5J2PA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and a second efda-mp at the n-(pre-translocation) site
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2pA05
4KB1A 4C8KA 4DQQA 4DQPA 4NLVA 3HM9A 4H4OB 3TI0A 4JLHA 2Y1JA 1TQLA 1DTQB 2B43A 3V1QA 4FLTA 3HYFA 1YVFA 3P83D 1RBRA 3KLFA 3LAKA 4IG3B 4URSA 5KFQA 4IH6A 4R8UA 5L1JA 2D41A 3OHAA 4CEFA 1QTMA 4FYDA 5I42A 3ZSXA 5HROA 2XO7A 1LWCB 1LWFA 3ALYA 2QKKA 4M3UA 1NK4A 1S6QB 1IKVB 2OYQA 4CEQA 3DLHA 3KLHB 4FLWA 4EBEA 4C8OA 5FRMA 1BISA 3VQ5A 3N6MA 2YNFA 3DLKA 3V9XA 5KFPA 3IS9A 5C25A 4BDPA 1TGOA 4Z4CA 4F8RA 4E19A 3AA5X 4JRPA 1XHZA 4CHZA 3BSNA 3TAQA 4F4XA 3C6UA 4YQWA 1TP7A 1QQCA 4O3RA 2BQUA 1GX5A 2XHBA 4KSEB 3VQAA 4ECSA 1B9DA 5F8NA 5KFXA 1MU2A 2HNZA 2C2EA 1X9MA 1OS5A 4IH5A 3HL8A 2DY4A 3HP6A 1S6PA 3E51A 4KI4A 4MIBA 3M8QA 3RMDA 4RW9A 2RDJA 2AGPA 3KOAA 1EP4B 3NF7A 3CYMA 3KK1B 2YHAA 4IKFA 4DL2A 2XY5A 3T5JA 3AA2A 2YNIB 2G8VA 4CJ3A 1JLFA 5DQGA 1NOZA 4CGFA 4CJRA 5T7BA 3M9OB 1BIUA 3ZT4A 4DTSA 1L3TA 2XGQA 4K4WA 4DG1A 4FK2A 3SI6A 3RAXA 4RNOA 4MKBA 1UA0A 2D5RA 4J2BA 4CHYA 3LZIA 2HHTA 4BE0A 1KCFA 1Z25A 1RCHA 1HRHA 5KTQA 1NHUA 1IKXB 1RT5B 3M9NB 1REVA 2W9BA 4K8ZA 3SPYA 1KFSA 2R8HA 3ZT0A 1QAIA 3I0RB 3ZT2A 1U48A 4WYLA 3BJYA 1IM4A 1BI4B 2B6AB 5KG5A 5KGXA 4CIFA 4J9SA 1Y97A 4ECRA 2E6LA 1SV5A 2R8JA 3AO5A 4B3OB 5KFIA 2A1SA 3T5KA 2YKNA 3K5OA 1S9GA 1IKVA 3KLHA 1HMVB 4K4UA 3DI6B 4Q0BB 3OYNA 1C0UB 2HW3A 3VQ7A 1RTIB 3M8PA 2WOMB 3DLEB 3OL9A 4OLBA 4BWJA 2J6SA 4HKQA 4YP3A 4EZ6A 4I2PA 1JX4A 4RNNA 2E4LA 3AVGA 4HCBA 2IM0A 4O3PA 1TV6B 5KFSA 4DL7A 1U09A 4ZTFA 2XGPA 3SUPA 2C28A 1KVBA 1TKXB 4F2RA 4MK9A 4EEYA 3KNAA 1C0TB 2QXFA 2E9RX 3SYZA 3PJXA 4M3WA 4O4RA 1T3NA 3E01A 3KK3A 5DQIA 2IM2A 3VQPA 1XC9A 4NLYA 1BQMA 3AVKA 1ZBFA 3NGIA 4ELTA 1HPZA 3NF8A 3ZSOA 4CIEA 3KK2A 2VG6B 2KFNA 4KKOB 3SI8A 1SL1A 4CEAA 3MEEB 1NKCA 1S10A 4JV0A 4E7LA 1ZBHA 4NCGA 1ASVA 3B6OA 2AX0A 2ETJA 3HPHA 1JLBA 3H2LA 1YT3A 3MFIA 1WLJA 4CJ5A 3MXIA 3VQ6A 2XCPA 3QINA 1RAJA 2YNGB 3RMAA 3RBEA 3UIQA 3AO1A 1L3SA 3TANA 4UQGA 2VA3A 2UUWA 4LY7A 1CXQA 3PX0A 1JIHA 4XPCA 1TKZA 4FJGA 5C42B 3KLIA 4E0DA 4W5QA 3TWHA 4PWDB 4CECA 4FJHA 1N56A 4TY8A 5F8LA 4HHTA 4FZXC 4KHRA 3BGRB 2WONA 2Z1HA 4ICLB 1RDDA 5D3GA 4BDZA 2G8WA 4RNFA 2HHWA 3OYFA 3O4QA 5DQHA 2Y1IA 1NNDA 1ITGA 2HMIA 3CO9A 4IRKA 4BWMA 4GMJB 3RB0A 4CF9A 3PX6A 4OPJA 5KT5A 3I5AA 3DI6A 1KFDA 3NBPB 3T5HA 2ZKUA 3TAMA 4KO0A 2WB4A 4FJMA 4FLYA 1RTIA 1BL3A 4AHTA 2E6MA 3DLEA 3RRHA 1RDBA 2OPPB 3PZPA 3AA3A 3K58A 4WZQA 3PW5A 2KTQA 3H40A 4WFXA 3OSNA 2HHXA 3NGZA 2JEIA 2FJXA 2R2SA 3OLAA 3V81A 2ATQA 1DTTA 3KLVA 3KD5E 4ZMMA 1C6VA 1HJRA 2XCAA 3AVMA 4DQRA 4NLQA 2GIQA 4FJKA 1HNVB 1HYSA 4Q8FA 3HK2A 3L2RA 3TQ1A 3MR2A 4J2EA 2IC3B 1EETB 1WAFA 3PR4A 2B4JA 2D0CA 1RNHA 2HNYB 2VG6A 4FZYA 2C2RA 3TR8A 3T19A 3MR5A 2C22A 4DU3A 4FLVA 4RG8A 1J54A 2O4IA 3FRZA 4CF8A 4HTUA 5SWMA 1ZTWA 4AH9A 4R5PA 4IFYB 2F8SA 4TYBA 3SUNA 1QSLA 4OJRA 3FQLA 3VQSA 1KRPA 4QAGA 3HKWA 4PUOA 3RRGA 1R0AB 4QWBA 4ZVEA 3F9KA 1SKRA 5J2NA 4DSEA 1KTQA 5F9NA 3OLBA 1SUQB 4J9MA 3NE6A 3AVAA 5J1EB 2W7OA 5C42A 1IH7A 4KHWA 3OS1A 3BQ1A 4URGA 4KFBA 1FK9A 1RT4B 4OKEA 1RYRA 4F4KA 2AJQA 1ZTTA 4CFDA 1JXEA 3JSMB 2X78A 1Q8IA 1TK0A 1RBSA 5DK5A 1EKEA 3RB6A 1QUVA 3MEGA 2VWJA 4KBIA 1ZBIA 1TAUA 1VRUB 5KFZA 3MF5A 5K14B 3WNFA 5F8GA 4YNQA 4DU4A 1RTDA 2FVCA 3MAQA 4B9LA 2ZD1B 3AVJA 2B5JA 3IRXA 1RT7A 4CK3A 1GOBA 3IAYA 2AWZA 1WN7A 3KLFB 3L8BA 2DPJA 5HRPA 4R8UB 1T8EA 2KQ2A 5I42B 4RW8A 5HROB 3K57A 1WNSA 3QZ7A 1LWFB 4WZMA 4LSLA 4K4VA 4FW1A 1Q9YA 3VQDA 4DTMA 2FVQA 3CM5A 3DYAA 2P5GA 2YNFB 3DLKB 4CFBA 3QIDA 4J9RA 4EBDA 1YTAA 5C25B 5DG9A 2J6TA 2RF2A 4NLOA 4FW2A 1WNEA 4ZTJA 2BRKA 3C6UB 4DTXA 2HHQA 3OL7A 2RN2A 2O5DA 3QLHA 3LP2A 4X2BA 2YKMA 1SL0A 4CJTA 1NJYA 1BCOA 1RA7A 4KHMA 1JXLA 1ZYQA 5J2MA 3K59A 4DSIA 1MU2B 2HNZB 1U04A 4GW6A 4KB7A 5CYQA 4ECQA 4ECXA 2P1JA 3WNEA 4KHYA 1S6PB 4MFBA 5E41A 3PV8A 3M8QB 4E7IA 4KPYA 3QGHA 1S0NA 4RW9B 4B9MA 4DU1A 3DMJA 4FS1A 2VG5A 3I0SA 4QWAA 1RDAA 3V6JA 3QEXA 4C8MA 1KVAA 4GVMA 2ATLA 1JLFB 3ZT3A 3S3NA 4J9PA 3JYTA 4ZP9A 3FSIA 3DRPA 2HB5A 2UUTA 3Q8RB 1RILA 4RUCA 2OPQA 4ECWA 3UR0A 1LV5A 5HBMA 3T5LA 4DFMA 4DG1B 3BREA 3NH1A 2BE2A 1RBUA 1TK5A 1X1PA 4PA1A 3H5XA 3THVA 2VG7A 4J9LA 1S0MA 2F8EX 1HYZA 3CJ2A 4MK7A 4KTQA 1S1XA 3EPIA 3OYKA 1QSSA 3RR8A 1RYSA 2G8UA 1C1AA 4FXDA 1VRUA 5K14A 2IAJA 3UDLA 1REVB 1FKOB 2W9BB 1L5UA 4E1NA 3NCIA 4NLWA 4U7CA 2CKWA 3LDSA 3KMQA 5DLGA 4QWEA 4Z4HA 1VSFA 4ELVA 5C5JA 2ZD1A 3KIOA 1NJWA 3WNGA 5KFWA 4Z4GA 5HLFA 3CDEA 4ED2A 2E9ZA 5KFRA 3AVIA 3QEPA 2JLEA 1NK8A 3OYEA 1SV5B 3L2VA 4OL8A 1I39A 1RTJA 4CJSA 5HRRA 3GV5B 2YKNB 5DGBA 1XI1A 1S9GB 5KFFA 2DFFA 2HWIA 3M8PB 4YMEA 4RNMA 4CE9A 4CCHA 2GC8A 3V6HA 4IKAA 2OA8A 1S1UA 3AVCA 1HNIA 2FLNA 3ULDA 2Z1IA 3OY9A 4I2PB 3QEVA 1JLEA 4CF0A 1S1WB 4ZVFA 4LQ3A 2JC0A 1WSIA 3VQBA 3KTQA 3KJVA 3S3OA 3QZ8A 3I8DA 2C2DA 4L8RB 5KFGA 3CJ3A 4U6PA 4MQ3A 2A1RA 2P5OA 4J9NA 4NLRA 4DSKA 3SPZA 3TAFA 3SV4A 3CVKA 3H98A 1VSJA 3SFGA 3E01B 3CIZA 3KK3B 3Q8PB 3P1GA 3M8RA 1ZBLA 1NK5A 2WTFA 1WSHA 3HVRA 4E7KA 3MXMA 1BQMB 3D45A 