5J2PA

Hiv-1 reverse transcriptase in complex with dna that has incorporated efda-mp at the p-(post-translocation) site and a second efda-mp at the n-(pre-translocation) site
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords reverse transcriptase, p66 domain
publication title Structural basis of HIV inhibition by translocation-defective RT inhibitor 4'-ethynyl-2-fluoro-2'-deoxyadenosine (EFdA).
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate hxb2)
molecule tags Transferase/dna
total genus 166
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5j2pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5j2pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5j2pA05
1RBUA 4R5PB 3NMAA 1YT3A 2Y1IA 3CYMA 2FBVA 3DLEA 3NCIA 4CHZA 4E7JA 4KHNA 2HNYB 4IH7A 3C94A 5KT4A 3NGYA 1RTIA 2IAJB 3V9WA 3PW7A 3TARA 1NK7A 4RW8A 3DRSB 3PUFA 3KOAA 3IS9A 3OYIA 3GYNA 1S0MA 4RNHA 2P5GA 4ID5A 4LSLB 1IG9A 1IKXA 4ED2A 2PY5A 3O3FA 1U45A 1KVBA 3LWMA 1C1AA 3CDEA 1RTHA 1UWBB 4B9SA 4C8OA 4M45A 5KI6A 1B9FA 3HVTB 4TXSA 4ED8A 1S6PA 1XHZA 3SYZA 2UUWA 3ZSZA 4EP4A 1TGOA 2LSNA 1Z4UA 2FVCA 4CF1A 4ZTJA 1S9FA 4E1NA 5DMRA 3WNFA 3ZT4A 1N5YB 4G1QB 3OHAA 4U6PA 3M8PA 2FJVA 3VQ7A 1XR7A 4URQU 2XY8A 4ID5B 3WNHA 3V6DA 2JEGA 1YTAA 3BSOA 2YNGB 2QKBA 1XWLA 4YFUA 1RTHB 3SJJA 1A5XA 1XI1A 3G0ZA 3QLHB 5T7BA 2ZKUA 1T05B 3B6OA 1CXQA 2VG6B 2WCXA 1RT1B 4GVMA 4Z4EA 4FM2A 1YTUA 2OPQB 5C5JA 4DG1A 3RBDA 3QEWA 4FJXA 4EO8A 1NKEA 5EU7A 4JS5A 2F8TA 2AGOA 3PO5A 3CJ5A 3BQ0A 4ECXA 1XC9A 4CJTA 3T19A 2XC9A 4KHRA 3E01A 3QGIA 4KSEB 2EX3A 1C0TA 4RW7B 4URGA 4ZMMA 4CJEA 3CJ0A 2DFEA 1HPZB 1J53A 3MXIA 4BWJA 2ASJA 3RB4A 1RT5B 3RB3A 5J2NA 5CZ1A 3DI6B 1RA7A 1TL1A 3MAQA 5L9XA 3Q8SB 4DL4A 4FLYA 2KTQA 2R8IA 2WOMA 3OL8A 2Z1JA 2OZMA 3B6PA 5F8NA 5KT3A 3OJUA 3M9MB 3RBEA 1N6QB 4H4OA 1SL1A 3GILA 3BSAA 5DLFA 4ECQA 4CFBA 2R2SA 3ZCMA 4HCCA 3I5AA 2JC1A 3I0RA 4OJRA 1C0TB 3V4IA 4Y2AA 1SKRA 4QWEA 4RZRA 3IGNA 1XR6A 4NLPA 4KTQA 1BQNA 1S4FA 3MEGB 4IKFA 2OPPA 4NRTA 1T3NA 3NE6A 4FLZA 2O4GA 2HWHA 4AILC 1X9WA 4ECRA 4QW9A 4HVJA 1VSFA 4NZ0A 3OYMA 5J2PA 4DLGA 4CGHA 3KMQA 4QWCA 3UIQA 1JLFA 3IN5A 3RTVA 4BE0A 3AVBA 5KFPA 2F8EX 4Q45A 4Q8FA 2HW3A 3NH0A 1BQNB 4MKBA 1S1UA 1KTQA 1JX4A 2FC0A 1RTDA 1HMVA 1QE1B 4K50A 3K58A 5EUHA 5C25A 1RBSA 1ZBLA 2IM2A 4BE2A 1RBRA 5JS1A 5KFMA 5KFEA 1NK9A 3PHEA 4NLXA 4DTSA 1C1CA 3P5JA 3OSNA 1LW0A 5KTQA 4IOBA 3DM2B 3SZ2A 1TKXA 4EYIB 1ZETA 3QNNA 4PWDA 2OPRA 4TY8B 3MFHA 2IC3A 3SFGA 2UVUA 2YNIB 5FRMA 4J9QA 2VA3A 2RKIA 5F9LA 4Z4HA 2JEJA 1IKWA 3MEDB 1TK8A 1RDRA 2V0NA 5KFJA 2JEFA 1RTDB 1EXQA 3ZSVA 2RPIA 3TAQA 4Q8EA 1C1BB 4E3SA 1JLAB 2HHVA 3QIDA 3KK1A 5KFFA 4IDKA 1RT6A 3PJXA 1TKZA 4CGDA 2FLLA 4DQQA 4B3OB 1S9EB 3CDUA 3QZ7A 3TABA 1A5WA 4O4GA 3H2LA 2BRKA 1ZBFA 1LW0B 4CCHA 1W9HA 1TKXB 2YNHB 1T03B 2W8LA 1D9DA 3K5LA 5KFTA 3BSNA 1BISA 4NLOA 1QSYA 3CDWA 4CGJA 4LQ3A 1QUVA 4F2SA 3M8SA 2R8JA 1QS4A 2XRIA 1JXEA 4DF8A 3OYNA 3OVNA 4QPXA 3QGGA 1S49A 4RUCA 1JIHA 1R0AB 5KT2A 4KV8A 1JKHA 2XGQA 3KK1B 4WFZA 1FKPB 1IKVA 1TKZB 2OPSB 1LWFB 4C8KA 4FJIA 4RW6B 4CEDA 5C24A 1WNSA 4O4GB 3DMJA 5I42B 4CJUA 3K5NA 5CZ2A 4CEFA 4K4XA 1SKWA 2E6LA 3OYKA 2J6SA 4PQUB 1XR5A 3DOLB 4MK8A 4ED3A 3OSPA 3HVWA 4R8UA 4KHSA 4LSNB 4EBDA 4IQXA 1ZYQA 2UVRA 4NLWA 1ASWA 1VSHA 4HKQA 2W7OA 3WNEA 4K8XA 4XPCA 4Y2CA 1NHUA 4DF4A 1LWCA 3CFPA 3M9OB 2YNFA 2HMIA 3M9NB 1U47A 5KFRA 2GV9A 4PUOA 4CJPA 1KLNA 3NF8A 4M41A 3ZSXA 3VQ9A 5KFDA 3LAKA 2DPJA 3QIPA 5CYQB 4M3YA 4FM1A 4PA1A 3KKSA 4UQGA 4AHVA 4K4WA 3ZT3A 4NCGA 1CSJA 1FKOA 2PZSA 1Q8IA 1U09A 2X6NA 3C95A 3WNGA 3CJ3A 1CXUA 3OS2A 4RW9A 4QAGA 1LWCB 3H5UA 1NJZA 2G8HA 2D0AA 4M95A 2BR0A 4Q43A 3LP3A 5KFGA 3QO9B 2FLPA 3D45A 5L1KA 1X9MA 1VSIA 4DL7A 4CIEA 4E19A 3T5JA 2C2DA 3RMCA 3MR3A 1S0OA 4FJHA 4M3WA 2IM3A 4IRKA 2DY4A 3V9UA 4CF0A 2QKKA 5EDWA 2OA8A 3RWUA 4RNMA 4CGFA 4DWIA 3DRRA 2J6TA 4FCYA 4M3ZA 3S3NA 1BL3A 4XIUA 4MKAA 1HNVB 3KJVB 4WZQA 3NDKA 2VG7A 4DU1A 4IRCA 3SQ2A 5F8IA 2AX0A 3KLHA 1B9DA 4OVLA 3RB0A 4DTRA 2WONA 5HBMA 3AO1A 3V1OA 1TL3A 4FJJA 4RNNA 2XWYA 4Z4IA 2D3ZA 1S1XB 1RT3B 4LH5A 1KCFA 4JRQA 4NLTA 2FVQA 4ICLB 3H40A 1SL0A 1NK0A 3TI0A 5KG1A 1KLMA 1BQMA 3FQLA 3KHGA 2V9WA 3V6HA 3NGDA 4KKOA 4MFBA 4FBUA 1U4BA 4F50A 2IS3A 4WFXA 5E41A 1OS5A 4H4MA 3DLBA 1DTTA 4B9NA 2KZMA 1A5VA 2FJXA 1LW2A 3OYHA 2VWJA 4CEQA 4FZYA 4DLEA 1D0EA 1RTJA 3SQ0A 4HUEA 1JLEB 4OL8A 2BQRA 4DQRA 2XGPA 2VG5B 2J6UA 3CG7A 3C6UA 4RW4A 2FLNA 4ECSA 2V4QA 4KFBA 2A1SA 3HL8A 2WONB 4FLTA 3KMSA 1TL3B 1HQEA 1RT2B 4RNFA 3GIMA 2V4RA 3BJYA 2GIRA 4U7CA 4FS2A 4I7FB 4R5PA 3BSCA 1RT4B 1BQMB 3N6NA 4NCAA 3TAFA 3Q8RB 4ELVA 4E7KA 3QEPA 1ITGA 3TR8A 1B92A 1D9FA 4DTNA 2XHBA 4YR3A 4DL5A 3V1QA 2IAJA 3ZSOA 2FJWA 5J2MA 1SH3A 1HYVA 2IMWP 3CQ8A 4O5BA 3DRSA 1N56A 3K2PA 3S3MA 3K59A 1KFSA 3MECB 1GOBA 4CJVA 3OYAA 2FBXA 1S1VB 5KG4A 4CHQA 2D41A 4DFMA 4DL6A 4ZP6A 3QESA 3C6UB 4I9LA 4NYZA 2RF2A 1UWBA 1HQEB 4DTPA 1T7PA 3HVTA 1VK0A 1TKDA 2W9CB 4DFJA 3CWJA 3NF7A 5KG5A 4J9SA 1VSDA 4LY7A 4KHUA 4O3SA 2HVIA 5J2MB 3EZUA 4NRUA 1N5YA 4G1QA 3L2QA 2FBTA 1CZBA 4F4KA 4BACA 3AVKA 3LP0A 3QEIA 3NAIA 4ZP9A 4B8AB 5L1IA 4EP5A 1RNHA 3ZT1A 3TAPA 