4Y1CA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
145
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase binding protein
total genus 50
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1cA00
1SKRA 4F4KA 1FK9A 2D0BA 3PX0A 1QSYA 2G8IA 2IGIA 4QAGA 3NBPA 1QQCA 3TARA 3RR8A 5SZTA 1TL1A 1VSHA 4I9QA 2KFZA 2FC0A 2ZD1A 3SPYA 4DTUA 3TANA 1BHLA 4E89A 3NDKA 4Y1CA 1C1AA 3ZSQA 3OYHA 4ZTJA 2QK9A 3RRHA 1EETA 2A1SA 3NF9A 4DTMA 4E7IA 4NCAA 1UAXA 3C6TA 1XC9A 2YNFA 4DG1A 3C6UA 5HRPA 2E6LA 1NKBA 3QINA 3TABA 3TAPA 4C8LA 2XY6A 4J2BA 4N41A 3RMAA 4M3UA 5J2PA 1RBTA 4B8CA 3T1AA 4XIUA 4OGCA 4DQQA 3SI6A 1N6QA 4AHVA 1RT1A 3V9XA 4YFUA 4OKEA 4WE1A 5K14A 4JS5A 1JKHA 2P51A 4CJKA 1IKWA 1BISA 4C8OA 1IKVA 1LW2A 1JLEA 4DS5A 2VG7A 1NJYA 3K5OA 3EY1A 1HNIA 1K6YA 4CGJA 4H4MA 1DTTA 3SYZA 4LSLA 4CHZA 4Z0UA 4IFVA 5KRTA 1TGOA 2YKMA 3AVKA 2QXFA 5J2QA 1BQNA 4AILC 2OPPA 5KGWA 2ITGA 1NK7A 1L3UA 1HPZA 2DFFA 2OZSA 4HHTA 4FJNA 3IS9A 1RDCA 2ATQA 1TKZA 2GBZA 3OYLA 2VWJA 4FW2A 3SUOA 4KO0A 4BE0A 3WNFA 4IKFA 1S1UA 2HHTA 1CZ9A 1B9FA 4LH5A 3L2VA 3G10A 4DU3A 1X9MA 5SWMA 3KLFA 2XY7A 1RTDA 3AO2A 2EHGA 3AVFA 3DLGA 3LZIA 4B9NA 4B9MA 3KLIA 1BI4A 3C94A 1CXUA 4RW9A 4CJPA 1EXQA 1EX4A 4B08A 4F3OA 2W42A 1KFSA 4FM1A 3PO4A 1UOCA 3AO3A 3LANA 1T05A 2DY4A 2B6AA 3O3HA 3QESA 2HHXA 3CYMA 4E7LA 4DSKA 4NCBA 5HP1A 4GW6A 1BGXT 3QEPA 1HYZA 1Z26A 1S9EA 1TVRA 4KTWA 5KTQA 3M8RA 3ZSYA 3QIOA 3OYEA 3LWLA 3VQ8A 4F2RA 4DTPA 4M42A 4CIGA 3NH1A 1RT5A 3T19A 1D8YA 4FK0A 4OLBA 3TAFA 4OPJA 1X9SA 1ZBUA 4ID5A 2Y1JA 3L2RA 4PA1A 1XHXA 4CHQA 1U45A 2HHQA 4B9LA 4LY7A 4CF8A 4CHNA 3VQ4A 1NK0A 4DQRA 3O3GA 1YVUA 4ZHRA 4IDKA 1T8EA 1QHTA 2BGGA 4FJKA 3TAEA 2HNDA 4CFBA 3KIOA 4AHCA 1SL1A 4FM2A 1RDDA 2WONA 2WOMA 4AH9A 3OJSA 2A1RA 1BIUA 1G15A 2P1JA 4B9UA 2X74A 3SQ0A 5HBMA 4Z4EA 2OZMA 3IG1A 4RW4A 3SZ2A 4CJRA 4O55A 3HVRA 3HVTA 2IDOA 5CY4A 3L2QA 3NE6A 1ZBHA 1YTUA 5KI6A 3SV3A 3AVHA 4CEZA 3KLHA 4FW1A 3D45A 5HLFA 4M3YA 3MECA 3V6DA 5FDLA 1LAVA 4JS4A 4F2SA 1KVBA 1J9AA 3VQEA 3QEWA 4ZTFA 4EZ9A 4KTQA 2YHAA 3MXMA 4OLAA 3RMDA 2IS3A 3RR7A 2KTQA 4CHYA 3QEXA 2Z1IA 4FLXA 4CJ5A 4KKOA 1KFDA 4ELVA 3HJFA 4NYFA 3KLGA 4CJTA 4CE9A 2ZQBA 4C8NA 4HCCA 3OY9A 2HB5A 3WNHA 2R7YA 1U48A 4HTUA 4CJFA 3SPZA 4FLTA 5D3GA 3RMBA 3RWUA 2F8SA 4KRFA 4IFYA 2GUIA 4DFMA 3TAQA 4N5SA 1CXQA 1VRTA 4M3TA 3ZSZA 4BDPA 2YNGA 3DRRA 1C0MA 4DF4A 4Y1DA 1TKXA 4I2PA 3TAGA 1NJZA 3JSMA 4BACA 1TV6A 3SUQA 4H8KA 4FK2A 1IKXA 1VSJA 1TAUA 4ELTA 2B4JA 2DFEA 4DTOA 1Q9XA 1C1CA 3AO1A 1T03A 4CEEA 3DM2A 3NAEA 3CQ8A 2HMIA 2HW3A 1S1XA 1BCMA 2QKBA 1LWEA 3LAKA 4FLUA 1SUQA 4LSNA 3V9WA 2DFHA 1QSLA 4DWIA 4CHOA 1I3AA 4CEDA 3H08A 1IO2A 4QOZB 3LPTA 2D0AA 4ID1A 3L3UA 4N76A 1QSSA 2D5RA 4Q5VA 1R0AA 1D9DA 4KREA 1IH7A 2PY5A 4FLYA 4CEOA 1HQUA 2E4LA 4HCBA 3HPGA 1X9WA 1N5YA 4CJWA 4EP4A 4B9SA 4RW7A 4M45A 1C0TA 3AO5A 1ASVA 2RF2A 3WNEA 2HNZA 2OPSA 4CK3A 4FZYA 1NOYA 1RDBA 3RTVA 4K8ZA 3O4QA 4FJLA 5FRNA 3PX6A 1WSIA 3RMCA 3IRXA 3MEDA 3S3OA 4E19A 4FJ5A 1X1PA 5DMRA 4E1MA 3EYZA 1L3SA 3L2WA 3K59A 3QEVA 3CG7A 3U6FA 1WLJA 4CJ4A 3LP2A 4CF0A 4CHPA 1JLFA 2XY5A 4Z4CA 4CGHA 4O4GA 3AO4A 3ZCMA 3DOKA 3OYKA 4O44A 3NF6A 1WSJA 4B3OA 3KKRA 4AHRA 3LZJA 1SKSA 1VRUA 4CGFA 4M41A 5EU7A 2HHVA 3MXJA 4I7FA 4BE1A 3CFRA 4Z4FA 3SNNA 3SQ1A 3HXMA 4FYDA 4CGIA 2IOCA 3BDPA 2X6NA 3DOLA 1YTAA 4TSXA 3KLEA 1ASWA 1UWBA 3BGRA 3HP9A 4DTXA 4E0DA 1C0UA 3QLHA 4G1QA 3P1GA 3VQCA 1S9GA 4CJEA 4EZ6A 1LAWA 3QETA 1LV5A 2VWKA 1MU2A 4M3XA 1XWLA 3DLKA 1J54A 3V9SA 4CFAA 4CIEA 4DFJA 1RBSA 5HRSA 1DLOA 2YHBA 3DYAA 4FJXA 3THVA 4DSJA 1JLBA 1NK6A 1A5XA 2X78A 1VK0A 1RDAA 3CFOA 4E7JA 4DSLA 1XHZA 5J1EA 1GOBA 3PUFA 4KHQA 2O4IA 3AVCA 3DLRA 4R5PA 3V9ZA 3F73A 3U3GA 1S1VA 3DI6A 5I3UA 3K58A 3AVMA 1GOCA 1RT2A 1I39A 4CJVA 1Y97A 3SQ4A 4KHYA 1S5JA 2HVIA 3LAMA 4NYNA 3VQPA 3DMJA 4BDYA 1IG9A 4E7KA 3UIQA 4KB0A 4CECA 2OA8A 3LWMA 2DTUA 4CK2A 4RW6A 2XY8A 3LALA 4CJSA 4RW8A 3HPHA 3DLHA 3AV9A 3ZT0A 3OYBA 5C25A 3VA3A 1L5UA 3C95A 1HYSA 4FJ9A 1HQEA 4KPYA 2OPQA 4CJ3A 4FZZA 3KD1E 3WNGA 4IG3A 2P5GA 4CFDA 4F3TA 4DSEA 2HHWA 3NFAA 1S6QA 4E1NA 3OYIA 1Q8IA 5CYMA 4AHUA 4FLVA 2KZMA 2AJQA 1FKPA 1L3TA 1C6VA 1L3VA 1Z25A 4O0IA 3VQ5A 3SUPA 4IG0A 3TR8A 3LPUA 3VQBA 3S9HA 1KLNA 2G8KA 1RBVA 4CGDA 1EP4A 3OS2A 3AVGA 1U04A 4DQSA 5I42A 4N47A 3NGIA 2NUBA 3MEEA 1NKCA 1J5OA 3ALYA 3OS1A 3ZT3A 5T7BA 1D9FA 1EKEA 4DTSA 4PUOA 3E01A 3V1RA 4DTJA 3MXIA 4OKKA 3QIPA 5C42A 2G8WA 3K5LA 2RKIA 1LWCA 1NK4A 4K8XA 2I5JA 4LH4A 2PYLA 3F9KA 2KFNA 4H4OA 4O0JA 4FJJA 1HJRA 1TK8A 2G8UA 1RBUA 3V4IA 4C8KA 2KW4A 1TK0A 3B6OA 1JLCA 2IAJA 2IC3A 4IBNA 4KI4A 1CLQA 2FBXA 3ASMA 3O3FA 1RCHA 1VSDA 4AHSA 3AVBA 1RBRA 1WSHA 3U3YA 4CF9A 1QS4A 2PYJA 1ASUA 1T7PA 4RG8A 4DTRA 3ZSOA 3NGZA 3NF7A 4C8MA 3OYDA 4FZXC 2EX3A 1JL2A 1D5AA 3KJVA 3NGYA 1TAQA 3AVIA 3VN5A 4PY5A 3D0PA 2OPRA 3HPOA 1XI1A 1WAJA 3G0ZA 4CJLA 3VQ6A 3LDSA 4FLWA 3NF8A 3I8DA 5CZ2A 3KK2A 2B5JA 3NHGA 5JS1A 1KVAA 3SV4A 4FK4A 3K57A 2Z1GA 3OYMA 4KV8A 3T3FA 4B9TA 3OYGA 4BDZA 3SCXA 1NKEA 3AVNA 4HUFA 4KB1A 1NJWA 2HHUA 1KCFA 2D0CA 3O4NA 3QNOA 3V81A 3S3NA 3HSTB 1KSPA 1YT3A 1HYVA 1KLMA 4HUEA 1WN7A 3HO1A 1NK5A 2FBYA 2BANA 5KRSA 3KD5E 4HUGA 4B8AB 3PV8A 2P5OA 1S1TA 3NH0A 3OYAA 3L2UA 1J53A 1A5VA 3OYJA 1S1WA 2FBTA 2YNHA 3LP1A 4AHTA 2HHSA 2F8TA 2O4GA 4W5OA 3KK1A 3OJUA 3NCIA 1VSIA 4FXDA 2XRIA 1B9DA 3P5JA 2QKKA 4LD0A 3SJJA 3M8PA 1RTHA 2Z1JA 4DFPA 2KQ2A 3OYNA 1TKDA 4CJUA 4DLGA 4FJ7A 4CEBA 1QTMA 5CYQA 1S6PA 4BWMA 4CF1A 4W5QA 3VA0A 3HT3A 1WAFA 3MAQA 1SL2A 3ZT2A 3CM5A 4OVLA 1WSEA 3AVAA 3ZSXA 5J2NA 1JLGA 2F96A 4ICLA 3AVLA 4CEAA 1NOZA 1UA1A 4CERA 4DQPA 4PQUA 4CESA 4I9LA 4FCYA 3I0SA 4J2EA 4B9VA 1JXEA 3QERA 4M3WA 3I0RA 3AA2A 4OGEA 1VSLA 3VQ9A 1TK5A 3HK2A 1ITGA 1JXBA 4OPKA 3QEIA 5HRNA 1RT4A 3L8BA 2YNIA 4MFBA 3TI0A 4M3ZA 5CZ1A 4W5NA 3OYFA 2Q3SA 3OVNA 4E7HA 2G8VA 3SUNA 3CFPA 1RTJA 3A2FA 3RRGA 3VQDA 3AA5X 3VQAA 4KFBA 4KHUA 2ETJA 2FBVA 3DRSA 4KTZA 1U4BA 4DSIA 3OYCA 1RT6A 2HNYA 2HVHA 5HRRA 4FJGA 1RT3A 1W0HA 4KHWA 4FLZA 1GOAA 4FVMA 4KHSA 4BWJA 1RNHA 4N56A 4M3RA 4JLHA 3ISNC 1ZYQA 2PZSA 3L3VA 2RPIA 3HYFA 4DTNA 3MEGA 4DFKA 1O1WA 3ITHA 4ELUA 2X6SA 3K5MA 2OYQA 5J2MA 1W9HA 1NK8A 4Z4GA 4CJQA 3ULDA 4Z4HA 5KGXA 4F8RA 1FXXA 3AVJA 2LSNA 2YKNA 4I2QA 4CGGA 4QCLA 1HMVA 3OS0A 1NJXA 3JYTA 1C1BA 2VG5A 3V9UA 1BL3A 1JLAA 3DLBA 4OJRA 5C24A 3LP3A 4GVMA 4CIFA 4KI6A 4DU1A 2KZZA 2E6MA 1JLQA 3PX4A 2GV9A 4JRPA 4FJMA 4CCHA 3ZT4A 1ZBFA 3VQ7A 1UA0A 1KVCA 1BI4B 4FJIA 1REVA 4MQ3A 1HNVA 1QE1A 5DK5A 2G8FA 4KAZA 2ZE2A 4KHNA 3P83D 1LW0A 2Z1HA 3LP0A 4O5BA 3B6PA 4DS4A 4CFCA 1A5WA 3TAMA 1NK9A 4UQGA 3QO9A 3KTQA 2YV0X 3NH2A 4BE2A 3PO5A 1TL3A 4HVJA 2Y1IA 1CZBA 4DQIA 4CK1A 1ZBLA 1VSMA 4Q0BA 4FM0A 3PY8A 3AA3A 1RILA 4FJHA 3M8SA 3IAYA 1DTQA 3DRPA 1SV5A 1BIZA 1F21A 3CM6A 3V1QA 2XO7A 3S3MA 4OKJA 4YNQA 1RTIA 3VQQA 4DU4A 4W5RA 1WSGA 3KK3A 4CF2A 1VSFA 5FROA 3EZ5A 4JRQA 4W5TA 1B92A 4J2AA 4NCGA 1LWFA 4DF8A 1SKWA 3FFIA 4E3SA 2RN2A 4FJ8A 1IKYA 1HRHA 4DSFA 1Q9YA 5E41A 1VSKA 2G8HA 4EP5A 2BDPA 1U49A 2BE2A 5JS2A 1JL1A 1FKOA 1KTQA 5HROA 1WNSA 2XHBA 1WSFA 1TKTA 3V1OA 1RT7A 1SL0A 4PWDA 3TWHA 4DMNA 4CEFA 1BCOA 1U47A 2JLEA 1VSEA 1KRPA 3AA4A 4CEQA 3ZT1A 4J2DA 4Z4IA 3HP6A 3SQ2A 3K2PA 3M8QA 2JGUA 5FRMA 3DLEA 3QNNA 4L8RB 3HM9A 4DLEA 3KKSA 3HL8A 3ZSRA 1ZBIA 1BQMA 4GMJB 3ZSVA 3ZSWA 2VG6A 3K5NA
chains in the Genus database with same CATH superfamily
1SKRA 3O9QA 5C15A 4BG8A 2D0PA 2IGIA 3KZBA 3RSEB 5SZTA 4I9QA 4A2BA 4DTUA 3TANA 4Y1CA 5AQLA 3P31A 3QBWA 4WFAL 1EETA 2A1SA 4DTMA 1NGFA 3QFPA 4B3SK 4J2BA 4X64K 1RBTA 1N6QA 4OGCA 4JI4K 4H0VB 1JJ2M 1Q7YO 1JKHA 2P51A 2QWRA 1BISA 4PKHA 3OHRA 4WFNL 4H5TA 2QM1A 2DPNA 3TTCA 3SYZA 4CHZA 4IFVA 1TGOA 3AVKA 4Z4IA 1R59O 5KGWA 3DLLL 1HPZA 2DFFA 2OZSA 3Q7CA 2FLOA 3C6HA 4GNIA 1TKZA 3O8MA 4B3MK 4V19S 2O8BA 4B9NA 2EHGA 2F9WA 3KLIA 1G99A 1EXQA 4B08A 3TSUA 4JAXA 2ASPA 2DY4A 4DSKA 3CQXA 3QIOA 4B1UB 3OYEA 3LWLA 4F2RA 4IEEA 4BC2A 4JD2A 1X9SA 2HHHK 2GTDA 1QHAA 3FZKA 1U45A 4DR4K 4LY7A 3DXMA 3MN5A 4CHNA 3O3GA 4LF6K 2E2OA 1KQSM 1QHTA 4JHDA 3H45C 4CFBA 4AHCA 1RDDA 4AH9A 3OJSA 2QWMA 4BR2A 3BUZB 4YOWA 4H5NA 3DAWA 3MN7A 1YTUA 4XH4A 4IEIA 5KI6A 3SV3A 3KLHA 3V6DA 5FDLA 1LAVA 1KVBA 2Q97A 3VQEA 3QEWA 4OLAA 3RMDA 2IS3A 2Q31A 3QEXA 4FLXA 3CHWA 4AM7A 3PSIA 2VYPA 5GINA 2ZQBA 1XMOK 4GVEA 3W3DA 4B1XB 4HCCA 4JI8K 1M1KO 2VQEK 1K8KB 4FLTA 3RMBA 3RWUA 3OW2M 4DFMA 4QS7A 4N5SA 1VRTA 5EVZA 3ZSZA 4Y1DA 4MDBA 4ILGB 3SMSA 1TV6A 3CC4N 3SAGA 4DTOA 3MN9A 1C1CA 1Q9XA 3CQ8A 4BC5A 2HW3A 3IUCA 2QKBA 1LWEA 4FLUA 4Y0WA 4CHOA 1N32K 4CEDA 2YHYA 3D2FB 3GE1A 2OANA 3B8AX 4Q5VA 1IH7A 4CEOA 3LDNA 1HQUA 4XH5A 3D6RA 3O1BA 1X9WA 5TKYA 4H5WA 2HNZA 2OPSA 5FPDA 1RDBA 5GAGP 4FVUA 3O4QA 4O8UA 4DR1K 3ENOA 3IRXA 1NGGA 5BRFA 2ZJPL 3CG7A 5AZIA 4CJ4A 5AQGA 4CHPA 1JLFA 3ZCMA 1QVFM 5H1SQ 2IIRA 3KKRA 4AHRA 3LZJA 2VQFK 5EU7A 1X3NA 5GAEP 4WQ5A 3SNNA 2IOCA 3DOLA 1YTAA 5AQMA 4ILHA 1HJOA 1NWKA 1N33K 4CFAA 3WXLA 1GLDG 5C12A 4DFJA 1DLOA 2YHBA 4JV5K 5CR4A 