2GUIA

Structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
176
structure length
176
Chain Sequence
ITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA polymerase III epsilon subunit
publication title Structure and Function of Cyclized Versions of the Proofreading Exonuclease Subunit E. coli DNA Polymerase III
rcsb
source organism Escherichia coli
total genus 58
structure length 176
sequence length 176
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2guiA00
3DI6A 4CESA 1TKTA 5HROA 1NK6A 1JLEA 3NAEA 3K5NA 3HXMA 2BGGA 2XY8A 1WSEA 3K59A 1BQMA 5C24A 1NK7A 4M3TA 3DLKA 4F3OA 5HP1A 1WLJA 3AO5A 1SL0A 4DF8A 4CGDA 4DS5A 2YKNA 2VG6A 3ZT4A 4Z4HA 1RT7A 3NH2A 3OYAA 3RMAA 4CIEA 4IG3A 3C6TA 3H08A 4CEAA 4KRFA 4B9VA 1HQUA 1RBRA 3TABA 3OYEA 2OPSA 4C8OA 4E19A 1Q9YA 3TAMA 3UIQA 4DTNA 3THVA 1FK9A 3P5JA 1NK4A 4FCYA 1X9WA 1S9GA 1ZBUA 4IKFA 1G15A 3DLBA 4KI6A 5SWMA 1S1TA 1LAVA 1TV6A 3QEXA 3NGYA 3HPOA 1I39A 4OVLA 5DK5A 3DLRA 4KAZA 4LD0A 1QSSA 1RBVA 1L3VA 4I9LA 3LALA 4M3XA 2PYLA 4E7LA 3ZT3A 4KHNA 3PV8A 4CEDA 4J2DA 4CJKA 4BWJA 4CF9A 4DTJA 4ZTFA 5FRMA 3VQ8A 4K8XA 3PUFA 1IG9A 4BE2A 2HHTA 1XI1A 4M41A 4JRQA 4AHCA 2Y1JA 4F2RA 1EX4A 3F9KA 1HMVA 2WONA 4CJ5A 2YV0X 1RDBA 1NKEA 3QINA 2HHSA 4Q5VA 3K2PA 3L2RA 2F8SA 4B8CA 3T3FA 1Y97A 3ZT2A 3L2VA 3G10A 3NF6A 4L8RB 3NHGA 3HL8A 3D0PA 3SV4A 1SV5A 2E4LA 4PA1A 4E3SA 2PYJA 3HJFA 2BE2A 4CF8A 1RBTA 1JL2A 4FK0A 2DY4A 1VSLA 2E6LA 1S6PA 1TKDA 3ZSXA 3O3GA 4DQIA 3G0ZA 3V1OA 4NCAA 5FRNA 4FYDA 2OPRA 1TL1A 1HNVA 3QNOA 4ELVA 4Y1DA 1FKPA 1B9DA 1RILA 5T7BA 2QK9A 1IKYA 4KHSA 1TAQA 4RW9A 4CHQA 4CJFA 1EETA 3OYDA 2YNGA 3ZT1A 4CEQA 3RR8A 1DLOA 1EXQA 1KLMA 1QQCA 1RT5A 4ZTJA 3TAGA 3PO5A 3MEEA 3IG1A 1SKWA 2PZSA 4KTQA 2HHQA 1WNSA 5JS1A 2WOMA 5FROA 3NFAA 3ZCMA 1GOAA 3KKSA 1X9MA 1S1WA 2HHVA 4CEEA 4NCBA 1VSJA 1BGXT 2O4IA 3P83D 1C0UA 5C25A 4E7KA 2FBVA 2NUBA 3AVFA 3OYCA 3V9XA 1NOZA 4RW4A 4H8KA 4FM2A 2PY5A 1LAWA 1NK9A 4E7JA 1TKZA 3NH0A 2ZD1A 4O0JA 3K5LA 4I9QA 1CXQA 2XHBA 4GVMA 3VQ9A 4Z4CA 1S1XA 1TGOA 4NYFA 3OYLA 3SNNA 1UAXA 1IH7A 1BCMA 4CEOA 4CHPA 1QS4A 3CFPA 4FLZA 4FJ5A 4FK4A 1YTUA 2EHGA 1C1BA 1CZBA 1VRTA 1W9HA 1T03A 4KB0A 4LH4A 2LSNA 1XHXA 4DWIA 3AVIA 2YNFA 3I0RA 3VA3A 3SZ2A 2D0CA 1ZBIA 1WSHA 1LW2A 4KREA 3VQAA 3QEPA 1T05A 4XIUA 4F3TA 3K57A 2DFFA 1EKEA 1VSIA 2X74A 4J2EA 5CZ2A 2GUIA 2Y1IA 1I3AA 3O4QA 4QAGA 4BACA 3OYIA 2FBTA 1J5OA 4O4GA 3L2WA 2FBYA 3QETA 3OJSA 5K14A 4FJIA 1HQEA 3ZSVA 3AVJA 1VRUA 5KRSA 1L5UA 3PO4A 4Z4FA 5CY4A 4FLYA 4KFBA 3C6UA 4K8ZA 3V9ZA 2HMIA 2DFHA 3AVLA 1WSJA 4RW7A 4CJQA 4IBNA 2G8FA 4CK3A 1GOCA 4FW2A 3IRXA 3MECA 3AVBA 1TK0A 3C94A 3B6PA 4E1MA 1HYZA 3FFIA 4DFPA 1NJWA 4FJ9A 1RT4A 4AHTA 3IS9A 2DFEA 4CIFA 4EZ9A 4CF0A 4EP5A 3SQ0A 5I3UA 1S6QA 4J2AA 1DTTA 1T7PA 5HRSA 4CEBA 4E7HA 1ZBHA 4KI4A 3ZSWA 4I7FA 4ICLA 5J2NA 4B3OA 2FBXA 2Z1JA 3DLGA 4FM0A 3SYZA 3VQ5A 4N47A 2A1RA 3JSMA 1DTQA 1IKWA 1GOBA 3DRRA 2OPQA 3VQEA 4AILC 4FVMA 4CIGA 5KGXA 3LDSA 4FJHA 4OLBA 3QIOA 4CFAA 4CF2A 4DSLA 3BGRA 2JGUA 3AA4A 3QLHA 1LWEA 1HYSA 4HHTA 4LY7A 4FZYA 3MAQA 1ASVA 2D0AA 1J53A 1IO2A 3QEWA 3CM5A 3HP9A 3NGZA 4BDZA 3SUOA 3VQ4A 3S3NA 1UA0A 2P5GA 3HP6A 1L3TA 4KPYA 3ZSYA 1ZBLA 4DSJA 4DTOA 1SKSA 3QNNA 1SL1A 2X6SA 3ZT0A 1JLBA 4O44A 3K58A 4BE0A 2GBZA 3AVCA 3OVNA 2Z1HA 2G8VA 1SUQA 2I5JA 4ID1A 1C1CA 2R7YA 4O55A 1C1AA 1ZBFA 3AA5X 1HJRA 4F8RA 3RWUA 5C42A 1UA1A 3QESA 2KTQA 3DLHA 1LV5A 1NK5A 3EZ5A 1Z25A 1KTQA 2IAJA 4OKEA 4N41A 3SPZA 4AHSA 4CJWA 4TSXA 5I42A 4E89A 4B9TA 2P51A 2VG5A 3JYTA 4CGJA 1Z26A 4BWMA 3HVTA 1JLCA 1HPZA 1WAFA 2ATQA 1BL3A 4H4OA 4JLHA 3T19A 4AHRA 4N76A 4CJTA 3LP0A 4CHOA 3M8PA 4DSFA 1C6VA 3TAEA 1BQNA 1O1WA 3LPTA 4KB1A 2HW3A 1WSGA 1ASWA 4OLAA 3LP1A 4W5RA 2HVIA 2RF2A 4IFVA 1W0HA 2KZZA 2B5JA 1CZ9A 3V4IA 4Y1CA 4DFJA 4O0IA 4CK1A 4EZ6A 1RDAA 2VWJA 4OGEA 3KK1A 3ZSRA 2OPPA 1RTHA 1TVRA 4DLEA 3RMDA 1HRHA 3SQ2A 2X6NA 1NK8A 4C8MA 3M8SA 4JS4A 3KJVA 2FC0A 1XHZA 4F4KA 1JLAA 2HHUA 3DRSA 3NF8A 2XY5A 4J2BA 1VSMA 4IFYA 4OKKA 3TAFA 4B8AB 5CZ1A 2JLEA 2A1SA 3AVKA 3V1RA 2EX3A 3QO9A 4CGHA 4CGIA 3ISNC 3OS2A 3KTQA 4DSKA 1TAUA 4B9UA 3AVHA 3O3FA 3EY1A 3AVAA 1NJXA 5KRTA 3CM6A 4M3YA 2W42A 2Z1GA 2IS3A 4EP4A 1NKBA 2O4GA 4Z4EA 4RW6A 1UOCA 1U45A 4CJUA 3HYFA 3CFRA 4GW6A 3AV9A 3DM2A 3U3GA 2XRIA 3NCIA 2D0BA 4CEFA 4DQSA 1TK5A 3OYGA 3KLHA 3K5MA 1SKRA 3OY9A 1RBSA 5KTQA 4CJPA 3WNGA 3QERA 5HLFA 4CHZA 3VA0A 3PX0A 4HUFA 4CFBA 4CK2A 4B9MA 4YFUA 2HNDA 3OYKA 4HUGA 4Z0UA 3QEIA 3MEGA 1YVUA 3WNEA 2G8IA 1A5XA 1BCOA 2E6MA 3SQ1A 3V9SA 4NCGA 3SQ4A 4JS5A 4OPKA 3MXJA 1CXUA 1NKCA 5HBMA 1N6QA 1VSEA 3HPGA 4RW8A 4W5OA 1VSDA 3EYZA 2XO7A 3RMCA 1QTMA 1QSLA 3SCXA 3SI6A 4FJ8A 2IOCA 3OS1A 3V6DA 1R0AA 2DTUA 3NGIA 2F8TA 4DLGA 1VK0A 3OYNA 4DU4A 3K5OA 4DTXA 1RDDA 4PY5A 4E7IA 4OPJA 2P5OA 1U47A 2VG7A 1SL2A 2OA8A 3OJUA 4KHYA 3OYBA 3HPHA 3ZSOA 3KLEA 1NJYA 3SUPA 4FZZA 4CF1A 3V81A 1VSFA 1HNIA 2AJQA 1X9SA 3ALYA 2G8HA 1B92A 1KVAA 1UWBA 3L3VA 3MEDA 4FJNA 1RT6A 2YHBA 3ITHA 2HNZA 1B9FA 4AHVA 3WNHA 3TANA 3NDKA 3DOKA 4O5BA 3RTVA 3L2UA 2HVHA 3ZSZA 4DTPA 2Z1IA 3SJJA 4BDPA 4FJXA 4FJJA 3V9UA 4M3WA 4M45A 3IAYA 3LZIA 2YNHA 3WNFA 3OYMA 1RT3A 1NJZA 2BANA 3AA3A 3TR8A 1ASUA 4DSEA 4OGCA 4F2SA 3OS0A 3HK2A 3HM9A 1L3UA 2BDPA 3KLFA 3SPYA 4M3ZA 1JKHA 4CJ4A 1JLQA 3AA2A 3KK3A 2KFNA 4DQQA 3RMBA 3KLGA 2B6AA 3P1GA 5FDLA 3LWMA 1U04A 2YNIA 1X1PA 4OJRA 1C0TA 1KVCA 4CGGA 1U4BA 1QE1A 1WSFA 3MXMA 3NBPA 4M3UA 1KVBA 3VQBA 3S9HA 4C8NA 3L3UA 3T1AA 1U48A 1TKXA 3KD1E 4DU1A 1EP4A 4N5SA 3L2QA 1D9DA 4CJSA 1KRPA 3AO2A 1FKOA 3A2FA 1CLQA 4I2PA 1JL1A 3TWHA 4FM1A 4CHNA 2Q3SA 1KCFA 4M3RA 4LSLA 3S3OA 1Q9XA 4M42A 4FLXA 3HO1A 2ZQBA 4N56A 1LW0A 4ID5A 3VQCA 4FZXC 5CYMA 4DSIA 1BISA 2IDOA 4H4MA 2OYQA 3AO3A 3NH1A 1XC9A 2B4JA 4CJRA 1RCHA 3D45A 3DRPA 3LPUA 4MFBA 2G8UA 3O4NA 1JLGA 3QIPA 4HCBA 3CFOA 1KFSA 4CJ3A 4KHWA 4KHQA 4E0DA 3HSTB 3CYMA 4HTUA 1K6YA 2GV9A 3BDPA 3SUNA 4ELUA 2RN2A 3KKRA 1KLNA 3TI0A 3V1QA 4C8LA 4BDYA 2IC3A 4PQUA 1A5VA 1U49A 3KIOA 4FLTA 1BIZA 1NOYA 3F73A 1RBUA 2G8KA 4KTWA 2KZMA 1LWFA 1YT3A 3KD5E 4DQPA 4KV8A 4Z4IA 1WN7A 4DTUA 4Q0BA 1RTDA 3VQ6A 4BE1A 4JRPA 4DS4A 3ZSQA 4Z4GA 1ZYQA 3VQQA 1ITGA 4KO0A 1KSPA 2HB5A 3OYJA 4FLUA 5J2QA 4KKOA 1VSKA 3HT3A 3V9WA 1VSHA 4NYNA 5JS2A 3VQDA 2G8WA 2YHAA 1YTAA 4C8KA 2XY7A 4CHYA 4LSNA 4WE1A 4FJ7A 3TAQA 4DFMA 3LAKA 5HRNA 5HRRA 4W5QA 4CCHA 2QXFA 4LH5A 4CJVA 1WSIA 3LP2A 4CFCA 2QKKA 5HRPA 4DTRA 1XWLA 4YNQA 1RTJA 4CECA 3PX6A 4HVJA 1MU2A 5SZTA 4FK2A 1REVA 3C95A 2YKMA 3I8DA 4DQRA 3PX4A 2HNYA 4B9LA 1J9AA 2P1JA 1RT1A 1RT2A 1S1UA 2IGIA 2RPIA 3M8RA 4DTMA 4B9SA 1TL3A 4DG1A 4FLVA 3SUQA 1JLFA 4FW1A 3AVMA 2OZMA 1C0MA 3NF7A 1J54A 3U3YA 1L3SA 4KTZA 2D5RA 4W5NA 4G1QA 5J2PA 3PY8A 4I2QA 3OYFA 3DMJA 2XY6A 4QOZB 4CEZA 1QSYA 2OZSA 4FJKA 3E01A 3KLIA 2X78A 3M8QA 2ITGA 4CJLA 1A5WA 3DLEA 4E1NA 4UQGA 4ZHRA 4CERA 1JXBA 4CJEA 4R5PA 4IG0A 3LP3A 3HVRA 3QEVA 5D3GA 3TARA 2ETJA 3CQ8A 1BIUA 3OYHA 4B9NA 3DOLA 3LAMA 3RRHA 2KQ2A 3VN5A 3NE6A 5EU7A 1IKXA 3ULDA 4IDKA 3AO4A 4W5TA 1BI4A 1BHLA 3AVNA 3L8BA 4QCLA 2HHXA 5E41A 1BI4B 1RDCA 3LWLA 5J2MA 4FJLA 1JXEA 1KFDA 4OKJA 5J1EA 4KHUA 3CG7A 3O3HA 3ASMA 4DTSA 3RRGA 1S5JA 4B08A 1N5YA 3NF9A 5KI6A 4DFKA 3TAPA 3LZJA 2RKIA 4MQ3A 2KW4A 4FLWA 4ELTA 1TK8A 4PUOA 1NK0A 4GMJB 3RR7A 4AH9A 4HCCA 1IKVA 1S1VA 5CYQA 1D8YA 5DMRA 2QKBA 1S9EA 1HYVA 3DYAA 4PWDA 4CE9A 3KK2A 3VQ7A 4CFDA 1WAJA 3SV3A 1T8EA 1D5AA 1RTIA 3LANA 2HHWA 2ZE2A 4FXDA 1D9FA 4DMNA 3U6FA 3S3MA 1LWCA 4DU3A 5KGWA 1Q8IA 2KFZA 1F21A 3AVGA 2VWKA 3MXIA 4DF4A 4HUEA 4CGFA 3AO1A 1RNHA 2F96A 3I0SA 4RG8A 3B6OA 4AHUA 4FJMA 1QHTA 3VQPA 1FXXA 4FJGA
chains in the Genus database with same CATH superfamily
