4Y1CA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
145
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase binding protein
total genus 50
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1cA00
2A1RA 1JLBA 4W5QA 3OS0A 4FLWA 3AO5A 3T3FA 4AILC 4FJIA 2KZZA 3IG1A 1VSKA 3AVCA 3DYAA 2IGIA 4CEZA 4NYNA 1EXQA 1JL1A 3NGZA 1ASUA 4OKEA 1NKEA 4BE1A 4FJHA 1IKVA 1SL0A 4JLHA 4KREA 1UWBA 1RDDA 4M3UA 1SL1A 4KHQA 3ZSOA 1HQUA 1LWEA 1IKYA 3HPOA 1L5UA 3WNEA 1RT2A 5K14A 4CGFA 4DS4A 3V1OA 2ZD1A 2ETJA 1HNVA 1TL3A 4H4OA 3O3GA 4BDYA 4FLXA 3DRSA 5HRNA 4I9LA 3ZSZA 4BACA 4Z4FA 1WAFA 1R0AA 5EU7A 1J9AA 2PYLA 4W5OA 1X9WA 5FRMA 2VWJA 2G8IA 3NGYA 1JLGA 1C0TA 1WSEA 1FKOA 1QQCA 3OVNA 3V9WA 2IDOA 2PY5A 1VSDA 4GVMA 1RBRA 3ZSYA 2GUIA 1SKRA 2X6SA 3ZT0A 1NKCA 3QO9A 3QLHA 3ZSVA 4NCBA 1TKZA 2D0AA 3RRGA 2HB5A 3T19A 3K2PA 4DWIA 1ZBUA 1ZBLA 1J5OA 2YKMA 2OPQA 3DRPA 3EY1A 1NJYA 4O55A 5C25A 1L3SA 4CHOA 3KK2A 2BDPA 1UOCA 4AHCA 1RT3A 4TSXA 5C42A 3LZIA 4FJGA 4IG3A 4IDKA 3M8QA 3CFRA 4M3TA 2B6AA 1RT5A 1KSPA 4FJKA 2IAJA 1X9SA 3PUFA 2G8KA 3TARA 2IOCA 3BGRA 5DMRA 3V1QA 3OYMA 3L2QA 1WNSA 2ZE2A 1XWLA 4DTPA 2DFHA 4C8MA 4K8ZA 1WSGA 4FJ7A 4DSIA 4Y1CA 4FK2A 3KIOA 3AVJA 3NE6A 1TAUA 4Y1DA 4KHUA 1JXBA 2FBVA 4FVMA 5HRRA 4CE9A 4OPKA 2EHGA 3CQ8A 3SQ2A 4I9QA 1C0MA 4DTSA 3IAYA 3OYLA 2KFNA 3SZ2A 3AVAA 4CERA 4CF8A 3K5NA 1KLMA 3PO5A 4CGDA 4F8RA 4KHWA 1L3TA 4B9SA 4RW8A 3NH2A 5JS2A 3KKSA 1S9EA 3ALYA 4AHRA 1N5YA 4HCBA 2DTUA 1Q8IA 4CJEA 4E7HA 4DSEA 1REVA 1HYZA 3WNHA 1BI4A 5CZ2A 5SWMA 4FJ9A 2P51A 2VG6A 1BCOA 1JLCA 2Z1IA 3ZSQA 3LDSA 3VQ8A 4CEQA 2D0BA 3AVNA 4KO0A 4CFCA 4CJKA 1NK6A 3VN5A 1B9FA 2BE2A 2ZQBA 1VSMA 4W5TA 3ASMA 4M3XA 1JXEA 3OY9A 4N5SA 2OA8A 3TR8A 3ZT4A 3DLBA 3SUQA 3G0ZA 3KLHA 4DSKA 3V9SA 3KK1A 1FK9A 3MEGA 1YVUA 1FXXA 3CM5A 5HP1A 1RTHA 3O4NA 1X1PA 2XRIA 4CF9A 4B8CA 3OYCA 1NK8A 4FK0A 4DF8A 1VSEA 4OKJA 1HPZA 3QETA 4O44A 3VQ5A 2X6NA 3ULDA 3KD5E 1IKXA 5KRSA 1S1WA 1BI4B 3C95A 4XIUA 1LAVA 4LD0A 3K58A 2G8FA 2BGGA 1N6QA 4CHNA 2FBXA 3DOLA 3AA5X 2OPPA 4CHZA 4L8RB 1F21A 1HNIA 2GV9A 3AVLA 3HL8A 1Z26A 3M8PA 3KTQA 3OYBA 2BANA 4BWJA 4C8KA 4CF2A 5J2NA 3V6DA 4E89A 4CK3A 3LANA 3NF8A 2IC3A 4LH4A 5I42A 1YT3A 3KD1E 1GOAA 3RRHA 4CF1A 4CIFA 2YNIA 4OJRA 3LP0A 2E6MA 3DLKA 3K59A 3MXMA 3HM9A 1C1CA 3SJJA 1IG9A 1WSFA 1HMVA 4O0JA 3RMCA 1KLNA 3PY8A 2B5JA 1T05A 5KRTA 4I2QA 2KQ2A 4DSJA 3SPYA 4CFAA 3S9HA 4FLVA 4OLBA 2HHSA 5FDLA 5CY4A 5SZTA 3EYZA 1NK4A 1QS4A 1WSJA 4PA1A 2OZSA 1TVRA 1BGXT 1GOBA 4OGEA 1VSJA 2VG5A 3AVBA 4BWMA 4PQUA 1TK5A 4GW6A 4W5NA 1BL3A 4CJPA 1XHZA 3S3NA 1BIUA 3OYJA 3JYTA 3PV8A 3HJFA 1VRTA 3OYKA 1XHXA 2HHUA 5HRSA 1KRPA 4IKFA 3TWHA 1D5AA 1ZBIA 1UA0A 3K5OA 1KVCA 1YTUA 1TAQA 4DQIA 3PX0A 2HW3A 3OJUA 4CJWA 4J2EA 1QHTA 4CGHA 4CEFA 1L3VA 1LAWA 4CJ5A 4DS5A 1KTQA 3MECA 3MAQA 4CIEA 2FC0A 4PY5A 3IRXA 2G8HA 3KLFA 3TAPA 1C1BA 1NK5A 4CK2A 3M8RA 2QKKA 3NGIA 4J2DA 4DQRA 4JS4A 2ATQA 5C24A 4DFJA 1WSIA 3NFAA 3VQAA 1KFDA 4I2PA 1LV5A 2XY7A 1VSLA 1RTJA 1TGOA 3SPZA 1Y97A 2XHBA 4KPYA 1WN7A 3E01A 3NF7A 4E7IA 4J2BA 2QXFA 1BQMA 1RT4A 1EP4A 4F2SA 4FJXA 4KB1A 1U49A 1UAXA 2XY8A 3MXJA 4CJUA 2QKBA 1L3UA 4CJQA 2QK9A 4B9LA 2DFFA 2OZMA 5HLFA 2YHBA 3QEIA 3TAFA 4Q0BA 3AVKA 5J2PA 1RDAA 3UIQA 3LWLA 1ITGA 4OPJA 1Z25A 1VSFA 4CEBA 4HTUA 3AO1A 1B9DA 4CEDA 4ID1A 1D9DA 2HVHA 3RMDA 1EX4A 5D3GA 3NAEA 1FKPA 2OPRA 4IBNA 4DSFA 4C8LA 3KLGA 3DLRA 4EZ9A 4FM2A 3AA3A 2P5OA 2F8SA 4KFBA 3LAMA 1TL1A 2AJQA 1CXUA 1YTAA 3ITHA 4M3WA 1BIZA 3VQEA 1BISA 4CEEA 3QNOA 4MQ3A 1TK0A 4KTWA 3LPUA 4DTXA 1IH7A 3V4IA 3PX6A 3V9ZA 3TAQA 2YKNA 2HNYA 1S1VA 1RBTA 1RBVA 4G1QA 3H08A 3QEWA 1JL2A 4ICLA 1QSSA 3RWUA 4KAZA 3L8BA 1U45A 4QCLA 3SV4A 3QEVA 4HUEA 3HO1A 1TV6A 3HPGA 4NYFA 2VWKA 4C8NA 4B9NA 4Q5VA 3LP2A 2HHWA 1XI1A 4FXDA 1VSIA 3OS2A 4E1NA 4DLGA 3VQPA 3SV3A 1JLFA 1RNHA 1A5XA 3SQ0A 1LWFA 1LW0A 4AHUA 2X78A 3U3GA 4BDPA 2XY5A 1U48A 2DFEA 3L2WA 4YNQA 4DQSA 1RT1A 3VA0A 3ZSXA 4O4GA 3KLEA 4DQQA 1ASWA 1G15A 3V81A 1C6VA 4FJ5A 3HT3A 4F3OA 1D9FA 1HYSA 3V9UA 2E6LA 4NCAA 4Z4IA 4KRFA 1CZBA 4NCGA 1DTTA 1DTQA 2Y1IA 3QIPA 4Z0UA 1SUQA 3OYEA 1TKTA 3PO4A 3SUOA 4DU3A 2Z1GA 1HYVA 4JRPA 1Q9YA 4CESA 1I39A 2PYJA 4PWDA 3MEEA 2Q3SA 1T03A 1D8YA 1IKWA 2JLEA 4KB0A 3TANA 4HVJA 1RT6A 1S6PA 2PZSA 3K5MA 4B3OA 3WNFA 4E3SA 4FLZA 1ASVA 4FJLA 1S5JA 2RN2A 3L3UA 3VQDA 2RF2A 4CJRA 3HSTB 4RW4A 4W5RA 4B8AB 3CFPA 5J2MA 4F2RA 3HK2A 1U4BA 4UQGA 3LPTA 3LP3A 3B6OA 4E19A 4CJ4A 1NJXA 2Z1HA 4B9UA 3L2RA 1QSLA 2KZMA 3SQ1A 5HBMA 4FK4A 1U04A 4Z4GA 3F73A 4PUOA 5KI6A 4AH9A 4FCYA 3TAEA 1JKHA 3DI6A 4E0DA 3WNGA 5J1EA 3L3VA 1W0HA 4K8XA 3ISNC 3AVGA 3V1RA 3CM6A 3LALA 4KTZA 4ZTFA 3T1AA 3OS1A 2EX3A 4DTJA 4FZYA 4FJ8A 4KHYA 5JS1A 1T8EA 3DMJA 2LSNA 1Q9XA 3NCIA 4CJ3A 3OJSA 2RKIA 5KGWA 3ZT1A 4CJLA 4E7LA 3RR7A 4CCHA 4M3ZA 1X9MA 1JLQA 3NH1A 4HUGA 4CJSA 3AO2A 3U6FA 4ELTA 2P1JA 5T7BA 2Y1JA 4FJJA 2Z1JA 4ELVA 4LY7A 1KVBA 4KKOA 2HNZA 3O3FA 1NOYA 1U47A 3DLHA 3SUPA 1TK8A 1MU2A 1S1TA 3S3OA 1NK7A 4ELUA 1SKSA 5DK5A 4JS5A 2KTQA 2YNGA 1NOZA 4F4KA 4HCCA 4E7KA 4CGJA 3AO3A 3K5LA 4LSLA 3HVTA 4DFKA 1XC9A 1W9HA 3AO4A 4QAGA 3VQ7A 1CXQA 3VQCA 2W42A 4FLUA 1WSHA 4DU4A 3RR8A 4FZZA 1EKEA 1KVAA 3QERA 3NH0A 3BDPA 4QOZB 3THVA 3OYNA 2NUBA 2D5RA 3KLIA 1O1WA 4MFBA 3C6UA 2O4GA 4B08A 1CLQA 2YHAA 3CG7A 3TAGA 1WAJA 4CJFA 2YNFA 4RW6A 4CIGA 4BE0A 3QIOA 4RW9A 3OYHA 4CJVA 3NBPA 1A5WA 3VQ4A 4HUFA 3AVFA 3MXIA 3RMAA 4CEAA 3JSMA 1NJZA 1T7PA 3MEDA 3A2FA 4N56A 3LZJA 2XY6A 3ZSWA 3TABA 4EZ6A 4CK1A 2YV0X 3B6PA 3VQBA 3NHGA 2YNHA 3P1GA 5I3UA 1RDBA 4O0IA 4IFVA 4B9MA 3L2UA 2G8WA 3NF6A 3FFIA 3F9KA 4OKKA 5FRNA 5CYMA 4KTQA 1JLEA 3NDKA 4N41A 3HPHA 2I5JA 3I0SA 3OYIA 3D0PA 4I7FA 4CGGA 4KHSA 4HHTA 4CGIA 3HXMA 1JLAA 4WE1A 3ZT3A 4DTUA 5FROA 3P83D 3M8SA 1WLJA 4CHYA 2HHVA 1BCMA 2WONA 2WOMA 1CZ9A 4DTNA 4DFPA 3SQ4A 3KKRA 2F8TA 4M45A 4M42A 1I3AA 1ZBFA 2GBZA 2VG7A 1UA1A 1RBSA 4FW1A 4H4MA 3VQ9A 4IG0A 4H8KA 4DMNA 3QNNA 4Z4HA 4E1MA 3AA2A 4DLEA 4FLTA 3V9XA 4DTOA 2F96A 4EP5A 3P5JA 1RTDA 4CFDA 3RTVA 3K57A 4AHSA 1LWCA 5HRPA 4FJMA 3ZT2A 1NKBA 1J54A 1SV5A 2ITGA 3HYFA 3HVRA 3QINA 1C0UA 3ZSRA 3QEXA 1VRUA 1QE1A 2IS3A 3AVIA 4ID5A 4FM1A 3S3MA 1QSYA 4DF4A 4FM0A 3SI6A 4DTMA 4DSLA 1HJRA 3QEPA 1GOCA 3QESA 4F3TA 2D0CA 1BHLA 3OYAA 1NJWA 1VSHA 2FBYA 4RG8A 2HHTA 4YFUA 4M3RA 4E7JA 4AHTA 4Z4EA 3EZ5A 2HNDA 3I0RA 3G10A 4LSNA 4DTRA 1RT7A 4FJNA 1RTIA 3KK3A 1KFSA 3AVMA 5E41A 4B9VA 4OVLA 5KTQA 2HVIA 3TI0A 3U3YA 3NF9A 4OLAA 1IO2A 4CHPA 1TKDA 1C1AA 4OGCA 3AA4A 4B9TA 3LP1A 4N47A 4J2AA 2G8UA 4DQPA 3HP6A 4CECA 5KGXA 1RILA 3D45A 3SNNA 1S6QA 3C6TA 4BE2A 3IS9A 4FYDA 3VQ6A 4FZXC 3OYFA 3AV9A 1HRHA 3OYGA 2G8VA 4LH5A 4O5BA 2HMIA 4CJTA 3TAMA 4CHQA 4FLYA 3AVHA 2JGUA 3LWMA 1RDCA 4R5PA 4ZHRA 4M3YA 1EETA 1ZYQA 3LAKA 1S1XA 1NK9A 4ZTJA 1DLOA 3KJVA 4DFMA 4KI6A 5J2QA 4CF0A 1RCHA 3ZCMA 3PX4A 1SKWA 1QTMA 4KHNA 1KCFA 4AHVA 3OYDA 4KI4A 3DM2A 2HHXA 2KFZA 2A1SA 1RBUA 1SL2A 2RPIA 1NK0A 2B4JA 3C94A 3VA3A 2OYQA 4C8OA 2O4IA 4JRQA 4CFBA 4Z4CA 1TKXA 2KW4A 3DLEA 2P5GA 2E4LA 4BDZA 3RMBA 3O4QA 4GMJB 4RW7A 4CEOA 1BQNA 4EP4A 4FW2A 3SYZA 3SCXA 4DG1A 2X74A 1HQEA 3DOKA 2XO7A 4IFYA 1S1UA 2R7YA 1S9GA 5HROA 1J53A 1VK0A 3O3HA 4N76A 4M41A 3I8DA 4DU1A 5CZ1A 3VQQA 3DLGA 1LW2A 4KV8A 1A5VA 3CFOA 2HHQA 5CYQA 1ZBHA 3CYMA 3SUNA 3L2VA 2OPSA 1K6YA 3HP9A 3DRRA 2FBTA 1B92A 2DY4A
chains in the Genus database with same CATH superfamily
3OBYA 3LL3A 4W5QA 4AILC 4FJIA 1QZ5A 3OBWA 1VSKA 2IGIA 3UKUA 1FJGK 4NYNA 1ASUA 4FJHA 1HKCA 4BE1A 1IKVA 1SL0A 2BUPA 4KREA 1RDDA 1SL1A 4MO4A 1Q18A 3WNEA 3V1OA 3MMVA 1V4SA 2ETJA 4O8KA 5HRNA 2QWOA 4BACA 1WAFA 4IEIA 1R0AA 5EU7A 2VWJA 3NGYA 1WSEA 1JLGA 2IDOA 2P9UB 4H5NA 4GVMA 3ZSYA 5BPNA 3F2KA 1W7AA 3QLHA 3ZSVA 4BGBA 1BDGA 1TKZA 2F7TA 4L3QA 1ZBUA 4GV3A 3DRPA 4O55A 4GKKK 1L3SA 2QI2A 4LFCK 5I9EB 4FJGA 3CFRA 4M3TA 4FJKA 1KSPA 3PUFA 2G8KA 5DMRA 2E1ZA 1WNSA 3O6WA 3TSQA 4DTPA 3QBXA 2QM1A 3CC2N 4K8ZA 4H0XB 1WSGA 3AVJA 4Y1DA 4KHUA 3SQ2A 2Q2RA 4I9QA 5BREA 3IAYA 3OYLA 4GVEA 3IDHA 4RW8A 3NH2A 1NLVA 5JS2A 3KKSA 3ALYA 1NGCA 5AQHA 4AHRA 5JVGL 5E84A 5BRDA 1BI4A 5CZ2A 1JLCA 3VQ8A 3UKRB 3W3DA 3CJBA 3R6MA 3TPQA 4H5TA 3HZ6A 4FOIA 4W5TA 3HSCA 4N5SA 4BG9A 3VMFB 5AQIA 3KLHA 1X9JA 3O4NA 1X1PA 4JNEA 4KHPK 4B8CA 1KAXA 1NK8A 4DF8A 1HR0K 3VOVA 1BG3A 1P90A 1P8ZA 3DAWA 1Q81O 3OYBA 2BANA 5J2NA 4JI8K 2P9LB 2IC3A 2ZJRL 1HJOA 1GOAA 5GIPA 1K9MO 5C2FA 4DHYA 3SJJA 3PY8A 1T05A 3DLLL 3CIPA 3O80A 3S9HA 4FLVA 4BC5A 5SZTA 3R8EA 1NK4A 1HPMA 1QS4A 1VHXA 3VENA 3WXIA 1TVRA 4OGEA 1YVNA 3MN9A 4PL8A 4BWMA 4GW6A 1XHZA 4ILGB 1BUPA 1BIUA 3JYTA 3PV8A 2O8FB 1VRTA 3PIOL 3CF5L 1OH8A 1UA0A 4K0KK 2HW3A 1U2VA 2E20A 2UUCK 4FPBA 2GX9A 3KK7A 1RDUA 3DWLA 1LAWA 3CCMN 4DS5A 1E4GT 3HRGA 1SZ2A 1IG8A 4PY5A 1S3XA 3IRXA 3JS6A 2G8HA 4B1XB 2QKKA 4DR4K 4DQRA 4JS4A 4WFNL 5C24A 5HL7L 4OPAA 3MCPA 3O08A 4EHUA 3J80O 3DXKB 3QFPA 4FWKA 1QHAA 3SPZA 3SAFA 3NF7A 4J2BA 2QXFA 1RT4A 1EP4A 4F2SA 4KB1A 3WT0A 1UAXA 4CJUA 1WB9A 4B9LA 3GDQA 3TAFA 3AVKA 3UIQA 