1J6ZA 4H0PA 2HF4A 3JXUA 2V7ZA 2HMPA 4PKHA 4I6MA 5BPMA 2YHYA 3LDQA 4KBOA 3CJBA 2VWBA 4JD2B 3VENA 2P9PA 4MO5A 4CZMA 3WXIA 2Q97A 3EN9A 2Q1NA 3BF3A 3O08A 4FWLA 4YDUA 3VEWA 3MN9A 4LC9B 5KPZA 4JD2A 2BUPA 4H0TB 1RGIA 4BRFA 5FPEA 3QBXA 4BRDA 2GWKA 5KQ8A 5AFUA 2CGKA 3L4IA 4QS7A 4PKIA 2ZGYA 3KHYA 1CZAN 3J8AA 3VGKA 1BDGA 3GOIA 3VEXA 4JHDB 2CGLA 1V4TA 4XH4A 1KXPA 1TUUA 4ISEA 2ASMA 5AQMA 3UKUB 4BC2A 3MN5A 2A40A 2W40A 1GLJO 4F9OA 3C7NB 4FOEA 3ZX2A 2E20A 4JHDA 3WXKA 1HUXA 2P9KB 2QWMA 3WXLA 4BRCA 3UB5A 1NGEA 1TUYA 3UKRB 4BRLA 3GBTA 4BVOA 2A42A 3WEEB 1ZXOA 1QQOA 3UKUA 2GELA 4MLEA 5F2RA 1U6ZA 5JMVA 3A5MC 2A6AA 3TU5A 4CBWA 5BRHA 2W41A 3QFUA 3C7NA 3LL3A 5AQRA 2P9KA 1GLDG 3UKRA 4K41A 3WEEA 1HPMA 5EVZA 1Q18A 4A2BA 2V51B 4DQ8A 3MDQA 1GLLO 4H03B 3D2EB 3ATVA 4EIAA 3AARA 4CD3A 4AM6A 5FPDA 4FO0A 2QXLA 3H46O 4MO4A 5ADXA 1T6DA 4L3QA 3D2EA 4BRMA 5JLFA 2P9LB 3MCPA 3U8XA 1ATRA 3ZETB 5ELZA 1NGJA 3VEYA 4H5VA 3FZLA 2A5XA 3BUZB 1XUPO 1GLAG 3LDNA 1XQSC 4RTFD 1X3MA 3VGMA 2P9LA 3TPQA 2E8AA 3ZETA 2QM1A 4JAXA 4WQ4A 1MWKA 4H0VB 4BRGA 2GEMA 3HI0A 1LOTB
chains in the Genus database with same CATH superfamily
2JWLA 2PFUA 1BU6O 2YNGA 2P9IB 4MLHA 1SUQA 4BR5A 3E01A 3CQ8A 3GE1A 3ENOA 4BDPA 3CCQN 2RKIA 5E41A 3EYZA 4H0XB 3TAFA 3DRSA 4DTJA 3MWPA 1WSIA 2P9IA 4CEFA 4Z4GA 3VMFB 4DV7K 4DTXA 2E1ZA 3MXMA 4YOUA 5EX5A 3VF4A 2HBKA 1ATSA 2QKBA 4DHYA 1NLVA 3C94A 1NGGA 3EKSA 1I94K 1RDWX 3VQDA 4JLHA 1VSDA 2D0BA 4JS5A 2G8IA 3B6PA 3VF2A 1VQPN 3E1YA 4Y1DA 2R7YA 2HHTA 4RCHA 1HNIA 3V9ZA 4PQUA 5IT9O 4FWMA 3CC7N 3EE9A 4DR4K 3NF7A 4FWNA 4DF8A 2Y1JA 5EXWA 1KAYA 3J7YP 1NK6A 2IGIA 3QICA 3SV4A 4IDHA 3VQPA 4JYAK 3ZSXA 3THXB 4UY8O 2NRZA 3D7EO 1IH7A 3CM5A 3OYLA 3O9RA 3TSPA 2HNDA 4CK1A 3PX6A 3B6OA 3CQYA 3THXA 4KHSA 3SV3A 3RR7A 4K42A 1TGOA 4ISGA 5FRMA 1RT7A 5CR4A 3W3DA 1CLQA 3R8EA 3FZFA 4M3WA 1NMDA 4DV4K 3EL2A 3OYHA 2QWOA 3A0IX 4WE1A 5JS2A 2IVNA 3FE1A 3CCVN 1QZ5A 3MN7A 5AR0A 2ASOA 4CCHA 4CFAA 3T1AA 3O9SA 1N6QA 4JI4K 3ZYYX 1RFQA 4M63C 4KTWA 4YOTA 4BE2A 2OZMA 1SKWA 2E2OA 4CJKA 3DLGA 1WBBA 4X66K 4FLUA 4IWVA 1SZ2A 4BC4A 3CJAA 4CJEA 1VQNN 2XY6A 1REVA 1WB9A 4W5RA 2P9UB 3QIOA 3LALA 1UA0A 3TANA 3IS9A 4FJ5A 1VQKN 3MX5A 4IFVA 1ASWA 2P9UA 2A41A 3QEXA 3KLFA 3K5NA 3EE8A 4LH5A 5KGWA 5HRNA 4CHYA 5A2QO 1IKWA 2RF2A 4JKHA 4RW9A 3KLIA 3VOVA 3AO3A 4J2EA 1DLOA 2VWKA 3QEIA 3MXJA 3WXMB 4G9ZA 4PL7A 4CZLA 3HZ6A 2WTUA 1SQKA 3QDKA 1ZBLA 4B3OA 5EOYA 2FSKA 3DLHA 4M3TA 4CJ5A 1VQ9N 4CGDA 4LD0A 3TTFA 4M3ZA 4J2DA 3KK3A 3T69A 3P4IA 3DLLL 3V9WA 5AQVA 5JS1A 4E7KA 2FBVA 2HBMA 3OS2A 1NGCA 4AM7A 3O9TA 3O80A 1BI4B 4OX9K 4N47A 3K58A 5HOOA 3T1YK 4CK2A 3B8AX 1Q82O 1RT4A 4K43A 3HM9A 2F96A 2O8FB 3M8RA 1BI4A 3U9ZA 2IS3A 2AJQA 1HYSA 4NLBA 3I0RA 3RMDA 1N32K 3I56N 2O8FA 1EXQA 3AO2A 1VQ5N 4FM2A 4JNEA 2DPNA 4DMNA 4OPAA 1LCUA 2ZJQL 4CEQA 1QQNA 4E1NA 2FBXA 3VQ8A 3K2PA 3HT3A 4FXDA 2G8KA 2PAVA 1WSFA 1QZ6A 2ZWHA 3ZSVA 4HCCA 4B3RK 4O5BA 1YIJN 4JI1K 5HRSA 1MA9B 3LPTA 3O4QA 2BDPA 3S3MA 3OYAA 4GY2B 1U2VB 1Z05A 3ID6A 4ELUA 4DR2K 1SV5A 3TAGA 5K14A 3VEVA 1MWMA 5E84A 4E7JA 3RMCA 1C0MA 4BWJA 2UYTA 3K5OA 3PX0A 4RG8A 1RT5A 1U2VA 4CZGA 4ID5A 5C2DA 1WNSA 2ATQA 4CIGA 4B3SK 3TSUA 1RDDA 4IO9L 4BC3A 4KO0A 4DV3K 1BCOA 1VSKA 3F9MA 4J8FA 1FK9A 2YNFA 4WQ5A 4FJIA 1IJJA 4KH6A 1LW2A 4NO7A 4CJ7A 1IV0A 4ISFA 3HOSA 5B8HA 4CHNA 3RMBA 4NXNK 1JLBA 3WNGA 3SAGA 2GUIA 1BA1A 1QHTA 4B1XB 2NRVA 3CCMN 4DV5K 2WOMA 2HHUA 2B4JA 5AQTA 1VRUA 3BY5A 4BQZA 1GLEG 2HW3A 2Q0UA 4H5TA 4ILGB 4BACA 1LWFA 1QS4A 3TAPA 1W97L 4IEIA 1S1VA 5M1NA 2V7YA 4AF1A 4FVUA 4BG9A 2H3GX 3SMPA 4PL8A 3QFPA 4QS8A 4DFMA 4XH5A 2HMIA 2QTDA 1RTJA 1WAJA 2YKNA 1J6ZA 3J7AP 3JXUA 2HMPA 4PKHA 5BPMA 3CFRA 3LDQA 3S3OA 3VENA 4MO5A 1XNRK 2XRIA 4B9MA 1JLAA 3WXIA 1RBTA 3NF9A 3JSMA 2ZD1A 3VEWA 5I42A 2O8EB 1Y97A 2ZQBA 3I55N 5KPZA 3S9HA 1OH5A 1D9FA 2OZSA 1RGIA 1TL1A 3O4NA 3OYIA 4BRDA 2GWKA 3L3VA 2E4LA 3MX2A 1SS6A 3CMEN 1CZAN 4N76A 2O8EA 3GOIA 5HLFA 4RW8A 4KAZA 4L8RB 1B9DA 3U3YA 4A5AA 4FW1A 2QEXN 1TUUA 4KHWA 2A1SA 5HBMA 2A40A 1KSPA 1GLJO 4FOEA 1FXXA 4M3UA 1HUXA 2QWMA 5GADP 3UB5A 3UKRB 4DQPA 1X9MA 4BVOA 5C15A 3KLGA 1N8RO 5F2RA 3VQ5A 4CBWA 2RE2A 5BRHA 2UXCK 3HXMA 4B9UA 1GLDG 3UKRA 1RTHA 1HPMA 5EVZA 1MU2A 4H03B 1XC9A 3D2EB 4EIAA 4IG3A 4CD3A 4AM6A 1SL2A 1NK4A 1KFDA 5ADXA 4F2SA 4L3QA 1Z26A 3D2EA 2P9LB 2HVIA 1ATRA 5ELZA 3PLAA 1NU0A 1LAVA 3P38A 4H5VA 2OTLN 3M8QA 4DTPA 4FJJA 4OO1J 3OY9A 1XUPO 1VQ8N 4PY5A 1GLAG 4RTFD 1K9MO 4K8ZA 2P9LA 2E8AA 5DM6L 1T7PA 4J2AA 1NK0A 4WQ4A 1L3SA 4NYFA 4FK0A 1EKEA 1C6VA 2ITGA 3CQXA 1KLNA 3ULDA 2GX9A 1JCGA 1WAFA 4GKJK 2YV0X 3KVGA 2F9WA 1S72N 4CJPA 4FZZA 3W0LA 2XY5A 3BF1A 5AQGA 3BZCA 1QTMA 3SK3A 3E9LA 3DOKA 4DTUA 4WCEL 2YCHA 4OVLA 1CXQA 3AY9A 3FR0A 2IAJA 3ZT3A 1RBVA 1HJRA 2D0CA 4FLZA 3THVA 4LFAK 3AVAA 1ASVA 2HB5A 4C8OA 5AQWA 4B1UB 3A5OC 4M7XA 3Q7BA 4CBUA 2FF6A 3SPYA 3LDSA 1B92A 5AQLA 1YAGA 4DR5K 2QXFA 2O8BB 3V1QA 5AFUH 3V1RA 4IFEA 3U4LA 4RW4A 1T03A 3DOLA 1HPZA 4B9SA 3ENBA 5AQSA 3VGLA 3TTCA 2HNZA 3ZSYA 1RCHA 4BY9C 4DTNA 4F2RA 2O8BA 2OPRA 1ZYQA 1RT3A 4KTZA 5KRTA 2CH5A 5GAEP 1ZBIA 1FW6A 4DS4A 1HRHA 1HQUA 1RDBA 1IG8A 2E2QA 4BQLA 4DUZK 4QOZB 5CYQA 4ELTA 5HROA 1VSEA 4KI6A 3LAKA 3WUHA 4PUOA 3VQ4A 1S5JA 3M5RA 4BR9A 4O5FA 3BP8A 3AA5X 3CJ1A 3NGZA 2QWQA 1TKZA 2KTQA 2NLXA 4CJVA 1S3XA 2GV9A 3V9UA 3AV9A 4A62A 3FGUA 2YNHA 3O9UA 4B1VA 3FFIA 3SJJA 4FJ8A 4H8KA 4BRPA 3G0ZA 1BUPA 4CIEA 3ZLJA 1TVRA 4DV2K 3IFRA 3EY1A 1CZBA 3U9DA 3M3ZA 5BPNA 5EY4A 5AQUA 4HTUA 5AZIB 3L3UA 4C8LA 3TR8A 1K73O 2HF3A 4YY3K 3E66A 3QEVA 1NOYA 3J80O 3C6TA 3LZJA 2WBNA 5AQOA 3RR8A 5AZIA 3KZBA 3QESA 3VEZA 3NDKA 2NZTA 1BISA 2D0PA 5KPTA 3KK2A 4OGCA 1UOCA 4DQQA 1BQNA 3QO9A 3M8SA 1U45A 4KH5A 1RDAA 2FSNA 4LFBK 1ZBUA 4BDZA 2G8WA 1VAZA 3DXKB 4ZHRA 2EHGA 3GL1A 1NGDA 5JLHA 4FLTA 2F9TA 3BZKA 3C6UA 1C1CA 2VGMA 4FK4A 3VQEA 2PBDA 3D45A 2WC9A 3AO4A 1YI2N 1KVCA 3D2FB 4LF8K 3DXKA 1QQCA 4CF9A 2KFNA 3KK1A 3O3HA 2HHWA 4AQYK 1VQ4N 3NH1A 2HSTA 3R9PA 3D2FA 3OHRA 4DQSA 5CE3A 5FRNA 4DCHA 3SUOA 1NJIO 3P1GA 3L0QA 4PA1A 1BCMA 4BROA 4B9TA 2YI1A 3DAWA 3PIOL 1HNZK 2WONA 5AQFA 2ETJA 3DRRA 2VCPA 1KCFA 3KKSA 1KRPA 2D5RA 1DEJA 1WSHA 1C0FA 3AA3A 2VG6A 3IG1A 2PY5A 2E88A 2YJFA 4FLXA 3H1VX 1TK5A 2HHQA 1VSIA 3RRGA 3AO1A 3CM6A 4NLCA 1NGFA 1DKGD 1J5OA 4OKEA 4CJQA 4H4MA 2HOEA 2X6SA 4KHYA 5AQXA 1YHQN 4XEIA 1TL3A 4Z4CA 4KHNA 4LF6K 1NGBA 4CF8A 4WYBA 4CZFA 4CEEA 1Q8IA 3HVTA 2QWRA 3HPHA 3TAMA 4CZHA 5KGXA 4AILC 4IO8A 2HHXA 3FFKB 3HSTB 2GUPA 2Z1IA 1BG3A 2XY7A 1NMNA 2KFZA 2HVHA 1DGKN 3EZ5A 5AQJA 3MAQA 4R79A 4RW7A 2KHOA 3AVGA 1Q9YA 5F1XA 1EP4A 3SQ0A 1BL3A 4B1WB 4CE9A 1VSJA 5AQNA 3ZSQA 3CCSN 4B8AB 3SPZA 4CJWA 1U48A 4QS9A 2NRHA 5GAGP 5BREA 3H3NO 2IVOA 2ZF5O 3NH2A 4DFPA 3EZWA 5AQPA 4E0DA 5TKYA 4HUFA 4CERA 4HTLA 5I9EB 3CHWA 2PZSA 1WSJA 3ATUA 1XMOK 4BGBA 1S1UA 2O8DB 3BGRA 4CFBA 4OKKA 3HJFA 4BR2A 4GNIA 3AGRA 4DQIA 3CCUN 4KFBA 3R6MA 2OPQA 4Y0WA 3AVNA 4CVNE 2O8DA 1BQMA 4OJRA 4BRKA 3VQQA 4A57A 1S22A 1GLCG 3M8PA 3HVRA 3CC4N 1E4GT 3KK7A 4FWOA 4IOXA 1Z25A 2YHBA 4I9LA 5LMUK 1ZBSA 4DFKA 1BO5O 5SWMA 4CHPA 1WLJA 5KTQA 3H08A 4DR7K 1RT1A 4JI8K 3SAFA 3NGIA 1GLFO 4JKCA 4FPAA 4CECA 3L2RA 4I6MB 3L2QA 5KQDA 1JLGA 4CJFA 1NJZA 1XHZA 4FJ7A 4ID1A 1NOZA 1DT9A 4FYDA 4I6MA 2F7TA 2YHYA 3MEEA 4GVMA 1FKOA 3CJBA 4FCYA 4JD2B 3VN5A 2O4GA 2YNIA 2HHVA 1S9GA 3VQ9A 1QVGM 4CHZA 1W7AA 3O08A 4YOYA 4DU4A 1P90A 3VA3A 1OH8A 4JD2A 4CJUA 4B9NA 