5J2PA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and a second efda-mp at the n-(pre-translocation) site
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/dna
molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2pA05
4FJ7A 2IC3B 2D0CA 3RBDA 4DL3A 2IAJA 2Z1IA 1N6QA 3GIIA 3OYNA 2PYJA 2GC8A 3TAEA 3LANA 4ZP8A 1HJRA 3RRGA 4YP3A 4DQIA 2F8TA 1YTAA 2XRIA 5HLFA 2ATQA 1Q9XA 4CFDA 4FBTA 4ZP9A 2FBYA 4K4VA 4NCAA 2Z1JA 4FK4A 4O4GB 4ECXA 1JIHA 1S0OA 3CM5A 1UA1A 1OS5A 3ICLA 4IOBA 5K14B 4EO6A 3DM2B 3L2QA 1J9AA 4DTPA 1ASVA 5KGWA 5J2PB 1XC9A 1S9GA 1IKWB 1JLBA 4I2QB 2WHOA 1BGXT 4U7CA 2YNHB 3NBPB 1RDBA 4CGIA 1TKTB 3CJ5A 5KT3A 3G6YA 4CEFA 4FZZA 4RG8A 3QERA 1Q9YA 2FLNA 1T8EA 4QWDA 3ITHA 5F8IA 4F50A 4EYIB 4O5BA 5DK5A 3H5UA 4FYDA 2YKMA 2FVPA 3ZT2A 3VQDA 3RMAA 2ITGA 4B9NA 4K4YA 3OL8A 4ZPBA 4CF8A 3SV3A 4BWJA 4NRUA 3HVTB 2KFZA 1LAWA 5DG9A 3IN5A 1NOYA 5J2QB 3KK1B 4ZPCA 2BANB 2AQ4A 3CM6A 1S1VB 1RT6B 4NLYA 1BCMA 3PR5B 4O4GA 4CK1A 4RNFA 4KI4A 4DTJA 3LP0B 3EZUA 2FJVA 4ICLA 3KTQA 5J2PA 1IKWA 1DTTB 5KFGA 5KFWA 4I2QA 1W0HA 3BJYA 4CJRA 3M8RA 3JYTB 3OLBA 3NBPA 1TKTA 1RAJA 2W9AA 3B6OA 2C2EA 2KTQA 4RW8B 2UVUA 1RA7A 1S1WB 3BQ2A 1CSJA 3LWMA 3RAQA 3I0RB 3MXMA 3TQ1A 3HVTA 1RBUA 2HW3A 4FCYA 1KCFA 4ED6A 5J2QA 3KK1A 4O0IA 1NOZA 2G8FA 3AVFA 4J9RA 2BANA 1B9FA 1KLMB 4FLZA 1RYRA 1S1VA 1RT6A 4CHOA 1SUQB 4O55A 4CJEA 2JEJA 3ZSQA 3V6JA 1Z26A 3DOLB 1N56A 2RF2B 3LP0A 2IBKA 2G8IA 4HCBA 4BACA 3VQAA 1S0NA 1TV6B 2XY8A 2OH2A 3DYAB 2GV9A 1DTTA 3MR5A 4DU1A 3QZ8A 3MAQA 3Q8SB 3JYTA 4NCBA 4DFPA 4CHYA 3RB0A 4JS5A 4ECWA 3ISNC 3CG7A 3MXIA 3U3GA 1LW0A 5C42B 3HPOA 5KFJA 4AHTA 3K57A 4F3TA 4EP4A 2FBVA 4H4MB 1D5AA 4ELVA 1CXUA 4DLGA 4QWEA 1UOCA 3TWHA 2P51A 1HARA 4Z4HA 3MFHA 2V9WA 4BDYA 2D3UA 4DL2A 3HXMA 3F9KA 2R8JA 3AA4A 4Z4GA 5CZ1A 2XWYA 2ETJA 4RUAA 1K6YA 1KLMA 1BCOA 5HRPA 1SUQA 2P5OA 4IKFA 4KTWA 2XCPA 3RB3A 2F96A 1R0AB 2RF2A 3AVCA 2J6SA 2KW4A 5HP1B 4TQSA 3DYAA 4IR1A 4J2BA 2HNZA 1VRTA 1QE1A 4KKOB 4NYZA 3KLGB 3KLHB 1D9FA 2PYLA 2ASLA 3NH1A 4YR2A 4J9MA 1XHXA 5C42A 4KB1A 5JS1A 3QETA 4CEQA 2I5JB 2P5GA 2HWHA 2HB5A 1JLFB 5KFOA 4ZHRB 4XIUA 5DQIA 2D7SA 1TKXB 4MIBA 5KG5A 4IFVB 4BDZA 3SNNA 3OYMA 4IKAA 2AJQA 5EDWA 4NLXA 1K1SA 5DMRA 3H98A 1TAQA 3LZJA 4CEZA 4KO0A 4C8MA 3RBEA 4DL7A 3VQQA 4KTZA 2ZD1B 3IAYA 2BDPA 1RTHB 1R0AA 3PX0A 1WNSA 3BQ1A 3I5BA 2V4QA 1HRHA 3OSNA 3QNOA 3QESA 3G10A 5HP1A 4QCLA 1ZBHA 4YFUA 3L2VA 2OPPA 4KKOA 5KFHA 4AHRA 3LP2A 3BGRA 3KLGA 1EETA 4NZ0A 4ZPDA 3NL0A 1UAXA 4Y1CA 1SL2A 3HL8A 4HKQA 1QHTA 2R2RA 5KT4A 2FBXA 2BRLA 3I0SB 2AGQA 2J6UA 2I5JA 3VA0A 1RT7B 3OHBA 4KI6A 3P5JA 5DGBA 5C25B 4FM0A 4JLHA 4IFVA 3AA2A 4U6PA 1S6QB 3VQBA 4JV1A 2LSNA 4GC6A 1HYSA 1RT1B 4GVMA 2IGIA 4E19A 5KFUA 1QQCA 1RDCA 4B9SA 5KI6A 4O44A 3K58A 2HWIA 3M8QB 1ZBIA 4J9QA 3HJFA 3PW0A 3DLGB 1NJWA 3QGGA 4IRKA 2JC0A 4ECRA 4M3WA 4HUFA 4RW6B 4ED8A 3CFOA 3IS9B 4R5PB 3I0SA 2A1RA 4M45A 2AGPA 3IGNA 1RT7A 4Z0UA 2OPQA 1KTQA 5C25A 4EZ6A 3OS2A 3AVAA 3SCXA 4ZTFA 1U47A 1RTJB 4BE2A 5F8GA 1QAIA 3AVJA 2B5JB 4ECYA 3ZT1A 4WFYA 4CF9A 4F4KA 4ECQA 1VSEA 3OSPA 1RT1A 2C22A 2X6SA 4DL4A 5KG7A 2HHVA 3V1OA 1NNDA 4CHQA 4ZMMA 5KFYA 3QEXA 3PVXA 2R2SA 3SQ0A 4TYBA 1B9DA 4WXOA 3OL9A 4DS5A 4B3OB 4OGCA 4N76A 4ZVHA 4CJTA 2AU0A 1J53A 1BHLA 3MFIA 4RW6A 4MK9A 2JEIA 3IS9A 4R5PA 3GIJA 1QSYA 3HO1A 4FJ8A 4M94A 3AO1A 4GC7A 1RNHA 4DSLA 4CFBA 4FLWA 2VG7B 4DL5A 4ECZA 1BQNB 2F8SA 3LP3A 4CEAA 1TQLA 4RW9B 3ZSWA 3HVWA 1C6VA 1W25A 3KOAA 3OYHA 1ZYQA 4ED2A 5JUMA 4F8RA 3C6UB 4IQXA 3CDUA 2KZMA 2DFFA 3Q8PB 2BGGA 1NK9A 1BIZA 3E51A 3QEWA 3OVNA 1VSLA 3M9NB 3NMAA 3LWLA 3SI8A 1U09A 3BR9A 4CJVA 2XI3A 3KD1E 4TQRA 4B9UA 1RT5B 3V9SA 3H4BA 4DQPA 4JRQA 1I6JA 3KK2B 4FJJA 4XPEA 2HHXA 4E7IA 3AA5X 4URSA 1FKPB 2VG6B 1QUVA 2RKIB 4NLGA 3G0ZA 4WE1B 2R8GA 3IG1B 4DF4A 1C1BA 4HHTA 3KD5E 5J2NA 3V6DB 3DMJB 3C6UA 2W8LA 3PW5A 4DTXA 1S6PB 2R8KA 4DU3A 3DLKB 1XR6A 4FS2A 4IRCA 2JC1A 3D5MA 4DSKA 4W5RA 4MKBA 4RZRA 3TARA 4O3RA 4CK3A 3C6TB 2R7YA 2BE2B 5SWMA 4J9NA 3K5OA 2UVWA 3I5AA 4E89A 1FKOB 4OVLA 1TVRA 1RT5A 1LV5A 2WRMA 4TYAA 3H08A 5HRRA 1TK0A 2FBTA 4NLUA 3SQ2A 1FK9A 3QGIA 3OS0A 2GIRA 4M3YA 1KLNA 1FKPA 2Y1JA 4WE1A 5EWGA 3IG1A 4KE5A 3QEVA 5F8HA 3VA3A 4YR3A 3LAMA 3PHEA 3O3GA 4Q0BB 1ZETA 1JKHA 4KRFA 3KLIB 4QPXA 1L3TA 4B9TA 2B6AB 5KT6A 1S6PA 3QLHA 1MMLA 2KFNA 4ECUA 3ZSYA 5KRTA 1BQMB 2IA6A 4J9LA 2O4IA 1TKZA 3C6TA 1JLQB 4IFYA 2BE2A 4N56A 2W7PA 4Y34A 1FKOA 3ITHB 2YKMB 1A5WA 2AGOA 1WN7A 4KB0A 3DRRB 4O3PA 5T14A 3KLVA 4C8KA 3JSMB 4I9QA 1GOBA 1FXXA 4K4SA 4ZPAA 5FRMA 3OYDA 3SQ1A 3PO4A 4DFJA 4EYHB 1VSFA 3K5LA 4Q0BA 2UUTA 1NJXA 3BSCA 3KLIA 1T03B 2B6AA 1S0MA 3AV9A 1BQMA 2XY7A 4ICLB 4MK7A 3ZSZA 1HNVB 1LWEB 2ZE2A 3BQ0A 2BRKA 1LW2A 1CZBA 4PUOA 1JLQA 3T5LA 2R8IA 2ASJA 2HNDB 1RT4A 3OYLA 1CLQA 2AWZA 2ILZA 4OLAA 3TABA 3S3MA 4Q45A 4DS4A 3RR8A 3VQPA 5F9NA 3DRRA 3IGVA 4CHNA 3SZ2A 3JSMA 1REVB 2JGUA 4CHZA 4FLYA 3NF6A 3UQSA 2HVIA 4CJ3A 5EUHA 4FJHA 2G8UA 4TSXA 3H59A 4M3TA 4AHVA 4CJPA 1YVFA 3TAFA 2PZSA 1T03A 2ATLA 3QO9B 3SYZA 3KMQA 4Y2AA 1HNVA 1L3UA 1LWEA 1KRPA 1YT3A 1NKCA 2IS3A 2G8WA 2IJFA 