4O44A

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 140
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o44A05
2B5JA 1NK8A 3V9ZA 4GC7A 3HP6A 1DTTA 4PQUA 1NNDA 2O4IA 1RTIA 1RBSA 3TI0A 3VN5A 2XI3A 4HUEA 3CM6A 2IA6A 1YT3A 2OPPB 4ZPBA 3DMJB 4EZ9A 3TAPA 4NCBA 4JS4A 3V9SA 2IOCA 3FQKA 2UVWA 4Y1CA 4NLXA 3ZSRA 3RMBA 1LW2B 5C25A 4JV0A 1S49A 3T5KA 4DLGA 2O5DA 3CFRA 1GOCA 2HWIA 4ZPAA 2OA8A 3IS9B 3E01A 1BI4B 3I0RA 1RNHA 3UPFA 1FK9B 4CK2A 4FCYA 2XHBA 3TAMA 4Q8FA 4FW2A 4W5OA 1RA6A 4J9QA 2DFHA 4RW8B 4NCAA 5DK5A 3RMCA 1KHWA 3M8QA 4CFDA 4B9SA 3M8PB 4I2PB 5DG9A 2IAJA 1S1UB 4R5PB 4DQRA 3KLGA 3DM2A 1C1CB 1C0TB 3QO9A 4Q43A 1Y97A 5KRTA 2VG6B 3RBEA 4YR0A 4K4VA 3ZSVA 3V1RA 1NJYA 4DFJA 4HCBA 4JRPA 4FZZA 4IG3A 3OYKA 4CF9A 5J2MB 5JXSA 1EP4A 4KHUA 4FBUA 4FJXA 5EDWA 4H4OA 3IGVA 4TY9A 2F8SA 2YKMA 1XWLA 1ZBFA 4YR2A 4PWDB 4HUGA 3CJ5A 2KFZA 4AILC 4F4YA 1U48A 3V9UA 1RT3A 4J9KA 3TAFA 4OGCA 3AVIA 4H8KA 2B6AA 2W9BB 1TVRB 4Q8EA 3KLFA 3ZSWA 4B3OB 1RT5A 4QW8A 1TKDA 4QWBA 3AVAA 3N6MA 5K14A 2IJNA 4EBEA 2HNYA 2D41A 1JLBA 1IKYA 5KFLA 2YHBA 3LZIA 2OPSB 3WNHA 4BDYA 3MR6A 2ASLA 4OKJA 4FM2A 3IN5A 2R8IA 4U6PA 3QIDA 4IH7A 3G6YA 1C0UA 3DRRA 3V4IA 3NAIA 3QINA 3KLEA 1WSHA 2F8EX 2NUBA 3PO4A 2X78A 1S0OA 1BIZA 1JX4A 5KFTA 1RT1B 4RW4A 3OJSA 4TY8A 3L2RA 2HHVA 2VA2A 1WAFA 3DYAA 1IO2A 2C22A 3NE6A 4DSEA 1KCFA 4LY7A 1VRTA 4DL5A 5HROB 1KFSA 4ED6A 1R0AA 3QERA 4BWMA 4I2QA 1EETA 2RF2A 4DTJA 4KFBA 4Q0BA 2CKWA 1RILA 5KG6A 1T8EA 3ITHA 4DTRA 1D8YA 3ZT1A 3GIIA 3AV9A 4NLYA 2HHTA 1N4LA 3BGRB 2HVHA 3KTQA 3HVTA 3LP2B 3L8BA 1RT4B 3IRXB 2JC1A 1DLOB 5KFSA 2Z1GA 1N48A 4M3TA 4FS1A 4MFBA 4KE5A 1VSHA 2FBYA 3H2LA 3SI8A 2FLLA 5HBMA 4KKOB 1JLGB 4RU9A 4CJQA 4IH5A 1TK0A 4ECVA 2BANB 3PJXA 3AA2A 2HVIA 4CEFA 4RW7A 5C24A 2QXFA 3RR8A 4KSEB 1RTJA 4ZVGA 2UUWA 3HPHA 4CEBA 1QE1B 4RNOA 3QYYA 3MFHA 2YKNB 3TQ1A 4Y1DA 2YNGB 3M8SA 3ALYA 3AO5A 2ILZA 3SV3A 1U09A 3WNFA 2P1JA 2D3ZA 1IKXB 3MEEA 1KTQA 2KW4A 3THVA 4ICLA 1TQLA 2X6NA 4O55A 4ZTFA 4AHRA 3MEDB 2HNZB 3D28A 1YVUA 2D0AA 1D9FA 4CFAA 4J9NA 1ZBHA 4KTZA 4AH9A 1TKZA 2G8KA 1JLQB 4I7FB 4CJSA 1BHLA 3F9KA 2EC0A 2GUIA 3SUQA 1JLAB 2JEIA 3CYMA 4F4ZA 1HNIA 4JLHA 4NZ0A 4NLUA 4NRTA 2IMWP 3PX6A 1EX4A 2D0CA 3NGZA 2AU0A 3FFIA 2D3UA 2DPJA 2HB5A 3O3HA 1UAXA 4ED3A 1HQEA 4XPEA 4E7KA 1TL3B 1BQMB 5CYMB 4FJ8A 4NLSA 5L1LA 2YNFB 2DFEA 2C2DA 4TQSA 3KLIB 4DQSA 3BQ2A 4WYLA 2FJWA 4CJ4A 4CJ3A 4FJLA 2V9WA 1IKWA 4R0EA 3JSMB 3MR5A 3M8PA 1WAJA 4IRKA 3RMDA 2GIQA 3HHKA 1U49A 1RBRA 2Z1JA 1C1CA 4F3TA 4LH5A 3ZSZA 3K5MA 4J9SA 1U04A 4B08A 1RT7A 4KV8A 2J6UA 1ZYQA 2VG6A 1WNSA 3RB3A 2JEFA 1WLJA 1LW0B 4TYBA 1FXXA 1HJRA 4I9QA 1JL2A 3CWJA 1ITGA 4H4MB 4O0IA 5KFKA 1LWFB 1Z4UA 4B9NA 2BQ3A 5KT6A 3I0SA 3L2UA 4IR9A 3CM5A 1S4FA 1S9FA 3F73A 3OL9A 1J9AA 4CGJA 1NOZA 3MEGB 3AVGA 1LWCA 4E3SA 5L1JA 3U3GA 2HHQA 3U6FA 2HHWA 3PUFA 4LQ9A 3PW2A 1S0MA 4WE1B 5J1EB 2FBXA 2W9BA 1TVRA 4CF0A 4KHWA 3CJ3A 3NF9A 3LALA 4OPJA 3KKRA 1L3TA 4DL2A 4WZMA 3CO9A 3U3YA 2XWYA 3CFOA 1RDBA 3RBDA 2J6TA 1WSFA 4FJIA 4PY5A 2XY7A 3Q8SB 3I5AA 5L1KA 3MXJA 1O1WA 4RNMA 3AVMA 1NJXA 4I9LA 4ZHRB 4KAZA 4EEYA 4OJRA 3CDWA 3KK1A 1S1VB 3QGGA 4HUFA 2KTQA 2I5JA 3NAHA 1Q9XA 3BSOA 1TL1A 1HRHA 2FVRA 3DI6B 3SFUA 2IBKA 1RBVA 2E4LA 4FJGA 3RTVA 3H5YA 3M8RA 4K4ZA 3C6TB 4FLYA 2X74A 3RB4A 1X1PA 4MK8A 2WTFA 4CECA 1QSLA 3EY1A 4Z4FA 2IGIA 4CJKA 5KFVA 5JS2A 2B4JA 3DLEB 1W0HA 4BWJA 4DTOA 3QLHB 3LP1B 3HP9A 1BISA 1RTDA 4FBTA 4FZXC 3AA5X 1EKEA 4B9UA 1TAUA 3KJVB 2ZKUA 4Z4CA 3VQEA 3QNNA 1JLFB 4N76A 1RBTA 3VA0A 1S9EB 2BE2B 3K57A 2P51A 1D5AA 1WNEA 1KLMA 1D9DA 3IRXA 3L2WA 4ZPCA 4OPKA 3FDSA 1DLOA 4GVMA 5KFDA 5KFPA 1KSPA 1UA1A 5KFBA 4PUOB 4E19A 2IC3B 4FLWA 3ZT4A 3LAKA 4N5SA 4DWIA 3QZ8A 3LP0B 4WFYA 3CJ2A 2IS3A 4DSFA 2V4QA 2O4GA 2VG5B 4ZVEA 4KREA 4IFVB 3UQSA 1ZBIA 3VQBA 1C1BB 2XGPA 3DRPA 3GYNA 3G86A 3G10A 5F9NA 1N56A 1F21A 1B9DA 3OSPA 3V9XA 4DF4A 4FLUA 4DF8A 4NCGB 4DG1A 1GX5A 5L9XA 1VSDA 4CGIA 1S1XA 3PW4A 4Q5VA 5J2NA 1LWEA 3MAQA 4E0DA 5F8MA 3B6PA 1IKXA 4F4WA 1ASVA 3CDEA 1TV6B 4K4UA 3BSNA 2C2RA 1RCHA 4YQWA 2Z1HA 4CJUA 1JL1A 4ZMMA 3MEDA 5HLFA 1C1AA 4KRFA 2OPQA 1NKBA 3DLGB 1RAJA 1HQUA 4DFPA 3L2QA 1K1SA 3OLAA 1JLQA 4DLEA 3MF5A 5DG7A 2R8GA 3NH0A 2DFFA 5KFZA 4IFYA 3OYCA 3KLHB 1HNVA 3SZ2A 3NBPB 4EZ6A 1JLCA 3TABA 1W25A 4OLBA 2XRIA 1XR7A 1SH0A 2WK4A 4E7JA 2IM1A 4URGA 2VWKA 3DLKB 1BIUA 1SKWA 3T5JA 1DTQA 1FKPA 1TL3A 1BQMA 4R8UA 1QSYA 3V6KA 3AA4A 1X9WA 4ZP7A 3VQAA 1WSJA 4HYKA 4L8RB 1S1TA 2HNDB 1UWBB 4ECXA 2OYQA 3ZT3A 1T05B 4QWDA 1SV5A 5F8HA 4QWAA 1VSFA 5KGXA 2UVRA 3CJ4A 2V0NA 5I3UB 1FKOB 4IDKB 3ZSYA 2E6MA 3V6DA 1CSJA 4ELTA 2EHGA 5CZ2A 3K59A 4J9RA 2VG7B 5SWMA 4J2DA 4DTSA 4FLZA 2G8UA 4AHVA 3SUPA 2R2RA 4CK1A 1TKTB 4EYHB 2KZMA 1HMVB 1MU2B 4BE2A 4NLRA 3S9HA 4Z4GA 5KFJA 1SUQB 1TKXB 4KB7A 2DY4A 3HPOA 2YNHB 3AVFA 4NLQA 2D7SA 4K8XA 3QNOA 3OY9A 1JLEA 4JV2A 1ZTWA 3PJWA 4OKEA 3IAYA 2E6LA 2FLNA 4EP4A 4KI6A 5D3GB 4CGDA 3DLHA 3QIOA 2Q3SA 3VQ8A 3TVKA 5FRMA 2EX3A 2Y1JA 3PV8A 2BQUA 4FW1A 2OZMA 1A5WA 2X6SA 3WNEA 4CF1A 3K5OA 4OL8A 5KRSA 4F4XA 3NDKA 1VSJA 3I8DA 