2GUIA

Structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
b'ITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase III epsilon subunit
publication title Structure and Function of Cyclized Versions of the Proofreading Exonuclease Subunit E. coli DNA Polymerase III
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 58
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2guiA00
4AHVA 2G8UA 4DMNA 3OYHA 1RNHA 3DOKA 2VWJA 1U47A 4F3OA 4CJ4A 2ZQBA 3RMDA 1RBRA 3OYFA 1BCMA 1TL3A 4AHRA 2VG6A 3D45A 1RDCA 5CZ1A 4F2RA 4PWDA 4DTMA 3AVNA 3C6UA 3AVJA 3ASMA 5HROA 1ZBLA 2YNGA 4W5OA 4CJKA 1I39A 1BIZA 2X78A 4OKKA 2FBTA 1QTMA 3ALYA 3VA0A 4K8ZA 4C8LA 3QIOA 1BQMA 3AA5X 3V9XA 3P5JA 4DQSA 1KLNA 1NJXA 2BE2A 4XIUA 1X1PA 3P83D 2HHVA 4B9VA 3LZIA 3TABA 3SUNA 4E1NA 4AHUA 3ZSZA 2XY7A 4FYDA 4CF2A 4DTOA 1NJZA 3ZSYA 2OPRA 1X9SA 4CEDA 1NKCA 2XY5A 5J2QA 1WSHA 3E01A 3C94A 4GVMA 2OA8A 2VG5A 3LWLA 3CQ8A 4M41A 2FBYA 1SKWA 1JLBA 2KZZA 4KPYA 3AO2A 4FJGA 4DU3A 3NH0A 2WOMA 4Z4IA 3QERA 4LSNA 3DRPA 1DTQA 2WONA 2G8VA 3AA2A 3QEIA 1BGXT 4HVJA 3V9UA 1LAWA 3V1RA 3KK2A 4FJKA 3VQCA 3SPYA 4L8RB 4AHCA 3TR8A 3RTVA 5FDLA 1TKTA 4KHSA 2IC3A 4DF8A 4IFYA 1JLGA 4KHWA 2Q3SA 2BANA 3AVMA 4OKEA 1L3TA 4FXDA 3M8QA 1VSHA 3KK1A 2XHBA 1HNVA 1RT2A 3ZCMA 3ULDA 2IDOA 3O4QA 1BCOA 1WAFA 1KVAA 4CGHA 3VQQA 4LY7A 4ELTA 3OYEA 1VSIA 3KLGA 1WNSA 5D3GA 4FLUA 1LWFA 2F96A 4BWMA 4DSFA 3V4IA 1VSEA 1S1UA 3AVIA 3THVA 4NCAA 4W5TA 3MEEA 2IAJA 1GOBA 1KTQA 4FK4A 1C1CA 4E7KA 4DSLA 4E7JA 3LANA 1HQUA 2PZSA 1WAJA 4JLHA 1DLOA 4FJLA 3B6PA 2ETJA 4FZXC 5T7BA 1QSYA 4ID5A 1NK6A 3HSTB 3K5NA 4OGCA 4G1QA 4DQPA 4CEOA 1JLFA 1HJRA 4CESA 1U45A 1N5YA 3SUOA 1TV6A 2YNFA 4NYFA 1JLAA 4H4MA 4LH4A 4QAGA 4ELUA 2HHQA 1WLJA 2LSNA 1KFSA 4J2DA 2G8IA 1KVCA 3OYMA 3A2FA 3QLHA 4FLVA 3HP9A 3LPTA 3JSMA 3TI0A 2YHBA 1JL2A 3OYNA 5KGXA 3D0PA 4AILC 3NBPA 2FBVA 3AO5A 4OLBA 2EHGA 1YT3A 4B9LA 3LP0A 5FRNA 3HPGA 3OJSA 1YVUA 3T19A 5HLFA 3LAKA 4CCHA 4DTSA 4NCGA 3KIOA 1S1WA 2DFHA 1BQNA 3OYLA 2G8WA 3QETA 3PX6A 1IKWA 4LH5A 3SNNA 2W42A 4HHTA 1D9DA 4DWIA 4PUOA 4FLXA 1FKOA 3WNEA 1S9EA 2YNHA 1L3VA 1G15A 3HK2A 1XHXA 4BACA 3IAYA 4FVMA 4W5NA 4TSXA 3L2WA 3MXJA 4I9LA 4OPKA 3OYGA 5CY4A 4CF8A 3KJVA 4FLTA 4M3WA 2QK9A 2KZMA 4FLZA 3CM6A 4CJWA 4KHNA 4N47A 5DK5A 1JXEA 4CGJA 4FJNA 5J2PA 4AH9A 4DTPA 1XWLA 3EZ5A 1TAQA 4FJJA 1NK8A 4E7IA 2HHUA 2F8TA 2HB5A 4IKFA 3F73A 5E41A 3AO1A 2OPQA 4KHUA 4OGEA 3KK3A 3VN5A 1W9HA 4C8NA 2YHAA 1NK0A 5HRNA 3NH2A 4DLEA 2ZD1A 4E0DA 3DOLA 4FCYA 4DU1A 1ZYQA 2HVIA 4F2SA 4BE1A 3O4NA 4FJIA 2ZE2A 1UOCA 1U48A 1S1XA 1C1AA 4CJSA 4ELVA 4DS4A 4I7FA 1TAUA 4DLGA 1U49A 1C0UA 3K57A 4I2QA 3OJUA 1CZ9A 4KTZA 4KTWA 3PY8A 2E6MA 3AO3A 1EXQA 4IBNA 4H8KA 1HMVA 1SL0A 3ZSQA 1KLMA 1J9AA 4CHPA 4CJ3A 3SZ2A 1R0AA 3L3VA 1HNIA 4CJPA 4EP5A 4FM0A 3HO1A 4Z4GA 1A5XA 3CYMA 3LPUA 5CYMA 3K5MA 3AVFA 4E3SA 1VSDA 1BISA 1S5JA 4CIGA 4Y1DA 1VSLA 1WSEA 1I3AA 1KSPA 3S9HA 3O3HA 4YFUA 3RWUA 3HJFA 2DFEA 3TAGA 4CK2A 4CFCA 3NF7A 3ZT4A 3P1GA 1Q9YA 4O4GA 2XY6A 4CIEA 2Z1JA 4N56A 3K5OA 2B6AA 2PYLA 4FJ8A 3NGYA 1FXXA 1HYSA 2IS3A 2QKKA 2E4LA 2D5RA 3HM9A 1O1WA 3B6OA 4KI4A 3T1AA 3ZT2A 4FLWA 2GV9A 4OVLA 1EP4A 3QO9A 4WE1A 3HVTA 4LD0A 4F4KA 2O4IA 3ZSRA 3O3FA 5DMRA 4E7HA 1T8EA 3I0SA 1SV5A 4NCBA 4CEEA 4FZZA 4EZ9A 3VQ6A 3HP6A 3M8RA 2YV0X 4KHYA 4BE2A 2BGGA 5EU7A 1NKBA 4CK3A 1RBVA 3JYTA 1D8YA 4CEZA 5SZTA 4M3XA 1S1VA 4N5SA 3V81A 3SPZA 2AJQA 3ZSWA 3K59A 3U3YA 4MQ3A 4KKOA 1ASVA 1Q8IA 3VQEA 1ZBFA 1X9WA 3OVNA 4Z4CA 1RDBA 4CF9A 4Q5VA 1RCHA 4J2AA 2X6NA 3NF9A 1HYVA 3OY9A 3NDKA 1W0HA 3TAEA 1VSJA 4KV8A 3ZT0A 2OZMA 1TVRA 3SCXA 4K8XA 3RMCA 2HHSA 3I0RA 4CJUA 2PY5A 1JLQA 2XY8A 1QE1A 4CJTA 3LDSA 3NAEA 1RBUA 4M42A 2E6LA 4BDPA 3BGRA 4EP4A 3FFIA 3LP2A 2KFNA 1C1BA 1BHLA 3VQ9A 1Q9XA 1ZBHA 4CHZA 2KFZA 4ZHRA 1ZBUA 4E89A 4KTQA 4ZTJA 3QINA 1NKEA 3AVCA 1KFDA 2IOCA 3K58A 4I2PA 1B9DA 1RT5A 3WNFA 4KB1A 1NK9A 3S3OA 4B9UA 4FJHA 2P5OA 1EX4A 4ID1A 3OYIA 3SQ2A 3OS2A 1C0TA 3HPHA 3H08A 4ZTFA 1BI4B 4CEFA 4Z0UA 2YKNA 2D0BA 3IRXA 2X6SA 4O0JA 4B8CA 3AVGA 4CFAA 3OYKA 3KLEA 1CXQA 4CFDA 1TK0A 1TK8A 3NGZA 4O0IA 3KD1E 4DTNA 1RBTA 2ATQA 1NK4A 4CEQA 4CHQA 4M3YA 3TAPA 3IS9A 1D5AA 5C25A 1HRHA 2RKIA 4CIFA 3S3MA 4M3RA 4RW7A 3L2VA 4C8OA 4Z4EA 2XRIA 3I8DA 4I9QA 3LZJA 2KW4A 3K5LA 1UAXA 1VSKA 1BI4A 4PA1A 4E1MA 5CZ2A 4JS4A 4DF4A 3KLFA 5FROA 1NOZA 1SL1A 4B9MA 4KB0A 3RMBA 5I42A 4FJ7A 1NOYA 4FJ9A 1VRTA 2JGUA 4IG3A 4CJ5A 3NH1A 4FW1A 2VWKA 3VQ4A 4JRQA 4GW6A 2YKMA 2VG7A 4GMJB 3VQBA 1ITGA 3MEGA 3AA4A 4DSJA 2XO7A 3DLBA 3NGIA 4DQIA 4CF0A 4FJ5A 3AVKA 4M3UA 1UA0A 4RW4A 4AHSA 1GOAA 4KRFA 1IKXA 1NJYA 1JLEA 3RRHA 3QNOA 3SQ0A 2HNZA 3TAFA 4O44A 4DTUA 4CGGA 3KLHA 3ZSVA 3HT3A 4B9SA 1Z25A 1RT4A 1QSSA 2DFFA 3AA3A 3CM5A 5KI6A 3ZSOA 3OYJA 3V9SA 4DQRA 2Y1IA 5I3UA 3RR7A 5J1EA 3WNGA 4DS5A 4DFJA 1LV5A 4NYNA 1A5WA 1RILA 3TARA 3HYFA 1ASWA 4O5BA 1L3SA 3T3FA 4F8RA 3G0ZA 4DFMA 1N6QA 3HVRA 1A5VA 4CHOA 2FC0A 4ICLA 4MFBA 4W5RA 4KREA 5CYQA 3QEXA 3SUQA 3SJJA 5J2MA 1C0MA 4DG1A 3L8BA 4H4OA 4Q0BA 4RW8A 4E7LA 3CFOA 4HCCA 5SWMA 5FRMA 3MXMA 3V6DA 2Y1JA 1S9GA 1JL1A 4M45A 1J5OA 2NUBA 1EKEA 1RDDA 1TGOA 4YNQA 4M3ZA 3O3GA 3CG7A 1T05A 4Z4FA 1YTUA 3NCIA 4CECA 1S6QA 4JRPA 1IG9A 4CGFA 2F8SA 3MECA 1IH7A 1JLCA 3VQ7A 1L3UA 1J53A 4HUFA 4HCBA 3HPOA 2O4GA 1RT3A 3U3GA 3S3NA 3SQ1A 4BE0A 4RW9A 5KTQA 2HHWA 2HHTA 4B3OA 1L5UA 4FK0A 1QQCA 2FBXA 3MEDA 1LAVA 2G8KA 1JXBA 4DTRA 3F9KA 3PX4A 3ITHA 3VQAA 1FK9A 3LAMA 1VSMA 4DSEA 2A1RA 4B9NA 2HVHA 1VRUA 2HW3A 4BWJA 1WN7A 3PO4A 2GBZA 5JS1A 4FW2A 2Z1HA 3NF6A 2OPSA 1RBSA 2RN2A 3ISNC 1GOCA 4DFKA 1WSJA 3L2QA 5KGWA 1XC9A 4N76A 1RTIA 1JKHA 4J2BA 2X74A 2P1JA 4CK1A 2R7YA 4DU4A 1CXUA 1DTTA 1BIUA 3OYBA 3AVBA 4OLAA 1Y97A 3SUPA 4CHYA 4IG0A 2OYQA 4JS5A 4CEBA 2B5JA 4FZYA 3LWMA 3OYDA 4M3TA 1FKPA 1SUQA 3DLRA 3RMAA 1K6YA 4DSKA 3KLIA 1WSGA 4QOZB 1IKYA 3MAQA 1XI1A 5K14A 4B08A 2IGIA 3LALA 1S1TA 3TANA 4C8KA 4QCLA 4DTJA 4Z4HA 4DFPA 3EYZA 4AHTA 4CJLA 3SV3A 4CHNA 2P51A 4BDYA 1IKVA 3DLHA 3PO5A 1QHTA 1RTHA 4OPJA 1LWEA 4BDZA 4OKJA 2HHXA 3SYZA 1YTAA 3V9ZA 3NE6A 5KRSA 3TWHA 3PV8A 4CFBA 2OZSA 4FJXA 1SL2A 3C95A 2RF2A 3PUFA 3OYCA 1KRPA 1HPZA 4RW6A 3AO4A 4CGDA 2OPPA 3OS1A 2D0AA 1RTDA 1QSLA 2DY4A 1KCFA 1REVA 1SKRA 3V9WA 5HBMA 4O55A 3L3UA 1S6PA 3VQ8A 1HQEA 1LW0A 4B8AB 1X9MA 1WSIA 2RPIA 4CJFA 3SQ4A 4KAZA 3K2PA 3OS0A 1TKDA 5J2NA 1RT7A 3QIPA 3KD5E 3WNHA 2KTQA 3KKSA 4FLYA 1NK5A 4J2EA 3QEPA 2ITGA 3DRSA 3NFAA 1RDAA 1RT1A 3DLGA 2Z1IA 4CE9A 4FM2A 3BDPA 3L2RA 3CFRA 1TKXA 1T03A 3ZT1A 1D9FA 3KTQA 1KVBA 4UQGA 1ZBIA 3KKRA 4DTXA 1WSFA 3ZT3A 2A1SA 3RR8A 4KFBA 1BL3A 3UIQA 1TKZA 4CF1A 2DTUA 4KHQA 4LSLA 3AV9A 3C6TA 1XHZA 1B92A 1CLQA 4OJRA 3U6FA 4FJMA 4EZ6A 3DYAA 1IO2A 1J54A 1UA1A 2I5JA 2HNYA 3NHGA 3CFPA 1VK0A 1LW2A 3IG1A 2PYJA 2G8HA 3QEVA 4W5QA 3VQPA 3HXMA 4CERA 2EX3A 3QNNA 4IFVA 4R5PA 3M8PA 3M8SA 3VQDA 4HUEA 3VA3A 3SV4A 4FK2A 4N41A 5HRPA 1LWCA 3LP1A 3G10A 5C42A 4CJEA 4DQQA 1QS4A 4C8MA 4CJVA 1RTJA 1VSFA 2KQ2A 3LP3A 4KI6A 1C6VA 1MU2A 1SKSA 3TAMA 4E19A 4IDKA 3DM2A 1T7PA 5KRTA 3DLEA 5HRRA 4PY5A 3QEWA 3RRGA 4DSIA 2JLEA 5HRSA 4HUGA 4F3TA 2QKBA 3AVAA 3TAQA 2QXFA 4CGIA 3NF8A 3V1QA 4CJQA 3AVHA 4RG8A 1RT6A 2YNIA 1Z26A 3ZSXA 2D0CA 3QESA 3PX0A 1NK7A 3HL8A 1NJWA 4CEAA 1TL1A 1ASUA 1U4BA 3DMJA 5JS2A 3SI6A 3DRRA 4Y1CA 3MXIA 1EETA 2HMIA 4FM1A 5C24A 1CZBA 1F21A 1U04A 2B4JA 3V1OA 5HP1A 2G8FA 1UWBA 4HTUA 4CJRA 3DI6A 3AVLA 4KO0A 3EY1A 1TK5A 3L2UA 3DLKA 4B9TA 3VQ5A 2BDPA 2Z1GA 2P5GA 3OYAA 2GUIA 1HYZA 2HNDA 4PQUA 1B9FA
chains in the Genus database with same CATH superfamily
4DMNA 2VWJA 1EQYA 4CJ4A 1IBKK 5AZJA 3TTCA 3H1QA 3OYFA 3D45A 5CZ1A 4PWDA 5AQTA 3MN5A 2KHOA 3AVJA 3ASMA 1N33K 1BU6O 5AQJA 1BQMA 4CI6A 3P5JA 4DQSA 1KLNA 1NJXA 2F9TA 2HHVA 3CPEA 3EKUA 4H0XB 2RE2A 4AHUA 4DTOA 2OPRA 1X9SA 5AQOA 4CEDA 1NKCA 1M1KO 1HKBA 2XY5A 3E9OA 1WSHA 3NVKA 1NM1A 3LWLA 3CQ8A 2KZZA 4DU3A 4K25A 4Z4IA 3EL2A 3QERA 1OH7A 3DRPA 1BGXT 4OO1J 3V9UA 5AJ3K 4FVUA 2BTFA 1Z6RA 3SPYA 4KHSA 1U2VA 5FDLA 4IFYA 3FZHA 3JS6A 2BANA 3M8QA 3KK1A 3CC7N 4ELTA 4FWSA 5M1QA 4NXNK 3KLGA 1WNSA 3V4IA 3BEXA 3AVIA 4PHTX 3DXMB 2IAJA 3CJAA 3VGLA 4DUZK 1GOBA 2QWRA 4E7KA 1HQUA 1DLOA 4B3RK 1RFQA 1D4XA 3K5NA 4YOWA 1LOTB 4X65K 5AQHA 1JLFA 3SUOA 3MCAB 4H4MA 3HZ6A 2G8IA 2HMPA 3ID8A 3A2FA 1QQNA 4B9LA 3VGKA 3H1VX 2VQEK 4FWQA 4QS9A 4PKGA 1EO1A 3OJSA 2QW9A 3CCSN 4LC9B 4BR4A 2G8WA 1S1WA 2DFHA 3OYLA 3QETA 5AQPA 3SNNA 4JKAA 3DJCA 1HLUA 1S9EA 3HK2A 4BR7A 1XHXA 4FVMA 3LDOA 3MXJA 4JK7A 2JWLA 4OPKA 3VERA 1NGFA 4N47A 1JXEA 2HBJA 5J2PA 1NK8A 4BRQA 2GX9A 2HBKA 4OGEA 3KK3A 4C8NA 2YHAA 1WUAA 3OBYA 1N36K 3FZLA 3AARA 4FCYA 2NRZA 3H3NO 3H3OB 3ZX2A 4ELVA 4PL7A 3OJUA 4KTZA 4H8KA 4JKHA 3ZSQA 4IWVA 5ELZA 3L3VA 1HNIA 4FM0A 2HHHK 1A5XA 3SMSA 5ADXH 1BISA 1S5JA 4CIGA 4F9OA 1VSLA 1KSPA 1I3AA 5FPEA 4DR3K 3RWUA 2DFEA 3TAGA 4JK9A 3MN9A 3ZT4A 3P1GA 3J7YP 4N56A 2Z1JA 4FJ8A 1HYSA 1FXXA 1GLLO 2QKKA 1BA1A 4GV3A 4KI4A 1YVNA 4FLWA 2GV9A 4NLBA 3HVTA 2Q97A 3MCPA 3HTVA 4FWRA 