1HPZB 5JS2A 2XWYA 1D5AA 3OYBA 3H5SA 3RAQA 3P5JA 4CK2A 3KK2B 1RDRA 1JKHB 2FBVA 3DDKA 4RZRA 1D8YA 2V4QA 3MECA 2QK9A 2DFHA 3QIPA 4CGGA 4FM0A 3H59A 4NCGB 4FJ9A 3T3FA 4NZ0A 4WFYA 1JLBB 4ZP8A 1VSIA 4CJKA 4DEZA 3AVLA 5CZ1A 1KVCA 3K5NA 1JXBA 1VSLA 1XHXA 3VA3A 3EPGA 3TAPA 2HHUA 1U4BA 4ZP6A 2QV6A 5T14A 3DRRA 4B9VA 3RBDA 1FKOA 4ZVHA 1TKZB 3SQ0A 3V4IB 1HQEB 1J9AA 5KFMA 3ZSZA 2R7YA 3KLIB 1WSJA 3U6FA 2FVSA 3AVNA 4DLGA 2IMWP 1Q9XA 4O0IA 5CYMB 4RU9A 2G8HA 4N5SA 4TY8B 5KT6A 3SJJA 2G8IA 5KG3A 4CJLA 2WONB 2IA6A 1GX6A 5D3GB 4C8LA 4RW4A 4LH4A 1TKTB 4IH7A 2HMIB 3KLEA 4CJWA 3QGIA 5KFYA 3G6VA 3CJ0A 3RMCA 4DTOA 2JEJA 1S9EA 2BQRA 1CZBA 4M94A 3TAMB 5KFDA 4KO0B 2ITGA 3QEWA 3HP9A 4CHQA 2WRMA 4M3ZA 2BGGA 3ITHA 1QHTA 2X6SA 5L1LA 3OJSA 2PY5A 4IG0A 3DLRA 4O0JA 5KFLA 1S0OA 3UPFA 5KG2A 5EWGA 5FDLB 3FFIA 1S1WA 3V81B 4I2QA 1DTTB 2W7PA 4HUGA 5JUMA 2BRLA 3OYLA 2IDOA 2OPSA 4AHSA 3LPTA 1JL2A 4WYWA 3SQ2A 3GYNA 2IGIA 4CJEA 1HYSB 2Z1GA 4J9OA 3QIOA 1SKWA 4FK4A 3ICLA 4K4ZA 1QS4A 3V9WA 4CHOA 3KHHA 3KMSA 4ED3A 4DS4A 4DF4A 3FDSA 1JKHA 1QE1A 1UA1A 4ELUA 1T03A 4OKKA 4IR1A 4PY5A 3C6TA 3OHBA 1NK7A 1RBTA 4G1QA 2HWHA 2F8TA 4R5PB 4K50A 3O3FA 3TARA 4CJPA 2V4RA 2D0AA 4NLUA 3CDWA 5L9XA 5KT4A 5F8MA 4ZPBA 4PUOB 1VSMA 1T05A 5J2NB 4GC7A 3HPOA 4FK0A 4WFZA 1YTUA 4ED6A 3V4IA 4Z4IA 3OYDA 1A5XA 1HQEA 4AILC 4NYZA 2EX3A 3NHGA 3QEIA 4FBUA 4N56A 4FJIA 4ED1A 3LP1A 5JS1A 4KFBB 4W5RA 5CYMA 2IJFA 1FK9B 4DMNA 3BQ0A 2IJNA 1LW0B 1IO2A 3OYAA 2IS3A 3L3VA 4ZPAA 4KV8A 2R8IA 4CFCA 1X9SA 3S9HA 2IM1A 1TKTA 2F96A 4B9TA 4Y3CA 1FKPA 3MEGB 4Q8EA 1C1BA 4CEEA 1N6QA 2DFEA 2JC1A 1RTDB 4W5TA 3DM2B 3CDUA 4IFVA 4O3QA 3DOLA 1A5WA 3ZSQA 1S49A 1TL3B 2B5JB 4J2DA 4DQIA 3IRXB 4ECTA 1RT7B 3LP0A 4W5NA 3PW4A 3RMBA 3MEDA 5FDLA 1LAVA 1KHWA 4TQRA 3BQ2A 4RW8B 4M42A 5FRNA 2OZSA 4CEBA 3DOKA 4DTNA 5KI6A 4LSLB 3PY8A 4FJXA 5I3UA 4CEOA 1XR6A 4I7FA 4H4MB 4EO8A 3DYAB 3SUOA 3CWJA 4NYNA 4ZP7A 4ZPCA 3LWMA 4HUFA 1ASWA 3NKYA 1BHLA 3GQCA 2RF2B 2GIRA 3F73A 2O4GA 1J53A 2GBZA 3AV9A 5KT7A 5J2QA 4Y2AA 4KHSA 5KFEA 3QLHB 3C94A 3LP2B 2XC9A 3VQEA 2YKMB 4NCBA 1RT3B 4CGIA 4F3TA 2YNHA 5J2MB 4O55A 4Q43A 4K4SA 1WSEA 5CYQB 4KTWA 4CF1A 1N5YA 1RT1A 2D7SA 4DL6A 4MFBB 3K5LA 4AHRA 4C8NA 1JLGA 2IOCA 3ZSWA 1S5JA 2KW4A 3DMJB 2D3UA 2VG5B 3I0SB 4ED0A 3SZ2A 3AVFA 1MMLA 4AHCA 3V9ZA 4M3YA 3JYTB 1D9DA 2E9TA 3DRPB 2HHVA 3O4NA 5SZTA 2OPQB 2VA2A 2HVHA 5HBMB 3V1RA 3BSOA 3CFOA 2FVPA 4EP5A 2ALZA 2BR0A 4KHUA 2BE2B 1LW0A 4ECYA 1QSYA 3PW7A 2R2UA 1WSFA 5F8IA 4YR2A 3QO9A 1DLOA 3S3MA 4B08A 2VG7B 5DGAA 4CF2A 4DFJA 1HARA 2FLLA 1S1XB 4KB0A 2V9WA 3K5MA 5F9LA 4FJLA 2IAJB 2HHSA 4KREA 2Z1JA 1RBVA 4ID5A 3DM2A 3QESA 4IDKA 4CEDA 3AVHA 1TL3A 3BR9A 4FCYA 2W42A 5HLFB 2W8LA 4DL5A 4Y1CA 4E3SA 4Z4FA 4E7JA 2ILZA 4OGEA 4KHQA 1CLQA 4DWIA 4XIUA 1C1CB 1EX4A 2ZE2A 4CHPA 1RTJB 4I9QA 3O3HA 3V6DA 3H08A 3C95A 4H4MA 3L2QA 4O4GA 3CFPA 4KAZA 4ZPDA 3G10A 2G8KA 4OVLA 5F8HA 4FS2A 2UVVA 1X9WA 4DQSA 4AHUA 2RDIA 4F2SA 1S1UB 1D0EA 1HNIB 3HJFA 1JLEB 3H4BA 3ZSVA 4TN2A 4ECUA 1HQUA 4CGJA 4F3OA 1RT3A 1CXUA 4M3XA 1B9FA 3KJVB 3OVNA 3B6PA 1F21A 4K4YA 2OZMA 3OYGA 2WHOA 1LWEA 3VN5A 3QYYA 1UWBB 3CJ4A 4O44A 4O3OA 1GOAA 2KZMA 1TVRB 4TSXA 3Q8SB 2R2TA 2FBXA 3EZ5A 2W9CA 3MECB 2D0BA 3QIPB 4QCLA 4BE1A 4MK8A 5J2PA 2AX1A 1S9FA 2XY7A 3SQ1A 4KHNA 4H8KA 1BCMA 1VSEA 1IKYB 4TYAA 2AGQA 1U49A 3MTKA 3ZSRA 2HNDA 2BANA 1HYVA 1LW2A 2I5JA 4FLZA 3OYJA 1S1TA 1S1VA 3LANA 1I3AA 3DRRB 2XI3A 1SH2A 2WK4A 1RTHA 5KFJA 3CFRA 3NH2A 1XR7A 1NOYA 5KGWA 3EYZA 3N6LA 3PW2A 2ASJA 4QWDA 4CESA 4WE1A 1TK8A 3IG1A 4O5BA 4DSJA 1TKDA 1NKBA 1RT6A 4RW4B 1C1CA 3ZT1A 5KFKA 3KLEB 4IRDA 4XO0A 2OH2A 3M8SA 2ASDA 2OPRB 4YR3A 5HP1A 1C2PA 2RKIA 4LD0A 1S9EB 3SQ4A 1KSPA 3LALA 1C0MA 3ITHB 3V6KA 3RTVA 4CFAA 3IGVA 4IG0B 1BQNA 3G6YA 5C24A 4FVMA 4K4TA 5KFUA 2ILYA 1Z4UA 2PYLA 1VSKA 4N76A 3FFIB 1KLMA 2ASLA 4I2QB 2R2RA 4CEZA 4DFPA 4HCCA 3FQKA 2OPSB 2V0NA 4LSNA 4KE5A 2G8FA 3HHKA 3GV7B 4PQUA 5KG0A 3VA0A 2HVIA 5KFOA 3QNOA 3HXMA 1IKWA 1D1UA 1BIZA 2EC0A 4FJJA 2W9AA 1UWBA 4RUAA 5EU7A 1S48A 2R8GA 1NJXA 1TVRA 4TXSA 2R8KA 3L2WA 1RT2A 5CY4A 3CJ5A 4E7HA 4NYFA 1I6JA 4EO6A 3KD1E 3AA4A 2XRIA 1J5OA 4URQU 1QE1B 4CIGA 3PX4A 1EXQA 2LSNA 4BDYA 3TVKA 3SV3A 4DTPA 1A5VA 4DSFA 1T03B 3C6TB 1JLCA 4K4XA 1CSJA 4G1QB 2GUIA 4DL4A 4ED8A 1IKYA 1IG9A 3ZCMA 3DLGB 3HVWA 3PVXA 3L3UA 3RB3A 1T05B 1TL1A 4NLTA 3L2UA 4AHVA 4EZ9A 4CJQA 1RA6A 4RW6A 5EWFA 1SKSA 3LPUA 5KFBA 1JLQA 3GV8B 4B9SA 3LP1B 3TABA 4HVJA 2QKBA 4EYHB 2BDPA 1T7PA 4J2AA 4FJNA 1S4FA 4F4ZA 3D28A 4H4OA 3PUFA 4KV8B 4Z4EA 1DTQA 5KG7A 4DF8A 3V1OA 1FKPB 1C1BB 3HSTB 1YVUA 2OPRA 3AO4A 4RNHA 1N6QB 3NAEA 2WCXA 4IG3A 1LAWA 3HVTB 2DTUA 4NLPA 1N48A 4FM2A 3ISND 3V9SA 3VQ4A 4IFVB 1VSDA 3BDPA 3DOLB 1LWCA 5DG8A 4O3SA 4DTJA 3NDKA 4KRFA 4F4WA 3LP0B 3SUQA 1S6QA 4KAIA 5F8JA 4NLXA 2AGOA 3MEDB 2JGUA 4HUEA 1QAJA 5KFCA 1VSHA 3QGGA 3DOKB 3H5UA 5I3UB 3HVAA 4I7FB 2FJVA 1U47A 5DG7A 3OS2A 1BGXT 3MR6A 3NF6A 3SCXA 3ZSYA 3QNNA 4ZHRB 4JUZA 4WXWA 3KKSA 3WNHA 4CK1A 3OYCA 1B92A 4CERA 3H5YA 3RB4A 5L1KA 4G3IA 4ZVGA 1G15A 4FJ8A 4KI6A 3UQSA 2J6UA 4Y1DA 1JLAB 5J2QB 