4Y1CA

Cyclic hexapeptide cyc[ndpoppkid] in complex with hiv-1 integrase core domain
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
145
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase binding protein
molecule keywords Integrase
publication title HEXAPEPTIDE MIMETICS OF LEDGF IN COMPLEX WITH HIV-1 INTEGRASE
rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4y1cA00
3F73A 5KGWA 1LAVA 2F96A 2JGUA 2XO7A 3TAPA 1MU2A 2Z1JA 3AO3A 3SUQA 5SWMA 2W42A 4RW4A 4HHTA 3RR8A 4CJEA 1C0MA 4ID1A 4ZTFA 1NK5A 4IFYA 3CFRA 2Y1IA 3S3OA 5FRMA 1QQCA 4OKEA 4DU4A 1BI4A 3I0SA 5J2NA 3PY8A 4RG8A 4CHOA 3BDPA 1NK8A 4IG3A 3O4QA 4DG1A 3QERA 1CZ9A 3K5MA 3K59A 3NH1A 4J2AA 4N41A 3QETA 4O5BA 3MXIA 4KB1A 3QESA 3L2VA 5KI6A 1KLMA 5E41A 3SUOA 2NUBA 1SKSA 1XI1A 3DLKA 3CM5A 3MECA 4FW1A 4CEEA 1ZBIA 1X1PA 2G8KA 1WSGA 1KCFA 3HVTA 1RT3A 4BE1A 1KSPA 1VRUA 4CJ4A 1KVAA 3T3FA 4K8ZA 3FFIA 3ITHA 1RCHA 5HROA 2G8VA 1IH7A 4OPJA 3S3MA 4C8LA 3LZJA 1EXQA 3S9HA 4OVLA 1TAUA 3ZSQA 1TL1A 3MXMA 1Q9YA 2ZQBA 2VWKA 2DY4A 5KRSA 3PO4A 3QIOA 3K5LA 3NH0A 2BE2A 1ASUA 3AO5A 3VQ4A 3OYDA 2X78A 4LH4A 4H4OA 4AHVA 3AVFA 1JL1A 4J2EA 3LP0A 4PY5A 1S1TA 1C0UA 1QE1A 3L2RA 1KTQA 2X74A 3LDSA 4CESA 3AVBA 1Z25A 4KTWA 3ZCMA 4CJVA 4DLGA 1ZBFA 1C1AA 1XHXA 3QNOA 1ASWA 3RMCA 1SKRA 2P5OA 2Y1JA 3O3HA 4JS4A 1T8EA 1IKWA 3NE6A 3CFOA 4I2PA 5CZ1A 4FJHA 3OYIA 3O3FA 1HYSA 4CEQA 4UQGA 4C8MA 4AHRA 3D45A 4Z0UA 3HP6A 4AHUA 1IKVA 3ZSYA 4W5RA 5J2QA 3SJJA 4O0JA 4BWJA 2G8FA 1RT1A 4B9NA 2YHAA 3KJVA 1LW2A 1TKTA 1W0HA 4CGDA 5HRNA 5KRTA 4BDZA 4CJWA 3ULDA 5I42A 4B08A 4ELTA 3ZT4A 4C8KA 2O4IA 1HNVA 3OY9A 2HHUA 1CXQA 4AH9A 4FJNA 4M3TA 5FRNA 3PUFA 3P1GA 1UA1A 1RBRA 4NCAA 3KLEA 1FK9A 4CJLA 4M3YA 1VK0A 4B8CA 1TK5A 4CJTA 2IGIA 3LWLA 2E6MA 3KD5E 3DLRA 2HNDA 4DTSA 3EYZA 4F2RA 4EP5A 3OYHA 3SZ2A 1Y97A 2G8HA 1HQEA 1Z26A 4E1NA 3LPTA 2GUIA 3TR8A 4CFCA 4DSLA 4FCYA 4KHSA 1X9MA 1F21A 1JXBA 2YKNA 4B9TA 4CF1A 4ZHRA 4RW9A 1LV5A 5JS1A 4CGHA 1RTIA 4FK2A 1GOCA 4NCGA 4DTOA 4C8OA 5KGXA 1ZBUA 4OLBA 2F8TA 3V9UA 1J53A 3OJSA 1XWLA 2HHWA 3NAEA 4BE0A 4FLVA 3DLGA 4L8RB 4KPYA 1UA0A 1S1XA 1RNHA 3MEEA 2JLEA 3V9ZA 1L3TA 4OPKA 1D9DA 1SUQA 4H8KA 3K5OA 1DLOA 4FLWA 2YNIA 3DM2A 1IKXA 3THVA 5JS2A 2WOMA 1HJRA 3DLBA 3CG7A 4CJ5A 5K14A 1KRPA 5CYMA 1T7PA 4M3ZA 4FJJA 2DFHA 4DWIA 4KHYA 3DOLA 1VSMA 2OZSA 2VWJA 2QXFA 1UWBA 1RBUA 2I5JA 1VSJA 2RKIA 3KK3A 2FBXA 3OYFA 3S3NA 1YVUA 3HXMA 4CK1A 3T19A 3HPOA 3HM9A 4OKKA 1S1UA 3QEPA 3CM6A 5J1EA 1EETA 1NK4A 3AVAA 4PUOA 3AO1A 2F8SA 4FJLA 4Y1DA 4FLUA 4DLEA 4KTQA 2RPIA 3T1AA 4DQRA 4YNQA 3KK1A 1JLQA 3OYNA 3AA3A 5HLFA 4FW2A 1HMVA 2XRIA 1WAFA 4FLZA 4DTXA 4HTUA 3BGRA 1K6YA 4DTPA 4RW8A 1JLFA 4NYNA 4BWMA 3OS1A 1S1WA 3AVCA 3LAMA 4DTNA 1NKCA 3M8RA 4KKOA 1J54A 1WSJA 1WN7A 3IG1A 3PX4A 3RR7A 2OPQA 3HPGA 3NF9A 3NF6A 4B9UA 3RMBA 4CFAA 3HL8A 3PX6A 1JLBA 2YNGA 4IFVA 1KVCA 4F8RA 4CE9A 1RTJA 1RDAA 2KFNA 2XY7A 4CIEA 3QEIA 1R0AA 1J9AA 1VSLA 1DTTA 3ISNC 3TAMA 2ZE2A 1QHTA 4FLYA 1NJZA 2D5RA 4DU1A 3AVKA 5CYQA 3V1QA 5HRPA 4YFUA 1C0TA 1C6VA 2X6NA 4IG0A 4ZTJA 2Z1HA 4TSXA 1B9DA 3OYMA 3ZSWA 4DF4A 3V4IA 5HP1A 2OYQA 1GOBA 4DSEA 1SL0A 4J2BA 1YTAA 3B6PA 4KFBA 2EHGA 1L3SA 3L8BA 2PY5A 3DRRA 2HHSA 3ZT2A 1RTHA 3RMDA 3ASMA 1ZBLA 4HCCA 3KLGA 4DQIA 1EX4A 1VRTA 3QEVA 3OS0A 3LPUA 4CF8A 1X9SA 3LP3A 1WNSA 4F3OA 4FZXC 3QEXA 1U4BA 2YV0X 3NGZA 4KHQA 4W5OA 3QNNA 3RRHA 2LSNA 4CEDA 2KZZA 3A2FA 4E3SA 3E01A 4B3OA 3DYAA 1FKPA 3LWMA 5D3GA 3NF7A 4IDKA 2P5GA 2HMIA 4FJGA 4M42A 4AHSA 3O4NA 1BCMA 4M3UA 1TGOA 2WONA 3EZ5A 1NJYA 4Z4CA 3HT3A 5I3UA 1RBTA 4CEFA 2ETJA 4CJ3A 3OYLA 3NF8A 3I8DA 3V9WA 4B9SA 1JLCA 4O4GA 3VQ8A 3ZSRA 3KK2A 4DF8A 4M41A 2A1RA 4KB0A 1REVA 5KTQA 3KLFA 3NCIA 1RDBA 1QSYA 4DSFA 4DTRA 3MXJA 5HRSA 4B9LA 2BDPA 5J2PA 1JL2A 1I39A 4GVMA 4CGIA 4B9MA 2G8IA 4KRFA 1RT6A 3NFAA 4E7JA 3VQ5A 4HVJA 5SZTA 4OKJA 3O3GA 1JXEA 4CJSA 3LZIA 3DLHA 1S9EA 4CERA 1Q9XA 1D9FA 2KFZA 1RTDA 5DMRA 3MEGA 3P83D 4FZYA 4Q0BA 2ZD1A 4ELVA 1S6QA 1LWFA 4FJ8A 4FJXA 5FDLA 2D0BA 4HUFA 4HUGA 5C24A 2YKMA 4N56A 3K57A 3M8SA 4DQSA 1SKWA 3KD1E 1N5YA 4FZZA 1T03A 1RT2A 4Z4FA 3L3VA 3SQ1A 3KLHA 1U49A 4Z4EA 3SPYA 2HVIA 1NKBA 3U3YA 2PYJA 4DS4A 4PWDA 1IKYA 3SV3A 5EU7A 4C8NA 3NGYA 3DMJA 3DRPA 4FJ5A 4E1MA 2P1JA 4CK3A 3OYKA 3V81A 4CF2A 2HB5A 3NHGA 2Z1GA 1TKZA 3RRGA 1CXUA 3AO2A 3RMAA 3VQAA 3ZSOA 1S6PA 4AHCA 4BACA 4CHQA 4O0IA 3OYAA 3ZT1A 4WE1A 2VG6A 1HYZA 1KFDA 2YNHA 4RW6A 1KFSA 4QCLA 5HBMA 3SQ0A 3SNNA 3TAEA 1HNIA 1XC9A 1WLJA 2IAJA 2GV9A 2OPSA 3EY1A 3V1OA 3KKRA 3V1RA 2XY5A 2OPPA 3SQ4A 1D8YA 1U45A 1U04A 4KI6A 2YHBA 3SYZA 3HPHA 5T7BA 3M8QA 3AV9A 1WSHA 4CK2A 4BE2A 4CJKA 3M8PA 4CJRA 4DSJA 4Z4GA 5DK5A 4FXDA 3SI6A 2FBVA 1JLEA 3QIPA 4OGEA 3WNHA 3TI0A 4FLXA 1CLQA 3JYTA 2XY8A 2KW4A 2HNZA 4Q5VA 4E89A 1RT5A 1BQMA 4I2QA 3DI6A 4MFBA 4NCBA 3ALYA 2HW3A 2HHQA 4AHTA 3WNEA 4CGFA 3NDKA 4N76A 2IS3A 4KI4A 4DFPA 1G15A 1HPZA 1VSKA 4IBNA 4CJFA 3L2WA 3VQEA 2B4JA 3K5NA 1JLGA 4FK4A 3AVJA 3LALA 4JLHA 3OYGA 3AVLA 4EZ6A 3OYCA 4QAGA 2OPRA 3U3GA 3VQBA 3ZSVA 4CHZA 4R5PA 4DSIA 3AVIA 3NBPA 3LP2A 4I9QA 1X9WA 3AO4A 3TANA 4OLAA 1WSFA 3C94A 2DFEA 4O55A 1TV6A 3TABA 4DSKA 3TARA 4E7LA 1S1VA 1QSSA 4ID5A 3NGIA 4B8AB 1A5XA 1WSEA 4DTUA 1BL3A 4FJIA 1TK8A 1IO2A 4CJQA 2HHVA 3C6TA 3WNFA 4FLTA 4AILC 1HQUA 1XHZA 4FJKA 4LD0A 1RT4A 3AVHA 1NJWA 3CQ8A 1SL2A 4KTZA 2HHTA 1RBVA 3AA2A 3HK2A 4DS5A 3KTQA 4I7FA 3HYFA 3G0ZA 1UAXA 4MQ3A 4JRQA 4OJRA 4KV8A 4M3RA 3F9KA 3K2PA 1KLNA 1TKXA 4CF0A 1D5AA 4PA1A 4F2SA 3VQPA 4HUEA 4CJPA 2OZMA 1U48A 1Q8IA 4CEBA 4Z4HA 3RWUA 4QOZB 2P51A 3AVMA 3HVRA 4J2DA 2HVHA 3OS2A 2G8UA 1ZBHA 2RF2A 1WSIA 1ITGA 2E4LA 3VA0A 4FM1A 4IKFA 4KHNA 4CJUA 2GBZA 1QS4A 1BQNA 3VQ6A 5C42A 1BIUA 1NOZA 3CFPA 2KQ2A 2AJQA 1HYVA 3SPZA 4K8XA 3UIQA 4BDYA 4CHPA 3V6DA 1TVRA 1LWCA 3ZSXA 3ZSZA 4E7HA 4FM0A 4O44A 2EX3A 2VG7A 4CEZA 1LW0A 2DFFA 3ZT3A 3VA3A 3SUNA 2B5JA 4ELUA 3U6FA 3AA5X 1VSIA 3K58A 3LP1A 3TAFA 3AA4A 3OVNA 1A5WA 1S9GA 4I9LA 