4LY7A

Ancestral rnase h
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
153
structure length
153
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYKQHEKTFSAGFHLTTNNRMELMAAIVALESLKQPCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAAIQRHTINWKWVKGHAGHPENERCDELARTAAESPTLEDVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease H
publication title Thermodynamic system drift in protein evolution.
pubmed doi rcsb
source organism Unidentified
total genus 50
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2013-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ly7A00
3AV9A 3T1AA 4O44A 3OY9A 2P5GA 4IKFA 4CEZA 3B6OA 4BDZA 3PUFA 2RF2A 3ZT1A 2PYJA 3NFAA 3QIOA 5C42A 3NE6A 4B9MA 3QESA 5CYQA 1F21A 1HJRA 1LV5A 4B3OA 4CJFA 3CQ8A 3V9WA 3SUOA 2X6SA 4Z0UA 4F4KA 3VQPA 2QKKA 1KTQA 2ETJA 4J2AA 2JGUA 3VQ7A 1QSSA 4EP5A 3PX0A 3CYMA 1RCHA 4H4OA 3M8PA 3OYGA 1KVBA 2P1JA 3OYJA 1HYZA 2XY8A 5HLFA 4DSKA 2R7YA 4CIGA 4FJHA 3LAMA 4CEAA 1JLAA 4JLHA 3OYLA 2KTQA 1RDAA 1ZBFA 4WE1A 4BE1A 3AVLA 1S9EA 2IC3A 1TK5A 1S1VA 2HHWA 3DRRA 1BISA 4CFCA 4OVLA 5HRNA 3DLHA 1WNSA 2YNGA 3DMJA 4N47A 3VQ9A 4FJJA 4KFBA 5FROA 4K8ZA 2XY7A 1JXBA 1Q8IA 3AVKA 3HL8A 4CJSA 4DFJA 3TAFA 1L3UA 4Z4GA 1A5WA 1BL3A 1EXQA 2XHBA 1UA0A 1U04A 3VQQA 1J9AA 4CFBA 1ZYQA 4FM2A 3PV8A 1WSEA 4ID1A 1S6QA 2WOMA 1S1WA 2VWKA 4H4MA 1WAFA 3M8SA 4HUGA 1HQEA 4KV8A 3O4NA 4OGEA 3TARA 4E19A 5KTQA 4FLXA 3HPGA 3CFOA 3KIOA 1L3TA 3PY8A 2HHSA 4FCYA 1CXUA 4G1QA 4CEQA 2PY5A 4KB0A 3ITHA 3V81A 4FYDA 1IO2A 1VSFA 4KHYA 3NGYA 3O4QA 2OPRA 4OLAA 1A5VA 3V6DA 4N41A 4NCGA 1KLNA 1TKZA 1LAWA 1KFSA 4AILC 1J54A 1RTJA 1BI4A 2YHAA 4DF8A 1C1AA 4Y1CA 4J2BA 3G10A 1W9HA 3HP9A 1D5AA 4O5BA 4CF8A 3OS0A 3DRPA 4JS4A 3ZSWA 4DMNA 3V9SA 4B9SA 5CYMA 4XIUA 4NYNA 2HW3A 3AVHA 1XWLA 1RBRA 5HRRA 4DTMA 4CJ3A 3NH0A 3KKRA 3AO5A 4OPKA 1VSLA 4RW9A 3KLGA 3L3VA 3RRGA 4KTQA 3P5JA 2IOCA 4CFAA 3NHGA 4JS5A 4FK2A 4DU1A 5J2QA 1T03A 2HNDA 3AVCA 3WNEA 5SWMA 2BGGA 1RDCA 1Z25A 3OYNA 4DQRA 1BI4B 1IKWA 2OPPA 1ASVA 2RKIA 1TKDA 4O4GA 1FXXA 1NK6A 4I2QA 1RT4A 2XO7A 4OGCA 1K6YA 3AVNA 4YNQA 3DLEA 4E1MA 2HHUA 3L2VA 4KTZA 4KHNA 3QIPA 3SNNA 1J53A 1LW0A 1ZBUA 4GW6A 4O0IA 1NOYA 3RMBA 1U4BA 1ASWA 3PO5A 4BWJA 5CZ2A 1JXEA 1W0HA 3PO4A 2B4JA 1Z26A 2O4IA 3U3GA 4GVMA 1LWEA 3V4IA 4FW1A 3V1QA 4GMJB 4FXDA 2OYQA 2O4GA 4M3UA 3MXMA 3K57A 4HTUA 4CJLA 3PX4A 3AVMA 2D0AA 4Y1DA 2FBXA 1S1XA 1UOCA 2HNYA 4HVJA 4DF4A 3CFPA 1JKHA 4KHWA 1RT2A 1VSMA 1KLMA 1UA1A 1YVUA 5HROA 1NOZA 4KHUA 2JLEA 5J2MA 4FJ7A 4M3XA 1LW2A 3LP0A 3ZT2A 3AVAA 4FJGA 3LP2A 1ZBIA 3HXMA 4BE2A 3IAYA 3RMCA 4HCCA 4CJUA 1DLOA 5D3GA 1YTUA 3NH2A 1WAJA 3VQ5A 3FFIA 3AO2A 3WNGA 3LAKA 3KLHA 3TAGA 4C8OA 4FJ9A 2HHVA 1R0AA 2KQ2A 1C1CA 2YV0X 3DLGA 1S1TA 3C95A 3RTVA 4IG0A 4HUFA 3TAQA 3E01A 3V9UA 4YFUA 3KK1A 3HSTB 4CGJA 1L5UA 2HHQA 3CM5A 3H08A 4F3TA 4M3WA 4DSEA 4Q0BA 4E7LA 4CEDA 4TSXA 3D0PA 4DFKA 1TGOA 4CJKA 4Z4EA 4IFVA 4BACA 4FK4A 5CY4A 1U49A 3QO9A 1VSJA 4DWIA 3PX6A 4H8KA 4FLTA 3OYBA 1B9DA 2G8VA 2ZQBA 3OYMA 2KFNA 5J1EA 4FLYA 2Z1JA 4CK2A 2YNHA 4B8CA 1NK5A 4CE9A 4HUEA 2DFHA 3EY1A 3NDKA 4N56A 2ATQA 3DOLA 1DTTA 1YT3A 3HYFA 2VG7A 3C6UA 1RT5A 4LY7A 4JRPA 4FJLA 1KVAA 1IKYA 3AO3A 4KKOA 3IRXA 3TAMA 1T8EA 1RILA 3K2PA 4CERA 4CFDA 3RRHA 5DMRA 4C8MA 1QSLA 3CG7A 4E3SA 5KRTA 1G15A 4OLBA 1HNIA 1WSHA 1QHTA 3S9HA 2DTUA 4KI6A 1S5JA 4CGIA 2FBVA 3ASMA 2IGIA 4KTWA 1ZBLA 1FK9A 4NYFA 3T3FA 2Y1IA 4IBNA 4E0DA 2X78A 3HP6A 4LH4A 4DQQA 1CZBA 1C6VA 1JLQA 4EP4A 1DTQA 3AVIA 1ITGA 4ZHRA 1SL0A 4F2RA 4Z4IA 4CEBA 2P5OA 4MQ3A 4F8RA 1ASUA 5C24A 3K58A 1IH7A 2X74A 1BQMA 4CK1A 4DU3A 3AA3A 2XRIA 4CJRA 3THVA 4CF9A 4I7FA 3VQ6A 1NJXA 4DSLA 3IS9A 2F8SA 1XHXA 1SUQA 2Z1IA 1O1WA 1RDDA 4AHVA 3SYZA 4B08A 4CEEA 2YNIA 3TANA 2PYLA 5I42A 3KTQA 3DLKA 2KZZA 4CJQA 3KK3A 3SZ2A 3U3YA 1B92A 3ZSZA 4W5OA 3ZSQA 1LWCA 2FC0A 1NKBA 1IKXA 4CHOA 4N5SA 4W5QA 1WSJA 4M3YA 3DM2A 4AHRA 3I8DA 3KD1E 1REVA 2W42A 3SV3A 4M3ZA 4PA1A 2BE2A 2FBYA 2B6AA 3HPHA 2RN2A 1B9FA 1TKXA 2RPIA 4FJIA 1JL1A 3OYCA 4ELUA 1JLGA 1KCFA 4OJRA 1CLQA 5SZTA 4CF1A 3LPUA 4FZZA 1RT3A 3HO1A 3QEIA 1L3SA 1VSDA 1NJZA 1TAUA 1RDBA 4IFYA 1VSHA 4FLUA 3S3NA 1SKRA 4B9UA 4I9QA 1HNVA 4F3OA 4LH5A 2HMIA 3ISNC 3LWMA 4DQPA 2E6LA 3AA2A 4JRQA 1RBSA 3AO4A 1X9WA 3OYIA 4CECA 1BIUA 3HK2A 2QK9A 3AO1A 4OKJA 1QE1A 3QEXA 3ZT3A 1A5XA 3OYFA 1HPZA 1FKPA 2BANA 4DLGA 1HQUA 2VWJA 3AVGA 4MFBA 3VQEA 5HRSA 3OYHA 4W5TA 3TAPA 1ZBHA 4CHZA 5HRPA 3HPOA 3SUQA 1VSIA 3MXIA 3VQAA 2G8KA 2Z1GA 3QEVA 1NK7A 4KHSA 3CM6A 3KKSA 4OKKA 2DFEA 3O3FA 3OYAA 3VQCA 3DLRA 4AHUA 4FW2A 1UWBA 4RW4A 3WNFA 3VA3A 3QLHA 1TL3A 2ZD1A 4C8LA 3T19A 4OKEA 3JSMA 3AA4A 3KJVA 3MEEA 3K5LA 3P83D 3KK2A 5CZ1A 4DS5A 1SKSA 4OPJA 4FVMA 3DLBA 1KFDA 2HVIA 4DLEA 5J2NA 3S3MA 1BIZA 3HVTA 3ZT0A 1VSKA 4W5RA 3SI6A 1U45A 4C8KA 4J2EA 2G8WA 3I0RA 5FDLA 4CHPA 1RT6A 1D8YA 4NCBA 5HP1A 1NK0A 2YKNA 1BGXT 3SUPA 1EX4A 1U48A 1RTIA 1XHZA 4CJTA 3ALYA 3L2UA 1QTMA 4Q5VA 1HRHA 1TV6A 1BCOA 2G8FA 3MXJA 5JS2A 4AHTA 4M45A 3V9XA 2HNZA 2HVHA 4DSFA 3C6TA 4DTRA 1Q9YA 1MU2A 3MECA 4HHTA 1RNHA 4BDYA 4BDPA 1C1BA 1C0UA 3P1GA 3MAQA 2G8UA 1JLEA 1NJYA 1QSYA 4KREA 1KRPA 1GOAA 4IDKA 4FJNA 1RT1A 3L8BA 2GUIA 4DTJA 2XY5A 5FRNA 3K5NA 3ULDA 4FJXA 4C8NA 3I0SA 3QNOA 4CGFA 5K14A 5FRMA 4DG1A 4NCAA 4E7KA 3C94A 1TVRA 4BWMA 1KSPA 2OZSA 3TI0A 1J5OA 2F8TA 3SQ2A 3VQDA 1VSEA 3LP1A 4B8AB 4QCLA 4CHNA 4ID5A 4DTXA 4RG8A 4LD0A 3TR8A 1BHLA 1BCMA 2OZMA 3SPYA 1S9GA 4O0JA 3ZSVA 4Z4HA 3NH1A 3IG1A 3QEWA 3SJJA 2X6NA 3ZSOA 1RTDA 4DS4A 4FLZA 1WSGA 2VG6A 3CFRA 1N5YA 1IKVA 1JLBA 3DI6A 4AHSA 3ZT4A 1X1PA 4RW7A 2XY6A 1FKOA 2WONA 3HM9A 4KI4A 1T7PA 4EZ9A 4FK0A 3BGRA 3K5MA 4PY5A 3B6PA 1WN7A 3HVRA 4DTSA 1X9SA 3A2FA 3G0ZA 1TK0A 4IG3A 2A1RA 4FZYA 2EX3A 3MEDA 4I2PA 2YHBA 4KO0A 5I3UA 1I39A 1WLJA 4PWDA 3L3UA 2A1SA 4DSIA 3DOKA 3AVFA 3F73A 4AH9A 3SCXA 2VG5A 3TWHA 1T05A 4B9TA 1JL2A 3OJUA 3ZSYA 4CGHA 1I3AA 4M3RA 3OS1A 4CF0A 3K59A 1EP4A 4CGGA 4FM1A 4CIEA 1LWFA 4DQSA 1NKEA 4KPYA 1EKEA 4CJ4A 1C0MA 1C0TA 2IS3A 2OPSA 5EU7A 3KLFA 1UAXA 3V1OA 3KLIA 3EZ5A 3LDSA 3TAEA 4ELVA 3QNNA 2OA8A 1VK0A 1Y97A 3SPZA 3V9ZA 4DU4A 2Y1JA 4CGDA 3S3OA 2DY4A 4DTPA 1HYVA 4R5PA 2IAJA 4CIFA 1D9DA 1IG9A 3NAEA 3VQBA 3LZIA 1SV5A 2I5JA 4DTNA 3SQ0A 1KVCA 2Q3SA 1QS4A 2ZE2A 1SL1A 4B9NA 3U6FA 4CJ5A 4DFPA 4KHQA 1TAQA 1CXQA 1S1UA 1D9FA 4W5NA 4O55A 5HBMA 2E4LA 3OS2A 4KAZA 3NF9A 1WSIA 4FLVA 3NBPA 4I9LA 1CZ9A 3KLEA 4CJPA 2GBZA 1NK9A 3RMAA 3L2WA 3RR8A 1X9MA 3UIQA 2HHTA 4E7HA 4KRFA 2IDOA 1RT7A 4CEFA 4CK3A 1YTAA 4Z4FA 3SQ4A 4E89A 1LAVA 2EHGA 1JLFA 3VQ4A 3HT3A 1RBUA 4CCHA 1HYSA 2HHXA 4LSNA 1RBTA 4QAGA 1SKWA 2G8HA 2D5RA 2KW4A 4E1NA 2Z1HA 3LZJA 5KGXA 4B9LA 4HCBA 1WSFA 4CESA 4DQIA 3M8RA 3NGZA 4LSLA 3OYKA 4F2SA 3NCIA 5KRSA 4QOZB 1L3VA 1VRTA 4M3TA 1GOBA 2ITGA 1NK4A 3NF8A 3NF7A 3F9KA 4CF2A 1XI1A 1TKTA 4K8XA 1NK8A 4PUOA 4UQGA 5KI6A 4DTUA 2QXFA 4ICLA 3LALA 4DSJA 3SUNA 3VQ8A 3M8QA 3WNHA 5DK5A 4RW8A 3EYZA 1N6QA 2P51A 4B9VA 4FJ8A 1NJWA 2FBTA 3OYDA 2G8IA 2KZMA 4ELTA 1GOCA 2E6MA 3ZSXA 3O3GA 5C25A 1VRUA 4DTOA 2QKBA 2F96A 4CJEA 1RBVA 3VN5A 4CHYA 4PQUA 3OVNA 1TK8A 4N76A 1NKCA 4CJVA 4DFMA 2HB5A 2PZSA 2D0CA 4Z4CA 4E7JA 4L8RB 3RR7A 2OPQA 4J2DA 3LANA 4KB1A 3AVJA 3K5OA 2GV9A 4CJWA 2LSNA 3QETA 4ZTFA 2BDPA 1QQCA 4RW6A 3HJFA 4FJMA 3L2RA 4FM0A 3RMDA 5E41A 3JYTA 1JLCA 1U47A 3KD5E 3D45A 3VA0A 3ZSRA 4CHQA 2YNFA 1TL1A 3O3HA 5J2PA 3L2QA 3SV4A 4EZ6A 1BQNA 4FJKA 3AA5X 2NUBA 3QERA 3LPTA 3DRSA 3QEPA 1EETA 3LP3A 3RWUA 1S6PA 3LWLA 3SQ1A 3BDPA 3OJSA 1RTHA 5KGWA 4CEOA 2AJQA 1XC9A 1SL2A 1HMVA 4M42A 3QINA 3OYEA 3AVBA 5T7BA 4FJ5A 5JS1A 2B5JA 2YKMA 3V1RA 4ZTJA 3DYAA 3NGIA 1Q9XA 4AHCA 4FZXC 3NF6A 3ZCMA 4FLWA 3TABA 2KFZA 4BE0A 4M41A 2DFFA 2D0BA 3MEGA 4E7IA
chains in the Genus database with same CATH superfamily