3CCRN 4U67L 5BRDA 3HP6A 1Y64A 3P4IA 2BGGA 2ZJPL 5EU7A 1NMDA 4CEZA 1IBLK 2UYTA 3SPZA 3H45C 3HOTA 2AJQA 2GWKA 1XMOK 1QZ5A 4KKOA 5AR0A 3VQEA 1ZBFA 3OVNA 1RDBA 4J2AA 3NDKA 4FPAA 1TVRA 3IMXA 1EWQA 2XY8A 4FPBA 4B9QA 1GLJO 1QQMA 2I7PA 1RBUA 3GBTA 4M42A 4DV1K 3GL1A 4GV6A 3WXIA 4GV9A 3FE1A 1ZBUA 1QHAA 2E1YA 3BP8A 3O9QA 1QQOA 1RT5A 3D2EB 1NGIA 3S3OA 2GELA 4FJHA 2WC9A 1K8KB 2QWNA 2YJEA 1Q81O 4CEFA 4CFAA 2D0BA 3OYKA 5C0YA 3NGZA 4O0IA 1XNRK 1RBTA 2PAVA 3FZKA 3TAPA 1D5AA 3C7NA 1HRHA 2ZGYA 3S3MA 3FZMA 3MDQA 4JI1K 5BPLA 4I9QA 1HNWK 3LZJA 2KW4A 1YJNN 3SAHA 1VSKA 4EZ9A 5CZ2A 4B9MA 3KLFA 5M1PA 1NOYA 3NH1A 4IG3A 2VWKA 3VQ4A 4DSJA 2XO7A 2NZTA 1OH6A 3DXKB 3ZYYX 4JI6K 4RW4A 4AHSA 3M5RA 1IKXA 3SQ0A 4DTUA 1HKCA 1RT4A 2Y1IA 4IZ9A 4DQRA 3A0IX 2P9LA 3WNGA 5AQWA 4CZEA 4DFJA 1HKGA 3TARA 4RCHA 5E26A 4O5BA 3G0ZA 4JAXA 4DFMA 1N6QA 4ICLA 4W5RA 2V52B 1VQPN 3KK7A 3SJJA 4KH6A 4Q0BA 4RW8A 4E7LA 4GVEA 3O1WA 1S9GA 1JL1A 4CBWA 1TGOA 1TUYA 3VEVA 1IG9A 3Q7CA 3CCUN 3HPOA 4RW9A 2NRRA 5EXWA 4B3OA 2UXBK 3UE5A 3F9MA 3MEDA 4WQ5A 2ZGZA 3F9KA 3ITHA 1V4SA 2HVHA 1VSMA 4DR2K 3E9LA 1WN7A 2WFBA 2ZJQL 5AQZA 1RBSA 2IVNA 1GOCA 4PKHA 3L2QA 1MWMA 1JKHA 2YHYA 2NRTA 1Y97A 4CHYA 4IG0A 4FZYA 1K6YA 3KLIA 4JI8K 3CIPA 3SK3A 3LALA 3TANA 4XEIA 5FPNA 4IO9L 3O9RA 3PO5A 4OPJA 1NBWA 4OKJA 3WQUA 3NE6A 3PUFA 3ENHA 2WBNA 3AO4A 2OPPA 1NGHA 1REVA 2DPNA 5HBMA 1OVYA 3VF6A 1VHXA 1HQEA 1LW0A 4B8AB 2RPIA 4H0TB 4KAZA 4CD1A 3SLCA 1IG8A 3QIPA 4FLYA 3QEPA 2ITGA 3DRSA 3NFAA 2E2PA 1RT1A 3BDPA 4KHPK 1H1VA 3ZT1A 4UQGA 3K9KA 2A1SA 4CZFA 4H5VA 4KFBA 3UIQA 4CF1A 1MWKA 4A61A 1XHZA 2VGMA 3U6FA 1IO2A 2HNYA 5I9EB 3CFPA 4WYBA 5HOOA 3OW2M 4K42A 2G8HA 2O8DA 3E1YA 3HXMA 4CERA 2EX3A 3CQXA 4IFVA 2AP1A 5BN8A 3CQYA 3VQDA 4AM7A 3LM2A 2CH6A 5HRPA 3CPWM 5C42A 4N41A 3O5BA 3C65A 3HRGA 1BG3A 1QS4A 3VF2A 1VSFA 2FXUA 2KQ2A 4OX9K 4KI6A 3CMAN 1C6VA 1SKSA 3O9SA 5JLFA 4PY5A 2HOEA 2FSJA 3GG4A 4CJQA 2OCEA 3AVHA 2YNIA 1DKGD 5CHIA 1TL1A 4FWMA 5AZJB 4Y1CA 3C6AA 4IXCA 3MXIA 3U8XA 3HSCA 1F21A 3V1OA 4O8UA 3DLKA 3EZWA 1O13A 2P5GA 3OYAA 3H46O 5FPDA 3OYHA 1U47A 3DOKA 2ZQBA 3SJHA 1WB9A 4AHRA 2ZJRL 4DTMA 4JHDA 5HL7L 3AVNA 4A59A 5HROA 1ZBLA 4W5OA 3L4QA 4YOUA 4CJKA 1BIZA 3EKSA 1JCGA 3ALYA 4NB4A 3WXJA 4C23A 3AA5X 3V9XA 4FWPA 2HSTA 3DAWA 4CZMA 4E1NA 3ZSZA 4FWOA 4X66K 4GVMA 4R79A 4M41A 2FBYA 1JLBA 4KPYA 1MDUB 4CZLA 3WXMB 3NH0A 2WOMA 4LSNA 1DTQA 2G8VA 3T1YK 4JN4A 1JCFA 3TR8A 1ESVA 3RTVA 1TKTA 2E2NA 2O8FA 4DF8A 4MO5A 1JLGA 5AQKA 3SBGA 1NU0A 1VSHA 2XHBA 2IDOA 3O4QA 1VQKN 4LY7A 2QTDA 1VSIA 5D3GA 4BWMA 1KAYA 2F96A 4DSFA 5KQ8A 1ILYA 3L6QA 3MEEA 1KTQA 4BRLA 4E7JA 4M7YA 3CMEN 2PZSA 4FJLA 1HPMA 2ETJA 2IIRA 3AY9A 2GWJA 4EFHA 4OGCA 1NLVA 4CEOA 3ZLJA 4BR0A 4V19S 1HJRA 4CESA 5GIOA 1TV6A 4BRGA 4NYFA 1N34K 3CERA 4IJNA 2LSNA 5AFUH 5GIPA 3PIPL 4FLVA 2ZWHA 1KC8O 3I8BA 2YHBA 3UKUA 1Z05A 1JL2A 3OYNA 3D0PA 4AILC 4A5AA 3NBPA 2FBVA 1IBMK 1VQ5N 3CJBA 5AZIA 5AQFA 4H0OA 5HLFA 3LAKA 3P38A 3KIOA 1BQNA 2D0OA 4JD2A 3NVMA 2W42A 1XUPO 4FLXA 3CI5A 3WNEA 2YNHA 4JKGA 3IAYA 4W5NA 4TSXA 2O8CB 2NRWA 4I9LA 1ATSA 4BREA 4M3WA 4FLTA 2Q0UA 4FLZA 5KPRA 2ASPA 5DK5A 4FJNA 1S3XA 4AH9A 1M90O 2FF6A 1TAQA 2HHUA 4E7IA 5GAHP 2F8TA 2HB5A 3F73A 5E41A 4H5NA 3VN5A 1W9HA 3JAMO 1MA9B 1ZYQA 4O8KA 1BOTO 3O4NA 4FJIA 1U48A 1C1AA 1GLBG 4BRFA 4I7FA 1XQSC 1TAUA 2D4WA 3K57A 4I2QA 4RWTA 1EXQA 2P9NA 1KLMA 3R6MA 4CJ3A 3H6EA 3VTHA 3ATVA 3HO1A 1W7AA 5KPZA 5CYMA 3QICA 2I7NA 3OTOK 4O4GA 4WFAL 2B6AA 2PYLA 3NGYA 1ZC6A 3CHWA 2E4LA 2D5RA 3HM9A 3CCVN 5C10A 1HUXA 4BRNA 4LD0A 3CJ9A 3ZSRA 4MLEA 4E7HA 1VQ6N 4DV3K 1T8EA 1SV5A 4FZZA 3JYTA 1RBVA 1CZAN 2D0PA 5SZTA 4N5SA 3V81A 1N32K 3U3YA 1VQLN 4L3QA 3THXB 1VQ8N 4Q5VA 4YY3K 3D6RA 3VEYA 3SCXA 2NRVA 3RMCA 3G4SN 2F4VK 4DV4K 1VQ9N 2P9KA 3FFIA 2KFNA 1C1BA 1WBBA 4CHZA 1YI2N 2VWBA 4DQ8A 5EOYA 3AVCA 3K58A 1QVFM 4I2PA 1QZ6A 1T44A 4B9UA 3UKRB 3C7NB 2P5OA 1EX4A 3OS2A 1NGAA 4ZTFA 3CJCA 3LM9A 2YKNA 3IRXA 4B8CA 4O0JA 3AVGA 1X9JA 5JICA 1TK0A 2V7YA 4CFDA 5JLHA 2NLXA 4DTNA 1NK4A 4M3YA 3FGUA 3IFRA 4M3RA 1BI4A 4E1MA 4DF4A 3HOSA 4FJ7A 5I42A 1VRTA 4CJ5A 1TUUA 3P31A 4GW6A 5AQNA 1FW6A 1ITGA 1VQMN 3NGIA 4CF0A 1J6ZA 4FSVA 3TTFA 2A42A 1UA0A 2YI1A 1W97L 1GOAA 4KRFA 2P9IB 5IT9O 4XH1A 3LDLA 3E9PA 4O44A 3RSEA 1ZBSA 4K41A 3KLHA 1Q18A 1ZXOA 3HT3A 4B9SA 1QSSA 4YORA 3CM5A 5KI6A 3V9SA 2QWMA 5LMUK 1TYQA 3HYFA 1L3SA 5F0XA 3T3FA 5M1FA 2FC0A 3MK6A 3QEXA 1C0MA 2P9PA 4DG1A 3L8BA 3BZCA 1NGJA 5SWMA 3MXMA 1EKEA 4YNQA 1Q7YO 4CECA 1S6QA 1HR0K 3BY5A 1IH7A 1OH8A 3VQ7A 1L3UA 3S3NA 4BE0A 4CZGA 5IWAK 3THWB 4KBOA 1LAVA 2HBLA 3EN9A 1JXBA 4DTRA 2G8KA 4ILJA 3LAMA 1GLCG 2HW3A 5LY3A 2F7TA 2GBZA 2Z1HA 4JKDA 2RN2A 1WSJA 4N76A 5KGWA 3CJ1A 2P1JA 3WXLA 4DU4A 3VETA 3OYBA 2GTDA 3ZETA 3SUPA 4J2BA 3K0SA 4BRKA 1FKPA 3RMAA 2E88A 4QOZB 4H5RA 3AAPA 1S1TA 4JI3K 5M1NA 4JI2K 2A6AA 4CJLA 3SAFA 3SV3A 4BDYA 3VEWA 3DLHA 1QHTA 1RTHA 1LWEA 4BG8A 3KWIA 4WFNL 5KRSA 3PV8A 2FSNA 2RF2A 2O8BB 1HPZA 3BF3A 3OS1A 1RTDA 1KCFA 3V9WA 3VQ8A 1WSIA 3SQ4A 4CJFA 4DCHA 1VAZA 1XNQK 2A40A 3KD5E 5M1OA 3KKSA 4J2EA 4GNIA 1NK5A 3THYA 4XH4A 3DLGA 3CFRA 3CCLN 3ULEA 5JVHL 1D9FA 3WEEB 4A2AA 4DTXA 3DXMA 3MWTA 3OHRA 3FFKB 2Q36A 4FJMA 4NXMK 1J54A 1DGKN 3ZEUB 3LL3A 1LW2A 2PYJA 1V4TA 4BR2A 4WF9L 4KH4A 4FK2A 2RHKA 4FOIA 5GAEP 5FPMA 4AM6A 4C8MA 3O8MA 4CJVA 5GAGP 1MU2A 1GLDG 1YF5L 4E19A 1T7PA 4DSIA 1HNXK 2QXFA 4CGIA 3NF8A 2WTUA 1Z26A 2D0CA 4CEAA 3SMPA 3DMJA 5JS2A 4MLHA 3DRRA 2HMIA 5C24A 1CZBA 1U04A 3BF1A 1UWBA 4HTUA 4CJRA 4JHDB 4KO0A 4BRMA 3VQ5A 4DV2K 4AHVA 2G8UA 4F3OA 4JYAK 4PL8A 4BC3A 1TL3A 4DR4K 3TU5A 1RDCA 4WQ4C 2A5XA 3E66A 2YNGA 3CXCM 1I39A 4BR5A 2X78A 4OKKA 1QTMA 4C8LA 3QIOA 5LJVA 2P9SB 4YOXA 4XIUA 3J8AA 1X1PA 1IV0A 2E1ZA 4B1VA 4B9VA 1NGEA 1EWRA 3SUNA 3KZBA 4YHHK 4CF2A 3ZSYA 4Y0WA 2YCHA 4CW7B 5J2QA 2VCPA 3C94A 4IJAA 5C2FA 2VG5A 2O8FB 4FJGA 3ENBA 2WONA 3QEIA 2ASOA 4HVJA 4EHTA 4FJKA 3VQCA 2UXDK 5EY4A 4L8RB 4AHCA 4BR9A 2E2QA 4KHWA 1L3TA 3D2FB 5MLCQ 3S41A 1YAGA 4YDUC 1BCOA 4JK8A 3PSIA 1IJJA 4FLUA 1VSEA 4U7BA 4NCAA 4W5TA 4FK4A 1Q86O 1VQON 3VENA 4JLHA 2QWOA 3B6PA 5BREA 3O80A 4FZXC 5T7BA 4ID5A 1NK6A 3HSTB 4MDAA 4G1QA 2UUCK 1X3NA 5ADXA 1VQ7N 1U45A 1N5YA 5AZIB 3QFUA 2O8EA 4JKCA 4LH4A 3T69A 3ENOA 4QAGA 3R9PA 2HHQA 4J2DA 4CD3A 3LPTA 3JSMA 4K0KK 3CCEN 3QDKA 4OLBA 2GEMA 3AO5A 2EHGA 2Q31A 4CZJA 3DLLL 5FRNA 3TSQA 3D2EA 1YVUA 4CCHA 1HX1A 4I6MB 1K8KA 2CGLA 3PX6A 1IKWA 4FWKA 4LH5A 3WT0A 4HHTA 3L0QA 2FF3B 4PUOA 3GE1A 3L2WA 4CF8A 4DV6K 2KZMA 4DV5K 5KPTA 1XWLA 1P90A 2W6KA 5GINA 3EZ5A 4FJJA 4ILHA 4EHUA 4IKFA 4KHUA 3AO1A 2WUSA 1NK0A 5HRNA 4DLEA 2ZD1A 3WXKA 4E0DA 3DOLA 4DU1A 1RGIA 2HVIA 4BE1A 1UOCA 3MX2A 1BA0A 1HJOA 1S1XA 4CJSA 4MO4A 2QXLA 1C0UA 4ISEA 1SQKA 4JKBA 3PY8A 4IEIA 1SL0A 3AGKA 1J9AA 4QS7A 3R3LA 4CHPA 4UY8O 4CJPA 4EP5A 3QBWA 3CYMA 4E3SA 3K5MA 3AVFA 1VSDA 4H5TA 1WSEA 4LF7K 3S9HA 4YFUA 3J7ZO 4CFCA 2QA4N 3EE9A 1Q9YA 4G9ZA 2HBMA 3K5OA 1GLEG 4B1YB 3CJ7A 2IS3A 5F1XA 1O1WA 3B6OA 4DR5K 3T1AA 5AQVA 3ZT2A 3VEXA 4OVLA 1U2VB 1EP4A 2Q2RA 4WE1A 4F4KA 4LF4K 1NGGA 4BGBA 2QWPA 4PKIA 3VQ6A 3M8RA 2YV0X 4BE2A 1NKBA 1D8YA 1S1VA 4MDBA 1R59O 3ZSWA 3K59A 4MQ3A 2P9KB 4Z4CA 3CF5L 1RCHA 3NF9A 3OY9A 3TAEA 3J81O 1VSJA 4KV8A 3ZT0A 4K8XA 2HHSA 3I0RA 4CJUA 2PY5A 1QE1A 4JKEA 4JI0K 3LDSA 5LL6Z 2E6LA 4BDPA 3BGRA 1P8ZA 4EP4A 3MX5A 1BHLA 4YOVA 2KKZA 1ZBHA 2KFZA 4ZHRA 4FO0A 4E89A 4JI5K 4IOXA 5C15A 2IOCA 4BRHA 1YXQA 1NK9A 1C0TA 2V51B 1U6ZA 1BI4B 5BN9A 4Z0UA 4DUYK 1TK8A 3KD1E 2ATQA 5A2QO 3F5TA 3IS9A 1YITN 4GKJK 5C25A 1G99A 2JWKA 2RKIA 4CIFA 4RW7A 3L2VA 4C8OA 4Z4EA 3PLAA 2NRXA 2HF4A 3R1XA 4PA1A 3HBTA 4JS4A 1ATRA 4IFEA 4E1JA 4FJ9A 2JGUA 4FW1A 3RSEB 2YKMA 2VG7A 3VQBA 3NMUA 3MEGA 3AA4A 2OANA 1KAXA 2ZF5O 4K43A 3HI0A 3DLBA 4DQIA 3M1FA 4M3UA 2QEXN 1ATNA 5LMNK 1JLEA 1VQNN 5B8HA 3RRHA 2GUPA 2HNZA 4NO7A 1K8AO 4DR7K 1Z25A 2DFFA 3RR7A 3MN7A 3ZSOA 3OYJA 1E3MA 4OPHA 4OPAA 4DS5A 3O1BA 1RILA 2Q0RA 3ATUA 2UU9K 1A5VA 3WUHA 3A5MC 4DR1K 5CYQA 1WBDA 3O4WA 1SZ2A 3CFOA 3VTIA 4HCCA 5FRMA 3V6DA 2Y1JA 1RDDA 1NGBA 3TTDA 3CG7A 4YOTA 1T05A 1YTUA 3MN6A 4DV0K 3IDHA 4B1XB 2E5LK 1JLCA 4HUFA 5BRHA 3U3GA 2P9UA 2HHTA 4EAHD 2QWLA 2YJFA 2FBXA 4FOEA 5M1KA 3G71N 3ZETB 2H3GX 5EVZA 3ZX0A 4A62A 5AQUA 1VRUA 4FW2A 4H5WA 3NF6A 2OPSA 3ISNC 4DFKA 3IKMA 4IOCL 2R7YA 4RTFD 3BUZB 3AVBA 4OLAA 2OYQA 4JS5A 4CEBA 1N8RO 1SUQA 3DLRA 2UUAK 4DSKA 1WSGA 3MAQA 4DTJA 4FL9A 4Z4HA 4DFPA 3DWLA 4CHNA 1IKVA 2HHXA 4FJXA 3WQTA 3N4QA 2OZSA 3C95A 3THYB 1S22A 4RW6A 4CGDA 2DY4A 3ULEB 3L3UA 3TSPA 1S6PA 3C6HA 3VF4A 1X9MA 5AQYA 3GDQA 3OS0A 2D1KA 4JI4K 2ZM6K 1NNEA 5J2NA 1YJ9N 4FWNA 2UUBK 3WNHA 4B3MK 2KTQA 4X64K 4CJ7A 1RDAA 4CE9A 3VEOA 2W41A 1ZBIA 3KKRA 1BO5O 3RR8A 1TKZA 2DTUA 4LSLA 3AV9A 5CE3A 4H0VB 5AQXA 4CBUA 1CLQA 1K9MO 4ILGB 1UA1A 1BUPA 1VK0A 5BRFA 2ASMA 4EIAA 4W5QA 3VQPA 2BH1A 3QNNA 4R5PA 4JNEA 4HUEA 3VA3A 2P9LB 3G10A 4CJEA 1RTJA 3LP3A 4BRDA 1SS6A 3RVCA 4M63C 5JVGL 5KRTA 3DLEA 5HRRA 4WQ4A 3QEWA 4J8FA 4AQYK 4F3TA 2QKBA 3AVAA 3TAQA 3V1QA 3ZSXA 