3KHLA 4W5TA 4ZTJA 4M3ZA 2W9AA 3G0ZA 4LSNA 1GX6A 1BQNB 1YTUA 4CJRA 2G8IA 4ED8A 2KQ2A 1S1VA 4CFBA 3UDLA 4QCLA 1VRUA 2BRLA 3AVLA 4CEDA 3HVAA 4EBCA 2ATQA 3RAXA 1HYVA 3H40A 1S6PA 3BQ0A 4RNHA 3DOKA 1HYSA 5SZTA 2XY5A 1S6QA 5J2QB 4N41A 4CGHA 1SH3A 4ZP6A 3GV8B 4FZYA 1SH2A 3O4NA 1QUVA 3EPGA 1L3UA 1JKHB 1RA7A 4M42A 1IKVB 1KVCA 5FRNA 3KD1E 4MKAA 3HXMA 2RDJA 1REVB 3SV4A 4Z4HA 1TK5A 2WOMA 4XPCA 5DQGA 3NH2A 4FK4A 4NLPA 2A1RA 4B9LA 2BE2A 5FDLB 4FJJA 3OS2A 2HHUA 1J53A 1L5UA 5F8GA 4DFKA 3GV7B 2W9CB 1D1UA 1GOAA 4IG0A 3K58A 4CIFA 1D0EA 1G15A 4DSIA 1S1WB 4FK0A 2W42A 4H54A 1A5XA 5KFRA 3N6LA 1ZBUA 4BE0A 4O4GB 4CJPA 3CFPA 4O3QA 3PW5A 2XCPA 5KFOA 3NGYA 3VA3A 4ECUA 4B8AB 1N5YA 3BSAA 5J2PB 4ECRA 3MECB 4RG8A 4AHTA 2Z1IA 1TV6A 4DL3A 2W8LA 1QAIA 4ZVHA 3H5UA 1RDDA 3RMAA 5KT3A 4ZP8A 4WXWA 3DRSB 3OYMA 4JUZA 2QE5A 4ED1A 3ISNC 5I42A 1VSKA 4CESA 3QGIA 4CIGA 2IM0A 4LSLB 3AA3A 1J5OB 4DL7A 4CEOA 1NK9A 4M3UA 3NGDA 3K5NA 5KFUA 1NJZA 1RTHB 3DLKA 4KHMA 4WXOA 4K4SA 4O5BA 4W5NA 1RYSA 1B92A 1NK7A 4WZQA 4G1QB 1NK5A 4CF8A 3DDKA 4DSJA 4M94A 4J9OA 1WSIA 4RW6B 3MTKA 2W7PA 2HNDA 3EZUA 4EP5A 1RT6B 3IGNA 1XI1A 4MQ3A 3SNNA 4IKAA 4O3NA 2HAIA 1N6QB 2RN2A 3VQQA 3AVHA 1T7PA 2WONB 1RT2B 1X9SA 2OPPA 2IJFA 2BRKA 4Y2CA 3DMJA 4LD0A 4RNNA 4CJTA 4IRDA 3DLBA 3QZ7A 2VA3A 1XHXA 1LW2A 2G8HA 3VQ7A 3C6UB 1MU2A 4K4TA 2HMIB 2AGQA 2WHOA 4FM1A 2AX1A 3IS9A 1BI4A 3EYZA 1HYZA 4CJVA 3NCIA 5KG1A 4ID5B 3LP3A 3AVCA 2YNHA 3D45A 1FK9A 4CHYA 4AHSA 5HP1B 3BSCA 4TSXA 4RW8A 1SL1A 1KFDA 3OYAA 1YVFA 2B43A 3QIPB 1C0MA 3H59A 4I2PA 2BR0A 3OYEA 2YHAA 5KFEA 5DQIA 1S1UA 4R5PA 1C0TA 1TP7A 1VSIA 1BCOA 4NYZA 1DTTB 3SFGA 3V1QA 4PQUB 3VQPA 1CXUA 3AO4A 3SQ2A 3V6JA 1RTIB 4U7CA 4J9PA 4ECWA 5EWGA 1SL0A 2XI2A 2XGQA 4CF2A 2C2EA 5J2MA 2G8WA 4ECZA 1IM4A 4MK9A 1NOYA 4K4YA 3KD5E 4QOZB 3SUNA 3CDUA 1L3VA 3O4QA 3UIQA 5JS1A 1BQNA 4CCHA 4PWDA 4MIAA 5DMRA 1IG9A 4DQPA 1I3AA 4FJ5A 3V6HA 5C25B 1BL3A 1XR6A 4FLXA 1U47A 4DS4A 2BQRA 2BGGA 3VQ9A 1ZBLA 3D5MA 3N6NA 3ZT2A 4IOBA 5KFAA 4B3OA 3TAGA 3BR9A 5KFWA 4MIBA 2D0BA 4WYWA 3OYJA 3PW7A 4MK7A 3M9OB 5CYQB 1ZTTA 2IAJB 2XC9A 2OPSA 4URQU 1JKHA 3FQLA 1IKVA 3RRGA 4J2AA 3QO9B 1S48A 3PX0A 2FJXA 3WNGA 4MH8A 4HHTA 5DGBA 4QWCA 5FDLA 4KO0B 5KG0A 3OS1A 4ECSA 1KVAA 3OYDA 5KFGA 4GC6A 4DQQA 1EP4B 3NF6A 4CJWA 3LPUA 1RT1A 3HVRA 4H4OB 3ZT0A 4DTXA 3H4DA 4CK3A 2YKMB 2IM2A 4J9LA 4F2SA 2FC0A 3OYLA 2P5GA 1NK0A 3SUOA 4W5QA 3C94A 3MR2A 5HROA 3O3FA 1NJWA 2UVVA 1WSEA 3PHEA 3M9MB 3OS0A 1RT3B 4E89A 1QQCA 1CLQA 3NAEA 4OVLA 5F8JA 2B6AB 3H5SA 3SPZA 3SQ4A 1K6YA 4FXDA 3ISND 1CZBA 2YV0X 3V9WA 2DTUA 1RT5B 2HWHA 5KFHA 5J2PA 3QEVA 3KNAA 3H5XA 1B9FA 3PO5A 2HNYB 5F9LA 2KFNA 3BGRA 1IKYB 3MECA 3LP2A 1C2PA 3HJFA 3OLBA 1RT4A 4CGFA 1JXBA 5EWEA 4Y3CA 4TQRA 4F4KA 4DL6A 1C0UB 1IH7A 5JUMA 3V4IB 2RDIA 1JXLA 4CEZA 2VWJA 4O3SA 3DRSA 4XO0A 3MFIA 3KLEB 1TAQA 4KKOA 1JLGA 2G8VA 3BQ1A 4FLTA 2BANA 4M45A 2ILYA 1XHZA 3DYAB 4Y2AA 1SKSA 4TLRA 4QPXA 4NLVA 3TAEA 1RTHA 1VRTB 3KK2B 4RZRA 3L3VA 1QE1A 2YKNA 4FK2A 1R0AB 2R7YA 2AWZA 3Q8RB 2YNGA 4CHPA 1EETB 2YNIB 2RF2B 2JEGA 4KFBB 5C42B 4F3OA 4Q0BB 4CEQA 3KHHA 3ICLA 4KAIA 4DMNA 2R8JA 3ITHB 4FJ7A 2R8KA 4M41A 2JGUA 2HNZA 4AHUA 4HKQA 1NHUA 1WSGA 4KHQA 3OL6A 1RYRA 2FVPA 4BDPA 2P5OA 4I7FA 3CVKA 3NL0A 3PR5B 1S10A 2W7OA 1JLAA 3T5HA 3KIOA 3KK3B 3ULDA 2ZE2B 3KLVA 4MFBB 3OJUA 1MMLA 2HW3A 3SI6A 5HBMB 4DEZA 5CYMA 5KT5A 3GV5B 3ZSXA 2YNFA 5KG4A 4RW7B 5C24B 3KLIA 1RTJB 3RR7A 4CJFA 4B8CA 1UOCA 3S3NA 1NHVA 3LAMA 4J2EA 3ZSOA 3FSIA 4QW9A 3JSMA 4YR3A 5L1IA 4YNQA 4FJ9A 3QIPA 2KZZA 1Z25A 1CZ9A 3MEEB 3CQ8A 1ZETA 3NMAA 4M3XA 4ICLB 2QV6A 4FJKA 3B6OA 2V4RA 3HL8A 4UQGA 4URSA 3RAQA 4HVJA 1LW0A 5EU7A 4M3WA 4FLVA 1TKZB 4H4MA 3O3GA 1L3SA 1LWFA 3ZCMA 3A2FA 1S5JA 3KHGA 4GMJB 2QKBA 3H4BA 2GBZA 3QEXA 1TGOA 1HNIB 3HK2A 4N56A 4Z4IA 3FFIB 3MEGA 1VSEA 3VQCA 2ZD1B 4ZPDA 1HQEB 4CHNA 4W5RA 4C8OA 4C8LA 2WRMA 5DLFA 5DQHA 4NLGA 4FYDA 1VK0A 4WE1A 5J1EA 2AQ4A 3SQ0A 3LWLA 3LDSA 1YTAA 1T3NA 5CZ1A 4IQXA 4B9VA 4ELVA 4RW9B 3K2PA 3DOLB 1QHTA 4DS5A 4KPYA 1IKWB 4E7LA 1KRPA 5CYQA 3PY8A 1S0NA 3KMQA 1RT7B 4KV8B 4ZHRA 3EZ5A 1LV5A 1BGXT 2ITGA 4C8KA 4KO0A 2OH2A 4O0JA 3S3OA 5KG3A 4RUCA 2XCAA 4E7HA 3DI6A 3I0SB 4JRQA 3E51A 5KFFA 4PA1A 3OYFA 2OPRB 1SL2A 3C6TA 3H98A 3IG1B 4NLWA 1LWCB 4ZP9A 1S97A 2ZQBA 3DLEA 2FBVA 4XIUA 2IM3A 3QLHA 3LP1A 5F8IA 2Y1IA 4DTUA 3AVNA 2GV9A 3KJVA 3AO3A 3CIZA 3PZPA 2R2UA 1JLFA 3EPIA 4DTNA 3SJJA 3BREA 2HHSA 4DFMA 3LANA 1S9EA 4CGGA 2E9RX 3ASMA 3AO1A 3TWHA 4O44B 4C8MA 5KG5A 4CJ5A 4ZVFA 4CE9A 4CIEA 4X2BA 4PUOA 2IC3A 2FVCA 3KK1B 1S9GB 3P83D 2W8KA 3LP0A 2I1RA 2I5JB 5EWFA 3PVXA 1TL1B 2VG5A 3T19A 4IFVA 2UUTA 4DTMA 4K4WA 2BDPA 5T7BA 1C1BA 4O3PA 2FVSA 1NKEA 3T5LA 3QESA 4KBIA 3KK2A 3MXMA 3GQCA 3GILA 4NCGA 5KGWA 5KG7A 4FVMA 2YNIA 3HPGA 2AJQA 3KHRA 5C42A 1T03B 1RTDB 3SCXA 5E41A 2GIRA 5KFIA 3HSTB 3L2VA 4OGEA 3CJ0A 5KFXA 3DLGA 4O4RA 3Q8PB 4ED7A 3SPYA 3RRHA 1EXQA 3I5BA 2AGPA 5KFQA 1KLMB 4DQIA 4M95A 3KLHA 3NBPA 4ID1A 3KK3A 4KB1A 2QKKA 2ZE2A 3M9NB 4CJEA 1QSSA 3OHAA 4ECTA 2GC8A 3T3FA 3QETA 1Q9YA 2RKIB 3OYBA 3MR3A 