4O44A

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 140
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o44A05
2XGQA 4KTWA 3OYBA 1FK9A 1BQNB 3DLEB 5KFTA 4QAGA 4FJNA 4CJTA 4RW7B 2BE2A 4FJIA 4TYAA 4EYHB 3OL6A 1LW0A 4OKKA 2HW3A 3AA4A 4IH6A 4B3OB 2B43A 4DSFA 4ECWA 3MF5A 3V1RA 4PWDB 1WNEA 2I5JB 3SUNA 1N6QB 1X9WA 1MU2A 1RTIA 3RB0A 2WCXA 3OLBA 2IC3B 3CJ2A 1REVB 2UVWA 1N6QA 3WNGA 2HNYA 4TN2A 3DRRA 4WYWA 3AO1A 3TARA 2W9BA 4RNHA 3PJXA 3BSOA 4Y2CA 2Z1JA 1UA1A 3L2WA 4AILC 4RNOA 4JV0A 4ELUA 4H54A 5F8HA 1VSLA 2W42A 4DQSA 1DTQA 3DOKB 4YQWA 3PY8A 3I5AA 4I2QA 4FJ7A 4IH7A 1U09A 2DPJA 3HO1A 4G1QB 4IH5A 3M8QB 3OHBA 1IKVB 2FBTA 4FLZA 2VWKA 2W9CA 4CESA 2Z1GA 1TKXA 4IRKA 4RW6A 4FJGA 3ZSOA 1T3NA 4IR9A 4IKFA 1KTQA 4NCGB 3JYTA 1YT3A 5KT3A 3I5BA 1Z4UA 3VA3A 5CZ2A 3SV4A 4CJ4A 4BE1A 2DY4A 5KFAA 4TY8B 2QXFA 4DL7A 4M3YA 1C1CA 2FC0A 4HHTA 4O3OA 4B9NA 1C1BA 4M95A 3CFPA 4R8UB 4LH4A 1IKYB 4W5OA 4DU3A 1RT4A 3H5XA 4TLRA 3C6UB 2P1JA 3BR9A 4ECUA 4CECA 5KFSA 5DLGA 2AGPA 2IMWP 2IGIA 1T05A 1ZTWA 3OY9A 2FBVA 1DLOB 3SPZA 3ZSZA 1LAVA 1VRUA 3VQ5A 4CHOA 5HRSA 4JRQA 4I2PB 3MTKA 2WHOA 1L3TA 4Q8EA 1ZBFA 4WE1A 3KK2A 1B9FA 2KFNA 4JLHA 4DFMA 1QSLA 1S49A 2RDIA 1T03A 3GV7B 4KFBB 1EXQA 1ITGA 4JUZA 1RTJA 1S1UB 4FLTA 4LD0A 3V9ZA 3KOAA 3HP6A 4E7KA 3NGDA 4M42A 3LPUA 3DOLB 3H5SA 4K50A 4QCLA 4K4TA 2ZD1A 3OJUA 3TAGA 3OVNA 4YR0A 1NJZA 3MFHA 4NRTA 2X74A 3CQ8A 1Q9XA 4ED0A 3FRZA 4H4MB 2Z1HA 4LSNB 5K14B 3QGHA 2HMIA 3CYMA 4E0DA 4DL5A 2BDPA 4KHYA 1KRPA 2HNDA 3PR5B 4CCHA 1U04A 3OS0A 3LZJA 3HT3A 4JV1A 4KTQA 3HPGA 3DLKA 5FDLA 4WXOA 4W5QA 2R2TA 1HNVB 2G8FA 3HPHA 4KV8B 4FJMA 2C2EA 1LWFA 1TGOA 4KHWA 3LANA 3ALYA 3LZIA 3VQPA 3OJSA 4GC6A 3QEIA 3OYKA 1SL0A 3VQSA 3KK1A 2B6AA 4CFDA 4NRUA 3AA2A 3QIPB 5DLFA 3QEVA 2KZMA 1YTAA 2XRIA 2F8EX 3TAPA 3HKWA 4MKAA 1CXUA 3QEPA 1NKBA 1YVUA 5KFCA 2ZKUA 4R5PB 3PO5A 4LY7A 4FLUA 4OLBA 4FS1A 2DFEA 1RBUA 5KFEA 1RBVA 5E41A 3FFIA 3IGNA 1BQMA 4FJXA 4IG3A 1NHVA 1SL1A 5KGXA 2F8TA 1T8EA 2HHQA 4DFJA 5I42A 3E01A 3V9SA 3KJVB 3T5KA 2PZSA 3NF7A 4KB7A 4GW6A 2Y1IA 2R2UA 1OS5A 2VG5A 2O4GA 2IM0A 3OL9A 1S0OA 3E01B 4CEBA 3HP9A 3HVWA 1JL2A 3LP2A 4PQUA 1BQMB 2J6UA 4TSXA 3AA3A 4K4WA 3LP3A 3ULDA 2OPRB 4EEYA 3BGRB 3L2QA 5L1IA 1A5WA 1T94A 1QQCA 2I1RA 5KFXA 3WNHA 4NYZA 3MR6A 4CJ5A 3N6LA 1TKTB 2FBYA 3CFRA 1S1VA 5J2MA 4M3RA 1IKWA 4TQSA 3GV5B 5F8GA 3AO2A 3GILA 4U7CA 4EZ9A 4KREA 3ICLA 2QKBA 3D28A 4J9NA 2XI3A 1JX4A 2V9WA 4J9RA 5KT6A 4WFYA 3FQLA 3OYNA 1ZBUA 4YFUA 2GIQA 1FKPA 1NK5A 2A1RA 1CSJA 4ZPDA 4ZHRA 4HUFA 5HROA 2AQ4A 1SH2A 5KG1A 1N48A 5KFNA 4URSA 3KKRA 4ECSA 1KFSA 4FZXC 3ZSXA 1TK8A 4NLTA 1QS4A 4HUGA 1JLCB 3TVKA 4IQXA 3N6NA 2P5GA 1S1WB 1JXBA 1HYSA 3CJ3A 4CGGA 3DRPB 1JLAA 5J2NB 1S9EA 4IFYA 4AHUA 5KFGA 1TV6B 1ZETA 5KFRA 4QWEA 3HVTB 3V6DA 4FK4A 2OPRA 3O3GA 5KT2A 3LAMA 3SFUA 1Z26A 1U45A 4CFAA 1HQEB 2QE5A 2G8UA 4PA1A 5HLFA 3LALA 4B08A 1S6QB 3RB6A 2B5JB 1RYSA 3U3YA 1HYZA 4NLOA 1RBTA 3QETA 2O5DA 4QW8A 1T03B 3DYAA 3PHEA 1NKEA 5I42B 3KHLA 4N47A 3B6OA 4J9OA 3L2VA 1IKXA 3I0RB 3NHGA 2YHBA 4DG1B 5EWEA 4NLYA 2WOMA 3V6HA 3RB4A 2A1SA 5KFWA 4FK2A 4CJEA 5J2PA 1IH7A 3OL8A 5K14A 3NH0A 4EBDA 3UPFA 3BSAA 4N5SA 3ZT0A 3K59A 4O3PA 3K5LA 4GMJB 5CYMB 2B6AB 4FJKA 3ZT3A 1S6PA 4CHNA 5J2QA 1VK0A 2OZSA 4KRFA 4FVMA 1NJYA 4CK1A 3D45A 3ZSWA 4AHSA 3MAQA 3VQ4A 1L3VA 4FLWA 3AVHA 3CIZA 1NK8A 4IOBA 2XY8A 1TKTA 3M9MB 1HNVA 3VQDA 1NK9A 4DLEA 3KLHB 3SQ4A 1JIHA 2KFZA 4C8OA 4NLDA 1F21A 3T19A 4J9PA 3KK1B 3H5UA 1DTQB 4DFKA 4E19A 3CM5A 2UVRA 3K57A 4CHYA 3QGIA 3V4IA 4PUOB 1RTHB 4KHMA 3DRRB 3THVA 4FJ5A 3O3HA 4N76A 2Y1JA 4DF8A 4O3RA 2R8GA 1RTIB 1X9SA 1JXLA 5KTQA 1HYVA 4FM1A 3QEXA 4KTZA 2QV6A 1D9FA 2W9AA 3HK2A 4WE1B 1C0UB 5F9NA 3EPIA 1HPZA 4K4ZA 4RZRA 3LP0B 1GOAA 2C2DA 2HNDB 1LWCA 4N56A 5HP1B 3V81B 3Q8PB 4KHSA 2HMIB 4NLWA 1JLFA 4MK8A 1BQNA 4CHPA 1JLCA 2IBKA 2JEIA 1S4FA 2V0NA 3PR4A 4CK3A 3QZ7A 1HARA 4CEQA 3L3UA 2ZD1B 4O44B 1YTUA 4CEDA 2R8JA 3TAMA 4QWCA 4F4KA 3QINA 3RBEA 1RYRA 4YNQA 1RTDB 1LAWA 4FLXA 3SI8A 3TWHA 2P51A 3TR8A 2FLNA 4KV8A 1SV5A 3PX0A 2C28A 4FJ9A 4DU4A 4CFBA 5HRRA 4TY8A 1HMVA 2IJNA 2R2SA 2FVCA 2BRKA 1WSFA 5CYQA 4KHNA 3PVXA 2IM2A 1NJWA 3RR7A 4URGA 1CLQA 2IA6A 5KG7A 1EETA 2LSNA 1J5OA 1SUQA 4W5NA 2Q3SA 4M3ZA 2J6TA 3AVMA 2YNHB 1VSEA 4FZYA 1JLQB 4H4MA 3PW0A 3VQ7A 5DGBA 4GVMA 1TL3B 3LAKA 4KO0B 3U3GA 2X6SA 4Z4CA 3SQ0A 3WNFA 1UA0A 1LW2B 4OGCA 1ZTTA 5JUMA 1EP4B 3GIKA 1BL3A 2KTQA 4AH9A 3CWJA 2D0CA 2WTFA 4OGEA 3ZSRA 3KK2B 1TP7A 1HJRA 3TAEA 5J1EA 4LH5A 2JGUA 4BE2A 4IG3B 1MU2B 4KPYA 2RKIA 3E51A 3F73A 3UDLA 1C0TA 1K1QA 4ED7A 4ID5B 1UWBA 1T05B 1JLGB 3OYDA 1ZYQA 4ELTA 3NBPB 4NYNA 3H4DA 3BQ0A 1QHTA 4CE9A 2NUBA 3I0RA 4DTJA 2E9TA 4FM2A 4RW7A 1JKHA 3NCIA 3K58A 3AVCA 1WAJA 3DOKA 1FK9B 5KFVA 2JEGA 4BACA 3IRXA 4HCBA 3NE6A 3NL0A 5C25B 3OYLA 3HYFA 1S10A 4C8MA 2ATQA 3RWUA 2VA3A 3AVJA 3DLGB 3RMCA 5KFOA 4CF8A 4BWJA 3G6VA 3SZ2A 2CJQA 3D5MA 3MEGA 1FXXA 4ZPBA 3KHRA 3I5CA 1RNHA 4CIEA 1RCHA 3KTQA 4FJJA 3MECA 3ISND 1JXEA 2DTUA 2VG6A 4EP4A 4B9VA 1ZBHA 1JLBA 4J2EA 4CEZA 4G1QA 3MR2A 3SYZA 4IFVB 3NDKA 