4O44A

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-(mesitylamino)-6-(3-morpholinopropoxy)-1,3,5-triazin-2-yl)amino)benzonitrile (jlj529), a non-nucleoside inhibitor
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title A mechanistic and structural investigation of modified derivatives of the diaryltriazine class of NNRTIs targeting HIV-1 reverse transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Hydrolase/hydrolase inhibitor
total genus 140
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4o44A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4o44A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4o44A05
3QESA 3CYMA 4E89A 1RA7A 1A5WA 1REVB 1HNVA 3DLKB 1MU2B 4B9MA 4DMNA 4CEOA 4F8RA 5FDLB 4FJKA 1NK7A 3WNGA 4RNOA 4B3OB 4RUCA 4KSEB 2UUTA 1TGOA 3QNOA 4Z4GA 5KFWA 1SL2A 1XR5A 1S1UB 1W9HA 5K14A 1S6PA 4Q0BB 4EO6A 2FJWA 4CEZA 2PYLA 3PO4A 1TQLA 5DQIA 2V4QA 4MK8A 4CJUA 3H5UA 3SV4A 3T5JA 1LWCA 2DPIA 3OHBA 1BQMB 4NLSA 1T05B 4RNMA 1BGXT 4TQSA 3ALYA 2YNHB 4JS5A 5DLGA 1KRPA 3KKSA 3TVKA 4FLUA 2IA6A 5KT3A 2BRLA 4RNHA 3HP6A 5HP1B 1VSIA 2R8HA 3ZSQA 3RMDA 2R2SA 3RB0A 4FJ8A 3LP0A 3MECA 2CJQA 3B6PA 1RTIB 3JSMB 3NGZA 4ELUA 4H4MA 4RW8A 4H4OA 4CIEA 4L8RB 4O3OA 2FVCA 5C25A 2RKIA 5DG8A 2W9CB 1N4LA 1RDCA 2E4LA 3CFOA 3Q8RB 4LH4A 1VK0A 4F4KA 4KI6A 4WE1B 1LWEB 4RW7A 3LALA 5KFPA 1JXEA 4MQ3A 4OPJA 3HT3A 4NCGB 2KW4A 4K4SA 3UIQA 3KK1B 4M41A 4ED8A 3M8PA 4YMEA 4WXWA 4F3OA 1NOYA 3PVXA 3G6XA 1WSFA 3AVIA 1C0UB 4QWEA 3C6UB 1JLBA 2Z1GA 5KG3A 3CVKA 2YV0X 4MK7A 5KFQA 4FJXA 3KHRA 2UVUA 4CJQA 4B8AB 3AV9A 1D0EA 4FJGA 3ISND 1T3NA 3IN5A 4YP3A 2YNGA 4Q8EA 4AH9A 4J9SA 4CCHA 2NUBA 4DFMA 3DRPA 4FCYA 2HHTA 3S3OA 3QO9B 1SH2A 2I5JB 4FBTA 5FRNA 5KT2A 1D5AA 2Z1IA 4FZZA 4FXDA 2FBXA 3O4NA 2Q3SA 4M94A 3ULDA 1LAVA 3DLEA 2HNDB 5HROB 1SKWA 1A5VA 3GQCA 3V9XA 3HVTA 5I42B 4K4UA 3QNNA 3OS0A 4E19A 2IM2A 1LV5A 5KFHA 4RZRA 2OPQB 2FVSA 1REVA 3DLKA 4TY8A 5FDLA 4FJHA 1C2PA 1DTQB 2JC0A 1NJXA 4B3OA 3V6HA 1KVCA 2ATLA 2XC9A 1FK9B 5KG7A 3NF7A 1EP4B 2ATQA 3ZSZA 1W0HA 2VG5B 4ECYA 4E3SA 3GV7B 1S1UA 2QE5A 4FM0A 4Q0BA 4DSFA 3OLBA 3HKWA 4TXSA 2W7OA 5KFVA 3I5AA 3MXJA 4CK1A 2D7SA 4U6PA 3GIJA 3OYGA 1RTDB 1HYSB 4AHRA 1SUQB 3H40A 2ASJA 3OJUA 3E01B 1NK5A 3VQBA 4EEYA 2OPRB 1BQMA 4TYAA 3LP3A 4XO0A 3OYKA 4AHVA 3QLHB 1T05A 5KFGA 2HHVA 1WSIA 2XY5A 3AVLA 1FXXA 2F8EX 1C1CB 2YNHA 3AA5X 3MEGA 1ITGA 3WNHA 2HW3A 4RW6B 5EDWA 4ZP6A 1S6QA 4QPXA 3SUPA 3M9MB 4CJTA 2YNIA 4C8OA 3EYZA 5HP1A 3F9KA 4M45A 4NLXA 4E7JA 1C1AA 4ZHRB 1SL1A 1RT7A 1U45A 4Y2AA 1A5XA 2FBVA 1VRUB 4O3PA 3OYHA 1RTIA 3M8QB 4Q5VA 3DI6B 5KRSA 3OSPA 1RDRA 3V6KA 3K5NA 2HNZA 1C0MA 1KLNA 2WK4A 4WXOA 2E6MA 1JLFB 4CEFA 1WSHA 1CLQA 1ZYQA 4BDYA 2ZD1A 4LSLB 3TI0A 3G86A 3V9ZA 3RMCA 3MFHA 3QERA 1HQEB 1JLCA 5KG5A 3BR9A 2GV9A 3KK1A 2KFNA 1UA1A 4FJ7A 4IDKB 2QK9A 2B6AB 3KLIA 3AVNA 4AHSA 1JKHB 3V9WA 1C0UA 4NYZA 2HWIA 4QWCA 4WYWA 4FK4A 4J9RA 3QINA 4DL3A 3SYZA 2IJNA 3AVCA 4DL6A 5KG0A 4URGA 3O4QA 5DG9A 4GMJB 5I3UB 4DTUA 1C0TB 4K4YA 1VSLA 4I9QA 1F21A 4OGEA 3K5OA 1B9DA 3MR5A 4HKQA 4DQSA 4F2SA 1TL1B 3HO1A 1NKCA 4FM1A 1GX6A 2AU0A 3DLHA 4NCAA 1X9WA 4MFBB 4KKOB 4CGHA 3OL9A 2XI2A 4KB7A 1NOZA 2I5JA 1S9FA 4ED6A 2W8LA 1VSEA 4CK3A 4W5QA 4M3YA 1L5UA 1BCOA 2FVQA 4Y2CA 4J9OA 2OA8A 3H4BA 4AHUA 4J9KA 4HUGA 3S9HA 2IS3A 5HROA 3NBPA 1EETB 2Z1JA 1WNSA 2B5JB 4DL2A 3AVMA 3NF6A 4QAGA 5I42A 2XGQA 1QUVA 3KLEB 2IBKA 3RMBA 2E6LA 4IQXA 1Y97A 1BCMA 3TAEA 1U09A 1NK4A 3IGVA 4ZP7A 1D9FA 2J6SA 3NF9A 5JXSA 3HSTB 1QQCA 3NKYA 2OPPB 4DS4A 3Q8QB 1DTQA 4W5NA 4IFVA 3DRSA 3KKRA 3HVRA 2RF2A 3DDKA 3NAHA 5KFJA 1FK9A 3OYDA 3CG7A 3MR2A 1CXUA 1EP4A 2HHWA 2A1SA 4K50A 1ZBLA 2HHXA 2PZSA 4KHWA 3OYNA 1N5YA 4IH5A 5HRSA 3MR3A 2XCPA 4F3TA 1X9MA 3RMAA 4ZVGA 4ICLA 3DOLA 3HPOA 1RTDA 1IO2A 4OGCA 1HYSA 4IKFA 3TAGA 1FKPB 4KHQA 1TKZB 3E01A 4YR3A 1HRHA 3KLGB 4B9SA 3WNFA 3LP0B 3OYBA 3QLHA 3V1RA 3ZT3A 4CHOA 2YKNB 3KHHA 4H4MB 5C5JA 1C1CA 4B9NA 4H4OB 4CECA 3ICLA 1YVFA 3VQSA 2G8FA 2RKIB 1DTTB 3BSCA 2D41A 3SPZA 3DLGB 3IS9A 3NGYA 4RW7B 3QEWA 3LP1A 4Z4CA 1D8YA 4HYKA 4TQRA 3OHAA 1NJZA 4IBNA 3AVKA 2DPJA 5D3GA 4CHNA 2BE2B 4RG8A 4K4TA 5EWGA 2EHGA 3AO1A 1O1WA 3ZSWA 3MAQA 1UWBB 3AO3A 4C8MA 3DI6A 1D9DA 3AVAA 4KHUA 1ASVA 4F50A 3OVNA 1NKEA 4CERA 4CIGA 1JLFA 1JL2A 1YVUA 4CGFA 1S5JA 1JLEA 4B9LA 4LSLA 4IOBA 1HQEA 4F4WA 3V9UA 3NDKA 4NLRA 1NJYA 4IKAA 4DTXA 2YNGB 1RT6B 3I5CA 4QWBA 3OYIA 3EZUA 3H5YA 1ZBFA 1HPZA 5CZ1A 3KMSA 5KT4A 2C2EA 2GUIA 3CDEA 4EYIB 2HHSA 4XPCA 4Z0UA 5F8LA 3H98A 4E1MA 1BIZA 1C0TA 4RW9B 4KHSA 4F4XA 3O3FA 1KSPA 4FBUA 1TL1A 4YQWA 2BDPA 3HVTB 1EKEA 4CJKA 4MFBA 4KKOA 3I5BA 2O4IA 1I39A 3ZSRA 5F9LA 4E7LA 4N56A 1S49A 1BISA 1GX5A 5KG2A 3G0ZA 3VQ6A 4TY8B 2GIRA 4CHQA 2VWKA 1S0OA 5KFAA 3N6MA 3ZT0A 2AX0A 4ED2A 1IKWA 4CF1A 1EETA 4LD0A 1RT2B 5KT6A 4ZTJA 3KOAA 4E7IA 2B5JA 3QEXA 1TV6B 1QS4A 3KLEA 4NLTA 1NJWA 1Z4UA 1WN7A 4WFZA 1LW0A 4NZ0A 4J9MA 5KTQA 1SL0A 4PUOB 3RAQA 3TARA 1IKXB 2LSNA 1WNEA 3L2RA 2OPPA 1RDBA 4DLEA 4H54A 3BSAA 2HAIA 4TYBA 1UA0A 4ELTA 1BL3A 3V4IA 4FW1A 5KFSA 3SQ2A 4DTRA 3DRRA 4BE1A 4BACA 3MEGB 4IG0B 3B6OA 3PY8A 4OKJA 1S6QB 