3UR0A 4QAGA 2ALZA 1KLNA 4TXSA 4BACA 2PZSA 3DRPB 4ELUA 3I5CA 4CFCA 1UWBA 1I39A 3TAQA 5C5JA 3VQ5A 1T05A 4DG1B 4Y34A 1QS4A 4M3RA 2PYJA 4NLDA 1S1XB 5KT7A 5J2NB 1LWEB 2AX0A 5KFMA 3OHBA 1X9MA 5I3UA 4NYNA 3T1AA 1FKOA 3D0PA 4IDKA 4KTQA 4ECQA 1QAJA 5HLFB 1RDCA 4G3IA 2OPQB 2VG7A 3LZJA 3RWUA 2D5RA 3BDPA 1NK6A 5KFCA 1HQUB 1NKCA 3V81B 4C8NA 5DGAA 1TKTA 2PYLA 1HMVA 4IKFA 4TN2A 1HPZB 1QTMA 1ASUA 4IFYB 1HNVB 1SUQA 1TKXA 4OKKA 1JLCB 2JLEA 3OL7A 3FRZA 3JYTB 2ZD1A 4LQ3A 1DTQB 1FKPB 2FVQA 3HT3A 3QEWA 4J2BA 3L3UA 4R8UB 2ASDA 5T14A 3SYZA 3VQSA 5KT4A 1S1TB 2B5JB 3PR4A 1Q8IA 4YMEA 4KHRA 2E9TA 5D3GA 4IRCA 1WN7A 4QWEA 1I6JA 3OYHA 1J54A 3TANA 4RW9A 3DOLA 4BE1A 4YFUA 3S3MA 1SV5B 2DPIA 4Q44A 3GIJA 4DTPA 3VQ6A 4NLTA 1OS5A 1TK8A 2XY8A 1LAVA 4DU1A 2ASJA 4JV1A 1XC9A 3RB0A 3V6DB 1JXEA 4EO8A 2FBTA 3KMSA 1KVBA 4DSKA 5KT2A 1Z26A 5KFNA 2R8HA 3K5LA 4HTUA 2OZSA 4K8ZA 4NRUA 3GIMA 3QGHA 3E01B 2OPRA 4ED2A 3NKYA 2UVUA 3I0RB 4CERA 1U4BA 3OVNA 4JS5A 4O3RA 3IG1A 3TAMB 4CJLA 1JLEB 4NLOA 2CJQA 1RBUA 2FLPA 5J2QA 3OSNA 3M8QB 1K1QA 2G8FA 2PY5A 1KHVA 5CY4A 3NH1A 3SQ1A 3GIKA 3KLGB 4EO6A 5DG8A 3RB6A 3DM2B 1REVA 2C28A 5KFYA 5F8LA 5HRNA 1VSMA 1NK4A 3H08A 4KB0A 4IG3B 5F8NA 2ATLA 4FS2A 2W9CA 4K4XA 4O44A 2IDOA 4KHNA 4AHCA 3OYNA 3KKSA 4LSNB 3CG7A 1S1WA 1XR5A 3KOAA 3ZSQA 3TARA 1S9GA 3NFAA 1VRUB 4O4GA 4DU3A 4Z0UA 2QK9A 3KLFB 1S6PB 3DOKB 1HYSB 1GOBA 5K14B 5DLGA 4BDZA 4B9TA 2J6SA 1S6QB 3HO1A 1JIHA 2XO7A 1JLBB 2ETJA 4KHYA 5HRPA 1BCMA 5KI6A 4WFXA 3HVWA 4IH6A 1T03A 4KI4A 4E7IA 1CXQA 4HCCA 3OYGA 3C95A 4N47A 2R2TA 2WOMB 4DL4A 3DRRB 2RPIA 3HM9A 4FJHA 4NYFA 3Q8QB 5EUHA 1SKRA 1A5VA 4LSLA 1J5OA 4GW6A 4RW4B 4TY8B 4IG0B 4EBDA 4K50A 5FROA 1HARA 3G6VA 2AGOA 4IR1A 2JEJA 3HYFA 4Q45A 3P1GA 1U45A 4O3OA 4FM0A 2RKIA 3QEIA 4G1QA 1LAWA 4I2QB 2HHXA 3QEPA 4RW6A 3V1OA 3AVBA 2JC0A 3PX4A 3OL8A 4E1MA 1N5YB 3P5JA 4F2RA 1T94A 4Z4EA 4CHQA 3AVJA 5HRRA 1RT6A 1ASWA 3LWMA 4EYIB 4B9MA 3NHGA 4CEAA 3PW0A 2WB4A 1UA0A 4DSLA 1N6QA 4IBNA 3HVTB 4CHZA 2LSNA 4FJMA 4DU4A 4FJNA 3VQ4A 2WONA 1RT2A 2WCXA 3VQDA 5KTQA 3OYIA 2E9ZA 1RDRA 2R2SA 4F8RA 3TR8A 5KG2A 1RDAA 1W9HA 3AVKA 4WFZA 3G6XA 5HRSA 4CEEA 2F96A 4CHOA 4OLAA 3V81A 5I42B 4ECYA 3C6UA 2F8TA 1HPZA 4MKBA 2HMIA 1C6VA 3DLRA 4M3YA 3MXIA 4F50A 4LH4A 3HKWA 4RUAA 4ID5A 4KHSA 4YP3A 3BJYA 4KTWA 4ED0A 4J9MA 3JYTA 4TYAA 5HP1A 3AO2A 2XY6A 2A1SA 3NGIA 4RNFA 3LPTA 3NF8A 2FJVA 1VSLA 4E1NA 3NF7A
chains in the Genus database with same CATH superfamily
3IAS9 1NK8A 5IS2A 4PQUA 1BG3A 3PSFA 4LREA 4U8YA 2FZKB 2ZDOA 4HI1A 1Y9OA 4OZ2A 2BXJA 2LVWA 2DITA 5AZIA 4OYXA 1TUUA 4WYBA 5IC4B 2CFXA 4ATNA 3W9HA 1R27B 3G8SA 4ZPBA 4GKJF 3MDFA 4DR3K 3MM5B 4NCBA 3R1XA 4JS4A 4DV2F 2MKCA 3V9SA 2R7RA 1UZHA 5CD4A 5AFUA 4Y1CA 3RMBA 5C25A 4A59A 3T5KA 4KPCA 7AT1B 3AJ2A 1GOCA 3D0HE 4ZJOA 2HWIA 3IS9B 3E01A 5ETKA 2FXUA 3EWGA 1GXTA 2MTLA 1RNHA 4ENOA 3UPFA 4CK2A 3O9TA 4OHWA 4W5OA 1SQEA 3RMCA 3BBCA 1N34K 3I8BA 4DCOB 4F67A 1RAAB 2IAJA 1S1UB 4R5PB 3GSDA 4DQRA 3DM2A 1C1CB 2HRUA 4OLOA 2CJKA 2VG6B 3E9LA 3KUEA 4DFJA 4IFEA 4PKHA 4BROA 1BWFO 1B0VA 1FERA 5EDWA 4H4OA 3DHWC 2YKMA 4ISGA 4YR2A 5F0UA 1V5VA 4AILC 4F4YA 1U48A 4CLKA 4LF9F 4ITSA 1NSKL 4OGCA 4H8KA 1F5BA 5AT1B 3IO1A 4Q8EA 3CC4S 4X4OA 4GMKA 4QW8A 2Y3YA 1AUDA 5K14A 2IJNA 1YJUA 2CJXB 5LMNJ 3SMSA 2D41A 1JLBA 1BE4A 4HACB 3AD7C 3LZIA 4NASA 3ZXWA 3D2EA 4BDYA 2F63A 3B4DA 2F7TA 2O8CB 1WACA 2R8IA 3M6VA 4IH7A 1C0UA 4TU7A 1JJCB 3NAIA 3GZ7A 2C2MB 4JI3K 3TEGA 2FHOB 3PO4A 3AD8C 1S0OA 1JX4A 1VISA 1RT1B 2W41A 4A47A 1HNXJ 2VA2A 4DSEA 2ASPA 2M4MA 2MZTA 4DR7F 3NGUA 4ZN3A 2QFIA 3OR1A 3O5BA 2FUG9 2Z56B 1X8DA 1U0HB 2PT0A 2YHWA 4BWMA 3R2CJ 1EETA 5LMUK 1H2TZ 1U2VB 4KFBA 4Q0BA 2MQQA 3DC2A 2GFFA 1RILA 4JKHA 1F9FA 2FC8A 3G9CA 3MMAA 1Y5IB 2U1AA 1D8YA 2HHTA 4AF1A 3KG4A 1Q82O 5ETLA 5D6GA 3OVSA 3HZEA 4JI1J 3I32A 1ICEB 3E2EA 1VSHA 3IBWA 3SI8A 3HSCA 4KKOB 3PM9A 4IH5A 4ECVA 2AJ2A 4IZ9A 4CEFA 4BRDA 5C24A 3RR8A 3Q83A 2WVDA 1TL5A 4BRMA 3GU0A 3UE5A 4J91A 2OEJA 3QYYA 3MFHA 5CZXA 4Y1DA 2P9LB 2AJ1A 2CNOB 3SV3A 3AO5A 1U09A 3U02A 1D9AA 3WNFA 2P1JA 1RXOB 3AA9A 3W5ZA 1IKXB 2ASYA 1K9MO 2CPXA 4DPXA 3ZYYX 4O55A 3MEDB 1YVUA 4CFAA 3O08A 1HWJA 2H4YB 3BF4A 4ZPWR 4KTZA 1P8ZA 4I7FB 4CJSA 3ULHA 2EC0A 1TMMA 3SUQA 1HNIA 2A6OA 2PC6A 3D7SB 2IMWP 2MZJA 3FFIA 2D3UA 3W66A 2HQGA 2DPJA 3O3HA 4XPEA 2GZOA 3IDHA 5K5MA 2V8DA 1RHRB 1PG5B 5CYMB 5IV4A 1TUGB 2ALYB 1BDGA 3FCWA 1KKHA 2C2DA 4TQSA 1YAGA 2IBOA 3KNGA 2YTCA 3MD3A 3CJKA 4WYLA 3PTWA 4M63A 2H48B 4EWTA 5CCLA 5A6WA 1RHKB 4DHVA 3MR5A 4PXCA 2KHOA 3THXA 1B64A 2UV8G 4IRKA 2R7VA 1RBRA 2Z1JA 4XTTA 4F3TA 2E66A 3K5MA 4J9SA 1ESVA 3PFOA 1RT7A 2L3MA 3BBBA 3BN4A 1VK3A 3HHLA 4LF5K 4TYBA 3HM8A 5HMYA 3CWJA 2UXBF 4O0IA 4UY8O 4C3LA 4B9NA 5KT6A 1MSWD 1S4FA 3MUTP 3VERA 3BKTA 4DUTA 2E29A 2XM3A 3F73A 3OL9A 1NOZA 4KGXB 3AVGA 3Q24A 5L1JA 2D74B 3TOQA 1KD1T 5AQHA 3ULEA 5EGYA 4NWBA 2ZZNA 1W2BM 4LQ9A 3PW2A 3VGTA 2KVIA 3LGNA 2Y8WA 5J1EB 1X7VA 2X1FA 3KKRA 1L3TA 1CS4B 3QAUA 2FHJA 1U6BA 4WP8A 2OO4A 4WU3A 2ZM6F 2I2YA 4AQYJ 1VYAA 2OFGX 4FJIA 3U1LA 1O51A 3I5AA 5L1KA 3CULA 3M7VA 