4Y1CA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
145
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase binding protein
molecule keywords Integrase
total genus 50
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1cA00
3LAMA 1S1XA 5SWMA 2XHBA 1TK8A 1L3SA 2A1SA 1C6VA 1LAWA 1TL3A 3EY1A 5KGWA 3QNNA 1S6QA 3PO4A 4CE9A 3SQ0A 3PX4A 3LANA 3LPUA 3AA5X 4B9TA 1Z25A 2E6MA 4DQQA 4ZHRA 3L2WA 3D0PA 3RWUA 4DF4A 1X9WA 3SCXA 4CECA 4DLGA 4F3OA 3NH0A 2PYJA 3QLHA 3AVCA 3PV8A 1QSSA 4PUOA 4QOZB 4CIFA 4W5QA 4B9SA 3KJVA 3OY9A 1EXQA 3I0SA 3L3VA 1B92A 4CFAA 1O1WA 1CZ9A 4PY5A 1BQMA 2BANA 3NF7A 1BCMA 4RW8A 1XWLA 3AV9A 1VSDA 3QNOA 2JGUA 1J54A 4M45A 4FLWA 1I3AA 3L2RA 3TAMA 3VA0A 1U49A 4FZYA 1IO2A 1WSIA 1ZBIA 4KTWA 3NGYA 2IOCA 4CHNA 3KLFA 1KFDA 4IFVA 4DS5A 1BHLA 3T19A 2HVHA 3O3HA 4WE1A 1Y97A 2PY5A 3IG1A 1CXUA 2ZE2A 4N5SA 3P83D 4QAGA 1RT3A 1RT4A 3KK2A 3QO9A 3F73A 1S9GA 3AVJA 3ZSVA 4FLXA 3V81A 1X9MA 3QEPA 3LP2A 1RTHA 3EYZA 4ID5A 3NDKA 4FXDA 4JRPA 4HUGA 2KTQA 2IGIA 2VG5A 4FYDA 1VSKA 1Z26A 3K58A 1KLNA 4M3XA 1LWEA 2DFEA 1JLGA 3AO4A 1FKPA 3AA4A 3AVGA 3TAGA 3L2QA 1RBUA 1HYSA 5JS1A 4GVMA 3OJUA 3V1OA 5J2PA 2HNZA 4KB0A 3ZSWA 3SQ2A 4FW2A 4RW4A 3LPTA 4CK2A 4LSNA 3ZT4A 4Z4CA 2Z1JA 1XHXA 4FLTA 5HRRA 4CGFA 1C0TA 4DTOA 1UA0A 3NF8A 2DTUA 4ICLA 4RW9A 2FBXA 1D8YA 1C1CA 3MEDA 4F2RA 2D0BA 1VSLA 3V4IA 5KRSA 1RT1A 3V9WA 3VQ5A 5C25A 3H08A 5HROA 1G15A 1L3UA 4DQIA 1ASWA 2HHSA 1NJYA 3TAEA 1L3VA 1A5VA 3AVMA 4DSIA 2XRIA 4KTZA 5KI6A 4DU1A 1D9FA 2KZZA 5KGXA 3AVIA 3SUNA 3LP3A 5DMRA 4CEDA 1QTMA 2G8UA 2IC3A 4FJXA 4B8CA 3K5OA 4AHTA 3LZJA 3SUPA 5CYMA 1L5UA 3K5MA 3B6OA 4KI6A 1RDDA 2D5RA 3CFRA 3CQ8A 4F2SA 1SV5A 4CJSA 5SZTA 3OYNA 1JXBA 4ZTJA 1U04A 3S9HA 2OZMA 4QCLA 1RBRA 2OPPA 1VSMA 2EHGA 1CZBA 3VA3A 2F96A 4IFYA 4ZTFA 4M3YA 4F8RA 2Z1HA 4KRFA 4CJVA 1ZBLA 4DQSA 4AHVA 4M3UA 3AO5A 1QS4A 3M8SA 1JLQA 1S1TA 1NKBA 1IG9A 3IAYA 2G8VA 2RPIA 4DSKA 4CEQA 1C1AA 3NHGA 4HCBA 1HPZA 3VQCA 1SKSA 1EX4A 4CHPA 1UAXA 1WSEA 4CEAA 4FLZA 1TKTA 3PO5A 4O0JA 3SPZA 4FJNA 3HSTB 2QKKA 3ASMA 1NK5A 3L2UA 1N5YA 1LWFA 2VG6A 2FBYA 4E7LA 1TK5A 2YHBA 1RDBA 2BE2A 1IH7A 2O4GA 3KTQA 2Y1IA 4FJHA 1TL1A 1F21A 3KLEA 1RTJA 1GOAA 1NJWA 4L8RB 2XY8A 4B3OA 3KK1A 3E01A 3V9ZA 1SKWA 4O5BA 4BDPA 1TKXA 1T8EA 1U48A 4Z4EA 4M3WA 2X74A 1HQEA 3LP0A 4G1QA 4ID1A 2ZD1A 4OKJA 4EP4A 4DTJA 3RMAA 3D45A 3ULDA 3HPHA 5CZ1A 2AJQA 3AVNA 2YKMA 1Q8IA 1BL3A 4E7IA 3NGIA 5E41A 2B4JA 4CJTA 3OYBA 4OGEA 4LY7A 4B08A 4N47A 3DLEA 4CJLA 3SV3A 1JLBA 5I42A 4FZXC 3DRRA 4DSFA 2PZSA 1NK0A 1KVBA 1IKVA 2OPRA 4AHCA 4KB1A 1C0UA 1JLAA 3SJJA 4FK2A 4E19A 1RNHA 3M8RA 3CYMA 2P5GA 1TAUA 4CJ3A 1S5JA 1YTAA 1KTQA 3OVNA 4CJEA 4DSJA 1ZBHA 2PYLA 1VRUA 4LH5A 2BGGA 3T3FA 2HVIA 4HCCA 1JL2A 4CIGA 1KFSA 3MEGA 2FBTA 3NH1A 4W5OA 5HRSA 4E0DA 1BCOA 3PY8A 1IKXA 3K5NA 3P1GA 1QSLA 4KHWA 1HNIA 1HQUA 3ITHA 3ZSYA 4KKOA 2OPQA 3QIPA 5FROA 1JXEA 4JS4A 4M3TA 2Y1JA 2ETJA 4B9UA 3BGRA 1IKWA 1BI4A 1QQCA 3NBPA 4I9LA 3ZT1A 4E89A 4BE2A 2IS3A 3SQ4A 3TABA 1NKEA 4K8XA 4F4KA 3AVAA 4HVJA 2ZQBA 4FM0A 2D0CA 5CZ2A 2WOMA 3QETA 2QKBA 1QSYA 3TARA 3U3GA 3K57A 1Q9XA 4Z4FA 1GOBA 3HM9A 3RMCA 2YNHA 1U4BA 1J5OA 4CFBA 4CERA 3AVKA 4NCGA 1EP4A 4H4OA 5CYQA 4FW1A 4C8LA 1KLMA 4PA1A 3HT3A 3OYGA 1TKZA 3QERA 2I5JA 2G8WA 3K59A 2E6LA 2KW4A 1YTUA 1K6YA 4KHYA 3VQ8A 2G8HA 2KFZA 1L3TA 4CFDA 3DLGA 4N41A 1I39A 3ALYA 4DTSA 3CM5A 1TK0A 1QE1A 4I2PA 4DU3A 4OPJA 1RCHA 3VQ9A 3VQBA 1CXQA 4KHSA 1W9HA 3SYZA 1VSHA 4CF8A 4E1NA 4HUEA 2Q3SA 4CEBA 4RW6A 4KO0A 3HP9A 1UA1A 3OYLA 1KSPA 3V1QA 1HJRA 3O4QA 4E7JA 4CGJA 3KLGA 2GUIA 1YVUA 3QINA 3DOKA 3WNGA 1TVRA 4BE1A 4N76A 4KHQA 4Z4GA 3SQ1A 4C8OA 4KTQA 2GBZA 1DTTA 3ZSXA 4CGGA 1GOCA 2HHWA 2A1RA 1WN7A 3I0RA 3SNNA 1ZYQA 3NE6A 1EKEA 1TKDA 2DFHA 1BQNA 2HHVA 3AVFA 3ZCMA 4DSLA 4Q0BA 4HUFA 1JLCA 4M42A 3VQ6A 1HRHA 3PUFA 3LWMA 3LDSA 2LSNA 1JLEA 4B9MA 1JKHA 4AHUA 1Q9YA 4FJMA 1KRPA 4FLVA 3TAPA 1VSFA 3FFIA 4FZZA 3RRHA 1VRTA 4CF1A 1SL0A 3MXJA 4OPKA 3HL8A 3SUQA 1T05A 2HMIA 3DRSA 2HHUA 1NJZA 1ZBFA 4O55A 2GV9A 3WNFA 1J9AA 4HTUA 3LALA 4H8KA 1VSJA 2YHAA 4OLAA 4PWDA 3MXMA 3V9SA 3IRXA 4CF0A 4CJFA 4Y1DA 3HPOA 3TAFA 3NF9A 2VWKA 4KHNA 3ZSOA 3HO1A 3L3UA 1HMVA 3ZSQA 4LH4A 1IKYA 1QHTA 4RW7A 4CJWA 4W5NA 4GMJB 5J1EA 2KQ2A 3AVHA 3DMJA 2HHXA 3LP1A 3OS1A 4FCYA 1LW0A 3OYJA 3KLHA 3JSMA 4PQUA 3HPGA 1TGOA 1WLJA 4OVLA 3U6FA 1NKCA 4OJRA 2P51A 1REVA 1U47A 4J2BA 3NAEA 1WNSA 1RT7A 4DU4A 4BDYA 1JL1A 3OYKA 1TAQA 3U3YA 4CF2A 3DLBA 2P5OA 4B9LA 2F8TA 4DS4A 4C8KA 4C8MA 3WNHA 3PX0A 4FJKA 1NK7A 4KHUA 3KKSA 3L8BA 3LZIA 1FKOA 5J2QA 3DLKA 5HBMA 3AVLA 4IG3A 1LWCA 2FBVA 3ZSZA 4O0IA 1MU2A 3TANA 4LSLA 1BGXT 4DTUA 4CHOA 5KRTA 5HP1A 4AILC 1J53A 4KREA 1NK4A 1CLQA 4FM1A 4KFBA 3MXIA 2DY4A 1S6PA 5KTQA 2HNYA 4I7FA 3V1RA 4CJ5A 1XI1A 2G8KA 2B6AA 4IKFA 1RBVA 3HK2A 3EZ5A 1LAVA 1RT6A 3WNEA 3DLRA 4DTXA 1X1PA 4B8AB 4M3RA 4CK1A 3KK3A 5D3GA 4N56A 4FJJA 4W5TA 1KVAA 1FK9A 4KV8A 3LAKA 5HRNA 3DM2A 2HHTA 1NJXA 4MFBA 1RT5A 4I9QA 2YNFA 1ITGA 3VN5A 4CJQA 3AVBA 3NGZA 4Z4IA 2ITGA 3NCIA 1YT3A 5HLFA 4BACA 3SUOA 3SZ2A 3DRPA 1S9EA 3QIOA 4E7HA 3AA3A 3SPYA 1NK8A 4KI4A 2G8IA 3OYIA 4CIEA 2HNDA 4DFJA 1LW2A 4TSXA 1HYZA 1T03A 5EU7A 2OA8A 4CJ4A 3O4NA 3HXMA 4DQPA 4CGHA 3KIOA 3DLHA 2XY6A 1DTQA 4M3ZA 4FK4A 3AA2A 1RILA 4KPYA 3NH2A 1UWBA 3VQDA 3OYCA 3MEEA 2YNIA 3RMBA 1X9SA 1NK9A 3RRGA 4OGCA 3V9UA 4OLBA 3MECA 1NOZA 3ZSRA 4FJGA 5T7BA 1S1VA 1HYVA 4K8ZA 3ZT2A 4DFMA 3OYFA 1WAFA 1TV6A 3B6PA 4DF8A 3THVA 4C8NA 4FJ7A 2YV0X 1BIZA 4CJUA 4FJ9A 1SL1A 4CK3A 3DOLA 2OYQA 3PX6A 1VK0A 3HVTA 3BDPA 3LWLA 4CJPA 4CGIA 3P5JA 5C42A 4DFPA 4F3TA 1C0MA 3RMDA 4R5PA 3NF6A 3MAQA 1HNVA 1WSGA 1BISA 5FDLA 2RKIA 3C6UA 3O3GA 3I8DA 3QEVA 2HHQA 4DQRA 3TWHA 3QEWA 3OYMA 4DTPA 1DLOA 1UOCA 3CG7A 4AH9A 4DLEA 2JLEA 4CHZA 3OJSA 2XY5A 3S3NA 3HVRA 4FJLA 4RG8A 4EZ9A 4Z4HA 5CY4A 4CCHA 2Z1GA 3AO2A 1B9DA 3F9KA 3V9XA 1B9FA 4DWIA 4UQGA 2YNGA 2HW3A 4FJ8A 4CEZA 4GW6A 5HRPA 1S1WA 4O4GA 4FJ5A 3DI6A 1RDAA 2NUBA 3HP6A 4Z0UA 2F8SA 2HB5A 1RBTA 2DFFA 1XC9A 5FRNA 5FRMA 4B9VA 3K5LA 3ISNC 2EX3A 2P1JA 3RTVA 3QEIA 1RBSA 2X78A 4CHYA 4FLYA 4FVMA 4FJIA 3M8QA 1VSIA 4JLHA 2VWJA 4I2QA 3K2PA 3SV4A 5J2NA 3AO3A 1JLFA 2G8FA 4DTNA 3CFPA 3VQAA 2KFNA 4CEEA 4E1MA 4DTMA 4BE0A 3DYAA 1SKRA 4ELUA 2RF2A 1T7PA 4JS5A 4AHRA 2FC0A 3C6TA 1RTIA 3C94A 3VQ4A 3CFOA 4FM2A 5DK5A 4ELTA 4E7KA 3KD5E 4DFKA 3OS2A 3OYEA 3A2FA 4MQ3A 1LV5A 4CHQA 1A5XA 3VQEA 4CEOA 1D5AA 2QK9A 4J2DA 3NFAA 2IAJA 3O3FA 1R0AA 3IS9A 1VSEA 4YNQA 2BDPA 4JRQA 3KKRA 1WSHA 3QEXA 3M8PA 1BI4B 1BIUA 4IBNA 5C24A 3RR8A 4LD0A 3UIQA 3OYAA 4ELVA 3G10A 4NYNA 4E3SA 4OKKA 3AO1A 4M41A 3KLIA 3VQQA 1NK6A 2ATQA 4OKEA 5J2MA 1RT2A 3ZT3A 3TAQA 3RR7A 4NCAA 2XY7A 1ASVA 2X6SA 2E4LA 2Z1IA 2D0AA 4BWMA 4EP5A 2VG7A 3ZT0A 2WONA 3VQ7A 4CFCA 1U45A 1WAJA 4J2EA 1ASUA 4CJRA 4KAZA 3HJFA 4CGDA 5JS2A 5I3UA 4CF9A 2R7YA 1RTDA 1N6QA 2X6NA 2RN2A 1FXXA 2YKNA 3T1AA 4NCBA 3OYDA 4EZ6A 2KZMA 1C1BA 2B5JA 3HYFA 3QESA 4O44A 3G0ZA 3S3MA 4DG1A 3C95A 2W42A 3S3OA 2OZSA 4YFUA 1SUQA 4XIUA 3OS0A 4NYFA 4Y1CA 3KD1E 4CEFA 4FLUA 4FK0A 4J2AA 4AHSA 1A5WA 1EETA 4CESA 4DTRA 4IG0A 2QXFA 4Q5VA 4CJKA 3L2VA 4BDZA 2O4IA 2IDOA 4W5RA 3CM6A 1NOYA 1W0HA 1XHZA 4H4MA 1KCFA 1D9DA 1WSFA 3OYHA 2XO7A 5K14A 4IDKA 4BWJA 1ZBUA 4DMNA 4HHTA 4DSEA 4B9NA 3VQPA 2OPSA 3TI0A 1S1UA 3JYTA 1SL2A 1RDCA 3TR8A 1WSJA 1KVCA 3V6DA 3SI6A
chains in the Genus database with same CATH superfamily
2XHBA 2A1SA 1LAWA 4CE9A 5BPLA 3PX4A 5AQHA 4B9TA 3CI5A 2WFBA 3A5MC 1X9WA 3CQYA 3MCPA 4CIFA 4W5QA 4DUZK 3VF6A 1EO1A 3EZWA 3O9UA 3WQUA 3A0IX 3L3VA 1YF5L 1BCMA 3AV9A 4XH4A 3QNOA 1JCGA 1YJNN 4M45A 4FWQA 3VA0A 4WQ4A 3N4QA 3GOIA 4KTWA 3NGYA 4CHNA 1KFDA 4DR2K 4NXMK 1Y97A 3C65A 3FZFA 1RT3A 4FXDA 3LP2A 4DV0K 3R9PA 3JS6A 1VSKA 5I9EB 4KH4A 5JS1A 4GVMA 3OJUA 5AQNA 5J2PA 5LMNK 4CK2A 3M1FA 3SBGA 3ZT4A 4FLTA 1C0TA 4BRGA 4DTOA 2EWSA 4BG8A 2DTUA 2E88A 1C1CA 4F2RA 2D0BA 4M7YA 2P9NB 4DQIA 1NJYA 1A5VA 5KI6A 1NGFA 3N4PA 2G8UA 3K5OA 2ASMA 1SV5A 1QQNA 1U04A 2OPPA 2EHGA 3VA3A 4F8RA 1Q81O 4KRFA 4CJVA 1ZBLA 3U9ZA 3IAYA 2KTQA 2RPIA 4CEQA 2H3GX 3D7EO 3CCSN 3NHGA 3IKMA 3PIPL 4FLZA 3PO5A 4JI4K 4O0JA 3WEEB 3SPZA 3HSTB 1N5YA 4LF4K 1LWFA 4E7LA 4JI0K 3E9OA 4H5TA 2Y1IA 3O1BA 4BRQA 3KLEA 2O8DB 1GOAA 1NJWA 2XY8A 3V9ZA 2UXBK 5AQRA 1T8EA 4WFNL 1IV0A 4M3WA 1HUXA 4G1QA 3AGKA 4YOXA 4DTJA 4JI5K 1OKJA 4E7IA 3NGIA 5E41A 1Y64A 3SV3A 1JLBA 5AZIB 4BRIA 3DRRA 1NK0A 4AHCA 4C1NK 1C0UA 3WXLA 3SJJA 2I7NA 4FK2A 2V7ZA 4YDUC 2P5GA 1S5JA 4DSJA 1KTQA 2PYLA 4DR5K 1VRUA 4KH6A 5AQWA 4LH5A 2BGGA 1JL2A 4FWLA 3G71N 4E0DA 1BCOA 5LJWA 1IKXA 1HNIA 5LY3A 3HM8A 2Y1JA 3NBPA 4H0PA 1XMQK 1WBBA 1ZBSA 4K8XA 1TUYA 4BC3A 4JKGB 2Q97A 2ZQBA 1M1KO 2Q0RA 3EL2A 3S41A 3QETA 2O8CA 3HM9A 4EFHA 4NB4A 1OH8A 4NCGA 4M63C 5CYQA 4PA1A 3OYGA 3O80A 3EO3A 1V4SA 1K6YA 2WC9A 2G8HA 3VPZA 1I39A 1JCEA 3CM5A 1TK0A 1QE1A 4DU3A 4OPJA 3VQ9A 3SYZA 3VEXA 4CBXA 4E1NA 2UU9K 3HP9A 1VQMN 4E7JA 3ZEUB 3KLGA 3QINA 3DOKA 4Z4GA 2ZGZA 1DTTA 3SLCA 3ZSXA 