2GUIA

Structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
ITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III epsilon subunit
publication title Structure and Function of Cyclized Versions of the Proofreading Exonuclease Subunit E. coli DNA Polymerase III
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2guiA00
4Z4GA 1TL3A 3DLRA 1TL1A 4IFYA 4RG8A 3VQ5A 5FRMA 3IRXA 4CJPA 4AILC 4IFVA 1BHLA 3NCIA 1U49A 1D9FA 1NK0A 1B92A 3PX4A 3AVKA 3D45A 4MQ3A 4O4GA 4CEZA 3HVTA 3C6TA 1HNVA 3ITHA 4M3UA 2Z1HA 4CJ3A 3I8DA 4E3SA 4DTOA 5HRSA 1NK9A 2HHQA 4IDKA 1HYSA 2G8VA 1IKWA 3AO1A 2YNGA 4EP4A 3OY9A 4J2EA 3PV8A 4N5SA 4CJSA 3WNGA 4CECA 1RBRA 2Z1IA 3ZSOA 3NDKA 1BQNA 2HHSA 2D5RA 3WNHA 3VQQA 4KHNA 4DU3A 1RTDA 1QSYA 1IKYA 3AVBA 1HRHA 3MEGA 4OJRA 1SV5A 1WSHA 4Z4HA 3L2WA 4FLXA 4B9MA 3G10A 2Y1IA 1VSJA 1SKRA 4DSIA 4RW6A 2RN2A 4W5TA 4BE2A 2OYQA 2F8SA 4C8KA 4EZ6A 1NK8A 4FJGA 1L3UA 4DFMA 1VSDA 1IH7A 1L3SA 2I5JA 4O0JA 4KAZA 1FKOA 2YNHA 1WAFA 2O4IA 4M3WA 1HNIA 2G8UA 1ZBLA 1S9EA 2VG7A 4CIGA 4ZHRA 4W5QA 3OYEA 4KTZA 4CJVA 4RW8A 3QEWA 3HM9A 4DQRA 4NCGA 4HUFA 2E4LA 1BIUA 3B6OA 1EETA 3HP9A 3VQCA 4DTMA 3S3NA 3OYJA 1ASVA 2KQ2A 3AVNA 4NYNA 3P1GA 3SQ0A 1KRPA 2O4GA 2ZQBA 4CFBA 4J2DA 1LV5A 5KRSA 3ZSYA 1L5UA 1Q9YA 3AVMA 3LP1A 4B9LA 2KZMA 4DTJA 4KKOA 1RTIA 4FW1A 3QO9A 4J2BA 4W5NA 3SPZA 1UA1A 1B9FA 1S5JA 3PX0A 4E7IA 3A2FA 2HHTA 2HMIA 4FJXA 2X6SA 4TSXA 4E19A 5C25A 3LP2A 1YTAA 3OYAA 1RNHA 2IGIA 3RMBA 4ID5A 3ULDA 4E7HA 4YNQA 1X9WA 3ZCMA 2HHVA 1VRUA 4DF8A 2ZD1A 1LWFA 5DMRA 1XI1A 2B5JA 2BDPA 4CHPA 5JS1A 1RTJA 1ZBFA 1D9DA 2KFNA 4H8KA 2BANA 1JLFA 4KHSA 1S1UA 3C95A 4CIEA 3V9UA 1UOCA 4DU4A 1C6VA 4OPKA 1C0TA 1EP4A 3OS1A 4M3XA 3VQ4A 1RBTA 2XHBA 4QCLA 2KTQA 3AA3A 3M8SA 1TKZA 3HPHA 2DFFA 3OYIA 4ELUA 1W0HA 3THVA 3QEIA 4Z4CA 4EZ9A 2JGUA 1D8YA 5E41A 4M42A 2QKBA 1SL2A 1EKEA 3L2RA 3U3GA 3QETA 4C8MA 3TAQA 4KI4A 4FW2A 1HPZA 4KV8A 3V9XA 4Z4IA 1VRTA 3OJSA 4IG0A 3QNNA 3AVJA 3T3FA 4B9UA 3DI6A 1S6QA 2YKNA 3D0PA 3ZSQA 3K5NA 4C8LA 4FJJA 4CGIA 4BE1A 4W5OA 4FZXC 3AO2A 1LAWA 4CEBA 3FFIA 3JYTA 4HTUA 3AO5A 1SKWA 2OA8A 4PA1A 2DFHA 1T8EA 1IG9A 1C0MA 4PY5A 3HPOA 4CIFA 3O4NA 3SV3A 2HW3A 4DWIA 4DSKA 3V4IA 3ZT4A 1QQCA 1YTUA 3TAGA 1DTTA 2R7YA 3QINA 5FROA 3HPGA 1JXBA 4FVMA 3VQ6A 1YVUA 4FLVA 1KTQA 2GV9A 3AVFA 2VWKA 1BIZA 3HXMA 3LDSA 4CJEA 2G8IA 2XY7A 1RT1A 3BDPA 3S3OA 3TAPA 4CGDA 3SPYA 3AA4A 4BWMA 3I0RA 1ZYQA 4DFJA 3UIQA 4FLYA 3LZJA 3OYGA 2D0BA 1FK9A 2VG6A 4HUGA 2GBZA 3V6DA 4IBNA 3NGZA 4LSLA 3OYCA 1TK0A 4Z4EA 3LP0A 5J2QA 2DY4A 4LH4A 4CESA 1KVAA 4CK3A 3OYMA 2HHWA 3PO5A 3DLEA 4DFKA 3M8RA 1VSLA 1NK5A 3ASMA 4Q5VA 1NJXA 1WN7A 4DTNA 5D3GA 4H4MA 3AVIA 4CGJA 3DLKA 1NKEA 3S3MA 1TKTA 1L3TA 1KFDA 4RW4A 3IG1A 4CFCA 1C1CA 5CZ1A 3MEDA 2X74A 4G1QA 1XHXA 1QE1A 3NF6A 1X9SA 4NCBA 3B6PA 4CF1A 3KD1E 1A5WA 1IKXA 3CYMA 3SNNA 1TK5A 3NAEA 3SUOA 3VQBA 1X1PA 1T7PA 3SUQA 4F2SA 1VSIA 3C6UA 1LWCA 1RT7A 3OYKA 2YHBA 4AHUA 4CJQA 5SZTA 3KLGA 4DTUA 3SQ2A 3MXMA 1JLAA 3P83D 3V1RA 5CZ2A 1DLOA 5HBMA 4CHYA 1TKDA 4KPYA 4DU1A 5J2MA 3QESA 2HNYA 5J2PA 1J54A 1UAXA 4E7KA 3CFPA 4B3OA 4DFPA 3HT3A 1HQUA 1RBVA 3OYDA 1U04A 5HRPA 3SQ1A 4JLHA 4KTWA 4B08A 3RTVA 1MU2A 3DYAA 1LAVA 1HMVA 2EX3A 4NYFA 3NFAA 2KZZA 1G15A 4GVMA 3M8QA 3KK1A 3K59A 1SL0A 2PY5A 1RDAA 1S1WA 3K5OA 4FJLA 3L2UA 2P51A 3SYZA 1WLJA 5CYQA 2IAJA 2PZSA 2FBXA 1GOBA 3L3VA 4M3RA 4HVJA 1WSJA 4CF8A 5KTQA 3I0SA 4DS5A 4DF4A 3DLBA 3L2QA 3HJFA 3O4QA 3SQ4A 2F96A 1T05A 1RDCA 3TAFA 4KREA 4EP5A 4FK2A 4CGHA 4AHCA 4CEFA 4HCCA 4FJIA 3ZSZA 1NOZA 1U4BA 3SZ2A 4CFAA 3HYFA 1CLQA 1BGXT 3EY1A 3QEVA 3LPUA 4DG1A 1REVA 3K58A 4B9VA 1A5XA 2OZMA 4KFBA 3MXJA 4OKKA 4FLUA 4B9NA 1LW0A 3KLFA 4FLWA 4N41A 4UQGA 4B9SA 3OS0A 3DOKA 2QKKA 4FXDA 1GOCA 1B9DA 1U45A 1CZ9A 3F9KA 1ASWA 3DRPA 1J53A 1I39A 2IDOA 4K8XA 2VG5A 3SUNA 2KFZA 3NH0A 4DSFA 4GW6A 3TI0A 4KHYA 3K5LA 3ZT3A 3NBPA 4Y1CA 3NGYA 3VQ8A 1WSFA 5FDLA 3QNOA 3KTQA 4DSJA 4CEEA 4B8CA 4FLZA 4ICLA 1S9GA 1UWBA 4O0IA 3RRHA 4I2PA 1KLNA 1QSLA 4FJ7A 5HLFA 3TANA 4BACA 3E01A 1HQEA 3VQ9A 4E7LA 1VK0A 1KLMA 1WNSA 2XRIA 1FKPA 4FM2A 3DRSA 3KKSA 4O5BA 3VQAA 5I3UA 3KJVA 4DSLA 4Z4FA 1JKHA 3M8PA 3S9HA 1RDBA 3OYLA 3AA5X 3ZT2A 2P5GA 2XY8A 1BI4B 3F73A 1SL1A 3HL8A 3U6FA 2OZSA 3NGIA 4ZTJA 4FM1A 4CJWA 3EZ5A 4M3YA 4E89A 1QS4A 3MEEA 2NUBA 3LWMA 4LD0A 4CF9A 2X78A 1CXUA 4OGEA 2P5OA 3ZSVA 1RBUA 1FXXA 1C1BA 4JS5A 3V1QA 2OPPA 4CHNA 4LSNA 4W5RA 1DTQA 4AHRA 2PYLA 4OPJA 4M41A 4JS4A 4FZYA 2G8HA 4FJKA 1L3VA 4FJNA 4M3TA 3WNEA 4ELVA 3OYBA 1RT4A 4F8RA 4MFBA 3ZT1A 3O3HA 4E1NA 3SV4A 4CJ5A 3TAEA 4FZZA 2Z1GA 1JXEA 3KK2A 1RT3A 3CFOA 3QIOA 4XIUA 4H4OA 4PUOA 2HVHA 1VSFA 4CF0A 3NH2A 3DLHA 4L8RB 2HHXA 2B4JA 1A5VA 2DTUA 4FJMA 3H08A 4KTQA 4AHTA 4HHTA 3MXIA 2Q3SA 1NKCA 4QOZB 4DMNA 3VA0A 2EHGA 3AVAA 3RMCA 3CFRA 3L3UA 4O44A 1VSKA 4CJKA 4IKFA 3LZIA 1JLCA 1Y97A 3ALYA 3SI6A 1Z26A 2RKIA 3KIOA 2OPRA 2XO7A 4OKJA 4I7FA 4PWDA 1ITGA 3AO3A 3U3YA 2FC0A 1TGOA 5KGXA 4KRFA 1WSEA 4CERA 1RT5A 4BE0A 2QXFA 1TAQA 4E0DA 4N76A 2ITGA 4M3ZA 3HP6A 4Z0UA 1N6QA 4F3TA 3NE6A 1Z25A 1XHZA 4BDZA 2D0CA 3LP3A 4CJLA 4FK0A 5EU7A 1D5AA 3JSMA 3QEPA 3AO4A 1HYZA 1N5YA 3V9ZA 4CE9A 3CG7A 1KCFA 5J2NA 2W42A 4KB1A 4F2RA 1RDDA 1QSSA 3OYFA 1KSPA 2LSNA 4CEQA 3QERA 1VSEA 3V9WA 3NHGA 4FJ5A 1TVRA 3T1AA 4CJTA 2G8KA 1WAJA 5HROA 3SJJA 3NF9A 2ZE2A 3RWUA 4FYDA 1QHTA 1KFSA 4AHSA 4DQPA 3EYZA 3CM6A 3VA3A 3KLIA 4CJUA 3AVHA 3IS9A 3KKRA 2HNZA 4FJ8A 5K14A 1WSIA 3LANA 4HUEA 2E6LA 3NH1A 2IS3A 4I9LA 5KGWA 4DTRA 2DFEA 4KHUA 1C0UA 3TARA 3K57A 4PQUA 4DTXA 3HVRA 2FBYA 4OVLA 3V9SA 1KVCA 3KLHA 2D0AA 2X6NA 1BQMA 1XC9A 1NJZA 1NJWA 1HYVA 3K2PA 3K5MA 3QEXA 4E7JA 5CY4A 4CK1A 1NKBA 1BL3A 2Z1JA 3LAMA 4QAGA 3VQDA 4CJFA 4DLEA 4DSEA 4CK2A 2YHAA 3ZSXA 4JRPA 2XY6A 1RCHA 3MECA 5KRTA 2ATQA 3DRRA 4FJHA 4B8AB 3PY8A 4FJ9A 4KI6A 3L8BA 2OPQA 4CEAA 2HB5A 2JLEA 3AVLA 3KK3A 4CJ4A 1U48A 1TK8A 4CF2A 2WOMA 4C8NA 2B6AA 4Y1DA 1TKXA 5SWMA 3OYHA 1ASUA 3ZT0A 1GOAA 1RILA 3G0ZA 4CGGA 2HNDA 4RW7A 3AA2A 1ZBUA 5DK5A 2OPSA 1R0AA 1RTHA 1S1XA 3DLGA 1RBSA 4I2QA 3VQPA 4CHZA 1RT2A 3L2VA 1BI4A 4F4KA 4KHWA 2G8WA 3TWHA 1LWEA 4B9TA 4ID1A 5JS2A 1JL1A 4DQQA 3RRGA 1EXQA 1KVBA 3OVNA 4YFUA 4FCYA 3T19A 2YKMA 1Q9XA 1ZBIA 4NCAA 2YNFA 4WE1A 1JLGA 3TR8A 3PUFA 4FM0A 2FBVA 4IG3A 2WONA 3DOLA 4E1MA 4FLTA 2PYJA 5CYMA 4OKEA 4CEOA 4DS4A 2G8FA 4J2AA 1HJRA 2VWJA 3RMAA 3QLHA 3AVCA 5KI6A 1BCMA 3VN5A 3SCXA 1TAUA 4LH5A 2FBTA 4CHQA 2E6MA 3PX6A 1O1WA 2IC3A 1JLBA 1IO2A 3AV9A 3NF8A 4N56A 3O3GA 3CQ8A 4C8OA 1VSMA 4GMJB 1NK4A 3TABA 2RPIA 1BCOA 1I3AA 1JLQA 4KO0A 4BWJA 2BGGA 1S6PA 1NJYA 3RMDA 5C24A 3ZSRA 4I9QA 1TV6A 4LY7A 1YT3A 3V1OA 4F3OA 1F21A 1S1TA 5HRRA 4ELTA 3VQ7A 4DTSA 4N47A 2YNIA 4DQIA 2A1SA 3KLEA 1J5OA 4M45A 3ZSWA 3OYNA 4KHQA 3LALA 2RF2A 4DQSA 3V81A 1W9HA 3WNFA 4BDYA 2F8TA 4CJRA 2P1JA 5C42A 1Q8IA 1C1AA 3P5JA 4K8ZA 4BDPA 1CXQA 1XWLA 3CM5A 1J9AA 1T03A 4OLAA 3C94A 3AVGA 1S1VA 4JRQA 3HSTB 3O3FA 4O55A 3HK2A 3VQEA 4CEDA 4CCHA 1JLEA 2A1RA 1EX4A 4AHVA 2HVIA 2KW4A 1IKVA 3LAKA 1X9MA 1WSGA 3OJUA 2GUIA 4Q0BA 3HO1A 1NOYA 3QIPA 1VSHA 4CGFA 2AJQA 1BISA 2BE2A 3ISNC 3MAQA 3TAMA 4R5PA 4CFDA 1SUQA 2IOCA 4DLGA 5J1EA 1QTMA 5HRNA 3SUPA 5I42A 1JL2A 3LWLA 3LPTA 3RR7A 3KD5E 4OGCA 1NK6A 3OS2A 3BGRA 5T7BA 2XY5A 4KB0A 1UA0A 4OLBA 5FRNA 1CZBA 4FK4A 3PO4A 1LW2A 1NK7A 1K6YA 4RW9A 2HHUA 1RT6A 3RR8A 3IAYA 1ZBHA 4AH9A 1U47A 4DTPA 2ETJA 4HCBA 3DMJA 3DM2A 5HP1A 2Y1JA 4ZTFA 2QK9A 4CHOA 2YV0X 3NF7A 1SKSA
chains in the Genus database with same CATH superfamily
4Z4GA 4RG8A 4IFYA 2A40A 4I6MA 2HBKA 4AILC 3L6QA 5FPEA 4M63C 3HVTA 3S41A 1SS6A 4E3SA 1NK9A 3CC4N 4IDKA 4CZJA 3WUHA 3TSUA 2FSNA 3OY9A 4FWQA 3A5NC 3P38A 2Z1IA 2NRZA 2HHSA 5M1FA 2D5RA 4YOWA 4DR1K 1QSYA 3AVBA 4Z4HA 1C0GA 1WSHA 3FGUA 3VEWA 4FLXA 4B9MA 4OPHA 4EHTA 4H03B 2OYQA 3SAHA 1NK8A 4DFMA 4O0JA 4KAZA 3QBXA 2O4IA 4M3WA 1S9EA 2VG7A 3QEWA 3HM9A 3VEXA 4CZFA 4NCGA 2E4LA 3B6OA 1EETA 3HP9A 1ASVA 3B8AX 3TU5A 1OVQA 5GAHP 3ZSYA 4JKEA 4B9LA 2QI2A 4KKOA 3FZKA 3SPZA 3CF5L 3UKUA 3PX0A 3A2FA 4BQZA 3TTDA 3ZX3A 4YOTA 5C25A 3LP2A 1RNHA 4A2BA 1M1KO 2PAVA 1GLDG 3ZCMA 2HHVA 4DF8A 3C65A 2O8EA 1U6ZA 1VQNN 3AY9A 3CCSN 1MDUB 2F9WA 1D9DA 2BANA 3C95A 4JYAK 3CI5A 3ENOA 4UY8O 3OS1A 4CD1A 2O8FB 3HPHA 4JI4K 1OH7A 1WOQA 4EZ9A 1HKBA 1D8YA 2QKBA 1M90O 3QETA 1E4FT 1GLBG 4IG0A 4B9UA 3VGMA 1CZAN 3AO2A 1SKWA 3LDPA 4GV6A 1XQSC 4H5NA 1T8EA 2YI1A 4XH1A 4XH4A 2HW3A 4DSKA 1DTTA 2R7YA 1ATRA 3CCUN 1E4GT 2GV9A 3HXMA 2G8IA 3FZMA 3TAPA 1HNXK 1BO5O 4BWMA 3I0RA 2GUPA 4JK7A 4BC4A 3CMAN 5M1QA 1FK9A 2VG6A 4A59A 3LP0A 5J2QA 2GEMA 3DLEA 1IG8A 3M8RA 1NK5A 3JAMO 3ASMA 2ZM6K 4NXNK 4DTNA 2FSJA 5D3GA 4CGJA 1L3TA 3S3MA 1TKTA 4YOXA 4RW4A 4DR4K 3D7EO 4G1QA 1QE1A 4NCBA 2YJFA 3CYMA 4LF4K 3SNNA 1LOTB 3MN5A 4AF1A 2E8AA 1T7PA 3SUQA 1VSIA 3KWGA 3H1VX 3V1RA 1DLOA 4KPYA 2F9TA 4FPAA 1Z05A 3ENBA 4K0KK 2HNYA 3W3DA 4BVPA 3SAGA 4DFPA 1W7AA 1HQUA 3ZYYX 1U04A 5AQPA 3DWLA 4WF9L 5ELZA 4NYFA 1VQPN 3K59A 4FJLA 3D2FB 3SYZA 5C12A 3K0SA 5LY3A 