1NK7A 1NJWA 3PSFA 2BUPA 1KQSM 1U4BA 3QBXA 3VMFB 3AVLA 1TK5A 4B9TA 3M6GA 2BDPA 1C0FA 4BRCA 3U9DA 2HNDA 1YJWN 3MWPA 1B9FA 3TPQA 2O8CA 1RDUA 1RNHA 3RMDA 1RBRA 4IDHA 1BCMA 1KAZA 2VG6A 4F2RA 1SAZA 3F2KA 3C6UA 5AFUA 1OKJA 2FBTA 3VA0A 1I94K 4K8ZA 4B1WB 2BE2A 3N4PA 4LFAK 5C2DA 3P83D 5KQDA 3LZIA 4YDUA 3TABA 4FYDA 2XY7A 1NJZA 1T6CA 1NJIO 3E01A 4A57A 5AQLA 2OA8A 2KLAA 1SKWA 5AQMA 3O08A 3AO2A 1GLFO 3AA2A 2E20A 4WFBL 3CC2N 1LAWA 5CR4A 1DT9A 3V1RA 4BC5A 3KK2A 2F9WA 4B3SK 2ITMA 4BRAA 4DR6K 2IC3A 2Q3SA 3AVMA 4OKEA 4JKFA 4FXDA 3T7ZA 3FZFA 3ULDA 1HNVA 1RT2A 3ZCMA 1X3MA 1WAFA 1KVAA 4CGHA 3VQQA 3OYEA 4LFBK 1LWFA 1QVGM 2YX6A 4JI7K 1S1UA 2O8EB 3THVA 1C1CA 3THXA 4DSLA 3LANA 1WAJA 4CZIA 1QSYA 3VESA 3OA9A 4DQPA 2O8DB 1T6DA 3EO3A 2YNFA 1JLAA 4GY2B 3O6WA 4ELUA 1WLJA 1KFSA 3W0LA 5AQRA 1KVCA 3OYMA 3QLHA 3HP9A 1XC3A 3TI0A 5KGXA 3ID6A 1YT3A 3LP0A 3SAGA 3LDPA 3HPGA 1NGCA 3T19A 3UKRA 5TKWA 2VQFK 4DTSA 4NCGA 4LF9K 4CZHA 4DWIA 1D9DA 3I33A 1LCUA 1FKOA 4BQZA 1L3VA 1BDGA 1G15A 4BACA 1E4FT 3SBTA 2QK9A 3OYGA 4X62K 5CY4A 3KJVA 3CM6A 4CJWA 4KHNA 4CGJA 3U4LA 2QI2A 4DTPA 4DHYA 4H03B 3I56N 3VPZA 2OPQA 2YHXA 3AGRA 1J5EK 5C12A 3QFPA 4CVNE 4IEEA 2W40A 5E84A 3K9JA 3NH2A 4Z94A 4IOAL 4F2SA 4CBXA 2ZE2A 4DS4A 4BROA 4DLGA 1U49A 1CZ9A 4KTWA 2E6MA 3AO3A 4IBNA 2P9IA 1HMVA 5LJWA 2VGNA 4LFCK 5AQQA 3SZ2A 1R0AA 3PIOL 5H1SQ 4Z4GA 3LPUA 1OH5A 1OVQA 4H0PA 4B1ZA 1C0GA 4Y1DA 5EX5A 3O3HA 3HJFA 3J7AP 4CK2A 3NF7A 3EEQA 3QB0A 3B8AX 2XY6A 2OTJN 4CIEA 4QS8A 3MMVA 2IVOA 3OBWA 1JCEA 4BRPA 3A5LC 3QO9A 2O4IA 3GOIA 4CZKA 3O3FA 5DMRA 3P39A 3I0SA 4NCBA 4CEEA 4KHYA 3O9UA 3Q7BA 4CK3A 1S72N 5AQSA 4M3XA 3THWA 2HF3A 1ASVA 1Q8IA 2W6LA 1X9WA 5GADP 4CF9A 5BR8K 2VYPA 2X6NA 1HYVA 1W0HA 2OZMA 3ZX3A 1JLQA 4ISFA 1W2BM 3TSUA 4CJTA 3NAEA 4IO8A 3G25A 3LP2A 3UB5A 4LF8K 3VQ9A 1Q9XA 3UKUB 4KTQA 3R8EA 3QINA 1NKEA 4WCEL 1K73O 1KFDA 5AQGA 1B9DA 3WNFA 4KB1A 1E4GT 1WOQA 2PFUA 4ID1A 3OYIA 3SQ2A 3HPHA 3H08A 4JD2B 2QM1A 2O8BA 3KLEA 2X6SA 4JKGB 1CXQA 3VEZA 3G6EN 4M7XA 4HWIA 1XMQK 4CEQA 4CHQA 2J4RA 3IUCA 1RDWX 3EE8A 3CCQN 2XRIA 5JMVA 3KVGA 3I8DA 2CH5A 3K5LA 1UAXA 4ZTJA 1SL1A 4DKWA 4KB0A 5FROA 1NOZA 3RMBA 4BY9C 3WEEA 4JRQA 4NLCA 4GMJB 4DB3A 3QMLA 2UXCK 5BPMA 3A8YA 1NGDA 4C1NK 5BPNA 4JEPA 4FJ5A 3AVKA 2P9NB 4BQLA 3ZEUA 1NJYA 3T1HK 3QNOA 3TAFA 3AAQA 4CGGA 2QWQA 3J80O 3VGMA 1YHQN 3ZSVA 3AA3A 5I3UA 3CCJN 3DXKA 5J1EA 4C1NI 1T3VA 4BG9A 1LV5A 5AQIA 2CGKA 4NYNA 1A5WA 1ASWA 3KWGA 3L4IA 4BRIA 3CETA 4F8RA 3C0BA 3HVRA 4CHOA 2FSKA 4MFBA 1KXPA 4KREA 3D7EO 2P9UB 3SUQA 5J2MA 2E2OA 5BR9A 4H4OA 5F2RA 2Q1NA 3VOVA 1VQ4N 4M45A 1J5OA 2NUBA 4BGAA 4M3ZA 3O3GA 4Z4FA 3NCIA 3FLCO 4JRPA 2F8SA 4CGFA 3MECA 1KD1O 1J53A 4YOYA 4HCBA 2O4GA 1RT3A 4A2BA 4BC4A 3JXUA 3SQ1A 5KTQA 1Q82O 2HHWA 1L5UA 3M3ZA 4FK0A 1QQCA 3A5NC 3PX4A 1BWFO 4B9NA 3VQAA 1FK9A 4DSEA 2A1RA 4XH5A 4BWJA 3PO4A 5JS1A 2YHWA 1FJGK 4KH5A 1XC9A 1RTIA 2X74A 4CK1A 1CXUA 1DTTA 1BIUA 5DM6L 2B5JA 4BVPA 3OYDA 3LWMA 4M3TA 4O5FA 1YIJN 3A5OC 1IKYA 2P9SA 3W3DA 4BC2A 1XI1A 5K14A 4B08A 2IGIA 4C8KA 2A41A 3BZKA 3EYZA 4JV5K 4AHTA 4WQ5C 1GLAG 2NRHA 3I55N 2P51A 1NWKA 4BDZA 3SYZA 1YTAA 3V9ZA 3TWHA 4CFBA 1SL2A 3OYCA 1KRPA 2D0AA 1QSLA 1SKRA 4O55A 4DV7K 3K2PA 1TKDA 1RT7A 4FWLA 3FR0A 4GKKK 3LDQA 3D2FA 1YUWA 2Z1IA 3U9ZA 4FM2A 3L2RA 1TKXA 1T03A 4B3TK 4BVOA 3KTQA 1KVBA 4LF6K 3LDNA 4A5BA 1WSFA 2EWSA 3ZT3A 4AF1A 1BL3A 4LF5K 4KHQA 3C6TA 2IVPA 1B92A 3KHYA 4OJRA 1NG9A 4EZ6A 3DYAA 4H0YB 2V7ZA 2I5JA 1DEJA 3NHGA 1JJ2M 4B1UB 3IG1A 2PBDA 3HM8A 3QEVA 3CCMN 5DM7L 3M8PA 3M8SA 3CD6N 3SV4A 2AA4A 1TYQB 1LWCA 3LP1A 4DQQA 2A3ZA 3TAMA 4IDKA 3DM2A 1NMNA 3RRGA 2JLEA 2P9PB 5HRSA 4HTLA 4HUGA 2FLOA 4QCLA 3QESA 4RG8A 1RT6A 3PX0A 3HL8A 1HNZK 1ASUA 4I6MA 3SI6A 1EETA 5TKYA 3O9TA 4FM1A 5HP1A 2B4JA 5FLXO 2NNWA 2G8FA 2CGJA 3DI6A 3EY1A 3L2UA 3CC4N 2OTLN 4ISGA 2Z1GA 2GUIA 1HYZA 2E8AA 4PQUA
chains in the Genus database with same CATH topology
4AHVA 2G8UA 4DMNA 3OYHA 1RNHA 3DOKA 2VWJA 1U47A 4F3OA 4CJ4A 2ZQBA 3RMDA 1RBRA 3OYFA 1BCMA 1TL3A 4AHRA 2VG6A 3D45A 1RDCA 5CZ1A 4F2RA 4PWDA 4DTMA 3AVNA 3C6UA 3AVJA 3ASMA 5HROA 1ZBLA 2YNGA 4W5OA 4CJKA 1I39A 1BIZA 2X78A 4OKKA 2FBTA 1QTMA 3ALYA 3VA0A 4K8ZA 4C8LA 3QIOA 1BQMA 3AA5X 3V9XA 3P5JA 4DQSA 1KLNA 1NJXA 2BE2A 4XIUA 1X1PA 3P83D 2HHVA 4B9VA 3LZIA 3TABA 3SUNA 4E1NA 4AHUA 3ZSZA 2XY7A 4FYDA 4CF2A 4DTOA 1NJZA 3ZSYA 2OPRA 1X9SA 4CEDA 1NKCA 2XY5A 5J2QA 1WSHA 3E01A 3C94A 4GVMA 2OA8A 2VG5A 3LWLA 3CQ8A 4M41A 2FBYA 1SKWA 1JLBA 2KZZA 4KPYA 3AO2A 4FJGA 4DU3A 3NH0A 2WOMA 4Z4IA 3QERA 4LSNA 3DRPA 1DTQA 2WONA 2G8VA 3AA2A 3QEIA 1BGXT 4HVJA 3V9UA 1LAWA 3V1RA 3KK2A 4FJKA 3VQCA 3SPYA 4L8RB 4AHCA 3TR8A 3RTVA 5FDLA 1TKTA 4KHSA 2IC3A 4DF8A 4IFYA 1JLGA 4KHWA 2Q3SA 2BANA 3AVMA 4OKEA 1L3TA 4FXDA 3M8QA 1VSHA 3KK1A 2XHBA 1HNVA 1RT2A 3ZCMA 3ULDA 2IDOA 3O4QA 1BCOA 1WAFA 1KVAA 4CGHA 3VQQA 4LY7A 4ELTA 3OYEA 1VSIA 3KLGA 1WNSA 5D3GA 4FLUA 1LWFA 2F96A 4BWMA 4DSFA 3V4IA 1VSEA 1S1UA 3AVIA 3THVA 4NCAA 4W5TA 3MEEA 2IAJA 1GOBA 1KTQA 4FK4A 1C1CA 4E7KA 4DSLA 4E7JA 3LANA 1HQUA 2PZSA 1WAJA 4JLHA 1DLOA 4FJLA 3B6PA 2ETJA 4FZXC 5T7BA 1QSYA 4ID5A 1NK6A 3HSTB 3K5NA 4OGCA 4G1QA 4DQPA 4CEOA 1JLFA 1HJRA 4CESA 1U45A 1N5YA 3SUOA 1TV6A 2YNFA 4NYFA 1JLAA 4H4MA 4LH4A 4QAGA 4ELUA 2HHQA 1WLJA 2LSNA 1KFSA 4J2DA 2G8IA 1KVCA 3OYMA 3A2FA 3QLHA 4FLVA 3HP9A 3LPTA 3JSMA 3TI0A 2YHBA 1JL2A 3OYNA 5KGXA 3D0PA 4AILC 3NBPA 2FBVA 3AO5A 4OLBA 2EHGA 1YT3A 4B9LA 3LP0A 5FRNA 3HPGA 3OJSA 1YVUA 3T19A 5HLFA 3LAKA 4CCHA 4DTSA 4NCGA 3KIOA 1S1WA 2DFHA 1BQNA 3OYLA 2G8WA 3QETA 3PX6A 1IKWA 4LH5A 3SNNA 2W42A 4HHTA 1D9DA 4DWIA 4PUOA 4FLXA 1FKOA 3WNEA 1S9EA 2YNHA 1L3VA 1G15A 3HK2A 1XHXA 4BACA 3IAYA 4FVMA 4W5NA 4TSXA 3L2WA 3MXJA 4I9LA 4OPKA 3OYGA 5CY4A 4CF8A 3KJVA 4FLTA 4M3WA 2QK9A 2KZMA 4FLZA 3CM6A 4CJWA 4KHNA 4N47A 5DK5A 1JXEA 4CGJA 4FJNA 5J2PA 4AH9A 4DTPA 1XWLA 3EZ5A 1TAQA 4FJJA 1NK8A 4E7IA 2HHUA 2F8TA 2HB5A 4IKFA 3F73A 5E41A 3AO1A 2OPQA 4KHUA 4OGEA 3KK3A 3VN5A 1W9HA 4C8NA 2YHAA 1NK0A 5HRNA 3NH2A 4DLEA 2ZD1A 4E0DA 3DOLA 4FCYA 4DU1A 1ZYQA 2HVIA 4F2SA 4BE1A 3O4NA 4FJIA 2ZE2A 1UOCA 1U48A 1S1XA 1C1AA 4CJSA 4ELVA 4DS4A 4I7FA 1TAUA 4DLGA 1U49A 1C0UA 3K57A 4I2QA 3OJUA 1CZ9A 4KTZA 4KTWA 3PY8A 2E6MA 3AO3A 1EXQA 4IBNA 4H8KA 1HMVA 1SL0A 3ZSQA 1KLMA 1J9AA 4CHPA 4CJ3A 3SZ2A 1R0AA 3L3VA 1HNIA 4CJPA 4EP5A 4FM0A 3HO1A 4Z4GA 1A5XA 3CYMA 3LPUA 5CYMA 3K5MA 3AVFA 4E3SA 1VSDA 1BISA 1S5JA 4CIGA 4Y1DA 1VSLA 1WSEA 1I3AA 1KSPA 3S9HA 3O3HA 4YFUA 3RWUA 3HJFA 2DFEA 3TAGA 4CK2A 4CFCA 3NF7A 3ZT4A 3P1GA 1Q9YA 4O4GA 2XY6A 4CIEA 2Z1JA 4N56A 3K5OA 2B6AA 2PYLA 4FJ8A 3NGYA 1FXXA 1HYSA 2IS3A 2QKKA 2E4LA 2D5RA 3HM9A 1O1WA 3B6OA 4KI4A 3T1AA 3ZT2A 4FLWA 2GV9A 4OVLA 1EP4A 3QO9A 4WE1A 3HVTA 4LD0A 4F4KA 2O4IA 3ZSRA 3O3FA 5DMRA 4E7HA 1T8EA 3I0SA 1SV5A 4NCBA 4CEEA 4FZZA 4EZ9A 3VQ6A 3HP6A 3M8RA 2YV0X 4KHYA 4BE2A 2BGGA 5EU7A 1NKBA 4CK3A 1RBVA 3JYTA 1D8YA 4CEZA 5SZTA 4M3XA 1S1VA 4N5SA 3V81A 3SPZA 2AJQA 3ZSWA 3K59A 3U3YA 4MQ3A 4KKOA 1ASVA 1Q8IA 3VQEA 1ZBFA 1X9WA 3OVNA 4Z4CA 1RDBA 4CF9A 4Q5VA 1RCHA 4J2AA 2X6NA 3NF9A 1HYVA 3OY9A 3NDKA 1W0HA 3TAEA 1VSJA 4KV8A 3ZT0A 2OZMA 1TVRA 3SCXA 4K8XA 3RMCA 2HHSA 3I0RA 4CJUA 2PY5A 1JLQA 2XY8A 1QE1A 4CJTA 3LDSA 3NAEA 1RBUA 4M42A 2E6LA 4BDPA 3BGRA 4EP4A 3FFIA 3LP2A 2KFNA 1C1BA 1BHLA 3VQ9A 1Q9XA 1ZBHA 4CHZA 2KFZA 4ZHRA 1ZBUA 4E89A 4KTQA 4ZTJA 3QINA 1NKEA 3AVCA 1KFDA 2IOCA 3K58A 4I2PA 1B9DA 1RT5A 3WNFA 4KB1A 1NK9A 3S3OA 4B9UA 4FJHA 2P5OA 1EX4A 4ID1A 3OYIA 3SQ2A 3OS2A 1C0TA 3HPHA 3H08A 4ZTFA 1BI4B 4CEFA 4Z0UA 2YKNA 2D0BA 3IRXA 2X6SA 4O0JA 4B8CA 3AVGA 4CFAA 3OYKA 3KLEA 1CXQA 4CFDA 1TK0A 1TK8A 3NGZA 4O0IA 3KD1E 4DTNA 1RBTA 2ATQA 1NK4A 4CEQA 4CHQA 4M3YA 3TAPA 3IS9A 1D5AA 5C25A 1HRHA 2RKIA 4CIFA 3S3MA 4M3RA 4RW7A 3L2VA 4C8OA 4Z4EA 2XRIA 3I8DA 4I9QA 3LZJA 2KW4A 3K5LA 1UAXA 1VSKA 1BI4A 4PA1A 4E1MA 5CZ2A 4JS4A 4DF4A 3KLFA 5FROA 1NOZA 1SL1A 4B9MA 4KB0A 3RMBA 5I42A 4FJ7A 1NOYA 4FJ9A 1VRTA 2JGUA 4IG3A 4CJ5A 3NH1A 4FW1A 2VWKA 3VQ4A 4JRQA 4GW6A 2YKMA 2VG7A 4GMJB 3VQBA 1ITGA 3MEGA 3AA4A 4DSJA 2XO7A 3DLBA 3NGIA 4DQIA 4CF0A 4FJ5A 3AVKA 4M3UA 1UA0A 4RW4A 4AHSA 1GOAA 4KRFA 1IKXA 1NJYA 1JLEA 3RRHA 3QNOA 3SQ0A 2HNZA 3TAFA 4O44A 4DTUA 4CGGA 3KLHA 3ZSVA 3HT3A 4B9SA 1Z25A 1RT4A 1QSSA 2DFFA 3AA3A 3CM5A 5KI6A 3ZSOA 3OYJA 3V9SA 4DQRA 2Y1IA 5I3UA 3RR7A 5J1EA 3WNGA 4DS5A 4DFJA 1LV5A 4NYNA 1A5WA 1RILA 3TARA 3HYFA 1ASWA 4O5BA 1L3SA 3T3FA 4F8RA 3G0ZA 4DFMA 1N6QA 3HVRA 1A5VA 4CHOA 2FC0A 4ICLA 4MFBA 4W5RA 4KREA 5CYQA 3QEXA 3SUQA 3SJJA 5J2MA 1C0MA 4DG1A 3L8BA 4H4OA 4Q0BA 4RW8A 4E7LA 3CFOA 4HCCA 5SWMA 5FRMA 3MXMA 3V6DA 2Y1JA 1S9GA 1JL1A 4M45A 1J5OA 2NUBA 1EKEA 1RDDA 1TGOA 4YNQA 4M3ZA 3O3GA 3CG7A 1T05A 4Z4FA 1YTUA 3NCIA 4CECA 1S6QA 4JRPA 1IG9A 4CGFA 2F8SA 3MECA 1IH7A 1JLCA 3VQ7A 1L3UA 1J53A 4HUFA 4HCBA 3HPOA 2O4GA 1RT3A 3U3GA 3S3NA 3SQ1A 4BE0A 4RW9A 5KTQA 2HHWA 2HHTA 4B3OA 1L5UA 4FK0A 1QQCA 2FBXA 3MEDA 1LAVA 2G8KA 1JXBA 4DTRA 3F9KA 3PX4A 3ITHA 3VQAA 1FK9A 3LAMA 1VSMA 4DSEA 2A1RA 