4CD1A 3HTVA 3VGKA 4CGGA 3NE6A 2HHVA 3AVFA 3TTFA 2CGKA 4HUFA 3DLLL 4M42A 1HRHA 5FPNA 1Q9YA 4FJMA 1KRPA 3TAPA 1SL0A 3QB0A 4FWNA 3HL8A 3SUQA 1T05A 3ID8A 1ZBFA 4CZKA 4PHTX 1J9AA 4HTUA 3CMAN 4OLAA 4IO8A 5M1OA 4PWDA 3VTIA 4CF0A 3HPOA 5ADXA 2VWKA 3HO1A 2YJEA 3L3UA 4BR2A 4GKJK 1QHTA 4CJWA 3AVHA 2HHXA 3OS1A 3OYJA 3KLHA 3JSMA 1TGOA 1WLJA 4OVLA 3ZX0A 2E5LK 1U47A 1NNEA 1JL1A 3OYKA 4B3MK 2F8TA 2ITMA 1KAZA 4DS4A 1GLCG 2GWKA 4FPBA 3KKSA 3L8BA 3A5OC 3BY5A 3D6RA 3CJCA 5HP1A 4CHOA 4ILGB 3ZX3A 3IMXA 5EX5A 3AAQA 1S6PA 5KTQA 3R6MA 1XI1A 4KHPK 2HMPA 1RBVA 4B3TK 4CK1A 1ATSA 4W5TA 3DXKB 4IOXA 3WXJA 2VCPA 4CZFA 3AVBA 4DV3K 1YT3A 1S9EA 4E7HA 3AA3A 5HL7L 1XQSC 1QQMA 3HXMA 4DQPA 4CGHA 5AQLA 1K9MO 1QZ6A 4FK4A 4KPYA 4IDHA 3DWLA 1UWBA 3RRGA 2YNIA 4FOIA 1HPMA 3TSQA 1NGIA 3G4SN 4C8NA 2YV0X 4CJUA 4CK3A 3K9JA 3ZX2A 2OYQA 1VK0A 3ULEA 4CJPA 4M7XA 3P5JA 4CGIA 1BA1A 3QBXA 3RMDA 4R5PA 3NF6A 3MAQA 3O3GA 1WSGA 3C6UA 2HHQA 4DTPA 2JLEA 3OJSA 4FJLA 4Z4HA 3HOTA 1U6ZA 3U4LA 1NMNA 1C0FA 4UQGA 2QI2A 1S1WA 4O4GA 4FJ5A 1N32K 3DI6A 4E1JA 4MLEA 4B3RK 2HF3A 5AQPA 3HP6A 4Z0UA 4CVNE 1RBTA 1XC9A 4CZGA 5GADP 3QEIA 3BZCA 1RBSA 4CHYA 3M8QA 4JLHA 3K2PA 3MN6A 4DTMA 2P9PB 1SKRA 1YHQN 3ZEUA 2FC0A 1RTIA 4K41A 4ELTA 2OTLN 2V52B 3W0LA 1VQ9N 1A5XA 5H1SQ 4U7BA 3KWGA 1VSEA 1NM1A 4H5RA 3H3NO 5AFUA 4LD0A 3UKUB 1T6CA 5GINA 4NYNA 3BF1A 1OVYA 4OKKA 3AO1A 3DXMB 4E3SA 4BROA 3PIOL 4OO1J 4OKEA 5EY4A 4EAHD 4BRMA 2Z1IA 4BWMA 4EP5A 3H3OB 3ZT0A 1YITN 5C2DA 4J2EA 1WAJA 1ASUA 4CBUA 4CJRA 5AQVA 2QW9A 4CF9A 1RTDA 2X6NA 2RN2A 1IJJA 1JCFA 1FXXA 3CC4N 3OYDA 3LDLA 1C1BA 2ZJQL 3NMUA 3HYFA 3QESA 5KQDA 2RE2A 1P90A 4NYFA 2QM1A 3WQTA 5BPNA 2QXFA 5AZJB 3CQXA 4CJKA 3L2VA 2P9IB 4IEEA 2IDOA 1NOYA 1XHZA 2JWLA 1KCFA 5ADXH 3T69A 4PL7A 4BWJA 4X66K 1ZBUA 3CF5L 5AQJA 4B9NA 4FWRA 1BUPA 3V6DA 4DKWA 2CGJA 3TTDA 1C6VA 1TL3A 3FZKA 2ZF5O 5KGWA 3PO4A 3WXKA 3LANA 3AA5X 5DM6L 2E6MA 3RWUA 4ZHRA 3L2WA 1NLVA 3MX5A 4F3OA 1SZ2A 3MWTA 1HJOA 2ASOA 2PYJA 3AVCA 4PUOA 4WQ5A 2UYTA 4A5AA 4CFAA 2CGLA 3G25A 3I8BA 1CZ9A 5AZIA 1BQMA 2BANA 1TYQA 2IVOA 1VSDA 3HOSA 2JGUA 4FLWA 1ZBIA 3TAMA 3AGRA 4FZYA 3E9PA 2GX9A 2IOCA 2BTFA 4WQ5C 3SAHA 2HVHA 3ID6A 3O3HA 4N5SA 4HTLA 1RT4A 4FLXA 3NDKA 4YOYA 4HUGA 3L4QA 4CZLA 1BOTO 2HBJA 2VG5A 4U67L 4M3XA 1FKPA 3AA4A 2HNZA 3B8AX 3ZSWA 3DXMA 4FL9A 5MLCQ 4LSNA 3CCJN 3HBTA 4CGFA 3NF8A 2QWNA 3MEDA 1VSLA 5KRSA 5KPZA 3H08A 5AR0A 4PKIA 4DV6K 2O8CB 2HHSA 3EE8A 3ZLJA 5B8HA 4X64K 3TAEA 1L3VA 3AVMA 3SK3A 4DSIA 1QZ5A 3ATVA 1W2BM 3VENA 2KZZA 3AVIA 3SUNA 3LP3A 1LCUA 4FJXA 3RSEA 3SAGA 2BH1A 5CYMA 1L5UA 4KI6A 3CQ8A 3BEXA 1FW6A 5SZTA 4ZTJA 1JXBA 2OZMA 5AQSA 4QCLA 1VSMA 3L0QA 4IFYA 2YJFA 1IBKK 3CC2N 1XMOK 3AO5A 3F9MA 1JLQA 1S1TA 5M1KA 1NKBA 2G8VA 5AQZA 1J5EK 4HCBA 4DV1K 1YI2N 1ILYA 3ASMA 5KQ8A 2QWQA 2VG6A 1TK5A 4OX9K 3SMPA 3GDQA 2YHBA 1IH7A 2O4GA 3VEVA 3GG4A 1LOTB 4B9QA 4B1ZA 4DR7K 3KK1A 2P9LA 2KKZA 2VGNA 4BG9A 3TSPA 4BRFA 4BRCA 2ZWHA 2ZD1A 4EP4A 2QA4N 3D45A 3DXKA 1BL3A 4CJTA 3OYBA 4OGEA 4YOTA 4H5WA 2NRWA 4BGBA 4DSFA 1T44A 1IKVA 2GTDA 4K43A 3E66A 2NZTA 3QBWA 4AM6A 5BREA 3CYMA 4CJEA 1ZBHA 3OVNA 2Q31A 4EHUA 1HX1A 3QICA 5M1FA 2VGMA 3G6EN 1Z6RA 1XNRK 3CC7N 4CIGA 4DR4K 3PY8A 3K5NA 4XH1A 4B1VA 1QSLA 4M3TA 5FROA 1JXEA 4I9LA 3ZT1A 1NKEA 3SQ4A 2IS3A 1K73O 3AVAA 2F9TA 4FM0A 1HNWK 2QKBA 1QSYA 3TARA 2VQEK 4O8KA 1U4BA 2E2PA 3LL3A 4C8LA 3O9TA 1TKZA 2G8WA 3K59A 4V19S 1YTUA 3THXB 2KFZA 1D4XA 4CFDA 2ASPA 2WUSA 3ALYA 5C10A 4H03B 3O6WA 1RCHA 1G99A 1BG3A 1W9HA 3SAFA 1VSHA 1WB9A 1YIJN 4BRHA 4RW6A 4KO0A 4CEBA 1UA1A 1ATRA 1KSPA 4CGJA 2NNWA 5FLXO 3VEWA 3WNGA 4BE1A 3SQ1A 5C0YA 3P39A 4KTQA 3OTOK 2GBZA 2E8AA 1BQNA 5F0XA 3CCQN 1DEJA 1JLCA 1P8ZA 3ULEB 3LDSA 5GIPA 1X9JA 4JKGA 4FWPA 3D2FB 1EQYA 3FFIA 5BRDA 2IVNA 2E2NA 4MDAA 4OPKA 3IFRA 2HMIA 3HI0A 2GEMA 4J8FA 2A41A 3LALA 4H8KA 1VSJA 1DT9A 4K0KK 4KHNA 3ZSQA 3THWB 4LH4A 1IKYA 2P9PA 4RW7A 4GMJB 2KQ2A 5BN9A 3LP1A 4AF1A 4PQUA 3FZHA 3SJHA 3U6FA 4OJRA 1REVA 2VWBA 3NAEA 2HSTA 4J2BA 4HWIA 3U3YA 4C8KA 5EVZA 4KHUA 1NK7A 2GWJA 3LZIA 1FKOA 5J2QA 3AVLA 3H1VX 1LWCA 1VAZA 3TANA 4YOWA 4LSLA 4DTUA 2HBLA 4AILC 1J53A 3OBWA 3O8MA 4C23A 4FM1A 3R3LA 2HNYA 3V1RA 3EZ5A 1RT6A 3WNEA 4DTXA 4B8AB 5JMVA 1GLBG 4KV8A 5AJ3K 2RHKA 4MFBA 1GLAG 1RT5A 4I9QA 3VN5A 4CJQA 1RGIA 4BR5A 3T1YK 2ITGA 1GLEG 1I94K 3NCIA 4Z4IA 5HLFA 4YY3K 5M1NA 1NWKA 1E4FT 3QIOA 2G8IA 2F4VK 4CIEA 4TSXA 3LDNA 1HYZA 1T03A 4CJ4A 3BUZB 4BR9A 3O4NA 3KIOA 1RILA 4QS8A 2P9KA 2QXLA 3NH2A 1N36K 4OGCA 3UKRB 3MECA 4A5BA 3P4IA 4BRNA 1HYVA 4JI1K 3ZT2A 5KPRA 4XH5A 1TV6A 4DF8A 2NRRA 5AFUH 4FJ7A 4FJ9A 2E1YA 1BO5O 1S22A 4A57A 5BR9A 3CPWM 3FGUA 4B1YB 1HNZK 3QEVA 5FDLA 2RKIA 2P9LB 3TWHA 3QEWA 5KPTA 1UOCA 4DLEA 3HVRA 4EZ9A 3QFPA 4H0VB 1Q7YO 3NVMA 4FJ8A 4GW6A 4LFCK 5HRPA 4X65K 2F8SA 5LMUK 1BA0A 5FRNA 3QDKA 3D2EA 2EX3A 1RFQA 3BP8A 4RWTA 3R1XA 3D2EB 3O9RA 1VSIA 2VWJA 2G8FA 1TAUA 1U2VA 1T7PA 1VQKN 4KBOA 4BVOA 3C6TA 3C94A 3EEQA 2Q0UA 5DK5A 5FPDA 4DFKA 2Q2RA 3OS2A 3OYEA 3HRGA 4IWVA 1LV5A 1SQKA 4JYAK 2A42A 3O5BA 4CEOA 1D5AA 1ZC6A 1N34K 3NFAA 1R0AA 4YNQA 2BDPA 2JWKA 1K8KB 3KKRA 3QEXA 4BC4A 1BI4B 5C24A 1MWKA 3OYAA 1KQSM 3KLIA 2HBKA 4LF7K 3A8YA 5TKWA 5J2MA 3THYB 3ZT3A 2XY7A 1ASVA 5BRHA 2D0AA 2VG7A 3FE1A 5AQKA 3VERA 2AP1A 4KAZA 3HJFA 4JKEA 2QTDA 5JS2A 2R7YA 1N6QA 1OVQA 5EOYA 3MX2A 1QVGM 4FVUA 2GUPA 2YKNA 4NCBA 4JNEA 2FF6A 4A2BA 3J7ZO 1VQ7N 1W97L 2B5JA 3G0ZA 3THXA 2YI1A 3C95A 2W42A 4YFUA 3OS0A 3WXMB 4CEFA 4KH5A 4FPAA 5ELZA 1A5WA 2A40A 4CZEA 4DTRA 4IG0A 5C12A 3MK6A 2WTUA 4Z94A 3CM6A 5BN8A 1WBDA 3EN9A 1W0HA 1D9DA 4H4MA 4JKDA 3OYHA 4CW7B 2XO7A 3WEEA 3VGLA 4NO7A 2D4WA 3M6GA 3TI0A 1SL2A 1RDCA 3TR8A 3LAMA 1S1XA 5SWMA 2QWRA 1TK8A 3EY1A 1S6QA 1FJGK 3SQ0A 3LPUA 3JAMO 3CHWA 3D0PA 5AQGA 4DF4A 5BR8K 3SCXA 1VQ5N 3NH0A 3PV8A 1QSSA 4BY9C 1DGKN 3KJVA 3OY9A 1EXQA 3I0SA 1NGJA 1O1WA 3PLAA 3QMLA 1J54A 2HBMA 1U49A 1WSIA 4B1XB 4O8UA 1GLDG 4DS5A 4IFVA 5FPEA 1BHLA 4A2AA 2PY5A 4LFBK 3F73A 3AVJA 3ZSVA 3V81A 3EYZA 4ID5A 4JRPA 2IGIA 3UKRA 3CCMN 4IFEA 3AVGA 3TAGA 3L2QA 1RBUA 1HYSA 4WF9L 4KB0A 4JV5K 4FW2A 2ZM6K 1HKBA 2Z1JA 1XHXA 5F1XA 3H46O 5HRRA 4JAXA 4DB3A 1D8YA 5GAHP 1OH6A 3V4IA 1IBMK 2NRHA 5CR4A 3VQ5A 1L3UA 3FZMA 4O5FA 4DU1A 1H1VA 1QTMA 2O8FA 2IC3A 4B8CA 2OANA 3LZJA 3SUPA 4BGAA 2P9SA 1RDDA 2D5RA 4F2SA 4CJSA 4BQZA 3OYNA 1X3NA 3S9HA 5AQTA 4JKHA 3GBTA 4ZTFA 3CCLN 2F96A 3KHYA 4BC5A 4I6MB 1QS4A 2DPNA 1IG9A 4DR6K 3ENBA 4DQ8A 1SKSA 3TPQA 4CEAA 5AQIA 1OH5A 4ISGA 2QKKA 3L2UA 3OHRA 4JD2A 1RDBA 2BE2A 4FJHA 1TL1A 4OPHA 4B1WB 4L8RB 4B3OA 4DV7K 2A6AA 3THYA 3H45C 3Q7CA 1NBWA 1BU6O 2X74A 1HQEA 4DV2K 3RMAA 3ULDA 3HPHA 5CZ1A 2AJQA 2IIRA 1Q8IA 3O9SA 4LY7A 4B08A 4CJLA 4MO5A 5I42A 4FZXC 1NJIO 2YHWA 4BC2A 3KK7A 3M8RA 4CJ3A 1YTAA 1K8AO 4YORA 2HF4A 2Q36A 2HVIA 3TTCA 5C2FA 4GY2B 3T1HK 3MEGA 3J8AA 5HRSA 3C7NB 4A59A 3O9QA 3P1GA 3C7NA 4KHWA 2ZJPL 3ITHA 4KKOA 2OPQA 5FPMA 4JS4A 4EHTA 3DAWA 1DKGD 2ETJA 3BGRA 4GNIA 1QQCA 4E89A 4BE2A 4FWMA 1QHAA 4YDUA 4F4KA 2HOEA 5E26A 3KZBA 2D0CA 5CZ2A 2WOMA 3U3GA 3K57A 3RMCA 4YOUA 3ZYYX 4CFBA 2W6KA 4CERA 1EP4A 4H4OA 1KLMA 3QERA 3HT3A 2E6LA 2KW4A 4JHDB 4DV5K 4KHYA 1YXQA 3RVCA 1L3TA 1M90O 4N41A 2FLOA 2O8BB 4I2PA 3VMFB 1CXQA 4H0OA 3V1QA 1HJRA 3O4QA 4CBWA 5BRFA 5CHIA 2GUIA 1YVUA 2Q1NA 4NLBA 1TVRA 1W7AA 2FSKA 4C8OA 2KHOA 1SAZA 5JVHL 2HHWA 2A1RA 1WN7A 1ZYQA 4JI7K 4DSLA 4GV6A 3VQ6A 3PUFA 1MDUB 3LWMA 2LSNA 3CJ9A 1JLEA 5M1QA 4FLVA 4FZZA 2HHUA 1BWFO 2A3ZA 2GV9A 4C1NI 3Q7BA 3MXMA 4JHDA 3V9SA 3IRXA 3CIPA 4CJFA 4Y1DA 3TAFA 2PBDA 1VHXA 3ZSOA 1TYQB 1HMVA 5J1EA 3MN5A 4FCYA 3OA9A 4Y0WA 1NKCA 4XEIA 1WNSA 1TUUA 4CZIA 4BDYA 1TAQA 4B9LA 3WNHA 3PX0A 4FJKA 3CPEA 4FSVA 3ENOA 1J6ZA 3UKUA 4WCEL 3DLKA 5HBMA 4JD2B 4LF5K 2FBVA 1MU2A 3KVGA 1BGXT 4R79A 4IOCL 4QS9A 3FLCO 1NK4A 3KWIA 4DV4K 2G8KA 2B6AA 1NK6A 1LAVA 2KLAA 1Q18A 3AY9A 3CERA 5D3GA 4M3RA 4FJJA 4JI6K 1KVAA 3SMSA 5HRNA 4BRAA 1NJXA 1E4GT 2AA4A 3GE1A 3NGZA 1O13A 4BACA 1NGEA 3DJCA 3SUOA 3SZ2A 4KI4A 1NK8A 3FZLA 4F9OA 4DFJA 1LW2A 4JEPA 5EU7A 4NLCA 1HR0K 1DTQA 4M3ZA 3LM9A 4FWKA 3MEEA 1X9SA 4OLBA 1YAGA 3V9UA 3E1YA 3W3DA 3M5RA 3ZSRA 4FJGA 4JKBA 4K8ZA 2PFUA 1ATNA 2FXUA 1VQON 1WAFA 2FSJA 1BIZA 4G9ZA 3DOLA 4JKAA 3HVTA 3BDPA 3LWLA 1KD1O 4F3TA 5C42A 4IEIA 3CCVN 4BVPA 4IO9L 1HNVA 3EKUA 1BISA 3TSUA 2UUAK 3OYMA 1DLOA 3K9KA 4CHZA 4CD3A 4RG8A 2CH5A 3HSCA 3MMVA 1WOQA 5CY4A 4CCHA 1CZAN 1VQ8N 2HW3A 4K42A 2YHXA 2D1KA 2NUBA 2DFFA 5FRMA 4B9VA 1EWRA 4CZHA 2P1JA 4GV9A 2X78A 4FLYA 4DR1K 4FVMA 4FJIA 5IWAK 4WFAL 1N33K 4DTNA 3CFPA 2KFNA 3FFKB 4ELUA 2RF2A 4JS5A 3VQ4A 4A62A 4PKHA 3LDPA 1QVFM 3KD5E 5AQFA 3A2FA 4MQ3A 2QK9A 4J2DA 2IAJA 3O3FA 3IS9A 1Z05A 3MDQA 3M8PA 3VEYA 3ENHA 4ELVA 1RDWX 4M41A 4BQLA 2ATQA 3F2KA 3LDQA 3D2FA 3EE9A 2F9WA 1HLUA 2E4LA 2X6SA 4AQYK 3VGMA 3VQ7A 3A5LC 3AAPA 5A2QO 2NRTA 3C6HA 4CGDA 4MO4A 3HZ6A 3T1AA 4JK9A 3F5TA 3PSFA 4EZ6A 2KZMA 2O8FB 2FSNA 5TKYA 4O44A 2QWMA 2W40A 3VESA 3S3OA 4Y1CA 3KD1E 2W6LA 3ATUA 3EKSA 4CI6A 4J2AA 