3TAMB 2YNGA 3RAXA 1WSIA 2RF2B 2IBKA 2BRLA 4FJ5A 4MIAA 3QLHA 4DL2A 3AVFA 1T05A 3OS1A 2VG6A 4KHYA 3DYAB 4IG0B 3SFUA 1VSEA 3GV7B 4CF9A 1RT1A 3RMBA 3LZIA 2OPQA 4KB7A 2F96A 4Y1CA 4DL3A 2A1RA 1C0MA 2BANB 1N48A 3LP0B 3BDPA 4J2AA 1LWEB 3H4DA 3NH1A 4KI6A 3ISNC 4RW7A 3IGVA 3VQAA 4JV1A 3OYGA 2B43A 2D7SA 1HPZA 2BE2B 5KT7A 1S6QA 1ZBUA 4B8CA 3SPYA 2AQ4A 4FYDA 2HHWA 1RT5A 2XY7A 1S97A 2UVWA 3LPUA 4W5QA 3DI6A 3QETA 3RRGA 4IKAA 1MU2B 2C2EA 3AA3A 2Z1IA 3OYDA 1N6QA 2DPIA 4MK9A 3PJWA 3QYYA 3H5YA 2X6SA 4CJLA 4KPYA 4KREA 1CLQA 3ITHB 3O4QA 2G8WA 3UPFA 4QCLA 4CF8A 3HP9A 1NOYA 3HVAA 1NKBA 3VN5A 4EBEA 1S6QB 4ID1A 4CE9A 3MEGA 4IH6A 5KFBA 2BQUA 4ZTFA 3N6MA 5F8LA 3K5MA 2HNZB 1IKYA 4KI4A 1RILA 2QE5A 4ZVEA 4B9MA 4L8RB 1EX4A 2FVSA 5HP1B 4FXDA 1TAUA 5DK5A 2E4LA 2XY6A 2ILYA 4O3OA 1BIZA 4N56A 2F8SA 4JS4A 4RU9A 3MTKA 5DQIA 3ASMA 4KBIA 4OKEA 4FK2A 5KRTA 4QOZB 4IFYB 3CJ4A 4ZPCA 1QE1A 4K4UA 5KFHA 4OLAA 2BQ3A 3VA0A 4WXWA 4FW1A 1D8YA 3GIKA 1ZTWA 3Q8QB 4ZVFA 1IKYB 4GC6A 2RDJA 1RBTA 4ECTA 1I39A 3EZ5A 4J2BA 4DSJA 4FJLA 3L2RA 4F3OA 2ALZA 4Z4FA 4DSKA 2YV0X 4ECWA 3LP1B 3IG1B 4J9PA 2HHXA 4ED1A 4B9VA 3DM2A 5FRNA 3P1GA 1TKTB 4K4TA 2E9TA 4DTOA 5KFOA 4TY8A 4CK3A 2ATQA 3CM5A 3SUNA 4J9KA 3CVKA 4GMJB 2E9RX 2YNIA 4YQWA 3O4NA 4JV2A 4E1MA 2JEIA 3MEDA 1RAJA 4C8LA 3C6TB 5KFSA 5KG0A 3SCXA 3OYCA 3KLEB 4DQSA 4HTUA 2ZQBA 1C1BA 1JLAA 2ZE2B 4R0EA 1NK5A 3JSMB 2RDIA 4CEBA 4B3OA 3H59A 2AWZA 1EETB 3OL7A 1S9EA 4NCBA 1BI4A 3VQ5A 2B4JA 3VQ4A 2G8UA 3VA3A 1LAVA 4KB1A 1RDBA 4ZPBA 1JL1A 2YNHA 1T03A 3GIJA 4N47A 1RDAA 2YKNB 3H5XA 2G8VA 3NKYA 4F4ZA 4I2QB 3H5SA 3OYJA 4FJ7A 3NGIA 2HWIA 4ZPDA 4YNQA 2YKMB 4Y1DA 1HARA 2IDOA 1WSJA 3G6YA 1HYZA 5KT6A 4DQPA 3G6XA 1R0AA 3NL0A 3M8QB 4XO0A 1FKPA 2OPSA 4ZVGA 4OKJA 1LWFA 1RA6A 4DEZA 4RW6A 3RMDA 4CHNA 1BI4B 1JL2A 4FJGA 3BQ1A 3HJFA 4PY5A 5I42A 4CIFA 2Y1JA 3RRHA 4K4ZA 5DG8A 3SUOA 2DFHA 3KHRA 1YVFA 2IGIA 4AHTA 4F4WA 3PX6A 2AU0A 4PQUA 3DOLA 1Q9XA 5F8HA 3BREA 3PVXA 4K4YA 4LSNA 3VQEA 2JC0A 4WE1B 4DSEA 3BR9A 2X74A 4WZMA 3TANA 1I3AA 4ELUA 2HHTA 4CHOA 4W5NA 5DQHA 1UA1A 1S0NA 4DS4A 1EP4B 4CFCA 3U3GA 5KRSA 1TVRB 3PX0A 1QAJA 2WHOA 3D0PA 5EWFA 1C0UA 1S1WB 2YHAA 4DTUA 4F4XA 3HP6A 3O3GA 5CYQA 1VSKA 5DG9A 3SV3A 1D5AA 4FK0A 1T94A 4FJ8A 4FBTA 4WYWA 3BGRB 1QQCA 4DS5A 2PYJA 5HRRA 3V9SA 3KHLA 1RBVA 4FJ9A 1ASVA 5L1LA 4W5TA 2O4IA 1HJRA 3LP2B 1ZTTA 1JLCB 2B6AB 2IM0A 4E89A 3NAHA 4ECVA 4AHSA 3QO9A 2D5RA 1JLGB 3BQ2A 1C0UB 4IH5A 4RG8A 4DFKA 2GIQA 4CEEA 3DRPA 3MXJA 4O0IA 2KQ2A 1XHXA 1GX5A 1CZ9A 1NK4A 1K1SA 4DMNA 2ETJA 2EC0A 4O4RA 4KE5A 3OYBA 3V81B 3PY8A 2CJQA 5HRSA 1WAFA 1WSEA 4ZP7A 3NF9A 4NLQA 5KG3A 3UDLA 1HNVA 3KJVA 4TQRA 2XI2A 3U6FA 3EYZA 3ZSYA 3AO3A 5HROB 3T1AA 4MK7A 5EWEA 2GBZA 3TQ1A 1KHVA 5KFZA 4EZ9A 3AO4A 1U48A 3PZPA 4O3RA 4RUAA 3DRPB 5FDLB 1ASUA 4CGGA 4K8ZA 4E0DA 4OGCA 2P1JA 3V9ZA 1S1XA 1RT3A 4ICLA 4KHWA 1RDCA 1X9SA 4HUFA 3GIIA 3CO9A 2AGPA 1QTMA 2OZSA 3AV9A 4W5RA 1KHWA 1L3VA 2CKWA 2ASDA 4EBCA 1HQUB 3TVKA 3SUPA 3Q8PB 1JLEA 4F8RA 2VG5A 1X1PA 1SUQA 3PW0A 1FXXA 1W25A 1NNDA 1RT7B 3DLGA 1RT2A 4QWBA 4F4YA 2R8KA 5CY4A 4NLSA 3NH2A 4I7FA 3HVRA 3D28A 5D3GB 3D5MA 1KFDA 1RT4A 4KO0B 5F8JA 1GOAA 4CJKA 4M3TA 3DOKA 5C42B 2ITGA 4Y3CA 4TYBA 4K4SA 4OKKA 4DSFA 3FFIB 3KLIB 3MECA 2XY5A 1S1VA 4TYAA 2X78A 3SI8A 4E7HA 5I3UB 4BE1A 5KFIA 2QK9A 1SUQB 3KLVA 1RCHA 1K1QA 2Q3SA 4Q0BB 3DLGB 2AX1A 1RYRA 1LV5A 3OJSA 3HSTB 3M8RA 4QWDA 5KFCA 3OY9A 3OYLA 1GX6A 2W9CA 4EZ6A 5KFWA 4CJQA 4FW2A 2IJFA 3DOKB 1WSGA 3QEXA 4J9LA 3F73A 3DDKA 4ED6A 4IR9A 1FK9B 3KLFB 3LANA 3NBPB 1C6VA 2KZZA 5F8GA 4J9MA 3NAEA 2W8KA 4DTXA 1NK6A 4BDYA 5T14A 2R2TA 3TAMA 4OGEA 3PV8A 5J2QA 4CJWA 5CYMB 3OS0A 4IFVB 1WSHA 2Z1HA 2EHGA 2G8FA 2AJQA 3L2VA 1S9GB 2ILZA 1TK0A 1BGXT 3S3OA 1L3UA 2I5JB 4CGIA 4DTJA 3LZJA 3DYAA 4IG0A 3I5BA 4B08A 1K6YA 3NGZA 4CHYA 1WSFA 3VQQA 3H98A 4FJNA 5HLFA 4F2RA 4W5OA 4C8MA 2O5DA 2OH2A 1DLOB 3FDSA 3AVCA 3OL9A 2BANA 3OYFA 3ISND 3NF6A 3HHKA 3V6JA 4FLUA 1LWEA 4TN2A 1HNIB 1SV5B 5J1EB 3K57A 4KRFA 2PYLA 3HK2A 4O44A 1WAJA 5J2QB 2ASLA 3QEVA 4HUGA 5DQGA 2BE2A 3PW4A 4O0JA 5KFVA 2XCAA 1SH2A 1REVB 1Z25A 1NJWA 5KFAA 5DG7A 3PO4A 5HLFB 1MU2A 4JUZA 5F8MA 2G8KA 1JLQB 2W9BB 5KFQA 3QGHA 1VRUB 3QERA 2VA2A 3I0SB 3ALYA 3RR8A 2WTFA 3LALA 4NLVA 3EY1A 3DLRA 4RNOA 3ITHA 3DLEB 4J9RA 4O44B 2HNDA 3ZSWA 3SPZA 2BGGA 3AVAA 1RTIB 1O1WA 1ZBIA 2HB5A 4MIBA 4RW8B 2HAIA 3HPHA 3MXMA 3IS9B 4IG3A 4FLWA 2NUBA 2P51A 3K5OA 1IKXB 1G15A 3MR5A 5KGWA 2HNZA 1QAIA 4WXOA 3DLKA 3MR6A 3LAMA 3LWLA 3THVA 3QIOA 5HP1A 4CK2A 1L3SA 3G86A 4CF2A 3FRZA 5KFYA 1KVAA 1UOCA 5KG7A 3AVGA 1F21A 4DSLA 4LH4A 3LDSA 1S6PB 4C8NA 2HNDB 1ZBHA 3HPOA 3DLHA 3QZ8A 2C28A 3AVJA 4EO6A 4Z4GA 4Z0UA 4DTMA 3M8PB 4NLGA 4IFYA 3KK2A 1YVUA 3SI6A 4IG3B 3TAGA 2DFFA 2C22A 3V6DB 4KAZA 4DU4A 1TP7A 4J2EA 2R7YA 1UAXA 2FBYA 1WNEA 2GC8A 2KFZA 3G10A 3SQ4A 3DLKB 1S10A 4E7LA 3GV5B 3ULDA 3I5CA 1UA0A 3LP1A 3IG1A 4N41A 1EKEA 4URSA 4OPJA 3I8DA 2FVPA 3P83D 5JUMA 1TKTA 4IRDA 3JYTA 2BDPA 3CFRA 5DGBA 3PW5A 2P5OA 1KRPA 4DG1B 4LQ9A 1HRHA 3ZT0A 3KD5E 3SNNA 2FVRA 3C6TA 2YHBA 4MH8A 3KK2B 3KLEA 4DU3A 4M3RA 4I2PA 2AGQA 4CFAA 3L3UA 3V1RA 2ZE2A 2W7PA 4KHMA 2B5JA 3JSMA 3E01B 