2YV0X 2ASDA 3SUQA 2AWZA 3TAQA 4CF9A 1CZ9A 1XI1A 2ASLA 2GUIA 4ZPAA 3RAXA 4E1MA 2G8IA 4ID5A 4DMNA 4DF4A 5L1LA 4KB1A 3GIMA 1QTMA 1D1UA 3EY1A 1FKOA 4B8AB 5KFLA 2IC3A 3L2UA 3P83D 4RW9A 1S1UA 2GC8A 2RPIA 3HXMA 4Q0BB 5FROA 4KFBA 4PWDA 1HNIB 1RILA 3MFIA 1U47A 2V4QA 4DWIA 4LSLA 3KLGA 4RNMA 3ITHA 1RT7B 1KCFA 2C2RA 2C22A 3H40A 3GV8B 1ASUA 1RT3B 4J9KA 4DSIA 2HHWA 3MXJA 3U6FA 4AHRA 4CHQA 3BGRA 4IG0A 2IAJB 4FBTA 3D0PA 5EUHA 3LP2B 5HBMB 3DLRA 5KFKA 1NK4A 1NK7A 1NHUA 4JS4A 4I2QB 5KG3A 5KFUA 1HQUB 4F4XA 4EO6A 3V1QA 3KK3B 1S9GB 3OYJA 3NGZA 3EZUA 4LSLB 2D3ZA 3QO9A 3AVAA 1BISA 4IR1A 4QPXA 4RNFA 4CEEA 4F3OA 5KFBA 1CXQA 1ASWA 4O3QA 2GBZA 2I5JA 3Q8QB 4RW6B 4FCYA 1S9GA 2D5RA 2UUWA 2XCAA 4EZ6A 2HHVA 1HQUA 4E7LA 3G86A 2IDOA 3TAMB 5KG0A 3CJ4A 4Z4IA 1TAQA 3HJFA 3I0SA 3VQAA 4CF2A 1BIUA 1KLMB 1RT5B 2OPQB 4NLGA 1C2PA 4EP5A 1I39A 4H4OB 1RT5A 2OPQA 4ZVFA 3KLIB 5KFYA 4FYDA 5HP1A 3T5LA 1LWCB 1NK0A 1VSIA 4O3NA 1ASVA 3HSTB 2OA8A 4Q8FA 1HPZB 3MECB 5C42B 3KD1E 3S3MA 2AU0A 2W9BB 5I3UA 3LP1B 3QYYA 2IJFA 4ED6A 5D3GA 4DTRA 4KHQA 2UVVA 2YHAA 5KFMA 2KZZA 1LWFB 1XR6A 3DI6B 2ITGA 3BSNA 4AHCA 5KFDA 4E89A 3OS2A 4MIAA 3BQ1A 3VQ9A 1KVBA 3QZ8A 5C25A 5C42A 4JV2A 3AVIA 2E4LA 5KI6A 3KLIA 3K5NA 3SJJA 1QE1B 2VG7B 3SCXA 4XPCA 4CJPA 3IN5A 1D9DA 2X78A 4UQGA 4OJRA 1TQLA 4E7IA 4I9QA 4B8CA 2RKIB 4CEOA 3KMQA 4ED1A 3IS9B 1D0EA 3ITHB 3M9OB 3AO5A 4ED3A 3RR8A 1KVAA 4JRPA 4CGJA 2EC0A 4KBIA 2RN2A 4ZVHA 4BDZA 1N56A 4ECYA 3PW2A 3HL8A 4J9LA 2BQ3A 3V9UA 4Z4EA 4N41A 3VN5A 1KFDA 3QIDA 4FW2A 4DS5A 1RT1B 4KO0A 1UOCA 1C1AA 3RRGA 3SQ1A 4YP3A 3PV8A 1RT2A 2XGPA 4KAZA 2GIRA 2OH2A 3CJ5A 4F4ZA 3QERA 1QE1A 3KKSA 1SUQB 2FVSA 2WRMA 2WOMB 4J9QA 3G10A 4DG1A 2YNIB 3F9KA 1GX6A 4W5RA 3SUOA 4CJLA 1RDBA 3AVKA 3DRSB 4YR3A 2EHGA 3V6KA 2OZMA 1BIZA 3C6TA 3MEDB 3CVKA 3JYTB 1IG9A 5C24A 4RW4A 3ZCMA 5KFHA 2W8LA 2IOCA 5KGWA 3KK3A 4ZP6A 5DQIA 5DG7A 2ATLA 4IDKB 2E9RX 1HRHA 4KB0A 5SWMA 4FJHA 5HBMA 1VRTB 2BGGA 2UVUA 3VQBA 3M8QA 4HVJA 1DTTA 3AVFA 4I7FB 2AX0A 4EBCA 3VQ8A 4EYIB 1JKHB 1RT3A 1U4BA 4DQIA 2IM1A 1T7PA 4WYLA 2AJQA 1TV6A 3SI6A 2D0BA 3B6PA 4CJUA 2JC0A 4IFVA 4Y2AA 3C94A 3G6XA 4F4YA 4MKBA 2O4IA 5J2NA 5KFPA 1UWBB 4F50A 4FK0A 4FLYA 1S1WA 1C0TB 3KIOA 3KLVA 5CYQB 4E7JA 3RB3A 2GV9A 4OLAA 4J2DA 4DL2A 3NMAA 4CJSA 4K4VA 2JC1A 4O4GB 4DTUA 1K6YA 4Z4GA 3QO9B 2FLPA 1JLEA 4ECVA 4CJ3A 3H2LA 3T5JA 2WONB 3EYZA 4DSKA 1L3SA 1RT6B 4DSEA 3M9NB 1EKEA 3MR5A 4FXDA 3C95A 4ELVA 4NLQA 3AVNA 2AGOA 3DLEA 4O3SA 2D7SA 3HHKA 3JSMA 3RTVA 1D8YA 5EWFA 1RDRA 4AHTA 4EO8A 1KLNA 3V6JA 4LQ3A 2AX1A 3LP0A 4B9UA 1JLBB 2DPIA 1JLQA 2BQRA 1JLGA 4K4XA 1WAFA 4CF1A 1XWLA 2HAIA 4ID1A 4CGFA 1NKCA 1TK5A 4XPEA 3KLHA 3OYHA 3PO4A 2ASJA 1S0NA 3UR0A 3LDSA 4NLPA 2R8HA 1WNSA 1SL2A 1S1XA 4PQUB 3KMSA 4BDYA 1JL1A 2CKWA 4B9MA 4M3WA 1Q9YA 3NFAA 1CZBA 3NAIA 2KQ2A 4MFBB 1C0MA 2D41A 1TVRB 3H08A 2W8KA 4G3IA 2J6SA 3NGIA 4OPJA 1TKZA 1KHWA 3VA0A 1EP4A 1XR5A 3KJVA 4NLSA 2RF2A 1TL1B 3FQKA 4KKOA 1K1SA 2HHXA 4JS5A 4MIBA 1KSPA 2WB4A 1WSIA 4MK7A 4IBNA 3QGGA 4DTXA 5SZTA 3UQSA 3V81A 1J5OB 5DQGA 2D0AA 3IGVA 3P5JA 1RT7A 4TYBA 4QWAA 3KLGB 4J9MA 1IKXB 4FS2A 4Y1DA 3A2FA 3IAYA 2ZE2B 4RU9A 2YNFA 4RUAA 2WK4A 2G8KA 3AO4A 3KLFB 5KG2A 1HMVB 3OHAA 2FVQA 1SKWA 3HPOA 1SV5B 3OSPA 1RBRA 1FKOB 3L3VA 3ISNC 4M41A 1J54A 2FLLA 3PW7A 2OPPA 2XI2A 4O44A 2OPSB 4CJRA 3T1AA 2ILZA 4HKQA 3ZSQA 4RW8A 3DM2A 5FDLB 4AHVA 3OYIA 1JLFB 4ZTJA 4KSEB 4L8RB 4WXWA 1EETB 3DDKA 3NBPA 3SUPA 1HYSB 2VG6B 3H4BA 4CK2A 4RNNA 1J9AA 4WFZA 4LSNA 1J53A 4DTNA 1VSJA 4CJKA 1VSKA 4BE0A 2OPSA 2OPPB 4CEAA 2B4JA 1NK6A 1RTDA 2YKNA 4NZ0A 3AVLA 2F8SA 4DQQA 1S6PB 4E3SA 3O4NA 1LW2A 1RBSA 5T14A 5FRMA 4K8ZA 4NLVA 2W7PA 1KVCA 1WSGA 1VSMA 2VWJA 1W9HA 5EU7A 2R7YA 3IG1A 4DS4A 5KG4A 3VQQA 2Z1IA 3NAHA 4M3TA 4CJWA 3ZT2A 4B9LA 4TQRA 1XHXA 2HVHA 3GYNA 1VSHA 3DRPA 5DQHA 3Q8RB 5KFJA 2YKMA 4DSLA 4DSJA 4F8RA 3V1OA 3CFOA 1QSYA 3VQ6A 1S1TA 2HNZB 1RDDA 2BANB 4CIGA 5JS1A 4X2BA 2W7OA 5KG6A 3HVRA 4DQRA 2R2RA 5HRPA 1C1CB 1G15A 3ZT4A 3S3OA 4C8KA 3CO9A 2FJWA 5KFIA 4CFCA 1XHZA 5F8MA 4HUEA 1BGXT 2ZE2A 2IM3A 5C5JA 4F4WA 5EWGA 1S1VB 4HYKA 1BHLA 3GQCA 4LQ9A 2W9CB 2YNHA 4RG8A 3PX6A 5J2PB 2ZQBA 4IFYB 2EX3A 3G6YA 3L8BA 4YR2A 3HM9A 2RF2B 1Z25A 3TI0A 2ILYA 1LWEA 4RW8B 2G8WA 4ED2A 1N4LA 3MR3A 3SV3A 5F8NA 4Z4FA 2XY6A 5KT5A 4DQPA 5J2QB 4XIUA 4QW9A 4R0EA 2QKKA 2B5JA 2JLEA 4MFBA 2YKNB 3BREA 4K8XA 4Q44A 3V4IB 4PUOA 1HQEA 3QESA 3M8SA 3CJ0A 4TXSA 1NOYA 4BWMA 2RDJA 1WN7A 3AO3A 5DG8A 3DMJB 4QWDA 1GOBA 2BQUA 3BSCA 1IKWB 4U6PA 2V4RA 2XC9A 1Y97A 1RA6A 1RDCA 3DLBA 1C0UA 4M3UA 1I6JA 4OVLA 3ZSYA 3Q8SB 3OYAA 3RAQA 4FJLA 1VRTA 1W0HA 4IDKA 3OLAA 1S6QA 4ZVEA 3DOLA 4Y1CA 4ZP9A 1X9MA 4O55A 1S97A 1S0MA 1RTHA 1ZBIA 1YVFA 4DTPA 5F8JA 4O5BA 5KRSA 1TVRA 2QK9A 4NLXA 1U49A 2XY5A 1LWEB 4CHZA 5KRTA 3EPGA 3DRSA 2BANA 1S1TB 4EBEA 1IM4A 2HHSA 4J9SA 4QWBA 3PX4A 4C8LA 2X6NA 1DLOA 4NLUA 3H5YA 1B9DA 3RMBA 4KE5A 5F8IA 1VSFA 3QIOA 2PYJA 4I7FA 4E7HA 4KKOB 1NOZA 3LWMA 4URQU 4ZTFA 1TL1A 5KFQA 4GC7A 3KNAA 3SNNA 3DYAB 1N5YB 2HHUA 3VQCA 1FKPB 2P5OA 1TKZB 1TAUA 1QUVA 5JS2A 4M3XA 