5AQKA 3DI6A 1TKTA 4CZEA 5HROA 1JLEA 2HSTA 3HXMA 3O4WA 3VEVA 4YY3K 2A40A 1WLJA 1NGCA 4JKHA 2YKNA 2UYTA 3RMAA 1RGIA 5AR0A 2NRHA 3LDLA 4IJAA 3C6TA 3H08A 4CEAA 4KRFA 1RBRA 4B1WB 1XMQK 4K42A 4E19A 1Q9YA 3TAMA 3CCJN 4RWTA 2HBJA 5AQFA 3H3OB 3P5JA 1NK4A 2E1YA 4KI6A 3MN7A 3IFRA 2QWRA 1S1TA 4EHTA 4IXCA 3QEXA 5DK5A 4YDUC 3DLRA 3KWGA 4IO8A 4LD0A 1RBVA 3O9RA 2V51B 3LALA 4M3XA 4DV2K 4KHNA 4CEDA 4NO7A 4U67L 4CJKA 3I33A 4CF9A 4ZTFA 4DKWA 4FVUA 2P9UA 3PUFA 5TKYA 1IG9A 2HHTA 4JKCA 4M41A 4A61A 4AHCA 2Y1JA 4F2RA 4FWPA 1X3NA 1S3XA 2F9WA 4CJ5A 3TPQA 2D0OA 1XMOK 3VF2A 2HHSA 4Q5VA 2Q97A 2GELA 3L2RA 3R6MA 3T3FA 2P9NA 4JI0K 3H1VX 3D0PA 2E4LA 2F9TA 4H0OA 3UKUB 3EL2A 2GWKA 2BE2A 1IBKK 4FK0A 2DY4A 1VSLA 5BRDA 1OH8A 3SJHA 3CCRN 3SK3A 3O3GA 3MK6A 4FYDA 4PL8A 1TL1A 3TTDA 1RILA 1IKYA 1TAQA 4ILHA 2OANA 3ZT1A 4CEQA 5AZJB 1QQCA 3TAGA 5LL6Z 2KKZA 2PZSA 2ASOA 1VQ4N 3FLCO 5JS1A 1GOAA 2HHVA 2O4IA 3O9QA 1C0UA 2NUBA 3AVFA 3OYCA 1K73O 4DV4K 4LF7K 2P9PA 3NH0A 4O0JA 1U2VA 3VQ9A 4Z4CA 1VQ9N 1S1XA 4NYFA 2NLXA 3SNNA 3CFPA 4FK4A 1YTUA 4FJ5A 1VRTA 1CZBA 1VQPN 1XHXA 4KREA 2X74A 5IWAK 3HBTA 5CZ2A 4YHHK 5C10A 5AQNA 1HQEA 1TUYA 3ZSVA 3PSIA 1L5UA 4Z4FA 3VMFB 1BU6O 2DFHA 1KXPA 1K9MO 2I7PA 4H0XB 1VQON 2G8FA 4CK3A 4FW2A 3C65A 3HM8A 3IRXA 3MECA 5M1OA 3HOSA 5JVHL 4EP5A 4J2AA 3Q7BA 1T7PA 1KC8O 4ICLA 5J2NA 2HMPA 3UKRB 2Z1JA 4FM0A 3SYZA 3RSEB 3VQ5A 2A1RA 1GOBA 3VQEA 2OPQA 4AILC 1W2BM 4DV1K 4OLBA 3QIOA 4CFAA 4DSLA 3QLHA 4WF9L 4BRAA 4HHTA 4FZYA 4NXMK 2HBLA 3MAQA 3VOVA 3CM5A 4JKEA 1UA0A 4WYBA 3HP6A 1Q86O 4KPYA 2J4RA 3ZSYA 1ZBLA 3SAFA 1SKSA 2A42A 1E4GT 4BRPA 2CGJA 3AVCA 1SUQA 2R7YA 4O55A 1C1AA 1ZBFA 3QBXA 3O9SA 5C42A 1UA1A 2KTQA 1Z25A 4OKEA 4N41A 2FSNA 4JK8A 4B9TA 2P51A 2OTJN 3PIPL 4CGJA 1Z26A 4BWMA 1P8ZA 2VWBA 3AARA 1OH7A 2ATQA 1P90A 1WAFA 3RVCA 4CJTA 4CHOA 3UKUA 1BQNA 1O1WA 1NGDA 1WSGA 1ASWA 3OW2M 2HVIA 4IFVA 1W0HA 1CZ9A 1DT9A 4O8KA 3AGRA 2VWJA 4JI1K 5JLHA 1TVRA 3RMDA 1NK8A 3QFPA 2P9LB 4F4KA 2FC0A 1KAZA 2HHUA 3VGLA 5EX5A 2W6LA 1Q81O 5AZJA 4OKKA 4FWKA 4CGHA 4DSKA 3O3FA 1ATSA 3EY1A 4YOYA 5KRTA 2GX9A 3MX2A 2Z1GA 2ZGYA 2O4GA 1Q7YO 3U3GA 3ZX0A 1SKRA 4CHZA 3PX0A 4CFBA 3M6GA 3OYKA 4HUGA 2G8IA 4DCHA 1A5XA 1BCOA 3SQ4A 4Z94A 3MXJA 3HPGA 4RW8A 3EYZA 4GKJK 4KH5A 2XO7A 2DTUA 4WQ4C 4X66K 1VK0A 4PY5A 4E7IA 2VG7A 1NG9A 1NGBA 4CW7B 4H0TB 3KLEA 4WQ5A 1HNIA 4CBXA 1VQLN 4LF8K 1B92A 4FJNA 2HNZA 3LDPA 4JNEA 3WNHA 5KQ8A 3NDKA 5KPRA 3GG4A 3ZSZA 2Z1IA 3I56N 4DR3K 4M45A 4WFNL 1GLEG 1RT3A 2BANA 3J80O 1ASUA 5M1PA 4OGCA 2P9SB 2DPNA 3LM2A 2BDPA 5GIPA 3KLFA 4JKGB 3O80A 3KK3A 2KFNA 4FWNA 3UKRA 4MO5A 1D4XA 2B6AA 4BR5A 3RSEA 3LWMA 1N34K 2A41A 3J7AP 2YNIA 2O8CB 1C0TA 1KVCA 2VGNA 1U4BA 4DR7K 4M3UA 3L3UA 4EAHD 3TTCA 1TKXA 3UB5A 1T6DA 2ZM6K 4YOUA 3A2FA 4I2PA 5BPMA 1WBBA 1KCFA 3VETA 2E2QA 3DWLA 3O9UA 1LW0A 4A57A 4ID5A 1BISA 2IDOA 5LMNK 3D45A 3LPUA 2G8UA 2ZGZA 4CZHA 3CFOA 2VYPA 3VF4A 4KHQA 4AM7A 1K6YA 4ELUA 1IG8A 4BDYA 1Q82O 1A5VA 2E5LK 1BIZA 5LJVA 1RBUA 1NGEA 1LWFA 2YCHA 4KH4A 4DQPA 4KV8A 4Z4IA 1FJGK 2NRRA 1RTDA 3U4LA 4Z4GA 1ITGA 2P9LA 5JLFA 3OYJA 4BREA 1VSHA 3E9PA 5JS2A 3VQDA 2YHAA 1M1KO 4LSNA 4WE1A 2FF6A 4FJ7A 5C0YA 5HRNA 4BRQA 1BWFO 4BRNA 2A3ZA 5HRPA 4DTRA 3TTFA 4CECA 1VAZA 4KH6A 3FZHA 2Q1NA 2YKMA 3I8DA 4BC5A 1J9AA 4DTMA 2IGIA 1TL3A 1MDUB 3SUQA 1HLUA 3AVMA 4FW1A 3VGKA 5CHIA 1VQNN 1C0MA 1L3SA 2D5RA 3CCQN 4W5NA 1HKBA 5J2PA 2HHHK 4I2QA 3OYFA 2XY6A 4FJKA 3E01A 1YJ9N 4GVEA 1GLJO 4CERA 2KHOA 1Z6RA 5D3GA 4FWLA 2ETJA 1T6CA 3OYHA 4B9NA 4BR9A 3E1YA 1NU0A 3WQUA 3C0BA 2KQ2A 5EU7A 1IKXA 3BF1A 1BI4A 1BHLA 4MLHA 3R8EA 3L8BA 2HHXA 3LWLA 5J2MA 4FJLA 1KFDA 3P31A 3ID6A 1N5YA 3T7ZA 5AQLA 4DR4K 3TAPA 2RKIA 2YHYA 4GMJB 1J6ZA 4FWSA 4AH9A 4HCCA 1IKVA 1GLLO 1S1VA 2YHXA 2ZJRL 1HYVA 3DYAA 4C1NI 4PWDA 3SV3A 1D5AA 2HHWA 3HTVA 2P9SA 3OTOK 4JKGA 1F21A 4OPHA 3AVGA 2VWKA 1U6ZA 3MXIA 1NMNA 3CI5A 4DF4A 1Y64A 5EVZA 4AHUA 3SZ2A 1QHTA 1FXXA 3L2VA 4FJGA 2O8CA 5GAEP 1NK6A 3NAEA 1DKGD 3MDQA 3H6EA 2XY8A 5HOOA 1QVGM 1BQMA 5M1FA 1NK7A 4MDBA 3CD6N 3MWPA 2VG6A 5AQUA 4Z4HA 1RT7A 3OYAA 3CF5L 4CIEA 1N8RO 4G9ZA 3QMLA 4A59A 5BN9A 3UIQA 3A5OC 4IOXA 1S9GA 1X9WA 4IKFA 4UY8O 1BOTO 5SWMA 1LAVA 4OVLA 1GLFO 2Q0RA 2NRTA 1SQKA 1L3VA 4I9LA 3C6AA 3CJBA 3PV8A 4J2DA 2WFBA 2Q31A 1I94K 1NGGA 4BRDA 1KD1O 5AQYA 3QB0A 3D7EO 4JRQA 1XQSC 3ZEUA 3F9KA 4JHDB 3THYB 2WONA 4B3TK 2VCPA 3QINA 3K2PA 4JK9A 2F8SA 4B8CA 3ZT2A 3G10A 2ZJQL 3SV4A 2PYJA 4JV5K 4JKBA 1SZ2A 4OPAA 2E6LA 2HBKA 4YOXA 4KBOA 5AQGA 1WBDA 1YITN 3VF6A 1HNVA 3QNOA 4Y1DA 5T7BA 5M1KA 3WXJA 3AAQA 4KHSA 2Q36A 4CJFA 2UUBK 1EETA 3MEEA 3IG1A 1GLAG 1SKWA 1VQ6N 1HNWK 4KTQA 3BY5A 4KHPK 2HHQA 1WNSA 4CEEA 1BGXT 3P39A 3O1WA 4E7KA 3AGKA 4BR4A 3V9XA 4DV3K 1NOZA 2PY5A 4FM2A 2V7YA 1XUPO 1UAXA 1JCGA 1BCMA 4CEOA 4CHPA 1QS4A 2EHGA 1T03A 4KB0A 1T44A 4YOTA 4LH4A 1DEJA 2LSNA 4DWIA 3G4SN 1ZBIA 1EO1A 4WFBL 1K8KB 1WSHA 4NXNK 5FLXO 4F3TA 1HR0K 1VSIA 4J2EA 1NGAA 2O8EB 2FF3B 4GY2B 2Y1IA 4FOEA 5AJ3K 4PKGA 2FBYA 2QWLA 4FJIA 5C15A 5KRSA 5CY4A 4FLYA 4KFBA 2V7ZA 1C0FA 1WSJA 4CJQA 4IBNA 4PKIA 3CCUN 3ZLJA 2FSKA 3EKSA 4FL9A 4DFPA 1NMDA 4EZ9A 2W40A 4CZMA 4CF0A 3C6HA 4BG9A 5HRSA 4ISGA 4H03B 4KI4A 3ZSWA 4I7FA 4B3OA 2VQEK 5AQQA 3HI0A 3O1BA 4MLEA 3HZ6A 2OTLN 3AA4A 1HYSA 1LWEA 1HPMA 4LY7A 2HF4A 4PHTX 2D0AA 3S3NA 4BDZA 3VPZA 3HRGA 5IT9O 1L3TA 4GV6A 4DSJA 4CBUA 3OBYA 3ZT0A 1JLBA 4X62K 3K58A 2FLOA 4BE0A 3OBWA 2Z1HA 4BRCA 4ID1A 3EKUA 2CH5A 4LF6K 4NLBA 1QZ6A 4JHDA 3THYA 3RWUA 3QESA 3DLHA 1M90O 2NRXA 3SPZA 3BEXA 3HVTA 1JLCA 3MCAB 4DSFA 3LP0A 3SAHA 3M8PA 5EY4A 1C6VA 3LPTA 2HW3A 1WB9A 5FPMA 5E26A 1W97L 4C23A 4DR1K 3LP1A 3BUZB 2B5JA 1YVNA 4Y1CA 4O0IA 4BQLA 3ZSRA 1KQSM 1RTHA 3WXKA 2X6NA 3C7NB 4C8MA 1JLAA 3DRSA 2XY5A 4BR2A 1VSMA 3CQXA 4B8AB 5CZ1A 2JLEA 4CGIA 3V1RA 1W7AA 3VERA 1QQNA 3KK7A 3LDOA 3CM6A 4EP4A 1U45A 3CCEN 4CJUA 3CFRA 3AV9A 1GLBG 4DQSA 2FSJA 3K5MA 4XH1A 4WCEL 3EEQA 4CJPA 5LY3A 3WUHA 4HUFA 2HNDA 3WNEA 1RDWX 3A8YA 4BRKA 1VQMN 4NCGA 3BZKA 1K8KA 1JCEA 1VSEA 4W5OA 1J5EK 1VSDA 5EOYA 3WEEB 1QSLA 3SI6A 4LF9K 2O8EA 4B3RK 4EHUA 3ENOA 2Q0UA 5C12A 1SL2A 2OA8A 3FZLA 3OYBA 2NRZA 3HPHA 3O8MA 3V81A 3FZKA 1RT6A 2YHBA 5BRHA 2W41A 1B9FA 4AHVA 4O5BA 4BDPA 3V9UA 4BRIA 4DR5K 3LZIA 3OYMA 3AA3A 1Z05A 4BR0A 4FPAA 3OS0A 4F2SA 3HM9A 1EQYA 1HKGA 4H0PA 3F9MA 3GE1A 3RMBA 5FDLA 2IVOA 4B3SK 2UXCK 4LC9B 1QE1A 1WSFA 4FWOA 3MXMA 3NBPA 3CC4N 3S9HA 1VQ7N 3KD1E 4DU1A 2O8FA 3U9DA 2AA4A 4H0YB 4N5SA 4LFAK 3A0IX 4CJSA 1KRPA 1FKOA 5ADXH 4DV6K 3PLAA 3TWHA 1IJJA 3WT0A 2ITMA 4M3RA 4CZKA 1K8AO 2P9KA 3S3OA 1Q9XA 4FLXA 4LFCK 2E2NA 2ZQBA 4IZ9A 4H4MA 1MA9B 2B4JA 4CJRA 1RCHA 4MFBA 1ESVA 3L0QA 4KHWA 4E0DA 5C2FA 3SMPA 2RN2A 3TI0A 4C8LA 4PKHA 5CR4A 3H46O 3AY9A 4FLTA 3F73A 4BRLA 4PL7A 1YT3A 4RTFD 5B8HA 1WN7A 2PBDA 3VQ6A 3ENBA 4JRPA 5AQRA 3ZSQA 1XC3A 3S41A 3C7NA 5J2QA 4FLUA 3HT3A 4NYNA 1C0GA 1YTAA 3CCMN 1YAGA 3TAQA 5HRRA 3MX5A 2YI1A 4CFCA 4J8FA 1XWLA 4YNQA 3PX6A 4HVJA 3O08A 4FK2A 3C95A 2F7TA 4DQRA 4B9LA 2P1JA 1RT1A 1S1UA 4JKDA 3NF7A 2YJEA 4IO9L 1O13A 4BC2A 3N4QA 3KLIA 2X78A 2NRVA 1JXBA 3WEEA 3VESA 3BF3A 4CJEA 3J7ZO 4IG0A 3HVRA 3QEVA 3TARA 1BIUA 1NGHA 3LDNA 4QS7A 4XEIA 3NE6A 1NJIO 3ULDA 2PFUA 3IDHA 4QCLA 1BI4B 4KHUA 4OKJA 3RRGA 3G71N 1S5JA 4B08A 5KI6A 4DFKA 3LZJA 4FLWA 1TK8A 1GLCG 3FZMA 4DV0K 1D8YA 5DMRA 2QKBA 2QWQA 4GKKK 5AQZA 3KK2A 3MMVA 1WAJA 3LANA 5HL7L 3LDQA 4H5TA 4B1XB 3U6FA 4DU3A 4CGFA 3AO1A 3GL1A 1NLVA 2F96A 3VQPA 5C2DA 4CESA 3FFKB 1WSEA 3K59A 1QQOA 5C24A 3DLKA 4F3OA 5HP1A 3IMXA 1SL0A 4XH5A 3NH2A 3QICA 2IVNA 4C1NK 4B9VA 3TABA 4ILGB 3OYEA 4C8OA 1YXQA 1FK9A 3CJ7A 4GV9A 3DLBA 1TV6A 3NGYA 1X3MA 3L4IA 4EFHA 2V52B 4MDAA 3L6QA 3OA9A 2ZF5O 4DV7K 3H3NO 4BWJA 4BC4A 3DJCA 5FRMA 4H5VA 3VQ8A 3VENA 4BE2A 3ULEA 3ZEUB 1SAZA 5AZIB 2YV0X 2PAVA 2CGKA 1Y97A 4L8RB 3NHGA 3HL8A 1SV5A 4PA1A 4E3SA 3HJFA 4CF8A 1RBTA 1JL2A 1OH6A 1CZAN 1ZXOA 1TKDA 3ZSXA 4DUYK 4DQIA 3CETA 3G0ZA 3V1OA 5FRNA 2OPRA 4H5WA 4ELVA 3L4QA 5AQJA 1B9DA 1FKPA 5E84A 1HKCA 4CHQA 2E2OA 2YNGA 5JVGL 1EXQA 1KLMA 1RT5A 3N4PA 3PO5A 4JI4K 5BPNA 3ZCMA 5FROA 3NFAA 1S1WA 4NCBA 1VSJA 1RFQA 4NB4A 2A5XA 5C25A 3CMAN 4K41A 4H8KA 4BGAA 1LAWA 1NK9A 1TYQB 4E7JA 1TKZA 4H5NA 4I9QA 3LM9A 1OKJA 1TGOA 3OYLA 3EE9A 1G99A 4FLZA 1C1BA 1W9HA 5AFUH 1FW6A 2ZJPL 3AVIA 1YJWN 2D0CA 4CZLA 3VQAA 3QEPA 4XIUA 3K57A 2DFFA 1EKEA 4JKFA 2GUIA 1I3AA 4BACA 5M1NA 4ILJA 3OYIA 3O6WA 1J5OA 3L2WA 3QETA 3OJSA 3AVJA 4WQ5C 4O5FA 3C6UA 2HF3A 3M1FA 4RW7A 2WC9A 2QWOA 3QDKA 4CZGA 1GOCA 2NRWA 1YJNN 2QWPA 1TK0A 3G6EN 3CJAA 4NLCA 4E1MA 5GADP 4FJ9A 1NJWA 4CD1A 4CIFA 4AHTA 2DFEA 3SQ0A 1S6QA 1QHAA 2QXLA 1HX1A 4CVNE 3VTIA 4JYAK 2FBXA 3CC2N 2HBMA 5AQMA 1IKWA 3DRRA 4FVMA 3HOTA 4CF2A 3E66A 3BGRA 4FWRA 1YI2N 4YDUA 2BTFA 5AQPA 1IO2A 3QEWA 4DHYA 3HP9A 3VQ4A 2P5GA 3QNNA 1SL1A 2X6SA 2GUPA 4B1YB 2GBZA 3T69A 3OVNA 1C1CA 3M5RA 2FXUA 3P38A 4F8RA 1S22A 1ILYA 5AZIA 4JEPA 1LV5A 1NK5A 3EZ5A 3SBTA 1KTQA 3JXUA 4CJWA 4TSXA 5I42A 3JYTA 4QS9A 4JLHA 2JWKA 3T19A 5AQWA 1BG3A 1YF5L 1MWKA 3EE8A 4IJNA 3ZETB 4OLAA 4CJ7A 3ATVA 1VHXA 4DFJA 4GNIA 3TU5A 4CK1A 1RDAA 4BR7A 3KK1A 5BN8A 2OPPA 1HRHA 3SQ2A 3KJVA 1XHZA 4J2BA 4IFYA 3AVKA 4JAXA 2EX3A 4XH4A 3KTQA 3ISNC 4A62A 3AVAA 1NJXA 4M3YA 3CJ9A 4Z4EA 4RW6A 3DXMB 3DM2A 2XRIA 3NCIA 2D0BA 1TYQA 4BVPA 3KLHA 3KWIA 3B8AX 5KTQA 3F2KA 5HLFA 4HTLA 3ZYYX 3A5MC 3VGMA 4BRFA 2E6MA 1BA1A 2YHWA 3V9SA 3WXLA 3K0SA 4A5BA 5BR8K 5HBMA 5BRFA 5AQTA 1YHQN 1NGFA 3SCXA 3IKMA 3V6DA 1R0AA 3NGIA 4DLGA 3NVKA 3OYNA 3K5OA 4DTXA 3CERA 2F4VK 1GLDG 4IDHA 3SUPA 4FZZA 4CF1A 4HWIA 4LFBK 1UWBA 3MEDA 1LOTB 5KQDA 3ITHA 2RE2A 3TANA 4DTPA 3SJJA 4B3MK 4AF1A 2W6KA 5FPDA 3WNFA 1NJZA 3TR8A 4DSEA 4B1ZA 3HK2A 1L3UA 3QFUA 4M3ZA 4CJ4A 1JLQA 3AA2A 1R59O 3KLGA 4JKAA 4OX9K 1U04A 3U9ZA 4OJRA 1X1PA 3WXMB 4BQZA 4X64K 5ELZA 2UU9K 2E1ZA 3J81O 1KVBA 3VQBA 4A2AA 3T1AA 3VEZA 1U48A 5LMUK 2O8FB 3QBWA 3NVMA 1JL1A 4FM1A 4R79A 4LSLA 4M42A 3HO1A 1BUPA 2P9KB 1XNRK 4N56A 4U7BA 3VQCA 5CYMA 4DSIA 4M7YA 2QM1A 5H1SQ 3R9PA 3NH1A 3EZWA 1XC9A 3VTHA 3AAPA 3O4NA 1JLGA 3QIPA 4HCBA 2D4WA 3THXB 4MO4A 3BP8A 4HTUA 3NMUA 2GV9A 3BDPA 3SUNA 3KKRA 3V1QA 3CJ1A 2O8DB 2IC3A 3H45C 1U49A 3ZETA 1NOYA 1E3MA 1N36K 2KZMA 4YOWA 4DTUA 4Q0BA 2UXBK 4DS4A 1ZYQA 3VQQA 4KO0A 3WXIA 4KKOA 2ZWHA 3V9WA 1HUXA 2G8WA 4C8KA 1NBWA 2XY7A 4CHYA 2QEXN 4DFMA 3LAKA 4W5QA 5GAHP 1BA0A 3TSPA 4JI8K 2QKKA 