1WSJA 3GL1A 4DS5A 2QM1A 4DV2K 2GWJA 5AQYA 1NGAA 4JI2K 3TAFA 1GLLO 3O6WA 3F9MA 2O8FA 3LPUA 3ZX0A 3O9SA 1REVA 4FLUA 4B9NA 3WXKA 3OS0A 1U45A 1CZ9A 1I39A 4K8XA 2KFZA 5BRDA 4JI7K 3TI0A 4BRFA 4DQ8A 5FDLA 1NGGA 4X62K 3CXCM 3ENHA 4ICLA 3RRHA 1KLNA 1QSLA 1WB9A 4BACA 3E01A 1FKPA 3ID6A 3DRSA 3VQAA 2P9LB 4MLEA 3KJVA 3S9HA 2P5GA 2Q0UA 3G6EN 1BI4B 5AQLA 2QWQA 2OZSA 5H1SQ 3NGIA 3EZ5A 1QS4A 3MEEA 2NUBA 4OGEA 3ZSVA 2HBLA 5GAGP 4W5RA 4FJKA 1T3VA 4M41A 3QMLA 1L3VA 4ELVA 2W6LA 4MFBA 3ZEUB 3CJBA 3KK2A 3MX2A 5KPRA 3LM9A 4H4OA 4PUOA 3NH2A 3VPZA 4OX9K 2DTUA 4HHTA 3MXIA 2Q3SA 5BR9A 4BC3A 2D4WA 2VGMA 2W40A 3CFRA 4JEPA 3I55N 2JWLA 1Z26A 2RKIA 3O4WA 1FW6A 3EE9A 4OKJA 4PWDA 1ITGA 3PLAA 4B3MK 2D1KA 4BDZA 3O80A 4FK0A 4WQ5C 3CJ7A 3V9ZA 1Q82O 5EX5A 1KCFA 2W42A 4F2RA 5BN9A 1VSEA 3NHGA 1VQMN 1TVRA 3CQYA 3D2FA 4K42A 2ZE2A 2QWRA 3RWUA 4QS7A 1KFSA 4FWKA 1QQOA 5CR4A 5MLCQ 1XMOK 3BF1A 2ASPA 3KLIA 3TSQA 4CJUA 1VQ9N 1HNWK 4HUEA 3R1XA 2E6LA 1K9MO 2IS3A 4CZGA 2DFEA 4KHUA 3TARA 5GIOA 3ULEB 3E9OA 2X6NA 3VMFB 1XC9A 1KD1O 1NJWA 1HYVA 3QEXA 4E7JA 3E9PA 4CJ7A 4QAGA 2Z1JA 4BQLA 4DSEA 4JRPA 3L4QA 2E2PA 3MWTA 3DRRA 4BR5A 3DLLL 4KI6A 5M1PA 2OPQA 4CJ4A 2QEXN 4FVUA 1GOAA 1RILA 4CGGA 2A41A 4RW7A 2P9LA 1ZBUA 1R0AA 5KPZA 4KHWA 1EQYA 1BI4A 2JWKA 5A2QO 1LWEA 4DQQA 1KVBA 3AAPA 3T19A 1YIJN 1JLGA 2P9NA 4J8FA 4LF5K 4IJNA 3DOLA 2VWBA 4CEOA 2G8FA 4PL7A 3RMAA 3AVCA 5KI6A 5LJVA 3SCXA 3ZEUA 4FOIA 4LH5A 2FXUA 5AQZA 4CZIA 2FBTA 2E6MA 4BRKA 4BG9A 1NK4A 1VQKN 2RPIA 1I3AA 4KO0A 2PBDA 2BGGA 3ID8A 3ZSRA 5AQQA 3ZX2A 1QZ6A 1F21A 4DTSA 4DQIA 1W97L 4BG8A 3WNFA 4LF9K 4CJRA 3P5JA 4BDPA 1R59O 1J9AA 2E2QA 4OLAA 4LF6K 2HSTA 4JRQA 4CEDA 1JLEA 3BP8A 4AHVA 2A1RA 4MLHA 5AQSA 1X9MA 4KH6A 3RSEB 2AJQA 1VSHA 4JI0K 1BISA 5FLXO 2BE2A 3MAQA 4WFBL 3UB5A 2IOCA 5AZIB 3THYA 1JL2A 3LWLA 1XNRK 1ILYA 4OGCA 1EO1A 2D0PA 5LL6Z 3OS2A 4XEIA 4C23A 5FRNA 1CZBA 1LW2A 3TTFA 1K6YA 3THWA 3A8YA 1U47A 4DTPA 3J8AA 3DMJA 1ZXOA 1RGIA 3FR0A 4JD2B 3VESA 4H0TB 4BR9A 1U49A 2HOEA 1B92A 3D45A 4CEZA 4MQ3A 3FZHA 4M3UA 2Z1HA 4DTOA 1IV0A 5HRSA 2OTJN 1HYSA 3AO1A 2YNGA 4EP4A 4K25A 2UYTA 3R6MA 3PV8A 4N5SA 5GIPA 2YHWA 3NDKA 2VQEK 1BQNA 3SK3A 3WQTA 3VQQA 4WCEL 2D0OA 4DU3A 1RTDA 4KHNA 1E3MA 4FSVA 1IKYA 1HRHA 3KZBA 3MEGA 4OJRA 4AM6A 4W5TA 5JLHA 1VSDA 5AQUA 4CIGA 4CJVA 1TUUA 4DQRA 4DTMA 3VQCA 4BRCA 4FWSA 3S3NA 3OYJA 4NYNA 3P1GA 3O5BA 2O4GA 2A3ZA 2RE2A 5EY4A 3HTVA 2Q1NA 3LP1A 5GAEP 2KZMA 3IKMA 4FW1A 4YHHK 3QO9A 1UA1A 1B9FA 2KLAA 4E7IA 2HMIA 4FJXA 2X6SA 3CCRN 1SAZA 4FWPA 2IGIA 3GBTA 4E7HA 1VRUA 2ZD1A 1LWFA 4WYBA 1VHXA 3D6RA 4GVEA 3EL2A 4CIEA 1IBKK 3FE1A 1C0TA 3SAFA 3UKUB 1DGKN 2XHBA 1RBTA 3H45C 1LCUA 3OYIA 3THVA 1YJ9N 1YF5L 4M42A 5E41A 3U3GA 4C8MA 4F9OA 3RSEA 1VRTA 3DI6A 1S6QA 3D0PA 3OHRA 5AQKA 3K5NA 4C8LA 5AZIA 1LAWA 5E84A 4CEBA 3CPEA 3FLCO 2OA8A 3SLCA 1IG9A 1N33K 4PY5A 3H1QA 3GG4A 3ZT4A 3H46O 5F2RA 1RFQA 4BGBA 1JXBA 4FLVA 1KTQA 3AVFA 3LDSA 1C0FA 4JD2A 1RT1A 1NGCA 3S3OA 3CHWA 3SPYA 4DFJA 1KAZA 4EFHA 2GBZA 1TK0A 1K8KA 2DY4A 1KVAA 5JVGL 1VSLA 3CCQN 1WN7A 3AVIA 1NKEA 4CBUA 1KFDA 1N8RO 5CZ1A 1XHXA 3NF6A 3M1FA 3B6PA 5C2DA 1A5WA 4LFCK 2O8CA 1LWCA 1RT7A 4HWIA 5SZTA 2QWNA 4DTUA 5BPMA 4CHYA 4B1UB 1TKDA 3N4PA 5BPLA 1NGEA 2P9UB 5J2PA 1J54A 1YUWA 5FPDA 3SQ1A 2YHYA 4KTWA 1JCGA 4WQ5A 2WTUA 4YORA 1G15A 1N36K 3M8QA 5EXWA 4A61A 2PY5A 3K5OA 1K8AO 2P51A 2Q0RA 2WBNA 5CYQA 2IAJA 2NZTA 3J7AP 4CF8A 5KTQA 4DF4A 1OH8A 3O4QA 2F96A 1T05A 1Q81O 4KREA 4JHDB 4EP5A 4CGHA 3C6HA 1NOZA 4BGAA 1QHAA 4CFAA 4JI8K 4CZKA 1O13A 3C7NB 4KFBA 4OKKA 1LW0A 3EKUA 2RHKA 3A5MC 2QKKA 3MX5A 1B9DA 3F9KA 3MDQA 5F0XA 4MDBA 4JI5K 5JLFA 3CJCA 1QQNA 2A6AA 3QNOA 4DSJA 3NGYA 4G9ZA 1WSFA 5AFUH 4BRQA 5AQTA 5LMNK 4CEEA 1T6DA 1NBWA 4FLZA 1S9GA 4O0IA 3EE8A 4FJ7A 3TANA 1HQEA 1VK0A 1BOTO 1WNSA 2XRIA 3VGLA 2P9SB 1KAYA 3KKSA 4DSLA 5KQDA 3M8PA 3OYLA 3AA5X 3C6AA 1YXQA 3ZT2A 5BREA 3F73A 3U6FA 3CCJN 4E89A 3IUCA 3LWMA 2X78A 1ATNA 5IWAK 3E9LA 1RBUA 1C1BA 4JS5A 3V1QA 2OPPA 2A5XA 3HM8A 3TSPA 2ZF5O 3UKRB 4OPJA 4IOAL 5LMUK 4B1ZA 3IMXA 4O5FA 3IDHA 3VF6A 3NVKA 3OYBA 1RT4A 5AQWA 3ZT1A 3SV4A 2IVNA 1JCEA 2QWMA 1JXEA 2Z1GA 1RT3A 3CFOA 1VSFA 4L8RB 3R3LA 2HF3A 2HMPA 3VA0A 4H5TA 1SZ2A 4V19S 3L3UA 5AQXA 3ALYA 2OTLN 3KIOA 4I7FA 3AO3A 3U9ZA 2FC0A 1TGOA 4BROA 4CERA 4YOYA 1RT5A 3HI0A 4E0DA 4LF8K 4M3ZA 1N6QA 1BUPA 1Z25A 2P9UA 3QFUA 3VTHA 3NE6A 4CJLA 4LFBK 1D5AA 3QEPA 4WQ4A 1Q7YO 5J2NA 4KB1A 3OYFA 3V9WA 3LDQA 1WAJA 3SJJA 3NF9A 2GELA 4FYDA 1QHTA 4JHDA 4PHTX 2NRXA 3KKRA 2EWSA 2QWLA 3LANA 3NH1A 3T69A 4DTRA 3R8EA 1C0UA 3C7NA 4X65K 4WFAL 3HVRA 2FBYA 1KVCA 5TKYA 1NKBA 4CK1A 1T6CA 4PL8A 4CJFA 4FL9A 2YHAA 3ZSXA 1Z6RA 5KRTA 4FJHA 4B8AB 2E1YA 1DT9A 1TK8A 4A62A 3QDKA 3OYHA 2VQFK 3FZLA 3G0ZA 2P9SA 1RTHA 4I2QA 1S1XA 3DLGA 4CHZA 1X3MA 4B9TA 4ID1A 4BRGA 1KAXA 4FCYA 2YKMA 1KXPA 4NCAA 2IVOA 4IO8A 4LF7K 4WE1A 3LM2A 3UKRA 4BRAA 4E1MA 2P9IB 1HJRA 1NLVA 3F2KA 1TAUA 3VETA 3L0QA 1EWQA 2IC3A 3AV9A 3A5LC 3NF8A 1VSMA 4GMJB 2P9NB 1BG3A 2NRWA 1BCOA 4BWJA 1JLQA 2Q36A 2O8BB 4BR4A 1XMQK 4I9QA 4F3OA 4ELTA 3VQ7A 4N47A 3TTCA 4A5BA 4HTLA 3V81A 2NRTA 2F8TA 4IFEA 2E20A 3VEZA 1Y64A 3O08A 1VQLN 1T03A 3SBTA 4JKAA 3C94A 3AVGA 1S1VA 4CD3A 4O55A 3I8BA 4CCHA 4X64K 3LAKA 5BPNA 3DAWA 4CGFA 3ISNC 1JCFA 3TAMA 3RR7A 1QTMA 5I42A 2QWOA 4OLBA 1UA0A 4DV4K 1NK7A 4RW9A 3RR8A 4AH9A 2ETJA 4BRLA 3DM2A 4ZTFA 4CHOA 2QXLA 2YV0X 2WUSA 1SKSA 3DLRA 1TL1A 3DJCA 5JVHL 3IRXA 4CJPA 4IFVA 1BHLA 3NCIA 3THYB 1NK0A 1NU0A 3AVKA 4B3TK 4O4GA 3C6TA 1HNVA 3ITHA 3THWB 3CJAA 3LDLA 2G8VA 1IKWA 4JNEA 4CJSA 4CECA 3ZSOA 4YOUA 1MWKA 3WNHA 5ADXA 1SV5A 3CETA 4JKCA 4DKWA 5I9EB 3CD6N 3G10A 1VSJA 4A57A 1J6ZA 2RN2A 3C0BA 4RW6A 2F8SA 2I5JA 2F4VK 1FKOA 2YNHA 4DR7K 1YJWN 1HNIA 2G8UA 1ZBLA 4H5RA 4KTZA 4RW8A 3CCEN 1NGBA 1BIUA 4LFAK 2P9IA 4NXMK 1YI2N 2V7ZA 1V4SA 3SQ0A 1KRPA 4CFBA 4J2DA 1LV5A 3BY5A 1L5UA 5AQJA 3AVMA 1X9JA 2DPNA 3LL3A 2BH1A 2HHTA 4TSXA 4E19A 2O8BA 4IEEA 4ID5A 4JKDA 3ULDA 4BRHA 3RMBA 1X9WA 1N32K 4IWVA 3BZKA 5JS1A 2GWKA 1ZBFA 3H3NO 4EHUA 4XH5A 3HBTA 3T1HK 4H8KA 1JLFA 4KHSA 4KHPK 3V9UA 1P90A 2ASOA 1EP4A 4M3XA 1NMDA 1H1VA 2KTQA 3M8SA 1TKZA 4ELUA 1W0HA 4DB3A 3QEIA 3VTIA 4QS9A 1NJIO 4FO0A 1EKEA 4EAHD 3VEVA 3TAQA 4FW2A 1HPZA 5CE3A 3BZCA 3R9PA 3QNNA 3T3FA 4ILHA 2YKNA 4FJJA 4CGIA 2CGJA 4BE1A 1NG9A 4W5OA 4IJAA 4QS8A 3FFIA 4HTUA 3J7YP 1C0MA 4CIFA 3SV3A 4JAXA 4DWIA 1YTUA 3V4IA 1DKGD 3TAGA 1IJJA 2Q97A 3HPGA 3VQ6A 3WQUA 2VWKA 3BEXA 4CJEA 1VQ6N 4NB4A 3THXB 5AR0A 2H3GX 4FLYA 3LZJA 4MDAA 4CZMA 2GX9A 2D0BA 4HUGA 3V6DA 3NGZA 5JICA 4LH4A 4IOXA 4IOCL 4DHYA 4CK3A 3OYMA 2HHWA 4DFKA 5C2FA 4Q5VA 4CZEA 5AQGA 4JK9A 2QA4N 4CFCA 1C1CA 3MEDA 2X74A 4GY2B 4R79A 4CF1A 3EEQA 1K8KB 3SJHA 1IKXA 1TK5A 3SUOA 1X1PA 2HHXA 3C6UA 3SQ2A 5M1NA 4YDUC 1JLAA 1VAZA 2NRVA 5HBMA 4DU1A 4B3SK 5DM6L 1VQ7N 4BR2A 1TUYA 4Z94A 4E7KA 3CFPA 4B3OA 3HT3A 1RBVA 1D4XA 5GINA 2O8CB 5KQ8A 4JLHA 3O9RA 4B08A 1YAGA 2YJEA 1MU2A 4YOVA 1HMVA 1OH6A 3QB0A 2UUCK 5AQIA 4GVMA 3U9DA 2ZJQL 4BR7A 1NGJA 1RDAA 1S1WA 3L2UA 1WLJA 2PZSA 4GKJK 4H5VA 2A42A 2FBXA 1GOBA 2PYJA 2IIRA 3L4IA 3DLBA 3HJFA 3SQ4A 4IO9L 1RDCA 4CI6A 4FK2A 4AHCA 4CEFA 3G71N 4DV6K 4FJIA 4DV3K 2NRHA 2W41A 4Y0WA 3EY1A 4A2AA 1CLQA 3QEVA 1KQSM 5C0YA 1NM1A 1P8ZA 1QQMA 4CBWA 3KLFA 4B9SA 3DOKA 2UXDK 1GOCA 3CPWM 3E1YA 1ASWA 2IDOA 2VG5A 3SUNA 2NNWA 4DSFA 3VENA 3K5LA 4AM7A 4Y1CA 3KTQA 3ATVA 2NRRA 4I2PA 2BUPA 1YJNN 2F7TA 3VQ9A 4E7LA 4FM2A 4O5BA 5I3UA 4JI3K 1JKHA 1RDBA 2XY8A 4KBOA 1SL1A 2CGKA 2J4RA 2QWPA 1NGFA 4CJWA 4FM1A 4ZTJA 4BR0A 3THXA 4LD0A 3KWIA 2QTDA 3J7ZO 4LSNA 5AQMA 1HUXA 3GOIA 4AHRA 4H0XB 2ZJPL 2PYLA 4JS4A 2G8HA 1VQON 4M3TA 3WNEA 5AQVA 3KHYA 3O3HA 5AJ3K 4E1NA 4FZZA 2ZWHA 3QIOA 4XIUA 4CF0A 5AFUA 2B4JA 2ASMA 4FJMA 1JJ2M 3AVAA 2IVPA 3RMCA 2FSKA 1XC3A 2VGNA 4IKFA 1JLCA 2OPRA 4PKIA 4M7YA 5AQOA 4BE0A 4GV9A 3CJ1A 1TAQA 4N76A 2ITGA 3HP6A 4F3TA 1X3NA 4RTFD 2D0CA 3PIPL 5EU7A 4BRNA 3AO4A 4FPBA 1N5YA 3LDNA 4CE9A 2E88A 1NMNA 1V4TA 1S3XA 1RDDA 3I33A 2LSNA 2CH6A 3O9UA 5JMVA 3QERA 4FJ5A 4CJTA 3T1AA 2G8KA 3WXMB 4H0PA 4DQPA 4AHSA 3EYZA 3CM6A 4C1NK 1SQKA 3VA3A 3AVHA 3IS9A 2UUBK 1HNZK 5K14A 1I94K 1Q18A 5KGWA 1IBMK 4DR2K 4PQUA 5AQRA 3V9SA 3VF2A 3KLHA 4EIAA 3UE5A 4U7BA 1NJZA 3K2PA 2Q2RA 3EO3A 3MN6A 5M1KA 3LAMA 3MK6A 3MN7A 2E5LK 3ZLJA 1RCHA 3MECA 2ATQA 3HOTA 4CEAA 3KK3A 2HB5A 3AVLA 5FPNA 1QVGM 1VQ4N 4CF2A 2WOMA 4C8NA 4Y1DA 1TKXA 3ZT0A 1BWFO 2HNDA 3AA2A 4NO7A 3A5OC 2OPSA 4FOEA 4F4KA 2G8WA 3TWHA 2AP1A 4DV1K 3WT0A 1JL1A 2UUAK 1EXQA 2ITMA 1ZBIA 3TR8A 4IZ9A 2O8DB 2P9PA 3CMEN 5CYMA 4DS4A 5GADP 2VWJA 3QLHA 1ZBSA 1BCMA 3OTOK 3VEOA 4CHQA 3W0LA 1IO2A 4GNIA 4N56A 3O3GA 3CQ8A 4C8OA 5EVZA 2I7NA 5BR8K 4L3QA 4BRDA 5C24A 1TV6A 4LY7A 1YT3A 5HRRA 2A1SA 3AARA 3E66A 3OYNA 4AQYK 1GLEG 4BDYA 5CHIA 2P1JA 5F1XA 1Q8IA 1C1AA 4K8ZA 3P4IA 1CXQA 3O9TA 2CGLA 3HSTB 3O3FA 3HK2A 1OKJA 2HVIA 3A0IX 1IKVA 3O9QA 1WSGA 3OJUA 1S22A 4MO4A 3HO1A 4NLBA 3JS6A 4BRPA 4R5PA 4BRIA 4CFDA 1SUQA 3SUPA 4DV7K 3BGRA 5T7BA 4KB0A 