2GUIA

Structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
ITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Cyclized Versions of the Proofreading Exonuclease Subunit E. coli DNA Polymerase III
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
total genus 58
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2guiA00
3QESA 2LSNA 2O4GA 4AH9A 1NK7A 3L3VA 3MXJA 4MFBA 1HYVA 1A5XA 1J9AA 1LAWA 3IG1A 3RMAA 4W5QA 3WNFA 3AVNA 4IBNA 2Z1JA 2HNDA 4I2QA 1WAFA 3MXIA 4CHOA 2HHWA 3OS2A 1VSLA 2F96A 3NF6A 4CIEA 3LWLA 1KFDA 4CEFA 5HP1A 5C25A 3QO9A 2B4JA 3AVIA 1A5WA 4E1MA 4DTOA 3NGZA 4RW6A 3LAKA 1NK4A 2KZMA 1KLMA 1EETA 4FCYA 1QQCA 1ZBFA 2ITGA 4JLHA 2XHBA 5J2PA 2YHAA 3SQ1A 4KTQA 4MQ3A 1X9SA 3KLGA 4DU4A 3CFRA 4M3TA 3CM6A 4JRQA 4BDZA 1JXEA 1HRHA 4DSJA 1ASVA 1KVCA 1VRTA 4DTPA 4DF4A 4F8RA 3OYKA 4CHNA 4DQSA 1X9MA 3KLHA 1RT3A 4J2DA 1NJZA 3V9ZA 4IFYA 4CHQA 2HVHA 1J54A 4CJEA 4CIFA 3V9UA 4CESA 1VSEA 3EYZA 2BDPA 1C0MA 2XRIA 3OYCA 3ZSXA 3KLFA 3KKSA 2Q3SA 3ZSWA 4PWDA 3WNGA 3NDKA 3SV4A 5J2MA 4FZYA 3SPYA 1ZYQA 4CK1A 4B9SA 3VQ4A 2RF2A 4N76A 2G8WA 1S5JA 1KVAA 1RTJA 1U48A 1XHXA 1D5AA 4DMNA 5I3UA 3DOKA 4CJ3A 4PUOA 4AHSA 3QIOA 3O3FA 1FKPA 1TKZA 4OVLA 5HBMA 3HPOA 2OYQA 4AHTA 1L3TA 4KHUA 4R5PA 1FKOA 1WN7A 3LP3A 4CGJA 4CK2A 4QAGA 1JL2A 4DFPA 3VQDA 4DFKA 1WSHA 4Z4FA 2F8SA 4Z4EA 3MEGA 3VQCA 3D0PA 2D0BA 3U3YA 3HSTB 3KD1E 4GVMA 4CE9A 2G8IA 1HMVA 4LH4A 4OLBA 3M8SA 2A1RA 2IS3A 4O4GA 1XWLA 5KI6A 4CERA 3MEEA 1UA0A 4CJFA 1RT4A 4DQIA 4E7HA 3OS1A 3OYIA 4BE1A 4FJLA 2VWKA 3DLRA 4OKKA 1GOBA 3TAPA 3H08A 2ETJA 3CM5A 2WOMA 3KLIA 3VQ7A 4CF0A 3EZ5A 4B9VA 2Z1IA 2HHSA 1UAXA 4LD0A 3TAQA 2DFEA 3LP1A 1U47A 3RRGA 1HPZA 3SUQA 2PYLA 3U3GA 4BWMA 3HJFA 4CFBA 5HLFA 4CIGA 3PV8A 3QEPA 3AVKA 2X78A 1EKEA 2Z1GA 4C8MA 2HHXA 4B9NA 3AVGA 3ZSYA 3AVAA 3DRSA 2HMIA 3B6OA 3ZT4A 3NCIA 4CEBA 2HNYA 3V9SA 2F8TA 5FRNA 1YTUA 1SUQA 3LAMA 5KRTA 5KTQA 4FLTA 1NK5A 1Y97A 4B8CA 1T7PA 1JLAA 3AVBA 3K2PA 2E6LA 4NYFA 3ALYA 4TSXA 4WE1A 3L2WA 4FJ5A 3HO1A 1RNHA 2B6AA 1GOAA 1BQMA 4B8AB 4JS5A 2B5JA 3AO2A 2OZSA 2PY5A 4KAZA 4UQGA 1RT7A 3S9HA 2YHBA 5CYQA 3DM2A 5HRPA 1RTDA 3OJUA 1QE1A 4M41A 5EU7A 3HM9A 3BDPA 2YNHA 2A1SA 3LZIA 2KW4A 2P5OA 2OPQA 1RT2A 4DLGA 4M3ZA 2NUBA 1VSMA 4AILC 1LWFA 2X74A 4RW4A 1NKBA 5C24A 2G8HA 3QNNA 4HCBA 3NF7A 1A5VA 3F9KA 3OYAA 4DTMA 4KHQA 4E89A 5D3GA 5KGXA 1C0TA 3K5MA 4BWJA 3DLBA 4C8OA 4Q0BA 4YNQA 2XY7A 1VRUA 4C8NA 3I0SA 1S1TA 2IC3A 3M8QA 5JS2A 4Z4CA 3NGIA 4KFBA 4KB0A 3TANA 4M3WA 3QERA 5DMRA 1JL1A 4CF8A 3C6UA 3HP9A 3VQEA 5J2QA 1C1BA 5SZTA 3OYBA 2KTQA 4N56A 2BANA 2JLEA 2XY6A 1TV6A 4IFVA 4QCLA 2YNFA 4CFAA 3VN5A 4ZHRA 2HNZA 4CJLA 3HK2A 2KZZA 5K14A 1LV5A 4IDKA 4CJTA 4DSLA 3TR8A 4NCAA 4HHTA 1QHTA 4RG8A 2I5JA 4FK4A 1X1PA 1T05A 1JLFA 4EP4A 3VQ6A 1D9DA 4FJGA 4AHCA 4E7KA 4J2AA 3T3FA 4KHWA 1RBUA 1J53A 1EXQA 1UOCA 4FJHA 1BISA 1U49A 4C8LA 2QK9A 1RTIA 3V1QA 2XY5A 1WSGA 4RW7A 1JLGA 2P1JA 4QOZB 3KD5E 3AO3A 1BIUA 3P1GA 4ZTFA 3RR8A 3S3MA 1L3VA 3V4IA 2ZE2A 1NJXA 1SL0A 1TKTA 1CXUA 4OPKA 3O3HA 4E7JA 4E7LA 4DS5A 1IKXA 5KGWA 1NK0A 3RWUA 4DTRA 1TL3A 1W9HA 3SV3A 4GMJB 4HUEA 3AO5A 2RPIA 5T7BA 4XIUA 3K58A 4DTNA 1NJWA 1SKSA 3P5JA 1BIZA 4K8ZA 4DF8A 1WAJA 4FLVA 3K5OA 5FDLA 5CYMA 4IG0A 3V1RA 3O3GA 1QTMA 3P83D 1CLQA 3L3UA 3I8DA 3QETA 3OVNA 5HROA 1SKWA 3IAYA 4Z4HA 3M8PA 1RBRA 1C1CA 3NE6A 1WSFA 1TGOA 4FK0A 1KRPA 2YNGA 3HVRA 1ZBUA 1JLBA 3CG7A 3SQ0A 1IO2A 4CHYA 1NKEA 3LZJA 4KB1A 3HP6A 1EP4A 2VG7A 1NOZA 5CZ1A 3QEXA 1NK6A 1RDDA 2ZQBA 5CZ2A 4KO0A 3VQPA 2FBYA 3C95A 4DQRA 4M42A 2W42A 3DRRA 3OYMA 3UIQA 1T8EA 3NHGA 1S1VA 4BE0A 3SPZA 1FK9A 4H4MA 3CFPA 3KLEA 3NF8A 4DU1A 5E41A 3AA2A 1RCHA 3O4NA 4OGCA 3NAEA 4CEOA 3SUOA 4AHVA 3AA3A 1WSEA 3U6FA 1YTAA 3KK2A 3TARA 4L8RB 4PQUA 4NCGA 1HYZA 4CJ5A 3B6PA 2G8VA 4JS4A 1S6QA 3TAEA 1SL1A 2OA8A 2VG6A 1BCOA 3ZSQA 4OPJA 4K8XA 1F21A 1JLEA 1G15A 1RBVA 2X6SA 4RW8A 4N41A 3OY9A 3IRXA 1N5YA 4FXDA 1DTTA 3M8RA 4O0JA 3ZT3A 4N47A 4KHYA 4KKOA 2PYJA 4FJMA 4AHRA 3SYZA 2BE2A 2FBXA 1RDCA 1Q9XA 1MU2A 2E6MA 2IDOA 2PZSA 3SQ4A 3MXMA 2G8UA 1SV5A 3LPTA 3V81A 4I2PA 2GV9A 4OLAA 4M3UA 3K5NA 4CJSA 1IKVA 3LALA 1LWEA 3OYFA 3SUNA 4CEAA 4FZXC 4Y1DA 4CGGA 4FYDA 1Z25A 4DSIA 3L2UA 4FW1A 2YNIA 1BL3A 4W5TA 3VQAA 4CGDA 3SNNA 1RT5A 1TK5A 4CHZA 3MEDA 3K5LA 4FLXA 1JXBA 1KSPA 1IH7A 3G0ZA 1S1XA 4M3XA 4E1NA 4CFCA 2VG5A 3T1AA 4PA1A 1T03A 4FVMA 4DTUA 3DYAA 1DLOA 4EP5A 3OJSA 1D9FA 4B9TA 4O55A 1TVRA 4KTZA 1R0AA 3ZT1A 4F2SA 2KFNA 1BHLA 4KHNA 4W5RA 3THVA 1VSJA 1XC9A 3AO4A 4FW2A 3C6TA 2YV0X 1N6QA 3ZT2A 4B9LA 4M3RA 2IOCA 1VSKA 4DSFA 1IG9A 2X6NA 3SUPA 3OYHA 1HQEA 2DTUA 4O0IA 2Z1HA 4ELVA 4B9MA 1C6VA 1U04A 3SJJA 2KQ2A 1S6PA 3PX4A 4Z0UA 4F3TA 1BI4A 3OYGA 3SI6A 3TWHA 4BDPA 1NKCA 1U45A 2P51A 1VSFA 1B92A 3G10A 4CFDA 2RKIA 3VQ9A 3IS9A 3OYJA 4J2EA 2FC0A 4CEQA 1HNVA 1RDAA 3NH1A 2FBTA 3LWMA 4Q5VA 4DTSA 4CJVA 4DQQA 4HUFA 2HHVA 1S9GA 1VSIA 3L2QA 3PO4A 4CJ4A 1S9EA 5J2NA 4J2BA 4AHUA 5FRMA 3ITHA 4CEZA 3KJVA 1XHZA 4ELTA 4DWIA 4Z4IA 4B3OA 3K59A 2HHQA 5JS1A 1HNIA 3KIOA 2G8KA 1IKWA 4E3SA 3EY1A 2HHUA 3QLHA 3K57A 1RTHA 3AVMA 4JRPA 1B9DA 1YT3A 2XO7A 3TI0A 3DLHA 1C0UA 3HPHA 1RILA 1EX4A 3RR7A 1NK8A 3PX6A 1KFSA 2HB5A 5J1EA 4BACA 4HCCA 3LP0A 4FJJA 3DOLA 3DLEA 3VQBA 4DS4A 3QEIA 4Z4GA 4G1QA 4FK2A 4Y1CA 4N5SA 4O5BA 1BCMA 4CJRA 3L2VA 1JLQA 4OGEA 3FFIA 1GOCA 1K6YA 3VQQA 3RMCA 4IKFA 3LP2A 3NF9A 4HUGA 1TKXA 1D8YA 1QSYA 5SWMA 4C8KA 1J5OA 4I7FA 3JYTA 1CXQA 3V6DA 1TKDA 2DFFA 5KRSA 4CGFA 4FM1A 4EZ9A 1L3UA 3AVHA 3O4QA 4CF2A 2QKKA 1HYSA 3ASMA 1X9WA 2Y1IA 1NOYA 3SQ2A 1TAQA 4I9LA 2GUIA 3ZSOA 2JGUA 4OKEA 1VSHA 5CY4A 1WNSA 2HW3A 2EHGA 4DLEA 1B9FA 1DTQA 3ZSZA 1TK8A 4CJWA 4DFMA 4CK3A 4FJXA 4HTUA 1KTQA 1S1WA 4BE2A 3RTVA 1IKYA 2R7YA 1HQUA 3WNHA 2YKMA 3CQ8A 4IG3A 3PX0A 4W5NA 1XI1A 1WSJA 2FBVA 1WSIA 2OPSA 4KPYA 4CHPA 4FJ7A 3ZT0A 3SCXA 4LSLA 4DQPA 1L5UA 3PO5A 2D0CA 3DMJA 4DSEA 1LAVA 3TAGA 3OYEA 3ZSVA 1LW2A 1VSDA 4PY5A 4RW9A 3A2FA 1Q8IA 2IAJA 3DLGA 4FM2A 4LH5A 4KRFA 3OS0A 3F73A 3V1OA 3HT3A 3RRHA 4CJUA 4LY7A 2OZMA 3L8BA 3NBPA 2HHTA 1BI4B 3LANA 3DRPA 4CJKA 3NFAA 1UA1A 3HPGA 3MECA 4H8KA 3SZ2A 3CYMA 1HJRA 4HVJA 3OYLA 4DU3A 1KCFA 4DTJA 2HVIA 3HYFA 2KFZA 1LW0A 2AJQA 4M45A 3AA4A 3V9XA 4FLZA 1RDBA 2GBZA 4M3YA 3AVLA 1O1WA 3HVTA 4OKJA 4FLWA 4FJ9A 4ICLA 2IGIA 1Q9YA 1QSSA 1LWCA 1W0HA 3HXMA 4ID5A 1SL2A 1RT1A 4FLUA 5HRSA 4NCBA 3L2RA 3KK3A 4KI4A 3QEVA 5HRRA 4EZ6A 1TL1A 3KKRA 3VA0A 3RMBA 3S3OA 5C42A 1RBTA 3S3NA 4F2RA 2D5RA 4FJIA 4NYNA 5DK5A 3AV9A 1U4BA 4O44A 4I9QA 2QKBA 1RT6A 4CECA 3C94A 3JSMA 4DFJA 4OJRA 2EX3A 1QSLA 2QXFA 4KTWA 4YFUA 4KREA 3AVFA 2RN2A 1FXXA 1S1UA 2E4LA 3AA5X 3DLKA 3PUFA 4H4OA 4CEEA 2G8FA 2DY4A 1BQNA 3WNEA 3TAFA 1ZBHA 4FJ8A 3V9WA 3AVJA 4GW6A 3VA3A 4F3OA 4CF9A 1NJYA 2XY8A 3NGYA 1BGXT 2OPRA 2WONA 3HL8A 1NK9A 4CGIA 3I0RA 3VQ5A 4CF1A 3QNOA 1KLNA 3LPUA 2D0AA 2Y1JA 4FZZA 4FJKA 3LDSA 1TK0A 2O4IA 4KHSA 4CGHA 1ITGA 2OPPA 3ULDA 3TABA 4FLYA 2DFHA 1JLCA 1ASWA 1Z26A 3CFOA 1I39A 1UWBA 3E01A 3DI6A 3ZSRA 1CZ9A 4E7IA 4BDYA 4F4KA 2VWJA 3D45A 5HRNA 3KTQA 3AVCA 1QS4A 2ATQA 3QEWA 3AO1A 1VK0A 4ZTJA 3PY8A 4KV8A 4CJPA 4E19A 4E0DA 3BGRA 4CCHA 1ASUA 3TAMA 3VQ8A 4B08A 4W5OA 1SKRA 2BGGA 1TAUA 3OYNA 3NH0A 3KK1A 4ELUA 2ZD1A 1YVUA 3QIPA 1JKHA 4CJQA 4CEDA 4DG1A 3ZCMA 1I3AA 3T19A 3OYDA 1CZBA 4FM0A 4B9UA 3NH2A 4DSKA 1WLJA 1C1AA 1ZBLA 5FROA 4FJNA 1L3SA 4LSNA 4DTXA 1RBSA 3RMDA 4ID1A 5I42A 4KI6A 3QINA 2P5GA 1KVBA 3ISNC 2YKNA 1ZBIA 3MAQA 1REVA
chains in the Genus database with same CATH superfamily
3QESA 3MXJA 1J9AA 4JKHA 4CZHA 1U2VA 4IBNA 4DQ8A 3MXIA 3A5MC 1VSLA 4CIEA 1QVGM 1N33K 3CC7N 5HP1A 1A5WA 3JXUA 1KLMA 4BR5A 1QQCA 2XHBA 3MWPA 1J6ZA 4MQ3A 3KLGA 4DU4A 4M3TA 1HRHA 4DTPA 3EKUA 1X9MA 1WBBA 1NJZA 5AQWA 4IFYA 1J54A 1C0MA 5H1SQ 3KLFA 5J2MA 4FZYA 4B9SA 4CK1A 3VGLA 2E2NA 3A5NC 3KVGA 3RVCA 1XHXA 1D5AA 3NMUA 4CJ3A 4AHSA 3HPOA 4OX9K 3CI5A 1FKOA 1WN7A 5AQLA 4CGJA 4Z94A 5MLCQ 1DT9A 3U3YA 3KD1E 3ENOA 4OLBA 3M8SA 2A1RA 1SS6A 5M1KA 2E8AA 4CJFA 1RT4A 4DQIA 3CIPA 3OYIA 4BE1A 4FJLA 3TAPA 4OKKA 4H5NA 3CM5A 3KLIA 3VQ7A 4BGBA 2HHSA 3FZMA 3F5TA 3LP1A 3LM2A 3SUQA 3BY5A 1GLFO 3VEWA 5E26A 3QEPA 1EKEA 5AZIA 2HMIA 3AVAA 3GOIA 4GV6A 3ZT4A 3NCIA 2HBLA 4BC2A 5KTQA 5GIOA 4FLTA 3CJ9A 4TSXA 3UKUA 2GWKA 3MK6A 4FJ5A 4DV6K 2B6AA 3G6EN 4B8AB 4KAZA 2PY5A 4H0VB 2YHBA 5CYQA 5HRPA 3WEEB 4B1XB 1QE1A 3BDPA 4JI1K 2A1SA 2P5OA 2OPQA 4DLGA 2NUBA 1VSMA 5AR0A 1NKBA 2G8HA 3J81O 4DUZK 4DTMA 1N8RO 3K5MA 4YNQA 2E2PA 3M8QA 1S1TA 4KFBA 1JL1A 4CF8A 3C6UA 3HP9A 5SZTA 1X3MA 3OYBA 3CETA 2JLEA 2XY6A 4QCLA 3DWLA 2YNFA 1TUUA 3VN5A 4CFAA 2HNZA 5AQGA 4X64K 1ZC6A 3R6MA 1LV5A 3D2EA 2HF4A 4IDKA 4DSLA 1QHTA 4FK4A 3O5BA 4EP4A 3ZETA 4E7KA 2PFUA 3T3FA 4BQZA 4QS8A 1YI2N 5C12A 3CMAN 1VQON 4BVOA 1NLVA 3N4PA 4DR1K 4B1UB 4DS5A 5IT9O 3WXIA 1ATNA 4GMJB 1KD1O 5T7BA 3K58A 1SZ2A 3E66A 3AAPA 4YHHK 1XMQK 5CYMA 3U9DA 2NRVA 3M8PA 5AQSA 1HUXA 4B3MK 1DKGD 2FSNA 4FK0A 2YNGA 3T7ZA 1ZBUA 3CG7A 4WCEL 3FZKA 2ZWHA 3CC4N 1NGIA 5CZ1A 