3OSPA 4B8CA 3OL6A 1RDCA 3N6NA 2YNHB 4MH8A 3OL8A 2Q3SA 3OYMA 4JV1A 4QW8A 4Z0UA 4RW7B 4WXOA 1EP4A 4NCAA 3LZJA 3KK1A 1N5YB 2YNIA 1RT1B 4Q44A 2X6NA 1XR5A 3DLGA 5DMRA 1JLGB 3CM6A 5HRNA 4M45A 3G0ZA 1O1WA 5KFAA 4N47A 3K2PA 4M95A 3AVBA 4FLXA 3KHRA 3V9UA 3MXJA 3HPGA 1UAXA 4DFKA 2PZSA 4E89A 2AQ4A 1XWLA 2BQ3A 5KT3A 5KFNA 1IKXA 1RT5A 4XPEA 4LH5A 2X74A 3SFUA 3QO9B 1DLOB 4R0EA 2FBYA 2GV9A 4FJ5A 3PW0A 4NLGA 1W9HA 1VK0A 4CJUA 4QPXA 3PR5B 3IGNA 5EUHA 4CJ4A 3I0RA 4K8XA 3HVTA 1BI4A 2B6AA 4ID5B 2YHBA 4TY9A 4IDKB 1WAJA 1W25A 4IQXA 2FJWA 3MFHA 2XY8A 2FLPA 4B3OA 2I1RA 1FXXA 2PYJA 3H4DA 3DRSB 4YFUA 3OYHA 4DTRA 1HMVA 5KRTA 4Q0BA 1TAQA 1C0UA 4Y2CA 2WOMA 4NLDA 2ZE2B 3U3YA 2RPIA 3V6DB 2W8KA 1NK9A 2P51A 1ASUA 3PHEA 4O4GB 4I9LA 3G86A 4ZHRA 4B9NA 1TV6A 3ISNC 4FM1A 3VQ8A 1KHVA 4JS5A 2FC0A 4QW9A 4NLSA 2KFZA 1TKXA 3I5CA 1JLAA 1VRTB 3MR3A 1NHVA 3SNNA 1N4LA 1HQUB 1C0TA 1ZBUA 4CGDA 4M3TA 3HT3A 4DSLA 1K1QA 5EDWA 4Q45A 4H54A 3GIJA 2D3ZA 1JL1A 4OPKA 1L3UA 4RW7A 3KKRA 4GC6A 4DS5A 4QWCA 2DPIA 3QETA 1LWEB 3GIIA 3PO5A 4KKOA 4O44B 4W5OA 5KFTA 4Y34A 4KTZA 4CJFA 1NK6A 3DLBA 3MEEA 3NGDA 3AO3A 1K1SA 3LP3A 2FVRA 1SH3A 1NJZA 4DLEA 3D5MA 2W9CB 4OGCA 4JV2A 3LAMA 2CJQA 4MIAA 4TLRA 4J9QA 4ID1A 4CGHA 1K6YA 5J2PB 2YNGA 4B8AB 4BACA 4HYKA 1U45A 2HNDB 4OLAA 2BANB 1LW2B 3NMAA 2I5JB 3CQ8A 3NFAA 1S1TB 1S1VB 4PWDA 2JEGA 1W0HA 3PJWA 1NK0A 2IM3A 4YR0A 4Q5VA 3KHGA 3KLGB 3EY1A 1RTHB 3GILA 4IR9A 3NAHA 3BGRA 2QE5A 3BSCA 1Z26A 4ICLA 4M3RA 4CHNA 3NL0A 4WE1B 4DL3A 3GIKA 3IG1B 4TQSA 4NRTA 3DRSA 2XI2A 3NBPA 1UOCA 3U3GA 1RT6B 3LWLA 5EWEA 2OPPA 5KRSA 3ASMA 4M41A 3VQCA 5CZ2A 5HP1B 2RKIB 4BE2A 2HAIA 5FROA 1KLNA 3NH0A 4E1MA 1T94A 3D0PA 1S97A 3BSAA 3IN5A 1BQNB 4FBTA 4QOZB 3VQQA 2ZQBA 5C24B 5JXSA 5KFVA 5HRSA 1VRTA 3NAIA 3TAEA 2UVRA 4IOBA 1SH0A 1HNVA 1KLMB 3IS9B 3EZUA 3M9MB 4EP4A 4LSNB 5KG6A 4MKAA 4N41A 2IC3A 4JRQA 5L1IA 1NKEA 1EETA 4EBCA 4PQUB 3A2FA 4LQ9A 3I5BA 1IKWB 2EHGA 2HNYA 3OYIA 4J9KA 4FJ7A 3AO2A 3PO4A 1WSGA 4O3NA 3RR7A 4IRCA 4FLUA 4F50A 1GOCA 5KG4A 3OS0A 1RT2B 3CG7A 1J5OB 4IFYA 3T1AA 3RWUA 2FBTA 4OKJA 4ED7A 3VQ9A 4JS4A 1CZ9A 4FZZA 4NRUA 3Q8QB 3KHLA 3NGYA 5KT2A 4CJVA 1JLCB 5KG1A 1SL2A 1R0AA 4F4YA 3QERA 3OJUA 3HO1A 1SUQA 3GIMA 2NUBA 2AU0A 5J1EA 1L3VA 3TAGA 2UVUA 4EYIB 2JEFA 1TL1B 4ECZA 3NF9A 1D9FA 5KFHA 4IBNA 2YV0X 2IBKA 1RT4A 3O3GA 3KLGA 3JSMA 4RW6B 4ECVA 4DTUA 1ZETA 2VWKA 1JLQB 3G6XA 2XY6A 2UVWA 4B9UA 5DLFA 2KZZA
chains in the Genus database with same CATH superfamily
4OFZA 3UKRB 3WXIA 2O01C 3EGVA 5K8NA 3GG0A 2DKOB 3J81O 3TI0A 4I4BA 4JLHA 4ZVPB 2XHWA 4WF9Q 2B43A 3CD7A 3U1NA 4MYUA 4PYAA 2JNJA 3LPYA 3ULHA 1YVFA 5B0EA 1A0OB 1RBRA 3KLFA 2JLGA 4IH6A 1TMMA 1K9MT 5L1JA 2D41A 3C0BA 4PZVA 5HROA 1LWCB 4PG4A 4AYBD 1FDAA 3ALYA 2QKKA 3W9HA 1X5PA 1S6QB 5E3QA 2YJFA 1IKVB 4QR0A 3DLHA 5LL6d 3N6MA 2YNFA 1JCEA 1VQOS 2ZJQL 2DRDA 4BS2A 4N7TA 3QT7A 1RLDA 3BSNA 3TAQA 4HHHA 1TP7A 1QQCA 4LF5F 1GX5A 2BOPA 1P90A 4K0KK 4FSVA 3BO2A 3P4IA 2ZBQA 3CIMA 5BRFA 5A8WB 3A5NC 1NLVA 2C2EA 5C15A 4WU2A 3HL8A 4KRWA 3AAPA 2H1YA 3E51A 4KI4A 4X64J 3D1HA 1JMTA 2AGPA 2VDHA 3AH6A 4DUYF 2H4YB 3T5JA 1UJ4A 3E9OA 5DQGA 4JNEA 1VIOA 1NOZA 1WG1A 2FZCB 2Q0UA 5T7BA 4DV2F 1QUPA 3M9OB 1BIUA 3JAMY 3ZT4A 1BWEA 2XGQA 2EFVA 4K4WA 4RNOA 4MKBA 4AQYJ 1UA0A 3LDQA 2D5RA 2W2NP 4J2BA 1XTZA 2XMUA 4CHYA 2V2KA 4DV5J 3W2WB 3DAWA 4BE0A 5B0GA 1HRHA 2HRUA 1FTCA 2G2YA 1NHUA 3HHNB 2H3GX 1REVA 4K8ZA 4P7TA 3QBWA 4ISGA 3AJDA 4JB8B 4K5RA 1Q7LB 3I0RB 2HMPA 1U48A 5LSRA 4BRKA 4DN0A 4XK8C 4IYQA 1R3NA 2DISA 1RE1B 4QQBA 1SV5A 1J5EF 4B3OB 5KFIA 2A1SA 1UVLA 2DITA 2YKNA 3K5OA 1IKVA 3DI6B 3OYNA 1C0UB 3HI9A 4ZOSA 4ZPWR 2AJ4A 2B8QA 1VHXA 1TZ0A 1B99A 4CTAA 2LP4A 2HAFA 3BS9A 2E1AA 2WVEA 3A8KA 5FJ4A 2RUSA 2IM0A 1S3XA 1TV6B 2NSCA 4FKXA 4YB7A 5JVHQ 4ZTFA 2N4DA 4KH1B 2C28A 4FWQA 1TKXB 3MMCA 2CPYA 1NPPA 4C11A 2GJ2A 1RQ0A 4IOCL 1C0TB 2R7QA 4ANDA 4M3WA 2IMOA 1X5OA 3VQPA 2B3TB 5D15A 4JI8J 2LQ5A 1XC9A 3AD7C 2JVRA 1ZBFA 4ELTA 1VQ7N 3NF8A 4CIEA 2GW8A 3KK2A 3TOQA 4KKOB 3SI8A 1B70B 1GXTA 1SL1A 3D6RA 5LJ5Y 1NKCA 1S10A 4JD2A 2KYXA 4NCGA 4GY2B 2QA4G 1OPIA 3A5LC 5ITHA 2AX0A 2BKOA 3EZOA 2B7BB 4Q7AA 1JLBA 3H2LA 3HPHA 5E26A 1VQNS 4IO9L 2WAQD 3QINA 2L3MA 1RAJA 3HBTA 3AO1A 4DV4J 2VA3A 4DPXA 1XNRJ 1TKZA 3ZFVA 4FJGA 2KXNB 3KLIA 1HR0K 2NYIA 4BRIA 2M0GB 2OD6A 1HNWK 4TY8A 4KHRA 2NZTA 2Z1HA 1RDDA 3JQMA 1FEEA 2ZHBA 2AJ0A 2Y1IA 3CO9A 2XULA 3MM7A 3UE2A 4BY9C 3RB0A 2V69A 2WVDA 3CCJS 4CF9A 2P9KA 1P9YA 2H4WB 1SC4B 4JI2F 3DI6A 1NGGA 3K2YA 5A0YB 2ZKUA 2CIMA 4LFAF 1IG8A 4HLBA 3J81j 4WZQA 4O8KA 4CP5A 4MAKA 2RNEA 2KTQA 4WFXA 2HHXA 3CD6S 1NGBA 2C2OB 3GFHA 5EY4A 1VHFA 2FJXA 2R2SA 2V5HG 3OLAA 2ATQA 4GVLA 2AV5A 4P9SA 1C6VA 1IBKJ 4MDBA 3AVMA 2GIQA 4DR2K 5D0HA 4USHA 1W2BR 3HK2A 2C2MB 4Q8FA 1PBAA 2QA1A 2Z8QA 3WXJA 3L2RA 1E4FT 1BE4A 4CW7B 1WTBA 4J2EA 5IT9O 2IC3B 1U1RA 3CCQN 2W2OP 1UPMB 2R7XA 4RBUA 3ENBA 2ZBRA 4B02A 5HATA 4OX7A 5T41A 3VF4A 3TR8A 2HIQA 2P9PA 2ROEA 2AHOB 1J54A 3KDNA 2UYTA 4HTUA 5SWMA 4B3RJ 4K7QA 3C19A 4YOWA 2XS7A 4IFYB 5AE3A 3T1HF 4U96A 2F8SA 3SDEA 4TYBA 2HBJA 1T9VA 1JJ2R 3FQLA 