5HRNA 3QNOA 2DFFA 1XC9A 5FRNA 2R8KA 1MMLA 4XO0A 5HLFB 2JEFA 3S3NA 3CM6A 5L1KA 1N5YA 3C6TB 4ECRA 4FZZA 3OYGA 5CYMA 4ZP8A 1S1XB 2IS3A 3O4QA 3HVTA 3V6DB 4CEFA 1QSSA 2FVRA 4CGIA 2KW4A 4DEZA 4Q43A 4ZP7A 1JLAB 5JXSA 3JSMB 3P1GA 5DK5A 3FSIA 4Y3CA 3QNNA 1Q8IA 1L5UA 1C6VA 3NKYA 5KG5A 4DLGA 2XO7A 4OKEA 2VG5B 1EX4A 2WONA 4M94A 3MEEB 1BCMA 2HNYB 5KT4A 4DFPA 4ZVGA 4O4GA 1O1WA 2FVPA 2BRLA 3RBDA 5C24B 3FFIB 2JEJA 3BJYA 4NCAA 2BR0A 1TKXB 1A5VA 4WFXA 3UIQA 4KHUA 4IRCA 4Z4HA 3H59A 1D5AA 5J2MB 3BDPA 1S5JA 1BI4B 4FM0A 4Z0UA 4ECTA 3SFGA 1WSEA 3PJWA 1S9EB 4H8KA 4H4OA 3PZPA 3DMJA 4WZQA 1DTTB 1RT2B 4CF0A 3TABA 3AVGA 1W25A 4DU1A 2PYLA 5HROB 3ASMA 3BQ2A 4CJQA 4ZMMA 4ZHRB 1S48A 3O3FA 2XWYA 2YNGB 4IKAA 4CJVA 4Q45A 3TAFA 1REVA 2AGQA 1I3AA 4I9LA 4FBUA 3S9HA 3DI6A 3RRHA 4RUCA 4J2AA 5DG9A 5D3GB 3PW5A 4NCGA 2FBXA 4DTOA 1R0AA 3CDWA 3IS9A 2E6LA 2F96A 2BE2B 3M8RA 3NH1A 4ECXA 4F2SA 3RMDA 4R5PA 5CZ1A 2ALZA 4HCCA 3MXMA 4Y34A 4O0JA 3PW4A 3I8DA 1L3UA 3ZSVA 3AV9A 3QIPA 4ZPCA 2E6MA 4MH8A 1SH0A 3RMAA 1IO2A 3OSNA 3HVAA 3V9WA 1RT6A 3L2RA 4B9TA 4KI4A 3ZT1A 1RTJB 1C1BB 1JLEB 2E9ZA 4DL4A 2D3UA 3TQ1A 2ETJA 2DFHA 4Q0BA 4FLVA 3V9XA 3QLHA 2HNZA 1A5XA 1ZBLA 3T3FA 1NJXA 3LWLA 1QAJA 2YKMB 4E1NA 1VRUB 2XCPA 3LP1A 1X1PA 1XR7A 3DLHA 4CGHA 4PY5A 4ECZA 3GIJA 4MQ3A 4O0IA 3OS1A 5EDWA 4B3OA 1B92A 5F9LA 3SQ2A 3MXIA 3SPYA 4DL3A 3CDEA 3IG1B 2IAJA 4IG0B 3TANA 1RT1A 1SH3A 4CIFA 4K4UA 2HHTA 2HWIA 3M8PB 4K4SA 1BI4A 3CDUA 1LV5A 4C8NA 4Q5VA 3OYEA 2G8VA 4F2RA 4M45A 3CG7A 5F8LA 1QAIA 5T7BA 1RAJA 3G0ZA 4RW4B 4KAIA 4QOZB 3OYFA 2FJXA 2PY5A 4KI6A 4DTSA 4BDPA 3OYMA 5I3UB 3T5HA 4ECQA 3MEEA 4O4RA 3DLKB 1IKVA 3NH2A 5KFFA 3M8PA 4I2PA 3H98A 4ED8A 1LW0B 3OYCA 2HWHA 3DM2B 3QEWA 3AVBA 3K5MA 4TY9A 1KLMA 3LPTA 3FDSA 4OL8A 4DTMA 2OYQA 2HB5A 4FJ8A 1S9FA 1RA7A 3K5OA 3NF9A 4OKJA 4NYFA 3PUFA 3N6MA 4W5TA 1RDAA 3C6UA 4NLRA 1RT4B 3NAEA 4K4YA 5DGAA 3MEGB 4DL6A 4CGDA 1WSJA 1U48A 3KLFA 3DLGA 4F3TA 1WLJA 1SKSA 3MEDA 1HNIA 2VA2A 3NGYA 2YNFB 3EZ5A 4HTUA 1VSDA 3NF6A 3KD5E 2UUTA 5L1JA 1BCOA 2YNIA 5CY4A 5KT7A 1NNDA 1TKDA 4ICLA 1WSHA 3IRXB 4YMEA 2FJVA 3OL7A 4FW1A 4NCBA 3I0SB 4WZMA 4MK9A 4OPKA 2VG7A 3KLEA 4CJFA 3KHHA 2XY7A 2HVIA 4ICLB 1GX5A 1IKYA 4R8UA 2XHBA 1R0AB 4CERA 3QLHB 5J1EB 4KHRA 5L9XA 4B9SA 3WNEA 4J2BA 4IRDA 4RW9B 1UAXA 1GOCA 1TK0A 3VQEA 3KHGA 2YNGA 2R8IA 1KHVA 3KLEB 2G8HA 1SKRA 5DMRA 5KFZA 3NF8A 1TL3A 3AA5X 3K2PA 3GIIA
chains in the Genus database with same CATH superfamily
3QRQA 3R27A 2F65A 4CJTA 4EYHB 4A8MP 1RAHB 4IH6A 4DCHA 4ECWA 3MF5A 4F3QA 4FF1A 4YUDA 2YKOA 2I5JB 1RBLA 4ZOSA 1RTIA 2WCXA 2IC3B 2MEWA 3ZTRA 3DRRA 4WYWA 3OFFA 1RHKB 3BZQA 5A0YB 2Z1JA 3GE1A 3FCWA 2P9KA 2UXCF 4H54A 1VSLA 2W42A 2N82B 1DTQA 4YQWA 3PY8A 3D68A 3IC1A 3M2RB 2HLUA 1CJVB 1RZMA 1M1HA 4L3QA 4DV0F 4CESA 1VQ7N 1TKXA 3DXMB 4DR1F 4RW6A 4NASA 3BKUA 4IR9A 4IKFA 1AA1B 4P74A 5ETKA 5KT3A 1YT3A 3I5BA 3UVJA 4FYWB 4C3KA 3BZCA 3SV4A 4BE1A 4WPAA 4JI5K 5E3PA 1C1CA 4KH1B 3E9LA 4O3OA 1FJGF 3ILOA 4LH4A 3DXBA 1Q7YO 3IWXA 3QDKA 4GMKA 4CBXA 4TLRA 2MZSA 3Q83A 2WSFC 4CP5A 3O80A 5AQJA 5GADI 2AGPA 4H0YB 5HRSA 4I2PB 5FLXU 1L3TA 5HSPA 2CWKA 2KFNA 2OKQA 3POTB 2HF4A 2GHVC 1ITGA 2JVOA 1CPZA 1RTJA 1U2VA 2ZHAA 4FLTA 3THWB 2EG1A 3P4UB 1NDPA 3D6TB 2DT9A 3H5SA 4CLKA 4QCLA 4K4TA 2AJ4A 1XEZA 1CZAN 1HR0F 1X31C 3MFHA 3OA9A 2LMIA 4C97A 5BREA 3D0IE 4K2XA 2Z1HA 5GAHI 5K14B 3QGHA 1KWMA 3CYMA 3AD9C 3EGNA 1IN0A 4OX6A 1RDUA 2BDPA 4KHYA 4ZN3A 2M3DA 1VK3A 4CCHA 1FD8A 3HT3A 3HPGA 3C7NB 3CETA 5FDLA 1KVIA 3VAHA 4NX9A 2VCPA 2F4FA 3HPHA 3C14B 5A6WA 2C2EA 5HL7L 3PG9A 1TGOA 2BW7A 3VQPA 4DOZA 2VFVA 4GC6A 4IEEA 4Z7CA 2BZ2A 3MCAB 3T1YF 3KK1A 2B6AA 4JHDA 3QMLA 3AA2A 2F1FA 1VQMN 1YZ6A 4LF6F 3HKWA 4MKAA 1UVKA 1VC0A 5KFCA 4R5PB 2GJIA 4P2FA 1IV0A 3D6RA 1RBUA 2A0FB 5E41A 1YJWS 3FFIA 3IGNA 3THPA 5KGXA 4ES3A 1T8EA 2HHQA 1IJEB 3E8OA 2FSJA 4PG8A 3AY9A 4J7CA 2VODA 4KB7A 4GW6A 3MXHP 2HVEA 2VG5A 2O4GA 4FDFA 3UN2A 3OL9A 3LPEA 2CNLB 3UWTA 4ZVSB 4CEBA 4DR5K 2MJNA 1I94F 3AA3A 2Q0RA 4EEYA 3ULDA 3BGRB 1BD6A 3BV8A 3EEQA 4WYBA 2BE7D 4UW2A 1B0VA 2Q0UA 1RHQB 3WNHA 2HHHJ 2J7UA 2FBYA 1S1VA 4WQ4C 4TQSA 3W0LA 4I67A 1FJGK 4P7TA 3ICLA 3SSQA 5A2QY 4J9NA 2ZEJA 3HM8A 3CNQP 2CQBA 2FHJA 3HSGA 1X4GA 4YFUA 2LYVA 3AAPA 5A8WA 3T6JA 1CSJA 3ATVA 1WI8A 3MCOA 4PEOA 2DNLA 1Q8BA 3KKRA 1KFSA 1VQPS 1TK8A 4NLTA 1QM9A 1JLCB 2GO9A 3HZ6A 3DRPB 4DUZJ 1JLAA 5J2NB 1S9EA 1VR6A 2HF3A 2A3JA 2P9IB 5IWAJ 4MDAA 4IFYA 4K5RA 2CQ0A 1OIAA 1X4FA 3MN9A 1VQ5S 4TKTA 2HVZA 4H5VA 3HVTB 1VQLN 5IT9U 1U1MA 1DT9A 4FK4A 4RO0A 4AM7A 3LAMA 3SFUA 2ZOGA 4CFAA 4DR5J 2PI5A 2SXLA 1WC0A 1AUDA 2G8UA 2YCHA 2KVQE 2FB0A 5HLFA 1S6QB 2BTFA 1FE4A 5C12A 1O0PA 1RBTA 6FDRA 2HIYA 4QW8A 2XQCA 3KHLA 2RMLA 1MWQA 1N33K 3SBGA 1R31A 4A59A 1HHSA 3MM7A 5KFWA 4FK2A 2WFBA 4CJEA 5J2PA 1IH7A 1BU6O 4PYDA 4EBDA 1Q18A 1RQ0A 3ZT0A 1F3VA 4JI8J 5CYMB 4TLQA 3P38A 3CD6N 3WBZA 3F9MA 5C2DA 5KPTA 5J2QA 1VK8A 3HOSA 3PXGa 3TW0A 4PKGA 2P6TA 1IJFB 5FPMA 2OHDA 2UUBK 4X62J 5KOXA 3M9MB 4V19S 3SQ4A 2H1YA 3UDEA 3ILJA 2B7CB 4YB7A 4DUTA 1OH6A 4C8OA 3R8YA 4BBYA 4J9PA 2W41A 