4O44A

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 140
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o44A05
1NJZA 4RUCA 1QSYA 1RT1B 3NGYA 5J2MA 3PO4A 1SUQB 3DDKA 1RBRA 2DPJA 1G15A 2HVHA 4OPJA 4PWDA 4KPYA 4H8KA 3SYZA 3VN5A 4I2QA 4OLBA 1IG9A 1TL3A 3IG1B 4ED1A 1UWBA 3KK1B 1IO2A 2D7SA 1S1UB 1FKOA 2AWZA 3PW5A 4Q43A 4DLGA 4ZPBA 3ITHB 4DU3A 2FBXA 4O4GB 4TY8A 4CJPA 4E1NA 1B9FA 4IFYA 2BE2A 4MK8A 2LSNA 1JLQA 2VG6B 4MFBA 3VQQA 1QS4A 2FVRA 1S1TB 1YVUA 1U09A 3MEDB 4J9RA 3NE6A 3SUOA 1ASWA 3KLFA 4IDKB 2GBZA 2J6SA 2XHBA 3NF6A 4W5TA 3QO9A 3AA5X 3PJXA 1N56A 5FDLA 2ZKUA 3HKWA 4RNFA 1Q8IA 3I0SA 4UQGA 4OPKA 4DTUA 1HQUB 4Y1CA 1ZETA 4B9NA 1S1VA 4WE1B 3M8QB 1RAJA 3AVMA 1RTHB 3PJWA 4CEOA 3OY9A 3MAQA 3N6NA 3V9XA 4AHVA 4N41A 2Z1IA 1S1WA 4FJHA 1NK9A 5F9LA 1S49A 3SUNA 4NRUA 1S48A 3CM6A 3ZSXA 3RMCA 2FLLA 5DGBA 2OPRB 3QZ8A 3P83D 4DLEA 4J2AA 1C0TA 3LALA 2IAJA 3DLKA 4CHQA 1FK9B 4O4RA 3UQSA 2ASJA 5D3GA 4NCGB 3CYMA 4HUEA 2RDJA 3NAEA 3IGNA 2PYJA 3RAXA 5HRPA 1VRUB 3TQ1A 4KI4A 4KAIA 1C6VA 1TK0A 4OGEA 4ELUA 4K4ZA 2XY8A 5KG0A 2E9ZA 5F8IA 3O4NA 2D3UA 3BSAA 4CHYA 3OYJA 3H5SA 4GC7A 2G8HA 1C1BB 4DG1A 4ZP9A 4Y1DA 4IKFA 4B9UA 4IR9A 4OVLA 3VQ9A 4J9PA 4F3OA 1EKEA 3CDUA 2W8KA 4K4XA 3OL8A 4O5BA 4O3SA 4ECTA 2JEFA 1DLOB 1KFSA 3ZT0A 4DSLA 3LP0A 4CJVA 5J2PA 3AVKA 3QIOA 2OPPA 1BI4A 2HHXA 1UA1A 5DG9A 2IBKA 2GUIA 3M8PA 2VWJA 5KFCA 4I2PB 1D9FA 1JLBA 2HW3A 1X1PA 4F3TA 3VQBA 1D0EA 4DS4A 3V1OA 4H4MA 4I7FA 1KCFA 5DQGA 4ELTA 1CZBA 1JXEA 3C95A 1MMLA 2FJVA 4CK2A 1TK5A 3I0RB 4Q0BB 1TKXB 1C0UB 1IKYB 3Q8QB 4E7IA 4EO6A 1RYSA 3LPTA 2BQ3A 5KG4A 4DTMA 3BREA 1VSEA 3LWLA 4DTRA 1LWFB 3OLBA 5F8LA 3RR7A 3OJUA 4FS1A 2R8HA 4OJRA 2CKWA 4L8RB 3IAYA 2IDOA 4OKJA 1TKZA 1WSIA 3E01B 1RBTA 2Z1JA 1VRTB 2RDIA 3MR3A 4AHSA 2XC9A 2XCPA 5C42B 4IR1A 3GIJA 2NUBA 2GC8A 1NJWA 5KRTA 3PX6A 4B3OA 4OL8A 2JLEA 2QKKA 3M8SA 2C28A 5DQHA 4KAZA 4IKAA 4KTWA 1SH3A 5HP1A 4N76A 3ZSYA 3IRXA 5FROA 1C2PA 4NLXA 3TAPA 4ECXA 4CJTA 4Q5VA 3KHHA 3RMBA 4RW6B 1UA0A 4FZZA 4E7KA 1CZ9A 1ITGA 3V6JA 4FYDA 3AA4A 3PW7A 3FQKA 1O1WA 2ATQA 3C6TA 4IBNA 2X6SA 1YT3A 3TAFA 3PHEA 4NLWA 1RT5B 4IH6A 3HXMA 5JXSA 1KVBA 3V1QA 5HBMB 2AGQA 1LW2A 1J9AA 4CJ4A 4RNHA 1JL2A 2P5OA 4CEFA 1IKWB 3CFRA 4M3XA 4F50A 1KLNA 2FVCA 2HWIA 4TSXA 3EZ5A 1QSSA 5L1JA 4OKKA 5CYMB 2BRKA 4FLWA 1X9MA 3L2RA 2XY6A 3DRRB 3QNOA 1VSHA 4ED2A 4KHYA 3UIQA 1RT1A 4Z4FA 3Q8PB 3NAHA 3WNFA 2FBTA 3OVNA 1EXQA 4ECVA 4E7LA 4OGCA 4DFMA 3IG1A 4FJLA 1RYRA 4G3IA 1JL1A 5KFYA 3CG7A 3H40A 4TY9A 4O4GA 1KSPA 3NH1A 2UVWA 2VG6A 3VQ5A 4BWMA 1EETA 4BDYA 4ZTFA 4TXSA 3GQCA 3DOKA 1LWCB 1S1TA 3QIPA 4FJGA 2C22A 4KTQA 4IH5A 1BHLA 1I3AA 3MEDA 3Q8RB 4FW2A 1D5AA 1WSFA 2Y1JA 1QHTA 4NZ0A 2XGPA 3T1AA 3RB0A 3OHAA 3TANA 3AVGA 1HMVB 4WFYA 5C24B 1NOZA 3SNNA 4CE9A 1KHWA 1MU2B 5EDWA 1ASVA 1HQUA 3MXIA 4WE1A 4WFXA 2WRMA 4PUOA 3KLHB 1C0MA 3VQ6A 4MIBA 5KGWA 2E4LA 5T14A 3AVCA 3AO1A 4E3SA 3KD1E 4TQSA 4HTUA 4DSIA 2OYQA 4CJQA 2FBVA 4M3RA 4ZP6A 2DPIA 3ZSQA 4CK1A 2BANB 3AO3A 1IKXB 2F8TA 3THVA 4R5PB 2JEJA 4NRTA 2D0CA 3M8RA 4JUZA 1XC9A 4NLUA 1FK9A 4C8KA 2VG7B 4NCGA 2BDPA 1TKTA 4IFVA 3SV3A 3ZT4A 2IJFA 1VRUA 2HHUA 3SUPA 4N5SA 1NKBA 1RTDA 3TVKA 3SCXA 4K4VA 1L3SA 5FRNA 4TN2A 2XY5A 1SL2A 4AH9A 4ZVGA 1ZBIA 4PY5A 5KFFA 5FRMA 3VQ8A 2W9CA 2OA8A 3RBEA 2R2RA 4CEDA 5HLFA 2IM2A 1BQNB 3MR2A 2BR0A 4HYKA 1XHZA 3AVJA 3CJ3A 1KHVA 1JLEB 5EWFA 3HVTA 3BGRA 1S9EB 1NKCA 2X6NA 3GIIA 3ISNC 4CJ5A 1W25A 3SJJA 1XI1A 2FBYA 1LWEB 4H4OB 4DU4A 1RT6B 4WXWA 2PZSA 4O3OA 3NGDA 3OL9A 2B6AB 4DTPA 1TAQA 1XHXA 3V81B 3U3YA 3I0RA 1TKXA 1C0UA 4CGGA 1IKYA 1A5WA 1WAFA 1NK6A 3H2LA 4KO0B 5EU7A 4OLAA 4ZPCA 4IG3B 1NK8A 4BACA 3QEVA 4ECZA 4BWJA 1RBVA 4ECUA 1LWFA 2WCXA 3GV8B 3ULDA 1L3TA 3MECA 2WTFA 2PY5A 4CGIA 3PR5B 1RT4A 3CJ4A 3D0PA 1S6QB 1ZTTA 4J2DA 2ZD1A 4B9VA 3CWJA 3O3HA 1NKEA 5C42A 3QEXA 3DLEB 4I9LA 1HYVA 2ASDA 4LQ9A 2WB4A 3H4BA 1RTIB 4IH7A 1S0NA 4JV2A 2IM3A 3NFAA 4FK0A 3PW2A 2EC0A 3NH0A 2HNYB 4M45A 5KFTA 2UUTA 4KHSA 1ZBFA 1UAXA 4E89A 4DQRA 4KB7A 3AA2A 1S0MA 5KFZA 2XY7A 3MFIA 4KHUA 4WZQA 3JSMB 1D1UA 4Z4HA 4QW8A 3WNGA 1WNEA 5CZ1A 3HK2A 1RT7A 3OYMA 5KFHA 4QWAA 3FQLA 3PV8A 1QAJA 4RW6A 4E0DA 3AO4A 2YKNB 2B5JA 4B9LA 4CIEA 4M41A 4ZVEA 3VQPA 2B4JA 5KFJA 1SH0A 3OYNA 3FRZA 4QPXA 3HPGA 1HPZB 4CEEA 4DL2A 2JC0A 4CF8A 3KK2B 5HROA 2R8GA 4M94A 2KQ2A 5KFLA 3ZSZA 1X9WA 3PW0A 1WSHA 4CK3A 4FJXA 4EO8A 4XIUA 2WOMB 1GOAA 4WYLA 1HRHA 3HPHA 4FK2A 1Z25A 4KB0A 3RTVA 5F8GA 4TLRA 4NYZA 2AGPA 3LP3A 5KT7A 4E19A 5CYMA 3S9HA 1EP4A 1S97A 5JS1A 4FXDA 3KMSA 2DFEA 3OS0A 5J2NB 1HNVB 5KT5A 1S9FA 3FDSA 3QGGA 2XCAA 3O4QA 2E6LA 4DEZA 3KHRA 3DRSA 2YHBA 4MKAA 4IG0B 4EZ9A 3AVIA 1GX6A 1VSFA 2R7YA 1GOCA 4DF8A 2YNFA 5EWGA 4LSNA 2E9TA 1JKHB 3T5KA 4KREA 4JV1A 1TAUA 3DMJA 3KLIB 1XR5A 3VQCA 1TK8A 3MEEB 3ICLA 3NF7A 1TVRB 2QKBA 3DI6B 4Y2CA 4IRKA 4FCYA 4FBTA 3T5JA 4CJLA 3WNEA 1NHUA 3DOLB 4KRFA 1HQEA 4FZXC 4R8UA 3S3NA 1J5OA 1LWCA 2WONB 5KT4A 1W9HA 4FBUA 2A1RA 4DWIA 3VQDA 3HM9A 3L2WA 3RRGA 2WK4A 4RW7B 5DG7A 4KFBA 2V4RA 1ZBLA 4ZPAA 3BSCA 4ED6A 1HMVA 5C24A 4RW8B 2R8JA 3PZPA 