3LWLA 1VSFA 1Z6RA 4XH5A 4BRPA 1FKPA 4C8LA 3KLGA 2P5OA 2F8SA 2AJQA 4BRAA 3VQEA 5LL6Z 2VGMA 4KTWA 3V4IA 2A42A 1RBTA 4CZGA 3H08A 4KAZA 1JL2A 4QCLA 3QEVA 3RSEB 3O9UA 1X3NA 1TV6A 3EEQA 2HHWA 1XI1A 4FXDA 1VSIA 3EL2A 3J7YP 4JKDA 4BDPA 3PIPL 2DFEA 5AZIA 4DQSA 1RT1A 3AY9A 3V81A 3V9UA 1CZBA 3CCSN 3AGKA 1DTTA 1DTQA 5ELZA 3OYEA 2P9IA 1SUQA 5FPNA 2WC9A 2Z1GA 3VEVA 1HYVA 2VQEK 1I39A 3MEEA 2Q3SA 4J8FA 3SK3A 1NGFA 4B3OA 3K5MA 4BRMA 4E3SA 1ASVA 1S5JA 2CH5A 2RF2A 3CFPA 5J2MA 4JKAA 3B6OA 1NJXA 5JVHL 1TUYA 3L2RA 4FK4A 1KC8O 1Q82O 3WNGA 5J1EA 4BGAA 4K8XA 3T7ZA 2IIRA 3V1RA 4KTZA 3LALA 3ZETB 3H45C 3OS1A 4DR6K 5JS1A 4LF6K 3D2FA 3VGKA 4A57A 1VQ9N 3ZT1A 3RR7A 2IVPA 4CCHA 3U6FA 4H0PA 4LY7A 2HNZA 4U7BA 1W2BM 1NOYA 1U47A 3CMEN 3DLHA 3SUPA 1TK8A 1MU2A 3GG4A 4FWPA 2YNGA 3L4IA 4E7KA 1NNEA 3K5LA 4DFKA 3HVTA 4FO0A 1XC9A 3AO4A 4QAGA 3WQTA 4FLUA 1WUAA 3RR8A 3W0LA 5KPZA 4FZZA 4QOZB 3THVA 3KLIA 1O1WA 2O4GA 3DXMB 3HTVA 1CLQA 3CG7A 1WAJA 5AFUH 4CJFA 2HBLA 4G9ZA 5AQQA 4CIGA 4RW9A 4CJVA 3O1WA 2HMPA 3QBWA 3MXIA 3RMAA 1NJZA 3MEDA 3A2FA 3TABA 3B6PA 1J6ZA 3GOIA 1HNWK 4KTQA 3J81O 1OH6A 2I5JA 3I0SA 2YHXA 4KHSA 1IV0A 4DUZK 4WE1A 3J8AA 5FROA 3P83D 1WLJA 3LDQA 4MLEA 4DFPA 3MN5A 4JI1K 4NXMK 3VF6A 3ZEUB 1RBSA 4H4MA 4DMNA 4H8KA 4FLTA 3AA2A 3K0SA 3O9QA 4NLBA 4Y0WA 1NKBA 1W97L 2QEXN 5M1OA 2ITGA 5FPMA 3MX2A 1OH7A 1C0UA 3FZLA 4XEIA 3O8MA 2O8CA 4IO8A 1NGEA 4DTMA 1HJRA 2P9PA 2CGJA 2D0CA 4PKGA 1VSHA 4E7JA 4Z4EA 4DV6K 2I7PA 5ADXH 4FJNA 3KK3A 3CC7N 2E8AA 5KTQA 3IMXA 3NF9A 4CHPA 4B9TA 1KXPA 2G8UA 3SAGA 2ZJQL 3I8BA 4FYDA 4FZXC 3OYGA 3TSUA 4M7YA 1NWKA 3TAMA 4CHQA 3AVHA 1ESVA 4ZHRA 1EETA 1SAZA 3KJVA 1T6DA 3ZCMA 3PX4A 1SKWA 4KHNA 4AF1A 3OYDA 2A1SA 2ZF5O 1SL2A 2RPIA 2OYQA 3VA3A 4C8OA 5KPRA 2KW4A 4BDZA 4FWNA 4B1YB 4GMJB 3RMBA 1EO1A 5JLFA 1NMDA 4DG1A 3DOKA 3E9PA 3VGMA 1S1UA 1VK0A 3MN7A 4N76A 3I8DA 3OA9A 4IWVA 3K9KA 4K25A 3KZBA 3VETA 5CYQA 3LDLA 2A1RA 1BA0A 3T3FA 2KZZA 5AQXA 1XNQK 4FVUA 3AVCA 3CQYA 1VAZA 2IVOA 4WFBL 2QXLA 3NGZA 4H03B 5DM6L 4M3UA 4QS8A 3ZSOA 1HQUA 1IKYA 1RT2A 3EKSA 4BROA 4CGFA 4DS4A 4I6MB 3UE5A 3O3GA 5HOOA 4HTLA 4UY8O 3VGLA 1YIJN 4Z4FA 3THWA 3ZSZA 5GAGP 2YJEA 1K73O 1K8KA 4W5OA 5FRMA 2G8IA 4PKHA 2V52B 1GLFO 3G4SN 2PY5A 1VSDA 3HI0A 5M1PA 4FWMA 3ZT0A 2UYTA 3CJCA 3QO9A 2D0AA 2VWBA 3ZX2A 2HB5A 3T19A 1ZBLA 1EWQA 2GWJA 1J5OA 2YKMA 2OPQA 3ZX0A 3KK2A 1UOCA 4AHCA 4CZEA 3FZHA 3M8QA 2B6AA 1X9SA 5LMUK 4WQ4C 3TARA 3OYMA 4CVNE 4DSIA 4Y1CA 3KIOA 3O4WA 4DR7K 1JXBA 4FVMA 4OPKA 3CQ8A 1E4FT 1NM1A 1VQNN 2KFNA 3SZ2A 3AVAA 3IKMA 1L3TA 3CQXA 1N5YA 1DEJA 1Q8IA 1YI2N 4E7HA 4FJ9A 1REVA 1HYZA 2E88A 5SWMA 1BA1A 3FGUA 2VG6A 3ZSQA 3LDSA 2D0BA 3AVNA 4KO0A 3ULEA 2QWRA 1NK6A 1GLDG 3VN5A 5B8HA 1VSMA 1JXEA 2O8EA 3A5NC 3GL1A 1ATSA 3DLBA 4B3TK 3SUQA 2IVNA 4DSKA 5JMVA 2O8BB 3CM5A 3MCAB 2V51B 3O9TA 3WUHA 1YXQA 4CF9A 1DGKN 5JLHA 4OKJA 1WOQA 3VQ5A 2CH6A 3ULDA 2G8FA 3K58A 2BGGA 1RDWX 2FBXA 3BEXA 5FPDA 1TYQA 4OX9K 4CHZA 1HNIA 2GV9A 3AVLA 3HL8A 1NMNA 3N4PA 4E89A 3CMAN 3CETA 4LH4A 5I42A 2E2NA 1YT3A 3QICA 4A2AA 1QVFM 2YNIA 4OJRA 2E6MA 3DLKA 3MXMA 1IG9A 4BRQA 3HM9A 4O0JA 1HMVA 2B5JA 5KRTA 4I2QA 3U9DA 2KQ2A 4WF9L 2CGLA 3I56N 3DXMA 2HHSA 5CY4A 3EYZA 1H1VA 1GLBG 3SLCA 1WSJA 4PA1A 3JXUA 4X65K 1VQLN 3CCRN 1GOBA 3FZMA 3AVBA 4PQUA 1QQNA 1NGBA 1T6CA 1HX1A 3G6EN 1TK5A 4CJPA 5M1FA 4JN4A 1DKGD 3CCQN 2AP1A 4CZFA 4IKFA 1ZBIA 1YTUA 1KVCA 4DV2K 4AQYK 3T1HK 5C12A 1NGJA 2Q0UA 4ISFA 3D2EB 4J2EA 1QHTA 4DV4K 3THYA 4CJ5A 1KTQA 3MAQA 4CIEA 2FC0A 1HUXA 3MWPA 3ENHA 3KLFA 3M8RA 3SAHA 4DR1K 3O9SA 1IBKK 2UXCK 3VQAA 2GWKA 4I2PA 4JHDA 1VSLA 5CHIA 1HNZK 5EOYA 1Y97A 2XHBA 3E01A 3HM8A 3KWGA 3H46O 4FJXA 1U49A 2QKBA 4CJQA 3BZKA 2OZMA 3QEIA 2UXBK 5J2PA 1RDAA 1Z25A 4CEBA 3THXB 2P9KB 4BG8A 5D3GA 4FWSA 4DSFA 2OPRA 3DLRA 4DV3K 3JAMO 3CJ1A 3LDPA 1YTAA 3ITHA 4M3WA 1BIZA 4CZMA 4PKIA 5KQDA 4FSVA 3ATUA 4IEEA 1IH7A 3MDQA 3DJCA 2YKNA 4G1QA 3VEWA 4CD1A 1NGGA 4CZHA 1QSSA 4A5AA 4R79A 5AJ3K 3HO1A 3KVGA 3O1BA 4E1NA 4XH4A 3SV3A 1JLFA 4L8RB 1QQMA 1LWFA 1LW0A 3L2WA 3A5MC 2E5LK 2OCEA 4O4GA 4FJ5A 3CJ9A 1D9FA 3R3LA 2E6LA 3R9PA 3CI5A 2Y1IA 5BRHA 3QIPA 3SUOA 4DU3A 4AM6A 4JRPA 4CESA 4FWQA 2FLOA 3EO3A 1VQMN 3TTFA 2JLEA 1YJ9N 2O8DB 3TANA 1RT6A 3EN9A 4BQZA 3A5LC 4BRFA 1QVGM 4W5RA 5BPLA 1O13A 3VEXA 4UQGA 1QSLA 2KZMA 1OVQA 3F73A 3TAEA 1JKHA 4ISEA 1VQ5N 4JKGA 3ISNC 4KH4A 3CM6A 3T1AA 4KHYA 2D4WA 4FZYA 1I94K 3DMJA 3NCIA 4E7LA 3OJSA 2RKIA 5KGWA 1X9MA 3AO2A 4ELTA 2P1JA 4BRCA 3WXMB 4BREA 2Z1JA 4CJ7A 4ELVA 4IJAA 1KVBA 3EE9A 4KKOA 3O3FA 5C2DA 4DV5K 1SKSA 2KLAA 4NXNK 4JS5A 2KTQA 4BRIA 4HCCA 4CGJA 3L4QA 2D0OA 3F5TA 4LSLA 2ZGYA 3E1YA 3VQ7A 3VQCA 2P9SA 3BDPA 2NUBA 2NRRA 3C6UA 4B08A 3ATVA 3A0IX 3ID6A 1C0GA 3QIOA 4JD2A 3OYHA 3SJHA 4LC9B 5AQYA 3VQ4A 4HUFA 4XH1A 3JSMA 1T7PA 2JWKA 3CCJN 3ZSWA 5AQKA 2FF6A 3NHGA 2YNHA 4B9MA 5I3UA 4IFVA 4A62A 3B8AX 1VQ8N 2G8WA 2RE2A 4OKKA 5CYMA 4DKWA 3OYIA 3D0PA 3AGRA 4DTUA 4CHYA 1BCMA 1HKBA 4DTNA 5IT9O 3SQ4A 5LY3A 5AQZA 1ZBFA 3CPEA 2VG7A 1UA1A 3QNNA 4FW1A 2GTDA 3NVMA 4V19S 3ID8A 1VQPN 4DLEA 3V9XA 2F96A 3VTIA 3K57A 4AHSA 5HRPA 1LOTB 3ZX3A 2D0PA 3C0BA 1SV5A 3Q7CA 3QEXA 2IS3A 4FM1A 3S3MA 4EHTA 4DF4A 1XQSC 2VCPA 4FWRA 1GOCA 3BP8A 3OYAA 3ENBA 2HHTA 4BRLA 4YFUA 4NB4A 3I0RA 4DTRA 3CCVN 4LSNA 1RT7A 1MDUB 3C7NA 3AVMA 4JI5K 2HVIA 1OVYA 1IO2A 4J2AA 3HP6A 2PBDA 1S6QA 4BE2A 2FSJA 3IS9A 3VQ6A 3AV9A 4BRGA 4H5WA 4LH5A 4FLYA 4NO7A 2UXDK 3P31A 3LWMA 1Q7YO 4R5PA 1ZYQA 3LAKA 4KI6A 5J2QA 4CF0A 1MA9B 3FZKA 2P9NB 4CZJA 1KCFA 2KFZA 2HHXA 3QFUA 2O8BA 3SBGA 3VERA 2YHYA 2KKZA 2NRVA 4EP4A 4RW7A 4CEOA 1YHQN 4RTFD 2XO7A 4IFYA 1S9GA 1J53A 4M41A 4LF8K 3VQQA 3L0QA 1FW6A 4MDBA 4A2BA 5AR0A 3CYMA 3SUNA 1BU6O 4RWTA 2OPSA 4PHTX 5HRRA 3DRRA 2DY4A 2VQFK 2HF4A 1S72N 1JLBA 4FLWA 3AO5A 4JK9A 3VEYA 3IG1A 1XMOK 1GLLO 4B3RK 3DYAA 4MLHA 1N32K 3U9ZA 4OKEA 4JLHA 2P9UA 1UWBA 1OKJA 2BH1A 5C0YA 4KHQA 1LWEA 1L5UA 5M1NA 4GV6A 3DRSA 5GIOA 4I9LA 4YHHK 4IZ9A 1J9AA 3H1QA 3UKUB 2FF3B 1X9WA 1KAYA 2PYLA 2F9WA 1FKOA 1QQCA 2YI1A 4O8UA 4YOVA 1RBRA 1E3MA 1SKRA 2X6SA 4NCBA 3ZYYX 4DWIA 5AQRA 3MK6A 1NJYA 2BDPA 4TSXA 5C42A 3LZIA 4IDKA 1RT5A 3CD6N 2IAJA 3V1QA 3PSFA 2ZE2A 3UKRA 3H3NO 5JICA 2NRWA 4FK2A 3NE6A 4IXCA 3PSIA 2FBVA 4CE9A 4QS9A 4B1ZA 1R59O 4YOTA 3S41A 3FR0A 4CF8A 4CERA 4JKBA 3K5NA 1KLMA 1J5EK 5M1QA 3PO5A 4KHWA 4B9SA 5IWAK 1Y64A 4HCBA 4H5VA 4CJEA 2DTUA 3J7AP 2W40A 1MWKA 1VQ4N 2P51A 2Z1IA 4FWOA 4CFCA 4CJKA 3BY5A 2ZQBA 1SQKA 3OY9A 4YOUA 5BR8K 3G0ZA 2P9LA 4O5FA 4IOCL 3VPZA 4YDUA 3V9SA 3MEGA 1FXXA 3FLCO 1RTHA 2XRIA 3OYCA 4FK0A 4JI4K 3HOSA 1HPZA 3QETA 3KD5E 1N8RO 2X6NA 5KRSA 1S1WA 1BI4B 3C95A 4XIUA 4LD0A 3J7ZO 1C0FA 5AQFA 4CHNA 2FXUA 4BY9C 3DOLA 2OPPA 4YOWA 3VEOA 3M8PA 3KTQA 4BWJA 4CK3A 4MO5A 3OHRA 3D6RA 3EKUA 4CF1A 4EFHA 2O8FA 4CIFA 4JK7A 3K59A 4FPAA 5FPEA 1C1CA 1WSFA 4DSJA 4MDAA 3FFKB 3CPWM 4OLBA 5FDLA 4DQ8A 3M6GA 2VG5A 3LDOA 4W5NA 3S3NA 3OYJA 3OYKA 2HHUA 4JEPA 5HRSA 3DXKA 1KRPA 4CZLA 1D5AA 4CBWA 2W6KA 3K5OA 1OH5A 3MX5A 4DQIA 3PX0A 3OJUA 4CJWA 1WBDA 4JI2K 3TSPA 4CEFA 3MECA 5EXWA 3TTDA 1C1BA 4JKHA 4CK2A 3NGIA 1VQKN 2ATQA 1KAZA 4DFJA 2WFBA 2D1KA 2HOEA 2Q1NA 4LFAK 2XY7A 4KPYA 1WN7A 4E7IA 5TKWA 1K8AO 4GV9A 1U2VB 2XY8A 4JKCA 4FL9A 2QK9A 4OPHA 2I7NA 2J4RA 3RSEA 2E2QA 1ITGA 4BC2A 4OPJA 4HTUA 3AO1A 3BF1A 1D9DA 2HVHA 3RMDA 4IBNA 4EZ9A 4KFBA 3LAMA 4YOXA 1TL1A 1CXUA 1BISA 3QNOA 1TK0A 4QS7A 3P4IA 4DTXA 1S1VA 1VQ7N 4ICLA 3C65A 1YITN 1U45A 2QTDA 3SV4A 4HUEA 3WXJA 4C8NA 3HPGA 1HNXK 2VWKA 4B9NA 3LP2A 1EQYA 3OS2A 5C15A 3VQPA 5MLCQ 4OO1J 1RNHA 3U3GA 1U48A 3VA0A 4C23A 4DQQA 1ASWA 2YHWA 5GAHP 1G15A 3I33A 1C6VA 1HYSA 4KRFA 3E66A 1WBBA 4B1UB 4Z0UA 1NGIA 3Q7BA 3I55N 4IFEA 1T03A 4PWDA 3ZETA 1D8YA 4B1WB 1KQSM 2PZSA 4FJLA 2RN2A 4CJRA 3HSTB 4DV7K 4B8AB 1U4BA 5AZIB 1GLJO 2QWLA 3SQ1A 5HBMA 4BR4A 4U67L 2KHOA 4WFAL 4PUOA 5KI6A 4AH9A 2P9IB 4FCYA 3QMLA 3TU5A 3L3VA 3IFRA 5LJWA 1ILYA 4ZTFA 4FJ8A 4PL7A 2LSNA 3O5BA 4CJLA 1JLQA 2WUSA 4HUGA 4B3SK 5T7BA 4FJJA 1X3MA 4BRKA 1NK7A 3S3OA 4RCHA 4ELUA 3M5RA 5DK5A 3A8YA 1NOZA 3AAPA 1W9HA 1XC3A 2H3GX 1EKEA 1YUWA 2Q36A 5DM7L 3NH0A 3QERA 4MFBA 2YHAA 3TAGA 3K9JA 4NLCA 4GNIA 1T44A 4IO9L 3AVFA 4JKEA 4BRDA 3LZJA 1KD1O 2XY6A 3ZEUA 4DV0K 3P1GA 3L2UA 4IOXA 3NF6A 3FFIA 3F9KA 5FRNA 1JLEA 1YF5L 4N41A 3HPHA 5AQWA 4CGGA 2ITMA 4HHTA 2Q31A 4BRHA 4CGIA 3HXMA 1JLAA 1U6ZA 3KKRA 3QDKA 1I3AA 3MN6A 3EZWA 3VQ9A 3FE1A 4Z4HA 4YDUC 4YY3K 4K42A 4EP5A 4X66K 3HBTA 4CFDA 3RTVA 2QWMA 1LWCA 3ZT2A 3WEEB 3F9MA 1J54A 3ZSRA 1QQOA 4ISGA 4ID5A 1JCFA 4A61A 4H0TB 1QSYA 4FM0A 3SI6A 4F3TA 3P38A 1ATRA 5EY4A 2FBYA 4LF9K 4AHTA 3NMUA 2HNDA 2NZTA 2YJFA 2AA4A 1RTIA 1KFSA 5E41A 4B9VA 4OVLA 3U3YA 4OLAA 1TKDA 3AA4A 4N47A 4CBUA 2O8CB 1VQON 1XUPO 4KBOA 3WXLA 5AQNA 3A5OC 1RILA 2ZGZA 2P9PB 5AQGA 3OYFA 5EVZA 4O5BA 4X62K 4A59A 4CJTA 5A2QO 1BO5O 2JGUA 2NNWA 4BVOA 5AQJA 2EWSA 4DR3K 3KWIA 1S1XA 4H0YB 1DLOA 3CERA 3VF2A 4DFMA 4K41A 3VTHA 1QTMA 2E2PA 3CCLN 3SMSA 4C1NI 2OANA 2WTUA 1NK0A 2B4JA 