1NOZA 4DCHA 5CZ2A 3IUCA 4KO0A 1KAXA 2W42A 3DRRA 4YORA 3NHGA 1S1VA 4FWLA 5AQRA 1NGBA 3KLEA 4DU1A 1YITN 3O4NA 2F9WA 3SUOA 1WSEA 2FSKA 2HOEA 3TARA 4JKAA 3AGRA 3D2EB 4NCGA 5FPDA 2G8VA 2VG6A 5FLXO 4K8XA 1F21A 4N41A 3C0BA 2ASOA 3ZT3A 1W97L 1GLLO 3SYZA 2E1ZA 1RDCA 4A5BA 3AY9A 1SV5A 3FGUA 3LPTA 1MDUB 3K5NA 2QI2A 1Q81O 4Y1DA 4CGGA 4DSIA 4H0YB 3TTDA 3CJ7A 4IJAA 4BR4A 3QBXA 1BL3A 4J8FA 4W5TA 4CGDA 3CCMN 3SNNA 1BUPA 4CHZA 3K5LA 3WEEA 4NXNK 5AQZA 4FLXA 1JXBA 1IH7A 3LM9A 2D1KA 3FFKB 2VG5A 1DGKN 3FZFA 4PA1A 5EOYA 4CZKA 3OJSA 3ZEUA 4KTZA 1R0AA 3ZT1A 2Q0UA 2CH5A 2GTDA 1XC9A 1QQNA 4FW2A 5JMVA 1VQ9N 1IV0A 2E20A 5AFUH 4M3RA 4G9ZA 2ZM6K 4CVNE 3OYHA 5BREA 2Z1HA 4B9MA 4DR7K 3SJJA 2IIRA 3M1FA 1BI4A 1YIJN 3TWHA 1WB9A 1VSFA 4FWRA 3OYJA 1RDAA 4JD2B 2FBTA 3EEQA 4GNIA 1VSIA 2Q2RA 4NXMK 3PO4A 4LFCK 4L3QA 4BROA 4BRDA 4KH6A 4CEZA 3QICA 4B3OA 3K59A 2F7TA 2HHUA 4JRPA 1XNRK 1HNWK 4BRQA 4FO0A 3TI0A 1NK8A 3PX6A 5JVHL 2O8CA 2HB5A 1E4GT 3LP0A 4FJJA 2WFBA 3VQBA 1FW6A 3VQQA 3RMCA 2UU9K 4H5RA 1QSYA 1CXQA 1TKDA 3RSEA 1QZ6A 4CF2A 2QKKA 1X9WA 3HRGA 2RHKA 4FWNA 3ZSOA 3EO3A 1WNSA 1Q82O 3KHYA 4DLEA 2Q1NA 4EAHD 2P9PB 3CCJN 4JYAK 3RTVA 4FWPA 4FWQA 3CQ8A 5HL7L 4YOVA 1G99A 3SCXA 4LSLA 2J4RA 3MCPA 4DQPA 5DM7L 1LAVA 4BRNA 1LW2A 2IVOA 3A2FA 1Q8IA 5FPNA 5BPMA 4FM2A 4H0XB 4LH5A 3V1OA 3O9RA 4CJUA 4LY7A 2ASPA 2OZMA 1YF5L 2HHTA 3DRPA 4B1YB 4DV4K 1T44A 3HPGA 3MECA 4DTJA 3OYLA 5EX5A 4FVUA 2AJQA 3HTVA 3AA4A 4BRHA 3V9XA 2VGMA 4IOAL 4M3YA 1O1WA 3HVTA 2IVPA 3ULEA 2IGIA 3VERA 1HLUA 1NGJA 3CQXA 3JAMO 1W0HA 4ID5A 4FLUA 5HRSA 4AM6A 5HRRA 3KKRA 2O8FA 1RBTA 3S3NA 2D5RA 2WUSA 4NYNA 5DK5A 3AV9A 4DV0K 4U67L 4DFJA 4OJRA 4YOYA 3P4IA 2QWLA 3IMXA 4KTWA 1QSLA 4KREA 3AVFA 1BG3A 4B3SK 3CCQN 3VA3A 2UXCK 5M1NA 1BA0A 3HL8A 3R1XA 4CGIA 1NK9A 4CF1A 4JKGB 1TYQA 4DKWA 3THYA 4FJKA 4IOXA 5CR4A 4JI2K 2O4IA 3CFOA 1SQKA 3HOSA 4JI3K 3H1VX 4K43A 1DEJA 1Z05A 5HRNA 3MN9A 2ATQA 1VK0A 3FZHA 4A57A 4HWIA 3BGRA 1TAUA 3NH0A 4ELUA 2P9PA 2ZD1A 4A5AA 3OYDA 4FM0A 1I3AA 3C7NA 1X3NA 3DAWA 4FJNA 4KI6A 1QQMA 1ZBIA 3NGIA 2LSNA 4AH9A 4YOUA 3CF5L 2A3ZA 4MFBA 3O6WA 3WNFA 4I2QA 2HNDA 1WAFA 1EWQA 4CHOA 4B3RK 3NF6A 3LWLA 4CEFA 3QO9A 4H03B 3AVIA 5I9EB 2KZMA 4FCYA 4JLHA 2O8CB 2YHAA 1NGAA 3CFRA 1M90O 2QTDA 4DSJA 1XUPO 1ASVA 1KVCA 4EHTA 4DR4K 4F8RA 3QBWA 1RT3A 4CHQA 2HVHA 3SBGA 4CIFA 3V9UA 1VSEA 2NRTA 1BOTO 2YX6A 3OYCA 3M3ZA 3KKSA 3VETA 2JWLA 3WNGA 4C1NI 3SPYA 2G8WA 1EO1A 1RTJA 5I3UA 4PUOA 1VQ8N 3QIOA 3O3FA 5HBMA 2OYQA 4AHTA 4KHUA 2CGKA 4DV1K 1JL2A 3VQDA 4DFKA 3HSTB 2E2QA 4LH4A 3M5RA 1S72N 2IS3A 3ZX0A 1XWLA 4JNEA 4CERA 3HOTA 1YJNN 1UA0A 3ZEUB 3OS1A 3H08A 2YHXA 4CF0A 3AARA 3EZWA 2WC9A 4LD0A 3U3GA 3HJFA 4YOWA 2F9TA 4C8MA 2HBKA 3C6AA 2ZJPL 4JKDA 1NK5A 1T7PA 3AVBA 2E6LA 3L2WA 2ZGYA 5LY3A 1RNHA 1GOAA 1BQMA 3WQUA 2B5JA 4UQGA 1RT7A 1RTDA 3QB0A 1N34K 3VPZA 4M41A 2QEXN 3HM9A 4ISGA 2UXBK 2KTQA 2X74A 5C24A 3NF7A 5D3GA 3DLBA 3CPWM 1VQKN 1VRUA 4LF5K 2IC3A 2P9UB 4KB0A 2BUPA 2VQFK 4LF8K 1TV6A 2QA4N 4NLCA 4ZHRA 4H0PA 4JI0K 4CJLA 3VEYA 3MMVA 5K14A 4FWMA 4CJTA 4RG8A 2I5JA 3E1YA 3VQ6A 5LJVA 4J2AA 4BY9C 3H6EA 1RBUA 2FSJA 1ATRA 1UOCA 1U49A 2QK9A 2P1JA 4QOZB 5M1QA 1BIUA 3P1GA 4Y0WA 4ZTFA 2ZJRL 3CMEN 3V4IA 1NJXA 2FLOA 4JK7A 3O3HA 1IKXA 4OO1J 4XIUA 3CC2N 4K8ZA 1BIZA 2BH1A 3K5OA 2O8DA 4IG0A 3O3GA 3L3UA 1IJJA 4KH4A 3ZETB 5HROA 4CZEA 2KLAA 4Z4HA 3NE6A 4FWOA 1WSFA 5AQQA 1RDUA 3ZYYX 1TGOA 1KRPA 3DXMB 1JLBA 2O8BA 2ZJQL 1IO2A 4KB1A 3HP6A 3NVKA 3O4WA 3QEXA 2UXDK 2ITMA 3CJBA 3GG4A 3JS6A 3VQPA 3DXMA 4DQRA 2V52B 4H5TA 5BRHA 2UUCK 3VGKA 3SPZA 3AA2A 1RCHA 4FWSA 2P9SA 2FF6A 4IJNA 4CEOA 1ZXOA 3U6FA 3KK2A 2VWBA 4L8RB 1HYZA 5HOOA 4ILJA 4CBUA 1S6QA 1BO5O 1BA1A 3ZSQA 4OPJA 4BRLA 1NJIO 1G15A 4WQ4C 4RW8A 1BDGA 2X6SA 4IEEA 3OY9A 1DTTA 3M8RA 4KHYA 5AQFA 3O1BA 4FJMA 5KPTA 1MU2A 2VCPA 2G8UA 4IZ9A 5DM6L 3D6RA 4M3UA 3OYFA 1IKVA 4FZXC 4GKKK 4FW1A 3H45C 3VQAA 3U8XA 3F2KA 4YDUA 4O8KA 5FPEA 1KSPA 4FVMA 4DTUA 4EP5A 1DLOA 4PL7A 5IWAK 1D9FA 3L0QA 4XH1A 1TYQB 2KFNA 1BHLA 4W5RA 4EFHA 4H5WA 3J7YP 2YV0X 4B9LA 2P9LB 4DSFA 2GWJA 2DTUA 4O0IA 5EY4A 4ELVA 1WBDA 1U04A 1S6PA 3PX4A 3SI6A 1U45A 4CFDA 3ZLJA 2FC0A 4CEQA 4DTSA 3LWMA 1MWKA 3GDQA 4ISEA 2HHHK 4DQQA 4HUFA 4CJ4A 1S9EA 5J2NA 1HKGA 4AHUA 5FRMA 1XMOK 3IDHA 4QS7A 3KJVA 5JLHA 4ELTA 4DWIA 5JS1A 5TKYA 3EY1A 3VGMA 3QLHA 3K57A 5JVGL 1VQ7N 1B9DA 3O1WA 2XO7A 2KHOA 3G71N 1C0UA 1NU0A 1HPMA 1RILA 1EX4A 3HPHA 4WYBA 3CJAA 3PLAA 4RWTA 2CH6A 4BACA 1NNEA 3SLCA 5AFUA 3DOLA 4DS4A 3QEIA 4Z4GA 2P9IA 1K8AO 1BCMA 3L2VA 3VEXA 4OGEA 1K6YA 4AF1A 3ID6A 3LP2A 3NF9A 1U2VB 1TKXA 3BP8A 4HUGA 4C8KA 2DFFA 5KRSA 3K9JA 1L3UA 1HYSA 1BU6O 5BN9A 2Y1IA 4JI5K 1NOYA 1TAQA 4K0KK 2GUIA 4BG9A 2JGUA 4OKEA 5CY4A 2A40A 3TTCA 2EHGA 3ZSZA 4CK3A 4FJXA 1S1WA 1T6CA 3DXKB 4BE2A 4O5FA 2R7YA 3WNHA 1YXQA 3PX0A 3PSIA 1XI1A 4XH5A 3AGKA 1L5UA 3PO5A 4BR0A 4LF7K 2D0CA 3LDPA 3TAGA 3ID8A 5C2DA 3DLGA 1NGEA 4PL8A 4DV5K 1XQSC 3T69A 4JHDA 4CJKA 2OTLN 4BVPA 4HVJA 1ATSA 4CZFA 3MN5A 3H3OB 3ENBA 3I33A 4FLZA 3FE1A 4OKJA 2P9NA 3EKSA 4PKGA 4FJ9A 4ICLA 3ZX2A 3LDQA 1NGGA 2F4VK 1TUYA 3TU5A 1SL2A 1VQ4N 3L2RA 4EZ6A 1TL1A 4MO5A 5C42A 5C2FA 4FJIA 4FWKA 1EWRA 5AQVA 2QKBA 4CECA 4YDUC 5JICA 2Q31A 3SQ1A 2RN2A 1FXXA 2DY4A 2G8FA 4R79A 1BQNA 4GW6A 4CF9A 1NMDA 1BGXT 4GY2B 4RCHA 4B1ZA 3HM8A 4BR7A 3QNOA 2NRXA 2DPNA 3LPUA 2Y1JA 3LDSA 1TK0A 4KHSA 4CGHA 4H5VA 3MX2A 4FLYA 2DFHA 3KWIA 3THWA 1JLCA 3A8YA 4LFAK 1Z26A 4FPAA 1K73O 3E01A 3DI6A 4BRFA 4E7IA 4BDYA 4F4KA 5KQ8A 4IO9L 3D45A 4A61A 3AVCA 4KV8A 4CJPA 4E0DA 5GAEP 4WFNL 1YVUA 5LL6Z 4CJQA 3TPQA 4B9UA 1GLEG 4DSKA 1WLJA 2O8FB 3CCRN 1RBSA 1ZBSA 4O8UA 1VQLN 3KWGA 1BWFO 1REVA 2O4GA 1OVYA 3PSFA 1NGHA 1HYVA 1A5XA 3CJCA 3ZX3A 3HZ6A 5FPMA 4JI6K 2HHWA 3OS2A 1KFDA 2QWPA 2B4JA 4DTOA 3NGZA 3EE9A 1S3XA 1NK4A 1EETA 1ZBFA 5J2PA 1WOQA 4KH5A 2PBDA 1JXEA 3Q7CA 1VRTA 4DQSA 3KLHA 4FSVA 4B3TK 4CESA 5M1PA 1KXPA 4JI8K 2XRIA 2NRHA 3D2FA 1S22A 3ZSWA 3CCVN 4PWDA 2QXLA 3NDKA 5AQXA 1NBWA 2NNWA 4AQYK 1U48A 5AQTA 4DMNA 3VOVA 1FKPA 2BTFA 1TKZA 4LC9B 1W2BM 4R5PA 5EVZA 3LP3A 4CK2A 4DFPA 4QAGA 4WQ4A 3H46O 1K9MO 1WSHA 4WQ5A 4Z4FA 2F8SA 4Z4EA 1Z6RA 3MEGA 2VYPA 3VQCA 4BR9A 4A2AA 1YJ9N 1FJGK 4GVMA 4CE9A 2G8IA 1HMVA 3U4LA 3THXB 5LJWA 5KI6A 4E7HA 5CHIA 5CE3A 1OH5A 5LMUK 5BRDA 4CJ7A 4B9VA 2Z1IA 3L6QA 3O08A 2DFEA 3VEZA 3RRGA 2AP1A 4FPBA 2PYLA 4BWMA 1K8KB 4CFBA 4JKFA 2X78A 3A5LC 2HHXA 4B9NA 3ZSYA 3DRSA 2WTUA 3BZCA 4CEBA 4CZIA 2F8TA 5FRNA 5AQPA 3MX5A 1SUQA 1Y97A 4B8CA 2OANA 1JLAA 4WE1A 3K2PA 2W40A 1XC3A 2O8EB 4JS5A 3AO2A 2CGJA 3B8AX 1YHQN 3THXA 5EU7A 3P39A 2YNHA 3LZIA 1Q86O 3J8AA 4RW4A 3F9KA 3OYAA 2GEMA 4KHQA 4E89A 5KGXA 4C8OA 4QS9A 4C8NA 3I0SA 4Z4CA 1M1KO 2ZF5O 3QERA 4BR2A 3VQEA 5J2QA 1C1BA 1QVFM 5AQIA 4IFVA 2Q97A 3HK2A 2KZZA 1W7AA 2P9KB 3I55N 4BQLA 4NCAA 3TR8A 4HHTA 4IOCL 1T05A 1JLFA 5F2RA 1T3VA 4AHCA 4KHWA 5AQYA 1J53A 4FJHA 1BISA 4C8LA 1RTIA 2XY5A 4A59A 3AO3A 2QWRA 4DR6K 3A5OC 2GX9A 3WQTA 3D7EO 3WT0A 3SJHA 2ZE2A 1Q7YO 3CHWA 3LDNA 2UUAK 1TKTA 1CXUA 4X62K 4OPKA 4E7JA 4E7LA 3KK7A 1HKCA 1NK0A 3RWUA 4DTRA 2P9UA 1W9HA 3S41A 4K41A 4ILHA 3AO5A 4X65K 4DTNA 3OBYA 1GLAG 3P5JA 3VEVA 3H1QA 4M7XA 3V1RA 3P83D 3EL2A 1RBRA 5BPNA 3HVRA 3O9UA 1WUAA 4BREA 4BGAA 4WQ5C 1EP4A 4XH4A 4BRKA 1QQOA 4V19S 1HNZK 2ZGZA 3ATVA 2FBYA 1GLBG 3OA9A 3OW2M 3CFPA 3OBWA 1YVNA 3FLCO 2WBNA 4DR5K 3NAEA 2GELA 1YTAA 4CZGA 3N4QA 3UB5A 2P9KA 3B6PA 4JS4A 1H1VA 4BC4A 1SL1A 1BCOA 3DJCA 1RBVA 4FXDA 4C23A 2OCEA 3H3NO 3IRXA 1N5YA 4O0JA 4KKOA 4JEPA 2D0PA 2JWKA 4E1JA 4PKHA 5AZJA 1SAZA 4YY3K 4RTFD 1Q9XA 2GUPA 2IDOA 3SQ4A 3Q7BA 1RDWX 3V81A 4I2PA 2GV9A 4OLAA 3P31A 1X9JA 3LALA 4BRGA 3SUNA 4CEAA 1QZ5A 4FYDA 3UE5A 2YNIA 4WFAL 5LMNK 1TK5A 4DV2K 2CGLA 4ILGB 4BRMA 1NGDA 5F0XA 2D0OA 3TTFA 5KQDA 4KHPK 1N36K 4GKJK 4F2SA 4KHNA 3THVA 1VSJA 2NRRA 4JAXA 3VMFB 4IWVA 3C6TA 4JKEA 1N6QA 3ZT2A 1HJOA 2IOCA 1YUWA 1VSKA 5ADXA 2V7ZA 4EHUA 5GAHP 3SUPA 3UKRA 1HQEA 1KAYA 1C6VA 2I7PA 3O9QA 2KQ2A 4BDPA 1NKCA 3EN9A 3G10A 3VQ9A 3IS9A 4J2EA 1HNVA 4MDAA 4CJVA 2HHVA 1S9GA 2QW9A 3ITHA 5C0YA 1Y64A 1MA9B 2HHQA 3KIOA 3WXJA 1V4TA 4E3SA 3CJ1A 1HX1A 4JD2A 1RTHA 3AVMA 3DXKA 5AZJB 1YT3A 3DLHA 2E5LK 4F9OA 1VQMN 1KFSA 5J1EA 2W41A 4B1WB 4DB3A 4HCCA 4LFBK 1E4FT 2AA4A 1HKBA 3D2FB 4G1QA 4FK2A 3FFIA 4IKFA 5AQUA 1N32K 3MWTA 1J5OA 4I7FA 4BC3A 4CGFA 4FM1A 3AVHA 3O4QA 1OKJA 2A41A 3SQ2A 3O9SA 1IBKK 3THYB 1VSHA 5EXWA 2HW3A 1DTQA 4CJWA 4DFMA 4U7BA 5AQJA 1C0FA 3UKRB 1IG8A 4FOIA 2QM1A 1WSJA 2FBVA 2OPSA 4FJ7A 3SBTA 5AQMA 1E3MA 3DMJA 5AQHA 3SAGA 3OYEA 3ZSVA 2EWSA 3BF1A 4IFEA 4RW9A 4X66K 3OS0A 3F73A 3HT3A 3RRHA 1T6DA 3L8BA 4FOEA 3NFAA 1UA1A 3SZ2A 4DU3A 2Q36A 4JHDB 3LL3A 3VTIA 4M45A 2P9LA 1RDBA 2GBZA 1NGFA 2I7NA 5AQKA 1Q9YA 1QSSA 1LWCA 2ASMA 3HXMA 4NCBA 3KK3A 4KI4A 3QEVA 3VA0A 3RMBA 3S3OA 3QFPA 4XEIA 5BN8A 3ATUA 1U4BA 4O44A 3C6HA 4I9QA 4LF6K 3C94A 3FR0A 2EX3A 2QXFA 3DLKA 1MWMA 3TAFA 1P90A 3V9WA 4A2BA 1P8ZA 4F3OA 3IKMA 4EIAA 1KC8O 3I0RA 2QWOA 2P9IB 1KLNA 4CI6A 2D4WA 5BR8K 