3DJCA

Crystal structure of pantothenate kinase from legionella pneumophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
b'LILCIDVGNSHIYGGVFDGDEIKLRFRHTSKVSTSDELGIFLKSVLRENNCSPETIRKIAICSVVPQVDYSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQNIIVIDFGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTAKLPSVEIIKTESVVGRSTIESIQSGVYYGVLGACKELIQRIHHEAFNGDQILILATGGFASLFDKQGLYDHLVPDLVLQGIRLAAMMNT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Pantothenate Kinase from Legionella Pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Transferase
total genus 75
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA01
3VEZA 2NRHA 3H3NO 2IVNA 3CQXA 4BC2A 2P9PA 3ZX3A 4CZKA 5AQIA 1Z6RA 5F2RA 4DCHA 4BRFA 4XH1A 5TKYA 3TU5A 4BR2A 5BN9A 2GEMA 3EKUA 4A2AA 3MN5A 4XH4A 1JCGA 3GL1A 2P9KA 3CHWA 1DKGD 3MN7A 3SJHA 4CBWA 2GUPA 3O1WA 2F9WA 2ZGYA 3GOIA 2V51B 3WXIA 5FPMA 4CZJA 4H0OA 3F9MA 1MWMA 1GLFO 4EIAA 2NZTA 3VETA 4BR7A 5I9EB 3LM2A 5BPNA 2V52B 1NGHA 3A5LC 5KQ8A 1K8KA 4B1ZA 2HF3A 1IJJA 4K25A 1QQNA 2F9TA 4FWMA 1NGDA 5AQYA 3L6QA 4HWIA 3FZKA 4FWOA 3JXUA 1SAZA 3ZETA 1ZC6A 4A2BA 4RCHA 3FZLA 4M7XA 2A6AA 1ZBSA 5AQPA 2VYPA 2QM1A 1TUYA 2DPNA 1HUXA 3DWLA 3L0QA 4FWKA 3FLCO 3DXKA 5BN8A 3MCPA 3FFKB 4CBXA 4GY2B 2GTDA 4H03B 5AQWA 3D2FB 3R9PA 5AQGA 1T6CA 4IJNA 4PKGA 4JN4A 1NBWA 3LL3A 2UYTA 1X3MA 5AZJB 2YI1A 4FWRA 5KPTA 5AQUA 3HZ6A 2ZGZA 5BR9A 2E2NA 2OANA 2QW9A 2E2PA 4A61A 4CZIA 1NGIA 5F0XA 2A42A 2E2QA 5KPRA 3CJCA 3VEWA 4B9QA 5AQSA 3M1FA 5AR0A 4FWLA 4CZFA 4LC9B 4YDUA 3QB0A 5B8HA 3BF1A 2Q1NA 3CJ7A 2Q97A 2FSKA 2E88A 1QZ6A 3GBTA 4FWSA 2CGKA 3C0BA 3L4IA 3EL2A 3H45C 3VPZA 2P9KB 4IJAA 4MLEA 1ATRA 4BVOA 4BRLA 3ZEUB 3EO3A 1HPMA 2YCHA 1J6ZA 4H0TB 1T44A 2Q2RA 4K43A 4BRCA 3UE5A 2E8AA 3MN6A 5FPNA 4BVPA 1XQSC 1X3NA 2ASOA 2CH5A 3IMXA 1XC3A 4H5RA 4Z94A 3VF4A 4B1VA 3IUCA 1C0FA 4KBOA 4C23A 4Y0WA 3IDHA 4CZLA 1U2VA 3R8EA 3ZETB 5JLFA 2P9UB 3DXMA 4O5FA 4YDUC 5EVZA 1P8ZA 1TUUA 3O6WA 3SLCA 1T6DA 3CI5A 2ZF5O 3FR0A 3O1BA 3UKRB 5AQLA 1YVNA 3ENHA 3CJBA 4IZ9A 1V4SA 3A8YA 4JAXA 4O8KA 3KHYA 3TPQA 5BPMA 5F1XA 2Q0UA 4BROA 2P9IA 3D2EA 3C7NA 3CERA 3KVGA 3MMVA 5ADXH 4RWTA 1U6ZA 3FGUA 1QQOA 2ASPA 1RFQA 3D7EO 3CETA 2P9LB 5LJWA 3WEEA 4FWPA 4WQ4A 4ISFA 4JNEA 1SQKA 4FOEA 4BRIA 3VGLA 5LJVA 5LY3A 4JD2B 3LM9A 1DEJA 1YXQA 5AQQA 1D4XA 3QBXA 1GLCG 4CZEA 1KAZA 4BRGA 4H0XB 1Y64A 3S41A 4GNIA 3UKUA 1E4FT 1Q18A 1JCFA 3BUZB 5AQNA 3FE1A 5ADXA 1IG8A 4BRAA 1GLBG 4DHYA 3QBWA 1NLVA 2VCPA 2FSJA 3FZHA 3ATVA 3QDKA 4BG8A 1NGEA 4QS9A 3LDLA 5E26A 1TYQA 4AM6A 2YJFA 4H5VA 2QXLA 3CJ9A 3WT0A 1X9JA 3AAQA 5AQHA 1BDGA 3LDNA 3W0LA 1S3XA 4IO8A 3U4LA 5BRFA 2HMPA 3HTVA 1BOTO 1BA0A 3MN9A 4QS7A 4B1WB 1GLJO 2IIRA 3AY9A 4WQ4C 5ELZA 2QWOA 3B8AX 1RGIA 2YHXA 4H5TA 4HTLA 4CI6A 2P9NB 1U2VB 3JS6A 4QS8A 3CQYA 2FF3B 3DXMB 3FZMA 3QMLA 3SK3A 1CZAN 1LOTB 4CJ7A 5BRDA 1DGKN 2CGJA 5AQJA 2P9PB 4AM7A 1G99A 2D0PA 1GLEG 2P9SA 3ID8A 2A41A 4ISGA 4WYBA 1QHAA 3I33A 1WUAA 1NMDA 4BRNA 5AQZA 3WQTA 3CJAA 4CD3A 1QQMA 2WUSA 4FOIA 4I6MA 1NM1A 2QWPA 4H0YB 5BRHA 2P9IB 4BC5A 3VESA 2V7YA 4F9OA 5JICA 3C7NB 4FPBA 3P4IA 5E84A 3VF2A 4PKHA 3GDQA 5JLHA 5KPZA 4BR5A 1GLLO 3OHRA 1BG3A 1KAXA 4XEIA 2PBDA 3H6EA 2I7PA 2V7ZA 3VEXA 1K8KB 1E4GT 2A5XA 3QFUA 4E1JA 4H5WA 1SZ2A 4PKIA 4B1YB 1Z05A 3ZX2A 4JHDA 3J8AA 3HM8A 2FLOA 4BQZA 3D2FA 2E2OA 3BEXA 4PL8A 5EXWA 3G25A 2BUPA 3HSCA 3MK6A 3CJ1A 3HBTA 4FSVA 2IVPA 1ESVA 3BF3A 3EN9A 4EFHA 5AQFA 4BG9A 2J4RA 3W3DA 3H3OB 3DXKB 4XH5A 1NGBA 2VWBA 3I8BA 5AQOA 3U9ZA 2QWNA 2A3ZA 3EZWA 3FZFA 2FXUA 2GWJA 2YJEA 4K41A 4A62A 3MDQA 2CH6A 3VGMA 4BGBA 4H0PA 4BGAA 2YHYA 3ULEA 2FSNA 4CZGA 1NGGA 3ATUA 2ZWHA 3HI0A 1YAGA 3LDPA 3QFPA 4BRPA 1BA1A 2Q31A 2YHWA 2QWRA 2Q36A 5CE3A 2HF4A 3EKSA 3RSEA 3A5OC 1ATNA 1ATSA 3A5NC 3H1QA 2BTFA 4BR0A 5FPEA 1KAYA 1GLAG 2H3GX 3AARA 4CD1A 4DQ8A 5AQKA 1LCUA 3H1VX 4FWNA 3U8XA 1ZXOA 3VF6A 1V4TA 3ZEUA 5AZIA 3CIPA 3VOVA 1MA9B 2P9SB 4FO0A 4CZHA 4M63C 4NB4A 5BPLA 4WQ5A 5JMVA 2ITMA 3VGKA 1BO5O 2I7NA 5AFUH 4B1UB 4BR4A 4PL7A 4RTFD 1YUWA 2AA4A 4ISEA 4I6MB 1HKCA 1HJOA 4MLHA 4M7YA 3M3ZA 3VENA 1BUPA 2P9UA 5AQTA 4B1XB 1S22A 2D1KA 3O4WA 2QWLA 3GG4A 1HX1A 1HKGA 3ENOA 1HKBA 3WUHA 1BU6O 5AFUA 4MO5A 1RDWX 4J8FA 3UKRA 1GLDG 4BC3A 2E1YA 2QWQA 4JHDB 3WXJA 4EAHD 4FPAA 4BRQA 4CBUA 3BP8A 3UB5A 2E20A 2IVOA 2A40A 3VERA 1C0GA 4H0VB 3LDQA 5AQVA 4CZMA 2E1ZA 4L3QA 5EOYA 2GELA 3IFRA 4H5NA 2GWKA 5AQRA 4WQ5C 3WQUA 1NGFA 2P9LA 2D0OA 5FPDA 1BWFO 3VEVA 2HOEA 2EWSA 3QICA 2QWMA 4MO4A 2Q0RA 2D4WA 3WXLA 2AP1A 4JD2A 1HLUA 1NGCA 2PAVA 3A0IX 1H1VA 2FF6A 3A5MC 3VEOA 3D2EB 4BQLA 4K42A 3R6MA 3SMSA 3ULEB 4FL9A 4FWQA 2CGLA 3WEEB 4DB3A 2W40A 4IXCA 3O80A 2NLXA 5KQDA 3RSEB 3ZX0A 4BREA 1OKJA 3GE1A 3O08A 1NWKA 3KZBA 1KXPA 2W41A 4BRDA 4BR9A 1NGJA 3UKUB 3DAWA 3M6GA 1MDUB 3DJCA 5AZIB 1WOQA 5AQMA 3H46O 4EHUA 1JCEA 1QZ5A 3SMPA 1R59O 4EHTA 5EY4A 4BC4A 4BRHA 3VEYA 5AZJA 4IWVA 1TYQB 1MWKA 5BREA 5EX5A 3LDOA 3O5BA 3U9DA 3AAPA 1NGAA 3WXKA 1XUPO 2KHOA 2ASMA 5AQXA 4BRKA 2P9NA 3O8MA 4BRMA 1EQYA 4NO7A
chains in the Genus database with same CATH superfamily
5HRRA 3CQXA 4MDAA 2HHXA 2BANA 4AHCA 2OZSA 1KCFA 3H08A 5AQIA 4CHOA 1Z6RA 1J5OA 4DCHA 2KLAA 4JYAK 4XH1A 1IKVA 1BL3A 4A2AA 3ZSOA 3GL1A 4I9LA 2QKKA 1DKGD 3SJHA 4CBWA 1TGOA 5HRNA 1YIJN 4F3TA 3V81A 1TL3A 1JJ2M 2XY7A 3HVRA 3DLGA 3WXIA 1BIZA 4DSKA 3T19A 5I9EB 1Q7YO 1A5WA 3VETA 2FBYA 3C6UA 4KHYA 1NGHA 3D0PA 1Q9YA 4K25A 1QQNA 3L6QA 3OYHA 2WOMA 4WE1A 3DLHA 4FWOA 3JXUA 5J2QA 4Z0UA 1N33K 4AQYK 3ZETA 3ZSWA 4RCHA 5FROA 4M7XA 3SBTA 4UY8O 2HBJA 4B08A 1NJZA 4KRFA 3O9QA 1ZBSA 5AQPA 3DM2A 4DTMA 1TUYA 4IDKA 1O13A 4CEZA 2DPNA 1HUXA 1BCOA 4OPAA 2HW3A 3HOSA 3FFKB 3L2UA 2JGUA 4M3UA 1HYVA 4O0IA 3CC7N 4DR4K 1NBWA 2D0BA 2UYTA 3BZCA 1FXXA 4JK8A 5AZJB 4AHVA 2YI1A 4FW1A 4N47A 3LP2A 3CXCM 4KKOA 4CHZA 3O3GA 1NJXA 4KH4A 4CZIA 5F0XA 4N5SA 1J53A 2EX3A 3KWGA 3LAKA 3I8DA 3SZ2A 5HP1A 1QQCA 2RE2A 3FFIA 1ASWA 1DT9A 1CZBA 1SKRA 1WAJA 4J2EA 1SKSA 3EL2A 4CJQA 4OPHA 1HPZA 2KZMA 2A1SA 1LW0A 3MEEA 3EO3A 1SL1A 4K43A 1ZBFA 3NF7A 2X78A 4BVPA 1S1WA 4DUZK 2D0CA 3VF4A 4DTJA 1C0FA 4Y0WA 4CECA 2LSNA 4H8KA 5JLFA 3CM5A 3DXMA 3HRGA 1WLJA 3KK1A 3ZSZA 4KTQA 3O4NA 1SL2A 1WSIA 3O6WA 1T6DA 4DQRA 2ZF5O 3IKMA 3O1BA 3HK2A 4JS4A 1XMOK 2EHGA 4KV8A 1HMVA 3VQ9A 1DTQA 3ENHA 3MXJA 3KWIA 3QNNA 1N8RO 4JAXA 3O9TA 4CGFA 2OPQA 5F1XA 4LF7K 3HJFA 3C7NA 3TAGA 4V19S 4F2SA 3KVGA 5ADXH 3ZT4A 4RWTA 1U6ZA 3TWHA 2YNIA 1RFQA 4A5BA 1OH8A 3D7EO 4AILC 3ENBA 2G8VA 4WQ4A 3ZT2A 3S3NA 2GV9A 4FJLA 4O8UA 1N6QA 2PZSA 3K0SA 2F4VK 4CZEA 1D4XA 3QBXA 1GLCG 4JKAA 3THWB 1FKPA 3S41A 3VQ5A 4G9ZA 5FRNA 3FE1A 1IG8A 4BRAA 3QBWA 1Z26A 2GX9A 4M3WA 4QS9A 3LDLA 1F21A 1TYQA 2YJFA 4CJ3A 4H5VA 2QXLA 3M8RA 4DKWA 1X9JA 3PSFA 3V9ZA 3DOLA 3K5OA 4IO8A 3V9UA 3T3FA 4FLUA 3NAEA 1B9DA 4RW7A 3QETA 2NRWA 2QWOA 2E6MA 4DMNA 3CG7A 1RGIA 3HL8A 4JI1K 1NNEA 2OZMA 4HTLA 1U2VB 3TR8A 1K8AO 3HO1A 4B3RK 3FZMA 4CJKA 1CZAN 1LOTB 1QVGM 4YHHK 2CGJA 1VSDA 4KH6A 5AQJA 2XY8A 4Z4GA 3ZSYA 3F5TA 4Z4CA 1HNIA 1I3AA 4BE1A 3OS1A 3F73A 4RW8A 4BRNA 1VQ9N 1NK5A 2HNYA 4CW7B 2WUSA 5BRHA 1QE1A 3ZCMA 4E1MA 1Q81O 2OCEA 3GDQA 3SAGA 3S3OA 1GLLO 1CXQA 3OYNA 4DSLA 1VHXA 4XEIA 3TSUA 2PBDA 2I7PA 2V7ZA 4I2QA 5LMNK 1WB9A 3SPYA 1E4GT 4CFCA 4KHUA 4JRPA 1SZ2A 4PKIA 4CIEA 3AVNA 1RTHA 3J8AA 4U7BA 3KK3A 3TSPA 4B8CA 3NFAA 2E2OA 3BEXA 4FZYA 4KI6A 3G25A 1W97L 2XHBA 1RDUA 5DK5A 1NKBA 4Q5VA 1VSFA 3CQ8A 3J7YP 4DF8A 2IVPA 4EFHA 3QIPA 3VQ7A 1NGBA 3I8BA 1RBTA 5AQOA 1EX4A 3WXMB 3EZWA 2BDPA 3ZSXA 2HHHK 3NHGA 2CH6A 1D9FA 4I9QA 1EXQA 4ILJA 4BGAA 3ULEA 1S6PA 3ATUA 2ZWHA 1YAGA 3LDPA 1BA1A 2Q31A 5C24A 3EKSA 3AVFA 4DTRA 3CCUN 1ATSA 1C1BA 1ZBHA 3KLFA 1EWQA 3H1QA 1KAYA 1B9FA 4DS5A 4M3XA 4FJJA 5HBMA 5FDLA 4LY7A 3HPHA 4LH5A 3VF6A 1RDDA 4K8ZA 3ZEUA 1RBVA 1MA9B 3T1AA 3P39A 3KIOA 4FO0A 2HHWA 4OKJA 4HCCA 3QNOA 1VQ7N 2ITMA 4DU4A 3MXMA 5AFUH 2DFFA 4RTFD 