4IJNA 1EETA 4WYBA 1HNXK 3PSIA 4IXCA 1U2VB 2O4IA 3BZKA 3J7AP 4I6MA 1WSFA 5K14A 4IDKA 4DMNA 1XC3A 1JJ2M 4FWSA 4DSEA 3VQPA 1K8KA 1S1UA 1I3AA 4CZJA 3T19A 4BE0A 4BRDA 1L3SA 3IDHA 3QNNA 1MWMA 4LC9B 1Z25A 3H1QA 3J80O 4DQQA 2O8EA 2P9NA 2A5XA 3T7ZA 4CECA 4DLGA 3QLHA 4QOZB 4DR3K 4B9SA 1IBLK 2IVPA 1B92A 2D0OA 1ESVA 4GKKK 3CMEN 3U8XA 4PY5A 3NF7A 1EWQA 4RW8A 1XWLA 4ILJA 4K25A 3L2RA 1VQPN 3CCEN 1IO2A 2ZGYA 3KLFA 3THWA 3WXIA 4WE1A 3IG1A 1CXUA 2ZE2A 3ZETB 3P83D 3VF4A 4QAGA 3KK2A 3QO9A 1X9MA 1S9GA 5BPMA 4DUYK 3QEPA 1RTHA 2V51B 4CJ7A 4FYDA 1KAXA 1Z26A 3K58A 2QWLA 1NU0A 1KLNA 1VQ6N 1LWEA 2DFEA 1JLGA 3AARA 3AO4A 3BF3A 4DHYA 1ZXOA 1KVCA 4BR4A 3V1OA 3SQ2A 4RW4A 3LPTA 2W41A 3O4WA 4Z4CA 2NRXA 4ILHA 4DCHA 1UA0A 3CCUN 4ICLA 4RW9A 2FBXA 3QFUA 4YHHK 4QS7A 1RT1A 3V9WA 5C25A 2BUPA 5HROA 1G15A 2OCEA 5C15A 1ASWA 1V4TA 4IJAA 1Q82O 2XRIA 4KTZA 1D9FA 3CJBA 5KGXA 5DMRA 4CEDA 3VETA 4GV3A 1YJ9N 4AHTA 4JI2K 3K5MA 3B6OA 3CFRA 5JLHA 4FOEA 3C6AA 1RBRA 1NGDA 2O8BA 1CZBA 3U9DA 4M3YA 2NRVA 2Z1HA 2ZJRL 4DQSA 3P31A 4AHVA 4M3UA 3M8SA 4DSKA 5AQYA 5HOOA 1C1AA 1HPZA 3VQCA 1EX4A 4CHPA 1UAXA 1WSEA 1TKTA 1VQ4N 2P9UA 1NK5A 2FBYA 3WUHA 3KTQA 1C0GA 1F21A 1S72N 3CJAA 1RTJA 5E84A 5LJVA 3E01A 3E9LA 1SKWA 4O5BA 4BDPA 1TKXA 5LL6Z 4ISEA 4H0XB 1U48A 2YHYA 4Z4EA 1NGGA 4OKJA 3LP0A 4ID1A 1KC8O 3AVNA 2YKMA 3RSEB 3O1WA 1XNQK 2B4JA 1KXPA 4B1UB 4N47A 4MLHA 3DLEA 1IG8A 2PZSA 1KVBA 2OPRA 4KB1A 1JLAA 5M1PA 3TU5A 4JI8K 4E19A 1RNHA 3C0BA 3VOVA 4BRPA 4BR7A 4CZMA 3T3FA 4HCCA 1KFSA 2FBTA 3NH1A 2YCHA 4W5OA 4MDBA 5AQUA 2UUCK 1SS6A 1HQUA 3ZSYA 3QIPA 4B9UA 1IKWA 1BI4A 3TABA 3L4IA 4FWOA 1NGBA 4EIAA 2VYPA 4HVJA 1KAYA 1NG9A 1Q86O 1Q9XA 4Z4FA 4IOAL 1GOBA 2YNHA 2OTJN 1J5OA 3OW2M 3J7YP 3AVKA 1OH7A 4FW1A 3CCRN 2I5JA 4JN4A 4WQ4C 4JI3K 4LF6K 3VQ8A 3DLGA 2UUBK 4DTSA 2QWOA 3I33A 1GLLO 3VQBA 4KHSA 2D0PA 2P9IA 3I56N 4CF8A 4HUEA 4H5VA 2Q3SA 3OYLA 4N76A 4KHQA 2V7YA 1YUWA 1GOCA 1RDUA 5DM7L 3I0RA 3SNNA 1EKEA 4BR0A 2DFHA 1TKDA 3ZCMA 1GLJO 3I55N 4Q0BA 5F2RA 1S3XA 4JKCA 4BRKA 4B9MA 1JKHA 4AHUA 1VSFA 3RRHA 1VRTA 4CF1A 2FF3B 5GAEP 4IZ9A 3MXJA 3DRSA 1NJZA 1X3MA 4O55A 4FO0A 3WNFA 4B3SK 2YHAA 3M3ZA 3NF9A 4X62K 3OBYA 1VQLN 4W5NA 3CJ1A 4H0YB 3DMJA 4LF9K 1LW0A 3L6QA 3HPGA 2P51A 4LF8K 1RT7A 4DU4A 2P5OA 4CF2A 3DLBA 4C8MA 1T3VA 2P9UB 4ISFA 2YX6A 4IG3A 1NMDA 4O0IA 3ZSZA 3WT0A 5KRTA 4KREA 1CLQA 3O08A 4KFBA 3MXIA 2DY4A 4I7FA 3CXCM 4CJ5A 4IKFA 3HK2A 3SBTA 3DLRA 1GLFO 1X1PA 3UE5A 3KK3A 1NGHA 4N56A 2VQFK 1FK9A 1QQOA 3LAKA 3CETA 3DM2A 2HHTA 2YNFA 1ITGA 3FR0A 2E1ZA 3IUCA 5JVGL 2QWPA 4PL8A 1HKCA 3DRPA 3SPYA 2P9SB 5GAGP 3VF2A 4PKGA 3OYIA 2HNDA 4BREA 3P38A 2OA8A 3ZETA 3DLHA 2XY6A 3AA2A 5AQOA 1T6DA 3VQDA 3OYCA 3RMBA 3K0SA 5CE3A 1NK9A 2HHHK 1NOZA 5T7BA 1S1VA 4DFMA 3OYFA 3LM2A 3B6PA 3THVA 4YOVA 1SL1A 2QEXN 3PX6A 4DFPA 4UY8O 1C0MA 4JK8A 2GELA 2E2QA 3I8DA 2O8EB 4DQRA 3CD6N 5JICA 3CG7A 4AH9A 4GVEA 1BDGA 4JK7A 2XY5A 3S3NA 1WUAA 2Z1GA 2E2OA 3AO2A 1B9DA 3F9KA 3V9XA 1B9FA 4DWIA 2YNGA 1VQNN 4CEZA 1MA9B 3VTHA 3MN9A 1RDAA 3MWPA 2HB5A 3GL1A 3K5LA 3ISNC 2E20A 3RTVA 4L3QA 5J2NA 4I2QA 3NVKA 3SV4A 3AO3A 1JLFA 4H0TB 3VQAA 2J4RA 3A5NC 4CEEA 4E1MA 3DYAA 4LFAK 3CJ7A 5AZJA 4AHRA 3CFOA 4FM2A 4E7KA 3J81O 4CHQA 3VQEA 4NXNK 3MN7A 4JRQA 1WSHA 2F7TA 2WBNA 4AM7A 1BIUA 4IBNA 3RR8A 3UIQA 3UB5A 4RCHA 1NGCA 3G10A 2O8DA 2NLXA 3VQQA 4H5NA 1RT2A 2UXCK 1N8RO 3TAQA 3RR7A 4NCAA 4OPAA 3VEOA 1HKGA 1YVNA 3VEZA 2NRZA 2WONA 4CFCA 3H6EA 1U45A 1YJWN 4WFBL 5I3UA 1XUPO 2UXDK 5EXWA 2I7PA 3MCAB 4JKFA 2PAVA 5GIOA 3S3MA 1E3MA 4DG1A 3JXUA 2OZSA 4BRLA 4XIUA 1NGAA 1SUQA 5AQXA 5IT9O 4FLUA 4FK0A 4AHSA 4CESA 4Q5VA 4RTFD 5JLFA 4BDZA 4W5RA 1R59O 2CH6A 2P9KB 5AQQA 4HHTA 3LDOA 2OPSA 3R8EA 3JYTA 5AQMA 4FJNA 1WSJA 4A61A 3SI6A
chains in the Genus database with same CATH topology
3LAMA 1S1XA 5SWMA 2XHBA 1TK8A 1L3SA 2A1SA 1C6VA 1LAWA 1TL3A 3EY1A 5KGWA 3QNNA 1S6QA 3PO4A 4CE9A 3SQ0A 3PX4A 3LANA 3LPUA 3AA5X 4B9TA 1Z25A 2E6MA 4DQQA 4ZHRA 3L2WA 3D0PA 3RWUA 4DF4A 1X9WA 3SCXA 4CECA 4DLGA 4F3OA 3NH0A 2PYJA 3QLHA 3AVCA 3PV8A 1QSSA 4PUOA 4QOZB 4CIFA 4W5QA 4B9SA 3KJVA 3OY9A 1EXQA 3I0SA 3L3VA 1B92A 4CFAA 1O1WA 1CZ9A 4PY5A 1BQMA 2BANA 3NF7A 1BCMA 4RW8A 1XWLA 3AV9A 1VSDA 3QNOA 2JGUA 1J54A 4M45A 4FLWA 1I3AA 3L2RA 3TAMA 3VA0A 1U49A 4FZYA 1IO2A 1WSIA 1ZBIA 4KTWA 3NGYA 2IOCA 4CHNA 3KLFA 1KFDA 4IFVA 4DS5A 1BHLA 3T19A 2HVHA 3O3HA 4WE1A 1Y97A 2PY5A 3IG1A 1CXUA 2ZE2A 4N5SA 3P83D 4QAGA 1RT3A 1RT4A 3KK2A 3QO9A 3F73A 1S9GA 3AVJA 3ZSVA 4FLXA 3V81A 1X9MA 3QEPA 3LP2A 1RTHA 3EYZA 4ID5A 3NDKA 4FXDA 4JRPA 4HUGA 2KTQA 2IGIA 2VG5A 4FYDA 1VSKA 1Z26A 3K58A 1KLNA 4M3XA 1LWEA 2DFEA 1JLGA 3AO4A 1FKPA 3AA4A 3AVGA 3TAGA 3L2QA 1RBUA 1HYSA 5JS1A 4GVMA 3OJUA 3V1OA 5J2PA 2HNZA 4KB0A 3ZSWA 3SQ2A 4FW2A 4RW4A 3LPTA 4CK2A 4LSNA 3ZT4A 4Z4CA 2Z1JA 1XHXA 4FLTA 5HRRA 4CGFA 1C0TA 4DTOA 1UA0A 3NF8A 2DTUA 4ICLA 4RW9A 2FBXA 1D8YA 1C1CA 3MEDA 4F2RA 2D0BA 1VSLA 3V4IA 5KRSA 1RT1A 3V9WA 3VQ5A 5C25A 3H08A 5HROA 1G15A 1L3UA 4DQIA 1ASWA 2HHSA 1NJYA 3TAEA 1L3VA 1A5VA 3AVMA 4DSIA 2XRIA 4KTZA 5KI6A 4DU1A 1D9FA 2KZZA 5KGXA 3AVIA 3SUNA 3LP3A 5DMRA 4CEDA 1QTMA 2G8UA 2IC3A 4FJXA 4B8CA 3K5OA 4AHTA 3LZJA 3SUPA 5CYMA 1L5UA 3K5MA 3B6OA 4KI6A 1RDDA 2D5RA 3CFRA 3CQ8A 4F2SA 1SV5A 4CJSA 5SZTA 3OYNA 1JXBA 4ZTJA 1U04A 3S9HA 2OZMA 4QCLA 1RBRA 2OPPA 1VSMA 2EHGA 1CZBA 3VA3A 2F96A 4IFYA 4ZTFA 4M3YA 4F8RA 2Z1HA 4KRFA 4CJVA 1ZBLA 4DQSA 4AHVA 4M3UA 3AO5A 1QS4A 3M8SA 1JLQA 1S1TA 1NKBA 1IG9A 3IAYA 2G8VA 2RPIA 4DSKA 4CEQA 1C1AA 3NHGA 4HCBA 1HPZA 3VQCA 1SKSA 1EX4A 4CHPA 1UAXA 1WSEA 4CEAA 4FLZA 1TKTA 3PO5A 4O0JA 3SPZA 4FJNA 3HSTB 2QKKA 3ASMA 1NK5A 3L2UA 1N5YA 1LWFA 2VG6A 2FBYA 4E7LA 1TK5A 2YHBA 1RDBA 2BE2A 1IH7A 2O4GA 3KTQA 2Y1IA 4FJHA 1TL1A 1F21A 3KLEA 1RTJA 1GOAA 1NJWA 4L8RB 2XY8A 4B3OA 3KK1A 3E01A 3V9ZA 1SKWA 4O5BA 4BDPA 1TKXA 1T8EA 1U48A 4Z4EA 4M3WA 2X74A 1HQEA 3LP0A 4G1QA 4ID1A 2ZD1A 4OKJA 4EP4A 4DTJA 3RMAA 3D45A 3ULDA 3HPHA 5CZ1A 2AJQA 3AVNA 2YKMA 1Q8IA 1BL3A 4E7IA 3NGIA 5E41A 2B4JA 4CJTA 3OYBA 4OGEA 4LY7A 4B08A 4N47A 3DLEA 4CJLA 3SV3A 1JLBA 5I42A 4FZXC 3DRRA 4DSFA 2PZSA 1NK0A 1KVBA 1IKVA 2OPRA 4AHCA 4KB1A 1C0UA 1JLAA 3SJJA 4FK2A 4E19A 1RNHA 3M8RA 3CYMA 2P5GA 1TAUA 4CJ3A 1S5JA 1YTAA 1KTQA 3OVNA 4CJEA 4DSJA 1ZBHA 2PYLA 1VRUA 4LH5A 2BGGA 3T3FA 2HVIA 4HCCA 1JL2A 4CIGA 1KFSA 3MEGA 2FBTA 3NH1A 4W5OA 5HRSA 4E0DA 1BCOA 3PY8A 1IKXA 3K5NA 3P1GA 1QSLA 4KHWA 1HNIA 1HQUA 3ITHA 3ZSYA 4KKOA 2OPQA 3QIPA 5FROA 1JXEA 4JS4A 4M3TA 2Y1JA 2ETJA 4B9UA 3BGRA 1IKWA 1BI4A 1QQCA 3NBPA 4I9LA 3ZT1A 4E89A 4BE2A 2IS3A 3SQ4A 3TABA 1NKEA 4K8XA 4F4KA 3AVAA 4HVJA 2ZQBA 4FM0A 2D0CA 5CZ2A 2WOMA 3QETA 2QKBA 1QSYA 3TARA 3U3GA 3K57A 1Q9XA 4Z4FA 1GOBA 3HM9A 3RMCA 2YNHA 1U4BA 1J5OA 4CFBA 4CERA 3AVKA 4NCGA 1EP4A 4H4OA 5CYQA 4FW1A 4C8LA 1KLMA 4PA1A 3HT3A 3OYGA 1TKZA 3QERA 2I5JA 2G8WA 3K59A 2E6LA 2KW4A 1YTUA 1K6YA 4KHYA 3VQ8A 2G8HA 2KFZA 1L3TA 4CFDA 3DLGA 4N41A 1I39A 3ALYA 4DTSA 3CM5A 1TK0A 1QE1A 4I2PA 4DU3A 4OPJA 1RCHA 3VQ9A 3VQBA 1CXQA 4KHSA 1W9HA 3SYZA 1VSHA 4CF8A 4E1NA 4HUEA 2Q3SA 4CEBA 4RW6A 4KO0A 3HP9A 1UA1A 3OYLA 1KSPA 3V1QA 1HJRA 3O4QA 4E7JA 4CGJA 3KLGA 2GUIA 1YVUA 3QINA 3DOKA 3WNGA 1TVRA 4BE1A 4N76A 4KHQA 4Z4GA 3SQ1A 4C8OA 4KTQA 2GBZA 1DTTA 3ZSXA 4CGGA 1GOCA 2HHWA 2A1RA 1WN7A 3I0RA 3SNNA 1ZYQA 3NE6A 1EKEA 1TKDA 2DFHA 1BQNA 2HHVA 3AVFA 3ZCMA 4DSLA 4Q0BA 4HUFA 1JLCA 4M42A 3VQ6A 1HRHA 3PUFA 3LWMA 3LDSA 2LSNA 1JLEA 4B9MA 1JKHA 4AHUA 1Q9YA 4FJMA 1KRPA 4FLVA 3TAPA 1VSFA 3FFIA 4FZZA 3RRHA 1VRTA 4CF1A 1SL0A 3MXJA 4OPKA 3HL8A 3SUQA 1T05A 2HMIA 3DRSA 2HHUA 1NJZA 1ZBFA 4O55A 2GV9A 3WNFA 1J9AA 4HTUA 3LALA 4H8KA 1VSJA 2YHAA 4OLAA 4PWDA 3MXMA 3V9SA 3IRXA 4CF0A 4CJFA 4Y1DA 3HPOA 3TAFA 3NF9A 2VWKA 4KHNA 3ZSOA 3HO1A 3L3UA 1HMVA 3ZSQA 4LH4A 1IKYA 1QHTA 4RW7A 4CJWA 4W5NA 4GMJB 5J1EA 2KQ2A 3AVHA 3DMJA 2HHXA 3LP1A 3OS1A 4FCYA 1LW0A 3OYJA 3KLHA 3JSMA 4PQUA 3HPGA 1TGOA 1WLJA 4OVLA 3U6FA 1NKCA 4OJRA 2P51A 1REVA 1U47A 4J2BA 3NAEA 1WNSA 1RT7A 4DU4A 4BDYA 1JL1A 3OYKA 1TAQA 3U3YA 4CF2A 3DLBA 2P5OA 4B9LA 2F8TA 4DS4A 4C8KA 4C8MA 3WNHA 3PX0A 4FJKA 1NK7A 4KHUA 3KKSA 3L8BA 3LZIA 1FKOA 5J2QA 3DLKA 5HBMA 3AVLA 4IG3A 1LWCA 2FBVA 3ZSZA 4O0IA 1MU2A 3TANA 4LSLA 1BGXT 4DTUA 4CHOA 5KRTA 5HP1A 4AILC 1J53A 4KREA 1NK4A 1CLQA 4FM1A 4KFBA 3MXIA 2DY4A 1S6PA 5KTQA 2HNYA 4I7FA 3V1RA 4CJ5A 1XI1A 2G8KA 2B6AA 4IKFA 1RBVA 3HK2A 3EZ5A 1LAVA 1RT6A 3WNEA 3DLRA 4DTXA 1X1PA 4B8AB 4M3RA 4CK1A 3KK3A 5D3GA 4N56A 4FJJA 4W5TA 1KVAA 1FK9A 4KV8A 3LAKA 5HRNA 3DM2A 2HHTA 1NJXA 4MFBA 1RT5A 4I9QA 2YNFA 1ITGA 3VN5A 4CJQA 3AVBA 3NGZA 4Z4IA 2ITGA 3NCIA 1YT3A 5HLFA 4BACA 3SUOA 3SZ2A 3DRPA 1S9EA 3QIOA 4E7HA 3AA3A 3SPYA 1NK8A 4KI4A 2G8IA 3OYIA 4CIEA 2HNDA 4DFJA 1LW2A 4TSXA 1HYZA 1T03A 5EU7A 2OA8A 4CJ4A 3O4NA 3HXMA 4DQPA 4CGHA 3KIOA 3DLHA 2XY6A 1DTQA 4M3ZA 4FK4A 3AA2A 1RILA 4KPYA 3NH2A 1UWBA 3VQDA 3OYCA 3MEEA 2YNIA 3RMBA 1X9SA 1NK9A 3RRGA 4OGCA 3V9UA 4OLBA 3MECA 1NOZA 3ZSRA 4FJGA 5T7BA 1S1VA 1HYVA 4K8ZA 