4IRCA 2YNIB 4CIFA 1FKPA 3VQQA 1TKZA 2ITGA 3V6JA 5DQGA 3KLGA 4LH5A 3H4DA 1NK8A 1RT7B 5SZTA 3SZ2A 2YKNA 2V4RA 3V6DB 2G8IA 4JRPA 2KQ2A 1R0AA 1HMVB 3OS2A 3MFIA 4CESA 3I0SA 5CYQB 2G8UA 1DTTA 1ZBHA 2HNZB 3C94A 1T7PA 5KFMA 4DU3A 3DLGA 2ZD1B 4B9UA 4N76A 4I2PB 4CFDA 3BQ0A 2Y1IA 5CYMB 2BE2A 3T19A 1JLCB 2C2DA 3G10A 4DTSA 5F8MA 1ASUA 1RBVA 2ASDA 4N41A 1UWBA 3NAIA 4OPKA 2HMIA 4OL8A 3KLIB 2BQUA 1NK0A 4X2BA 5F8JA 3WNEA 2W7PA 1EX4A 5DLFA 2FJXA 1KVAA 3L3UA 3VQDA 2A1RA 2VWJA 4KHRA 5JS1A 3IGNA 4DG1B 3VA3A 5F8GA 3NMAA 1JXBA 3HK2A 5J2MA 3O3GA 4O4GA 1XHZA 2Z1HA 1J9AA 4FJIA 1Q8IA 5J1EB 4IRDA 2FLNA 1B92A 1RT6A 4Y3CA 1JIHA 2JC1A 3RBEA 2KTQA 4URQU 4ZPCA 5KFOA 3S3NA 3NL0A 1S0NA 3EY1A 5EU7A 2X6SA 2JEJA 4Q43A 3HVAA 3PZPA 4KB0A 1TKXB 3D0PA 4CFCA 3PW4A 4RW9A 1RT1B 3T5KA 1NNDA 1BHLA 3NBPB 3IRXA 1TK5A 2G8HA 3QZ8A 2GBZA 3QETA 3AO5A 4FZXC 1U04A 4KI4A 5KFLA 3RR8A 3N6LA 3LZJA 4JRQA 4CHYA 3RTVA 1IKYB 1HNIB 1L3UA 4GC6A 4QW9A 4ED0A 4DSKA 3T1AA 1JL1A 1S97A 1LW2B 3L2WA 4HCCA 3SV3A 4IFVB 3DRSB 2RF2B 3NCIA 4FLVA 1RT2A 4F4YA 4ID5B 1TV6A 4GC7A 3KHGA 4O4RA 1N5YB 4WZQA 1FKOB 3GYNA 5KFZA 4UQGA 3CM5A 1HJRA 4QWAA 4EBCA 4PQUB 4WZMA 4ZTFA 4ZP8A 1S1WB 4PUOA 2BRKA 1IKXA 1VSJA 5J2NB 4ICLB 3DOLB 3D28A 3H59A 4DL4A 4E7KA 2Y1JA 2R2UA 5L1LA 3CJ2A 1BI4B 1KCFA 3I0RB 4J9PA 4WFYA 4AILC 4Z4FA 3OSNA 3F73A 3GIMA 4FK0A 3GV8B 4CJ5A 4HTUA 5HBMB 3L2VA 4NLUA 4IG0A 2R7YA 4FJ5A 2E9ZA 3BQ2A 2B4JA 4NLOA 2FVPA 2WCXA 3DLRA 4IFYA 3FDSA 1N48A 2R8IA 1RBTA 3IS9B 5L1KA 3LP1B 2IOCA 4LY7A 1CZ9A 3C95A 4CFAA 4JUZA 1WAFA 5KT5A 5D3GB 1YT3A 1S1VB 3VQCA 3V6DA 2R2RA 4DU1A 4Y1CA 3PW0A 4NLPA 4IR9A 3M8SA 1HMVA 3PR4A 5CYQA 4R8UB 2P5GA 4ED1A 3K5MA 4EZ9A 1CSJA 3MTKA 3PJWA 3SJJA 3NHGA 3PJXA 1JLEB 1D1UA 2HWHA 4O5BA 3SUNA 4I2PA 3U6FA 4JV2A 3OL6A 4QCLA 3BSOA 5CYMA 5KI6A 3BDPA 4DQIA 1KHWA 3QGGA 3OL7A 3TAMB 3HM9A 2C22A 1IKVA 3AO2A 3AVGA 1KVBA 2IMWP 5C42B 4FJMA 4NRUA 1QE1B 1KLMB 3ZSXA 1HPZB 2ETJA 4DQPA 5KFUA 2ILYA 2UVWA 1ZTTA 1TP7A 4BE2A 1L3SA 2XY7A 3PUFA 4CK2A 4FLTA 4DG1A 5DK5A 5FROA 3M9NB 4IR1A 3AVJA 3BREA 4ECQA 1XC9A 1N6QA 3OJSA 2G8KA 3IG1B 1RTHA 5J1EA 2W42A 2WRMA 4CJ3A 1HYZA 3G6VA 1RBRA 4RU9A 4ED3A 2OPSB 2D3ZA 5KFDA 3OL8A 1B9FA 4DQRA 4EZ6A 1SV5A 1WLJA 4KO0B 1TKXA 1K6YA 4EBEA 5T7BA 4IRKA 1RT1A 2DFHA 2BANB 1WAJA 1KFSA 4KRFA 1IKWB 4EYHB 4LQ9A 4DQQA 3KTQA 5L1IA 1TKTA 3ZT2A 1IH7A 3VQ4A 1S48A 4KREA 1Z26A 1U49A 1LW0B 3Q8SB 2CKWA 4J9NA 1IKYA 1HNIA 1C6VA 3QIDA 1J54A 4HUFA 4NLDA 4J9LA 1LWFB 4KHNA 3LPTA 1LW2A 2IC3B 4Y34A 4KTWA 4DTMA 4TLRA 3CWJA 2AGQA 2GIQA 4W5RA 4ID5A 3SI6A 3KHLA 3V4IB 3EPIA 4M3UA 2D3UA 1S1TB 1FKOA 2V9WA 5KFTA 3AVFA 3DRRB 4OKKA 4J2BA 3K58A 4PQUA 1S1WA 2QXFA 3HPHA 4WFXA 5J2NA 4ZPDA 4J9QA 1JLQA 2WOMB 3LAMA 2BQRA 1GOBA 1BI4A 4DFKA 3QEVA 3SQ0A 4DTJA 4RUAA 3I0RA 3PO5A 3N6NA 2HVIA 4RNFA 4I7FA 2GC8A 3U3YA 3AVHA 4KTZA 5HBMA 4MK9A 3LPUA 5KFRA 3NFAA 4O0JA 4O55A 1R0AB 1DLOA 4F2RA 3I0SB 3OYEA 3CFRA 3SQ4A 3ITHA 2VG7B 1C1BA 5KFKA 3D45A 3V1QA 1TAQA 5KFCA 5JS2A 3RWUA 4CF0A 4RNNA 5KRTA 4MKAA 4F4ZA 1VRTB 1S1VA 3OYMA 3GILA 2W8KA 3KLFB 4CJ4A 4AHCA 4ELVA 3DYAB 2HMIB 3CIZA 4R8UA 1S9EA 2X74A 3CJ0A 2RDJA 3V81B 3TWHA 1VSFA 5KFIA 1RT4A 4MKBA 4Q44A 3ZSVA 5EUHA 3QEIA 1GOAA 3ASMA 1JLAB 3L3VA 4CJPA 3L2QA 3TQ1A 1U4BA 3H2LA 4DL7A 5J2MB 4PY5A 4DF8A 3TR8A 4O4GB 5KFFA 1T03B 2XGPA 4XIUA 4CF2A 4DSJA 4I2QA 2OZMA 2E9TA 5F9NA 3TAMA 4W5OA 2AJQA 3CJ3A 1IG9A 3T3FA 2HNYB 5C42A 3VQ9A 4DTPA 1QE1A 1KLMA 1IM4A 2RDIA 3HYFA 3FSIA 1KTQA 2R8GA 3P5JA 2UVVA 3DMJB 2ALZA 3K59A 3NH1A 1ZETA 1L3TA 1S9GA 2OH2A 1JXLA 2XCAA 4DEZA 2YKMB 3MR6A 5DG7A 1XHXA 3IRXB 3UQSA 2IGIA 3O3HA 3IG1A 3PW2A 4ECWA 2WHOA 4ZPAA 4O3SA 2D0AA 3EZ5A 3LDSA 3AO4A 3KMQA 2OPSA 3CDUA 3AA2A 3CQ8A 1NK6A 5HRPA 4KV8B 1G15A 4KO0A 4ECUA 3ZT4A 3LWLA 3V1OA 4FZYA 3BSNA 2BANA 4NLQA 5DGAA 3ZSYA 2X6NA 4FS2A 1QHTA 4NLGA 1RT3B 2ZE2A 4DSIA 1XR7A 2W9BB 2FBYA 3DM2B 3QIPB 1NK9A 1LWFA 4N5SA 2HHUA 2IC3A 4Z4EA 1U48A 3LAKA 3LZIA 4G3IA 4ECZA 4K4ZA 3NF8A 5KG6A 4E7HA 3QGIA 3PW7A 1S1TA 5T14A 3RRGA 4K4VA 4CEQA 1VSMA 2WONA 4BDZA 5HRRA 4TY9A 4JS4A 4B8CA 4KAZA 3DLBA 3TANA 4DLGA 2IAJB 4HCBA 4C8NA 4O3NA 4Q45A 4IFYB 2WOMA 4DFPA 4ZMMA 2ILZA 4U7CA 2C2RA 4C8LA 1J5OB 2PY5A 4ECRA 1RYRA 3SUQA 2X78A 3RR7A 1T94A 5KFBA 3TAPA 5L1JA 1K1QA 3CDWA 3PW5A 3FFIB 4MIAA 1WSJA 1SKRA 5F8HA 4CJVA 3NGDA 4QW8A 3IAYA 2P51A 5L9XA 4G1QB 4DL5A 4DSLA 1VSHA 2PYJA 3CJ4A 2C28A 2VG7A 4Y1DA 2G8WA 3KD1E 4IG3B 2FLPA 4NYFA 3NGIA 4ZVFA 1NHVA 3U3GA 1KHVA 4MH8A 1QSLA 2O5DA 5KFYA 1VRTA 2XRIA 4C8KA 2JEIA 4CJFA 4KHMA 3KLFA 4OKEA 2BR0A 1QTMA 3DYAA 4ZVEA 1IKVB 4OLBA 2AGPA 2HVHA 3V81A 4CJEA 2BQ3A 3KK3A 3KLHB 1Q9XA 1Q9YA 5F8NA 1TAUA 1JLAA 4CF9A 4PA1A 1RT5A 1T03A 4QWDA 3VN5A 1N6QB 5KG1A 3MEDB 1RTHB 3BGRB 1RDDA 5J2QA 4NRTA 4DTNA 2HNYA 5KG4A 4CE9A 4W5TA 3TAFA 4M3WA 4Q8FA 1W25A 2B43A 5KFEA 1SV5B 3DMJA 4KTQA 1ZBUA 1HYVA 3CJ5A 4ID1A 2D5RA 2YKMA 2D0CA 3OYCA 4FJNA 1TKTB 3SFUA 1UAXA 3DOKB 3NAEA 4M3ZA 3RBDA 1VSKA 4IH6A 3MXIA 2XY6A 3KJVB 4GW6A 3MF5A 3VA0A 4CJRA 2G8VA 4KV8A 3GIIA 1NKBA 2DY4A 4HVJA 3AA3A 3K57A 3PX4A 4O3RA 2IM3A 5FRMA 2W9AA 2YNFB 1RT3A 4YR0A 3PX0A 4R5PB 4FYDA 4EO8A 2W9BA 2XY8A 3BQ1A 4DF4A 