2YV0X 4CE9A 3WNEA 2PY5A 1X9WA 1S9EA 3CDEA 2IM1A 2HNDA 1LW0B 3ALYA 4MK8A 5E41A 3PR4A 2C28A 4HTUA 2D3ZA 3CJ4A 3DRSA 4L8RB 2HHTA 4DF8A 2IMWP 4NRTA 4UQGA 4MIAA 1REVA 1L3VA 4ED3A 4R8UA 3EYZA 1X9MA 3OS1A 3KKRA 1SL0A 5EWFA 2BQUA 1Z25A 5CY4A 3U3YA 1HQUA 1B92A 1KFDA 3VN5A 4AHSA 4IBNA 3QO9A 4CFCA 4M3UA 4B8AB 4FM2A 1IG9A 2HNZB 4WFZA 3GV8B 3ZSVA 1VRTB 1J5OB 4KAZA 1QE1B 1RTIB 4NLPA 2WK4A 3HPHA 4MH8A 2D41A 2XHBA 3QEPA 4DTNA 2I1RA 4O3NA 4DTSA 3O3FA 4KAIA 2VG5B 2B43A 1Z4UA 2E6MA 3K2PA 3DRPB 5DG7A 1EP4B 2VWJA 1Y97A 3QIPA 1IKXB 4R0EA 4EBDA 3OYGA 4FBUA 2E6LA 2R2TA 4OKKA 4J2EA 3TVKA 2D0BA 2JEFA 1N5YB 3VQSA 2DY4A 4MQ3A 3MR3A 2W8KA 2EC0A 3ISND 1S49A 2ZKUA 4KO0B 1U04A 1VSIA 2YNIB 4F2RA 3AVGA 1RT2A 4GMJB 4OKEA 3VQEA 1NK7A 2VWKA 4M42A 1ITGA 2QXFA 4FXDA 3DLEA 1J5OA 1RTIA 2OPPB 1ZTWA 4E7KA 4E7LA 2NUBA 3BGRB 3LP2B 4HVJA 1EETB 3WNGA 3EZ5A 5L1KA 3SFUA 2VG5A 1A5XA 4CESA 2BQRA 3KHHA 3DRPA 1GX6A 1EP4A 2GIQA 1IKXA 4CEBA 4CECA 2W42A 1ZBFA 3KNAA 4NLSA 2WTFA 3G6XA 2E9TA 4DTUA 1Q8IA 3AVLA 1N5YA 3MEGA 3PJXA 4ELTA 4CIFA 4LSNB 3C95A 1S1XB 1HYSB 2RDJA 2QE5A 1JXLA 1VK0A 1NKBA 3V81A 2YNIA 3UR0A 3PUFA 3TAPA 3T5KA 4FJIA 4O44B 1ASWA 1C0TB 2Z1GA 4CEDA 3SUPA 4IH7A 4CJFA 3TAMB 3OYCA 4Y1DA 4E7HA 3M9MB 5KFZA 3HYFA 3BDPA 1NK6A 5C5JA 3SPYA 4KHUA 3DOKA 2RN2A 4LQ3A 3F73A 1S1UB 2W7OA 1SKRA 3KIOA 4QOZB 3QINA 2ILYA 2CJQA 1YVUA 4OJRA 2KQ2A 5KFFA 2OPQB 3GILA 3EPIA 4ZP7A 1WAFA 1NK8A 3RMBA 5C24B 4LSNA 4CIEA 1S1XA 2OYQA 2QV6A 4W5NA 3CYMA 4N41A 5KFBA 1T05B 4QW8A 5D3GA 4CF2A 1VRUB 2YNFB 3DLBA 1XI1A 1WSIA 2WCXA 3QYYA 4FLXA 4DWIA 4FLVA 3SQ4A 3L8BA 1C0TA 1SKWA 1RT3B 1DLOB 4QWBA 2WOMA 3TAQA 2OZMA 3TAMA 2C2DA 4ZVGA 4OLBA 1JLGB 1U45A 3L3VA 2WB4A 3HT3A 4QAGA 4I2PB 3MXJA 2FJXA 2UUWA 3O3HA 5F8JA 1S1UA 1QS4A 4I9LA 2YKNB 5HROA 1S10A 5KRSA 4F3OA 5F8NA 4ELUA 3VQ5A 4LH5A 4KREA 3CIZA 1RDRA 4OPKA 4O3SA 5KFNA 3NGIA 4FVMA 5C24A 4RNOA 2Y1IA 1TK5A 3AA3A 1DTQA 3DLRA 1RTDA 3T3FA 4JUZA 4JRPA 3AO4A 1T05A 1SL1A 1XWLA 1VRUA 2YNFA 3D45A 1IO2A 5CYMA 4KHYA 1XR5A 5L1IA 5KT7A 1RT3A 1DLOA 3TI0A 3PW7A 3KJVA 4F4WA 3ZSOA 1JLGA 5KFVA 2G8HA 1D0EA 1IKYA 2DPJA 4I2PA 4EP5A 3UIQA 1HQEB 3I8DA 3FRZA 2YKNA 4KBIA 3KHLA 1NK4A 4DG1B 4FJ5A 4KHWA 2DPIA 1ASUA 4CERA 5L1JA 4YQWA 4C8LA 3LP1B 2E9RX 1QTMA 1WSEA 1C1BB 2CKWA 5J2NB 1WSFA 5J2MA 3PZPA 1S5JA 3NAHA 5KT5A 5KFMA 3KHGA 4YNQA 3NAEA 1BL3A 1RBSA 2XCAA 1JLEA 4JV2A 2X74A 4ECVA 4RW4B 4TY8B 3PX4A 4RU9A 4CJSA 3VQ4A 1TK8A 3H5YA 3N6LA 4H54A 3BSNA 2OPRB 5DLGA 4K8ZA 1HQEA 1VSHA 1TVRB 4DMNA 4W5QA 1GOAA 3ZSRA 4DG1A 3SUQA 4OPJA 3ASMA 4E1NA 1FK9B 4EO8A 1BISA 1XHZA 1S9FA 1U49A 3QZ7A 4IG3B 2VA2A 4J9PA 3LP1A 1F21A 4LY7A 1UA0A 3AVKA 3V6KA 1RBVA 4O4RA 5KFLA 1RYSA 4B08A 3O4QA 4Z4FA 4K4XA 1YTUA 1JKHB 2GUIA 3L3UA 3QLHB 1RILA 4KFBA 4DL6A 2DFHA 3T1AA 1X1PA 1O1WA 2YNGB 1HYVA 3GYNA 4RW4A 5FDLA 3THVA 3C94A 1JL1A 4TY8A 3HM9A 4DSFA 3FDSA 1TKZB 2OPRA 1SH2A 1KFSA 4IFYB 3NDKA 5KFSA 4CJUA 3CFRA 3G86A 4NLTA 4KHSA 4IG0B 1C0MA 1UWBA 4FW1A 4ED7A 5KG0A 1RDAA 4CEOA 1NK0A 5KFIA 3HVRA 1TL3A 4FJMA 3SPZA 4E1MA 1VSDA 1NKEA 4IG3A 4EBEA 4AHUA 3RB6A 2A1SA 4RNMA 3DLHA 1A5VA 5DLFA 2UVVA 4B8CA 4BWMA 3EY1A 3V9UA 5J1EA 4M3XA 3CQ8A 4K4ZA 1L5UA 3ULDA 2IM2A 1U48A 5KFKA 1SKSA 4DFMA 4CFAA 2YNGA 3CFPA 4Q5VA 2ZE2B 1RA6A 4RUCA 4YMEA 4LH4A 3V9WA 1LW2B 3K5NA 4PUOB 1HNIB 4IH6A 5DQHA 4PQUA 3H4DA 4IG0A 1RT4B 4FW2A 5F9LA 1JX4A 2IM0A 1X9SA 1GOCA 4AHCA 4EZ9A 3RB4A 4EBCA 3RMCA 1I3AA 4WYWA 5KFTA 3H5XA 2D5RA 1EX4A 2R2UA 1WSHA 4DFKA 5KG4A 4M41A 1IH7A 4ZTJA 5KFCA 1JLAA 1T3NA 4IRDA 4ID5B 3QEIA 5KFQA 2Z1HA 3NFAA 4CF1A 4F2SA 3S3NA 4FJ9A 1T94A 4DQQA 3BSOA 4O0JA 5F8LA 1D8YA 4Q8EA 3S3OA 4MFBB 2XGPA 3ZT4A 1HNIA 4CJ5A 4E3SA 1S9EB 4FJNA 2E4LA 4KSEB 3CWJA 3BREA 5KTQA 4O3OA 4E0DA 3T19A 5KFAA 1L3SA 4LSLB 4WXWA 1CZ9A 3DRSB 5EU7A 3TANA 3CDWA 4K4WA 2AX1A 4WZMA 4W5TA 2UVRA 5I3UB 3UPFA 4ED0A 4R8UB 1JXEA 3HP9A 1ZTTA 2IC3A 3G6VA 4N5SA 5HRSA 2RPIA 3PW2A 3H40A 4CEEA 3CVKA 4ID5A 1S1TB 3N6MA 4Z4IA 1HQUB 2G8VA 3TR8A 5JXSA 3LALA 2QKBA 4MFBA 4KHMA 3KLEB 3OJUA 3CJ0A 3NGZA 2FVQA 1ZBUA 5K14A 3HPGA 4DLEA 3DM2A 3QIPB 4LSLA 4URGA 3RR7A 4OL8A 2J6TA 3V1QA 4NLVA 4CCHA 4BDPA 3K5MA 1VSMA 2YNHA 5KG3A 4FK2A 1QAJA 3PV8A 5I3UA 1MU2B 4J2AA 4HYKA 4DU4A 5KT2A 1RDDA 1QSLA 5DG8A 4IDKB 1S1TA 3WNFA 3L2WA 3HKWA 1RT2B 3RRHA 2DTUA 3SFGA 4QW9A 3UDLA 4K4TA 4IR9A 2R8HA 2FVSA 3FQLA 3VQCA 3L2RA 3DLEB 4K8XA 3NCIA 3PY8A 4NLQA 3KLEA 2HAIA 4J9SA 1WLJA 5KFDA 4ZVFA 3RTVA 4PY5A 3MR6A 2HVHA 4TY9A 4ID1A 1D9DA 4CGGA 4FLUA 2HHSA 3MTKA 3V6HA 4CGJA 3QIOA 4ECSA 3IRXB 2ALZA 5CZ2A 4Z4CA 2XGQA 4ECTA 2IJNA 3MEGB 2KZZA 1KHWA 3TAGA 1MU2A 4QWCA 1S97A 5HBMB 3NE6A 4RW8A 1U4BA 4XPCA 1W9HA 1S1WA 2FJWA 3V81B 4IDKA 5SZTA 3QNNA 2G8KA 3I0RA 3OHAA 4C8NA 3SV4A 5KG1A 3GIKA 2FLPA 2WONB 3D0PA 1BI4B 3I5CA 2FLLA 1EXQA 4M95A 4WFXA 5DGAA 2XI2A 4F4YA 4FLTA 4AILC 3DOKB 3DOLA 3D28A 2OPSB 4RW7B 4B9MA 1KVAA 3QGHA 1TV6A 3RWUA 3IRXA 4CJWA 4G3IA 5KFXA 3MEDB 3RMDA 2IM3A 4KPYA 2B4JA 4CGFA 4GW6A 5HBMA 3E01B 4TLRA 4M3ZA 4KB7A 1S48A 1SV5B 4H4MA 5D3GB 5F8MA 3AVMA 3U6FA 1N48A 3KHRA 4CIGA 3OL7A 4DTMA 1LWCB 3NH2A 3HP6A 2WONA 3L2UA 