2E2PA

Crystal structure of sulfolobus tokodaii hexokinase in complex with adp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
298
structure length
298
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 104
structure length 298
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2pA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2pA01
4BRFA 4CZLA 1LOTB 1XQSC 2GWKA 1H1VA 5JLHA 1C0GA 2E1ZA 4A62A 2V7ZA 3LL3A 3C0BA 3CJ1A 3TPQA 3KZBA 1IG8A 2Q0RA 2D0PA 3EZWA 2NRHA 1E4GT 1GLDG 2P9LB 4PKGA 2E8AA 3QFPA 1HPMA 3WXLA 3WEEB 2YCHA 3CQXA 2P9PA 1T6DA 2VWBA 3FFKB 2I7NA 2FF3B 3R8EA 2D0OA 2KHOA 3D2FA 3MN9A 3FZHA 4BR5A 3UB5A 3FZKA 1JCFA 4QS7A 2YHWA 4XH1A 5AFUA 1KAZA 4BRAA 5KPTA 2A42A 2PAVA 4JN4A 3UKUA 4RTFD 3AAPA 1GLBG 3A5OC 4CZMA 2IVPA 4H0VB 4K43A 1HJOA 1K8KA 3LDQA 4NO7A 3IUCA 3L4IA 5KPRA 3AARA 3DXKB 4EHTA 4A2AA 5AQIA 5LY3A 1GLAG 2V51B 4BVOA 3CQYA 3HM8A 5AQOA 1BU6O 3P4IA 2DPNA 3VPZA 3R6MA 1BA0A 3A5LC 4FWMA 5BR9A 1GLFO 5KQ8A 3BEXA 4AM7A 2A6AA 3H1VX 4PKHA 3UKRB 4Y0WA 3SMPA 4XH4A 2I7PA 4XEIA 4B9QA 3L0QA 4DB3A 3VEWA 1HKGA 2P9LA 3RSEA 1ESVA 3C7NB 3SLCA 3WEEA 4BC3A 3LDOA 4JHDB 4FWRA 3VEXA 2P9KB 1NGIA 1NGAA 5FPEA 4K41A 2J4RA 4FO0A 5ADXH 3D2EB 4WQ5C 3U8XA 2D4WA 2P9NB 3CJ9A 2GEMA 3S41A 2YHXA 1QZ5A 3D7EO 3BF3A 2A3ZA 4MLHA 3KVGA 1KXPA 4M7YA 2NZTA 3CHWA 5E26A 3ZETB 4CZKA 4HTLA 3FZLA 1V4SA 4IXCA 2FF6A 3SJHA 2NLXA 1SAZA 1HKCA 4FOIA 3O4WA 5AQSA 3U9ZA 3WXIA 4C23A 5LJWA 4ISEA 3WT0A 2Q2RA 3H6EA 3DAWA 5AQLA 5AZJB 2V7YA 4IZ9A 5AR0A 4BRKA 4BRNA 4H0YB 5ADXA 3WQUA 1LCUA 2ZWHA 4BC4A 3VEZA 1G99A 1NGBA 5B8HA 3UKRA 5AQGA 3EKSA 4YDUA 1NGCA 2FSKA 1MWMA 3IDHA 2CGJA 3TU5A 2ZF5O 4EAHD 2CGKA 1ATRA 4CZJA 4BRGA 1YXQA 3C7NA 1DGKN 4JHDA 3DXMA 2QWMA 3ULEB 2P9SA 2HMPA 2QWRA 1U2VB 4BRQA 3MCPA 4CD1A 3U4LA 2UYTA 5AFUH 4BRIA 5BPNA 4HWIA 2GWJA 1X3NA 4AM6A 2IVNA 1NWKA 4FPBA 3LDLA 5AQXA 5CE3A 4IWVA 4GY2B 5EXWA 1S3XA 1RFQA 1WOQA 2F9WA 3FE1A 5F0XA 4FL9A 2OANA 1V4TA 1NM1A 1XC3A 2W41A 2QWQA 4B1VA 5JICA 3GOIA 4BQZA 5AZJA 1BWFO 4H5NA 3W3DA 3GE1A 3MN5A 3BUZB 1YUWA 3UE5A 5E84A 3ZX2A 5AQZA 2ASMA 2VCPA 1YVNA 4BRMA 3LM2A 4H0PA 4H5WA 5AQVA 3VERA 4CBWA 4F9OA 5FPDA 2H3GX 3HTVA 3CIPA 1Y64A 1SZ2A 3OHRA 4I6MB 5BRFA 3CI5A 1BUPA 4PKIA 3QMLA 2P9IB 3ZX3A 3VEOA 2FXUA 2QW9A 2E2OA 2WUSA 4BVPA 1U2VA 4H5RA 1TYQB 1ZXOA 4WQ4C 4BC2A 4FOEA 1NBWA 4O8KA 4WQ4A 1MA9B 4B1YB 2QXLA 3VENA 3H1QA 2HF4A 2VYPA 3ATVA 3EO3A 3R9PA 5BREA 3ZEUB 1J6ZA 1BG3A 4JNEA 3W0LA 4BG9A 4EIAA 1OKJA 4BC5A 5F1XA 2Q36A 2ASOA 1C0FA 4BR9A 1GLLO 5JMVA 3M1FA 3LDNA 2HF3A 1Z6RA 4BG8A 4IJNA 1KAYA 1JCGA 3F9MA 1NGGA 4BRDA 3GG4A 1HKBA 1MWKA 5BPLA 2CGLA 5AQQA 1ZC6A 4M7XA 4IO8A 3FLCO 4JAXA 2P9UB 1MDUB 3H3OB 4IJAA 4Z94A 3GL1A 2IIRA 4I6MA 3EL2A 3O5BA 3O80A 4JD2B 2CH6A 4LC9B 3O6WA 3IMXA 4KBOA 3ZX0A 3DXKA 1ATNA 4BRCA 3A5MC 3MDQA 3VGKA 1Z05A 5TKYA 2QWOA 3HSCA 1E4FT 2W40A 3HI0A 4B1UB 4PL7A 1IJJA 4YDUC 1R59O 2A40A 4J8FA 4FWOA 2AP1A 2GTDA 5BN9A 2PBDA 4XH5A 3EKUA 3A8YA 5BPMA 2ASPA 2P9PB 4MO5A 5BRHA 1XUPO 4CZIA 3QBXA 2Q31A 1RGIA 4CZEA 4DCHA 3D2FB 3HZ6A 3DWLA 2P9KA 3MN7A 3FR0A 5AQUA 2E20A 1X9JA 4CZHA 3MN6A 3D2EA 3VF6A 4H03B 2P9NA 1NGEA 2QWPA 3B8AX 3VEYA 4BR7A 3AAQA 3O8MA 3UKUB 4BR4A 3VGMA 2GELA 3CJAA 4H0OA 5BN8A 1TUUA 2D1KA 4FSVA 1K8KB 1QQMA 2P9UA 2Q97A 4FWQA 5JLFA 3WUHA 4H5TA 1S22A 3ZETA 1ATSA 4B1XB 4L3QA 3H46O 3QDKA 4JD2A 1YAGA 3CJBA 2FSNA 3M6GA 5FPNA 4CZGA 1HX1A 1SQKA 1NLVA 2YJEA 3CJCA 4H0TB 1T6CA 2ZGZA 4CBUA 1CZAN 4GNIA 4B1ZA 4M63C 4BR2A 3DJCA 1ZBSA 3AY9A 4BREA 1NGFA 4E1JA 2E88A 4FWSA 3RSEB 4BRPA 4RWTA 5I9EB 1BO5O 3GDQA 3JS6A 2BUPA 4QS9A 1DEJA 5AZIB 3QFUA 4BGAA 2V52B 2GUPA 4QS8A 3WXJA 3SMSA 4DHYA 3ULEA 5AQFA 1QQOA 5AQMA 1RDWX 4K42A 5EX5A 3VF2A 4RCHA 2FSJA 3LDPA 3FGUA 4MO4A 3KHYA 3ID8A 5AQTA 3BP8A 4A2BA 1NGJA 1DKGD 2CH5A 4B1WB 1GLJO 5LJVA 2ITMA 5AQYA 4DQ8A 3FZMA 2EWSA 3U9DA 2F9TA 2YJFA 1GLEG 4CBXA 3I8BA 2E2NA 1QZ6A 2A41A 3BF1A 1P8ZA 3L6QA 4FWNA 1BDGA 3GBTA 5AQHA 1U6ZA 2HOEA 3A0IX 3O1BA 4K25A 4NB4A 3ATUA 4EHUA 2Q0UA 5F2RA 2BTFA 3QICA 1D4XA 4ISGA 1X3MA 3VOVA 3ENOA 2E2QA 3IFRA 3VETA 3QB0A 2YI1A 3MMVA 1NGHA 2ZGYA 3ENHA 3QBWA 4BROA 5AQRA 3JXUA 5ELZA 4ISFA 3CJ7A 3LM9A 3SK3A 2IVOA 3VESA 4CD3A 4PL8A 5FPMA 3DXMB 1T44A 5AZIA 5BRDA 3FZFA 2P9SB 4BQLA 4FWLA 2P9IA 4BRLA 5AQPA 1NMDA 4CI6A 4H0XB 3A5NC 1QQNA 4WQ5A 1TYQA 2QM1A 3MK6A 3WXKA 5KQDA 1NGDA 2A5XA 1BOTO 3VEVA 4WYBA 1KAXA 1EQYA 3CERA 3VGLA 3ZEUA 4CJ7A 1Q18A 3WQTA 4BRHA 3HBTA 2E2PA 1TUYA 3EN9A 1WUAA 2QWNA 5AQNA 5AQWA 4H5VA 4MLEA 4O5FA 3CETA 4A61A 4CZFA 1HUXA 5EY4A 5EOYA 1GLCG 3VF4A 1HLUA 4BGBA 4BR0A 4FPAA 3H3NO 4FWKA 4EFHA 2AA4A 4FWPA 1BA1A 2FLOA 5EVZA 3M3ZA 3H45C 3I33A 3O08A 3J8AA 5KPZA 2Q1NA 3O1WA 3G25A 2QWLA 2E1YA 2YHYA 5AQKA 1QHAA 1JCEA 5AQJA
chains in the Genus database with same CATH superfamily
4BRFA 3ZSRA 1EWRA 4DTSA 3DOKA 3DLGA 1H1VA 2E1ZA 2VWJA 1Q9YA 4B9SA 5C0YA 3KZBA 2YNHA 2NRRA 4LH4A 2Q0RA 4DFPA 2D0BA 1HNIA 4M41A 3C6TA 1WSGA 2P9LB 1BISA 1S6QA 1HPMA 3WXLA 3IAYA 3HSTB 4KV8A 3VQ6A 4R5PA 3OW2M 4Y1CA 4GV9A 2VWBA 4KRFA 1YJWN 4DTPA 3HPOA 2D0OA 5TKWA 1HNVA 4FVUA 4HCCA 4QS7A 2YHWA 1ZBHA 4FLTA 2OPPA 5KPTA 1O13A 4KHSA 3C65A 4JKDA 3UKUA 4RTFD 3AAPA 3IKMA 1VHXA 2IVPA 4H0VB 3L2QA 3LDQA 1KRPA 4JKEA 3J7ZO 4C8OA 5AQIA 1GLAG 4BVOA 3HM8A 3OYGA 4CGHA 3I55N 3OS2A 5CZ2A 1HYVA 5KQ8A 3BEXA 4FJNA 2YKMA 4AM7A 2A6AA 4DTJA 3SMPA 2HSTA 4CHZA 1W0HA 2KQ2A 4YORA 4B9QA 2PY5A 3TTDA 4PWDA 2E4LA 1S1UA 1ZBUA 4AHUA 4DSJA 1ESVA 3WEEA 4BC3A 3OYFA 3THYA 3SPZA 1BI4A 3AGRA 1VSMA 4CHYA 4FJHA 3TARA 1NGAA 3EE9A 2B6AA 1KQSM 5ADXH 3D2EB 2AJQA 3OYHA 4Z4GA 4BY9C 4JI8K 2DY4A 4DSEA 4LF4K 3J81O 2A3ZA 4M7YA 3E66A 2O8BA 1HNWK 5E26A 2X6NA 3LPUA 3HXMA 2VWKA 3O4WA 4WFBL 3G0ZA 3OA9A 4ISEA 4DS4A 5CZ1A 4IZ9A 4HUFA 2ZWHA 4DR1K 4DF8A 3OYLA 3QERA 3EKSA 1KVBA 1MWMA 3IDHA 1OVQA 2CGJA 3TU5A 3LP2A 3KJVA 2CGKA 1ATRA 4N76A 3O3FA 3RWUA 1YXQA 3C7NA 3QNOA 3THVA 2VGNA 4LF5K 3DXMA 3KLFA 4M3ZA 1J53A 3SNNA 4MQ3A 1U2VB 4JKBA 4FXDA 3U3YA 3MCPA 3F2KA 4GMJB 4CE9A 5BPNA 1C1AA 2IVNA 2VG7A 1RTHA 4JV5K 4GY2B 1WOQA 1VSDA 4FM0A 4LY7A 4CF8A 2ZQBA 1XC3A 2W41A 1J9AA 4YOXA 4F3TA 4LSLA 4FJ7A 1TKXA 4CEBA 5AZJA 3DLBA 2QK9A 3V6DA 2O8FB 3BUZB 2XO7A 3UE5A 4ELTA 4JRQA 1M90O 2ASMA 4BRMA 2XY7A 4DR5K 4E89A 4W5NA 3HTVA 3OHRA 4GVEA 4DFMA 4F2RA 4CFBA 4KH4A 3ZX3A 4FLWA 4Z4CA 3VQQA 4KHYA 2E2OA 5J2MA 2WUSA 4BVPA 2GUIA 2EX3A 3RTVA 1TYQB 4E7HA 1ZXOA 4BC2A 3PUFA 3WNGA 3ZSZA 4WQ4A 4BWMA 2GV9A 3VENA 4I2PA 1LW2A 2HF4A 4M3TA 5BREA 3AVKA 4J2EA 3ZT0A 4BG9A 4PUOA 1OKJA 4BC5A 1QVGM 4DTNA 4JRPA 3OYJA 4C8LA 2F7TA 5KTQA 4KHQA 3VN5A 3HJFA 1GLLO 3AA2A 3DYAA 2HF3A 4IJNA 3VQ8A 3NE6A 3O9TA 1JCGA 3E01A 4CJPA 1VQKN 3ID6A 1JLAA 1NGGA 1HKBA 2WTUA 5M1PA 3Q7CA 1ZC6A 3AA4A 4OVLA 4Z94A 2P9UB 1IO2A 4IJAA 3GL1A 5JVHL 4N41A 3EL2A 3O5BA 3O3HA 4JD2B 4AHRA 5J2QA 4LC9B 3MEGA 4CK2A 1SKSA 3OYDA 4DR2K 4FK2A 1ATNA 4BRCA 1Z05A 3QINA 1SL0A 4M3WA 3KWIA 1NMNA 1E4FT 3HSCA 3VQ7A 4B1UB 3MEDA 4DSIA 4FWOA 2AP1A 5BN9A 2PBDA 4XH5A 2O4GA 1KVAA 3CMAN 1J5OA 3QEIA 1S1TA 4KTZA 1ZBIA 3TAGA 2ASPA 4MO5A 4CZIA 1RNHA 2Q31A 3OY9A 1RGIA 5M1NA 3DWLA 3UIQA 4LFCK 3FR0A 4DUYK 1JL1A 1WLJA 1X9JA 4O44A 4DSLA 3VF6A 1BQNA 2F96A 3E9PA 3AGKA 4H4MA 3AAQA 3UKUB 4BR4A 4DV2K 1N5YA 2GELA 3CJAA 2UUCK 4H0OA 3R3LA 4FSVA 2ITGA 1QQMA 2JLEA 3EEQA 3VQPA 3NGIA 1JLGA 2IS3A 3CPEA 3ZETA 1ATSA 4L3QA 4ZHRA 3CJBA 4BDYA 1WNSA 3M6GA 1SQKA 1NLVA 2YJEA 4OKJA 2ZGZA 4CIEA 4WFAL 3AVLA 1TVRA 4M63C 4JS4A 4CFDA 5AJ3K 4BACA 1YJ9N 3AY9A 4JI4K 3HRGA 3KWGA 4E1JA 2E88A 3WNHA 4BRPA 5I9EB 1BO5O 3CCQN 1JJ2M 3JS6A 3LP3A 2BUPA 5C10A 3N4PA 4X62K 5IWAK 2G8KA 2P5OA 2Z1GA 4YOYA 4QS8A 3WXJA 5AQMA 3O4NA 4OKEA 3VF2A 3HL8A 5C2DA 3ID8A 1JLEA 3JSMA 2O8CB 3FZMA 1NK8A 4OGCA 4AILC 3U9DA 2F9TA 4W5RA 4YOTA 3OYBA 4CBXA 3AVCA 3PSFA 4G9ZA 2FBTA 1YT3A 5FDLA 1BDGA 1U6ZA 1TL3A 3O1BA 3L3VA 5F2RA 3ZT4A 3TR8A 4ISGA 3VETA 