3VQ8A 1EETA 4CJFA 1HYSA 4ZVHA 1L3TA 1C2PA 2JLEA 3TAEA 1NHVA 4WYLA 3U3YA 4ECUA 3LPTA 4IBNA 1JXBA 3GQCA 3HKWA 1IH7A 5J2NB 3JYTB 1QSSA 4CJ5A 3S9HA 1TL1B 2YKNA 4CHPA 1SL2A 4CECA 3O3HA 2Z1GA 1VRTA 4I2QA 4O55A 2IOCA 1Z26A 3KD1E 2WOMB 2YKMA 1TK5A 2IM1A 2QXFA 1U49A 2IJNA 4H4OB 4B9UA 3TWHA 4I2PB 3M8QA 2WK4A 2B5JB 3EPIA 3I0RB 3V4IB 1HYSB 3KKRA 3KIOA 1WN7A 5KFXA 4AHRA 4Q44A 3OLBA 4G3IA 3QINA 3SV4A 5DLGA 4FK4A 2UUTA 3AA4A 3RR7A 4BDPA 4X2BA 1J5OA 1SH0A 2D3UA 4I9QA 2R8GA 2OPPB 3L8BA 1VSJA 1VRTB 3MR2A 2QV6A 4EEYA 4FJKA 5L1JA 3HPGA 4CEZA 4FZXC 3ZSRA 3V6KA 4M3XA 3AVLA 4WE1A 4ZHRA 5J2PB 3HM9A 3AA2A 4H54A 1JLFB 5JS2A 1QHTA 3KLGA 1NJXA 4IR1A 1J54A 5DGAA 3VQDA 3MEEA 1EP4A 1RYSA 1S1UB 3PX4A 4BDZA 3NHGA 3T5KA 1TVRA 4DFPA 1HMVB 5KGXA 1S1WA 1J5OB 3L3VA 4LD0A 2ZD1A 1GOCA 4ZP8A 5C25B 2W42A 4B9LA 4CEOA 3BGRA 3CIZA 1VSMA 4TLRA 1C1CB 5FROA 1RDDA 3OYEA 4ZHRB 1BCMA 4CJ4A 4FZZA 3ICLA 3NFAA 5KG2A 4PWDB 2OPRB 3H4BA 2IA6A 3V9XA 2IC3B 2E9ZA 3LP2A 1JLCA 3AVMA 4AH9A 3KLGB 2RKIB 4O3PA 2B6AA 1IKWB 4OPKA 3MEEB 2D0BA 3CM6A 4KTZA 1BHLA 1JLGA 4F3TA 3KK3A 1LAWA 4YR0A 3G6VA 4KAIA 2ZD1B 4AHUA 5KFNA 4IDKB 4TSXA 1RT6B 4HYKA 3PR4A 5HRNA 1VSLA 4CJ3A 3T3FA 3SQ1A 5KFUA 1N4LA 3FQKA 4YP3A 4WFYA 5SZTA 4M3UA 4M94A 3AVIA 4E7IA 3V81A 4KB0A 3CJ2A 4JLHA 1L5UA 2HHUA 4ED0A 4KTWA 4KHQA 4M42A 3QNOA 5HROA 4AHCA 4Y34A 3KTQA 2C2RA 1I6JA 3VQPA 3IRXA 5KFLA 2R2UA 4KV8B 3KK3B 3MF5A 1JKHB 4XPEA 2XCPA 4K4VA 1IKVB 2KW4A 1Y97A 2W9AA 5KFKA 5FDLA 1KVCA 4EYHB 4FLXA 4FVMA 5C24B 3VQ6A 3DMJB 3F9KA 3OHBA 4GW6A 2D0CA 4CJSA 2OYQA 3RAQA 1J9AA 2HHSA 4J9OA 3ZSQA 4TY9A 2GUIA 4FLVA 3VQSA 3RMAA 3AO2A 3AVHA 4R8UB 1S48A 4H8KA 1HQUA 3IRXB 4N5SA 3EPGA 3L2WA 2I1RA 1TAQA 4YR2A 3L2UA 4NYNA 4HHTA 1RT7A 3T5LA 3PR5B 1DTQA 2YNFB 2HMIB 4QW8A 3HYFA 4PUOB 2HVHA 3VQCA 5D3GA 4ECZA 2RN2A 4KO0A 3HT3A 3OLAA 1NKCA 1JXLA 3GV8B 4FS1A 3QIPB 4O3QA 5C42A 4HCBA 4ED7A 4NYFA 4GC7A 4J2DA 4ECYA 4BWMA 3FFIA 3KLIA 3KNAA 3CFOA 1IM4A 1BCOA 4DQIA 5JXSA 4NCGB 1FKOB 4Z4CA 5I3UA 2WRMA 4RW9B 1TQLA 1T8EA 2HHQA 5HRPA 1JLBA 4CK1A 4Q0BA 4B9TA 4CJRA 3AO5A 1DTQB 2XI3A 4CIGA 2R8HA 2E6MA 3MFIA 4OLBA 2UVVA 3ZT2A 4N76A 4FJMA 1WLJA 5KG6A 3VQBA 2DTUA 1FK9A 3KLFA 3NBPA 1IO2A 4CEAA 4JRPA 3DRRB 4ZPAA 3PW2A 5CYMA 4IFVA 1JLBB 4J9NA 3UQSA 4CESA 1TV6A 1S9GA 4ELTA 5K14A 3AVNA 1S1TA 2R2RA 2VG7B 2ATLA 1BIUA 2I5JA 3N6LA 3KLHB 3HO1A 4Q5VA 4NLRA 3IAYA 3RB6A 1KSPA 1MMLA 3UR0A 5HBMB 5EWGA 5SWMA 2KFNA 1DLOA 3FSIA 3H08A 3HXMA 1Q9YA 3T5HA 4NLUA 4NLDA 3AA5X 3A2FA 4YMEA 4MQ3A 4O3NA 2G8IA 1KLMB 1HNIA 1SV5A 5J1EA 2JGUA 1NOZA 4KKOB 2HNYA 4MFBB 4FM0A 4TQSA 1S5JA 4JV0A 1QSLA 1U04A 1D1UA 4H4MB 4CFDA 3KHHA 4DSIA 1DTTB 1TV6B 5K14B 1S1TB 1NJYA 1LW2B 4QWAA 1REVA 4LSLA 1RTJB 3OL6A 3SUQA 1NK8A 4RW4B 4KFBB 1SKSA 4CERA 2VWKA 2WB4A 4NLYA 5F9NA 1JLQA 2W9BA 1W0HA 2XO7A 5KT5A 1VRUA 3E51A 3I0SA
chains in the Genus database with same CATH superfamily
1RBUA 4R5PB 1MN9A 1YT3A 4PKDB 2Y1IA 3CYMA 2DNZA 4JI1J 3DLEA 4Q2MA 4CHZA 4E7JA 1LK7A 5KT4A 1RTIA 4MDAA 1WTBA 3V9WA 1U1LA 3DRSB 3RYLA 3CCZA 3IS9A 3KOAA 3GYNA 2GAHC 4B3RF 2QLFB 4LRBA 2QWOA 3NCPA 2VBZA 2QL9B 4KH6A 3R97A 3FBEA 4C8OA 4M45A 2V94A 1B9FA 3HVTB 3CJKB 2B7CB 4ED8A 2NRRA 3SYZA 2XS2A 4AQYJ 3WT0A 1TGOA 1K8AO 1Z4UA 3DLJA 3T1HJ 1MROA 3VR1A 5MLCQ 4G1QB 3OHAA 4U6PA 2MSSA 1XN9A 1XR7A 2XY8A 3CMAN 4L3QA 3AY0A 2JEGA 1KQSR 5BYRA 1VR6A 3BSOA 5ADXA 5M1OA 3MCNA 2YNGB 2QKBA 2CGKA 1XWLA 2O67A 4YFUA 1RTHB 4YS2A 4L72B 1XI1A 1PIEA 2IVYA 1MWZA 4JKGA 1FD2A 4JI5F 4B3RK 2M8HA 3B6OA 1VFJA 2VG6B 1RAOA 4GVMA 1QLNA 4QYZJ 4IWVA 4A8XA 2YQ3A 3VGTA 4JS5A 1XTZA 2F8TA 2AGOA 1YHQS 4JYAJ 2YWEA 2LP4A 3BQ0A 2YHWA 2QL5B 3QFHA 1X5OA 2EX3A 2H5IB 2KT3A 2YJEA 4ZMMA 1OH7A 1IQZA 3CJ0A 3MXIA 3ULEA 2ASJA 1LXJA 3RB4A 5J2NA 4U96A 1GK8A 3PRBA 4TU9A 1TL1A 3HT0A 3MMAA 4OX7A 4DV0F 4ILJA 2V51B 4WKYA 2YTCA 4BRKA 4JI5K 2A0FB 1WHYA 4CFBA 4HCCA 5GAHP 1Q86O 4UQTA 3M2UB 3I5AA 1NU0A 4HI2A 2HURA 2E2PA 3VETA 3PNIA 2CPIA 2R7XA 2Z4PA 4UUWA 3MPYA 1BQNA 2VHGA 3MEGB 1R43A 4JI3J 3T7ZA 2FF6A 2ZBQA 3A8EA 2E7XA 1MN7A 2OPPA 1GFWB 4WTYA 4USVA 3N4PA 5ETTA 1WACA 5B0BA 1X9WA 1RISA 4Q7AA 2AD9A 2HAFA 3BKTA 3JTNA 3UN3A 1TYQA 1SC4B 4FF3A 4DLGA 2W24A 1URRA 2B4UA 4FNHA 3UIQA 3SLCA 1N5VA 2DGOA 4DV0K 1JMTA 5A8RA 1RWOB 2F8EX 5GMKa 3KKFA 1KTQA 4I6MA 2QWMA 4FVUA 1YHQN 1R8CA 2IM2A 3RBXA 5KFEA 1YTYA 1WUAA 1NK9A 2ZGYA 1FDBA 3PHEA 4NLXA 5I3QA 5E0OA 4DTSA 3P5JA 4PKGA 3OBWA 3OSNA 5KTQA 1MW7A 1D8ZA 3SZ2A 4C2MA 1TKXA 3P4UB 2E44A 1VQ6S 1MMDA 4TY8B 1WWHA 4AE5A 2LCWA 3HI9A 3OHRA 2VA3A 5A6PA 4NI2A 1W97L 1QDUB 1IBCB 4DV5F 3BKFA 4CLPA 1RTDB 1VIOA 4A2BA 4CTAB 3TAQA 1IR0A 4Q8EA 1C1BB 2HHVA 3KK1A 1FO1A 1TKZA 4DQQA 2HIYA 4ITSA 4ZVQB 1N5QA 4WF9L 2ASOA 4YOVA 3QRRA 2P9NA 3TABA 3NGSA 3ZFVA 2B56A 3MCAB 1LW0B 2ZJRL 3WBZA 3MCPA 1W9HA 2W8LA 5IM0B 3K5LA 4X66F 4BRAA 1BISA 1RHMB 3BSNA 4O8UA 4EHUA 3CDWA 2XYPB 4CGJA 4LQ3A 1U26A 2DH8A 4LF9F 2HRTA 2ZUGA 1JXEA 4DF8A 4OJ1A 5FJ4A 3QGGA 1S49A 4PRFA 3Q8UA 1LOUA 2XGQA 4NA1A 4WFZA 1IKVA 2OPSB 4C8KA 1RZMA 2QWLA 5AJ3J 4FJIA 2XZDB 4M63C 2YWFA 4Y6IA 3UI3A 4DV5K 1VBZA 2UXBJ 1Y5NB 2H54B 1GMVA 4RTFD 2M2BA 4OO1J 4M5JA 1HHTP 1Q78A 4YHHF 1YJ9S 3WIUA 