4M7XA 3F5TA 1MU2A 5SZTA 1RDUA 4YOVA 1REVA 4E1JA 3DXMA 3CJCA 4B9SA 3ATUA 4FLVA 3IUCA 2OZMA 3SLCA 3U3YA 2JWLA 4G1QA 1S72N 3PY8A 3DMJA 1WUAA 1QSYA 3M8QA 4CBWA 4CJLA 5F0XA 3DLEA 4CI6A 3LP3A 3J7YP 1ZC6A 3H1QA 3DOLA 4WQ4A 2BUPA 3RRHA 3VN5A 2QTDA 3FE1A 3O5BA 4W5TA 3AVNA 4A5AA 1JXEA 3CCVN 5J1EA 3MWTA 4LF5K 1SS6A 4MQ3A 1VQ5N 4A2BA 3FGUA 3KVGA 4PUOA 2H3GX 1S9EA 3P4IA 5EXWA 5LJWA 3VQ7A 1T8EA 1RTIA 4DMNA 2E2PA 5BREA 1XNQK 5GINA 4BRGA 2KFZA 1Q8IA 4HUEA 2QWMA 1RNHA 4FJMA 3I0SA 2QK9A 3B6OA 3VEXA 4JK7A 2WUSA 4BVOA 3K5NA 4IWVA 2BGGA 3PIOL 4M3TA 2I7NA 3DXKB 3AO5A 1YUWA 4CGDA 4DS5A 4DF8A 3ZT4A 3JAMO 4IG3A 5I9EB 5AQVA 1HQUA 5MLCQ 4B1VA 2OPSA 4FSVA 4EIAA 3I8BA 4DTNA 3THVA 4FCYA 1ZBUA 1G15A 3EO3A 3T1YK 3HPOA 1I39A 3THXA 3SMSA 4KAZA 1QSSA 5BR9A 2WTUA 3KZBA 3MN9A 2PYLA 4E7LA 3ZT3A 2O8DA 3R3LA 1HJOA 4DTJA 4K8XA 2QA4N 4F9OA 1XI1A 1EX4A 3ULEB 2OCEA 4CZJA 1HMVA 1RDBA 1NKEA 4BC3A 3NF6A 4B9QA 4JD2B 5JICA 3J8AA 1S6PA 4NCAA 4K25A 4JI2K 1EWQA 3D6RA 3E9OA 4RW9A 3OYDA 3RR8A 1DLOA 4ZTJA 3CCLN 4K43A 2WOMA 1X9MA 3KKSA 4BGBA 2Q2RA 3P83D 2FBVA 3MN5A 2E8AA 4RW4A 1WOQA 5CE3A 2ZD1A 3K5LA 1CXQA 4GVMA 4ISFA 1IH7A 3ZX3A 4JI3K 4K0KK 3A5NC 2YNFA 3I0RA 3VA3A 1IV0A 1LW2A 4IOAL 4X65K 3W3DA 1T05A 1OVYA 1HNXK 3O4QA 2GEMA 4QAGA 1JCFA 1TUUA 1V4TA 2ASPA 2FBTA 3E9LA 4O4GA 4DB3A 1BDGA 1QQMA 5K14A 5F2RA 1VRUA 3PO4A 4LF4K 4AQYK 1N32K 4K8ZA 1VQKN 3V9ZA 3AVLA 3CXCM 3DXKA 3ID8A 4BROA 3AVBA 3C94A 1KAYA 3B6PA 1HYZA 2IIRA 3FFIA 1RT4A 3IS9A 2QWNA 5DM6L 5I3UA 4B1UB 1DTTA 1V4SA 4CEBA 4E7HA 1ZBHA 2ASMA 2GWJA 2NZTA 2P9IB 3DLGA 4N47A 3JSMA 1DTQA 5AQIA 3ENHA 1ATRA 4CIGA 5KGXA 3LDSA 4FJHA 3EN9A 3DLLL 4IEEA 5ADXA 5JMVA 2YJFA 2JGUA 4FO0A 2VGMA 3CMEN 1ASVA 4IFEA 1J53A 4V19S 3NGZA 4BRMA 3SUOA 4IEIA 5AQXA 4DTOA 5TKWA 4O44A 2QI2A 3SAGA 3CHWA 2G8VA 2I5JA 1OH5A 1X9JA 3CIPA 3AA5X 5FPEA 1HJRA 5AQOA 5AQSA 4DR6K 2IAJA 3G25A 4AHSA 5GAGP 4E89A 2VG5A 2QW9A 4H4OA 4AHRA 1HPZA 1BL3A 2D1KA 4N76A 4FPBA 4KB1A 3TAEA 3TSQA 3W0LA 4JD2A 4W5RA 2RF2A 2KZZA 3V4IA 5KPTA 4EZ6A 4OGEA 3M3ZA 3D2FB 4DLEA 4JS4A 3M8SA 1IBLK 4BY9C 3NF8A 1NWKA 3TAFA 2NNWA 3K9KA 2HMIA 2A1SA 1TAUA 3QO9A 3OS2A 4B9UA 3AVHA 5F1XA 2WBNA 3D2EB 2W42A 1NKBA 2IS3A 4I6MB 1UOCA 4CZIA 1BO5O 3HYFA 4GW6A 5GIOA 4CEFA 1KAXA 1TK5A 3OYGA 3OY9A 1RBSA 3U8XA 3WNGA 3QERA 3GOIA 3GBTA 4H5RA 4WFAL 3VA0A 3JS6A 4CK2A 4GV3A 4B9MA 4YFUA 4Z0UA 4DUZK 3MEGA 1YVUA 3QEIA 1Q18A 4CZFA 3SQ1A 4JS5A 4OPKA 1NKCA 1CXUA 4H0VB 1N6QA 1OVQA 5BPLA 1QTMA 3RMCA 4FJ8A 2GTDA 2IOCA 3OS1A 1YIJN 2F8TA 3K9JA 4DU4A 1RDDA 3SBGA 4OPJA 2P5OA 1U47A 3FR0A 4OO1J 3WQTA 3OJUA 4KHYA 4DV5K 3DAWA 3ZSOA 1NJYA 3THWB 1QZ5A 1VSFA 2AJQA 3OHRA 1X9SA 3ALYA 2G8HA 1KVAA 3L3VA 4JN4A 2O8BB 3DOKA 2HVHA 4L3QA 3L2UA 3RTVA 4FJXA 4FJJA 4M3WA 3IAYA 2YNHA 1HNZK 2IVPA 1NGJA 3SPYA 1JKHA 1MWMA 4DQQA 2P9IA 3P1GA 2RHKA 1NNEA 5DM7L 4CGGA 2A6AA 4C8NA 2KLAA 3BZCA 1EP4A 5KPZA 3L2QA 1D9DA 1E4FT 4JI7K 4BG8A 3R1XA 3AO2A 2AP1A 1CLQA 4YORA 4CHNA 2Q3SA 3CPEA 2UUCK 4DR2K 3MCPA 4CD3A 2D0PA 4FZXC 4Y0WA 1LCUA 2OYQA 3AO3A 1H1VA 1NGIA 3A5LC 3DRPA 4FWMA 1KFSA 4CJ3A 3HSTB 3CYMA 5M1QA 2BH1A 1KLNA 3GDQA 2UUAK 4PQUA 2CH6A 3KIOA 1JJ2M 2G8KA 4KTWA 2P9UB 3KD5E 4BE1A 3TSUA 4JI5K 3Q7CA 3D2FA 3ZX2A 3CC7N 2HOEA 1KSPA 2HB5A 3KHYA 1VSKA 3VEOA 4RCHA 1DGKN 3HSCA 2P9NB 4CCHA 2QXFA 4LH5A 3D2EA 1EWRA 1WSIA 3LP2A 4CJVA 4JI6K 3MN6A 1RTJA 4I6MA 5AQHA 2E20A 2UXDK 3PX4A 2HNYA 1RT2A 3M8RA 2RPIA 3CCSN 4DG1A 1JLFA 4AM6A 5FPNA 1J54A 4KTZA 4M63C 3LL3A 4QOZB 2CGLA 3VEWA 4CEZA 2OZSA 4BRHA 2ITGA 4FWQA 3CPWM 1A5WA 4E1NA 4UQGA 4ZHRA 1NM1A 4R5PA 1IBMK 3T1HK 3PSFA 3CQ8A 1ATNA 1T3VA 3LAMA 4FOIA 2YX6A 3CQYA 2P9PB 5AFUA 4IDKA 3AO4A 2VQFK 5E41A 1RDCA 1U2VB 3THWA 2E88A 2EWSA 3CG7A 3O3HA 3ASMA 4DTSA 3UE5A 3NF9A 1VQ8N 4O8UA 1QVFM 4ELTA 2O8BA 2KW4A 1NK0A 3RR7A 3I55N 5CYQA 1ZBSA 4CE9A 4QS8A 4CFDA 4IOCL 3VEYA 2ZE2A 4FXDA 1D9FA 4DQ8A 3FZFA 3S3MA 1LWCA 5KGWA 1N33K 3O9TA 5A2QO 4RG8A 4ISEA 2XHBA
chains in the Genus database with same CATH topology
3DI6A 4CESA 1TKTA 5HROA 1NK6A 1JLEA 3NAEA 3K5NA 3HXMA 2BGGA 2XY8A 1WSEA 3K59A 1BQMA 5C24A 1NK7A 4M3TA 3DLKA 4F3OA 5HP1A 1WLJA 3AO5A 1SL0A 4DF8A 4CGDA 4DS5A 2YKNA 2VG6A 3ZT4A 4Z4HA 1RT7A 3NH2A 3OYAA 3RMAA 4CIEA 4IG3A 3C6TA 3H08A 4CEAA 4KRFA 4B9VA 1HQUA 1RBRA 3TABA 3OYEA 2OPSA 4C8OA 4E19A 1Q9YA 3TAMA 3UIQA 4DTNA 3THVA 1FK9A 3P5JA 1NK4A 4FCYA 1X9WA 1S9GA 1ZBUA 4IKFA 1G15A 3DLBA 4KI6A 5SWMA 1S1TA 1LAVA 1TV6A 3QEXA 3NGYA 3HPOA 1I39A 4OVLA 5DK5A 3DLRA 4KAZA 4LD0A 1QSSA 1RBVA 1L3VA 4I9LA 3LALA 4M3XA 2PYLA 4E7LA 3ZT3A 4KHNA 3PV8A 4CEDA 4J2DA 4CJKA 4BWJA 4CF9A 4DTJA 4ZTFA 5FRMA 3VQ8A 4K8XA 3PUFA 1IG9A 4BE2A 2HHTA 1XI1A 4M41A 4JRQA 4AHCA 2Y1JA 4F2RA 1EX4A 3F9KA 1HMVA 2WONA 4CJ5A 2YV0X 1RDBA 1NKEA 3QINA 2HHSA 4Q5VA 3K2PA 3L2RA 2F8SA 4B8CA 3T3FA 1Y97A 3ZT2A 3L2VA 3G10A 3NF6A 4L8RB 3NHGA 3HL8A 3D0PA 3SV4A 1SV5A 2E4LA 4PA1A 4E3SA 2PYJA 3HJFA 2BE2A 4CF8A 1RBTA 1JL2A 4FK0A 2DY4A 1VSLA 2E6LA 1S6PA 1TKDA 3ZSXA 3O3GA 4DQIA 3G0ZA 3V1OA 4NCAA 5FRNA 4FYDA 2OPRA 1TL1A 1HNVA 3QNOA 4ELVA 4Y1DA 1FKPA 1B9DA 1RILA 5T7BA 2QK9A 1IKYA 4KHSA 1TAQA 4RW9A 4CHQA 4CJFA 1EETA 3OYDA 2YNGA 3ZT1A 4CEQA 3RR8A 1DLOA 1EXQA 1KLMA 1QQCA 1RT5A 4ZTJA 3TAGA 3PO5A 3MEEA 3IG1A 1SKWA 2PZSA 4KTQA 2HHQA 1WNSA 5JS1A 2WOMA 5FROA 3NFAA 3ZCMA 1GOAA 3KKSA 1X9MA 1S1WA 2HHVA 4CEEA 4NCBA 1VSJA 1BGXT 2O4IA 3P83D 1C0UA 5C25A 4E7KA 2FBVA 2NUBA 3AVFA 3OYCA 3V9XA 1NOZA 4RW4A 4H8KA 4FM2A 2PY5A 1LAWA 1NK9A 4E7JA 1TKZA 3NH0A 2ZD1A 4O0JA 3K5LA 4I9QA 1CXQA 2XHBA 4GVMA 3VQ9A 4Z4CA 1S1XA 1TGOA 4NYFA 3OYLA 3SNNA 1UAXA 1IH7A 1BCMA 4CEOA 4CHPA 1QS4A 3CFPA 4FLZA 4FJ5A 4FK4A 1YTUA 2EHGA 1C1BA 1CZBA 1VRTA 1W9HA 1T03A 4KB0A 4LH4A 2LSNA 1XHXA 4DWIA 3AVIA 2YNFA 3I0RA 3VA3A 3SZ2A 2D0CA 1ZBIA 1WSHA 1LW2A 4KREA 3VQAA 3QEPA 1T05A 4XIUA 4F3TA 3K57A 2DFFA 1EKEA 1VSIA 2X74A 4J2EA 5CZ2A 2GUIA 2Y1IA 1I3AA 3O4QA 4QAGA 4BACA 3OYIA 2FBTA 1J5OA 4O4GA 3L2WA 2FBYA 3QETA 3OJSA 5K14A 4FJIA 1HQEA 3ZSVA 3AVJA 1VRUA 5KRSA 1L5UA 3PO4A 4Z4FA 5CY4A 4FLYA 4KFBA 3C6UA 4K8ZA 3V9ZA 2HMIA 2DFHA 3AVLA 1WSJA 4RW7A 4CJQA 4IBNA 2G8FA 4CK3A 1GOCA 4FW2A 3IRXA 3MECA 3AVBA 1TK0A 3C94A 3B6PA 4E1MA 1HYZA 3FFIA 4DFPA 1NJWA 4FJ9A 1RT4A 4AHTA 3IS9A 2DFEA 4CIFA 4EZ9A 4CF0A 4EP5A 3SQ0A 5I3UA 1S6QA 4J2AA 1DTTA 1T7PA 5HRSA 4CEBA 4E7HA 1ZBHA 4KI4A 3ZSWA 4I7FA 4ICLA 5J2NA 4B3OA 2FBXA 2Z1JA 3DLGA 4FM0A 3SYZA 3VQ5A 4N47A 2A1RA 3JSMA 1DTQA 1IKWA 1GOBA 3DRRA 2OPQA 3VQEA 4AILC 4FVMA 4CIGA 5KGXA 3LDSA 4FJHA 4OLBA 3QIOA 4CFAA 4CF2A 4DSLA 3BGRA 2JGUA 3AA4A 3QLHA 1LWEA 1HYSA 4HHTA 4LY7A 4FZYA 3MAQA 1ASVA 2D0AA 1J53A 1IO2A 3QEWA 3CM5A 3HP9A 3NGZA 4BDZA 3SUOA 3VQ4A 3S3NA 1UA0A 2P5GA 3HP6A 1L3TA 4KPYA 3ZSYA 1ZBLA 4DSJA 4DTOA 1SKSA 3QNNA 1SL1A 2X6SA 3ZT0A 1JLBA 4O44A 3K58A 4BE0A 2GBZA 3AVCA 3OVNA 2Z1HA 2G8VA 1SUQA 2I5JA 4ID1A 1C1CA 2R7YA 4O55A 1C1AA 1ZBFA 3AA5X 1HJRA 4F8RA 3RWUA 5C42A 1UA1A 3QESA 2KTQA 3DLHA 1LV5A 1NK5A 3EZ5A 1Z25A 1KTQA 2IAJA 4OKEA 4N41A 3SPZA 4AHSA 4CJWA 4TSXA 5I42A 4E89A 4B9TA 2P51A 2VG5A 3JYTA 4CGJA 1Z26A 4BWMA 3HVTA 1JLCA 1HPZA 1WAFA 2ATQA 1BL3A 4H4OA 4JLHA 3T19A 4AHRA 4N76A 4CJTA 3LP0A 4CHOA 3M8PA 4DSFA 1C6VA 3TAEA 1BQNA 1O1WA 3LPTA 4KB1A 2HW3A 1WSGA 1ASWA 4OLAA 3LP1A 4W5RA 2HVIA 2RF2A 4IFVA 1W0HA 2KZZA 2B5JA 1CZ9A 3V4IA 4Y1CA 4DFJA 4O0IA 4CK1A 4EZ6A 1RDAA 2VWJA 4OGEA 3KK1A 3ZSRA 2OPPA 1RTHA 1TVRA 4DLEA 3RMDA 1HRHA 3SQ2A 2X6NA 1NK8A 4C8MA 3M8SA 4JS4A 3KJVA 2FC0A 1XHZA 4F4KA 1JLAA 2HHUA 3DRSA 3NF8A 2XY5A 4J2BA 1VSMA 4IFYA 4OKKA 3TAFA 4B8AB 5CZ1A 2JLEA 2A1SA 3AVKA 3V1RA 2EX3A 3QO9A 4CGHA 4CGIA 3ISNC 3OS2A 3KTQA 4DSKA 1TAUA 4B9UA 3AVHA 3O3FA 3EY1A 3AVAA 1NJXA 5KRTA 3CM6A 4M3YA 2W42A 2Z1GA 2IS3A 4EP4A 1NKBA 2O4GA 4Z4EA 4RW6A 1UOCA 1U45A 4CJUA 3HYFA 3CFRA 4GW6A 3AV9A 3DM2A 3U3GA 2XRIA 3NCIA 2D0BA 4CEFA 4DQSA 1TK5A 3OYGA 3KLHA 3K5MA 1SKRA 3OY9A 1RBSA 5KTQA 4CJPA 3WNGA 3QERA 5HLFA 4CHZA 3VA0A 3PX0A 4HUFA 4CFBA 4CK2A 4B9MA 4YFUA 2HNDA 3OYKA 4HUGA 4Z0UA 3QEIA 3MEGA 1YVUA 3WNEA 2G8IA 1A5XA 1BCOA 2E6MA 3SQ1A 3V9SA 4NCGA 3SQ4A 4JS5A 4OPKA 3MXJA 1CXUA 1NKCA 5HBMA 1N6QA 1VSEA 3HPGA 4RW8A 4W5OA 1VSDA 3EYZA 2XO7A 3RMCA 1QTMA 1QSLA 3SCXA 3SI6A 4FJ8A 2IOCA 3OS1A 3V6DA 1R0AA 2DTUA 3NGIA 2F8TA 4DLGA 1VK0A 3OYNA 4DU4A 3K5OA 4DTXA 1RDDA 4PY5A 4E7IA 4OPJA 2P5OA 1U47A 2VG7A 1SL2A 2OA8A 3OJUA 4KHYA 3OYBA 3HPHA 3ZSOA 3KLEA 1NJYA 3SUPA 4FZZA 4CF1A 3V81A 1VSFA 1HNIA 2AJQA 1X9SA 3ALYA 2G8HA 1B92A 1KVAA 1UWBA 3L3VA 3MEDA 4FJNA 1RT6A 2YHBA 3ITHA 2HNZA 1B9FA 4AHVA 3WNHA 3TANA 3NDKA 3DOKA 4O5BA 3RTVA 3L2UA 2HVHA 3ZSZA 4DTPA 2Z1IA 3SJJA 4BDPA 4FJXA 4FJJA 3V9UA 4M3WA 4M45A 3IAYA 3LZIA 2YNHA 3WNFA 3OYMA 1RT3A 1NJZA 2BANA 3AA3A 3TR8A 1ASUA 4DSEA 4OGCA 4F2SA 3OS0A 3HK2A 3HM9A 1L3UA 2BDPA 3KLFA 3SPYA 4M3ZA 1JKHA 4CJ4A 1JLQA 3AA2A 3KK3A 2KFNA 4DQQA 3RMBA 3KLGA 2B6AA 3P1GA 5FDLA 3LWMA 1U04A 2YNIA 1X1PA 4OJRA 1C0TA 1KVCA 4CGGA 1U4BA 1QE1A 1WSFA 3MXMA 3NBPA 4M3UA 1KVBA 3VQBA 3S9HA 4C8NA 3L3UA 3T1AA 1U48A 1TKXA 3KD1E 4DU1A 1EP4A 4N5SA 3L2QA 1D9DA 