4LY7A

Ancestral rnase h
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
153
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYKQHEKTFSAGFHLTTNNRMELMAAIVALESLKQPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAAIQRHTINWKWVKGHAGHPENERCDELARTAAESPTLEDVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Thermodynamic system drift in protein evolution.
pubmed doi rcsb
source organism Unidentified
molecule tags Hydrolase
total genus 50
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ly7A00
1IKYA 4HCCA 5KRSA 5CZ2A 1J5OA 3CYMA 1BCOA 4OPKA 1Z26A 4FM1A 3PO4A 1VSDA 4ELTA 3C95A 2F8TA 4CK1A 2GBZA 4RG8A 3DLBA 3ISNC 2FBXA 4DTXA 4M3UA 1DTTA 3LZIA 1HYSA 2PZSA 4M3RA 2YHAA 2G8VA 1I39A 1RTIA 1WSFA 1TK0A 1NKBA 4C8OA 3RTVA 1ASVA 1WLJA 3C94A 1QHTA 4OKEA 4CHOA 4FJJA 3C6UA 4LH5A 2HHXA 4PUOA 4DMNA 3OYLA 5C24A 2XY7A 1SL0A 2G8KA 4I9QA 1VSJA 4KTZA 3L2WA 4F8RA 4J2EA 4NCAA 1ITGA 2W42A 2O4IA 3LP3A 3V6DA 4O44A 5HRPA 1L3SA 1VSLA 3MECA 4CGJA 5J2MA 4YNQA 3OYCA 2FBVA 3M8SA 1KRPA 3FFIA 4AHVA 1BQMA 2WOMA 1A5XA 1HRHA 4I9LA 5HBMA 4HTUA 1RDBA 1WSJA 2VG5A 5CZ1A 1JLFA 3LPTA 4C8NA 4KB1A 4N41A 4CJWA 3WNGA 3PX6A 1TGOA 2EX3A 4B9MA 4GW6A 3VQAA 4DSJA 3HSTB 4E89A 1J9AA 4CJQA 4IFVA 3V1OA 3L3UA 4IFYA 3CFPA 4CJTA 1QS4A 3U3YA 3BGRA 1NK5A 4M3ZA 2HHWA 4CESA 3NGIA 4Z4EA 3I8DA 1QSLA 4CJ3A 3VN5A 4I7FA 4DTPA 4NYFA 3QNOA 1TAQA 4KTWA 4LSNA 3TAMA 3VQBA 3L2VA 1Q9XA 2HVHA 2O4GA 1JL2A 2OPQA 1S6PA 3NF6A 1BIUA 3K58A 2FBYA 5DK5A 4FJ8A 4O5BA 1FKPA 1W9HA 4DSFA 1VSHA 3VQCA 4Z4HA 1HQEA 3DRSA 4JS4A 4ELVA 1BI4A 3AVGA 3WNFA 3EY1A 1NOYA 1HMVA 4AHCA 3G0ZA 4H4OA 3SPZA 4CCHA 1C0MA 1X1PA 4DLGA 4HUGA 1JLEA 4I2PA 3HPGA 2ZD1A 4E7HA 3SQ2A 2RN2A 2X6NA 3AVFA 3CFOA 5KRTA 2F8SA 4KB0A 1VRTA 3ASMA 1DLOA 4AH9A 4E1NA 2VWJA 2G8IA 4BE0A 3QEVA 1C1AA 4KV8A 1Q9YA 1ZBHA 2D5RA 4FLWA 4DTMA 2XO7A 1ZBIA 1XHXA 2KQ2A 1T05A 3AA2A 3KD5E 3OYKA 1F21A 4CGHA 1W0HA 3UIQA 4RW7A 1U4BA 1BIZA 3PY8A 1S9GA 3M8RA 3KLEA 3P83D 3E01A 3MEDA 4N56A 2E6LA 1UA0A 4CEEA 1L3TA 1Q8IA 1YVUA 1LAVA 3KKSA 2A1SA 3DLGA 2DY4A 1TVRA 3V9UA 2HHVA 1ASUA 4AHSA 1NJXA 1EP4A 3ULDA 3RMDA 4C8KA 2BE2A 3DOLA 3KIOA 2Z1HA 3DLRA 4CJPA 3TANA 4PQUA 4JRQA 1UWBA 3RR8A 2HNDA 3RMCA 4E3SA 1BL3A 4CEZA 3DLEA 3SCXA 3S9HA 3THVA 3RR7A 3ZSQA 3QESA 3TAFA 1WAJA 3L2UA 3LP0A 1XI1A 5KGXA 1CXQA 1L3UA 5FRMA 1KFDA 3SQ1A 1R0AA 5D3GA 2HNYA 4CHYA 1U45A 5I3UA 3QEWA 3V9SA 3QERA 3OY9A 4LY7A 3OS0A 4JS5A 2YV0X 2DTUA 1LV5A 1O1WA 2Z1JA 1JLAA 2HHTA 3T19A 5K14A 2YNHA 1U47A 2DFEA 3KTQA 4FJHA 4DFPA 2ETJA 4Z4IA 4B9NA 4O0IA 4FLXA 2XY6A 1CXUA 3TR8A 4AHUA 1RNHA 4K8ZA 4CJEA 4LSLA 1SKWA 2D0AA 2FBTA 4B9UA 1SL1A 1NOZA 2P5GA 1D9DA 1ASWA 4FLYA 4J2DA 5SZTA 4KPYA 3OYMA 1D5AA 3DOKA 4N47A 4CEFA 3NAEA 4KAZA 1IKVA 3S3NA 3SZ2A 4F2RA 3HYFA 3NH2A 1A5VA 1L5UA 1RT2A 3KK3A 4O4GA 1N5YA 2RKIA 3KKRA 3ZT0A 3AO5A 3OYBA 2IS3A 3T1AA 4KHQA 3CG7A 4QAGA 4DWIA 4NCBA 1SUQA 4QOZB 3T3FA 3HVTA 3V81A 4CF9A 1BISA 1JKHA 4KI4A 3VQ4A 3K5MA 1C0TA 1VSKA 4DTNA 4Z4GA 4KHUA 1U04A 3HK2A 4CIFA 4KHSA 4CFCA 4FK4A 1JLGA 3QLHA 4KHYA 2ZE2A 3MAQA 4KHNA 3AV9A 4DSIA 3AVAA 4FW1A 3OYEA 4E7JA 4M41A 3SV4A 3NDKA 1KLNA 4PY5A 2KFZA 3PUFA 2HB5A 1Y97A 3O3GA 3OS1A 1RILA 2LSNA 3QETA 4IKFA 4ZTFA 4OKKA 1X9MA 1DTQA 4N5SA 4HCBA 5I42A 4W5QA 1FXXA 5J1EA 3SJJA 1VSMA 3TARA 4CEQA 4FK0A 3NF8A 2ATQA 2VG7A 4IDKA 3DMJA 3L2QA 3NF7A 4JLHA 1RT4A 3DRPA 4DQRA 4BDZA 3TWHA 1T8EA 4C8MA 3AVNA 3VQDA 4CIGA 1EKEA 3K57A 2KZZA 4M42A 1NK7A 1IG9A 2A1RA 4CJUA 2Q3SA 3SUOA 3MXMA 1C0UA 3AVMA 3TAEA 1I3AA 4MQ3A 4BWJA 1SKRA 2OZSA 1RBRA 3QO9A 3V1RA 4OJRA 4CECA 3V9XA 4DSEA 1U49A 3HP9A 1HQUA 4B9TA 3I0SA 4JRPA 4E0DA 5SWMA 2D0BA 3AVBA 1KVAA 1YTAA 3S3MA 4FYDA 5C25A 1QTMA 1VK0A 2PYLA 3WNEA 3NE6A 1NK0A 1GOCA 2P5OA 3OYHA 4DF8A 4DFJA 1UOCA 2RPIA 5HRNA 4G1QA 3D0PA 3RMBA 3VQ9A 4HVJA 1RTDA 4FJ7A 4YFUA 3V9WA 4FM2A 1XHZA 4HHTA 4DSLA 4ICLA 1RT5A 1VSEA 4DS5A 1JLCA 2Y1JA 1TAUA 4DS4A 4FJLA 2QKKA 4ELUA 3AA3A 3DM2A 3OVNA 3G10A 4BE2A 1RDAA 3HPOA 1CZ9A 1TKDA 4RW4A 5J2PA 3VQPA 3HJFA 2VWKA 4PWDA 3K2PA 4W5RA 1EETA 3LWLA 4F3OA 3QIOA 5HRRA 4E7KA 3AA4A 3F9KA 1A5WA 4KO0A 1KTQA 3SUNA 1LAWA 4FJ9A 3V1QA 3VQ8A 3K5OA 4CEDA 1KVBA 4ZTJA 1XC9A 3WNHA 1SKSA 3HO1A 3AVHA 3SQ4A 1QE1A 3ALYA 3KK1A 3TABA 1NKCA 2G8UA 3SV3A 2XHBA 1S1UA 1BI4B 3ZSRA 4CEBA 1K6YA 1WSHA 1KSPA 4J2AA 2XRIA 3AO3A 3ZT2A 5CY4A 5J2QA 4NCGA 2Z1IA 3NGYA 3QEPA 4OLAA 3AO1A 2YHBA 3ZCMA 5KTQA 4Y1CA 4OLBA 4KHWA 2G8HA 4CHZA 3O4NA 4IG0A 4CFAA 4FLTA 1ZBLA 3EYZA 3B6PA 1RDCA 3HT3A 1HYVA 4DU3A 3OJSA 3K5LA 4LH4A 3ZT4A 1JXEA 3QIPA 4DTJA 4CJFA 1KLMA 4IG3A 1TV6A 4EZ6A 4OGEA 2AJQA 1TL3A 3HXMA 4R5PA 2I5JA 2OA8A 1GOBA 3SQ0A 3IG1A 3LAKA 2RF2A 1S9EA 3JSMA 4E7LA 1WAFA 3MXIA 4CK3A 4LD0A 1RBVA 5KGWA 1IH7A 2DFHA 4AHTA 4KRFA 3DYAA 1BQNA 1REVA 1T03A 4E7IA 3P1GA 3PX4A 5JS1A 1WNSA 3CM5A 1QQCA 4Q0BA 4B08A 4EP5A 1IKXA 4ID5A 4CEOA 3P5JA 5J2NA 3SNNA 2HMIA 4FJGA 1EXQA 1X9SA 1VRUA 1YT3A 3ITHA 4M3WA 2HHUA 4CHQA 2JGUA 4Y1DA 3NH0A 4FZXC 4BWMA 2YKMA 1RT1A 1JL1A 1LW0A 1S1TA 4GVMA 4TSXA 4CJ5A 4HUFA 3KLFA 3S3OA 1NJZA 1FK9A 1QSSA 2B6AA 1WSIA 4EZ9A 3ZSWA 1NK6A 1SV5A 2G8FA 1YTUA 3RMAA 3L8BA 1NK9A 4PA1A 1C6VA 1MU2A 4B9VA 4W5NA 3QEXA 4EP4A 3NCIA 1RT7A 4CF1A 3LDSA 1UAXA 2IC3A 4FW2A 3NH1A 1ZBUA 2YNIA 3O3HA 1TKXA 3OYFA 3TI0A 1TK5A 5CYQA 4Z0UA 3MEEA 4F2SA 2BGGA 1KVCA 3I0RA 4OGCA 4DTRA 4B9LA 4IBNA 2OPPA 4DTUA 2BDPA 3CM6A 2HNZA 4FJMA 1NJWA 4CFDA 4FLVA 4CFBA 4BE1A 2X6SA 4FJNA 3HL8A 4CE9A 3TAQA 2XY5A 5EU7A 3SYZA 4H4MA 3OYIA 3HVRA 1B9FA 1VSIA 3VQEA 3ZSVA 4M3YA 4M45A 3AA5X 1NJYA 2EHGA 3AVLA 3HM9A 3M8PA 2X74A 4CHNA 3KK2A 1QSYA 3L2RA 4DU1A 4FJ5A 4CGDA 4HUEA 3AVCA 2Z1GA 1U48A 1IKWA 5FDLA 3K59A 5JS2A 1J53A 4CGGA 3LPUA 1EX4A 5DMRA 3OYJA 4FK2A 3AO2A 2IGIA 4CJ4A 1TKTA 3V9ZA 2YKNA 4FJIA 4FZZA 2OPRA 4CJRA 4DFMA 3PO5A 3OS2A 5E41A 4GMJB 1WN7A 1S1XA 4M3XA 2R7YA 4CF0A 4DU4A 4DF4A 4M3TA 1L3VA 4C8LA 2YNGA 1KCFA 2DFFA 4BACA 3KLHA 3TAGA 2G8WA 3VQQA 3SPYA 4DQPA 4DG1A 5HROA 4O55A 1D8YA 1JLBA 1G15A 1HJRA 2GUIA 2KW4A 1HPZA 3HPHA 3KLIA 5KI6A 3F73A 3LZJA 4DFKA 1TK8A 3DLHA 4FZYA 2NUBA 1Z25A 4CHPA 1JLQA 4NYNA 3OYDA 2XY8A 4W5TA 1IO2A 4DSKA 3ZT3A 3KLGA 4ZHRA 3RRGA 3LP2A 3C6TA 2FC0A 1N6QA 3NFAA 4MFBA 1D9FA 3VQ7A 1BCMA 4CERA 4N76A 4AILC 3NGZA 5HRSA 3NF9A 1XWLA 1NK4A 4FVMA 4ID1A 2QXFA 4O0JA 4FLUA 3VQ6A 4B3OA 2D0CA 1KFSA 1RT3A 4BDYA 3MXJA 2B5JA 2GV9A 4WE1A 3ZT1A 3PV8A 4KI6A 1BGXT 2YNFA 3IRXA 2E4LA 1C1BA 1VSFA 3RRHA 3VQ5A 3RWUA 1RBUA 3ZSXA 3PX0A 3K5NA 3CQ8A 1TL1A 4L8RB 2P1JA 1S1WA 1GOAA 3CFRA 3MEGA 1JXBA 1RBSA 3V4IA 3NHGA 3ZSZA 4J2BA 4FCYA 5C42A 1CZBA 4CF2A 1C1CA 4B8CA 3L3VA 4FM0A 3VA0A 2OYQA 4FJXA 1WSGA 2OPSA 5FROA 3QNNA 3D45A 3DLKA 2KFNA 4CJKA 4F4KA 4FJKA 3SI6A 1RCHA 1RDDA 4OVLA 3IS9A 4RW6A 4FXDA 1S6QA 2PY5A 1RTHA 1WSEA 1NK8A 2Y1IA 3KD1E 1FKOA 5T7BA 2QKBA 3OJUA 3LANA 4CGIA 4KREA 4UQGA 3SUQA 2X78A 1LWCA 3AVJA 3NBPA 4RW9A 4AHRA 3OYGA 5FRNA 2HHSA 4K8XA 4E1MA 5CYMA 1TKZA 4CIEA 1LW2A 4F3TA 4CEAA 3AO4A 4CF8A 3LWMA 1NKEA 1T7PA 3LALA 3VA3A 1RT6A 1LWFA 3QINA 4I2QA 4CGFA 2BANA 3JYTA 3B6OA 2WONA 2ZQBA 2P51A 4DTSA 3KJVA 4CJVA 4DLEA 3QEIA 2PYJA 4OPJA 4BDPA 4W5OA 3OYNA 1RTJA 4OKJA 3EZ5A 4KTQA 5HP1A 1RBTA 3DRRA 1J54A 4DQSA 3HP6A 2QK9A 3U6FA 2HW3A 1B9DA 3A2FA 1LWEA 1HNVA 4CJLA 3SUPA 4FLZA 3BDPA 3IAYA 2KTQA 1ZBFA 3DI6A 5HLFA 2HHQA 4H8KA 2IDOA 4QCLA 4B9SA 2JLEA 3U3GA 4CJSA 2F96A 3O3FA 4CK2A 1UA1A 1S5JA 4KFBA 1HYZA 4KKOA 2KZMA 1X9WA 1B92A 4Z4FA 1BHLA 3ZSOA 2E6MA 2IAJA 1HNIA 4DQIA 3ZSYA 4E19A 3LP1A 1SL2A 2B4JA 1CLQA 3M8QA 3AVIA 4Q5VA 4XIUA 3O4QA 2ITGA 3AVKA 3LAMA 2IOCA 2OZMA 2HVIA 4B8AB 4RW8A 4Z4CA 3H08A 3OYAA 3TAPA 4DQQA 1ZYQA 4DTOA 2VG6A 1S1VA
chains in the Genus database with same CATH superfamily