3S9HA 2YKNA 3KK7A 1U49A 2IDOA 3IS9A 3F2KA 3M3ZA 1BUPA 5AQTA 4GKKK 3OYFA 1S22A 2O4GA 3AO2A 2QA4N 2QWLA 3MEGA 1HX1A 3KTQA 1KLNA 4CK3A 4KTZA 1QSLA 2W42A 1RTDA 4BE0A 5BR8K 3WXJA 4R79A 4FJXA 3BY5A 3BP8A 3UB5A 1HNXK 2A40A 3VERA 4H0VB 3LDQA 5DM6L 2E1ZA 5EOYA 3CCSN 3QEXA 2IC3A 3IFRA 4H5NA 2GWKA 3I56N 4DTXA 3OYKA 1BWFO 3VEVA 2HOEA 3K59A 2ZQBA 2Q0RA 2AP1A 3P5JA 5CYQA 2XY6A 5M1OA 1FKOA 3A5MC 4AH9A 3TAPA 2GUIA 4K42A 3KLHA 3CM6A 4GMJB 1RT4A 3VQ4A 3OBWA 4CJPA 3O9UA 2UUAK 5M1QA 2WBNA 3LZIA 4HHTA 3O80A 2OA8A 4PWDA 2HMIA 4PQUA 1S9GA 3U3GA 3KLIA 3KZBA 1NK9A 5CZ1A 3N4QA 1SUQA 3AA4A 4ZTFA 3SMPA 4EHTA 3VEYA 3LALA 5AZJA 1K73O 1K6YA 1MWKA 1TYQB 5BREA 4DV7K 5C42A 4CJSA 1VRTA 5AQXA 3TAMA 4JI5K 2YHAA 3O8MA 1EQYA 4NO7A 4DQQA 3KLEA 5HROA 3VEZA 1TV6A 3V9XA 3AO1A 4BC2A 3AA5X 1BGXT 1ZYQA 4RW4A 5CR4A 2QKBA 1VQON 4ZTJA 3TU5A 4BR2A 5BN9A 2HVIA 2GEMA 3OA9A 3EKUA 4PHTX 4PUOA 4LFBK 4OKEA 3O1WA 5IWAK 3L3UA 4EZ9A 3F9KA 3GOIA 4CK1A 4CZJA 1XMQK 3F9MA 1GLFO 4C8NA 4OKKA 4KREA 2ZE2A 4HUFA 2OPRA 5FRMA 3AVMA 5KQ8A 4CEDA 4FWMA 3MCAB 2FBTA 4E3SA 3FZKA 1EKEA 1SAZA 3T69A 5KGXA 2VGNA 2NRTA 1FJGK 2YKMA 1S1TA 2YV0X 1JLCA 3Q7BA 4FWKA 4DV6K 2I5JA 3DXKA 4B3SK 4NYNA 3K58A 4H03B 5AQWA 3B6PA 2O8DA 4J2BA 4JKBA 3R9PA 3CC2N 1T6CA 3MX2A 1N32K 4CEAA 4JN4A 1X3MA 4B9SA 3NMUA 3HZ6A 2ZGZA 4KAZA 5BR9A 1G15A 1LAWA 3HM9A 2E2PA 3C6HA 1NGIA 2A42A 4IDHA 3B6OA 1NU0A 3VTHA 5MLCQ 5C2FA 4DR7K 2HHVA 3AVLA 1QTMA 3OJSA 3CJ7A 2E88A 1C1AA 1QZ6A 4JLHA 3OYMA 3SBGA 1RT5A 4BWMA 1XC9A 3VPZA 4NYFA 4IJAA 2G8FA 4B3OA 3MAQA 3E66A 4BVOA 3RR8A 1N34K 4BRLA 3ZEUB 4M3ZA 2YCHA 2G8UA 3RWUA 4OPKA 3ALYA 1T44A 2Q2RA 4BRCA 4JI0K 2E8AA 3LP0A 4CJVA 3MN6A 5FPNA 1LWEA 2DFEA 1XQSC 5H1SQ 3ITHA 2CH5A 4B1VA 4KBOA 1B92A 3ZSVA 3IDHA 1U2VA 2X6NA 3R8EA 4LFAK 1ITGA 2JLEA 1XNQK 3OW2M 1TUUA 1U47A 2X6SA 3SLCA 5GAGP 3E9OA 3SCXA 1LV5A 4CGGA 5LMUK 4KFBA 2HHQA 3LANA 3LP1A 5AQLA 1RBSA 1YVNA 5HL7L 4E89A 4EP5A 2IOCA 1V4SA 3A8YA 3VA3A 1K9MO 3NVMA 4O8KA 1ZBIA 3KHYA 3TPQA 5BPMA 4JV5K 4BROA 4FJHA 3G0ZA 2Q3SA 3CCJN 3V6DA 4MDBA 1HR0K 4FOEA 1X9WA 4O0JA 1Q86O 3VGLA 4F2RA 1L3TA 3CCEN 4N76A 1YXQA 5AQQA 1BIUA 1FK9A 4N56A 3DLEA 4DFKA 4IBNA 3UKUA 1Q18A 3BUZB 5ADXA 4X64K 1NLVA 1Q82O 3FZHA 3L2WA 3ID6A 1XHXA 4AM6A 2QI2A 2ATQA 1KVBA 4AHTA 4FM2A 4OX9K 3R1XA 1BI4B 3ZT0A 4H4OA 2P51A 3RTVA 3EE8A 3TTDA 4CESA 3VQEA 3W0LA 3A2FA 2HNDA 5BRFA 3HTVA 4JKHA 4K0KK 4B1WB 4RG8A 3NF8A 1GLJO 1TAUA 2NUBA 3SUOA 2HBMA 3AA3A 2VG5A 5ELZA 3B8AX 1NJWA 1ILYA 3VQ8A 4DV3K 3NE6A 4B9UA 3OYIA 4X65K 1CXUA 3CQYA 3SK3A 2FF3B 3QMLA 4NLCA 4FJ7A 4B9MA 4FJNA 4CJ7A 3K9KA 4Z4HA 1DGKN 1JL1A 5C10A 4LSLA 2D0PA 3SV4A 1GLEG 4FJIA 2A41A 3C6AA 4JI4K 1WUAA 3OS0A 3TI0A 3OYJA 2ZD1A 4PY5A 4E7KA 2ITGA 4FK2A 4H0YB 2RN2A 2P9IB 2V7YA 4J2DA 5JICA 1WSJA 1RDAA 1YTAA 4PKHA 1JXEA 5KPZA 4GVMA 3ZYYX 1KAXA 3H6EA 3MEDA 1WBBA 4DSIA 4OJRA 5J1EA 5T7BA 1Z05A 3CCVN 5CHIA 1VQKN 3D45A 3CC4N 1S72N 3D2FA 4RW6A 4NCBA 4DV5K 5EXWA 1ASUA 4IOAL 2BUPA 3KKRA 2RF2A 4DWIA 2UXBK 4FSVA 3BF3A 3VQPA 4BG9A 3H3OB 3DXKB 4IG3A 3U9ZA 1KSPA 1RCHA 2QWNA 2XO7A 2ZM6K 2O8DB 3FZFA 4FJ8A 2FXUA 4K41A 4O4GA 4IFVA 4BGBA 4H0PA 2YHYA 3BGRA 4BDYA 4E7HA 3QFPA 3PX6A 4C8OA 1EO1A 1N36K 2Q36A 5CE3A 2HF4A 1WSEA 4Q0BA 3IRXA 3RRGA 3DRPA 3BDPA 3THVA 1YF5L 5DM7L 4DQ8A 4XIUA 1LCUA 3H1VX 1ZXOA 4DTPA 4Y1DA 4YFUA 3ULDA 3CIPA 3VOVA 1VQNN 3DLKA 1HYSA 4BDZA 4CZHA 2YNFA 4CIGA 4M63C 5JMVA 4YOWA 3VGKA 2Z1GA 3O4QA 5KRTA 2O8FB 1HRHA 5M1NA 2AA4A 3J81O 4DTNA 4I6MB 1HJOA 3HYFA 4O44A 4CHQA 2ZJRL 3EEQA 2D1KA 2VQFK 2IS3A 2R7YA 1HKGA 1GOAA 3ENOA 1BU6O 1NK6A 5AFUA 5GADP 3TTFA 4LF5K 2UXCK 2AJQA 3PSIA 3RVCA 3V9WA 4O5BA 3CFOA 4EAHD 2KFNA 3THYA 1KLMA 3CMEN 4GV3A 4YOUA 3EZ5A 5KI6A 4FVMA 4IEEA 3TAFA 1VQ4N 4AHRA 4CZMA 2NRZA 2P5OA 3NDKA 1U4BA 1VK0A 3CCLN 2D0OA 5FPDA 4DSEA 2EWSA 3QICA 1T7PA 3NGZA 2D4WA 4JD2A 1HLUA 1NGCA 1KFDA 1VSHA 2FF6A 3VEOA 4BQLA 3KD1E 3R6MA 3SMSA 1WSFA 2KZZA 1A5VA 2O8BB 4M45A 2CGLA 2VWJA 3HPGA 5KRSA 1CLQA 4DSJA 1S1XA 3RSEB 3RMCA 3DLBA 3P31A 3GE1A 4FJGA 2HB5A 4DLEA 4OO1J 2W41A 4BRDA 3J80O 1NGJA 4DR2K 4YOTA 3UKUB 5SWMA 1JKHA 5AZIB 1WOQA 3H46O 1OH7A 1QZ5A 1MU2A 4ILGB 2WONA 2PYLA 5EY4A 1RT1A 4CGIA 1S5JA 4J2AA 5EU7A 1NGAA 4IG0A 2KHOA 4YOVA 1TK0A 3VQDA 2W6KA 2F7TA 4HUEA 1D5AA 1VAZA 4DLGA 3KLGA 4B3TK 4M42A 3HXMA 4DR1K 1UAXA 1WNSA 1XNRK 2FBVA 2NRHA 1YVUA 1KVCA 4JI3K 2YNGA 4FVUA 5C0YA 4DTSA 2P9PA 1BISA 4QCLA 4CZKA 5F2RA 4BRFA 3CPWM 1BCMA 4MFBA 4KB0A 3MN5A 3MWTA 1QSSA 1W7AA 5M1PA 2DFHA 2GUPA 3I0SA 1RBUA 4KO0A 3C95A 1W9HA 3SQ1A 2V51B 5FPMA 4BR7A 1HNWK 4JK7A 3A5LC 4DR5K 3L8BA 1K8KA 2HF3A 2XY5A 4KI4A 1NGDA 3NF6A 4FM1A 3IG1A 2HBKA 2Y1JA 1WSHA 3AVHA 4JKFA 3K9JA 2A6AA 1FW6A 1NK0A 4HCBA 2VYPA 2QM1A 2UUBK 4E1NA 3KKSA 3DWLA 5CYMA 4FYDA 4A5AA 1C0MA 3FLCO 3SUPA 1NOZA 4CBXA 2GTDA 1U45A 3D2FB 3CCMN 2B5JA 2HNZA 2WTUA 4CIFA 1IBLK 4FWRA 3VQBA 5KPTA 4WFNL 3PX0A 2E2NA 2UXDK 1UOCA 2QW9A 4A61A 4OVLA 2QK9A 5KPRA 3CJCA 3VEWA 2P5GA 2X74A 3M1FA 3NGYA 4DSFA 4BY9C 4CZFA 4LC9B 1L3VA 4HUGA 3BF1A 1HQEA 1C0TA 3KJVA 4M3YA 3AO5A 4NCAA 3NBPA 1VSKA 2CGKA 3C0BA 4CF1A 3L4IA 4FW2A 3QEPA 4DTOA 2P9KB 3VN5A 2ZJPL 1BI4A 3LP3A 3S3MA 3AO4A 4JKGA 1HPMA 4IOXA 1YJ9N 3E1YA 3OYDA 4DS4A 3UE5A 1TVRA 1HNZK 4I2PA 3NH0A 3KK2A 1X3NA 2ASOA 4OLAA 3IMXA 4H5RA 1XC3A 4CCHA 4AHUA 4DFMA 2NRXA 4DQSA 3AVJA 4C23A 3NH1A 4CZLA 4OLBA 4FJ9A 4BWJA 3CMAN 1N5YA 1WBDA 2O8CA 2D0AA 3P1GA 4DF4A 4YDUC 4JI2K 5EVZA 1P8ZA 3L2RA 4DV2K 3ZSQA 3ISNC 3CI5A 4FJKA 1RILA 4OGEA 3AVAA 4DV4K 3CJBA 4IZ9A 4EZ6A 1TK8A 3THYB 1C6VA 2P9IA 3D2EA 3LAMA 4DR6K 4LF8K 3CERA 1BQNA 2ASPA 3CETA 4HTUA 5LJWA 4FWPA 3P38A 4ISFA 1JLAA 2KFZA 1SQKA 4BRIA 1WSGA 5LJVA 5LY3A 3SPZA 1I39A 3LM9A 1DEJA 1YT3A 4JD2B 2OYQA 5D3GA 4BRGA 4H0XB 1Y64A 4GNIA 3DOKA 1REVA 1SS6A 3QESA 3OTOK 3PY8A 2B4JA 1JL2A 1GLBG 1IKYA 4CERA 2FSJA 3VA0A 4M3TA 3QDKA 4BG8A 1NGEA 3HT3A 2Z1IA 4X62K 2OPSA 3CFPA 1IBMK 1D8YA 5K14A 3CJ9A 3WT0A 3BZKA 5AQHA 1BDGA 3LDNA 4Z4IA 4BACA 4Z4FA 2HMPA 4QS7A 3N4PA 1KD1O 4LD0A 2IIRA 1SV5A 4I7FA 4NXNK 3OYCA 3MWPA 1UA1A 4KHQA 4CI6A 4GV6A 3JS6A 3CCQN 1NKEA 3CFRA 2IAJA 3PIOL 5BRDA 3DI6A 5TKWA 2P9PB 5A2QO 1OH5A 4GV9A 4KHWA 4LH4A 4WYBA 4ISGA 1QHAA 3I33A 3QO9A 4CHYA 3JYTA 1QQMA 1EP4A 4FLXA 4UQGA 1LW2A 3RMDA 2O8FA 4I6MA 1NM1A 2QWPA 4CFBA 4NLBA 2DTUA 2ZJQL 4BC5A 5C12A 3ZT1A 3OYAA 3QEWA 4FPBA 3P4IA 5E84A 3VF2A 5JLHA 3PUFA 4BR5A 5C2DA 1VSLA 4CEEA 1BG3A 4YNQA 4CF8A 1K8KB 3VMFB 1RDBA 4H5WA 4B1YB 3SQ0A 1RT6A 5M1FA 3OY9A 2HHTA 3G6EN 4C8KA 3TAQA 1VSJA 4A59A 4FK4A 1YITN 3HSCA 4JKDA 3HBTA 4ELTA 1DLOA 4CFDA 3OVNA 4CGHA 2J4RA 3K5MA 3DRSA 2A3ZA 4QAGA 1JXBA 4LF9K 1JLFA 2KTQA 2YJEA 2GWJA 4A62A 4W5OA 3AGRA 3MDQA 4LF6K 2VGMA 1LWFA 4BDPA 4CZGA 1NOYA 3HI0A 3NCIA 4CE9A 4BRPA 3VQ6A 2O8BA 4TSXA 3L3VA 3VQAA 3K5NA 3RSEA 4K8XA 1ATNA 5DMRA 3A5NC 1VQMN 3O3HA 2Z1HA 4BR0A 3OYGA 1QHTA 5GIOA 4DG1A 2H3GX 3T7ZA 5AQKA 1VSIA 4FWNA 3U8XA 4HVJA 3K57A 4FLWA 1EETA 5AZIA 2F8TA 4CF9A 2E6LA 4N41A 3THXB 2P9SB 4FK0A 4DUYK 5BPLA 4CFAA 4WF9L 3AVGA 3QIOA 1IKWA 4PL7A 3HOTA 4ISEA 2F8SA 2ETJA 1NK8A 4MLHA 2FC0A 4ID1A 4M7YA 1Y97A 2RPIA 4JKGB 4C1NI 1T05A 2P9UA 3IAYA 3GG4A 1VQ8N 4F3OA 3TAEA 3C6TA 1D9DA 3AA2A 1SL0A 4MO5A 4DFPA 1RDWX 4LFCK 3CD6N 3UKRA 1GLDG 1VSEA 3VQQA 4JHDB 3M8SA 4OPJA 2O8CB 4FLVA 4FPAA 1NKCA 4CBUA 4CK2A 4DR3K 1L5UA 1RT2A 2GELA 3UIQA 3EE9A 1LWCA 4G1QA 3VTIA 4WQ5C 4NCGA 2P9LA 1S9EA 3SUNA 2QWMA 3WXLA 3C65A 3L2VA 1VQ6N 4DQIA 2PAVA 3AGKA 1RTJA 3D2EB 4JK9A 2W6LA 3DMJA 5JS2A 2PY5A 3SAFA 4IXCA 4CVNE 3ZX0A 4E7LA 4E7IA 1OKJA 3QERA 4B9VA 3O08A 1NWKA 1KFSA 3R3LA 4CJTA 4CF2A 4BR9A 4M3RA 3DAWA 3M6GA 1C1CA 3DJCA 5AQMA 3V4IA 4BRHA 1IV0A 4JI6K 4FLYA 5FLXO 3U9DA 3AAPA 1XUPO 5JVHL 1L3SA 2G8HA 4BRKA 2P9NA 2PYJA 3WNHA 4CJEA 4J8FA 1GOCA 4ZHRA 4NXMK 3OJUA 1VSMA 1YJNN 3H3NO 2G8WA 2OTLN 2IVNA 1JLGA 1RT7A 3SI6A 1KC8O 4OGCA 3ZX3A 3K2PA 1IBKK 1QVFM 5GINA 5TKYA 5J2NA 3AVCA 2NNWA 4RW9A 4XH4A 1EWRA 