5GVQA 3H5UA 1WELA 1DTQB 3P5TL 3CC2S 5F2RA 3M5RA 2HFOA 2O8DA 2ZUGA 2AJ0A 4AQYJ 2UVRA 2VHGA 1CBKA 3EVWA 3LQVA 3F2KA 4ED5A 4M7XA 4DX5A 3DRRB 2PA8D 1D09B 2NZTA 2DNMA 1BQXA 4DF8A 3MMAB 3CCQS 4LFBJ 1RTIB 3UN5A 1HYVA 3CJTA 3QEXA 2P9NB 2HRUA 3VVUA 1D9FA 1K44A 1S12A 4BQLA 3EPIA 4KGVB 4RZRA 2MKSA 2QL7B 2C2DA 1SJFA 2P9GA 2NLXA 4DR4K 1Q5YA 3QZ7A 1HARA 4OZNA 4C0BA 4CEDA 2DNQA 2BJ1A 3MM8A 3D3BJ 2ZJQQ 1URNA 3ET6B 3EZOA 1RTDB 3M05A 1LAWA 1VQ6N 2FLNA 1SV5A 3ZX2A 4FJ9A 4DU4A 4TY8A 5L46A 2B9WA 4K2JA 1SAZA 3PVXA 2CVEA 1NJWA 3J80Y 1ICEB 5AQZA 5M1FA 1YG0A 2QW9A 1NDLA 2WVEA 1U2FA 2NNWA 2LSNA 4HACB 2Z57B 4USTA 3CJBA 2K8GA 4M3ZA 4DUZF 1OKJA 1RWOB 1U1PA 4DUYF 4IOAQ 2HGMA 4Z7YA 1ATNA 5M1QA 1V6HA 1WDTA 4Z4CA 1NEEA 4DR7J 3GP9A 4DPUA 2RU3A 2ACYA 1ZTTA 5GAEU 4X4PA 4C9DA 4U67Q 2NXEA 1EP4B 3H6EA 3SDEB 3KK7A 3W60A 4DR6J 1TFYA 3SK3A 1SQEA 2AIRB 2ZWHA 2PSZA 1NG9A 3DHXA 2JOQA 1U1LA 3NGRA 3TAEA 2JGUA 5DO2A 1N32F 3E51A 4B3TF 1K1QA 1OY6A 2Y8YA 4ID5B 1PBAA 1JLGB 3OYDA 4ELTA 3T9ZA 3H4DA 4X4UA 4CE9A 1HI1A 4LF4F 2NUBA 2E9TA 1ZM3A 2C2MB 1MMDA 1YLXA 3ZZ0A 1FK9B 5KFVA 4PPZA 4HTIA 4HCBA 5B0CA 3NE6A 3EVMA 5C25B 1S10A 3BYRA 2R7VA 5LMUF 2VA3A 2V4JA 4DBQA 5ETPA 3G6VA 2CJQA 1FXXA 4ZPBA 1AW0A 4CIEA 4ZVQB 5M1OA 1JXEA 2BA9A 4EP4A 3MM9A 3Q8YA 1H2VZ 2KB2A 1RLDA 2PO4A 4CEZA 4G1QA 3NDKA 2RJZA 2W2OP 2B9XA 2MKIA 2FHJD 3SUQA 1YVNA 3OTBA 3JAMY 3TAQA 4F7VA 2CGKA 4CF9A 2DGTA 1CZ9A 1XI1A 4HR2A 4FWSA 2R7SA 2QYGA 4DMNA 5L1LA 2Y0SD 1NGHA 2CQDA 3AHPA 1D1UA 2LVWA 3S7RA 3P83D 1DQAA 4ATNA 1IBLK 2RPIA 3MUTP 1V4SA 1GK8A 2XEXA 1HLUA 1HNIB 4ANDA 5AQRA 1U47A 3N01A 1S57A 4LSLA 4MMOA 4LF7K 5L9NA 3KLGA 1XNQK 1KCFA 1RT7B 5IS2A 1YJNS 3GV8B 4BRQA 5LMNK 1VI7A 1WEXA 2AJFE 3NMRA 4CHQA 3BGRA 2IAJB 4I0WA 3KFWX 2XHWA 5HBMB 3HBTA 5HJXA 4AE5A 5F1XA 3CO0P 5KG3A 1YITS 2E5LF 4EO6A 5AJ3F 4GY2B 5E7OB 1YJ9N 3TZXA 2IVYA 2HZCA 3G8QA 4UOFA 2MLZA 3CCSN 4IR1A 4NPOA 3O4WA 4CEEA 3A3NB 3U1NA 3FFKB 4WIIA 2K1RB 5LMUJ 2JFDA 5GIPA 1VJWA 2PAVA 1TFWA 2J0XA 4FCYA 2D5RA 5HQMA 2XCAA 4EZ6A 1VLYA 1GNKA 3G86A 5E3CA 3TAMB 1YGYA 2JFKA 4WWSA 2QWRA 1FXLA 4Z4IA 2NXCA 3HJFA 3I0SA 3VQAA 1TYQB 1KLMB 1VQ4S 4NLGA 4DV4F 4EP5A 4YOYA 4H4OB 2RDDA 5KQ8A 3CD5A 1H2TZ 3T5LA 1VSIA 3HSTB 2HVDA 1WACA 4FVUA 4WFAQ 3C3LA 4IJAA 2AU0A 3K8VA 1P8ZA 5D3GA 3ENQA 4KHQA 4OJ3A 2UVVA 2YHAA 2KZZA 1FRXA 2V69A 1SIWB 5ETSA 3DU6A 4AHCA 5MAOA 3UD4P 3PSFA 2AYBA 3BQ1A 3VQ9A 3A1YG 2C42A 5LJ5Y 1Q8KA 4QYZJ 2NCKL 3HSZA 2E5LJ 2GMLA 4JV2A 5DDQC 4JI3K 3R7SB 4D3GA 4UTGA 1YRUA 2R42A 3CPWM 1DURA 4Y2KA 3SCXA 4YB5A 4CJPA 5E3RA 2AW0A 2MKKA 2NREA 4PHTX 1Y0HA 3CF5Q 2X78A 4E7IA 3S41A 1EHWA 4I9QA 4Y0WA 2NRHA 4L3KA 3HSJA 1FDNA 3RR8A 2VFRA 4IXCA 1NZAA 4CGJA 1WJ9A 1N56A 2MLYA 1MSWD 2O01C 2IPOB 3PW2A 2P9LB 4J9LA 3L09A 2QZ8A 3IBWA 2LLZA 1PKUA 2POKA 1WC6A 3U9ZA 2O8BB 3QIDA 4CZLA 3J8AA 4CZGA 4KO0A 2FJDB 1UOCA 1C1AA 4ZVPB 4H5WA 5K8NA 3PV8A 3JXUA 4LFCK 1M1GA 4F4ZA 1IBLF 1QE1A 4ILRA 2WRMA 2WOMB 1Y9OA 2GW8A 5E5NA 2EKYA 1GX6A 4OQJA 4E1JA 3AVKA 3DRSB 3BF4A 1BIZA 3V2UC 4CM0A 1K9MO 2J9DE 5LMNF 2M8DB 4RW4A 4JKAA 2AYMA 3TNVA 4OJGA 2ZH6A 5KGWA 3KK3A 4C8YA 2DY9A 4ANCA 5DQIA 4IDKB 2KRBA 2D3O1 1NAQA 2E5LK 2W1BA 3AVFA 3OTOJ 3TVZA 2EFPA 2LU1A 1RB0A 4EYIB 1RT3A 5J1PA 2IM1A 4JV5J 1TV6A 5GAHP 2D0BA 4CJUA 1FX4A 2DHXA 4F25A 4Y2AA 3G6XA 3U02A 1D8ZA 4F50A 4FK0A 3FBCA 3MTJA 3NNHA 3RB3A 4J2DA 1HBNA 3FEYB 1MWYA 4DL2A 1W97L 1W2BR 2UU9J 3CGIA 1VMBA 3QO9B 2FLPA 1GXUA 2F3JA 1XTZA 5K5MA 5GINA 1PAUB 3H2LA 4OV6A 1Q81T 2VBXA 3T5JA 1N5TA 1L3SA 2O8EA 1RT6B 2PDAA 2D74B 3M9NB 1EKEA 4BRAA 3AVNA 4FOEA 2OTJN 5A8RA 1XNRK 5RUBA 5M1NA 1D8YA 1RDRA 4AHTA 2AX1A 4YDUC 2F8HA 4B9UA 3TZZA 2BQRA 1WAFA 3M8ZA 3K5PA 3TSPA 4QU6A 4H5TA 4CGFA 3KLHA 1R8HA 2LA4A 2XS5A 4WKRA 3OYHA 3UR0A 1WNSA 5LL6d 3HD2A 4LC9B 3IR6B 2WVCA 3DAWA 4M5KA 1OVYA 4M3WA 3NFAA 1CZBA 3NAIA 1JCFA 4NWBA 2D41A 1TVRB 3X3UA 1JJ2M 3Q86A 2O8DB 5AXMA 1RI7A 3ET6A 2CAJA 4Y00A 2RF2A 1TL1B 3OPKA 1RP5A 4WBFA 4B3SF 3LUYA 3U4LA 4RWXA 1D3WA 3ENWA 4KKOA 3OR1A 4JS5A 4MIBA 1WSIA 3QGGA 1H6KX 1W2BM 1YIJS 1J5OB 5DQGA 2D0AA 2FSNA 2EBGA 4TYBA 4QWAA 1IKXB 3AQOA 1VS3A 3IAYA 2V68A 2YNFA 2F63A 2BE9B 4JOUA 2G8KA 1HQ2A 2ZJRL 1SKWA 2X1BA 3HPOA 3U1LA 3OSPA 1LOUA 4USMA 1RBRA 1FKOB 4L76A 3CMAN 1J54A 4LFCF 2FLLA 2VL1A 8RUCA 3ZSQA 3IR5B 2HGNA 3SBMA 2IA0A 4EI2A 4LFAJ 1JJHA 1P6TA 4AHVA 3J7YP 4KHPK 4WXWA 4DR7K 1EETB 3SUPA 3UCZP 5A8KA 3SMPA 1HYSB 2VG6B 3M32B 5EGYA 1PJ6A 2DR8A 3BBBA 2OPSA 4DV6J 1J5EJ 4I6AA 2FIUA 4NZ0A 4QBUA 2F8SA 2D0OA 4WP3A 2EWSA 4LRAA 2KM8C 2DGOA 6AT1B 1WB9A 1J5EF 3N0VA 5FRMA 4MJKA 2J0SD 1WSGA 3PEJA 1VSMA 2H5IB 5KG4A 4DZDA 4M3TA 3ZT2A 4CO2A 4DCOB 2B7BB 3IAS9 3GYNA 1VSHA 3DRPA 3Q8RB 2EW9A 3MM7B 2J0QD 3VGLA 4TU7A 4G1IA 4GV9A 2CQCA 3MDQA 4CIGA 2AEMA 1FRKA 5FLXO 3KUEA 4KGMA 3NNAA 2DXEA 5D77A 4FWQA 2CQPA 1H1VA 5I3PA 4LFBK 2BJDA 5DDPC 4JBCA 4P72A 4A8XA 4CD1A 1HWKA 1X9JA 4CFCA 1XHZA 2E1CA 1FWLA 1BGXT 5E26A 4F4WA 4WFBL 3CCMN 5AQMA 2IIHA 1S1VB 2C3YA 2V2KA 2BOAA 2Q43A 4KGXB 3GQCA 1CC8A 2UUAK 2W9CB 2YNHA 1WKLA 2JVRA 1AXQA 3ZTOA 3BH6B 1F1BB 5E2QA 4IFYB 2YPYA 