3DJCA

Crystal structure of pantothenate kinase from legionella pneumophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
255
Chain Sequence
LILCIDVGNSHIYGGVFDGDEIKLRFRHTSKVSTSDELGIFLKSVLRENNCSPETIRKIAICSVVPQVDYSLRSACVKYFSIDPFLLQAGVKTGLNIKYRNPVEVGADRIANAIAATHSFPNQNIIVIDFGTATTFCAISHKKAYLGGAILPGLRLSADALSKNTAKLPSVEIIKTESVVGRSTIESIQSGVYYGVLGACKELIQRIHHEAFNGDQILILATGGFASLFDKQGLYDHLVPDLVLQGIRLAAMMNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Crystal Structure of Pantothenate Kinase from Legionella Pneumophila
rcsb
source organism Legionella pneumophila subsp. pneumophila str. philadelphia 1
molecule tags Transferase
total genus 75
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2008-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3djcA01
4EAHD 2Q0RA 1LOTB 4IJNA 3LDNA 4BRDA 5AZJB 4KBOA 5BPMA 4EHTA 5AZIA 2FF6A 3QFUA 4XH5A 3WEEB 5LY3A 2P9NA 3U8XA 5BR9A 4RCHA 1MDUB 2V51B 2FLOA 1TUYA 3CJ1A 3G25A 4FOEA 2YJFA 5B8HA 3UB5A 4BRGA 5AQLA 3FLCO 4FWMA 4BC5A 3VOVA 3SK3A 5AQVA 3TU5A 2A42A 4CZKA 2P9KB 4BGBA 1ZXOA 2Q36A 1YVNA 3VETA 3VGKA 1DKGD 4GY2B 1LCUA 3FZHA 3D2FB 3MN6A 5AFUH 1QQNA 1GLEG 2IIRA 4NB4A 4MLEA 3GBTA 2A3ZA 5EOYA 1QZ5A 1X3NA 4FPAA 5F0XA 5BN9A 4CBWA 1V4TA 3MMVA 4BQLA 5AQXA 3IFRA 2IVOA 5KPTA 5LJVA 2P9UA 4I6MB 4Y0WA 5AQIA 5JLHA 4B1UB 4A2AA 3ATVA 2AP1A 5JMVA 3CI5A 3HI0A 4MO5A 5KQDA 2Q2RA 3ZX0A 4B1YB 1NGBA 3WXJA 3VENA 2V7ZA 4PKIA 3MN5A 3FZKA 3DXMA 3L0QA 4JNEA 5EX5A 3D2EA 1G99A 5AQTA 2GELA 3TPQA 3UKUA 3WXKA 4JHDB 4WYBA 1J6ZA 2D0OA 4K43A 4BR9A 4WQ4A 1HKBA 2BUPA 3VERA 5E26A 4BRLA 3WQUA 3H45C 4CBUA 2HOEA 4O8KA 3WQTA 2UYTA 2V7YA 4WQ5C 5EVZA 1YAGA 1NWKA 2W40A 2P9SA 4BRNA 5AQWA 4BR7A 2GWKA 1V4SA 1RFQA 2ZWHA 3A8YA 3LDPA 1E4GT 1QZ6A 3QBXA 1YXQA 3AAPA 1BWFO 2E1YA 3IUCA 4MO4A 1IG8A 3VEYA 4JN4A 4AM7A 3L4IA 4CZGA 1KAZA 1HX1A 2A40A 4H5RA 1MWKA 3SMPA 4BC4A 4DQ8A 5AQSA 4CZIA 3CETA 3ZETA 3BUZB 1D4XA 1ZBSA 1KXPA 3FZFA 3WUHA 2E2NA 4Z94A 3U9DA 1TYQA 4FWLA 4B1XB 1XQSC 1GLAG 4BQZA 1ATSA 1NMDA 4CI6A 1ZC6A 3VEVA 1GLDG 3VGMA 1NGAA 3GDQA 3IMXA 3QB0A 2CGJA 3MN9A 5BRHA 4BC3A 1QQOA 2D4WA 1DGKN 1RDWX 1GLBG 3M1FA 1MWMA 3ATUA 1BA1A 1HUXA 1OKJA 3S41A 2P9IB 1NGJA 2QWOA 4H5NA 4IXCA 4CD3A 1BU6O 3BF3A 4IO8A 5FPNA 3A5NC 1GLLO 4BC2A 3P4IA 4HWIA 1T6CA 3CHWA 2A41A 4ISGA 3EN9A 5BRFA 4H5WA 2CGKA 4H5VA 4MLHA 3FZMA 2F9WA 2QWLA 3D2FA 2ASPA 4EIAA 3FFKB 3CJ7A 5TKYA 3VF2A 1JCEA 1JCFA 1GLFO 1BDGA 3A5LC 3EKSA 3DJCA 3OHRA 4A2BA 2ASMA 3R6MA 3ULEB 3MCPA 5FPEA 4B1VA 2ASOA 3DXKA 5AQUA 5BPNA 5AQYA 1T6DA 5CE3A 1U2VB 1SZ2A 2I7NA 3RSEA 3ID8A 1HKCA 1NBWA 5EY4A 4BR2A 3IDHA 2Q0UA 4I6MA 3GL1A 2QXLA 1MA9B 1ATNA 2P9LA 5AZIB 2P9NB 3AY9A 2PAVA 3BP8A 1NGFA 3J8AA 1NGIA 3O1WA 2GWJA 5AQPA 3EO3A 4BGAA 3LDOA 4JD2B 2CH6A 4XH1A 3LM9A 3WXLA 3MK6A 3R9PA 3O1BA 2Q97A 3O6WA 4L3QA 2D0PA 4BRCA 2HF3A 4J8FA 1NGHA 5JLFA 4H0VB 3GG4A 2YHWA 1HJOA 3WT0A 3VF4A 4BREA 1WOQA 4BRIA 4C23A 4CZFA 5ADXA 1BO5O 4PKGA 3UE5A 3JS6A 5AR0A 4FWSA 4E1JA 3O08A 4QS8A 3C7NA 1YUWA 4WQ4C 5BPLA 3ZEUA 3CERA 3CJBA 4AM6A 2E2QA 4BR0A 1GLCG 1KAXA 1R59O 5EXWA 2P9UB 2FSJA 3ENHA 3H3OB 3FE1A 4K41A 4BRPA 2QWNA 1K8KA 1ATRA 4M63C 4QS9A 2GUPA 5FPMA 3VGLA 2E88A 4BRMA 4B1WB 2P9PA 3JXUA 4B1ZA 3D2EB 1H1VA 1X3MA 4YDUA 3VEWA 2YJEA 3LL3A 4HTLA 3O80A 3AAQA 3DWLA 1Z6RA 3U4LA 3UKUB 5FPDA 3I33A 4IWVA 4DB3A 4GNIA 2FSKA 3QFPA 1BUPA 3L6QA 2D1KA 4BG8A 4BR5A 4XH4A 5ELZA 1E4FT 2E20A 4H5TA 2P9SB 4A61A 5AZJA 3VEZA 4DCHA 4EFHA 2NLXA 2V52B 2PBDA 3WEEA 4O5FA 3CQXA 4CZEA 4FWRA 1S3XA 5AQGA 1SAZA 4EHUA 3WXIA 4FWOA 3GOIA 3HSCA 1P8ZA 4F9OA 1NGCA 4FSVA 4BRFA 2GEMA 1QHAA 2DPNA 3AARA 2BTFA 2P9KA 4BVOA 3ZX3A 3BEXA 4M7XA 1Q18A 1S22A 4BRQA 3KZBA 5BREA 1WUAA 3H46O 3ZETB 4ISEA 2QWPA 5AQZA 4BVPA 2ZGYA 4ISFA 2H3GX 4BRHA 3H6EA 2VYPA 3H1QA 4FWNA 1TYQB 3O5BA 4BRKA 1NLVA 2W41A 3UKRB 2IVPA 4K42A 4CZMA 3M3ZA 3O4WA 2ITMA 2GTDA 2YI1A 3EZWA 5AQKA 4FWPA 3VEXA 1RGIA 3VPZA 4JD2A 3HTVA 1NGEA 2EWSA 2OANA 3SLCA 2FSNA 2ZF5O 4H03B 5JICA 3KHYA 3FZLA 2QM1A 3LDQA 4H0YB 3W0LA 2YHYA 1XC3A 4FPBA 1Z05A 2HMPA 3I8BA 2Q31A 1QQMA 4FOIA 3LM2A 3GE1A 4JHDA 1HLUA 5AQQA 1C0GA 3ZX2A 4DHYA 3QBWA 4BRAA 3HZ6A 1NGDA 5BRDA 5KQ8A 2FXUA 3DXKB 4CZJA 4H0PA 3FGUA 2E1ZA 1HPMA 4K25A 5I9EB 4BG9A 3C0BA 3RSEB 4BR4A 1BOTO 4RWTA 2FF3B 3CJCA 5AQHA 1DEJA 3CJAA 3A5MC 2E2OA 2WUSA 3VESA 1U6ZA 4FWQA 2P9LB 4JAXA 1JCGA 3CQYA 2I7PA 3CIPA 4B9QA 3O8MA 5AQOA 4CBXA 4QS7A 3ENOA 2KHOA 1GLJO 1HKGA 4H0TB 4NO7A 1IJJA 3FR0A 2J4RA 3H3NO 1BA0A 3M6GA 5F2RA 2CGLA 5E84A 2CH5A 3EKUA 4CJ7A 1CZAN 3F9MA 2AA4A 3BF1A 4FO0A 3DXMB 2QWMA 2YHXA 1TUUA 4YDUC 3B8AX 2E8AA 4CZLA 3D7EO 2VWBA 4WQ5A 3SMSA 2QWQA 3C7NB 3HM8A 3H1VX 1X9JA 3W3DA 1NGGA 5LJWA 5AQNA 2NZTA 4H0OA 3ZEUB 4XEIA 2QWRA 2Q1NA 1Y64A 3QICA 1SQKA 4BROA 5F1XA 2E2PA 5AQMA 5AQRA 4M7YA 4PL7A 3VF6A 1ESVA 5AQFA 1XUPO 2VCPA 3A0IX 1NM1A 4H0XB 4PKHA 2P9IA 1EQYA 3A5OC 4CD1A 1K8KB 5AFUA 5BN8A 3DAWA 2A5XA 5KPZA 5ADXH 1T44A 4RTFD 2YCHA 1BG3A 2P9PB 3U9ZA 1KAYA 2ZGZA 4LC9B 4PL8A 4FWKA 2A6AA 4CZHA 3R8EA 2F9TA 3CJ9A 5AQJA 3QMLA 4IZ9A 3SJHA 3MDQA 3VEOA 2NRHA 3ULEA 2IVNA 2HF4A 4IJAA 3MN7A 4FL9A 5KPRA 3KVGA 3UKRA 3HBTA 4A62A 2QW9A 3EL2A 3QDKA 1U2VA 3LDLA 1C0FA
chains in the Genus database with same CATH superfamily
4EAHD 2Q0RA 3KK7A 3DRRA 4IJNA 1SKRA 1RT5A 4X62K 3RR7A 5AZIA 2FF6A 4CHNA 3SUOA 1L3UA 4JKHA 3CQ8A 1FW6A 4KB1A 1KRPA 5BR9A 1MDUB 4JYAK 3I0RA 5JS1A 4M3TA 1O13A 4FWMA 4IFYA 1TK8A 4JI3K 3TU5A 3SZ2A 4FJ8A 3L2UA 2P9KB 3LANA 1ZXOA 2B6AA 1EX4A 3VGKA 1DKGD 4V19S 1N32K 4CHOA 5AFUH 4KFBA 3DLRA 1VQON 4CJEA 3F2KA 1WSJA 3OYMA 2G8IA 1QZ5A 5F0XA 4CBWA 1GOBA 1YTAA 3J7ZO 3C95A 4B1UB 3DYAA 3ATVA 3DLGA 5JMVA 4DV3K 2ZQBA 4O8UA 4YNQA 3FZKA 3S3NA 4FJ9A 3LAMA 4DSLA 3ITHA 2A1RA 1Z26A 3QEXA 2GELA 4CEOA 2BE2A 3J7YP 2OPSA 3HP6A 1ZBIA 4CF2A 3LPUA 4CIGA 2BUPA 4MDBA 1JLGA 5DK5A 4YY3K 3WQUA 4CBUA 1WSEA 4CFCA 4O8KA 2HNDA 2W40A 4DQQA 3AVLA 5AQWA 3WXMB 1D5AA 1OVQA 1V4SA 3P38A 4KKOA 4IKFA 3BZCA 4DFPA 1EETA 3L2WA 1QZ6A 1YXQA 5M1FA 3AAPA 2E1YA 3CM5A 1EXQA 3MWPA 5M1PA 5FRMA 4AM7A 3FFIA 3NF7A 1NK7A 4GVMA 3PO4A 4BC4A 4DQ8A 2O8FB 3HXMA 3E9OA 5GIOA 3ZETA 2E5LK 3LP1A 3SQ2A 4DV4K 4Z94A 4B1XB 4BQZA 3J81O 3Q7BA 1TKZA 4JRPA 1NGAA 2KFZA 2KW4A 3QB0A 3MN9A 5BRHA 5H1SQ 1QQOA 1RDWX 4FLUA 3M1FA 3ATUA 3MEEA 3OYHA 2UUBK 4B9TA 4BDZA 4KB0A 1YF5L 1B9FA 1JL2A 1M1KO 3S41A 1NGJA 3TAMA 4H5NA 1BU6O 2O8EB 3BF3A 1C0UA 3P4IA 4BC2A 4HWIA 1CZBA 1S1WA 2XY6A 3CHWA 4LY7A 5CYQA 5TKWA 1HR0K 5KGXA 2FBXA 2F9WA 3FZMA 1HMVA 4DR5K 4I2PA 3OW2M 4EIAA 3ULDA 3FFKB 3VF2A 2WC9A 3DJCA 3OHRA 2ASMA 3ULEB 1E3MA 4B1VA 3AVBA 3VA3A 2HHXA 2ASOA 5AQYA 3KLEA 3VQ9A 1ZYQA 5CE3A 1C0TA 3CMEN 4OX9K 3DM2A 3RSEA 2FBVA 2W6LA 4BR2A 4I6MA 3OYDA 3GL1A 4UQGA 1WSFA 1MA9B 5IWAK 4KO0A 3SPZA 4KHSA 2PAVA 4CJKA 3Q7CA 3NGZA 4LF4K 1QSYA 4DQIA 4R5PA 4OLAA 3VQ6A 3K9JA 2QK9A 2Q97A 4JI0K 4FYDA 4FM1A 4BRCA 1IG9A 4CEDA 3DOLA 3M5RA 2OA8A 1B92A 2WBNA 4CEEA 1WOQA 2FBTA 1S1XA 3OS1A 2KZZA 4JKFA 2ETJA 4E1JA 3O08A 3CFRA 1VSHA 1RDBA 3DMJA 5CHIA 4E19A 1IH7A 1GLCG 5EXWA 4YFUA 4GVEA 1CLQA 4BE2A 3CCQN 1A5VA 2OPRA 2VG7A 3EYZA 3RMAA 3VQAA 3FE1A 2QWNA 3AVMA 4MQ3A 1VQ5N 1JLFA 3AVCA 2GUPA 4H4MA 1VSEA 4JI8K 4FW1A 1L3TA 1O1WA 3D2EB 3VEWA 4CHZA 1VRTA 4CCHA 2BH1A 3CF5L 3O80A 2UXDK 3U4LA 3L2RA 5FPDA 4CE9A 3RMCA 2X78A 4B9MA 4GNIA 5HOOA 3OYCA 2W6KA 3PO5A 4BR5A 1C0MA 4MFBA 1E4FT 3F5TA 5AZJA 2DFHA 2NLXA 2PYJA 3LZJA 2V52B 4CZEA 4EHUA 1BQNA 1S3XA 3HO1A 3WXIA 1RCHA 1C1BA 5FDLA 4FSVA 4B8AB 1DTQA 5GAGP 1WN7A 1LV5A 2HMIA 3G6EN 2KTQA 4BVOA 4CHPA 4CJFA 3VQ7A 3SI6A 2O4IA 1WSIA 1MU2A 3KK3A 1Q18A 1S22A 1Z25A 2NRZA 3KZBA 4KH4A 4BRQA 4FCYA 3H46O 4Z4CA 1X9SA 4BVPA 3TABA 2NNWA 3H6EA 2VYPA 1TYQB 3MEDA 3D6RA 3O5BA 3HL8A 3ZT0A 1NLVA 3NCIA 2W41A 4LF5K 4DTXA 1F21A 4M42A 5HRRA 2HNZA 3EE8A 1W2BM 4FWPA 1J5OA 1NOYA 4ILJA 3TI0A 3KK1A 4CJVA 1RT1A 2YNHA 4JD2A 4CJPA 2EWSA 4RW6A 5DM6L 5JICA 1HRHA 3CC7N 3KHYA 2QM1A 3LDQA 