2YHXA 1MWMA 4KH5A 5C10A 3WXJA 4FK4A 2HHUA 3IAYA 4HCBA 1ESVA 3VGKA 4K41A 5HP1A 2Y1JA 2QK9A 4U67L 4LC9B 3NF7A 1TL3A 3VQ5A 5FRMA 2QW9A 1D9FA 5M1OA 3CERA 1U2VB 3PX4A 3JXUA 3GDQA 4DR6K 1NNEA 4CJ3A 3I8DA 2FF6A 2HHQA 4YY3K 4PKHA 2HHHK 1GLJO 3SBGA 3HZ6A 1NWKA 4B9QA 4J2EA 3WNGA 1RBRA 3GE1A 1XNQK 2KKZA 3QICA 4PKGA 3SMSA 1HKGA 3L2WA 1W2BM 1Q86O 5HL7L 2Y1IA 1SKRA 4DSIA 4BE2A 3WXLA 5AZJB 4C8KA 4EZ6A 4M7XA 4IEIA 4FJGA 1L3UA 1IH7A 3FFKB 1L3SA 2YX6A 3I56N 1WAFA 4ZHRA 4W5QA 3OYEA 5AQHA 2O8DA 4HUFA 4YDUA 4BRMA 2KQ2A 3AVNA 3U8XA 4ISFA 4FWRA 2ZQBA 3CIPA 1OH5A 2WFBA 5KRSA 1Q9YA 4DTJA 1RTIA 4J2BA 3H3OB 3VF4A 1S5JA 4FWLA 5B8HA 3MMVA 1YTAA 3OYAA 1WBDA 4GV3A 3K9KA 5HOOA 4YNQA 4JK8A 2FLOA 5DMRA 3PIOL 1XI1A 2B5JA 2BDPA 4CHPA 1RTJA 2KFNA 1S1UA 4DU4A 1UOCA 1C6VA 4OPKA 2BTFA 3VQ4A 4QCLA 3AA3A 2FF3B 2DFFA 4Z4CA 2JGUA 3CCMN 1SL2A 3L2RA 4DV0K 1TYQB 4KI4A 3Q7BA 1HJOA 4KV8A 3V9XA 3G25A 4Z4IA 3J80O 3OJSA 3D2EB 4BC2A 3AVJA 3ZSQA 4FZXC 5IT9O 2VCPA 3JYTA 3AO5A 4B1YB 4PA1A 2DFHA 2V7YA 3AGRA 3LDOA 4JI1K 3HPOA 3O4NA 1QQCA 4RCHA 3QINA 5FROA 4FVMA 1YVUA 4CBXA 1BIZA 3P31A 2Q31A 2XY7A 1YITN 3BDPA 1MA9B 4CGDA 3AA4A 1ZYQA 3UIQA 1ZC6A 2YCHA 3OYGA 3M3ZA 1U2VA 2I7PA 1BDGA 4JV5K 1N34K 4FWOA 4IBNA 4LSLA 3OYCA 4Z4EA 4CESA 2V51B 4WFNL 3PO5A 1QVFM 1NJXA 3OBWA 3CQXA 4H4MA 3DLKA 4OO1J 2E2OA 3IG1A 3QFPA 1X9SA 4H0OA 3KD1E 5KPTA 1GLCG 1ATSA 3F5TA 4JKHA 2ZGYA 5AZJA 3QBWA 3NAEA 4ILGB 3VQBA 4F2SA 3KLGA 3OYKA 2YHBA 4AHUA 4CJQA 3MXMA 3P83D 1J5EK 5CZ2A 1XUPO 2UXCK 5J2MA 3QESA 4FWNA 5AQFA 1HLUA 3BF3A 1UAXA 3CC2N 3Q7CA 3EN9A 1VQ5N 3OYDA 5HRPA 4JKGB 4B1WB 3RTVA 1RDUA 3DYAA 1LAVA 3U4LA 2EX3A 3NFAA 2KZZA 1IBLK 2W6KA 4DUYK 4ISEA 3KK1A 1SL0A 2HBJA 3L3VA 4M3RA 3ATUA 4HVJA 3PSIA 3I0SA 4W5NA 3L2QA 3DXMB 1HKCA 4H0VB 3M5RA 3P39A 4DUZK 4HCCA 3ZSZA 1U4BA 3SZ2A 3HYFA 3WXIA 5AQNA 4CZLA 1BGXT 3CJ9A 4DG1A 3K58A 4B9VA 1A5XA 2OZMA 3MXJA 4FLWA 2UU9K 4UQGA 4N41A 4ILJA 1TYQA 4E1JA 3DRPA 1J53A 3D2EA 3NH0A 4KHYA 1EWRA 4GW6A 4ISGA 3HSCA 3ZT3A 3NBPA 3VQ8A 4B8CA 3EKSA 1K73O 1UWBA 3MCAB 4DV5K 5HLFA 1KLMA 3PSFA 4Z4FA 4B3RK 1HX1A 4MO5A 3HL8A 4M3YA 4CF9A 4O8UA 1CXUA 1KC8O 2P5OA 5LJWA 4NLCA 5BRFA 2AA4A 1DEJA 1FXXA 4IDHA 1YVNA 2HBMA 4CHNA 3OW2M 4B1VA 1DTQA 4FZYA 4C1NI 4FJNA 2VYPA 4CVNE 4F8RA 3TAEA 4CJ5A 4BC5A 2HVHA 3DLHA 4JKBA 4WQ4C 1A5VA 5TKWA 3H08A 4KTQA 1HPMA 2E1ZA 4AHTA 4BREA 1NKCA 2OANA 4DMNA 1NGIA 4QOZB 2EHGA 3DXKB 3FZFA 3VEYA 3J81O 3M6GA 1BA0A 1VSKA 1GLFO 4O44A 4CJKA 1Y97A 3LZIA 3SI6A 2XO7A 4KH4A 3ZETB 3U3YA 2KHOA 4GKKK 1RDWX 3CCLN 5KGXA 4KRFA 2V52B 1WSEA 2QXFA 5E26A 4Z0UA 1NGDA 1XHZA 3LP3A 3JSMA 3AAQA 3VOVA 5ADXH 2UXBK 1HYZA 4DR3K 4JKGA 3CG7A 1QSSA 5DM7L 1KSPA 4CEQA 2P9KB 1OVYA 5HROA 5FPMA 3ULEA 1HR0K 3DXMA 3O8MA 1FJGK 3AGKA 2OCEA 2WC9A 2HNZA 4FJ8A 2GTDA 1WSIA 1T44A 4CZHA 5BRHA 4I9LA 3WEEB 1QZ5A 3K57A 4X66K 5C15A 4DTXA 5BN8A 4I6MB 4OVLA 2D0AA 3O1WA 4FWMA 3N4QA 1BQMA 4BVOA 3VERA 3NMUA 3K5MA 5CY4A 1BL3A 3VQDA 1BU6O 5EOYA 4DLEA 4CK2A 2XY6A 3T7ZA 1G99A 1WBBA 3PY8A 4FJ9A 3L8BA 2JLEA 1U48A 3KK7A 3RVCA 2B6AA 1YHQN 5SWMA 1ASUA 3T1YK 2HF4A 5DK5A 2PFUA 3VQPA 4FXDA 1RBSA 3MWPA 3L2VA 1RT2A 5JS2A 2ZJRL 1S72N 3RRGA 3OVNA 4YFUA 3MN9A 3HRGA 1Q9XA 2YNFA 3PUFA 3NVMA 4FM0A 2FBVA 3IFRA 4H0YB 2WONA 4IG3A 4FLTA 3H6EA 4OKEA 4J2AA 4IXCA 4K43A 1BA1A 2ZGZA 3VN5A 4DR5K 3CC7N 4BY9C 4RWTA 2CH5A 3PX6A 1O1WA 1JLBA 4OPAA 4CW7B 1VQ8N 4DCHA 3TABA 3DXKA 1S6PA 2P9PB 1NJYA 3RMDA 3MCPA 3V1OA 1S1TA 2O8EB 3OBYA 2YNIA 3ZETA 4JI6K 3KLEA 1J5OA 2E2NA 4M45A 3ZSWA 4KHQA 3LALA 2RF2A 3OA9A 4DQSA 3EZWA 1W9HA 5C42A 1XWLA 3CM5A 2NLXA 3O1BA 3VQEA 3G4SN 1EX4A 3CCVN 2KW4A 4B1XB 4JKFA 2GUIA 2P9KA 4Q0BA 4A5AA 1NOYA 3QIPA 1NGHA 1GLAG 3HOSA 3K9JA 4DLGA 5J1EA 5HRNA 3LPTA 3KD5E 3SMPA 1NK6A 4JN4A 1WUAA 2XY5A 4H5WA 3KVGA 3PO4A 1RT6A 1ZBHA 4O8KA 3TPQA 3BUZB 3WEEA
chains in the Genus database with same CATH topology
4Z4GA 1TL3A 3DLRA 1TL1A 4IFYA 4RG8A 3VQ5A 5FRMA 3IRXA 4CJPA 4AILC 4IFVA 1BHLA 3NCIA 1U49A 1D9FA 1NK0A 1B92A 3PX4A 3AVKA 3D45A 4MQ3A 4O4GA 4CEZA 3HVTA 3C6TA 1HNVA 3ITHA 4M3UA 2Z1HA 4CJ3A 3I8DA 4E3SA 4DTOA 5HRSA 1NK9A 2HHQA 4IDKA 1HYSA 2G8VA 1IKWA 3AO1A 2YNGA 4EP4A 3OY9A 4J2EA 3PV8A 4N5SA 4CJSA 3WNGA 4CECA 1RBRA 2Z1IA 3ZSOA 3NDKA 1BQNA 2HHSA 2D5RA 3WNHA 3VQQA 4KHNA 4DU3A 1RTDA 1QSYA 1IKYA 3AVBA 1HRHA 3MEGA 4OJRA 1SV5A 1WSHA 4Z4HA 3L2WA 4FLXA 4B9MA 3G10A 2Y1IA 1VSJA 1SKRA 4DSIA 4RW6A 2RN2A 4W5TA 4BE2A 2OYQA 2F8SA 4C8KA 4EZ6A 1NK8A 4FJGA 1L3UA 4DFMA 1VSDA 1IH7A 1L3SA 2I5JA 4O0JA 4KAZA 1FKOA 2YNHA 1WAFA 2O4IA 4M3WA 1HNIA 2G8UA 1ZBLA 1S9EA 2VG7A 4CIGA 4ZHRA 4W5QA 3OYEA 4KTZA 4CJVA 4RW8A 3QEWA 3HM9A 4DQRA 4NCGA 4HUFA 2E4LA 1BIUA 3B6OA 1EETA 3HP9A 3VQCA 4DTMA 3S3NA 3OYJA 1ASVA 2KQ2A 3AVNA 4NYNA 3P1GA 3SQ0A 1KRPA 2O4GA 2ZQBA 4CFBA 4J2DA 1LV5A 5KRSA 3ZSYA 1L5UA 1Q9YA 3AVMA 3LP1A 4B9LA 2KZMA 4DTJA 4KKOA 1RTIA 4FW1A 3QO9A 4J2BA 4W5NA 3SPZA 1UA1A 1B9FA 1S5JA 3PX0A 4E7IA 3A2FA 2HHTA 2HMIA 4FJXA 2X6SA 4TSXA 4E19A 5C25A 3LP2A 1YTAA 3OYAA 1RNHA 2IGIA 3RMBA 4ID5A 3ULDA 4E7HA 4YNQA 1X9WA 3ZCMA 2HHVA 1VRUA 4DF8A 2ZD1A 1LWFA 5DMRA 1XI1A 2B5JA 2BDPA 4CHPA 5JS1A 1RTJA 1ZBFA 1D9DA 2KFNA 4H8KA 2BANA 1JLFA 4KHSA 1S1UA 3C95A 4CIEA 3V9UA 1UOCA 4DU4A 1C6VA 4OPKA 1C0TA 1EP4A 3OS1A 4M3XA 3VQ4A 1RBTA 2XHBA 4QCLA 2KTQA 3AA3A 3M8SA 1TKZA 3HPHA 2DFFA 3OYIA 4ELUA 1W0HA 3THVA 3QEIA 4Z4CA 4EZ9A 2JGUA 1D8YA 5E41A 4M42A 2QKBA 1SL2A 1EKEA 3L2RA 3U3GA 3QETA 4C8MA 3TAQA 4KI4A 4FW2A 1HPZA 4KV8A 3V9XA 4Z4IA 1VRTA 3OJSA 4IG0A 3QNNA 3AVJA 3T3FA 4B9UA 3DI6A 1S6QA 2YKNA 3D0PA 3ZSQA 3K5NA 4C8LA 4FJJA 4CGIA 4BE1A 4W5OA 4FZXC 3AO2A 1LAWA 4CEBA 3FFIA 3JYTA 4HTUA 3AO5A 1SKWA 2OA8A 4PA1A 2DFHA 1T8EA 1IG9A 1C0MA 4PY5A 3HPOA 4CIFA 3O4NA 3SV3A 2HW3A 4DWIA 4DSKA 3V4IA 3ZT4A 1QQCA 1YTUA 3TAGA 1DTTA 2R7YA 3QINA 5FROA 3HPGA 1JXBA 4FVMA 3VQ6A 1YVUA 4FLVA 1KTQA 2GV9A 3AVFA 2VWKA 1BIZA 3HXMA 3LDSA 4CJEA 2G8IA 2XY7A 1RT1A 3BDPA 3S3OA 3TAPA 4CGDA 3SPYA 3AA4A 4BWMA 3I0RA 1ZYQA 4DFJA 3UIQA 4FLYA 3LZJA 3OYGA 2D0BA 1FK9A 2VG6A 4HUGA 2GBZA 3V6DA 4IBNA 3NGZA 4LSLA 3OYCA 1TK0A 4Z4EA 3LP0A 5J2QA 2DY4A 4LH4A 4CESA 1KVAA 4CK3A 3OYMA 2HHWA 3PO5A 3DLEA 4DFKA 3M8RA 1VSLA 1NK5A 3ASMA 4Q5VA 1NJXA 1WN7A 4DTNA 5D3GA 4H4MA 3AVIA 4CGJA 3DLKA 1NKEA 3S3MA 1TKTA 1L3TA 1KFDA 4RW4A 3IG1A 4CFCA 1C1CA 5CZ1A 3MEDA 2X74A 4G1QA 1XHXA 1QE1A 3NF6A 1X9SA 4NCBA 3B6PA 4CF1A 3KD1E 1A5WA 1IKXA 3CYMA 3SNNA 1TK5A 3NAEA 3SUOA 3VQBA 1X1PA 1T7PA 3SUQA 4F2SA 1VSIA 3C6UA 1LWCA 1RT7A 3OYKA 2YHBA 4AHUA 4CJQA 5SZTA 3KLGA 4DTUA 3SQ2A 3MXMA 1JLAA 3P83D 3V1RA 5CZ2A 1DLOA 5HBMA 4CHYA 1TKDA 4KPYA 4DU1A 5J2MA 3QESA 2HNYA 5J2PA 1J54A 1UAXA 4E7KA 3CFPA 4B3OA 4DFPA 3HT3A 1HQUA 1RBVA 3OYDA 1U04A 5HRPA 3SQ1A 4JLHA 4KTWA 4B08A 3RTVA 1MU2A 3DYAA 1LAVA 1HMVA 2EX3A 4NYFA 3NFAA 2KZZA 1G15A 4GVMA 3M8QA 3KK1A 3K59A 1SL0A 2PY5A 1RDAA 1S1WA 3K5OA 4FJLA 3L2UA 2P51A 3SYZA 1WLJA 5CYQA 2IAJA 2PZSA 2FBXA 1GOBA 3L3VA 4M3RA 4HVJA 1WSJA 4CF8A 5KTQA 3I0SA 4DS5A 4DF4A 3DLBA 3L2QA 3HJFA 3O4QA 3SQ4A 2F96A 1T05A 1RDCA 3TAFA 4KREA 4EP5A 4FK2A 4CGHA 4AHCA 4CEFA 4HCCA 4FJIA 3ZSZA 1NOZA 1U4BA 3SZ2A 4CFAA 3HYFA 1CLQA 1BGXT 3EY1A 3QEVA 3LPUA 4DG1A 1REVA 3K58A 4B9VA 1A5XA 2OZMA 4KFBA 3MXJA 4OKKA 4FLUA 4B9NA 1LW0A 3KLFA 4FLWA 4N41A 4UQGA 4B9SA 3OS0A 3DOKA 2QKKA 4FXDA 1GOCA 1B9DA 1U45A 1CZ9A 3F9KA 1ASWA 3DRPA 1J53A 1I39A 2IDOA 4K8XA 2VG5A 3SUNA 2KFZA 3NH0A 4DSFA 4GW6A 3TI0A 4KHYA 3K5LA 3ZT3A 3NBPA 4Y1CA 3NGYA 3VQ8A 1WSFA 5FDLA 3QNOA 3KTQA 4DSJA 4CEEA 4B8CA 4FLZA 4ICLA 1S9GA 1UWBA 4O0IA 3RRHA 4I2PA 1KLNA 1QSLA 4FJ7A 5HLFA 3TANA 4BACA 3E01A 1HQEA 3VQ9A 4E7LA 1VK0A 1KLMA 1WNSA 2XRIA 1FKPA 4FM2A 3DRSA 3KKSA 4O5BA 3VQAA 5I3UA 3KJVA 4DSLA 4Z4FA 1JKHA 3M8PA 3S9HA 1RDBA 3OYLA 3AA5X 3ZT2A 2P5GA 2XY8A 1BI4B 3F73A 1SL1A 3HL8A 3U6FA 2OZSA 3NGIA 4ZTJA 4FM1A 4CJWA 3EZ5A 4M3YA 4E89A 1QS4A 3MEEA 2NUBA 3LWMA 4LD0A 4CF9A 2X78A 1CXUA 4OGEA 2P5OA 3ZSVA 1RBUA 1FXXA 1C1BA 4JS5A 3V1QA 2OPPA 4CHNA 4LSNA 4W5RA 1DTQA 4AHRA 2PYLA 4OPJA 4M41A 4JS4A 4FZYA 2G8HA 4FJKA 1L3VA 4FJNA 4M3TA 3WNEA 4ELVA 3OYBA 1RT4A 4F8RA 4MFBA 3ZT1A 3O3HA 4E1NA 3SV4A 4CJ5A 3TAEA 4FZZA 2Z1GA 1JXEA 3KK2A 1RT3A 3CFOA 3QIOA 4XIUA 4H4OA 4PUOA 2HVHA 1VSFA 4CF0A 3NH2A 3DLHA 4L8RB 2HHXA 2B4JA 1A5VA 2DTUA 4FJMA 3H08A 4KTQA 4AHTA 4HHTA 3MXIA 2Q3SA 1NKCA 4QOZB 4DMNA 3VA0A 2EHGA 3AVAA 3RMCA 3CFRA 3L3UA 4O44A 1VSKA 4CJKA 4IKFA 3LZIA 1JLCA 1Y97A 3ALYA 3SI6A 1Z26A 2RKIA 3KIOA 2OPRA 2XO7A 4OKJA 4I7FA 4PWDA 1ITGA 3AO3A 3U3YA 2FC0A 1TGOA 5KGXA 4KRFA 1WSEA 4CERA 1RT5A 4BE0A 2QXFA 1TAQA 4E0DA 4N76A 2ITGA 4M3ZA 3HP6A 4Z0UA 1N6QA 4F3TA 3NE6A 1Z25A 1XHZA 4BDZA 2D0CA 3LP3A 4CJLA 4FK0A 5EU7A 1D5AA 3JSMA 3QEPA 3AO4A 1HYZA 1N5YA 3V9ZA 4CE9A 3CG7A 1KCFA 5J2NA 2W42A 4KB1A 4F2RA 1RDDA 1QSSA 3OYFA 1KSPA 2LSNA 4CEQA 3QERA 1VSEA 3V9WA 3NHGA 4FJ5A 1TVRA 3T1AA 4CJTA 2G8KA 1WAJA 5HROA 3SJJA 3NF9A 2ZE2A 3RWUA 4FYDA 1QHTA 1KFSA 4AHSA 4DQPA 3EYZA 3CM6A 3VA3A 3KLIA 4CJUA 3AVHA 3IS9A 3KKRA 2HNZA 4FJ8A 5K14A 1WSIA 3LANA 