2DHAA 2J6SA 2JWKA 2MLXA 2CWKA 5HVHA 4MK8A 1WHXA 2CPFA 3KDNA 1MWQA 3FCHA 3HVWA 1ZYQA 1ASWA 2F9JA 3POTA 1JJCB 3ENAA 4X66K 1QHAA 2B4PA 1XMOF 1DURA 1NHUA 4DF4A 3FE1A 4ZIVA 3Q23A 3CFPA 4LF9K 1VQ6N 2QYCA 3D68A 2QMUB 4HHUA 1U47A 3ZZTA 3IR5B 5K8PA 3DHXA 1N8RO 2GQQA 3B8HA 2CJAA 1GLCG 5KFDA 3UB5A 2DPJA 5LJ3Y 5CYQB 4CWBA 5IQ6A 4PA1A 5D0GA 3KKSA 2OEMA 1PC5A 3BB5A 3GTYX 3CTRA 2R7QA 1XJWB 3L7OA 4M5GA 1CSJA 1U09A 4YHHK 2OP5A 2DPNA 3C95A 3OS2A 2E5JA 2M70A 2ZWOA 4M95A 4BRFA 4ZA1A 2BR0A 3GJTB 1V5IB 2YY3A 4DR3F 2CA9A 4Q43A 2OMLA 2FLPA 3D45A 3TEGA 1EAYC 4PYDA 1XMOK 3KG4A 5ITHA 3MR3A 4FJHA 2MKHA 2DY4A 3EM1A 4HACB 2VJVA 3V9UA 1KEKA 4OJHA 4RNMA 4DWIA 4CGFA 3DRRA 4FCYA 3K9KA 4M3ZA 4AM6A 4WFBL 1GTEA 3KJVB 2GQ2A 1HBOB 1HQ2A 3H1VX 1VIXA 3IUCA 1YJ9N 3SQ2A 4ZITA 4ISEA 4ZJLA 1RWNB 1C0GA 3G96A 2EVZA 1TMMA 4CRJA 2XWYA 2D3ZA 2C2ZB 1RT3B 4DR3K 3W5ZA 4NLTA 4ICLB 5HL7L 5KG1A 3KHGA 3O5TB 4DXLA 3NGDA 4C4WA 1YJVA 1CJTA 1HWKA 4FBUA 3QBCA 5KQDA 2IS3A 1YKWA 4ISGA 3PEJA 1DTTA 1XC3A 2XMUA 1LW2A 2AJ0A 3WC2A 1NEEA 2F9DA 3W8PA 3J7A1 4DPXA 4CEQA 5KQ8A 1D0EA 3BO4A 4WJBA 3SQ0A 1JLEB 2VD3A 3MMCB 4DQRA 2XGPA 4ECSA 3KMSA 1VQ8S 1TL3B 2UP1A 3O08A 3J81O 2HQDA 3GIMA 3OTDA 4FYVB 4FS2A 2VZ9A 4R5PA 3BSCA 2Q0RA 1RT4B 3N6NA 1Y5IB 4NCAA 3TAFA 1VLYA 4DTNA 4DL5A 1BQXA 2IMWP 3DRSA 1Q18A 4C6AA 1BU6O 3K59A 1GOBA 3OYAA 4YY3J 2XHCA 4DL6A 4BRCA 3C6UB 4RL1A 2YPZA 3FRYA 3VHQA 4CT8A 1SKUB 4DV2F 1VBXA 2H5JB 4B3SJ 4GV3A 2CQGA 2AF6A 4X4SA 1OSDA 3HVTA 2YXLA 2NXUA 2W9CB 1FRLA 3K2YA 4LR9A 2LXIA 1RWPB 4DR6F 4KHUA 2HVIA 1Q82O 4G1QA 1XNRF 1O0PA 4P73A 4BACA 3MN6A 4C0OC 1EKSA 3NAIA 4ZP9A 1TFYA 4B8AB 2SXLA 4EP5A 4JI4J 2VQEF 2IBOA 4QU7A 2YNGA 2O01C 2IBKA 2BRLA 4JI6J 4FJ5A 3MWPA 2PEBA 2VU5A 3G71S 2QSFA 1RAHB 3OS1A 2VG6A 1ZM2A 1VSEA 3F41A 4EMDA 4CF9A 2EK1A 2VF3A 3RMBA 3SMZA 4KB7A 2DBBA 4DV2K 2AYGA 1M1HA 1N48A 3FBFA 3GJRB 1KQKA 4H4KA 4YOEA 5DM7L 4F36A 2BH1A 3IWNC 2XNQA 1UVNA 4V1Ak 4YDXA 3ISNC 3FZMA 4JI0F 2DGTA 3R1XA 2B43A 2YQ0A 2IHR1 3HFVA 4KYZA 3PFEA 4W4MA 1S6QA 1XNRK 3BEXA 5B09A 5DZ7A 5CHIA 4BR0A 3SPYA 2HHWA 3LPUA 2DY1A 4W5QA 3EZWA 2VQEK 2AZ3A 3AA3A 4USKA 3W2VB 3C66A 2Z1IA 2ZH9A 4B1VA 1AA1B 3VVUA 2DPIA 3PJWA 3GG4A 4CJLA 2CFXA 1I3OB 1YJWS 4DR2K 4QCLA 4CF8A 1NOYA 1FJCA 1OIAA 1FRMA 1NKBA 2BJ3A 2EFPA 5SUHA 5AQHA 1RDWX 1VJWA 5BRDA 3JSBA 5AZJB 4IYQA 4Z7CA 3MEGA 3CCRS 2CNKB 2JFDA 2GWKA 4BR2A 3N6MA 3O6QA 3ENBA 3K5MA 4KI4A 1NMEB 4M7XA 1DHMA 4JI0K 4L8RB 1U25A 1UEVA 1UJ6A 2VBYA 1TAUA 5DK5A 2ZH8A 4C98A 4O3OA 1EARA 4N56A 4RU9A 3MTKA 4FWOA 2YX6A 2KYXA 4DUZF 1KXPA 1ZC6A 4LVOP 4C48A 5A2QU 4QOZB 2CJXB 4J5OA 1OSCA 1EQ0A 1M5HA 4E2FB 3A8JA 2C3MA 2H4YB 3Q8QB 4GC6A 2IIHA 1SCJB 3EZ5A 2RDJA 1HI8A 3CCJS 4FJLA 4F3OA 2Q1LA 4DSKA 2YV0X 2YVSA 1UEUA 2K1RB 2JWNA 1TKTB 2E9TA 2E5LJ 4TY8A 3CM5A 3SUNA 3H45C 2QA4G 3MEKA 2R3VA 4JV5F 2DRBA 2JDJA 4ZJQA 5AQVA 3OYCA 3KLEB 4HTUA 3ZTSA 3HF5A 4CTAA 2ZQBA 3C6AA 3SBMA 1C1BA 4H5VA 1RKIA 2X1BA 2RDIA 4GVBA 4CEBA 2AWZA 3NXZA 1EETB 3OL7A 2E1ZA 4DUZK 2MZQA 1SIWB 2I8EA 1YJWN 3C7NB 4KB1A 3SQGB 4P2XA 4OV6A 1EKRA 2NYIA 4FPAA 5IM0A 2G8VA 4F4ZA 3L4QA 1QD1A 3CCRN 3H5SA 4NX9A 4YNQA 1HARA 2KT2A 3UDCA 1OYDA 3P3DA 4GKJJ 3AAPA 2BE9B 5KT6A 1LEOA 4U8VA 3TA1A 1WI6A 2O3DA 4AD6A 1FA0A 4WK1A 2OPSA 5CE3A 4JV5K 2FJDB 1BI4B 5HANA 3HJFA 5LXRA 4CIFA 4K4ZA 4IJNA 5AZIB 3I32A 1RHRB 2N4CA 2FY1A 3IWLA 4K2JA 1JJ2M 2ZM6K 3GJQB 3OW2M 2PC6A 1Y7PA 4K4YA 3CDBA 4I64A 3I9V9 2NPIA 2CH6A 3CCJN 2HS3A 2F4VK 5GAHU 1E6YB 3CE8A 2UUCJ 4WQ4A 5DQHA 1PCAA 2WBRA 1NGGA 4CFCA 3GSDA 1TVRB 2MKKA 3PX0A 2KVQE 4KHPJ 4DB3A 1C0UA 1S1WB 5EX0A 3MMVA 1JCGA 1U02A 5CYQA 1VSKA 5DG9A 2LDIA 4CYUB 3SV3A 4FWQA 3GMGA 1GH8A 2BJ1A 3BGRB 1QQCA 4NLBA 3J7Z5 3CCES 3D9BA 3PYEA 2BV3A 4WYBA 4WU2A 5L9NA 2KKHA 3KHLA 4FJ9A 3EMTA 5L1LA 1W7AA 1JLCB 2DYAA 2B6AB 2J7WA 2YX1A 5D0EA 2E5HA 1M5SA 2D3O1 1G2EA 4ILMA 4NYOA 4FXWA 3MXJA 4O0IA 4DQ8A 1NGEA 4ILRA 1XHXA 1GX5A 1CZ9A 3PYGA 3US5A 1K1SA 1YRUA 2ZZMA 4HACA 4RWXA 4EFHA 2EC0A 5EX5A 2JVRA 1PO6A 1TTHB 2PT0A 3V81B 2J8AA 5IT9O 3CCSS 1WSEA 4ZP7A 2CQ0A 3KJVA 4LT6A 1HBOA 2XI2A 2IRYA 3ZSYA 3AXKA 3T1AA 2JOQA 2EBGA 1AB8A 4ZLPA 5MAOA 1K8AT 3LM2A 4DX6A 1IBKJ 3DRPB 2C3UA 2W4PA 9RUBA 1YG0A 1HL6A 2HBRB 3HHEA 4K8ZA 1UW4A 3SDEB 1RP5A 4OGCA 2CQBA 4DCPB 3GIRA 3PCOB 2CQ2A 5CXTA 1RT3A 2BABA 4ICLA 3HHLB 1X9SA 2NUHA 2E7WA 3BF3A 4HUFA 3GIIA 1QTMA 4LREA 2UXCJ 3AV9A 2QMWA 1SJ1A 2ASYA 3KZBA 1OPZA 2ASDA 4QR1A 1IV0A 1JLEA 3MMCA 3CF5L 2FC9A 1S4EA 5FPNA 4CZLA 3IC1A 1XQIA 3PW0A 3TZXA 4HH0A 3CCEN 4CH0S 3HLUA 3DC2A 2VQFF 1CPZA 3DLGA 1FJGF 1SC1B 2P9CA 3HVRA 5D3GB 1RT4A 5F8JA 4CJKA 1GOAA 5ETMA 1W2BR 3R8YA 1N34J 4M3TA 4DV4J 4PWWA 3HTVA 4ETXA 4B1WB 4TYAA 4A62A 2FJBB 4NXNJ 5D6GA 4BE1A 3BGLA 2RRBA 1SUQB 4LF1A 4UOGA 3KLVA 4ZLJA 4PWUA 4Q0BB 3OJSA 4DJBA 1Q86T 3CCSN 3QRQA 3HI0A 4QWDA 2W9CA 4B3TF 2VKZG 3ZZ0A 4FW2A 3NLCA 4F4AA 3DOKB 2HSEB 1WSGA 3QEXA 3A1YG 2KHDA 3DDKA 1F3VA 4QQBA 2VQFK 5CABA 4L6V3 2CZVC 2KL8A 2KZZA 3EXCX 3TSQA 1FJGK 1R8BA 4BR7A 5F8GA 3ZTOA 4J9MA 3VF6A 1YZ7A 3NAEA 4JKDA 4BDYA 2M5YA 1YJRA 5T14A 3C65A 2LQBA 4DPWA 1PG5B 4OGEA 3PV8A 1IJEB 5J2QA 4CJWA 5CYMB 1QY7A 1WSHA 2Z1HA 1ZZFA 2AJQA 2G4BA 2ILZA 