4LY7A

Ancestral rnase h
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
153
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYKQHEKTFSAGFHLTTNNRMELMAAIVALESLKQPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAAIQRHTINWKWVKGHAGHPENERCDELARTAAESPTLEDVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Thermodynamic system drift in protein evolution.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 50
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ly7A00
4WE1A 1HRHA 3VQ6A 3TABA 1NK8A 4CE9A 1UWBA 1WSGA 2HNDA 3ISNC 2BDPA 4EZ6A 3OYGA 2VWJA 2KFNA 1VSHA 5KRSA 3ZSVA 4CJVA 4AILC 4CGDA 5CZ1A 2OYQA 3L2RA 3AA5X 3B6PA 3VQCA 3F73A 3LP2A 1RBSA 3QINA 4DFKA 1NJXA 1VSDA 4OGCA 2OZMA 3V1OA 3V9SA 1HMVA 3K5NA 3DLBA 4F4KA 4O5BA 5J2NA 2R7YA 4FJGA 3NDKA 3AO4A 5E41A 3NF6A 3TR8A 1RBRA 1TVRA 3NGZA 3SV4A 1JLQA 3JYTA 1DLOA 4DU4A 1TL1A 4KTWA 1SL0A 1WSJA 2HHTA 1IKXA 3VQBA 4E7KA 3V9WA 1NK6A 3WNFA 1QQCA 2OPSA 1JXBA 3OYCA 4CJTA 1UA0A 1W9HA 4M41A 2JLEA 5SWMA 3HM9A 2ZQBA 3MECA 3K5LA 1VSIA 4Y1CA 1VSLA 1QS4A 1NJZA 4O55A 1D9FA 4CK2A 5CYQA 4FJLA 2D0AA 3V9XA 2OA8A 3OS1A 5HRSA 2DFFA 4FJHA 1GOAA 5KRTA 3TI0A 3L2VA 3OYDA 3KK1A 4FLUA 3OYAA 2XO7A 1DTQA 4HTUA 4HUGA 3NGYA 3ZT0A 3F9KA 4FK4A 3G10A 5I3UA 4EZ9A 4PUOA 3EZ5A 3CYMA 3ZT3A 4DTJA 1BHLA 1QHTA 1RNHA 4OKEA 2KFZA 3V9ZA 3U6FA 3AVKA 2HHUA 1WLJA 3TAMA 4CJ4A 3CFRA 3SZ2A 2F8TA 2XY8A 5KGWA 4J2DA 3ZSQA 3V81A 1D5AA 2E4LA 1RT1A 3AO1A 3SUNA 4J2EA 3S3MA 4FCYA 4Z4IA 4M3WA 4KRFA 3OYHA 2NUBA 1O1WA 4OVLA 3VQ8A 3HP6A 1RDBA 4Z0UA 1L5UA 1EP4A 4DF4A 4KHNA 3MEGA 3OYJA 1LWEA 1IKWA 1F21A 3SQ4A 4DSEA 3QLHA 2QXFA 4Z4EA 1XWLA 5JS1A 3HYFA 4FJIA 1W0HA 1RT6A 4CFDA 3DLGA 4HCCA 3SJJA 4FJXA 3CFOA 2EHGA 2RN2A 1R0AA 2HHXA 2IC3A 3SV3A 4O0IA 1A5VA 3M8PA 5J2MA 1J54A 4CJLA 1SL1A 4IKFA 4NCAA 3RRHA 4I9LA 4IDKA 4QCLA 1EX4A 1KVCA 5CZ2A 4DMNA 3ZSRA 3QEVA 2G8FA 3BDPA 3OYIA 4HCBA 1RBUA 2FBVA 1TK5A 1WAJA 4K8XA 1I3AA 3DLKA 2Y1IA 1RTIA 4FK2A 3DMJA 4AHSA 1C6VA 4IFYA 4FZZA 3HK2A 3MXIA 4Z4CA 1A5XA 4F3OA 4HUEA 4B9NA 4JS5A 2AJQA 4M3UA 5JS2A 3QEWA 2OPRA 4E7LA 3HP9A 1BI4B 3BGRA 4UQGA 3VQ7A 4GVMA 1L3TA 4FW2A 3AO3A 3S3NA 3C6TA 3IRXA 1NKCA 3VQDA 3I0SA 1X9SA 1T05A 4C8OA 3NF8A 4CJKA 4FLZA 4F2RA 3LWMA 3K57A 2A1RA 3O4QA 4FJ9A 3OYFA 1CZBA 1GOCA 1YTUA 4DTMA 3ZSWA 1Z25A 3ZSOA 1CZ9A 1WN7A 1BI4A 3M8SA 2D0CA 1B9FA 3U3GA 1TK0A 4KI6A 3KKRA 4PWDA 3QIOA 2P51A 4CGIA 3VQAA 1YTAA 4CK3A 3I8DA 4DQRA 3S3OA 1JL1A 4YNQA 4B9TA 4QOZB 3K59A 4CHYA 4W5NA 3H08A 4PA1A 3C95A 3ULDA 3DRRA 1SL2A 1WSHA 1B9DA 1RTHA 3DI6A 4C8MA 3L2UA 1SV5A 3L3VA 4CJWA 3KLFA 3KLHA 3PX0A 1LV5A 1L3VA 5J1EA 1HYSA 4FM0A 1CLQA 4KTQA 2IGIA 3KKSA 1CXUA 3O3GA 3ASMA 3VQPA 4GW6A 3SCXA 2BE2A 3NF7A 3LP3A 5C25A 1U47A 4B9LA 1KSPA 2P5GA 1JLEA 2HHWA 4Z4HA 2O4GA 3QETA 3D45A 4FJKA 1ASVA 2G8WA 1CXQA 4FLYA 4DSIA 2VG5A 2IAJA 1HYZA 1JXEA 4CFCA 1BCMA 1VRUA 3DLRA 1NKEA 1N5YA 4MFBA 4R5PA 1Q9YA 3L3UA 3AVNA 4RW4A 1KLNA 3OYKA 4J2BA 4FJ7A 5FRMA 2KTQA 4KV8A 1FKOA 4IG0A 4E1MA 4CEFA 1TKXA 3ZSYA 5D3GA 4I2PA 3DOKA 4KB0A 2VG6A 3SUQA 1HPZA 4CEZA 4CIEA 3SQ2A 4OLBA 1GOBA 3PUFA 4CF0A 3AO5A 4CJUA 4KPYA 3RMDA 3TWHA 3VQ9A 3HXMA 3KLIA 3QEPA 5HLFA 4L8RB 1ZBHA 4Z4GA 2GUIA 1HYVA 2ATQA 2XY6A 4B9MA 1RDAA 4F2SA 3C94A 1T7PA 3LDSA 4KHSA 2F8SA 1VSJA 1S1TA 1BIUA 4JRQA 4M3TA 1QTMA 1RT7A 1QE1A 4KKOA 3KLGA 3NHGA 1D8YA 3V6DA 4FLTA 3VQEA 2P5OA 5C42A 3QO9A 3AVMA 5DMRA 4CF8A 4I7FA 3NE6A 2YKNA 1BGXT 3HPHA 4H4OA 1LW2A 4DS4A 4DU3A 1EKEA 2YNHA 3LAMA 1IH7A 1C1CA 4CEAA 4N76A 3LZJA 2QKKA 3HVTA 1FK9A 4FM1A 1XHZA 4Q0BA 2W42A 1U48A 4HHTA 3DLEA 4ZHRA 5J2QA 4KFBA 1TKDA 4CF1A 3K5MA 4ELUA 1A5WA 3ITHA 4E1NA 3OS0A 1ZBLA 3VQ5A 5C24A 4KO0A 2G8KA 3OYMA 2PY5A 3KD5E 2ETJA 3NCIA 5DK5A 4B9SA 1HNVA 2Q3SA 4DSLA 4PY5A 4KAZA 3K5OA 3NAEA 4F3TA 1X1PA 3KTQA 1RT2A 2A1SA 3DM2A 3V9UA 1JLGA 4W5TA 1KFSA 4CF9A 3LP1A 3HO1A 4NCGA 1U4BA 3HVRA 3NF9A 4FW1A 3QNOA 4CGFA 5I42A 3LANA 1ZBIA 3MEDA 3AVGA 4DLGA 2X74A 4W5OA 3OS2A 4ZTJA 1C1AA 2Z1JA 3T1AA 1J53A 1KFDA 1Q8IA 4CFAA 4DF8A 3VQ4A 4DFPA 1FKPA 4ID5A 3ZT1A 2G8UA 1RTJA 2WOMA 2HW3A 3RR7A 1RBVA 2YNIA 3MAQA 3WNEA 4E7HA 4DTSA 4DWIA 2I5JA 4OPKA 3CFPA 3KLEA 4KHQA 1NK4A 4CEQA 3PO4A 4FZYA 1WSEA 1YVUA 1UAXA 3WNHA 3IS9A 4CF2A 3QEXA 3IG1A 3VN5A 4LH4A 4M3ZA 4CEOA 1MU2A 1VSMA 4N56A 1JKHA 4FJ8A 4N5SA 4EP5A 5KTQA 4DQQA 4DS5A 3M8QA 4CCHA 3RMBA 1J9AA 4DTRA 3V1RA 3ZSXA 2KQ2A 3SPYA 3LZIA 4LSNA 3AA4A 3K2PA 5KGXA 4IG3A 3QEIA 4CGGA 2IDOA 4CEDA 3EY1A 4H8KA 3HJFA 1UOCA 2HVHA 3NBPA 4DSFA 3CG7A 4I2QA 1DTTA 3NH2A 4DTXA 4OJRA 1QSLA 2D5RA 1B92A 1BQNA 2GBZA 3VA3A 4CESA 2YNFA 3RR8A 3IAYA 4FJJA 1XHXA 3OYNA 3TARA 3OYLA 1KVAA 1KVBA 2F96A 4AH9A 4DSKA 2DTUA 4ID1A 4CJEA 1HNIA 3LPTA 3SI6A 1D9DA 2X6NA 1TV6A 3FFIA 4CK1A 1L3UA 4ELVA 2X6SA 4CHOA 1LWFA 3P83D 5HRRA 4CHQA 1VSFA 2PYLA 2OZSA 1BQMA 4NCBA 1HQEA 3K58A 4K8ZA 4JLHA 3OYEA 3PO5A 3OVNA 4FJ5A 4FLXA 2KZZA 1K6YA 1C1BA 1ZBUA 2HMIA 4KHWA 4YFUA 4OKKA 3PX6A 2HHQA 4B8AB 2Z1GA 4IFVA 4HVJA 5SZTA 5K14A 4CIGA 1N6QA 1XC9A 1VRTA 3ALYA 4G1QA 1RTDA 4TSXA 5T7BA 1TK8A 3O3HA 2HHVA 3OYBA 3DYAA 2DFHA 4MQ3A 1BISA 4AHRA 4AHCA 4CFBA 3RMAA 4M42A 4M3XA 3RWUA 3SQ0A 4N41A 4DFMA 3KJVA 1NK9A 2GV9A 3ZCMA 4KHUA 4B3OA 4W5QA 2HB5A 4DTPA 3LAKA 1RT5A 1TL3A 2FBYA 2OPPA 3LP0A 3AA2A 3NH0A 1NOYA 3LALA 4FK0A 4DLEA 3SPZA 3HT3A 1WSFA 3AO2A 4FJMA 4BWJA 2OPQA 2QK9A 1S6QA 3TAPA 4DQPA 1IG9A 1S9EA 2XRIA 1KLMA 4H4MA 1UA1A 3RTVA 1X9MA 2JGUA 4OGEA 2YHBA 5J2PA 4LH5A 3DRSA 3ZT2A 4E89A 3OJSA 1SKSA 4DSJA 2VWKA 1ZYQA 3KD1E 3S9HA 1NKBA 3AVJA 3SUOA 2VG7A 3PV8A 1ZBFA 2E6LA 3KIOA 4FXDA 1YT3A 2YNGA 4FVMA 4C8NA 3NGIA 2Z1IA 4BE2A 4BE1A 1Q9XA 1S1WA 4E7IA 2HNYA 3DLHA 4ICLA 3HPOA 4HUFA 1T03A 1VSEA 2RPIA 4BWMA 4Z4FA 3QESA 1J5OA 4RW8A 1JLCA 2D0BA 4AHTA 3D0PA 3THVA 1BCOA 3KK2A 1VSKA 1G15A 1RILA 2ZE2A 3T3FA 1JL2A 2WONA 1WNSA 1SKRA 2Z1HA 4M3YA 3KK3A 1IO2A 1LAVA 2FBXA 1EETA 4KREA 1WAFA 3SQ1A 1U04A 4O4GA 1ASWA 4CIFA 1NK7A 4XIUA 3L2QA 1EXQA 4RW9A 1KTQA 4DFJA 1BIZA 3V1QA 4FJNA 2B4JA 3MXMA 1TAUA 3B6OA 2QKBA 2HNZA 5HROA 3VQQA 1TKTA 1X9WA 1RBTA 4AHUA 4ELTA 4E3SA 3ZSZA 4B8CA 2G8HA 2PZSA 4DQIA 4KB1A 2FBTA 1QSSA 3SYZA 3PY8A 2ZD1A 4RW7A 2YHAA 3CM5A 4CJQA 1SUQA 3L2WA 2G8VA 3MXJA 4BDPA 2HHSA 1NK0A 4C8KA 3RMCA 1FXXA 4FLWA 3OY9A 1C0MA 4NYNA 4CECA 3AV9A 3QERA 3A2FA 1TGOA 4OPJA 3EYZA 2XY5A 4CGHA 1JLFA 3MEEA 4C8LA 4KI4A 1RDDA 2XY7A 2YKMA 3M8RA 4E0DA 2KW4A 4GMJB 2ITGA 4CEEA 4NYFA 4Y1DA 2P1JA 4CHZA 4Q5VA 4LSLA 3AVLA 5KI6A 1S1XA 1RDCA 4FLVA 1I39A 1RCHA 3HPGA 2BANA 2DFEA 3LWLA 1T8EA 3AVIA 4DG1A 4DTUA 1TKZA 4BDZA 4F8RA 1HJRA 1Y97A 1XI1A 5FRNA 3AVAA 4RW6A 1SKWA 1WSIA 3P1GA 2E6MA 4O0JA 3U3YA 4DU1A 1S1UA 1RT4A 2BGGA 2G8IA 4CJFA 4PQUA 3P5JA 4E19A 2IS3A 2LSNA 4O44A 4CJSA 2RKIA 4CJ5A 4M45A 4KHYA 4BDYA 3LPUA 3G0ZA 4I9QA 1S9GA 3TANA 3SNNA 2B5JA 4B9VA 5FROA 4J2AA 3AVHA 4RG8A 4N47A 3PX4A 4M3RA 1U49A 4CJPA 4FZXC 4JS4A 4FM2A 4DQSA 1LAWA 3TAGA 2B6AA 5CY4A 5HRPA 5HP1A 4CJ3A 1NJYA 1C0UA 3TAQA 3DOLA 2XHBA 4CJRA 1ASUA 4E7JA 1VK0A 4AHVA 4FYDA 3CM6A 4IBNA 2PYJA 4QAGA 3CQ8A 3VA0A 1S6PA 3SUPA 3E01A 1TAQA 2Y1JA 2IOCA 3HSTB 4ZTFA 3QNNA 1REVA 4KTZA 3QIPA 4DTOA 1LW0A 3NH1A 2RF2A 3T19A 5CYMA 3UIQA 5HBMA 1S5JA 2KZMA 2YV0X 3OJUA 1LWCA 3AVBA 1BL3A 1U45A 4BACA 3AVCA 3NFAA 1JLAA 3DRPA 3TAEA 1NK5A 4LY7A 1C0TA 3JSMA 4CHPA 1KRPA 1NOZA 3C6UA 1ITGA 1L3SA 1NJWA 3I0RA 4OKJA 4CHNA 1Z26A 1JLBA 2DY4A 3RRGA 3AVFA 3AA3A 3O4NA 1S1VA 4B9UA 3HL8A 4B08A 4LD0A 3L8BA 4BE0A 4JRPA 2EX3A 3WNGA 4CERA 3ZT4A 4CGJA 1IKYA 1HQUA 5EU7A 5HRNA 3O3FA 2FC0A 4DTNA 4OLAA 4CEBA 5FDLA 2X78A 2O4IA 2HVIA 1KCFA 1IKVA 1RT3A 3V4IA 1QSYA 4W5RA 3TAFA 4EP4A
chains in the Genus database with same CATH superfamily