3NMUA 3THVA 1XWLA 4FPBA 4YOUA 3OS0A 4DTOA 4I7FA 4YOVA 4DU4A 1K6YA 3DRSA 3ZT3A 4CJUA 4JHDA 1HLUA 3WNFA 3OJSA 4DHYA 1UA0A 3E9PA 2XY8A 5BRDA 3DXKB 1HYVA 4H0PA 2E1ZA 3P5JA 1HPMA 2JWKA 4FLTA 5I9EB 3C0BA 4BR4A 2Z1IA 1A5WA 3HOTA 3HP9A 4RWTA 1NKCA 4FJHA 2ITGA 2WUSA 1U6ZA 1HNXK 4KI4A 2ZM6K 2UU9K 4W5NA 1JL1A 3CIPA 3TSQA 1G15A 3CCSN 3THWB 2NRXA 4NO7A 2E6MA 1BA0A 3M6GA 1KVCA 4B3OA 3KJVA 4DS4A 3PSFA 2JGUA 3F9MA 2DY4A 2KQ2A 2PZSA 2AA4A 5J2MA 3O4QA 3AO2A 5CY4A 4FO0A 1I94K 2QWMA 4FJMA 3ZSRA 4K8ZA 3AO1A 2E8AA 3C6HA 1BQMA 3MXJA 3T1YK 1TKTA 3JYTA 1NGGA 4RW4A 4OPJA 3CM6A 4XEIA 2QWRA 4NLCA 3U3GA 1T7PA 2VG5A 3G10A 3KKSA 3CCVN 3CCRN 3VQDA 4M7YA 1ESVA 4AHVA 1XUPO 2VCPA 4GV9A 3VA0A 3A5OC 5AFUA 3AVHA 1NK4A 3OVNA 1T44A 3QINA 3V9WA 4RTFD 2KZMA 3U9ZA 3O9UA 2ZGZA 2RF2A 4RG8A 5KRTA 4CZHA 3R8EA 2F9TA 5AQJA 3QMLA 4FZYA 3ZSOA 1KCFA 3AVGA 1RTJA 3VEOA 3AGKA 3ZCMA 1ZBHA 4OPAA 2IVNA 1QHTA 1NK8A 2OPQA 3EL2A 3NAEA 3QDKA 1L3VA 1U2VA 4KREA 3TSPA 3HK2A 1B9DA 3P39A 4I2QA 4BRDA 2HBJA 3VQ8A 5LY3A 3S9HA 2V51B 2PY5A 3CJ1A 1N34K 3OBWA 3ZSZA 2YJFA 5AQLA 3V1QA 4BC5A 3SK3A 3MWTA 3DRPA 4CZKA 2ZJRL 4OKKA 1TVRA 3VQEA 1YVNA 4B08A 1BIUA 5HLFA 3VETA 3ZT2A 1ZBUA 4GY2B 3DLEA 4IEIA 3QEWA 4KHWA 1LCUA 4FVMA 2X74A 3D2FB 1QVFM 5C2FA 1QQNA 4CGIA 4FK4A 2IIRA 3KLIA 3HPHA 4DV7K 3GBTA 5EOYA 3C6AA 4FJXA 3CCMN 4KTWA 5C24A 4DG1A 2Z1HA 5BN9A 4DR6K 4DR3K 4AHTA 4I9LA 1V4TA 3MMVA 4DS5A 5AQXA 2B5JA 3IFRA 2IVOA 3THXB 2P9UA 4Y0WA 1FKPA 1XNQK 1OH6A 4H4OA 1S1TA 4Z4FA 3CI5A 4CF0A 5C2DA 3NGIA 4KHQA 1NNEA 3ZX0A 1HNZK 3QIPA 4B1YB 1RTDA 4M3WA 3K5LA 2V7ZA 3L0QA 3SQ4A 3K0SA 1OH7A 4IEEA 1VQKN 4AILC 5AQTA 3WXKA 1J6ZA 4K43A 4DFKA 3PIOL 3L3VA 4E0DA 4KH5A 1SKSA 3KTQA 1HKBA 5E26A 2HHUA 4LFCK 1L5UA 3ZSVA 3AGRA 4ILGB 1RDCA 2P9SA 4LD0A 3WNEA 1YI2N 2HHSA 3OY9A 2GWKA 2G8UA 3TWHA 1N8RO 1TL3A 4LF6K 3A8YA 3LDPA 4CGGA 5C15A 2IS3A 1BWFO 4W5QA 3IUCA 4MO4A 1IG8A 3VEYA 4JKGB 4FJ5A 4PUOA 4XIUA 1UA1A 4CZIA 3CETA 4BDPA 4RW8A 1QSLA 1HJRA 1RBSA 5AJ3K 1D4XA 1ZBSA 1KXPA 2E2NA 3QO9A 3ZLJA 1BCOA 1ZBLA 1SV5A 3VEVA 3VGMA 4E7IA 4JK9A 4NYNA 4O0JA 2CGJA 4N56A 3M8PA 4Z4GA 5FLXO 4DV1K 1BA1A 1A5XA 1HUXA 1QTMA 4EZ9A 4IXCA 4CD3A 3OYJA 2EX3A 3SBTA 5FPNA 1VSIA 1NKBA 4EP5A 3V9UA 1NK6A 5GIPA 3C65A 3MXMA 4H5WA 2CGKA 3KWIA 2YKNA 4H5VA 4W5RA 4OO1J 4IG0A 2ASPA 5KI6A 3CJ7A 5TKYA 4X66K 4JI4K 3EKSA 4M3UA 4A2BA 3I0SA 1T6DA 1RT7A 1SZ2A 3ID8A 1NBWA 5EY4A 4LF8K 3IDHA 2Q0UA 1WBDA 2QXLA 3AVKA 1IBKK 1VSFA 4FLWA 4K0KK 5AZIB 3NHGA 3SUQA 3AY9A 3NF8A 4M45A 3ZYYX 1RT4A 4HUEA 1NGFA 2GWJA 4OLBA 1T03A 3EO3A 4BGAA 3LDOA 2NUBA 4XH1A 1NJZA 3AO4A 4FZXC 1C1AA 2D0PA 4NCAA 2HF3A 3CCJN 1YTUA 4H0VB 1KQSM 1SL2A 2AJQA 2HW3A 3WT0A 1HYZA 4CZFA 2O8CA 4Y1CA 5DMRA 4JV5K 1BO5O 3TAGA 3UE5A 5A2QO 1RILA 4QS8A 5GAHP 3IS9A 2VWKA 3ZEUA 3AA2A 3AO3A 3CERA 3KIOA 3AVJA 4AM6A 2E2QA 4J2BA 4BR0A 3CCUN 2P5OA 1R59O 5LMNK 1VQLN 4BRPA 4CFDA 3OBYA 1K8KA 3VQ5A 4FJ7A 4QS9A 4OGEA 3ALYA 3MXIA 2E88A 4BRMA 1NKEA 4B1WB 2P9PA 3NF9A 4DLGA 4X65K 4CW7B 1GOCA 4JRQA 1H1VA 4HTLA 2YJEA 3DWLA 3LPTA 4DTJA 1IO2A 3SAGA 4F3TA 4ELUA 4DB3A 1VQNN 3HRGA 3QFPA 4ZTJA 1YJWN 1BUPA 2P1JA 4AHRA 1YJ9N 1IBLK 3L6QA 4KPYA 4MDAA 4RW7A 4O44A 1RDDA 2HHWA 3SPYA 3NH1A 1XI1A 4EFHA 4YOXA 4IO9L 3E9LA 3WEEA 3CQXA 3C94A 4FWRA 4AHCA 4M3XA 4FWOA 4KAZA 3GOIA 1P8ZA 4F9OA 5M1OA 4DR1K 1QQCA 3QEVA 1K9MO 2ATQA 5J2QA 2O8BA 3ZX3A 3SBGA 4ID5A 2KFNA 1SUQA 3TTFA 2DFFA 5FROA 5BREA 1WUAA 3ZETB 2QWPA 5AQZA 1QVGM 2ZGYA 1N36K 3AA4A 4CJ4A 4FJGA 2H3GX 4FM2A 2RPIA 4U67L 4W5TA 2RKIA 3B6OA 3HSTB 3ZSWA 1TV6A 1WLJA 1QSSA 3BZKA 3K59A 3M3ZA 5I42A 2GTDA 2YI1A 3EZWA 5AQKA 4IFEA 3VPZA 4LF7K 4LH4A 4CEBA 2OANA 1C6VA 4B9NA 4KHNA 2FSNA 2ZF5O 4H03B 3W0LA 4LF9K 1UOCA 1IKWA 3VTIA 4L8RB 4CIFA 1JXBA 4C1NK 1KLMA 4CVNE 3DOKA 2XO7A 4WE1A 1C0GA 3ZX2A 3QBWA 4BRAA 3FGUA 4O4GA 1VQ9N 3IAYA 1RTHA 3OJUA 4BG9A 3PX6A 3RSEB 1S72N 1BOTO 3CJCA 4C1NI 3PLAA 4CJSA 4JAXA 4DFJA 3T19A 1W97L 3R3LA 4CK2A 1JCGA 1IKXA 4B9QA 3O8MA 1RT3A 4JKCA 5K14A 3CC4N 4CFAA 2CGLA 5E84A 2O8DA 1NK0A 4LH5A 3EKUA 4CJ7A 3KLGA 2DTUA 1VSJA 4OVLA 5T7BA 1XC9A 4NLBA 3DXMB 2YHXA 3PY8A 2YHAA 4CZLA 5D3GA 3D7EO 4WQ5A 5EU7A 1X9JA 3OA9A 2NZTA 4H0OA 3K2PA 2HBLA 1OH5A 2Q1NA 1Y64A 4CJQA 1I39A 3K57A 3VF6A 5AQFA 1VQ8N 1JLEA 3HPOA 4IDKA 2P9IA 1EQYA 1TL1A 5M1NA 3DAWA 2A5XA 5JS2A 5KPZA 2LSNA 1CZ9A 1FK9A 4FWKA 2A6AA 4KH6A 4WFNL 1NJWA 2P5GA 3CJ9A 3TAPA 5CZ2A 4IZ9A 5C10A 3RMDA 3TAEA 1QE1A 4FJNA 2NRHA 4M41A 2HF4A 4FL9A 5KPRA 3KVGA 5LL6Z 4DF4A 4J2DA 3T7ZA 4F2SA 3HYFA 1C0FA 2G8WA 3LDNA 4IG3A 4KBOA 5AZJB 3K5MA 5BPMA 3JSMA 2P9NA 1VQMN 2UXBK 4RCHA 4BDYA 2FLOA 4CEQA 3UB5A 3OYKA 4BRGA 4KHUA 1SL1A 5AQVA 2G8KA 1T05A 4BGBA 2Q36A 4N5SA 3CFOA 3V9ZA 4YOWA 3U6FA 1L3SA 4WCEL 1Y97A 2D0AA 4BE0A 3LAKA 3IRXA 1S1VA 3KKRA 3MN6A 3PUFA 1Q86O 1D9FA 4NB4A 1HQEA 2A3ZA 3LWMA 4FPAA 2QTDA 5SWMA 5IT9O 1NJIO 4TSXA 3I56N 2XY5A 5LJVA 1FJGK 5JLHA 5AQIA 3M8RA 4JKEA 4DU1A 4PQUA 3DLLL 3A2FA 4A5AA 4E3SA 4A2AA 4YOTA 3VQCA 3I55N 3HI0A 3SYZA 4MO5A 1RBRA 2Q2RA 1U45A 3MN5A 2G8VA 4JNEA 4J2EA 3LP2A 5MLCQ 1BIZA 3S3OA 4B3RK 1JLBA 4KTZA 2XY7A 3C6UA 3E1YA 3TPQA 3UKUA 2Z1JA 4JHDB 2WONA 4WYBA 2Z1GA 5BR8K 3SQ0A 4IBNA 1S5JA 3QESA 1TK0A 3VERA 3H45C 1YVUA 2HOEA 3WQTA 4WQ5C 3N4QA 5EVZA 2Y1JA 1DLOA 1NWKA 1HYSA 4BR7A 1YHQN 1LWFA 2ZWHA 4HVJA 3V4IA 2HHHK 4JLHA 4C8NA 1LW2A 1U04A 3IG1A 4C8MA 1W0HA 1XNRK 1K8AO 3L8BA 1T8EA 5SZTA 1JKHA 3L4IA 4JI5K 1XMQK 1HX1A 2A40A 4NCGA 3NDKA 4AHSA 2A1SA 3SMPA 4NCBA 4IOXA 3AVAA 1KD1O 3BUZB 3AA3A 3FZFA 3WUHA 3SJJA 3U9DA 4O55A 2JWLA 4FWLA 4PA1A 1XQSC 1ATSA 1NMDA 3LALA 4CI6A 3AA5X 4W5OA 1KSPA 1GLDG 2YX6A 3GDQA 1BI4A 3IMXA 1S6PA 3DLHA 3K58A 1GLBG 3P1GA 3K5NA 5HRSA 4KI6A 2F7TA 3OYFA 4LSLA 3ZT1A 4DV2K 3NH0A 3LP3A 4GKKK 2PYLA 4BY9C 5M1QA 2QWOA 2QI2A 3MCAB 5HRPA 2GBZA 3A5NC 2ZE2A 4A57A 2A41A 4ISGA 2OZMA 3EN9A 5BRFA 4Z0UA 3MECA 4CJRA 3OYNA 3D2FA 3THYA 3MX5A 3PIPL 1JCEA 3TTDA 5GAEP 1JCFA 4FJKA 1BDGA 4G1QA 1ILYA 3MCPA 4FK0A 5I3UA 3ZSQA 4CGDA 1RTIA 3ISNC 5AQUA 1U2VB 3CPWM 4DR4K 2I7NA 1HKCA 1REVA 4HHTA 4DTNA 1JLCA 3TR8A 4CF1A 1U4BA 4FVUA 1RT2A 1TAUA 4JK8A 4E89A 2P9LA 4B3SK 3AVIA 3TANA 4ZHRA 1FXXA 3BP8A 1WAJA 3O1WA 3O9TA 1NG9A 3ENBA 3LM9A 3WXLA 3R9PA 3VMFB 3KK2A 3O1BA 4J2AA 5JVHL 2VG6A 4BWJA 1NGHA 5JLFA 4HUGA 1FKOA 5KGWA 3GG4A 4AH9A 3O9QA 4BREA 4C23A 4CK3A 4CERA 3C6TA 4PKGA 5AR0A 2YV0X 4FWSA 3AV9A 5GINA 4CFBA 3PX0A 3C7NA 2WTUA 3V9XA 5C25A 5BPLA 1WB9A 1RNHA 1KTQA 4FW2A 4O5BA 2ZD1A 5J2NA 4WFBL 3V6DA 3PSIA 3CCEN 2P9UB 4JKAA 2DFEA 4G9ZA 3ENHA 1SS6A 1ASVA 4DV0K 3QERA 2OTLN 1ATRA 1BHLA 4F8RA 5FPMA 1VK0A 4A59A 2VQFK 1CXQA 2HVIA 3P83D 2HNYA 3JXUA 4B1ZA 4IDHA 4JS5A 1IKYA 2IC3A 3AAQA 1KFDA 3I33A 3O9RA 4LSNA 3KLFA 1OH8A 1DT9A 5HROA 5JVGL 4DMNA 2UUAK 1C1CA 2D1KA 4KV8A 4XH4A 5ELZA 4FM0A 5GADP 3G0ZA 3V1RA 4H5TA 2P9SB 3VEZA 4DCHA 1T3VA 3T1HK 3SCXA 1WAFA 4O5FA 3M8SA 5AQGA 1UAXA 1NGCA 1D8YA 2G8HA 3SV3A 3NFAA 4BRFA 4CGFA 3HVRA 1WSGA 3AARA 2P9KA 3HVTA 1OVYA 1R0AA 4M7XA 1LWEA 4CJ5A 4Z4EA 1WNSA 4ISEA 1ITGA 1ZBFA 4DTPA 4ISFA 4Z4HA 3H1QA 4FWNA 3N4PA 5C42A 4N76A 4BWMA 4DQSA 3ASMA 1W7AA 4YHHK 1VQPN 4BRKA 3CYMA 3UKRB 4CZMA 1WSHA 2ITMA 1RDAA 2WOMA 3VEXA 3HTVA 1NGEA 3NBPA 3RMBA 2YKMA 4DWIA 2G8FA 4F2RA 3FZLA 4H0YB 2NRWA 4CEFA 1I3AA 3I8BA 5CZ1A 2Q31A 3GE1A 4ELVA 4QOZB 3WNGA 3BGRA 5HL7L 3HZ6A 4AHUA 4FLZA 5KQ8A 2FXUA 4CZJA 1EWRA 1X1PA 4B3MK 2QXFA 4H8KA 4LFAK 1HQUA 2E2OA 4CHQA 3VESA 4DU3A 4FWQA 4WFAL 1XMOK 3KWGA 1Q9XA 4JK7A 3K9KA 4LFBK 4JI1K 4E7HA 4CEAA 5LMUK 4GW6A 4FXDA 4QS7A 1GLJO 4H0TB 1ASWA 2CH5A 1N6QA 4OGCA 1LWCA 4K8XA 4RW9A 3G71N 2O8FA 2HBMA 3VQ4A 4YORA 1TUUA 5CR4A 2O8CB 5HRNA 4FLXA 1VQ6N 3SMSA 1IV0A 4CF9A 2JLEA 3W3DA 3H1VX 4DSEA 5AQNA 1EWQA 3ZEUB 4GV6A 3L3UA 4GV3A 3LP0A 4KHYA 4DR7K 1SQKA 4O0IA 4JKBA 1J9AA 4DQRA 4IFVA 4PL7A 2QA4N 3A0IX 4PKHA 1K8KB 3CG7A 2IDOA 1S6QA 4CGJA 1RBVA 1VQ7N 2O8EA 1Q81O 4M3ZA 1TKXA 2YCHA 2Y1IA 1BGXT 4EZ6A 2OCEA 2P9PB 4B8CA 1KAYA 4LC9B 