3SCXA 3H08A 4CEOA 2A1SA 4FYDA 4H4MA 2PZSA 1VSEA 1L3UA 1NKEA 3VQ9A 1TAQA 1NK6A 4HCBA 4G1QA 3C95A 3QO9A 4FVMA 4W5TA 1LAWA 4OGCA 3JSMA 4JS5A 3QEWA 3SUPA 3TAQA 4FJ7A 5FROA 4CECA 1FXXA 1WAJA 3C6UA 4CGJA 1IG9A 3OYEA 4PQUA 1YT3A 4FK0A 4LY7A 1VSHA 1C1CA 1VSDA 2OA8A 4EP4A 5J2MA 1U47A 4CIFA 1T05A 2KZMA 4DQQA 4M3XA 1B92A 2BANA 1VSFA 2O4GA 1GOAA 1J5OA 3PV8A 2ITGA 5C25A 1HRHA 3L2UA 1JKHA 2XHBA 1RDCA 1S5JA 3LANA 4W5QA 3G10A 3SQ2A 4KHWA 4CEAA 4Y1CA 2ATQA 4GW6A 2Q3SA 3HJFA 1N6QA 3WNGA 2DTUA 1LWEA 4Z4IA 3B6OA 4CHNA 3TAGA 2FBYA 4N47A 1NOYA 1UOCA 5CZ2A 1NK7A 1L3VA 3IAYA 1RBSA 2FBTA 1EKEA 1SV5A 4DFJA 4DTMA 3OYJA 2PYLA 4GMJB 3KIOA 2R7YA 1NK9A 4CCHA 4E19A 2E6LA 4KAZA 3OYBA 4ICLA 1W9HA 3HP9A 3AVGA 1TKDA 4DTJA 1O1WA 2BGGA 4CIGA 4DFKA 1BHLA 4CHYA 4NYFA 3DRSA 2QK9A 3VQDA 4DMNA 3V9SA 3HO1A 3DLEA 4N5SA 1TL3A 3AVNA 4KHUA 4E7IA 3I0RA 4LSLA 4F3TA 1JLAA 2G8WA 1B9FA 1CZBA 3QINA 2IOCA 3HSTB 4KREA 5CY4A 4LH5A 3SV4A 1ASVA 1EP4A 3IRXA 3IS9A 3NH2A 4F4KA 1BI4B 3OJUA 3KKSA 1A5VA 5HRRA 1NK0A 1BGXT 2D0CA 3PO5A 2QKKA 2IDOA 1FKOA 4LSNA 2X6SA 4EZ9A 2YNFA 4CGGA 4RW7A 3VN5A 1DTQA 1I3AA 4CFBA 3PX0A 2XY6A 4KO0A 1TK0A 1BISA 1C1BA 1RILA 4CF9A 4FJMA 2HNYA 4FJ9A 3MEDA 3ZT0A 1SL1A 1QSLA 4XIUA 1YTUA 3VQCA 4E7KA 3D0PA 3MAQA 1L5UA 1BIZA 4E0DA 2FC0A 2KTQA 4M3WA 1ZYQA 4BDPA 2IC3A 1NJXA 4DFMA 3CYMA 3LAKA 3VQQA 3L2QA 4DQPA 3RTVA 3KLIA 4CFDA 4B9VA 2HHXA 4M45A 3TWHA 1BCOA 2D0AA 4FM2A 2B6AA 2QKBA 1RDDA 2VG5A 3V9XA 4DU3A 3QLHA 4W5NA 1KVBA 3P5JA 1QTMA 2Z1IA 3VQ7A 2RN2A 3L3UA 4JRPA 1RT7A 3DOKA
chains in the Genus database with same CATH superfamily
1LAVA 2F96A 2HF3A 5GAHP 3OBYA 3AO3A 3WXJA 2QTDA 2W42A 3SUQA 3RR8A 3T1HK 2IVNA 3O1WA 1LCUA 3O8MA 1QQCA 4OKEA 1BI4A 3BDPA 3O4QA 5BN8A 4J2AA 1J6ZA 1YVNA 4H0XB 2O8EA 4CEEA 3MECA 3EZWA 2QW9A 1WSGA 4BE1A 2HF4A 3ENOA 1KVAA 5HROA 3O6WA 3LZJA 1TAUA 4MLHA 1Q86O 1M1KO 2YJFA 3PO4A 3NH0A 3AO5A 3OYDA 3QICA 1W2BM 2Q0RA 1C0UA 1QE1A 4CESA 3ZEUB 3TTDA 4BR0A 1C1AA 1TYQB 3FZKA 3J81O 3QNOA 2P5OA 2Q2RA 4A59A 1T8EA 4FPAA 1NGEA 4CEQA 4UQGA 4DUYK 3SJJA 4B9NA 3KJVA 5BPNA 2Q0UA 4B1YB 5KRTA 1W0HA 4C8KA 1CXQA 4AH9A 4CZGA 3PUFA 2ZJPL 4NCAA 4DUZK 5AZJB 1XC3A 2IGIA 3VEVA 1SAZA 3KD5E 5C2DA 4EP5A 2G8HA 1N32K 2W6LA 4FCYA 2YI1A 5GADP 1JXBA 4B9TA 4BRIA 4RW9A 4CGHA 4FK2A 1GOCA 4DTOA 5KGXA 1ZBUA 4FWKA 3V9UA 3R1XA 3ZLJA 3ZEUA 1VQNN 5AFUA 3SAFA 4KPYA 1UA0A 1S1XA 1TYQA 1RNHA 4H5VA 3V9ZA 1DLOA 4FLWA 3THVA 1IKXA 4IO8A 4B1VA 2WOMA 3CG7A 5BRHA 1T7PA 4FJJA 1N36K 4DWIA 3DOLA 2FSKA 4IFEA 1VSJA 2RKIA 4OX9K 1YIJN 3HTVA 4CK1A 5AZJA 4H0PA 1ZC6A 5EOYA 5J1EA 2F8SA 3AO1A 2YHWA 4BC3A 3IUCA 5E26A 4YNQA 3BEXA 1BDGA 5HLFA 2JWKA 2CGJA 3CCRN 1GLBG 4LF8K 4RW8A 2D1KA 4RWTA 3AVCA 3L6QA 4KKOA 1WB9A 1WN7A 1QZ6A 3IG1A 4F3TA 3HPGA 3NF9A 3MWPA 3PX6A 3HL8A 2YNGA 2HSTA 4F8RA 4K43A 4FWSA 1T44A 3JS6A 1R0AA 3ISNC 3CJAA 2ZE2A 5CYQA 2YHXA 4CZKA 4A2AA 4PL8A 1C0TA 4BREA 4IJAA 5HP1A 4DF4A 5AQVA 2WC9A 3M1FA 2PY5A 2VGNA 2VQEK 3ASMA 1I94K 4F3OA 4FZXC 3QEXA 1U4BA 3NGZA 3U8XA 3U9ZA 3H1VX 3W0LA 4KHPK 1FKPA 4BRQA 4M42A 4M3UA 3FR0A 5LJVA 2ZJRL 4B9SA 1NMDA 1MWMA 4AM6A 4B9LA 2BDPA 4CGIA 2G8IA 1NGIA 2QWOA 4GV3A 4CZJA 4OKJA 1JXEA 4CERA 4GV6A 1K8AO 3L4IA 1RGIA 1YAGA 3CC4N 3P83D 4LC9B 3ZETA 4ELVA 2D0BA 4HUGA 3IDHA 4A5AA 4BRAA 4PL7A 1YXQA 4DV5K 3Q7CA 1NKBA 1HPMA 4IZ9A 4PWDA 5M1KA 3NGYA 3DMJA 3DRPA 1W97L 2P1JA 4CK3A 4JI3K 2HB5A 4KH6A 3T1YK 3RRGA 3RMAA 1DEJA 4CHQA 3ZT1A 4WE1A 1Q18A 3VF6A 3W3DA 3PIPL 1V4SA 1HNIA 3AARA 1WLJA 2OPSA 4XH1A 2XY5A 3SQ4A 1C0GA 5AQIA 4PHTX 2QA4N 2QEXN 3HPHA 3C7NB 1NGHA 3VEZA 3SI6A 3QFPA 1T6CA 4JKDA 4FOIA 4E89A 1RT5A 5IWAK 1QZ5A 3CJBA 3J8AA 2HBKA 3WNEA 3NDKA 1G15A 2OTLN 4A62A 3K5NA 5MLCQ 4A61A 4OO1J 3LALA 4EZ6A 2VCPA 1DGKN 1J5EK 3VQBA 3ZSVA 4CHZA 3NBPA 4I9QA 4OLAA 3CMEN 5TKWA 5GAGP 3DAWA 1S1VA 4EIAA 1TK8A 3JAMO 2I7NA 3A0IX 4LD0A 1HKCA 3AVHA 3CQ8A 1SL2A 2HHTA 1RBVA 3C7NA 3HK2A 3HYFA 3G0ZA 1KLNA 4CF0A 2GX9A 4PA1A 1Q7YO 3VQPA 4HUEA 4CJPA 3RWUA 2P51A 4J2DA 3J7YP 4BY9C 3VA0A 2GBZA 1BIUA 1NWKA 1BU6O 2AJQA 4DV2K 1HYVA 3UIQA 4BDYA 4R79A 3ZSZA 4DR2K 4WCEL 2EX3A 1LW0A 4X65K 3ZT3A 2FF6A 2D4WA 1BA0A 3K58A 3O1BA 3OVNA 3EL2A 4JN4A 4FWPA 3EKUA 3SCXA 2OCEA 3MDQA 1NKEA 3VQ9A 1NK6A 3QEWA 3FZHA 3L0QA 4JS5A 3VENA 4C1NK 4CGJA 3QDKA 4IXCA 4FWRA 4X64K 2KZMA 4DQQA 4M3XA 2BANA 4B1XB 1J5OA 3GDQA 1E4FT 2ITGA 5C25A 3LANA 5KPRA 3AGKA 4JHDB 4CD1A 4GW6A 3CXCM 3D2EB 3RVCA 1N6QA 2DTUA 4CHNA 2VYPA 2FBYA 3K9JA 4FSVA 1L3VA 2YCHA 1EKEA 2PYLA 3KIOA 3SMPA 2E6LA 3SLCA 3AVGA 4BC4A 4DTJA 4CIGA 2NNWA 3E66A 4BQLA 4NYFA 4DMNA 3HO1A 3CCEN 1WBBA 4LSLA 4KREA 1B9FA 1CZBA 1XUPO 2O8FA 4F4KA 1KXPA 3C65A 4WFBL 2D0CA 3PO5A 1FKOA 2X6SA 2YX6A 4RW7A 1I3AA 3DXMB 4CFBA 3J7AP 4PKIA 4KO0A 4YOXA 2XY6A 3P39A 1C1BA 1RILA 1FW6A 1VQ6N 3ZT0A 2H3GX 3D2EA 3MAQA 1L5UA 3D7EO 5C0YA 3FE1A 3UKUA 2FC0A 3KWIA 1X9JA 1ZYQA 1ILYA 2A40A 1P8ZA 3L2QA 4B1WB 3MX2A 1D4XA 1XNQK 3H1QA 4M45A 2D0AA 2B6AA 3HBTA 4W5NA 1KVBA 1QTMA 3BP8A 3WXLA 3VQ7A 3HOTA 3L3UA 2JGUA 2XO7A 1Q81O 5M1OA 4FWOA 4CJEA 1NK5A 1SQKA 3OW2M 4DU4A 5HL7L 4A5BA 4DG1A 2QWNA 3K5MA 3K59A 3FZFA 2UXBK 3QETA 5E41A 3DXMA 3FGUA 1XI1A 2W6KA 1KSPA 1KCFA 5AQTA 2AA4A 1IG8A 5M1PA 2IVPA 2P9UB 4K8ZA 1NGAA 4C8LA 1EXQA 3S9HA 1C0FA 1TL1A 2JWLA 4MO5A 1QQNA 2DY4A 5KRSA 4NXNK 3VQ4A 2X78A 4LH4A 4H4OA 5TKYA 4H03B 4J2EA 1S1TA 1R59O 2X74A 2BH1A 4CBWA 1GLAG 3U4LA 3RMCA 1ASWA 1SKRA 2Y1JA 3O3HA 2P9NA 4I2PA 5CZ1A 3OYIA 3O3FA 4JI1K 4JI5K 4B3MK 1JCFA 1HNZK 1TKTA 5HRNA 4BDZA 1QVGM 4XEIA 1U2VB 2VQFK 3E9PA 2P9UA 4BR2A 4B8CA 4CJTA 2HOEA 2E6MA 3DLRA 2HNDA 4BC5A 3SZ2A 3OYHA 4JKAA 1HQEA 1Z26A 1YJ9N 4LF4K 3MX5A 1NBWA 2GUIA 3TR8A 4CFCA 2J4RA 4KHSA 1X9MA 5LJWA 4JAXA 4CF1A 4JK8A 4FPBA 1RTIA 3WQTA 3R8EA 3I55N 5M1QA 4YOVA 2HHWA 1YJWN 1IBKK 1L3TA 4FL9A 4EFHA 1D9DA 1U6ZA 3H3NO 3K5OA 2GEMA 4MDBA 1HJRA 4CJ5A 1KRPA 4M3ZA 1RBUA 3VTIA 2I5JA 3J80O 3KK7A 4IOAL 3SAGA 3OYFA 4C23A 3P4IA 5ELZA 3HM9A 1EETA 2FLOA 3FZLA 3ID8A 4Y1DA 