4WE1A 5BPLA 4X64K 3TABA 4CE9A 2BDPA 2VWJA 1FW6A 5AJ3K 4B3TK 4CJVA 4JK9A 3WEEA 3KHYA 4CGDA 5CZ1A 1OH8A 3L2RA 4KH4A 4DFKA 1RBSA 1VSDA 3FE1A 3V9SA 4FJGA 4CZFA 1XC3A 3GG4A 3SV4A 3JYTA 4X62K 1DLOA 4DU4A 3CJBA 5LY3A 1HJOA 3VESA 1VQMN 3E9OA 2ZGZA 4FWRA 2OPSA 1W9HA 4M41A 2JLEA 3HM9A 3K5LA 1VSLA 4H5NA 1O13A 4JD2B 4FJLA 2OA8A 5HRSA 4FJHA 3TI0A 3LDOA 1GLFO 4HUGA 3NGYA 5EOYA 3G10A 1BU6O 5I3UA 4EZ9A 1V4TA 1QHTA 4OKEA 4MLEA 2HHUA 4JD2A 5AQXA 2AP1A 2D1KA 5AQHA 2XY8A 5FLXO 4FL9A 4J2EA 4BRQA 4M3WA 4PKGA 2ITMA 1L5UA 4Z0UA 4DF4A 3FR0A 1LWEA 1F21A 2GELA 3HYFA 1W0HA 4FWSA 1RT6A 4CFDA 1KAXA 3DLGA 3SJJA 4DUZK 4O0IA 2FLOA 4BRGA 3B8AX 4IKFA 4I9LA 1KVCA 4DMNA 2G8FA 1RBUA 1WAJA 4FK2A 4JKDA 2BTFA 4IFYA 4FZZA 4B9NA 1TUUA 3QEWA 1GLCG 4FWMA 2NRHA 3HP9A 2QWQA 4FW2A 3N4QA 4BVOA 1X9SA 4V19S 4C8OA 1HLUA 4CJKA 1OVYA 4FLZA 1NGIA 4HWIA 3OW2M 3O4QA 3I8BA 4FJ9A 1YTUA 5FPMA 4DTMA 3CXCM 1WN7A 2D4WA 2WFBA 1T3VA 3I8DA 2P51A 1XMOK 1YF5L 4QOZB 3VGMA 3S3OA 4YNQA 4PA1A 3ULDA 1VQ7N 4DR4K 1WSHA 1KRPA 3L3VA 3KLHA 1HYSA 4DCHA 4IWVA 2ASOA 3I33A 4FWPA 2UU9K 1VQ4N 1QVGM 5C25A 3LP3A 4JI4K 1U47A 4M63C 4FJKA 2G8WA 4FLYA 1VRUA 4C1NK 4MFBA 4R5PA 3U8XA 3U9DA 2UUAK 1KLNA 3DXMB 4XEIA 3OYKA 4J2BA 2E2PA 4KV8A 4IG0A 3UKUA 3G71N 3ZSYA 4I2PA 2VG6A 3MWPA 5FPNA 3KWGA 1GOBA 5B8HA 3VQ9A 5HLFA 1WBBA 3DXMA 1DGKN 4B9MA 2DTUA 3HRGA 2F8SA 4M3TA 4JI5K 4KKOA 3VQEA 4CI6A 3ZX2A 4I7FA 1BGXT 4JI2K 1E3MA 3HSCA 3SBTA 2QWRA 3LAMA 3QFPA 1C1CA 4CEAA 2KKZA 4F9OA 3EN9A 3HVTA 2W42A 3OS0A 3VQ5A 4KO0A 3OYMA 2ETJA 4JEPA 2Q3SA 3K5OA 2CH5A 3NAEA 4FOEA 4BREA 3DM2A 1JLGA 4W5TA 4CF9A 3LP1A 1ATRA 1ZBIA 3OS2A 4GNIA 3T1AA 1FKPA 1IBKK 2G8UA 1VQLN 3FZKA 2WOMA 1XUPO 1NK4A 3PO4A 3MN7A 1UAXA 4NO7A 3WNHA 3VN5A 4CEOA 4FJ8A 4N5SA 3ENBA 4DQQA 3TU5A 2JWLA 2P9LB 3AA4A 1HKCA 5KGXA 4CGGA 3OHRA 3EY1A 4H8KA 1UOCA 2QEXN 4I2QA 4FPBA 5FRMA 3VETA 3NH2A 4BR2A 2D5RA 2GBZA 2I7PA 3VA3A 4CZIA 1XHXA 3TARA 3OYLA 1NGEA 4AH9A 4CJEA 1HNIA 1D9DA 2X6NA 3RVCA 4CZHA 3NMUA 2P9LA 5AZIB 1VQKN 4CHOA 4KBOA 3P83D 3UB5A 5AQPA 1BQMA 4NCBA 3K58A 5CHIA 4FJ5A 3C65A 4BRAA 1U2VB 3VF6A 3PX6A 1N36K 4GV9A 4FWOA 3H1VX 3T69A 4IFVA 5AZIA 1XC9A 4CVNE 1RTDA 4RWTA 2D0OA 3O3HA 2VGMA 3D7EO 2HHVA 5BRDA 1BA0A 1BISA 4AHRA 3HTVA 1U2VA 3SQ0A 1NK9A 3CCJN 3ZCMA 4KHUA 4W5QA 4DQ8A 1NGBA 3LAKA 1NOYA 2OPPA 5IT9O 3P4IA 2OPQA 4K43A 1S6QA 3TAPA 1RDUA 4OGEA 1YUWA 3DRSA 4E89A 3MMVA 4WQ5C 1ZYQA 3KD1E 5DM7L 2H3GX 3U4LA 3F2KA 3KIOA 3NGIA 1GLLO 2Z1IA 4BE1A 3HPOA 1VSEA 2RPIA 4K42A 4M7YA 3QESA 3MN9A 1J5OA 4GV6A 3THVA 4M3YA 3T3FA 1WNSA 1IO2A 1LAVA 2FBXA 4JI3K 3SQ1A 3O5BA 4CIFA 1GLDG 2QW9A 3V1QA 3I55N 4FJNA 3DXKB 3B6OA 3VEVA 3DWLA 4NXMK 4ELTA 4E3SA 1RGIA 3ZSZA 1VHXA 1NK0A 2F9TA 1FXXA 3DXKA 4BG9A 3QERA 4DKWA 4O8UA 1TGOA 3G25A 4OPJA 3QBXA 1YJNN 2XY5A 4CGHA 5M1NA 3CCQN 4BRHA 4E0DA 2KW4A 1NMNA 3AVLA 1WOQA 3FZFA 2BANA 2DFEA 1T8EA 2QWMA 4BDZA 1Y97A 1SKWA 3P1GA 4O0JA 3U3YA 2G8IA 1RFQA 3TTDA 4PQUA 2LSNA 4YOTA 2RKIA 2P9SB 3QBWA 4BR7A 2PFUA 4WYBA 4X66K 4BDYA 3LPUA 1R59O 4B9VA 2O8EB 3VEZA 1IBLK 3AGKA 1BO5O 2VQFK 2V7ZA 1SQKA 3T1YK 3PX4A 3NVKA 4BRPA 2ZF5O 4JS4A 4DQSA 3SK3A 1LAWA 5AQYA 1X3NA 3QDKA 4CJ3A 2P9SA 2XHBA 2O8EA 3CQ8A 3E01A 4R79A 2IOCA 3HSTB 4XH1A 1X9JA 4ZTFA 3QIPA 5HBMA 4A57A 2KZMA 4CZGA 1LWCA 2UXBK 2A3ZA 2Q31A 3IKMA 3C6UA 1ITGA 3VEWA 4H0XB 1NJWA 1W7AA 4OKJA 4CHNA 3FZLA 3AA3A 3O4NA 1S1VA 4B9UA 4B1YB 4CD1A 3MCPA 2QXLA 3IMXA 4OLAA 4DTNA 3U9ZA 4CEBA 4DR5K 2HVIA 1QSYA 4W5RA 1YI2N 4EP4A 1HRHA 1WSGA 2HNDA 3ISNC 4LF4K 5KRSA 4RCHA 3KVGA 4NLBA 1QVFM 5EVZA 2OYQA 1VQ5N 2VQEK 3N4PA 3F73A 3ID8A 3V1OA 4B3RK 3DLBA 4F4KA 4O5BA 4WQ5A 3NF6A 3TR8A 3HBTA 3NGZA 1JLQA 3VEXA 4DHYA 1MWKA 2JWKA 1NU0A 3O4WA 3VQBA 3T1HK 2NRZA 1CZAN 2V51B 4CJTA 1UA0A 1I94K 4BRDA 4Y1CA 1QS4A 4CK2A 3LL3A 2D0AA 3V9XA 3CCLN 2DFFA 1GOAA 5KRTA 3W0LA 3OYAA 1DTQA 1W2BM 4HTUA 1HX1A 1IV0A 4FK4A 2Q0RA 1N32K 3ZT3A 4DTJA 1BHLA 1RNHA 3C6HA 4IOXA 3U6FA 3QICA 1WLJA 3C7NB 3TAMA 3UE5A 1V4SA 2F8TA 2NRXA 2NRTA 1RT1A 3AO1A 3SUNA 4Z4IA 3QB0A 4A5AA 5KPTA 3OYHA 1BDGA 3VQ8A 5AQSA 4KHNA 1IKWA 2KLAA 3QLHA 2QXFA 3A8YA 1DKGD 3E9PA 3BY5A 3C7NA 4FJIA 2YJFA 3KWIA 3AAPA 3EO3A 3CFOA 1LCUA 2HBJA 1W97L 1KAZA 4CJLA 3ZLJA 3RRHA 3AAQA 5AQVA 1OH6A 3ZSRA 2GWJA 4MLHA 1I3AA 3DLKA 3LDQA 1Q18A 2I7NA 3WXJA 3HK2A 3MXIA 4Z4CA 2V52B 2HSTA 4UQGA 4GVMA 1OVQA 3LM9A 3C6TA 3VOVA 2NRWA 3NF8A 1S22A 3M3ZA 3OYFA 5HOOA 2FSJA 2D0CA 2E1ZA 1TK0A 4WQ4A 3O08A 4PWDA 4CGIA 1T6CA 4DQRA 2UYTA 3K59A 1OH7A 5M1PA 3H08A 3G6EN 1SL2A 3DI6A 1SV5A 4CJWA 5BR8K 2FF3B 1CLQA 4YHHK 1XNRK 2IGIA 5BN8A 3VQPA 4WFBL 2BE2A 1JLEA 1YJWN 4Z4HA 1CXQA 2IAJA 1HYZA 1JXEA 1BCMA 4ISFA 5F1XA 3L3UA 3AVNA 3F5TA 3R9PA 4FJ7A 4ILJA 4BG8A 2UUBK 1XNQK 3DOKA 5AFUA 5BRHA 5FPDA 1YJ9N 5GINA 4IJAA 2PBDA 3HXMA 3KLIA 3QEPA 4BR0A 4Z4GA 2ATQA 3C94A 1TUYA 1T7PA 4KHSA 1KQSM 1S1TA 1BIUA 4JRQA 3OBWA 1QTMA 3NHGA 3OBYA 3GOIA 1HR0K 2V7YA 5DMRA 5AQGA 3NE6A 1MDUB 4I6MB 3HPHA 4H4OA 4JKCA 3O9RA 1EKEA 1IH7A 3Q7BA 4JKAA 1NGJA 2RHKA 1XHZA 3CC2N 3DLEA 4LF5K 5J2QA 4KFBA 4CF1A 3ITHA 4E1NA 2PY5A 5C24A 1BUPA 4I6MA 3KD5E 4DSLA 1E4GT 4KAZA 3KTQA 1KD1O 2A1SA 1KFSA 3LM2A 4NCGA 4FW1A 4CGFA 5I42A 2OTJN 4DLGA 2X74A 2NLXA 1C1AA 4DFPA 2UUCK 3CJ1A 5JLHA 3IFRA 1RTJA 2HW3A 4E7HA 2HF3A 2I5JA 4KHQA 4CEQA 1D4XA 1P90A 1WSEA 3CJ9A 4CF2A 3IG1A 4LH4A 5MLCQ 1JKHA 5KTQA 3DAWA 1J9AA 5AQQA 2A6AA 5GAGP 2KQ2A 1LOTB 3LZIA 2ZJRL 5AQRA 4FO0A 1C0FA 4IG3A 3IUCA 2IDOA 3EZWA 4CEDA 2YX6A 4JAXA 2YHXA 3HJFA 2HVHA 1QSLA 4DTXA 4OJRA 1KXPA 1B92A 3IAYA 4JI7K 3JXUA 1KVBA 5HL7L 2F96A 4ELVA 2W6LA 5HRRA 4CHQA 1VSFA 3BEXA 4JNEA 4K8ZA 4JI6K 3OYEA 3OVNA 4BVPA 5BRFA 2KZZA 1K6YA 1EWRA 5TKWA 1ZBUA 2HMIA 2GX9A 4B8AB 4HVJA 5K14A 4NLCA 1N6QA 3AY9A 2FSKA 1TK8A 3L4IA 3UKUB 3H46O 3OYBA 4M3XA 3RMAA 4AHCA 4M42A 4N41A 3KJVA 3R8EA 4H5WA 1NJIO 1VQNN 1S72N 2HB5A 4BRIA 1RT5A 3NH0A 4LF6K 4FOIA 1WSFA 3AO2A 2QK9A 2IVOA 4BWJA 4DQPA 3P31A 1UA1A 2YCHA 2F4VK 2JGUA 4LH5A 3ZT2A 4YOVA 3OJSA 3TSUA 4DV6K 3S9HA 4FSVA 2VG7A 3ATUA 1QZ5A 1YT3A 4QS7A 1NGDA 4FVMA 4C8NA 1Q9XA 1S1WA 3DLHA 2HNYA 4ICLA 1T03A 5JVGL 4Z4FA 4A62A 4JHDB 4DB3A 5TKYA 4H0VB 1Q86O 2GEMA 5CR4A 1BCOA 4BC4A 1G15A 4XH4A 2WONA 1SKRA 2NZTA 1EETA 4KREA 5C2FA 4JHDA 3WXLA 3J7AP 1BWFO 3MN5A 4K0KK 1KTQA 1VQPN 3IDHA 2QKBA 5HROA 3GBTA 1X9WA 4MDBA 3PY8A 2YHAA 2HBKA 5AQJA 2HHSA 3MXJA 4C8KA 1Z6RA 3M1FA 3OY9A 4FLWA 1C0MA 4YOUA 4FWQA 2RE2A 3CI5A 1T44A 1NWKA 3L4QA 1JLFA 4BRNA 1RDDA 2XY7A 3SBGA 3M8RA 2ITGA 3S41A 2AA4A 2P1JA 4CHZA 3QFUA 3LWLA 3HPGA 1TKZA 4RW6A 2BGGA 1S1UA 1RT4A 2HHHK 3P5JA 4E19A 3OTOK 4O44A 3CCEN 4CJ5A 4M45A 3H1QA 3G0ZA 3TANA 4J2AA 2Q97A 1XQSC 4DV0K 1OH5A 5CY4A 4JV5K 4WF9L 4A61A 1NJYA 3TAQA 3DOLA 2ZWHA 1K8KA 1ASUA 4JKGB 2PYJA 3VA0A 3ZEUB 1TAQA 2O8DB 3QNNA 4DTOA 2WUSA 3UIQA 5CYMA 3CERA 3AVBA 1U45A 4JKGA 3NFAA 3DRPA 3O9SA 3TAEA 4LY7A 1N33K 1C0TA 2EWSA 3ZEUA 2O8DA 3WXKA 3I0RA 3R3LA 1JLBA 1ILYA 3RRGA 4LF7K 4GVEA 3J7YP 4HTLA 4LD0A 3ZETB 4JRPA 4CERA 3WNGA 1QQMA 3ZT4A 1IKYA 5EU7A 5FDLA 4YY3K 1KCFA 1IKVA 1RT3A 3J7ZO 3TAFA 4BROA 4EHUA 1NK8A 1UWBA 4IDHA 2KFNA 1VSHA 5GIPA 4H5RA 1TYQB 3A0IX 3ZETA 1Q81O 4BR4A 3VQCA 3EL2A 3E9LA 4U7BA 3FLCO 4OGCA 2OZMA 1HMVA 5J2NA 1TVRA 3P39A 5AQTA 1TYQA 2A40A 4JYAK 1TL1A 5M1KA 1WSJA 3W3DA 4O8KA 3V9WA 1NK6A 3WNFA 4ISEA 1JXBA 3RSEB 4FWNA 3MECA 1VSIA 4YOWA 3VERA 5AQIA 4X65K 1NJZA 4O55A 4EFHA 1D9FA 3UKRB 4DV4K 4BR5A 4FLUA 5ADXH 1J5EK 3ZT0A 1MWMA 3MX2A 3RSEA 4PUOA 3KK7A 1VQ8N 4JK7A 2A41A 2KFZA 1S3XA 2YHYA 5BR9A 4CJ4A 3GL1A 3CFRA 3SZ2A 4IEIA 3M5RA 3UKRA 2CGLA 3V81A 3EE9A 1QQOA 2E4LA 3S3MA 4FCYA 2NUBA 4JN4A 3PIPL 3HP6A 1GLEG 3AGRA 5JLFA 5GIOA 3MEGA 3VTIA 4PL7A 4DSEA 4CZMA 4Z4EA 1XWLA 3THXB 5JS1A 4NXNK 3EKUA 2EHGA 2IC3A 3M8PA 5BN9A 1J54A 4NCAA 1SL1A 4IDKA 4YOYA 4QCLA 1EX4A 4H0PA 3BZKA 3R1XA 5CZ2A 3THXA 3ZX0A 2FBVA 2Y1IA 5BREA 1VQ9N 3DMJA 4DV1K 4HUEA 4JS5A 2AJQA 5JS2A 4E7LA 3MN6A 1BI4B 4QS9A 2FF6A 4WQ4C 3AO3A 2QA4N 2QWOA 3S3NA 1NKCA 1K73O 4WCEL 1T05A 4AF1A 5M1FA 3CCSN 5AQKA 4IEEA 4F2RA 3K57A 2A1RA 1GOCA 1NM1A 3ZSWA 1Z25A 1NGCA 3ZSOA 1CZ9A 1BI4A 1B9FA 4EAHD 4FYDA 3VQAA 4B9TA 1JL1A 4JI8K 4MO4A 3WT0A 4CHYA 3WQUA 2E2NA 4H0TB 4W5NA 3C95A 3D2EB 1LV5A 3KLFA 4DR2K 4BQLA 1L3VA 5J1EA 4OPAA 3KKSA 3O3GA 3ASMA 3SCXA 4EHTA 4B9LA 1KSPA 1U6ZA 2HHWA 2O4GA 3CPWM 3QETA 3D45A 3DJCA 1ASVA 2HBMA 3D2EA 2D0PA 4DSIA 2VG5A 1WB9A 4CFCA 3CF5L 3DLRA 1NKEA 1N5YA 1Q9YA 4RW4A 2W41A 4GKJK 1FKOA 5D3GA 4KB0A 3O80A 4ILGB 3CCVN 1NLVA 3FZMA 3ID6A 3SQ2A 4CJUA 4KPYA 2OTLN 4L8RB 2IVNA 5AQLA 1ZBHA 1JCGA 4KRFA 3LDSA 5A2QO 1VSJA 2FSNA 4IOAL 2BH1A 1QE1A 3KLGA 1YAGA 2YJEA 4FLTA 2E20A 4DR7K 3AVMA 1N8RO 4CF8A 4JKBA 2ASPA 4CJ7A 4JKEA 4DS4A 3H6EA 5E26A 4DU3A 4DR6K 4N76A 3WXMB 2QKKA 1YXQA 1FK9A 4FM1A 4Q0BA 3VEOA 1U48A 2O8FA 3HI0A 1EQYA 2P9UB 1YHQN 5DK5A 5LJVA 1HNVA 4B9SA 2IVPA 4F3TA 2WTUA 1RT2A 3TPQA 1WUAA 3HO1A 5M1QA 4H5TA 4G9ZA 3QNOA 3O1BA 1IG8A 3LANA 4K41A 3AVGA 4BY9C 4W5OA 4GV3A 2Z1JA 1KFDA 2P9UA 4BQZA 2DPNA 4DF8A 3VQ4A 1NGAA 4AM7A 5AQFA 3TSQA 1RBVA 2YNIA 5F0XA 4DTSA 4OPKA 3CFPA 3KLEA 3IS9A 3ATVA 4L3QA 4EP5A 3SAFA 3M8QA 4B9QA 4DS5A 4CCHA 4JKHA 4WFAL 3V1RA 4DUYK 3SPYA 4LSNA 3K2PA 2F7TA 4OO1J 4DSFA 3CG7A 1DTTA 1BOTO 1BQNA 3LDLA 4CESA 2YNFA 3RR8A 3OYNA 3ZX3A 3GE1A 5DM6L 4ID1A 3LPTA 4PL8A 3FFIA 4CK1A 4BR9A 3J81O 2X6SA 1LWFA 4Y0WA 2PYLA 2HF4A 1ATSA 4JLHA 1NMDA 3EKSA 5ELZA 1ZXOA 3ENOA 4YFUA 4OKKA 2Z1GA 4CIGA 3VENA 4H0YB 5KQ8A 3DYAA 4BRKA 5E84A 2GV9A 4B3OA 3H45C 2FBYA 3AA2A 3LALA 4FK0A 4DLEA 1BA1A 5LJWA 4JKFA 1IG9A 1S9EA 2XRIA 3F9MA 4H4MA 1K9MO 2QM1A 3RTVA 5J2PA 2VWBA 2YHBA 3VGKA 2CGJA 5AQUA 4DSJA 2VWKA 3SUOA 2KHOA 4BE2A 3O6WA 3AARA 4E7IA 2ZJQL 4HUFA 2Q36A 4BWMA 3O8MA 1VAZA 3K0SA 1JLCA 2D0BA 2P9IB 4AHTA 3SJHA 1VSKA 3L0QA 5AQMA 3THYB 1RILA 2J4RA 1JL2A 4RTFD 1E4FT 3KK3A 4JI0K 1ASWA 4Z94A 3SAHA 3A5NC 4RW9A 4DFJA 1X3MA 4CW7B 1BIZA 2P9IA 3MXMA 3THYA 3BP8A 2HNZA 1TKTA 1RBTA 2PZSA 4B8CA 2G8HA 2P9KB 4KB1A 2FBTA 1QSSA 2CH6A 2W6KA 2ZD1A 3SYZA 3CM5A 5GADP 4CD3A 3L2WA 2G8VA 3RMCA 4NYNA 4CZEA 4CECA 3CMAN 4ILHA 3ENHA 3A2FA 1KC8O 3EYZA 4C8LA 2P9KA 2P9NB 4B1ZA 5LMNK 4NYFA 4Y1DA 2WBNA 2HBLA 4Q5VA 4LSLA 1RDCA 1VQON 1YITN 3E1YA 1I39A 1HNXK 4BRMA 4DTUA 1H1VA 4XH5A 1NGHA 1XI1A 3O9QA 3AVAA 2P9NA 2E6MA 3C0BA 4CJFA 2IS3A 3CJ7A 4KHYA 1XMQK 3T7ZA 1S9GA 3SNNA 4J8FA 1QQNA 3HM8A 5ADXA 4B1WB 4LFAK 3K9KA 4RG8A 3QMLA 