3KMSA 5JS2A 3K59A 1BI4A 4O3QA 3GV7B 4C8OA 4WYLA 1HMVB 2WOMB 3FSIA 4HUGA 1G15A 3MECB 5FROA 1HYZA 4Z4EA 2EHGA 1IM4A 5L1LA 2X78A 4FZXC 5DQGA 3QIDA 4CGDA 4KHNA 1NK5A 2OPSA 4RW7A 5HROB 4CGHA 3O4NA 3GIMA 2ASDA 2XY6A 1N4LA 4B9LA 3HVAA 4J9KA 1D1UA 2O4GA 3HSTB 4H4OB 4IH5A 4TXSA 3OYIA 3MEDA 2RDIA 1RBTA 3OL6A 2IDOA 3KLFB 3KLHA 2XC9A 3V4IB 1TKDA 4CK2A 3PO5A 1C0UB 2P1JA 3NHGA 3M8SA 3E01A 1DTQB 1RTDB 1TL1B 1JLFA 2BQ3A 1SV5A 4FM1A 4HCCA 3AO5A 4ZHRA 3MR2A 1TKXA 4NLRA 1KVBA 3H2LA 5CYMB 3PJWA 2W9BB 4PWDB 2XO7A 4G1QB 1LWCA 1C2PA 1NHUA 2HNYB 4Y2CA 3PW4A 1HMVA 5L9XA 3KJVB 3MECA 2VA3A 4RNNA 2GBZA 3NF8A 1IKYB 3LPUA 2ZD1A 4Q43A 4ED1A 1RTHA 3V1RA 3S9HA 3VQ7A 2HHWA 3NAIA 3V9ZA 4KV8B 3HHKA 3RAXA 3AVNA 4H4OA 3ZT3A 5CYQB 3ZCMA 1T7PA 1RBRA 2E9ZA 1VSJA 3CJ2A 3KK3B 4FJXA 1K1QA 3KLFA 3V4IA 3OYFA 4FK0A 1I39A 3ZT0A 1C0UA 4KHQA 3FFIB 1RCHA 3NGYA 1TL1A 5J2MB 4N47A 4DTOA 5T7BA 3T5JA 4CHPA 2W9BA 4PWDA 3V9XA 3N6NA 4G1QA 3LAKA 5HRNA 5KG6A 1S6QA 2HNYA 3OYKA 3AVIA 1JLEB 4F4XA 2QKKA 5I42B 3NH0A 4DQSA 3GV5B 1QSSA 4DSEA 2FVCA 4JV0A 3B6PA 2Q3SA 4OKJA 3NGDA 3M8QA 1NJYA 4E7JA 4KV8A 3VQ9A 3DLGA 5EWEA 4Y3CA 3OYAA 1LWFB 5CYQA 4AH9A 2HHUA 1BIUA 3KK3A 4NLDA 1C1AA 4YR0A 3LPTA 3NF9A 3FFIA 3NKYA 3KKSA 2YHAA 3VQ8A 3WNHA 4X2BA 1J54A 4BE0A 4BE1A 1RTJA 4ZP6A 5KGXA 4KFBB 4K4UA 1JXBA 3OYEA 3OLAA 3DI6B 2B5JA 3VQ6A 4DSIA 1VSKA 3FQKA 1HPZB 5FDLB 4CJKA 4XO0A 5I42A 5KFEA 1TAUA 3MEEB 4Q8FA 2V0NA 4FS1A 2AX0A 3P1GA 4B9VA 3SI6A 5FRNA 2HMIB 4NYFA 1EKEA 1UWBB 1XR7A 4DQRA 2D0AA 2W9CB 3H5SA 3AVHA 4B3OA 3OYJA 4KHRA 1LWFA 4DSJA 1WNEA 4NLWA 4LQ9A 1TL3B 4K50A 1NHVA 2C2RA 4DEZA 2EX3A 3PX6A 3DDKA 2HHQA 2O5DA 2V4RA 1KSPA 1TP7A 5J1EB 4CF0A 3Q8RB 3CO9A 2VG7A 3LZIA 1CXQA 1BQNA 1WSJA 3GQCA 3DI6A 4RW9A 3AO2A 4OGEA 3BSAA 1WAJA 4NCGB 1HPZA 4NLOA 4CJQA 3MEEA 3M8PB 1WSGA 2ZQBA 2HMIA 4CJ4A 1JLCB 3EPGA 1JL2A 3OYBA 2IOCA 4FJGA 1GX5A 4PQUB 3MF5A 1SH3A 3T5HA 5KFPA 3ZSXA 3M9OB 4WZQA 4PA1A 1ZBLA 4URQU 4M3RA 4FJLA 2YHBA 4JS4A 2JLEA 1S4FA 1C1CB 2W9CA 5KFRA 1KHVA 4I7FB 1IKVB 4MKAA 4QWAA 3SUOA 4FZYA 3OJSA 4NYNA 4HUEA 4ZVEA 1KVCA 2IAJB 2FVRA 3A2FA 1JLAB 2OA8A 1N6QB 2QK9A 4RNHA 2JEGA 1NJZA 2FC0A 3KK2A 4LD0A 4J9OA 2VG6A 2RKIA 3NF7A 1SH0A 5HLFB 4NCGA 5KG2A 3OY9A 4F4ZA 3V6DA 3DMJA 3M8PA 4CJLA 3AO3A 3Q8QB 2OZSA 1TGOA 3P83D 2BR0A 1JLCA 1LAVA 4W5OA 3HK2A 3SUNA 3SJJA 2XY5A 3CJ3A 2DFEA 3DLKA 4KTQA 3AVBA 3LDSA 1C1CA 4H8KA 1S9GB 4Q44A 1JLBB 4TN2A 4EEYA 4I7FA 1IKVA 2X6NA 4DTRA 4J2DA 4FJKA 2F8EX
chains in the Genus database with same CATH superfamily
2DNPA 3J80Y 1M5KC 3GE9A 2P9KA 3PTWA 1R8PA 5D0GA 3OYNA 3TAEA 3QWUA 1VQ5S 4ZVOB 3RRGA 2XMVA 2ZVIA 3B8AX 2AW0A 2VONA 3BKTA 1NGJA 2B8QA 2CFXA 5AQUA 5JICA 1MROB 5K14B 1WOSA 1NH7A 1R8BA 2IA0A 2FY8A 1J9AA 2KG0A 1LNQA 3H1QA 2MQMA 1JLBA 4JKAA 2QA4G 2YNHB 1RDBA 3UCZP 4OI2A 1G2EA 4FWOA 3G6YA 4JKCA 4FZZA 1Q9YA 2FLNA 3DRXA 2LYVA 1KTVA 2J0XA 4F50A 2LQ9A 1WHWA 3L7UA 2E1ZA 1BD6A 4Z94A 2MLXA 4OIXA 5B0FA 3IDHA 4CF8A 4DX8H 3HVTB 2KFZA 3BS9A 2AQ4A 1WSVA 2PMZD 3KDNA 3NVKA 1S1VB 1RT6B 1VQLS 2M7SA 1BCMA 3PR5B 5A2QO 2Y3YA 4CK1A 5L39A 2QTWA 4FF4A 4MJKA 4YUDA 4L3KA 3LP0B 1X31C 3EZUA 2VDHA 2F5GA 3NS5A 2FJVA 4ICLA 3KTQA 5J2PA 2OCEA 4ILJA 1DTTB 2BUNA 5KFGA 3CJQA 1RBAA 2DR5A 1O0PA 3POTB 5HSPA 4CJRA 1VC6A 4FN5A 1K0VA 2DNRA 3DHXA 1RAJA 2V2KA 2NYIA 2KTQA 2DGSA 1RA7A 1CSJA 4LBPA 5AQTA 1M5PC 1PYTA 3RAQA 1APSA 5G0RB 3TQ1A 2HW3A 2RRBA 4BR5A 1R6YA 3KK1A 4KPCA 2GMLA 3ILIA 2GZOA 1S72S 1VQKN 4XDDA 4FZVA 3V6JA 4ED5A 1Z26A 4DV7F 1FWLA 3C16A 2WTUA 3VHQA 5E3QA 2V63A 3UI3A 3UN3A 4C0BA 2Z2LA 2HHHF 1VQ7S 1K44A 3RB0A 4ECWA 4H5NA 2Q0UA 1LW0A 5C42B 4RL1A 1WHYA 5KFJA 3R97A 2Z57B 3W9JA 4DLGA 3ZZYA 1UOCA 4YOUA 4BCAA 2P51A 1WBBA 4ZPVR 3MFHA 4BDYA 4DL2A 3AHPA 3R27A 4JD2A 2E7XA 2RU9A 2OI2A 2VB6A 5LMNJ 5HRPA 2OP5A 4UOGA 1SUQA 3Q7CA 4QR2A 4KTWA 2DR7A 5JVHL 3IWLA 1LWXA 4PKHA 4DV3F 2IIHA 2RF2A 2CQPA 1FJCA 2RVJA 4PAAA 3JSRA 3GU0A 3DYAA 1SPBP 2HNZA 1YRUA 1VRTA 4DR5F 4KKOB 3J7A1 5FPDA 2OSRA 1B70B 3KLHB 3FR0A 2ASLA 3NH1A 5K8NA 1CC8A 1M5HA 1J5EF 2AKWB 4CEQA 4KYZA 4M5GA 2ZFHA 1N33K 5DQIA 1TKXB 4YORA 5KG5A 1IQTA 4IFVB 3SNNA 3BM7A 2X7IA 3MM7A 3SMSA 2AJQA 1VBKA 4NLXA 4JI2F 3Q2TC 2CWXA 3Q83A 5FLXO 1S12A 3H98A 1TAQA 3M1VB 4OI0A 1KOOA 2KT3A 3VQQA 3ZZPA 2KHDA 1WNSA 2G4BA 5C2FA 1HRHA 3SDEA 2YHYA 1ZBHA 3L2VA 5E2QA 3LP2A 4O0NA 1UAXA 2ATCB 4QIFA 4NA1A 3OTOJ 1QHTA 2CRLA 2FBXA 4R79A 4AQYK 3CD0A 4CDIA 3NRBA 3OHBA 1YVNA 1NDLA 1YI2S 5C25B 4FM0A 4JLHA 2NPIA 4FPAA 4JK7A 3SQOP 2VQFJ 3VQBA 3VF4A 4X65K 5DS7A 3MCMA 2LSNA 4KY3A 3H46O 1VQPN 4GC6A 1HYSA 4PG8A 4CP5A 1X5TA 3Q22A 3TJ8A 2HSEB 4CLKA 1FCAA 5B09A 1RDCA 3SCIE 5KI6A 4K5RA 1I51B 4ALZA 4WBFA 3CCUS 4J9QA 1PJ6A 4IRKA 2JC0A 2Z58B 2GMHA 4ECRA 2UUCJ 1R3NA 1PSDA 3QFHA 5SUHA 1S0VA 3DLLQ 3N4PA 1PAUB 1F3VA 1D8ZA 2HS0A 4C48A 5A8KB 5GMDA 2YWFA 4EZ6A 3T1HF 2KHOA 1N34J 2IVOA 2IRUA 2B5JB 4ECYA 1XMOF 2YQ0A 1Q79A 2UXCJ 4F4KA 2QLJB 5BN9A 3PIPL 4UT4A 1YITS 2C22A 2RQMA 1N8RO 1WC5A 3MN9A 4ETXA 7AT1B 3OR2B 5KG7A 2W01A 1IBMK 4ZMMA 2DXFA 3SQ0A 1QDUB 1U6BA 5BR8J 4B3OB 2O8EB 4CJTA 1J53A 2F8MA 4DHYA 1AFJA 4R5PA 