3RB6A 4FZYA 1U4BA 3L3UA 4Z0UA 4CECA 2JEGA 3KLHA 5HRRA 1ZYQA 4LSLB 1HJRA 1JLAB 4K4SA 4B9SA 3MEGB 3KIOA 3G6VA 1J53A 2D0BA 2R2UA 1SKWA 3O3FA 4BDPA 4Y34A 2Z1GA 4M3WA 4W5RA 4KHRA 4ID1A 4FJMA 3GIKA 2IMWP 3K5OA 2BANA 4CEAA 5KFSA 4FW1A 4YMEA 1S9GA 4O0JA 5KG7A 3OYFA 2V4QA 4EP5A 4K50A 5DMRA 3T5LA 2ATLA 1NOYA 2IJNA 1QE1A 5KT2A 1LW0A 3OYGA 1QQCA 3VA0A 4O44B 1HNIB 1BIZA 3KLEA 5I3UB 1N6QA 2YNIA 3QINA 3LP2B 4ID5B 1S6PB 4K4UA 2OZSA 3OSPA 3KLGB 1T3NA 4Z4IA 3QETA 3NH2A 2AU0A 5KFRA 1NHVA 2YKMA 4ZPDA 5J2QB 3NDKA 2GIRA 1IM4A 3ZT3A 4WFZA 1T7PA 3LP1B 2KFNA 1NJYA 2IGIA 2ZQBA 1EX4A 3EPGA 1TV6B 5KFMA 3OS2A 4HCBA 4URQU 3FSIA 5CY4A 3C6UB 1W0HA 2OPSB 1BGXT 1KTQA 5KG6A 1L3VA 4M95A 4NYFA 2HMIA 1YVFA 3H98A 5DGAA 4KV8A 3CDWA 4QAGA 3CO9A 4ZHRA 2RKIB 4IRCA 1VSMA 3M9OB 5KG5A 2UVUA 4LY7A 3OYKA 4G1QA 4CFAA 1LWEA 4H4OA 2VG5B 1RT6A 3DRPB 3V4IB 3GIMA 2ZE2B 5CYQB 2B6AA 4JS4A 1S0OA 5KFBA 2HNDA 4BDZA 1ZTWA 3KKRA 5HRNA 1FKPB 4CHZA 3ZSOA 4DQPA 3SV4A 2OPQB 4IG3A 2DFHA 2IC3A 4KBIA 2A1SA 3OYHA 4W5NA 1YTAA 1HYSA 4J9KA 4EBDA 4HVJA 1IH7A 2YNHB 2OH2A 4B8AB 3VQEA 4RW9B 4QWCA 3Q8SB 1C1CB 3OJSA 4Y3CA 4K4WA 3V6DB 2XWYA 3VA3A 1S6QA 3MFHA 3CFOA 1REVA 1KLMB 1DTQA 2KTQA 4FJJA 3DLEA 3RB4A 1N4LA 4CFBA 5K14B 4CF1A 4JV0A 1RTIA 1F21A 3DM2B 3K5NA 2BGGA 4JLHA 4C8NA 2X78A 4ELVA 1KRPA 4J2BA 1JLCB 1SL1A 3QLHB 1BQMA 1U49A 4DTNA 5J1EB 3AVNA 3AVFA 4C8LA 1C1AA 3T19A 5J2MB 1OS5A 4E1MA 2W9BA 4ED7A 1DTTA 3E51A 2RF2B 4EYHB 3DLGB 3L2QA 4FM1A 4I2QB 3KD5E 2YKNA 2XGQA 1TL3B 3G6XA 4LQ3A 3IS9A 3KK3A 4MQ3A 4MK9A 1RBSA 1UWBB 4K4TA 5F8MA 4U6PA 4IOBA 1SUQA 2FLPA 1JLFB 4IFYB 1Q9YA 2BE2B 3B6OA 3FFIB 2O4GA 3SQ2A 4M3ZA 2FC0A 1JLQB 4MFBB 2J6UA 4ED0A 2YHAA 5JUMA 4F4KA 1D9DA 4DL4A 1KFDA 2IS3A 4C8MA 1VSKA 3S3OA 3KK1A 3OYAA 2RN2A 4CJUA 4I9QA 1S1UA 2AX0A 2V0NA 1BL3A 3MTKA 3SPZA 1QAIA 3ITHA 1L3UA 3G6YA 3CDEA 2G8WA 4ZVFA 4PQUB 5FDLB 4E7JA 4B9MA 3I5AA 3LZIA 5KT6A 2BRLA 5KI6A 5J2NA 4QOZB 5JS2A 4W5OA 3NAIA 2O5DA 2I5JB 4M3YA 1RNHA 4CHPA 4CF9A 4IDKA 3AV9A 3L2VA 4F8RA 3IN5A 4K8XA 1S1WB 5C25B 1S1XB 3H5XA 1JKHA 3MR5A 4DL3A 5SZTA 3KLIA 2V9WA 3M8QA 1C0TB 3HT3A 3MEEA 4E7HA 4N56A 1XR7A 1QTMA 3H5UA 1RTHA 2C2DA 3U3GA 2W8LA 5SWMA 4NLQA 3DOLA 3VQAA 2R8IA 3GV7B 3LPUA 1XR6A 4Q8EA 4YNQA 2XI2A 4RNMA 2OPRA 3UPFA 4DQIA 1RT3B 3ASMA 3V9UA 3NCIA 4WYWA 5KFQA 4FS2A 2F8EX 4DG1B 4RW7A 5KFIA 4KSEB 5CZ2A 4LD0A 4F4XA 4ICLB 2X74A 4KTZA 4F2RA 3MF5A 4F2SA 3KTQA 4RW8A 4BE0A 2XO7A 4KE5A 1CSJA 4CF0A 4XO0A 3LP0B 3SI6A 3MXMA 3OYLA 2OPPB 3CFPA 3M8PB 5KG1A 1C1BA 3EPIA 4Q8FA 1JLBB 4GVMA 3TAGA 1A5VA 1S5JA 1WNSA 1U47A 4URGA 1RILA 1DLOA 4DTSA 3NHGA 4NLDA 1ASUA 4FJ5A 4J9QA 3T3FA 1NK5A 4O3RA 3P5JA 2W42A 3QEPA 4I2PA 3A2FA 4O44A 4TYAA 1HNIA 3K59A 1SKRA 3VQSA 2QK9A 3KNAA 4WZMA 3SFUA 4FLXA 4B8CA 2G8FA 1SL0A 4FLYA 4CEBA 4O3NA 2D3ZA 1VK0A 2AGOA 4Q0BA 4J9LA 2IOCA 3AVBA 3QNNA 3M9NB 4DL7A 1TGOA 2HB5A 1TV6A 2FVPA 2KZMA 3G86A 4ECQA 4FJKA 3BQ1A 5KFVA 2Y1IA 1U45A 5KFAA 1Q9XA 3C6UA 2OPSA 4O3PA 4DMNA 1TQLA 4NLPA 3E01A 1CXUA 1VRTA 2W9AA 3JYTB 3QYYA 4QCLA 4F4YA 4CJWA 3N6LA 4RUAA 1BCOA 3TAQA 4XPCA 1KVAA 1RBUA 3VQ4A 4DU1A 1U48A 1U04A 3AO5A 1B92A 4HCCA 3V6HA 2J6TA 3TAEA 3SQ1A 3O3GA 2G8KA 3HSTB 3HVRA 4EEYA 2XI3A 2OPQA 1N48A 3C6TB 1BIUA 1K6YA 3RRHA 1T8EA 2RPIA 2GIQA 2YNHA 3I5BA 4RW9A 4NLSA 3KJVB 2HHVA 2E9RX 3V6DA 3UDLA 4CJEA 4EBCA 5L1IA 2QV6A 1KLMA 1T05B 3KMQA 1N5YB 3B6PA 1B9DA 3PY8A 3DM2A 4M3UA 3SZ2A 1LAVA 4JRPA 1RT5A 3RAQA 4YR3A 5HBMA 1JLCA 1TP7A 1RDCA 1K1SA 3AVHA 1UOCA 4NYNA 4O55A 4AHTA 3PO5A 2HNZB 1IKWA 3ISND 4GW6A 4ZTJA 4RW4B 2C2RA 4Z4CA 2RF2A 3BR9A 4ECWA 3QIDA 3DLGA 2R2SA 2AQ4A 3DLRA 5KFOA 4FJ8A 1HARA 3DRRA 1WSEA 3ZT2A 3BDPA 3CJ2A 2FLNA 1KVCA 1CXQA 3D5MA 1XWLA 1JLFA 4FK4A 4O0IA 4CIFA 3FFIA 3K58A 1EETB 2BQUA 2R8KA 3CIZA 3PUFA 4DTXA 4FJ7A 3DOKB 3QIPB 3DLBA 4O3QA 1NK0A 4CJ3A 4HUFA 5I42B 5KT3A 2ALZA 3H5YA 3SQ0A 2HHTA 2YV0X 3LWMA 5L1KA 5KRSA 4Y2AA 3KLVA 3TARA 4FM0A 4BE2A 1RTJB 3RWUA 4PQUA 3HP6A 4FLZA 3L3VA 2D41A 5KFUA 3OL6A 4ECYA 3SFGA 4DFPA 4NLOA 3QEWA 1TKDA 2I5JA 5F8HA 2W7PA 4PA1A 5L1LA 4PUOB 2HAIA 1Y97A 3IGVA 4EYIB 3P1GA 2KFZA 5EWEA 3VQ7A 4DSKA 3EYZA 2VWKA 1L5UA 1GOBA 3N6MA 3AVAA 2FVQA 5T7BA 5C25A 1S1XA 4KKOB 1MU2A 1TL1B 2AJQA 3AO2A 3HO1A 2HWHA 2HHWA 3HPOA 4ZP8A 1TKTB 4IFVB 2DTUA 5HRSA 3MR6A 2E6MA 1GX5A 4RZRA 3NL0A 4DQSA 3GV5B 3DYAB 1RTDB 4FVMA 2PYLA 1YTUA 1IKXA 3RMDA 4R5PA 1JLGB 4NCAA 4DL5A 4YFUA 1RT3A 3C94A 2W9CB 3HJFA 5HLFB 5KGXA 2VG7A 4DL6A 3BSNA 4ICLA 3NF8A 3NGZA 5DQIA 3PVXA 5F8JA 3OYBA 5KFPA 3DLHA 4J9NA 3LAKA 1QUVA 3CJ0A 2EHGA 3HVTB 3BGRB 4AHRA 1Z26A 3LAMA 4F4WA 4DFKA 4FJIA 4CIGA 4AHUA 2D0AA 4CERA 1BQNA 3LZJA 3RB3A 4RU9A 4TQRA 2FJXA 4MIAA 3TAMB 3ZSWA 2ITGA 5KFKA 1NJXA 4TYBA 2G8IA 3V1RA 4EP4A 1JLEA 1BCMA 4CGJA 4M42A 1T03B 1S9EA 3NMAA 2ETJA 3TWHA 2YNGB 1RT2B 1J54A 4LH4A 3L8BA 1HYZA 3SI8A 4KB1A 2JGUA 3AVLA 3MECB 4Q44A 2GV9A 3F73A 2Z1HA 3V81A 1RT4B 3G0ZA 2JC1A 3T5HA 4FLUA 2ZD1B 4RNOA 4KO0A 3NBPB 4IRDA 3V9SA 3CVKA 4MKBA 3GILA 1VSIA 3SQ4A 1SV5B 4CFDA 3V9WA 1WAJA 3I5CA 3OYIA 1S4FA 3RR8A 4KHMA 3F9KA 3WNHA 2G8VA 3CM5A 4RNNA 