3U9DA 3T1AA 4O44A 3IMXA 4JI1K 3B6OA 3CC2N 3ZT1A 3VF2A 1XNQK 3VEWA 3BUZB 3VF4A 2QEXN 3NFAA 3QIOA 2VQEK 5C42A 3NE6A 4B9MA 3QESA 1VQ5N 2OANA 1HJRA 4FL9A 1IBKK 4BRGA 3VQPA 2ETJA 5C15A 4BRPA 4XH5A 4LFCK 5EY4A 1JCEA 3TSQA 1KVBA 4GNIA 1IBMK 2KTQA 1BA1A 4WE1A 3KK7A 3KZBA 3EN9A 2KHOA 1BISA 1WNSA 3ATVA 2P9NA 3DMJA 2A42A 3O5BA 5FROA 4K8ZA 2XY7A 1WOQA 4DFJA 2D4WA 2QTDA 1ZYQA 1S6QA 4HUGA 2NRZA 4E19A 3CFOA 2QWNA 5AQLA 2OCEA 1NGBA 4QS7A 4H0VB 2PY5A 4KB0A 2WUSA 1IO2A 1Y64A 4KHYA 4OLAA 2OPRA 3V6DA 4N41A 1TKZA 1LAWA 1VQ4N 4AILC 1J54A 1RTJA 4ILJA 3N4QA 4O5BA 3VEOA 3OS0A 3DRPA 4JS4A 1J6ZA 2E2QA 3O9SA 1RBRA 2P9UB 3IKMA 3M1FA 4DTMA 1GLLO 1KXPA 3IDHA 3KKRA 4H0TB 1U2VB 4OPKA 1HX1A 1ATSA 4RW9A 2IVPA 3RRGA 4KTQA 3LDQA 3NHGA 3CI5A 2D0PA 2IIRA 4M7XA 4FK2A 4B3RK 3BZKA 2HNDA 3WNEA 1RDCA 1S72N 2OPPA 3HOTA 1TKDA 1NGDA 4I2QA 2XO7A 4BREA 3ZETA 4AM6A 3R8EA 1NWKA 1OVYA 5KPZA 1K6YA 4EIAA 3DLEA 3N4PA 2HHUA 4KTZA 1VQ9N 1ZBUA 4YORA 4BWJA 2PFUA 4A2AA 4GKKK 4FW1A 3OTOK 4GMJB 2WC9A 4QS8A 4FXDA 4Z94A 4BRQA 3VETA 3A5MC 3K57A 4CJLA 3R6MA 3TSPA 4DF4A 3CFPA 3FR0A 4CW7B 5J2MA 3ZT2A 2F9TA 3H3NO 3LP2A 4BE2A 3RMCA 4CJUA 4NO7A 1YTUA 3NH2A 4O8KA 1WAJA 4WFBL 3FFIA 1YUWA 3AO2A 3KLHA 1C1CA 3DLGA 3C95A 4IG0A 3TAQA 4MO5A 4CGJA 3THWB 1Q18A 3MWTA 4M3WA 1V4SA 4CJKA 4IFVA 4PL7A 2ZJRL 1U49A 3B8AX 2G8VA 4WCEL 4AM7A 4B8CA 4HUEA 2ATQA 4JRPA 3C6UA 3J7YP 1IKYA 3TAMA 1XC3A 1RILA 3K2PA 1NMDA 5DMRA 4C8MA 1QSLA 2E8AA 1G15A 1HNIA 1WSHA 1QHTA 4KI6A 2FBVA 3ASMA 4M3UA 2P9LA 3HP6A 4LH4A 1C6VA 1JLQA 1DTQA 1BG3A 5TKWA 4Z4IA 2A5XA 4MQ3A 3E9PA 5AQSA 4CK1A 3THVA 2A6AA 4C1NK 3LM2A 4CF9A 3VQ6A 1NJXA 4AHVA 1RDDA 2PYLA 2YNIA 5I42A 3CJAA 3KK3A 1QVGM 3ZSZA 3ZSQA 2F7TA 2P9NB 1C0FA 2A40A 5KQDA 3UE5A 4CHOA 4W5QA 3HZ6A 1LCUA 1WB9A 5GAGP 3J7AP 2J4RA 1ZBSA 2W42A 4PA1A 3SK3A 3WXKA 3HPHA 5M1PA 3QB0A 4CZIA 1JL1A 3OYCA 3ZX0A 1CLQA 5SZTA 5JICA 1L3SA 4BGBA 3WXMB 3W0LA 1VSHA 4CBXA 4A59A 1KC8O 2E6LA 4CECA 3A5LC 4FWQA 1IG8A 4OKJA 3ZT3A 3OYFA 1FKPA 4BRIA 3KWGA 3AVGA 3O9RA 4JAXA 5EX5A 3MXIA 5AR0A 4DB3A 3QEVA 1K8KA 1NK7A 3CCEN 3VQCA 3DLRA 3SLCA 4RW4A 3BEXA 1TL3A 4B1VA 3JSMA 4C8LA 1N32K 4MLEA 3KJVA 3SJHA 3P83D 5CZ1A 4O5FA 3EKSA 2KKZA 2Q2RA 4OPJA 4WYBA 4YOYA 3DLBA 3ZT0A 4A5BA 4C8KA 2G8WA 1D8YA 5HP1A 1EX4A 3VGMA 1U48A 2HBLA 3ALYA 1ILYA 2HVHA 3V9XA 3MN9A 2HNZA 2VWBA 4WFAL 4DTRA 3AARA 1RNHA 4BDPA 2O8CA 1C1BA 1C0UA 4BRAA 3SAFA 3MAQA 2G8UA 4KREA 1GOAA 5H1SQ 4FJNA 2XY5A 4DTJA 5JLHA 3ULDA 3I0SA 3SMPA 4CGFA 4ISFA 4E7KA 3C94A 1TVRA 4IJAA 1DGKN 4BWMA 1W7AA 3SQ2A 3LP1A 2QA4N 4DTXA 4RG8A 4O0JA 4Z4HA 3SJJA 2X6NA 1NU0A 4FLZA 2HHHK 1N5YA 3RSEA 3LDOA 2XY6A 1FKOA 2QXLA 5BRFA 4FK0A 3NMUA 3HSCA 3B6PA 2CGLA 4DR5K 4DTSA 1TK0A 3UIQA 4CZEA 2YHBA 3MX2A 5I3UA 3OW2M 2VQFK 4DSIA 3DOKA 4HWIA 3F73A 4AH9A 4BC3A 2GWJA 2VG5A 3TWHA 3I8BA 2UXCK 4M3RA 2ZJQL 2Q31A 3K59A 1EP4A 4FM1A 4DHYA 4KPYA 3EZ5A 3TAEA 3LDSA 4LF4K 4LC9B 1VQKN 2OA8A 2UXDK 3T69A 1WBBA 3ULEA 1WBDA 1ATRA 1HYVA 3VGKA 2P9LB 1YJNN 3QFUA 4J8FA 2Q97A 5JVGL 1KVCA 2NLXA 1QS4A 2Q3SA 4FWLA 2GTDA 4H0OA 4DKWA 1SL1A 4B9NA 1M90O 1NNEA 4O55A 3ZEUA 5HBMA 2E4LA 3OS2A 3NF9A 3NBPA 4BVOA 4E7HA 3MWPA 3TSUA 5A2QO 1U6ZA 4JK9A 4IOXA 3LDNA 4B1ZA 2D5RA 1WSFA 1N33K 3H46O 4F2SA 3NCIA 5KRSA 3FZHA 4QOZB 1VRTA 4B3TK 1NK4A 4BROA 3MX5A 4ILHA 4CF2A 4GY2B 4EHTA 1Q81O 3DWLA 3LALA 4YOTA 3VQ8A 4LFBK 1N36K 3EYZA 2G8IA 1NJWA 3L6QA 2E6MA 5CE3A 1VRUA 5AQUA 2F96A 1GLAG 1NGIA 2PZSA 4E7JA 1I94K 3EKUA 3RR7A 3G25A 3QETA 2GV9A 1HKBA 1QQCA 2UUBK 3MK6A 4FM0A 3ENBA 4BRNA 4B1XB 4CHQA 4EZ6A 4FJKA 3LPTA 3RWUA 1EETA 3S41A 1S6PA 2BUPA 3PIOL 5KGWA 4H5RA 4IEIA 4DV6K 2KLAA 4FO0A 3AVBA 5T7BA 4ZTJA 3NGIA 4AHCA 4BRMA 1M1KO 4M41A 3CCJN 2DFFA 3MEGA 3Q7BA 3QEXA 1OH8A 2P5GA 1MA9B 3LDPA 4MLHA 1E4FT 1BU6O 2PYJA 3JAMO 5TKYA 1F21A 3CQ8A 3V9WA 3SUOA 4JI2K 2X6SA 4Z0UA 3WUHA 1KTQA 2NRXA 4J2AA 4RTFD 1BUPA 2WBNA 2QM1A 3P31A 3O80A 3CQXA 4KBOA 2XY8A 4CEAA 1RDAA 1TK5A 4BE1A 1S9EA 2IC3A 2HHWA 3F2KA 2IVNA 3DLHA 1YAGA 4N47A 4KFBA 4A62A 3EO3A 3HL8A 4FWOA 1A5WA 1GLEG 1U04A 3M8SA 2VWKA 5M1NA 5IT9O 4X64K 4OGEA 4GV9A 1L3TA 5KTQA 4FLXA 1MWKA 3PY8A 1T6DA 4JKEA 2HHSA 4JKFA 4DV1K 4G1QA 4FYDA 1VSFA 3DXKA 3NGYA 3O4QA 3GOIA 4NCGA 1KLNA 1KFSA 4DF8A 2E1YA 5KPTA 2ASMA 2FSJA 5AQMA 3V9SA 3VENA 4DMNA 4U67L 3GL1A 5CYMA 3CCUN 4H5NA 3AVHA 1XWLA 2HF3A 5HRRA 4CJ3A 3NH0A 2A41A 1NG9A 3QBXA 4R79A 2IOCA 4CFAA 4JS5A 4B3MK 4DU1A 2NZTA 4C1NI 2BGGA 3OYNA 2RKIA 2E2PA 2QWOA 3I56N 2JWLA 1YITN 4KH5A 3VEZA 1LW0A 3P38A 1ASWA 3J7ZO 5CZ2A 1VAZA 3PO4A 4BRFA 2O4IA 4LF6K 3U3GA 3V4IA 3THXA 2OYQA 3ENOA 3TPQA 3CF5L 1X3NA 3MXMA 1NGGA 4HTUA 3GG4A 3THWA 5JLFA 1UOCA 2FXUA 3CJBA 3L4QA 4HVJA 1RT2A 1VSMA 4A61A 1UA1A 1NOZA 4DV4K 4FJ7A 1LW2A 2QW9A 3AVAA 4FJGA 4PL8A 1ZBIA 3HXMA 3IAYA 3LAKA 2QWPA 1R0AA 2KQ2A 1S1TA 4YFUA 3HSTB 1QZ6A 4F3TA 3EZWA 3T7ZA 2F9WA 5AQVA 4DSEA 4Q0BA 3E9OA 4CEDA 3D0PA 4PKHA 4DFKA 3DXMB 1TGOA 4XH4A 4NLBA 2UUCK 5CY4A 1VSJA 1P90A 4H5VA 3OYMA 1RDUA 3IUCA 4CK2A 1NK5A 5JMVA 3EY1A 3NDKA 4N56A 3DOLA 1YT3A 3HYFA 2VG7A 4LY7A 1RT5A 4JKHA 5AQGA 3AO3A 4KKOA 4X65K 3IRXA 3RRHA 4CFDA 3H1VX 1ZXOA 3H1QA 5AQWA 4OLBA 4YY3K 3CIPA 1S5JA 4CGIA 3ENHA 4E0DA 4NYFA 2VYPA 4IBNA 2X78A 1CZBA 4JEPA 4EP4A 1ITGA 1SL0A 4F2RA 2HF4A 3PSIA 4CEBA 4JKGB 5LMUK 3K58A 5C2DA 3VTHA 4CJRA 3TANA 2Z1IA 4B9TA 3SYZA 3PLAA 2YJFA 4BRKA 2HBMA 4CJQA 3SZ2A 3U9ZA 4W5OA 1NKBA 1WSJA 3DM2A 3J81O 4WFNL 2WTUA 3SV3A 2E1ZA 4BR2A 2BE2A 2FBYA 3CCMN 2RN2A 4K0KK 1B9FA 1TKXA 4FJIA 4OJRA 3LPUA 3A5OC 3HRGA 2BTFA 1TAUA 4IFYA 4M3XA 4FLUA 4OPAA 1HNVA 4NXMK 3ISNC 2V7ZA 2FF3B 3DXKB 5GADP 2I7NA 3AA2A 1RBSA 1X9WA 3OYIA 4JI8K 5F0XA 3AO1A 4M7YA 3OHRA 3D2EB 2VWJA 3VQEA 2ZJPL 4W5TA 5E84A 3SUQA 2W41A 4KHSA 4OKKA 2YHYA 3OYAA 2PBDA 1UWBA 3WNFA 3VA3A 3P4IA 4OKEA 3AA4A 1YVNA 3K9JA 3OBWA 5BPNA 4Y0WA 2HVIA 1BIZA 4B1UB 1VSKA 1U45A 3I0RA 1RT6A 3FZFA 1NK0A 3CC7N 3UKRB 1RTIA 2ZF5O 4CJTA 3L2UA 4Q5VA 3HOSA 4M45A 4DSFA 3THXB 1MU2A 4YOUA 1VQ6N 4HHTA 3CCRN 3ZLJA 3T1HK 1JLEA 1KRPA 4IDKA 1RT1A 1X9JA 2GUIA 3O8MA 3K5NA 4IO9L 4C8NA 1G99A 5AQTA 3WXIA 1J5EK 4JKBA 4NCAA 3O08A 2OZSA 5LJWA 2F8TA 1JCGA 4BG8A 4BRCA 4OX9K 1VSEA 1XNRK 4CHNA 4LD0A 5AQPA 2OZMA 3WT0A 1MDUB 1S9GA 3ZX2A 2NRVA 3NH1A 3ZSOA 5KQ8A 1WSGA 3J80O 3CFRA 1JLBA 3WQTA 3D6RA 4BG9A 4RW7A 2WONA 1YHQN 1T7PA 3K5MA 3A8YA 4PY5A 1X9SA 3A2FA 3E9LA 3G0ZA 2A1RA 1VQON 4AQYK 2EX3A 2YJEA 4I2PA 1I39A 3SAGA 1WLJA 4PWDA 3D2FA 4DR3K 1JL2A 3OJUA 1I3AA 4X66K 3OS1A 4BC5A 4DQSA 3O4WA 1EKEA 1C0TA 2E20A 2IS3A 3KLFA 1UAXA 1RFQA 4ELVA 4IO8A 3MN7A 1QQOA 4FOIA 4FWKA 4BR9A 4CIFA 1SZ2A 3LZIA 2VGMA 5C10A 4BGAA 4CJ5A 3CC4N 1TAQA 3L4IA 1S1UA 1D9FA 4W5NA 3A0IX 4DV2K 4FLVA 1WSIA 4CBUA 1HR0K 1NK9A 3RMAA 3RR8A 3AAPA 4KRFA 4CEFA 4CK3A 3WEEB 4E89A 3SQ4A 1JLFA 3HT3A 1HYSA 4FOEA 2O8FB 4DR4K 1SKWA 2HBKA 4CZKA 3O1BA 2KW4A 3CCQN 1NGFA 4CESA 1YJ9N 4DQIA 3T1YK 3M8RA 3NGZA 1GOBA 4GVEA 3F9KA 1NM1A 1TKTA 4K8XA 4PUOA 4UQGA 2QXFA 4DSJA 4NB4A 3WNHA 5DK5A 3VEVA 3OYDA 2KZMA 4ILGB 3FE1A 4B9QA 1DKGD 2O8EB 4F9OA 4PQUA 3OVNA 1GLDG 4N76A 4DFMA 4DR2K 3K5OA 4ZTFA 2LSNA 2BDPA 1JCFA 4RW6A 4FJMA 3L2RA 4K43A 5BN8A 2O8DB 3KD5E 3D45A 4L3QA 2W6KA 1TL1A 3VERA 4WQ5C 2JWKA 3BF1A 4FPBA 3AA5X 3QERA 5M1QA 4X62K 1RTHA 5DM7L 4M42A 1XMOK 3OYEA 4YDUC 2YKMA 3DYAA 4FZXC 5BPMA 3TABA 2DPNA 4BE0A 1RCHA 3SBTA 2D0BA 4OPHA 2CGKA 3PUFA 1S3XA 1BOTO 5FPEA 2NRTA 1CZAN 5C0YA 3EE9A 4B3OA 4CJFA 4LF7K 2JGUA 1QSSA 5AQYA 4JD2A 3PX0A 4NLCA 2IVOA 4H4OA 3M8PA 3G4SN 3OYGA 2P1JA 3OYJA 1JJ2M 4DSKA 4CIGA 4BQLA 1JLAA 4JLHA 1ZBFA 3AVLA 1E4GT 4BVPA 1TYQA 3DRRA 1VQPN 4OVLA 3VQ9A 2A3ZA 1BDGA 3D2FB 3AY9A 1JXBA 1Q8IA 3AVKA 4H0PA 1DEJA 4CJSA 3TAFA 4DV0K 4Z4GA 1R59O 2ASOA 3O9TA 1J9AA 4CFBA 1WSEA 4JNEA 2WOMA 1S1WA 4H4MA 1WAFA 2ITMA 3CETA 3CJ7A 1HQEA 4KV8A 3O4NA 4JI7K 2ASPA 4JKAA 3W3DA 4FCYA 1CXUA 4CEQA 3LM9A 3V81A 1OH7A 2E88A 1XQSC 3UKUB 5AQFA 1O13A 5AQXA 1KD1O 2YHAA 3G10A 5CR4A 5B8HA 4NYNA 1ESVA 2AA4A 2FF6A 1NBWA 3C7NB 1NLVA 3AO5A 3O9QA 3L3VA 4IZ9A 4H5TA 5J2QA 4K25A 5SWMA 1BI4B 1IKWA 5JVHL 2GUPA 1FXXA 1NK6A 1RT4A 1QQNA 4CZMA 5GAEP 2HSTA 4OGCA 2PAVA 2EWSA 3L2VA 4KHNA 1YI2N 3SNNA 1J53A 1HPMA 3VOVA 4GW6A 4H0XB 2QWRA 3RMBA 1NJIO 1NOYA 3PO5A 4M63C 1BWFO 3C65A 2P9IB 1Z26A 4GVMA 1LWEA 4JYAK 2O4GA 4AF1A 1Q86O 4CZGA 3PX4A 1K8AO 5AFUH 2YI1A 1S1XA 1YF5L 1KAXA 4FWPA 1RGIA 4KHWA 1KLMA 1YVUA 3DAWA 5HROA 4KHUA 2JLEA 3DXMA 5KPRA 3E66A 3LP0A 4BRLA 1Z6RA 4JI5K 3VEXA 3VQ5A 1WUAA 3WNGA 4UY8O 5FPDA 3RTVA 2VCPA 4JI3K 3KK1A 2HHQA 2NNWA 1IV0A 4E7LA 4TSXA 4LFAK 3MCAB 2NRWA 5FLXO 4Z4EA 4BACA 4O8UA 4DR6K 4DWIA 4H8KA 1K9MO 1B9DA 2ZQBA 3M5RA 4JKGA 2Z1JA 4FLYA 2YNHA 4CE9A 2DFHA 2HHVA 4FJLA 1KVAA 3LL3A 1T8EA 4CERA 4WQ5A 4E3SA 5KRTA 2P9KB 1SQKA 1ZBLA 1IJJA 1FK9A 3C6HA 2F4VK 4DQQA 4JKCA 3AVIA 4YDUA 4JD2B 1IH7A 1DT9A 3AA3A 2XRIA 5ADXA 3FZKA 3IS9A 2F8SA 1XHXA 1SUQA 1O1WA 4CEEA 3QDKA 4DQ8A 1IBLK 3DLKA 3U3YA 1TYQB 3U8XA 1LWCA 3O1WA 1Q82O 4M3YA 4CI6A 4AHRA 5HL7L 1HKGA 4M3ZA 2B6AA 3D2EA 2RPIA 4ELUA 4CZLA 1KCFA 1XUPO 4FZZA 2ZM6K 3QEIA 4H0YB 1VSDA 3S3NA 1SKRA 4B9UA 4I9QA 1NMNA 5EVZA 4F3OA 2UU9K 2HMIA 4JI4K 4JI6K 4BR0A 4DQPA 4C23A 3GDQA 3AO4A 3IFRA 1BIUA 2AP1A 2QK9A 1N34K 1QE1A 1QZ5A 1VQ8N 1A5XA 2BANA 5FPNA 3CERA 1HQUA 4DLGA 5HRSA 4MFBA 4BY9C 3KHYA 2E2NA 4CHZA 5HRPA 1ZBHA 2G8KA 3VQAA 4JK7A 2V7YA 2FLOA 3VESA 3RVCA 3UKRA 3O3FA 4PKGA 1GLJO 4FW2A 2UYTA 2RHKA 4FPAA 4AHUA 2GWKA 3T19A 5BRDA 3MEEA 3K5LA 3KK2A 5AQKA 3QBWA 4XEIA 4DS5A 1SKSA 1VQLN 3EL2A 4CJ7A 1KFDA 3S3MA 1NGEA 4W5RA 4J2EA 1Z05A 4CBWA 4IOAL 1BGXT 1QTMA 2CH6A 2G8FA 1BCOA 3MXJA 3TU5A 3MECA 4BDYA 2V51B 3I55N 2YCHA 3U4LA 2QI2A 1NJYA 1QSYA 3OA9A 3L8BA 5FRNA 5BREA 3QNOA 4DG1A 4U7BA 3CHWA 3M3ZA 3P39A 4ID5A 4BRDA 3TR8A 1BHLA 1BCMA 4BRHA 3GBTA 3SPYA 3IG1A 4DV5K 4GKJK 2VG6A 3HTVA 1IKVA 3DI6A 1X1PA 3QMLA 3ATUA 4PHTX 4KI4A 4EZ9A 5C12A 3R1XA 1WN7A 3HVRA 4FZYA 3CJCA 4DUZK 1X3MA 3MEDA 4KO0A 3L3UA 2A1SA 3CPEA 3MN5A 1T05A 3K0SA 4CF0A 4CGGA 5BR8K 4JHDA 1LWFA 4IFEA 1NKEA 4CJ4A 4CD1A 5EU7A 3V1OA 1VK0A 4IJNA 4CZFA 5M1FA 3V9ZA 2Y1JA 4CGDA 2DY4A 4DTPA 3WEEA 4YOXA 1D9DA 3NAEA 3VQBA 1KQSM 1SV5A 4YHHK 2O8FA 2UUAK 1V4TA 4DTNA 2ZE2A 3U6FA 2OTLN 3NVMA 4DFPA 4KHQA 3FFKB 1CXQA 4I9LA 3VPZA 3WQUA 2GBZA 4CJPA 3L2WA 1X9MA 2HHTA 1BO5O 2YHXA 5BRHA 1TUYA 