1JCGA 2P9KA 3CHWA 3MN7A 1TK5A 4WFBL 2WC9A 2F9WA 1Q8IA 2BH1A 1J54A 1W0HA 2ZGYA 3TABA 4CHPA 4H0OA 1MWMA 5LL6Z 2NZTA 4EIAA 4DFJA 3LM2A 5BPNA 2V52B 4QOZB 4FXDA 4WFAL 3P83D 4B1ZA 1RBRA 1IJJA 4B9TA 3CYMA 2F9TA 5GIPA 4PA1A 5AQYA 2Z1JA 4HWIA 4WCEL 1NMNA 4JKEA 4YORA 4FZXC 3SAHA 4R5PA 4JRQA 3DLLL 1ZBUA 1ZC6A 4A2BA 4CF0A 3FZLA 1NJIO 1S1UA 1M1KO 4CJWA 2O8EA 4FLTA 1KVAA 3L0QA 5M1KA 2KQ2A 2OTJN 1DTTA 5BN8A 3MCPA 1S6QA 4GY2B 5HRPA 1HQUA 3NVKA 2HVHA 1XWLA 5GAEP 5CZ2A 1TKXA 4DTUA 2VG6A 3G71N 3K5LA 4EP4A 5AQGA 3ZLJA 3AVKA 4IJNA 4PKGA 3LL3A 3ASMA 3OYLA 4FZZA 5AQUA 2OANA 3M5RA 2E2QA 3AO3A 4B9QA 5AQSA 5AR0A 5JS1A 4FWLA 3TARA 3V1OA 3SNNA 1L3UA 2QEXN 4YDUA 3QB0A 5B8HA 2Q1NA 4M41A 2Q97A 2FSKA 2F96A 4CGDA 2UUCK 1KTQA 2BE2A 3GBTA 4FWSA 1W2BM 1KRPA 3H45C 4YY3K 2HSTA 4MLEA 1ATRA 3M8PA 3LPTA 2XRIA 1JLEA 4CJLA 4CEFA 3SUQA 1IO2A 3RMBA 4F8RA 1UWBA 1J6ZA 4H0TB 1HNVA 3V9SA 3RRHA 1QS4A 3O3FA 1SKWA 3HP9A 1GOBA 2JWKA 4X66K 1E3MA 2NRVA 4Z94A 1YTUA 3V1QA 3IUCA 3ZSRA 4IFEA 4E0DA 3SV3A 2D5RA 3ZETB 4W5TA 2P9UB 4DU3A 1A5XA 3LZJA 4B3MK 4JI7K 4O5FA 3AV9A 2UU9K 3M8QA 4CJ5A 1VQPN 1J5EK 2QXFA 3FR0A 3PX4A 3UKRB 4CJ4A 2E5LK 4C8LA 3G4SN 4B9LA 2Q0UA 4A57A 4Z4EA 2B6AA 3V1RA 3MMVA 3FGUA 1QQOA 1U48A 4FJ5A 3G10A 2P9LB 2JWLA 3WEEA 1TAQA 2VWKA 4JNEA 5IT9O 4IFYA 2O4IA 3U3YA 3SYZA 4CEQA 1WN7A 2OPPA 1ZBLA 1KAZA 3MX5A 1OH6A 1E4FT 1JCFA 5AQNA 4W5RA 4DHYA 3C94A 1TKTA 2VCPA 4CJUA 3ATVA 5E26A 5JVGL 1YJWN 3RR7A 4FLZA 2KKZA 4CJRA 3AAQA 1BHLA 1IH7A 3WNEA 1T03A 1S3XA 4LF4K 5E41A 3U4LA 1OVYA 1BOTO 1BA0A 3MN9A 3L2QA 4KHNA 3LPUA 3OYEA 1J9AA 4W5NA 3AY9A 4WQ4C 3DYAA 1IKXA 5CY4A 2YHXA 4H5TA 4FCYA 2P9NB 4YOXA 1NK7A 3CPEA 3HPOA 4QS8A 4DU1A 5I3UA 3DXMB 3OS2A 4IEIA 3RMAA 1HJRA 3VQCA 2A1RA 4IOCL 1BQMA 4AM7A 1G99A 5HOOA 1M90O 3THXA 2P9SA 1OVQA 3ID8A 4C8MA 3SQ4A 4B9NA 1NMDA 3QEVA 5AQZA 3WQTA 3CJAA 4JKCA 4CD3A 3SQ2A 1X9MA 1RNHA 1CZ9A 4FOIA 2KW4A 3PIPL 4B8AB 1IG9A 1Q9XA 3DRRA 3VESA 4JI8K 4F9OA 3I0RA 3C7NB 1T8EA 1X9SA 3OHRA 3JSMA 4JS5A 1NK4A 3VEXA 2A5XA 3QFUA 2NRRA 4E1JA 2FBXA 4AHSA 4ELUA 3ZX2A 3TSQA 4JHDA 1VRUA 3HM8A 4CHNA 4GKJK 2FLOA 1S1VA 4BQZA 4PL8A 2GBZA 5C25A 5HRSA 3ZT3A 3OYBA 3CF5L 2E4LA 1LAVA 2O8EB 5KGWA 3MK6A 5J2PA 4YOYA 2DY4A 1RDCA 3CJ1A 3PLAA 4KB1A 1ESVA 3DLRA 3E9PA 3EN9A 5AQFA 3W3DA 4XH5A 4IO9L 2VWBA 2HHSA 5C15A 3HP6A 4LSNA 4ELVA 3QINA 5SZTA 2RKIA 1ASVA 1U04A 4AF1A 4BE2A 1YHQN 3VGMA 2G8KA 2VQEK 1T3VA 2YNHA 4CJFA 1JLBA 2FSNA 1TKZA 3LDSA 3WNGA 1NGGA 2VG7A 4H4MA 3MXIA 4DQPA 2YHWA 2QWRA 3T1YK 2IGIA 1VQ5N 2YX6A 3E01A 5I42A 3A5OC 3MECA 3QEIA 1C0UA 2BTFA 3SJJA 5FPEA 1GLAG 3AARA 4CD1A 4ILHA 3O9RA 3HSTB 3J7ZO 1V4TA 3HVTA 4FJMA 4F4KA 1VQLN 1WAFA 5AJ3K 4GW6A 3WNFA 5KTQA 4NB4A 2HHUA 4WQ5A 1BO5O 3I55N 2I7NA 4B1UB 5GAHP 2BGGA 4BR4A 1YUWA 3NH2A 2RHKA 1HKCA 4GVEA 3VENA 4CGJA 3LWLA 2HBLA 1KQSM 4B1XB 4DV1K 3O4WA 4CEOA 1I94K 3QLHA 1HKBA 3WUHA 3D6RA 1R0AA 1O1WA 1YI2N 4FM0A 4BC3A 2E1YA 2QWQA 1RT3A 3AVBA 4CEBA 4BRQA 3TTCA 4KH5A 1JLQA 2E20A 2IVOA 4DV0K 4E19A 5J2MA 1UA0A 3NF9A 1C0GA 3OBYA 4L3QA 1RTIA 4IKFA 3WQUA 5AQRA 2PFUA 1NGFA 1NJYA 4MQ3A 3T1HK 4KHSA 4L8RB 2P1JA 4ID5A 3PO4A 4MO4A 3TANA 3A0IX 1H1VA 1XHZA 3THWA 4C1NK 3ULEB 4FL9A 1QSYA 4Y1CA 2Y1IA 4FWQA 3Q7CA 3WEEB 4DB3A 2W40A 3PO5A 4KHPK 2NLXA 5KQDA 4BREA 3JAMO 4KTWA 3L4QA 1P90A 3E9LA 1HYZA 1TKDA 2QTDA 3EY1A 2YHBA 1KXPA 3CCRN 5HLFA 1Z25A 3KD5E 3J7AP 4W5QA 1MDUB 4EHUA 1JCEA 3EYZA 1R59O 1TL1A 3U6FA 4KPYA 1X1PA 4BC4A 3LWMA 4IWVA 4JEPA 2G8IA 3NGIA 5EX5A 3LDOA 3O5BA 3WXKA 4ICLA 4E7JA 2ASMA 3O9SA 3PV8A 4O55A 1NG9A 4U67L 3AVIA 2WFBA 4BRMA 5AQVA 1XI1A
chains in the Genus database with same CATH topology
3VEZA 2NRHA 4FVUA 1YJNN 3H3NO 5C0YA 2OTLN 2IVNA 3CQXA 4MDAA 4BC2A 2P9PA 1KC8O 3ZX3A 4CZKA 5CR4A 1QVFM 1VQON 5AQIA 1Z6RA 5F2RA 4DCHA 5GINA 4BRFA 2KLAA 4XH1A 5TKYA 3TU5A 4BR2A 5BN9A 3CPWM 2GEMA 3OA9A 3EKUA 4A2AA 3MN5A 4PHTX 2NNWA 4XH4A 1JCGA 3MWTA 3GL1A 2P9KA 3CHWA 1DKGD 3MN7A 5M1PA 3SJHA 4CBWA 2GUPA 1YIJN 4WFBL 3O1WA 2WC9A 2F9WA 2BH1A 2ZGYA 1JJ2M 3GOIA 2V51B 3WXIA 5FPMA 4CZJA 4H0OA 3F9MA 1MWMA 1Q7YO 1GLFO 4EIAA 2NZTA 3VETA 4BR7A 5I9EB 3LM2A 5BPNA 2V52B 1NGHA 4JK7A 3A5LC 4WFAL 5KQ8A 1K8KA 4B1ZA 2HF3A 1IJJA 4K25A 1QQNA 2F9TA 4FWMA 3MCAB 1NGDA 5GIPA 5AQYA 3L6QA 4HWIA 4WCEL 3FZKA 4JKEA 2HBKA 4FWOA 3JXUA 1SAZA 4YORA 3T69A 3SAHA 3ZETA 4JKFA 3K9JA 3DLLL 1ZC6A 2VGNA 4RCHA 4A2BA 2NRTA 3FZLA 4M7XA 3SBTA 2A6AA 4UY8O 2HBJA 1NJIO 1M1KO 3O9QA 1ZBSA 5AQPA 2VYPA 2QM1A 1TUYA 1O13A 2DPNA 1HUXA 3DWLA 3L0QA 3Q7BA 4FWKA 4OPAA 4A5AA 5M1KA 3FLCO 2OTJN 3DXKA 5BN8A 3MCPA 3FFKB 3HOSA 4CBXA 4GY2B 3NVKA 2GTDA 4H03B 5AQWA 5GAEP 3D2FB 3CCMN 3CC7N 3G71N 4JKBA 3R9PA 3CC2N 5AQGA 1T6CA 3MX2A 4IJNA 4PKGA 4JN4A 1NBWA 3LL3A 2UYTA 1X3MA 4JK8A 3CXCM 5AZJB 2YI1A 4FWRA 3NMUA 5KPTA 5AQUA 3HZ6A 2ZGZA 4WFNL 5BR9A 2E2NA 2OANA 2QW9A 2E2PA 3C6HA 4KH4A 3M5RA 4A61A 4CZIA 1NGIA 5F0XA 2A42A 2E2QA 5KPRA 3CJCA 3VEWA 3KWGA 4B9QA 4IDHA 5AQSA 3M1FA 5AR0A 3VTHA 5MLCQ 5C2FA 4FWLA 4BY9C 2QEXN 4CZFA 4LC9B 4YDUA 3QB0A 2RE2A 5B8HA 3BF1A 2Q1NA 3CJ7A 2Q97A 2FSKA 1DT9A 2E88A 1QZ6A 3GBTA 4FWSA 2CGKA 3SBGA 3C0BA 3L4IA 1W2BM 3EL2A 3H45C 3VPZA 2P9KB 2HSTA 4IJAA 4MLEA 2ZJPL 1ATRA 3E66A 4BVOA 4OPHA 4JKGA 4BRLA 3ZEUB 3EO3A 1HPMA 4IOXA 2YCHA 3E1YA 1YJ9N 1J6ZA 4H0TB 1T44A 2Q2RA 4K43A 4BRCA 3UE5A 2E8AA 3MN6A 5FPNA 4BVPA 2JWKA 1XQSC 1X3NA 2ASOA 5H1SQ 2NRVA 2CH5A 3IMXA 1XC3A 4H5RA 4Z94A 3VF4A 4B1VA 3IUCA 1C0FA 2NRXA 4KBOA 4IFEA 4C23A 4Y0WA 3IDHA 4CZLA 1U2VA 3R8EA 3CMAN 3ZETB 5JLFA 2P9UB 3DXMA 3HRGA 4O5FA 4YDUC 5EVZA 1P8ZA 3OW2M 1TUUA 3O6WA 1VQPN 3SLCA 1T6DA 5GAGP 3CI5A 3E9OA 2ZF5O 3FR0A 3IKMA 3O1BA 3UKRB 5AQLA 1YVNA 3ENHA 5HL7L 3CJBA 3KWIA 4IZ9A 1N8RO 1V4SA 3A8YA 4JAXA 1K9MO 3NVMA 3O9TA 4O8KA 3G4SN 3KHYA 3TPQA 5BPMA 5F1XA 2Q0UA 4BROA 2P9IA 3D2EA 3C7NA 4A57A 3CERA 3CCJN 3KVGA 3MMVA 5ADXH 4RWTA 1U6ZA 3FGUA 1QQOA 2ASPA 1RFQA 4A5BA 3D7EO 3CETA 4MDBA 2P9LB 2JWLA 5LJWA 3WEEA 4FWPA 3ENBA 4WQ4A 3P38A 4ISFA 4JNEA 1SQKA 4FOEA 1Q86O 4BRIA 3VGLA 5LJVA 4O8UA 5LY3A 4JD2B 3LM9A 1DEJA 3CCEN 1YXQA 5AQQA 1D4XA 3QBXA 1GLCG 4CZEA 1KAZA 4BRGA 4H0XB 4JKAA 1Y64A 3S41A 3MX5A 4GNIA 4G9ZA 1SS6A 3UKUA 1E4FT 1Q18A 1JCFA 3BUZB 5AQNA 3FE1A 5ADXA 1IG8A 4BRAA 1GLBG 4DHYA 3QBWA 1NLVA 2VCPA 2FSJA 3FZHA 1Q82O 3ATVA 2GX9A 3QDKA 4BG8A 1NGEA 3ID6A 3LDLA 4QS9A 5E26A 5JVGL 1TYQA 4AM6A 2YJFA 4H5VA 2QI2A 1YJWN 2QXLA 3CJ9A 3R1XA 3WT0A 4DKWA 1X9JA 2KKZA 3EE8A 3AAQA 3TTDA 5AQHA 1BDGA 3LDNA 3W0LA 1S3XA 4IO8A 3U4LA 5BRFA 2HMPA 3HTVA 4JKHA 1OVYA 1BOTO 1BA0A 3MN9A 4QS7A 4B1WB 1GLJO 3N4PA 1KD1O 2IIRA 2HBMA 3AY9A 2NRWA 4WQ4C 5ELZA 2QWOA 3B8AX 1RGIA 2YHXA 3MWPA 4H5TA 1ILYA 4HTLA 4CI6A 2P9NB 1U2VB 4GV6A 3JS6A 4YOXA 3CCQN 3CPEA 4QS8A 1K8AO 3CQYA 2FF3B 3DXMB 3FZMA 3QMLA 4NLCA 3SK3A 1CZAN 1LOTB 4IEIA 3K9KA 4CJ7A 5BRDA 3PIOL 1QVGM 1DGKN 5TKWA 2CGJA 4KH6A 4IOCL 5AQJA 5C10A 2P9PB 4GV9A 4AM7A 1G99A 5HOOA 3F5TA 2D0PA 1GLEG 1M90O 2P9SA 3ID8A 2A41A 4ISGA 4WYBA 1QHAA 3C6AA 3I33A 1WUAA 1NMDA 4BRNA 1VQ9N 5AQZA 3WQTA 3CJAA 4JKCA 4CD3A 1QQMA 2WUSA 4FOIA 4I6MA 3PIPL 1NM1A 2QWPA 4H0YB 4NLBA 5BRHA 2P9IB 2ZJQL 4BC5A 3VESA 5C12A 2V7YA 4F9OA 1Q81O 5JICA 3C7NB 4FPBA 3P4IA 5E84A 3VF2A 4PKHA 3GDQA 5JLHA 5KPZA 4BR5A 5C2DA 3ZYYX 3SAGA 1GLLO 3OHRA 1BG3A 1KAXA 4XEIA 3TSUA 2PBDA 3H6EA 2I7PA 2V7ZA 3VEXA 1K8KB 1E4GT 2A5XA 3QFUA 3VMFB 2NRRA 4E1JA 4H5WA 1SZ2A 4PKIA 4B1YB 1Z05A 3TSQA 3ZX2A 4JHDA 3CCVN 5CHIA 3J8AA 4U7BA 3HM8A 3TSPA 1VQKN 2FLOA 5M1FA 3CC4N 1S72N 4BQZA 3D2FA 2E2OA 3BEXA 4PL8A 5EXWA 3G25A 1W97L 3G6EN 1RDUA 4IOAL 2BUPA 4A59A 3CF5L 1YITN 3HSCA 3MK6A 4YOYA 4JKDA 3CJ1A 3HBTA 4FSVA 3PLAA 2IVPA 1ESVA 3BF3A 3E9PA 3EN9A 4EFHA 5AQFA 4BG9A 2J4RA 3W3DA 3H3OB 3DXKB 4XH5A 4IO9L 1NGBA 2VWBA 3I8BA 5AQOA 3U9ZA 3WXMB 2QWNA 2A3ZA 5C15A 3EZWA 3FZFA 2FXUA 2GWJA 2YJEA 4K41A 4A62A 3AGRA 3MDQA 4AF1A 2CH6A 1YHQN 2VGMA 3VGMA 4BGBA 4H0PA 4ILJA 1T3VA 4BGAA 2YHYA 3ULEA 