4AQYK 4PHTX 1BL3A 3CXCM 4CESA 1K73O 2YHBA 1NU0A 2Q3SA 3SAHA 3EZ5A 3SJHA 3V9SA 2HHQA 1VSMA 1EP4A 4DR2K 3D45A 3ULEA 1N5YA 3D0PA 4IJAA 1NOZA 3DLBA 3SUNA 3CFPA 4HUFA 4DTRA 4IOAL 1VQ4N 4JEPA 1JJ2M 4E1NA 1LOTB 1NMNA 1LAWA 2P51A 1VAZA 4EHTA 3SAFA 3EEQA 3QFUA 4XH5A 3WEEB 3U8XA 2X6NA 1TUYA 4FOEA 3G25A 4ID1A 4HTUA 5B8HA 4ZTFA 1SKWA 3FLCO 2KKZA 4YOYA 3VOVA 4DFMA 4JI6K 2A42A 4JI7K 2KLAA 2O8BB 2B4JA 1Q9YA 3DLKA 1XHXA 4CJ3A 1TKDA 3FZHA 4E7JA 2ZJPL 2HVHA 1GLEG 3JAMO 3U3YA 3CCLN 4MLEA 5HP1A 4R79A 2YNIA 3RRGA 4FK2A 1HNWK 1X3NA 4M3RA 2F4VK 3H08A 4N47A 3OYLA 4BQLA 5KPTA 4FLYA 4DTMA 2HHTA 4I6MB 3RVCA 3CD6N 3K5OA 1IKVA 2AP1A 3O9SA 4ELTA 5KQDA 3T69A 3KD5E 1NGBA 3WXJA 3VENA 2I5JA 4QCLA 4PKIA 3DXMA 5FRNA 5EX5A 3D2EA 4OKJA 1NK5A 4DTUA 3OYAA 1G99A 4CF8A 2IGIA 2D0OA 4BR9A 4WQ4A 3E66A 3SNNA 3QEPA 3VN5A 4FLVA 3NGYA 1GOAA 4BRLA 2PFUA 2UYTA 2V7YA 1BISA 2UUCK 1YAGA 3UIQA 3TAFA 4BRNA 1XHZA 1RFQA 2E6LA 2IAJA 4C8OA 1RT6A 1E4GT 3QBXA 3RR8A 1W9HA 1N33K 4ILHA 4GKJK 1M90O 4JN4A 3S3MA 4CZGA 4DUYK 2O8DB 1KAZA 4H5RA 4DQPA 1MWKA 3PV8A 1YT3A 5AQSA 3F9KA 3EY1A 2OZSA 2VGNA 4CJTA 2RE2A 3G4SN 3BY5A 4C8KA 5C12A 1TYQA 4B9SA 3RTVA 1GLAG 4NYFA 3BDPA 4FZZA 4E7LA 4DTSA 1ZC6A 4DSIA 4BC3A 2F8SA 2D4WA 1DGKN 2D0BA 4DSKA 5M1KA 1MWMA 4CECA 3CMAN 1OKJA 2P9IB 4C8LA 1NK9A 4ICLA 4IO8A 1GLLO 3CPEA 4QAGA 1T6CA 1JLAA 4PWDA 1S9EA 4MLHA 2QWLA 4KTQA 2FBYA 4X64K 1EO1A 4JKDA 1YJNN 2GUIA 3DI6A 5E41A 4WF9L 1GLFO 3A5LC 4F3OA 4AF1A 1Q7YO 5FPEA 4DF8A 3R6MA 2D5RA 1NJYA 4B9LA 3DXKA 5BPNA 2HHVA 3LDSA 1ATNA 4Y1DA 1YIJN 2P9NB 1U48A 1J54A 3ID6A 1EKEA 3O3GA 4Q0BA 3AVFA 3J8AA 1NGIA 1VSLA 5AQPA 1S1UA 3THWA 3NVMA 2E4LA 4CJLA 3ZT4A 3QEIA 4JD2B 3OYEA 2CH6A 2QKKA 3MK6A 3AVNA 3O6WA 4L3QA 3M8QA 2OYQA 4J8FA 3O4NA 1KFSA 5DM7L 1KVBA 3WNHA 3L2QA 4FJJA 2YHWA 1HJOA 3VF4A 1JXEA 4BRIA 5ADXA 1X9WA 3OYIA 3ZSXA 3JS6A 3KD1E 3EE9A 4F4KA 1YUWA 4WQ4C 2F96A 1U47A 3NVKA 1RBUA 4PY5A 3CJBA 1KAXA 4NXNK 1J5EK 1HPZA 4OJRA 2FSJA 2RHKA 3VQPA 4KHPK 3H3OB 4K41A 4CHYA 4M63C 2UXCK 3IKMA 4NXMK 2WFBA 3VGLA 4JS4A 2NRRA 3NE6A 1X3MA 4YDUA 3QNNA 1Q82O 2YNGA 3L4QA 3LL3A 3I8DA 4IOCL 3V1OA 2XRIA 1Z6RA 4CIEA 3PX4A 3UKUB 2VGMA 4IWVA 4KRFA 2FSKA 2D0CA 3KLHA 2QKBA 2HB5A 4B3TK 4BG8A 4OPKA 3F73A 1HNVA 5C0YA 1HNIA 2E20A 1LW0A 4Z4IA 4A61A 2PBDA 1SAZA 3HSCA 4I9QA 1VSDA 2GEMA 1QHAA 2DPNA 4M3YA 2BTFA 3SQ1A 2W42A 3BEXA 3HOSA 2GV9A 4OPHA 2VWJA 3SV4A 4N41A 3MAQA 2O4GA 2NRTA 5J2PA 4BRHA 5KTQA 1JLQA 1LAVA 2RN2A 3LWLA 3TSUA 3V81A 2R7YA 1J53A 1RDUA 3E01A 4CGHA 1BI4B 2IVPA 4K42A 3O4WA 3R1XA 3SUPA 3THXA 4E7KA 2QEXN 4U7BA 1RGIA 3HJFA 2X6SA 4CK1A 3SLCA 4Q5VA 3J7AP 4FJLA 3ZSYA 1RBTA 1X9MA 2GX9A 3B6PA 3P31A 1D9DA 2YHYA 1XC3A 2ZJQL 1Z05A 2EHGA 3THYB 5HBMA 2HMPA 4DUZK 1Q8IA 3QIOA 1QQMA 3O3FA 4FOIA 3LM2A 3MEGA 5AQQA 3NH2A 1UWBA 3VTHA 1NGDA 3OTOK 4OKEA 4DSFA 3QNOA 4K25A 2YNFA 3T1AA 3L2VA 2BGGA 2FF3B 4E1MA 5AQHA 1DEJA 3CJAA 4DLEA 3OYGA 3A5MC 3CC2N 2NRVA 2FC0A 2P9LB 3QLHA 4DV5K 2BDPA 4EP4A 1S9GA 1WBBA 3CQYA 2I7PA 2OPPA 1CXUA 5AQOA 3T3FA 4CBXA 2BANA 4DV6K 3ENOA 2KHOA 4DKWA 1HKGA 1IJJA 3FR0A 2J4RA 5CYMA 3H3NO 5F2RA 4JKGA 4B9VA 1VHXA 4UY8O 1TGOA 1CZAN 3O3HA 3OS2A 4HCCA 2F8TA 3BF1A 3QETA 2VQEK 4JI2K 3NF6A 4CEZA 4YDUC 3B8AX 3HM9A 1NJXA 4B9UA 2OTJN 2VWBA 4GMJB 2QWQA 3C7NB 3HM8A 5J1EA 5LJWA 1ASUA 3HT3A 1YITN 1KLNA 3J80O 3VQQA 4DSJA 1VSKA 5KRSA 3VQBA 3QICA 1BCMA 4BROA 1KVAA 1VRUA 1QS4A 5F1XA 2E2PA 3TARA 5AQMA 5AQRA 4CJWA 4FJIA 1NM1A 3MX2A 4H0XB 4HCBA 5BN8A 4CD1A 4BE1A 5ADXH 3AO5A 4BACA 1BG3A 1DTTA 1U49A 3RWUA 1P90A 1TAQA 4PL8A 1TK5A 3RRHA 1IBMK 1SL0A 2HSTA 2IOCA 3TAQA 3MDQA 3TTCA 3OYBA 2HBKA 4A5BA 3LZIA 1KC8O 3MN7A 3UKRA 4A62A 3HBTA 2QW9A 3LDLA 3HPGA 2XHBA
chains in the Genus database with same CATH topology
4EAHD 2Q0RA 1LOTB 3KK7A 4IJNA 3P39A 3LDNA 4BRDA 2HBJA 5AZJB 4KBOA 1VAZA 5BPMA 4EHTA 5AZIA 2FF6A 3QFUA 3SAFA 4XH5A 3WEEB 5LY3A 4JKHA 2P9NA 1VQMN 3U8XA 5BR9A 4RCHA 1MDUB 2V51B 2FLOA 1TUYA 3CJ1A 3G25A 4FOEA 1O13A 3OBWA 2YJFA 5B8HA 3UB5A 4BRGA 5AQLA 3FLCO 2KKZA 4FWMA 4YOYA 4BC5A 3VOVA 3SK3A 5AQVA 3TU5A 2A42A 3MWTA 4CZKA 2ZJRL 2KLAA 2P9KB 4BGBA 1ZXOA 2Q36A 1YVNA 4YOWA 4WCEL 3VETA 3VGKA 1DKGD 4GY2B 4IEIA 1LCUA 3FZHA 3D2FB 3MN6A 5AFUH 2ZJPL 5C2FA 1QVFM 1Q86O 1QQNA 1GLEG 1VQON 2IIRA 3F2KA 4NB4A 3CCLN 4MLEA 3GBTA 2A3ZA 5EOYA 4R79A 3C6AA 1QZ5A 3CCMN 1X3NA 4FPAA 2QTDA 5F0XA 5BN9A 4CBWA 1NJIO 1V4TA 3MMVA 4BQLA 5AQXA 3I56N 3IFRA 2IVOA 5KPTA 5LJVA 2P9UA 4I6MB 4Y0WA 5AQIA 5JLHA 4JKEA 3RVCA 3J7ZO 4B1UB 3DLLL 4A5AA 3CD6N 4A2AA 4YOTA 3ATVA 2AP1A 5JMVA 3I55N 3CI5A 3HI0A 3O9SA 4MO5A 5KQDA 5C2DA 3T69A 4O8UA 2Q2RA 3ZX0A 4B1YB 1NGBA 3WXJA 3VENA 2V7ZA 4PKIA 3MN5A 3FZKA 3DXMA 3L0QA 4JNEA 5EX5A 3D2EA 5MLCQ 1G99A 4IEEA 1VQKN 5AQTA 2GELA 3E1YA 3TPQA 3UKUA 3WXKA 4JHDB 4WYBA 1J6ZA 2D0OA 4K43A 4BR9A 3PIOL 4WQ4A 3E66A 4KH5A 1HKBA 2BUPA 3VERA 5E26A 4MDBA 4BRLA 3WQUA 3H45C 4CBUA 2HOEA 4O8KA 3WQTA 2PFUA 2UYTA 3AGRA 2V7YA 3N4QA 4ILGB 4WQ5C 5EVZA 1YAGA 1NWKA 2W40A 2P9SA 1YI2N 4BRNA 5AQWA 4BR7A 3WXMB 1YHQN 2GWKA 1V4SA 3P38A 1RFQA 1N8RO 2ZWHA 3A8YA 3LDPA 3CF5L 5C15A 1E4GT 1QZ6A 3QBXA 1YXQA 5M1FA 3AAPA 1BWFO 2E1YA 3IUCA 1K8AO 4MO4A 4ILHA 1IG8A 3VEYA 1M90O 3MWPA 4JN4A 5M1PA 4AM7A 3L4IA 4JKGB 4CZGA 1KAZA 1HX1A 2A40A 4H5RA 1MWKA 3SMPA 4BC4A 4DQ8A 5AQSA 4CZIA 3CETA 4IOXA 3E9OA 5GIOA 1KD1O 3ZETA 2VGNA 2RE2A 3G4SN 3BUZB 1D4XA 1ZBSA 1KXPA 3FZFA 3WUHA 2E2NA 4Z94A 5C12A 3U9DA 1TYQA 2JWLA 4FWLA 4B1XB 1XQSC 1GLAG 4BQZA 1ATSA 1NMDA 3Q7BA 4CI6A 1ZC6A 3VEVA 1GLDG 3VGMA 4JK9A 1NGAA 2YX6A 3GDQA 3IMXA 3QB0A 2CGJA 3MN9A 5BRHA 4BC3A 5H1SQ 1QQOA 2D4WA 1DGKN 1RDWX 1GLBG 3M1FA 1MWMA 5M1KA 3ATUA 3CMAN 2F7TA 1BA1A 1YF5L 1HUXA 1OKJA 1M1KO 3S41A 2P9IB 4BY9C 1NGJA 5M1QA 2QWOA 2QI2A 4H5NA 4IXCA 4CD3A 1BU6O 3BF3A 3MCAB 3SBTA 4IO8A 5FPNA 3A5NC 1GLLO 4BC2A 3P4IA 3CPEA 4A57A 4HWIA 1T6CA 3CHWA 2A41A 4ISGA 3EN9A 5TKWA 5BRFA 3C65A 5GIPA 4H5WA 2CGKA 3KWIA 4H5VA 4MLHA 4OO1J 2F9WA 2QWLA 3FZMA 3D2FA 2ASPA 3MX5A 3OW2M 4EIAA 1EO1A 3FFKB 4JKDA 1YJNN 3CJ7A 5TKYA 3VF2A 1JCEA 3TTDA 2WC9A 1JCFA 5GAEP 4WF9L 3PIPL 1GLFO 1BDGA 3A5LC 4AF1A 3EKSA 3DJCA 3OHRA 4A2BA 2ASMA 3R6MA 3ULEB 3MCPA 5FPEA 1Q7YO 1ILYA 4B1VA 2ASOA 3DXKA 5AQUA 5BPNA 5AQYA 1T6DA 5CE3A 1U2VB 3CPWM 3CMEN 1SZ2A 2I7NA 3RSEA 3ID8A 1HKCA 1NBWA 5EY4A 4BR2A 3IDHA 2Q0UA 4I6MA 3GL1A 2QXLA 1MA9B 4FVUA 1ATNA 4JK8A 2P9LA 5AZIB 1YIJN 2P9NB 3AY9A 3ID6A 2PAVA 3ZYYX 3Q7CA 3BP8A 1NGFA 3J8AA 1NGIA 3O1WA 3O9TA 2GWJA 5AQPA 3ENBA 3EO3A 4BGAA 3NVMA 3LDOA 4JD2B 2CH6A 4XH1A 3K9JA 3LM9A 3WXLA 3MK6A 3R9PA 3VMFB 3O1BA 5JVHL 2Q97A 3O6WA 1VQ4N 4L3QA 2D0PA 4BRCA 2HF3A 4J8FA 3CCJN 1NGHA 5JLFA 4H0VB 5DM7L 1KQSM 3M5RA 3GG4A 2YHWA 1HJOA 2WBNA 3O9QA 3WT0A 3VF4A 4BREA 1WOQA 4BRIA 4C23A 4CZFA 5ADXA 1BO5O 4PKGA 4JKFA 3JS6A 5AR0A 3UE5A 4FWSA 5GINA 4E1JA 3EE9A 3O08A 4QS8A 3C7NA 5GAHP 1YUWA 4WQ4C 5BPLA 3ZEUA 3NVKA 3CERA 3CJBA 5CHIA 4AM6A 2E2QA 4BR0A 1GLCG 4WFBL 3CCUN 1KAXA 3CCEN 1R59O 5EXWA 2P9UB 4GVEA 4JKAA 2FSJA 3CCQN 2RHKA 1VQLN 4G9ZA 3ENHA 1SS6A 3FE1A 3H3OB 4K41A 4BRPA 3OBYA 2QWNA 2OTLN 1K8KA 1ATRA 4M63C 4QS9A 1VQ5N 3IKMA 2GUPA 5FPMA 2WFBA 3VGLA 2E88A 4A59A 4BRMA 4B1WB 2P9PA 2NRRA 3JXUA 4B1ZA 3D2EB 1H1VA 1X3MA 4YDUA 3VEWA 1Q82O 4IDHA 2YJEA 2BH1A 3L4QA 3LL3A 3O80A 3AAQA 3DWLA 1Z6RA 4HTLA 3U4LA 3UKUB 4IOCL 5FPDA 3I33A 3SAGA 2VGMA 4IWVA 3O9RA 1VQNN 4DB3A 4GNIA 1DT9A 2FSKA 5HOOA 3HRGA 3QFPA 5JVGL 1YJWN 1BUPA 1YJ9N 3L6QA 2D1KA 4BG8A 4BR5A 4XH4A 5ELZA 4MDAA 5GADP 5C0YA 1E4FT 2E20A 4H5TA 2P9SB 3F5TA 4A61A 3VEZA 5AZJA 4DCHA 1T3VA 4EFHA 4YOXA 2NLXA 4IO9L 2V52B 3E9LA 2PBDA 3WEEA 4O5FA 3CQXA 4CZEA 4FWRA 1S3XA 5AQGA 1SAZA 4EHUA 3WXIA 4FWOA 3GOIA 3HSCA 1P8ZA 4F9OA 1NGCA 5M1OA 4FSVA 4BRFA 5GAGP 2GEMA 1QHAA 2DPNA 1K9MO 3AARA 2BTFA 3G6EN 2P9KA 4BVOA 3ZX3A 3BEXA 1OVYA 3SBGA 3HOSA 4OPHA 4M7XA 1Q18A 1S22A 2NRZA 4KH4A 3KZBA 3TTFA 4BRQA 5BREA 1WUAA 3H46O 3ZETB 4ISEA 2QWPA 5AQZA 4BVPA 1QVGM 