4CESA 3PW4A 4C8OA 3HHKA 4CGHA 3JYTA 3CQ8A 1SKSA 4YP3A 4R0EA 2F8SA 4FM2A 1LAWA 4BE1A 5KFWA 1ZBUA 1RT7B 3H4DA 1IKVB 3QEIA 5F8NA 2Q3SA 2HNYA 5DG8A 3D28A 3D45A 1R0AB 1RDRA 2B5JB 3KHLA 4U7CA 2KW4A 1CLQA 3EZUA 5KFXA 4DSFA 4FLTA 3JSMA 2ASLA 4KHWA 4ZP7A 3KJVA 2VA2A 3K5MA 4PWDB 2KZZA 4KHNA 4ECRA 2UVRA 4CF2A 5HROB 1WN7A 2HVIA 1I39A 1T05A 4JS5A 2UUWA 1ZBHA 1N5YA 3OHBA 2IA6A 3HVWA 1FKOB 4QWDA 4EBEA 2QXFA 3ZSVA 4X2BA 2VA3A 3RMAA 2DFFA 3M9MB 4TY8B 1EP4B 5KG3A 1HPZA 4FJ9A 1K1QA 2CJQA 3KK2A 4QWBA 3HVAA 4AHCA 2O4IA 3QGIA 2HNZA 5L9XA 4QWEA 5KG2A 3TABA 2WOMA 3KLFB 4RW4A 2C2EA 3DRSB 3V9ZA 3QO9B 1NK4A 2YNFB 2JEIA 3I0SB 4LSNB 4ECSA 3L2UA 1HNVA 3V6KA 3DMJB 4B08A 1S1VB 3KKSA 1SH2A 5E41A 4J9OA 4NLYA 4DSJA 4FLVA 4IG0A 4CEZA 4Z4GA 4ZVHA 3I8DA 4AILC 1HQEB 4NLRA 4R8UB 4M3TA 3OYDA 2R2TA 1J5OB 3QERA 4WXOA 3HYFA 1QSLA 4DS5A 5I42A 1JX4A 3BQ0A 3G10A 4CGFA 1I6JA 3MXJA 2IM0A 3AA3A 2IAJB 3DLKB 1TVRA 4DQQA 1Z4UA 3DI6A 4KFBB 5D3GB 1RTJA 4J9MA 4CFCA 4CJFA 4XPEA 4CGDA 1RA7A 3RBDA 2WONA 2D5RA 3SPYA 1WSGA 3LDSA 1A5XA 4MH8A 4DTOA 4LH5A 1VSLA 1NNDA 3SUQA 2ILYA 3ZT1A 2WHOA 4NLGA 1RCHA 2FVSA 4OKEA 4KKOA 2I1RA 1TL1A 1S9GB 3H59A 3QGHA 3OLAA 5J2PB 4CJRA 2UVVA 1BI4B 1S10A 1RDBA 1VSDA 4ED3A 4CEQA 4LSLA 1QE1B 2XRIA 1JLAA 3U6FA 1LW0B 2ILZA 4YR0A 2HHQA 3MEGA 2P1JA 1JXBA 3KLEB 1N6QB 3K5LA 2YNIB 3PX0A 4NCBA 3NGIA 3DYAA 2B43A 4B9TA 1X9SA 4H4MB 4YQWA 4I7FB 3OL7A 1JLGA 1FXXA 4J2EA 2YKMB 3TI0A 3KOAA 4QW9A 4IQXA 3ALYA 3UR0A 4W5QA 4GMJB 1WLJA 4Q45A 4KHQA 4CCHA 4HUGA 4EZ6A 4K8ZA 2DY4A 4HHTA 5I3UA 4F4ZA 3LP2A 4ID5A 1S6PA 5F9NA 4Z4EA 5KFGA 1NK7A 3KLGA 4DF4A 2HMIB 5J2QA 1TKZB 4KV8B 2IM1A 4MK7A 4ZHRB 3LP1A 3CJ5A 1WSJA 2P51A 1JIHA 4GC6A 4G1QB 1BISA 3TAMA 3BJYA 1RDDA 5KFEA 3EY1A 2EX3A 4RG8A 4B3OB 3BQ2A 5C5JA 4ED8A 2HNDB 1T03A 5DLGA 3HL8A 5EUHA 2YNGA 5HP1B 4ZMMA 3OYEA 3KHGA 3PX4A 2RKIA 3BSOA 4K4YA 1RT2A 4HKQA 3IRXB 3NKYA 4NLTA 4CJSA 4N47A 2IC3B 4JRQA 3LANA 1HYSB 2VG5A 1VSJA 3DRPA 4NLVA 4DFJA 3V4IA 3NF9A 2ZE2A 5CYQA 3S3MA 2G8UA 2OZMA 4H54A 2QE5A 3HP9A 4DTJA 1REVB 3K57A 1DTQB 1FKPA 4KI6A 3NBPA 1JXLA 3ZCMA 4J9SA 5DLFA 4CHNA 3OS1A 3TR8A 3GYNA 5KTQA 1SV5A 3PR4A 1C1CA 2P5GA 4DSEA 1BQMB 3OSNA 1LW2B 2BQRA 1D8YA 3ZSRA 4CHOA 2FJWA 1LV5A 1RDAA 2F96A 2AX1A 4YR2A 3QZ7A 3H08A 5K14A 3QESA 3OYCA 4FJNA 2W9BB 2HHSA 1T94A 1DTTB 1IKVA 4CJKA 5DK5A 1RA6A 1R0AA 3QLHA 2W7OA 3IS9B 3KK3B 5KFDA 5J1EA 5KFNA 4URSA 3K2PA
chains in the Genus database with same CATH superfamily
2YQ1A 4K5SA 1HBNB 1RT1B 3R8EA 4ZDNA 3T1HK 3KJQB 2HVHA 4YB1P 4QYRA 3NCRA 4H8KA 4R79A 4OLBA 5AQNA 1IG9A 1WF1A 2OELA 4CQ1A 1V9OA 4ED1A 2A3ZA 4LBHA 5E3CA 2BKPA 1FKOA 3PW5A 4KY3A 3RG6A 2R3VA 4ZPBA 3OXLA 4CZMA 3MDFA 4BR5A 2IRXA 2GCFA 4DU3A 2FBXA 3ZTSA 4MK8A 2VU5A 3HJVA 1RAEB 1JLQA 4LFAK 2R7RA 1SJFA 3ID6A 3R3LA 6FDRA 2FVRA 4YY3K 1VI7A 2CGJA 3WBZA 5A0YA 3SUOA 4HTIA 4IO9L 4FKYA 3KLFA 4IDKB 2QTWA 4I1TA 4RWXA 2MYFA 1IJEB 2IVFB 3T9NA 3CETA 4RNFA 5A8RB 2FJEB 3I0SA 3N4QA 1N33F 1IR2A 1W97L 1SJ3P 3WZ0A 2DGXA 1MN7A 4K43A 1KQFB 3AVMA 5AQQA 3PJWA 2HPUA 4X66F 1I3OB 1S1WA 2CQ0A 1S49A 2WB1D 1S48A 4AQYF 4JI5F 3EE9A 2OPRB 3P83D 3CCRN 1IBCB 3Q2SC 3J81j 3DLKA 4O4RA 2ASJA 4FPRA 3D4JA 4JI2F 3CYMA 1P8GA 4K5RA 2RDJA 1VRUB 3A5LC 4KAIA 4ELUA 4K4ZA 1OY9A 3FUYA 4B3SF 4OX6A 1JB0C 2GGPA 4CHYA 3C6HA 2G8HA 1C1BB 2BV3A 4QR2A 4Y1DA 2MEWA 3VQ9A 1KFSA 3BH6B 2YX4A 2O8EB 4DXLA 4ZITA 4HHHA 3LP0A 4FWQA 2OPPA 1RAFB 2HHXA 3M8PA 3DDNA 1UVJA 1RAAB 2VWJA 1DKGD 2JRSA 3AT1B 4BBYA 2HW3A 1VHIA 2BMBA 4LF8J 4F3TA 3HSZA 2O8FB 1FJGK 1WI6A 1M1KT 2DITA 4EAHD 1YKWA 4CNYA 5DQGA 1CZBA 1TK5A 4CK2A 2VQFJ 1IKYB 2QXLA 5C15A 3LPTA 5KG4A 2VH7A 2VL1A 3W8PA 1TFYA 1QAXA 1OO0B 2CNOB 3UFCX 3RR7A 3FMBA 2QFIA 1U2VA 1R8HA 2R8HA 4GV9A 1FNXH 5CA5A 2CKWA 4EHTA 5GVQA 2YH1A 1TKZA 2MMYA 2YWEA 1VRTB 2CPEA 4NI2B 2RDIA 4F0KA 2XCPA 1APSA 2D4WA 4NX9A 1CZAN 3E1YA 5FLXO 1LXJA 1MDUB 4OL8A 2QKKA 1Y4ZB 2CQ1A 1M5PC 2L08A 3MX2A 4KAZA 3IKMA 3MCSA 1FEHA 1GNKA 2IVPA 5HP1A 1HW8A 1VQ6S 3G8SA 3CERA 1VQ4S 3Q8UA 2L9DA 1Q86T 1C2PA 4CJTA 1HIYA 1S72N 1E3MA 1IQZA 1WEYA 4BVOA 2QWRA 3O08A 4LR8A 5HO4A 2RU9A 2YWHA 1UA0A 4N77A 3PFEA 1S77D 2PMHA 2XBPA 2X1FA 2NLWA 3WQTA 1RT5B 5AZJB 4IH6A 5JXSA 4CLUA 4B3TK 3UI3A 3TU5A 4OYZA 1SC4B 2LVWA 4ENOA 1TUGB 2J7UA 4CEFA 3CFRA 3J81Y 2MGZB 2HWIA 3I56S 5JVHQ 2GIFA 3Q8YA 4TSXA 2YXLA 2UXCF 2A6MA 3EGVA 4MLEA 2BRKA 5C2CA 4FLWA 2L41A 3E9OA 3PYGA 1X9MA 1N5TA 2H9ZA 1AW0A 3C65A 1SC3B 1M90O 3SBGA 3H8YA 1DBDA 3CCMS 4P52A 2AKWB 3VVUA 1WG5A 2WVBA 3ID8A 1N36F 1EXQA 1FDBA 3D0GE 1RBAA 1HL6A 3IG1A 3NGKA 1ATSA 2W2MP 1JL1A 4JI7K 4ZVUB 1WC1A 4O4GA 1KSPA 4LUBA 2UVWA 4WFAL 4E8UA 1N5SA 3NS5A 4BDYA 4OYXA 4FJGA 2C22A 5H9EJ 3PRDA 2FJAB 3KXDA 1BHLA 2MZQA 3DOMB 4ZPTR 1O8BA 1FVQA 3IDHA 2Y1JA 4XH5A 4BR4A 1QHTA 4NZ0A 3T1AA 2JFKA 4QS7A 3PSFA 5C24B 1NOZA 5AQYA 1KHWA 5HAOA 2HHHF 1FTCA 3SQOP 5EDWA 1HQUA 3MXIA 4WE1A 4WFXA 1HHSA 2NXUA 4JV5F 4MTPA 1C0MA 4ZVTB 3AVCA 3MMBB 3AO1A 4JI0J 4TQSA 1RHMB 3W7BA 4LF6K 2MY7A 2OYQA 4QZVB 2FBVA 1G7CB 4M3RA 4ZP6A 1P27B 2OEKA 3ZSQA 2BANB 2V4JB 4IXCA 2F8TA 1R7IA 1RACB 4Y6IA 