4FP9A 5IT9U 4FKXA 4EEYA 4OJRA 5IT4A 1S1VB 4HUFA 2J76E 2FZGB 2LA6A 3NAHA 1TL1A 4BRKA 1UVJA 1RP5A 3SFUA 3RTVA 3H5YA 4A8FA 1GLEG 3RB4A 1X1PA 2C2OB 3EGNA 3J7AP 4WK1A 3EY1A 1HL6A 3OA9A 2DH8A 2E5HA 5LT5A 1O5JA 2DNYA 3WIVA 3FVYA 4LF4F 1E3MA 3LOUA 3QLHB 3LP1B 1BISA 3KJVB 1FTRA 1LWXA 1FX2A 1YHQN 1WHVA 5HMXA 2BE2B 1N0VC 1WNEA 2F9WA 2VJVA 1KLMA 3IRXA 5AQWA 1EARA 4GVMA 4JEPA 4FWMA 4WK3A 1UA1A 1Q8LA 4E19A 3JTOA 4FLWA 3ONQA 3LAKA 4N5SA 4DWIA 3AOCA 3QZ8A 3T69A 5DDOC 4WFYA 3CJ2A 4DSFA 2IS3A 2ZVIA 2DR9A 3L3CA 3CUNA 4IFVB 3VQBA 1C1BB 2DHSA 1N32K 3MCMA 3P96A 5F9NA 3RSEA 3LF0A 3V9XA 2CGLA 2QG9B 2BE7D 4FLUA 2AP1A 4NCGB 3ILIA 1S59A 1S1XA 2K7KA 5CAAA 2V4JB 1ZM9A 3FNNA 3V5RA 3UN2A 1EKSA 1VAZA 4F4WA 3CDEA 5CD4H 5AFUH 1TV6B 2P9KA 2A3JA 1RCHA 4CJUA 4RWWA 1C1AA 1ZA2B 4YOTA 2OPQA 3DLGB 1PCAA 1HQUA 3ETOA 3CXCR 2K3IA 5BN8A 3FEXB 1HNVA 3TABA 1HUXA 4X4TA 3G8QA 4E7JA 2IM1A 1YJNS 2VWKA 1SKWA 4MO5A 2BW2A 4JNEA 3MMCA 1NO8A 4R8UA 4CO5A 1QVGR 1X9WA 4ZP7A 3VQAA 3QWUA 3FBCA 4HYKA 1S1TA 2HNDB 5FD1A 1HBUB 1ELOA 2OYQA 2CDQA 2ROEA 5AQGA 3WQPA 1SV5A 3OVBA 1YRTA 1RHQB 2UVRA 3CJ4A 4GO5X 3VVUA 2OP5A 3T1HK 4JYAJ 2Q6CA 2V0NA 1VBYA 2GIFA 2E6MA 1CSJA 3M5RA 4LC9B 3U9ZA 4J2DA 2N3OA 2HLUA 2R2RA 3QFWA 4USJC 1HMVB 5M2UA 2ZBPA 4UQTA 1T6DA 1QZ5A 3DGPA 5KFJA 5CABA 1ZZNA 3G82B 1RUSA 4YY3J 2NZ4A 3W3SA 3EKUA 5LJ5Y 3OY9A 4DN9A 5HVHA 3ILLA 2VJUA 2J8AA 1ZTWA 4FWQA 3VAJA 3TTCA 3NS5A 4NXMK 2DGWA 2FLNA 2E6LA 1RKIA 2OD6A 1IJFB 5D3GB 4B17A 5AR0A 2ERRA 3KXDA 1WKKA 2Q3SA 2O8DB 4BS2A 2W4CA 2E2NA 2NUUG 4CNYA 1RAIB 2BQUA 2X6SA 3TRGA 4JI1K 5KRSA 3K5OA 3I8DA 4ZTJA 4W5TA 1OJ4A 1F2HA 4LSNA 1GX6A 4UOHA 1YTUA 2HIYA 1TTHB 1WD6A 4CJRA 1NDPA 3A8KA 2VC0A 3GFXA 4QCLA 2BRLA 3AVLA 2YPZA 5FPDA 2B9EA 3RG6A 2VD3A 2DRDA 2E1PA 4ZLPA 3OHRA 3H40A 1Y64A 3RRKA 1S6PA 4GV6A 4OX9J 3DOKA 1YWXA 4DX8H 3H0PA 3MMBB 2YKOA 1S6QA 2P9PB 4NI2A 3CB4A 2MHEA 4N41A 2QRRA 3O4NA 1FXRA 3GJSB 3P3DA 1UFLA 2GHVC 3OR2B 4CO0A 3HXMA 4DMZA 2V2VA 4Z4HA 1GAOA 2A1RA 3PSIA 2PIIA 3OD2A 2HG4A 5BRHA 4QS7A 1SJRA 5A76A 4I1TA 3GG4A 5FDLB 1XMBA 5C2CA 3NS6A 3R1HA 3FJ2A 2E1RA 3GV7B 2FJBB 2F4FA 1GOAA 4UOGA 3K58A 3G71N 3C3LA 4NYOA 3Q22A 3IM8A 4FK0A 1ITPA 4C6AA 3QMLA 1A5XA 1XNRJ 3CCRS 2RRBA 5G0RB 3G25A 3PW5A 2F4VJ 2DHHA 3NGYA 1G4CA 3VA3A 4ECUA 2B3TB 4GKKJ 1N5YA 4OV1A 3HHNB 3DXKB 1Q4RA 4ECRA 4PL7A 2Y9HA 4CM2A 3MECB 1OY9A 4DZDA 4PG6A 4I6YA 4B3RF 5FPMA 3KG0A 4USTA 4S0MA 2X51A 4NA3A 2F65A 3LH2S 3DRSB 2F8MA 4JUZA 4KYZA 4QPTA 3ISNC 5I42A 3VALA 3MCPA 4UZCA 1Z6RA 4LSLB 1J5OB 4DL7A 1X4FA 2D3OR 1FJCA 3K5NA 2MEWA 3BF3A 5CHCB 1NJZA 3OFHA 3O2IA 2E1MC 4J9VA 3LO3A 1M5KC 4MIWA 1NK7A 2XHWA 3DDKA 4M94A 3Q86A 3D2FB 4CZIA 4JHDA 4B1ZA 4ZCMA 2J8SA 1MMDA 3EZUA 3NP5A 3CMES 1RT6B 2D9OA 2O8BA 1WG1A 3PFEA 4AQYK 1N6QB 4RBTA 3M05A 2UXCJ 3QT8A 4CO3A 3L4BC 2WONB 1J5EJ 4HT5A 1OO0B 4LD0A 2G9OA 3MM5A 4KC5A 3GL1A 3ZETB 5DZ7A 5C2GA 2P9IB 4CJTA 2WVBA 4IRDA 3A3PB 4DV7J 3PKMA 2VA3A 2HHPA 1XHXA 2IIRA 1WEZA 3VQ7A 3IS9A 4V19J 3EYZA 5IZHA 1HYZA 4C1NK 5KG1A 2K06A 3D45A 5AJ3K 2ZBIA 4D3HA 3I82A 4AHSA 2ZDPA 2NLXA 3G6ES 3OYAA 4U7UK 2QL9B 4JI0J 3MZIA 3H59A 1WWHA 5KFEA 4LT6A 1S1UA 4R5PA 4HHJA 2RRNA 1J2VA 1TP7A 3V1QA 3H2UB 2BOAA 3V6JA 3H42A 4U7CA 1P27B 4U67L 2XGQA 4O8UA 4CF2A 4CT8A 3BH7B 1U1LA 5HI7A 4ECZA 2X7IA 1YIJN 2EEYA 4CBXA 1QQMA 3O4QA 3UIQA 5JS1A 2GNKA 2RT3A 1NU0A 2EBGA 2B51A 1I3AA 2NRHA 2YH0A 5M1QA 3KJQB 2JVOA 4DHYA 1BL3A 2HBQB 3LM9A 2J4RA 5CHIA 3A8IA 2AHOB 4FLXA 1VQNN 2HHHF 1NLKL 1FD8A 1F6TA 3BR9A 1Q81O 2CJ9A 2IVYA 5KFWA 3NCPA 3D3CJ 2DH7A 2HS4A 2M8DB 4HACA 4RLEA 4MK7A 2RU3A 1FHTA 3B8HA 5CYQB 5D0HA 1RAEB 2CWXA 2H1YA 1SC1B 4FKYA 2XC9A 4J2AA 3EUNA 3QO9B 3NGKA 3I56S 3GE1A 2CADA 3CCMN 1YJTA 5FLXU 3WNGA 4X4PA 2BX6A 5KG0A 3OS1A 4PXEA 2H9ZA 3P4UB 4GC6A 3R8EA 3NF6A 4DUYK 2ASMA 1RT1A 4J9LA 2FC0A 3P45B 2O67A 2ZNZA 4JV5K 4USVA 3PXGa 3O3FA 1NJWA 3BO3A 1HD0A 1YZ6A 2UVVA 1VQ4N 5B0EA 3OS0A 5E84A 4E89A 3FFKB 1KVIA 1U2VA 2QZ8A 4FF4A 5F8JA 1E6YA 3H5SA 3MGJA 1K6YA 4FXDA 1CZBA 4ZOSA 2HWHA 3A13A 5KFHA 3QB0A 1ZS6A 2EXUA 1JCEA 3U1MA 3PO5A 1AROP 4JYAK 5FIIA 3BPDA 3R7NB 1C2PA 4OIXA 3HJFA 1Q18A 3OLBA 4TNOA 1HKCA 3J80Y 1NDLA 3R27A 4F4KA 2MSSA 4ILHA 2RDIA 1AZSB 3A5LC 3J8AA 1TAQA 3MFIA 4OHXA 4KKOA 2HFOA 3O80A 1DZ5A 2G8VA 3BQ1A 1TFWA 3D0GE 1V4SA 1REGX 2RD5C 4OX7A 4NLVA 3CJ9A 1RTHA 1H7XA 5GADI 1VRTB 3OTOF 2NRXA 4MAKA 2OTLS 2R7YA 3Q8RB 2P9LA 4L6V3 5RUBA 1IBKF 2RF2B 5C42B 5B0CA 4PWUA 4B3MK 3ENVA 4HKQA 1NHUA 2A10A 4KHQA 3D6TB 2G2YA 4DR4K 2FVPA 3CI5A 1VQYA 4I7FA 3NVKA 4L3KA 1BUXA 4DU8A 1XMOF 1DQ8A 1G1XA 2CQIA 3N79A 3FK4A 5D0GA 1X4GA 1NDKA 3HULA 4LF7J 9ATCB 5CYMA 2P9EA 3JAMU 3GV5B 1FRMA 4OX9K 2XS5A 1SC4B 1RTJB 2EKYA 1AFIA 2V67A 3ZO7A 8ATCB 4B8CA 1UOCA 1Y5LB 2OGUA 1NHVA 3A3NB 3ZLJA 1F3VA 4CH7A 2GJ2A 3FSIA 4DR6K 4OJGA 1SIZA 5L1IA 2MKKA 4FJ9A 3QIPA 5B7WA 2R4FA 1Z25A 3Q89A 2QLFB 5JVGL 4DV6F 4LR8A 3MX5A 4ICLB 4PKIA 2CNLB 4DR5J 4FJKA 3B6OA 1L3KA 4UQGA 1SC6A 4URSA 5EU7A 2XB2D 4TU8A 3MWPA 1TKZB 4LFAK 2EWSA 1UMJA 2OMLA 1L3SA 3A2FA 1S5JA 3KHGA 4GMJB 1UP1A 3H4BA 2RUSA 1TGOA 1GLLO 1YKWA 