2NRTA 2NNWA 2ZGYA 4ISFA 2H3GX 4BRHA 3H6EA 2VYPA 3H1QA 3N4PA 4FWNA 1TYQB 4U67L 3TSUA 3D6RA 3O5BA 1VQPN 4BRKA 1NLVA 1RDUA 2W41A 3UKRB 2IVPA 4K42A 4CZMA 3M3ZA 3O4WA 3R1XA 2ITMA 3EE8A 2GTDA 2YI1A 3EZWA 5AQKA 4IFEA 1W2BM 2QEXN 4FWPA 4U7BA 3VEXA 4ILJA 1RGIA 3VPZA 4JD2A 3HTVA 1NGEA 2EWSA 2OANA 3SLCA 2FSNA 5DM6L 2ZF5O 4H03B 5JICA 2GX9A 3CC7N 3KHYA 3FZLA 2QM1A 3LDQA 4H0YB 3W0LA 3P31A 3NMUA 2NRWA 2YHYA 1XC3A 2ZJQL 4FPBA 4YOUA 1Z05A 2HMPA 3VTIA 3I8BA 2Q31A 4YOVA 4C1NK 1QQMA 4FOIA 3LM2A 3GE1A 4JHDA 1HLUA 5AQQA 1C0GA 3ZX2A 4DHYA 3E9PA 3QBWA 3VTHA 4BRAA 5HL7L 3HZ6A 1NGDA 5BRDA 5KQ8A 2FXUA 3DXKB 4CZJA 4H0PA 3FGUA 2E1ZA 1HPMA 4K25A 1VQ9N 2JWKA 5I9EB 4BG9A 3C0BA 3RSEB 4BR4A 3HOTA 1S72N 1BOTO 4RWTA 2FF3B 3CJCA 5AQHA 1DEJA 3CJAA 4C1NI 3A5MC 3CC2N 2E2OA 2NRVA 2WUSA 3VESA 3PLAA 1U6ZA 4FWQA 2P9LB 4WFAL 3KWGA 4JAXA 1W97L 3R3LA 4JK7A 3K9KA 1JCGA 3CQYA 2I7PA 3CIPA 3TSQA 4B9QA 3O8MA 5AQOA 4CBXA 4QS7A 3CCSN 3ENOA 2KHOA 1GLJO 4JKCA 1HKGA 2NRXA 4H0TB 4NO7A 1IJJA 3FR0A 2J4RA 4DKWA 3H3NO 1BA0A 3CC4N 3M6GA 5F2RA 4JKGA 2CGLA 5E84A 4UY8O 2CH5A 3EKUA 4CJ7A 1CZAN 3F9MA 2AA4A 3G71N 2HBMA 3BF1A 4FO0A 4YORA 4NLBA 3DXMB 2QWMA 2YHXA 1TUUA 5CR4A 4YDUC 3B8AX 2E8AA 3C6HA 4CZLA 1VQ6N 2OTJN 3D7EO 2VWBA 4WQ5A 3SMSA 2QWQA 3C7NB 3HM8A 3H1VX 1X9JA 3W3DA 1NGGA 5LJWA 1YITN 3OA9A 5AQNA 2NZTA 4H0OA 3ZEUB 2HBLA 4GV6A 4XEIA 2QWRA 4NLCA 2Q1NA 1Y64A 4GV3A 3QICA 1SQKA 4BROA 4JKBA 5F1XA 2E2PA 5AQMA 5AQRA 3CCVN 3CCRN 4M7YA 4PL7A 3VF6A 1ESVA 5AQFA 1XUPO 2VCPA 3A0IX 1NM1A 2QA4N 1VQ8N 3MX2A 4GV9A 4H0XB 4PKHA 2P9IA 1EQYA 3A5OC 4CD1A 1K8KB 5AFUA 5BN8A 5M1NA 3DAWA 2A5XA 5KPZA 5ADXH 1VQ7N 1T44A 1Q81O 4RTFD 2YCHA 1BG3A 2P9PB 1P90A 3O9UA 1KAYA 2ZGZA 4LC9B 4PL8A 3U9ZA 4PHTX 4FWKA 2A6AA 4KH6A 4WFNL 3CXCM 4CZHA 1K73O 3R8EA 2F9TA 3CJ9A 5AQJA 3QMLA 3SAHA 2HSTA 4IZ9A 3SJHA 3MDQA 5C10A 3VEOA 3AGKA 3TTCA 2NRHA 2HBKA 4OPAA 2IVNA 3ULEA 4A5BA 2HF4A 4IJAA 3MN7A 1KC8O 4FL9A 5KPRA 3KVGA 3UKRA 3HBTA 4A62A 2QW9A 3EL2A 3T7ZA 3QDKA 4IOAL 1U2VA 3LDLA 3TSPA 1C0FA 4JEPA 1JJ2M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAH D;  2Q0R A;  1LOT B;  4IJN A;  3LDN A;  4BRD A;  5AZJ B;  4KBO A;  5BPM A;  4EHT A;  5AZI A;  2FF6 A;  3QFU A;  4XH5 A;  3WEE B;  5LY3 A;  2P9N A;  3U8X A;  5BR9 A;  4RCH A;  1MDU B;  2V51 B;  2FLO A;  1TUY A;  3CJ1 A;  3G25 A;  4FOE A;  2YJF A;  5B8H A;  3UB5 A;  4BRG A;  5AQL A;  3FLC O;  4FWM A;  4BC5 A;  3VOV A;  3SK3 A;  5AQV A;  3TU5 A;  2A42 A;  4CZK A;  2P9K B;  4BGB A;  1ZXO A;  2Q36 A;  1YVN A;  3VET A;  3VGK A;  1DKG D;  4GY2 B;  1LCU A;  3FZH A;  3D2F B;  3MN6 A;  5AFU H;  1QQN A;  1GLE G;  2IIR A;  4NB4 A;  4MLE A;  3GBT A;  2A3Z A;  5EOY A;  1QZ5 A;  1X3N A;  4FPA A;  5F0X A;  5BN9 A;  4CBW A;  1V4T A;  3MMV A;  4BQL A;  5AQX A;  3IFR A;  2IVO A;  5KPT A;  5LJV A;  2P9U A;  4I6M B;  4Y0W A;  5AQI A;  5JLH A;  4B1U B;  4A2A A;  3ATV A;  2AP1 A;  5JMV A;  3CI5 A;  3HI0 A;  4MO5 A;  5KQD A;  2Q2R A;  3ZX0 A;  4B1Y B;  1NGB A;  3WXJ A;  3VEN A;  2V7Z A;  4PKI A;  3MN5 A;  3FZK A;  3DXM A;  3L0Q A;  4JNE A;  5EX5 A;  3D2E A;  1G99 A;  5AQT A;  2GEL A;  3TPQ A;  3UKU A;  3WXK A;  4JHD B;  4WYB A;  1J6Z A;  2D0O A;  4K43 A;  4BR9 A;  4WQ4 A;  1HKB A;  2BUP A;  3VER A;  5E26 A;  4BRL A;  3WQU A;  3H45 C;  4CBU A;  2HOE A;  4O8K A;  3WQT A;  2UYT A;  2V7Y A;  4WQ5 C;  5EVZ A;  1YAG A;  1NWK A;  2W40 A;  2P9S A;  4BRN A;  5AQW A;  4BR7 A;  2GWK A;  1V4S A;  1RFQ A;  2ZWH A;  3A8Y A;  3LDP A;  1E4G T;  1QZ6 A;  3QBX A;  1YXQ A;  3AAP A;  1BWF O;  2E1Y A;  3IUC A;  4MO4 A;  1IG8 A;  3VEY A;  4JN4 A;  4AM7 A;  3L4I A;  4CZG A;  1KAZ A;  1HX1 A;  2A40 A;  4H5R A;  1MWK A;  3SMP A;  4BC4 A;  4DQ8 A;  5AQS A;  4CZI A;  3CET A;  3ZET A;  3BUZ B;  1D4X A;  1ZBS A;  1KXP A;  3FZF A;  3WUH A;  2E2N A;  4Z94 A;  3U9D A;  1TYQ A;  4FWL A;  4B1X B;  1XQS C;  1GLA G;  4BQZ A;  1ATS A;  1NMD A;  4CI6 A;  1ZC6 A;  3VEV A;  1GLD G;  3VGM A;  1NGA A;  3GDQ A;  3IMX A;  3QB0 A;  2CGJ A;  3MN9 A;  5BRH A;  4BC3 A;  1QQO A;  2D4W A;  1DGK N;  1RDW X;  1GLB G;  3M1F A;  1MWM A;  3ATU A;  1BA1 A;  1HUX A;  1OKJ A;  3S41 A;  2P9I B;  1NGJ A;  2QWO A;  4H5N A;  4IXC A;  4CD3 A;  1BU6 O;  3BF3 A;  4IO8 A;  5FPN A;  3A5N C;  1GLL O;  4BC2 A;  3P4I A;  4HWI A;  1T6C A;  3CHW A;  2A41 A;  4ISG A;  3EN9 A;  5BRF A;  4H5W A;  2CGK A;  4H5V A;  4MLH A;  3FZM A;  2F9W A;  2QWL A;  3D2F A;  2ASP A;  4EIA A;  3FFK B;  3CJ7 A;  5TKY A;  3VF2 A;  1JCE A;  1JCF A;  1GLF O;  1BDG A;  3A5L C;  3EKS A;  3DJC A;  3OHR A;  4A2B A;  2ASM A;  3R6M A;  3ULE B;  3MCP A;  5FPE A;  4B1V A;  2ASO A;  3DXK A;  5AQU A;  5BPN A;  5AQY A;  1T6D A;  5CE3 A;  1U2V B;  1SZ2 A;  2I7N A;  3RSE A;  3ID8 A;  1HKC A;  1NBW A;  5EY4 A;  4BR2 A;  3IDH A;  2Q0U A;  4I6M A;  3GL1 A;  2QXL A;  1MA9 B;  1ATN A;  2P9L A;  5AZI B;  2P9N B;  3AY9 A;  2PAV A;  3BP8 A;  1NGF A;  3J8A A;  1NGI A;  3O1W A;  2GWJ A;  5AQP A;  3EO3 A;  4BGA A;  3LDO A;  4JD2 B;  2CH6 A;  4XH1 A;  3LM9 A;  3WXL A;  3MK6 A;  3R9P A;  3O1B A;  2Q97 A;  3O6W A;  4L3Q A;  2D0P A;  4BRC A;  2HF3 A;  4J8F A;  1NGH A;  5JLF A;  4H0V B;  3GG4 A;  2YHW A;  1HJO A;  3WT0 A;  3VF4 A;  4BRE A;  1WOQ A;  4BRI A;  4C23 A;  4CZF A;  5ADX A;  1BO5 O;  4PKG A;  3UE5 A;  3JS6 A;  5AR0 A;  4FWS A;  4E1J A;  3O08 A;  4QS8 A;  3C7N A;  1YUW A;  4WQ4 C;  5BPL A;  3ZEU A;  3CER A;  3CJB A;  4AM6 A;  2E2Q A;  4BR0 A;  1GLC G;  1KAX A;  1R59 O;  5EXW A;  2P9U B;  2FSJ A;  3ENH A;  3H3O B;  3FE1 A;  4K41 A;  4BRP A;  2QWN A;  1K8K A;  1ATR A;  4M63 C;  4QS9 A;  2GUP A;  5FPM A;  3VGL A;  2E88 A;  4BRM A;  4B1W B;  2P9P A;  3JXU A;  4B1Z A;  3D2E B;  1H1V A;  1X3M A;  4YDU A;  3VEW A;  2YJE A;  3LL3 A;  4HTL A;  3O80 A;  3AAQ A;  3DWL A;  1Z6R A;  3U4L A;  3UKU B;  5FPD A;  3I33 A;  4IWV A;  4DB3 A;  4GNI A;  2FSK A;  3QFP A;  1BUP A;  3L6Q A;  2D1K A;  4BG8 A;  4BR5 A;  4XH4 A;  5ELZ A;  1E4F T;  2E20 A;  4H5T A;  2P9S B;  4A61 A;  5AZJ A;  3VEZ A;  4DCH A;  4EFH A;  2NLX A;  2V52 B;  2PBD A;  3WEE A;  4O5F A;  3CQX A;  4CZE A;  4FWR A;  1S3X A;  5AQG A;  1SAZ A;  4EHU A;  3WXI A;  4FWO A;  3GOI A;  3HSC A;  1P8Z A;  4F9O A;  1NGC A;  4FSV A;  4BRF A;  2GEM A;  1QHA A;  2DPN A;  3AAR A;  2BTF A;  2P9K A;  4BVO A;  3ZX3 A;  3BEX A;  4M7X A;  1Q18 A;  1S22 A;  4BRQ A;  3KZB A;  5BRE A;  1WUA A;  3H46 O;  3ZET B;  4ISE A;  2QWP A;  5AQZ A;  4BVP A;  2ZGY A;  4ISF A;  2H3G X;  4BRH A;  3H6E A;  2VYP A;  3H1Q A;  4FWN A;  1TYQ B;  3O5B A;  4BRK A;  1NLV A;  2W41 A;  3UKR B;  2IVP A;  4K42 A;  4CZM A;  3M3Z A;  3O4W A;  2ITM A;  2GTD A;  2YI1 A;  3EZW A;  5AQK A;  4FWP A;  3VEX A;  1RGI A;  3VPZ A;  4JD2 A;  3HTV A;  1NGE A;  2EWS A;  2OAN A;  3SLC A;  2FSN A;  2ZF5 O;  4H03 B;  5JIC A;  3KHY A;  3FZL A;  2QM1 A;  3LDQ A;  4H0Y B;  3W0L A;  2YHY A;  1XC3 A;  4FPB A;  1Z05 A;  2HMP A;  3I8B A;  2Q31 A;  1QQM A;  4FOI A;  3LM2 A;  3GE1 A;  4JHD A;  1HLU A;  5AQQ A;  1C0G A;  3ZX2 A;  4DHY A;  3QBW A;  4BRA A;  3HZ6 A;  1NGD A;  5BRD A;  5KQ8 A;  2FXU A;  3DXK B;  4CZJ A;  4H0P A;  3FGU A;  2E1Z A;  1HPM A;  4K25 A;  5I9E B;  4BG9 A;  3C0B A;  3RSE B;  4BR4 A;  1BOT O;  4RWT A;  2FF3 B;  3CJC A;  5AQH A;  1DEJ A;  3CJA A;  3A5M C;  2E2O A;  2WUS A;  3VES A;  1U6Z A;  4FWQ A;  2P9L B;  4JAX A;  1JCG A;  3CQY A;  2I7P A;  3CIP A;  4B9Q A;  3O8M A;  5AQO A;  4CBX A;  4QS7 A;  3ENO A;  2KHO A;  1GLJ O;  1HKG A;  4H0T B;  4NO7 A;  1IJJ A;  3FR0 A;  2J4R A;  3H3N O;  1BA0 A;  3M6G A;  5F2R A;  2CGL A;  5E84 A;  2CH5 A;  3EKU A;  4CJ7 A;  1CZA N;  3F9M A;  2AA4 A;  3BF1 A;  4FO0 A;  3DXM B;  2QWM A;  2YHX A;  1TUU A;  4YDU C;  3B8A X;  2E8A A;  4CZL A;  3D7E O;  2VWB A;  4WQ5 A;  3SMS A;  2QWQ A;  3C7N B;  3HM8 A;  3H1V X;  1X9J A;  3W3D A;  1NGG A;  5LJW A;  5AQN A;  2NZT A;  4H0O A;  3ZEU B;  4XEI A;  2QWR A;  2Q1N A;  1Y64 A;  3QIC A;  1SQK A;  4BRO A;  5F1X A;  2E2P A;  5AQM A;  5AQR A;  4M7Y A;  4PL7 A;  3VF6 A;  1ESV A;  5AQF A;  1XUP O;  2VCP A;  3A0I X;  1NM1 A;  4H0X B;  4PKH A;  2P9I A;  1EQY A;  3A5O C;  4CD1 A;  1K8K B;  5AFU A;  5BN8 A;  3DAW A;  2A5X A;  5KPZ A;  5ADX H;  1T44 A;  4RTF D;  2YCH A;  1BG3 A;  2P9P B;  3U9Z A;  1KAY A;  2ZGZ A;  4LC9 B;  4PL8 A;  4FWK A;  2A6A A;  4CZH A;  3R8E A;  2F9T A;  3CJ9 A;  5AQJ A;  3QML A;  4IZ9 A;  3SJH A;  3MDQ A;  3VEO A;  2NRH A;  3ULE A;  2IVN A;  2HF4 A;  4IJA A;  3MN7 A;  4FL9 A;  5KPR A;  3KVG A;  3UKR A;  3HBT A;  4A62 A;  2QW9 A;  3EL2 A;  3QDK A;  1U2V A;  3LDL A;  1C0F A; 