5KPTA 2C3UA 2PMHA 4FJ8A 1RNHA 4NL5A 5D0RA 1WG1A 2MYFA 3H8YA 1TQLA 2R4FA 5LJ5Y 3OYHA 2IJRA 1ZYQA 2MY7A 1UFKA 4DPYA 2ZGZA 2DCUB 3CDUA 3KHYA 2BW2A 2DFFA 4B17A 4M8LA 3MX5A 3SJHA 3E51A 1ILYA 4CJ7A 2UUBJ 1BY9A 3B78A 3MM5A 1AZSA 4BR9A 2CWKA 5AZJB 3HI0A 1ROFA 2ZHOA 1R31A 5BRFA 4B9UA 1XNQK 3SBMA 4KH4A 1RT5B 1P6TA 3CCJS 4JRQA 4FJJA 2HHXA 1ZA1B 1U26A 3AA5X 3CDAA 4IFEA 3D2EB 4URSA 1FKPB 1QUVA 1IR0A 2I2YA 1WF2A 2CQ0A 5J2NA 3U4LA 3VGSA 3C6UA 2W8LA 2HYIB 4Z7YA 4A2BA 3PW5A 3B8HA 3L3CA 4DTXA 4A2AA 2HMPA 3ENVA 4A61A 1RSCA 4FS2A 3QRQA 2CGJA 4DSKA 2I38A 2JX2A 4NASA 4J9NA 3K5OA 2UVWA 4M5NA 3I5AA 2HQFA 4OVLA 2WRMA 2CPDA 5BPNA 1N33F 1CULA 2LKZA 2QL7B 4NLUA 3SQ2A 5ETSA 3QGIA 1SCJB 1Z05A 3UN5A 1OSDA 1KLNA 2V51B 3AY9A 1T9WA 4KE5A 3QEVA 4LIWA 2W2OP 4B1WB 4IO8A 1A9NB 3D7EO 2B6AB 1S6PA 3QLHA 2FXUA 4H0YB 3ZSYA 4I1TA 5C0YA 1N8RT 2FC9A 2MZ1A 2A40A 3EGWB 5DDOC 2KT5A 2MSSA 4Y2MA 1YWXA 4N56A 3HTVA 4AQYF 4ZJOA 1JB0C 3TSQA 2XSJA 1X8DA 2HRTA 5TKYA 2CPXA 4N7TA 2JL9A 1FXXA 4K4SA 1S6UA 2IVYA 4X65F 2E5IA 4L74A 4JB8B 1DRZA 4DV3J 3OFHA 3SQ1A 4DV6K 3HM8A 2ZJPL 7FD1A 3K5LA 1NJXA 5FPMA 5AQHA 2Q31A 4B1XB 4F4AA 1R43A 4DR5J 4I68A 4N8OA 5IT4A 3T6BA 4ICLB 4MK7A 2DNMA 1URNA 4UTGA 3TZWA 1CZBA 1JLQA 2KI2A 1GMVA 2XQCA 2HNDB 1RADB 1X9JA 1RT4A 3U1LA 2AWZA 3TABA 3S3MA 3RR8A 4JI2J 4OJGA 5F9NA 2RSQA 3JSMA 3UQSA 3V4MA 3VR1A 1VQLN 2AJFE 4ZCLA 4WTYA 1U1KA 3SMPA 3O6QA 1NG9A 8AT1B 3TAFA 2D9OA 1TYQB 2VC0A 2RMLA 2ATLA 5IM0A 2P2CB 1SC4B 2K3KA 1K0TA 1IBMF 3KMQA 2DGXA 1N32K 2GUPA 2M8HA 2IS3A 2IJFA 1U1NA 2BJDA 2CGKA 3HJVA 4PQAA 4FP9A 1VISA 4DV2J 1QZ6A 2PY5A 2IM1A 1LW0B 1BLUA 2CNLB 2VBYA 5E41A 4LF2A 3PR4A 2HGMA 2C28A 4HTUA 3CO0P 3OW2M 2GVDA 3W2VB 3VAKA 3MXHP 2IMWP 2YXLA 4NRTA 1M1KT 4MIAA 1REVA 1L3VA 2Z30B 2GHVC 4JD2B 1IWGA 3R5AA 1S76D 5CY4A 3T7ZA 1KFDA 3VN5A 4OX9F 2H5JB 3Q23A 4FM2A 4HACB 4PG7A 2HNZB 1VRTB 1J5OB 4KAZA 1RTIB 2BOPA 1CEZA 1U02A 2XHBA 1GLJO 4DTNA 3ZZUA 3OPKA 5LMUK 4O3NA 4QPTA 1P27B 3O3FA 3D6MB 2KM8C 1Z4UA 2DYAA 3I6PA 2E6MA 2ITMA 5DG7A 1NO8A 1EP4B 3T1HJ 1EARA 2M8DB 1XNQF 1IKXB 4EBDA 4CZMA 2R2TA 1XMOJ 3VEWA 2NXCA 4OKKA 2MLZA 1VCTA 2JEFA 1WEZA 1HD1A 2EEYA 1UCNA 1LFPA 2DY4A 5JLFA 2W8KA 3A3PB 4KGMA 3ISND 1VSIA 4NEYA 5GADP 1FFSB 2WB1D 4C11A 4OKEA 1GLBG 3SDEB 1FKAF 4P10A 3M30A 1HUXA 5DDRC 2ZF5O 2QA2A 1ZTWA 2MZJA 2DJWA 2NUBA 3LP2B 2JLFA 3LDPA 4CESA 4OZ5A 3KHHA 4DR7K 2GIQA 2XMKA 4E8UA 4YN3B 2CG4A 4CT9A 2WTFA 3KNAA 1A6LA 1UWAA 3AVLA 3PJXA 3OVAA 2QWQA 1HYSB 2ROPA 4JI8F 1KR4A 1KS2A 4PHTX 3V81A 3UR0A 3W8PA 4FSVA 4X4SA 3ETMA 1ESVA 3A5NC 5LJ3Y 5E5NA 5JLHA 4A46A 4E7HA 3M9MB 4A8WA 4BQLA 2E2PA 3BDPA 2MLYA 2D74B 2GTDA 3SPYA 3W9IA 2MQOA 5D4LA 1NDPA 1C0GA 1YI2N 3MPYA 4QOZB 3K89A 4OFZA 2PIIA 1YVUA 4OJRA 1N5TA 5KFFA 4BBYA 5H9EK 1WORA 2KM8B 4ZP7A 2D0PA 1QLNA 1NK8A 3BGUA 4IOCQ 4IEIA 4LSNA 4CIEA 1S1XA 2OYQA 2QV6A 2NRXA 3J7ZO 1WTBA 1FRIA 3W2WB 3CYMA 4DV6F 4DV4K 1T05B 4ER8A 1AROP 4RBVA 5D3GA 1VRUB 1QD1A 4QW8A 1JCGA 3QYYA 4FLXA 3SQ4A 3L8BA 4I6AA 1C0TA 3HFZB 1RT3B 4DZ6A 2OZMA 3X1LB 4WKYA 4OLBA 2J0WA 3OBYA 4JI4F 1B0VA 2WBNA 4I2PB 2FJXA 1RAFB 2BBEA 4F3OA 4EIAA 1BO5O 2GNKA 3JSYA 2O1PA 2HBZB 3CJ7A 3KJNB 4OPKA 5KFNA 1DURA 5LSLA 2W6KA 2QT7A 5C24A 4WU2A 1YITN 3M8ZA 4JI0K 2MZSA 4MDAA 3HZ6A 3EGVA 1E6VB 1SL1A 1EO1A 1XR5A 4P2XA 3GR0A 4YY3J 1DLOA 5B0EA 2ZWOA 1AZSB 4LR7A 4CM2A 1N32F 3EM1A 1Y10A 2V8PA 4BC2A 4KC5A 4L72B 4EP5A 3UIQA 3O44A 2V67A 3IUCA 1HHQA 3MPUB 3EVOA 1UEVA 2QSWA 1RTZA 2ZM6J 3WX4A 1NLKL 3NWGA 1VRQC 4H03B 3MK6A 3K8WA 1T0TV 3M8WA 4C8LA 1QTMA 2E9RX 1GEHA 5E3AA 5D4OA 5J2NB 3NG8A 5J2MA 1VS3A 1HW8A 5KFMA 3J81O 4ZCKA 2ZUGA 1RBSA 3O9SA 2CIMA 3HSGA 4RW4B 1U1QA 4CJSA 4BRDA 2VFSA 4K41A 5I3QA 2OPRB 5LMUF 2E2QA 3CJ9A 2L08A 4N8NA 3CCJN 5E3RA 4W5QA 1CULB 4K2JA 4DG1A 3SUQA 5AJ3J 2BJ9A 2DH9A 2M9KA 3J81Y 1S9FA 1U49A 2UU9F 1P9YA 2K3IA 3N01A 3V6KA 1B99A 5KFLA 3ONQA 3VWSA 1RYSA 2DR9A 1WOOA 4OYAA 2MB0B 2H5IB 3QLHB 1RILA 3BF3A 4DL6A 2DFHA 1O1WA 3BUZB 4A8FA 3N9UC 1BU6O 5K20B 4WP3A 1SH2A 3UDVA 1Y9OA 3MURP 1NDKA 5GAGU 3NDKA 5KFSA 2PGCA 2VV5A 3CJ1A 3CFRA 3B54A 2C2NA 4DR7F 5B0DA 1U0HA 5L8RC 3PFEA 4U7UK 5KG0A 5RUBA 2AZ3A 4FWKA 5KFIA 1UEUA 3HVRA 2W1BA 4ZCIA 1TL3A 2BEFA 1PJ7A 2HPUA 4EBEA 3RB6A 5T7LB 4RNMA 3DLHA 3TZZA 3L4QA 2DNHA 3EY1A 4OX9J 1URRA 2HZCA 3HBTA 4M3XA 3CQ8A 4C1NK 4ZPTR 3ULDA 1LEOA 1LOUA 1F6TA 3UR3C 1KN6A 3D2FA 1SKSA 4CFAA 2JH3A 5DDPC 2HAFA 4RUCA 2LQBA 2MQQA 1T3OA 3QFUA 1HNIB 4IH6A 4LRCA 3FLCO 5DQHA 3IA0A 3H4DA 4IG0A 1RT4B 2VOOA 4FW2A 5F9LA 1JX4A 4CLPA 2BACA 3P96A 4AHCA 1OYDA 2GWKA 5CH7B 3BZQA 1SIZA 3FZLA 3RMCA 1I3AA 4WYWA 5HMYA 3MMBB 2FTRA 2D5RA 1EX4A 3AB2B 1UVJA 1OY8A 4A8SA 1VYAA 4DFKA 2G2ZA 3TNVA 4DV4F 4ID5B 2KYXA 4F2SA 1T94A 2ZBCA 3D1HA 4I56A 2FHKA 4BRMA 4A4JA 3FZ2A 4XAKA 5ETOA 2V34A 1VHFA 4E3SA 3NCPA 3TUPA 2U2FA 3JS9A 4E0DA 4WXWA 4PKDB 1MWZA 1HBOA 4K4WA 4JI8J 1SQKA 2HFOA 3UPFA 2J76E 4ED0A 2XTJP 2A5XA 2OD6A 3EE9A 1ZTTA 2M88A 5HRSA 4JI0F 1VK8A 1FF2A 4ILHA 1NGIA 1A7GE 3HX9A 3QT5A 1S1TB 4Z4IA 1ZM2A 2QL5B 5AQIA 1RK8A 1V5IB 3HD2A 5JXSA 2IVMA 1YLXA 3FMBA 4JKDA 4KHMA 3G71S 3VAMA 4K5SA 5DZ6A 