3QIPA 5KQ8A 3MCAB 2P51A 3QINA 3K9JA 3NH0A 4PKIA 3KHYA 4EP4A 4AHCA 3VGKA 4CJRA 1BDGA 4OPKA 4E7LA 3AA2A 4FK2A 1HYVA 1D5AA 4JHDB 4KTQA 1V4TA 5J2MA 3F2KA 1C1AA 3K5LA 2VWJA 5AQMA 3UKUB 4KB1A 3CCEN 1SKSA 3MN5A 4LY7A 5CY4A 4JK8A 3HRGA 4H4OA 2E20A 3NMUA 4JHDA 3ZSOA 2P9KB 4BRCA 2Z1HA 3WEEB 4KHPK 1QQOA 3PUFA 4MLEA 3UKUA 4FJLA 2OPPA 4Z4FA 2A6AA 3OYDA 3PO5A 3LL3A 4JK7A 2NRRA 2P9KA 3WEEA 4E7HA 1EETA 4IDKA 1Q18A 4LF9K 4DSLA 4DQ8A 4M42A 1U4BA 3OW2M 3ATVA 3AARA 1YJ9N 3LZIA 3LWLA 3MEGA 4JKDA 3LPUA 4FO0A 3T7ZA 4KHUA 4MO4A 3RRHA 1VQLN 1T6DA 3ZCMA 5JLFA 3VQBA 3MCPA 3ZETB 3VEYA 2P5GA 3FZLA 2KZZA 1IKVA 3LDNA 4CESA 4YHHK 3DLBA 3G10A 5CYMA 3ZETA 3LWMA 2YX6A 4CGFA 3OYEA 4BRGA 2RPIA 3MXIA 5LJVA 5HL7L 1BA0A 2UUAK 3KD1E 2NUBA 4CIFA 4CGIA 4LSLA 5DMRA 4MFBA 3J7ZO 4O0JA 2J4RA 1KFSA 3ASMA 1WUAA 1YF5L 1Q86O 1NKBA 4FSVA 1TYQB 3OBYA 3ZX3A 3H1QA 3NGYA 4ILHA 3AVMA 3UIQA 3OS1A 1YVUA 3V4IA 5LJWA 1TYQA 1VQON 3SJHA 1NKCA 4N41A 3THYB 3WXJA 3QEWA 3MN6A 3NBPA 4RW6A 3CFOA 3AAQA 3M6GA 3OYNA 5BRFA 2AA4A 2QW9A 4MDBA 3ZEUB 4CFCA 3THYA 5M1PA 1A5VA 1JJ2M 5FLXO 1BIZA 2EX3A 4FZXC 5BN9A 3SQ4A 2QWNA 5HP1A 4FWPA 1NK7A 4B3MK 3ALYA 3ZEUA 2RHKA 4B08A 4CGHA 4DTRA 1D8YA 1KAXA 4H0YB 1N36K 3AVKA 5GIPA 1NJWA 3RWUA 5C25A 1ATNA 4BRHA 1OVYA 3QB0A 2YKMA 1UAXA 1N34K 2IVPA 3V1OA 1RBRA 3ZSZA 4HUGA 5KPRA 2PYJA 1MDUB 1K8KB 1HNVA 1L3VA 4FJGA 1HKGA 5TKWA 3OYCA 1W2BM 3ID8A 4FZYA 3LANA 4U7BA 2D1KA 1K8KA 3D0PA 1I3AA 5IWAK 4KKOA 1VQMN 2BTFA 4O8KA 4IJAA 4F4KA 1NM1A 3SBGA 4QAGA 3NF6A 3VQ7A 4LF7K 1O13A 3F9KA 1YJWN 4Z4EA 4KI4A 3SLCA 3OS0A 4U67L 3QMLA 2UUCK 3CIPA 1S6PA 5ADXH 2QA4N 1T3VA 3OYJA 3LP0A 1X9JA 5H1SQ 1IKYA 5T7BA 2F8TA 3E9PA 3T1HK 4M45A 1SL0A 4AHUA 3SZ2A 1NG9A 2Q0RA 4A5BA 4B8CA 1T05A 2JWKA 3OVNA 4XH1A 5C10A 4JKAA 2FLOA 5M1FA 1GOCA 3J81O 1OKJA 1WOQA 1X3NA 4H5WA 2GTDA 4K8XA 3V6DA 5KI6A 4NCGA 3A2FA 3ZX0A 3KKRA 4PWDA 5I3UA 3H6EA 1R59O 1GLBG 3BDPA 3HM8A 5KRSA 1RT6A 4FWKA 3VETA 4TSXA 1C0TA 3CD6N 4A61A 5GAHP 2AP1A 2BE2A 4H5RA 4MQ3A 3ZSRA 4FL9A 2FXUA 2WUSA 2KW4A 3QNNA 2CH6A 3HBTA 5HRPA 4YDUC 3K9KA 2VQEK 2CGJA 4DV6K 1WBDA 4M41A 1VSLA 3DM2A 1TKXA 1FJGK 1LWEA 2Q2RA 2VGNA 4NB4A 1CZ9A 1UWBA 3G6EN 3ZT1A 1QSSA 2O8CB 2XO7A 5M1QA 3JYTA 3A5NC 4FWSA 4CF1A 3WNEA 1H1VA 3OBWA 3NAEA 1BHLA 4KRFA 5E26A 2D0OA 3DLEA 1QE1A 4DSIA 2O8CA 2KQ2A 1VK0A 1G15A 1S1XA 4CFDA 1GOBA 2Q31A 4CGJA 4C1NK 3CJ9A 4BGAA 1A5XA 3NE6A 1OH6A 1L3TA 3G25A 3WQTA 1VSMA 3ZT2A 4FJ9A 3AAPA 1E3MA 3DLKA 3LM2A 1NKEA 2W42A 1NJYA 3SBTA 3AVCA 4ICLA 1J9AA 4A2AA 4BREA 4O55A 3HYFA 1Q81O 3O1WA 1TKTA 3QNOA 4M3XA 3FZKA 2KKZA 1YVNA 4W5NA 3ENHA 4B9LA 2EWSA 3CCRN 4NCBA 3VF6A 4CD1A 2G8FA 2B6AA 2FC0A 3CI5A 1LV5A 4LSNA 3K57A 3F73A 2Z1GA 3DRPA 5BR8K 4GW6A 2BANA 1YTAA 2ZJRL 3FLCO 1D9DA 4F3TA 3OA9A 4Y1CA 4F8RA 1HNWK 2G8VA 5FDLA 2NRXA 4FVMA 1WSGA 4BE0A 3MK6A 1HR0K 3K5MA 3AVIA 3KLEA 1KC8O 4Z0UA 3AVHA 2JGUA 1IKXA 1M1KO 3O9QA 2HHSA 2B5JA 1TAUA 4NXMK 4KH4A 5F0XA 3C6HA 3I33A 2XHBA 3TAEA 4Z94A 4B9VA 4DV0K 1X9WA 3RMAA 1XHXA 3IDHA 4FLWA 4DSJA 4CZKA 5J2QA 4DB3A 4BE1A 4I2PA 3R1XA 1ZBFA 1BIUA 2GBZA 4N56A 3SAHA 5CZ1A 4BG8A 2GWJA 5BN8A 4FJKA 2LSNA 5D3GA 3JAMO 4PKGA 2IIRA 3TAQA 1BGXT 3WQUA 1S9EA 5AQQA 1TAQA 3CYMA 4I9QA 4IKFA 3NVKA 4CGGA 1ESVA 4FJHA 5HRRA 1F21A 3WT0A 5FROA 3HPGA 4X65K 1N5YA 3U6FA 3O3GA 3SQ1A 5C2FA 3SUNA 4E19A 1Z6RA 3CJ7A 2OANA 3TTDA 1HJOA 2P9PB 5C12A 3PIPL 1NK9A 2HF4A 2V7ZA 3OYKA 2NRWA 2QK9A 4KBOA 4IOCL 1WSEA 2VWBA 2P9PA 3CXCM 4CZMA 1NK5A 2Q1NA 3S3NA 4A59A 2QI2A 4C8MA 3C65A 4H0TB 4R5PA 2ZE2A 3QBXA 1EO1A 1EX4A 2CGKA 3L4IA 2ZGYA 4KV8A 3C6AA 3J8AA 3SYZA 4FLYA 1OVQA 4CHOA 3AVLA 5C24A 3CC2N 3ZT0A 4JRQA 3VEXA 1R0AA 4JV5K 1KXPA 4ISEA 1DTQA 1B9FA 4BC2A 1S1WA 2DFFA 4Z4HA 3E9OA 1IBMK 1TKDA 4F9OA 3C7NB 3QETA 3ZX2A 1DTTA 3WXKA 4BRLA 3WXLA 1TUYA 4DSFA 4JI5K 2WFBA 4OGEA 2GELA 1U6ZA 5JMVA 3TU5A 3QFUA 3C7NA 4AHVA 5AQRA 4FJXA 4K41A 4J2BA 4YOVA 2E6LA 1RNHA 3VTHA 3PY8A 4A2BA 3G4SN 2V51B 4JKGB 1T8EA 1SL1A 3THWB 4OKJA 3L4QA 4LH4A 1NNEA 1RTIA 4JKGA 3AA4A 4C8NA 3K59A 3HPOA 2O4IA 3THWA 4BRMA 3HP9A 1VQ6N 3U8XA 1O1WA 4M3YA 1TK8A 3CPEA 3DYAA 2A5XA 1XQSC 1RBSA 4CJTA 4JI3K 3VGMA 3TPQA 4JAXA 3SUPA 2UXDK 4H0VB 1RILA 2X74A 3FZMA 2OA8A 5M1OA 1BOTO 4M3RA 1S6QA 2W6LA 3L2WA 4B3TK 2FBYA 2Q3SA 4OPHA 3VEOA 4EAHD 4DTOA 4JN4A 1QHAA 4DFJA 3I8BA 2VG7A 3HTVA 3LDOA 3V9SA 4B1YB 3L6QA 3AO5A 3P39A 1KQSM 2Q36A 1VSFA 2UUBK 4BRIA 2FF3B 4YNQA 3RSEB 3O6WA 2YHAA 1G99A 1JL1A 1HLUA 4W5TA 3H3OB 3TARA 1BWFO 4CHQA 1RDCA 3QBWA 3RSEA 3UE5A 2NNWA 3HP6A 4OLBA 4DTSA 3LP1A 4O4GA 5J2NA 1YUWA 3OYMA 1JKHA 5AJ3K 4CEZA 4V19S 4KREA 3P83D 4AHRA 3PSFA 3NHGA 3TI0A 5BR9A 3G71N 4E3SA 1X9SA 2X6NA 3V9XA 1YITN 3L8BA 5M1KA 2D4WA 5JICA 4W5OA 4IFYA 4DS5A 1NWKA 4I7FA 1QSYA 2DY4A 1IBLK 3N4PA 4EFHA 4X62K 2E5LK 1JLFA 4OPJA 3T19A 1KLMA 4BC5A 3HK2A 3LP2A 3EEQA 2ZJPL 3VERA 4DV1K 2BGGA 5CZ2A 2IOCA 1YJNN 2I5JA 3I0SA 3KJVA 3TWHA 4RWTA 2I7PA 4FPBA 5DM7L 1FKPA 1LWCA 4K25A 3CF5L 4ZTJA 4O0IA 4Q0BA 2ZGZA 1EQYA 3AGKA 1IO2A 1U49A 3U3GA 1VSHA 4AH9A 3OJSA 4GV6A 1JCEA 3A8YA 4JI2K 3VTIA 4GMJB 4B1ZA 4WQ5C 5GINA 3V81A 1TK0A 2RN2A 4CJ4A 5BRDA 5J1EA 3VESA 1EWQA 4YFUA 4CF0A 3OYFA 1JLCA 3MECA 1RBUA 2FBTA 2E1YA 1ASUA 5C42A 4GV9A 5AQYA 2VQFK 4BRQA 4O44A 4FM1A 3HSCA 3O1BA 3FZHA 4KHQA 3A5LC 2A1RA 4CZEA 2FSJA 3N4QA 2DTUA 4NCAA 1JLEA 2VG5A 2KZMA 3SQ2A 3F5TA 1X1PA 1VHXA 5SZTA 4DQRA 1CXUA 5AQZA 1RTDA 4FW2A 4FLVA 3CCLN 5BPLA 4EZ9A 2ASPA 4FJNA 2D0AA 1VQ7N 5AQKA 3VPZA 1T6CA 4DKWA 1LAWA 3MMVA 3LP3A 3DLRA 3NCIA 3P5JA 1ILYA 4IXCA 4E7IA 4XIUA 1T44A 5J2PA 2DFEA 2F8SA 2ITMA 2A3ZA 4N5SA 3QEPA 1NGHA 4ILJA 3DJCA 3L2VA 4YORA 1HNXK 3DXMB 4ELVA 2KLAA 4BRNA 3KWIA 3DWLA 2HBJA 1KVBA 4LFCK 3SI6A 2UXBK 2E2PA 4BR0A 2P1JA 3KWGA 4PHTX 2YHWA 3LM9A 4BVPA 4JRPA 4JS4A 5C0YA 3DXMA 2UU9K 5AZJB 1W0HA 3OTOK 4C23A 2HNYA 1JXEA 1I39A 2YJEA 4H5NA 2OPSA 2I7NA 4YOXA 3IUCA 3L2UA 4HCBA 4DU1A 1NGIA 1HKCA 4EHUA 1JLQA 1NGAA 2X78A 3CPWM 1D4XA 4DF4A 5AZJA 3TABA 4DLGA 3DI6A 3SNNA 2Y1IA 3KD5E 1YT3A 5AQHA 1K8AO 4CJLA 4DSKA 5MLCQ 1QQMA 4IBNA 4BR7A 2QWPA 1U47A 4LF4K 2XY8A 3OJUA 2OTJN 3IAYA 1NBWA 3MWTA 4CI6A 2ZM6K 4JI7K 4EHTA 3ITHA 3GDQA 4CK3A 2P9SB 3P31A 3GG4A 4IG0A 4ZTFA 1UA1A 1QSLA 3ULEB 4CJSA 1HX1A 4CEBA 3K0SA 4OLAA 3PV8A 2QWLA 2W6KA 4BDYA 3C95A 4B9QA 2F4VK 1IBKK 3NVMA 4YOWA 3LDLA 4FWRA 3RVCA 2P9SA 3T3FA 1ZC6A 3BEXA 4GV3A 4HWIA 3ULEA 3CERA 2P5OA 3EO3A 1RT2A 2V52B 1NJXA 1HKBA 4BR4A 1P8ZA 3IKMA 2P9NB 4AHTA 3C0BA 2OCEA 3KIOA 4MDAA 3IMXA 3KLHA 4G1QA 1YTUA 1VRTA 2JLEA 3R3LA 1KD1O 3MEDA 2P9NA 2YHXA 3HOTA 4E1JA 4WQ4C 3LDPA 3NFAA 4C8KA 3CETA 1HYZA 4JKEA 1XNQK 4I2QA 5LY3A 3VQCA 3AVFA 4DR3K 4HUEA 3I8DA 4HHTA 1XC3A 4IZ9A 1XWLA 4H0OA 1SKRA 3JS6A 1KVAA 1S1TA 4BRAA 4E89A 2VYPA 1C0GA 4CW7B 4IEEA 4FJMA 1E4FT 5GIOA 3VA0A 4WFBL 3CMAN 4NYNA 4CZIA 4E1MA 3NF8A 3HO1A 4EZ6A 4FWQA 1L5UA 5FPMA 4GVEA 4QCLA 4JEPA 4LF5K 4KPYA 2QKKA 4DWIA 1WN7A 1K6YA 1JCFA 3LAMA 1A5WA 1KAZA 3SMSA 1KTQA 4Q5VA 1N33K 1YXQA 3AVJA 4WFNL 4CZJA 1ITGA 1SAZA 3PX4A 2Z1JA 4DLEA 3O4WA 1V4SA 4DU3A 5AQIA 4CEDA 3M1FA 1Y64A 3H45C 1HMVA 3O5BA 5FPNA 4CBXA 3QERA 3IRXA 2E2NA 3O8MA 4IJNA 3S41A 3ZSWA 1XMQK 2PYLA 3ISNC 4X64K 3CJCA 3EKUA 4FOIA 4JKFA 4UQGA 3OYGA 4M7YA 1JXBA 4CJ3A 3Q7CA 1C0UA 4H0PA 3O3FA 4DR6K 1GOAA 1Q9XA 4GKKK 4JI6K 5JVGL 4WFAL 3CG7A 3VQ6A 5EU7A 5DK5A 3CFPA 4FM0A 5LMNK 2Q97A 3EN9A 4YDUA 1J54A 3BF3A 4FWLA 3MN9A 1LW0A 4JK9A 4LC9B 2BUPA 3WNFA 1U04A 2HHHK 3HL8A 4BRFA 5FPEA 4WF9L 3CCJN 5AFUA 4QS7A 1C1BA 4DSEA 4JKBA 4CEOA 4JI0K 1J5EK 3VQAA 1XI1A 2CGLA 4XH4A 4F3OA 1J53A 2ASMA 3AVBA 2W40A 5CHIA 3TSQA 1W9HA 4DR1K 1NGEA 3PO4A 3GBTA 5LL6Z 2A42A 4KB0A 1ZXOA 3QLHA 4CF2A 1QVFM 1JL2A 3A5MC 4Z4IA 3KTQA 4C1NI 2W41A 2BH1A 3WNHA 2DFHA 3SUQA 2IC3A 2NRTA 3PSIA 3MDQA 4BWMA 4DUYK 1GLLO 3RTVA 1Q7YO 3OYBA 4DTMA 1TV6A 5FPDA 3DMJA 2QXLA 2G8UA 4DG1A 4HVJA 3SCXA 3H46O 4W5QA 1RDUA 2IDOA 5JVHL 1NGJA 3D6RA 1L3UA 1HQEA 4O8UA 3BUZB 4CEAA 1OH7A 1NK8A 1EWRA 1ZBHA 2E6MA 3ZT4A 1IG9A 1X3MA 4EP5A 2OYQA 2HBLA 4K0KK 4AHSA 2QM1A 1M90O 1MWKA 2GEMA 3HI0A 2G8HA 1LOTB 4IOAL