4HUEA 2E6LA 3NH1A 2IS3A 4I9LA 5KGWA 4DTRA 2DFEA 4KHUA 1C0UA 3TARA 3K57A 4PQUA 4DTXA 3HVRA 2FBYA 4OVLA 3V9SA 1KVCA 3KLHA 2D0AA 2X6NA 1BQMA 1XC9A 1NJZA 1NJWA 1HYVA 3K2PA 3K5MA 3QEXA 4E7JA 5CY4A 4CK1A 1NKBA 1BL3A 2Z1JA 3LAMA 4QAGA 3VQDA 4CJFA 4DLEA 4DSEA 4CK2A 2YHAA 3ZSXA 4JRPA 2XY6A 1RCHA 3MECA 5KRTA 2ATQA 3DRRA 4FJHA 4B8AB 3PY8A 4FJ9A 4KI6A 3L8BA 2OPQA 4CEAA 2HB5A 2JLEA 3AVLA 3KK3A 4CJ4A 1U48A 1TK8A 4CF2A 2WOMA 4C8NA 2B6AA 4Y1DA 1TKXA 5SWMA 3OYHA 1ASUA 3ZT0A 1GOAA 1RILA 3G0ZA 4CGGA 2HNDA 4RW7A 3AA2A 1ZBUA 5DK5A 2OPSA 1R0AA 1RTHA 1S1XA 3DLGA 1RBSA 4I2QA 3VQPA 4CHZA 1RT2A 3L2VA 1BI4A 4F4KA 4KHWA 2G8WA 3TWHA 1LWEA 4B9TA 4ID1A 5JS2A 1JL1A 4DQQA 3RRGA 1EXQA 1KVBA 3OVNA 4YFUA 4FCYA 3T19A 2YKMA 1Q9XA 1ZBIA 4NCAA 2YNFA 4WE1A 1JLGA 3TR8A 3PUFA 4FM0A 2FBVA 4IG3A 2WONA 3DOLA 4E1MA 4FLTA 2PYJA 5CYMA 4OKEA 4CEOA 4DS4A 2G8FA 4J2AA 1HJRA 2VWJA 3RMAA 3QLHA 3AVCA 5KI6A 1BCMA 3VN5A 3SCXA 1TAUA 4LH5A 2FBTA 4CHQA 2E6MA 3PX6A 1O1WA 2IC3A 1JLBA 1IO2A 3AV9A 3NF8A 4N56A 3O3GA 3CQ8A 4C8OA 1VSMA 4GMJB 1NK4A 3TABA 2RPIA 1BCOA 1I3AA 1JLQA 4KO0A 4BWJA 2BGGA 1S6PA 1NJYA 3RMDA 5C24A 3ZSRA 4I9QA 1TV6A 4LY7A 1YT3A 3V1OA 4F3OA 1F21A 1S1TA 5HRRA 4ELTA 3VQ7A 4DTSA 4N47A 2YNIA 4DQIA 2A1SA 3KLEA 1J5OA 4M45A 3ZSWA 3OYNA 4KHQA 3LALA 2RF2A 4DQSA 3V81A 1W9HA 3WNFA 4BDYA 2F8TA 4CJRA 2P1JA 5C42A 1Q8IA 1C1AA 3P5JA 4K8ZA 4BDPA 1CXQA 1XWLA 3CM5A 1J9AA 1T03A 4OLAA 3C94A 3AVGA 1S1VA 4JRQA 3HSTB 3O3FA 4O55A 3HK2A 3VQEA 4CEDA 4CCHA 1JLEA 2A1RA 1EX4A 4AHVA 2HVIA 2KW4A 1IKVA 3LAKA 1X9MA 1WSGA 3OJUA 2GUIA 4Q0BA 3HO1A 1NOYA 3QIPA 1VSHA 4CGFA 2AJQA 1BISA 2BE2A 3ISNC 3MAQA 3TAMA 4R5PA 4CFDA 1SUQA 2IOCA 4DLGA 5J1EA 1QTMA 5HRNA 3SUPA 5I42A 1JL2A 3LWLA 3LPTA 3RR7A 3KD5E 4OGCA 1NK6A 3OS2A 3BGRA 5T7BA 2XY5A 4KB0A 1UA0A 4OLBA 5FRNA 1CZBA 4FK4A 3PO4A 1LW2A 1NK7A 1K6YA 4RW9A 2HHUA 1RT6A 3RR8A 3IAYA 1ZBHA 4AH9A 1U47A 4DTPA 2ETJA 4HCBA 3DMJA 3DM2A 5HP1A 2Y1JA 4ZTFA 2QK9A 4CHOA 2YV0X 3NF7A 1SKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4G A;  1TL3 A;  3DLR A;  1TL1 A;  4IFY A;  4RG8 A;  3VQ5 A;  5FRM A;  3IRX A;  4CJP A;  4AIL C;  4IFV A;  1BHL A;  3NCI A;  1U49 A;  1D9F A;  1NK0 A;  1B92 A;  3PX4 A;  3AVK A;  3D45 A;  4MQ3 A;  4O4G A;  4CEZ A;  3HVT A;  3C6T A;  1HNV A;  3ITH A;  4M3U A;  2Z1H A;  4CJ3 A;  3I8D A;  4E3S A;  4DTO A;  5HRS A;  1NK9 A;  2HHQ A;  4IDK A;  1HYS A;  2G8V A;  1IKW A;  3AO1 A;  2YNG A;  4EP4 A;  3OY9 A;  4J2E A;  3PV8 A;  4N5S A;  4CJS A;  3WNG A;  4CEC A;  1RBR A;  2Z1I A;  3ZSO A;  3NDK A;  1BQN A;  2HHS A;  2D5R A;  3WNH A;  3VQQ A;  4KHN A;  4DU3 A;  1RTD A;  1QSY A;  1IKY A;  3AVB A;  1HRH A;  3MEG A;  4OJR A;  1SV5 A;  1WSH A;  4Z4H A;  3L2W A;  4FLX A;  4B9M A;  3G10 A;  2Y1I A;  1VSJ A;  1SKR A;  4DSI A;  4RW6 A;  2RN2 A;  4W5T A;  4BE2 A;  2OYQ A;  2F8S A;  4C8K A;  4EZ6 A;  1NK8 A;  4FJG A;  1L3U A;  4DFM A;  1VSD A;  1IH7 A;  1L3S A;  2I5J A;  4O0J A;  4KAZ A;  1FKO A;  2YNH A;  1WAF A;  2O4I A;  4M3W A;  1HNI A;  2G8U A;  1ZBL A;  1S9E A;  2VG7 A;  4CIG A;  4ZHR A;  4W5Q A;  3OYE A;  4KTZ A;  4CJV A;  4RW8 A;  3QEW A;  3HM9 A;  4DQR A;  4NCG A;  4HUF A;  2E4L A;  1BIU A;  3B6O A;  1EET A;  3HP9 A;  3VQC A;  4DTM A;  3S3N A;  3OYJ A;  1ASV A;  2KQ2 A;  3AVN A;  4NYN A;  3P1G A;  3SQ0 A;  1KRP A;  2O4G A;  2ZQB A;  4CFB A;  4J2D A;  1LV5 A;  5KRS A;  3ZSY A;  1L5U A;  1Q9Y A;  3AVM A;  3LP1 A;  4B9L A;  2KZM A;  4DTJ A;  4KKO A;  1RTI A;  4FW1 A;  3QO9 A;  4J2B A;  4W5N A;  3SPZ A;  1UA1 A;  1B9F A;  1S5J A;  3PX0 A;  4E7I A;  3A2F A;  2HHT A;  2HMI A;  4FJX A;  2X6S A;  4TSX A;  4E19 A;  5C25 A;  3LP2 A;  1YTA A;  3OYA A;  1RNH A;  2IGI A;  3RMB A;  4ID5 A;  3ULD A;  4E7H A;  4YNQ A;  1X9W A;  3ZCM A;  2HHV A;  1VRU A;  4DF8 A;  2ZD1 A;  1LWF A;  5DMR A;  1XI1 A;  2B5J A;  2BDP A;  4CHP A;  5JS1 A;  1RTJ A;  1ZBF A;  1D9D A;  2KFN A;  4H8K A;  2BAN A;  1JLF A;  4KHS A;  1S1U A;  3C95 A;  4CIE A;  3V9U A;  1UOC A;  4DU4 A;  1C6V A;  4OPK A;  1C0T A;  1EP4 A;  3OS1 A;  4M3X A;  3VQ4 A;  1RBT A;  2XHB A;  4QCL A;  2KTQ A;  3AA3 A;  3M8S A;  1TKZ A;  3HPH A;  2DFF A;  3OYI A;  4ELU A;  1W0H A;  3THV A;  3QEI A;  4Z4C A;  4EZ9 A;  2JGU A;  1D8Y A;  5E41 A;  4M42 A;  2QKB A;  1SL2 A;  1EKE A;  3L2R A;  3U3G A;  3QET A;  4C8M A;  3TAQ A;  4KI4 A;  4FW2 A;  1HPZ A;  4KV8 A;  3V9X A;  4Z4I A;  1VRT A;  3OJS A;  4IG0 A;  3QNN A;  3AVJ A;  3T3F A;  4B9U A;  3DI6 A;  1S6Q A;  2YKN A;  3D0P A;  3ZSQ A;  3K5N A;  4C8L A;  4FJJ A;  4CGI A;  4BE1 A;  4W5O A;  4FZX C;  3AO2 A;  1LAW A;  4CEB A;  3FFI A;  3JYT A;  4HTU A;  3AO5 A;  1SKW A;  2OA8 A;  4PA1 A;  2DFH A;  1T8E A;  1IG9 A;  1C0M A;  4PY5 A;  3HPO A;  4CIF A;  3O4N A;  3SV3 A;  2HW3 A;  4DWI A;  4DSK A;  3V4I A;  3ZT4 A;  1QQC A;  1YTU A;  3TAG A;  1DTT A;  2R7Y A;  3QIN A;  5FRO A;  3HPG A;  1JXB A;  4FVM A;  3VQ6 A;  1YVU A;  4FLV A;  1KTQ A;  2GV9 A;  3AVF A;  2VWK A;  1BIZ A;  3HXM A;  3LDS A;  4CJE A;  2G8I A;  2XY7 A;  1RT1 A;  3BDP A;  3S3O A;  3TAP A;  4CGD A;  3SPY A;  3AA4 A;  4BWM A;  3I0R A;  1ZYQ A;  4DFJ A;  3UIQ A;  4FLY A;  3LZJ A;  3OYG A;  2D0B A;  1FK9 A;  2VG6 A;  4HUG A;  2GBZ A;  3V6D A;  4IBN A;  3NGZ A;  4LSL A;  3OYC A;  1TK0 A;  4Z4E A;  3LP0 A;  5J2Q A;  2DY4 A;  4LH4 A;  4CES A;  1KVA A;  4CK3 A;  3OYM A;  2HHW A;  3PO5 A;  3DLE A;  4DFK A;  3M8R A;  1VSL A;  1NK5 A;  3ASM A;  4Q5V A;  1NJX A;  1WN7 A;  4DTN A;  5D3G A;  4H4M A;  3AVI A;  4CGJ A;  3DLK A;  1NKE A;  3S3M A;  1TKT A;  1L3T A;  1KFD A;  4RW4 A;  3IG1 A;  4CFC A;  1C1C A;  5CZ1 A;  3MED A;  2X74 A;  4G1Q A;  1XHX A;  1QE1 A;  3NF6 A;  1X9S A;  4NCB A;  3B6P A;  4CF1 A;  3KD1 E;  1A5W A;  1IKX A;  3CYM A;  3SNN A;  1TK5 A;  3NAE A;  3SUO A;  3VQB A;  1X1P A;  1T7P A;  3SUQ A;  4F2S A;  1VSI A;  3C6U A;  1LWC A;  1RT7 A;  3OYK A;  2YHB A;  4AHU A;  4CJQ A;  5SZT A;  3KLG A;  4DTU A;  3SQ2 A;  3MXM A;  1JLA A;  3P83 D;  3V1R A;  5CZ2 A;  1DLO A;  5HBM A;  4CHY A;  1TKD A;  4KPY A;  4DU1 A;  5J2M A;  3QES A;  2HNY A;  5J2P A;  1J54 A;  1UAX A;  4E7K A;  3CFP A;  4B3O A;  4DFP A;  3HT3 A;  1HQU A;  1RBV A;  3OYD A;  1U04 A;  5HRP A;  3SQ1 A;  4JLH A;  4KTW A;  4B08 A;  3RTV A;  1MU2 A;  3DYA A;  1LAV A;  1HMV A;  2EX3 A;  4NYF A;  3NFA A;  2KZZ A;  1G15 A;  4GVM A;  3M8Q A;  3KK1 A;  3K59 A;  1SL0 A;  2PY5 A;  1RDA A;  1S1W A;  3K5O A;  4FJL A;  3L2U A;  2P51 A;  3SYZ A;  1WLJ A;  5CYQ A;  2IAJ A;  2PZS A;  2FBX A;  1GOB A;  3L3V A;  4M3R A;  4HVJ A;  1WSJ A;  4CF8 A;  5KTQ A;  3I0S A;  4DS5 A;  4DF4 A;  3DLB A;  3L2Q A;  3HJF A;  3O4Q A;  3SQ4 A;  2F96 A;  1T05 A;  1RDC A;  3TAF A;  4KRE A;  4EP5 A;  4FK2 A;  4CGH A;  4AHC A;  4CEF A;  4HCC A;  4FJI A;  3ZSZ A;  1NOZ A;  1U4B A;  3SZ2 A;  4CFA A;  3HYF A;  1CLQ A;  1BGX T;  3EY1 A;  3QEV A;  3LPU A;  4DG1 A;  1REV A;  3K58 A;  4B9V A;  1A5X A;  2OZM A;  4KFB A;  3MXJ A;  4OKK A;  4FLU A;  4B9N A;  1LW0 A;  3KLF A;  4FLW A;  4N41 A;  4UQG A;  4B9S A;  3OS0 A;  3DOK A;  2QKK A;  4FXD A;  1GOC A;  1B9D A;  1U45 A;  1CZ9 A;  3F9K A;  1ASW A;  3DRP A;  1J53 A;  1I39 A;  2IDO A;  4K8X A;  2VG5 A;  3SUN A;  2KFZ A;  3NH0 A;  4DSF A;  4GW6 A;  3TI0 A;  4KHY A;  3K5L A;  3ZT3 A;  3NBP A;  4Y1C A;  3NGY A;  3VQ8 A;  1WSF A;  5FDL A;  3QNO A;  3KTQ A;  4DSJ A;  4CEE A;  4B8C A;  4FLZ A;  4ICL A;  1S9G A;  1UWB A;  4O0I A;  3RRH A;  4I2P A;  1KLN A;  1QSL A;  4FJ7 A;  5HLF A;  3TAN A;  4BAC A;  3E01 A;  1HQE A;  3VQ9 A;  4E7L A;  1VK0 A;  1KLM A;  1WNS A;  2XRI A;  1FKP A;  4FM2 A;  3DRS A;  3KKS A;  4O5B A;  3VQA A;  5I3U A;  3KJV A;  4DSL A;  4Z4F A;  1JKH A;  3M8P A;  3S9H A;  1RDB A;  3OYL A;  3AA5 X;  3ZT2 A;  2P5G A;  2XY8 A;  1BI4 B;  3F73 A;  1SL1 A;  3HL8 A;  3U6F A;  2OZS A;  3NGI A;  4ZTJ A;  4FM1 A;  4CJW A;  3EZ5 A;  4M3Y A;  4E89 A;  1QS4 A;  3MEE A;  2NUB A;  3LWM A;  4LD0 A;  4CF9 A;  2X78 A;  1CXU A;  4OGE A;  2P5O A;  3ZSV A;  1RBU A;  1FXX A;  1C1B A;  4JS5 A;  3V1Q A;  2OPP A;  4CHN A;  4LSN A;  4W5R A;  1DTQ A;  4AHR A;  2PYL A;  4OPJ A;  4M41 A;  4JS4 A;  4FZY A;  2G8H A;  4FJK A;  1L3V A;  4FJN A;  4M3T A;  3WNE A;  4ELV A;  3OYB A;  1RT4 A;  4F8R A;  4MFB A;  3ZT1 A;  3O3H A;  4E1N A;  3SV4 A;  4CJ5 A;  3TAE A;  4FZZ A;  2Z1G A;  1JXE A;  3KK2 A;  1RT3 A;  3CFO A;  3QIO A;  4XIU A;  4H4O A;  4PUO A;  2HVH A;  1VSF A;  4CF0 A;  3NH2 A;  3DLH A;  4L8R B;  2HHX A;  2B4J A;  1A5V A;  2DTU A;  4FJM A;  3H08 A;  4KTQ A;  4AHT A;  4HHT A;  3MXI A;  2Q3S A;  1NKC A;  4QOZ B;  4DMN A;  3VA0 A;  2EHG A;  3AVA A;  3RMC A;  3CFR A;  3L3U A;  4O44 A;  1VSK A;  4CJK A;  4IKF A;  3LZI A;  1JLC A;  1Y97 A;  3ALY A;  3SI6 A;  1Z26 A;  2RKI A;  3KIO A;  2OPR A;  2XO7 A;  4OKJ A;  4I7F A;  4PWD A;  1ITG A;  3AO3 A;  3U3Y A;  2FC0 A;  1TGO A;  5KGX A;  4KRF A;  1WSE A;  4CER A;  1RT5 