4CJSA 1KRPA 3AO2A 1FKOA 3A2FA 1CLQA 4I2PA 1JL1A 3TWHA 4FM1A 4CHNA 2Q3SA 1KCFA 4M3RA 4LSLA 3S3OA 1Q9XA 4M42A 4FLXA 3HO1A 2ZQBA 4N56A 1LW0A 4ID5A 3VQCA 4FZXC 5CYMA 4DSIA 1BISA 2IDOA 4H4MA 2OYQA 3AO3A 3NH1A 1XC9A 2B4JA 4CJRA 1RCHA 3D45A 3DRPA 3LPUA 4MFBA 2G8UA 3O4NA 1JLGA 3QIPA 4HCBA 3CFOA 1KFSA 4CJ3A 4KHWA 4KHQA 4E0DA 3HSTB 3CYMA 4HTUA 1K6YA 2GV9A 3BDPA 3SUNA 4ELUA 2RN2A 3KKRA 1KLNA 3TI0A 3V1QA 4C8LA 4BDYA 2IC3A 4PQUA 1A5VA 1U49A 3KIOA 4FLTA 1BIZA 1NOYA 3F73A 1RBUA 2G8KA 4KTWA 2KZMA 1LWFA 1YT3A 3KD5E 4DQPA 4KV8A 4Z4IA 1WN7A 4DTUA 4Q0BA 1RTDA 3VQ6A 4BE1A 4JRPA 4DS4A 3ZSQA 4Z4GA 1ZYQA 3VQQA 1ITGA 4KO0A 1KSPA 2HB5A 3OYJA 4FLUA 5J2QA 4KKOA 1VSKA 3HT3A 3V9WA 1VSHA 4NYNA 5JS2A 3VQDA 2G8WA 2YHAA 1YTAA 4C8KA 2XY7A 4CHYA 4LSNA 4WE1A 4FJ7A 3TAQA 4DFMA 3LAKA 5HRNA 5HRRA 4W5QA 4CCHA 2QXFA 4LH5A 4CJVA 1WSIA 3LP2A 4CFCA 2QKKA 5HRPA 4DTRA 1XWLA 4YNQA 1RTJA 4CECA 3PX6A 4HVJA 1MU2A 5SZTA 4FK2A 1REVA 3C95A 2YKMA 3I8DA 4DQRA 3PX4A 2HNYA 4B9LA 1J9AA 2P1JA 1RT1A 1RT2A 1S1UA 2IGIA 2RPIA 3M8RA 4DTMA 4B9SA 1TL3A 4DG1A 4FLVA 3SUQA 1JLFA 4FW1A 3AVMA 2OZMA 1C0MA 3NF7A 1J54A 3U3YA 1L3SA 4KTZA 2D5RA 4W5NA 4G1QA 5J2PA 3PY8A 4I2QA 3OYFA 3DMJA 2XY6A 4QOZB 4CEZA 1QSYA 2OZSA 4FJKA 3E01A 3KLIA 2X78A 3M8QA 2ITGA 4CJLA 1A5WA 3DLEA 4E1NA 4UQGA 4ZHRA 4CERA 1JXBA 4CJEA 4R5PA 4IG0A 3LP3A 3HVRA 3QEVA 5D3GA 3TARA 2ETJA 3CQ8A 1BIUA 3OYHA 4B9NA 3DOLA 3LAMA 3RRHA 2KQ2A 3VN5A 3NE6A 5EU7A 1IKXA 3ULDA 4IDKA 3AO4A 4W5TA 1BI4A 1BHLA 3AVNA 3L8BA 4QCLA 2HHXA 5E41A 1BI4B 1RDCA 3LWLA 5J2MA 4FJLA 1JXEA 1KFDA 4OKJA 5J1EA 4KHUA 3CG7A 3O3HA 3ASMA 4DTSA 3RRGA 1S5JA 4B08A 1N5YA 3NF9A 5KI6A 4DFKA 3TAPA 3LZJA 2RKIA 4MQ3A 2KW4A 4FLWA 4ELTA 1TK8A 4PUOA 1NK0A 4GMJB 3RR7A 4AH9A 4HCCA 1IKVA 1S1VA 5CYQA 1D8YA 5DMRA 2QKBA 1S9EA 1HYVA 3DYAA 4PWDA 4CE9A 3KK2A 3VQ7A 4CFDA 1WAJA 3SV3A 1T8EA 1D5AA 1RTIA 3LANA 2HHWA 2ZE2A 4FXDA 1D9FA 4DMNA 3U6FA 3S3MA 1LWCA 4DU3A 5KGWA 1Q8IA 2KFZA 1F21A 3AVGA 2VWKA 3MXIA 4DF4A 4HUEA 4CGFA 3AO1A 1RNHA 2F96A 3I0SA 4RG8A 3B6OA 4AHUA 4FJMA 1QHTA 3VQPA 1FXXA 4FJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DI6 A;  4CES A;  1TKT A;  5HRO A;  1NK6 A;  1JLE A;  3NAE A;  3K5N A;  3HXM A;  2BGG A;  2XY8 A;  1WSE A;  3K59 A;  1BQM A;  5C24 A;  1NK7 A;  4M3T A;  3DLK A;  4F3O A;  5HP1 A;  1WLJ A;  3AO5 A;  1SL0 A;  4DF8 A;  4CGD A;  4DS5 A;  2YKN A;  2VG6 A;  3ZT4 A;  4Z4H A;  1RT7 A;  3NH2 A;  3OYA A;  3RMA A;  4CIE A;  4IG3 A;  3C6T A;  3H08 A;  4CEA A;  4KRF A;  4B9V A;  1HQU A;  1RBR A;  3TAB A;  3OYE A;  2OPS A;  4C8O A;  4E19 A;  1Q9Y A;  3TAM A;  3UIQ A;  4DTN A;  3THV A;  1FK9 A;  3P5J A;  1NK4 A;  4FCY A;  1X9W A;  1S9G A;  1ZBU A;  4IKF A;  1G15 A;  3DLB A;  4KI6 A;  5SWM A;  1S1T A;  1LAV A;  1TV6 A;  3QEX A;  3NGY A;  3HPO A;  1I39 A;  4OVL A;  5DK5 A;  3DLR A;  4KAZ A;  4LD0 A;  1QSS A;  1RBV A;  1L3V A;  4I9L A;  3LAL A;  4M3X A;  2PYL A;  4E7L A;  3ZT3 A;  4KHN A;  3PV8 A;  4CED A;  4J2D A;  4CJK A;  4BWJ A;  4CF9 A;  4DTJ A;  4ZTF A;  5FRM A;  3VQ8 A;  4K8X A;  3PUF A;  1IG9 A;  4BE2 A;  2HHT A;  1XI1 A;  4M41 A;  4JRQ A;  4AHC A;  2Y1J A;  4F2R A;  1EX4 A;  3F9K A;  1HMV A;  2WON A;  4CJ5 A;  2YV0 X;  1RDB A;  1NKE A;  3QIN A;  2HHS A;  4Q5V A;  3K2P A;  3L2R A;  2F8S A;  4B8C A;  3T3F A;  1Y97 A;  3ZT2 A;  3L2V A;  3G10 A;  3NF6 A;  4L8R B;  3NHG A;  3HL8 A;  3D0P A;  3SV4 A;  1SV5 A;  2E4L A;  4PA1 A;  4E3S A;  2PYJ A;  3HJF A;  2BE2 A;  4CF8 A;  1RBT A;  1JL2 A;  4FK0 A;  2DY4 A;  1VSL A;  2E6L A;  1S6P A;  1TKD A;  3ZSX A;  3O3G A;  4DQI A;  3G0Z A;  3V1O A;  4NCA A;  5FRN A;  4FYD A;  2OPR A;  1TL1 A;  1HNV A;  3QNO A;  4ELV A;  4Y1D A;  1FKP A;  1B9D A;  1RIL A;  5T7B A;  2QK9 A;  1IKY A;  4KHS A;  1TAQ A;  4RW9 A;  4CHQ A;  4CJF A;  1EET A;  3OYD A;  2YNG A;  3ZT1 A;  4CEQ A;  3RR8 A;  1DLO A;  1EXQ A;  1KLM A;  1QQC A;  1RT5 A;  4ZTJ A;  3TAG A;  3PO5 A;  3MEE A;  3IG1 A;  1SKW A;  2PZS A;  4KTQ A;  2HHQ A;  1WNS A;  5JS1 A;  2WOM A;  5FRO A;  3NFA A;  3ZCM A;  1GOA A;  3KKS A;  1X9M A;  1S1W A;  2HHV A;  4CEE A;  4NCB A;  1VSJ A;  1BGX T;  2O4I A;  3P83 D;  1C0U A;  5C25 A;  4E7K A;  2FBV A;  2NUB A;  3AVF A;  3OYC A;  3V9X A;  1NOZ A;  4RW4 A;  4H8K A;  4FM2 A;  2PY5 A;  1LAW A;  1NK9 A;  4E7J A;  1TKZ A;  3NH0 A;  2ZD1 A;  4O0J A;  3K5L A;  4I9Q A;  1CXQ A;  2XHB A;  4GVM A;  3VQ9 A;  4Z4C A;  1S1X A;  1TGO A;  4NYF A;  3OYL A;  3SNN A;  1UAX A;  1IH7 A;  1BCM A;  4CEO A;  4CHP A;  1QS4 A;  3CFP A;  4FLZ A;  4FJ5 A;  4FK4 A;  1YTU A;  2EHG A;  1C1B A;  1CZB A;  1VRT A;  1W9H A;  1T03 A;  4KB0 A;  4LH4 A;  2LSN A;  1XHX A;  4DWI A;  3AVI A;  2YNF A;  3I0R A;  3VA3 A;  3SZ2 A;  2D0C A;  1ZBI A;  1WSH A;  1LW2 A;  4KRE A;  3VQA A;  3QEP A;  1T05 A;  4XIU A;  4F3T A;  3K57 A;  2DFF A;  1EKE A;  1VSI A;  2X74 A;  4J2E A;  5CZ2 A;  2GUI A;  2Y1I A;  1I3A A;  3O4Q A;  4QAG A;  4BAC A;  3OYI A;  2FBT A;  1J5O A;  4O4G A;  3L2W A;  2FBY A;  3QET A;  3OJS A;  5K14 A;  4FJI A;  1HQE A;  3ZSV A;  3AVJ A;  1VRU A;  5KRS A;  1L5U A;  3PO4 A;  4Z4F A;  5CY4 A;  4FLY A;  4KFB A;  3C6U A;  4K8Z A;  3V9Z A;  2HMI A;  2DFH A;  3AVL A;  1WSJ A;  4RW7 A;  4CJQ A;  4IBN A;  2G8F A;  4CK3 A;  1GOC A;  4FW2 A;  3IRX A;  3MEC A;  3AVB A;  1TK0 A;  3C94 A;  3B6P A;  4E1M A;  1HYZ A;  3FFI A;  4DFP A;  1NJW A;  4FJ9 A;  1RT4 A;  4AHT A;  3IS9 A;  2DFE A;  4CIF A;  4EZ9 A;  4CF0 A;  4EP5 A;  3SQ0 A;  5I3U A;  1S6Q A;  4J2A A;  1DTT A;  1T7P A;  5HRS A;  4CEB A;  4E7H A;  1ZBH A;  4KI4 A;  3ZSW A;  4I7F A;  4ICL A;  5J2N A;  4B3O A;  2FBX A;  2Z1J A;  3DLG A;  4FM0 A;  3SYZ A;  3VQ5 A;  4N47 A;  2A1R A;  3JSM A;  1DTQ A;  1IKW A;  1GOB A;  3DRR A;  2OPQ A;  3VQE A;  4AIL C;  4FVM A;  4CIG A;  5KGX A;  3LDS A;  4FJH A;  4OLB A;  3QIO A;  4CFA A;  4CF2 A;  4DSL A;  3BGR A;  2JGU A;  3AA4 A;  3QLH A;  1LWE A;  1HYS A;  4HHT A;  4LY7 A;  4FZY A;  3MAQ A;  1ASV A;  2D0A A;  1J53 A;  1IO2 A;  3QEW A;  3CM5 A;  3HP9 A;  3NGZ A;  4BDZ A;  3SUO A;  3VQ4 A;  3S3N A;  1UA0 A;  2P5G A;  3HP6 A;  1L3T A;  4KPY A;  3ZSY A;  1ZBL A;  4DSJ A;  4DTO A;  1SKS A;  3QNN A;  1SL1 A;  2X6S A;  3ZT0 A;  1JLB A;  4O44 A;  3K58 A;  4BE0 A;  2GBZ A;  3AVC A;  3OVN A;  2Z1H A;  2G8V A;  1SUQ A;  2I5J A;  4ID1 A;  1C1C A;  2R7Y A;  4O55 A;  1C1A A;  1ZBF A;  3AA5 X;  1HJR A;  4F8R A;  3RWU A;  5C42 A;  1UA1 A;  3QES A;  2KTQ A;  3DLH A;  1LV5 A;  1NK5 A;  3EZ5 A;  1Z25 A;  1KTQ A;  2IAJ A;  4OKE A;  4N41 A;  3SPZ A;  4AHS A;  4CJW A;  4TSX A;  5I42 A;  4E89 A;  4B9T A;  2P51 A;  2VG5 A;  3JYT A;  4CGJ A;  1Z26 A;  4BWM A;  3HVT A;  1JLC A;  1HPZ A;  1WAF A;  2ATQ A;  1BL3 A;  4H4O A;  4JLH A;  3T19 A;  4AHR A;  4N76 A;  4CJT A;  3LP0 A;  4CHO A;  3M8P A;  4DSF A;  1C6V A;  3TAE A;  1BQN A;  1O1W A;  3LPT A;  4KB1 A;  2HW3 A;  1WSG A;  1ASW A;  4OLA A;  3LP1 A;  4W5R A;  2HVI A;  2RF2 A;  4IFV A;  1W0H A;  2KZZ A;  2B5J A;  1CZ9 A;  3V4I A;  4Y1C A;  4DFJ A;  4O0I A;  4CK1 A;  4EZ6 A;  1RDA A;  2VWJ A;  4OGE A;  3KK1 A;  3ZSR A;  2OPP A;  1RTH A;  1TVR A;  4DLE A;  3RMD A;  1HRH A;  3SQ2 A;  2X6N A;  1NK8 A;  4C8M A;  3M8S A;  4JS4 A;  3KJV A;  2FC0 A;  1XHZ A;  4F4K A;  1JLA A;  2HHU A;  3DRS A;  3NF8 A;  2XY5 A;  4J2B A;  1VSM A;  4IFY A;  4OKK A;  3TAF A;  4B8A B;  5CZ1 A;  2JLE A;  2A1S A;  3AVK A;  3V1R A;  2EX3 A;  3QO9 A;  4CGH A;  4CGI A;  3ISN C;  3OS2 A;  3KTQ A;  4DSK A;  1TAU A;  4B9U A;  3AVH A;  3O3F A;  3EY1 A;  3AVA A;  1NJX A;  5KRT A;  3CM6 A;  4M3Y A;  2W42 A;  2Z1G A;  2IS3 A;  4EP4 A;  1NKB A;  2O4G A;  4Z4E A;  4RW6 A;  1UOC A;  1U45 A;  4CJU A;  3HYF A;  3CFR A;  4GW6 A;  3AV9 A;  3DM2 A;  3U3G A;  2XRI A;  3NCI A;  2D0B A;  4CEF A;  4DQS A;  1TK5 A;  3OYG A;  3KLH A;  3K5M A;  1SKR A;  3OY9 A;  1RBS A;  5KTQ A;  4CJP A;  3WNG A;  3QER A;  5HLF A;  4CHZ A;  3VA0 A;  3PX0 A;  4HUF A;  4CFB A;  4CK2 A;  4B9M A;  4YFU A;  2HND A;  3OYK A;  4HUG A;  4Z0U A;  3QEI A;  3MEG A;  1YVU A;  3WNE A;  2G8I A;  1A5X A;  1BCO A;  2E6M A;  3SQ1 A;  3V9S A;  4NCG A;  3SQ4 A;  4JS5 A;  4OPK A;  3MXJ A;  1CXU A;  1NKC A;  5HBM A;  1N6Q A;  1VSE A;  3HPG A;  4RW8 A;  4W5O A;  1VSD A;  3EYZ A;  2XO7 A;  3RMC A;  1QTM A;  1QSL A;  3SCX A;  3SI6 A;  4FJ8 A;  2IOC A;  3OS1 A;  3V6D A;  1R0A A;  2DTU A;  3NGI A;  2F8T A;  4DLG A;  1VK0 A;  3OYN A;  4DU4 A;  3K5O A;  4DTX A;  1RDD A;  4PY5 A;  4E7I A;  4OPJ A;  2P5O A;  1U47 A;  2VG7 A;  1SL2 A;  2OA8 A;  3OJU A;  4KHY A;  3OYB A;  3HPH A;  3ZSO A;  3KLE A;  1NJY A;  3SUP A;  4FZZ A;  4CF1 A;  3V81 A;  1VSF A;  1HNI A;  2AJQ A;  1X9S A;  3ALY A;  2G8H A;  1B92 A;  1KVA A;  1UWB A;  3L3V A;  3MED A;  4FJN A;  1RT6 A;  2YHB A;  3ITH A;  2HNZ A;  1B9F A;  4AHV A;  3WNH A;  3TAN A;  3NDK A;  3DOK A;  4O5B A;  3RTV A;  3L2U A;  2HVH A;  3ZSZ A;  4DTP A;  2Z1I A;  3SJJ A;  4BDP A;  