2FSNA 4CZGA 1NGGA 3ATUA 2ZWHA 3HI0A 1YAGA 3LDPA 3QFPA 4BRPA 1EO1A 1BA1A 2Q31A 2YHWA 2QWRA 2Q36A 5CE3A 2HF4A 3EKSA 2YX6A 1VQ5N 3RSEA 3A5OC 1ATNA 5DM7L 3CCUN 1ATSA 3A5NC 1VQMN 3H1QA 1VQ7N 2BTFA 4BR0A 5GIOA 5FPEA 1KAYA 1GLAG 1YF5L 2H3GX 3AARA 3T7ZA 4CD1A 4ILHA 3O9RA 4DQ8A 5AQKA 1LCUA 3H1VX 4FWNA 3U8XA 1ZXOA 3VF6A 3J7ZO 1V4TA 3ZEUA 5AZIA 3CIPA 3VOVA 1VQNN 1MA9B 3P39A 2P9SB 1VQLN 4FO0A 4CZHA 4M63C 4NB4A 5BPLA 4WQ5A 5JMVA 2ITMA 4YOWA 3VGKA 1BO5O 3I55N 2I7NA 5AFUH 4B1UB 5GAHP 4WF9L 4BR4A 4PL7A 4RTFD 1YUWA 5M1NA 3HOTA 2AA4A 4ISEA 4I6MB 2RHKA 1HKCA 1HJOA 3KK7A 4MLHA 4M7YA 4GVEA 4JKGB 3F2KA 3M3ZA 4C1NI 3VENA 1BUPA 2HBLA 2ZJRL 2P9UA 5AQTA 1KQSM 4B1XB 1S22A 2D1KA 3O4WA 2QWLA 3GG4A 2QA4N 1VQ8N 1HX1A 1HKGA 3ENOA 1HKBA 3WUHA 1BU6O 3D6RA 5AFUA 4MO5A 5GADP 1RDWX 3TTFA 3CD6N 4J8FA 3UKRA 1YI2N 1GLDG 4BC3A 2E1YA 2QWQA 4JHDB 3RVCA 3WXJA 4EAHD 4R79A 3CMEN 4FPAA 4GV3A 4BRQA 4YOUA 3TTCA 4CBUA 4KH5A 3BP8A 4IEEA 3UB5A 1VQ4N 2E20A 2IVOA 2A40A 3VERA 1C0GA 4H0VB 3LDQA 5AQVA 5DM6L 4CZMA 3OBYA 2E1ZA 2NRZA 4L3QA 2GELA 5EOYA 3CCSN 3EE9A 3IFRA 4H5NA 2GWKA 5AQRA 4WQ5C 2PFUA 1NGFA 3VTIA 2P9LA 3WQUA 2D0OA 3CCLN 5FPDA 1BWFO 3VEVA 2HOEA 2EWSA 3QICA 2QWMA 4MO4A 2Q0RA 2D4WA 3C65A 3WXLA 2AP1A 1VQ6N 4JD2A 1HLUA 1NGCA 5M1OA 2PAVA 3A0IX 1H1VA 3AGKA 2FF6A 3A5MC 3VEOA 3D2EB 4JK9A 4BQLA 4C1NK 4K42A 3R6MA 3SMSA 3ULEB 4FL9A 4FWQA 3OBWA 3O9UA 3Q7CA 5M1QA 2CGLA 2WBNA 3WEEB 4DB3A 2W40A 3SAFA 4IXCA 3O80A 2NLXA 5KQDA 3RSEB 3ZX0A 4BREA 1OKJA 3L4QA 1P90A 3E9LA 3P31A 3GE1A 3O08A 1NWKA 2QTDA 3KZBA 3R3LA 4OO1J 1KXPA 2W41A 4BRDA 3CCRN 4BR9A 1NGJA 4YOTA 3DAWA 3M6GA 1MDUB 3UKUB 3DJCA 3N4QA 5AZIB 1WOQA 5AQMA 3H46O 4EHUA 1JCEA 1QZ5A 3SMPA 4ILGB 1R59O 4EHTA 5EY4A 4BC4A 4BRHA 3VEYA 5AZJA 4IWVA 4JEPA 1K73O 1TYQB 1MWKA 5BREA 5EX5A 3LDOA 3O5BA 3U9DA 3AAPA 1NGAA 3WXKA 1XUPO 5JVHL 2KHOA 2ASMA 4YOVA 5AQXA 3O9SA 3I56N 2F7TA 2P9NA 4BRKA 4U67L 1VAZA 2WFBA 3O8MA 4BRMA 1EQYA 4NO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEZ A;  2NRH A;  3H3N O;  2IVN A;  3CQX A;  4BC2 A;  2P9P A;  3ZX3 A;  4CZK A;  5AQI A;  1Z6R A;  5F2R A;  4DCH A;  4BRF A;  4XH1 A;  5TKY A;  3TU5 A;  4BR2 A;  5BN9 A;  2GEM A;  3EKU A;  4A2A A;  3MN5 A;  4XH4 A;  1JCG A;  3GL1 A;  2P9K A;  3CHW A;  1DKG D;  3MN7 A;  3SJH A;  4CBW A;  2GUP A;  3O1W A;  2F9W A;  2ZGY A;  3GOI A;  2V51 B;  3WXI A;  5FPM A;  4CZJ A;  4H0O A;  3F9M A;  1MWM A;  1GLF O;  4EIA A;  2NZT A;  3VET A;  4BR7 A;  5I9E B;  3LM2 A;  5BPN A;  2V52 B;  1NGH A;  3A5L C;  5KQ8 A;  1K8K A;  4B1Z A;  2HF3 A;  1IJJ A;  4K25 A;  1QQN A;  2F9T A;  4FWM A;  1NGD A;  5AQY A;  3L6Q A;  4HWI A;  3FZK A;  4FWO A;  3JXU A;  1SAZ A;  3ZET A;  1ZC6 A;  4A2B A;  4RCH A;  3FZL A;  4M7X A;  2A6A A;  1ZBS A;  5AQP A;  2VYP A;  2QM1 A;  1TUY A;  2DPN A;  1HUX A;  3DWL A;  3L0Q A;  4FWK A;  3FLC O;  3DXK A;  5BN8 A;  3MCP A;  3FFK B;  4CBX A;  4GY2 B;  2GTD A;  4H03 B;  5AQW A;  3D2F B;  3R9P A;  5AQG A;  1T6C A;  4IJN A;  4PKG A;  4JN4 A;  1NBW A;  3LL3 A;  2UYT A;  1X3M A;  5AZJ B;  2YI1 A;  4FWR A;  5KPT A;  5AQU A;  3HZ6 A;  2ZGZ A;  5BR9 A;  2E2N A;  2OAN A;  2QW9 A;  2E2P A;  4A61 A;  4CZI A;  1NGI A;  5F0X A;  2A42 A;  2E2Q A;  5KPR A;  3CJC A;  3VEW A;  4B9Q A;  5AQS A;  3M1F A;  5AR0 A;  4FWL A;  4CZF A;  4LC9 B;  4YDU A;  3QB0 A;  5B8H A;  3BF1 A;  2Q1N A;  3CJ7 A;  2Q97 A;  2FSK A;  2E88 A;  1QZ6 A;  3GBT A;  4FWS A;  2CGK A;  3C0B A;  3L4I A;  3EL2 A;  3H45 C;  3VPZ A;  2P9K B;  4IJA A;  4MLE A;  1ATR A;  4BVO A;  4BRL A;  3ZEU B;  3EO3 A;  1HPM A;  2YCH A;  1J6Z A;  4H0T B;  1T44 A;  2Q2R A;  4K43 A;  4BRC A;  3UE5 A;  2E8A A;  3MN6 A;  5FPN A;  4BVP A;  1XQS C;  1X3N A;  2ASO A;  2CH5 A;  3IMX A;  1XC3 A;  4H5R A;  4Z94 A;  3VF4 A;  4B1V A;  3IUC A;  1C0F A;  4KBO A;  4C23 A;  4Y0W A;  3IDH A;  4CZL A;  1U2V A;  3R8E A;  3ZET B;  5JLF A;  2P9U B;  3DXM A;  4O5F A;  4YDU C;  5EVZ A;  1P8Z A;  1TUU A;  3O6W A;  3SLC A;  1T6D A;  3CI5 A;  2ZF5 O;  3FR0 A;  3O1B A;  3UKR B;  5AQL A;  1YVN A;  3ENH A;  3CJB A;  4IZ9 A;  1V4S A;  3A8Y A;  4JAX A;  4O8K A;  3KHY A;  3TPQ A;  5BPM A;  5F1X A;  2Q0U A;  4BRO A;  2P9I A;  3D2E A;  3C7N A;  3CER A;  3KVG A;  3MMV A;  5ADX H;  4RWT A;  1U6Z A;  3FGU A;  1QQO A;  2ASP A;  1RFQ A;  3D7E O;  3CET A;  2P9L B;  5LJW A;  3WEE A;  4FWP A;  4WQ4 A;  4ISF A;  4JNE A;  1SQK A;  4FOE A;  4BRI A;  3VGL A;  5LJV A;  5LY3 A;  4JD2 B;  3LM9 A;  1DEJ A;  1YXQ A;  5AQQ A;  1D4X A;  3QBX A;  1GLC G;  4CZE A;  1KAZ A;  4BRG A;  4H0X B;  1Y64 A;  3S41 A;  4GNI A;  3UKU A;  1E4F T;  1Q18 A;  1JCF A;  3BUZ B;  5AQN A;  3FE1 A;  5ADX A;  1IG8 A;  4BRA A;  1GLB G;  4DHY A;  3QBW A;  1NLV A;  2VCP A;  2FSJ A;  3FZH A;  3ATV A;  3QDK A;  4BG8 A;  1NGE A;  4QS9 A;  3LDL A;  5E26 A;  1TYQ A;  4AM6 A;  2YJF A;  4H5V A;  2QXL A;  3CJ9 A;  3WT0 A;  1X9J A;  3AAQ A;  5AQH A;  1BDG A;  3LDN A;  3W0L A;  1S3X A;  4IO8 A;  3U4L A;  5BRF A;  2HMP A;  3HTV A;  1BOT O;  1BA0 A;  3MN9 A;  4QS7 A;  4B1W B;  1GLJ O;  2IIR A;  3AY9 A;  4WQ4 C;  5ELZ A;  2QWO A;  3B8A X;  1RGI A;  2YHX A;  4H5T A;  4HTL A;  4CI6 A;  2P9N B;  1U2V B;  3JS6 A;  4QS8 A;  3CQY A;  2FF3 B;  3DXM B;  3FZM A;  3QML A;  3SK3 A;  1CZA N;  1LOT B;  4CJ7 A;  5BRD A;  1DGK N;  2CGJ A;  5AQJ A;  2P9P B;  4AM7 A;  1G99 A;  2D0P A;  1GLE G;  2P9S A;  3ID8 A;  2A41 A;  4ISG A;  4WYB A;  1QHA A;  3I33 A;  1WUA A;  1NMD A;  4BRN A;  5AQZ A;  3WQT A;  3CJA A;  4CD3 A;  1QQM A;  2WUS A;  4FOI A;  4I6M A;  1NM1 A;  2QWP A;  4H0Y B;  5BRH A;  2P9I B;  4BC5 A;  3VES A;  2V7Y A;  4F9O A;  5JIC A;  3C7N B;  4FPB A;  3P4I A;  5E84 A;  3VF2 A;  4PKH A;  3GDQ A;  5JLH A;  5KPZ A;  4BR5 A;  1GLL O;  3OHR A;  1BG3 A;  1KAX A;  4XEI A;  2PBD A;  3H6E A;  2I7P A;  2V7Z A;  3VEX A;  1K8K B;  1E4G T;  2A5X A;  3QFU A;  4E1J A;  4H5W A;  1SZ2 A;  4PKI A;  4B1Y B;  1Z05 A;  3ZX2 A;  4JHD A;  3J8A A;  3HM8 A;  2FLO A;  4BQZ A;  3D2F A;  2E2O A;  3BEX A;  4PL8 A;  5EXW A;  3G25 A;  2BUP A;  3HSC A;  3MK6 A;  3CJ1 A;  3HBT A;  4FSV A;  2IVP A;  1ESV A;  3BF3 A;  3EN9 A;  4EFH A;  5AQF A;  4BG9 A;  2J4R A;  3W3D A;  3H3O B;  3DXK B;  4XH5 A;  1NGB A;  2VWB A;  3I8B A;  5AQO A;  3U9Z A;  2QWN A;  2A3Z A;  3EZW A;  3FZF A;  2FXU A;  2GWJ A;  2YJE A;  4K41 A;  4A62 A;  3MDQ A;  2CH6 A;  3VGM A;  4BGB A;  4H0P A;  4BGA A;  2YHY A;  3ULE A;  2FSN A;  4CZG A;  1NGG A;  3ATU A;  2ZWH A;  3HI0 A;  1YAG A;  3LDP A;  3QFP A;  4BRP A;  1BA1 A;  2Q31 A;  2YHW A;  2QWR A;  2Q36 A;  5CE3 A;  2HF4 A;  3EKS A;  3RSE A;  3A5O C;  1ATN A;  1ATS A;  3A5N C;  3H1Q A;  2BTF A;  4BR0 A;  5FPE A;  1KAY A;  1GLA G;  2H3G X;  3AAR A;  4CD1 A;  4DQ8 A;  5AQK A;  1LCU A;  3H1V X;  4FWN A;  3U8X A;  1ZXO A;  3VF6 A;  1V4T A;  3ZEU A;  5AZI A;  3CIP A;  3VOV A;  1MA9 B;  2P9S B;  4FO0 A;  4CZH A;  4M63 C;  4NB4 A;  5BPL A;  4WQ5 A;  5JMV A;  2ITM A;  3VGK A;  1BO5 O;  2I7N A;  5AFU H;  4B1U B;  4BR4 A;  4PL7 A;  4RTF D;  1YUW A;  2AA4 A;  4ISE A;  4I6M B;  1HKC A;  1HJO A;  4MLH A;  4M7Y A;  3M3Z A;  3VEN A;  1BUP A;  2P9U A;  5AQT A;  4B1X B;  1S22 A;  2D1K A;  3O4W A;  2QWL A;  3GG4 A;  1HX1 A;  1HKG A;  3ENO A;  1HKB A;  3WUH A;  1BU6 O;  5AFU A;  4MO5 A;  1RDW X;  4J8F A;  3UKR A;  1GLD G;  4BC3 A;  2E1Y A;  2QWQ A;  4JHD B;  3WXJ A;  4EAH D;  4FPA A;  4BRQ A;  4CBU A;  3BP8 A;  3UB5 A;  2E20 A;  2IVO A;  2A40 A;  3VER A;  1C0G A;  4H0V B;  3LDQ A;  5AQV A;  4CZM A;  2E1Z A;  4L3Q A;  5EOY A;  2GEL A;  3IFR A;  4H5N A;  2GWK A;  5AQR A;  4WQ5 C;  3WQU A;  1NGF A;  2P9L A;  2D0O A;  5FPD A;  1BWF O;  3VEV A;  2HOE A;  2EWS A;  3QIC A;  2QWM A;  4MO4 A;  2Q0R A;  2D4W A;  3WXL A;  2AP1 A;  4JD2 A;  1HLU A;  1NGC A;  2PAV A;  3A0I X;  1H1V A;  2FF6 A;  3A5M C;  3VEO A;  3D2E B;  4BQL A;  4K42 A;  3R6M A;  3SMS A;  3ULE B;  4FL9 A;  4FWQ A;  2CGL A;  3WEE B;  4DB3 A;  2W40 A;  4IXC A;  3O80 A;  2NLX A;  5KQD A;  3RSE B;  3ZX0 A;  4BRE A;  1OKJ A;  3GE1 A;  3O08 A;  1NWK A;  3KZB A;  1KXP A;  2W41 A;  4BRD A;  4BR9 A;  1NGJ A;  3UKU B;  3DAW A;  3M6G A;  1MDU B;  3DJC A;  5AZI B;  1WOQ A;  5AQM A;  3H46 O;  4EHU A;  1JCE A;  1QZ5 A;  3SMP A;  1R59 O;  4EHT A;  5EY4 A;  4BC4 A;  4BRH A;  3VEY A;  5AZJ A;  4IWV A;  1TYQ B;  1MWK A;  5BRE A;  5EX5 A;  3LDO A;  3O5B A;  3U9D A;  3AAP A;  1NGA A;  3WXK A;  1XUP O;  2KHO A;  2ASM A;  5AQX A;  4BRK A;  2P9N A;  3O8M A;  4BRM A;  1EQY A;  4NO7 A; 