1KC8T 3GYXB 4JI5F 4CO1A 4IOCL 4ZPDA 1ZBTA 4PR6A 5BN9A 4C8OA 4LFBK 2H65B 1MWYA 2WRMA 3KJFB 2MKIA 3I31A 2HBMA 5ADXA 1MLAA 5J1EA 2J5AA 2UU9J 2V8VA 2I9SA 1W7WA 5CZ1A 2KO1A 4ELVA 4RW9B 3DOLB 1MWQA 4DS5A 4KPYA 4OHYA 1IKWB 3J7YU 1DQAA 1GLJO 3MD1A 3PY8A 2UUBF 1FNXH 3BB5A 1N33K 3KMQA 1I5OB 4KV8B 3ZNUA 1OSCA 2DGQA 3MM7B 1FDAA 3US5A 4KO0A 2EVZA 4GRSA 3HSGA 1VQ8S 3S3OA 2E1ZA 3THPA 4X64F 4E7HA 4DR1J 4FWSA 4FNHA 3E51A 5KFFA 1SL2A 3OYFA 3H98A 3W63A 2F7VA 3K5PA 5IOLA 1GMUA 1HNZF 4MYUA 1T44A 5HMWA 4FWKA 2PGCA 4PHTX 4X84A 2M0GB 2FJEB 2DNQA 3NY0A 2FBVA 1BMQB 3UDEA 2DT9A 3QLHA 3LP1A 5F8IA 1XMQK 1WF0A 4BG9A 5J1NA 3KJVA 1ZPWX 2ZFHA 3BREA 2D9PA 4YDUC 4JI2J 2CVEA 3QWPA 2DK2A 5GAHU 2HZCA 4C0OC 3TWHA 1VQON 3OPKA 3LDNA 2NR0A 4QIFA 4CE9A 2ZBRA 4X2BA 1JJ4A 2FVCA 1AYEA 3K17A 3KK1B 4IEIA 1S9GB 3P83D 2KT2A 1HI0P 4KBOA 4IFVA 2UUTA 4K4WA 2LQ9A 2BDPA 1C1BA 4DV1F 2RU9A 3KK2A 3SDEA 4AT1B 4M5IA 4GKJJ 2JL9A 3MXMA 3SJHA 2ZEJA 4NCGA 4DV2J 5KG7A 2V4JA 1HR0F 4U67Q 3SCLE 1RTDB 3R97A 5IM0A 1X4CA 3DNCA 2H3EB 5KFIA 4JI7K 3L2VA 3CJ0A 3DLGA 3Q8PB 4ED7A 5AZJA 2MPUA 2QA4N 3BZKA 4QS9A 1KDNA 2RS2A 1ZOTA 5ETSA 1YG0A 4NOHA 4B1VA 1KQGB 3KK3A 2VBYA 2QLWA 2PI5A 4ECTA 2GC8A 1Z2ZA 2RKIB 2XZDB 2NYIA 1KLNA 1UVKA 4ELUA 3L7UA 1GQEA 4CFCA 1YDLA 1HBUA 1AW0A 2W4DA 3TAQA 3VESA 2QO3A 3W65A 1NSPA 1WG4A 5J2NB 1LWEB 3ENWA 2F40A 2AX0A 1QY7A 3CPWM 1X9MA 1IXKA 2J9DA 2KYXA 3FKBA 1YI2N 1KQKA 4KTQA 1IQZA 1GLBG 4ED4A 5KFCA 1NKCA 2AYGA 3D68A 1HMVA 4V1Ak 4NXNF 1ASUA 2NS1B 1OY6A 1NMDA 3CCLS 4IO8A 4DV4F 3GCXP 3FRZA 4WF9Q 3OFEA 2ZD1A 4M5JA 5F0XA 1FKPB 4B3TF 3QEWA 3L3UA 4V19X 1WOSA 2KKHA 5T14A 3LTOA 4M1KA 2B5JB 4YMEA 2E9TA 5D3GA 4IRCA 1WN7A 1FEEA 4CP5A 3M1VB 2O8DA 2VC1A 4A8OA 4DR7J 3CCJS 2DPIA 3GIJA 1TU0B 3OXLA 1OS5A 1WG5A 2XY8A 1LAVA 1NM1A 4I6MA 4RWXA 1XC9A 4JV1A 3RB0A 3A5OC 2X3GA 4WQ5C 3RJMB 2F5GA 1CJUB 1VQ5S 4EO8A 3KMSA 4DSKA 2MLZA 3ZZYA 1LEOA 5KFNA 3CDBA 2R8HA 4HTUA 3TZWA 1NGDA 2QM1A 3S41A 3U1NA 4WU2A 4PG4A 5HL7L 2OPRA 3D6HB 3NKYA 3I0RB 4ANDA 3OVNA 3MN5A 3RGIA 2R7QA 4O3RA 3MMBA 5A2QU 1F5AA 3TR5A 1XQIA 2P9PA 2QWOA 2PMHA 3OSNA 2YHYA 1K1QA 2ZF5O 3GCWP 2G8FA 1EB0A 1OYDA 3NH1A 1O13A 4BC3A 3RB6A 3OR2A 4EO6A 4WP3A 4B02A 3NMUA 2C28A 1GMWD 3CJAA 2QWPA 3W2VB 2VASA 1OPIA 5HRNA 2QTDA 4LBIA 4GVEA 4IG3B 2QA1A 5JMNA 5H9EK 4DPWA 1RWVB 3B82A 4KHNA 2CIMA 1JNZB 3JQMA 2A40A 1Q0NA 2QT7A 3FSXA 1K8AT 4DU3A 3P8BB 5G0RA 1HLUA 3EVWA 4UW2A 3SBMA 4ZCIA 3KLFB 4OX8A 5E3CA 3MPYA 4LF8F 1HYSB 1GOBA 3DXKA 2J6SA 1RHUB 5AE2A 1JIHA 2XO7A 1BCMA 5KI6A 4WFXA 4JKFA 4IH6A 1CQMA 3M2VB 5EX5A 4KI4A 4E7IA 4HCCA 5B08A 2GUPA 1WHXA 2RPIA 1NGIA 1RDUA 2MKYA 1NWKA 2QFJA 5EUHA 1A5VA 4LSLA 1J5OA 4IOCQ 4HH1A 1YBUA 3L0QA 8RUCA 4IG0B 4K50A 5FROA 2AGOA 3ZTRA 2IHR1 3QSYB 1U45A 1JXVA 4BQZA 1QVFM 2UXBJ 1F60B 3CC2N 3PX4A 4DR2K 3D2FA 2VF3A 1UVLA 4F2RA 1RT6A 1ASWA 4DSLA 1N6QA 1APSA 4CHZA 3N9UC 3OFFA 2LSNA 4FJNA 3VQ4A 2WONA 4FYXB 2MQOA 4Z37A 5KTQA 3OYIA 2E9ZA 4DX6A 1FJEB 1RDRA 2IMOA 3TR8A 3ZETA 3HLUA 2P9IA 5AQSA 1WDTA 2F96A 2ROPA 4CHOA 4OLAA 3PYEA 1WSVA 5IV3A 1FDNA 4C3MA 2ZM6J 4DR1K 3PIOL 3NS7B 3MUVP 4X66F 3FZMA 1YITN 4KHSA 2R7OA 1F1BB 3Q2TC 3AO2A 2FHKA 1ZC6A 3WQUA 2A1SA 3NGIA 3QPIA 3NLCA 1PAEX 3LQVA 4BRGA 2ADBA 4LFCJ 2FJVA 3V9ZA 4GC7A 3HP6A 2VZ9A 1RBLA 1JCGA 2PMZD 1MROB 6FDRA 4CBUA 3E3XA 3RBXA 4JI2K 2O4IA 2PD1A 2QX0A 1Q86O 2KI2A 3POTB 3VN5A 2XI3A 2XTJP 2F1FA 2CDRB 3M2RB 1NRKA 4LF4J 2OPPB 2V52B 2ZWHA 3W61A 3P39A 3DMJB 5ETTA 2IPOB 3FQKA 4JK7A 4MMOA 1D09B 2YWEA 4DLGA 2O5DA 3AA8A 1Y0HA 3I55S 1IWAA 4ZPAA 5M1OA 5AXLA 4FCYA 2XHBA 3E1YA 4QS8A 4DV2K 3CF5L 4J9QA 5DK5A 3M8QA 4B9SA 4CFDA 1WTFA 4LIWA 1YJWS 2DGXA 1IBLF 1HKBA 4NA2A 3KLGA 3QO9A 4Q43A 1Y97A 3ZX2A 4A2AA 2DGSA 4YR0A 4K4VA 3HD2A 4HCBA 1NJYA 4JRPA 4B3SF 4UOFA 3OYKA 1SAZA 3EJMA 1BQXA 1H98A 1S6UA 4GO7X 5K8MA 2ITMA 2H5JB 3KDOA 2A5XA 4HUGA 3CJ5A 1DAXA 2QA4G 3ADAC 3CC7S 2DGTA 6FD1A 1HI8A 4EHTA 5JJBA 4J9KA 2NREA 3NEKA 1X9JA 3VF6A 3EVOA 1K8KB 2W9BB 3IMQJ 3ZSWA 4NMLA 4QWBA 3AVAA 4IJAA 1R8PA 1TUYA 4LF9K 5KFLA 2VGMA 3MN7A 3TPQA 4DCPB 1Y10A 3MR6A 4MKYA 4QIEA 2NQPA 2G0JA 4OKJA 1O8BA 4FM2A 2COLA 3CCTA 4NE9C 1BY9A 4C1NI 2QN6B 3IN5A 3ZZOA 4U6PA 3QIDA 1ZPVA 2ATCB 3DRRA 1EAYC 1AZSA 2O8EB 3DCAA 2HVDA 2NUBA 4ZIVA 1VC5A 4RW4A 2N7YA 1UPMB 1Q7YT 4W92B 5HMZA 4TU9A 1WAFA 3DRYA 2C22A 3NE6A 1KCFA 4LY7A 1VRTA 2Q97A 4M5HA 4DL5A 3LM2A 5HROB 2P9CA 3VAFA 3D2WA 2ZGZA 1K73T 2RF2A 4DTJA 5HVGA 1HBOB 1T8EA 4DTRA 3GIIA 3W7BA 3CQYA 1N4LA 2QI2A 2VONA 3BGRB 4DX5A 2HVHA 3HVTA 2BJ3A 3T7ZA 3LP2B 2OCEA 1HD1A 1RT4B 1RLCL 4FPAA 2R42A 3AJ1A 2ZH1A 3CJSA 2XYGB 4CJQA 3CGIA 3GYGA 3PG9A 2HEKA 2D0OA 2HVIA 4USWA 1RTJA 4ZVGA 2UUWA 1GT8A 1S99A 2PE8A 4N77A 1TL4A 4RNOA 3P31A 4EGLA 3CC4N 2VB6A 3TQ1A 1UFWA 2NSBA 1G3OA 3S8SA 3M8SA 2HVZA 5ETMA 2D3ZA 1KTQA 3THVA 4ICLA 5LL6d 2X6NA 2HNZB 2VCPA 3MR7A 2MQNA 4B9QA 2W2OP 4IJNA 1TKZA 4AH9A 4I6WA 3BV8A 4WCEL 1UZDA 3BBFA 2KU7A 5KOXA 1Y3JA 2VDIA 2RRAA 3J81Y 4NLUA 1U2FA 2AU0A 3KZBA 2V8HA 4ED3A 1BQMB 2LQBA 4D3GA 2KFYA 1BXNA 4FJ8A 4G65A 4NLSA 3VVTA 2YNFB 2DFEA 3SQGB 4A8QA 3J7A1 3KLIB 