3THWA 4NXNK 1BWFO 3PO4A 4RG8A 3DLBA 1NGBA 4DTXA 1DTTA 1HYSA 2PZSA 1YVNA 4CZLA 4FJJA 4CHOA 4LH5A 1SL0A 3OYLA 1WBDA 4I9QA 4FSVA 1ITGA 4ISFA 4OPHA 1I94K 4NB4A 4O44A 3T69A 1VSLA 4CGJA 5J2MA 3OYCA 3M8SA 3UB5A 1KRPA 3FFIA 4AHVA 3LM9A 5HBMA 1RDBA 3THWB 2GELA 5M1FA 3VQAA 3HSTB 4E89A 2AP1A 1J9AA 3UKRA 4IFVA 3V1OA 4IFYA 3CFPA 1XNQK 3U3YA 3FGUA 4CESA 2F4VK 3I8DA 1QSLA 3QNOA 4LSNA 2ZWHA 2O4GA 1BIUA 4C1NI 1FKPA 4DSFA 1HLUA 3VQCA 4Z4HA 1HQEA 3DRSA 3VOVA 4FWKA 4JS4A 1T6CA 1XUPO 5AQHA 3G0ZA 5C2FA 4BRAA 2F8SA 2H3GX 3ASMA 3JAMO 1T44A 2VWJA 3VERA 1NMNA 1C1AA 4KV8A 3UKRB 4DR1K 4FLWA 4DTMA 4WCEL 4FWNA 3FFKB 1ZBIA 1XHXA 2JWKA 1T05A 1F21A 3PY8A 4BVOA 2HF4A 4DUZK 3P83D 3MEDA 1L3TA 2E6LA 4CEEA 3KKSA 2A1SA 2DY4A 1TVRA 3M1FA 3DJCA 1EP4A 3CMEN 3JXUA 4C8KA 3KIOA 3D7EO 4FPBA 4CJPA 4YOYA 4JRQA 1UWBA 3RR8A 4FWRA 1K8KA 1BL3A 5BRFA 3RR7A 2GWJA 2Q97A 2QI2A 3VEWA 3TAFA 1XI1A 3ULEA 1L3UA 4A5AA 1R0AA 4BC3A 5AQTA 3QEWA 3V9SA 1VQ5N 3ATUA 5BRDA 5EOYA 2UU9K 2DFEA 4FJHA 2ETJA 4Z4IA 2XY6A 1CXUA 1RNHA 2D0AA 2FBTA 2P5GA 1D9DA 4JI8K 3OYMA 1YHQN 1IKVA 3O9QA 4CZIA 2EWSA 5AQPA 4K25A 4F2RA 1K8KB 1L5UA 1RT2A 3KK3A 3ZT0A 3AO5A 3ULEB 5M1OA 4NCBA 1SUQA 1QVGM 4DTNA 2YHXA 1U04A 4FK4A 1JLGA 5A2QO 3TSPA 5AQZA 1FW6A 4KHNA 2QWPA 5EXWA 1NNEA 3OYEA 4E7JA 4PY5A 1KLNA 1HKGA 3PUFA 1RILA 2LSNA 4OPAA 5M1KA 2O8EA 4WFNL 1FXXA 1HKCA 4CEQA 1OVQA 3SLCA 3L2QA 3SMPA 3CIPA 1RT4A 4XH5A 4BDZA 4PL8A 2ZGYA 1T8EA 4BRMA 4CIGA 2D1KA 1NK7A 1IG9A 1N32K 4DV1K 3ID8A 2E8AA 3MXMA 1SKRA 4MQ3A 3F2KA 3FZMA 1HQUA 3S3MA 1T3VA 4H5RA 1QTMA 4CD3A 1NK0A 1YJWN 1GOCA 2P5OA 3OYHA 4DF8A 4DFJA 2HOEA 2O8EB 3C0BA 1HR0K 5HRNA 4FJ7A 4PL7A 4YFUA 3V9WA 3OA9A 4FM2A 5JMVA 4DSLA 1RT5A 3B8AX 1JLCA 2NRVA 4RW4A 2VWKA 4PWDA 1RGIA 2W40A 1EETA 4WQ5C 4F3OA 2IVNA 3CI5A 2YX6A 1GLBG 4U67L 1KTQA 1LCUA 3MK6A 3HTVA 4FJ9A 3VQ8A 1SKSA 4B1UB 1GLAG 3HRGA 3KK1A 1VQ4N 3VF6A 3SV3A 4FO0A 1BI4B 4CEBA 1KSPA 4J2AA 2XRIA 2A5XA 5CY4A 5J2QA 3NMUA 2YHBA 2KHOA 3ZCMA 5KTQA 4Y1CA 4JKHA 5KPRA 2QWNA 4IG0A 3JS6A 4CFAA 4IEIA 4YORA 3HT3A 3K5LA 4LH4A 4YY3K 1KLMA 1NWKA 4R5PA 3DLLL 1S9EA 3JSMA 4E7LA 4BREA 2UXDK 3MN5A 4AHTA 4KRFA 4JKCA 3DYAA 4LF9K 3SMSA 4Q0BA 4BRNA 4C1NK 2O8FA 4BVPA 4X62K 3KHYA 1Q7YO 1WUAA 1YT3A 4CHQA 2A6AA 3E9LA 4DV7K 4Y1DA 1N34K 4O8UA 1JCFA 1RT1A 1NJZA 3C7NA 1FK9A 3QB0A 3S41A 4A59A 4EZ9A 1XMQK 3L8BA 3QEXA 4YDUC 3ENOA 3NCIA 1RT7A 4CF1A 3LDSA 3CD6N 2IC3A 2YNIA 3P4IA 1TKXA 3WUHA 3OYFA 2BGGA 4DTRA 4B9LA 3BF3A 3MWPA 4O8KA 2HBLA 5KQ8A 1NJWA 2QXLA 3KK7A 4BROA 4MLHA 1QVFM 2X6SA 4FJNA 3HL8A 4WQ5A 3TAQA 4NLCA 5EU7A 2XY5A 3SYZA 5LJWA 1B9FA 3HVRA 3VQEA 1ILYA 4M45A 5LMNK 3H1VX 2EHGA 3AVLA 4JAXA 5LMUK 2W6LA 3C7NB 4KHUA 2Z1GA 3P38A 5BPMA 3HI0A 2FLOA 3VMFB 4FK2A 3LPUA 5DMRA 4BQLA 5FPMA 3V9ZA 4FJIA 2OPRA 3CCJN 4DFMA 3PO5A 4GMJB 1WN7A 4DF4A 5C0YA 4M3TA 2YNGA 3TAGA 5AR0A 4DG1A 2GTDA 1D8YA 2KLAA 2IIRA 2GUIA 4AF1A 1OH5A 4B3RK 4FZYA 4X65K 3ZT3A 3KLGA 3BUZB 3WXJA 1NGEA 1WOQA 5HRSA 3MCAB 4O0JA 4FLUA 3VQ6A 2E1ZA 2D0CA 1KFSA 3ZT1A 4WE1A 4DQ8A 4KI6A 3WXMB 4IOAL 4DV3K 3PX0A 3CQ8A 1OH6A 2P1JA 4BC2A 5BN9A 3MEGA 1JXBA 2QW9A 3V4IA 4J2BA 3FLCO 4YDUA 4LFCK 2QWMA 1BG3A 3L0QA 2NRXA 2OPSA 3QNNA 5AQRA 2KFNA 2OANA 5KPZA 3IS9A 4RW6A 2PY5A 3KD1E 4B1YB 5T7BA 2ASMA 5AQIA 4UQGA 2O8CB 2X78A 3OYGA 1O13A 4CZFA 5IT9O 4ILHA 4BRHA 4FWOA 2P9UA 3VA3A 1RT6A 1HNWK 2UYTA 3FZLA 4I2QA 4CGFA 4FOIA 3JYTA 3PSFA 5AQUA 1XNRK 2WONA 3QICA 5IWAK 4CJVA 3QEIA 4OPJA 4BDPA 3M3ZA 4M7YA 3DRRA 1KAYA 1S22A 3HP6A 3U6FA 2ZF5O 1LWEA 3E1YA 3SUPA 5BPNA 3BDPA 2HHQA 1IV0A 4B9SA 3U3GA 3O3FA 2KZMA 1X9WA 5C12A 1B92A 3A5NC 2E6MA 1HNIA 3PLAA 3IUCA 2B4JA 2P9UB 3AGKA 2GUPA 4PKGA 2ZJRL 4B8AB 3H08A 3TAPA 4DQQA 4HCCA 2UXCK 3AARA 3CYMA 2VWBA 3C95A 2F8TA 4CK1A 3W0LA 3CPEA 2FBXA 4M3RA 2G8VA 1I39A 1RTIA 1NKBA 2HSTA 1ASVA 1QHTA 4OKEA 2VYPA 4DCHA 2HHXA 1IBMK 5C24A 2G8KA 2NLXA 3L2WA 4NCAA 2W42A 3V6DA 3EO3A 2FF6A 3PSIA 5HRPA 2FBVA 4DR6K 1BQMA 2WOMA 1S72N 1DKGD 4MDBA 4HTUA 1YITN 4KB1A 4CJWA 3WNGA 1TGOA 2EX3A 4DSJA 1TYQA 1BOTO 4K41A 3FE1A 1QS4A 3VENA 1NK5A 3IMXA 3NGIA 1T6DA 4NYFA 1Q9XA 2HVHA 3E9OA 3T7ZA 4A61A 1JL2A 2OPQA 4O5BA 1VSHA 1RDWX 2NZTA 2JWLA 3H3OB 3AVGA 4CZEA 5LJVA 5AQQA 3SBGA 3SPZA 4CCHA 1C0MA 4HUGA 1XC3A 2ZD1A 3R6MA 3CJCA 3AVFA 2OTLN 1VRTA 1DLOA 3ZX2A 4BE0A 3CCVN 2XO7A 2ITMA 2KQ2A 3AA2A 3GG4A 4KH4A 4CZMA 4H5TA 4RW7A 3O9TA 3VPZA 1U4BA 3KLEA 1HX1A 3E01A 3CCRN 1Q8IA 1YVUA 1E4FT 3V9UA 1NJXA 4CD1A 3RMDA 4KH6A 4YOTA 5AQFA 1HPMA 2V7ZA 2PFUA 4PQUA 3O4WA 5TKWA 2HNDA 3DLEA 3QESA 1WAJA 4JV5K 5FRMA 1KFDA 1X9JA 3QERA 4BC5A 4LY7A 1KAZA 1LV5A 2Q1NA 3LDPA 1O1WA 4BR2A 1JLAA 3T19A 2YNHA 1U47A 3KTQA 2CH5A 4B1WB 5JLFA 4DR5K 3O80A 5AJ3K 4LF7K 2HBMA 2WC9A 1U2VA 1SKWA 4LSLA 1YAGA 1SL1A 1W97L 3G6EN 1ASWA 4DV6K 3G25A 4AQYK 4J2DA 2O8DB 1D5AA 3NAEA 5JICA 3S3NA 3CC4N 2P9IA 3HYFA 3KKRA 3T1AA 3CG7A 4DHYA 1VQ6N 3R9PA 4DWIA 3HVTA 4Z4GA 1VSKA 1Z6RA 2HBJA 3TSUA 1K73O 1BO5O 4KHSA 2P9PB 3TPQA 5MLCQ 5AQKA 3EE9A 3AV9A 2E2QA 3OW2M 4FW1A 4M41A 3SV4A 2KFZA 1Y97A 4BC4A 3OS1A 2YHWA 3QETA 4IKFA 4OKKA 2P9IB 5J1EA 3SJJA 4K0KK 4JK8A 3ZETA 4BRGA 5BPLA 3DMJA 3NF7A 4DQRA 4JI2K 5BREA 4C8MA 2KZZA 4BRQA 1V4SA 4M42A 1NGDA 3SUOA 3AVMA 3TAEA 1I3AA 4BWJA 2OZSA 4OJRA 4A2AA 3V9XA 4BGBA 4E0DA 3HP9A 2QWOA 1MWMA 3ZLJA 3AVBA 1KVAA 1ATNA 1VK0A 3WNEA 4J8FA 1UOCA 3O1BA 4G1QA 3D0PA 5I9EB 2VQFK 3ZETB 1XHZA 4XH4A 5CR4A 5HOOA 3MN6A 1VSEA 5AZIA 4DS5A 4JYAK 4ELUA 4B3SK 3AA3A 3DM2A 1TKDA 1VQNN 3HPOA 3VTHA 3HBTA 1D4XA 3VF2A 1SQKA 4W5RA 3DXMA 3R1XA 5HRRA 3AY9A 3EKSA 3O08A 1A5WA 1LAWA 4JHDA 3V1QA 1XC9A 2FF3B 3AVHA 3SQ4A 3TABA 1NKCA 2XHBA 1WSHA 4BR9A 1NGJA 2NRTA 4IOCL 4DR3K 4JKDA 1FJGK 5AZIB 1NGAA 2FSNA 4M63C 4FLTA 1DEJA 3B6PA 2QEXN 5ADXH 1HYVA 2F9TA 4XEIA 5GINA 3OJSA 1NGIA 1JXEA 4CJFA 4YOVA 3DXMB 1TV6A 2FSKA 4OGEA 1TL3A 1VHXA 3MWTA 3P39A 4YOWA 3IG1A 1ATRA 2RF2A 3MXIA 2E2OA 2YI1A 4JHDB 1MWKA 3WXKA 1EQYA 3ENHA 1REVA 3G4SN 3D2FA 4E7IA 3P1GA 2V52B 1WNSA 3CM5A 1QQCA 4GY2B 4B08A 5JLHA 4ID5A 3SNNA 3H46O 1EXQA 3CF5L 2HHUA 4FPAA 2YKMA 4TSXA 3RSEA 4BRDA 4CJ5A 4HUFA 4IJAA 1QSSA 2B6AA 1VQKN 2GX9A 3ZSWA 1SV5A 2G8FA 1MU2A 4AM7A 5M1QA 4EIAA 4EP4A 1UAXA 3NH1A 2HMIA 1ZBUA 3KVGA 3C65A 3TI0A 5CYQA 4DB3A 4OGCA 4JK7A 4IBNA 1GLJO 2BDPA 2HNZA 4FJMA 5AFUH 5FPNA 3D2FB 1OH7A 4BE1A 3QFUA 3J7YP 2RE2A 3OYIA 4JKEA 3THXA 3ZSVA 4M7XA 1NJYA 3RSEB 3M8PA 2X74A 3EKUA 4CHNA 3KK2A 3L2RA 3AVCA 1C0FA 5FDLA 5JS2A 1J53A 2I7NA 5EX5A 4CJ4A 4Y0WA 1W7AA 4ISEA 3T1HK 4M3XA 1QZ6A 4DU4A 4C8LA 3SPYA 4BRFA 4JK9A 5KI6A 1G15A 1HJRA 2KW4A 3KLIA 2OCEA 3LZJA 4CZKA 4DFKA 1Q18A 3DLHA 1JLQA 4NYNA 2YJFA 1W2BM 2WUSA 4ISGA 1E4GT 4ZHRA 2YCHA 3NVMA 4EFHA 3CJ9A 4MFBA 1NJIO 1D9FA 3BF1A 4N76A 2ZJPL 2Q0RA 1EWQA 3MXJA 2B5JA 2GV9A 1NLVA 2YNFA 1C1BA 5E26A 3RWUA 1RBUA 3G71N 3ZX0A 1YI2N 1GOAA 3CFRA 1RFQA 1RBSA 3NHGA 3ZSZA 4FCYA 5AQXA 5C42A 4FM0A 3VA0A 1WSGA 5AQWA 5F2RA 3D45A 4CJKA 3N4PA 4F4KA 3SI6A 4GV9A 1RDDA 3C6HA 1S6QA 5C2DA 2Y1IA 3OJUA 3LANA 4CGIA 3TTCA 1LWCA 3NBPA 4RW9A 4AHRA 2HHSA 4K8XA 4E1MA 4GNIA 2ZJQL 4CIEA 1LW2A 4CEAA 3AO4A 3LWMA 1T7PA 3LALA 2WTUA 1H1VA 3CCQN 2ZQBA 3EE8A 4FWMA 4FWSA 4DLEA 2PYJA 4V19S 3OYNA 4OKJA 1K9MO 4WYBA 4DQSA 2HW3A 4CJLA 4FLZA 4IDHA 3I56N 3IAYA 4H8KA 4QS8A 4CK2A 1UA1A 3CCEN 4DR4K 5EY4A 3W3DA 4DQIA 4GKKK 5ELZA 4LF8K 3ZSYA 4JI3K 4XIUA 3AVKA 5M1PA 4DV5K 3VGMA 1Q81O 4RW8A 4Z4CA 4K42A 4DTOA 1IKYA 4IJNA 5KRSA 3E9PA 1BCOA 4FM1A 1VSDA 2O8FB 4ELTA 5AQNA 3ISNC 4M3UA 3L4IA 3LZIA 4JKAA 1VQLN 1TK0A 1ZXOA 3RTVA 3DWLA 2HF3A 3C94A 5LY3A 3AAQA 4PUOA 4DMNA 2XY7A 2W41A 4F8RA 4J2EA 1L3SA 3MECA 1KC8O 3J8AA 4R79A 3A8YA 2FSJA 1A5XA 4A57A 1HRHA 2D0PA 5H1SQ 5CZ1A 1Y64A 1JLFA 3LPTA 4C8NA 4N41A 3PX6A 4GW6A 4GVEA 4X66K 4CJTA 4BY9C 4M3ZA 2HHWA 4H03B 1TAQA 4KTWA 2E88A 3VQBA 4JI7K 3M5RA 4IO8A 3K58A 4FJ8A 1W9HA 1P8ZA 2P9SA 4ELVA 1NOYA 2NRWA 2PAVA 3LM2A 4AHCA 4CBUA 1X1PA 4B1VA 3MMVA 5AQMA 3SQ2A 2X6NA 3QMLA 4KB0A 3BY5A 3QEVA 2D5RA 5AQGA 5BRHA 4HWIA 2V51B 3EEQA 3KD5E 3D6RA 4CGHA 1W0HA 5BR8K 1XQSC 3AGRA 4GV3A 1GLDG 1S9GA 3M8RA 2WFBA 1UA0A 4A5BA 1LAVA 1YF5L 2HHVA 1ASUA 4AHSA 2P9SB 3EZWA 2P9LA 2BE2A 3O8MA 3PIPL 1WB9A 4QS9A 3U9ZA 1LOTB 3RMCA 4CEZA 3S9HA 3HM8A 2HBKA 2YHYA 3LP0A 1CXQA 4CHYA 1U45A 5I3UA 3THYA 4CBWA 4BG9A 4EHTA 2YV0X 2Z1JA 4JI1K 4B3MK 4DFPA 3CMAN 4FLXA 3TR8A 4AHUA 4K8ZA 3CHWA 4FLYA 4KPYA 5SZTA 3DOKA 4N47A 4CEFA 4RWTA 5DM7L 3J81O 3H1QA 3SJHA 3SZ2A 3NH2A 2NRHA 1N5YA 3OYBA 2IS3A 1V4TA 4QAGA 5HL7L 3HOTA 4QOZB 1JKHA 3THYB 3K5MA 3HK2A 4CFCA 1IJJA 3QLHA 3CC7N 3J7ZO 3CETA 1IG8A 3O9UA 3NDKA 3FZFA 1NBWA 3J80O 1X9MA 1DTQA 4HCBA 5I42A 1DT9A 4RTFD 1Q82O 2QA4N 2NRRA 4FK0A 3NF8A 2ATQA 5GAHP 2VG7A 1NG9A 4CI6A 3D2EA 4JLHA 3DRPA 4L3QA 4Z94A 3TWHA 3KZBA 3MN7A 3VQDA 3OBYA 4MDAA 3A5OC 5BR9A 2A1RA 2I7PA 2Q3SA 4IO9L 4DV2K 1C0UA 3QO9A 3V1RA 4DSEA 2P9KA 3I0SA 4BG8A 1ZBSA 3VEOA 1NM1A 1S3XA 2PYLA 3NE6A 3TU5A 4LFBK 4PKIA 1CZAN 4HVJA 1RTDA 3GL1A 4HHTA 3D2EB 4WF9L 3CQXA 1U6ZA 1TYQB 4H5VA 1TAUA 2YJEA 4BE2A 3G10A 1CZ9A 2UXBK 3CCSN 3CCLN 2P9KB 3F9KA 3SUNA 1NGHA 3K5OA 3CJBA 4CEDA 1XMOK 3HO1A 1S1UA 4JI5K 3H45C 3ZSRA 1K6YA 4PHTX 3CJ7A 3ZEUA 3H6EA 3PIOL 5DM6L 3ZT2A 3NGYA 4CZHA 3AO1A 4OLBA 4KHWA 2G8HA 3O4NA 3ID6A 4JKGA 1RDCA 4H0YB 1VQON 3ZT4A 4DTJA 3R3LA 4IG3A 4IOXA 2I5JA 2OA8A 3SQ0A 1WAFA 1RBVA 4LC9B 5KGWA 1IH7A 3BZCA 1BQNA 1T03A 3IFRA 3PX4A 5JS1A 2BTFA 4CEOA 2UUCK 5J2NA 1BDGA 3ZEUB 1X9SA 4M3WA 4HTLA 2JGUA 4CVNE 3NH0A 4FZXC 1JL1A 1S1TA 4GVMA 4BRCA 1GLEG 3KLFA 2Q36A 3NVKA 4JKGB 1NK6A 3RMAA 4A2BA 4PA1A 1C6VA 2DPNA 5AQSA 4FW2A 1TK5A 1IBLK 2VGMA 4F2SA 2O8BA 1KVCA 3CQYA 3ENBA 1VAZA 4DTUA 4KHPK 4CFDA 1U2VB 4CFBA 4CE9A 4M3YA 3AA5X 1C0GA 3FZHA 3HM9A 1VQPN 1QSYA 4FJ5A 4BRPA 1U48A 3K59A 4CGGA 1QQMA 4JKFA 3VTIA 3OYJA 1NGGA 4IEEA 2YKNA 4FZZA 3VGKA 1ATSA 5E41A 4MO5A 1S1XA 2R7YA 2O8BB 3WEEA 4KH5A 1NU0A 4BGAA 4BACA 2G8WA 4DUYK 3KLHA 3A5MC 4DQPA 4O55A 3F73A 2CH6A 1TK8A 2NUBA 1Z25A 4CHPA 1WBBA 2XY8A 2VGNA 2FC0A 3NFAA 1N8RO 1BCMA 4DV4K 5F1XA 3NF9A 1XWLA 1NK4A 4FVMA 4ID1A 4B3OA 5AQOA 4GV6A 1RT3A 3PV8A 3IRXA 2E4LA 1VSFA 3RRHA 3VQ5A 4BR4A 3K5NA 3WEEB 4K43A 2W6KA 3LDOA 1CZBA 4CF2A 2A42A 1C1CA 4B8CA 3L3VA 2QWLA 3R8EA 4FWQA 3L6QA 2Q2RA 1RCHA 4OVLA 5AZJA 1YUWA 4FXDA 4RCHA 1QQOA 1RTHA 1WSEA 2VCPA 1NK8A 4KREA 2HHHK 3LDNA 3SUQA 5EVZA 3U4LA 5CYMA 4WQ4C 4F3TA 4CF8A 3QINA 3BZKA 