2KZMA 3RRHA 1MU2A 4CJWA 3DM2A 3QIPA 1SH3A 2R2TA 5CZ2A 1OS5A 4JV1A 1BQNB 1SH0A 1CZBA 2RPIA 1JLQB 1JLGB 4EBDA 1XWLA 2AWZA 1YTUA 3HP9A 4CGGA 3AA4A 4M3XA 3H5SA 2F96A 2R8KA 1RA6A 3FQLA 3THVA 3UPFA 4I7FB 4AHTA 1WSGA 4O0IA 3VQPA 5DMRA 5HLFB 2IM1A 2OYQA 1XI1A 1RBUA 3MEEB 4CEAA 4M3TA 1DLOB 4CGJA 1S1XB 3KIOA 2ZQBA 2IAJA 3ITHB 2FVRA 3C6TB 3HL8A 4FJLA 1TL3B 4BE0A 3I8DA 1C1BB 1RTJB 3OYAA 1XR6A 4YFUA 4ZPBA 1J5OA 2KFZA 3T5LA 4BDPA 2IM0A 4FW2A 1T8EA 4NLWA 4O44B 1TVRB 1HQUB 3FFIA 3LP2B 4R0EA 3CFPA 3SPYA 3H5XA 4RW4B 4FK2A 1RNHA 1QAJA 2QKKA 1GOCA 4TSXA 1S9EB 4G1QA 4CJLA 1N56A 1RT4B 2O4GA 2DFFA 3HVWA 3S3MA 2ZKUA 2RN2A 1NHUA 4IG3A 3JSMA 2IJFA 4EP4A 3E51A 2YHAA 3GIKA 1TKDA 3SFGA 4I2QB 2W9CA 1L3VA 1TK0A 3JYTB 3PX6A 5KFNA 4OJRA 4KAIA 4K4WA 5C24B 1RBSA 4WE1A 1LWEA 2AX1A 3HPGA 3CO9A 1WSEA 2R8JA 5KGXA 3NH0A 3T5HA 4M3RA 1S10A 1CXQA 3KLHA 4O3QA 4NCGA 4KHYA 4J2EA 3RAXA 4FLXA 1TK8A 3K2PA 2V0NA 2J6TA 1S9GB 2XO7A 4CGIA 4NCBA 3PHEA 3MEDA 2JEFA 3BGRA 4KFBB 1BIUA 3D5MA 3KLVA 3RB3A 2OZSA 4H8KA 3C6UA 3OYJA 4FJ9A 3KK2B 1UOCA 3L2UA 4IH7A 3UDLA 3SUOA 2FC0A 3OYFA 4FLWA 3QEPA 3MXMA 2QKBA 5J2PB 3VQ5A 1ASWA 4B08A 4KB1A 4LSNB 4FJJA 4FM2A 2VG6B 3KNAA 3G6YA 4GVMA 1U47A 2ZE2B 4PWDB 3DOKA 1VSDA 4LQ3A 1RAJA 3QO9A 4CEBA 4M95A 5CY4A 4J2DA 1HNVB 3VQ7A 3KJVA 1S0MA 4NLYA 2DTUA 5JUMA 3HJFA 4ECSA 2HNDA 3QYYA 1JX4A 4B9VA 3EPGA 2VA2A 3M9OB 2HHQA 3M8RA 3SCXA 2DFEA 3VQAA 3FRZA 1SKSA 2YNFA 5EWEA 5K14B 2EX3A 2UUWA 2HB5A 1S6PB 4ECXA 4CEDA 4R5PA 3KD5E 3ZCMA 1X9SA 4Z4IA 4CJSA 3LANA 2I1RA 2OPQA 4BWMA 2WONB 2FJVA 4CEEA 1ZTWA 4ZP9A 4ED7A 5E41A 3VQEA 3NE6A 3OS1A 2J6UA 4DU4A 4FVMA 1BQNA 4HHTA 1LWCB 3QZ7A 1J53A 3TABA 1RCHA 4EP5A 2XHBA 3K5LA 1JLGA 1RILA 4MIBA 3A2FA 3OYLA 2VG5A 4XPEA 3CM6A 3ZSOA 1QAIA 4TN2A 2JGUA 4YNQA 1LAWA 4HUEA 3V9SA 4OLAA 4Z4HA 4DWIA 3Q8PB 5HLFA 5DQHA 3SNNA 1QSSA 4J2AA 3MEEA 3P83D 3HXMA 1K1SA 4JV0A 1SUQA 3SQ1A 1S1XA 2E9RX 3RB6A 2BGGA 3QIOA 4CF8A 3HHKA 2XI3A 2VA3A 2OPRA 3C6TA 1TL3A 3MECB 4QOZB 2D0BA 1RTJA 3ISNC 1HARA 2IDOA 3VQ8A 4RW8B 4O44A 1TVRA 1HQUA 4URSA 4RW6A 3LP2A 5C25B 5KFXA 2P1JA 4KBIA 4FLZA 2F8TA 2FLLA 4RW4A 1S4FA 5HRNA 5EWFA 1QSYA 5KGWA 4DS5A 1Z25A 1EXQA 4ZHRA 3NH2A 4ECVA 3UR0A 2KZZA 3GV5B 3H08A 3KK3B 4K8XA 4ZVHA 1VRUA 4WYLA 3M8QA 4DFJA 1RDAA 5DGBA 2JLEA 1RT5B 3M8PB 4CHZA 3SI8A 4K8ZA 3JYTA 3P1GA 2UVRA 3BJYA 4M42A 4E0DA 4NYNA 3OLAA 5C24A 3FQKA 5J2QB 1JLBB 3ZT1A 3OY9A 2WTFA 4CFBA 4DSEA 5SWMA 3QGHA 2JEGA 1YTAA 4NLVA 3L8BA 4B9TA 4IDKA 2B6AA 4CHPA 2WB4A 3AVBA 1JKHA 5KT7A 3DRPB 4FLYA 3RB4A 4KFBA 4OVLA 1KFDA 1X1PA 4N47A 4E1NA 4I9LA 1I3AA 3TAQA 3PV8A 3KK2A 4ECTA 4K4XA 3LWMA 5I3UA 2ASLA 1RYSA 4CGDA 4KPYA 2F8SA 3DLEB 5J2PA 1ZBIA 4DTOA 2XWYA 2EC0A 2YHBA 3PR5B 4LSNA 2AGOA 2FBTA 2VG6A 4FS1A 1MMLA 1I6JA 2QV6A 2P5OA 4KE5A 2AQ4A 4JLHA 4YR2A 4PWDA 4BWJA 5F8IA
chains in the Genus database with same CATH superfamily
4ZPWR 5AZIB 2IJRA 1RA7A 2DGWA 1VBYA 5F0XA 1VQ4S 1REVB 2E1CA 5CZXA 6AT1B 1VQ6S 4GNIA 5D4LA 2EG1A 3MD1A 2XYHB 5DZ7A 2XHWA 2CVIA 2UUTA 2MDAA 2YKOA 4Z4GA 1XR5A 4DHVA 3V4MA 1S1UB 2DKOB 1W9HA 5K14A 2YJFA 1R3NA 3O3LA 1ZPVA 3FUYA 3TA1A 1SXLA 5DQIA 5JICA 4JYAK 4AT1B 1YBUA 3OW2M 3SV4A 2ZOFA 1KEKA 5GADP 2K1RB 2YPYA 2RAQA 2XQCA 1T05B 2HOEA 4IOAQ 4TQSA 4JI8J 1LOUA 1SBRA 5F0UA 2YWWA 5M1PA 3H6EA 4WQ4C 3TVKA 4FLUA 2IA6A 1HNZJ 3TPQA 5KT3A 3I55S 3CMES 4C2MA 4WCEQ 3RSEA 1FJGJ 3J7ZO 2GVDB 5HQLA 2FHOB 1NRKA 4MLEA 3ZSQA 1W2IA 4FJ8A 2VZ9A 2CQ2A 3LP0A 4HDGA 2MQNA 2DEIA 2CJKA 2K2PA 1T3VA 5F0WA 4CP5A 3EDRB 4WIIA 4RBVA 1P9YA 4O3OA 4L8RB 2E4LA 3CFOA 4LH4A 3A8KA 4F4KA 1LXNA 1VDHA 1NH8A 1LWEB 4Y0WA 3LALA 4F7VA 4NZ6A 1B99A 2AZ1A 3M2RA 3SJHA 3HCXA 2YKQA 1LQ9A 2FY8A 2EEYA 3VZIA 2BVZA 3DXKB 1KR4A 4FPAA 5ADXA 4YMEA 2JFKA 2CAJA 3AVIA 3CQYA 3GP9A 4QWEA 1R0CB 2DR9A 9ATCB 5T41A 5KG3A 3CVKA 3JS9A 1WC0A 4FJXA 3HFVA 1QQNA 4P73A 1Y64A 1QAXA 4B8AB 2MB0B 4FJGA 1RWNB 3ISND 1I94F 2SXLA 2NZTA 3TOQA 1C0GA 4CCHA 4AH9A 2NUBA 2Q79A 3S3OA 2J9DE 3EKSA 1Q82T 2VYPA 3MM7B 5FRNA 3VCDA 4FZZA 4DPWA 2A3JA 4FXDA 3O4NA 3PLAA 1VK3A 2QG9B 3ULDA 2HNDB 5HROB 4WK1A 2V69A 3PFOA 3HVTA 1WI6A 2Z30B 2UXCK 1GFWB 4E19A 3OHRA 2FSNA 2IVFB 2JSXA 1YVNA 1A0OB 2FVSA 3PJ9A 3DLKA 2C42A 3THXB 3WIVA 4ZS6A 2JC0A 3V6HA 1M1HA 4QIGA 2ATLA 1EP4B 1IR0A 4A8OA 2B8QA 3TTFA 3TX8A 2R7TA 3GV7B 1IN0A 4ZVSB 2ZBPA 3MPYA 4QJVA 4Q0BA 3UE2A 2QT7A 1UKUA 2ALYB 4DX8H 4FZVA 2P9PA 4CK1A 1GMWD 2D7SA 1I94K 3KFWX 3OYGA 2VPXB 1RTDB 2UV8A 3N28A 4AHRA 1SUQB 1YQHA 1EZZB 2ASJA 1NK5A 2M52A 2DCLA 5BPLA 3SAGA 1NB7A 4EEYA 4QU6A 1BQMA 4TYAA 1HNWK 2O3DA 3MUVP 1TFWA 3UW1A 5KFGA 3SBGA 2HHVA 1IQZA 3U1MA 1HI8A 4PG7A 3AVLA 4MKVA 3MI7X 3POTB 2YNHA 1RAOA 1W2BR 3AA5X 1ITGA 1ZH5A 3WNHA 2VFRA 2HW3A 4RW6B 1SS6A 1LCUA 3US5A 3K0SA 2XLJA 4ZCKA 2QL7B 4BGAA 4C8OA 3EYZA 5HP1A 1C1AA 1R43A 4JV5J 1U45A 3FRYA 4D3GA 4Y2AA 4BCAA 3OYHA 1RTIA 3THYA 1DAXA 3DI6B 1WUUA 1KLNA 2WK4A 4WXOA 1FXDA 1JLFB 5LXRA 1FXLA 2E6MA 1NDCA 4GVEA 5CQGA 3CCSN 3D3BJ 3L3CA 3TI0A 3K2YA 4LBPA 2K7JA 3G86A 3WQTA 4K41A 4A8SA 1NH7A 4GO7X 4ZVUB 2DNYA 3Q8VA 4OI2A 3AVNA 1JKHB 8ATCB 3MTJA 3UWTA 2FB0A 3V9WA 2CPHA 4QWCA 4WYWA 4J9RA 2QL5B 3MMBB 4OLOA 1E3MA 