chains in the Genus database with same CATH topology
2JWLA 5LJVA 5HL7L 1BA0A 3FZMA 3CQXA 5M1OA 1BOTO 2PFUA 1BU6O 2GX9A 1JCGA 2P9IB 4MLHA 3KVGA 3J7ZO 2F9WA 4OPHA 3VEOA 4BR5A 4EAHD 2J4RA 1S72N 4JN4A 3GE1A 3ENOA 3CCQN 3W0LA 1QHAA 1WUAA 1YF5L 3I8BA 1Q86O 4H0XB 3HTVA 3LDOA 3BF1A 4FSVA 1TYQB 5AQGA 3L6QA 3MWPA 3OBYA 3ZX3A 4B1YB 3H1QA 4ILHA 3P39A 2P9IA 1KQSM 2Q36A 4BRIA 2FF3B 3SK3A 3VMFB 3RSEB 3O6WA 3E9LA 2E1ZA 1G99A 4WCEL 2YCHA 1HLUA 5LJWA 4YOUA 1TYQA 1VQON 5EX5A 3SJHA 3H3OB 3VF4A 1BWFO 3WXJA 2HBKA 1ATSA 3AY9A 3MN6A 4DHYA 3FR0A 1NLVA 3QBWA 3RSEA 2NNWA 3UE5A 3AAQA 3M6GA 1NGGA 3EKSA 5BRFA 2AA4A 2QW9A 4MDBA 1YUWA 3ZEUB 1RDWX 5AQWA 4B1UB 5M1PA 3A5OC 4M7XA 3Q7BA 1JJ2M 4CBUA 3VF2A 1VQPN 2FF6A 3E1YA 5BN9A 4RCHA 2QWNA 4FWPA 5AQLA 5BR9A 4FWMA 3G71N 3CC7N 1YAGA 3ZEUA 2RHKA 3EE9A 5AFUH 4FWNA 4IFEA 3U4LA 1KAXA 4H0YB 1YITN 5EXWA 5M1KA 1KAYA 2D4WA 3ENBA 5AQSA 3TTCA 3VGLA 5JICA 5GIPA 1NWKA 3QICA 4BY9C 4IDHA 1ATNA 3N4PA 4EFHA 4BRHA 1OVYA 3QB0A 2CH5A 5GAEP 4UY8O 2NRZA 3D7EO 4BC5A 2E2QA 4BQLA 1IG8A 2ZJPL 3O9RA 3VERA 2IVPA 3TSPA 3WUHA 4BR9A 3CQYA 3M5RA 1YJNN 4O5FA 3BP8A 5KPRA 3CJ1A 1MDUB 1K8KB 4RWTA 2QWQA 4K42A 2I7PA 4FPBA 1HKGA 5DM7L 2NLXA 4ISGA 5TKWA 3CF5L 4K25A 1S3XA 1W2BM 3ID8A 4A62A 3FGUA 3O9UA 2ZGZA 4B1VA 1EQYA 2D1KA 3AGKA 4U7BA 5CR4A 3W3DA 4BRPA 1BUPA 3FZFA 3R8EA 1K8KA 1NMDA 4GV6A 1JCEA 3A8YA 3EL2A 1VQMN 2BTFA 4O8KA 2QWOA 4IJAA 3A0IX 3IFRA 3VTIA 1NM1A 3SBGA 4B1ZA 4WQ5C 3U9DA 5GINA 3M3ZA 5BPNA 5EY4A 5AQUA 1O13A 5AZIB 1YJWN 2IVNA 3FE1A 1K73O 2HF3A 5BRDA 3E66A 3VESA 3SLCA 4U67L 2WBNA 1QZ5A 5AQOA 3CCVN 3MN7A 3QMLA 5AR0A 2ASOA 3CIPA 5ADXH 2QA4N 2E1YA 1T3VA 5AZIA 3KZBA 3O9SA 3VEZA 4GV9A 1X9JA 2NZTA 5AQYA 5H1SQ 4BRQA 3ZYYX 2D0PA 1RFQA 3E9PA 3HSCA 3O1BA 3FZHA 4M63C 3A5LC 4YOTA 5KPTA 4CZEA 2FSJA 2E2OA 3N4QA 2Q0RA 4A5BA 4IWVA 1SZ2A 4KH5A 4BC4A 3F5TA 2JWKA 5C10A 3CJAA 4XH1A 4JKAA 2FLOA 5M1FA 1OKJA 1WOQA 2FSNA 1X3NA 1VQNN 4H5WA 1VAZA 3DXKB 2GTDA 5AQZA 3GL1A 1NGDA 2P9UB 5JLHA 3CCLN 2F9TA 5BPLA 2ASPA 1VQ7N 2VGMA 5AQKA 3VPZA 3ZX0A 1T6CA 2PBDA 4DKWA 1YI2N 2WC9A 3H6EA 3D2FB 3MMVA 1VQKN 1R59O 3DXKA 1GLBG 3MX5A 3HM8A 2P9UA 2A41A 1ILYA 4IXCA 4FWKA 3VETA 1VQ4N 1T44A 3CD6N 2ITMA 2A3ZA 3EE8A 4A61A 5GAHP 2AP1A 2HSTA 1NGHA 4H5RA 3DJCA 4ILJA 4YORA 3DXMB 2KLAA 4FL9A 3D2FA 2FXUA 2WUSA 3DWLA 3KWIA 3R9PA 4BRNA 2HBJA 2E2PA 3OHRA 4JKHA 2CH6A 3HBTA 3VOVA 4YDUC 4BR0A 5CE3A 3KWGA 4PHTX 2YHWA 3K9KA 3LM9A 4BVPA 4DCHA 1NJIO 5C0YA 3L0QA 3WXMB 3DXMA 4G9ZA 5AZJB 4BROA 4PL7A 4CZLA 3HZ6A 2CGJA 2YI1A 3DAWA 4C23A 3PIOL 1SQKA 5AQFA 2YJEA 4H5NA 4YOXA 2I7NA 3IUCA 3QDKA 1NGIA 2VCPA 5EOYA 1HKCA 2FSKA 4EHUA 1VQ9N 1NGAA 3CPWM 1D4XA 5AZJA 1DEJA 2Q2RA 2VGNA 4NB4A 3TTFA 1C0FA 3G6EN 5AQHA 5M1QA 2E88A 2YJFA 3T69A 3P4IA 3DLLL 3A5NC 4FWSA 3H1VX 5AQVA 1K8AO 1H1VA 2HBMA 3OBWA 1NGCA 4AM7A 3O9TA 5E26A 2D0OA 5MLCQ 3O80A 1QQMA 4NLCA 4BR7A 2QWPA 1NGFA 1DKGD 5HOOA 2OTJN 2Q31A 1NBWA 3B8AX 2HOEA 3CJ9A 3MWTA 4BGAA 4C1NK 1Q82O 4K43A 5AQXA 4CI6A 1YHQN 4XEIA 3U9ZA 4EHTA 3GDQA 1NGBA 3G25A 4NLBA 3WQTA 2P9SB 3P31A 3GG4A 3AAPA 4WYBA 4CZFA 3LM2A 3ULEB 1HX1A 3I56N 2QWLA 3SBTA 1VQ5N 4B9QA 3NVMA 4YOWA 3LDLA 2QWRA 4A2AA 4CZHA 4BREA 4JNEA 2DPNA 3O1WA 4FWRA 1Q81O 4IO8A 4OPAA 3RVCA 2P9SA 3FFKB 1ZC6A 3FZKA 2KKZA 1LCUA 1YVNA 3BEXA 4HWIA 2ZJQL 4GV3A 3ENHA 1QQNA 3ULEA 2GUPA 2EWSA 3CERA 3CCRN 1BG3A 3VF6A 3EO3A 4CD1A 2V52B 1DGKN 1HKBA 3CI5A 4BR4A 2PAVA 1P8ZA 3IKMA 5AQJA 4R79A 2KHOA 1QZ6A 2P9NB 2ZWHA 3C0BA 5F1XA 4MDAA 1YIJN 3IMXA 2ZJRL 3FLCO 4B1WB 1MA9B 3OA9A 4GY2B 1U2VB 5AQNA 2NRXA 1Z05A 3ID6A 3R3LA 1KD1O 2P9NA 2YHXA 3VEVA 3CCSN 1MWMA 3HOTA 5E84A 4E1JA 3MK6A 3LDPA 4WQ4C 2UYTA 1KC8O 3CETA 4JKEA 4QS9A 5LY3A 1M1KO 3O9QA 1U2VA 4CZGA 2NRHA 5GAGP 5BREA 3H3NO 2IVOA 2ZF5O 4KH4A 3EZWA 5AQPA 5C2DA 5F0XA 3C6HA 1XC3A 4IZ9A 5TKYA 4H0OA 4HTLA 5I9EB 3I33A 3TSUA 3JS6A 4Z94A 3CHWA 4IO9L 3ATUA 4BC3A 4BRAA 4BGBA 2VYPA 1C0GA 3F9MA 4J8FA 4IEEA 4WQ5A 4BR2A 1E4FT 4GNIA 3AGRA 3IDHA 3CCUN 1IJJA 5GIOA 4KH6A 4CZKA 4WFBL 3CMAN 3R6MA 4NO7A 4DB3A 4CJ7A 4CZIA 4Y0WA 4ISFA 3HOSA 3R1XA 5B8HA 4FWQA 4BRKA 5FPMA 4A57A 1S22A 4GVEA 1GLCG 4JEPA 3SAHA 3CC4N 3SAGA 4BG8A 2GWJA 5BN8A 1BA1A 1JCFA 4PKGA 2IIRA 4B1XB 1KAZA 3SMSA 1E4GT 3KK7A 4FWOA 1YXQA 2NRVA 4IOXA 5AQQA 3WQUA 4CZJA 1SAZA 4WFNL 3CCMN 1ZBSA 5AQTA 3NVKA 1BO5O 3O4WA 1ESVA 1V4SA 5AQIA 4BQZA 1GLEG 2Q0UA 1Y64A 3H45C 3M1FA 4H5TA 4ILGB 3O5BA 5FPNA 4CBXA 3WT0A 1W97L 2E2NA 3O8MA 4IEIA 4IJNA 3S41A 5M1NA 3SAFA 2V7YA 1GLFO 4JKCA 4AF1A 5C2FA 4FVUA 3CJCA 3EKUA 4FOIA 4FPAA 2H3GX 4JKFA 3SMPA 4I6MB 4PL8A 4BG9A 3QFPA 4M7YA 4QS8A 5KQDA 4XH5A 1Z6RA 3CJ7A 2OANA 3TTDA 1HJOA 2P9PB 2QTDA 3Q7CA 5C12A 1J6ZA 4H0PA 3PIPL 2HF4A 3JXUA 2V7ZA 1DT9A 2HMPA 4PKHA 4I6MA 5BPMA 2F7TA 2YHYA 3LDQA 2NRWA 5JVGL 4KBOA 4WFAL 3CJBA 4IOCL 2VWBA 4JD2B 3VENA 2P9PA 4MO5A 3CXCM 4CZMA 1QVGM 3WXIA 2Q97A 3EN9A 2Q1NA 3BF3A 3O08A 4FWLA 4YDUA 3VEWA 4A59A 3MN9A 4YOYA 4JK9A 1P90A 2QI2A 4LC9B 3I55N 5KPZA 4JD2A 2BUPA 3C65A 4H0TB 1RGIA 4BRFA 5FPEA 3QBXA 4BRDA 2GWKA 3MCAB 5AFUA 5KQ8A 4WF9L 3CCJN 2CGKA 3L4IA 4QS7A 1EO1A 3K9JA 3MX2A 1SS6A 4PKIA 3CMEN 2ZGYA 3KHYA 1CZAN 3C6AA 3J8AA 4JKBA 3VGKA 1BDGA 3GOIA 3CC2N 4A5AA 3VEXA 4JHDB 2CGLA 1V4TA 4XH4A 3F2KA 2QEXN 1KXPA 1TUUA 4ISEA 2ASMA 5AQMA 3UKUB 4BC2A 3CCEN 3MN5A 3E9OA 2A40A 5CHIA 2W40A 4JK8A 1GLJO 3TSQA 4F9OA 3C7NB 3HRGA 4FOEA 3ZX2A 2E20A 3NMUA 4JHDA 3WXKA 1HUXA 2P9KB 2QWMA 3WXLA 4BRCA 3UB5A 1NGEA 1TUYA 3UKRB 4BRLA 5GADP 3GBTA 4BVOA 2A42A 2WFBA 3WEEB 5C15A 1ZXOA 1QQOA 3UKUA 2GELA 4MLEA 1N8RO 5F2RA 1QVFM 1U6ZA 5JMVA 3A5MC 2A6AA 3TU5A 4CBWA 4C1NI 2RE2A 5BRHA 2W41A 3QFUA 3C7NA 3LL3A 4JK7A 5AQRA 2NRRA 2BH1A 2P9KA 1GLDG 3UKRA 4K41A 4YOVA 3WEEA 2NRTA 3VTHA 1HPMA 5EVZA 1Q18A 4A2BA 3G4SN 2V51B 4JKGB 4DQ8A 3MDQA 1GLLO 4H03B 3OW2M 1Q7YO 3D2EB 3ATVA 4EIAA 3AARA 1YJ9N 4CD3A 3L4QA 4AM6A 5FPDA 4JKDA 4FO0A 2QXLA 3T7ZA 4JKGA 3H46O 4MO4A 5ADXA 1VQLN 1T6DA 4L3QA 1RDUA 3D2EA 4BRMA 5JLFA 2P9LB 3MCPA 3U8XA 5JVHL 1VQ6N 1ATRA 3ZETB 5ELZA 1NGJA 3PLAA 3D6RA 3CPEA 3VEYA 3P38A 4H5VA 2OTLN 3FZLA 4O8UA 2A5XA 3BUZB 4OO1J 1XUPO 1VQ8N 1GLAG 3LDNA 1XQSC 4RTFD 1K9MO 1X3MA 3VGMA 2P9LA 2HBLA 2E8AA 3TPQA 5DM6L 3ZETA 2QM1A 1M90O 2YX6A 4JAXA 4WQ4A 1MWKA 4H0VB 4BRGA 2GEMA 3HI0A 1LOTB 4IOAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJV A;  1BA0 A;  3FZM A;  3CQX A;  1BOT O;  1BU6 O;  1JCG A;  2P9I B;  4MLH A;  3KVG A;  2F9W A;  3VEO A;  4BR5 A;  4EAH D;  2J4R A;  4JN4 A;  3GE1 A;  3ENO A;  3W0L A;  1QHA A;  1WUA A;  3I8B A;  4H0X B;  3HTV A;  3LDO A;  3BF1 A;  4FSV A;  1TYQ B;  5AQG A;  3L6Q A;  4B1Y B;  3ZX3 A;  3H1Q A;  2P9I A;  2Q36 A;  4BRI A;  2FF3 B;  3SK3 A;  3RSE B;  3O6W A;  2E1Z A;  1G99 A;  2YCH A;  1HLU A;  5LJW A;  1TYQ A;  5EX5 A;  