3U6FA 3QEWA 3QB0A 1TAQA 3MMVA 5AQRA 4O8UA 5ELZA 4FLVA 3RMCA 3ALYA 3CJ7A 3LM9A 3SK3A 4CD3A 5H1SQ 3NGZA 3PIOL 3DXMB 1T44A 5BRDA 5GADP 5DM6L 1XNQK 4KHPK 2KFNA 4FWLA 4AHTA 4ILJA 5AQPA 4BRLA 1NMDA 5DK5A 3MWPA 2QM1A 3NH2A 3MK6A 3O4QA 1BOTO 3V4IA 3SYZA 5J2PA 4V19S 1EQYA 4OX9K 2ZJPL 4B3TK 4B9NA 3WNEA 4LF9K 3WQTA 4FJJA 2E2PA 3EN9A 2QWNA 3THXA 3TSPA 4M3XA 1IKWA 2IDOA 1JLCA 1RBRA 2XRIA 1Z25A 2BH1A 1GLCG 3AA3A 3RVCA 4A59A 4CEAA 3TAPA 1TL1A 4CJKA 4FPAA 3LWMA 2BGGA 1YTAA 4EFHA 4LSNA 5GIOA 4FK0A 1BA1A 4FW2A 5FLXO 2HHUA 3M3ZA 3H45C 5KPZA 3J8AA 4QAGA 3PX6A 1XMQK 1F21A 1GLFO 1QHAA 2VG5A 4DLGA 3K58A 3NGYA 1XQSC 5C12A 4A62A 2V7ZA 3LL3A 1Q7YO 3C0BA 4WCEL 2NRWA 4JKAA 3TAQA 2D0PA 1JXBA 3CD6N 1E4GT 4U7BA 4PKGA 3QFPA 3M5RA 3S3OA 2P9PA 1T6DA 3FFKB 1S9GA 2KHOA 4CESA 1KVCA 3OBWA 4RW6A 3UB5A 1S6PA 3FZKA 3MCAB 1JCFA 5AFUA 3CYMA 1KAZA 4BRAA 2A42A 4NYFA 4IBNA 2RF2A 4JI6K 1L5UA 4YY3K 3A5OC 2ZD1A 4K43A 2WOMA 3SV3A 3IUCA 3L4IA 1SKRA 4EHTA 2V51B 1QVFM 3CQYA 4LFAK 2DFHA 3K59A 2ZM6K 3P4IA 1EXQA 3R6MA 4DMNA 3A5LC 1Y97A 4WFNL 1FKOA 4H4OA 3BZKA 4N56A 3MXIA 1C0MA 3L0QA 3QETA 3MAQA 3QO9A 3RSEA 3SLCA 1N33K 1HNXK 1RDDA 4JHDB 4F3OA 3VEXA 1NKEA 2X78A 1VK0A 4DQIA 2RHKA 3CCLN 4M45A 1I3AA 1DTTA 3U8XA 2P51A 1U04A 4JKFA 4KI6A 5JVGL 4IFYA 3S41A 1QZ5A 3D7EO 2OYQA 5GAEP 3KVGA 2JWLA 1KXPA 3J7AP 3CHWA 1U45A 2NRTA 3ZETB 3JAMO 3QEPA 2G8HA 4CZKA 4HTLA 4E1MA 1IH7A 4FW1A 3KKSA 3QIPA 4C23A 1HJRA 5LJWA 2XY5A 1VQPN 1T03A 3DAWA 4CECA 4FJ9A 4BRKA 2E6MA 3CFPA 3OS0A 4HVJA 3UKRA 3L4QA 4B3SK 4KO0A 4EAHD 1IV0A 2W6KA 3KK3A 3V9ZA 3P38A 1JXEA 4GV6A 4Y1DA 2P9SA 4FZXC 2QWRA 1C6VA 4AHVA 2RE2A 4BRQA 4IG3A 4CD1A 5C2FA 1KLMA 3KD5E 3LAKA 4BRIA 4DTUA 2OTLN 2HNYA 3S9HA 4NXNK 3LDLA 1VRTA 2HHHK 1EKEA 1NJYA 1WBDA 1RFQA 3NF9A 4N5SA 3FE1A 5F0XA 4FL9A 2OANA 1IKYA 2QWQA 4B1VA 5CR4A 3CPWM 3GOIA 3P1GA 4JEPA 4BQZA 3ZSQA 4OJRA 3ZSOA 1M1KO 3RRHA 4H5NA 2NNWA 3PSIA 3JYTA 1SL1A 3MN5A 4I9QA 5E84A 3ZX2A 2FBXA 2VCPA 4WF9L 4KFBA 3KK7A 1KFSA 3AO2A 2RN2A 4H0PA 2G8VA 3NF6A 4I6MB 3CI5A 2IGIA 4O5BA 2KZMA 2BE2A 4OPHA 3HO1A 2O8EA 1NKCA 1LWCA 5CYQA 4QCLA 2NRVA 3VQAA 4R79A 2WONA 2Z1IA 3LWLA 3HOTA 1KLNA 1RT7A 4O8KA 3CCRN 2NUBA 3OYCA 2QXLA 2ZE2A 3ATVA 3R9PA 1ZBFA 3NF8A 4CJRA 1WBBA 1RTJA 3BZCA 1X9MA 1D8YA 1WSJA 3HPHA 3THXB 1T7PA 4DSKA 2F4VK 1BL3A 1C0FA 3V81A 2QKBA 1RDUA 3CM6A 4FLYA 4BR9A 2HNDA 3AVFA 3LDNA 1UWBA 3K9KA 1T3VA 3OS1A 3KTQA 2OTJN 3TAFA 3GG4A 5KRTA 3I0RA 3ZT3A 1Q82O 3G10A 5AQQA 4M7XA 4IO8A 1TV6A 3FLCO 4FJ5A 4CJUA 2HHTA 1S5JA 2Z1JA 1B9DA 3OYMA 4CF2A 4DQSA 3OJUA 3PV8A 3IMXA 4YHHK 3M8SA 2VQEK 3ZX0A 3T1YK 3H08A 1NK9A 3DLHA 5HL7L 3MDQA 5FROA 3VGKA 5TKYA 3P31A 2YX6A 1SKWA 2W40A 4YDUC 4PA1A 4J8FA 4C8KA 2GTDA 4CGFA 1X9SA 5BPMA 2W42A 2P9PB 4CFCA 5BRHA 3RR7A 2WFBA 3T1HK 1NU0A 3AVMA 3DI6A 2O8DA 3EY1A 4LF8K 2KFZA 3AO3A 4M3UA 1CXQA 3SV4A 5LMUK 4N47A 2E20A 4CZHA 1OVYA 4B9MA 4JLHA 2QWPA 1HYZA 3CCSN 4BR7A 3O8MA 3D6RA 1RBUA 1TUUA 3VTHA 3DRSA 2Q97A 5JLFA 2BDPA 4BE2A 4A57A 3CC4N 3H46O 2KZZA 3SAHA 4B3MK 4YOVA 3QESA 2FSNA 1QSLA 3OYIA 5J1EA 1BHLA 3ZSVA 4CZGA 2FC0A 2D0AA 3J80O 4Q0BA 1D9FA 4CBUA 3THWB 4FZZA 1CZAN 2X74A 3KK2A 3E9OA 5JS2A 2QA4N 4B8AB 5C25A 4M3YA 4FWSA 3RSEB 2UXCK 3EE8A 1NOZA 2HBJA 3ZSWA 4CF9A 5HOOA 3AVGA 2YHAA 4FK4A 4AHCA 3AVHA 4BGAA 4CJQA 3ULEA 4K42A 1UA1A 1TK8A 5J2NA 3KHYA 4W5OA 3KD1E 4X66K 4CJ3A 4BE0A 1GLJO 4DQ8A 1Q86O 1ASVA 2EWSA 2F8TA 2YNIA 3AVJA 2B4JA 4FJ8A 4CEDA 3IG1A 1U49A 1VQLN 1QZ6A 5KGXA 3PX0A 3BF1A 4FWNA 3GBTA 5AQHA 2RPIA 5KGWA 4K25A 4NB4A 3ATUA 1QSSA 2Q0UA 4KTQA 1NKBA 3OYAA 3QICA 5C24A 1X3MA 3VOVA 3CG7A 1TGOA 1EWQA 4BROA 2OZSA 3JXUA 3SBTA 5HRPA 4QOZB 1IBMK 5AZIA 3FZFA 2P9SB 4IDKA 5EU7A 3NMUA 4DF4A 3KLHA 2WC9A 5I3UA 3J7YP 4CI6A 4H0XB 1QQNA 1TK5A 1KD1O 3SUPA 5HLFA 5A2QO 3HVRA 2A5XA 3ZT2A 3VEVA 3ITHA 4ZTFA 3NCIA 1NJZA 1C1BA 1N36K 3HP9A 1WUAA 4Q5VA 4JI7K 4B9VA 4KHNA 3BGRA 4PY5A 1RDAA 4NLBA 3VTIA 4CEQA 4MLEA 4O5FA 3CETA 4A61A 4CZFA 1HUXA 3G6EN 5EOYA 4UQGA 4FLXA 1HLUA 1RDBA 4DV3K 1VSHA 2X6SA 4FWKA 1HNZK 2HVHA 3PO4A 4HTUA 4DUZK 2HB5A 5DMRA 4IO9L 4EZ6A 1JLQA 4DTRA 3O08A 3I33A 2QTDA 3VMFB 2QWLA 4E1NA 1YIJN 3SAFA 2O8EB 1JCEA 4CJSA 4CZLA 1X1PA 3M8QA 3K5LA 3ENBA 4K8XA 1LOTB 1RCHA 4JK7A 1C0GA 5JLHA 4KTWA 3P83D 1CLQA 1SS6A 3S3NA 1J54A 1TKTA 3ZLJA 2Q3SA 4B9UA 2KW4A 3WEEB 4GKJK 3THYB 3LDSA 4RW7A 3CQXA 1BI4B 3DRPA 3WNFA 1W2BM 1ILYA 3TAEA 4CIGA 2FF3B 3R8EA 3MX2A 2WBNA 4FYDA 3MN9A 1N32K 3D2FA 4TSXA 3FZHA 1LW0A 3HP6A 4XH1A 4Z0UA 1HRHA 3QNNA 4JYAK 4JN4A 3BDPA 2O8BB 4CGIA 1IKVA 3KLIA 4Z4EA 1K8KA 3CC2N 2QI2A 4E7IA 4AHSA 4A2AA 5M1KA 5LY3A 3CCEN 1X9WA 3KLGA 2HVIA 1W97L 1S72N 3RMDA 1QSYA 4CEFA 1BU6O 4CFAA 2DPNA 4ID5A 3VPZA 1BA0A 4FWMA 5KI6A 4ICLA 1WN7A 3AO1A 4CJ5A 4FJXA 1NJWA 1VAZA 2I5JA 2HNZA 5K14A 4JKCA 3TTCA 3VA0A 4Y0WA 4FJIA 4CJEA 3F73A 4XH4A 2I7PA 4XEIA 1NJIO 2UU9K 4F4KA 4DB3A 4GV3A 1HKGA 2P9LA 3DLKA 5M1FA 3C7NB 5HRSA 3TI0A 2O8DB 5BR8K 5GINA 3TWHA 1NGIA 3PO5A 4CEZA 3NFAA 3LANA 4CF1A 5M1OA 4WQ5C 3CJ9A 4KH6A 4MDAA 2YHXA 2NRZA 3T7ZA 1BIZA 4MLHA 4J2BA 3SJJA 2NZTA 5D3GA 1VQMN 1ZYQA 3FZLA 4IXCA 4ELUA 2FF6A 2GX9A 3SJHA 1VRUA 5AQSA 3D0PA 4F2SA 1YI2N 4M42A 3WT0A 2HHQA 2Q2RA 1U4BA 5AZJB 3ZT1A 5AR0A 4RW9A 4H0YB 5MLCQ 3WQUA 1RT1A 4BC4A 3VEZA 4KB0A 4YDUA 1NGCA 2B5JA 2VQFK 1YHQN 3MWTA 3I56N 4BRGA 3RRGA 4FJGA 4X65K 4DV0K 3NF7A 4DTMA 1U48A 2QWMA 3ULEB 2HMPA 3HOSA 4NCBA 2UUAK 4CK1A 4AM6A 2RKIA 3C6UA 1NWKA 4FPBA 5CE3A 3K5MA 4KHUA 3OBYA 4IEEA 4IWVA 4E0DA 4B08A 1LV5A 3I8DA 4KHWA 4CJ4A 4KI4A 1D5AA 3TAMA 3AVIA 1D9DA 1V4TA 1C0UA 2OPRA 5JICA 3OYEA 1L3SA 1JKHA 5LMNK 1K8AO 2R7YA 1SV5A 1BWFO 3W3DA 3HYFA 4JKGA 1YUWA 5AQZA 3CC7N 3QLHA 1VSIA 3DLRA 1DT9A 1ASUA 1S1XA 4NCGA 3LM2A 4OPKA 5HRRA 5FPDA 5AQVA 3VERA 1W9HA 5BRFA 1Y64A 1BUPA 4PKIA 4FZYA 3QMLA 1A5VA 4CHNA 2QW9A 1XI1A 4ELVA 5I42A 2YKNA 1U2VA 4CK3A 3SQ2A 4DSFA 4WQ4C 1I39A 4FOEA 4DV4K 1NBWA 4B1YB 4YOUA 3KIOA 1WSIA 1JLBA 2VYPA 3EO3A 4JNEA 4I2QA 3W0LA 3LALA 4EIAA 3MECA 1EP4A 4CGJA 3TSUA 2OPQA 2QXFA 3K57A 3PLAA 5F1XA 1XNRK 1HYSA 3V9WA 1VQ8N 3BY5A 4DV7K 4IKFA 5JMVA 3M1FA 3OJSA 4DV6K 1KAYA 1VQ5N 2IAJA 3F9MA 5BPLA 4BRDA 1N6QA 3V9XA 2CGLA 4ILHA 1BQMA 4JAXA 3SBGA 1MDUB 4AF1A 4CJVA 4OLAA 4ID1A 3TABA 3O80A 1G15A 2D5RA 3O6WA 4HUGA 3DXKA 2UUBK 3A5MC 3QIOA 3ASMA 4JK8A 4NXMK 3CXCM 1OH8A 4B9LA 4K8ZA 3HI0A 1JL2A 4PL7A 1VQ6N 3MX5A 3RMBA 4E7KA 3A8YA 1S1WA 2QEXN 4IFEA 1XUPO 4DR4K 4YOWA 3QBXA 4JK9A 1NK6A 5GAGP 1NNEA 3T3FA 3V1RA 4CZEA 3PY8A 3D2FB 3HZ6A 2P9KA 4O4GA 1WSHA 5AQUA 3M8PA 4DFKA 3MN6A 3DOLA 4E19A 3VQBA 2P9NA 3VQEA 3B8AX 3SQ1A 1RT4A 3VGMA 2UXBK 3SPYA 5BN8A 4DV1K 1XMOK 1K8KB 2P9UA 4FWQA 3WUHA 4H5TA 1S22A 4B1XB 1BCMA 1JLFA 3QDKA 4FLUA 4JD2A 5T7BA 1UAXA 3TSQA 1WSEA 3DLLL 1CZ9A 1HX1A 1UA0A 4OLBA 3CJCA 4H0TB 1TAUA 2YHBA 4DFJA 4B1ZA 1L3VA 1IBLK 4CEEA 4AH9A 4BREA 1NGFA 5SWMA 3P5JA 4IOAL 1RT2A 2O4IA 1DLOA 4RWTA 1FXXA 4QS9A 3NDKA 3MXMA 3F9KA 1NK7A 2V52B 2GUPA 5AQFA 1BGXT 1QQOA 1QTMA 3ZSYA 3CCMN 4RCHA 3LDPA 3FGUA 3HM9A 5AQTA 1HQEA 3BP8A 4JKHA 4JI3K 1NGJA 3C95A 4OKKA 4B1WB 1WSFA 1ITGA 4J2DA 4FCYA 1KCFA 3HK2A 2E2NA 2A41A 1N8RO 3WXMB 2DFEA 4I7FA 4GVMA 4KREA 2A1RA 3NVKA 3A0IX 4EHUA 4FJMA 4DS5A 3VQ5A 4C1NK 4IG0A 1D4XA 3QEXA 2ZGYA 1WAFA 1O1WA 3VESA 4XIUA 4E7JA 4PL8A 5FPMA 1LWEA 3CCVN 3NVMA 4BQLA 2P9IA 1GOBA 3NBPA 1L3TA 2E5LK 3EZ5A 4DLEA 3VQCA 1UOCA 2FBVA 3A5NC 4WQ5A 1J5EK 4YFUA 3WXKA 5KQDA 1K6YA 5FRNA 2NRXA 3LZIA 2O8CA 3VGLA 3ZEUA 2OCEA 3O3GA 1TUYA 4CHPA 4LFBK 3QEVA 5AQWA 4JI5K 4H5VA 5CY4A 1TKZA 2HBKA 4JS5A 1WB9A 4JKGB 3VF4A 1ZBLA 4DU4A 1QHTA 3H3NO 1LWFA 2JGUA 1RBTA 1RT3A 3G25A 3O1WA 4M3RA 4CJFA 2E1YA 3VA3A 5AQKA 2Y1IA 4OPAA 4E7LA 3OYNA 2JWKA 3HT3A 4CGGA 4PQUA 2GWKA 3O9SA 3CJ1A 3TPQA 1VSKA 1Z26A 1IG8A 4WE1A 1RDCA 3EZWA 4C1NI 4CHQA 4E3SA 4IEIA 4JI0K 2NRHA 4CEOA 1OH6A 3VQ4A 1GLDG 1LAVA 2E8AA 1I94K 1FK9A 3K5OA 4NLCA 2YCHA 1VQ9N 1B9FA 