4B9NA 2HVHA 1VRUA 2HW3A 4BWJA 1WN7A 3PO4A 2GBZA 5JS1A 4FW2A 2Z1HA 3NF6A 2OPSA 1RBSA 2RN2A 3ISNC 1GOCA 4DFKA 1WSJA 3L2QA 5KGWA 1XC9A 4N76A 1RTIA 1JKHA 4J2BA 2X74A 2P1JA 4CK1A 2R7YA 4DU4A 1CXUA 1DTTA 1BIUA 3OYBA 3AVBA 4OLAA 1Y97A 3SUPA 4CHYA 4IG0A 2OYQA 4JS5A 4CEBA 2B5JA 4FZYA 3LWMA 3OYDA 4M3TA 1FKPA 1SUQA 3DLRA 3RMAA 1K6YA 4DSKA 3KLIA 1WSGA 4QOZB 1IKYA 3MAQA 1XI1A 5K14A 4B08A 2IGIA 3LALA 1S1TA 3TANA 4C8KA 4QCLA 4DTJA 4Z4HA 4DFPA 3EYZA 4AHTA 4CJLA 3SV3A 4CHNA 2P51A 4BDYA 1IKVA 3DLHA 3PO5A 1QHTA 1RTHA 4OPJA 1LWEA 4BDZA 4OKJA 2HHXA 3SYZA 1YTAA 3V9ZA 3NE6A 5KRSA 3TWHA 3PV8A 4CFBA 2OZSA 4FJXA 1SL2A 3C95A 2RF2A 3PUFA 3OYCA 1KRPA 1HPZA 4RW6A 3AO4A 4CGDA 2OPPA 3OS1A 2D0AA 1RTDA 1QSLA 2DY4A 1KCFA 1REVA 1SKRA 3V9WA 5HBMA 4O55A 3L3UA 1S6PA 3VQ8A 1HQEA 1LW0A 4B8AB 1X9MA 1WSIA 2RPIA 4CJFA 3SQ4A 4KAZA 3K2PA 3OS0A 1TKDA 5J2NA 1RT7A 3QIPA 3KD5E 3WNHA 2KTQA 3KKSA 4FLYA 1NK5A 4J2EA 3QEPA 2ITGA 3DRSA 3NFAA 1RDAA 1RT1A 3DLGA 2Z1IA 4CE9A 4FM2A 3BDPA 3L2RA 3CFRA 1TKXA 1T03A 3ZT1A 1D9FA 3KTQA 1KVBA 4UQGA 1ZBIA 3KKRA 4DTXA 1WSFA 3ZT3A 2A1SA 3RR8A 4KFBA 1BL3A 3UIQA 1TKZA 4CF1A 2DTUA 4KHQA 4LSLA 3AV9A 3C6TA 1XHZA 1B92A 1CLQA 4OJRA 3U6FA 4FJMA 4EZ6A 3DYAA 1IO2A 1J54A 1UA1A 2I5JA 2HNYA 3NHGA 3CFPA 1VK0A 1LW2A 3IG1A 2PYJA 2G8HA 3QEVA 4W5QA 3VQPA 3HXMA 4CERA 2EX3A 3QNNA 4IFVA 4R5PA 3M8PA 3M8SA 3VQDA 4HUEA 3VA3A 3SV4A 4FK2A 4N41A 5HRPA 1LWCA 3LP1A 3G10A 5C42A 4CJEA 4DQQA 1QS4A 4C8MA 4CJVA 1RTJA 1VSFA 2KQ2A 3LP3A 4KI6A 1C6VA 1MU2A 1SKSA 3TAMA 4E19A 4IDKA 3DM2A 1T7PA 5KRTA 3DLEA 5HRRA 4PY5A 3QEWA 3RRGA 4DSIA 2JLEA 5HRSA 4HUGA 4F3TA 2QKBA 3AVAA 3TAQA 2QXFA 4CGIA 3NF8A 3V1QA 4CJQA 3AVHA 4RG8A 1RT6A 2YNIA 1Z26A 3ZSXA 2D0CA 3QESA 3PX0A 1NK7A 3HL8A 1NJWA 4CEAA 1TL1A 1ASUA 1U4BA 3DMJA 5JS2A 3SI6A 3DRRA 4Y1CA 3MXIA 1EETA 2HMIA 4FM1A 5C24A 1CZBA 1F21A 1U04A 2B4JA 3V1OA 5HP1A 2G8FA 1UWBA 4HTUA 4CJRA 3DI6A 3AVLA 4KO0A 3EY1A 1TK5A 3L2UA 3DLKA 4B9TA 3VQ5A 2BDPA 2Z1GA 2P5GA 3OYAA 2GUIA 1HYZA 2HNDA 4PQUA 1B9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AHV A;  2G8U A;  4DMN A;  3OYH A;  1RNH A;  3DOK A;  2VWJ A;  1U47 A;  4F3O A;  4CJ4 A;  2ZQB A;  3RMD A;  1RBR A;  3OYF A;  1BCM A;  1TL3 A;  4AHR A;  2VG6 A;  3D45 A;  1RDC A;  5CZ1 A;  4F2R A;  4PWD A;  4DTM A;  3AVN A;  3C6U A;  3AVJ A;  3ASM A;  5HRO A;  1ZBL A;  2YNG A;  4W5O A;  4CJK A;  1I39 A;  1BIZ A;  2X78 A;  4OKK A;  2FBT A;  1QTM A;  3ALY A;  3VA0 A;  4K8Z A;  4C8L A;  3QIO A;  1BQM A;  3AA5 X;  3V9X A;  3P5J A;  4DQS A;  1KLN A;  1NJX A;  2BE2 A;  4XIU A;  1X1P A;  3P83 D;  2HHV A;  4B9V A;  3LZI A;  3TAB A;  3SUN A;  4E1N A;  4AHU A;  3ZSZ A;  2XY7 A;  4FYD A;  4CF2 A;  4DTO A;  1NJZ A;  3ZSY A;  2OPR A;  1X9S A;  4CED A;  1NKC A;  2XY5 A;  5J2Q A;  1WSH A;  3E01 A;  3C94 A;  4GVM A;  2OA8 A;  2VG5 A;  3LWL A;  3CQ8 A;  4M41 A;  2FBY A;  1SKW A;  1JLB A;  2KZZ A;  4KPY A;  3AO2 A;  4FJG A;  4DU3 A;  3NH0 A;  2WOM A;  4Z4I A;  3QER A;  4LSN A;  3DRP A;  1DTQ A;  2WON A;  2G8V A;  3AA2 A;  3QEI A;  1BGX T;  4HVJ A;  3V9U A;  1LAW A;  3V1R A;  3KK2 A;  4FJK A;  3VQC A;  3SPY A;  4L8R B;  4AHC A;  3TR8 A;  3RTV A;  5FDL A;  1TKT A;  4KHS A;  2IC3 A;  4DF8 A;  4IFY A;  1JLG A;  4KHW A;  2Q3S A;  2BAN A;  3AVM A;  4OKE A;  1L3T A;  4FXD A;  3M8Q A;  1VSH A;  3KK1 A;  2XHB A;  1HNV A;  1RT2 A;  3ZCM A;  3ULD A;  2IDO A;  3O4Q A;  1BCO A;  1WAF A;  1KVA A;  4CGH A;  3VQQ A;  4LY7 A;  4ELT A;  3OYE A;  1VSI A;  3KLG A;  1WNS A;  5D3G A;  4FLU A;  1LWF A;  2F96 A;  4BWM A;  4DSF A;  3V4I A;  1VSE A;  1S1U A;  3AVI A;  3THV A;  4NCA A;  4W5T A;  3MEE A;  2IAJ A;  1GOB A;  1KTQ A;  4FK4 A;  1C1C A;  4E7K A;  4DSL A;  4E7J A;  3LAN A;  1HQU A;  2PZS A;  1WAJ A;  4JLH A;  1DLO A;  4FJL A;  3B6P A;  2ETJ A;  4FZX C;  5T7B A;  1QSY A;  4ID5 A;  1NK6 A;  3HST B;  3K5N A;  4OGC A;  4G1Q A;  4DQP A;  4CEO A;  1JLF A;  1HJR A;  4CES A;  1U45 A;  1N5Y A;  3SUO A;  1TV6 A;  2YNF A;  4NYF A;  1JLA A;  4H4M A;  4LH4 A;  4QAG A;  4ELU A;  2HHQ A;  1WLJ A;  2LSN A;  1KFS A;  4J2D A;  2G8I A;  1KVC A;  3OYM A;  3A2F A;  3QLH A;  4FLV A;  3HP9 A;  3LPT A;  3JSM A;  3TI0 A;  2YHB A;  1JL2 A;  3OYN A;  5KGX A;  3D0P A;  4AIL C;  3NBP A;  2FBV A;  3AO5 A;  4OLB A;  2EHG A;  1YT3 A;  4B9L A;  3LP0 A;  5FRN A;  3HPG A;  3OJS A;  1YVU A;  3T19 A;  5HLF A;  3LAK A;  4CCH A;  4DTS A;  4NCG A;  3KIO A;  1S1W A;  2DFH A;  1BQN A;  3OYL A;  2G8W A;  3QET A;  3PX6 A;  1IKW A;  4LH5 A;  3SNN A;  2W42 A;  4HHT A;  1D9D A;  4DWI A;  4PUO A;  4FLX A;  1FKO A;  3WNE A;  1S9E A;  2YNH A;  1L3V A;  1G15 A;  3HK2 A;  1XHX A;  4BAC A;  3IAY A;  4FVM A;  4W5N A;  4TSX A;  3L2W A;  3MXJ A;  4I9L A;  4OPK A;  3OYG A;  5CY4 A;  4CF8 A;  3KJV A;  4FLT A;  4M3W A;  2QK9 A;  2KZM A;  4FLZ A;  3CM6 A;  4CJW A;  4KHN A;  4N47 A;  5DK5 A;  1JXE A;  4CGJ A;  4FJN A;  5J2P A;  4AH9 A;  4DTP A;  1XWL A;  3EZ5 A;  1TAQ A;  4FJJ A;  1NK8 A;  4E7I A;  2HHU A;  2F8T A;  2HB5 A;  4IKF A;  3F73 A;  5E41 A;  3AO1 A;  2OPQ A;  4KHU A;  4OGE A;  3KK3 A;  3VN5 A;  1W9H A;  4C8N A;  2YHA A;  1NK0 A;  5HRN A;  3NH2 A;  4DLE A;  2ZD1 A;  4E0D A;  3DOL A;  4FCY A;  4DU1 A;  1ZYQ A;  2HVI A;  4F2S A;  4BE1 A;  3O4N A;  4FJI A;  2ZE2 A;  1UOC A;  1U48 A;  1S1X A;  1C1A A;  4CJS A;  4ELV A;  4DS4 A;  4I7F A;  1TAU A;  4DLG A;  1U49 A;  1C0U A;  3K57 A;  4I2Q A;  3OJU A;  1CZ9 A;  4KTZ A;  4KTW A;  3PY8 A;  2E6M A;  3AO3 A;  1EXQ A;  4IBN A;  4H8K A;  1HMV A;  1SL0 A;  3ZSQ A;  1KLM A;  1J9A A;  4CHP A;  4CJ3 A;  3SZ2 A;  1R0A A;  3L3V A;  1HNI A;  4CJP A;  4EP5 A;  4FM0 A;  3HO1 A;  4Z4G A;  1A5X A;  3CYM A;  3LPU A;  5CYM A;  3K5M A;  3AVF A;  4E3S A;  1VSD A;  1BIS A;  1S5J A;  4CIG A;  4Y1D A;  1VSL A;  1WSE A;  1I3A A;  1KSP A;  3S9H A;  3O3H A;  4YFU A;  3RWU A;  3HJF A;  2DFE A;  3TAG A;  4CK2 A;  4CFC A;  3NF7 A;  3ZT4 A;  3P1G A;  1Q9Y A;  4O4G A;  2XY6 A;  4CIE A;  2Z1J A;  4N56 A;  3K5O A;  2B6A A;  2PYL A;  4FJ8 A;  3NGY A;  1FXX A;  1HYS A;  2IS3 A;  2QKK A;  2E4L A;  2D5R A;  3HM9 A;  1O1W A;  3B6O A;  4KI4 A;  3T1A A;  3ZT2 A;  4FLW A;  2GV9 A;  4OVL A;  1EP4 A;  3QO9 A;  4WE1 A;  3HVT A;  4LD0 A;  4F4K A;  2O4I A;  3ZSR A;  3O3F A;  5DMR A;  4E7H A;  1T8E A;  3I0S A;  1SV5 A;  4NCB A;  4CEE A;  4FZZ A;  4EZ9 A;  3VQ6 A;  3HP6 A;  3M8R A;  2YV0 X;  4KHY A;  4BE2 A;  2BGG A;  5EU7 A;  1NKB A;  4CK3 A;  1RBV A;  3JYT A;  1D8Y A;  4CEZ A;  5SZT A;  4M3X A;  1S1V A;  4N5S A;  3V81 A;  3SPZ A;  2AJQ A;  3ZSW A;  3K59 A;  3U3Y A;  4MQ3 A;  4KKO A;  1ASV A;  1Q8I A;  3VQE A;  1ZBF A;  1X9W A;  3OVN A;  4Z4C A;  1RDB A;  4CF9 A;  4Q5V A;  1RCH A;  4J2A A;  2X6N A;  3NF9 A;  1HYV A;  3OY9 A;  3NDK A;  1W0H A;  3TAE A;  1VSJ A;  4KV8 A;  3ZT0 A;  2OZM A;  1TVR A;  3SCX A;  4K8X A;  3RMC A;  2HHS A;  3I0R A;  4CJU A;  2PY5 A;  1JLQ A;  2XY8 A;  1QE1 A;  4CJT A;  3LDS A;  3NAE A;  1RBU A;  4M42 A;  2E6L A;  4BDP A;  3BGR A;  4EP4 A;  3FFI A;  3LP2 A;  2KFN A;  1C1B A;  1BHL A;  3VQ9 A;  1Q9X A;  1ZBH A;  4CHZ A;  2KFZ A;  4ZHR A;  1ZBU A;  4E89 A;  4KTQ A;  4ZTJ A;  3QIN A;  1NKE A;  3AVC A;  1KFD A;  2IOC A;  3K58 A;  4I2P A;  1B9D A;  1RT5 A;  3WNF A;  4KB1 A;  1NK9 A;  3S3O A;  4B9U A;  4FJH A;  2P5O A;  1EX4 A;  4ID1 A;  3OYI A;  3SQ2 A;  3OS2 A;  1C0T A;  3HPH A;  3H08 A;  4ZTF A;  1BI4 B;  4CEF A;  4Z0U A;  2YKN A;  2D0B A;  3IRX A;  2X6S A;  4O0J A;  4B8C A;  3AVG A;  4CFA A;  3OYK A;  3KLE A;  1CXQ A;  4CFD A;  1TK0 A;  1TK8 A;  3NGZ A;  4O0I A;  3KD1 E;  4DTN A;  1RBT A;  2ATQ A;  1NK4 A;  4CEQ A;  4CHQ A;  4M3Y A;  3TAP A;  3IS9 A;  1D5A A;  5C25 A;  1HRH A;  2RKI A;  4CIF A;  3S3M A;  4M3R A;  4RW7 A;  3L2V A;  4C8O A;  4Z4E A;  2XRI A;  3I8D A;  4I9Q A;  3LZJ A;  2KW4 A;  3K5L A;  1UAX A;  1VSK A;  1BI4 A;  4PA1 A;  4E1M A;  5CZ2 A;  4JS4 A;  4DF4 A;  3KLF A;  5FRO A;  1NOZ A;  1SL1 A;  4B9M A;  4KB0 A;  3RMB A;  5I42 A;  4FJ7 A;  1NOY A;  4FJ9 A;  1VRT A;  2JGU A;  4IG3 A;  4CJ5 A;  3NH1 A;  4FW1 A;  2VWK A;  3VQ4 A;  4JRQ A;  4GW6 A;  2YKM A;  2VG7 A;  4GMJ B;  3VQB A;  1ITG A;  3MEG A;  3AA4 A;  4DSJ A;  2XO7 A;  3DLB A;  3NGI A;  4DQI A;  4CF0 A;  4FJ5 A;  3AVK A;  4M3U A;  1UA0 A;  4RW4 A;  4AHS A;  1GOA A;  4KRF A;  1IKX A;  1NJY A;  1JLE A;  3RRH A;  3QNO A;  3SQ0 A;  2HNZ A;  3TAF A;  4O44 A;  4DTU A;  4CGG A;  3KLH A;  3ZSV A;  3HT3 A;  4B9S A;  1Z25 A;  1RT4 A;  1QSS A;  2DFF A;  3AA3 A;  3CM5 A;  5KI6 A;  3ZSO A;  3OYJ A;  3V9S A;  4DQR A;  2Y1I A;  5I3U A;  3RR7 A;  5J1E A;  3WNG A;  4DS5 A;  4DFJ A;  1LV5 A;  4NYN A;  1A5W A;  1RIL A;  3TAR A;  3HYF A;  1ASW A;  4O5B A;  1L3S A;  3T3F A;  4F8R A;  3G0Z A;  4DFM A;  1N6Q A;  3HVR A;  1A5V A;  4CHO A;  2FC0 A;  4ICL A;  4MFB A;  4W5R A;  4KRE A;  5CYQ A;  3QEX A;  3SUQ A;  3SJJ A;  5J2M A;  1C0M A;  4DG1 A;  3L8B A;  