2E2PA

Crystal structure of sulfolobus tokodaii hexokinase in complex with adp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
298
structure length
298
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 104
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2pA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2pA01
1JCFA 3EKSA 4F9OA 2D0PA 2Q1NA 5E26A 2YHWA 4BRGA 1GLDG 2F9WA 4BROA 3DJCA 3QICA 1K8KB 2W40A 1U2VB 3FZHA 3BP8A 4BR5A 5JLHA 2YCHA 2Q31A 1QZ5A 2E1YA 4HTLA 4XH4A 4BR2A 4BGAA 2BUPA 4H0VB 1D4XA 1E4GT 2HMPA 3GDQA 1S3XA 3J8AA 3LDOA 3HI0A 2FSNA 3ID8A 4FWKA 4JN4A 1EQYA 1BA0A 3RSEA 4BRDA 3MDQA 4FWMA 4BQZA 2P9LA 3I33A 3UKRA 3IMXA 4LC9B 3SMSA 3CJAA 3LDPA 4H5VA 2UYTA 2ASPA 2QWMA 2A40A 5AQGA 2Q97A 1CZAN 1TUYA 2GWJA 1XC3A 5BRDA 3R8EA 2E2QA 3GE1A 4H5RA 4IJAA 5LY3A 4O8KA 2QW9A 3RSEB 5EVZA 3ZX2A 4NB4A 2P9LB 4H5TA 3GOIA 3UKRB 2FXUA 3QFUA 2NRHA 3M6GA 1DKGD 2CGJA 4BRQA 4BRFA 2ZF5O 3AAPA 2VWBA 1T6DA 5KQ8A 3LDQA 3QDKA 2Q36A 4B1XB 1DGKN 1NWKA 3LDNA 4FWOA 5FPMA 4QS9A 1QHAA 1NMDA 4FPAA 2D4WA 3O4WA 2VYPA 4CZHA 3FZMA 1SQKA 5AQHA 3QMLA 1RGIA 1HLUA 1G99A 2QWRA 4IZ9A 2QXLA 3QBXA 3VF6A 3H1QA 3CJ1A 3QBWA 4JHDA 1ATNA 2YHXA 4FWLA 4NO7A 2P9PB 5AQMA 3VGKA 5F0XA 4BRIA 2A6AA 2P9SA 3CJ7A 4K43A 4WQ5C 3AAQA 3ULEB 4RWTA 4BRHA 3BEXA 1C0FA 1Z6RA 1BWFO 1Y64A 4PKHA 3SK3A 3O5BA 4IO8A 4J8FA 1YXQA 3L4IA 2GELA 4PL8A 3L0QA 5AQOA 2E8AA 4JHDB 4H0TB 3I8BA 3CI5A 5AQVA 1ESVA 3WEEA 5EXWA 2P9SB 2Q0UA 4EFHA 5KQDA 4CJ7A 3VF4A 4AM7A 2GUPA 2ZWHA 2P9UA 4XEIA 2V7YA 1XUPO 1E4FT 3JXUA 3A5NC 1ZC6A 4B1VA 5JMVA 4DB3A 2WUSA 4MLEA 3A5OC 3WEEB 5BRHA 1NGBA 3O1BA 3BUZB 5FPDA 4BRAA 3CQXA 1Z05A 2FLOA 4DQ8A 2P9UB 3H46O 4WQ4C 4CZLA 5AQKA 3HM8A 3VERA 2YJEA 2OANA 4FOEA 2CGKA 4B9QA 1KAXA 2E2NA 4CZKA 1V4SA 3KVGA 1QQOA 4JNEA 4GNIA 4Y0WA 4CZFA 5EY4A 3ZX0A 4H5NA 1NBWA 3KHYA 4FWRA 4A62A 2NZTA 4CZJA 3CETA 3R6MA 4ISEA 5AQRA 3TU5A 3D7EO 4EHUA 1SAZA 3AARA 5BPLA 3L6QA 1KXPA 3H6EA 2E20A 4QS7A 1YUWA 4BR7A 2QWNA 4H5WA 4BQLA 4M7XA 5BR9A 1QZ6A 2AP1A 1NGCA 4H0OA 1ATSA 5BN9A 3WXIA 3C0BA 3WXJA 5I9EB 1ZBSA 1P8ZA 5AQTA 3VGMA 1U6ZA 3D2FA 5AQUA 1YVNA 3HZ6A 4H0PA 1DEJA 2J4RA 4JAXA 5AFUH 3WUHA 3EZWA 5AQNA 1ATRA 1GLAG 1HJOA 2H3GX 4DHYA 3M1FA 1NGFA 2AA4A 2IVPA 2P9IA 3MMVA 3D2FB 4K25A 4FWNA 5KPRA 3FR0A 3GG4A 1BA1A 3W0LA 4BR9A 1T6CA 1NGEA 1MDUB 2IIRA 2GEMA 4CI6A 2P9PA 3HSCA 1X3MA 4BC2A 1NM1A 4FSVA 2P9IB 2E2PA 3ULEA 3R9PA 1IG8A 2GWKA 3CJ9A 3D2EA 4CBWA 3VEYA 2QWOA 3EO3A 3CJCA 2QWPA 5EX5A 4FWPA 3ZETA 1MWKA 1GLEG 5AZJA 3MK6A 4K42A 4BRMA 3ZX3A 5ADXA 2E88A 4L3QA 2QWQA 1MWMA 1HUXA 3D2EB 3C7NA 4O5FA 3U9DA 4PKIA 2W41A 4RTFD 1QQNA 3ZETB 1H1VA 1BU6O 1WOQA 2QWLA 2GTDA 5AZJB 3ATUA 3VGLA 5AQWA 1T44A 4BC5A 4BRCA 5JICA 2ZGZA 3O8MA 4BVPA 3H45C 1X3NA 4I6MA 2F9TA 3SJHA 4QS8A 3JS6A 3C7NB 3FZKA 1NLVA 3U4LA 2FF6A 3G25A 2CH6A 3MCPA 4FL9A 3A0IX 4BGBA 3MN7A 4EAHD 3O1WA 4CD1A 4ISGA 1BG3A 3WXLA 3HBTA 5AQIA 4I6MB 3WQUA 3VOVA 1ZXOA 3EKUA 5E84A 4EIAA 4K41A 2V51B 3DAWA 4BVOA 1YAGA 1BO5O 4FOIA 2HOEA 3ENHA 2DPNA 4BRPA 5B8HA 2PBDA 4ISFA 5BRFA 5BPNA 4FWQA 3MN5A 4CZMA 4A61A 3FFKB 5AQFA 1HPMA 2Q2RA 4CZGA 2YI1A 1TUUA 3SLCA 4EHTA 5FPNA 3EN9A 3VENA 1BUPA 3IUCA 2NLXA 4XH5A 3KZBA 5AQQA 4A2BA 5BN8A 3CIPA 3MN9A 2I7NA 4PKGA 3CERA 4M63C 3SMPA 3B8AX 2E1ZA 2HF3A 5FPEA 4HWIA 3VEOA 5BPMA 4CBUA 4H03B 1NGDA 5AQXA 5AQJA 3LDLA 1LCUA 2PAVA 3BF1A 1MA9B 2KHOA 4B1YB 4BG9A 1HKBA 4BRKA 1RDWX 3DWLA 4FWSA 5EOYA 1QQMA 1XQSC 3CHWA 3QB0A 3ENOA 3CJBA 3FGUA 1KAZA 4BC3A 4CZIA 3H3OB 4BREA 3O08A 5LJVA 3VPZA 3A5MC 3LM9A 3O6WA 5AQLA 2A42A 4CD3A 2I7PA 2IVOA 4CZEA 3WXKA 2CGLA 2FF3B 5AQPA 4BRNA 1V4TA 3VETA 3IFRA 1HKGA 1Q18A 2FSKA 1GLFO 1HKCA 5KPZA 1WUAA 4A2AA 1C0GA 3CQYA 4WQ5A 4AM6A 3F9MA 1JCGA 1GLJO 2A41A 2BTFA 3DXMA 4FPBA 3GBTA 3DXKA 4IXCA 4MO4A 2ASOA 3P4IA 3UKUA 1IJJA 4XH1A 1S22A 5AZIA 3GL1A 1GLBG 4H0YB 3U9ZA 1GLLO 2E2OA 4DCHA 3EL2A 4KBOA 2D0OA 4FO0A 2P9KA 5F2RA 4BR4A 2V52B 3DXMB 4MLHA 3VF2A 2D1KA 3FZLA 3DXKB 4IJNA 4YDUA 4Z94A 3FE1A 2IVNA 3VEZA 3UKUB 1NGAA 5AZIB 1TYQA 3FZFA 3UE5A 4B1WB 3MN6A 1JCEA 5AQYA 3O80A 1GLCG 2P9KB 1NGJA 4C23A 5CE3A 1NGHA 4WQ4A 3A8YA 2A3ZA 3ATVA 4B1UB 2V7ZA 3H1VX 2ITMA 1OKJA 3VEXA 5AQZA 4BRLA 5KPTA 1TYQB 1X9JA 4MO5A 2Q0RA 4BG8A 2YHYA 4E1JA 3UB5A 2FSJA 3S41A 2CH5A 5AR0A 3VESA 3W3DA 5ELZA 4PL7A 4JD2A 3BF3A 5ADXH 4M7YA 2ZGYA 3OHRA 1J6ZA 4YDUC 3WQTA 4WYBA 1KAYA 4B1ZA 1NGGA 2A5XA 5BREA 2P9NA 3H3NO 2ASMA 4JD2B 1BDGA 4GY2B 5LJWA 3M3ZA 1HX1A 1SZ2A 2HF4A 3AY9A 3HTVA 2EWSA 4RCHA 5AQSA 5JLFA 1LOTB 2YJFA 3LM2A 3ZEUA 4BR0A 3TPQA 3FLCO 3U8XA 1BOTO 5AFUA 2QM1A 3WT0A 5F1XA 1RFQA 1NGIA 4CBXA 3VEVA 1K8KA 1R59O 1U2VA 2P9NB 4BC4A 5TKYA 4H0XB 3A5LC 2VCPA 4IWVA 3VEWA 3QFPA 3LL3A 3ZEUB 3IDHA
chains in the Genus database with same CATH superfamily
3DJCA 3QICA 1SL1A 3FZHA 1HNZK 2E1YA 3CMAN 1VAZA 1LWFA 4CJUA 4BR2A 1NJYA 2BUPA 4GMJB 1E4GT 3GDQA 1TKTA 4IFVA 3SCXA 4DV4K 1S3XA 4FXDA 2BH1A 3ID8A 1BA0A 4BRDA 2P9LA 3I33A 5LL6Z 4B9SA 2A40A 3MXJA 3U6FA 5AQGA 2HBKA 3WNGA 4E89A 2O8FA 4FYDA 3CFPA 4HVJA 1QE1A 3R8EA 1Y97A 4IJAA 3AVCA 3RSEB 1VQ8N 3ZX2A 4C8KA 4H5TA 3UKRB 1SUQA 2FXUA 4A5AA 2X6SA 4F3TA 3QFUA 2BDPA 2NRHA 1ZBUA 2ZF5O 1N6QA 2VWBA 2OZSA 3NH0A 4E7LA 2QA4N 1ZBLA 1KVCA 3QMLA 1CZ9A 4CHNA 1RGIA 3G6EN 3VF6A 4DR7K 4NO7A 3QBWA 1ATNA 2YHXA 4FWLA 4RW7A 5AQMA 5F0XA 4JI7K 3AAQA 2VQFK 4YFUA 1QSLA 2UUCK 1Z6RA 4GV9A 4PKHA 4CIGA 4L8RB 4AH9A 3L2QA 4CJ7A 5C10A 3SAFA 3SUOA 3C95A 4CGDA 5BR8K 1OH8A 3J7ZO 1S1VA 1TK0A 1QVFM 4B3SK 1E3MA 3JXUA 1S6QA 2Z1IA 1JLBA 1VQ5N 3A5OC 4DTNA 1IKWA 3AO2A 1SL2A 1ITGA 2IDOA 4BRAA 4KO0A 3ZSXA 5AQKA 1C1BA 4MDAA 1NK8A 2CGKA 3R3LA 4OPKA 1RBVA 2E2NA 4CZKA 1HRHA 4JNEA 4FLWA 4KHSA 1KTQA 5EY4A 3TSQA 4H5NA 3KHYA 3DYAA 4FWRA 2WOMA 5CR4A 2G8WA 1NK9A 3CETA 2JWLA 4JEPA 5EU7A 3TU5A 4DQPA 1RDUA 3S3NA 1KXPA 3H6EA 2OTJN 2E20A 1BCOA 4DS5A 1JL1A 1N34K 4H0OA 3IRXA 4B9TA 3AO1A 3EZ5A 3NH2A 5I9EB 3KLGA 1J9AA 5AQTA 2OA8A 3OA9A 1YITN 5AQUA 4EP5A 2ZJRL 4O8UA 3EYZA 4DF8A 3SNNA 3HZ6A 5M1NA 2O8BA 2J4RA 2RN2A 2O8DA 1BGXT 3EZWA 1JXEA 3AVHA 2H3GX 1NGFA 3OJUA 2AA4A 3MMVA 3D2FB 4K25A 4KTQA 4IG3A 4KI4A 4BWMA 3SAGA 3QO9A 3Q7BA 3ULDA 1MU2A 1MDUB 1WSGA 4CIEA 2P9PA 3ZT1A 2G8VA 4H8KA 3BZKA 2P9IB 2E2PA 3ULEA 5FDLA 4CBWA 4HUEA 1A5VA 1YJ9N 3KWGA 4FWPA 3ZETA 4CK3A 4C8OA 4JI8K 4OPAA 1VHXA 4K42A 2HNZA 5HBMA 1NK4A 3CXCM 3NGIA 3LP0A 3TAPA 2E88A 5HRRA 5FLXO 5GAEP 5E41A 4WFAL 2WTUA 3QIOA 3PX6A 3V1OA 4OX9K 4JI2K 1SL0A 1K73O 5M1PA 1QQNA 3ATUA 3VGLA 5AQWA 4CIFA 2O8EB 4LFAK 5JICA 3DLKA 3L3UA 3H45C 4I6MA 1L3UA 4QS8A 3SQ2A 1WBBA 3IKMA 4CF1A 2A1SA 1SS6A 2ATQA 3A0IX 4DLEA 3SUQA 2ZQBA 4DSJA 3KWIA 1T05A 1BG3A 3WXLA 1B9DA 3ZSVA 3NF9A 4FM1A 4K41A 3QINA 3DAWA 2DFHA 2FBVA 3ISNC 2UXBK 1Z26A 3LALA 1CXUA 1B92A 3EE9A 1VQON 4B9NA 3RTVA 2P5OA 4FCYA 5LMUK 3MAQA 1T3VA 1W2BM 5BPNA 4CZMA 2E4LA 3FFKB 4CZGA 4R5PA 2Q2RA 3SLCA 4CK1A 3PY8A 3AVIA 4W5NA 1XWLA 1Q9XA 3QNOA 4H4OA 3KZBA 5AQQA 4NYNA 4A2BA 2WBNA 3NDKA 1YJWN 4I9QA 2I7NA 4KAZA 4CFDA 5M1FA 2E1ZA 2HF3A 1RTDA 3BGRA 1Q82O 4Z4GA 3VEOA 4CJQA 4KHNA 2AJQA 3OYCA 4FJ9A 3P31A 4Y1CA 3LPTA 1BISA 4GKKK 1BI4A 4FJJA 1MA9B 4BDZA 3CQ8A 5EOYA 4PWDA 4DSEA 3MWPA 4CJEA 4C8LA 1T7PA 3FGUA 1KAZA 4JRQA 1TK5A 4CZIA 3HPOA 3I0SA 1XMOK 3VQBA 3MX2A 3A5MC 3LM9A 2PYLA 4CZEA 1JLEA 1KSPA 3T7ZA 3WXKA 4CVNE 2CGLA 5AQPA 4BRNA 1YI2N 1VK0A 2FSKA 2EHGA 1NK5A 4A2AA 3OW2M 3V4IA 4LFBK 1HJRA 4B8AB 4EZ9A 1I94K 1KCFA 2NRTA 3P4IA 4DU1A 1S22A 5AZIA 5HLFA 3U9ZA 4AHUA 1D9FA 3OYHA 3E9LA 3V81A 4B9UA 3ENBA 4DCHA 3C6UA 3MEDA 4MLHA 4CEAA 3V9UA 4PY5A 1WSFA 3DXKB 4IJNA 1P90A 3KLIA 2IVNA 3K57A 3AGRA 2OPSA 3FZFA 4M42A 3CC4N 5J2PA 4CCHA 3IG1A 3O80A 4CERA 2P9KB 5CHIA 3HOSA 4C23A 1NGHA 4E1NA 3A8YA 2A3ZA 4B1UB 1JLQA 1J53A 4BRLA 1VRUA 2X6NA 4JKGA 3OYJA 4LH5A 4FJIA 4LF6K 5JS1A 3W3DA 5ELZA 4JD2A 3BF3A 3DLRA 3SBTA 1TKDA 3SI6A 1VQPN 4KHPK 5CYQA 