A;  4BE0 A;  2QXF A;  1TAQ A;  4E0D A;  4N76 A;  2ITG A;  4M3Z A;  3HP6 A;  4Z0U A;  1N6Q A;  4F3T A;  3NE6 A;  1Z25 A;  1XHZ A;  4BDZ A;  2D0C A;  3LP3 A;  4CJL A;  4FK0 A;  5EU7 A;  1D5A A;  3JSM A;  3QEP A;  3AO4 A;  1HYZ A;  1N5Y A;  3V9Z A;  4CE9 A;  3CG7 A;  1KCF A;  5J2N A;  2W42 A;  4KB1 A;  4F2R A;  1RDD A;  1QSS A;  3OYF A;  1KSP A;  2LSN A;  4CEQ A;  3QER A;  1VSE A;  3V9W A;  3NHG A;  4FJ5 A;  1TVR A;  3T1A A;  4CJT A;  2G8K A;  1WAJ A;  5HRO A;  3SJJ A;  3NF9 A;  2ZE2 A;  3RWU A;  4FYD A;  1QHT A;  1KFS A;  4AHS A;  4DQP A;  3EYZ A;  3CM6 A;  3VA3 A;  3KLI A;  4CJU A;  3AVH A;  3IS9 A;  3KKR A;  2HNZ A;  4FJ8 A;  5K14 A;  1WSI A;  3LAN A;  4HUE A;  2E6L A;  3NH1 A;  2IS3 A;  4I9L A;  5KGW A;  4DTR A;  2DFE A;  4KHU A;  1C0U A;  3TAR A;  3K57 A;  4PQU A;  4DTX A;  3HVR A;  2FBY A;  4OVL A;  3V9S A;  1KVC A;  3KLH A;  2D0A A;  2X6N A;  1BQM A;  1XC9 A;  1NJZ A;  1NJW A;  1HYV A;  3K2P A;  3K5M A;  3QEX A;  4E7J A;  5CY4 A;  4CK1 A;  1NKB A;  1BL3 A;  2Z1J A;  3LAM A;  4QAG A;  3VQD A;  4CJF A;  4DLE A;  4DSE A;  4CK2 A;  2YHA A;  3ZSX A;  4JRP A;  2XY6 A;  1RCH A;  3MEC A;  5KRT A;  2ATQ A;  3DRR A;  4FJH A;  4B8A B;  3PY8 A;  4FJ9 A;  4KI6 A;  3L8B A;  2OPQ A;  4CEA A;  2HB5 A;  2JLE A;  3AVL A;  3KK3 A;  4CJ4 A;  1U48 A;  1TK8 A;  4CF2 A;  2WOM A;  4C8N A;  2B6A A;  4Y1D A;  1TKX A;  5SWM A;  3OYH A;  1ASU A;  3ZT0 A;  1GOA A;  1RIL A;  3G0Z A;  4CGG A;  2HND A;  4RW7 A;  3AA2 A;  1ZBU A;  5DK5 A;  2OPS A;  1R0A A;  1RTH A;  1S1X A;  3DLG A;  1RBS A;  4I2Q A;  3VQP A;  4CHZ A;  1RT2 A;  3L2V A;  1BI4 A;  4F4K A;  4KHW A;  2G8W A;  3TWH A;  1LWE A;  4B9T A;  4ID1 A;  5JS2 A;  1JL1 A;  4DQQ A;  3RRG A;  1EXQ A;  1KVB A;  3OVN A;  4YFU A;  4FCY A;  3T19 A;  2YKM A;  1Q9X A;  1ZBI A;  4NCA A;  2YNF A;  4WE1 A;  1JLG A;  3TR8 A;  3PUF A;  4FM0 A;  2FBV A;  4IG3 A;  2WON A;  3DOL A;  4E1M A;  4FLT A;  2PYJ A;  5CYM A;  4OKE A;  4CEO A;  4DS4 A;  2G8F A;  4J2A A;  1HJR A;  2VWJ A;  3RMA A;  3QLH A;  3AVC A;  5KI6 A;  1BCM A;  3VN5 A;  3SCX A;  1TAU A;  4LH5 A;  2FBT A;  4CHQ A;  2E6M A;  3PX6 A;  1O1W A;  2IC3 A;  1JLB A;  1IO2 A;  3AV9 A;  3NF8 A;  4N56 A;  3O3G A;  3CQ8 A;  4C8O A;  1VSM A;  4GMJ B;  1NK4 A;  3TAB A;  2RPI A;  1BCO A;  1I3A A;  1JLQ A;  4KO0 A;  4BWJ A;  2BGG A;  1S6P A;  1NJY A;  3RMD A;  5C24 A;  3ZSR A;  4I9Q A;  1TV6 A;  4LY7 A;  1YT3 A;  3V1O A;  4F3O A;  1F21 A;  1S1T A;  5HRR A;  4ELT A;  3VQ7 A;  4DTS A;  4N47 A;  2YNI A;  4DQI A;  2A1S A;  3KLE A;  1J5O A;  4M45 A;  3ZSW A;  3OYN A;  4KHQ A;  3LAL A;  2RF2 A;  4DQS A;  3V81 A;  1W9H A;  3WNF A;  4BDY A;  2F8T A;  4CJR A;  2P1J A;  5C42 A;  1Q8I A;  1C1A A;  3P5J A;  4K8Z A;  4BDP A;  1CXQ A;  1XWL A;  3CM5 A;  1J9A A;  1T03 A;  4OLA A;  3C94 A;  3AVG A;  1S1V A;  4JRQ A;  3HST B;  3O3F A;  4O55 A;  3HK2 A;  3VQE A;  4CED A;  4CCH A;  1JLE A;  2A1R A;  1EX4 A;  4AHV A;  2HVI A;  2KW4 A;  1IKV A;  3LAK A;  1X9M A;  1WSG A;  3OJU A;  2GUI A;  4Q0B A;  3HO1 A;  1NOY A;  3QIP A;  1VSH A;  4CGF A;  2AJQ A;  1BIS A;  2BE2 A;  3ISN C;  3MAQ A;  3TAM A;  4R5P A;  4CFD A;  1SUQ A;  2IOC A;  4DLG A;  5J1E A;  1QTM A;  5HRN A;  3SUP A;  5I42 A;  1JL2 A;  3LWL A;  3LPT A;  3RR7 A;  3KD5 E;  4OGC A;  1NK6 A;  3OS2 A;  3BGR A;  5T7B A;  2XY5 A;  4KB0 A;  1UA0 A;  4OLB A;  5FRN A;  1CZB A;  4FK4 A;  3PO4 A;  1LW2 A;  1NK7 A;  1K6Y A;  4RW9 A;  2HHU A;  1RT6 A;  3RR8 A;  3IAY A;  1ZBH A;  4AH9 A;  1U47 A;  4DTP A;  2ETJ A;  4HCB A;  3DMJ A;  3DM2 A;  5HP1 A;  2Y1J A;  4ZTF A;  2QK9 A;  4CHO A;  2YV0 X;  3NF7 A;  1SKS A; 
#chains in the Genus database with same CATH topology
 4Z4G A;  4RG8 A;  4IFY A;  2A40 A;  4I6M A;  2HBK A;  4AIL C;  3L6Q A;  5FPE A;  4M63 C;  3HVT A;  3S41 A;  1SS6 A;  4E3S A;  1NK9 A;  3CC4 N;  4IDK A;  4CZJ A;  3WUH A;  3TSU A;  2FSN A;  3OY9 A;  4FWQ A;  3A5N C;  3P38 A;  2Z1I A;  2NRZ A;  2HHS A;  5M1F A;  2D5R A;  4YOW A;  4DR1 K;  1QSY A;  3AVB A;  4Z4H A;  1C0G A;  1WSH A;  3FGU A;  3VEW A;  4FLX A;  4B9M A;  4OPH A;  4EHT A;  4H03 B;  2OYQ A;  3SAH A;  1NK8 A;  4DFM A;  4O0J A;  4KAZ A;  3QBX A;  2O4I A;  4M3W A;  1S9E A;  2VG7 A;  3QEW A;  3HM9 A;  3VEX A;  4CZF A;  4NCG A;  2E4L A;  3B6O A;  1EET A;  3HP9 A;  1ASV A;  3B8A X;  3TU5 A;  1OVQ A;  5GAH P;  3ZSY A;  4JKE A;  4B9L A;  2QI2 A;  4KKO A;  3FZK A;  3SPZ A;  3CF5 L;  3UKU A;  3PX0 A;  3A2F A;  4BQZ A;  3TTD A;  3ZX3 A;  4YOT A;  5C25 A;  3LP2 A;  1RNH A;  4A2B A;  1M1K O;  2PAV A;  1GLD G;  3ZCM A;  2HHV A;  4DF8 A;  3C65 A;  2O8E A;  1U6Z A;  1VQN N;  3AY9 A;  3CCS N;  1MDU B;  2F9W A;  1D9D A;  2BAN A;  3C95 A;  4JYA K;  3CI5 A;  3ENO A;  4UY8 O;  3OS1 A;  4CD1 A;  2O8F B;  3HPH A;  4JI4 K;  1OH7 A;  1WOQ A;  4EZ9 A;  1HKB A;  1D8Y A;  2QKB A;  1M90 O;  3QET A;  1E4F T;  1GLB G;  4IG0 A;  4B9U A;  3VGM A;  1CZA N;  3AO2 A;  1SKW A;  3LDP A;  4GV6 A;  1XQS C;  4H5N A;  1T8E A;  2YI1 A;  4XH1 A;  4XH4 A;  2HW3 A;  4DSK A;  1DTT A;  2R7Y A;  1ATR A;  3CCU N;  1E4G T;  2GV9 A;  3HXM A;  2G8I A;  3FZM A;  3TAP A;  1HNX K;  1BO5 O;  4BWM A;  3I0R A;  2GUP A;  4JK7 A;  4BC4 A;  3CMA N;  5M1Q A;  1FK9 A;  2VG6 A;  4A59 A;  3LP0 A;  5J2Q A;  2GEM A;  3DLE A;  1IG8 A;  3M8R A;  1NK5 A;  3JAM O;  3ASM A;  2ZM6 K;  4NXN K;  4DTN A;  2FSJ A;  5D3G A;  4CGJ A;  1L3T A;  3S3M A;  1TKT A;  4YOX A;  4RW4 A;  4DR4 K;  3D7E O;  4G1Q A;  1QE1 A;  4NCB A;  2YJF A;  3CYM A;  4LF4 K;  3SNN A;  1LOT B;  3MN5 A;  4AF1 A;  2E8A A;  1T7P A;  3SUQ A;  1VSI A;  3KWG A;  3H1V X;  3V1R A;  1DLO A;  4KPY A;  2F9T A;  4FPA A;  1Z05 A;  3ENB A;  4K0K K;  2HNY A;  3W3D A;  4BVP A;  3SAG A;  4DFP A;  1W7A A;  1HQU A;  3ZYY X;  1U04 A;  5AQP A;  3DWL A;  4WF9 L;  5ELZ A;  4NYF A;  1VQP N;  3K59 A;  4FJL A;  3D2F B;  3SYZ A;  5C12 A;  3K0S A;  5LY3 A;  1WSJ A;  3GL1 A;  4DS5 A;  2QM1 A;  4DV2 K;  2GWJ A;  5AQY A;  1NGA A;  4JI2 K;  3TAF A;  1GLL O;  3O6W A;  3F9M A;  2O8F A;  3LPU A;  3ZX0 A;  3O9S A;  1REV A;  4FLU A;  4B9N A;  3WXK A;  3OS0 A;  1U45 A;  1CZ9 A;  1I39 A;  4K8X A;  2KFZ A;  5BRD A;  4JI7 K;  3TI0 A;  4BRF A;  4DQ8 A;  5FDL A;  1NGG A;  4X62 K;  3CXC M;  3ENH A;  4ICL A;  3RRH A;  1KLN A;  1QSL A;  1WB9 A;  4BAC A;  3E01 A;  1FKP A;  3ID6 A;  3DRS A;  3VQA A;  2P9L B;  4MLE A;  3KJV A;  3S9H A;  2P5G A;  2Q0U A;  3G6E N;  1BI4 B;  5AQL A;  2QWQ A;  2OZS A;  5H1S Q;  3NGI A;  3EZ5 A;  1QS4 A;  3MEE A;  2NUB A;  4OGE A;  3ZSV A;  2HBL A;  5GAG P;  4W5R A;  4FJK A;  1T3V A;  4M41 A;  3QML A;  1L3V A;  4ELV A;  2W6L A;  4MFB A;  3ZEU B;  3CJB A;  3KK2 A;  3MX2 A;  5KPR A;  3LM9 A;  4H4O A;  4PUO A;  3NH2 A;  3VPZ A;  4OX9 K;  2DTU A;  4HHT A;  3MXI A;  2Q3S A;  5BR9 A;  4BC3 A;  2D4W A;  2VGM A;  2W40 A;  3CFR A;  4JEP A;  3I55 N;  2JWL A;  1Z26 A;  2RKI A;  3O4W A;  1FW6 A;  3EE9 A;  4OKJ A;  4PWD A;  1ITG A;  3PLA A;  4B3M K;  2D1K A;  4BDZ A;  3O80 A;  4FK0 A;  4WQ5 C;  3CJ7 A;  3V9Z A;  1Q82 O;  5EX5 A;  1KCF A;  2W42 A;  4F2R A;  5BN9 A;  1VSE A;  3NHG A;  1VQM N;  1TVR A;  3CQY A;  3D2F A;  4K42 A;  2ZE2 A;  2QWR A;  3RWU A;  4QS7 A;  1KFS A;  4FWK A;  1QQO A;  5CR4 A;  5MLC Q;  1XMO K;  3BF1 A;  2ASP A;  3KLI A;  3TSQ A;  4CJU A;  1VQ9 N;  1HNW K;  4HUE A;  3R1X A;  2E6L A;  1K9M O;  2IS3 A;  4CZG A;  2DFE A;  4KHU A;  3TAR A;  5GIO A;  3ULE B;  3E9O A;  2X6N A;  3VMF B;  1XC9 A;  1KD1 O;  1NJW A;  1HYV A;  3QEX A;  4E7J A;  3E9P A;  4CJ7 A;  4QAG A;  2Z1J A;  4BQL A;  4DSE A;  4JRP A;  3L4Q A;  2E2P A;  3MWT A;  3DRR A;  4BR5 A;  3DLL L;  4KI6 A;  5M1P A;  2OPQ A;  4CJ4 A;  2QEX N;  4FVU A;  1GOA A;  1RIL A;  4CGG A;  2A41 A;  4RW7 A;  2P9L A;  1ZBU A;  1R0A A;  5KPZ A;  4KHW A;  1EQY A;  1BI4 A;  2JWK A;  5A2Q O;  1LWE A;  4DQQ A;  1KVB A;  3AAP A;  3T19 A;  1YIJ N;  1JLG A;  2P9N A;  4J8F A;  4LF5 K;  4IJN A;  3DOL A;  2VWB A;  4CEO A;  2G8F A;  4PL7 A;  3RMA A;  3AVC A;  5KI6 A;  5LJV A;  3SCX A;  3ZEU A;  4FOI A;  4LH5 A;  2FXU A;  5AQZ A;  4CZI A;  2FBT A;  2E6M A;  4BRK A;  4BG9 A;  1NK4 A;  1VQK N;  2RPI A;  1I3A A;  4KO0 A;  2PBD A;  2BGG A;  3ID8 A;  3ZSR A;  5AQQ A;  3ZX2 A;  1QZ6 A;  1F21 A;  4DTS A;  4DQI A;  1W97 L;  4BG8 A;  3WNF A;  4LF9 K;  4CJR A;  3P5J A;  4BDP A;  1R59 O;  1J9A A;  2E2Q A;  4OLA A;  4LF6 K;  2HST A;  4JRQ A;  4CED A;  1JLE A;  3BP8 A;  4AHV A;  2A1R A;  4MLH A;  5AQS A;  1X9M A;  4KH6 A;  3RSE B;  2AJQ A;  1VSH A;  4JI0 K;  1BIS A;  5FLX O;  2BE2 A;  3MAQ A;  4WFB L;  3UB5 A;  2IOC A;  5AZI B;  3THY A;  1JL2 A;  3LWL A;  1XNR K;  1ILY A;  4OGC A;  1EO1 A;  2D0P A;  5LL6 Z;  3OS2 A;  4XEI A;  4C23 A;  5FRN A;  1CZB A;  1LW2 A;  3TTF A;  1K6Y A;  3THW A;  3A8Y A;  1U47 A;  4DTP A;  3J8A A;  3DMJ A;  1ZXO A;  1RGI A;  3FR0 A;  4JD2 B;  3VES A;  4H0T B;  4BR9 