2JEJA 3M8RA 3UB5A 3GR1A 1X5PA 2GHPA 4DV0J 4NCGA 4IFVA 2G2ZA 1NKBA 1RTDA 3WC0A 5A2QO 4DR1K 5FRNA 3EDRB 1M0SA 4CZLA 2FPHX 4JKDA 4CEDA 2IM2A 3AJ1A 1BQNB 4K0KF 4I4BA 1M5KC 1XMQF 4C9DA 2HRTA 3LGNA 4BR0A 5B0DA 2W4CA 2QMUB 4GO5X 1KN6A 4IQMA 3VAKA 3GIIA 1HNZF 1R3NA 5GAEP 1XNQJ 1W25A 4F9OA 4X62F 1XI1A 1Q82T 4DU4A 4ILMA 1RT6B 1XMBA 2B6AB 2VPXB 1FNOA 2YTCA 3D6FB 1S0VA 3L4IA 1CJUB 3H25A 3UW1A 2FYXA 4KO0B 5EU7A 2IPOB 1ZC6A 1V5IB 5KPRA 5HATA 1WDDA 2R7XA 1LWFA 1L3TA 2WTFA 4WPAA 2B4PA 3OTOF 4F0HA 4DCHA 5DRKA 1RT4A 3CJ4A 1S6QB 1ZTTA 3VAHA 1UL3A 1FDNA 2V8PA 4MYTA 5IOLA 5C42A 4B1UB 3CCJS 4OZ5A 2DEIA 4OJ3A 2YWWA 2IM3A 4C4WA 5HL7L 2W25A 1UZDA 3PW2A 3NH0A 2W24A 5KFTA 2UUTA 4ATNA 2MKHA 1CS4A 1DURA 5AQTA 3AA2A 4GVLA 4JK8A 5KFZA 4QJVA 4EU0A 2XY7A 3E9PA 4TLQA 3M6VA 4BR7A 2O1PA 1EHWA 1D1UA 3QFHA 5HJXA 3SMZA 2KG0A 2OTLN 3HK2A 3OFHA 3OYMA 3IXQA 2Z2YB 4E0DA 3FNNA 2B5JA 3MURP 1AZSB 4OJ1A 3GFYA 3VQPA 3SCLE 4KH1B 1M5SA 1NSAA 3OTBA 3OYNA 2DGVA 3MAAA 2MXYA 3Q24A 2CDRB 4CI0B 4P75A 1RGVA 1KVJA 3PW0A 4NMXA 2PI4A 4Z2XA 3L6QA 1MWMA 3HPHA 3HTVA 1CBKA 1J27A 1VHXA 3A8YA 3M1VA 5BRFA 3LP3A 2IRUA 5KT7A 4F3MA 1E6YB 2G4BA 3EN9A 4FXDA 3KMSA 2HLUA 1FFGB 1YJTA 5BPNA 4ZN1A 2HKEA 1BE4A 1S9FA 1XMOJ 2DBBA 2HFUA 3O4QA 4DEZA 3KHRA 4V19S 2YHBA 1GX6A 1BA1A 3ENBA 2EFGA 4DF8A 2YNFA 3FRYA 2R7TA 5AQGA 3M7VA 3A12A 2CZVC 2HFVA 3DMJA 5D4LA 3M30A 3ZZPA 3MEEB 5LMNF 2DR9A 2P9LA 4IRKA 4Y2CA 2FF3B 2LXIA 1KP6A 2KVIA 3K9JA 5IWAJ 2CQGA 1HQEA 2RE2A 1J5OA 2Z2LA 2EXUA 4HWIA 2WONB 5KPZA 1W9HA 2A1RA 2Q66A 3MM6A 4FF3A 1YJNN 2D0PA 3N28A 5ETPA 2PFFB 3VQDA 5D4PA 3HM9A 4B02A 4USKA 4RW7B 1ZBLA 4ZPAA 3MN9A 3M32B 4ES2A 1GFWB 4ED6A 2RILA 3LDPA 1EQYA 3R7BB 2GMJA 2VIHA 4FZYA 1XIQA 1U4BA 2MLYA 5FIIA 4CECA 4CO3A 1WHXA 4B9SA 2VC1A 2DR8A 2FY1A 3O3FA 4BDPA 4Y34A 1FRXA 3T1HJ 3OR1A 4PHTX 2OAUA 3X1LB 4CEAA 5KFSA 3BKFA 4FW1A 3THYB 4O0JA 1OSDA 4FWNA 4K50A 2DRAA 1Q18A 5ETNA 4TU9A 1QE1A 4B1VA 4NXNF 2QLBB 3UCUP 3OYGA 3HULA 3J8AA 3VA0A 1BIZA 4ID5B 5K20B 2OZSA 3OSPA 3C66A 1NH8A 4CLWA 2QLWA 4RBVA 4LFAJ 3NDKA 1T7PA 4DOZA 1X4BA 4YY3J 1VBYA 2YHXA 1LFPA 2IGIA 1HBMB 1PBAA 4DV4K 3PG9A 4UOFA 3V2UC 4WCEQ 3CCLS 5LXRA 3MMCA 4OYAA 4CLSA 1EZZB 3C6UB 5M1OA 1BY9A 1BGXT 4EWTA 5KG6A 4M95A 2J8AA 3FEYB 2IHR1 4IRCA 3H0PA 1HHQA 3M9OB 5KG5A 4G1QA 2JL9A 3MM5A 3S41A 3MCNA 2CJKA 2V2ZA 4WF9Q 2IY5B 3V4IB 2ZE2B 5CYQB 1FXRA 4JS4A 5E84A 3MM7A 2PO4A 3EVWA 1ZTWA 3KKRA 1HKGA 2X1GA 3ZSOA 4DQPA 3SV4A 2IC3A 4KBIA 3OYHA 3O6QA 2Q2RA 1HYSA 4HVJA 3LA0A 1IH7A 1QDUB 2C1EB 2OH2A 3EEQA 4RW9B 1VIOA 4USHA 3OJSA 4Y3CA 5GAEI 4K4WA 4BRLA 3QBXA 4A8YA 3ZXWA 4KH5A 4C48A 1U1KA 3TUIC 3DLEA 4CF1A 1RTIA 4A47A 5GIPA 1PO6A 2QSFA 3ZETB 5TKWA 4C8NA 2D0OA 5AQVA 5IT9U 4UZBA 4ELVA 3DXMB 3X3UA 4BC9A 2G2YA 1RWMB 4MO5A 1SL1A 1BQMA 1LOUA 4RL1A 4DTNA 3BZKA 5J1EB 1VQOS 3AVFA 1PYSB 4PWUA 4ZIWA 3CCVN 4U67L 1Y5IB 1OS5A 4W90B 4E1MA 3U1MA 3OXFA 2RF2B 4EYHB 2QWLA 4DR6K 2C3PA 4FZVA 3ET6B 4PEOA 1FJGJ 2J9DE 4HH1A 1RBSA 1UWBB 1FFSB 3DRXA 5F8MA 4U6PA 3T7ZA 4I64A 1FRMA 1Q9YA 2AA4A 2O4GA 2FC0A 5M1KA 4L72B 2FHJD 1D9DA 4YDUA 3GYXB 4WK1A 2ACMA 2IS3A 1U1NA 1BL3A 1YJ9N 1AFIA 1BXNA 1TL5A 3T9ZA 4OJHA 3CDEA 3BEXA 4ZVFA 4PQUB 2B7CB 1RXOB 5FDLB 4E7JA 4DDFA 4B9MA 3I5AA 5KT6A 2DRDA 3R1XA 2V8HA 3TZYA 2HVEA 2WVCA 1IQTA 4WQ4A 3S1TA 2GVZA 3IN5A 4K8XA 2VKRA 4DPXA 2HEKA 1P9QC 4ER8A 2VQFF 2AYGA 3CO0P 4EUVA 3G4SS 2NSCA 3WIUA 4KRWA 3MR5A 3LH2S 4ZA1A 3KLIA 2DT9A 2V9WA 1C0TB 3BYPA 3HT3A 4N56A 1QTMA 4U7UK 4OLOA 4ZK7M 4KT0C 2I0XA 3OFEA 1XR6A 5BR8K 3PKMA 4FPAA 4QIVA 1GMWD 1RT3B 3V9UA 4B3TJ 3NRBA 3NCIA 2HIYA 2KO1A 3PNIA 4CYUB 4DUTA 2KI2A 4AYBD 4YB7A 2W2QP 4F4XA 4ICLB 4F2RA 2KT2A 4F2SA 3KTQA 4DR3F 1X31C 4RW8A 2XO7A 5DM7Q 4KE5A 2VPWB 3CJKB 2XS2A 4XO0A 4P72A 3SI6A 2DNLA 3M3ZA 3OYLA 2MZ1A 5LY3A 1O13A 1S5JA 3HDSA 5IQ6A 2Z56B 1X4AA 2HSEB 3NHGA 3C14B 4PKDB 4MO4A 4J9QA 4IO1A 1NK5A 1YX2A 5M1PA 4ZVOB 4I2PA 3A2FA 4O44A 4TYAA 4JI7J 4DR2K 1AYEA 3KNAA 5LMUF 4BRQA 2HBZB 1Q53A 3SFUA 4FLXA 1TMJA 4A8MP 3IA0A 1NMEB 4O3NA 2R9LA 2D3ZA 2AGOA 4Q0BA 1W2IA 3MGJA 3M9NB 4DX7A 2HB5A 1WSVA 3QB0A 2GJ2A 2KZMA 3NMUA 4FJKA 3PEHA 4CO0A 1J2VA 1G4CA 2DHGA 4YS2A 4DMNA 2BX6A 3E01A 1P9YA 4BY9C 3AH6A 4CJWA 1UP1A 3VESA 1BCOA 4WK3A 4XPCA 1KVAA 4LF6J 2EFNA 2E1MC 2PI5A 3FLCO 2MSTA 1U04A 4RJVA 1B92A 3ZX0A 3T6JA 4L3NA 4HCCA 1BLUA 3SQ1A 2E2PA 3FZ2A 3OUYB 2XI3A 4CBWA 3I9V9 1BIUA 4X4QA 3FBFA 3J7YP 2RPIA 1PKUA 2GIQA 2YNHA 4PCQA 3SAFA 4HT7A 4NLSA 1TUWA 2HHVA 4DR1J 4Q7AA 4EBCA 4GVBB 5L1IA 1P1LA 1HQ2A 3MPUB 5CCMA 4PG4A 2IVNA 4H5VA 1B9DA 2V2KA 4F0MA 2F1FA 5D4OA 3PY8A 3TZZA 3VGTA 3SZ2A 3D7SB 3K9KA 1HBUA 2O8DB 5HBMA 1TP7A 1RDCA 5C12A 2XMTA 3AVHA 3HSGA 2B8PA 1SPBP 3QAUA 4JI0F 1GT8A 1KQKA 4ZTJA 2C2RA 1NDLA 1FESA 3BR9A 4ECWA 3VEWA 3QIDA 2AQ4A 1HFEL 1HARA 1KBRA 1RWWB 4DV0F 3DRRA 3ZT2A 3N79A 2X51A 1IBMJ 4DU8A 3CJ2A 1NSPA 1Q8KA 1F6TA 2VV5A 4LREA 2F9TA 5ETQA 4QBUA 1YJWS 3QJJA 3OR2A 3ZO7A 4FJ7A 3QIPB 3J80O 4PKIA 3H5YA 3SQ0A 5B0AA 4PKHA 1Q78A 3MCOA 1FW6A 4I6YA 3PKYA 3THPA 1RTJB 3HP6A 4F02A 1UW9A 1WUUA 3CJ7A 4YOTA 3P38A 3OL6A 3MPDA 