4JKCA 2OPPA 1ASWA 2A5XA 3PIOL 2QWNA 4MLEA 4YOXA 3ZSRA 4LF4K 3RSEB 3CCSN 1CZ9A 1QHAA 3WXLA 3P38A 1QS4A 3AO1A 4ZTJA 1VQNN 1K8KA 2BGGA 4WF9L 1SKRA 3AAQA 4B1VA 3OYNA 2FXUA 4FL9A 3EE8A 1JKHA 4DG1A 4CEDA 3R8EA 2W6KA 4BC5A 1CZBA 3NH2A 1ZBLA 4K25A 5FROA 4OPHA 3SAFA 4LSNA 3E9OA 3E9PA 1KVBA 5GIPA 3MAQA 2HMPA 1NK7A 3L3VA 1LAWA 2QWQA 3IG1A 4NB4A 3GE1A 4W5QA 3RMAA 3AVNA 2Z1JA 3QMLA 4JN4A 2F96A 4B9QA 1VQ5N 3K9KA 5C25A 4E1MA 3TSQA 4RW6A 4HTLA 3E9LA 3LAKA 3BF3A 1GLCG 3U9ZA 2ITGA 4KTQA 2VGNA 1X9SA 4CBXA 1EQYA 3CPEA 3CM6A 4JRQA 4BDZA 4BG8A 3FZLA 4DF4A 4MLHA 1V4SA 4CHNA 3OYKA 2NLXA 4J2DA 2V7YA 3V9ZA 3R3LA 3BZKA 3VF4A 4CJEA 3EYZA 2BDPA 4CD3A 2YHYA 3ZSXA 1OH7A 2Q3SA 3SV4A 1ZYQA 4N76A 3VQ4A 2RF2A 5B8HA 4MO4A 1S5JA 1KVAA 4CBWA 3DOKA 3L4IA 4OVLA 3WXKA 1L3TA 2YHWA 3VTHA 3VENA 2P9SB 1VAZA 3D0PA 2D0BA 2P9NB 1ILYA 1NGCA 4O4GA 5AJ3K 4GV9A 3MEEA 4CW7B 3DLLL 2W6LA 2VWKA 3DLRA 4BRIA 1GOBA 2ETJA 2WOMA 3EZ5A 3K0SA 1UAXA 4UY8O 3TAQA 1U47A 1HPZA 1RGIA 5HLFA 4CIGA 3PV8A 3AVKA 2Z1GA 5GADP 3AVGA 5GAGP 2YJFA 3B6OA 1D4XA 3V9SA 2HNYA 3W0LA 4JK9A 1YTUA 3LAMA 5KRTA 1I94K 1IBLK 3G4SN 4NYFA 3ALYA 3HO1A 2H3GX 4MDBA 2OZSA 3S9HA 3R9PA 3TSPA 3SMPA 2NRWA 3CERA 3DM2A 3OJUA 4IEIA 5M1OA 2KW4A 4M3ZA 1RT2A 4AILC 1LWFA 3VEOA 2YCHA 4HCBA 3QNNA 1A5VA 1NWKA 4GVEA 1C0TA 4Q0BA 4BWJA 1VQPN 2XY7A 3SAHA 5JS2A 4M3WA 3TANA 5DMRA 1JCGA 3GL1A 4N56A 2IVNA 2BANA 2UYTA 1YJWN 3OHRA 4CZLA 4JKBA 1OH8A 3BEXA 1X1PA 4CZMA 1D9DA 4FJGA 4KBOA 1EXQA 4DR3K 2E2OA 4BRPA 3V1QA 1WSGA 4RW7A 1JLGA 3KD5E 2HF3A 3RR8A 3S3MA 1L3VA 1SL0A 4JI4K 5KGWA 4JK8A 4OPAA 1TL3A 3SV3A 4HUEA 1NJWA 2RPIA 1SKSA 4DF8A 1WAJA 4FLVA 3CCLN 5FDLA 1QTMA 3QFUA 3HBTA 4A62A 1CLQA 3I8DA 3QETA 3OVNA 3IAYA 1C0GA 1SKWA 4LF9K 1C1CA 3CCUN 3T1YK 3SQ0A 1NKEA 4CHYA 3MDQA 3LZJA 2VG7A 4NLBA 3I56N 1NK6A 1RDDA 3CXCM 2ZQBA 1JCEA 3BUZB 3C95A 4M42A 3NVMA 3OYMA 3UIQA 1T8EA 4BE0A 1VHXA 1JJ2M 1FK9A 4H4MA 3NF8A 5AZIB 5E41A 1NG9A 4OGCA 3LDOA 4AM7A 4AHVA 3AA3A 1HR0K 4PQUA 4CJ5A 1OH6A 5F1XA 3TAEA 2OA8A 1JLEA 4IDHA 4N47A 2O8EA 2PYJA 4JKGA 4AHRA 2BE2A 2FBXA 1LOTB 2E6MA 3J7ZO 3ENHA 2PZSA 3MXMA 2HBMA 3SK3A 4CJSA 1LWEA 1HNXK 1Z25A 4CZJA 3L2UA 5C10A 5ADXH 3I8BA 1RT5A 3LDLA 3MEDA 5BPLA 3G0ZA 1S1XA 4M3XA 4E1NA 4CFCA 3T1AA 1T03A 1YAGA 2Q0RA 3DYAA 4B9TA 4O55A 1TVRA 3MN6A 5AQNA 5JLFA 2FF3B 4C1NK 3WXMB 3AO4A 1IBMK 3ULEB 4YOTA 4IO8A 3MCAB 1OVQA 3M6GA 1IG9A 2X6NA 4BRAA 4M63C 3C65A 4BRCA 4Z0UA 4F3TA 3OYGA 4GV3A 2P51A 1B92A 2RKIA 5TKWA 3NH1A 4Q5VA 3L2QA 3J80O 4J2BA 2PAVA 1XHZA 3KZBA 4Z4IA 1HNIA 2E88A 4H0OA 1IKWA 2G8KA 4DUYK 3OTOK 1GLDG 5GINA 3RR7A 3CCEN 5C15A 1Q18A 4DV7K 3O80A 5BRFA 3DLEA 2VQEK 2HSTA 3CQYA 4Y1CA 4N5SA 4O5BA 4CJRA 1JLQA 1GOCA 1D8YA 4DR2K 4DV3K 5SWMA 3QDKA 3JYTA 3V6DA 2QWMA 4I6MA 4EZ9A 3TSUA 3ASMA 3VF2A 5AQOA 4H0TB 4I9LA 2OTJN 2O8BB 3F9MA 1B9FA 2RE2A 1TK8A 2A42A 4HTUA 1KTQA 4DHYA 3VESA 1IKYA 1HQUA 2YKMA 4IG3A 4K42A 4PKIA 3O9TA 4W5NA 1WSIA 3IFRA 4KPYA 4CHPA 3A0IX 3ZT0A 3GBTA 4DSEA 3WUHA 1VSDA 4PY5A 2IAJA 4M7YA 4KRFA 3NBPA 3THWB 1BI4B 3LANA 4H8KA 3UKUB 2HVIA 3CYMA 1HJRA 1KCFA 3HYFA 2KFZA 4ISFA 1LW0A 4NO7A 5A2QO 2NZTA 3AVLA 4FLWA 5KPZA 3MN7A 1RT1A 2YI1A 4IXCA 3G25A 4F2RA 3O8MA 1O13A 1U6ZA 3VF6A 4JI7K 1VQ6N 1RT6A 3JSMA 4JV5K 1CZAN 4YFUA 5ELZA 1LCUA 3AA5X 1S1UA 2E4LA 3PUFA 4H4OA 4CEEA 3W3DA 3WNEA 1ZBHA 4FJ8A 3AVJA 1NJYA 2XY8A 3NGYA 2A6AA 2OPRA 2WONA 3VQ5A 1KAZA 3HSCA 5BR9A 3T1HK 2D0AA 2YJEA 3SMSA 5E84A 4FZZA 4WFBL 2HBJA 1JCFA 1ITGA 1KQSM 3ULDA 3TABA 1NM1A 4PHTX 1I39A 1NMNA 1UWBA 3J7AP 4I6MB 2VWJA 3KTQA 1J5EK 2NRZA 3QEWA 3HI0A 1RFQA 2UUBK 3PY8A 2O8DB 1ESVA 3PIPL 4E19A 4CCHA 1ASUA 3TAMA 2V51B 3VQ8A 4B08A 4W5OA 3KK1A 4CD1A 5KPRA 1XNQK 3QIPA 1R59O 3ZCMA 1GLJO 3T19A 2KKZA 3C7NB 1C1AA 1L3SA 3RMDA 4DTXA 5I42A 4ID1A 5M1FA 3QINA 2P5GA 3ISNC 2YKNA 2E1YA 3L4QA 3CD6N
chains in the Genus database with same CATH topology
3QESA 2LSNA 2O4GA 4AH9A 1NK7A 3L3VA 3MXJA 4MFBA 1HYVA 1A5XA 1J9AA 1LAWA 3IG1A 3RMAA 4W5QA 3WNFA 3AVNA 4IBNA 2Z1JA 2HNDA 4I2QA 1WAFA 3MXIA 4CHOA 2HHWA 3OS2A 1VSLA 2F96A 3NF6A 4CIEA 3LWLA 1KFDA 4CEFA 5HP1A 5C25A 3QO9A 2B4JA 3AVIA 1A5WA 4E1MA 4DTOA 3NGZA 4RW6A 3LAKA 1NK4A 2KZMA 1KLMA 1EETA 4FCYA 1QQCA 1ZBFA 2ITGA 4JLHA 2XHBA 5J2PA 2YHAA 3SQ1A 4KTQA 4MQ3A 1X9SA 3KLGA 4DU4A 3CFRA 4M3TA 3CM6A 4JRQA 4BDZA 1JXEA 1HRHA 4DSJA 1ASVA 1KVCA 1VRTA 4DTPA 4DF4A 4F8RA 3OYKA 4CHNA 4DQSA 1X9MA 3KLHA 1RT3A 4J2DA 1NJZA 3V9ZA 4IFYA 4CHQA 2HVHA 1J54A 4CJEA 4CIFA 3V9UA 4CESA 1VSEA 3EYZA 2BDPA 1C0MA 2XRIA 3OYCA 3ZSXA 3KLFA 3KKSA 2Q3SA 3ZSWA 4PWDA 3WNGA 3NDKA 3SV4A 5J2MA 4FZYA 3SPYA 1ZYQA 4CK1A 4B9SA 3VQ4A 2RF2A 4N76A 2G8WA 1S5JA 1KVAA 1RTJA 1U48A 1XHXA 1D5AA 4DMNA 5I3UA 3DOKA 4CJ3A 4PUOA 4AHSA 3QIOA 3O3FA 1FKPA 1TKZA 4OVLA 5HBMA 3HPOA 2OYQA 4AHTA 1L3TA 4KHUA 4R5PA 1FKOA 1WN7A 3LP3A 4CGJA 4CK2A 4QAGA 1JL2A 4DFPA 3VQDA 4DFKA 1WSHA 4Z4FA 2F8SA 4Z4EA 3MEGA 3VQCA 3D0PA 2D0BA 3U3YA 3HSTB 3KD1E 4GVMA 4CE9A 2G8IA 1HMVA 4LH4A 4OLBA 3M8SA 2A1RA 2IS3A 4O4GA 1XWLA 5KI6A 4CERA 3MEEA 1UA0A 4CJFA 1RT4A 4DQIA 4E7HA 3OS1A 3OYIA 4BE1A 4FJLA 2VWKA 3DLRA 4OKKA 1GOBA 3TAPA 3H08A 2ETJA 3CM5A 2WOMA 3KLIA 3VQ7A 4CF0A 3EZ5A 4B9VA 2Z1IA 2HHSA 1UAXA 4LD0A 3TAQA 2DFEA 3LP1A 1U47A 3RRGA 1HPZA 3SUQA 2PYLA 3U3GA 4BWMA 3HJFA 4CFBA 5HLFA 4CIGA 3PV8A 3QEPA 3AVKA 2X78A 1EKEA 2Z1GA 4C8MA 2HHXA 4B9NA 3AVGA 3ZSYA 3AVAA 3DRSA 2HMIA 3B6OA 3ZT4A 3NCIA 4CEBA 2HNYA 3V9SA 2F8TA 5FRNA 1YTUA 1SUQA 3LAMA 5KRTA 5KTQA 4FLTA 1NK5A 1Y97A 4B8CA 1T7PA 1JLAA 3AVBA 3K2PA 2E6LA 4NYFA 3ALYA 4TSXA 4WE1A 3L2WA 4FJ5A 3HO1A 1RNHA 2B6AA 1GOAA 1BQMA 4B8AB 4JS5A 2B5JA 3AO2A 2OZSA 2PY5A 4KAZA 4UQGA 1RT7A 3S9HA 2YHBA 5CYQA 3DM2A 5HRPA 1RTDA 3OJUA 1QE1A 4M41A 5EU7A 3HM9A 3BDPA 2YNHA 2A1SA 3LZIA 2KW4A 2P5OA 2OPQA 1RT2A 4DLGA 4M3ZA 2NUBA 1VSMA 4AILC 1LWFA 2X74A 4RW4A 1NKBA 5C24A 2G8HA 3QNNA 4HCBA 3NF7A 1A5VA 3F9KA 3OYAA 4DTMA 4KHQA 4E89A 5D3GA 5KGXA 1C0TA 3K5MA 4BWJA 3DLBA 4C8OA 4Q0BA 4YNQA 2XY7A 1VRUA 4C8NA 3I0SA 1S1TA 2IC3A 3M8QA 5JS2A 4Z4CA 3NGIA 4KFBA 4KB0A 3TANA 4M3WA 3QERA 5DMRA 1JL1A 4CF8A 3C6UA 3HP9A 3VQEA 5J2QA 1C1BA 5SZTA 3OYBA 2KTQA 4N56A 2BANA 2JLEA 2XY6A 1TV6A 4IFVA 4QCLA 2YNFA 4CFAA 3VN5A 4ZHRA 2HNZA 4CJLA 3HK2A 2KZZA 5K14A 1LV5A 4IDKA 4CJTA 4DSLA 3TR8A 4NCAA 4HHTA 1QHTA 4RG8A 2I5JA 4FK4A 1X1PA 1T05A 1JLFA 4EP4A 3VQ6A 1D9DA 4FJGA 4AHCA 4E7KA 4J2AA 3T3FA 4KHWA 1RBUA 1J53A 1EXQA 1UOCA 4FJHA 1BISA 1U49A 4C8LA 2QK9A 1RTIA 3V1QA 2XY5A 1WSGA 4RW7A 1JLGA 2P1JA 4QOZB 3KD5E 3AO3A 1BIUA 3P1GA 4ZTFA 3RR8A 3S3MA 1L3VA 3V4IA 2ZE2A 1NJXA 1SL0A 1TKTA 1CXUA 4OPKA 3O3HA 4E7JA 4E7LA 4DS5A 1IKXA 5KGWA 1NK0A 3RWUA 4DTRA 1TL3A 1W9HA 3SV3A 4GMJB 4HUEA 3AO5A 2RPIA 5T7BA 4XIUA 3K58A 4DTNA 1NJWA 1SKSA 3P5JA 1BIZA 4K8ZA 4DF8A 1WAJA 4FLVA 3K5OA 5FDLA 5CYMA 4IG0A 3V1RA 3O3GA 1QTMA 3P83D 1CLQA 3L3UA 3I8DA 3QETA 3OVNA 5HROA 1SKWA 3IAYA 4Z4HA 3M8PA 1RBRA 1C1CA 3NE6A 1WSFA 1TGOA 4FK0A 1KRPA 2YNGA 3HVRA 1ZBUA 1JLBA 3CG7A 3SQ0A 1IO2A 4CHYA 1NKEA 3LZJA 4KB1A 3HP6A 1EP4A 2VG7A 1NOZA 5CZ1A 3QEXA 1NK6A 1RDDA 2ZQBA 5CZ2A 4KO0A 3VQPA 2FBYA 3C95A 4DQRA 4M42A 2W42A 3DRRA 3OYMA 3UIQA 1T8EA 3NHGA 1S1VA 4BE0A 3SPZA 1FK9A 4H4MA 3CFPA 3KLEA 3NF8A 4DU1A 5E41A 3AA2A 1RCHA 3O4NA 4OGCA 3NAEA 4CEOA 3SUOA 4AHVA 3AA3A 1WSEA 3U6FA 1YTAA 3KK2A 3TARA 4L8RB 4PQUA 4NCGA 1HYZA 4CJ5A 3B6PA 2G8VA 4JS4A 1S6QA 3TAEA 1SL1A 2OA8A 2VG6A 1BCOA 3ZSQA 4OPJA 4K8XA 1F21A 1JLEA 1G15A 1RBVA 2X6SA 4RW8A 4N41A 3OY9A 3IRXA 1N5YA 4FXDA 1DTTA 3M8RA 4O0JA 3ZT3A 4N47A 4KHYA 4KKOA 2PYJA 4FJMA 4AHRA 3SYZA 2BE2A 2FBXA 1RDCA 1Q9XA 1MU2A 2E6MA 2IDOA 2PZSA 3SQ4A 3MXMA 2G8UA 1SV5A 3LPTA 3V81A 4I2PA 2GV9A 4OLAA 4M3UA 3K5NA 4CJSA 1IKVA 3LALA 1LWEA 3OYFA 3SUNA 4CEAA 4FZXC 4Y1DA 4CGGA 4FYDA 1Z25A 4DSIA 3L2UA 4FW1A 2YNIA 1BL3A 4W5TA 3VQAA 4CGDA 3SNNA 1RT5A 1TK5A 4CHZA 3MEDA 3K5LA 4FLXA 1JXBA 1KSPA 1IH7A 3G0ZA 1S1XA 4M3XA 4E1NA 4CFCA 2VG5A 3T1AA 4PA1A 1T03A 4FVMA 4DTUA 3DYAA 1DLOA 4EP5A 3OJSA 1D9FA 4B9TA 4O55A 1TVRA 4KTZA 1R0AA 3ZT1A 4F2SA 2KFNA 1BHLA 4KHNA 4W5RA 3THVA 1VSJA 1XC9A 3AO4A 4FW2A 3C6TA 2YV0X 1N6QA 3ZT2A 4B9LA 4M3RA 2IOCA 1VSKA 4DSFA 1IG9A 2X6NA 3SUPA 3OYHA 1HQEA 2DTUA 4O0IA 2Z1HA 4ELVA 4B9MA 1C6VA 1U04A 3SJJA 2KQ2A 1S6PA 3PX4A 4Z0UA 4F3TA 1BI4A 3OYGA 3SI6A 3TWHA 4BDPA 1NKCA 1U45A 2P51A 1VSFA 1B92A 3G10A 4CFDA 2RKIA 3VQ9A 3IS9A 3OYJA 4J2EA 2FC0A 4CEQA 1HNVA 1RDAA 3NH1A 2FBTA 3LWMA 4Q5VA 4DTSA 4CJVA 4DQQA 4HUFA 2HHVA 1S9GA 1VSIA 3L2QA 3PO4A 4CJ4A 1S9EA 5J2NA 4J2BA 4AHUA 5FRMA 3ITHA 4CEZA 3KJVA 1XHZA 4ELTA 4DWIA 4Z4IA 4B3OA 3K59A 2HHQA 5JS1A 1HNIA 3KIOA 2G8KA 1IKWA 4E3SA 3EY1A 2HHUA 3QLHA 3K57A 1RTHA 3AVMA 4JRPA 1B9DA 1YT3A 2XO7A 3TI0A 3DLHA 1C0UA 3HPHA 1RILA 1EX4A 3RR7A 1NK8A 3PX6A 1KFSA 2HB5A 5J1EA 4BACA 4HCCA 3LP0A 4FJJA 3DOLA 3DLEA 3VQBA 4DS4A 3QEIA 4Z4GA 4G1QA 4FK2A 4Y1CA 4N5SA 4O5BA 1BCMA 4CJRA 3L2VA 1JLQA 4OGEA 3FFIA 1GOCA 1K6YA 3VQQA 3RMCA 4IKFA 3LP2A 3NF9A 4HUGA 1TKXA 1D8YA 1QSYA 5SWMA 4C8KA 1J5OA 4I7FA 3JYTA 1CXQA 3V6DA 1TKDA 