2I7NA 1IG9A 4IOCL 1VSLA 3T1AA 1T05A 4BR5A 3KKRA 3N4QA 3P39A 3NAEA 3IS9A 4RG8A 3B6OA 5GAHP 3HVTA 4ZTJA 2BANA 2PAVA 2IC3A 4EP4A 4BDZA 1GLBG 4CZMA 1S1VA 1XHXA 1HR0K 1HJOA 2D0CA 1W7AA 1WAJA 4OGEA 1K9MO 3G4SN 4NO7A 4DTXA 5KPRA 3AARA 3DXKB 5AQOA 2E6LA 1HMVA 4BE1A 1RTDA 5BR9A 4GW6A 4RW4A 4Z4IA 2EHGA 3T69A 3H1VX 2Z1HA 4PKHA 2XY8A 3UKRB 4B9TA 4ILGB 2HHWA 1NJXA 3VEWA 1YITN 1YVUA 1ASWA 4LF6K 4EZ9A 3LDOA 4FWRA 1VSFA 2A1SA 1E3MA 1TKDA 4F8RA 2P9KB 4FM2A 4KB1A 5FPEA 1C0TA 3SI6A 3CCJN 3NHGA 3MXJA 4CVNE 4K41A 2ZJQL 1EO1A 4CJLA 2J4RA 4FO0A 2QKKA 2D4WA 1HPZA 1NK0A 2P9NB 2GEMA 3C94A 3AV9A 3BF3A 2YNGA 4IDHA 3D45A 1SL2A 4UY8O 2KKZA 3L2WA 3I0SA 1CXUA 2FBYA 1C1CA 2UXDK 1V4SA 2NLXA 1SAZA 1HKCA 4FOIA 3U9ZA 3L8BA 3WXIA 2OPSA 3H6EA 4DV5K 5AQLA 1BCOA 2V7YA 3M8RA 1Q81O 4BRNA 1QQCA 5ADXA 3LZJA 2IOCA 1LCUA 5GIPA 2G8UA 1G99A 1NGBA 5B8HA 4FLZA 5AQGA 1S9EA 2FSKA 3TTFA 1DTQA 1RBSA 3DM2A 2ZF5O 5HBMA 3DRRA 4CZJA 3E1YA 3T19A 3E9LA 1DGKN 3SUOA 4JHDA 1VQNN 1REVA 1TK0A 2HHSA 5KRSA 4Z4HA 4DQPA 3U4LA 3AO5A 2UYTA 5AFUH 4HWIA 2GWJA 1X3NA 3EYZA 4CERA 5AQXA 1K73O 2LSNA 4PHTX 3TANA 5EXWA 1S3XA 2F9WA 3NH1A 1FKPA 1NM1A 3OVNA 4KAZA 5HP1A 3MEEA 2ETJA 1EX4A 3SUQA 1QE1A 1VQ7N 3GE1A 3AVAA 1NG9A 3PIPL 4LF7K 4K0KK 4RW8A 2ZJRL 1YVNA 5DM7L 3O9RA 3S3MA 4DKWA 4H5WA 4CBWA 4F9OA 3CM5A 2H3GX 3KK1A 3CIPA 1SZ2A 3AA5X 3OYKA 1L3UA 4JI2K 2HMIA 5E41A 3LP1A 2P9IB 3R1XA 2ATQA 5SZTA 3VEOA 2FXUA 5LL6Z 1XWLA 3HPGA 4H5RA 4LD0A 3V9SA 1XHZA 2HHXA 4W5TA 1KC8O 1HQUA 1MA9B 1VSEA 3SCXA 3H1QA 5C15A 5HROA 1NOYA 2W6LA 3ZEUB 1J6ZA 1BG3A 1VSJA 2P1JA 1VQ4N 1U47A 4NCAA 2HW3A 4H8KA 1EETA 4FM1A 2HBLA 2Q36A 4FJLA 4MDBA 1IBKK 1B92A 2ASOA 3VQDA 2HHVA 1Z6RA 4BG8A 3L3UA 3SUNA 4MFBA 1KSPA 3IRXA 1NK5A 1YJNN 3V9UA 1MWKA 3V1QA 3CCUN 3CQ8A 1P90A 1RTIA 4HHTA 3H3OB 2IIRA 3ZSXA 4I6MA 4J2AA 2CH6A 4B3RK 2DFFA 4KBOA 3SZ2A 1LAWA 3CF5L 4O55A 2QWOA 2P5GA 4IFVA 5CYMA 4HCBA 1IJJA 4B3OA 1R59O 2A40A 2G8WA 4BDPA 3B6PA 4KH5A 4L8RB 3EKUA 4DQRA 2G8IA 2PFUA 4FJKA 1T8EA 1A5XA 3RMAA 2DTUA 3ULDA 4DCHA 3MN7A 3FFIA 4NYNA 1N34K 1GOAA 3O9UA 4CJTA 1BIUA 3D2EA 4CJWA 4H03B 1NGEA 3VEYA 4DQQA 2XY6A 3SQ0A 4IOXA 1KTQA 1RILA 2D1KA 1R0AA 2KTQA 4O0IA 3K0SA 4DR3K 3V1OA 5CHIA 3U3GA 1YAGA 1VQON 1CZBA 4OO1J 4DR6K 5FPNA 1SUQA 5JS1A 3AVBA 3LP0A 4X64K 1T6CA 4GNIA 1RT5A 4JI1K 4CGDA 4CW7B 4BR2A 3DJCA 1ZBSA 2G8FA 1IKXA 3F5TA 3K2PA 2F8SA 3GDQA 4HUEA 1DEJA 5AZIB 4B8CA 3QFUA 3L2UA 3L2RA 3G71N 1YF5L 4DHYA 3SMSA 4A5AA 3ISNC 1RDWX 1A5WA 5EX5A 4O0JA 3A2FA 2FSJA 4MO4A 4A2BA 3ZYYX 1DKGD 2CH5A 4DR7K 5LJVA 2ITMA 5AQYA 4A5BA 3RR8A 2KLAA 3OTOK 2PYLA 2YJFA 1GLEG 4Z4FA 3I8BA 1Q8IA 1OH7A 4FVMA 1P8ZA 3L6QA 5IT9O 4EP5A 3DMJA 4C8MA 1NK4A 2HOEA 2VGMA 3THWA 1KFDA 2HBMA 2O8FA 2BTFA 2GBZA 4W5QA 3CFOA 3KLEA 3O9QA 3ENOA 2E2QA 3K9JA 3ZCMA 3IFRA 3L2VA 4C8NA 2YI1A 2YV0X 1NGHA 3ENHA 3QBWA 4ISFA 2IVOA 4U67L 4DU1A 4GKKK 1RT6A 3AVNA 4LH5A 4DU3A 5M1QA 1Q9XA 4KKOA 3SQ4A 4CHOA 4CCHA 5C42A 2VG6A 1FJGK 5FRMA 1RBVA 2Y1JA 1TYQA 3LAMA 1NGDA 1QS4A 4I9LA 2YNFA 4WYBA 4CIFA 3SAGA 2PYJA 1KAXA 3AO4A 3CERA 4CJ7A 1MU2A 3PX4A 1Q18A 4BRHA 3HBTA 2PZSA 2OA8A 4KPYA 5AQNA 4YNQA 4AQYK 4BWJA 3Q7BA 2OZMA 1FW6A 3C6HA 3CMEN 3DLEA 5EY4A 3CFRA 4BGBA 4OPJA 4BR0A 3C6AA 3LPTA 1GOCA 4DWIA 3K5NA 2AA4A 2XHBA 4FWPA 4G1QA 4DTOA 2FLOA 5EVZA 1YTUA 3VQ9A 5HRNA 1OH5A 2Q1NA 3NH0A 2YHYA 4DG1A 1XC9A 4CF0A 5AQJA
chains in the Genus database with same CATH topology
4BRFA 4CZLA 3ENBA 2JWKA 1LOTB 1XQSC 2GWKA 1H1VA 4JK7A 1C0GA 2E1ZA 3O9SA 4A62A 2V7ZA 3LL3A 5C12A 5JLHA 1Q7YO 3C0BA 4WCEL 2NRWA 3CJ1A 3KZBA 4JKAA 3TPQA 2NRRA 1IG8A 2Q0RA 2D0PA 3EZWA 4C1NI 1SS6A 4IEIA 3CD6N 2NRHA 1E4GT 1GLDG 2P9LB 4U7BA 4PKGA 2E8AA 3QFPA 1HPMA 3WXLA 3M5RA 3WEEB 4NLCA 3OW2M 2YCHA 3CQXA 1W2BM 1ILYA 4GV9A 2P9PA 1T6DA 2VWBA 3FFKB 1VQ9N 2I7NA 2FF3B 4IOCL 3R8EA 3MX2A 2WBNA 1YJWN 2D0OA 2KHOA 3D2FA 3MN9A 5TKWA 3FZHA 3OBWA 4BR5A 4FVUA 3N4QA 3P39A 3UB5A 3FZKA 3MCAB 1JCFA 4QS7A 2YHWA 4XH1A 5AFUA 1KAZA 5GAHP 4BRAA 1O13A 5KPTA 2A42A 2PAVA 3C65A 4JKDA 4JN4A 3UKUA 4RTFD 3AAPA 1GLBG 3A5OC 4CZMA 3IKMA 2IVPA 4H0VB 4K43A 1HJOA 1K8KA 3LDQA 3CC2N 1K9MO 4JKEA 3G4SN 4NO7A 3IUCA 2QI2A 3L4IA 5KPRA 3AARA 3DXKB 4EHTA 4A2AA 5AQIA 5LY3A 1GLAG 2V51B 4BVOA 5M1KA 3CQYA 3CCEN 3HM8A 1QVFM 1W97L 1S72N 3I55N 5AQOA 1BU6O 3P4IA 2DPNA 3VPZA 3R6MA 1BA0A 3A5LC 4FWMA 5BR9A 1GLFO 5KQ8A 4WFNL 3BEXA 1VAZA 4AM7A 2A6AA 3T69A 3H1VX 4PKHA 3UKRB 4JKCA 3TTCA 4Y0WA 3SMPA 2HSTA 1NJIO 4XH4A 2I7PA 4ILGB 4XEIA 4YORA 3TTDA 3L0QA 4B9QA 4DB3A 4GV3A 3VEWA 1YITN 1HKGA 2P9LA 5M1FA 3RSEA 1ESVA 3C7NB 3SLCA 3WEEA 4BC3A 3LDOA 4JHDB 4FWRA 3AGRA 3VEXA 5GINA 2P9KB 1NGIA 1NGAA 5FPEA 3EE9A 3CCJN 2RHKA 3CCLN 4K41A 2ZJQL 5M1OA 1EO1A 1KQSM 2J4RA 4FO0A 5ADXH 3D2EB 4WQ5C 3U8XA 2D4WA 2P9NB 3CJ9A 4JKFA 4KH6A 4BY9C 4MDAA 5JVGL 2GEMA 3S41A 2YHXA 1QZ5A 2NRZA 3T7ZA 3D7EO 3BF3A 2A3ZA 4IDHA 5GAEP 4MLHA 3KVGA 2JWLA 1KXPA 4M7YA 2NZTA 3E66A 2KKZA 3CHWA 4UY8O 5E26A 2NRTA 3ZETB 1VQMN 4CZKA 4HTLA 3FZLA 1V4SA 4IXCA 2FF6A 2GX9A 3SJHA 2NLXA 1SAZA 1HKCA 4FOIA 3O4WA 5AQSA 3U9ZA 3WXIA 4C23A 5LJWA 4WFBL 1VQPN 1YI2N 3OA9A 4ISEA 3WT0A 2Q2RA 3H6EA 3DAWA 5AQLA 5AZJB 2V7YA 4IZ9A 5AR0A 4BRKA 1Q81O 4BRNA 4H0YB 5ADXA 5MLCQ 3WQUA 1LCUA 2ZWHA 5GIPA 4BC4A 3VEZA 1G99A 1NGBA 5B8HA 3UKRA 5AQGA 3EKSA 4YDUA 1NGCA 2FSKA 1MWMA 3TTFA 3IDHA 2CGJA 3L4QA 3TU5A 1YHQN 3MWTA 2ZF5O 4EAHD 2CGKA 1ATRA 4CZJA 3I56N 3E1YA 4BRGA 1YXQA 3C7NA 3E9LA 2VGNA 1DGKN 4JHDA 3P38A 3DXMA 2QWMA 4GV6A 3ULEB 2P9SA 1VQNN 2HMPA 2QWRA 1U2VB 3HOSA 4JKBA 2RE2A 4BRQA 3MCPA 4CD1A 3F2KA 3U4LA 5C2FA 2UYTA 5AFUH 4BRIA 2OTLN 5BPNA 4HWIA 2GWJA 1X3NA 4AM6A 2IVNA 1NWKA 4FPBA 3LDLA 5AQXA 5CE3A 1K73O 3OBYA 4IEEA 4IWVA 4PHTX 4GY2B 5EXWA 1S3XA 1RFQA 1WOQA 2F9WA 3FE1A 5F0XA 4FL9A 2OANA 1V4TA 1NM1A 1XC3A 2W41A 2QWQA 4B1VA 4YOXA 5JICA 5CR4A 3CPWM 3GOIA 4JEPA 4BQZA 1K8AO 5AZJA 1M1KO 1BWFO 4H5NA 2NNWA 1VQ7N 3W3DA 3GE1A 3MN5A 4JKGA 3BUZB 1YUWA 3UE5A 5E84A 3ZX2A 3PIPL 5AQZA 1M90O 3CC7N 2ASMA 2VCPA 2ZJRL 4WF9L 1YVNA 4BRMA 1DT9A 3KK7A 5DM7L 3LM2A 3O9RA 4DKWA 4H0PA 4H5WA 5AQVA 3VERA 4CBWA 4F9OA 5FPDA 2H3GX 3HTVA 3CIPA 1Y64A 1SZ2A 3OHRA 4I6MB 5BRFA 3CI5A 4GVEA 1BUPA 4PKIA 3QMLA 2P9IB 3R1XA 4KH4A 3ZX3A 3VEOA 2FXUA 2QW9A 4OPHA 2E2OA 2WUSA 4BVPA 1U2VA 4H5RA 2NRVA 4R79A 1TYQB 1ZXOA 4WQ4C 4BC2A 1KC8O 3HOTA 4FOEA 1NBWA 4O8KA 4WQ4A 3CCRN 1MA9B 4B1YB 2QXLA 4YOUA 3VENA 3H1QA 5C15A 2HF4A 2VYPA 3ATVA 3EO3A 3R9PA 5BREA 1VQ4N 3ZEUB 1J6ZA 1BG3A 4JNEA 3W0LA 4BG9A 4EIAA 1OKJA 3TSUA 4BC5A 1QVGM 3PLAA 2HBLA 5F1XA 2Q36A 4MDBA 2ASOA 2F7TA 1C0FA 1RDUA 4BR9A 1VQ8N 1GLLO 5JMVA 3M1FA 3LDNA 2HF3A 1Z6RA 4BG8A 3K9KA 4IJNA 1T3VA 1KAYA 3O9TA 1VQ5N 1JCGA 1VQKN 2OTJN 3ID6A 3F9MA 1YJNN 1NGGA 4BRDA 3GG4A 1HKBA 1MWKA 5BPLA 3CCUN 5M1PA 3Q7CA 1Q82O 1P90A 2CGLA 5AQQA 4ILHA 1ZC6A 4M7XA 4IO8A 3FLCO 4JAXA 2P9UB 1MDUB 3H3OB 4IJAA 3SBGA 4Z94A 3GL1A 4AF1A 5JVHL 2IIRA 4I6MA 3EL2A 3O5BA 3O80A 4JD2B 2CH6A 4LC9B 3O6WA 3IMXA 4KBOA 3ZX0A 3DXKA 1ATNA 4BRCA 3A5MC 5HL7L 4JK8A 3MDQA 3VGKA 1Z05A 3CF5L 5TKYA 3CXCM 3P31A 2QWOA 2YX6A 3KWIA 3HSCA 1E4FT 2W40A 3HI0A 4B1UB 4PL7A 1IJJA 4YDUC 1VQ6N 1R59O 2A40A 4J8FA 3MX5A 4FWOA 2AP1A 2GTDA 4KH5A 5BN9A 2PBDA 4XH5A 3EKUA 3A8YA 3CMAN 2PFUA 5BPMA 2ASPA 2P9PB 4MO5A 5BRHA 2QEXN 4IFEA 1XUPO 2WFBA 4CZIA 3J7ZO 4YOWA 3QBXA 2Q31A 4JK9A 1RGIA 5AQJA 5GAGP 4CZEA 4DCHA 5M1NA 3D2FB 3HZ6A 3DWLA 2P9KA 3MN7A 3FR0A 5AQUA 3O9UA 2E20A 1X9JA 4CZHA 1OVYA 3MN6A 3D2EA 3VF6A 4H03B 2P9NA 1NGEA 2QWPA 3B8AX 3AGKA 3E9PA 3CCSN 3VEYA 4BR7A 3AAQA 3D6RA 3O8MA 3UKUB 4BR4A 3VGMA 2GELA 3CJAA 4IOXA 4H0OA 5BN8A 1TUUA 2D1KA 3VTHA 3R3LA 4FSVA 1K8KB 1QQMA 2P9UA 2Q97A 4FWQA 5JLFA 3WUHA 4H5TA 1S22A 3CPEA 3ZETA 1ATSA 4B1XB 4L3QA 4A57A 5CHIA 3CC4N 3H46O 3QDKA 4JD2A 3SAHA 1YAGA 3CJBA 4YOVA 1VQON 2FSNA 4OO1J 3M6GA 5FPNA 3TSQA 3DLLL 4CZGA 1HX1A 1SQKA 1NLVA 2YJEA 3CJCA 4H0TB 1T6CA 2ZGZA 4CBUA 1CZAN 4WFAL 4GNIA 3E9OA 4B1ZA 4M63C 4BR2A 3DJCA 2QA4N 1YJ9N 1ZBSA 3AY9A 4BREA 1NGFA 3HRGA 4IOAL 3KWGA 4E1JA 2E88A 4FWSA 3RSEB 4BRPA 3EE8A 2HBJA 4RWTA 5I9EB 3F5TA 1BO5O 3CCQN 3GDQA 3JS6A 5HOOA 1JJ2M 2BUPA 4QS9A 1DEJA 5C10A 5AZIB 3N4PA 3QFUA 3G71N 1YF5L 4YOYA 4BGAA 2V52B 2GUPA 4QS8A 3WXJA 3SMSA 4A5AA 4DHYA 3ULEA 5AQFA 1QQOA 5AQMA 1RDWX 4K42A 5EX5A 3CCMN 3VF2A 4RCHA 2FSJA 3LDPA 3FGUA 4MO4A 3KHYA 5C2DA 3ID8A 5AQTA 3BP8A 4A2BA 4JKHA 3ZYYX 1NGJA 1DKGD 2CH5A 4B1WB 1GLJO 5LJVA 2ITMA 5AQYA 4DQ8A 1Q86O 3FZMA 2EWSA 4A5BA 2KLAA 3U9DA 2F9TA 2YJFA 4YOTA 1GLEG 4CBXA 1VQLN 4G9ZA 3I8BA 2E2NA 1QZ6A 2A41A 1N8RO 3WXMB 3BF1A 1P8ZA 3L6QA 4FWNA 1BDGA 3GBTA 5AQHA 1U6ZA 2HOEA 3NVKA 3A0IX 3O1BA 4K25A 4NB4A 2VGMA 3ATUA 4EHUA 2Q0UA 5C0YA 2HBMA 5F2RA 2BTFA 4C1NK 3QICA 1D4XA 4ISGA 1X3MA 3O9QA 3VOVA 3ENOA 2E2QA 3K9JA 3IFRA 3VETA 3QB0A 2YI1A 3MMVA 1NGHA 2ZGYA 3ENHA 3QBWA 4BROA 5AQRA 3JXUA 4O8UA 4ISFA 5ELZA 3CJ7A 3LM9A 3SBTA 2IVOA 3SK3A 3VESA 4CD3A 4U67L 5H1SQ 4PL8A 5FPMA 3PIOL 3DXMB 1T44A 5AZIA 5BRDA 3FZFA 5GADP 5M1QA 2P9SB 5DM6L 3CCVN 3NVMA 4BQLA 3NMUA 4FWLA 2P9IA 4ILJA 5AQPA 4BRLA 2WC9A 1NMDA 4CI6A 4H0XB 3A5NC 1QQNA 4WQ5A 3MWPA 1KD1O 1TYQA 2QM1A 3MK6A 3WXKA 5KQDA 1NGDA 2A5XA 1BOTO 3VEVA 4WYBA 3SAGA 1KAXA 1EQYA 2NRXA 2ZJPL 3CERA 3VGLA 3ZEUA 4CJ7A 1Q18A 3WQTA 4BRHA 3HBTA 2E2PA 1TUYA 3EN9A 1WUAA 2QWNA 5AQNA 3Q7BA 5AQWA 4H5VA 4NLBA 3TSPA 3C6HA 3VTIA 3CMEN 4MLEA 2HBKA 3CETA 4O5FA 4A61A 4CZFA 1HUXA 5EY4A 3G6EN 5EOYA 2BH1A 1GLCG 4JKGB 3VF4A 1HLUA 4BGBA 3RVCA 4A59A 4BR0A 4FPAA 3C6AA 3H3NO 4FWKA 4EFHA 5GIOA 2AA4A 4FWPA 1BA1A 4IO9L 2FLOA 5EVZA 3M3ZA 3H45C 3I33A 2QTDA 3J8AA 3O08A 3VMFB 2Q1NA 5KPZA 3O1WA 3G25A 2QWLA 2E1YA 2YHYA 1YIJN 3SAFA 5AQKA 1QHAA 1JCEA 4OPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRF A;  4CZL A;  1LOT B;  1XQS C;  2GWK A;  1H1V A;  5JLH A;  1C0G A;  2E1Z A;  4A62 A;  2V7Z A;  3LL3 A;  3C0B A;  3CJ1 A;  3TPQ A;  3KZB A;  1IG8 A;  2Q0R A;  2D0P A;  3EZW A;  2NRH A;  1E4G T;  1GLD G;  2P9L B;  4PKG A;  2E8A A;  3QFP A;  1HPM A;  3WXL A;  3WEE B;  2YCH A;  3CQX A;  2P9P A;  1T6D A;  2VWB A;  3FFK B;  2I7N A;  2FF3 B;  3R8E A;  2D0O A;  2KHO A;  3D2F A;  3MN9 A;  3FZH A;  4BR5 A;  3UB5 A;  3FZK A;  1JCF A;  4QS7 A;  2YHW A;  4XH1 A;  5AFU A;  1KAZ A;  4BRA A;  5KPT A;  2A42 A;  2PAV A;  4JN4 A;  3UKU A;  4RTF D;  3AAP A;  1GLB G;  3A5O C;  4CZM A;  2IVP A;  4H0V B;  4K43 A;  1HJO A;  1K8K A;  3LDQ A;  4NO7 A;  3IUC A;  3L4I A;  5KPR A;  3AAR A;  3DXK B;  4EHT A;  4A2A A;  5AQI A;  5LY3 A;  1GLA G;  2V51 B;  4BVO A;  3CQY A;  3HM8 A;  5AQO A;  1BU6 O;  3P4I A;  2DPN A;  3VPZ A;  3R6M A;  1BA0 A;  3A5L C;  4FWM A;  5BR9 A;  1GLF O;  5KQ8 A;  3BEX A;  4AM7 A;  2A6A A;  3H1V X;  4PKH A;  3UKR B;  4Y0W A;  3SMP A;  4XH4 A;  2I7P A;  4XEI A;  4B9Q A;  3L0Q A;  4DB3 A;  3VEW A;  1HKG A;  2P9L A;  3RSE A;  1ESV A;  3C7N B;  3SLC A;  3WEE A;  4BC3 A;  3LDO A;  4JHD B;  4FWR A;  3VEX A;  2P9K B;  1NGI A;  1NGA A;  5FPE A;  4K41 A;  2J4R A;  4FO0 A;  5ADX H;  3D2E B;  4WQ5 C;  3U8X A;  2D4W A;  2P9N B;  3CJ9 A;  2GEM A;  3S41 A;  2YHX A;  1QZ5 A;  3D7E O;  3BF3 A;  2A3Z A;  4MLH A;  3KVG A;  1KXP A;  4M7Y A;  2NZT A;  3CHW A;  5E26 A;  3ZET B;  4CZK A;  4HTL A;  3FZL A;  1V4S A;  4IXC A;  2FF6 A;  3SJH A;  2NLX A;  1SAZ A;  1HKC A;  4FOI A;  3O4W A;  5AQS A;  3U9Z A;  3WXI A;  4C23 A;  5LJW A;  4ISE A;  3WT0 A;  2Q2R A;  3H6E A;  3DAW A;  5AQL A;  5AZJ B;  2V7Y A;  4IZ9 A;  5AR0 A;  4BRK A;  4BRN A;  4H0Y B;  5ADX A;  3WQU A;  1LCU A;  2ZWH A;  4BC4 A;  3VEZ A;  1G99 A;  1NGB A;  5B8H A;  3UKR A;  5AQG A;  3EKS A;  4YDU A;  1NGC A;  2FSK A;  1MWM A;  3IDH A;  2CGJ A;  3TU5 A;  2ZF5 O;  4EAH D;  2CGK A;  1ATR A;  4CZJ A;  4BRG A;  1YXQ A;  3C7N A;  1DGK N;  4JHD A;  3DXM A;  2QWM A;  3ULE B;  2P9S A;  2HMP A;  2QWR A;  1U2V B;  4BRQ A;  3MCP A;  4CD1 A;  3U4L A;  2UYT A;  5AFU H;  4BRI A;  5BPN A;  4HWI A;  2GWJ A;  1X3N A;  4AM6 A;  2IVN A;  1NWK A;  4FPB A;  3LDL A;  5AQX A;  5CE3 A;  4IWV A;  4GY2 B;  5EXW A;  1S3X A;  1RFQ A;  1WOQ A;  2F9W A;  3FE1 A;  5F0X A;  4FL9 A;  2OAN A;  1V4T A;  1NM1 A;  1XC3 A;  2W41 A;  2QWQ A;  4B1V A;  5JIC A;  3GOI A;  4BQZ A;  5AZJ A;  1BWF O;  4H5N A;  3W3D A;  3GE1 A;  3MN5 A;  3BUZ B;  1YUW A;  3UE5 A;  5E84 A;  3ZX2 A;  5AQZ A;  2ASM A;  2VCP A;  1YVN A;  4BRM A;  3LM2 A;  4H0P A;  4H5W A;  5AQV A;  3VER A;  4CBW A;  4F9O A;  5FPD A;  2H3G X;  3HTV A;  3CIP A;  1Y64 A;  1SZ2 A;  3OHR A;  4I6M B;  5BRF A;  3CI5 A;  1BUP A;  4PKI A;  3QML A;  2P9I B;  3ZX3 A;  3VEO A;  2FXU A;  2QW9 A;  2E2O A;  2WUS A;  4BVP A;  1U2V A;  4H5R A;  1TYQ B;  1ZXO A;  4WQ4 C;  4BC2 A;  4FOE A;  1NBW A;  4O8K A;  4WQ4 A;  1MA9 B;  4B1Y B;  2QXL A;  3VEN A;  3H1Q A;  2HF4 A;  2VYP A;  3ATV A;  3EO3 A;  3R9P A;  5BRE A;  3ZEU B;  1J6Z A;  1BG3 A;  4JNE A;  3W0L A;  4BG9 A;  4EIA A;  1OKJ A;  4BC5 A;  5F1X A;  2Q36 A;  2ASO A;  1C0F A;  4BR9 A;  1GLL O;  5JMV A;  3M1F A;  3LDN A;  2HF3 A;  1Z6R A;  4BG8 A;  4IJN A;  1KAY A;  1JCG A;  3F9M A;  1NGG A;  4BRD A;  3GG4 A;  1HKB A;  1MWK A;  5BPL A;  2CGL A;  5AQQ A;  1ZC6 A;  4M7X A;  4IO8 A;  3FLC O;  4JAX A;  2P9U B;  1MDU B;  3H3O B;  4IJA A;  4Z94 A;  3GL1 A;  2IIR A;  4I6M A;  3EL2 A;  3O5B A;  3O80 A;  4JD2 B;  2CH6 A;  4LC9 B;  3O6W A;  3IMX A;  4KBO A;  3ZX0 A;  3DXK A;  1ATN A;  4BRC A;  3A5M C;  3MDQ A;  3VGK A;  1Z05 A;  5TKY A;  2QWO A;  3HSC A;  1E4F T;  2W40 A;  3HI0 A;  4B1U B;  4PL7 A;  1IJJ A;  4YDU C;  1R59 O;  2A40 A;  4J8F A;  4FWO A;  2AP1 A;  2GTD A;  5BN9 A;  2PBD A;  4XH5 A;  3EKU A;  3A8Y A;  5BPM A;  2ASP A;  2P9P B;  4MO5 A;  5BRH A;  1XUP O;  4CZI A;  3QBX A;  2Q31 A;  1RGI A;  4CZE A;  4DCH A;  3D2F B;  3HZ6 A;  3DWL A;  2P9K A;  3MN7 A;  3FR0 A;  5AQU A;  2E20 A;  1X9J A;  4CZH A;  3MN6 A;  3D2E A;  3VF6 A;  4H03 B;  2P9N A;  1NGE A;  2QWP A;  3B8A X;  3VEY A;  4BR7 A;  3AAQ A;  3O8M A;  3UKU B;  4BR4 A;  3VGM A;  2GEL A;  3CJA A;  4H0O A;  5BN8 A;  1TUU A;  2D1K A;  4FSV A;  1K8K B;  1QQM A;  2P9U A;  2Q97 A;  4FWQ A;  5JLF A;  3WUH A;  4H5T A;  1S22 A;  3ZET A;  1ATS A;  4B1X B;  4L3Q A;  3H46 O;  3QDK A;  4JD2 A;  1YAG A;  3CJB A;  2FSN A;  3M6G A;  5FPN A;  4CZG A;  1HX1 A;  1SQK A;  1NLV A;  2YJE A;  3CJC A;  4H0T B;  1T6C A;  2ZGZ A;  4CBU A;  1CZA N;  4GNI A;  4B1Z A;  4M63 C;  4BR2 A;  3DJC A;  1ZBS A;  3AY9 A;  4BRE A;  1NGF A;  4E1J A;  2E88 A;  4FWS A;  3RSE B;  4BRP A;  4RWT A;  5I9E B;  1BO5 O;  3GDQ A;  3JS6 A;  2BUP A;  4QS9 A;  1DEJ A;  5AZI B;  3QFU A;  4BGA A;  2V52 B;  2GUP A;  4QS8 A;  3WXJ A;  3SMS A;  4DHY A;  3ULE A;  5AQF A;  1QQO A;  5AQM A;  1RDW X;  4K42 A;  5EX5 A;  3VF2 A;  4RCH A;  2FSJ A;  3LDP A;  3FGU A;  4MO4 A;  3KHY A;  3ID8 A;  5AQT A;  3BP8 A;  4A2B A;  1NGJ A;  1DKG D;  2CH5 A;  4B1W B;  1GLJ O;  5LJV A;  2ITM A;  5AQY A;  4DQ8 A;  3FZM A;  2EWS A;  3U9D A;  2F9T A;  2YJF A;  1GLE G;  4CBX A;  3I8B A;  2E2N A;  1QZ6 A;  2A41 A;  3BF1 A;  1P8Z A;  3L6Q A;  4FWN A;  1BDG A;  3GBT A;  5AQH A;  1U6Z A;  2HOE A;  3A0I X;  3O1B A;  4K25 A;  4NB4 A;  3ATU A;  4EHU A;  2Q0U A;  5F2R A;  2BTF A;  3QIC A;  1D4X A;  4ISG A;  1X3M A;  3VOV A;  3ENO A;  2E2Q A;  3IFR A;  3VET A;  3QB0 A;  2YI1 A;  3MMV A;  1NGH A;  2ZGY A;  3ENH A;  3QBW A;  4BRO A;  5AQR A;  3JXU A;  5ELZ A;  4ISF A;  3CJ7 A;  3LM9 A;  3SK3 A;  2IVO A;  3VES A;  4CD3 A;  4PL8 A;  5FPM A;  3DXM B;  1T44 A;  5AZI A;  5BRD A;  3FZF A;  2P9S B;  4BQL A;  4FWL A;  2P9I A;  4BRL A;  5AQP A;  1NMD A;  4CI6 A;  4H0X B;  3A5N C;  1QQN A;  4WQ5 A;  1TYQ A;  2QM1 A;  3MK6 A;  3WXK A;  5KQD A;  1NGD A;  2A5X A;  1BOT O;  3VEV A;  4WYB A;  1KAX A;  1EQY A;  3CER A;  3VGL A;  3ZEU A;  4CJ7 A;  1Q18 A;  3WQT A;  4BRH A;  3HBT A;  2E2P A;  1TUY A;  3EN9 A;  1WUA A;  2QWN A;  5AQN A;  5AQW A;  4H5V A;  4MLE A;  4O5F A;  3CET A;  4A61 A;  4CZF A;  1HUX A;  5EY4 A;  5EOY A;  1GLC G;  3VF4 A;  1HLU A;  4BGB A;  4BR0 A;  4FPA A;  3H3N O;  4FWK A;  4EFH A;  2AA4 A;  4FWP A;  1BA1 A;  2FLO A;  5EVZ A;  3M3Z A;  3H45 C;  3I33 A;  3O08 A;  3J8A A;  5KPZ A;  2Q1N A;  3O1W A;  3G25 A;  2QWL A;  2E1Y A;  2YHY A;  5AQK A;  1QHA A;  1JCE A;  5AQJ A; 