4JI6K 5BN8A 4FWLA 4JKFA 3BF3A 4CFBA 1TKXA 3DLEA 2P5GA 1ZBSA 2E4LA 1BQNA 4FW2A 2GUPA 1GLEG 1HQEA 2Q97A 4YORA 1NJIO 1ZXOA 2HSTA 4BR0A 3HOTA 3LM2A 4C1NK 1A5VA 2HHQA 4CBXA 3L2VA 3TTCA 2YX6A 4I6MA 1B92A 4LFBK 3CC4N 1EWRA 3OS0A 1IJJA 4KH6A 1NG9A 4CEZA 1EXQA 5E26A 4DV1K 1JL1A 1NKEA 1V4TA 5LJVA 4IDHA 3WQUA 2PFUA 2A40A 2W41A 2VYPA 3HPOA 1BWFO 5K14A 3OTOK 2ZD1A 1T3VA 1HNVA 1ATNA 1TL3A 4H4OA 4BDYA 3KHYA 2OTJN 4FLXA 3CHWA 3BZCA 4DR2K 3H1VX 3P39A 5FLXO 5AZJB 4LF4K 1C0TA 2ASPA 3OVNA 3C6HA 1XMQK 3CXCM 3V9WA 5AQMA 2GUIA 1NKCA 3RRGA 3K2PA 1LCUA 3IUCA 3EY1A 3THWB 5C25A 1NGAA 3H6EA 4CHOA 1JJ2M 1K8KB 1RT3A 1D4XA 4IG3A 5LMNK 2RHKA 2IOCA 3BGRA 2UUBK 5CE3A 3L2QA 1RFQA 1XWLA 2DFHA 4C8MA 3SBTA 4B1VA 4BR5A 5H1SQ 4FJ7A 1TAUA 5AFUA 2EHGA 1C0MA 4BVPA 5F0XA 4DTSA 4CI6A 4F8RA 4CGDA 1BOTO 1GLCG 1S9EA 4X64K 4DSEA 3WNHA 1BCOA 3R1XA 4CEQA 2Q0RA 4WQ5A 1B9FA 2BE2A 2ASOA 3ASMA 4M3XA 1YJNN 2OA8A 3TR8A 3ZT4A 4JV5K 4WCEL 3KK1A 1FK9A 3G71N 1YVUA 4CZIA 4CW7B 5HP1A 2HBKA 1IBLK 5KPTA 4M7XA 3MWTA 3OW2M 1VSEA 4EAHD 1ZC6A 4O44A 1IKXA 1LAVA 1N6QA 2OTLN 4H5RA 3AA5X 4IJNA 4WQ4A 3ULEB 4JI0K 1F21A 3BUZB 1NGHA 5AQTA 1Z26A 2O8EB 4C8KA 4CF2A 3V6DA 3LANA 3NF8A 3KD1E 3RRHA 4E0DA 3T69A 3LP0A 1KLNA 3RMCA 3SPYA 3D2EA 4CFAA 5ADXA 1TYQB 3AARA 5AQUA 2OZSA 1BGXT 2W6LA 1VSJA 4KH5A 3NVKA 2NRXA 2E2OA 1BL3A 3ENOA 3HJFA 1XHXA 5AQSA 3TWHA 3CJAA 1GLAG 1TAQA 4BR7A 4CGHA 1L3VA 4BR2A 2UUAK 5BR9A 4Z94A 2FSKA 3TAPA 1NK5A 4J2DA 1NBWA 2QA4N 3THXA 2P9KA 1WSIA 3NFAA 1S22A 5BN9A 1KFDA 4GY2B 1LV5A 2NLXA 1RTJA 1TGOA 4DR5K 2FSNA 1BQMA 2E1YA 3CCEN 3UB5A 1HKGA 2ASMA 4ILJA 3VESA 3MXJA 1L3UA 5M1KA 3THYB 3WEEA 2DFFA 5HLFA 2YHBA 4Q0BA 5BRFA 2A3ZA 5EX5A 2WBNA 1B9DA 1TUUA 4CEDA 4ID1A 1EX4A 4H0VB 3NAEA 3G25A 4FM2A 3AA3A 4JHDB 4CEEA 3M1FA 4MQ3A 4BR9A 1SS6A 1YJWN 3LPUA 3TAQA 3PX6A 3V9ZA 2HNYA 1RBVA 3RWUA 2NRHA 3QEWA 3L8BA 5BPMA 3E9OA 4JAXA 4NYFA 2O8DA 2HF3A 4Q5VA 3SMPA 4DLGA 3SQ0A 1A5XA 2GEMA 1IBMK 4AHUA 2X78A 4DCHA 2XY5A 4YNQA 4B3MK 3FZFA 3ZSXA 3KLEA 2GELA 3HT3A 4F3OA 2QWNA 4Z4IA 4NCAA 4NCGA 4E1JA 5CR4A 2A5XA 3PO4A 1TKTA 1N33K 1Q9YA 2PYJA 3ZLJA 2VGNA 1YAGA 1IKWA 4KB0A 4HVJA 1S6PA 3RVCA 3WNFA 4FLZA 4EIAA 3L3UA 3VQDA 4RW4A 1XNRK 4K43A 4F2RA 3HK2A 4H0OA 3LPTA 3LP3A 3O9RA 4E19A 4CJ4A 2Z1HA 4B9UA 3N4QA 4BC3A 1MWMA 1U04A 3AAQA 4DUYK 4Z4GA 1QZ6A 3DI6A 1N34K 1W0HA 4HWIA 1CZAN 3AVGA 4DTJA 2EX3A 3VF4A 1T8EA 1Q9XA 4CJ3A 4M3ZA 1M1KO 3GE1A 1M90O 3NH1A 4CJSA 2Y1JA 2ZM6K 2ZWHA 4F9OA 4JI7K 1S1TA 4A5BA 5TKYA 4JKGB 4F4KA 3AO3A 1NGDA 4DU4A 1CXQA 2W42A 1WSHA 3U4LA 1KVAA 3OYNA 2A41A 2D5RA 5AQLA 4AM7A 2YNFA 5AZJA 4YOYA 4RW6A 2HBJA 4BE0A 5GINA 2NRTA 3NBPA 3L6QA 2HBMA 4JK8A 1A5WA 4CEAA 4EZ6A 2V7ZA 4N56A 3PLAA 4CK1A 2YV0X 3VQBA 2QW9A 1RDBA 4O0IA 4GKJK 2A6AA 2P9SB 3NDKA 4I7FA 4IOAL 1Q86O 4LF7K 3QB0A 3ZT3A 3CJ7A 3M8SA 4WYBA 2HHVA 2WONA 2WOMA 1CZ9A 4JD2B 3U8XA 4WQ5C 4BQLA 2F8TA 4M45A 4ILHA 4M42A 3EE8A 2GBZA 2V7YA 4CZKA 5GAEP 4IG0A 1JCGA 4E1MA 4DTOA 3P5JA 4BC4A 1RTDA 4FOEA 4FJMA 5F2RA 4M63C 1HLUA 3HVRA 3HYFA 3CCUN 3GBTA 3QINA 1VRUA 1QE1A 2DPNA 3AVIA 4DSLA 3QEPA 5AQPA 3QESA 1DT9A 4JYAK 2YCHA 1BHLA 1NJWA 5C10A 4RG8A 4M3RA 3EZ5A 3LM9A 3G10A 4JI3K 3LDNA 3TI0A 5AQVA 2P9NA 2ZJPL 3D7EO 1C1AA 4OGCA 2QWQA 3M3ZA 3LP1A 4DQPA 1N36K 4CECA 5KGXA 3WXKA 3D45A 3SNNA 3E9LA 3C6TA 1HRHA 2G8VA 1G99A 2HMIA 1RGIA 3C6AA 2CGKA 2QWPA 1RDCA 3C7NB 4M3YA 1NK9A 4ZTJA 1VQ6N 1RCHA 1JCEA 4KI4A 4AHVA 3DM2A 2F9TA 2JWLA 3H3OB 1RBUA 2PAVA 3C94A 2O4IA 4JRQA 4Z4CA 3O4QA 5GADP 5AQOA 5KQ8A 3T1YK 2UU9K 4LF5K 2BTFA 3SYZA 3SCXA 2X74A 4B9QA 3VEZA 2R7YA 5HROA 4CD3A 3O3HA 4DU1A 1NU0A 5CZ1A 5F1XA 4BRNA 2NRZA 1LW2A 3DLGA 4KV8A 2HHHK 3CFOA 1Z05A 1ZBHA 4DB3A 1K6YA 3HP9A 2F4VK 3D2FB 2FBTA
chains in the Genus database with same CATH topology
2A1RA 1JLBA 4W5QA 3OS0A 4FLWA 3AO5A 3T3FA 4AILC 4FJIA 2KZZA 3IG1A 1VSKA 3AVCA 3DYAA 2IGIA 4CEZA 4NYNA 1EXQA 1JL1A 3NGZA 1ASUA 4OKEA 1NKEA 4BE1A 4FJHA 1IKVA 1SL0A 4JLHA 4KREA 1UWBA 1RDDA 4M3UA 1SL1A 4KHQA 3ZSOA 1HQUA 1LWEA 1IKYA 3HPOA 1L5UA 3WNEA 1RT2A 5K14A 4CGFA 4DS4A 3V1OA 2ZD1A 2ETJA 1HNVA 1TL3A 4H4OA 3O3GA 4BDYA 4FLXA 3DRSA 5HRNA 4I9LA 3ZSZA 4BACA 4Z4FA 1WAFA 1R0AA 5EU7A 1J9AA 2PYLA 4W5OA 1X9WA 5FRMA 2VWJA 2G8IA 3NGYA 1JLGA 1C0TA 1WSEA 1FKOA 1QQCA 3OVNA 3V9WA 2IDOA 2PY5A 1VSDA 4GVMA 1RBRA 3ZSYA 2GUIA 1SKRA 2X6SA 3ZT0A 1NKCA 3QO9A 3QLHA 3ZSVA 4NCBA 1TKZA 2D0AA 3RRGA 2HB5A 3T19A 3K2PA 4DWIA 1ZBUA 1ZBLA 1J5OA 2YKMA 2OPQA 3DRPA 3EY1A 1NJYA 4O55A 5C25A 1L3SA 4CHOA 3KK2A 2BDPA 1UOCA 4AHCA 1RT3A 4TSXA 5C42A 3LZIA 4FJGA 4IG3A 4IDKA 3M8QA 3CFRA 4M3TA 2B6AA 1RT5A 1KSPA 4FJKA 2IAJA 1X9SA 3PUFA 2G8KA 3TARA 2IOCA 3BGRA 5DMRA 3V1QA 3OYMA 3L2QA 1WNSA 2ZE2A 1XWLA 4DTPA 2DFHA 4C8MA 4K8ZA 1WSGA 4FJ7A 4DSIA 4Y1CA 4FK2A 3KIOA 3AVJA 3NE6A 1TAUA 4Y1DA 4KHUA 1JXBA 2FBVA 4FVMA 5HRRA 4CE9A 4OPKA 2EHGA 3CQ8A 3SQ2A 4I9QA 1C0MA 4DTSA 3IAYA 3OYLA 2KFNA 3SZ2A 3AVAA 4CERA 4CF8A 3K5NA 1KLMA 3PO5A 4CGDA 4F8RA 4KHWA 1L3TA 4B9SA 4RW8A 3NH2A 5JS2A 3KKSA 1S9EA 3ALYA 4AHRA 1N5YA 4HCBA 2DTUA 1Q8IA 4CJEA 4E7HA 4DSEA 1REVA 1HYZA 3WNHA 1BI4A 5CZ2A 5SWMA 4FJ9A 2P51A 2VG6A 1BCOA 1JLCA 2Z1IA 3ZSQA 3LDSA 3VQ8A 4CEQA 2D0BA 3AVNA 4KO0A 4CFCA 4CJKA 1NK6A 3VN5A 1B9FA 2BE2A 2ZQBA 1VSMA 4W5TA 3ASMA 4M3XA 1JXEA 3OY9A 4N5SA 2OA8A 3TR8A 3ZT4A 3DLBA 3SUQA 3G0ZA 3KLHA 4DSKA 3V9SA 3KK1A 1FK9A 3MEGA 1YVUA 1FXXA 3CM5A 5HP1A 1RTHA 3O4NA 1X1PA 2XRIA 4CF9A 4B8CA 3OYCA 1NK8A 4FK0A 4DF8A 1VSEA 4OKJA 1HPZA 3QETA 4O44A 3VQ5A 2X6NA 3ULDA 3KD5E 1IKXA 5KRSA 1S1WA 1BI4B 3C95A 4XIUA 1LAVA 4LD0A 3K58A 2G8FA 2BGGA 1N6QA 4CHNA 2FBXA 3DOLA 3AA5X 2OPPA 4CHZA 4L8RB 1F21A 1HNIA 2GV9A 3AVLA 3HL8A 1Z26A 3M8PA 3KTQA 3OYBA 2BANA 4BWJA 4C8KA 4CF2A 5J2NA 3V6DA 4E89A 4CK3A 3LANA 3NF8A 2IC3A 4LH4A 5I42A 1YT3A 3KD1E 1GOAA 3RRHA 4CF1A 4CIFA 2YNIA 4OJRA 3LP0A 2E6MA 3DLKA 3K59A 3MXMA 3HM9A 1C1CA 3SJJA 1IG9A 1WSFA 1HMVA 4O0JA 3RMCA 1KLNA 3PY8A 2B5JA 1T05A 5KRTA 4I2QA 2KQ2A 4DSJA 3SPYA 4CFAA 3S9HA 4FLVA 4OLBA 2HHSA 5FDLA 5CY4A 5SZTA 3EYZA 1NK4A 1QS4A 1WSJA 4PA1A 2OZSA 1TVRA 1BGXT 1GOBA 4OGEA 1VSJA 2VG5A 3AVBA 4BWMA 4PQUA 1TK5A 4GW6A 4W5NA 1BL3A 4CJPA 1XHZA 3S3NA 1BIUA 3OYJA 3JYTA 3PV8A 3HJFA 1VRTA 3OYKA 1XHXA 2HHUA 5HRSA 1KRPA 4IKFA 3TWHA 1D5AA 1ZBIA 1UA0A 3K5OA 1KVCA 1YTUA 1TAQA 4DQIA 3PX0A 2HW3A 3OJUA 4CJWA 4J2EA 1QHTA 4CGHA 4CEFA 1L3VA 1LAWA 4CJ5A 4DS5A 1KTQA 3MECA 3MAQA 4CIEA 2FC0A 4PY5A 3IRXA 2G8HA 3KLFA 3TAPA 1C1BA 1NK5A 4CK2A 3M8RA 2QKKA 3NGIA 4J2DA 4DQRA 4JS4A 2ATQA 5C24A 4DFJA 1WSIA 3NFAA 3VQAA 1KFDA 4I2PA 1LV5A 2XY7A 1VSLA 1RTJA 1TGOA 3SPZA 1Y97A 2XHBA 4KPYA 1WN7A 3E01A 3NF7A 4E7IA 4J2BA 2QXFA 1BQMA 1RT4A 1EP4A 4F2SA 4FJXA 4KB1A 1U49A 1UAXA 2XY8A 3MXJA 4CJUA 2QKBA 1L3UA 4CJQA 2QK9A 4B9LA 2DFFA 2OZMA 5HLFA 2YHBA 3QEIA 3TAFA 4Q0BA 3AVKA 5J2PA 1RDAA 3UIQA 3LWLA 1ITGA 4OPJA 1Z25A 1VSFA 4CEBA 4HTUA 3AO1A 1B9DA 4CEDA 4ID1A 1D9DA 2HVHA 3RMDA 1EX4A 5D3GA 3NAEA 1FKPA 2OPRA 4IBNA 4DSFA 4C8LA 3KLGA 3DLRA 4EZ9A 4FM2A 3AA3A 2P5OA 2F8SA 4KFBA 3LAMA 1TL1A 2AJQA 1CXUA 1YTAA 3ITHA 4M3WA 1BIZA 3VQEA 1BISA 4CEEA 3QNOA 4MQ3A 1TK0A 4KTWA 3LPUA 4DTXA 1IH7A 3V4IA 3PX6A 3V9ZA 3TAQA 2YKNA 2HNYA 1S1VA 1RBTA 1RBVA 4G1QA 3H08A 3QEWA 1JL2A 4ICLA 1QSSA 3RWUA 4KAZA 3L8BA 1U45A 4QCLA 3SV4A 3QEVA 4HUEA 3HO1A 1TV6A 3HPGA 4NYFA 2VWKA 4C8NA 4B9NA 4Q5VA 3LP2A 2HHWA 1XI1A 4FXDA 1VSIA 3OS2A 4E1NA 4DLGA 3VQPA 3SV3A 1JLFA 1RNHA 1A5XA 3SQ0A 1LWFA 1LW0A 4AHUA 2X78A 3U3GA 4BDPA 2XY5A 1U48A 2DFEA 3L2WA 4YNQA 4DQSA 1RT1A 3VA0A 3ZSXA 4O4GA 3KLEA 4DQQA 1ASWA 1G15A 3V81A 1C6VA 4FJ5A 3HT3A 4F3OA 1D9FA 1HYSA 3V9UA 2E6LA 4NCAA 4Z4IA 4KRFA 1CZBA 4NCGA 1DTTA 1DTQA 2Y1IA 3QIPA 4Z0UA 1SUQA 3OYEA 1TKTA 3PO4A 3SUOA 4DU3A 2Z1GA 1HYVA 4JRPA 1Q9YA 4CESA 1I39A 2PYJA 4PWDA 3MEEA 2Q3SA 1T03A 1D8YA 1IKWA 2JLEA 4KB0A 3TANA 4HVJA 1RT6A 1S6PA 2PZSA 3K5MA 4B3OA 3WNFA 4E3SA 4FLZA 1ASVA 4FJLA 1S5JA 2RN2A 3L3UA 3VQDA 2RF2A 4CJRA 3HSTB 4RW4A 4W5RA 4B8AB 3CFPA 5J2MA 4F2RA 3HK2A 1U4BA 4UQGA 3LPTA 3LP3A 3B6OA 4E19A 4CJ4A 1NJXA 2Z1HA 4B9UA 3L2RA 1QSLA 2KZMA 3SQ1A 5HBMA 4FK4A 1U04A 4Z4GA 3F73A 4PUOA 5KI6A 4AH9A 4FCYA 3TAEA 1JKHA 3DI6A 4E0DA 3WNGA 5J1EA 3L3VA 1W0HA 4K8XA 3ISNC 3AVGA 3V1RA 3CM6A 3LALA 4KTZA 4ZTFA 3T1AA 3OS1A 2EX3A 4DTJA 4FZYA 4FJ8A 4KHYA 5JS1A 1T8EA 3DMJA 2LSNA 1Q9XA 3NCIA 4CJ3A 3OJSA 2RKIA 5KGWA 3ZT1A 4CJLA 4E7LA 3RR7A 4CCHA 4M3ZA 1X9MA 1JLQA 3NH1A 4HUGA 4CJSA 3AO2A 3U6FA 4ELTA 2P1JA 5T7BA 2Y1JA 4FJJA 2Z1JA 4ELVA 4LY7A 1KVBA 4KKOA 2HNZA 3O3FA 1NOYA 1U47A 3DLHA 3SUPA 1TK8A 1MU2A 1S1TA 3S3OA 1NK7A 4ELUA 1SKSA 5DK5A 4JS5A 2KTQA 2YNGA 1NOZA 4F4KA 4HCCA 4E7KA 4CGJA 3AO3A 3K5LA 4LSLA 3HVTA 4DFKA 1XC9A 1W9HA 3AO4A 4QAGA 3VQ7A 1CXQA 3VQCA 2W42A 4FLUA 1WSHA 4DU4A 3RR8A 4FZZA 1EKEA 1KVAA 3QERA 3NH0A 3BDPA 4QOZB 3THVA 3OYNA 2NUBA 2D5RA 3KLIA 1O1WA 4MFBA 3C6UA 2O4GA 4B08A 1CLQA 2YHAA 3CG7A 3TAGA 1WAJA 4CJFA 2YNFA 4RW6A 4CIGA 4BE0A 3QIOA 4RW9A 3OYHA 4CJVA 3NBPA 1A5WA 3VQ4A 4HUFA 3AVFA 3MXIA 3RMAA 4CEAA 