#chains in the Genus database with same CATH topology
 4EAH D;  2Q0R A;  3KK7 A;  3DRR A;  4IJN A;  1SKR A;  1RT5 A;  4X62 K;  3RR7 A;  5AZI A;  2FF6 A;  4CHN A;  3SUO A;  1L3U A;  4JKH A;  3CQ8 A;  1FW6 A;  4KB1 A;  1KRP A;  5BR9 A;  1MDU B;  4JYA K;  3I0R A;  5JS1 A;  4M3T A;  1O13 A;  4FWM A;  4IFY A;  1TK8 A;  4JI3 K;  3TU5 A;  3SZ2 A;  4FJ8 A;  3L2U A;  2P9K B;  3LAN A;  1ZXO A;  2B6A A;  1EX4 A;  3VGK A;  1DKG D;  4V19 S;  1N32 K;  4CHO A;  5AFU H;  4KFB A;  3DLR A;  1VQO N;  4CJE A;  3F2K A;  1WSJ A;  3OYM A;  2G8I A;  1QZ5 A;  5F0X A;  4CBW A;  1GOB A;  1YTA A;  3J7Z O;  3C95 A;  4B1U B;  3DYA A;  3ATV A;  3DLG A;  5JMV A;  4DV3 K;  2ZQB A;  4O8U A;  4YNQ A;  3FZK A;  3S3N A;  4FJ9 A;  3LAM A;  4DSL A;  3ITH A;  2A1R A;  1Z26 A;  3QEX A;  2GEL A;  4CEO A;  2BE2 A;  3J7Y P;  2OPS A;  3HP6 A;  1ZBI A;  4CF2 A;  3LPU A;  4CIG A;  2BUP A;  4MDB A;  1JLG A;  5DK5 A;  4YY3 K;  3WQU A;  4CBU A;  1WSE A;  4CFC A;  4O8K A;  2HND A;  2W40 A;  4DQQ A;  3AVL A;  5AQW A;  3WXM B;  1D5A A;  1OVQ A;  1V4S A;  3P38 A;  4KKO A;  4IKF A;  3BZC A;  4DFP A;  1EET A;  3L2W A;  1QZ6 A;  1YXQ A;  5M1F A;  3AAP A;  2E1Y A;  3CM5 A;  1EXQ A;  3MWP A;  5M1P A;  5FRM A;  4AM7 A;  3FFI A;  3NF7 A;  1NK7 A;  4GVM A;  3PO4 A;  4BC4 A;  4DQ8 A;  2O8F B;  3HXM A;  3E9O A;  5GIO A;  3ZET A;  2E5L K;  3LP1 A;  3SQ2 A;  4DV4 K;  4Z94 A;  4B1X B;  4BQZ A;  3J81 O;  3Q7B A;  1TKZ A;  4JRP A;  1NGA A;  2KFZ A;  2KW4 A;  3QB0 A;  3MN9 A;  5BRH A;  5H1S Q;  1QQO A;  1RDW X;  4FLU A;  3M1F A;  3ATU A;  3MEE A;  3OYH A;  2UUB K;  4B9T A;  4BDZ A;  4KB0 A;  1YF5 L;  1B9F A;  1JL2 A;  1M1K O;  3S41 A;  1NGJ A;  3TAM A;  4H5N A;  1BU6 O;  2O8E B;  3BF3 A;  1C0U A;  3P4I A;  4BC2 A;  4HWI A;  1CZB A;  1S1W A;  2XY6 A;  3CHW A;  4LY7 A;  5CYQ A;  5TKW A;  1HR0 K;  5KGX A;  2FBX A;  2F9W A;  3FZM A;  1HMV A;  4DR5 K;  4I2P A;  3OW2 M;  4EIA A;  3ULD A;  3FFK B;  3VF2 A;  2WC9 A;  3DJC A;  3OHR A;  2ASM A;  3ULE B;  1E3M A;  4B1V A;  3AVB A;  3VA3 A;  2HHX A;  2ASO A;  5AQY A;  3KLE A;  3VQ9 A;  1ZYQ A;  5CE3 A;  1C0T A;  3CME N;  4OX9 K;  3DM2 A;  3RSE A;  2FBV A;  2W6L A;  4BR2 A;  4I6M A;  3OYD A;  3GL1 A;  4UQG A;  1WSF A;  1MA9 B;  5IWA K;  4KO0 A;  3SPZ A;  4KHS A;  2PAV A;  4CJK A;  3Q7C A;  3NGZ A;  4LF4 K;  1QSY A;  4DQI A;  4R5P A;  4OLA A;  3VQ6 A;  3K9J A;  2QK9 A;  2Q97 A;  4JI0 K;  4FYD A;  4FM1 A;  4BRC A;  1IG9 A;  4CED A;  3DOL A;  3M5R A;  2OA8 A;  1B92 A;  2WBN A;  4CEE A;  1WOQ A;  2FBT A;  1S1X A;  3OS1 A;  2KZZ A;  4JKF A;  2ETJ A;  4E1J A;  3O08 A;  3CFR A;  1VSH A;  1RDB A;  3DMJ A;  5CHI A;  4E19 A;  1IH7 A;  1GLC G;  5EXW A;  4YFU A;  4GVE A;  1CLQ A;  4BE2 A;  3CCQ N;  1A5V A;  2OPR A;  2VG7 A;  3EYZ A;  3RMA A;  3VQA A;  3FE1 A;  2QWN A;  3AVM A;  4MQ3 A;  1VQ5 N;  1JLF A;  3AVC A;  2GUP A;  4H4M A;  1VSE A;  4JI8 K;  4FW1 A;  1L3T A;  1O1W A;  3D2E B;  3VEW A;  4CHZ A;  1VRT A;  4CCH A;  2BH1 A;  3CF5 L;  3O80 A;  2UXD K;  3U4L A;  3L2R A;  5FPD A;  4CE9 A;  3RMC A;  2X78 A;  4B9M A;  4GNI A;  5HOO A;  3OYC A;  2W6K A;  3PO5 A;  4BR5 A;  1C0M A;  4MFB A;  1E4F T;  3F5T A;  5AZJ A;  2DFH A;  2NLX A;  2PYJ A;  3LZJ A;  2V52 B;  4CZE A;  4EHU A;  1BQN A;  1S3X A;  3HO1 A;  3WXI A;  1RCH A;  1C1B A;  5FDL A;  4FSV A;  4B8A B;  1DTQ A;  5GAG P;  1WN7 A;  1LV5 A;  2HMI A;  3G6E N;  2KTQ A;  4BVO A;  4CHP A;  4CJF A;  3VQ7 A;  3SI6 A;  2O4I A;  1WSI A;  1MU2 A;  3KK3 A;  1Q18 A;  1S22 A;  1Z25 A;  2NRZ A;  3KZB A;  4KH4 A;  4BRQ A;  4FCY A;  3H46 O;  4Z4C A;  1X9S A;  4BVP A;  3TAB A;  2NNW A;  3H6E A;  2VYP A;  1TYQ B;  3MED A;  3D6R A;  3O5B A;  3HL8 A;  3ZT0 A;  1NLV A;  3NCI A;  2W41 A;  4LF5 K;  4DTX A;  1F21 A;  4M42 A;  5HRR A;  2HNZ A;  3EE8 A;  1W2B M;  4FWP A;  1J5O A;  1NOY A;  4ILJ A;  3TI0 A;  3KK1 A;  4CJV A;  1RT1 A;  2YNH A;  4JD2 A;  4CJP A;  2EWS A;  4RW6 A;  5DM6 L;  5JIC A;  1HRH A;  3CC7 N;  3KHY A;  2QM1 A;  3LDQ A;  3NMU A;  3THV A;  1XWL A;  4FPB A;  4YOU A;  3OS0 A;  4DTO A;  4I7F A;  4YOV A;  4DU4 A;  1K6Y A;  3DRS A;  3ZT3 A;  4CJU A;  4JHD A;  1HLU A;  3WNF A;  3OJS A;  4DHY A;  1UA0 A;  3E9P A;  2XY8 A;  5BRD A;  3DXK B;  1HYV A;  4H0P A;  2E1Z A;  3P5J A;  1HPM A;  2JWK A;  4FLT A;  5I9E B;  3C0B A;  4BR4 A;  2Z1I A;  1A5W A;  3HOT A;  3HP9 A;  4RWT A;  1NKC A;  4FJH A;  2ITG A;  2WUS A;  1U6Z A;  1HNX K;  4KI4 A;  2ZM6 K;  2UU9 K;  4W5N A;  1JL1 A;  3CIP A;  3TSQ A;  1G15 A;  3CCS N;  3THW B;  2NRX A;  4NO7 A;  2E6M A;  1BA0 A;  3M6G A;  1KVC A;  4B3O A;  3KJV A;  4DS4 A;  3PSF A;  2JGU A;  3F9M A;  2DY4 A;  2KQ2 A;  2PZS A;  2AA4 A;  5J2M A;  3O4Q A;  3AO2 A;  5CY4 A;  4FO0 A;  1I94 K;  2QWM A;  4FJM A;  3ZSR A;  4K8Z A;  3AO1 A;  2E8A A;  3C6H A;  1BQM A;  3MXJ A;  3T1Y K;  1TKT A;  3JYT A;  1NGG A;  4RW4 A;  4OPJ A;  3CM6 A;  4XEI A;  2QWR A;  4NLC A;  3U3G A;  1T7P A;  2VG5 A;  3G10 A;  3KKS A;  3CCV N;  3CCR N;  3VQD A;  4M7Y A;  1ESV A;  4AHV A;  1XUP O;  2VCP A;  4GV9 A;  3VA0 A;  3A5O C;  5AFU A;  3AVH A;  1NK4 A;  3OVN A;  1T44 A;  3QIN A;  3V9W A;  4RTF D;  2KZM A;  3U9Z A;  3O9U A;  2ZGZ A;  2RF2 A;  4RG8 A;  5KRT A;  4CZH A;  3R8E A;  2F9T A;  5AQJ A;  3QML A;  4FZY A;  3ZSO A;  1KCF A;  3AVG A;  1RTJ A;  3VEO A;  3AGK A;  3ZCM A;  1ZBH A;  4OPA A;  2IVN A;  1QHT A;  1NK8 A;  2OPQ A;  3EL2 A;  3NAE A;  3QDK A;  1L3V A;  1U2V A;  4KRE A;  3TSP A;  3HK2 A;  1B9D A;  3P39 A;  4I2Q A;  4BRD A;  2HBJ A;  3VQ8 A;  5LY3 A;  3S9H A;  2V51 B;  2PY5 A;  3CJ1 A;  1N34 K;  3OBW A;  3ZSZ A;  2YJF A;  5AQL A;  3V1Q A;  4BC5 A;  3SK3 A;  3MWT A;  3DRP A;  4CZK A;  2ZJR L;  4OKK A;  1TVR A;  3VQE A;  1YVN A;  4B08 A;  1BIU A;  5HLF A;  3VET A;  3ZT2 A;  1ZBU A;  4GY2 B;  3DLE A;  4IEI A;  3QEW A;  4KHW A;  1LCU A;  4FVM A;  2X74 A;  3D2F B;  1QVF M;  5C2F A;  1QQN A;  4CGI A;  4FK4 A;  2IIR A;  3KLI A;  3HPH A;  4DV7 K;  3GBT A;  5EOY A;  3C6A A;  4FJX A;  3CCM N;  4KTW A;  5C24 A;  4DG1 A;  2Z1H A;  5BN9 A;  4DR6 K;  4DR3 K;  4AHT A;  4I9L A;  1V4T A;  3MMV A;  4DS5 A;  5AQX A;  2B5J A;  3IFR A;  2IVO A;  3THX B;  2P9U A;  4Y0W A;  1FKP A;  1XNQ K;  1OH6 A;  4H4O A;  1S1T A;  4Z4F A;  3CI5 A;  4CF0 A;  5C2D A;  3NGI A;  4KHQ A;  1NNE A;  3ZX0 A;  1HNZ K;  3QIP A;  4B1Y B;  1RTD A;  4M3W A;  3K5L A;  2V7Z A;  3L0Q A;  3SQ4 A;  3K0S A;  1OH7 A;  4IEE A;  1VQK N;  4AIL C;  5AQT A;  3WXK A;  1J6Z A;  4K43 A;  4DFK A;  3PIO L;  3L3V A;  4E0D A;  4KH5 A;  1SKS A;  3KTQ A;  1HKB A;  5E26 A;  2HHU A;  4LFC K;  1L5U A;  3ZSV A;  3AGR A;  4ILG B;  1RDC A;  2P9S A;  4LD0 A;  3WNE A;  1YI2 N;  2HHS A;  3OY9 A;  2GWK A;  2G8U A;  3TWH A;  1N8R O;  1TL3 A;  4LF6 K;  3A8Y A;  3LDP A;  4CGG A;  5C15 A;  2IS3 A;  1BWF O;  4W5Q A;  3IUC A;  4MO4 A;  1IG8 A;  3VEY A;  4JKG B;  4FJ5 A;  4PUO A;  4XIU A;  1UA1 A;  4CZI A;  3CET A;  4BDP A;  4RW8 A;  1QSL A;  1HJR A;  1RBS A;  5AJ3 K;  1D4X A;  1ZBS A;  1KXP A;  2E2N A;  3QO9 A;  3ZLJ A;  1BCO A;  1ZBL A;  1SV5 A;  3VEV A;  3VGM