2DFFA 5KRSA 4CGFA 4FM1A 4EZ9A 1L3UA 3AVHA 3O4QA 4CF2A 2QKKA 1HYSA 3ASMA 1X9WA 2Y1IA 1NOYA 3SQ2A 1TAQA 4I9LA 2GUIA 3ZSOA 2JGUA 4OKEA 1VSHA 5CY4A 1WNSA 2HW3A 2EHGA 4DLEA 1B9FA 1DTQA 3ZSZA 1TK8A 4CJWA 4DFMA 4CK3A 4FJXA 4HTUA 1KTQA 1S1WA 4BE2A 3RTVA 1IKYA 2R7YA 1HQUA 3WNHA 2YKMA 3CQ8A 4IG3A 3PX0A 4W5NA 1XI1A 1WSJA 2FBVA 1WSIA 2OPSA 4KPYA 4CHPA 4FJ7A 3ZT0A 3SCXA 4LSLA 4DQPA 1L5UA 3PO5A 2D0CA 3DMJA 4DSEA 1LAVA 3TAGA 3OYEA 3ZSVA 1LW2A 1VSDA 4PY5A 4RW9A 3A2FA 1Q8IA 2IAJA 3DLGA 4FM2A 4LH5A 4KRFA 3OS0A 3F73A 3V1OA 3HT3A 3RRHA 4CJUA 4LY7A 2OZMA 3L8BA 3NBPA 2HHTA 1BI4B 3LANA 3DRPA 4CJKA 3NFAA 1UA1A 3HPGA 3MECA 4H8KA 3SZ2A 3CYMA 1HJRA 4HVJA 3OYLA 4DU3A 1KCFA 4DTJA 2HVIA 3HYFA 2KFZA 1LW0A 2AJQA 4M45A 3AA4A 3V9XA 4FLZA 1RDBA 2GBZA 4M3YA 3AVLA 1O1WA 3HVTA 4OKJA 4FLWA 4FJ9A 4ICLA 2IGIA 1Q9YA 1QSSA 1LWCA 1W0HA 3HXMA 4ID5A 1SL2A 1RT1A 4FLUA 5HRSA 4NCBA 3L2RA 3KK3A 4KI4A 3QEVA 5HRRA 4EZ6A 1TL1A 3KKRA 3VA0A 3RMBA 3S3OA 5C42A 1RBTA 3S3NA 4F2RA 2D5RA 4FJIA 4NYNA 5DK5A 3AV9A 1U4BA 4O44A 4I9QA 2QKBA 1RT6A 4CECA 3C94A 3JSMA 4DFJA 4OJRA 2EX3A 1QSLA 2QXFA 4KTWA 4YFUA 4KREA 3AVFA 2RN2A 1FXXA 1S1UA 2E4LA 3AA5X 3DLKA 3PUFA 4H4OA 4CEEA 2G8FA 2DY4A 1BQNA 3WNEA 3TAFA 1ZBHA 4FJ8A 3V9WA 3AVJA 4GW6A 3VA3A 4F3OA 4CF9A 1NJYA 2XY8A 3NGYA 1BGXT 2OPRA 2WONA 3HL8A 1NK9A 4CGIA 3I0RA 3VQ5A 4CF1A 3QNOA 1KLNA 3LPUA 2D0AA 2Y1JA 4FZZA 4FJKA 3LDSA 1TK0A 2O4IA 4KHSA 4CGHA 1ITGA 2OPPA 3ULDA 3TABA 4FLYA 2DFHA 1JLCA 1ASWA 1Z26A 3CFOA 1I39A 1UWBA 3E01A 3DI6A 3ZSRA 1CZ9A 4E7IA 4BDYA 4F4KA 2VWJA 3D45A 5HRNA 3KTQA 3AVCA 1QS4A 2ATQA 3QEWA 3AO1A 1VK0A 4ZTJA 3PY8A 4KV8A 4CJPA 4E19A 4E0DA 3BGRA 4CCHA 1ASUA 3TAMA 3VQ8A 4B08A 4W5OA 1SKRA 2BGGA 1TAUA 3OYNA 3NH0A 3KK1A 4ELUA 2ZD1A 1YVUA 3QIPA 1JKHA 4CJQA 4CEDA 4DG1A 3ZCMA 1I3AA 3T19A 3OYDA 1CZBA 4FM0A 4B9UA 3NH2A 4DSKA 1WLJA 1C1AA 1ZBLA 5FROA 4FJNA 1L3SA 4LSNA 4DTXA 1RBSA 3RMDA 4ID1A 5I42A 4KI6A 3QINA 2P5GA 1KVBA 3ISNC 2YKNA 1ZBIA 3MAQA 1REVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QES A;  2LSN A;  2O4G A;  4AH9 A;  1NK7 A;  3L3V A;  3MXJ A;  4MFB A;  1HYV A;  1A5X A;  1J9A A;  1LAW A;  3IG1 A;  3RMA A;  4W5Q A;  3WNF A;  3AVN A;  4IBN A;  2Z1J A;  2HND A;  4I2Q A;  1WAF A;  3MXI A;  4CHO A;  2HHW A;  3OS2 A;  1VSL A;  2F96 A;  3NF6 A;  4CIE A;  3LWL A;  1KFD A;  4CEF A;  5HP1 A;  5C25 A;  3QO9 A;  2B4J A;  3AVI A;  1A5W A;  4E1M A;  4DTO A;  3NGZ A;  4RW6 A;  3LAK A;  1NK4 A;  2KZM A;  1KLM A;  1EET A;  4FCY A;  1QQC A;  1ZBF A;  2ITG A;  4JLH A;  2XHB A;  5J2P A;  2YHA A;  3SQ1 A;  4KTQ A;  4MQ3 A;  1X9S A;  3KLG A;  4DU4 A;  3CFR A;  4M3T A;  3CM6 A;  4JRQ A;  4BDZ A;  1JXE A;  1HRH A;  4DSJ A;  1ASV A;  1KVC A;  1VRT A;  4DTP A;  4DF4 A;  4F8R A;  3OYK A;  4CHN A;  4DQS A;  1X9M A;  3KLH A;  1RT3 A;  4J2D A;  1NJZ A;  3V9Z A;  4IFY A;  4CHQ A;  2HVH A;  1J54 A;  4CJE A;  4CIF A;  3V9U A;  4CES A;  1VSE A;  3EYZ A;  2BDP A;  1C0M A;  2XRI A;  3OYC A;  3ZSX A;  3KLF A;  3KKS A;  2Q3S A;  3ZSW A;  4PWD A;  3WNG A;  3NDK A;  3SV4 A;  5J2M A;  4FZY A;  3SPY A;  1ZYQ A;  4CK1 A;  4B9S A;  3VQ4 A;  2RF2 A;  4N76 A;  2G8W A;  1S5J A;  1KVA A;  1RTJ A;  1U48 A;  1XHX A;  1D5A A;  4DMN A;  5I3U A;  3DOK A;  4CJ3 A;  4PUO A;  4AHS A;  3QIO A;  3O3F A;  1FKP A;  1TKZ A;  4OVL A;  5HBM A;  3HPO A;  2OYQ A;  4AHT A;  1L3T A;  4KHU A;  4R5P A;  1FKO A;  1WN7 A;  3LP3 A;  4CGJ A;  4CK2 A;  4QAG A;  1JL2 A;  4DFP A;  3VQD A;  4DFK A;  1WSH A;  4Z4F A;  2F8S A;  4Z4E A;  3MEG A;  3VQC A;  3D0P A;  2D0B A;  3U3Y A;  3HST B;  3KD1 E;  4GVM A;  4CE9 A;  2G8I A;  1HMV A;  4LH4 A;  4OLB A;  3M8S A;  2A1R A;  2IS3 A;  4O4G A;  1XWL A;  5KI6 A;  4CER A;  3MEE A;  1UA0 A;  4CJF A;  1RT4 A;  4DQI A;  4E7H A;  3OS1 A;  3OYI A;  4BE1 A;  4FJL A;  2VWK A;  3DLR A;  4OKK A;  1GOB A;  3TAP A;  3H08 A;  2ETJ A;  3CM5 A;  2WOM A;  3KLI A;  3VQ7 A;  4CF0 A;  3EZ5 A;  4B9V A;  2Z1I A;  2HHS A;  1UAX A;  4LD0 A;  3TAQ A;  2DFE A;  3LP1 A;  1U47 A;  3RRG A;  1HPZ A;  3SUQ A;  2PYL A;  3U3G A;  4BWM A;  3HJF A;  4CFB A;  5HLF A;  4CIG A;  3PV8 A;  3QEP A;  3AVK A;  2X78 A;  1EKE A;  2Z1G A;  4C8M A;  2HHX A;  4B9N A;  3AVG A;  3ZSY A;  3AVA A;  3DRS A;  2HMI A;  3B6O A;  3ZT4 A;  3NCI A;  4CEB A;  2HNY A;  3V9S A;  2F8T A;  5FRN A;  1YTU A;  1SUQ A;  3LAM A;  5KRT A;  5KTQ A;  4FLT A;  1NK5 A;  1Y97 A;  4B8C A;  1T7P A;  1JLA A;  3AVB A;  3K2P A;  2E6L A;  4NYF A;  3ALY A;  4TSX A;  4WE1 A;  3L2W A;  4FJ5 A;  3HO1 A;  1RNH A;  2B6A A;  1GOA A;  1BQM A;  4B8A B;  4JS5 A;  2B5J A;  3AO2 A;  2OZS A;  2PY5 A;  4KAZ A;  4UQG A;  1RT7 A;  3S9H A;  2YHB A;  5CYQ A;  3DM2 A;  5HRP A;  1RTD A;  3OJU A;  1QE1 A;  4M41 A;  5EU7 A;  3HM9 A;  3BDP A;  2YNH A;  2A1S A;  3LZI A;  2KW4 A;  2P5O A;  2OPQ A;  1RT2 A;  4DLG A;  4M3Z A;  2NUB A;  1VSM A;  4AIL C;  1LWF A;  2X74 A;  4RW4 A;  1NKB A;  5C24 A;  2G8H A;  3QNN A;  4HCB A;  3NF7 A;  1A5V A;  3F9K A;  3OYA A;  4DTM A;  4KHQ A;  4E89 A;  5D3G A;  5KGX A;  1C0T A;  3K5M A;  4BWJ A;  3DLB A;  4C8O A;  4Q0B A;  4YNQ A;  2XY7 A;  1VRU A;  4C8N A;  3I0S A;  1S1T A;  2IC3 A;  3M8Q A;  5JS2 A;  4Z4C A;  3NGI A;  4KFB A;  4KB0 A;  3TAN A;  4M3W A;  3QER A;  5DMR A;  1JL1 A;  4CF8 A;  3C6U A;  3HP9 A;  3VQE A;  5J2Q A;  1C1B A;  5SZT A;  3OYB A;  2KTQ A;  4N56 A;  2BAN A;  2JLE A;  2XY6 A;  1TV6 A;  4IFV A;  4QCL A;  2YNF A;  4CFA A;  3VN5 A;  4ZHR A;  2HNZ A;  4CJL A;  3HK2 A;  2KZZ A;  5K14 A;  1LV5 A;  4IDK A;  4CJT A;  4DSL A;  3TR8 A;  4NCA A;  4HHT A;  1QHT A;  4RG8 A;  2I5J A;  4FK4 A;  1X1P A;  1T05 A;  1JLF A;  4EP4 A;  3VQ6 A;  1D9D A;  4FJG A;  4AHC A;  4E7K A;  4J2A A;  3T3F A;  4KHW A;  1RBU A;  1J53 A;  1EXQ A;  1UOC A;  4FJH A;  1BIS A;  1U49 A;  4C8L A;  2QK9 A;  1RTI A;  3V1Q A;  2XY5 A;  1WSG A;  4RW7 A;  1JLG A;  2P1J A;  4QOZ B;  3KD5 E;  3AO3 A;  1BIU A;  3P1G A;  4ZTF A;  3RR8 A;  3S3M A;  1L3V A;  3V4I A;  2ZE2 A;  1NJX A;  1SL0 A;  1TKT A;  1CXU A;  4OPK A;  3O3H A;  4E7J A;  4E7L A;  4DS5 A;  1IKX A;  5KGW A;  1NK0 A;  3RWU A;  4DTR A;  1TL3 A;  1W9H A;  3SV3 A;  4GMJ B;  4HUE A;  3AO5 A;  2RPI A;  5T7B A;  4XIU A;  3K58 A;  4DTN A;  1NJW A;  1SKS A;  3P5J A;  1BIZ A;  4K8Z A;  4DF8 A;  1WAJ A;  4FLV A;  3K5O A;  5FDL A;  5CYM A;  4IG0 A;  3V1R A;  3O3G A;  1QTM A;  3P83 D;  1CLQ A;  3L3U A;  3I8D A;  3QET A;  3OVN A;  5HRO A;  1SKW A;  3IAY A;  4Z4H A;  3M8P A;  1RBR A;  1C1C A;  3NE6 A;  1WSF A;  1TGO A;  4FK0 A;  1KRP A;  2YNG A;  3HVR A;  1ZBU A;  1JLB A;  3CG7 A;  3SQ0 A;  1IO2 A;  4CHY A;  1NKE A;  3LZJ A;  4KB1 A;  3HP6 A;  1EP4 A;  2VG7 A;  1NOZ A;  5CZ1 A;  3QEX A;  1NK6 A;  1RDD A;  2ZQB A;  5CZ2 A;  4KO0 A;  3VQP A;  2FBY A;  3C95 A;  4DQR A;  4M42 A;  2W42 A;  3DRR A;  3OYM A;  3UIQ A;  1T8E A;  3NHG A;  1S1V A;  4BE0 A;  3SPZ A;  1FK9 A;  4H4M A;  3CFP A;  3KLE A;  3NF8 A;  4DU1 A;  5E41 A;  3AA2 A;  1RCH A;  3O4N A;  4OGC A;  3NAE A;  4CEO A;  3SUO A;  4AHV A;  3AA3 A;  1WSE A;  3U6F A;  1YTA A;  3KK2 A;  3TAR A;  4L8R B;  4PQU A;  4NCG A;  1HYZ A;  4CJ5 A;  3B6P A;  2G8V A;  4JS4 A;  1S6Q A;  3TAE A;  1SL1 A;  2OA8 A;  2VG6 A;  1BCO A;  3ZSQ A;  4OPJ A;  4K8X A;  1F21 A;  1JLE A;  1G15 A;  1RBV A;  2X6S A;  4RW8 A;  4N41 A;  3OY9 A;  3IRX A;  1N5Y A;  4FXD A;  1DTT A;  3M8R A;  4O0J A;  3ZT3 A;  4N47 A;  4KHY A;  4KKO A;  2PYJ A;  4FJM A;  4AHR A;  3SYZ A;  2BE2 A;  2FBX A;  1RDC A;  1Q9X A;  1MU2 A;  2E6M A;  2IDO A;  2PZS A;  3SQ4 A;  3MXM A;  2G8U A;  1SV5 A;  3LPT A;  3V81 A;  4I2P A;  2GV9 A;  4OLA A;  4M3U A;  3K5N A;  4CJS A;  1IKV A;  3LAL A;  1LWE A;  3OYF A;  3SUN A;  4CEA A;  4FZX C;  4Y1D A;  4CGG A;  4FYD A;  1Z25 A;  4DSI A;  3L2U A;  4FW1 A;  2YNI A;  1BL3 A;  4W5T A;  3VQA A;  4CGD A;  3SNN A;  1RT5 A;  1TK5 A;  4CHZ A;  3MED A;  3K5L A;  4FLX A;  1JXB A;  1KSP A;  1IH7 A;  3G0Z A;  1S1X A;  4M3X A;  4E1N A;  4CFC A;  2VG5 A;  3T1A A;  4PA1 A;  1T03 A;  4FVM A;  4DTU A;  3DYA A;  1DLO A;  4EP5 A;  3OJS A;  1D9F A;  4B9T A;  4O55 A;  1TVR A;  4KTZ A;  1R0A A;  3ZT1 A;  4F2S A;  2KFN A;  1BHL A;  4KHN A;  4W5R A;  3THV A;  1VSJ A;  1XC9 A;  3AO4 A;  4FW2 A;  3C6T A;  2YV0 X;  1N6Q A;  3ZT2 A;  4B9L A;  4M3R A;  2IOC A;  1VSK A;  4DSF A;  1IG9 A;  2X6N A;  3SUP A;  3OYH A;  1HQE A;  2DTU A;  4O0I A;  2Z1H A;  4ELV A;  4B9M A;  1C6V A;  1U04 A;  3SJJ A;  2KQ2 A;  1S6P A;  3PX4 A;  4Z0U A;  4F3T A;  1BI4 A;  3OYG A;  3SI6 A;  3TWH A;  4BDP A;  1NKC A;  1U45 A;  2P51 A;  1VSF A;  1B92 A;  3G10 A;  4CFD A;  2RKI A;  3VQ9 A;  3IS9 A;  3OYJ A;  4J2E A;  2FC0 A;  4CEQ A;  1HNV A;  1RDA A;  3NH1 A;  2FBT A;  3LWM A;  4Q5V A;  4DTS A;  4CJV A;  4DQQ A;  4HUF A;  2HHV A;  1S9G A;  1VSI A;  3L2Q A;  3PO4 A;  4CJ4 A;  1S9E A;  5J2N A;  4J2B A;  4AHU A;  5FRM A;  3ITH A;  4CEZ A;  3KJV A;  1XHZ A;  