2FSJA 3VQSA 3MR7A 1WEXA 1A9NB 4ZVEA 1SKRA 3R7BB 1PCAA 2DNMA 5M2RA 4FOEA 1DHMA 2GQQA 2QWNA 4J9MA 2IDLA 4JHDA 5J1EB 1IH7A 2ZKTA 2QC3A 3WX8A 1WD6A 3NNHA 3DLLQ 4URGA 5GAHI 4KFBA 1TFYA 2AJQA 2MDAA 4QBUA 3M8ZA 3J7YU 1QUVA 2MKKA 4JI6J 5F8GA 1TL5A 3QRRA 3LH2S 3C7NB 4TVAB 1NSQA 4B9LA 3CCSN 1HHSA 2EG2A 5E0OA 3AVJA 3IRXA 1RT7A 1GOBA 3IAYA 5IOLA 3GB0A 5HMWA 5FLXO 4DV1K 4J9UE 4L3KA 1VGYA 4WZMA 2EBEA 1F3FA 4B3TK 1NDKA 4KC5A 5AQZA 2IYIA 3CCLS 3WT0A 2M2BA 4QU7A 3JTOA 4J9RA 4DPWA 5C25B 5DG9A 4A5AA 4MO4A 5KOWA 4NLOA 2DO0A 1WUAA 2XHCA 4FXVA 2UUCJ 3VR1A 1HI1A 1U1NA 1VQLS 4ZTJA 2RILA 3C6UB 3EE8A 2HLTA 4LF7J 2XLIA 4CWBA 3OL7A 3C15B 2RN2A 4X65J 4X2BA 2YKMA 2BM0A 1KC8T 4BR5A 5HI7A 1BHNA 1X4AA 4KHYA 1GMUA 5E41A 5D4LA 4KPYA 1S0NA 1HNZF 5B09A 1S7IA 2N82B 2VG5A 3QEXA 1EQ0A 1KVAA 3VTIA 3KFWX 3ZT3A 5ETVA 5K5MA 5ETNA 1R6VA 5FPMA 2MTLA 3UR0A 2LA6A 1SCJB 5C2FA 3ZTSA 1ELOA 1EQMA 4DG1B 5EVZA 5BREA 1YJ9S 2HFVA 3WC0A 1RBUA 1TK5A 1X1PA 2XZWA 3JS9A 3H8YA 2C42A 1S0MA 2F8EX 3N0VA 3CSKA 1S1XA 3EPIA 2DNPA 1CJVA 2G8UA 5HJYA 4FN5A 3AQOA 2IAJA 1FKOB 3O8MA 2J76E 4E1NA 2R3VA 1DARA 2CKWA 5AQSA 3D9BA 4Z4HA 1VSFA 1AZSA 3LO3A 3PIPQ 5C5JA 1NJWA 4Z4GA 5HLFA 4EHTA 2J9DA 4J5OA 1RISA 3CW2C 2JLEA 4C1NI 1TR0A 3OYEA 1K8KA 7FD1A 4K0KJ 2QT7A 1I39A 5G0RA 5HRRA 3J7Z5 1V3ZA 3UD4P 1BWVA 3UO0A 1FRJA 2DFFA 1VC0A 5HMYA 3GR0A 2O8BB 3RAMA 3AOBA 1AROP 1LK7A 4IKAA 1S1UA 1Z1ZA 1HNIA 2A0FB 1JLEA 3FSXA 2HZVA 4CF0A 1CS4B 5IT0A 5IWAK 4ZVFA 3SCKE 5EX3A 1LXNA 1WSIA 4OX9K 3KTQA 4K2XA 4IJNA 3KJVA 3I8DA 3F2KA 1MNEA 4J9NA 2W01A 1T9XA 3PJ9A 1YRTA 1OSDA 3SFGA 4ILHA 3KK3B 2HQCA 3P1GA 1NK5A 3HVRA 2N4CA 4A8MP 1WSHA 4WFNQ 4DR5K 2VDIA 2D1CA 1Q7YO 2VKZG 2ASMA 4GV6A 3GWCA 4JI7K 2PGCA 2M4MA 4DR6F 5GMDA 4RZRA 2A6AA 2DHXA 2QK9A 2DFHA 3QIPA 2I0XA 2MHNA 3HX9A 3T1YJ 3VAMA 2E8AA 4WFAQ 4FJ9A 3PM9A 3T3FA 1SJ4P 1ZA1B 3TA0A 1GMWD 2XEXA 4WFYA 1Q86T 3OHRA 4NXNK 4DEZA 5CZ1A 3ULEA 1KVCA 4NA2A 1VSLA 3VA3A 2HHUA 1NMEB 3L7UA 5KOXA 3CC4N 1H7XA 4B9VA 5KPRA 1FKOA 3LDNA 4CLKA 3SQ0A 4K42A 3IFEA 2IBOA 5KFMA 2Q97A 1YJNS 2BJ1A 4BCAA 3ZZZA 2FJEB 2G8HA 4N5SA 3MPWA 2BJ9A 4I64A 2D3OR 4BROA 4G9ZA 4CJLA 2WONB 1GX6A 2AKWB 1EWRA 1RAIB 1TKTB 2UU9K 2XTJP 3KLEA 1VR6A 5K8MA 3G6VA 2J0XA 4DTOA 3BV8A 3H7HB 4M94A 3P31A 3TAMB 3QEWA 3JAMO 3HP9A 2MB0B 4M3ZA 1RBAA 2BGGA 4RLEA 1V4SA 4CVNE 3R97A 1G4CA 3OJSA 2V4JB 2PY5A 4CLFA 3EKSA 1NNEA 4JKDA 3K8VA 4JI3J 2A2DA 1FDBA 2QL5B 3SMZA 3FFIA 1UFKA 5AQIA 3LDPA 2H48B 1N0UA 3FCHA 4AHSA 4CO2A 3RVCA 2BJEA 3POTB 3LGMA 4C0HA 2Z1GA 2U2FA 3FZKA 2HZAA 2L9NA 4X64F 1T9TA 3DLJA 4FK4A 5IM0A 1QS4A 3PEHA 2FZKB 2VBZA 3GG4A 3TP2A 4YDUC 4DF4A 1QE1A 1CVJA 2I8EA 1VQSA 3GOIA 1DEJA 4IR1A 2XYHB 4DV7J 3EL2A 3TEHB 1NK7A 1LK5A 2FIUA 2OJ3A 2ZM6J 4AQYF 1HNWJ 1MLAA 4F0HA 4NLUA 3L9ZA 2IRXA 3CDWA 3ATUA 1VQ8N 3EWGA 3BEXA 4DV5F 3O4WA 5KT4A 3IBCB 4ZPBA 4PUOB 1RGVA 2DGUA 3L7OA 4CNZA 4UQTA 5J2NB 5CD4A 4IXCA 1T9WA 3P5TL 1BUPA 4TKTA 3MPYA 2BVZA 4G65A 2EX3A 4FKYA 4LVNP 4FJIA 3IP0A 4W5RA 4DR1K 1EIYB 1KC8O 2E2OA 5F2RA 2IJNA 2HHPA 1LW0B 1FFWB 2IS3A 3L3VA 4BR2A 1VCTA 1G7CB 3LDOA 1VQPN 2IM1A 2LFVA 4UOFA 1TKTA 2F96A 3O3LA 2M52A 6FD1A 4EFAC 1SAZA 1N6QA 3GMGA 1R0BG 3OTCA 3SSRA 1RTDB 4W5TA 2J9DE 3DM2B 3CDUA 2KHCA 1TUWA 4RR5A 3DOLA 1S59A 1AUSL 3ZSQA 1TL3B 1RJJA 4J2DA 4DQIA 4W5NA 3PW4A 3AODA 3AHPA 3M2RB 4AE5A 3Q8VA 3CCMS 1KHWA 4BLGA 5ADXA 4ES1A 1YZ6A 3AA8A 1W7AA 4LSLB 3LL3A 1P1TA 1XR6A 2C2NA 1S79A 3CPWM 1U1LA 4NYNA 4Y65A 2CQ1A 1QY7A 3NKYA 2JWNA 2RF2B 1VQ9N 3F73A 4JI8F 2HEKA 4HWIA 2GZOA 3I55N 2VONA 3ET6A 4NX9A 2YQ3A 2IVPA 5KFEA 1XUPO 4CGIA 4F3TA 4UF4A 3I56S 3H3OB 3H1VX 1WG5A 5A8KB 2P9IB 3D6TB 5DZ6A 2Y9HA 4K4SA 3B8AX 1WSEA 2IDEA 2OO4A 3MI7X 1RT1A 4JKEA 4DL6A 4MFBB 4FDFA 4B3SK 3O9SA 2V2QA 2D3UA 3SZ2A 3QMQA 4AHCA 5C0YA 4DV4F 5HQ8A 1XNRF 1EARA 5CYJA 4CI0B 3VALA 3CJRA 5HBMB 4OYAA 4KHUA 2BE2B 1LW0A 4ECYA 2DNZA 2R2UA 4YR2A 3S3MA 2VG7B 4PG6A 1WF0A 1HARA 1H72C 4IJAA 4DV1J 4HACA 4KB0A 2V9WA 3MPVA 1MROB 4B3TJ 1RBVA 3DM2A 2J9CA 2OANA 5AZJB 3RZAA 2HGMA 3M1FA 4CEDA 4YB6A 3AVHA 1TL3A 2YPZA 2W8LA 3CULA 3EGZA 4Y1CA 2B0GA 4L74A 3VEWA 4E7JA 2ILZA 1CLQA 3AGRA 4UOHA 2CG4A 3MX5A 3IM9A 2ZE2A 4I9QA 2QLFB 3QMLA 1IBKF 2HGLA 3R5AA 4KAZA 4JYAK 3S6EA 5F8HA 4LSZB 5EX5A 3S8SA 4FS2A 1X9WA 5FPNA 3THXA 2M7SA 3DKDA 2VFVA 3VAGA 1CJTA 4PYDA 4TN2A 3N4WA 1SJ1A 1B9FA 1PSDA 2P9IA 4DJBA 5FD1A 1F21A 1CZAN 1DQ9A 4B3RF 4JKHA 2W2PP 4PR6A 2GHVC 3FEYB 4L72B 2VOPA 1VISA 4JN4A 2YVSA 3GONA 4JI5J 3NMUA 2VWBA 1X4DA 4WTOB 3T7ZA 2HS3A 2FDNA 3EVWA 2R2TA 2MPUA 1FX4A 4W90B 4AL6A 4DV0J 3R9PA 2F8MA 1ZBSA 3AGKA 5KQ8A 1OIAA 2MSTA 2BKNA 3SSSA 4BE1A 4MK8A 5J2PA 3W61A 1S9FA 2XY7A 3OVBA 2FSKA 2FHJD 1BCMA 3I8BA 3BZQA 3Q83A 3N4PA 4OHXA 4IWVA 2VGMA 3AY9A 1LW2A 2I5JA 4FLZA 1NO8A 2KRBA 3OYJA 2V6AA 2KO1A 4JI6F 3CEDA 3VTHA 1I3AA 3DRRB 1Y5IB 3PDNA 1PAUB 2C2KB 2VIHA 4FXWA 2YJEA 3E1YA 3CFRA 3NH2A 1XR7A 1NCLA 1NDLA 4Y6IA 2XLKA 2QFIA 3CMAN 2LA4A 1TK8A 3MUVP 2D9OA 2K06A 4DR3K 1I94K 1IM6A 4RW4B 3O9UA 3ZT1A 5IWAJ 5KFKA 4IRDA 4OX9J 1H6KX 5L8RC 1IR1A 2NNWA 3ETOA 2PBDA 2RKIA 3MTJA 4WPAA 3P38A 3ITHB 3RTVA 