3H1QA 2J9CA 4URGA 5DG9A 4GMJB 2YX6A 5MAOA 1C0TB 4K4YA 1VSLA 4QIFA 1YI2S 5RUBA 4DR2K 3MR5A 2VQFF 4HKQA 2KFYA 4LFAK 1NKCA 2NR0A 1KC8O 3GG4A 1FNXH 2AU0A 3DLHA 3WC2A 2F8MA 4MFBB 4OQJA 3G96A 1NOZA 3FEYB 1VSEA 4M3YA 5AE3A 1BCOA 2FVQA 2DNNA 2DR6A 1VR6A 2OA8A 2VIHA 4J9KA 5A2QY 1WF2A 3OV7A 2UUBK 1RHJB 3WXKA 4ANEA 4DL2A 3QQCD 5I42A 1QUVA 1KD1O 3WBZA 2RILA 3CGIA 2ZZNA 4CI6A 1BCMA 3F2KA 3TAEA 3WX4A 4N77A 3IGVA 4A62A 5JXSA 2LA6A 2VF3A 1VQPN 3AJ2A 2HSEB 2EPIA 3Q8QB 1DTQA 2A40A 4W5NA 4IFVA 3HVRA 2HIQA 3ILOA 4X62K 3OYDA 3MR2A 3DAWA 2MSTA 1L3KA 1WTBA 4YOVA 1ZZFA 4FWOA 2ZJQL 4W98A 2XCPA 3PSIA 1X9MA 4UF4A 2BJEA 3CJCA 2VQFK 3TAGA 3O5BA 3CCLN 1LK5A 3NCQA 3CDBA 4YR3A 3KLGB 1QVFM 2VU5A 4JI1F 3LP0B 5IZHA 2AYBA 3V1RA 4CLSA 3R5BA 4C3MA 4OYPA 2RHQB 5C5JA 2HS4A 4USHA 1VQ7S 5KAKA 2YHYA 2G8FA 5ELZA 3TZWA 3BSCA 1F9HA 3SPZA 2XWXA 1VQSA 4DL0C 3NGYA 3LP1A 3RBXA 3J7AN 4WP9A 3MK6A 5HVGA 1X7VA 4WFNL 3M2RB 2DPJA 4CHNA 3G4SN 1S79A 2GMLA 5AQGA 2CH5A 4E8UA 2RD5C 5JLHA 3ZSWA 2JOQA 2CFXA 4LF1A 1D9DA 3U9ZA 4Z94A 4BC5A 1NKEA 3CJ7A 1B7FA 1YVUA 4CGFA 2A2DA 3EEQA 2X3GA 1XMOF 4B9LA 1CJTA 5GIPA 4LSLA 3ZZTA 4H0VB 1W7WA 2QLWA 1S6OA 4PPZA 1KD1T 4I6YA 1Y7PA 3HSCA 4BLGA 4PHTX 4JI1K 1DBDA 2IIHA 1PC5A 4NOHA 3H5YA 3DGPA 4RL1A 1ZBFA 5CZ1A 5KT4A 1RAHB 2C2EA 4C8YA 2GUIA 3CDEA 3TX0A 3A8IA 5AQPA 3DXMA 1BIZA 1X60A 2X1GA 3FZ2A 3QWPA 4M8LA 4YQWA 3H1VX 3HVTB 3IAM9 4GVLA 2RQCA 5HK4A 1T9XA 4DR4J 4LFCJ 1I39A 4Z2XA 4UQTA 4N56A 3BF1A 2HQGA 1GX5A 2MGZA 1IJFB 1X0FA 5KG2A 3W9IA 1TYQA 2VWKA 1S0OA 3CCVN 2PD1A 5DDQC 3N6MA 3ZT0A 4CF1A 2KHCA 2JWKA 4LD0A 1RT2B 2I7NA 3PYGA 5CCLA 4E7IA 1RE1B 3QEXA 4BY9C 3ILJA 1XMOK 1YJRA 4WFZA 1LW0A 1YTYA 4LF8J 3CPWR 3TUJC 2P9PB 2ZHAA 4ILGB 1FD2A 2LSNA 3L2RA 5AQOA 2WC9A 1PBAA 3B78A 4DPOA 2G1DA 2L3MA 4DLEA 3BSAA 1UA0A 3R9LA 2PO4A 2OSRA 4ELTA 2DY1A 3BGLA 4FW1A 5KFSA 2WVEA 4CYUA 5GMEA 5AQSA 3DRRA 3GIRA 1J2VA 4IG0B 3DDIA 3TA2A 3OUYA 2CXEA 1VQNN 3B6OA 4OKJA 4IRCA 4ES3A 1DARA 3X1LB 2V2ZA 2HQCA 3VQQA 1TKZA 3S1TA 1GK8A 2WW8A 1H2UX 4X65J 2HGLA 3NS7B 4DDFA 1NK8A 5SZTA 1UPMB 2V4RA 3PIOQ 2NZ4A 3V6DB 5DZ6A 3DOMB 5ETKA 4JRPA 2GNKA 3MFIA 3I0SA 5CYQB 1ZBHA 3MM9A 1GMUA 4DU3A 4Y65A 4K2XA 3TTCA 2DHXA 3OT9A 4B9UA 4N76A 2ZZMA 4YN3B 1RLDA 3CCJS 1NMDA 4LF9F 5CYMB 3T19A 2C2DA 1RBVA 1ZA1B 3Q89A 2ASDA 1AXQA 2HMIA 4OL8A 3TW0A 2O01C 3IA0A 4X2BA 4UY85 1SKUB 2FJXA 4M63C 3CC7S 3VQDA 1HI0P 3J7A1 2VWJA 1NGFA 3VA3A 4U67Q 3NMAA 3FMBA 4FYXB 3NNHA 4O4GA 2J8AA 2CQDA 3CCZA 3VGLA 3OTEA 1UFKA 2D9OA 1B92A 5L9NA 4CLZA 2CQ4A 2MKSA 5KFOA 3S3NA 4ILHA 1S0NA 4PYDA 2ZH3A 4Q43A 3PZPA 3GJTB 4KB0A 2G1HA 2B0GA 3D0PA 2G4BA 5HMZA 1CQNA 4CO5A 1BHLA 1N5SA 2E7XA 2X51A 3I87A 2MQQA 3G25A 2G8HA 3VGKA 3R3LA 1BWFO 1WD6A 2GBZA 3VGUA 4CLTA 3QETA 3AO5A 1XNQJ 2IRUA 4FZXC 3A8EA 3NRBA 1ELOA 5KFLA 5HL7L 4K0KK 1N32F 4USTA 4LF9K 4K2JA 2NRXA 2W6KA 1L3UA 3G8TA 4GC6A 2DJWA 1S97A 2ZJRL 2KVIA 3VGSA 1V3ZA 2E2PA 2HAFA 4IFVB 2FJBB 3NCIA 5T7LA 3L6QA 1TV6A 4GC7A 5C2CA 1FKOB 2FF3B 4GKKK 2HIYA 5H9FK 3GCXP 3BY5A 4PUOA 2LEAA 3AQOA 4PABA 2EKNA 2MHEA 2H4WB 3D28A 3A8JA 3HOSA 4DL4A 1UPPA 3VR1A 2R2UA 1BDGA 3JSBA 2J0QD 1KCFA 2HS3A 3I0RB 4J9PA 4AILC 4Z4FA 2KKHA 2R7QA 2UU9K 4CJ5A 2IVPA 4EGLA 3UD4P 5HBMB 5D0EA 4YHHF 4FJ5A 3C16B 1HR0J 4KHPJ 3FDSA 1ATSA 1N48A 1VQ4N 3LP1B 2IOCA 1GLFO 4LY7A 1N32K 5HQMA 5D0HA 3LL3A 4JUZA 3S6EA 1VQ6N 3FVYA 3ZZUA 4FYWB 4DV6K 4DV0J 3WQUA 4B1YB 2IIRA 1YT3A 2WAQD 1FHTA 1BOTO 3AH6A 1DHMA 1YDLA 4Y1CA 5AZJA 2GUPA 3Q22A 1HMVA 3ZFVA 4KR0B 1G4CA 3MTKA 4DV2K 4HTLA 3DRYA 4PQAA 1NO8A 4EUVA 2HWHA 3SUNA 1W26A 4I2PA 3U6FA 3OL6A 3BSOA 4WFBQ 2PEHA 1XQIA 3MMAA 2XM3A 2XULA 3HD1A 4CBWA 3QFPA 4FF4A 5C42B 3DGPB 1TU0B 3ZSXA 1RDWX 4QQBA 2D3OR 2UVWA 3CMEN 5CD4A 2XY7A 1U2FA 1PJ7A 3JTOA 5ETTA 4PRFA 3BREA 5K20B 2BJDA 2IYIA 1TUWA 4CJ3A 3VGTA 1HYZA 3G6VA 1D4XA 4YS2A 1RGVA 5ETPA 1QLNA 3C2PA 2F4VF 1WUAA 2MGZB 1TKXA 1K6YA 1FEEA 1GMVA 4IRKA 2DFHA 3O9RA 1KFSA 5F2RA 3PIPL 2RVJA 4LQ9A 2DNQA 3VQ4A 1WWHA 4CT8A 1IBLJ 3R5AA 2PBDA 5LJ3Y 3R5CA 4KREA 1Z26A 1LW0B 3OTOF 3F44A 4J9NA 1KOHA 1IKYA 5C7PA 4J9LA 1LWFB 1LW2A 3MWPA 1P90A 2C2ZB 5A8KA 4A8FA 3CWJA 4OX9F 2AGQA 5AQNA 5GAEI 1YJ7A 2D3UA 2V9WA 3O8WA 3DRRB 2OHDA 4FNIA 1NCLA 1B4SA 3CI5A 2C2MB 5K8PA 1JLQA 2BQRA 1BI4A 4DFKA 3SQ0A 4DTJA 2YTCA 2I0XA 2QTWA 4ZVPB 5CABA 4X64F 1GLLO 4RNFA 1BU6O 4DR7J 5KFRA 3JSRA 3I0SB 3OYEA 3A3PB 3UKRA 4L74A 1X4BA 2MSSA 5DO2A 2AEFA 3V1QA 1XMQF 1Y0HA 3RWUA 4QBUA 1NMEB 4Z7CA 2R42A 4MKAA 1VRTB 2MQMA 3L95X 3KLFB 1G2EA 3BYPA 4AHCA 2HMIB 3CIZA 4R8UA 1FJ7A 1S9EA 3V81B 1VSFA 4FPIA 4NYOA 3NGTA 4Z7YA 1FESA 4K42A 3D6TB 1N33K 4Q44A 3ZSVA 5EUHA 3QEIA 2D1KA 5C2DA 3ASMA 1YXQA 4CBUA 1EJ7L 1U4BA 5BR8K 1QY7A 4DF8A 4O4GB 2NXCA 4I2QA 5BXIA 4DV5F 3WXJA 2E5HA 1EX8A 4AL7A 2CPXA 3CJ3A 1REGX 3T3FA 2BKOA 2ZVSA 3VQ9A 3VOVA 1RDUA 5G0RA 3HYFA 1U1KA 2V5HG 4OZJA 1TMJA 4QZVB 2R8GA 2UVVA 1R8BA 3AXKA 4YORA 2EWHA 3R1LA 3K59A 3CPEA 1X0PA 5E3PA 3VWSA 3MR6A 4MO5A 3UQSA 1VGYA 2LQBA 3FCWA 2IGIA 3P39A 4KC5A 3CCUN 4ECWA 2WHOA 4LF4F 1X5PA 4U8VA 2HHHF 1VQ8S 4JI7F 3CDUA 3CQ8A 3U1LA 2EFGA 1NK6A 5HRPA 2XS2A 4KV8B 3M32A 4KO0A 1CJUA 2CGKA 3EWGA 5JVHL 1HLUA 