4ELT A;  4DWI A;  4Z4I A;  4B3O A;  3K59 A;  2HHQ A;  5JS1 A;  1HNI A;  3KIO A;  2G8K A;  1IKW A;  4E3S A;  3EY1 A;  2HHU A;  3QLH A;  3K57 A;  1RTH A;  3AVM A;  4JRP A;  1B9D A;  1YT3 A;  2XO7 A;  3TI0 A;  3DLH A;  1C0U A;  3HPH A;  1RIL A;  1EX4 A;  3RR7 A;  1NK8 A;  3PX6 A;  1KFS A;  2HB5 A;  5J1E A;  4BAC A;  4HCC A;  3LP0 A;  4FJJ A;  3DOL A;  3DLE A;  3VQB A;  4DS4 A;  3QEI A;  4Z4G A;  4G1Q A;  4FK2 A;  4Y1C A;  4N5S A;  4O5B A;  1BCM A;  4CJR A;  3L2V A;  1JLQ A;  4OGE A;  3FFI A;  1GOC A;  1K6Y A;  3VQQ A;  3RMC A;  4IKF A;  3LP2 A;  3NF9 A;  4HUG A;  1TKX A;  1D8Y A;  1QSY A;  5SWM A;  4C8K A;  1J5O A;  4I7F A;  3JYT A;  1CXQ A;  3V6D A;  1TKD A;  2DFF A;  5KRS A;  4CGF A;  4FM1 A;  4EZ9 A;  1L3U A;  3AVH A;  3O4Q A;  4CF2 A;  2QKK A;  1HYS A;  3ASM A;  1X9W A;  2Y1I A;  1NOY A;  3SQ2 A;  1TAQ A;  4I9L A;  2GUI A;  3ZSO A;  2JGU A;  4OKE A;  1VSH A;  5CY4 A;  1WNS A;  2HW3 A;  2EHG A;  4DLE A;  1B9F A;  1DTQ A;  3ZSZ A;  1TK8 A;  4CJW A;  4DFM A;  4CK3 A;  4FJX A;  4HTU A;  1KTQ A;  1S1W A;  4BE2 A;  3RTV A;  1IKY A;  2R7Y A;  1HQU A;  3WNH A;  2YKM A;  3CQ8 A;  4IG3 A;  3PX0 A;  4W5N A;  1XI1 A;  1WSJ A;  2FBV A;  1WSI A;  2OPS A;  4KPY A;  4CHP A;  4FJ7 A;  3ZT0 A;  3SCX A;  4LSL A;  4DQP A;  1L5U A;  3PO5 A;  2D0C A;  3DMJ A;  4DSE A;  1LAV A;  3TAG A;  3OYE A;  3ZSV A;  1LW2 A;  1VSD A;  4PY5 A;  4RW9 A;  3A2F A;  1Q8I A;  2IAJ A;  3DLG A;  4FM2 A;  4LH5 A;  4KRF A;  3OS0 A;  3F73 A;  3V1O A;  3HT3 A;  3RRH A;  4CJU A;  4LY7 A;  2OZM A;  3L8B A;  3NBP A;  2HHT A;  1BI4 B;  3LAN A;  3DRP A;  4CJK A;  3NFA A;  1UA1 A;  3HPG A;  3MEC A;  4H8K A;  3SZ2 A;  3CYM A;  1HJR A;  4HVJ A;  3OYL A;  4DU3 A;  1KCF A;  4DTJ A;  2HVI A;  3HYF A;  2KFZ A;  1LW0 A;  2AJQ A;  4M45 A;  3AA4 A;  3V9X A;  4FLZ A;  1RDB A;  2GBZ A;  4M3Y A;  3AVL A;  1O1W A;  3HVT A;  4OKJ A;  4FLW A;  4FJ9 A;  4ICL A;  2IGI A;  1Q9Y A;  1QSS A;  1LWC A;  1W0H A;  3HXM A;  4ID5 A;  1SL2 A;  1RT1 A;  4FLU A;  5HRS A;  4NCB A;  3L2R A;  3KK3 A;  4KI4 A;  3QEV A;  5HRR A;  4EZ6 A;  1TL1 A;  3KKR A;  3VA0 A;  3RMB A;  3S3O A;  5C42 A;  1RBT A;  3S3N A;  4F2R A;  2D5R A;  4FJI A;  4NYN A;  5DK5 A;  3AV9 A;  1U4B A;  4O44 A;  4I9Q A;  2QKB A;  1RT6 A;  4CEC A;  3C94 A;  3JSM A;  4DFJ A;  4OJR A;  2EX3 A;  1QSL A;  2QXF A;  4KTW A;  4YFU A;  4KRE A;  3AVF A;  2RN2 A;  1FXX A;  1S1U A;  2E4L A;  3AA5 X;  3DLK A;  3PUF A;  4H4O A;  4CEE A;  2G8F A;  2DY4 A;  1BQN A;  3WNE A;  3TAF A;  1ZBH A;  4FJ8 A;  3V9W A;  3AVJ A;  4GW6 A;  3VA3 A;  4F3O A;  4CF9 A;  1NJY A;  2XY8 A;  3NGY A;  1BGX T;  2OPR A;  2WON A;  3HL8 A;  1NK9 A;  4CGI A;  3I0R A;  3VQ5 A;  4CF1 A;  3QNO A;  1KLN A;  3LPU A;  2D0A A;  2Y1J A;  4FZZ A;  4FJK A;  3LDS A;  1TK0 A;  2O4I A;  4KHS A;  4CGH A;  1ITG A;  2OPP A;  3ULD A;  3TAB A;  4FLY A;  2DFH A;  1JLC A;  1ASW A;  1Z26 A;  3CFO A;  1I39 A;  1UWB A;  3E01 A;  3DI6 A;  3ZSR A;  1CZ9 A;  4E7I A;  4BDY A;  4F4K A;  2VWJ A;  3D45 A;  5HRN A;  3KTQ A;  3AVC A;  1QS4 A;  2ATQ A;  3QEW A;  3AO1 A;  1VK0 A;  4ZTJ A;  3PY8 A;  4KV8 A;  4CJP A;  4E19 A;  4E0D A;  3BGR A;  4CCH A;  1ASU A;  3TAM A;  3VQ8 A;  4B08 A;  4W5O A;  1SKR A;  2BGG A;  1TAU A;  3OYN A;  3NH0 A;  3KK1 A;  4ELU A;  2ZD1 A;  1YVU A;  3QIP A;  1JKH A;  4CJQ A;  4CED A;  4DG1 A;  3ZCM A;  1I3A A;  3T19 A;  3OYD A;  1CZB A;  4FM0 A;  4B9U A;  3NH2 A;  4DSK A;  1WLJ A;  1C1A A;  1ZBL A;  5FRO A;  4FJN A;  1L3S A;  4LSN A;  4DTX A;  1RBS A;  3RMD A;  4ID1 A;  5I42 A;  4KI6 A;  3QIN A;  2P5G A;  1KVB A;  3ISN C;  2YKN A;  1ZBI A;  3MAQ A;  1REV A; 
#chains in the Genus database with same CATH topology
 3QES A;  3MXJ A;  1J9A A;  4JKH A;  4CZH A;  1U2V A;  4IBN A;  4DQ8 A;  3MXI A;  3A5M C;  1VSL A;  4CIE A;  1QVG M;  1N33 K;  3CC7 N;  5HP1 A;  1A5W A;  3JXU A;  1KLM A;  4BR5 A;  1QQC A;  2XHB A;  3MWP A;  1J6Z A;  4MQ3 A;  3KLG A;  4DU4 A;  4M3T A;  1HRH A;  4DTP A;  3EKU A;  1X9M A;  1WBB A;  1NJZ A;  5AQW A;  4IFY A;  1J54 A;  1C0M A;  5H1S Q;  3KLF A;  5J2M A;  4FZY A;  4B9S A;  4CK1 A;  3VGL A;  2E2N A;  3A5N C;  3KVG A;  3RVC A;  1XHX A;  1D5A A;  3NMU A;  4CJ3 A;  4AHS A;  3HPO A;  4OX9 K;  3CI5 A;  1FKO A;  1WN7 A;  5AQL A;  4CGJ A;  4Z94 A;  5MLC Q;  1DT9 A;  3U3Y A;  3KD1 E;  3ENO A;  4OLB A;  3M8S A;  2A1R A;  1SS6 A;  5M1K A;  2E8A A;  4CJF A;  1RT4 A;  4DQI A;  3CIP A;  3OYI A;  4BE1 A;  4FJL A;  3TAP A;  4OKK A;  4H5N A;  3CM5 A;  3KLI A;  3VQ7 A;  4BGB A;  2HHS A;  3FZM A;  3F5T A;  3LP1 A;  3LM2 A;  3SUQ A;  3BY5 A;  1GLF O;  3VEW A;  5E26 A;  3QEP A;  1EKE A;  5AZI A;  2HMI A;  3AVA A;  3GOI A;  4GV6 A;  3ZT4 A;  3NCI A;  2HBL A;  4BC2 A;  5KTQ A;  5GIO A;  4FLT A;  3CJ9 A;  4TSX A;  3UKU A;  2GWK A;  3MK6 A;  4FJ5 A;  4DV6 K;  2B6A A;  3G6E N;  4B8A B;  4KAZ A;  2PY5 A;  4H0V B;  2YHB A;  5CYQ A;  5HRP A;  3WEE B;  4B1X B;  1QE1 A;  3BDP A;  4JI1 K;  2A1S A;  2P5O A;  2OPQ A;  4DLG A;  2NUB A;  1VSM A;  5AR0 A;  1NKB A;  2G8H A;  3J81 O;  4DUZ K;  4DTM A;  1N8R O;  3K5M A;  4YNQ A;  2E2P A;  3M8Q A;  1S1T A;  4KFB A;  1JL1 A;  4CF8 A;  3C6U A;  3HP9 A;  5SZT A;  1X3M A;  3OYB A;  3CET A;  2JLE A;  2XY6 A;  4QCL A;  3DWL A;  2YNF A;  1TUU A;  3VN5 A;  4CFA A;  2HNZ A;  5AQG A;  4X64 K;  1ZC6 A;  3R6M A;  1LV5 A;  3D2E A;  2HF4 A;  4IDK A;  4DSL A;  1QHT A;  4FK4 A;  3O5B A;  4EP4 A;  3ZET A;  4E7K A;  2PFU A;  3T3F A;  4BQZ A;  4QS8 A;  1YI2 N;  5C12 A;  3CMA N;  1VQO N;  4BVO A;  1NLV A;  3N4P A;  4DR1 K;  4B1U B;  4DS5 A;  5IT9 O;  3WXI A;  1ATN A;  4GMJ B;  1KD1 O;  5T7B A;  3K58 A;  1SZ2 A;  3E66 A;  3AAP A;  4YHH K;  1XMQ K;  5CYM A;  3U9D A;  2NRV A;  3M8P A;  5AQS A;  1HUX A;  4B3M K;  1DKG D;  2FSN A;  4FK0 A;  2YNG A;  3T7Z A;  1ZBU A;  3CG7 A;  4WCE L;  3FZK A;  2ZWH A;  3CC4 N;  1NGI A;  5CZ1 A;  1NOZ A;  4DCH A;  5CZ2 A;  3IUC A;  4KO0 A;  1KAX A;  2W42 A;  3DRR A;  4YOR A;  3NHG A;  1S1V A;  4FWL A;  5AQR A;  1NGB A;  3KLE A;  4DU1 A;  1YIT N;  3O4N A;  2F9W A;  3SUO A;  1WSE A;  2FSK A;  2HOE A;  3TAR A;  4JKA A;  3AGR A;  3D2E B;  4NCG A;  5FPD A;  2G8V A;  2VG6 A;  5FLX O;  4K8X A;  1F21 A;  4N41 A;  3C0B A;  2ASO A;  3ZT3 A;  1W97 L;  1GLL O;  3SYZ A;  2E1Z A;  1RDC A;  4A5B A;  3AY9 A;  1SV5 A;  3FGU A;  3LPT A;  1MDU B;  3K5N A;  2QI2 A;  1Q81 O;  4Y1D A;  4CGG A;  4DSI A;  4H0Y B;  3TTD A;  3CJ7 A;  4IJA A;  4BR4 A;  3QBX A;  1BL3 A;  4J8F A;  4W5T A;  4CGD A;  3CCM N;  3SNN A;  1BUP A;  4CHZ A;  3K5L A;  3WEE A;  4NXN K;  5AQZ A;  4FLX A;  1JXB A;  1IH7 A;  3LM9 A;  2D1K A;  3FFK B;  2VG5 A;  1DGK N;  3FZF A;  4PA1 A;  5EOY A;  4CZK A;  3OJS A;  3ZEU A;  4KTZ A;  1R0A A;  3ZT1 A;  2Q0U A;  2CH5 A;  2GTD A;  1XC9 A;  1QQN A;  4FW2 A;  5JMV A;  1VQ9 N;  1IV0 A;  2E20 A;  5AFU H;  4M3R A;  4G9Z A;  2ZM6 K;  4CVN E;  3OYH A;  5BRE A;  2Z1H A;  4B9M A;  4DR7 K;  3SJJ A;  2IIR A;  3M1F A;  1BI4 A;  1YIJ N;  3TWH A;  1WB9 A;  1VSF A;  4FWR A;  3OYJ A;  1RDA A;  4JD2 B;  2FBT A;  3EEQ A;  4GNI A;  1VSI A;  2Q2R A;  4NXM K;  3PO4 A;  4LFC K;  4L3Q A;  4BRO A;  4BRD A;  4KH6 A;  4CEZ A;  3QIC A;  4B3O A;  3K59 A;  2F7T A;  2HHU A;  4JRP A;  1XNR K;  1HNW K;  4BRQ A;  4FO0 A;  3TI0 A;  1NK8 A;  3PX6 A;  5JVH L;  2O8C A;  2HB5 A;  1E4G T;  3LP0 A;  4FJJ A;  2WFB A;  3VQB A;  1FW6 A;  3VQQ A;  3RMC A;  2UU9 K;  4H5R A;  1QSY A;  1CXQ A;  1TKD A;  3RSE A;  1QZ6 A;  4CF2 A;  2QKK A;  1X9W A;  3HRG A;  2RHK A;  4FWN A;  3ZSO A;  3EO3 A;  1WNS A;  1Q82 O;  3KHY A;  4DLE A;  2Q1N A;  4EAH D;  2P9P B;  3CCJ N;  4JYA K;  3RTV A;  4FWP A;  4FWQ A;  3CQ8 A;  5HL7 L;  4YOV A;  1G99 A;  3SCX A;  4LSL A;  2J4R A;  3MCP A;  4DQP A;  5DM7 L;  1LAV A;  4BRN A;  1LW2 A;  2IVO A;  3A2F A;  1Q8I A;  5FPN A;  5BPM A;  4FM2 A;  4H0X B;  4LH5 A;  3V1O A;  3O9R A;  4CJU A;  4LY7 A;  2ASP A;  2OZM A;  1YF5 L;  2HHT A;  3DRP A;  4B1Y B;  4DV4 K;  1T44 A;  3HPG A;  3MEC A;  4DTJ A;  3OYL A;  5EX5 A;  4FVU A;  2AJQ A;  3HTV A;  3AA4 A;  4BRH A;  3V9X A;  2VGM A;  4IOA L;  4M3Y A;  1O1W A;  3HVT A;  2IVP A;  3ULE A;  2IGI A;  3VER A;  1HLU A;  1NGJ A;  3CQX A;  3JAM O;  1W0H A;  4ID5 A;  4FLU A;  5HRS A;  4AM6 A;  5HRR A;  3KKR A;  2O8F A;  1RBT A;  3S3N A;  2D5R A;  2WUS A;  4NYN A;  5DK5 A;  3AV9 A;  4DV0 K;  4U67 L;  4DFJ A;  4OJR A;  4YOY A;  3P4I A;  2QWL A;  3IMX A;  4KTW A;  1QSL A;  4KRE A;  3AVF A;  1BG3 A;  4B3S K;  3CCQ N;  3VA3 A;  2UXC K;  5M1N A;  1BA0 A;  3HL8 A;  3R1X A;  4CGI A;  1NK9 A;  4CF1 A;  4JKG B;  1TYQ A;  4DKW A;  3THY A;  4FJK A;  4IOX A;  5CR4 A;  4JI2 K;  2O4I A;  3CFO A;  1SQK A;  3HOS A;  4JI3 K;  3H1V X;  4K43 A;  1DEJ A;  1Z05 A;  5HRN A;  3MN9 A;  2ATQ A;  1VK0 A;  3FZH A;  4A57 A;  4HWI A;  3BGR A;  1TAU A;  3NH0 A;  4ELU A;  2P9P A;  2ZD1 A;  4A5A A;  3OYD