4DFPA 2Y3YA 4ISFA 3DN9A 2RQCA 1XNQF 2I5JA 2I2YA 1YXQA 4PUOB 4UOGA 3ZC4A 3D67A 4E2FB 5EWEA 5GAEU 3EYZA 1GLLO 4MYUA 4OIXA 5K8MA 4C8YA 3MXHP 3D54A 4FYXB 4HHJA 1CJTB 2O67A 1S1XA 2HHPA 2LU1A 1N32K 3AO2A 3VWSA 1V3SA 3SQGA 4LF4K 2HHWA 1OYDA 2LDIA 5HRSA 2E6MA 4JKBA 5BR9A 2ACYA 4CD3A 1IKXA 4A57A 4NCAA 4WFBL 3MCAB 4DL5A 2IBOA 2DXDA 3C94A 2M4MA 3HJFA 2EG2A 3M2UA 2DO4A 3HZGA 4UZCA 1ZAWA 4DL6A 1HI8A 3NF8A 3E8OA 2XEXA 1U6FA 3HHLB 5I4MA 5KFPA 1FD8A 1OY8A 3CJQA 3LAKA 4BS2A 1QUVA 1RLDA 3HVTB 4PG8A 3H45C 1T3OA 1Z26A 3WQUA 5BYQA 3R8YA 3C16A 4RU9A 4TQRA 2FXUA 3W0LA 4MIAA 1RAGB 4PWWA 3W62A 1Y0HA 2OIHA 5KFKA 4TYBA 3ZX2A 3NGTA 4A62A 4M42A 2RUGA 1T03B 1S9EA 3MOZA 3NMAA 2ETJA 3UD4P 2YNGB 1RT2B 3VQTA 3VF0B 2VPZB 3SI8A 2AIRB 4KB1A 3EX7B 3AVLA 3AXMA 1UMJA 3MECB 5HN0A 2PGCA 2OP5A 2N3OA 1U1OA 3G0ZA 3ULEA 2OEJA 4FLUA 2G0JA 3NBPB 4IRDA 3L0QA 1W2BM 5K9FA 3CPWM 1U26A 1N5QA 1VQ6N 1VQ4N 1SV5B 4CFDA 2WSEC 2VGMA 3OYIA 2CWXA 2BJ7A 2NYHA 2VDHA 3HHEA 1XMOF 3F9KA 3QFWA 2CQ2A 1HJOA 1EX8A 4CESA 5ELZA 1A7GE 3HHKA 3JYTA 4IFEA 2J0QD 3CQ8A 4C97A 4C3LA 2GHVC 4BE1A 2UP1A 1YBUA 3RRKA 1ZXOA 3H4DA 2Q3SA 2HNYA 1UAWA 1WF2A 3IBFB 1FRIA 2KW4A 3K8WA 1NDCA 2VQEK 5KFXA 1WACA 3W5YA 1R0BG 4JKFA 5IWAF 4FLTA 1BQXA 3LDOA 3UNYA 4U7BA 1WELA 1R31A 1WBDA 3R5JB 1M1GA 2MQQA 2H51B 3I56N 1X4GA 2ZHAA 3VENA 2I38A 2VD3A 1WN7A 2NXNA 1T05A 1RABB 4JS5A 2UUWA 2D9PA 4UOCA 3OHBA 2IA6A 4QWDA 1FKOB 4X2BA 5I9EB 3ISZA 3MMVA 4DV4J 1EP4B 5KG3A 3CCMN 2RRBA 2G1HA 1PGZA 2CZ4A 2CJQA 1GLDG 1QD1A 2CQIA 3KK2A 3JTOA 3NMRA 3QGIA 3J7YI 3VPZA 2HNZA 5L9XA 5A0YB 3D2EA 3KLFB 3T1HF 4CBUA 2CG4A 1S7HA 2IVMA 1RCXB 4UW2A 2QTDA 3A4TA 1BA0A 3UO0A 3I0SB 1HKCA 1YJ7A 2P9PA 4B08A 4EIAA 3KKSA 4N8NA 4QS9A 3G71S 4J9OA 1P1TA 2XB2D 5F41A 1TYQA 5D0RA 4LFAF 4DUZK 2R2TA 3HHLD 4WXOA 2VASA 4JKGB 4DS5A 4YY3F 3IWNC 1SXLA 1WKKA 3TA2A 3AA3A 3THWA 3DLKB 2MB0B 3GR0A 1TVRA 1Z4UA 4ZVRB 2V52B 1JJ2M 4KFBB 3SIPB 4USIA 4IOAL 4W98A 4CFCA 1RWNB 4J7CA 3ELHA 3HKZD 4PXEA 1RBLA 3SPYA 3IWLA 1WSGA 4H0YB 2GGPB 2FZGB 2VB6A 3L7UA 1HKBA 4G1IA 2M3DA 5CAAA 1P6TA 3QBWA 1VSLA 3ZT1A 2FHOB 4I6MA 4BLGA 3TX8A 1YJUA 2I1RA 1PAUB 4DR6J 3OLAA 2UVVA 1RWXB 4KYZA 1RDBA 1T9VA 2VOPA 1S4EA 4CEQA 2XRIA 1JLAA 1LW0B 2ILZA 4YR0A 1I51B 1WTFA 3MEGA 1K8KA 4AE5A 3O1BA 3GSIA 1WEXA 2YNIB 2HBRB 4NCBA 1Q81T 1ZM4A 4F3QA 2BUNA 2YKMB 3KOAA 3ALYA 3UR0A 2DNHA 5F3TA 5ADXA 1YRTA 2XZTB 3I96A 3VMFB 4EZ6A 1KR4A 2DY4A 4RBUA 5GINA 5I3UA 1W7WA 2JH3A 1BUXA 3AOCA 4RR5A 1V4SA 2YQ0A 3CJ8A 1TKZB 4KV8B 3VCDA 2F5GA 1Y00A 1WSJA 5C2DA 1FA0A 1JIHA 4DMZA 4DV1K 1E4FT 3U02A 3BJYA 1RDDA 4YHHK 4DR4K 1FJGF 3EY1A 1LQ9A 2EX3A 1R43A 3BQ2A 4NA2A 1G3OA 2HNDB 3H1QA 5F0UA 3VAJA 5HVGA 1NRKA 1XK8A 5HP1B 3KHGA 3PX4A 1FFWB 4K4YA 5AQXA 4Z7CA 2Z2ZA 3DRPA 2J9CA 3C0BA 5LM7E 3CCJN 2HFOA 5BR8J 1F9EB 4H54A 4BC2A 2QE5A 2ASOA 3HP9A 1REVB 1DTQB 4L3QA 5AQWA 1NJIT 5C7PA 4PG7A 3BBCA 3GYNA 1T3VA 2QLFB 5KTQA 2AYEA 2K06A 1YF5L 1XEZA 2P5GA 4DSEA 2P6SA 4CHOA 2P9UA 2F96A 2LXFA 3QZ7A 5K14A 3TA0A 3NOCA 5BN8A 3BH7B 1RA6A 4K2XA 5I3QA 4C0BA 3QLHA 3W2WA 5KFDA 3M2VB 4URSA 2QA4G 5FPDA 3NGYA 4DV5K 2GJIA 3CSKA 2VODA 3PO4A 4UUWA 1RBRA 4N8OA 1RE1B 1IN0A 4DR2J 5LT5A 1OIAA 4B3TF 4I2QA 3SAGA 4WQ5A 3IG1B 1S1UB 1K8AT 8AT1B 2NS1B 4O4GB 4C98A 3HZ6A 4CJPA 4IFYA 2BE2A 2HQCA 4DV7K 1SIWB 1UEUA 3VQQA 3A13A 3HSCA 2EWSA 4B1YB 4FWPA 3IR6B 3R1LA 1U09A 3D2FA 3NE6A 1ZM3A 3CIPA 1JCFA 4Y2MA 2E1YA 3ILLA 2QMXA 3AA5X 3PJXA 3BGLA 3HKWA 4NO7A 1Q8BA 4A8KA 1NGAA 4UQGA 1HQUB 1ZETA 4WE1B 4OZNA 3M8QB 4OI1A 4JI7F 1YAGA 3V9XA 3I82A 4AHVA 2Z1IA 1NK9A 3NGUA 4RO0A 4NRUA 4CW7B 2XSJA 3ZSXA 1OWXA 3RMCA 4ZLNA 4YOUA 5L9NA 1RWKB 2RHSB 2G0CA 2RS8A 4PKGA 3KHYA 2C2KB 4FPBA 3MM8A 4NCGB 3UVJA 3NAEA 3H90A 3RAXA 5HRPA 3TQ1A 4KI4A 3O5BA 1UW4A 1C6VA 4OGEA 5EX0A 5KG0A 2BOPA 2E9ZA 2FUG9 3S7RA 2D3UA 4YOYA 4WU2A 3KDOA 5FLXU 2R7OA 1R8CA 1LOTB 4QU6A 3OYJA 4BGAA 1GXUA 4ZP9A 1JWWA 1NPPA 4LF6F 4IR9A 4NL5A 4J9PA 2BA9A 1SAZA 4K4XA 4FL9A 3ADAC 5CXTA 2JEFA 1DLOB 4WP8A 3GONA 3ZT0A 5AE3A 3AVKA 1R6VA 1UA1A 4DCJB 2FC9A 4CI6A 5KFCA 4PYDA 3K2YA 2NRVA 3J7YU 1T6DA 2HBQB 4CD1A 2OUGA 4OHWA 4DS4A 1QVGR 3V1OA 2KVQE 2VONA 1CJVB 4P7VA 4ZJQA 4MKYA 2FJVA 3CCLN 1IUJA 2N7YA 4OX8A 1FNMA 3Q8QB 4E7IA 5AXNA 4WFNQ 3NCPA 2E7XA 1VSEA 4BRMA 2OSRA 1BWFO 1CLFA 3LWLA 1LWFB 5T7LA 1TELA 5F8LA 3OJUA 3QBCA 4FS1A 3IAYA 2E5HA 4CO1A 2IDOA 5JVHL 1WSIA 4JI4K 1DQAA 3CQYA 3R27A 3NCQA 1OY6A 2XC9A 3U27A 5C42B 4FP9A 1BWVA 4IR1A 1JCEA 3DXBA 3I55S 4YB5A 1OYEA 3PX6A 1R8PA 1AUSL 3M8SA 4IKAA 1CS4B 2CQBA 1SH3A 1DZ5A 3ZEUA 4FWOA 4C1NK 1N32J 4HVZA 3IRXA 4LF4J 4A48A 1WF0A 1SZ2A 3LTOA 4NLXA 2KDOA 1U8SA 1K47A 1YSJA 3VF6A 4Q5VA 1XUPO 4USMA 3BV8A 2D1CA 3N5FA 2IMOA 3PYFA 3ZZ0A 3V6JA 3D0IE 3CC2N 1EIYB 1Y3KA 3AA4A 3QFPA 1RSCA 1O1WA 4BGBA 3BPSP 2EG1A 4BR2A 1FE4A 4XDCA 2X6SA 3WXIA 3MAAB 2M9KA 1VQON 3TAFA 3SDEB 3PHEA 4NLWA 4CT9A 4OMFG 3V1QA 1UFKA 2JVOA 3GE1A 1KDNA 1LW2A 4C3KA 2P5OA 3EZWA 4BR9A 3JSRA 2CNKB 1IKWB 4F50A 1KLNA 2J7WA 3OW2M 4QOTA 3M1VB 3GU0A 3EZ5A 1QSSA 4OKKA 1U0HB 4PXBA 3S6EA 3HMJG 2LYVA 4ZCMA 1ZBSA 2Y9HA 5AQHA 3QNOA 