4KTQA 4DLEA 4WYBA 4DQRA 3KK1A 3R3LA 1JLQA 3O08A 1WAFA 4FLZA 4HTUA 3BGRA 1K6YA 1JLFA 1VQON 1NGBA 1S1WA 3O9QA 2YHYA 1WSJA 1HNXK 4OPHA 3RR7A 4EZ9A 3HI0A 3EE9A 4B9UA 3RMBA 1KVCA 5F2RA 2RHKA 1RTJA 1RDAA 2XY7A 5AZIB 5GAEP 3QEIA 3TSUA 2E1YA 3QBWA 1J9AA 3TAMA 3MCPA 1QHTA 2D5RA 1T6DA 5HRPA 3CQYA 4IG0A 2OYQA 3V4IA 4DSEA 1SL0A 3G71N 1YTAA 3T69A 3L8BA 1X3NA 3DRRA 4HCCA 4DQIA 1VRTA 4UY8O 3QEVA 2I7PA 4CF8A 3LP3A 1WNSA 2YV0X 1OH6A 2LSNA 3A2FA 4L3QA 3E1YA 1SZ2A 4B3OA 4FWLA 5D3GA 2ZWHA 3HT3A 3CCLN 5I3UA 3HZ6A 4CJ3A 3NF8A 1JLCA 2A1RA 4KB0A 1ZXOA 5AZIA 2KKZA 4DV7K 1QSYA 4DSFA 4DTRA 1QQMA 3MXJA 4BRKA 5E84A 4EAHD 2ASPA 5J2PA 1RT6A 3NFAA 5AQHA 3VPZA 2HMPA 5SZTA 3LZIA 2KFZA 1D9FA 1RTDA 1HLUA 5BPLA 1WOQA 5AQKA 4BG9A 3F9MA 4N56A 1SKWA 4DQSA 5CHIA 4BGAA 3KD1E 2ASOA 3I33A 4BQZA 3VERA 3AAPA 3SPYA 3P31A 5FLXO 3U3YA 3N4QA 4DS4A 3R9PA 4C8NA 3CCUN 3F5TA 3GOIA 5I9EB 1KAYA 3V81A 2Z1GA 1NNEA 3VQAA 4AHCA 2VGMA 4ILHA 1KFDA 3R6MA 3SQ0A 2WFBA 2OPPA 1U45A 1GLJO 3SYZA 5T7BA 3M8PA 1H1VA 5DK5A 1JLEA 3WT0A 2FSJA 4OGEA 3F2KA 3WNHA 2E5LK 3MMVA 2HNZA 1OH8A 4CZHA 1BQMA 4H0VB 3DI6A 4I2QA 4MFBA 4NCBA 2HHQA 4N76A 4KI4A 4DFPA 3L2WA 4IBNA 1JLGA 4FK4A 3IMXA 2OPRA 4LFBK 4DSIA 3AVIA 1X9WA 1WSFA 3C94A 3ID6A 3B8AX 5AQJA 3BF1A 3QBXA 3TABA 4ILGB 5EXWA 3TARA 4E7LA 5BPMA 1QSSA 4DTUA 1WSEA 1BL3A 3BZCA 2HHVA 3WNFA 4FJKA 3KWGA 1NJWA 3A5OC 3DJCA 1S72N 5JLHA 4JRQA 4OJRA 3VEYA 5AQZA 3K2PA 4F2SA 1HKBA 3VF2A 2V51B 2NRVA 4K41A 2OZMA 1U48A 5FPEA 3KZBA 3AVMA 1BUPA 3HVRA 3CPWM 5EVZA 2G8UA 3TU5A 2HBMA 1ITGA 4JV5K 4FM1A 4H5TA 3PSIA 1NOZA 3CFPA 4BC2A 3ZSXA 4E7HA 4FM0A 4NLBA 2DFFA 3VA3A 3SUNA 4JD2B 1GLDG 4ELUA 3VETA 2ITMA 3U6FA 1VSIA 3TAFA 4F9OA 3AA4A 4I9LA 4JKHA 4CEOA 3MN9A 2PZSA 4O8UA 2E2OA 3VOVA 1E3MA 1LAWA 4JKFA 3JSMA 4DR6K 4CECA 1FXXA 1IG9A 2P9SB 4H0YB 1P90A 4LY7A 5AQRA 1VSHA 4CIFA 4YOTA 1NGJA 1OH7A 1GOAA 5IT9O 3PV8A 2P9IB 1JKHA 3G10A 1DT9A 4JI4K 4E1JA 1K8KB 3B6OA 4M63C 1RBSA 2FBTA 1SV5A 4JD2A 4DFJA 1NK9A 4CCHA 4QS7A 2BUPA 1NU0A 3O4WA 1Q82O 4BR4A 1O1WA 2BGGA 5JMVA 4DFKA 3M3ZA 2QK9A 4KBOA 3VQDA 3V9SA 3QFUA 2YJEA 4N5SA 1GLFO 4KHUA 1ESVA 1JLAA 2IOCA 4CZIA 4WQ4C 2P9SA 1ASVA 3IRXA 3NH2A 1YITN 3C6AA 3OJUA 4IDHA 3EKSA 4LSNA 2QKKA 3JXUA 3TSPA 4BVOA 2P9IA 1DTQA 1TK0A 2W40A 1BISA 3O9RA 4ISGA 4CF9A 4FJMA 4XIUA 4DV4K 4KH4A 4DFMA 4B1ZA 4IEEA 2PAVA 3KVGA 5AQLA 4ISFA 4DU3A 3THYB 3ATVA 2P9PB 2E1ZA 3F73A 1S3XA 5KGWA 5KPTA 2WBNA 4GNIA 1MU2A 2Z1JA 1NLVA 5SWMA 4CW7B 1OVQA 4ID1A 4U67L 2Y1IA 3S3OA 5J2NA 3CJ9A 4MO4A 4YOWA 3THXB 3PY8A 4IG3A 3QERA 5JVGL 1CZ9A 5GIPA 4N41A 4O5BA 2ZGYA 1MDUB 1W7AA 4KB1A 4K25A 5KI6A 1KLMA 3WQUA 4BR9A 2NUBA 3CM5A 3MN7A 4FW1A 3VESA 3CI5A 1X1PA 1RT3A 4LFCK 1VRUA 4ISEA 4CJ4A 3H45C 3ITHA 3VGMA 1RCHA 2G8VA 5AQQA 3S3MA 2P9KB 4JEPA 2ZQBA 2NRRA 5KQ8A 2P9PA 2HBLA 4AHVA 3AVFA 2A6AA 4YHHK 1QVFM 3L2RA 3CJ7A 3NMUA 1Z25A 5FPDA 1ZBFA 3THXA 4JS4A 3NE6A 3CFOA 3HRGA 4FJHA 3L4QA 1HYSA 4C8MA 3D45A 1IKVA 3ZSYA 4W5RA 5J2QA 4O0JA 2G8FA 3BZKA 1LW2A 4DQPA 5I42A 2O4IA 1OKJA 2HHUA 3SBGA 4FJNA 5FRNA 2UXCK 3P1GA 4BRLA 1UA1A 1RBRA 1FK9A 1VK0A 2IIRA 2A5XA 1TK5A 4DTSA 5LMNK 4BRHA 4E1NA 3LPTA 4FO0A 3I8BA 4NB4A 2YKNA 3O9UA 4ZHRA 1LV5A 4V19S 2QXLA 4FVUA 3A5MC 5JS1A 4YORA 4NCGA 2F8TA 3OJSA 1XWLA 2UUCK 4FLVA 4L8RB 3MEEA 1YJNN 2JLEA 3LDPA 4OPKA 1EWRA 2UU9K 1SUQA 5ADXH 3OBWA 4H8KA 4CI6A 1VHXA 2YNIA 4JNEA 5EY4A 3CCJN 5JS2A 3CJ1A 3CCVN 5CYMA 2CGLA 2OZSA 2VWJA 1VQLN 4JHDA 4LF6K 1YHQN 3TTFA 3KK3A 1YVUA 3HXMA 3T19A 4O8KA 3WXKA 4PUOA 4FJLA 3CJCA 4FLUA 4BG8A 4BRNA 1NGGA 1IJJA 4FW2A 4NYNA 3GL1A 4BWMA 3OS1A 4DTNA 3M8RA 2O8CB 1WBDA 3I56N 3VEOA 5C2FA 3PX4A 4K0KK 3NF6A 4JK7A 1JLBA 4IFVA 4CE9A 3AAQA 4B3TK 3FLCO 3MWTA 2KFNA 1SS6A 3SBTA 1HX1A 1VSLA 1DTTA 3U9DA 4FLYA 2E2NA 4A57A 4JI8K 2X6NA 3WXIA 2ASMA 4ZTJA 4H5NA 1B9DA 4TSXA 5EX5A 1GOBA 4CZMA 4KFBA 2HHSA 2EHGA 4DV6K 5A2QO 1ZBLA 3WUHA 2A3ZA 3OS0A 1NJIO 1VQ4N 1X9SA 1M90O 1BG3A 4CEDA 2KZZA 4E3SA 2FSNA 4DR1K 3CCMN 4EHTA 4IDKA 4AHSA 1TGOA 4H0OA 2O8CA 1NM1A 5DM7L 4CEFA 2ETJA 2QWQA 3OYLA 3I8DA 5CE3A 3V9WA 1KQSM 4O4GA 3ZSRA 4DF8A 1REVA 5KTQA 1YUWA 3NCIA 3G25A 4AM7A 3CPEA 1E4GT 4KRFA 1JL2A 1X3MA 2PFUA 3GBTA 4B9MA 3NVKA 4DKWA 1OH5A 5M1FA 3O3GA 4CJSA 1S9EA 4YOUA 1Y64A 4CD3A 4CZFA 5DMRA 4GKKK 3DLLL 4FZYA 4Q0BA 4FJ8A 1S6QA 1LWFA 4FJXA 5FDLA 2YKMA 2ZGZA 3K57A 3M8SA 3D2FB 1N5YA 1T03A 1RT2A 4FWMA 3KLHA 4Y0WA 1U49A 3CETA 3MK6A 2PYJA 4BRGA 3BF3A 5EU7A 4E1MA 1TKZA 2E2PA 3ZSOA 4DB3A 1TUUA 1S6PA 4O0IA 2VG6A 1NG9A 2YNHA 1KFSA 4CBXA 5HBMA 5AQFA 5KQDA 3TAEA 2GV9A 3V1OA 3KKRA 3V1RA 4U7BA 1GLEG 4KI6A 2YHBA 1U2VA 3O9TA 1WSHA 4NO7A 4CJKA 4FXDA 2FBVA 4FWNA 3TI0A 4FLXA 1CLQA 2UUAK 4JKCA 3D2FA 5AQOA 1JCEA 3ULEB 1RT7A 4AHTA 4WFAL 3CERA 4CGFA 2IS3A 4JKEA 1HPZA 1VSKA 4EHUA 3VQEA 2B4JA 3CHWA 3BUZB 3IKMA 3AVLA 4CBUA 1EWQA 4R5PA 4C1NI 3AO4A 3DXKB 3TANA 1YF5L 2DFEA 4CVNE 4O55A 2WTUA 4DSKA 2NZTA 2D0PA 1V4TA 3NGIA 4B8AB 4CJQA 4JI6K 1HQUA 3LL3A 4YY3K 4PKHA 1RT4A 4YDUA 4M7YA 3SJHA 4KTZA 4FWQA 3KTQA 4I7FA 4BRMA 1UAXA 1XQSC 4MQ3A 4WQ4A 5BRFA 4KV8A 4M3RA 3IFRA 3SMSA 1D5AA 4JKBA 3VMFB 2V7YA 4X66K 4QOZB 4CEBA 4Z4HA 1EO1A 3ULEA 3H6EA 1ZBHA 2E2QA 5GINA 4IKFA 2F4VK 4CJUA 2QWMA 1BQNA 3VQ6A 1G99A 4OPAA 4QS8A 3SPZA 4K8XA 4CHPA 3V6DA 2QWLA 1LWCA 1VQ7N 2IVOA 2E88A 2NRHA 1QQOA 2B5JA 2UUBK 1NGCA 3DXKA 4DCHA 3AA5X 1HNWK 2VWBA 1A5WA 4IOXA 2A1SA 4B1UB 1XMOK 3O9SA 4FYDA 1L3UA 1TAQA 4HCBA 4G1QA 3HOSA 1K9MO 3C95A 4FVMA 3TAQA 4W5TA 3FZMA 5AFUH 2QWPA 1WAJA 3C6UA 4PQUA 1LOTB 4CZLA 4FK0A 1RDWX 3D6RA 4EP4A 5J2MA 1T05A 1KD1O 1VSFA 2O4GA 1EQYA 5BR9A 1NGDA 1S5JA 3HM8A 5AQUA 4W5QA 3CF5L 3TPQA 4Y1CA 2Q3SA 3HJFA 3WNGA 3TAGA 3VEXA 4WQ5C 1NOYA 5CZ2A 1NK7A 3CCSN 4DTMA 3OYJA 4LFAK 1VQMN 3OYBA 1W9HA 1JJ2M 1TKDA 5C15A 5AQWA 5CR4A 4CHYA 3DLEA 1Z05A 1TL3A 4RCHA 1VQ9N 3HSTB 5CY4A 3SV4A 1JCGA 1EP4A 3IS9A 2GTDA 4NLCA 5HRRA 2QWRA 4BRCA 1VQKN 4BGBA 4BR5A 4CGGA 3VN5A 5AQGA 2F7TA 2V52B 4DHYA 4IOCL 2HNYA 4FJ9A 