5H1SV 1RAOA 3VV2B 3IGVA 1GXLA 2CZVC 1RABB 2P9LB 1VQ4N 2UUCF 4WTYA 2ILYA 4OJHA 1Z4UA 4ED4A 3HSCA 2B9WA 3UE5A 1NSPA 4LF7F 4N76A 4JI7J 1TFWA 1Z2LA 4X65F 2A6MA 2ASLA 4DV6J 3OXLA 4CEZA 4ILLA 1RDWX 4LSNA 3G82A 4QPTA 4F7VA 4ES2A 2XS2A 5LY3A 2HBKA 5D6GA 5FPEA 3CO0P 1SI9A 1D1UA 4DQ8A 5EU7A 4NXNJ 1CJUB 1S48A 4C0BA 4PPZA 3D7EO 1NJXA 1R27B 1RUSA 4CLLA 4NYFA 4F0KA 1I6JA 4DV3K 3VAIA 1AA1B 2XRIA 5HL7L 4URQU 4IZ9A 1NGEA 3PX4A 3M6VA 2FZGB 4ZVRB 2RB7A 3TVKA 1HWLA 2DNGA 3ZEUA 4DSFA 1T03B 3C6HA 3GE9A 1U1OA 1XJWB 1CSJA 5DM7Q 1KBRA 4YS2A 1U6FA 1Y4ZB 4DL4A 3D68A 1W2BM 4CO3A 3DLGB 3PVXA 2ZC4A 3SBMA 1T05B 3THPA 3L2UA 3DCAA 2BJ3A 4CLTA 3IKMA 4CJQA 2NREA 1VQ6S 4RW6A 4GV3A 3W66A 1N36K 4NLBA 1LFWA 3D6FB 2GMLA 3GV8B 2AD9A 4KJIA 3TABA 5CHIA 2CPHA 4M7XA 4EYHB 2IY5B 2BDPA 1T7PA 4FJNA 2W4PA 1ATSA 5BYQA 4H4OA 3R5DA 2PMZD 2KKZA 3PUFA 4OYWA 2CJYB 1JJ2M 4GV9A 1DTQA 5KG7A 2O1PA 3MM8A 1O8BA 1E6VA 2ABYA 4K0KF 1KN6A 1YVUA 1ZZFA 5E33A 2QWMA 5DZ7A 4OI3A 3BDPA 3W7BA 2NRVA 3NDKA 4F4WA 1U0HB 3JS6A 3V5RA 4FF4A 3WXMB 1HWIA 3UN3A 4HUEA 1N5QA 5LXRA 5KFCA 2YKPA 7AT1B 2MGZA 1JWWA 5I3UB 2AJFE 3HVAA 4I7FB 1FD8A 2PD1A 3CCVN 1BGXT 5HK4A 3QJPA 1RBLA 4WXWA 3WNHA 1X8DA 4CK1A 2OTLN 3F56A 1B92A 1GLBG 5HVGA 4FJ8A 3M7VA 2J6UA 4Y1DA 5J2QB 3MURP 1X5SA 3KDOA 1KOHA 3VENA 4BRGA 2YNHB 4P6QA 3OYMA 5B7WA 1N33K 4QW8A 1PG5B 1WKLA 3T1YF 1EP4A 4NCAA 3KK1A 4DR1J 4AUKA 4Q44A 3J7AP 3DLGA 1JLGB 5HRNA 2LXUA 1PC5A 4M45A 3PTWA 4GVBB 5KFAA 2V8DA 2GGPB 1BQXA 4FLXA 3V9UA 3RYLA 1CQNA 1X4HA 3EVMA 1UEVA 5E84A 4DU7A 3O6QA 2AQ4A 1Q82O 1NG9A 1U2VB 1BUXA 1IKXA 5DM6L 2GJIA 1Y9OA 3ONQA 3SFUA 3M5RA 4NWBA 3QO9B 1DLOB 2IVOA 2N7CA 3PW0A 2GELA 1W9HA 1VK0A 4EU0A 3W5YA 4DCPB 4QPXA 2APOA 3IGNA 2NRRA 1YRUA 4LF9J 3QICA 4TLQA 3D3BJ 1BI4A 2KT2A 3OUYA 1HI8A 2EKYA 4IDKB 1WAJA 3UDCA 3MFHA 2QJ3A 3S7RA 4ILMA 3P49B 2YCHA 2I1RA 4DMZA 4DCJB 3MAAB 3H4DA 4DTRA 1HMVA 4JI3F 5IC6B 4JBCA 3ZYYX 3EXCX 1K0VA 3V6DB 2ZWPA 1NK9A 1FO1A 3NVMA 1HBMB 4X66K 2HQDA 4WQ4A 5IZHA 4DPYA 4B9NA 1WF1A 4YY3K 4OZ0A 1KHVA 2FC0A 2MKJA 3FLCO 2KFZA 4MLHA 3SJHA 3I5CA 3I4HX 1LWXA 3PXGa 1VRTB 4HDHA 1Q18A 2CJ9A 1ZBUA 2CPDA 5AQPA 3LOUA 3VERA 4H54A 4OPKA 4Z7YA 3OVAA 4DV7F 5HQMA 3KKRA 4GC6A 1DURA 2QLWA 2ZM6F 1FXDA 1HNWF 1LWEB 5AQXA 3GIIA 3DWLA 3A0IX 1LCUA 4W5OA 2E1PA 4Y34A 2DGSA 4HVZA 3QFUA 3DLBA 1HWUA 3AO3A 4OZLA 4K2JA 5C2GA 3D5MA 5I4MA 2X7IA 3W9IA 2W9CB 3P39A 4QIFA 3C16A 4EK2A 4M63A 2XMAA 5M1OA 2X1BA 3R2DJ 4J9QA 4DZDA 3O8WA 2RQ4A 5AFUA 2M8DB 4KGMA 2RRNA 2XZDB 2BANB 4ILGB 4ERDA 1JJ4A 3NCRA 1TUGB 2F5GA 4M8LA 3NFAA 4KBOA 3HFKA 3DXMB 1S1TB 1S1VB 2JEGA 1W0HA 3PJWA 1UVKA 4IR9A 3NAHA 3G6ES 5LJWA 4JYAJ 4A62A 3MCMA 4ZDNA 3O80A 2RS8A 3QPIA 5JVGL 4NRTA 1RXOB 2DXFA 4Q2MA 3NBPA 2MXYA 1UOCA 2E5LK 1RT6B 5L39A 3ZETB 4K43A 2RH3A 4J91A 4CZJA 3VQCA 3R5JB 2HAIA 3A3OB 4CDIA 3VGUA 4AXJA 3OR2B 3R27A 1BQNB 5C24B 1FEHA 3HHLB 2QN6B 1VRTA 3NAIA 4B1UB 1UAWA 5ELZA 2ZUAA 3MWBA 2P9NB 1U6ZA 3ZZ0A 3IS9B 2BV3A 4CM0A 2V67A 4TU8A 4N41A 2JRSA 4RCHA 1NDCA 4JRQA 2HBYB 3VGTA 2HBRB 3A2FA 1NGCA 3HZEA 5D78A 2MZ1A 5C10A 2HNYA 3OYIA 4J9KA 3PO4A 4O3NA 3RR7A 3UI3A 4FLUA 3BBBA 4BC5A 3BBFA 1AXQA 5F41A 1GOCA 1RT2B 2NRWA 9RUBA 2A1BA 2VD3A 4UZBA 1CZ9A 4NRUA 3Q0AA 2UV8G 3KHLA 5DJBA 1SL2A 1NU4A 4Y28C 3H90A 4F4YA 3OJUA 2RIJA 4BR7A 2NUBA 3KUHA 3G9CA 4HTLA 4IO8A 4DR3J 4DV1F 1IJEB 4ECZA 2YX6A 2F9JA 3DXMA 1CQMA 4ER8A 4IBNA 3G71N 1ZM3A 2XNRA 1CPZA 1M1KO 4B3TF 4DX6A 3JSMA 5BYSA 1NGDA 3D2EA 1ZETA 3DDIA 2UVWA 4B9UA 2BW2A 2DNKA 2KZZA 2DVIA 3SLCA 3THYA 4H0YB 5FPDA 3H20A 4WF9L 1B0TA 2F7VA 5CHCB 1RZMA 1X4EA 3PFOA 3BH7B 3O1BA 1TQLA 4DUYK 3BKUA 3ZZYA 3K9JA 3P83D 2A41A 3DFEA 3LAKA 4IG3B 1HFEL 5KFQA 2AEFA 1IBMK 4PABA 5I42A 3ZSXA 1YIJN 3G2XA 4DR4J 2B8PA 2WSEC 1OO0B 3L4IA 2XSFA 2CH6A 4M3UA 2VQFJ 1KQGB 1WUUA 1O0PA 1VQ7S 5FRMA 3VQ5A 1RAGB 3ENVA 2VQEK 4DV3J 2GQ2A 4OHYA 3IS9A 5KAKA 3J81U 1TGOA 4Z4CA 2YX1A 4F8RA 2HQ3A 3H2UB 1XHZA 3CDBA 2PO4A 2AT1B 2LCWA 4F4XA 1BDGA 2PDAA 4WQ5A 4USUA 4JI5F 2VGNA 4ECSA 5BPMA 2PE8A 5F8NA 3VEZA 4YHHK 2HNZA 4NOHA 2W2MP 1X9MA 4PKHA 4TU9A 4IH5A 5AXKA 4DV0F 2ZBCA 2E5GA 3HP6A 2UV8A 3RMDA 2Z2ZA 4RW9A 9ATCB 1N36J 2RDJA 5E3CA 1RKIA 3AA2A 2YNIB 2G8VA 4CJ3A 4LF4J 4CJRA 2WSCC 2IRUA 4A8WA 1F0XA 2FHMA 3RW7A 5M1KA 2QL9B 2FB0A 3SI6A 3CXCR 1SQKA 4V1Ak 1RWKB 3D2FA 5AT1B 1RWPB 2FPHX 2XLJA 1X4GA 3LZIA 3LDLA 4X4NA 1KCFA 1TUYA 1RCHA 1CULA 3HZGA 4B1XB 3GFZA 2VJUA 3FR0A 2VFUA 5IWAF 3ZT0A 4OX9F 2QSWA 4A8SA 3ZTOA 4ZVQB 4BRLA 5BJRA 2QFJA 3CJAA 4ECRA 1VBKA 5AE1A 2R8JA 3BH6B 3BKFA 2FY1A 1S9GA 3UVJA 2GJFA 4Q0BB 2RHQB 4JOUA 5CQGA 3TYTA 1VBYA 1RTIB 3M8PA 4DV6F 3DLEB 4A48A 2J6SA 1N33J 4GRSA 3W3DA 4HKQA 2MKIA 5JVHL 4EZ6A 4I2PA 4ILJA 1JX4A 4RNNA 4H5RA 3AVGA 2W4CA 3IXQA 3HDSA 2NYHA 1VDHA 4CYUB 4NXNF 1Z05A 1U6BA 5JJBA 2VICA 2YBVA 4XAKA 4EEYA 1WC5A 4JI1K 3KNAA 2DH9A 4QIWD 4MDAA 2R4FA 2OEJA 4O4RA 3UCZP 3C65A 1RK8A 5DQIA 3ZNJ1 4U7UD 1W26A 2XMKA 4NLYA 1BQMA 3JSBA 3MGJA 3NGIA 1V5VA 1HPZA 1OJ4A 5M1FA 3THTA 1Q0NA 1J27A 4EHUA 2AZ1A 4CM2A 4YUDA 4O23A 2AYGA 3MCSA 4AL5A 4A4JA 3MEEB 3GCWP 3NOCA 4JV0A 1ZBHA 1PJ5A 3W65A 