1K73T 4CDIA 1L3UA 2ZJQL 3QT5A 1VC6A 2RQMA 3NMUA 1K6YA 2A40A 2MB0B 4B17A 2CIMA 2FZCB 2CPDA 1BWEA 5HLFA 1PC4A 3KHYA 4W5OA 2W2NP 4C8MA 2XMAA 3FDSA 3OL9A 2ZNYA 1ICEB 1FDDA 1UWAA 1F0XA 3V6JA 4B3TK 2LMIA 4P75A 3NVMA 4F0MA 2Q31A 3M7VA 4B1ZA 1YBAA 2XHWA 2XYHB 3UNYA 2YBVA 3Q22A 2A6MA 4U67Q 1V4TA 2NS1B 5AQTA 4O0JA 4LF7J 5KFVA 4DV3J 1SQKA 1H7XA 3R9PA 2CPXA 3VZIA 3BBBA 4JK7A 1REVB 5C2FA 1NJWA 2FIUA 3PO4A 3O1LA 3W2VA 2VIHA 3QGHA 2VA2A 1SJ3P 2WTFA 3LALA 3EY1A 1RHKB 1PYOB 1FCAA 4JI1F 1ESVA 2HB5A 4MIBA 3LOUA 2KXFA 3MXMA 5AZJA 3EJMA 5LM7E 1WC5A 3TQEA 3W5XA 3K5OA 4N8OA 2NZ4A 4JI2J 3LDOA 3NOGA 1KAZA 3MUTP 3MN5A 3PIPL 3MR6A 3THVA 3FSYA 3GR1A 4CK2A 4X64J 3W3DA 2PA8D 1UOCA 4RCHA 1F21A 4F3QA 2MZ1A 3VZHA 2J7KA 2HNDB 3DLHA 3UDVA 1H38A 5AQGA 4FXVA 2BW7A 2FSKA 1FKAF 4M5IA 3KK2A 1H2TZ 4IG3B 3W9JA 5LSLA 2DFFA 3HOTA 2ZH5A 4EWTA 1LFPA 2ZF5O 1M5VC 3TUPA 1NSPA 2W40A 2EKYA 4JI1K 3TTCA 1IUJA 3PEHA 4OYIA 1VQ5S 3SQ4A 1ZXOA 4E7LA 1UA0A 1TUUA 5B7WA 4URSA 3I8DA 2K1RA 2MKYA 5JUMA 4ZVRB 1TKTA 3I55S 2BDPA 1YITS 4IRDA 3TZWA 3CFRA 3AHPA 3TTDA 5FLXO 2QC3A 4DG1B 4LQ9A 5L8RC 3JQMA 1N8RT 2PMWA 2F7TA 2YHBA 3H90A 2OFGX 5A0YB 3KLEA 2AGQA 2VKRA 3NGUA 4RJVA 4JYAF 4P7VA 3Q8VA 2F8HA 2F4FA 4AUKA 3VQ8A 1VYAA 4FPRA 5H1SV 1EETA 2OTJS 4DR4J 4AQYK 1C2PA 3KG0A 3TAEA 5K9FA 4YDUC 4ECUA 3SQGA 3MOJB 4LC9B 3QBWA 3VPZA 3CXCR 1JXBA 3B4DA 1WD6A 4M5DB 2VFRA 3BF1A 2HOEA 1HD0A 1WOSA 1TK5A 1VQ7S 1R0BG 5ETKA 1WEXA 4H4OB 2YKQA 4D3GA 3TWHA 2NLWA 3MM7B 2B5JB 3EPIA 3I0RB 2ALYB 2ZBCA 4EFAC 3C0BA 1WN7A 1T9WA 4QYZK 1N52B 3ATUA 2ZBIA 3Q83A 2W4DA 1ATNA 2DGUA 1J5OA 4UZBA 1SH0A 4JYAK 5AZIA 4JI3F 3UCGA 4I9QA 1UETA 1W26A 2R8GA 1VSJA 1VRTB 1VQPS 2QV6A 3HJVA 1EQMA 1NGCA 1H98A 2VPXB 3D2WA 5BRHA 2MYFA 4MAKA 2OFHX 2MKJA 2YKPA 4M3XA 2QA2A 1X4DA 1WG1A 3AVLA 1NU4A 2NXNA 3OXLA 3HM9A 1Y3KA 1VQ5N 4C0HA 5IT0A 2K3KA 1DRZA 1E6YA 1BLUA 1NJXA 1SQGA 2DCUB 3I55N 5D4NA 1YITN 2Y0SD 3MM5B 4PEOA 4ANCA 2X1AA 5DGAA 3PX4A 4YUDA 4JK8A 3T5KA 1TVRA 1RHQB 2D0PA 1K0TA 1S1WA 2ZD1A 1X4AA 5C25B 4CYUA 4CP5A 3HULA 2Q43A 4LFBJ 4R25A 4FWRA 3BGRA 3W7BA 5BPMA 3CJTA 3CIZA 2VWBA 1VSMA 4OX8A 3MAHA 3OYEA 4ZHRB 1Y5LB 1PSDA 1BCMA 4CJ4A 4MT1A 4JI3K 4PWDB 1I94J 2OI2A 3ZXWA 2IA6A 2O8CB 2P9IB 1JLCA 4AH9A 3KLGB 1U6BA 2RKIB 4O3PA 2B6AA 1ZAXA 2QTDA 2PDAA 3U1MA 4C11B 3MHYA 4JAXA 3TW0A 1NNEA 3NNCA 4KTZA 4BGAA 1RAIB 4F3TA 3KK3A 1GT8A 3Q24A 1VQ7N 3D67A 3CIMA 4CLYA 4PABA 5AQYA 3A5NC 2PN6A 4CLTA 4A8OA 2E5IA 5KFUA 2VCPA 5SZTA 4FN5A 3AVIA 1IR2A 3V81A 4KB0A 3DRYA 4JLHA 2HHUA 4ED0A 2HGMA 1Z2LA 1FX2A 5A6WA 4F9OA 5LMUF 4M42A 2F8MA 3CCMS 1OY6A 4ED5A 4AHCA 4I6WA 2C2RA 1VQPN 4OJ3A 4G9ZA 3S6EA 2R2UA 4EHTA 5M2RA 4A5AA 1NHKL 3R6MA 3MF5A 3LDPA 2G13A 1Q82T 2XCPA 2YWGA 5LOQA 5BPLA 3HBTA 2DEIA 5AXKA 4LVNP 8AT1B 4XAKA 3SDEA 3JAMU 2OEJA 3DMJB 1OVQA 5AJ3F 2E1YA 3VWSA 5E3PA 4GW6A 3THTA 2VBXA 3KWGA 3ZTQA 5BN8A 2G2ZA 2PMZD 2HK2A 2BKPA 1VQYA 4ERDA 2AEFA 2KI2A 2VYPA 4WBFA 2HRUA 3EE9A 5THWA 4JI8J 4H8KA 3N9UC 4N5SA 4DDFA 4OYZA 2B9WA 3EPGA 2JH3A 4NYPA 2I1RA 1TAQA 4IO8A 1N33J 2DNOA 1VQNS 4LF4J 3BO3A 3VAMA 3T5LA 3GPAA 3FMBA 3UKRB 2YNFB 4QW8A 3HYFA 1UVJA 1WOQA 5D3GA 4ECZA 2RN2A 3OLAA 1GNKA 1F9FA 4O3QA 4NYFA 4OHVA 4J2DA 2MJUA 3DDIA 3BDEA 4ECYA 1G4CA 4BWMA 3WIVA 1NWKA 5AJ3K 4HR2A 4OIXA 2HFZA 3AJDA 1G3OA 1T8EA 2HHQA 2KDOA 3Q2SC 1UJ5A 1UAWA 4CK1A 4Q0BA 4OHYA 3C6HA 1DTQB 4DCOB 3VGLA 4CIGA 4DMZA 3P31A 4YB1P 3MFIA 4DR5J 4KIAA 2K7JA 3CCMN 1S22A 2GJIA 2VL1A 3VQBA 2DTUA 3EL2A 3OFFA 4L76A 2KVIA 2VFSA 3DJCA 2AJ2A 3MXHP 2W2OP 4B1YB 3U27A 5HQLA 3CCWA 2DNPA 2MY7A 5CYMA 3AB4B 4UY8O 4AM7A 1JLBB 4J9NA 4CESA 1TV6A 1CULA 4ELTA 5K14A 3CPEA 2LEPA 3HO1A 2RD5C 4NLRA 3D3CJ 4K0KJ 4OYPA 5EWGA 3H08A 1Q9YA 3EDRB 3IM8A 1BUPA 4U9RA 1TL7B 1FDAA 5HO4A 1VQNN 2Q0UA 5FIIA 4YMEA 3IR6B 2G8IA 1KLMB 1RBOB 2JGUA 1NOZA 3GFYA 4KKOB 2HQIA 3MAAB 1O51A 1D1UA 3O5BA 1AROP 1S1TB 4K25A 4ZN3A 3BPSP 3MM9B 5IC4B 1REVA 1W7WA 3QICA 3LO3A 4KFBB 4QU6A 3SSSA 2D1CA 1EX8A 1R59O 5HI7A 4C0BA 3E51A 2V9KA 3O1BA 2DNRA 3VGMA 2EFVA 3NMAA 4X4OA 2V8PA 2FBVA 4BRDA 5M1QA 3NCIA 3O44A 2E1AA 5CA5A 2HNYB 1S99A 1ZH5A 1EHWA 3CJSA 4PG6A 2XS5A 4J9UE 4CT9A 1NK7A 3R5GA 2IIRA 1Z2ZA 2ADBA 1NDKA 3OYIA 1T95A 2K2PA 3FSXA 2QLJB 4LSLB 2RJZA 1Q8KA 1IG9A 2PY5A 1U45A 4M5MA 1KVBA 2EBEA 4O0NA 3OTEA 1C1AA 3CDEA 1R6VA 4YY3F 4WCEQ 1KP6A 1UWBB 1H7WA 1AT1B 2MHEA 4DPOA 5KI6A 3HRGA 2KB2A 2PO4A 3BEGB 4TXSA 4H0OA 2AKWB 2KM8C 3OFHA 1T11A 4ZTJA 2UV8G 3UKUB 2GUPA 3M8YA 3QGPA 3OPKA 2FJVA 3AAQA 4ID5B 3OTOJ 5GAHI 3TX8A 4X4PA 3HSJA 1X0PA 5E84A 1WG4A 3U9ZA 4YB5A 5DM6Q 3DLLQ 4JI4F 1U2RA 1VBKA 3WXIA 2C3PA 4G65A 3D54A 5T7BA 2J0WA 2ZKUA 5BN9A 1CXQA 2JL9A 2Z2ZA 2WCXA 3CCTA 3D0IE 3FKBA 3UN5A 2DXFA 4Z4EA 1PAEX 4FM2A 1YTUA 4DG1A 4YY3K 3QEWA 1FNXH 2K7KA 4FJXA 3TWZA 4EO8A 1NKEA 1ZBSA 2Y9HA 5EU7A 3UWTA 4ATNA 1NPKA 5A0YA 4CJTA 2Z56B 2XC9A 4KHRA 3C19A 4KSEB 3IMXA 4RW7B 2F3JA 4URGA 4CJEA 4ILHA 4UT4A 2DFEA 4BWJA 4WF9Q 1RT5B 1Q81O 4WKRA 4M5DA 4OZ2A 2AP1A 1YBUA 3HMJG 4DL4A 2KTQA 4FL9A 4R0JA 2FYXA 3TR5A 4JI4K 4IEIA 5KT3A 4DHVA 3SAFA 1D9AA 4ZPVR 3QAUA 3GSIA 3FEZA 4JI6K 4H4OA 3PIOQ 2ABYA 2P9SB 4ECQA 1NH7A 3HZEA 3MM7A 5K8OA 1X4GA 4P72A 2Q3PA 