3THVA 2WC9A 1JLBA 1VK0A 5JICA 5CHIA 5J1EA 5AR0A 1YAGA 1GLLO 3DLRA 3FE1A 1BWFO 4CVNE 3AVMA 4CJVA 3SQ4A 3WXMB 1S5JA 1NGEA 3VEVA 3VQPA 1IG9A 4IO9L 3D2EA 4CK2A 5M1PA 2XY8A 4CBWA 4DHYA 5AQYA 1MWMA 3RVCA 4IDHA 5M1OA 3C95A 2HF4A 4FJ9A 4KPYA 2YHWA 4DB3A 2P5GA 1BA0A 3VESA 4X65K 1Q8IA 5CYMA 1L3TA 1Z25A 2A6AA 4O0IA 3SUPA 3TR8A 4BRFA 2G8KA 4BR4A 1VQ9N 1EP4A 4FWMA 1U04A 4FWLA 2NUBA 5M1QA 3FFKB 1NKCA 3RSEA 4IZ9A 2YX6A 3TSQA 2YJFA 5T7BA 3CJBA 4DTSA 4WQ4A 2UYTA 1SS6A 3E01A 3V1RA 3VEYA 2NRRA 3QIPA 5C42A 1YITN 3K5LA 2RKIA 5GIPA 1LWCA 1YI2N 4LH4A 2PYLA 4BQLA 1WBDA 1HJRA 3NMUA 4C8KA 1XUPO 2KLAA 4BRQA 3B6OA 2IC3A 4KI4A 1CLQA 4NO7A 2QWPA 1RCHA 1OKJA 3AVBA 4M63C 3ZETB 3U3YA 3DJCA 2EX3A 4AQYK 5A2QO 3HPOA 4C1NI 3G0ZA 3K0SA 2H3GX 3TTDA 4FLWA 3NF8A 3I8DA 1KVAA 5BN9A 3SV4A 1NBWA 2Z1GA 3VGMA 4B9TA 3THWB 5EOYA 2Q0UA 4LC9B 3AVNA 4KB1A 3C6AA 2HHUA 1KCFA 2D0CA 3QNOA 2CGKA 2P9KA 2W41A 4HUEA 1WN7A 1NK5A 3WXKA 2BANA 5KRSA 3KD5E 4XEIA 4OPHA 3L2UA 1J53A 2FBTA 2YNHA 3VMFB 4CZFA 2HHSA 2JWKA 4W5OA 1Z05A 4FXDA 1ZC6A 1B9DA 4A59A 3P5JA 2CGLA 4DFPA 2Z1JA 1GLAG 1YHQN 1NGJA 5GADP 2E2NA 2VWBA 1S6PA 4W5QA 1IV0A 3A8YA 4A57A 3ZSXA 3IDHA 5J2NA 2F96A 4BC3A 4GKJK 3LM9A 5AQUA 3TTFA 4LF4K 4FCYA 4J2EA 1SQKA 4BVOA 1ITGA 3QEIA 1S72N 4QS9A 4MFBA 4DR2K 3OBWA 5AFUA 4KFBA 3DRSA 4DSIA 2NRWA 3OYCA 1RT6A 2OTLN 2NRXA 3GL1A 4KHWA 4KHSA 4FVMA 4N56A 3ISNC 4JNEA 2PZSA 3L3VA 2RPIA 3HYFA 3MEGA 4DFKA 4ELUA 2ZJRL 1K8KA 1W9HA 4F8RA 4FWSA 3AVJA 2QEXN 2E2QA 1VQ5N 4BRHA 3DLBA 2I7PA 3P4IA 4JKFA 1ATRA 3GDQA 5BR8K 4RCHA 2GV9A 3H1VX 4CCHA 2O8BB 1ZBFA 1WOQA 5BRHA 1HNVA 1QE1A 2ZE2A 2Z1HA 2GUPA 1A5WA 4BRCA 2A3ZA 3PO5A 1CZBA 1VSMA 4HTLA 1K9MO 1RILA 4FJHA 3IAYA 1F21A 3S3MA 3VQQA 4DU4A 3KK3A 5HL7L 3A5MC 4JRQA 5AQRA 1V4TA 2E5LK 3A5LC 4E3SA 3A0IX 1N34K 4JHDB 3CJ1A 5AQTA 2G8HA 4YOUA 2BDPA 1U49A 2BE2A 5JS2A 2UUAK 1JL1A 1FKOA 1KTQA 3VF6A 5HROA 3EEQA 1TKTA 3QBXA 5F2RA 4CEFA 1VSEA 3AA4A 4CEQA 1OH6A 3ZT1A 3K2PA 3E66A 1YUWA 5LMNK 3QNNA 4L8RB 1K8AO 3KKSA 3HL8A 3ZSRA 2VG6A 2YHXA 1NGAA 4JI0K 4KBOA 3L4QA 4QAGA 3NBPA 2FXUA 2GWKA 3TARA 1VQ4N 3CCUN 1H1VA 1VSHA 3WQUA 2FC0A 2ZD1A 1BHLA 3OYHA 2NLXA 3RRHA 3NF9A 3C6TA 2YNFA 1BO5O 3O9RA 5HRPA 3TAPA 4FWRA 2VCPA 3RMAA 3O9SA 2JWLA 4JK9A 4B8CA 1TYQB 3T1AA 3EKUA 4C1NK 4XIUA 4DQQA 5J2PA 4UY8O 2HBLA 4YFUA 1T6CA 5MLCQ 4OKEA 5K14A 2YI1A 2ZWHA 1IKWA 1IKVA 2ASOA 3G4SN 4FWKA 2VG7A 3THYB 4Z0UA 4AILC 2ITGA 4FJNA 1RDCA 3TU5A 4G9ZA 1HKBA 4BR0A 4BE0A 1S1UA 1X9MA 4DU3A 1RTDA 5SWMA 4Q0BA 3AO2A 4GV3A 4K25A 2P9SB 3C94A 4RW9A 3OTOK 1YF5L 2W42A 3PO4A 3LANA 2GELA 2B6AA 3QESA 2ZF5O 3E9PA 2E20A 1HYZA 2P9UA 1S9EA 1TVRA 3CIPA 3LDPA 4H0OA 1VQ7N 1LCUA 4FK0A 1RT5A 3T19A 1D8YA 3TAFA 4OPJA 4JI3K 1ZBUA 2Y1JA 3GOIA 3L2RA 4PA1A 1XHXA 2YCHA 4ISFA 4CF8A 4LFCK 4DQRA 1YVUA 4ZHRA 4IDKA 2IVNA 2BGGA 1HNXK 4FOEA 3ZEUA 3MCPA 4YOYA 4IO8A 2A1RA 2P1JA 4CZIA 4YOVA 2X74A 3SQ0A 5HBMA 2OZMA 5DM7L 1KD1O 2IDOA 3HM8A 2GEMA 5CY4A 1KAXA 4FW1A 3D45A 4GY2B 5HLFA 2V52B 4M3YA 4MLEA 4JS4A 3THWA 2YHAA 3MXMA 3OBYA 4X62K 2Z1IA 2ASMA 4ELVA 1KFDA 3CERA 4NYFA 4WFBL 3D2EB 5EX5A 2HB5A 4LF5K 4DV3K 4BQZA 3SPZA 1DKGD 5D3GA 4E1JA 4IFYA 4M3TA 3DRRA 3EL2A 3ENHA 4QS8A 1NJZA 3JSMA 1J5EK 4BACA 4FK2A 3ZX2A 1VSJA 4ELTA 2B4JA 2W6LA 2QXLA 3FZFA 1T03A 4CEEA 3DM2A 4WCEL 1HR0K 1BCMA 4EAHD 1X3MA 2ZGZA 4DCHA 1IO2A 4QOZB 1P8ZA 3MDQA 3FR0A 1U6ZA 2D5RA 4KREA 4FLYA 4FWNA 1N5YA 3CC2N 5KPTA 3Q7BA 4RW7A 1C0TA 2RF2A 2P9NB 1FJGK 4FO0A 4BVPA 4FZYA 1NOYA 5FRNA 4K8ZA 3NVMA 4BRNA 5LJVA 3MEDA 5BRDA 4FJ5A 2QWNA 2HOEA 3L2WA 3QEVA 1WLJA 4CF0A 4Z4CA 3O9UA 4O4GA 1S3XA 4O44A 3NF6A 4B3OA 3HOTA 1CZAN 1SKSA 4M41A 3MXJA 3W0LA 2QA4N 3CFRA 3SQ1A 3LDLA 3CJCA 3EZWA 3I8BA 3BDPA 1UWBA 3BGRA 3HP9A 1NU0A 1N36K 4DR7K 4E0DA 3VQCA 5FPMA 4EZ6A 3P1GA 2P9KB 4CZKA 1LAWA 3CCJN 3QETA 2VWKA 2KKZA 3WXJA 4M3XA 3V9SA 3L4IA 2P9PA 3MN6A 4DSJA 1A5XA 3CFOA 4DSLA 3EE8A 3PUFA 3AVCA 3V9ZA 3U3GA 3CJAA 5I3UA 2GX9A 5BREA 3TPQA 5FPEA 1Y97A 3ZLJA 4KHYA 4NYNA 3BF1A 3DMJA 3UIQA 4CECA 4FL9A 4BRDA 5LL6Z 3N4QA 2ZM6K 4RW8A 3WQTA 3ZT0A 3OYBA 4LF9K 1HYSA 2OPQA 2Q36A 3KD1E 2UXDK 4IG3A 4DSEA 2HHWA 1S6QA 3OYIA 4IFEA 3U4LA 1FKPA 1WUAA 1L3VA 3VQBA 3LPUA 4CGDA 4PHTX 2UUBK 2Q1NA 3VF4A 4IJNA 4DQSA 3MEEA 1VQMN 3OS1A 4YHHK 1EKEA 4EHTA 4DTJA 4FWQA 4JK8A 1NK4A 4O0JA 4YDUA 1RBUA 1TK0A 3F9MA 1TYQA 1JLCA 2QTDA 2FBXA 3ASMA 1VSDA 4AHSA 2F7TA 1ASUA 4RG8A 3NGZA 3KHYA 3NF7A 4NLCA 4CJ7A 3CCEN 3THYA 1D5AA 3KJVA 3VN5A 2PFUA 5LJWA 1XI1A 3BEXA 5CZ2A 3U8XA 3KK2A 4DQ8A 3CCRN 4FK4A 3K57A 3T3FA 4DV5K 4HUFA 1KAZA 1NGIA 5AQJA 3S3NA 3WUHA 1E3MA 1QQNA 4NXMK 3F5TA 2YJEA 2P9SA 3HO1A 2FBYA 3EN9A 4FPAA 1NG9A 3OA9A 2CH6A 5ADXA 2O8CB 1A5VA 1V4SA 4PKGA 1S1WA 2O4GA 3SK3A 5AQIA 5C2FA 3SJJA 3M8PA 1RTHA 3AAPA 1EWQA 3OYNA 4FJ7A 4CF1A 1SL2A 1WAFA 3VGKA 1WSEA 3VF2A 1JLGA 3KK7A 1NMNA 3SMPA 4B9VA 1JXBA 1RT4A 2YNIA 3OYFA 3P39A 3OVNA 4CZHA 3CFPA 1RTJA 3A2FA 3VQAA 4KHUA 4H0TB 2A42A 4CZLA 5EXWA 4FJGA 1RT3A 3F2KA 2ITMA 4FLZA 4BWJA 4DTNA 4KH5A 4Z4GA 5KQ8A 5J2MA 1NK8A 4WF9L 3H6EA 2D0OA 2YKNA 2V7YA 4I2QA 4CGGA 2RHKA 3OS0A 3JYTA 4JKHA 5C24A 4GVMA 4ILJA 4CIFA 4KI6A 4NB4A 3M5RA 3O5BA 4DR5K 4FJMA 3ZT4A 5AFUH 3QMLA 3VQ7A 1EQYA 4KAZA 3QDKA 3D7EO 3TAMA 4WQ5C 2YV0X 4BE2A 1TL3A 1KXPA 1ZBLA 4FM0A 2P9UB 3AA3A 3M8SA 3CM6A 4ZTJA 2XO7A 4YNQA 3I55N 4KH6A 3EKSA 1VSFA 5FROA 2P9NA 1B92A 4BREA 1C0GA 1LWFA 1SKWA 3J8AA 4LFAK 4FJ8A 1HRHA 5E41A 1VSKA 3CMAN 3ZEUB 4DUYK 3A5NC 1T44A 3CXCM 2XHBA 4PWDA 1WSFA 3V1OA 1RT7A 4B1VA 1JCGA 2JLEA 3NVKA 1EWRA 2UUCK 3O4WA 4DLEA 1ZBIA 1N8RO 4GMJB 1W7AA 1RDUA 3K5NA 2D0BA 3PX0A 3BY5A 3AY9A 5C2DA 4JKAA 3M6GA 3RR8A 3E1YA 5KPZA 3NDKA 3ZSQA 3KWIA 3VEXA 1MWKA 4NCAA 1XC9A 4DG1A 2E6LA 2OCEA 3TABA 4N41A 2XY6A 3KWGA 4M3UA 3SAFA 5E84A 3SI6A 3THXB 3V9XA 4AF1A 4CJKA 1LW2A 3O08A 1NJYA 4WQ4C 3K5OA 5BPNA 3EY1A 1HNIA 5DM6L 4H4MA 1DTTA 4LSLA 5KRTA 5BPMA 2CH5A 2YKMA 5J2QA 1L3UA 1NK7A 1GLJO 3IS9A 2VWJA 3E9OA 4FW2A 4BRPA 3SUOA 4KO0A 2EWSA 2HHTA 1CZ9A 3L2VA 4LH5A 3KLFA 1DEJA 3DLGA 5JVGL 4B9MA 2HF3A 1BI4A 4CJPA 3IKMA 4F3OA 1IG8A 1M90O 1XNQK 4FM1A 4MLHA 1YXQA 3O3HA 4NCBA 2QW9A 5HP1A 4GW6A 3LDQA 4KTWA 4JYAK 3VQ8A 4EHUA 4CIGA 4OLBA 5C0YA 3G6EN 4JI6K 1EO1A 4B9LA 1MA9B 1T8EA 2E8AA 4MO4A 3TAEA 3KIOA 4FM2A 2QWOA 5GIOA 1VAZA 4Z4EA 4JKGB 2P9PB 3IG1A 3HVRA 1ZBHA 3L2QA 1VQ8N 1GLFO 3ZYYX 3QICA 4YORA 4F2SA 1J9AA 1Q18A 1OVYA 2KHOA 3CCVN 4CHYA 4GKKK 4CJ5A 4KKOA 3PSFA 1RDWX 1NMDA 3KLGA 4CE9A 4C8NA 3OY9A 3AGRA 3WNHA 2O8CA 3ENBA 1VQKN 4DF4A 1TKXA 2E1YA 3TAGA 3AARA 2CGJA 3VEWA 1YIJN 3SUQA 4H8KA 1YJNN 4BR5A 3NAEA 2HMIA 1S1XA 3LAKA 1SZ2A 5BN8A 1QSLA 4DWIA 1RGIA 1I3AA 4EIAA 3HBTA 3H1QA 3LPTA 3FZHA 4ID1A 3L3UA 1QSSA 2FF6A 3PLAA 1R0AA 4IXCA 2PY5A 2E4LA 1NGCA 3CJ9A 1E4GT 3HPGA 3QFUA 4B1ZA 3BZCA 2Q0RA 4EP4A 4B9SA 4M45A 3AO5A 1ASVA 4IJAA 4CK3A 3RTVA 4FJLA 4BRMA 1WSIA 1DT9A 2P9IB 4E19A 1X1PA 4E1MA 3EYZA 1L3SA 3K59A 3U6FA 3CPEA 3ULEA 4GV9A 1C0FA 4DV0K 2FSJA 1VRUA 1NLVA 2GWJA 4C23A 4CGFA 2HHVA 4F9OA 3HXMA 1BG3A 4FYDA 4CGIA 2X6NA 3KLEA 1ASWA 1QQOA 4G1QA 4EFHA 1LV5A 4CZGA 1ZXOA 1MU2A 5AQXA 1XWLA 1J54A 2NRZA 4CIEA 1VQON 3H46O 4FJXA 1Q82O 1NK6A 4E7JA 5I9EB 3MWPA 4K43A 3N4PA 1XHZA 1GOBA 4KHQA 2O4IA 3BF3A 1S1VA 4YOXA 2UXCK 1GOCA 1I39A 3C7NA 2HVIA 4FOIA 3LAMA 3CD6N 4E7KA 2QWLA 2OA8A 3LWMA 3HPHA 3DLHA 4IOXA 3AV9A 5M1KA 5C25A 3VA3A 1HQEA 4CJ3A 4FZZA 2BH1A 3LL3A 3WNGA 1FW6A 4F3TA 3NFAA 4AHUA 3UKUB 1VQPN 1C6VA 5AQZA 3H3NO 1GLCG 4PKIA 3OS2A 2O8FB 1YJ9N 4L3QA 3G25A 5LY3A 3H3OB 4N47A 2ZJQL 1J5OA 3ZT3A 3CMEN 2V7ZA 4RTFD 4PUOA 1ATNA 3GG4A 5EY4A 4K8XA 1HKCA 3F9KA 2KFNA 1IBKK 3J7ZO 1TK8A 2KW4A 3EE9A 3THXA 3O3FA 4DV7K 4CF9A 1T7PA 4DTRA 2BTFA 1Q86O 3NGYA 1TAQA 3AVIA 4PY5A 3D0PA 2OPRA 4CJLA 3LDSA 1VQLN 2B5JA 5BR9A 4NXNK 4JI1K 3OYMA 4ISEA 4BGAA 3SCXA 2W40A 4LFBK 3L6QA 1NJWA 3O4NA 3JXUA 1KSPA 1YT3A 1HYVA 3E9LA 3LM2A 1KLMA 2HMPA 2WBNA 4B8AB 3PV8A 4BRKA 5AQHA 2UU9K 1S1TA 3T1YK 4JI5K 4IWVA 3LP1A 4GV6A 3NCIA 1VSIA 1ATSA 2QKKA 2A5XA 2KQ2A 2D1KA 4CD3A 4CW7B 3T1HK 1TKDA 4U7BA 3VA0A 3HT3A 3MAQA 2O8EB 3CM5A 4OVLA 3AVAA 3MK6A 4MO5A 3AVLA 3VEOA 3P38A 4AM6A 4KHPK 1BU6O 3HTVA 2A40A 4CERA 2V51B 4M3WA 3I0RA 3AA2A 4FWOA 4OGEA 4BY9C 4JKGA 5ADXH 3DWLA 1YJWN 1TK5A 3HK2A 2F9TA 4OPKA 5HRNA 4K42A 5FLXO 4M3ZA 3SJHA 5CZ1A 5BPLA 4W5NA 1TUUA 3SUNA 3RRGA 3AA5X 3CCQN 4LF7K 5AJ3K 2ETJA 4KTZA 1U4BA 3ATUA 5HRRA 4B1WB 4NLBA 1ZBSA 1RNHA 4HWIA 4JLHA 1ZYQA 2OYQA 3IMXA 4CJQA 4Z4HA 4H0PA 4JEPA 5KPRA 3HI0A 1QZ5A 4I6MB 4QCLA 1HMVA 1NJXA 4M7XA 1C1BA 2VG5A 1HUXA 1VHXA 2A41A 3WXIA 3R3LA 5AQWA 3PX4A 4JRPA 3VGLA 1OVQA 1JCFA 2NNWA 1BI4B 2WFBA 1NGDA 4FJIA 1REVA 5DK5A 3MMVA 4KHNA 1LW0A 3U9DA 4DS4A 5FPNA 1NK9A 4YY3K 3VEZA 3QO9A 1ESVA 1KC8O 3NH2A 3CPWM 3HSCA 5IT9O 4DQIA 4CK1A 4IOCL 2I7NA 4JKEA 1SAZA 1SV5A 1T3VA 4JKBA 1RTIA 5HOOA 4JI2K 1WSGA 4CD1A 4JI7K 1NNEA 3M3ZA 4W5TA 4J2AA 4NCGA 3FFIA 3MWTA 1IKYA 2P9IA 1W97L 2NZTA 4EP5A 4CZMA 2IVPA 5TKWA 4BGBA 1SL0A 3I33A 3TWHA 3ZX0A 1U47A 1KRPA 4X66K 3U9ZA 