3QDKA 2DY1A 1YJWS 2YHWA 1WLJA 1JNRB 5IFMA 2XCPA 1NB2A 4GKJK 1IVZA 3CCSS 3D0IE 5H9EK 1NAQA 5IS2A 4LY7A 1CXQA 2HFOA 2WW4A 2DRAA 3GG1A 4DOZA 3MN9A 2X3GA 1BOTO 3TWHA 4FJHA 2CAJA 5LJ3Y 1N56A 1E4GT 3CCWA 2E1YA 2EFPA 3EUNA 2KRRA 4UUWA 2NRTA 4RUBA 5D3GA 1RP5A 3OYFA 1VS3A 1RWXB 4IRKA 4BWMA 4GMJB 1Q8BA 3MM9B 3PX6A 3T1HK 1HW9A 3BN4A 2ZOGA 2F63A 3NS5A 1RWNB 2OIHA 5F3TA 4FJMA 4NYOA 3TA2A 1RTIA 3TEGA 1BL3A 4FLYA 3DLEA 5AQMA 2CQIA 3RRHA 4F67A 2OPPB 3PZPA 5D0RA 3AA3A 4RBTA 2Q43A 2Q6CA 1LKZA 3PW5A 3KYLA 3W8GA 2ATCB 4QIEA 3AXKA 3MMAB 2MY8A 3V81A 1FVQA 4FWPA 1M0SA 2HS4A 3KLVA 2LQ8A 2P9SB 2ZH4A 4NLQA 3MPUB 3M1VA 1HNVB 1HYSA 4PXEA 1SS6A 4MT1A 3MR2A 2HQGA 2WFBA 4OYXA 1EETB 2PIIA 2HK3A 3NGTA 4A8KA 1MWMA 1WAFA 4NLCA 3R8EA 4DR1F 3G8TA 4P10A 2C2RA 3WX4A 3UD5A 1U24A 4FLVA 4Y0WA 2DCUB 2O4IA 4CF8A 2FGCA 1U2RA 4RX6A 5F0UA 4Z94A 3SUNA 2CYYA 4OJRA 1L3KA 3FZ2A 1KRPA 4QAGA 2O8CA 4JKFA 2Y0SD 4QWBA 1FRLA 1BG3A 1KTQA 5IT9U 3P3DA 3OLBA 1SUQB 3DLLL 3AVAA 3TA1A 5A2QO 3HRGA 5E3RA 3BQ1A 3IA0A 1E6YB 4LF9F 1RT4B 2CQHA 3CETA 1DY3A 4CFDA 2X78A 1Q8IA 1VQKS 3RUBL 1EKEA 1HNXK 2G1HA 2HBQB 2P9UA 3AARA 1VRUB 3R5CA 4WP8A 4YNQA 3CC7S 1HUXA 1V3RA 4GVEA 3Q8YA 3FC9A 2HHHJ 2BACA 3B54A 2FSNA 3L09A 3TNVA 4R8UB 1FNMA 2KQ2A 4IQMA 4RW8A 1WC6A 1OYDA 3K57A 2WUSA 1WNSA 3Q86A 3QZ7A 1C0FA 1LWFB 1YLXA 5G4DA 4FF2A 2JH3A 4FO0A 3DYAA 5M2PA 2P5GA 1FRXA 3SK3A 3DLKB 4CFBA 4A8OA 4EBDA 2EPIA 3QFHA 3W0LA 4FVUA 2FHOB 2E7XA 5B0AA 2KYZA 4CLWA 3QLHA 2F9TA 1SL0A 1RDUA 4FZVA 1RGIA 3HFZB 2G0IA 2KLAA 4PXBA 5FLXU 1MU2B 1U04A 4KB7A 5CYQA 3WNEA 1P6TA 1S6PB 4M5IA 3PV8A 3M8QB 3QGHA 2KH9A 3J81Y 3N9UC 4DU1A 3DMJA 1TUUA 4FS1A 2CQ0A 1RDAA 3JB9k 4GVMA 1X31C 4KPCA 1JLFB 3T9NA 2HK2A 3S3NA 2HB5A 4U67Q 2QLXA 3M32A 1SJRA 2OPQA 1JQGA 1LV5A 3LPEA 1UW4A 4JKCA 1VQMS 2A42A 1IBMJ 4JYAF 5ETSA 3MMBB 2MQMA 1QSSA 1VRUA 1QD1A 4M5HA 1TL7B 2W9BB 2GS8A 3BKTA 1L5UA 3WEEB 3NCIA 3PIPL 4P52A 4UZCA 4U7CA 2VQEJ 1YI2N 3KMQA 2NUHA 3FE1A 3KIOA 3VESA 4A61A 1SBRA 3WNGA 5KFWA 1V4TA 4NASA 4DR6K 2GMJA 1LFPA 5KFRA 3UD3P 4LT6A 1H2UX 1H73A 4FF1A 3QEPA 3HCXA 2ZZNA 1NK8A 3L0QA 4NYPA 4X4SA 4FPRA 4OL8A 1RTJA 4CJSA 1FI4A 4CJ7A 1XI1A 1NGAA 5CD4H 4YHHJ 2NQPA 4UY8T 3S01A 1IQTA 4H03B 1BY9A 2V8GA 4RNMA 4GNIA 2LYVA 3V6HA 5IV3A 5LM7E 2FLNA 4OYOA 1M5OC 2ZEJA 2ZWOA 4LQ3A 1MN7A 4ZS6A 2BMBA 2C2DA 2IVFB 2VYPA 3CJ3A 3DGPA 2QLBB 2DIUA 2XYPB 3CVKA 3R7SB 3E01B 1ZBLA 2Q79A 1B64A 2UXBJ 3C3LA 3PACA 2WTFA 1LNQA 3ZC4A 3IRWP 2E1ZA 4EUVA 3BGUA 3MXMA 3HHEA 3OYBA 3RAQA 4CK2A 4LC9B 3DDKA 5ADXH 4ZJQA 3MECA 4FF3A 3NWRA 3DXSX 1VQPS 4WFAL 4DR3F 3HLUA 4I0WA 3H59A 3O1WA 1UFWA 3NLCA 4ZP8A 3UR3C 3OV7A 2YKAA 2DY9A 1FESA 2CA9A 3TAPA 3EE9A 2MSSA 1IR0A 2FY8A 1U4BA 1NRKA 5T14A 3VGMA 4PKIA 4ZVHA 2DH7A 3UNGC 3GCXP 1WSJA 2KT3A 2FVSA 2HFZA 2QMWA 4WP9A 3M30A 2R7SA 2RU9A 2G8IA 1NXIA 2PT0A 1S6UA 2BA9A 1C0GA 2IA6A 2HBMA 3HFVA 1YZ7A 1FE0A 2HMIB 4DR4F 4ZLNA 3CTRA 3QGIA 2BQRA 2VQFF 3I55S 4XH5A 2UXDK 1NSAA 4KO0B 3IR6B 5KFDA 4JI1J 2ITGA 4DPTA 1QJHA 4DV3F 1GH8A 2EEYA 2B51A 2Z4PA 2X6SA 4OV1A 2ZH5A 2B9YA 5DRKA 3OXGA 2W1BA 5C2DA 1S0OA 5KG2A 5EWGA 1WF2A 1R89A 4X84A 2ZGZA 2OLWA 1CJKA 3WBZA 5EXWA 4AM7A 4I2QA 1DTTB 5JUMA 2BRLA 4L3QA 1WEYA 3MCNA 4YDUA 2UUBJ 3M2UA 1JL2A 4WYWA 3GYNA 4A47A 3I82A 4J9OA 3OR1B 4MMOA 1WOPA 1RADB 1N36F 3ICLA 3M2VB 3JAMU 2Q36A 2QWPA 3V9WA 4CHOA 4NZ7A 4GKJJ 1VFJA 5H9EJ 3FDSA 2ZH2A 2VBYA 1VQON 4LF4F 4B17A 5AQOA 3QT6A 2LQJA 4NZ6A 1WEZA 1BC6A 3OHBA 4DHVA 1RBTA 4G1QA 4R5PB 3CMES 3AD9C 1PJ6A 3TARA 4CRJA 5ADZA 5TKWA 4WK3A 4F26A 2K1RB 1QVGM 4DCHA 1Y64A 4U8VA 2M3DA 4Z4IA 3OYDA 1A5XA 4NYZA 2MZSA 3NHGA 4FBUA 1NSKL 1KQSM 2IJFA 1B3TA 1FK9B 4DMNA 4M5LA 4NI2A 1IO2A 2GWKA 4U7UK 4ZPAA 4CFCA 4MTPA 1X9SA 1N5SA 4B9TA 4Y3CA 3MEGB 4Q8EA 4CEEA 5L46A 3ID8A 3R6GB 4C3KA 5IT9Y 3W5XA 4YOXA 2OKQA 5F3ZA 2V2VA 2ACYA 2B5JB 1N33F 4ECTA 4H0OA 4DV4K 1FE4A 1ZM2A 4CZHA 3I9V9 5J1PA 1XNRK 2E5IA 3MEDA 4MIWA 5RUBA 2FJDB 3BQ2A 2ITMA 3E2EA 3QRQA 5AQUA 4CEBA 4YEAA 3DOKA 4FJXA 4CEOA 4KIAA 1GT8A 3PKYA 4L76A 4YOEA 3NS6A 2YX4A 3CWJA 2J8AA 2BKPA 4ZPCA 3IWLA 3A12A 1PYSB 3GQCA 2UXCK 3SQGA 2VZ9A 4ZK7M 1LQ9A 1J53A 2VPZB 2GBZA 3KKFA 2QA4N 2LQ9A 3OPKA 5KT7A 2CH5A 3BF1A 4Y2AA 1QQNA 5CAAA 3C94A 2RDDA 3LP2B 3PYGA 2D0OA 1RT3B 3VZIA 5J2MB 1H0HB 4IOXA 2DH8A 3T9ZA 2O8FB 2KVIA 3VCDA 4KTWA 1N5YA 4YN3B 3SQOP 4UOCA 1XIQA 4UY8O 4C8NA 2IOCA 3CCZA 3I0SB 4OYPA 3M05A 1HNXJ 3AVFA 1MMLA 1FFSB 3FBCA 4M3YA 3JYTB 1F5CA 4ZPTR 3DRPB 5MLCV 3R1XA 4WBFA 5SZTA 3ILIA 4P2XA 2HIYA 2XBPA 5AQFA 3V2UC 2FVPA 2DNRA 4EP5A 2RQKA 4YDXA 5AQGA 3ENAA 4A8FA 3WIVA 1C4CA 1TYQB 4B08A 4DFJA 2X1GA 3SMSA 4M63C 1SQEA 3TJAA 4BC4A 1V6HA 2DXDA 1LOUA 3OQ2A 1VQ4S 4F4AA 2HHSA 3IAS9 2VL1A 4KREA 3NCPA 2VBWA 4PKGA 5LXYA 4ID5A 3SCLE 4HHJA 1YDLA 3P6YC 1CLFA 4FCYA 2W42A 4DL5A 4E3SA 1HBUB 1ZM9A 5FIIA 4OGEA 4KHQA 2ZJPL 1HWJA 2VPXB 1S22A 1Y5NB 3IWXA 1V3SA 4WCEQ 3O3HA 5IQQA 4KH6A 2QWQA 4JKGA 1RHJB 4I6MB 1SIWB 4IOAQ 3THWB 2UVVA 2B56A 2RDIA 3SXLA 3HJFA 2G0JA 4FPBA 4F3MA 3OTOJ 3H4BA 3KNGA 2OSRA 3ZSVA 2P9EA 4CI6A 4GO7X 1WC3A 1RT3A 3J7AN 3OVNA 4AT1B 2DCLA 1Q79A 2NRHA 