3JSMA 1NJZA 1T7PA 3MEDA 3A2FA 4N56A 3LZJA 2XY6A 3ZSWA 3TABA 4EZ6A 4CK1A 2YV0X 3B6PA 3VQBA 3NHGA 2YNHA 3P1GA 5I3UA 1RDBA 4O0IA 4IFVA 4B9MA 3L2UA 2G8WA 3NF6A 3FFIA 3F9KA 4OKKA 5FRNA 5CYMA 4KTQA 1JLEA 3NDKA 4N41A 3HPHA 2I5JA 3I0SA 3OYIA 3D0PA 4I7FA 4CGGA 4KHSA 4HHTA 4CGIA 3HXMA 1JLAA 4WE1A 3ZT3A 4DTUA 5FROA 3P83D 3M8SA 1WLJA 4CHYA 2HHVA 1BCMA 2WONA 2WOMA 1CZ9A 4DTNA 4DFPA 3SQ4A 3KKRA 2F8TA 4M45A 4M42A 1I3AA 1ZBFA 2GBZA 2VG7A 1UA1A 1RBSA 4FW1A 4H4MA 3VQ9A 4IG0A 4H8KA 4DMNA 3QNNA 4Z4HA 4E1MA 3AA2A 4DLEA 4FLTA 3V9XA 4DTOA 2F96A 4EP5A 3P5JA 1RTDA 4CFDA 3RTVA 3K57A 4AHSA 1LWCA 5HRPA 4FJMA 3ZT2A 1NKBA 1J54A 1SV5A 2ITGA 3HYFA 3HVRA 3QINA 1C0UA 3ZSRA 3QEXA 1VRUA 1QE1A 2IS3A 3AVIA 4ID5A 4FM1A 3S3MA 1QSYA 4DF4A 4FM0A 3SI6A 4DTMA 4DSLA 1HJRA 3QEPA 1GOCA 3QESA 4F3TA 2D0CA 1BHLA 3OYAA 1NJWA 1VSHA 2FBYA 4RG8A 2HHTA 4YFUA 4M3RA 4E7JA 4AHTA 4Z4EA 3EZ5A 2HNDA 3I0RA 3G10A 4LSNA 4DTRA 1RT7A 4FJNA 1RTIA 3KK3A 1KFSA 3AVMA 5E41A 4B9VA 4OVLA 5KTQA 2HVIA 3TI0A 3U3YA 3NF9A 4OLAA 1IO2A 4CHPA 1TKDA 1C1AA 4OGCA 3AA4A 4B9TA 3LP1A 4N47A 4J2AA 2G8UA 4DQPA 3HP6A 4CECA 5KGXA 1RILA 3D45A 3SNNA 1S6QA 3C6TA 4BE2A 3IS9A 4FYDA 3VQ6A 4FZXC 3OYFA 3AV9A 1HRHA 3OYGA 2G8VA 4LH5A 4O5BA 2HMIA 4CJTA 3TAMA 4CHQA 4FLYA 3AVHA 2JGUA 3LWMA 1RDCA 4R5PA 4ZHRA 4M3YA 1EETA 1ZYQA 3LAKA 1S1XA 1NK9A 4ZTJA 1DLOA 3KJVA 4DFMA 4KI6A 5J2QA 4CF0A 1RCHA 3ZCMA 3PX4A 1SKWA 1QTMA 4KHNA 1KCFA 4AHVA 3OYDA 4KI4A 3DM2A 2HHXA 2KFZA 2A1SA 1RBUA 1SL2A 2RPIA 1NK0A 2B4JA 3C94A 3VA3A 2OYQA 4C8OA 2O4IA 4JRQA 4CFBA 4Z4CA 1TKXA 2KW4A 3DLEA 2P5GA 2E4LA 4BDZA 3RMBA 3O4QA 4GMJB 4RW7A 4CEOA 1BQNA 4EP4A 4FW2A 3SYZA 3SCXA 4DG1A 2X74A 1HQEA 3DOKA 2XO7A 4IFYA 1S1UA 2R7YA 1S9GA 5HROA 1J53A 1VK0A 3O3HA 4N76A 4M41A 3I8DA 4DU1A 5CZ1A 3VQQA 3DLGA 1LW2A 4KV8A 1A5VA 3CFOA 2HHQA 5CYQA 1ZBHA 3CYMA 3SUNA 3L2VA 2OPSA 1K6YA 3HP9A 3DRRA 2FBTA 1B92A 2DY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1R A;  1JLB A;  4W5Q A;  3OS0 A;  4FLW A;  3AO5 A;  3T3F A;  4AIL C;  4FJI A;  2KZZ A;  3IG1 A;  1VSK A;  3AVC A;  3DYA A;  2IGI A;  4CEZ A;  4NYN A;  1EXQ A;  1JL1 A;  3NGZ A;  1ASU A;  4OKE A;  1NKE A;  4BE1 A;  4FJH A;  1IKV A;  1SL0 A;  4JLH A;  4KRE A;  1UWB A;  1RDD A;  4M3U A;  1SL1 A;  4KHQ A;  3ZSO A;  1HQU A;  1LWE A;  1IKY A;  3HPO A;  1L5U A;  3WNE A;  1RT2 A;  5K14 A;  4CGF A;  4DS4 A;  3V1O A;  2ZD1 A;  2ETJ A;  1HNV A;  1TL3 A;  4H4O A;  3O3G A;  4BDY A;  4FLX A;  3DRS A;  5HRN A;  4I9L A;  3ZSZ A;  4BAC A;  4Z4F A;  1WAF A;  1R0A A;  5EU7 A;  1J9A A;  2PYL A;  4W5O A;  1X9W A;  5FRM A;  2VWJ A;  2G8I A;  3NGY A;  1JLG A;  1C0T A;  1WSE A;  1FKO A;  1QQC A;  3OVN A;  3V9W A;  2IDO A;  2PY5 A;  1VSD A;  4GVM A;  1RBR A;  3ZSY A;  2GUI A;  1SKR A;  2X6S A;  3ZT0 A;  1NKC A;  3QO9 A;  3QLH A;  3ZSV A;  4NCB A;  1TKZ A;  2D0A A;  3RRG A;  2HB5 A;  3T19 A;  3K2P A;  4DWI A;  1ZBU A;  1ZBL A;  1J5O A;  2YKM A;  2OPQ A;  3DRP A;  3EY1 A;  1NJY A;  4O55 A;  5C25 A;  1L3S A;  4CHO A;  3KK2 A;  2BDP A;  1UOC A;  4AHC A;  1RT3 A;  4TSX A;  5C42 A;  3LZI A;  4FJG A;  4IG3 A;  4IDK A;  3M8Q A;  3CFR A;  4M3T A;  2B6A A;  1RT5 A;  1KSP A;  4FJK A;  2IAJ A;  1X9S A;  3PUF A;  2G8K A;  3TAR A;  2IOC A;  3BGR A;  5DMR A;  3V1Q A;  3OYM A;  3L2Q A;  1WNS A;  2ZE2 A;  1XWL A;  4DTP A;  2DFH A;  4C8M A;  4K8Z A;  1WSG A;  4FJ7 A;  4DSI A;  4Y1C A;  4FK2 A;  3KIO A;  3AVJ A;  3NE6 A;  1TAU A;  4Y1D A;  4KHU A;  1JXB A;  2FBV A;  4FVM A;  5HRR A;  4CE9 A;  4OPK A;  2EHG A;  3CQ8 A;  3SQ2 A;  4I9Q A;  1C0M A;  4DTS A;  3IAY A;  3OYL A;  2KFN A;  3SZ2 A;  3AVA A;  4CER A;  4CF8 A;  3K5N A;  1KLM A;  3PO5 A;  4CGD A;  4F8R A;  4KHW A;  1L3T A;  4B9S A;  4RW8 A;  3NH2 A;  5JS2 A;  3KKS A;  1S9E A;  3ALY A;  4AHR A;  1N5Y A;  4HCB A;  2DTU A;  1Q8I A;  4CJE A;  4E7H A;  4DSE A;  1REV A;  1HYZ A;  3WNH A;  1BI4 A;  5CZ2 A;  5SWM A;  4FJ9 A;  2P51 A;  2VG6 A;  1BCO A;  1JLC A;  2Z1I A;  3ZSQ A;  3LDS A;  3VQ8 A;  4CEQ A;  2D0B A;  3AVN A;  4KO0 A;  4CFC A;  4CJK A;  1NK6 A;  3VN5 A;  1B9F A;  2BE2 A;  2ZQB A;  1VSM A;  4W5T A;  3ASM A;  4M3X A;  1JXE A;  3OY9 A;  4N5S A;  2OA8 A;  3TR8 A;  3ZT4 A;  3DLB A;  3SUQ A;  3G0Z A;  3KLH A;  4DSK A;  3V9S A;  3KK1 A;  1FK9 A;  3MEG A;  1YVU A;  1FXX A;  3CM5 A;  5HP1 A;  1RTH A;  3O4N A;  1X1P A;  2XRI A;  4CF9 A;  4B8C A;  3OYC A;  1NK8 A;  4FK0 A;  4DF8 A;  1VSE A;  4OKJ A;  1HPZ A;  3QET A;  4O44 A;  3VQ5 A;  2X6N A;  3ULD A;  3KD5 E;  1IKX A;  5KRS A;  1S1W A;  1BI4 B;  3C95 A;  4XIU A;  1LAV A;  4LD0 A;  3K58 A;  2G8F A;  2BGG A;  1N6Q A;  4CHN A;  2FBX A;  3DOL A;  3AA5 X;  2OPP A;  4CHZ A;  4L8R B;  1F21 A;  1HNI A;  2GV9 A;  3AVL A;  3HL8 A;  1Z26 A;  3M8P A;  3KTQ A;  3OYB A;  2BAN A;  4BWJ A;  4C8K A;  4CF2 A;  5J2N A;  3V6D A;  4E89 A;  4CK3 A;  3LAN A;  3NF8 A;  2IC3 A;  4LH4 A;  5I42 A;  1YT3 A;  3KD1 E;  1GOA A;  3RRH A;  4CF1 A;  4CIF A;  2YNI A;  4OJR A;  3LP0 A;  2E6M A;  3DLK A;  3K59 A;  3MXM A;  3HM9 A;  1C1C A;  3SJJ A;  1IG9 A;  1WSF A;  1HMV A;  4O0J A;  3RMC A;  1KLN A;  3PY8 A;  2B5J A;  1T05 A;  5KRT A;  4I2Q A;  2KQ2 A;  4DSJ A;  3SPY A;  4CFA A;  3S9H A;  4FLV A;  4OLB A;  2HHS A;  5FDL A;  5CY4 A;  5SZT A;  3EYZ A;  1NK4 A;  1QS4 A;  1WSJ A;  4PA1 A;  2OZS A;  1TVR A;  1BGX T;  1GOB A;  4OGE A;  1VSJ A;  2VG5 A;  3AVB A;  4BWM A;  4PQU A;  1TK5 A;  4GW6 A;  4W5N A;  1BL3 A;  4CJP A;  1XHZ A;  3S3N A;  1BIU A;  3OYJ A;  3JYT A;  3PV8 A;  3HJF A;  1VRT A;  3OYK A;  1XHX A;  2HHU A;  5HRS A;  1KRP A;  4IKF A;  3TWH A;  1D5A A;  1ZBI A;  1UA0 A;  3K5O A;  1KVC A;  1YTU A;  1TAQ A;  4DQI A;  3PX0 A;  2HW3 A;  3OJU A;  4CJW A;  4J2E A;  1QHT A;  4CGH A;  4CEF A;  1L3V A;  1LAW A;  4CJ5 A;  4DS5 A;  1KTQ A;  3MEC A;  3MAQ A;  4CIE A;  2FC0 A;  4PY5 A;  3IRX A;  2G8H A;  3KLF A;  3TAP A;  1C1B A;  1NK5 A;  4CK2 A;  3M8R A;  2QKK A;  3NGI A;  4J2D A;  4DQR A;  4JS4 A;  2ATQ A;  5C24 A;  4DFJ A;  1WSI A;  3NFA A;  3VQA A;  1KFD A;  4I2P A;  1LV5 A;  2XY7 A;  1VSL A;  1RTJ A;  1TGO A;  3SPZ A;  1Y97 A;  2XHB A;  4KPY A;  1WN7 A;  3E01 A;  3NF7 A;  4E7I A;  4J2B A;  2QXF A;  1BQM A;  1RT4 A;  1EP4 A;  4F2S A;  4FJX A;  4KB1 A;  1U49 A;  1UAX A;  2XY8 A;  3MXJ A;  4CJU A;  2QKB A;  1L3U A;  4CJQ A;  2QK9 A;  4B9L A;  2DFF A;  2OZM A;  5HLF A;  2YHB A;  3QEI A;  3TAF A;  4Q0B A;  3AVK A;  5J2P A;  1RDA A;  3UIQ A;  3LWL A;  1ITG A;  4OPJ A;  1Z25 A;  1VSF A;  4CEB A;  4HTU A;  3AO1 A;  1B9D A;  4CED A;  4ID1 A;  1D9D A;  2HVH A;  3RMD A;  1EX4 A;  5D3G A;  3NAE A;  1FKP A;  2OPR A;  4IBN A;  4DSF A;  4C8L A;  3KLG A;  3DLR A;  4EZ9 A;  4FM2 A;  3AA3 A;  2P5O A;  2F8S A;  4KFB A;  3LAM A;  1TL1 A;  2AJQ A;  1CXU A;  1YTA A;  3ITH A;  4M3W A;  1BIZ A;  3VQE A;  1BIS A;  4CEE A;  3QNO A;  4MQ3 A;  1TK0 A;  4KTW A;  3LPU A;  4DTX A;  1IH7 A;  3V4I A;  3PX6 A;  3V9Z A;  3TAQ A;  2YKN A;  2HNY A;  1S1V A;  1RBT A;  1RBV A;  4G1Q A;  3H08 A;  3QEW A;  1JL2 A;  4ICL A;  1QSS A;  3RWU A;  4KAZ A;  3L8B A;  1U45 A;  4QCL A;  3SV4 A;  3QEV A;  4HUE A;  3HO1 A;  1TV6 A;  3HPG A;  4NYF A;  2VWK A;  4C8N A;  4B9N A;  4Q5V A;  3LP2 A;  2HHW A;  1XI1 A;  4FXD A;  1VSI A;  3OS2 A;  4E1N A;  4DLG A;  3VQP A;  3SV3 A;  1JLF A;  1RNH A;  1A5X A;  3SQ0 A;  1LWF A;  1LW0 A;  4AHU A;  2X78 A;  3U3G A;  4BDP A;  2XY5 A;  1U48 A;  2DFE A;  3L2W A;  4YNQ A;  4DQS A;  1RT1 A;  3VA0 A;  3ZSX A;  4O4G A;  3KLE A;  4DQQ A;  1ASW A;  1G15 A;  3V81 A;  1C6V A;  4FJ5 A;  3HT3 A;  4F3O A;  1D9F A;  1HYS A;  3V9U A;  2E6L A;  4NCA A;  4Z4I A;  4KRF A;  1CZB A;  4NCG A;  1DTT A;  1DTQ A;  2Y1I A;  3QIP A;  4Z0U A;  1SUQ A;  3OYE A;  1TKT A;  3PO4 A;  3SUO A;  4DU3 A;  2Z1G A;  1HYV A;  4JRP A;  1Q9Y A;  4CES A;  1I39 A;  2PYJ A;  4PWD A;  3MEE A;  2Q3S A;  1T03 A;  1D8Y A;  1IKW A;  2JLE A;  4KB0 A;  3TAN A;  4HVJ A;  1RT6 A;  1S6P A;  2PZS A;  3K5M A;  4B3O A;  3WNF A;  4E3S A;  4FLZ A;  1ASV A;  4FJL A;  1S5J A;  2RN2 A;  3L3U A;  3VQD A;  2RF2 A;  4CJR A;  3HST B;  4RW4 A;  4W5R A;  4B8A B;  3CFP A;  5J2M A;  4F2R A;  3HK2 A;  1U4B A;  4UQG A;  3LPT A;  3LP3 A;  3B6O A;  4E19 A;  4CJ4 A;  1NJX A;  2Z1H A;  4B9U A;  3L2R A;  1QSL A;  2KZM A;  3SQ1 A;  5HBM A;  4FK4 A;  1U04 A;  4Z4G A;  3F73 A;  4PUO A;  5KI6 A;  4AH9 A;  4FCY A;  3TAE A;  1JKH A;  3DI6 A;  4E0D A;  3WNG A;  5J1E A;  3L3V A;  1W0H A;  4K8X A;  3ISN C;  3AVG A;  3V1R A;  3CM6 A;  3LAL A;  4KTZ A;  4ZTF A;  3T1A A;  3OS1 A;  2EX3 A;  4DTJ A;  4FZY A;  4FJ8 A;  4KHY A;  5JS1 A;  1T8E A;  3DMJ A;  2LSN A;  1Q9X A;  3NCI A;  4CJ3 A;  3OJS A;  2RKI A;  5KGW A;  3ZT1 A;  4CJL A;  4E7L A;  3RR7 A;  4CCH A;  4M3Z A;  1X9M A;  1JLQ A;  3NH1 A;  4HUG A;  4CJS A;  3AO2 A;  3U6F A;  4ELT A;  2P1J A;  5T7B A;  2Y1J A;  4FJJ A;  2Z1J A;  4ELV A;  4LY7 A;  