3SLCA 4M3RA 1U49A 4CJPA 4FZXC 4FM2A 2B6AA 3CCUN 4OX9K 2YHWA 4CJRA 4E7JA 4IBNA 4BRFA 4QAGA 1S6PA 2Y1JA 4H0OA 4C23A 3TTCA 1REVA 2ZGYA 3MWTA 3VF2A 1LW0A 3NH1A 4NB4A 4A2BA 1BG3A 1IJJA 2YV0X 3BUZB 1BL3A 1JLAA 5AQNA 1NK5A 3JSMA 4CHPA 3CC7N 3O9UA 1NOZA 4DV2K 2ZM6K 3CQYA 4FWKA 3JS6A 4AQYK 1NGGA 1Z26A 4YORA 3VGLA 4MDAA 5C10A 2EX3A 3O3FA 1NBWA 1FJGK 2FC0A 2X78A 3V4IA 3VQ6A 1NNEA 1GLJO 4A59A 4U67L 4IFEA 4EZ6A 3OYGA 3ZSVA 4AILC 3AA5X 3B6PA 3LP2A 1NJXA 3QINA 1N34K 2QWPA 3K5NA 2ZJPL 4GY2B 1IBMK 2R7YA 4MO5A 3NDKA 3AO4A 5E41A 5M1OA 4CBWA 1RBRA 3HOSA 4KTWA 1SL0A 4ISGA 2HHTA 1IKXA 4E7KA 2PAVA 1SS6A 1QQCA 5JMVA 3OYCA 1L3UA 2VCPA 5SWMA 2ZQBA 1M1KO 4YDUC 4LF8K 5CYQA 3H3NO 3OS1A 3L2VA 3OYDA 3KK1A 4DV5K 2XO7A 4B1VA 2ASMA 3F9KA 2E1YA 1GLAG 3EZ5A 3CYMA 3PSIA 3BF1A 3V9ZA 3AVKA 4E1JA 5GAHP 5KGWA 4J2DA 1OKJA 3ZSQA 1D5AA 4CBUA 4B3SK 1Y64A 1O1WA 4H03B 4IXCA 4OVLA 1RDBA 3TSPA 2A5XA 1EP4A 3OYJA 2BUPA 3SQ4A 3J8AA 4HCCA 4FJXA 4AM6A 2RN2A 3EE8A 4IJNA 1R0AA 2HHXA 3SV3A 1A5VA 2E5LK 5J2MA 4PHTX 2IIRA 3GDQA 3SAGA 2QI2A 1K8KB 3BDPA 3QEVA 3OYIA 4HCBA 3NVMA 1TK5A 4BC3A 3VPZA 4K8XA 5AZJB 1RTIA 3CIPA 1ESVA 4B1UB 5KPZA 4AHSA 1C6VA 4F3OA 1A5XA 5BPMA 4M3UA 2OPRA 1HKGA 3BGRA 1L3TA 3VQ7A 4UY8O 3IRXA 3MX5A 5AR0A 5AZJA 2GWKA 1Z05A 3H3OB 3VQDA 3I0SA 3O9TA 5BPNA 4DV3K 5H1SQ 3VTHA 3LWMA 4FWLA 3A5MC 3K9JA 4PKHA 3LDNA 5LMUK 1CZBA 3JAMO 4H5VA 2E88A 3MCAB 1J6ZA 5AFUH 3L6QA 4IO8A 1SZ2A 3CQXA 3M8SA 1JCEA 3U3GA 4KI6A 3KKRA 3QIOA 2HOEA 1YTAA 4CK3A 3CJCA 4K25A 3DRRA 3R6MA 4A5BA 4B3MK 1B9DA 1RTHA 4C8MA 5IWAK 3L2UA 3PX0A 1YVNA 3OA9A 4FM0A 5C15A 2E8AA 4KTQA 4BRCA 1CXUA 4GW6A 2Q2RA 3NF7A 1VQ6N 2P5GA 3HZ6A 2NRRA 4M7XA 4CBXA 1WBDA 1JJ2M 1KAYA 2KTQA 1QZ6A 4BGAA 2NNWA 4E1MA 4CEFA 1TKXA 2E2QA 3PSFA 3SUQA 1HPZA 4CEZA 4CIEA 4OLBA 3PUFA 2P9PB 4CF0A 3AO5A 2QTDA 3RMDA 3TWHA 2WC9A 4BC5A 1EO1A 2GUIA 1HYVA 3LDPA 2XY6A 4F2SA 1RDAA 2F9WA 1NG9A 1RT7A 4BC2A 1D8YA 3V6DA 4JI1K 2P5OA 5C42A 3QO9A 2P9PA 3DLLL 2YKNA 4OPHA 1LW2A 4A2AA 1HKBA 4IO9L 1QHAA 4CZLA 2YNHA 5FPEA 3LZJA 3J80O 4YDUA 3M6GA 1TKDA 4HHTA 4ELUA 4ZHRA 3K5MA 1A5WA 5EY4A 1Q82O 2G8KA 1ZBLA 3VEYA 3A5OC 4PY5A 3NCIA 4FVUA 3TTFA 1M90O 1X1PA 2OCEA 3V9UA 1U4BA 3HVRA 3NF9A 3G4SN 3MEDA 3PIOL 4KH5A 5GAEP 4ZTJA 4IOCL 1J53A 1Q8IA 4CFAA 1T6DA 5C12A 5JICA 4ID5A 3CETA 5EXWA 3ZT1A 1EWQA 5JVHL 3C6AA 3RR7A 4DWIA 3MAQA 3WNEA 3ULEB 4FZYA 3CD6N 1GLBG 1YVUA 1HPMA 5AQWA 3QEXA 4M3ZA 4JK8A 1MU2A 1VSMA 4N56A 2UXCK 3RMBA 3WUHA 4DTRA 2FXUA 3ZSXA 2VGNA 3ULEA 1HUXA 3I56N 4O5FA 3QEIA 3FGUA 4LFBK 3NBPA 4KI4A 1ATNA 2Q1NA 4CZKA 3MK6A 4FJJA 1KVAA 4DSKA 3SI6A 5EX5A 3CHWA 4GKKK 1TV6A 2NRVA 1K8AO 4DV7K 1C0GA 4WFNL 2OZSA 3MDQA 1HQEA 3PO5A 2UXDK 4FLXA 5AQZA 3BZCA 1C1BA 4KHWA 2HHQA 3CCMN 5F2RA 4DR3K 5SZTA 5C2DA 1VRTA 3ALYA 4G1QA 1YIJN 1HNWK 3FZHA 4TSXA 5T7BA 2DFHA 4MQ3A 4CFBA 3SMSA 3RWUA 4DFMA 1NGFA 3O1WA 4DTPA 1TL3A 3LP0A 3SPZA 3EEQA 3HT3A 4FJMA 1KLMA 2CGKA 1X9MA 4LC9B 2O8BB 3FFKB 1SKSA 1NKBA 3AVJA 3PV8A 1ZBFA 2E6LA 5KQDA 4FXDA 5CE3A 2YNGA 3Q7CA 2A42A 1DT9A 4KHPK 2GUPA 3A5LC 2O8BA 4RW8A 3D0PA 2O8FB 3KK2A 3D2FB 4EIAA 3VMFB 1ZC6A 2ZE2A 2HMPA 2Z1HA 1WAFA 1U04A 4O4GA 4BGBA 1NK7A 1G99A 4XIUA 1EXQA 3L2QA 2VYPA 4LFCK 2B4JA 1TAUA 3CMEN 3D2FA 1HNZK 3VQQA 4AHUA 3ZYYX 4DQIA 4RW7A 4CJQA 2GTDA 1SUQA 1MA9B 4BDPA 3VF4A 1DEJA 4QS8A 5LL6Z 4BRLA 3AV9A 3E66A 3MEEA 2W40A 2E2OA 2YKMA 4CEEA 4GMJB 3WXIA 3PLAA 3CPEA 5KI6A 1S1XA 4FLVA 1RCHA 4YOXA 5C0YA 1JCFA 3AVIA 4DG1A 4F8RA 1HJRA 4IZ9A 5FRNA 1WSIA 4C1NI 4DU1A 1RDWX 1ZBSA 2OANA 4CJSA 3BF3A 4I9QA 2B5JA 2O8CB 5FROA 3AVHA 5I9EB 3THWB 4N47A 2Q0UA 3TAGA 5HRPA 5HP1A 3P38A 1C0UA 3HOTA 1VK0A 3D6RA 4AHVA 3CM6A 3SUPA 4LF9K 2O8CA 1P8ZA 3THWA 5AQOA 1Q7YO 4KTZA 2RF2A 3T19A 3CCRN 4FPAA 1SAZA 1S5JA 4PKIA 3OJUA 2QWLA 3KZBA 4BACA 3AVCA 3SMPA 4CZJA 3CC4N 4DR1K 4B1XB 1L3SA 5KPRA 2YI1A 3CJAA 2DY4A 3AVFA 2QWNA 3HL8A 4B08A 4KH6A 3L8BA 4BE0A 3WQTA 3WEEB 4CGJA 1HQUA 5HRNA 2O4IA
chains in the Genus database with same CATH topology
4WE1A 1HRHA 3VQ6A 3TABA 1NK8A 4CE9A 1UWBA 1WSGA 2HNDA 3ISNC 2BDPA 4EZ6A 3OYGA 2VWJA 2KFNA 1VSHA 5KRSA 3ZSVA 4CJVA 4AILC 4CGDA 5CZ1A 2OYQA 3L2RA 3AA5X 3B6PA 3VQCA 3F73A 3LP2A 1RBSA 3QINA 4DFKA 1NJXA 1VSDA 4OGCA 2OZMA 3V1OA 3V9SA 1HMVA 3K5NA 3DLBA 4F4KA 4O5BA 5J2NA 2R7YA 4FJGA 3NDKA 3AO4A 5E41A 3NF6A 3TR8A 1RBRA 1TVRA 3NGZA 3SV4A 1JLQA 3JYTA 1DLOA 4DU4A 1TL1A 4KTWA 1SL0A 1WSJA 2HHTA 1IKXA 3VQBA 4E7KA 3V9WA 1NK6A 3WNFA 1QQCA 2OPSA 1JXBA 3OYCA 4CJTA 1UA0A 1W9HA 4M41A 2JLEA 5SWMA 3HM9A 2ZQBA 3MECA 3K5LA 1VSIA 4Y1CA 1VSLA 1QS4A 1NJZA 4O55A 1D9FA 4CK2A 5CYQA 4FJLA 2D0AA 3V9XA 2OA8A 3OS1A 5HRSA 2DFFA 4FJHA 1GOAA 5KRTA 3TI0A 3L2VA 3OYDA 3KK1A 4FLUA 3OYAA 2XO7A 1DTQA 4HTUA 4HUGA 3NGYA 3ZT0A 3F9KA 4FK4A 3G10A 5I3UA 4EZ9A 4PUOA 3EZ5A 3CYMA 3ZT3A 4DTJA 1BHLA 1QHTA 1RNHA 4OKEA 2KFZA 3V9ZA 3U6FA 3AVKA 2HHUA 1WLJA 3TAMA 4CJ4A 3CFRA 3SZ2A 2F8TA 2XY8A 5KGWA 4J2DA 3ZSQA 3V81A 1D5AA 2E4LA 1RT1A 3AO1A 3SUNA 4J2EA 3S3MA 4FCYA 4Z4IA 4M3WA 4KRFA 3OYHA 2NUBA 1O1WA 4OVLA 3VQ8A 3HP6A 1RDBA 4Z0UA 1L5UA 1EP4A 4DF4A 4KHNA 3MEGA 3OYJA 1LWEA 1IKWA 1F21A 3SQ4A 4DSEA 3QLHA 2QXFA 4Z4EA 1XWLA 5JS1A 3HYFA 4FJIA 1W0HA 1RT6A 4CFDA 3DLGA 4HCCA 3SJJA 4FJXA 3CFOA 2EHGA 2RN2A 1R0AA 2HHXA 2IC3A 3SV3A 4O0IA 1A5VA 3M8PA 5J2MA 1J54A 4CJLA 1SL1A 4IKFA 4NCAA 3RRHA 4I9LA 4IDKA 4QCLA 1EX4A 1KVCA 5CZ2A 4DMNA 3ZSRA 3QEVA 2G8FA 3BDPA 3OYIA 4HCBA 1RBUA 2FBVA 1TK5A 1WAJA 4K8XA 1I3AA 3DLKA 2Y1IA 1RTIA 4FK2A 3DMJA 4AHSA 1C6VA 4IFYA 4FZZA 3HK2A 3MXIA 4Z4CA 1A5XA 4F3OA 4HUEA 4B9NA 4JS5A 2AJQA 4M3UA 5JS2A 3QEWA 2OPRA 4E7LA 3HP9A 1BI4B 3BGRA 4UQGA 3VQ7A 4GVMA 1L3TA 4FW2A 3AO3A 3S3NA 3C6TA 3IRXA 1NKCA 3VQDA 3I0SA 1X9SA 1T05A 4C8OA 3NF8A 4CJKA 4FLZA 4F2RA 3LWMA 3K57A 2A1RA 3O4QA 4FJ9A 3OYFA 1CZBA 1GOCA 1YTUA 4DTMA 3ZSWA 1Z25A 3ZSOA 1CZ9A 1WN7A 1BI4A 3M8SA 2D0CA 1B9FA 3U3GA 1TK0A 4KI6A 3KKRA 4PWDA 3QIOA 2P51A 4CGIA 3VQAA 1YTAA 4CK3A 3I8DA 4DQRA 3S3OA 1JL1A 4YNQA 4B9TA 4QOZB 3K59A 4CHYA 4W5NA 3H08A 4PA1A 3C95A 3ULDA 3DRRA 1SL2A 1WSHA 1B9DA 1RTHA 3DI6A 4C8MA 3L2UA 1SV5A 3L3VA 4CJWA 3KLFA 3KLHA 3PX0A 1LV5A 1L3VA 5J1EA 1HYSA 4FM0A 1CLQA 4KTQA 2IGIA 3KKSA 1CXUA 3O3GA 3ASMA 3VQPA 4GW6A 3SCXA 2BE2A 3NF7A 3LP3A 5C25A 1U47A 4B9LA 1KSPA 2P5GA 1JLEA 2HHWA 4Z4HA 2O4GA 3QETA 3D45A 4FJKA 1ASVA 2G8WA 1CXQA 4FLYA 4DSIA 2VG5A 2IAJA 1HYZA 1JXEA 4CFCA 1BCMA 1VRUA 3DLRA 1NKEA 1N5YA 4MFBA 4R5PA 1Q9YA 3L3UA 3AVNA 4RW4A 1KLNA 3OYKA 4J2BA 4FJ7A 5FRMA 2KTQA 4KV8A 1FKOA 4IG0A 4E1MA 4CEFA 1TKXA 3ZSYA 5D3GA 4I2PA 3DOKA 4KB0A 2VG6A 3SUQA 1HPZA 4CEZA 4CIEA 3SQ2A 4OLBA 1GOBA 3PUFA 4CF0A 3AO5A 4CJUA 4KPYA 3RMDA 3TWHA 3VQ9A 3HXMA 3KLIA 3QEPA 5HLFA 4L8RB 1ZBHA 4Z4GA 2GUIA 1HYVA 2ATQA 2XY6A 4B9MA 1RDAA 4F2SA 3C94A 1T7PA 3LDSA 4KHSA 2F8SA 1VSJA 1S1TA 1BIUA 4JRQA 4M3TA 1QTMA 1RT7A 1QE1A 4KKOA 3KLGA 3NHGA 1D8YA 3V6DA 4FLTA 3VQEA 2P5OA 5C42A 3QO9A 3AVMA 5DMRA 4CF8A 4I7FA 3NE6A 2YKNA 1BGXT 3HPHA 4H4OA 1LW2A 4DS4A 4DU3A 1EKEA 2YNHA 3LAMA 1IH7A 1C1CA 4CEAA 4N76A 3LZJA 2QKKA 3HVTA 1FK9A 4FM1A 1XHZA 4Q0BA 2W42A 1U48A 4HHTA 3DLEA 4ZHRA 5J2QA 4KFBA 1TKDA 4CF1A 3K5MA 4ELUA 1A5WA 3ITHA 4E1NA 3OS0A 1ZBLA 3VQ5A 5C24A 4KO0A 2G8KA 3OYMA 2PY5A 3KD5E 2ETJA 3NCIA 5DK5A 4B9SA 1HNVA 2Q3SA 4DSLA 4PY5A 4KAZA 3K5OA 3NAEA 4F3TA 1X1PA 3KTQA 1RT2A 2A1SA 3DM2A 3V9UA 1JLGA 4W5TA 1KFSA 4CF9A 3LP1A 3HO1A 4NCGA 1U4BA 3HVRA 3NF9A 4FW1A 3QNOA 4CGFA 5I42A 3LANA 1ZBIA 3MEDA 3AVGA 4DLGA 2X74A 4W5OA 3OS2A 4ZTJA 1C1AA 2Z1JA 3T1AA 1J53A 1KFDA 1Q8IA 4CFAA 4DF8A 3VQ4A 4DFPA 1FKPA 4ID5A 3ZT1A 2G8UA 1RTJA 2WOMA 2HW3A 3RR7A 1RBVA 2YNIA 3MAQA 3WNEA 4E7HA 4DTSA 4DWIA 2I5JA 4OPKA 3CFPA 3KLEA 4KHQA 1NK4A 4CEQA 3PO4A 4FZYA 1WSEA 1YVUA 1UAXA 3WNHA 3IS9A 4CF2A 3QEXA 3IG1A 3VN5A 4LH4A 4M3ZA 4CEOA 1MU2A 1VSMA 4N56A 1JKHA 4FJ8A 4N5SA 4EP5A 5KTQA 4DQQA 4DS5A 3M8QA 4CCHA 3RMBA 1J9AA 4DTRA 3V1RA 3ZSXA 2KQ2A 3SPYA 3LZIA 4LSNA 3AA4A 3K2PA 5KGXA 4IG3A 3QEIA 4CGGA 2IDOA 4CEDA 3EY1A 4H8KA 3HJFA 1UOCA 2HVHA 3NBPA 4DSFA 3CG7A 4I2QA 1DTTA 3NH2A 4DTXA 4OJRA 1QSLA 2D5RA 1B92A 1BQNA 2GBZA 3VA3A 4CESA 2YNFA 3RR8A 3IAYA 4FJJA 1XHXA 3OYNA 3TARA 3OYLA 1KVAA 1KVBA 2F96A 4AH9A 4DSKA 2DTUA 4ID1A 4CJEA 1HNIA 3LPTA 3SI6A 1D9DA 2X6NA 1TV6A 3FFIA 4CK1A 1L3UA 4ELVA 2X6SA 4CHOA 1LWFA 3P83D 5HRRA 4CHQA 1VSFA 2PYLA 2OZSA 1BQMA 4NCBA 1HQEA 3K58A 4K8ZA 4JLHA 3OYEA 3PO5A 3OVNA 4FJ5A 4FLXA 2KZZA 1K6YA 1C1BA 1ZBUA 2HMIA 4KHWA 4YFUA 4OKKA 3PX6A 2HHQA 4B8AB 2Z1GA 4IFVA 4HVJA 5SZTA 5K14A 4CIGA 1N6QA 1XC9A 1VRTA 3ALYA 4G1QA 1RTDA 4TSXA 5T7BA 1TK8A 3O3HA 2HHVA 3OYBA 3DYAA 2DFHA 4MQ3A 1BISA 4AHRA 4AHCA 4CFBA 3RMAA 4M42A 4M3XA 3RWUA 3SQ0A 4N41A 4DFMA 3KJVA 1NK9A 2GV9A 3ZCMA 4KHUA 4B3OA 4W5QA 2HB5A 4DTPA 3LAKA 1RT5A 1TL3A 2FBYA 2OPPA 3LP0A 3AA2A 3NH0A 1NOYA 3LALA 4FK0A 4DLEA 3SPZA 3HT3A 1WSFA 3AO2A 4FJMA 4BWJA 2OPQA 2QK9A 1S6QA 3TAPA 4DQPA 1IG9A 1S9EA 2XRIA 1KLMA 4H4MA 1UA1A 3RTVA 1X9MA 2JGUA 4OGEA 2YHBA 5J2PA 4LH5A 3DRSA 3ZT2A 4E89A 3OJSA 1SKSA 4DSJA 2VWKA 1ZYQA 3KD1E 3S9HA 