4FJX A;  4FJJ A;  3V9U A;  4M3W A;  4M45 A;  3IAY A;  3LZI A;  2YNH A;  3WNF A;  3OYM A;  1RT3 A;  1NJZ A;  2BAN A;  3AA3 A;  3TR8 A;  1ASU A;  4DSE A;  4OGC A;  4F2S A;  3OS0 A;  3HK2 A;  3HM9 A;  1L3U A;  2BDP A;  3KLF A;  3SPY A;  4M3Z A;  1JKH A;  4CJ4 A;  1JLQ A;  3AA2 A;  3KK3 A;  2KFN A;  4DQQ A;  3RMB A;  3KLG A;  2B6A A;  3P1G A;  5FDL A;  3LWM A;  1U04 A;  2YNI A;  1X1P A;  4OJR A;  1C0T A;  1KVC A;  4CGG A;  1U4B A;  1QE1 A;  1WSF A;  3MXM A;  3NBP A;  4M3U A;  1KVB A;  3VQB A;  3S9H A;  4C8N A;  3L3U A;  3T1A A;  1U48 A;  1TKX A;  3KD1 E;  4DU1 A;  1EP4 A;  4N5S A;  3L2Q A;  1D9D A;  4CJS A;  1KRP A;  3AO2 A;  1FKO A;  3A2F A;  1CLQ A;  4I2P A;  1JL1 A;  3TWH A;  4FM1 A;  4CHN A;  2Q3S A;  1KCF A;  4M3R A;  4LSL A;  3S3O A;  1Q9X A;  4M42 A;  4FLX A;  3HO1 A;  2ZQB A;  4N56 A;  1LW0 A;  4ID5 A;  3VQC A;  4FZX C;  5CYM A;  4DSI A;  1BIS A;  2IDO A;  4H4M A;  2OYQ A;  3AO3 A;  3NH1 A;  1XC9 A;  2B4J A;  4CJR A;  1RCH A;  3D45 A;  3DRP A;  3LPU A;  4MFB A;  2G8U A;  3O4N A;  1JLG A;  3QIP A;  4HCB A;  3CFO A;  1KFS A;  4CJ3 A;  4KHW A;  4KHQ A;  4E0D A;  3HST B;  3CYM A;  4HTU A;  1K6Y A;  2GV9 A;  3BDP A;  3SUN A;  4ELU A;  2RN2 A;  3KKR A;  1KLN A;  3TI0 A;  3V1Q A;  4C8L A;  4BDY A;  2IC3 A;  4PQU A;  1A5V A;  1U49 A;  3KIO A;  4FLT A;  1BIZ A;  1NOY A;  3F73 A;  1RBU A;  2G8K A;  4KTW A;  2KZM A;  1LWF A;  1YT3 A;  3KD5 E;  4DQP A;  4KV8 A;  4Z4I A;  1WN7 A;  4DTU A;  4Q0B A;  1RTD A;  3VQ6 A;  4BE1 A;  4JRP A;  4DS4 A;  3ZSQ A;  4Z4G A;  1ZYQ A;  3VQQ A;  1ITG A;  4KO0 A;  1KSP A;  2HB5 A;  3OYJ A;  4FLU A;  5J2Q A;  4KKO A;  1VSK A;  3HT3 A;  3V9W A;  1VSH A;  4NYN A;  5JS2 A;  3VQD A;  2G8W A;  2YHA A;  1YTA A;  4C8K A;  2XY7 A;  4CHY A;  4LSN A;  4WE1 A;  4FJ7 A;  3TAQ A;  4DFM A;  3LAK A;  5HRN A;  5HRR A;  4W5Q A;  4CCH A;  2QXF A;  4LH5 A;  4CJV A;  1WSI A;  3LP2 A;  4CFC A;  2QKK A;  5HRP A;  4DTR A;  1XWL A;  4YNQ A;  1RTJ A;  4CEC A;  3PX6 A;  4HVJ A;  1MU2 A;  5SZT A;  4FK2 A;  1REV A;  3C95 A;  2YKM A;  3I8D A;  4DQR A;  3PX4 A;  2HNY A;  4B9L A;  1J9A A;  2P1J A;  1RT1 A;  1RT2 A;  1S1U A;  2IGI A;  2RPI A;  3M8R A;  4DTM A;  4B9S A;  1TL3 A;  4DG1 A;  4FLV A;  3SUQ A;  1JLF A;  4FW1 A;  3AVM A;  2OZM A;  1C0M A;  3NF7 A;  1J54 A;  3U3Y A;  1L3S A;  4KTZ A;  2D5R A;  4W5N A;  4G1Q A;  5J2P A;  3PY8 A;  4I2Q A;  3OYF A;  3DMJ A;  2XY6 A;  4QOZ B;  4CEZ A;  1QSY A;  2OZS A;  4FJK A;  3E01 A;  3KLI A;  2X78 A;  3M8Q A;  2ITG A;  4CJL A;  1A5W A;  3DLE A;  4E1N A;  4UQG A;  4ZHR A;  4CER A;  1JXB A;  4CJE A;  4R5P A;  4IG0 A;  3LP3 A;  3HVR A;  3QEV A;  5D3G A;  3TAR A;  2ETJ A;  3CQ8 A;  1BIU A;  3OYH A;  4B9N A;  3DOL A;  3LAM A;  3RRH A;  2KQ2 A;  3VN5 A;  3NE6 A;  5EU7 A;  1IKX A;  3ULD A;  4IDK A;  3AO4 A;  4W5T A;  1BI4 A;  1BHL A;  3AVN A;  3L8B A;  4QCL A;  2HHX A;  5E41 A;  1BI4 B;  1RDC A;  3LWL A;  5J2M A;  4FJL A;  1JXE A;  1KFD A;  4OKJ A;  5J1E A;  4KHU A;  3CG7 A;  3O3H A;  3ASM A;  4DTS A;  3RRG A;  1S5J A;  4B08 A;  1N5Y A;  3NF9 A;  5KI6 A;  4DFK A;  3TAP A;  3LZJ A;  2RKI A;  4MQ3 A;  2KW4 A;  4FLW A;  4ELT A;  1TK8 A;  4PUO A;  1NK0 A;  4GMJ B;  3RR7 A;  4AH9 A;  4HCC A;  1IKV A;  1S1V A;  5CYQ A;  1D8Y A;  5DMR A;  2QKB A;  1S9E A;  1HYV A;  3DYA A;  4PWD A;  4CE9 A;  3KK2 A;  3VQ7 A;  4CFD A;  1WAJ A;  3SV3 A;  1T8E A;  1D5A A;  1RTI A;  3LAN A;  2HHW A;  2ZE2 A;  4FXD A;  1D9F A;  4DMN A;  3U6F A;  3S3M A;  1LWC A;  4DU3 A;  5KGW A;  1Q8I A;  2KFZ A;  1F21 A;  3AVG A;  2VWK A;  3MXI A;  4DF4 A;  4HUE A;  4CGF A;  3AO1 A;  1RNH A;  2F96 A;  3I0S A;  4RG8 A;  3B6O A;  4AHU A;  4FJM A;  1QHT A;  3VQP A;  1FXX A;  4FJG A; 
#chains in the Genus database with same CATH topology
 5AQK A;  3DI6 A;  1TKT A;  4CZE A;  5HRO A;  1JLE A;  2HST A;  3HXM A;  3O4W A;  3VEV A;  4YY3 K;  2A40 A;  1WLJ A;  1NGC A;  4JKH A;  2YKN A;  2UYT A;  3RMA A;  1RGI A;  5AR0 A;  2NRH A;  3LDL A;  4IJA A;  3C6T A;  3H08 A;  4CEA A;  4KRF A;  1RBR A;  4B1W B;  1XMQ K;  4K42 A;  4E19 A;  1Q9Y A;  3TAM A;  3CCJ N;  4RWT A;  2HBJ A;  5AQF A;  3H3O B;  3P5J A;  1NK4 A;  2E1Y A;  4KI6 A;  3MN7 A;  3IFR A;  2QWR A;  1S1T A;  4EHT A;  4IXC A;  3QEX A;  5DK5 A;  4YDU C;  3DLR A;  3KWG A;  4IO8 A;  4LD0 A;  1RBV A;  3O9R A;  2V51 B;  3LAL A;  4M3X A;  4DV2 K;  4KHN A;  4CED A;  4NO7 A;  4U67 L;  4CJK A;  3I33 A;  4CF9 A;  4ZTF A;  4DKW A;  4FVU A;  2P9U A;  3PUF A;  5TKY A;  1IG9 A;  2HHT A;  4JKC A;  4M41 A;  4A61 A;  4AHC A;  2Y1J A;  4F2R A;  4FWP A;  1X3N A;  1S3X A;  2F9W A;  4CJ5 A;  3TPQ A;  2D0O A;  1XMO K;  3VF2 A;  2HHS A;  4Q5V A;  2Q97 A;  2GEL A;  3L2R A;  3R6M A;  3T3F A;  2P9N A;  4JI0 K;  3H1V X;  3D0P A;  2E4L A;  2F9T A;  4H0O A;  3UKU B;  3EL2 A;  2GWK A;  2BE2 A;  1IBK K;  4FK0 A;  2DY4 A;  1VSL A;  5BRD A;  1OH8 A;  3SJH A;  3CCR N;  3SK3 A;  3O3G A;  3MK6 A;  4FYD A;  4PL8 A;  1TL1 A;  3TTD A;  1RIL A;  1IKY A;  1TAQ A;  4ILH A;  2OAN A;  3ZT1 A;  4CEQ A;  5AZJ B;  1QQC A;  3TAG A;  5LL6 Z;  2KKZ A;  2PZS A;  2ASO A;  1VQ4 N;  3FLC O;  5JS1 A;  1GOA A;  2HHV A;  2O4I A;  3O9Q A;  1C0U A;  2NUB A;  3AVF A;  3OYC A;  1K73 O;  4DV4 K;  4LF7 K;  2P9P A;  3NH0 A;  4O0J A;  1U2V A;  3VQ9 A;  4Z4C A;  1VQ9 N;  1S1X A;  4NYF A;  2NLX A;  3SNN A;  3CFP A;  4FK4 A;  1YTU A;  4FJ5 A;  1VRT A;  1CZB A;  1VQP N;  1XHX A;  4KRE A;  2X74 A;  5IWA K;  3HBT A;  5CZ2 A;  4YHH K;  5C10 A;  5AQN A;  1HQE A;  1TUY A;  3ZSV A;  3PSI A;  1L5U A;  4Z4F A;  3VMF B;  1BU6 O;  2DFH A;  1KXP A;  1K9M O;  2I7P A;  4H0X B;  1VQO N;  2G8F A;  4CK3 A;  4FW2 A;  3C65 A;  3HM8 A;  3IRX A;  3MEC A;  5M1O A;  3HOS A;  5JVH L;  4EP5 A;  4J2A A;  3Q7B A;  1T7P A;  1KC8 O;  4ICL A;  5J2N A;  2HMP A;  3UKR B;  2Z1J A;  4FM0 A;  3SYZ A;  3RSE B;  3VQ5 A;  2A1R A;  1GOB A;  3VQE A;  2OPQ A;  4AIL C;  1W2B M;  4DV1 K;  4OLB A;  3QIO A;  4CFA A;  4DSL A;  3QLH A;  4WF9 L;  4BRA A;  4HHT A;  4FZY A;  4NXM K;  2HBL A;  3MAQ A;  3VOV A;  3CM5 A;  4JKE A;  1UA0 A;  4WYB A;  3HP6 A;  1Q86 O;  4KPY A;  2J4R A;  3ZSY A;  1ZBL A;  3SAF A;  1SKS A;  2A42 A;  1E4G T;  4BRP A;  2CGJ A;  3AVC A;  1SUQ A;  2R7Y A;  4O55 A;  1C1A A;  1ZBF A;  3QBX A;  3O9S A;  5C42 A;  1UA1 A;  2KTQ A;  1Z25 A;  4OKE A;  4N41 A;  2FSN A;  4JK8 A;  4B9T A;  2P51 A;  2OTJ N;  3PIP L;  4CGJ A;  1Z26 A;  4BWM A;  1P8Z A;  2VWB A;  3AAR A;  1OH7 A;  2ATQ A;  1P90 A;  1WAF A;  3RVC A;  4CJT A;  4CHO A;  3UKU A;  1BQN A;  1O1W A;  1NGD A;  1WSG A;  1ASW A;  3OW2 M;  2HVI A;  4IFV A;  1W0H A;  1CZ9 A;  1DT9 A;  4O8K A;  3AGR A;  2VWJ A;  4JI1 K;  5JLH A;  1TVR A;  3RMD A;  1NK8 A;  3QFP A;  2P9L B;  4F4K A;  2FC0 A;  1KAZ A;  2HHU A;  3VGL A;  5EX5 A;  2W6L A;  1Q81 O;  5AZJ A;  4OKK A;  4FWK A;  4CGH A;  4DSK A;  3O3F A;  1ATS A;  3EY1 A;  4YOY A;  5KRT A;  2GX9 A;  3MX2 A;  2Z1G A;  2ZGY A;  2O4G A;  1Q7Y O;  3U3G A;  3ZX0 A;  1SKR A;  4CHZ A;  3PX0 A;  4CFB A;  3M6G A;  3OYK A;  4HUG A;  2G8I A;  4DCH A;  1A5X A;  1BCO A;  3SQ4 A;  4Z94 A;  3MXJ A;  3HPG A;  4RW8 A;  3EYZ A;  4GKJ K;  4KH5 A;  2XO7 A;  2DTU A;  4WQ4 C;  4X66 K;  1VK0 A;  4PY5 A;  4E7I A;  2VG7 A;  1NG9 A;  1NGB A;  4CW7 B;  4H0T B;  3KLE A;  4WQ5 A;  1HNI A;  4CBX A;  1VQL N;  4LF8 K;  1B92 A;  4FJN A;  2HNZ A;  3LDP A;  4JNE A;  3WNH A;  5KQ8 A;  3NDK A;  5KPR A;  3GG4 A;  3ZSZ A;  2Z1I A;  3I56 N;  4DR3 K;  4M45 A;  4WFN L;  1GLE G;  1RT3 A;  2BAN A;  3J80 O;  1ASU A;  5M1P A;  4OGC A;  2P9S B;  2DPN A;  3LM2 A;  2BDP A;  5GIP A;  3KLF A;  4JKG B;  3O80 A;  3KK3 A;  2KFN A;  4FWN A;  3UKR A;  4MO5 A;  1D4X A;  2B6A A;  4BR5 A;  3RSE A;  3LWM A;  1N34 K;  2A41 A;  3J7A P;  2YNI A;  2O8C B;  1C0T A;  1KVC A;  2VGN A;  1U4B A;  4DR7 K;  4M3U A;  3L3U A;  4EAH D;  3TTC A;  1TKX A;  3UB5 A;  1T6D A;  2ZM6 K;  4YOU A;  3A2F A;  4I2P A;  5BPM A;  1WBB A;  1KCF A;  3VET A;  2E2Q A;  3DWL A;  3O9U A;  1LW0 A;  4A57 A;  4ID5 A;  1BIS A;  2IDO A;  5LMN K;  3D45 A;  3LPU A;  2G8U A;  2ZGZ A;  4CZH A;  3CFO A;  2VYP A;  3VF4 A;  4KHQ A;  4AM7 A;  1K6Y A;  4ELU A;  1IG8 A;  4BDY A;  1Q82 O;  1A5V A;  2E5L K;  1BIZ A;  5LJV A;  1RBU A;  1NGE A;  1LWF A;  2YCH A;  4KH4 A;  4DQP A;  4KV8 A;  4Z4I A;  1FJG K;  2NRR A;  1RTD A;  3U4L A;  4Z4G A;  1ITG A;  2P9L A;  5JLF A;  3OYJ A;  4BRE A;  1VSH A;  3E9P A;  5JS2 A;  3VQD A;  2YHA A;  1M1K O;  4LSN A;  4WE1 A;  2FF6 A;  4FJ7 A;  5C0Y A;  5HRN A;  4BRQ A;  1BWF O;  4BRN A;  2A3Z A;  5HRP A;  4DTR A;  3TTF A;  4CEC A;  1VAZ A;  4KH6 A;  3FZH A;  2Q1N A;  2YKM A;  3I8D A;  4BC5 A;  1J9A A;  4DTM A;  2IGI A;  1TL3 A;  1MDU B;  3SUQ A;  1HLU A;  3AVM A;  4FW1 A;  3VGK A;  5CHI A;  1VQN N;  1C0M A;  1L3S A;  2D5R A;  3CCQ N;  4W5N A;  1HKB A;  5J2P A;  2HHH K;  4I2Q A;  3OYF A;  2XY6 A;  4FJK A;  3E01 A;  1YJ9 