2IDOA 1RT7A 3D7EO 5AQOA 1QHAA 1SAZA 1LAVA 2EHGA 3VQ4A 5BPLA 2HHXA 4LSNA 4A5AA 4RCHA 4YOVA 3LZJA 2Z1HA 3K9KA 5KGXA 5AZJA 4PKIA 5AZIB 4LSLA 2O8EA 2WFBA 4BR7A 4CZJA 3UB5A 2ITGA 3NF8A 3NF7A 2I7PA 1XI1A 1NK8A 5IWAK 1P8ZA 4LF9K 3FLCO 4DTUA 1NGJA 4ICLA 3SUNA 4FSVA 2O8DA 3EEQA 2P51A 4FJ8A 2FBTA 3BY5A 3C6AA 1LOTB 2P9PA 3THYB 5C25A 3VGLA 2QKBA 2RE2A 4LF8K 4CHYA 4CJVA 2D0CA 4Z4CA 1VHXA 4L8RB 5AQRA 4QS9A 3LANA 3O9UA 4CJWA 3KVGA 1YJWN 3HJFA 2FSKA 2D1KA 5E41A 3JYTA 1JLCA 3MN6A 1U47A 3VA0A 3ZSRA 4ISGA 5F2RA 5GAHP 3O3HA 5J2PA 2O8BB 3LDLA 1W97L 2NUBA 3DRSA 1HKCA 3LP3A 3QEPA 3LWLA 3OJSA 4CEOA 1XC9A 1VQMN 1HMVA 4WQ4C 4DR1K 5AQZA 4K41A 4FJ5A 2B5JA 4A57A 4MO4A 4RWTA 4FLWA 4MDBA 2KFZA 4CD3A 3AV9A 3OY9A 2ZGZA 4IKFA 4CEZA 4BDZA 2RF2A 1HNXK 1QQMA 2QWMA 3JXUA 4JV5K 3DLLL 4YOWA 3HBTA 5CYQA 1LV5A 5AQJA 2GELA 4FWMA 4F4KA 1NGHA 2QKKA 2Q0UA 3VQ7A 3J8AA 4EP5A 4DV3K 2W40A 3CYMA 2P9SB 5AQQA 3DJCA 2HMPA 1HYZA 5HLFA 3G71N 2R7YA 4FJHA 4IXCA 3LAMA 3SBGA 4B1WB 4BR4A 5M1KA 1FJGK 3OYLA 4BC4A 1S1VA 4CFCA 5HRNA 3CCVN 4IEEA 5GIPA 2YNGA 3UKUA 1HJOA 3QICA 4H03B 1L3UA 4IWVA 1BL3A 1EXQA 3MDQA 2XHBA 1UA0A 3VQQA 4FM2A 3PV8A 2D0OA 4ID1A 4JHDB 3ID6A 4BC2A 5BR9A 1SS6A 2CH5A 3TARA 3FGUA 3HPGA 3KIOA 3C7NA 2HOEA 1S22A 3VF6A 4B1YB 5LY3A 3ITHA 5LJVA 3OBYA 1A5VA 1TUUA 1BI4A 1C1AA 4Y1CA 2QWLA 4J2BA 1W9HA 3HP9A 1D5AA 4CF8A 5GIOA 3ZSWA 4B9SA 4XIUA 2HW3A 4EAHD 4DV7K 1VSLA 3KLGA 1FW6A 3P5JA 2P9IA 3H6EA 1T03A 3AVCA 4WF9L 4IOCL 1Z25A 4DQRA 5AZJB 1ASVA 5GINA 4O4GA 2W6LA 3AVNA 1E3MA 4YNQA 3L0QA 4E1MA 3QIPA 3CCLN 4H5WA 4O0IA 1U4BA 1HUXA 1JXEA 1W0HA 2NRRA 3CMEN 2B4JA 4E1JA 1NGAA 3V1QA 4CVNE 5M1OA 2P9PB 2NRHA 3ZETB 1ATNA 5F1XA 3AVMA 2D0AA 4Y1DA 2FBXA 3CXCM 3R3LA 2HNYA 1JKHA 2GX9A 3VEYA 3AGRA 4I6MA 4HCCA 5D3GA 1DLOA 1K73O 1OKJA 3TAGA 4FJ9A 4C8OA 2YV0X 4LF5K 4HUFA 3AGKA 3E1YA 3E01A 3V9UA 1L5UA 3CM5A 3H08A 1T3VA 1RDWX 2P9KA 4FK4A 3QO9A 1NGCA 3PX6A 4FLTA 3OYBA 3BP8A 2KFNA 5J1EA 2CGJA 4FJJA 3ID8A 1DTTA 4FWRA 2YX6A 1EWQA 3CG7A 2OTJN 2DTUA 3S9HA 4KTWA 2IGIA 3T3FA 2Y1IA 4WQ4A 3BZCA 3R9PA 3JS6A 2E5LK 4ZHRA 4NXNK 2P5OA 4F8RA 1ASUA 5C24A 2X74A 1BQMA 4DU3A 4I7FA 4DSLA 3SAHA 1EWRA 4FWSA 4B08A 3KTQA 1HLUA 2KZZA 1B92A 4DR7K 2FC0A 1IKXA 3I33A 4N5SA 4JI0K 3I8DA 1GLFO 3KD1E 1REVA 4B3SK 5ELZA 1HNWK 3TTCA 1C0GA 4JK8A 2HBJA 5AQHA 5LMNK 1T44A 5AFUA 1JLGA 2H3GX 4CF1A 3HO1A 1RT3A 1EQYA 4IDHA 2YHWA 1D4XA 5AJ3K 1NJZA 3TTDA 1RDBA 4FVUA 3VTIA 4JN4A 4LH5A 3LWMA 4JRQA 3HK2A 5C2FA 3CQYA 4MDAA 1HPZA 1OH6A 5CHIA 4FWNA 3OYHA 3SMSA 3TAPA 3QFPA 3HPOA 1VSIA 2Z1GA 3CM6A 3KKSA 3C0BA 2DFEA 1W2BM 3QLHA 2ZD1A 3M6GA 1N8RO 4BQZA 2GEMA 5AQNA 4FVMA 5EXWA 4DLEA 5J2NA 3HVTA 3SI6A 4KH4A 5LL6Z 5FDLA 4CHPA 1K8KB 4K42A 4NCBA 3HI0A 2YKNA 3SUPA 1XHZA 3PIPL 1HRHA 1TV6A 4KH6A 5JS2A 4AHTA 2UXBK 3C6TA 1Q9YA 4JKDA 3P1GA 3G6EN 5MLCQ 4OO1J 4BR5A 4FJXA 5K14A 5FRMA 3F5TA 1KSPA 3TI0A 1KAZA 4I6MB 1J5OA 1VQ7N 4KHPK 1OH5A 3VQDA 3CPWM 4B8AB 4QCLA 1XMQK 4V19S 2O8CB 4DUYK 3ZSVA 3QEWA 2QWQA 3CMAN 3ZX3A 4DS4A 1RTDA 4AHSA 3MMVA 1QVFM 1ZC6A 3ZT4A 1EO1A 3H3OB 1MWMA 3HM9A 3Q7CA 3BGRA 2V52B 1GLCG 2ZWHA 2Q1NA 4IG3A 4EFHA 5EOYA 2FSNA 2E2OA 3VMFB 3SCXA 3AVFA 2ZGYA 4EHUA 3FZMA 3ZSYA 4CGHA 3CCSN 4CZHA 3CJ9A 3A5NC 3EE8A 3RSEB 4CIEA 1C0MA 2OPSA 5AQIA 3KLIA 3QNNA 1Y97A 3SPZA 4DU4A 1YIJN 3S3OA 4R5PA 4HTLA 2IAJA 1IG9A 2I5JA 5DM6L 3SQ0A 1H1VA 4XH1A 5I9EB 3AAQA 5AZIA 1BA0A 4KAZA 1CZ9A 3KLEA 2P9UA 1U2VA 3FZLA 1YTAA 3ULEB 4Z4FA 4GV3A 4GV6A 4CCHA 1RBUA 3GE1A 4QAGA 1RBTA 1GLBG 2G8HA 3F9MA 4E1NA 4B9LA 4HCBA 3THYA 3ZEUB 3TTFA 3OYKA 5E26A 1L3VA 4M3TA 3HM8A 2Q36A 5KI6A 3H45C 4G9ZA 3M8QA 4RW8A 1N6QA 3NVKA 4B9VA 2BH1A 4ELTA 1GOCA 3ZSXA 3O3GA 3KWIA 4DTOA 2O8BA 5ADXH 1HNZK 4CJEA 1RBVA 3VN5A 1TK8A 1NKCA 3CD6N 2HB5A 3WXLA 2OPQA 4J2DA 2VGNA 4KB1A 4A2BA 5HOOA 3AVJA 3CJ1A 1KAYA 3ZYYX 3BF3A 1VQNN 3RMDA 3MCPA 2Q0RA 5FPMA 5BN9A 2YNFA 1YXQA 3O6WA 1T6CA 3L2QA 3SV4A 1BQNA 1Q7YO 3SQ1A 3BDPA 2AJQA 3PSFA 1SL2A 1OVQA 3QINA 5JS1A 4DCHA 3V1RA 1Q9XA 3NF6A 3WXJA 4ISEA 3ZCMA 2P9SA 4E7IA
chains in the Genus database with same CATH topology
3AV9A 3T1AA 4O44A 3OY9A 2P5GA 4IKFA 4CEZA 3B6OA 4BDZA 3PUFA 2RF2A 3ZT1A 2PYJA 3NFAA 3QIOA 5C42A 3NE6A 4B9MA 3QESA 5CYQA 1F21A 1HJRA 1LV5A 4B3OA 4CJFA 3CQ8A 3V9WA 3SUOA 2X6SA 4Z0UA 4F4KA 3VQPA 2QKKA 1KTQA 2ETJA 4J2AA 2JGUA 3VQ7A 1QSSA 4EP5A 3PX0A 3CYMA 1RCHA 4H4OA 3M8PA 3OYGA 1KVBA 2P1JA 3OYJA 1HYZA 2XY8A 5HLFA 4DSKA 2R7YA 4CIGA 4FJHA 3LAMA 4CEAA 1JLAA 4JLHA 3OYLA 2KTQA 1RDAA 1ZBFA 4WE1A 4BE1A 3AVLA 1S9EA 2IC3A 1TK5A 1S1VA 2HHWA 3DRRA 1BISA 4CFCA 4OVLA 5HRNA 3DLHA 1WNSA 2YNGA 3DMJA 4N47A 3VQ9A 4FJJA 4KFBA 5FROA 4K8ZA 2XY7A 1JXBA 1Q8IA 3AVKA 3HL8A 4CJSA 4DFJA 3TAFA 1L3UA 4Z4GA 1A5WA 1BL3A 1EXQA 2XHBA 1UA0A 1U04A 3VQQA 1J9AA 4CFBA 1ZYQA 4FM2A 3PV8A 1WSEA 4ID1A 1S6QA 2WOMA 1S1WA 2VWKA 4H4MA 1WAFA 3M8SA 4HUGA 1HQEA 4KV8A 3O4NA 4OGEA 3TARA 4E19A 5KTQA 4FLXA 3HPGA 3CFOA 3KIOA 1L3TA 3PY8A 2HHSA 4FCYA 1CXUA 4G1QA 4CEQA 2PY5A 4KB0A 3ITHA 3V81A 4FYDA 1IO2A 1VSFA 4KHYA 3NGYA 3O4QA 2OPRA 4OLAA 1A5VA 3V6DA 4N41A 4NCGA 1KLNA 1TKZA 1LAWA 1KFSA 4AILC 1J54A 1RTJA 1BI4A 2YHAA 4DF8A 1C1AA 4Y1CA 4J2BA 3G10A 1W9HA 3HP9A 1D5AA 4O5BA 4CF8A 3OS0A 3DRPA 4JS4A 3ZSWA 4DMNA 3V9SA 4B9SA 5CYMA 4XIUA 4NYNA 2HW3A 3AVHA 1XWLA 1RBRA 5HRRA 4DTMA 4CJ3A 3NH0A 3KKRA 3AO5A 4OPKA 1VSLA 4RW9A 3KLGA 3L3VA 3RRGA 4KTQA 3P5JA 2IOCA 4CFAA 3NHGA 4JS5A 4FK2A 4DU1A 5J2QA 1T03A 2HNDA 3AVCA 3WNEA 5SWMA 2BGGA 1RDCA 1Z25A 3OYNA 4DQRA 1BI4B 1IKWA 2OPPA 1ASVA 2RKIA 1TKDA 4O4GA 1FXXA 1NK6A 4I2QA 1RT4A 2XO7A 4OGCA 1K6YA 3AVNA 4YNQA 3DLEA 4E1MA 2HHUA 3L2VA 4KTZA 4KHNA 3QIPA 3SNNA 1J53A 1LW0A 1ZBUA 4GW6A 4O0IA 1NOYA 3RMBA 1U4BA 1ASWA 3PO5A 4BWJA 5CZ2A 1JXEA 1W0HA 3PO4A 2B4JA 1Z26A 2O4IA 3U3GA 4GVMA 1LWEA 3V4IA 4FW1A 3V1QA 4GMJB 4FXDA 2OYQA 2O4GA 4M3UA 3MXMA 3K57A 4HTUA 4CJLA 3PX4A 3AVMA 2D0AA 4Y1DA 2FBXA 1S1XA 1UOCA 2HNYA 4HVJA 4DF4A 3CFPA 1JKHA 4KHWA 1RT2A 1VSMA 1KLMA 1UA1A 1YVUA 5HROA 1NOZA 4KHUA 2JLEA 5J2MA 4FJ7A 4M3XA 1LW2A 3LP0A 3ZT2A 3AVAA 4FJGA 3LP2A 1ZBIA 3HXMA 4BE2A 3IAYA 3RMCA 4HCCA 4CJUA 1DLOA 5D3GA 1YTUA 3NH2A 1WAJA 3VQ5A 3FFIA 3AO2A 3WNGA 3LAKA 3KLHA 3TAGA 4C8OA 4FJ9A 2HHVA 1R0AA 2KQ2A 1C1CA 2YV0X 3DLGA 1S1TA 3C95A 3RTVA 4IG0A 4HUFA 3TAQA 3E01A 3V9UA 4YFUA 3KK1A 3HSTB 4CGJA 1L5UA 2HHQA 3CM5A 3H08A 4F3TA 4M3WA 4DSEA 4Q0BA 4E7LA 4CEDA 4TSXA 3D0PA 4DFKA 1TGOA 4CJKA 4Z4EA 4IFVA 4BACA 4FK4A 5CY4A 1U49A 3QO9A 1VSJA 4DWIA 3PX6A 4H8KA 4FLTA 3OYBA 1B9DA 2G8VA 2ZQBA 3OYMA 2KFNA 5J1EA 4FLYA 2Z1JA 4CK2A 2YNHA 4B8CA 1NK5A 4CE9A 4HUEA 2DFHA 3EY1A 3NDKA 4N56A 2ATQA 3DOLA 1DTTA 1YT3A 3HYFA 2VG7A 3C6UA 1RT5A 4LY7A 4JRPA 4FJLA 1KVAA 1IKYA 3AO3A 4KKOA 3IRXA 3TAMA 1T8EA 1RILA 3K2PA 4CERA 4CFDA 3RRHA 5DMRA 4C8MA 1QSLA 3CG7A 4E3SA 5KRTA 1G15A 4OLBA 1HNIA 1WSHA 1QHTA 3S9HA 2DTUA 4KI6A 1S5JA 4CGIA 2FBVA 3ASMA 2IGIA 4KTWA 1ZBLA 1FK9A 4NYFA 3T3FA 2Y1IA 4IBNA 4E0DA 2X78A 3HP6A 4LH4A 4DQQA 1CZBA 1C6VA 1JLQA 4EP4A 1DTQA 3AVIA 1ITGA 4ZHRA 1SL0A 4F2RA 4Z4IA 4CEBA 2P5OA 4MQ3A 4F8RA 1ASUA 5C24A 3K58A 1IH7A 2X74A 1BQMA 4CK1A 4DU3A 3AA3A 2XRIA 4CJRA 3THVA 4CF9A 4I7FA 3VQ6A 1NJXA 4DSLA 3IS9A 2F8SA 1XHXA 1SUQA 2Z1IA 1O1WA 1RDDA 4AHVA 3SYZA 4B08A 4CEEA 2YNIA 3TANA 2PYLA 5I42A 3KTQA 3DLKA 2KZZA 4CJQA 3KK3A 3SZ2A 3U3YA 1B92A 3ZSZA 4W5OA 3ZSQA 1LWCA 2FC0A 1NKBA 1IKXA 4CHOA 4N5SA 4W5QA 1WSJA 4M3YA 3DM2A 4AHRA 3I8DA 3KD1E 1REVA 2W42A 3SV3A 4M3ZA 4PA1A 2BE2A 2FBYA 2B6AA 3HPHA 2RN2A 1B9FA 1TKXA 2RPIA 4FJIA 1JL1A 3OYCA 4ELUA 1JLGA 1KCFA 4OJRA 1CLQA 5SZTA 4CF1A 3LPUA 4FZZA 1RT3A 3HO1A 3QEIA 1L3SA 1VSDA 1NJZA 1TAUA 1RDBA 4IFYA 1VSHA 4FLUA 3S3NA 1SKRA 4B9UA 4I9QA 1HNVA 4F3OA 4LH5A 2HMIA 3ISNC 3LWMA 4DQPA 2E6LA 3AA2A 4JRQA 1RBSA 3AO4A 1X9WA 3OYIA 4CECA 1BIUA 3HK2A 2QK9A 3AO1A 4OKJA 1QE1A 3QEXA 3ZT3A 1A5XA 3OYFA 1HPZA 1FKPA 2BANA 4DLGA 1HQUA 2VWJA 3AVGA 4MFBA 3VQEA 5HRSA 3OYHA 4W5TA 3TAPA 1ZBHA 4CHZA 5HRPA 3HPOA 3SUQA 1VSIA 3MXIA 3VQAA 2G8KA 2Z1GA 3QEVA 1NK7A 4KHSA 3CM6A 3KKSA 4OKKA 2DFEA 3O3FA 3OYAA 3VQCA 3DLRA 4AHUA 4FW2A 1UWBA 4RW4A 3WNFA 3VA3A 3QLHA 1TL3A 2ZD1A 4C8LA 3T19A 4OKEA 3JSMA 3AA4A 3KJVA 3MEEA 3K5LA 3P83D 3KK2A 5CZ1A 4DS5A 1SKSA 4OPJA 4FVMA 3DLBA 1KFDA 2HVIA 4DLEA 5J2NA 3S3MA 1BIZA 3HVTA 3ZT0A 1VSKA 4W5RA 3SI6A 1U45A 4C8KA 4J2EA 2G8WA 3I0RA 5FDLA 4CHPA 1RT6A 1D8YA 4NCBA 5HP1A 1NK0A 2YKNA 1BGXT 3SUPA 1EX4A 1U48A 1RTIA 1XHZA 4CJTA 3ALYA 3L2UA 1QTMA 4Q5VA 1HRHA 1TV6A 1BCOA 2G8FA 3MXJA 5JS2A 4AHTA 4M45A 3V9XA 2HNZA 2HVHA 4DSFA 3C6TA 4DTRA 1Q9YA 1MU2A 3MECA 4HHTA 1RNHA 4BDYA 4BDPA 1C1BA 1C0UA 3P1GA 3MAQA 2G8UA 1JLEA 1NJYA 1QSYA 4KREA 1KRPA 1GOAA 4IDKA 4FJNA 1RT1A 3L8BA 2GUIA 4DTJA 2XY5A 5FRNA 3K5NA 3ULDA 4FJXA 4C8NA 3I0SA 3QNOA 4CGFA 5K14A 5FRMA 4DG1A 4NCAA 4E7KA 3C94A 1TVRA 4BWMA 1KSPA 2OZSA 3TI0A 1J5OA 2F8TA 3SQ2A 3VQDA 1VSEA 3LP1A 4B8AB 4QCLA 4CHNA 4ID5A 4DTXA 4RG8A 4LD0A 3TR8A 1BHLA 1BCMA 2OZMA 3SPYA 1S9GA 4O0JA 3ZSVA 4Z4HA 3NH1A 3IG1A 3QEWA 3SJJA 2X6NA 3ZSOA 1RTDA 4DS4A 4FLZA 1WSGA 2VG6A 3CFRA 1N5YA 