2VJUA 1ZBUA 1HKBA 3TOQA 1TELA 1X4EA 1Y00A 3QSIA 1CVJA 3I87A 4OL8A 2LECA 4CCHA 2E8AA 4DV5F 1VSMA 5KG3A 4EU0A 2UXDK 2CPJA 4F25A 3ENAA 1FEEA 5DETA 3KJFB 3NVMA 1WC3A 4P52A 4JV5F 4RTFD 5ADXA 4CZFA 1QSLA 3QATA 2BUPA 3LGHA 1N0UA 3OA9A 4LR9A 2WUSA 3Q8UA 4C11B 3RRHA 2DTUA 1XERA 4JI4J 2OELA 3UDLA 1RACB 3M30B 4U95A 1FDBA 3FQLA 3AD7C 4BROA 3PY8A 4H0VB 5IXUA 2KXFA 4KIAA 2X1BA 3KLEA 1KQSR 4M5HA 4ZVFA 4TY9A 3MCSA 1D9DA 2HHSA 1I1GA 4BRNA 1FX4A 1U2VA 1SBRA 3AQPA 4Z4CA 3UNGC 2G13A 3FGUA 2PBDA 4RPFA 4WWSA 1Q8BA 1U4BA 4XPCA 3CJKA 1RGVA 3V81B 4LRFA 3P49B 5SZTA 2KXHA 3NOCA 3CJCA 5KG1A 4BG9A 4CH0S 4M5IA 1UVLA 2A1BA 4E98A 3DCAA 3TJAA 1AUSL 2Z2MA 4FNHA 5AQNA 3B6BA 4A8MP 4AILC 3QNWB 3VVUA 4BQZA 2ERRA 1Y64A 3ZZOA 3R5JB 1YJWS 1T6DA 3IRXA 2IM3A 2MGZB 5HQ8A 2B4JA 4CGFA 1OWXA 1BMQB 3N79A 1QM9A 4M3ZA 4KB7A 1PYSB 1FESA 5D3GB 4MTPA 5HOOA 2I7PA 3IFEA 1N48A 2B3TB 3TZXA 2SXLA 2HSTA 3HP6A 2WSCC 1BI4A 4O3QA 3GV7B 4WYLA 4YY3K 1HMVB 3FSIA 3MECB 5GAHI 4Z4EA 2FGCA 1Z1ZA 4L3NA 4YOEA 1DQ8A 4GV3A 2OD4A 2NSCA 3I9ZA 3O1BA 4KHNA 3NLCA 2OPSA 2RILA 4CGHA 3O4NA 1N4LA 2UU9J 2H4WB 4B9LA 2O4GA 2CPFA 4IH5A 1PO6A 1H1VA 2AP6A 2IDOA 1DGKN 3HOTA 2ZM6K 2P1JA 1VK3A 3GSIA 2LXIA 2YHWA 1TL4A 4HCCA 1VOMA 4ZHRA 4NLRA 3DXMA 1KVBA 4NI2A 2FC8A 1RXOB 2HOEA 1LWCA 1YJUA 2B0GA 4NXNF 3PW4A 2GBZA 2VODA 1MLAA 2ZH2A 4DPWA 1RTHA 4R25A 1JJ2R 3V9ZA 2RRAA 4KV8B 3RAXA 1YKWA 1EB0A 1HI8A 4ZS6A 2V7ZA 3L6QA 1RBRA 2VFTA 4A48A 1UW9A 4F3MA 4BG8A 4EAHD 1VSJA 3JAMO 3KK3B 1RDUA 4FJXA 2DNZA 3KLFA 1YRXA 2RT3A 4KHQA 3A8KA 2FHJA 3FFIB 2IYGA 4Y0FA 1RCHA 1S57A 1TL1A 5J2MB 4DTOA 2C2ZB 1AB8A 3D4JA 3VMFB 1XK8A 4NPOA 3F2KA 2A6MA 2AV5A 2W9BA 4PWDA 5HL7L 3N6NA 5HRNA 2K7JA 2HNYA 3OYKA 2P9IA 4H4KC 4Q7AA 5I42B 3B6PA 2Q3SA 4OKJA 2VPXB 3M8QA 3VZIA 4CTAA 3DLGA 5EWEA 4Y3CA 4O8UA 1EZZB 3M4XA 1UEKA 4BRKA 2GIFA 3U1NA 4DR4K 2HHUA 1FXLA 5THWA 3WX8A 2HURA 2UXDF 1EKSA 3GWCA 3LPTA 2ZBQA 4WQ4A 3GTYX 3NKYA 1Q7YO 2LA6A 2YHAA 3VQ8A 2BVZA 1J54A 3NEKA 1ULRA 3AJ2A 1UVIA 5KGXA 3DAWA 3OYEA 4JHDB 3A8IA 4LF6K 3RBZA 3FQKA 3MCNA 3GR1A 4XO0A 4FS1A 1SQGA 4B9VA 1K8AO 3QSYB 3MUVP 2LDYA 5F41A 1FRHA 2ZZTA 1XR7A 2A18A 4BC9A 2W9CB 3AVHA 2YQ1A 3D9BA 5DRKA 2MZQA 1TL3B 1RHRB 2C2RA 1SQEA 3HKZD 2EX3A 2O8FA 4P73A 4LF4K 3CTRA 3QMQA 5DM6Q 3RSEA 1PBUA 2WVCA 3H6EA 3MPVA 4OYXA 1TP7A 2GGPA 4C0OC 3C66A 2VG7A 3LZIA 2RNEA 1NEEA 1BWEA 4YHHF 3M8YA 4AF1A 2F63A 3GQCA 3DI6A 3AO2A 2NXNA 1F0XA 1HPZA 1DARA 3VENA 4UOCA 2H4YB 1OO0B 4JNEA 2HMIA 1JLCB 1RISA 4FJGA 3TPQA 3MF5A 3T5HA 5KFPA 1HBMA 4PA1A 4DV5J 4URQU 1ZBLA 4M3RA 2JLEA 1KHVA 4I7FB 4JV5J 3TZYA 4QWAA 3OJSA 4ZVEA 4QQBA 3LL3A 3FSYA 2FVRA 4FVCA 5FD1A 3DC2A 2JDJA 3O6WA 2EFVA 3A3NB 2JEGA 1H74A 3M2RA 4BC3A 3JQJA 2W40A 2VG6A 5F3ZA 3R2CJ 3NF7A 1NU4A 5E0OA 4F0KA 3D1OA 3UDCA 3DMJA 2EK1A 1ZC6A 2CQ1A 4W5OA 1LAVA 1OIAA 4CZLA 3HK2A 1RWMB 3CJ3A 1S59A 3G8QA 4LBIA 3UCUP 3AVBA 2BXJA 1C1CA 1F9FA 1S9GB 4B3TK 3KDOA 1CG2A 2FB0A 5CE3A 4M5JA 5L46A 3DJCA 4FJ7A 3RBDA 5IV3A 1RZMA 1N6QA 2UYTA 1IBLF 2XYPB 1S79A 2WBRA 1WC0A 1Q7YT 4C8ZA 4ZP8A 1HJRA 2F4VF 4YP3A 4DQIA 2FIUA 3M2VA 2QTDA 1OQ3A 4KGXB 3MTJA 4FBTA 4ZVTB 4NCAA 3ENOA 2V8VA 4O4GB 4ECXA 3PHTA 2EFPA 1UA1A 1OS5A 3ICLA 3MWPA 1WG5A 4USHA 4PG5A 3VV2B 2POKA 3A4TA 3C15B 1K8AT 1KNZA 4ILMA 2WHOA 3WXKA 2HVZA 3HI9A 4CLUA 5KT3A 2P5VA 4B9QA 4YOWA 2V2QA 3H5UA 4FYDA 2YKMA 1JK9B 3ZT2A 4B9NA 4DV0J 4NRUA 1LAWA 5DG9A 3IN5A 5J2QB 3G71N 4CO2A 5AXMA 2BANB 5ETMA 3UDEA 4NLYA 4FF2A 3K9KA 3PIOQ 3W5XA 3I9V9 4KI4A 3RBXA 1ZZNA 1BDGA 3AQOA 1IKWA 1YIJN 2GJFA 3G4SN 4I2QA 3BJYA 3M8RA 4DR4F 1ZBTA 3JYTB 3OLBA 3C46A 3NBPA 1TKTA 1U2RA 2Q66A 1JCFA 1UAWA 4MLEA 2DGQA 3AA9A 2GV1A 3GFYA 4X64F 2J7UA 4NXNJ 4CM0A 4PYDA 3HD1A 4Y28C 2DISA 2HZVA 1RU2A 1JJ2M 4PG4A 5KPRA 4QIGA 4LF6F 4YB5A 1B9FA 1KLMB 3IWXA 4FLZA 3IO1A 1FNXH 4O55A 4CJEA 1SB6A 3CC7S 3QJJA 3VCDA 4R0JA 4OHXA 4KQZA 4WP8A 4QU7A 3VQAA 2XY8A 4NO7A 3DWLA 2OJ3A 4LF1A 2RU3A 3PSIA 3QRPA 3KVGA 3SAFA 4UY8O 2XS2A 4JS5A 3D6FB 1OVYA 3CG7A 4LF4F 4DR2F 1OKJA 1V3RA 5C12A 4P75A 4AHTA 3F9MA 4BS2A 1B7YB 4F3TA 3CJRA 3PEHA 4H5WA 1D5AA 2ZC3A 2VPYB 1EQYA 1T95A 3HXMA 3U9ZA 3SEOA 1SS6A 4GKJJ 3AA4A 2XWYA 4UF4A 2OANA 4X84A 2P5OA 1RI7A 4LIRA 3FZHA 1U8SA 1YJWN 3RW6A 2F96A 3J7YU 2L41A 2VDIA 2J4RA 4FO0A 5HP1B 4IR1A 4WQ4C 2ZBPA 1FRMA 2ZC4A 1UFLA 1FFWB 1Q1KA 1S5ZA 3KLGB 1WI6A 1D9FA 4YR2A 1XHXA 2MKCA 2G0CA 1FRLA 4KB1A 3QETA 2I5JB 4AL5A 3FJ2A 3BGFA 3JSBA 4ZHRB 3DXMB 4NI2B 4B3MK 1G99A 3H45C 4PXBA 3VPZA 3DU6A 5EDWA 2A3JA 4DX6A 1Q8LA 4F0HA 1SJ1A 1U2CA 3CMAS 4DL7A 3IAYA 2NRVA 2PA8D 1RTHB 2ZWHA 1R0AA 4BRAA 3I5BA 5KAKA 2V4QA 2GJ2A 1FE4A 5EVZA 4B3TF 4B02A 5KFHA 1ZA2B 3ZYYX 4NZ0A 1I94J 3NL0A 2K1RA 3HL8A 4HKQA 2OEKA 2R2RA 1WI8A 5KT4A 2CZ9A 1X5PA 2BRLA 4OYBA 2AGQA 1KQFB 1E6YB 1IBKJ 1YBAA 4YHHJ 1RT7B 4KI6A 4NX9A 4DOZA 4QYZK 4BR0A 2W7AA 3VEYA 3AA2A 4U6PA 1LXJA 4M1KA 2F7TA 3G8SA 2PSZA 2VF3A 4AXIA 4ZITA 2YJEA 3A8JA 2DO0A 3MZIA 1IWAA 2DRDA 4E19A 4CI0B 4B9SA 1QQCA 2Y8WA 3I96A 3M8QB 1WF1A 3LGMA 3HJFA 3DLGB 1KQKA 2GEMA 3D54A 3HRGA 4CBUA 3QGGA 1LK7A 3KNGA 4M3WA 4HUFA 3T69A 3TRGA 4RW6B 5AQFA 3IS9B 5IT9Y 