#chains in the Genus database with same CATH topology
 5HRR A;  3CQX A;  4MDA A;  2HHX A;  2BAN A;  4AHC A;  2OZS A;  1KCF A;  3H08 A;  5AQI A;  4CHO A;  1Z6R A;  1J5O A;  4DCH A;  2KLA A;  4JYA K;  4XH1 A;  1IKV A;  1BL3 A;  4A2A A;  3ZSO A;  3GL1 A;  4I9L A;  2QKK A;  1DKG D;  3SJH A;  4CBW A;  1TGO A;  5HRN A;  1YIJ N;  4F3T A;  3V81 A;  1TL3 A;  1JJ2 M;  2XY7 A;  3HVR A;  3DLG A;  3WXI A;  1BIZ A;  4DSK A;  3T19 A;  5I9E B;  1Q7Y O;  1A5W A;  3VET A;  2FBY A;  3C6U A;  4KHY A;  1NGH A;  3D0P A;  1Q9Y A;  4K25 A;  1QQN A;  3L6Q A;  3OYH A;  2WOM A;  4WE1 A;  3DLH A;  4FWO A;  3JXU A;  5J2Q A;  4Z0U A;  1N33 K;  4AQY K;  3ZET A;  3ZSW A;  4RCH A;  5FRO A;  4M7X A;  3SBT A;  4UY8 O;  2HBJ A;  4B08 A;  1NJZ A;  4KRF A;  3O9Q A;  1ZBS A;  5AQP A;  3DM2 A;  4DTM A;  1TUY A;  4IDK A;  1O13 A;  4CEZ A;  2DPN A;  1HUX A;  1BCO A;  4OPA A;  2HW3 A;  3HOS A;  3FFK B;  3L2U A;  2JGU A;  4M3U A;  1HYV A;  4O0I A;  3CC7 N;  4DR4 K;  1NBW A;  2D0B A;  2UYT A;  3BZC A;  1FXX A;  4JK8 A;  5AZJ B;  4AHV A;  2YI1 A;  4FW1 A;  4N47 A;  3LP2 A;  3CXC M;  4KKO A;  4CHZ A;  3O3G A;  1NJX A;  4KH4 A;  4CZI A;  5F0X A;  4N5S A;  1J53 A;  2EX3 A;  3KWG A;  3LAK A;  3I8D A;  3SZ2 A;  5HP1 A;  1QQC A;  2RE2 A;  3FFI A;  1ASW A;  1DT9 A;  1CZB A;  1SKR A;  1WAJ A;  4J2E A;  1SKS A;  3EL2 A;  4CJQ A;  4OPH A;  1HPZ A;  2KZM A;  2A1S A;  1LW0 A;  3MEE A;  3EO3 A;  1SL1 A;  4K43 A;  1ZBF A;  3NF7 A;  2X78 A;  4BVP A;  1S1W A;  4DUZ K;  2D0C A;  3VF4 A;  4DTJ A;  1C0F A;  4Y0W A;  4CEC A;  2LSN A;  4H8K A;  5JLF A;  3CM5 A;  3DXM A;  3HRG A;  1WLJ A;  3KK1 A;  3ZSZ A;  4KTQ A;  3O4N A;  1SL2 A;  1WSI A;  3O6W A;  1T6D A;  4DQR A;  2ZF5 O;  3IKM A;  3O1B A;  3HK2 A;  4JS4 A;  1XMO K;  2EHG A;  4KV8 A;  1HMV A;  3VQ9 A;  1DTQ A;  3ENH A;  3MXJ A;  3KWI A;  3QNN A;  1N8R O;  4JAX A;  3O9T A;  4CGF A;  2OPQ A;  5F1X A;  4LF7 K;  3HJF A;  3C7N A;  3TAG A;  4V19 S;  4F2S A;  3KVG A;  5ADX H;  3ZT4 A;  4RWT A;  1U6Z A;  3TWH A;  2YNI A;  1RFQ A;  4A5B A;  1OH8 A;  3D7E O;  4AIL C;  3ENB A;  2G8V A;  4WQ4 A;  3ZT2 A;  3S3N A;  2GV9 A;  4FJL A;  4O8U A;  1N6Q A;  2PZS A;  3K0S A;  2F4V K;  4CZE A;  1D4X A;  3QBX A;  1GLC G;  4JKA A;  3THW B;  1FKP A;  3S41 A;  3VQ5 A;  4G9Z A;  5FRN A;  3FE1 A;  1IG8 A;  4BRA A;  3QBW A;  1Z26 A;  2GX9 A;  4M3W A;  4QS9 A;  3LDL A;  1F21 A;  1TYQ A;  2YJF A;  4CJ3 A;  4H5V A;  2QXL A;  3M8R A;  4DKW A;  1X9J A;  3PSF A;  3V9Z A;  3DOL A;  3K5O A;  4IO8 A;  3V9U A;  3T3F A;  4FLU A;  3NAE A;  1B9D A;  4RW7 A;  3QET A;  2NRW A;  2QWO A;  2E6M A;  4DMN A;  3CG7 A;  1RGI A;  3HL8 A;  4JI1 K;  1NNE A;  2OZM A;  4HTL A;  1U2V B;  3TR8 A;  1K8A O;  3HO1 A;  4B3R K;  3FZM A;  4CJK A;  1CZA N;  1LOT B;  1QVG M;  4YHH K;  2CGJ A;  1VSD A;  4KH6 A;  5AQJ A;  2XY8 A;  4Z4G A;  3ZSY A;  3F5T A;  4Z4C A;  1HNI A;  1I3A A;  4BE1 A;  3OS1 A;  3F73 A;  4RW8 A;  4BRN A;  1VQ9 N;  1NK5 A;  2HNY A;  4CW7 B;  2WUS A;  5BRH A;  1QE1 A;  3ZCM A;  4E1M A;  1Q81 O;  2OCE A;  3GDQ A;  3SAG A;  3S3O A;  1GLL O;  1CXQ A;  3OYN A;  4DSL A;  1VHX A;  4XEI A;  3TSU A;  2PBD A;  2I7P A;  2V7Z A;  4I2Q A;  5LMN K;  1WB9 A;  3SPY A;  1E4G T;  4CFC A;  4KHU A;  4JRP A;  1SZ2 A;  4PKI A;  4CIE A;  3AVN A;  1RTH A;  3J8A A;  4U7B A;  3KK3 A;  3TSP A;  4B8C A;  3NFA A;  2E2O A;  3BEX A;  4FZY A;  4KI6 A;  3G25 A;  1W97 L;  2XHB A;  1RDU A;  5DK5 A;  1NKB A;  4Q5V A;  1VSF A;  3CQ8 A;  3J7Y P;  4DF8 A;  2IVP A;  4EFH A;  3QIP A;  3VQ7 A;  1NGB A;  3I8B A;  1RBT A;  5AQO A;  1EX4 A;  3WXM B;  3EZW A;  2BDP A;  3ZSX A;  2HHH K;  3NHG A;  2CH6 A;  1D9F A;  4I9Q A;  1EXQ A;  4ILJ A;  4BGA A;  3ULE A;  1S6P A;  3ATU A;  2ZWH A;  1YAG A;  3LDP A;  1BA1 A;  2Q31 A;  5C24 A;  3EKS A;  3AVF A;  4DTR A;  3CCU N;  1ATS A;  1C1B A;  1ZBH A;  3KLF A;  1EWQ A;  3H1Q A;  1KAY A;  1B9F A;  4DS5 A;  4M3X A;  4FJJ A;  5HBM A;  5FDL A;  4LY7 A;  3HPH A;  4LH5 A;  3VF6 A;  1RDD A;  4K8Z A;  3ZEU A;  1RBV A;  1MA9 B;  3T1A A;  3P39 A;  3KIO A;  4FO0 A;  2HHW A;  4OKJ A;  4HCC A;  3QNO A;  1VQ7 N;  2ITM A;  4DU4 A;  3MXM A;  5AFU H;  2DFF A;  4RTF D;  3S9H A;  2YKN A;  3KK7 A;  1U49 A;  2IDO A;  3IS9 A;  3F2K A;  3M3Z A;  1BUP A;  5AQT A;  4GKK K;  3OYF A;  1S22 A;  2O4G A;  3AO2 A;  2QA4 N;  2QWL A;  3MEG A;  1HX1 A;  3KTQ A;  1KLN A;  4CK3 A;  4KTZ A;  1QSL A;  2W42 A;  1RTD A;  4BE0 A;  5BR8 K;  3WXJ A;  4R79 A;  4FJX A;  3BY5 A;  3BP8 A;  3UB5 A;  1HNX K;  2A40 A;  3VER A;  4H0V B;  3LDQ A;  5DM6 L;  2E1Z A;  5EOY A;  3CCS N;  3QEX A;  2IC3 A;  3IFR A;  4H5N A;  2GWK A;  3I56 N;  4DTX A;  3OYK A;  1BWF O;  3VEV A;  2HOE A;  3K59 A;  2ZQB A;  2Q0R A;  2AP1 A;  3P5J A;  5CYQ A;  2XY6 A;  5M1O A;  1FKO A;  3A5M C;  4AH9 A;  3TAP A;  2GUI A;  4K42 A;  3KLH A;  3CM6 A;  4GMJ B;  1RT4 A;  3VQ4 A;  3OBW A;  4CJP A;  3O9U A;  2UUA K;  5M1Q A;  2WBN A;  3LZI A;  4HHT A;  3O80 A;  2OA8 A;  4PWD A;  2HMI A;  4PQU A;  1S9G A;  3U3G A;  3KLI A;  3KZB A;  1NK9 A;  5CZ1 A;  3N4Q A;  1SUQ A;  3AA4 A;  4ZTF A;  3SMP A;  4EHT A;  3VEY A;  3LAL A;  5AZJ A;  1K73 O;  1K6Y A;  1MWK A;  1TYQ B;  5BRE A;  4DV7 K;  5C42 A;  4CJS A;  1VRT A;  5AQX A;  3TAM A;  4JI5 K;  2YHA A;  3O8M A;  1EQY A;  4NO7 A;  4DQQ A;  3KLE A;  5HRO A;  3VEZ A;  1TV6 A;  3V9X A;  3AO1 A;  4BC2 A;  3AA5 X;  1BGX T;  1ZYQ A;  4RW4 A;  5CR4 A;  2QKB A;  1VQO N;  4ZTJ A;  3TU5 A;  4BR2 A;  5BN9 A;  2HVI A;  2GEM A;  3OA9 A;  3EKU A;  4PHT X;  4PUO A;  4LFB K;  4OKE A;  3O1W A;  5IWA K;  3L3U A;  4EZ9 A;  3F9K A;  3GOI A;  4CK1 A;  4CZJ A;  1XMQ K;  3F9M A;  1GLF O;  4C8N A;  4OKK A;  4KRE A;  2ZE2 A;  4HUF A;  2OPR A;  5FRM A;  3AVM A;  5KQ8 A;  4CED A;  4FWM A;  3MCA B;  2FBT A;  4E3S A;  3FZK A;  1EKE A;  1SAZ A;  3T69 A;  5KGX A;  2VGN A;  2NRT A;  1FJG K;  2YKM A;  1S1T A;  2YV0 X;  1JLC A;  3Q7B A;  4FWK A;  4DV6 K;  2I5J A;  3DXK A;  4B3S K;  4NYN A;  3K58 A;  4H03 B;  5AQW A;  3B6P A;  2O8D A;  4J2B A;  4JKB A;  3R9P A;  3CC2 N;  1T6C A;  3MX2 A;  1N32 K;  4CEA A;  4JN4 A;  1X3M A;  4B9S A;  3NMU A;  3HZ6 A;  2ZGZ A;  4KAZ A;  5BR9 A;  1G15 A;  1LAW A;  3HM9 A;  2E2P A;  3C6H A;  1NGI A;  2A42 A;  4IDH A;  3B6O A;  1NU0 A;  3VTH A;  5MLC Q;  5C2F A;  4DR7 K;  2HHV A;  3AVL A;  1QTM A;  3OJS A;  3CJ7 A;  2E88 A;  1C1A A;  1QZ6 A;  4JLH A;  3OYM A;  3SBG A;  1RT5 A;  4BWM A;  1XC9 A;  3VPZ A;  4NYF A;  4IJA A;  2G8F A;  4B3O A;  3MAQ A;  3E66 A;  4BVO A;  3RR8 A;  1N34 K;  4BRL A;  3ZEU B;  4M3Z A;  2YCH A;  2G8U A;  3RWU A;  4OPK A;  3ALY A;  1T44 A;  2Q2R A;  4BRC A;  4JI0 K;  2E8A A;  3LP0 A;  4CJV A;  3MN6 A;  5FPN A;  1LWE A;  2DFE A;  1XQS C;  5H1S Q;  3ITH A;  2CH5 A;  4B1V A;  4KBO A;  1B92 A;  3ZSV A;  3IDH A;  1U2V A;  2X6N A;  3R8E A;  4LFA K;  1ITG A;  2JLE A;  1XNQ K;  3OW2 M;  1TUU A;  1U47 A;  2X6S A;  3SLC A;  5GAG P;  3E9O A;  3SCX A;  1LV5 A;  4CGG A;  5LMU K;  4KFB A;  2HHQ A;  3LAN A;  3LP1 A;  5AQL A;  1RBS A;  1YVN A;  5HL7 L;  4E89 A;  4EP5 A;  2IOC A;  1V4S A;  3A8Y A;  3VA3 A;  1K9M O;  3NVM A;  