5B8HA 3B6OA 2P51A 4DTSA 3KJVA 4JEPA 1M1KO 4JD2A 4W5OA 1RTJA 3VEVA 4BRKA 5HP1A 1JJ2M 2CGLA 1B9DA 3A2FA 1HNVA 5AZJB 3O1WA 2VQEK 5HLFA 2IDOA 4BR0A 2JLEA 4CJSA 3MN9A 1S5JA 1HYZA 4KKOA 3ZSOA 2IAJA 1SL2A 1CLQA 3M8QA 3O4QA 3CPWM 2IOCA 2OZMA 2HVIA 3A5LC 3I55N 3OYAA 4LFAK 3CCUN 4JD2B 3ATVA 1NGFA 5CZ2A 1J5OA 4OPKA 1GLLO 1Z26A 1HJOA 2CGJA 2GBZA 1ZC6A 2YHAA 3CCMN 3K9KA 1WSFA 4C8OA 1WLJA 5GADP 3C6UA 1KD1O 5F0XA 3TTFA 1BA0A 1VSJA 4KTZA 3J7AP 3FZKA 2O4IA 3LP3A 2BUPA 4JI0K 1KAXA 3E66A 4B1ZA 4YNQA 1M90O 4JKBA 2E20A 4I9LA 4WQ4A 2VG5A 1WSJA 5KPTA 4EAHD 3THXB 4B9MA 1OKJA 2E1YA 4CJQA 1BUPA 3L3UA 4QS7A 4ILJA 3BGRA 4Z4EA 4DR7K 4CJ3A 3VN5A 4I7FA 4DTPA 3TAMA 3L2VA 1S6PA 3NF6A 2FBYA 5DK5A 4BRLA 4CJ7A 5CE3A 4JNEA 1BI4A 3WNFA 3EY1A 4MLEA 4EHUA 3SK3A 1HMVA 4H4OA 2A41A 3HOSA 2OTJN 4DLGA 4JI6K 4MO4A 1JLEA 2Q0UA 3HPGA 4I2PA 4E7HA 3F9MA 4CW7B 2RN2A 3CFOA 5KRTA 4E1NA 2G8IA 4AH9A 4BRIA 1Q9YA 1ZBHA 2F7TA 2QWRA 3CJ1A 3OYKA 3CC2N 3UIQA 1BIZA 2V7YA 4N56A 1HKBA 4XH1A 3CERA 2NNWA 3DLGA 3QFPA 4WFBL 3ULDA 3DOLA 2Z1HA 3DLRA 3TANA 1QQNA 5AQVA 4IXCA 4YHHK 4H0XB 5AQJA 4E3SA 3SCXA 4X64K 3THVA 3ZSQA 5GIPA 3GE1A 3L2UA 1YXQA 5KGXA 3U9DA 5GAEP 3SQ1A 4NLBA 5D3GA 2HNYA 4BR5A 3OY9A 3OS0A 4LF6K 4JS5A 2DTUA 3F5TA 2HHTA 5K14A 3DAWA 4JI4K 1SS6A 4B9NA 4O0IA 4CJEA 4B9UA 5JVHL 1NOZA 5CHIA 2CGKA 2D4WA 4KAZA 3ZYYX 1A5VA 4FWLA 4O4GA 2RKIA 1YIJN 4A62A 1DGKN 4KHQA 3SAHA 1EO1A 4FL9A 3T3FA 3V81A 4CF9A 1BISA 4BQZA 4KI4A 3VQ4A 1C0TA 4H5NA 4CIFA 4KHYA 4IZ9A 3SBTA 2ZE2A 3MAQA 3K9JA 2F9WA 1TUYA 4DSIA 3AVAA 2A40A 3WXLA 3IKMA 3CXCM 2HB5A 3RVCA 1K8AO 3O3GA 1NGCA 4ZTFA 3T1YK 4N5SA 4W5QA 1OVYA 3HSCA 1VSMA 3TARA 1YJ9N 5BN8A 4IDKA 1EWRA 2PBDA 4FVUA 3AVNA 1EKEA 3K57A 1VQ9N 1JCEA 3TTDA 4CJUA 3VF4A 3QBWA 3HZ6A 1HNZK 1RBRA 4CECA 2QM1A 1U49A 1Q86O 4B9TA 4BR7A 4JRPA 5SWMA 2D0BA 3H3NO 1YTAA 4FYDA 4E1JA 5C25A 3VGLA 5AQYA 1G99A 5C10A 4U7BA 2RHKA 5M1NA 3QDKA 2RPIA 1GLCG 3RMBA 3VQ9A 3QBXA 4ICLA 3O5BA 2O8CA 2Y1JA 4DS4A 5GAGP 1MA9B 3WQTA 3I8BA 2QKKA 4FJLA 3OVNA 1VQMN 1RDAA 5J2PA 1NMDA 3VQPA 3HJFA 3K2PA 4I6MA 3LWLA 3QIOA 2IVPA 4E7KA 1ESVA 3AA4A 3LDQA 4KO0A 1Z05A 3OHRA 3I33A 3OBWA 4ZTJA 1KVBA 3WNHA 3P31A 2E2PA 1QE1A 3ALYA 2G8UA 2E5LK 3UKUA 4ILGB 3C6AA 4H0OA 3AO3A 3L4QA 4NCGA 2Z1IA 3QEPA 4OLAA 4CHZA 3MX5A 1ZBLA 3EYZA 1E3MA 2IVOA 4DU3A 4JN4A 4OO1J 3KWIA 3LDLA 3QIPA 4I6MB 4OX9K 4IWVA 5LL6Z 4DKWA 4EZ6A 2AJQA 3HXMA 4CZGA 5GIOA 1GOBA 3LAKA 4CK3A 4LD0A 4H0PA 3GDQA 2DFHA 3U8XA 1MDUB 5TKYA 1BA1A 4GKJK 2P9LB 4EP5A 3UKUB 1IKXA 4H0TB 4FJGA 3P5JA 5E84A 1VRUA 3ITHA 2NRZA 3N4QA 4BWMA 3S3OA 1LW0A 3GOIA 3MCPA 3VEXA 4FOEA 5JVGL 1WSIA 1YTUA 1NK9A 1VQ8N 5KQDA 4B9VA 4W5NA 4NO7A 1YJNN 4CBXA 4WFAL 3O3HA 4LF4K 4Z0UA 3MEEA 3I0RA 2OPPA 2QTDA 3FR0A 3CM6A 4FLVA 1P90A 4O5FA 3KWGA 2ZM6K 4H4MA 5FPEA 1VSIA 4B9QA 4F9OA 3WXIA 2P9NA 2QWQA 3O6WA 4DU1A 3VETA 4CGDA 4HUEA 2UUBK 3BEXA 1IKWA 3GBTA 4YOXA 1EX4A 3WT0A 3AAPA 2IGIA 3AO2A 3O9SA 1TKTA 1X3NA 4CJRA 3Q7BA 4KBOA 3OS2A 3VESA 1N36K 4CF0A 1N33K 1L3VA 1KCFA 2DFFA 4DV0K 3VQQA 5HROA 1JLBA 3HPHA 1HPZA 2GWKA 3K0SA 1HUXA 1GLFO 3UE5A 4H5WA 3OYDA 3O9RA 4FWPA 1SZ2A 1IO2A 4W5TA 4DSKA 3EL2A 2P9NB 3RRGA 3LP2A 3C6TA 1N6QA 2FXUA 3VQ7A 2AA4A 4CERA 4AILC 3NGZA 5ADXA 1J5EK 2QXFA 3SAFA 4BDYA 2E2NA 1BGXT 2ZGZA 2HMPA 4AM6A 3VEYA 3ZSXA 1QHAA 1QZ5A 5FLXO 4L8RB 1TL1A 4CZJA 1TUUA 1S1WA 3EN9A 1IBKK 2WBNA 3DXKA 3A0IX 1BU6O 5AQLA 4PKHA 2OYQA 3MDQA 4FJXA 1X3MA 4B1XB 5FROA 2A3ZA 3DLKA 3ZX3A 4DR2K 4B3TK 4FJKA 3LL3A 2ASPA 1R59O 1FKOA 3TSQA 2QKBA 4UY8O 3AVJA 5FRNA 4H0VB 2GEMA 1JCGA 1TKZA 3BP8A 1VQ7N 1J6ZA 1NKEA 3SAGA 4IFEA 1LWFA 2BANA 1SAZA 4NXMK 3DXKB 4C23A 2O8DA 3MX2A 5AFUA 2J4RA 1OH8A 2UUAK 3EZ5A 4KTQA 1RBTA 1J54A 3VEZA 2QK9A 1KQSM 4LF5K 1ZBFA 3DI6A 3M6GA 2KTQA 3OTOK 4QCLA 2F96A 3Q7CA 4KFBA 2D0OA 2P9PA 4Z4FA 1BHLA 1KXPA 3IDHA 3WQUA 4E19A 5C15A 3LP1A 3AVIA 4G9ZA 4Q5VA 1RDUA 2ASOA 4YOUA 2ITGA 3LAMA 5FPDA 2BH1A 2Q31A 2KKZA 1ZYQA 3CJAA 2VG6A 1S1VA 1HNXK
chains in the Genus database with same CATH topology
1IKYA 4HCCA 5KRSA 5CZ2A 1J5OA 3CYMA 1BCOA 4OPKA 1Z26A 4FM1A 3PO4A 1VSDA 4ELTA 3C95A 2F8TA 4CK1A 2GBZA 4RG8A 3DLBA 3ISNC 2FBXA 4DTXA 4M3UA 1DTTA 3LZIA 1HYSA 2PZSA 4M3RA 2YHAA 2G8VA 1I39A 1RTIA 1WSFA 1TK0A 1NKBA 4C8OA 3RTVA 1ASVA 1WLJA 3C94A 1QHTA 4OKEA 4CHOA 4FJJA 3C6UA 4LH5A 2HHXA 4PUOA 4DMNA 3OYLA 5C24A 2XY7A 1SL0A 2G8KA 4I9QA 1VSJA 4KTZA 3L2WA 4F8RA 4J2EA 4NCAA 1ITGA 2W42A 2O4IA 3LP3A 3V6DA 4O44A 5HRPA 1L3SA 1VSLA 3MECA 4CGJA 5J2MA 4YNQA 3OYCA 2FBVA 3M8SA 1KRPA 3FFIA 4AHVA 1BQMA 2WOMA 1A5XA 1HRHA 4I9LA 5HBMA 4HTUA 1RDBA 1WSJA 2VG5A 5CZ1A 1JLFA 3LPTA 4C8NA 4KB1A 4N41A 4CJWA 3WNGA 3PX6A 1TGOA 2EX3A 4B9MA 4GW6A 3VQAA 4DSJA 3HSTB 4E89A 1J9AA 4CJQA 4IFVA 3V1OA 3L3UA 4IFYA 3CFPA 4CJTA 1QS4A 3U3YA 3BGRA 1NK5A 4M3ZA 2HHWA 4CESA 3NGIA 4Z4EA 3I8DA 1QSLA 4CJ3A 3VN5A 4I7FA 4DTPA 4NYFA 3QNOA 1TAQA 4KTWA 4LSNA 3TAMA 3VQBA 3L2VA 1Q9XA 2HVHA 2O4GA 1JL2A 2OPQA 1S6PA 3NF6A 1BIUA 3K58A 2FBYA 5DK5A 4FJ8A 4O5BA 1FKPA 1W9HA 4DSFA 1VSHA 3VQCA 4Z4HA 1HQEA 3DRSA 4JS4A 4ELVA 1BI4A 3AVGA 3WNFA 3EY1A 1NOYA 1HMVA 4AHCA 3G0ZA 4H4OA 3SPZA 4CCHA 1C0MA 1X1PA 4DLGA 4HUGA 1JLEA 4I2PA 3HPGA 2ZD1A 4E7HA 3SQ2A 2RN2A 2X6NA 3AVFA 3CFOA 5KRTA 2F8SA 4KB0A 1VRTA 3ASMA 1DLOA 4AH9A 4E1NA 2VWJA 2G8IA 4BE0A 3QEVA 1C1AA 4KV8A 1Q9YA 1ZBHA 2D5RA 4FLWA 4DTMA 2XO7A 1ZBIA 1XHXA 2KQ2A 1T05A 3AA2A 3KD5E 3OYKA 1F21A 4CGHA 1W0HA 3UIQA 4RW7A 1U4BA 1BIZA 3PY8A 1S9GA 3M8RA 3KLEA 3P83D 3E01A 3MEDA 4N56A 2E6LA 1UA0A 4CEEA 1L3TA 1Q8IA 1YVUA 1LAVA 3KKSA 2A1SA 3DLGA 2DY4A 1TVRA 3V9UA 2HHVA 1ASUA 4AHSA 1NJXA 1EP4A 3ULDA 3RMDA 4C8KA 2BE2A 3DOLA 3KIOA 2Z1HA 3DLRA 4CJPA 3TANA 4PQUA 4JRQA 1UWBA 3RR8A 2HNDA 3RMCA 4E3SA 1BL3A 4CEZA 3DLEA 3SCXA 3S9HA 3THVA 3RR7A 3ZSQA 3QESA 3TAFA 1WAJA 3L2UA 3LP0A 1XI1A 5KGXA 1CXQA 1L3UA 5FRMA 1KFDA 3SQ1A 1R0AA 5D3GA 2HNYA 4CHYA 1U45A 5I3UA 3QEWA 3V9SA 3QERA 3OY9A 4LY7A 3OS0A 4JS5A 2YV0X 2DTUA 1LV5A 1O1WA 2Z1JA 1JLAA 2HHTA 3T19A 5K14A 2YNHA 1U47A 2DFEA 3KTQA 4FJHA 4DFPA 2ETJA 4Z4IA 4B9NA 4O0IA 4FLXA 2XY6A 1CXUA 3TR8A 4AHUA 1RNHA 4K8ZA 4CJEA 4LSLA 1SKWA 2D0AA 2FBTA 4B9UA 1SL1A 1NOZA 2P5GA 1D9DA 1ASWA 4FLYA 4J2DA 5SZTA 4KPYA 3OYMA 1D5AA 3DOKA 4N47A 4CEFA 3NAEA 4KAZA 1IKVA 3S3NA 3SZ2A 4F2RA 3HYFA 3NH2A 1A5VA 1L5UA 1RT2A 3KK3A 4O4GA 1N5YA 2RKIA 3KKRA 3ZT0A 3AO5A 3OYBA 2IS3A 3T1AA 4KHQA 3CG7A 4QAGA 4DWIA 4NCBA 1SUQA 4QOZB 3T3FA 3HVTA 3V81A 4CF9A 1BISA 1JKHA 4KI4A 3VQ4A 3K5MA 1C0TA 1VSKA 4DTNA 4Z4GA 4KHUA 1U04A 3HK2A 4CIFA 4KHSA 4CFCA 4FK4A 1JLGA 3QLHA 4KHYA 2ZE2A 3MAQA 4KHNA 3AV9A 4DSIA 3AVAA 4FW1A 3OYEA 4E7JA 4M41A 3SV4A 3NDKA 1KLNA 4PY5A 2KFZA 3PUFA 2HB5A 1Y97A 3O3GA 3OS1A 1RILA 2LSNA 3QETA 4IKFA 4ZTFA 4OKKA 1X9MA 1DTQA 4N5SA 4HCBA 5I42A 4W5QA 1FXXA 5J1EA 3SJJA 1VSMA 3TARA 4CEQA 4FK0A 3NF8A 2ATQA 2VG7A 4IDKA 3DMJA 3L2QA 3NF7A 4JLHA 1RT4A 3DRPA 4DQRA 4BDZA 3TWHA 1T8EA 4C8MA 3AVNA 3VQDA 4CIGA 1EKEA 3K57A 2KZZA 4M42A 1NK7A 1IG9A 2A1RA 4CJUA 2Q3SA 3SUOA 3MXMA 1C0UA 3AVMA 3TAEA 1I3AA 4MQ3A 4BWJA 1SKRA 2OZSA 1RBRA 3QO9A 3V1RA 4OJRA 4CECA 3V9XA 4DSEA 1U49A 3HP9A 1HQUA 4B9TA 3I0SA 4JRPA 4E0DA 5SWMA 2D0BA 3AVBA 1KVAA 1YTAA 3S3MA 4FYDA 5C25A 1QTMA 1VK0A 2PYLA 3WNEA 3NE6A 1NK0A 1GOCA 2P5OA 3OYHA 4DF8A 4DFJA 1UOCA 2RPIA 5HRNA 4G1QA 3D0PA 3RMBA 3VQ9A 4HVJA 1RTDA 4FJ7A 4YFUA 3V9WA 4FM2A 1XHZA 4HHTA 4DSLA 4ICLA 1RT5A 1VSEA 4DS5A 1JLCA 2Y1JA 1TAUA 4DS4A 4FJLA 2QKKA 4ELUA 3AA3A 3DM2A 3OVNA 3G10A 4BE2A 1RDAA 3HPOA 1CZ9A 1TKDA 4RW4A 5J2PA 3VQPA 3HJFA 2VWKA 4PWDA 3K2PA 4W5RA 1EETA 3LWLA 4F3OA 3QIOA 5HRRA 4E7KA 3AA4A 3F9KA 1A5WA 4KO0A 1KTQA 3SUNA 1LAWA 4FJ9A 3V1QA 3VQ8A 3K5OA 4CEDA 1KVBA 4ZTJA 1XC9A 3WNHA 1SKSA 3HO1A 3AVHA 3SQ4A 1QE1A 3ALYA 3KK1A 3TABA 1NKCA 2G8UA 3SV3A 2XHBA 1S1UA 1BI4B 3ZSRA 4CEBA 1K6YA 1WSHA 1KSPA 4J2AA 2XRIA 3AO3A 3ZT2A 5CY4A 5J2QA 4NCGA 2Z1IA 3NGYA 3QEPA 4OLAA 3AO1A 2YHBA 3ZCMA 5KTQA 4Y1CA 4OLBA 4KHWA 2G8HA 4CHZA 3O4NA 4IG0A 4CFAA 4FLTA 1ZBLA 3EYZA 3B6PA 1RDCA 3HT3A 1HYVA 4DU3A 3OJSA 3K5LA 4LH4A 3ZT4A 1JXEA 3QIPA 4DTJA 4CJFA 1KLMA 4IG3A 1TV6A 4EZ6A 4OGEA 2AJQA 1TL3A 3HXMA 4R5PA 2I5JA 2OA8A 1GOBA 3SQ0A 3IG1A 3LAKA 2RF2A 1S9EA 3JSMA 4E7LA 1WAFA 3MXIA 4CK3A 4LD0A 1RBVA 5KGWA 1IH7A 2DFHA 4AHTA 4KRFA 3DYAA 1BQNA 1REVA 1T03A 4E7IA 3P1GA 3PX4A 5JS1A 1WNSA 3CM5A 1QQCA 4Q0BA 4B08A 4EP5A 1IKXA 4ID5A 4CEOA 3P5JA 5J2NA 3SNNA 2HMIA 4FJGA 1EXQA 1X9SA 1VRUA 1YT3A 3ITHA 4M3WA 2HHUA 4CHQA 2JGUA 4Y1DA 3NH0A 4FZXC 4BWMA 2YKMA 1RT1A 1JL1A 1LW0A 1S1TA 4GVMA 4TSXA 4CJ5A 4HUFA 3KLFA 3S3OA 1NJZA 1FK9A 1QSSA 2B6AA 1WSIA 4EZ9A 3ZSWA 1NK6A 1SV5A 2G8FA 1YTUA 3RMAA 3L8BA 1NK9A 4PA1A 1C6VA 1MU2A 4B9VA 4W5NA 3QEXA 4EP4A 3NCIA 1RT7A 4CF1A 3LDSA 1UAXA 2IC3A 4FW2A 3NH1A 1ZBUA 2YNIA 3O3HA 1TKXA 3OYFA 3TI0A 1TK5A 5CYQA 4Z0UA 3MEEA 4F2SA 2BGGA 1KVCA 3I0RA 4OGCA 4DTRA 4B9LA 4IBNA 2OPPA 4DTUA 2BDPA 3CM6A 2HNZA 4FJMA 1NJWA 4CFDA 4FLVA 4CFBA 4BE1A 2X6SA 4FJNA 3HL8A 4CE9A 3TAQA 2XY5A 5EU7A 3SYZA 4H4MA 3OYIA 3HVRA 1B9FA 1VSIA 3VQEA 3ZSVA 4M3YA 