1IKVA 1JLBA 3DI6A 4AHSA 3ZT4A 1X1PA 4RW7A 2XY6A 1FKOA 2WONA 3HM9A 4KI4A 1T7PA 4EZ9A 4FK0A 3BGRA 3K5MA 4PY5A 3B6PA 1WN7A 3HVRA 4DTSA 1X9SA 3A2FA 3G0ZA 1TK0A 4IG3A 2A1RA 4FZYA 2EX3A 3MEDA 4I2PA 2YHBA 4KO0A 5I3UA 1I39A 1WLJA 4PWDA 3L3UA 2A1SA 4DSIA 3DOKA 3AVFA 3F73A 4AH9A 3SCXA 2VG5A 3TWHA 1T05A 4B9TA 1JL2A 3OJUA 3ZSYA 4CGHA 1I3AA 4M3RA 3OS1A 4CF0A 3K59A 1EP4A 4CGGA 4FM1A 4CIEA 1LWFA 4DQSA 1NKEA 4KPYA 1EKEA 4CJ4A 1C0MA 1C0TA 2IS3A 2OPSA 5EU7A 3KLFA 1UAXA 3V1OA 3KLIA 3EZ5A 3LDSA 3TAEA 4ELVA 3QNNA 2OA8A 1VK0A 1Y97A 3SPZA 3V9ZA 4DU4A 2Y1JA 4CGDA 3S3OA 2DY4A 4DTPA 1HYVA 4R5PA 2IAJA 4CIFA 1D9DA 1IG9A 3NAEA 3VQBA 3LZIA 1SV5A 2I5JA 4DTNA 3SQ0A 1KVCA 2Q3SA 1QS4A 2ZE2A 1SL1A 4B9NA 3U6FA 4CJ5A 4DFPA 4KHQA 1TAQA 1CXQA 1S1UA 1D9FA 4W5NA 4O55A 5HBMA 2E4LA 3OS2A 4KAZA 3NF9A 1WSIA 4FLVA 3NBPA 4I9LA 1CZ9A 3KLEA 4CJPA 2GBZA 1NK9A 3RMAA 3L2WA 3RR8A 1X9MA 3UIQA 2HHTA 4E7HA 4KRFA 2IDOA 1RT7A 4CEFA 4CK3A 1YTAA 4Z4FA 3SQ4A 4E89A 1LAVA 2EHGA 1JLFA 3VQ4A 3HT3A 1RBUA 4CCHA 1HYSA 2HHXA 4LSNA 1RBTA 4QAGA 1SKWA 2G8HA 2D5RA 2KW4A 4E1NA 2Z1HA 3LZJA 5KGXA 4B9LA 4HCBA 1WSFA 4CESA 4DQIA 3M8RA 3NGZA 4LSLA 3OYKA 4F2SA 3NCIA 5KRSA 4QOZB 1L3VA 1VRTA 4M3TA 1GOBA 2ITGA 1NK4A 3NF8A 3NF7A 3F9KA 4CF2A 1XI1A 1TKTA 4K8XA 1NK8A 4PUOA 4UQGA 5KI6A 4DTUA 2QXFA 4ICLA 3LALA 4DSJA 3SUNA 3VQ8A 3M8QA 3WNHA 5DK5A 4RW8A 3EYZA 1N6QA 2P51A 4B9VA 4FJ8A 1NJWA 2FBTA 3OYDA 2G8IA 2KZMA 4ELTA 1GOCA 2E6MA 3ZSXA 3O3GA 5C25A 1VRUA 4DTOA 2QKBA 2F96A 4CJEA 1RBVA 3VN5A 4CHYA 4PQUA 3OVNA 1TK8A 4N76A 1NKCA 4CJVA 4DFMA 2HB5A 2PZSA 2D0CA 4Z4CA 4E7JA 4L8RB 3RR7A 2OPQA 4J2DA 3LANA 4KB1A 3AVJA 3K5OA 2GV9A 4CJWA 2LSNA 3QETA 4ZTFA 2BDPA 1QQCA 4RW6A 3HJFA 4FJMA 3L2RA 4FM0A 3RMDA 5E41A 3JYTA 1JLCA 1U47A 3KD5E 3D45A 3VA0A 3ZSRA 4CHQA 2YNFA 1TL1A 3O3HA 5J2PA 3L2QA 3SV4A 4EZ6A 1BQNA 4FJKA 3AA5X 2NUBA 3QERA 3LPTA 3DRSA 3QEPA 1EETA 3LP3A 3RWUA 1S6PA 3LWLA 3SQ1A 3BDPA 3OJSA 1RTHA 5KGWA 4CEOA 2AJQA 1XC9A 1SL2A 1HMVA 4M42A 3QINA 3OYEA 3AVBA 5T7BA 4FJ5A 5JS1A 2B5JA 2YKMA 3V1RA 4ZTJA 3DYAA 3NGIA 1Q9XA 4AHCA 4FZXC 3NF6A 3ZCMA 4FLWA 3TABA 2KFZA 4BE0A 4M41A 2DFFA 2D0BA 3MEGA 4E7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV9 A;  3T1A A;  4O44 A;  3OY9 A;  2P5G A;  4IKF A;  4CEZ A;  3B6O A;  4BDZ A;  3PUF A;  2RF2 A;  3ZT1 A;  2PYJ A;  3NFA A;  3QIO A;  5C42 A;  3NE6 A;  4B9M A;  3QES A;  5CYQ A;  1F21 A;  1HJR A;  1LV5 A;  4B3O A;  4CJF A;  3CQ8 A;  3V9W A;  3SUO A;  2X6S A;  4Z0U A;  4F4K A;  3VQP A;  2QKK A;  1KTQ A;  2ETJ A;  4J2A A;  2JGU A;  3VQ7 A;  1QSS A;  4EP5 A;  3PX0 A;  3CYM A;  1RCH A;  4H4O A;  3M8P A;  3OYG A;  1KVB A;  2P1J A;  3OYJ A;  1HYZ A;  2XY8 A;  5HLF A;  4DSK A;  2R7Y A;  4CIG A;  4FJH A;  3LAM A;  4CEA A;  1JLA A;  4JLH A;  3OYL A;  2KTQ A;  1RDA A;  1ZBF A;  4WE1 A;  4BE1 A;  3AVL A;  1S9E A;  2IC3 A;  1TK5 A;  1S1V A;  2HHW A;  3DRR A;  1BIS A;  4CFC A;  4OVL A;  5HRN A;  3DLH A;  1WNS A;  2YNG A;  3DMJ A;  4N47 A;  3VQ9 A;  4FJJ A;  4KFB A;  5FRO A;  4K8Z A;  2XY7 A;  1JXB A;  1Q8I A;  3AVK A;  3HL8 A;  4CJS A;  4DFJ A;  3TAF A;  1L3U A;  4Z4G A;  1A5W A;  1BL3 A;  1EXQ A;  2XHB A;  1UA0 A;  1U04 A;  3VQQ A;  1J9A A;  4CFB A;  1ZYQ A;  4FM2 A;  3PV8 A;  1WSE A;  4ID1 A;  1S6Q A;  2WOM A;  1S1W A;  2VWK A;  4H4M A;  1WAF A;  3M8S A;  4HUG A;  1HQE A;  4KV8 A;  3O4N A;  4OGE A;  3TAR A;  4E19 A;  5KTQ A;  4FLX A;  3HPG A;  3CFO A;  3KIO A;  1L3T A;  3PY8 A;  2HHS A;  4FCY A;  1CXU A;  4G1Q A;  4CEQ A;  2PY5 A;  4KB0 A;  3ITH A;  3V81 A;  4FYD A;  1IO2 A;  1VSF A;  4KHY A;  3NGY A;  3O4Q A;  2OPR A;  4OLA A;  1A5V A;  3V6D A;  4N41 A;  4NCG A;  1KLN A;  1TKZ A;  1LAW A;  1KFS A;  4AIL C;  1J54 A;  1RTJ A;  1BI4 A;  2YHA A;  4DF8 A;  1C1A A;  4Y1C A;  4J2B A;  3G10 A;  1W9H A;  3HP9 A;  1D5A A;  4O5B A;  4CF8 A;  3OS0 A;  3DRP A;  4JS4 A;  3ZSW A;  4DMN A;  3V9S A;  4B9S A;  5CYM A;  4XIU A;  4NYN A;  2HW3 A;  3AVH A;  1XWL A;  1RBR A;  5HRR A;  4DTM A;  4CJ3 A;  3NH0 A;  3KKR A;  3AO5 A;  4OPK A;  1VSL A;  4RW9 A;  3KLG A;  3L3V A;  3RRG A;  4KTQ A;  3P5J A;  2IOC A;  4CFA A;  3NHG A;  4JS5 A;  4FK2 A;  4DU1 A;  5J2Q A;  1T03 A;  2HND A;  3AVC A;  3WNE A;  5SWM A;  2BGG A;  1RDC A;  1Z25 A;  3OYN A;  4DQR A;  1BI4 B;  1IKW A;  2OPP A;  1ASV A;  2RKI A;  1TKD A;  4O4G A;  1FXX A;  1NK6 A;  4I2Q A;  1RT4 A;  2XO7 A;  4OGC A;  1K6Y A;  3AVN A;  4YNQ A;  3DLE A;  4E1M A;  2HHU A;  3L2V A;  4KTZ A;  4KHN A;  3QIP A;  3SNN A;  1J53 A;  1LW0 A;  1ZBU A;  4GW6 A;  4O0I A;  1NOY A;  3RMB A;  1U4B A;  1ASW A;  3PO5 A;  4BWJ A;  5CZ2 A;  1JXE A;  1W0H A;  3PO4 A;  2B4J A;  1Z26 A;  2O4I A;  3U3G A;  4GVM A;  1LWE A;  3V4I A;  4FW1 A;  3V1Q A;  4GMJ B;  4FXD A;  2OYQ A;  2O4G A;  4M3U A;  3MXM A;  3K57 A;  4HTU A;  4CJL A;  3PX4 A;  3AVM A;  2D0A A;  4Y1D A;  2FBX A;  1S1X A;  1UOC A;  2HNY A;  4HVJ A;  4DF4 A;  3CFP A;  1JKH A;  4KHW A;  1RT2 A;  1VSM A;  1KLM A;  1UA1 A;  1YVU A;  5HRO A;  1NOZ A;  4KHU A;  2JLE A;  5J2M A;  4FJ7 A;  4M3X A;  1LW2 A;  3LP0 A;  3ZT2 A;  3AVA A;  4FJG A;  3LP2 A;  1ZBI A;  3HXM A;  4BE2 A;  3IAY A;  3RMC A;  4HCC A;  4CJU A;  1DLO A;  5D3G A;  1YTU A;  3NH2 A;  1WAJ A;  3VQ5 A;  3FFI A;  3AO2 A;  3WNG A;  3LAK A;  3KLH A;  3TAG A;  4C8O A;  4FJ9 A;  2HHV A;  1R0A A;  2KQ2 A;  1C1C A;  2YV0 X;  3DLG A;  1S1T A;  3C95 A;  3RTV A;  4IG0 A;  4HUF A;  3TAQ A;  3E01 A;  3V9U A;  4YFU A;  3KK1 A;  3HST B;  4CGJ A;  1L5U A;  2HHQ A;  3CM5 A;  3H08 A;  4F3T A;  4M3W A;  4DSE A;  4Q0B A;  4E7L A;  4CED A;  4TSX A;  3D0P A;  4DFK A;  1TGO A;  4CJK A;  4Z4E A;  4IFV A;  4BAC A;  4FK4 A;  5CY4 A;  1U49 A;  3QO9 A;  1VSJ A;  4DWI A;  3PX6 A;  4H8K A;  4FLT A;  3OYB A;  1B9D A;  2G8V A;  2ZQB A;  3OYM A;  2KFN A;  5J1E A;  4FLY A;  2Z1J A;  4CK2 A;  2YNH A;  4B8C A;  1NK5 A;  4CE9 A;  4HUE A;  2DFH A;  3EY1 A;  3NDK A;  4N56 A;  2ATQ A;  3DOL A;  1DTT A;  1YT3 A;  3HYF A;  2VG7 A;  3C6U A;  1RT5 A;  4LY7 A;  4JRP A;  4FJL A;  1KVA A;  1IKY A;  3AO3 A;  4KKO A;  3IRX A;  3TAM A;  1T8E A;  1RIL A;  3K2P A;  4CER A;  4CFD A;  3RRH A;  5DMR A;  4C8M A;  1QSL A;  3CG7 A;  4E3S A;  5KRT A;  1G15 A;  4OLB A;  1HNI A;  1WSH A;  1QHT A;  3S9H A;  2DTU A;  4KI6 A;  1S5J A;  4CGI A;  2FBV A;  3ASM A;  2IGI A;  4KTW A;  1ZBL A;  1FK9 A;  4NYF A;  3T3F A;  2Y1I A;  4IBN A;  4E0D A;  2X78 A;  3HP6 A;  4LH4 A;  4DQQ A;  1CZB A;  1C6V A;  1JLQ A;  4EP4 A;  1DTQ A;  3AVI A;  1ITG A;  4ZHR A;  1SL0 A;  4F2R A;  4Z4I A;  4CEB A;  2P5O A;  4MQ3 A;  4F8R A;  1ASU A;  5C24 A;  3K58 A;  1IH7 A;  2X74 A;  1BQM A;  4CK1 A;  4DU3 A;  3AA3 A;  2XRI A;  4CJR A;  3THV A;  4CF9 A;  4I7F A;  3VQ6 A;  1NJX A;  4DSL A;  3IS9 A;  2F8S A;  1XHX A;  1SUQ A;  2Z1I A;  1O1W A;  1RDD A;  4AHV A;  3SYZ A;  4B08 A;  4CEE A;  2YNI A;  3TAN A;  2PYL A;  5I42 A;  3KTQ A;  3DLK A;  2KZZ A;  4CJQ A;  3KK3 A;  3SZ2 A;  3U3Y A;  1B92 A;  3ZSZ A;  4W5O A;  3ZSQ A;  1LWC A;  2FC0 A;  1NKB A;  1IKX A;  4CHO A;  4N5S A;  4W5Q A;  1WSJ A;  4M3Y A;  3DM2 A;  4AHR A;  3I8D A;  3KD1 E;  1REV A;  2W42 A;  3SV3 A;  4M3Z A;  4PA1 A;  2BE2 A;  2FBY A;  2B6A A;  3HPH A;  2RN2 A;  1B9F A;  1TKX A;  2RPI A;  4FJI A;  1JL1 A;  3OYC A;  4ELU A;  1JLG A;  1KCF A;  4OJR A;  1CLQ A;  5SZT A;  4CF1 A;  3LPU A;  4FZZ A;  1RT3 A;  3HO1 A;  3QEI A;  1L3S A;  1VSD A;  1NJZ A;  1TAU A;  1RDB A;  4IFY A;  1VSH A;  4FLU A;  3S3N A;  1SKR A;  4B9U A;  4I9Q A;  1HNV A;  4F3O A;  4LH5 A;  2HMI A;  3ISN C;  3LWM A;  4DQP A;  2E6L A;  3AA2 A;  4JRQ A;  1RBS A;  3AO4 A;  1X9W A;  3OYI A;  4CEC A;  1BIU A;  3HK2 A;  2QK9 A;  3AO1 A;  4OKJ A;  1QE1 A;  3QEX A;  3ZT3 A;  1A5X A;  3OYF A;  1HPZ A;  1FKP A;  2BAN A;  4DLG A;  1HQU A;  2VWJ A;  3AVG A;  4MFB A;  3VQE A;  5HRS A;  3OYH A;  4W5T A;  3TAP A;  1ZBH A;  4CHZ A;  5HRP A;  3HPO A;  3SUQ A;  1VSI A;  3MXI A;  3VQA A;  2G8K A;  2Z1G A;  3QEV A;  1NK7 A;  4KHS A;  3CM6 A;  3KKS A;  4OKK A;  2DFE A;  3O3F A;  3OYA A;  3VQC A;  3DLR A;  4AHU A;  4FW2 A;  1UWB A;  4RW4 A;  3WNF A;  3VA3 A;  3QLH A;  1TL3 A;  2ZD1 A;  4C8L A;  3T19 A;  4OKE A;  3JSM A;  3AA4 A;  3KJV A;  3MEE A;  3K5L A;  3P83 D;  3KK2 A;  5CZ1 A;  4DS5 A;  1SKS A;  4OPJ A;  4FVM A;  3DLB A;  1KFD A;  2HVI A;  4DLE A;  5J2N A;  3S3M A;  1BIZ A;  3HVT A;  3ZT0 A;  1VSK A;  4W5R A;  3SI6 A;  1U45 A;  4C8K A;  4J2E A;  2G8W A;  3I0R A;  5FDL A;  4CHP A;  1RT6 A;  1D8Y A;  4NCB A;  5HP1 A;  1NK0 A;  2YKN A;  1BGX T;  3SUP A;  1EX4 A;  1U48 A;  1RTI A;  1XHZ A;  4CJT A;  3ALY A;  3L2U A;  1QTM A;  4Q5V A;  1HRH A;  1TV6 A;  1BCO A;  2G8F A;  3MXJ A;  5JS2 A;  4AHT A;  4M45 A;  3V9X A;  2HNZ A;  2HVH A;  4DSF A;  3C6T A;  4DTR A;  1Q9Y A;  1MU2 A;  3MEC A;  4HHT A;  1RNH A;  4BDY A;  4BDP A;  1C1B A;  1C0U A;  3P1G A;  3MAQ A;  2G8U A;  1JLE A;  1NJY A;  1QSY A;  4KRE A;  1KRP A;  1GOA A;  