4H4O A;  4Q0B A;  4RW8 A;  4E7L A;  3CFO A;  4HCC A;  5SWM A;  5FRM A;  3MXM A;  3V6D A;  2Y1J A;  1S9G A;  1JL1 A;  4M45 A;  1J5O A;  2NUB A;  1EKE A;  1RDD A;  1TGO A;  4YNQ A;  4M3Z A;  3O3G A;  3CG7 A;  1T05 A;  4Z4F A;  1YTU A;  3NCI A;  4CEC A;  1S6Q A;  4JRP A;  1IG9 A;  4CGF A;  2F8S A;  3MEC A;  1IH7 A;  1JLC A;  3VQ7 A;  1L3U A;  1J53 A;  4HUF A;  4HCB A;  3HPO A;  2O4G A;  1RT3 A;  3U3G A;  3S3N A;  3SQ1 A;  4BE0 A;  4RW9 A;  5KTQ A;  2HHW A;  2HHT A;  4B3O A;  1L5U A;  4FK0 A;  1QQC A;  2FBX A;  3MED A;  1LAV A;  2G8K A;  1JXB A;  4DTR A;  3F9K A;  3PX4 A;  3ITH A;  3VQA A;  1FK9 A;  3LAM A;  1VSM A;  4DSE A;  2A1R A;  4B9N A;  2HVH A;  1VRU A;  2HW3 A;  4BWJ A;  1WN7 A;  3PO4 A;  2GBZ A;  5JS1 A;  4FW2 A;  2Z1H A;  3NF6 A;  2OPS A;  1RBS A;  2RN2 A;  3ISN C;  1GOC A;  4DFK A;  1WSJ A;  3L2Q A;  5KGW A;  1XC9 A;  4N76 A;  1RTI A;  1JKH A;  4J2B A;  2X74 A;  2P1J A;  4CK1 A;  2R7Y A;  4DU4 A;  1CXU A;  1DTT A;  1BIU A;  3OYB A;  3AVB A;  4OLA A;  1Y97 A;  3SUP A;  4CHY A;  4IG0 A;  2OYQ A;  4JS5 A;  4CEB A;  2B5J A;  4FZY A;  3LWM A;  3OYD A;  4M3T A;  1FKP A;  1SUQ A;  3DLR A;  3RMA A;  1K6Y A;  4DSK A;  3KLI A;  1WSG A;  4QOZ B;  1IKY A;  3MAQ A;  1XI1 A;  5K14 A;  4B08 A;  2IGI A;  3LAL A;  1S1T A;  3TAN A;  4C8K A;  4QCL A;  4DTJ A;  4Z4H A;  4DFP A;  3EYZ A;  4AHT A;  4CJL A;  3SV3 A;  4CHN A;  2P51 A;  4BDY A;  1IKV A;  3DLH A;  3PO5 A;  1QHT A;  1RTH A;  4OPJ A;  1LWE A;  4BDZ A;  4OKJ A;  2HHX A;  3SYZ A;  1YTA A;  3V9Z A;  3NE6 A;  5KRS A;  3TWH A;  3PV8 A;  4CFB A;  2OZS A;  4FJX A;  1SL2 A;  3C95 A;  2RF2 A;  3PUF A;  3OYC A;  1KRP A;  1HPZ A;  4RW6 A;  3AO4 A;  4CGD A;  2OPP A;  3OS1 A;  2D0A A;  1RTD A;  1QSL A;  2DY4 A;  1KCF A;  1REV A;  1SKR A;  3V9W A;  5HBM A;  4O55 A;  3L3U A;  1S6P A;  3VQ8 A;  1HQE A;  1LW0 A;  4B8A B;  1X9M A;  1WSI A;  2RPI A;  4CJF A;  3SQ4 A;  4KAZ A;  3K2P A;  3OS0 A;  1TKD A;  5J2N A;  1RT7 A;  3QIP A;  3KD5 E;  3WNH A;  2KTQ A;  3KKS A;  4FLY A;  1NK5 A;  4J2E A;  3QEP A;  2ITG A;  3DRS A;  3NFA A;  1RDA A;  1RT1 A;  3DLG A;  2Z1I A;  4CE9 A;  4FM2 A;  3BDP A;  3L2R A;  3CFR A;  1TKX A;  1T03 A;  3ZT1 A;  1D9F A;  3KTQ A;  1KVB A;  4UQG A;  1ZBI A;  3KKR A;  4DTX A;  1WSF A;  3ZT3 A;  2A1S A;  3RR8 A;  4KFB A;  1BL3 A;  3UIQ A;  1TKZ A;  4CF1 A;  2DTU A;  4KHQ A;  4LSL A;  3AV9 A;  3C6T A;  1XHZ A;  1B92 A;  1CLQ A;  4OJR A;  3U6F A;  4FJM A;  4EZ6 A;  3DYA A;  1IO2 A;  1J54 A;  1UA1 A;  2I5J A;  2HNY A;  3NHG A;  3CFP A;  1VK0 A;  1LW2 A;  3IG1 A;  2PYJ A;  2G8H A;  3QEV A;  4W5Q A;  3VQP A;  3HXM A;  4CER A;  2EX3 A;  3QNN A;  4IFV A;  4R5P A;  3M8P A;  3M8S A;  3VQD A;  4HUE A;  3VA3 A;  3SV4 A;  4FK2 A;  4N41 A;  5HRP A;  1LWC A;  3LP1 A;  3G10 A;  5C42 A;  4CJE A;  4DQQ A;  1QS4 A;  4C8M A;  4CJV A;  1RTJ A;  1VSF A;  2KQ2 A;  3LP3 A;  4KI6 A;  1C6V A;  1MU2 A;  1SKS A;  3TAM A;  4E19 A;  4IDK A;  3DM2 A;  1T7P A;  5KRT A;  3DLE A;  5HRR A;  4PY5 A;  3QEW A;  3RRG A;  4DSI A;  2JLE A;  5HRS A;  4HUG A;  4F3T A;  2QKB A;  3AVA A;  3TAQ A;  2QXF A;  4CGI A;  3NF8 A;  3V1Q A;  4CJQ A;  3AVH A;  4RG8 A;  1RT6 A;  2YNI A;  1Z26 A;  3ZSX A;  2D0C A;  3QES A;  3PX0 A;  1NK7 A;  3HL8 A;  1NJW A;  4CEA A;  1TL1 A;  1ASU A;  1U4B A;  3DMJ A;  5JS2 A;  3SI6 A;  3DRR A;  4Y1C A;  3MXI A;  1EET A;  2HMI A;  4FM1 A;  5C24 A;  1CZB A;  1F21 A;  1U04 A;  2B4J A;  3V1O A;  5HP1 A;  2G8F A;  1UWB A;  4HTU A;  4CJR A;  3DI6 A;  3AVL A;  4KO0 A;  3EY1 A;  1TK5 A;  3L2U A;  3DLK A;  4B9T A;  3VQ5 A;  2BDP A;  2Z1G A;  2P5G A;  3OYA A;  2GUI A;  1HYZ A;  2HND A;  4PQU A;  1B9F A; 
#chains in the Genus database with same CATH topology
 4DMN A;  2VWJ A;  1EQY A;  4CJ4 A;  1IBK K;  5AZJ A;  3TTC A;  3H1Q A;  3OYF A;  3D45 A;  5CZ1 A;  4PWD A;  5AQT A;  3MN5 A;  2KHO A;  3AVJ A;  3ASM A;  1N33 K;  1BU6 O;  5AQJ A;  1BQM A;  4CI6 A;  3P5J A;  4DQS A;  1KLN A;  1NJX A;  2F9T A;  2HHV A;  3CPE A;  3EKU A;  4H0X B;  2RE2 A;  4AHU A;  4DTO A;  2OPR A;  1X9S A;  5AQO A;  4CED A;  1NKC A;  1M1K O;  1HKB A;  2XY5 A;  3E9O A;  1WSH A;  3NVK A;  1NM1 A;  3LWL A;  3CQ8 A;  2KZZ A;  4DU3 A;  4K25 A;  4Z4I A;  3EL2 A;  3QER A;  1OH7 A;  3DRP A;  1BGX T;  4OO1 J;  3V9U A;  5AJ3 K;  4FVU A;  2BTF A;  1Z6R A;  3SPY A;  4KHS A;  1U2V A;  5FDL A;  4IFY A;  3FZH A;  3JS6 A;  2BAN A;  3M8Q A;  3KK1 A;  3CC7 N;  4ELT A;  4FWS A;  5M1Q A;  4NXN K;  3KLG A;  1WNS A;  3V4I A;  3BEX A;  3AVI A;  4PHT X;  3DXM B;  2IAJ A;  3CJA A;  3VGL A;  4DUZ K;  1GOB A;  2QWR A;  4E7K A;  1HQU A;  1DLO A;  4B3R K;  1RFQ A;  1D4X A;  3K5N A;  4YOW A;  1LOT B;  4X65 K;  5AQH A;  1JLF A;  3SUO A;  3MCA B;  4H4M A;  3HZ6 A;  2G8I A;  2HMP A;  3ID8 A;  3A2F A;  1QQN A;  4B9L A;  3VGK A;  3H1V X;  2VQE K;  4FWQ A;  4QS9 A;  4PKG A;  1EO1 A;  3OJS A;  2QW9 A;  3CCS N;  4LC9 B;  4BR4 A;  2G8W A;  1S1W A;  2DFH A;  3OYL A;  3QET A;  5AQP A;  3SNN A;  4JKA A;  3DJC A;  1HLU A;  1S9E A;  3HK2 A;  4BR7 A;  1XHX A;  4FVM A;  3LDO A;  3MXJ A;  4JK7 A;  2JWL A;  4OPK A;  3VER A;  1NGF A;  4N47 A;  1JXE A;  2HBJ A;  5J2P A;  1NK8 A;  4BRQ A;  2GX9 A;  2HBK A;  4OGE A;  3KK3 A;  4C8N A;  2YHA A;  1WUA A;  3OBY A;  1N36 K;  3FZL A;  3AAR A;  4FCY A;  2NRZ A;  3H3N O;  3H3O B;  3ZX2 A;  4ELV A;  4PL7 A;  3OJU A;  4KTZ A;  4H8K A;  4JKH A;  3ZSQ A;  4IWV A;  5ELZ A;  3L3V A;  1HNI A;  4FM0 A;  2HHH K;  1A5X A;  3SMS A;  5ADX H;  1BIS A;  1S5J A;  4CIG A;  4F9O A;  1VSL A;  1KSP A;  1I3A A;  5FPE A;  4DR3 K;  3RWU A;  2DFE A;  3TAG A;  4JK9 A;  3MN9 A;  3ZT4 A;  3P1G A;  3J7Y P;  4N56 A;  2Z1J A;  4FJ8 A;  1HYS A;  1FXX A;  1GLL O;  2QKK A;  1BA1 A;  4GV3 A;  4KI4 A;  1YVN A;  4FLW A;  2GV9 A;  4NLB A;  3HVT A;  2Q97 A;  3MCP A;  3HTV A;  4FWR A;  3CCR N;  4U67 L;  5BRD A;  3HP6 A;  1Y64 A;  3P4I A;  2BGG A;  2ZJP L;  5EU7 A;  1NMD A;  4CEZ A;  1IBL K;  2UYT A;  3SPZ A;  3H45 C;  3HOT A;  2AJQ A;  2GWK A;  1XMO K;  1QZ5 A;  4KKO A;  5AR0 A;  3VQE A;  1ZBF A;  3OVN A;  1RDB A;  4J2A A;  3NDK A;  4FPA A;  1TVR A;  3IMX A;  1EWQ A;  2XY8 A;  4FPB A;  4B9Q A;  1GLJ O;  1QQM A;  2I7P A;  1RBU A;  3GBT A;  4M42 A;  4DV1 K;  3GL1 A;  4GV6 A;  3WXI A;  4GV9 A;  3FE1 A;  1ZBU A;  1QHA A;  2E1Y A;  3BP8 A;  3O9Q A;  1QQO A;  1RT5 A;  3D2E B;  1NGI A;  3S3O A;  2GEL A;  4FJH A;  2WC9 A;  1K8K B;  2QWN A;  2YJE A;  1Q81 O;  4CEF A;  4CFA A;  2D0B A;  3OYK A;  5C0Y A;  3NGZ A;  4O0I A;  1XNR K;  1RBT A;  2PAV A;  3FZK A;  3TAP A;  1D5A A;  3C7N A;  1HRH A;  2ZGY A;  3S3M A;  3FZM A;  3MDQ A;  4JI1 K;  5BPL A;  4I9Q A;  1HNW K;  3LZJ A;  2KW4 A;  1YJN N;  3SAH A;  1VSK A;  4EZ9 A;  5CZ2 A;  4B9M A;  3KLF A;  5M1P A;  1NOY A;  3NH1 A;  4IG3 A;  2VWK A;  3VQ4 A;  4DSJ A;  2XO7 A;  2NZT A;  1OH6 A;  3DXK B;  3ZYY X;  4JI6 K;  4RW4 A;  4AHS A;  3M5R A;  1IKX A;  3SQ0 A;  4DTU A;  1HKC A;  1RT4 A;  2Y1I A;  4IZ9 A;  4DQR A;  3A0I X;  2P9L A;  3WNG A;  5AQW A;  4CZE A;  4DFJ A;  1HKG A;  3TAR A;  4RCH A;  5E26 A;  4O5B A;  3G0Z A;  4JAX A;  4DFM A;  1N6Q A;  4ICL A;  4W5R A;  2V52 B;  1VQP N;  3KK7 A;  3SJJ A;  4KH6 A;  4Q0B A;  4RW8 A;  4E7L A;  4GVE A;  3O1W A;  1S9G A;  1JL1 A;  4CBW A;  1TGO A;  1TUY A;  3VEV A;  1IG9 A;  3Q7C A;  3CCU N;  3HPO A;  4RW9 A;  2NRR A;  5EXW A;  4B3O A;  2UXB K;  3UE5 A;  3F9M A;  3MED A;  4WQ5 A;  2ZGZ A;  3F9K A;  3ITH A;  1V4S A;  2HVH A;  1VSM A;  4DR2 K;  3E9L A;  1WN7 A;  2WFB A;  2ZJQ L;  5AQZ A;  1RBS A;  2IVN A;  1GOC A;  4PKH A;  3L2Q A;  1MWM A;  1JKH A;  2YHY A;  2NRT A;  1Y97 A;  4CHY A;  4IG0 A;  4FZY A;  1K6Y A;  3KLI A;  4JI8 K;  3CIP A;  3SK3 A;  3LAL A;  3TAN A;  4XEI A;  5FPN A;  4IO9 L;  3O9R A;  3PO5 A;  4OPJ A;  1NBW A;  4OKJ A;  3WQU A;  3NE6 A;  3PUF A;  3ENH A;  2WBN A;  3AO4 A;  2OPP A;  1NGH A;  1REV A;  2DPN A;  5HBM A;  1OVY A;  3VF6 A;  1VHX A;  1HQE A;  1LW0 A;  4B8A B;  2RPI A;  4H0T B;  4KAZ A;  4CD1 A;  3SLC A;  1IG8 A;  3QIP A;  4FLY A;  3QEP A;  2ITG A;  3DRS A;  3NFA A;  2E2P A;  1RT1 A;  3BDP A;  4KHP K;  1H1V A;  3ZT1 A;  4UQG A;  3K9K A;  2A1S A;  4CZF A;  4H5V A;  4KFB A;  3UIQ A;  4CF1 A;  1MWK A;  4A61 A;  1XHZ A;  2VGM A;  3U6F A;  1IO2 A;  2HNY A;  5I9E B;  3CFP A;  4WYB A;  5HOO A;  3OW2 M;  4K42 A;  2G8H A;  2O8D A;  3E1Y A;  3HXM A;  4CER A;  2EX3 A;  3CQX A;  4IFV A;  2AP1 A;  5BN8 A;  3CQY A;  3VQD A;  4AM7 A;  3LM2 A;  2CH6 A;  5HRP A;  3CPW M;  5C42 A;  4N41 A;  3O5B A;  3C65 A;  3HRG A;  1BG3 A;  1QS4 A;  3VF2 A;  1VSF A;  2FXU A;  2KQ2 A;  4OX9 K;  4KI6 A;  3CMA N;  1C6V A;  1SKS A;  3O9S A;  5JLF A;  4PY5 A;  2HOE A;  2FSJ A;  3GG4 A;  4CJQ A;  2OCE A;  3AVH A;  2YNI A;  1DKG D;  5CHI A;  1TL1 A;  4FWM A;  5AZJ B;  4Y1C A;  3C6A A;  4IXC A;  3MXI A;  3U8X A;  3HSC A;  1F21 A;  3V1O A;  4O8U A;  