A;  4E7I A;  4JK9 A;  4NYN A;  4O0J A;  2CGJ A;  4N56 A;  3M8P A;  4Z4G A;  5FLX O;  4DV1 K;  1BA1 A;  1A5X A;  1HUX A;  1QTM A;  4EZ9 A;  4IXC A;  4CD3 A;  3OYJ A;  2EX3 A;  3SBT A;  5FPN A;  1VSI A;  1NKB A;  4EP5 A;  3V9U A;  1NK6 A;  5GIP A;  3C65 A;  3MXM A;  4H5W A;  2CGK A;  3KWI A;  2YKN A;  4H5V A;  4W5R A;  4OO1 J;  4IG0 A;  2ASP A;  5KI6 A;  3CJ7 A;  5TKY A;  4X66 K;  4JI4 K;  3EKS A;  4M3U A;  4A2B A;  3I0S A;  1T6D A;  1RT7 A;  1SZ2 A;  3ID8 A;  1NBW A;  5EY4 A;  4LF8 K;  3IDH A;  2Q0U A;  1WBD A;  2QXL A;  3AVK A;  1IBK K;  1VSF A;  4FLW A;  4K0K K;  5AZI B;  3NHG A;  3SUQ A;  3AY9 A;  3NF8 A;  4M45 A;  3ZYY X;  1RT4 A;  4HUE A;  1NGF A;  2GWJ A;  4OLB A;  1T03 A;  3EO3 A;  4BGA A;  3LDO A;  2NUB A;  4XH1 A;  1NJZ A;  3AO4 A;  4FZX C;  1C1A A;  2D0P A;  4NCA A;  2HF3 A;  3CCJ N;  1YTU A;  4H0V B;  1KQS M;  1SL2 A;  2AJQ A;  2HW3 A;  3WT0 A;  1HYZ A;  4CZF A;  2O8C A;  4Y1C A;  5DMR A;  4JV5 K;  1BO5 O;  3TAG A;  3UE5 A;  5A2Q O;  1RIL A;  4QS8 A;  5GAH P;  3IS9 A;  2VWK A;  3ZEU A;  3AA2 A;  3AO3 A;  3CER A;  3KIO A;  3AVJ A;  4AM6 A;  2E2Q A;  4J2B A;  4BR0 A;  3CCU N;  2P5O A;  1R59 O;  5LMN K;  1VQL N;  4BRP A;  4CFD A;  3OBY A;  1K8K A;  3VQ5 A;  4FJ7 A;  4QS9 A;  4OGE A;  3ALY A;  3MXI A;  2E88 A;  4BRM A;  1NKE A;  4B1W B;  2P9P A;  3NF9 A;  4DLG A;  4X65 K;  4CW7 B;  1GOC A;  4JRQ A;  1H1V A;  4HTL A;  2YJE A;  3DWL A;  3LPT A;  4DTJ A;  1IO2 A;  3SAG A;  4F3T A;  4ELU A;  4DB3 A;  1VQN N;  3HRG A;  3QFP A;  4ZTJ A;  1YJW N;  1BUP A;  2P1J A;  4AHR A;  1YJ9 N;  1IBL K;  3L6Q A;  4KPY A;  4MDA A;  4RW7 A;  4O44 A;  1RDD A;  2HHW A;  3SPY A;  3NH1 A;  1XI1 A;  4EFH A;  4YOX A;  4IO9 L;  3E9L A;  3WEE A;  3CQX A;  3C94 A;  4FWR A;  4AHC A;  4M3X A;  4FWO A;  4KAZ A;  3GOI A;  1P8Z A;  4F9O A;  5M1O A;  4DR1 K;  1QQC A;  3QEV A;  1K9M O;  2ATQ A;  5J2Q A;  2O8B A;  3ZX3 A;  3SBG A;  4ID5 A;  2KFN A;  1SUQ A;  3TTF A;  2DFF A;  5FRO A;  5BRE A;  1WUA A;  3ZET B;  2QWP A;  5AQZ A;  1QVG M;  2ZGY A;  1N36 K;  3AA4 A;  4CJ4 A;  4FJG A;  2H3G X;  4FM2 A;  2RPI A;  4U67 L;  4W5T A;  2RKI A;  3B6O A;  3HST B;  3ZSW A;  1TV6 A;  1WLJ A;  1QSS A;  3BZK A;  3K59 A;  3M3Z A;  5I42 A;  2GTD A;  2YI1 A;  3EZW A;  5AQK A;  4IFE A;  3VPZ A;  4LF7 K;  4LH4 A;  4CEB A;  2OAN A;  1C6V A;  4B9N A;  4KHN A;  2FSN A;  2ZF5 O;  4H03 B;  3W0L A;  4LF9 K;  1UOC A;  1IKW A;  3VTI A;  4L8R B;  4CIF A;  1JXB A;  4C1N K;  1KLM A;  4CVN E;  3DOK A;  2XO7 A;  4WE1 A;  1C0G A;  3ZX2 A;  3QBW A;  4BRA A;  3FGU A;  4O4G A;  1VQ9 N;  3IAY A;  1RTH A;  3OJU A;  4BG9 A;  3PX6 A;  3RSE B;  1S72 N;  1BOT O;  3CJC A;  4C1N I;  3PLA A;  4CJS A;  4JAX A;  4DFJ A;  3T19 A;  1W97 L;  3R3L A;  4CK2 A;  1JCG A;  1IKX A;  4B9Q A;  3O8M A;  1RT3 A;  4JKC A;  5K14 A;  3CC4 N;  4CFA A;  2CGL A;  5E84 A;  2O8D A;  1NK0 A;  4LH5 A;  3EKU A;  4CJ7 A;  3KLG A;  2DTU A;  1VSJ A;  4OVL A;  5T7B A;  1XC9 A;  4NLB A;  3DXM B;  2YHX A;  3PY8 A;  2YHA A;  4CZL A;  5D3G A;  3D7E O;  4WQ5 A;  5EU7 A;  1X9J A;  3OA9 A;  2NZT A;  4H0O A;  3K2P A;  2HBL A;  1OH5 A;  2Q1N A;  1Y64 A;  4CJQ A;  1I39 A;  3K57 A;  3VF6 A;  5AQF A;  1VQ8 N;  1JLE A;  3HPO A;  4IDK A;  2P9I A;  1EQY A;  1TL1 A;  5M1N A;  3DAW A;  2A5X A;  5JS2 A;  5KPZ A;  2LSN A;  1CZ9 A;  1FK9 A;  4FWK A;  2A6A A;  4KH6 A;  4WFN L;  1NJW A;  2P5G A;  3CJ9 A;  3TAP A;  5CZ2 A;  4IZ9 A;  5C10 A;  3RMD A;  3TAE A;  1QE1 A;  4FJN A;  2NRH A;  4M41 A;  2HF4 A;  4FL9 A;  5KPR A;  3KVG A;  5LL6 Z;  4DF4 A;  4J2D A;  3T7Z A;  4F2S A;  3HYF A;  1C0F A;  2G8W A;  3LDN A;  4IG3 A;  4KBO A;  5AZJ B;  3K5M A;  5BPM A;  3JSM A;  2P9N A;  1VQM N;  2UXB K;  4RCH A;  4BDY A;  2FLO A;  4CEQ A;  3UB5 A;  3OYK A;  4BRG A;  4KHU A;  1SL1 A;  5AQV A;  2G8K A;  1T05 A;  4BGB A;  2Q36 A;  4N5S A;  3CFO A;  3V9Z A;  4YOW A;  3U6F A;  1L3S A;  4WCE L;  1Y97 A;  2D0A A;  4BE0 A;  3LAK A;  3IRX A;  1S1V A;  3KKR A;  3MN6 A;  3PUF A;  1Q86 O;  1D9F A;  4NB4 A;  1HQE A;  2A3Z A;  3LWM A;  4FPA A;  2QTD A;  5SWM A;  5IT9 O;  1NJI O;  4TSX A;  3I56 N;  2XY5 A;  5LJV A;  1FJG K;  5JLH A;  5AQI A;  3M8R A;  4JKE A;  4DU1 A;  4PQU A;  3DLL L;  3A2F A;  4A5A A;  4E3S A;  4A2A A;  4YOT A;  3VQC A;  3I55 N;  3HI0 A;  3SYZ A;  4MO5 A;  1RBR A;  2Q2R A;  1U45 A;  3MN5 A;  2G8V A;  4JNE A;  4J2E A;  3LP2 A;  5MLC Q;  1BIZ A;  3S3O A;  4B3R K;  1JLB A;  4KTZ A;  2XY7 A;  3C6U A;  3E1Y A;  3TPQ A;  3UKU A;  2Z1J A;  4JHD B;  2WON A;  4WYB A;  2Z1G A;  5BR8 K;  3SQ0 A;  4IBN A;  1S5J A;  3QES A;  1TK0 A;  3VER A;  3H45 C;  1YVU A;  2HOE A;  3WQT A;  4WQ5 C;  3N4Q A;  5EVZ A;  2Y1J A;  1DLO A;  1NWK A;  1HYS A;  4BR7 A;  1YHQ N;  1LWF A;  2ZWH A;  4HVJ A;  3V4I A;  2HHH K;  4JLH A;  4C8N A;  1LW2 A;  1U04 A;  3IG1 A;  4C8M A;  1W0H A;  1XNR K;  1K8A O;  3L8B A;  1T8E A;  5SZT A;  1JKH A;  3L4I A;  4JI5 K;  1XMQ K;  1HX1 A;  2A40 A;  4NCG A;  3NDK A;  4AHS A;  2A1S A;  3SMP A;  4NCB A;  4IOX A;  3AVA A;  1KD1 O;  3BUZ B;  3AA3 A;  3FZF A;  3WUH A;  3SJJ A;  3U9D A;  4O55 A;  2JWL A;  4FWL A;  4PA1 A;  1XQS C;  1ATS A;  1NMD A;  3LAL A;  4CI6 A;  3AA5 X;  4W5O A;  1KSP A;  1GLD G;  2YX6 A;  3GDQ A;  1BI4 A;  3IMX A;  1S6P A;  3DLH A;  3K58 A;  1GLB G;  3P1G A;  3K5N A;  5HRS A;  4KI6 A;  2F7T A;  3OYF A;  4LSL A;  3ZT1 A;  4DV2 K;  3NH0 A;  3LP3 A;  4GKK K;  2PYL A;  4BY9 C;  5M1Q A;  2QWO A;  2QI2 A;  3MCA B;  5HRP A;  2GBZ A;  3A5N C;  2ZE2 A;  4A57 A;  2A41 A;  4ISG A;  2OZM A;  3EN9 A;  5BRF A;  4Z0U A;  3MEC A;  4CJR A;  3OYN A;  3D2F A;  3THY A;  3MX5 A;  3PIP L;  1JCE A;  3TTD A;  5GAE P;  1JCF A;  4FJK A;  1BDG A;  4G1Q A;  1ILY A;  3MCP A;  4FK0 A;  5I3U A;  3ZSQ A;  4CGD A;  1RTI A;  3ISN C;  5AQU A;  1U2V B;  3CPW M;  4DR4 K;  2I7N A;  1HKC A;  1REV A;  4HHT A;  4DTN A;  1JLC A;  3TR8 A;  4CF1 A;  1U4B A;  4FVU A;  1RT2 A;  1TAU A;  4JK8 A;  4E89 A;  2P9L A;  4B3S K;  3AVI A;  3TAN A;  4ZHR A;  1FXX A;  3BP8 A;  1WAJ A;  3O1W A;  3O9T A;  1NG9 A;  3ENB A;  3LM9 A;  3WXL A;  3R9P A;  3VMF B;  3KK2 A;  3O1B A;  4J2A A;  5JVH L;  2VG6 A;  4BWJ A;  1NGH A;  5JLF A;  4HUG A;  1FKO A;  5KGW A;  3GG4 A;  4AH9 A;  3O9Q A;  4BRE A;  4C23 A;  4CK3 A;  4CER A;  3C6T A;  4PKG A;  5AR0 A;  2YV0 X;  4FWS A;  3AV9 A;  5GIN A;  4CFB A;  3PX0 A;  3C7N A;  2WTU A;  3V9X A;  5C25 A;  5BPL A;  1WB9 A;  1RNH A;  1KTQ A;  4FW2 A;  4O5B A;  2ZD1 A;  5J2N A;  4WFB L;  3V6D A;  3PSI A;  3CCE N;  2P9U B;  4JKA A;  2DFE A;  4G9Z A;  3ENH A;  1SS6 A;  1ASV A;  4DV0 K;  3QER A;  2OTL N;  1ATR A;  1BHL A;  4F8R A;  5FPM A;  1VK0 A;  4A59 A;  2VQF K;  1CXQ A;  2HVI A;  3P83 D;  2HNY A;  3JXU A;  4B1Z A;  4IDH A;  4JS5 A;  1IKY A;  2IC3 A;  3AAQ A;  1KFD A;  3I33 A;  3O9R A;  4LSN A;  3KLF A;  1OH8 A;  1DT9 A;  5HRO A;  5JVG L;  4DMN A;  2UUA K;  1C1C A;  2D1K A;  4KV8 A;  4XH4 A;  5ELZ A;  4FM0 A;  5GAD P;  3G0Z A;  3V1R A;  4H5T A;  2P9S B;  3VEZ A;  4DCH A;  1T3V A;  3T1H K;  3SCX A;  1WAF A;  4O5F A;  3M8S A;  5AQG A;  1UAX A;  1NGC A;  1D8Y A;  2G8H A;  3SV3 A;  3NFA A;  4BRF A;  4CGF A;  3HVR A;  1WSG A;  3AAR A;  2P9K A;  3HVT A;  1OVY A;  1R0A A;  4M7X A;  1LWE A;  4CJ5 A;  4Z4E A;  1WNS A;  4ISE A;  1ITG A;  1ZBF A;  4DTP A;  4ISF A;  4Z4H A;  3H1Q A;  4FWN A;  3N4P A;  5C42 A;  4N76 A;  4BWM A;  4DQS A;  3ASM A;  1W7A A;  4YHH K;  1VQP N;  4BRK A;  3CYM A;  3UKR B;  4CZM A;  1WSH A;  2ITM A;  1RDA A;  2WOM A;  3VEX A;  3HTV A;  1NGE A;  3NBP A;  3RMB A;  2YKM A;  4DWI A;  2G8F A;  4F2R A;  3FZL A;  4H0Y B;  2NRW A;  4CEF A;  1I3A A;  3I8B A;  5CZ1 A;  2Q31 A;  3GE1 A;  4ELV A;  4QOZ B;  3WNG A;  3BGR A;  5HL7 L;  3HZ6 A;  4AHU A;  4FLZ A;  5KQ8 A;  2FXU A;  4CZJ A;  1EWR A;  1X1P A;  4B3M K;  2QXF