4IDK A;  4FJN A;  1RT1 A;  3L8B A;  2GUI A;  4DTJ A;  2XY5 A;  5FRN A;  3K5N A;  3ULD A;  4FJX A;  4C8N A;  3I0S A;  3QNO A;  4CGF A;  5K14 A;  5FRM A;  4DG1 A;  4NCA A;  4E7K A;  3C94 A;  1TVR A;  4BWM A;  1KSP A;  2OZS A;  3TI0 A;  1J5O A;  2F8T A;  3SQ2 A;  3VQD A;  1VSE A;  3LP1 A;  4B8A B;  4QCL A;  4CHN A;  4ID5 A;  4DTX A;  4RG8 A;  4LD0 A;  3TR8 A;  1BHL A;  1BCM A;  2OZM A;  3SPY A;  1S9G A;  4O0J A;  3ZSV A;  4Z4H A;  3NH1 A;  3IG1 A;  3QEW A;  3SJJ A;  2X6N A;  3ZSO A;  1RTD A;  4DS4 A;  4FLZ A;  1WSG A;  2VG6 A;  3CFR A;  1N5Y A;  1IKV A;  1JLB A;  3DI6 A;  4AHS A;  3ZT4 A;  1X1P A;  4RW7 A;  2XY6 A;  1FKO A;  2WON A;  3HM9 A;  4KI4 A;  1T7P A;  4EZ9 A;  4FK0 A;  3BGR A;  3K5M A;  4PY5 A;  3B6P A;  1WN7 A;  3HVR A;  4DTS A;  1X9S A;  3A2F A;  3G0Z A;  1TK0 A;  4IG3 A;  2A1R A;  4FZY A;  2EX3 A;  3MED A;  4I2P A;  2YHB A;  4KO0 A;  5I3U A;  1I39 A;  1WLJ A;  4PWD A;  3L3U A;  2A1S A;  4DSI A;  3DOK A;  3AVF A;  3F73 A;  4AH9 A;  3SCX A;  2VG5 A;  3TWH A;  1T05 A;  4B9T A;  1JL2 A;  3OJU A;  3ZSY A;  4CGH A;  1I3A A;  4M3R A;  3OS1 A;  4CF0 A;  3K59 A;  1EP4 A;  4CGG A;  4FM1 A;  4CIE A;  1LWF A;  4DQS A;  1NKE A;  4KPY A;  1EKE A;  4CJ4 A;  1C0M A;  1C0T A;  2IS3 A;  2OPS A;  5EU7 A;  3KLF A;  1UAX A;  3V1O A;  3KLI A;  3EZ5 A;  3LDS A;  3TAE A;  4ELV A;  3QNN A;  2OA8 A;  1VK0 A;  1Y97 A;  3SPZ A;  3V9Z A;  4DU4 A;  2Y1J A;  4CGD A;  3S3O A;  2DY4 A;  4DTP A;  1HYV A;  4R5P A;  2IAJ A;  4CIF A;  1D9D A;  1IG9 A;  3NAE A;  3VQB A;  3LZI A;  1SV5 A;  2I5J A;  4DTN A;  3SQ0 A;  1KVC A;  2Q3S A;  1QS4 A;  2ZE2 A;  1SL1 A;  4B9N A;  3U6F A;  4CJ5 A;  4DFP A;  4KHQ A;  1TAQ A;  1CXQ A;  1S1U A;  1D9F A;  4W5N A;  4O55 A;  5HBM A;  2E4L A;  3OS2 A;  4KAZ A;  3NF9 A;  1WSI A;  4FLV A;  3NBP A;  4I9L A;  1CZ9 A;  3KLE A;  4CJP A;  2GBZ A;  1NK9 A;  3RMA A;  3L2W A;  3RR8 A;  1X9M A;  3UIQ A;  2HHT A;  4E7H A;  4KRF A;  2IDO A;  1RT7 A;  4CEF A;  4CK3 A;  1YTA A;  4Z4F A;  3SQ4 A;  4E89 A;  1LAV A;  2EHG A;  1JLF A;  3VQ4 A;  3HT3 A;  1RBU A;  4CCH A;  1HYS A;  2HHX A;  4LSN A;  1RBT A;  4QAG A;  1SKW A;  2G8H A;  2D5R A;  2KW4 A;  4E1N A;  2Z1H A;  3LZJ A;  5KGX A;  4B9L A;  4HCB A;  1WSF A;  4CES A;  4DQI A;  3M8R A;  3NGZ A;  4LSL A;  3OYK A;  4F2S A;  3NCI A;  5KRS A;  4QOZ B;  1L3V A;  1VRT A;  4M3T A;  1GOB A;  2ITG A;  1NK4 A;  3NF8 A;  3NF7 A;  3F9K A;  4CF2 A;  1XI1 A;  1TKT A;  4K8X A;  1NK8 A;  4PUO A;  4UQG A;  5KI6 A;  4DTU A;  2QXF A;  4ICL A;  3LAL A;  4DSJ A;  3SUN A;  3VQ8 A;  3M8Q A;  3WNH A;  5DK5 A;  4RW8 A;  3EYZ A;  1N6Q A;  2P51 A;  4B9V A;  4FJ8 A;  1NJW A;  2FBT A;  3OYD A;  2G8I A;  2KZM A;  4ELT A;  1GOC A;  2E6M A;  3ZSX A;  3O3G A;  5C25 A;  1VRU A;  4DTO A;  2QKB A;  2F96 A;  4CJE A;  1RBV A;  3VN5 A;  4CHY A;  4PQU A;  3OVN A;  1TK8 A;  4N76 A;  1NKC A;  4CJV A;  4DFM A;  2HB5 A;  2PZS A;  2D0C A;  4Z4C A;  4E7J A;  4L8R B;  3RR7 A;  2OPQ A;  4J2D A;  3LAN A;  4KB1 A;  3AVJ A;  3K5O A;  2GV9 A;  4CJW A;  2LSN A;  3QET A;  4ZTF A;  2BDP A;  1QQC A;  4RW6 A;  3HJF A;  4FJM A;  3L2R A;  4FM0 A;  3RMD A;  5E41 A;  3JYT A;  1JLC A;  1U47 A;  3KD5 E;  3D45 A;  3VA0 A;  3ZSR A;  4CHQ A;  2YNF A;  1TL1 A;  3O3H A;  5J2P A;  3L2Q A;  3SV4 A;  4EZ6 A;  1BQN A;  4FJK A;  3AA5 X;  2NUB A;  3QER A;  3LPT A;  3DRS A;  3QEP A;  1EET A;  3LP3 A;  3RWU A;  1S6P A;  3LWL A;  3SQ1 A;  3BDP A;  3OJS A;  1RTH A;  5KGW A;  4CEO A;  2AJQ A;  1XC9 A;  1SL2 A;  1HMV A;  4M42 A;  3QIN A;  3OYE A;  3AVB A;  5T7B A;  4FJ5 A;  5JS1 A;  2B5J A;  2YKM A;  3V1R A;  4ZTJ A;  3DYA A;  3NGI A;  1Q9X A;  4AHC A;  4FZX C;  3NF6 A;  3ZCM A;  4FLW A;  3TAB A;  2KFZ A;  4BE0 A;  4M41 A;  2DFF A;  2D0B A;  3MEG A;  4E7I A; 
#chains in the Genus database with same CATH topology
 3U9D A;  3T1A A;  4O44 A;  3IMX A;  4JI1 K;  3B6O A;  3CC2 N;  3ZT1 A;  3VF2 A;  1XNQ K;  3VEW A;  3BUZ B;  3VF4 A;  2QEX N;  3NFA A;  3QIO A;  2VQE K;  5C42 A;  3NE6 A;  4B9M A;  3QES A;  1VQ5 N;  2OAN A;  1HJR A;  4FL9 A;  1IBK K;  4BRG A;  3VQP A;  2ETJ A;  5C15 A;  4BRP A;  4XH5 A;  4LFC K;  5EY4 A;  1JCE A;  3TSQ A;  1KVB A;  4GNI A;  1IBM K;  2KTQ A;  1BA1 A;  4WE1 A;  3KK7 A;  3KZB A;  3EN9 A;  2KHO A;  1BIS A;  1WNS A;  3ATV A;  2P9N A;  3DMJ A;  2A42 A;  3O5B A;  5FRO A;  4K8Z A;  2XY7 A;  1WOQ A;  4DFJ A;  2D4W A;  2QTD A;  1ZYQ A;  1S6Q A;  4HUG A;  2NRZ A;  4E19 A;  3CFO A;  2QWN A;  5AQL A;  2OCE A;  1NGB A;  4QS7 A;  4H0V B;  2PY5 A;  4KB0 A;  2WUS A;  1IO2 A;  1Y64 A;  4KHY A;  4OLA A;  2OPR A;  3V6D A;  4N41 A;  1TKZ A;  1LAW A;  1VQ4 N;  4AIL C;  1J54 A;  1RTJ A;  4ILJ A;  3N4Q A;  4O5B A;  3VEO A;  3OS0 A;  3DRP A;  4JS4 A;  1J6Z A;  2E2Q A;  3O9S A;  1RBR A;  2P9U B;  3IKM A;  3M1F A;  4DTM A;  1GLL O;  1KXP A;  3IDH A;  3KKR A;  4H0T B;  1U2V B;  4OPK A;  1HX1 A;  1ATS A;  4RW9 A;  2IVP A;  3RRG A;  4KTQ A;  3LDQ A;  3NHG A;  3CI5 A;  2D0P A;  2IIR A;  4M7X A;  4FK2 A;  4B3R K;  3BZK A;  2HND A;  3WNE A;  1RDC A;  1S72 N;  2OPP A;  3HOT A;  1TKD A;  1NGD A;  4I2Q A;  2XO7 A;  4BRE A;  3ZET A;  4AM6 A;  3R8E A;  1NWK A;  1OVY A;  5KPZ A;  1K6Y A;  4EIA A;  3DLE A;  3N4P A;  2HHU A;  4KTZ A;  1VQ9 N;  1ZBU A;  4YOR A;  4BWJ A;  2PFU A;  4A2A A;  4GKK K;  4FW1 A;  3OTO K;  4GMJ B;  2WC9 A;  4QS8 A;  4FXD A;  4Z94 A;  4BRQ A;  3VET A;  3A5M C;  3K57 A;  4CJL A;  3R6M A;  3TSP A;  4DF4 A;  3CFP A;  3FR0 A;  4CW7 B;  5J2M A;  3ZT2 A;  2F9T A;  3H3N O;  3LP2 A;  4BE2 A;  3RMC A;  4CJU A;  4NO7 A;  1YTU A;  3NH2 A;  4O8K A;  1WAJ A;  4WFB L;  3FFI A;  1YUW A;  3AO2 A;  3KLH A;  1C1C A;  3DLG A;  3C95 A;  4IG0 A;  3TAQ A;  4MO5 A;  4CGJ A;  3THW B;  1Q18 A;  3MWT A;  4M3W A;  1V4S A;  4CJK A;  4IFV A;  4PL7 A;  2ZJR L;  1U49 A;  3B8A X;  2G8V A;  4WCE L;  4AM7 A;  4B8C A;  4HUE A;  2ATQ A;  4JRP A;  3C6U A;  3J7Y P;  1IKY A;  3TAM A;  1XC3 A;  1RIL A;  3K2P A;  1NMD A;  5DMR A;  4C8M A;  1QSL A;  2E8A A;  1G15 A;  1HNI A;  1WSH A;  1QHT A;  4KI6 A;  2FBV A;  3ASM A;  4M3U A;  2P9L A;  3HP6 A;  4LH4 A;  1C6V A;  1JLQ A;  1DTQ A;  1BG3 A;  5TKW A;  4Z4I A;  2A5X A;  4MQ3 A;  3E9P A;  5AQS A;  4CK1 A;  3THV A;  2A6A A;  4C1N K;  3LM2 A;  4CF9 A;  3VQ6 A;  1NJX A;  4AHV A;  1RDD A;  2PYL A;  2YNI A;  5I42 A;  3CJA A;  3KK3 A;  1QVG M;  3ZSZ A;  3ZSQ A;  2F7T A;  2P9N B;  1C0F A;  2A40 A;  5KQD A;  3UE5 A;  4CHO A;  4W5Q A;  3HZ6 A;  1LCU A;  1WB9 A;  5GAG P;  3J7A P;  2J4R A;  1ZBS A;  2W42 A;  4PA1 A;  3SK3 A;  3WXK A;  3HPH A;  5M1P A;  3QB0 A;  4CZI A;  1JL1 A;  3OYC A;  3ZX0 A;  1CLQ A;  5SZT A;  5JIC A;  1L3S A;  4BGB A;  3WXM B;  3W0L A;  1VSH A;  4CBX A;  4A59 A;  1KC8 O;  2E6L A;  4CEC A;  3A5L C;  4FWQ A;  1IG8 A;  4OKJ A;  3ZT3 A;  3OYF A;  1FKP A;  4BRI A;  3KWG A;  3AVG A;  3O9R A;  4JAX A;  5EX5 A;  3MXI A;  5AR0 A;  4DB3 A;  3QEV A;  1K8K A;  1NK7 A;  3CCE N;  3VQC A;  3DLR A;  3SLC A;  4RW4 A;  3BEX A;  1TL3 A;  4B1V A;  3JSM A;  4C8L A;  1N32 K;  4MLE A;  3KJV A;  3SJH A;  3P83 D;  5CZ1 A;  4O5F A;  3EKS A;  2KKZ A;  2Q2R A;  4OPJ A;  4WYB A;  4YOY A;  3DLB A;  3ZT0 A;  4A5B A;  4C8K A;  2G8W A;  1D8Y A;  5HP1 A;  1EX4 A;  3VGM A;  1U48 A;  2HBL A;  3ALY A;  1ILY A;  2HVH A;  3V9X A;  3MN9 A;  2HNZ A;  2VWB A;  4WFA L;  4DTR A;  3AAR A;  1RNH A;  4BDP A;  2O8C A;  1C1B A;  1C0U A;  4BRA A;  3SAF A;  3MAQ A;  2G8U A;  4KRE A;  1GOA A;  5H1S Q;  4FJN A;  2XY5 A;  4DTJ A;  5JLH A;  3ULD A;  3I0S A;  3SMP A;  4CGF A;  4ISF A;  4E7K A;  3C94 A;  1TVR A;  4IJA A;  1DGK N;  4BWM A;  1W7A A;  3SQ2 A;  3LP1 A;  2QA4 N;  4DTX A;  4RG8 A;  4O0J A;  4Z4H A;  3SJJ A;  2X6N A;  1NU0 A;  4FLZ A;  2HHH K;  1N5Y A;  3RSE A;  3LDO A;  2XY6 A;  1FKO A;  2QXL A;  5BRF A;  4FK0 A;  3NMU A;  3HSC A;  3B6P A;  2CGL A;  4DR5 K;  4DTS A;  1TK0 A;  3UIQ A;  4CZE A;  2YHB A;  3MX2 A;  5I3U A;  3OW2 M;  2VQF K;  4DSI A;  3DOK A;  4HWI A;  3F73 A;  4AH9 A;  4BC3 A;  2GWJ A;  2VG5 A;  3TWH A;  3I8B A;  2UXC K;  4M3R A;  2ZJQ L;  2Q31 A;  3K59 A;  1EP4 A;  4FM1 A;  4DHY A;  4KPY A;  3EZ5 A;  3TAE A;  3LDS A;  4LF4 K;  4LC9 B;  1VQK N;  2OA8 A;  2UXD K;  3T69 A;  1WBB A;  3ULE A;  1WBD A;  1ATR A;  1HYV A;  3VGK A;  2P9L B;  1YJN N;  3QFU A;  4J8F A;  2Q97 A;  5JVG L;  1KVC A;  2NLX A;  1QS4 A;  2Q3S A;  4FWL A;  2GTD A;  4H0O A;  4DKW A;  1SL1 A;  4B9N A;  1M90 O;  1NNE A;  4O55 A;  3ZEU A;  5HBM A;  2E4L A;  3OS2 A;  3NF9 A;  3NBP A;  4BVO A;  4E7H A;  3MWP A;  3TSU A;  5A2Q O;  1U6Z A;  4JK9 A;  4IOX A;  3LDN A;  4B1Z A;  2D5R A;  1WSF A;  1N33 K;  3H46 O;  4F2S A;  3NCI A;  5KRS A;  3FZH A;  4QOZ B;  1VRT A;  4B3T K;  1NK4 A;  4BRO A;  3MX5 A;  4ILH A;  4CF2 A;  4GY2 B;  4EHT A;  1Q81 O;  3DWL A;  3LAL A;  4YOT A;  3VQ8 A;  4LFB K;  1N36 K;  3EYZ A;  2G8I A;  1NJW A;  3L6Q A;  2E6M A;  5CE3 A;  1VRU A;  