1NKBA 3AVJA 3SUOA 2VG7A 3PV8A 1ZBFA 2E6LA 3KIOA 4FXDA 1YT3A 2YNGA 4FVMA 4C8NA 3NGIA 2Z1IA 4BE2A 4BE1A 1Q9XA 1S1WA 4E7IA 2HNYA 3DLHA 4ICLA 3HPOA 4HUFA 1T03A 1VSEA 2RPIA 4BWMA 4Z4FA 3QESA 1J5OA 4RW8A 1JLCA 2D0BA 4AHTA 3D0PA 3THVA 1BCOA 3KK2A 1VSKA 1G15A 1RILA 2ZE2A 3T3FA 1JL2A 2WONA 1WNSA 1SKRA 2Z1HA 4M3YA 3KK3A 1IO2A 1LAVA 2FBXA 1EETA 4KREA 1WAFA 3SQ1A 1U04A 4O4GA 1ASWA 4CIFA 1NK7A 4XIUA 3L2QA 1EXQA 4RW9A 1KTQA 4DFJA 1BIZA 3V1QA 4FJNA 2B4JA 3MXMA 1TAUA 3B6OA 2QKBA 2HNZA 5HROA 3VQQA 1TKTA 1X9WA 1RBTA 4AHUA 4ELTA 4E3SA 3ZSZA 4B8CA 2G8HA 2PZSA 4DQIA 4KB1A 2FBTA 1QSSA 3SYZA 3PY8A 2ZD1A 4RW7A 2YHAA 3CM5A 4CJQA 1SUQA 3L2WA 2G8VA 3MXJA 4BDPA 2HHSA 1NK0A 4C8KA 3RMCA 1FXXA 4FLWA 3OY9A 1C0MA 4NYNA 4CECA 3AV9A 3QERA 3A2FA 1TGOA 4OPJA 3EYZA 2XY5A 4CGHA 1JLFA 3MEEA 4C8LA 4KI4A 1RDDA 2XY7A 2YKMA 3M8RA 4E0DA 2KW4A 4GMJB 2ITGA 4CEEA 4NYFA 4Y1DA 2P1JA 4CHZA 4Q5VA 4LSLA 3AVLA 5KI6A 1S1XA 1RDCA 4FLVA 1I39A 1RCHA 3HPGA 2BANA 2DFEA 3LWLA 1T8EA 3AVIA 4DG1A 4DTUA 1TKZA 4BDZA 4F8RA 1HJRA 1Y97A 1XI1A 5FRNA 3AVAA 4RW6A 1SKWA 1WSIA 3P1GA 2E6MA 4O0JA 3U3YA 4DU1A 1S1UA 1RT4A 2BGGA 2G8IA 4CJFA 4PQUA 3P5JA 4E19A 2IS3A 2LSNA 4O44A 4CJSA 2RKIA 4CJ5A 4M45A 4KHYA 4BDYA 3LPUA 3G0ZA 4I9QA 1S9GA 3TANA 3SNNA 2B5JA 4B9VA 5FROA 4J2AA 3AVHA 4RG8A 4N47A 3PX4A 4M3RA 1U49A 4CJPA 4FZXC 4JS4A 4FM2A 4DQSA 1LAWA 3TAGA 2B6AA 5CY4A 5HRPA 5HP1A 4CJ3A 1NJYA 1C0UA 3TAQA 3DOLA 2XHBA 4CJRA 1ASUA 4E7JA 1VK0A 4AHVA 4FYDA 3CM6A 4IBNA 2PYJA 4QAGA 3CQ8A 3VA0A 1S6PA 3SUPA 3E01A 1TAQA 2Y1JA 2IOCA 3HSTB 4ZTFA 3QNNA 1REVA 4KTZA 3QIPA 4DTOA 1LW0A 3NH1A 2RF2A 3T19A 5CYMA 3UIQA 5HBMA 1S5JA 2KZMA 2YV0X 3OJUA 1LWCA 3AVBA 1BL3A 1U45A 4BACA 3AVCA 3NFAA 1JLAA 3DRPA 3TAEA 1NK5A 4LY7A 1C0TA 3JSMA 4CHPA 1KRPA 1NOZA 3C6UA 1ITGA 1L3SA 1NJWA 3I0RA 4OKJA 4CHNA 1Z26A 1JLBA 2DY4A 3RRGA 3AVFA 3AA3A 3O4NA 1S1VA 4B9UA 3HL8A 4B08A 4LD0A 3L8BA 4BE0A 4JRPA 2EX3A 3WNGA 4CERA 3ZT4A 4CGJA 1IKYA 1HQUA 5EU7A 5HRNA 3O3FA 2FC0A 4DTNA 4OLAA 4CEBA 5FDLA 2X78A 2O4IA 2HVIA 1KCFA 1IKVA 1RT3A 3V4IA 1QSYA 4W5RA 3TAFA 4EP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WE1 A;  1HRH A;  3VQ6 A;  3TAB A;  1NK8 A;  4CE9 A;  1UWB A;  1WSG A;  2HND A;  3ISN C;  2BDP A;  4EZ6 A;  3OYG A;  2VWJ A;  2KFN A;  1VSH A;  5KRS A;  3ZSV A;  4CJV A;  4AIL C;  4CGD A;  5CZ1 A;  2OYQ A;  3L2R A;  3AA5 X;  3B6P A;  3VQC A;  3F73 A;  3LP2 A;  1RBS A;  3QIN A;  4DFK A;  1NJX A;  1VSD A;  4OGC A;  2OZM A;  3V1O A;  3V9S A;  1HMV A;  3K5N A;  3DLB A;  4F4K A;  4O5B A;  5J2N A;  2R7Y A;  4FJG A;  3NDK A;  3AO4 A;  5E41 A;  3NF6 A;  3TR8 A;  1RBR A;  1TVR A;  3NGZ A;  3SV4 A;  1JLQ A;  3JYT A;  1DLO A;  4DU4 A;  1TL1 A;  4KTW A;  1SL0 A;  1WSJ A;  2HHT A;  1IKX A;  3VQB A;  4E7K A;  3V9W A;  1NK6 A;  3WNF A;  1QQC A;  2OPS A;  1JXB A;  3OYC A;  4CJT A;  1UA0 A;  1W9H A;  4M41 A;  2JLE A;  5SWM A;  3HM9 A;  2ZQB A;  3MEC A;  3K5L A;  1VSI A;  4Y1C A;  1VSL A;  1QS4 A;  1NJZ A;  4O55 A;  1D9F A;  4CK2 A;  5CYQ A;  4FJL A;  2D0A A;  3V9X A;  2OA8 A;  3OS1 A;  5HRS A;  2DFF A;  4FJH A;  1GOA A;  5KRT A;  3TI0 A;  3L2V A;  3OYD A;  3KK1 A;  4FLU A;  3OYA A;  2XO7 A;  1DTQ A;  4HTU A;  4HUG A;  3NGY A;  3ZT0 A;  3F9K A;  4FK4 A;  3G10 A;  5I3U A;  4EZ9 A;  4PUO A;  3EZ5 A;  3CYM A;  3ZT3 A;  4DTJ A;  1BHL A;  1QHT A;  1RNH A;  4OKE A;  2KFZ A;  3V9Z A;  3U6F A;  3AVK A;  2HHU A;  1WLJ A;  3TAM A;  4CJ4 A;  3CFR A;  3SZ2 A;  2F8T A;  2XY8 A;  5KGW A;  4J2D A;  3ZSQ A;  3V81 A;  1D5A A;  2E4L A;  1RT1 A;  3AO1 A;  3SUN A;  4J2E A;  3S3M A;  4FCY A;  4Z4I A;  4M3W A;  4KRF A;  3OYH A;  2NUB A;  1O1W A;  4OVL A;  3VQ8 A;  3HP6 A;  1RDB A;  4Z0U A;  1L5U A;  1EP4 A;  4DF4 A;  4KHN A;  3MEG A;  3OYJ A;  1LWE A;  1IKW A;  1F21 A;  3SQ4 A;  4DSE A;  3QLH A;  2QXF A;  4Z4E A;  1XWL A;  5JS1 A;  3HYF A;  4FJI A;  1W0H A;  1RT6 A;  4CFD A;  3DLG A;  4HCC A;  3SJJ A;  4FJX A;  3CFO A;  2EHG A;  2RN2 A;  1R0A A;  2HHX A;  2IC3 A;  3SV3 A;  4O0I A;  1A5V A;  3M8P A;  5J2M A;  1J54 A;  4CJL A;  1SL1 A;  4IKF A;  4NCA A;  3RRH A;  4I9L A;  4IDK A;  4QCL A;  1EX4 A;  1KVC A;  5CZ2 A;  4DMN A;  3ZSR A;  3QEV A;  2G8F A;  3BDP A;  3OYI A;  4HCB A;  1RBU A;  2FBV A;  1TK5 A;  1WAJ A;  4K8X A;  1I3A A;  3DLK A;  2Y1I A;  1RTI A;  4FK2 A;  3DMJ A;  4AHS A;  1C6V A;  4IFY A;  4FZZ A;  3HK2 A;  3MXI A;  4Z4C A;  1A5X A;  4F3O A;  4HUE A;  4B9N A;  4JS5 A;  2AJQ A;  4M3U A;  5JS2 A;  3QEW A;  2OPR A;  4E7L A;  3HP9 A;  1BI4 B;  3BGR A;  4UQG A;  3VQ7 A;  4GVM A;  1L3T A;  4FW2 A;  3AO3 A;  3S3N A;  3C6T A;  3IRX A;  1NKC A;  3VQD A;  3I0S A;  1X9S A;  1T05 A;  4C8O A;  3NF8 A;  4CJK A;  4FLZ A;  4F2R A;  3LWM A;  3K57 A;  2A1R A;  3O4Q A;  4FJ9 A;  3OYF A;  1CZB A;  1GOC A;  1YTU A;  4DTM A;  3ZSW A;  1Z25 A;  3ZSO A;  1CZ9 A;  1WN7 A;  1BI4 A;  3M8S A;  2D0C A;  1B9F A;  3U3G A;  1TK0 A;  4KI6 A;  3KKR A;  4PWD A;  3QIO A;  2P51 A;  4CGI A;  3VQA A;  1YTA A;  4CK3 A;  3I8D A;  4DQR A;  3S3O A;  1JL1 A;  4YNQ A;  4B9T A;  4QOZ B;  3K59 A;  4CHY A;  4W5N A;  3H08 A;  4PA1 A;  3C95 A;  3ULD A;  3DRR A;  1SL2 A;  1WSH A;  1B9D A;  1RTH A;  3DI6 A;  4C8M A;  3L2U A;  1SV5 A;  3L3V A;  4CJW A;  3KLF A;  3KLH A;  3PX0 A;  1LV5 A;  1L3V A;  5J1E A;  1HYS A;  4FM0 A;  1CLQ A;  4KTQ A;  2IGI A;  3KKS A;  1CXU A;  3O3G A;  3ASM A;  3VQP A;  4GW6 A;  3SCX A;  2BE2 A;  3NF7 A;  3LP3 A;  5C25 A;  1U47 A;  4B9L A;  1KSP A;  2P5G A;  1JLE A;  2HHW A;  4Z4H A;  2O4G A;  3QET A;  3D45 A;  4FJK A;  1ASV A;  2G8W A;  1CXQ A;  4FLY A;  4DSI A;  2VG5 A;  2IAJ A;  1HYZ A;  1JXE A;  4CFC A;  1BCM A;  1VRU A;  3DLR A;  1NKE A;  1N5Y A;  4MFB A;  4R5P A;  1Q9Y A;  3L3U A;  3AVN A;  4RW4 A;  1KLN A;  3OYK A;  4J2B A;  4FJ7 A;  5FRM A;  2KTQ A;  4KV8 A;  1FKO A;  4IG0 A;  4E1M A;  4CEF A;  1TKX A;  3ZSY A;  5D3G A;  4I2P A;  3DOK A;  4KB0 A;  2VG6 A;  3SUQ A;  1HPZ A;  4CEZ A;  4CIE A;  3SQ2 A;  4OLB A;  1GOB A;  3PUF A;  4CF0 A;  3AO5 A;  4CJU A;  4KPY A;  3RMD A;  3TWH A;  3VQ9 A;  3HXM A;  3KLI A;  3QEP A;  5HLF A;  4L8R B;  1ZBH A;  4Z4G A;  2GUI A;  1HYV A;  2ATQ A;  2XY6 A;  4B9M A;  1RDA A;  4F2S A;  3C94 A;  1T7P A;  3LDS A;  4KHS A;  2F8S A;  1VSJ A;  1S1T A;  1BIU A;  4JRQ A;  4M3T A;  1QTM A;  1RT7 A;  1QE1 A;  4KKO A;  3KLG A;  3NHG A;  1D8Y A;  3V6D A;  4FLT A;  3VQE A;  2P5O A;  5C42 A;  3QO9 A;  3AVM A;  5DMR A;  4CF8 A;  4I7F A;  3NE6 A;  2YKN A;  1BGX T;  3HPH A;  4H4O A;  1LW2 A;  4DS4 A;  4DU3 A;  1EKE A;  2YNH A;  3LAM A;  1IH7 A;  1C1C A;  4CEA A;  4N76 A;  3LZJ A;  2QKK A;  3HVT A;  1FK9 A;  4FM1 A;  1XHZ A;  4Q0B A;  2W42 A;  1U48 A;  4HHT A;  3DLE A;  4ZHR A;  5J2Q A;  4KFB A;  1TKD A;  4CF1 A;  3K5M A;  4ELU A;  1A5W A;  3ITH A;  4E1N A;  3OS0 A;  1ZBL A;  3VQ5 A;  5C24 A;  4KO0 A;  2G8K A;  3OYM A;  2PY5 A;  3KD5 E;  2ETJ A;  3NCI A;  5DK5 A;  4B9S A;  1HNV A;  2Q3S A;  4DSL A;  4PY5 A;  4KAZ A;  3K5O A;  3NAE A;  4F3T A;  1X1P A;  3KTQ A;  1RT2 A;  2A1S A;  3DM2 A;  3V9U A;  1JLG A;  4W5T A;  1KFS A;  4CF9 A;  3LP1 A;  3HO1 A;  4NCG A;  1U4B A;  3HVR A;  3NF9 A;  4FW1 A;  3QNO A;  4CGF A;  5I42 A;  3LAN A;  1ZBI A;  3MED A;  3AVG A;  4DLG A;  2X74 A;  4W5O A;  3OS2 A;  4ZTJ A;  1C1A A;  2Z1J A;  3T1A A;  1J53 A;  1KFD A;  1Q8I A;  4CFA A;  4DF8 A;  3VQ4 A;  4DFP A;  1FKP A;  4ID5 A;  3ZT1 A;  2G8U A;  1RTJ A;  2WOM A;  2HW3 A;  3RR7 A;  1RBV A;  2YNI A;  3MAQ A;  3WNE A;  4E7H A;  4DTS A;  4DWI A;  2I5J A;  4OPK A;  3CFP A;  3KLE A;  4KHQ A;  1NK4 A;  4CEQ A;  3PO4 A;  4FZY A;  1WSE A;  1YVU A;  1UAX A;  3WNH A;  3IS9 A;  4CF2 A;  3QEX A;  3IG1 A;  3VN5 A;  4LH4 A;  4M3Z A;  4CEO A;  1MU2 A;  1VSM A;  4N56 A;  1JKH A;  4FJ8 A;  4N5S A;  4EP5 A;  5KTQ A;  4DQQ A;  4DS5 A;  3M8Q A;  4CCH A;  3RMB A;  1J9A A;  4DTR A;  3V1R A;  3ZSX A;  2KQ2 A;  3SPY A;  3LZI A;  4LSN A;  3AA4 A;  3K2P A;  5KGX A;  4IG3 A;  3QEI A;  4CGG A;  2IDO A;  4CED A;  3EY1 A;  4H8K A;  3HJF A;  1UOC A;  2HVH A;  3NBP A;  4DSF A;  3CG7 A;  4I2Q A;  1DTT A;  3NH2 A;  4DTX A;  4OJR A;  1QSL A;  2D5R A;  1B92 A;  1BQN A;  2GBZ A;  3VA3 A;  4CES A;  2YNF A;  3RR8 A;  3IAY A;  4FJJ A;  1XHX A;  3OYN A;  3TAR A;  3OYL A;  1KVA A;  1KVB A;  2F96 A;  4AH9 A;  4DSK A;  2DTU A;  4ID1 A;  4CJE A;  1HNI A;  3LPT A;  3SI6 A;  1D9D A;  2X6N A;  1TV6 A;  3FFI A;  4CK1 A;  1L3U A;  4ELV A;  2X6S A;  4CHO A;  1LWF A;  3P83 D;  5HRR A;  4CHQ A;  1VSF A;  2PYL A;  2OZS A;  1BQM A;  4NCB A;  1HQE A;  3K58 A;  4K8Z A;  4JLH A;  3OYE A;  3PO5 A;  3OVN A;  4FJ5 A;  4FLX A;  2KZZ A;  1K6Y A;  1C1B A;  1ZBU A;  2HMI A;  4KHW A;  4YFU A;  4OKK A;  3PX6 A;  2HHQ A;  4B8A B;  2Z1G A;  4IFV A;  4HVJ A;  5SZT A;  5K14 A;  4CIG A;  1N6Q A;  1XC9 A;  1VRT A;  3ALY A;  4G1Q A;  1RTD A;  4TSX A;  5T7B A;  1TK8 A;  3O3H A;  2HHV A;  3OYB A;  3DYA A;  2DFH A;  4MQ3 A;  