4KH6A 3WQTA 2Z1GA 2HVHA 4JKCA 4FLTA 4V19S 4KHQA 1YVUA 4PHTX 5LJWA 2OPRA 3M3ZA 5AQSA 5JLFA 4DV3K 4NCAA 3TAMA 1K8AO 3ZT0A 2YJFA 1R0AA 5AFUA 1C0UA 1Q8IA 5C15A 4A5BA 4FJHA 2F4VK 4CBXA 2P9NB 2RHKA 1VSDA 4H0XB 3VQ4A 2VCPA 3TAFA 3O3HA 3MEEA 2GX9A 3ZEUB 1VQ4N 3IDHA 4FLUA 1ZYQA 4C1NK 3VQ6A 4F9OA 2D0PA 1WSJA 4F3OA 4LF7K 2W40A 5JLHA 2YCHA 2Q31A 3MECA 1QZ5A 4CGGA 5DM7L 3IAYA 4HTLA 4BGAA 3B6OA 1OH6A 4CEDA 4U67L 1VSMA 3LDOA 3HI0A 3HJFA 1K9MO 1DLOA 3DRRA 5KTQA 3RSEA 1BL3A 4FWMA 3UKRA 4CF9A 2P5GA 3CJAA 3LDPA 4B08A 1QHTA 2QWMA 2FC0A 1CZAN 1TUYA 3AA4A 2OZMA 1KLMA 5BRDA 5K14A 4H5RA 4BWJA 3SBGA 4O8KA 1IBKK 5EVZA 2LSNA 1Q7YO 4IBNA 4DR2K 1X1PA 1D8YA 1RCHA 2CGJA 4BRQA 1T6DA 3LDQA 3VTHA 4BE1A 4M3YA 4OKKA 4DV0K 4HUFA 3CMEN 1NWKA 2JLEA 3LDNA 3KTQA 1NMDA 2D4WA 3O4WA 3TI0A 4IEIA 2RKIA 4YY3K 3BZCA 1QS4A 3E66A 3QBXA 1XHZA 4DTOA 3I8DA 3HL8A 4YOUA 3OTOK 1W0HA 3O9QA 4PA1A 5KRTA 4N56A 1ZBHA 2I5JA 3NF8A 4CJVA 3L0QA 5AQOA 2E8AA 3V9ZA 3HPHA 3I8BA 5AQVA 1YJNN 1ESVA 5EXWA 2P9SB 1S5JA 2Q3SA 3VF4A 3LWLA 4PQUA 2ZWHA 2QKBA 3F73A 2VG7A 4XEIA 4DFKA 1XUPO 1TAUA 3THWB 3J80O 4B1VA 2WUSA 4MLEA 3L2UA 4AHTA 3WEEB 3WNHA 5BRHA 4CF2A 1RTIA 4HUGA 5FPDA 4ZTFA 1XNRK 1WSIA 2P9UB 1WBDA 4CZLA 4MQ3A 3OYLA 2YJEA 1XC9A 2OANA 1C1CA 3MWTA 2F96A 1KAXA 1KVAA 3RVCA 4AHRA 1V4SA 4W5QA 4FVUA 4CHQA 4GNIA 4Y0WA 2YHAA 3ZX0A 1NBWA 3TTCA 4A62A 4YOVA 3MEGA 1RT2A 3A2FA 4OGEA 4OJRA 2P51A 4W5TA 5BPLA 3F2KA 3L6QA 4BR7A 2QWNA 3CF5L 4M7XA 5BR9A 1FW6A 3H08A 4NLCA 5BN9A 3WXIA 2F8TA 3PV8A 4FLZA 5HROA 3VGMA 1U6ZA 3D2FA 4DR3K 4DU3A 1Q81O 1M90O 4JI4K 4AHSA 2Y1JA 1LWCA 1LAVA 1WAFA 1ATRA 1RNHA 1GLAG 1HJOA 3BY5A 1S1UA 2IVPA 2P9IA 4FWNA 1VQMN 3FR0A 3AGKA 3VA0A 1G15A 2VG6A 4DUZK 4BR9A 4IFEA 4DFPA 2GEMA 4ZHRA 1CLQA 2F7TA 4BC2A 4FSVA 3AA3A 4OKEA 4OPJA 3CJ9A 1UWBA 2QWOA 1RBUA 5EX5A 4J2AA 2P1JA 1MWKA 1W97L 1S6PA 4BY9C 4DV6K 2HHUA 3ITHA 2O8EA 3ZX3A 5ADXA 3DOLA 3SUPA 3I56N 4L3QA 1MWMA 5JVHL 2GV9A 3QEPA 1RT4A 2QWLA 4YORA 3C65A 4LH4A 1T44A 3O8MA 3CCLN 3CFOA 4BVPA 2F9TA 3VQ8A 3SJHA 5HRPA 5T7BA 4O0JA 1KFDA 3C7NB 1I3AA 4MDBA 3U4LA 4BGBA 4FL9A 2VWJA 3MN7A 4DTSA 4M41A 3CCEN 4B3RK 4CD1A 1JJ2M 3S9HA 2RF2A 3LP1A 3U3YA 2PFUA 3WQUA 2NRWA 3EKUA 5C25A 3AVMA 5E84A 4EIAA 1NKCA 3HK2A 2V51B 4CHZA 3V6DA 4FW1A 4CW7B 2HOEA 3I0RA 2BANA 3ENHA 4CFAA 2PBDA 2YNHA 4CJ3A 3DLBA 4B8CA 4FWQA 4A59A 3VMFB 2KLAA 1HPMA 1VSFA 2YI1A 1TUUA 4EHTA 4UQGA 5FPNA 2VQEK 1U4BA 1VSIA 3VENA 1BUPA 4XH5A 4CHOA 1FKPA 3OS2A 4CGJA 3MN9A 1WB9A 3AVGA 2YHBA 5C42A 4M63C 3SMPA 2F8SA 3OYMA 3B8AX 3DRSA 4GV6A 4NCGA 5BPMA 3SV3A 1HNWK 3LDLA 3CCVN 3V9XA 4CEBA 4Q0BA 1Q86O 1IO2A 3BF1A 4BG9A 1HKBA 4BRKA 4JI3K 1T03A 5IT9O 3DMJA 3MCAB 1VSJA 2XO7A 2IC3A 2OCEA 4NLBA 4FJKA 4FK2A 3QEIA 4BREA 4KHUA 5LJVA 3VPZA 4OPHA 3P83D 5AQLA 4FJLA 4CD3A 4CHYA 4B9VA 4IOAL 3VQ5A 1HKGA 4CFCA 2UXDK 1HKCA 5DK5A 4RW4A 2R7YA 1C0GA 4E19A 4FM0A 3F9MA 2A41A 4DU4A 3GBTA 1D5AA 3OYFA 3DXKA 5CZ2A 3N4QA 1WSHA 1JLAA 4KREA 4B9MA 4XH1A 4E0DA 3T3FA 5CY4A 3GL1A 4N41A 3G0ZA 1X9WA 3KD1E 3DOKA 3AA5X 3ZLJA 4DR4K 4FO0A 2P9KA 5F2RA 3DXMB 4CEFA 3VF2A 2D1KA 4CEOA 3WXMB 4M3RA 1VQNN 2YKMA 3AO4A 5GIPA 3VEZA 4O44A 4RG8A 2A1RA 4CJFA 4JKHA 1JLFA 4FJMA 3E9OA 1RDAA 1HNIA 4DFJA 5M1QA 4CJSA 1UOCA 1UA1A 4DV2K 1WN7A 3ZYYX 4GW6A 4DTRA 4LF4K 4CHPA 4OKJA 2ITMA 5KRSA 3ZSWA 5AQZA 2RE2A 4M45A 4QOZB 4CGHA 4MO5A 5CZ1A 2Q0RA 4I2QA 2YHYA 2YX6A 3UB5A 4CJRA 1HYZA 1VQ9N 3PIPL 2CH5A 5AR0A 3VESA 2E6MA 3EEQA 4DR6K 4M7YA 1NK7A 2O8CB 1YT3A 4BACA 3KLEA 4M3ZA 1J6ZA 4IO9L 4WYBA 1QSYA 5FRNA 3CCQN 2G8IA 3ZCMA 2Y1IA 5BREA 4UY8O 2P9NA 1BIUA 3PX0A 4KI6A 1UAXA 1DTTA 4M3WA 4RCHA 4M3XA 3ZEUA 3RRHA 4BR0A 4CK2A 2G8HA 3FLCO 3NCIA 1BOTO 1LWEA 4G9ZA 1NK0A 3NVKA 2QM1A 3WT0A 1VQLN 1OH7A 1RFQA 5D3GA 1GOBA 3VEVA 4DUYK 1R59O 3OY9A 4BC4A 3QETA 1NJZA 1C6VA 3NF7A 2W6KA 1IV0A 2OTLN 3LL3A 5SZTA 3EKSA 2ETJA 2HHXA 2Q1NA 4KHWA 1WSEA 3SV4A 2F9WA 4BROA 1LW0A 1K8KB 1S1WA 1RBRA 4BR5A 3BP8A 4XH4A 1D4XA 1IBLK 2HMPA 4JKAA 3J8AA 2FSNA 4JN4A 4X65K 1SKRA 4DR5K 3VQ9A 3ZT4A 4AF1A 3MDQA 4BQZA 2ZJQL 1NOYA 4DV1K 3IMXA 4LC9B 3J81O 4H5VA 2HHVA 3J7YP 2ASPA 3NGZA 5KI6A 2Q97A 3NVMA 4HHTA 2GWJA 1NOZA 1OVYA 5M1OA 4F2SA 3CCUN 3SPYA 4BDPA 3LWMA 1XMQK 4GVEA 4NB4A 4FJXA 3GOIA 1X9SA 2UXCK 4WE1A 1M1KO 5J2NA 1DKGD 1SKWA 2HHHK 5KQ8A 3QDKA 2Q36A 3PSIA 4B1XB 1ZBIA 3L2RA 1HNVA 4J2BA 4RW8A 1DGKN 4JYAK 3THXB 2UUAK 5FPMA 4IDHA 2HHSA 1YTUA 1QHAA 3L2VA 2VYPA 2Z1HA 5GIOA 2KFNA 1SQKA 5AQHA 3VQPA 1HLUA 1G99A 1W9HA 2QWRA 2XHBA 3H1QA 3CJ1A 3VGKA 2P9PB 3O3GA 2QKKA 1OVQA 4BRIA 2A6AA 2P9SA 4K43A 4WQ5C 3HP6A 4KB1A 3ULEB 3NBPA 4EZ6A 4BRHA 1NKBA 2G8UA 4ILGB 1Y64A 4JK9A 3SK3A 1XI1A 3PUFA 3QEVA 3O3FA 4J8FA 3TSPA 2HVIA 1Z25A 3L4IA 3M8SA 2GELA 3L2WA 4CJPA 4JHDB 4H0TB 4DKWA 3QNNA 2HNDA 4Z0UA 3THWA 3QERA 3CI5A 4FVMA 3WEEA 1YIJN 3AVBA 1C0TA 3OYNA 4AM7A 2GUPA 1BQNA 2P9UA 1S1TA 4IOCL 1YF5L 5FROA 3NH1A 1CZBA 4LSLA 2V7YA 3Q7CA 1E4FT 4KPYA 5HRSA 3O9TA 2HSTA 4FLVA 1L3VA 1VSLA 4LY7A 4DB3A 2O4IA 1L3SA 1NG9A 3NE6A 5DMRA 1Q9YA 2FLOA 1JLGA 3H46O 4JKBA 4WQ4C 3HOTA 4DLGA 3CPEA 2Z1JA 4FW2A 2DFEA 3KLFA 5I3UA 1BCMA 3KVGA 5DM6L 1QQOA 1EO1A 3HVTA 4DTJA 1HQEA 4FZYA 2NZTA 1SV5A 4ELVA 3L3VA 5AQRA 3VQQA 3D7EO 2QXFA 2HHQA 3AARA 4QS7A 3V9SA 1NJWA 4M3UA 1QZ6A 3HSTB 4KV8A 3T69A 1NGCA 4C1NI 2KQ2A 3C0BA 3DLEA 3WXJA 4WCEL 4MFBA 4LF8K 4GKJK 4CJ5A 3OYGA 3QESA 3CPWM 1DEJA 1S9GA 1RT1A 2YNIA 3M8PA 4O0IA 4Z4CA 3DI6A 5AQNA 3OYEA 2XRIA 3LP2A 4JKEA 4DS4A 3FFIA 4K8ZA 4DTMA 3OJSA 2PYJA 2NRZA 3CM6A 1BA1A 3G4SN 1RTHA 3PO5A 3KK3A 1I39A 5JS2A 1HMVA 1T6CA 3LANA 1NGEA 2PY5A 4CI6A 1X3MA 3K5LA 4FJNA 1JL2A 5J2QA 3MXIA 3AVJA 3R9PA 3TSUA 2GWKA 1WLJA 3LZJA 4ELTA 2HBMA 3OYAA 3QEWA 1GLEG 2DTUA 4I9LA 5MLCQ 3MK6A 1IKVA 4BRMA 2VGMA 3D2EB 3C7NA 3U9DA 4BDYA 2OPQA 1H1VA 2GTDA 5AZJB 2XY8A 4KH4A 3ZSZA 1ASVA 2HB5A 4BC5A 4BRCA 2X78A 4OLBA 4GV3A 1KD1O 3JS6A 2KW4A 3FZKA 4YNQA 1NLVA 1RT3A 3D0PA 3MCPA 3RMAA 1NMNA 3SQ1A 2WC9A 1BHLA 1TK8A 4ISGA 3VQDA 4X66K 5AQIA 4DSIA 4JS5A 2ZJPL 2HHWA 3BDPA 2VG5A 4FLYA 3PSFA 2XY7A 3ALYA 4CJLA 3JAMO 3RMBA 1IH7A 4E1MA 3KIOA 3ZT3A 1TL1A 1YAGA 1BO5O 4RW6A 3MX5A 4FOIA 2ITGA 4JV5K 3SQ4A 1YTAA 5B8HA 4N47A 3F5TA 5BRFA 4JK8A 4FZXC 4FK0A 1TVRA 2FBTA 3AVNA 2OPPA 3SPZA 4DMNA 3P39A 4O4GA 1BQMA 4DTPA 5C2DA 2NLXA 4FJ7A 1FK9A 2QK9A 5BN8A 3O4QA 2IAJA 2NRRA 3CERA 2D5RA 3LAKA 3MXMA 3SYZA 3CFRA 3HPGA 1VSHA 5FPEA 5IWAK 3G10A 2XY5A 5GAGP 4H03B 1NGDA 3RWUA 5AQJA 3R1XA 3TARA 4AHVA 1XNQK 5A2QO 1LCUA 1IKXA 1C1AA 4F2RA 1TGOA 3VA3A 4FWSA 1K6YA 1XQSC 4ID1A 3CHWA 3QB0A 2QI2A 4CE9A 3ENOA 1GOAA 4BC3A 3PLAA 3H3OB 3KK1A 4E3SA 3RMCA 3O6WA 2UUBK 2IVOA 3J7AP 4XIUA 1RDDA 3K5OA 2KFZA 2D0BA 3VETA 3THVA 3IFRA 1VQ7N 3AVKA 1WUAA 1HR0K 1TAQA 4TSXA 1JCGA 1GLJO 1RILA 3HT3A 1U47A 3DXMA 4CJKA 4ELUA 1ZBFA 1EX4A 1EXQA 2JWKA 4IXCA 4MO4A 4DQIA 4E7IA 1X9MA 1IJJA 2DFFA 4JI6K 1GLBG 4AQYK 4LD0A 4OVLA 3HO1A 1RDBA 2D0OA 3HRGA 4I2PA 4CEZA 3AV9A 4X64K 4E7KA 4PUOA 3FZLA 4CECA 4YDUA 3V1QA 3RMDA 3FE1A 4IEEA 2HHTA 3OBYA 3K58A 4KKOA 1W7AA 1EETA 3O9RA 3UKUB 2HW3A 3WNEA 1NGAA 4B1WB 3MN6A 1UA0A 1JCEA 1F21A 1GLCG 5HOOA 4LF9K 1NGJA 3AVFA 3OYKA 3D45A 3H1VX 3VEXA 2O8CA 4JKDA 3QLHA 5KPTA 2YKNA 5C2FA 3KLHA 1TYQB 3DLLL 1KRPA 2B6AA 4BG8A 3CCSN 4E1JA 4O55A 3THYB 3O4NA 4PL7A 4JRPA 3D6RA 3JSMA 1VQ6N 4WFNL 1S9EA 3CCJN 3OHRA 3IS9A 4YOWA 1IKYA 1KAYA 4JK7A 4B3MK 4B1ZA 1B9FA 4AHCA 1N5YA 2ZE2A 2A5XA 2NUBA 4KTWA 4U7BA 3L4QA 2ASMA 1BDGA 4GY2B 5LMNK 5FRMA 4DQRA 4IOXA 4FK4A 1HX1A 1SZ2A 2HF4A 3EE8A 4B3OA 2EWSA 3DLGA 3DM2A 3CD6N 4KRFA 2HMIA 4ZTJA 5F1XA 4E7JA 3LP3A 1NGIA 1TV6A 1S72N 2YV0X 1S1XA 1K8KA 4IWVA 3T19A 5C24A 2E5LK 1JCFA 1YHQN 4OLAA 5HP1A 2PZSA 3TR8A 5E26A 2YHWA 4BRGA 1GLDG 5GINA 3JYTA 3OYIA 1NNEA 1U2VB 4DG1A 3T1YK 4H0VB 5I42A 3UIQA 3T1AA 4NCBA 4HCCA 4FWKA 5KGXA 2WFBA 3M8QA 1EQYA 4N5SA 2E6LA 1J54A 5GADP 1IBMK 3SMSA 2UYTA 4NXNK 4Z4IA 4HTUA 5J1EA 