4M45A 3AA5X 1NJYA 2EHGA 3AVLA 3HM9A 3M8PA 2X74A 4CHNA 3KK2A 1QSYA 3L2RA 4DU1A 4FJ5A 4CGDA 4HUEA 3AVCA 2Z1GA 1U48A 1IKWA 5FDLA 3K59A 5JS2A 1J53A 4CGGA 3LPUA 1EX4A 5DMRA 3OYJA 4FK2A 3AO2A 2IGIA 4CJ4A 1TKTA 3V9ZA 2YKNA 4FJIA 4FZZA 2OPRA 4CJRA 4DFMA 3PO5A 3OS2A 5E41A 4GMJB 1WN7A 1S1XA 4M3XA 2R7YA 4CF0A 4DU4A 4DF4A 4M3TA 1L3VA 4C8LA 2YNGA 1KCFA 2DFFA 4BACA 3KLHA 3TAGA 2G8WA 3VQQA 3SPYA 4DQPA 4DG1A 5HROA 4O55A 1D8YA 1JLBA 1G15A 1HJRA 2GUIA 2KW4A 1HPZA 3HPHA 3KLIA 5KI6A 3F73A 3LZJA 4DFKA 1TK8A 3DLHA 4FZYA 2NUBA 1Z25A 4CHPA 1JLQA 4NYNA 3OYDA 2XY8A 4W5TA 1IO2A 4DSKA 3ZT3A 3KLGA 4ZHRA 3RRGA 3LP2A 3C6TA 2FC0A 1N6QA 3NFAA 4MFBA 1D9FA 3VQ7A 1BCMA 4CERA 4N76A 4AILC 3NGZA 5HRSA 3NF9A 1XWLA 1NK4A 4FVMA 4ID1A 2QXFA 4O0JA 4FLUA 3VQ6A 4B3OA 2D0CA 1KFSA 1RT3A 4BDYA 3MXJA 2B5JA 2GV9A 4WE1A 3ZT1A 3PV8A 4KI6A 1BGXT 2YNFA 3IRXA 2E4LA 1C1BA 1VSFA 3RRHA 3VQ5A 3RWUA 1RBUA 3ZSXA 3PX0A 3K5NA 3CQ8A 1TL1A 4L8RB 2P1JA 1S1WA 1GOAA 3CFRA 3MEGA 1JXBA 1RBSA 3V4IA 3NHGA 3ZSZA 4J2BA 4FCYA 5C42A 1CZBA 4CF2A 1C1CA 4B8CA 3L3VA 4FM0A 3VA0A 2OYQA 4FJXA 1WSGA 2OPSA 5FROA 3QNNA 3D45A 3DLKA 2KFNA 4CJKA 4F4KA 4FJKA 3SI6A 1RCHA 1RDDA 4OVLA 3IS9A 4RW6A 4FXDA 1S6QA 2PY5A 1RTHA 1WSEA 1NK8A 2Y1IA 3KD1E 1FKOA 5T7BA 2QKBA 3OJUA 3LANA 4CGIA 4KREA 4UQGA 3SUQA 2X78A 1LWCA 3AVJA 3NBPA 4RW9A 4AHRA 3OYGA 5FRNA 2HHSA 4K8XA 4E1MA 5CYMA 1TKZA 4CIEA 1LW2A 4F3TA 4CEAA 3AO4A 4CF8A 3LWMA 1NKEA 1T7PA 3LALA 3VA3A 1RT6A 1LWFA 3QINA 4I2QA 4CGFA 2BANA 3JYTA 3B6OA 2WONA 2ZQBA 2P51A 4DTSA 3KJVA 4CJVA 4DLEA 3QEIA 2PYJA 4OPJA 4BDPA 4W5OA 3OYNA 1RTJA 4OKJA 3EZ5A 4KTQA 5HP1A 1RBTA 3DRRA 1J54A 4DQSA 3HP6A 2QK9A 3U6FA 2HW3A 1B9DA 3A2FA 1LWEA 1HNVA 4CJLA 3SUPA 4FLZA 3BDPA 3IAYA 2KTQA 1ZBFA 3DI6A 5HLFA 2HHQA 4H8KA 2IDOA 4QCLA 4B9SA 2JLEA 3U3GA 4CJSA 2F96A 3O3FA 4CK2A 1UA1A 1S5JA 4KFBA 1HYZA 4KKOA 2KZMA 1X9WA 1B92A 4Z4FA 1BHLA 3ZSOA 2E6MA 2IAJA 1HNIA 4DQIA 3ZSYA 4E19A 3LP1A 1SL2A 2B4JA 1CLQA 3M8QA 3AVIA 4Q5VA 4XIUA 3O4QA 2ITGA 3AVKA 3LAMA 2IOCA 2OZMA 2HVIA 4B8AB 4RW8A 4Z4CA 3H08A 3OYAA 3TAPA 4DQQA 1ZYQA 4DTOA 2VG6A 1S1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKY A;  4HCC A;  5KRS A;  5CZ2 A;  1J5O A;  3CYM A;  1BCO A;  4OPK A;  1Z26 A;  4FM1 A;  3PO4 A;  1VSD A;  4ELT A;  3C95 A;  2F8T A;  4CK1 A;  2GBZ A;  4RG8 A;  3DLB A;  3ISN C;  2FBX A;  4DTX A;  4M3U A;  1DTT A;  3LZI A;  1HYS A;  2PZS A;  4M3R A;  2YHA A;  2G8V A;  1I39 A;  1RTI A;  1WSF A;  1TK0 A;  1NKB A;  4C8O A;  3RTV A;  1ASV A;  1WLJ A;  3C94 A;  1QHT A;  4OKE A;  4CHO A;  4FJJ A;  3C6U A;  4LH5 A;  2HHX A;  4PUO A;  4DMN A;  3OYL A;  5C24 A;  2XY7 A;  1SL0 A;  2G8K A;  4I9Q A;  1VSJ A;  4KTZ A;  3L2W A;  4F8R A;  4J2E A;  4NCA A;  1ITG A;  2W42 A;  2O4I A;  3LP3 A;  3V6D A;  4O44 A;  5HRP A;  1L3S A;  1VSL A;  3MEC A;  4CGJ A;  5J2M A;  4YNQ A;  3OYC A;  2FBV A;  3M8S A;  1KRP A;  3FFI A;  4AHV A;  1BQM A;  2WOM A;  1A5X A;  1HRH A;  4I9L A;  5HBM A;  4HTU A;  1RDB A;  1WSJ A;  2VG5 A;  5CZ1 A;  1JLF A;  3LPT A;  4C8N A;  4KB1 A;  4N41 A;  4CJW A;  3WNG A;  3PX6 A;  1TGO A;  2EX3 A;  4B9M A;  4GW6 A;  3VQA A;  4DSJ A;  3HST B;  4E89 A;  1J9A A;  4CJQ A;  4IFV A;  3V1O A;  3L3U A;  4IFY A;  3CFP A;  4CJT A;  1QS4 A;  3U3Y A;  3BGR A;  1NK5 A;  4M3Z A;  2HHW A;  4CES A;  3NGI A;  4Z4E A;  3I8D A;  1QSL A;  4CJ3 A;  3VN5 A;  4I7F A;  4DTP A;  4NYF A;  3QNO A;  1TAQ A;  4KTW A;  4LSN A;  3TAM A;  3VQB A;  3L2V A;  1Q9X A;  2HVH A;  2O4G A;  1JL2 A;  2OPQ A;  1S6P A;  3NF6 A;  1BIU A;  3K58 A;  2FBY A;  5DK5 A;  4FJ8 A;  4O5B A;  1FKP A;  1W9H A;  4DSF A;  1VSH A;  3VQC A;  4Z4H A;  1HQE A;  3DRS A;  4JS4 A;  4ELV A;  1BI4 A;  3AVG A;  3WNF A;  3EY1 A;  1NOY A;  1HMV A;  4AHC A;  3G0Z A;  4H4O A;  3SPZ A;  4CCH A;  1C0M A;  1X1P A;  4DLG A;  4HUG A;  1JLE A;  4I2P A;  3HPG A;  2ZD1 A;  4E7H A;  3SQ2 A;  2RN2 A;  2X6N A;  3AVF A;  3CFO A;  5KRT A;  2F8S A;  4KB0 A;  1VRT A;  3ASM A;  1DLO A;  4AH9 A;  4E1N A;  2VWJ A;  2G8I A;  4BE0 A;  3QEV A;  1C1A A;  4KV8 A;  1Q9Y A;  1ZBH A;  2D5R A;  4FLW A;  4DTM A;  2XO7 A;  1ZBI A;  1XHX A;  2KQ2 A;  1T05 A;  3AA2 A;  3KD5 E;  3OYK A;  1F21 A;  4CGH A;  1W0H A;  3UIQ A;  4RW7 A;  1U4B A;  1BIZ A;  3PY8 A;  1S9G A;  3M8R A;  3KLE A;  3P83 D;  3E01 A;  3MED A;  4N56 A;  2E6L A;  1UA0 A;  4CEE A;  1L3T A;  1Q8I A;  1YVU A;  1LAV A;  3KKS A;  2A1S A;  3DLG A;  2DY4 A;  1TVR A;  3V9U A;  2HHV A;  1ASU A;  4AHS A;  1NJX A;  1EP4 A;  3ULD A;  3RMD A;  4C8K A;  2BE2 A;  3DOL A;  3KIO A;  2Z1H A;  3DLR A;  4CJP A;  3TAN A;  4PQU A;  4JRQ A;  1UWB A;  3RR8 A;  2HND A;  3RMC A;  4E3S A;  1BL3 A;  4CEZ A;  3DLE A;  3SCX A;  3S9H A;  3THV A;  3RR7 A;  3ZSQ A;  3QES A;  3TAF A;  1WAJ A;  3L2U A;  3LP0 A;  1XI1 A;  5KGX A;  1CXQ A;  1L3U A;  5FRM A;  1KFD A;  3SQ1 A;  1R0A A;  5D3G A;  2HNY A;  4CHY A;  1U45 A;  5I3U A;  3QEW A;  3V9S A;  3QER A;  3OY9 A;  4LY7 A;  3OS0 A;  4JS5 A;  2YV0 X;  2DTU A;  1LV5 A;  1O1W A;  2Z1J A;  1JLA A;  2HHT A;  3T19 A;  5K14 A;  2YNH A;  1U47 A;  2DFE A;  3KTQ A;  4FJH A;  4DFP A;  2ETJ A;  4Z4I A;  4B9N A;  4O0I A;  4FLX A;  2XY6 A;  1CXU A;  3TR8 A;  4AHU A;  1RNH A;  4K8Z A;  4CJE A;  4LSL A;  1SKW A;  2D0A A;  2FBT A;  4B9U A;  1SL1 A;  1NOZ A;  2P5G A;  1D9D A;  1ASW A;  4FLY A;  4J2D A;  5SZT A;  4KPY A;  3OYM A;  1D5A A;  3DOK A;  4N47 A;  4CEF A;  3NAE A;  4KAZ A;  1IKV A;  3S3N A;  3SZ2 A;  4F2R A;  3HYF A;  3NH2 A;  1A5V A;  1L5U A;  1RT2 A;  3KK3 A;  4O4G A;  1N5Y A;  2RKI A;  3KKR A;  3ZT0 A;  3AO5 A;  3OYB A;  2IS3 A;  3T1A A;  4KHQ A;  3CG7 A;  4QAG A;  4DWI A;  4NCB A;  1SUQ A;  4QOZ B;  3T3F A;  3HVT A;  3V81 A;  4CF9 A;  1BIS A;  1JKH A;  4KI4 A;  3VQ4 A;  3K5M A;  1C0T A;  1VSK A;  4DTN A;  4Z4G A;  4KHU A;  1U04 A;  3HK2 A;  4CIF A;  4KHS A;  4CFC A;  4FK4 A;  1JLG A;  3QLH A;  4KHY A;  2ZE2 A;  3MAQ A;  4KHN A;  3AV9 A;  4DSI A;  3AVA A;  4FW1 A;  3OYE A;  4E7J A;  4M41 A;  3SV4 A;  3NDK A;  1KLN A;  4PY5 A;  2KFZ A;  3PUF A;  2HB5 A;  1Y97 A;  3O3G A;  3OS1 A;  1RIL A;  2LSN A;  3QET A;  4IKF A;  4ZTF A;  4OKK A;  1X9M A;  1DTQ A;  4N5S A;  4HCB A;  5I42 A;  4W5Q A;  1FXX A;  5J1E A;  3SJJ A;  1VSM A;  3TAR A;  4CEQ A;  4FK0 A;  3NF8 A;  2ATQ A;  2VG7 A;  4IDK A;  3DMJ A;  3L2Q A;  3NF7 A;  4JLH A;  1RT4 A;  3DRP A;  4DQR A;  4BDZ A;  3TWH A;  1T8E A;  4C8M A;  3AVN A;  3VQD A;  4CIG A;  1EKE A;  3K57 A;  2KZZ A;  4M42 A;  1NK7 A;  1IG9 A;  2A1R A;  4CJU A;  2Q3S A;  3SUO A;  3MXM A;  1C0U A;  3AVM A;  3TAE A;  1I3A A;  4MQ3 A;  4BWJ A;  1SKR A;  2OZS A;  1RBR A;  3QO9 A;  3V1R A;  4OJR A;  4CEC A;  3V9X A;  4DSE A;  1U49 A;  3HP9 A;  1HQU A;  4B9T A;  3I0S A;  4JRP A;  4E0D A;  5SWM A;  2D0B A;  3AVB A;  1KVA A;  1YTA A;  3S3M A;  4FYD A;  5C25 A;  1QTM A;  1VK0 A;  2PYL A;  3WNE A;  3NE6 A;  1NK0 A;  1GOC A;  2P5O A;  3OYH A;  4DF8 A;  4DFJ A;  1UOC A;  2RPI A;  5HRN A;  4G1Q A;  3D0P A;  3RMB A;  3VQ9 A;  4HVJ A;  1RTD A;  4FJ7 A;  4YFU A;  3V9W A;  4FM2 A;  1XHZ A;  4HHT A;  4DSL A;  4ICL A;  1RT5 A;  1VSE A;  4DS5 A;  1JLC A;  2Y1J A;  1TAU A;  4DS4 A;  4FJL A;  2QKK A;  4ELU A;  3AA3 A;  3DM2 A;  3OVN A;  3G10 A;  4BE2 A;  1RDA A;  3HPO A;  1CZ9 A;  1TKD A;  4RW4 A;  5J2P A;  3VQP A;  3HJF A;  2VWK A;  4PWD A;  3K2P A;  4W5R A;  1EET A;  3LWL A;  4F3O A;  3QIO A;  5HRR A;  4E7K A;  3AA4 A;  3F9K A;  1A5W A;  4KO0 A;  1KTQ A;  3SUN A;  1LAW A;  4FJ9 A;  3V1Q A;  3VQ8 A;  3K5O A;  4CED A;  1KVB A;  4ZTJ A;  1XC9 A;  3WNH A;  1SKS A;  3HO1 A;  3AVH A;  3SQ4 A;  1QE1 A;  3ALY A;  3KK1 A;  3TAB A;  1NKC A;  2G8U A;  3SV3 A;  2XHB A;  1S1U A;  1BI4 B;  3ZSR A;  4CEB A;  1K6Y A;  1WSH A;  1KSP A;  4J2A A;  2XRI A;  3AO3 A;  3ZT2 A;  5CY4 A;  5J2Q A;  4NCG A;  2Z1I A;  3NGY A;  3QEP A;  4OLA A;  3AO1 A;  2YHB A;  3ZCM A;  5KTQ A;  4Y1C A;  4OLB A;  4KHW A;  2G8H A;  4CHZ A;  3O4N A;  4IG0 A;  4CFA A;  4FLT A;  1ZBL A;  3EYZ A;  3B6P A;  1RDC A;  3HT3 A;  1HYV A;  4DU3 A;  3OJS A;  3K5L A;  4LH4 A;  3ZT4 A;  1JXE A;  3QIP A;  4DTJ A;  4CJF A;  1KLM A;  4IG3 A;  1TV6 A;  4EZ6 A;  4OGE A;  2AJQ A;  1TL3 A;  3HXM A;  4R5P A;  2I5J A;  2OA8 A;  1GOB A;  3SQ0 A;  3IG1 A;  3LAK A;  2RF2 A;  1S9E A;  3JSM A;  4E7L A;  1WAF A;  3MXI A;  4CK3 A;  4LD0 A;  1RBV A;  5KGW A;  1IH7 A;  2DFH A;  4AHT A;  4KRF A;  3DYA A;  1BQN A;  1REV A;  1T03 A;  4E7I A;  3P1G A;  3PX4 A;  5JS1 A;  1WNS A;  3CM5 A;  1QQC A;  4Q0B A;  4B08 A;  4EP5 A;  1IKX A;  4ID5 A;  4CEO A;  3P5J A;  5J2N A;  3SNN A;  2HMI A;  4FJG A;  1EXQ A;  1X9S A;  1VRU A;  1YT3 A;  3ITH A;  4M3W A;  2HHU A;  4CHQ A;  2JGU A;  4Y1D A;  3NH0 A;  4FZX C;  4BWM A;  2YKM A;  1RT1 A;  1JL1 A;  1LW0 A;  1S1T A;  4GVM A;  4TSX A;  4CJ5 A;  4HUF A;  3KLF A;  3S3O A;  1NJZ A;  1FK9 A;  1QSS A;  2B6A A;  1WSI A;  4EZ9 A;  3ZSW A;  1NK6 A;  1SV5 A;  2G8F