5AQU A;  2F96 A;  1GLA G;  1NGI A;  2PZS A;  4E7J A;  1I94 K;  3EKU A;  3RR7 A;  3G25 A;  3QET A;  2GV9 A;  1HKB A;  1QQC A;  2UUB K;  3MK6 A;  4FM0 A;  3ENB A;  4BRN A;  4B1X B;  4CHQ A;  4EZ6 A;  4FJK A;  3LPT A;  3RWU A;  1EET A;  3S41 A;  1S6P A;  2BUP A;  3PIO L;  5KGW A;  4H5R A;  4IEI A;  4DV6 K;  2KLA A;  4FO0 A;  3AVB A;  5T7B A;  4ZTJ A;  3NGI A;  4AHC A;  4BRM A;  1M1K O;  4M41 A;  3CCJ N;  2DFF A;  3MEG A;  3Q7B A;  3QEX A;  1OH8 A;  2P5G A;  1MA9 B;  3LDP A;  4MLH A;  1E4F T;  1BU6 O;  2PYJ A;  3JAM O;  5TKY A;  1F21 A;  3CQ8 A;  3V9W A;  3SUO A;  4JI2 K;  2X6S A;  4Z0U A;  3WUH A;  1KTQ A;  2NRX A;  4J2A A;  4RTF D;  1BUP A;  2WBN A;  2QM1 A;  3P31 A;  3O80 A;  3CQX A;  4KBO A;  2XY8 A;  4CEA A;  1RDA A;  1TK5 A;  4BE1 A;  1S9E A;  2IC3 A;  2HHW A;  3F2K A;  2IVN A;  3DLH A;  1YAG A;  4N47 A;  4KFB A;  4A62 A;  3EO3 A;  3HL8 A;  4FWO A;  1A5W A;  1GLE G;  1U04 A;  3M8S A;  2VWK A;  5M1N A;  5IT9 O;  4X64 K;  4OGE A;  4GV9 A;  1L3T A;  5KTQ A;  4FLX A;  1MWK A;  3PY8 A;  1T6D A;  4JKE A;  2HHS A;  4JKF A;  4DV1 K;  4G1Q A;  4FYD A;  1VSF A;  3DXK A;  3NGY A;  3O4Q A;  3GOI A;  4NCG A;  1KLN A;  1KFS A;  4DF8 A;  2E1Y A;  5KPT A;  2ASM A;  2FSJ A;  5AQM A;  3V9S A;  3VEN A;  4DMN A;  4U67 L;  3GL1 A;  5CYM A;  3CCU N;  4H5N A;  3AVH A;  1XWL A;  2HF3 A;  5HRR A;  4CJ3 A;  3NH0 A;  2A41 A;  1NG9 A;  3QBX A;  4R79 A;  2IOC A;  4CFA A;  4JS5 A;  4B3M K;  4DU1 A;  2NZT A;  4C1N I;  2BGG A;  3OYN A;  2RKI A;  2E2P A;  2QWO A;  3I56 N;  2JWL A;  1YIT N;  4KH5 A;  3VEZ A;  1LW0 A;  3P38 A;  1ASW A;  3J7Z O;  5CZ2 A;  1VAZ A;  3PO4 A;  4BRF A;  2O4I A;  4LF6 K;  3U3G A;  3V4I A;  3THX A;  2OYQ A;  3ENO A;  3TPQ A;  3CF5 L;  1X3N A;  3MXM A;  1NGG A;  4HTU A;  3GG4 A;  3THW A;  5JLF A;  1UOC A;  2FXU A;  3CJB A;  3L4Q A;  4HVJ A;  1RT2 A;  1VSM A;  4A61 A;  1UA1 A;  1NOZ A;  4DV4 K;  4FJ7 A;  1LW2 A;  2QW9 A;  3AVA A;  4FJG A;  4PL8 A;  1ZBI A;  3HXM A;  3IAY A;  3LAK A;  2QWP A;  1R0A A;  2KQ2 A;  1S1T A;  4YFU A;  3HST B;  1QZ6 A;  4F3T A;  3EZW A;  3T7Z A;  2F9W A;  5AQV A;  4DSE A;  4Q0B A;  3E9O A;  4CED A;  3D0P A;  4PKH A;  4DFK A;  3DXM B;  1TGO A;  4XH4 A;  4NLB A;  2UUC K;  5CY4 A;  1VSJ A;  1P90 A;  4H5V A;  3OYM A;  1RDU A;  3IUC A;  4CK2 A;  1NK5 A;  5JMV A;  3EY1 A;  3NDK A;  4N56 A;  3DOL A;  1YT3 A;  3HYF A;  2VG7 A;  4LY7 A;  1RT5 A;  4JKH A;  5AQG A;  3AO3 A;  4KKO A;  4X65 K;  3IRX A;  3RRH A;  4CFD A;  3H1V X;  1ZXO A;  3H1Q A;  5AQW A;  4OLB A;  4YY3 K;  3CIP A;  1S5J A;  4CGI A;  3ENH A;  4E0D A;  4NYF A;  2VYP A;  4IBN A;  2X78 A;  1CZB A;  4JEP A;  4EP4 A;  1ITG A;  1SL0 A;  4F2R A;  2HF4 A;  3PSI A;  4CEB A;  4JKG B;  5LMU K;  3K58 A;  5C2D A;  3VTH A;  4CJR A;  3TAN A;  2Z1I A;  4B9T A;  3SYZ A;  3PLA A;  2YJF A;  4BRK A;  2HBM A;  4CJQ A;  3SZ2 A;  3U9Z A;  4W5O A;  1NKB A;  1WSJ A;  3DM2 A;  3J81 O;  4WFN L;  2WTU A;  3SV3 A;  2E1Z A;  4BR2 A;  2BE2 A;  2FBY A;  3CCM N;  2RN2 A;  4K0K K;  1B9F A;  1TKX A;  4FJI A;  4OJR A;  3LPU A;  3A5O C;  3HRG A;  2BTF A;  1TAU A;  4IFY A;  4M3X A;  4FLU A;  4OPA A;  1HNV A;  4NXM K;  3ISN C;  2V7Z A;  2FF3 B;  3DXK B;  5GAD P;  2I7N A;  3AA2 A;  1RBS A;  1X9W A;  3OYI A;  4JI8 K;  5F0X A;  3AO1 A;  4M7Y A;  3OHR A;  3D2E B;  2VWJ A;  3VQE A;  2ZJP L;  4W5T A;  5E84 A;  3SUQ A;  2W41 A;  4KHS A;  4OKK A;  2YHY A;  3OYA A;  2PBD A;  1UWB A;  3WNF A;  3VA3 A;  3P4I A;  4OKE A;  3AA4 A;  1YVN A;  3K9J A;  3OBW A;  5BPN A;  4Y0W A;  2HVI A;  1BIZ A;  4B1U B;  1VSK A;  1U45 A;  3I0R A;  1RT6 A;  3FZF A;  1NK0 A;  3CC7 N;  3UKR B;  1RTI A;  2ZF5 O;  4CJT A;  3L2U A;  4Q5V A;  3HOS A;  4M45 A;  4DSF A;  3THX B;  1MU2 A;  4YOU A;  1VQ6 N;  4HHT A;  3CCR N;  3ZLJ A;  3T1H K;  1JLE A;  1KRP A;  4IDK A;  1RT1 A;  1X9J A;  2GUI A;  3O8M A;  3K5N A;  4IO9 L;  4C8N A;  1G99 A;  5AQT A;  3WXI A;  1J5E K;  4JKB A;  4NCA A;  3O08 A;  2OZS A;  5LJW A;  2F8T A;  1JCG A;  4BG8 A;  4BRC A;  4OX9 K;  1VSE A;  1XNR K;  4CHN A;  4LD0 A;  5AQP A;  2OZM A;  3WT0 A;  1MDU B;  1S9G A;  3ZX2 A;  2NRV A;  3NH1 A;  3ZSO A;  5KQ8 A;  1WSG A;  3J80 O;  3CFR A;  1JLB A;  3WQT A;  3D6R A;  4BG9 A;  4RW7 A;  2WON A;  1YHQ N;  1T7P A;  3K5M A;  3A8Y A;  4PY5 A;  1X9S A;  3A2F A;  3E9L A;  3G0Z A;  2A1R A;  1VQO N;  4AQY K;  2EX3 A;  2YJE A;  4I2P A;  1I39 A;  3SAG A;  1WLJ A;  4PWD A;  3D2F A;  4DR3 K;  1JL2 A;  3OJU A;  1I3A A;  4X66 K;  3OS1 A;  4BC5 A;  4DQS A;  3O4W A;  1EKE A;  1C0T A;  2E20 A;  2IS3 A;  3KLF A;  1UAX A;  1RFQ A;  4ELV A;  4IO8 A;  3MN7 A;  1QQO A;  4FOI A;  4FWK A;  4BR9 A;  4CIF A;  1SZ2 A;  3LZI A;  2VGM A;  5C10 A;  4BGA A;  4CJ5 A;  3CC4 N;  1TAQ A;  3L4I A;  1S1U A;  1D9F A;  4W5N A;  3A0I X;  4DV2 K;  4FLV A;  1WSI A;  4CBU A;  1HR0 K;  1NK9 A;  3RMA A;  3RR8 A;  3AAP A;  4KRF A;  4CEF A;  4CK3 A;  3WEE B;  4E89 A;  3SQ4 A;  1JLF A;  3HT3 A;  1HYS A;  4FOE A;  2O8F B;  4DR4 K;  1SKW A;  2HBK A;  4CZK A;  3O1B A;  2KW4 A;  3CCQ N;  1NGF A;  4CES A;  1YJ9 N;  4DQI A;  3T1Y K;  3M8R A;  3NGZ A;  1GOB A;  4GVE A;  3F9K A;  1NM1 A;  1TKT A;  4K8X A;  4PUO A;  4UQG A;  2QXF A;  4DSJ A;  4NB4 A;  3WNH A;  5DK5 A;  3VEV A;  3OYD A;  2KZM A;  4ILG B;  3FE1 A;  4B9Q A;  1DKG D;  2O8E B;  4F9O A;  4PQU A;  3OVN A;  1GLD G;  4N76 A;  4DFM A;  4DR2 K;  3K5O A;  4ZTF A;  2LSN A;  2BDP A;  1JCF A;  4RW6 A;  4FJM A;  3L2R A;  4K43 A;  5BN8 A;  2O8D B;  3KD5 E;  3D45 A;  4L3Q A;  2W6K A;  1TL1 A;  3VER A;  4WQ5 C;  2JWK A;  3BF1 A;  4FPB A;  3AA5 X;  3QER A;  5M1Q A;  4X62 K;  1RTH A;  5DM7 L;  4M42 A;  1XMO K;  3OYE A;  4YDU C;  2YKM A;  3DYA A;  4FZX C;  5BPM A;  3TAB A;  2DPN A;  4BE0 A;  1RCH A;  3SBT A;  2D0B A;  4OPH A;  2CGK A;  3PUF A;  1S3X A;  1BOT O;  5FPE A;  2NRT A;  1CZA N;  5C0Y A;  3EE9 A;  4B3O A;  4CJF A;  4LF7 K;  2JGU A;  1QSS A;  5AQY A;  4JD2 A;  3PX0 A;  4NLC A;  2IVO A;  4H4O A;  3M8P A;  3G4S N;  3OYG A;  2P1J A;  3OYJ A;  1JJ2 M;  4DSK A;  4CIG A;  4BQL A;  1JLA A;  4JLH A;  1ZBF A;  3AVL A;  1E4G T;  4BVP A;  1TYQ A;  3DRR A;  1VQP N;  4OVL A;  3VQ9 A;  2A3Z A;  1BDG A;  3D2F B;  3AY9 A;  1JXB A;  1Q8I A;  3AVK A;  4H0P A;  1DEJ A;  4CJS A;  3TAF A;  4DV0 K;  4Z4G A;  1R59 O;  2ASO A;  3O9T A;  1J9A A;  4CFB A;  1WSE A;  4JNE A;  2WOM A;  1S1W A;  4H4M A;  1WAF A;  2ITM A;  3CET A;  3CJ7 A;  1HQE A;  4KV8 A;  3O4N A;  4JI7 K;  2ASP A;  4JKA A;  3W3D A;  4FCY A;  1CXU A;  4CEQ A;  3LM9 A;  3V81 A;  1OH7 A;  2E88 A;  1XQS C;  3UKU B;  5AQF A;  1O13 A;  5AQX A;  1KD1 O;  2YHA A;  3G10 A;  5CR4 A;  5B8H A;  4NYN A;  1ESV A;  2AA4 A;  2FF6 A;  1NBW A;  3C7N B;  1NLV A;  3AO5 A;  3O9Q A;  3L3V A;  4IZ9 A;  4H5T A;  5J2Q A;  4K25 A;  5SWM A;  1BI4 B;  1IKW A;  5JVH L;  2GUP A;  1FXX A;  1NK6 A;  1RT4 A;  1QQN A;  4CZM A;  5GAE P;  2HST A;  4OGC A;  2PAV A;  2EWS A;  3L2V A;  4KHN A;  1YI2 N;  3SNN A;  1J53 A;  1HPM A;  3VOV A;  4GW6 A;  4H0X B;  2QWR A;  3RMB A;  1NJI O;  1NOY A;  3PO5 A;  4M63 C;  1BWF O;  3C65 A;  2P9I B;  1Z26 A;  4GVM A;  1LWE A;  4JYA K;  2O4G A;  4AF1 A;  1Q86 O;  4CZG A;  3PX4 A;  1K8A O;  5AFU H;  2YI1 A;  1S1X A;  1YF5 L;  1KAX A;  4FWP A;  1RGI A;  4KHW A;  1KLM A;  1YVU A;  3DAW A;  5HRO A;  4KHU A;  2JLE A;  3DXM A;  5KPR A;  3E66 A;  3LP0 A;  4BRL A;  1Z6R A;  4JI5 K;  3VEX A;  3VQ5 A;  1WUA A;  3WNG A;  4UY8 O;  5FPD A;  3RTV A;  2VCP A;  4JI3 K;  3KK1 A;  2HHQ A;  2NNW A;  1IV0 A;  4E7L A;  4TSX A;  4LFA K;  3MCA B;  2NRW A;  5FLX O;  4Z4E A;  4BAC A;  4O8U A;  4DR6 K;  4DWI A;  4H8K A;  1K9M O;  1B9D A;  2ZQB A;  3M5R A;  4JKG A;  2Z1J A;  4FLY A;  2YNH A;  4CE9 A;  2DFH A;  2HHV A;  4FJL A;  1KVA A;  3LL3 A;  1T8E A;  4CER A;  4WQ5 A;  4E3S A;  5KRT A;  2P9K B;  1SQK A;  1ZBL A;  1IJJ A;  1FK9 A;  3C6H A;  2F4V K;  4DQQ A;  4JKC A;  3AVI A;  4YDU A;  4JD2 B;  1IH7 A;  1DT9 A;  3AA3 A;  2XRI A;  5ADX A;  3FZK A;  3IS9 A;  2F8S A;  1XHX A;  1SUQ A;  1O1W A;  4CEE A;  3QDK A;  4DQ8 A;  1IBL K;  3DLK A;  3U3Y A;  1TYQ B;  3U8X A;  1LWC A;  3O1W A;  1Q82 O;  4M3Y A;  4CI6 A;  4AHR A;  5HL7 L;  1HKG A;  4M3Z A;  2B6A A;  3D2E A;  2RPI A;  4ELU A;  4CZL A;  1KCF A;  1XUP O;  4FZZ A;  2ZM6 K;  3QEI A;  4H0Y B;  1VSD A;  3S3N A;  1SKR A;  4B9U A;  4I9Q A;  1NMN A;  5EVZ A;  4F3O A;  2UU9 K;  2HMI A;  4JI4 K;  4JI6 K;  4BR0 A;  4DQP A;  4C23 A;  3GDQ A;  3AO4 A;  3IFR A;  1BIU A;  2AP1 A;  2QK9 A;  1N34 K;  1QE1 A;  1QZ5 A;  1VQ8 N;  1A5X A;  2BAN A;  5FPN A;  3CER A;  1HQU A;  4DLG A;  5HRS A;  4MFB A;  4BY9 C;  3KHY A;  2E2N A;  4CHZ A;  5HRP A;  1ZBH A;  2G8K A;  3VQA A;  4JK7 A;  2V7Y A;  2FLO A;  3VES A;  3RVC A;  3UKR A;  3O3F A;  4PKG A;  1GLJ O;  4FW2 A;  2UYT A;  2RHK A;  4FPA A;  4AHU A;  2GWK A;  3T19 A;  5BRD A;  3MEE A;  3K5L A;  3KK2 A;  5AQK A;  3QBW A;  4XEI