4ED2A 3UIQA 1VGYA 4HACA 5K8NA 4Z4FA 3NAHA 4FYYB 3ATUA 2FBTA 4PG5A 3OVNA 2YKQA 4FNIA 3TYTA 4KR0B 5HMWA 5A2QU 1RYRA 2P9NA 1PJ6A 1X5TA 3FSXA 3PIPQ 2Z2MA 5KFYA 3H40A 4YOEA 3NGSA 3CULA 3QDKA 1EETA 5LJ3Y 3T1YK 1FO1A 3GQCA 1S1TA 3MM6B 3Q8RB 3G4SN 3W3SA 3W9HA 3OHAA 3TANA 3GB0A 1FDDA 2LA6A 3AVGA 4WFYA 2XMKA 1ASVA 2A18A 3SSRA 2WRMA 5F0WA 2H5IB 1VQ7S 3BF1A 5KGWA 2KL8A 4LRFA 1LFWA 3UN3A 4DKWA 1T11A 2AYMA 4M5GA 4HTUA 2VQEJ 2LA4A 2ZOMA 1A9NB 4O8KA 1VQYA 3I33A 5GAGP 5GIOA 4DHVA 4CK1A 3AO3A 4R5PB 1T02A 1ILYA 3R9LA 5KOWA 4QPTA 4OO1J 3FGUA 3AB2B 2VG7B 2BDPA 1TKTA 3KFWX 2HHUA 3SUPA 4N5SA 2APOA 1U1MA 2ZJRL 3TP2A 3SCXA 2UXDK 2ZHOA 1AXQA 4ZS6A 3KJNB 3QATA 2XY5A 1SL2A 4ZVGA 4DCOB 3VF2A 1MA9B 2CQ3A 5HLFA 5CZVA 4XAKA 3QICA 4QIGA 2BR0A 2ZOGA 4HYKA 3O9UA 5BRHA 1XHZA 1FHTA 1JLEB 1H1VA 2FSKA 4MLHA 3CI5A 3UKRA 3BGRA 1NKCA 1EARA 3TRGA 3ISNC 2OCEA 3R5CA 5D6GA 3LDQA 3MM5B 3KDNA 2RQMA 2HK2A 1JNRB 3CXCM 3MD1A 2HRUA 1RHRB 3R6GB 1SQFA 4JHDA 4CP5A 5AE2A 4CGGA 2UUAK 2RSQA 4WU3A 5EOYA 3D0HE 2E8AA 4OLAA 1JJHA 4DV4F 5AZIB 1LK7A 4BACA 3QEVA 4ECZA 5EVZA 4BWJA 4J5OA 1RBVA 4ECUA 1SQKA 4PXDA 3GV8B 1ZAVA 1EJ7L 2G9OA 3LF0A 1U0SA 4M5HA 3HZEA 2DYAA 2PY5A 4RWTA 3AAWB 2QA2A 2CQHA 3P5TL 2ZHBA 2ZD1A 1Z05A 3DHWC 1NKEA 3DLEB 2ASDA 1UJ6A 2WB4A 1RTIB 3H4BA 2WAQD 3OPKA 3UDEA 4M45A 1QVFM 1Q79A 3D6HB 4KHSA 2FIUA 3SCKE 4Q2MA 4IZ9A 4KB7A 2EFVA 4JNEA 3MFIA 1IV0A 3M2RA 1KOOA 3JSMB 4Z4HA 3BM7A 3WNGA 1WNEA 2E1RA 3MN7A 5CD4H 3NLCA 3CJTA 2PIIA 3BGOP 3FQLA 2MKKA 3AA9A 3AO4A 1LXNA 3LW5C 4CIEA 4H4KC 3MHYA 4WKYA 2B4JA 1RHJB 5CHIA 3GBTA 4QPXA 1QTNB 4F36A 1NU0A 1HPZB 2KYXA 4DR7F 4CF8A 2N4DA 2A3JA 4BRAA 4KGZB 4M94A 5KFLA 1X4FA 2M7SA 2GAHC 4FJXA 1K73T 4WYLA 3AD8C 2E5LK 3OVBA 3TZWA 4CLZA 1U2FA 2AGPA 2IRYA 4TLRA 3U4LA 5CYMA 4DV1J 4DR6F 3G6ES 4DR4J 4YHHJ 3OS0A 1ACMB 2J4RA 5IM0A 5IT9Y 1VFJA 1HNVB 2W7AA 1YJWN 3JQKA 1Q8LA 1WUAA 2XCAA 2KHOA 4LF8K 2GVZB 4MKAA 4IG0B 1SBRA 2CXEA 4EZ9A 2HSTA 4NXMK 5EWGA 3GMGA 4LSNA 2ZWPA 4H0TB 5BREA 3KLIB 4PG6A 3VQCA 1AUDA 4C1NI 3A1YG 5A76A 1WOSA 3T5JA 4CJLA 4ZVSB 1NGFA 3WNEA 4KRFA 3VERA 1KQGB 4FZXC 4R8UA 2DIVA 1LWCA 2H48B 3W5ZA 3TSPA 3UKUA 4WCEL 3FZMA 3JS9A 4CM0A 4ZIVA 2WK4A 2KKZA 1FCAA 5DG7A 3TNVA 3VOVA 2Z0GA 2V4RA 2UU9K 3PDNA 3BSCA 1NU4A 3GYGA 3H46O 4RW8B 2R8JA 2W6KA 3PZPA 5DM6Q 1B0VA 1KAZA 2JEGA 2RU3A 1ZYQA 1JJ4A 5K8PA 4LSLB 4WF9L 1WOOA 4QR1A 2CIMA 2CPXA 1J53A 2D0BA 2R2UA 3CC4S 4M3WA 3W66A 4W5RA 4FJMA 3W64A 4DV5J 5BR8F 1EKSA 3K5OA 3GIKA 3WDOA 4LVOP 3IP0A 3G8QA 4YMEA 1S9GA 1Z2LA 5KG7A 2V4QA 4EP5A 3H6EA 3I32A 5DMRA 2ATLA 3UN2A 2VBWA 1YGYA 5BJRA 3HRGA 2CJXB 4O44B 3MM9B 3KLEA 1N6QA 3LP2B 1S6PB 2KLAA 2X1BA 3KLGB 1T3NA 4DV7J 5KFRA 4CTAA 5J2QB 2GIRA 1IM4A 4EFAC 4WFZA 2CPFA 3NS7B 2ZZNA 2KFNA 1NJYA 3CJSA 4ETXA 3R2CJ 2ZQBA 5GAGI 3LO3A 2VYPA 2BM0A 1GAOA 4U9RA 4URQU 2QW9A 2QIFA 3KWGA 4PAAA 3CC7S 1KTQA 1L3VA 2HMIA 5L8RC 3DXKB 3PIOL 4QAGA 4ZHRA 2RKIB 4ES3A 1UETA 2UVUA 3OYKA 1LWEA 4H4OA 4DR2F 1X7VA 2NCKL 2FGCA 2G2OA 2V2VA 2IFXA 2HVDA 1FKPB 4CHZA 2XYGB 4IG3A 3THXA 3FBEA 4TVAB 2A1SA 4EBDA 2E7VA 2DNQA 2YNHB 2GJFA 1D4XA 1VR6A 4JI8K 4LSZB 2XULA 2QZ8A 3DWLA 3NNHA 1HNXK 4H0OA 3VA3A 3MFHA 1L3KA 3CW2C 3ILOA 3QFUA 9RUBA 1KWMA 1N4LA 4ZCLA 3QQCD 2ZJPQ 4X4UA 2BGGA 3MDQA 1WHVA 1HBUB 4J2BA 2GNKA 1RK8A 1AT1B 2AJ2A 4HTLA 2YHYA 4GKJJ 2MHEA 3T19A 2ZVIA 5J2MB 4JN4A 4TU7A 3IUCA 4ED7A 1JMTA 1IBKK 4CJ7A 1HD0A 4FM1A 2HQGA 1TL3B 3G6XA 3IS9A 3KK3A 1FWPA 3EICA 4MQ3A 4MK9A 2CADA 3WXLA 4JI3K 2JWLA 2LQBA 5CYJA 3FBCA 3B6OA 2GV1A 4M3ZA 4MFBB 3DRYA 3OR2B 1CJKB 4DJBA 1U1QA 1X4HA 4M63C 1V3ZA 1EAYC 1VSKA 2X1AA 5IT4A 4AD6A 3M4XA 2AZ3A 4I9QA 2AX0A 2V0NA 4JI4J 5DM7L 2JJ4D 3MTKA 3SPZA 5LJVA 3M5RA 1IR1A 2KKHA 2J8SA 3G71N 3L9ZA 2GAGC 5GADP 5J2NA 5E3RA 1Y11A 2O5DA 4Z37A 5ETMA 2I5JB 2MHNA 4CF9A 4IDKA 3L2VA 3EUNA 4F8RA 1BMQB 3A8IA 4LBIA 2WVEA 1S1XB 2R7SA 4AM7A 4DL3A 3N5BA 2AZ1A 3H5UA 4L75A 3U3GA 2W8LA 2RRNA 4DPUA 4HEA9 4IOXA 4NLQA 3DOLA 4LF1A 4ID8A 3GV7B 2EBGA 4UOHA 2BE9B 4X84A 5I3PA 2XI2A 2OPRA 3N9UC 2KRRA 4DQIA 3FFKB 1ZPWX 3VEYA 1S7IA 4WYWA 5CCLA 2ABYA 2A40A 4YOXA 5KFQA 1CVJA 4DG1B 2XLJA 5KFIA 2ZH6A 1U1LA 4LD0A 1NB7A 1V6HA 2KXFA 4EK2A 2IIRA 1FD2A 2ZH8A 1N32F 4CF0A 4M7YA 2LXUA 2IDEA 4LF4F 1UFWA 3ULHA 4UY8T 3CFPA 2QWMA 1DJ0A 4EHUA 1C1BA 3BYRA 3EPIA 1X0FA 2BE7D 1JLBB 4YUDA 1A5VA 2BKOA 5DS7A 5LJWA 2O8EA 3TTFA 5LSLA 3QJPA 1PIEA 3ZTPA 2HS3A 3T3FA 1SS6A 2DO0A 4Z94A 4BG9A 4O3RA 3P5JA 4R25A 3QEPA 1TL4A 3DLLQ 2UUCK 4W92B 4B8CA 4JI6K 1XC3A 2G8FA 1SL0A 1OH8A 4FLYA 4BRKA 2XTJP 3T1YJ 2IOCA 3QNNA 3MWBA 2DGOA 2J0SD 3JQMA 4FYWB 2FVPA 1FE0A 1V4TA 2HBKA 4M5NA 4ECQA 1H6KX 2CQDA 2W01A 2Y1IA 3Q7BA 5KFAA 3ENQA 1Q9XA 3C15A 3T6BA 4O3PA 1TQLA 1F5BA 1UVNA 4BQLA 3OFFA 4X65K 1VRTA 4NI2A 2W9AA 3JYTB 3N6LA 2J76E 2JLGA 5SUHA 4CZGA 2JWKA 1Y5LB 3CDBA 3VV2B 3BZCA 4BRFA 4LRCA 2G8KA 2QLJB 1BHNA 2ZNZA 4EEYA 2RMLA 3C6TB 3RRHA 2WBMA 3QMLA 3RSEB 3J80U 5JVGQ 1HI1A 5GAHP 2UXDJ 4CJEA 1T05B 2DGSA 3FZHA 3B6PA 3U1NA 3FCHA 1T9TA 4YDDB 3DM2A 2O3DA 2RQ4A 1RT5A 2WC9A 1BG3A 4YR3A 4B1XB 2P9CA 2FF6A 1RADB 4LRAA 3F56A 3QSIA 