1KVB A;  4KKO A;  2HNZ A;  3O3F A;  1NOY A;  1U47 A;  3DLH A;  3SUP A;  1TK8 A;  1MU2 A;  1S1T A;  3S3O A;  1NK7 A;  4ELU A;  1SKS A;  5DK5 A;  4JS5 A;  2KTQ A;  2YNG A;  1NOZ A;  4F4K A;  4HCC A;  4E7K A;  4CGJ A;  3AO3 A;  3K5L A;  4LSL A;  3HVT A;  4DFK A;  1XC9 A;  1W9H A;  3AO4 A;  4QAG A;  3VQ7 A;  1CXQ A;  3VQC A;  2W42 A;  4FLU A;  1WSH A;  4DU4 A;  3RR8 A;  4FZZ A;  1EKE A;  1KVA A;  3QER A;  3NH0 A;  3BDP A;  4QOZ B;  3THV A;  3OYN A;  2NUB A;  2D5R A;  3KLI A;  1O1W A;  4MFB A;  3C6U A;  2O4G A;  4B08 A;  1CLQ A;  2YHA A;  3CG7 A;  3TAG A;  1WAJ A;  4CJF A;  2YNF A;  4RW6 A;  4CIG A;  4BE0 A;  3QIO A;  4RW9 A;  3OYH A;  4CJV A;  3NBP A;  1A5W A;  3VQ4 A;  4HUF A;  3AVF A;  3MXI A;  3RMA A;  4CEA A;  3JSM A;  1NJZ A;  1T7P A;  3MED A;  3A2F A;  4N56 A;  3LZJ A;  2XY6 A;  3ZSW A;  3TAB A;  4EZ6 A;  4CK1 A;  2YV0 X;  3B6P A;  3VQB A;  3NHG A;  2YNH A;  3P1G A;  5I3U A;  1RDB A;  4O0I A;  4IFV A;  4B9M A;  3L2U A;  2G8W A;  3NF6 A;  3FFI A;  3F9K A;  4OKK A;  5FRN A;  5CYM A;  4KTQ A;  1JLE A;  3NDK A;  4N41 A;  3HPH A;  2I5J A;  3I0S A;  3OYI A;  3D0P A;  4I7F A;  4CGG A;  4KHS A;  4HHT A;  4CGI A;  3HXM A;  1JLA A;  4WE1 A;  3ZT3 A;  4DTU A;  5FRO A;  3P83 D;  3M8S A;  1WLJ A;  4CHY A;  2HHV A;  1BCM A;  2WON A;  2WOM A;  1CZ9 A;  4DTN A;  4DFP A;  3SQ4 A;  3KKR A;  2F8T A;  4M45 A;  4M42 A;  1I3A A;  1ZBF A;  2GBZ A;  2VG7 A;  1UA1 A;  1RBS A;  4FW1 A;  4H4M A;  3VQ9 A;  4IG0 A;  4H8K A;  4DMN A;  3QNN A;  4Z4H A;  4E1M A;  3AA2 A;  4DLE A;  4FLT A;  3V9X A;  4DTO A;  2F96 A;  4EP5 A;  3P5J A;  1RTD A;  4CFD A;  3RTV A;  3K57 A;  4AHS A;  1LWC A;  5HRP A;  4FJM A;  3ZT2 A;  1NKB A;  1J54 A;  1SV5 A;  2ITG A;  3HYF A;  3HVR A;  3QIN A;  1C0U A;  3ZSR A;  3QEX A;  1VRU A;  1QE1 A;  2IS3 A;  3AVI A;  4ID5 A;  4FM1 A;  3S3M A;  1QSY A;  4DF4 A;  4FM0 A;  3SI6 A;  4DTM A;  4DSL A;  1HJR A;  3QEP A;  1GOC A;  3QES A;  4F3T A;  2D0C A;  1BHL A;  3OYA A;  1NJW A;  1VSH A;  2FBY A;  4RG8 A;  2HHT A;  4YFU A;  4M3R A;  4E7J A;  4AHT A;  4Z4E A;  3EZ5 A;  2HND A;  3I0R A;  3G10 A;  4LSN A;  4DTR A;  1RT7 A;  4FJN A;  1RTI A;  3KK3 A;  1KFS A;  3AVM A;  5E41 A;  4B9V A;  4OVL A;  5KTQ A;  2HVI A;  3TI0 A;  3U3Y A;  3NF9 A;  4OLA A;  1IO2 A;  4CHP A;  1TKD A;  1C1A A;  4OGC A;  3AA4 A;  4B9T A;  3LP1 A;  4N47 A;  4J2A A;  2G8U A;  4DQP A;  3HP6 A;  4CEC A;  5KGX A;  1RIL A;  3D45 A;  3SNN A;  1S6Q A;  3C6T A;  4BE2 A;  3IS9 A;  4FYD A;  3VQ6 A;  4FZX C;  3OYF A;  3AV9 A;  1HRH A;  3OYG A;  2G8V A;  4LH5 A;  4O5B A;  2HMI A;  4CJT A;  3TAM A;  4CHQ A;  4FLY A;  3AVH A;  2JGU A;  3LWM A;  1RDC A;  4R5P A;  4ZHR A;  4M3Y A;  1EET A;  1ZYQ A;  3LAK A;  1S1X A;  1NK9 A;  4ZTJ A;  1DLO A;  3KJV A;  4DFM A;  4KI6 A;  5J2Q A;  4CF0 A;  1RCH A;  3ZCM A;  3PX4 A;  1SKW A;  1QTM A;  4KHN A;  1KCF A;  4AHV A;  3OYD A;  4KI4 A;  3DM2 A;  2HHX A;  2KFZ A;  2A1S A;  1RBU A;  1SL2 A;  2RPI A;  1NK0 A;  2B4J A;  3C94 A;  3VA3 A;  2OYQ A;  4C8O A;  2O4I A;  4JRQ A;  4CFB A;  4Z4C A;  1TKX A;  2KW4 A;  3DLE A;  2P5G A;  2E4L A;  4BDZ A;  3RMB A;  3O4Q A;  4GMJ B;  4RW7 A;  4CEO A;  1BQN A;  4EP4 A;  4FW2 A;  3SYZ A;  3SCX A;  4DG1 A;  2X74 A;  1HQE A;  3DOK A;  2XO7 A;  4IFY A;  1S1U A;  2R7Y A;  1S9G A;  5HRO A;  1J53 A;  1VK0 A;  3O3H A;  4N76 A;  4M41 A;  3I8D A;  4DU1 A;  5CZ1 A;  3VQQ A;  3DLG A;  1LW2 A;  4KV8 A;  1A5V A;  3CFO A;  2HHQ A;  5CYQ A;  1ZBH A;  3CYM A;  3SUN A;  3L2V A;  2OPS A;  1K6Y A;  3HP9 A;  3DRR A;  2FBT A;  1B92 A;  2DY4 A; 
#chains in the Genus database with same CATH topology
 3OBY A;  3LL3 A;  4W5Q A;  4AIL C;  4FJI A;  1QZ5 A;  3OBW A;  1VSK A;  2IGI A;  3UKU A;  1FJG K;  4NYN A;  1ASU A;  4FJH A;  1HKC A;  4BE1 A;  1IKV A;  1SL0 A;  2BUP A;  4KRE A;  1RDD A;  1SL1 A;  4MO4 A;  1Q18 A;  3WNE A;  3V1O A;  3MMV A;  1V4S A;  2ETJ A;  4O8K A;  5HRN A;  2QWO A;  4BAC A;  1WAF A;  4IEI A;  1R0A A;  5EU7 A;  2VWJ A;  3NGY A;  1WSE A;  1JLG A;  2IDO A;  2P9U B;  4H5N A;  4GVM A;  3ZSY A;  5BPN A;  3F2K A;  1W7A A;  3QLH A;  3ZSV A;  4BGB A;  1BDG A;  1TKZ A;  2F7T A;  4L3Q A;  1ZBU A;  4GV3 A;  3DRP A;  4O55 A;  4GKK K;  1L3S A;  2QI2 A;  4LFC K;  5I9E B;  4FJG A;  3CFR A;  4M3T A;  4FJK A;  1KSP A;  3PUF A;  2G8K A;  5DMR A;  2E1Z A;  1WNS A;  3O6W A;  3TSQ A;  4DTP A;  3QBX A;  2QM1 A;  3CC2 N;  4K8Z A;  4H0X B;  1WSG A;  3AVJ A;  4Y1D A;  4KHU A;  3SQ2 A;  2Q2R A;  4I9Q A;  5BRE A;  3IAY A;  3OYL A;  4GVE A;  3IDH A;  4RW8 A;  3NH2 A;  1NLV A;  5JS2 A;  3KKS A;  3ALY A;  1NGC A;  5AQH A;  4AHR A;  5JVG L;  5E84 A;  5BRD A;  1BI4 A;  5CZ2 A;  1JLC A;  3VQ8 A;  3UKR B;  3W3D A;  3CJB A;  3R6M A;  3TPQ A;  4H5T A;  3HZ6 A;  4FOI A;  4W5T A;  3HSC A;  4N5S A;  4BG9 A;  3VMF B;  5AQI A;  3KLH A;  1X9J A;  3O4N A;  1X1P A;  4JNE A;  4KHP K;  4B8C A;  1KAX A;  1NK8 A;  4DF8 A;  1HR0 K;  3VOV A;  1BG3 A;  1P90 A;  1P8Z A;  3DAW A;  1Q81 O;  3OYB A;  2BAN A;  5J2N A;  4JI8 K;  2P9L B;  2IC3 A;  2ZJR L;  1HJO A;  1GOA A;  5GIP A;  1K9M O;  5C2F A;  4DHY A;  3SJJ A;  3PY8 A;  1T05 A;  3DLL L;  3CIP A;  3O80 A;  3S9H A;  4FLV A;  4BC5 A;  5SZT A;  3R8E A;  1NK4 A;  1HPM A;  1QS4 A;  1VHX A;  3VEN A;  3WXI A;  1TVR A;  4OGE A;  1YVN A;  3MN9 A;  4PL8 A;  4BWM A;  4GW6 A;  1XHZ A;  4ILG B;  1BUP A;  1BIU A;  3JYT A;  3PV8 A;  2O8F B;  1VRT A;  3PIO L;  3CF5 L;  1OH8 A;  1UA0 A;  4K0K K;  2HW3 A;  1U2V A;  2E20 A;  2UUC K;  4FPB A;  2GX9 A;  3KK7 A;  1RDU A;  3DWL A;  1LAW A;  3CCM N;  4DS5 A;  1E4G T;  3HRG A;  1SZ2 A;  1IG8 A;  4PY5 A;  1S3X A;  3IRX A;  3JS6 A;  2G8H A;  4B1X B;  2QKK A;  4DR4 K;  4DQR A;  4JS4 A;  4WFN L;  5C24 A;  5HL7 L;  4OPA A;  3MCP A;  3O08 A;  4EHU A;  3J80 O;  3DXK B;  3QFP A;  4FWK A;  1QHA A;  3SPZ A;  3SAF A;  3NF7 A;  4J2B A;  2QXF A;  1RT4 A;  1EP4 A;  4F2S A;  4KB1 A;  3WT0 A;  1UAX A;  4CJU A;  1WB9 A;  4B9L A;  3GDQ A;  3TAF A;  3AVK A;  3UIQ A;  3LWL A;  1VSF A;  1Z6R A;  4XH5 A;  4BRP A;  1FKP A;  4C8L A;  3KLG A;  2P5O A;  2F8S A;  2AJQ A;  4BRA A;  3VQE A;  5LL6 Z;  2VGM A;  4KTW A;  3V4I A;  2A42 A;  1RBT A;  4CZG A;  3H08 A;  4KAZ A;  1JL2 A;  4QCL A;  3QEV A;  3RSE B;  3O9U A;  1X3N A;  1TV6 A;  3EEQ A;  2HHW A;  1XI1 A;  4FXD A;  1VSI A;  3EL2 A;  3J7Y P;  4JKD A;  4BDP A;  3PIP L;  2DFE A;  5AZI A;  4DQS A;  1RT1 A;  3AY9 A;  3V81 A;  3V9U A;  1CZB A;  3CCS N;  3AGK A;  1DTT A;  1DTQ A;  5ELZ A;  3OYE A;  2P9I A;  1SUQ A;  5FPN A;  2WC9 A;  2Z1G A;  3VEV A;  1HYV A;  2VQE K;  1I39 A;  3MEE A;  2Q3S A;  4J8F A;  3SK3 A;  1NGF A;  4B3O A;  3K5M A;  4BRM A;  4E3S A;  1ASV A;  1S5J A;  2CH5 A;  2RF2 A;  3CFP A;  5J2M A;  4JKA A;  3B6O A;  1NJX A;  5JVH L;  1TUY A;  3L2R A;  4FK4 A;  1KC8 O;  1Q82 O;  3WNG A;  5J1E A;  4BGA A;  4K8X A;  3T7Z A;  2IIR A;  3V1R A;  4KTZ A;  3LAL A;  3ZET B;  3H45 C;  3OS1 A;  4DR6 K;  5JS1 A;  4LF6 K;  3D2F A;  3VGK A;  4A57 A;  1VQ9 N;  3ZT1 A;  3RR7 A;  2IVP A;  4CCH A;  3U6F A;  4H0P A;  4LY7 A;  2HNZ A;  4U7B A;  1W2B M;  1NOY A;  1U47 A;  3CME N;  3DLH A;  3SUP A;  1TK8 A;  1MU2 A;  3GG4 A;  4FWP A;  2YNG A;  3L4I A;  4E7K A;  1NNE A;  3K5L A;  4DFK A;  3HVT A;  4FO0 A;  1XC9 A;  3AO4 A;  4QAG A;  3WQT A;  4FLU A;  1WUA A;  3RR8 A;  3W0L A;  5KPZ A;  4FZZ A;  4QOZ B;  3THV A;  3KLI A;  1O1W A;  2O4G A;  3DXM B;  3HTV A;  1CLQ A;  3CG7 A;  1WAJ A;  5AFU H;  4CJF A;  2HBL A;  4G9Z A;  5AQQ A;  4CIG A;  4RW9 A;  4CJV A;  3O1W A;  2HMP A;  3QBW A;  3MXI A;  3RMA A;  1NJZ A;  3MED A;  3A2F A;  3TAB A;  3B6P A;  1J6Z A;  3GOI A;  1HNW K;  4KTQ A;  3J81 O;  1OH6 A;  2I5J A;  3I0S A;  2YHX A;  4KHS A;  1IV0 A;  4DUZ K;  4WE1 A;  3J8A A;  5FRO A;  3P83 D;  1WLJ A;  3LDQ A;  4MLE A;  4DFP A;  3MN5 A;  4JI1 K;  4NXM K;  3VF6 A;  3ZEU B;  1RBS A;  4H4M A;  4DMN A;  4H8K A;  4FLT A;  3AA2 A;  3K0S A;  3O9Q A;  4NLB A;  4Y0W A;  1NKB A;  1W97 L;  2QEX N;  5M1O A;  2ITG A;  5FPM A;  3MX2 A;  1OH7 A;  1C0U A;  3FZL A;  4XEI A;  3O8M A;  2O8C A;  4IO8 A;  1NGE A;  4DTM A;  1HJR A;  2P9P A;  2CGJ A;  2D0C A;  4PKG A;  1VSH A;  4E7J A;  4Z4E A;  4DV6 K;  2I7P A;  5ADX H;  4FJN A;  3KK3 A;  3CC7 N;  2E8A A;  5KTQ A;  3IMX A;  3NF9 A;  4CHP A;  4B9T A;  1KXP A;  2G8U A;  3SAG A;  2ZJQ L;  3I8B A;  4FYD A;  4FZX C;  3OYG A;  3TSU A;  4M7Y A;  1NWK A;  3TAM A;  4CHQ A;  3AVH A;  1ESV A;  4ZHR A;  1EET A;  1SAZ A;  3KJV A;  1T6D A;  3ZCM A;  3PX4 A;  1SKW A;  4KHN A;  4AF1 A;  3OYD A;  2A1S A;  2ZF5 O;  1SL2 A;  2RPI A;  2OYQ A;  3VA3 A;  4C8O A;  5KPR A;  2KW4 A;  4BDZ A;  4FWN A;  4B1Y B;  4GMJ B;  3RMB A;  1EO1 A;  5JLF A;  1NMD A;  4DG1 A;  3DOK A;  3E9P A;  3VGM A;  1S1U A;  1VK0 A;  3MN7 A;  4N76 A;  3I8D A;  3OA9 A;  4IWV A;  3K9K A;  4K25 A;  3KZB A;  3VET A;  5CYQ A;  3LDL A;  2A1R A;  1BA0 A;  3T3F A;  2KZZ A;  5AQX A;  1XNQ K;  4FVU A;  3AVC A;  3CQY A;  1VAZ A;  2IVO A;  4WFB L;  2QXL A;  3NGZ A;  4H03 B;  5DM6 L;  4M3U A;  4QS8 A;  3ZSO A;  1HQU A;  1IKY A;  1RT2 A;  3EKS A;  4BRO A;  4CGF A;  4DS4 A;  4I6M B;  3UE5 A;  3O3G A;  5HOO A;  4HTL A;  4UY8 O;  3VGL A;  1YIJ N;  4Z4F A;  3THW A;  3ZSZ A;  5GAG P;  2YJE A;  1K73 O;  1K8K A;  4W5O A;  5FRM A;  2G8I A;  4PKH A;  2V52 B;  1GLF O;  3G4S N;  2PY5 A;  1VSD A;  3HI0 A;  5M1P A;  4FWM A;  3ZT0 A;  2UYT A;  3CJC A;  3QO9 A;  2D0A A;  2VWB A;  3ZX2 A;  2HB5 A;  3T19 A;  1ZBL A;  1EWQ A;  2GWJ A;  1J5O A;  2YKM A;  2OPQ A;  3ZX0 A;  3KK2 A;  1UOC A;  4AHC A;  4CZE A;  3FZH A;  3M8Q A;  2B6A A;  1X9S A;  5LMU K;  4WQ4 C;  3TAR A;  3OYM A;  4CVN E;  4DSI A;  4Y1C A;  3KIO A;  3O4W A;  4DR7 K;  1JXB A;  4FVM A;  4OPK A;  3CQ8 A;  1E4F T;  1NM1 A;  1VQN N;  2KFN A;  3SZ2 A;  3AVA A;  3IKM A;  1L3T A;  3CQX A;  1N5Y A;  1DEJ A;  1Q8I A;  1YI2 N;  4E7H A;  4FJ9 A;  1REV A;  1HYZ A;  2E88 A;  5SWM A;  1BA1 A;  3FGU A;  2VG6 A;  3ZSQ A;  3LDS A;  2D0B A;  3AVN A;  4KO0 A;  3ULE A;  2QWR A;  1NK6 A;  1GLD G;  3VN5 A;  5B8H A;  1VSM A;  1JXE A;  2O8E A;  3A5N C;  3GL1 A;  1ATS A;  3DLB A;  4B3T K;  3SUQ A;  2IVN A;  4DSK A;  5JMV A;  2O8B B;  3CM5 A;  3MCA B;  2V51 B;  3O9T A;  3WUH A;  1YXQ A;  4CF9 A;  1DGK N;  5JLH A;  4OKJ A;  1WOQ A;  3VQ5 A;  2CH6 A;  3ULD A;  2G8F A;  3K58 A;  2BGG A;  1RDW X;  2FBX A;  3BEX A;  5FPD A;  1TYQ A;  4OX9 K;  4CHZ A;  1HNI A;  2GV9 A;  3AVL A;  3HL8 A;  1NMN A;  3N4P A;  4E89 A;  3CMA N;  3CET A;  4LH4 A;  5I42 A;  2E2N A;  1YT3 A;  3QIC A;  4A2A A;  1QVF M;  2YNI A;  4OJR A;  2E6M A;  3DLK A;  3MXM A;  1IG9 A;  4BRQ A;  3HM9 A;  4O0J A;  1HMV A;  2B5J A;  5KRT A;  4I2Q A;  3U9D A;  2KQ2 A;  4WF9 L;  2CGL A;  3I56 N;  3DXM A;  2HHS A;  5CY4 A;  3EYZ A;  1H1V A;  1GLB G;  3SLC A;  1WSJ A;  4PA1 A;  3JXU A;  4X65 K;  1VQL N;  3CCR N;  1GOB A;  3FZM A;  3AVB A;  4PQU A;  1QQN A;  1NGB A;  1T6C A;  1HX1 A;  3G6E N;  1TK5 A;  4CJP A;  5M1F A;  4JN4 A;  1DKG D;  3CCQ N;  2AP1 A;  4CZF A;  4IKF A;  1ZBI A;  1YTU A;  1KVC A;  4DV2 K;  4AQY K;  3T1H K;  5C12 A;  1NGJ A;  2Q0U A;  4ISF A;  3D2E B;  4J2E A;  1QHT A;  4DV4 K;  3THY A;  4CJ5 A;  1KTQ A;  3MAQ A;  4CIE A;  2FC0 A;  1HUX A;  3MWP A;  3ENH A;  3KLF A;  3M8R A;  3SAH A;  4DR1 K;  3O9S A;  1IBK K;  2UXC K;  3VQA A;  2GWK A;  4I2P A;  4JHD A;  1VSL A;  5CHI A;  1HNZ K;  5EOY A;  1Y97 A;  2XHB A;  3E01 A;  3HM8 A;  3KWG A;  3H46 O;  4FJX A;  1U49 A;  2QKB A;  4CJQ A;  3BZK A;  2OZM A;  3QEI A;  2UXB K;  5J2P A;  1RDA A;  1Z25 A;  4CEB A;  3THX B;  2P9K B;  4BG8 A;  5D3G A;  4FWS A;  4DSF A;  2OPR A;  3DLR A;  4DV3 K;  3JAM O;  3CJ1 A;  3LDP A;  1YTA A;  3ITH A;  4M3W A;  1BIZ A;  4CZM A;  4PKI A;  5KQD A;  4FSV A;  3ATU A;  4IEE A;  1IH7 A;  3MDQ A;  3DJC A;  2YKN A;  4G1Q A;  3VEW A;  4CD1 A;  1NGG A;  4CZH A;  1QSS A;  4A5A A;  4R79 A;  5AJ3 K;  3HO1 A;  3KVG A;  3O1B A;  4E1N A;  4XH4 A;  3SV3 A;  1JLF A;  4L8R B;  1QQM A;  1LWF A;  1LW0 A;  3L2W A;  3A5M C;  2E5L K;  2OCE A;  4O4G A;  4FJ5 A;  3CJ9 A;  1D9F A;  3R3L A;  2E6L A;  3R9P A;  3CI5 A;  2Y1I A;  5BRH A;  3QIP A;  3SUO A;  4DU3 A;  4AM6 A;  4JRP A;  4CES A;  4FWQ A;  2FLO A;  3EO3 A;  1VQM N;  3TTF A;  2JLE A;  1YJ9 N;  2O8D B;  3TAN A;  1RT6 A;  3EN9 A;  4BQZ A;  3A5L C;  4BRF A;  1QVG M;  4W5R A;  5BPL A;  1O13 A;  3VEX A;  4UQG A;  1QSL A;  2KZM A;  1OVQ A;  3F73 A;  3TAE A;  1JKH A;  4ISE A;  1VQ5 N;  4JKG A;  3ISN C;  4KH4 A;  3CM6 A;  3T1A A;  4KHY A;  2D4W A;  4FZY A;  1I94 K;  3DMJ A;  3NCI A;  4E7L A;  3OJS A;  2RKI A;  5KGW A;  1X9M A;  3AO2 A;  4ELT A;  2P1J A;  4BRC A;  3WXM B;  4BRE A;  2Z1J A;  4CJ7 A;  4ELV A;  4IJA A;  1KVB A;  3EE9 A;  4KKO A;  3O3F A;  5C2D A;  4DV5 K;  1SKS A;  2KLA A;  4NXN K;  4JS5 A;  2KTQ A;  4BRI A;  4HCC A;  4CGJ A;  3L4Q A;  2D0O A;  3F5T A;  4LSL A;  2ZGY A;  3E1Y A;  3VQ7 A;  3VQC A;  2P9S A;  3BDP A;  2NUB A;  2NRR A;  3C6U A;  4B08 A;  3ATV A;  3A0I X;  3ID6 A;  1C0G A;  3QIO A;  4JD2 A;  3OYH A;  3SJH A;  4LC9 B;  5AQY A;  3VQ4 A;  4HUF A;  4XH1 A;  3JSM A;  1T7P A;  2JWK A;  3CCJ N;  3ZSW A;  5AQK A;  2FF6 A;  3NHG A;  2YNH A;  4B9M A;  5I3U A;  4IFV A;  4A62 A;  3B8A X;  1VQ8 N;  2G8W A;  2RE2 A;  4OKK A;  5CYM A;  4DKW A;  3OYI A;  3D0P A;  3AGR A;  4DTU A;  4CHY A;  1BCM A;  1HKB A;  4DTN A;  5IT9 O;  3SQ4 A;  5LY3 A;  5AQZ A;  1ZBF A;  3CPE A;  2VG7 A;  1UA1 A;  3QNN A;  4FW1 A;  2GTD A;  3NVM A;  4V19 S;  3ID8 A;  1VQP N;  4DLE A;  3V9X A;  2F96 A;  3VTI A;  3K57 A;  4AHS A;  5HRP A;  1LOT B;  3ZX3 A;  2D0P A;  3C0B A;  1SV5 A;  3Q7C A;  3QEX A;  2IS3 A;  4FM1 A;  3S3M A;  4EHT A;  4DF4 A;  1XQS C;  2VCP A;  4FWR A;  1GOC A;  3BP8 A;  3OYA A;  3ENB A;  2HHT A;  4BRL A;  4YFU A;  4NB4 A;  3I0R A;  4DTR A;  3CCV N;  4LSN A;  1RT7 A;  1MDU B;  3C7N A;  3AVM A;  4JI5 K;  2HVI A;  1OVY A;  1IO2 A;  4J2A A;  3HP6 A;  2PBD A;  1S6Q A;  4BE2 A;  2FSJ A;  3IS9 A;  3VQ6 A;  3AV9 A;  4BRG A;  4H5W A;  4LH5 A;  4FLY A;  4NO7 A;  2UXD K;  3P31 A;  3LWM A;  1Q7Y O;  4R5P A;  1ZYQ A;  3LAK A;  4KI6 A;  5J2Q A;  4CF0 A;  1MA9 B;  3FZK A;  2P9N B;  4CZJ A;  1KCF A;  2KFZ A;  2HHX A;  3QFU A;  2O8B A;  3SBG A;  3VER A;  2YHY A;  2KKZ A;  2NRV A;  4EP4 A;  4RW7 A;  4CEO A;  1YHQ N;  4RTF D;  2XO7 A;  4IFY A;  1S9G A;  1J53 A;  4M41 A;  4LF8 K;  3VQQ A;  3L0Q A;  1FW6 A;  4MDB A;  4A2B A;  5AR0 A;  3CYM A;  3SUN A;  1BU6 O;  4RWT A;  2OPS A;  4PHT X;  5HRR A;  3DRR A;  2DY4 A;  2VQF K;  2HF4 A;  1S72 N;  1JLB A;  4FLW A;  3AO5 A;  4JK9 A;  3VEY A;  3IG1 A;  1XMO K;  1GLL O;  4B3R K;  3DYA A;  4MLH A;  1N32 K;  3U9Z A;  4OKE A;  4JLH A;  2P9U A;  1UWB A;  1OKJ A;  2BH1 A;  5C0Y A;  4KHQ A;  1LWE A;  1L5U A;  5M1N A;  4GV6 A;  3DRS A;  5GIO A;  4I9L A;  4YHH K;  4IZ9 A;  1J9A A;  3H1Q A;  3UKU B;  2FF3 B;  1X9W A;  1KAY A;  2PYL A;  2F9W A;  1FKO A;  1QQC A;  2YI1 A;  4O8U A;  4YOV A;  1RBR A;  1E3M A;  1SKR A;  2X6S A;  4NCB A;  3ZYY X;  4DWI A;  5AQR A;  3MK6 A;  1NJY A;  2BDP A;  4TSX A;  5C42 A;  3LZI A;  4IDK A;  1RT5 A;  3CD6 N;  2IAJ A;  3V1Q A;  3PSF A;  2ZE2 A;  3UKR A;  3H3N O;  5JIC A;  2NRW A;  4FK2 A;  3NE6 A;  4IXC A;  3PSI A;  2FBV A;  4CE9 A;  4QS9 A;  4B1Z A;  1R59 O;  4YOT A;  3S41 A;  3FR0 A;  4CF8 A;  4CER A;  4JKB A;  3K5N A;  1KLM A;  1J5E K;  5M1Q A;  3PO5 A;  4KHW A;  4B9S A;  5IWA K;  1Y64 A;  4HCB A;  4H5V A;  4CJE A;  2DTU A;  3J7A P;  2W40 A;  1MWK A;  1VQ4 N;  2P51 A;  2Z1I A;  4FWO A;  4CFC A;  4CJK A;  3BY5 A;  2ZQB A;  1SQK A;  3OY9 A;  4YOU A;  5BR8 K;  3G0Z A;  2P9L A;  4O5F A;  4IOC L;  3VPZ A;  4YDU A;  3V9S A;  3MEG A;  1FXX A;  3FLC O;  1RTH A;  2XRI A;  3OYC A;  4FK0 A;  4JI4 K;  3HOS A;  1HPZ A;  3QET A;  3KD5 E;  1N8R O;  2X6N A;  5KRS A;  1S1W A;  1BI4 B;  3C95 A;  4XIU A;  4LD0 A;  3J7Z O;  1C0F A;  5AQF A;  4CHN A;  2FXU A;  4BY9 C;  3DOL A;  2OPP A;  4YOW A;  3VEO A;  3M8P A;  3KTQ A;  4BWJ A;  4CK3 A;  4MO5 A;  3OHR A;  3D6R A;  3EKU A;  4CF1 A;  4EFH A;  2O8F A;  4CIF A;  4JK7 A;  3K59 A;  4FPA A;  5FPE A;  1C1C A;  1WSF A;  4DSJ A;  4MDA A;  3FFK B;  3CPW M;  4OLB A;  5FDL A;  4DQ8 A;  3M6G A;  2VG5 A;  3LDO A;  4W5N A;  3S3N A;  3OYJ A;  3OYK A;  2HHU A;  4JEP A;  5HRS A;  3DXK A;  1KRP A;  4CZL A;  1D5A A;  4CBW A;  2W6K A;  3K5O A;  1OH5 A;  3MX5 A;  4DQI A;  3PX0 A;  3OJU A;  4CJW A;  1WBD A;  4JI2 K;  3TSP A;  4CEF A;  3MEC A;  5EXW A;  3TTD A;  1C1B A;  4JKH A;  4CK2 A;  3NGI A;  1VQK N;  2ATQ A;  1KAZ A;  4DFJ A;  2WFB A;  2D1K A;  2HOE A;  2Q1N A;  4LFA K;  2XY7 A;  4KPY A;  1WN7 A;  4E7I A;  5TKW A;  1K8A O;  4GV9 A;  1U2V B;  2XY8 A;  4JKC A;  4FL9 A;  2QK9 A;  4OPH A;  2I7N A;  2J4R A;  3RSE A;  2E2Q A;  1ITG A;  4BC2 A;  4OPJ A;  4HTU A;  3AO1 A;  3BF1 A;  1D9D A;  2HVH A;  3RMD A;  4IBN A;  4EZ9 A;  4KFB A;  3LAM A;  4YOX A;  1TL1 A;  1CXU A;  1BIS A;  3QNO A;  1TK0 A;  4QS7 A;  3P4I A;  4DTX A;  1S1V A;  1VQ7 N;  4ICL A;  3C65 A;  1YIT N;  1U45 A;  2QTD A;  3SV4 A;  4HUE A;  3WXJ A;  4C8N A;  3HPG A;  1HNX K;  2VWK A;  4B9N A;  3LP2 A;  1EQY A;  3OS2 A;  5C15 A;  3VQP A;  5MLC Q;  4OO1 J;  1RNH A;  3U3G A;  1U48 A;  3VA0 A;  4C23 A;  4DQQ A;  1ASW A;  2YHW A;  5GAH P;  1G15 A;  3I33 A;  1C6V A;  1HYS A;  4KRF A;  3E66 A;  1WBB A;  4B1U B;  4Z0U A;  1NGI A;  3Q7B A;  3I55 N;  4IFE A;  1T03 A;  4PWD A;  3ZET A;  1D8Y A;  4B1W B;  1KQS M;  2PZS A;  4FJL A;  2RN2 A;  4CJR A;  3HST B;  4DV7 K;  4B8A B;  1U4B A;  5AZI B;  1GLJ O;  2QWL A;  3SQ1 A;  5HBM A;  4BR4 A;  4U67 L;  2KHO A;  4WFA L;  4PUO A;  5KI6 A;  4AH9 A;  2P9I B;  4FCY A;  3QML A;  3TU5 A;  3L3V A;  3IFR A;  5LJW A;  1ILY A;  4ZTF A;  4FJ8 