1UZHA 3G6ES 2EX3A 4MTPA 4I1TA 3AQPA 2ILYA 3GONA 2ZOMA 2G8WA 1W26A 3MR3A 3NGKA 1U02A 2RE1A 5F8NA 5C15A 4Z4FA 1FTCA 2XY6A 5ETLA 4DQPA 3MCPA 4XIUA 4QW9A 1G2EA 4A8OA 2QEXN 2G0IA 2JLEA 2YKNB 4PUOA 3VGTA 3SMZA 2F4VF 4YOUA 4BWMA 2Y8WA 5IFMA 2UXBJ 5DG8A 3DMJB 4V19X 2VQEJ 8AT1B 2QMXA 4QWDA 4N77A 2HK3A 3BSCA 3T41A 1G99A 3AAWB 3CD7A 2ROEA 5H9EK 4DV6K 5BYQA 2EFOA 4P2SA 1RDCA 1C0UA 2WZ1A 3ZSYA 3A5LC 2CVIA 1BC6A 3RUBL 3OYAA 3M30B 3MOZA 1LXNA 1DY3A 2Z0GA 4OYZA 2MSSA 3RAQA 3US5A 2MXYA 2MHEA 3OLAA 4OYXA 4PXEA 4C0OC 1X9MA 3SQOP 1VQ4N 1ZBIA 1KONA 1YVFA 4IQMA 3AY0A 5A2QO 2GQQA 4DR7F 3UR3C 3EE8A 2Q3PA 2XLIA 2D69A 1KD1O 5LM7E 2FZGB 2RB7A 3J81O 2HAFA 3PM9A 1IM4A 2GELA 1F5AA 5HMXA 2X6NA 1DLOA 3CCSS 4KE5A 1ZPWX 2PYJA 4URQU 4ZTFA 3H2UB 2CFXA 5KFQA 1YJ9S 4JI0K 1N5YB 1S22A 2HHUA 4UUWA 1YSJA 4CNYA 1QUVA 1NMDA 3WXLA 2DFFA 3ZTPA 1MMLA 4XO0A 2VONA 1YJUA 3S3NA 3MPWA 3C6TB 1QAXA 1YUWA 3JAMU 4P6QA 1FDDA 3GFZA 4UZCA 1UCNA 2QA1A 5CZXA 2FVRA 3GE9A 3VZHA 4CGIA 2KW4A 4Q43A 5DM6Q 1Y5NB 4FKXA 3Q7CA 2QWLA 4Y3CA 1B70B 1UAWA 5GMDA 4JI6F 2QMUB 3GIRA 4LFBF 1C6VA 1ZPVA 5ETOA 2WONA 2NSCA 1KAYA 3ZZYA 4M94A 1X5TA 1U7LA 2BJ8A 4DFPA 2GGPB 1O1WA 1YHQS 2H3EB 2GTDA 1TKXB 3DXMA 4WFXA 4KHUA 4IRCA 2EFNA 1LXJA 2PEBA 2V63A 4FM0A 1UZDA 4Z0UA 4ECTA 3SFGA 2CG8A 3GDQA 3J7Z5 2KI2A 1HBMB 1I94J 5D8HB 4LF5F 3I82A 4CF0A 3WT0A 1W25A 5IM0A 1JK9B 1XJWB 5HROB 3IXQA 1GTHA 2G0JA 5IV4A 2F4VK 1YBUA 5A0YA 3JTNA 3T1YK 3DLJA 3MD1A 4IKAA 1EO1A 4JK9A 1Y3JA 3TAFA 2AGQA 1WHXA 1QTNB 3RRHA 2H5EA 4DV6F 4LVNP 4FOIA 3RW6A 5F3ZA 1SC6A 3ZXWA 2Q31A 2FBXA 2O3DA 3LF0A 3UKUB 3FCVA 2MQQA 2FGOA 3KNGA 5D4OA 2F96A 1FE0A 5DZ6A 5EN1A 3NH1A 4ECXA 1XBWA 2A40A 3MXMA 2O8CB 4O0JA 2Z58B 4DV4J 2HQGA 3PW4A 3HF5A 3I9V9 2C3MA 5EX0A 1KQGB 2IDEA 4MH8A 1IO2A 2DO0A 3OSNA 4C1NI 3GR1A 3SCLE 3L2RA 2UUCJ 4B9TA 5HATA 2IVOA 3FEZA 4MO5A 4DR5F 3TQ1A 2ETJA 2DFHA 4CI6A 2OSQA 1UFKA 2HS3A 2HYIB 2VGNA 3QLHA 2XMAA 3T3FA 3LWLA 2YKMB 1NMNA 1X1PA 4JI0F 5EDWA 4YDUA 1G4CA 2DJWA 1VQ6S 3SQ2A 3IG1B 5IV3A 1RT1A 1SH3A 3CJ8A 3ENAA 4B3RJ 4USUA 3UKRA 5AQXA 1BI4A 4L6V3 3DRYA 5AQWA 4Q5VA 3P45B 1U2CA 4FN5A 2UXDK 2G8VA 4M45A 3MMBB 5F8LA 3G0ZA 1RAEB 2ZNZA 3EDRB 3KJFB 2BV3A 4USHA 2FJXA 1NPRA 2ZM6F 1IR2A 4ECQA 7FD1A 1X8DA 1G6BA 5KFFA 3FSYA 5EHHA 3H98A 3CIPA 3UKRB 1OY9A 4CDIA 3T1HJ 3AVBA 2E5GA 4PL7A 3LPTA 5IXUA 2RVJA 2HB5A 4DHVA 3OUYB 1S9FA 4FJ8A 3W61A 2XTJP 3NF9A 3THXA 3JQKA 4Y2IA 3PUFA 2RQMA 4Q2MA 4CO1A 3H3NO 5H9FJ 2DR7A 1PAEX 5DGAA 2I8EA 2CPYA 3MCSA 3EWGA 3TSUA 2GHWA 2W2NP 2DNRA 1WLJA 2VA2A 4LF1A 3NGYA 1WKJA 4C3MA 2V94A 1BCOA 4CZJA 2XSJA 3E9PA 4QR0A 1TKDA 3IRXB 4YMEA 2FJVA 4JV5F 4FW1A 3D54A 4NCBA 4WZMA 3D1OA 4B17A 2YI1A 7AT1B 2EFQA 3CD6S 2VG7A 3UCUP 1BO5O 4B3RK 2DGSA 1OWXA 1GX5A 2XM3A 1IKYA 4U95A 2XHBA 4OHZA 2DVIA 4FSVA 4KHRA 2G2OA 5GADU 1M5KC 2P9LA 4UY8O 4PG7A 2E1RA 1UAXA 1GOCA 2G4BA 4CLLA 4I6YA 3C16A 1Q81O 3WX4A 3OVBA 3KLEB 1B64A 2G8HA 2DK2A 3NF8A 2E88A 4A8YA 3IAM9 4OPHA 2DH8A 4LF8F 3JS6A 2A6AA 1BQNB 4FWKA 2A42A 4JI4J 4RW7B 1CJKA 2JDJA 2GMHA 2XS2A 5AQPA 3OL6A 4OKKA 4B3OB 2B43A 1ELOA 3BZKA 1OYEA 2Q1NA 3SUNA 1N6QB 3AARA 1MU2A 1B4SA 3RB0A 1YJ7A 3OLBA 3CJ2A 2UVWA 1DGKN 2HG4A 1DKGD 2P9UA 1VQPN 3I31A 4RNHA 2C1EB 4X4NA 3PJXA 3BSOA 2H5JB 4BC2A 3CCVN 4AILC 3DOMA 4JV0A 4ELUA 3N28A 4F4AA 1V3RA 3HJVA 3D2FA 2B51A 4F04B 3ID8A 4LF7J 3B8AX 4OX9K 4DV1F 1VLOA 4HHHA 1IKVB 2J8AA 4MAKA 7FDRA 4CIOA 4FLZA 1DQ8A 3DJCA 4DV2J 2GFFA 1TZ0A 1AT1B 1HLWA 3RW7A 2ZGYA 1NM2A 3GPAA 3MOJB 1KTQA 4NCGB 1OYDA 4WFAL 1VHXA 3VV2B 1E6YB 4CJ4A 2IY5B 4RWWA 1X3NA 1PBUA 3JXOA 2FC0A 3SMSA 4U96A 1C1BA 4R8UB 2FJEB 2CNKB 2MGZB 3T7ZA 2KG1A 4DMZA 3J7AP 1RT4A 3L9ZA 4ILGB 3C6UB 4ZCLA 2P1JA 2MPUA 3BR9A 3VESA 3D9BA 4CECA 5KFSA 3C6HA 3G87A 4MYUA 3IM8A 3WIVA 1S0VA 4OI3A 1H0HB 3OY9A 2FBVA 1DLOB 2CPJA 4GKKJ 4WK3A 2HHHF 1VRUA 4B3TJ 3QRPA 2WHOA 4WFNQ 4Q8EA 2PGCA 2W2PP 2VQEF 1YJWN 3KK2A 2RE2A 4JLHA 4H4KA 2ZM6J 2YBVA 2RDIA 1RJJA 4DR2J 3GOIA 4JUZA 4LD0A 4IDHA 5D78A 4E7KA 3CMQA 3R8EA 4M42A 3OTEA 4JKGB 1MDUB 3LPUA 3UN3A 4K50A 1NJZA 4BHQA 1TUWA 2Z30B 1S3XA 3D2EA 3CCVS 3SCJE 2DR5A 2AKWB 3FRZA 1VBYA 4LSNB 5LSOA 3AH6A 1WUAA 2HMIA 1CQMA 2XB2D 4E0DA 2OAUA 1RFQA 2GUPA 1KRPA 2HNDA 1R89A 3VAKA 3ISZA 3PR5B 3OS0A 1SVDA 1K0TA 4JV1A 4KTQA 1RHMB 4CTAB 5JVGQ 2CDQA 3MM5A 1KBRA 4FF4A 4WXOA 1XC3A 3H46O 5I3QA 1PCAA 1HNVB 4LF6J 3LW5C 1WOQA 2G8FA 4ZCIA 1FJCA 3AJDA 5CA5A 1LWFA 3VGKA 3ALYA 3HZEA 3C2PA 4JI8K 1UP1A 3O9UA 3R1XA 5BN9A 3UDVA 1UJ4A 1HNWK 5L8RC 4OO1J 2Z4PA 4GV6A 4DR3K 3ILIA 4QYZK 4KGZB 1N8RO 4NRUA 1S77D 3DXKB 3H20A 1NMEB 2XRIA 2F8EX 3TAPA 3MX5A 3THYB 3NCQA 2V67A 4K42A 5B0GA 3W9HA 1YVUA 2ZKUA 4OMFG 3PO5A 1N34J 3VR1A 5C2FA 4AUKA 3OFHA 1BQMA 2NUHA 4FJXA 5CXTA 3OW2M 1NHVA 2RS2A 2AT1B 1ZS6A 4ZPWR 4F3MA 5I42A 3V9SA 4BRNA 1XMQF 1CJTB 4LF9F 1FO1A 2Y1IA 1IBKF 1SKUB 2NZ4A 2XZDB 2IM0A 2KVIA 2EC2A 1QVFR 5HVFA 3GSDA 4OX9F 2ASMA 2OD4A 4N8NA 3LTOA 2MZJA 3HVWA 1RAFB 1Y5IB 4K4WA 3H7HB 2A6OA 3LP3A 1NLKL 1NHKL 1BMQB 2BJEA 1QQCA 3LGNA 4WP8A 5KFXA 4NYZA 1HKBA 5IC4B 1MN9A 3CFRA 5J2MA 1HBOA 3TZYA 1VQ7S 3GV5B 