A;  1U49 A;  2HOE A;  1B92 A;  3D45 A;  4CEZ A;  4MQ3 A;  3FZH A;  4M3U A;  2Z1H A;  4DTO A;  1IV0 A;  5HRS A;  2OTJ N;  1HYS A;  3AO1 A;  2YNG A;  4EP4 A;  4K25 A;  2UYT A;  3R6M A;  3PV8 A;  4N5S A;  5GIP A;  2YHW A;  3NDK A;  2VQE K;  1BQN A;  3SK3 A;  3WQT A;  3VQQ A;  4WCE L;  2D0O A;  4DU3 A;  1RTD A;  4KHN A;  1E3M A;  4FSV A;  1IKY A;  1HRH A;  3KZB A;  3MEG A;  4OJR A;  4AM6 A;  4W5T A;  5JLH A;  1VSD A;  5AQU A;  4CIG A;  4CJV A;  1TUU A;  4DQR A;  4DTM A;  3VQC A;  4BRC A;  4FWS A;  3S3N A;  3OYJ A;  4NYN A;  3P1G A;  3O5B A;  2O4G A;  2A3Z A;  2RE2 A;  5EY4 A;  3HTV A;  2Q1N A;  3LP1 A;  5GAE P;  2KZM A;  3IKM A;  4FW1 A;  4YHH K;  3QO9 A;  1UA1 A;  1B9F A;  2KLA A;  4E7I A;  2HMI A;  4FJX A;  2X6S A;  3CCR N;  1SAZ A;  4FWP A;  2IGI A;  3GBT A;  4E7H A;  1VRU A;  2ZD1 A;  1LWF A;  4WYB A;  1VHX A;  3D6R A;  4GVE A;  3EL2 A;  4CIE A;  1IBK K;  3FE1 A;  1C0T A;  3SAF A;  3UKU B;  1DGK N;  2XHB A;  1RBT A;  3H45 C;  1LCU A;  3OYI A;  3THV A;  1YJ9 N;  1YF5 L;  4M42 A;  5E41 A;  3U3G A;  4C8M A;  4F9O A;  3RSE A;  1VRT A;  3DI6 A;  1S6Q A;  3D0P A;  3OHR A;  5AQK A;  3K5N A;  4C8L A;  5AZI A;  1LAW A;  5E84 A;  4CEB A;  3CPE A;  3FLC O;  2OA8 A;  3SLC A;  1IG9 A;  1N33 K;  4PY5 A;  3H1Q A;  3GG4 A;  3ZT4 A;  3H46 O;  5F2R A;  1RFQ A;  4BGB A;  1JXB A;  4FLV A;  1KTQ A;  3AVF A;  3LDS A;  1C0F A;  4JD2 A;  1RT1 A;  1NGC A;  3S3O A;  3CHW A;  3SPY A;  4DFJ A;  1KAZ A;  4EFH A;  2GBZ A;  1TK0 A;  1K8K A;  2DY4 A;  1KVA A;  5JVG L;  1VSL A;  3CCQ N;  1WN7 A;  3AVI A;  1NKE A;  4CBU A;  1KFD A;  1N8R O;  5CZ1 A;  1XHX A;  3NF6 A;  3M1F A;  3B6P A;  5C2D A;  1A5W A;  4LFC K;  2O8C A;  1LWC A;  1RT7 A;  4HWI A;  5SZT A;  2QWN A;  4DTU A;  5BPM A;  4CHY A;  4B1U B;  1TKD A;  3N4P A;  5BPL A;  1NGE A;  2P9U B;  5J2P A;  1J54 A;  1YUW A;  5FPD A;  3SQ1 A;  2YHY A;  4KTW A;  1JCG A;  4WQ5 A;  2WTU A;  4YOR A;  1G15 A;  1N36 K;  3M8Q A;  5EXW A;  4A61 A;  2PY5 A;  3K5O A;  1K8A O;  2P51 A;  2Q0R A;  2WBN A;  5CYQ A;  2IAJ A;  2NZT A;  3J7A P;  4CF8 A;  5KTQ A;  4DF4 A;  1OH8 A;  3O4Q A;  2F96 A;  1T05 A;  1Q81 O;  4KRE A;  4JHD B;  4EP5 A;  4CGH A;  3C6H A;  1NOZ A;  4BGA A;  1QHA A;  4CFA A;  4JI8 K;  4CZK A;  1O13 A;  3C7N B;  4KFB A;  4OKK A;  1LW0 A;  3EKU A;  2RHK A;  3A5M C;  2QKK A;  3MX5 A;  1B9D A;  3F9K A;  3MDQ A;  5F0X A;  4MDB A;  4JI5 K;  5JLF A;  3CJC A;  1QQN A;  2A6A A;  3QNO A;  4DSJ A;  3NGY A;  4G9Z A;  1WSF A;  5AFU H;  4BRQ A;  5AQT A;  5LMN K;  4CEE A;  1T6D A;  1NBW A;  4FLZ A;  1S9G A;  4O0I A;  3EE8 A;  4FJ7 A;  3TAN A;  1HQE A;  1VK0 A;  1BOT O;  1WNS A;  2XRI A;  3VGL A;  2P9S B;  1KAY A;  3KKS A;  4DSL A;  5KQD A;  3M8P A;  3OYL A;  3AA5 X;  3C6A A;  1YXQ A;  3ZT2 A;  5BRE A;  3F73 A;  3U6F A;  3CCJ N;  4E89 A;  3IUC A;  3LWM A;  2X78 A;  1ATN A;  5IWA K;  3E9L A;  1RBU A;  1C1B A;  4JS5 A;  3V1Q A;  2OPP A;  2A5X A;  3HM8 A;  3TSP A;  2ZF5 O;  3UKR B;  4OPJ A;  4IOA L;  5LMU K;  4B1Z A;  3IMX A;  4O5F A;  3IDH A;  3VF6 A;  3NVK A;  3OYB A;  1RT4 A;  5AQW A;  3ZT1 A;  3SV4 A;  2IVN A;  1JCE A;  2QWM A;  1JXE A;  2Z1G A;  1RT3 A;  3CFO A;  1VSF A;  4L8R B;  3R3L A;  2HF3 A;  2HMP A;  3VA0 A;  4H5T A;  1SZ2 A;  4V19 S;  3L3U A;  5AQX A;  3ALY A;  2OTL N;  3KIO A;  4I7F A;  3AO3 A;  3U9Z A;  2FC0 A;  1TGO A;  4BRO A;  4CER A;  4YOY A;  1RT5 A;  3HI0 A;  4E0D A;  4LF8 K;  4M3Z A;  1N6Q A;  1BUP A;  1Z25 A;  2P9U A;  3QFU A;  3VTH A;  3NE6 A;  4CJL A;  4LFB K;  1D5A A;  3QEP A;  4WQ4 A;  1Q7Y O;  5J2N A;  4KB1 A;  3OYF A;  3V9W A;  3LDQ A;  1WAJ A;  3SJJ A;  3NF9 A;  2GEL A;  4FYD A;  1QHT A;  4JHD A;  4PHT X;  2NRX A;  3KKR A;  2EWS A;  2QWL A;  3LAN A;  3NH1 A;  3T69 A;  4DTR A;  3R8E A;  1C0U A;  3C7N A;  4X65 K;  4WFA L;  3HVR A;  2FBY A;  1KVC A;  5TKY A;  1NKB A;  4CK1 A;  1T6C A;  4PL8 A;  4CJF A;  4FL9 A;  2YHA A;  3ZSX A;  1Z6R A;  5KRT A;  4FJH A;  4B8A B;  2E1Y A;  1DT9 A;  1TK8 A;  4A62 A;  3QDK A;  3OYH A;  2VQF K;  3FZL A;  3G0Z A;  2P9S A;  1RTH A;  4I2Q A;  1S1X A;  3DLG A;  4CHZ A;  1X3M A;  4B9T A;  4ID1 A;  4BRG A;  1KAX A;  4FCY A;  2YKM A;  1KXP A;  4NCA A;  2IVO A;  4IO8 A;  4LF7 K;  4WE1 A;  3LM2 A;  3UKR A;  4BRA A;  4E1M A;  2P9I B;  1HJR A;  1NLV A;  3F2K A;  1TAU A;  3VET A;  3L0Q A;  1EWQ A;  2IC3 A;  3AV9 A;  3A5L C;  3NF8 A;  1VSM A;  4GMJ B;  2P9N B;  1BG3 A;  2NRW A;  1BCO A;  4BWJ A;  1JLQ A;  2Q36 A;  2O8B B;  4BR4 A;  1XMQ K;  4I9Q A;  4F3O A;  4ELT A;  3VQ7 A;  4N47 A;  3TTC A;  4A5B A;  4HTL A;  3V81 A;  2NRT A;  2F8T A;  4IFE A;  2E20 A;  3VEZ A;  1Y64 A;  3O08 A;  1VQL N;  1T03 A;  3SBT A;  4JKA A;  3C94 A;  3AVG A;  1S1V A;  4CD3 A;  4O55 A;  3I8B A;  4CCH A;  4X64 K;  3LAK A;  5BPN A;  3DAW A;  4CGF A;  3ISN C;  1JCF A;  3TAM A;  3RR7 A;  1QTM A;  5I42 A;  2QWO A;  4OLB A;  1UA0 A;  4DV4 K;  1NK7 A;  4RW9 A;  3RR8 A;  4AH9 A;  2ETJ A;  4BRL A;  3DM2 A;  4ZTF A;  4CHO A;  2QXL A;  2YV0 X;  2WUS A;  1SKS A;  3DLR A;  1TL1 A;  3DJC A;  5JVH L;  3IRX A;  4CJP A;  4IFV A;  1BHL A;  3NCI A;  3THY B;  1NK0 A;  1NU0 A;  3AVK A;  4B3T K;  4O4G A;  3C6T A;  1HNV A;  3ITH A;  3THW B;  3CJA A;  3LDL A;  2G8V A;  1IKW A;  4JNE A;  4CJS A;  4CEC A;  3ZSO A;  4YOU A;  1MWK A;  3WNH A;  5ADX A;  1SV5 A;  3CET A;  4JKC A;  4DKW A;  5I9E B;  3CD6 N;  3G10 A;  1VSJ A;  4A57 A;  1J6Z A;  2RN2 A;  3C0B A;  4RW6 A;  2F8S A;  2I5J A;  2F4V K;  1FKO A;  2YNH A;  4DR7 K;  1YJW N;  1HNI A;  2G8U A;  1ZBL A;  4H5R A;  4KTZ A;  4RW8 A;  3CCE N;  1NGB A;  1BIU A;  4LFA K;  2P9I A;  4NXM K;  1YI2 N;  2V7Z A;  1V4S A;  3SQ0 A;  1KRP A;  4CFB A;  4J2D A;  1LV5 A;  3BY5 A;  1L5U A;  5AQJ A;  3AVM A;  1X9J A;  2DPN A;  3LL3 A;  2BH1 A;  2HHT A;  4TSX A;  4E19 A;  2O8B A;  4IEE A;  4ID5 A;  4JKD A;  3ULD A;  4BRH A;  3RMB A;  1X9W A;  1N32 K;  4IWV A;  3BZK A;  5JS1 A;  2GWK A;  1ZBF A;  3H3N O;  4EHU A;  4XH5 A;  3HBT A;  3T1H K;  4H8K A;  1JLF A;  4KHS A;  4KHP K;  3V9U A;  1P90 A;  2ASO A;  1EP4 A;  4M3X A;  1NMD A;  1H1V A;  2KTQ A;  3M8S A;  1TKZ A;  4ELU A;  1W0H A;  4DB3 A;  3QEI A;  3VTI A;  4QS9 A;  1NJI O;  4FO0 A;  1EKE A;  4EAH D;  3VEV A;  3TAQ A;  4FW2 A;  1HPZ A;  5CE3 A;  3BZC A;  3R9P A;  3QNN A;  3T3F A;  4ILH A;  2YKN A;  4FJJ A;  4CGI A;  2CGJ A;  4BE1 A;  1NG9 A;  4W5O A;  4IJA A;  4QS8 A;  3FFI A;  4HTU A;  3J7Y P;  1C0M A;  4CIF A;  3SV3 A;  4JAX A;  4DWI A;  1YTU A;  3V4I A;  1DKG D;  3TAG A;  1IJJ A;  2Q97 A;  3HPG A;  3VQ6 A;  3WQU A;  2VWK A;  3BEX A;  4CJE A;  1VQ6 N;  4NB4 A;  3THX B;  5AR0 A;  2H3G X;  4FLY A;  3LZJ A;  4MDA A;  4CZM A;  2GX9 A;  2D0B A;  4HUG A;  3V6D A;  3NGZ A;  5JIC A;  4LH4 A;  4IOX A;  4IOC L;  4DHY A;  4CK3 A;  3OYM A;  2HHW A;  4DFK A;  5C2F A;  4Q5V A;  4CZE A;  5AQG A;  4JK9 A;  2QA4 N;  4CFC A;  1C1C A;  3MED A;  2X74 A;  4GY2 B;  4R79 A;  4CF1 A;  3EEQ A;  1K8K B;  3SJH A;  1IKX A;  1TK5 A;  3SUO A;  1X1P A;  2HHX A;  3C6U A;  3SQ2 A;  5M1N A;  4YDU C;  1JLA A;  1VAZ A;  2NRV A;  5HBM A;  4DU1 A;  4B3S K;  5DM6 L;  1VQ7 N;  4BR2 A;  1TUY A;  4Z94 A;  4E7K A;  3CFP A;  4B3O A;  3HT3 A;  1RBV A;  1D4X A;  5GIN A;  2O8C B;  5KQ8 A;  4JLH A;  3O9R A;  4B08 A;  1YAG A;  2YJE A;  1MU2 A;  4YOV A;  1HMV A;  1OH6 A;  3QB0 A;  2UUC K;  5AQI A;  4GVM A;  3U9D A;  2ZJQ L;  4BR7 A;  1NGJ A;  1RDA A;  1S1W A;  3L2U A;  1WLJ A;  2PZS A;  4GKJ K;  4H5V A;  2A42 A;  2FBX A;  1GOB A;  2PYJ A;  2IIR A;  3L4I A;  3DLB A;  3HJF A;  3SQ4 A;  4IO9 L;  1RDC A;  4CI6 A;  4FK2 A;  4AHC A;  4CEF A;  3G71 N;  4DV6 K;  4FJI A;  4DV3 K;  2NRH A;  2W41 A;  4Y0W A;  3EY1 A;  4A2A A;  1CLQ A;  3QEV A;  1KQS M;  5C0Y A;  1NM1 A;  1P8Z A;  1QQM A;  4CBW A;  3KLF A;  4B9S A;  3DOK A;  2UXD K;  1GOC A;  3CPW M;  3E1Y A;  1ASW A;  2IDO A;  2VG5 A;  3SUN A;  2NNW A;  4DSF A;  3VEN A;  3K5L A;  4AM7 A;  4Y1C A;  3KTQ A;  3ATV A;  2NRR A;  4I2P A;  2BUP A;  1YJN N;  2F7T A;  3VQ9 A;  4E7L A;  4FM2 A;  4O5B A;  5I3U A;  4JI3 K;  1JKH A;  1RDB A;  2XY8 A;  4KBO A;  1SL1 A;  2CGK A;  2J4R A;  2QWP A;  1NGF A;  4CJW A;  4FM1 A;  4ZTJ A;  4BR0 A;  3THX A;  4LD0 A;  3KWI A;  2QTD A;  3J7Z O;  4LSN A;  5AQM A;  1HUX A;  3GOI A;  4AHR A;  4H0X B;  2ZJP L;  2PYL A;  4JS4 A;  2G8H A;  1VQO N;  4M3T A;  3WNE A;  5AQV A;  3KHY A;  3O3H A;  5AJ3 K;  4E1N A;  4FZZ A;  2ZWH A;  3QIO A;  4XIU A;  4CF0 A;  5AFU A;  2B4J A;  2ASM A;  4FJM A;  1JJ2 M;  3AVA A;  2IVP A;  3RMC A;  2FSK A;  1XC3 A;  2VGN A;  4IKF A;  1JLC A;  2OPR A;  4PKI A;  4M7Y A;  5AQO A;  4BE0 A;  4GV9 A;  3CJ1 A;  1TAQ A;  4N76 A;  2ITG A;  3HP6 A;  4F3T A;  1X3N A;  4RTF D;  2D0C A;  3PIP L;  5EU7 A;  4BRN A;  3AO4 A;  4FPB A;  1N5Y A;  3LDN A;  4CE9 A;  2E88 A;  1NMN A;  1V4T A;  1S3X A;  1RDD A;  3I33 A;  2LSN A;  2CH6 A;  3O9U A;  