#chains in the Genus database with same CATH topology
 4BRF A;  3ZSR A;  1EWR A;  4DTS A;  3DOK A;  3DLG A;  1H1V A;  2E1Z A;  2VWJ A;  1Q9Y A;  4B9S A;  5C0Y A;  3KZB A;  2YNH A;  2NRR A;  4LH4 A;  2Q0R A;  4DFP A;  2D0B A;  1HNI A;  4M41 A;  3C6T A;  1WSG A;  2P9L B;  1BIS A;  1S6Q A;  1HPM A;  3WXL A;  3IAY A;  3HST B;  4KV8 A;  3VQ6 A;  4R5P A;  3OW2 M;  4Y1C A;  4GV9 A;  2VWB A;  4KRF A;  1YJW N;  4DTP A;  3HPO A;  2D0O A;  5TKW A;  1HNV A;  4FVU A;  4HCC A;  4QS7 A;  2YHW A;  1ZBH A;  4FLT A;  2OPP A;  5KPT A;  1O13 A;  4KHS A;  3C65 A;  4JKD A;  3UKU A;  4RTF D;  3AAP A;  3IKM A;  1VHX A;  2IVP A;  4H0V B;  3L2Q A;  3LDQ A;  1KRP A;  4JKE A;  3J7Z O;  4C8O A;  5AQI A;  1GLA G;  4BVO A;  3HM8 A;  3OYG A;  4CGH A;  3I55 N;  3OS2 A;  5CZ2 A;  1HYV A;  5KQ8 A;  3BEX A;  4FJN A;  2YKM A;  4AM7 A;  2A6A A;  4DTJ A;  3SMP A;  2HST A;  4CHZ A;  1W0H A;  2KQ2 A;  4YOR A;  4B9Q A;  2PY5 A;  3TTD A;  4PWD A;  2E4L A;  1S1U A;  1ZBU A;  4AHU A;  4DSJ A;  1ESV A;  3WEE A;  4BC3 A;  3OYF A;  3THY A;  3SPZ A;  1BI4 A;  3AGR A;  1VSM A;  4CHY A;  4FJH A;  3TAR A;  1NGA A;  3EE9 A;  2B6A A;  1KQS M;  5ADX H;  3D2E B;  2AJQ A;  3OYH A;  4Z4G A;  4BY9 C;  4JI8 K;  2DY4 A;  4DSE A;  4LF4 K;  3J81 O;  2A3Z A;  4M7Y A;  3E66 A;  2O8B A;  1HNW K;  5E26 A;  2X6N A;  3LPU A;  3HXM A;  2VWK A;  3O4W A;  4WFB L;  3G0Z A;  3OA9 A;  4ISE A;  4DS4 A;  5CZ1 A;  4IZ9 A;  4HUF A;  2ZWH A;  4DR1 K;  4DF8 A;  3OYL A;  3QER A;  3EKS A;  1KVB A;  1MWM A;  3IDH A;  1OVQ A;  2CGJ A;  3TU5 A;  3LP2 A;  3KJV A;  2CGK A;  1ATR A;  4N76 A;  3O3F A;  3RWU A;  1YXQ A;  3C7N A;  3QNO A;  3THV A;  2VGN A;  4LF5 K;  3DXM A;  3KLF A;  4M3Z A;  1J53 A;  3SNN A;  4MQ3 A;  1U2V B;  4JKB A;  4FXD A;  3U3Y A;  3MCP A;  3F2K A;  4GMJ B;  4CE9 A;  5BPN A;  1C1A A;  2IVN A;  2VG7 A;  1RTH A;  4JV5 K;  4GY2 B;  1WOQ A;  1VSD A;  4FM0 A;  4LY7 A;  4CF8 A;  2ZQB A;  1XC3 A;  2W41 A;  1J9A A;  4YOX A;  4F3T A;  4LSL A;  4FJ7 A;  1TKX A;  4CEB A;  5AZJ A;  3DLB A;  2QK9 A;  3V6D A;  2O8F B;  3BUZ B;  2XO7 A;  3UE5 A;  4ELT A;  4JRQ A;  1M90 O;  2ASM A;  4BRM A;  2XY7 A;  4DR5 K;  4E89 A;  4W5N A;  3HTV A;  3OHR A;  4GVE A;  4DFM A;  4F2R A;  4CFB A;  4KH4 A;  3ZX3 A;  4FLW A;  4Z4C A;  3VQQ A;  4KHY A;  2E2O A;  5J2M A;  2WUS A;  4BVP A;  2GUI A;  2EX3 A;  3RTV A;  1TYQ B;  4E7H A;  1ZXO A;  4BC2 A;  3PUF A;  3WNG A;  3ZSZ A;  4WQ4 A;  4BWM A;  2GV9 A;  3VEN A;  4I2P A;  1LW2 A;  2HF4 A;  4M3T A;  5BRE A;  3AVK A;  4J2E A;  3ZT0 A;  4BG9 A;  4PUO A;  1OKJ A;  4BC5 A;  1QVG M;  4DTN A;  4JRP A;  3OYJ A;  4C8L A;  2F7T A;  5KTQ A;  4KHQ A;  3VN5 A;  3HJF A;  1GLL O;  3AA2 A;  3DYA A;  2HF3 A;  4IJN A;  3VQ8 A;  3NE6 A;  3O9T A;  1JCG A;  3E01 A;  4CJP A;  1VQK N;  3ID6 A;  1JLA A;  1NGG A;  1HKB A;  2WTU A;  5M1P A;  3Q7C A;  1ZC6 A;  3AA4 A;  4OVL A;  4Z94 A;  2P9U B;  1IO2 A;  4IJA A;  3GL1 A;  5JVH L;  4N41 A;  3EL2 A;  3O5B A;  3O3H A;  4JD2 B;  4AHR A;  5J2Q A;  4LC9 B;  3MEG A;  4CK2 A;  1SKS A;  3OYD A;  4DR2 K;  4FK2 A;  1ATN A;  4BRC A;  1Z05 A;  3QIN A;  1SL0 A;  4M3W A;  3KWI A;  1NMN A;  1E4F T;  3HSC A;  3VQ7 A;  4B1U B;  3MED A;  4DSI A;  4FWO A;  2AP1 A;  5BN9 A;  2PBD A;  4XH5 A;  2O4G A;  1KVA A;  3CMA N;  1J5O A;  3QEI A;  1S1T A;  4KTZ A;  1ZBI A;  3TAG A;  2ASP A;  4MO5 A;  4CZI A;  1RNH A;  2Q31 A;  3OY9 A;  1RGI A;  5M1N A;  3DWL A;  3UIQ A;  4LFC K;  3FR0 A;  4DUY K;  1JL1 A;  1WLJ A;  1X9J A;  4O44 A;  4DSL A;  3VF6 A;  1BQN A;  2F96 A;  3E9P A;  3AGK A;  4H4M A;  3AAQ A;  3UKU B;  4BR4 A;  4DV2 K;  1N5Y A;  2GEL A;  3CJA A;  2UUC K;  4H0O A;  3R3L A;  4FSV A;  2ITG A;  1QQM A;  2JLE A;  3EEQ A;  3VQP A;  3NGI A;  1JLG A;  2IS3 A;  3CPE A;  3ZET A;  1ATS A;  4L3Q A;  4ZHR A;  3CJB A;  4BDY A;  1WNS A;  3M6G A;  1SQK A;  1NLV A;  2YJE A;  4OKJ A;  2ZGZ A;  4CIE A;  4WFA L;  3AVL A;  1TVR A;  4M63 C;  4JS4 A;  4CFD A;  5AJ3 K;  4BAC A;  1YJ9 N;  3AY9 A;  4JI4 K;  3HRG A;  3KWG A;  4E1J A;  2E88 A;  3WNH A;  4BRP A;  5I9E B;  1BO5 O;  3CCQ N;  1JJ2 M;  3JS6 A;  3LP3 A;  2BUP A;  5C10 A;  3N4P A;  4X62 K;  5IWA K;  2G8K A;  2P5O A;  2Z1G A;  4YOY A;  4QS8 A;  3WXJ A;  5AQM A;  3O4N A;  4OKE A;  3VF2 A;  3HL8 A;  5C2D A;  3ID8 A;  1JLE A;  3JSM A;  2O8C B;  3FZM A;  1NK8 A;  4OGC A;  4AIL C;  3U9D A;  2F9T A;  4W5R A;  4YOT A;  3OYB A;  4CBX A;  3AVC A;  3PSF A;  4G9Z A;  2FBT A;  1YT3 A;  5FDL A;  1BDG A;  1U6Z A;  1TL3 A;  3O1B A;  3L3V A;  5F2R A;  3ZT4 A;  3TR8 A;  4ISG A;  3VET A;  3U6F A;  3QEW A;  3QB0 A;  1TAQ A;  3MMV A;  5AQR A;  4O8U A;  5ELZ A;  4FLV A;  3RMC A;  3ALY A;  3CJ7 A;  3LM9 A;  3SK3 A;  4CD3 A;  5H1S Q;  3NGZ A;  3PIO L;  3DXM B;  1T44 A;  5BRD A;  5GAD P;  5DM6 L;  1XNQ K;  4KHP K;  2KFN A;  4FWL A;  4AHT A;  4ILJ A;  5AQP A;  4BRL A;  1NMD A;  5DK5 A;  3MWP A;  2QM1 A;  3NH2 A;  3MK6 A;  3O4Q A;  1BOT O;  3V4I A;  3SYZ A;  5J2P A;  4V19 S;  1EQY A;  4OX9 K;  2ZJP L;  4B3T K;  4B9N A;  3WNE A;  4LF9 K;  3WQT A;  4FJJ A;  2E2P A;  3EN9 A;  2QWN A;  3THX A;  3TSP A;  4M3X A;  1IKW A;  2IDO A;  1JLC A;  1RBR A;  2XRI A;  1Z25 A;  2BH1 A;  1GLC G;  3AA3 A;  3RVC A;  4A59 A;  4CEA A;  3TAP A;  1TL1 A;  4CJK A;  4FPA A;  3LWM A;  2BGG A;  1YTA A;  4EFH A;  4LSN A;  5GIO A;  4FK0 A;  1BA1 A;  4FW2 A;  5FLX O;  2HHU A;  3M3Z A;  3H45 C;  5KPZ A;  3J8A A;  4QAG A;  3PX6 A;  1XMQ K;  1F21 A;  1GLF O;  1QHA A;  2VG5 A;  4DLG A;  3K58 A;  3NGY A;  1XQS C;  5C12 A;  4A62 A;  2V7Z A;  3LL3 A;  1Q7Y O;  3C0B A;  4WCE L;  2NRW A;  4JKA A;  3TAQ A;  2D0P A;  1JXB A;  3CD6 N;  1E4G T;  4U7B A;  4PKG A;  3QFP A;  3M5R A;  3S3O A;  2P9P A;  1T6D A;  3FFK B;  1S9G A;  2KHO A;  4CES A;  1KVC A;  3OBW A;  4RW6 A;  3UB5 A;  1S6P A;  3FZK A;  3MCA B;  1JCF A;  5AFU A;  3CYM A;  1KAZ A;  4BRA A;  2A42 A;  4NYF A;  4IBN A;  2RF2 A;  4JI6 K;  1L5U A;  4YY3 K;  3A5O C;  2ZD1 A;  4K43 A;  2WOM A;  3SV3 A;  3IUC A;  3L4I A;  1SKR A;  4EHT A;  2V51 B;  1QVF M;  3CQY A;  4LFA K;  2DFH A;  3K59 A;  2ZM6 K;  3P4I A;  1EXQ A;  3R6M A;  4DMN A;  3A5L C;  1Y97 A;  4WFN L;  1FKO A;  4H4O A;  3BZK A;  4N56 A;  3MXI A;  1C0M A;  3L0Q A;  3QET A;  3MAQ A;  3QO9 A;  3RSE A;  3SLC A;  1N33 K;  1HNX K;  1RDD A;  4JHD B;  4F3O A;  3VEX A;  1NKE A;  2X78 A;  1VK0 A;  4DQI A;  2RHK A;  3CCL N;  4M45 A;  1I3A A;  1DTT A;  3U8X A;  2P51 A;  1U04 A;  4JKF A;  4KI6 A;  5JVG L;  4IFY A;  3S41 A;  1QZ5 A;  3D7E O;  2OYQ A;  5GAE P;  3KVG A;  2JWL A;  1KXP A;  3J7A P;  3CHW A;  1U45 A;  2NRT A;  3ZET B;  3JAM O;  3QEP A;  2G8H A;  4CZK A;  4HTL A;  4E1M A;  1IH7 A;  4FW1 A;  3KKS A;  3QIP A;  4C23 A;  1HJR A;  5LJW A;  2XY5 A;  1VQP N;  1T03 A;  3DAW A;  4CEC A;  4FJ9 A;  4BRK A;  2E6M A;  3CFP A;  3OS0 A;  4HVJ A;  3UKR A;  3L4Q A;  4B3S K;  4KO0 A;  4EAH D;  1IV0 A;  2W6K A;  3KK3 A;  3V9Z A;  3P38 A;  1JXE A;  4GV6 A;  4Y1D A;  2P9S A;  4FZX C;  2QWR A;  1C6V A;  4AHV A;  2RE2 A;  4BRQ A;  4IG3 A;  4CD1 A;  5C2F A;  1KLM A;  3KD5 E;  3LAK A;  4BRI A;  4DTU A;  2OTL N;  2HNY A;  3S9H A;  4NXN K;  3LDL A;  1VRT A;  2HHH K;  1EKE A;  1NJY A;  1WBD A;  1RFQ A;  3NF9 A;  4N5S A;  3FE1 A;  