1WORA 1FXRA 3I0RA 4OJRA 1C0TB 2GHPA 3HD2A 2HF4A 2NRVA 1HI1A 1XR6A 4NLPA 1U2FA 3UE2A 2RHKA 4B9QA 4IKFA 1KQSM 4Y28C 3SEOA 4NRTA 1RB0A 2FUG9 3NE6A 1JJ2R 4FLZA 3O9SA 3SIPB 5KPZA 3R3TA 3OW2R 1VSFA 2N3OA 2OUGA 4NZ0A 2E5GA 2YH0A 4CGHA 3KMQA 5EN1A 3EE3A 4CZKA 2DR7A 2E7VA 3AVBA 1VLOA 3CJCA 5KFPA 5F2RA 2MQNA 1IR1A 3MM5A 4MKBA 1VMBA 1BXNA 1JX4A 1NUEA 1QE1B 4K50A 1WI8A 2GA7A 1S7HA 3K58A 3QB0A 3KUGA 2PSZA 1M5KC 2WFBA 3FGVA 5EUHA 5IV4A 5C25A 4NXMJ 5JS1A 1F5AA 4BRLA 4CD3A 5EVZA 7FD1A 4DV1J 3EEQA 4IOBA 5IXUA 4CM2A 4EYIB 1ZETA 3QNNA 4PWDA 1X60A 4BVPA 2O8CA 4CZFA 5ELZA 2YNIB 2E5LF 2RKIA 3VGVA 2JEJA 3MEDB 1OVYA 1TK8A 1XK8A 3ILOA 4C11A 2R7VA 2KT5A 2IVPA 1NGFA 4NZ7A 2JEFA 1BDGA 4UOHA 2A10A 1JNZB 3ZX2A 5K8MA 4E3SA 3CJBA 5KFFA 2LYVA 1RSCA 3EGWB 1KD1O 2OO4A 2Z57B 1H2VZ 2GQCA 2YJFA 3CDUA 2EW9A 3W61A 2VPWB 3U1NA 1HUXA 1UTAA 2DXDA 2BRKA 4ZVOB 2VODA 3LL3A 2YNHB 3PRVA 1D9DA 5AQSA 5KFTA 1RE1B 2ZITA 3AAWB 4CH1A 2P8IA 3GE1A 1QUVA 2HBYB 5K20B 2I0XA 4F2SA 3J7AN 2W1BA 3D0HE 3OYNA 3OVNA 1T9UA 4QPXA 3UDEA 1PJ7A 2G1DA 3ENWA 4RUCA 1T6CA 1TUGB 3HFKA 2KYZA 4UW2A 4LF8J 1LWFB 2E5LK 4QIGA 1WNSA 4O4GB 2LDYA 3DMJA 2M0GB 2J9DA 4MKYA 5I42B 1FTCA 4CJUA 1HBNA 1C0FA 3K5NA 3SBTA 5CZ2A 4HL9A 3QWPA 2E6LA 4X4QA 1WF2A 1Y10A 1B4SA 4ED3A 3GDQA 3OSPA 4ZS6A 4LSNB 4EBDA 4IQXA 2UVRA 4NLWA 1VSHA 4F02A 4K8XA 1XNQJ 4PL7A 4XPCA 1X9JA 4Y2CA 4DV7J 2HLUA 4BQLA 2UUCF 4CQ1A 2YNFA 3UKRA 5KFRA 2GV9A 3H6EA 4GKJK 4CJPA 3Q2TC 3EN9A 5F41A 3VQ9A 3LAKA 3OVBA 4GRSA 4KHPF 4JKEA 3BGUA 5JVGL 2D9PA 4UQGA 5AQOA 4K4WA 2V63A 1QVGR 2X6NA 4H0TB 3OVSA 1LWCB 4DR1J 3GB0A 4IEEA 4JKFA 6FD1A 3U7JA 3I56S 3RW7A 5KFGA 1TUYA 3ZX0A 4QBUA 4A8MP 1X9MA 1LXNA 2XULA 4PKIA 1DARA 3J81Y 4Z94A 3RMCA 1S0OA 4M3WA 1PJ5A 4OI0A 2YPYA 2OSRA 3J80U 2UUCK 2ACYA 2EI5A 1FRHA 2FD2A 2V5HG 5CZXA 4CF0A 2L9WA 3DGPA 2ZOFA 3CI5A 3TZYA 3D7EO 4XH1A 3S3NA 3O8MA 4MMOA 2HYIB 4KHPK 1WEZA 4XIUA 1F3FA 5HMXA 5DO2A 4WZQA 4B1UB 1S6OA 3M30B 4E8UA 1E3MA 4DU1A 1NO8A 2AX0A 3UE5A 1B9DA 4FP9A 3RB0A 4DTRA 1CJKB 4I6YA 4KGVB 3IBWA 2L41A 3V1OA 1IBKF 4RNNA 4FJJA 3FZFA 4JN4A 1TL7A 2FY8A 2H1YA 2YI1A 1KLMA 1BQMA 2XQCA 2GMLA 4KKOA 3CUNA 4Y00A 1U4BA 3MAAA 5E41A 1B0PA 2NZTA 1IWGA 2UXCF 1ZAVA 2GMHA 3OYHA 3MM9A 2VWJA 2VGMA 2FF3B 4HUEA 1GMUA 2DIVA 2BQRA 1RWKB 5E3QA 2J6UA 2MKIA 4Y0WA 4KFBA 2K8GA 2WONB 3O1WA 2OEKA 4RWTA 1HQEA 4RNFA 2V4RA 2DNKA 1TUVA 4PXEA 4BRNA 2IRUA 3C14B 2HS4A 3NGTA 4ELVA 3TR8A 2GX9A 2FJWA 3I56N 5J2MA 1SH3A 1N34F 2P9LB 1IBKK 4DV4F 1N56A 3S3MA 2FBXA 1S1VB 5BPNA 1UKUA 4DFMA 1YWXA 3DU5A 3QESA 2ITMA 3QQCD 1TR0A 2B8PA 4NYZA 2RF2A 1UWBA 3NCQA 4LRFA 4DTPA 2UXCK 1ROFA 1KDNA 1VHXA 4K42A 2VV5A 4DFJA 1RADB 3CWJA 4CLFA 3NF7A 3G8TA 3NOCA 4Z37A 3UKUA 2DGQA 2QYGA 1HX1A 3L2QA 1CZBA 4F4KA 3AVKA 4BBYA 3LP0A 1NM1A 1AFIA 1RNHA 4DHYA 3BPDA 4PXBA 3TAPA 2DO4A 3RAXA 1N34K 4AL7A 4DV4K 4MLHA 4IXCA 3GG0A 2QFJA 3RUBL 3U1LA 3GV7B 1RI7A 2PFUA 5AT1B 1PKUA 1FNOA 3LZIA 2PBDA 2CXEA 3VV2B 1WSRA 4CBUA 4OYMA 2VUGA 1NBWA 3GR0A 5A2QO 2GJ2A 4QR0A 5DDQC 2Y1RI 4OZNA 2H51B 5A8WB 4RW7A 5C12A 3IGVA 3VQAA 4BR4A 5IZHA 2ZHAA 1FTRA 4B8CA 4WIIA 1U6FA 2AQ4A 1RT5A 5AQXA 2UVWA 4LF7F 4DV3F 3QETA 3E3XA 4K8RA 2LXFA 1MU2B 1TL5A 1UZHA 4JBCA 3NP5A 4MK9A 1HNWJ 4KPYA 5F0WA 2HG4A 3ITHB 1NGHA 1R3NA 3UPFA 3HP9A 2VASA 3HVAA 4I1TA 5D4PA 3VN5A 2PIIA 4CBWA 5M1FA 4ID1A 4IH6A 2QM1A 3CD6S 3UD3P 3SMSA 3QPIA 1R8PA 1NJIO 2RUSA 1HWUA 2L9NA 1HR0J 2HNZB 1IKYA 3QJJA 4BQZA 2FVSA 4EU0A 4FXDA 1T3VA 2BA9A 4ZIWA 1AUSL 4A47A 2XY6A 4LF7K 4DV3K 2VBWA 2ILYA 1RLCL 2D9OA 2DISA 1M1KT 2XMMA 4P6QA 2W25A 3OTBA 4I67A 4OPHA 1Q0NA 3JS9A 4DPUA 5KRTA 4JB8B 3CETA 4IFYB 3CJ4A 4ZPCA 3SK3A 1QE1A 4LBIA 4K4UA 1VQ9S 4RU2A 4F0KA 2BQ3A 3VA0A 3PJ9A 4U67L 5AQZA 1GLAG 3GIKA 3WZ0A 4YEAA 1B99A 5ADZA 2KFYA 2CJYB 4DSJA 3L2RA 4Z4FA 4HT5A 4ECWA 2Q97A 3LP1B 3IG1B 2HHXA 4B9VA 4OV1A 1X5SA 2GO9A 2E9RX 2YNIA 4JI2K 2VFUA 4E1MA 5GMDA 2HZVA 5HMYA 3MEDA 4FZVA 1SI9A 2BE7D 1VQLS 1CC7A 1Y11A 2H9ZA 2BUNA 2O1PA 2GVDB 3JSMB 3W3SA 1FT8A 4YB6A 1CZAN 3VQ4A 1B3TA 2G8UA 4PZVA 1LAVA 4NWBA 1XQSC 4LFCJ 2YNHA 2KJVA 2HVDA 3TPQA 2YKNB 1Q95G 3CULA 3NKYA 2C2NA 4I2QB 4FJ7A 1RLDA 3TJ9A 4Y1DA 3ZC4A 2GV1A 2IDOA 3N4WA 1WSJA 4KY3A 3G6YA 1ZM9A 3NL0A 2GWJA 5AE1A 5LMNJ 3OV7A 2X7IA 1OYEA 1FRXA 4OKJA 1LWFA 4CZGA 2XBPA 4CHNA 4DU8A 3BQ1A 4PY5A 1KAYA 5I42A 2JFKA 2Y1JA 2HBZB 2ZNZA 3RRHA 4OX6A 4UY8T 3OA9A 2CPYA 3KHRA 2IGIA 1H73A 3PYFA 1VQ9N 1SJFA 2DD8S 4HWIA 3ISZA 3P49B 4LRCA 3PVXA 4LSNA 5IT9Y 3S7RA 4WE1B 3BR9A 3BN4A 2X74A 3TANA 1I3AA 6FDRA 3OUYA 4ELUA 3D0GE 4W5NA 3BO2A 4XTTA 3C8YA 3CF5Q 4PL8A 1UA1A 3CHWA 4DS4A 4AYBD 1EP4B 2J0SD 1WSVA 4ZDNA 3OVAA 2YHAA 2HQGA 4F4XA 1X7VA 4KR0B 4ZPTR 1VQLN 1UVLA 5DJBA 4FBTA 1VBYA 5D8HB 2WSEC 2PYJA 4OQJA 1HNZJ 4LFBF 1YLXA 2C3OA 1WTFA 5JICA 2H48B 4CJ7A 2E88A 2CJBA 4MIWA 4W5TA 2GAGC 3EKUA 2U2FA 1I94F 2Z2YB 1NSKL 3NAHA 4ECVA 4P7TA 4AHSA 2KKZA 3AQPA 3BQ2A 2ZZNA 2GIQA 3R5DA 2AEMA 5GINA 2ZVIA 2EKNA 3QRPA 4LR8A 3BBCA 4OZ1A 3L9ZA 2DNNA 3O6WA 2UYTA 4M63A 1VC5A 2I2YA 1SS6A 2X3GA 2CQPA 1WAFA 3NF9A 4NLQA 1KOOA 2V69A 4QJVA 3JSRA 3KVGA 3U6FA 3EYZA 1ZA1B 3M30A 4MK7A 3GLJA 1VDHA 3TU5A 4LFBK 2GBZA 3TQ1A 4LMZA 3AO4A 