1BIS A;  4AHR A;  4AHC A;  4CFB A;  3RMA A;  4M42 A;  4M3X A;  3RWU A;  3SQ0 A;  4N41 A;  4DFM A;  3KJV A;  1NK9 A;  2GV9 A;  3ZCM A;  4KHU A;  4B3O A;  4W5Q A;  2HB5 A;  4DTP A;  3LAK A;  1RT5 A;  1TL3 A;  2FBY A;  2OPP A;  3LP0 A;  3AA2 A;  3NH0 A;  1NOY A;  3LAL A;  4FK0 A;  4DLE A;  3SPZ A;  3HT3 A;  1WSF A;  3AO2 A;  4FJM A;  4BWJ A;  2OPQ A;  2QK9 A;  1S6Q A;  3TAP A;  4DQP A;  1IG9 A;  1S9E A;  2XRI A;  1KLM A;  4H4M A;  1UA1 A;  3RTV A;  1X9M A;  2JGU A;  4OGE A;  2YHB A;  5J2P A;  4LH5 A;  3DRS A;  3ZT2 A;  4E89 A;  3OJS A;  1SKS A;  4DSJ A;  2VWK A;  1ZYQ A;  3KD1 E;  3S9H A;  1NKB A;  3AVJ A;  3SUO A;  2VG7 A;  3PV8 A;  1ZBF A;  2E6L A;  3KIO A;  4FXD A;  1YT3 A;  2YNG A;  4FVM A;  4C8N A;  3NGI A;  2Z1I A;  4BE2 A;  4BE1 A;  1Q9X A;  1S1W A;  4E7I A;  2HNY A;  3DLH A;  4ICL A;  3HPO A;  4HUF A;  1T03 A;  1VSE A;  2RPI A;  4BWM A;  4Z4F A;  3QES A;  1J5O A;  4RW8 A;  1JLC A;  2D0B A;  4AHT A;  3D0P A;  3THV A;  1BCO A;  3KK2 A;  1VSK A;  1G15 A;  1RIL A;  2ZE2 A;  3T3F A;  1JL2 A;  2WON A;  1WNS A;  1SKR A;  2Z1H A;  4M3Y A;  3KK3 A;  1IO2 A;  1LAV A;  2FBX A;  1EET A;  4KRE A;  1WAF A;  3SQ1 A;  1U04 A;  4O4G A;  1ASW A;  4CIF A;  1NK7 A;  4XIU A;  3L2Q A;  1EXQ A;  4RW9 A;  1KTQ A;  4DFJ A;  1BIZ A;  3V1Q A;  4FJN A;  2B4J A;  3MXM A;  1TAU A;  3B6O A;  2QKB A;  2HNZ A;  5HRO A;  3VQQ A;  1TKT A;  1X9W A;  1RBT A;  4AHU A;  4ELT A;  4E3S A;  3ZSZ A;  4B8C A;  2G8H A;  2PZS A;  4DQI A;  4KB1 A;  2FBT A;  1QSS A;  3SYZ A;  3PY8 A;  2ZD1 A;  4RW7 A;  2YHA A;  3CM5 A;  4CJQ A;  1SUQ A;  3L2W A;  2G8V A;  3MXJ A;  4BDP A;  2HHS A;  1NK0 A;  4C8K A;  3RMC A;  1FXX A;  4FLW A;  3OY9 A;  1C0M A;  4NYN A;  4CEC A;  3AV9 A;  3QER A;  3A2F A;  1TGO A;  4OPJ A;  3EYZ A;  2XY5 A;  4CGH A;  1JLF A;  3MEE A;  4C8L A;  4KI4 A;  1RDD A;  2XY7 A;  2YKM A;  3M8R A;  4E0D A;  2KW4 A;  4GMJ B;  2ITG A;  4CEE A;  4NYF A;  4Y1D A;  2P1J A;  4CHZ A;  4Q5V A;  4LSL A;  3AVL A;  5KI6 A;  1S1X A;  1RDC A;  4FLV A;  1I39 A;  1RCH A;  3HPG A;  2BAN A;  2DFE A;  3LWL A;  1T8E A;  3AVI A;  4DG1 A;  4DTU A;  1TKZ A;  4BDZ A;  4F8R A;  1HJR A;  1Y97 A;  1XI1 A;  5FRN A;  3AVA A;  4RW6 A;  1SKW A;  1WSI A;  3P1G A;  2E6M A;  4O0J A;  3U3Y A;  4DU1 A;  1S1U A;  1RT4 A;  2BGG A;  2G8I A;  4CJF A;  4PQU A;  3P5J A;  4E19 A;  2IS3 A;  2LSN A;  4O44 A;  4CJS A;  2RKI A;  4CJ5 A;  4M45 A;  4KHY A;  4BDY A;  3LPU A;  3G0Z A;  4I9Q A;  1S9G A;  3TAN A;  3SNN A;  2B5J A;  4B9V A;  5FRO A;  4J2A A;  3AVH A;  4RG8 A;  4N47 A;  3PX4 A;  4M3R A;  1U49 A;  4CJP A;  4FZX C;  4JS4 A;  4FM2 A;  4DQS A;  1LAW A;  3TAG A;  2B6A A;  5CY4 A;  5HRP A;  5HP1 A;  4CJ3 A;  1NJY A;  1C0U A;  3TAQ A;  3DOL A;  2XHB A;  4CJR A;  1ASU A;  4E7J A;  1VK0 A;  4AHV A;  4FYD A;  3CM6 A;  4IBN A;  2PYJ A;  4QAG A;  3CQ8 A;  3VA0 A;  1S6P A;  3SUP A;  3E01 A;  1TAQ A;  2Y1J A;  2IOC A;  3HST B;  4ZTF A;  3QNN A;  1REV A;  4KTZ A;  3QIP A;  4DTO A;  1LW0 A;  3NH1 A;  2RF2 A;  3T19 A;  5CYM A;  3UIQ A;  5HBM A;  1S5J A;  2KZM A;  2YV0 X;  3OJU A;  1LWC A;  3AVB A;  1BL3 A;  1U45 A;  4BAC A;  3AVC A;  3NFA A;  1JLA A;  3DRP A;  3TAE A;  1NK5 A;  4LY7 A;  1C0T A;  3JSM A;  4CHP A;  1KRP A;  1NOZ A;  3C6U A;  1ITG A;  1L3S A;  1NJW A;  3I0R A;  4OKJ A;  4CHN A;  1Z26 A;  1JLB A;  2DY4 A;  3RRG A;  3AVF A;  3AA3 A;  3O4N A;  1S1V A;  4B9U A;  3HL8 A;  4B08 A;  4LD0 A;  3L8B A;  4BE0 A;  4JRP A;  2EX3 A;  3WNG A;  4CER A;  3ZT4 A;  4CGJ A;  1IKY A;  1HQU A;  5EU7 A;  5HRN A;  3O3F A;  2FC0 A;  4DTN A;  4OLA A;  4CEB A;  5FDL A;  2X78 A;  2O4I A;  2HVI A;  1KCF A;  1IKV A;  1RT3 A;  3V4I A;  1QSY A;  4W5R A;  3TAF A;  4EP4 A; 
#chains in the Genus database with same CATH topology
 4WE1 A;  5BPL A;  4X64 K;  3TAB A;  4CE9 A;  2BDP A;  2VWJ A;  1FW6 A;  5AJ3 K;  4B3T K;  4CJV A;  4JK9 A;  3WEE A;  3KHY A;  4CGD A;  5CZ1 A;  1OH8 A;  3L2R A;  4KH4 A;  4DFK A;  1RBS A;  1VSD A;  3FE1 A;  3V9S A;  4FJG A;  4CZF A;  1XC3 A;  3GG4 A;  3SV4 A;  3JYT A;  4X62 K;  1DLO A;  4DU4 A;  3CJB A;  5LY3 A;  1HJO A;  3VES A;  1VQM N;  3E9O A;  2ZGZ A;  4FWR A;  2OPS A;  1W9H A;  4M41 A;  2JLE A;  3HM9 A;  3K5L A;  1VSL A;  4H5N A;  1O13 A;  4JD2 B;  4FJL A;  2OA8 A;  5HRS A;  4FJH A;  3TI0 A;  3LDO A;  1GLF O;  4HUG A;  3NGY A;  5EOY A;  3G10 A;  1BU6 O;  5I3U A;  4EZ9 A;  1V4T A;  1QHT A;  4OKE A;  4MLE A;  2HHU A;  4JD2 A;  5AQX A;  2AP1 A;  2D1K A;  5AQH A;  2XY8 A;  5FLX O;  4FL9 A;  4J2E A;  4BRQ A;  4M3W A;  4PKG A;  2ITM A;  1L5U A;  4Z0U A;  4DF4 A;  3FR0 A;  1LWE A;  1F21 A;  2GEL A;  3HYF A;  1W0H A;  4FWS A;  1RT6 A;  4CFD A;  1KAX A;  3DLG A;  3SJJ A;  4DUZ K;  4O0I A;  2FLO A;  4BRG A;  3B8A X;  4IKF A;  4I9L A;  1KVC A;  4DMN A;  2G8F A;  1RBU A;  1WAJ A;  4FK2 A;  4JKD A;  2BTF A;  4IFY A;  4FZZ A;  4B9N A;  1TUU A;  3QEW A;  1GLC G;  4FWM A;  2NRH A;  3HP9 A;  2QWQ A;  4FW2 A;  3N4Q A;  4BVO A;  1X9S A;  4V19 S;  4C8O A;  1HLU A;  4CJK A;  1OVY A;  4FLZ A;  1NGI A;  4HWI A;  3OW2 M;  3O4Q A;  3I8B A;  4FJ9 A;  1YTU A;  5FPM A;  4DTM A;  3CXC M;  1WN7 A;  2D4W A;  2WFB A;  1T3V A;  3I8D A;  2P51 A;  1XMO K;  1YF5 L;  4QOZ B;  3VGM A;  3S3O A;  4YNQ A;  4PA1 A;  3ULD A;  1VQ7 N;  4DR4 K;  1WSH A;  1KRP A;  3L3V A;  3KLH A;  1HYS A;  4DCH A;  4IWV A;  2ASO A;  3I33 A;  4FWP A;  2UU9 K;  1VQ4 N;  1QVG M;  5C25 A;  3LP3 A;  4JI4 K;  1U47 A;  4M63 C;  4FJK A;  2G8W A;  4FLY A;  1VRU A;  4C1N K;  4MFB A;  4R5P A;  3U8X A;  3U9D A;  2UUA K;  1KLN A;  3DXM B;  4XEI A;  3OYK A;  4J2B A;  2E2P A;  4KV8 A;  4IG0 A;  3UKU A;  3G71 N;  3ZSY A;  4I2P A;  2VG6 A;  3MWP A;  5FPN A;  3KWG A;  1GOB A;  5B8H A;  3VQ9 A;  5HLF A;  1WBB A;  3DXM A;  1DGK N;  4B9M A;  2DTU A;  3HRG A;  2F8S A;  4M3T A;  4JI5 K;  4KKO A;  3VQE A;  4CI6 A;  3ZX2 A;  4I7F A;  1BGX T;  4JI2 K;  1E3M A;  3HSC A;  3SBT A;  2QWR A;  3LAM A;  3QFP A;  1C1C A;  4CEA A;  2KKZ A;  4F9O A;  3EN9 A;  3HVT A;  2W42 A;  3OS0 A;  3VQ5 A;  4KO0 A;  3OYM A;  2ETJ A;  4JEP A;  2Q3S A;  3K5O A;  2CH5 A;  3NAE A;  4FOE A;  4BRE A;  3DM2 A;  1JLG A;  4W5T A;  4CF9 A;  3LP1 A;  1ATR A;  1ZBI A;  3OS2 A;  4GNI A;  3T1A A;  1FKP A;  1IBK K;  2G8U A;  1VQL N;  3FZK A;  2WOM A;  1XUP O;  1NK4 A;  3PO4 A;  3MN7 A;  1UAX A;  4NO7 A;  3WNH A;  3VN5 A;  4CEO A;  4FJ8 A;  4N5S A;  3ENB A;  4DQQ A;  3TU5 A;  2JWL A;  2P9L B;  3AA4 A;  1HKC A;  5KGX A;  4CGG A;  3OHR A;  3EY1 A;  4H8K A;  1UOC A;  2QEX N;  4I2Q A;  4FPB A;  5FRM A;  3VET A;  3NH2 A;  4BR2 A;  2D5R A;  2GBZ A;  2I7P A;  3VA3 A;  4CZI A;  1XHX A;  3TAR A;  3OYL A;  1NGE A;  4AH9 A;  4CJE A;  1HNI A;  1D9D A;  2X6N A;  3RVC A;  4CZH A;  3NMU A;  2P9L A;  5AZI B;  1VQK N;  4CHO A;  4KBO A;  3P83 D;  3UB5 A;  5AQP A;  1BQM A;  4NCB A;  3K58 A;  5CHI A;  4FJ5 A;  3C65 A;  4BRA A;  1U2V B;  3VF6 A;  3PX6 A;  1N36 K;  4GV9 A;  4FWO A;  3H1V X;  3T69 A;  4IFV A;  5AZI A;  1XC9 A;  4CVN E;  1RTD A;  4RWT A;  2D0O A;  3O3H A;  2VGM A;  3D7E O;  2HHV A;  5BRD A;  1BA0 A;  1BIS A;  4AHR A;  3HTV A;  1U2V A;  3SQ0 A;  1NK9 A;  3CCJ N;  3ZCM A;  4KHU A;  4W5Q A;  4DQ8 A;  1NGB A;  3LAK A;  1NOY A;  2OPP A;  5IT9 O;  3P4I A;  2OPQ A;  4K43 A;  1S6Q A;  3TAP A;  1RDU A;  4OGE A;  1YUW A;  3DRS A;  4E89 A;  3MMV A;  4WQ5 C;  1ZYQ A;  3KD1 E;  5DM7 L;  2H3G X;  3U4L A;  3F2K A;  3KIO A;  3NGI A;  1GLL O;  2Z1I A;  4BE1 A;  3HPO A;  1VSE A;  2RPI A;  4K42 A;  4M7Y A;  3QES A;  3MN9 A;  1J5O A;  4GV6 A;  3THV A;  4M3Y A;  3T3F A;  1WNS A;  1IO2 A;  1LAV A;  2FBX A;  4JI3 K;  3SQ1 A;  3O5B A;  4CIF A;  1GLD G;  2QW9 A;  3V1Q A;  3I55 N;  4FJN A;  3DXK B;  3B6O A;  3VEV A;  3DWL A;  4NXM K;  4ELT A;  4E3S A;  1RGI A;  3ZSZ A;  1VHX A;  1NK0 A;  2F9T A;  1FXX A;  3DXK A;  4BG9 A;  3QER A;  4DKW A;  4O8U A;  1TGO A;  3G25 A;  4OPJ A;  3QBX A;  1YJN N;  2XY5 A;  4CGH A;  5M1N A;  3CCQ N;  4BRH A;  4E0D A;  2KW4 A;  1NMN A;  3AVL A;  1WOQ A;  3FZF A;  2BAN A;  2DFE A;  1T8E A;  2QWM A;  4BDZ A;  1Y97 A;  1SKW A;  3P1G A;  4O0J A;  3U3Y A;  2G8I A;  1RFQ A;  3TTD A;  4PQU A;  2LSN A;  4YOT A;  2RKI A;  2P9S B;  3QBW A;  4BR7 A;  2PFU A;  4WYB A;  4X66 K;  4BDY A;  3LPU A;  1R59 O;  4B9V A;  2O8E B;  3VEZ A;  1IBL K;  3AGK A;  1BO5 O;  2VQF K;  2V7Z A;  1SQK A;  3T1Y K;  3PX4 A;  3NVK A;  4BRP A;  2ZF5 O;  4JS4 A;  4DQS A;  3SK3 A;  1LAW A;  5AQY A;  1X3N A;  3QDK A;  4CJ3 A;  2P9S A;  2XHB A;  2O8E A;  3CQ8 A;  3E01 A;  4R79 A;  2IOC A;  3HST B;  4XH1 A;  1X9J A;  4ZTF A;  3QIP A;  5HBM A;  4A57 A;  2KZM A;  4CZG A;  1LWC A;  2UXB K;  2A3Z A;  2Q31 A;  3IKM A;  3C6U A;  1ITG A;  3VEW A;  4H0X B;  1NJW A;  1W7A A;  4OKJ A;  4CHN A;  3FZL A;  3AA3 A;  3O4N A;  1S1V A;  4B9U A;  4B1Y B;  4CD1 A;  3MCP A;  2QXL A;  3IMX A;  4OLA A;  4DTN A;  3U9Z A;  4CEB