3AO2A 3CXCR 2G2ZA 4MLEA 4U7CA 5CQGA 4KREA 3EGVA 2F4VJ 2QKBA 3D28A 4AL7A 1JX4A 3VOVA 1CVJA 4CT9A 5KT6A 1LCUA 2IHR1 3OYNA 1QQNA 2GIQA 1NK5A 4ZVUB 4F0KA 3MR7A 4HUFA 4PXBA 4DPXA 2HQ3A 3HT0A 2VDHA 2RHSB 2CQ2A 1SH2A 4URSA 4ECSA 4FZXC 4DUYJ 1QS4A 3VEOA 1S1WB 2ZBQA 1HYSA 5BXIA 4CGGA 3FGUA 2W2QP 1TMMA 3DU5A 5KFRA 5GAEI 2C3OA 4QWEA 2Z2MA 1GLJO 2ZH2A 3FC9A 4DHYA 2OPRA 3O3GA 2E1YA 4C11B 2HQIA 5KT2A 3J81Y 1Z26A 1UW4A 4BC3A 2BKOA 2CJYB 2B5JB 2YHYA 3ENVA 4LMZA 2O5DA 1T03B 3DYAA 3D67A 5CZVA 4USIA 2EK6A 1IKXA 1Y3KA 1MWMA 3I0RB 3NHGA 3ZEUA 1XNQJ 1M1KT 3FR0A 1N0UA 2MZRA 2ZJPL 4NLYA 3RB4A 2A1SA 3ZETB 3FVYA 3OL8A 4F0HA 3W63A 4F0MA 1CJUA 1E3MA 3K89A 3U9DA 3K59A 4O3PA 1HBUA 2V8HA 3CW2C 2M5YA 3BBFA 2JLGA 5ETRA 1IBMF 4CHNA 2VC0A 1NJYA 3D45A 4BQZA 4AHSA 3MAQA 2MHNA 4FLWA 3IP0A 2KKZA 3W2WB 2XY8A 2BKPA 4BRIA 1Y5LB 3KLHB 1FFGB 3MMCB 1UWAA 3M6VA 1JIHA 2HFNA 2KFZA 1LK7A 2GHPA 4LF9K 3MHYA 2G0CA 1IBKK 4NLDA 5MLCQ 1NGGA 4YDDB 2F8MA 4XH4A 3F56A 3CM5A 1HWLA 4CHYA 1RTHB 2XWXA 1FD2A 4EMDA 2ASOA 3CHWA 2P9CA 5BRHA 2OLWA 5KTQA 2P5VA 3ENBA 4KTZA 2QV6A 4BR9A 3HK2A 4WE1B 1HPZA 3SQGA 3LP0B 4LRDA 1FWKA 5HP1B 4N56A 4B1ZA 2GAGC 4NEZA 1YHQN 2KXNB 4MK8A 2QGFB 1JLCA 2GCFA 2IBKA 2JJ4D 1VISA 3L3UA 4GO7X 3WIUA 4B3MJ 4DV7F 2ZD1B 4O44B 3TA0A 4F4KA 3QINA 1RYRA 3EJMA 2E29A 3UFCX 3TR8A 1U1NA 2C28A 4BROA 4J90A 3W5ZA 1DZ5A 5HRRA 2YWGA 2GZOA 2FVCA 4FPRA 3BN7A 4NOHA 2BRKA 5CYQA 4KHNA 3O8WA 1MROB 2MB0B 3NWGA 3W5XA 5KG7A 2Q36A 1GAOA 1YBAA 2XMUA 1N54B 1PC5A 4W5NA 2Q3SA 1VSEA 4FZYA 1D9AA 3PW0A 3PDNA 4EU0A 1N0VC 2F9JA 2BYCA 5DGBA 4GVMA 3THYA 1TL3B 3LAKA 4KO0B 3U3GA 2X6SA 2FUG9 4O23A 1T02A 3IBCB 1WOSA 2QC3A 2M70A 3AD7C 4AH9A 1GMVA 1T9XA 3CWJA 2KYZA 4OHWA 4G6VB 4PPDA 3ZSRA 3KK2B 1HJRA 2PFDA 5J1EA 4LH5A 4BE2A 1KQKA 4PG6A 1Z6RA 4OZ3A 1SIZA 5AQVA 4ED7A 2UUCF 3AB4B 1ZYQA 3G82B 1OH8A 3BQ0A 4FXVA 4YY3J 1QHTA 1WBBA 4CRJA 1GLAG 1ZBSA 1JKHA 3K58A 2OO4A 2ZF5O 3DOKA 1P27B 3LA0A 1SPBP 1NM1A 5AZIA 4Q2LA 4V19J 2YY3A 4PKHA 2NYIA 3RWUA 3BDEA 3CQXA 1S4EA 5D0RA 3DLGB 2YWWA 3RMCA 3MGJA 5KFOA 3BKTA 4KHPF 3MEGA 3A8EA 5DM7L 2M88A 1UJ5A 1RNHA 1RCHA 2NZCA 1H38A 3ISND 1U26A 4B9VA 1JLBA 4HLBA 3SYZA 2A41A 3NGTA 1F5CA 3PRVA 1HNWJ 1JQGA 1A9NB 1WTFA 5ELZA 2AWZA 1FRIA 1KKHA 1S76D 4KRWA 5ETNA 2QEXS 2GUIA 3IFRA 3TA1A 3PYEA 2ZBCA 2PMHA 1E4GT 1C4CA 2MMYA 1VHIA 2UU9K 2J9DA 4B8AB 1U8WA 3PIPQ 3G6EN 2HBMA 1RADB 2YHWA 1T6DA 1FJ7A 3E3XA 3MFIA 2AD9A 1O8BA 3AAQA 3FBEA 1SXLA 3SAGA 4RNMA 3CCMS 5HVGA 2C22A 3B8HA 1ASUA 4BRLA 3MXJA 2N7YA 4KGKA 1T9TA 2C2KB 3JSYA 4IG0A 1UPPA 2HKEA 4ZN1A 2QLFB 1HI0P 3DLRA 5KFKA 1ZBTA 3AJ2A 4O8KA 4CBUA 5AQYA 1HR0J 5KFUA 3VAMA 1HQUB 4E2FB 2GV1A 3V1QA 4BR2A 3LGMA 3ONQA 3M6WA 2ZBPA 3EZUA 4LSLB 2D3ZA 4Y65A 4I6WA 2P9UB 3UD5A 2BUNA 1HWJA 4DR4J 1YX2A 2XZTB 3FMBA 3PYGA 1ULRA 4RW6B 1S9GA 3M2UA 4HHUA 2CJAA 2MJUA 4K43A 4BY9C 3DRXA 4UY8T 2IDOA 3QRRA 2VD3A 1TAQA 2C3UA 3AXKA 4X4TA 1H73A 1RGIA 2OPQB 4ZITA 4C23A 1C2PA 1TL7B 5JLHA 1RT5A 4JKDA 4ZVRB 3KLIB 3AB2B 4JK7A 4FYDA 5HP1A 4X4OA 4O3NA 2IRYA 2OA8A 2P9PA 4J9UE 1HPZB 5F0UA 4DV5F 4B9QA 5C42B 3GJSB 5I3UA 3LP1B 1HNZK 3QYYA 2IMOA 5CH7B 1A0OB 4B1VA 1XR6A 4FWMA 2KRRA 4DPTA 2DNYA 3BSNA 5AQIA 4JNEA 4MIAA 2L9DA 3B4DA 1KVBA 3U1MA 5C25A 4K25A 2LQ5A 1EKRA 2XHCA 3OFEA 4NZ6A 4DV0J 2YX1A 2E4LA 1F6TA 3VTIA 3K5NA 2VG7B 2A2CA 2CGLA 3BM7A 2XYGB 2JWLA 3BYPA 3CMAS 3W9JA 4X64F 1WG5A 1X4CA 5H1SV 4AXJA 3SCKE 2RQCA 1UTAA 2EKNA 3IS9B 1D0EA 2WW8A 1CS4B 1KVAA 3PLAA 4F67A 1YIJN 4KBIA 2RN2A 2H4YB 2Q66A 4BDZA 3EGZA 2JL9A 3HL8A 1N34K 1DRZA 2F7TA 3V9UA 3SDEA 4X4RA 3VN5A 4MIWA 2J7WA 2FLOA 4FW2A 1NDKA 1FWPA 2M0GB 4DS5A 2ZZNA 1RT1B 5BRDA 3RRGA 3G8SA 5AT1B 1U24A 5K8MA 4I4BA 2XGPA 3ELHA 3I6PA 2Z2LA 3CJ5A 4U67L 3SXLA 3KKSA 2FVSA 3H25A 1WHYA 1V4TA 2DR6A 4CO0A 3SUOA 2YNIB 3F9KA 4W5RA 1RHRB 4CJLA 3KWGA 1V3ZA 3MK6A 2PIIA 2GA7A 1RWWB 4RCHA 9ATCB 5C24A 4QU7A 4C7QA 1U1OA 3I8BA 3ZO7A 2OTJS 3MM8B 5F3TA 2X1FA 2ATLA 1RWXB 2YTCA 4OYWA 1W7AA 1SCJB 2E9RX 4A2AA 1VRTB 3VQBA 4QIVA 4OI0A 1DTTA 3KJQB 4CO5A 1NGCA 2D9PA 2ZC4A 2I9SA 1FVSA 2N3OA 4EBCA 3VQ8A 3OBYA 4WYLA 2AJQA 3SI6A 2DNGA 2JC0A 3G2XA 4IFVA 3GTYX 3DCAA 2DHHA 2OI2A 4MKBA 4B1WB 4FLYA 1YRTA 3BO4A 1APSA 1S1WA 2OUGA 3HFVA 2V7ZA 1J27A 3KLVA 4E7JA 1HHQA 5LMNJ 2GV9A 2H9ZA 3LO3A 1NSAA 3R5DA 4CLUA 4ISFA 4BG8A 5AFUH 3JB9k 2L41A 1RHUB 4DR4F 1R3NA 3GJTB 3QGPA 2NRXA 4O4GB 4DTUA 1K6YA 1G1XA 3PKMA 4WF9Q 4OIXA 4ILMA 3A8YA 1MW7A 2EXUA 1HD1A 4FXDA 1S99A 3CJ9A 1DAXA 3BS9A 3HHKA 1PGZA 3JSMA 2IBOA 3RVCA 3VVTA 2EFVA 2DPIA 2HAIA 2CPZA 1OQ3A 1TK5A 4XPEA 2DIVA 2HZVA 3UO0A 4NLPA 2R7UA 1S1XA 3KMSA 3CPEA 1IJJA 1JL1A 4G65A 1SJ1A 2CKWA 2A3ZA 3DFEA 4B9MA 2EFGA 3RSEA 2KQ2A 2QA4G 4FO0A 3GYXB 2W8KA 3TTDA 3S6EA 2LXFA 1TKZA 5C0YA 3HMJG 2HEKA 1VBKA 5LL6Z 2P9EA 3W65A 4B02A 2EBEA 1VQNS 4WTOB 3QQCD 1KSPA 5E3AA 2OTLS 4MK7A 4F02A 1SS6A 4IBNA 2UXBK 4DTXA 1WDDA 5SZTA 1LWXA 3FKBA 4HH1A 1FESA 3IGVA 3A0IX 1S7IA 3MMJA 4Y1DA 5BPNA 4RU9A 1NZ8A 1H7XA 2WK4A 1Q95G 2O8FA 5LY3A 3KLFB 2GVDA 2DCLA 1HMVB 2D1KA 2FVQA 4BS2A 3MN5A 2LA6A 3L3VA 2COLA 4M41A 4HI1A 3L3CA 4I64A 