A;  4PL7 A;  2LSN A;  3O5B A;  4CJL A;  1JLQ A;  2WUS A;  4HUG A;  4B3S K;  5T7B A;  4FJJ A;  1X3M A;  4BRK A;  1NK7 A;  3S3O A;  4RCH A;  4ELU A;  3M5R A;  5DK5 A;  3A8Y A;  1NOZ A;  3AAP A;  1W9H A;  1XC3 A;  2H3G X;  1EKE A;  1YUW A;  2Q36 A;  5DM7 L;  3NH0 A;  3QER A;  4MFB A;  2YHA A;  3TAG A;  3K9J A;  4NLC A;  4GNI A;  1T44 A;  4IO9 L;  3AVF A;  4JKE A;  4BRD A;  3LZJ A;  1KD1 O;  2XY6 A;  3ZEU A;  4DV0 K;  3P1G A;  3L2U A;  4IOX A;  3NF6 A;  3FFI A;  3F9K A;  5FRN A;  1JLE A;  1YF5 L;  4N41 A;  3HPH A;  5AQW A;  4CGG A;  2ITM A;  4HHT A;  2Q31 A;  4BRH A;  4CGI A;  3HXM A;  1JLA A;  1U6Z A;  3KKR A;  3QDK A;  1I3A A;  3MN6 A;  3EZW A;  3VQ9 A;  3FE1 A;  4Z4H A;  4YDU C;  4YY3 K;  4K42 A;  4EP5 A;  4X66 K;  3HBT A;  4CFD A;  3RTV A;  2QWM A;  1LWC A;  3ZT2 A;  3WEE B;  3F9M A;  1J54 A;  3ZSR A;  1QQO A;  4ISG A;  4ID5 A;  1JCF A;  4A61 A;  4H0T B;  1QSY A;  4FM0 A;  3SI6 A;  4F3T A;  3P38 A;  1ATR A;  5EY4 A;  2FBY A;  4LF9 K;  4AHT A;  3NMU A;  2HND A;  2NZT A;  2YJF A;  2AA4 A;  1RTI A;  1KFS A;  5E41 A;  4B9V A;  4OVL A;  3U3Y A;  4OLA A;  1TKD A;  3AA4 A;  4N47 A;  4CBU A;  2O8C B;  1VQO N;  1XUP O;  4KBO A;  3WXL A;  5AQN A;  3A5O C;  1RIL A;  2ZGZ A;  2P9P B;  5AQG A;  3OYF A;  5EVZ A;  4O5B A;  4X62 K;  4A59 A;  4CJT A;  5A2Q O;  1BO5 O;  2JGU A;  2NNW A;  4BVO A;  5AQJ A;  2EWS A;  4DR3 K;  3KWI A;  1S1X A;  4H0Y B;  1DLO A;  3CER A;  3VF2 A;  4DFM A;  4K41 A;  3VTH A;  1QTM A;  2E2P A;  3CCL N;  3SMS A;  4C1N I;  2OAN A;  2WTU A;  1NK0 A;  2B4J A;  4JI6 K;  5BN8 A;  4FWL A;  4JKF A;  3BF3 A;  4CFB A;  1TKX A;  3DLE A;  2P5G A;  1ZBS A;  2E4L A;  1BQN A;  4FW2 A;  2GUP A;  1GLE G;  1HQE A;  2Q97 A;  4YOR A;  1NJI O;  1ZXO A;  2HST A;  4BR0 A;  3HOT A;  3LM2 A;  4C1N K;  1A5V A;  2HHQ A;  4CBX A;  3L2V A;  3TTC A;  2YX6 A;  4I6M A;  1B92 A;  4LFB K;  3CC4 N;  1EWR A;  3OS0 A;  1IJJ A;  4KH6 A;  1NG9 A;  4CEZ A;  1EXQ A;  5E26 A;  4DV1 K;  1JL1 A;  1NKE A;  1V4T A;  5LJV A;  4IDH A;  3WQU A;  2PFU A;  2A40 A;  2W41 A;  2VYP A;  3HPO A;  1BWF O;  5K14 A;  3OTO K;  2ZD1 A;  1T3V A;  1HNV A;  1ATN A;  1TL3 A;  4H4O A;  4BDY A;  3KHY A;  2OTJ N;  4FLX A;  3CHW A;  3BZC A;  4DR2 K;  3H1V X;  3P39 A;  5FLX O;  5AZJ B;  4LF4 K;  1C0T A;  2ASP A;  3OVN A;  3C6H A;  1XMQ K;  3CXC M;  3V9W A;  5AQM A;  2GUI A;  1NKC A;  3RRG A;  3K2P A;  1LCU A;  3IUC A;  3EY1 A;  3THW B;  5C25 A;  1NGA A;  3H6E A;  4CHO A;  1JJ2 M;  1K8K B;  1RT3 A;  1D4X A;  4IG3 A;  5LMN K;  2RHK A;  2IOC A;  3BGR A;  2UUB K;  5CE3 A;  3L2Q A;  1RFQ A;  1XWL A;  2DFH A;  4C8M A;  3SBT A;  4B1V A;  4BR5 A;  5H1S Q;  4FJ7 A;  1TAU A;  5AFU A;  2EHG A;  1C0M A;  4BVP A;  5F0X A;  4DTS A;  4CI6 A;  4F8R A;  4CGD A;  1BOT O;  1GLC G;  1S9E A;  4X64 K;  4DSE A;  3WNH A;  1BCO A;  3R1X A;  4CEQ A;  2Q0R A;  4WQ5 A;  1B9F A;  2BE2 A;  2ASO A;  3ASM A;  4M3X A;  1YJN N;  2OA8 A;  3TR8 A;  3ZT4 A;  4JV5 K;  4WCE L;  3KK1 A;  1FK9 A;  3G71 N;  1YVU A;  4CZI A;  4CW7 B;  5HP1 A;  2HBK A;  1IBL K;  5KPT A;  4M7X A;  3MWT A;  3OW2 M;  1VSE A;  4EAH D;  1ZC6 A;  4O44 A;  1IKX A;  1LAV A;  1N6Q A;  2OTL N;  4H5R A;  3AA5 X;  4IJN A;  4WQ4 A;  3ULE B;  4JI0 K;  1F21 A;  3BUZ B;  1NGH A;  5AQT A;  1Z26 A;  2O8E B;  4C8K A;  4CF2 A;  3V6D A;  3LAN A;  3NF8 A;  3KD1 E;  3RRH A;  4E0D A;  3T69 A;  3LP0 A;  1KLN A;  3RMC A;  3SPY A;  3D2E A;  4CFA A;  5ADX A;  1TYQ B;  3AAR A;  5AQU A;  2OZS A;  1BGX T;  2W6L A;  1VSJ A;  4KH5 A;  3NVK A;  2NRX A;  2E2O A;  1BL3 A;  3ENO A;  3HJF A;  1XHX A;  5AQS A;  3TWH A;  3CJA A;  1GLA G;  1TAQ A;  4BR7 A;  4CGH A;  1L3V A;  4BR2 A;  2UUA K;  5BR9 A;  4Z94 A;  2FSK A;  3TAP A;  1NK5 A;  4J2D A;  1NBW A;  2QA4 N;  3THX A;  2P9K A;  1WSI A;  3NFA A;  1S22 A;  5BN9 A;  1KFD A;  4GY2 B;  1LV5 A;  2NLX A;  1RTJ A;  1TGO A;  4DR5 K;  2FSN A;  1BQM A;  2E1Y A;  3CCE N;  3UB5 A;  1HKG A;  2ASM A;  4ILJ A;  3VES A;  3MXJ A;  1L3U A;  5M1K A;  3THY B;  3WEE A;  2DFF A;  5HLF A;  2YHB A;  4Q0B A;  5BRF A;  2A3Z A;  5EX5 A;  2WBN A;  1B9D A;  1TUU A;  4CED A;  4ID1 A;  1EX4 A;  4H0V B;  3NAE A;  3G25 A;  4FM2 A;  3AA3 A;  4JHD B;  4CEE A;  3M1F A;  4MQ3 A;  4BR9 A;  1SS6 A;  1YJW N;  3LPU A;  3TAQ A;  3PX6 A;  3V9Z A;  2HNY A;  1RBV A;  3RWU A;  2NRH A;  3QEW A;  3L8B A;  5BPM A;  3E9O A;  4JAX A;  4NYF A;  2O8D A;  2HF3 A;  4Q5V A;  3SMP A;  4DLG A;  3SQ0 A;  1A5X A;  2GEM A;  1IBM K;  4AHU A;  2X78 A;  4DCH A;  2XY5 A;  4YNQ A;  4B3M K;  3FZF A;  3ZSX A;  3KLE A;  2GEL A;  3HT3 A;  4F3O A;  2QWN A;  4Z4I A;  4NCA A;  4NCG A;  4E1J A;  5CR4 A;  2A5X A;  3PO4 A;  1TKT A;  1N33 K;  1Q9Y A;  2PYJ A;  3ZLJ A;  2VGN A;  1YAG A;  1IKW A;  4KB0 A;  4HVJ A;  1S6P A;  3RVC A;  3WNF A;  4FLZ A;  4EIA A;  3L3U A;  3VQD A;  4RW4 A;  1XNR K;  4K43 A;  4F2R A;  3HK2 A;  4H0O A;  3LPT A;  3LP3 A;  3O9R A;  4E19 A;  4CJ4 A;  2Z1H A;  4B9U A;  3N4Q A;  4BC3 A;  1MWM A;  1U04 A;  3AAQ A;  4DUY K;  4Z4G A;  1QZ6 A;  3DI6 A;  1N34 K;  1W0H A;  4HWI A;  1CZA N;  3AVG A;  4DTJ A;  2EX3 A;  3VF4 A;  1T8E A;  1Q9X A;  4CJ3 A;  4M3Z A;  1M1K O;  3GE1 A;  1M90 O;  3NH1 A;  4CJS A;  2Y1J A;  2ZM6 K;  2ZWH A;  4F9O A;  4JI7 K;  1S1T A;  4A5B A;  5TKY A;  4JKG B;  4F4K A;  3AO3 A;  1NGD A;  4DU4 A;  1CXQ A;  2W42 A;  1WSH A;  3U4L A;  1KVA A;  3OYN A;  2A41 A;  2D5R A;  5AQL A;  4AM7 A;  2YNF A;  5AZJ A;  4YOY A;  4RW6 A;  2HBJ A;  4BE0 A;  5GIN A;  2NRT A;  3NBP A;  3L6Q A;  2HBM A;  4JK8 A;  1A5W A;  4CEA A;  4EZ6 A;  2V7Z A;  4N56 A;  3PLA A;  4CK1 A;  2YV0 X;  3VQB A;  2QW9 A;  1RDB A;  4O0I A;  4GKJ K;  2A6A A;  2P9S B;  3NDK A;  4I7F A;  4IOA L;  1Q86 O;  4LF7 K;  3QB0 A;  3ZT3 A;  3CJ7 A;  3M8S A;  4WYB A;  2HHV A;  2WON A;  2WOM A;  1CZ9 A;  4JD2 B;  3U8X A;  4WQ5 C;  4BQL A;  2F8T A;  4M45 A;  4ILH A;  4M42 A;  3EE8 A;  2GBZ A;  2V7Y A;  4CZK A;  5GAE P;  4IG0 A;  1JCG A;  4E1M A;  4DTO A;  3P5J A;  4BC4 A;  1RTD A;  4FOE A;  4FJM A;  5F2R A;  4M63 C;  1HLU A;  3HVR A;  3HYF A;  3CCU N;  3GBT A;  3QIN A;  1VRU A;  1QE1 A;  2DPN A;  3AVI A;  4DSL A;  3QEP A;  5AQP A;  3QES A;  1DT9 A;  4JYA K;  2YCH A;  1BHL A;  1NJW A;  5C10 A;  4RG8 A;  4M3R A;  3EZ5 A;  3LM9 A;  3G10 A;  4JI3 K;  3LDN A;  3TI0 A;  5AQV A;  2P9N A;  2ZJP L;  3D7E O;  1C1A A;  4OGC A;  2QWQ A;  3M3Z A;  3LP1 A;  4DQP A;  1N36 K;  4CEC A;  5KGX A;  3WXK A;  3D45 A;  3SNN A;  3E9L A;  3C6T A;  1HRH A;  2G8V A;  1G99 A;  2HMI A;  1RGI A;  3C6A A;  2CGK A;  2QWP A;  1RDC A;  3C7N B;  4M3Y A;  1NK9 A;  4ZTJ A;  1VQ6 N;  1RCH A;  1JCE A;  4KI4 A;  4AHV A;  3DM2 A;  2F9T A;  2JWL A;  3H3O B;  1RBU A;  2PAV A;  3C94 A;  2O4I A;  4JRQ A;  4Z4C A;  3O4Q A;  5GAD P;  5AQO A;  5KQ8 A;  3T1Y K;  2UU9 K;  4LF5 K;  2BTF A;  3SYZ A;  3SCX A;  2X74 A;  4B9Q A;  3VEZ A;  2R7Y A;  5HRO A;  4CD3 A;  3O3H A;  4DU1 A;  1NU0 A;  5CZ1 A;  5F1X A;  4BRN A;  2NRZ A;  1LW2 A;  3DLG A;  4KV8 A;  2HHH K;  3CFO A;  1Z05 A;  1ZBH A;  4DB3 A;  1K6Y A;  3HP9 A;  2F4V K;  3D2F B;  2FBT A; 
#chains in the Genus database with same CATH homology
 2A1R A;  1JLB A;  4W5Q A;  3OS0 A;  4FLW A;  3AO5 A;  3T3F A;  4AIL C;  4FJI A;  2KZZ A;  3IG1 A;  1VSK A;  3AVC A;  3DYA A;  2IGI A;  4CEZ A;  4NYN A;  1EXQ A;  1JL1 A;  3NGZ A;  1ASU A;  4OKE A;  1NKE A;  4BE1 A;  4FJH A;  1IKV A;  1SL0 A;  4JLH A;  4KRE A;  1UWB A;  1RDD A;  4M3U A;  1SL1 A;  4KHQ A;  3ZSO A;  1HQU A;  1LWE A;  1IKY A;  3HPO A;  1L5U A;  3WNE A;  1RT2 A;  5K14 A;  4CGF A;  4DS4 A;  3V1O A;  2ZD1 A;  2ETJ A;  1HNV A;  1TL3 A;  4H4O A;  3O3G A;  4BDY A;  4FLX A;  3DRS A;  5HRN A;  4I9L A;  3ZSZ A;  4BAC A;  4Z4F A;  1WAF A;  1R0A A;  5EU7 A;  1J9A A;  2PYL A;  4W5O A;  1X9W A;  5FRM A;  2VWJ A;  2G8I A;  3NGY A;  1JLG A;  1C0T A;  1WSE A;  1FKO A;  1QQC A;  3OVN A;  3V9W A;  2IDO A;  2PY5 A;  1VSD A;  4GVM A;  1RBR A;  3ZSY A;  2GUI A;  1SKR A;  2X6S A;  3ZT0 A;  1NKC A;  3QO9 A;  3QLH A;  3ZSV A;  4NCB A;  1TKZ A;  2D0A A;  3RRG A;  2HB5 A;  3T19 A;  3K2P A;  4DWI A;  1ZBU A;  1ZBL A;  1J5O A;  2YKM A;  2OPQ A;  3DRP A;  3EY1 A;  1NJY A;  4O55 A;  5C25 A;  1L3S A;  4CHO A;  3KK2 A;  2BDP A;  1UOC A;  4AHC A;  1RT3 A;  4TSX A;  5C42 A;  3LZI A;  4FJG A;  4IG3 A;  4IDK A;  3M8Q A;  3CFR A;  4M3T A;  2B6A A;  1RT5 A;  1KSP A;  4FJK A;  2IAJ A;  1X9S A;  3PUF A;  2G8K A;  3TAR A;  2IOC A;  3BGR A;  5DMR A;  3V1Q A;  3OYM A;  3L2Q A;  1WNS A;  2ZE2 A;  1XWL A;  4DTP A;  2DFH A;  4C8M A;  4K8Z A;  1WSG A;  4FJ7 A;  4DSI A;  4Y1C A;  4FK2 A;  3KIO A;  3AVJ A;  3NE6 A;  1TAU A;  4Y1D A;  4KHU A;  1JXB A;  2FBV A;  4FVM A;  5HRR A;  4CE9 A;  4OPK A;  2EHG A;  3CQ8 A;  3SQ2 A;  4I9Q A;  1C0M A;  4DTS A;  3IAY A;  3OYL A;  2KFN A;  3SZ2 A;  3AVA A;  4CER A;  4CF8 A;  3K5N A;  