3ZT2A 4DFMA 3OYFA 1WAFA 1TV6A 3B6PA 4DF8A 3THVA 4C8NA 4FJ7A 2YV0X 1BIZA 4CJUA 4FJ9A 1SL1A 4CK3A 3DOLA 2OYQA 3PX6A 1VK0A 3HVTA 3BDPA 3LWLA 4CJPA 4CGIA 3P5JA 5C42A 4DFPA 4F3TA 1C0MA 3RMDA 4R5PA 3NF6A 3MAQA 1HNVA 1WSGA 1BISA 5FDLA 2RKIA 3C6UA 3O3GA 3I8DA 3QEVA 2HHQA 4DQRA 3TWHA 3QEWA 3OYMA 4DTPA 1DLOA 1UOCA 3CG7A 4AH9A 4DLEA 2JLEA 4CHZA 3OJSA 2XY5A 3S3NA 3HVRA 4FJLA 4RG8A 4EZ9A 4Z4HA 5CY4A 4CCHA 2Z1GA 3AO2A 1B9DA 3F9KA 3V9XA 1B9FA 4DWIA 4UQGA 2YNGA 2HW3A 4FJ8A 4CEZA 4GW6A 5HRPA 1S1WA 4O4GA 4FJ5A 3DI6A 1RDAA 2NUBA 3HP6A 4Z0UA 2F8SA 2HB5A 1RBTA 2DFFA 1XC9A 5FRNA 5FRMA 4B9VA 3K5LA 3ISNC 2EX3A 2P1JA 3RTVA 3QEIA 1RBSA 2X78A 4CHYA 4FLYA 4FVMA 4FJIA 3M8QA 1VSIA 4JLHA 2VWJA 4I2QA 3K2PA 3SV4A 5J2NA 3AO3A 1JLFA 2G8FA 4DTNA 3CFPA 3VQAA 2KFNA 4CEEA 4E1MA 4DTMA 4BE0A 3DYAA 1SKRA 4ELUA 2RF2A 1T7PA 4JS5A 4AHRA 2FC0A 3C6TA 1RTIA 3C94A 3VQ4A 3CFOA 4FM2A 5DK5A 4ELTA 4E7KA 3KD5E 4DFKA 3OS2A 3OYEA 3A2FA 4MQ3A 1LV5A 4CHQA 1A5XA 3VQEA 4CEOA 1D5AA 2QK9A 4J2DA 3NFAA 2IAJA 3O3FA 1R0AA 3IS9A 1VSEA 4YNQA 2BDPA 4JRQA 3KKRA 1WSHA 3QEXA 3M8PA 1BI4B 1BIUA 4IBNA 5C24A 3RR8A 4LD0A 3UIQA 3OYAA 4ELVA 3G10A 4NYNA 4E3SA 4OKKA 3AO1A 4M41A 3KLIA 3VQQA 1NK6A 2ATQA 4OKEA 5J2MA 1RT2A 3ZT3A 3TAQA 3RR7A 4NCAA 2XY7A 1ASVA 2X6SA 2E4LA 2Z1IA 2D0AA 4BWMA 4EP5A 2VG7A 3ZT0A 2WONA 3VQ7A 4CFCA 1U45A 1WAJA 4J2EA 1ASUA 4CJRA 4KAZA 3HJFA 4CGDA 5JS2A 5I3UA 4CF9A 2R7YA 1RTDA 1N6QA 2X6NA 2RN2A 1FXXA 2YKNA 3T1AA 4NCBA 3OYDA 4EZ6A 2KZMA 1C1BA 2B5JA 3HYFA 3QESA 4O44A 3G0ZA 3S3MA 4DG1A 3C95A 2W42A 3S3OA 2OZSA 4YFUA 1SUQA 4XIUA 3OS0A 4NYFA 4Y1CA 3KD1E 4CEFA 4FLUA 4FK0A 4J2AA 4AHSA 1A5WA 1EETA 4CESA 4DTRA 4IG0A 2QXFA 4Q5VA 4CJKA 3L2VA 4BDZA 2O4IA 2IDOA 4W5RA 3CM6A 1NOYA 1W0HA 1XHZA 4H4MA 1KCFA 1D9DA 1WSFA 3OYHA 2XO7A 5K14A 4IDKA 4BWJA 1ZBUA 4DMNA 4HHTA 4DSEA 4B9NA 3VQPA 2OPSA 3TI0A 1S1UA 3JYTA 1SL2A 1RDCA 3TR8A 1WSJA 1KVCA 3V6DA 3SI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAM A;  1S1X A;  5SWM A;  2XHB A;  1TK8 A;  1L3S A;  2A1S A;  1C6V A;  1LAW A;  1TL3 A;  3EY1 A;  5KGW A;  3QNN A;  1S6Q A;  3PO4 A;  4CE9 A;  3SQ0 A;  3PX4 A;  3LAN A;  3LPU A;  3AA5 X;  4B9T A;  1Z25 A;  2E6M A;  4DQQ A;  4ZHR A;  3L2W A;  3D0P A;  3RWU A;  4DF4 A;  1X9W A;  3SCX A;  4CEC A;  4DLG A;  4F3O A;  3NH0 A;  2PYJ A;  3QLH A;  3AVC A;  3PV8 A;  1QSS A;  4PUO A;  4QOZ B;  4CIF A;  4W5Q A;  4B9S A;  3KJV A;  3OY9 A;  1EXQ A;  3I0S A;  3L3V A;  1B92 A;  4CFA A;  1O1W A;  1CZ9 A;  4PY5 A;  1BQM A;  2BAN A;  3NF7 A;  1BCM A;  4RW8 A;  1XWL A;  3AV9 A;  1VSD A;  3QNO A;  2JGU A;  1J54 A;  4M45 A;  4FLW A;  1I3A A;  3L2R A;  3TAM A;  3VA0 A;  1U49 A;  4FZY A;  1IO2 A;  1WSI A;  1ZBI A;  4KTW A;  3NGY A;  2IOC A;  4CHN A;  3KLF A;  1KFD A;  4IFV A;  4DS5 A;  1BHL A;  3T19 A;  2HVH A;  3O3H A;  4WE1 A;  1Y97 A;  2PY5 A;  3IG1 A;  1CXU A;  2ZE2 A;  4N5S A;  3P83 D;  4QAG A;  1RT3 A;  1RT4 A;  3KK2 A;  3QO9 A;  3F73 A;  1S9G A;  3AVJ A;  3ZSV A;  4FLX A;  3V81 A;  1X9M A;  3QEP A;  3LP2 A;  1RTH A;  3EYZ A;  4ID5 A;  3NDK A;  4FXD A;  4JRP A;  4HUG A;  2KTQ A;  2IGI A;  2VG5 A;  4FYD A;  1VSK A;  1Z26 A;  3K58 A;  1KLN A;  4M3X A;  1LWE A;  2DFE A;  1JLG A;  3AO4 A;  1FKP A;  3AA4 A;  3AVG A;  3TAG A;  3L2Q A;  1RBU A;  1HYS A;  5JS1 A;  4GVM A;  3OJU A;  3V1O A;  5J2P A;  2HNZ A;  4KB0 A;  3ZSW A;  3SQ2 A;  4FW2 A;  4RW4 A;  3LPT A;  4CK2 A;  4LSN A;  3ZT4 A;  4Z4C A;  2Z1J A;  1XHX A;  4FLT A;  5HRR A;  4CGF A;  1C0T A;  4DTO A;  1UA0 A;  3NF8 A;  2DTU A;  4ICL A;  4RW9 A;  2FBX A;  1D8Y A;  1C1C A;  3MED A;  4F2R A;  2D0B A;  1VSL A;  3V4I A;  5KRS A;  1RT1 A;  3V9W A;  3VQ5 A;  5C25 A;  3H08 A;  5HRO A;  1G15 A;  1L3U A;  4DQI A;  1ASW A;  2HHS A;  1NJY A;  3TAE A;  1L3V A;  1A5V A;  3AVM A;  4DSI A;  2XRI A;  4KTZ A;  5KI6 A;  4DU1 A;  1D9F A;  2KZZ A;  5KGX A;  3AVI A;  3SUN A;  3LP3 A;  5DMR A;  4CED A;  1QTM A;  2G8U A;  2IC3 A;  4FJX A;  4B8C A;  3K5O A;  4AHT A;  3LZJ A;  3SUP A;  5CYM A;  1L5U A;  3K5M A;  3B6O A;  4KI6 A;  1RDD A;  2D5R A;  3CFR A;  3CQ8 A;  4F2S A;  1SV5 A;  4CJS A;  5SZT A;  3OYN A;  1JXB A;  4ZTJ A;  1U04 A;  3S9H A;  2OZM A;  4QCL A;  1RBR A;  2OPP A;  1VSM A;  2EHG A;  1CZB A;  3VA3 A;  2F96 A;  4IFY A;  4ZTF A;  4M3Y A;  4F8R A;  2Z1H A;  4KRF A;  4CJV A;  1ZBL A;  4DQS A;  4AHV A;  4M3U A;  3AO5 A;  1QS4 A;  3M8S A;  1JLQ A;  1S1T A;  1NKB A;  1IG9 A;  3IAY A;  2G8V A;  2RPI A;  4DSK A;  4CEQ A;  1C1A A;  3NHG A;  4HCB A;  1HPZ A;  3VQC A;  1SKS A;  1EX4 A;  4CHP A;  1UAX A;  1WSE A;  4CEA A;  4FLZ A;  1TKT A;  3PO5 A;  4O0J A;  3SPZ A;  4FJN A;  3HST B;  2QKK A;  3ASM A;  1NK5 A;  3L2U A;  1N5Y A;  1LWF A;  2VG6 A;  2FBY A;  4E7L A;  1TK5 A;  2YHB A;  1RDB A;  2BE2 A;  1IH7 A;  2O4G A;  3KTQ A;  2Y1I A;  4FJH A;  1TL1 A;  1F21 A;  3KLE A;  1RTJ A;  1GOA A;  1NJW A;  4L8R B;  2XY8 A;  4B3O A;  3KK1 A;  3E01 A;  3V9Z A;  1SKW A;  4O5B A;  4BDP A;  1TKX A;  1T8E A;  1U48 A;  4Z4E A;  4M3W A;  2X74 A;  1HQE A;  3LP0 A;  4G1Q A;  4ID1 A;  2ZD1 A;  4OKJ A;  4EP4 A;  4DTJ A;  3RMA A;  3D45 A;  3ULD A;  3HPH A;  5CZ1 A;  2AJQ A;  3AVN A;  2YKM A;  1Q8I A;  1BL3 A;  4E7I A;  3NGI A;  5E41 A;  2B4J A;  4CJT A;  3OYB A;  4OGE A;  4LY7 A;  4B08 A;  4N47 A;  3DLE A;  4CJL A;  3SV3 A;  1JLB A;  5I42 A;  4FZX C;  3DRR A;  4DSF A;  2PZS A;  1NK0 A;  1KVB A;  1IKV A;  2OPR A;  4AHC A;  4KB1 A;  1C0U A;  1JLA A;  3SJJ A;  4FK2 A;  4E19 A;  1RNH A;  3M8R A;  3CYM A;  2P5G A;  1TAU A;  4CJ3 A;  1S5J A;  1YTA A;  1KTQ A;  3OVN A;  4CJE A;  4DSJ A;  1ZBH A;  2PYL A;  1VRU A;  4LH5 A;  2BGG A;  3T3F A;  2HVI A;  4HCC A;  1JL2 A;  4CIG A;  1KFS A;  3MEG A;  2FBT A;  3NH1 A;  4W5O A;  5HRS A;  4E0D A;  1BCO A;  3PY8 A;  1IKX A;  3K5N A;  3P1G A;  1QSL A;  4KHW A;  1HNI A;  1HQU A;  3ITH A;  3ZSY A;  4KKO A;  2OPQ A;  3QIP A;  5FRO A;  1JXE A;  4JS4 A;  4M3T A;  2Y1J A;  2ETJ A;  4B9U A;  3BGR A;  1IKW A;  1BI4 A;  1QQC A;  3NBP A;  4I9L A;  3ZT1 A;  4E89 A;  4BE2 A;  2IS3 A;  3SQ4 A;  3TAB A;  1NKE A;  4K8X A;  4F4K A;  3AVA A;  4HVJ A;  2ZQB A;  4FM0 A;  2D0C A;  5CZ2 A;  2WOM A;  3QET A;  2QKB A;  1QSY A;  3TAR A;  3U3G A;  3K57 A;  1Q9X A;  4Z4F A;  1GOB A;  3HM9 A;  3RMC A;  2YNH A;  1U4B A;  1J5O A;  4CFB A;  4CER A;  3AVK A;  4NCG A;  1EP4 A;  4H4O A;  5CYQ A;  4FW1 A;  4C8L A;  1KLM A;  4PA1 A;  3HT3 A;  3OYG A;  1TKZ A;  3QER A;  2I5J A;  2G8W A;  3K59 A;  2E6L A;  2KW4 A;  1YTU A;  1K6Y A;  4KHY A;  3VQ8 A;  2G8H A;  2KFZ A;  1L3T A;  4CFD A;  3DLG A;  4N41 A;  1I39 A;  3ALY A;  4DTS A;  3CM5 A;  1TK0 A;  1QE1 A;  4I2P A;  4DU3 A;  4OPJ A;  1RCH A;  3VQ9 A;  3VQB A;  1CXQ A;  4KHS A;  1W9H A;  3SYZ A;  1VSH A;  4CF8 A;  4E1N A;  4HUE A;  2Q3S A;  4CEB A;  4RW6 A;  4KO0 A;  3HP9 A;  1UA1 A;  3OYL A;  1KSP A;  3V1Q A;  1HJR A;  3O4Q A;  4E7J A;  4CGJ A;  3KLG A;  2GUI A;  1YVU A;  3QIN A;  3DOK A;  3WNG A;  1TVR A;  4BE1 A;  4N76 A;  4KHQ A;  4Z4G A;  3SQ1 A;  4C8O A;  4KTQ A;  2GBZ A;  1DTT A;  3ZSX A;  4CGG A;  1GOC A;  2HHW A;  2A1R A;  1WN7 A;  3I0R A;  3SNN A;  1ZYQ A;  3NE6 A;  1EKE A;  1TKD A;  2DFH A;  1BQN A;  2HHV A;  3AVF A;  3ZCM A;  4DSL A;  4Q0B A;  4HUF A;  1JLC A;  4M42 A;  3VQ6 A;  1HRH A;  3PUF A;  3LWM A;  3LDS A;  2LSN A;  1JLE A;  4B9M A;  1JKH A;  4AHU A;  1Q9Y A;  4FJM A;  1KRP A;  4FLV A;  3TAP A;  1VSF A;  3FFI A;  4FZZ A;  3RRH A;  1VRT A;  4CF1 A;  1SL0 A;  3MXJ A;  4OPK A;  3HL8 A;  3SUQ A;  1T05 A;  2HMI A;  3DRS A;  2HHU A;  1NJZ A;  1ZBF A;  4O55 A;  2GV9 A;  3WNF A;  1J9A A;  4HTU A;  3LAL A;  4H8K A;  1VSJ A;  2YHA A;  4OLA A;  4PWD A;  3MXM A;  3V9S A;  3IRX A;  4CF0 A;  4CJF A;  4Y1D A;  3HPO A;  3TAF A;  3NF9 A;  2VWK A;  4KHN A;  3ZSO A;  3HO1 A;  3L3U A;  1HMV A;  3ZSQ A;  4LH4 A;  1IKY A;  1QHT A;  4RW7 A;  4CJW A;  4W5N A;  4GMJ B;  5J1E A;  2KQ2 A;  3AVH A;  3DMJ A;  2HHX A;  3LP1 A;  3OS1 A;  4FCY A;  1LW0 A;  3OYJ A;  3KLH A;  3JSM A;  4PQU A;  3HPG A;  1TGO A;  1WLJ A;  4OVL A;  3U6F A;  1NKC A;  4OJR A;  2P51 A;  1REV A;  1U47 A;  4J2B A;  3NAE A;  1WNS A;  1RT7 A;  4DU4 A;  4BDY A;  1JL1 A;  3OYK A;  1TAQ A;  3U3Y A;  4CF2 A;  3DLB A;  2P5O A;  4B9L A;  2F8T A;  4DS4 A;  4C8K A;  4C8M A;  3WNH A;  3PX0 A;  4FJK A;  1NK7 A;  4KHU A;  3KKS A;  3L8B A;  3LZI A;  1FKO A;  5J2Q A;  3DLK A;  5HBM A;  3AVL A;  4IG3 A;  1LWC A;  2FBV A;  3ZSZ A;  4O0I A;  1MU2 A;  3TAN A;  4LSL A;  1BGX T;  4DTU A;  4CHO A;  5KRT A;  5HP1 A;  4AIL C;  1J53 A;  4KRE A;  1NK4 A;  1CLQ A;  4FM1 A;  4KFB A;  3MXI A;  2DY4 A;  1S6P A;  5KTQ A;  2HNY A;  4I7F A;  3V1R A;  4CJ5 A;  1XI1 A;  2G8K A;  2B6A A;  4IKF A;  1RBV A;  3HK2 A;  3EZ5 A;  1LAV A;  1RT6 A;  3WNE A;  3DLR A;  4DTX A;  1X1P A;  4B8A B;  4M3R A;  4CK1 A;  3KK3 A;  5D3G A;  4N56 A;  4FJJ A;  4W5T A;  1KVA