5JMV A;  3QER A;  4FJ5 A;  4CJT A;  3T1A A;  2G8K A;  3WXM B;  4H0P A;  4DQP A;  4AHS A;  3EYZ A;  3CM6 A;  4C1N K;  1SQK A;  3VA3 A;  3AVH A;  3IS9 A;  2UUB K;  1HNZ K;  5K14 A;  1I94 K;  1Q18 A;  5KGW A;  1IBM K;  4DR2 K;  4PQU A;  5AQR A;  3V9S A;  3VF2 A;  3KLH A;  4EIA A;  3UE5 A;  4U7B A;  1NJZ A;  3K2P A;  2Q2R A;  3EO3 A;  3MN6 A;  5M1K A;  3LAM A;  3MK6 A;  3MN7 A;  2E5L K;  3ZLJ A;  1RCH A;  3MEC A;  2ATQ A;  3HOT A;  4CEA A;  3KK3 A;  2HB5 A;  3AVL A;  5FPN A;  1QVG M;  1VQ4 N;  4CF2 A;  2WOM A;  4C8N A;  4Y1D A;  1TKX A;  3ZT0 A;  1BWF O;  2HND A;  3AA2 A;  4NO7 A;  3A5O C;  2OPS A;  4FOE A;  4F4K A;  2G8W A;  3TWH A;  2AP1 A;  4DV1 K;  3WT0 A;  1JL1 A;  2UUA K;  1EXQ A;  2ITM A;  1ZBI A;  3TR8 A;  4IZ9 A;  2O8D B;  2P9P A;  3CME N;  5CYM A;  4DS4 A;  5GAD P;  2VWJ A;  3QLH A;  1ZBS A;  1BCM A;  3OTO K;  3VEO A;  4CHQ A;  3W0L A;  1IO2 A;  4GNI A;  4N56 A;  3O3G A;  3CQ8 A;  4C8O A;  5EVZ A;  2I7N A;  5BR8 K;  4L3Q A;  4BRD A;  5C24 A;  1TV6 A;  4LY7 A;  1YT3 A;  5HRR A;  2A1S A;  3AAR A;  3E66 A;  3OYN A;  4AQY K;  1GLE G;  4BDY A;  5CHI A;  2P1J A;  5F1X A;  1Q8I A;  1C1A A;  4K8Z A;  3P4I A;  1CXQ A;  3O9T A;  2CGL A;  3HST B;  3O3F A;  3HK2 A;  1OKJ A;  2HVI A;  3A0I X;  1IKV A;  3O9Q A;  1WSG A;  3OJU A;  1S22 A;  4MO4 A;  3HO1 A;  4NLB A;  3JS6 A;  4BRP A;  4R5P A;  4BRI A;  4CFD A;  1SUQ A;  3SUP A;  4DV7 K;  3BGR A;  5T7B A;  4KB0 A;  2YHX A;  1MWM A;  4KH5 A;  5C10 A;  3WXJ A;  4FK4 A;  2HHU A;  3IAY A;  4HCB A;  1ESV A;  3VGK A;  4K41 A;  5HP1 A;  2Y1J A;  2QK9 A;  4U67 L;  4LC9 B;  3NF7 A;  1TL3 A;  3VQ5 A;  5FRM A;  2QW9 A;  1D9F A;  5M1O A;  3CER A;  1U2V B;  3PX4 A;  3JXU A;  3GDQ A;  4DR6 K;  1NNE A;  4CJ3 A;  3I8D A;  2FF6 A;  2HHQ A;  4YY3 K;  4PKH A;  2HHH K;  1GLJ O;  3SBG A;  3HZ6 A;  1NWK A;  4B9Q A;  4J2E A;  3WNG A;  1RBR A;  3GE1 A;  1XNQ K;  2KKZ A;  3QIC A;  4PKG A;  3SMS A;  1HKG A;  3L2W A;  1W2B M;  1Q86 O;  5HL7 L;  2Y1I A;  1SKR A;  4DSI A;  4BE2 A;  3WXL A;  5AZJ B;  4C8K A;  4EZ6 A;  4M7X A;  4IEI A;  4FJG A;  1L3U A;  1IH7 A;  3FFK B;  1L3S A;  2YX6 A;  3I56 N;  1WAF A;  4ZHR A;  4W5Q A;  3OYE A;  5AQH A;  2O8D A;  4HUF A;  4YDU A;  4BRM A;  2KQ2 A;  3AVN A;  3U8X A;  4ISF A;  4FWR A;  2ZQB A;  3CIP A;  1OH5 A;  2WFB A;  5KRS A;  1Q9Y A;  4DTJ A;  1RTI A;  4J2B A;  3H3O B;  3VF4 A;  1S5J A;  4FWL A;  5B8H A;  3MMV A;  1YTA A;  3OYA A;  1WBD A;  4GV3 A;  3K9K A;  5HOO A;  4YNQ A;  4JK8 A;  2FLO A;  5DMR A;  3PIO L;  1XI1 A;  2B5J A;  2BDP A;  4CHP A;  1RTJ A;  2KFN A;  1S1U A;  4DU4 A;  1UOC A;  1C6V A;  4OPK A;  2BTF A;  3VQ4 A;  4QCL A;  3AA3 A;  2FF3 B;  2DFF A;  4Z4C A;  2JGU A;  3CCM N;  1SL2 A;  3L2R A;  4DV0 K;  1TYQ B;  4KI4 A;  3Q7B A;  1HJO A;  4KV8 A;  3V9X A;  3G25 A;  4Z4I A;  3J80 O;  3OJS A;  3D2E B;  4BC2 A;  3AVJ A;  3ZSQ A;  4FZX C;  5IT9 O;  2VCP A;  3JYT A;  3AO5 A;  4B1Y B;  4PA1 A;  2DFH A;  2V7Y A;  3AGR A;  3LDO A;  4JI1 K;  3HPO A;  3O4N A;  1QQC A;  4RCH A;  3QIN A;  5FRO A;  4FVM A;  1YVU A;  4CBX A;  1BIZ A;  3P31 A;  2Q31 A;  2XY7 A;  1YIT N;  3BDP A;  1MA9 B;  4CGD A;  3AA4 A;  1ZYQ A;  3UIQ A;  1ZC6 A;  2YCH A;  3OYG A;  3M3Z A;  1U2V A;  2I7P A;  1BDG A;  4JV5 K;  1N34 K;  4FWO A;  4IBN A;  4LSL A;  3OYC A;  4Z4E A;  4CES A;  2V51 B;  4WFN L;  3PO5 A;  1QVF M;  1NJX A;  3OBW A;  3CQX A;  4H4M A;  3DLK A;  4OO1 J;  2E2O A;  3IG1 A;  3QFP A;  1X9S A;  4H0O A;  3KD1 E;  5KPT A;  1GLC G;  1ATS A;  3F5T A;  4JKH A;  2ZGY A;  5AZJ A;  3QBW A;  3NAE A;  4ILG B;  3VQB A;  4F2S A;  3KLG A;  3OYK A;  2YHB A;  4AHU A;  4CJQ A;  3MXM A;  3P83 D;  1J5E K;  5CZ2 A;  1XUP O;  2UXC K;  5J2M A;  3QES A;  4FWN A;  5AQF A;  1HLU A;  3BF3 A;  1UAX A;  3CC2 N;  3Q7C A;  3EN9 A;  1VQ5 N;  3OYD A;  5HRP A;  4JKG B;  4B1W B;  3RTV A;  1RDU A;  3DYA A;  1LAV A;  3U4L A;  2EX3 A;  3NFA A;  2KZZ A;  1IBL K;  2W6K A;  4DUY K;  4ISE A;  3KK1 A;  1SL0 A;  2HBJ A;  3L3V A;  4M3R A;  3ATU A;  4HVJ A;  3PSI A;  3I0S A;  4W5N A;  3L2Q A;  3DXM B;  1HKC A;  4H0V B;  3M5R A;  3P39 A;  4DUZ K;  4HCC A;  3ZSZ A;  1U4B A;  3SZ2 A;  3HYF A;  3WXI A;  5AQN A;  4CZL A;  1BGX T;  3CJ9 A;  4DG1 A;  3K58 A;  4B9V A;  1A5X A;  2OZM A;  3MXJ A;  4FLW A;  2UU9 K;  4UQG A;  4N41 A;  4ILJ A;  1TYQ A;  4E1J A;  3DRP A;  1J53 A;  3D2E A;  3NH0 A;  4KHY A;  1EWR A;  4GW6 A;  4ISG A;  3HSC A;  3ZT3 A;  3NBP A;  3VQ8 A;  4B8C A;  3EKS A;  1K73 O;  1UWB A;  3MCA B;  4DV5 K;  5HLF A;  1KLM A;  3PSF A;  4Z4F A;  4B3R K;  1HX1 A;  4MO5 A;  3HL8 A;  4M3Y A;  4CF9 A;  4O8U A;  1CXU A;  1KC8 O;  2P5O A;  5LJW A;  4NLC A;  5BRF A;  2AA4 A;  1DEJ A;  1FXX A;  4IDH A;  1YVN A;  2HBM A;  4CHN A;  3OW2 M;  4B1V A;  1DTQ A;  4FZY A;  4C1N I;  4FJN A;  2VYP A;  4CVN E;  4F8R A;  3TAE A;  4CJ5 A;  4BC5 A;  2HVH A;  3DLH A;  4JKB A;  4WQ4 C;  1A5V A;  5TKW A;  3H08 A;  4KTQ A;  1HPM A;  2E1Z A;  4AHT A;  4BRE A;  1NKC A;  2OAN A;  4DMN A;  1NGI A;  4QOZ B;  2EHG A;  3DXK B;  3FZF A;  3VEY A;  3J81 O;  3M6G A;  1BA0 A;  1VSK A;  1GLF O;  4O44 A;  4CJK A;  1Y97 A;  3LZI A;  3SI6 A;  2XO7 A;  4KH4 A;  3ZET B;  3U3Y A;  2KHO A;  4GKK K;  1RDW X;  3CCL N;  5KGX A;  4KRF A;  2V52 B;  1WSE A;  2QXF A;  5E26 A;  4Z0U A;  1NGD A;  1XHZ A;  3LP3 A;  3JSM A;  3AAQ A;  3VOV A;  5ADX H;  2UXB K;  1HYZ A;  4DR3 K;  4JKG A;  3CG7 A;  1QSS A;  5DM7 L;  1KSP A;  4CEQ A;  2P9K B;  1OVY A;  5HRO A;  5FPM A;  3ULE A;  1HR0 K;  3DXM A;  3O8M A;  1FJG K;  3AGK A;  2OCE A;  2WC9 A;  2HNZ A;  4FJ8 A;  2GTD A;  1WSI A;  1T44 A;  4CZH A;  5BRH A;  4I9L A;  3WEE B;  1QZ5 A;  3K57 A;  4X66 K;  5C15 A;  4DTX A;  5BN8 A;  4I6M B;  4OVL A;  2D0A A;  3O1W A;  4FWM A;  3N4Q A;  1BQM A;  4BVO A;  3VER A;  3NMU A;  3K5M A;  5CY4 A;  1BL3 A;  3VQD A;  1BU6 O;  5EOY A;  4DLE A;  4CK2 A;  2XY6 A;  3T7Z A;  1G99 A;  1WBB A;  3PY8 A;  4FJ9 A;  3L8B A;  2JLE A;  1U48 A;  3KK7 A;  3RVC A;  2B6A A;  1YHQ N;  5SWM A;  1ASU A;  3T1Y K;  2HF4 A;  5DK5 A;  2PFU A;  3VQP A;  4FXD A;  1RBS A;  3MWP A;  3L2V A;  1RT2 A;  5JS2 A;  2ZJR L;  1S72 N;  3RRG A;  3OVN A;  4YFU A;  3MN9 A;  3HRG A;  1Q9X A;  2YNF A;  3PUF A;  3NVM A;  4FM0 A;  2FBV A;  3IFR A;  4H0Y B;  2WON A;  4IG3 A;  4FLT A;  3H6E A;  4OKE A;  4J2A A;  4IXC A;  4K43 A;  1BA1 A;  2ZGZ A;  3VN5 A;  4DR5 K;  3CC7 N;  4BY9 C;  4RWT A;  2CH5 A;  3PX6 A;  1O1W A;  1JLB A;  4OPA A;  4CW7 B;  1VQ8 N;  4DCH A;  3TAB A;  3DXK A;  1S6P A;  2P9P B;  1NJY A;  3RMD A;  3MCP A;  3V1O A;  1S1T A;  2O8E B;  3OBY A;  2YNI A;  3ZET A;  4JI6 K;  3KLE A;  1J5O A;  2E2N A;  4M45 A;  3ZSW A;  4KHQ A;  3LAL A;  2RF2 A;  3OA9 A;  4DQS A;  3EZW A;  1W9H A;  5C42 A;  1XWL A;  3CM5 A;  2NLX A;  3O1B A;  3VQE A;  3G4S N;  1EX4 A;  3CCV N;  2KW4 A;  4B1X B;  4JKF A;  2GUI A;  2P9K A;  4Q0B A;  4A5A A;  1NOY A;  3QIP A;  1NGH A;  1GLA G;  3HOS A;  3K9J A;  4DLG A;  5J1E A;  5HRN A;  3LPT A;  3KD5 E;  3SMP A;  1NK6 A;  4JN4 A;  1WUA A;  2XY5 A;  4H5W A;  3KVG A;  3PO4 A;  1RT6 A;  1ZBH A;  4O8K A;  3TPQ A;  3BUZ B;  3WEE A; 
#chains in the Genus database with same CATH homology
 4Z4G A;  1TL3 A;  3DLR A;  1TL1 A;  4IFY A;  4RG8 A;  3VQ5 A;  5FRM A;  3IRX A;  4CJP A;  4AIL C;  4IFV A;  1BHL A;  3NCI A;  1U49 A;  1D9F A;  1NK0 A;  1B92 A;  3PX4 A;  3AVK A;  3D45 A;  4MQ3 A;  4O4G A;  4CEZ A;  3HVT A;  3C6T A;  1HNV A;  3ITH A;  4M3U A;  2Z1H A;  4CJ3 A;  3I8D A;  4E3S A;  4DTO A;  5HRS A;  1NK9 A;  2HHQ A;  4IDK A;  1HYS A;  2G8V A;  1IKW A;  3AO1 A;  2YNG A;  4EP4 A;  3OY9 A;  4J2E A;  3PV8 A;  4N5S A;  4CJS A;  3WNG A;  4CEC A;  1RBR A;  2Z1I A;  3ZSO A;  3NDK A;  1BQN A;  2HHS A;  2D5R A;  3WNH A;  3VQQ A;  4KHN A;  4DU3 A;  1RTD A;  1QSY A;  1IKY A;  3AVB A;  1HRH A;  3MEG A;  4OJR A;  1SV5 A;  1WSH A;  4Z4H A;  3L2W A;  4FLX A;  4B9M A;  3G10 A;  2Y1I A;  1VSJ A;  1SKR A;  4DSI A;  4RW6 A;  2RN2 A;  4W5T A;  4BE2 A;  2OYQ A;  2F8S A;  4C8K A;  4EZ6 A;  1NK8 A;  4FJG A;  1L3U A;  4DFM A;  1VSD A;  1IH7 A;  1L3S A;  2I5J A;  4O0J A;  4KAZ A;  1FKO A;  2YNH A;  1WAF A;  2O4I A;  4M3W A;  1HNI A;  2G8U A;  1ZBL A;  1S9E A;  2VG7 A;  4CIG A;  4ZHR A;  4W5Q A;  3OYE A;  4KTZ A;  4CJV A;  4RW8 A;  3QEW A;  3HM9 A;  4DQR A;  4NCG A;  4HUF A;  2E4L A;  1BIU A;  3B6O A;  1EET A;  3HP9 A;  3VQC A;  4DTM A;  3S3N A;  3OYJ A;  1ASV A;  2KQ2 A;  3AVN A;  4NYN A;  3P1G A;  3SQ0 A;  1KRP A;  2O4G A;  2ZQB A;  4CFB A;  4J2D A;  1LV5 A;  5KRS A;  3ZSY A;  1L5U A;  1Q9Y A;  3AVM A;  3LP1 A;  4B9L A;  2KZM A;  4DTJ A;  4KKO A;  1RTI A;  4FW1 A;  3QO9 A;  4J2B A;  4W5N A;  3SPZ A;  1UA1 A;  1B9F A;  1S5J A;  3PX0 A;  4E7I A;  3A2F A;  2HHT A;  2HMI A;  4FJX A;  2X6S A;  4TSX A;  4E19 A;  5C25 A;  3LP2 A;  1YTA A;  3OYA A;  1RNH A;  2IGI A;  3RMB A;  4ID5 A;  