3BQ2A 2FJWA 4CJ4A 3EKSA 1WELA 2V9WA 2RHQB 1IKWA 2VPZB 1S0VA 3CCWA 2DHGA 4B1YB 3A8JA 3M8PA 2CQDA 2YWWA 3JTNA 3A5NC 3RMDA 2GIQA 1RBOB 4MDBA 3CD7A 2C3PA 3MCSA 2DHXA 3DLLQ 4LH5A 3ZSZA 1U04A 4KV8A 3I87A 3MM7A 1WLJA 1LK5A 1ILYA 1PIEA 2MGZB 1FXXA 2BKNA 2YQ3A 4BC2A 2VYPA 3WX8A 4ZN1A 5BR8F 1JL2A 2CJYB 4H4MB 5CZVA 2EFPA 1RGIA 3SLCA 1VK8A 5BPNA 1R43A 1K47A 1N52B 2XS2A 2H51B 3CM5A 5LJWA 4B3RJ 2VFRA 4BGBA 4CGJA 1C4AA 1Q82T 2QTWA 3P38A 2HHQA 2OEMA 4F0KA 2UXBK 3C16B 1S0MA 2RB7A 2XNQA 2FBXA 1YRUA 1TVRA 2B8PA 1YQHA 4KHWA 3KHYA 3NF9A 2L9WA 3LALA 1H1VA 3CT9A 2AT1B 4NZ6A 4WZMA 3U3YA 3W62A 2LXIA 3VGUA 3DXMB 1KEKA 1VLYA 3RBDA 3VAGA 3EX7B 1XN9A 3JSRA 3PIOQ 5D77A 4RNMA 1IM6A 3AVMA 5AQVA 1SZ2A 3KK1A 1RGVA 4WFBQ 3QT5A 3GSIA 4ZVQB 4KHPF 1FRXA 2LEAA 1RISA 1K9MT 2LLZA 4O23A 2IBKA 1RBVA 1PBAA 1QM9A 3M8RA 3I9V9 3C6TB 5M2PA 4OLPA 2WTFA 2NNWA 1C0GA 5F2RA 3CD6S 1H2UX 2VICA 1QD1A 2VFTA 2B4JA 3DLEB 4DTOA 3GB0A 1WSRA 4UF4A 1V3RA 5AXNA 1RTDA 4FBTA 3M6XA 1X3MA 2LA4A 1TAUA 2R7TA 3VQEA 3CMAS 1HBMA 1JLFB 2ZJQL 3QNNA 3T1YK 3I33A 1KC8O 4LR7A 3RU0A 1S9EB 1D5AA 2R7WA 4UUWA 4LF4K 1D9DA 2D1KA 1X31C 4OPKA 4TKTA 3FDSA 1DLOA 4YY3F 4OYMA 1Q16B 5KFDA 4PUOB 1EHWA 3J7ZO 3ZT4A 3FZKA 1JJ2M 3LP0B 4UT4A 2CQHA 2V4QA 1P1LA 2O4GA 3MN6A 2VG5B 2BYCA 4ZVEA 1NAQA 2VBXA 2XGPA 4FVUA 3SMZA 3DU5A 5CYJA 2Z2LA 2C3OA 1V5IB 4UY8T 4ISFA 4BQLA 4YB7A 5J2NA 2JLGA 1LWEA 1N5TA 5F8MA 1OQ6A 2JLFA 1ASVA 1GNKA 4K4UA 2Z1HA 1JL1A 4L75A 3GG1A 1GTHA 3SK3A 2QGFB 3O9RA 5B0AA 1FTCA 2MY7A 4B1XB 1H3DA 2P9GA 3FZBA 1K1SA 3R9PA 1JLQA 2DBBA 3JQJA 3NH0A 3AGRA 4OJHA 1NGCA 3CCZA 1RLDA 4OLBA 2CPZA 1SH0A 2WK4A 4KRWA 3F0NA 3DLKB 4LIRA 4X4QA 2W1BA 1FKPA 1TL3A 1U0SA 2WB1D 1S4EA 2Q3PA 1RDWX 1R8CA 3V6KA 3AA4A 4YOWA 2NPFA 1RFQA 1WSJA 4F0MA 3NGSA 5L8RC 4Y0WA 1UWBB 4ECXA 3EDQB 3M1VA 2GO9A 1RHMB 3HHLD 4QWDA 3AFGA 1OY8A 1VSFA 5KGXA 2VQEK 4J9UE 3Q0AA 4BBYA 3QBXA 5I3UB 4P71A 2ZHOA 3O8WA 4JD2B 3OT9A 5LM7E 1CJUA 2EHGA 1RACB 4J9RA 5SWMA 4PAAA 3BF1A 2G8UA 4CK1A 5CXTA 3GFYA 3IR6B 1QVGM 4GKKF 5K20B 4KB7A 4MKVA 2DY4A 4X4VA 3ENHA 2F9JA 4ISEA 2YNHB 3AVFA 4NLQA 1NM2A 1AUSL 3QNOA 1Z05A 2HIQA 4QYRA 4OI4A 4ZA1A 3RVCA 3I4HX 5L38A 2FHMA 4NB4A 4OKEA 3IAYA 2DEJA 3VAIA 2XBPA 4KI6A 3PIPL 3W2VA 4H0OA 3OTOJ 2EX3A 1T11A 3I6PA 2Y1JA 3VEOA 5GMDA 4UY85 1UEVA 4FW1A 4RWTA 2W6KA 4CF1A 1IBKJ 3NDKA 5E3RA 3KHLA 2W9AA 3G0ZA 5AQFA 2G8IA 4XK8C 4DN0A 5A8KB 1TYQB 3UFCX 1YJNN 1KAZA 4BCAA 2ATQA 3FRYA 1XMOJ 3BZCA 3BQ0A 1HYSA 2XY5A 2KT3A 2UXCF 5J2QB 3WXKA 1SH2A 2DIUA 3M2VA 1QUVA 1X4HA 2Q66A 1JKHB 4M42A 2N82B 4C11B 2RDJA 5EXWA 2ZH9A 1TK5A 4XPCA 5DQGA 3NH2A 1RABB 4WCEQ 4NLPA 5D78A 4MTPA 3OS2A 1L5UA 5AQQA 4G1IA 5LJ3Y 4DFKA 2W9CB 1D1UA 4IG0A 2HZAA 1G15A 2U2FA 1M90O 4DV6J 1AFJA 3N6LA 3A12A 2CQ0A 1U1NA 4BE0A 3KUGA 2YQ1A 3CFPA 1PAUB 4F25A 3TSQA 2BACA 3D6RA 4EFHA 3WXMB 4RUBA 2MKSA 4QQBA 2Y1LB 1CULB 5J2PB 1WB9A 4ZVSB 5GMEA 4OHVA 3N4WA 1G7CB 1ZM3A 3TA0A 4JI5J 2VWBA 4FXWA 1A0OB 4AHTA 2C2NA 1PGZA 2C1EB 2G0IA 3GP9A 1RJJA 2WZ1A 4P6QA 3W1YC 2Z1IA 4DL3A 2W8LA 1EQMA 3OTCA 4ZVHA 1RDDA 2DNKA 4PABA 4WXWA 1H7WA 1R7IA 2D1CA 4BRPA 4K41A 2QE5A 4CIGA 3AA3A 2EK1A 1G6BA 1R8BA 2UZAA 2UUBJ 4B3RK 3DU6A 1T0TV 2EK6A 1KXPA 4WQ4A 3AQPA 3OTEA 3QDKA 4K4SA 4O5BA 3WT0A 2RDDA 4LRAA 2VBWA 1WUUA 4DSJA 4J9OA 4RW6B 3SMPA 3MTKA 3C15B 4X64J 1FEHA 1DARA 1MROA 2HBYB 1HKAA 4YUDA 4DV0J 1TUWA 4MQ3A 3SNNA 3LPEA 1GEHA 2DTJA 2RN2A 3POTA 3AVHA 3VETA 4FOIA 4JI6K 2KL8A 3HD1A 1K8AO 1RT2B 4RBUA 2OPPA 2J0SD 2W24A 3DMJA 5ETRA 3ZTQA 2VHGA 4RNNA 2WVCA 4BR9A 3KWIA 2IVMA 2LDYA 2YI1A 2QWNA 2GGPB 1MU2A 1NGAA 2WHOA 4FM1A 2AX1A 3CCRN 3OUYB 3HX9A 3NCIA 4CJVA 4CTAA 1TMJA 4LF5F 1W26A 2E5IA 2CNNB 3PHTA 1SL1A 1W2BR 1KFDA 3A5MC 1J27A 2FSKA 3QRRA 1WKLA 1VSIA 1BCOA 1DTTB 4PZVA 2EI5A 1A7GE 4DV1J 1U1RA 1EX8A 3VQPA 5BYSA 3SQ2A 1RTIB 1M0SA 4QYZK 2VOPA 2XI2A 3S6EA 2C2EA 2G1HA 2G8WA 2X1GA 1NOYA 4QOZB 1HR0J 1BQNA 3R3TA 3TA2A 3TUPA 1DFDA 4MIAA 4DQPA 4X65K 4FJ5A 1RQ0A 4DS4A 2BQRA 1K8KA 3N6NA 2E1CA 5KFAA 3RZAA 1BC6A 3D0IE 3TAGA 3H7HB 2ZH3A 3R5AA 4KR0B 2MJNA 1BWEA 2R3VA 1YX2A 3EGWB 3GJRB 2E8AA 2WTUA 3CMEN 4URQU 2HHHK 3FQLA 2PFFB 1IKVA 3IWXA 1NCLA 3AGKA 1NPKA 1DRZA 2O8EA 5DGBA 4QWCA 2DNGA 1KVAA 5KFGA 1EP4B 2HQIA 2XNRA 1T95A 2VH7A 4CK3A 4F2SA 4A48A 2LEBA 3OYLA 1NK0A 3SUOA 5HROA 3K9KA 3VWSA 2YH1A 1HLWA 4KGKA 2JWLA 1WSEA 1SIWB 1CLQA 2APOA 1KR4A 1HBOA 2B6AB 4NXNJ 2DIVA 3ISND 1H0HB 2YV0X 3G6EN 2DTUA 1RT5B 2O1PA 5DDPC 3QEVA 3KNAA 3H5XA 4DV4J 2FC9A 5ETNA 2HNYB 4CYUB 2AYMA 1URNA 2AA4A 4K25A 3BGRA 1IKYB 4F3QA 1X0PA 3LP2A 4B3TJ 1RT4A 4JKGA 4BLGA 1RWKB 2OANA 2CQCA 2JNJA 5DM7Q 3NOCA 4O3SA 4BRLA 2A6MA 3KLEB 4OYZA 1UCNA 4PG7A 2XULA 4PKDB 4ES2A 3DYAB 1SKSA 4QPXA 2HBZB 3C0BA 2J0QD 3EM1A 2DNZA 4RZRA 2XQCA 1MWKA 3L3VA 2RQMA 1R0AB 4FK2A 5AQKA 3PIPQ 2AJ0A 2YNIB 2JEGA 4CZJA 4CEQA 4CW7B 3KHHA 3ICLA 2YX4A 2I7PA 4C0BA 2R8JA 2R8KA 2KT5A 4QR2A 3G4SN 2HNZA 3FBBA 1WSGA 5B0GA 3R7BB 4BDPA 4N7TA 1HPMA 3I56N 2P5OA 4HL9A 4CI6A 1XC3A 3P5BP 5C12A 2W7OA 1Q81T 3GJTB 1SPBP 3ULDA 2ZE2B 3N5FA 4MFBB 3OJUA 4BR5A 4BR0A 1AT1B 1P9YA 1WORA 5HBMB 