N;  4GVE A;  1GLJ O;  4CER A;  2KHO A;  1Z6R A;  5D3G A;  4FWL A;  2ETJ A;  1T6C A;  3OYH A;  4B9N A;  4BR9 A;  3E1Y A;  1NU0 A;  3WQU A;  3C0B A;  2KQ2 A;  5EU7 A;  1IKX A;  3BF1 A;  1BI4 A;  1BHL A;  4MLH A;  3R8E A;  3L8B A;  2HHX A;  3LWL A;  5J2M A;  4FJL A;  1KFD A;  3P31 A;  3ID6 A;  1N5Y A;  3T7Z A;  5AQL A;  4DR4 K;  3TAP A;  2RKI A;  2YHY A;  4GMJ B;  1J6Z A;  4FWS A;  4AH9 A;  4HCC A;  1IKV A;  1GLL O;  1S1V A;  2YHX A;  2ZJR L;  1HYV A;  3DYA A;  4C1N I;  4PWD A;  3SV3 A;  1D5A A;  2HHW A;  3HTV A;  2P9S A;  3OTO K;  4JKG A;  1F21 A;  4OPH A;  3AVG A;  2VWK A;  1U6Z A;  3MXI A;  1NMN A;  3CI5 A;  4DF4 A;  1Y64 A;  5EVZ A;  4AHU A;  3SZ2 A;  1QHT A;  1FXX A;  3L2V A;  4FJG A;  2O8C A;  5GAE P;  1NK6 A;  3NAE A;  1DKG D;  3MDQ A;  3H6E A;  2XY8 A;  5HOO A;  1QVG M;  1BQM A;  5M1F A;  1NK7 A;  4MDB A;  3CD6 N;  3MWP A;  2VG6 A;  5AQU A;  4Z4H A;  1RT7 A;  3OYA A;  3CF5 L;  4CIE A;  1N8R O;  4G9Z A;  3QML A;  4A59 A;  5BN9 A;  3UIQ A;  3A5O C;  4IOX A;  1S9G A;  1X9W A;  4IKF A;  4UY8 O;  1BOT O;  5SWM A;  1LAV A;  4OVL A;  1GLF O;  2Q0R A;  2NRT A;  1SQK A;  1L3V A;  4I9L A;  3C6A A;  3CJB A;  3PV8 A;  4J2D A;  2WFB A;  2Q31 A;  1I94 K;  1NGG A;  4BRD A;  1KD1 O;  5AQY A;  3QB0 A;  3D7E O;  4JRQ A;  1XQS C;  3ZEU A;  3F9K A;  4JHD B;  3THY B;  2WON A;  4B3T K;  2VCP A;  3QIN A;  3K2P A;  4JK9 A;  2F8S A;  4B8C A;  3ZT2 A;  3G10 A;  2ZJQ L;  3SV4 A;  2PYJ A;  4JV5 K;  4JKB A;  1SZ2 A;  4OPA A;  2E6L A;  2HBK A;  4YOX A;  4KBO A;  5AQG A;  1WBD A;  1YIT N;  3VF6 A;  1HNV A;  3QNO A;  4Y1D A;  5T7B A;  5M1K A;  3WXJ A;  3AAQ A;  4KHS A;  2Q36 A;  4CJF A;  2UUB K;  1EET A;  3MEE A;  3IG1 A;  1GLA G;  1SKW A;  1VQ6 N;  1HNW K;  4KTQ A;  3BY5 A;  4KHP K;  2HHQ A;  1WNS A;  4CEE A;  1BGX T;  3P39 A;  3O1W A;  4E7K A;  3AGK A;  4BR4 A;  3V9X A;  4DV3 K;  1NOZ A;  2PY5 A;  4FM2 A;  2V7Y A;  1XUP O;  1UAX A;  1JCG A;  1BCM A;  4CEO A;  4CHP A;  1QS4 A;  2EHG A;  1T03 A;  4KB0 A;  1T44 A;  4YOT A;  4LH4 A;  1DEJ A;  2LSN A;  4DWI A;  3G4S N;  1ZBI A;  1EO1 A;  4WFB L;  1K8K B;  1WSH A;  4NXN K;  5FLX O;  4F3T A;  1HR0 K;  1VSI A;  4J2E A;  1NGA A;  2O8E B;  2FF3 B;  4GY2 B;  2Y1I A;  4FOE A;  5AJ3 K;  4PKG A;  2FBY A;  2QWL A;  4FJI A;  5C15 A;  5KRS A;  5CY4 A;  4FLY A;  4KFB A;  2V7Z A;  1C0F A;  1WSJ A;  4CJQ A;  4IBN A;  4PKI A;  3CCU N;  3ZLJ A;  2FSK A;  3EKS A;  4FL9 A;  4DFP A;  1NMD A;  4EZ9 A;  2W40 A;  4CZM A;  4CF0 A;  3C6H A;  4BG9 A;  5HRS A;  4ISG A;  4H03 B;  4KI4 A;  3ZSW A;  4I7F A;  4B3O A;  2VQE K;  5AQQ A;  3HI0 A;  3O1B A;  4MLE A;  3HZ6 A;  2OTL N;  3AA4 A;  1HYS A;  1LWE A;  1HPM A;  4LY7 A;  2HF4 A;  4PHT X;  2D0A A;  3S3N A;  4BDZ A;  3VPZ A;  3HRG A;  5IT9 O;  1L3T A;  4GV6 A;  4DSJ A;  4CBU A;  3OBY A;  3ZT0 A;  1JLB A;  4X62 K;  3K58 A;  2FLO A;  4BE0 A;  3OBW A;  2Z1H A;  4BRC A;  4ID1 A;  3EKU A;  2CH5 A;  4LF6 K;  4NLB A;  1QZ6 A;  4JHD A;  3THY A;  3RWU A;  3QES A;  3DLH A;  1M90 O;  2NRX A;  3SPZ A;  3BEX A;  3HVT A;  1JLC A;  3MCA B;  4DSF A;  3LP0 A;  3SAH A;  3M8P A;  5EY4 A;  1C6V A;  3LPT A;  2HW3 A;  1WB9 A;  5FPM A;  5E26 A;  1W97 L;  4C23 A;  4DR1 K;  3LP1 A;  3BUZ B;  2B5J A;  1YVN A;  4Y1C A;  4O0I A;  4BQL A;  3ZSR A;  1KQS M;  1RTH A;  3WXK A;  2X6N A;  3C7N B;  4C8M A;  1JLA A;  3DRS A;  2XY5 A;  4BR2 A;  1VSM A;  3CQX A;  4B8A B;  5CZ1 A;  2JLE A;  4CGI A;  3V1R A;  1W7A A;  3VER A;  1QQN A;  3KK7 A;  3LDO A;  3CM6 A;  4EP4 A;  1U45 A;  3CCE N;  4CJU A;  3CFR A;  3AV9 A;  1GLB G;  4DQS A;  2FSJ A;  3K5M A;  4XH1 A;  4WCE L;  3EEQ A;  4CJP A;  5LY3 A;  3WUH A;  4HUF A;  2HND A;  3WNE A;  1RDW X;  3A8Y A;  4BRK A;  1VQM N;  4NCG A;  3BZK A;  1K8K A;  1JCE A;  1VSE A;  4W5O A;  1J5E K;  1VSD A;  5EOY A;  3WEE B;  1QSL A;  3SI6 A;  4LF9 K;  2O8E A;  4B3R K;  4EHU A;  3ENO A;  2Q0U A;  5C12 A;  1SL2 A;  2OA8 A;  3FZL A;  3OYB A;  2NRZ A;  3HPH A;  3O8M A;  3V81 A;  3FZK A;  1RT6 A;  2YHB A;  5BRH A;  2W41 A;  1B9F A;  4AHV A;  4O5B A;  4BDP A;  3V9U A;  4BRI A;  4DR5 K;  3LZI A;  3OYM A;  3AA3 A;  1Z05 A;  4BR0 A;  4FPA A;  3OS0 A;  4F2S A;  3HM9 A;  1EQY A;  1HKG A;  4H0P A;  3F9M A;  3GE1 A;  3RMB A;  5FDL A;  2IVO A;  4B3S K;  2UXC K;  4LC9 B;  1QE1 A;  1WSF A;  4FWO A;  3MXM A;  3NBP A;  3CC4 N;  3S9H A;  1VQ7 N;  3KD1 E;  4DU1 A;  2O8F A;  3U9D A;  2AA4 A;  4H0Y B;  4N5S A;  4LFA K;  3A0I X;  4CJS A;  1KRP A;  1FKO A;  5ADX H;  4DV6 K;  3PLA A;  3TWH A;  1IJJ A;  3WT0 A;  2ITM A;  4M3R A;  4CZK A;  1K8A O;  2P9K A;  3S3O A;  1Q9X A;  4FLX A;  4LFC K;  2E2N A;  2ZQB A;  4IZ9 A;  4H4M A;  1MA9 B;  2B4J A;  4CJR A;  1RCH A;  4MFB A;  1ESV A;  3L0Q A;  4KHW A;  4E0D A;  5C2F A;  3SMP A;  2RN2 A;  3TI0 A;  4C8L A;  4PKH A;  5CR4 A;  3H46 O;  3AY9 A;  4FLT A;  3F73 A;  4BRL A;  4PL7 A;  1YT3 A;  4RTF D;  5B8H A;  1WN7 A;  2PBD A;  3VQ6 A;  3ENB A;  4JRP A;  5AQR A;  3ZSQ A;  1XC3 A;  3S41 A;  3C7N A;  5J2Q A;  4FLU A;  3HT3 A;  4NYN A;  1C0G A;  1YTA A;  3CCM N;  1YAG A;  3TAQ A;  5HRR A;  3MX5 A;  2YI1 A;  4CFC A;  4J8F A;  1XWL A;  4YNQ A;  3PX6 A;  4HVJ A;  3O08 A;  4FK2 A;  3C95 A;  2F7T A;  4DQR A;  4B9L A;  2P1J A;  1RT1 A;  1S1U A;  4JKD A;  3NF7 A;  2YJE A;  4IO9 L;  1O13 A;  4BC2 A;  3N4Q A;  3KLI A;  2X78 A;  2NRV A;  1JXB A;  3WEE A;  3VES A;  3BF3 A;  4CJE A;  3J7Z O;  4IG0 A;  3HVR A;  3QEV A;  3TAR A;  1BIU A;  1NGH A;  3LDN A;  4QS7 A;  4XEI A;  3NE6 A;  1NJI O;  3ULD A;  2PFU A;  3IDH A;  4QCL A;  1BI4 B;  4KHU A;  4OKJ A;  3RRG A;  3G71 N;  1S5J A;  4B08 A;  5KI6 A;  4DFK A;  3LZJ A;  4FLW A;  1TK8 A;  1GLC G;  3FZM A;  4DV0 K;  1D8Y A;  5DMR A;  2QKB A;  2QWQ A;  4GKK K;  5AQZ A;  3KK2 A;  3MMV A;  1WAJ A;  3LAN A;  5HL7 L;  3LDQ A;  4H5T A;  4B1X B;  3U6F A;  4DU3 A;  4CGF A;  3AO1 A;  3GL1 A;  1NLV A;  2F96 A;  3VQP A;  5C2D A;  4CES A;  3FFK B;  1WSE A;  3K59 A;  1QQO A;  5C24 A;  3DLK A;  4F3O A;  5HP1 A;  3IMX A;  1SL0 A;  4XH5 A;  3NH2 A;  3QIC A;  2IVN A;  4C1N K;  4B9V A;  3TAB A;  4ILG B;  3OYE A;  4C8O A;  1YXQ A;  1FK9 A;  3CJ7 A;  4GV9 A;  3DLB A;  1TV6 A;  3NGY A;  1X3M A;  3L4I A;  4EFH A;  2V52 B;  4MDA A;  3L6Q A;  3OA9 A;  2ZF5 O;  4DV7 K;  3H3N O;  4BWJ A;  4BC4 A;  3DJC A;  5FRM A;  4H5V A;  3VQ8 A;  3VEN A;  4BE2 A;  3ULE A;  3ZEU B;  1SAZ A;  5AZI B;  2YV0 X;  2PAV A;  2CGK A;  1Y97 A;  4L8R B;  3NHG A;  3HL8 A;  1SV5 A;  4PA1 A;  4E3S A;  3HJF A;  4CF8 A;  1RBT A;  1JL2 A;  1OH6 A;  1CZA N;  1ZXO A;  1TKD A;  3ZSX A;  4DUY K;  4DQI A;  3CET A;  3G0Z A;  3V1O A;  5FRN A;  2OPR A;  4H5W A;  4ELV A;  3L4Q A;  5AQJ A;  1B9D A;  1FKP A;  5E84 A;  1HKC A;  4CHQ A;  2E2O A;  2YNG A;  5JVG L;  1EXQ A;  1KLM A;  1RT5 A;  3N4P A;  3PO5 A;  4JI4 K;  5BPN A;  3ZCM A;  5FRO A;  3NFA A;  1S1W A;  4NCB A;  1VSJ A;  1RFQ A;  4NB4 A;  2A5X A;  5C25 A;  3CMA N;  4K41 A;  4H8K A;  4BGA A;  1LAW A;  1NK9 A;  1TYQ B;  4E7J A;  1TKZ A;  4H5N A;  4I9Q A;  3LM9 A;  1OKJ A;  1TGO A;  3OYL A;  3EE9 A;  1G99 A;  4FLZ A;  1C1B A;  1W9H A;  5AFU H;  1FW6 A;  2ZJP L;  3AVI A;  1YJW N;  2D0C A;  4CZL A;  3VQA A;  3QEP A;  4XIU A;  3K57 A;  2DFF A;  1EKE A;  4JKF A;  2GUI A;  1I3A A;  4BAC A;  5M1N A;  4ILJ A;  3OYI A;  3O6W A;  1J5O A;  3L2W A;  3QET A;  3OJS A;  3AVJ A;  4WQ5 C;  4O5F A;  3C6U A;  2HF3 A;  3M1F A;  4RW7 A;  2WC9 A;  2QWO A;  3QDK A;  4CZG A;  1GOC A;  2NRW A;  1YJN N;  2QWP A;  1TK0 A;  3G6E N;  3CJA A;  4NLC A;  4E1M A;  5GAD P;  4FJ9 A;  1NJW A;  4CD1 A;  4CIF A;  4AHT A;  2DFE A;  3SQ0 A;  1S6Q A;  1QHA A;  2QXL A;  1HX1 A;  4CVN E;  3VTI A;  4JYA K;  2FBX A;  3CC2 N;  2HBM A;  5AQM A;  1IKW A;  3DRR A;  4FVM A;  3HOT A;  4CF2 A;  3E66 A;  3BGR A;  4FWR A;  1YI2 N;  4YDU A;  2BTF A;  5AQP A;  1IO2 A;  3QEW A;  4DHY A;  3HP9 A;  3VQ4 A;  2P5G A;  3QNN A;  1SL1 A;  2X6S A;  2GUP A;  4B1Y B;  2GBZ A;  3T69 A;  3OVN A;  1C1C A;  3M5R A;  2FXU A;  3P38 A;  4F8R A;  1S22 A;  1ILY A;  5AZI A;  4JEP A;  1LV5 A;  1NK5 A;  3EZ5 A;  3SBT A;  1KTQ A;  3JXU A;  4CJW A;  4TSX A;  5I42 A;  3JYT A;  4QS9 A;  4JLH A;  2JWK A;  3T19 A;  5AQW A;  1BG3 A;  1YF5 L;  1MWK A;  3EE8 A;  4IJN A;  3ZET B;  4OLA A;  4CJ7 A;  3ATV A;  1VHX A;  4DFJ A;  4GNI A;  3TU5 A;  4CK1 A;  1RDA A;  4BR7 A;  3KK1 A;  5BN8 A;  2OPP A;  1HRH A;  3SQ2 A;  3KJV A;  1XHZ A;  4J2B A;  4IFY A;  3AVK A;  4JAX A;  2EX3 A;  4XH4 A;  3KTQ A;  3ISN C;  4A62 A;  3AVA A;  1NJX A;  4M3Y A;  3CJ9 A;  4Z4E A;  4RW6 A;  3DXM B;  3DM2 A;  2XRI A;  3NCI A;  2D0B A;  1TYQ A;  4BVP A;  3KLH A;  3KWI A;  3B8A X;  5KTQ A;  3F2K A;  5HLF A;  4HTL A;  3ZYY X;  3A5M C;  3VGM A;  4BRF A;  2E6M A;  1BA1 A;  2YHW A;  3V9S A;  3WXL A;  3K0S A;  4A5B A;  5BR8 K;  5HBM A;  5BRF A;  5AQT A;  1YHQ N;  1NGF A;  3SCX A;  3IKM A;  3V6D A;  1R0A A;  3NGI A;  