3SJH A;  3H3O B;  3VF4 A;  1BWF O;  3WXJ A;  1ATS A;  3AY9 A;  3MN6 A;  4DHY A;  3FR0 A;  1NLV A;  3QBW A;  3RSE A;  3UE5 A;  3AAQ A;  3M6G A;  1NGG A;  3EKS A;  5BRF A;  2AA4 A;  2QW9 A;  1YUW A;  3ZEU B;  1RDW X;  5AQW A;  4B1U B;  3A5O C;  4M7X A;  4CBU A;  3VF2 A;  2FF6 A;  5BN9 A;  4RCH A;  2QWN A;  4FWP A;  5AQL A;  5BR9 A;  4FWM A;  1YAG A;  3ZEU A;  5AFU H;  4FWN A;  3U4L A;  1KAX A;  4H0Y B;  5EXW A;  1KAY A;  2D4W A;  5AQS A;  3VGL A;  5JIC A;  1NWK A;  3QIC A;  1ATN A;  4EFH A;  4BRH A;  3QB0 A;  2CH5 A;  3D7E O;  4BC5 A;  2E2Q A;  4BQL A;  1IG8 A;  3VER A;  2IVP A;  3WUH A;  4BR9 A;  3CQY A;  4O5F A;  3BP8 A;  5KPR A;  3CJ1 A;  1MDU B;  1K8K B;  4RWT A;  2QWQ A;  4K42 A;  2I7P A;  4FPB A;  1HKG A;  2NLX A;  4ISG A;  4K25 A;  1S3X A;  3ID8 A;  4A62 A;  3FGU A;  2ZGZ A;  4B1V A;  1EQY A;  2D1K A;  3W3D A;  4BRP A;  1BUP A;  3FZF A;  3R8E A;  1K8K A;  1NMD A;  1JCE A;  3A8Y A;  3EL2 A;  2BTF A;  4O8K A;  2QWO A;  4IJA A;  3A0I X;  3IFR A;  1NM1 A;  4B1Z A;  4WQ5 C;  3U9D A;  3M3Z A;  5BPN A;  5EY4 A;  5AQU A;  5AZI B;  2IVN A;  3FE1 A;  2HF3 A;  5BRD A;  3VES A;  3SLC A;  5AQO A;  1QZ5 A;  3MN7 A;  3QML A;  5AR0 A;  2ASO A;  3CIP A;  5ADX H;  2E1Y A;  5AZI A;  3KZB A;  3VEZ A;  1X9J A;  2NZT A;  5AQY A;  4BRQ A;  2D0P A;  1RFQ A;  3HSC A;  3O1B A;  3FZH A;  4M63 C;  3A5L C;  5KPT A;  4CZE A;  2FSJ A;  2E2O A;  2Q0R A;  4IWV A;  1SZ2 A;  4BC4 A;  3CJA A;  4XH1 A;  2FLO A;  1OKJ A;  1WOQ A;  2FSN A;  1X3N A;  4H5W A;  3DXK B;  2GTD A;  5AQZ A;  3GL1 A;  1NGD A;  2P9U B;  5JLH A;  2F9T A;  5BPL A;  2ASP A;  5AQK A;  3VPZ A;  3ZX0 A;  1T6C A;  2PBD A;  3H6E A;  3D2F B;  3MMV A;  1R59 O;  3DXK A;  1GLB G;  3HM8 A;  2P9U A;  2A41 A;  4IXC A;  4FWK A;  3VET A;  1T44 A;  2ITM A;  2A3Z A;  4A61 A;  2AP1 A;  1NGH A;  4H5R A;  3DJC A;  3DXM B;  4BRN A;  4FL9 A;  3D2F A;  2FXU A;  2WUS A;  3DWL A;  3R9P A;  2E2P A;  3OHR A;  2CH6 A;  3HBT A;  3VOV A;  4YDU C;  4BR0 A;  5CE3 A;  2YHW A;  3LM9 A;  4BVP A;  4DCH A;  3L0Q A;  3DXM A;  5AZJ B;  4BRO A;  4PL7 A;  4CZL A;  3HZ6 A;  2CGJ A;  2YI1 A;  3DAW A;  4C23 A;  1SQK A;  5AQF A;  2YJE A;  4H5N A;  2I7N A;  3IUC A;  3QDK A;  1NGI A;  2VCP A;  5EOY A;  1HKC A;  2FSK A;  4EHU A;  1NGA A;  1D4X A;  5AZJ A;  1DEJ A;  2Q2R A;  4NB4 A;  1C0F A;  5AQH A;  2E88 A;  2YJF A;  3P4I A;  3A5N C;  4FWS A;  3H1V X;  5AQV A;  1H1V A;  1NGC A;  4AM7 A;  5E26 A;  2D0O A;  3O80 A;  1QQM A;  4BR7 A;  2QWP A;  1NGF A;  1DKG D;  2Q31 A;  1NBW A;  3B8A X;  3CJ9 A;  2HOE A;  4BGA A;  4K43 A;  5AQX A;  4CI6 A;  4XEI A;  3U9Z A;  4EHT A;  3GDQ A;  1NGB A;  3G25 A;  3WQT A;  2P9S B;  3GG4 A;  3AAP A;  4WYB A;  4CZF A;  3LM2 A;  3ULE B;  1HX1 A;  2QWL A;  4B9Q A;  3LDL A;  2QWR A;  4A2A A;  4CZH A;  4BRE A;  4JNE A;  2DPN A;  3O1W A;  4FWR A;  4IO8 A;  2P9S A;  3FFK B;  1ZC6 A;  3FZK A;  1LCU A;  1YVN A;  3BEX A;  4HWI A;  3ENH A;  1QQN A;  3ULE A;  2GUP A;  2EWS A;  3CER A;  1BG3 A;  3VF6 A;  3EO3 A;  4CD1 A;  2V52 B;  1DGK N;  1HKB A;  3CI5 A;  4BR4 A;  2PAV A;  1P8Z A;  5AQJ A;  2KHO A;  1QZ6 A;  2P9N B;  2ZWH A;  3C0B A;  5F1X A;  3IMX A;  3FLC O;  4B1W B;  1MA9 B;  4GY2 B;  1U2V B;  5AQN A;  1Z05 A;  2P9N A;  2YHX A;  3VEV A;  1MWM A;  5E84 A;  4E1J A;  3MK6 A;  3LDP A;  4WQ4 C;  2UYT A;  3CET A;  4QS9 A;  5LY3 A;  1U2V A;  4CZG A;  2NRH A;  5BRE A;  3H3N O;  2IVO A;  2ZF5 O;  3EZW A;  5AQP A;  5F0X A;  1XC3 A;  4IZ9 A;  5TKY A;  4H0O A;  4HTL A;  5I9E B;  3I33 A;  3JS6 A;  4Z94 A;  3CHW A;  3ATU A;  4BC3 A;  4BRA A;  4BGB A;  2VYP A;  1C0G A;  3F9M A;  4J8F A;  4WQ5 A;  4BR2 A;  1E4F T;  4GNI A;  3IDH A;  1IJJ A;  4CZK A;  3R6M A;  4NO7 A;  4DB3 A;  4CJ7 A;  4CZI A;  4Y0W A;  4ISF A;  5B8H A;  4FWQ A;  4BRK A;  5FPM A;  1S22 A;  1GLC G;  4BG8 A;  2GWJ A;  5BN8 A;  1BA1 A;  1JCF A;  4PKG A;  2IIR A;  4B1X B;  1KAZ A;  3SMS A;  1E4G T;  4FWO A;  3WQU A;  1YXQ A;  5AQQ A;  4CZJ A;  1SAZ A;  1ZBS A;  5AQT A;  1BO5 O;  3O4W A;  1ESV A;  1V4S A;  5AQI A;  4BQZ A;  1GLE G;  2Q0U A;  1Y64 A;  3H45 C;  3M1F A;  4H5T A;  3O5B A;  5FPN A;  4CBX A;  3WT0 A;  2E2N A;  3O8M A;  4IJN A;  3S41 A;  2V7Y A;  1GLF O;  3CJC A;  3EKU A;  4FOI A;  4FPA A;  2H3G X;  3SMP A;  4BG9 A;  4I6M B;  4PL8 A;  3QFP A;  4M7Y A;  4QS8 A;  5KQD A;  4XH5 A;  1Z6R A;  3CJ7 A;  2OAN A;  1HJO A;  2P9P B;  1J6Z A;  4H0P A;  2HF4 A;  3JXU A;  2V7Z A;  2HMP A;  4PKH A;  4I6M A;  5BPM A;  2YHY A;  3LDQ A;  4KBO A;  3CJB A;  2VWB A;  4JD2 B;  3VEN A;  2P9P A;  4MO5 A;  4CZM A;  3WXI A;  2Q97 A;  3EN9 A;  2Q1N A;  3BF3 A;  3O08 A;  4FWL A;  4YDU A;  3VEW A;  3MN9 A;  4LC9 B;  5KPZ A;  4JD2 A;  2BUP A;  4H0T B;  1RGI A;  4BRF A;  5FPE A;  3QBX A;  4BRD A;  2GWK A;  5KQ8 A;  5AFU A;  2CGK A;  3L4I A;  4QS7 A;  4PKI A;  2ZGY A;  3KHY A;  1CZA N;  3J8A A;  3VGK A;  1BDG A;  3GOI A;  3VEX A;  4JHD B;  2CGL A;  1V4T A;  4XH4 A;  1KXP A;  1TUU A;  4ISE A;  2ASM A;  5AQM A;  3UKU B;  4BC2 A;  3MN5 A;  2A40 A;  2W40 A;  1GLJ O;  4F9O A;  3C7N B;  4FOE A;  3ZX2 A;  2E20 A;  4JHD A;  3WXK A;  1HUX A;  2P9K B;  2QWM A;  3WXL A;  4BRC A;  3UB5 A;  1NGE A;  1TUY A;  3UKR B;  4BRL A;  3GBT A;  4BVO A;  2A42 A;  3WEE B;  1ZXO A;  1QQO A;  3UKU A;  2GEL A;  4MLE A;  5F2R A;  1U6Z A;  5JMV A;  3A5M C;  2A6A A;  3TU5 A;  4CBW A;  5BRH A;  2W41 A;  3QFU A;  3C7N A;  3LL3 A;  5AQR A;  2P9K A;  1GLD G;  3UKR A;  4K41 A;  3WEE A;  1HPM A;  5EVZ A;  1Q18 A;  4A2B A;  2V51 B;  4DQ8 A;  3MDQ A;  1GLL O;  4H03 B;  3D2E B;  3ATV A;  4EIA A;  3AAR A;  4CD3 A;  4AM6 A;  5FPD A;  4FO0 A;  2QXL A;  3H46 O;  4MO4 A;  5ADX A;  1T6D A;  4L3Q A;  3D2E A;  4BRM A;  5JLF A;  2P9L B;  3MCP A;  3U8X A;  1ATR A;  3ZET B;  5ELZ A;  1NGJ A;  3VEY A;  4H5V A;  3FZL A;  2A5X A;  3BUZ B;  1XUP O;  1GLA G;  3LDN A;  1XQS C;  4RTF D;  1X3M A;  3VGM A;  2P9L A;  3TPQ A;  2E8A A;  3ZET A;  2QM1 A;  4JAX A;  4WQ4 A;  1MWK A;  4H0V B;  4BRG A;  2GEM A;  3HI0 A;  1LOT B; 
#chains in the Genus database with same CATH topology
 2JWL A;  2PFU A;  1BU6 O;  2YNG A;  2P9I B;  4MLH A;  1SUQ A;  4BR5 A;  3E01 A;  3CQ8 A;  3GE1 A;  3ENO A;  4BDP A;  3CCQ N;  2RKI A;  5E41 A;  3EYZ A;  4H0X B;  3TAF A;  3DRS A;  4DTJ A;  3MWP A;  1WSI A;  2P9I A;  4CEF A;  4Z4G A;  3VMF B;  4DV7 K;  4DTX A;  2E1Z A;  3MXM A;  4YOU A;  5EX5 A;  3VF4 A;  2HBK A;  1ATS A;  2QKB A;  4DHY A;  1NLV A;  3C94 A;  1NGG A;  3EKS A;  1I94 K;  1RDW X;  3VQD A;  4JLH A;  1VSD A;  2D0B A;  4JS5 A;  2G8I A;  3B6P A;  3VF2 A;  1VQP N;  3E1Y A;  4Y1D A;  2R7Y A;  2HHT A;  4RCH A;  1HNI A;  3V9Z A;  4PQU A;  5IT9 O;  4FWM A;  3CC7 N;  3EE9 A;  4DR4 K;  3NF7 A;  4FWN A;  4DF8 A;  2Y1J A;  5EXW A;  1KAY A;  3J7Y P;  1NK6 A;  2IGI A;  3QIC A;  3SV4 A;  4IDH A;  3VQP A;  4JYA K;  3ZSX A;  3THX B;  4UY8 O;  2NRZ A;  3D7E O;  1IH7 A;  3CM5 A;  3OYL A;  3O9R A;  3TSP A;  2HND A;  4CK1 A;  3PX6 A;  3B6O A;  3CQY A;  3THX A;  4KHS A;  3SV3 A;  3RR7 A;  4K42 A;  1TGO A;  4ISG A;  5FRM A;  1RT7 A;  5CR4 A;  3W3D A;  1CLQ A;  3R8E A;  3FZF A;  4M3W A;  1NMD A;  4DV4 K;  3EL2 A;  3OYH A;  2QWO A;  3A0I X;  4WE1 A;  5JS2 A;  2IVN A;  3FE1 A;  3CCV N;  1QZ5 A;  3MN7 A;  5AR0 A;  2ASO A;  4CCH A;  4CFA A;  3T1A A;  3O9S