3I0SA 2A1RA 1YBTA 4UY8T 3IGNA 2OPQA 4U67Q 3OS2A 1U47A 3SCXA 1QAIA 1NSQA 2L3MA 3AVJA 2ZJQL 3ZT1A 3MAHA 1PCAA 4ECQA 2IDLA 4M7YA 3OSPA 1RT1A 2XS5A 2WVBA 4ES3A 4DUYK 4IO9L 3C8YA 2DR8A 4K0KJ 5TKWA 4LF8J 3C7NB 1NNDA 4CHQA 3QEXA 1VHXA 4TYBA 1B9DA 4WXOA 3OL9A 4N76A 1BHLA 4JKFA 1IBLJ 3GIJA 2CG8A 4NYOA 4GO7X 3FKBA 5DM7L 2GGPB 2F4VJ 2ZH4A 2B9EA 2H5EA 3PKYA 1HR0F 3A8YA 5CCMA 2VG7B 1JJHA 2UV8A 3ZSWA 3HVWA 2F65A 3KK7A 4OPHA 4AYBD 3CMEN 1NPKA 4IQXA 1HNWK 2KZMA 2QC3A 4HDHA 3K9JA 3QEWA 2C2MB 3EZOA 2GA7A 2MKSA 3SI8A 1U09A 2E5LF 4OHVA 3BR9A 2A41A 3A5MC 2XI3A 2A10A 1DEJA 4ES2A 4JI1K 4XH4A 4OYIA 4TQRA 2RUGA 3TX8A 2GQQA 1U24A 1I6JA 4XPEA 4IUFA 3FC9A 2AYGA 2Y1LB 2VG6B 4GY2B 4WF9Q 2O8DA 3IG1B 4DF4A 1GAOA 2V4JA 4HHTA 3FCWA 3DMJB 1DY3A 1TFWA 2JWLA 1WTFA 2Q97A 1XTZA 3CUNA 4O23A 2RHQB 2R8KA 3VF6A 1YXQA 4BRLA 1XR6A 5HO4A 1I3OB 1HNXF 4IRCA 2EBEA 2JC1A 2ZOMA 4FKXA 4RZRA 4O3RA 4CK3A 2P9NA 2BE2B 2E66A 2QA4N 1FKOB 3SK3A 2HBLA 1JMTA 1LV5A 2RD5C 5DM6L 3QFPA 2GVZA 2YBVA 1TK0A 5HRRA 2FBTA 1FK9A 4B3MF 3OS0A 2GIRA 3AT1B 5C7PA 4FL9A 5K8OA 2VICA 4DV0K 4IJAA 1OMSA 4WE1A 3A1YG 1HBNA 5GIOA 1YQHA 2ZJRQ 3ULEB 4Q0BB 2H48B 4RUBA 1L3TA 4B3SF 2XMTA 4ECUA 3W5ZA 1BQMB 1SVDA 3DRYA 3EDRB 5C2CA 3MCPA 4DR2J 3QWPA 4HLBA 2CZ4A 2O4IA 3C6TA 4ZK7M 4X66J 4FPIA 2LFVA 1DQ9A 1RB0A 1Y11A 1NGDA 2YKMB 1A5WA 3DU5A 5T14A 4M63A 5HN0A 3PKMA 2PEBA 1GOBA 3IR6B 2DNKA 4ZPAA 1Q0NA 1TMJA 5FRMA 3OYDA 5AQVA 2B4UA 4FYVB 2CPYA 3MEKA 3PO4A 2ASYA 4DFJA 2ZH9A 2EBGA 4RX6A 4LFCK 1NGCA 3BSCA 1ZZFA 3KLIA 2XSFA 4RWXA 1S0MA 2JFDA 1UFWA 3AV9A 2PAVA 2AIRB 3IMXA 4OI4A 2CJ9A 4J91A 2XY7A 3M3ZA 2DNYA 1HNVB 1LWEB 5IWAK 3O5BA 3TTCA 1LW2A 4BY9C 3T5LA 2CQ4A 3OYLA 2XZDB 2ILZA 4OLAA 4PYAA 2MTLA 3U8XA 3MM8A 4LT6A 2VKZG 1VAZA 3DRRA 1YK9A 5C15A 4CHNA 3SZ2A 1TR0A 3CCVS 3DXBA 3NF6A 2A3ZA 4CJ3A 2G8UA 5AQLA 3I31A 2I8EA 4GKJK 3WBZA 1YVFA 4Y00A 1T03A 1T3VA 2M70A 3QO9B 3SYZA 3QB0A 4WQ5A 3AODA 2OHDA 3GYGA 3WXMB 3DHWC 2UXBK 3MCOA 2C3YA 1YJNN 1NKCA 3CC2S 2H54B 4B3RF 4FWMA 1PG5B 2QI2A 1S9EA 3CDEA 5A8WA 3ALYA 1ZPVA 2F4FA 3V2UC 1UL3A 2D3ZA 3CJ4A 3WQPA 2HHTA 2P9UA 2NR0A 5D4NA 1VQ8N 4ED3A 3CJTA 4R8UA 3CC7N 2IVPA 3OS1A 4CLLA 2PN6A 2E29A 1VQ9N 5EWFA 1IJJA 3U3YA 1XUPO 3MI7X 1OQ6A 3TTDA 4CFCA 4NOHA 4P7TA 3CETA 1IG9A 2PFFB 2O01C 3QEPA 1R8CA 4ILLA 4DTSA 5LT5A 2VG5B 4JI1F 3DRPB 4ANDA 5HJYA 1Y97A 3FBBA 3D3BJ 4BLGA 5AFUA 1V5VA 3TVKA 4J2EA 2Z2YB 1CPZA 3VVTA 2IVFB 1N5YB 2JWNA 3DFEA 2BKNA 3D66A 1S49A 4DR6K 1U04A 4C3MA 3AVGA 2V7YA 1ZM3A 2UP1A 1IBCB 1SJ4P 1NK7A 2F9WA 2VWKA 2GO8A 3UB5A 4MLHA 1ITGA 3EVWA 1FD2A 5JVGQ 4E7LA 2CPIA 2CPEA 5A0YA 2K1RB 5L1KA 3EO3A 2OTJS 4PPDA 1HR0J 1SJQA 2ALYB 4RUHA 2B4VA 1T9YA 2KXNB 4DTUA 1Q8IA 4MKYA 5DDQC 3GB0A 3TA2A 3RAMA 3C95A 3CMAN 2RRNA 4JYAJ 5EHHA 4U7BA 2FJAB 2EWHA 1M5VC 3AAPA 1NKBA 2YNIA 3T5KA 4FJIA 2CUYA 1NNEA 2Z1GA 4CEDA 3SUPA 3MMJA 5M2RA 2ZH7A 4CJFA 1R8HA 3TAMB 4LF8K 1BHNA 2AHOB 1PC5A 3FSXA 3DOKA 2RN2A 4KHUA 3CT9A 4KGZB 1SKRA 5B0GA 3KIOA 1P8GA 1DT9A 3GCXP 2CJQA 4AFFA 2RUSA 2AEJA 3R3TA 2OPQB 4LRBA 4IOXA 3CCRS 3C19A 1MA9B 1YX2A 1V4TA 4QIWD 2NUHA 4NXMK 2YTCA 3EMTA 3W62A 3ENWA 2FZCB 4N41A 5KFBA 2X51A 3VERA 2YX4A 4WFNL 3O9TA 3DLBA 2LDIA 1HNXJ 1RBLA 4CRJA 3WC0A 4MYTA 2B9YA 4FLVA 1R27B 2R7OA 2OFHX 1C0FA 3H3OB 1RHKB 4QWBA 3JB9k 4FOIA 3L7OA 1YJ7A 2C2DA 4ZVGA 1JLGB 1U45A 3R8EA 4LF5K 3A8EA 2UUWA 1B0PA 1S1UA 2YKNB 4NMXA 1NJIT 5KRSA 2LU1A 4ELUA 3VQ5A 4YB1P 5HMXA 4KHPJ 4QIEA 2C3PA 3ATVA 1FTRA 3KKFA 3NGIA 4FVMA 4RNOA 2Y1IA 4B3SJ 5EX5A 1RTDA 3T3FA 4JUZA 3CF5L 4JRPA 3OBIA 2MQNA 2YNFA 3O9QA 5L1IA 4C9DA 5KT7A 2P9SA 3LM2A 1MN9A 1H2TZ 2MEWA 2YKQA 4V19X 3OR1B 4F4WA 3UVJA 3ZXWA 5KFVA 1HWKA 2KLAA 4M63C 5A6WA 5AT1B 3LDQA 1TL7B 5HANA 4BR4A 2IHR1 5D6GA 2UUAF 3FRZA 3CJAA 3KHLA 2HF3A 3VGMA 1NK4A 1ELOA 2LQ8A 4KHWA 3IBCB 2DPIA 5L1JA 1V3ZA 3LP1B 2V4JB 5FPEA 2V6AA 1G4CA 2QWMA 1FVSA 4JK9A 3W5YA 2G9OA 4AL7A 1RWWB 3NAEA 3OUYA 4USUA 1AW0A 2XCAA 5CXTA 4BRCA 1JLEA 3CCQS 3DKDA 2GMJA 3PX4A 2A0FB 3H5YA 4H54A 1RCOB 2GJIA 2AJ4A 4CLFA 1HQEA 1F5AA 4I6MB 2OGUA 2GVZB 4K59A 4JI5K 3QJLA 3ZSRA 4OPJA 4LF7J 1FK9B 4EO8A 1BISA 2H3GX 4YB6A 1QHAA 3QZ7A 4IG3B 4J9PA 1RABB 4L75A 2J9CA 3T9ZA 4IQMA 3WQUA 3H25A 4DR6F 3I56S 4B08A 3H42A 1U1OA 3FK4A 4GMKA 5MLCQ 2HZAA 1SJRA 2LEAA 4NE9C 4BREA 5G4DA 5D0EA 4B3RJ 4JI6F 3GZ7A 1YJVA 1HYVA 5FDLA 4KJIA 4TY8A 3U9DA 4DU7A 3R6GB 4FYWB 1UTAA 2B9WA 3BR8A 3O1LA 2BM0A 3ZETA 1KFSA 3G82A 4CLSA 2Z0GA 3AFGA 1RGIA 2Q6CA 4NLTA 4KHSA 5BRHA 3VESA 2DNNA 1RDAA 5DO2A 2WSFC 2LXUA 4M5DA 1FRJA 4FF3A 2GWJA 1KVJA 1VSDA 4HEA9 5EGYA 2A1SA 1A5VA 4WF9L 1KC8T 3MMAB 4LFAJ 4K4ZA 5LOQA 3W8GA 4XTTA 4JI3K 2P8IA 4PXCA 2EWSA 1U48A 4U9RA 4WFAQ 5KFKA 4M5KA 5A6PA 2YNGA 3CFPA 2VZ9A 3ZZZA 4YMEA 4DBQA 5AQXA 1LW2B 2CPZA 3K5NA 1HBUA 2UV8G 4USTA 3RJMB 1K9MT 2X1GA 2ZOGA 2ZWPA 4WIIA 3LO3A 2QWOA 1GOCA 3NCQA 3CEDA 2DEIA 4EZ9A 2VPZB 3DOMB 2RJZA 3NGSA 1YJRA 5KFTA 3H5XA 4NXMF 2DT9A 2YPYA 1BG3A 3MN7A 1IH7A 4M41A 4ZTJA 4J37A 1JLAA 4PCQA 3VAFA 2R7XA 3B4MA 5B0CA 1X7VA 4V1Ak 4CF1A 3S01A 1QZ5A 2CADA 4CO1A 3BSOA 5E33A 4O0JA 3BGLA 5F8LA 1D8YA 2IDEA 3LF0A 3IRWP 4IDHA 