A;  1YTU A;  3RMA A;  3L8B A;  1NK9 A;  4PA1 A;  1C6V A;  1MU2 A;  4B9V A;  4W5N A;  3QEX A;  4EP4 A;  3NCI A;  1RT7 A;  4CF1 A;  3LDS A;  1UAX A;  2IC3 A;  4FW2 A;  3NH1 A;  1ZBU A;  2YNI A;  3O3H A;  1TKX A;  3OYF A;  3TI0 A;  1TK5 A;  5CYQ A;  4Z0U A;  3MEE A;  4F2S A;  2BGG A;  1KVC A;  3I0R A;  4OGC A;  4DTR A;  4B9L A;  4IBN A;  2OPP A;  4DTU A;  2BDP A;  3CM6 A;  2HNZ A;  4FJM A;  1NJW A;  4CFD A;  4FLV A;  4CFB A;  4BE1 A;  2X6S A;  4FJN A;  3HL8 A;  4CE9 A;  3TAQ A;  2XY5 A;  5EU7 A;  3SYZ A;  4H4M A;  3OYI A;  3HVR A;  1B9F A;  1VSI A;  3VQE A;  3ZSV A;  4M3Y A;  4M45 A;  3AA5 X;  1NJY A;  2EHG A;  3AVL A;  3HM9 A;  3M8P A;  2X74 A;  4CHN A;  3KK2 A;  1QSY A;  3L2R A;  4DU1 A;  4FJ5 A;  4CGD A;  4HUE A;  3AVC A;  2Z1G A;  1U48 A;  1IKW A;  5FDL A;  3K59 A;  5JS2 A;  1J53 A;  4CGG A;  3LPU A;  1EX4 A;  5DMR A;  3OYJ A;  4FK2 A;  3AO2 A;  2IGI A;  4CJ4 A;  1TKT A;  3V9Z A;  2YKN A;  4FJI A;  4FZZ A;  2OPR A;  4CJR A;  4DFM A;  3PO5 A;  3OS2 A;  5E41 A;  4GMJ B;  1WN7 A;  1S1X A;  4M3X A;  2R7Y A;  4CF0 A;  4DU4 A;  4DF4 A;  4M3T A;  1L3V A;  4C8L A;  2YNG A;  1KCF A;  2DFF A;  4BAC A;  3KLH A;  3TAG A;  2G8W A;  3VQQ A;  3SPY A;  4DQP A;  4DG1 A;  5HRO A;  4O55 A;  1D8Y A;  1JLB A;  1G15 A;  1HJR A;  2GUI A;  2KW4 A;  1HPZ A;  3HPH A;  3KLI A;  5KI6 A;  3F73 A;  3LZJ A;  4DFK A;  1TK8 A;  3DLH A;  4FZY A;  2NUB A;  1Z25 A;  4CHP A;  1JLQ A;  4NYN A;  3OYD A;  2XY8 A;  4W5T A;  1IO2 A;  4DSK A;  3ZT3 A;  3KLG A;  4ZHR A;  3RRG A;  3LP2 A;  3C6T A;  2FC0 A;  1N6Q A;  3NFA A;  4MFB A;  1D9F A;  3VQ7 A;  1BCM A;  4CER A;  4N76 A;  4AIL C;  3NGZ A;  5HRS A;  3NF9 A;  1XWL A;  1NK4 A;  4FVM A;  4ID1 A;  2QXF A;  4O0J A;  4FLU A;  3VQ6 A;  4B3O A;  2D0C A;  1KFS A;  1RT3 A;  4BDY A;  3MXJ A;  2B5J A;  2GV9 A;  4WE1 A;  3ZT1 A;  3PV8 A;  4KI6 A;  1BGX T;  2YNF A;  3IRX A;  2E4L A;  1C1B A;  1VSF A;  3RRH A;  3VQ5 A;  3RWU A;  1RBU A;  3ZSX A;  3PX0 A;  3K5N A;  3CQ8 A;  1TL1 A;  4L8R B;  2P1J A;  1S1W A;  1GOA A;  3CFR A;  3MEG A;  1JXB A;  1RBS A;  3V4I A;  3NHG A;  3ZSZ A;  4J2B A;  4FCY A;  5C42 A;  1CZB A;  4CF2 A;  1C1C A;  4B8C A;  3L3V A;  4FM0 A;  3VA0 A;  2OYQ A;  4FJX A;  1WSG A;  2OPS A;  5FRO A;  3QNN A;  3D45 A;  3DLK A;  2KFN A;  4CJK A;  4F4K A;  4FJK A;  3SI6 A;  1RCH A;  1RDD A;  4OVL A;  3IS9 A;  4RW6 A;  4FXD A;  1S6Q A;  2PY5 A;  1RTH A;  1WSE A;  1NK8 A;  2Y1I A;  3KD1 E;  1FKO A;  5T7B A;  2QKB A;  3OJU A;  3LAN A;  4CGI A;  4KRE A;  4UQG A;  3SUQ A;  2X78 A;  1LWC A;  3AVJ A;  3NBP A;  4RW9 A;  4AHR A;  3OYG A;  5FRN A;  2HHS A;  4K8X A;  4E1M A;  5CYM A;  1TKZ A;  4CIE A;  1LW2 A;  4F3T A;  4CEA A;  3AO4 A;  4CF8 A;  3LWM A;  1NKE A;  1T7P A;  3LAL A;  3VA3 A;  1RT6 A;  1LWF A;  3QIN A;  4I2Q A;  4CGF A;  2BAN A;  3JYT A;  3B6O A;  2WON A;  2ZQB A;  2P51 A;  4DTS A;  3KJV A;  4CJV A;  4DLE A;  3QEI A;  2PYJ A;  4OPJ A;  4BDP A;  4W5O A;  3OYN A;  1RTJ A;  4OKJ A;  3EZ5 A;  4KTQ A;  5HP1 A;  1RBT A;  3DRR A;  1J54 A;  4DQS A;  3HP6 A;  2QK9 A;  3U6F A;  2HW3 A;  1B9D A;  3A2F A;  1LWE A;  1HNV A;  4CJL A;  3SUP A;  4FLZ A;  3BDP A;  3IAY A;  2KTQ A;  1ZBF A;  3DI6 A;  5HLF A;  2HHQ A;  4H8K A;  2IDO A;  4QCL A;  4B9S A;  2JLE A;  3U3G A;  4CJS A;  2F96 A;  3O3F A;  4CK2 A;  1UA1 A;  1S5J A;  4KFB A;  1HYZ A;  4KKO A;  2KZM A;  1X9W A;  1B92 A;  4Z4F A;  1BHL A;  3ZSO A;  2E6M A;  2IAJ A;  1HNI A;  4DQI A;  3ZSY A;  4E19 A;  3LP1 A;  1SL2 A;  2B4J A;  1CLQ A;  3M8Q A;  3AVI A;  4Q5V A;  4XIU A;  3O4Q A;  2ITG A;  3AVK A;  3LAM A;  2IOC A;  2OZM A;  2HVI A;  4B8A B;  4RW8 A;  4Z4C A;  3H08 A;  3OYA A;  3TAP A;  4DQQ A;  1ZYQ A;  4DTO A;  2VG6 A;  1S1V A; 
#chains in the Genus database with same CATH topology
 3THW A;  4NXN K;  1BWF O;  3PO4 A;  4RG8 A;  3DLB A;  1NGB A;  4DTX A;  1DTT A;  1HYS A;  2PZS A;  1YVN A;  4CZL A;  4FJJ A;  4CHO A;  4LH5 A;  1SL0 A;  3OYL A;  1WBD A;  4I9Q A;  4FSV A;  1ITG A;  4ISF A;  4OPH A;  1I94 K;  4NB4 A;  4O44 A;  3T69 A;  1VSL A;  4CGJ A;  5J2M A;  3OYC A;  3M8S A;  3UB5 A;  1KRP A;  3FFI A;  4AHV A;  3LM9 A;  5HBM A;  1RDB A;  3THW B;  2GEL A;  5M1F A;  3VQA A;  3HST B;  4E89 A;  2AP1 A;  1J9A A;  3UKR A;  4IFV A;  3V1O A;  4IFY A;  3CFP A;  1XNQ K;  3U3Y A;  3FGU A;  4CES A;  2F4V K;  3I8D A;  1QSL A;  3QNO A;  4LSN A;  2ZWH A;  2O4G A;  1BIU A;  4C1N I;  1FKP A;  4DSF A;  1HLU A;  3VQC A;  4Z4H A;  1HQE A;  3DRS A;  3VOV A;  4FWK A;  4JS4 A;  1T6C A;  1XUP O;  5AQH A;  3G0Z A;  5C2F A;  4BRA A;  2F8S A;  2H3G X;  3ASM A;  3JAM O;  1T44 A;  2VWJ A;  3VER A;  1NMN A;  1C1A A;  4KV8 A;  3UKR B;  4DR1 K;  4FLW A;  4DTM A;  4WCE L;  4FWN A;  3FFK B;  1ZBI A;  1XHX A;  2JWK A;  1T05 A;  1F21 A;  3PY8 A;  4BVO A;  2HF4 A;  4DUZ K;  3P83 D;  3MED A;  1L3T A;  2E6L A;  4CEE A;  3KKS A;  2A1S A;  2DY4 A;  1TVR A;  3M1F A;  3DJC A;  1EP4 A;  3CME N;  3JXU A;  4C8K A;  3KIO A;  3D7E O;  4FPB A;  4CJP A;  4YOY A;  4JRQ A;  1UWB A;  3RR8 A;  4FWR A;  1K8K A;  1BL3 A;  5BRF A;  3RR7 A;  2GWJ A;  2Q97 A;  2QI2 A;  3VEW A;  3TAF A;  1XI1 A;  3ULE A;  1L3U A;  4A5A A;  1R0A A;  4BC3 A;  5AQT A;  3QEW A;  3V9S A;  1VQ5 N;  3ATU A;  5BRD A;  5EOY A;  2UU9 K;  2DFE A;  4FJH A;  2ETJ A;  4Z4I A;  2XY6 A;  1CXU A;  1RNH A;  2D0A A;  2FBT A;  2P5G A;  1D9D A;  4JI8 K;  3OYM A;  1YHQ N;  1IKV A;  3O9Q A;  4CZI A;  2EWS A;  5AQP A;  4K25 A;  4F2R A;  1K8K B;  1L5U A;  1RT2 A;  3KK3 A;  3ZT0 A;  3AO5 A;  3ULE B;  5M1O A;  4NCB A;  1SUQ A;  1QVG M;  4DTN A;  2YHX A;  1U04 A;  4FK4 A;  1JLG A;  5A2Q O;  3TSP A;  5AQZ A;  1FW6 A;  4KHN A;  2QWP A;  5EXW A;  1NNE A;  3OYE A;  4E7J A;  4PY5 A;  1KLN A;  1HKG A;  3PUF A;  1RIL A;  2LSN A;  4OPA A;  5M1K A;  2O8E A;  4WFN L;  1FXX A;  1HKC A;  4CEQ A;  1OVQ A;  3SLC A;  3L2Q A;  3SMP A;  3CIP A;  1RT4 A;  4XH5 A;  4BDZ A;  4PL8 A;  2ZGY A;  1T8E A;  4BRM A;  4CIG A;  2D1K A;  1NK7 A;  1IG9 A;  1N32 K;  4DV1 K;  3ID8 A;  2E8A A;  3MXM A;  1SKR A;  4MQ3 A;  3F2K A;  3FZM A;  1HQU A;  3S3M A;  1T3V A;  4H5R A;  1QTM A;  4CD3 A;  1NK0 A;  1YJW N;  1GOC A;  2P5O A;  3OYH A;  4DF8 A;  4DFJ A;  2HOE A;  2O8E B;  3C0B A;  1HR0 K;  5HRN A;  4FJ7 A;  4PL7 A;  4YFU A;  3V9W A;  3OA9 A;  4FM2 A;  5JMV A;  4DSL A;  1RT5 A;  3B8A X;  1JLC A;  2NRV A;  4RW4 A;  2VWK A;  4PWD A;  1RGI A;  2W40 A;  1EET A;  4WQ5 C;  4F3O A;  2IVN A;  3CI5 A;  2YX6 A;  1GLB G;  4U67 L;  1KTQ A;  1LCU A;  3MK6 A;  3HTV A;  4FJ9 A;  3VQ8 A;  1SKS A;  4B1U B;  1GLA G;  3HRG A;  3KK1 A;  1VQ4 N;  3VF6 A;  3SV3 A;  4FO0 A;  1BI4 B;  4CEB A;  1KSP A;  4J2A A;  2XRI A;  2A5X A;  5CY4 A;  5J2Q A;  3NMU A;  2YHB A;  2KHO A;  3ZCM A;  5KTQ A;  4Y1C A;  4JKH A;  5KPR A;  2QWN A;  4IG0 A;  3JS6 A;  4CFA A;  4IEI A;  4YOR A;  3HT3 A;  3K5L A;  4LH4 A;  4YY3 K;  1KLM A;  1NWK A;  4R5P A;  3DLL L;  1S9E A;  3JSM A;  4E7L A;  4BRE A;  2UXD K;  3MN5 A;  4AHT A;  4KRF A;  4JKC A;  3DYA A;  4LF9 K;  3SMS A;  4Q0B A;  4BRN A;  4C1N K;  2O8F A;  4BVP A;  4X62 K;  3KHY A;  1Q7Y O;  1WUA A;  1YT3 A;  4CHQ A;  2A6A A;  3E9L A;  4DV7 K;  4Y1D A;  1N34 K;  4O8U A;  1JCF A;  1RT1 A;  1NJZ A;  3C7N A;  1FK9 A;  3QB0 A;  3S41 A;  4A59 A;  4EZ9 A;  1XMQ K;  3L8B A;  3QEX A;  4YDU C;  3ENO A;  3NCI A;  1RT7 A;  4CF1 A;  3LDS A;  3CD6 N;  2IC3 A;  2YNI A;  3P4I A;  1TKX A;  3WUH A;  3OYF A;  2BGG A;  4DTR A;  4B9L A;  3BF3 A;  3MWP A;  4O8K A;  2HBL A;  5KQ8 A;  1NJW A;  2QXL A;  3KK7 A;  4BRO A;  4MLH A;  1QVF M;  2X6S A;  4FJN A;  3HL8 A;  4WQ5 A;  3TAQ A;  4NLC A;  5EU7 A;  2XY5 A;  3SYZ A;  5LJW A;  1B9F A;  3HVR A;  3VQE A;  1ILY A;  4M45 A;  5LMN K;  3H1V X;  2EHG A;  3AVL A;  4JAX A;  5LMU K;  2W6L A;  3C7N B;  4KHU A;  2Z1G A;  3P38 A;  5BPM A;  3HI0 A;  2FLO A;  3VMF B;  4FK2 A;  3LPU A;  5DMR A;  4BQL A;  5FPM A;  3V9Z A;  4FJI A;  2OPR A;  3CCJ N;  4DFM A;  3PO5 A;  4GMJ B;  1WN7 A;  4DF4 A;  5C0Y A;  4M3T A;  2YNG A;  3TAG A;  5AR0 A;  4DG1 A;  2GTD A;  1D8Y A;  2KLA A;  2IIR A;  2GUI A;  4AF1 A;  1OH5 A;  4B3R K;  4FZY A;  4X65 K;  3ZT3 A;  3KLG A;  3BUZ B;  3WXJ A;  1NGE A;  1WOQ A;  5HRS A;  3MCA B;  4O0J A;  4FLU A;  3VQ6 A;  2E1Z A;  2D0C A;  1KFS A;  3ZT1 A;  4WE1 A;  4DQ8 A;  4KI6 A;  3WXM B;  4IOA L;  4DV3 K;  3PX0 A;  3CQ8 A;  1OH6 A;  2P1J A;  4BC2 A;  5BN9 A;  3MEG A;  1JXB A;  2QW9 A;  3V4I A;  4J2B A;  3FLC O;  4YDU A;  4LFC K;  2QWM A;  1BG3 A;  3L0Q A;  2NRX A;  2OPS A;  3QNN A;  5AQR A;  2KFN A;  2OAN A;  5KPZ A;  3IS9 A;  4RW6 A;  2PY5 A;  3KD1 E;  4B1Y B;  5T7B A;  2ASM A;  5AQI A;  4UQG A;  2O8C B;  2X78 A;  3OYG A;  1O13 A;  4CZF A;  5IT9 O;  4ILH A;  4BRH A;  4FWO A;  2P9U A;  3VA3 A;  1RT6 A;  1HNW K;  2UYT A;  3FZL A;  4I2Q A;  4CGF A;  4FOI A;  3JYT A;  3PSF A;  5AQU A;  1XNR K;  2WON A;  3QIC A;  5IWA K;  