A;  1FK9 A;  4KV8 A;  3LAK A;  5HRN A;  3DM2 A;  2HHT A;  1NJX A;  4MFB A;  1RT5 A;  4I9Q A;  2YNF A;  1ITG A;  3VN5 A;  4CJQ A;  3AVB A;  3NGZ A;  4Z4I A;  2ITG A;  3NCI A;  1YT3 A;  5HLF A;  4BAC A;  3SUO A;  3SZ2 A;  3DRP A;  1S9E A;  3QIO A;  4E7H A;  3AA3 A;  3SPY A;  1NK8 A;  4KI4 A;  2G8I A;  3OYI A;  4CIE A;  2HND A;  4DFJ A;  1LW2 A;  4TSX A;  1HYZ A;  1T03 A;  5EU7 A;  2OA8 A;  4CJ4 A;  3O4N A;  3HXM A;  4DQP A;  4CGH A;  3KIO A;  3DLH A;  2XY6 A;  1DTQ A;  4M3Z A;  4FK4 A;  3AA2 A;  1RIL A;  4KPY A;  3NH2 A;  1UWB A;  3VQD A;  3OYC A;  3MEE A;  2YNI A;  3RMB A;  1X9S A;  1NK9 A;  3RRG A;  4OGC A;  3V9U A;  4OLB A;  3MEC A;  1NOZ A;  3ZSR A;  4FJG A;  5T7B A;  1S1V A;  1HYV A;  4K8Z A;  3ZT2 A;  4DFM A;  3OYF A;  1WAF A;  1TV6 A;  3B6P A;  4DF8 A;  3THV A;  4C8N A;  4FJ7 A;  2YV0 X;  1BIZ A;  4CJU A;  4FJ9 A;  1SL1 A;  4CK3 A;  3DOL A;  2OYQ A;  3PX6 A;  1VK0 A;  3HVT A;  3BDP A;  3LWL A;  4CJP A;  4CGI A;  3P5J A;  5C42 A;  4DFP A;  4F3T A;  1C0M A;  3RMD A;  4R5P A;  3NF6 A;  3MAQ A;  1HNV A;  1WSG A;  1BIS A;  5FDL A;  2RKI A;  3C6U A;  3O3G A;  3I8D A;  3QEV A;  2HHQ A;  4DQR A;  3TWH A;  3QEW A;  3OYM A;  4DTP A;  1DLO A;  1UOC A;  3CG7 A;  4AH9 A;  4DLE A;  2JLE A;  4CHZ A;  3OJS A;  2XY5 A;  3S3N A;  3HVR A;  4FJL A;  4RG8 A;  4EZ9 A;  4Z4H A;  5CY4 A;  4CCH A;  2Z1G A;  3AO2 A;  1B9D A;  3F9K A;  3V9X A;  1B9F A;  4DWI A;  4UQG A;  2YNG A;  2HW3 A;  4FJ8 A;  4CEZ A;  4GW6 A;  5HRP A;  1S1W A;  4O4G A;  4FJ5 A;  3DI6 A;  1RDA A;  2NUB A;  3HP6 A;  4Z0U A;  2F8S A;  2HB5 A;  1RBT A;  2DFF A;  1XC9 A;  5FRN A;  5FRM A;  4B9V A;  3K5L A;  3ISN C;  2EX3 A;  2P1J A;  3RTV A;  3QEI A;  1RBS A;  2X78 A;  4CHY A;  4FLY A;  4FVM A;  4FJI A;  3M8Q A;  1VSI A;  4JLH A;  2VWJ A;  4I2Q A;  3K2P A;  3SV4 A;  5J2N A;  3AO3 A;  1JLF A;  2G8F A;  4DTN A;  3CFP A;  3VQA A;  2KFN A;  4CEE A;  4E1M A;  4DTM A;  4BE0 A;  3DYA A;  1SKR A;  4ELU A;  2RF2 A;  1T7P A;  4JS5 A;  4AHR A;  2FC0 A;  3C6T A;  1RTI A;  3C94 A;  3VQ4 A;  3CFO A;  4FM2 A;  5DK5 A;  4ELT A;  4E7K A;  3KD5 E;  4DFK A;  3OS2 A;  3OYE A;  3A2F A;  4MQ3 A;  1LV5 A;  4CHQ A;  1A5X A;  3VQE A;  4CEO A;  1D5A A;  2QK9 A;  4J2D A;  3NFA A;  2IAJ A;  3O3F A;  1R0A A;  3IS9 A;  1VSE A;  4YNQ A;  2BDP A;  4JRQ A;  3KKR A;  1WSH A;  3QEX A;  3M8P A;  1BI4 B;  1BIU A;  4IBN A;  5C24 A;  3RR8 A;  4LD0 A;  3UIQ A;  3OYA A;  4ELV A;  3G10 A;  4NYN A;  4E3S A;  4OKK A;  3AO1 A;  4M41 A;  3KLI A;  3VQQ A;  1NK6 A;  2ATQ A;  4OKE A;  5J2M A;  1RT2 A;  3ZT3 A;  3TAQ A;  3RR7 A;  4NCA A;  2XY7 A;  1ASV A;  2X6S A;  2E4L A;  2Z1I A;  2D0A A;  4BWM A;  4EP5 A;  2VG7 A;  3ZT0 A;  2WON A;  3VQ7 A;  4CFC A;  1U45 A;  1WAJ A;  4J2E A;  1ASU A;  4CJR A;  4KAZ A;  3HJF A;  4CGD A;  5JS2 A;  5I3U A;  4CF9 A;  2R7Y A;  1RTD A;  1N6Q A;  2X6N A;  2RN2 A;  1FXX A;  2YKN A;  3T1A A;  4NCB A;  3OYD A;  4EZ6 A;  2KZM A;  1C1B A;  2B5J A;  3HYF A;  3QES A;  4O44 A;  3G0Z A;  3S3M A;  4DG1 A;  3C95 A;  2W42 A;  3S3O A;  2OZS A;  4YFU A;  1SUQ A;  4XIU A;  3OS0 A;  4NYF A;  4Y1C A;  3KD1 E;  4CEF A;  4FLU A;  4FK0 A;  4J2A A;  4AHS A;  1A5W A;  1EET A;  4CES A;  4DTR A;  4IG0 A;  2QXF A;  4Q5V A;  4CJK A;  3L2V A;  4BDZ A;  2O4I A;  2IDO A;  4W5R A;  3CM6 A;  1NOY A;  1W0H A;  1XHZ A;  4H4M A;  1KCF A;  1D9D A;  1WSF A;  3OYH A;  2XO7 A;  5K14 A;  4IDK A;  4BWJ A;  1ZBU A;  4DMN A;  4HHT A;  4DSE A;  4B9N A;  3VQP A;  2OPS A;  3TI0 A;  1S1U A;  3JYT A;  1SL2 A;  1RDC A;  3TR8 A;  1WSJ A;  1KVC A;  3V6D A;  3SI6 A; 
#chains in the Genus database with same CATH topology
 2XHB A;  2A1S A;  1LAW A;  4CE9 A;  5BPL A;  3PX4 A;  5AQH A;  4B9T A;  3CI5 A;  2WFB A;  3A5M C;  1X9W A;  3CQY A;  3MCP A;  4CIF A;  4W5Q A;  4DUZ K;  3VF6 A;  1EO1 A;  3EZW A;  3O9U A;  3WQU A;  3A0I X;  3L3V A;  1YF5 L;  1BCM A;  3AV9 A;  4XH4 A;  3QNO A;  1JCG A;  1YJN N;  4M45 A;  4FWQ A;  3VA0 A;  4WQ4 A;  3N4Q A;  3GOI A;  4KTW A;  3NGY A;  4CHN A;  1KFD A;  4DR2 K;  4NXM K;  1Y97 A;  3C65 A;  3FZF A;  1RT3 A;  4FXD A;  3LP2 A;  4DV0 K;  3R9P A;  3JS6 A;  1VSK A;  5I9E B;  4KH4 A;  5JS1 A;  4GVM A;  3OJU A;  5AQN A;  5J2P A;  5LMN K;  4CK2 A;  3M1F A;  3SBG A;  3ZT4 A;  4FLT A;  1C0T A;  4BRG A;  4DTO A;  2EWS A;  4BG8 A;  2DTU A;  2E88 A;  1C1C A;  4F2R A;  2D0B A;  4M7Y A;  2P9N B;  4DQI A;  1NJY A;  1A5V A;  5KI6 A;  1NGF A;  3N4P A;  2G8U A;  3K5O A;  2ASM A;  1SV5 A;  1QQN A;  1U04 A;  2OPP A;  2EHG A;  3VA3 A;  4F8R A;  1Q81 O;  4KRF A;  4CJV A;  1ZBL A;  3U9Z A;  3IAY A;  2KTQ A;  2RPI A;  4CEQ A;  2H3G X;  3D7E O;  3CCS N;  3NHG A;  3IKM A;  3PIP L;  4FLZ A;  3PO5 A;  4JI4 K;  4O0J A;  3WEE B;  3SPZ A;  3HST B;  1N5Y A;  4LF4 K;  1LWF A;  4E7L A;  4JI0 K;  3E9O A;  4H5T A;  2Y1I A;  3O1B A;  4BRQ A;  3KLE A;  2O8D B;  1GOA A;  1NJW A;  2XY8 A;  3V9Z A;  2UXB K;  5AQR A;  1T8E A;  4WFN L;  1IV0 A;  4M3W A;  1HUX A;  4G1Q A;  3AGK A;  4YOX A;  4DTJ A;  4JI5 K;  1OKJ A;  4E7I A;  3NGI A;  5E41 A;  1Y64 A;  3SV3 A;  1JLB A;  5AZI B;  4BRI A;  3DRR A;  1NK0 A;  4AHC A;  4C1N K;  1C0U A;  3WXL A;  3SJJ A;  2I7N A;  4FK2 A;  2V7Z A;  4YDU C;  2P5G A;  1S5J A;  4DSJ A;  1KTQ A;  2PYL A;  4DR5 K;  1VRU A;  4KH6 A;  5AQW A;  4LH5 A;  2BGG A;  1JL2 A;  4FWL A;  3G71 N;  4E0D A;  1BCO A;  5LJW A;  1IKX A;  1HNI A;  5LY3 A;  3HM8 A;  2Y1J A;  3NBP A;  4H0P A;  1XMQ K;  1WBB A;  1ZBS A;  4K8X A;  1TUY A;  4BC3 A;  4JKG B;  2Q97 A;  2ZQB A;  1M1K O;  2Q0R A;  3EL2 A;  3S41 A;  3QET A;  2O8C A;  3HM9 A;  4EFH A;  4NB4 A;  1OH8 A;  4NCG A;  4M63 C;  5CYQ A;  4PA1 A;  3OYG A;  3O80 A;  3EO3 A;  1V4S A;  1K6Y A;  2WC9 A;  2G8H A;  3VPZ A;  1I39 A;  1JCE A;  3CM5 A;  1TK0 A;  1QE1 A;  4DU3 A;  4OPJ A;  3VQ9 A;  3SYZ A;  3VEX A;  4CBX A;  4E1N A;  2UU9 K;  3HP9 A;  1VQM N;  4E7J A;  3ZEU B;  3KLG A;  3QIN A;  3DOK A;  4Z4G A;  2ZGZ A;  1DTT A;  3SLC A;  3ZSX A;  4CD1 A;  3HTV A;  3VGK A;  4CGG A;  3NE6 A;  2HHV A;  3AVF A;  3TTF A;  2CGK A;  4HUF A;  3DLL L;  4M42 A;  1HRH A;  5FPN A;  1Q9Y A;  4FJM A;  1KRP A;  3TAP A;  1SL0 A;  3QB0 A;  4FWN A;  3HL8 A;  3SUQ A;  1T05 A;  3ID8 A;  1ZBF A;  4CZK A;  4PHT X;  1J9A A;  4HTU A;  3CMA N;  4OLA A;  4IO8 A;  5M1O A;  4PWD A;  3VTI A;  4CF0 A;  3HPO A;  5ADX A;  2VWK A;  3HO1 A;  2YJE A;  3L3U A;  4BR2 A;  4GKJ K;  1QHT A;  4CJW A;  3AVH A;  2HHX A;  3OS1 A;  3OYJ A;  3KLH A;  3JSM A;  1TGO A;  1WLJ A;  4OVL A;  3ZX0 A;  2E5L K;  1U47 A;  1NNE A;  1JL1 A;  3OYK A;  4B3M K;  2F8T A;  2ITM A;  1KAZ A;  4DS4 A;  1GLC G;  2GWK A;  4FPB A;  3KKS A;  3L8B A;  3A5O C;  3BY5 A;  3D6R A;  3CJC A;  5HP1 A;  4CHO A;  4ILG B;  3ZX3 A;  3IMX A;  5EX5 A;  3AAQ A;  1S6P A;  5KTQ A;  3R6M A;  1XI1 A;  4KHP K;  2HMP A;  1RBV A;  4B3T K;  4CK1 A;  1ATS A;  4W5T A;  3DXK B;  4IOX A;  3WXJ A;  2VCP A;  4CZF A;  3AVB A;  4DV3 K;  1YT3 A;  1S9E A;  4E7H A;  3AA3 A;  5HL7 L;  1XQS C;  1QQM A;  3HXM A;  4DQP A;  4CGH A;  5AQL A;  1K9M O;  1QZ6 A;  4FK4 A;  4KPY A;  4IDH A;  3DWL A;  1UWB A;  3RRG A;  2YNI A;  4FOI A;  1HPM A;  3TSQ A;  1NGI A;  3G4S N;  4C8N A;  2YV0 X;  4CJU A;  4CK3 A;  3K9J A;  3ZX2 A;  2OYQ A;  1VK0 A;  3ULE A;  4CJP A;  4M7X A;  3P5J A;  4CGI A;  1BA1 A;  3QBX A;  3RMD A;  4R5P A;  3NF6 A;  3MAQ A;  3O3G A;  1WSG A;  3C6U A;  2HHQ A;  4DTP A;  2JLE A;  3OJS A;  4FJL A;  4Z4H A;  3HOT A;  1U6Z A;  3U4L A;  1NMN A;  1C0F A;  4UQG A;  2QI2 A;  1S1W A;  4O4G A;  4FJ5 A;  1N32 K;  3DI6 A;  4E1J A;  4MLE A;  4B3R K;  2HF3 A;  5AQP A;  3HP6 A;  4Z0U A;  4CVN E;  1RBT A;  1XC9 A;  4CZG A;  5GAD P;  3QEI A;  3BZC A;  1RBS A;  4CHY A;  3M8Q A;  4JLH A;  3K2P A;  3MN6 A;  4DTM A;  2P9P B;  1SKR A;  1YHQ N;  3ZEU A;  2FC0 A;  1RTI A;  4K41 A;  4ELT A;  2OTL N;  2V52 B;  3W0L A;  1VQ9 N;  1A5X A;  5H1S Q;  4U7B A;  3KWG A;  1VSE A;  1NM1 A;  4H5R A;  3H3N O;  5AFU A;  4LD0 A;  3UKU B;  1T6C A;  5GIN A;  4NYN A;  3BF1 A;  1OVY A;  4OKK A;  3AO1 A;  3DXM B;  4E3S A;  4BRO A;  3PIO L;  4OO1 J;  4OKE A;  5EY4 A;  4EAH D;  4BRM A;  2Z1I A;  4BWM A;  4EP5 A;  3H3O B;  3ZT0 A;  1YIT N;  5C2D A;  4J2E A;  1WAJ A;  1ASU A;  4CBU A;  4CJR A;  5AQV A;  2QW9 A;  4CF9 A;  1RTD A;  2X6N A;  2RN2 A;  1IJJ A;  1JCF A;  1FXX A;  3CC4 N;  3OYD A;  3LDL A;  1C1B A;  2ZJQ L;  3NMU A;  3HYF A;  3QES A;  5KQD A;  2RE2 A;  1P90 A;  4NYF A;  2QM1 A;  3WQT A;  5BPN A;  2QXF A;  5AZJ B;  3CQX A;  4CJK A;  3L2V A;  2P9I B;  4IEE A;  2IDO A;  1NOY A;  1XHZ A;  2JWL A;  1KCF A;  5ADX H;  3T69 A;  4PL7 A;  4BWJ A;  4X66 K;  1ZBU A;  3CF5 L;  5AQJ A;  4B9N A;  4FWR A;  1BUP A;  3V6D A;  4DKW A;  2CGJ A;  3TTD A;  1C6V A;  1TL3 A;  3FZK A;  2ZF5 O;  5KGW A;  3PO4 A;  3WXK A;  3LAN A;  3AA5 X;  5DM6 L;  2E6M A;  3RWU A;  4ZHR A;  3L2W