4FLXA 2UU9K 4DFMA 4DV5K 4I7FA 1XC3A 4H4MA 2E2QA 3GE1A 1QSSA 3THXA 3VN5A 5LY3A 2QW9A 2P9LB 4CF0A 3QEXA 1ASUA 3PO4A 1QQCA 3ZSYA 3S3OA 3K5MA 5J2MA 3M6GA 4BRFA 3AAPA 4DTXA 2O8FB 4ID5A 2GUIA 2NRVA 4KTZA 1LW2A 4CEEA 4FWOA 4JLHA 2B4JA 3ZSQA 4QS9A 4FPAA 4CZHA 1WAJA 3FZMA 3VTIA 4DSLA 3OS0A 4FZZA 2HNYA 2FBYA 3CYMA 1EWRA 4IZ9A 2QXLA 4JHDA 5AJ3K 4EP4A 4CESA 4BE0A 5GAHP 2XY6A 3CJ7A 3VQEA 4RWTA 3BEXA 1C0FA 1BWFO 3E1YA 3O5BA 4IO8A 3V1RA 1YXQA 2HBLA 4K8XA 4IG0A 4FJ5A 1FKOA 4PL8A 4C8NA 3K5NA 4F8RA 3CC7N 3AO5A 3RR7A 4KHYA 2Q0UA 4EFHA 5KQDA 1FXXA 4CGIA 3ASMA 3OYBA 4FM2A 1L5UA 4LF5K 3NGYA 4J2EA 3PX4A 3A5NC 1ZC6A 3NFAA 4C8MA 5JMVA 1IG9A 1NGBA 3O1BA 3BUZB 3SAHA 4FJGA 4JS4A 4YOYA 2KKZA 3CQXA 1Z05A 4DTUA 3KK7A 4DQ8A 4DWIA 3TAGA 4E7HA 3HM8A 3VERA 4FOEA 4B9QA 3E01A 1NKEA 4QAGA 1KQSM 3P5JA 4CZFA 1FJGK 1CXQA 2BGGA 3M8RA 3VQ7A 4CZJA 1RBTA 3R6MA 4ISEA 1N33K 3F9KA 4EHUA 3K59A 1SAZA 3HXMA 1LAWA 4ILHA 4CJWA 1YUWA 4H5WA 4BQLA 4HCBA 3RRGA 3LPUA 2QEXN 2AP1A 3SUNA 1ATSA 4ICLA 3HP9A 3HM9A 1ZBSA 1P8ZA 2IGIA 4IDKA 1JLCA 2DY4A 3CCMN 1L3TA 1YVNA 1N8RO 2G8FA 4H0PA 4Y1DA 4JAXA 4KH5A 5M1KA 5AFUH 3TAQA 4QCLA 3CM5A 3WUHA 4A57A 1U49A 4DHYA 3M1FA 2QTDA 4ILJA 3V9WA 5KPRA 1KFSA 2D0CA 3GG4A 4LSNA 1JXBA 3W0LA 4CJ4A 3I55N 3NHGA 2O8BB 1O1WA 1BIZA 2O8DB 2IIRA 3HYFA 1XHXA 1U48A 3KJVA 3C6HA 3HSCA 3TTDA 1NM1A 4Z4EA 3DLHA 3C94A 3S3MA 1IG8A 3D2EA 3VEYA 3EO3A 3CJCA 4B9LA 2QWPA 1U45A 3P38A 3PIOL 5AZJA 4NXMK 3LDSA 1EP4A 3NAEA 1ASWA 2W6LA 2QWQA 5KGWA 1HUXA 1TKXA 2YNFA 4YOTA 1NK6A 3HVRA 4O5FA 3SJJA 4K0KK 1KC8O 2ZM6K 4PKIA 2W41A 5TKWA 4RTFD 3ZETB 1EKEA 1VRTA 1BU6O 1WOQA 4Z4FA 3NMUA 4DSKA 4DF4A 4DQQA 2ZGZA 3KKSA 1NJXA 4R79A 1X3NA 5H1SQ 4J2DA 4DV7K 1JKHA 2FF6A 3G25A 2CH6A 3U3GA 2KZZA 4EAHD 3O1WA 4IFYA 3AO3A 2O4GA 3L8BA 2FBXA 4X62K 4WFBL 3HBTA 3TAEA 3T1HK 1HYSA 4I6MB 2YNGA 1A5XA 1ZXOA 3VOVA 3RR8A 3DRPA 3VQAA 2IOCA 4BVOA 1A5WA 5CYMA 2GBZA 3O9SA 2DPNA 4BRPA 1RT6A 4ISFA 1VSEA 3MN5A 4A61A 3N4PA 1OH5A 5AQFA 3LZIA 1DT9A 3EY1A 3EN9A 3CC2N 1N32K 3CG7A 3IUCA 4OGCA 5SWMA 1KLNA 4KB0A 4YOXA 4CF8A 3E9PA 1TKZA 1D9DA 4G1QA 3CIPA 4W5RA 1LV5A 1NJIO 4PKGA 1DTQA 3OBWA 3TWHA 5HL7L 3K9JA 1EWQA 1RTJA 4HWIA 3TTFA 4B3TK 4CBUA 1HYVA 2VGNA 5AQXA 3AA2A 2IS3A 2PAVA 1N36K 4DR1K 2KHOA 4B1YB 1RDWX 5C12A 3DWLA 2RPIA 3C6TA 2KTQA 1QQMA 4M3TA 3CJBA 1VQKN 3OS1A 2G8KA 3O08A 2ZD1A 1O13A 2A42A 2I7PA 1BI4B 4GVMA 5JVGL 4DSFA 1U04A 3C6AA 2WONA 2FF3B 3G71N 4JKFA 1QVGM 1V4TA 3VQCA 4KFBA 1ILYA 1Q18A 4BE2A 1GLFO 5KPZA 4OO1J 4CGFA 3CQYA 4WQ5A 4AM6A 2BTFA 3QIPA 4W5OA 2D0AA 4FPBA 1RT5A 2ASOA 3SZ2A 3WNFA 3UKUA 4H0YB 1GLLO 4AILC 2E2OA 1RDCA 4Q5VA 5C0YA 3EL2A 3KKRA 4KBOA 4BR4A 4CJTA 1VSKA 2V52B 1REVA 4F4KA 3K0SA 1J5EK 4Z94A 3AVLA 2OYQA 5AZIB 1TYQA 3UE5A 3B6PA 3TANA 5AQYA 3ZSOA 1TL3A 3THYA 4YHHK 3KK2A 4NYFA 4N76A 5HRNA 4O5BA 5CE3A 3KD5E 4WQ4A 3ATVA 1GOCA 2V7ZA 1OKJA 2NRXA 3ZT2A 4WF9L 3SQ0A 1X9JA 1HPZA 3M5RA 2NNWA 2FSJA 3S41A 2BE2A 4Z4HA 1SKSA 4LFCK 3TABA 3K2PA 1HQUA 5ADXH 2ZGYA 3K9KA 3NF6A 1QTMA 4JI1K 1WNSA 2VWKA 4JI5K 2JGUA 4YDUC 4IKFA 1KVBA 3O9UA 3OVNA 4JKGB 2KZMA 3P1GA 1NGGA 4CEQA 3AVAA 3ZSRA 3H3NO 1C0MA 2W42A 4JD2B 2B5JA 2X74A 1J5OA 1HNXK 3AY9A 3HTVA 3OYDA 1LOTB 4JI0K 3LM2A 3TPQA 3U8XA 1NU0A 4RW9A 1T8EA 3CCRN 1U2VA 5TKYA 3A5LC 4FJ8A 1RT7A 2EX3A 3ID6A 3LAMA 3VEWA 2HBJA 4DQSA 1RBSA 3QFPA 4CFBA
chains in the Genus database with same CATH topology
1JCFA 1YHQN 3EKSA 4C1NK 4F9OA 2D0PA 2Q1NA 5E26A 2YHWA 4BRGA 1GLDG 2F9WA 4BROA 3DJCA 3QICA 1K8KB 5GINA 2W40A 1U2VB 3FZHA 3BP8A 4BR5A 5JLHA 5JLFA 2YCHA 2Q31A 1QZ5A 5DM7L 2E1YA 4HTLA 3CMAN 1VAZA 4XH4A 4BR2A 4BGAA 2BUPA 4H0VB 4U67L 1D4XA 1E4GT 2HMPA 3GDQA 4JKAA 1S3XA 3J8AA 3LDOA 3HI0A 2FSNA 2BH1A 1K9MO 3ID8A 4FWKA 4JN4A 2WFBA 1EQYA 1BA0A 3RSEA 4AF1A 4BRDA 3MDQA 4FWMA 4BQZA 2P9LA 3I33A 3UKRA 5GADP 3IMXA 2ZJQL 4LC9B 3SMSA 3CJAA 3LDPA 4H5VA 2UYTA 2ASPA 2QWMA 2A40A 5AQGA 2HBKA 2Q97A 3NVMA 1CZAN 1TUYA 2GWJA 1OVYA 1XC3A 5M1OA 5BRDA 3R8EA 2E2QA 3CCUN 3GE1A 3SBGA 4H5RA 4IJAA 5LY3A 4O8KA 2QW9A 3RSEB 1VQ8N 5EVZA 3ZX2A 4GVEA 4NB4A 2P9LB 1Q7YO 4H5TA 3GOIA 3UKRB 2FXUA 4A5AA 3QFUA 1M1KO 2NRHA 3M6GA 1DKGD 2CGJA 4BRQA 4BRFA 2ZF5O 3AAPA 2VWBA 1T6DA 5KQ8A 3LDQA 3QDKA 3VTHA 2Q36A 2NRVA 4B1XB 3CMEN 1DGKN 1NWKA 3LDNA 4FWOA 5FPMA 4IDHA 2QA4N 4QS9A 1QHAA 1NMDA 4FPAA 2D4WA 3O4WA 2VYPA 3VTIA 3FZMA 4CZHA 5GIOA 1SQKA 5AQHA 3QMLA 1RGIA 4IEIA 3G6EN 1HLUA 1G99A 2QWRA 4IZ9A 2QXLA 3E66A 3QBXA 3VF6A 3H1QA 3CJ1A 3QBWA 4JHDA 1ATNA 2YHXA 4FWLA 4NO7A 2P9PB 5AQMA 3VGKA 5F0XA 4YOUA 5GAHP 4BRIA 2A6AA 2P9SA 3CJ7A 4K43A 4WQ5C 3AAQA 3ULEB 4RWTA 3O9QA 4BRHA 3BEXA 1C0FA 1Z6RA 1BWFO 4GV9A 4ILGB 1Y64A 4JK9A 3E1YA 3O5BA 4PKHA 3SK3A 4IO8A 4J8FA 3TSPA 1YXQA 2HBLA 3L4IA 2GELA 4PL8A 3L0QA 5AQOA 2E8AA 4JHDB 4H0TB 4DKWA 3I8BA 3CI5A 5AQVA 1YJNN 3CC7N 1ESVA 3WEEA 5EXWA 2P9SB 1YIJN 2Q0UA 4EFHA 5KQDA 4CJ7A 5C10A 3SAFA 3VF4A 4AM7A 2GUPA 2ZWHA 2P9UA 3J7ZO 4IOCL 1YF5L 1QVFM 4XEIA 2V7YA 1XUPO 3Q7CA 1E4FT 3JXUA 3O9TA 2HSTA 3A5NC 1ZC6A 4B1VA 5JMVA 4DB3A 2WUSA 4MLEA 3A5OC 1VQ5N 3WEEB 5BRHA 1NGBA 3O1BA 3BUZB 3SAHA 5FPDA 4YOYA 4BRAA 2KKZA 3CQXA 1Z05A 2FLOA 3KK7A 4DQ8A 2P9UB 3H46O 4JKBA 4WQ4C 4CZLA 3HOTA 5AQKA 3HM8A 3CPEA 3VERA 2YJEA 2OANA 4FOEA 4MDAA 2CGKA 3MWTA 3R3LA 4B9QA 1KAXA 2E2NA 3RVCA 4CZKA 1V4SA 3KVGA 5DM6L 4FVUA 1QQOA 4JNEA 4GNIA 4Y0WA 4CZFA 1KQSM 1EO1A 5EY4A 3TSQA 3ZX0A 4H5NA 1NBWA 3KHYA 4FWRA 3TTCA 5CR4A 4A62A 2NZTA 4YOVA 4CZJA 3CETA 2JWLA 3R6MA 4ISEA 4JEPA 5AQRA 3TU5A 3D7EO 4EHUA 1RDUA 1SAZA 3AARA 5BPLA 3F2KA 1KXPA 3H6EA 3L6QA 2E20A 4ILHA 4QS7A 2OTJN 1YUWA 4BR7A 2QWNA 4H5WA 4BQLA 3CF5L 4M7XA 5BR9A 1QZ6A 3T69A 2QEXN 4NLCA 2AP1A 1NGCA 4H0OA 4C1NI 1ATSA 5BN9A 3WXIA 3C0BA 3WXJA 5I9EB 1ZBSA 1P8ZA 4WCEL 5AQTA 3VGMA 1U6ZA 3D2FA 3OA9A 1YITN 5AQUA 1Q81O 1M90O 2ZJRL 4O8UA 3CCMN 1YVNA 3HZ6A 3CPWM 1N8RO 4H0PA 1DEJA 5M1NA 2J4RA 4JAXA 4KH5A 5M1KA 5AFUH 3WUHA 3EZWA 5AQNA 1ATRA 4A57A 1GLAG 1HJOA 2H3GX 4JKEA 4DHYA 3M1FA 1NGFA 2AA4A 2QTDA 2IVPA 2P9IA 4ILJA 3MMVA 3D2FB 4K25A 4FWNA 5KPRA 3FR0A 1VQMN 2NRZA 3AGKA 3GG4A 1BA1A 3G4SN 3W0LA 3SAGA 4BR9A 3I55N 3Q7BA 1T6CA 4IFEA 1NGEA 1MDUB 2IIRA 2GEMA 4CI6A 2F7TA 2P9PA 3C6HA 1X3MA 3HSCA 3TTDA 4BC2A 1NM1A 4FSVA 2P9IB 2E2PA 3ULEA 3R9PA 1IG8A 2GWKA 3CJ9A 3D2EA 3TSUA 3VEYA 4CBWA 2QWOA 3EO3A 1YJ9N 2HBMA 3CJCA 2QWPA 3KWGA 5EX5A 4FWPA 3ZETA 1MWKA 1GLEG 5MLCQ 3P38A 1W97L 4OPAA 3PIOL 4BY9C 5AZJA 3MK6A 4K42A 4BRMA 3ZX3A 5ADXA 3CXCM 2VGMA 2E88A 3I56N 4L3QA 2QWQA 5GAEP 4WFAL 1MWMA 1HUXA 5JVHL 4YOTA 3D2EB 3C7NA 4O5FA 3U9DA 1KC8O 4PKIA 2W41A 5TKWA 4RTFD 5M1PA 1QQNA 3ZETB 1K73O 3NVKA 1H1VA 1BU6O 1WOQA 2QWLA 2GTDA 4YORA 3C65A 5AZJB 3ATUA 3VGLA 4KH4A 5AQWA 3NMUA 1T44A 4BC5A 4BRCA 5JICA 2ZGZA 3O8MA 3CCLN 4BVPA 4R79A 3H45C 1X3NA 4I6MA 5H1SQ 2F9TA 3SJHA 4GV3A 4QS8A 1KD1O 3JS6A 3C7NB 3FZKA 3IKMA 1NLVA 1SS6A 4MDBA 2FF6A 3G25A 2CH6A 3MCPA 4FL9A 3A0IX 3U4LA 4BGBA 3MN7A 4EAHD 2WC9A 3O1WA 3CCEN 4CD1A 1JJ2M 3KWIA 4ISGA 1BG3A 3WXLA 4WFBL 3HBTA 5AQIA 2ZJPL 2PFUA 4I6MB 3WQUA 3VOVA 1ZXOA 2NRWA 3EKUA 5E84A 4EIAA 4K41A 2V51B 3DAWA 4BVOA 1YAGA 1BO5O 3MX5A 4FOIA 2HOEA 3O9SA 1VQON 3EE9A 3ENHA 2DPNA 4BRPA 5B8HA 2PBDA 4ISFA 1T3VA 3F5TA 5BRFA 4JK8A 4FWQA 5BPNA 3MN5A 4CZMA 1W2BM 4A59A 4A61A 3VMFB 3N4PA 3P39A 2KLAA 3FFKB 5AQFA 1HPMA 2Q2RA 4CZGA 1DT9A 2YI1A 1TUUA 3SLCA 4EHTA 5FPNA 3EN9A 3CC2N 3VENA 5C2DA 1BUPA 3IUCA 2NLXA 4YOXA 3E9PA 4XH5A 3KZBA 5AQQA 4A2BA 5BN8A 3CIPA 2NRRA 2WBNA 1YJWN 3MN9A 2I7NA 3OBWA 4PKGA 1NJIO 3CERA 5HL7L 3K9JA 4M63C 3SMPA 3B8AX 5M1FA 2E1ZA 2HF3A 5FPEA 1Q82O 4GV6A 4HWIA 3VEOA 5BPMA 3TTFA 4CBUA 5GAGP 4H03B 2VGNA 1NGDA 5AQXA 5AQJA 3P31A 3LDLA 3R1XA 3CCVN 1LCUA 2PAVA 1Q86O 3BF1A 1MA9B 2KHOA 4B1YB 4BG9A 1HKBA 4BRKA 1RDWX 5C12A 3DWLA 4FWSA 3MCAB 5EOYA 1QQMA 1XQSC 3MWPA 3CHWA 3QB0A 2QI2A 4NLBA 3ENOA 3CJBA 3FGUA 1KAZA 1VQKN 4BC3A 4CZIA 