A;  1N6Q A;  4JI4 K;  3ZYY X;  1RFQ A;  4M63 C;  4KTW A;  4YOT A;  4BE2 A;  2OZM A;  1SKW A;  2E2O A;  4CJK A;  3DLG A;  1WBB A;  4X66 K;  4FLU A;  4IWV A;  1SZ2 A;  4BC4 A;  3CJA A;  4CJE A;  1VQN N;  2XY6 A;  1REV A;  1WB9 A;  4W5R A;  2P9U B;  3QIO A;  3LAL A;  1UA0 A;  3TAN A;  3IS9 A;  4FJ5 A;  1VQK N;  3MX5 A;  4IFV A;  1ASW A;  2P9U A;  2A41 A;  3QEX A;  3KLF A;  3K5N A;  3EE8 A;  4LH5 A;  5KGW A;  5HRN A;  4CHY A;  5A2Q O;  1IKW A;  2RF2 A;  4JKH A;  4RW9 A;  3KLI A;  3VOV A;  3AO3 A;  4J2E A;  1DLO A;  2VWK A;  3QEI A;  3MXJ A;  3WXM B;  4G9Z A;  4PL7 A;  4CZL A;  3HZ6 A;  2WTU A;  1SQK A;  3QDK A;  1ZBL A;  4B3O A;  5EOY A;  2FSK A;  3DLH A;  4M3T A;  4CJ5 A;  1VQ9 N;  4CGD A;  4LD0 A;  3TTF A;  4M3Z A;  4J2D A;  3KK3 A;  3T69 A;  3P4I A;  3DLL L;  3V9W A;  5AQV A;  5JS1 A;  4E7K A;  2FBV A;  2HBM A;  3OS2 A;  1NGC A;  4AM7 A;  3O9T A;  3O80 A;  1BI4 B;  4OX9 K;  4N47 A;  3K58 A;  5HOO A;  3T1Y K;  4CK2 A;  3B8A X;  1Q82 O;  1RT4 A;  4K43 A;  3HM9 A;  2F96 A;  2O8F B;  3M8R A;  1BI4 A;  3U9Z A;  2IS3 A;  2AJQ A;  1HYS A;  4NLB A;  3I0R A;  3RMD A;  1N32 K;  3I56 N;  2O8F A;  1EXQ A;  3AO2 A;  1VQ5 N;  4FM2 A;  4JNE A;  2DPN A;  4DMN A;  4OPA A;  1LCU A;  2ZJQ L;  4CEQ A;  1QQN A;  4E1N A;  2FBX A;  3VQ8 A;  3K2P A;  3HT3 A;  4FXD A;  2G8K A;  2PAV A;  1WSF A;  1QZ6 A;  2ZWH A;  3ZSV A;  4HCC A;  4B3R K;  4O5B A;  1YIJ N;  4JI1 K;  5HRS A;  1MA9 B;  3LPT A;  3O4Q A;  2BDP A;  3S3M A;  3OYA A;  4GY2 B;  1U2V B;  1Z05 A;  3ID6 A;  4ELU A;  4DR2 K;  1SV5 A;  3TAG A;  5K14 A;  3VEV A;  1MWM A;  5E84 A;  4E7J A;  3RMC A;  1C0M A;  4BWJ A;  2UYT A;  3K5O A;  3PX0 A;  4RG8 A;  1RT5 A;  1U2V A;  4CZG A;  4ID5 A;  5C2D A;  1WNS A;  2ATQ A;  4CIG A;  4B3S K;  3TSU A;  1RDD A;  4IO9 L;  4BC3 A;  4KO0 A;  4DV3 K;  1BCO A;  1VSK A;  3F9M A;  4J8F A;  1FK9 A;  2YNF A;  4WQ5 A;  4FJI A;  1IJJ A;  4KH6 A;  1LW2 A;  4NO7 A;  4CJ7 A;  1IV0 A;  4ISF A;  3HOS A;  5B8H A;  4CHN A;  3RMB A;  4NXN K;  1JLB A;  3WNG A;  3SAG A;  2GUI A;  1BA1 A;  1QHT A;  4B1X B;  2NRV A;  3CCM N;  4DV5 K;  2WOM A;  2HHU A;  2B4J A;  5AQT A;  1VRU A;  3BY5 A;  4BQZ A;  1GLE G;  2HW3 A;  2Q0U A;  4H5T A;  4ILG B;  4BAC A;  1LWF A;  1QS4 A;  3TAP A;  1W97 L;  4IEI A;  1S1V A;  5M1N A;  2V7Y A;  4AF1 A;  4FVU A;  4BG9 A;  2H3G X;  3SMP A;  4PL8 A;  3QFP A;  4QS8 A;  4DFM A;  4XH5 A;  2HMI A;  2QTD A;  1RTJ A;  1WAJ A;  2YKN A;  1J6Z A;  3J7A P;  3JXU A;  2HMP A;  4PKH A;  5BPM A;  3CFR A;  3LDQ A;  3S3O A;  3VEN A;  4MO5 A;  1XNR K;  2XRI A;  4B9M A;  1JLA A;  3WXI A;  1RBT A;  3NF9 A;  3JSM A;  2ZD1 A;  3VEW A;  5I42 A;  2O8E B;  1Y97 A;  2ZQB A;  3I55 N;  5KPZ A;  3S9H A;  1OH5 A;  1D9F A;  2OZS A;  1RGI A;  1TL1 A;  3O4N A;  3OYI A;  4BRD A;  2GWK A;  3L3V A;  2E4L A;  3MX2 A;  1SS6 A;  3CME N;  1CZA N;  4N76 A;  2O8E A;  3GOI A;  5HLF A;  4RW8 A;  4KAZ A;  4L8R B;  1B9D A;  3U3Y A;  4A5A A;  4FW1 A;  2QEX N;  1TUU A;  4KHW A;  2A1S A;  5HBM A;  2A40 A;  1KSP A;  1GLJ O;  4FOE A;  1FXX A;  4M3U A;  1HUX A;  2QWM A;  5GAD P;  3UB5 A;  3UKR B;  4DQP A;  1X9M A;  4BVO A;  5C15 A;  3KLG A;  1N8R O;  5F2R A;  3VQ5 A;  4CBW A;  2RE2 A;  5BRH A;  2UXC K;  3HXM A;  4B9U A;  1GLD G;  3UKR A;  1RTH A;  1HPM A;  5EVZ A;  1MU2 A;  4H03 B;  1XC9 A;  3D2E B;  4EIA A;  4IG3 A;  4CD3 A;  4AM6 A;  1SL2 A;  1NK4 A;  1KFD A;  5ADX A;  4F2S A;  4L3Q A;  1Z26 A;  3D2E A;  2P9L B;  2HVI A;  1ATR A;  5ELZ A;  3PLA A;  1NU0 A;  1LAV A;  3P38 A;  4H5V A;  2OTL N;  3M8Q A;  4DTP A;  4FJJ A;  4OO1 J;  3OY9 A;  1XUP O;  1VQ8 N;  4PY5 A;  1GLA G;  4RTF D;  1K9M O;  4K8Z A;  2P9L A;  2E8A A;  5DM6 L;  1T7P A;  4J2A A;  1NK0 A;  4WQ4 A;  1L3S A;  4NYF A;  4FK0 A;  1EKE A;  1C6V A;  2ITG A;  3CQX A;  1KLN A;  3ULD A;  2GX9 A;  1JCG A;  1WAF A;  4GKJ K;  2YV0 X;  3KVG A;  2F9W A;  1S72 N;  4CJP A;  4FZZ A;  3W0L A;  2XY5 A;  3BF1 A;  5AQG A;  3BZC A;  1QTM A;  3SK3 A;  3E9L A;  3DOK A;  4DTU A;  4WCE L;  2YCH A;  4OVL A;  1CXQ A;  3AY9 A;  3FR0 A;  2IAJ A;  3ZT3 A;  1RBV A;  1HJR A;  2D0C A;  4FLZ A;  3THV A;  4LFA K;  3AVA A;  1ASV A;  2HB5 A;  4C8O A;  5AQW A;  4B1U B;  3A5O C;  4M7X A;  3Q7B A;  4CBU A;  2FF6 A;  3SPY A;  3LDS A;  1B92 A;  5AQL A;  1YAG A;  4DR5 K;  2QXF A;  2O8B B;  3V1Q A;  5AFU H;  3V1R A;  4IFE A;  3U4L A;  4RW4 A;  1T03 A;  3DOL A;  1HPZ A;  4B9S A;  3ENB A;  5AQS A;  3VGL A;  3TTC A;  2HNZ A;  3ZSY A;  1RCH A;  4BY9 C;  4DTN A;  4F2R A;  2O8B A;  2OPR A;  1ZYQ A;  1RT3 A;  4KTZ A;  5KRT A;  2CH5 A;  5GAE P;  1ZBI A;  1FW6 A;  4DS4 A;  1HRH A;  1HQU A;  1RDB A;  1IG8 A;  2E2Q A;  4BQL A;  4DUZ K;  4QOZ B;  5CYQ A;  4ELT A;  5HRO A;  1VSE A;  4KI6 A;  3LAK A;  3WUH A;  4PUO A;  3VQ4 A;  1S5J A;  3M5R A;  4BR9 A;  4O5F A;  3BP8 A;  3AA5 X;  3CJ1 A;  3NGZ A;  2QWQ A;  1TKZ A;  2KTQ A;  2NLX A;  4CJV A;  1S3X A;  2GV9 A;  3V9U A;  3AV9 A;  4A62 A;  3FGU A;  2YNH A;  3O9U A;  4B1V A;  3FFI A;  3SJJ A;  4FJ8 A;  4H8K A;  4BRP A;  3G0Z A;  1BUP A;  4CIE A;  3ZLJ A;  1TVR A;  4DV2 K;  3IFR A;  3EY1 A;  1CZB A;  3U9D A;  3M3Z A;  5BPN A;  5EY4 A;  5AQU A;  4HTU A;  5AZI B;  3L3U A;  4C8L A;  3TR8 A;  1K73 O;  2HF3 A;  4YY3 K;  3E66 A;  3QEV A;  1NOY A;  3J80 O;  3C6T A;  3LZJ A;  2WBN A;  5AQO A;  3RR8 A;  5AZI A;  3KZB A;  3QES A;  3VEZ A;  3NDK A;  2NZT A;  1BIS A;  2D0P A;  5KPT A;  3KK2 A;  4OGC A;  1UOC A;  4DQQ A;  1BQN A;  3QO9 A;  3M8S A;  1U45 A;  4KH5 A;  1RDA A;  2FSN A;  4LFB K;  1ZBU A;  4BDZ A;  2G8W A;  1VAZ A;  3DXK B;  4ZHR A;  2EHG A;  3GL1 A;  1NGD A;  5JLH A;  4FLT A;  2F9T A;  3BZK A;  3C6U A;  1C1C A;  2VGM A;  4FK4 A;  3VQE A;  2PBD A;  3D45 A;  2WC9 A;  3AO4 A;  1YI2 N;  1KVC A;  3D2F B;  4LF8 K;  3DXK A;  1QQC A;  4CF9 A;  2KFN A;  3KK1 A;  3O3H A;  2HHW A;  4AQY K;  1VQ4 N;  3NH1 A;  2HST A;  3R9P A;  3D2F A;  3OHR A;  4DQS A;  5CE3 A;  5FRN A;  4DCH A;  3SUO A;  1NJI O;  3P1G A;  3L0Q A;  4PA1 A;  1BCM A;  4BRO A;  4B9T A;  2YI1 A;  3DAW A;  3PIO L;  1HNZ K;  2WON A;  5AQF A;  2ETJ A;  3DRR A;  2VCP A;  1KCF A;  3KKS A;  1KRP A;  2D5R A;  1DEJ A;  1WSH A;  1C0F A;  3AA3 A;  2VG6 A;  3IG1 A;  2PY5 A;  2E88 A;  2YJF A;  4FLX A;  3H1V X;  1TK5 A;  2HHQ A;  1VSI A;  3RRG A;  3AO1 A;  3CM6 A;  4NLC A;  1NGF A;  1DKG D;  1J5O A;  4OKE A;  4CJQ A;  4H4M A;  2HOE A;  2X6S A;  4KHY A;  5AQX A;  1YHQ N;  4XEI A;  1TL3 A;  4Z4C A;  4KHN A;  4LF6 K;  1NGB A;  4CF8 A;  4WYB A;  4CZF A;  4CEE A;  1Q8I A;  3HVT A;  2QWR A;  3HPH A;  3TAM A;  4CZH A;  5KGX A;  4AIL C;  4IO8 A;  2HHX A;  3FFK B;  3HST B;  2GUP A;  2Z1I A;  1BG3 A;  2XY7 A;  1NMN A;  2KFZ A;  2HVH A;  1DGK N;  3EZ5 A;  5AQJ A;  3MAQ A;  4R79 A;  4RW7 A;  2KHO A;  3AVG A;  1Q9Y A;  5F1X A;  1EP4 A;  3SQ0 A;  1BL3 A;  4B1W B;  4CE9 A;  1VSJ A;  5AQN A;  3ZSQ A;  3CCS N;  4B8A B;  3SPZ A;  4CJW A;  1U48 A;  4QS9 A;  2NRH A;  5GAG P;  5BRE A;  3H3N O;  2IVO A;  2ZF5 O;  3NH2 A;  4DFP A;  3EZW A;  5AQP A;  4E0D A;  5TKY A;  4HUF A;  4CER A;  4HTL A;  5I9E B;  3CHW A;  2PZS A;  1WSJ A;  3ATU A;  1XMO K;  4BGB A;  1S1U A;  2O8D B;  3BGR A;  4CFB A;  4OKK A;  3HJF A;  4BR2 A;  4GNI A;  3AGR A;  4DQI A;  3CCU N;  4KFB A;  3R6M A;  2OPQ A;  4Y0W A;  3AVN A;  4CVN E;  