3MEDA 1SL1A 1QSLA 4WF9L 3VQCA 1BIZA 3J7ZO 2KTQA 4CZEA 4BDPA 1NJXA 2CGKA 3CYMA 5AJ3K 3VQQA 3RTVA 3DWLA 4CFDA 2A42A 3TWHA 4FM2A 4ILJA 2VG5A 3V9XA 3UKRB 3QLHA 1O13A 5LL6Z 3CC2N 2RN2A 4YOYA 4BROA 4DV3K 3TAPA 4HHTA 4RW4A 2Q36A 1C0MA 4ZTFA 4IFYA 3CFRA 4DV1K 5FRMA 3I0SA 2GUPA 4RG8A 4CHOA 2ZJQL 3PSFA 1NK8A 3TSQA 4KH5A 4G9ZA 4JI0K 3NH1A 3ZYYX 3OA9A 3AGRA 3MXIA 3QB0A 3HSCA 3QESA 3L2VA 4A2BA 3THWB 3SUOA 3LDLA 1SKSA 3QMLA 3DLKA 1ZBIA 5AQNA 2G8KA 4DR5K 3HVTA 1KAZA 2DPNA 2D0OA 5GIOA 3T3FA 3FFIA 3O5BA 3TTCA 1IH7A 3KHYA 1ATNA 3ZETB 4OPJA 1XNRK 4OVLA 3ZSQA 3O80A 5AQXA 5C12A 3MXMA 1Q9YA 3CD6N 2VWKA 3G6EN 3QIOA 1OVYA 3UKRA 3K5LA 2BE2A 1ASUA 1S22A 3K0SA 5LMUK 1JL1A 3LP0A 1XMQK 4PY5A 1KTQA 2FF3B 3LDSA 3AVBA 4KTWA 3ZCMA 4CJVA 2ZM6K 3CCQN 4DLGA 2KHOA 1XHXA 1IKWA 1FJGK 4AHRA 3THWA 4Z0UA 3HP6A 4AHUA 2NRZA 4BWJA 1RT1A 2YHAA 4CGDA 4CJWA 3ULDA 4B08A 4ELTA 3ZT4A 1HNVA 3OY9A 5JVHL 4M3TA 3LM9A 4M3YA 3KLEA 4CJLA 3LWLA 1TUYA 3EYZA 4F2RA 1Y97A 3E9OA 4H0TB 4DSLA 1F21A 2KLAA 4BVPA 4YDUC 4C8OA 4OLBA 1J53A 3VF4A 3NAEA 4BE0A 2A41A 3DLGA 4DR7K 4XH4A 2UXDK 1BO5O 4QS9A 3DM2A 4IO9L 2Q97A 3DLBA 5K14A 2DFHA 2FXUA 4KHYA 1VSMA 1VAZA 4FOEA 2QXFA 1UWBA 2HHHK 3CC7N 4DR3K 1K8KA 1BWFO 2FBXA 3NVMA 3S3NA 3HPOA 4OKKA 1S1UA 5FPMA 3CM6A 3QEPA 4X62K 1NK4A 3AVAA 2E8AA 2F9TA 4BR7A 2RPIA 3T1AA 3OYNA 3AA3A 1HMVA 2GELA 2XRIA 2QM1A 4DTXA 4DTPA 3M6GA 1QHAA 3LAMA 1NKCA 3EEQA 3Q7BA 4NXMK 1J54A 2CH6A 2OPQA 4CFAA 2WUSA 4MDAA 4CIEA 2V7ZA 1NJZA 5AQPA 3GE1A 5C10A 4DU1A 4LF9K 3AVKA 3V1QA 1BOTO 4YFUA 1C6VA 2Z1HA 3OYMA 3ZSWA 3AY9A 4J2BA 3CMAN 3B6PA 3UE5A 1L3SA 4O5FA 3ZT2A 1RTHA 3RMDA 3KLGA 1EX4A 3LPUA 4GV9A 3M5RA 4KHQA 4W5OA 3QNNA 3RRHA 3T7ZA 3VGLA 3EE8A 3E01A 1RFQA 3THYA 3DYAA 3LWMA 4DV0K 3NF7A 2P5GA 4FJGA 2HMIA 2F9WA 3O4NA 1BCMA 4H5WA 2WONA 3EZ5A 1NJYA 4Z4CA 1RBTA 1N8RO 5H1SQ 4M7XA 1NGFA 3VQ8A 3KK2A 4JK9A 4M41A 3LDOA 1KC8O 3KLFA 1RDBA 5HRSA 1I39A 4GVMA 4E7JA 3VQ5A 4HVJA 3DLHA 1VQ5N 3RSEB 1Q9XA 2NRWA 4GKJK 4DR4K 2O8FB 2Q31A 3MEGA 2ZD1A 2P9KA 1WUAA 4HUFA 5C24A 4FZZA 5BRDA 1N34K 3L3VA 3SQ1A 4Z4FA 4Z4EA 2HVIA 5BN9A 4MLEA 3ATUA 1IKYA 3SV3A 3FFKB 3UKUB 4I6MB 4FJ5A 1GLCG 3OYKA 4CF2A 3NHGA 4B9QA 5DM6L 1CXUA 3AO2A 4K42A 4BACA 3SAHA 3OYAA 1HYZA 4RW6A 4QCLA 3SNNA 1XC9A 3N4PA 2IAJA 3EY1A 1T3VA 3PLAA 1D8YA 1U04A 3RSEA 3M8QA 3AV9A 4CK2A 4BE2A 4CJRA 4DSJA 4XH5A 4Z4GA 3QIPA 3JYTA 4BRFA 2XY8A 2KW4A 4Q5VA 2P9LB 2CH5A 3ALYA 2HW3A 4WFNL 4CJFA 2BTFA 3AVJA 3C0BA 3EN9A 4JLHA 4AQYK 5M1NA 3OYGA 3OYCA 4QAGA 4I6MA 3U3GA 3LP2A 4WQ5A 3G4SN 4Z94A 5BR8K 2W41A 1HR0K 3CQXA 1TV6A 3ENHA 3MN5A 5JLFA 4GVEA 3GG4A 1K73O 1ZBSA 4ID5A 2Q1NA 5ADXA 1A5XA 4FJIA 2GWJA 1IO2A 3WEEB 3C6TA 4FLTA 4AILC 1XHZA 3LDNA 4JI7K 4CJ7A 3H3OB 3PIOL 3AA2A 1YI2N 4DS5A 3A8YA 5KPZA 3F9KA 1TKXA 3A5NC 2P9NB 1MA9B 1Q8IA 2P9LA 2HVHA 3OS2A 2RF2A 1WSIA 5AQMA 2E4LA 3MCAB 3ZX2A 5F1XA 1HUXA 4KHNA 4DQ8A 3S41A 1QS4A 5C42A 3VTHA 3OHRA 1HKGA 3VGKA 2KQ2A 2OANA 1BA1A 2O8DB 5HOOA 1TVRA 1DKGD 3UB5A 2GWKA 2NRXA 4O44A 2VG7A 4CEZA 4JYAK 2RE2A 3OTOK 3LDQA 5B8HA 3C6HA 3LP1A 5AQSA 1S9GA 1VQPN 3H08A 4H4MA 1VSEA 2ZF5O 2O8BB 3ZX3A 3QO9A 2NLXA 3WEEA 1HJOA 4OGCA 3SUPA 4FJ7A 5FROA 3OYEA 1YT3A 1ATSA 4BRPA 3ZX0A 1C1CA 1VSDA 2OA8A 1ATRA 1U47A 1NMNA 4HTLA 3CIPA 1B92A 1N33K 2PBDA 2EWSA 1HRHA 4JKGB 3L2UA 2XHBA 2E20A 5AR0A 1RDCA 5FPNA 1CZAN 3SQ2A 4J8FA 4KHWA 5AQYA 4IEIA 4CEAA 4BRDA 2ATQA 3LM2A 2O8DA 1LWEA 4Z4IA 3WXMB 3SK3A 4H5RA 4LF7K 5F0XA 2NRTA 4N47A 1UOCA 3IAYA 1RDUA 3A5LC 4HWIA 4JI2K 4GMJB 2R7YA 4E19A 4KAZA 3EO3A 4ICLA 4IWVA 3HP9A 1GLLO 3H46O 1BHLA 3MN6A 2O8BA 1KAXA 3DRSA 5BREA 5LY3A 3AVNA 4E7IA 3I0RA 2G8WA 3QINA 1IBLK 4LH5A 2QI2A 3VEWA 1BI4B 1VQ8N 3KKSA 1A5VA 1NK0A 1BGXT 1Z6RA 2IDOA 3P38A 2YNFA 4B3RK 2O8EB 3PX0A 4JKGA 4GY2B 1IBMK 1IV0A 4LF5K 4B3SK 1YTUA 4AF1A 4PKGA 3D0PA 4E7KA 5JICA 4E0DA 4M3WA 2IC3A 3LAKA 2HBJA 2OTJN 3ENBA 3KLIA 2UYTA 4B9VA 2HHXA 1MWKA 1BCOA 2AP1A 3BY5A 3E9LA 2QKBA 1RDDA 4IJNA 3P5JA 2Z1IA 4RTFD 4JRPA 3K9KA 3DOKA
chains in the Genus database with same CATH topology
3F73A 5KGWA 1LAVA 2F96A 2JGUA 2XO7A 3TAPA 1MU2A 2Z1JA 3AO3A 3SUQA 5SWMA 2W42A 4RW4A 4HHTA 3RR8A 4CJEA 1C0MA 4ID1A 4ZTFA 1NK5A 4IFYA 3CFRA 2Y1IA 3S3OA 5FRMA 1QQCA 4OKEA 4DU4A 1BI4A 3I0SA 5J2NA 3PY8A 4RG8A 4CHOA 3BDPA 1NK8A 4IG3A 3O4QA 4DG1A 3QERA 1CZ9A 3K5MA 3K59A 3NH1A 4J2AA 4N41A 3QETA 4O5BA 3MXIA 4KB1A 3QESA 3L2VA 5KI6A 1KLMA 5E41A 3SUOA 2NUBA 1SKSA 1XI1A 3DLKA 3CM5A 3MECA 4FW1A 4CEEA 1ZBIA 1X1PA 2G8KA 1WSGA 1KCFA 3HVTA 1RT3A 4BE1A 1KSPA 1VRUA 4CJ4A 1KVAA 3T3FA 4K8ZA 3FFIA 3ITHA 1RCHA 5HROA 2G8VA 1IH7A 4OPJA 3S3MA 4C8LA 3LZJA 1EXQA 3S9HA 4OVLA 1TAUA 3ZSQA 1TL1A 3MXMA 1Q9YA 2ZQBA 2VWKA 2DY4A 5KRSA 3PO4A 3QIOA 3K5LA 3NH0A 2BE2A 1ASUA 3AO5A 3VQ4A 3OYDA 2X78A 4LH4A 4H4OA 4AHVA 3AVFA 1JL1A 4J2EA 3LP0A 4PY5A 1S1TA 1C0UA 1QE1A 3L2RA 1KTQA 2X74A 3LDSA 4CESA 3AVBA 1Z25A 4KTWA 3ZCMA 4CJVA 4DLGA 1ZBFA 1C1AA 1XHXA 3QNOA 1ASWA 3RMCA 1SKRA 2P5OA 2Y1JA 3O3HA 4JS4A 1T8EA 1IKWA 3NE6A 3CFOA 4I2PA 5CZ1A 4FJHA 3OYIA 3O3FA 1HYSA 4CEQA 4UQGA 4C8MA 4AHRA 3D45A 4Z0UA 3HP6A 4AHUA 1IKVA 3ZSYA 4W5RA 5J2QA 3SJJA 4O0JA 4BWJA 2G8FA 1RT1A 4B9NA 2YHAA 3KJVA 1LW2A 1TKTA 1W0HA 4CGDA 5HRNA 5KRTA 4BDZA 4CJWA 3ULDA 5I42A 4B08A 4ELTA 3ZT4A 4C8KA 2O4IA 1HNVA 3OY9A 2HHUA 1CXQA 4AH9A 4FJNA 4M3TA 5FRNA 3PUFA 3P1GA 1UA1A 1RBRA 4NCAA 3KLEA 1FK9A 4CJLA 4M3YA 1VK0A 4B8CA 1TK5A 4CJTA 2IGIA 3LWLA 2E6MA 3KD5E 3DLRA 2HNDA 4DTSA 3EYZA 4F2RA 4EP5A 3OYHA 3SZ2A 1Y97A 2G8HA 1HQEA 1Z26A 4E1NA 3LPTA 2GUIA 3TR8A 4CFCA 4DSLA 4FCYA 4KHSA 1X9MA 1F21A 1JXBA 2YKNA 4B9TA 4CF1A 4ZHRA 4RW9A 1LV5A 5JS1A 4CGHA 1RTIA 4FK2A 1GOCA 4NCGA 4DTOA 4C8OA 5KGXA 1ZBUA 4OLBA 2F8TA 3V9UA 1J53A 3OJSA 1XWLA 2HHWA 3NAEA 4BE0A 4FLVA 3DLGA 4L8RB 4KPYA 1UA0A 1S1XA 1RNHA 3MEEA 2JLEA 3V9ZA 1L3TA 4OPKA 1D9DA 1SUQA 4H8KA 3K5OA 1DLOA 4FLWA 2YNIA 3DM2A 1IKXA 3THVA 5JS2A 2WOMA 1HJRA 3DLBA 3CG7A 4CJ5A 5K14A 1KRPA 5CYMA 1T7PA 4M3ZA 4FJJA 