4O8K A;  1ZBI A;  3KHY A;  3TPQ A;  5BPM A;  4JV5 K;  4BRO A;  4FJH A;  3G0Z A;  2Q3S A;  3CCJ N;  3V6D A;  4MDB A;  1HR0 K;  4FOE A;  1X9W A;  4O0J A;  1Q86 O;  3VGL A;  4F2R A;  1L3T A;  3CCE N;  4N76 A;  1YXQ A;  5AQQ A;  1BIU A;  1FK9 A;  4N56 A;  3DLE A;  4DFK A;  4IBN A;  3UKU A;  1Q18 A;  3BUZ B;  5ADX A;  4X64 K;  1NLV A;  1Q82 O;  3FZH A;  3L2W A;  3ID6 A;  1XHX A;  4AM6 A;  2QI2 A;  2ATQ A;  1KVB A;  4AHT A;  4FM2 A;  4OX9 K;  3R1X A;  1BI4 B;  3ZT0 A;  4H4O A;  2P51 A;  3RTV A;  3EE8 A;  3TTD A;  4CES A;  3VQE A;  3W0L A;  3A2F A;  2HND A;  5BRF A;  3HTV A;  4JKH A;  4K0K K;  4B1W B;  4RG8 A;  3NF8 A;  1GLJ O;  1TAU A;  2NUB A;  3SUO A;  2HBM A;  3AA3 A;  2VG5 A;  5ELZ A;  3B8A X;  1NJW A;  1ILY A;  3VQ8 A;  4DV3 K;  3NE6 A;  4B9U A;  3OYI A;  4X65 K;  1CXU A;  3CQY A;  3SK3 A;  2FF3 B;  3QML A;  4NLC A;  4FJ7 A;  4B9M A;  4FJN A;  4CJ7 A;  3K9K A;  4Z4H A;  1DGK N;  1JL1 A;  5C10 A;  4LSL A;  2D0P A;  3SV4 A;  1GLE G;  4FJI A;  2A41 A;  3C6A A;  4JI4 K;  1WUA A;  3OS0 A;  3TI0 A;  3OYJ A;  2ZD1 A;  4PY5 A;  4E7K A;  2ITG A;  4FK2 A;  4H0Y B;  2RN2 A;  2P9I B;  2V7Y A;  4J2D A;  5JIC A;  1WSJ A;  1RDA A;  1YTA A;  4PKH A;  1JXE A;  5KPZ A;  4GVM A;  3ZYY X;  1KAX A;  3H6E A;  3MED A;  1WBB A;  4DSI A;  4OJR A;  5J1E A;  5T7B A;  1Z05 A;  3CCV N;  5CHI A;  1VQK N;  3D45 A;  3CC4 N;  1S72 N;  3D2F A;  4RW6 A;  4NCB A;  4DV5 K;  5EXW A;  1ASU A;  4IOA L;  2BUP A;  3KKR A;  2RF2 A;  4DWI A;  2UXB K;  4FSV A;  3BF3 A;  3VQP A;  4BG9 A;  3H3O B;  3DXK B;  4IG3 A;  3U9Z A;  1KSP A;  1RCH A;  2QWN A;  2XO7 A;  2ZM6 K;  2O8D B;  3FZF A;  4FJ8 A;  2FXU A;  4K41 A;  4O4G A;  4IFV A;  4BGB A;  4H0P A;  2YHY A;  3BGR A;  4BDY A;  4E7H A;  3QFP A;  3PX6 A;  4C8O A;  1EO1 A;  1N36 K;  2Q36 A;  5CE3 A;  2HF4 A;  1WSE A;  4Q0B A;  3IRX A;  3RRG A;  3DRP A;  3BDP A;  3THV A;  1YF5 L;  5DM7 L;  4DQ8 A;  4XIU A;  1LCU A;  3H1V X;  1ZXO A;  4DTP A;  4Y1D A;  4YFU A;  3ULD A;  3CIP A;  3VOV A;  1VQN N;  3DLK A;  1HYS A;  4BDZ A;  4CZH A;  2YNF A;  4CIG A;  4M63 C;  5JMV A;  4YOW A;  3VGK A;  2Z1G A;  3O4Q A;  5KRT A;  2O8F B;  1HRH A;  5M1N A;  2AA4 A;  3J81 O;  4DTN A;  4I6M B;  1HJO A;  3HYF A;  4O44 A;  4CHQ A;  2ZJR L;  3EEQ A;  2D1K A;  2VQF K;  2IS3 A;  2R7Y A;  1HKG A;  1GOA A;  3ENO A;  1BU6 O;  1NK6 A;  5AFU A;  5GAD P;  3TTF A;  4LF5 K;  2UXC K;  2AJQ A;  3PSI A;  3RVC A;  3V9W A;  4O5B A;  3CFO A;  4EAH D;  2KFN A;  3THY A;  1KLM A;  3CME N;  4GV3 A;  4YOU A;  3EZ5 A;  5KI6 A;  4FVM A;  4IEE A;  3TAF A;  1VQ4 N;  4AHR A;  4CZM A;  2NRZ A;  2P5O A;  3NDK A;  1U4B A;  1VK0 A;  3CCL N;  2D0O A;  5FPD A;  4DSE A;  2EWS A;  3QIC A;  1T7P A;  3NGZ A;  2D4W A;  4JD2 A;  1HLU A;  1NGC A;  1KFD A;  1VSH A;  2FF6 A;  3VEO A;  4BQL A;  3KD1 E;  3R6M A;  3SMS A;  1WSF A;  2KZZ A;  1A5V A;  2O8B B;  4M45 A;  2CGL A;  2VWJ A;  3HPG A;  5KRS A;  1CLQ A;  4DSJ A;  1S1X A;  3RSE B;  3RMC A;  3DLB A;  3P31 A;  3GE1 A;  4FJG A;  2HB5 A;  4DLE A;  4OO1 J;  2W41 A;  4BRD A;  3J80 O;  1NGJ A;  4DR2 K;  4YOT A;  3UKU B;  5SWM A;  1JKH A;  5AZI B;  1WOQ A;  3H46 O;  1OH7 A;  1QZ5 A;  1MU2 A;  4ILG B;  2WON A;  2PYL A;  5EY4 A;  1RT1 A;  4CGI A;  1S5J A;  4J2A A;  5EU7 A;  1NGA A;  4IG0 A;  2KHO A;  4YOV A;  1TK0 A;  3VQD A;  2W6K A;  2F7T A;  4HUE A;  1D5A A;  1VAZ A;  4DLG A;  3KLG A;  4B3T K;  4M42 A;  3HXM A;  4DR1 K;  1UAX A;  1WNS A;  1XNR K;  2FBV A;  2NRH A;  1YVU A;  1KVC A;  4JI3 K;  2YNG A;  4FVU A;  5C0Y A;  4DTS A;  2P9P A;  1BIS A;  4QCL A;  4CZK A;  5F2R A;  4BRF A;  3CPW M;  1BCM A;  4MFB A;  4KB0 A;  3MN5 A;  3MWT A;  1QSS A;  1W7A A;  5M1P A;  2DFH A;  2GUP A;  3I0S A;  1RBU A;  4KO0 A;  3C95 A;  1W9H A;  3SQ1 A;  2V51 B;  5FPM A;  4BR7 A;  1HNW K;  4JK7 A;  3A5L C;  4DR5 K;  3L8B A;  1K8K A;  2HF3 A;  2XY5 A;  4KI4 A;  1NGD A;  3NF6 A;  4FM1 A;  3IG1 A;  2HBK A;  2Y1J A;  1WSH A;  3AVH A;  4JKF A;  3K9J A;  2A6A A;  1FW6 A;  1NK0 A;  4HCB A;  2VYP A;  2QM1 A;  2UUB K;  4E1N A;  3KKS A;  3DWL A;  5CYM A;  4FYD A;  4A5A A;  1C0M A;  3FLC O;  3SUP A;  1NOZ A;  4CBX A;  2GTD A;  1U45 A;  3D2F B;  3CCM N;  2B5J A;  2HNZ A;  2WTU A;  4CIF A;  1IBL K;  4FWR A;  3VQB A;  5KPT A;  4WFN L;  3PX0 A;  2E2N A;  2UXD K;  1UOC A;  2QW9 A;  4A61 A;  4OVL A;  2QK9 A;  5KPR A;  3CJC A;  3VEW A;  2P5G A;  2X74 A;  3M1F A;  3NGY A;  4DSF A;  4BY9 C;  4CZF A;  4LC9 B;  1L3V A;  4HUG A;  3BF1 A;  1HQE A;  1C0T A;  3KJV A;  4M3Y A;  3AO5 A;  4NCA A;  3NBP A;  1VSK A;  2CGK A;  3C0B A;  4CF1 A;  3L4I A;  4FW2 A;  3QEP A;  4DTO A;  2P9K B;  3VN5 A;  2ZJP L;  1BI4 A;  3LP3 A;  3S3M A;  3AO4 A;  4JKG A;  1HPM A;  4IOX A;  1YJ9 N;  3E1Y A;  3OYD A;  4DS4 A;  3UE5 A;  1TVR A;  1HNZ K;  4I2P A;  3NH0 A;  3KK2 A;  1X3N A;  2ASO A;  4OLA A;  3IMX A;  4H5R A;  1XC3 A;  4CCH A;  4AHU A;  4DFM A;  2NRX A;  4DQS A;  3AVJ A;  4C23 A;  3NH1 A;  4CZL A;  4OLB A;  4FJ9 A;  4BWJ A;  3CMA N;  1N5Y A;  1WBD A;  2O8C A;  2D0A A;  3P1G A;  4DF4 A;  4YDU C;  4JI2 K;  5EVZ A;  1P8Z A;  3L2R A;  4DV2 K;  3ZSQ A;  3ISN C;  3CI5 A;  4FJK A;  1RIL A;  4OGE A;  3AVA A;  4DV4 K;  3CJB A;  4IZ9 A;  4EZ6 A;  1TK8 A;  3THY B;  1C6V A;  2P9I A;  3D2E A;  3LAM A;  4DR6 K;  4LF8 K;  3CER A;  1BQN A;  2ASP A;  3CET A;  4HTU A;  5LJW A;  4FWP A;  3P38 A;  4ISF A;  1JLA A;  2KFZ A;  1SQK A;  4BRI A;  1WSG A;  5LJV A;  5LY3 A;  3SPZ A;  1I39 A;  3LM9 A;  1DEJ A;  1YT3 A;  4JD2 B;  2OYQ A;  5D3G A;  4BRG A;  4H0X B;  1Y64 A;  4GNI A;  3DOK A;  1REV A;  1SS6 A;  3QES A;  3OTO K;  3PY8 A;  2B4J A;  1JL2 A;  1GLB G;  1IKY A;  4CER A;  2FSJ A;  3VA0 A;  4M3T A;  3QDK A;  4BG8 A;  1NGE A;  3HT3 A;  2Z1I A;  4X62 K;  2OPS A;  3CFP A;  1IBM K;  1D8Y A;  5K14 A;  3CJ9 A;  3WT0 A;  3BZK A;  5AQH A;  1BDG A;  3LDN A;  4Z4I A;  4BAC A;  4Z4F A;  2HMP A;  4QS7 A;  3N4P A;  1KD1 O;  4LD0 A;  2IIR A;  1SV5 A;  4I7F A;  4NXN K;  3OYC A;  3MWP A;  1UA1 A;  4KHQ A;  4CI6 A;  4GV6 A;  3JS6 A;  3CCQ N;  1NKE A;  3CFR A;  2IAJ A;  3PIO L;  5BRD A;  3DI6 A;  5TKW A;  2P9P B;  5A2Q O;  1OH5 A;  4GV9 A;  4KHW A;  4LH4 A;  4WYB A;  4ISG A;  1QHA A;  3I33 A;  3QO9 A;  4CHY A;  3JYT A;  1QQM A;  1EP4 A;  4FLX A;  4UQG A;  1LW2 A;  3RMD A;  2O8F A;  4I6M A;  1NM1 A;  2QWP A;  4CFB A;  4NLB A;  2DTU A;  2ZJQ L;  4BC5 A;  5C12 A;  3ZT1 A;  3OYA A;  3QEW A;  4FPB A;  3P4I A;  5E84 A;  3VF2 A;  5JLH A;  3PUF A;  4BR5 A;  5C2D A;  1VSL A;  4CEE A;  1BG3 A;  4YNQ A;  4CF8 A;  1K8K B;  3VMF B;  1RDB A;  4H5W A;  4B1Y B;  3SQ0 A;  1RT6 A;  5M1F A;  3OY9 A;  2HHT A;  3G6E N;  4C8K A;  3TAQ A;  1VSJ A;  4A59 A;  4FK4 A;  1YIT N;  3HSC A;  4JKD A;  3HBT A;  4ELT A;  1DLO A;  4CFD A;  3OVN A;  4CGH A;  2J4R A;  3K5M A;  3DRS A;  2A3Z A;  4QAG A;  1JXB A;  4LF9 K;  1JLF A;  2KTQ A;  2YJE A;  2GWJ A;  4A62 A;  4W5O A;  3AGR A;  3MDQ A;  4LF6 K;  2VGM A;  1LWF A;  4BDP A;  4CZG A;  1NOY A;  3HI0 A;  3NCI A;  4CE9 A;  4BRP A;  3VQ6 A;  2O8B A;  4TSX A;  3L3V A;  3VQA A;  3K5N A;  3RSE A;  4K8X A;  1ATN A;  5DMR A;  3A5N C;  1VQM N;  3O3H A;  2Z1H A;  4BR0 A;  3OYG A;  1QHT A;  5GIO A;  4DG1 A;  2H3G X;  3T7Z A;  5AQK A;  1VSI A;  4FWN A;  3U8X A;  4HVJ A;  3K57 A;  4FLW A;  1EET A;  5AZI A;  2F8T A;  4CF9 A;  2E6L A;  4N41 A;  3THX B;  2P9S B;  4FK0 A;  4DUY K;  5BPL A;  4CFA A;  4WF9 L;  3AVG A;  3QIO A;  1IKW A;  4PL7 A;  3HOT A;  4ISE A;  2F8S A;  2ETJ A;  1NK8 A;  4MLH A;  2FC0 A;  4ID1 A;  4M7Y A;  1Y97 A;  2RPI A;  4JKG B;  4C1N I;  1T05 A;  2P9U A;  3IAY A;  3GG4 A;  1VQ8 N;  4F3O A;  3TAE A;  3C6T A;  1D9D A;  3AA2 A;  1SL0 A;  4MO5 A;  4DFP A;  1RDW X;  4LFC K;  3CD6 N;  3UKR A;  1GLD G;  1VSE A;  3VQQ A;  4JHD B;  3M8S A;  4OPJ A;  2O8C B;  