3DLK A;  3EZW A;  1O13 A;  2P5G A;  3OYA A;  3H46 O;  5FPD A;  3OYH A;  1U47 A;  3DOK A;  2ZQB A;  3SJH A;  1WB9 A;  4AHR A;  2ZJR L;  4DTM A;  4JHD A;  5HL7 L;  3AVN A;  4A59 A;  5HRO A;  1ZBL A;  4W5O A;  3L4Q A;  4YOU A;  4CJK A;  1BIZ A;  3EKS A;  1JCG A;  3ALY A;  4NB4 A;  3WXJ A;  4C23 A;  3AA5 X;  3V9X A;  4FWP A;  2HST A;  3DAW A;  4CZM A;  4E1N A;  3ZSZ A;  4FWO A;  4X66 K;  4GVM A;  4R79 A;  4M41 A;  2FBY A;  1JLB A;  4KPY A;  1MDU B;  4CZL A;  3WXM B;  3NH0 A;  2WOM A;  4LSN A;  1DTQ A;  2G8V A;  3T1Y K;  4JN4 A;  1JCF A;  3TR8 A;  1ESV A;  3RTV A;  1TKT A;  2E2N A;  2O8F A;  4DF8 A;  4MO5 A;  1JLG A;  5AQK A;  3SBG A;  1NU0 A;  1VSH A;  2XHB A;  2IDO A;  3O4Q A;  1VQK N;  4LY7 A;  2QTD A;  1VSI A;  5D3G A;  4BWM A;  1KAY A;  2F96 A;  4DSF A;  5KQ8 A;  1ILY A;  3L6Q A;  3MEE A;  1KTQ A;  4BRL A;  4E7J A;  4M7Y A;  3CME N;  2PZS A;  4FJL A;  1HPM A;  2ETJ A;  2IIR A;  3AY9 A;  2GWJ A;  4EFH A;  4OGC A;  1NLV A;  4CEO A;  3ZLJ A;  4BR0 A;  4V19 S;  1HJR A;  4CES A;  5GIO A;  1TV6 A;  4BRG A;  4NYF A;  1N34 K;  3CER A;  4IJN A;  2LSN A;  5AFU H;  5GIP A;  3PIP L;  4FLV A;  2ZWH A;  1KC8 O;  3I8B A;  2YHB A;  3UKU A;  1Z05 A;  1JL2 A;  3OYN A;  3D0P A;  4AIL C;  4A5A A;  3NBP A;  2FBV A;  1IBM K;  1VQ5 N;  3CJB A;  5AZI A;  5AQF A;  4H0O A;  5HLF A;  3LAK A;  3P38 A;  3KIO A;  1BQN A;  2D0O A;  4JD2 A;  3NVM A;  2W42 A;  1XUP O;  4FLX A;  3CI5 A;  3WNE A;  2YNH A;  4JKG A;  3IAY A;  4W5N A;  4TSX A;  2O8C B;  2NRW A;  4I9L A;  1ATS A;  4BRE A;  4M3W A;  4FLT A;  2Q0U A;  4FLZ A;  5KPR A;  2ASP A;  5DK5 A;  4FJN A;  1S3X A;  4AH9 A;  1M90 O;  2FF6 A;  1TAQ A;  2HHU A;  4E7I A;  5GAH P;  2F8T A;  2HB5 A;  3F73 A;  5E41 A;  4H5N A;  3VN5 A;  1W9H A;  3JAM O;  1MA9 B;  1ZYQ A;  4O8K A;  1BOT O;  3O4N A;  4FJI A;  1U48 A;  1C1A A;  1GLB G;  4BRF A;  4I7F A;  1XQS C;  1TAU A;  2D4W A;  3K57 A;  4I2Q A;  4RWT A;  1EXQ A;  2P9N A;  1KLM A;  3R6M A;  4CJ3 A;  3H6E A;  3VTH A;  3ATV A;  3HO1 A;  1W7A A;  5KPZ A;  5CYM A;  3QIC A;  2I7N A;  3OTO K;  4O4G A;  4WFA L;  2B6A A;  2PYL A;  3NGY A;  1ZC6 A;  3CHW A;  2E4L A;  2D5R A;  3HM9 A;  3CCV N;  5C10 A;  1HUX A;  4BRN A;  4LD0 A;  3CJ9 A;  3ZSR A;  4MLE A;  4E7H A;  1VQ6 N;  4DV3 K;  1T8E A;  1SV5 A;  4FZZ A;  3JYT A;  1RBV A;  1CZA N;  2D0P A;  5SZT A;  4N5S A;  3V81 A;  1N32 K;  3U3Y A;  1VQL N;  4L3Q A;  3THX B;  1VQ8 N;  4Q5V A;  4YY3 K;  3D6R A;  3VEY A;  3SCX A;  2NRV A;  3RMC A;  3G4S N;  2F4V K;  4DV4 K;  1VQ9 N;  2P9K A;  3FFI A;  2KFN A;  1C1B A;  1WBB A;  4CHZ A;  1YI2 N;  2VWB A;  4DQ8 A;  5EOY A;  3AVC A;  3K58 A;  1QVF M;  4I2P A;  1QZ6 A;  1T44 A;  4B9U A;  3UKR B;  3C7N B;  2P5O A;  1EX4 A;  3OS2 A;  1NGA A;  4ZTF A;  3CJC A;  3LM9 A;  2YKN A;  3IRX A;  4B8C A;  4O0J A;  3AVG A;  1X9J A;  5JIC A;  1TK0 A;  2V7Y A;  4CFD A;  5JLH A;  2NLX A;  4DTN A;  1NK4 A;  4M3Y A;  3FGU A;  3IFR A;  4M3R A;  1BI4 A;  4E1M A;  4DF4 A;  3HOS A;  4FJ7 A;  5I42 A;  1VRT A;  4CJ5 A;  1TUU A;  3P31 A;  4GW6 A;  5AQN A;  1FW6 A;  1ITG A;  1VQM N;  3NGI A;  4CF0 A;  1J6Z A;  4FSV A;  3TTF A;  2A42 A;  1UA0 A;  2YI1 A;  1W97 L;  1GOA A;  4KRF A;  2P9I B;  5IT9 O;  4XH1 A;  3LDL A;  3E9P A;  4O44 A;  3RSE A;  1ZBS A;  4K41 A;  3KLH A;  1Q18 A;  1ZXO A;  3HT3 A;  4B9S A;  1QSS A;  4YOR A;  3CM5 A;  5KI6 A;  3V9S A;  2QWM A;  5LMU K;  1TYQ A;  3HYF A;  1L3S A;  5F0X A;  3T3F A;  5M1F A;  2FC0 A;  3MK6 A;  3QEX A;  1C0M A;  2P9P A;  4DG1 A;  3L8B A;  3BZC A;  1NGJ A;  5SWM A;  3MXM A;  1EKE A;  4YNQ A;  1Q7Y O;  4CEC A;  1S6Q A;  1HR0 K;  3BY5 A;  1IH7 A;  1OH8 A;  3VQ7 A;  1L3U A;  3S3N A;  4BE0 A;  4CZG A;  5IWA K;  3THW B;  4KBO A;  1LAV A;  2HBL A;  3EN9 A;  1JXB A;  4DTR A;  2G8K A;  4ILJ A;  3LAM A;  1GLC G;  2HW3 A;  5LY3 A;  2F7T A;  2GBZ A;  2Z1H A;  4JKD A;  2RN2 A;  1WSJ A;  4N76 A;  5KGW A;  3CJ1 A;  2P1J A;  3WXL A;  4DU4 A;  3VET A;  3OYB A;  2GTD A;  3ZET A;  3SUP A;  4J2B A;  3K0S A;  4BRK A;  1FKP A;  3RMA A;  2E88 A;  4QOZ B;  4H5R A;  3AAP A;  1S1T A;  4JI3 K;  5M1N A;  4JI2 K;  2A6A A;  4CJL A;  3SAF A;  3SV3 A;  4BDY A;  3VEW A;  3DLH A;  1QHT A;  1RTH A;  1LWE A;  4BG8 A;  3KWI A;  4WFN L;  5KRS A;  3PV8 A;  2FSN A;  2RF2 A;  2O8B B;  1HPZ A;  3BF3 A;  3OS1 A;  1RTD A;  1KCF A;  3V9W A;  3VQ8 A;  1WSI A;  3SQ4 A;  4CJF A;  4DCH A;  1VAZ A;  1XNQ K;  2A40 A;  3KD5 E;  5M1O A;  3KKS A;  4J2E A;  4GNI A;  1NK5 A;  3THY A;  4XH4 A;  3DLG A;  3CFR A;  3CCL N;  3ULE A;  5JVH L;  1D9F A;  3WEE B;  4A2A A;  4DTX A;  3DXM A;  3MWT A;  3OHR A;  3FFK B;  2Q36 A;  4FJM A;  4NXM K;  1J54 A;  1DGK N;  3ZEU B;  3LL3 A;  1LW2 A;  2PYJ A;  1V4T A;  4BR2 A;  4WF9 L;  4KH4 A;  4FK2 A;  2RHK A;  4FOI A;  5GAE P;  5FPM A;  4AM6 A;  4C8M A;  3O8M A;  4CJV A;  5GAG P;  1MU2 A;  1GLD G;  1YF5 L;  4E19 A;  1T7P A;  4DSI A;  1HNX K;  2QXF A;  4CGI A;  3NF8 A;  2WTU A;  1Z26 A;  2D0C A;  4CEA A;  3SMP A;  3DMJ A;  5JS2 A;  4MLH A;  3DRR A;  2HMI A;  5C24 A;  1CZB A;  1U04 A;  3BF1 A;  1UWB A;  4HTU A;  4CJR A;  4JHD B;  4KO0 A;  4BRM A;  3VQ5 A;  4DV2 K;  4AHV A;  2G8U A;  4F3O A;  4JYA K;  4PL8 A;  4BC3 A;  1TL3 A;  4DR4 K;  3TU5 A;  1RDC A;  4WQ4 C;  2A5X A;  3E66 A;  2YNG A;  3CXC M;  1I39 A;  4BR5 A;  2X78 A;  4OKK A;  1QTM A;  4C8L A;  3QIO A;  5LJV A;  2P9S B;  4YOX A;  4XIU A;  3J8A A;  1X1P A;  1IV0 A;  2E1Z A;  4B1V A;  4B9V A;  1NGE A;  1EWR A;  3SUN A;  3KZB A;  4YHH K;  4CF2 A;  3ZSY A;  4Y0W A;  2YCH A;  4CW7 B;  5J2Q A;  2VCP A;  3C94 A;  4IJA A;  5C2F A;  2VG5 A;  2O8F B;  4FJG A;  3ENB A;  2WON A;  3QEI A;  2ASO A;  4HVJ A;  4EHT A;  4FJK A;  3VQC A;  2UXD K;  5EY4 A;  4L8R B;  4AHC A;  4BR9 A;  2E2Q A;  4KHW A;  1L3T A;  3D2F B;  5MLC Q;  3S41 A;  1YAG A;  4YDU C;  1BCO A;  4JK8 A;  3PSI A;  1IJJ A;  4FLU A;  1VSE A;  4U7B A;  4NCA A;  4W5T A;  4FK4 A;  1Q86 O;  1VQO N;  3VEN A;  4JLH A;  2QWO A;  3B6P A;  5BRE A;  3O80 A;  4FZX C;  5T7B A;  4ID5 A;  1NK6 A;  3HST B;  4MDA A;  4G1Q A;  2UUC K;  1X3N A;  5ADX A;  1VQ7 N;  1U45 A;  1N5Y A;  5AZI B;  3QFU A;  2O8E A;  4JKC A;  4LH4 A;  3T69 A;  3ENO A;  4QAG A;  3R9P A;  2HHQ A;  4J2D A;  4CD3 A;  3LPT A;  3JSM A;  4K0K K;  3CCE N;  3QDK A;  4OLB A;  2GEM A;  3AO5 A;  2EHG A;  2Q31 A;  4CZJ A;  3DLL L;  5FRN A;  3TSQ A;  3D2E A;  1YVU A;  4CCH A;  1HX1 A;  4I6M B;  1K8K A;  2CGL A;  3PX6 A;  1IKW A;  4FWK A;  4LH5 A;  3WT0 A;  4HHT A;  3L0Q A;  2FF3 B;  4PUO A;  3GE1 A;  3L2W A;  4CF8 A;  4DV6 K;  2KZM A;  4DV5 K;  5KPT A;  1XWL A;  1P90 A;  2W6K A;  5GIN A;  3EZ5 A;  4FJJ A;  4ILH A;  4EHU A;  4IKF A;  4KHU A;  3AO1 A;  2WUS A;  1NK0 A;  5HRN A;  4DLE A;  2ZD1 A;  3WXK A;  4E0D A;  3DOL A;  4DU1 A;  1RGI A;  2HVI A;  4BE1 A;  1UOC A;  3MX2 A;  1BA0 A;  1HJO A;  1S1X A;  4CJS A;  4MO4 A;  2QXL A;  1C0U A;  4ISE A;  1SQK A;  4JKB A;  3PY8 A;  4IEI A;  1SL0 A;  3AGK A;  1J9A A;  4QS7 A;  3R3L A;  4CHP A;  4UY8 O;  4CJP A;  4EP5 A;  3QBW A;  3CYM A;  4E3S A;  3K5M A;  3AVF A;  1VSD A;  4H5T A;  1WSE A;  4LF7 K;  3S9H A;  4YFU A;  3J7Z O;  4CFC A;  2QA4 N;  3EE9 A;  1Q9Y A;  4G9Z A;  2HBM A;  3K5O A;  1GLE G;  4B1Y B;  3CJ7 A;  2IS3 A;  5F1X A;  1O1W A;  3B6O A;  4DR5 K;  3T1A A;  5AQV A;  3ZT2 A;  3VEX A;  4OVL A;  1U2V B;  1EP4 A;  2Q2R A;  4WE1 A;  4F4K A;  4LF4 K;  1NGG A;  4BGB A;  2QWP A;  4PKI A;  3VQ6 A;  3M8R A;  2YV0 X;  4BE2 A;  1NKB A;  1D8Y A;  1S1V A;  4MDB A;  1R59 O;  3ZSW A;  3K59 A;  4MQ3 A;  2P9K B;  4Z4C A;  3CF5 L;  1RCH A;  3NF9 A;  3OY9 A;  3TAE A;  3J81 O;  1VSJ A;  4KV8 A;  3ZT0 A;  4K8X A;  2HHS A;  3I0R A;  4CJU A;  2PY5 A;  1QE1 A;  4JKE A;  4JI0 K;  3LDS A;  5LL6 Z;  2E6L A;  4BDP A;  3BGR A;  1P8Z A;  4EP4 A;  3MX5 A;  1BHL A;  4YOV A;  2KKZ A;  1ZBH A;  2KFZ A;  4ZHR A;  4FO0 A;  4E89 A;  4JI5 K;  4IOX A;  5C15 A;  2IOC A;  4BRH A;  1YXQ A;  1NK9 A;  1C0T A;  2V51 B;  1U6Z A;  1BI4 B;  5BN9 A;  4Z0U A;  4DUY K;  1TK8 A;  3KD1 E;  2ATQ A;  5A2Q O;  3F5T A;  3IS9 A;  1YIT N;  4GKJ K;  5C25 A;  1G99 A;  2JWK A;  2RKI A;  4CIF A;  4RW7 A;  3L2V A;  4C8O A;  4Z4E A;  3PLA A;  2NRX A;  2HF4 A;  3R1X A;  4PA1 A;  3HBT A;  4JS4 A;  1ATR A;  4IFE A;  4E1J A;  4FJ9 A;  2JGU A;  4FW1 A;  3RSE B;  2YKM A;  2VG7 A;  3VQB A;  3NMU A;  3MEG A;  3AA4 A;  2OAN A;  1KAX A;  2ZF5 O;  4K43 A;  3HI0 A;  3DLB A;  4DQI A;  3M1F A;  4M3U A;  2QEX N;  1ATN A;  5LMN K;  1JLE A;  1VQN N;  5B8H A;  3RRH A;  2GUP A;  2HNZ A;  4NO7 A;  1K8A O;  4DR7 K;  1Z25 A;  2DFF A;  3RR7 A;  3MN7 A;  3ZSO A;  3OYJ A;  1E3M A;  4OPH A;  4OPA A;  4DS5 A;  3O1B A;  1RIL A;  2Q0R A;  3ATU A;  2UU9 K;  1A5V A;  3WUH A;  3A5M C;  4DR1 K;  5CYQ A;  1WBD A;  3O4W A;  1SZ2 A;  3CFO A;  3VTI A;  4HCC A;  5FRM A;  3V6D A;  2Y1J A;  1RDD A;  1NGB A;  3TTD A;  3CG7 A;  