2DFHA 4DWIA 4KHYA 3DOLA 1VSMA 2OZSA 2VWJA 2QXFA 1UWBA 1RBUA 2I5JA 1VSJA 2RKIA 3KK3A 2FBXA 3OYFA 3S3NA 1YVUA 3HXMA 4CK1A 3T19A 3HPOA 3HM9A 4OKKA 1S1UA 3QEPA 3CM6A 5J1EA 1EETA 1NK4A 3AVAA 4PUOA 3AO1A 2F8SA 4FJLA 4Y1DA 4FLUA 4DLEA 4KTQA 2RPIA 3T1AA 4DQRA 4YNQA 3KK1A 1JLQA 3OYNA 3AA3A 5HLFA 4FW2A 1HMVA 2XRIA 1WAFA 4FLZA 4DTXA 4HTUA 3BGRA 1K6YA 4DTPA 4RW8A 1JLFA 4NYNA 4BWMA 3OS1A 1S1WA 3AVCA 3LAMA 4DTNA 1NKCA 3M8RA 4KKOA 1J54A 1WSJA 1WN7A 3IG1A 3PX4A 3RR7A 2OPQA 3HPGA 3NF9A 3NF6A 4B9UA 3RMBA 4CFAA 3HL8A 3PX6A 1JLBA 2YNGA 4IFVA 1KVCA 4F8RA 4CE9A 1RTJA 1RDAA 2KFNA 2XY7A 4CIEA 3QEIA 1R0AA 1J9AA 1VSLA 1DTTA 3ISNC 3TAMA 2ZE2A 1QHTA 4FLYA 1NJZA 2D5RA 4DU1A 3AVKA 5CYQA 3V1QA 5HRPA 4YFUA 1C0TA 1C6VA 2X6NA 4IG0A 4ZTJA 2Z1HA 4TSXA 1B9DA 3OYMA 3ZSWA 4DF4A 3V4IA 5HP1A 2OYQA 1GOBA 4DSEA 1SL0A 4J2BA 1YTAA 3B6PA 4KFBA 2EHGA 1L3SA 3L8BA 2PY5A 3DRRA 2HHSA 3ZT2A 1RTHA 3RMDA 3ASMA 1ZBLA 4HCCA 3KLGA 4DQIA 1EX4A 1VRTA 3QEVA 3OS0A 3LPUA 4CF8A 1X9SA 3LP3A 1WNSA 4F3OA 4FZXC 3QEXA 1U4BA 2YV0X 3NGZA 4KHQA 4W5OA 3QNNA 3RRHA 2LSNA 4CEDA 2KZZA 3A2FA 4E3SA 3E01A 4B3OA 3DYAA 1FKPA 3LWMA 5D3GA 3NF7A 4IDKA 2P5GA 2HMIA 4FJGA 4M42A 4AHSA 3O4NA 1BCMA 4M3UA 1TGOA 2WONA 3EZ5A 1NJYA 4Z4CA 3HT3A 5I3UA 1RBTA 4CEFA 2ETJA 4CJ3A 3OYLA 3NF8A 3I8DA 3V9WA 4B9SA 1JLCA 4O4GA 3VQ8A 3ZSRA 3KK2A 4DF8A 4M41A 2A1RA 4KB0A 1REVA 5KTQA 3KLFA 3NCIA 1RDBA 1QSYA 4DSFA 4DTRA 3MXJA 5HRSA 4B9LA 2BDPA 5J2PA 1JL2A 1I39A 4GVMA 4CGIA 4B9MA 2G8IA 4KRFA 1RT6A 3NFAA 4E7JA 3VQ5A 4HVJA 5SZTA 4OKJA 3O3GA 1JXEA 4CJSA 3LZIA 3DLHA 1S9EA 4CERA 1Q9XA 1D9FA 2KFZA 1RTDA 5DMRA 3MEGA 3P83D 4FZYA 4Q0BA 2ZD1A 4ELVA 1S6QA 1LWFA 4FJ8A 4FJXA 5FDLA 2D0BA 4HUFA 4HUGA 5C24A 2YKMA 4N56A 3K57A 3M8SA 4DQSA 1SKWA 3KD1E 1N5YA 4FZZA 1T03A 1RT2A 4Z4FA 3L3VA 3SQ1A 3KLHA 1U49A 4Z4EA 3SPYA 2HVIA 1NKBA 3U3YA 2PYJA 4DS4A 4PWDA 1IKYA 3SV3A 5EU7A 4C8NA 3NGYA 3DMJA 3DRPA 4FJ5A 4E1MA 2P1JA 4CK3A 3OYKA 3V81A 4CF2A 2HB5A 3NHGA 2Z1GA 1TKZA 3RRGA 1CXUA 3AO2A 3RMAA 3VQAA 3ZSOA 1S6PA 4AHCA 4BACA 4CHQA 4O0IA 3OYAA 3ZT1A 4WE1A 2VG6A 1HYZA 1KFDA 2YNHA 4RW6A 1KFSA 4QCLA 5HBMA 3SQ0A 3SNNA 3TAEA 1HNIA 1XC9A 1WLJA 2IAJA 2GV9A 2OPSA 3EY1A 3V1OA 3KKRA 3V1RA 2XY5A 2OPPA 3SQ4A 1D8YA 1U45A 1U04A 4KI6A 2YHBA 3SYZA 3HPHA 5T7BA 3M8QA 3AV9A 1WSHA 4CK2A 4BE2A 4CJKA 3M8PA 4CJRA 4DSJA 4Z4GA 5DK5A 4FXDA 3SI6A 2FBVA 1JLEA 3QIPA 4OGEA 3WNHA 3TI0A 4FLXA 1CLQA 3JYTA 2XY8A 2KW4A 2HNZA 4Q5VA 4E89A 1RT5A 1BQMA 4I2QA 3DI6A 4MFBA 4NCBA 3ALYA 2HW3A 2HHQA 4AHTA 3WNEA 4CGFA 3NDKA 4N76A 2IS3A 4KI4A 4DFPA 1G15A 1HPZA 1VSKA 4IBNA 4CJFA 3L2WA 3VQEA 2B4JA 3K5NA 1JLGA 4FK4A 3AVJA 3LALA 4JLHA 3OYGA 3AVLA 4EZ6A 3OYCA 4QAGA 2OPRA 3U3GA 3VQBA 3ZSVA 4CHZA 4R5PA 4DSIA 3AVIA 3NBPA 3LP2A 4I9QA 1X9WA 3AO4A 3TANA 4OLAA 1WSFA 3C94A 2DFEA 4O55A 1TV6A 3TABA 4DSKA 3TARA 4E7LA 1S1VA 1QSSA 4ID5A 3NGIA 4B8AB 1A5XA 1WSEA 4DTUA 1BL3A 4FJIA 1TK8A 1IO2A 4CJQA 2HHVA 3C6TA 3WNFA 4FLTA 4AILC 1HQUA 1XHZA 4FJKA 4LD0A 1RT4A 3AVHA 1NJWA 3CQ8A 1SL2A 4KTZA 2HHTA 1RBVA 3AA2A 3HK2A 4DS5A 3KTQA 4I7FA 3HYFA 3G0ZA 1UAXA 4MQ3A 4JRQA 4OJRA 4KV8A 4M3RA 3F9KA 3K2PA 1KLNA 1TKXA 4CF0A 1D5AA 4PA1A 4F2SA 3VQPA 4HUEA 4CJPA 2OZMA 1U48A 1Q8IA 4CEBA 4Z4HA 3RWUA 4QOZB 2P51A 3AVMA 3HVRA 4J2DA 2HVHA 3OS2A 2G8UA 1ZBHA 2RF2A 1WSIA 1ITGA 2E4LA 3VA0A 4FM1A 4IKFA 4KHNA 4CJUA 2GBZA 1QS4A 1BQNA 3VQ6A 5C42A 1BIUA 1NOZA 3CFPA 2KQ2A 2AJQA 1HYVA 3SPZA 4K8XA 3UIQA 4BDYA 4CHPA 3V6DA 1TVRA 1LWCA 3ZSXA 3ZSZA 4E7HA 4FM0A 4O44A 2EX3A 2VG7A 4CEZA 1LW0A 2DFFA 3ZT3A 3VA3A 3SUNA 2B5JA 4ELUA 3U6FA 3AA5X 1VSIA 3K58A 3LP1A 3TAFA 3AA4A 3OVNA 1A5WA 1S9GA 4I9LA 3SCXA 3H08A 4CEOA 2A1SA 4FYDA 4H4MA 2PZSA 1VSEA 1L3UA 1NKEA 3VQ9A 1TAQA 1NK6A 4HCBA 4G1QA 3C95A 3QO9A 4FVMA 4W5TA 1LAWA 4OGCA 3JSMA 4JS5A 3QEWA 3SUPA 3TAQA 4FJ7A 5FROA 4CECA 1FXXA 1WAJA 3C6UA 4CGJA 1IG9A 3OYEA 4PQUA 1YT3A 4FK0A 4LY7A 1VSHA 1C1CA 1VSDA 2OA8A 4EP4A 5J2MA 1U47A 4CIFA 1T05A 2KZMA 4DQQA 4M3XA 1B92A 2BANA 1VSFA 2O4GA 1GOAA 1J5OA 3PV8A 2ITGA 5C25A 1HRHA 3L2UA 1JKHA 2XHBA 1RDCA 1S5JA 3LANA 4W5QA 3G10A 3SQ2A 4KHWA 4CEAA 4Y1CA 2ATQA 4GW6A 2Q3SA 3HJFA 1N6QA 3WNGA 2DTUA 1LWEA 4Z4IA 3B6OA 4CHNA 3TAGA 2FBYA 4N47A 1NOYA 1UOCA 5CZ2A 1NK7A 1L3VA 3IAYA 1RBSA 2FBTA 1EKEA 1SV5A 4DFJA 4DTMA 3OYJA 2PYLA 4GMJB 3KIOA 2R7YA 1NK9A 4CCHA 4E19A 2E6LA 4KAZA 3OYBA 4ICLA 1W9HA 3HP9A 3AVGA 1TKDA 4DTJA 1O1WA 2BGGA 4CIGA 4DFKA 1BHLA 4CHYA 4NYFA 3DRSA 2QK9A 3VQDA 4DMNA 3V9SA 3HO1A 3DLEA 4N5SA 1TL3A 3AVNA 4KHUA 4E7IA 3I0RA 4LSLA 4F3TA 1JLAA 2G8WA 1B9FA 1CZBA 3QINA 2IOCA 3HSTB 4KREA 5CY4A 4LH5A 3SV4A 1ASVA 1EP4A 3IRXA 3IS9A 3NH2A 4F4KA 1BI4B 3OJUA 3KKSA 1A5VA 5HRRA 1NK0A 1BGXT 2D0CA 3PO5A 2QKKA 2IDOA 1FKOA 4LSNA 2X6SA 4EZ9A 2YNFA 4CGGA 4RW7A 3VN5A 1DTQA 1I3AA 4CFBA 3PX0A 2XY6A 4KO0A 1TK0A 1BISA 1C1BA 1RILA 4CF9A 4FJMA 2HNYA 4FJ9A 3MEDA 3ZT0A 1SL1A 1QSLA 4XIUA 1YTUA 3VQCA 4E7KA 3D0PA 3MAQA 1L5UA 1BIZA 4E0DA 2FC0A 2KTQA 4M3WA 1ZYQA 4BDPA 2IC3A 1NJXA 4DFMA 3CYMA 3LAKA 3VQQA 3L2QA 4DQPA 3RTVA 3KLIA 4CFDA 4B9VA 2HHXA 4M45A 3TWHA 1BCOA 2D0AA 4FM2A 2B6AA 2QKBA 1RDDA 2VG5A 3V9XA 4DU3A 3QLHA 4W5NA 1KVBA 3P5JA 1QTMA 2Z1IA 3VQ7A 2RN2A 3L3UA 4JRPA 1RT7A 3DOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F73 A;  5KGW A;  1LAV A;  2F96 A;  2JGU A;  2XO7 A;  3TAP A;  1MU2 A;  2Z1J A;  3AO3 A;  3SUQ A;  5SWM A;  2W42 A;  4RW4 A;  4HHT A;  3RR8 A;  4CJE A;  1C0M A;  4ID1 A;  4ZTF A;  1NK5 A;  4IFY A;  3CFR A;  2Y1I A;  3S3O A;  5FRM A;  1QQC A;  4OKE A;  4DU4 A;  1BI4 A;  3I0S A;  5J2N A;  3PY8 A;  4RG8 A;  4CHO A;  3BDP A;  1NK8 A;  4IG3 A;  3O4Q A;  4DG1 A;  3QER A;  1CZ9 A;  3K5M A;  3K59 A;  3NH1 A;  4J2A A;  4N41 A;  3QET A;  4O5B A;  3MXI A;  4KB1 A;  3QES A;  3L2V A;  5KI6 A;  1KLM A;  5E41 A;  3SUO A;  2NUB A;  1SKS A;  1XI1 A;  3DLK A;  3CM5 A;  3MEC A;  4FW1 A;  4CEE A;  1ZBI A;  1X1P A;  2G8K A;  1WSG A;  1KCF A;  3HVT A;  1RT3 A;  4BE1 A;  1KSP