3LDOA 2HFVA 1B3TA 4E1JA 3T1HF 1VHXA 4A8SA 2YNFA 1XMOK 2B7CB 3ZX3A 3TSUA 3KLIA 1N36K 3T6JA 4JKEA 1C0FA 2D3O1 5CCMA 4CZMA 2A0FB 2J0WA 4QW9A 4OYWA 3ZC4A 1B7FA 2KZZA 2KDOA 3CSKA 4AUKA 1X3NA 2KXHA 3PNIA 1Q7YO 2ZC4A 3J81j 2V4RA 3RYLA 1FRJA 2RMLA 4LF8J 1JMTA 4AL6A 4YDXA 1HI1A 2B4OA 2CPFA 4H4MA 2GWJA 3O3GA 2CAJA 4NXMF 3ZCMA 1MG7A 3C7NA 2QKBA 3QEXA 1K73O 2CPYA 4N56A 4GV9A 5AQNA 1SBRA 3VCDA 1PO6A 3VQCA 4U7UD 1S72S 2CQGA 2UUAK 1NSAA 4C8LA 4Y2IA 2GX8A 4FYDA 1VK0A 3C16A 4J37A 1P1TA 1RWNB 3SQ0A 2OTLN 4CO2A 4IOXA 4C8ZA 3LWLA 1FFWB 3NRBA 1S22A 2GMHA 3C46A 4YHHK 4E7LA 5HJYA 2QJ3A 3DXMA 4UTGA 1YJRA 3DDIA 4K0KF 3PRBA 5CA5A 4C7QA 3SCJE 4KIAA 3KYLA 1LFWA 1LV5A 1DY3A 2XMUA 4C8KA 1DJ0A 2ZJPL 5HQLA 2OH2A 4EMDA 2K1RB 2NRTA 4A5AA 5KG3A 2FIUA 2CYYA 3I0SB 3AARA 2VL1A 5GAEI 3C6TA 3EMTA 3IG1B 2OTJS 4NLWA 1LWCB 4FYVB 2KH9A 3M3ZA 2GWKA 4IO9Q 1FWLA 3DLEA 4BR2A 2HQDA 2OI2A 1JCFA 3D66A 3T6BA 4DTUA 2DRBA 3DXBA 3PZPA 2UP1A 4X66J 1HNZK 1JLFA 4DTNA 4UUXA 4HDGA 2HHSA 1NEEA 5GAEU 1S9EA 4BRHA 1XNQK 3HFVA 8AT1B 3N4QA 3AO1A 4O44B 1T3OA 1CVJA 1NH8A 1PKUA 2AYEA 3AB4B 4CIEA 4CH0S 4PUOA 2HKEA 4L73A 4OI0A 1WC4A 1YF5L 4ZKAA 3LP0A 5DETA 5EOYA 4RTFD 2VG5A 1S79A 3T19A 3MPWA 3RAMA 5TKWA 4TLQA 2J7WA 2FVSA 1Y3KA 3IBCB 3QESA 2BMBA 2AYBA 1H2VZ 1TELA 2WC9A 1FNMA 4NPOA 2QWMA 2AJQA 2CJAA 2L48A 2AV5A 2WBMA 3SCXA 4YOEA 4DV1K 4OMFG 4DXLA 2E44A 1YIJS 3F5TA 3I5BA 2AGPA 3R5DA 5KFQA 1HR0K 4YEAA 1IBLJ 2WVFA 2MYFA 1GXUA 3AY9A 4KB1A 2N3LA 1VQ8N 1VQNS 2GELA 3UKRB 3MAAB 4BRNA 1DBDA 1KTVA 3T3FA 1Q9YA 1KONA 3SAGA 2VFUA 3MR3A 3UR0A 4P74A 4QAGA 1U7LA 2GCFA 4B3SJ 2BJ9A 4PG5A 3IFRA 3FBFA 1V6HA 5E0OA 5GAGI 2OMOA 1UWBA 2V69A 3V2UC 5DS7A 4ERDA 1Y00A 5C5JA 3M1FA 3VQ5A 4FWOA 1CJKB 4DG1B 4Y34A 3R5CA 4JB8B 2QSWA 1WC3A 4USIA 3OHBA 5I3UA 4NYNA 3AXMA 3P5TL 3D0PA 1RU1A 1B4SA 4BC7A 5HLFB 5AJ3F 4YORA 4JD2A 1R8AA 5GAGU 3RWUA 2D5RA 3T9NA 3IWLA 3W2WA 4C8NA 3EE9A 5AQTA 4IKFA 1HPZB 1JLCB 1VQ4S 4CZHA 3FLCO 1SVDA 3E9OA 4PYDA 2FVQA 2BABA 1Q7LB 2HK3A 5B0DA 1AXQA 2YJFA 4NXNK 5KT4A 4A62A 2WVEA 4X62K 1FWPA 3PR4A 3MK6A 4KHRA 3CMQA 2PA3A 3TANA 1J54A 5M1KA 4LJMA 4PPDA 1ZAVA 4KH0B 4M63C 5B09A 1CJVB 2DVIA 4YOXA 3CERA 4DPYA 1TK8A 5BRDA 4KH6A 1NJIO 3V6DB 4HWIA 1I94F 4FWRA 4X4UA 3TNVA 2KJWA 5A8KA 4EIAA 1TYQA 5TKYA 5KT2A 2F8HA 3CPEA 3C19A 2LP4A 1VBZA 2GHWA 3CJ7A 1M5HA 3HHLC 1RTZA 4OPAA 3E01B 3JAMY 1OIAA 4BR4A 4JS5A 4YS2A 3O4WA 1JLEB 2XEXA 2CJQA 3U7JA 5J2QA 2JX2A 5IWAK 3SEOA 2M5YA 4CZEA 1KHVA 5DG8A 4ILRA 3DM2B 4C11A 1GFWB 4LBPA 5I3PA 3FEZA 5KFYA 2CPEA 4MYTA 4JV5F 1VSMA 4C23A 3EGVA 3JS9A 1NK4A 3H08A 2JFKA 1EQYA 2E5GA 1TFYA 5F8NA 1SJ4P 2W9CA 2IDOA 1X4BA 4ILMA 1PJ7A 1QZ6A 3R5JB 3QGPA 1AA1B 1NB2A 4AHCA 4BREA 3ZZZA 1XR5A 1DQ9A 5THWA 3TARA 3TSPA 1RB0A 3NFAA 2HRTA 4LFCF 5DM6L 4DL0C 5EHHA 3TX8A 1W7AA 4H5WA 1PJ5A 2QK9A 1FF2A 1JK9B 1MWZA 1CULA 5K14B 1QUPA 3CETA 1JLBB 5HRPA 3IA0A 3TVYA 3HVWA 2ZGYA 4J8FA 1T03A 1R0BG 1CXQA 2E1YA 3C95A 4N47A 2KM8C 2KRRA 3HM9A 4FJHA 1Q53A 2ZKTA 4NYPA 3Q8QB 1YJ9S 2QYGA 4BC5A 2Q79A 2XMJA 4GW6A 1VQ5N 2UXDF 3L09A 4B3MF 3TYTA 2G4BA 4OJ3A 1ZH5A 3HYFA 3O5TB 1UW4A 3VAKA 3P1GA 4DR4F 2QIFA 1K0TA 3D1QA 3OR1B 1T9VA 2VODA 3QEIA 1LAWA 1FDDA 4BRCA 2HHXA 5BR8J 3QEPA 4RW6A 4I56A 3OL8A 2MDAA 2M52A 3C15A 4E1MA 4U7BA 1HBNA 2KXFA 4NLCA 4CLSA 2WW4A 4Z4EA 3AVJA 3LWMA 4B9MA 4DV5F 3VEXA 4EAHD 4IBNA 3SQOP 3JSBA 4DU4A 3OW2R 1RT2A 3AOBA 2ZJPQ 4JI8J 2C3YA 3CW2C 5AQIA 1RDAA 3JS6A 5C2FA 4WFZA 3G6XA 2ZUGA 5HRSA 4CEEA 3R6MA 4DR6F 3V81A 4F26A 3AH6A 4I6AA 2DPNA 2F8TA 4MKBA 2DO0A 5HN0A 3VHQA 3DLRA 4CZLA 3MXIA 4WFNL 2QMUB 2Z0GA 4YP3A 3BJYA 4ED0A 3UWTA 3JYTA 2DKOB 2QL7B 2XSFA 3N5BA 3UR3C 2XY6A 3R1LA 3VF2A 1Q8KA 4LFAF 3QFPA 4KHPJ 1R89A 2O66A 3VGMA 3DJCA 5HOOA 4X66K 5AQRA 1DTTA 4J7CA 5FPNA 5LMNK 4DBQA 2GQCA 3ZZPA 1VQOS 4BGAA 1OVQA 3UD4P 3EXYA 1RTIA 4A8WA 4LFBF 1RBSA 3TI0A 4HUEA 3CM6A 3EN9A 2XWXA 2C2KB 1YT3A 1X60A 3TAPA 5FPEA 2UVWA 2ABYA 4NLXA 4JV0A 1S49A 5GADP 1HNXK 1U1PA 2C2ZB 4ZDNA 1N33F 1I51B 4K7QA 3CJKB 3IP0A 2DO4A 5DRKA 2H4WB 4QZVB 2CJBA 5AXMA 3CCSS 2QEXS 3TAMA 4Q8FA 4FW2A 5A0YB 5C2DA 1RA6A 1B0TA 2DFHA 4RW8B 1CZAN 1KHWA 4NZ7A 5C10A 2R7XA 4I2PB 5E5NA 5DG9A 5KPTA 1X5PA 2JZ5A 1C0TB 2QA4S 4FNIA 3LA0A 1YXQA 2G2ZA 3ZSVA 2GTDA 4FZZA 2HGLA 1VI7A 5J2MB 5JXSA 4M8LA 1EP4A 4KHUA 2IRXA 1JJHA 3IGVA 4TY9A 4EU0A 4DCJB 2Z30B 3CD0A 2R7SA 2KFZA 4OJ1A 1WF2A 4C0HA 3V9UA 2B6AA 5M1PA 3VF4A 1GK8A 2CPHA 4B3OB 3AOAA 1RT5A 4BC9A 5FJ4A 2HNYA 4CYUA 4BRFA 1OH7A 3JQKA 4JP8A 1IKYA 4CLWA 2EFNA 2OPSB 5AQOA 4Y2KA 1KVKA 4E98A 3PEJA 5C7PA 2Z8QA 4OYOA 4HTLA 3J7YP 3KLEA 2AJ4A 4IOAL 2L9DA 1WSHA 3HSJA 4ILLA 1BIZA 2HS0A 3MM6B 5KFTA 3OJSA 4R25A 4TY8A 2HHVA 3L2RA 1GLCG 1A9NB 4A8MP 3DYAA 2OUGA 3WHIA 1IO2A 5KQ8A 4ZVUB 1CJTA 4JI7F 1Q86T 3KUHA 4CLZA 3I55N 3H8YA 4Z7YA 1G2EA 3ZX0A 1R0AA 3ZZTA 5I9EB 3VV2B 5A8RB 3L7OA 1RE1B 4I2QA 2HAFA 3HSZA 3O3LA 4DUZF 3EICA 4XDCA 5KG6A 4DB3A 2NXEA 4U9RA 1YJWN 3ZT1A 1TL7B 3AV9A 4H4KA 1EJ7L 2CZ4A 3A8YA 3KTQA 2W2MP 3L8BA 2VFVA 3CPWR 3IRXB 2M88A 2JC1A 2HZVA 2Z1GA 4K5SA 3K8VA 3R6GB 4MFBA 4KE5A 1WBBA 2E5JA 