A;  4DR5 K;  2HVI A;  1QSY A;  4W5R A;  1YI2 N;  4EP4 A;  1HRH A;  1WSG A;  2HND A;  3ISN C;  4LF4 K;  5KRS A;  4RCH A;  3KVG A;  4NLB A;  1QVF M;  5EVZ A;  2OYQ A;  1VQ5 N;  2VQE K;  3N4P A;  3F73 A;  3ID8 A;  3V1O A;  4B3R K;  3DLB A;  4F4K A;  4O5B A;  4WQ5 A;  3NF6 A;  3TR8 A;  3HBT A;  3NGZ A;  1JLQ A;  3VEX A;  4DHY A;  1MWK A;  2JWK A;  1NU0 A;  3O4W A;  3VQB A;  3T1H K;  2NRZ A;  1CZA N;  2V51 B;  4CJT A;  1UA0 A;  1I94 K;  4BRD A;  4Y1C A;  1QS4 A;  4CK2 A;  3LL3 A;  2D0A A;  3V9X A;  3CCL N;  2DFF A;  1GOA A;  5KRT A;  3W0L A;  3OYA A;  1DTQ A;  1W2B M;  4HTU A;  1HX1 A;  1IV0 A;  4FK4 A;  2Q0R A;  1N32 K;  3ZT3 A;  4DTJ A;  1BHL A;  1RNH A;  3C6H A;  4IOX A;  3U6F A;  3QIC A;  1WLJ A;  3C7N B;  3TAM A;  3UE5 A;  1V4S A;  2F8T A;  2NRX A;  2NRT A;  1RT1 A;  3AO1 A;  3SUN A;  4Z4I A;  3QB0 A;  4A5A A;  5KPT A;  3OYH A;  1BDG A;  3VQ8 A;  5AQS A;  4KHN A;  1IKW A;  2KLA A;  3QLH A;  2QXF A;  3A8Y A;  1DKG D;  3E9P A;  3BY5 A;  3C7N A;  4FJI A;  2YJF A;  3KWI A;  3AAP A;  3EO3 A;  3CFO A;  1LCU A;  2HBJ A;  1W97 L;  1KAZ A;  4CJL A;  3ZLJ A;  3RRH A;  3AAQ A;  5AQV A;  1OH6 A;  3ZSR A;  2GWJ A;  4MLH A;  1I3A A;  3DLK A;  3LDQ A;  1Q18 A;  2I7N A;  3WXJ A;  3HK2 A;  3MXI A;  4Z4C A;  2V52 B;  2HST A;  4UQG A;  4GVM A;  1OVQ A;  3LM9 A;  3C6T A;  3VOV A;  2NRW A;  3NF8 A;  1S22 A;  3M3Z A;  3OYF A;  5HOO A;  2FSJ A;  2D0C A;  2E1Z A;  1TK0 A;  4WQ4 A;  3O08 A;  4PWD A;  4CGI A;  1T6C A;  4DQR A;  2UYT A;  3K59 A;  1OH7 A;  5M1P A;  3H08 A;  3G6E N;  1SL2 A;  3DI6 A;  1SV5 A;  4CJW A;  5BR8 K;  2FF3 B;  1CLQ A;  4YHH K;  1XNR K;  2IGI A;  5BN8 A;  3VQP A;  4WFB L;  2BE2 A;  1JLE A;  1YJW N;  4Z4H A;  1CXQ A;  2IAJ A;  1HYZ A;  1JXE A;  1BCM A;  4ISF A;  5F1X A;  3L3U A;  3AVN A;  3F5T A;  3R9P A;  4FJ7 A;  4ILJ A;  4BG8 A;  2UUB K;  1XNQ K;  3DOK A;  5AFU A;  5BRH A;  5FPD A;  1YJ9 N;  5GIN A;  4IJA A;  2PBD A;  3HXM A;  3KLI A;  3QEP A;  4BR0 A;  4Z4G A;  2ATQ A;  3C94 A;  1TUY A;  1T7P A;  4KHS A;  1KQS M;  1S1T A;  1BIU A;  4JRQ A;  3OBW A;  1QTM A;  3NHG A;  3OBY A;  3GOI A;  1HR0 K;  2V7Y A;  5DMR A;  5AQG A;  3NE6 A;  1MDU B;  4I6M B;  3HPH A;  4H4O A;  4JKC A;  3O9R A;  1EKE A;  1IH7 A;  3Q7B A;  4JKA A;  1NGJ A;  2RHK A;  1XHZ A;  3CC2 N;  3DLE A;  4LF5 K;  5J2Q A;  4KFB A;  4CF1 A;  3ITH A;  4E1N A;  2PY5 A;  5C24 A;  1BUP A;  4I6M A;  3KD5 E;  4DSL A;  1E4G T;  4KAZ A;  3KTQ A;  1KD1 O;  2A1S A;  1KFS A;  3LM2 A;  4NCG A;  4FW1 A;  4CGF A;  5I42 A;  2OTJ N;  4DLG A;  2X74 A;  2NLX A;  1C1A A;  4DFP A;  2UUC K;  3CJ1 A;  5JLH A;  3IFR A;  1RTJ A;  2HW3 A;  4E7H A;  2HF3 A;  2I5J A;  4KHQ A;  4CEQ A;  1D4X A;  1P90 A;  1WSE A;  3CJ9 A;  4CF2 A;  3IG1 A;  4LH4 A;  5MLC Q;  1JKH A;  5KTQ A;  3DAW A;  1J9A A;  5AQQ A;  2A6A A;  5GAG P;  2KQ2 A;  1LOT B;  3LZI A;  2ZJR L;  5AQR A;  4FO0 A;  1C0F A;  4IG3 A;  3IUC A;  2IDO A;  3EZW A;  4CED A;  2YX6 A;  4JAX A;  2YHX A;  3HJF A;  2HVH A;  1QSL A;  4DTX A;  4OJR A;  1KXP A;  1B92 A;  3IAY A;  4JI7 K;  3JXU A;  1KVB A;  5HL7 L;  2F96 A;  4ELV A;  2W6L A;  5HRR A;  4CHQ A;  1VSF A;  3BEX A;  4JNE A;  4K8Z A;  4JI6 K;  3OYE A;  3OVN A;  4BVP A;  5BRF A;  2KZZ A;  1K6Y A;  1EWR A;  5TKW A;  1ZBU A;  2HMI A;  2GX9 A;  4B8A B;  4HVJ A;  5K14 A;  4NLC A;  1N6Q A;  3AY9 A;  2FSK A;  1TK8 A;  3L4I A;  3UKU B;  3H46 O;  3OYB A;  4M3X A;  3RMA A;  4AHC A;  4M42 A;  4N41 A;  3KJV A;  3R8E A;  4H5W A;  1NJI O;  1VQN N;  1S72 N;  2HB5 A;  4BRI A;  1RT5 A;  3NH0 A;  4LF6 K;  4FOI A;  1WSF A;  3AO2 A;  2QK9 A;  2IVO A;  4BWJ A;  4DQP A;  3P31 A;  1UA1 A;  2YCH A;  2F4V K;  2JGU A;  4LH5 A;  3ZT2 A;  4YOV A;  3OJS A;  3TSU A;  4DV6 K;  3S9H A;  4FSV A;  2VG7 A;  3ATU A;  1QZ5 A;  1YT3 A;  4QS7 A;  1NGD A;  4FVM A;  4C8N A;  1Q9X A;  1S1W A;  3DLH A;  2HNY A;  4ICL A;  1T03 A;  5JVG L;  4Z4F A;  4A62 A;  4JHD B;  4DB3 A;  5TKY A;  4H0V B;  1Q86 O;  2GEM A;  5CR4 A;  1BCO A;  4BC4 A;  1G15 A;  4XH4 A;  2WON A;  1SKR A;  2NZT A;  1EET A;  4KRE A;  5C2F A;  4JHD A;  3WXL A;  3J7A P;  1BWF O;  3MN5 A;  4K0K K;  1KTQ A;  1VQP N;  3IDH A;  2QKB A;  5HRO A;  3GBT A;  1X9W A;  4MDB A;  3PY8 A;  2YHA A;  2HBK A;  5AQJ A;  2HHS A;  3MXJ A;  4C8K A;  1Z6R A;  3M1F A;  3OY9 A;  4FLW A;  1C0M A;  4YOU A;  4FWQ A;  2RE2 A;  3CI5 A;  1T44 A;  1NWK A;  3L4Q A;  1JLF A;  4BRN A;  1RDD A;  2XY7 A;  3SBG A;  3M8R A;  2ITG A;  3S41 A;  2AA4 A;  2P1J A;  4CHZ A;  3QFU A;  3LWL A;  3HPG A;  1TKZ A;  4RW6 A;  2BGG A;  1S1U A;  1RT4 A;  2HHH K;  3P5J A;  4E19 A;  3OTO K;  4O44 A;  3CCE N;  4CJ5 A;  4M45 A;  3H1Q A;  3G0Z A;  3TAN A;  4J2A A;  2Q97 A;  1XQS C;  4DV0 K;  1OH5 A;  5CY4 A;  4JV5 K;  4WF9 L;  4A61 A;  1NJY A;  3TAQ A;  3DOL A;  2ZWH A;  1K8K A;  1ASU A;  4JKG B;  2PYJ A;  3VA0 A;  3ZEU B;  1TAQ A;  2O8D B;  3QNN A;  4DTO A;  2WUS A;  3UIQ A;  5CYM A;  3CER A;  3AVB A;  1U45 A;  4JKG A;  3NFA A;  3DRP A;  3O9S A;  3TAE A;  4LY7 A;  1N33 K;  1C0T A;  2EWS A;  3ZEU A;  2O8D A;  3WXK A;  3I0R A;  3R3L A;  1JLB A;  1ILY A;  3RRG A;  4LF7 K;  4GVE A;  3J7Y P;  4HTL A;  4LD0 A;  3ZET B;  4JRP A;  4CER A;  3WNG A;  1QQM A;  3ZT4 A;  1IKY A;  5EU7 A;  5FDL A;  4YY3 K;  1KCF A;  1IKV A;  1RT3 A;  3J7Z O;  3TAF A;  4BRO A;  4EHU A;  1NK8 A;  1UWB A;  4IDH A;  2KFN A;  1VSH A;  5GIP A;  4H5R A;  1TYQ B;  3A0I X;  3ZET A;  1Q81 O;  4BR4 A;  3VQC A;  3EL2 A;  3E9L A;  4U7B A;  3FLC O;  4OGC A;  2OZM A;  1HMV A;  5J2N A;  1TVR A;  3P39 A;  5AQT A;  1TYQ A;  2A40 A;  4JYA K;  1TL1 A;  5M1K A;  1WSJ A;  3W3D A;  4O8K A;  3V9W A;  1NK6 A;  3WNF A;  4ISE A;  1JXB A;  3RSE B;  4FWN A;  3MEC A;  1VSI A;  4YOW A;  3VER A;  5AQI A;  4X65 K;  1NJZ A;  4O55 A;  4EFH A;  1D9F A;  3UKR B;  4DV4 K;  4BR5 A;  4FLU A;  5ADX H;  1J5E K;  3ZT0 A;  1MWM A;  3MX2 A;  3RSE A;  4PUO A;  3KK7 A;  1VQ8 N;  4JK7 A;  2A41 A;  2KFZ A;  1S3X A;  2YHY A;  5BR9 A;  4CJ4 A;  3GL1 A;  3CFR A;  3SZ2 A;  4IEI A;  3M5R A;  3UKR A;  2CGL A;  3V81 A;  3EE9 A;  1QQO A;  2E4L A;  3S3M A;  4FCY A;  2NUB A;  4JN4 A;  3PIP L;  3HP6 A;  1GLE G;  3AGR A;  5JLF A;  5GIO A;  3MEG A;  3VTI A;  4PL7 A;  4DSE A;  4CZM A;  4Z4E A;  1XWL A;  3THX B;  5JS1 A;  4NXN K;  3EKU A;  2EHG A;  2IC3 A;  3M8P A;  5BN9 A;  1J54 A;  4NCA A;  1SL1 A;  4IDK A;  4YOY A;  4QCL A;  1EX4 A;  4H0P A;  3BZK A;  3R1X A;  5CZ2 A;  3THX A;  3ZX0 A;  2FBV A;  2Y1I A;  5BRE A;  1VQ9 N;  3DMJ A;  4DV1 K;  4HUE A;  4JS5 A;  2AJQ A;  5JS2 A;  4E7L A;  3MN6 A;  1BI4 B;  4QS9 A;  2FF6 A;  4WQ4 C;  3AO3 A;  2QA4 N;  2QWO A;  3S3N A;  1NKC A;  1K73 O;  4WCE L;  1T05 A;  4AF1 A;  5M1F A;  3CCS N;  5AQK A;  4IEE A;  4F2R A;  3K57 A;  2A1R A;  1GOC A;  1NM1 A;  3ZSW A;  1Z25 A;  1NGC A;  3ZSO A;  1CZ9 A;  1BI4 A;  1B9F A;  4EAH D;  4FYD A;  3VQA A;  4B9T A;  1JL1 A;  4JI8 K;  4MO4 A;  3WT0 A;  4CHY A;  3WQU A;  2E2N A;  4H0T B;  4W5N A;  3C95 A;  3D2E B;  1LV5 A;  3KLF A;  4DR2 K;  4BQL A;  1L3V A;  5J1E A;  4OPA A;  3KKS A;  3O3G A;  3ASM A;  3SCX A;  4EHT A;  4B9L A;  1KSP A;  1U6Z A;  2HHW A;  2O4G A;  3CPW M;  3QET A;  3D45 A;  3DJC A;  1ASV A;  2HBM A;  3D2E A;  2D0P A;  4DSI A;  2VG5 A;  1WB9 A;  4CFC A;  3CF5 L;  3DLR A;  1NKE A;  1N5Y A;  1Q9Y A;  4RW4 A;  2W41 A;  4GKJ K;  1FKO A;  5D3G A;  4KB0 A;  3O80 A;  4ILG B;  3CCV N;  1NLV A;  3FZM A;  3ID6 A;  3SQ2 A;  4CJU A;  4KPY A;  2OTL N;  4L8R B;  2IVN A;  5AQL A;  1ZBH A;  1JCG A;  4KRF A;  3LDS A;  5A2Q O;  1VSJ A;  2FSN A;  4IOA L;  2BH1 A;  1QE1 A;  3KLG A;  1YAG A;  2YJE A;  4FLT A;  2E20 A;  4DR7 K;  3AVM A;  1N8R O;  4CF8 A;  4JKB A;  2ASP A;  4CJ7 A;  4JKE A;  4DS4 A;  3H6E A;  5E26 A;  4DU3 A;  4DR6 K;  4N76 A;  3WXM B;  2QKK A;  1YXQ A;  1FK9 A;  4FM1 A;  4Q0B A;  3VEO A;  1U48 A;  2O8F A;  3HI0 A;  1EQY A;  2P9U B;  1YHQ N;  5DK5 A;  5LJV A;  1HNV A;  4B9S A;  2IVP A;  4F3T A;  2WTU A;  1RT2 A;  3TPQ A;  1WUA A;  3HO1 A;  5M1Q A;  4H5T A;  4G9Z A;  3QNO A;  3O1B A;  1IG8 A;  3LAN A;  4K41 A;  3AVG A;  4BY9 C;  4W5O A;  4GV3 A;  2Z1J A;  1KFD A;  2P9U A;  4BQZ A;  2DPN A;  4DF8 A;  3VQ4 A;  1NGA A;  4AM7 A;  5AQF A;  3TSQ A;  1RBV A;  2YNI A;  5F0X A;  4DTS A;  4OPK A;  3CFP A;  3KLE A;  3IS9 A;  3ATV A;  4L3Q A;  4EP5 A;  3SAF A;  3M8Q A;  4B9Q A;  4DS5 A;  4CCH A;  4JKH A;  4WFA L;  3V1R A;  4DUY K;  3SPY A;  4LSN A;  3K2P A;  2F7T A;  4OO1 J;  4DSF A;  3CG7 A;  1DTT A;  1BOT O;  1BQN A;  3LDL A;  4CES A;  2YNF A;  3RR8 A;  3OYN A;  3ZX3 A;  3GE1 A;  5DM6 L;  4ID1 A;  3LPT A;  4PL8 A;  3FFI A;  4CK1 A;  4BR9 A;  3J81 O;  2X6S A;  1LWF A;  4Y0W A;  2PYL A;  2HF4 A;  1ATS A;  4JLH A;  1NMD A;  3EKS A;  5ELZ A;  1ZXO A;  3ENO A;  4YFU A;  4OKK A;  2Z1G A;  4CIG A;  3VEN A;  4H0Y B;  5KQ8 A;  3DYA A;  4BRK A;  5E84 A;  2GV9 A;  4B3O A;  3H45 C;  2FBY