A;  1VRU A;  4CJ4 A;  1KVA A;  3T3F A;  4K8Z A;  3FFI A;  3ITH A;  1RCH A;  5HRO A;  2G8V A;  1IH7 A;  4OPJ A;  3S3M A;  4C8L A;  3LZJ A;  1EXQ A;  3S9H A;  4OVL A;  1TAU A;  3ZSQ A;  1TL1 A;  3MXM A;  1Q9Y A;  2ZQB A;  2VWK A;  2DY4 A;  5KRS A;  3PO4 A;  3QIO A;  3K5L A;  3NH0 A;  2BE2 A;  1ASU A;  3AO5 A;  3VQ4 A;  3OYD A;  2X78 A;  4LH4 A;  4H4O A;  4AHV A;  3AVF A;  1JL1 A;  4J2E A;  3LP0 A;  4PY5 A;  1S1T A;  1C0U A;  1QE1 A;  3L2R A;  1KTQ A;  2X74 A;  3LDS A;  4CES A;  3AVB A;  1Z25 A;  4KTW A;  3ZCM A;  4CJV A;  4DLG A;  1ZBF A;  1C1A A;  1XHX A;  3QNO A;  1ASW A;  3RMC A;  1SKR A;  2P5O A;  2Y1J A;  3O3H A;  4JS4 A;  1T8E A;  1IKW A;  3NE6 A;  3CFO A;  4I2P A;  5CZ1 A;  4FJH A;  3OYI A;  3O3F A;  1HYS A;  4CEQ A;  4UQG A;  4C8M A;  4AHR A;  3D45 A;  4Z0U A;  3HP6 A;  4AHU A;  1IKV A;  3ZSY A;  4W5R A;  5J2Q A;  3SJJ A;  4O0J A;  4BWJ A;  2G8F A;  1RT1 A;  4B9N A;  2YHA A;  3KJV A;  1LW2 A;  1TKT A;  1W0H A;  4CGD A;  5HRN A;  5KRT A;  4BDZ A;  4CJW A;  3ULD A;  5I42 A;  4B08 A;  4ELT A;  3ZT4 A;  4C8K A;  2O4I A;  1HNV A;  3OY9 A;  2HHU A;  1CXQ A;  4AH9 A;  4FJN A;  4M3T A;  5FRN A;  3PUF A;  3P1G A;  1UA1 A;  1RBR A;  4NCA A;  3KLE A;  1FK9 A;  4CJL A;  4M3Y A;  1VK0 A;  4B8C A;  1TK5 A;  4CJT A;  2IGI A;  3LWL A;  2E6M A;  3KD5 E;  3DLR A;  2HND A;  4DTS A;  3EYZ A;  4F2R A;  4EP5 A;  3OYH A;  3SZ2 A;  1Y97 A;  2G8H A;  1HQE A;  1Z26 A;  4E1N A;  3LPT A;  2GUI A;  3TR8 A;  4CFC A;  4DSL A;  4FCY A;  4KHS A;  1X9M A;  1F21 A;  1JXB A;  2YKN A;  4B9T A;  4CF1 A;  4ZHR A;  4RW9 A;  1LV5 A;  5JS1 A;  4CGH A;  1RTI A;  4FK2 A;  1GOC A;  4NCG A;  4DTO A;  4C8O A;  5KGX A;  1ZBU A;  4OLB A;  2F8T A;  3V9U A;  1J53 A;  3OJS A;  1XWL A;  2HHW A;  3NAE A;  4BE0 A;  4FLV A;  3DLG A;  4L8R B;  4KPY A;  1UA0 A;  1S1X A;  1RNH A;  3MEE A;  2JLE A;  3V9Z A;  1L3T A;  4OPK A;  1D9D A;  1SUQ A;  4H8K A;  3K5O A;  1DLO A;  4FLW A;  2YNI A;  3DM2 A;  1IKX A;  3THV A;  5JS2 A;  2WOM A;  1HJR A;  3DLB A;  3CG7 A;  4CJ5 A;  5K14 A;  1KRP A;  5CYM A;  1T7P A;  4M3Z A;  4FJJ A;  2DFH A;  4DWI A;  4KHY A;  3DOL A;  1VSM A;  2OZS A;  2VWJ A;  2QXF A;  1UWB A;  1RBU A;  2I5J A;  1VSJ A;  2RKI A;  3KK3 A;  2FBX A;  3OYF A;  3S3N A;  1YVU A;  3HXM A;  4CK1 A;  3T19 A;  3HPO A;  3HM9 A;  4OKK A;  1S1U A;  3QEP A;  3CM6 A;  5J1E A;  1EET A;  1NK4 A;  3AVA A;  4PUO A;  3AO1 A;  2F8S A;  4FJL A;  4Y1D A;  4FLU A;  4DLE A;  4KTQ A;  2RPI A;  3T1A A;  4DQR A;  4YNQ A;  3KK1 A;  1JLQ A;  3OYN A;  3AA3 A;  5HLF A;  4FW2 A;  1HMV A;  2XRI A;  1WAF A;  4FLZ A;  4DTX A;  4HTU A;  3BGR A;  1K6Y A;  4DTP A;  4RW8 A;  1JLF A;  4NYN A;  4BWM A;  3OS1 A;  1S1W A;  3AVC A;  3LAM A;  4DTN A;  1NKC A;  3M8R A;  4KKO A;  1J54 A;  1WSJ A;  1WN7 A;  3IG1 A;  3PX4 A;  3RR7 A;  2OPQ A;  3HPG A;  3NF9 A;  3NF6 A;  4B9U A;  3RMB A;  4CFA A;  3HL8 A;  3PX6 A;  1JLB A;  2YNG A;  4IFV A;  1KVC A;  4F8R A;  4CE9 A;  1RTJ A;  1RDA A;  2KFN A;  2XY7 A;  4CIE A;  3QEI A;  1R0A A;  1J9A A;  1VSL A;  1DTT A;  3ISN C;  3TAM A;  2ZE2 A;  1QHT A;  4FLY A;  1NJZ A;  2D5R A;  4DU1 A;  3AVK A;  5CYQ A;  3V1Q A;  5HRP A;  4YFU A;  1C0T A;  1C6V A;  2X6N A;  4IG0 A;  4ZTJ A;  2Z1H A;  4TSX A;  1B9D A;  3OYM A;  3ZSW A;  4DF4 A;  3V4I A;  5HP1 A;  2OYQ A;  1GOB A;  4DSE A;  1SL0 A;  4J2B A;  1YTA A;  3B6P A;  4KFB A;  2EHG A;  1L3S A;  3L8B A;  2PY5 A;  3DRR A;  2HHS A;  3ZT2 A;  1RTH A;  3RMD A;  3ASM A;  1ZBL A;  4HCC A;  3KLG A;  4DQI A;  1EX4 A;  1VRT A;  3QEV A;  3OS0 A;  3LPU A;  4CF8 A;  1X9S A;  3LP3 A;  1WNS A;  4F3O A;  4FZX C;  3QEX A;  1U4B A;  2YV0 X;  3NGZ A;  4KHQ A;  4W5O A;  3QNN A;  3RRH A;  2LSN A;  4CED A;  2KZZ A;  3A2F A;  4E3S A;  3E01 A;  4B3O A;  3DYA A;  1FKP A;  3LWM A;  5D3G A;  3NF7 A;  4IDK A;  2P5G A;  2HMI A;  4FJG A;  4M42 A;  4AHS A;  3O4N A;  1BCM A;  4M3U A;  1TGO A;  2WON A;  3EZ5 A;  1NJY A;  4Z4C A;  3HT3 A;  5I3U A;  1RBT A;  4CEF A;  2ETJ A;  4CJ3 A;  3OYL A;  3NF8 A;  3I8D A;  3V9W A;  4B9S A;  1JLC A;  4O4G A;  3VQ8 A;  3ZSR A;  3KK2 A;  4DF8 A;  4M41 A;  2A1R A;  4KB0 A;  1REV A;  5KTQ A;  3KLF A;  3NCI A;  1RDB A;  1QSY A;  4DSF A;  4DTR A;  3MXJ A;  5HRS A;  4B9L A;  2BDP A;  5J2P A;  1JL2 A;  1I39 A;  4GVM A;  4CGI A;  4B9M A;  2G8I A;  4KRF A;  1RT6 A;  3NFA A;  4E7J A;  3VQ5 A;  4HVJ A;  5SZT A;  4OKJ A;  3O3G A;  1JXE A;  4CJS A;  3LZI A;  3DLH A;  1S9E A;  4CER A;  1Q9X A;  1D9F A;  2KFZ A;  1RTD A;  5DMR A;  3MEG A;  3P83 D;  4FZY A;  4Q0B A;  2ZD1 A;  4ELV A;  1S6Q A;  1LWF A;  4FJ8 A;  4FJX A;  5FDL A;  2D0B A;  4HUF A;  4HUG A;  5C24 A;  2YKM A;  4N56 A;  3K57 A;  3M8S A;  4DQS A;  1SKW A;  3KD1 E;  1N5Y A;  4FZZ A;  1T03 A;  1RT2 A;  4Z4F A;  3L3V A;  3SQ1 A;  3KLH A;  1U49 A;  4Z4E A;  3SPY A;  2HVI A;  1NKB A;  3U3Y A;  2PYJ A;  4DS4 A;  4PWD A;  1IKY A;  3SV3 A;  5EU7 A;  4C8N A;  3NGY A;  3DMJ A;  3DRP A;  4FJ5 A;  4E1M A;  2P1J A;  4CK3 A;  3OYK A;  3V81 A;  4CF2 A;  2HB5 A;  3NHG A;  2Z1G A;  1TKZ A;  3RRG A;  1CXU A;  3AO2 A;  3RMA A;  3VQA A;  3ZSO A;  1S6P A;  4AHC A;  4BAC A;  4CHQ A;  4O0I A;  3OYA A;  3ZT1 A;  4WE1 A;  2VG6 A;  1HYZ A;  1KFD A;  2YNH A;  4RW6 A;  1KFS A;  4QCL A;  5HBM A;  3SQ0 A;  3SNN A;  3TAE A;  1HNI A;  1XC9 A;  1WLJ A;  2IAJ A;  2GV9 A;  2OPS A;  3EY1 A;  3V1O A;  3KKR A;  3V1R A;  2XY5 A;  2OPP A;  3SQ4 A;  1D8Y A;  1U45 A;  1U04 A;  4KI6 A;  2YHB A;  3SYZ A;  3HPH A;  5T7B A;  3M8Q A;  3AV9 A;  1WSH A;  4CK2 A;  4BE2 A;  4CJK A;  3M8P A;  4CJR A;  4DSJ A;  4Z4G A;  5DK5 A;  4FXD A;  3SI6 A;  2FBV A;  1JLE A;  3QIP A;  4OGE A;  3WNH A;  3TI0 A;  4FLX A;  1CLQ A;  3JYT A;  2XY8 A;  2KW4 A;  2HNZ A;  4Q5V A;  4E89 A;  1RT5 A;  1BQM A;  4I2Q A;  3DI6 A;  4MFB A;  4NCB A;  3ALY A;  2HW3 A;  2HHQ A;  4AHT A;  3WNE A;  4CGF A;  3NDK