3M8QA 2JGUA 3DLEA 3SLCA 1BDGA 3O6WA 2VGMA 1Y64A 3ZSVA 4F4KA 1FK9A 2E88A 4J8FA 1QSYA 1TUYA 2G8IA 1QQCA 1XNRK 1XQSC 1TL1A 2KFZA 5AQFA 1D4XA 3FGUA 4FSVA 5JLHA 3SPYA 2PAVA 2QK9A 4E89A 1C1AA 2F4VK 2VGNA 3M1FA 1KAYA 4E7IA 1XC3A 1YVNA 1UAXA 4H0XB 1NKBA 3C6UA 3HRGA 4M7YA 4C8LA 3QINA 3TSPA 3GBTA 4JN4A 3CCSN 3UKRB 3BP8A 4AHVA 4LF8K 1RT1A 4WE1A 4JS5A 4B9QA 4C8OA 2NRHA 1IJJA 1JLEA 4DS5A 3CETA 3R8EA 2E2PA 1K6YA 4CGJA 3J7YP 2QXFA 1BQNA 2OPPA 1K73O 4H0YB 4YDUC 4HHTA 1OH8A 1DGKN 2ATQA 2GBZA 2P9LA 3OYLA 4OO1J 3UKUA 4H5VA 3WNFA 4IKFA 1B9FA 3G10A 4N76A 2XY7A 3MX2A 3LZIA 2O8FA 3AVFA 3WEEB 3K9JA 1CXUA 1HNZK 1EX4A 1KFSA 3VTHA 1UOCA 2E1ZA 3AO3A 3HOSA 1T05A 3R6MA 5JLFA 3ULEB 4JKCA 2HHXA 3CYMA 4E7LA 5GAHP 1BGXT 3QEPA 1Z26A 5KTQA 3M8RA 3ZSYA 3FZLA 3DXKA 4DTPA 4M42A 4DV4K 3NH1A 3AAQA 4ID5A 1E4FT 2HHQA 4CHQA 5AQOA 3VQ4A 1NK0A 1W2BM 4FJKA 2HNDA 1IBLK 1SL1A 2WONA 2WOMA 4A61A 1BIUA 1G15A 4MDAA 4B9UA 4RW4A 3SZ2A 4CJRA 4O55A 3HVTA 3NE6A 4YOTA 4DR3K 3EO3A 3AVHA 3UB5A 4CEZA 3MECA 2BUPA 2UXBK 4ZTFA 4EZ9A 3C65A 4KTQA 1HX1A 3KVGA 3RR7A 2KTQA 3C7NB 1ILYA 3HJFA 4CJTA 2AA4A 4RWTA 4ISGA 2R7YA 1U48A 4HTUA 4CJFA 2F8SA 5JMVA 4KRFA 2GUIA 3TAQA 1CXQA 2HSTA 4BDPA 2YNGA 1C0MA 4I2PA 1X9JA 3SBTA 1IKXA 1TAUA 2DFEA 3S41A 4K0KK 3AO1A 3T7ZA 5AZJB 1U2VB 2WUSA 2O8EA 5E26A 1SUQA 4LSNA 3V9WA 4B3TK 2DFHA 4IOAL 3H08A 2Q2RA 3C0BA 4JKDA 4B1YB 2D0AA 1D9DA 2O8DB 4CBUA 5IWAK 4BR9A 4HCBA 1J6ZA 4CJWA 3O80A 3VETA 2AP1A 3IFRA 3VPZA 3WNEA 4DV6K 4BRIA 3PX6A 3RMCA 3S3OA 5DMRA 2FSNA 1BA1A 3LP2A 2XY5A 4CGHA 3AO4A 3DOKA 4A5AA 3OYKA 3ID6A 1WSJA 3WT0A 4I6MA 3ZX3A 5AQVA 4I7FA 4BE1A 4Z4FA 3R9PA 1IBMK 1OH5A 4BR7A 2W6KA 4TSXA 2QI2A 4DTXA 1C0UA 3O9TA 3QLHA 4CJEA 5M1NA 1S9GA 3QB0A 3J7AP 3DLKA 1RBSA 5HRSA 2NRVA 3DYAA 2X78A 1RDAA 4DV2K 3VTIA 5JVHL 4R5PA 3F73A 1QVGM 3DI6A 1XMQK 3A5OC 3K58A 1RT2A 4A62A 3UE5A 4BDYA 4KB0A 2DTUA 4RW6A 3LALA 1BUPA 4CJSA 3JAMO 2FSKA 5AQNA 2HBJA 4BRAA 1L5UA 5AQKA 5ELZA 2OTJN 5CE3A 1WBBA 4CFDA 4E1NA 1QZ6A 4FLVA 2KZMA 2AJQA 3J81O 1JCEA 1BOTO 2ZGYA 1Q81O 1NM1A 3VQ5A 4IG0A 1NGBA 1KLNA 3S9HA 4B3RK 1RBVA 3MX5A 4BRLA 3AVGA 2HBMA 4K41A 5I42A 3NGIA 1P90A 3ALYA 4DUZK 3D2FA 1D9FA 4DR6K 3FLCO 3MXIA 1QQMA 4OKKA 2G8WA 4Z94A 2QWQA 2I5JA 4JD2B 4FPBA 4H4OA 4FJJA 4O5FA 3CJ7A 3V4IA 2G8UA 5C10A 1Z6RA 3DXMB 2IAJA 3UKRA 4IBNA 1RBRA 1LOTB 1WSHA 1QS4A 2PYJA 3ZSOA 3OYDA 4C8MA 4FZXC 3PIPL 1JL2A 1WAJA 3VQ6A 5JS1A 2HBKA 3NHGA 2IVOA 4KV8A 3OYGA 4BDZA 1NKEA 5F1XA 1GLEG 3I56N 3G71N 3V81A 3HSTB 3WEEA 4HUGA 3ATVA 2P5OA 3O1WA 3NH0A 3OYAA 1I94K 2RE2A 2WTUA 3VERA 1NGHA 3OYJA 1MDUB 3R1XA 4OPAA 4AHTA 2F8TA 3KK1A 3VENA 3OJUA 2XRIA 5LMUK 3CCMN 4LD0A 1RFQA 3BZKA 4CJUA 4DLGA 4CEBA 1QTMA 5CYQA 4BWMA 1HNWK 1HLUA 3L0QA 3LDOA 3ZT2A 4ICLA 4CEAA 1NOZA 1O13A 4BRGA 1UA1A 4DQPA 3CI5A 4WYBA 4PQUA 5M1FA 4CESA 4I9LA 3AGKA 3I0SA 1JXEA 3QERA 1VSLA 3VQ9A 5F0XA 3CC7N 2D4WA 1T6DA 4A2AA 3L8BA 4CBXA 3TI0A 2Q3SA 4E7HA 2G8VA 3VQDA 2FBVA 3FZMA 2HNYA 2HVHA 1VQNN 1W0HA 4U67L 5AQQA 1GOAA 4KH4A 1HPMA 4M3RA 4FWPA 5AQPA 1O1WA 3ITHA 5AZIB 3SBGA 4DKWA 2X6SA 3K5MA 1WB9A 3ULDA 5KGXA 1FXXA 4XH1A 4BROA 2LSNA 3CCLN 3PIOL 3J80O 4CZJA 1HKGA 4OX9K 1GLBG 3MCAB 1OH7A 3V9UA 1BL3A 1JLAA 4BC4A 2P9LB 4OJRA 3LP3A 4A5BA 4DU1A 2KZZA 2E6MA 1JLQA 5AZJA 1U2VA 4R79A 1VQ6N 1UA0A 1NJIO 1KVCA 3ZETA 3CF5L 4MQ3A 2G8FA 3SAHA 3P83D 3LP0A 4O5BA 3B6PA 4CFCA 2J4RA 4UQGA 3KTQA 1S22A 4HVJA 2Y1IA 3ID8A 4BG9A 4PL7A 3PY8A 2O8DA 5AQSA 1DTQA 3DRPA 3V1QA 1BIZA 5B8HA 4OKJA 3DXKB 4W5RA 4CF2A 3EZ5A 4H03B 5KQDA 4PL8A 4O8KA 2FF3B 4DF8A 3CQYA 2RN2A 4DV1K 3T69A 3K9KA 4DSFA 1Q9YA 4JK7A 3VOVA 1WNSA 2PBDA 4DMNA 4H5RA 1BCOA 3JS6A 4CI6A 4CZEA 4J2DA 2NRTA 3HP6A 3SQ2A 5FRMA 3HZ6A 3HM9A 1BQMA 3ZSWA
chains in the Genus database with same CATH topology
1SKRA 4F4KA 1FK9A 2D0BA 3PX0A 1QSYA 2G8IA 2IGIA 4QAGA 3NBPA 1QQCA 3TARA 3RR8A 5SZTA 1TL1A 1VSHA 4I9QA 2KFZA 2FC0A 2ZD1A 3SPYA 4DTUA 3TANA 1BHLA 4E89A 3NDKA 4Y1CA 1C1AA 3ZSQA 3OYHA 4ZTJA 2QK9A 3RRHA 1EETA 2A1SA 3NF9A 4DTMA 4E7IA 4NCAA 1UAXA 3C6TA 1XC9A 2YNFA 4DG1A 3C6UA 5HRPA 2E6LA 1NKBA 3QINA 3TABA 3TAPA 4C8LA 2XY6A 4J2BA 4N41A 3RMAA 4M3UA 5J2PA 1RBTA 4B8CA 3T1AA 4XIUA 4OGCA 4DQQA 3SI6A 1N6QA 4AHVA 1RT1A 3V9XA 4YFUA 4OKEA 4WE1A 5K14A 4JS5A 1JKHA 2P51A 4CJKA 1IKWA 1BISA 4C8OA 1IKVA 1LW2A 1JLEA 4DS5A 2VG7A 1NJYA 3K5OA 3EY1A 1HNIA 1K6YA 4CGJA 4H4MA 1DTTA 3SYZA 4LSLA 4CHZA 4Z0UA 4IFVA 5KRTA 1TGOA 2YKMA 3AVKA 2QXFA 5J2QA 1BQNA 4AILC 2OPPA 5KGWA 2ITGA 1NK7A 1L3UA 1HPZA 2DFFA 2OZSA 4HHTA 4FJNA 3IS9A 1RDCA 2ATQA 1TKZA 2GBZA 3OYLA 2VWJA 4FW2A 3SUOA 4KO0A 4BE0A 3WNFA 4IKFA 1S1UA 2HHTA 1CZ9A 1B9FA 4LH5A 3L2VA 3G10A 4DU3A 1X9MA 5SWMA 3KLFA 2XY7A 1RTDA 3AO2A 2EHGA 3AVFA 3DLGA 3LZIA 4B9NA 4B9MA 3KLIA 1BI4A 3C94A 1CXUA 4RW9A 4CJPA 1EXQA 1EX4A 4B08A 4F3OA 2W42A 1KFSA 4FM1A 3PO4A 1UOCA 3AO3A 3LANA 1T05A 2DY4A 2B6AA 3O3HA 3QESA 2HHXA 3CYMA 4E7LA 4DSKA 4NCBA 5HP1A 4GW6A 1BGXT 3QEPA 1HYZA 1Z26A 1S9EA 1TVRA 4KTWA 5KTQA 3M8RA 3ZSYA 3QIOA 3OYEA 3LWLA 3VQ8A 4F2RA 4DTPA 4M42A 4CIGA 3NH1A 1RT5A 3T19A 1D8YA 4FK0A 4OLBA 3TAFA 4OPJA 1X9SA 1ZBUA 4ID5A 2Y1JA 3L2RA 4PA1A 1XHXA 4CHQA 1U45A 2HHQA 4B9LA 4LY7A 4CF8A 4CHNA 3VQ4A 1NK0A 4DQRA 3O3GA 1YVUA 4ZHRA 4IDKA 1T8EA 1QHTA 2BGGA 4FJKA 3TAEA 2HNDA 4CFBA 3KIOA 4AHCA 1SL1A 4FM2A 1RDDA 2WONA 2WOMA 4AH9A 3OJSA 2A1RA 1BIUA 1G15A 2P1JA 4B9UA 2X74A 3SQ0A 5HBMA 4Z4EA 2OZMA 3IG1A 4RW4A 3SZ2A 4CJRA 4O55A 3HVRA 3HVTA 2IDOA 5CY4A 3L2QA 3NE6A 1ZBHA 1YTUA 5KI6A 3SV3A 3AVHA 4CEZA 3KLHA 4FW1A 3D45A 5HLFA 4M3YA 3MECA 3V6DA 5FDLA 1LAVA 4JS4A 4F2SA 1KVBA 1J9AA 3VQEA 3QEWA 4ZTFA 4EZ9A 4KTQA 2YHAA 3MXMA 4OLAA 3RMDA 2IS3A 3RR7A 2KTQA 4CHYA 3QEXA 2Z1IA 4FLXA 4CJ5A 4KKOA 1KFDA 4ELVA 3HJFA 4NYFA 3KLGA 4CJTA 4CE9A 2ZQBA 4C8NA 4HCCA 3OY9A 2HB5A 3WNHA 2R7YA 1U48A 4HTUA 4CJFA 3SPZA 4FLTA 5D3GA 3RMBA 3RWUA 2F8SA 4KRFA 4IFYA 2GUIA 4DFMA 3TAQA 4N5SA 1CXQA 1VRTA 4M3TA 3ZSZA 4BDPA 2YNGA 3DRRA 1C0MA 4DF4A 4Y1DA 1TKXA 4I2PA 3TAGA 1NJZA 3JSMA 4BACA 1TV6A 3SUQA 4H8KA 4FK2A 1IKXA 1VSJA 1TAUA 4ELTA 2B4JA 2DFEA 4DTOA 1Q9XA 1C1CA 3AO1A 1T03A 4CEEA 3DM2A 3NAEA 3CQ8A 2HMIA 2HW3A 1S1XA 1BCMA 2QKBA 1LWEA 3LAKA 4FLUA 1SUQA 4LSNA 3V9WA 2DFHA 1QSLA 4DWIA 4CHOA 1I3AA 4CEDA 3H08A 1IO2A 4QOZB 3LPTA 2D0AA 4ID1A 3L3UA 4N76A 1QSSA 2D5RA 4Q5VA 1R0AA 1D9DA 4KREA 1IH7A 2PY5A 4FLYA 4CEOA 1HQUA 2E4LA 4HCBA 3HPGA 1X9WA 1N5YA 4CJWA 4EP4A 4B9SA 4RW7A 4M45A 1C0TA 3AO5A 1ASVA 2RF2A 3WNEA 2HNZA 2OPSA 4CK3A 4FZYA 1NOYA 1RDBA 3RTVA 4K8ZA 3O4QA 4FJLA 5FRNA 3PX6A 1WSIA 3RMCA 3IRXA 3MEDA 3S3OA 4E19A 4FJ5A 1X1PA 5DMRA 4E1MA 3EYZA 1L3SA 3L2WA 3K59A 3QEVA 3CG7A 3U6FA 1WLJA 4CJ4A 3LP2A 4CF0A 4CHPA 1JLFA 2XY5A 4Z4CA 4CGHA 4O4GA 3AO4A 3ZCMA 3DOKA 3OYKA 4O44A 3NF6A 1WSJA 4B3OA 3KKRA 4AHRA 3LZJA 1SKSA 1VRUA 4CGFA 4M41A 5EU7A 2HHVA 3MXJA 4I7FA 4BE1A 3CFRA 4Z4FA 3SNNA 3SQ1A 3HXMA 4FYDA 4CGIA 2IOCA 3BDPA 2X6NA 3DOLA 1YTAA 4TSXA 3KLEA 1ASWA 1UWBA 3BGRA 3HP9A 4DTXA 4E0DA 1C0UA 3QLHA 4G1QA 3P1GA 3VQCA 1S9GA 4CJEA 4EZ6A 1LAWA 3QETA 1LV5A 2VWKA 1MU2A 4M3XA 1XWLA 3DLKA 1J54A 3V9SA 4CFAA 4CIEA 4DFJA 1RBSA 5HRSA 1DLOA 2YHBA 3DYAA 4FJXA 3THVA 4DSJA 1JLBA 1NK6A 1A5XA 2X78A 1VK0A 1RDAA 3CFOA 4E7JA 4DSLA 1XHZA 5J1EA 1GOBA 3PUFA 4KHQA 2O4IA 3AVCA 3DLRA 4R5PA 3V9ZA 3F73A 3U3GA 1S1VA 3DI6A 5I3UA 3K58A 3AVMA 1GOCA 1RT2A 1I39A 4CJVA 1Y97A 3SQ4A 4KHYA 1S5JA 2HVIA 3LAMA 4NYNA 3VQPA 3DMJA 4BDYA 1IG9A 4E7KA 3UIQA 4KB0A 4CECA 2OA8A 3LWMA 2DTUA 4CK2A 4RW6A 2XY8A 3LALA 4CJSA 4RW8A 3HPHA 3DLHA 3AV9A 3ZT0A 3OYBA 5C25A 3VA3A 1L5UA 3C95A 1HYSA 4FJ9A 1HQEA 4KPYA 2OPQA 4CJ3A 4FZZA 3KD1E 3WNGA 4IG3A 2P5GA 4CFDA 4F3TA 4DSEA 2HHWA 3NFAA 1S6QA 4E1NA 3OYIA 1Q8IA 5CYMA 4AHUA 4FLVA 2KZMA 2AJQA 1FKPA 1L3TA 1C6VA 1L3VA 1Z25A 4O0IA 3VQ5A 3SUPA 4IG0A 3TR8A 3LPUA 3VQBA 3S9HA 1KLNA 2G8KA 1RBVA 4CGDA 1EP4A 3OS2A 3AVGA 1U04A 4DQSA 5I42A 4N47A 3NGIA 2NUBA 3MEEA 1NKCA 1J5OA 3ALYA 3OS1A 3ZT3A 5T7BA 1D9FA 1EKEA 4DTSA 4PUOA 3E01A 3V1RA 4DTJA 3MXIA 4OKKA 3QIPA 5C42A 2G8WA 3K5LA 2RKIA 1LWCA 1NK4A 4K8XA 2I5JA 4LH4A 2PYLA 3F9KA 2KFNA 4H4OA 4O0JA 4FJJA 1HJRA 1TK8A 2G8UA 1RBUA 3V4IA 4C8KA 2KW4A 1TK0A 3B6OA 1JLCA 2IAJA 2IC3A 4IBNA 4KI4A 1CLQA 2FBXA 3ASMA 3O3FA 1RCHA 1VSDA 4AHSA 3AVBA 1RBRA 1WSHA 3U3YA 4CF9A 1QS4A 2PYJA 1ASUA 1T7PA 4RG8A 4DTRA 3ZSOA 3NGZA 3NF7A 4C8MA 3OYDA 4FZXC 2EX3A 1JL2A 1D5AA 3KJVA 3NGYA 1TAQA 3AVIA 3VN5A 4PY5A 3D0PA 2OPRA 3HPOA 1XI1A 1WAJA 3G0ZA 4CJLA 3VQ6A 3LDSA 4FLWA 3NF8A 3I8DA 5CZ2A 3KK2A 2B5JA 3NHGA 5JS1A 1KVAA 3SV4A 4FK4A 3K57A 2Z1GA 3OYMA 4KV8A 3T3FA 4B9TA 3OYGA 4BDZA 3SCXA 1NKEA 3AVNA 4HUFA 4KB1A 1NJWA 2HHUA 1KCFA 2D0CA 3O4NA 3QNOA 3V81A 3S3NA 3HSTB 1KSPA 1YT3A 1HYVA 1KLMA 4HUEA 1WN7A 3HO1A 1NK5A 2FBYA 2BANA 5KRSA 3KD5E 4HUGA 4B8AB 3PV8A 2P5OA 1S1TA 3NH0A 3OYAA 3L2UA 1J53A 1A5VA 3OYJA 1S1WA 2FBTA 2YNHA 3LP1A 4AHTA 2HHSA 2F8TA 2O4GA 4W5OA 3KK1A 3OJUA 3NCIA 1VSIA 4FXDA 2XRIA 1B9DA 3P5JA 2QKKA 4LD0A 3SJJA 3M8PA 1RTHA 2Z1JA 4DFPA 2KQ2A 3OYNA 1TKDA 