4CJV A;  3QEI A;  4OPJ A;  4BDP A;  3M3Z A;  4M7Y A;  3DRR A;  1KAY A;  1S22 A;  3HP6 A;  3U6F A;  2ZF5 O;  1LWE A;  3E1Y A;  3SUP A;  5BPN A;  3BDP A;  2HHQ A;  1IV0 A;  4B9S A;  3U3G A;  3O3F A;  2KZM A;  1X9W A;  5C12 A;  1B92 A;  3A5N C;  2E6M A;  1HNI A;  3PLA A;  3IUC A;  2B4J A;  2P9U B;  3AGK A;  2GUP A;  4PKG A;  2ZJR L;  4B8A B;  3H08 A;  3TAP A;  4DQQ A;  4HCC A;  2UXC K;  3AAR A;  3CYM A;  2VWB A;  3C95 A;  2F8T A;  4CK1 A;  3W0L A;  3CPE A;  2FBX A;  4M3R A;  2G8V A;  1I39 A;  1RTI A;  1NKB A;  2HST A;  1ASV A;  1QHT A;  4OKE A;  2VYP A;  4DCH A;  2HHX A;  1IBM K;  5C24 A;  2G8K A;  2NLX A;  3L2W A;  4NCA A;  2W42 A;  3V6D A;  3EO3 A;  2FF6 A;  3PSI A;  5HRP A;  2FBV A;  4DR6 K;  1BQM A;  2WOM A;  1S72 N;  1DKG D;  4MDB A;  4HTU A;  1YIT N;  4KB1 A;  4CJW A;  3WNG A;  1TGO A;  2EX3 A;  4DSJ A;  1TYQ A;  1BOT O;  4K41 A;  3FE1 A;  1QS4 A;  3VEN A;  1NK5 A;  3IMX A;  3NGI A;  1T6D A;  4NYF A;  1Q9X A;  2HVH A;  3E9O A;  3T7Z A;  4A61 A;  1JL2 A;  2OPQ A;  4O5B A;  1VSH A;  1RDW X;  2NZT A;  2JWL A;  3H3O B;  3AVG A;  4CZE A;  5LJV A;  5AQQ A;  3SBG A;  3SPZ A;  4CCH A;  1C0M A;  4HUG A;  1XC3 A;  2ZD1 A;  3R6M A;  3CJC A;  3AVF A;  2OTL N;  1VRT A;  1DLO A;  3ZX2 A;  4BE0 A;  3CCV N;  2XO7 A;  2ITM A;  2KQ2 A;  3AA2 A;  3GG4 A;  4KH4 A;  4CZM A;  4H5T A;  4RW7 A;  3O9T A;  3VPZ A;  1U4B A;  3KLE A;  1HX1 A;  3E01 A;  3CCR N;  1Q8I A;  1YVU A;  1E4F T;  3V9U A;  1NJX A;  4CD1 A;  3RMD A;  4KH6 A;  4YOT A;  5AQF A;  1HPM A;  2V7Z A;  2PFU A;  4PQU A;  3O4W A;  5TKW A;  2HND A;  3DLE A;  3QES A;  1WAJ A;  4JV5 K;  5FRM A;  1KFD A;  1X9J A;  3QER A;  4BC5 A;  4LY7 A;  1KAZ A;  1LV5 A;  2Q1N A;  3LDP A;  1O1W A;  4BR2 A;  1JLA A;  3T19 A;  2YNH A;  1U47 A;  3KTQ A;  2CH5 A;  4B1W B;  5JLF A;  4DR5 K;  3O80 A;  5AJ3 K;  4LF7 K;  2HBM A;  2WC9 A;  1U2V A;  1SKW A;  4LSL A;  1YAG A;  1SL1 A;  1W97 L;  3G6E N;  1ASW A;  4DV6 K;  3G25 A;  4AQY K;  4J2D A;  2O8D B;  1D5A A;  3NAE A;  5JIC A;  3S3N A;  3CC4 N;  2P9I A;  3HYF A;  3KKR A;  3T1A A;  3CG7 A;  4DHY A;  1VQ6 N;  3R9P A;  4DWI A;  3HVT A;  4Z4G A;  1VSK A;  1Z6R A;  2HBJ A;  3TSU A;  1K73 O;  1BO5 O;  4KHS A;  2P9P B;  3TPQ A;  5MLC Q;  5AQK A;  3EE9 A;  3AV9 A;  2E2Q A;  3OW2 M;  4FW1 A;  4M41 A;  3SV4 A;  2KFZ A;  1Y97 A;  4BC4 A;  3OS1 A;  2YHW A;  3QET A;  4IKF A;  4OKK A;  2P9I B;  5J1E A;  3SJJ A;  4K0K K;  4JK8 A;  3ZET A;  4BRG A;  5BPL A;  3DMJ A;  3NF7 A;  4DQR A;  4JI2 K;  5BRE A;  4C8M A;  2KZZ A;  4BRQ A;  1V4S A;  4M42 A;  1NGD A;  3SUO A;  3AVM A;  3TAE A;  1I3A A;  4BWJ A;  2OZS A;  4OJR A;  4A2A A;  3V9X A;  4BGB A;  4E0D A;  3HP9 A;  2QWO A;  1MWM A;  3ZLJ A;  3AVB A;  1KVA A;  1ATN A;  1VK0 A;  3WNE A;  4J8F A;  1UOC A;  3O1B A;  4G1Q A;  3D0P A;  5I9E B;  2VQF K;  3ZET B;  1XHZ A;  4XH4 A;  5CR4 A;  5HOO A;  3MN6 A;  1VSE A;  5AZI A;  4DS5 A;  4JYA K;  4ELU A;  4B3S K;  3AA3 A;  3DM2 A;  1TKD A;  1VQN N;  3HPO A;  3VTH A;  3HBT A;  1D4X A;  3VF2 A;  1SQK A;  4W5R A;  3DXM A;  3R1X A;  5HRR A;  3AY9 A;  3EKS A;  3O08 A;  1A5W A;  1LAW A;  4JHD A;  3V1Q A;  1XC9 A;  2FF3 B;  3AVH A;  3SQ4 A;  3TAB A;  1NKC A;  2XHB A;  1WSH A;  4BR9 A;  1NGJ A;  2NRT A;  4IOC L;  4DR3 K;  4JKD A;  1FJG K;  5AZI B;  1NGA A;  2FSN A;  4M63 C;  4FLT A;  1DEJ A;  3B6P A;  2QEX N;  5ADX H;  1HYV A;  2F9T A;  4XEI A;  5GIN A;  3OJS A;  1NGI A;  1JXE A;  4CJF A;  4YOV A;  3DXM B;  1TV6 A;  2FSK A;  4OGE A;  1TL3 A;  1VHX A;  3MWT A;  3P39 A;  4YOW A;  3IG1 A;  1ATR A;  2RF2 A;  3MXI A;  2E2O A;  2YI1 A;  4JHD B;  1MWK A;  3WXK A;  1EQY A;  3ENH A;  1REV A;  3G4S N;  3D2F A;  4E7I A;  3P1G A;  2V52 B;  1WNS A;  3CM5 A;  1QQC A;  4GY2 B;  4B08 A;  5JLH A;  4ID5 A;  3SNN A;  3H46 O;  1EXQ A;  3CF5 L;  2HHU A;  4FPA A;  2YKM A;  4TSX A;  3RSE A;  4BRD A;  4CJ5 A;  4HUF A;  4IJA A;  1QSS A;  2B6A A;  1VQK N;  2GX9 A;  3ZSW A;  1SV5 A;  2G8F A;  1MU2 A;  4AM7 A;  5M1Q A;  4EIA A;  4EP4 A;  1UAX A;  3NH1 A;  2HMI A;  1ZBU A;  3KVG A;  3C65 A;  3TI0 A;  5CYQ A;  4DB3 A;  4OGC A;  4JK7 A;  4IBN A;  1GLJ O;  2BDP A;  2HNZ A;  4FJM A;  5AFU H;  5FPN A;  3D2F B;  1OH7 A;  4BE1 A;  3QFU A;  3J7Y P;  2RE2 A;  3OYI A;  4JKE A;  3THX A;  3ZSV A;  4M7X A;  1NJY A;  3RSE B;  3M8P A;  2X74 A;  3EKU A;  4CHN A;  3KK2 A;  3L2R A;  3AVC A;  1C0F A;  5FDL A;  5JS2 A;  1J53 A;  2I7N A;  5EX5 A;  4CJ4 A;  4Y0W A;  1W7A A;  4ISE A;  3T1H K;  4M3X A;  1QZ6 A;  4DU4 A;  4C8L A;  3SPY A;  4BRF A;  4JK9 A;  5KI6 A;  1G15 A;  1HJR A;  2KW4 A;  3KLI A;  2OCE A;  3LZJ A;  4CZK A;  4DFK A;  1Q18 A;  3DLH A;  1JLQ A;  4NYN A;  2YJF A;  1W2B M;  2WUS A;  4ISG A;  1E4G T;  4ZHR A;  2YCH A;  3NVM A;  4EFH A;  3CJ9 A;  4MFB A;  1NJI O;  1D9F A;  3BF1 A;  4N76 A;  2ZJP L;  2Q0R A;  1EWQ A;  3MXJ A;  2B5J A;  2GV9 A;  1NLV A;  2YNF A;  1C1B A;  5E26 A;  3RWU A;  1RBU A;  3G71 N;  3ZX0 A;  1YI2 N;  1GOA A;  3CFR A;  1RFQ A;  1RBS A;  3NHG A;  3ZSZ A;  4FCY A;  5AQX A;  5C42 A;  4FM0 A;  3VA0 A;  1WSG A;  5AQW A;  5F2R A;  3D45 A;  4CJK A;  3N4P A;  4F4K A;  3SI6 A;  4GV9 A;  1RDD A;  3C6H A;  1S6Q A;  5C2D A;  2Y1I A;  3OJU A;  3LAN A;  4CGI A;  3TTC A;  1LWC A;  3NBP A;  4RW9 A;  4AHR A;  2HHS A;  4K8X A;  4E1M A;  4GNI A;  2ZJQ L;  4CIE A;  1LW2 A;  4CEA A;  3AO4 A;  3LWM A;  1T7P A;  3LAL A;  2WTU A;  1H1V A;  3CCQ N;  2ZQB A;  3EE8 A;  4FWM A;  4FWS A;  4DLE A;  2PYJ A;  4V19 S;  3OYN A;  4OKJ A;  1K9M O;  4WYB A;  4DQS A;  2HW3 A;  4CJL A;  4FLZ A;  4IDH A;  3I56 N;  3IAY A;  4H8K A;  4QS8 A;  4CK2 A;  1UA1 A;  3CCE N;  4DR4 K;  5EY4 A;  3W3D A;  4DQI A;  4GKK K;  5ELZ A;  4LF8 K;  3ZSY A;  4JI3 K;  4XIU A;  3AVK A;  5M1P A;  4DV5 K;  3VGM A;  1Q81 O;  4RW8 A;  4Z4C A;  4K42 A;  4DTO A;  1IKY A;  4IJN A;  5KRS A;  3E9P A;  1BCO A;  4FM1 A;  1VSD A;  2O8F B;  4ELT A;  5AQN A;  3ISN C;  4M3U A;  3L4I A;  3LZI A;  4JKA A;  1VQL N;  1TK0 A;  1ZXO A;  3RTV A;  3DWL A;  2HF3 A;  3C94 A;  5LY3 A;  3AAQ A;  4PUO A;  4DMN A;  2XY7 A;  2W41 A;  4F8R A;  4J2E A;  1L3S A;  3MEC A;  1KC8 O;  3J8A A;  4R79 A;  3A8Y A;  2FSJ A;  1A5X A;  4A57 A;  1HRH A;  2D0P A;  5H1S Q;  5CZ1 A;  1Y64 A;  1JLF A;  3LPT A;  4C8N A;  4N41 A;  3PX6 A;  4GW6 A;  4GVE A;  4X66 K;  4CJT A;  4BY9 C;  4M3Z A;  2HHW A;  4H03 B;  1TAQ A;  4KTW A;  2E88 A;  3VQB A;  4JI7 K;  3M5R A;  4IO8 A;  3K58 A;  4FJ8 A;  1W9H A;  1P8Z A;  2P9S A;  4ELV A;  1NOY A;  2NRW A;  2PAV A;  3LM2 A;  4AHC A;  4CBU A;  1X1P A;  4B1V A;  3MMV A;  5AQM A;  3SQ2 A;  2X6N A;  3QML A;  4KB0 A;  3BY5 A;  3QEV A;  2D5R A;  5AQG A;  5BRH A;  4HWI A;  2V51 B;  3EEQ A;  3KD5 E;  3D6R A;  4CGH A;  1W0H A;  5BR8 K;  1XQS C;  3AGR A;  4GV3 A;  1GLD G;  1S9G A;  3M8R A;  2WFB A;  1UA0 A;  4A5B A;  1LAV A;  1YF5 L;  2HHV A;  1ASU A;  4AHS A;  2P9S B;  3EZW A;  2P9L A;  2BE2 A;  3O8M A;  3PIP L;  1WB9 A;  4QS9 A;  3U9Z A;  1LOT B;  3RMC A;  4CEZ A;  3S9H A;  3HM8 A;  2HBK A;  2YHY A;  3LP0 A;  1CXQ A;  4CHY A;  1U45 A;  5I3U A;  3THY A;  4CBW A;  4BG9 A;  4EHT A;  2YV0 X;  2Z1J A;  4JI1 K;  4B3M K;  4DFP A;  3CMA N;  4FLX A;  3TR8 A;  4AHU A;  4K8Z A;  3CHW A;  4FLY A;  4KPY A;  5SZT A;  3DOK A;  4N47 A;  4CEF A;  4RWT A;  5DM7 L;  3J81 O;  3H1Q A;  3SJH A;  3SZ2 A;  3NH2 A;  2NRH A;  1N5Y A;  3OYB A;  2IS3 A;  1V4T A;  4QAG A;  5HL7 L;  3HOT A;  4QOZ B;  1JKH A;  3THY B;  3K5M A;  3HK2 A;  4CFC A;  1IJJ A;  3QLH A;  3CC7 N;  3J7Z O;  3CET A;  1IG8 A;  3O9U A;  3NDK A;  3FZF A;  1NBW A;  3J80 O;  1X9M A;  1DTQ A;  4HCB A;  5I42 A;  1DT9 A;  4RTF D;  1Q82 O;  2QA4 N;  2NRR A;  4FK0 A;  3NF8 A;  2ATQ A;  5GAH P;  2VG7 A;  1NG9 A;  4CI6 A;  3D2E A;  4JLH A;  3DRP A;  4L3Q A;  4Z94 A;  3TWH A;  3KZB A;  3MN7 A;  3VQD A;  3OBY A;  4MDA A;  3A5O C;  5BR9 A;  2A1R A;  2I7P A;  2Q3S A;  4IO9 L;  4DV2 K;  1C0U A;  3QO9 A;  3V1R A;  4DSE A;  2P9K A;  3I0S A;  4BG8 A;  1ZBS A;  3VEO A;  1NM1 A;  1S3X A;  2PYL A;  3NE6 A;  3TU5 A;  4LFB K;  4PKI A;  1CZA N;  4HVJ A;  1RTD A;  3GL1 A;  4HHT A;  3D2E B;  4WF9 L;  3CQX A;  1U6Z A;  1TYQ B;  4H5V A;  1TAU A;  2YJE A;  4BE2 A;  3G10 A;  1CZ9 A;  2UXB K;  3CCS N;  3CCL N;  2P9K B;  3F9K A;  3SUN A;  1NGH A;  3K5O A;  3CJB A;  4CED A;  1XMO K;  3HO1 A;  1S1U A;  4JI5 K;  3H45 C;  3ZSR A;  1K6Y A;  4PHT X;  3CJ7 A;  3ZEU A;  3H6E A;  3PIO L;  5DM6 L;  3ZT2 A;  3NGY A;  4CZH A;  3AO1 A;  4OLB A;  4KHW A;  2G8H A;  3O4N A;  3ID6 A;  4JKG A;  1RDC A;  4H0Y B;  1VQO N;  3ZT4 A;  4DTJ A;  3R3L A;  4IG3 A;  4IOX A;  2I5J A;  2OA8 A;  3SQ0 A;  1WAF A;  1RBV A;  4LC9 B;  5KGW A;  1IH7 A;  3BZC A;  1BQN A;  1T03 A;  3IFR A;  3PX4 A;  5JS1 A;  2BTF A;  4CEO A;  2UUC K;  5J2N A;  1BDG A;  3ZEU B;  1X9S A;  4M3W A;  4HTL A;  2JGU A;  4CVN E;  3NH0 A;  4FZX C;  1JL1 A;  1S1T A;  4GVM A;  4BRC A;  