A;  4N76 A;  2IS3 A;  4KI4 A;  4DFP A;  1G15 A;  1HPZ A;  1VSK A;  4IBN A;  4CJF A;  3L2W A;  3VQE A;  2B4J A;  3K5N A;  1JLG A;  4FK4 A;  3AVJ A;  3LAL A;  4JLH A;  3OYG A;  3AVL A;  4EZ6 A;  3OYC A;  4QAG A;  2OPR A;  3U3G A;  3VQB A;  3ZSV A;  4CHZ A;  4R5P A;  4DSI A;  3AVI A;  3NBP A;  3LP2 A;  4I9Q A;  1X9W A;  3AO4 A;  3TAN A;  4OLA A;  1WSF A;  3C94 A;  2DFE A;  4O55 A;  1TV6 A;  3TAB A;  4DSK A;  3TAR A;  4E7L A;  1S1V A;  1QSS A;  4ID5 A;  3NGI A;  4B8A B;  1A5X A;  1WSE A;  4DTU A;  1BL3 A;  4FJI A;  1TK8 A;  1IO2 A;  4CJQ A;  2HHV A;  3C6T A;  3WNF A;  4FLT A;  4AIL C;  1HQU A;  1XHZ A;  4FJK A;  4LD0 A;  1RT4 A;  3AVH A;  1NJW A;  3CQ8 A;  1SL2 A;  4KTZ A;  2HHT A;  1RBV A;  3AA2 A;  3HK2 A;  4DS5 A;  3KTQ A;  4I7F A;  3HYF A;  3G0Z A;  1UAX A;  4MQ3 A;  4JRQ A;  4OJR A;  4KV8 A;  4M3R A;  3F9K A;  3K2P A;  1KLN A;  1TKX A;  4CF0 A;  1D5A A;  4PA1 A;  4F2S A;  3VQP A;  4HUE A;  4CJP A;  2OZM A;  1U48 A;  1Q8I A;  4CEB A;  4Z4H A;  3RWU A;  4QOZ B;  2P51 A;  3AVM A;  3HVR A;  4J2D A;  2HVH A;  3OS2 A;  2G8U A;  1ZBH A;  2RF2 A;  1WSI A;  1ITG A;  2E4L A;  3VA0 A;  4FM1 A;  4IKF A;  4KHN A;  4CJU A;  2GBZ A;  1QS4 A;  1BQN A;  3VQ6 A;  5C42 A;  1BIU A;  1NOZ A;  3CFP A;  2KQ2 A;  2AJQ A;  1HYV A;  3SPZ A;  4K8X A;  3UIQ A;  4BDY A;  4CHP A;  3V6D A;  1TVR A;  1LWC A;  3ZSX A;  3ZSZ A;  4E7H A;  4FM0 A;  4O44 A;  2EX3 A;  2VG7 A;  4CEZ A;  1LW0 A;  2DFF A;  3ZT3 A;  3VA3 A;  3SUN A;  2B5J A;  4ELU A;  3U6F A;  3AA5 X;  1VSI A;  3K58 A;  3LP1 A;  3TAF A;  3AA4 A;  3OVN A;  1A5W A;  1S9G A;  4I9L A;  3SCX A;  3H08 A;  4CEO A;  2A1S A;  4FYD A;  4H4M A;  2PZS A;  1VSE A;  1L3U A;  1NKE A;  3VQ9 A;  1TAQ A;  1NK6 A;  4HCB A;  4G1Q A;  3C95 A;  3QO9 A;  4FVM A;  4W5T A;  1LAW A;  4OGC A;  3JSM A;  4JS5 A;  3QEW A;  3SUP A;  3TAQ A;  4FJ7 A;  5FRO A;  4CEC A;  1FXX A;  1WAJ A;  3C6U A;  4CGJ A;  1IG9 A;  3OYE A;  4PQU A;  1YT3 A;  4FK0 A;  4LY7 A;  1VSH A;  1C1C A;  1VSD A;  2OA8 A;  4EP4 A;  5J2M A;  1U47 A;  4CIF A;  1T05 A;  2KZM A;  4DQQ A;  4M3X A;  1B92 A;  2BAN A;  1VSF A;  2O4G A;  1GOA A;  1J5O A;  3PV8 A;  2ITG A;  5C25 A;  1HRH A;  3L2U A;  1JKH A;  2XHB A;  1RDC A;  1S5J A;  3LAN A;  4W5Q A;  3G10 A;  3SQ2 A;  4KHW A;  4CEA A;  4Y1C A;  2ATQ A;  4GW6 A;  2Q3S A;  3HJF A;  1N6Q A;  3WNG A;  2DTU A;  1LWE A;  4Z4I A;  3B6O A;  4CHN A;  3TAG A;  2FBY A;  4N47 A;  1NOY A;  1UOC A;  5CZ2 A;  1NK7 A;  1L3V A;  3IAY A;  1RBS A;  2FBT A;  1EKE A;  1SV5 A;  4DFJ A;  4DTM A;  3OYJ A;  2PYL A;  4GMJ B;  3KIO A;  2R7Y A;  1NK9 A;  4CCH A;  4E19 A;  2E6L A;  4KAZ A;  3OYB A;  4ICL A;  1W9H A;  3HP9 A;  3AVG A;  1TKD A;  4DTJ A;  1O1W A;  2BGG A;  4CIG A;  4DFK A;  1BHL A;  4CHY A;  4NYF A;  3DRS A;  2QK9 A;  3VQD A;  4DMN A;  3V9S A;  3HO1 A;  3DLE A;  4N5S A;  1TL3 A;  3AVN A;  4KHU A;  4E7I A;  3I0R A;  4LSL A;  4F3T A;  1JLA A;  2G8W A;  1B9F A;  1CZB A;  3QIN A;  2IOC A;  3HST B;  4KRE A;  5CY4 A;  4LH5 A;  3SV4 A;  1ASV A;  1EP4 A;  3IRX A;  3IS9 A;  3NH2 A;  4F4K A;  1BI4 B;  3OJU A;  3KKS A;  1A5V A;  5HRR A;  1NK0 A;  1BGX T;  2D0C A;  3PO5 A;  2QKK A;  2IDO A;  1FKO A;  4LSN A;  2X6S A;  4EZ9 A;  2YNF A;  4CGG A;  4RW7 A;  3VN5 A;  1DTQ A;  1I3A A;  4CFB A;  3PX0 A;  2XY6 A;  4KO0 A;  1TK0 A;  1BIS A;  1C1B A;  1RIL A;  4CF9 A;  4FJM A;  2HNY A;  4FJ9 A;  3MED A;  3ZT0 A;  1SL1 A;  1QSL A;  4XIU A;  1YTU A;  3VQC A;  4E7K A;  3D0P A;  3MAQ A;  1L5U A;  1BIZ A;  4E0D A;  2FC0 A;  2KTQ A;  4M3W A;  1ZYQ A;  4BDP A;  2IC3 A;  1NJX A;  4DFM A;  3CYM A;  3LAK A;  3VQQ A;  3L2Q A;  4DQP A;  3RTV A;  3KLI A;  4CFD A;  4B9V A;  2HHX A;  4M45 A;  3TWH A;  1BCO A;  2D0A A;  4FM2 A;  2B6A A;  2QKB A;  1RDD A;  2VG5 A;  3V9X A;  4DU3 A;  3QLH A;  4W5N A;  1KVB A;  3P5J A;  1QTM A;  2Z1I A;  3VQ7 A;  2RN2 A;  3L3U A;  4JRP A;  1RT7 A;  3DOK A; 
#chains in the Genus database with same CATH topology
 1LAV A;  2F96 A;  2HF3 A;  5GAH P;  3OBY A;  3AO3 A;  3WXJ A;  2QTD A;  2W42 A;  3SUQ A;  3RR8 A;  3T1H K;  2IVN A;  3O1W A;  1LCU A;  3O8M A;  1QQC A;  4OKE A;  1BI4 A;  3BDP A;  3O4Q A;  5BN8 A;  4J2A A;  1J6Z A;  1YVN A;  4H0X B;  2O8E A;  4CEE A;  3MEC A;  3EZW A;  2QW9 A;  1WSG A;  4BE1 A;  2HF4 A;  3ENO A;  1KVA A;  5HRO A;  3O6W A;  3LZJ A;  1TAU A;  4MLH A;  1Q86 O;  1M1K O;  2YJF A;  3PO4 A;  3NH0 A;  3AO5 A;  3OYD A;  3QIC A;  1W2B M;  2Q0R A;  1C0U A;  1QE1 A;  4CES A;  3ZEU B;  3TTD A;  4BR0 A;  1C1A A;  1TYQ B;  3FZK A;  3J81 O;  3QNO A;  2P5O A;  2Q2R A;  4A59 A;  1T8E A;  4FPA A;  1NGE A;  4CEQ A;  4UQG A;  4DUY K;  3SJJ A;  4B9N A;  3KJV A;  5BPN A;  2Q0U A;  4B1Y B;  5KRT A;  1W0H A;  4C8K A;  1CXQ A;  4AH9 A;  4CZG A;  3PUF A;  2ZJP L;  4NCA A;  4DUZ K;  5AZJ B;  1XC3 A;  2IGI A;  3VEV A;  1SAZ A;  3KD5 E;  5C2D A;  4EP5 A;  2G8H A;  1N32 K;  2W6L A;  4FCY A;  2YI1 A;  5GAD P;  1JXB A;  4B9T A;  4BRI A;  4RW9 A;  4CGH A;  4FK2 A;  1GOC A;  4DTO A;  5KGX A;  1ZBU A;  4FWK A;  3V9U A;  3R1X A;  3ZLJ A;  3ZEU A;  1VQN N;  5AFU A;  3SAF A;  4KPY A;  1UA0 A;  1S1X A;  1TYQ A;  1RNH A;  4H5V A;  3V9Z A;  1DLO A;  4FLW A;  3THV A;  1IKX A;  4IO8 A;  4B1V A;  2WOM A;  3CG7 A;  5BRH A;  1T7P A;  4FJJ A;  1N36 K;  4DWI A;  3DOL A;  2FSK A;  4IFE A;  1VSJ A;  2RKI A;  4OX9 K;  1YIJ N;  3HTV A;  4CK1 A;  5AZJ A;  4H0P A;  1ZC6 A;  5EOY A;  5J1E A;  2F8S A;  3AO1 A;  2YHW A;  4BC3 A;  3IUC A;  5E26 A;  4YNQ A;  3BEX A;  1BDG A;  5HLF A;  2JWK A;  2CGJ A;  3CCR N;  1GLB G;  4LF8 K;  4RW8 A;  2D1K A;  4RWT A;  3AVC A;  3L6Q A;  4KKO A;  1WB9 A;  1WN7 A;  1QZ6 A;  3IG1 A;  4F3T A;  3HPG A;  3NF9 A;  3MWP A;  3PX6 A;  3HL8 A;  2YNG A;  2HST A;  4F8R A;  4K43 A;  4FWS A;  1T44 A;  3JS6 A;  1R0A A;  3ISN C;  3CJA A;  2ZE2 A;  5CYQ A;  2YHX A;  4CZK A;  4A2A A;  