5F0X A;  4FL9 A;  2OAN A;  1IKY A;  2QWQ A;  4B1V A;  5CR4 A;  3CPW M;  3GOI A;  3P1G A;  4JEP A;  4BQZ A;  3ZSQ A;  4OJR A;  3ZSO A;  1M1K O;  3RRH A;  4H5N A;  2NNW A;  3PSI A;  3JYT A;  1SL1 A;  3MN5 A;  4I9Q A;  5E84 A;  3ZX2 A;  2FBX A;  2VCP A;  4WF9 L;  4KFB A;  3KK7 A;  1KFS A;  3AO2 A;  2RN2 A;  4H0P A;  2G8V A;  3NF6 A;  4I6M B;  3CI5 A;  2IGI A;  4O5B A;  2KZM A;  2BE2 A;  4OPH A;  3HO1 A;  2O8E A;  1NKC A;  1LWC A;  5CYQ A;  4QCL A;  2NRV A;  3VQA A;  4R79 A;  2WON A;  2Z1I A;  3LWL A;  3HOT A;  1KLN A;  1RT7 A;  4O8K A;  3CCR N;  2NUB A;  3OYC A;  2QXL A;  2ZE2 A;  3ATV A;  3R9P A;  1ZBF A;  3NF8 A;  4CJR A;  1WBB A;  1RTJ A;  3BZC A;  1X9M A;  1D8Y A;  1WSJ A;  3HPH A;  3THX B;  1T7P A;  4DSK A;  2F4V K;  1BL3 A;  1C0F A;  3V81 A;  2QKB A;  1RDU A;  3CM6 A;  4FLY A;  4BR9 A;  2HND A;  3AVF A;  3LDN A;  1UWB A;  3K9K A;  1T3V A;  3OS1 A;  3KTQ A;  2OTJ N;  3TAF A;  3GG4 A;  5KRT A;  3I0R A;  3ZT3 A;  1Q82 O;  3G10 A;  5AQQ A;  4M7X A;  4IO8 A;  1TV6 A;  3FLC O;  4FJ5 A;  4CJU A;  2HHT A;  1S5J A;  2Z1J A;  1B9D A;  3OYM A;  4CF2 A;  4DQS A;  3OJU A;  3PV8 A;  3IMX A;  4YHH K;  3M8S A;  2VQE K;  3ZX0 A;  3T1Y K;  3H08 A;  1NK9 A;  3DLH A;  5HL7 L;  3MDQ A;  5FRO A;  3VGK A;  5TKY A;  3P31 A;  2YX6 A;  1SKW A;  2W40 A;  4YDU C;  4PA1 A;  4J8F A;  4C8K A;  2GTD A;  4CGF A;  1X9S A;  5BPM A;  2W42 A;  2P9P B;  4CFC A;  5BRH A;  3RR7 A;  2WFB A;  3T1H K;  1NU0 A;  3AVM A;  3DI6 A;  2O8D A;  3EY1 A;  4LF8 K;  2KFZ A;  3AO3 A;  4M3U A;  1CXQ A;  3SV4 A;  5LMU K;  4N47 A;  2E20 A;  4CZH A;  1OVY A;  4B9M A;  4JLH A;  2QWP A;  1HYZ A;  3CCS N;  4BR7 A;  3O8M A;  3D6R A;  1RBU A;  1TUU A;  3VTH A;  3DRS A;  2Q97 A;  5JLF A;  2BDP A;  4BE2 A;  4A57 A;  3CC4 N;  3H46 O;  2KZZ A;  3SAH A;  4B3M K;  4YOV A;  3QES A;  2FSN A;  1QSL A;  3OYI A;  5J1E A;  1BHL A;  3ZSV A;  4CZG A;  2FC0 A;  2D0A A;  3J80 O;  4Q0B A;  1D9F A;  4CBU A;  3THW B;  4FZZ A;  1CZA N;  2X74 A;  3KK2 A;  3E9O A;  5JS2 A;  2QA4 N;  4B8A B;  5C25 A;  4M3Y A;  4FWS A;  3RSE B;  2UXC K;  3EE8 A;  1NOZ A;  2HBJ A;  3ZSW A;  4CF9 A;  5HOO A;  3AVG A;  2YHA A;  4FK4 A;  4AHC A;  3AVH A;  4BGA A;  4CJQ A;  3ULE A;  4K42 A;  1UA1 A;  1TK8 A;  5J2N A;  3KHY A;  4W5O A;  3KD1 E;  4X66 K;  4CJ3 A;  4BE0 A;  1GLJ O;  4DQ8 A;  1Q86 O;  1ASV A;  2EWS A;  2F8T A;  2YNI A;  3AVJ A;  2B4J A;  4FJ8 A;  4CED A;  3IG1 A;  1U49 A;  1VQL N;  1QZ6 A;  5KGX A;  3PX0 A;  3BF1 A;  4FWN A;  3GBT A;  5AQH A;  2RPI A;  5KGW A;  4K25 A;  4NB4 A;  3ATU A;  1QSS A;  2Q0U A;  4KTQ A;  1NKB A;  3OYA A;  3QIC A;  5C24 A;  1X3M A;  3VOV A;  3CG7 A;  1TGO A;  1EWQ A;  4BRO A;  2OZS A;  3JXU A;  3SBT A;  5HRP A;  4QOZ B;  1IBM K;  5AZI A;  3FZF A;  2P9S B;  4IDK A;  5EU7 A;  3NMU A;  4DF4 A;  3KLH A;  2WC9 A;  5I3U A;  3J7Y P;  4CI6 A;  4H0X B;  1QQN A;  1TK5 A;  1KD1 O;  3SUP A;  5HLF A;  5A2Q O;  3HVR A;  2A5X A;  3ZT2 A;  3VEV A;  3ITH A;  4ZTF A;  3NCI A;  1NJZ A;  1C1B A;  1N36 K;  3HP9 A;  1WUA A;  4Q5V A;  4JI7 K;  4B9V A;  4KHN A;  3BGR A;  4PY5 A;  1RDA A;  4NLB A;  3VTI A;  4CEQ A;  4MLE A;  4O5F A;  3CET A;  4A61 A;  4CZF A;  1HUX A;  3G6E N;  5EOY A;  4UQG A;  4FLX A;  1HLU A;  1RDB A;  4DV3 K;  1VSH A;  2X6S A;  4FWK A;  1HNZ K;  2HVH A;  3PO4 A;  4HTU A;  4DUZ K;  2HB5 A;  5DMR A;  4IO9 L;  4EZ6 A;  1JLQ A;  4DTR A;  3O08 A;  3I33 A;  2QTD A;  3VMF B;  2QWL A;  4E1N A;  1YIJ N;  3SAF A;  2O8E B;  1JCE A;  4CJS A;  4CZL A;  1X1P A;  3M8Q A;  3K5L A;  3ENB A;  4K8X A;  1LOT B;  1RCH A;  4JK7 A;  1C0G A;  5JLH A;  4KTW A;  3P83 D;  1CLQ A;  1SS6 A;  3S3N A;  1J54 A;  1TKT A;  3ZLJ A;  2Q3S A;  4B9U A;  2KW4 A;  3WEE B;  4GKJ K;  3THY B;  3LDS A;  4RW7 A;  3CQX A;  1BI4 B;  3DRP A;  3WNF A;  1W2B M;  1ILY A;  3TAE A;  4CIG A;  2FF3 B;  3R8E A;  3MX2 A;  2WBN A;  4FYD A;  3MN9 A;  1N32 K;  3D2F A;  4TSX A;  3FZH A;  1LW0 A;  3HP6 A;  4XH1 A;  4Z0U A;  1HRH A;  3QNN A;  4JYA K;  4JN4 A;  3BDP A;  2O8B B;  4CGI A;  1IKV A;  3KLI A;  4Z4E A;  1K8K A;  3CC2 N;  2QI2 A;  4E7I A;  4AHS A;  4A2A A;  5M1K A;  5LY3 A;  3CCE N;  1X9W A;  3KLG A;  2HVI A;  1W97 L;  1S72 N;  3RMD A;  1QSY A;  4CEF A;  1BU6 O;  4CFA A;  2DPN A;  4ID5 A;  3VPZ A;  1BA0 A;  4FWM A;  5KI6 A;  4ICL A;  1WN7 A;  3AO1 A;  4CJ5 A;  4FJX A;  1NJW A;  1VAZ A;  2I5J A;  2HNZ A;  5K14 A;  4JKC A;  3TTC A;  3VA0 A;  4Y0W A;  4FJI A;  4CJE A;  3F73 A;  4XH4 A;  2I7P A;  4XEI A;  1NJI O;  2UU9 K;  4F4K A;  4DB3 A;  4GV3 A;  1HKG A;  2P9L A;  3DLK A;  5M1F A;  3C7N B;  5HRS A;  3TI0 A;  2O8D B;  5BR8 K;  5GIN A;  3TWH A;  1NGI A;  3PO5 A;  4CEZ A;  3NFA A;  3LAN A;  4CF1 A;  5M1O A;  4WQ5 C;  3CJ9 A;  4KH6 A;  4MDA A;  2YHX A;  2NRZ A;  3T7Z A;  1BIZ A;  4MLH A;  4J2B A;  3SJJ A;  2NZT A;  5D3G A;  1VQM N;  1ZYQ A;  3FZL A;  4IXC A;  4ELU A;  2FF6 A;  2GX9 A;  3SJH A;  1VRU A;  5AQS A;  3D0P A;  4F2S A;  1YI2 N;  4M42 A;  3WT0 A;  2HHQ A;  2Q2R A;  1U4B A;  5AZJ B;  3ZT1 A;  5AR0 A;  4RW9 A;  4H0Y B;  5MLC Q;  3WQU A;  1RT1 A;  4BC4 A;  3VEZ A;  4KB0 A;  4YDU A;  1NGC A;  2B5J A;  2VQF K;  1YHQ N;  3MWT A;  3I56 N;  4BRG A;  3RRG A;  4FJG A;  4X65 K;  4DV0 K;  3NF7 A;  4DTM A;  1U48 A;  2QWM A;  3ULE B;  2HMP A;  3HOS A;  4NCB A;  2UUA K;  4CK1 A;  4AM6 A;  2RKI A;  3C6U A;  1NWK A;  4FPB A;  5CE3 A;  3K5M A;  4KHU A;  3OBY A;  4IEE A;  4IWV A;  4E0D A;  4B08 A;  1LV5 A;  3I8D A;  4KHW A;  4CJ4 A;  4KI4 A;  1D5A A;  3TAM A;  3AVI A;  1D9D A;  1V4T A;  1C0U A;  2OPR A;  5JIC A;  3OYE A;  1L3S A;  1JKH A;  5LMN K;  1K8A O;  2R7Y A;  1SV5 A;  1BWF O;  3W3D A;  3HYF A;  4JKG A;  1YUW A;  5AQZ A;  3CC7 N;  3QLH A;  1VSI A;  3DLR A;  1DT9 A;  1ASU A;  1S1X A;  4NCG A;  3LM2 A;  4OPK A;  5HRR A;  5FPD A;  5AQV A;  3VER A;  1W9H A;  5BRF A;  1Y64 A;  1BUP A;  4PKI A;  4FZY A;  3QML A;  1A5V A;  4CHN A;  2QW9 A;  1XI1 A;  4ELV A;  5I42 A;  2YKN A;  1U2V A;  4CK3 A;  3SQ2 A;  4DSF A;  4WQ4 C;  1I39 A;  4FOE A;  4DV4 K;  1NBW A;  4B1Y B;  4YOU A;  3KIO A;  1WSI A;  1JLB A;  2VYP A;  3EO3 A;  4JNE A;  4I2Q A;  3W0L A;  3LAL A;  4EIA A;  3MEC A;  1EP4 A;  4CGJ A;  3TSU A;  2OPQ A;  2QXF A;  3K57 A;  3PLA A;  5F1X A;  1XNR K;  1HYS A;  3V9W A;  1VQ8 N;  3BY5 A;  4DV7 K;  4IKF A;  5JMV A;  3M1F A;  3OJS A;  4DV6 K;  1KAY A;  1VQ5 N;  2IAJ A;  3F9M A;  5BPL A;  4BRD A;  1N6Q A;  3V9X A;  2CGL A;  4ILH A;  1BQM A;  4JAX A;  3SBG A;  1MDU B;  4AF1 A;  4CJV A;  4OLA A;  4ID1 A;  3TAB A;  3O80 A;  1G15 A;  2D5R A;  3O6W A;  4HUG A;  3DXK A;  2UUB K;  3A5M C;  3QIO A;  3ASM A;  4JK8 A;  4NXM K;  3CXC M;  1OH8 A;  4B9L A;  4K8Z A;  3HI0 A;  1JL2 A;  4PL7 A;  1VQ6 N;  3MX5 A;  3RMB A;  4E7K A;  3A8Y A;  1S1W A;  2QEX N;  4IFE A;  1XUP O;  4DR4 K;  4YOW A;  3QBX A;  4JK9 A;  1NK6 A;  5GAG P;  1NNE A;  3T3F A;  3V1R A;  4CZE A;  3PY8 A;  3D2F B;  3HZ6 A;  2P9K A;  4O4G A;  1WSH A;  5AQU A;  3M8P A;  4DFK A;  3MN6 A;  3DOL A;  4E19 A;  3VQB A;  2P9N A;  3VQE A;  3B8A X;  3SQ1 A;  1RT4 A;  3VGM A;  2UXB K;  3SPY A;  5BN8 A;  4DV1 K;  1XMO K;  1K8K B;  2P9U A;  4FWQ A;  3WUH A;  4H5T A;  1S22 A;  4B1X B;  1BCM A;  1JLF A;  3QDK A;  4FLU A;  4JD2 A;  5T7B A;  1UAX A;  3TSQ A;  1WSE A;  3DLL L;  1CZ9 A;  1HX1 A;  1UA0 A;  4OLB A;  3CJC A;  4H0T B;  1TAU A;  2YHB A;  4DFJ A;  4B1Z A;  1L3V A;  1IBL K;  4CEE A;  4AH9 A;  4BRE A;  1NGF A;  5SWM A;  3P5J A;  4IOA L;  1RT2 A;  2O4I A;  1DLO A;  4RWT A;  1FXX A;  4QS9 A;  3NDK A;  3MXM A;  3F9K A;  1NK7 A;  2V52 B;  2GUP A;  5AQF A;  1BGX T;  1QQO A;  1QTM A;  3ZSY A;  3CCM N;  4RCH A;  3LDP A;  3FGU A;  3HM9 A;  5AQT A;  1HQE A;  3BP8 A;  4JKH A;  4JI3 K;  1NGJ A;  3C95 A;  4OKK A;  4B1W