1N36K 2F9WA 1IXKA 2OHDA 3W9IA 1UOCA 2Q43A 4AHTA 1MW7A 2HNZB 2VQEF 3PO5A 3O9QA 2MGZA 5MAOA 5D77A 3D7EO 4A8WA 5F3ZA 1VQ9S 3DLGA 5GAGU 1K44A 3ENVA 3R5GA 2P9PB 2COLA 3DU5A 1Q4RA 1NZ8A 4USUA 2UUAJ 2K1RB 3TSUA 1S59A 3N01A 1CXQA 4F25A 1NGIA 3DGPB 1JLFA 4O0IA 2BQUA 1PBUA 3CIZA 3DOKB 3DLBA 4BC4A 1IBLK 1NK0A 2LP4A 5KT3A 2ALZA 1VOMA 3MTJA 3TJAA 1U1PA 3LWMA 3R1HA 5L1KA 4Y2AA 2N7CA 3HI9A 1NSKL 1P90A 3OTCA 1QLNA 2DXFA 3OQ2A 4FLZA 1U8WA 2Y0BB 3ZZOA 2F3JA 2F7VA 2QYCA 5FD1A 4ECYA 4P2SA 4NLOA 2E88A 3QEWA 3CPEA 2QC3A 4OPAA 2W7PA 1PSDA 3DOMA 1YTYA 2NXCA 2HAIA 3BBBA 1Y97A 2OTJS 1VQPS 2QGFB 3EGNA 4ILHA 4I0WA 2KFYA 2IJRA 4O5FA 4A8OA 4A8XA 1GOBA 5HVHA 4DUZF 1S57A 2FVQA 3AVAA 5C25A 1OH5A 2BACA 1EQMA 1J5EK 2QJ3A 2DNNA 3BO2A 3E2EA 3JAMO 2HWHA 1RQ0A 4HHUA 3LM9A 5ETKA 2PFDA 2B8QA 2PMWA 5G4DA 2YCHA 3R2DJ 3CCES 3NL0A 3K7RA 3GV5B 4V19J 5DDRC 1F5AA 2V4JA 4YFUA 2W9CB 1RDWX 1Y5NB 4M7XA 3UNGC 2ZM6F 4M5IA 2DHSA 1TZ0A 2E5LJ 5F8JA 4B1WB 5CD4A 3J7A1 7FDRA 3LAMA 1BWEA 2HZAA 4AHUA 2D0AA 2NREA 1BQNA 1DHMA 2Z8QA 3AQOA 2V8GA 5AQLA 2G8IA 3TSQA 3V1RA 4DUYK 4NXMJ 1W26A 1BCMA 2X7IA 2CVIA 3TWHA 3ZZUA 2I8EA 3OBIA 1RAOA 3TA1A 3DGVA 5IFMA 4LH4A 3L8BA 4NASA 1CQMA 4Q44A 3EO3A 2Z1HA 1URNA 1K9MO 3I55N 2HFSA 2A6OA 2JC1A 2B4UA 1CJUA 3OV7A 4KO0A 4KGXB 4DV1F 3A3NB 4DR4F 4YHHF 3GILA 1VSIA 2UU9J 4ZN3A 1PYOB 4H0VB 4WJBA 3WNHA 4CT8A 4J91A 4RNNA 3CUNA 2DRBA 3RVCA 4YP3A 2F8SA 4QIEA 3WT0A 1ZBUA 1RT7B 1YLXA 2VBYA 3CCWA 5DG8A 3D28A 3D45A 4CZCA 2NNWA 3KHLA 4IO8A 4U7CA 1S6OA 1VDHA 4AF1A 3GSDA 2DVIA 5C2GA 4BC7A 1WOQA 4I6WA 1WC0A 5EGYA 1OVYA 3N4WA 4ZP7A 3KJVA 3O3LA 2KZZA 5HROB 2O8BA 5E3PA 2KHDA 1KAXA 3HVWA 3W65A 2QXFA 3CEDA 3EE3A 3ZSVA 3CHWA 4A2BA 4ZLPA 2IIHA 2BZ2A 1K1QA 2YJFA 2OKQA 1U6ZA 4QWBA 2O4IA 3B8AX 3JXUA 1NBEB 4QWEA 5KG2A 2YX1A 4XEIA 4DV5F 4JYAK 2ZF5O 4RW4A 2C2EA 4K59A 3DRSB 2ZVSA 2E20A 1F5CA 3DJCA 1U1RA 2AJFE 2JEIA 1PC5A 4ECSA 3P39A 3V6KA 5E41A 1SH2A 3NWRA 4EMDA 4MMOA 2E1CA 4NLYA 5A8WA 3ENWA 1GLCG 4DV7F 3GE9A 4LFBK 3I8DA 2FHKA 4NLRA 2V63A 3OYDA 2KG1A 2NLXA 1S79A 3HYFA 2OLWA 4JI8J 1QSLA 2NYIA 1LWXA 4CZIA 3FMWA 1JX4A 2KHCA 3G10A 4CLTA 4JK9A 3PSIA 3H42A 1HNXJ 2HG4A 1WWHA 1A6LA 1Y3JA 3MM8B 3BO3A 2MZJA 3UVJB 1VQ7N 4XPEA 4CGDA 3K8VA 2WONA 2HBMA 4BCAA 5K5MA 1RHKB 3AY0A 2XLKA 2UUBK 1NNDA 1IJFB 3SUQA 3MCMA 3R9PA 4OKEA 4KKOA 1RJJA 4DV6K 1TL1A 3H59A 1IBKJ 4CJRA 1URRA 3MPWA 3FZLA 1VC5A 1VSDA 1DY3A 2C2ZB 3U6FA 1ZM2A 1RAHB 2HHQA 4ANDA 3JQJA 3D3BJ 4IEEA 2AD9A 1JXBA 4JI3J 3K5LA 3P4UB 3NGIA 3DYAA 2B43A 4DPTA 3PFOA 1X9SA 3SEOA 1M90T 1JLGA 1QM9A 3THYA 4J2EA 3TI0A 4ETZA 4IQXA 2ROPA 2V50A 1WLJA 1N52B 2AJ1A 2GX8A 5EX3A 3VALA 4A2AA 3BZQA 3HCXA 5AQPA 3VZIA 1OMSA 4ID5A 5LJ5Y 1NK7A 1VRQC 3C7NB 3IAS9 4NB4A 1NGEA 3W61A 4DX8H 3CD6S 2YX7A 3BP8A 2Q79A 1GQEA 4P10A 2JNJA 5FLXY 2VOOA 1SJQA 4GC6A 1BISA 1YITS 5HMZA 1EB0A 5M2UA 1OQ6A 3W63A 2V51B 4N7TA 1Q5VA 1IBMK 4IOCQ 1F2HA 1IR0A 5EUHA 1U02A 3ZEUB 1N34K 3US5A 3IRXB 5E0OA 3NKYA 4CJSA 4JRQA 1PCAA 1O0PA 1RWUA 4NLVA 2QM1A 2AEFA 4DFJA 3V4IA 1A0OB 3VAGA 2ZE2A 5CYQA 4JEPA 1RU1A 2G8UA 3FK4A 2OZMA 4JI4F 4BRNA 2ZJRQ 4A59A 2J5AA 4KI6A 3AGRA 1FI4A 3TR8A 3BDEA 3CD5A 5D78A 2DK2A 2LLZA 1VLOA 2DD8S 5GADU 1LW2B 2YPZA 2BTFA 1HLWA 3GWCA 2L3MA 2YWFA 3KK7A 1LV5A 1N54B 1YWXA 3G87A 2HZVA 2CQPA 4FJNA 2B4VA 4WIIA 1NDKA 3ZETA 2W9BB 1UEKA 2M5YA 5KPTA 4ZJLA 1DTTB 3F9MA 4CJKA 1EKRA 1RCOB 1UCNA 2ZH7A 1RBOB 3W2VA 3IFRA 2YJEA 1H7XA 5J1EA 1H72C 3VTIA 3ZFVA 3K2PA 4RUCA 4GKKK 1QSYA 1NNEA 3AAPA 1N0UA 1SUQB 3DDKA 2DPJA 2D3OR 2UUCJ 1N88A 2RS2A 1I94K 2JDJA 3VN5A 4JI6J 2LMIA 4NYPA 4AT1B 4HLBA 3G6EN 2P9NB 1UWBA 3KK1B 1IO2A 2OJ3A 1UVMA 2P5VA 4CNZA 5LOQA 3NEKA 4DLGA 2WFBA 3ITHB 2RT3A 3BGFA 4KJIA 1G2EA 4E1NA 1B9FA 4LF7K 1WC6A 4BVPA 2P9GA 2NUUG 1Y9OA 2LDYA 2NZTA 4BRGA 1S1TB 1IM6A 3CIMA 3UCZP 1ASWA 1AA1B 3FGVA 3THTA 2MKCA 3OVSA 4Y28C 3ZZRA 4C11B 4QIFA 2J6SA 1FJCA 3MN6A 4X65J 3NF6A 1JK9B 4W5TA 3OXGA 3QO9A 3AAQA 4HL9A 5FDLA 2ZKUA 3LQVA 2ASMA 1Q16B 4DTUA 3D2WA 4B9NA 4H03B 1RTHB 2Y0SD 3TOQA 3OY9A 3AFGA 3ZTRA 3TJ8A 4N41A 2LFVA 4A5AA 5F9LA 4JKAA 3T1YF 5TKYA 3SUNA 4DR3K 4WFNL 4EI2A 1CQNA 5KQ8A 1NGCA 3OFGA 4J2AA 3HF5A 1C0TA 5ETSA 2IAJA 1ELOA 3K89A 1RKJA 2FZCB 5A2QY 3UQSA 2BOAA 3FCVA 3I9ZA 2PYJA 2ZH1A 4GNIA 2QWPA 1TK0A 1RKIA 4ALZA 3C2PA 4JI1K 2XY8A 5F8IA 2WZ1A 3CC4N 3BSAA 2PSZA 1N36J 3N0VA 2P9IB 4KH4A 3H5SA 3SAHA 4GC7A 2CAJA 2BYCA 2DH7A 4CYUA 4IKFA 4OVLA 4K8RA 4F3OA 2HIQA 1KNZA 2LQ9A 3CDUA 2W8KA 3CJRA 3QT5A 5AJ3K 2XMVA 5LMUK 5ETVA 4DSLA 2XZDB 3UKRB 4CJVA 1HWJA 5CQGA 3PYEA 3QIOA 2QYGA 3SMSA 2IBKA 1VQKS 3TVZA 1D9FA 5EX5A 4HTJA 3WX4A 2DR7A 1SC1B 2UXDF 5D15A 1RHQB 1D0EA 4I7FA 5GAHU 4ZVPB 1MMLA 1IBLJ 3BREA 3CC7N 5F0XA 4JKEA 2NSBA 1KXPA 3LGHA 4DTRA 2VZ9A 1ZPVA 3OLBA 4XH1A 1F9HA 3VTHA 2VKZG 4OJRA 3A3OB 4C6AA 1FWKA 4OKJA 2EC2A 2IVYA 4LMZA 2Z1JA 4CZJA 4AHSA 3MR3A 3QAEA 5M2PA 2DY1A 4FXWA 4OV6A 2GC8A 5J1PA 3NP5A 3L4QA 1EQ0A 2DPNA 5DQHA 2HF4A 4HI2A 1X5OA 2UUAF 4KTWA 3A5OC 2NRZA 1KD1O 1J5EJ 3ZSYA 3E66A 3M2RB 5KAKA 3ONQA 2UZAA 2FJDB 5FROA 1CPZA 3G8TA 3PIPL 1VJQA 2MPUA 1CC7A 