4K4YA 3MEKA 4UT4A 2G0CA 3VVUA 3VN5A 3CE8A 1UWBB 4F36A 3CJ4A 1TVRB 3D1OA 3G8SA 2IRYA 2RE1A 2LLZA 4CLPA 2D3O1 2YX7A 1R8HA 1YJTA 2UUCK 3A5OC 1LEOA 4KHNA 3FZLA 4I68A 3TRGA 3H45C 4X65K 3HOSA 3KZBA 3MTKA 3ZSRA 1F9EB 3H46O 1ZZNA 5AZIB 4IO1A 1SH2A 3BYRA 1RTHA 4OHWA 3QGPA 1S5ZA 2HHHF 1JB0C 3PW2A 4QWDA 1GTEA 3IG1A 4DSJA 3UCGA 1IBLK 3CCVS 1TKDA 5GAEP 3TR5A 1QZ6A 3TX0A 3MDQA 4PPDA 2E2QA 3VGSA 2G13A 2HWTA 3MD1A 5KQDA 4KT0C 2OH2A 2Q2RA 3M8SA 3PRBA 1BO5O 3OT9A 3J7YI 5HP1A 3M6GA 1S9EB 1KVIA 4KH4A 4FYYB 2YH1A 1C0MA 3DC2A 2AEMA 3VAKA 4IG0B 3G6YA 4LMZA 1HBOA 4FVMA 4A59A 1NJIT 3FJ2A 3ZX2A 2DNNA 1NH7A 3EJMA 3EMTA 4CZCA 2JLFA 2R2RA 4DFPA 4PQAA 2HF4A 3SCIE 2OPSB 4KE5A 3HHKA 4PQUA 3DOMA 5KG0A 3G4SN 3HHLC 1I3OB 3HXMA 5A6PA 1IKWA 1VK3A 2EC0A 1WOSA 3HF5A 1UWBA 3IM8A 3UCUP 5DO2A 2R7RA 1TVRA 1GLDG 4DUZK 4CO5A 2R8KA 1M5VC 3CCLN 2GV1A 1XMOJ 4EO6A 4FWNA 1J5OA 1YJUA 2CVEA 1EXQA 5DM7L 3MWTA 4BDYA 4WQ5C 5KPZA 1P8ZA 4DTPA 1VJQA 1SJ3P 1A5VA 3C6TB 1VQLN 1JLCA 1F9HA 4P74A 4ED8A 3ZCMA 3CJKB 3FNNA 3HVWA 4PG7A 1IBMF 2YWKA 2V8PA 3RB3A 3UKUA 3VEXA 3UN2A 4X62K 4AHVA 4EZ9A 3FCWA 3JSRA 1URNA 1BU6O 4BRMA 2DR9A 3BPDA 2DNOA 4YORA 2UXDJ 3CCES 2VQEF 3LPUA 1KVKA 5E3PA 1JLQA 3LP1B 2LEAA 3UKRA 2QKBA 4JAXA 2MY7A 2FF3B 4F4ZA 1S4FA 2ZH7A 3HSZA 1AFJA 4KV8B 1UW9A 1RWVB 1Q16B 1XQSC 1I51B 1FKPB 3T1YK 2DHAA 1C1BB 3LA0A 3HSTB 1YJ9N 2XQCA 3NAEA 2DJWA 4YHHF 2VC0A 1X9JA 3HVTB 2DTUA 1TELA 3QT5A 4IFVB 1VSDA 2XG8A 4CLSA 2BEFA 1LWCA 5DG8A 4O3SA 4DTJA 3LP0B 1GXUA 3R3LA 2UUAK 1S6QA 3ZZPA 4P75A 3LUYA 1YJRA 2AMCB 3QGGA 2OD4A 2FJAB 1D3WA 1X7VA 1VLOA 1WKJA 3D7SB 2E88A 1GLFO 2O8EB 3D6HB 4R25A 2FJVA 1QAYA 2JDJA 3OS2A 4ZHRB 4JUZA 3KKSA 1GAOA 3A5MC 5D4PA 4C2MA 3H5YA 2UXBF 5ETQA 1S4EA 3EXYA 4ZVGA 1G15A 4ZN1A 3UQSA 1IXKA 5A8WA 3OSPA 4ZIVA 2CNOB 3N6NA 3OL8A 3A8EA 2CDQA 1JCFA 3N28A 3R5GA 4Z0UA 4JI3K 3K0SA 3HULA 2V51B 2X6NA 2CPJA 3QSYB 3CM6A 1X5TA 3CUNA 3G0ZA 1O1WA 2EKNA 4N47A 2VH7A 3KUEA 1N5VA 1RSCA 3NRBA 3K2PA 3ELHA 1GMWA 3TU5A 1NU0A 2MQNA 1H2TZ 2CWKA 3MM5B 4LRCA 3W2WA 2PZSA 3LW5C 2DPNA 5KFNA 2WW8A 2Z2LA 2DEIA 1W7WA 2B4OA 2FBYA 2GV9A 5HQLA 4FJ5A 1OWXA 3CJ7A 2VJVA 2QWRA 1N52B 4CJUA 4DV7K 1HHTP 2F7TA 3PR5B 3AD8C 3I0RA 2ZM6K 1RHQB 5GADI 1FFGB 2PI4A 4P2SA 3HVTA 1VBXA 3A1YG 4JI1F 2YHBA 3FEXB 4TY9A 2DHSA 4OJ1A 2FJWA 1XMQJ 4FWOA 1WI8A 2UXCJ 4B3OA 4CLYA 3M8YA 2ERRA 4NA3A 3OYHA 1QVFR 2C1EB 1X3MA 1C0UA 4Y2CA 2HG4A 3GJTB 3UNYA 1TU0B 4USTA 2QEXS 1JJCB 4NLDA 1U8WA 3U3YA 2RHKA 1N8RO 3JQKA 5ETTA 3PHEA 2UUBF 4O4GB 2A3ZA 3G86A 3TTCA 4ZHRA 4C4WA 3OVSA 3CJCA 1TV6A 3ISNC 2VHGA 1SXLA 3RGIA 1TKXA 5DDQC 4DR7K 4GKJF 4G1IA 1HQUB 4MYTA 1C0TA 5M1PA 4DSLA 1K1QA 1KKHA 1IV0A 1JL1A 2D3ZA 3FBBA 1VMBA 2MQLA 5AJ3J 4QWCA 3G71S 2MZQA 1XEZA 4CO4A 1KP6A 1G1XA 4HH1A 3PSFA 5B8HA 4KKOA 4O44B 1K9MO 4C3LA 4JK9A 2ROGA 4KTZA 1NK6A 3R7NB 1KDNA 1K1SA 1WKKA 1SH3A 2R7WA 1NLKL 1IJJA 1H74A 4JV2A 3LAMA 2DO4A 2OFHX 4KGKA 4NL5A 4BG9A 4S0MA 4A8QA 1F9FA 2ZZTA 2YWGA 5I3PA 3OFFA 2CWXA 2HSEB 3WXKA 3MCAB 3T69A 4HYKA 1U45A 2HNDB 4PAAA 2XMTA 4A8XA 3NMAA 4OJ3A 2DYAA 3CQ8A 4USMA 3O9TA 1UEUA 3KHGA 2IVMA 3PLAA 3BSCA 4LF6J 3I96A 1Z26A 3MN5A 3QWUA 1YWXA 2JHEA 1R6YA 2Z2MA 3NL0A 4WE1B 2CQ2A 2NUUG 3U9ZA 2QGFB 3W1YC 4JKBA 5A0YA 5GAGI 3CB4A 3JQJA 2IHR1 4BRPA 2QM1A 4M41A 3ENHA 2G2OA 1N0VC 5CH7B 5CZ2A 2WSFC 5FROA 1KLNA 3K9KA 1NWKA 3NH0A 6AT1B 3IDHA 3BY5A 4E1MA 3CF5Q 4BRCA 2XSJB 1UTAA 3BSAA 1H1VA 4FBTA 2E1CA 5JXSA 1DFDA 4BGAA 1F5AA 4IOBA 1RTZA 1KLMB 1NM2A 2QYCA 1NGHA 5KG6A 3HHDA 2IC3A 1NKEA 5L1IA 4M5KA 4X4VA 3N5FA 5GIPA 4YOUA 2EHGA 4Z2XA 1G6BA 2YWWA 2XO6A 3GLJA 2RRBA 2KDOA 5K8OA 3GZ7A 4F50A 1HNXF 5KG4A 2OHDA 3TUJC 2Q66A 2RT3A 2K2PA 4XH4A 4IFYA 1NPKA 2FBTA 4PKDB 4ED7A 4H0XB 3VQ9A 2HVEA 5IQ6A 4P72A 2ZJRQ 1IQZA 5ETPA 4CJVA 4KH5A 4EGLA 2PFDA 5BXIA 1RWOB 1WBBA 4A57A 3PSIA 2CDRB 2EBGA 1IBLJ 1VQYA 5J1EA 1L3VA 3KWMA 4EYIB 2B4VA 1TL1B 3NF9A 3NWGA 3OA9A 2IBKA 3GIRA 4C7QA 4BVPA 1QHAA 3ATVA 3W2VB 4JI5K 2DNYA 1VOMA 2XY6A 1FRMA 4DCOB 4KB1A 3K89A 4ALZA 4DQPA 4NLVA 4DV0K 1R31A 2NXEA 3C7NA 2C3PA 2Y1JA 2QW9A 3UDVA 2GO8A 4FLTA 1UEKA 4ZCMA 3HYFA 2CRLA 2FHKA 1N32J 2GCFA 3P4UB 2GNKA 2XYGB 1HW8A 5IT4A 3TSUA 1QTMA 3W8PA 4FYDA 3H1QA 1U1KA 4OIXA 1D09B 1OY8A 2IVNA 1NZ8A 1DAXA 4DUZJ 3O2IA 2VBXA 4HT5A 1F3VA 2GMHA 3OTOF 4EBEA 4FLWA 1BISA 1M1HA 3CI5A 2BW7A 2KN4A 4ZN3A 1QM9A 2R9LA 3ZO7A 2QWLA 1UJ6A 5C25A 1GK8A 4BDPA 2M9KA 1XC3A 1RWUA 4O5FA 3PYEA 1SC6A 3FCVA 3EX7B 3VETA 3C6UA 3RU0A 4YQWA 8RUCA 2F3JA 4O3RA 3C15A 2BQUA 2XHBA 4CLZA 3KHYA 3VQAA 5KFXA 3UW1A 1BMQB 4A46A 2OMLA 2QX0A 2DGVA 4LF1A 4ZLJA 4X62J 2Q0RA 2NLXA 2F9WA 4MIBA 4RO0A 3E66A 3NF7A 3CYMA 2XY5A 1PIEA 2NXNA 4DV6K 2KI2A 4DBQA 4DTSA 4PL8A 3EM1A 1L3TA 2JVOA 4DG1A 1GLEG 4GKKK 3RAXA 2EC2A 4ISFA 2HHTA 2GVZB 2W25A 3TWZA 3S41A 3MOZA 5KTQA 3MOJB 2H54B 2CQ4A 1RT5B 1CEZA 1S76D 2UUAJ 3SPYA 1PYTA 2R8HA 2YTCA 1QAIA 3ZT2A 2B6AB 5KG5A 4CIFA 1FWPA 2O8DB 1RLCL 2HKEA 1Y97A 2E6LA 2K3KA 3K7RA 3GJRB 3AO5A 2DT9A 2VFTA 3TUPA 4K4UA 1S7HA 3VQ7A 1NBEB 3Q8UA 2WOMB 2O8BA 3OL9A 2X51A 4BWJA 3QBXA 4H4KA 4YP3A 3O44A 1PAEX 5GAEU 1CS4A 1U09A 