A;  4H8K A;  4LFA K;  1HQU A;  2E2O A;  4CHQ A;  3VES A;  4DU3 A;  4FWQ A;  4WFA L;  1XMO K;  3KWG A;  1Q9X A;  4JK7 A;  3K9K A;  4LFB K;  4JI1 K;  4E7H A;  4CEA A;  5LMU K;  4GW6 A;  4FXD A;  4QS7 A;  1GLJ O;  4H0T B;  1ASW A;  2CH5 A;  1N6Q A;  4OGC A;  1LWC A;  4K8X A;  4RW9 A;  3G71 N;  2O8F A;  2HBM A;  3VQ4 A;  4YOR A;  1TUU A;  5CR4 A;  2O8C B;  5HRN A;  4FLX A;  1VQ6 N;  3SMS A;  1IV0 A;  4CF9 A;  2JLE A;  3W3D A;  3H1V X;  4DSE A;  5AQN A;  1EWQ A;  3ZEU B;  4GV6 A;  3L3U A;  4GV3 A;  3LP0 A;  4KHY A;  4DR7 K;  1SQK A;  4O0I A;  4JKB A;  1J9A A;  4DQR A;  4IFV A;  4PL7 A;  2QA4 N;  3A0I X;  4PKH A;  1K8K B;  3CG7 A;  2IDO A;  1S6Q A;  4CGJ A;  1RBV A;  1VQ7 N;  2O8E A;  1Q81 O;  4M3Z A;  1TKX A;  2YCH A;  2Y1I A;  1BGX T;  4EZ6 A;  2OCE A;  2P9P B;  4B8C A;  1KAY A;  4LC9 B;  4AQY K;  4PHT X;  1BL3 A;  3CXC M;  4CES A;  1K73 O;  2YHB A;  1NU0 A;  2Q3S A;  3SAH A;  3EZ5 A;  3SJH A;  3V9S A;  2HHQ A;  1VSM A;  1EP4 A;  4DR2 K;  3D45 A;  3ULE A;  1N5Y A;  3D0P A;  4IJA A;  1NOZ A;  3DLB A;  3SUN A;  3CFP A;  4HUF A;  4DTR A;  4IOA L;  1VQ4 N;  4JEP A;  1JJ2 M;  4E1N A;  1LOT B;  1NMN A;  1LAW A;  2P51 A;  1VAZ A;  4EHT A;  3SAF A;  3EEQ A;  3QFU A;  4XH5 A;  3WEE B;  3U8X A;  2X6N A;  1TUY A;  4FOE A;  3G25 A;  4ID1 A;  4HTU A;  5B8H A;  4ZTF A;  1SKW A;  3FLC O;  2KKZ A;  4YOY A;  3VOV A;  4DFM A;  4JI6 K;  2A42 A;  4JI7 K;  2KLA A;  2O8B B;  2B4J A;  1Q9Y A;  3DLK A;  1XHX A;  4CJ3 A;  1TKD A;  3FZH A;  4E7J A;  2ZJP L;  2HVH A;  1GLE G;  3JAM O;  3U3Y A;  3CCL N;  4MLE A;  5HP1 A;  4R79 A;  2YNI A;  3RRG A;  4FK2 A;  1HNW K;  1X3N A;  4M3R A;  2F4V K;  3H08 A;  4N47 A;  3OYL A;  4BQL A;  5KPT A;  4FLY A;  4DTM A;  2HHT A;  4I6M B;  3RVC A;  3CD6 N;  3K5O A;  1IKV A;  2AP1 A;  3O9S A;  4ELT A;  5KQD A;  3T69 A;  3KD5 E;  1NGB A;  3WXJ A;  3VEN A;  2I5J A;  4QCL A;  4PKI A;  3DXM A;  5FRN A;  5EX5 A;  3D2E A;  4OKJ A;  1NK5 A;  4DTU A;  3OYA A;  1G99 A;  4CF8 A;  2IGI A;  2D0O A;  4BR9 A;  4WQ4 A;  3E66 A;  3SNN A;  3QEP A;  3VN5 A;  4FLV A;  3NGY A;  1GOA A;  4BRL A;  2PFU A;  2UYT A;  2V7Y A;  1BIS A;  2UUC K;  1YAG A;  3UIQ A;  3TAF A;  4BRN A;  1XHZ A;  1RFQ A;  2E6L A;  2IAJ A;  4C8O A;  1RT6 A;  1E4G T;  3QBX A;  3RR8 A;  1W9H A;  1N33 K;  4ILH A;  4GKJ K;  1M90 O;  4JN4 A;  3S3M A;  4CZG A;  4DUY K;  2O8D B;  1KAZ A;  4H5R A;  4DQP A;  1MWK A;  3PV8 A;  1YT3 A;  5AQS A;  3F9K A;  3EY1 A;  2OZS A;  2VGN A;  4CJT A;  2RE2 A;  3G4S N;  3BY5 A;  4C8K A;  5C12 A;  1TYQ A;  4B9S A;  3RTV A;  1GLA G;  4NYF A;  3BDP A;  4FZZ A;  4E7L A;  4DTS A;  1ZC6 A;  4DSI A;  4BC3 A;  2F8S A;  2D4W A;  1DGK N;  2D0B A;  4DSK A;  5M1K A;  1MWM A;  4CEC A;  3CMA N;  1OKJ A;  2P9I B;  4C8L A;  1NK9 A;  4ICL A;  4IO8 A;  1GLL O;  3CPE A;  4QAG A;  1T6C A;  1JLA A;  4PWD A;  1S9E A;  4MLH A;  2QWL A;  4KTQ A;  2FBY A;  4X64 K;  1EO1 A;  4JKD A;  1YJN N;  2GUI A;  3DI6 A;  5E41 A;  4WF9 L;  1GLF O;  3A5L C;  4F3O A;  4AF1 A;  1Q7Y O;  5FPE A;  4DF8 A;  3R6M A;  2D5R A;  1NJY A;  4B9L A;  3DXK A;  5BPN A;  2HHV A;  3LDS A;  1ATN A;  4Y1D A;  1YIJ N;  2P9N B;  1U48 A;  1J54 A;  3ID6 A;  1EKE A;  3O3G A;  4Q0B A;  3AVF A;  3J8A A;  1NGI A;  1VSL A;  5AQP A;  1S1U A;  3THW A;  3NVM A;  2E4L A;  4CJL A;  3ZT4 A;  3QEI A;  4JD2 B;  3OYE A;  2CH6 A;  2QKK A;  3MK6 A;  3AVN A;  3O6W A;  4L3Q A;  3M8Q A;  2OYQ A;  4J8F A;  3O4N A;  1KFS A;  5DM7 L;  1KVB A;  3WNH A;  3L2Q A;  4FJJ A;  2YHW A;  1HJO A;  3VF4 A;  1JXE A;  4BRI A;  5ADX A;  1X9W A;  3OYI A;  3ZSX A;  3JS6 A;  3KD1 E;  3EE9 A;  4F4K A;  1YUW A;  4WQ4 C;  2F96 A;  1U47 A;  3NVK A;  1RBU A;  4PY5 A;  3CJB A;  1KAX A;  4NXN K;  1J5E K;  1HPZ A;  4OJR A;  2FSJ A;  2RHK A;  3VQP A;  4KHP K;  3H3O B;  4K41 A;  4CHY A;  4M63 C;  2UXC K;  3IKM A;  4NXM K;  2WFB A;  3VGL A;  4JS4 A;  2NRR A;  3NE6 A;  1X3M A;  4YDU A;  3QNN A;  1Q82 O;  2YNG A;  3L4Q A;  3LL3 A;  3I8D A;  4IOC L;  3V1O A;  2XRI A;  1Z6R A;  4CIE A;  3PX4 A;  3UKU B;  2VGM A;  4IWV A;  4KRF A;  2FSK A;  2D0C A;  3KLH A;  2QKB A;  2HB5 A;  4B3T K;  4BG8 A;  4OPK A;  3F73 A;  1HNV A;  5C0Y A;  1HNI A;  2E20 A;  1LW0 A;  4Z4I A;  4A61 A;  2PBD A;  1SAZ A;  3HSC A;  4I9Q A;  1VSD A;  2GEM A;  1QHA A;  2DPN A;  4M3Y A;  2BTF A;  3SQ1 A;  2W42 A;  3BEX A;  3HOS A;  2GV9 A;  4OPH A;  2VWJ A;  3SV4 A;  4N41 A;  3MAQ A;  2O4G A;  2NRT A;  5J2P A;  4BRH A;  5KTQ A;  1JLQ A;  1LAV A;  2RN2 A;  3LWL A;  3TSU A;  3V81 A;  2R7Y A;  1J53 A;  1RDU A;  3E01 A;  4CGH A;  1BI4 B;  2IVP A;  4K42 A;  3O4W A;  3R1X A;  3SUP A;  3THX A;  4E7K A;  2QEX N;  4U7B A;  1RGI A;  3HJF A;  2X6S A;  4CK1 A;  3SLC A;  4Q5V A;  3J7A P;  4FJL A;  3ZSY A;  1RBT A;  1X9M A;  2GX9 A;  3B6P A;  3P31 A;  1D9D A;  2YHY A;  1XC3 A;  2ZJQ L;  1Z05 A;  2EHG A;  3THY B;  5HBM A;  2HMP A;  4DUZ K;  1Q8I A;  3QIO A;  1QQM A;  3O3F A;  4FOI A;  3LM2 A;  3MEG A;  5AQQ A;  3NH2 A;  1UWB A;  3VTH A;  1NGD A;  3OTO K;  4OKE A;  4DSF A;  3QNO A;  4K25 A;  2YNF A;  3T1A A;  3L2V A;  2BGG A;  2FF3 B;  4E1M A;  5AQH A;  1DEJ A;  3CJA A;  4DLE A;  3OYG A;  3A5M C;  3CC2 N;  2NRV A;  2FC0 A;  2P9L B;  3QLH A;  4DV5 K;  2BDP A;  4EP4 A;  1S9G A;  1WBB A;  3CQY A;  2I7P A;  2OPP A;  1CXU A;  5AQO A;  3T3F A;  4CBX A;  2BAN A;  4DV6 K;  3ENO A;  2KHO A;  4DKW A;  1HKG A;  1IJJ A;  3FR0 A;  2J4R A;  5CYM A;  3H3N O;  5F2R A;  4JKG A;  4B9V A;  1VHX A;  4UY8 O;  1TGO A;  1CZA N;  3O3H A;  3OS2 A;  4HCC A;  2F8T A;  3BF1 A;  3QET A;  2VQE K;  4JI2 K;  3NF6 A;  4CEZ A;  4YDU C;  3B8A X;  3HM9 A;  1NJX A;  4B9U A;  2OTJ N;  2VWB A;  4GMJ B;  2QWQ A;  3C7N B;  3HM8 A;  5J1E A;  5LJW A;  1ASU A;  3HT3 A;  1YIT N;  1KLN A;  3J80 O;  3VQQ A;  4DSJ A;  1VSK A;  5KRS A;  3VQB A;  3QIC A;  1BCM A;  4BRO A;  1KVA A;  1VRU A;  1QS4 A;  5F1X A;  2E2P A;  3TAR A;  5AQM A;  5AQR A;  4CJW A;  4FJI A;  1NM1 A;  3MX2 A;  4H0X B;  4HCB A;  5BN8 A;  4CD1 A;  4BE1 A;  5ADX H;  3AO5 A;  4BAC A;  1BG3 A;  1DTT A;  1U49 A;  3RWU A;  1P90 A;  1TAQ A;  4PL8 A;  1TK5 A;  3RRH A;  1IBM K;  1SL0 A;  2HST A;  2IOC A;  3TAQ A;  3MDQ A;  3TTC A;  3OYB A;  2HBK A;  4A5B A;  3LZI A;  1KC8 O;  3MN7 A;  3UKR A;  4A62 A;  3HBT A;  2QW9 A;  3LDL A;  3HPG A;  2XHB A; 
#chains in the Genus database with same CATH homology
 4EAH D;  2Q0R A;  1LOT B;  3KK7 A;  4IJN A;  3P39 A;  3LDN A;  4BRD A;  2HBJ A;  5AZJ B;  4KBO A;  1VAZ A;  5BPM A;  4EHT A;  5AZI A;  2FF6 A;  3QFU A;  3SAF A;  4XH5 A;  3WEE B;  5LY3 A;  4JKH A;  2P9N A;  1VQM N;  3U8X A;  5BR9 A;  4RCH A;  1MDU B;  2V51 B;  2FLO A;  1TUY A;  3CJ1 A;  3G25 A;  4FOE A;  1O13 A;  3OBW A;  2YJF A;  5B8H A;  3UB5 A;  4BRG A;  5AQL A;  3FLC O;  2KKZ A;  4FWM A;  4YOY A;  4BC5 A;  3VOV A;  3SK3 A;  5AQV A;  3TU5 A;  2A42 A;  3MWT A;  4CZK A;  2ZJR L;  2KLA A;  2P9K B;  4BGB A;  1ZXO A;  2Q36 A;  1YVN A;  4YOW A;  4WCE L;  3VET A;  3VGK A;  1DKG D;  4GY2 B;  4IEI A;  1LCU A;  3FZH A;  3D2F B;  3MN6 A;  5AFU H;  2ZJP L;  5C2F A;  1QVF M;  1Q86 O;  1QQN A;  1GLE G;  1VQO N;  2IIR A;  3F2K A;  4NB4 A;  3CCL N;  4MLE A;  3GBT A;  2A3Z A;  5EOY A;  4R79 A;  3C6A A;  1QZ5 A;  3CCM N;  1X3N A;  4FPA A;  2QTD A;  5F0X A;  5BN9 A;  4CBW A;  1NJI O;  1V4T A;  3MMV A;  4BQL A;  5AQX A;  3I56 N;  3IFR A;  2IVO A;  5KPT A;  5LJV A;  2P9U A;  4I6M B;  4Y0W A;  5AQI A;  5JLH A;  4JKE A;  3RVC A;  3J7Z O;  4B1U B;  3DLL L;  4A5A A;  3CD6 N;  4A2A A;  4YOT A;  3ATV A;  2AP1 A;  5JMV A;  3I55 N;  3CI5 A;  3HI0 A;  3O9S A;  4MO5 A;  5KQD A;  5C2D A;  3T69 A;  4O8U A;  2Q2R A;  3ZX0 A;  4B1Y B;  1NGB A;  3WXJ A;  3VEN A;  2V7Z A;  4PKI A;  3MN5 A;  3FZK A;  3DXM A;  3L0Q A;  4JNE A;  5EX5 A;  3D2E A;  5MLC Q;  1G99 A;  4IEE A;  