3RMBA 2DXEA 4DI6A 2VJVA 3OUYA 2VBXA 3E9LA 3MZIA 1FTRA 2ATQA 4IBNA 1X4DA 4KIAA 3D6MB 3IRWP 1YT3A 3HXMA 3NOGA 3CC2S 6FD1A 1ROFA 3AD7C 1C0FA 4ITSA 3RW7A 4GVBA 3A8EA 3ETMA 1J9AA 5IC6B 4CJ4A 5ADXH 3ILIA 4M3XA 3LUYA 2FVCA 1OVQA 1H74A 3PIOQ 3M8WA 3UWTA 2DGWA 4Y0FA 5AFUA 2P9EA 5CYMB 1ATRA 2O8DA 4G6VB 1EO1A 2XY6A 3POTA 5IM0B 1GLFO 1AB8A 1XNRK 3KUGA 4DUYJ 5EN1A 3OTOJ 4ZOSA 4BRDA 3KVGA 3EKSA 4G65A 3Q8PB 3PRVA 2UV8G 3W9JA 1Q7YO 2EFPA 2OI2A 3ZZYA 4ECVA 2CNNB 4PXCA 5AQKA 2F4VK 3AODA 4A8SA 4OZ3A 4G3IA 3EJMA 4LRDA 2E5LF 4TY9A 2VG6A 3VQ5A 4BWMA 4CIOA 2YBVA 3QIPA 1LWCB 4V1Ak 3CTRA 3CMQA 4IH5A 1FX2A 1I3AA 3RZAA 3MEDA 6AT1B 1KAYA 4LIWA 1MROA 4P73A 4FW2A 3PTWA 4WTOB 2ZJQQ 1TFWA 1WSFA 4LF8F 1N8RO 2F65A 1NUEA 1DRZA 2MY8A 3EZOA 3SCJE 3RB0A 2A0FB 2AP1A 4KC5A 4X4VA 3IC1A 4NXMF 2W2NP 2GO9A 1MU2B 4LFCK 3LDNA 3VGMA 5DDQC 4FXVA 4PUOA 2YHWA 3CMES 4MIBA 5T14A 3KD1E 1HPMA 4MAKA 4PPDA 1UPMB 2KM8B 4BC5A 4CJQA 3O8MA 1CJTA 5CE3A 4CH0S 3WEEA 3THVA 1KC8O 2DHHA 2HMPA 1XC9A 4H0XB 3CD0A 1FK9A 3MI7X 4C8KA 2UU9F 4MJKA 2GQQA 3DXSX 3ZT4A 2IJFA 1YZ6A 3TVKA 3GFXA 4K4VA 1L3SA 2IVOA 4TN2A 2VDIA 4WYBA 2QX0A 3CF5Q 1ZBIA 4CTAB 4PY5A 3VQ8A 2JWNA 2CZ9A 2R2RA 3GZ7A 4B3MK 2VPYB 2P6TA 4JYAJ 5LMNJ 3TQEA 3AVJA 2QWOA 3UE2A 3HVTA 2MQLA 2X6NA 5CABA 4H0PA 3SJJA 4CLYA 1LWEB 4H4OB 2GVDB 4WXWA 2OGUA 4O3OA 3NGDA 4DTPA 4LFBJ 1RI7A 1TAQA 4QYZK 3V81B 3I0RA 1N8RT 1TKXA 1C0UA 5AT1B 1A5WA 1NK6A 3H2LA 3C8YA 1LCUA 4IG3B 3THXB 1NK8A 3FR0A 2CWKA 2E1AA 1HWLA 3FZFA 4MDAA 3ULDA 3GG1A 1WG4A 3MECA 1K0TA 5AE1A 3TUJC 4CGIA 3R5AA 5HQLA 3BB5A 3CWJA 4BG8A 1IWAA 3O3HA 2Y1LB 3TW0A 2AF6A 2WSFC 3QEXA 2RDDA 4I9LA 2DGUA 1HYVA 3BN7A 4AL6A 1GH8A 4IH7A 1S0NA 1ITPA 2CH6A 3A5NC 1UPPA 2UUBJ 1GMUA 4I56A 1ZBFA 3HX9A 2UV8A 4DV6J 4E89A 4DQRA 1MN9A 1S0MA 4KHUA 1HWKA 4UF4A 3TEHB 2P8IA 2ZGZA 5CZ1A 4JI8F 4XDDA 3EKUA 5KFHA 1QAJA 2DGQA 1XERA 4RW6A 1HNXF 1QQOA 4NEZA 2BVZA 4B9LA 4M41A 4IJAA 4M5MA 4M5DA 3A8JA 2AJ0A 5JLFA 3MUMP 1VK3A 3FRZA 5D4NA 2H3EB 1VQ5S 1VLYA 3KZBA 3BGUA 3HPGA 4X4TA 2JC0A 2R8GA 3HBTA 4ZCKA 1VAZA 4A46A 2KQ2A 1VQNS 3ZSZA 1VQ9N 2G13A 4XIUA 3I31A 1OH7A 2WOMB 1GOAA 1HRHA 3G96A 2ZBCA 2VUGA 3VEZA 1Z25A 3RTVA 5F8GA 2E1ZA 2N82B 2GUPA 4CZEA 5DM6L 2KU7A 3S9HA 1EP4A 4HI1A 1IBKF 1S97A 3J81O 1YZ7A 4WP3A 3TEGA 5LXYA 5J2NB 4OX7A 3QWUA 1M1KO 3EMTA 3T69A 5KT5A 5AQIA 4OYPA 2X3GA 4JI3F 2L48A 3QGGA 4A5BA 1S6UA 3ENHA 2E6LA 2C3YA 2QFJA 3K0SA 1N34J 4L6V3 2MLZA 3AVIA 2P2CB 3O8WA 1VSFA 1WHYA 3OD2A 5EXWA 1H38A 2GO8A 1GXLA 1RB0A 4KGKA 5AQRA 4KREA 4PRFA 2Q0UA 2QT7A 3NF7A 3DI6B 2F63A 3O1WA 3VR1A 4FVUA 3NXZA 3O1LA 3DOLB 2DR6A 2OTJN 3FBBA 1VQPN 4ILLA 3OBYA 1HBOB 1RWVB 5KT4A 4JKGA 2QA4S 1D09B 5B8HA 3BPDA 3RRGA 3EM1A 3L2WA 2LCWA 2CG8A 4H5RA 4KFBA 1DARA 4TNOA 4CBXA 1M1HA 5G0RA 1XBWA 1HMVA 1Q86O 3ZZZA 2MSSA 2QA1A 2VF3A 2IDLA 1Q7LB 3CCEN 2MJNA 3E3XA 3QSYB 4OYBA 4QR0A 1B7FA 3KLHA 5HRRA 4CO2A 1HJRA 2OANA 3D9BA 4DBQA 1T6CA 2ASPA 4NYOA 4GKKJ 2Z1GA 3M1FA 4KHRA 2CGKA 3QJLA 1GLJO 1WC3A 1RISA 1I94J 1B3TA 2E29A 1CEZA 5BN9A 2EFQA 3OYFA 4OZ2A 1K0VA 1NOYA 5KT2A 1LW0A 2NR0A 2HYIB 3QINA 2YNIA 2YKOA 4J8FA 4NLCA 2LECA 2DCUB 3QETA 4LF7J 2CFXA 4W4MA 1UVKA 3NH2A 1NHVA 2YKMA 1X60A 3CGIA 2ZJPL 2F9JA 3LP1B 4CM2A 2YI1A 4Y2IA 5KFMA 4HCBA 1X4EA 4J9VA 4LBPA 1HR0K 3JTPA 1NGBA 5CY4A 3C15B 4AUKA 4O23A 3FZBA 1IG8A 1B0PA 2XS5A 4NYFA 1B4SA 2KJWA 1QUPA 3H98A 4KV8A 3CDWA 1I1GA 1U24A 2EVZA 2UUCF 4LY7A 4CFAA 5ETRA 2VG5B 4JI6F 2K7JA 3GIMA 1S0OA 2A5XA 5E2QA 5ITHA 5KFBA 2HNDA 4DR3J 4BDZA 3KG0A 2PAVA 5HRNA 1VISA 1MMNA 5H1SV 2Q6CA 4C0OC 3CD7A 2DNOA 2B9EA 2F40A 1C1CB 3HHLC 4BRIA 1UTAA 2C2NA 3FEXB 5A8KB 4JI1J 2XWYA 4TKTA 1REVA 4X65F 1DTQA 2KTQA 2P9SB 3BEGB 1WEZA 1R27B 4FJJA 4CFBA 4JV0A 3DM2B 2KN4A 1GXTA 2X78A 4ISGA 3TZXA 5AJ3J 5LMUJ 4P74A 2HS4A 4P6QA 3UE5A 5AQSA 3EE8A 4C8LA 4DHYA 3A3PB 1O5JA 4KHPK 5M2RA 3GCWP 4CH1A 2B9XA 3DLGB 3KD5E 2YKNA 5L46A 2XGQA 2Q0RA 4G1PA 1VK8A 2XYHB 3M2VA 4FDFA 3WQPA 5EY4A 1MMDA 4K4TA 4PZVA 4IOBA 2B7BB 2FLPA 4WWSA 1YJRA 1JLFB 3F41A 4D3GA 2ZKTA 3SQ2A 3J80Y 1JLQB 3VZHA 3P31A 4DN0A 2DNPA 3SBTA 2J6UA 4ED0A 2RD5C 5IV4A 2B4OA 5HI7A 3FVYA 2RN2A 4CJUA 1S1UA 1F2GA 1YJVA 3DU6A 3H1VX 1QAIA 1FXDA 4KBOA 1VQMS 3AOBA 2L9WA 3AA8A 3UN5A 5ETLA 1YI2N 1C4CA 3DC2A 1EWQA 4UQTA 3J7AP 1Q82O 1YVNA 2DKOB 2D9OA 4LR9A 4QOZB 3L7PA 1TR0A 4M3YA 2OD4A 1YBTA 2K8GA 3IM8A 3AHPA 2NRTA 3PRBA 4ES1A 1J6ZA 2MJUA 3TWZA 1S1WB 4A8FA 4AL5A 4LR7A 2HRYA 4U8VA 5C25B 3OTEA 1IBLF 3H5XA 1JKHA 3DLLL 5SZTA 3M8QA 4E7HA 1CC8A 1XR7A 4Y2KA 5IS2A 1NGHA 5SWMA 2R8IA 2CPYA 1NDPA 3LPUA 3MX5A 4OI6A 3JTNA 1XTZA 2M8DB 4BHQA 4RNMA 3ASMA 4RLEA 4FS2A 1WD6A 2QL5B 4KSEB 4OHZA 4KTZA 2WBRA 4OHXA 3I8BA 3J7Z5 1CSJA 5M1NA 2CJYB 1J5EF 3LP0B 3MXMA 3QRRA 1VBZA 2OPPB 3M8PB 1GK8A 2CVEA 3CCUS 5THWA 1XNRJ 4Q8FA 2E7WA 5HANA 3HFKA 1S76D 1AFJA 1WNSA 1U47A 4URGA 1QHAA 1RILA 2FB0A 1DLOA 4DTSA 2XMWA 5AQJA 4NLDA 1ASUA 4FJ5A 4DR5K 5EHHA 2ZH9A 5JVGL 2F4VJ 2E2OA 4ZLJA 3CD6N 1HNIA 1SI9A 3K59A 2QK9A 4WZMA 5AQUA 2OFHX 1CJVA 1U2VB 5AQFA 2ZBRA 1YITN 1VK0A 5E3QA 1OSCA 3NY0A 3S8SA 3AVBA 2ZH4A 1NH7A 3SSSA