A;  3AA2 A;  3LAL A;  4FK0 A;  4DLE A;  1BA1 A;  5LJW A;  4JKF A;  1IG9 A;  1S9E A;  2XRI A;  3F9M A;  4H4M A;  1K9M O;  2QM1 A;  3RTV A;  5J2P A;  2VWB A;  2YHB A;  3VGK A;  2CGJ A;  5AQU A;  4DSJ A;  2VWK A;  3SUO A;  2KHO A;  4BE2 A;  3O6W A;  3AAR A;  4E7I A;  2ZJQ L;  4HUF A;  2Q36 A;  4BWM A;  3O8M A;  1VAZ A;  3K0S A;  1JLC A;  2D0B A;  2P9I B;  4AHT A;  3SJH A;  1VSK A;  3L0Q A;  5AQM A;  3THY B;  1RIL A;  2J4R A;  1JL2 A;  4RTF D;  1E4F T;  3KK3 A;  4JI0 K;  1ASW A;  4Z94 A;  3SAH A;  3A5N C;  4RW9 A;  4DFJ A;  1X3M A;  4CW7 B;  1BIZ A;  2P9I A;  3MXM A;  3THY A;  3BP8 A;  2HNZ A;  1TKT A;  1RBT A;  2PZS A;  4B8C A;  2G8H A;  2P9K B;  4KB1 A;  2FBT A;  1QSS A;  2CH6 A;  2W6K A;  2ZD1 A;  3SYZ A;  3CM5 A;  5GAD P;  4CD3 A;  3L2W A;  2G8V A;  3RMC A;  4NYN A;  4CZE A;  4CEC A;  3CMA N;  4ILH A;  3ENH A;  3A2F A;  1KC8 O;  3EYZ A;  4C8L A;  2P9K A;  2P9N B;  4B1Z A;  5LMN K;  4NYF A;  4Y1D A;  2WBN A;  2HBL A;  4Q5V A;  4LSL A;  1RDC A;  1VQO N;  1YIT N;  3E1Y A;  1I39 A;  1HNX K;  4BRM A;  4DTU A;  1H1V A;  4XH5 A;  1NGH A;  1XI1 A;  3O9Q A;  3AVA A;  2P9N A;  2E6M A;  3C0B A;  4CJF A;  2IS3 A;  3CJ7 A;  4KHY A;  1XMQ K;  3T7Z A;  1S9G A;  3SNN A;  4J8F A;  1QQN A;  3HM8 A;  5ADX A;  4B1W B;  4LFA K;  3K9K A;  4RG8 A;  3QML A;  3SLC A;  4M3R A;  1U49 A;  4CJP A;  4FZX C;  4FM2 A;  2B6A A;  3CCU N;  4OX9 K;  2YHW A;  4CJR A;  4E7J A;  4IBN A;  4BRF A;  4QAG A;  1S6P A;  2Y1J A;  4H0O A;  4C23 A;  3TTC A;  1REV A;  2ZGY A;  3MWT A;  3VF2 A;  1LW0 A;  3NH1 A;  4NB4 A;  4A2B A;  1BG3 A;  1IJJ A;  2YV0 X;  3BUZ B;  1BL3 A;  1JLA A;  5AQN A;  1NK5 A;  3JSM A;  4CHP A;  3CC7 N;  3O9U A;  1NOZ A;  4DV2 K;  2ZM6 K;  3CQY A;  4FWK A;  3JS6 A;  4AQY K;  1NGG A;  1Z26 A;  4YOR A;  3VGL A;  4MDA A;  5C10 A;  2EX3 A;  3O3F A;  1NBW A;  1FJG K;  2FC0 A;  2X78 A;  3V4I A;  3VQ6 A;  1NNE A;  1GLJ O;  4A59 A;  4U67 L;  4IFE A;  4EZ6 A;  3OYG A;  3ZSV A;  4AIL C;  3AA5 X;  3B6P A;  3LP2 A;  1NJX A;  3QIN A;  1N34 K;  2QWP A;  3K5N A;  2ZJP L;  4GY2 B;  1IBM K;  2R7Y A;  4MO5 A;  3NDK A;  3AO4 A;  5E41 A;  5M1O A;  4CBW A;  1RBR A;  3HOS A;  4KTW A;  1SL0 A;  4ISG A;  2HHT A;  1IKX A;  4E7K A;  2PAV A;  1SS6 A;  1QQC A;  5JMV A;  3OYC A;  1L3U A;  2VCP A;  5SWM A;  2ZQB A;  1M1K O;  4YDU C;  4LF8 K;  5CYQ A;  3H3N O;  3OS1 A;  3L2V A;  3OYD A;  3KK1 A;  4DV5 K;  2XO7 A;  4B1V A;  2ASM A;  3F9K A;  2E1Y A;  1GLA G;  3EZ5 A;  3CYM A;  3PSI A;  3BF1 A;  3V9Z A;  3AVK A;  4E1J A;  5GAH P;  5KGW A;  4J2D A;  1OKJ A;  3ZSQ A;  1D5A A;  4CBU A;  4B3S K;  1Y64 A;  1O1W A;  4H03 B;  4IXC A;  4OVL A;  1RDB A;  3TSP A;  2A5X A;  1EP4 A;  3OYJ A;  2BUP A;  3SQ4 A;  3J8A A;  4HCC A;  4FJX A;  4AM6 A;  2RN2 A;  3EE8 A;  4IJN A;  1R0A A;  2HHX A;  3SV3 A;  1A5V A;  2E5L K;  5J2M A;  4PHT X;  2IIR A;  3GDQ A;  3SAG A;  2QI2 A;  1K8K B;  3BDP A;  3QEV A;  3OYI A;  4HCB A;  3NVM A;  1TK5 A;  4BC3 A;  3VPZ A;  4K8X A;  5AZJ B;  1RTI A;  3CIP A;  1ESV A;  4B1U B;  5KPZ A;  4AHS A;  1C6V A;  4F3O A;  1A5X A;  5BPM A;  4M3U A;  2OPR A;  1HKG A;  3BGR A;  1L3T A;  3VQ7 A;  4UY8 O;  3IRX A;  3MX5 A;  5AR0 A;  5AZJ A;  2GWK A;  1Z05 A;  3H3O B;  3VQD A;  3I0S A;  3O9T A;  5BPN A;  4DV3 K;  5H1S Q;  3VTH A;  3LWM A;  4FWL A;  3A5M C;  3K9J A;  4PKH A;  3LDN A;  5LMU K;  1CZB A;  3JAM O;  4H5V A;  2E88 A;  3MCA B;  1J6Z A;  5AFU H;  3L6Q A;  4IO8 A;  1SZ2 A;  3CQX A;  3M8S A;  1JCE A;  3U3G A;  4KI6 A;  3KKR A;  3QIO A;  2HOE A;  1YTA A;  4CK3 A;  3CJC A;  4K25 A;  3DRR A;  3R6M A;  4A5B A;  4B3M K;  1B9D A;  1RTH A;  4C8M A;  5IWA K;  3L2U A;  3PX0 A;  1YVN A;  3OA9 A;  4FM0 A;  5C15 A;  2E8A A;  4KTQ A;  4BRC A;  1CXU A;  4GW6 A;  2Q2R A;  3NF7 A;  1VQ6 N;  2P5G A;  3HZ6 A;  2NRR A;  4M7X A;  4CBX A;  1WBD A;  1JJ2 M;  1KAY A;  2KTQ A;  1QZ6 A;  4BGA A;  2NNW A;  4E1M A;  4CEF A;  1TKX A;  2E2Q A;  3PSF A;  3SUQ A;  1HPZ A;  4CEZ A;  4CIE A;  4OLB A;  3PUF A;  2P9P B;  4CF0 A;  3AO5 A;  2QTD A;  3RMD A;  3TWH A;  2WC9 A;  4BC5 A;  1EO1 A;  2GUI A;  1HYV A;  3LDP A;  2XY6 A;  4F2S A;  1RDA A;  2F9W A;  1NG9 A;  1RT7 A;  4BC2 A;  1D8Y A;  3V6D A;  4JI1 K;  2P5O A;  5C42 A;  3QO9 A;  2P9P A;  3DLL L;  2YKN A;  4OPH A;  1LW2 A;  4A2A A;  1HKB A;  4IO9 L;  1QHA A;  4CZL A;  2YNH A;  5FPE A;  3LZJ A;  3J80 O;  4YDU A;  3M6G A;  1TKD A;  4HHT A;  4ELU A;  4ZHR A;  3K5M A;  1A5W A;  5EY4 A;  1Q82 O;  2G8K A;  1ZBL A;  3VEY A;  3A5O C;  4PY5 A;  3NCI A;  4FVU A;  3TTF A;  1M90 O;  1X1P A;  2OCE A;  3V9U A;  1U4B A;  3HVR A;  3NF9 A;  3G4S N;  3MED A;  3PIO L;  4KH5 A;  5GAE P;  4ZTJ A;  4IOC L;  1J53 A;  1Q8I A;  4CFA A;  1T6D A;  5C12 A;  5JIC A;  4ID5 A;  3CET A;  5EXW A;  3ZT1 A;  1EWQ A;  5JVH L;  3C6A A;  3RR7 A;  4DWI A;  3MAQ A;  3WNE A;  3ULE B;  4FZY A;  3CD6 N;  1GLB G;  1YVU A;  1HPM A;  5AQW A;  3QEX A;  4M3Z A;  4JK8 A;  1MU2 A;  1VSM A;  4N56 A;  2UXC K;  3RMB A;  3WUH A;  4DTR A;  2FXU A;  3ZSX A;  2VGN A;  3ULE A;  1HUX A;  3I56 N;  4O5F A;  3QEI A;  3FGU A;  4LFB K;  3NBP A;  4KI4 A;  1ATN A;  2Q1N A;  4CZK A;  3MK6 A;  4FJJ A;  1KVA A;  4DSK A;  3SI6 A;  5EX5 A;  3CHW A;  4GKK K;  1TV6 A;  2NRV A;  1K8A O;  4DV7 K;  1C0G A;  4WFN L;  2OZS A;  3MDQ A;  1HQE A;  3PO5 A;  2UXD K;  4FLX A;  5AQZ A;  3BZC A;  1C1B A;  4KHW A;  2HHQ A;  3CCM N;  5F2R A;  4DR3 K;  5SZT A;  5C2D A;  1VRT A;  3ALY A;  4G1Q A;  1YIJ N;  1HNW K;  3FZH A;  4TSX A;  5T7B A;  2DFH A;  4MQ3 A;  4CFB A;  3SMS A;  3RWU A;  4DFM A;  1NGF A;  3O1W A;  4DTP A;  1TL3 A;  3LP0 A;  3SPZ A;  3EEQ A;  3HT3 A;  4FJM A;  1KLM A;  2CGK A;  1X9M A;  4LC9 B;  2O8B B;  3FFK B;  1SKS A;  1NKB A;  3AVJ A;  3PV8 A;  1ZBF A;  2E6L A;  5KQD A;  4FXD A;  5CE3 A;  2YNG A;  3Q7C A;  2A42 A;  1DT9 A;  4KHP K;  2GUP A;  3A5L C;  2O8B A;  4RW8 A;  3D0P A;  2O8F B;  3KK2 A;  3D2F B;  4EIA A;  3VMF B;  1ZC6 A;  2ZE2 A;  2HMP A;  2Z1H A;  1WAF A;  1U04 A;  4O4G A;  4BGB A;  1NK7 A;  1G99 A;  4XIU A;  1EXQ A;  3L2Q A;  2VYP A;  4LFC K;  2B4J A;  1TAU A;  3CME N;  3D2F A;  1HNZ K;  3VQQ A;  4AHU A;  3ZYY X;  4DQI A;  4RW7 A;  4CJQ A;  2GTD A;  1SUQ A;  1MA9 B;  4BDP A;  3VF4 A;  1DEJ A;  4QS8 A;  5LL6 Z;  4BRL A;  3AV9 A;  3E66 A;  3MEE A;  2W40 A;  2E2O A;  2YKM A;  4CEE A;  4GMJ B;  3WXI A;  3PLA A;  3CPE A;  5KI6 A;  1S1X A;  4FLV A;  1RCH A;  4YOX A;  5C0Y A;  1JCF A;  3AVI A;  4DG1 A;  4F8R A;  1HJR A;  4IZ9 A;  5FRN A;  1WSI A;  4C1N I;  4DU1 A;  1RDW X;  1ZBS A;  2OAN A;  4CJS A;  3BF3 A;  4I9Q A;  2B5J A;  2O8C B;  5FRO A;  3AVH A;  5I9E B;  3THW B;  4N47 A;  2Q0U A;  3TAG A;  5HRP A;  5HP1 A;  3P38 A;  1C0U A;  3HOT A;  1VK0 A;  3D6R A;  4AHV A;  3CM6 A;  3SUP A;  4LF9 K;  2O8C A;  1P8Z A;  3THW A;  5AQO A;  1Q7Y O;  4KTZ A;  2RF2 A;  3T19 A;  3CCR N;  4FPA A;  1SAZ A;  1S5J A;  4PKI A;  3OJU A;  2QWL A;  3KZB A;  4BAC A;  3AVC A;  3SMP A;  4CZJ A;  3CC4 N;  4DR1 K;  4B1X B;  1L3S A;  5KPR A;  2YI1 A;  3CJA A;  2DY4 A;  3AVF A;  2QWN A;  3HL8 A;  4B08 A;  4KH6 A;  3L8B A;  4BE0 A;  3WQT A;  3WEE B;  4CGJ A;  1HQU A;  5HRN A;  2O4I A; 
#chains in the Genus database with same CATH homology
 4WE1 A;  1HRH A;  3VQ6 A;  3TAB A;  1NK8 A;  4CE9 A;  1UWB A;  1WSG A;  2HND A;  3ISN C;  2BDP A;  4EZ6 A;  3OYG A;  2VWJ A;  2KFN A;  1VSH A;  5KRS A;  3ZSV A;  4CJV A;  4AIL C;  4CGD A;  5CZ1 A;  2OYQ A;  3L2R A;  3AA5 X;  3B6P A;  3VQC A;  3F73 A;  3LP2 A;  1RBS A;  3QIN A;  4DFK A;  1NJX A;  1VSD A;  4OGC A;  2OZM A;  3V1O A;  3V9S A;  1HMV A;  3K5N A;  3DLB A;  4F4K A;  4O5B A;  5J2N A;  2R7Y A;  4FJG A;  3NDK A;  3AO4 A;  5E41 A;  3NF6 A;  3TR8 A;  1RBR A;  1TVR A;  3NGZ A;  3SV4 A;  1JLQ A;  3JYT A;  1DLO A;  4DU4 A;  1TL1 A;  4KTW A;  1SL0 A;  1WSJ A;  2HHT A;  1IKX A;  3VQB A;  4E7K A;  3V9W A;  1NK6 A;  3WNF A;  1QQC A;  2OPS A;  1JXB A;  3OYC A;  4CJT A;  1UA0 A;  1W9H A;  4M41 A;  2JLE A;  5SWM A;  3HM9 A;  2ZQB A;  3MEC A;  3K5L A;  1VSI A;  4Y1C A;  1VSL A;  1QS4 A;  1NJZ A;  4O55 A;  1D9F A;  4CK2 A;  5CYQ A;  4FJL A;  2D0A A;  3V9X A;  2OA8 A;  3OS1 A;  5HRS A;  2DFF A;  4FJH A;  1GOA A;  5KRT A;  3TI0 A;  3L2V A;  3OYD A;  3KK1 A;  4FLU A;  3OYA A;  2XO7 A;  1DTQ A;  4HTU A;  4HUG A;  3NGY A;  3ZT0 A;  3F9K A;  4FK4 A;  3G10 A;  5I3U A;  4EZ9 A;  4PUO A;  3EZ5 A;  3CYM A;  3ZT3 A;  4DTJ A;  1BHL A;  1QHT A;  1RNH A;  4OKE A;  2KFZ A;  3V9Z A;  3U6F A;  3AVK A;  2HHU A;  1WLJ A;  3TAM A;  4CJ4 A;  3CFR A;  3SZ2 A;  2F8T A;  2XY8 A;  5KGW A;  4J2D A;  3ZSQ A;  3V81 A;  1D5A A;  2E4L A;  1RT1 A;  3AO1 A;  3SUN A;  4J2E A;  3S3M A;  4FCY A;  4Z4I A;  4M3W A;  4KRF A;  3OYH A;  2NUB A;  1O1W A;  4OVL A;  3VQ8 A;  3HP6 A;  1RDB A;  4Z0U A;  1L5U A;  1EP4 A;  4DF4 A;  4KHN A;  3MEG A;  3OYJ A;  1LWE A;  1IKW A;  1F21 A;  3SQ4 A;  4DSE A;  