B;  1WSF A;  1ITG A;  4J2D A;  4FCY A;  1KCF A;  3HK2 A;  2E2N A;  2A41 A;  1N8R O;  3WXM B;  2DFE A;  4I7F A;  4GVM A;  4KRE A;  2A1R A;  3NVK A;  3A0I X;  4EHU A;  4FJM A;  4DS5 A;  3VQ5 A;  4C1N K;  4IG0 A;  1D4X A;  3QEX A;  2ZGY A;  1WAF A;  1O1W A;  3VES A;  4XIU A;  4E7J A;  4PL8 A;  5FPM A;  1LWE A;  3CCV N;  3NVM A;  4BQL A;  2P9I A;  1GOB A;  3NBP A;  1L3T A;  2E5L K;  3EZ5 A;  4DLE A;  3VQC A;  1UOC A;  2FBV A;  3A5N C;  4WQ5 A;  1J5E K;  4YFU A;  3WXK A;  5KQD A;  1K6Y A;  5FRN A;  2NRX A;  3LZI A;  2O8C A;  3VGL A;  3ZEU A;  2OCE A;  3O3G A;  1TUY A;  4CHP A;  4LFB K;  3QEV A;  5AQW A;  4JI5 K;  4H5V A;  5CY4 A;  1TKZ A;  2HBK A;  4JS5 A;  1WB9 A;  4JKG B;  3VF4 A;  1ZBL A;  4DU4 A;  1QHT A;  3H3N O;  1LWF A;  2JGU A;  1RBT A;  1RT3 A;  3G25 A;  3O1W A;  4M3R A;  4CJF A;  2E1Y A;  3VA3 A;  5AQK A;  2Y1I A;  4OPA A;  4E7L A;  3OYN A;  2JWK A;  3HT3 A;  4CGG A;  4PQU A;  2GWK A;  3O9S A;  3CJ1 A;  3TPQ A;  1VSK A;  1Z26 A;  1IG8 A;  4WE1 A;  1RDC A;  3EZW A;  4C1N I;  4CHQ A;  4E3S A;  4IEI A;  4JI0 K;  2NRH A;  4CEO A;  1OH6 A;  3VQ4 A;  1GLD G;  1LAV A;  2E8A A;  1I94 K;  1FK9 A;  3K5O A;  4NLC A;  2YCH A;  1VQ9 N;  1B9F A;  2I7N A;  1IG9 A;  4IOC L;  1VSL A;  3T1A A;  1T05 A;  4BR5 A;  3KKR A;  3N4Q A;  3P39 A;  3NAE A;  3IS9 A;  4RG8 A;  3B6O A;  5GAH P;  3HVT A;  4ZTJ A;  2BAN A;  2PAV A;  2IC3 A;  4EP4 A;  4BDZ A;  1GLB G;  4CZM A;  1S1V A;  1XHX A;  1HR0 K;  1HJO A;  2D0C A;  1W7A A;  1WAJ A;  4OGE A;  1K9M O;  3G4S N;  4NO7 A;  4DTX A;  5KPR A;  3AAR A;  3DXK B;  5AQO A;  2E6L A;  1HMV A;  4BE1 A;  1RTD A;  5BR9 A;  4GW6 A;  4RW4 A;  4Z4I A;  2EHG A;  3T69 A;  3H1V X;  2Z1H A;  4PKH A;  2XY8 A;  3UKR B;  4B9T A;  4ILG B;  2HHW A;  1NJX A;  3VEW A;  1YIT N;  1YVU A;  1ASW A;  4LF6 K;  4EZ9 A;  3LDO A;  4FWR A;  1VSF A;  2A1S A;  1E3M A;  1TKD A;  4F8R A;  2P9K B;  4FM2 A;  4KB1 A;  5FPE A;  1C0T A;  3SI6 A;  3CCJ N;  3NHG A;  3MXJ A;  4CVN E;  4K41 A;  2ZJQ L;  1EO1 A;  4CJL A;  2J4R A;  4FO0 A;  2QKK A;  2D4W A;  1HPZ A;  1NK0 A;  2P9N B;  2GEM A;  3C94 A;  3AV9 A;  3BF3 A;  2YNG A;  4IDH A;  3D45 A;  1SL2 A;  4UY8 O;  2KKZ A;  3L2W A;  3I0S A;  1CXU A;  2FBY A;  1C1C A;  2UXD K;  1V4S A;  2NLX A;  1SAZ A;  1HKC A;  4FOI A;  3U9Z A;  3L8B A;  3WXI A;  2OPS A;  3H6E A;  4DV5 K;  5AQL A;  1BCO A;  2V7Y A;  3M8R A;  1Q81 O;  4BRN A;  1QQC A;  5ADX A;  3LZJ A;  2IOC A;  1LCU A;  5GIP A;  2G8U A;  1G99 A;  1NGB A;  5B8H A;  4FLZ A;  5AQG A;  1S9E A;  2FSK A;  3TTF A;  1DTQ A;  1RBS A;  3DM2 A;  2ZF5 O;  5HBM A;  3DRR A;  4CZJ A;  3E1Y A;  3T19 A;  3E9L A;  1DGK N;  3SUO A;  4JHD A;  1VQN N;  1REV A;  1TK0 A;  2HHS A;  5KRS A;  4Z4H A;  4DQP A;  3U4L A;  3AO5 A;  2UYT A;  5AFU H;  4HWI A;  2GWJ A;  1X3N A;  3EYZ A;  4CER A;  5AQX A;  1K73 O;  2LSN A;  4PHT X;  3TAN A;  5EXW A;  1S3X A;  2F9W A;  3NH1 A;  1FKP A;  1NM1 A;  3OVN A;  4KAZ A;  5HP1 A;  3MEE A;  2ETJ A;  1EX4 A;  3SUQ A;  1QE1 A;  1VQ7 N;  3GE1 A;  3AVA A;  1NG9 A;  3PIP L;  4LF7 K;  4K0K K;  4RW8 A;  2ZJR L;  1YVN A;  5DM7 L;  3O9R A;  3S3M A;  4DKW A;  4H5W A;  4CBW A;  4F9O A;  3CM5 A;  2H3G X;  3KK1 A;  3CIP A;  1SZ2 A;  3AA5 X;  3OYK A;  1L3U A;  4JI2 K;  2HMI A;  5E41 A;  3LP1 A;  2P9I B;  3R1X A;  2ATQ A;  5SZT A;  3VEO A;  2FXU A;  5LL6 Z;  1XWL A;  3HPG A;  4H5R A;  4LD0 A;  3V9S A;  1XHZ A;  2HHX A;  4W5T A;  1KC8 O;  1HQU A;  1MA9 B;  1VSE A;  3SCX A;  3H1Q A;  5C15 A;  5HRO A;  1NOY A;  2W6L A;  3ZEU B;  1J6Z A;  1BG3 A;  1VSJ A;  2P1J A;  1VQ4 N;  1U47 A;  4NCA A;  2HW3 A;  4H8K A;  1EET A;  4FM1 A;  2HBL A;  2Q36 A;  4FJL A;  4MDB A;  1IBK K;  1B92 A;  2ASO A;  3VQD A;  2HHV A;  1Z6R A;  4BG8 A;  3L3U A;  3SUN A;  4MFB A;  1KSP A;  3IRX A;  1NK5 A;  1YJN N;  3V9U A;  1MWK A;  3V1Q A;  3CCU N;  3CQ8 A;  1P90 A;  1RTI A;  4HHT A;  3H3O B;  2IIR A;  3ZSX A;  4I6M A;  4J2A A;  2CH6 A;  4B3R K;  2DFF A;  4KBO A;  3SZ2 A;  1LAW A;  3CF5 L;  4O55 A;  2QWO A;  2P5G A;  4IFV A;  5CYM A;  4HCB A;  1IJJ A;  4B3O A;  1R59 O;  2A40 A;  2G8W A;  4BDP A;  3B6P A;  4KH5 A;  4L8R B;  3EKU A;  4DQR A;  2G8I A;  2PFU A;  4FJK A;  1T8E A;  1A5X A;  3RMA A;  2DTU A;  3ULD A;  4DCH A;  3MN7 A;  3FFI A;  4NYN A;  1N34 K;  1GOA A;  3O9U A;  4CJT A;  1BIU A;  3D2E A;  4CJW A;  4H03 B;  1NGE A;  3VEY A;  4DQQ A;  2XY6 A;  3SQ0 A;  4IOX A;  1KTQ A;  1RIL A;  2D1K A;  1R0A A;  2KTQ A;  4O0I A;  3K0S A;  4DR3 K;  3V1O A;  5CHI A;  3U3G A;  1YAG A;  1VQO N;  1CZB A;  4OO1 J;  4DR6 K;  5FPN A;  1SUQ A;  5JS1 A;  3AVB A;  3LP0 A;  4X64 K;  1T6C A;  4GNI A;  1RT5 A;  4JI1 K;  4CGD A;  4CW7 B;  4BR2 A;  3DJC A;  1ZBS A;  2G8F A;  1IKX A;  3F5T A;  3K2P A;  2F8S A;  3GDQ A;  4HUE A;  1DEJ A;  5AZI B;  4B8C A;  3QFU A;  3L2U A;  3L2R A;  3G71 N;  1YF5 L;  4DHY A;  3SMS A;  4A5A A;  3ISN C;  1RDW X;  1A5W A;  5EX5 A;  4O0J A;  3A2F A;  2FSJ A;  4MO4 A;  4A2B A;  3ZYY X;  1DKG D;  2CH5 A;  4DR7 K;  5LJV A;  2ITM A;  5AQY A;  4A5B A;  3RR8 A;  2KLA A;  3OTO K;  2PYL A;  2YJF A;  1GLE G;  4Z4F A;  3I8B A;  1Q8I A;  1OH7 A;  4FVM A;  1P8Z A;  3L6Q A;  5IT9 O;  4EP5 A;  3DMJ A;  4C8M A;  1NK4 A;  2HOE A;  2VGM A;  3THW A;  1KFD A;  2HBM A;  2O8F A;  2BTF A;  2GBZ A;  4W5Q A;  3CFO A;  3KLE A;  3O9Q A;  3ENO A;  2E2Q A;  3K9J A;  3ZCM A;  3IFR A;  3L2V A;  4C8N A;  2YI1 A;  2YV0 X;  1NGH A;  3ENH A;  3QBW A;  4ISF A;  2IVO A;  4U67 L;  4DU1 A;  4GKK K;  1RT6 A;  3AVN A;  4LH5 A;  4DU3 A;  5M1Q A;  1Q9X A;  4KKO A;  3SQ4 A;  4CHO A;  4CCH A;  5C42 A;  2VG6 A;  1FJG K;  5FRM A;  1RBV A;  2Y1J A;  1TYQ A;  3LAM A;  1NGD A;  1QS4 A;  4I9L A;  2YNF A;  4WYB A;  4CIF A;  3SAG A;  2PYJ A;  1KAX A;  3AO4 A;  3CER A;  4CJ7 A;  1MU2 A;  3PX4 A;  1Q18 A;  4BRH A;  3HBT A;  2PZS A;  2OA8 A;  4KPY A;  5AQN A;  4YNQ A;  4AQY K;  4BWJ A;  3Q7B A;  2OZM A;  1FW6 A;  3C6H A;  3CME N;  3DLE A;  5EY4 A;  3CFR A;  4BGB A;  4OPJ A;  4BR0 A;  3C6A A;  3LPT A;  1GOC A;  4DWI A;  3K5N A;  2AA4 A;  2XHB A;  4FWP A;  4G1Q A;  4DTO A;  2FLO A;  5EVZ A;  1YTU A;  3VQ9 A;  5HRN A;  1OH5 A;  2Q1N A;  3NH0 A;  2YHY A;  4DG1 A;  1XC9 A;  4CF0 A;  5AQJ A; 
#chains in the Genus database with same CATH homology
 4BRF A;  4CZL A;  3ENB A;  2JWK A;  1LOT B;  1XQS C;  2GWK A;  1H1V A;  4JK7 A;  1C0G A;  2E1Z A;  3O9S A;  4A62 A;  2V7Z A;  3LL3 A;  5C12 A;  5JLH A;  1Q7Y O;  3C0B A;  4WCE L;  2NRW A;  3CJ1 A;  3KZB A;  4JKA A;  3TPQ A;  2NRR A;  1IG8 A;  2Q0R A;  2D0P A;  3EZW A;  4C1N I;  1SS6 A;  4IEI A;  3CD6 N;  2NRH A;  1E4G T;  1GLD G;  2P9L B;  4U7B A;  4PKG A;  2E8A A;  3QFP A;  1HPM A;  3WXL A;  3M5R A;  3WEE B;  4NLC A;  3OW2 M;  2YCH A;  3CQX A;  1W2B M;  1ILY A;  4GV9 A;  2P9P A;  1T6D A;  2VWB A;  3FFK B;  1VQ9 N;  2I7N A;  2FF3 B;  4IOC L;  3R8E A;  3MX2 A;  2WBN A;  1YJW N;  2D0O A;  2KHO A;  3D2F A;  3MN9 A;  5TKW A;  3FZH A;  3OBW A;  4BR5 A;  4FVU A;  3N4Q A;  3P39 A;  3UB5 A;  3FZK A;  3MCA B;  1JCF A;  4QS7 A;  2YHW A;  4XH1 A;  5AFU A;  1KAZ A;  5GAH P;  4BRA A;  1O13 A;  5KPT A;  2A42 A;  2PAV A;  3C65 A;  4JKD A;  4JN4 A;  3UKU A;  4RTF D;  3AAP A;  1GLB G;  3A5O C;  4CZM A;  3IKM A;  2IVP A;  4H0V B;  4K43 A;  1HJO A;  1K8K A;  3LDQ A;  3CC2 N;  1K9M O;  4JKE A;  3G4S N;  4NO7 A;  3IUC A;  2QI2 A;  3L4I A;  5KPR A;  3AAR A;  3DXK B;  4EHT A;  4A2A A;  5AQI A;  5LY3 A;  1GLA G;  2V51 B;  4BVO A;  5M1K A;  3CQY A;  3CCE N;  3HM8 A;  1QVF M;  1W97 L;  1S72 N;  3I55 N;  5AQO A;  1BU6 O;  3P4I A;  2DPN A;  3VPZ A;  3R6M A;  1BA0 A;  3A5L C;  4FWM A;  5BR9 A;  1GLF O;  5KQ8 A;  4WFN L;  3BEX A;  1VAZ A;  4AM7 A;  2A6A A;  3T69 A;  3H1V X;  4PKH A;  3UKR B;  4JKC A;  3TTC A;  4Y0W