4DLG A;  3NVK A;  3OYN A;  3K5O A;  4DTX A;  3CER A;  2F4V K;  1GLD G;  4IDH A;  3SUP A;  4FZZ A;  4CF1 A;  4HWI A;  4LFB K;  1UWB A;  3MED A;  1LOT B;  5KQD A;  3ITH A;  2RE2 A;  3TAN A;  4DTP A;  3SJJ A;  4B3M K;  4AF1 A;  2W6K A;  5FPD A;  3WNF A;  1NJZ A;  3TR8 A;  4DSE A;  4B1Z A;  3HK2 A;  1L3U A;  3QFU A;  4M3Z A;  4CJ4 A;  1JLQ A;  3AA2 A;  1R59 O;  3KLG A;  4JKA A;  4OX9 K;  1U04 A;  3U9Z A;  4OJR A;  1X1P A;  3WXM B;  4BQZ A;  4X64 K;  5ELZ A;  2UU9 K;  2E1Z A;  3J81 O;  1KVB A;  3VQB A;  4A2A A;  3T1A A;  3VEZ A;  1U48 A;  5LMU K;  2O8F B;  3QBW A;  3NVM A;  1JL1 A;  4FM1 A;  4R79 A;  4LSL A;  4M42 A;  3HO1 A;  1BUP A;  2P9K B;  1XNR K;  4N56 A;  4U7B A;  3VQC A;  5CYM A;  4DSI A;  4M7Y A;  2QM1 A;  5H1S Q;  3R9P A;  3NH1 A;  3EZW A;  1XC9 A;  3VTH A;  3AAP A;  3O4N A;  1JLG A;  3QIP A;  4HCB A;  2D4W A;  3THX B;  4MO4 A;  3BP8 A;  4HTU A;  3NMU A;  2GV9 A;  3BDP A;  3SUN A;  3KKR A;  3V1Q A;  3CJ1 A;  2O8D B;  2IC3 A;  3H45 C;  1U49 A;  3ZET A;  1NOY A;  1E3M A;  1N36 K;  2KZM A;  4YOW A;  4DTU A;  4Q0B A;  2UXB K;  4DS4 A;  1ZYQ A;  3VQQ A;  4KO0 A;  3WXI A;  4KKO A;  2ZWH A;  3V9W A;  1HUX A;  2G8W A;  4C8K A;  1NBW A;  2XY7 A;  4CHY A;  2QEX N;  4DFM A;  3LAK A;  4W5Q A;  5GAH P;  1BA0 A;  3TSP A;  4JI8 K;  2QKK A;  4M7X A;  3F5T A;  1MU2 A;  5SZT A;  1RDU A;  4YOV A;  1REV A;  4E1J A;  3DXM A;  3CJC A;  4B9S A;  3ATU A;  4FLV A;  3IUC A;  2OZM A;  3SLC A;  3U3Y A;  2JWL A;  4G1Q A;  1S72 N;  3PY8 A;  3DMJ A;  1WUA A;  1QSY A;  3M8Q A;  4CBW A;  4CJL A;  5F0X A;  3DLE A;  4CI6 A;  3LP3 A;  3J7Y P;  1ZC6 A;  3H1Q A;  3DOL A;  4WQ4 A;  2BUP A;  3RRH A;  3VN5 A;  2QTD A;  3FE1 A;  3O5B A;  4W5T A;  3AVN A;  4A5A A;  1JXE A;  3CCV N;  5J1E A;  3MWT A;  4LF5 K;  1SS6 A;  4MQ3 A;  1VQ5 N;  4A2B A;  3FGU A;  3KVG A;  4PUO A;  2H3G X;  1S9E A;  3P4I A;  5EXW A;  5LJW A;  3VQ7 A;  1T8E A;  1RTI A;  4DMN A;  2E2P A;  5BRE A;  1XNQ K;  5GIN A;  4BRG A;  2KFZ A;  1Q8I A;  4HUE A;  2QWM A;  1RNH A;  4FJM A;  3I0S A;  2QK9 A;  3B6O A;  3VEX A;  4JK7 A;  2WUS A;  4BVO A;  3K5N A;  4IWV A;  2BGG A;  3PIO L;  4M3T A;  2I7N A;  3DXK B;  3AO5 A;  1YUW A;  4CGD A;  4DS5 A;  4DF8 A;  3ZT4 A;  3JAM O;  4IG3 A;  5I9E B;  5AQV A;  1HQU A;  5MLC Q;  4B1V A;  2OPS A;  4FSV A;  4EIA A;  3I8B A;  4DTN A;  3THV A;  4FCY A;  1ZBU A;  1G15 A;  3EO3 A;  3T1Y K;  3HPO A;  1I39 A;  3THX A;  3SMS A;  4KAZ A;  1QSS A;  5BR9 A;  2WTU A;  3KZB A;  3MN9 A;  2PYL A;  4E7L A;  3ZT3 A;  2O8D A;  3R3L A;  1HJO A;  4DTJ A;  4K8X A;  2QA4 N;  4F9O A;  1XI1 A;  1EX4 A;  3ULE B;  2OCE A;  4CZJ A;  1HMV A;  1RDB A;  1NKE A;  4BC3 A;  3NF6 A;  4B9Q A;  4JD2 B;  5JIC A;  3J8A A;  1S6P A;  4NCA A;  4K25 A;  4JI2 K;  1EWQ A;  3D6R A;  3E9O A;  4RW9 A;  3OYD A;  3RR8 A;  1DLO A;  4ZTJ A;  3CCL N;  4K43 A;  2WOM A;  1X9M A;  3KKS A;  4BGB A;  2Q2R A;  3P83 D;  2FBV A;  3MN5 A;  2E8A A;  4RW4 A;  1WOQ A;  5CE3 A;  2ZD1 A;  3K5L A;  1CXQ A;  4GVM A;  4ISF A;  1IH7 A;  3ZX3 A;  4JI3 K;  4K0K K;  3A5N C;  2YNF A;  3I0R A;  3VA3 A;  1IV0 A;  1LW2 A;  4IOA L;  4X65 K;  3W3D A;  1T05 A;  1OVY A;  1HNX K;  3O4Q A;  2GEM A;  4QAG A;  1JCF A;  1TUU A;  1V4T A;  2ASP A;  2FBT A;  3E9L A;  4O4G A;  4DB3 A;  1BDG A;  1QQM A;  5K14 A;  5F2R A;  1VRU A;  3PO4 A;  4LF4 K;  4AQY K;  1N32 K;  4K8Z A;  1VQK N;  3V9Z A;  3AVL A;  3CXC M;  3DXK A;  3ID8 A;  4BRO A;  3AVB A;  3C94 A;  1KAY A;  3B6P A;  1HYZ A;  2IIR A;  3FFI A;  1RT4 A;  3IS9 A;  2QWN A;  5DM6 L;  5I3U A;  4B1U B;  1DTT A;  1V4S A;  4CEB A;  4E7H A;  1ZBH A;  2ASM A;  2GWJ A;  2NZT A;  2P9I B;  3DLG A;  4N47 A;  3JSM A;  1DTQ A;  5AQI A;  3ENH A;  1ATR A;  4CIG A;  5KGX A;  3LDS A;  4FJH A;  3EN9 A;  3DLL L;  4IEE A;  5ADX A;  5JMV A;  2YJF A;  2JGU A;  4FO0 A;  2VGM A;  3CME N;  1ASV A;  4IFE A;  1J53 A;  4V19 S;  3NGZ A;  4BRM A;  3SUO A;  4IEI A;  5AQX A;  4DTO A;  5TKW A;  4O44 A;  2QI2 A;  3SAG A;  3CHW A;  2G8V A;  2I5J A;  1OH5 A;  1X9J A;  3CIP A;  3AA5 X;  5FPE A;  1HJR A;  5AQO A;  5AQS A;  4DR6 K;  2IAJ A;  3G25 A;  4AHS A;  5GAG P;  4E89 A;  2VG5 A;  2QW9 A;  4H4O A;  4AHR A;  1HPZ A;  1BL3 A;  2D1K A;  4N76 A;  4FPB A;  4KB1 A;  3TAE A;  3TSQ A;  3W0L A;  4JD2 A;  4W5R A;  2RF2 A;  2KZZ A;  3V4I A;  5KPT A;  4EZ6 A;  4OGE A;  3M3Z A;  3D2F B;  4DLE A;  4JS4 A;  3M8S A;  1IBL K;  4BY9 C;  3NF8 A;  1NWK A;  3TAF A;  2NNW A;  3K9K A;  2HMI A;  2A1S A;  1TAU A;  3QO9 A;  3OS2 A;  4B9U A;  3AVH A;  5F1X A;  2WBN A;  3D2E B;  2W42 A;  1NKB A;  2IS3 A;  4I6M B;  1UOC A;  4CZI A;  1BO5 O;  3HYF A;  4GW6 A;  5GIO A;  4CEF A;  1KAX A;  1TK5 A;  3OYG A;  3OY9 A;  1RBS A;  3U8X A;  3WNG A;  3QER A;  3GOI A;  3GBT A;  4H5R A;  4WFA L;  3VA0 A;  3JS6 A;  4CK2 A;  4GV3 A;  4B9M A;  4YFU A;  4Z0U A;  4DUZ K;  3MEG A;  1YVU A;  3QEI A;  1Q18 A;  4CZF A;  3SQ1 A;  4JS5 A;  4OPK A;  1NKC A;  1CXU A;  4H0V B;  1N6Q A;  1OVQ A;  5BPL A;  1QTM A;  3RMC A;  4FJ8 A;  2GTD A;  2IOC A;  3OS1 A;  1YIJ N;  2F8T A;  3K9J A;  4DU4 A;  1RDD A;  3SBG A;  4OPJ A;  2P5O A;  1U47 A;  3FR0 A;  4OO1 J;  3WQT A;  3OJU A;  4KHY A;  4DV5 K;  3DAW A;  3ZSO A;  1NJY A;  3THW B;  1QZ5 A;  1VSF A;  2AJQ A;  3OHR A;  1X9S A;  3ALY A;  2G8H A;  1KVA A;  3L3V A;  4JN4 A;  2O8B B;  3DOK A;  2HVH A;  4L3Q A;  3L2U A;  3RTV A;  4FJX A;  4FJJ A;  4M3W A;  3IAY A;  2YNH A;  1HNZ K;  2IVP A;  1NGJ A;  3SPY A;  1JKH A;  1MWM A;  4DQQ A;  2P9I A;  3P1G A;  2RHK A;  1NNE A;  5DM7 L;  4CGG A;  2A6A A;  4C8N A;  2KLA A;  3BZC A;  1EP4 A;  5KPZ A;  3L2Q A;  1D9D A;  1E4F T;  4JI7 K;  4BG8 A;  3R1X A;  3AO2 A;  2AP1 A;  1CLQ A;  4YOR A;  4CHN A;  2Q3S A;  3CPE A;  2UUC K;  4DR2 K;  3MCP A;  4CD3 A;  2D0P A;  4FZX C;  4Y0W A;  1LCU A;  2OYQ A;  3AO3 A;  1H1V A;  1NGI A;  3A5L C;  3DRP A;  4FWM A;  1KFS A;  4CJ3 A;  3HST B;  3CYM A;  5M1Q A;  2BH1 A;  1KLN A;  3GDQ A;  2UUA K;  4PQU A;  2CH6 A;  3KIO A;  1JJ2 M;  2G8K A;  4KTW A;  2P9U B;  3KD5 E;  4BE1 A;  3TSU A;  4JI5 K;  3Q7C A;  3D2F A;  3ZX2 A;  3CC7 N;  2HOE A;  1KSP A;  2HB5 A;  3KHY A;  1VSK A;  3VEO A;  4RCH A;  1DGK N;  3HSC A;  2P9N B;  4CCH A;  2QXF A;  4LH5 A;  3D2E A;  1EWR A;  1WSI A;  3LP2 A;  4CJV A;  4JI6 K;  3MN6 A;  1RTJ A;  4I6M A;  5AQH A;  2E20 A;  2UXD K;  3PX4 A;  2HNY A;  1RT2 A;  3M8R A;  2RPI A;  3CCS N;  4DG1 A;  1JLF A;  4AM6 A;  5FPN A;  1J54 A;  4KTZ A;  4M63 C;  3LL3 A;  4QOZ B;  2CGL A;  3VEW A;  4CEZ A;  2OZS A;  4BRH A;  2ITG A;  4FWQ A;  3CPW M;  1A5W A;  4E1N A;  4UQG A;  4ZHR A;  1NM1 A;  4R5P A;  1IBM K;  3T1H K;  3PSF A;  3CQ8 A;  1ATN A;  1T3V A;  3LAM A;  4FOI A;  2YX6 A;  3CQY A;  2P9P B;  5AFU A;  4IDK A;  3AO4 A;  2VQF K;  5E41 A;  1RDC A;  1U2V B;  3THW A;  2E88 A;  2EWS A;  3CG7 A;  3O3H A;  3ASM A;  4DTS A;  3UE5 A;  3NF9 A;  1VQ8 N;  4O8U A;  1QVF M;  4ELT A;  2O8B A;  2KW4 A;  1NK0 A;  3RR7 A;  3I55 N;  5CYQ A;  1ZBS A;  4CE9 A;  4QS8 A;  4CFD A;  4IOC L;  3VEY A;  2ZE2 A;  4FXD A;  1D9F A;  4DQ8 A;  3FZF A;  3S3M A;  1LWC A;  5KGW A;  1N33 K;  3O9T A;  5A2Q O;  4RG8 A;  4ISE A;  2XHB A; 
#chains in the Genus database with same CATH homology
 3DI6 A;  4CES A;  1TKT A;  5HRO A;  1NK6 A;  1JLE A;  3NAE A;  3K5N A;  3HXM A;  2BGG A;  2XY8 A;  1WSE A;  3K59 A;  1BQM A;  5C24 A;  1NK7 A;  4M3T A;  3DLK A;  4F3O A;  5HP1 A;  1WLJ A;  3AO5 A;  1SL0 A;  4DF8 A;  4CGD A;  4DS5 A;  2YKN A;  2VG6 A;  3ZT4 A;  4Z4H A;  1RT7 A;  3NH2 A;  3OYA A;  3RMA A;  4CIE A;  4IG3 A;  3C6T A;  3H08 A;  4CEA A;  4KRF A;  4B9V A;  1HQU A;  1RBR A;  3TAB A;  3OYE A;  2OPS A;  4C8O A;  4E19 A;  1Q9Y A;  3TAM A;  3UIQ A;  4DTN A;  3THV A;  1FK9 A;  3P5J A;  1NK4 A;  4FCY A;  1X9W A;  1S9G A;  1ZBU A;  4IKF A;  1G15 A;  3DLB A;  4KI6 A;  5SWM A;  1S1T A;  1LAV A;  1TV6 A;  3QEX A;  3NGY A;  3HPO A;  1I39 A;  4OVL A;  5DK5 A;  3DLR A;  4KAZ A;  4LD0 A;  1QSS A;  1RBV A;  1L3V A;  4I9L A;  3LAL A;  4M3X A;  2PYL A;  4E7L A;  3ZT3 A;  4KHN A;  3PV8 A;  4CED A;  4J2D A;  4CJK A;  4BWJ A;  4CF9 A;  4DTJ A;  4ZTF A;  5FRM A;  3VQ8 A;  4K8X A;  3PUF A;  1IG9 A;  4BE2 A;  2HHT A;  1XI1 A;  4M41 A;  4JRQ A;  4AHC A;  2Y1J A;  4F2R A;  1EX4 A;  3F9K A;  1HMV A;  2WON A;  4CJ5 A;  2YV0 X;  1RDB A;  1NKE A;  3QIN A;  2HHS A;  4Q5V A;  3K2P A;  3L2R A;  2F8S A;  4B8C A;  3T3F A;  1Y97 A;  3ZT2 A;  3L2V A;  3G10 A;  3NF6 A;  4L8R B;  3NHG A;  3HL8 A;  3D0P A;  3SV4 A;  1SV5 A;  2E4L A;  4PA1 A;  4E3S A;  2PYJ A;  3HJF A;  2BE2 A;  4CF8 A;  1RBT A;  1JL2 A;  4FK0 A;  2DY4 A;  1VSL A;  2E6L A;  1S6P A;  1TKD A;  3ZSX A;  3O3G A;  4DQI A;  3G0Z A;  3V1O A;  4NCA A;  5FRN A;  4FYD A;  2OPR A;  1TL1 A;  1HNV A;  3QNO A;  4ELV A;  4Y1D A;  1FKP A;  1B9D A;  1RIL A;  5T7B A;  2QK9 A;  1IKY A;  4KHS A;  1TAQ A;  4RW9 A;  4CHQ A;  4CJF A;  