3QLH A;  2QXF A;  4Z4E A;  1XWL A;  5JS1 A;  3HYF A;  4FJI A;  1W0H A;  1RT6 A;  4CFD A;  3DLG A;  4HCC A;  3SJJ A;  4FJX A;  3CFO A;  2EHG A;  2RN2 A;  1R0A A;  2HHX A;  2IC3 A;  3SV3 A;  4O0I A;  1A5V A;  3M8P A;  5J2M A;  1J54 A;  4CJL A;  1SL1 A;  4IKF A;  4NCA A;  3RRH A;  4I9L A;  4IDK A;  4QCL A;  1EX4 A;  1KVC A;  5CZ2 A;  4DMN A;  3ZSR A;  3QEV A;  2G8F A;  3BDP A;  3OYI A;  4HCB A;  1RBU A;  2FBV A;  1TK5 A;  1WAJ A;  4K8X A;  1I3A A;  3DLK A;  2Y1I A;  1RTI A;  4FK2 A;  3DMJ A;  4AHS A;  1C6V A;  4IFY A;  4FZZ A;  3HK2 A;  3MXI A;  4Z4C A;  1A5X A;  4F3O A;  4HUE A;  4B9N A;  4JS5 A;  2AJQ A;  4M3U A;  5JS2 A;  3QEW A;  2OPR A;  4E7L A;  3HP9 A;  1BI4 B;  3BGR A;  4UQG A;  3VQ7 A;  4GVM A;  1L3T A;  4FW2 A;  3AO3 A;  3S3N A;  3C6T A;  3IRX A;  1NKC A;  3VQD A;  3I0S A;  1X9S A;  1T05 A;  4C8O A;  3NF8 A;  4CJK A;  4FLZ A;  4F2R A;  3LWM A;  3K57 A;  2A1R A;  3O4Q A;  4FJ9 A;  3OYF A;  1CZB A;  1GOC A;  1YTU A;  4DTM A;  3ZSW A;  1Z25 A;  3ZSO A;  1CZ9 A;  1WN7 A;  1BI4 A;  3M8S A;  2D0C A;  1B9F A;  3U3G A;  1TK0 A;  4KI6 A;  3KKR A;  4PWD A;  3QIO A;  2P51 A;  4CGI A;  3VQA A;  1YTA A;  4CK3 A;  3I8D A;  4DQR A;  3S3O A;  1JL1 A;  4YNQ A;  4B9T A;  4QOZ B;  3K59 A;  4CHY A;  4W5N A;  3H08 A;  4PA1 A;  3C95 A;  3ULD A;  3DRR A;  1SL2 A;  1WSH A;  1B9D A;  1RTH A;  3DI6 A;  4C8M A;  3L2U A;  1SV5 A;  3L3V A;  4CJW A;  3KLF A;  3KLH A;  3PX0 A;  1LV5 A;  1L3V A;  5J1E A;  1HYS A;  4FM0 A;  1CLQ A;  4KTQ A;  2IGI A;  3KKS A;  1CXU A;  3O3G A;  3ASM A;  3VQP A;  4GW6 A;  3SCX A;  2BE2 A;  3NF7 A;  3LP3 A;  5C25 A;  1U47 A;  4B9L A;  1KSP A;  2P5G A;  1JLE A;  2HHW A;  4Z4H A;  2O4G A;  3QET A;  3D45 A;  4FJK A;  1ASV A;  2G8W A;  1CXQ A;  4FLY A;  4DSI A;  2VG5 A;  2IAJ A;  1HYZ A;  1JXE A;  4CFC A;  1BCM A;  1VRU A;  3DLR A;  1NKE A;  1N5Y A;  4MFB A;  4R5P A;  1Q9Y A;  3L3U A;  3AVN A;  4RW4 A;  1KLN A;  3OYK A;  4J2B A;  4FJ7 A;  5FRM A;  2KTQ A;  4KV8 A;  1FKO A;  4IG0 A;  4E1M A;  4CEF A;  1TKX A;  3ZSY A;  5D3G A;  4I2P A;  3DOK A;  4KB0 A;  2VG6 A;  3SUQ A;  1HPZ A;  4CEZ A;  4CIE A;  3SQ2 A;  4OLB A;  1GOB A;  3PUF A;  4CF0 A;  3AO5 A;  4CJU A;  4KPY A;  3RMD A;  3TWH A;  3VQ9 A;  3HXM A;  3KLI A;  3QEP A;  5HLF A;  4L8R B;  1ZBH A;  4Z4G A;  2GUI A;  1HYV A;  2ATQ A;  2XY6 A;  4B9M A;  1RDA A;  4F2S A;  3C94 A;  1T7P A;  3LDS A;  4KHS A;  2F8S A;  1VSJ A;  1S1T A;  1BIU A;  4JRQ A;  4M3T A;  1QTM A;  1RT7 A;  1QE1 A;  4KKO A;  3KLG A;  3NHG A;  1D8Y A;  3V6D A;  4FLT A;  3VQE A;  2P5O A;  5C42 A;  3QO9 A;  3AVM A;  5DMR A;  4CF8 A;  4I7F A;  3NE6 A;  2YKN A;  1BGX T;  3HPH A;  4H4O A;  1LW2 A;  4DS4 A;  4DU3 A;  1EKE A;  2YNH A;  3LAM A;  1IH7 A;  1C1C A;  4CEA A;  4N76 A;  3LZJ A;  2QKK A;  3HVT A;  1FK9 A;  4FM1 A;  1XHZ A;  4Q0B A;  2W42 A;  1U48 A;  4HHT A;  3DLE A;  4ZHR A;  5J2Q A;  4KFB A;  1TKD A;  4CF1 A;  3K5M A;  4ELU A;  1A5W A;  3ITH A;  4E1N A;  3OS0 A;  1ZBL A;  3VQ5 A;  5C24 A;  4KO0 A;  2G8K A;  3OYM A;  2PY5 A;  3KD5 E;  2ETJ A;  3NCI A;  5DK5 A;  4B9S A;  1HNV A;  2Q3S A;  4DSL A;  4PY5 A;  4KAZ A;  3K5O A;  3NAE A;  4F3T A;  1X1P A;  3KTQ A;  1RT2 A;  2A1S A;  3DM2 A;  3V9U A;  1JLG A;  4W5T A;  1KFS A;  4CF9 A;  3LP1 A;  3HO1 A;  4NCG A;  1U4B A;  3HVR A;  3NF9 A;  4FW1 A;  3QNO A;  4CGF A;  5I42 A;  3LAN A;  1ZBI A;  3MED A;  3AVG A;  4DLG A;  2X74 A;  4W5O A;  3OS2 A;  4ZTJ A;  1C1A A;  2Z1J A;  3T1A A;  1J53 A;  1KFD A;  1Q8I A;  4CFA A;  4DF8 A;  3VQ4 A;  4DFP A;  1FKP A;  4ID5 A;  3ZT1 A;  2G8U A;  1RTJ A;  2WOM A;  2HW3 A;  3RR7 A;  1RBV A;  2YNI A;  3MAQ A;  3WNE A;  4E7H A;  4DTS A;  4DWI A;  2I5J A;  4OPK A;  3CFP A;  3KLE A;  4KHQ A;  1NK4 A;  4CEQ A;  3PO4 A;  4FZY A;  1WSE A;  1YVU A;  1UAX A;  3WNH A;  3IS9 A;  4CF2 A;  3QEX A;  3IG1 A;  3VN5 A;  4LH4 A;  4M3Z A;  4CEO A;  1MU2 A;  1VSM A;  4N56 A;  1JKH A;  4FJ8 A;  4N5S A;  4EP5 A;  5KTQ A;  4DQQ A;  4DS5 A;  3M8Q A;  4CCH A;  3RMB A;  1J9A A;  4DTR A;  3V1R A;  3ZSX A;  2KQ2 A;  3SPY A;  3LZI A;  4LSN A;  3AA4 A;  3K2P A;  5KGX A;  4IG3 A;  3QEI A;  4CGG A;  2IDO A;  4CED A;  3EY1 A;  4H8K A;  3HJF A;  1UOC A;  2HVH A;  3NBP A;  4DSF A;  3CG7 A;  4I2Q A;  1DTT A;  3NH2 A;  4DTX A;  4OJR A;  1QSL A;  2D5R A;  1B92 A;  1BQN A;  2GBZ A;  3VA3 A;  4CES A;  2YNF A;  3RR8 A;  3IAY A;  4FJJ A;  1XHX A;  3OYN A;  3TAR A;  3OYL A;  1KVA A;  1KVB A;  2F96 A;  4AH9 A;  4DSK A;  2DTU A;  4ID1 A;  4CJE A;  1HNI A;  3LPT A;  3SI6 A;  1D9D A;  2X6N A;  1TV6 A;  3FFI A;  4CK1 A;  1L3U A;  4ELV A;  2X6S A;  4CHO A;  1LWF A;  3P83 D;  5HRR A;  4CHQ A;  1VSF A;  2PYL A;  2OZS A;  1BQM A;  4NCB A;  1HQE A;  3K58 A;  4K8Z A;  4JLH A;  3OYE A;  3PO5 A;  3OVN A;  4FJ5 A;  4FLX A;  2KZZ A;  1K6Y A;  1C1B A;  1ZBU A;  2HMI A;  4KHW A;  4YFU A;  4OKK A;  3PX6 A;  2HHQ A;  4B8A B;  2Z1G A;  4IFV A;  4HVJ A;  5SZT A;  5K14 A;  4CIG A;  1N6Q A;  1XC9 A;  1VRT A;  3ALY A;  4G1Q A;  1RTD A;  4TSX A;  5T7B A;  1TK8 A;  3O3H A;  2HHV A;  3OYB A;  3DYA A;  2DFH A;  4MQ3 A;  1BIS A;  4AHR A;  4AHC A;  4CFB A;  3RMA A;  4M42 A;  4M3X A;  3RWU A;  3SQ0 A;  4N41 A;  4DFM A;  3KJV A;  1NK9 A;  2GV9 A;  3ZCM A;  4KHU A;  4B3O A;  4W5Q A;  2HB5 A;  4DTP A;  3LAK A;  1RT5 A;  1TL3 A;  2FBY A;  2OPP A;  3LP0 A;  3AA2 A;  3NH0 A;  1NOY A;  3LAL A;  4FK0 A;  4DLE A;  3SPZ A;  3HT3 A;  1WSF A;  3AO2 A;  4FJM A;  4BWJ A;  2OPQ A;  2QK9 A;  1S6Q A;  3TAP A;  4DQP A;  1IG9 A;  1S9E A;  2XRI A;  1KLM A;  4H4M A;  1UA1 A;  3RTV A;  1X9M A;  2JGU A;  4OGE A;  2YHB A;  5J2P A;  4LH5 A;  3DRS A;  3ZT2 A;  4E89 A;  3OJS A;  1SKS A;  4DSJ A;  2VWK A;  1ZYQ A;  3KD1 E;  3S9H A;  1NKB A;  3AVJ A;  3SUO A;  2VG7 A;  3PV8 A;  1ZBF A;  2E6L A;  3KIO A;  4FXD A;  1YT3 A;  2YNG A;  4FVM A;  4C8N A;  3NGI A;  2Z1I A;  4BE2 A;  4BE1 A;  1Q9X A;  1S1W A;  4E7I A;  2HNY A;  3DLH A;  4ICL A;  3HPO A;  4HUF A;  1T03 A;  1VSE A;  2RPI A;  4BWM A;  4Z4F A;  3QES A;  1J5O A;  4RW8 A;  1JLC A;  2D0B A;  4AHT A;  3D0P A;  3THV A;  1BCO A;  3KK2 A;  1VSK A;  1G15 A;  1RIL A;  2ZE2 A;  3T3F A;  1JL2 A;  2WON A;  1WNS A;  1SKR A;  2Z1H A;  4M3Y A;  3KK3 A;  1IO2 A;  1LAV A;  2FBX A;  1EET A;  4KRE A;  1WAF A;  3SQ1 A;  1U04 A;  4O4G A;  1ASW A;  4CIF A;  1NK7 A;  4XIU A;  3L2Q A;  1EXQ A;  4RW9 A;  1KTQ A;  4DFJ A;  1BIZ A;  3V1Q A;  4FJN A;  2B4J A;  3MXM A;  1TAU A;  3B6O A;  2QKB A;  2HNZ A;  5HRO A;  3VQQ A;  1TKT A;  1X9W A;  1RBT A;  4AHU A;  4ELT A;  4E3S A;  3ZSZ A;  4B8C A;  2G8H A;  2PZS A;  4DQI A;  4KB1 A;  2FBT A;  1QSS A;  3SYZ A;  3PY8 A;  2ZD1 A;  4RW7 A;  2YHA A;  3CM5 A;  4CJQ A;  1SUQ A;  3L2W A;  2G8V A;  3MXJ A;  4BDP A;  2HHS A;  1NK0 A;  4C8K A;  3RMC A;  1FXX A;  4FLW A;  3OY9 A;  1C0M A;  4NYN A;  4CEC A;  3AV9 A;  3QER A;  3A2F A;  1TGO A;  4OPJ A;  3EYZ A;  2XY5 A;  4CGH A;  1JLF A;  3MEE A;  4C8L A;  4KI4 A;  1RDD A;  2XY7 A;  2YKM A;  3M8R A;  4E0D A;  2KW4 A;  4GMJ B;  2ITG A;  4CEE A;  4NYF A;  4Y1D A;  2P1J A;  4CHZ A;  4Q5V A;  4LSL A;  3AVL A;  5KI6 A;  1S1X A;  1RDC A;  4FLV A;  1I39 A;  1RCH A;  3HPG A;  2BAN A;  2DFE A;  3LWL A;  1T8E A;  3AVI A;  4DG1 A;  4DTU A;  1TKZ A;  4BDZ A;  4F8R A;  1HJR A;  1Y97 A;  1XI1 A;  5FRN A;  3AVA A;  4RW6 A;  1SKW A;  1WSI A;  3P1G A;  2E6M A;  4O0J A;  3U3Y A;  4DU1 A;  1S1U A;  1RT4 A;  2BGG A;  2G8I A;  4CJF A;  4PQU A;  3P5J A;  4E19 A;  2IS3 A;  2LSN A;  4O44 A;  4CJS A;  2RKI A;  4CJ5 A;  4M45 A;  4KHY A;  4BDY A;  3LPU A;  3G0Z A;  4I9Q A;  1S9G A;  3TAN A;  3SNN A;  2B5J A;  4B9V A;  5FRO A;  4J2A A;  3AVH A;  4RG8 A;  4N47 A;  3PX4 A;  4M3R A;  1U49 A;  4CJP A;  4FZX C;  4JS4 A;  4FM2 A;  4DQS A;  1LAW A;  3TAG A;  2B6A A;  5CY4 A;  5HRP A;  5HP1 A;  4CJ3 A;  1NJY A;  1C0U A;  3TAQ A;  3DOL A;  2XHB A;  4CJR A;  1ASU A;  4E7J A;  1VK0 A;  4AHV A;  4FYD A;  3CM6 A;  4IBN A;  2PYJ A;  4QAG A;  3CQ8 A;  3VA0 A;  1S6P A;  3SUP A;  3E01 A;  1TAQ A;  2Y1J A;  2IOC A;  3HST B;  4ZTF A;  3QNN A;  1REV A;  4KTZ A;  3QIP A;  4DTO A;  1LW0 A;  3NH1 A;  2RF2 A;  3T19 A;  5CYM A;  3UIQ A;  5HBM A;  1S5J A;  2KZM A;  2YV0 X;  3OJU A;  1LWC A;  3AVB A;  1BL3 A;  1U45 A;  4BAC A;  3AVC A;  3NFA A;  1JLA A;  3DRP A;  3TAE A;  1NK5 A;  4LY7 A;  1C0T A;  3JSM A;  4CHP A;  1KRP A;  1NOZ A;  3C6U A;  1ITG A;  1L3S A;  1NJW A;  3I0R A;  4OKJ A;  4CHN A;  1Z26 A;  1JLB A;  2DY4 A;  3RRG A;  3AVF A;  3AA3 A;  3O4N A;  1S1V A;  4B9U A;  3HL8 A;  4B08 A;  4LD0 A;  3L8B A;  4BE0 A;  4JRP A;  2EX3 A;  3WNG A;  4CER A;  3ZT4 A;  4CGJ A;  1IKY A;  1HQU A;  5EU7 A;  5HRN A;  3O3F A;  2FC0 A;  4DTN A;  4OLA A;  4CEB A;  5FDL A;  2X78 A;  2O4I A;  2HVI A;  1KCF A;  1IKV A;  1RT3 A;  3V4I A;  1QSY A;  4W5R A;  3TAF A;  4EP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...