4YOT A;  1T05 A;  1YTU A;  3MN6 A;  4DV0 K;  3IDH A;  4B1X B;  2E5L K;  1JLC A;  4HUF A;  5BRH A;  3U3G A;  2P9U A;  2HHT A;  4EAH D;  2QWL A;  2YJF A;  2FBX A;  4FOE A;  5M1K A;  3G71 N;  3ZET B;  2H3G X;  5EVZ A;  3ZX0 A;  4A62 A;  5AQU A;  1VRU A;  4FW2 A;  4H5W A;  3NF6 A;  2OPS A;  3ISN C;  4DFK A;  3IKM A;  4IOC L;  2R7Y A;  4RTF D;  3BUZ B;  3AVB A;  4OLA A;  2OYQ A;  4JS5 A;  4CEB A;  1N8R O;  1SUQ A;  3DLR A;  2UUA K;  4DSK A;  1WSG A;  3MAQ A;  4DTJ A;  4FL9 A;  4Z4H A;  4DFP A;  3DWL A;  4CHN A;  1IKV A;  2HHX A;  4FJX A;  3WQT A;  3N4Q A;  2OZS A;  3C95 A;  3THY B;  1S22 A;  4RW6 A;  4CGD A;  2DY4 A;  3ULE B;  3L3U A;  3TSP A;  1S6P A;  3C6H A;  3VF4 A;  1X9M A;  5AQY A;  3GDQ A;  3OS0 A;  2D1K A;  4JI4 K;  2ZM6 K;  1NNE A;  5J2N A;  1YJ9 N;  4FWN A;  2UUB K;  3WNH A;  4B3M K;  2KTQ A;  4X64 K;  4CJ7 A;  1RDA A;  4CE9 A;  3VEO A;  2W41 A;  1ZBI A;  3KKR A;  1BO5 O;  3RR8 A;  1TKZ A;  2DTU A;  4LSL A;  3AV9 A;  5CE3 A;  4H0V B;  5AQX A;  4CBU A;  1CLQ A;  1K9M O;  4ILG B;  1UA1 A;  1BUP A;  1VK0 A;  5BRF A;  2ASM A;  4EIA A;  4W5Q A;  3VQP A;  2BH1 A;  3QNN A;  4R5P A;  4JNE A;  4HUE A;  3VA3 A;  2P9L B;  3G10 A;  4CJE A;  1RTJ A;  3LP3 A;  4BRD A;  1SS6 A;  3RVC A;  4M63 C;  5JVG L;  5KRT A;  3DLE A;  5HRR A;  4WQ4 A;  3QEW A;  4J8F A;  4AQY K;  4F3T A;  2QKB A;  3AVA A;  3TAQ A;  3V1Q A;  3ZSX A;  1NK7 A;  1NJW A;  3PSF A;  2BUP A;  1KQS M;  1U4B A;  3QBX A;  3VMF B;  3AVL A;  1TK5 A;  4B9T A;  3M6G A;  2BDP A;  1C0F A;  4BRC A;  3U9D A;  2HND A;  1YJW N;  3MWP A;  1B9F A;  3TPQ A;  2O8C A;  1RDU A;  1RNH A;  3RMD A;  1RBR A;  4IDH A;  1BCM A;  1KAZ A;  2VG6 A;  4F2R A;  1SAZ A;  3F2K A;  3C6U A;  5AFU A;  1OKJ A;  2FBT A;  3VA0 A;  1I94 K;  4K8Z A;  4B1W B;  2BE2 A;  3N4P A;  4LFA K;  5C2D A;  3P83 D;  5KQD A;  3LZI A;  4YDU A;  3TAB A;  4FYD A;  2XY7 A;  1NJZ A;  1T6C A;  1NJI O;  3E01 A;  4A57 A;  5AQL A;  2OA8 A;  2KLA A;  1SKW A;  5AQM A;  3O08 A;  3AO2 A;  1GLF O;  3AA2 A;  2E20 A;  4WFB L;  3CC2 N;  1LAW A;  5CR4 A;  1DT9 A;  3V1R A;  4BC5 A;  3KK2 A;  2F9W A;  4B3S K;  2ITM A;  4BRA A;  4DR6 K;  2IC3 A;  2Q3S A;  3AVM A;  4OKE A;  4JKF A;  4FXD A;  3T7Z A;  3FZF A;  3ULD A;  1HNV A;  1RT2 A;  3ZCM A;  1X3M A;  1WAF A;  1KVA A;  4CGH A;  3VQQ A;  3OYE A;  4LFB K;  1LWF A;  1QVG M;  2YX6 A;  4JI7 K;  1S1U A;  2O8E B;  3THV A;  1C1C A;  3THX A;  4DSL A;  3LAN A;  1WAJ A;  4CZI A;  1QSY A;  3VES A;  3OA9 A;  4DQP A;  2O8D B;  1T6D A;  3EO3 A;  2YNF A;  1JLA A;  4GY2 B;  3O6W A;  4ELU A;  1WLJ A;  1KFS A;  3W0L A;  5AQR A;  1KVC A;  3OYM A;  3QLH A;  3HP9 A;  1XC3 A;  3TI0 A;  5KGX A;  3ID6 A;  1YT3 A;  3LP0 A;  3SAG A;  3LDP A;  3HPG A;  1NGC A;  3T19 A;  3UKR A;  5TKW A;  2VQF K;  4DTS A;  4NCG A;  4LF9 K;  4CZH A;  4DWI A;  1D9D A;  3I33 A;  1LCU A;  1FKO A;  4BQZ A;  1L3V A;  1BDG A;  1G15 A;  4BAC A;  1E4F T;  3SBT A;  2QK9 A;  3OYG A;  4X62 K;  5CY4 A;  3KJV A;  3CM6 A;  4CJW A;  4KHN A;  4CGJ A;  3U4L A;  2QI2 A;  4DTP A;  4DHY A;  4H03 B;  3I56 N;  3VPZ A;  2OPQ A;  2YHX A;  3AGR A;  1J5E K;  5C12 A;  3QFP A;  4CVN E;  4IEE A;  2W40 A;  5E84 A;  3K9J A;  3NH2 A;  4Z94 A;  4IOA L;  4F2S A;  4CBX A;  2ZE2 A;  4DS4 A;  4BRO A;  4DLG A;  1U49 A;  1CZ9 A;  4KTW A;  2E6M A;  3AO3 A;  4IBN A;  2P9I A;  1HMV A;  5LJW A;  2VGN A;  4LFC K;  5AQQ A;  3SZ2 A;  1R0A A;  3PIO L;  5H1S Q;  4Z4G A;  3LPU A;  1OH5 A;  1OVQ A;  4H0P A;  4B1Z A;  1C0G A;  4Y1D A;  5EX5 A;  3O3H A;  3HJF A;  3J7A P;  4CK2 A;  3NF7 A;  3EEQ A;  3QB0 A;  3B8A X;  2XY6 A;  2OTJ N;  4CIE A;  4QS8 A;  3MMV A;  2IVO A;  3OBW A;  1JCE A;  4BRP A;  3A5L C;  3QO9 A;  2O4I A;  3GOI A;  4CZK A;  3O3F A;  5DMR A;  3P39 A;  3I0S A;  4NCB A;  4CEE A;  4KHY A;  3O9U A;  3Q7B A;  4CK3 A;  1S72 N;  5AQS A;  4M3X A;  3THW A;  2HF3 A;  1ASV A;  1Q8I A;  2W6L A;  1X9W A;  5GAD P;  4CF9 A;  5BR8 K;  2VYP A;  2X6N A;  1HYV A;  1W0H A;  2OZM A;  3ZX3 A;  1JLQ A;  4ISF A;  1W2B M;  3TSU A;  4CJT A;  3NAE A;  4IO8 A;  3G25 A;  3LP2 A;  3UB5 A;  4LF8 K;  3VQ9 A;  1Q9X A;  3UKU B;  4KTQ A;  3R8E A;  3QIN A;  1NKE A;  4WCE L;  1K73 O;  1KFD A;  5AQG A;  1B9D A;  3WNF A;  4KB1 A;  1E4G T;  1WOQ A;  2PFU A;  4ID1 A;  3OYI A;  3SQ2 A;  3HPH A;  3H08 A;  4JD2 B;  2QM1 A;  2O8B A;  3KLE A;  2X6S A;  4JKG B;  1CXQ A;  3VEZ A;  3G6E N;  4M7X A;  4HWI A;  1XMQ K;  4CEQ A;  4CHQ A;  2J4R A;  3IUC A;  1RDW X;  3EE8 A;  3CCQ N;  2XRI A;  5JMV A;  3KVG A;  3I8D A;  2CH5 A;  3K5L A;  1UAX A;  4ZTJ A;  1SL1 A;  4DKW A;  4KB0 A;  5FRO A;  1NOZ A;  3RMB A;  4BY9 C;  3WEE A;  4JRQ A;  4NLC A;  4GMJ B;  4DB3 A;  3QML A;  2UXC K;  5BPM A;  3A8Y A;  1NGD A;  4C1N K;  5BPN A;  4JEP A;  4FJ5 A;  3AVK A;  2P9N B;  4BQL A;  3ZEU A;  1NJY A;  3T1H K;  3QNO A;  3TAF A;  3AAQ A;  4CGG A;  2QWQ A;  3J80 O;  3VGM A;  1YHQ N;  3ZSV A;  3AA3 A;  5I3U A;  3CCJ N;  3DXK A;  5J1E A;  4C1N I;  1T3V A;  4BG9 A;  1LV5 A;  5AQI A;  2CGK A;  4NYN A;  1A5W A;  1ASW A;  3KWG A;  3L4I A;  4BRI A;  3CET A;  4F8R A;  3C0B A;  3HVR A;  4CHO A;  2FSK A;  4MFB A;  1KXP A;  4KRE A;  3D7E O;  2P9U B;  3SUQ A;  5J2M A;  2E2O A;  5BR9 A;  4H4O A;  5F2R A;  2Q1N A;  3VOV A;  1VQ4 N;  4M45 A;  1J5O A;  2NUB A;  4BGA A;  4M3Z A;  3O3G A;  4Z4F A;  3NCI A;  3FLC O;  4JRP A;  2F8S A;  4CGF A;  3MEC A;  1KD1 O;  1J53 A;  4YOY A;  4HCB A;  2O4G A;  1RT3 A;  4A2B A;  4BC4 A;  3JXU A;  3SQ1 A;  5KTQ A;  1Q82 O;  2HHW A;  1L5U A;  3M3Z A;  4FK0 A;  1QQC A;  3A5N C;  3PX4 A;  1BWF O;  4B9N A;  3VQA A;  1FK9 A;  4DSE A;  2A1R A;  4XH5 A;  4BWJ A;  3PO4 A;  5JS1 A;  2YHW A;  1FJG K;  4KH5 A;  1XC9 A;  1RTI A;  2X74 A;  4CK1 A;  1CXU A;  1DTT A;  1BIU A;  5DM6 L;  2B5J A;  4BVP A;  3OYD A;  3LWM A;  4M3T A;  4O5F A;  1YIJ N;  3A5O C;  1IKY A;  2P9S A;  3W3D A;  4BC2 A;  1XI1 A;  5K14 A;  4B08 A;  2IGI A;  4C8K A;  2A41 A;  3BZK A;  3EYZ A;  4JV5 K;  4AHT A;  4WQ5 C;  1GLA G;  2NRH A;  3I55 N;  2P51 A;  1NWK A;  4BDZ A;  3SYZ A;  1YTA A;  3V9Z A;  3TWH A;  4CFB A;  1SL2 A;  3OYC A;  1KRP A;  2D0A A;  1QSL A;  1SKR A;  4O55 A;  4DV7 K;  3K2P A;  1TKD A;  1RT7 A;  4FWL A;  3FR0 A;  4GKK K;  3LDQ A;  3D2F A;  1YUW A;  2Z1I A;  3U9Z A;  4FM2 A;  3L2R A;  1TKX A;  1T03 A;  4B3T K;  4BVO A;  3KTQ A;  1KVB A;  4LF6 K;  3LDN A;  4A5B A;  1WSF A;  2EWS A;  3ZT3 A;  4AF1 A;  1BL3 A;  4LF5 K;  4KHQ A;  3C6T A;  2IVP A;  1B92 A;  3KHY A;  4OJR A;  1NG9 A;  4EZ6 A;  3DYA A;  4H0Y B;  2V7Z A;  2I5J A;  1DEJ A;  3NHG A;  1JJ2 M;  4B1U B;  3IG1 A;  2PBD A;  3HM8 A;  3QEV A;  3CCM N;  5DM7 L;  3M8P A;  3M8S A;  3CD6 N;  3SV4 A;  2AA4 A;  1TYQ B;  1LWC A;  3LP1 A;  4DQQ A;  2A3Z A;  3TAM A;  4IDK A;  3DM2 A;  1NMN A;  3RRG A;  2JLE A;  2P9P B;  5HRS A;  4HTL A;  4HUG A;  2FLO A;  4QCL A;  3QES A;  4RG8 A;  1RT6 A;  3PX0 A;  3HL8 A;  1HNZ K;  1ASU A;  4I6M A;  3SI6 A;  1EET A;  5TKY A;  3O9T A;  4FM1 A;  5HP1 A;  2B4J A;  5FLX O;  2NNW A;  2G8F A;  2CGJ A;  3DI6 A;  3EY1 A;  3L2U A;  3CC4 N;  2OTL N;  4ISG A;  2Z1G A;  2GUI A;  1HYZ A;  2E8A A;  4PQU A; 
#chains in the Genus database with same CATH homology
 4AHV A;  2G8U A;  4DMN A;  3OYH A;  1RNH A;  3DOK A;  2VWJ A;  1U47 A;  4F3O A;  4CJ4 A;  2ZQB A;  3RMD A;  1RBR A;  3OYF A;  1BCM A;  1TL3 A;  4AHR A;  2VG6 A;  3D45 A;  1RDC A;  5CZ1 A;  4F2R A;  4PWD A;  4DTM A;  3AVN A;  3C6U A;  3AVJ A;  3ASM A;  5HRO A;  1ZBL A;  2YNG A;  4W5O A;  4CJK A;  1I39 A;  1BIZ A;  2X78 A;  4OKK A;  2FBT A;  1QTM A;  3ALY A;  3VA0 A;  4K8Z A;  4C8L A;  3QIO A;  1BQM A;  3AA5 X;  3V9X A;  3P5J A;  4DQS A;  1KLN A;  1NJX A;  2BE2 A;  4XIU A;  1X1P A;  3P83 D;  2HHV A;  4B9V A;  3LZI A;  3TAB A;  3SUN A;  4E1N A;  4AHU A;  3ZSZ A;  2XY7 A;  4FYD A;  4CF2 A;  4DTO A;  1NJZ A;  3ZSY A;  2OPR A;  1X9S A;  4CED A;  1NKC A;  2XY5 A;  5J2Q A;  1WSH A;  3E01 A;  3C94 A;  4GVM A;  2OA8 A;  2VG5 A;  3LWL A;  3CQ8 A;  4M41 A;  2FBY A;  1SKW A;  1JLB A;  2KZZ A;  4KPY A;  3AO2 A;  4FJG A;  4DU3 A;  3NH0 A;  2WOM A;  4Z4I A;  3QER A;  4LSN A;  3DRP A;  1DTQ A;  2WON A;  2G8V A;  3AA2 A;  3QEI A;  1BGX T;  4HVJ A;  3V9U A;  1LAW A;  3V1R A;  3KK2 A;  4FJK A;  3VQC A;  3SPY A;  4L8R B;  4AHC A;  3TR8 A;  3RTV A;  5FDL A;  1TKT A;  4KHS A;  2IC3 A;  4DF8 A;  4IFY A;  1JLG A;  4KHW A;  2Q3S A;  2BAN A;  3AVM A;  4OKE A;  1L3T A;  4FXD A;  3M8Q A;  1VSH A;  3KK1 A;  2XHB A;  1HNV A;  1RT2 A;  3ZCM A;  3ULD A;  2IDO A;  3O4Q A;  1BCO A;  1WAF A;  1KVA A;  4CGH A;  3VQQ A;  4LY7 A;  4ELT A;  3OYE A;  1VSI A;  3KLG A;  1WNS A;  5D3G A;  4FLU A;  1LWF A;  2F96 A;  4BWM A;  4DSF A;  3V4I A;  1VSE A;  1S1U A;  3AVI A;  3THV A;  4NCA A;  4W5T A;  3MEE A;  2IAJ A;  1GOB A;  1KTQ A;  4FK4 A;  1C1C A;  4E7K A;  4DSL A;  4E7J A;  3LAN A;  1HQU A;  2PZS A;  1WAJ A;  4JLH A;  1DLO A;  4FJL A;  3B6P A;  2ETJ A;  4FZX C;  5T7B A;  1QSY A;  4ID5 A;  1NK6 A;  3HST B;  3K5N A;  4OGC A;  4G1Q A;  4DQP A;  4CEO A;  1JLF A;  1HJR A;  4CES A;  1U45 A;  1N5Y A;  3SUO A;  1TV6 A;  2YNF A;  4NYF A;  1JLA A;  4H4M A;  4LH4 A;  4QAG A;  4ELU A;  2HHQ A;  1WLJ A;  2LSN A;  1KFS A;  4J2D A;  2G8I A;  1KVC A;  3OYM A;  3A2F A;  3QLH A;  4FLV A;  3HP9 A;  3LPT A;  3JSM A;  3TI0 A;  2YHB A;  1JL2 A;  3OYN A;  5KGX A;  3D0P A;  4AIL C;  3NBP A;  2FBV A;  3AO5 A;  4OLB A;  2EHG A;  1YT3 A;  4B9L A;  3LP0 A;  5FRN A;  3HPG A;  3OJS A;  1YVU A;  3T19 A;  5HLF A;  3LAK A;  4CCH A;  4DTS A;  4NCG A;  3KIO A;  1S1W A;  2DFH A;  1BQN A;  3OYL A;  2G8W A;  3QET A;  3PX6 A;  1IKW A;  4LH5 A;  3SNN A;  2W42 A;  4HHT A;  1D9D A;  4DWI A;  4PUO A;  4FLX A;  1FKO A;  3WNE A;  1S9E A;  2YNH A;  1L3V A;  1G15 A;  3HK2 A;  1XHX A;  4BAC A;  3IAY A;  4FVM A;  4W5N A;  4TSX A;  3L2W A;  3MXJ A;  4I9L A;  4OPK A;  3OYG A;  5CY4 A;  4CF8 A;  3KJV A;  4FLT A;  4M3W A;  2QK9 A;  2KZM A;  4FLZ A;  3CM6 A;  4CJW A;  4KHN A;  4N47 A;  5DK5 A;  1JXE A;  4CGJ A;  4FJN A;  5J2P A;  4AH9 A;  4DTP A;  1XWL A;  3EZ5 A;  1TAQ A;  4FJJ A;  1NK8 A;  4E7I A;  2HHU A;  2F8T A;  2HB5 A;  4IKF A;  3F73 A;  5E41 A;  3AO1 A;  2OPQ A;  4KHU A;  4OGE A;  3KK3 A;  3VN5 A;  1W9H A;  4C8N A;  2YHA A;  1NK0 A;  5HRN A;  3NH2 A;  4DLE A;  2ZD1 A;  4E0D A;  3DOL A;  4FCY A;  4DU1 A;  1ZYQ A;  2HVI A;  4F2S A;  4BE1 A;  3O4N A;  4FJI A;  2ZE2 A;  1UOC A;  1U48 A;  1S1X A;  1C1A A;  4CJS A;  4ELV A;  4DS4 A;  4I7F A;  1TAU A;  4DLG A;  1U49 A;  1C0U A;  3K57 A;  4I2Q A;  3OJU A;  1CZ9 A;  4KTZ A;  4KTW A;  3PY8 A;  2E6M A;  3AO3 A;  1EXQ A;  4IBN A;  4H8K A;  1HMV A;  1SL0 A;  3ZSQ A;  1KLM A;  1J9A A;  4CHP A;  4CJ3 A;  3SZ2 A;  1R0A A;  3L3V A;  1HNI A;  4CJP A;  4EP5 A;  4FM0 A;  3HO1 A;  4Z4G A;  1A5X A;  3CYM A;  3LPU A;  5CYM A;  3K5M A;  3AVF A;  4E3S A;  1VSD A;  1BIS A;  1S5J A;  4CIG A;  4Y1D A;  1VSL A;  1WSE A;  1I3A A;  1KSP A;  3S9H A;  3O3H A;  4YFU A;  3RWU A;  3HJF A;  2DFE A;  3TAG A;  4CK2 A;  4CFC A;  3NF7 A;  3ZT4 A;  3P1G A;  1Q9Y A;  4O4G A;  2XY6 A;  4CIE A;  2Z1J A;  4N56 A;  3K5O A;  2B6A A;  2PYL A;  4FJ8 A;  3NGY A;  1FXX A;  1HYS A;  2IS3 A;  2QKK A;  2E4L A;  2D5R A;  3HM9 A;  1O1W A;  3B6O A;  4KI4 A;  3T1A A;  3ZT2 A;  4FLW A;  2GV9 A;  4OVL A;  1EP4 A;  3QO9 A;  4WE1 A;  3HVT A;  4LD0 A;  4F4K A;  2O4I A;  3ZSR A;  3O3F A;  5DMR A;  4E7H A;  1T8E A;  3I0S A;  1SV5 A;  4NCB A;  4CEE A;  4FZZ A;  4EZ9 A;  3VQ6 A;  3HP6 A;  3M8R A;  2YV0 X;  4KHY A;  4BE2 A;  2BGG A;  5EU7 A;  1NKB A;  4CK3 A;  1RBV A;  3JYT A;  1D8Y A;  4CEZ A;  5SZT A;  4M3X A;  1S1V A;  4N5S A;  3V81 A;  3SPZ A;  2AJQ A;  3ZSW A;  3K59 A;  3U3Y A;  4MQ3 A;  4KKO A;  1ASV A;  1Q8I A;  3VQE A;  1ZBF A;  1X9W A;  3OVN A;  4Z4C A;  1RDB A;  4CF9 A;  4Q5V A;  1RCH A;  4J2A A;  2X6N A;  3NF9 A;  1HYV A;  3OY9 A;  3NDK A;  1W0H A;  3TAE A;  1VSJ A;  4KV8 A;  3ZT0 A;  2OZM A;  1TVR A;  3SCX A;  4K8X A;  3RMC A;  2HHS A;  3I0R A;  4CJU A;  2PY5 A;  1JLQ A;  2XY8 A;  1QE1 A;  4CJT A;  3LDS A;  3NAE A;  1RBU A;  4M42 A;  2E6L A;  4BDP A;  3BGR A;  4EP4 A;  3FFI A;  3LP2 A;  2KFN A;  1C1B A;  1BHL A;  3VQ9 A;  1Q9X A;  1ZBH A;  4CHZ A;  2KFZ A;  4ZHR A;  1ZBU A;  4E89 A;  4KTQ A;  4ZTJ A;  3QIN A;  1NKE A;  3AVC A;  1KFD A;  2IOC A;  3K58 A;  4I2P A;  1B9D A;  1RT5 A;  3WNF A;  4KB1 A;  1NK9 A;  3S3O A;  4B9U A;  4FJH A;  2P5O A;  1EX4 A;  4ID1 A;  3OYI A;  3SQ2 A;  3OS2 A;  1C0T A;  3HPH A;  3H08 A;  4ZTF A;  1BI4 B;  4CEF A;  4Z0U A;  2YKN A;  2D0B A;  3IRX A;  2X6S A;  4O0J A;  4B8C A;  3AVG A;  4CFA A;  3OYK A;  3KLE A;  1CXQ A;  4CFD A;  1TK0 A;  1TK8 A;  3NGZ A;  4O0I A;  3KD1 E;  4DTN A;  1RBT A;  2ATQ A;  1NK4 A;  4CEQ A;  4CHQ A;  4M3Y A;  3TAP A;  3IS9 A;  1D5A A;  5C25 A;  1HRH A;  2RKI A;  4CIF A;  3S3M A;  4M3R A;  4RW7 A;  3L2V A;  4C8O A;  4Z4E A;  2XRI A;  3I8D A;  4I9Q A;  3LZJ A;  2KW4 A;  3K5L A;  1UAX A;  1VSK A;  1BI4 A;  4PA1 A;  4E1M A;  5CZ2 A;  4JS4 A;  4DF4 A;  3KLF A;  5FRO A;  1NOZ A;  1SL1 A;  4B9M A;  4KB0 A;  3RMB A;  5I42 A;  4FJ7 A;  1NOY A;  4FJ9 A;  1VRT A;  2JGU A;  4IG3 A;  4CJ5 A;  3NH1 A;  4FW1 A;  2VWK A;  3VQ4 A;  4JRQ A;  4GW6 A;  2YKM A;  2VG7 A;  4GMJ B;  3VQB A;  1ITG A;  3MEG A;  3AA4 A;  4DSJ A;  2XO7 A;  3DLB A;  3NGI A;  4DQI A;  4CF0 A;  4FJ5 A;  3AVK A;  4M3U A;  1UA0 A;  4RW4 A;  4AHS A;  1GOA A;  4KRF A;  1IKX A;  1NJY A;  1JLE A;  3RRH A;  3QNO A;  3SQ0 A;  2HNZ A;  3TAF A;  4O44 A;  4DTU A;  4CGG A;  3KLH A;  3ZSV A;  3HT3 A;  4B9S A;  1Z25 A;  1RT4 A;  1QSS A;  2DFF A;  3AA3 A;  3CM5 A;  5KI6 A;  3ZSO A;  3OYJ A;  3V9S A;  4DQR A;  2Y1I A;  5I3U A;  3RR7 A;  5J1E A;  3WNG A;  4DS5 A;  4DFJ A;  1LV5 A;  4NYN A;  1A5W A;  1RIL A;  3TAR A;  3HYF A;  1ASW A;  4O5B A;  1L3S A;  3T3F A;  4F8R A;  3G0Z A;  4DFM A;  1N6Q A;  3HVR A;  1A5V A;  4CHO A;  2FC0 A;  4ICL A;  4MFB A;  4W5R A;  4KRE A;  5CYQ A;  3QEX A;  3SUQ A;  3SJJ A;  5J2M A;  1C0M A;  4DG1 A;  3L8B A;  4H4O A;  4Q0B A;  4RW8 A;  4E7L A;  3CFO A;  4HCC A;  5SWM A;  5FRM A;  3MXM A;  3V6D A;  2Y1J A;  1S9G A;  1JL1 A;  4M45 A;  1J5O A;  2NUB A;  1EKE A;  1RDD A;  1TGO A;  4YNQ A;  4M3Z A;  3O3G A;  3CG7 A;  1T05 A;  4Z4F A;  1YTU A;  3NCI A;  4CEC A;  1S6Q A;  4JRP A;  1IG9 A;  4CGF A;  2F8S A;  3MEC A;  1IH7 A;  1JLC A;  3VQ7 A;  1L3U A;  1J53 A;  4HUF A;  4HCB A;  3HPO A;  2O4G A;  1RT3 A;  3U3G A;  3S3N A;  3SQ1 A;  4BE0 A;  4RW9 A;  5KTQ A;  2HHW A;  2HHT A;  4B3O A;  1L5U A;  4FK0 A;  1QQC A;  2FBX A;  3MED A;  1LAV A;  2G8K A;  1JXB A;  4DTR A;  3F9K A;  3PX4 A;  3ITH A;  3VQA A;  1FK9 A;  3LAM A;  1VSM A;  4DSE A;  2A1R A;  4B9N A;  2HVH A;  1VRU A;  2HW3 A;  4BWJ A;  1WN7 A;  3PO4 A;  2GBZ A;  5JS1 A;  4FW2 A;  2Z1H A;  3NF6 A;  2OPS A;  1RBS A;  2RN2 A;  3ISN C;  1GOC A;  4DFK A;  1WSJ A;  3L2Q A;  5KGW A;  1XC9 A;  4N76 A;  1RTI A;  1JKH A;  4J2B A;  2X74 A;  2P1J A;  4CK1 A;  2R7Y A;  4DU4 A;  1CXU A;  1DTT A;  1BIU A;  3OYB A;  3AVB A;  4OLA A;  1Y97 A;  3SUP A;  4CHY A;  4IG0 A;  2OYQ A;  4JS5 A;  4CEB A;  2B5J A;  4FZY A;  3LWM A;  3OYD A;  4M3T A;  1FKP A;  1SUQ A;  3DLR A;  3RMA A;  1K6Y A;  4DSK A;  3KLI A;  1WSG A;  4QOZ B;  1IKY A;  3MAQ A;  1XI1 A;  5K14 A;  4B08 A;  2IGI A;  3LAL A;  1S1T A;  3TAN A;  4C8K A;  4QCL A;  4DTJ A;  4Z4H A;  4DFP A;  3EYZ A;  4AHT A;  4CJL A;  3SV3 A;  4CHN A;  2P51 A;  4BDY A;  1IKV A;  3DLH A;  3PO5 A;  1QHT A;  1RTH A;  4OPJ A;  1LWE A;  4BDZ A;  4OKJ A;  2HHX A;  3SYZ A;  1YTA A;  3V9Z A;  3NE6 A;  5KRS A;  3TWH A;  3PV8 A;  4CFB A;  2OZS A;  4FJX A;  1SL2 A;  3C95 A;  2RF2 A;  3PUF A;  3OYC A;  1KRP A;  1HPZ A;  4RW6 A;  3AO4 A;  4CGD A;  2OPP A;  3OS1 A;  2D0A A;  1RTD A;  1QSL A;  2DY4 A;  1KCF A;  1REV A;  1SKR A;  3V9W A;  5HBM A;  4O55 A;  3L3U A;  1S6P A;  3VQ8 A;  1HQE A;  1LW0 A;  4B8A B;  1X9M A;  1WSI A;  2RPI A;  4CJF A;  3SQ4 A;  4KAZ A;  3K2P A;  3OS0 A;  1TKD A;  5J2N A;  1RT7 A;  3QIP A;  3KD5 E;  3WNH A;  2KTQ A;  3KKS A;  4FLY A;  1NK5 A;  4J2E A;  3QEP A;  2ITG A;  3DRS A;  3NFA A;  1RDA A;  1RT1 A;  3DLG A;  2Z1I A;  4CE9 A;  4FM2 A;  3BDP A;  3L2R A;  3CFR A;  1TKX A;  1T03 A;  3ZT1 A;  1D9F A;  3KTQ A;  1KVB A;  4UQG A;  1ZBI A;  3KKR A;  4DTX A;  1WSF A;  3ZT3 A;  2A1S A;  3RR8 A;  4KFB A;  1BL3 A;  3UIQ A;  1TKZ A;  4CF1 A;  2DTU A;  4KHQ A;  4LSL A;  3AV9 A;  3C6T A;  1XHZ A;  1B92 A;  1CLQ A;  4OJR A;  3U6F A;  4FJM A;  4EZ6 A;  3DYA A;  1IO2 A;  1J54 A;  1UA1 A;  2I5J A;  2HNY A;  3NHG A;  3CFP A;  1VK0 A;  1LW2 A;  3IG1 A;  2PYJ A;  2G8H A;  3QEV A;  4W5Q A;  3VQP A;  3HXM A;  4CER A;  2EX3 A;  3QNN A;  4IFV A;  4R5P A;  3M8P A;  3M8S A;  3VQD A;  4HUE A;  3VA3 A;  3SV4 A;  4FK2 A;  4N41 A;  5HRP A;  1LWC A;  3LP1 A;  3G10 A;  5C42 A;  4CJE A;  4DQQ A;  1QS4 A;  4C8M A;  4CJV A;  1RTJ A;  1VSF A;  2KQ2 A;  3LP3 A;  4KI6 A;  1C6V A;  1MU2 A;  1SKS A;  3TAM A;  4E19 A;  4IDK A;  3DM2 A;  1T7P A;  5KRT A;  3DLE A;  5HRR A;  4PY5 A;  3QEW A;  3RRG A;  4DSI A;  2JLE A;  5HRS A;  4HUG A;  4F3T A;  2QKB A;  3AVA A;  3TAQ A;  2QXF A;  4CGI A;  3NF8 A;  3V1Q A;  4CJQ A;  3AVH A;  4RG8 A;  1RT6 A;  2YNI A;  1Z26 A;  3ZSX A;  2D0C A;  3QES A;  3PX0 A;  1NK7 A;  3HL8 A;  1NJW A;  4CEA A;  1TL1 A;  1ASU A;  1U4B A;  3DMJ A;  5JS2 A;  3SI6 A;  3DRR A;  4Y1C A;  3MXI A;  1EET A;  2HMI A;  4FM1 A;  5C24 A;  1CZB A;  1F21 A;  1U04 A;  2B4J A;  3V1O A;  5HP1 A;  2G8F A;  1UWB A;  4HTU A;  4CJR A;  3DI6 A;  3AVL A;  4KO0 A;  3EY1 A;  1TK5 A;  3L2U A;  3DLK A;  4B9T A;  3VQ5 A;  2BDP A;  2Z1G A;  2P5G A;  3OYA A;  2GUI A;  1HYZ A;  2HND A;  4PQU A;  1B9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...