3F44A 4M5NA 3H2LA 2RSQA 4U8VA 3FZLA 5HBMA 2LXFA 4C4WA 5GAHP 2QWRA 4CO4A 2VDHA 4RU9A 1TK0A 3CC7N 3PJXA 1NSQA 2V50A 1RWXB 3TTFA 1DT9A 2QXFA 4P7TA 4KSEB 2BM1A 3L9ZA 2DRAA 1HJOA 4OO1J 4HHHA 3QJJA 3HPHA 4CEBA 1QE1B 2YKNB 2ZH7A 4PYAA 4DJBA 1S3XA 3ALYA 2GV1A 5CE3A 1ACMB 1GLAG 2I6WA 2P9KB 4IYQA 5AQYA 2RIJA 3WXJA 3D28A 1D9FA 3LDQA 4J9NA 2RHSB 4FL9A 1ZBHA 3J80O 4ILGB 2G8KA 1BHLA 4CD1A 2WFBA 3F9KA 3KVGA 2GUIA 3CYMA 4F4ZA 4CZKA 4M5DB 4NZ0A 2DCUB 3Q23A 4JLHA 4NRTA 3NGZA 2XZTB 5HQMA 2HB5A 3BM7A 2MLXA 2CNKB 1WJ9A 3MMCB 4WKYA 1GTEA 1OVYA 4JI4F 5L1LA 1X4AA 5L39A 2DXDA 4DQSA 1W97L 1T9XA 4CJ3A 4FJLA 2W4PA 1VQMN 3G2XA 4R0EA 2LU2A 4QU7A 2Z2ZA 1UW9A 4WIQA 3HHKA 1C1CA 3CJ1A 3VENA 2HWTA 4CIOA 3MI7X 2VPWB 2J6UA 2VG6A 4X4RA 3QT7A 3RB3A 4I9QA 2EBEA 2K1RA 1UVMA 3I0SA 1PSDA 3L2UA 5A8WB 4IR9A 3O9UA 1WI8A 4JK9A 1PYTA 1CQNA 1NGGA 1LWCA 1F2GA 4E3SA 3CC2S 3U3GA 3U6FA 2V5HG 2HHWA 3PUFA 2WSEC 2Z4PA 3CTRA 4WE1B 5T41A 4CF0A 2CPIA 3E66A 1HFEL 3CJ3A 3NCRA 2CUYA 2DD8S 4DL2A 1VQKS 3CO9A 3HHDA 3VAHA 2L9NA 2ZH5A 4P73A 1WC6A 2J6TA 4WKRA 1WSFA 2IRUA 4PY5A 2XY7A 2MQMA 3Q8SB 2O8CA 2ZITA 5F3TA 3CDWA 1XERA 3TTDA 4WFNQ 1UEUA 4IEEA 1ZXOA 2KTQA 2K3KA 1Q9XA 3BSOA 3HOSA 2GQ2A 1FRHA 1HRHA 3FMWA 3VEVA 4F0HA 2E4LA 4FJGA 5DJBA 2VGNA 4FLYA 2RILA 4MK8A 1QSLA 1JNRB 4Z4FA 2IGIA 4DI6A 1U0HA 5KFVA 1K44A 1WC5A 4HDHA 1NMEB 3BEXA 1FKAF 4FZXC 2ZKUA 4DV3F 4Z4CA 2MXYA 1RBTA 1NH7A 5E3QA 1R6VA 3VA0A 2P51A 4LF5J 2FJAB 3HKZD 3BY5A 3O1WA 1VQPN 5KPRA 3SAFA 2HBJA 3L2WA 2DNNA 4DR2F 3WC0A 1U8SA 5LJVA 4CQ1A 2FD2A 5KFBA 2IC3B 3UKRA 3MAAA 3HRGA 1FA0A 2DNMA 1NPPA 3C65A 1JB0C 3GE9A 3UQSA 4F02A 3GYNA 3G86A 4YY3K 3G10A 1N56A 1ZAWA 1UTAA 1F21A 3NMRA 3OSPA 3WEEB 5BRFA 5BJRA 3MTJA 5D4OA 4DF8A 4DG1A 3OV7A 4CGIA 1FJGF 5HVFA 2DR5A 3M6WA 4E0DA 3UKUB 1UVNA 3B6PA 4IO1A 1IKXA 1DKGD 4C98A 2C2RA 5U47A 4UOCA 3O44A 3MEDA 5HLFA 3CCUS 3ID6A 3LDPA 1HHSA 1NKBA 2G13A 2XS7A 3D6MB 4DFPA 3L2QA 2NCKL 4CLTA 2DFFA 1IR1A 1S6OA 3OYCA 1HWKA 3SZ2A 2DYAA 4EZ6A 1JLCA 1W25A 2XRIA 2DY1A 2GO8A 1IG8A 1XIQA 3UE2A 3T5JA 4LRBA 1WUAA 4FYYB 2BOPA 3VGLA 5IXUA 3CD6N 3VF0B 2PO4A 4ETZA 4JHDB 2EG1A 1W2IA 2QMXA 3QNWB 3UD5A 5EY4A 3BKUA 2O8BB 5F8HA 2QMWA 4QWAA 3AAQA 3CMAN 3FCVA 4ANEA 4HTJA 1CJVA 2HOEA 4IOAQ 1R31A 5MLCQ 4CLLA 3ZSYA 3V6DA 1KQSM 4AD6A 3K59A 1KNZA 5CZ2A 4KT0C 2GA7A 4AHVA 3HDSA 2ZUAA 3SUPA 3K0SA 1TKTB 4EYHB 3WUHA 4BE2A 3D6FB 1UFKA 4H5NA 4NLRA 3P4IA 3OBIA 1TKXB 3J7YI 2PA8D 1GXLA 4TVAB 4IQMA 1XTZA 1N32J 1XNRK 1KOOA 2BJ1A 2D7SA 4K8XA 2W2PP 2J9CA 1JLEA 2QC3A 4W4MA 2MB0B 5KAKA 4JV2A 1TR0A 1BWVA 2E7XA 2G1DA 2F4VK 3BR8A 3WX4A 4DPUA 4P7VA 4GKKK 4EP4A 5JLHA 3J7ZT 2NLWA 3G8TA 1VLOA 3I4PA 3DLHA 3QIOA 5B8HA 1CS4A 1FXDA 4RBVA 3K0JA 4AL7A 3VQ8A 4NO7A 3TVKA 4WPAA 3PV8A 1U6ZA 2W6LA 2OZMA 1A5WA 2V7ZA 2C3UA 3DAWA 1VSJA 2Y8YA 4ID8A 5B0FA 5DO2A 3CCVS 4XH4A 5HSPA 4ED8A 1S1VA 3QFHA 4CFBA 3UDLA 5F1XA 2ZH2A 3HVAA 2G2OA 4L76A 4EBCA 3RAXA 5GAHI 4DV0F 1PYOB 1M1KO 3MUMP 3QJLA 2B4VA 2NPIA 1LK7A 4CGHA 4FZYA 3AODA 3EPGA 3T1HJ 1L3UA 4FOEA 2O8FB 5D15A 3T9ZA 3KD1E 3SV4A 4CLYA 1KAXA 4B1UB 3IR5B 3PYDA 4FK4A 1IJJA 1BUPA 2BE2A 1F3FA 4ZK7M 2UXCK 2HHUA 1J53A 4ILJA 4I67A 3CJQA 1J5EK 2EFQA 1LCUA 4DZ6A 1S7IA 3ENBA 3UB5A 2HFUA 2QWLA 1D0EA 4A4JA 4DSIA 4DV7K 5KFRA 4PQAA 1AB8A 2KN4A 1ZBUA 4CD3A 1NGHA 2HFSA 5E2QA 4O4GB 4CJPA 3BGLA 2J7KA 2MZ1A 3ZEUB 1WKJA 3NNAA 4O3QA 1E6YB 2P2CB 4CLPA 4NXMJ 5KFOA 3QSIA 4B8AB 4KH4A 2BW7A 4ALZA 3LPYA 5F3ZA 4JI0K 2DB1A 3N0VA 1Q78A 1WC0A 1KP6A 1ZZFA 1TV6A 1ZM4A 1QAIA 3RMAA 2GMJA 4ZP8A 3IR7B 3J7Z5 1MNEA 3OYMA 4USKA 1Y5NB 3VMFB 2ZWPA 4ED1A 1VQ6S 1VSKA 4CESA 3UN5A 2IM0A 1WEYA 1WTBA 2VPYB 3OTBA 2XMAA 3AQOA 4M3UA 5KFUA 4K0KJ 2QA2A 3OBYA 1RTHB 2K8GA 2KLAA 1N8RT 3SBGA 1DHMA 1IQTA 4WXOA 4W5NA 1OQ3A 1RYSA 2Q1LA 1B92A 1KVJA 2ZH6A 1NU4A 5DDQC 4ZITA 4WZQA 3IC1A 4YN3B 4CF8A 2YWHA 1UEKA 2KXNB 1WSIA 1FNOA 4OZ1A 5AQUA 2HNDA 6AT1B 4X4SA 3I96A 4EP5A 2H5EA 4F36A 2Y1RI 3Q7CA 3E8OA 3IGNA 2Q31A 4C97A 4IKAA 4O3NA 2OD4A 5BPMA 3VQQA 1XEZA 4I4BA 1X9SA 2BRKA 3FR0A 3W8PA 3CCES 1XJWB 2JVRA 3DLBA 3QZ7A 1I3OB 2JWKA 4EFAC 3WC2A 3TWZA 3C6UB 3CJTA 2J9DE 4ES3A 1VIXA 3S1TA 3LP3A 3AVCA 3G82A 4A5BA 3FSYA 4P10A 4XAKA 3HBTA 4CHYA 3GLJA 5HP1B 1YJVA 5A0YA 2CWKA 3H20A 4RW8A 3VTIA 1SJQA 1YVFA 3ILOA 3TQEA 3QIPB 1C0MA 4RPFA 4I2PA 5ELZA 4EK2A 1M90T 2I38A 1C0TA 3W64A 2RAQA 4P72A 3SFGA 2XYPB 4AXIA 1CXUA 2JOQA 3AO4A 3WQTA 2RVJA 4J9PA 3M8WA 1SL0A 3QT6A 2KJVA 4RUHA 5J2MA 4CVNE 4U95A 4ZS6A 2QLXA 5IC6B 2WBRA 2ZJRL 4K4YA 3KD5E 3SUNA 3GBTA 2L08A 5CH7B 1L3VA 4RJVA 4CCHA 1H74A 2Y0BB 1XK8A 3A8EA 3V6HA 3UVJB 3QJPA 2PSZA 4HEA9 2F9TA 1UL3A 2ZZTA 4FO0A 5GINA 3VQ9A 3ZT2A 4RR5A 4IOBA 3THYB 4B3OA 4MIBA 4ZCLA 4WYWA 5JVHL 3GG0A 3OYJA 4Q2MA 3ET6B 3PW7A 4OI2A 3M9OB 1NMNA 3K2YA 1X5TA 3QATA 2OPSA 3RRGA 4LF2A 4FF3A 1X0FA 3PX0A 4ZLNA 4K2JA 3J7AN 1CPZA 4R79A 5FDLA 2GW8A 4KO0B 1SQFA 4ECSA 2W2NP 4O8KA 4DQQA 2V7YA 3KFWX 3MM6A 3LPUA 1BD6A 3HVRA 3A3OB 2DJWA 2IJRA 4P52A 3T1YF 1U6FA 4Q7AA 3MR2A 4LF7K 2ZWOA 5AJ3J 1JJ2R 2R9LA 2QLBB 3KKFA 5A8RA 1KAYA 1RT3B 2AMCB 2HF4A 3R5BA 2XLJA 3SPZA