A;  4FM0 A;  1I3A A;  3C7N A;  1X3N A;  3DAW A;  4FJN A;  4KI6 A;  1QQM A;  1ZBI A;  3NGI A;  2LSN A;  4AH9 A;  4YOU A;  3CF5 L;  2A3Z A;  4MFB A;  3O6W A;  3WNF A;  4I2Q A;  2HND A;  1WAF A;  1EWQ A;  4CHO A;  4B3R K;  3NF6 A;  3LWL A;  4CEF A;  3QO9 A;  4H03 B;  3AVI A;  5I9E B;  2KZM A;  4FCY A;  4JLH A;  2O8C B;  2YHA A;  1NGA A;  3CFR A;  1M90 O;  2QTD A;  4DSJ A;  1XUP O;  1ASV A;  1KVC A;  4EHT A;  4DR4 K;  4F8R A;  3QBW A;  1RT3 A;  4CHQ A;  2HVH A;  3SBG A;  4CIF A;  3V9U A;  1VSE A;  2NRT A;  1BOT O;  2YX6 A;  3OYC A;  3M3Z A;  3KKS A;  3VET A;  2JWL A;  3WNG A;  4C1N I;  3SPY A;  2G8W A;  1EO1 A;  1RTJ A;  5I3U A;  4PUO A;  1VQ8 N;  3QIO A;  3O3F A;  5HBM A;  2OYQ A;  4AHT A;  4KHU A;  2CGK A;  4DV1 K;  1JL2 A;  3VQD A;  4DFK A;  3HST B;  2E2Q A;  4LH4 A;  3M5R A;  1S72 N;  2IS3 A;  3ZX0 A;  1XWL A;  4JNE A;  4CER A;  3HOT A;  1YJN N;  1UA0 A;  3ZEU B;  3OS1 A;  3H08 A;  2YHX A;  4CF0 A;  3AAR A;  3EZW A;  2WC9 A;  4LD0 A;  3U3G A;  3HJF A;  4YOW A;  2F9T A;  4C8M A;  2HBK A;  3C6A A;  2ZJP L;  4JKD A;  1NK5 A;  1T7P A;  3AVB A;  2E6L A;  3L2W A;  2ZGY A;  5LY3 A;  1RNH A;  1GOA A;  1BQM A;  3WQU A;  2B5J A;  4UQG A;  1RT7 A;  1RTD A;  3QB0 A;  1N34 K;  3VPZ A;  4M41 A;  2QEX N;  3HM9 A;  4ISG A;  2UXB K;  2KTQ A;  2X74 A;  5C24 A;  3NF7 A;  5D3G A;  3DLB A;  3CPW M;  1VQK N;  1VRU A;  4LF5 K;  2IC3 A;  2P9U B;  4KB0 A;  2BUP A;  2VQF K;  4LF8 K;  1TV6 A;  2QA4 N;  4NLC A;  4ZHR A;  4H0P A;  4JI0 K;  4CJL A;  3VEY A;  3MMV A;  5K14 A;  4FWM A;  4CJT A;  4RG8 A;  2I5J A;  3E1Y A;  3VQ6 A;  5LJV A;  4J2A A;  4BY9 C;  3H6E A;  1RBU A;  2FSJ A;  1ATR A;  1UOC A;  1U49 A;  2QK9 A;  2P1J A;  4QOZ B;  5M1Q A;  1BIU A;  3P1G A;  4Y0W A;  4ZTF A;  2ZJR L;  3CME N;  3V4I A;  1NJX A;  2FLO A;  4JK7 A;  3O3H A;  1IKX A;  4OO1 J;  4XIU A;  3CC2 N;  4K8Z A;  1BIZ A;  2BH1 A;  3K5O A;  2O8D A;  4IG0 A;  3O3G A;  3L3U A;  1IJJ A;  4KH4 A;  3ZET B;  5HRO A;  4CZE A;  2KLA A;  4Z4H A;  3NE6 A;  4FWO A;  1WSF A;  5AQQ A;  1RDU A;  3ZYY X;  1TGO A;  1KRP A;  3DXM B;  1JLB A;  2O8B A;  2ZJQ L;  1IO2 A;  4KB1 A;  3HP6 A;  3NVK A;  3O4W A;  3QEX A;  2UXD K;  2ITM A;  3CJB A;  3GG4 A;  3JS6 A;  3VQP A;  3DXM A;  4DQR A;  2V52 B;  4H5T A;  5BRH A;  2UUC K;  3VGK A;  3SPZ A;  3AA2 A;  1RCH A;  4FWS A;  2P9S A;  2FF6 A;  4IJN A;  4CEO A;  1ZXO A;  3U6F A;  3KK2 A;  2VWB A;  4L8R B;  1HYZ A;  5HOO A;  4ILJ A;  4CBU A;  1S6Q A;  1BO5 O;  1BA1 A;  3ZSQ A;  4OPJ A;  4BRL A;  1NJI O;  1G15 A;  4WQ4 C;  4RW8 A;  1BDG A;  2X6S A;  4IEE A;  3OY9 A;  1DTT A;  3M8R A;  4KHY A;  5AQF A;  3O1B A;  4FJM A;  5KPT A;  1MU2 A;  2VCP A;  2G8U A;  4IZ9 A;  5DM6 L;  3D6R A;  4M3U A;  3OYF A;  1IKV A;  4FZX C;  4GKK K;  4FW1 A;  3H45 C;  3VQA A;  3U8X A;  3F2K A;  4YDU A;  4O8K A;  5FPE A;  1KSP A;  4FVM A;  4DTU A;  4EP5 A;  1DLO A;  4PL7 A;  5IWA K;  1D9F A;  3L0Q A;  4XH1 A;  1TYQ B;  2KFN A;  1BHL A;  4W5R A;  4EFH A;  4H5W A;  3J7Y P;  2YV0 X;  4B9L A;  2P9L B;  4DSF A;  2GWJ A;  2DTU A;  4O0I A;  5EY4 A;  4ELV A;  1WBD A;  1U04 A;  1S6P A;  3PX4 A;  3SI6 A;  1U45 A;  4CFD A;  3ZLJ A;  2FC0 A;  4CEQ A;  4DTS A;  3LWM A;  1MWK A;  3GDQ A;  4ISE A;  2HHH K;  4DQQ A;  4HUF A;  4CJ4 A;  1S9E A;  5J2N A;  1HKG A;  4AHU A;  5FRM A;  1XMO K;  3IDH A;  4QS7 A;  3KJV A;  5JLH A;  4ELT A;  4DWI A;  5JS1 A;  5TKY A;  3EY1 A;  3VGM A;  3QLH A;  3K57 A;  5JVG L;  1VQ7 N;  1B9D A;  3O1W A;  2XO7 A;  2KHO A;  3G71 N;  1C0U A;  1NU0 A;  1HPM A;  1RIL A;  1EX4 A;  3HPH A;  4WYB A;  3CJA A;  3PLA A;  4RWT A;  2CH6 A;  4BAC A;  1NNE A;  3SLC A;  5AFU A;  3DOL A;  4DS4 A;  3QEI A;  4Z4G A;  2P9I A;  1K8A O;  1BCM A;  3L2V A;  3VEX A;  4OGE A;  1K6Y A;  4AF1 A;  3ID6 A;  3LP2 A;  3NF9 A;  1U2V B;  1TKX A;  3BP8 A;  4HUG A;  4C8K A;  2DFF A;  5KRS A;  3K9J A;  1L3U A;  1HYS A;  1BU6 O;  5BN9 A;  2Y1I A;  4JI5 K;  1NOY A;  1TAQ A;  4K0K K;  2GUI A;  4BG9 A;  2JGU A;  4OKE A;  5CY4 A;  2A40 A;  3TTC A;  2EHG A;  3ZSZ A;  4CK3 A;  4FJX A;  1S1W A;  1T6C A;  3DXK B;  4BE2 A;  4O5F A;  2R7Y A;  3WNH A;  1YXQ A;  3PX0 A;  3PSI A;  1XI1 A;  4XH5 A;  3AGK A;  1L5U A;  3PO5 A;  4BR0 A;  4LF7 K;  2D0C A;  3LDP A;  3TAG A;  3ID8 A;  5C2D A;  3DLG A;  1NGE A;  4PL8 A;  4DV5 K;  1XQS C;  3T69 A;  4JHD A;  4CJK A;  2OTL N;  4BVP A;  4HVJ A;  1ATS A;  4CZF A;  3MN5 A;  3H3O B;  3ENB A;  3I33 A;  4FLZ A;  3FE1 A;  4OKJ A;  2P9N A;  3EKS A;  4PKG A;  4FJ9 A;  4ICL A;  3ZX2 A;  3LDQ A;  1NGG A;  2F4V K;  1TUY A;  3TU5 A;  1SL2 A;  1VQ4 N;  3L2R A;  4EZ6 A;  1TL1 A;  4MO5 A;  5C42 A;  5C2F A;  4FJI A;  4FWK A;  1EWR A;  5AQV A;  2QKB A;  4CEC A;  4YDU C;  5JIC A;  2Q31 A;  3SQ1 A;  2RN2 A;  1FXX A;  2DY4 A;  2G8F A;  4R79 A;  1BQN A;  4GW6 A;  4CF9 A;  1NMD A;  1BGX T;  4GY2 B;  4RCH A;  4B1Z A;  3HM8 A;  4BR7 A;  3QNO A;  2NRX A;  2DPN A;  3LPU A;  2Y1J A;  3LDS A;  1TK0 A;  4KHS A;  4CGH A;  4H5V A;  3MX2 A;  4FLY A;  2DFH A;  3KWI A;  3THW A;  1JLC A;  3A8Y A;  4LFA K;  1Z26 A;  4FPA A;  1K73 O;  3E01 A;  3DI6 A;  4BRF A;  4E7I A;  4BDY A;  4F4K A;  5KQ8 A;  4IO9 L;  3D45 A;  4A61 A;  3AVC A;  4KV8 A;  4CJP A;  4E0D A;  5GAE P;  4WFN L;  1YVU A;  5LL6 Z;  4CJQ A;  3TPQ A;  4B9U A;  1GLE G;  4DSK A;  1WLJ A;  2O8F B;  3CCR N;  1RBS A;  1ZBS A;  4O8U A;  1VQL N;  3KWG A;  1BWF O;  1REV A;  2O4G A;  1OVY A;  3PSF A;  1NGH A;  1HYV A;  1A5X A;  3CJC A;  3ZX3 A;  3HZ6 A;  5FPM A;  4JI6 K;  2HHW A;  3OS2 A;  1KFD A;  2QWP A;  2B4J A;  4DTO A;  3NGZ A;  3EE9 A;  1S3X A;  1NK4 A;  1EET A;  1ZBF A;  5J2P A;  1WOQ A;  4KH5 A;  2PBD A;  1JXE A;  3Q7C A;  1VRT A;  4DQS A;  3KLH A;  4FSV A;  4B3T K;  4CES A;  5M1P A;  1KXP A;  4JI8 K;  2XRI A;  2NRH A;  3D2F A;  1S22 A;  3ZSW A;  3CCV N;  4PWD A;  2QXL A;  3NDK A;  5AQX A;  1NBW A;  2NNW A;  4AQY K;  1U48 A;  5AQT A;  4DMN A;  3VOV A;  1FKP A;  2BTF A;  1TKZ A;  4LC9 B;  1W2B M;  4R5P A;  5EVZ A;  3LP3 A;  4CK2 A;  4DFP A;  4QAG A;  4WQ4 A;  3H46 O;  1K9M O;  1WSH A;  4WQ5 A;  4Z4F A;  2F8S A;  4Z4E A;  1Z6R A;  3MEG A;  2VYP A;  3VQC A;  4BR9 A;  4A2A A;  1YJ9 N;  1FJG K;  4GVM A;  4CE9 A;  2G8I A;  1HMV A;  3U4L A;  3THX B;  5LJW A;  5KI6 A;  4E7H A;  5CHI A;  5CE3 A;  1OH5 A;  5LMU K;  5BRD A;  4CJ7 A;  4B9V A;  2Z1I A;  3L6Q A;  3O08 A;  2DFE A;  3VEZ A;  3RRG A;  2AP1 A;  4FPB A;  2PYL A;  4BWM A;  1K8K B;  4CFB A;  4JKF A;  2X78 A;  3A5L C;  2HHX A;  4B9N A;  3ZSY A;  3DRS A;  2WTU A;  3BZC A;  4CEB A;  4CZI A;  2F8T A;  5FRN A;  5AQP A;  3MX5 A;  1SUQ A;  1Y97 A;  4B8C A;  2OAN A;  1JLA A;  4WE1 A;  3K2P A;  2W40 A;  1XC3 A;  2O8E B;  4JS5 A;  3AO2 A;  2CGJ A;  3B8A X;  1YHQ N;  3THX A;  5EU7 A;  3P39 A;  2YNH A;  3LZI A;  1Q86 O;  3J8A A;  4RW4 A;  3F9K A;  3OYA A;  2GEM A;  4KHQ A;  4E89 A;  5KGX A;  4C8O A;  4QS9 A;  4C8N A;  3I0S A;  4Z4C A;  1M1K O;  2ZF5 O;  3QER A;  4BR2 A;  3VQE A;  5J2Q A;  1C1B A;  1QVF M;  5AQI A;  4IFV A;  2Q97 A;  3HK2 A;  2KZZ A;  1W7A A;  2P9K B;  3I55 N;  4BQL A;  4NCA A;  3TR8 A;  4HHT A;  4IOC L;  1T05 A;  1JLF A;  5F2R A;  1T3V A;  4AHC A;  4KHW A;  5AQY A;  1J53 A;  4FJH A;  1BIS A;  4C8L A;  1RTI A;  2XY5 A;  4A59 A;  3AO3 A;  2QWR A;  4DR6 K;  3A5O C;  2GX9 A;  3WQT A;  3D7E O;  3WT0 A;  3SJH A;  2ZE2 A;  1Q7Y O;  3CHW A;  3LDN A;  2UUA K;  1TKT A;  1CXU A;  4X62 K;  4OPK A;  4E7J A;  4E7L A;  3KK7 A;  1HKC A;  1NK0 A;  3RWU A;  4DTR A;  2P9U A;  1W9H A;  3S41 A;  4K41 A;  4ILH A;  3AO5 A;  4X65 K;  4DTN A;  3OBY A;  1GLA G;  3P5J A;  3VEV A;  3H1Q A;  4M7X A;  3V1R A;  3P83 D;  3EL2 A;  1RBR A;  5BPN A;  3HVR A;  3O9U A;  1WUA A;  4BRE A;  4BGA A;  4WQ5 C;  1EP4 A;  4XH4 A;  4BRK A;  1QQO A;  4V19 S;  1HNZ K;  2ZGZ A;  3ATV A;  2FBY A;  1GLB G;  3OA9 A;  3OW2 M;  3CFP A;  3OBW A;  1YVN A;  3FLC O;  2WBN A;  4DR5 K;  3NAE A;  2GEL A;  1YTA A;  4CZG A;  3N4Q A;  3UB5 A;  2P9K A;  3B6P A;  4JS4 A;  1H1V A;  4BC4 A;  1SL1 A;  1BCO A;  3DJC A;  1RBV A;  4FXD A;  4C23 A;  2OCE A;  3H3N O;  3IRX A;  1N5Y A;  4O0J A;  4KKO A;  4JEP A;  2D0P A;  2JWK A;  4E1J A;  4PKH A;  5AZJ A;  1SAZ A;  4YY3 K;  4RTF D;  1Q9X A;  2GUP A;  2IDO A;  3SQ4 A;  3Q7B A;  1RDW X;  3V81 A;  4I2P A;  2GV9 A;  4OLA A;  3P31 A;  1X9J A;  3LAL A;  4BRG A;  3SUN A;  4CEA A;  1QZ5 A;  4FYD A;  3UE5 A;  2YNI A;  4WFA L;  5LMN K;  1TK5 A;  4DV2 K;  2CGL A;  4ILG B;  4BRM A;  1NGD A;  5F0X A;  2D0O A;  3TTF A;  5KQD A;  4KHP K;  1N36 K;  4GKJ K;  4F2S A;  4KHN A;  3THV A;  1VSJ A;  2NRR A;  4JAX A;  3VMF B;  4IWV A;  3C6T A;  4JKE A;  1N6Q A;  3ZT2 A;  1HJO A;  2IOC A;  1YUW A;  1VSK A;  5ADX A;  2V7Z A;  4EHU A;  5GAH P;  3SUP A;  3UKR A;  1HQE A;  1KAY A;  1C6V A;  2I7P A;  3O9Q A;  2KQ2 A;  4BDP A;  1NKC A;  3EN9 A;  3G10 A;  3VQ9 A;  3IS9 A;  4J2E A;  