3H3OB 3PLAA 4BREA 3O08A 5LJVA 3VPZA 3MX2A 3A5MC 3LM9A 3O6WA 4OPHA 1O13A 5AQLA 2A42A 4CD3A 2I7PA 2IVOA 4CZEA 3T7ZA 5JVGL 3WXKA 2CGLA 3C6AA 2FF3B 3G71N 4JKFA 5AQPA 4BRNA 1QVGM 1V4TA 3VETA 1YI2N 4IOAL 1ILYA 3IFRA 1HKGA 1Q18A 1VQ7N 2FSKA 1GLFO 1HKCA 5KPZA 1WUAA 4OO1J 4A2AA 1C0GA 3OW2M 3CQYA 4WQ5A 4AM6A 3F9MA 1JCGA 1GLJO 2A41A 2BTFA 3DXMA 4FPBA 3GBTA 3DXKA 2JWKA 4IXCA 4MO4A 2ASOA 3N4QA 2NRTA 3P4IA 3UKUA 1IJJA 4XH1A 1S22A 5AZIA 3GL1A 1GLBG 4H0YB 3U9ZA 1GLLO 3E9LA 2E2OA 3ENBA 5C0YA 4DCHA 3EL2A 3HRGA 2D0OA 4KBOA 4FO0A 2P9KA 5F2RA 4BR4A 2V52B 3DXMB 4MLHA 3VF2A 2D1KA 3FZLA 3WXMB 1VQNN 3DXKB 4IJNA 4YDUA 1P90A 4Z94A 5GIPA 3FE1A 4IEEA 2IVNA 3OBYA 3VEZA 3O9RA 3UKUB 3AGRA 1NGAA 5AZIB 4JKHA 1TYQA 3E9OA 3FZFA 3UE5A 4B1WB 3CC4N 3MN6A 1JCEA 5AQYA 5M1QA 3O80A 1GLCG 5CHIA 2P9KB 5HOOA 3HOSA 3ZYYX 1NGJA 4C23A 5CE3A 1NGHA 4WQ4A 3A8YA 2A3ZA 3ATVA 4B1UB 2V7ZA 3H1VX 2ITMA 1OKJA 2NRXA 3VEXA 5AQZA 2RE2A 4JKDA 4BRLA 5KPTA 5C2FA 4WF9L 1TYQB 3DLLL 1X9JA 4MO5A 2Q0RA 4BG8A 2YHYA 3CCSN 2YX6A 4JKGA 4E1JA 3M5RA 2NNWA 2FSJA 3UB5A 1VQ9N 3S41A 3PIPL 2CH5A 5AR0A 3VESA 3W3DA 3D6RA 5ELZA 4PL7A 4JD2A 3BF3A 3SBTA 5ADXH 1VQPN 4M7YA 2ZGYA 1VQ6N 3K9KA 4WFNL 3CCJN 3OHRA 4KH6A 4YOWA 1J6ZA 4YDUC 4IO9L 3WQTA 4WYBA 1KAYA 3O9UA 4JK7A 4B1ZA 4JKGB 1NGGA 3CCQN 2A5XA 5BREA 4UY8O 2P9NA 3H3NO 4JKCA 4U7BA 3L4QA 2ASMA 4JD2B 1BDGA 4GY2B 4PHTX 5LJWA 4IOXA 3M3ZA 1HX1A 1SZ2A 2HF4A 3AY9A 3EE8A 2EWSA 3HTVA 4RCHA 5AQSA 1LOTB 1K8AO 2YJFA 3LM2A 3ZEUA 4BR0A 3CD6N 3TPQA 3FLCO 3U8XA 1BOTO 4G9ZA 5AFUA 5C15A 2QM1A 3WT0A 4A5BA 5F1XA 1VQLN 1RFQA 1NGIA 4CBXA 3CCRN 1S72N 3VEVA 1K8KA 1R59O 1U2VA 2P9NB 4BC4A 2RHKA 5TKYA 4H0XB 3A5LC 2VCPA 4IWVA 3ID6A 3VEWA 2HBJA 2OTLN 2GX9A 3QFPA 3LL3A 3ZEUB 1VQ4N 3IDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCF A;  3EKS A;  4F9O A;  2D0P A;  2Q1N A;  5E26 A;  2YHW A;  4BRG A;  1GLD G;  2F9W A;  4BRO A;  3DJC A;  3QIC A;  1K8K B;  2W40 A;  1U2V B;  3FZH A;  3BP8 A;  4BR5 A;  5JLH A;  2YCH A;  2Q31 A;  1QZ5 A;  2E1Y A;  4HTL A;  4XH4 A;  4BR2 A;  4BGA A;  2BUP A;  4H0V B;  1D4X A;  1E4G T;  2HMP A;  3GDQ A;  1S3X A;  3J8A A;  3LDO A;  3HI0 A;  2FSN A;  3ID8 A;  4FWK A;  4JN4 A;  1EQY A;  1BA0 A;  3RSE A;  4BRD A;  3MDQ A;  4FWM A;  4BQZ A;  2P9L A;  3I33 A;  3UKR A;  3IMX A;  4LC9 B;  3SMS A;  3CJA A;  3LDP A;  4H5V A;  2UYT A;  2ASP A;  2QWM A;  2A40 A;  5AQG A;  2Q97 A;  1CZA N;  1TUY A;  2GWJ A;  1XC3 A;  5BRD A;  3R8E A;  2E2Q A;  3GE1 A;  4H5R A;  4IJA A;  5LY3 A;  4O8K A;  2QW9 A;  3RSE B;  5EVZ A;  3ZX2 A;  4NB4 A;  2P9L B;  4H5T A;  3GOI A;  3UKR B;  2FXU A;  3QFU A;  2NRH A;  3M6G A;  1DKG D;  2CGJ A;  4BRQ A;  4BRF A;  2ZF5 O;  3AAP A;  2VWB A;  1T6D A;  5KQ8 A;  3LDQ A;  3QDK A;  2Q36 A;  4B1X B;  1DGK N;  1NWK A;  3LDN A;  4FWO A;  5FPM A;  4QS9 A;  1QHA A;  1NMD A;  4FPA A;  2D4W A;  3O4W A;  2VYP A;  4CZH A;  3FZM A;  1SQK A;  5AQH A;  3QML A;  1RGI A;  1HLU A;  1G99 A;  2QWR A;  4IZ9 A;  2QXL A;  3QBX A;  3VF6 A;  3H1Q A;  3CJ1 A;  3QBW A;  4JHD A;  1ATN A;  2YHX A;  4FWL A;  4NO7 A;  2P9P B;  5AQM A;  3VGK A;  5F0X A;  4BRI A;  2A6A A;  2P9S A;  3CJ7 A;  4K43 A;  4WQ5 C;  3AAQ A;  3ULE B;  4RWT A;  4BRH A;  3BEX A;  1C0F A;  1Z6R A;  1BWF O;  1Y64 A;  4PKH A;  3SK3 A;  3O5B A;  4IO8 A;  4J8F A;  1YXQ A;  3L4I A;  2GEL A;  4PL8 A;  3L0Q A;  5AQO A;  2E8A A;  4JHD B;  4H0T B;  3I8B A;  3CI5 A;  5AQV A;  1ESV A;  3WEE A;  5EXW A;  2P9S B;  2Q0U A;  4EFH A;  5KQD A;  4CJ7 A;  3VF4 A;  4AM7 A;  2GUP A;  2ZWH A;  2P9U A;  4XEI A;  2V7Y A;  1XUP O;  1E4F T;  3JXU A;  3A5N C;  1ZC6 A;  4B1V A;  5JMV A;  4DB3 A;  2WUS A;  4MLE A;  3A5O C;  3WEE B;  5BRH A;  1NGB A;  3O1B A;  3BUZ B;  5FPD A;  4BRA A;  3CQX A;  1Z05 A;  2FLO A;  4DQ8 A;  2P9U B;  3H46 O;  4WQ4 C;  4CZL A;  5AQK A;  3HM8 A;  3VER A;  2YJE A;  2OAN A;  4FOE A;  2CGK A;  4B9Q A;  1KAX A;  2E2N A;  4CZK A;  1V4S A;  3KVG A;  1QQO A;  4JNE A;  4GNI A;  4Y0W A;  4CZF A;  5EY4 A;  3ZX0 A;  4H5N A;  1NBW A;  3KHY A;  4FWR A;  4A62 A;  2NZT A;  4CZJ A;  3CET A;  3R6M A;  4ISE A;  5AQR A;  3TU5 A;  3D7E O;  4EHU A;  1SAZ A;  3AAR A;  5BPL A;  3L6Q A;  1KXP A;  3H6E A;  2E20 A;  4QS7 A;  1YUW A;  4BR7 A;  2QWN A;  4H5W A;  4BQL A;  4M7X A;  5BR9 A;  1QZ6 A;  2AP1 A;  1NGC A;  4H0O A;  1ATS A;  5BN9 A;  3WXI A;  3C0B A;  3WXJ A;  5I9E B;  1ZBS A;  1P8Z A;  5AQT A;  3VGM A;  1U6Z A;  3D2F A;  5AQU A;  1YVN A;  3HZ6 A;  4H0P A;  1DEJ A;  2J4R A;  4JAX A;  5AFU H;  3WUH A;  3EZW A;  5AQN A;  1ATR A;  1GLA G;  1HJO A;  2H3G X;  4DHY A;  3M1F A;  1NGF A;  2AA4 A;  2IVP A;  2P9I A;  3MMV A;  3D2F B;  4K25 A;  4FWN A;  5KPR A;  3FR0 A;  3GG4 A;  1BA1 A;  3W0L A;  4BR9 A;  1T6C A;  1NGE A;  1MDU B;  2IIR A;  2GEM A;  4CI6 A;  2P9P A;  3HSC A;  1X3M A;  4BC2 A;  1NM1 A;  4FSV A;  2P9I B;  2E2P A;  3ULE A;  3R9P A;  1IG8 A;  2GWK A;  3CJ9 A;  3D2E A;  4CBW A;  3VEY A;  2QWO A;  3EO3 A;  3CJC A;  2QWP A;  5EX5 A;  4FWP A;  3ZET A;  1MWK A;  1GLE G;  5AZJ A;  3MK6 A;  4K42 A;  4BRM A;  3ZX3 A;  5ADX A;  2E88 A;  4L3Q A;  2QWQ A;  1MWM A;  1HUX A;  3D2E B;  3C7N A;  4O5F A;  3U9D A;  4PKI A;  2W41 A;  4RTF D;  1QQN A;  3ZET B;  1H1V A;  1BU6 O;  1WOQ A;  2QWL A;  2GTD A;  5AZJ B;  3ATU A;  3VGL A;  5AQW A;  1T44 A;  4BC5 A;  4BRC A;  5JIC A;  2ZGZ A;  3O8M A;  4BVP A;  3H45 C;  1X3N A;  4I6M A;  2F9T A;  3SJH A;  4QS8 A;  3JS6 A;  3C7N B;  3FZK A;  1NLV A;  3U4L A;  2FF6 A;  3G25 A;  2CH6 A;  3MCP A;  4FL9 A;  3A0I X;  4BGB A;  3MN7 A;  4EAH D;  3O1W A;  4CD1 A;  4ISG A;  1BG3 A;  3WXL A;  3HBT A;  5AQI A;  4I6M B;  3WQU A;  3VOV A;  1ZXO A;  3EKU A;  5E84 A;  4EIA A;  4K41 A;  2V51 B;  3DAW A;  4BVO A;  1YAG A;  1BO5 O;  4FOI A;  2HOE A;  3ENH A;  2DPN A;  4BRP A;  5B8H A;  2PBD A;  4ISF A;  5BRF A;  5BPN A;  4FWQ A;  3MN5 A;  4CZM A;  4A61 A;  3FFK B;  5AQF A;  1HPM A;  2Q2R A;  4CZG A;  2YI1 A;  1TUU A;  3SLC A;  4EHT A;  5FPN A;  3EN9 A;  3VEN A;  1BUP A;  3IUC A;  2NLX A;  4XH5 A;  3KZB A;  5AQQ A;  4A2B A;  5BN8 A;  3CIP A;  3MN9 A;  2I7N A;  4PKG A;  3CER A;  4M63 C;  3SMP A;  3B8A X;  2E1Z A;  2HF3 A;  5FPE A;  4HWI A;  3VEO A;  5BPM A;  4CBU A;  4H03 B;  1NGD A;  5AQX A;  5AQJ A;  3LDL A;  1LCU A;  2PAV A;  3BF1 A;  1MA9 B;  2KHO A;  4B1Y B;  4BG9 A;  1HKB A;  4BRK A;  1RDW X;  3DWL A;  4FWS A;  5EOY A;  1QQM A;  1XQS C;  3CHW A;  3QB0 A;  3ENO A;  3CJB A;  3FGU A;  1KAZ A;  4BC3 A;  4CZI A;  3H3O B;  4BRE A;  3O08 A;  5LJV A;  3VPZ A;  3A5M C;  3LM9 A;  3O6W A;  5AQL A;  2A42 A;  4CD3 A;  2I7P A;  2IVO A;  4CZE A;  3WXK A;  2CGL A;  2FF3 B;  5AQP A;  4BRN A;  1V4T A;  3VET A;  3IFR A;  1HKG A;  1Q18 A;  2FSK A;  1GLF O;  1HKC A;  5KPZ A;  1WUA A;  4A2A A;  1C0G A;  3CQY A;  4WQ5 A;  4AM6 A;  3F9M A;  1JCG A;  1GLJ O;  2A41 A;  2BTF A;  3DXM A;  4FPB A;  3GBT A;  3DXK A;  4IXC A;  4MO4 A;  2ASO A;  3P4I A;  3UKU A;  1IJJ A;  4XH1 A;  1S22 A;  5AZI A;  3GL1 A;  1GLB G;  4H0Y B;  3U9Z A;  1GLL O;  2E2O A;  4DCH A;  3EL2 A;  4KBO A;  2D0O A;  4FO0 A;  2P9K A;  5F2R A;  4BR4 A;  2V52 B;  3DXM B;  4MLH A;  3VF2 A;  2D1K A;  3FZL A;  3DXK B;  4IJN A;  4YDU A;  4Z94 A;  3FE1 A;  2IVN A;  3VEZ A;  3UKU B;  1NGA A;  5AZI B;  1TYQ A;  3FZF A;  3UE5 A;  4B1W B;  3MN6 A;  1JCE A;  5AQY A;  3O80 A;  1GLC G;  2P9K B;  1NGJ A;  4C23 A;  5CE3 A;  1NGH A;  4WQ4 A;  3A8Y A;  2A3Z A;  3ATV A;  4B1U B;  2V7Z A;  3H1V X;  2ITM A;  1OKJ A;  3VEX A;  5AQZ A;  4BRL A;  5KPT A;  1TYQ B;  1X9J A;  4MO5 A;  2Q0R A;  4BG8 A;  2YHY A;  4E1J A;  3UB5 A;  2FSJ A;  3S41 A;  2CH5 A;  5AR0 A;  3VES A;  3W3D A;  5ELZ A;  4PL7 A;  4JD2 A;  3BF3 A;  5ADX H;  4M7Y A;  2ZGY A;  3OHR A;  1J6Z A;  4YDU C;  3WQT A;  4WYB A;  1KAY A;  4B1Z A;  1NGG A;  2A5X A;  5BRE A;  2P9N A;  3H3N O;  2ASM A;  4JD2 B;  1BDG A;  4GY2 B;  5LJW A;  3M3Z A;  1HX1 A;  1SZ2 A;  2HF4 A;  3AY9 A;  3HTV A;  2EWS A;  4RCH A;  5AQS A;  5JLF A;  1LOT B;  2YJF A;  3LM2 A;  3ZEU A;  4BR0 A;  3TPQ A;  3FLC O;  3U8X A;  1BOT O;  5AFU A;  2QM1 A;  3WT0 A;  5F1X A;  1RFQ A;  1NGI A;  4CBX A;  3VEV A;  1K8K A;  1R59 O;  1U2V A;  2P9N B;  4BC4 A;  5TKY A;  4H0X B;  3A5L C;  2VCP A;  4IWV A;  3VEW A;  3QFP A;  3LL3 A;  3ZEU B;  3IDH A; 
#chains in the Genus database with same CATH topology
 3DJC A;  3QIC A;  1SL1 A;  3FZH A;  1HNZ K;  2E1Y A;  3CMA N;  1VAZ A;  1LWF A;  4CJU A;  4BR2 A;  1NJY A;  2BUP A;  4GMJ B;  1E4G T;  3GDQ A;  1TKT A;  4IFV A;  3SCX A;  4DV4 K;  1S3X A;  4FXD A;  2BH1 A;  3ID8 A;  1BA0 A;  4BRD A;  2P9L A;  3I33 A;  5LL6 Z;  4B9S A;  2A40 A;  3MXJ A;  3U6F A;  5AQG A;  2HBK A;  3WNG A;  4E89 A;  2O8F A;  4FYD A;  3CFP A;  4HVJ A;  1QE1 A;  3R8E A;  1Y97 A;  4IJA A;  3AVC A;  3RSE B;  1VQ8 N;  3ZX2 A;  4C8K A;  4H5T A;  3UKR B;  1SUQ A;  2FXU A;  4A5A A;  2X6S A;  4F3T A;  3QFU A;  2BDP A;  2NRH A;  1ZBU A;  2ZF5 O;  1N6Q A;  2VWB A;  2OZS A;  3NH0 A;  4E7L A;  2QA4 N;  1ZBL A;  1KVC A;  3QML A;  1CZ9 A;  4CHN A;  1RGI A;  3G6E N;  3VF6 A;  4DR7 K;  4NO7 A;  3QBW A;  1ATN A;  2YHX A;  4FWL A;  4RW7 A;  5AQM A;  5F0X A;  4JI7 K;  3AAQ A;  2VQF K;  4YFU A;  1QSL A;  2UUC K;  1Z6R A;  4GV9 A;  4PKH A;  4CIG A;  4L8R B;  4AH9 A;  3L2Q A;  4CJ7 A;  5C10 A;  3SAF A;  3SUO A;  3C95 A;  4CGD A;  5BR8 K;  1OH8 A;  3J7Z O;  1S1V A;  1TK0 A;  1QVF M;  4B3S K;  1E3M A;  3JXU A;  1S6Q A;  2Z1I A;  1JLB A;  1VQ5 N;  3A5O C;  4DTN A;  1IKW A;  3AO2 A;  1SL2 A;  1ITG A;  2IDO A;  4BRA A;  4KO0 A;  3ZSX A;  5AQK A;  1C1B A;  4MDA A;  1NK8 A;  2CGK A;  3R3L A;  4OPK A;  1RBV A;  2E2N A;  4CZK A;  1HRH A;  4JNE A;  4FLW A;  4KHS A;  1KTQ A;  5EY4 A;  3TSQ A;  4H5N A;  3KHY A;  3DYA A;  4FWR A;  2WOM A;  5CR4 A;  2G8W A;  1NK9 A;  3CET A;  2JWL A;  4JEP A;  5EU7 A;  3TU5 A;  4DQP A;  1RDU A;  3S3N A;  1KXP A;  3H6E A;  2OTJ N;  2E20 A;  1BCO A;  4DS5 A;  1JL1 A;  1N34 K;  4H0O A;  3IRX A;  4B9T A;  3AO1 A;  3EZ5 A;  3NH2 A;  5I9E B;  3KLG A;  1J9A A;  5AQT A;  2OA8 A;  3OA9 A;  1YIT N;  5AQU A;  4EP5 A;  2ZJR L;  4O8U A;  3EYZ A;  4DF8 A;  3SNN A;  3HZ6 A;  5M1N A;  2O8B A;  2J4R A;  2RN2 A;  2O8D A;  1BGX T;  3EZW A;  1JXE A;  3AVH A;  2H3G X;  1NGF A;  3OJU A;  2AA4 A;  3MMV A;  3D2F B;  4K25 A;  4KTQ A;  4IG3 A;  4KI4 A;  4BWM A;  3SAG A;  3QO9 A;  3Q7B A;  3ULD A;  1MU2 A;  1MDU B;  1WSG A;  4CIE A;  2P9P A;  3ZT1 A;  2G8V A;  4H8K A;  3BZK A;  2P9I B;  2E2P A;  3ULE A;  5FDL A;  4CBW A;  4HUE A;  1A5V A;  1YJ9 N;  3KWG A;  4FWP A;  3ZET A;  4CK3 A;  4C8O A;  4JI8 K;  4OPA A;  1VHX A;  4K42 A;  2HNZ A;  5HBM A;  1NK4 A;  3CXC M;  3NGI A;  3LP0 A;  3TAP A;  2E88 A;  5HRR A;  5FLX O;  5GAE P;  5E41 A;  4WFA L;  2WTU A;  3QIO A;  3PX6 A;  3V1O A;  4OX9 K;  4JI2 K;  1SL0 A;  1K73 O;  5M1P A;  1QQN A;  3ATU A;  3VGL A;  5AQW A;  4CIF A;  2O8E B;  4LFA K;  5JIC A;  3DLK A;  3L3U A;  3H45 C;  4I6M A;  1L3U A;  4QS8 A;  3SQ2 A;  1WBB A;  3IKM A;  4CF1 A;  2A1S A;  1SS6 A;  2ATQ A;  3A0I X;  4DLE A;  3SUQ A;  2ZQB A;  4DSJ A;  3KWI A;  1T05 A;  1BG3 A;  3WXL A;  1B9D A;  3ZSV A;  3NF9 A;  4FM1 A;  4K41 A;  3QIN A;  3DAW A;  2DFH A;  2FBV A;  3ISN C;  2UXB K;  1Z26 A;  3LAL A;  1CXU A;  1B92 A;  3EE9 A;  1VQO N;  4B9N A;  3RTV A;  2P5O A;  4FCY A;  5LMU K;  3MAQ A;  1T3V A;  1W2B M;  5BPN A;  4CZM A;  2E4L A;  3FFK B;  4CZG A;  4R5P A;  2Q2R A;  3SLC A;  4CK1 A;  3PY8 A;  3AVI A;  4W5N A;  1XWL A;  1Q9X A;  3QNO A;  4H4O A;  3KZB A;  5AQQ A;  4NYN A;  4A2B A;  2WBN A;  3NDK A;  1YJW N;  4I9Q A;  2I7N A;  4KAZ A;  4CFD A;  5M1F A;  2E1Z A;  2HF3 A;  1RTD A;  3BGR A;  1Q82 O;  4Z4G A;  3VEO A;  4CJQ A;  4KHN A;  2AJQ A;  3OYC A;  4FJ9 A;  3P31 A;  4Y1C A;  3LPT A;  1BIS A;  4GKK K;  1BI4 A;  4FJJ A;  1MA9 B;  4BDZ A;  3CQ8 A;  5EOY A;  4PWD A;  4DSE A;  3MWP A;  4CJE A;  4C8L A;  1T7P A;  3FGU A;  1KAZ A;  4JRQ A;  1TK5 A;  4CZI A;  3HPO A;  3I0S A;  1XMO K;  3VQB A;  3MX2 A;  3A5M C;  3LM9 A;  2PYL A;  4CZE A;  1JLE A;  1KSP A;  3T7Z A;  3WXK A;  4CVN E;  2CGL A;  5AQP A;  4BRN A;  1YI2 N;  1VK0 A;  2FSK A;  2EHG A;  1NK5 A;  4A2A A;  3OW2 M;  3V4I A;  4LFB K;  1HJR A;  4B8A B;  4EZ9 A;  1I94 K;  1KCF A;  2NRT A;  3P4I A;  4DU1 A;  1S22 A;  5AZI A;  5HLF A;  3U9Z A;  4AHU A;  1D9F A;  3OYH A;  3E9L A;  3V81 A;  4B9U A;  3ENB A;  4DCH A;  3C6U A;  3MED A;  4MLH A;  4CEA A;  3V9U A;  4PY5 A;  1WSF A;  3DXK B;  4IJN A;  1P90 A;  3KLI A;  2IVN A;  3K57 A;  3AGR A;  2OPS A;  3FZF A;  4M42 A;  3CC4 N;  5J2P A;  4CCH A;  3IG1 A;  3O80 A;  4CER A;  2P9K B;  5CHI A;  3HOS A;  4C23 A;  1NGH A;  4E1N A;  3A8Y A;  2A3Z A;  4B1U B;  1JLQ A;  1J53 A;  4BRL A;  1VRU A;  2X6N A;  4JKG A;  3OYJ A;  4LH5 A;  4FJI A;  4LF6 K;  5JS1 A;  3W3D A;  5ELZ A;  4JD2 A;  3BF3 A;  3DLR A;  3SBT A;  1TKD A;  3SI6 A;  1VQP N;  4KHP K;  5CYQ A;  4KH6 A;  3WQT A;  2Z1G A;  2HVH A;  4JKC A;  4FLT A;  4V19 S;  4KHQ A;  1YVU A;  4PHT X;  5LJW A;  2OPR A;  3M3Z A;  5AQS A;  5JLF A;  4DV3 K;  4NCA A;  3TAM A;  1K8A O;  3ZT0 A;  2YJF A;  1R0A A;  5AFU A;  1C0U A;  1Q8I A;  5C15 A;  4A5B A;  4FJH A;  2F4V K;  4CBX A;  2P9N B;  2RHK A;  1VSD A;  4H0X B;  3VQ4 A;  2VCP A;  3TAF A;  3O3H A;  3MEE A;  2GX9 A;  3ZEU B;  1VQ4 N;  3IDH A;  4FLU A;  1ZYQ A;  4C1N K;  3VQ6 A;  4F9O A;  2D0P A;  1WSJ A;  4F3O A;  4LF7 K;  2W40 A;  5JLH A;  2YCH A;  2Q31 A;  3MEC A;  1QZ5 A;  4CGG A;  5DM7 L;  3IAY A;  4HTL A;  4BGA A;  3B6O A;  1OH6 A;  4CED A;  4U67 L;  1VSM A;  3LDO A;  3HI0 A;  3HJF A;  1K9M O;  1DLO A;  3DRR A;  5KTQ A;  3RSE A;  1BL3 A;  4FWM A;  3UKR A;  4CF9 A;  2P5G A;  3CJA A;  3LDP A;  4B08 A;  1QHT A;  2QWM A;  2FC0 A;  1CZA N;  1TUY A;  3AA4 A;  2OZM A;  1KLM A;  5BRD A;  5K14 A;  4H5R A;  4BWJ A;  3SBG A;  4O8K A;  1IBK K;  5EVZ A;  2LSN A;  1Q7Y O;  4IBN A;  4DR2 K;  1X1P A;  1D8Y A;  1RCH A;  2CGJ A;  4BRQ A;  1T6D A;  3LDQ A;  3VTH A;  4BE1 A;  4M3Y A;  4OKK A;  4DV0 K;  4HUF A;  3CME N;  1NWK A;  2JLE A;  3LDN A;  3KTQ A;  1NMD A;  2D4W A;  3O4W A;  3TI0 A;  4IEI A;  2RKI A;  4YY3 K;  3BZC A;  1QS4 A;  3E66 A;  3QBX A;  1XHZ A;  4DTO A;  3I8D A;  3HL8 A;  4YOU A;  3OTO K;  1W0H A;  3O9Q A;  4PA1 A;  5KRT A;  4N56 A;  1ZBH A;  2I5J A;  3NF8 A;  4CJV A;  3L0Q A;  5AQO A;  2E8A A;  3V9Z A;  3HPH A;  3I8B A;  5AQV A;  1YJN N;  1ESV A;  5EXW A;  2P9S B;  1S5J A;  2Q3S A;  3VF4 A;  3LWL A;  4PQU A;  2ZWH A;  2QKB A;  3F73 A;  2VG7 A;  4XEI A;  4DFK A;  1XUP O;  1TAU A;  3THW B;  3J80 O;  4B1V A;  2WUS A;  4MLE A;  3L2U A;  4AHT A;  3WEE B;  3WNH A;  5BRH A;  4CF2 A;  1RTI A;  4HUG A;  5FPD A;  4ZTF A;  1XNR K;  1WSI A;  2P9U B;  1WBD A;  4CZL A;  4MQ3 A;  3OYL A;  2YJE A;  1XC9 A;  2OAN A;  1C1C A;  3MWT A;  2F96 A;  1KAX A;  1KVA A;  3RVC A;  4AHR A;  1V4S A;  4W5Q A;  4FVU A;  4CHQ A;  4GNI A;  4Y0W A;  2YHA A;  3ZX0 A;  1NBW A;  3TTC A;  4A62 A;  4YOV A;  3MEG A;  1RT2 A;  3A2F A;  4OGE A;  4OJR A;  2P51 A;  4W5T A;  5BPL A;  3F2K A;  3L6Q A;  4BR7 A;  2QWN A;  3CF5 L;  4M7X A;  5BR9 A;  1FW6 A;  3H08 A;  4NLC A;  5BN9 A;  3WXI A;  2F8T A;  3PV8 A;  4FLZ A;  5HRO A;  3VGM A;  1U6Z A;  3D2F A;  4DR3 K;  4DU3 A;  1Q81 O;  1M90 O;  4JI4 K;  4AHS A;  2Y1J A;  1LWC A;  1LAV A;  1WAF A;  1ATR A;  1RNH A;  1GLA G;  1HJO A;  3BY5 A;  1S1U A;  2IVP A;  2P9I A;  4FWN A;  1VQM N;  3FR0 A;  3AGK A;  3VA0 A;  1G15 A;  2VG6 A;  4DUZ K;  4BR9 A;  4IFE A;  4DFP A;  2GEM A;  4ZHR A;  1CLQ A;  2F7T A;  4BC2 A;  4FSV