2SXLA 4FWMA 1FWLA 4R0JA 1WDDA 5BPNA 2D69A 1KVBA 3CJBA 1MWKA 2HQIA 1NM1A 1XMOF 4NMLA 2QXFA 3SYZA 3PJXA 2ACMA 1V5IB 1T3NA 5ETKA 3KK3A 4NPOA 2Y8YA 2J0QD 2WB1D 4F0MA 3R9LA 3AVKA 1JNZB 3JSYA 1WI6A 2KFNA 2HBZB 3G25A 1Q8KA 4WYBA 2PMHA 4AM6A 1FRHA 2BJ7A 2CJKA 2KFYA 4E7LA 4JK7A 3B6OA 2RJZA 2LEBA 3MN6A 2ETJA 5DS7A 2HURA 4CJ5A 3CCRN 3MFIA 2UXDF 1WDTA 3CHWA 3VQ6A 3DU6A 2BUNA 3AFGA 3QSIA 4F04B 2YNGB 3WQTA 3RMAA 3UIQA 1L3SA 3TANA 2PI5A 1OMSA 4QYZJ 2PAVA 3H6EA 3PX0A 1JIHA 4XPCA 4YOTA 1GFWB 5MLCQ 4IEIA 2GO9A 2GVDB 1GTHA 2HZCA 2J7KA 2W24A 4E0DA 4W5QA 1OH8A 4PWDB 5D77A 1ITPA 4CQ1A 5JLFA 1WC4A 4HHTA 4FZXC 2QYGA 3BGRB 2WONA 4ICLB 1SVDA 4RNFA 2HHWA 4LBHA 3L95X 1ITGA 4DU8A 3W62A 2KHDA 4FYXB 4DR7J 1VQ6N 1KFDA 5HMXA 3TAMA 1KOOA 4LR7A 3NNAA 2OTJN 4AHTA 1T6CA 2E5HA 2V4JA 1OQ6A 2B4UA 4OZ1A 3OSNA 3NGZA 3M6WA 4FWRA 1NH8A 4AFFA 2L08A 3NOGA 2NZCA 4CD1A 1WHYA 4ZMMA 3KD5E 4C98A 4LF9K 1RB0A 3POTA 2WVBA 4RUHA 3TJ8A 2DGQA 1Q78A 3TQ1A 1YBTA 4GO5X 1FERA 4M5DB 2NSBA 4KYZA 3A3NB 4HI2A 4LF2A 1OSCA 1RNHA 4FZYA 1UKUA 4A8YA 4DU3A 4L75A 3DU5A 1SKUB 3VF6A 4PG8A 1HD0A 2DB1A 4O8UA 4I56A 1FNOA 4AH9A 4RJVA 2GWJA 1MSWD 4LIRA 1P8GA 5HVFA 1F2HA 1RWMB 2J0WA 1Q95G 5CE3A 2JL9A 4PUOA 1R0AB 1O5JA 1U0SA 3CGIA 1YHQS 5J2NA 4DSEA 3B78A 3P8BB 5F9NA 4TU7A 3RW6A 3NE6A 1WOQA 2W7OA 2GVDA 2EWHA 4A2BA 3ZZOA 3I33A 4KHWA 3OS1A 1MWZA 4PL7A 3QB0A 4OKEA 1OQ3A 2D0PA 3J8AA 2ALYB 3GE1A 5T7LB 1JXEA 3FVYA 1RBSA 5DK5A 3JXUA 3R1LA 3GJSB 1XMQF 3RB6A 2VWJA 4RWXA 4UUXA 1ZBIA 2UXCF 2XMMA 3OTEA 1TAUA 5KFZA 4OYZA 5K14B 2L41A 1Y7PA 1RTDA 2FVCA 4ZVSB 4FPAA 2AYEA 2MZJA 2AZ3A 5A2QU 1NUEA 1FKAF 2E7WA 3B6BA 3IUCA 3KLFB 3L8BA 4O0NA 2DPJA 3M2RA 5EHHA 5HRPA 3EZWA 1T8EA 3TQEA 1WACA 2H65B 4I69A 4USKA 5HROB 4H5NA 2BYCA 1Q86O 1A6LA 2JSXA 4LSLA 3P5BP 4X4RA 4K4VA 4FW1A 1Q9YA 1YXQA 3VQDA 4DTMA 2W40A 2RVJA 2YNFB 2CPZA 4J37A 2JZ5A 1Y00A 4DL0C 1YTAA 1G3OA 2RF2A 4FW2A 5AJ3F 2A2CA 1WNEA 1WC1A 2OEKA 2MKHA 4CJTA 3ILOA 3R2CJ 4KHMA 1ZYQA 1JXLA 5GADP 2Y0BB 3K59A 1REGX 5A8KA 4DSIA 1YSJA 2EVZA 3UB5A 4DB3A 1O13A 4PG5A 4ECQA 1JCGA 4ZITA 4MFBA 4E7IA 4B9MA 4BVOA 1QDUB 4QWAA 3V6JA 4C9DA 4U67L 4H5VA 2AEJA 2ATLA 4PWUA 3FSIA 3ENQA 4M5MA 1GLLO 4JI4J 4RUCA 3TSQA 3TJ9A 4ECWA 4ZCLA 4ETXA 5HBMA 2ZITA 1DZ5A 4DFMA 1ZC6A 2NLWA 3BREA 3NH1A 2BE2A 2CPFA 5T7LA 2KVQE 4PA1A 3THVA 1EB0A 4LF6F 2VG7A 2NXCA 5AQWA 3PRVA 1HYZA 3GSIA 4CBWA 3E9PA 2Y3YA 4KY3A 1Q5VA 3T6BA 2MQOA 4MLEA 4PHTX 3OYKA 2H5IB 3VAJA 1C1AA 4WJBA 2DR8A 4FXDA 5K14A 3CPWR 1MROA 1WWHA 1REVB 2KT5A 4NLWA 3MN7A 3Q7CA 5AZJA 5KPTA 3LDSA 1OYEA 5DLGA 4QWEA 1Q1KA 4OHZA 4ELVA 2KU7A 3E9LA 2QTWA 3MWPA 3CD5A 1IBCB 4U8YA 3AVIA 2IVYA 4WKYA 1DRZA 4PXCA 4W98A 3KVGA 3B4MA 1SV5B 1MWYA 2GFFA 3N5BA 4B1VA 2ADCA 2AYBA 2YKNB 5DGBA 3K0JA 1U8SA 2NRZA 5KFFA 2HWIA 3G6EN 4V19X 2HBLA 4YMEA 2ZH8A 2GC8A 4CTAB 3EKUA 5AE2A 5D4OA 3QEVA 3NS7B 1S1WB 4V19J 5GAHP 3MMCB 2ZH6A 4L8RB 4C11B 2Z56B 5KFGA 4U6PA 2VPYB 2Q31A 4RWTA 2HVZA 4MQ3A 4GKKJ 2A1RA 1QVFM 4DSKA 4B1WB 3SPZA 3SV4A 3HZ6A 1VSJA 4J90A 4DR4K 1CC8A 3CIZA 3Q8PB 3M8RA 1ULRA 4WFBQ 2GAGC 2KHOA 3D45A 4ED5A 2VQFK 1SQFA 5JS2A 2XWYA 1JK9B 3H5SA 5GAGP 3P5JA 3M4XA 3KK2B 1JKHB 3IWNC 2GUPA 3HSGA 1IBLF 4NXMK 2ZHAA 2KB2A 2CADA 4QOTA 4CGGA 2CNLB 2E2PA 2BZ2A 4JD2B 4FM0A 1S72S 2YHXA 4NCGB 2C2ZB 4NZ0A 2Q3PA 3ZZUA 1JLBB 1VSIA 1V9OA 4CJKA 4YB5A 1XHXA 1I1GA 3EPGA 3SSQA 4ZP6A 1T3OA 3DRRA 2VPWB 4FP9A 1TKZB 5HMZA 3V4IB 3VGVA 1J9AA 2R7YA 3KLIB 1SQGA 3AVNA 3I6PA 3CT9A 4DLGA 1Q9XA 5CYMB 1N32F 4TY8B 4LF4K 3K17A 4I6YA 5KG3A 3K5PA 3LM9A 4ZVOB 4C8LA 3PRDA 4RW4A 5B08A 1I5OB 3J7ZT 3MM7B 2P9KB 1R43A 3CJ0A 3RMCA 4DUZF 2QA4S 1YVNA 1CZBA 1UETA 3FBFA 3Q23A 3S1TA 4CHQA 4CH7A 5AQQA 3WZ0A 3ITHA 1QHTA 5L1LA 4Y0FA 4KH0B 2YI1A 3DLRA 2QL7B 4O0JA 5KFLA 2P9LA 3DXBA 2VUGA 3UPFA 1S1WA 5U47A 4ZIWA 3W60A 2RUGA 2W7PA 4HUGA 4FNHA 2IDOA 2JJ4D 3H25A 2MQQA 3SQ2A 4X62F 2IGIA 4CJEA 3U4LA 1CJUA 2WTUA 4OPAA 4K4ZA 1UJ5A 3EGNA 5D4NA 4ED3A 1R7IA 1JKHA 2ASOA 5LMUK 4BRHA 2P9PB 3M6UA 4EAHD 4QYRA 3N79A 1T03A 4OKKA 1VHIA 2ADBA 2F8TA 3O3FA 1OVQA 1HPMA 3KG4A 2V4RA 3SDEB 1PYOB 1YQHA 2OI2A 3QJLA 1K8AT 1EWQA 1U2CA 1WHWA 1HQ2A 1T05A 3O9QA 2I7PA 5CR4A 1YITS 1OVYA 3HPOA 4GC7A 4FK0A 2EG1A 4WFZA 1YTUA 4ED6A 2UUAF 2HFUA 3V4IA 1SC3B 4JHDB 4AILC 2GX8A 1D4XA 3QEIA 4ED1A 2FF6A 4KFBB 5CYMA 2XMVA 4X4PA 5M1QA 3OYAA 2ZF5O 2RQCA 2PN6A 1KS2A 1FJGJ 2HYIB 4ZCKA 1UPPA 1Y10A 4MJKA 1VQ5S 3TW0A 3OBWA 3HI0A 4R79A 1Q7YT 4C6AA 1A5WA 1D8ZA 3U1MA 3IRXB 1QLNA 1RT7B 2YQ0A 1U0HA 2J9EA 2H51B 1J2VA 1K73T 3I87A 2PEHA 3NG8A 4TNOA 1LAVA 4M42A 4CBUA 2YQ1A 2OZSA 3PFEA 4DTNA 5BRHA 4EI2A 5KI6A 2OGUA 5I3UA 3FGVA 4I7FA 4H4MB 1SZ2A 4D3GA 3VEVA 4ZA1A 1RFQA 2MKYA 3LWMA 4HUFA 3LQVA 1ASWA 3QAEA 1BHLA 2O4GA 5A2QY 1EKSA 1UZHA 1XERA 4JV5J 5J2QA 1WJ9A 4KHSA 4FWLA 2QMXA 3VQEA 2YKMB 3AT1B 3IR5B 4BBYA 2YNHA 3MMVA 1HKGA 1BD6A 2WZ1A 2CPIA 3M6XA 3EICA 2FD2A 2WBNA 4ISEA 2Z2YB 2XNQA 3GU0A 4I6WA 4AHRA 2FUG9 1JLGA 5CABA 2VG5B 4GVBA 1KTVA 1KONA 2GGPA 1U26A 3FMBA 2BABA 4B9QA 1ZXOA 3V9ZA 3MD3A 1D9DA 2L9WA 2E9TA 2M8HA 2ASPA 3H3NO 2VA2A 4OI4A 1AUDA 5AXMA 2J5AA 2DGXA