1J5EF 3V1OA 3G8QA 4NLQA 3EGZA 2X6NA 2NCKL 4NLGA 2ZE2A 4DSIA 2HK2A 1WHXA 4QIWD 2W9BB 5IT9U 2FBYA 3SEOA 3M6WA 3LW5C 5LSLA 2GVZB 4OZ2A 1NK9A 4H0OA 3C3LA 1HWLA 5D8HB 1RCOB 2DO0A 2UUAK 3MCNA 2IC3A 2O8BB 5DJBA 3LAKA 3C15A 1Q8KA 4NWBA 2VOOA 3NF8A 1YI2N 1QM9A 5KG6A 2JLFA 2P9EA 4C3LA 3QGIA 5ITHA 3PW7A 1S1TA 5T14A 4CEQA 1VSMA 4TY9A 3H42A 4JS4A 1CEZA 1ZAVA 1MW7A 3TANA 2IAJB 4IFEA 2GGPA 4O3NA 3EN9A 1HI1A 4UT4A 4C8LA 1D09B 1J5OB 3SMSA 4JI7K 3RR7A 4FKYA 5ETNA 3TAPA 2QMUB 3QRQA 4J8FA 3FFIB 2Q0UA 4B1VA 5F8HA 2ZJPQ 5C10A 1J5EK 2DT9A 5AZJB 2G0CA 4QW8A 3IAYA 1IG8A 3UNYA 2B8PA 3P5BP 2B51A 4OX6A 3CXCR 1BO5O 4FSVA 4IG3B 2ZNZA 3TZYA 4MDAA 3VETA 4IOAL 4JHDA 4MH8A 1XERA 4LFBF 4BRLA 1QSLA 4ZCIA 3MCAB 2PMZD 3G71N 4CM0A 3AAQA 3RJMB 2Q43A 2BR0A 1QTMA 2AGPA 4WCEL 3BGUA 4Q2LA 1B0TA 3W2WA 3CF5Q 2BQ3A 1EARA 4BRAA 2IVNA 2X1FA 2NQPA 2M3DA 2ERRA 5FLXO 4QIEA 2DISA 4YOWA 3VAMA 1Q9YA 4O8UA 2FYXA 2AV5A 5DDOC 4OYAA 2CDRB 1T03A 3TO8A 4QWDA 2FZKB 1K0TA 3VN5A 2C2KB 3BPSP 5A8WB 3MEDB 4OI4A 2YQ1A 2QW9A 1U2CA 1RDDA 5J2QA 2RSQA 4YB7A 4ZN1A 3NEKA 3TAFA 4M3WA 2OLWA 2AJFE 3H2VE 4I6MA 5KFEA 3R7BB 1B64A 2BABA 4B3SJ 4IDHA 3R27A 4OJHA 2OSQA 3I82A 4LR9A 2DH7A 3NAEA 3EZOA 3WXLA 3O8MA 3RBDA 2HURA 1FJGK 2XY6A 4BG8A 3Q2SC 5BRHA 3VA0A 2G8VA 3QDKA 3NWGA 4E98A 1NKBA 2DY4A 4FWRA 4HVJA 3K57A 2BOAA 2M9KA 2ZGYA 4O3RA 2IM3A 3LQVA 4JI6F 1X3MA 4B3TJ 2E5GA 3QFWA 1DT9A 4K25A 2DTJA 1N0UA 3KDOA 4LUBA 3N4WA 5CZ2A 1BQNB 5H1SQ 2P9UA 1JLQB 3ILIA 1HUXA 3HP9A 2N3OA 2M8DB 4M63A 2RT3A 1X4AA 3VQPA 5LY3A 5LMNJ 2OYQA 4L72B 3SCIE 1RHQB 1RBUA 2MJNA 2FZCB 3GR0A 5J1NA 3KIOA 3E2EA 2ZQBA 4NXNJ 1KAYA 3W61A 4FYVB 3BS9A 3C6TB 1RWPB 3HL8A 3HF5A 1RTJB 1XR6A 4BRFA 4BDPA 2IM0A 1T8EA 2IDEA 5M1KA 4O44B 1HQUB 3W9JA 3L9ZA 1KKHA 2OANA 4P6QA 3CC2S 4JI6K 1GOCA 2FTRA 1S9EB 3A8YA 3CIPA 1NHUA 4TKTA 4EP4A 1AZSA 4N8OA 4HI1A 4ZJQA 2RUSA 4P71A 3GIKA 4USVA 2GV1A 4I2QB 4DR5J 2W9CA 3ILLA 4YY3F 3N5FA 3KWGA 1UVJA 1RBSA 1KVJA 3ZEUA 1WSEA 4F0MA 3NH0A 3UDEA 1NUEA 4O3QA 3RAXA 4FLXA 3K2PA 1MLAA 4CT9A 5B0BA 3OVSA 3T41A 4OZ5A 1NGCA 3BGRA 4KFBB 4OHVA 1BIUA 4E1JA 3KLVA 1QZ5A 4PL7A 3OYJA 1VRQC 4FJ9A 4FWMA 1LWXA 3VVTA 4IH7A 2Y0BB 1SPBP 5AE1A 4A5BA 2AP6A 4FLWA 5I3PA 1HWUA 1CJUB 3G82A 1ASWA 4CQ1A 4DUYJ 3UN3A 4HTJA 3CCJN 1X4CA 3VGVA 2ZE2B 4M5KA 1NGBA 3EZWA 2IA0A 4AL6A 1RAJA 2NSCA 3R2DJ 4N7TA 2N7YA 1F5CA 1HNVB 1SZ2A 2DH9A 4B9QA 3ZX3A 3A13A 4JV5K 1FTCA 4YY3K 1Q79A 4KYZA 4Q7AA 3CC7N 2C1EB 1AYEA 4ALZA 2B9EA 3M9OB 3ID8A 1YBTA 3O9TA 5AQHA 3PG9A 2IYGA 2UXDJ 3C15B 4HEA9 2RRNA 4ECXA 1N52B 1PC4A 2Q3PA 3ZCMA 2I1RA 2OPQA 2FJVA 4JI4F 1GH8A 3I33A 1ZTWA 5E41A 3NE6A 3VQEA 3JQKA 1FDNA 3DHXA 4DPUA 4MIBA 3EE3A 2A6OA 3SAFA 5EHHA 2VG5A 4XPEA 3CM6A 5IM0A 2JGUA 4I0WA 1N54B 3LPYA 3NY0A 3V9SA 2H54B 3CTRA 2JJ4D 3Q8PB 3Q86A 5HLFA 2Q0RA 2UUCF 4X84A 2W2NP 3T7ZA 4G65A 2EI5A 1S1XA 4DHYA 4CF8A 2XI3A 3BGFA 2OPRA 4FPRA 3MECB 4QOZB 2I9SA 2D0BA 3ISNC 4CW7B 3IMQJ 1DQ9A 3VQ8A 1J27A 4RW8B 1TVRA 3BDEA 3ADAC 5HSPA 1QSYA 2J4RA 5EWFA 1HKAA 5KGWA 2HLTA 4DS5A 1KAXA 4HTIA 5EX3A 4OFZA 3W2VA 2MY8A 4EWTA 1NU0A 3R1XA 4CLFA 5EY4A 3NH2A 1AFIA 3UR0A 2DHSA 2V8PA 5M1QA 4JI4K 1ZAWA 3M8QA 2JWLA 3BYRA 5K5MA 3W66A 5DGBA 4DKWA 5A0YB 3M8PB 2BE7D 3MPDA 3TEGA 3JYTA 5KPZA 3GR1A 1ZS6A 4ZK7M 2NYHA 4NYNA 3FQKA 5J2QB 1JLBB 3OY9A 3P4UB 2WTFA 5FD1A 4LIWA 1CJKB 2HQ3A 1SQGA 3B6BA 1SIWB 2H65B 7FDRA 1M90O 1LKZA 2CQ0A 3JSYA 3T1YF 4B9TA 4IDKA 2B6AA 3UN2A 5KT7A 4BRIA 4NI2A 4OVLA 3J81O 1X1PA 4DBQA 4E1NA 4I9LA 5GAGU 4OJ3A 3FK4A 3Q2TC 2ASLA 4KPYA 5BN8A 2F8SA 3HHLC 4GVBA 2AGOA 4ID8A 4FS1A 2RHSB 2RQMA 5TKWA 3QESA 3P45B 1I1GA 4DI6A 1Q81O 1A5WA 4B9MA 4CEOA 4F8RA 5FDLB 3LM2A 4B3OB 1RP5A 3HJVA 3B8HA 3M6UA 4KH1B 1FO1A 2DHGA 3QWUA 2G13A 4JI3F 5KFWA 3N4PA 5HJXA 1S99A 4EO6A 4C1NI 5LJWA 3OPKA 1H0HB 2HBYB 2PYLA 1SC4B 5HAOA 2B9YA 4MK8A 4CJUA 1IBMK 1VI7A 2Q31A 3UVJA 3MM8A 1LWCA 2RQKA 2BH1A 4OHWA 3JS6A 3HI9A 1GXTA 5DLGA 3ZYYX 1KRPA 1M5KC 2ITMA 4A2BA 1UEUA 2DXFA 2BRLA 2B4OA 3WXMB 3JQMA 2FC8A 4ZCMA 3NS5A 1B0PA 3GYXB 4WBFA 2L9WA 4J91A 3NGKA 3GG1A 4OZ3A 1EHWA 4HLBA 2X1BA 3NGZA 2M8HA 4H4MA 1MNEA 3ET6B 3A1YG 2F63A 5IV4A 4DUZF 2QMXA 2W9CB 4DZ6A 3VAHA 1RDCA 4JI3K 3Q8RB 1VK0A 4RW7A 5AQLA 3ZEUB 4PR6A 5KFPA 4MQ3A 4OPJA 2YVSA 1GLBG 2KHDA 3PIOL 3KK1B 4ED8A 3O9SA 4ISFA 2PAVA 4WXWA 1NOYA 3PVXA 2M0GB 3G6XA 2KXFA 1C0UB 2XYGB 2YH0A 1I94J 1WBBA 2KN4A 3DKDA 1P27B 3ZO7A 2O8CB 1D3WA 4F67A 2YV0X 3UD5A 4MK7A 5KFQA 2EK1A 5H9EK 3AA8A 3AV9A 1D0EA 4YP3A 2FJAB 3GZ7A 4JOUA 4Q8EA 1X5TA 2AYEA 4J9SA 2NXNA 3TZXA 4FCYA 2ZH1A 4QR1A 3THWA 1GQEA 3AOBA 1YJNN 2V68A 2FBXA 4DUZK 2QMWA 1LAVA 4ES1A 3M5RA 4ZPVR 3FSXA 1SKWA 2ZFHA 1H73A 3BBFA 4K4UA 3OS0A 3CD5A 3M3ZA 2BYCA 4RUBA 4ENOA 4JKFA 2E44A 4DU7A 2OGUA 4X4NA 1HBMA 1FFWB 1BY9A 2OPQB 4OZ0A 2V52B 4TY8A 3HHDA 1FX4A 3OXGA 5GAHU 3T9NA 3K7RA 3MAAB 3C6HA 1KVCA 4LJMA 1SJ1A 2XC9A 1FK9B 2AJ4A 5KG7A 2ATQA 2V8GA 1GLCG 2ZGZA 1W0HA 2VG5B 4E3SA 5EGYA 3W5YA 5IM0B 4FM0A 1RBLA 2UXBF 5KFVA 1M5VC 4PAAA 3MXJA 2FHJD 4U6PA 1HYSB 4PWWA 1HW8A 4KIAA 4P2XA 3FEXB 4P2FA 4AM6A 3VQBA 1YIJS 4DB3A 2OPRB 3MUMP 4JD2B 1WKLA 3CMQA 1W97L 1WSIA 2CWKA 1C1CB 5E84A 3VZHA 5EDWA 3SUPA 