A;  1NLV A;  3MX5 A;  4F3O A;  1SZ2 A;  3MWT A;  1HJO A;  2ASO A;  2PYJ A;  3AVC A;  4PUO A;  4WQ5 A;  2UYT A;  4A5A A;  4CFA A;  2CGL A;  3G25 A;  3I8B A;  1CZ9 A;  5AZI A;  1BQM A;  2BAN A;  1TYQ A;  2IVO A;  1VSD A;  3HOS A;  2JGU A;  4FLW A;  1ZBI A;  3TAM A;  3AGR A;  4FZY A;  3E9P A;  2GX9 A;  2IOC A;  2BTF A;  4WQ5 C;  3SAH A;  2HVH A;  3ID6 A;  3O3H A;  4N5S A;  4HTL A;  1RT4 A;  4FLX A;  3NDK A;  4YOY A;  4HUG A;  3L4Q A;  4CZL A;  1BOT O;  2HBJ A;  2VG5 A;  4U67 L;  4M3X A;  1FKP A;  3AA4 A;  2HNZ A;  3B8A X;  3ZSW A;  3DXM A;  4FL9 A;  5MLC Q;  4LSN A;  3CCJ N;  3HBT A;  4CGF A;  3NF8 A;  2QWN A;  3MED A;  1VSL A;  5KRS A;  5KPZ A;  3H08 A;  5AR0 A;  4PKI A;  4DV6 K;  2O8C B;  2HHS A;  3EE8 A;  3ZLJ A;  5B8H A;  4X64 K;  3TAE A;  1L3V A;  3AVM A;  3SK3 A;  4DSI A;  1QZ5 A;  3ATV A;  1W2B M;  3VEN A;  2KZZ A;  3AVI A;  3SUN A;  3LP3 A;  1LCU A;  4FJX A;  3RSE A;  3SAG A;  2BH1 A;  5CYM A;  1L5U A;  4KI6 A;  3CQ8 A;  3BEX A;  1FW6 A;  5SZT A;  4ZTJ A;  1JXB A;  2OZM A;  5AQS A;  4QCL A;  1VSM A;  3L0Q A;  4IFY A;  2YJF A;  1IBK K;  3CC2 N;  1XMO K;  3AO5 A;  3F9M A;  1JLQ A;  1S1T A;  5M1K A;  1NKB A;  2G8V A;  5AQZ A;  1J5E K;  4HCB A;  4DV1 K;  1YI2 N;  1ILY A;  3ASM A;  5KQ8 A;  2QWQ A;  2VG6 A;  1TK5 A;  4OX9 K;  3SMP A;  3GDQ A;  2YHB A;  1IH7 A;  2O4G A;  3VEV A;  3GG4 A;  1LOT B;  4B9Q A;  4B1Z A;  4DR7 K;  3KK1 A;  2P9L A;  2KKZ A;  2VGN A;  4BG9 A;  3TSP A;  4BRF A;  4BRC A;  2ZWH A;  2ZD1 A;  4EP4 A;  2QA4 N;  3D45 A;  3DXK A;  1BL3 A;  4CJT A;  3OYB A;  4OGE A;  4YOT A;  4H5W A;  2NRW A;  4BGB A;  4DSF A;  1T44 A;  1IKV A;  2GTD A;  4K43 A;  3E66 A;  2NZT A;  3QBW A;  4AM6 A;  5BRE A;  3CYM A;  4CJE A;  1ZBH A;  3OVN A;  2Q31 A;  4EHU A;  1HX1 A;  3QIC A;  5M1F A;  2VGM A;  3G6E N;  1Z6R A;  1XNR K;  3CC7 N;  4CIG A;  4DR4 K;  3PY8 A;  3K5N A;  4XH1 A;  4B1V A;  1QSL A;  4M3T A;  5FRO A;  1JXE A;  4I9L A;  3ZT1 A;  1NKE A;  3SQ4 A;  2IS3 A;  1K73 O;  3AVA A;  2F9T A;  4FM0 A;  1HNW K;  2QKB A;  1QSY A;  3TAR A;  2VQE K;  4O8K A;  1U4B A;  2E2P A;  3LL3 A;  4C8L A;  3O9T A;  1TKZ A;  2G8W A;  3K59 A;  4V19 S;  1YTU A;  3THX B;  2KFZ A;  1D4X A;  4CFD A;  2ASP A;  2WUS A;  3ALY A;  5C10 A;  4H03 B;  3O6W A;  1RCH A;  1G99 A;  1BG3 A;  1W9H A;  3SAF A;  1VSH A;  1WB9 A;  1YIJ N;  4BRH A;  4RW6 A;  4KO0 A;  4CEB A;  1UA1 A;  1ATR A;  1KSP A;  4CGJ A;  2NNW A;  5FLX O;  3VEW A;  3WNG A;  4BE1 A;  3SQ1 A;  5C0Y A;  3P39 A;  4KTQ A;  3OTO K;  2GBZ A;  2E8A A;  1BQN A;  5F0X A;  3CCQ N;  1DEJ A;  1JLC A;  1P8Z A;  3ULE B;  3LDS A;  5GIP A;  1X9J A;  4JKG A;  4FWP A;  3D2F B;  1EQY A;  3FFI A;  5BRD A;  2IVN A;  2E2N A;  4MDA A;  4OPK A;  3IFR A;  2HMI A;  3HI0 A;  2GEM A;  4J8F A;  2A41 A;  3LAL A;  4H8K A;  1VSJ A;  1DT9 A;  4K0K K;  4KHN A;  3ZSQ A;  3THW B;  4LH4 A;  1IKY A;  2P9P A;  4RW7 A;  4GMJ B;  2KQ2 A;  5BN9 A;  3LP1 A;  4AF1 A;  4PQU A;  3FZH A;  3SJH A;  3U6F A;  4OJR A;  1REV A;  2VWB A;  3NAE A;  2HST A;  4J2B A;  4HWI A;  3U3Y A;  4C8K A;  5EVZ A;  4KHU A;  1NK7 A;  2GWJ A;  3LZI A;  1FKO A;  5J2Q A;  3AVL A;  3H1V X;  1LWC A;  1VAZ A;  3TAN A;  4YOW A;  4LSL A;  4DTU A;  2HBL A;  4AIL C;  1J53 A;  3OBW A;  3O8M A;  4C23 A;  4FM1 A;  3R3L A;  2HNY A;  3V1R A;  3EZ5 A;  1RT6 A;  3WNE A;  4DTX A;  4B8A B;  5JMV A;  1GLB G;  4KV8 A;  5AJ3 K;  2RHK A;  4MFB A;  1GLA G;  1RT5 A;  4I9Q A;  3VN5 A;  4CJQ A;  1RGI A;  4BR5 A;  3T1Y K;  2ITG A;  1GLE G;  1I94 K;  3NCI A;  4Z4I A;  5HLF A;  4YY3 K;  5M1N A;  1NWK A;  1E4F T;  3QIO A;  2G8I A;  2F4V K;  4CIE A;  4TSX A;  3LDN A;  1HYZ A;  1T03 A;  4CJ4 A;  3BUZ B;  4BR9 A;  3O4N A;  3KIO A;  1RIL A;  4QS8 A;  2P9K A;  2QXL A;  3NH2 A;  1N36 K;  4OGC A;  3UKR B;  3MEC A;  4A5B A;  3P4I A;  4BRN A;  1HYV A;  4JI1 K;  3ZT2 A;  5KPR A;  4XH5 A;  1TV6 A;  4DF8 A;  2NRR A;  5AFU H;  4FJ7 A;  4FJ9 A;  2E1Y A;  1BO5 O;  1S22 A;  4A57 A;  5BR9 A;  3CPW M;  3FGU A;  4B1Y B;  1HNZ K;  3QEV A;  5FDL A;  2RKI A;  2P9L B;  3TWH A;  3QEW A;  5KPT A;  1UOC A;  4DLE A;  3HVR A;  4EZ9 A;  3QFP A;  4H0V B;  1Q7Y O;  3NVM A;  4FJ8 A;  4GW6 A;  4LFC K;  5HRP A;  4X65 K;  2F8S A;  5LMU K;  1BA0 A;  5FRN A;  3QDK A;  3D2E A;  2EX3 A;  1RFQ A;  3BP8 A;  4RWT A;  3R1X A;  3D2E B;  3O9R A;  1VSI A;  2VWJ A;  2G8F A;  1TAU A;  1U2V A;  1T7P A;  1VQK N;  4KBO A;  4BVO A;  3C6T A;  3C94 A;  3EEQ A;  2Q0U A;  5DK5 A;  5FPD A;  4DFK A;  2Q2R A;  3OS2 A;  3OYE A;  3HRG A;  4IWV A;  1LV5 A;  1SQK A;  4JYA K;  2A42 A;  3O5B A;  4CEO A;  1D5A A;  1ZC6 A;  1N34 K;  3NFA A;  1R0A A;  4YNQ A;  2BDP A;  2JWK A;  1K8K B;  3KKR A;  3QEX A;  4BC4 A;  1BI4 B;  5C24 A;  1MWK A;  3OYA A;  1KQS M;  3KLI A;  2HBK A;  4LF7 K;  3A8Y A;  5TKW A;  5J2M A;  3THY B;  3ZT3 A;  2XY7 A;  1ASV A;  5BRH A;  2D0A A;  2VG7 A;  3FE1 A;  5AQK A;  3VER A;  2AP1 A;  4KAZ A;  3HJF A;  4JKE A;  2QTD A;  5JS2 A;  2R7Y A;  1N6Q A;  1OVQ A;  5EOY A;  3MX2 A;  1QVG M;  4FVU A;  2GUP A;  2YKN A;  4NCB A;  4JNE A;  2FF6 A;  4A2B A;  3J7Z O;  1VQ7 N;  1W97 L;  2B5J A;  3G0Z A;  3THX A;  2YI1 A;  3C95 A;  2W42 A;  4YFU A;  3OS0 A;  3WXM B;  4CEF A;  4KH5 A;  4FPA A;  5ELZ A;  1A5W A;  2A40 A;  4CZE A;  4DTR A;  4IG0 A;  5C12 A;  3MK6 A;  2WTU A;  4Z94 A;  3CM6 A;  5BN8 A;  1WBD A;  3EN9 A;  1W0H A;  1D9D A;  4H4M A;  4JKD A;  3OYH A;  4CW7 B;  2XO7 A;  3WEE A;  3VGL A;  4NO7 A;  2D4W A;  3M6G A;  3TI0 A;  1SL2 A;  1RDC A;  3TR8 A;  3LAM A;  1S1X A;  5SWM A;  2QWR A;  1TK8 A;  3EY1 A;  1S6Q A;  1FJG K;  3SQ0 A;  3LPU A;  3JAM O;  3CHW A;  3D0P A;  5AQG A;  4DF4 A;  5BR8 K;  3SCX A;  1VQ5 N;  3NH0 A;  3PV8 A;  1QSS A;  4BY9 C;  1DGK N;  3KJV A;  3OY9 A;  1EXQ A;  3I0S A;  1NGJ A;  1O1W A;  3PLA A;  3QML A;  1J54 A;  2HBM A;  1U49 A;  1WSI A;  4B1X B;  4O8U A;  1GLD G;  4DS5 A;  4IFV A;  5FPE A;  1BHL A;  4A2A A;  2PY5 A;  4LFB K;  3F73 A;  3AVJ A;  3ZSV A;  3V81 A;  3EYZ A;  4ID5 A;  4JRP A;  2IGI A;  3UKR A;  3CCM N;  4IFE A;  3AVG A;  3TAG A;  3L2Q A;  1RBU A;  1HYS A;  4WF9 L;  4KB0 A;  4JV5 K;  4FW2 A;  2ZM6 K;  1HKB A;  2Z1J A;  1XHX A;  5F1X A;  3H46 O;  5HRR A;  4JAX A;  4DB3 A;  1D8Y A;  5GAH P;  1OH6 A;  3V4I A;  1IBM K;  2NRH A;  5CR4 A;  3VQ5 A;  1L3U A;  3FZM A;  4O5F A;  4DU1 A;  1H1V A;  1QTM A;  2O8F A;  2IC3 A;  4B8C A;  2OAN A;  3LZJ A;  3SUP A;  4BGA A;  2P9S A;  1RDD A;  2D5R A;  4F2S A;  4CJS A;  4BQZ A;  3OYN A;  1X3N A;  3S9H A;  5AQT A;  4JKH A;  3GBT A;  4ZTF A;  3CCL N;  2F96 A;  3KHY A;  4BC5 A;  4I6M B;  1QS4 A;  2DPN A;  1IG9 A;  4DR6 K;  3ENB A;  4DQ8 A;  1SKS A;  3TPQ A;  4CEA A;  5AQI A;  1OH5 A;  4ISG A;  2QKK A;  3L2U A;  3OHR A;  4JD2 A;  1RDB A;  2BE2 A;  4FJH A;  1TL1 A;  4OPH A;  4B1W B;  4L8R B;  4B3O A;  4DV7 K;  2A6A A;  3THY A;  3H45 C;  3Q7C A;  1NBW A;  1BU6 O;  2X74 A;  1HQE A;  4DV2 K;  3RMA A;  3ULD A;  3HPH A;  5CZ1 A;  2AJQ A;  2IIR A;  1Q8I A;  3O9S A;  4LY7 A;  4B08 A;  4CJL A;  4MO5 A;  5I42 A;  4FZX C;  1NJI O;  2YHW A;  4BC2 A;  3KK7 A;  3M8R A;  4CJ3 A;  1YTA A;  1K8A O;  4YOR A;  2HF4 A;  2Q36 A;  2HVI A;  3TTC A;  5C2F A;  4GY2 B;  3T1H K;  3MEG A;  3J8A A;  5HRS A;  3C7N B;  4A59 A;  3O9Q A;  3P1G A;  3C7N A;  4KHW A;  2ZJP L;  3ITH A;  4KKO A;  2OPQ A;  5FPM A;  4JS4 A;  4EHT A;  3DAW A;  1DKG D;  2ETJ A;  3BGR A;  4GNI A;  1QQC A;  4E89 A;  4BE2 A;  4FWM A;  1QHA A;  4YDU A;  4F4K A;  2HOE A;  5E26 A;  3KZB A;  2D0C A;  5CZ2 A;  2WOM A;  3U3G A;  3K57 A;  3RMC A;  4YOU A;  3ZYY X;  4CFB A;  2W6K A;  4CER A;  1EP4 A;  4H4O A;  1KLM A;  3QER A;  3HT3 A;  2E6L A;  2KW4 A;  4JHD B;  4DV5 K;  4KHY A;  1YXQ A;  3RVC A;  1L3T A;  1M90 O;  4N41 A;  2FLO A;  2O8B B;  4I2P A;  3VMF B;  1CXQ A;  4H0O A;  3V1Q A;  1HJR A;  3O4Q A;  4CBW A;  5BRF A;  5CHI A;  2GUI A;  1YVU A;  2Q1N A;  4NLB A;  1TVR A;  1W7A A;  2FSK A;  4C8O A;  2KHO A;  1SAZ A;  5JVH L;  2HHW A;  2A1R A;  1WN7 A;  1ZYQ A;  4JI7 K;  4DSL A;  4GV6 A;  3VQ6 A;  3PUF A;  1MDU B;  3LWM A;  2LSN A;  3CJ9 A;  1JLE A;  5M1Q A;  4FLV A;  4FZZ A;  2HHU A;  1BWF O;  2A3Z A;  2GV9 A;  4C1N I;  3Q7B A;  3MXM A;  4JHD A;  3V9S A;  3IRX A;  3CIP A;  4CJF A;  4Y1D A;  3TAF A;  2PBD A;  1VHX A;  3ZSO A;  1TYQ B;  1HMV A;  5J1E A;  3MN5 A;  4FCY A;  3OA9 A;  4Y0W A;  1NKC A;  4XEI A;  1WNS A;  1TUU A;  4CZI A;  4BDY A;  1TAQ A;  4B9L A;  3WNH A;  3PX0 A;  4FJK A;  3CPE A;  4FSV A;  3ENO A;  1J6Z A;  3UKU A;  4WCE L;  3DLK A;  5HBM A;  4JD2 B;  4LF5 K;  2FBV A;  1MU2 A;  3KVG A;  1BGX T;  4R79 A;  4IOC L;  4QS9 A;  3FLC O;  1NK4 A;  3KWI A;  4DV4 K;  2G8K A;  2B6A A;  1NK6 A;  1LAV A;  2KLA A;  1Q18 A;  3AY9 A;  3CER A;  5D3G A;  4M3R A;  4FJJ A;  4JI6 K;  1KVA A;  3SMS A;  5HRN A;  4BRA A;  1NJX A;  1E4G T;  2AA4 A;  3GE1 A;  3NGZ A;  1O13 A;  4BAC A;  1NGE A;  3DJC A;  3SUO A;  3SZ2 A;  4KI4 A;  1NK8 A;  3FZL A;  4F9O A;  4DFJ A;  1LW2 A;  4JEP A;  5EU7 A;  4NLC A;  1HR0 K;  1DTQ A;  4M3Z A;  3LM9 A;  4FWK A;  3MEE A;  1X9S A;  4OLB A;  1YAG A;  3V9U A;  3E1Y A;  3W3D A;  3M5R A;  3ZSR A;  4FJG A;  4JKB A;  4K8Z A;  2PFU A;  1ATN A;  2FXU A;  1VQO N;  1WAF A;  2FSJ A;  1BIZ A;  4G9Z A;  3DOL A;  4JKA A;  3HVT A;  3BDP A;  3LWL A;  1KD1 O;  4F3T A;  5C42 A;  4IEI A;  3CCV N;  4BVP A;  4IO9 L;  1HNV A;  3EKU A;  1BIS A;  3TSU A;  2UUA K;  3OYM A;  1DLO A;  3K9K A;  4CHZ A;  4CD3 A;  4RG8 A;  2CH5 A;  3HSC A;  3MMV A;  1WOQ A;  5CY4 A;  4CCH A;  1CZA N;  1VQ8 N;  2HW3 A;  4K42 A;  2YHX A;  2D1K A;  2NUB A;  2DFF A;  5FRM A;  4B9V A;  1EWR A;  4CZH A;  2P1J A;  4GV9 A;  2X78 A;  4FLY A;  4DR1 K;  4FVM A;  4FJI A;  5IWA K;  4WFA L;  1N33 K;  4DTN A;  3CFP A;  2KFN A;  3FFK B;  4ELU A;  2RF2 A;  4JS5 A;  3VQ4 A;  4A62 A;  4PKH A;  3LDP A;  1QVF M;  3KD5 E;  5AQF A;  3A2F A;  4MQ3 A;  2QK9 A;  4J2D A;  2IAJ A;  3O3F A;  3IS9 A;  1Z05 A;  3MDQ A;  3M8P A;  3VEY A;  3ENH A;  4ELV A;  1RDW X;  4M41 A;  4BQL A;  2ATQ A;  3F2K A;  3LDQ A;  3D2F A;  3EE9 A;  2F9W A;  1HLU A;  2E4L A;  2X6S A;  4AQY K;  3VGM A;  3VQ7 A;  3A5L C;  3AAP A;  5A2Q O;  2NRT A;  3C6H A;  4CGD A;  4MO4 A;  3HZ6 A;  3T1A A;  4JK9 A;  3F5T A;  3PSF A;  4EZ6 A;  2KZM A;  2O8F B;  2FSN A;  5TKY A;  4O44 A;  2QWM A;  2W40 A;  3VES A;  3S3O A;  4Y1C A;  3KD1 E;  2W6L A;  3ATU A;  3EKS A;  4CI6 A;  4J2A A;  4IJN A;  1EET A;  4WYB A;  1HNX K;  3PSI A;  4IXC A;  1U2V B;  2O4I A;  3BZK A;  3J7A P;  4I6M A;  1WSF A;  5K14 A;  4IDK A;  4DMN A;  1XC3 A;  1JJ2 M;  4FWS A;  4DSE A;  3VQP A;  1K8K A;  1S1U A;  1I3A A;  4CZJ A;  3T19 A;  4BE0 A;  4BRD A;  1L3S A;  3IDH A;  3QNN A;  1MWM A;  4LC9 B;  1Z25 A;  3H1Q A;  3J80 O;  4DQQ A;  2O8E A;  2P9N A;  2A5X A;  3T7Z A;  4CEC A;  4DLG A;  3QLH A;  4QOZ B;  4DR3 K;  4B9S A;  1IBL K;  2IVP A;  1B92 A;  2D0O A;  1ESV A;  4GKK K;  3CME N;  3U8X A;  4PY5 A;  3NF7 A;  1EWQ A;  4RW8 A;  1XWL A;  4ILJ A;  4K25 A;  3L2R A;  1VQP N;  3CCE N;  1IO2 A;  2ZGY A;  3KLF A;  3THW A;  3WXI A;  4WE1 A;  3IG1 A;  1CXU A;  2ZE2 A;  3ZET B;  3P83 D;  3VF4 A;  4QAG A;  3KK2 A;  3QO9 A;  1X9M A;  1S9G A;  5BPM A;  4DUY K;  3QEP A;  1RTH A;  2V51 B;  4CJ7 A;  4FYD A;  1KAX A;  1Z26 A;  3K58 A;  2QWL A;  1NU0 A;  1KLN A;  1VQ6 N;  1LWE A;  2DFE A;  1JLG A;  3AAR A;  3AO4 A;  3BF3 A;  4DHY A;  1ZXO A;  1KVC A;  4BR4 A;  3V1O A;  3SQ2 A;  4RW4 A;  3LPT A;  2W41 A;  3O4W A;  4Z4C A;  2NRX A;  4ILH A;  4DCH A;  1UA0 A;  3CCU N;  4ICL A;  4RW9 A;  2FBX A;  3QFU A;  4YHH K;  4QS7 A;  1RT1 A;  3V9W A;  5C25 A;  2BUP A;  5HRO A;  1G15 A;  2OCE A;  5C15 A;  1ASW A;  1V4T A;  4IJA A;  1Q82 O;  2XRI A;  4KTZ A;  1D9F A;  3CJB A;  5KGX A;  5DMR A;  4CED A;  3VET A;  4GV3 A;  1YJ9 N;  4AHT A;  4JI2 K;  3K5M A;  3B6O A;  3CFR A;  5JLH A;  4FOE A;  3C6A A;  1RBR A;  1NGD A;  2O8B A;  1CZB A;  3U9D A;  4M3Y A;  2NRV A;  2Z1H A;  2ZJR L;  4DQS A;  3P31 A;  4AHV A;  4M3U A;  3M8S A;  4DSK A;  5AQY A;  5HOO A;  1C1A A;  1HPZ A;  3VQC A;  1EX4 A;  4CHP A;  1UAX A;  1WSE A;  1TKT A;  1VQ4 N;  2P9U A;  1NK5 A;  2FBY A;  3WUH A;  3KTQ A;  1C0G A;  1F21 A;  1S72 N;  3CJA A;  1RTJ A;  5E84 A;  5LJV A;  3E01 A;  3E9L A;  1SKW A;  4O5B A;  4BDP A;  1TKX A;  5LL6 Z;  4ISE A;  4H0X B;  1U48 A;  2YHY A;  4Z4E A;  1NGG A;  4OKJ A;  3LP0 A;  4ID1 A;  1KC8 O;  3AVN A;  2YKM A;  3RSE B;  3O1W A;  1XNQ K;  2B4J A;  1KXP A;  4B1U B;  4N47 A;  4MLH A;  3DLE A;  1IG8 A;  2PZS A;  1KVB A;  2OPR A;  4KB1 A;  1JLA A;  5M1P A;  3TU5 A;  4JI8 K;  4E19 A;  1RNH A;  3C0B A;  3VOV A;  4BRP A;  4BR7 A;  4CZM A;  3T3F A;  4HCC A;  1KFS A;  2FBT A;  3NH1 A;  2YCH A;  4W5O A;  4MDB A;  5AQU A;  2UUC K;  1SS6 A;  1HQU A;  3ZSY A;  3QIP A;  4B9U A;  1IKW A;  1BI4 A;  3TAB A;  3L4I A;  4FWO A;  1NGB A;  4EIA A;  2VYP A;  4HVJ A;  1KAY A;  1NG9 A;  1Q86 O;  1Q9X A;  4Z4F A;  4IOA L;  1GOB A;  2YNH A;  2OTJ N;  1J5O A;  3OW2 M;  3J7Y P;  3AVK A;  1OH7 A;  4FW1 A;  3CCR N;  2I5J A;  4JN4 A;  4WQ4 C;  4JI3 K;  4LF6 K;  3VQ8 A;  3DLG A;  2UUB K;  4DTS A;  2QWO A;  3I33 A;  1GLL O;  3VQB A;  4KHS A;  2D0P A;  2P9I A;  3I56 N;  4CF8 A;  4HUE A;  4H5V A;  2Q3S A;  3OYL A;  4N76 A;  4KHQ A;  2V7Y A;  1YUW A;  1GOC A;  1RDU A;  5DM7 L;  3I0R A;  3SNN A;  1EKE A;  4BR0 A;  2DFH A;  1TKD A;  3ZCM A;  1GLJ O;  3I55 N;  4Q0B A;  5F2R A;  1S3X A;  4JKC A;  4BRK A;  4B9M A;  1JKH A;  4AHU A;  1VSF A;  3RRH A;  1VRT A;  4CF1 A;  2FF3 B;  5GAE P;  4IZ9 A;  3MXJ A;  3DRS A;  1NJZ A;  1X3M A;  4O55 A;  4FO0 A;  3WNF A;  4B3S K;  2YHA A;  3M3Z A;  3NF9 A;  4X62 K;  3OBY A;  1VQL N;  4W5N A;  3CJ1 A;  4H0Y B;  3DMJ A;  4LF9 K;  1LW0 A;  3L6Q A;  3HPG A;  2P51 A;  4LF8 K;  1RT7 A;  4DU4 A;  2P5O A;  4CF2 A;  3DLB A;  4C8M A;  1T3V A;  2P9U B;  4ISF A;  2YX6 A;  4IG3 A;  1NMD A;  4O0I A;  3ZSZ A;  3WT0 A;  5KRT A;  4KRE A;  1CLQ A;  3O08 A;  4KFB A;  3MXI A;  2DY4 A;  4I7F A;  3CXC M;  4CJ5 A;  4IKF A;  3HK2 A;  3SBT A;  3DLR A;  1GLF O;  1X1P A;  3UE5 A;  3KK3 A;  1NGH A;  4N56 A;  2VQF K;  1FK9 A;  1QQO A;  3LAK A;  3CET A;  3DM2 A;  2HHT A;  2YNF A;  1ITG A;  3FR0 A;  2E1Z A;  3IUC A;  5JVG L;  2QWP A;  4PL8 A;  1HKC A;  3DRP A;  3SPY A;  2P9S B;  5GAG P;  3VF2 A;  4PKG A;  3OYI A;  2HND A;  4BRE A;  3P38 A;  2OA8 A;  3ZET A;  3DLH A;  2XY6 A;  3AA2 A;  5AQO A;  1T6D A;  3VQD A;  3OYC A;  3RMB A;  3K0S A;  5CE3 A;  1NK9 A;  2HHH K;  1NOZ A;  5T7B A;  1S1V A;  4DFM A;  3OYF A;  3LM2 A;  3B6P A;  3THV A;  4YOV A;  1SL1 A;  2QEX N;  3PX6 A;  4DFP A;  4UY8 O;  1C0M A;  4JK8 A;  2GEL A;  2E2Q A;  3I8D A;  2O8E B;  4DQR A;  3CD6 N;  5JIC A;  3CG7 A;  4AH9 A;  4GVE A;  1BDG A;  4JK7 A;  2XY5 A;  3S3N A;  1WUA A;  2Z1G A;  2E2O A;  3AO2 A;  1B9D A;  3F9K A;  3V9X A;  1B9F A;  4DWI A;  2YNG A;  1VQN N;  4CEZ A;  1MA9 B;  3VTH A;  3MN9 A;  1RDA A;  3MWP A;  2HB5 A;  3GL1 A;  3K5L A;  3ISN C;  2E20 A;  3RTV A;  4L3Q A;  5J2N A;  4I2Q A;  3NVK A;  3SV4 A;  3AO3 A;  1JLF A;  4H0T B;  3VQA A;  2J4R A;  3A5N C;  4CEE A;  4E1M A;  3DYA A;  4LFA K;  3CJ7 A;  5AZJ A;  4AHR A;  3CFO A;  4FM2 A;  4E7K A;  3J81 O;  4CHQ A;  3VQE A;  4NXN K;  3MN7 A;  4JRQ A;  1WSH A;  2F7T A;  2WBN A;  4AM7 A;  1BIU A;  4IBN A;  3RR8 A;  3UIQ A;  3UB5 A;  4RCH A;  1NGC A;  3G10 A;  2O8D A;  2NLX A;  3VQQ A;  4H5N A;  1RT2 A;  2UXC K;  1N8R O;  3TAQ A;  3RR7 A;  4NCA A;  4OPA A;  3VEO A;  1HKG A;  1YVN A;  3VEZ A;  2NRZ A;  2WON A;  4CFC A;  3H6E A;  1U45 A;  1YJW N;  4WFB L;  5I3U A;  1XUP O;  2UXD K;  5EXW A;  2I7P A;  3MCA B;  4JKF A;  2PAV A;  5GIO A;  3S3M A;  1E3M A;  4DG1 A;  3JXU A;  2OZS A;  4BRL A;  4XIU A;  1NGA A;  1SUQ A;  5AQX A;  5IT9 O;  4FLU A;  4FK0 A;  4AHS A;  4CES A;  4Q5V A;  4RTF D;  5JLF A;  4BDZ A;  4W5R A;  1R59 O;  2CH6 A;  2P9K B;  5AQQ A;  4HHT A;  3LDO A;  2OPS A;  3R8E A;  3JYT A;  5AQM A;  4FJN A;  1WSJ A;  4A61 A;  3SI6 A; 
#chains in the Genus database with same CATH homology
 3LAM A;  1S1X A;  5SWM A;  2XHB A;  1TK8 A;  1L3S A;  2A1S A;  1C6V A;  1LAW A;  1TL3 A;  3EY1 A;  5KGW A;  3QNN A;  1S6Q A;  3PO4 A;  4CE9 A;  3SQ0 A;  3PX4 A;  3LAN A;  3LPU A;  3AA5 X;  4B9T A;  1Z25 A;  2E6M A;  4DQQ A;  4ZHR A;  3L2W A;  3D0P A;  3RWU A;  4DF4 A;  1X9W A;  3SCX A;  4CEC A;  4DLG A;  4F3O A;  3NH0 A;  2PYJ A;  3QLH A;  3AVC A;  3PV8 A;  1QSS A;  4PUO A;  4QOZ B;  4CIF A;  4W5Q A;  4B9S A;  3KJV A;  3OY9 A;  1EXQ A;  3I0S A;  3L3V A;  1B92 A;  4CFA A;  1O1W A;  1CZ9 A;  4PY5 A;  1BQM A;  2BAN A;  3NF7 A;  1BCM A;  4RW8 A;  1XWL A;  3AV9 A;  1VSD A;  3QNO A;  2JGU A;  1J54 A;  4M45 A;  4FLW A;  1I3A A;  3L2R A;  3TAM A;  3VA0 A;  1U49 A;  4FZY A;  1IO2 A;  1WSI A;  1ZBI A;  4KTW A;  3NGY A;  2IOC A;  4CHN A;  3KLF A;  1KFD A;  4IFV A;  4DS5 A;  1BHL A;  3T19 A;  2HVH A;  3O3H A;  4WE1 A;  1Y97 A;  2PY5 A;  3IG1 A;  1CXU A;  2ZE2 A;  4N5S A;  3P83 D;  4QAG A;  1RT3 A;  1RT4 A;  3KK2 A;  3QO9 A;  3F73 A;  1S9G A;  3AVJ A;  3ZSV A;  4FLX A;  3V81 A;  1X9M A;  3QEP A;  3LP2 A;  1RTH A;  3EYZ A;  4ID5 A;  3NDK A;  4FXD A;  4JRP A;  4HUG A;  2KTQ A;  2IGI A;  2VG5 A;  4FYD A;  1VSK A;  1Z26 A;  3K58 A;  1KLN A;  4M3X A;  1LWE A;  2DFE A;  1JLG A;  3AO4 A;  1FKP A;  3AA4 A;  3AVG A;  3TAG A;  3L2Q A;  1RBU A;  1HYS A;  5JS1 A;  4GVM A;  3OJU A;  3V1O A;  5J2P A;  2HNZ A;  4KB0 A;  3ZSW A;  3SQ2 A;  4FW2 A;  4RW4 A;  3LPT A;  4CK2 A;  4LSN A;  3ZT4 A;  4Z4C A;  2Z1J A;  1XHX A;  4FLT A;  5HRR A;  4CGF A;  1C0T A;  4DTO A;  1UA0 A;  3NF8 A;  2DTU A;  4ICL A;  4RW9 A;  2FBX A;  1D8Y A;  1C1C A;  3MED A;  4F2R A;  2D0B A;  1VSL A;  3V4I A;  5KRS A;  1RT1 A;  3V9W A;  3VQ5 