A;  3AA3 A;  4OKE A;  4OPJ A;  3CJ9 A;  1UWB A;  2QWO A;  1RBU A;  5EX5 A;  4J2A A;  2P1J A;  1MWK A;  1W97 L;  1S6P A;  4BY9 C;  4DV6 K;  2HHU A;  3ITH A;  2O8E A;  3ZX3 A;  5ADX A;  3DOL A;  3SUP A;  3I56 N;  4L3Q A;  1MWM A;  5JVH L;  2GV9 A;  3QEP A;  1RT4 A;  2QWL A;  4YOR A;  3C65 A;  4LH4 A;  1T44 A;  3O8M A;  3CCL N;  3CFO A;  4BVP A;  2F9T A;  3VQ8 A;  3SJH A;  5HRP A;  5T7B A;  4O0J A;  1KFD A;  3C7N B;  1I3A A;  4MDB A;  3U4L A;  4BGB A;  4FL9 A;  2VWJ A;  3MN7 A;  4DTS A;  4M41 A;  3CCE N;  4B3R K;  4CD1 A;  1JJ2 M;  3S9H A;  2RF2 A;  3LP1 A;  3U3Y A;  2PFU A;  3WQU A;  2NRW A;  3EKU A;  5C25 A;  3AVM A;  5E84 A;  4EIA A;  1NKC A;  3HK2 A;  2V51 B;  4CHZ A;  3V6D A;  4FW1 A;  4CW7 B;  2HOE A;  3I0R A;  2BAN A;  3ENH A;  4CFA A;  2PBD A;  2YNH A;  4CJ3 A;  3DLB A;  4B8C A;  4FWQ A;  4A59 A;  3VMF B;  2KLA A;  1HPM A;  1VSF A;  2YI1 A;  1TUU A;  4EHT A;  4UQG A;  5FPN A;  2VQE K;  1U4B A;  1VSI A;  3VEN A;  1BUP A;  4XH5 A;  4CHO A;  1FKP A;  3OS2 A;  4CGJ A;  3MN9 A;  1WB9 A;  3AVG A;  2YHB A;  5C42 A;  4M63 C;  3SMP A;  2F8S A;  3OYM A;  3B8A X;  3DRS A;  4GV6 A;  4NCG A;  5BPM A;  3SV3 A;  1HNW K;  3LDL A;  3CCV N;  3V9X A;  4CEB A;  4Q0B A;  1Q86 O;  1IO2 A;  3BF1 A;  4BG9 A;  1HKB A;  4BRK A;  4JI3 K;  1T03 A;  5IT9 O;  3DMJ A;  3MCA B;  1VSJ A;  2XO7 A;  2IC3 A;  2OCE A;  4NLB A;  4FJK A;  4FK2 A;  3QEI A;  4BRE A;  4KHU A;  5LJV A;  3VPZ A;  4OPH A;  3P83 D;  5AQL A;  4FJL A;  4CD3 A;  4CHY A;  4B9V A;  4IOA L;  3VQ5 A;  1HKG A;  4CFC A;  2UXD K;  1HKC A;  5DK5 A;  4RW4 A;  2R7Y A;  1C0G A;  4E19 A;  4FM0 A;  3F9M A;  2A41 A;  4DU4 A;  3GBT A;  1D5A A;  3OYF A;  3DXK A;  5CZ2 A;  3N4Q A;  1WSH A;  1JLA A;  4KRE A;  4B9M A;  4XH1 A;  4E0D A;  3T3F A;  5CY4 A;  3GL1 A;  4N41 A;  3G0Z A;  1X9W A;  3KD1 E;  3DOK A;  3AA5 X;  3ZLJ A;  4DR4 K;  4FO0 A;  2P9K A;  5F2R A;  3DXM B;  4CEF A;  3VF2 A;  2D1K A;  4CEO A;  3WXM B;  4M3R A;  1VQN N;  2YKM A;  3AO4 A;  5GIP A;  3VEZ A;  4O44 A;  4RG8 A;  2A1R A;  4CJF A;  4JKH A;  1JLF A;  4FJM A;  3E9O A;  1RDA A;  1HNI A;  4DFJ A;  5M1Q A;  4CJS A;  1UOC A;  1UA1 A;  4DV2 K;  1WN7 A;  3ZYY X;  4GW6 A;  4DTR A;  4LF4 K;  4CHP A;  4OKJ A;  2ITM A;  5KRS A;  3ZSW A;  5AQZ A;  2RE2 A;  4M45 A;  4QOZ B;  4CGH A;  4MO5 A;  5CZ1 A;  2Q0R A;  4I2Q A;  2YHY A;  2YX6 A;  3UB5 A;  4CJR A;  1HYZ A;  1VQ9 N;  3PIP L;  2CH5 A;  5AR0 A;  3VES A;  2E6M A;  3EEQ A;  4DR6 K;  4M7Y A;  1NK7 A;  2O8C B;  1YT3 A;  4BAC A;  3KLE A;  4M3Z A;  1J6Z A;  4IO9 L;  4WYB A;  1QSY A;  5FRN A;  3CCQ N;  2G8I A;  3ZCM A;  2Y1I A;  5BRE A;  4UY8 O;  2P9N A;  1BIU A;  3PX0 A;  4KI6 A;  1UAX A;  1DTT A;  4M3W A;  4RCH A;  4M3X A;  3ZEU A;  3RRH A;  4BR0 A;  4CK2 A;  2G8H A;  3FLC O;  3NCI A;  1BOT O;  1LWE A;  4G9Z A;  1NK0 A;  3NVK A;  2QM1 A;  3WT0 A;  1VQL N;  1OH7 A;  1RFQ A;  5D3G A;  1GOB A;  3VEV A;  4DUY K;  1R59 O;  3OY9 A;  4BC4 A;  3QET A;  1NJZ A;  1C6V A;  3NF7 A;  2W6K A;  1IV0 A;  2OTL N;  3LL3 A;  5SZT A;  3EKS A;  2ETJ A;  2HHX A;  2Q1N A;  4KHW A;  1WSE A;  3SV4 A;  2F9W A;  4BRO A;  1LW0 A;  1K8K B;  1S1W A;  1RBR A;  4BR5 A;  3BP8 A;  4XH4 A;  1D4X A;  1IBL K;  2HMP A;  4JKA A;  3J8A A;  2FSN A;  4JN4 A;  4X65 K;  1SKR A;  4DR5 K;  3VQ9 A;  3ZT4 A;  4AF1 A;  3MDQ A;  4BQZ A;  2ZJQ L;  1NOY A;  4DV1 K;  3IMX A;  4LC9 B;  3J81 O;  4H5V A;  2HHV A;  3J7Y P;  2ASP A;  3NGZ A;  5KI6 A;  2Q97 A;  3NVM A;  4HHT A;  2GWJ A;  1NOZ A;  1OVY A;  5M1O A;  4F2S A;  3CCU N;  3SPY A;  4BDP A;  3LWM A;  1XMQ K;  4GVE A;  4NB4 A;  4FJX A;  3GOI A;  1X9S A;  2UXC K;  4WE1 A;  1M1K O;  5J2N A;  1DKG D;  1SKW A;  2HHH K;  5KQ8 A;  3QDK A;  2Q36 A;  3PSI A;  4B1X B;  1ZBI A;  3L2R A;  1HNV A;  4J2B A;  4RW8 A;  1DGK N;  4JYA K;  3THX B;  2UUA K;  5FPM A;  4IDH A;  2HHS A;  1YTU A;  1QHA A;  3L2V A;  2VYP A;  2Z1H A;  5GIO A;  2KFN A;  1SQK A;  5AQH A;  3VQP A;  1HLU A;  1G99 A;  1W9H A;  2QWR A;  2XHB A;  3H1Q A;  3CJ1 A;  3VGK A;  2P9P B;  3O3G A;  2QKK A;  1OVQ A;  4BRI A;  2A6A A;  2P9S A;  4K43 A;  4WQ5 C;  3HP6 A;  4KB1 A;  3ULE B;  3NBP A;  4EZ6 A;  4BRH A;  1NKB A;  2G8U A;  4ILG B;  1Y64 A;  4JK9 A;  3SK3 A;  1XI1 A;  3PUF A;  3QEV A;  3O3F A;  4J8F A;  3TSP A;  2HVI A;  1Z25 A;  3L4I A;  3M8S A;  2GEL A;  3L2W A;  4CJP A;  4JHD B;  4H0T B;  4DKW A;  3QNN A;  2HND A;  4Z0U A;  3THW A;  3QER A;  3CI5 A;  4FVM A;  3WEE A;  1YIJ N;  3AVB A;  1C0T A;  3OYN A;  4AM7 A;  2GUP A;  1BQN A;  2P9U A;  1S1T A;  4IOC L;  1YF5 L;  5FRO A;  3NH1 A;  1CZB A;  4LSL A;  2V7Y A;  3Q7C A;  1E4F T;  4KPY A;  5HRS A;  3O9T A;  2HST A;  4FLV A;  1L3V A;  1VSL A;  4LY7 A;  4DB3 A;  2O4I A;  1L3S A;  1NG9 A;  3NE6 A;  5DMR A;  1Q9Y A;  2FLO A;  1JLG A;  3H46 O;  4JKB A;  4WQ4 C;  3HOT A;  4DLG A;  3CPE A;  2Z1J A;  4FW2 A;  2DFE A;  3KLF A;  5I3U A;  1BCM A;  3KVG A;  5DM6 L;  1QQO A;  1EO1 A;  3HVT A;  4DTJ A;  1HQE A;  4FZY A;  2NZT A;  1SV5 A;  4ELV A;  3L3V A;  5AQR A;  3VQQ A;  3D7E O;  2QXF A;  2HHQ A;  3AAR A;  4QS7 A;  3V9S A;  1NJW A;  4M3U A;  1QZ6 A;  3HST B;  4KV8 A;  3T69 A;  1NGC A;  4C1N I;  2KQ2 A;  3C0B A;  3DLE A;  3WXJ A;  4WCE L;  4MFB A;  4LF8 K;  4GKJ K;  4CJ5 A;  3OYG A;  3QES A;  3CPW M;  1DEJ A;  1S9G A;  1RT1 A;  2YNI A;  3M8P A;  4O0I A;  4Z4C A;  3DI6 A;  5AQN A;  3OYE A;  2XRI A;  3LP2 A;  4JKE A;  4DS4 A;  3FFI A;  4K8Z A;  4DTM A;  3OJS A;  2PYJ A;  2NRZ A;  3CM6 A;  1BA1 A;  3G4S N;  1RTH A;  3PO5 A;  3KK3 A;  1I39 A;  5JS2 A;  1HMV A;  1T6C A;  3LAN A;  1NGE A;  2PY5 A;  4CI6 A;  1X3M A;  3K5L A;  4FJN A;  1JL2 A;  5J2Q A;  3MXI A;  3AVJ A;  3R9P A;  3TSU A;  2GWK A;  1WLJ A;  3LZJ A;  4ELT A;  2HBM A;  3OYA A;  3QEW A;  1GLE G;  2DTU A;  4I9L A;  5MLC Q;  3MK6 A;  1IKV A;  4BRM A;  2VGM A;  3D2E B;  3C7N A;  3U9D A;  4BDY A;  2OPQ A;  1H1V A;  2GTD A;  5AZJ B;  2XY8 A;  4KH4 A;  3ZSZ A;  1ASV A;  2HB5 A;  4BC5 A;  4BRC A;  2X78 A;  4OLB A;  4GV3 A;  1KD1 O;  3JS6 A;  2KW4 A;  3FZK A;  4YNQ A;  1NLV A;  1RT3 A;  3D0P A;  3MCP A;  3RMA A;  1NMN A;  3SQ1 A;  2WC9 A;  1BHL A;  1TK8 A;  4ISG A;  3VQD A;  4X66 K;  5AQI A;  4DSI A;  4JS5 A;  2ZJP L;  2HHW A;  3BDP A;  2VG5 A;  4FLY A;  3PSF A;  2XY7 A;  3ALY A;  4CJL A;  3JAM O;  3RMB A;  1IH7 A;  4E1M A;  3KIO A;  3ZT3 A;  1TL1 A;  1YAG A;  1BO5 O;  4RW6 A;  3MX5 A;  4FOI A;  2ITG A;  4JV5 K;  3SQ4 A;  1YTA A;  5B8H A;  4N47 A;  3F5T A;  5BRF A;  4JK8 A;  4FZX C;  4FK0 A;  1TVR A;  2FBT A;  3AVN A;  2OPP A;  3SPZ A;  4DMN A;  3P39 A;  4O4G A;  1BQM A;  4DTP A;  5C2D A;  2NLX A;  4FJ7 A;  1FK9 A;  2QK9 A;  5BN8 A;  3O4Q A;  2IAJ A;  2NRR A;  3CER A;  2D5R A;  3LAK A;  3MXM A;  3SYZ A;  3CFR A;  3HPG A;  1VSH A;  5FPE A;  5IWA K;  3G10 A;  2XY5 A;  5GAG P;  4H03 B;  1NGD A;  3RWU A;  5AQJ A;  3R1X A;  3TAR A;  4AHV A;  1XNQ K;  5A2Q O;  1LCU A;  1IKX A;  1C1A A;  4F2R A;  1TGO A;  3VA3 A;  4FWS A;  1K6Y A;  1XQS C;  4ID1 A;  3CHW A;  3QB0 A;  2QI2 A;  4CE9 A;  3ENO A;  1GOA A;  4BC3 A;  3PLA A;  3H3O B;  3KK1 A;  4E3S A;  3RMC A;  3O6W A;  2UUB K;  2IVO A;  3J7A P;  4XIU A;  1RDD A;  3K5O A;  2KFZ A;  2D0B A;  3VET A;  3THV A;  3IFR A;  1VQ7 N;  3AVK A;  1WUA A;  1HR0 K;  1TAQ A;  4TSX A;  1JCG A;  1GLJ O;  1RIL A;  3HT3 A;  1U47 A;  3DXM A;  4CJK A;  4ELU A;  1ZBF A;  1EX4 A;  1EXQ A;  2JWK A;  4IXC A;  4MO4 A;  4DQI A;  4E7I A;  1X9M A;  1IJJ A;  2DFF A;  4JI6 K;  1GLB G;  4AQY K;  4LD0 A;  4OVL A;  3HO1 A;  1RDB A;  2D0O A;  3HRG A;  4I2P A;  4CEZ A;  3AV9 A;  4X64 K;  4E7K A;  4PUO A;  3FZL A;  4CEC A;  4YDU A;  3V1Q A;  3RMD A;  3FE1 A;  4IEE A;  2HHT A;  3OBY A;  3K58 A;  4KKO A;  1W7A A;  1EET A;  3O9R A;  3UKU B;  2HW3 