3T6BA 1UW4A 2WSEC 1HFEL 4CLKA 3W2VB 4HHJA 4CI0B 4USKA 5AJ3F 1BD6A 2QWQA 2FBVA 4O3PA 2DK2A 3M8QB 1TL4A 1XNQK 4K5SA 4Q5VA 3KUHA 3N01A 1CPZA 1RDRA 3FBBA 4OHZA 4BC9A 2P9IA 3K5NA 2HNZA 5MLCV 1WSHA 3MCSA 4I6WA 2CPJA 4BDYA 1NSQA 2CPFA 3BM7A 2X7IA 3VHQA 2CQIA 4KGKA 3QERA 1HQEB 1DKGD 4DPYA 1NBEB 4J5OA 3W3SA 1HL6A 2GV9A 3UFCX 3QJJA 4HT5A 3O80A 4IDKB 3HTVA 3PEHA 2B6AB 3M7VA 4RKUC 1T6CA 2ADCA 4CZLA 2VQFJ 2B4VA 5JJBA 3QINA 1F3FA 1U0HA 4DL3A 3BPDA 5IS2A 3SYZA 2IJNA 3AVCA 1FTRA 4JKDA 1BE4A 2DGTA 4C97A 1UZDA 2YWKA 1F21A 2NRVA 2GO8A 1B9DA 3JXUA 2KT5A 4Y0FA 2OI2A 2KRBA 4BRDA 1OSCA 4QPTA 5AJ3K 3HKZD 2MYFA 2LFVA 4KHPK 2I5JA 4D3HA 3MDQA 1S9FA 4ED6A 2W8LA 2FY1A 5AQKA 2CVEA 3NGSA 2P9KA 4BC2A 3PEJA 2VQEF 4DV0K 1EETB 2Z1JA 1WNSA 4L6V3 5CXTA 4ILRA 3PM9A 4KGZB 2DGQA 2DBBA 2E6LA 2VDIA 3OVAA 3VERA 3HDSA 2RMLA 1FVSA 1NK4A 3L09A 3O9UA 3HSTB 1CC8A 4BC4A 2JVOA 3NKYA 1PIEA 7AT1B 4DS4A 3UVJB 3MM8B 2RF2A 3NAHA 2E1PA 5KFJA 1CXUA 1FWPA 2HHWA 4K50A 1ZBLA 3LF0A 3TRGA 3FZBA 5CZVA 2PZSA 4KHWA 4IH5A 3TYTA 2ZOMA 3MR3A 3S41A 1Z2ZA 2FQQB 4C6AA 4NE9C 2QIFA 4JI1J 1AW0A 4M5DA 3EDQB 3RMAA 4ICLA 3DOLA 3HPOA 4IKFA 4C11A 3IR7B 1BXNA 3E01A 2WVCA 3GL1A 3OYBA 3QLHA 3R6LB 1UVIA 2YKNB 1BMQB 2F65A 1E6VA 2FGCA 4H4MB 4B9NA 1Y11A 2VH7A 2OTLS 4RBTA 2VQEK 1XUPO 5AFUA 1YVFA 2F4FA 4FXWA 3VQSA 3BO3A 3U8XA 4RPFA 5HN0A 3SQGA 4IXCA 3OFEA 3DLGB 3IS9A 4RW7B 1D8YA 2BUPA 4Z4CA 1U6BA 2JH3A 1WHYA 2YWFA 1JJCB 2QX0A 2G0JA 3AVKA 4DV1F 5BREA 2NPFA 4K4TA 4WF9Q 1XMOJ 1RXOB 4V19S 1Y4ZB 1UWBB 3AO3A 3AVAA 1ASVA 3NGUA 2CUYA 4CERA 2DGXA 1RISA 4FWPA 4IO9Q 5C15A 3UKUA 2ZITA 2F9TA 3P6YC 1RLCL 3VPZA 1NPKA 3M1FA 2HPUA 2VASA 3DXSX 4IOBA 4IOCL 3V9UA 3R7NB 3C19A 3NDKA 4IKAA 4DTXA 1K47A 3BKTA 1RT6B 3I5CA 4QWBA 3OYIA 2RU3A 4ZA1A 2K8GA 3EZUA 3V2UC 4JKAA 1HPZA 3B54A 3KMSA 3PACA 2HFVA 4L76A 4KH4A 3R8YA 4V19J 3SLCA 3CC2N 2P9SA 4RW9B 4KHSA 5E33A 1N34F 1KSPA 4M5LA 1TL1A 2ABYA 3Q8UA 5EX5A 3KWMA 2BJ9A 4KKOA 2O4IA 4G6VB 4DV1K 3M4XA 1IR2A 2DH8A 1HBMB 1NAQA 5DM6L 5M1FA 1S49A 3G0ZA 3VQ6A 2HK3A 4TY8B 4CHQA 2Q1NA 4H5RA 1VISA 2AX0A 4ZTJA 3KOAA 2B5JA 1WHWA 1QS4A 5GAGP 1APSA 3KLEA 5D15A 1I51B 5JMVA 1Z4UA 3D2EA 3TSUA 1IKXB 2Q6BA 2AF6A 1DZ5A 2OPPA 2MQOA 1RDBA 1VQYA 4BS2A 4H54A 3PYDA 3KK7A 2GMJA 4RWTA 1WEZA 1BL3A 1O51A 3SQ2A 4DCJB 1RFQA 5DRKA 3CCEN 1VQKS 2GJIA 4QOTA 1O8BA 1FJCA 3HSDA 2L9DA 1FKPA 4PG6A 4K7QA 4ETZA 8AT1B 1UTAA 3V6JA 3LDLA 4LH5A 4LBHA 2FZGB 2RRAA 1GMWA 1MWQA 3UN5A 3SZ2A 3AARA 1HNZF 1PYTA 1WOPA 2BE9B 2G8IA 3KJQB 2KQ2A 1R0AA 3BKUA 5IT4A 1VQ5S 4LF9J 2G8UA 3AOCA 2WVDA 1DTTA 2HNZB 3C94A 1T7PA 1HBNA 5KFMA 5BPNA 1T11A 1RWXB 5IQ6A 3NVKA 1CVJA 1OH5A 2HFNA 3HZEA 2QSFA 3IXQA 4OX7A 5CYJA 2BE2A 1DQAA 3RGIA 1Q5YA 1ASUA 5A8RB 1NWKA 3LOUA 4N41A 4FXVA 5HANA 2ZJPL 3DU5A 2C3PA 5F8JA 3BB5A 2W7PA 1EX4A 5DLFA 4KH0B 1U0HB 5D78A 4U7UK 2A1RA 5I9EB 3KHYA 2YBVA 5JS1A 1OVYA 1R8CA 1O13A 3W9HA 1XHZA 1WELA 1N5QA 1Q8IA 4JI2F 5J1EB 2RB7A 3MMCA 1UETA 5LSRA 2QA1A 5DM7Q 3NL0A 2WZ1A 1G99A 5EU7A 3H25A 3D1HA 2PMWA 1N32J 2LCWA 3I56S 3IRXA 1TK5A 2CQBA 2XZWA 4CO4A 2ZDPA 3M1VA 4IO8A 4KJIA 4ZPTR 4AQYF 2ZWHA 2OFGX 4YDUC 5AQXA 2VDHA 3H2UB 3RR8A 1U6FA 3N6LA 3RTVA 2L48A 3CJQA 1HNIB 3W5ZA 4DSKA 3L2WA 3JTNA 2RF2B 3RBZA 2BMBA 3E9OA 1IR1A 4YB1P 2VFVA 2KKZA 1QQMA 1HNXF 3KHGA 3GYNA 4WZQA 1Q8LA 4UQGA 3R7SB 2RNEA 4F26A 5ETQA 4PXEA 3CM5A 3CCWA 4PQUB 4M5DB 2BUNA 4WZMA 4ZTFA 1S1WB 1K73O 2BRKA 4JI2K 5J2NB 4ICLB 4FN5A 3DOLB 1NXIA 2Y1JA 1TR0A 3CJ2A 1S72S 1Y3JA 4C4WA 3PFEA 1GEHA 4WFYA 2JDJA 2ZHOA 3OSNA 1M5HA 3GIMA 4JI5F 4FK0A 5BYSA 1YHQS 4EMDA 2WUSA 3J80Y 5GAHP 3DLLL 1X4FA 2DITA 3BQ2A 2OMOA 4ER8A 5FIIA 2B4JA 4ILJA 3AQPA 3FCVA 3H20A 4NLOA 2FVPA 5I3QA 2R8IA 4B3SK 3IS9B 3BN4A 5L1KA 4BVOA 4ZLNA 4ZITA 3VEZA 1CZ9A 3C95A 2D4WA 1JB0C 1HLWA 4OYZA 5HI7A 2B9XA 9RUBA 2R2RA 1DQ8A 4DU1A 3PW0A 4IR9A 4ED1A 1OSDA 1IBKF 3PJWA 3QB0A 2VJUA 2UP1A 4Y2MA 2CPYA 3UKUB 4O5BA 5IFMA 1JJ2M 4QCLA 4B3TK 4FPBA 2AJ1A 3QGGA 3OL7A 2BM1A 3BP8A 4BR9A 4X4RA 4LIRA 4JI5K 4YDDB 1HPZB 1N5TA 2B9WA 4DQPA 1FWLA 1ZTTA 3CJBA 1VQ9N 1K8AT 1L3SA 2QC3A 5D0GA 4OYIA 4CK2A 4DG1A 1XJWB 4NXMF 5DK5A 1TTHB 4IR1A 3OW2R 2F4VJ 3IM9A 2CJAA 4A61A 3IG1B 2W42A 2P9LB 1GAOA 3ENHA 3WQPA 5HMXA 1K73T 4ED3A 2OPSB 5ETOA 4NXNK 5KFDA 3K5PA 4DQRA 3AXMA 2XO6A 4RO0A 4J37A 3X3UA 1CJVA 5FPMA 1WG4A 1RT1A 1WAJA 1IBKK 4KRFA 3AB2B 2DNMA 1NGEA 1PJ6A 3I4HX 5BRFA 4OX9J 3Q8SB 3ZTOA 3D2EB 2CKWA 3P38A 2WVBA 3QIDA 4ISEA 2GHVC 4NLDA 3E9LA 3DFEA 3F5TA 2KM8C 3J81j 3EGNA 2KH9A 4DTMA 4Q2MA 4JI0F 1X31C 4X4SA 1EWQA 3R1HA 1MROA 2GIQA 4ID5A 2FD2A 2EFQA 1QAYA 3HFKA 4C98A 3V5RA 4KBOA 4M3UA 3FC9A 5KFTA 2ZM6F 1J6ZA 4OKKA 1R0BG 2PN6A 1YWXA 4F3MA 2D69A 2PDAA 4DN9A 2W4PA 5M2PA 4WFXA 5SUHA 2F7TA 2LVWA 3HX9A 4QIVA 2CJYB 2HVIA 2GC8A 5FLXU 3U3YA 3AVHA 1T44A 1XMQJ 2W2PP 3NFAA 4O0JA 3ETMA 1HBOB 1R0AB 1DLOA 1K44A 3CFRA 4LRCA 3SQ4A 4MT1A 4MO4A 1RWWB 5E26A 2VG7B 1ZM3A 3O08A 5IWAF 3J7YI 1TAQA 2OTJS 1YLXA 4CF0A 2ZZTA 1SQFA 3OR2B 1S1VA 3OBWA 3ZZOA 4CWBA 3D3CJ 3DYAB 1ESVA 3B4MA 4JP8A 4LF7F 3ATVA 2VCPA 3D0GE 1XBWA 1H98A 1TUGB 3ZETB 3QMLA 1RT4A 2QLBB 3VESA 1ZM9A 4MKBA 3O1LA 3IWNC 1JLAB 4CJPA 3TQ1A 4DL7A 