4FLV A;  4FPA A;  1NKC A;  4CBU A;  4CK2 A;  4DR3 K;  1L5U A;  1RT2 A;  2GEL A;  3UIQ A;  3EE9 A;  1LWC A;  4G1Q A;  3VTI A;  4WQ5 C;  4NCG A;  2P9L A;  1S9E A;  3SUN A;  2QWM A;  3WXL A;  3C65 A;  3L2V A;  1VQ6 N;  4DQI A;  2PAV A;  3AGK A;  1RTJ A;  3D2E B;  4JK9 A;  2W6L A;  3DMJ A;  5JS2 A;  2PY5 A;  3SAF A;  4IXC A;  4CVN E;  3ZX0 A;  4E7L A;  4E7I A;  1OKJ A;  3QER A;  4B9V A;  3O08 A;  1NWK A;  1KFS A;  3R3L A;  4CJT A;  4CF2 A;  4BR9 A;  4M3R A;  3DAW A;  3M6G A;  1C1C A;  3DJC A;  5AQM A;  3V4I A;  4BRH A;  1IV0 A;  4JI6 K;  4FLY A;  5FLX O;  3U9D A;  3AAP A;  1XUP O;  5JVH L;  1L3S A;  2G8H A;  4BRK A;  2P9N A;  2PYJ A;  3WNH A;  4CJE A;  4J8F A;  1GOC A;  4ZHR A;  4NXM K;  3OJU A;  1VSM A;  1YJN N;  3H3N O;  2G8W A;  2OTL N;  2IVN A;  1JLG A;  1RT7 A;  3SI6 A;  1KC8 O;  4OGC A;  3ZX3 A;  3K2P A;  1IBK K;  1QVF M;  5GIN A;  5TKY A;  5J2N A;  3AVC A;  2NNW A;  4RW9 A;  4XH4 A;  1EWR A;  1JCG A;  2P9K A;  3CHW A;  3MN7 A;  1TK5 A;  4WFB L;  2WC9 A;  2F9W A;  1Q8I A;  2BH1 A;  1J54 A;  1W0H A;  2ZGY A;  3TAB A;  4CHP A;  4H0O A;  1MWM A;  5LL6 Z;  2NZT A;  4EIA A;  4DFJ A;  3LM2 A;  5BPN A;  2V52 B;  4QOZ B;  4FXD A;  4WFA L;  3P83 D;  4B1Z A;  1RBR A;  1IJJ A;  4B9T A;  3CYM A;  2F9T A;  5GIP A;  4PA1 A;  5AQY A;  2Z1J A;  4HWI A;  4WCE L;  1NMN A;  4JKE A;  4YOR A;  4FZX C;  3SAH A;  4R5P A;  4JRQ A;  3DLL L;  1ZBU A;  1ZC6 A;  4A2B A;  4CF0 A;  3FZL A;  1NJI O;  1S1U A;  1M1K O;  4CJW A;  2O8E A;  4FLT A;  1KVA A;  3L0Q A;  5M1K A;  2KQ2 A;  2OTJ N;  1DTT A;  5BN8 A;  3MCP A;  1S6Q A;  4GY2 B;  5HRP A;  1HQU A;  3NVK A;  2HVH A;  1XWL A;  5GAE P;  5CZ2 A;  1TKX A;  4DTU A;  2VG6 A;  3G71 N;  3K5L A;  4EP4 A;  5AQG A;  3ZLJ A;  3AVK A;  4IJN A;  4PKG A;  3LL3 A;  3ASM A;  3OYL A;  4FZZ A;  5AQU A;  2OAN A;  3M5R A;  2E2Q A;  3AO3 A;  4B9Q A;  5AQS A;  5AR0 A;  5JS1 A;  4FWL A;  3TAR A;  3V1O A;  3SNN A;  1L3U A;  2QEX N;  4YDU A;  3QB0 A;  5B8H A;  2Q1N A;  4M41 A;  2Q97 A;  2FSK A;  2F96 A;  4CGD A;  2UUC K;  1KTQ A;  2BE2 A;  3GBT A;  4FWS A;  1W2B M;  1KRP A;  3H45 C;  4YY3 K;  2HST A;  4MLE A;  1ATR A;  3M8P A;  3LPT A;  2XRI A;  1JLE A;  4CJL A;  4CEF A;  3SUQ A;  1IO2 A;  3RMB A;  4F8R A;  1UWB A;  1J6Z A;  4H0T B;  1HNV A;  3V9S A;  3RRH A;  1QS4 A;  3O3F A;  1SKW A;  3HP9 A;  1GOB A;  2JWK A;  4X66 K;  1E3M A;  2NRV A;  4Z94 A;  1YTU A;  3V1Q A;  3IUC A;  3ZSR A;  4IFE A;  4E0D A;  3SV3 A;  2D5R A;  3ZET B;  4W5T A;  2P9U B;  4DU3 A;  1A5X A;  3LZJ A;  4B3M K;  4JI7 K;  4O5F A;  3AV9 A;  2UU9 K;  3M8Q A;  4CJ5 A;  1VQP N;  1J5E K;  2QXF A;  3FR0 A;  3PX4 A;  3UKR B;  4CJ4 A;  2E5L K;  4C8L A;  3G4S N;  4B9L A;  2Q0U A;  4A57 A;  4Z4E A;  2B6A A;  3V1R A;  3MMV A;  3FGU A;  1QQO A;  1U48 A;  4FJ5 A;  3G10 A;  2P9L B;  2JWL A;  3WEE A;  1TAQ A;  2VWK A;  4JNE A;  5IT9 O;  4IFY A;  2O4I A;  3U3Y A;  3SYZ A;  4CEQ A;  1WN7 A;  2OPP A;  1ZBL A;  1KAZ A;  3MX5 A;  1OH6 A;  1E4F T;  1JCF A;  5AQN A;  4W5R A;  4DHY A;  3C94 A;  1TKT A;  2VCP A;  4CJU A;  3ATV A;  5E26 A;  5JVG L;  1YJW N;  3RR7 A;  4FLZ A;  2KKZ A;  4CJR A;  3AAQ A;  1BHL A;  1IH7 A;  3WNE A;  1T03 A;  1S3X A;  4LF4 K;  5E41 A;  3U4L A;  1OVY A;  1BOT O;  1BA0 A;  3MN9 A;  3L2Q A;  4KHN A;  3LPU A;  3OYE A;  1J9A A;  4W5N A;  3AY9 A;  4WQ4 C;  3DYA A;  1IKX A;  5CY4 A;  2YHX A;  4H5T A;  4FCY A;  2P9N B;  4YOX A;  1NK7 A;  3CPE A;  3HPO A;  4QS8 A;  4DU1 A;  5I3U A;  3DXM B;  3OS2 A;  4IEI A;  3RMA A;  1HJR A;  3VQC A;  2A1R A;  4IOC L;  1BQM A;  4AM7 A;  1G99 A;  5HOO A;  1M90 O;  3THX A;  2P9S A;  1OVQ A;  3ID8 A;  4C8M A;  3SQ4 A;  4B9N A;  1NMD A;  3QEV A;  5AQZ A;  3WQT A;  3CJA A;  4JKC A;  4CD3 A;  3SQ2 A;  1X9M A;  1RNH A;  1CZ9 A;  4FOI A;  2KW4 A;  3PIP L;  4B8A B;  1IG9 A;  1Q9X A;  3DRR A;  3VES A;  4JI8 K;  4F9O A;  3I0R A;  3C7N B;  1T8E A;  1X9S A;  3OHR A;  3JSM A;  4JS5 A;  1NK4 A;  3VEX A;  2A5X A;  3QFU A;  2NRR A;  4E1J A;  2FBX A;  4AHS A;  4ELU A;  3ZX2 A;  3TSQ A;  4JHD A;  1VRU A;  3HM8 A;  4CHN A;  4GKJ K;  2FLO A;  1S1V A;  4BQZ A;  4PL8 A;  2GBZ A;  5C25 A;  5HRS A;  3ZT3 A;  3OYB A;  3CF5 L;  2E4L A;  1LAV A;  2O8E B;  5KGW A;  3MK6 A;  5J2P A;  4YOY A;  2DY4 A;  1RDC A;  3CJ1 A;  3PLA A;  4KB1 A;  1ESV A;  3DLR A;  3E9P A;  3EN9 A;  5AQF A;  3W3D A;  4XH5 A;  4IO9 L;  2VWB A;  2HHS A;  5C15 A;  3HP6 A;  4LSN A;  4ELV A;  3QIN A;  5SZT A;  2RKI A;  1ASV A;  1U04 A;  4AF1 A;  4BE2 A;  1YHQ N;  3VGM A;  2G8K A;  2VQE K;  1T3V A;  2YNH A;  4CJF A;  1JLB A;  2FSN A;  1TKZ A;  3LDS A;  3WNG A;  1NGG A;  2VG7 A;  4H4M A;  3MXI A;  4DQP A;  2YHW A;  2QWR A;  3T1Y K;  2IGI A;  1VQ5 N;  2YX6 A;  3E01 A;  5I42 A;  3A5O C;  3MEC A;  3QEI A;  1C0U A;  2BTF A;  3SJJ A;  5FPE A;  1GLA G;  3AAR A;  4CD1 A;  4ILH A;  3O9R A;  3HST B;  3J7Z O;  1V4T A;  3HVT A;  4FJM A;  4F4K A;  1VQL N;  1WAF A;  5AJ3 K;  4GW6 A;  3WNF A;  5KTQ A;  4NB4 A;  2HHU A;  4WQ5 A;  1BO5 O;  3I55 N;  2I7N A;  4B1U B;  5GAH P;  2BGG A;  4BR4 A;  1YUW A;  3NH2 A;  2RHK A;  1HKC A;  4GVE A;  3VEN A;  4CGJ A;  3LWL A;  2HBL A;  1KQS M;  4B1X B;  4DV1 K;  3O4W A;  4CEO A;  1I94 K;  3QLH A;  1HKB A;  3WUH A;  3D6R A;  1R0A A;  1O1W A;  1YI2 N;  4FM0 A;  4BC3 A;  2E1Y A;  2QWQ A;  1RT3 A;  3AVB A;  4CEB A;  4BRQ A;  3TTC A;  4KH5 A;  1JLQ A;  2E20 A;  2IVO A;  4DV0 K;  4E19 A;  5J2M A;  1UA0 A;  3NF9 A;  1C0G A;  3OBY A;  4L3Q A;  1RTI A;  4IKF A;  3WQU A;  5AQR A;  2PFU A;  1NGF A;  1NJY A;  4MQ3 A;  3T1H K;  4KHS A;  4L8R B;  2P1J A;  4ID5 A;  3PO4 A;  4MO4 A;  3TAN A;  3A0I X;  1H1V A;  1XHZ A;  3THW A;  4C1N K;  3ULE B;  4FL9 A;  1QSY A;  4Y1C A;  2Y1I A;  4FWQ A;  3Q7C A;  3WEE B;  4DB3 A;  2W40 A;  3PO5 A;  4KHP K;  2NLX A;  5KQD A;  4BRE A;  3JAM O;  4KTW A;  3L4Q A;  1P90 A;  3E9L A;  1HYZ A;  1TKD A;  2QTD A;  3EY1 A;  2YHB A;  1KXP A;  3CCR N;  5HLF A;  1Z25 A;  3KD5 E;  3J7A P;  4W5Q A;  1MDU B;  4EHU A;  1JCE A;  3EYZ A;  1R59 O;  1TL1 A;  3U6F A;  4KPY A;  1X1P A;  4BC4 A;  3LWM A;  4IWV A;  4JEP A;  2G8I A;  3NGI A;  5EX5 A;  3LDO A;  3O5B A;  3WXK A;  4ICL A;  4E7J A;  2ASM A;  3O9S A;  3PV8 A;  4O55 A;  1NG9 A;  4U67 L;  3AVI A;  2WFB A;  4BRM A;  5AQV A;  1XI1 A; 
#chains in the Genus database with same CATH homology
 3VEZ A;  2NRH A;  4FVU A;  1YJN N;  3H3N O;  5C0Y A;  2OTL N;  2IVN A;  3CQX A;  4MDA A;  4BC2 A;  2P9P A;  1KC8 O;  3ZX3 A;  4CZK A;  5CR4 A;  1QVF M;  1VQO N;  5AQI A;  1Z6R A;  5F2R A;  4DCH A;  5GIN A;  4BRF A;  2KLA A;  4XH1 A;  5TKY A;  3TU5 A;  4BR2 A;  5BN9 A;  3CPW M;  2GEM A;  3OA9 A;  3EKU A;  4A2A A;  3MN5 A;  4PHT X;  2NNW A;  4XH4 A;  1JCG A;  3MWT A;  3GL1 A;  2P9K A;  3CHW A;  1DKG D;  3MN7 A;  5M1P A;  3SJH A;  4CBW A;  2GUP A;  1YIJ N;  4WFB L;  3O1W A;  2WC9 A;  2F9W A;  2BH1 A;  2ZGY A;  1JJ2 M;  3GOI A;  2V51 B;  3WXI A;  5FPM A;  4CZJ A;  4H0O A;  3F9M A;  1MWM A;  1Q7Y O;  1GLF O;  4EIA A;  2NZT A;  3VET A;  4BR7 A;  5I9E B;  3LM2 A;  5BPN A;  2V52 B;  1NGH A;  4JK7 A;  3A5L C;  4WFA L;  5KQ8 A;  1K8K A;  4B1Z A;  2HF3 A;  1IJJ A;  4K25 A;  1QQN A;  2F9T A;  4FWM A;  3MCA B;  1NGD A;  5GIP A;  5AQY A;  3L6Q A;  4HWI A;  4WCE L;  3FZK A;  4JKE A;  2HBK A;  4FWO A;  3JXU A;  1SAZ A;  4YOR A;  3T69 A;  3SAH A;  3ZET A;  4JKF A;  3K9J A;  3DLL L;  1ZC6 A;  2VGN A;  4RCH A;  4A2B A;  2NRT A;  3FZL A;  4M7X A;  3SBT A;  2A6A A;  4UY8 O;  2HBJ A;  1NJI O;  1M1K O;  3O9Q A;  1ZBS A;  5AQP A;  2VYP A;  2QM1 A;  1TUY A;  1O13 A;  2DPN A;  1HUX A;  3DWL A;  3L0Q A;  3Q7B A;  4FWK A;  4OPA A;  4A5A A;  5M1K A;  3FLC O;  2OTJ N;  3DXK A;  5BN8 A;  3MCP A;  3FFK B;  3HOS A;  4CBX A;  4GY2 B;  3NVK A;  2GTD A;  4H03 B;  5AQW A;  5GAE P;  3D2F