1S5ZA 1WHVA 4PAAA 4RUAA 1U2VB 1CJKA 1U8WA 5FDLB 1I94K 2CRLA 4CGGA 1RWVB 2CZ9A 1SXLA 2P1JA 3DOMA 3J8AA 3GYGA 3AD7C 3THYA 4Y0FA 1RDCA 3S01A 2K06A 2V50A 1KHWA 3R7BB 1X4EA 1FEHA 3PKMA 2DO0A 1WDTA 2IA0A 2DGSA 2DHHA 3WEEB 3GP9A 3N5FA 3MDQA 3L7UA 3DKDA 1N36J 1W25A 1NNDA 1KVIA 3S41A 1N33F 2HKEA 1NMNA 1RT7B 3D4JA 5LSRA 2R8KA 4QWBA 4NLSA 3PRDA 1DQAA 4AXJA 3C14A 1KFDA 3NNHA 5C42B 2OHDA 3MX5A 3V2UC 3SJHA 2ITGA 2OMOA 4TYBA 1X4BA 2P9LA 4OKKA 3FFIB 3HSDA 2XY5A 1Q81T 3CMQA 1NLVA 1S1VA 3T1YJ 1OQ3A 4E7HA 1YI2S 5I3UB 1ZS6A 4AT1B 2Q66A 1F9HA 1V4SA 4FYWB 2YCHA 4RWWA 1K1QA 2LQJA 3DXKB 4P2SA 1LV5A 1GAOA 2CGJA 3DXSX 3N01A 2HHHJ 5KFCA 2UUAJ 2N3LA 4MTPA 1U8SA 2MKCA 4JI8K 4BHQA 4DR5F 3FEXB 2ZWHA 1FK9B 5IC6B 1N33K 2DXEA 3NBPB 1IXKA 3R1HA 4DR7F 1RBAA 4BC5A 1DBDA 1Q79A 1A7GE 2ZHBA 4HH1A 3ZEUB 2V2VA 2W8KA 4P71A 1NK6A 2PGCA 3IRWP 3SSRA 2AW0A 2NRTA 1C4AA 1U0HB 4IFVB 3SXLA 3FUYA 2EHGA 3MGJA 4U95A 1S9GB 5EXWA 4LBHA 2I5JB 4CGIA 1S12A 4B08A 1BC6A 3NGZA 2Y1LB 4FNIA 3VQQA 3VGSA 4C8ZA 4F2RA 2GCFA 2G9OA 3AGKA 3VF4A 4K0KF 3TUIC 2MY8A 3NF6A 4G1IA 2R9LA 4FLUA 4OPAA 3OXFA 5AR0A 5J1EB 1S6UA 4O8KA 2LA6A 1W2BM 4O44A 1WAJA 3QMLA 3NVKA 1KOHA 5A8WA 4DR5K 4HUGA 4J37A 2P5VA 5HQ8A 1BG3A 4DR7K 3Q0AA 1RTZA 1U24A 1SH2A 3ADAC 3VAJA 4TNOA 5AXNA 3N28A 5KFAA 3T9NA 4C7QA 3EGVA 1MU2A 4JUZA 2C3YA 5F8MA 2G8KA 3B82A 5KFQA 1YI2N 2MMYA 5E3CA 1VRUB 4OHZA 3RR8A 3ATVA 3DLRA 4RNOA 3BKUA 5FLXY 3ITHA 1KD1T 1KTVA 3ZSWA 5TKWA 3SPZA 2BGGA 4IUFA 2DHSA 2HAIA 1U1OA 2ZDPA 3KJNB 3HPHA 4K0KK 3A8IA 1KQGB 4B3MJ 3UVJB 1IKXB 2V8HA 2DITA 2HNZA 3KJQB 2HFNA 2P9EA 3A5MC 5D77A 2MQMA 3DLKA 4J8FA 3LAMA 3G86A 3FRZA 2WW8A 3J7YI 1S6PB 4ILGB 4C8NA 3E2EA 1HA1A 2C28A 4EO6A 4Z4GA 2LQ8A 4NLGA 4IFYA 3VAHA 4NO7A 3V6DB 2DEJA 3P6YC 1TP7A 3OTOF 1UAXA 1RJJA 2HZCA 1WNEA 2GC8A 2KFZA 3G10A 3NNAA 1S10A 5ETOA 1S3XA 3LP1A 3IG1A 1QZ5A 5AQFA 2FVPA 3ZZZA 3JYTA 2A2CA 2P9PB 3EICA 5DGBA 1FWLA 2GS8A 2GIFA 2P5OA 3FK4A 3ZT0A 3SNNA 2H4WB 1FFWB 4FWPA 2Y0BB 3RVCA 2N82B 4CFAA 2JVOA 4BR9A 2G0IA 2GVDA 3JSMA 3E01B 5KAKA 2NRZA 4KBOA 2HVZA 4Q2LA 1X0FA 1L3TA 1SAZA 1HIYA 3D2FB 1Y64A 1WC4A 1NHVA 3I33A 1NDLA 2CNLB 2MZJA 1IH7A 4WCEL 1Z1ZA 2EG2A 2DKOB 1K44A 4IFEA 2YKNA 3T6BA 3OTOK 1FJEB 4CECA 2IRXA 2PFDA 4U8YA 4I2QA 1Z26A 4TKTA 1VGYA 2WVCA 5ETPA 1UEKA 4RX6A 1Q7YO 4HI1A 5CR4A 3JB9k 5JJBA 2AMCB 4I2PB 4X84A 2WK4A 2KXHA 1OWXA 3BY5A 2MQ8A 1HYSB 1BO5O 3KIOA 4AHRA 3QINA 4A8YA 2PD1A 4FK4A 2UUTA 5DM6L 3RR7A 3DLLL 4X2BA 2D3UA 2RH3A 1RABB 2RNEA 1ILYA 3VEYA 4FJKA 1F6TA 1U1QA 1U1MA 3OTCA 3V6KA 4WE1A 3HHLD 1FF2A 4H54A 1JLFB 3CJ9A 5JS2A 1QHTA 5EX3A 1Y3JA 5GIPA 1S72S 1RACB 3MEEA 1EP4A 2YWKA 1S1UB 2GFFA 3JAMO 3R8EA 2MLZA 5CHCB 2VB6A 3E1YA 3BGOP 3L3VA 4LD0A 5C7PA 2RDDA 3ENOA 4P2FA 2W42A 5B0EA 3A4TA 2JHEA 4XDDA 1IG8A 1PYTA 1MWKA 3QAEA 4NXMF 5BRFA 4TLRA 4YOTA 3CXCM 5AQMA 4FZZA 3ICLA 1HW9A 2OPRB 3H4BA 3O8WA 3DNCA 4X4RA 3AVMA 3PIOL 5J1PA 3ZZUA 2XS7A 3L6QA 4CO2A 4OPKA 4U7UD 1D09B 2W01A 1BHLA 1YXQA 2F40A 4YR0A 3NEKA 4TSXA 4HYKA 3PR4A 5HRNA 1VSLA 1N88A 1EJ7L 2ZWPA 3T3FA 3SQ1A 3R2CJ 4BGBA 2JRSA 2CPZA 4WFYA 4E7IA 5G0RB 3CJ2A 3GZ7A 2M8DB 3MPWA 1T0TV 4KTWA 2YX4A 1RXOB 2HQ3A 3QNOA 3IO1A 4NXMK 4Y34A 1I6JA 4KGKA 3QDKA 4DV1K 4XPEA 2E8AA 3KUHA 1U2VA 4FPIA 1Z6RA 5FDLA 1PAUB 4LF8F 1B7FA 4A8SA 4LUBA 3M3ZA 5CYJA 1K0VA 3LDNA 3F9KA 4XDCA 4CJSA 3DHWC 3RAQA 1J9AA 1OQ6A 3DDNA 2MLYA 1S72N 3ZSQA 3EVWA 4TY9A 3GL1A 2U1AA 4W98A 3VQSA 2F1FA 3AVHA 4A46A 4R8UB 2AV5A 3IRXB 3WEEA 2A41A 2CH5A 4ZCMA 1YIJS 2VDIA 4HHTA 1WBDA 1XNQF 1RT7A 3BYPA 2A1BA 3NRBA 2HMIB 4PUOB 4DV7F 1FEEA 1U1RA 2EWSA 3M6XA 1JXLA 3GV8B 3QIPB 1A0OB 5C42A 2P6SA 3AA8A 3OT9A 1A6LA 3CNQP 3PLAA 4LF8K 4USTA 4KJIA 2FXUA 3FFIA 2WVBA 1YVNA 1IM4A 4JI7J 4RBUA 5HJXA 4DQIA 5JXSA 4NCGB 1UZDA 5I3UA 1ACMB 3D1QA 5GMEA 4RW9B 3LUYA 1UVKA 1YX2A 2QO3A 4B9TA 4MYUA 3MOZA 2CYYA 4DR1F 2BBEA 4UF4A 2E6MA 1ITPA 3KK7A 2UVVA 1N5TA 1OPIA 2QLBB 2MQQA 1WLJA 4BC7A 3WXLA 5LJ5Y 1XNQK 1FK9A 2CPJA 3NBPA 1X5PA 1NJIT 1JB0C 3ZEUA 1IO2A 4DV7K 1WHWA 4ZPAA 3PW2A 1WKLA 2ZH3A 4ZLLA 1NB7A 4WQ5A 1U0HA 4IFVA 4J9VA 3CJQA 2OELA 2HWTA 3HOSA 3LGHA 1S9GA 1ZPVA 2Z2MA 5F1XA 2ATLA 2R2RA 2VG7B 1UW9A 3VESA 1FNMA 2I5JA 4H03B 3N6LA 3KLHB 4DR6J 4Q5VA 1RWMB 1JCFA 2N7CA 2GHVC 3NS7B 5DETA 3RB6A 4M7YA 2E2QA 4PHTX 1DT9A 5L38A 5RUBA 3UR0A 5SWMA 4N7TA 1RCXB 4NLDA 4P52A 3AA5X 3KFWX 3M32B 4DR1K 2RQCA 5JLFA 1YIJN 2M3DA 1NLKL 3A2FA 1N0UA 4DN9A 5J1EA 2GZOA 5ETNA 1OMSA 4RBVA 1IM6A 2VFVA 4H4MB 4CFDA 3KHHA 4DSIA 2WW4A 4CW7B 5CQGA 1F9EB 4QWAA 3FZHA 5AQRA 1RTJB 3OQ2A 3SUQA 2F65A 1P8GA 4WFAQ 3R5BA 4CERA 1FRKA 1U1KA 4CO5A 2VWKA 2WB4A 2LQ5A 4NLYA 2XO7A 3W66A 1VRUA 4CLWA 3GYXB 2AYEA 3CJKA 2R7SA 4IQMA 3RSEB 1I51B 4KHNA 1J27A 2P9UB 4XH5A 3C94A 2W7AA 2IAJB 3TARA 1XERA 4GKKF 4GNIA 3PUFA 4H5NA 2FHMA 2V4JB 4RNHA 2P5GA 4OYAA 3UVJA 5H9FJ 2C42A 1IKXA 5AQNA 2IJRA 3O3FA 3LWMA 3S8SA 1RTHA 4C3LA 4B9SA 2NRXA 3L0QA 3KYLA 1S6PA 1XHZA 3O9UA 2GJFA 4DR2F 1HNXJ 4CF1A 1NGDA 5DMRA 2M7SA 3WNFA 1N5YB 1OO0B 3VQ7A 1PBAA 2XEXA 1EIYB 1KNZA 3WNHA 1V9OA 3V6DA 1KVJA 2FSJA 4GKKK 1A5XA 1VOMA 3G0ZA 3QLHB 5KPRA 1T05B 5IOLA 3MCOA 2P9PA 5CH7B 2FJEB 1CVJA 1NSQA 4MO5A 3H2VE 2V8GA 