4CJUA 4DLGA 4FJ7A 4CEBA 1QTMA 5CYQA 1S6PA 4BWMA 4CF1A 4W5QA 3VA0A 3HT3A 1WAFA 3MAQA 1SL2A 3ZT2A 3CM5A 4OVLA 1WSEA 3AVAA 3ZSXA 5J2NA 1JLGA 2F96A 4ICLA 3AVLA 4CEAA 1NOZA 1UA1A 4CERA 4DQPA 4PQUA 4CESA 4I9LA 4FCYA 3I0SA 4J2EA 4B9VA 1JXEA 3QERA 4M3WA 3I0RA 3AA2A 4OGEA 1VSLA 3VQ9A 1TK5A 3HK2A 1ITGA 1JXBA 4OPKA 3QEIA 5HRNA 1RT4A 3L8BA 2YNIA 4MFBA 3TI0A 4M3ZA 5CZ1A 4W5NA 3OYFA 2Q3SA 3OVNA 4E7HA 2G8VA 3SUNA 3CFPA 1RTJA 3A2FA 3RRGA 3VQDA 3AA5X 3VQAA 4KFBA 4KHUA 2ETJA 2FBVA 3DRSA 4KTZA 1U4BA 4DSIA 3OYCA 1RT6A 2HNYA 2HVHA 5HRRA 4FJGA 1RT3A 1W0HA 4KHWA 4FLZA 1GOAA 4FVMA 4KHSA 4BWJA 1RNHA 4N56A 4M3RA 4JLHA 3ISNC 1ZYQA 2PZSA 3L3VA 2RPIA 3HYFA 4DTNA 3MEGA 4DFKA 1O1WA 3ITHA 4ELUA 2X6SA 3K5MA 2OYQA 5J2MA 1W9HA 1NK8A 4Z4GA 4CJQA 3ULDA 4Z4HA 5KGXA 4F8RA 1FXXA 3AVJA 2LSNA 2YKNA 4I2QA 4CGGA 4QCLA 1HMVA 3OS0A 1NJXA 3JYTA 1C1BA 2VG5A 3V9UA 1BL3A 1JLAA 3DLBA 4OJRA 5C24A 3LP3A 4GVMA 4CIFA 4KI6A 4DU1A 2KZZA 2E6MA 1JLQA 3PX4A 2GV9A 4JRPA 4FJMA 4CCHA 3ZT4A 1ZBFA 3VQ7A 1UA0A 1KVCA 1BI4B 4FJIA 1REVA 4MQ3A 1HNVA 1QE1A 5DK5A 2G8FA 4KAZA 2ZE2A 4KHNA 3P83D 1LW0A 2Z1HA 3LP0A 4O5BA 3B6PA 4DS4A 4CFCA 1A5WA 3TAMA 1NK9A 4UQGA 3QO9A 3KTQA 2YV0X 3NH2A 4BE2A 3PO5A 1TL3A 4HVJA 2Y1IA 1CZBA 4DQIA 4CK1A 1ZBLA 1VSMA 4Q0BA 4FM0A 3PY8A 3AA3A 1RILA 4FJHA 3M8SA 3IAYA 1DTQA 3DRPA 1SV5A 1BIZA 1F21A 3CM6A 3V1QA 2XO7A 3S3MA 4OKJA 4YNQA 1RTIA 3VQQA 4DU4A 4W5RA 1WSGA 3KK3A 4CF2A 1VSFA 5FROA 3EZ5A 4JRQA 4W5TA 1B92A 4J2AA 4NCGA 1LWFA 4DF8A 1SKWA 3FFIA 4E3SA 2RN2A 4FJ8A 1IKYA 1HRHA 4DSFA 1Q9YA 5E41A 1VSKA 2G8HA 4EP5A 2BDPA 1U49A 2BE2A 5JS2A 1JL1A 1FKOA 1KTQA 5HROA 1WNSA 2XHBA 1WSFA 1TKTA 3V1OA 1RT7A 1SL0A 4PWDA 3TWHA 4DMNA 4CEFA 1BCOA 1U47A 2JLEA 1VSEA 1KRPA 3AA4A 4CEQA 3ZT1A 4J2DA 4Z4IA 3HP6A 3SQ2A 3K2PA 3M8QA 2JGUA 5FRMA 3DLEA 3QNNA 4L8RB 3HM9A 4DLEA 3KKSA 3HL8A 3ZSRA 1ZBIA 1BQMA 4GMJB 3ZSVA 3ZSWA 2VG6A 3K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKR A;  4F4K A;  1FK9 A;  2D0B A;  3PX0 A;  1QSY A;  2G8I A;  2IGI A;  4QAG A;  3NBP A;  1QQC A;  3TAR A;  3RR8 A;  5SZT A;  1TL1 A;  1VSH A;  4I9Q A;  2KFZ A;  2FC0 A;  2ZD1 A;  3SPY A;  4DTU A;  3TAN A;  1BHL A;  4E89 A;  3NDK A;  4Y1C A;  1C1A A;  3ZSQ A;  3OYH A;  4ZTJ A;  2QK9 A;  3RRH A;  1EET A;  2A1S A;  3NF9 A;  4DTM A;  4E7I A;  4NCA A;  1UAX A;  3C6T A;  1XC9 A;  2YNF A;  4DG1 A;  3C6U A;  5HRP A;  2E6L A;  1NKB A;  3QIN A;  3TAB A;  3TAP A;  4C8L A;  2XY6 A;  4J2B A;  4N41 A;  3RMA A;  4M3U A;  5J2P A;  1RBT A;  4B8C A;  3T1A A;  4XIU A;  4OGC A;  4DQQ A;  3SI6 A;  1N6Q A;  4AHV A;  1RT1 A;  3V9X A;  4YFU A;  4OKE A;  4WE1 A;  5K14 A;  4JS5 A;  1JKH A;  2P51 A;  4CJK A;  1IKW A;  1BIS A;  4C8O A;  1IKV A;  1LW2 A;  1JLE A;  4DS5 A;  2VG7 A;  1NJY A;  3K5O A;  3EY1 A;  1HNI A;  1K6Y A;  4CGJ A;  4H4M A;  1DTT A;  3SYZ A;  4LSL A;  4CHZ A;  4Z0U A;  4IFV A;  5KRT A;  1TGO A;  2YKM A;  3AVK A;  2QXF A;  5J2Q A;  1BQN A;  4AIL C;  2OPP A;  5KGW A;  2ITG A;  1NK7 A;  1L3U A;  1HPZ A;  2DFF A;  2OZS A;  4HHT A;  4FJN A;  3IS9 A;  1RDC A;  2ATQ A;  1TKZ A;  2GBZ A;  3OYL A;  2VWJ A;  4FW2 A;  3SUO A;  4KO0 A;  4BE0 A;  3WNF A;  4IKF A;  1S1U A;  2HHT A;  1CZ9 A;  1B9F A;  4LH5 A;  3L2V A;  3G10 A;  4DU3 A;  1X9M A;  5SWM A;  3KLF A;  2XY7 A;  1RTD A;  3AO2 A;  2EHG A;  3AVF A;  3DLG A;  3LZI A;  4B9N A;  4B9M A;  3KLI A;  1BI4 A;  3C94 A;  1CXU A;  4RW9 A;  4CJP A;  1EXQ A;  1EX4 A;  4B08 A;  4F3O A;  2W42 A;  1KFS A;  4FM1 A;  3PO4 A;  1UOC A;  3AO3 A;  3LAN A;  1T05 A;  2DY4 A;  2B6A A;  3O3H A;  3QES A;  2HHX A;  3CYM A;  4E7L A;  4DSK A;  4NCB A;  5HP1 A;  4GW6 A;  1BGX T;  3QEP A;  1HYZ A;  1Z26 A;  1S9E A;  1TVR A;  4KTW A;  5KTQ A;  3M8R A;  3ZSY A;  3QIO A;  3OYE A;  3LWL A;  3VQ8 A;  4F2R A;  4DTP A;  4M42 A;  4CIG A;  3NH1 A;  1RT5 A;  3T19 A;  1D8Y A;  4FK0 A;  4OLB A;  3TAF A;  4OPJ A;  1X9S A;  1ZBU A;  4ID5 A;  2Y1J A;  3L2R A;  4PA1 A;  1XHX A;  4CHQ A;  1U45 A;  2HHQ A;  4B9L A;  4LY7 A;  4CF8 A;  4CHN A;  3VQ4 A;  1NK0 A;  4DQR A;  3O3G A;  1YVU A;  4ZHR A;  4IDK A;  1T8E A;  1QHT A;  2BGG A;  4FJK A;  3TAE A;  2HND A;  4CFB A;  3KIO A;  4AHC A;  1SL1 A;  4FM2 A;  1RDD A;  2WON A;  2WOM A;  4AH9 A;  3OJS A;  2A1R A;  1BIU A;  1G15 A;  2P1J A;  4B9U A;  2X74 A;  3SQ0 A;  5HBM A;  4Z4E A;  2OZM A;  3IG1 A;  4RW4 A;  3SZ2 A;  4CJR A;  4O55 A;  3HVR A;  3HVT A;  2IDO A;  5CY4 A;  3L2Q A;  3NE6 A;  1ZBH A;  1YTU A;  5KI6 A;  3SV3 A;  3AVH A;  4CEZ A;  3KLH A;  4FW1 A;  3D45 A;  5HLF A;  4M3Y A;  3MEC A;  3V6D A;  5FDL A;  1LAV A;  4JS4 A;  4F2S A;  1KVB A;  1J9A A;  3VQE A;  3QEW A;  4ZTF A;  4EZ9 A;  4KTQ A;  2YHA A;  3MXM A;  4OLA A;  3RMD A;  2IS3 A;  3RR7 A;  2KTQ A;  4CHY A;  3QEX A;  2Z1I A;  4FLX A;  4CJ5 A;  4KKO A;  1KFD A;  4ELV A;  3HJF A;  4NYF A;  3KLG A;  4CJT A;  4CE9 A;  2ZQB A;  4C8N A;  4HCC A;  3OY9 A;  2HB5 A;  3WNH A;  2R7Y A;  1U48 A;  4HTU A;  4CJF A;  3SPZ A;  4FLT A;  5D3G A;  3RMB A;  3RWU A;  2F8S A;  4KRF A;  4IFY A;  2GUI A;  4DFM A;  3TAQ A;  4N5S A;  1CXQ A;  1VRT A;  4M3T A;  3ZSZ A;  4BDP A;  2YNG A;  3DRR A;  1C0M A;  4DF4 A;  4Y1D A;  1TKX A;  4I2P A;  3TAG A;  1NJZ A;  3JSM A;  4BAC A;  1TV6 A;  3SUQ A;  4H8K A;  4FK2 A;  1IKX A;  1VSJ A;  1TAU A;  4ELT A;  2B4J A;  2DFE A;  4DTO A;  1Q9X A;  1C1C A;  3AO1 A;  1T03 A;  4CEE A;  3DM2 A;  3NAE A;  3CQ8 A;  2HMI A;  2HW3 A;  1S1X A;  1BCM A;  2QKB A;  1LWE A;  3LAK A;  4FLU A;  1SUQ A;  4LSN A;  3V9W A;  2DFH A;  1QSL A;  4DWI A;  4CHO A;  1I3A A;  4CED A;  3H08 A;  1IO2 A;  4QOZ B;  3LPT A;  2D0A A;  4ID1 A;  3L3U A;  4N76 A;  1QSS A;  2D5R A;  4Q5V A;  1R0A A;  1D9D A;  4KRE A;  1IH7 A;  2PY5 A;  4FLY A;  4CEO A;  1HQU A;  2E4L A;  4HCB A;  3HPG A;  1X9W A;  1N5Y A;  4CJW A;  4EP4 A;  4B9S A;  4RW7 A;  4M45 A;  1C0T A;  3AO5 A;  1ASV A;  2RF2 A;  3WNE A;  2HNZ A;  2OPS A;  4CK3 A;  4FZY A;  1NOY A;  1RDB A;  3RTV A;  4K8Z A;  3O4Q A;  4FJL A;  5FRN A;  3PX6 A;  1WSI A;  3RMC A;  3IRX A;  3MED A;  3S3O A;  4E19 A;  4FJ5 A;  1X1P A;  5DMR A;  4E1M A;  3EYZ A;  1L3S A;  3L2W A;  3K59 A;  3QEV A;  3CG7 A;  3U6F A;  1WLJ A;  4CJ4 A;  3LP2 A;  4CF0 A;  4CHP A;  1JLF A;  2XY5 A;  4Z4C A;  4CGH A;  4O4G A;  3AO4 A;  3ZCM A;  3DOK A;  3OYK A;  4O44 A;  3NF6 A;  1WSJ A;  4B3O A;  3KKR A;  4AHR A;  3LZJ A;  1SKS A;  1VRU A;  4CGF A;  4M41 A;  5EU7 A;  2HHV A;  3MXJ A;  4I7F A;  4BE1 A;  3CFR A;  4Z4F A;  3SNN A;  3SQ1 A;  3HXM A;  4FYD A;  4CGI A;  2IOC A;  3BDP A;  2X6N A;  3DOL A;  1YTA A;  4TSX A;  3KLE A;  1ASW A;  1UWB A;  3BGR A;  3HP9 A;  4DTX A;  4E0D A;  1C0U A;  3QLH A;  4G1Q A;  3P1G A;  3VQC A;  1S9G A;  4CJE A;  4EZ6 A;  1LAW A;  3QET A;  1LV5 A;  2VWK A;  1MU2 A;  4M3X A;  1XWL A;  3DLK A;  1J54 A;  3V9S A;  4CFA A;  4CIE A;  4DFJ A;  1RBS A;  5HRS A;  1DLO A;  2YHB A;  3DYA A;  4FJX A;  3THV A;  4DSJ A;  1JLB A;  1NK6 A;  1A5X A;  2X78 A;  1VK0 A;  1RDA A;  3CFO A;  4E7J A;  4DSL A;  1XHZ A;  5J1E A;  1GOB A;  3PUF A;  4KHQ A;  2O4I A;  3AVC A;  3DLR A;  4R5P A;  3V9Z A;  3F73 A;  3U3G A;  1S1V A;  3DI6 A;  5I3U A;  3K58 A;  3AVM A;  1GOC A;  1RT2 A;  1I39 A;  4CJV A;  1Y97 A;  3SQ4 A;  4KHY A;  1S5J A;  2HVI A;  3LAM A;  4NYN A;  3VQP A;  3DMJ A;  4BDY A;  1IG9 A;  4E7K A;  3UIQ A;  4KB0 A;  4CEC A;  2OA8 A;  3LWM A;  2DTU A;  4CK2 A;  4RW6 A;  2XY8 A;  3LAL A;  4CJS A;  4RW8 A;  3HPH A;  3DLH A;  3AV9 A;  3ZT0 A;  3OYB A;  5C25 A;  3VA3 A;  1L5U A;  3C95 A;  1HYS A;  4FJ9 A;  1HQE A;  4KPY A;  2OPQ A;  4CJ3 A;  4FZZ A;  3KD1 E;  3WNG A;  4IG3 A;  2P5G A;  4CFD A;  4F3T A;  4DSE A;  2HHW A;  3NFA A;  1S6Q A;  4E1N A;  3OYI A;  1Q8I A;  5CYM A;  4AHU A;  4FLV A;  2KZM A;  2AJQ A;  1FKP A;  1L3T A;  1C6V A;  1L3V A;  1Z25 A;  4O0I A;  3VQ5 A;  3SUP A;  4IG0 A;  3TR8 A;  3LPU A;  3VQB A;  3S9H A;  1KLN A;  2G8K A;  1RBV A;  4CGD A;  1EP4 A;  3OS2 A;  3AVG A;  1U04 A;  4DQS A;  5I42 A;  4N47 A;  3NGI A;  2NUB A;  3MEE A;  1NKC A;  1J5O A;  3ALY A;  3OS1 A;  3ZT3 A;  5T7B A;  1D9F A;  1EKE A;  4DTS A;  4PUO A;  3E01 A;  3V1R A;  4DTJ A;  3MXI A;  4OKK A;  3QIP A;  5C42 A;  2G8W A;  3K5L A;  2RKI A;  1LWC A;  1NK4 A;  4K8X A;  2I5J A;  4LH4 A;  2PYL A;  3F9K A;  2KFN A;  4H4O A;  4O0J A;  4FJJ A;  1HJR A;  1TK8 A;  2G8U A;  1RBU A;  3V4I A;  4C8K A;  2KW4 A;  1TK0 A;  3B6O A;  1JLC A;  2IAJ A;  2IC3 A;  4IBN A;  4KI4 A;  1CLQ A;  2FBX A;  3ASM A;  3O3F A;  1RCH A;  1VSD A;  4AHS A;  3AVB A;  1RBR A;  1WSH A;  3U3Y A;  4CF9 A;  1QS4 A;  2PYJ A;  1ASU A;  1T7P A;  4RG8 A;  4DTR A;  3ZSO A;  3NGZ A;  3NF7 A;  4C8M A;  3OYD A;  4FZX C;  2EX3 A;  1JL2 A;  1D5A A;  3KJV A;  3NGY A;  1TAQ A;  3AVI A;  3VN5 A;  4PY5 A;  3D0P A;  2OPR A;  3HPO A;  1XI1 A;  1WAJ A;  3G0Z A;  4CJL A;  3VQ6 A;  3LDS A;  4FLW A;  3NF8 A;  3I8D A;  