2O8D A;  1BQM A;  4OJR A;  4BRK A;  3VQQ A;  4A57 A;  1S22 A;  1GLC G;  3M8P A;  3HVR A;  3CC4 N;  1E4G T;  3KK7 A;  4FWO A;  4IOX A;  1Z25 A;  2YHB A;  4I9L A;  5LMU K;  1ZBS A;  4DFK A;  1BO5 O;  5SWM A;  4CHP A;  1WLJ A;  5KTQ A;  3H08 A;  4DR7 K;  1RT1 A;  4JI8 K;  3SAF A;  3NGI A;  1GLF O;  4JKC A;  4FPA A;  4CEC A;  3L2R A;  4I6M B;  3L2Q A;  5KQD A;  1JLG A;  4CJF A;  1NJZ A;  1XHZ A;  4FJ7 A;  4ID1 A;  1NOZ A;  1DT9 A;  4FYD A;  4I6M A;  2F7T A;  2YHY A;  3MEE A;  4GVM A;  1FKO A;  3CJB A;  4FCY A;  4JD2 B;  3VN5 A;  2O4G A;  2YNI A;  2HHV A;  1S9G A;  3VQ9 A;  1QVG M;  4CHZ A;  1W7A A;  3O08 A;  4YOY A;  4DU4 A;  1P90 A;  3VA3 A;  1OH8 A;  4JD2 A;  4CJU A;  4B9N A;  3QIP A;  5KQ8 A;  3MCA B;  2P51 A;  3QIN A;  3K9J A;  3NH0 A;  4PKI A;  3KHY A;  4EP4 A;  4AHC A;  3VGK A;  4CJR A;  1BDG A;  4OPK A;  4E7L A;  3AA2 A;  4FK2 A;  1HYV A;  1D5A A;  4JHD B;  4KTQ A;  1V4T A;  5J2M A;  3F2K A;  1C1A A;  3K5L A;  2VWJ A;  5AQM A;  3UKU B;  4KB1 A;  3CCE N;  1SKS A;  3MN5 A;  4LY7 A;  5CY4 A;  4JK8 A;  3HRG A;  4H4O A;  2E20 A;  3NMU A;  4JHD A;  3ZSO A;  2P9K B;  4BRC A;  2Z1H A;  3WEE B;  4KHP K;  1QQO A;  3PUF A;  4MLE A;  3UKU A;  4FJL A;  2OPP A;  4Z4F A;  2A6A A;  3OYD A;  3PO5 A;  3LL3 A;  4JK7 A;  2NRR A;  2P9K A;  3WEE A;  4E7H A;  1EET A;  4IDK A;  1Q18 A;  4LF9 K;  4DSL A;  4DQ8 A;  4M42 A;  1U4B A;  3OW2 M;  3ATV A;  3AAR A;  1YJ9 N;  3LZI A;  3LWL A;  3MEG A;  4JKD A;  3LPU A;  4FO0 A;  3T7Z A;  4KHU A;  4MO4 A;  3RRH A;  1VQL N;  1T6D A;  3ZCM A;  5JLF A;  3VQB A;  3MCP A;  3ZET B;  3VEY A;  2P5G A;  3FZL A;  2KZZ A;  1IKV A;  3LDN A;  4CES A;  4YHH K;  3DLB A;  3G10 A;  5CYM A;  3ZET A;  3LWM A;  2YX6 A;  4CGF A;  3OYE A;  4BRG A;  2RPI A;  3MXI A;  5LJV A;  5HL7 L;  1BA0 A;  2UUA K;  3KD1 E;  2NUB A;  4CIF A;  4CGI A;  4LSL A;  5DMR A;  4MFB A;  3J7Z O;  4O0J A;  2J4R A;  1KFS A;  3ASM A;  1WUA A;  1YF5 L;  1Q86 O;  1NKB A;  4FSV A;  1TYQ B;  3OBY A;  3ZX3 A;  3H1Q A;  3NGY A;  4ILH A;  3AVM A;  3UIQ A;  3OS1 A;  1YVU A;  3V4I A;  5LJW A;  1TYQ A;  1VQO N;  3SJH A;  1NKC A;  4N41 A;  3THY B;  3WXJ A;  3QEW A;  3MN6 A;  3NBP A;  4RW6 A;  3CFO A;  3AAQ A;  3M6G A;  3OYN A;  5BRF A;  2AA4 A;  2QW9 A;  4MDB A;  3ZEU B;  4CFC A;  3THY A;  5M1P A;  1A5V A;  1JJ2 M;  5FLX O;  1BIZ A;  2EX3 A;  4FZX C;  5BN9 A;  3SQ4 A;  2QWN A;  5HP1 A;  4FWP A;  1NK7 A;  4B3M K;  3ALY A;  3ZEU A;  2RHK A;  4B08 A;  4CGH A;  4DTR A;  1D8Y A;  1KAX A;  4H0Y B;  1N36 K;  3AVK A;  5GIP A;  1NJW A;  3RWU A;  5C25 A;  1ATN A;  4BRH A;  1OVY A;  3QB0 A;  2YKM A;  1UAX A;  1N34 K;  2IVP A;  3V1O A;  1RBR A;  3ZSZ A;  4HUG A;  5KPR A;  2PYJ A;  1MDU B;  1K8K B;  1HNV A;  1L3V A;  4FJG A;  1HKG A;  5TKW A;  3OYC A;  1W2B M;  3ID8 A;  4FZY A;  3LAN A;  4U7B A;  2D1K A;  1K8K A;  3D0P A;  1I3A A;  5IWA K;  4KKO A;  1VQM N;  2BTF A;  4O8K A;  4IJA A;  4F4K A;  1NM1 A;  3SBG A;  4QAG A;  3NF6 A;  3VQ7 A;  4LF7 K;  1O13 A;  3F9K A;  1YJW N;  4Z4E A;  4KI4 A;  3SLC A;  3OS0 A;  4U67 L;  3QML A;  2UUC K;  3CIP A;  1S6P A;  5ADX H;  2QA4 N;  1T3V A;  3OYJ A;  3LP0 A;  1X9J A;  5H1S Q;  1IKY A;  5T7B A;  2F8T A;  3E9P A;  3T1H K;  4M45 A;  1SL0 A;  4AHU A;  3SZ2 A;  1NG9 A;  2Q0R A;  4A5B A;  4B8C A;  1T05 A;  2JWK A;  3OVN A;  4XH1 A;  5C10 A;  4JKA A;  2FLO A;  5M1F A;  1GOC A;  3J81 O;  1OKJ A;  1WOQ A;  1X3N A;  4H5W A;  2GTD A;  4K8X A;  3V6D A;  5KI6 A;  4NCG A;  3A2F A;  3ZX0 A;  3KKR A;  4PWD A;  5I3U A;  3H6E A;  1R59 O;  1GLB G;  3BDP A;  3HM8 A;  5KRS A;  1RT6 A;  4FWK A;  3VET A;  4TSX A;  1C0T A;  3CD6 N;  4A61 A;  5GAH P;  2AP1 A;  2BE2 A;  4H5R A;  4MQ3 A;  3ZSR A;  4FL9 A;  2FXU A;  2WUS A;  2KW4 A;  3QNN A;  2CH6 A;  3HBT A;  5HRP A;  4YDU C;  3K9K A;  2VQE K;  2CGJ A;  4DV6 K;  1WBD A;  4M41 A;  1VSL A;  3DM2 A;  1TKX A;  1FJG K;  1LWE A;  2Q2R A;  2VGN A;  4NB4 A;  1CZ9 A;  1UWB A;  3G6E N;  3ZT1 A;  1QSS A;  2O8C B;  2XO7 A;  5M1Q A;  3JYT A;  3A5N C;  4FWS A;  4CF1 A;  3WNE A;  1H1V A;  3OBW A;  3NAE A;  1BHL A;  4KRF A;  5E26 A;  2D0O A;  3DLE A;  1QE1 A;  4DSI A;  2O8C A;  2KQ2 A;  1VK0 A;  1G15 A;  1S1X A;  4CFD A;  1GOB A;  2Q31 A;  4CGJ A;  4C1N K;  3CJ9 A;  4BGA A;  1A5X A;  3NE6 A;  1OH6 A;  1L3T A;  3G25 A;  3WQT A;  1VSM A;  3ZT2 A;  4FJ9 A;  3AAP A;  1E3M A;  3DLK A;  3LM2 A;  1NKE A;  2W42 A;  1NJY A;  3SBT A;  3AVC A;  4ICL A;  1J9A A;  4A2A A;  4BRE A;  4O55 A;  3HYF A;  1Q81 O;  3O1W A;  1TKT A;  3QNO A;  4M3X A;  3FZK A;  2KKZ A;  1YVN A;  4W5N A;  3ENH A;  4B9L A;  2EWS A;  3CCR N;  4NCB A;  3VF6 A;  4CD1 A;  2G8F A;  2B6A A;  2FC0 A;  3CI5 A;  1LV5 A;  4LSN A;  3K57 A;  3F73 A;  2Z1G A;  3DRP A;  5BR8 K;  4GW6 A;  2BAN A;  1YTA A;  2ZJR L;  3FLC O;  1D9D A;  4F3T A;  3OA9 A;  4Y1C A;  4F8R A;  1HNW K;  2G8V A;  5FDL A;  2NRX A;  4FVM A;  1WSG A;  4BE0 A;  3MK6 A;  1HR0 K;  3K5M A;  3AVI A;  3KLE A;  1KC8 O;  4Z0U A;  3AVH A;  2JGU A;  1IKX A;  1M1K O;  3O9Q A;  2HHS A;  2B5J A;  1TAU A;  4NXM K;  4KH4 A;  5F0X A;  3C6H A;  3I33 A;  2XHB A;  3TAE A;  4Z94 A;  4B9V A;  4DV0 K;  1X9W A;  3RMA A;  1XHX A;  3IDH A;  4FLW A;  4DSJ A;  4CZK A;  5J2Q A;  4DB3 A;  4BE1 A;  4I2P A;  3R1X A;  1ZBF A;  1BIU A;  2GBZ A;  4N56 A;  3SAH A;  5CZ1 A;  4BG8 A;  2GWJ A;  5BN8 A;  4FJK A;  2LSN A;  5D3G A;  3JAM O;  4PKG A;  2IIR A;  3TAQ A;  1BGX T;  3WQU A;  1S9E A;  5AQQ A;  1TAQ A;  3CYM A;  4I9Q A;  4IKF A;  3NVK A;  4CGG A;  1ESV A;  4FJH A;  5HRR A;  1F21 A;  3WT0 A;  5FRO A;  3HPG A;  4X65 K;  1N5Y A;  3U6F A;  3O3G A;  3SQ1 A;  5C2F A;  3SUN A;  4E19 A;  1Z6R A;  3CJ7 A;  2OAN A;  3TTD A;  1HJO A;  2P9P B;  5C12 A;  3PIP L;  1NK9 A;  2HF4 A;  2V7Z A;  3OYK A;  2NRW A;  2QK9 A;  4KBO A;  4IOC L;  1WSE A;  2VWB A;  2P9P A;  3CXC M;  4CZM A;  1NK5 A;  2Q1N A;  3S3N A;  4A59 A;  2QI2 A;  4C8M A;  3C65 A;  4H0T B;  4R5P A;  2ZE2 A;  3QBX A;  1EO1 A;  1EX4 A;  2CGK A;  3L4I A;  2ZGY A;  4KV8 A;  3C6A A;  3J8A A;  3SYZ A;  4FLY A;  1OVQ A;  4CHO A;  3AVL A;  5C24 A;  3CC2 N;  3ZT0 A;  4JRQ A;  3VEX A;  1R0A A;  4JV5 K;  1KXP A;  4ISE A;  1DTQ A;  1B9F A;  4BC2 A;  1S1W A;  2DFF A;  4Z4H A;  3E9O A;  1IBM K;  1TKD A;  4F9O A;  3C7N B;  3QET A;  3ZX2 A;  1DTT A;  3WXK A;  4BRL A;  3WXL A;  1TUY A;  4DSF A;  4JI5 K;  2WFB A;  4OGE A;  2GEL A;  1U6Z A;  5JMV A;  3TU5 A;  3QFU A;  3C7N A;  4AHV A;  5AQR A;  4FJX A;  4K41 A;  4J2B A;  4YOV A;  2E6L A;  1RNH A;  3VTH A;  3PY8 A;  4A2B A;  3G4S N;  2V51 B;  4JKG B;  1T8E A;  1SL1 A;  3THW B;  4OKJ A;  3L4Q A;  4LH4 A;  1NNE A;  1RTI A;  4JKG A;  3AA4 A;  4C8N A;  3K59 A;  3HPO A;  2O4I A;  3THW A;  4BRM A;  3HP9 A;  1VQ6 N;  3U8X A;  1O1W A;  4M3Y A;  1TK8 A;  3CPE A;  3DYA A;  2A5X A;  1XQS C;  1RBS A;  4CJT A;  4JI3 K;  3VGM A;  3TPQ A;  4JAX A;  3SUP A;  2UXD K;  4H0V B;  1RIL A;  2X74 A;  3FZM A;  2OA8 A;  5M1O A;  1BOT O;  4M3R A;  1S6Q A;  2W6L A;  3L2W A;  4B3T K;  2FBY A;  2Q3S A;  4OPH A;  3VEO A;  4EAH D;  4DTO A;  4JN4 A;  1QHA A;  4DFJ A;  3I8B A;  2VG7 A;  3HTV A;  3LDO A;  3V9S A;  4B1Y B;  3L6Q A;  3AO5 A;  3P39 A;  1KQS M;  2Q36 A;  1VSF A;  2UUB K;  4BRI A;  2FF3 B;  4YNQ A;  3RSE B;  3O6W A;  2YHA A;  1G99 A;  1JL1 A;  1HLU A;  4W5T