1EET A;  3OYD A;  2YNG A;  3ZT1 A;  4CEQ A;  3RR8 A;  1DLO A;  1EXQ A;  1KLM A;  1QQC A;  1RT5 A;  4ZTJ A;  3TAG A;  3PO5 A;  3MEE A;  3IG1 A;  1SKW A;  2PZS A;  4KTQ A;  2HHQ A;  1WNS A;  5JS1 A;  2WOM A;  5FRO A;  3NFA A;  3ZCM A;  1GOA A;  3KKS A;  1X9M A;  1S1W A;  2HHV A;  4CEE A;  4NCB A;  1VSJ A;  1BGX T;  2O4I A;  3P83 D;  1C0U A;  5C25 A;  4E7K A;  2FBV A;  2NUB A;  3AVF A;  3OYC A;  3V9X A;  1NOZ A;  4RW4 A;  4H8K A;  4FM2 A;  2PY5 A;  1LAW A;  1NK9 A;  4E7J A;  1TKZ A;  3NH0 A;  2ZD1 A;  4O0J A;  3K5L A;  4I9Q A;  1CXQ A;  2XHB A;  4GVM A;  3VQ9 A;  4Z4C A;  1S1X A;  1TGO A;  4NYF A;  3OYL A;  3SNN A;  1UAX A;  1IH7 A;  1BCM A;  4CEO A;  4CHP A;  1QS4 A;  3CFP A;  4FLZ A;  4FJ5 A;  4FK4 A;  1YTU A;  2EHG A;  1C1B A;  1CZB A;  1VRT A;  1W9H A;  1T03 A;  4KB0 A;  4LH4 A;  2LSN A;  1XHX A;  4DWI A;  3AVI A;  2YNF A;  3I0R A;  3VA3 A;  3SZ2 A;  2D0C A;  1ZBI A;  1WSH A;  1LW2 A;  4KRE A;  3VQA A;  3QEP A;  1T05 A;  4XIU A;  4F3T A;  3K57 A;  2DFF A;  1EKE A;  1VSI A;  2X74 A;  4J2E A;  5CZ2 A;  2GUI A;  2Y1I A;  1I3A A;  3O4Q A;  4QAG A;  4BAC A;  3OYI A;  2FBT A;  1J5O A;  4O4G A;  3L2W A;  2FBY A;  3QET A;  3OJS A;  5K14 A;  4FJI A;  1HQE A;  3ZSV A;  3AVJ A;  1VRU A;  5KRS A;  1L5U A;  3PO4 A;  4Z4F A;  5CY4 A;  4FLY A;  4KFB A;  3C6U A;  4K8Z A;  3V9Z A;  2HMI A;  2DFH A;  3AVL A;  1WSJ A;  4RW7 A;  4CJQ A;  4IBN A;  2G8F A;  4CK3 A;  1GOC A;  4FW2 A;  3IRX A;  3MEC A;  3AVB A;  1TK0 A;  3C94 A;  3B6P A;  4E1M A;  1HYZ A;  3FFI A;  4DFP A;  1NJW A;  4FJ9 A;  1RT4 A;  4AHT A;  3IS9 A;  2DFE A;  4CIF A;  4EZ9 A;  4CF0 A;  4EP5 A;  3SQ0 A;  5I3U A;  1S6Q A;  4J2A A;  1DTT A;  1T7P A;  5HRS A;  4CEB A;  4E7H A;  1ZBH A;  4KI4 A;  3ZSW A;  4I7F A;  4ICL A;  5J2N A;  4B3O A;  2FBX A;  2Z1J A;  3DLG A;  4FM0 A;  3SYZ A;  3VQ5 A;  4N47 A;  2A1R A;  3JSM A;  1DTQ A;  1IKW A;  1GOB A;  3DRR A;  2OPQ A;  3VQE A;  4AIL C;  4FVM A;  4CIG A;  5KGX A;  3LDS A;  4FJH A;  4OLB A;  3QIO A;  4CFA A;  4CF2 A;  4DSL A;  3BGR A;  2JGU A;  3AA4 A;  3QLH A;  1LWE A;  1HYS A;  4HHT A;  4LY7 A;  4FZY A;  3MAQ A;  1ASV A;  2D0A A;  1J53 A;  1IO2 A;  3QEW A;  3CM5 A;  3HP9 A;  3NGZ A;  4BDZ A;  3SUO A;  3VQ4 A;  3S3N A;  1UA0 A;  2P5G A;  3HP6 A;  1L3T A;  4KPY A;  3ZSY A;  1ZBL A;  4DSJ A;  4DTO A;  1SKS A;  3QNN A;  1SL1 A;  2X6S A;  3ZT0 A;  1JLB A;  4O44 A;  3K58 A;  4BE0 A;  2GBZ A;  3AVC A;  3OVN A;  2Z1H A;  2G8V A;  1SUQ A;  2I5J A;  4ID1 A;  1C1C A;  2R7Y A;  4O55 A;  1C1A A;  1ZBF A;  3AA5 X;  1HJR A;  4F8R A;  3RWU A;  5C42 A;  1UA1 A;  3QES A;  2KTQ A;  3DLH A;  1LV5 A;  1NK5 A;  3EZ5 A;  1Z25 A;  1KTQ A;  2IAJ A;  4OKE A;  4N41 A;  3SPZ A;  4AHS A;  4CJW A;  4TSX A;  5I42 A;  4E89 A;  4B9T A;  2P51 A;  2VG5 A;  3JYT A;  4CGJ A;  1Z26 A;  4BWM A;  3HVT A;  1JLC A;  1HPZ A;  1WAF A;  2ATQ A;  1BL3 A;  4H4O A;  4JLH A;  3T19 A;  4AHR A;  4N76 A;  4CJT A;  3LP0 A;  4CHO A;  3M8P A;  4DSF A;  1C6V A;  3TAE A;  1BQN A;  1O1W A;  3LPT A;  4KB1 A;  2HW3 A;  1WSG A;  1ASW A;  4OLA A;  3LP1 A;  4W5R A;  2HVI A;  2RF2 A;  4IFV A;  1W0H A;  2KZZ A;  2B5J A;  1CZ9 A;  3V4I A;  4Y1C A;  4DFJ A;  4O0I A;  4CK1 A;  4EZ6 A;  1RDA A;  2VWJ A;  4OGE A;  3KK1 A;  3ZSR A;  2OPP A;  1RTH A;  1TVR A;  4DLE A;  3RMD A;  1HRH A;  3SQ2 A;  2X6N A;  1NK8 A;  4C8M A;  3M8S A;  4JS4 A;  3KJV A;  2FC0 A;  1XHZ A;  4F4K A;  1JLA A;  2HHU A;  3DRS A;  3NF8 A;  2XY5 A;  4J2B A;  1VSM A;  4IFY A;  4OKK A;  3TAF A;  4B8A B;  5CZ1 A;  2JLE A;  2A1S A;  3AVK A;  3V1R A;  2EX3 A;  3QO9 A;  4CGH A;  4CGI A;  3ISN C;  3OS2 A;  3KTQ A;  4DSK A;  1TAU A;  4B9U A;  3AVH A;  3O3F A;  3EY1 A;  3AVA A;  1NJX A;  5KRT A;  3CM6 A;  4M3Y A;  2W42 A;  2Z1G A;  2IS3 A;  4EP4 A;  1NKB A;  2O4G A;  4Z4E A;  4RW6 A;  1UOC A;  1U45 A;  4CJU A;  3HYF A;  3CFR A;  4GW6 A;  3AV9 A;  3DM2 A;  3U3G A;  2XRI A;  3NCI A;  2D0B A;  4CEF A;  4DQS A;  1TK5 A;  3OYG A;  3KLH A;  3K5M A;  1SKR A;  3OY9 A;  1RBS A;  5KTQ A;  4CJP A;  3WNG A;  3QER A;  5HLF A;  4CHZ A;  3VA0 A;  3PX0 A;  4HUF A;  4CFB A;  4CK2 A;  4B9M A;  4YFU A;  2HND A;  3OYK A;  4HUG A;  4Z0U A;  3QEI A;  3MEG A;  1YVU A;  3WNE A;  2G8I A;  1A5X A;  1BCO A;  2E6M A;  3SQ1 A;  3V9S A;  4NCG A;  3SQ4 A;  4JS5 A;  4OPK A;  3MXJ A;  1CXU A;  1NKC A;  5HBM A;  1N6Q A;  1VSE A;  3HPG A;  4RW8 A;  4W5O A;  1VSD A;  3EYZ A;  2XO7 A;  3RMC A;  1QTM A;  1QSL A;  3SCX A;  3SI6 A;  4FJ8 A;  2IOC A;  3OS1 A;  3V6D A;  1R0A A;  2DTU A;  3NGI A;  2F8T A;  4DLG A;  1VK0 A;  3OYN A;  4DU4 A;  3K5O A;  4DTX A;  1RDD A;  4PY5 A;  4E7I A;  4OPJ A;  2P5O A;  1U47 A;  2VG7 A;  1SL2 A;  2OA8 A;  3OJU A;  4KHY A;  3OYB A;  3HPH A;  3ZSO A;  3KLE A;  1NJY A;  3SUP A;  4FZZ A;  4CF1 A;  3V81 A;  1VSF A;  1HNI A;  2AJQ A;  1X9S A;  3ALY A;  2G8H A;  1B92 A;  1KVA A;  1UWB A;  3L3V A;  3MED A;  4FJN A;  1RT6 A;  2YHB A;  3ITH A;  2HNZ A;  1B9F A;  4AHV A;  3WNH A;  3TAN A;  3NDK A;  3DOK A;  4O5B A;  3RTV A;  3L2U A;  2HVH A;  3ZSZ A;  4DTP A;  2Z1I A;  3SJJ A;  4BDP A;  4FJX A;  4FJJ A;  3V9U A;  4M3W A;  4M45 A;  3IAY A;  3LZI A;  2YNH A;  3WNF A;  3OYM A;  1RT3 A;  1NJZ A;  2BAN A;  3AA3 A;  3TR8 A;  1ASU A;  4DSE A;  4OGC A;  4F2S A;  3OS0 A;  3HK2 A;  3HM9 A;  1L3U A;  2BDP A;  3KLF A;  3SPY A;  4M3Z A;  1JKH A;  4CJ4 A;  1JLQ A;  3AA2 A;  3KK3 A;  2KFN A;  4DQQ A;  3RMB A;  3KLG A;  2B6A A;  3P1G A;  5FDL A;  3LWM A;  1U04 A;  2YNI A;  1X1P A;  4OJR A;  1C0T A;  1KVC A;  4CGG A;  1U4B A;  1QE1 A;  1WSF A;  3MXM A;  3NBP A;  4M3U A;  1KVB A;  3VQB A;  3S9H A;  4C8N A;  3L3U A;  3T1A A;  1U48 A;  1TKX A;  3KD1 E;  4DU1 A;  1EP4 A;  4N5S A;  3L2Q A;  1D9D A;  4CJS A;  1KRP A;  3AO2 A;  1FKO A;  3A2F A;  1CLQ A;  4I2P A;  1JL1 A;  3TWH A;  4FM1 A;  4CHN A;  2Q3S A;  1KCF A;  4M3R A;  4LSL A;  3S3O A;  1Q9X A;  4M42 A;  4FLX A;  3HO1 A;  2ZQB A;  4N56 A;  1LW0 A;  4ID5 A;  3VQC A;  4FZX C;  5CYM A;  4DSI A;  1BIS A;  2IDO A;  4H4M A;  2OYQ A;  3AO3 A;  3NH1 A;  1XC9 A;  2B4J A;  4CJR A;  1RCH A;  3D45 A;  3DRP A;  3LPU A;  4MFB A;  2G8U A;  3O4N A;  1JLG A;  3QIP A;  4HCB A;  3CFO A;  1KFS A;  4CJ3 A;  4KHW A;  4KHQ A;  4E0D A;  3HST B;  3CYM A;  4HTU A;  1K6Y A;  2GV9 A;  3BDP A;  3SUN A;  4ELU A;  2RN2 A;  3KKR A;  1KLN A;  3TI0 A;  3V1Q A;  4C8L A;  4BDY A;  2IC3 A;  4PQU A;  1A5V A;  1U49 A;  3KIO A;  4FLT A;  1BIZ A;  1NOY A;  3F73 A;  1RBU A;  2G8K A;  4KTW A;  2KZM A;  1LWF A;  1YT3 A;  3KD5 E;  4DQP A;  4KV8 A;  4Z4I A;  1WN7 A;  4DTU A;  4Q0B A;  1RTD A;  3VQ6 A;  4BE1 A;  4JRP A;  4DS4 A;  3ZSQ A;  4Z4G A;  1ZYQ A;  3VQQ A;  1ITG A;  4KO0 A;  1KSP A;  2HB5 A;  3OYJ A;  4FLU A;  5J2Q A;  4KKO A;  1VSK A;  3HT3 A;  3V9W A;  1VSH A;  4NYN A;  5JS2 A;  3VQD A;  2G8W A;  2YHA A;  1YTA A;  4C8K A;  2XY7 A;  4CHY A;  4LSN A;  4WE1 A;  4FJ7 A;  3TAQ A;  4DFM A;  3LAK A;  5HRN A;  5HRR A;  4W5Q A;  4CCH A;  2QXF A;  4LH5 A;  4CJV A;  1WSI A;  3LP2 A;  4CFC A;  2QKK A;  5HRP A;  4DTR A;  1XWL A;  4YNQ A;  1RTJ A;  4CEC A;  3PX6 A;  4HVJ A;  1MU2 A;  5SZT A;  4FK2 A;  1REV A;  3C95 A;  2YKM A;  3I8D A;  4DQR A;  3PX4 A;  2HNY A;  4B9L A;  1J9A A;  2P1J A;  1RT1 A;  1RT2 A;  1S1U A;  2IGI A;  2RPI A;  3M8R A;  4DTM A;  4B9S A;  1TL3 A;  4DG1 A;  4FLV A;  3SUQ A;  1JLF A;  4FW1 A;  3AVM A;  2OZM A;  1C0M A;  3NF7 A;  1J54 A;  3U3Y A;  1L3S A;  4KTZ A;  2D5R A;  4W5N A;  4G1Q A;  5J2P A;  3PY8 A;  4I2Q A;  3OYF A;  3DMJ A;  2XY6 A;  4QOZ B;  4CEZ A;  1QSY A;  2OZS A;  4FJK A;  3E01 A;  3KLI A;  2X78 A;  3M8Q A;  2ITG A;  4CJL A;  1A5W A;  3DLE A;  4E1N A;  4UQG A;  4ZHR A;  4CER A;  1JXB A;  4CJE A;  4R5P A;  4IG0 A;  3LP3 A;  3HVR A;  3QEV A;  5D3G A;  3TAR A;  2ETJ A;  3CQ8 A;  1BIU A;  3OYH A;  4B9N A;  3DOL A;  3LAM A;  3RRH A;  2KQ2 A;  3VN5 A;  3NE6 A;  5EU7 A;  1IKX A;  3ULD A;  4IDK A;  3AO4 A;  4W5T A;  1BI4 A;  1BHL A;  3AVN A;  3L8B A;  4QCL A;  2HHX A;  5E41 A;  1BI4 B;  1RDC A;  3LWL A;  5J2M A;  4FJL A;  1JXE A;  1KFD A;  4OKJ A;  5J1E A;  4KHU A;  3CG7 A;  3O3H A;  3ASM A;  4DTS A;  3RRG A;  1S5J A;  4B08 A;  1N5Y A;  3NF9 A;  5KI6 A;  4DFK A;  3TAP A;  3LZJ A;  2RKI A;  4MQ3 A;  2KW4 A;  4FLW A;  4ELT A;  1TK8 A;  4PUO A;  1NK0 A;  4GMJ B;  3RR7 A;  4AH9 A;  4HCC A;  1IKV A;  1S1V A;  5CYQ A;  1D8Y A;  5DMR A;  2QKB A;  1S9E A;  1HYV A;  3DYA A;  4PWD A;  4CE9 A;  3KK2 A;  3VQ7 A;  4CFD A;  1WAJ A;  3SV3 A;  1T8E A;  1D5A A;  1RTI A;  3LAN A;  2HHW A;  2ZE2 A;  4FXD A;  1D9F A;  4DMN A;  3U6F A;  3S3M A;  1LWC A;  4DU3 A;  5KGW A;  1Q8I A;  2KFZ A;  1F21 A;  3AVG A;  2VWK A;  3MXI A;  4DF4 A;  4HUE A;  4CGF A;  3AO1 A;  1RNH A;  2F96 A;  3I0S A;  4RG8 A;  3B6O A;  4AHU A;  4FJM A;  1QHT A;  3VQP A;  1FXX A;  4FJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...