1HNV A;  4MDA A;  4CJV A;  2HHV A;  1S9G A;  2QW9 A;  3ITH A;  5C0Y A;  1Y64 A;  1MA9 B;  2HHQ A;  3KIO A;  3WXJ A;  1V4T A;  4E3S A;  3CJ1 A;  1HX1 A;  4JD2 A;  1RTH A;  3AVM A;  3DXK A;  5AZJ B;  1YT3 A;  3DLH A;  2E5L K;  4F9O A;  1VQM N;  1KFS A;  5J1E A;  2W41 A;  4B1W B;  4DB3 A;  4HCC A;  4LFB K;  1E4F T;  2AA4 A;  1HKB A;  3D2F B;  4G1Q A;  4FK2 A;  3FFI A;  4IKF A;  5AQU A;  1N32 K;  3MWT A;  1J5O A;  4I7F A;  4BC3 A;  4CGF A;  4FM1 A;  3AVH A;  3O4Q A;  1OKJ A;  2A41 A;  3SQ2 A;  3O9S A;  1IBK K;  3THY B;  1VSH A;  5EXW A;  2HW3 A;  1DTQ A;  4CJW A;  4DFM A;  4U7B A;  5AQJ A;  1C0F A;  3UKR B;  1IG8 A;  4FOI A;  2QM1 A;  1WSJ A;  2FBV A;  2OPS A;  4FJ7 A;  3SBT A;  5AQM A;  1E3M A;  3DMJ A;  5AQH A;  3SAG A;  3OYE A;  3ZSV A;  2EWS A;  3BF1 A;  4IFE A;  4RW9 A;  4X66 K;  3OS0 A;  3F73 A;  3HT3 A;  3RRH A;  1T6D A;  3L8B A;  4FOE A;  3NFA A;  1UA1 A;  3SZ2 A;  4DU3 A;  2Q36 A;  4JHD B;  3LL3 A;  3VTI A;  4M45 A;  2P9L A;  1RDB A;  2GBZ A;  1NGF A;  2I7N A;  5AQK A;  1Q9Y A;  1QSS A;  1LWC A;  2ASM A;  3HXM A;  4NCB A;  3KK3 A;  4KI4 A;  3QEV A;  3VA0 A;  3RMB A;  3S3O A;  3QFP A;  4XEI A;  5BN8 A;  3ATU A;  1U4B A;  4O44 A;  3C6H A;  4I9Q A;  4LF6 K;  3C94 A;  3FR0 A;  2EX3 A;  2QXF A;  3DLK A;  1MWM A;  3TAF A;  1P90 A;  3V9W A;  4A2B A;  1P8Z A;  4F3O A;  3IKM A;  4EIA A;  1KC8 O;  3I0R A;  2QWO A;  2P9I B;  1KLN A;  4CI6 A;  2D4W A;  5BR8 K;  4JKC A;  2OPP A;  1ASW A;  2A5X A;  3PIO L;  2QWN A;  4MLE A;  4YOX A;  3ZSR A;  4LF4 K;  3RSE B;  3CCS N;  1CZ9 A;  1QHA A;  3WXL A;  3P38 A;  1QS4 A;  3AO1 A;  4ZTJ A;  1VQN N;  1K8K A;  2BGG A;  4WF9 L;  1SKR A;  3AAQ A;  4B1V A;  3OYN A;  2FXU A;  4FL9 A;  3EE8 A;  1JKH A;  4DG1 A;  4CED A;  3R8E A;  2W6K A;  4BC5 A;  1CZB A;  3NH2 A;  1ZBL A;  4K25 A;  5FRO A;  4OPH A;  3SAF A;  4LSN A;  3E9O A;  3E9P A;  1KVB A;  5GIP A;  3MAQ A;  2HMP A;  1NK7 A;  3L3V A;  1LAW A;  2QWQ A;  3IG1 A;  4NB4 A;  3GE1 A;  4W5Q A;  3RMA A;  3AVN A;  2Z1J A;  3QML A;  4JN4 A;  2F96 A;  4B9Q A;  1VQ5 N;  3K9K A;  5C25 A;  4E1M A;  3TSQ A;  4RW6 A;  4HTL A;  3E9L A;  3LAK A;  3BF3 A;  1GLC G;  3U9Z A;  2ITG A;  4KTQ A;  2VGN A;  1X9S A;  4CBX A;  1EQY A;  3CPE A;  3CM6 A;  4JRQ A;  4BDZ A;  4BG8 A;  3FZL A;  4DF4 A;  4MLH A;  1V4S A;  4CHN A;  3OYK A;  2NLX A;  4J2D A;  2V7Y A;  3V9Z A;  3R3L A;  3BZK A;  3VF4 A;  4CJE A;  3EYZ A;  2BDP A;  4CD3 A;  2YHY A;  3ZSX A;  1OH7 A;  2Q3S A;  3SV4 A;  1ZYQ A;  4N76 A;  3VQ4 A;  2RF2 A;  5B8H A;  4MO4 A;  1S5J A;  1KVA A;  4CBW A;  3DOK A;  3L4I A;  4OVL A;  3WXK A;  1L3T A;  2YHW A;  3VTH A;  3VEN A;  2P9S B;  1VAZ A;  3D0P A;  2D0B A;  2P9N B;  1ILY A;  1NGC A;  4O4G A;  5AJ3 K;  4GV9 A;  3MEE A;  4CW7 B;  3DLL L;  2W6L A;  2VWK A;  3DLR A;  4BRI A;  1GOB A;  2ETJ A;  2WOM A;  3EZ5 A;  3K0S A;  1UAX A;  4UY8 O;  3TAQ A;  1U47 A;  1HPZ A;  1RGI A;  5HLF A;  4CIG A;  3PV8 A;  3AVK A;  2Z1G A;  5GAD P;  3AVG A;  5GAG P;  2YJF A;  3B6O A;  1D4X A;  3V9S A;  2HNY A;  3W0L A;  4JK9 A;  1YTU A;  3LAM A;  5KRT A;  1I94 K;  1IBL K;  3G4S N;  4NYF A;  3ALY A;  3HO1 A;  2H3G X;  4MDB A;  2OZS A;  3S9H A;  3R9P A;  3TSP A;  3SMP A;  2NRW A;  3CER A;  3DM2 A;  3OJU A;  4IEI A;  5M1O A;  2KW4 A;  4M3Z A;  1RT2 A;  4AIL C;  1LWF A;  3VEO A;  2YCH A;  4HCB A;  3QNN A;  1A5V A;  1NWK A;  4GVE A;  1C0T A;  4Q0B A;  4BWJ A;  1VQP N;  2XY7 A;  3SAH A;  5JS2 A;  4M3W A;  3TAN A;  5DMR A;  1JCG A;  3GL1 A;  4N56 A;  2IVN A;  2BAN A;  2UYT A;  1YJW N;  3OHR A;  4CZL A;  4JKB A;  1OH8 A;  3BEX A;  1X1P A;  4CZM A;  1D9D A;  4FJG A;  4KBO A;  1EXQ A;  4DR3 K;  2E2O A;  4BRP A;  3V1Q A;  1WSG A;  4RW7 A;  1JLG A;  3KD5 E;  2HF3 A;  3RR8 A;  3S3M A;  1L3V A;  1SL0 A;  4JI4 K;  5KGW A;  4JK8 A;  4OPA A;  1TL3 A;  3SV3 A;  4HUE A;  1NJW A;  2RPI A;  1SKS A;  4DF8 A;  1WAJ A;  4FLV A;  3CCL N;  5FDL A;  1QTM A;  3QFU A;  3HBT A;  4A62 A;  1CLQ A;  3I8D A;  3QET A;  3OVN A;  3IAY A;  1C0G A;  1SKW A;  4LF9 K;  1C1C A;  3CCU N;  3T1Y K;  3SQ0 A;  1NKE A;  4CHY A;  3MDQ A;  3LZJ A;  2VG7 A;  4NLB A;  3I56 N;  1NK6 A;  1RDD A;  3CXC M;  2ZQB A;  1JCE A;  3BUZ B;  3C95 A;  4M42 A;  3NVM A;  3OYM A;  3UIQ A;  1T8E A;  4BE0 A;  1VHX A;  1JJ2 M;  1FK9 A;  4H4M A;  3NF8 A;  5AZI B;  5E41 A;  1NG9 A;  4OGC A;  3LDO A;  4AM7 A;  4AHV A;  3AA3 A;  1HR0 K;  4PQU A;  4CJ5 A;  1OH6 A;  5F1X A;  3TAE A;  2OA8 A;  1JLE A;  4IDH A;  4N47 A;  2O8E A;  2PYJ A;  4JKG A;  4AHR A;  2BE2 A;  2FBX A;  1LOT B;  2E6M A;  3J7Z O;  3ENH A;  2PZS A;  3MXM A;  2HBM A;  3SK3 A;  4CJS A;  1LWE A;  1HNX K;  1Z25 A;  4CZJ A;  3L2U A;  5C10 A;  5ADX H;  3I8B A;  1RT5 A;  3LDL A;  3MED A;  5BPL A;  3G0Z A;  1S1X A;  4M3X A;  4E1N A;  4CFC A;  3T1A A;  1T03 A;  1YAG A;  2Q0R A;  3DYA A;  4B9T A;  4O55 A;  1TVR A;  3MN6 A;  5AQN A;  5JLF A;  2FF3 B;  4C1N K;  3WXM B;  3AO4 A;  1IBM K;  3ULE B;  4YOT A;  4IO8 A;  3MCA B;  1OVQ A;  3M6G A;  1IG9 A;  2X6N A;  4BRA A;  4M63 C;  3C65 A;  4BRC A;  4Z0U A;  4F3T A;  3OYG A;  4GV3 A;  2P51 A;  1B92 A;  2RKI A;  5TKW A;  3NH1 A;  4Q5V A;  3L2Q A;  3J80 O;  4J2B A;  2PAV A;  1XHZ A;  3KZB A;  4Z4I A;  1HNI A;  2E88 A;  4H0O A;  1IKW A;  2G8K A;  4DUY K;  3OTO K;  1GLD G;  5GIN A;  3RR7 A;  3CCE N;  5C15 A;  1Q18 A;  4DV7 K;  3O80 A;  5BRF A;  3DLE A;  2VQE K;  2HST A;  3CQY A;  4Y1C A;  4N5S A;  4O5B A;  4CJR A;  1JLQ A;  1GOC A;  1D8Y A;  4DR2 K;  4DV3 K;  5SWM A;  3QDK A;  3JYT A;  3V6D A;  2QWM A;  4I6M A;  4EZ9 A;  3TSU A;  3ASM A;  3VF2 A;  5AQO A;  4H0T B;  4I9L A;  2OTJ N;  2O8B B;  3F9M A;  1B9F A;  2RE2 A;  1TK8 A;  2A42 A;  4HTU A;  1KTQ A;  4DHY A;  3VES A;  1IKY A;  1HQU A;  2YKM A;  4IG3 A;  4K42 A;  4PKI A;  3O9T A;  4W5N A;  1WSI A;  3IFR A;  4KPY A;  4CHP A;  3A0I X;  3ZT0 A;  3GBT A;  4DSE A;  3WUH A;  1VSD A;  4PY5 A;  2IAJ A;  4M7Y A;  4KRF A;  3NBP A;  3THW B;  1BI4 B;  3LAN A;  4H8K A;  3UKU B;  2HVI A;  3CYM A;  1HJR A;  1KCF A;  3HYF A;  2KFZ A;  4ISF A;  1LW0 A;  4NO7 A;  5A2Q O;  2NZT A;  3AVL A;  4FLW A;  5KPZ A;  3MN7 A;  1RT1 A;  2YI1 A;  4IXC A;  3G25 A;  4F2R A;  3O8M A;  1O13 A;  1U6Z A;  3VF6 A;  4JI7 K;  1VQ6 N;  1RT6 A;  3JSM A;  4JV5 K;  1CZA N;  4YFU A;  5ELZ A;  1LCU A;  3AA5 X;  1S1U A;  2E4L A;  3PUF A;  4H4O A;  4CEE A;  3W3D A;  3WNE A;  1ZBH A;  4FJ8 A;  3AVJ A;  1NJY A;  2XY8 A;  3NGY A;  2A6A A;  2OPR A;  2WON A;  3VQ5 A;  1KAZ A;  3HSC A;  5BR9 A;  3T1H K;  2D0A A;  2YJE A;  3SMS A;  5E84 A;  4FZZ A;  4WFB L;  2HBJ A;  1JCF A;  1ITG A;  1KQS M;  3ULD A;  3TAB A;  1NM1 A;  4PHT X;  1I39 A;  1NMN A;  1UWB A;  3J7A P;  4I6M B;  2VWJ A;  3KTQ A;  1J5E K;  2NRZ A;  3QEW A;  3HI0 A;  1RFQ A;  2UUB K;  3PY8 A;  2O8D B;  1ESV A;  3PIP L;  4E19 A;  4CCH A;  1ASU A;  3TAM A;  2V51 B;  3VQ8 A;  4B08 A;  4W5O A;  3KK1 A;  4CD1 A;  5KPR A;  1XNQ K;  3QIP A;  1R59 O;  3ZCM A;  1GLJ O;  3T19 A;  2KKZ A;  3C7N B;  1C1A A;  1L3S A;  3RMD A;  4DTX A;  5I42 A;  4ID1 A;  5M1F A;  3QIN A;  2P5G A;  3ISN C;  2YKN A;  2E1Y A;  3L4Q A;  3CD6 N; 
#chains in the Genus database with same CATH homology
 3QES A;  2LSN A;  2O4G A;  4AH9 A;  1NK7 A;  3L3V A;  3MXJ A;  4MFB A;  1HYV A;  1A5X A;  1J9A A;  1LAW A;  3IG1 A;  3RMA A;  4W5Q A;  3WNF A;  3AVN A;  4IBN A;  2Z1J A;  2HND A;  4I2Q A;  1WAF A;  3MXI A;  4CHO A;  2HHW A;  3OS2 A;  1VSL A;  2F96 A;  3NF6 A;  4CIE A;  3LWL A;  1KFD A;  4CEF A;  5HP1 A;  5C25 A;  3QO9 A;  2B4J A;  3AVI A;  1A5W A;  4E1M A;  4DTO A;  3NGZ A;  4RW6 A;  3LAK A;  1NK4 A;  2KZM A;  1KLM A;  1EET A;  4FCY A;  1QQC A;  1ZBF A;  2ITG A;  4JLH A;  2XHB A;  5J2P A;  2YHA A;  3SQ1 A;  4KTQ A;  4MQ3 A;  1X9S A;  3KLG A;  4DU4 A;  3CFR A;  4M3T A;  3CM6 A;  4JRQ A;  4BDZ A;  1JXE A;  1HRH A;  4DSJ A;  1ASV A;  1KVC A;  1VRT A;  4DTP A;  4DF4 A;  4F8R A;  3OYK A;  4CHN A;  4DQS A;  1X9M A;  3KLH A;  1RT3 A;  4J2D A;  1NJZ A;  3V9Z A;  4IFY A;  4CHQ A;  2HVH A;  1J54 A;  4CJE A;  4CIF A;  3V9U A;  4CES A;  1VSE A;  3EYZ A;  2BDP A;  1C0M A;  2XRI A;  3OYC A;  3ZSX A;  3KLF A;  3KKS A;  2Q3S A;  3ZSW A;  4PWD A;  3WNG A;  3NDK A;  3SV4 A;  5J2M A;  4FZY A;  3SPY A;  1ZYQ A;  4CK1 A;  4B9S A;  3VQ4 A;  2RF2 A;  4N76 A;  2G8W A;  1S5J A;  1KVA A;  1RTJ A;  1U48 A;  1XHX A;  1D5A A;  4DMN A;  5I3U A;  3DOK A;  4CJ3 A;  4PUO A;  4AHS A;  3QIO A;  3O3F A;  1FKP A;  1TKZ A;  4OVL A;  5HBM A;  3HPO A;  2OYQ A;  4AHT A;  1L3T A;  4KHU A;  4R5P A;  1FKO A;  1WN7 A;  3LP3 A;  4CGJ A;  4CK2 A;  4QAG A;  1JL2 A;  4DFP A;  3VQD A;  4DFK A;  1WSH A;  4Z4F A;  2F8S A;  4Z4E A;  3MEG A;  3VQC A;  3D0P A;  2D0B A;  3U3Y A;  3HST B;  3KD1 E;  4GVM A;  4CE9 A;  2G8I A;  1HMV A;  4LH4 A;  4OLB A;  3M8S A;  2A1R A;  2IS3 A;  4O4G A;  1XWL A;  5KI6 A;  4CER A;  3MEE A;  