3JSBA 3T1AA 5FPEA 2YVSA 3NOCA 4HKQA 1RWMB 3N9UC 1GXLA 2QWQA 3PCOB 3AA8A 5C2GA 5LJ3Y 5T41A 4IOCL 1JLFB 1WI6A 1H2UX 4KSEB 4NLCA 4X65F 3DDKA 3NBPA 1RCXB 4QQBA 3W66A 5HQ8A 3H4BA 2W40A 1J9AA 4LSNA 1RBAA 3E66A 1J53A 2WVDA 3CJCA 2ZNYA 1UW9A 5BPLA 1VSKA 3EGWB 2OPPB 1AB8A 2CH5A 4CEAA 1NK6A 3OXGA 1EB0A 2MKCA 4DQQA 3WUHA 2ZH7A 1S6PB 1RTZA 5HQLA 1BA0A 2F9WA 4E3SA 4NA3A 3O4NA 1LW2A 4X4SA 4K8ZA 4P75A 2AYGA 3NRBA 5GADP 3I4PA 2R4FA 4TU8A 4DS4A 2KLAA 3NAHA 4TQRA 2VWBA 2HVHA 1OSDA 1X7VA 2CZVC 1BE4A 1OVQA 5KFJA 1XNQF 1NPPA 4IOXA 2JZ5A 4DSJA 4F8RA 4HEA9 4FXWA 3M3ZA 1QSYA 1VQON 3HDSA 1RDDA 1MNEA 3UE2A 1FI4A 2VU5A 3T1YJ 2W7OA 1YITN 2E7WA 5KG6A 3HVRA 2R2RA 3D3CJ 4LFCJ 4ALZA 2MGZA 2VIHA 1YF5L 2NSBA 2QO3A 1UEUA 4CT8A 5HRPA 1G15A 3NGSA 1DEJA 4C8KA 5CE3A 2GVDB 5KFIA 2Y1RI 3N4PA 3MAHA 1YJNN 3A12A 1BHLA 3WC0A 5LT5A 4NXNJ 4RG8A 5THWA 1OPZA 2ZDOA 5IWAF 1HNZJ 2H48B 2ZZTA 1Q4RA 4WQ4A 2DXDA 1VDHA 3G6YA 4FNHA 3T9NA 4JI1K 3HM9A 3CC4N 1LWEA 1T3VA 4ED2A 1N4LA 1GTEA 3VGVA 1Y10A 3HD1A 2HQCA 2E7VA 2ROPA 1UL3A 2QKKA 1WTBA 2KM8B 4J8FA 4K8XA 2KT5A 4WFBQ 4Q44A 4AQYF 2D1CA 3V4IB 5L39A 4LF8K 1FEHA 3KKFA 3EZWA 1HQEA 1OPIA 1S72S 3M8SA 4TXSA 4ZLPA 2RDJA 5HI7A 1WN7A 3AO3A 4YY3F 5DDRC 1NBEB 1Q79A 2BQUA 2E1ZA 2QSWA 3GJRB 1IKWB 3H1QA 3BF3A 3SQGB 1MN7A 3GCXP 4M3UA 1I6JA 1Z2ZA 4OVLA 4BRCA 3Q8SB 3CMEN 3IRWP 3RU0A 1W0HA 3AOCA 2C2OB 2CQGA 2WSCC 1TELA 2RT3A 2AJ2A 3CJ7A 4Y1CA 2K7JA 4C6AA 4ZP9A 1S0MA 4YN3B 1FJGJ 1RTHA 6FD1A 1M5HA 4DTPA 4H0OA 4XAKA 4NLXA 1U49A 2O8FB 3RSEB 1VYAA 3EUNA 4Z94A 3EPGA 1NDCA 4MO4A 2UUBJ 2QX0A 1P8GA 4NMXA 3PX4A 4MDBA 4NLUA 3H5YA 1GMWD 4X65J 3RMBA 4E7HA 2E5JA 1NOZA 1BWEA 2PEHA 5A6PA 1KQSM 5TKWA 1KAXA 4PYAA 2RH3A 4R0JA 2RNEA 1KNZA 2FF6A 3VQCA 1IG8A 1FKPB 1TKZB 4KR0B 4M3XA 5K8OA 3J80O 1M5PC 4FPIA 4N7TA 3ZZUA 5FRNA 2R8KA 3ILLA 3PFEA 4CYUA 3CM6A 4FZZA 2CQIA 1O13A 3Q22A 3PIOL 1S1XB 2AP6A 3FZBA 3V6DB 3PRDA 1QSSA 4CH7A 4ISEA 3SSSA 2O66A 1URRA 3JSMB 3FSIA 2IJRA 3NOGA 1NH7A 3WC2A 5GAHU 3IR7B 1XK8A 4Y0FA 1MWZA 2KL8A 4A47A 2Q97A 2KHCA 3B78A 4JYAK 3CC7N 1YJVA 4O4GA 1LOTB 3OV7A 4JI7F 2BRLA 5TKYA 5C24B 2IFXA 1Z2LA 4NCAA 2VV5A 3CB4A 1A5VA 5IT9Y 4J37A 1RGVA 1BI4B 4KH5A 3CCQN 1HJOA 1FW6A 4FYXB 3TTFA 3DGVA 1VBXA 3QFUA 4QS9A 3TJ8A 2ZWOA 4WZQA 1SZ2A 4RJVA 1DTTB 4DR3J 3F41A 3AVGA 1BUPA 1RUSA 3CC2N 4ZMMA 3P31A 4JI2K 3O3FA 3VHQA 2YNGB 1BWFO 1REVA 1XMQJ 4GVLA 3BBCA 1IBCB 2JLFA 4LJMA 4J2AA 5DG9A 4GKKK 3FEXB 1HKCA 3O9RA 4DTOA 3SJHA 1HBOB 3CDWA 1O6XA 4HTJA 3BF1A 1JMTA 3IS9A 3Q24A 3G8TA 2KFYA 2MZTA 4FNIA 4NA1A 4ETZA 4F2SA 3ULHA 2L9NA 4Y34A 1X4HA 2QL5B 1QQMA 2RQKA 2V8GA 3AV9A 2FDNA 3FUYA 3QIPA 2E6MA 1SH0A 2YX4A 4B3SK 3GR0A 1RT6A 3HI0A 4F9OA 3DGPA 4KI4A 3KUGA 3ZT1A 2E9ZA 3OXFA 1CG2A 3MPYA 2CADA 1WC3A 3DC2A 3RZAA 4Q0BA 3CPWR 3FLCO 4OI4A 3R1LA 2HNZA 1ZBLA 5ETQA 3J7ZO 1NGEA 3FBBA 3LP1A 4WIQA 1EIYB 4WFNL 2DH7A 1VBZA 3GG0A 1T9YA 3GIJA 1Q1KA 4ECZA 4O0IA 3QBXA 1F3FA 3MXIA 3SPYA 4IG0B 4CIFA 3A8KA 2HHTA 1JNRB 2HWIA 3M8PB 3ZZRA 3NLCA 3FZ2A 4BRKA 2NRZA 2VZ9A 5FJ4A 4C8NA 3EXCX 1VQLS 1GLEG 2B56A 1QAIA 5T7BA 1RAJA 1VQ5N 4RW4B 4O8UA 3OYFA 1XMOK 1TMJA 5HN0A 4BDPA 3OYMA 5I3UB 3T5HA 2ZH3A 3L4IA 2KKHA 4C0HA 4LRCA 2J8SA 3M1FA 5ADXH 2JHEA 1WF2A 1LW0B 2CJ9A 2LEAA 1ATSA 3DM2B 2EEYA 3QEWA 1HL6A 3ZZZA 3K5MA 1T6CA 4JKBA 2E2QA 4ENOA 4JYAF 3K5OA 2PC6A 4NYFA 3G9CA 4OLOA 2CPXA 4R79A 5IOLA 4NLRA 3W9IA 3NAEA 4USWA 4K4YA 1FRLA 2VFUA 1KXPA 3MEGB 4K0KJ 2I0XA 3C15B 2FJBB 1XMBA 2KJWA 5T7LA 3DLGA 4AL5A 3MEDA 4CJ7A 1Q82T 3ZTQA 1GLLO 4HTUA 5BJRA 3NF6A 4AT1B 2OEMA 3K2YA 5CY4A 5KT7A 4XH1A 5JLFA 4FF2A 3NVKA 4ICLA 5AZJB 5B0EA 3QFWA 2VQFJ 4JB8B 4JI2F 2G1HA 4JD2A 3I0SB 2CPFA 5JJBA 3R6LB 1PYOB 4E8UA 2AV5A 2P6SA 3BKFA 1CULB 2J9EA 4CJFA 2XULA 4ICLB 5AZJA 2AYEA 4F36A 4R8UA 2AZ1A 1R0AB 4BR4A 5J1EB 2H54B 3VCDA 2CNNB 3G71N 3A3OB 4FWOA 1TK0A 3ZZPA 2DY1A 1AYEA 2R8IA 1VQMS 1OY8A 1SKRA 1K0VA 1KDNA 5DMRA 1HKAA 2HHPA 3DWLA 1TL3A 1AUSL 3GIIA 3GJQB 2Z8QA 3OYBA 3DLEB 5KFTA 4WQ5A 4FJNA 4PCQA 1NH8A 4GKJK 3J7ZT 3M7VA 2BE2A 3I96A 3NMUA 4TYAA 2W6LA 4NYPA 1LW0A 1WSVA 3OHRA 2DNPA 1U2RA 5CHIA 2LQBA 4OI6A 4LF6K 3Q89A 3V1RA 4C1NK 1WNEA 5BR8J 4DR6K 1NSPA 2UV8G 1N6QA 2XLJA 2UV8A 3WNGA 4BLGA 2HK2A 5GMKa 2HNYA 4IO1A 3A3PB 2YX7A 4DKWA 4BRDA 1U6ZA 3AO1A 3P5BP 3IWNC 5B09A 4Y2CA 1UA1A 3L2WA 3MPVA 2HRTA 2C3PA 2BJ9A 2BJ7A 1X60A 3DOKB 2PT0A 3I5AA 2ZH4A 4IH7A 2DPJA 4BC5A 5B7WA 3WXIA 4OZ2A 4G1QB 2ZVSA 3M8QB 3B82A 1MG7A 4CZFA 1VFJA 2FBTA 3D6HB 2W9CA 4DB3A 1I94K 2MDAA 4IRKA 3O9TA 4FJGA 3LDOA 3N79A 2XMTA 3L95X 3JYTA 2DRBA 5GAGP 4E98A 1X5OA 4DZ6A 2GS8A 3NS6A 3I55N 3R6MA 5KFAA 2QXFA 1DHMA 4OHXA 1VQ9N 1WOOA 4B9NA 4M95A 3CFPA 1IKYB 4W5OA 4M5NA 4LRFA 1Y00A 3DHWC 3H5XA 1QZ6A 2Q6BA 4DV1J 4ZCKA 2B4OA 2ATCB 2YH0A 2IMWP 3IDHA 1ZTWA 3D1HA 4A8FA 1U6BA 1LAVA 3ZSZA 3OFGA 2ZHBA 2BKNA 2CJKA 1ZBFA 1X4BA 4WE1A 4HT7A 3ZZOA 2FXUA 1S49A 1VOMA 3GV7B 2NYHA 2XZWA 5BR8F 3KDOA 2LCWA 2XMVA 1S1UB 5EX5A 2M8HA 2UUCK 2FF3B 3VGUA 3V9ZA 2YWEA 3HP6A 3KOAA 3NGDA 1IUJA 1QQOA 3OTOK 3DOLB 2ZD1A 3OJUA 4JI4F 3GFYA 1V5VA 4YR0A 3W8PA 2ZJQL 4NRTA 1Q9XA 