2KRBA 3ZT4A 3EWGA 4WYBA 3ZEUA 1S9EB 2E4LA 4KSEB 4LF5F 5K8PA 4O3OA 4EHUA 4FNIA 3T19A 4ID8A 3X3UA 3HFKA 3DDNA 3V5RA 1CZ9A 3CCVN 4LF9J 1EWRA 5BYSA 2AX1A 1CJKB 4WZMA 2HBRB 2UVRA 4R8UB 4ZLLA 3HP9A 3ELHA 2BM1A 1YZ6A 3AGRA 3BH6B 3THYB 3H40A 3M2UB 4ZPWR 4ZVSB 4CEEA 4MO5A 3CVKA 3HZEA 2NUUG 3N6MA 3ULHA 4BRPA 2G8VA 2IIRA 4C1NI 3O1WA 2GX9A 4BC4A 1VDHA 4MFBA 1GT8A 4FWNA 1IXKA 3I55S 3CJ0A 4A8YA 3NGZA 2FVQA 3ZO7A 4OLOA 4C0HA 3MPWA 1YGYA 3R5CA 3HPGA 1VR6A 1FJGF 1SQFA 1REGX 1SXLA 3ET6A 3AD8C 4LSLA 4URGA 2J6TA 4EHTA 4LVNP 4NLVA 3BN4A 2IMOA 1RWNB 3K5MA 4DR3J 3CC4S 2V5HG 4JI7J 5I3UA 4HWIA 3CHWA 4J2AA 4FWLA 1N5QA 4DR1J 4HYKA 4A8OA 1YSJA 4DU4A 5KT2A 2E2OA 1BWFO 3TSPA 4DUZF 1F3FA 5A2QY 2FJEB 2MPUA 3HKWA 2DH7A 3TUJC 1VQOS 4QW9A 4ERDA 3CDBA 2Q43A 2R8HA 4WK1A 4K8XA 5GMEA 4NLQA 3CCLS 2HAIA 3D7SB 3FCHA 2NSBA 4KBOA 2HVHA 5AQPA 4UZBA 4CGGA 2CAJA 4FLUA 3OTDA 5ETLA 2I9SA 3V6HA 4CGJA 3DN9A 4JI5F 4QS7A 3M6XA 2V2ZA 2QWPA 5CZ2A 4LFBK 2IJNA 1KHWA 1MU2A 3QQCD 5E3CA 3NE6A 4RW8A 1W9HA 1S1WA 2FJWA 4Y65A 1TTHB 2K06A 3BPSP 4IDKA 1HX1A 2MQLA 3QNNA 3OHAA 4C8NA 4DHVA 3EZWA 3LDOA 2AEMA 3VGLA 2D69A 3IM8A 1FTCA 4ISGA 3N0VA 2BH1A 1HWJA 2Q6BA 5F0UA 2UUAJ 1VLOA 4F4YA 3DOKB 1YJ9S 2GW8A 2KO1A 4RW7B 1S3XA 3VOVA 4BRFA 3QGHA 1TV6A 2R7QA 5U47A 4CJWA 3MEDB 1HFEL 3SLCA 3RMDA 3H7HB 3T1YK 1OH5A 4KPYA 5GVQA 5FJ4A 2E2NA 1HA1A 5HBMA 3E01B 3K7RA 2XM3A 4UUWA 4H4MA 3AVMA 3U6FA 3AOAA 4CIGA 4DTMA 2DRBA 2R7TA 3J7Z5 4JI3F 2WONA 3L0QA 3L09A 3ZLJA 1H98A 4MKVA 4HTLA 5LXRA 1HYZA 3EE3A 5K8MA 4PKGA 1BQXA 4FZXC 1RLCL 5JVGL 5DQGA 3MUMP 3BY5A 4GV9A 2MZTA 2NRRA 4PKIA 4OZNA 3O4WA 4M7XA 1HNZF 2AZ1A 2ZNYA 4J9KA 4H4OB 3FEXB 1PILA 2D4WA 1NGEA 3OYIA 2DKOB 2RDIA 1RBTA 4JP8A 3OL6A 2DBBA 2HKEA 3HHLA 2XC9A 3GL1A 3IKMA 4CK2A 3PO5A 5FLXY 1C0UB 3T6JA 2ZVSA 3RRKA 3M8SA 3KG1A 4CLTA 1RTDB 2BQ3A 1SV5A 3CW2C 3AO5A 4DV1K 1V4SA 3DGPA 3MR2A 5GMKa 4JI6J 3WXJA 2BV3A 1GXTA 2E20A 1T9VA 4G1QB 2R7SA 2P9SB 3C6HA 4Y2CA 4WIQA 2HVEA 1QQMA 1RBOB 1F60B 4RNNA 2NRTA 4OJ1A 4E1JA 3OW2R 3LPUA 3R8YA 3S9HA 3AJDA 3NAIA 5F0XA 2MMYA 3ZZTA 1KEKA 4USMA 3AVNA 4I6WA 3ZT3A 5CYQB 1T7PA 2E9ZA 3FUYA 3V4IA 2C3MA 2BTFA 1I39A 2P9PA 1XNRJ 1P1TA 1XMQK 3NGYA 5T7BA 4CHPA 3LOUA 3V9XA 3LAKA 3OUYB 1S6QA 2HFZA 2W41A 2CYYA 1KDNA 2VQEK 1JLEB 4F4XA 2RS2A 1N36K 4W98A 3CCTA 3QAEA 2M52A 4DQSA 4GKKK 1JJCB 3SCKE 2FVCA 4ZOSA 1WKJA 3E8OA 4P2MA 3CJBA 1CS4A 2D9PA 1WSRA 3VQ9A 1R8AA 3VEZA 3BO4A 1LWFB 4Z2XA 3THPA 1BIUA 3CCMN 2JHEA 4NLDA 1C1AA 3OD2A 4CYUA 3F56A 3P31A 3KXDA 3KKSA 3O2IA 1NUEA 3TU5A 2O67A 3OXGA 4H0OA 4ZP6A 3CCQN 4K4UA 2XMWA 2Y8YA 3LGNA 1TUUA 5FDLB 1TZ0A 4Q8FA 5GAGI 3P1GA 3SI6A 5FRNA 1WF0A 2QG9B 3WHIA 2D0AA 3LDNA 4K8RA 4X62K 4FOEA 3OYJA 4KHRA 2IFXA 2DGWA 2E44A 3P4UB 1NHVA 2YI1A 4EMDA 1WUUA 4DEZA 1IJFB 2V8HA 3BN7A 2E1RA 2FSJA 1VBZA 2PA3A 3I56N 2GELA 4FVUA 2O5DA 2NPFA 1KSPA 2ASOA 5C2DA 3IWNC 2ZITA 3QBWA 4AXJA 1NB7A 1J27A 5H9FJ 2F8HA 1CXQA 2LA4A 1WSJA 2FD2A 2MHNA 2EI5A 4OGEA 4OI1A 4QU6A 3NGRA 2HIQA 1NU0A 1JXVA 4YDUA 5KQDA 1FJGJ 3MEEA 3M8PB 4CD3A 2AT1B 4CJ4A 4USJC 1JL2A 1F9HA 1SH3A 5AZIA 3ZSXA 2APOA 3HF5A 2QXLA 1IKVB 3WT0A 3AY0A 4LMZA 3T1YF 4NYNA 4LF9K 6FD1A 4DUZJ 1KVCA 2P9KB 1CQMA 3T41A 1QVFM 1M1KO 3GOIA 1JLAB 2OA8A 4G9ZA 2QK9A 2YVSA 4LD0A 1YDLA 3FNNA 4J9OA 1ZM4A 2XMJA 2HRUA 1SH0A 1VJWA 4NCGA 2BE9B 2L9DA 4OZ0A 4DV7J 3V6DA 4CJLA 3AO3A 5BPMA 2R7VA 2OZSA 3WIUA 1TGOA 2WVDA 4CH1A 1GXLA 2HHHJ 3EGNA 1I5OB 2XZWA 3DLKA 5D78A 2J8AA 1JLBB 4TN2A 3R2DJ 2G1DA 1FI4A 2X6NA 3K5PA 5M1QA 2F8EX 3RYLA 4NEZA 1DFDA 2WBMA 2D0CA 4DL3A 1P8ZA 1SC6A 2IAJA 4CZEA 2Z1IA 1CC7A 2F9TA 1G3OA 1VQ5N 1T9TA 2PYJA 3D6HB 2D3OR 1AFIA 2XRIA 3D3CJ 5HLFA 3THWA 4RWWA 3I82A 1GTEA 4USKA 4CFDA 1Q9XA 2LVWA 2KH9A 1VQMS 3QBCA 2FBYA 4EWTA 4K4VA 2Z1JA 4MAKA 1DJ0A 1JIHA 1ATRA 2DIVA 2QO3A 5GAEI 4IOBA 4EO6A 4F04B 4WU3A 5KGWA 5J2PB 1X4AA 1XC9A 3OFFA 5AXKA 1CJUA 1J5EJ 4ZLNA 2KHCA 2GX8A 3BZCA 4RG8A 2J0QD 1C4AA 1Y5NB 1T8EA 4QWDA 3ITHA 1XMQF 3O9RA 4O5BA 3L7PA 2FVPA 3RMAA 1B4SA 2M5YA 4CNYA 4K4YA 2HIYA 2IVNA 2QYGA 4ZPBA 3SV3A 4BWJA 1RAEB 4AM7A 1KONA 3CSKA 1NOYA 3KK1B 4ZPCA 1NRKA 1N36F 3TSUA 3CM6A 2HK3A 1WKKA 5LMNK 1HNZJ 4GKKF 3P3DA 1WDTA 4RNFA 3CD6S 4DTJA 1ZXOA 4MIWA 1GLEG 3C16B 3D68A 2EFQA 5M2UA 4IYQA 2NXJA 3B6OA 1HWUA 4OO1J 2C2EA 4RW8B 3RZAA 4BRGA 3FGVA 3HT0A 1S1WB 2GHPA 3BQ2A 1UVNA 1VQON 4OZ2A 3LWMA 2DRAA 2NZ4A 3HHLD 3MXMA 1F2GA 3HVTA 1HJOA 4FCYA 1VBYA 1KCFA 4ED6A 3W3SA 3CCLN 1S72N 1F5CA 4O0IA 3AVFA 1S1VA 1RT6A 5JVHQ 4CHOA 2XLJA 4NB4A 1SUQB 1RCXB 1N56A 3UE2A 2RF2B 3O5TB 3LP0A 1UJ4A 4HCBA 4BACA 1TV6B 2B56A 5GIPA 3DYAB 1VQ7N 1DTTA 2JRSA 1RFQA 4DU1A 1ITPA 3Q8SB 2YJFA 1PIEA 4NCBA 4DFPA 2KKZA 2BJ8A 4CHYA 3D0HE 3ISNC 4DCJB 3MXIA 2W24A 3U3GA 4H5VA 3QBXA 2XNQA 3Q89A 3K57A 3FZKA 4EP4A 5IQQA 2FBVA 4H4MB 2HQIA 3OTOK 2AF6A 1UZDA 4QWEA 2DIUA 1KVIA 3TWHA 1HARA 3BDEA 2G2YA 1HLUA 5AQZA 2X3GA 2D3UA 3MM7B 2GQ2A 5E3PA 4PL7A 2R8JA 1WACA 3W60A 1UKUA 5CZ1A 4Z4GA 2ETJA 4RUAA 4PWWA 1K6YA 2VQFK 1YJ9N 2V52B 5AQMA 1NSPA 3AJ1A 4ZIVA 4YDDB 2XCPA 5ETVA 5HMZA 2DY1A 2J6SA 2KW4A 3PRBA 3P45B 3GIRA 1RDWX 2ZOFA 4NYZA 1MMDA 