1GLE G;  3KLF A;  2Q36 A;  3NVK A;  4JKG B;  1NK6 A;  3RMA A;  4A2B A;  4PA1 A;  1C6V A;  2DPN A;  5AQS A;  4FW2 A;  1TK5 A;  1IBL K;  2VGM A;  4F2S A;  2O8B A;  1KVC A;  3CQY A;  3ENB A;  1VAZ A;  4DTU A;  4KHP K;  4CFD A;  1U2V B;  4CFB A;  4CE9 A;  4M3Y A;  3AA5 X;  1C0G A;  3FZH A;  3HM9 A;  1VQP N;  1QSY A;  4FJ5 A;  4BRP A;  1U48 A;  3K59 A;  4CGG A;  1QQM A;  4JKF A;  3VTI A;  3OYJ A;  1NGG A;  4IEE A;  2YKN A;  4FZZ A;  3VGK A;  1ATS A;  5E41 A;  4MO5 A;  1S1X A;  2R7Y A;  2O8B B;  3WEE A;  4KH5 A;  1NU0 A;  4BGA A;  4BAC A;  2G8W A;  4DUY K;  3KLH A;  3A5M C;  4DQP A;  4O55 A;  3F73 A;  2CH6 A;  1TK8 A;  2NUB A;  1Z25 A;  4CHP A;  1WBB A;  2XY8 A;  2VGN A;  2FC0 A;  3NFA A;  1N8R O;  1BCM A;  4DV4 K;  5F1X A;  3NF9 A;  1XWL A;  1NK4 A;  4FVM A;  4ID1 A;  4B3O A;  5AQO A;  4GV6 A;  1RT3 A;  3PV8 A;  3IRX A;  2E4L A;  1VSF A;  3RRH A;  3VQ5 A;  4BR4 A;  3K5N A;  3WEE B;  4K43 A;  2W6K A;  3LDO A;  1CZB A;  4CF2 A;  2A42 A;  1C1C A;  4B8C A;  3L3V A;  2QWL A;  3R8E A;  4FWQ A;  3L6Q A;  2Q2R A;  1RCH A;  4OVL A;  5AZJ A;  1YUW A;  4FXD A;  4RCH A;  1QQO A;  1RTH A;  1WSE A;  2VCP A;  1NK8 A;  4KRE A;  2HHH K;  3LDN A;  3SUQ A;  5EVZ A;  3U4L A;  5CYM A;  4WQ4 C;  4F3T A;  4CF8 A;  3QIN A;  3BZK A;  5B8H A;  3B6O A;  2P51 A;  4DTS A;  3KJV A;  4JEP A;  1M1K O;  4JD2 A;  4W5O A;  1RTJ A;  3VEV A;  4BRK A;  5HP1 A;  1JJ2 M;  2CGL A;  1B9D A;  3A2F A;  1HNV A;  5AZJ B;  3O1W A;  2VQE K;  5HLF A;  2IDO A;  4BR0 A;  2JLE A;  4CJS A;  3MN9 A;  1S5J A;  1HYZ A;  4KKO A;  3ZSO A;  2IAJ A;  1SL2 A;  1CLQ A;  3M8Q A;  3O4Q A;  3CPW M;  2IOC A;  2OZM A;  2HVI A;  3A5L C;  3I55 N;  3OYA A;  4LFA K;  3CCU N;  4JD2 B;  3ATV A;  1NGF A;  5CZ2 A;  1J5O A;  4OPK A;  1GLL O;  1Z26 A;  1HJO A;  2CGJ A;  2GBZ A;  1ZC6 A;  2YHA A;  3CCM N;  3K9K A;  1WSF A;  4C8O A;  1WLJ A;  5GAD P;  3C6U A;  1KD1 O;  5F0X A;  3TTF A;  1BA0 A;  1VSJ A;  4KTZ A;  3J7A P;  3FZK A;  2O4I A;  3LP3 A;  2BUP A;  4JI0 K;  1KAX A;  3E66 A;  4B1Z A;  4YNQ A;  1M90 O;  4JKB A;  2E20 A;  4I9L A;  4WQ4 A;  2VG5 A;  1WSJ A;  5KPT A;  4EAH D;  3THX B;  4B9M A;  1OKJ A;  2E1Y A;  4CJQ A;  1BUP A;  3L3U A;  4QS7 A;  4ILJ A;  3BGR A;  4Z4E A;  4DR7 K;  4CJ3 A;  3VN5 A;  4I7F A;  4DTP A;  3TAM A;  3L2V A;  1S6P A;  3NF6 A;  2FBY A;  5DK5 A;  4BRL A;  4CJ7 A;  5CE3 A;  4JNE A;  1BI4 A;  3WNF A;  3EY1 A;  4MLE A;  4EHU A;  3SK3 A;  1HMV A;  4H4O A;  2A41 A;  3HOS A;  2OTJ N;  4DLG A;  4JI6 K;  4MO4 A;  1JLE A;  2Q0U A;  3HPG A;  4I2P A;  4E7H A;  3F9M A;  4CW7 B;  2RN2 A;  3CFO A;  5KRT A;  4E1N A;  2G8I A;  4AH9 A;  4BRI A;  1Q9Y A;  1ZBH A;  2F7T A;  2QWR A;  3CJ1 A;  3OYK A;  3CC2 N;  3UIQ A;  1BIZ A;  2V7Y A;  4N56 A;  1HKB A;  4XH1 A;  3CER A;  2NNW A;  3DLG A;  3QFP A;  4WFB L;  3ULD A;  3DOL A;  2Z1H A;  3DLR A;  3TAN A;  1QQN A;  5AQV A;  4IXC A;  4YHH K;  4H0X B;  5AQJ A;  4E3S A;  3SCX A;  4X64 K;  3THV A;  3ZSQ A;  5GIP A;  3GE1 A;  3L2U A;  1YXQ A;  5KGX A;  3U9D A;  5GAE P;  3SQ1 A;  4NLB A;  5D3G A;  2HNY A;  4BR5 A;  3OY9 A;  3OS0 A;  4LF6 K;  4JS5 A;  2DTU A;  3F5T A;  2HHT A;  5K14 A;  3DAW A;  4JI4 K;  1SS6 A;  4B9N A;  4O0I A;  4CJE A;  4B9U A;  5JVH L;  1NOZ A;  5CHI A;  2CGK A;  2D4W A;  4KAZ A;  3ZYY X;  1A5V A;  4FWL A;  4O4G A;  2RKI A;  1YIJ N;  4A62 A;  1DGK N;  4KHQ A;  3SAH A;  1EO1 A;  4FL9 A;  3T3F A;  3V81 A;  4CF9 A;  1BIS A;  4BQZ A;  4KI4 A;  3VQ4 A;  1C0T A;  4H5N A;  4CIF A;  4KHY A;  4IZ9 A;  3SBT A;  2ZE2 A;  3MAQ A;  3K9J A;  2F9W A;  1TUY A;  4DSI A;  3AVA A;  2A40 A;  3WXL A;  3IKM A;  3CXC M;  2HB5 A;  3RVC A;  1K8A O;  3O3G A;  1NGC A;  4ZTF A;  3T1Y K;  4N5S A;  4W5Q A;  1OVY A;  3HSC A;  1VSM A;  3TAR A;  1YJ9 N;  5BN8 A;  4IDK A;  1EWR A;  2PBD A;  4FVU A;  3AVN A;  1EKE A;  3K57 A;  1VQ9 N;  1JCE A;  3TTD A;  4CJU A;  3VF4 A;  3QBW A;  3HZ6 A;  1HNZ K;  1RBR A;  4CEC A;  2QM1 A;  1U49 A;  1Q86 O;  4B9T A;  4BR7 A;  4JRP A;  5SWM A;  2D0B A;  3H3N O;  1YTA A;  4FYD A;  4E1J A;  5C25 A;  3VGL A;  5AQY A;  1G99 A;  5C10 A;  4U7B A;  2RHK A;  5M1N A;  3QDK A;  2RPI A;  1GLC G;  3RMB A;  3VQ9 A;  3QBX A;  4ICL A;  3O5B A;  2O8C A;  2Y1J A;  4DS4 A;  5GAG P;  1MA9 B;  3WQT A;  3I8B A;  2QKK A;  4FJL A;  3OVN A;  1VQM N;  1RDA A;  5J2P A;  1NMD A;  3VQP A;  3HJF A;  3K2P A;  4I6M A;  3LWL A;  3QIO A;  2IVP A;  4E7K A;  1ESV A;  3AA4 A;  3LDQ A;  4KO0 A;  1Z05 A;  3OHR A;  3I33 A;  3OBW A;  4ZTJ A;  1KVB A;  3WNH A;  3P31 A;  2E2P A;  1QE1 A;  3ALY A;  2G8U A;  2E5L K;  3UKU A;  4ILG B;  3C6A A;  4H0O A;  3AO3 A;  3L4Q A;  4NCG A;  2Z1I A;  3QEP A;  4OLA A;  4CHZ A;  3MX5 A;  1ZBL A;  3EYZ A;  1E3M A;  2IVO A;  4DU3 A;  4JN4 A;  4OO1 J;  3KWI A;  3LDL A;  3QIP A;  4I6M B;  4OX9 K;  4IWV A;  5LL6 Z;  4DKW A;  4EZ6 A;  2AJQ A;  3HXM A;  4CZG A;  5GIO A;  1GOB A;  3LAK A;  4CK3 A;  4LD0 A;  4H0P A;  3GDQ A;  2DFH A;  3U8X A;  1MDU B;  5TKY A;  1BA1 A;  4GKJ K;  2P9L B;  4EP5 A;  3UKU B;  1IKX A;  4H0T B;  4FJG A;  3P5J A;  5E84 A;  1VRU A;  3ITH A;  2NRZ A;  3N4Q A;  4BWM A;  3S3O A;  1LW0 A;  3GOI A;  3MCP A;  3VEX A;  4FOE A;  5JVG L;  1WSI A;  1YTU A;  1NK9 A;  1VQ8 N;  5KQD A;  4B9V A;  4W5N A;  4NO7 A;  1YJN N;  4CBX A;  4WFA L;  3O3H A;  4LF4 K;  4Z0U A;  3MEE A;  3I0R A;  2OPP A;  2QTD A;  3FR0 A;  3CM6 A;  4FLV A;  1P90 A;  4O5F A;  3KWG A;  2ZM6 K;  4H4M A;  5FPE A;  1VSI A;  4B9Q A;  4F9O A;  3WXI A;  2P9N A;  2QWQ A;  3O6W A;  4DU1 A;  3VET A;  4CGD A;  4HUE A;  2UUB K;  3BEX A;  1IKW A;  3GBT A;  4YOX A;  1EX4 A;  3WT0 A;  3AAP A;  2IGI A;  3AO2 A;  3O9S A;  1TKT A;  1X3N A;  4CJR A;  3Q7B A;  4KBO A;  3OS2 A;  3VES A;  1N36 K;  4CF0 A;  1N33 K;  1L3V A;  1KCF A;  2DFF A;  4DV0 K;  3VQQ A;  5HRO A;  1JLB A;  3HPH A;  1HPZ A;  2GWK A;  3K0S A;  1HUX A;  1GLF O;  3UE5 A;  4H5W A;  3OYD A;  3O9R A;  4FWP A;  1SZ2 A;  1IO2 A;  4W5T A;  4DSK A;  3EL2 A;  2P9N B;  3RRG A;  3LP2 A;  3C6T A;  1N6Q A;  2FXU A;  3VQ7 A;  2AA4 A;  4CER A;  4AIL C;  3NGZ A;  5ADX A;  1J5E K;  2QXF A;  3SAF A;  4BDY A;  2E2N A;  1BGX T;  2ZGZ A;  2HMP A;  4AM6 A;  3VEY A;  3ZSX A;  1QHA A;  1QZ5 A;  5FLX O;  4L8R B;  1TL1 A;  4CZJ A;  1TUU A;  1S1W A;  3EN9 A;  1IBK K;  2WBN A;  3DXK A;  3A0I X;  1BU6 O;  5AQL A;  4PKH A;  2OYQ A;  3MDQ A;  4FJX A;  1X3M A;  4B1X B;  5FRO A;  2A3Z A;  3DLK A;  3ZX3 A;  4DR2 K;  4B3T K;  4FJK A;  3LL3 A;  2ASP A;  1R59 O;  1FKO A;  3TSQ A;  2QKB A;  4UY8 O;  3AVJ A;  5FRN A;  4H0V B;  2GEM A;  1JCG A;  1TKZ A;  3BP8 A;  1VQ7 N;  1J6Z A;  1NKE A;  3SAG A;  4IFE A;  1LWF A;  2BAN A;  1SAZ A;  4NXM K;  3DXK B;  4C23 A;  2O8D A;  3MX2 A;  5AFU A;  2J4R A;  1OH8 A;  2UUA K;  3EZ5 A;  4KTQ A;  1RBT A;  1J54 A;  3VEZ A;  2QK9 A;  1KQS M;  4LF5 K;  1ZBF A;  3DI6 A;  3M6G A;  2KTQ A;  3OTO K;  4QCL A;  2F96 A;  3Q7C A;  4KFB A;  2D0O A;  2P9P A;  4Z4F A;  1BHL A;  1KXP A;  3IDH A;  3WQU A;  4E19 A;  5C15 A;  3LP1 A;  3AVI A;  4G9Z A;  4Q5V A;  1RDU A;  2ASO A;  4YOU A;  2ITG A;  3LAM A;  5FPD A;  2BH1 A;  2Q31 A;  2KKZ A;  1ZYQ A;  3CJA A;  2VG6 A;  1S1V A;  1HNX K; 
#chains in the Genus database with same CATH homology
 1IKY A;  4HCC A;  5KRS A;  5CZ2 A;  1J5O A;  3CYM A;  1BCO A;  4OPK A;  1Z26 A;  4FM1 A;  3PO4 A;  1VSD A;  4ELT A;  3C95 A;  2F8T A;  4CK1 A;  2GBZ A;  4RG8 A;  3DLB A;  3ISN C;  2FBX A;  4DTX A;  4M3U A;  1DTT A;  3LZI A;  1HYS A;  2PZS A;  4M3R A;  2YHA A;  2G8V A;  1I39 A;  1RTI A;  1WSF A;  1TK0 A;  1NKB A;  4C8O A;  3RTV A;  1ASV A;  1WLJ A;  3C94 A;  1QHT A;  4OKE A;  4CHO A;  4FJJ A;  3C6U A;  4LH5 A;  2HHX A;  4PUO A;  4DMN A;  3OYL A;  5C24 A;  2XY7 A;  1SL0 A;  2G8K A;  4I9Q A;  1VSJ A;  4KTZ A;  3L2W A;  4F8R A;  4J2E A;  4NCA A;  1ITG A;  2W42 A;  2O4I A;  3LP3 A;  3V6D A;  4O44 A;  5HRP A;  1L3S A;  1VSL A;  3MEC A;  4CGJ A;  5J2M A;  4YNQ A;  3OYC A;  2FBV A;  3M8S A;  1KRP A;  3FFI A;  4AHV A;  1BQM A;  2WOM A;  1A5X A;  1HRH A;  4I9L A;  5HBM A;  4HTU A;  1RDB A;  1WSJ A;  2VG5 A;  5CZ1 A;  1JLF A;  3LPT A;  4C8N A;  4KB1 A;  4N41 A;  4CJW A;  3WNG A;  3PX6 A;  1TGO A;  2EX3 A;  4B9M A;  4GW6 A;  3VQA A;  4DSJ A;  3HST B;  4E89 A;  1J9A A;  4CJQ A;  4IFV A;  3V1O A;  3L3U A;  4IFY A;  3CFP A;  4CJT A;  1QS4 A;  3U3Y A;  3BGR A;  1NK5 A;  4M3Z A;  2HHW A;  4CES A;  3NGI A;  4Z4E A;  3I8D A;  1QSL A;  4CJ3 A;  3VN5 A;  4I7F A;  4DTP A;  4NYF A;  3QNO A;  1TAQ A;  4KTW A;  4LSN A;  3TAM A;  3VQB A;  3L2V A;  1Q9X A;  2HVH A;  2O4G A;  1JL2 A;  2OPQ A;  1S6P A;  3NF6 A;  1BIU A;  3K58 A;  2FBY A;  5DK5 A;  4FJ8 A;  4O5B A;  1FKP A;  1W9H A;  4DSF A;  1VSH A;  3VQC A;  4Z4H A;  1HQE A;  3DRS A;  4JS4 A;  4ELV A;  1BI4 A;  3AVG A;  3WNF A;  3EY1 A;  1NOY A;  1HMV A;  4AHC A;  3G0Z A;  4H4O A;  3SPZ A;  4CCH A;  1C0M A;  1X1P A;  4DLG