B;  3CCM N;  3CC7 N;  3G71 N;  4JKB A;  3R9P A;  3CC2 N;  5AQG A;  1T6C A;  3MX2 A;  4IJN A;  4PKG A;  4JN4 A;  1NBW A;  3LL3 A;  2UYT A;  1X3M A;  4JK8 A;  3CXC M;  5AZJ B;  2YI1 A;  4FWR A;  3NMU A;  5KPT A;  5AQU A;  3HZ6 A;  2ZGZ A;  4WFN L;  5BR9 A;  2E2N A;  2OAN A;  2QW9 A;  2E2P A;  3C6H A;  4KH4 A;  3M5R A;  4A61 A;  4CZI A;  1NGI A;  5F0X A;  2A42 A;  2E2Q A;  5KPR A;  3CJC A;  3VEW A;  3KWG A;  4B9Q A;  4IDH A;  5AQS A;  3M1F A;  5AR0 A;  3VTH A;  5MLC Q;  5C2F A;  4FWL A;  4BY9 C;  2QEX N;  4CZF A;  4LC9 B;  4YDU A;  3QB0 A;  2RE2 A;  5B8H A;  3BF1 A;  2Q1N A;  3CJ7 A;  2Q97 A;  2FSK A;  1DT9 A;  2E88 A;  1QZ6 A;  3GBT A;  4FWS A;  2CGK A;  3SBG A;  3C0B A;  3L4I A;  1W2B M;  3EL2 A;  3H45 C;  3VPZ A;  2P9K B;  2HST A;  4IJA A;  4MLE A;  2ZJP L;  1ATR A;  3E66 A;  4BVO A;  4OPH A;  4JKG A;  4BRL A;  3ZEU B;  3EO3 A;  1HPM A;  4IOX A;  2YCH A;  3E1Y A;  1YJ9 N;  1J6Z A;  4H0T B;  1T44 A;  2Q2R A;  4K43 A;  4BRC A;  3UE5 A;  2E8A A;  3MN6 A;  5FPN A;  4BVP A;  2JWK A;  1XQS C;  1X3N A;  2ASO A;  5H1S Q;  2NRV A;  2CH5 A;  3IMX A;  1XC3 A;  4H5R A;  4Z94 A;  3VF4 A;  4B1V A;  3IUC A;  1C0F A;  2NRX A;  4KBO A;  4IFE A;  4C23 A;  4Y0W A;  3IDH A;  4CZL A;  1U2V A;  3R8E A;  3CMA N;  3ZET B;  5JLF A;  2P9U B;  3DXM A;  3HRG A;  4O5F A;  4YDU C;  5EVZ A;  1P8Z A;  3OW2 M;  1TUU A;  3O6W A;  1VQP N;  3SLC A;  1T6D A;  5GAG P;  3CI5 A;  3E9O A;  2ZF5 O;  3FR0 A;  3IKM A;  3O1B A;  3UKR B;  5AQL A;  1YVN A;  3ENH A;  5HL7 L;  3CJB A;  3KWI A;  4IZ9 A;  1N8R O;  1V4S A;  3A8Y A;  4JAX A;  1K9M O;  3NVM A;  3O9T A;  4O8K A;  3G4S N;  3KHY A;  3TPQ A;  5BPM A;  5F1X A;  2Q0U A;  4BRO A;  2P9I A;  3D2E A;  3C7N A;  4A57 A;  3CER A;  3CCJ N;  3KVG A;  3MMV A;  5ADX H;  4RWT A;  1U6Z A;  3FGU A;  1QQO A;  2ASP A;  1RFQ A;  4A5B A;  3D7E O;  3CET A;  4MDB A;  2P9L B;  2JWL A;  5LJW A;  3WEE A;  4FWP A;  3ENB A;  4WQ4 A;  3P38 A;  4ISF A;  4JNE A;  1SQK A;  4FOE A;  1Q86 O;  4BRI A;  3VGL A;  5LJV A;  4O8U A;  5LY3 A;  4JD2 B;  3LM9 A;  1DEJ A;  3CCE N;  1YXQ A;  5AQQ A;  1D4X A;  3QBX A;  1GLC G;  4CZE A;  1KAZ A;  4BRG A;  4H0X B;  4JKA A;  1Y64 A;  3S41 A;  3MX5 A;  4GNI A;  4G9Z A;  1SS6 A;  3UKU A;  1E4F T;  1Q18 A;  1JCF A;  3BUZ B;  5AQN A;  3FE1 A;  5ADX A;  1IG8 A;  4BRA A;  1GLB G;  4DHY A;  3QBW A;  1NLV A;  2VCP A;  2FSJ A;  3FZH A;  1Q82 O;  3ATV A;  2GX9 A;  3QDK A;  4BG8 A;  1NGE A;  3ID6 A;  3LDL A;  4QS9 A;  5E26 A;  5JVG L;  1TYQ A;  4AM6 A;  2YJF A;  4H5V A;  2QI2 A;  1YJW N;  2QXL A;  3CJ9 A;  3R1X A;  3WT0 A;  4DKW A;  1X9J A;  2KKZ A;  3EE8 A;  3AAQ A;  3TTD A;  5AQH A;  1BDG A;  3LDN A;  3W0L A;  1S3X A;  4IO8 A;  3U4L A;  5BRF A;  2HMP A;  3HTV A;  4JKH A;  1OVY A;  1BOT O;  1BA0 A;  3MN9 A;  4QS7 A;  4B1W B;  1GLJ O;  3N4P A;  1KD1 O;  2IIR A;  2HBM A;  3AY9 A;  2NRW A;  4WQ4 C;  5ELZ A;  2QWO A;  3B8A X;  1RGI A;  2YHX A;  3MWP A;  4H5T A;  1ILY A;  4HTL A;  4CI6 A;  2P9N B;  1U2V B;  4GV6 A;  3JS6 A;  4YOX A;  3CCQ N;  3CPE A;  4QS8 A;  1K8A O;  3CQY A;  2FF3 B;  3DXM B;  3FZM A;  3QML A;  4NLC A;  3SK3 A;  1CZA N;  1LOT B;  4IEI A;  3K9K A;  4CJ7 A;  5BRD A;  3PIO L;  1QVG M;  1DGK N;  5TKW A;  2CGJ A;  4KH6 A;  4IOC L;  5AQJ A;  5C10 A;  2P9P B;  4GV9 A;  4AM7 A;  1G99 A;  5HOO A;  3F5T A;  2D0P A;  1GLE G;  1M90 O;  2P9S A;  3ID8 A;  2A41 A;  4ISG A;  4WYB A;  1QHA A;  3C6A A;  3I33 A;  1WUA A;  1NMD A;  4BRN A;  1VQ9 N;  5AQZ A;  3WQT A;  3CJA A;  4JKC A;  4CD3 A;  1QQM A;  2WUS A;  4FOI A;  4I6M A;  3PIP L;  1NM1 A;  2QWP A;  4H0Y B;  4NLB A;  5BRH A;  2P9I B;  2ZJQ L;  4BC5 A;  3VES A;  5C12 A;  2V7Y A;  4F9O A;  1Q81 O;  5JIC A;  3C7N B;  4FPB A;  3P4I A;  5E84 A;  3VF2 A;  4PKH A;  3GDQ A;  5JLH A;  5KPZ A;  4BR5 A;  5C2D A;  3ZYY X;  3SAG A;  1GLL O;  3OHR A;  1BG3 A;  1KAX A;  4XEI A;  3TSU A;  2PBD A;  3H6E A;  2I7P A;  2V7Z A;  3VEX A;  1K8K B;  1E4G T;  2A5X A;  3QFU A;  3VMF B;  2NRR A;  4E1J A;  4H5W A;  1SZ2 A;  4PKI A;  4B1Y B;  1Z05 A;  3TSQ A;  3ZX2 A;  4JHD A;  3CCV N;  5CHI A;  3J8A A;  4U7B A;  3HM8 A;  3TSP A;  1VQK N;  2FLO A;  5M1F A;  3CC4 N;  1S72 N;  4BQZ A;  3D2F A;  2E2O A;  3BEX A;  4PL8 A;  5EXW A;  3G25 A;  1W97 L;  3G6E N;  1RDU A;  4IOA L;  2BUP A;  4A59 A;  3CF5 L;  1YIT N;  3HSC A;  3MK6 A;  4YOY A;  4JKD A;  3CJ1 A;  3HBT A;  4FSV A;  3PLA A;  2IVP A;  1ESV A;  3BF3 A;  3E9P A;  3EN9 A;  4EFH A;  5AQF A;  4BG9 A;  2J4R A;  3W3D A;  3H3O B;  3DXK B;  4XH5 A;  4IO9 L;  1NGB A;  2VWB A;  3I8B A;  5AQO A;  3U9Z A;  3WXM B;  2QWN A;  2A3Z A;  5C15 A;  3EZW A;  3FZF A;  2FXU A;  2GWJ A;  2YJE A;  4K41 A;  4A62 A;  3AGR A;  3MDQ A;  4AF1 A;  2CH6 A;  1YHQ N;  2VGM A;  3VGM A;  4BGB A;  4H0P A;  4ILJ A;  1T3V A;  4BGA A;  2YHY A;  3ULE A;  2FSN A;  4CZG A;  1NGG A;  3ATU A;  2ZWH A;  3HI0 A;  1YAG A;  3LDP A;  3QFP A;  4BRP A;  1EO1 A;  1BA1 A;  2Q31 A;  2YHW A;  2QWR A;  2Q36 A;  5CE3 A;  2HF4 A;  3EKS A;  2YX6 A;  1VQ5 N;  3RSE A;  3A5O C;  1ATN A;  5DM7 L;  3CCU N;  1ATS A;  3A5N C;  1VQM N;  3H1Q A;  1VQ7 N;  2BTF A;  4BR0 A;  5GIO A;  5FPE A;  1KAY A;  1GLA G;  1YF5 L;  2H3G X;  3AAR A;  3T7Z A;  4CD1 A;  4ILH A;  3O9R A;  4DQ8 A;  5AQK A;  1LCU A;  3H1V X;  4FWN A;  3U8X A;  1ZXO A;  3VF6 A;  3J7Z O;  1V4T A;  3ZEU A;  5AZI A;  3CIP A;  3VOV A;  1VQN N;  1MA9 B;  3P39 A;  2P9S B;  1VQL N;  4FO0 A;  4CZH A;  4M63 C;  4NB4 A;  5BPL A;  4WQ5 A;  5JMV A;  2ITM A;  4YOW A;  3VGK A;  1BO5 O;  3I55 N;  2I7N A;  5AFU H;  4B1U B;  5GAH P;  4WF9 L;  4BR4 A;  4PL7 A;  4RTF D;  1YUW A;  5M1N A;  3HOT A;  2AA4 A;  4ISE A;  4I6M B;  2RHK A;  1HKC A;  1HJO A;  3KK7 A;  4MLH A;  4M7Y A;  4GVE A;  4JKG B;  3F2K A;  3M3Z A;  4C1N I;  3VEN A;  1BUP A;  2HBL A;  2ZJR L;  2P9U A;  5AQT A;  1KQS M;  4B1X B;  1S22 A;  2D1K A;  3O4W A;  2QWL A;  3GG4 A;  2QA4 N;  1VQ8 N;  1HX1 A;  1HKG A;  3ENO A;  1HKB A;  3WUH A;  1BU6 O;  3D6R A;  5AFU A;  4MO5 A;  5GAD P;  1RDW X;  3TTF A;  3CD6 N;  4J8F A;  3UKR A;  1YI2 N;  1GLD G;  4BC3 A;  2E1Y A;  2QWQ A;  4JHD B;  3RVC A;  3WXJ A;  4EAH D;  4R79 A;  3CME N;  4FPA A;  4GV3 A;  4BRQ A;  4YOU A;  3TTC A;  4CBU A;  4KH5 A;  3BP8 A;  4IEE A;  3UB5 A;  1VQ4 N;  2E20 A;  2IVO A;  2A40 A;  3VER A;  1C0G A;  4H0V B;  3LDQ A;  5AQV A;  5DM6 L;  4CZM A;  3OBY A;  2E1Z A;  2NRZ A;  4L3Q A;  2GEL A;  5EOY A;  3CCS N;  3EE9 A;  3IFR A;  4H5N A;  2GWK A;  5AQR A;  4WQ5 C;  2PFU A;  1NGF A;  3VTI A;  2P9L A;  3WQU A;  2D0O A;  3CCL N;  5FPD A;  1BWF O;  3VEV A;  2HOE A;  2EWS A;  3QIC A;  2QWM A;  4MO4 A;  2Q0R A;  2D4W A;  3C65 A;  3WXL A;  2AP1 A;  1VQ6 N;  4JD2 A;  1HLU A;  1NGC A;  5M1O A;  2PAV A;  3A0I X;  1H1V A;  3AGK A;  2FF6 A;  3A5M C;  3VEO A;  3D2E B;  4JK9 A;  4BQL A;  4C1N K;  4K42 A;  3R6M A;  3SMS A;  3ULE B;  4FL9 A;  4FWQ A;  3OBW A;  3O9U A;  3Q7C A;  5M1Q A;  2CGL A;  2WBN A;  3WEE B;  4DB3 A;  2W40 A;  3SAF A;  4IXC A;  3O80 A;  2NLX A;  5KQD A;  3RSE B;  3ZX0 A;  4BRE A;  1OKJ A;  3L4Q A;  1P90 A;  3E9L A;  3P31 A;  3GE1 A;  3O08 A;  1NWK A;  2QTD A;  3KZB A;  3R3L A;  4OO1 J;  1KXP A;  2W41 A;  4BRD A;  3CCR N;  4BR9 A;  1NGJ A;  4YOT A;  3DAW A;  3M6G A;  1MDU B;  3UKU B;  3DJC A;  3N4Q A;  5AZI B;  1WOQ A;  5AQM A;  3H46 O;  4EHU A;  1JCE A;  1QZ5 A;  3SMP A;  4ILG B;  1R59 O;  4EHT A;  5EY4 A;  4BC4 A;  4BRH A;  3VEY A;  5AZJ A;  4IWV A;  4JEP A;  1K73 O;  1TYQ B;  1MWK A;  5BRE A;  5EX5 A;  3LDO A;  3O5B A;  3U9D A;  3AAP A;  1NGA A;  3WXK A;  1XUP O;  5JVH L;  2KHO A;  2ASM A;  4YOV A;  5AQX A;  3O9S A;  3I56 N;  2F7T A;  2P9N A;  4BRK A;  4U67 L;  1VAZ A;  2WFB A;  3O8M A;  4BRM A;  1EQY A;  4NO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...