A;  5C25 A;  3H08 A;  5HRO A;  1G15 A;  1L3U A;  4DQI A;  1ASW A;  2HHS A;  1NJY A;  3TAE A;  1L3V A;  1A5V A;  3AVM A;  4DSI A;  2XRI A;  4KTZ A;  5KI6 A;  4DU1 A;  1D9F A;  2KZZ A;  5KGX A;  3AVI A;  3SUN A;  3LP3 A;  5DMR A;  4CED A;  1QTM A;  2G8U A;  2IC3 A;  4FJX A;  4B8C A;  3K5O A;  4AHT A;  3LZJ A;  3SUP A;  5CYM A;  1L5U A;  3K5M A;  3B6O A;  4KI6 A;  1RDD A;  2D5R A;  3CFR A;  3CQ8 A;  4F2S A;  1SV5 A;  4CJS A;  5SZT A;  3OYN A;  1JXB A;  4ZTJ A;  1U04 A;  3S9H A;  2OZM A;  4QCL A;  1RBR A;  2OPP A;  1VSM A;  2EHG A;  1CZB A;  3VA3 A;  2F96 A;  4IFY A;  4ZTF A;  4M3Y A;  4F8R A;  2Z1H A;  4KRF A;  4CJV A;  1ZBL A;  4DQS A;  4AHV A;  4M3U A;  3AO5 A;  1QS4 A;  3M8S A;  1JLQ A;  1S1T A;  1NKB A;  1IG9 A;  3IAY A;  2G8V A;  2RPI A;  4DSK A;  4CEQ A;  1C1A A;  3NHG A;  4HCB A;  1HPZ A;  3VQC A;  1SKS A;  1EX4 A;  4CHP A;  1UAX A;  1WSE A;  4CEA A;  4FLZ A;  1TKT A;  3PO5 A;  4O0J A;  3SPZ A;  4FJN A;  3HST B;  2QKK A;  3ASM A;  1NK5 A;  3L2U A;  1N5Y A;  1LWF A;  2VG6 A;  2FBY A;  4E7L A;  1TK5 A;  2YHB A;  1RDB A;  2BE2 A;  1IH7 A;  2O4G A;  3KTQ A;  2Y1I A;  4FJH A;  1TL1 A;  1F21 A;  3KLE A;  1RTJ A;  1GOA A;  1NJW A;  4L8R B;  2XY8 A;  4B3O A;  3KK1 A;  3E01 A;  3V9Z A;  1SKW A;  4O5B A;  4BDP A;  1TKX A;  1T8E A;  1U48 A;  4Z4E A;  4M3W A;  2X74 A;  1HQE A;  3LP0 A;  4G1Q A;  4ID1 A;  2ZD1 A;  4OKJ A;  4EP4 A;  4DTJ A;  3RMA A;  3D45 A;  3ULD A;  3HPH A;  5CZ1 A;  2AJQ A;  3AVN A;  2YKM A;  1Q8I A;  1BL3 A;  4E7I A;  3NGI A;  5E41 A;  2B4J A;  4CJT A;  3OYB A;  4OGE A;  4LY7 A;  4B08 A;  4N47 A;  3DLE A;  4CJL A;  3SV3 A;  1JLB A;  5I42 A;  4FZX C;  3DRR A;  4DSF A;  2PZS A;  1NK0 A;  1KVB A;  1IKV A;  2OPR A;  4AHC A;  4KB1 A;  1C0U A;  1JLA A;  3SJJ A;  4FK2 A;  4E19 A;  1RNH A;  3M8R A;  3CYM A;  2P5G A;  1TAU A;  4CJ3 A;  1S5J A;  1YTA A;  1KTQ A;  3OVN A;  4CJE A;  4DSJ A;  1ZBH A;  2PYL A;  1VRU A;  4LH5 A;  2BGG A;  3T3F A;  2HVI A;  4HCC A;  1JL2 A;  4CIG A;  1KFS A;  3MEG A;  2FBT A;  3NH1 A;  4W5O A;  5HRS A;  4E0D A;  1BCO A;  3PY8 A;  1IKX A;  3K5N A;  3P1G A;  1QSL A;  4KHW A;  1HNI A;  1HQU A;  3ITH A;  3ZSY A;  4KKO A;  2OPQ A;  3QIP A;  5FRO A;  1JXE A;  4JS4 A;  4M3T A;  2Y1J A;  2ETJ A;  4B9U A;  3BGR A;  1IKW A;  1BI4 A;  1QQC A;  3NBP A;  4I9L A;  3ZT1 A;  4E89 A;  4BE2 A;  2IS3 A;  3SQ4 A;  3TAB A;  1NKE A;  4K8X A;  4F4K A;  3AVA A;  4HVJ A;  2ZQB A;  4FM0 A;  2D0C A;  5CZ2 A;  2WOM A;  3QET A;  2QKB A;  1QSY A;  3TAR A;  3U3G A;  3K57 A;  1Q9X A;  4Z4F A;  1GOB A;  3HM9 A;  3RMC A;  2YNH A;  1U4B A;  1J5O A;  4CFB A;  4CER A;  3AVK A;  4NCG A;  1EP4 A;  4H4O A;  5CYQ A;  4FW1 A;  4C8L A;  1KLM A;  4PA1 A;  3HT3 A;  3OYG A;  1TKZ A;  3QER A;  2I5J A;  2G8W A;  3K59 A;  2E6L A;  2KW4 A;  1YTU A;  1K6Y A;  4KHY A;  3VQ8 A;  2G8H A;  2KFZ A;  1L3T A;  4CFD A;  3DLG A;  4N41 A;  1I39 A;  3ALY A;  4DTS A;  3CM5 A;  1TK0 A;  1QE1 A;  4I2P A;  4DU3 A;  4OPJ A;  1RCH A;  3VQ9 A;  3VQB A;  1CXQ A;  4KHS A;  1W9H A;  3SYZ A;  1VSH A;  4CF8 A;  4E1N A;  4HUE A;  2Q3S A;  4CEB A;  4RW6 A;  4KO0 A;  3HP9 A;  1UA1 A;  3OYL A;  1KSP A;  3V1Q A;  1HJR A;  3O4Q A;  4E7J A;  4CGJ A;  3KLG A;  2GUI A;  1YVU A;  3QIN A;  3DOK A;  3WNG A;  1TVR A;  4BE1 A;  4N76 A;  4KHQ A;  4Z4G A;  3SQ1 A;  4C8O A;  4KTQ A;  2GBZ A;  1DTT A;  3ZSX A;  4CGG A;  1GOC A;  2HHW A;  2A1R A;  1WN7 A;  3I0R A;  3SNN A;  1ZYQ A;  3NE6 A;  1EKE A;  1TKD A;  2DFH A;  1BQN A;  2HHV A;  3AVF A;  3ZCM A;  4DSL A;  4Q0B A;  4HUF A;  1JLC A;  4M42 A;  3VQ6 A;  1HRH A;  3PUF A;  3LWM A;  3LDS A;  2LSN A;  1JLE A;  4B9M A;  1JKH A;  4AHU A;  1Q9Y A;  4FJM A;  1KRP A;  4FLV A;  3TAP A;  1VSF A;  3FFI A;  4FZZ A;  3RRH A;  1VRT A;  4CF1 A;  1SL0 A;  3MXJ A;  4OPK A;  3HL8 A;  3SUQ A;  1T05 A;  2HMI A;  3DRS A;  2HHU A;  1NJZ A;  1ZBF A;  4O55 A;  2GV9 A;  3WNF A;  1J9A A;  4HTU A;  3LAL A;  4H8K A;  1VSJ A;  2YHA A;  4OLA A;  4PWD A;  3MXM A;  3V9S A;  3IRX A;  4CF0 A;  4CJF A;  4Y1D A;  3HPO A;  3TAF A;  3NF9 A;  2VWK A;  4KHN A;  3ZSO A;  3HO1 A;  3L3U A;  1HMV A;  3ZSQ A;  4LH4 A;  1IKY A;  1QHT A;  4RW7 A;  4CJW A;  4W5N A;  4GMJ B;  5J1E A;  2KQ2 A;  3AVH A;  3DMJ A;  2HHX A;  3LP1 A;  3OS1 A;  4FCY A;  1LW0 A;  3OYJ A;  3KLH A;  3JSM A;  4PQU A;  3HPG A;  1TGO A;  1WLJ A;  4OVL A;  3U6F A;  1NKC A;  4OJR A;  2P51 A;  1REV A;  1U47 A;  4J2B A;  3NAE A;  1WNS A;  1RT7 A;  4DU4 A;  4BDY A;  1JL1 A;  3OYK A;  1TAQ A;  3U3Y A;  4CF2 A;  3DLB A;  2P5O A;  4B9L A;  2F8T A;  4DS4 A;  4C8K A;  4C8M A;  3WNH A;  3PX0 A;  4FJK A;  1NK7 A;  4KHU A;  3KKS A;  3L8B A;  3LZI A;  1FKO A;  5J2Q A;  3DLK A;  5HBM A;  3AVL A;  4IG3 A;  1LWC A;  2FBV A;  3ZSZ A;  4O0I A;  1MU2 A;  3TAN A;  4LSL A;  1BGX T;  4DTU A;  4CHO A;  5KRT A;  5HP1 A;  4AIL C;  1J53 A;  4KRE A;  1NK4 A;  1CLQ A;  4FM1 A;  4KFB A;  3MXI A;  2DY4 A;  1S6P A;  5KTQ A;  2HNY A;  4I7F A;  3V1R A;  4CJ5 A;  1XI1 A;  2G8K A;  2B6A A;  4IKF A;  1RBV A;  3HK2 A;  3EZ5 A;  1LAV A;  1RT6 A;  3WNE A;  3DLR A;  4DTX A;  1X1P A;  4B8A B;  4M3R A;  4CK1 A;  3KK3 A;  5D3G A;  4N56 A;  4FJJ A;  4W5T A;  1KVA A;  1FK9 A;  4KV8 A;  3LAK A;  5HRN A;  3DM2 A;  2HHT A;  1NJX A;  4MFB A;  1RT5 A;  4I9Q A;  2YNF A;  1ITG A;  3VN5 A;  4CJQ A;  3AVB A;  3NGZ A;  4Z4I A;  2ITG A;  3NCI A;  1YT3 A;  5HLF A;  4BAC A;  3SUO A;  3SZ2 A;  3DRP A;  1S9E A;  3QIO A;  4E7H A;  3AA3 A;  3SPY A;  1NK8 A;  4KI4 A;  2G8I A;  3OYI A;  4CIE A;  2HND A;  4DFJ A;  1LW2 A;  4TSX A;  1HYZ A;  1T03 A;  5EU7 A;  2OA8 A;  4CJ4 A;  3O4N A;  3HXM A;  4DQP A;  4CGH A;  3KIO A;  3DLH A;  2XY6 A;  1DTQ A;  4M3Z A;  4FK4 A;  3AA2 A;  1RIL A;  4KPY A;  3NH2 A;  1UWB A;  3VQD A;  3OYC A;  3MEE A;  2YNI A;  3RMB A;  1X9S A;  1NK9 A;  3RRG A;  4OGC A;  3V9U A;  4OLB A;  3MEC A;  1NOZ A;  3ZSR A;  4FJG A;  5T7B A;  1S1V A;  1HYV A;  4K8Z A;  3ZT2 A;  4DFM A;  3OYF A;  1WAF A;  1TV6 A;  3B6P A;  4DF8 A;  3THV A;  4C8N A;  4FJ7 A;  2YV0 X;  1BIZ A;  4CJU A;  4FJ9 A;  1SL1 A;  4CK3 A;  3DOL A;  2OYQ A;  3PX6 A;  1VK0 A;  3HVT A;  3BDP A;  3LWL A;  4CJP A;  4CGI A;  3P5J A;  5C42 A;  4DFP A;  4F3T A;  1C0M A;  3RMD A;  4R5P A;  3NF6 A;  3MAQ A;  1HNV A;  1WSG A;  1BIS A;  5FDL A;  2RKI A;  3C6U A;  3O3G A;  3I8D A;  3QEV A;  2HHQ A;  4DQR A;  3TWH A;  3QEW A;  3OYM A;  4DTP A;  1DLO A;  1UOC A;  3CG7 A;  4AH9 A;  4DLE A;  2JLE A;  4CHZ A;  3OJS A;  2XY5 A;  3S3N A;  3HVR A;  4FJL A;  4RG8 A;  4EZ9 A;  4Z4H A;  5CY4 A;  4CCH A;  2Z1G A;  3AO2 A;  1B9D A;  3F9K A;  3V9X A;  1B9F A;  4DWI A;  4UQG A;  2YNG A;  2HW3 A;  4FJ8 A;  4CEZ A;  4GW6 A;  5HRP A;  1S1W A;  4O4G A;  4FJ5 A;  3DI6 A;  1RDA A;  2NUB A;  3HP6 A;  4Z0U A;  2F8S A;  2HB5 A;  1RBT A;  2DFF A;  1XC9 A;  5FRN A;  5FRM A;  4B9V A;  3K5L A;  3ISN C;  2EX3 A;  2P1J A;  3RTV A;  3QEI A;  1RBS A;  2X78 A;  4CHY A;  4FLY A;  4FVM A;  4FJI A;  3M8Q A;  1VSI A;  4JLH A;  2VWJ A;  4I2Q A;  3K2P A;  3SV4 A;  5J2N A;  3AO3 A;  1JLF A;  2G8F A;  4DTN A;  3CFP A;  3VQA A;  2KFN A;  4CEE A;  4E1M A;  4DTM A;  4BE0 A;  3DYA A;  1SKR A;  4ELU A;  2RF2 A;  1T7P A;  4JS5 A;  4AHR A;  2FC0 A;  3C6T A;  1RTI A;  3C94 A;  3VQ4 A;  3CFO A;  4FM2 A;  5DK5 A;  4ELT A;  4E7K A;  3KD5 E;  4DFK A;  3OS2 A;  3OYE A;  3A2F A;  4MQ3 A;  1LV5 A;  4CHQ A;  1A5X A;  3VQE A;  4CEO A;  1D5A A;  2QK9 A;  4J2D A;  3NFA A;  2IAJ A;  3O3F A;  1R0A A;  3IS9 A;  1VSE A;  4YNQ A;  2BDP A;  4JRQ A;  3KKR A;  1WSH A;  3QEX A;  3M8P A;  1BI4 B;  1BIU A;  4IBN A;  5C24 A;  3RR8 A;  4LD0 A;  3UIQ A;  3OYA A;  4ELV A;  3G10 A;  4NYN A;  4E3S A;  4OKK A;  3AO1 A;  4M41 A;  3KLI A;  3VQQ A;  1NK6 A;  2ATQ A;  4OKE A;  5J2M A;  1RT2 A;  3ZT3 A;  3TAQ A;  3RR7 A;  4NCA A;  2XY7 A;  1ASV A;  2X6S A;  2E4L A;  2Z1I A;  2D0A A;  4BWM A;  4EP5 A;  2VG7 A;  3ZT0 A;  2WON A;  3VQ7 A;  4CFC A;  1U45 A;  1WAJ A;  4J2E A;  1ASU A;  4CJR A;  4KAZ A;  3HJF A;  4CGD A;  5JS2 A;  5I3U A;  4CF9 A;  2R7Y A;  1RTD A;  1N6Q A;  2X6N A;  2RN2 A;  1FXX A;  2YKN A;  3T1A A;  4NCB A;  3OYD A;  4EZ6 A;  2KZM A;  1C1B A;  2B5J A;  3HYF A;  3QES A;  4O44 A;  3G0Z A;  3S3M A;  4DG1 A;  3C95 A;  2W42 A;  3S3O A;  2OZS A;  4YFU A;  1SUQ A;  4XIU A;  3OS0 A;  4NYF A;  4Y1C A;  3KD1 E;  4CEF A;  4FLU A;  4FK0 A;  4J2A A;  4AHS A;  1A5W A;  1EET A;  4CES A;  4DTR A;  4IG0 A;  2QXF A;  4Q5V A;  4CJK A;  3L2V A;  4BDZ A;  2O4I A;  2IDO A;  4W5R A;  3CM6 A;  1NOY A;  1W0H A;  1XHZ A;  4H4M A;  1KCF A;  1D9D A;  1WSF A;  3OYH A;  2XO7 A;  5K14 A;  4IDK A;  4BWJ A;  1ZBU A;  4DMN A;  4HHT A;  4DSE A;  4B9N A;  3VQP A;  2OPS A;  3TI0 A;  1S1U A;  3JYT A;  1SL2 A;  1RDC A;  3TR8 A;  1WSJ A;  1KVC A;  3V6D A;  3SI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...