1UA0 A;  4CJF A;  1RT4 A;  4DQI A;  4E7H A;  3OS1 A;  3OYI A;  4BE1 A;  4FJL A;  2VWK A;  3DLR A;  4OKK A;  1GOB A;  3TAP A;  3H08 A;  2ETJ A;  3CM5 A;  2WOM A;  3KLI A;  3VQ7 A;  4CF0 A;  3EZ5 A;  4B9V A;  2Z1I A;  2HHS A;  1UAX A;  4LD0 A;  3TAQ A;  2DFE A;  3LP1 A;  1U47 A;  3RRG A;  1HPZ A;  3SUQ A;  2PYL A;  3U3G A;  4BWM A;  3HJF A;  4CFB A;  5HLF A;  4CIG A;  3PV8 A;  3QEP A;  3AVK A;  2X78 A;  1EKE A;  2Z1G A;  4C8M A;  2HHX A;  4B9N A;  3AVG A;  3ZSY A;  3AVA A;  3DRS A;  2HMI A;  3B6O A;  3ZT4 A;  3NCI A;  4CEB A;  2HNY A;  3V9S A;  2F8T A;  5FRN A;  1YTU A;  1SUQ A;  3LAM A;  5KRT A;  5KTQ A;  4FLT A;  1NK5 A;  1Y97 A;  4B8C A;  1T7P A;  1JLA A;  3AVB A;  3K2P A;  2E6L A;  4NYF A;  3ALY A;  4TSX A;  4WE1 A;  3L2W A;  4FJ5 A;  3HO1 A;  1RNH A;  2B6A A;  1GOA A;  1BQM A;  4B8A B;  4JS5 A;  2B5J A;  3AO2 A;  2OZS A;  2PY5 A;  4KAZ A;  4UQG A;  1RT7 A;  3S9H A;  2YHB A;  5CYQ A;  3DM2 A;  5HRP A;  1RTD A;  3OJU A;  1QE1 A;  4M41 A;  5EU7 A;  3HM9 A;  3BDP A;  2YNH A;  2A1S A;  3LZI A;  2KW4 A;  2P5O A;  2OPQ A;  1RT2 A;  4DLG A;  4M3Z A;  2NUB A;  1VSM A;  4AIL C;  1LWF A;  2X74 A;  4RW4 A;  1NKB A;  5C24 A;  2G8H A;  3QNN A;  4HCB A;  3NF7 A;  1A5V A;  3F9K A;  3OYA A;  4DTM A;  4KHQ A;  4E89 A;  5D3G A;  5KGX A;  1C0T A;  3K5M A;  4BWJ A;  3DLB A;  4C8O A;  4Q0B A;  4YNQ A;  2XY7 A;  1VRU A;  4C8N A;  3I0S A;  1S1T A;  2IC3 A;  3M8Q A;  5JS2 A;  4Z4C A;  3NGI A;  4KFB A;  4KB0 A;  3TAN A;  4M3W A;  3QER A;  5DMR A;  1JL1 A;  4CF8 A;  3C6U A;  3HP9 A;  3VQE A;  5J2Q A;  1C1B A;  5SZT A;  3OYB A;  2KTQ A;  4N56 A;  2BAN A;  2JLE A;  2XY6 A;  1TV6 A;  4IFV A;  4QCL A;  2YNF A;  4CFA A;  3VN5 A;  4ZHR A;  2HNZ A;  4CJL A;  3HK2 A;  2KZZ A;  5K14 A;  1LV5 A;  4IDK A;  4CJT A;  4DSL A;  3TR8 A;  4NCA A;  4HHT A;  1QHT A;  4RG8 A;  2I5J A;  4FK4 A;  1X1P A;  1T05 A;  1JLF A;  4EP4 A;  3VQ6 A;  1D9D A;  4FJG A;  4AHC A;  4E7K A;  4J2A A;  3T3F A;  4KHW A;  1RBU A;  1J53 A;  1EXQ A;  1UOC A;  4FJH A;  1BIS A;  1U49 A;  4C8L A;  2QK9 A;  1RTI A;  3V1Q A;  2XY5 A;  1WSG A;  4RW7 A;  1JLG A;  2P1J A;  4QOZ B;  3KD5 E;  3AO3 A;  1BIU A;  3P1G A;  4ZTF A;  3RR8 A;  3S3M A;  1L3V A;  3V4I A;  2ZE2 A;  1NJX A;  1SL0 A;  1TKT A;  1CXU A;  4OPK A;  3O3H A;  4E7J A;  4E7L A;  4DS5 A;  1IKX A;  5KGW A;  1NK0 A;  3RWU A;  4DTR A;  1TL3 A;  1W9H A;  3SV3 A;  4GMJ B;  4HUE A;  3AO5 A;  2RPI A;  5T7B A;  4XIU A;  3K58 A;  4DTN A;  1NJW A;  1SKS A;  3P5J A;  1BIZ A;  4K8Z A;  4DF8 A;  1WAJ A;  4FLV A;  3K5O A;  5FDL A;  5CYM A;  4IG0 A;  3V1R A;  3O3G A;  1QTM A;  3P83 D;  1CLQ A;  3L3U A;  3I8D A;  3QET A;  3OVN A;  5HRO A;  1SKW A;  3IAY A;  4Z4H A;  3M8P A;  1RBR A;  1C1C A;  3NE6 A;  1WSF A;  1TGO A;  4FK0 A;  1KRP A;  2YNG A;  3HVR A;  1ZBU A;  1JLB A;  3CG7 A;  3SQ0 A;  1IO2 A;  4CHY A;  1NKE A;  3LZJ A;  4KB1 A;  3HP6 A;  1EP4 A;  2VG7 A;  1NOZ A;  5CZ1 A;  3QEX A;  1NK6 A;  1RDD A;  2ZQB A;  5CZ2 A;  4KO0 A;  3VQP A;  2FBY A;  3C95 A;  4DQR A;  4M42 A;  2W42 A;  3DRR A;  3OYM A;  3UIQ A;  1T8E A;  3NHG A;  1S1V A;  4BE0 A;  3SPZ A;  1FK9 A;  4H4M A;  3CFP A;  3KLE A;  3NF8 A;  4DU1 A;  5E41 A;  3AA2 A;  1RCH A;  3O4N A;  4OGC A;  3NAE A;  4CEO A;  3SUO A;  4AHV A;  3AA3 A;  1WSE A;  3U6F A;  1YTA A;  3KK2 A;  3TAR A;  4L8R B;  4PQU A;  4NCG A;  1HYZ A;  4CJ5 A;  3B6P A;  2G8V A;  4JS4 A;  1S6Q A;  3TAE A;  1SL1 A;  2OA8 A;  2VG6 A;  1BCO A;  3ZSQ A;  4OPJ A;  4K8X A;  1F21 A;  1JLE A;  1G15 A;  1RBV A;  2X6S A;  4RW8 A;  4N41 A;  3OY9 A;  3IRX A;  1N5Y A;  4FXD A;  1DTT A;  3M8R A;  4O0J A;  3ZT3 A;  4N47 A;  4KHY A;  4KKO A;  2PYJ A;  4FJM A;  4AHR A;  3SYZ A;  2BE2 A;  2FBX A;  1RDC A;  1Q9X A;  1MU2 A;  2E6M A;  2IDO A;  2PZS A;  3SQ4 A;  3MXM A;  2G8U A;  1SV5 A;  3LPT A;  3V81 A;  4I2P A;  2GV9 A;  4OLA A;  4M3U A;  3K5N A;  4CJS A;  1IKV A;  3LAL A;  1LWE A;  3OYF A;  3SUN A;  4CEA A;  4FZX C;  4Y1D A;  4CGG A;  4FYD A;  1Z25 A;  4DSI A;  3L2U A;  4FW1 A;  2YNI A;  1BL3 A;  4W5T A;  3VQA A;  4CGD A;  3SNN A;  1RT5 A;  1TK5 A;  4CHZ A;  3MED A;  3K5L A;  4FLX A;  1JXB A;  1KSP A;  1IH7 A;  3G0Z A;  1S1X A;  4M3X A;  4E1N A;  4CFC A;  2VG5 A;  3T1A A;  4PA1 A;  1T03 A;  4FVM A;  4DTU A;  3DYA A;  1DLO A;  4EP5 A;  3OJS A;  1D9F A;  4B9T A;  4O55 A;  1TVR A;  4KTZ A;  1R0A A;  3ZT1 A;  4F2S A;  2KFN A;  1BHL A;  4KHN A;  4W5R A;  3THV A;  1VSJ A;  1XC9 A;  3AO4 A;  4FW2 A;  3C6T A;  2YV0 X;  1N6Q A;  3ZT2 A;  4B9L A;  4M3R A;  2IOC A;  1VSK A;  4DSF A;  1IG9 A;  2X6N A;  3SUP A;  3OYH A;  1HQE A;  2DTU A;  4O0I A;  2Z1H A;  4ELV A;  4B9M A;  1C6V A;  1U04 A;  3SJJ A;  2KQ2 A;  1S6P A;  3PX4 A;  4Z0U A;  4F3T A;  1BI4 A;  3OYG A;  3SI6 A;  3TWH A;  4BDP A;  1NKC A;  1U45 A;  2P51 A;  1VSF A;  1B92 A;  3G10 A;  4CFD A;  2RKI A;  3VQ9 A;  3IS9 A;  3OYJ A;  4J2E A;  2FC0 A;  4CEQ A;  1HNV A;  1RDA A;  3NH1 A;  2FBT A;  3LWM A;  4Q5V A;  4DTS A;  4CJV A;  4DQQ A;  4HUF A;  2HHV A;  1S9G A;  1VSI A;  3L2Q A;  3PO4 A;  4CJ4 A;  1S9E A;  5J2N A;  4J2B A;  4AHU A;  5FRM A;  3ITH A;  4CEZ A;  3KJV A;  1XHZ A;  4ELT A;  4DWI A;  4Z4I A;  4B3O A;  3K59 A;  2HHQ A;  5JS1 A;  1HNI A;  3KIO A;  2G8K A;  1IKW A;  4E3S A;  3EY1 A;  2HHU A;  3QLH A;  3K57 A;  1RTH A;  3AVM A;  4JRP A;  1B9D A;  1YT3 A;  2XO7 A;  3TI0 A;  3DLH A;  1C0U A;  3HPH A;  1RIL A;  1EX4 A;  3RR7 A;  1NK8 A;  3PX6 A;  1KFS A;  2HB5 A;  5J1E A;  4BAC A;  4HCC A;  3LP0 A;  4FJJ A;  3DOL A;  3DLE A;  3VQB A;  4DS4 A;  3QEI A;  4Z4G A;  4G1Q A;  4FK2 A;  4Y1C A;  4N5S A;  4O5B A;  1BCM A;  4CJR A;  3L2V A;  1JLQ A;  4OGE A;  3FFI A;  1GOC A;  1K6Y A;  3VQQ A;  3RMC A;  4IKF A;  3LP2 A;  3NF9 A;  4HUG A;  1TKX A;  1D8Y A;  1QSY A;  5SWM A;  4C8K A;  1J5O A;  4I7F A;  3JYT A;  1CXQ A;  3V6D A;  1TKD A;  2DFF A;  5KRS A;  4CGF A;  4FM1 A;  4EZ9 A;  1L3U A;  3AVH A;  3O4Q A;  4CF2 A;  2QKK A;  1HYS A;  3ASM A;  1X9W A;  2Y1I A;  1NOY A;  3SQ2 A;  1TAQ A;  4I9L A;  2GUI A;  3ZSO A;  2JGU A;  4OKE A;  1VSH A;  5CY4 A;  1WNS A;  2HW3 A;  2EHG A;  4DLE A;  1B9F A;  1DTQ A;  3ZSZ A;  1TK8 A;  4CJW A;  4DFM A;  4CK3 A;  4FJX A;  4HTU A;  1KTQ A;  1S1W A;  4BE2 A;  3RTV A;  1IKY A;  2R7Y A;  1HQU A;  3WNH A;  2YKM A;  3CQ8 A;  4IG3 A;  3PX0 A;  4W5N A;  1XI1 A;  1WSJ A;  2FBV A;  1WSI A;  2OPS A;  4KPY A;  4CHP A;  4FJ7 A;  3ZT0 A;  3SCX A;  4LSL A;  4DQP A;  1L5U A;  3PO5 A;  2D0C A;  3DMJ A;  4DSE A;  1LAV A;  3TAG A;  3OYE A;  3ZSV A;  1LW2 A;  1VSD A;  4PY5 A;  4RW9 A;  3A2F A;  1Q8I A;  2IAJ A;  3DLG A;  4FM2 A;  4LH5 A;  4KRF A;  3OS0 A;  3F73 A;  3V1O A;  3HT3 A;  3RRH A;  4CJU A;  4LY7 A;  2OZM A;  3L8B A;  3NBP A;  2HHT A;  1BI4 B;  3LAN A;  3DRP A;  4CJK A;  3NFA A;  1UA1 A;  3HPG A;  3MEC A;  4H8K A;  3SZ2 A;  3CYM A;  1HJR A;  4HVJ A;  3OYL A;  4DU3 A;  1KCF A;  4DTJ A;  2HVI A;  3HYF A;  2KFZ A;  1LW0 A;  2AJQ A;  4M45 A;  3AA4 A;  3V9X A;  4FLZ A;  1RDB A;  2GBZ A;  4M3Y A;  3AVL A;  1O1W A;  3HVT A;  4OKJ A;  4FLW A;  4FJ9 A;  4ICL A;  2IGI A;  1Q9Y A;  1QSS A;  1LWC A;  1W0H A;  3HXM A;  4ID5 A;  1SL2 A;  1RT1 A;  4FLU A;  5HRS A;  4NCB A;  3L2R A;  3KK3 A;  4KI4 A;  3QEV A;  5HRR A;  4EZ6 A;  1TL1 A;  3KKR A;  3VA0 A;  3RMB A;  3S3O A;  5C42 A;  1RBT A;  3S3N A;  4F2R A;  2D5R A;  4FJI A;  4NYN A;  5DK5 A;  3AV9 A;  1U4B A;  4O44 A;  4I9Q A;  2QKB A;  1RT6 A;  4CEC A;  3C94 A;  3JSM A;  4DFJ A;  4OJR A;  2EX3 A;  1QSL A;  2QXF A;  4KTW A;  4YFU A;  4KRE A;  3AVF A;  2RN2 A;  1FXX A;  1S1U A;  2E4L A;  3AA5 X;  3DLK A;  3PUF A;  4H4O A;  4CEE A;  2G8F A;  2DY4 A;  1BQN A;  3WNE A;  3TAF A;  1ZBH A;  4FJ8 A;  3V9W A;  3AVJ A;  4GW6 A;  3VA3 A;  4F3O A;  4CF9 A;  1NJY A;  2XY8 A;  3NGY A;  1BGX T;  2OPR A;  2WON A;  3HL8 A;  1NK9 A;  4CGI A;  3I0R A;  3VQ5 A;  4CF1 A;  3QNO A;  1KLN A;  3LPU A;  2D0A A;  2Y1J A;  4FZZ A;  4FJK A;  3LDS A;  1TK0 A;  2O4I A;  4KHS A;  4CGH A;  1ITG A;  2OPP A;  3ULD A;  3TAB A;  4FLY A;  2DFH A;  1JLC A;  1ASW A;  1Z26 A;  3CFO A;  1I39 A;  1UWB A;  3E01 A;  3DI6 A;  3ZSR A;  1CZ9 A;  4E7I A;  4BDY A;  4F4K A;  2VWJ A;  3D45 A;  5HRN A;  3KTQ A;  3AVC A;  1QS4 A;  2ATQ A;  3QEW A;  3AO1 A;  1VK0 A;  4ZTJ A;  3PY8 A;  4KV8 A;  4CJP A;  4E19 A;  4E0D A;  3BGR A;  4CCH A;  1ASU A;  3TAM A;  3VQ8 A;  4B08 A;  4W5O A;  1SKR A;  2BGG A;  1TAU A;  3OYN A;  3NH0 A;  3KK1 A;  4ELU A;  2ZD1 A;  1YVU A;  3QIP A;  1JKH A;  4CJQ A;  4CED A;  4DG1 A;  3ZCM A;  1I3A A;  3T19 A;  3OYD A;  1CZB A;  4FM0 A;  4B9U A;  3NH2 A;  4DSK A;  1WLJ A;  1C1A A;  1ZBL A;  5FRO A;  4FJN A;  1L3S A;  4LSN A;  4DTX A;  1RBS A;  3RMD A;  4ID1 A;  5I42 A;  4KI6 A;  3QIN A;  2P5G A;  1KVB A;  3ISN C;  2YKN A;  1ZBI A;  3MAQ A;  1REV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...