A;  3H3O B;  3TAR A;  1BWF O;  4CHQ A;  1RDC A;  3QBW A;  3RSE A;  3UE5 A;  2NNW A;  3HP6 A;  4OLB A;  4DTS A;  3LP1 A;  4O4G A;  5J2N A;  1YUW A;  3OYM A;  1JKH A;  5AJ3 K;  4CEZ A;  4V19 S;  4KRE A;  3P83 D;  4AHR A;  3PSF A;  3NHG A;  3TI0 A;  5BR9 A;  3G71 N;  4E3S A;  1X9S A;  2X6N A;  3V9X A;  1YIT N;  3L8B A;  5M1K A;  2D4W A;  5JIC A;  4W5O A;  4IFY A;  4DS5 A;  1NWK A;  4I7F A;  1QSY A;  2DY4 A;  1IBL K;  3N4P A;  4EFH A;  4X62 K;  2E5L K;  1JLF A;  4OPJ A;  3T19 A;  1KLM A;  4BC5 A;  3HK2 A;  3LP2 A;  3EEQ A;  2ZJP L;  3VER A;  4DV1 K;  2BGG A;  5CZ2 A;  2IOC A;  1YJN N;  2I5J A;  3I0S A;  3KJV A;  3TWH A;  4RWT A;  2I7P A;  4FPB A;  5DM7 L;  1FKP A;  1LWC A;  4K25 A;  3CF5 L;  4ZTJ A;  4O0I A;  4Q0B A;  2ZGZ A;  1EQY A;  3AGK A;  1IO2 A;  1U49 A;  3U3G A;  1VSH A;  4AH9 A;  3OJS A;  4GV6 A;  1JCE A;  3A8Y A;  4JI2 K;  3VTI A;  4GMJ B;  4B1Z A;  4WQ5 C;  5GIN A;  3V81 A;  1TK0 A;  2RN2 A;  4CJ4 A;  5BRD A;  5J1E A;  3VES A;  1EWQ A;  4YFU A;  4CF0 A;  3OYF A;  1JLC A;  3MEC A;  1RBU A;  2FBT A;  2E1Y A;  1ASU A;  5C42 A;  4GV9 A;  5AQY A;  2VQF K;  4BRQ A;  4O44 A;  4FM1 A;  3HSC A;  3O1B A;  3FZH A;  4KHQ A;  3A5L C;  2A1R A;  4CZE A;  2FSJ A;  3N4Q A;  2DTU A;  4NCA A;  1JLE A;  2VG5 A;  2KZM A;  3SQ2 A;  3F5T A;  1X1P A;  1VHX A;  5SZT A;  4DQR A;  1CXU A;  5AQZ A;  1RTD A;  4FW2 A;  4FLV A;  3CCL N;  5BPL A;  4EZ9 A;  2ASP A;  4FJN A;  2D0A A;  1VQ7 N;  5AQK A;  3VPZ A;  1T6C A;  4DKW A;  1LAW A;  3MMV A;  3LP3 A;  3DLR A;  3NCI A;  3P5J A;  1ILY A;  4IXC A;  4E7I A;  4XIU A;  1T44 A;  5J2P A;  2DFE A;  2F8S A;  2ITM A;  2A3Z A;  4N5S A;  3QEP A;  1NGH A;  4ILJ A;  3DJC A;  3L2V A;  4YOR A;  1HNX K;  3DXM B;  4ELV A;  2KLA A;  4BRN A;  3KWI A;  3DWL A;  2HBJ A;  1KVB A;  4LFC K;  3SI6 A;  2UXB K;  2E2P A;  4BR0 A;  2P1J A;  3KWG A;  4PHT X;  2YHW A;  3LM9 A;  4BVP A;  4JRP A;  4JS4 A;  5C0Y A;  3DXM A;  2UU9 K;  5AZJ B;  1W0H A;  3OTO K;  4C23 A;  2HNY A;  1JXE A;  1I39 A;  2YJE A;  4H5N A;  2OPS A;  2I7N A;  4YOX A;  3IUC A;  3L2U A;  4HCB A;  4DU1 A;  1NGI A;  1HKC A;  4EHU A;  1JLQ A;  1NGA A;  2X78 A;  3CPW M;  1D4X A;  4DF4 A;  5AZJ A;  3TAB A;  4DLG A;  3DI6 A;  3SNN A;  2Y1I A;  3KD5 E;  1YT3 A;  5AQH A;  1K8A O;  4CJL A;  4DSK A;  5MLC Q;  1QQM A;  4IBN A;  4BR7 A;  2QWP A;  1U47 A;  4LF4 K;  2XY8 A;  3OJU A;  2OTJ N;  3IAY A;  1NBW A;  3MWT A;  4CI6 A;  2ZM6 K;  4JI7 K;  4EHT A;  3ITH A;  3GDQ A;  4CK3 A;  2P9S B;  3P31 A;  3GG4 A;  4IG0 A;  4ZTF A;  1UA1 A;  1QSL A;  3ULE B;  4CJS A;  1HX1 A;  4CEB A;  3K0S A;  4OLA A;  3PV8 A;  2QWL A;  2W6K A;  4BDY A;  3C95 A;  4B9Q A;  2F4V K;  1IBK K;  3NVM A;  4YOW A;  3LDL A;  4FWR A;  3RVC A;  2P9S A;  3T3F A;  1ZC6 A;  3BEX A;  4GV3 A;  4HWI A;  3ULE A;  3CER A;  2P5O A;  3EO3 A;  1RT2 A;  2V52 B;  1NJX A;  1HKB A;  4BR4 A;  1P8Z A;  3IKM A;  2P9N B;  4AHT A;  3C0B A;  2OCE A;  3KIO A;  4MDA A;  3IMX A;  3KLH A;  4G1Q A;  1YTU A;  1VRT A;  2JLE A;  3R3L A;  1KD1 O;  3MED A;  2P9N A;  2YHX A;  3HOT A;  4E1J A;  4WQ4 C;  3LDP A;  3NFA A;  4C8K A;  3CET A;  1HYZ A;  4JKE A;  1XNQ K;  4I2Q A;  5LY3 A;  3VQC A;  3AVF A;  4DR3 K;  4HUE A;  3I8D A;  4HHT A;  1XC3 A;  4IZ9 A;  1XWL A;  4H0O A;  1SKR A;  3JS6 A;  1KVA A;  1S1T A;  4BRA A;  4E89 A;  2VYP A;  1C0G A;  4CW7 B;  4IEE A;  4FJM A;  1E4F T;  5GIO A;  3VA0 A;  4WFB L;  3CMA N;  4NYN A;  4CZI A;  4E1M A;  3NF8 A;  3HO1 A;  4EZ6 A;  4FWQ A;  1L5U A;  5FPM A;  4GVE A;  4QCL A;  4JEP A;  4LF5 K;  4KPY A;  2QKK A;  4DWI A;  1WN7 A;  1K6Y A;  1JCF A;  3LAM A;  1A5W A;  1KAZ A;  3SMS A;  1KTQ A;  4Q5V A;  1N33 K;  1YXQ A;  3AVJ A;  4WFN L;  4CZJ A;  1ITG A;  1SAZ A;  3PX4 A;  2Z1J A;  4DLE A;  3O4W A;  1V4S A;  4DU3 A;  5AQI A;  4CED A;  3M1F A;  1Y64 A;  3H45 C;  1HMV A;  3O5B A;  5FPN A;  4CBX A;  3QER A;  3IRX A;  2E2N A;  3O8M A;  4IJN A;  3S41 A;  3ZSW A;  1XMQ K;  2PYL A;  3ISN C;  4X64 K;  3CJC A;  3EKU A;  4FOI A;  4JKF A;  4UQG A;  3OYG A;  4M7Y A;  1JXB A;  4CJ3 A;  3Q7C A;  1C0U A;  4H0P A;  3O3F A;  4DR6 K;  1GOA A;  1Q9X A;  4GKK K;  4JI6 K;  5JVG L;  4WFA L;  3CG7 A;  3VQ6 A;  5EU7 A;  5DK5 A;  3CFP A;  4FM0 A;  5LMN K;  2Q97 A;  3EN9 A;  4YDU A;  1J54 A;  3BF3 A;  4FWL A;  3MN9 A;  1LW0 A;  4JK9 A;  4LC9 B;  2BUP A;  3WNF A;  1U04 A;  2HHH K;  3HL8 A;  4BRF A;  5FPE A;  4WF9 L;  3CCJ N;  5AFU A;  4QS7 A;  1C1B A;  4DSE A;  4JKB A;  4CEO A;  4JI0 K;  1J5E K;  3VQA A;  1XI1 A;  2CGL A;  4XH4 A;  4F3O A;  1J53 A;  2ASM A;  3AVB A;  2W40 A;  5CHI A;  3TSQ A;  1W9H A;  4DR1 K;  1NGE A;  3PO4 A;  3GBT A;  5LL6 Z;  2A42 A;  4KB0 A;  1ZXO A;  3QLH A;  4CF2 A;  1QVF M;  1JL2 A;  3A5M C;  4Z4I A;  3KTQ A;  4C1N I;  2W41 A;  2BH1 A;  3WNH A;  2DFH A;  3SUQ A;  2IC3 A;  2NRT A;  3PSI A;  3MDQ A;  4BWM A;  4DUY K;  1GLL O;  3RTV A;  1Q7Y O;  3OYB A;  4DTM A;  1TV6 A;  5FPD A;  3DMJ A;  2QXL A;  2G8U A;  4DG1 A;  4HVJ A;  3SCX A;  3H46 O;  4W5Q A;  1RDU A;  2IDO A;  5JVH L;  1NGJ A;  3D6R A;  1L3U A;  1HQE A;  4O8U A;  3BUZ B;  4CEA A;  1OH7 A;  1NK8 A;  1EWR A;  1ZBH A;  2E6M A;  3ZT4 A;  1IG9 A;  1X3M A;  4EP5 A;  2OYQ A;  2HBL A;  4K0K K;  4AHS A;  2QM1 A;  1M90 O;  1MWK A;  2GEM A;  3HI0 A;  2G8H A;  1LOT B;  4IOA L; 
#chains in the Genus database with same CATH homology
 2JWL A;  5LJV A;  5HL7 L;  1BA0 A;  3FZM A;  3CQX A;  5M1O A;  1BOT O;  2PFU A;  1BU6 O;  2GX9 A;  1JCG A;  2P9I B;  4MLH A;  3KVG A;  3J7Z O;  2F9W A;  4OPH A;  3VEO A;  4BR5 A;  4EAH D;  2J4R A;  1S72 N;  4JN4 A;  3GE1 A;  3ENO A;  3CCQ N;  3W0L A;  1QHA A;  1WUA A;  1YF5 L;  3I8B A;  1Q86 O;  4H0X B;  3HTV A;  3LDO A;  3BF1 A;  4FSV A;  1TYQ B;  5AQG A;  3L6Q A;  3MWP A;  3OBY A;  3ZX3 A;  4B1Y B;  3H1Q A;  4ILH A;  3P39 A;  2P9I A;  1KQS M;  2Q36 A;  4BRI A;  2FF3 B;  3SK3 A;  3VMF B;  3RSE B;  3O6W A;  3E9L A;  2E1Z A;  1G99 A;  4WCE L;  2YCH A;  1HLU A;  5LJW A;  4YOU A;  1TYQ A;  1VQO N;  5EX5 A;  3SJH A;  3H3O B;  3VF4 A;  1BWF O;  3WXJ A;  2HBK A;  1ATS A;  3AY9 A;  3MN6 A;  4DHY A;  3FR0 A;  1NLV A;  3QBW A;  3RSE A;  2NNW A;  3UE5 A;  3AAQ A;  3M6G A;  1NGG A;  3EKS A;  5BRF A;  2AA4 A;  2QW9 A;  4MDB A;  1YUW A;  3ZEU B;  1RDW X;  5AQW A;  4B1U B;  5M1P A;  3A5O C;  4M7X A;  3Q7B A;  1JJ2 M;  4CBU A;  3VF2 A;  1VQP N;  2FF6 A;  3E1Y A;  5BN9 A;  4RCH A;  2QWN A;  4FWP A;  5AQL A;  5BR9 A;  4FWM A;  3G71 N;  3CC7 N;  1YAG A;  3ZEU A;  2RHK A;  3EE9 A;  5AFU H;  4FWN A;  4IFE A;  3U4L A;  1KAX A;  4H0Y B;  1YIT N;  5EXW A;  5M1K A;  1KAY A;  2D4W A;  3ENB A;  5AQS A;  3TTC A;  3VGL A;  5JIC A;  5GIP A;  1NWK A;  3QIC A;  4BY9 C;  4IDH A;  1ATN A;  3N4P A;  4EFH A;  4BRH A;  1OVY A;  3QB0 A;  2CH5 A;  5GAE P;  4UY8 O;  2NRZ A;  3D7E O;  4BC5 A;  2E2Q A;  4BQL A;  1IG8 A;  2ZJP L;  3O9R A;  3VER A;  2IVP A;  3TSP A;  3WUH A;  4BR9 A;  3CQY A;  3M5R A;  1YJN N;  4O5F A;  3BP8 A;  5KPR A;  3CJ1 A;  1MDU B;  1K8K B;  4RWT A;  2QWQ A;  4K42 A;  2I7P A;  4FPB A;  1HKG A;  5DM7 L;  2NLX A;  4ISG A;  5TKW A;  3CF5 L;  4K25 A;  1S3X A;  1W2B M;  3ID8 A;  4A62 A;  3FGU A;  3O9U A;  2ZGZ A;  4B1V A;  1EQY A;  2D1K A;  3AGK A;  4U7B A;  5CR4 A;  3W3D A;  4BRP A;  1BUP A;  3FZF A;  3R8E A;  1K8K A;  1NMD A;  