A;  4DS5 A;  1SKS A;  1VQL N;  3EL2 A;  4CJ7 A;  1KFD A;  3S3M A;  1NGE A;  4W5R A;  4J2E A;  1Z05 A;  4CBW A;  4IOA L;  1BGX T;  1QTM A;  2CH6 A;  2G8F A;  1BCO A;  3MXJ A;  3TU5 A;  3MEC A;  4BDY A;  2V51 B;  3I55 N;  2YCH A;  3U4L A;  2QI2 A;  1NJY A;  1QSY A;  3OA9 A;  3L8B A;  5FRN A;  5BRE A;  3QNO A;  4DG1 A;  4U7B A;  3CHW A;  3M3Z A;  3P39 A;  4ID5 A;  4BRD A;  3TR8 A;  1BHL A;  1BCM A;  4BRH A;  3GBT A;  3SPY A;  3IG1 A;  4DV5 K;  4GKJ K;  2VG6 A;  3HTV A;  1IKV A;  3DI6 A;  1X1P A;  3QML A;  3ATU A;  4PHT X;  4KI4 A;  4EZ9 A;  5C12 A;  3R1X A;  1WN7 A;  3HVR A;  4FZY A;  3CJC A;  4DUZ K;  1X3M A;  3MED A;  4KO0 A;  3L3U A;  2A1S A;  3CPE A;  3MN5 A;  1T05 A;  3K0S A;  4CF0 A;  4CGG A;  5BR8 K;  4JHD A;  1LWF A;  4IFE A;  1NKE A;  4CJ4 A;  4CD1 A;  5EU7 A;  3V1O A;  1VK0 A;  4IJN A;  4CZF A;  5M1F A;  3V9Z A;  2Y1J A;  4CGD A;  2DY4 A;  4DTP A;  3WEE A;  4YOX A;  1D9D A;  3NAE A;  3VQB A;  1KQS M;  1SV5 A;  4YHH K;  2O8F A;  2UUA K;  1V4T A;  4DTN A;  2ZE2 A;  3U6F A;  2OTL N;  3NVM A;  4DFP A;  4KHQ A;  3FFK B;  1CXQ A;  4I9L A;  3VPZ A;  3WQU A;  2GBZ A;  4CJP A;  3L2W A;  1X9M A;  2HHT A;  1BO5 O;  2YHX A;  5BRH A;  1TUY A;  2IDO A;  1RT7 A;  3D7E O;  5AQO A;  1QHA A;  1SAZ A;  1LAV A;  2EHG A;  3VQ4 A;  5BPL A;  2HHX A;  4LSN A;  4A5A A;  4RCH A;  4YOV A;  3LZJ A;  2Z1H A;  3K9K A;  5KGX A;  5AZJ A;  4PKI A;  5AZI B;  4LSL A;  2O8E A;  2WFB A;  4BR7 A;  4CZJ A;  3UB5 A;  2ITG A;  3NF8 A;  3NF7 A;  2I7P A;  1XI1 A;  1NK8 A;  5IWA K;  1P8Z A;  4LF9 K;  3FLC O;  4DTU A;  1NGJ A;  4ICL A;  3SUN A;  4FSV A;  2O8D A;  3EEQ A;  2P51 A;  4FJ8 A;  2FBT A;  3BY5 A;  3C6A A;  1LOT B;  2P9P A;  3THY B;  5C25 A;  3VGL A;  2QKB A;  2RE2 A;  4LF8 K;  4CHY A;  4CJV A;  2D0C A;  4Z4C A;  1VHX A;  4L8R B;  5AQR A;  4QS9 A;  3LAN A;  3O9U A;  4CJW A;  3KVG A;  1YJW N;  3HJF A;  2FSK A;  2D1K A;  5E41 A;  3JYT A;  1JLC A;  3MN6 A;  1U47 A;  3VA0 A;  3ZSR A;  4ISG A;  5F2R A;  5GAH P;  3O3H A;  5J2P A;  2O8B B;  3LDL A;  1W97 L;  2NUB A;  3DRS A;  1HKC A;  3LP3 A;  3QEP A;  3LWL A;  3OJS A;  4CEO A;  1XC9 A;  1VQM N;  1HMV A;  4WQ4 C;  4DR1 K;  5AQZ A;  4K41 A;  4FJ5 A;  2B5J A;  4A57 A;  4MO4 A;  4RWT A;  4FLW A;  4MDB A;  2KFZ A;  4CD3 A;  3AV9 A;  3OY9 A;  2ZGZ A;  4IKF A;  4CEZ A;  4BDZ A;  2RF2 A;  1HNX K;  1QQM A;  2QWM A;  3JXU A;  4JV5 K;  3DLL L;  4YOW A;  3HBT A;  5CYQ A;  1LV5 A;  5AQJ A;  2GEL A;  4FWM A;  4F4K A;  1NGH A;  2QKK A;  2Q0U A;  3VQ7 A;  3J8A A;  4EP5 A;  4DV3 K;  2W40 A;  3CYM A;  2P9S B;  5AQQ A;  3DJC A;  2HMP A;  1HYZ A;  5HLF A;  3G71 N;  2R7Y A;  4FJH A;  4IXC A;  3LAM A;  3SBG A;  4B1W B;  4BR4 A;  5M1K A;  1FJG K;  3OYL A;  4BC4 A;  1S1V A;  4CFC A;  5HRN A;  3CCV N;  4IEE A;  5GIP A;  2YNG A;  3UKU A;  1HJO A;  3QIC A;  4H03 B;  1L3U A;  4IWV A;  1BL3 A;  1EXQ A;  3MDQ A;  2XHB A;  1UA0 A;  3VQQ A;  4FM2 A;  3PV8 A;  2D0O A;  4ID1 A;  4JHD B;  3ID6 A;  4BC2 A;  5BR9 A;  1SS6 A;  2CH5 A;  3TAR A;  3FGU A;  3HPG A;  3KIO A;  3C7N A;  2HOE A;  1S22 A;  3VF6 A;  4B1Y B;  5LY3 A;  3ITH A;  5LJV A;  3OBY A;  1A5V A;  1TUU A;  1BI4 A;  1C1A A;  4Y1C A;  2QWL A;  4J2B A;  1W9H A;  3HP9 A;  1D5A A;  4CF8 A;  5GIO A;  3ZSW A;  4B9S A;  4XIU A;  2HW3 A;  4EAH D;  4DV7 K;  1VSL A;  3KLG A;  1FW6 A;  3P5J A;  2P9I A;  3H6E A;  1T03 A;  3AVC A;  4WF9 L;  4IOC L;  1Z25 A;  4DQR A;  5AZJ B;  1ASV A;  5GIN A;  4O4G A;  2W6L A;  3AVN A;  1E3M A;  4YNQ A;  3L0Q A;  4E1M A;  3QIP A;  3CCL N;  4H5W A;  4O0I A;  1U4B A;  1HUX A;  1JXE A;  1W0H A;  2NRR A;  3CME N;  2B4J A;  4E1J A;  1NGA A;  3V1Q A;  4CVN E;  5M1O A;  2P9P B;  2NRH A;  3ZET B;  1ATN A;  5F1X A;  3AVM A;  2D0A A;  4Y1D A;  2FBX A;  3CXC M;  3R3L A;  2HNY A;  1JKH A;  2GX9 A;  3VEY A;  3AGR A;  4I6M A;  4HCC A;  5D3G A;  1DLO A;  1K73 O;  1OKJ A;  3TAG A;  4FJ9 A;  4C8O A;  2YV0 X;  4LF5 K;  4HUF A;  3AGK A;  3E1Y A;  3E01 A;  3V9U A;  1L5U A;  3CM5 A;  3H08 A;  1T3V A;  1RDW X;  2P9K A;  4FK4 A;  3QO9 A;  1NGC A;  3PX6 A;  4FLT A;  3OYB A;  3BP8 A;  2KFN A;  5J1E A;  2CGJ A;  4FJJ A;  3ID8 A;  1DTT A;  4FWR A;  2YX6 A;  1EWQ A;  3CG7 A;  2OTJ N;  2DTU A;  3S9H A;  4KTW A;  2IGI A;  3T3F A;  2Y1I A;  4WQ4 A;  3BZC A;  3R9P A;  3JS6 A;  2E5L K;  4ZHR A;  4NXN K;  2P5O A;  4F8R A;  1ASU A;  5C24 A;  2X74 A;  1BQM A;  4DU3 A;  4I7F A;  4DSL A;  3SAH A;  1EWR A;  4FWS A;  4B08 A;  3KTQ A;  1HLU A;  2KZZ A;  1B92 A;  4DR7 K;  2FC0 A;  1IKX A;  3I33 A;  4N5S A;  4JI0 K;  3I8D A;  1GLF O;  3KD1 E;  1REV A;  4B3S K;  5ELZ A;  1HNW K;  3TTC A;  1C0G A;  4JK8 A;  2HBJ A;  5AQH A;  5LMN K;  1T44 A;  5AFU A;  1JLG A;  2H3G X;  4CF1 A;  3HO1 A;  1RT3 A;  1EQY A;  4IDH A;  2YHW A;  1D4X A;  5AJ3 K;  1NJZ A;  3TTD A;  1RDB A;  4FVU A;  3VTI A;  4JN4 A;  4LH5 A;  3LWM A;  4JRQ A;  3HK2 A;  5C2F A;  3CQY A;  4MDA A;  1HPZ A;  1OH6 A;  5CHI A;  4FWN A;  3OYH A;  3SMS A;  3TAP A;  3QFP A;  3HPO A;  1VSI A;  2Z1G A;  3CM6 A;  3KKS A;  3C0B A;  2DFE A;  1W2B M;  3QLH A;  2ZD1 A;  3M6G A;  1N8R O;  4BQZ A;  2GEM A;  5AQN A;  4FVM A;  5EXW A;  4DLE A;  5J2N A;  3HVT A;  3SI6 A;  4KH4 A;  5LL6 Z;  5FDL A;  4CHP A;  1K8K B;  4K42 A;  4NCB A;  3HI0 A;  2YKN A;  3SUP A;  1XHZ A;  3PIP L;  1HRH A;  1TV6 A;  4KH6 A;  5JS2 A;  4AHT A;  2UXB K;  3C6T A;  1Q9Y A;  4JKD A;  3P1G A;  3G6E N;  5MLC Q;  4OO1 J;  4BR5 A;  4FJX A;  5K14 A;  5FRM A;  3F5T A;  1KSP A;  3TI0 A;  1KAZ A;  4I6M B;  1J5O A;  1VQ7 N;  4KHP K;  1OH5 A;  3VQD A;  3CPW M;  4B8A B;  4QCL A;  1XMQ K;  4V19 S;  2O8C B;  4DUY K;  3ZSV A;  3QEW A;  2QWQ A;  3CMA N;  3ZX3 A;  4DS4 A;  1RTD A;  4AHS A;  3MMV A;  1QVF M;  1ZC6 A;  3ZT4 A;  1EO1 A;  3H3O B;  1MWM A;  3HM9 A;  3Q7C A;  3BGR A;  2V52 B;  1GLC G;  2ZWH A;  2Q1N A;  4IG3 A;  4EFH A;  5EOY A;  2FSN A;  2E2O A;  3VMF B;  3SCX A;  3AVF A;  2ZGY A;  4EHU A;  3FZM A;  3ZSY A;  4CGH A;  3CCS N;  4CZH A;  3CJ9 A;  3A5N C;  3EE8 A;  3RSE B;  4CIE A;  1C0M A;  2OPS A;  5AQI A;  3KLI A;  3QNN A;  1Y97 A;  3SPZ A;  4DU4 A;  1YIJ N;  3S3O A;  4R5P A;  4HTL A;  2IAJ A;  1IG9 A;  2I5J A;  5DM6 L;  3SQ0 A;  1H1V A;  4XH1 A;  5I9E B;  3AAQ A;  5AZI A;  1BA0 A;  4KAZ A;  1CZ9 A;  3KLE A;  2P9U A;  1U2V A;  3FZL A;  1YTA A;  3ULE B;  4Z4F A;  4GV3 A;  4GV6 A;  4CCH A;  1RBU A;  3GE1 A;  4QAG A;  1RBT A;  1GLB G;  2G8H A;  3F9M A;  4E1N A;  4B9L A;  4HCB A;  3THY A;  3ZEU B;  3TTF A;  3OYK A;  5E26 A;  1L3V A;  4M3T A;  3HM8 A;  2Q36 A;  5KI6 A;  3H45 C;  4G9Z A;  3M8Q A;  4RW8 A;  1N6Q A;  3NVK A;  4B9V A;  2BH1 A;  4ELT A;  1GOC A;  3ZSX A;  3O3G A;  3KWI A;  4DTO A;  2O8B A;  5ADX H;  1HNZ K;  4CJE A;  1RBV A;  3VN5 A;  1TK8 A;  1NKC A;  3CD6 N;  2HB5 A;  3WXL A;  2OPQ A;  4J2D A;  2VGN A;  4KB1 A;  4A2B A;  5HOO A;  3AVJ A;  3CJ1 A;  1KAY A;  3ZYY X;  3BF3 A;  1VQN N;  3RMD A;  3MCP A;  2Q0R A;  5FPM A;  5BN9 A;  2YNF A;  1YXQ A;  3O6W A;  1T6C A;  3L2Q A;  3SV4 A;  1BQN A;  1Q7Y O;  3SQ1 A;  3BDP A;  2AJQ A;  3PSF A;  1SL2 A;  1OVQ A;  3QIN A;  5JS1 A;  4DCH A;  3V1R A;  1Q9X A;  3NF6 A;  3WXJ A;  4ISE A;  3ZCM A;  2P9S A;  4E7I A; 
#chains in the Genus database with same CATH homology
 3AV9 A;  3T1A A;  4O44 A;  3OY9 A;  2P5G A;  4IKF A;  4CEZ A;  3B6O A;  4BDZ A;  3PUF A;  2RF2 A;  3ZT1 A;  2PYJ A;  3NFA A;  3QIO A;  5C42 A;  3NE6 A;  4B9M A;  3QES A;  5CYQ A;  1F21 A;  1HJR A;  1LV5 A;  4B3O A;  4CJF A;  3CQ8 A;  3V9W A;  3SUO A;  2X6S A;  4Z0U A;  4F4K A;  3VQP A;  2QKK A;  1KTQ A;  2ETJ A;  4J2A A;  2JGU A;  3VQ7 A;  1QSS A;  4EP5 A;  3PX0 A;  3CYM A;  1RCH A;  4H4O A;  3M8P A;  3OYG A;  1KVB A;  2P1J A;  3OYJ A;  1HYZ A;  2XY8 A;  5HLF A;  4DSK A;  2R7Y A;  4CIG A;  4FJH A;  3LAM A;  4CEA A;  1JLA A;  4JLH A;  3OYL A;  2KTQ A;  1RDA A;  1ZBF A;  4WE1 A;  4BE1 A;  3AVL A;  1S9E A;  2IC3 A;  1TK5 A;  1S1V A;  2HHW A;  3DRR A;  1BIS A;  4CFC A;  4OVL A;  5HRN A;  3DLH A;  1WNS A;  2YNG A;  3DMJ A;  4N47 A;  3VQ9 A;  4FJJ A;  4KFB A;  5FRO A;  4K8Z A;  2XY7 A;  1JXB A;  1Q8I A;  3AVK A;  3HL8 A;  4CJS A;  4DFJ A;  3TAF A;  1L3U A;  4Z4G A;  1A5W A;  1BL3 A;  1EXQ A;  2XHB A;  1UA0 A;  1U04 A;  3VQQ A;  1J9A A;  4CFB A;  1ZYQ A;  4FM2 A;  3PV8 A;  1WSE A;  4ID1 A;  1S6Q A;  2WOM A;  1S1W A;  2VWK A;  4H4M A;  1WAF A;  3M8S A;  4HUG A;  1HQE A;  4KV8 A;  3O4N A;  4OGE A;  3TAR A;  4E19 A;  5KTQ A;  4FLX A;  3HPG A;  3CFO A;  3KIO A;  1L3T A;  3PY8 A;  2HHS A;  4FCY A;  1CXU A;  4G1Q A;  4CEQ A;  2PY5 A;  4KB0 A;  3ITH A;  3V81 A;  4FYD A;  1IO2 A;  1VSF A;  4KHY A;  3NGY A;  3O4Q A;  2OPR A;  4OLA A;  1A5V A;  3V6D A;  4N41 A;  4NCG A;  1KLN A;  1TKZ A;  1LAW A;  1KFS A;  4AIL C;  1J54 A;  1RTJ A;  1BI4 A;  2YHA A;  4DF8 A;  1C1A A;  4Y1C A;  4J2B A;  3G10 A;  1W9H A;  3HP9 A;  1D5A A;  4O5B A;  4CF8 A;  3OS0 A;  3DRP