5CZ2 A;  3KK2 A;  2B5J A;  3NHG A;  5JS1 A;  1KVA A;  3SV4 A;  4FK4 A;  3K57 A;  2Z1G A;  3OYM A;  4KV8 A;  3T3F A;  4B9T A;  3OYG A;  4BDZ A;  3SCX A;  1NKE A;  3AVN A;  4HUF A;  4KB1 A;  1NJW A;  2HHU A;  1KCF A;  2D0C A;  3O4N A;  3QNO A;  3V81 A;  3S3N A;  3HST B;  1KSP A;  1YT3 A;  1HYV A;  1KLM A;  4HUE A;  1WN7 A;  3HO1 A;  1NK5 A;  2FBY A;  2BAN A;  5KRS A;  3KD5 E;  4HUG A;  4B8A B;  3PV8 A;  2P5O A;  1S1T A;  3NH0 A;  3OYA A;  3L2U A;  1J53 A;  1A5V A;  3OYJ A;  1S1W A;  2FBT A;  2YNH A;  3LP1 A;  4AHT A;  2HHS A;  2F8T A;  2O4G A;  4W5O A;  3KK1 A;  3OJU A;  3NCI A;  1VSI A;  4FXD A;  2XRI A;  1B9D A;  3P5J A;  2QKK A;  4LD0 A;  3SJJ A;  3M8P A;  1RTH A;  2Z1J A;  4DFP A;  2KQ2 A;  3OYN A;  1TKD A;  4CJU A;  4DLG A;  4FJ7 A;  4CEB A;  1QTM A;  5CYQ A;  1S6P A;  4BWM A;  4CF1 A;  4W5Q A;  3VA0 A;  3HT3 A;  1WAF A;  3MAQ A;  1SL2 A;  3ZT2 A;  3CM5 A;  4OVL A;  1WSE A;  3AVA A;  3ZSX A;  5J2N A;  1JLG A;  2F96 A;  4ICL A;  3AVL A;  4CEA A;  1NOZ A;  1UA1 A;  4CER A;  4DQP A;  4PQU A;  4CES A;  4I9L A;  4FCY A;  3I0S A;  4J2E A;  4B9V A;  1JXE A;  3QER A;  4M3W A;  3I0R A;  3AA2 A;  4OGE A;  1VSL A;  3VQ9 A;  1TK5 A;  3HK2 A;  1ITG A;  1JXB A;  4OPK A;  3QEI A;  5HRN A;  1RT4 A;  3L8B A;  2YNI A;  4MFB A;  3TI0 A;  4M3Z A;  5CZ1 A;  4W5N A;  3OYF A;  2Q3S A;  3OVN A;  4E7H A;  2G8V A;  3SUN A;  3CFP A;  1RTJ A;  3A2F A;  3RRG A;  3VQD A;  3AA5 X;  3VQA A;  4KFB A;  4KHU A;  2ETJ A;  2FBV A;  3DRS A;  4KTZ A;  1U4B A;  4DSI A;  3OYC A;  1RT6 A;  2HNY A;  2HVH A;  5HRR A;  4FJG A;  1RT3 A;  1W0H A;  4KHW A;  4FLZ A;  1GOA A;  4FVM A;  4KHS A;  4BWJ A;  1RNH A;  4N56 A;  4M3R A;  4JLH A;  3ISN C;  1ZYQ A;  2PZS A;  3L3V A;  2RPI A;  3HYF A;  4DTN A;  3MEG A;  4DFK A;  1O1W A;  3ITH A;  4ELU A;  2X6S A;  3K5M A;  2OYQ A;  5J2M A;  1W9H A;  1NK8 A;  4Z4G A;  4CJQ A;  3ULD A;  4Z4H A;  5KGX A;  4F8R A;  1FXX A;  3AVJ A;  2LSN A;  2YKN A;  4I2Q A;  4CGG A;  4QCL A;  1HMV A;  3OS0 A;  1NJX A;  3JYT A;  1C1B A;  2VG5 A;  3V9U A;  1BL3 A;  1JLA A;  3DLB A;  4OJR A;  5C24 A;  3LP3 A;  4GVM A;  4CIF A;  4KI6 A;  4DU1 A;  2KZZ A;  2E6M A;  1JLQ A;  3PX4 A;  2GV9 A;  4JRP A;  4FJM A;  4CCH A;  3ZT4 A;  1ZBF A;  3VQ7 A;  1UA0 A;  1KVC A;  1BI4 B;  4FJI A;  1REV A;  4MQ3 A;  1HNV A;  1QE1 A;  5DK5 A;  2G8F A;  4KAZ A;  2ZE2 A;  4KHN A;  3P83 D;  1LW0 A;  2Z1H A;  3LP0 A;  4O5B A;  3B6P A;  4DS4 A;  4CFC A;  1A5W A;  3TAM A;  1NK9 A;  4UQG A;  3QO9 A;  3KTQ A;  2YV0 X;  3NH2 A;  4BE2 A;  3PO5 A;  1TL3 A;  4HVJ A;  2Y1I A;  1CZB A;  4DQI A;  4CK1 A;  1ZBL A;  1VSM A;  4Q0B A;  4FM0 A;  3PY8 A;  3AA3 A;  1RIL A;  4FJH A;  3M8S A;  3IAY A;  1DTQ A;  3DRP A;  1SV5 A;  1BIZ A;  1F21 A;  3CM6 A;  3V1Q A;  2XO7 A;  3S3M A;  4OKJ A;  4YNQ A;  1RTI A;  3VQQ A;  4DU4 A;  4W5R A;  1WSG A;  3KK3 A;  4CF2 A;  1VSF A;  5FRO A;  3EZ5 A;  4JRQ A;  4W5T A;  1B92 A;  4J2A A;  4NCG A;  1LWF A;  4DF8 A;  1SKW A;  3FFI A;  4E3S A;  2RN2 A;  4FJ8 A;  1IKY A;  1HRH A;  4DSF A;  1Q9Y A;  5E41 A;  1VSK A;  2G8H A;  4EP5 A;  2BDP A;  1U49 A;  2BE2 A;  5JS2 A;  1JL1 A;  1FKO A;  1KTQ A;  5HRO A;  1WNS A;  2XHB A;  1WSF A;  1TKT A;  3V1O A;  1RT7 A;  1SL0 A;  4PWD A;  3TWH A;  4DMN A;  4CEF A;  1BCO A;  1U47 A;  2JLE A;  1VSE A;  1KRP A;  3AA4 A;  4CEQ A;  3ZT1 A;  4J2D A;  4Z4I A;  3HP6 A;  3SQ2 A;  3K2P A;  3M8Q A;  2JGU A;  5FRM A;  3DLE A;  3QNN A;  4L8R B;  3HM9 A;  4DLE A;  3KKS A;  3HL8 A;  3ZSR A;  1ZBI A;  1BQM A;  4GMJ B;  3ZSV A;  3ZSW A;  2VG6 A;  3K5N A; 
#chains in the Genus database with same CATH topology
 1SKR A;  3O9Q A;  5C15 A;  4BG8 A;  2D0P A;  2IGI A;  3KZB A;  3RSE B;  5SZT A;  4I9Q A;  4A2B A;  4DTU A;  3TAN A;  4Y1C A;  5AQL A;  3P31 A;  3QBW A;  4WFA L;  1EET A;  2A1S A;  4DTM A;  1NGF A;  3QFP A;  4B3S K;  4J2B A;  4X64 K;  1RBT A;  1N6Q A;  4OGC A;  4JI4 K;  4H0V B;  1JJ2 M;  1Q7Y O;  1JKH A;  2P51 A;  2QWR A;  1BIS A;  4PKH A;  3OHR A;  4WFN L;  4H5T A;  2QM1 A;  2DPN A;  3TTC A;  3SYZ A;  4CHZ A;  4IFV A;  1TGO A;  3AVK A;  4Z4I A;  1R59 O;  5KGW A;  3DLL L;  1HPZ A;  2DFF A;  2OZS A;  3Q7C A;  2FLO A;  3C6H A;  4GNI A;  1TKZ A;  3O8M A;  4B3M K;  4V19 S;  2O8B A;  4B9N A;  2EHG A;  2F9W A;  3KLI A;  1G99 A;  1EXQ A;  4B08 A;  3TSU A;  4JAX A;  2ASP A;  2DY4 A;  4DSK A;  3CQX A;  3QIO A;  4B1U B;  3OYE A;  3LWL A;  4F2R A;  4IEE A;  4BC2 A;  4JD2 A;  1X9S A;  2HHH K;  2GTD A;  1QHA A;  3FZK A;  1U45 A;  4DR4 K;  4LY7 A;  3DXM A;  3MN5 A;  4CHN A;  3O3G A;  4LF6 K;  2E2O A;  1KQS M;  1QHT A;  4JHD A;  3H45 C;  4CFB A;  4AHC A;  1RDD A;  4AH9 A;  3OJS A;  2QWM A;  4BR2 A;  3BUZ B;  4YOW A;  4H5N A;  3DAW A;  3MN7 A;  1YTU A;  4XH4 A;  4IEI A;  5KI6 A;  3SV3 A;  3KLH A;  3V6D A;  5FDL A;  1LAV A;  1KVB A;  2Q97 A;  3VQE A;  3QEW A;  4OLA A;  3RMD A;  2IS3 A;  2Q31 A;  3QEX A;  4FLX A;  3CHW A;  4AM7 A;  3PSI A;  2VYP A;  5GIN A;  2ZQB A;  1XMO K;  4GVE A;  3W3D A;  4B1X B;  4HCC A;  4JI8 K;  1M1K O;  2VQE K;  1K8K B;  4FLT A;  3RMB A;  3RWU A;  3OW2 M;  4DFM A;  4QS7 A;  4N5S A;  1VRT A;  5EVZ A;  3ZSZ A;  4Y1D A;  4MDB A;  4ILG B;  3SMS A;  1TV6 A;  3CC4 N;  3SAG A;  4DTO A;  3MN9 A;  1C1C A;  1Q9X A;  3CQ8 A;  4BC5 A;  2HW3 A;  3IUC A;  2QKB A;  1LWE A;  4FLU A;  4Y0W A;  4CHO A;  1N32 K;  4CED A;  2YHY A;  3D2F B;  3GE1 A;  2OAN A;  3B8A X;  4Q5V A;  1IH7 A;  4CEO A;  3LDN A;  1HQU A;  4XH5 A;  3D6R A;  3O1B A;  1X9W A;  5TKY A;  4H5W A;  2HNZ A;  2OPS A;  5FPD A;  1RDB A;  5GAG P;  4FVU A;  3O4Q A;  4O8U A;  4DR1 K;  3ENO A;  3IRX A;  1NGG A;  5BRF A;  2ZJP L;  3CG7 A;  5AZI A;  4CJ4 A;  5AQG A;  4CHP A;  1JLF A;  3ZCM A;  1QVF M;  5H1S Q;  2IIR A;  3KKR A;  4AHR A;  3LZJ A;  2VQF K;  5EU7 A;  1X3N A;  5GAE P;  4WQ5 A;  3SNN A;  2IOC A;  3DOL A;  1YTA A;  5AQM A;  4ILH A;  1HJO A;  1NWK A;  1N33 K;  4CFA A;  3WXL A;  1GLD G;  5C12 A;  4DFJ A;  1DLO A;  2YHB A;  4JV5 K;  5CR4 A;  3THV A;  2WC9 A;  1JLB A;  1VK0 A;  5JIC A;  5CHI A;  5J1E A;  5AR0 A;  1YAG A;  1GLL O;  3DLR A;  3FE1 A;  1BWF O;  4CVN E;  3AVM A;  4CJV A;  3SQ4 A;  3WXM B;  1S5J A;  1NGE A;  3VEV A;  3VQP A;  1IG9 A;  4IO9 L;  3D2E A;  4CK2 A;  5M1P A;  2XY8 A;  4CBW A;  4DHY A;  5AQY A;  1MWM A;  3RVC A;  4IDH A;  5M1O A;  3C95 A;  2HF4 A;  4FJ9 A;  4KPY A;  2YHW A;  4DB3 A;  2P5G A;  1BA0 A;  3VES A;  4X65 K;  1Q8I A;  5CYM A;  1L3T A;  1Z25 A;  2A6A A;  4O0I A;  3SUP A;  3TR8 A;  4BRF A;  2G8K A;  4BR4 A;  1VQ9 N;  1EP4 A;  4FWM A;  1U04 A;  4FWL A;  2NUB A;  5M1Q A;  3FFK B;  1NKC A;  3RSE A;  4IZ9 A;  2YX6 A;  3TSQ A;  2YJF A;  5T7B A;  3CJB A;  4DTS A;  4WQ4 A;  2UYT A;  1SS6 A;  3E01 A;  3V1R A;  3VEY A;  2NRR A;  3QIP A;  5C42 A;  1YIT N;  3K5L A;  2RKI A;  5GIP A;  1LWC A;  1YI2 N;  4LH4 A;  2PYL A;  4BQL A;  1WBD A;  1HJR A;  3NMU A;  4C8K A;  1XUP O;  2KLA A;  4BRQ A;  3B6O A;  2IC3 A;  4KI4 A;  1CLQ A;  4NO7 A;  2QWP A;  1RCH A;  1OKJ A;  3AVB A;  4M63 C;  3ZET B;  3U3Y A;  3DJC A;  2EX3 A;  4AQY K;  5A2Q O;  3HPO A;  4C1N I;  3G0Z A;  3K0S A;  2H3G X;  3TTD A;  4FLW A;  3NF8 A;  3I8D A;  1KVA A;  5BN9 A;  3SV4 A;  1NBW A;  2Z1G A;  3VGM A;  4B9T A;  3THW B;  5EOY A;  2Q0U A;  4LC9 B;  3AVN A;  4KB1 A;  3C6A A;  2HHU A;  1KCF A;  2D0C A;  3QNO A;  2CGK A;  2P9K A;  2W41 A;  4HUE A;  1WN7 A;  1NK5 A;  3WXK A;  2BAN A;  5KRS A;  3KD5 E;  4XEI A;  4OPH A;  3L2U A;  1J53 A;  2FBT A;  2YNH A;  3VMF B;  4CZF A;  2HHS A;  2JWK A;  4W5O A;  1Z05 A;  4FXD A;  1ZC6 A;  1B9D A;  4A59 A;  3P5J A;  2CGL A;  4DFP A;  2Z1J A;  1GLA G;  1YHQ N;  1NGJ A;  5GAD P;  2E2N A;  2VWB A;  1S6P A;  4W5Q A;  1IV0 A;  3A8Y A;  4A57 A;  3ZSX A;  3IDH A;  5J2N A;  2F96 A;  4BC3 A;  4GKJ K;  3LM9 A;  5AQU A;  3TTF A;  4LF4 K;  4FCY A;  4J2E A;  1SQK A;  4BVO A;  1ITG A;  3QEI A;  1S72 N;  4QS9 A;  4MFB A;  4DR2 K;  3OBW A;  5AFU A;  4KFB A;  3DRS A;  4DSI A;  2NRW A;  3OYC A;  1RT6 A;  2OTL N;  2NRX A;  3GL1 A;  4KHW A;  4KHS A;  4FVM A;  4N56 A;  3ISN C;  4JNE A;  2PZS A;  3L3V A;  2RPI A;  3HYF A;  3MEG A;  4DFK A;  4ELU A;  2ZJR L;  1K8K A;  1W9H A;  4F8R A;  4FWS A;  3AVJ A;  2QEX N;  2E2Q A;  1VQ5 N;  4BRH A;  3DLB A;  2I7P A;  3P4I A;  4JKF A;  1ATR A;  3GDQ A;  5BR8 K;  4RCH A;  2GV9 A;  3H1V X;  4CCH A;  2O8B B;  1ZBF A;  1WOQ A;  5BRH A;  1HNV A;  1QE1 A;  2ZE2 A;  2Z1H A;  2GUP A;  1A5W A;  4BRC A;  2A3Z A;  3PO5 A;  1CZB A;  1VSM A;  4HTL A;  1K9M O;  1RIL A;  4FJH A;  3IAY A;  1F21 A;  3S3M A;  3VQQ A;  4DU4 A;  3KK3 A;  5HL7 L;  3A5M C;  4JRQ A;  5AQR A;  1V4T A;  2E5L K;  3A5L C;  4E3S A;  3A0I X;  1N34 K;  4JHD B;  3CJ1 A;  5AQT A;  2G8H A;  4YOU A;  2BDP A;  1U49 A;  2BE2 A;  5JS2 A;  2UUA K;  1JL1 A;  1FKO A;  1KTQ A;  3VF6 A;  5HRO A;  3EEQ A;  1TKT A;  3QBX