A;  3WNE A;  1NGA A;  4B1W B;  3MN6 A;  1UA0 A;  1JCE A;  1F21 A;  1GLC G;  5HOO A;  4LF9 K;  1NGJ A;  3AVF A;  3OYK A;  3D45 A;  3H1V X;  3VEX A;  2O8C A;  4JKD A;  3QLH A;  5KPT A;  2YKN A;  5C2F A;  3KLH A;  1TYQ B;  3DLL L;  1KRP A;  2B6A A;  4BG8 A;  3CCS N;  4E1J A;  4O55 A;  3THY B;  3O4N A;  4PL7 A;  4JRP A;  3D6R A;  3JSM A;  1VQ6 N;  4WFN L;  1S9E A;  3CCJ N;  3OHR A;  3IS9 A;  4YOW A;  1IKY A;  1KAY A;  4JK7 A;  4B3M K;  4B1Z A;  1B9F A;  4AHC A;  1N5Y A;  2ZE2 A;  2A5X A;  2NUB A;  4KTW A;  4U7B A;  3L4Q A;  2ASM A;  1BDG A;  4GY2 B;  5LMN K;  5FRM A;  4DQR A;  4IOX A;  4FK4 A;  1HX1 A;  1SZ2 A;  2HF4 A;  3EE8 A;  4B3O A;  2EWS A;  3DLG A;  3DM2 A;  3CD6 N;  4KRF A;  2HMI A;  4ZTJ A;  5F1X A;  4E7J A;  3LP3 A;  1NGI A;  1TV6 A;  1S72 N;  2YV0 X;  1S1X A;  1K8K A;  4IWV A;  3T19 A;  5C24 A;  2E5L K;  1JCF A;  1YHQ N;  4OLA A;  5HP1 A;  2PZS A;  3TR8 A;  5E26 A;  2YHW A;  4BRG A;  1GLD G;  5GIN A;  3JYT A;  3OYI A;  1NNE A;  1U2V B;  4DG1 A;  3T1Y K;  4H0V B;  5I42 A;  3UIQ A;  3T1A A;  4NCB A;  4HCC A;  4FWK A;  5KGX A;  2WFB A;  3M8Q A;  1EQY A;  4N5S A;  2E6L A;  1J54 A;  5GAD P;  1IBM K;  3SMS A;  2UYT A;  4NXN K;  4Z4I A;  4HTU A;  5J1E A;  4FLX A;  2UU9 K;  4DFM A;  4DV5 K;  4I7F A;  1XC3 A;  4H4M A;  2E2Q A;  3GE1 A;  1QSS A;  3THX A;  3VN5 A;  5LY3 A;  2QW9 A;  2P9L B;  4CF0 A;  3QEX A;  1ASU A;  3PO4 A;  1QQC A;  3ZSY A;  3S3O A;  3K5M A;  5J2M A;  3M6G A;  4BRF A;  3AAP A;  4DTX A;  2O8F B;  4ID5 A;  2GUI A;  2NRV A;  4KTZ A;  1LW2 A;  4CEE A;  4FWO A;  4JLH A;  2B4J A;  3ZSQ A;  4QS9 A;  4FPA A;  4CZH A;  1WAJ A;  3FZM A;  3VTI A;  4DSL A;  3OS0 A;  4FZZ A;  2HNY A;  2FBY A;  3CYM A;  1EWR A;  4IZ9 A;  2QXL A;  4JHD A;  5AJ3 K;  4EP4 A;  4CES A;  4BE0 A;  5GAH P;  2XY6 A;  3CJ7 A;  3VQE A;  4RWT A;  3BEX A;  1C0F A;  1BWF O;  3E1Y A;  3O5B A;  4IO8 A;  3V1R A;  1YXQ A;  2HBL A;  4K8X A;  4IG0 A;  4FJ5 A;  1FKO A;  4PL8 A;  4C8N A;  3K5N A;  4F8R A;  3CC7 N;  3AO5 A;  3RR7 A;  4KHY A;  2Q0U A;  4EFH A;  5KQD A;  1FXX A;  4CGI A;  3ASM A;  3OYB A;  4FM2 A;  1L5U A;  4LF5 K;  3NGY A;  4J2E A;  3PX4 A;  3A5N C;  1ZC6 A;  3NFA A;  4C8M A;  5JMV A;  1IG9 A;  1NGB A;  3O1B A;  3BUZ B;  3SAH A;  4FJG A;  4JS4 A;  4YOY A;  2KKZ A;  3CQX A;  1Z05 A;  4DTU A;  3KK7 A;  4DQ8 A;  4DWI A;  3TAG A;  4E7H A;  3HM8 A;  3VER A;  4FOE A;  4B9Q A;  3E01 A;  1NKE A;  4QAG A;  1KQS M;  3P5J A;  4CZF A;  1FJG K;  1CXQ A;  2BGG A;  3M8R A;  3VQ7 A;  4CZJ A;  1RBT A;  3R6M A;  4ISE A;  1N33 K;  3F9K A;  4EHU A;  3K59 A;  1SAZ A;  3HXM A;  1LAW A;  4ILH A;  4CJW A;  1YUW A;  4H5W A;  4BQL A;  4HCB A;  3RRG A;  3LPU A;  2QEX N;  2AP1 A;  3SUN A;  1ATS A;  4ICL A;  3HP9 A;  3HM9 A;  1ZBS A;  1P8Z A;  2IGI A;  4IDK A;  1JLC A;  2DY4 A;  3CCM N;  1L3T A;  1YVN A;  1N8R O;  2G8F A;  4H0P A;  4Y1D A;  4JAX A;  4KH5 A;  5M1K A;  5AFU H;  3TAQ A;  4QCL A;  3CM5 A;  3WUH A;  4A57 A;  1U49 A;  4DHY A;  3M1F A;  2QTD A;  4ILJ A;  3V9W A;  5KPR A;  1KFS A;  2D0C A;  3GG4 A;  4LSN A;  1JXB A;  3W0L A;  4CJ4 A;  3I55 N;  3NHG A;  2O8B B;  1O1W A;  1BIZ A;  2O8D B;  2IIR A;  3HYF A;  1XHX A;  1U48 A;  3KJV A;  3C6H A;  3HSC A;  3TTD A;  1NM1 A;  4Z4E A;  3DLH A;  3C94 A;  3S3M A;  1IG8 A;  3D2E A;  3VEY A;  3EO3 A;  3CJC A;  4B9L A;  2QWP A;  1U45 A;  3P38 A;  3PIO L;  5AZJ A;  4NXM K;  3LDS A;  1EP4 A;  3NAE A;  1ASW A;  2W6L A;  2QWQ A;  5KGW A;  1HUX A;  1TKX A;  2YNF A;  4YOT A;  1NK6 A;  3HVR A;  4O5F A;  3SJJ A;  4K0K K;  1KC8 O;  2ZM6 K;  4PKI A;  2W41 A;  5TKW A;  4RTF D;  3ZET B;  1EKE A;  1VRT A;  1BU6 O;  1WOQ A;  4Z4F A;  3NMU A;  4DSK A;  4DF4 A;  4DQQ A;  2ZGZ A;  3KKS A;  1NJX A;  4R79 A;  1X3N A;  5H1S Q;  4J2D A;  4DV7 K;  1JKH A;  2FF6 A;  3G25 A;  2CH6 A;  3U3G A;  2KZZ A;  4EAH D;  3O1W A;  4IFY A;  3AO3 A;  2O4G A;  3L8B A;  2FBX A;  4X62 K;  4WFB L;  3HBT A;  3TAE A;  3T1H K;  1HYS A;  4I6M B;  2YNG A;  1A5X A;  1ZXO A;  3VOV A;  3RR8 A;  3DRP A;  3VQA A;  2IOC A;  4BVO A;  1A5W A;  5CYM A;  2GBZ A;  3O9S A;  2DPN A;  4BRP A;  1RT6 A;  4ISF A;  1VSE A;  3MN5 A;  4A61 A;  3N4P A;  1OH5 A;  5AQF A;  3LZI A;  1DT9 A;  3EY1 A;  3EN9 A;  3CC2 N;  1N32 K;  3CG7 A;  3IUC A;  4OGC A;  5SWM A;  1KLN A;  4KB0 A;  4YOX A;  4CF8 A;  3E9P A;  1TKZ A;  1D9D A;  4G1Q A;  3CIP A;  4W5R A;  1LV5 A;  1NJI O;  4PKG A;  1DTQ A;  3OBW A;  3TWH A;  5HL7 L;  3K9J A;  1EWQ A;  1RTJ A;  4HWI A;  3TTF A;  4B3T K;  4CBU A;  1HYV A;  2VGN A;  5AQX A;  3AA2 A;  2IS3 A;  2PAV A;  1N36 K;  4DR1 K;  2KHO A;  4B1Y B;  1RDW X;  5C12 A;  3DWL A;  2RPI A;  3C6T A;  2KTQ A;  1QQM A;  4M3T A;  3CJB A;  1VQK N;  3OS1 A;  2G8K A;  3O08 A;  2ZD1 A;  1O13 A;  2A42 A;  2I7P A;  1BI4 B;  4GVM A;  5JVG L;  4DSF A;  1U04 A;  3C6A A;  2WON A;  2FF3 B;  3G71 N;  4JKF A;  1QVG M;  1V4T A;  3VQC A;  4KFB A;  1ILY A;  1Q18 A;  4BE2 A;  1GLF O;  5KPZ A;  4OO1 J;  4CGF A;  3CQY A;  4WQ5 A;  4AM6 A;  2BTF A;  3QIP A;  4W5O A;  2D0A A;  4FPB A;  1RT5 A;  2ASO A;  3SZ2 A;  3WNF A;  3UKU A;  4H0Y B;  1GLL O;  4AIL C;  2E2O A;  1RDC A;  4Q5V A;  5C0Y A;  3EL2 A;  3KKR A;  4KBO A;  4BR4 A;  4CJT A;  1VSK A;  2V52 B;  1REV A;  4F4K A;  3K0S A;  1J5E K;  4Z94 A;  3AVL A;  2OYQ A;  5AZI B;  1TYQ A;  3UE5 A;  3B6P A;  3TAN A;  5AQY A;  3ZSO A;  1TL3 A;  3THY A;  4YHH K;  3KK2 A;  4NYF A;  4N76 A;  5HRN A;  4O5B A;  5CE3 A;  3KD5 E;  4WQ4 A;  3ATV A;  1GOC A;  2V7Z A;  1OKJ A;  2NRX A;  3ZT2 A;  4WF9 L;  3SQ0 A;  1X9J A;  1HPZ A;  3M5R A;  2NNW A;  2FSJ A;  3S41 A;  2BE2 A;  4Z4H A;  1SKS A;  4LFC K;  3TAB A;  3K2P A;  1HQU A;  5ADX H;  2ZGY A;  3K9K A;  3NF6 A;  1QTM A;  4JI1 K;  1WNS A;  2VWK A;  4JI5 K;  2JGU A;  4YDU C;  4IKF A;  1KVB A;  3O9U A;  3OVN A;  4JKG B;  2KZM A;  3P1G A;  1NGG A;  4CEQ A;  3AVA A;  3ZSR A;  3H3N O;  1C0M A;  2W42 A;  4JD2 B;  2B5J A;  2X74 A;  1J5O A;  1HNX K;  3AY9 A;  3HTV A;  3OYD A;  1LOT B;  4JI0 K;  3LM2 A;  3TPQ A;  3U8X A;  1NU0 A;  4RW9 A;  1T8E A;  3CCR N;  1U2V A;  5TKY A;  3A5L C;  4FJ8 A;  1RT7 A;  2EX3 A;  3ID6 A;  3LAM A;  3VEW A;  2HBJ A;  4DQS A;  1RBS A;  3QFP A;  4CFB A; 
#chains in the Genus database with same CATH homology
 1JCF A;  1YHQ N;  3EKS A;  4C1N K;  4F9O A;  2D0P A;  2Q1N A;  5E26 A;  2YHW A;  4BRG A;  1GLD G;  2F9W A;  4BRO A;  3DJC A;  3QIC A;  1K8K B;  5GIN A;  2W40 A;  1U2V B;  3FZH A;  3BP8 A;  4BR5 A;  5JLH A;  5JLF A;  2YCH A;  2Q31 A;  1QZ5 A;  5DM7 L;  2E1Y A;  4HTL A;  3CMA N;  1VAZ A;  4XH4 A;  4BR2 A;  4BGA A;  2BUP A;  4H0V B;  4U67 L;  1D4X A;  1E4G T;  2HMP A;  3GDQ A;  4JKA A;  1S3X A;  3J8A A;  3LDO A;  3HI0 A;  2FSN A;  2BH1 A;  1K9M O;  3ID8 A;  4FWK A;  4JN4 A;  2WFB A;  1EQY A;  1BA0 A;  3RSE A;  4AF1 A;  4BRD A;  3MDQ A;  4FWM A;  4BQZ A;  2P9L A;  3I33 A;  3UKR A;  5GAD P;  3IMX A;  2ZJQ L;  4LC9 B;  3SMS A;  3CJA A;  3LDP A;  4H5V A;  2UYT A;  2ASP A;  2QWM A;  2A40 A;  5AQG A;  2HBK A;  2Q97 A;  3NVM A;  1CZA N;  1TUY A;  2GWJ A;  1OVY A;  1XC3 A;  5M1O A;  5BRD A;  3R8E A;  2E2Q A;  3CCU N;  3GE1 A;  3SBG A;  4H5R A;  4IJA A;  5LY3 A;  4O8K A;  2QW9 A;  3RSE B;  1VQ8 N;  5EVZ A;  3ZX2 A;  4GVE A;  4NB4 A;  2P9L B;  1Q7Y O;  4H5T A;  3GOI A;  3UKR B;  2FXU A;  4A5A A;  3QFU A;  1M1K O;  2NRH A;  3M6G A;  1DKG D;  2CGJ A;  4BRQ A;  4BRF A;  2ZF5 O;  3AAP A;  2VWB A;  1T6D A;  5KQ8 A;  3LDQ A;  3QDK A;  3VTH A;  2Q36 A;  2NRV A;  4B1X B;  3CME N;  1DGK N;  1NWK A;  3LDN A;  4FWO A;  5FPM A;  4IDH A;  2QA4 N;  4QS9 A;  1QHA A;  1NMD A;  4FPA A;  2D4W A;  3O4W A;  2VYP A;  3VTI A;  3FZM A;  4CZH A;  5GIO A;  1SQK A;  5AQH A;  3QML A;  1RGI A;  4IEI A;  3G6E N;  1HLU A;  1G99 A;  