5BJRA 2PYLA 4N77A 2UUCK 2ROGA 2HBYB 5C42A 3A13A 3BEXA 1V6HA 2P5GA 2FHMA 2HB5A 4G65A 2QW9A 5KFOA 1GK8A 3LA0A 3DGPB 4XIUA 4MIBA 1IN0A 1W2IA 4P71A 1K1SA 4OLPA 5DMRA 1N34K 2HFUA 1YUWA 3LZJA 4C8MA 2UXCK 4OX8A 2BDPA 1D4XA 3MAAA 1GTHA 3BQ1A 3PX0A 3QNOA 2KYZA 3TWZA 1NM2A 3R9LA 3VTHA 3NNCA 3QMLA 5DZ7A 4KKOA 2LQJA 2ZH1A 4H5TA 5BR8K 2EKNA 4ZPDA 1EETA 3BF4A 2P9PB 2YWHA 3TUIC 3TX0A 3AXKA 2W4CA 3P5JA 3IAS9 5DGBA 3VF0B 4IFVA 1PBAA 1KD1O 2A6AA 2DNGA 1U1LA 1ATSA 1S6QB 3PIPQ 4YB7A 3M1VA 1DHMA 4GVMA 3LQVA 5GAHP 3MD3A 3CCUN 5BPLA 1VQNS 4O44A 3K58A 2HWIA 1NMNA 1GLCG 2LMIA 2EFGA 4OQJA 2JFKA 3PW0A 3M1FA 2NYHA 2UUBK 2R7WA 3CFOA 2DR6A 5IT9U 3H2UB 1N33J 1O8BA 1Q8KA 4R5PB 4L73A 4ITSA 4U8YA 1Q5VA 1F1BB 3CCSS 4M45A 2AGPA 3ID6A 3ZTQA 1S22A 4Z0UA 1KTQA 5C25A 3AVAA 3OTCA 1IUJA 3GJSB 2J9DE 4DPOA 4JOUA 2IRXA 4WFYA 2F40A 3CIMA 2D0OA 4CF9A 5AFUH 1VSEA 4U96A 4IJNA 1SI9A 3M6VA 2H9ZA 4FWRA 4F0MA 2J8SA 2X6SA 4DL4A 2D1KA 3V1OA 2R2SA 1PC4A 4F67A 1E3MA 3MM5B 4DS5A 1N88A 2O3DA 3UKRA 3DGVA 4AQYJ 2CQHA 4UOFA 2WAQD 2QMUB 1QSYA 2KVIA 4M94A 3AO1A 1ZAVA 3DLLL 5A8KA 3EN9A 4DSLA 4X65J 4FLWA 3FZMA 4USWA 4CEAA 2HQCA 4JKBA 3WDOA 1C6VA 3KOAA 4WPAA 5M1FA 2P9LA 1NCLA 3P5TL 4ED2A 1H2UX 4CD1A 4MYUA 3C6UB 4OYOA 3EUNA 3GONA 3PYDA 2VBZA 3W0LA 2BGGA 2EG1A 1YBUA 2XS7A 3GBTA 3OVNA 1VSLA 4DN0A 4OX7A 3I8BA 4HR2A 3M9NB 3LWLA 2O8EA 3MR7A 2YKOA 4F26A 4CIOA 3SCLE 2B51A 4Z37A 3KD1E 3HZGA 1RWVB 3BP8A 2BX6A 3EKSA 3SIPB 3ZNUA 3OTOF 1HLWA 1NZAA 2ADBA 3HSZA 3W66A 3H20A 3HSCA 4NLGA 2W2NP 3CMQA 1C1BA 1KD1T 5JMVA 3V6DB 2DNLA 2VQFF 1IBMJ 2Y1RI 4DV3K 3R3LA 4DCOB 1S6PB 4H5RA 2QA1A 3DLKB 1XBWA 2XZTB 3L4IA 2E1MC 2ZBIA 3R7NB 4DR5K 1G7CB 3D5MA 3TARA 4Z7CA 2R7YA 2E88A 5SWMA 2UUCF 1C4CA 4E89A 1EX8A 1RT5A 1T6CA 3H08A 2XSJB 2G0JA 4JI2K 1BC6A 3MX2A 1FKPA 3SXLA 2ZJPQ 5F8HA 3VA3A 4YR3A 2NZCA 3BO3A 3K0JA 4DJBA 1ZETA 2UXCF 1JKHA 2KFNA 1MMLA 8RUCA 1U0SA 1H7XA 5KRTA 2EW9A 1W2BM 2DCLA 2IA6A 4H0TB 5F0WA 1WEXA 4J9LA 1FHTA 1F9EB 1IG8A 5CCLA 1TKZA 5BR8F 1XNQJ 1JLQB 1GQEA 2Q36A 2HBJA 1YAGA 4CQ1A 1Q78A 3W9HA 4Y34A 3ITHB 3NOGA 4A8XA 4DV2K 1R0CB 1HPMA 1M5OC 4X4QA 4KB0A 4O3PA 4C8KA 3JSMB 3P5BP 5EX3A 1AT1B 2G2OA 4K2XA 1VQMN 4IO1A 4J7CA 1IV0A 5B7WA 4W4MA 1QAXA 1AYEA 2COLA 3VAHA 4EYHB 2UUTA 4C8YA 1MWYA 2B6AA 2XMMA 5IM0B 3PJ9A 4FDFA 2DGTA 3HMJG 3ZSZA 2BMBA 2ZE2A 3R6LB 1R0BG 3AH6A 2BRKA 5KOWA 4PUOA 2UUBF 4GV6A 3TP2A 3PYGA 1S7HA 5H1SV 4Q45A 4DS4A 3NGUA 3QRRA 2YWKA 1BWVA 5H1SQ 3IGVA 2GVDB 5AR0A 3T1HK 3C65A 3K8VA 2JSXA 1REVB 4CHZA 4FLYA 4USIA 1XMOK 2E1CA 2HVIA 3G96A 3H59A 1T02A 3NNHA 1IQZA 4CJPA 4CZHA 3CD6N 1VI7A 2PZSA 3HHDA 1KRPA 1VQ4S 3B4DA 4IXCA 2JZ5A 2G8WA 5ETPA 1SJFA 2CPHA 3TQEA 3WNEA 2OMLA 1X9WA 2CQDA 1HHSA 2HGLA 2HNDA 5GAEU 4MK8A 1WHVA 4UY85 4DMZA 4L8RB 3NXZA 2PEHA 4DF8A 3I33A 1FT8A 3VETA 1Q81O 3UE5A 4DV6J 1H2VZ 4QR0A 4Y0WA 2VBXA 1X9MA 2CVIA 3KKRA 1MN7A 1WUAA 4WK3A 4F36A 2FY1A 1Z25A 3J7YI 1TYQA 1HQUA 5JJBA 4AHSA 4LRAA 4IBNA 4EUVA 4M3UA 1U6ZA 2GHWA 3GV8B 4NLPA 2WK4A 3HPHA 4MH8A 1HKCA 3UNYA 3VEOA 4LBHA 3K2PA 2VH7A 3QT6A 2XO6A 3OYGA 2ZDPA 4Y2IA 1MMNA 4HH0A 1RWOB 1GMWA 3EGZA 3E2EA 1MWMA 3W2VA 2JJ4D 1GXUA 3R5BA 7FDRA 3AOBA 3UD4P 2RDDA 2DXDA 3DXKA 1U6FA 2EC0A 3G2XA 2ZKUA 2FF6A 4P7VA 4F2RA 3P6YC 1MDUB 3MAAB 1N32J 3VQEA 2H51B 4HACA 4FXDA 3DLEA 4LSZB 1J5OA 1RTIA 4HHJA 4E7KA 2LCWA 1NSKL 2EKYA 4HVJA 1EETB 1UW4A 3WNGA 2YWGA 3S8SA 1O5JA 1RU1A 1EP4A 3H1VX 4OI3A 4P74A 3A5OC 3KUHA 1IKXA 2CA9A 4CEBA 4Q2MA 1RHJB 1ZBFA 4NLSA 1XQSC 5CQGA 1XMBA 1YG0A 3MWTA 2FJBB 4CT8A 2DITA 4ELTA 4CIFA 4LSNB 1S1XB 2FQQB 1IJEB 2V50A 1JXLA 3OQ2A 5EN1A 1YJTA 3TAPA 3PUFA 5IOLA 1TL5A 4O44B 3M7VA 2D1CA 1ASWA 1RUSA 3RGIA 1C0TB 1KOHA 3U02A 4IH7A 5LMUJ 4FYYB 1Y5LB 3EDQB 3IR7B 2GO9A 3AXMA 3OYCA 3HYFA 5KFZA 1SJ3P 3AD9C 1NK6A 1X4CA 1T9XA 5BR9A 3HLUA 1TU0B 4LQ3A 2W7OA 3QINA 3Q86A 4DV2F 3MOZA 5BXIA 2DEJA 3AAWB 4DDFA 5LJVA 2VKRA 4CVNE 1WAFA 4DL0C 3RMBA 5C24B 4J5OA 2QLFB 1Q81T 4W5NA 1VQNN 2B4OA 3R6MA 2QWRA 3KG4A 3OBWA 3VAJA 2RE1A 1XI1A 1WSIA 5E84A 2YY3A 2RIJA 1SKWA 4TNOA 1DLOB 1H72C 1JNRB 2WSEC 1N52B 3TW0A 2WOMA 5LL6d 4YOYA 3UKRB 2WB4A 1PAEX 4DR7J 2BKPA 4B1VA 1HWIA 5LM7E 4QAGA 2DY9A 3CCSN 1QVGM 3MXJA 3O3HA 1S7IA 3BYPA 4ZVRB 1NMDA 4I9LA 5HROA 1E4FT 2XWXA 2A2CA 2B7CB 3NMUA 5AJ3K 2P9LB 1VQ6S 1TK5A 3AA3A 1DTQA 4IOCL 3W2WA 2BOAA 1T05A 1XWLA 1VRUA 3KWIA 3FRYA 4HHUA 1EJ7L 5E7OB 4AE5A 1RT3A 5LJWA 3QT7A 2OIHA 3PW7A 3KJVA 4KRWA 2HQ3A 2G8HA 3JAMY 1D0EA 1IKYA 1NPRA 5CAAA 3J7AN 4I2PA 1BA1A 2CGLA 5H9EJ 1D9AA 2YCHA 3ID8A 1X3MA 4DG1B 1H6KX 2DNQA 3GG0A 1ASUA 2IPOB 2PC6A 4YQWA 2HS4A 4CNZA 3GYXB 4DV4J 1WSEA 1C1BB 4U7UD 2AA4A 4Q2LA 3CD5A 3F44A 1VGYA 2CQGA 1E6VA 1ZOTA 3NAHA 4LJMA 3PRVA 3MMVA 4OX9K 3KHGA 3GJTB 4AUKA 1U8WA 1CJTA 5LL6Z 1M1HA 3OVSA 4ECVA 3UW1A 3VQ4A 3D0GE 1NSAA 3E9LA 4MO4A 2Y0SD 4DI6A 1VC5A 1CZAN 1H38A 4JEPA 2QJ3A 1U0HB 4DMNA 2AJ0A 2QIFA 1G1XA 4E1NA 3J81j 3ILOA 1KXPA 4JI0J 1CLFA 1F21A 1RBVA 1GNKA 2CNOB 1QY7A 4OV1A 4BHQA 1RHUB 2CVEA 2NXEA 3O4QA 1B7FA 4Z4FA 4K4XA 1YTUA 1JKHB 2QWNA 2OMOA 4FPBA 4KFBA 3D2FB 1KBRA 4PPZA 5IT0A 4RW4A 3C94A 1V3SA 1JL1A 4DSFA <