A;  3SMP A;  2HST A;  1NJI O;  4XH4 A;  2I7P A;  4ILG B;  4XEI A;  4YOR A;  3TTD A;  3L0Q A;  4B9Q A;  4DB3 A;  4GV3 A;  3VEW A;  1YIT N;  1HKG A;  2P9L A;  5M1F A;  3RSE A;  1ESV A;  3C7N B;  3SLC A;  3WEE A;  4BC3 A;  3LDO A;  4JHD B;  4FWR A;  3AGR A;  3VEX A;  5GIN A;  2P9K B;  1NGI A;  1NGA A;  5FPE A;  3EE9 A;  3CCJ N;  2RHK A;  3CCL N;  4K41 A;  2ZJQ L;  5M1O A;  1EO1 A;  1KQS M;  2J4R A;  4FO0 A;  5ADX H;  3D2E B;  4WQ5 C;  3U8X A;  2D4W A;  2P9N B;  3CJ9 A;  4JKF A;  4KH6 A;  4BY9 C;  4MDA A;  5JVG L;  2GEM A;  3S41 A;  2YHX A;  1QZ5 A;  2NRZ A;  3T7Z A;  3D7E O;  3BF3 A;  2A3Z A;  4IDH A;  5GAE P;  4MLH A;  3KVG A;  2JWL A;  1KXP A;  4M7Y A;  2NZT A;  3E66 A;  2KKZ A;  3CHW A;  4UY8 O;  5E26 A;  2NRT A;  3ZET B;  1VQM N;  4CZK A;  4HTL A;  3FZL A;  1V4S A;  4IXC A;  2FF6 A;  2GX9 A;  3SJH A;  2NLX A;  1SAZ A;  1HKC A;  4FOI A;  3O4W A;  5AQS A;  3U9Z A;  3WXI A;  4C23 A;  5LJW A;  4WFB L;  1VQP N;  1YI2 N;  3OA9 A;  4ISE A;  3WT0 A;  2Q2R A;  3H6E A;  3DAW A;  5AQL A;  5AZJ B;  2V7Y A;  4IZ9 A;  5AR0 A;  4BRK A;  1Q81 O;  4BRN A;  4H0Y B;  5ADX A;  5MLC Q;  3WQU A;  1LCU A;  2ZWH A;  5GIP A;  4BC4 A;  3VEZ A;  1G99 A;  1NGB A;  5B8H A;  3UKR A;  5AQG A;  3EKS A;  4YDU A;  1NGC A;  2FSK A;  1MWM A;  3TTF A;  3IDH A;  2CGJ A;  3L4Q A;  3TU5 A;  1YHQ N;  3MWT A;  2ZF5 O;  4EAH D;  2CGK A;  1ATR A;  4CZJ A;  3I56 N;  3E1Y A;  4BRG A;  1YXQ A;  3C7N A;  3E9L A;  2VGN A;  1DGK N;  4JHD A;  3P38 A;  3DXM A;  2QWM A;  4GV6 A;  3ULE B;  2P9S A;  1VQN N;  2HMP A;  2QWR A;  1U2V B;  3HOS A;  4JKB A;  2RE2 A;  4BRQ A;  3MCP A;  4CD1 A;  3F2K A;  3U4L A;  5C2F A;  2UYT A;  5AFU H;  4BRI A;  2OTL N;  5BPN A;  4HWI A;  2GWJ A;  1X3N A;  4AM6 A;  2IVN A;  1NWK A;  4FPB A;  3LDL A;  5AQX A;  5CE3 A;  1K73 O;  3OBY A;  4IEE A;  4IWV A;  4PHT X;  4GY2 B;  5EXW A;  1S3X A;  1RFQ A;  1WOQ A;  2F9W A;  3FE1 A;  5F0X A;  4FL9 A;  2OAN A;  1V4T A;  1NM1 A;  1XC3 A;  2W41 A;  2QWQ A;  4B1V A;  4YOX A;  5JIC A;  5CR4 A;  3CPW M;  3GOI A;  4JEP A;  4BQZ A;  1K8A O;  5AZJ A;  1M1K O;  1BWF O;  4H5N A;  2NNW A;  1VQ7 N;  3W3D A;  3GE1 A;  3MN5 A;  4JKG A;  3BUZ B;  1YUW A;  3UE5 A;  5E84 A;  3ZX2 A;  3PIP L;  5AQZ A;  1M90 O;  3CC7 N;  2ASM A;  2VCP A;  2ZJR L;  4WF9 L;  1YVN A;  4BRM A;  1DT9 A;  3KK7 A;  5DM7 L;  3LM2 A;  3O9R A;  4DKW A;  4H0P A;  4H5W A;  5AQV A;  3VER A;  4CBW A;  4F9O A;  5FPD A;  2H3G X;  3HTV A;  3CIP A;  1Y64 A;  1SZ2 A;  3OHR A;  4I6M B;  5BRF A;  3CI5 A;  4GVE A;  1BUP A;  4PKI A;  3QML A;  2P9I B;  3R1X A;  4KH4 A;  3ZX3 A;  3VEO A;  2FXU A;  2QW9 A;  4OPH A;  2E2O A;  2WUS A;  4BVP A;  1U2V A;  4H5R A;  2NRV A;  4R79 A;  1TYQ B;  1ZXO A;  4WQ4 C;  4BC2 A;  1KC8 O;  3HOT A;  4FOE A;  1NBW A;  4O8K A;  4WQ4 A;  3CCR N;  1MA9 B;  4B1Y B;  2QXL A;  4YOU A;  3VEN A;  3H1Q A;  5C15 A;  2HF4 A;  2VYP A;  3ATV A;  3EO3 A;  3R9P A;  5BRE A;  1VQ4 N;  3ZEU B;  1J6Z A;  1BG3 A;  4JNE A;  3W0L A;  4BG9 A;  4EIA A;  1OKJ A;  3TSU A;  4BC5 A;  1QVG M;  3PLA A;  2HBL A;  5F1X A;  2Q36 A;  4MDB A;  2ASO A;  2F7T A;  1C0F A;  1RDU A;  4BR9 A;  1VQ8 N;  1GLL O;  5JMV A;  3M1F A;  3LDN A;  2HF3 A;  1Z6R A;  4BG8 A;  3K9K A;  4IJN A;  1T3V A;  1KAY A;  3O9T A;  1VQ5 N;  1JCG A;  1VQK N;  2OTJ N;  3ID6 A;  3F9M A;  1YJN N;  1NGG A;  4BRD A;  3GG4 A;  1HKB A;  1MWK A;  5BPL A;  3CCU N;  5M1P A;  3Q7C A;  1Q82 O;  1P90 A;  2CGL A;  5AQQ A;  4ILH A;  1ZC6 A;  4M7X A;  4IO8 A;  3FLC O;  4JAX A;  2P9U B;  1MDU B;  3H3O B;  4IJA A;  3SBG A;  4Z94 A;  3GL1 A;  4AF1 A;  5JVH L;  2IIR A;  4I6M A;  3EL2 A;  3O5B A;  3O80 A;  4JD2 B;  2CH6 A;  4LC9 B;  3O6W A;  3IMX A;  4KBO A;  3ZX0 A;  3DXK A;  1ATN A;  4BRC A;  3A5M C;  5HL7 L;  4JK8 A;  3MDQ A;  3VGK A;  1Z05 A;  3CF5 L;  5TKY A;  3CXC M;  3P31 A;  2QWO A;  2YX6 A;  3KWI A;  3HSC A;  1E4F T;  2W40 A;  3HI0 A;  4B1U B;  4PL7 A;  1IJJ A;  4YDU C;  1VQ6 N;  1R59 O;  2A40 A;  4J8F A;  3MX5 A;  4FWO A;  2AP1 A;  2GTD A;  4KH5 A;  5BN9 A;  2PBD A;  4XH5 A;  3EKU A;  3A8Y A;  3CMA N;  2PFU A;  5BPM A;  2ASP A;  2P9P B;  4MO5 A;  5BRH A;  2QEX N;  4IFE A;  1XUP O;  2WFB A;  4CZI A;  3J7Z O;  4YOW A;  3QBX A;  2Q31 A;  4JK9 A;  1RGI A;  5AQJ A;  5GAG P;  4CZE A;  4DCH A;  5M1N A;  3D2F B;  3HZ6 A;  3DWL A;  2P9K A;  3MN7 A;  3FR0 A;  5AQU A;  3O9U A;  2E20 A;  1X9J A;  4CZH A;  1OVY A;  3MN6 A;  3D2E A;  3VF6 A;  4H03 B;  2P9N A;  1NGE A;  2QWP A;  3B8A X;  3AGK A;  3E9P A;  3CCS N;  3VEY A;  4BR7 A;  3AAQ A;  3D6R A;  3O8M A;  3UKU B;  4BR4 A;  3VGM A;  2GEL A;  3CJA A;  4IOX A;  4H0O A;  5BN8 A;  1TUU A;  2D1K A;  3VTH A;  3R3L A;  4FSV A;  1K8K B;  1QQM A;  2P9U A;  2Q97 A;  4FWQ A;  5JLF A;  3WUH A;  4H5T A;  1S22 A;  3CPE A;  3ZET A;  1ATS A;  4B1X B;  4L3Q A;  4A57 A;  5CHI A;  3CC4 N;  3H46 O;  3QDK A;  4JD2 A;  3SAH A;  1YAG A;  3CJB A;  4YOV A;  1VQO N;  2FSN A;  4OO1 J;  3M6G A;  5FPN A;  3TSQ A;  3DLL L;  4CZG A;  1HX1 A;  1SQK A;  1NLV A;  2YJE A;  3CJC A;  4H0T B;  1T6C A;  2ZGZ A;  4CBU A;  1CZA N;  4WFA L;  4GNI A;  3E9O A;  4B1Z A;  4M63 C;  4BR2 A;  3DJC A;  2QA4 N;  1YJ9 N;  1ZBS A;  3AY9 A;  4BRE A;  1NGF A;  3HRG A;  4IOA L;  3KWG A;  4E1J A;  2E88 A;  4FWS A;  3RSE B;  4BRP A;  3EE8 A;  2HBJ A;  4RWT A;  5I9E B;  3F5T A;  1BO5 O;  3CCQ N;  3GDQ A;  3JS6 A;  5HOO A;  1JJ2 M;  2BUP A;  4QS9 A;  1DEJ A;  5C10 A;  5AZI B;  3N4P A;  3QFU A;  3G71 N;  1YF5 L;  4YOY A;  4BGA A;  2V52 B;  2GUP A;  4QS8 A;  3WXJ A;  3SMS A;  4A5A A;  4DHY A;  3ULE A;  5AQF A;  1QQO A;  5AQM A;  1RDW X;  4K42 A;  5EX5 A;  3CCM N;  3VF2 A;  4RCH A;  2FSJ A;  3LDP A;  3FGU A;  4MO4 A;  3KHY A;  5C2D A;  3ID8 A;  5AQT A;  3BP8 A;  4A2B A;  4JKH A;  3ZYY X;  1NGJ A;  1DKG D;  2CH5 A;  4B1W B;  1GLJ O;  5LJV A;  2ITM A;  5AQY A;  4DQ8 A;  1Q86 O;  3FZM A;  2EWS A;  4A5B A;  2KLA A;  3U9D A;  2F9T A;  2YJF A;  4YOT A;  1GLE G;  4CBX A;  1VQL N;  4G9Z A;  3I8B A;  2E2N A;  1QZ6 A;  2A41 A;  1N8R O;  3WXM B;  3BF1 A;  1P8Z A;  3L6Q A;  4FWN A;  1BDG A;  3GBT A;  5AQH A;  1U6Z A;  2HOE A;  3NVK A;  3A0I X;  3O1B A;  4K25 A;  4NB4 A;  2VGM A;  3ATU A;  4EHU A;  2Q0U A;  5C0Y A;  2HBM A;  5F2R A;  2BTF A;  4C1N K;  3QIC A;  1D4X A;  4ISG A;  1X3M A;  3O9Q A;  3VOV A;  3ENO A;  2E2Q A;  3K9J A;  3IFR A;  3VET A;  3QB0 A;  2YI1 A;  3MMV A;  1NGH A;  2ZGY A;  3ENH A;  3QBW A;  4BRO A;  5AQR A;  3JXU A;  4O8U A;  4ISF A;  5ELZ A;  3CJ7 A;  3LM9 A;  3SBT A;  2IVO A;  3SK3 A;  3VES A;  4CD3 A;  4U67 L;  5H1S Q;  4PL8 A;  5FPM A;  3PIO L;  3DXM B;  1T44 A;  5AZI A;  5BRD A;  3FZF A;  5GAD P;  5M1Q A;  2P9S B;  5DM6 L;  3CCV N;  3NVM A;  4BQL A;  3NMU A;  4FWL A;  2P9I A;  4ILJ A;  5AQP A;  4BRL A;  2WC9 A;  1NMD A;  4CI6 A;  4H0X B;  3A5N C;  1QQN A;  4WQ5 A;  3MWP A;  1KD1 O;  1TYQ A;  2QM1 A;  3MK6 A;  3WXK A;  5KQD A;  1NGD A;  2A5X A;  1BOT O;  3VEV A;  4WYB A;  3SAG A;  1KAX A;  1EQY A;  2NRX A;  2ZJP L;  3CER A;  3VGL A;  3ZEU A;  4CJ7 A;  1Q18 A;  3WQT A;  4BRH A;  3HBT A;  2E2P A;  1TUY A;  3EN9 A;  1WUA A;  2QWN A;  5AQN A;  3Q7B A;  5AQW A;  4H5V A;  4NLB A;  3TSP A;  3C6H A;  3VTI A;  3CME N;  4MLE A;  2HBK A;  3CET A;  4O5F A;  4A61 A;  4CZF A;  1HUX A;  5EY4 A;  3G6E N;  5EOY A;  2BH1 A;  1GLC G;  4JKG B;  3VF4 A;  1HLU A;  4BGB A;  3RVC A;  4A59 A;  4BR0 A;  4FPA A;  3C6A A;  3H3N O;  4FWK A;  4EFH A;  5GIO A;  2AA4 A;  4FWP A;  1BA1 A;  4IO9 L;  2FLO A;  5EVZ A;  3M3Z A;  3H45 C;  3I33 A;  2QTD A;  3J8A A;  3O08 A;  3VMF B;  2Q1N A;  5KPZ A;  3O1W A;  3G25 A;  2QWL A;  2E1Y A;  2YHY A;  1YIJ N;  3SAF A;  5AQK A;  1QHA A;  1JCE A;  4OPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...