2QWR A;  4IZ9 A;  2QXL A;  3E66 A;  3QBX A;  3VF6 A;  3H1Q A;  3CJ1 A;  3QBW A;  4JHD A;  1ATN A;  2YHX A;  4FWL A;  4NO7 A;  2P9P B;  5AQM A;  3VGK A;  5F0X A;  4YOU A;  5GAH P;  4BRI A;  2A6A A;  2P9S A;  3CJ7 A;  4K43 A;  4WQ5 C;  3AAQ A;  3ULE B;  4RWT A;  3O9Q A;  4BRH A;  3BEX A;  1C0F A;  1Z6R A;  1BWF O;  4GV9 A;  4ILG B;  1Y64 A;  4JK9 A;  3E1Y A;  3O5B A;  4PKH A;  3SK3 A;  4IO8 A;  4J8F A;  3TSP A;  1YXQ A;  2HBL A;  3L4I A;  2GEL A;  4PL8 A;  3L0Q A;  5AQO A;  2E8A A;  4JHD B;  4H0T B;  4DKW A;  3I8B A;  3CI5 A;  5AQV A;  1YJN N;  3CC7 N;  1ESV A;  3WEE A;  5EXW A;  2P9S B;  1YIJ N;  2Q0U A;  4EFH A;  5KQD A;  4CJ7 A;  5C10 A;  3SAF A;  3VF4 A;  4AM7 A;  2GUP A;  2ZWH A;  2P9U A;  3J7Z O;  4IOC L;  1YF5 L;  1QVF M;  4XEI A;  2V7Y A;  1XUP O;  3Q7C A;  1E4F T;  3JXU A;  3O9T A;  2HST A;  3A5N C;  1ZC6 A;  4B1V A;  5JMV A;  4DB3 A;  2WUS A;  4MLE A;  3A5O C;  1VQ5 N;  3WEE B;  5BRH A;  1NGB A;  3O1B A;  3BUZ B;  3SAH A;  5FPD A;  4YOY A;  4BRA A;  2KKZ A;  3CQX A;  1Z05 A;  2FLO A;  3KK7 A;  4DQ8 A;  2P9U B;  3H46 O;  4JKB A;  4WQ4 C;  4CZL A;  3HOT A;  5AQK A;  3HM8 A;  3CPE A;  3VER A;  2YJE A;  2OAN A;  4FOE A;  4MDA A;  2CGK A;  3MWT A;  3R3L A;  4B9Q A;  1KAX A;  2E2N A;  3RVC A;  4CZK A;  1V4S A;  3KVG A;  5DM6 L;  4FVU A;  1QQO A;  4JNE A;  4GNI A;  4Y0W A;  4CZF A;  1KQS M;  1EO1 A;  5EY4 A;  3TSQ A;  3ZX0 A;  4H5N A;  1NBW A;  3KHY A;  4FWR A;  3TTC A;  5CR4 A;  4A62 A;  2NZT A;  4YOV A;  4CZJ A;  3CET A;  2JWL A;  3R6M A;  4ISE A;  4JEP A;  5AQR A;  3TU5 A;  3D7E O;  4EHU A;  1RDU A;  1SAZ A;  3AAR A;  5BPL A;  3F2K A;  1KXP A;  3H6E A;  3L6Q A;  2E20 A;  4ILH A;  4QS7 A;  2OTJ N;  1YUW A;  4BR7 A;  2QWN A;  4H5W A;  4BQL A;  3CF5 L;  4M7X A;  5BR9 A;  1QZ6 A;  3T69 A;  2QEX N;  4NLC A;  2AP1 A;  1NGC A;  4H0O A;  4C1N I;  1ATS A;  5BN9 A;  3WXI A;  3C0B A;  3WXJ A;  5I9E B;  1ZBS A;  1P8Z A;  4WCE L;  5AQT A;  3VGM A;  1U6Z A;  3D2F A;  3OA9 A;  1YIT N;  5AQU A;  1Q81 O;  1M90 O;  2ZJR L;  4O8U A;  3CCM N;  1YVN A;  3HZ6 A;  3CPW M;  1N8R O;  4H0P A;  1DEJ A;  5M1N A;  2J4R A;  4JAX A;  4KH5 A;  5M1K A;  5AFU H;  3WUH A;  3EZW A;  5AQN A;  1ATR A;  4A57 A;  1GLA G;  1HJO A;  2H3G X;  4JKE A;  4DHY A;  3M1F A;  1NGF A;  2AA4 A;  2QTD A;  2IVP A;  2P9I A;  4ILJ A;  3MMV A;  3D2F B;  4K25 A;  4FWN A;  5KPR A;  3FR0 A;  1VQM N;  2NRZ A;  3AGK A;  3GG4 A;  1BA1 A;  3G4S N;  3W0L A;  3SAG A;  4BR9 A;  3I55 N;  3Q7B A;  1T6C A;  4IFE A;  1NGE A;  1MDU B;  2IIR A;  2GEM A;  4CI6 A;  2F7T A;  2P9P A;  3C6H A;  1X3M A;  3HSC A;  3TTD A;  4BC2 A;  1NM1 A;  4FSV A;  2P9I B;  2E2P A;  3ULE A;  3R9P A;  1IG8 A;  2GWK A;  3CJ9 A;  3D2E A;  3TSU A;  3VEY A;  4CBW A;  2QWO A;  3EO3 A;  1YJ9 N;  2HBM A;  3CJC A;  2QWP A;  3KWG A;  5EX5 A;  4FWP A;  3ZET A;  1MWK A;  1GLE G;  5MLC Q;  3P38 A;  1W97 L;  4OPA A;  3PIO L;  4BY9 C;  5AZJ A;  3MK6 A;  4K42 A;  4BRM A;  3ZX3 A;  5ADX A;  3CXC M;  2VGM A;  2E88 A;  3I56 N;  4L3Q A;  2QWQ A;  5GAE P;  4WFA L;  1MWM A;  1HUX A;  5JVH L;  4YOT A;  3D2E B;  3C7N A;  4O5F A;  3U9D A;  1KC8 O;  4PKI A;  2W41 A;  5TKW A;  4RTF D;  5M1P A;  1QQN A;  3ZET B;  1K73 O;  3NVK A;  1H1V A;  1BU6 O;  1WOQ A;  2QWL A;  2GTD A;  4YOR A;  3C65 A;  5AZJ B;  3ATU A;  3VGL A;  4KH4 A;  5AQW A;  3NMU A;  1T44 A;  4BC5 A;  4BRC A;  5JIC A;  2ZGZ A;  3O8M A;  3CCL N;  4BVP A;  4R79 A;  3H45 C;  1X3N A;  4I6M A;  5H1S Q;  2F9T A;  3SJH A;  4GV3 A;  4QS8 A;  1KD1 O;  3JS6 A;  3C7N B;  3FZK A;  3IKM A;  1NLV A;  1SS6 A;  4MDB A;  2FF6 A;  3G25 A;  2CH6 A;  3MCP A;  4FL9 A;  3A0I X;  3U4L A;  4BGB A;  3MN7 A;  4EAH D;  2WC9 A;  3O1W A;  3CCE N;  4CD1 A;  1JJ2 M;  3KWI A;  4ISG A;  1BG3 A;  3WXL A;  4WFB L;  3HBT A;  5AQI A;  2ZJP L;  2PFU A;  4I6M B;  3WQU A;  3VOV A;  1ZXO A;  2NRW A;  3EKU A;  5E84 A;  4EIA A;  4K41 A;  2V51 B;  3DAW A;  4BVO A;  1YAG A;  1BO5 O;  3MX5 A;  4FOI A;  2HOE A;  3O9S A;  1VQO N;  3EE9 A;  3ENH A;  2DPN A;  4BRP A;  5B8H A;  2PBD A;  4ISF A;  1T3V A;  3F5T A;  5BRF A;  4JK8 A;  4FWQ A;  5BPN A;  3MN5 A;  4CZM A;  1W2B M;  4A59 A;  4A61 A;  3VMF B;  3N4P A;  3P39 A;  2KLA A;  3FFK B;  5AQF A;  1HPM A;  2Q2R A;  4CZG A;  1DT9 A;  2YI1 A;  1TUU A;  3SLC A;  4EHT A;  5FPN A;  3EN9 A;  3CC2 N;  3VEN A;  5C2D A;  1BUP A;  3IUC A;  2NLX A;  4YOX A;  3E9P A;  4XH5 A;  3KZB A;  5AQQ A;  4A2B A;  5BN8 A;  3CIP A;  2NRR A;  2WBN A;  1YJW N;  3MN9 A;  2I7N A;  3OBW A;  4PKG A;  1NJI O;  3CER A;  5HL7 L;  3K9J A;  4M63 C;  3SMP A;  3B8A X;  5M1F A;  2E1Z A;  2HF3 A;  5FPE A;  1Q82 O;  4GV6 A;  4HWI A;  3VEO A;  5BPM A;  3TTF A;  4CBU A;  5GAG P;  4H03 B;  2VGN A;  1NGD A;  5AQX A;  5AQJ A;  3P31 A;  3LDL A;  3R1X A;  3CCV N;  1LCU A;  2PAV A;  1Q86 O;  3BF1 A;  1MA9 B;  2KHO A;  4B1Y B;  4BG9 A;  1HKB A;  4BRK A;  1RDW X;  5C12 A;  3DWL A;  4FWS A;  3MCA B;  5EOY A;  1QQM A;  1XQS C;  3MWP A;  3CHW A;  3QB0 A;  2QI2 A;  4NLB A;  3ENO A;  3CJB A;  3FGU A;  1KAZ A;  1VQK N;  4BC3 A;  4CZI A;  3H3O B;  3PLA A;  4BRE A;  3O08 A;  5LJV A;  3VPZ A;  3MX2 A;  3A5M C;  3LM9 A;  3O6W A;  4OPH A;  1O13 A;  5AQL A;  2A42 A;  4CD3 A;  2I7P A;  2IVO A;  4CZE A;  3T7Z A;  5JVG L;  3WXK A;  2CGL A;  3C6A A;  2FF3 B;  3G71 N;  4JKF A;  5AQP A;  4BRN A;  1QVG M;  1V4T A;  3VET A;  1YI2 N;  4IOA L;  1ILY A;  3IFR A;  1HKG A;  1Q18 A;  1VQ7 N;  2FSK A;  1GLF O;  1HKC A;  5KPZ A;  1WUA A;  4OO1 J;  4A2A A;  1C0G A;  3OW2 M;  3CQY A;  4WQ5 A;  4AM6 A;  3F9M A;  1JCG A;  1GLJ O;  2A41 A;  2BTF A;  3DXM A;  4FPB A;  3GBT A;  3DXK A;  2JWK A;  4IXC A;  4MO4 A;  2ASO A;  3N4Q A;  2NRT A;  3P4I A;  3UKU A;  1IJJ A;  4XH1 A;  1S22 A;  5AZI A;  3GL1 A;  1GLB G;  4H0Y B;  3U9Z A;  1GLL O;  3E9L A;  2E2O A;  3ENB A;  5C0Y A;  4DCH A;  3EL2 A;  3HRG A;  2D0O A;  4KBO A;  4FO0 A;  2P9K A;  5F2R A;  4BR4 A;  2V52 B;  3DXM B;  4MLH A;  3VF2 A;  2D1K A;  3FZL A;  3WXM B;  1VQN N;  3DXK B;  4IJN A;  4YDU A;  1P90 A;  4Z94 A;  5GIP A;  3FE1 A;  4IEE A;  2IVN A;  3OBY A;  3VEZ A;  3O9R A;  3UKU B;  3AGR A;  1NGA A;  5AZI B;  4JKH A;  1TYQ A;  3E9O A;  3FZF A;  3UE5 A;  4B1W B;  3CC4 N;  3MN6 A;  1JCE A;  5AQY A;  5M1Q A;  3O80 A;  1GLC G;  5CHI A;  2P9K B;  5HOO A;  3HOS A;  3ZYY X;  1NGJ A;  4C23 A;  5CE3 A;  1NGH A;  4WQ4 A;  3A8Y A;  2A3Z A;  3ATV A;  4B1U B;  2V7Z A;  3H1V X;  2ITM A;  1OKJ A;  2NRX A;  3VEX A;  5AQZ A;  2RE2 A;  4JKD A;  4BRL A;  5KPT A;  5C2F A;  4WF9 L;  1TYQ B;  3DLL L;  1X9J A;  4MO5 A;  2Q0R A;  4BG8 A;  2YHY A;  3CCS N;  2YX6 A;  4JKG A;  4E1J A;  3M5R A;  2NNW A;  2FSJ A;  3UB5 A;  1VQ9 N;  3S41 A;  3PIP L;  2CH5 A;  5AR0 A;  3VES A;  3W3D A;  3D6R A;  5ELZ A;  4PL7 A;  4JD2 A;  3BF3 A;  3SBT A;  5ADX H;  1VQP N;  4M7Y A;  2ZGY A;  1VQ6 N;  3K9K A;  4WFN L;  3CCJ N;  3OHR A;  4KH6 A;  4YOW A;  1J6Z A;  4YDU C;  4IO9 L;  3WQT A;  4WYB A;  1KAY A;  3O9U A;  4JK7 A;  4B1Z A;  4JKG B;  1NGG A;  3CCQ N;  2A5X A;  5BRE A;  4UY8 O;  2P9N A;  3H3N O;  4JKC A;  4U7B A;  3L4Q A;  2ASM A;  4JD2 B;  1BDG A;  4GY2 B;  4PHT X;  5LJW A;  4IOX A;  3M3Z A;  1HX1 A;  1SZ2 A;  2HF4 A;  3AY9 A;  3EE8 A;  2EWS A;  3HTV A;  4RCH A;  5AQS A;  1LOT B;  1K8A O;  2YJF A;  3LM2 A;  3ZEU A;  4BR0 A;  3CD6 N;  3TPQ A;  3FLC O;  3U8X A;  1BOT O;  4G9Z A;  5AFU A;  5C15 A;  2QM1 A;  3WT0 A;  4A5B A;  5F1X A;  1VQL N;  1RFQ A;  1NGI A;  4CBX A;  3CCR N;  1S72 N;  3VEV A;  1K8K A;  1R59 O;  1U2V A;  2P9N B;  4BC4 A;  2RHK A;  5TKY A;  4H0X B;  3A5L C;  2VCP A;  4IWV A;  3ID6 A;  3VEW A;  2HBJ A;  2OTL N;  2GX9 A;  3QFP A;  3LL3 A;  3ZEU B;  1VQ4 N;  3IDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...