4NPOA 2DVIA 3TR8A 2IVOA 5DS7A 1YIJN 5KFFA 4XIUA 2XGPA 4CF2A 2FSKA 1VBXA 2V2VA 4IUFA 1WEXA 2LA4A 4NB4A 5EVZA 1RK8A 3TAMA 2AJQA 3VEYA 3MMCB 3FE1A 2AMCB 2V4JB 1QE1A 1KLMA 2K3IA 1IM4A 2RDIA 4P74A 5IC4B 4A8XA 1IXKA 3DMJB 4LF4J 4MAKA 2ALZA 3NH1A 1ZETA 3WEEB 3D2FB 2HHHJ 1S9GA 1VYAA 4JI7J 1JXLA 4DEZA 5DG7A 1XHXA 3IRXB 3PRVA 4TU7A 1EB0A 3SSRA 4CJ7A 1J5EJ 5IWAK 1T9YA 2DHAA 2CG8A 4A4JA 1VAZA 2D0AA 2AW0A 3LDSA 2KB2A 3AA2A 1HHTP 3DU6A 2A3ZA 1MN7A 1M5SA 4LF7K 2BANA 4HL9A 4WPAA 4FS2A 1RT3B 3IRWP 3MOZA 5G4DA 3M05A 2ACYA 4XH5A 1YZ6A 5KOXA 3QIPB 3LGMA 1VHFA 4HACA 4N5SA 4NL5A 2HHUA 5CR4A 2R9LA 4J90A 2NLXA 4B3RF 1WC4A 2BKNA 4K4ZA 1FNOA 5BR9A 4DV4F 3RRGA 2AT1B 4CTAA 1T6DA 4ZJOA 1UEVA 4KAZA 2PI4A 3NS6A 4PWUA 3DLBA 4HCBA 2CZ9A 3TEHB 2P5VA 2WOMA 3H7HB 4DFPA 3E1YA 4U7CA 1Q7LB 1T9TA 2C2RA 1PBUA 1NSPA 2PY5A 3W0LA 2X1AA 1T94A 2YWHA 5ETVA 4U7BA 1K1QA 3PW5A 4MIAA 1SKRA 1UJ5A 3CO0P 3L0QA 3RW6A 4LFBJ 2P51A 4G1QB 4DSLA 2HZCA 2YCHA 3ELHA 3M6GA 3MN7A 4DQ8A 3KD1E 2GELA 2OD6A 5EN1A 4ZVFA 1NHVA 4Y2IA 3U3GA 1KHVA 2F1FA 3HMJG 3CJAA 5KFYA 1S4EA 1UFWA 3OA9A 4ZIVA 2QA2A 1ZAXA 4B3RK 1V9OA 1MMDA 2JHEA 4OLBA 1UMJA 4PKDB 3MPWA 2HVHA 1GLAG 4DV4K 1UCNA 1Q53A 3QJPA 3GE9A 4X4VA 1CULB 1Z05A 4JKGA 3KLHB 4OHYA 4LRBA 3KYLA 1RT5A 1VQMN 2W41A 1U25A 3IAS9 4ZJLA 2DXEA 1V3SA 3BF4A 4NRTA 2HNYA 2NXEA 3QFUA 2OTLN 2WB1D 2B43A 3UNGC 2HMPA 3GFYA 1D8ZA 1K8KB 4ID1A 3IO1A 2YKMA 2D0CA 3OYCA 3G6EN 3SFUA 1N8RO 1I3OB 1QVFR 4PCQA 1UAWA 1VJQA 1JQGA 3BBCA 3MM6B 4NO7A 2CA9A 5AXMA 4IH6A 4R0JA 1VSKA 4JI6J 3MXIA 4FOIA 4FP9A 3FCHA 2A0FB 4PG5A 1VLYA 5LMUF 4CJRA 2I7PA 5AQRA 3GPAA 3GB0A 1SC1B 3KNGA 2FSJA 2ZKTA 2OIHA 3PX4A 3L7OA 2HLUA 1MROB 2W9AA 2YNFB 3D66A 3RYLA 3IC1A 4R5PB 4EO8A 5FPNA 2YI1A 3CD7A 3D0IE 3J7ZT 1MU2A 4DX7A 2DRAA 3DM2A 2LXFA 2R2TA 2XSFA 1JWWA 1E6YA 1CZBA 2RE2A 4EBDA 1XWLA 1FT8A 2HYIB 4CGGA 4JB8B 1P6TA 4RLEA 4GKJF 3H5SA 5AXKA 4QS9A 1RA6A 4AHTA 4O0IA 4ED5A 1XI1A 3MEEB 1NZAA 3VEVA 2F9JA 4M3TA 1DLOB 3ZX0A 4EU0A 3I9ZA 3ZTQA 3ENWA 3HHLD 2C3UA 3I8DA 2RU9A 3OYAA 3DJCA 1CG2A 2KL8A 3T5LA 5LMUK 3HZGA 3R8EA 2GQQA 1HR0F 3CW2C 4PKGA 3SPYA 3H5XA 2GZOA 5CH7B 4BGBA 1RNHA 4FK2A 5E3AA 2QKKA 3ZX2A 1S22A 1VQOS 4CZJA 1G1XA 4CLLA 1N56A 3J81U 5D4PA 4YY3J 1RT4B 2O4GA 2HBKA 2DFFA 3HVWA 3S3MA 4X4PA 4YDUA 3JSMA 3T1HF 2GTDA 2WSCC 2YHAA 4BRQA 3SFGA 2MZSA 1L3VA 3K0JA 2CZVC 1PO6A 4BRHA 1BQXA 5C24B 2H3GX 3HPGA 1D9AA 2QGFB 1VQKN 3T6JA 4M3RA 4NCGA 1YSJA 2GO9A 1OJ4A 3L7UA 2R7SA 2V0NA 1S9GB 3PHEA 1RAGB 4QYZJ 1FRMA 2OZSA 3C6UA 4CRJA 4JAXA 4MYTA 2ROGA 3UDLA 2NZCA 5M1NA 3QEPA 3MXMA 3EXYA 2LU2A 3VQ5A 4A48A 2KG1A 4LSNB 2AYGA 4FM2A 1IBCB 2VG6B 2ZVIA 3DOKA 4IYQA 1VSDA 3QO9A 2QWNA 4CEBA 3VEWA 3EVOA 2MY7A 1F9EB 3T1HK 3VQ7A 4LR7A 3NOCA 3KJVA 1OPIA 2QN6B 2YKPA 4NLYA 4PKIA 5JUMA 3HJFA 2MLYA 3C14A 2GJ2A 2MJUA 5GADI 5HMYA 4B9VA 3EPGA 2XMTA 4JI4J 2DFEA 2QLXA 3D67A 3UO0A 1SKSA 3U27A 1VJWA 2PC6A 2P9CA 5K14B 3MUTP 2EX3A 2HB5A 4DN0A 4KGVB 1YGYA 4CEDA 1M0SA 3KD5E 1X9SA 1PCAA 1H74A 3LANA 5B0FA 4CEEA 2ZWPA 3N0VA 4ZP9A 2MKYA 4FWLA 2A5XA 4FVMA 3NNCA 4ATNA 3QZ7A 1J53A 3TABA 1RCHA 3RRKA 3K5LA 5ADXH 1JLGA 3IBFB 1IWGA 3OQ2A 5IXUA 1WI8A 1GLDG 4TN2A 3E8OA 3I56N 3O6QA 4ZLPA 4DWIA 2B3TB 4J2AA 2BW2A 1R6YA 3P83D 3HXMA 2J7WA 4JV0A 4JKCA 4BRGA 2JNJA 3RSEB 2V51B 3RB6A 2Q1LA 2BGGA 3QIOA 1XNRF 3HHKA 2OMLA 2O66A 1TL3A 4F36A 1OH6A 4YUDA 3B8AX 3DHWC 4BRKA 4N8NA 2W4DA 3LP2A 3U7JA 2P1JA 3UB5A 2FLLA 4RW4A 5HRNA 3H3OB 4MJKA 2W24A 4ZHRA 5A6WA 1JCGA 2ZBIA 2KZZA 1I5OB 3GV5B 1NGGA 3H08A 2IVYA 4JKGB 1VRUA 4WYLA 2QLFB 2MPUA 2QYGA 1S72N 1KC8T 4CLPA 2JLEA 2VICA 1P1LA 3WUHA 3DXBA 1RT5B 4MDBA 2D3O1 3G87A 2KYXA 1YHQN 3T1YJ 4E0DA 5LT5A 1IBMJ 1OIAA 1UW9A 4CFBA 2VPYB 3H90A 2VKZG 1H72C 2ASOA 2ZWOA 1MWMA 3C46A 2C2OB 3CJTA 1XNRK 1Q5VA 2WB4A 1XTZA 3AVBA 1FA0A 2HBZB 3H46O 4CZIA 3TTDA 5HVHA 2C3OA 3RB4A 4PYAA 2DCUB 2F5GA 3CC4S 4N47A 3LDQA 3TAQA 1YJUA 1I3AA 3KK2A 4LRAA 5AR0A 5I3UA 2NXUA 2D9PA 3F0NA 5J2PA 1ZBIA 4WP3A 3PR5B 2PFUA 1VC6A 3QT5A 3U1NA 4C8ZA 2QV6A 2HKEA 2AQ4A 4JLHA 4PWDA 4AXIA 5F8IA 2BOPA 1HBUA 4E89A 4JI3J 1WDTA 3DLKB 1MU2B 2ROEA 4DMNA 3CJKA 1NK7A 4RNOA 1H7WA 2GS8A 4PG4A 1OPZA 4UY8O 1FRXA 4DR1F 2AJ0A 3QSIA 4K5RA 1SL2A 1WOSA 1S6PA 4Q0BB 4Y2KA 4CEZA 1Q4RA 2B56A 5ETSA 4H0PA 2V4QA 1SJ4P 3CCSS 4KH6A 3H5UA 5H9EJ 2KYZA 2DPIA 2VC1A 2IBOA 1F9FA 2FIUA 3OHBA 5B7WA 1BQMB 1NJIO 4NLSA 2ZH8A 2E8AA 4RNMA 1BGXT 5AQFA 1IUJA 3HSZA 3NP5A 2HQIA 1U2VA 1BA1A 4GRSA 1M1KO 2YNHB 2V8HA 1KQGB 4JS5A 4DV3F 3QATA 1R8HA 3HP6A 5HP1B 1VFJA 2O8FA 1VSIA 4DUZJ 3RMDA 1HHSA 3RB0A 2WSFC 1Q1KA 3QMQA 2CJQA 4A8YA 3B6PA 1RTIB 3CJRA 3JSMB 3THYB 3HLUA 1DGKN 4OYOA 4ELUA 1NNEA 4H4OA 2GCFA 4CIEA 5C25A 2RKIA 1ZXOA 2IY5B 1Y3KA 1WC6A 5BYQA 2XMKA 1WBDA 1GTHA 2GIFA 2ZH2A 4FVCA 2I6WA 4NCGB 2VODA 4K4SA 1YRXA 3BH6B 4DX5A 4FVUA 3D0HE 2XHCA 5L39A 4FO0A 1GTEA 5HL7Q 2P6TA 2GMHA 4A5AA 3C6UB 2Z1GA 1VC5A 4LF6F 3U4LA 2ZF5O 2FJEB 3KHRA 4UY8T 4DV3K 4CJQA 2VPZB 1FFSB 1U0SA 3K89A 2ZC3A 3IN5A 2XZDB 1Q86O 1NLKL 2YNGA 2E1RA 4JKEA 3C8YA 2OTJN 2N7CA 4DFMA 3DRPA 5AQMA 1BWEA 4ZLLA 2HHTA 3QO9B 4JEPA 4FBTA 1TUYA 2E7WA 3C14B 4WQ4A 3DLEA 1NJIT 3BEGB 2ZH5A 1WOQA 