2OPQB 4CZHA 3PO5A 3NGKA 1GLBG 4HLBA 4UTGA 3FCVA 4ECXA 3T19A 3M2UA 3E01A 5FD1A 3QGIA 1R27B 4RUHA 1FDNA 2MQOA 1HPZB 5CZ1A 1RA7A 3MAQA 1FX4A 3Q8SB 4FLYA 4Z2XA 2R8IA 2KJWA 2NUUG 2PI4A 4QPTA 5F8NA 3BZKA 3W8GA 3OJUA 3I87A 4MYTA 3RBEA 1N6QB 1SL1A 3GILA 3H25A 3K8WA 5DLFA 2R2SA 1FESA 3ZCMA 4X4NA 2A18A 1HNWF 4N77A 3FMWA 3ZZRA 2KM8B 4Y2AA 1WC0A 4QWEA 1SKRA 4RZRA 2QA1A 3IGNA 4HTIA 2HBJA 1S4FA 2NXEA 1P9YA 1T3NA 3K9JA 4J7CA 2HWHA 4ZCLA 3FZLA 1HR0F 5B08A 4AILC 1WC1A 4ECRA 4QW9A 1FERA 4HVJA 1HBMB 3OYMA 4FF4A 3PDNA 2GGPB 2DNGA 4QWCA 4FPBA 1JLFA 3PYDA 2K3IA 3RTVA 2HSTA 4AFFA 4Q8FA 3NH0A 1BQNB 1S1UA 4HTLA 1RTDA 2D69A 1HNWK 1PGZA 2W2PP 3CDAA 3PKYA 1ZBLA 2ZM6F 5KFMA 2X51A 4ILLA 1Y0HA 4ES3A 4JKCA 1LW0A 2UU9J 5JVGQ 3DM2B 3OR1B 4CO1A 2F4VF 2OPRA 4H0XB 3ZNUA 3CCLS 2UVUA 1HR0K 5F9LA 1NSAA 3KXDA 1YF5L 5E3AA 1BHNA 3IM9A 5G4DA 5KFJA 1SBRA 2A3ZA 2LFVA 3ZSVA 2Q1NA 1IWAA 3QIDA 3W62A 4CGDA 2FLLA 4CLKA 4B3OB 5T7LB 3CJ8A 1S9EB 4MJKA 1A5WA 1F5BA 3ENVA 3HZ6A 1ZBFA 3RAMA 1BMQB 1TKXB 1T03B 5G0RA 1I1GA 4LFCF 1QSYA 3M8SA 2R8JA 1QS4A 2VOPA 1ZPWX 2Z8QA 3M2RB 1TU0B 2WUSA 3KK1B 1FKPB 2QX0A 3G2XA 1TKZB 3MUVP 5BR8J 5LMNF 4P9SA 3FCWA 3W64A 3ZZOA 2LA4A 2N7YA 3RRKA 1I5OB 3J80O 4D3HA 1BUXA 1SKWA 2CUYA 3M6UA 1XR5A 3DOLB 3FZ2A 4NB4A 3R6GB 1HLUA 3N4QA 4R8UA 4KHSA 1BWVA 2LEBA 4HKQA 2W7OA 4QS7A 1U0SA 3T6JA 4LFCK 4I6AA 1Q1KA 1U2CA 5D0RA 5HVGA 1BA0A 1VJQA 2QZ8A 1Q4RA 3EVOA 4OLPA 1FFSB 1T9TA 3M9OB 1SC6A 3RBZA 3UD5A 2HFSA 2HMIA 3CCLN 4PUOA 1KLNA 3NF8A 4M41A 3ZSXA 4RR5A 2WZ1A 4ZK7M 2UUBJ 1VK8A 1TFWA 3QIPA 5LJWA 3I8BA 2HF3A 3H20A 5LMNK 4FM1A 4WP9A 1TL4A 2DHXA 2CQ4A 1GLJO 3MD1A 1SB6A 3AD8C 1YJNS 4NCGA 4YOXA 3VAIA 1Q8IA 2WTUA 4TU8A 3TRGA 2AJFE 2DJWA 1HNZF 1J6ZA 3WNGA 3CJ3A 1CXUA 4RW9A 4FWNA 3M8ZA 4A48A 2D0AA 2ACMA 2QMXA 5ETVA 3H2UB 3LP3A 5L1KA 1VSIA 4CIEA 3LGNA 2ZOGA 1YRXA 3CGIA 4E19A 3J7AP 2X3DA 1HHQA 3T5JA 2AHOB 1VC0A 1UFLA 1Q16B 2W41A 2FTRA 4DCHA 2QKKA 5EDWA 2GMJA 4CLSA 2OCEA 3RWUA 2X1FA 4QS8A 1BL3A 4MKAA 1HNVB 4QZVB 2VG7A 3ZO7A 4IRCA 5F8IA 3KLHA 4OMFG 4OVLA 3HHDA 1HNZK 5C10A 4BRMA 1FD8A 3AO1A 2YWHA 1TL3A 3N0VA 3M32A 3PSIA 2O8BB 1S1XB 1KCFA 2FVQA 3H40A 2E2NA 1SL0A 3TI0A 4TU7A 4OYOA 2RRAA 1H72C 1OS5A 4NEZA 4H4MA 1TZ0A 3QT6A 3LA0A 4B9NA 2ZGZA 1A5VA 2FJXA 5LXYA 4UOFA 1HWJA 4CLLA 2R7WA 1RTJA 3S1TA 2RQKA 3MZIA 3CG7A 3C6UA 1QVGM 2V4QA 1AZSB 5MLCV 2A1SA 3HL8A 3BH6B 3GFXA 1YJNN 5HAOA 4A8WA 5C2CA 1N36F 1FFGB 1RT2B 3BJYA 4I7FB 2FGOA 2F5GA 3Q8RB 2GTDA 3QEPA 2P9UA 1B92A 1RWWB 3V1QA 2IAJA 1HYVA 3CQ8A 3ZX3A 1FRIA 2CDQA 2MPUA 2RB7A 5A2QY 2V4JA 4CJVA 5KG4A 3IMQJ 2E1CA 4CHQA 2D41A 1PBUA 2G2YA 2RSQA 2MXYA 1Q7YT 4TVAB 4I9LA 5AFUH 5L39A 1JCEA 2BKOA 2Z58B 2R4FA 1T7PA 5CCMA 3NG8A 5AQPA 3W9IA 3BZCA 1VK0A 2JSXA 2DNMA 2HHHF 5KG5A 4J9SA 1VSDA 2OTLS 2UUAF 3OBYA 4O3SA 2MKSA 1VAZA 1GLFO 4NRUA 1N5YA 2COLA 1N36K 3TX0A 1S7IA 3ID8A 3BGFA 2CJKA 5IWAJ 3F5TA 3GOIA 1EO1A 4CM0A 4X65J 3ZT1A 4FKYA 2IVFB 4CO4A 2PAVA 1XMQJ 1WSIA 2NREA 1S76D 3P8BB 4AXIA 3AJ1A 4DI6A 3QLHA 2XLJA 4DL2A 3AVFA 1T05A 3E9PA 3UW1A 3DYAB 4IG0B 4ALZA 3T1YK 4DV6J 2OPQA 3RJMB 2DIUA 2OJ3A 4DL3A 5HOOA 2DR5A 3EO3A 2BANB 1M5PC 3BDPA 4DN0A 2ZBRA 4J2AA 2ATCB 4K7QA 3H4DA 2HHHK 5E3RA 2UUAK 3NH1A 2QW9A 4H0VB 1DQ9A 2DNHA 4NL5A 3CJ7A 2D7SA 1HPZA 2BE2B 3LGMA 5KT7A 4O23A 1ATRA 1MNEA 2XY7A 4DUYJ 2O8DB 1S97A 1DZ5A 3PG9A 5GVQA 5DDOC 4BG9A 1Y9OA 1N6QA 1QUPA 3QYYA 2X6SA 2XMWA 3VGUA 4KREA 2DRAA 1BOTO 3O4QA 2G8WA 4K5RA 2XMVA 5CD4H 3P45B 4GV9A 2E29A 4AQYF 4EBEA 1Q5VA 1SJRA 3T1HF 3AOBA 1S6QB 1JWWA 4CE9A 4HEA9 2OTLN 3OBIA 1NGJA 4BR5A 4ZTFA 3U02A 4B3MF 1T6DA 4FSVA 1RILA 1FWKA 1JK9B 2FC8A 1VQSA 4B9MA 1EX4A 3VTIA 1EZZB 4WP3A 3SSQA 2RRNA 5HP1B 1X3MA 1HBMA 3BR8A 3L3CA 2CADA 4WIQA 2E4LA 2F8SA 2GGPA 4JS4A 5LSOA 5DQIA 2JX2A 5AQIA 4FK2A 3AH6A 5KFHA 4OLAA 3I4HX 4F67A 4FW1A 3M2VB 1D8YA 3VALA 2JJ4D 2QEXS 4ZVFA 1I39A 2IPOB 3G4SS 4J2BA 2V8VA 3EZOA 5LL6d 3T1HK 2X1GA 1FXDA 2M9KA 2ZBPA 3FC9A 3C7NA 3FZBA 3DM2A 3OR1A 5FRNA 1K73O 4K4TA 4DTOA 3J7YP 5KFOA 4B3MK 1X31C 4J9KA 3CVKA 4GMJB 4QIEA 4ZVSB 4YQWA 3O4NA 4BRPA 1QJHA 2JEIA 1RAJA 4C8LA 5KFSA 1CJUB 3GBTA 1TUWA 4DQSA 1SC3B 3MWBA 2ZE2B 3PTWA 2I7NA 5I9EB 2L3MA 2QTWA 4B3OA 2HZAA 2DH7A 5T7LA 1FVQA 3WXKA 4NCBA 2J9DE 1S9EA 1BI4A 3VQ5A 2ASPA 5C2GA 2J0XA 2A6AA 2DH9A 3VA3A 5DZ6A 1RDBA 3CD5A 4ZPBA 3J81j 1YGYA 1CJVB 3GIJA 1T03A 4OI3A 1Q8BA 2AP6A 4N47A 1KVKA 2B4VA 1OKJA 1BD6A 4WP8A 4HTJA 2DGVA 2XMKA 4RUBA 3OYJA 3NGIA 1N0VC 4QR2A 4ZPDA 2YKMB 3AJ2A 2DR8A 3EDQB 1QAXA 4WK3A 1IBMJ 4CZCA 3AGRA 3M2RA 2CVEA 4YOUA 3M8QB 1UVIA 4XO0A 3G6ES 5JMVA 1FKPA 5IT4A 4CD1A 4GVBB 4ZVGA 4L3KA 2DY9A 4DEZA 3ZNJ1 5GADP 5I4MA 4FJGA 3NCRA 3BM7A 2V34A 2CQDA 2NR0A 4F26A 5K8NA 5DG8A 3SUOA 4K59A 5CCLA 5LMUJ 3UN2A 1ZAWA 4F4WA 3CB4A 1O5JA 4QOTA 3DOLA 3CMES 3R7SB 2NZCA 1LK5A 1W2IA 5H1SQ 1NPRA 2QEXN 3VQEA 3MN9A 5F0UA 3G4SN 2JC0A 4DSEA 4WZMA 4V19X 1E6VB 2HHTA 5DDPC 4K41A 4OZ0A 1RAEB 1T3OA 3KUEA 3A8YA 3P38A 3A5OC 1J2VA 2CWXA 1NGBA 2FB0A 5KRSA 3D0PA 5EWFA 4DTUA 1J5EJ 3IBCB 3HP6A 3QBXA 4I4BA 1D5AA 1QVFR 4PPDA 4DS5A 3DAWA 5F3ZA 2CVIA 3V9SA 2B7BB 3ETOA 3M1VB 4FO0A 1RBVA 3D6FB 4A8KA 1ASVA 2B0GA 2O4IA 4CI6A 3F0NA 3LP2B