A;  5F2R A;  4CEF A;  1VSE A;  3AA4 A;  4CEQ A;  1OH6 A;  3ZT1 A;  3K2P A;  3E66 A;  1YUW A;  5LMN K;  3QNN A;  4L8R B;  1K8A O;  3KKS A;  3HL8 A;  3ZSR A;  2VG6 A;  2YHX A;  1NGA A;  4JI0 K;  4KBO A;  3L4Q A;  4QAG A;  3NBP A;  2FXU A;  2GWK A;  3TAR A;  1VQ4 N;  3CCU N;  1H1V A;  1VSH A;  3WQU A;  2FC0 A;  2ZD1 A;  1BHL A;  3OYH A;  2NLX A;  3RRH A;  3NF9 A;  3C6T A;  2YNF A;  1BO5 O;  3O9R A;  5HRP A;  3TAP A;  4FWR A;  2VCP A;  3RMA A;  3O9S A;  2JWL A;  4JK9 A;  4B8C A;  1TYQ B;  3T1A A;  3EKU A;  4C1N K;  4XIU A;  4DQQ A;  5J2P A;  4UY8 O;  2HBL A;  4YFU A;  1T6C A;  5MLC Q;  4OKE A;  5K14 A;  2YI1 A;  2ZWH A;  1IKW A;  1IKV A;  2ASO A;  3G4S N;  4FWK A;  2VG7 A;  3THY B;  4Z0U A;  4AIL C;  2ITG A;  4FJN A;  1RDC A;  3TU5 A;  4G9Z A;  1HKB A;  4BR0 A;  4BE0 A;  1S1U A;  1X9M A;  4DU3 A;  1RTD A;  5SWM A;  4Q0B A;  3AO2 A;  4GV3 A;  4K25 A;  2P9S B;  3C94 A;  4RW9 A;  3OTO K;  1YF5 L;  2W42 A;  3PO4 A;  3LAN A;  2GEL A;  2B6A A;  3QES A;  2ZF5 O;  3E9P A;  2E20 A;  1HYZ A;  2P9U A;  1S9E A;  1TVR A;  3CIP A;  3LDP A;  4H0O A;  1VQ7 N;  1LCU A;  4FK0 A;  1RT5 A;  3T19 A;  1D8Y A;  3TAF A;  4OPJ A;  4JI3 K;  1ZBU A;  2Y1J A;  3GOI A;  3L2R A;  4PA1 A;  1XHX A;  2YCH A;  4ISF A;  4CF8 A;  4LFC K;  4DQR A;  1YVU A;  4ZHR A;  4IDK A;  2IVN A;  2BGG A;  1HNX K;  4FOE A;  3ZEU A;  3MCP A;  4YOY A;  4IO8 A;  2A1R A;  2P1J A;  4CZI A;  4YOV A;  2X74 A;  3SQ0 A;  5HBM A;  2OZM A;  5DM7 L;  1KD1 O;  2IDO A;  3HM8 A;  2GEM A;  5CY4 A;  1KAX A;  4FW1 A;  3D45 A;  4GY2 B;  5HLF A;  2V52 B;  4M3Y A;  4MLE A;  4JS4 A;  3THW A;  2YHA A;  3MXM A;  3OBY A;  4X62 K;  2Z1I A;  2ASM A;  4ELV A;  1KFD A;  3CER A;  4NYF A;  4WFB L;  3D2E B;  5EX5 A;  2HB5 A;  4LF5 K;  4DV3 K;  4BQZ A;  3SPZ A;  1DKG D;  5D3G A;  4E1J A;  4IFY A;  4M3T A;  3DRR A;  3EL2 A;  3ENH A;  4QS8 A;  1NJZ A;  3JSM A;  1J5E K;  4BAC A;  4FK2 A;  3ZX2 A;  1VSJ A;  4ELT A;  2B4J A;  2W6L A;  2QXL A;  3FZF A;  1T03 A;  4CEE A;  3DM2 A;  4WCE L;  1HR0 K;  1BCM A;  4EAH D;  1X3M A;  2ZGZ A;  4DCH A;  1IO2 A;  4QOZ B;  1P8Z A;  3MDQ A;  3FR0 A;  1U6Z A;  2D5R A;  4KRE A;  4FLY A;  4FWN A;  1N5Y A;  3CC2 N;  5KPT A;  3Q7B A;  4RW7 A;  1C0T A;  2RF2 A;  2P9N B;  1FJG K;  4FO0 A;  4BVP A;  4FZY A;  1NOY A;  5FRN A;  4K8Z A;  3NVM A;  4BRN A;  5LJV A;  3MED A;  5BRD A;  4FJ5 A;  2QWN A;  2HOE A;  3L2W A;  3QEV A;  1WLJ A;  4CF0 A;  4Z4C A;  3O9U A;  4O4G A;  1S3X A;  4O44 A;  3NF6 A;  4B3O A;  3HOT A;  1CZA N;  1SKS A;  4M41 A;  3MXJ A;  3W0L A;  2QA4 N;  3CFR A;  3SQ1 A;  3LDL A;  3CJC A;  3EZW A;  3I8B A;  3BDP A;  1UWB A;  3BGR A;  3HP9 A;  1NU0 A;  1N36 K;  4DR7 K;  4E0D A;  3VQC A;  5FPM A;  4EZ6 A;  3P1G A;  2P9K B;  4CZK A;  1LAW A;  3CCJ N;  3QET A;  2VWK A;  2KKZ A;  3WXJ A;  4M3X A;  3V9S A;  3L4I A;  2P9P A;  3MN6 A;  4DSJ A;  1A5X A;  3CFO A;  4DSL A;  3EE8 A;  3PUF A;  3AVC A;  3V9Z A;  3U3G A;  3CJA A;  5I3U A;  2GX9 A;  5BRE A;  3TPQ A;  5FPE A;  1Y97 A;  3ZLJ A;  4KHY A;  4NYN A;  3BF1 A;  3DMJ A;  3UIQ A;  4CEC A;  4FL9 A;  4BRD A;  5LL6 Z;  3N4Q A;  2ZM6 K;  4RW8 A;  3WQT A;  3ZT0 A;  3OYB A;  4LF9 K;  1HYS A;  2OPQ A;  2Q36 A;  3KD1 E;  2UXD K;  4IG3 A;  4DSE A;  2HHW A;  1S6Q A;  3OYI A;  4IFE A;  3U4L A;  1FKP A;  1WUA A;  1L3V A;  3VQB A;  3LPU A;  4CGD A;  4PHT X;  2UUB K;  2Q1N A;  3VF4 A;  4IJN A;  4DQS A;  3MEE A;  1VQM N;  3OS1 A;  4YHH K;  1EKE A;  4EHT A;  4DTJ A;  4FWQ A;  4JK8 A;  1NK4 A;  4O0J A;  4YDU A;  1RBU A;  1TK0 A;  3F9M A;  1TYQ A;  1JLC A;  2QTD A;  2FBX A;  3ASM A;  1VSD A;  4AHS A;  2F7T A;  1ASU A;  4RG8 A;  3NGZ A;  3KHY A;  3NF7 A;  4NLC A;  4CJ7 A;  3CCE N;  3THY A;  1D5A A;  3KJV A;  3VN5 A;  2PFU A;  5LJW A;  1XI1 A;  3BEX A;  5CZ2 A;  3U8X A;  3KK2 A;  4DQ8 A;  3CCR N;  4FK4 A;  3K57 A;  3T3F A;  4DV5 K;  4HUF A;  1KAZ A;  1NGI A;  5AQJ A;  3S3N A;  3WUH A;  1E3M A;  1QQN A;  4NXM K;  3F5T A;  2YJE A;  2P9S A;  3HO1 A;  2FBY A;  3EN9 A;  4FPA A;  1NG9 A;  3OA9 A;  2CH6 A;  5ADX A;  2O8C B;  1A5V A;  1V4S A;  4PKG A;  1S1W A;  2O4G A;  3SK3 A;  5AQI A;  5C2F A;  3SJJ A;  3M8P A;  1RTH A;  3AAP A;  1EWQ A;  3OYN A;  4FJ7 A;  4CF1 A;  1SL2 A;  1WAF A;  3VGK A;  1WSE A;  3VF2 A;  1JLG A;  3KK7 A;  1NMN A;  3SMP A;  4B9V A;  1JXB A;  1RT4 A;  2YNI A;  3OYF A;  3P39 A;  3OVN A;  4CZH A;  3CFP A;  1RTJ A;  3A2F A;  3VQA A;  4KHU A;  4H0T B;  2A42 A;  4CZL A;  5EXW A;  4FJG A;  1RT3 A;  3F2K A;  2ITM A;  4FLZ A;  4BWJ A;  4DTN A;  4KH5 A;  4Z4G A;  5KQ8 A;  5J2M A;  1NK8 A;  4WF9 L;  3H6E A;  2D0O A;  2YKN A;  2V7Y A;  4I2Q A;  4CGG A;  2RHK A;  3OS0 A;  3JYT A;  4JKH A;  5C24 A;  4GVM A;  4ILJ A;  4CIF A;  4KI6 A;  4NB4 A;  3M5R A;  3O5B A;  4DR5 K;  4FJM A;  3ZT4 A;  5AFU H;  3QML A;  3VQ7 A;  1EQY A;  4KAZ A;  3QDK A;  3D7E O;  3TAM A;  4WQ5 C;  2YV0 X;  4BE2 A;  1TL3 A;  1KXP A;  1ZBL A;  4FM0 A;  2P9U B;  3AA3 A;  3M8S A;  3CM6 A;  4ZTJ A;  2XO7 A;  4YNQ A;  3I55 N;  4KH6 A;  3EKS A;  1VSF A;  5FRO A;  2P9N A;  1B92 A;  4BRE A;  1C0G A;  1LWF A;  1SKW A;  3J8A A;  4LFA K;  4FJ8 A;  1HRH A;  5E41 A;  1VSK A;  3CMA N;  3ZEU B;  4DUY K;  3A5N C;  1T44 A;  3CXC M;  2XHB A;  4PWD A;  1WSF A;  3V1O A;  1RT7 A;  4B1V A;  1JCG A;  2JLE A;  3NVK A;  1EWR A;  2UUC K;  3O4W A;  4DLE A;  1ZBI A;  1N8R O;  4GMJ B;  1W7A A;  1RDU A;  3K5N A;  2D0B A;  3PX0 A;  3BY5 A;  3AY9 A;  5C2D A;  4JKA A;  3M6G A;  3RR8 A;  3E1Y A;  5KPZ A;  3NDK A;  3ZSQ A;  3KWI A;  3VEX A;  1MWK A;  4NCA A;  1XC9 A;  4DG1 A;  2E6L A;  2OCE A;  3TAB A;  4N41 A;  2XY6 A;  3KWG A;  4M3U A;  3SAF A;  5E84 A;  3SI6 A;  3THX B;  3V9X A;  4AF1 A;  4CJK A;  1LW2 A;  3O08 A;  1NJY A;  4WQ4 C;  3K5O A;  5BPN A;  3EY1 A;  1HNI A;  5DM6 L;  4H4M A;  1DTT A;  4LSL A;  5KRT A;  5BPM A;  2CH5 A;  2YKM A;  5J2Q A;  1L3U A;  1NK7 A;  1GLJ O;  3IS9 A;  2VWJ A;  3E9O A;  4FW2 A;  4BRP A;  3SUO A;  4KO0 A;  2EWS A;  2HHT A;  1CZ9 A;  3L2V A;  4LH5 A;  3KLF A;  1DEJ A;  3DLG A;  5JVG L;  4B9M A;  2HF3 A;  1BI4 A;  4CJP A;  3IKM A;  4F3O A;  1IG8 A;  1M90 O;  1XNQ K;  4FM1 A;  4MLH A;  1YXQ A;  3O3H A;  4NCB A;  2QW9 A;  5HP1 A;  4GW6 A;  3LDQ A;  4KTW A;  4JYA K;  3VQ8 A;  4EHU A;  4CIG A;  4OLB A;  5C0Y A;  3G6E N;  4JI6 K;  1EO1 A;  4B9L A;  1MA9 B;  1T8E A;  2E8A A;  4MO4 A;  3TAE A;  3KIO A;  4FM2 A;  2QWO A;  5GIO A;  1VAZ A;  4Z4E A;  4JKG B;  2P9P B;  3IG1 A;  3HVR A;  1ZBH A;  3L2Q A;  1VQ8 N;  1GLF O;  3ZYY X;  3QIC A;  4YOR A;  4F2S A;  1J9A A;  1Q18 A;  1OVY A;  2KHO A;  3CCV N;  4CHY A;  4GKK K;  4CJ5 A;  4KKO A;  3PSF A;  1RDW X;  1NMD A;  3KLG A;  4CE9 A;  4C8N A;  3OY9 A;  3AGR A;  3WNH A;  2O8C A;  3ENB A;  1VQK N;  4DF4 A;  1TKX A;  2E1Y A;  3TAG A;  3AAR A;  2CGJ A;  3VEW A;  1YIJ N;  3SUQ A;  4H8K A;  1YJN N;  4BR5 A;  3NAE A;  2HMI A;  1S1X A;  3LAK A;  1SZ2 A;  5BN8 A;  1QSL A;  4DWI A;  1RGI A;  1I3A A;  4EIA A;  3HBT A;  3H1Q A;  3LPT A;  3FZH A;  4ID1 A;  3L3U A;  1QSS A;  2FF6 A;  3PLA A;  1R0A A;  4IXC A;  2PY5 A;  2E4L A;  1NGC A;  3CJ9 A;  1E4G T;  3HPG A;  3QFU A;  4B1Z A;  3BZC A;  2Q0R A;  4EP4 A;  4B9S A;  4M45 A;  3AO5 A;  1ASV A;  4IJA A;  4CK3 A;  3RTV A;  4FJL A;  4BRM A;  1WSI A;  1DT9 A;  2P9I B;  4E19 A;  1X1P A;  4E1M A;  3EYZ A;  1L3S A;  3K59 A;  3U6F A;  3CPE A;  3ULE A;  4GV9 A;  1C0F A;  4DV0 K;  2FSJ A;  1VRU A;  1NLV A;  2GWJ A;  4C23 A;  4CGF A;  2HHV A;  4F9O A;  3HXM A;  1BG3 A;  4FYD A;  4CGI A;  2X6N A;  3KLE A;  1ASW A;  1QQO A;  4G1Q A;  4EFH A;  1LV5 A;  4CZG A;  1ZXO A;  1MU2 A;  5AQX A;  1XWL A;  1J54 A;  2NRZ A;  4CIE A;  1VQO N;  3H46 O;  4FJX A;  1Q82 O;  1NK6 A;  4E7J A;  5I9E B;  3MWP A;  4K43 A;  3N4P A;  1XHZ A;  1GOB A;  4KHQ A;  2O4I A;  3BF3 A;  1S1V A;  4YOX A;  2UXC K;  1GOC A;  1I39 A;  3C7N A;  2HVI A;  4FOI A;  3LAM A;  3CD6 N;  4E7K A;  2QWL A;  2OA8 A;  3LWM A;  3HPH A;  3DLH A;  4IOX A;  3AV9 A;  5M1K A;  5C25 A;  3VA3 A;  1HQE A;  4CJ3 A;  4FZZ A;  2BH1 A;  3LL3 A;  3WNG A;  1FW6 A;  4F3T A;  3NFA A;  4AHU A;  3UKU B;  1VQP N;  1C6V A;  5AQZ A;  3H3N O;  1GLC G;  4PKI A;  3OS2 A;  2O8F B;  1YJ9 N;  4L3Q A;  3G25 A;  5LY3 A;  3H3O B;  4N47 A;  2ZJQ L;  1J5O A;  3ZT3 A;  3CME N;  2V7Z A;  4RTF D;  4PUO A;  1ATN A;  3GG4 A;  5EY4 A;  4K8X A;  1HKC A;  3F9K A;  2KFN A;  1IBK K;  3J7Z O;  1TK8 A;  2KW4 A;  3EE9 A;  3THX A;  3O3F A;  4DV7 K;  4CF9 A;  1T7P A;  4DTR A;  2BTF A;  1Q86 O;  3NGY A;  1TAQ A;  3AVI A;  4PY5 A;  3D0P A;  2OPR A;  4CJL A;  3LDS A;  1VQL N;  2B5J A;  5BR9 A;  4NXN K;  4JI1 K;  3OYM A;  4ISE A;  4BGA A;  3SCX A;  2W40 A;  4LFB K;  3L6Q A;  1NJW A;  3O4N A;  3JXU A;  1KSP A;  1YT3 A;  1HYV A;  3E9L A;  3LM2 A;  1KLM A;  2HMP A;  2WBN A;  4B8A B;  3PV8 A;  4BRK A;  5AQH A;  2UU9 K;  1S1T A;  3T1Y