2HFZA 3HOTA 3D7SB 2D0PA 1AROP 1EAYC 3GQCA 1A5VA 3CCTA 1KVKA 1Q0NA 5I42B 4A59A 4XDDA 3QNNA 1EWRA 3M30A 4ISGA 2A2CA 2IM2A 2CPDA 5DM7L 1REVA 2BEFA 4RR5A 1DTQB 2UXBJ 3G4SS 3NF7A 5L46A 3HI0A 1JMTA 4ECYA 4KGMA 1S1UA 1RQ0A 2QE5A 3GSDA 2BACA 2W1BA 4DSFA 1PSDA 3GFZA 4U95A 3OLBA 4TXSA 1NGHA 1IJEB 1OYEA 4A2AA 1Z1ZA 3SSQA 4AE5A 2R7WA 2FLOA 1SQEA 3OJUA 4FKXA 3JAMO 1XQSC 2E1YA 2OCEA 4I56A 2K1RA 1X4HA 3VAGA 4XO0A 3OYKA 4R25A 4AHVA 1T05A 4OI3A 1CZAN 4BC3A 2XS5A 2JRSA 2XY5A 3VF0B 1FXXA 5AJ3J 3MEGA 1N5VA 4ZP6A 1OWXA 1FE0A 4GY2B 1S6QA 3M9MB 4Y28C 3K8WA 3F9KA 3CIMA 4NLXA 4E7JA 4ZHRB 3MEKA 3PKMA 1YBAA 1R7IA 1N36F 4ZCLA 3ULHA 2EW9A 1VRUB 1Q86T 3GDQA 2YX7A 1AUDA 3PHTA 1KQSM 5KRSA 3OSPA 2AP1A 2CJXB 3V6KA 1C0MA 3D6FB 4CEFA 1CLQA 1ZYQA 3E66A 4PXBA 1F2GA 4W4MA 1CJTB 4XK8C 4LSLB 1U8SA 3MFHA 4BRPA 5LL6Z 3BR9A 2Q6CA 1C4AA 3DXKA 4LBIA 2DXDA 4FJ7A 2QK9A 3KLIA 4TU9A 4AHSA 2HWIA 4DR6F 4FK4A 2M2BA 3LDPA 1WOOA 4PKHA 5AQWA 3I55N 2V8VA 4DL6A 4YHHK 5KG0A 3DXMB 3CUNA 5I3UB 4OGEA 4CZHA 2CPZA 4DQSA 3ZNJ1 3HO1A 3UCGA 2AEMA 4FM1A 5GMDA 1X9WA 2KRRA 3UDCA 2VQEJ 3OL9A 5D0RA 2XI2A 1HBUB 3DC2A 2KT2A 5E3RA 3R9PA 2J7KA 3ENBA 1L5UA 3ONQA 3CJKB 1TYQB 3H4BA 4NASA 3S9HA 1SJ3P 2IS3A 5HROA 2JLGA 2XB2D 3BBBA 4RCHA 1WORA 1RABB 3MMJA 3ZZZA 1IVZA 2IBKA 4OIXA 1P9QC 4IQXA 3AODA 3C0BA 1MN9A 3WC0A 2Z2ZA 4RBUA 1QQCA 2XZTB 3THXA 1V3RA 3DRSA 1YRTA 1MA9B 2HSTA 3DDKA 4DR6K 2YWEA 1EP4A 2A1SA 2HHXA 1KN6A 1URRA 1N5YA 4CYUB 2EBGA 3MCMA 1U2VB 3NG8A 1KXPA 1F5BA 2QWLA 3OUYB 4F3QA 2DR8A 4GMKA 4X66F 1RTDA 1IO2A 5U47A 2Y1RI 1GXUA 3HRGA 4KHQA 1TKZB 3DDNA 3WX8A 3O9QA 3QBWA 5GVQA 4B9SA 3WNFA 2F4VK 4B1UB 3ZT3A 4CHOA 1SJQA 2DPNA 1VK8A 4H4OB 5E3CA 2LQ8A 4DV1J 2LQJA 5E5NA 2RKIB 2XEXA 3MM9B 2D41A 2POKA 1WSRA 3OTOK 4I1TA 4HYKA 1UL3A 4TQRA 1MDUB 3OHAA 4IBNA 3A4TA 3TP2A 5D3GA 2XG8A 4RG8A 1RAAB 2E88A 2EHGA 3AO1A 3MAQA 1O1WA 3DI6A 4OX9K 2RRBA 1F3VA 4KHUA 3MR7A 4F50A 1Y00A 2CNLB 1JLFA 1KTVA 4ZIWA 4P75A 3MOJB 1OH8A 1MSWD 1S5JA 3LTOA 4YOYA 1U1NA 3GWCA 4X66K 5AQVA 1NM2A 2GWJA 1T02A 4NLRA 5JVGQ 2QXLA 4NLBA 1AB8A 3LPEA 2YNGB 2DY9A 2JVRA 4JYAF 3U9DA 2LQ9A 4DV7F 3QRRA 4TVAB 5LOQA 1BC6A 1N34J 4X64K 2J9DA 2FHKA 1DURA 5B0CA 4YEAA 1NU4A 1VQON 2E1AA 4E1MA 1IJJA 2A6MA 1C0TA 2WW4A 4F4XA 3RZAA 3IDHA 3IWLA 3O3FA 4FBUA 3FZHA 4CZEA 2BDPA 4NYPA 1Y5LB 1XMQK 2CG4A 4CJKA 2VBZA 3M30B 4MFBA 2Y0SD 3P4IA 3TSQA 2VD3A 3I9V9 1T3OA 1T95A 1BLUA 3TSPA 4E7LA 3D4JA 3AB4B 5KPRA 2AIRB 5KFAA 2M88A 2YPZA 3KJFB 1TL5A 4ED2A 1IKWA 1H2TZ 1FI4A 2MMYA 5KT6A 4PPDA 5T7LB 1TV6B 4NLTA 4FWSA 1SB6A 1SL0A 4PUOB 3RAQA 1YRUA 3TARA 4DV5K 1RHUB 2HGMA 2MZ1A 4IZ9A 5GAEU 1Q82O 4HWIA 2DNOA 3C7NA 3GE1A 4DV7K 1S5ZA 1DJ0A 1XN9A 4DCOB 3VGMA 3OFGA 5ETLA 5HATA 3V4IA 2YKAA 4DTRA 3LDOA 1DRZA 4BE1A 2W7AA 3MEGB 5HVFA 5CD4H 5B08A 2VL1A 3PY8A 5CHIA 1S6QB 1Y10A 3DRXA 4CIFA 4LF4K 4JN4A 2J0WA 2ITGA 2EK6A 5LSOA 2GA7A 5DQGA 3KLGA 2HHHK 3H4DA 1U26A 4H0XB 1R31A 2FHJA 3VEXA 1ACMB 3GFHA 3E3XA 4O5FA 1HMVB 3OS2A 4CESA 1ZA2B 2LYVA 2YX1A 5AQYA 2R4FA 3K8VA 3ZTSA 3J7AP 2UXCF 4I2PB 3BQ0A 3ENOA 2XMAA 2QA4G 3ATUA 3D54A 4WKRA 3MMAB 5F8MA 3NAIA 4OPKA 5GINA 3KLIB 2BQUA 3CULA 1NK0A 3BKFA 3ZLJA 4JI2J 2HGNA 1KVAA 1NGDA 4UOCA 3J8AA 1KBRA 4KHRA 2DRDA 2PMHA 5J2MA 3D1OA 2QO3A 1KQFB 2Z1HA 4CM2A 4IRDA 2FLNA 1JIHA 3RBEA 2KTQA 4URQU 4ZN3A 1VQ7N 3ID6A 1MWKA 1HNWF 2X6SA 2PT0A 2KDOA 4AQYJ 3HVAA 2WBRA 1HHQA 1TKXB 1TUUA 1NZ8A 4GO5X 2MLZA 3C66A 3HULA 4G1IA 5HO4A 3Q7BA 1NNDA 5DETA 4UW2A 2VFSA 4JKBA 2HZAA 3HBTA 1KQKA 2OUGA 4HHHA 4QR2A 1EKSA 3QZ8A 4WIQA 3A5MC 1U04A 4KI4A 3J7Z5 4H0YB 4JRQA 4LFBK 1IV0A 2V50A 1IKYB 4BBYA 2IPOB 1HNXJ 3MCOA 3T1AA 1JL1A 1LW2B 4USMA 3S8SA 4RU2A 1E4GT 4ZVRB 5A8KB 3DRSB 5AXNA 1V4SA 4FLVA 1RT2A 2D74B 4O4RA 1N5YB 2XBPA 2QEXS 1UVKA 3QPIA 4I64A 4QWAA 3LUYA 2PEBA 4JI5J 2HBMA 1AUSL 3CCMS 5IT0A 2HBLA 4HT7A 3E9PA 3CC4N 4E7KA 5L1LA 1BI4B 1FERA 1WSVA 2LXUA 3J80O 2QWOA 2VHGA 2YHWA 4USIA 3PRDA 2P6SA 3GV8B 4HTUA 3CDAA 3SMZA 4K43A 2LMIA 3O1WA 4IG0A 4DOZA 2ZH9A 3UKRB 2WCXA 2BJ8A 3DLRA 2HVEA 4DR2F 4LFAF 2VBYA 4CFAA 1P1TA 1WAFA 3TA0A 1IBKJ 3WT0A 2LDYA 3MZIA 5D3GB 2PFFB 1NPPA 2H1YA 2RS8A 3A12A 4OYXA 3CCUS 3VQCA 3V6DA 3AY0A 3LA0A 3DOMA 4BR7A 3UE5A 1ILYA 4NLPA 4H4KC 3SDEA 5CYQA 1OQ6A 4R8UB 2P5GA 3K5MA 1CSJA 2NRTA 2N3LA 2UUBF 3NHGA 4U96A 3PJXA 3KVGA 2C3YA 3M6VA 1D1UA 1H2VZ 2AHOB 2NREA 1QVGR 1LNQA 5CYMA 3H3NO 3P8BB 3KZBA 5KI6A 1X4EA 4H03B 3N5BA 1DEJA 4RJVA 4NXMJ 3HM9A 2C22A 1IKVA 3AO2A 5B0GA 2IMWP 2ZOGA 4FJMA 4NRUA 4X62F 5G0RB 3QT7A 3HD2A 2EFNA 3FMWA 2LU1A 4LREA 4CZMA 2AD9A 2DNKA 1TP7A 4BE2A 3P49B 1KVIA 2MZJA 5FROA 5EXWA 1PAUB 4ECQA 4P9SA 2MHNA 4RWXA 3OJSA 2I38A 2G8KA 4OZNA 2QA4S 1RTHA 4AXJA 4ZOSA 2AEJA 3QNWB 1RBRA 4F25A 2D3ZA 2VPWB 1FJEB 4EZ6A 1SV5A 3M32B 4KO0B 2OFHX 2B4UA 2Q36A 5IQQA 4FF3A 5EX0A 1IKWB 1JK9B 2ACMA 4DQQA 3KTQA 5L1IA 5AQZA 1TKTA 1IH7A 3CJSA 2XLKA 5F3ZA 3ENAA 3MPVA 4JI0J 3DGVA 1U49A 1C6VA 4CO3A 3O5TB 2KI2A 3C65A 4LSZB 1O6XA 2ZM6J 4M5IA 1KDNA 3LPTA 3C7NB 4HH1A 2IC3B 4Y34A 4KTWA 2BKPA 4JKHA 4TLRA 1H38A 4W5RA 1A7GE 2A41A 3L4IA 3V4IB 3EPIA 3G71S 3IUCA 3P5TL 1RWOB 1S1TB 1FKOA 3AVFA 4J2BA 2V94A 2FHMA 3ZNUA 5M2UA 3K58A