A;  4HUG A;  1JLE A;  4I2P A;  3HPG A;  2ZD1 A;  4E7H A;  3SQ2 A;  2RN2 A;  2X6N A;  3AVF A;  3CFO A;  5KRT A;  2F8S A;  4KB0 A;  1VRT A;  3ASM A;  1DLO A;  4AH9 A;  4E1N A;  2VWJ A;  2G8I A;  4BE0 A;  3QEV A;  1C1A A;  4KV8 A;  1Q9Y A;  1ZBH A;  2D5R A;  4FLW A;  4DTM A;  2XO7 A;  1ZBI A;  1XHX A;  2KQ2 A;  1T05 A;  3AA2 A;  3KD5 E;  3OYK A;  1F21 A;  4CGH A;  1W0H A;  3UIQ A;  4RW7 A;  1U4B A;  1BIZ A;  3PY8 A;  1S9G A;  3M8R A;  3KLE A;  3P83 D;  3E01 A;  3MED A;  4N56 A;  2E6L A;  1UA0 A;  4CEE A;  1L3T A;  1Q8I A;  1YVU A;  1LAV A;  3KKS A;  2A1S A;  3DLG A;  2DY4 A;  1TVR A;  3V9U A;  2HHV A;  1ASU A;  4AHS A;  1NJX A;  1EP4 A;  3ULD A;  3RMD A;  4C8K A;  2BE2 A;  3DOL A;  3KIO A;  2Z1H A;  3DLR A;  4CJP A;  3TAN A;  4PQU A;  4JRQ A;  1UWB A;  3RR8 A;  2HND A;  3RMC A;  4E3S A;  1BL3 A;  4CEZ A;  3DLE A;  3SCX A;  3S9H A;  3THV A;  3RR7 A;  3ZSQ A;  3QES A;  3TAF A;  1WAJ A;  3L2U A;  3LP0 A;  1XI1 A;  5KGX A;  1CXQ A;  1L3U A;  5FRM A;  1KFD A;  3SQ1 A;  1R0A A;  5D3G A;  2HNY A;  4CHY A;  1U45 A;  5I3U A;  3QEW A;  3V9S A;  3QER A;  3OY9 A;  4LY7 A;  3OS0 A;  4JS5 A;  2YV0 X;  2DTU A;  1LV5 A;  1O1W A;  2Z1J A;  1JLA A;  2HHT A;  3T19 A;  5K14 A;  2YNH A;  1U47 A;  2DFE A;  3KTQ A;  4FJH A;  4DFP A;  2ETJ A;  4Z4I A;  4B9N A;  4O0I A;  4FLX A;  2XY6 A;  1CXU A;  3TR8 A;  4AHU A;  1RNH A;  4K8Z A;  4CJE A;  4LSL A;  1SKW A;  2D0A A;  2FBT A;  4B9U A;  1SL1 A;  1NOZ A;  2P5G A;  1D9D A;  1ASW A;  4FLY A;  4J2D A;  5SZT A;  4KPY A;  3OYM A;  1D5A A;  3DOK A;  4N47 A;  4CEF A;  3NAE A;  4KAZ A;  1IKV A;  3S3N A;  3SZ2 A;  4F2R A;  3HYF A;  3NH2 A;  1A5V A;  1L5U A;  1RT2 A;  3KK3 A;  4O4G A;  1N5Y A;  2RKI A;  3KKR A;  3ZT0 A;  3AO5 A;  3OYB A;  2IS3 A;  3T1A A;  4KHQ A;  3CG7 A;  4QAG A;  4DWI A;  4NCB A;  1SUQ A;  4QOZ B;  3T3F A;  3HVT A;  3V81 A;  4CF9 A;  1BIS A;  1JKH A;  4KI4 A;  3VQ4 A;  3K5M A;  1C0T A;  1VSK A;  4DTN A;  4Z4G A;  4KHU A;  1U04 A;  3HK2 A;  4CIF A;  4KHS A;  4CFC A;  4FK4 A;  1JLG A;  3QLH A;  4KHY A;  2ZE2 A;  3MAQ A;  4KHN A;  3AV9 A;  4DSI A;  3AVA A;  4FW1 A;  3OYE A;  4E7J A;  4M41 A;  3SV4 A;  3NDK A;  1KLN A;  4PY5 A;  2KFZ A;  3PUF A;  2HB5 A;  1Y97 A;  3O3G A;  3OS1 A;  1RIL A;  2LSN A;  3QET A;  4IKF A;  4ZTF A;  4OKK A;  1X9M A;  1DTQ A;  4N5S A;  4HCB A;  5I42 A;  4W5Q A;  1FXX A;  5J1E A;  3SJJ A;  1VSM A;  3TAR A;  4CEQ A;  4FK0 A;  3NF8 A;  2ATQ A;  2VG7 A;  4IDK A;  3DMJ A;  3L2Q A;  3NF7 A;  4JLH A;  1RT4 A;  3DRP A;  4DQR A;  4BDZ A;  3TWH A;  1T8E A;  4C8M A;  3AVN A;  3VQD A;  4CIG A;  1EKE A;  3K57 A;  2KZZ A;  4M42 A;  1NK7 A;  1IG9 A;  2A1R A;  4CJU A;  2Q3S A;  3SUO A;  3MXM A;  1C0U A;  3AVM A;  3TAE A;  1I3A A;  4MQ3 A;  4BWJ A;  1SKR A;  2OZS A;  1RBR A;  3QO9 A;  3V1R A;  4OJR A;  4CEC A;  3V9X A;  4DSE A;  1U49 A;  3HP9 A;  1HQU A;  4B9T A;  3I0S A;  4JRP A;  4E0D A;  5SWM A;  2D0B A;  3AVB A;  1KVA A;  1YTA A;  3S3M A;  4FYD A;  5C25 A;  1QTM A;  1VK0 A;  2PYL A;  3WNE A;  3NE6 A;  1NK0 A;  1GOC A;  2P5O A;  3OYH A;  4DF8 A;  4DFJ A;  1UOC A;  2RPI A;  5HRN A;  4G1Q A;  3D0P A;  3RMB A;  3VQ9 A;  4HVJ A;  1RTD A;  4FJ7 A;  4YFU A;  3V9W A;  4FM2 A;  1XHZ A;  4HHT A;  4DSL A;  4ICL A;  1RT5 A;  1VSE A;  4DS5 A;  1JLC A;  2Y1J A;  1TAU A;  4DS4 A;  4FJL A;  2QKK A;  4ELU A;  3AA3 A;  3DM2 A;  3OVN A;  3G10 A;  4BE2 A;  1RDA A;  3HPO A;  1CZ9 A;  1TKD A;  4RW4 A;  5J2P A;  3VQP A;  3HJF A;  2VWK A;  4PWD A;  3K2P A;  4W5R A;  1EET A;  3LWL A;  4F3O A;  3QIO A;  5HRR A;  4E7K A;  3AA4 A;  3F9K A;  1A5W A;  4KO0 A;  1KTQ A;  3SUN A;  1LAW A;  4FJ9 A;  3V1Q A;  3VQ8 A;  3K5O A;  4CED A;  1KVB A;  4ZTJ A;  1XC9 A;  3WNH A;  1SKS A;  3HO1 A;  3AVH A;  3SQ4 A;  1QE1 A;  3ALY A;  3KK1 A;  3TAB A;  1NKC A;  2G8U A;  3SV3 A;  2XHB A;  1S1U A;  1BI4 B;  3ZSR A;  4CEB A;  1K6Y A;  1WSH A;  1KSP A;  4J2A A;  2XRI A;  3AO3 A;  3ZT2 A;  5CY4 A;  5J2Q A;  4NCG A;  2Z1I A;  3NGY A;  3QEP A;  4OLA A;  3AO1 A;  2YHB A;  3ZCM A;  5KTQ A;  4Y1C A;  4OLB A;  4KHW A;  2G8H A;  4CHZ A;  3O4N A;  4IG0 A;  4CFA A;  4FLT A;  1ZBL A;  3EYZ A;  3B6P A;  1RDC A;  3HT3 A;  1HYV A;  4DU3 A;  3OJS A;  3K5L A;  4LH4 A;  3ZT4 A;  1JXE A;  3QIP A;  4DTJ A;  4CJF A;  1KLM A;  4IG3 A;  1TV6 A;  4EZ6 A;  4OGE A;  2AJQ A;  1TL3 A;  3HXM A;  4R5P A;  2I5J A;  2OA8 A;  1GOB A;  3SQ0 A;  3IG1 A;  3LAK A;  2RF2 A;  1S9E A;  3JSM A;  4E7L A;  1WAF A;  3MXI A;  4CK3 A;  4LD0 A;  1RBV A;  5KGW A;  1IH7 A;  2DFH A;  4AHT A;  4KRF A;  3DYA A;  1BQN A;  1REV A;  1T03 A;  4E7I A;  3P1G A;  3PX4 A;  5JS1 A;  1WNS A;  3CM5 A;  1QQC A;  4Q0B A;  4B08 A;  4EP5 A;  1IKX A;  4ID5 A;  4CEO A;  3P5J A;  5J2N A;  3SNN A;  2HMI A;  4FJG A;  1EXQ A;  1X9S A;  1VRU A;  1YT3 A;  3ITH A;  4M3W A;  2HHU A;  4CHQ A;  2JGU A;  4Y1D A;  3NH0 A;  4FZX C;  4BWM A;  2YKM A;  1RT1 A;  1JL1 A;  1LW0 A;  1S1T A;  4GVM A;  4TSX A;  4CJ5 A;  4HUF A;  3KLF A;  3S3O A;  1NJZ A;  1FK9 A;  1QSS A;  2B6A A;  1WSI A;  4EZ9 A;  3ZSW A;  1NK6 A;  1SV5 A;  2G8F A;  1YTU A;  3RMA A;  3L8B A;  1NK9 A;  4PA1 A;  1C6V A;  1MU2 A;  4B9V A;  4W5N A;  3QEX A;  4EP4 A;  3NCI A;  1RT7 A;  4CF1 A;  3LDS A;  1UAX A;  2IC3 A;  4FW2 A;  3NH1 A;  1ZBU A;  2YNI A;  3O3H A;  1TKX A;  3OYF A;  3TI0 A;  1TK5 A;  5CYQ A;  4Z0U A;  3MEE A;  4F2S A;  2BGG A;  1KVC A;  3I0R A;  4OGC A;  4DTR A;  4B9L A;  4IBN A;  2OPP A;  4DTU A;  2BDP A;  3CM6 A;  2HNZ A;  4FJM A;  1NJW A;  4CFD A;  4FLV A;  4CFB A;  4BE1 A;  2X6S A;  4FJN A;  3HL8 A;  4CE9 A;  3TAQ A;  2XY5 A;  5EU7 A;  3SYZ A;  4H4M A;  3OYI A;  3HVR A;  1B9F A;  1VSI A;  3VQE A;  3ZSV A;  4M3Y A;  4M45 A;  3AA5 X;  1NJY A;  2EHG A;  3AVL A;  3HM9 A;  3M8P A;  2X74 A;  4CHN A;  3KK2 A;  1QSY A;  3L2R A;  4DU1 A;  4FJ5 A;  4CGD A;  4HUE A;  3AVC A;  2Z1G A;  1U48 A;  1IKW A;  5FDL A;  3K59 A;  5JS2 A;  1J53 A;  4CGG A;  3LPU A;  1EX4 A;  5DMR A;  3OYJ A;  4FK2 A;  3AO2 A;  2IGI A;  4CJ4 A;  1TKT A;  3V9Z A;  2YKN A;  4FJI A;  4FZZ A;  2OPR A;  4CJR A;  4DFM A;  3PO5 A;  3OS2 A;  5E41 A;  4GMJ B;  1WN7 A;  1S1X A;  4M3X A;  2R7Y A;  4CF0 A;  4DU4 A;  4DF4 A;  4M3T A;  1L3V A;  4C8L A;  2YNG A;  1KCF A;  2DFF A;  4BAC A;  3KLH A;  3TAG A;  2G8W A;  3VQQ A;  3SPY A;  4DQP A;  4DG1 A;  5HRO A;  4O55 A;  1D8Y A;  1JLB A;  1G15 A;  1HJR A;  2GUI A;  2KW4 A;  1HPZ A;  3HPH A;  3KLI A;  5KI6 A;  3F73 A;  3LZJ A;  4DFK A;  1TK8 A;  3DLH A;  4FZY A;  2NUB A;  1Z25 A;  4CHP A;  1JLQ A;  4NYN A;  3OYD A;  2XY8 A;  4W5T A;  1IO2 A;  4DSK A;  3ZT3 A;  3KLG A;  4ZHR A;  3RRG A;  3LP2 A;  3C6T A;  2FC0 A;  1N6Q A;  3NFA A;  4MFB A;  1D9F A;  3VQ7 A;  1BCM A;  4CER A;  4N76 A;  4AIL C;  3NGZ A;  5HRS A;  3NF9 A;  1XWL A;  1NK4 A;  4FVM A;  4ID1 A;  2QXF A;  4O0J A;  4FLU A;  3VQ6 A;  4B3O A;  2D0C A;  1KFS A;  1RT3 A;  4BDY A;  3MXJ A;  2B5J A;  2GV9 A;  4WE1 A;  3ZT1 A;  3PV8 A;  4KI6 A;  1BGX T;  2YNF A;  3IRX A;  2E4L A;  1C1B A;  1VSF A;  3RRH A;  3VQ5 A;  3RWU A;  1RBU A;  3ZSX A;  3PX0 A;  3K5N A;  3CQ8 A;  1TL1 A;  4L8R B;  2P1J A;  1S1W A;  1GOA A;  3CFR A;  3MEG A;  1JXB A;  1RBS A;  3V4I A;  3NHG A;  3ZSZ A;  4J2B A;  4FCY A;  5C42 A;  1CZB A;  4CF2 A;  1C1C A;  4B8C A;  3L3V A;  4FM0 A;  3VA0 A;  2OYQ A;  4FJX A;  1WSG A;  2OPS A;  5FRO A;  3QNN A;  3D45 A;  3DLK A;  2KFN A;  4CJK A;  4F4K A;  4FJK A;  3SI6 A;  1RCH A;  1RDD A;  4OVL A;  3IS9 A;  4RW6 A;  4FXD A;  1S6Q A;  2PY5 A;  1RTH A;  1WSE A;  1NK8 A;  2Y1I A;  3KD1 E;  1FKO A;  5T7B A;  2QKB A;  3OJU A;  3LAN A;  4CGI A;  4KRE A;  4UQG A;  3SUQ A;  2X78 A;  1LWC A;  3AVJ A;  3NBP A;  4RW9 A;  4AHR A;  3OYG A;  5FRN A;  2HHS A;  4K8X A;  4E1M A;  5CYM A;  1TKZ A;  4CIE A;  1LW2 A;  4F3T A;  4CEA A;  3AO4 A;  4CF8 A;  3LWM A;  1NKE A;  1T7P A;  3LAL A;  3VA3 A;  1RT6 A;  1LWF A;  3QIN A;  4I2Q A;  4CGF A;  2BAN A;  3JYT A;  3B6O A;  2WON A;  2ZQB A;  2P51 A;  4DTS A;  3KJV A;  4CJV A;  4DLE A;  3QEI A;  2PYJ A;  4OPJ A;  4BDP A;  4W5O A;  3OYN A;  1RTJ A;  4OKJ A;  3EZ5 A;  4KTQ A;  5HP1 A;  1RBT A;  3DRR A;  1J54 A;  4DQS A;  3HP6 A;  2QK9 A;  3U6F A;  2HW3 A;  1B9D A;  3A2F A;  1LWE A;  1HNV A;  4CJL A;  3SUP A;  4FLZ A;  3BDP A;  3IAY A;  2KTQ A;  1ZBF A;  3DI6 A;  5HLF A;  2HHQ A;  4H8K A;  2IDO A;  4QCL A;  4B9S A;  2JLE A;  3U3G A;  4CJS A;  2F96 A;  3O3F A;  4CK2 A;  1UA1 A;  1S5J A;  4KFB A;  1HYZ A;  4KKO A;  2KZM A;  1X9W A;  1B92 A;  4Z4F A;  1BHL A;  3ZSO A;  2E6M A;  2IAJ A;  1HNI A;  4DQI A;  3ZSY A;  4E19 A;  3LP1 A;  1SL2 A;  2B4J A;  1CLQ A;  3M8Q A;  3AVI A;  4Q5V A;  4XIU A;  3O4Q A;  2ITG A;  3AVK A;  3LAM A;  2IOC A;  2OZM A;  2HVI A;  4B8A B;  4RW8 A;  4Z4C A;  3H08 A;  3OYA A;  3TAP A;  4DQQ A;  1ZYQ A;  4DTO A;  2VG6 A;  1S1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...