K;  4JI5 K;  4IWV A;  3LP1 A;  4GV6 A;  3NCI A;  1VSI A;  1ATS A;  2QKK A;  2A5X A;  2KQ2 A;  2D1K A;  4CD3 A;  4CW7 B;  3T1H K;  1TKD A;  4U7B A;  3VA0 A;  3HT3 A;  3MAQ A;  2O8E B;  3CM5 A;  4OVL A;  3AVA A;  3MK6 A;  4MO5 A;  3AVL A;  3VEO A;  3P38 A;  4AM6 A;  4KHP K;  1BU6 O;  3HTV A;  2A40 A;  4CER A;  2V51 B;  4M3W A;  3I0R A;  3AA2 A;  4FWO A;  4OGE A;  4BY9 C;  4JKG A;  5ADX H;  3DWL A;  1YJW N;  1TK5 A;  3HK2 A;  2F9T A;  4OPK A;  5HRN A;  4K42 A;  5FLX O;  4M3Z A;  3SJH A;  5CZ1 A;  5BPL A;  4W5N A;  1TUU A;  3SUN A;  3RRG A;  3AA5 X;  3CCQ N;  4LF7 K;  5AJ3 K;  2ETJ A;  4KTZ A;  1U4B A;  3ATU A;  5HRR A;  4B1W B;  4NLB A;  1ZBS A;  1RNH A;  4HWI A;  4JLH A;  1ZYQ A;  2OYQ A;  3IMX A;  4CJQ A;  4Z4H A;  4H0P A;  4JEP A;  5KPR A;  3HI0 A;  1QZ5 A;  4I6M B;  4QCL A;  1HMV A;  1NJX A;  4M7X A;  1C1B A;  2VG5 A;  1HUX A;  1VHX A;  2A41 A;  3WXI A;  3R3L A;  5AQW A;  3PX4 A;  4JRP A;  3VGL A;  1OVQ A;  1JCF A;  2NNW A;  1BI4 B;  2WFB A;  1NGD A;  4FJI A;  1REV A;  5DK5 A;  3MMV A;  4KHN A;  1LW0 A;  3U9D A;  4DS4 A;  5FPN A;  1NK9 A;  4YY3 K;  3VEZ A;  3QO9 A;  1ESV A;  1KC8 O;  3NH2 A;  3CPW M;  3HSC A;  5IT9 O;  4DQI A;  4CK1 A;  4IOC L;  2I7N A;  4JKE A;  1SAZ A;  1SV5 A;  1T3V A;  4JKB A;  1RTI A;  5HOO A;  4JI2 K;  1WSG A;  4CD1 A;  4JI7 K;  1NNE A;  3M3Z A;  4W5T A;  4J2A A;  4NCG A;  3FFI A;  3MWT A;  1IKY A;  2P9I A;  1W97 L;  2NZT A;  4EP5 A;  4CZM A;  2IVP A;  5TKW A;  4BGB A;  1SL0 A;  3I33 A;  3TWH A;  3ZX0 A;  1U47 A;  1KRP A;  4X66 K;  3U9Z A;  3M8Q A;  2JGU A;  3DLE A;  3SLC A;  1BDG A;  3O6W A;  2VGM A;  1Y64 A;  3ZSV A;  4F4K A;  1FK9 A;  2E88 A;  4J8F A;  1QSY A;  1TUY A;  2G8I A;  1QQC A;  1XNR K;  1XQS C;  1TL1 A;  2KFZ A;  5AQF A;  1D4X A;  3FGU A;  4FSV A;  5JLH A;  3SPY A;  2PAV A;  2QK9 A;  4E89 A;  1C1A A;  2F4V K;  2VGN A;  3M1F A;  1KAY A;  4E7I A;  1XC3 A;  1YVN A;  1UAX A;  4H0X B;  1NKB A;  3C6U A;  3HRG A;  4M7Y A;  4C8L A;  3QIN A;  3TSP A;  3GBT A;  4JN4 A;  3CCS N;  3UKR B;  3BP8 A;  4AHV A;  4LF8 K;  1RT1 A;  4WE1 A;  4JS5 A;  4B9Q A;  4C8O A;  2NRH A;  1IJJ A;  1JLE A;  4DS5 A;  3CET A;  3R8E A;  2E2P A;  1K6Y A;  4CGJ A;  3J7Y P;  2QXF A;  1BQN A;  2OPP A;  1K73 O;  4H0Y B;  4YDU C;  4HHT A;  1OH8 A;  1DGK N;  2ATQ A;  2GBZ A;  2P9L A;  3OYL A;  4OO1 J;  3UKU A;  4H5V A;  3WNF A;  4IKF A;  1B9F A;  3G10 A;  4N76 A;  2XY7 A;  3MX2 A;  3LZI A;  2O8F A;  3AVF A;  3WEE B;  3K9J A;  1CXU A;  1HNZ K;  1EX4 A;  1KFS A;  3VTH A;  1UOC A;  2E1Z A;  3AO3 A;  3HOS A;  1T05 A;  3R6M A;  5JLF A;  3ULE B;  4JKC A;  2HHX A;  3CYM A;  4E7L A;  5GAH P;  1BGX T;  3QEP A;  1Z26 A;  5KTQ A;  3M8R A;  3ZSY A;  3FZL A;  3DXK A;  4DTP A;  4M42 A;  4DV4 K;  3NH1 A;  3AAQ A;  4ID5 A;  1E4F T;  2HHQ A;  4CHQ A;  5AQO A;  3VQ4 A;  1NK0 A;  1W2B M;  4FJK A;  2HND A;  1IBL K;  1SL1 A;  2WON A;  2WOM A;  4A61 A;  1BIU A;  1G15 A;  4MDA A;  4B9U A;  4RW4 A;  3SZ2 A;  4CJR A;  4O55 A;  3HVT A;  3NE6 A;  4YOT A;  4DR3 K;  3EO3 A;  3AVH A;  3UB5 A;  4CEZ A;  3MEC A;  2BUP A;  2UXB K;  4ZTF A;  4EZ9 A;  3C65 A;  4KTQ A;  1HX1 A;  3KVG A;  3RR7 A;  2KTQ A;  3C7N B;  1ILY A;  3HJF A;  4CJT A;  2AA4 A;  4RWT A;  4ISG A;  2R7Y A;  1U48 A;  4HTU A;  4CJF A;  2F8S A;  5JMV A;  4KRF A;  2GUI A;  3TAQ A;  1CXQ A;  2HST A;  4BDP A;  2YNG A;  1C0M A;  4I2P A;  1X9J A;  3SBT A;  1IKX A;  1TAU A;  2DFE A;  3S41 A;  4K0K K;  3AO1 A;  3T7Z A;  5AZJ B;  1U2V B;  2WUS A;  2O8E A;  5E26 A;  1SUQ A;  4LSN A;  3V9W A;  4B3T K;  2DFH A;  4IOA L;  3H08 A;  2Q2R A;  3C0B A;  4JKD A;  4B1Y B;  2D0A A;  1D9D A;  2O8D B;  4CBU A;  5IWA K;  4BR9 A;  4HCB A;  1J6Z A;  4CJW A;  3O80 A;  3VET A;  2AP1 A;  3IFR A;  3VPZ A;  3WNE A;  4DV6 K;  4BRI A;  3PX6 A;  3RMC A;  3S3O A;  5DMR A;  2FSN A;  1BA1 A;  3LP2 A;  2XY5 A;  4CGH A;  3AO4 A;  3DOK A;  4A5A A;  3OYK A;  3ID6 A;  1WSJ A;  3WT0 A;  4I6M A;  3ZX3 A;  5AQV A;  4I7F A;  4BE1 A;  4Z4F A;  3R9P A;  1IBM K;  1OH5 A;  4BR7 A;  2W6K A;  4TSX A;  2QI2 A;  4DTX A;  1C0U A;  3O9T A;  3QLH A;  4CJE A;  5M1N A;  1S9G A;  3QB0 A;  3J7A P;  3DLK A;  1RBS A;  5HRS A;  2NRV A;  3DYA A;  2X78 A;  1RDA A;  4DV2 K;  3VTI A;  5JVH L;  4R5P A;  3F73 A;  1QVG M;  3DI6 A;  1XMQ K;  3A5O C;  3K58 A;  1RT2 A;  4A62 A;  3UE5 A;  4BDY A;  4KB0 A;  2DTU A;  4RW6 A;  3LAL A;  1BUP A;  4CJS A;  3JAM O;  2FSK A;  5AQN A;  2HBJ A;  4BRA A;  1L5U A;  5AQK A;  5ELZ A;  2OTJ N;  5CE3 A;  1WBB A;  4CFD A;  4E1N A;  1QZ6 A;  4FLV A;  2KZM A;  2AJQ A;  3J81 O;  1JCE A;  1BOT O;  2ZGY A;  1Q81 O;  1NM1 A;  3VQ5 A;  4IG0 A;  1NGB A;  1KLN A;  3S9H A;  4B3R K;  1RBV A;  3MX5 A;  4BRL A;  3AVG A;  2HBM A;  4K41 A;  5I42 A;  3NGI A;  1P90 A;  3ALY A;  4DUZ K;  3D2F A;  1D9F A;  4DR6 K;  3FLC O;  3MXI A;  1QQM A;  4OKK A;  2G8W A;  4Z94 A;  2QWQ A;  2I5J A;  4JD2 B;  4FPB A;  4H4O A;  4FJJ A;  4O5F A;  3CJ7 A;  3V4I A;  2G8U A;  5C10 A;  1Z6R A;  3DXM B;  2IAJ A;  3UKR A;  4IBN A;  1RBR A;  1LOT B;  1WSH A;  1QS4 A;  2PYJ A;  3ZSO A;  3OYD A;  4C8M A;  4FZX C;  3PIP L;  1JL2 A;  1WAJ A;  3VQ6 A;  5JS1 A;  2HBK A;  3NHG A;  2IVO A;  4KV8 A;  3OYG A;  4BDZ A;  1NKE A;  5F1X A;  1GLE G;  3I56 N;  3G71 N;  3V81 A;  3HST B;  3WEE A;  4HUG A;  3ATV A;  2P5O A;  3O1W A;  3NH0 A;  3OYA A;  1I94 K;  2RE2 A;  2WTU A;  3VER A;  1NGH A;  3OYJ A;  1MDU B;  3R1X A;  4OPA A;  4AHT A;  2F8T A;  3KK1 A;  3VEN A;  3OJU A;  2XRI A;  5LMU K;  3CCM N;  4LD0 A;  1RFQ A;  3BZK A;  4CJU A;  4DLG A;  4CEB A;  1QTM A;  5CYQ A;  4BWM A;  1HNW K;  1HLU A;  3L0Q A;  3LDO A;  3ZT2 A;  4ICL A;  4CEA A;  1NOZ A;  1O13 A;  4BRG A;  1UA1 A;  4DQP A;  3CI5 A;  4WYB A;  4PQU A;  5M1F A;  4CES A;  4I9L A;  3AGK A;  3I0S A;  1JXE A;  3QER A;  1VSL A;  3VQ9 A;  5F0X A;  3CC7 N;  2D4W A;  1T6D A;  4A2A A;  3L8B A;  4CBX A;  3TI0 A;  2Q3S A;  4E7H A;  2G8V A;  3VQD A;  2FBV A;  3FZM A;  2HNY A;  2HVH A;  1VQN N;  1W0H A;  4U67 L;  5AQQ A;  1GOA A;  4KH4 A;  1HPM A;  4M3R A;  4FWP A;  5AQP A;  1O1W A;  3ITH A;  5AZI B;  3SBG A;  4DKW A;  2X6S A;  3K5M A;  1WB9 A;  3ULD A;  5KGX A;  1FXX A;  4XH1 A;  4BRO A;  2LSN A;  3CCL N;  3PIO L;  3J80 O;  4CZJ A;  1HKG A;  4OX9 K;  1GLB G;  3MCA B;  1OH7 A;  3V9U A;  1BL3 A;  1JLA A;  4BC4 A;  2P9L B;  4OJR A;  3LP3 A;  4A5B A;  4DU1 A;  2KZZ A;  2E6M A;  1JLQ A;  5AZJ A;  1U2V A;  4R79 A;  1VQ6 N;  1UA0 A;  1NJI O;  1KVC A;  3ZET A;  3CF5 L;  4MQ3 A;  2G8F A;  3SAH A;  3P83 D;  3LP0 A;  4O5B A;  3B6P A;  4CFC A;  2J4R A;  4UQG A;  3KTQ A;  1S22 A;  4HVJ A;  2Y1I A;  3ID8 A;  4BG9 A;  4PL7 A;  3PY8 A;  2O8D A;  5AQS A;  1DTQ A;  3DRP A;  3V1Q A;  1BIZ A;  5B8H A;  4OKJ A;  3DXK B;  4W5R A;  4CF2 A;  3EZ5 A;  4H03 B;  5KQD A;  4PL8 A;  4O8K A;  2FF3 B;  4DF8 A;  3CQY A;  2RN2 A;  4DV1 K;  3T69 A;  3K9K A;  4DSF A;  1Q9Y A;  4JK7 A;  3VOV A;  1WNS A;  2PBD A;  4DMN A;  4H5R A;  1BCO A;  3JS6 A;  4CI6 A;  4CZE A;  4J2D A;  2NRT A;  3HP6 A;  3SQ2 A;  5FRM A;  3HZ6 A;  3HM9 A;  1BQM A;  3ZSW A; 
#chains in the Genus database with same CATH homology
 1SKR A;  4F4K A;  1FK9 A;  2D0B A;  3PX0 A;  1QSY A;  2G8I A;  2IGI A;  4QAG A;  3NBP A;  1QQC A;  3TAR A;  3RR8 A;  5SZT A;  1TL1 A;  1VSH A;  4I9Q A;  2KFZ A;  2FC0 A;  2ZD1 A;  3SPY A;  4DTU A;  3TAN A;  1BHL A;  4E89 A;  3NDK A;  4Y1C A;  1C1A A;  3ZSQ A;  3OYH A;  4ZTJ A;  2QK9 A;  3RRH A;  1EET A;  2A1S A;  3NF9 A;  4DTM A;  4E7I A;  4NCA A;  1UAX A;  3C6T A;  1XC9 A;  2YNF A;  4DG1 A;  3C6U A;  5HRP A;  2E6L A;  1NKB A;  3QIN A;  3TAB A;  3TAP A;  4C8L A;  2XY6 A;  4J2B A;  4N41 A;  3RMA A;  4M3U A;  5J2P A;  1RBT A;  4B8C A;  3T1A A;  4XIU A;  4OGC A;  4DQQ A;  3SI6 A;  1N6Q A;  4AHV A;  1RT1 A;  3V9X A;  4YFU A;  4OKE A;  4WE1 A;  5K14 A;  4JS5 A;  1JKH A;  2P51 A;  4CJK A;  1IKW A;  1BIS A;  4C8O A;  1IKV A;  1LW2 A;  1JLE A;  4DS5 A;  2VG7 A;  1NJY A;  3K5O A;  3EY1 A;  1HNI A;  1K6Y A;  4CGJ A;  4H4M A;  1DTT A;  3SYZ A;  4LSL A;  4CHZ A;  4Z0U A;  4IFV A;  5KRT A;  1TGO A;  2YKM A;  3AVK A;  2QXF A;  5J2Q A;  1BQN A;  4AIL C;  2OPP A;  5KGW A;  2ITG A;  1NK7 A;  1L3U A;  1HPZ A;  2DFF A;  2OZS A;  4HHT A;  4FJN A;  3IS9 A;  1RDC A;  2ATQ A;  1TKZ A;  2GBZ A;  3OYL A;  2VWJ A;  4FW2 A;  3SUO A;  4KO0 A;  4BE0 A;  3WNF A;  4IKF A;  1S1U A;  2HHT A;  1CZ9 A;  1B9F A;  4LH5 A;  3L2V A;  3G10 A;  4DU3 A;  1X9M A;  5SWM A;  3KLF A;  2XY7 A;  1RTD A;  3AO2 A;  2EHG A;  3AVF A;  3DLG A;  3LZI A;  4B9N A;  4B9M A;  3KLI A;  1BI4 A;  3C94 A;  1CXU A;  4RW9 A;  4CJP A;  1EXQ A;  1EX4 A;  4B08 A;  4F3O A;  2W42 A;  1KFS A;  4FM1 A;  3PO4 A;  1UOC A;  3AO3 A;  3LAN A;  1T05 A;  2DY4 A;  2B6A A;  3O3H A;  3QES A;  2HHX A;  3CYM A;  4E7L A;  4DSK A;  4NCB A;  5HP1 A;  4GW6 A;  1BGX T;  