3ULD A;  4E7H A;  4YNQ A;  1X9W A;  3ZCM A;  2HHV A;  1VRU A;  4DF8 A;  2ZD1 A;  1LWF A;  5DMR A;  1XI1 A;  2B5J A;  2BDP A;  4CHP A;  5JS1 A;  1RTJ A;  1ZBF A;  1D9D A;  2KFN A;  4H8K A;  2BAN A;  1JLF A;  4KHS A;  1S1U A;  3C95 A;  4CIE A;  3V9U A;  1UOC A;  4DU4 A;  1C6V A;  4OPK A;  1C0T A;  1EP4 A;  3OS1 A;  4M3X A;  3VQ4 A;  1RBT A;  2XHB A;  4QCL A;  2KTQ A;  3AA3 A;  3M8S A;  1TKZ A;  3HPH A;  2DFF A;  3OYI A;  4ELU A;  1W0H A;  3THV A;  3QEI A;  4Z4C A;  4EZ9 A;  2JGU A;  1D8Y A;  5E41 A;  4M42 A;  2QKB A;  1SL2 A;  1EKE A;  3L2R A;  3U3G A;  3QET A;  4C8M A;  3TAQ A;  4KI4 A;  4FW2 A;  1HPZ A;  4KV8 A;  3V9X A;  4Z4I A;  1VRT A;  3OJS A;  4IG0 A;  3QNN A;  3AVJ A;  3T3F A;  4B9U A;  3DI6 A;  1S6Q A;  2YKN A;  3D0P A;  3ZSQ A;  3K5N A;  4C8L A;  4FJJ A;  4CGI A;  4BE1 A;  4W5O A;  4FZX C;  3AO2 A;  1LAW A;  4CEB A;  3FFI A;  3JYT A;  4HTU A;  3AO5 A;  1SKW A;  2OA8 A;  4PA1 A;  2DFH A;  1T8E A;  1IG9 A;  1C0M A;  4PY5 A;  3HPO A;  4CIF A;  3O4N A;  3SV3 A;  2HW3 A;  4DWI A;  4DSK A;  3V4I A;  3ZT4 A;  1QQC A;  1YTU A;  3TAG A;  1DTT A;  2R7Y A;  3QIN A;  5FRO A;  3HPG A;  1JXB A;  4FVM A;  3VQ6 A;  1YVU A;  4FLV A;  1KTQ A;  2GV9 A;  3AVF A;  2VWK A;  1BIZ A;  3HXM A;  3LDS A;  4CJE A;  2G8I A;  2XY7 A;  1RT1 A;  3BDP A;  3S3O A;  3TAP A;  4CGD A;  3SPY A;  3AA4 A;  4BWM A;  3I0R A;  1ZYQ A;  4DFJ A;  3UIQ A;  4FLY A;  3LZJ A;  3OYG A;  2D0B A;  1FK9 A;  2VG6 A;  4HUG A;  2GBZ A;  3V6D A;  4IBN A;  3NGZ A;  4LSL A;  3OYC A;  1TK0 A;  4Z4E A;  3LP0 A;  5J2Q A;  2DY4 A;  4LH4 A;  4CES A;  1KVA A;  4CK3 A;  3OYM A;  2HHW A;  3PO5 A;  3DLE A;  4DFK A;  3M8R A;  1VSL A;  1NK5 A;  3ASM A;  4Q5V A;  1NJX A;  1WN7 A;  4DTN A;  5D3G A;  4H4M A;  3AVI A;  4CGJ A;  3DLK A;  1NKE A;  3S3M A;  1TKT A;  1L3T A;  1KFD A;  4RW4 A;  3IG1 A;  4CFC A;  1C1C A;  5CZ1 A;  3MED A;  2X74 A;  4G1Q A;  1XHX A;  1QE1 A;  3NF6 A;  1X9S A;  4NCB A;  3B6P A;  4CF1 A;  3KD1 E;  1A5W A;  1IKX A;  3CYM A;  3SNN A;  1TK5 A;  3NAE A;  3SUO A;  3VQB A;  1X1P A;  1T7P A;  3SUQ A;  4F2S A;  1VSI A;  3C6U A;  1LWC A;  1RT7 A;  3OYK A;  2YHB A;  4AHU A;  4CJQ A;  5SZT A;  3KLG A;  4DTU A;  3SQ2 A;  3MXM A;  1JLA A;  3P83 D;  3V1R A;  5CZ2 A;  1DLO A;  5HBM A;  4CHY A;  1TKD A;  4KPY A;  4DU1 A;  5J2M A;  3QES A;  2HNY A;  5J2P A;  1J54 A;  1UAX A;  4E7K A;  3CFP A;  4B3O A;  4DFP A;  3HT3 A;  1HQU A;  1RBV A;  3OYD A;  1U04 A;  5HRP A;  3SQ1 A;  4JLH A;  4KTW A;  4B08 A;  3RTV A;  1MU2 A;  3DYA A;  1LAV A;  1HMV A;  2EX3 A;  4NYF A;  3NFA A;  2KZZ A;  1G15 A;  4GVM A;  3M8Q A;  3KK1 A;  3K59 A;  1SL0 A;  2PY5 A;  1RDA A;  1S1W A;  3K5O A;  4FJL A;  3L2U A;  2P51 A;  3SYZ A;  1WLJ A;  5CYQ A;  2IAJ A;  2PZS A;  2FBX A;  1GOB A;  3L3V A;  4M3R A;  4HVJ A;  1WSJ A;  4CF8 A;  5KTQ A;  3I0S A;  4DS5 A;  4DF4 A;  3DLB A;  3L2Q A;  3HJF A;  3O4Q A;  3SQ4 A;  2F96 A;  1T05 A;  1RDC A;  3TAF A;  4KRE A;  4EP5 A;  4FK2 A;  4CGH A;  4AHC A;  4CEF A;  4HCC A;  4FJI A;  3ZSZ A;  1NOZ A;  1U4B A;  3SZ2 A;  4CFA A;  3HYF A;  1CLQ A;  1BGX T;  3EY1 A;  3QEV A;  3LPU A;  4DG1 A;  1REV A;  3K58 A;  4B9V A;  1A5X A;  2OZM A;  4KFB A;  3MXJ A;  4OKK A;  4FLU A;  4B9N A;  1LW0 A;  3KLF A;  4FLW A;  4N41 A;  4UQG A;  4B9S A;  3OS0 A;  3DOK A;  2QKK A;  4FXD A;  1GOC A;  1B9D A;  1U45 A;  1CZ9 A;  3F9K A;  1ASW A;  3DRP A;  1J53 A;  1I39 A;  2IDO A;  4K8X A;  2VG5 A;  3SUN A;  2KFZ A;  3NH0 A;  4DSF A;  4GW6 A;  3TI0 A;  4KHY A;  3K5L A;  3ZT3 A;  3NBP A;  4Y1C A;  3NGY A;  3VQ8 A;  1WSF A;  5FDL A;  3QNO A;  3KTQ A;  4DSJ A;  4CEE A;  4B8C A;  4FLZ A;  4ICL A;  1S9G A;  1UWB A;  4O0I A;  3RRH A;  4I2P A;  1KLN A;  1QSL A;  4FJ7 A;  5HLF A;  3TAN A;  4BAC A;  3E01 A;  1HQE A;  3VQ9 A;  4E7L A;  1VK0 A;  1KLM A;  1WNS A;  2XRI A;  1FKP A;  4FM2 A;  3DRS A;  3KKS A;  4O5B A;  3VQA A;  5I3U A;  3KJV A;  4DSL A;  4Z4F A;  1JKH A;  3M8P A;  3S9H A;  1RDB A;  3OYL A;  3AA5 X;  3ZT2 A;  2P5G A;  2XY8 A;  1BI4 B;  3F73 A;  1SL1 A;  3HL8 A;  3U6F A;  2OZS A;  3NGI A;  4ZTJ A;  4FM1 A;  4CJW A;  3EZ5 A;  4M3Y A;  4E89 A;  1QS4 A;  3MEE A;  2NUB A;  3LWM A;  4LD0 A;  4CF9 A;  2X78 A;  1CXU A;  4OGE A;  2P5O A;  3ZSV A;  1RBU A;  1FXX A;  1C1B A;  4JS5 A;  3V1Q A;  2OPP A;  4CHN A;  4LSN A;  4W5R A;  1DTQ A;  4AHR A;  2PYL A;  4OPJ A;  4M41 A;  4JS4 A;  4FZY A;  2G8H A;  4FJK A;  1L3V A;  4FJN A;  4M3T A;  3WNE A;  4ELV A;  3OYB A;  1RT4 A;  4F8R A;  4MFB A;  3ZT1 A;  3O3H A;  4E1N A;  3SV4 A;  4CJ5 A;  3TAE A;  4FZZ A;  2Z1G A;  1JXE A;  3KK2 A;  1RT3 A;  3CFO A;  3QIO A;  4XIU A;  4H4O A;  4PUO A;  2HVH A;  1VSF A;  4CF0 A;  3NH2 A;  3DLH A;  4L8R B;  2HHX A;  2B4J A;  1A5V A;  2DTU A;  4FJM A;  3H08 A;  4KTQ A;  4AHT A;  4HHT A;  3MXI A;  2Q3S A;  1NKC A;  4QOZ B;  4DMN A;  3VA0 A;  2EHG A;  3AVA A;  3RMC A;  3CFR A;  3L3U A;  4O44 A;  1VSK A;  4CJK A;  4IKF A;  3LZI A;  1JLC A;  1Y97 A;  3ALY A;  3SI6 A;  1Z26 A;  2RKI A;  3KIO A;  2OPR A;  2XO7 A;  4OKJ A;  4I7F A;  4PWD A;  1ITG A;  3AO3 A;  3U3Y A;  2FC0 A;  1TGO A;  5KGX A;  4KRF A;  1WSE A;  4CER A;  1RT5 A;  4BE0 A;  2QXF A;  1TAQ A;  4E0D A;  4N76 A;  2ITG A;  4M3Z A;  3HP6 A;  4Z0U A;  1N6Q A;  4F3T A;  3NE6 A;  1Z25 A;  1XHZ A;  4BDZ A;  2D0C A;  3LP3 A;  4CJL A;  4FK0 A;  5EU7 A;  1D5A A;  3JSM A;  3QEP A;  3AO4 A;  1HYZ A;  1N5Y A;  3V9Z A;  4CE9 A;  3CG7 A;  1KCF A;  5J2N A;  2W42 A;  4KB1 A;  4F2R A;  1RDD A;  1QSS A;  3OYF A;  1KSP A;  2LSN A;  4CEQ A;  3QER A;  1VSE A;  3V9W A;  3NHG A;  4FJ5 A;  1TVR A;  3T1A A;  4CJT A;  2G8K A;  1WAJ A;  5HRO A;  3SJJ A;  3NF9 A;  2ZE2 A;  3RWU A;  4FYD A;  1QHT A;  1KFS A;  4AHS A;  4DQP A;  3EYZ A;  3CM6 A;  3VA3 A;  3KLI A;  4CJU A;  3AVH A;  3IS9 A;  3KKR A;  2HNZ A;  4FJ8 A;  5K14 A;  1WSI A;  3LAN A;  4HUE A;  2E6L A;  3NH1 A;  2IS3 A;  4I9L A;  5KGW A;  4DTR A;  2DFE A;  4KHU A;  1C0U A;  3TAR A;  3K57 A;  4PQU A;  4DTX A;  3HVR A;  2FBY A;  4OVL A;  3V9S A;  1KVC A;  3KLH A;  2D0A A;  2X6N A;  1BQM A;  1XC9 A;  1NJZ A;  1NJW A;  1HYV A;  3K2P A;  3K5M A;  3QEX A;  4E7J A;  5CY4 A;  4CK1 A;  1NKB A;  1BL3 A;  2Z1J A;  3LAM A;  4QAG A;  3VQD A;  4CJF A;  4DLE A;  4DSE A;  4CK2 A;  2YHA A;  3ZSX A;  4JRP A;  2XY6 A;  1RCH A;  3MEC A;  5KRT A;  2ATQ A;  3DRR A;  4FJH A;  4B8A B;  3PY8 A;  4FJ9 A;  4KI6 A;  3L8B A;  2OPQ A;  4CEA A;  2HB5 A;  2JLE A;  3AVL A;  3KK3 A;  4CJ4 A;  1U48 A;  1TK8 A;  4CF2 A;  2WOM A;  4C8N A;  2B6A A;  4Y1D A;  1TKX A;  5SWM A;  3OYH A;  1ASU A;  3ZT0 A;  1GOA A;  1RIL A;  3G0Z A;  4CGG A;  2HND A;  4RW7 A;  3AA2 A;  1ZBU A;  5DK5 A;  2OPS A;  1R0A A;  1RTH A;  1S1X A;  3DLG A;  1RBS A;  4I2Q A;  3VQP A;  4CHZ A;  1RT2 A;  3L2V A;  1BI4 A;  4F4K A;  4KHW A;  2G8W A;  3TWH A;  1LWE A;  4B9T A;  4ID1 A;  5JS2 A;  1JL1 A;  4DQQ A;  3RRG A;  1EXQ A;  1KVB A;  3OVN A;  4YFU A;  4FCY A;  3T19 A;  2YKM A;  1Q9X A;  1ZBI A;  4NCA A;  2YNF A;  4WE1 A;  1JLG A;  3TR8 A;  3PUF A;  4FM0 A;  2FBV A;  4IG3 A;  2WON A;  3DOL A;  4E1M A;  4FLT A;  2PYJ A;  5CYM A;  4OKE A;  4CEO A;  4DS4 A;  2G8F A;  4J2A A;  1HJR A;  2VWJ A;  3RMA A;  3QLH A;  3AVC A;  5KI6 A;  1BCM A;  3VN5 A;  3SCX A;  1TAU A;  4LH5 A;  2FBT A;  4CHQ A;  2E6M A;  3PX6 A;  1O1W A;  2IC3 A;  1JLB A;  1IO2 A;  3AV9 A;  3NF8 A;  4N56 A;  3O3G A;  3CQ8 A;  4C8O A;  1VSM A;  4GMJ B;  1NK4 A;  3TAB A;  2RPI A;  1BCO A;  1I3A A;  1JLQ A;  4KO0 A;  4BWJ A;  2BGG A;  1S6P A;  1NJY A;  3RMD A;  5C24 A;  3ZSR A;  4I9Q A;  1TV6 A;  4LY7 A;  1YT3 A;  3V1O A;  4F3O A;  1F21 A;  1S1T A;  5HRR A;  4ELT A;  3VQ7 A;  4DTS A;  4N47 A;  2YNI A;  4DQI A;  2A1S A;  3KLE A;  1J5O A;  4M45 A;  3ZSW A;  3OYN A;  4KHQ A;  3LAL A;  2RF2 A;  4DQS A;  3V81 A;  1W9H A;  3WNF A;  4BDY A;  2F8T A;  4CJR A;  2P1J A;  5C42 A;  1Q8I A;  1C1A A;  3P5J A;  4K8Z A;  4BDP A;  1CXQ A;  1XWL A;  3CM5 A;  1J9A A;  1T03 A;  4OLA A;  3C94 A;  3AVG A;  1S1V A;  4JRQ A;  3HST B;  3O3F A;  4O55 A;  3HK2 A;  3VQE A;  4CED A;  4CCH A;  1JLE A;  2A1R A;  1EX4 A;  4AHV A;  2HVI A;  2KW4 A;  1IKV A;  3LAK A;  1X9M A;  1WSG A;  3OJU A;  2GUI A;  4Q0B A;  3HO1 A;  1NOY A;  3QIP A;  1VSH A;  4CGF A;  2AJQ A;  1BIS A;  2BE2 A;  3ISN C;  3MAQ A;  3TAM A;  4R5P A;  4CFD A;  1SUQ A;  2IOC A;  4DLG A;  5J1E A;  1QTM A;  5HRN A;  3SUP A;  5I42 A;  1JL2 A;  3LWL A;  3LPT A;  3RR7 A;  3KD5 E;  4OGC A;  1NK6 A;  3OS2 A;  3BGR A;  5T7B A;  2XY5 A;  4KB0 A;  1UA0 A;  4OLB A;  5FRN A;  1CZB A;  4FK4 A;  3PO4 A;  1LW2 A;  1NK7 A;  1K6Y A;  4RW9 A;  2HHU A;  1RT6 A;  3RR8 A;  3IAY A;  1ZBH A;  4AH9 A;  1U47 A;  4DTP A;  2ETJ A;  4HCB A;  3DMJ A;  3DM2 A;  5HP1 A;  2Y1J A;  4ZTF A;  2QK9 A;  4CHO A;  2YV0 X;  3NF7 A;  1SKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...