1VQK N;  5AQT A;  2GEL A;  3E1Y A;  3TPQ A;  3UKU A;  3WXK A;  4JHD B;  4WYB A;  1J6Z A;  2D0O A;  4K43 A;  4BR9 A;  3PIO L;  4WQ4 A;  3E66 A;  4KH5 A;  1HKB A;  2BUP A;  3VER A;  5E26 A;  4MDB A;  4BRL A;  3WQU A;  3H45 C;  4CBU A;  2HOE A;  4O8K A;  3WQT A;  2PFU A;  2UYT A;  3AGR A;  2V7Y A;  3N4Q A;  4ILG B;  4WQ5 C;  5EVZ A;  1YAG A;  1NWK A;  2W40 A;  2P9S A;  1YI2 N;  4BRN A;  5AQW A;  4BR7 A;  3WXM B;  1YHQ N;  2GWK A;  1V4S A;  3P38 A;  1RFQ A;  1N8R O;  2ZWH A;  3A8Y A;  3LDP A;  3CF5 L;  5C15 A;  1E4G T;  1QZ6 A;  3QBX A;  1YXQ A;  5M1F A;  3AAP A;  1BWF O;  2E1Y A;  3IUC A;  1K8A O;  4MO4 A;  4ILH A;  1IG8 A;  3VEY A;  1M90 O;  3MWP A;  4JN4 A;  5M1P A;  4AM7 A;  3L4I A;  4JKG B;  4CZG A;  1KAZ A;  1HX1 A;  2A40 A;  4H5R A;  1MWK A;  3SMP A;  4BC4 A;  4DQ8 A;  5AQS A;  4CZI A;  3CET A;  4IOX A;  3E9O A;  5GIO A;  1KD1 O;  3ZET A;  2VGN A;  2RE2 A;  3G4S N;  3BUZ B;  1D4X A;  1ZBS A;  1KXP A;  3FZF A;  3WUH A;  2E2N A;  4Z94 A;  5C12 A;  3U9D A;  1TYQ A;  2JWL A;  4FWL A;  4B1X B;  1XQS C;  1GLA G;  4BQZ A;  1ATS A;  1NMD A;  3Q7B A;  4CI6 A;  1ZC6 A;  3VEV A;  1GLD G;  3VGM A;  4JK9 A;  1NGA A;  2YX6 A;  3GDQ A;  3IMX A;  3QB0 A;  2CGJ A;  3MN9 A;  5BRH A;  4BC3 A;  5H1S Q;  1QQO A;  2D4W A;  1DGK N;  1RDW X;  1GLB G;  3M1F A;  1MWM A;  5M1K A;  3ATU A;  3CMA N;  2F7T A;  1BA1 A;  1YF5 L;  1HUX A;  1OKJ A;  1M1K O;  3S41 A;  2P9I B;  4BY9 C;  1NGJ A;  5M1Q A;  2QWO A;  2QI2 A;  4H5N A;  4IXC A;  4CD3 A;  1BU6 O;  3BF3 A;  3MCA B;  3SBT A;  4IO8 A;  5FPN A;  3A5N C;  1GLL O;  4BC2 A;  3P4I A;  3CPE A;  4A57 A;  4HWI A;  1T6C A;  3CHW A;  2A41 A;  4ISG A;  3EN9 A;  5TKW A;  5BRF A;  3C65 A;  5GIP A;  4H5W A;  2CGK A;  3KWI A;  4H5V A;  4MLH A;  4OO1 J;  2F9W A;  2QWL A;  3FZM A;  3D2F A;  2ASP A;  3MX5 A;  3OW2 M;  4EIA A;  1EO1 A;  3FFK B;  4JKD A;  1YJN N;  3CJ7 A;  5TKY A;  3VF2 A;  1JCE A;  3TTD A;  2WC9 A;  1JCF A;  5GAE P;  4WF9 L;  3PIP L;  1GLF O;  1BDG A;  3A5L C;  4AF1 A;  3EKS A;  3DJC A;  3OHR A;  4A2B A;  2ASM A;  3R6M A;  3ULE B;  3MCP A;  5FPE A;  1Q7Y O;  1ILY A;  4B1V A;  2ASO A;  3DXK A;  5AQU A;  5BPN A;  5AQY A;  1T6D A;  5CE3 A;  1U2V B;  3CPW M;  3CME N;  1SZ2 A;  2I7N A;  3RSE A;  3ID8 A;  1HKC A;  1NBW A;  5EY4 A;  4BR2 A;  3IDH A;  2Q0U A;  4I6M A;  3GL1 A;  2QXL A;  1MA9 B;  4FVU A;  1ATN A;  4JK8 A;  2P9L A;  5AZI B;  1YIJ N;  2P9N B;  3AY9 A;  3ID6 A;  2PAV A;  3ZYY X;  3Q7C A;  3BP8 A;  1NGF A;  3J8A A;  1NGI A;  3O1W A;  3O9T A;  2GWJ A;  5AQP A;  3ENB A;  3EO3 A;  4BGA A;  3NVM A;  3LDO A;  4JD2 B;  2CH6 A;  4XH1 A;  3K9J A;  3LM9 A;  3WXL A;  3MK6 A;  3R9P A;  3VMF B;  3O1B A;  5JVH L;  2Q97 A;  3O6W A;  1VQ4 N;  4L3Q A;  2D0P A;  4BRC A;  2HF3 A;  4J8F A;  3CCJ N;  1NGH A;  5JLF A;  4H0V B;  5DM7 L;  1KQS M;  3M5R A;  3GG4 A;  2YHW A;  1HJO A;  2WBN A;  3O9Q A;  3WT0 A;  3VF4 A;  4BRE A;  1WOQ A;  4BRI A;  4C23 A;  4CZF A;  5ADX A;  1BO5 O;  4PKG A;  4JKF A;  3JS6 A;  5AR0 A;  3UE5 A;  4FWS A;  5GIN A;  4E1J A;  3EE9 A;  3O08 A;  4QS8 A;  3C7N A;  5GAH P;  1YUW A;  4WQ4 C;  5BPL A;  3ZEU A;  3NVK A;  3CER A;  3CJB A;  5CHI A;  4AM6 A;  2E2Q A;  4BR0 A;  1GLC G;  4WFB L;  3CCU N;  1KAX A;  3CCE N;  1R59 O;  5EXW A;  2P9U B;  4GVE A;  4JKA A;  2FSJ A;  3CCQ N;  2RHK A;  1VQL N;  4G9Z A;  3ENH A;  1SS6 A;  3FE1 A;  3H3O B;  4K41 A;  4BRP A;  3OBY A;  2QWN A;  2OTL N;  1K8K A;  1ATR A;  4M63 C;  4QS9 A;  1VQ5 N;  3IKM A;  2GUP A;  5FPM A;  2WFB A;  3VGL A;  2E88 A;  4A59 A;  4BRM A;  4B1W B;  2P9P A;  2NRR A;  3JXU A;  4B1Z A;  3D2E B;  1H1V A;  1X3M A;  4YDU A;  3VEW A;  1Q82 O;  4IDH A;  2YJE A;  2BH1 A;  3L4Q A;  3LL3 A;  3O80 A;  3AAQ A;  3DWL A;  1Z6R A;  4HTL A;  3U4L A;  3UKU B;  4IOC L;  5FPD A;  3I33 A;  3SAG A;  2VGM A;  4IWV A;  3O9R A;  1VQN N;  4DB3 A;  4GNI A;  1DT9 A;  2FSK A;  5HOO A;  3HRG A;  3QFP A;  5JVG L;  1YJW N;  1BUP A;  1YJ9 N;  3L6Q A;  2D1K A;  4BG8 A;  4BR5 A;  4XH4 A;  5ELZ A;  4MDA A;  5GAD P;  5C0Y A;  1E4F T;  2E20 A;  4H5T A;  2P9S B;  3F5T A;  4A61 A;  3VEZ A;  5AZJ A;  4DCH A;  1T3V A;  4EFH A;  4YOX A;  2NLX A;  4IO9 L;  2V52 B;  3E9L A;  2PBD A;  3WEE A;  4O5F A;  3CQX A;  4CZE A;  4FWR A;  1S3X A;  5AQG A;  1SAZ A;  4EHU A;  3WXI A;  4FWO A;  3GOI A;  3HSC A;  1P8Z A;  4F9O A;  1NGC A;  5M1O A;  4FSV A;  4BRF A;  5GAG P;  2GEM A;  1QHA A;  2DPN A;  1K9M O;  3AAR A;  2BTF A;  3G6E N;  2P9K A;  4BVO A;  3ZX3 A;  3BEX A;  1OVY A;  3SBG A;  3HOS A;  4OPH A;  4M7X A;  1Q18 A;  1S22 A;  2NRZ A;  4KH4 A;  3KZB A;  3TTF A;  4BRQ A;  5BRE A;  1WUA A;  3H46 O;  3ZET B;  4ISE A;  2QWP A;  5AQZ A;  4BVP A;  1QVG M;  2NRT A;  2NNW A;  2ZGY A;  4ISF A;  2H3G X;  4BRH A;  3H6E A;  2VYP A;  3H1Q A;  3N4P A;  4FWN A;  1TYQ B;  4U67 L;  3TSU A;  3D6R A;  3O5B A;  1VQP N;  4BRK A;  1NLV A;  1RDU A;  2W41 A;  3UKR B;  2IVP A;  4K42 A;  4CZM A;  3M3Z A;  3O4W A;  3R1X A;  2ITM A;  3EE8 A;  2GTD A;  2YI1 A;  3EZW A;  5AQK A;  4IFE A;  1W2B M;  2QEX N;  4FWP A;  4U7B A;  3VEX A;  4ILJ A;  1RGI A;  3VPZ A;  4JD2 A;  3HTV A;  1NGE A;  2EWS A;  2OAN A;  3SLC A;  2FSN A;  5DM6 L;  2ZF5 O;  4H03 B;  5JIC A;  2GX9 A;  3CC7 N;  3KHY A;  3FZL A;  2QM1 A;  3LDQ A;  4H0Y B;  3W0L A;  3P31 A;  3NMU A;  2NRW A;  2YHY A;  1XC3 A;  2ZJQ L;  4FPB A;  4YOU A;  1Z05 A;  2HMP A;  3VTI A;  3I8B A;  2Q31 A;  4YOV A;  4C1N K;  1QQM A;  4FOI A;  3LM2 A;  3GE1 A;  4JHD A;  1HLU A;  5AQQ A;  1C0G A;  3ZX2 A;  4DHY A;  3E9P A;  3QBW A;  3VTH A;  4BRA A;  5HL7 L;  3HZ6 A;  1NGD A;  5BRD A;  5KQ8 A;  2FXU A;  3DXK B;  4CZJ A;  4H0P A;  3FGU A;  2E1Z A;  1HPM A;  4K25 A;  1VQ9 N;  2JWK A;  5I9E B;  4BG9 A;  3C0B A;  3RSE B;  4BR4 A;  3HOT A;  1S72 N;  1BOT O;  4RWT A;  2FF3 B;  3CJC A;  5AQH A;  1DEJ A;  3CJA A;  4C1N I;  3A5M C;  3CC2 N;  2E2O A;  2NRV A;  2WUS A;  3VES A;  3PLA A;  1U6Z A;  4FWQ A;  2P9L B;  4WFA L;  3KWG A;  4JAX A;  1W97 L;  3R3L A;  4JK7 A;  3K9K A;  1JCG A;  3CQY A;  2I7P A;  3CIP A;  3TSQ A;  4B9Q A;  3O8M A;  5AQO A;  4CBX A;  4QS7 A;  3CCS N;  3ENO A;  2KHO A;  1GLJ O;  4JKC A;  1HKG A;  2NRX A;  4H0T B;  4NO7 A;  1IJJ A;  3FR0 A;  2J4R A;  4DKW A;  3H3N O;  1BA0 A;  3CC4 N;  3M6G A;  5F2R A;  4JKG A;  2CGL A;  5E84 A;  4UY8 O;  2CH5 A;  3EKU A;  4CJ7 A;  1CZA N;  3F9M A;  2AA4 A;  3G71 N;  2HBM A;  3BF1 A;  4FO0 A;  4YOR A;  4NLB A;  3DXM B;  2QWM A;  2YHX A;  1TUU A;  5CR4 A;  4YDU C;  3B8A X;  2E8A A;  3C6H A;  4CZL A;  1VQ6 N;  2OTJ N;  3D7E O;  2VWB A;  4WQ5 A;  3SMS A;  2QWQ A;  3C7N B;  3HM8 A;  3H1V X;  1X9J A;  3W3D A;  1NGG A;  5LJW A;  1YIT N;  3OA9 A;  5AQN A;  2NZT A;  4H0O A;  3ZEU B;  2HBL A;  4GV6 A;  4XEI A;  2QWR A;  4NLC A;  2Q1N A;  1Y64 A;  4GV3 A;  3QIC A;  1SQK A;  4BRO A;  4JKB A;  5F1X A;  2E2P A;  5AQM A;  5AQR A;  3CCV N;  3CCR N;  4M7Y A;  4PL7 A;  3VF6 A;  1ESV A;  5AQF A;  1XUP O;  2VCP A;  3A0I X;  1NM1 A;  2QA4 N;  1VQ8 N;  3MX2 A;  4GV9 A;  4H0X B;  4PKH A;  2P9I A;  1EQY A;  3A5O C;  4CD1 A;  1K8K B;  5AFU A;  5BN8 A;  5M1N A;  3DAW A;  2A5X A;  5KPZ A;  5ADX H;  1VQ7 N;  1T44 A;  1Q81 O;  4RTF D;  2YCH A;  1BG3 A;  2P9P B;  1P90 A;  3O9U A;  1KAY A;  2ZGZ A;  4LC9 B;  4PL8 A;  3U9Z A;  4PHT X;  4FWK A;  2A6A A;  4KH6 A;  4WFN L;  3CXC M;  4CZH A;  1K73 O;  3R8E A;  2F9T A;  3CJ9 A;  5AQJ A;  3QML A;  3SAH A;  2HST A;  4IZ9 A;  3SJH A;  3MDQ A;  5C10 A;  3VEO A;  3AGK A;  3TTC A;  2NRH A;  2HBK A;  4OPA A;  2IVN A;  3ULE A;  4A5B A;  2HF4 A;  4IJA A;  3MN7 A;  1KC8 O;  4FL9 A;  5KPR A;  3KVG A;  3UKR A;  3HBT A;  4A62 A;  2QW9 A;  3EL2 A;  3T7Z A;  3QDK A;  4IOA L;  1U2V A;  3LDL A;  3TSP A;  1C0F A;  4JEP A;  1JJ2 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...