3CQ8A 4ED0A 2J0WA 2I2YA 3LGHA 1NSKL 2ZFHA 3QJPA 4C3LA 4DL5A 5B0AA 3CJRA 4LR8A 5B08A 2WVFA 3LZJA 5JVHQ 1PG5B 1OJ4A 4DPYA 4IUFA 1W2IA 3J7YU 1H98A 4W5QA 3A5MC 2YKPA 4OJHA 2WSEC 1ZC6A 2L9WA 2NR0A 3W2VB 5E3QA 4KHWA 2VDIA 3LZIA 4DDFA 3QATA 3OJSA 3RYLA 3OYKA 1SL0A 1E6VB 3QIPB 5DLFA 3QEVA 3QBWA 3FMWA 5DETA 4YOEA 1CXUA 1NXIA 1R8PA 4H0XB 1X0FA 2ZZMA 2DFEA 4CLSA 2UUBF 5JMVA 5KFEA 4HACA 2B4UA 2NLWA 3A8IA 1TL4A 1NBWA 3MN6A 1XERA 1SL1A 4DCJB 3MMAA 2YQ0A 4H03B 2I7PA 2K2PA 4DFJA 3E01A 1Q5VA 4K0KF 3JQMA 2PZSA 3NF7A 1TL5A 4JKHA 1OS5A 4FPBA 5AQQA 5E0OA 4MYTA 3E01B 4M5MA 4MT1A 4BRFA 2J7KA 2CPHA 4HT5A 2QA4S 3HP9A 3TOQA 1GLBG 1CJUB 1JL2A 3LP2A 2J6UA 1A7GE 4TSXA 2Y1LB 3QAUA 4C98A 3C46A 4U7UD 2OPRB 3FZLA 5EY4A 1GH8A 3P3DA 2V52B 1SQGA 1T94A 4O0NA 2I1RA 2J4RA 1SQFA 4CJ5A 2DITA 3N6LA 4GVBB 2HOEA 4M3RA 4PAAA 5F8GA 2DR9A 3GILA 3HHLA 2ACMA 2DGWA 4CYUB 4JAXA 4BCAA 4ZJOA 2APOA 2V9WA 1WF1A 4OX9J 1ZBUA 1U0HA 1FKPA 3FRYA 3EX7B 4B1UB 4ZLLA 4LREA 5HROA 2H3GX 1U1QA 5AQTA 5KG1A 5LXRA 4OYOA 2VQFK 1FNXH 3ZX3A 3ZSXA 3R3TA 4DV5K 3TVKA 4IQXA 4U8YA 2P5GA 1JXBA 3C8YA 3CJ3A 5EOYA 1ZM4A 1HD0A 1HNZF 2OELA 4AHUA 3CE8A 1BHNA 4QIFA 1TV6B 4NO7A 4RUBA 3V6DA 1P9QC 2X1GA 4IEIA 1U45A 4C2MA 2HBLA 2GVZA 1HQEB 2QE5A 1YQHA 2CPEA 1FCAA 4PA1A 3LALA 5J1NA 3RB6A 2HURA 1RYSA 3AXMA 3U3YA 4CLYA 3CCJN 1X5PA 1HYZA 4NLOA 2LQJA 5I42B 4N47A 4J9OA 3L2VA 4Y2MA 2RHQB 2WOMA 1XIQA 4HDHA 2Z56B 3NH0A 3UPFA 1X3MA 3BSAA 3U8XA 3WXMB 2KO1A 4RL1A 3EKSA 1MLAA 4PZVA 1RKJA 1RAGB 3QFPA 4LF4K 4FJKA 3ZT3A 3H45C 4LFAK 2QI2A 2B0GA 4WJBA 3ZTSA 1VK0A 2OZSA 2D0PA 4KRFA 1FNOA 4P10A 4J9VA 4CK1A 4IO9Q 3ZSWA 3AVHA 4IOBA 1TUVA 3JTOA 9RUBA 4P52A 1HNVA 2XMKA 3VQDA 4DLEA 4AL6A 2RAQA 3H1VX 1UVJA 4NEYA 3QWPA 2IVMA 5D0HA 4CH0S 1F2HA 2Q6CA 4X62F 5BRFA 5D6GA 3T19A 4UF4A 3AD8C 1UETA 2CIMA 2ZDPA 3IA0A 1S5ZA 3QGIA 3V4IA 3HZGA 2VUGA 1HNXK 3THVA 4FJ5A 1C4AA 3O3HA 4N76A 2Y1JA 3P49B 2R8GA 1X9SA 4DCPB 1JXLA 1FERA 3ID6A 3CCUN 4FM1A 1U1RA 1R0BG 4X84A 1C0UB 2KT3A 4OFZA 4K4ZA 2HNDB 3V81B 3Q8PB 4KHSA 1H3DA 5D4PA 1RHJB 4CZKA 2HMIB 4NLWA 4DX8H 2UXDJ 1JLFA 1KR4A 2BVZA 2XSFA 4LF7F 1FXRA 4I6MB 1NGJA 3EKUA 2JEIA 2V0NA 4CK3A 2P9SA 2VPWB 1FF2A 3MZIA 4L72B 1YTUA 1OSCA 3L4BC 1KS2A 3TAMA 2BMBA 3O9QA 3RBEA 1HHTP 4YNQA 3CCEN 1RWUA 4DV1K 2V34A 4FLXA 1KVJA 2P51A 3PX0A 4QIWD 4LBHA 4ZJQA 3PNIA 1RCOB 4CFBA 1KQFB 5AJ3K 2EK1A 3NNCA 3TPQA 1HMVA 2QJ3A 4FYVB 3OBIA 3H8YA 2IM2A 1HKGA 2N3LA 1CLQA 2IA6A 3CQYA 1RABB 2DNKA 3HSCA 1SUQA 3EN9A 4L75A 2HZAA 2J6TA 2YNHB 1JLQB 1Q16B 2LU2A 2HLTA 2F40A 2OANA 2ZH9A 1VC5A 3SQ0A 1UA0A 1LW2B 4CO4A 1UVMA 5JUMA 3GIKA 1WG1A 2QFIA 2KTQA 1T95A 4DV4K 1N33F 3C66A 1M5OC 3W64A 3P4IA 4YHHK 2NRVA 1IWAA 4OGEA 4YOVA 4BG9A 2VQEK 1NU4A 3C15A 4OLPA 4IG3B 1MU2B 2RKIA 2BJ3A 3F73A 1YI2N 1C0TA 2MQOA 1BWVA 3QSIA 4UT4A 2AP1A 1YXQA 1UWBA 3NBPB 1H74A 2XNQA 4LFAF 4RW7A 1X5SA 1WAJA 3PJ9A 5L38A 1NGFA 3IRXA 4ZS6A 3D6FB 2BUPA 2V50A 1SJ3P 3NL0A 2PA3A 5A76A 3FJ2A 1A6LA 3HYFA 3TR5A 5AQUA 4C8MA 2FTRA 4BVOA 3BPDA 3AVJA 1VQYA 5HOOA 3Q7BA 4BREA 4BWJA 3G4SN 3PTWA 3I5CA 5K8PA 3MECA 4X62K 4EHTA 2DTUA 2VG6A 4J2EA 3H2VE 2NQPA 1IBLJ 4IFVB 4OYMA 3MCMA 3MMVA 1GLDG 4DR3F 2VJUA 1HNXF 2FC9A 2ASLA 2GX8A 4ZPAA 4ID5A 2VGMA 1QTMA 3EY1A 1FKOA 2IC3A 3L2UA 2EI5A 1S79A 3CCZA 1B0PA 4Y6IA 3HXMA 4Q0BB 3LM2A 2HQDA 4GVEA 4RTFD 4KFBA 2HBZB 3NCPA 1RILA 1FJEB 3HHLB 1QZ5A 2M7SA 4FWRA 4DWIA 3D7EO 4EIAA 4MLHA 3ITHA 2AHOB 3R9PA 4J9KA 3U6FA 1ILYA 3TYTA 4FBTA 4J91A 2K06A 3D0PA 3VENA 3LP2B 4LIWA 1T9UA 2RS8A 3TO8A 1NK4A 4IYQA 1NHUA 4JS4A 3CJAA 3IO1A 4F4XA 2F5GA 3R1HA 3VEZA 2VASA 1SJ4P 3AVAA 1BISA 2DGUA 4QPXA 1SC1B 4DR2F 2FD2A 4B1XB 3GZ7A 1CXQA 4DUZK 3R6GB 1NB2A 3BO3A 2I5JA 3Q8QB 4KBOA 3IUCA 2LDYA 4GKJJ 4DUYK 4QR1A 5ETMA 2QWOA 1RACB 3LDQA 3BGOP 3S8SA 3O44A 2YHXA 2X7IA 3GG4A 3CJ4A 3CDAA 3FNNA 3JQJA 1BIUA 1ZAVA 4CZEA 3HI9A 3UNYA 2QXLA 1I39A 3GSIA 3IM9A 5CAAA 1FDBA 5KFYA 1R8AA 4YHHF 1X4EA 2X1AA 1N5QA 4Q8FA 4R25A 3MI7X 3KD1E 3MCNA 2W9BB 4HHJA 3D7SB 5EX3A 4ED6A 2O1PA 4DTRA 5KFMA 4B3TK 2Q2RA 2ITGA 4FVCA 4FPAA 2YXLA 1X0PA 3O6QA 3MMBA 5KFDA 4RBVA 3R3LA 1Q78A 5C42A 1S6UA 3FZMA 3AVIA 3CIMA 2VF3A 5KI6A 1F9EB 3QSYB 3KLIA 3CF5L 3K9JA 4B3SJ 4ES1A 3IN5A 3CI5A 1ZM2A 1OH5A 4WK1A 1J6ZA 1D9DA 4DN0A 2DNHA 2QWNA 4OJRA 1TQLA 4A2BA 2JSXA 3N4WA 2CDRB 3DNCA 2AJ1A 3ITHB 2MKHA 1K73T 1VAZA 3CSKA 3PEHA 2MSTA 2G1DA 1MA9B 3FZFA 2CZ9A 2PI4A 2ZBIA 1W7WA 5AQFA 4YDXA 4N41A 3BY5A 2V7YA 5ADZA 4PKIA 2GQ2A 1KFDA 4FWLA 4P73A 3PKYA 4X64J 2E2OA 1TL7A 1CEZA 1KD1T 4PRFA 5IM0B 3SQ1A 4LF8J 4JI6J 2CA9A 4FF3A 2OH2A 4BRMA 1REGX 3QERA 2ZH8A 2OMLA 3JAMO 4NXMF 2DKOB 1BUXA 4A8QA 3UB5A 3G10A 1RDBA 2EHGA 4BC9A 4KH6A 4BRPA 2QLXA 3HOTA 3C6TA 4FKYA 3Q2TC 3JYTB 4CZHA 2W01A 4FYYB 1UVNA 4MKYA 2YJEA 2M4MA 1Y4ZB 2YPZA 5KFHA 2W8LA 2FY8A 2IOCA 3BH7B 4FL9A 5DG7A 3HLUA 2QL9B 3HTVA 2P9PB 1NPKA 1HRHA 1VQKN 5SWMA 4KB0A 5AQKA 2BGGA 3M8QA 2UYTA 1R6YA 4HVJA 1PC4A 2PFFB 4WQ5C 1B0TA 2VPZB 1WHWA 3B6PA 4DR2K 3C94A 1J5EK 2OFHX 2P9IA 2O4IA 5J2NA 5KFPA 1UWBB 4JI7K 1C0TB 4CZCA 3M2UB 1N88A 3WZ0A 3QPIA 1VJQA 1VIOA 5FD1A 1NGBA