A;  4JS4 A;  3ZSW A;  4DMN A;  3V9S A;  4B9S A;  5CYM A;  4XIU A;  4NYN A;  2HW3 A;  3AVH A;  1XWL A;  1RBR A;  5HRR A;  4DTM A;  4CJ3 A;  3NH0 A;  3KKR A;  3AO5 A;  4OPK A;  1VSL A;  4RW9 A;  3KLG A;  3L3V A;  3RRG A;  4KTQ A;  3P5J A;  2IOC A;  4CFA A;  3NHG A;  4JS5 A;  4FK2 A;  4DU1 A;  5J2Q A;  1T03 A;  2HND A;  3AVC A;  3WNE A;  5SWM A;  2BGG A;  1RDC A;  1Z25 A;  3OYN A;  4DQR A;  1BI4 B;  1IKW A;  2OPP A;  1ASV A;  2RKI A;  1TKD A;  4O4G A;  1FXX A;  1NK6 A;  4I2Q A;  1RT4 A;  2XO7 A;  4OGC A;  1K6Y A;  3AVN A;  4YNQ A;  3DLE A;  4E1M A;  2HHU A;  3L2V A;  4KTZ A;  4KHN A;  3QIP A;  3SNN A;  1J53 A;  1LW0 A;  1ZBU A;  4GW6 A;  4O0I A;  1NOY A;  3RMB A;  1U4B A;  1ASW A;  3PO5 A;  4BWJ A;  5CZ2 A;  1JXE A;  1W0H A;  3PO4 A;  2B4J A;  1Z26 A;  2O4I A;  3U3G A;  4GVM A;  1LWE A;  3V4I A;  4FW1 A;  3V1Q A;  4GMJ B;  4FXD A;  2OYQ A;  2O4G A;  4M3U A;  3MXM A;  3K57 A;  4HTU A;  4CJL A;  3PX4 A;  3AVM A;  2D0A A;  4Y1D A;  2FBX A;  1S1X A;  1UOC A;  2HNY A;  4HVJ A;  4DF4 A;  3CFP A;  1JKH A;  4KHW A;  1RT2 A;  1VSM A;  1KLM A;  1UA1 A;  1YVU A;  5HRO A;  1NOZ A;  4KHU A;  2JLE A;  5J2M A;  4FJ7 A;  4M3X A;  1LW2 A;  3LP0 A;  3ZT2 A;  3AVA A;  4FJG A;  3LP2 A;  1ZBI A;  3HXM A;  4BE2 A;  3IAY A;  3RMC A;  4HCC A;  4CJU A;  1DLO A;  5D3G A;  1YTU A;  3NH2 A;  1WAJ A;  3VQ5 A;  3FFI A;  3AO2 A;  3WNG A;  3LAK A;  3KLH A;  3TAG A;  4C8O A;  4FJ9 A;  2HHV A;  1R0A A;  2KQ2 A;  1C1C A;  2YV0 X;  3DLG A;  1S1T A;  3C95 A;  3RTV A;  4IG0 A;  4HUF A;  3TAQ A;  3E01 A;  3V9U A;  4YFU A;  3KK1 A;  3HST B;  4CGJ A;  1L5U A;  2HHQ A;  3CM5 A;  3H08 A;  4F3T A;  4M3W A;  4DSE A;  4Q0B A;  4E7L A;  4CED A;  4TSX A;  3D0P A;  4DFK A;  1TGO A;  4CJK A;  4Z4E A;  4IFV A;  4BAC A;  4FK4 A;  5CY4 A;  1U49 A;  3QO9 A;  1VSJ A;  4DWI A;  3PX6 A;  4H8K A;  4FLT A;  3OYB A;  1B9D A;  2G8V A;  2ZQB A;  3OYM A;  2KFN A;  5J1E A;  4FLY A;  2Z1J A;  4CK2 A;  2YNH A;  4B8C A;  1NK5 A;  4CE9 A;  4HUE A;  2DFH A;  3EY1 A;  3NDK A;  4N56 A;  2ATQ A;  3DOL A;  1DTT A;  1YT3 A;  3HYF A;  2VG7 A;  3C6U A;  1RT5 A;  4LY7 A;  4JRP A;  4FJL A;  1KVA A;  1IKY A;  3AO3 A;  4KKO A;  3IRX A;  3TAM A;  1T8E A;  1RIL A;  3K2P A;  4CER A;  4CFD A;  3RRH A;  5DMR A;  4C8M A;  1QSL A;  3CG7 A;  4E3S A;  5KRT A;  1G15 A;  4OLB A;  1HNI A;  1WSH A;  1QHT A;  3S9H A;  2DTU A;  4KI6 A;  1S5J A;  4CGI A;  2FBV A;  3ASM A;  2IGI A;  4KTW A;  1ZBL A;  1FK9 A;  4NYF A;  3T3F A;  2Y1I A;  4IBN A;  4E0D A;  2X78 A;  3HP6 A;  4LH4 A;  4DQQ A;  1CZB A;  1C6V A;  1JLQ A;  4EP4 A;  1DTQ A;  3AVI A;  1ITG A;  4ZHR A;  1SL0 A;  4F2R A;  4Z4I A;  4CEB A;  2P5O A;  4MQ3 A;  4F8R A;  1ASU A;  5C24 A;  3K58 A;  1IH7 A;  2X74 A;  1BQM A;  4CK1 A;  4DU3 A;  3AA3 A;  2XRI A;  4CJR A;  3THV A;  4CF9 A;  4I7F A;  3VQ6 A;  1NJX A;  4DSL A;  3IS9 A;  2F8S A;  1XHX A;  1SUQ A;  2Z1I A;  1O1W A;  1RDD A;  4AHV A;  3SYZ A;  4B08 A;  4CEE A;  2YNI A;  3TAN A;  2PYL A;  5I42 A;  3KTQ A;  3DLK A;  2KZZ A;  4CJQ A;  3KK3 A;  3SZ2 A;  3U3Y A;  1B92 A;  3ZSZ A;  4W5O A;  3ZSQ A;  1LWC A;  2FC0 A;  1NKB A;  1IKX A;  4CHO A;  4N5S A;  4W5Q A;  1WSJ A;  4M3Y A;  3DM2 A;  4AHR A;  3I8D A;  3KD1 E;  1REV A;  2W42 A;  3SV3 A;  4M3Z A;  4PA1 A;  2BE2 A;  2FBY A;  2B6A A;  3HPH A;  2RN2 A;  1B9F A;  1TKX A;  2RPI A;  4FJI A;  1JL1 A;  3OYC A;  4ELU A;  1JLG A;  1KCF A;  4OJR A;  1CLQ A;  5SZT A;  4CF1 A;  3LPU A;  4FZZ A;  1RT3 A;  3HO1 A;  3QEI A;  1L3S A;  1VSD A;  1NJZ A;  1TAU A;  1RDB A;  4IFY A;  1VSH A;  4FLU A;  3S3N A;  1SKR A;  4B9U A;  4I9Q A;  1HNV A;  4F3O A;  4LH5 A;  2HMI A;  3ISN C;  3LWM A;  4DQP A;  2E6L A;  3AA2 A;  4JRQ A;  1RBS A;  3AO4 A;  1X9W A;  3OYI A;  4CEC A;  1BIU A;  3HK2 A;  2QK9 A;  3AO1 A;  4OKJ A;  1QE1 A;  3QEX A;  3ZT3 A;  1A5X A;  3OYF A;  1HPZ A;  1FKP A;  2BAN A;  4DLG A;  1HQU A;  2VWJ A;  3AVG A;  4MFB A;  3VQE A;  5HRS A;  3OYH A;  4W5T A;  3TAP A;  1ZBH A;  4CHZ A;  5HRP A;  3HPO A;  3SUQ A;  1VSI A;  3MXI A;  3VQA A;  2G8K A;  2Z1G A;  3QEV A;  1NK7 A;  4KHS A;  3CM6 A;  3KKS A;  4OKK A;  2DFE A;  3O3F A;  3OYA A;  3VQC A;  3DLR A;  4AHU A;  4FW2 A;  1UWB A;  4RW4 A;  3WNF A;  3VA3 A;  3QLH A;  1TL3 A;  2ZD1 A;  4C8L A;  3T19 A;  4OKE A;  3JSM A;  3AA4 A;  3KJV A;  3MEE A;  3K5L A;  3P83 D;  3KK2 A;  5CZ1 A;  4DS5 A;  1SKS A;  4OPJ A;  4FVM A;  3DLB A;  1KFD A;  2HVI A;  4DLE A;  5J2N A;  3S3M A;  1BIZ A;  3HVT A;  3ZT0 A;  1VSK A;  4W5R A;  3SI6 A;  1U45 A;  4C8K A;  4J2E A;  2G8W A;  3I0R A;  5FDL A;  4CHP A;  1RT6 A;  1D8Y A;  4NCB A;  5HP1 A;  1NK0 A;  2YKN A;  1BGX T;  3SUP A;  1EX4 A;  1U48 A;  1RTI A;  1XHZ A;  4CJT A;  3ALY A;  3L2U A;  1QTM A;  4Q5V A;  1HRH A;  1TV6 A;  1BCO A;  2G8F A;  3MXJ A;  5JS2 A;  4AHT A;  4M45 A;  3V9X A;  2HNZ A;  2HVH A;  4DSF A;  3C6T A;  4DTR A;  1Q9Y A;  1MU2 A;  3MEC A;  4HHT A;  1RNH A;  4BDY A;  4BDP A;  1C1B A;  1C0U A;  3P1G A;  3MAQ A;  2G8U A;  1JLE A;  1NJY A;  1QSY A;  4KRE A;  1KRP A;  1GOA A;  4IDK A;  4FJN A;  1RT1 A;  3L8B A;  2GUI A;  4DTJ A;  2XY5 A;  5FRN A;  3K5N A;  3ULD A;  4FJX A;  4C8N A;  3I0S A;  3QNO A;  4CGF A;  5K14 A;  5FRM A;  4DG1 A;  4NCA A;  4E7K A;  3C94 A;  1TVR A;  4BWM A;  1KSP A;  2OZS A;  3TI0 A;  1J5O A;  2F8T A;  3SQ2 A;  3VQD A;  1VSE A;  3LP1 A;  4B8A B;  4QCL A;  4CHN A;  4ID5 A;  4DTX A;  4RG8 A;  4LD0 A;  3TR8 A;  1BHL A;  1BCM A;  2OZM A;  3SPY A;  1S9G A;  4O0J A;  3ZSV A;  4Z4H A;  3NH1 A;  3IG1 A;  3QEW A;  3SJJ A;  2X6N A;  3ZSO A;  1RTD A;  4DS4 A;  4FLZ A;  1WSG A;  2VG6 A;  3CFR A;  1N5Y A;  1IKV A;  1JLB A;  3DI6 A;  4AHS A;  3ZT4 A;  1X1P A;  4RW7 A;  2XY6 A;  1FKO A;  2WON A;  3HM9 A;  4KI4 A;  1T7P A;  4EZ9 A;  4FK0 A;  3BGR A;  3K5M A;  4PY5 A;  3B6P A;  1WN7 A;  3HVR A;  4DTS A;  1X9S A;  3A2F A;  3G0Z A;  1TK0 A;  4IG3 A;  2A1R A;  4FZY A;  2EX3 A;  3MED A;  4I2P A;  2YHB A;  4KO0 A;  5I3U A;  1I39 A;  1WLJ A;  4PWD A;  3L3U A;  2A1S A;  4DSI A;  3DOK A;  3AVF A;  3F73 A;  4AH9 A;  3SCX A;  2VG5 A;  3TWH A;  1T05 A;  4B9T A;  1JL2 A;  3OJU A;  3ZSY A;  4CGH A;  1I3A A;  4M3R A;  3OS1 A;  4CF0 A;  3K59 A;  1EP4 A;  4CGG A;  4FM1 A;  4CIE A;  1LWF A;  4DQS A;  1NKE A;  4KPY A;  1EKE A;  4CJ4 A;  1C0M A;  1C0T A;  2IS3 A;  2OPS A;  5EU7 A;  3KLF A;  1UAX A;  3V1O A;  3KLI A;  3EZ5 A;  3LDS A;  3TAE A;  4ELV A;  3QNN A;  2OA8 A;  1VK0 A;  1Y97 A;  3SPZ A;  3V9Z A;  4DU4 A;  2Y1J A;  4CGD A;  3S3O A;  2DY4 A;  4DTP A;  1HYV A;  4R5P A;  2IAJ A;  4CIF A;  1D9D A;  1IG9 A;  3NAE A;  3VQB A;  3LZI A;  1SV5 A;  2I5J A;  4DTN A;  3SQ0 A;  1KVC A;  2Q3S A;  1QS4 A;  2ZE2 A;  1SL1 A;  4B9N A;  3U6F A;  4CJ5 A;  4DFP A;  4KHQ A;  1TAQ A;  1CXQ A;  1S1U A;  1D9F A;  4W5N A;  4O55 A;  5HBM A;  2E4L A;  3OS2 A;  4KAZ A;  3NF9 A;  1WSI A;  4FLV A;  3NBP A;  4I9L A;  1CZ9 A;  3KLE A;  4CJP A;  2GBZ A;  1NK9 A;  3RMA A;  3L2W A;  3RR8 A;  1X9M A;  3UIQ A;  2HHT A;  4E7H A;  4KRF A;  2IDO A;  1RT7 A;  4CEF A;  4CK3 A;  1YTA A;  4Z4F A;  3SQ4 A;  4E89 A;  1LAV A;  2EHG A;  1JLF A;  3VQ4 A;  3HT3 A;  1RBU A;  4CCH A;  1HYS A;  2HHX A;  4LSN A;  1RBT A;  4QAG A;  1SKW A;  2G8H A;  2D5R A;  2KW4 A;  4E1N A;  2Z1H A;  3LZJ A;  5KGX A;  4B9L A;  4HCB A;  1WSF A;  4CES A;  4DQI A;  3M8R A;  3NGZ A;  4LSL A;  3OYK A;  4F2S A;  3NCI A;  5KRS A;  4QOZ B;  1L3V A;  1VRT A;  4M3T A;  1GOB A;  2ITG A;  1NK4 A;  3NF8 A;  3NF7 A;  3F9K A;  4CF2 A;  1XI1 A;  1TKT A;  4K8X A;  1NK8 A;  4PUO A;  4UQG A;  5KI6 A;  4DTU A;  2QXF A;  4ICL A;  3LAL A;  4DSJ A;  3SUN A;  3VQ8 A;  3M8Q A;  3WNH A;  5DK5 A;  4RW8 A;  3EYZ A;  1N6Q A;  2P51 A;  4B9V A;  4FJ8 A;  1NJW A;  2FBT A;  3OYD A;  2G8I A;  2KZM A;  4ELT A;  1GOC A;  2E6M A;  3ZSX A;  3O3G A;  5C25 A;  1VRU A;  4DTO A;  2QKB A;  2F96 A;  4CJE A;  1RBV A;  3VN5 A;  4CHY A;  4PQU A;  3OVN A;  1TK8 A;  4N76 A;  1NKC A;  4CJV A;  4DFM A;  2HB5 A;  2PZS A;  2D0C A;  4Z4C A;  4E7J A;  4L8R B;  3RR7 A;  2OPQ A;  4J2D A;  3LAN A;  4KB1 A;  3AVJ A;  3K5O A;  2GV9 A;  4CJW A;  2LSN A;  3QET A;  4ZTF A;  2BDP A;  1QQC A;  4RW6 A;  3HJF A;  4FJM A;  3L2R A;  4FM0 A;  3RMD A;  5E41 A;  3JYT A;  1JLC A;  1U47 A;  3KD5 E;  3D45 A;  3VA0 A;  3ZSR A;  4CHQ A;  2YNF A;  1TL1 A;  3O3H A;  5J2P A;  3L2Q A;  3SV4 A;  4EZ6 A;  1BQN A;  4FJK A;  3AA5 X;  2NUB A;  3QER A;  3LPT A;  3DRS A;  3QEP A;  1EET A;  3LP3 A;  3RWU A;  1S6P A;  3LWL A;  3SQ1 A;  3BDP A;  3OJS A;  1RTH A;  5KGW A;  4CEO A;  2AJQ A;  1XC9 A;  1SL2 A;  1HMV A;  4M42 A;  3QIN A;  3OYE A;  3AVB A;  5T7B A;  4FJ5 A;  5JS1 A;  2B5J A;  2YKM A;  3V1R A;  4ZTJ A;  3DYA A;  3NGI A;  1Q9X A;  4AHC A;  4FZX C;  3NF6 A;  3ZCM A;  4FLW A;  3TAB A;  2KFZ A;  4BE0 A;  4M41 A;  2DFF A;  2D0B A;  3MEG A;  4E7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...