4GV6 A;  1JCE A;  3A8Y A;  3EL2 A;  1VQM N;  2BTF A;  4O8K A;  2QWO A;  4IJA A;  3A0I X;  3IFR A;  3VTI A;  1NM1 A;  3SBG A;  4B1Z A;  4WQ5 C;  3U9D A;  5GIN A;  3M3Z A;  5BPN A;  5EY4 A;  5AQU A;  1O13 A;  5AZI B;  1YJW N;  2IVN A;  3FE1 A;  1K73 O;  2HF3 A;  5BRD A;  3E66 A;  3VES A;  3SLC A;  4U67 L;  2WBN A;  1QZ5 A;  5AQO A;  3CCV N;  3MN7 A;  3QML A;  5AR0 A;  2ASO A;  3CIP A;  5ADX H;  2QA4 N;  2E1Y A;  1T3V A;  5AZI A;  3KZB A;  3O9S A;  3VEZ A;  4GV9 A;  1X9J A;  2NZT A;  5AQY A;  5H1S Q;  4BRQ A;  3ZYY X;  2D0P A;  1RFQ A;  3E9P A;  3HSC A;  3O1B A;  3FZH A;  4M63 C;  3A5L C;  4YOT A;  5KPT A;  4CZE A;  2FSJ A;  2E2O A;  3N4Q A;  2Q0R A;  4A5B A;  4IWV A;  1SZ2 A;  4KH5 A;  4BC4 A;  3F5T A;  2JWK A;  5C10 A;  3CJA A;  4XH1 A;  4JKA A;  2FLO A;  5M1F A;  1OKJ A;  1WOQ A;  2FSN A;  1X3N A;  1VQN N;  4H5W A;  1VAZ A;  3DXK B;  2GTD A;  5AQZ A;  3GL1 A;  1NGD A;  2P9U B;  5JLH A;  3CCL N;  2F9T A;  5BPL A;  2ASP A;  1VQ7 N;  2VGM A;  5AQK A;  3VPZ A;  3ZX0 A;  1T6C A;  2PBD A;  4DKW A;  1YI2 N;  2WC9 A;  3H6E A;  3D2F B;  3MMV A;  1VQK N;  1R59 O;  3DXK A;  1GLB G;  3MX5 A;  3HM8 A;  2P9U A;  2A41 A;  1ILY A;  4IXC A;  4FWK A;  3VET A;  1VQ4 N;  1T44 A;  3CD6 N;  2ITM A;  2A3Z A;  3EE8 A;  4A61 A;  5GAH P;  2AP1 A;  2HST A;  1NGH A;  4H5R A;  3DJC A;  4ILJ A;  4YOR A;  3DXM B;  2KLA A;  4FL9 A;  3D2F A;  2FXU A;  2WUS A;  3DWL A;  3KWI A;  3R9P A;  4BRN A;  2HBJ A;  2E2P A;  3OHR A;  4JKH A;  2CH6 A;  3HBT A;  3VOV A;  4YDU C;  4BR0 A;  5CE3 A;  3KWG A;  4PHT X;  2YHW A;  3K9K A;  3LM9 A;  4BVP A;  4DCH A;  1NJI O;  5C0Y A;  3L0Q A;  3WXM B;  3DXM A;  4G9Z A;  5AZJ B;  4BRO A;  4PL7 A;  4CZL A;  3HZ6 A;  2CGJ A;  2YI1 A;  3DAW A;  4C23 A;  3PIO L;  1SQK A;  5AQF A;  2YJE A;  4H5N A;  4YOX A;  2I7N A;  3IUC A;  3QDK A;  1NGI A;  2VCP A;  5EOY A;  1HKC A;  2FSK A;  4EHU A;  1VQ9 N;  1NGA A;  3CPW M;  1D4X A;  5AZJ A;  1DEJ A;  2Q2R A;  2VGN A;  4NB4 A;  3TTF A;  1C0F A;  3G6E N;  5AQH A;  5M1Q A;  2E88 A;  2YJF A;  3T69 A;  3P4I A;  3DLL L;  3A5N C;  4FWS A;  3H1V X;  5AQV A;  1K8A O;  1H1V A;  2HBM A;  3OBW A;  1NGC A;  4AM7 A;  3O9T A;  5E26 A;  2D0O A;  5MLC Q;  3O80 A;  1QQM A;  4NLC A;  4BR7 A;  2QWP A;  1NGF A;  1DKG D;  5HOO A;  2OTJ N;  2Q31 A;  1NBW A;  3B8A X;  2HOE A;  3CJ9 A;  3MWT A;  4BGA A;  4C1N K;  1Q82 O;  4K43 A;  5AQX A;  4CI6 A;  1YHQ N;  4XEI A;  3U9Z A;  4EHT A;  3GDQ A;  1NGB A;  3G25 A;  4NLB A;  3WQT A;  2P9S B;  3P31 A;  3GG4 A;  3AAP A;  4WYB A;  4CZF A;  3LM2 A;  3ULE B;  1HX1 A;  3I56 N;  2QWL A;  3SBT A;  1VQ5 N;  4B9Q A;  3NVM A;  4YOW A;  3LDL A;  2QWR A;  4A2A A;  4CZH A;  4BRE A;  4JNE A;  2DPN A;  3O1W A;  4FWR A;  1Q81 O;  4IO8 A;  4OPA A;  3RVC A;  2P9S A;  3FFK B;  1ZC6 A;  3FZK A;  2KKZ A;  1LCU A;  1YVN A;  3BEX A;  4HWI A;  2ZJQ L;  4GV3 A;  3ENH A;  1QQN A;  3ULE A;  2GUP A;  2EWS A;  3CER A;  3CCR N;  1BG3 A;  3VF6 A;  3EO3 A;  4CD1 A;  2V52 B;  1DGK N;  1HKB A;  3CI5 A;  4BR4 A;  2PAV A;  1P8Z A;  3IKM A;  5AQJ A;  4R79 A;  2KHO A;  1QZ6 A;  2P9N B;  2ZWH A;  3C0B A;  5F1X A;  4MDA A;  1YIJ N;  3IMX A;  2ZJR L;  3FLC O;  4B1W B;  1MA9 B;  3OA9 A;  4GY2 B;  1U2V B;  5AQN A;  2NRX A;  1Z05 A;  3ID6 A;  3R3L A;  1KD1 O;  2P9N A;  2YHX A;  3VEV A;  3CCS N;  1MWM A;  3HOT A;  5E84 A;  4E1J A;  3MK6 A;  3LDP A;  4WQ4 C;  2UYT A;  1KC8 O;  3CET A;  4JKE A;  4QS9 A;  5LY3 A;  1M1K O;  3O9Q A;  1U2V A;  4CZG A;  2NRH A;  5GAG P;  5BRE A;  3H3N O;  2IVO A;  2ZF5 O;  4KH4 A;  3EZW A;  5AQP A;  5C2D A;  5F0X A;  3C6H A;  1XC3 A;  4IZ9 A;  5TKY A;  4H0O A;  4HTL A;  5I9E B;  3I33 A;  3TSU A;  3JS6 A;  4Z94 A;  3CHW A;  4IO9 L;  3ATU A;  4BC3 A;  4BRA A;  4BGB A;  2VYP A;  1C0G A;  3F9M A;  4J8F A;  4IEE A;  4WQ5 A;  4BR2 A;  1E4F T;  4GNI A;  3AGR A;  3IDH A;  3CCU N;  1IJJ A;  5GIO A;  4KH6 A;  4CZK A;  4WFB L;  3CMA N;  3R6M A;  4NO7 A;  4DB3 A;  4CJ7 A;  4CZI A;  4Y0W A;  4ISF A;  3HOS A;  3R1X A;  5B8H A;  4FWQ A;  4BRK A;  5FPM A;  4A57 A;  1S22 A;  4GVE A;  1GLC G;  4JEP A;  3SAH A;  3CC4 N;  3SAG A;  4BG8 A;  2GWJ A;  5BN8 A;  1BA1 A;  1JCF A;  4PKG A;  2IIR A;  4B1X B;  1KAZ A;  3SMS A;  1E4G T;  3KK7 A;  4FWO A;  1YXQ A;  2NRV A;  4IOX A;  5AQQ A;  3WQU A;  4CZJ A;  1SAZ A;  4WFN L;  3CCM N;  1ZBS A;  5AQT A;  3NVK A;  1BO5 O;  3O4W A;  1ESV A;  1V4S A;  5AQI A;  4BQZ A;  1GLE G;  2Q0U A;  1Y64 A;  3H45 C;  3M1F A;  4H5T A;  4ILG B;  3O5B A;  5FPN A;  4CBX A;  3WT0 A;  1W97 L;  2E2N A;  3O8M A;  4IEI A;  4IJN A;  3S41 A;  5M1N A;  3SAF A;  2V7Y A;  1GLF O;  4JKC A;  4AF1 A;  5C2F A;  4FVU A;  3CJC A;  3EKU A;  4FOI A;  4FPA A;  2H3G X;  4JKF A;  3SMP A;  4I6M B;  4PL8 A;  4BG9 A;  3QFP A;  4M7Y A;  4QS8 A;  5KQD A;  4XH5 A;  1Z6R A;  3CJ7 A;  2OAN A;  3TTD A;  1HJO A;  2P9P B;  2QTD A;  3Q7C A;  5C12 A;  1J6Z A;  4H0P A;  3PIP L;  2HF4 A;  3JXU A;  2V7Z A;  1DT9 A;  2HMP A;  4PKH A;  4I6M A;  5BPM A;  2F7T A;  2YHY A;  3LDQ A;  2NRW A;  5JVG L;  4KBO A;  4WFA L;  3CJB A;  4IOC L;  2VWB A;  4JD2 B;  3VEN A;  2P9P A;  4MO5 A;  3CXC M;  4CZM A;  1QVG M;  3WXI A;  2Q97 A;  3EN9 A;  2Q1N A;  3BF3 A;  3O08 A;  4FWL A;  4YDU A;  3VEW A;  4A59 A;  3MN9 A;  4YOY A;  4JK9 A;  1P90 A;  2QI2 A;  4LC9 B;  3I55 N;  5KPZ A;  4JD2 A;  2BUP A;  3C65 A;  4H0T B;  1RGI A;  4BRF A;  5FPE A;  3QBX A;  4BRD A;  2GWK A;  3MCA B;  5AFU A;  5KQ8 A;  4WF9 L;  3CCJ N;  2CGK A;  3L4I A;  4QS7 A;  1EO1 A;  3K9J A;  3MX2 A;  1SS6 A;  4PKI A;  3CME N;  2ZGY A;  3KHY A;  1CZA N;  3C6A A;  3J8A A;  4JKB A;  3VGK A;  1BDG A;  3GOI A;  3CC2 N;  4A5A A;  3VEX A;  4JHD B;  2CGL A;  1V4T A;  4XH4 A;  3F2K A;  2QEX N;  1KXP A;  1TUU A;  4ISE A;  2ASM A;  5AQM A;  3UKU B;  4BC2 A;  3CCE N;  3MN5 A;  3E9O A;  2A40 A;  5CHI A;  2W40 A;  4JK8 A;  1GLJ O;  3TSQ A;  4F9O A;  3C7N B;  3HRG A;  4FOE A;  3ZX2 A;  2E20 A;  3NMU A;  4JHD A;  3WXK A;  1HUX A;  2P9K B;  2QWM A;  3WXL A;  4BRC A;  3UB5 A;  1NGE A;  1TUY A;  3UKR B;  4BRL A;  5GAD P;  3GBT A;  4BVO A;  2A42 A;  2WFB A;  3WEE B;  5C15 A;  1ZXO A;  1QQO A;  3UKU A;  2GEL A;  4MLE A;  1N8R O;  5F2R A;  1QVF M;  1U6Z A;  5JMV A;  3A5M C;  2A6A A;  3TU5 A;  4CBW A;  4C1N I;  2RE2 A;  5BRH A;  2W41 A;  3QFU A;  3C7N A;  3LL3 A;  4JK7 A;  5AQR A;  2NRR A;  2BH1 A;  2P9K A;  1GLD G;  3UKR A;  4K41 A;  4YOV A;  3WEE A;  2NRT A;  3VTH A;  1HPM A;  5EVZ A;  1Q18 A;  4A2B A;  3G4S N;  2V51 B;  4JKG B;  4DQ8 A;  3MDQ A;  1GLL O;  4H03 B;  3OW2 M;  1Q7Y O;  3D2E B;  3ATV A;  4EIA A;  3AAR A;  1YJ9 N;  4CD3 A;  3L4Q A;  4AM6 A;  5FPD A;  4JKD A;  4FO0 A;  2QXL A;  3T7Z A;  4JKG A;  3H46 O;  4MO4 A;  5ADX A;  1VQL N;  1T6D A;  4L3Q A;  1RDU A;  3D2E A;  4BRM A;  5JLF A;  2P9L B;  3MCP A;  3U8X A;  5JVH L;  1VQ6 N;  1ATR A;  3ZET B;  5ELZ A;  1NGJ A;  3PLA A;  3D6R A;  3CPE A;  3VEY A;  3P38 A;  4H5V A;  2OTL N;  3FZL A;  4O8U A;  2A5X A;  3BUZ B;  4OO1 J;  1XUP O;  1VQ8 N;  1GLA G;  3LDN A;  1XQS C;  4RTF D;  1K9M O;  1X3M A;  3VGM A;  2P9L A;  2HBL A;  2E8A A;  3TPQ A;  5DM6 L;  3ZET A;  2QM1 A;  1M90 O;  2YX6 A;  4JAX A;  4WQ4 A;  1MWK A;  4H0V B;  4BRG A;  2GEM A;  3HI0 A;  1LOT B;  4IOA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...