1KLM A;  3PO5 A;  4CGD A;  4F8R A;  4KHW A;  1L3T A;  4B9S A;  4RW8 A;  3NH2 A;  5JS2 A;  3KKS A;  1S9E A;  3ALY A;  4AHR A;  1N5Y A;  4HCB A;  2DTU A;  1Q8I A;  4CJE A;  4E7H A;  4DSE A;  1REV A;  1HYZ A;  3WNH A;  1BI4 A;  5CZ2 A;  5SWM A;  4FJ9 A;  2P51 A;  2VG6 A;  1BCO A;  1JLC A;  2Z1I A;  3ZSQ A;  3LDS A;  3VQ8 A;  4CEQ A;  2D0B A;  3AVN A;  4KO0 A;  4CFC A;  4CJK A;  1NK6 A;  3VN5 A;  1B9F A;  2BE2 A;  2ZQB A;  1VSM A;  4W5T A;  3ASM A;  4M3X A;  1JXE A;  3OY9 A;  4N5S A;  2OA8 A;  3TR8 A;  3ZT4 A;  3DLB A;  3SUQ A;  3G0Z A;  3KLH A;  4DSK A;  3V9S A;  3KK1 A;  1FK9 A;  3MEG A;  1YVU A;  1FXX A;  3CM5 A;  5HP1 A;  1RTH A;  3O4N A;  1X1P A;  2XRI A;  4CF9 A;  4B8C A;  3OYC A;  1NK8 A;  4FK0 A;  4DF8 A;  1VSE A;  4OKJ A;  1HPZ A;  3QET A;  4O44 A;  3VQ5 A;  2X6N A;  3ULD A;  3KD5 E;  1IKX A;  5KRS A;  1S1W A;  1BI4 B;  3C95 A;  4XIU A;  1LAV A;  4LD0 A;  3K58 A;  2G8F A;  2BGG A;  1N6Q A;  4CHN A;  2FBX A;  3DOL A;  3AA5 X;  2OPP A;  4CHZ A;  4L8R B;  1F21 A;  1HNI A;  2GV9 A;  3AVL A;  3HL8 A;  1Z26 A;  3M8P A;  3KTQ A;  3OYB A;  2BAN A;  4BWJ A;  4C8K A;  4CF2 A;  5J2N A;  3V6D A;  4E89 A;  4CK3 A;  3LAN A;  3NF8 A;  2IC3 A;  4LH4 A;  5I42 A;  1YT3 A;  3KD1 E;  1GOA A;  3RRH A;  4CF1 A;  4CIF A;  2YNI A;  4OJR A;  3LP0 A;  2E6M A;  3DLK A;  3K59 A;  3MXM A;  3HM9 A;  1C1C A;  3SJJ A;  1IG9 A;  1WSF A;  1HMV A;  4O0J A;  3RMC A;  1KLN A;  3PY8 A;  2B5J A;  1T05 A;  5KRT A;  4I2Q A;  2KQ2 A;  4DSJ A;  3SPY A;  4CFA A;  3S9H A;  4FLV A;  4OLB A;  2HHS A;  5FDL A;  5CY4 A;  5SZT A;  3EYZ A;  1NK4 A;  1QS4 A;  1WSJ A;  4PA1 A;  2OZS A;  1TVR A;  1BGX T;  1GOB A;  4OGE A;  1VSJ A;  2VG5 A;  3AVB A;  4BWM A;  4PQU A;  1TK5 A;  4GW6 A;  4W5N A;  1BL3 A;  4CJP A;  1XHZ A;  3S3N A;  1BIU A;  3OYJ A;  3JYT A;  3PV8 A;  3HJF A;  1VRT A;  3OYK A;  1XHX A;  2HHU A;  5HRS A;  1KRP A;  4IKF A;  3TWH A;  1D5A A;  1ZBI A;  1UA0 A;  3K5O A;  1KVC A;  1YTU A;  1TAQ A;  4DQI A;  3PX0 A;  2HW3 A;  3OJU A;  4CJW A;  4J2E A;  1QHT A;  4CGH A;  4CEF A;  1L3V A;  1LAW A;  4CJ5 A;  4DS5 A;  1KTQ A;  3MEC A;  3MAQ A;  4CIE A;  2FC0 A;  4PY5 A;  3IRX A;  2G8H A;  3KLF A;  3TAP A;  1C1B A;  1NK5 A;  4CK2 A;  3M8R A;  2QKK A;  3NGI A;  4J2D A;  4DQR A;  4JS4 A;  2ATQ A;  5C24 A;  4DFJ A;  1WSI A;  3NFA A;  3VQA A;  1KFD A;  4I2P A;  1LV5 A;  2XY7 A;  1VSL A;  1RTJ A;  1TGO A;  3SPZ A;  1Y97 A;  2XHB A;  4KPY A;  1WN7 A;  3E01 A;  3NF7 A;  4E7I A;  4J2B A;  2QXF A;  1BQM A;  1RT4 A;  1EP4 A;  4F2S A;  4FJX A;  4KB1 A;  1U49 A;  1UAX A;  2XY8 A;  3MXJ A;  4CJU A;  2QKB A;  1L3U A;  4CJQ A;  2QK9 A;  4B9L A;  2DFF A;  2OZM A;  5HLF A;  2YHB A;  3QEI A;  3TAF A;  4Q0B A;  3AVK A;  5J2P A;  1RDA A;  3UIQ A;  3LWL A;  1ITG A;  4OPJ A;  1Z25 A;  1VSF A;  4CEB A;  4HTU A;  3AO1 A;  1B9D A;  4CED A;  4ID1 A;  1D9D A;  2HVH A;  3RMD A;  1EX4 A;  5D3G A;  3NAE A;  1FKP A;  2OPR A;  4IBN A;  4DSF A;  4C8L A;  3KLG A;  3DLR A;  4EZ9 A;  4FM2 A;  3AA3 A;  2P5O A;  2F8S A;  4KFB A;  3LAM A;  1TL1 A;  2AJQ A;  1CXU A;  1YTA A;  3ITH A;  4M3W A;  1BIZ A;  3VQE A;  1BIS A;  4CEE A;  3QNO A;  4MQ3 A;  1TK0 A;  4KTW A;  3LPU A;  4DTX A;  1IH7 A;  3V4I A;  3PX6 A;  3V9Z A;  3TAQ A;  2YKN A;  2HNY A;  1S1V A;  1RBT A;  1RBV A;  4G1Q A;  3H08 A;  3QEW A;  1JL2 A;  4ICL A;  1QSS A;  3RWU A;  4KAZ A;  3L8B A;  1U45 A;  4QCL A;  3SV4 A;  3QEV A;  4HUE A;  3HO1 A;  1TV6 A;  3HPG A;  4NYF A;  2VWK A;  4C8N A;  4B9N A;  4Q5V A;  3LP2 A;  2HHW A;  1XI1 A;  4FXD A;  1VSI A;  3OS2 A;  4E1N A;  4DLG A;  3VQP A;  3SV3 A;  1JLF A;  1RNH A;  1A5X A;  3SQ0 A;  1LWF A;  1LW0 A;  4AHU A;  2X78 A;  3U3G A;  4BDP A;  2XY5 A;  1U48 A;  2DFE A;  3L2W A;  4YNQ A;  4DQS A;  1RT1 A;  3VA0 A;  3ZSX A;  4O4G A;  3KLE A;  4DQQ A;  1ASW A;  1G15 A;  3V81 A;  1C6V A;  4FJ5 A;  3HT3 A;  4F3O A;  1D9F A;  1HYS A;  3V9U A;  2E6L A;  4NCA A;  4Z4I A;  4KRF A;  1CZB A;  4NCG A;  1DTT A;  1DTQ A;  2Y1I A;  3QIP A;  4Z0U A;  1SUQ A;  3OYE A;  1TKT A;  3PO4 A;  3SUO A;  4DU3 A;  2Z1G A;  1HYV A;  4JRP A;  1Q9Y A;  4CES A;  1I39 A;  2PYJ A;  4PWD A;  3MEE A;  2Q3S A;  1T03 A;  1D8Y A;  1IKW A;  2JLE A;  4KB0 A;  3TAN A;  4HVJ A;  1RT6 A;  1S6P A;  2PZS A;  3K5M A;  4B3O A;  3WNF A;  4E3S A;  4FLZ A;  1ASV A;  4FJL A;  1S5J A;  2RN2 A;  3L3U A;  3VQD A;  2RF2 A;  4CJR A;  3HST B;  4RW4 A;  4W5R A;  4B8A B;  3CFP A;  5J2M A;  4F2R A;  3HK2 A;  1U4B A;  4UQG A;  3LPT A;  3LP3 A;  3B6O A;  4E19 A;  4CJ4 A;  1NJX A;  2Z1H A;  4B9U A;  3L2R A;  1QSL A;  2KZM A;  3SQ1 A;  5HBM A;  4FK4 A;  1U04 A;  4Z4G A;  3F73 A;  4PUO A;  5KI6 A;  4AH9 A;  4FCY A;  3TAE A;  1JKH A;  3DI6 A;  4E0D A;  3WNG A;  5J1E A;  3L3V A;  1W0H A;  4K8X A;  3ISN C;  3AVG A;  3V1R A;  3CM6 A;  3LAL A;  4KTZ A;  4ZTF A;  3T1A A;  3OS1 A;  2EX3 A;  4DTJ A;  4FZY A;  4FJ8 A;  4KHY A;  5JS1 A;  1T8E A;  3DMJ A;  2LSN A;  1Q9X A;  3NCI A;  4CJ3 A;  3OJS A;  2RKI A;  5KGW A;  3ZT1 A;  4CJL A;  4E7L A;  3RR7 A;  4CCH A;  4M3Z A;  1X9M A;  1JLQ A;  3NH1 A;  4HUG A;  4CJS A;  3AO2 A;  3U6F A;  4ELT A;  2P1J A;  5T7B A;  2Y1J A;  4FJJ A;  2Z1J A;  4ELV A;  4LY7 A;  1KVB A;  4KKO A;  2HNZ A;  3O3F A;  1NOY A;  1U47 A;  3DLH A;  3SUP A;  1TK8 A;  1MU2 A;  1S1T A;  3S3O A;  1NK7 A;  4ELU A;  1SKS A;  5DK5 A;  4JS5 A;  2KTQ A;  2YNG A;  1NOZ A;  4F4K A;  4HCC A;  4E7K A;  4CGJ A;  3AO3 A;  3K5L A;  4LSL A;  3HVT A;  4DFK A;  1XC9 A;  1W9H A;  3AO4 A;  4QAG A;  3VQ7 A;  1CXQ A;  3VQC A;  2W42 A;  4FLU A;  1WSH A;  4DU4 A;  3RR8 A;  4FZZ A;  1EKE A;  1KVA A;  3QER A;  3NH0 A;  3BDP A;  4QOZ B;  3THV A;  3OYN A;  2NUB A;  2D5R A;  3KLI A;  1O1W A;  4MFB A;  3C6U A;  2O4G A;  4B08 A;  1CLQ A;  2YHA A;  3CG7 A;  3TAG A;  1WAJ A;  4CJF A;  2YNF A;  4RW6 A;  4CIG A;  4BE0 A;  3QIO A;  4RW9 A;  3OYH A;  4CJV A;  3NBP A;  1A5W A;  3VQ4 A;  4HUF A;  3AVF A;  3MXI A;  3RMA A;  4CEA A;  3JSM A;  1NJZ A;  1T7P A;  3MED A;  3A2F A;  4N56 A;  3LZJ A;  2XY6 A;  3ZSW A;  3TAB A;  4EZ6 A;  4CK1 A;  2YV0 X;  3B6P A;  3VQB A;  3NHG A;  2YNH A;  3P1G A;  5I3U A;  1RDB A;  4O0I A;  4IFV A;  4B9M A;  3L2U A;  2G8W A;  3NF6 A;  3FFI A;  3F9K A;  4OKK A;  5FRN A;  5CYM A;  4KTQ A;  1JLE A;  3NDK A;  4N41 A;  3HPH A;  2I5J A;  3I0S A;  3OYI A;  3D0P A;  4I7F A;  4CGG A;  4KHS A;  4HHT A;  4CGI A;  3HXM A;  1JLA A;  4WE1 A;  3ZT3 A;  4DTU A;  5FRO A;  3P83 D;  3M8S A;  1WLJ A;  4CHY A;  2HHV A;  1BCM A;  2WON A;  2WOM A;  1CZ9 A;  4DTN A;  4DFP A;  3SQ4 A;  3KKR A;  2F8T A;  4M45 A;  4M42 A;  1I3A A;  1ZBF A;  2GBZ A;  2VG7 A;  1UA1 A;  1RBS A;  4FW1 A;  4H4M A;  3VQ9 A;  4IG0 A;  4H8K A;  4DMN A;  3QNN A;  4Z4H A;  4E1M A;  3AA2 A;  4DLE A;  4FLT A;  3V9X A;  4DTO A;  2F96 A;  4EP5 A;  3P5J A;  1RTD A;  4CFD A;  3RTV A;  3K57 A;  4AHS A;  1LWC A;  5HRP A;  4FJM A;  3ZT2 A;  1NKB A;  1J54 A;  1SV5 A;  2ITG A;  3HYF A;  3HVR A;  3QIN A;  1C0U A;  3ZSR A;  3QEX A;  1VRU A;  1QE1 A;  2IS3 A;  3AVI A;  4ID5 A;  4FM1 A;  3S3M A;  1QSY A;  4DF4 A;  4FM0 A;  3SI6 A;  4DTM A;  4DSL A;  1HJR A;  3QEP A;  1GOC A;  3QES A;  4F3T A;  2D0C A;  1BHL A;  3OYA A;  1NJW A;  1VSH A;  2FBY A;  4RG8 A;  2HHT A;  4YFU A;  4M3R A;  4E7J A;  4AHT A;  4Z4E A;  3EZ5 A;  2HND A;  3I0R A;  3G10 A;  4LSN A;  4DTR A;  1RT7 A;  4FJN A;  1RTI A;  3KK3 A;  1KFS A;  3AVM A;  5E41 A;  4B9V A;  4OVL A;  5KTQ A;  2HVI A;  3TI0 A;  3U3Y A;  3NF9 A;  4OLA A;  1IO2 A;  4CHP A;  1TKD A;  1C1A A;  4OGC A;  3AA4 A;  4B9T A;  3LP1 A;  4N47 A;  4J2A A;  2G8U A;  4DQP A;  3HP6 A;  4CEC A;  5KGX A;  1RIL A;  3D45 A;  3SNN A;  1S6Q A;  3C6T A;  4BE2 A;  3IS9 A;  4FYD A;  3VQ6 A;  4FZX C;  3OYF A;  3AV9 A;  1HRH A;  3OYG A;  2G8V A;  4LH5 A;  4O5B A;  2HMI A;  4CJT A;  3TAM A;  4CHQ A;  4FLY A;  3AVH A;  2JGU A;  3LWM A;  1RDC A;  4R5P A;  4ZHR A;  4M3Y A;  1EET A;  1ZYQ A;  3LAK A;  1S1X A;  1NK9 A;  4ZTJ A;  1DLO A;  3KJV A;  4DFM A;  4KI6 A;  5J2Q A;  4CF0 A;  1RCH A;  3ZCM A;  3PX4 A;  1SKW A;  1QTM A;  4KHN A;  1KCF A;  4AHV A;  3OYD A;  4KI4 A;  3DM2 A;  2HHX A;  2KFZ A;  2A1S A;  1RBU A;  1SL2 A;  2RPI A;  1NK0 A;  2B4J A;  3C94 A;  3VA3 A;  2OYQ A;  4C8O A;  2O4I A;  4JRQ A;  4CFB A;  4Z4C A;  1TKX A;  2KW4 A;  3DLE A;  2P5G A;  2E4L A;  4BDZ A;  3RMB A;  3O4Q A;  4GMJ B;  4RW7 A;  4CEO A;  1BQN A;  4EP4 A;  4FW2 A;  3SYZ A;  3SCX A;  4DG1 A;  2X74 A;  1HQE A;  3DOK A;  2XO7 A;  4IFY A;  1S1U A;  2R7Y A;  1S9G A;  5HRO A;  1J53 A;  1VK0 A;  3O3H A;  4N76 A;  4M41 A;  3I8D A;  4DU1 A;  5CZ1 A;  3VQQ A;  3DLG A;  1LW2 A;  4KV8 A;  1A5V A;  3CFO A;  2HHQ A;  5CYQ A;  1ZBH A;  3CYM A;  3SUN A;  3L2V A;  2OPS A;  1K6Y A;  3HP9 A;  3DRR A;  2FBT A;  1B92 A;  2DY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...