3QEP A;  1HYZ A;  1Z26 A;  1S9E A;  1TVR A;  4KTW A;  5KTQ A;  3M8R A;  3ZSY A;  3QIO A;  3OYE A;  3LWL A;  3VQ8 A;  4F2R A;  4DTP A;  4M42 A;  4CIG A;  3NH1 A;  1RT5 A;  3T19 A;  1D8Y A;  4FK0 A;  4OLB A;  3TAF A;  4OPJ A;  1X9S A;  1ZBU A;  4ID5 A;  2Y1J A;  3L2R A;  4PA1 A;  1XHX A;  4CHQ A;  1U45 A;  2HHQ A;  4B9L A;  4LY7 A;  4CF8 A;  4CHN A;  3VQ4 A;  1NK0 A;  4DQR A;  3O3G A;  1YVU A;  4ZHR A;  4IDK A;  1T8E A;  1QHT A;  2BGG A;  4FJK A;  3TAE A;  2HND A;  4CFB A;  3KIO A;  4AHC A;  1SL1 A;  4FM2 A;  1RDD A;  2WON A;  2WOM A;  4AH9 A;  3OJS A;  2A1R A;  1BIU A;  1G15 A;  2P1J A;  4B9U A;  2X74 A;  3SQ0 A;  5HBM A;  4Z4E A;  2OZM A;  3IG1 A;  4RW4 A;  3SZ2 A;  4CJR A;  4O55 A;  3HVR A;  3HVT A;  2IDO A;  5CY4 A;  3L2Q A;  3NE6 A;  1ZBH A;  1YTU A;  5KI6 A;  3SV3 A;  3AVH A;  4CEZ A;  3KLH A;  4FW1 A;  3D45 A;  5HLF A;  4M3Y A;  3MEC A;  3V6D A;  5FDL A;  1LAV A;  4JS4 A;  4F2S A;  1KVB A;  1J9A A;  3VQE A;  3QEW A;  4ZTF A;  4EZ9 A;  4KTQ A;  2YHA A;  3MXM A;  4OLA A;  3RMD A;  2IS3 A;  3RR7 A;  2KTQ A;  4CHY A;  3QEX A;  2Z1I A;  4FLX A;  4CJ5 A;  4KKO A;  1KFD A;  4ELV A;  3HJF A;  4NYF A;  3KLG A;  4CJT A;  4CE9 A;  2ZQB A;  4C8N A;  4HCC A;  3OY9 A;  2HB5 A;  3WNH A;  2R7Y A;  1U48 A;  4HTU A;  4CJF A;  3SPZ A;  4FLT A;  5D3G A;  3RMB A;  3RWU A;  2F8S A;  4KRF A;  4IFY A;  2GUI A;  4DFM A;  3TAQ A;  4N5S A;  1CXQ A;  1VRT A;  4M3T A;  3ZSZ A;  4BDP A;  2YNG A;  3DRR A;  1C0M A;  4DF4 A;  4Y1D A;  1TKX A;  4I2P A;  3TAG A;  1NJZ A;  3JSM A;  4BAC A;  1TV6 A;  3SUQ A;  4H8K A;  4FK2 A;  1IKX A;  1VSJ A;  1TAU A;  4ELT A;  2B4J A;  2DFE A;  4DTO A;  1Q9X A;  1C1C A;  3AO1 A;  1T03 A;  4CEE A;  3DM2 A;  3NAE A;  3CQ8 A;  2HMI A;  2HW3 A;  1S1X A;  1BCM A;  2QKB A;  1LWE A;  3LAK A;  4FLU A;  1SUQ A;  4LSN A;  3V9W A;  2DFH A;  1QSL A;  4DWI A;  4CHO A;  1I3A A;  4CED A;  3H08 A;  1IO2 A;  4QOZ B;  3LPT A;  2D0A A;  4ID1 A;  3L3U A;  4N76 A;  1QSS A;  2D5R A;  4Q5V A;  1R0A A;  1D9D A;  4KRE A;  1IH7 A;  2PY5 A;  4FLY A;  4CEO A;  1HQU A;  2E4L A;  4HCB A;  3HPG A;  1X9W A;  1N5Y A;  4CJW A;  4EP4 A;  4B9S A;  4RW7 A;  4M45 A;  1C0T A;  3AO5 A;  1ASV A;  2RF2 A;  3WNE A;  2HNZ A;  2OPS A;  4CK3 A;  4FZY A;  1NOY A;  1RDB A;  3RTV A;  4K8Z A;  3O4Q A;  4FJL A;  5FRN A;  3PX6 A;  1WSI A;  3RMC A;  3IRX A;  3MED A;  3S3O A;  4E19 A;  4FJ5 A;  1X1P A;  5DMR A;  4E1M A;  3EYZ A;  1L3S A;  3L2W A;  3K59 A;  3QEV A;  3CG7 A;  3U6F A;  1WLJ A;  4CJ4 A;  3LP2 A;  4CF0 A;  4CHP A;  1JLF A;  2XY5 A;  4Z4C A;  4CGH A;  4O4G A;  3AO4 A;  3ZCM A;  3DOK A;  3OYK A;  4O44 A;  3NF6 A;  1WSJ A;  4B3O A;  3KKR A;  4AHR A;  3LZJ A;  1SKS A;  1VRU A;  4CGF A;  4M41 A;  5EU7 A;  2HHV A;  3MXJ A;  4I7F A;  4BE1 A;  3CFR A;  4Z4F A;  3SNN A;  3SQ1 A;  3HXM A;  4FYD A;  4CGI A;  2IOC A;  3BDP A;  2X6N A;  3DOL A;  1YTA A;  4TSX A;  3KLE A;  1ASW A;  1UWB A;  3BGR A;  3HP9 A;  4DTX A;  4E0D A;  1C0U A;  3QLH A;  4G1Q A;  3P1G A;  3VQC A;  1S9G A;  4CJE A;  4EZ6 A;  1LAW A;  3QET A;  1LV5 A;  2VWK A;  1MU2 A;  4M3X A;  1XWL A;  3DLK A;  1J54 A;  3V9S A;  4CFA A;  4CIE A;  4DFJ A;  1RBS A;  5HRS A;  1DLO A;  2YHB A;  3DYA A;  4FJX A;  3THV A;  4DSJ A;  1JLB A;  1NK6 A;  1A5X A;  2X78 A;  1VK0 A;  1RDA A;  3CFO A;  4E7J A;  4DSL A;  1XHZ A;  5J1E A;  1GOB A;  3PUF A;  4KHQ A;  2O4I A;  3AVC A;  3DLR A;  4R5P A;  3V9Z A;  3F73 A;  3U3G A;  1S1V A;  3DI6 A;  5I3U A;  3K58 A;  3AVM A;  1GOC A;  1RT2 A;  1I39 A;  4CJV A;  1Y97 A;  3SQ4 A;  4KHY A;  1S5J A;  2HVI A;  3LAM A;  4NYN A;  3VQP A;  3DMJ A;  4BDY A;  1IG9 A;  4E7K A;  3UIQ A;  4KB0 A;  4CEC A;  2OA8 A;  3LWM A;  2DTU A;  4CK2 A;  4RW6 A;  2XY8 A;  3LAL A;  4CJS A;  4RW8 A;  3HPH A;  3DLH A;  3AV9 A;  3ZT0 A;  3OYB A;  5C25 A;  3VA3 A;  1L5U A;  3C95 A;  1HYS A;  4FJ9 A;  1HQE A;  4KPY A;  2OPQ A;  4CJ3 A;  4FZZ A;  3KD1 E;  3WNG A;  4IG3 A;  2P5G A;  4CFD A;  4F3T A;  4DSE A;  2HHW A;  3NFA A;  1S6Q A;  4E1N A;  3OYI A;  1Q8I A;  5CYM A;  4AHU A;  4FLV A;  2KZM A;  2AJQ A;  1FKP A;  1L3T A;  1C6V A;  1L3V A;  1Z25 A;  4O0I A;  3VQ5 A;  3SUP A;  4IG0 A;  3TR8 A;  3LPU A;  3VQB A;  3S9H A;  1KLN A;  2G8K A;  1RBV A;  4CGD A;  1EP4 A;  3OS2 A;  3AVG A;  1U04 A;  4DQS A;  5I42 A;  4N47 A;  3NGI A;  2NUB A;  3MEE A;  1NKC A;  1J5O A;  3ALY A;  3OS1 A;  3ZT3 A;  5T7B A;  1D9F A;  1EKE A;  4DTS A;  4PUO A;  3E01 A;  3V1R A;  4DTJ A;  3MXI A;  4OKK A;  3QIP A;  5C42 A;  2G8W A;  3K5L A;  2RKI A;  1LWC A;  1NK4 A;  4K8X A;  2I5J A;  4LH4 A;  2PYL A;  3F9K A;  2KFN A;  4H4O A;  4O0J A;  4FJJ A;  1HJR A;  1TK8 A;  2G8U A;  1RBU A;  3V4I A;  4C8K A;  2KW4 A;  1TK0 A;  3B6O A;  1JLC A;  2IAJ A;  2IC3 A;  4IBN A;  4KI4 A;  1CLQ A;  2FBX A;  3ASM A;  3O3F A;  1RCH A;  1VSD A;  4AHS A;  3AVB A;  1RBR A;  1WSH A;  3U3Y A;  4CF9 A;  1QS4 A;  2PYJ A;  1ASU A;  1T7P A;  4RG8 A;  4DTR A;  3ZSO A;  3NGZ A;  3NF7 A;  4C8M A;  3OYD A;  4FZX C;  2EX3 A;  1JL2 A;  1D5A A;  3KJV A;  3NGY A;  1TAQ A;  3AVI A;  3VN5 A;  4PY5 A;  3D0P A;  2OPR A;  3HPO A;  1XI1 A;  1WAJ A;  3G0Z A;  4CJL A;  3VQ6 A;  3LDS A;  4FLW A;  3NF8 A;  3I8D A;  5CZ2 A;  3KK2 A;  2B5J A;  3NHG A;  5JS1 A;  1KVA A;  3SV4 A;  4FK4 A;  3K57 A;  2Z1G A;  3OYM A;  4KV8 A;  3T3F A;  4B9T A;  3OYG A;  4BDZ A;  3SCX A;  1NKE A;  3AVN A;  4HUF A;  4KB1 A;  1NJW A;  2HHU A;  1KCF A;  2D0C A;  3O4N A;  3QNO A;  3V81 A;  3S3N A;  3HST B;  1KSP A;  1YT3 A;  1HYV A;  1KLM A;  4HUE A;  1WN7 A;  3HO1 A;  1NK5 A;  2FBY A;  2BAN A;  5KRS A;  3KD5 E;  4HUG A;  4B8A B;  3PV8 A;  2P5O A;  1S1T A;  3NH0 A;  3OYA A;  3L2U A;  1J53 A;  1A5V A;  3OYJ A;  1S1W A;  2FBT A;  2YNH A;  3LP1 A;  4AHT A;  2HHS A;  2F8T A;  2O4G A;  4W5O A;  3KK1 A;  3OJU A;  3NCI A;  1VSI A;  4FXD A;  2XRI A;  1B9D A;  3P5J A;  2QKK A;  4LD0 A;  3SJJ A;  3M8P A;  1RTH A;  2Z1J A;  4DFP A;  2KQ2 A;  3OYN A;  1TKD A;  4CJU A;  4DLG A;  4FJ7 A;  4CEB A;  1QTM A;  5CYQ A;  1S6P A;  4BWM A;  4CF1 A;  4W5Q A;  3VA0 A;  3HT3 A;  1WAF A;  3MAQ A;  1SL2 A;  3ZT2 A;  3CM5 A;  4OVL A;  1WSE A;  3AVA A;  3ZSX A;  5J2N A;  1JLG A;  2F96 A;  4ICL A;  3AVL A;  4CEA A;  1NOZ A;  1UA1 A;  4CER A;  4DQP A;  4PQU A;  4CES A;  4I9L A;  4FCY A;  3I0S A;  4J2E A;  4B9V A;  1JXE A;  3QER A;  4M3W A;  3I0R A;  3AA2 A;  4OGE A;  1VSL A;  3VQ9 A;  1TK5 A;  3HK2 A;  1ITG A;  1JXB A;  4OPK A;  3QEI A;  5HRN A;  1RT4 A;  3L8B A;  2YNI A;  4MFB A;  3TI0 A;  4M3Z A;  5CZ1 A;  4W5N A;  3OYF A;  2Q3S A;  3OVN A;  4E7H A;  2G8V A;  3SUN A;  3CFP A;  1RTJ A;  3A2F A;  3RRG A;  3VQD A;  3AA5 X;  3VQA A;  4KFB A;  4KHU A;  2ETJ A;  2FBV A;  3DRS A;  4KTZ A;  1U4B A;  4DSI A;  3OYC A;  1RT6 A;  2HNY A;  2HVH A;  5HRR A;  4FJG A;  1RT3 A;  1W0H A;  4KHW A;  4FLZ A;  1GOA A;  4FVM A;  4KHS A;  4BWJ A;  1RNH A;  4N56 A;  4M3R A;  4JLH A;  3ISN C;  1ZYQ A;  2PZS A;  3L3V A;  2RPI A;  3HYF A;  4DTN A;  3MEG A;  4DFK A;  1O1W A;  3ITH A;  4ELU A;  2X6S A;  3K5M A;  2OYQ A;  5J2M A;  1W9H A;  1NK8 A;  4Z4G A;  4CJQ A;  3ULD A;  4Z4H A;  5KGX A;  4F8R A;  1FXX A;  3AVJ A;  2LSN A;  2YKN A;  4I2Q A;  4CGG A;  4QCL A;  1HMV A;  3OS0 A;  1NJX A;  3JYT A;  1C1B A;  2VG5 A;  3V9U A;  1BL3 A;  1JLA A;  3DLB A;  4OJR A;  5C24 A;  3LP3 A;  4GVM A;  4CIF A;  4KI6 A;  4DU1 A;  2KZZ A;  2E6M A;  1JLQ A;  3PX4 A;  2GV9 A;  4JRP A;  4FJM A;  4CCH A;  3ZT4 A;  1ZBF A;  3VQ7 A;  1UA0 A;  1KVC A;  1BI4 B;  4FJI A;  1REV A;  4MQ3 A;  1HNV A;  1QE1 A;  5DK5 A;  2G8F A;  4KAZ A;  2ZE2 A;  4KHN A;  3P83 D;  1LW0 A;  2Z1H A;  3LP0 A;  4O5B A;  3B6P A;  4DS4 A;  4CFC A;  1A5W A;  3TAM A;  1NK9 A;  4UQG A;  3QO9 A;  3KTQ A;  2YV0 X;  3NH2 A;  4BE2 A;  3PO5 A;  1TL3 A;  4HVJ A;  2Y1I A;  1CZB A;  4DQI A;  4CK1 A;  1ZBL A;  1VSM A;  4Q0B A;  4FM0 A;  3PY8 A;  3AA3 A;  1RIL A;  4FJH A;  3M8S A;  3IAY A;  1DTQ A;  3DRP A;  1SV5 A;  1BIZ A;  1F21 A;  3CM6 A;  3V1Q A;  2XO7 A;  3S3M A;  4OKJ A;  4YNQ A;  1RTI A;  3VQQ A;  4DU4 A;  4W5R A;  1WSG A;  3KK3 A;  4CF2 A;  1VSF A;  5FRO A;  3EZ5 A;  4JRQ A;  4W5T A;  1B92 A;  4J2A A;  4NCG A;  1LWF A;  4DF8 A;  1SKW A;  3FFI A;  4E3S A;  2RN2 A;  4FJ8 A;  1IKY A;  1HRH A;  4DSF A;  1Q9Y A;  5E41 A;  1VSK A;  2G8H A;  4EP5 A;  2BDP A;  1U49 A;  2BE2 A;  5JS2 A;  1JL1 A;  1FKO A;  1KTQ A;  5HRO A;  1WNS A;  2XHB A;  1WSF A;  1TKT A;  3V1O A;  1RT7 A;  1SL0 A;  4PWD A;  3TWH A;  4DMN A;  4CEF A;  1BCO A;  1U47 A;  2JLE A;  1VSE A;  1KRP A;  3AA4 A;  4CEQ A;  3ZT1 A;  4J2D A;  4Z4I A;  3HP6 A;  3SQ2 A;  3K2P A;  3M8Q A;  2JGU A;  5FRM A;  3DLE A;  3QNN A;  4L8R B;  3HM9 A;  4DLE A;  3KKS A;  3HL8 A;  3ZSR A;  1ZBI A;  1BQM A;  4GMJ B;  3ZSV A;  3ZSW A;  2VG6 A;  3K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...