4PL8 A;  1C0T A;  4BRE A;  4IJA A;  5HP1 A;  4DF4 A;  5AQV A;  2WC9 A;  3M1F A;  2PY5 A;  2VGN A;  2VQE K;  3ASM A;  1I94 K;  4F3O A;  4FZX C;  3QEX A;  1U4B A;  3NGZ A;  3U8X A;  3U9Z A;  3H1V X;  3W0L A;  4KHP K;  1FKP A;  4BRQ A;  4M42 A;  4M3U A;  3FR0 A;  5LJV A;  2ZJR L;  4B9S A;  1NMD A;  1MWM A;  4AM6 A;  4B9L A;  2BDP A;  4CGI A;  2G8I A;  1NGI A;  2QWO A;  4GV3 A;  4CZJ A;  4OKJ A;  1JXE A;  4CER A;  4GV6 A;  1K8A O;  3L4I A;  1RGI A;  1YAG A;  3CC4 N;  3P83 D;  4LC9 B;  3ZET A;  4ELV A;  2D0B A;  4HUG A;  3IDH A;  4A5A A;  4BRA A;  4PL7 A;  1YXQ A;  4DV5 K;  3Q7C A;  1NKB A;  1HPM A;  4IZ9 A;  4PWD A;  5M1K A;  3NGY A;  3DMJ A;  3DRP A;  1W97 L;  2P1J A;  4CK3 A;  4JI3 K;  2HB5 A;  4KH6 A;  3T1Y K;  3RRG A;  3RMA A;  1DEJ A;  4CHQ A;  3ZT1 A;  4WE1 A;  1Q18 A;  3VF6 A;  3W3D A;  3PIP L;  1V4S A;  1HNI A;  3AAR A;  1WLJ A;  2OPS A;  4XH1 A;  2XY5 A;  3SQ4 A;  1C0G A;  5AQI A;  4PHT X;  2QA4 N;  2QEX N;  3HPH A;  3C7N B;  1NGH A;  3VEZ A;  3SI6 A;  3QFP A;  1T6C A;  4JKD A;  4FOI A;  4E89 A;  1RT5 A;  5IWA K;  1QZ5 A;  3CJB A;  3J8A A;  2HBK A;  3WNE A;  3NDK A;  1G15 A;  2OTL N;  4A62 A;  3K5N A;  5MLC Q;  4A61 A;  4OO1 J;  3LAL A;  4EZ6 A;  2VCP A;  1DGK N;  1J5E K;  3VQB A;  3ZSV A;  4CHZ A;  3NBP A;  4I9Q A;  4OLA A;  3CME N;  5TKW A;  5GAG P;  3DAW A;  1S1V A;  4EIA A;  1TK8 A;  3JAM O;  2I7N A;  3A0I X;  4LD0 A;  1HKC A;  3AVH A;  3CQ8 A;  1SL2 A;  2HHT A;  1RBV A;  3C7N A;  3HK2 A;  3HYF A;  3G0Z A;  1KLN A;  4CF0 A;  2GX9 A;  4PA1 A;  1Q7Y O;  3VQP A;  4HUE A;  4CJP A;  3RWU A;  2P51 A;  4J2D A;  3J7Y P;  4BY9 C;  3VA0 A;  2GBZ A;  1BIU A;  1NWK A;  1BU6 O;  2AJQ A;  4DV2 K;  1HYV A;  3UIQ A;  4BDY A;  4R79 A;  3ZSZ A;  4DR2 K;  4WCE L;  2EX3 A;  1LW0 A;  4X65 K;  3ZT3 A;  2FF6 A;  2D4W A;  1BA0 A;  3K58 A;  3O1B A;  3OVN A;  3EL2 A;  4JN4 A;  4FWP A;  3EKU A;  3SCX A;  2OCE A;  3MDQ A;  1NKE A;  3VQ9 A;  1NK6 A;  3QEW A;  3FZH A;  3L0Q A;  4JS5 A;  3VEN A;  4C1N K;  4CGJ A;  3QDK A;  4IXC A;  4FWR A;  4X64 K;  2KZM A;  4DQQ A;  4M3X A;  2BAN A;  4B1X B;  1J5O A;  3GDQ A;  1E4F T;  2ITG A;  5C25 A;  3LAN A;  5KPR A;  3AGK A;  4JHD B;  4CD1 A;  4GW6 A;  3CXC M;  3D2E B;  3RVC A;  1N6Q A;  2DTU A;  4CHN A;  2VYP A;  2FBY A;  3K9J A;  4FSV A;  1L3V A;  2YCH A;  1EKE A;  2PYL A;  3KIO A;  3SMP A;  2E6L A;  3SLC A;  3AVG A;  4BC4 A;  4DTJ A;  4CIG A;  2NNW A;  3E66 A;  4BQL A;  4NYF A;  4DMN A;  3HO1 A;  3CCE N;  1WBB A;  4LSL A;  4KRE A;  1B9F A;  1CZB A;  1XUP O;  2O8F A;  4F4K A;  1KXP A;  3C65 A;  4WFB L;  2D0C A;  3PO5 A;  1FKO A;  2X6S A;  2YX6 A;  4RW7 A;  1I3A A;  3DXM B;  4CFB A;  3J7A P;  4PKI A;  4KO0 A;  4YOX A;  2XY6 A;  3P39 A;  1C1B A;  1RIL A;  1FW6 A;  1VQ6 N;  3ZT0 A;  2H3G X;  3D2E A;  3MAQ A;  1L5U A;  3D7E O;  5C0Y A;  3FE1 A;  3UKU A;  2FC0 A;  3KWI A;  1X9J A;  1ZYQ A;  1ILY A;  2A40 A;  1P8Z A;  3L2Q A;  4B1W B;  3MX2 A;  1D4X A;  1XNQ K;  3H1Q A;  4M45 A;  2D0A A;  2B6A A;  3HBT A;  4W5N A;  1KVB A;  1QTM A;  3BP8 A;  3WXL A;  3VQ7 A;  3HOT A;  3L3U A;  2JGU A;  2XO7 A;  1Q81 O;  5M1O A;  4FWO A;  4CJE A;  1NK5 A;  1SQK A;  3OW2 M;  4DU4 A;  5HL7 L;  4A5B A;  4DG1 A;  2QWN A;  3K5M A;  3K59 A;  3FZF A;  2UXB K;  3QET A;  5E41 A;  3DXM A;  3FGU A;  1XI1 A;  2W6K A;  1KSP A;  1KCF A;  5AQT A;  2AA4 A;  1IG8 A;  5M1P A;  2IVP A;  2P9U B;  4K8Z A;  1NGA A;  4C8L A;  1EXQ A;  3S9H A;  1C0F A;  1TL1 A;  2JWL A;  4MO5 A;  1QQN A;  2DY4 A;  5KRS A;  4NXN K;  3VQ4 A;  2X78 A;  4LH4 A;  4H4O A;  5TKY A;  4H03 B;  4J2E A;  1S1T A;  1R59 O;  2X74 A;  2BH1 A;  4CBW A;  1GLA G;  3U4L A;  3RMC A;  1ASW A;  1SKR A;  2Y1J A;  3O3H A;  2P9N A;  4I2P A;  5CZ1 A;  3OYI A;  3O3F A;  4JI1 K;  4JI5 K;  4B3M K;  1JCF A;  1HNZ K;  1TKT A;  5HRN A;  4BDZ A;  1QVG M;  4XEI A;  1U2V B;  2VQF K;  3E9P A;  2P9U A;  4BR2 A;  4B8C A;  4CJT A;  2HOE A;  2E6M A;  3DLR A;  2HND A;  4BC5 A;  3SZ2 A;  3OYH A;  4JKA A;  1HQE A;  1Z26 A;  1YJ9 N;  4LF4 K;  3MX5 A;  1NBW A;  2GUI A;  3TR8 A;  4CFC A;  2J4R A;  4KHS A;  1X9M A;  5LJW A;  4JAX A;  4CF1 A;  4JK8 A;  4FPB A;  1RTI A;  3WQT A;  3R8E A;  3I55 N;  5M1Q A;  4YOV A;  2HHW A;  1YJW N;  1IBK K;  1L3T A;  4FL9 A;  4EFH A;  1D9D A;  1U6Z A;  3H3N O;  3K5O A;  2GEM A;  4MDB A;  1HJR A;  4CJ5 A;  1KRP A;  4M3Z A;  1RBU A;  3VTI A;  2I5J A;  3J80 O;  3KK7 A;  4IOA L;  3SAG A;  3OYF A;  4C23 A;  3P4I A;  5ELZ A;  3HM9 A;  1EET A;  2FLO A;  3FZL A;  3ID8 A;  4Y1D A;  4KTQ A;  4DLE A;  4WYB A;  4DQR A;  3KK1 A;  3R3L A;  1JLQ A;  3O08 A;  1WAF A;  4FLZ A;  4HTU A;  3BGR A;  1K6Y A;  1JLF A;  1VQO N;  1NGB A;  1S1W A;  3O9Q A;  2YHY A;  1WSJ A;  1HNX K;  4OPH A;  3RR7 A;  4EZ9 A;  3HI0 A;  3EE9 A;  4B9U A;  3RMB A;  1KVC A;  5F2R A;  2RHK A;  1RTJ A;  1RDA A;  2XY7 A;  5AZI B;  5GAE P;  3QEI A;  3TSU A;  2E1Y A;  3QBW A;  1J9A A;  3TAM A;  3MCP A;  1QHT A;  2D5R A;  1T6D A;  5HRP A;  3CQY A;  4IG0 A;  2OYQ A;  3V4I A;  4DSE A;  1SL0 A;  3G71 N;  1YTA A;  3T69 A;  3L8B A;  1X3N A;  3DRR A;  4HCC A;  4DQI A;  1VRT A;  4UY8 O;  3QEV A;  2I7P A;  4CF8 A;  3LP3 A;  1WNS A;  2YV0 X;  1OH6 A;  2LSN A;  3A2F A;  4L3Q A;  3E1Y A;  1SZ2 A;  4B3O A;  4FWL A;  5D3G A;  2ZWH A;  3HT3 A;  3CCL N;  5I3U A;  3HZ6 A;  4CJ3 A;  3NF8 A;  1JLC A;  2A1R A;  4KB0 A;  1ZXO A;  5AZI A;  2KKZ A;  4DV7 K;  1QSY A;  4DSF A;  4DTR A;  1QQM A;  3MXJ A;  4BRK A;  5E84 A;  4EAH D;  2ASP A;  5J2P A;  1RT6 A;  3NFA A;  5AQH A;  3VPZ A;  2HMP A;  5SZT A;  3LZI A;  2KFZ A;  1D9F A;  1RTD A;  1HLU A;  5BPL A;  1WOQ A;  5AQK A;  4BG9 A;  3F9M A;  4N56 A;  1SKW A;  4DQS A;  5CHI A;  4BGA A;  3KD1 E;  2ASO A;  3I33 A;  4BQZ A;  3VER A;  3AAP A;  3SPY A;  3P31 A;  5FLX O;  3U3Y A;  3N4Q A;  4DS4 A;  3R9P A;  4C8N A;  3CCU N;  3F5T A;  3GOI A;  5I9E B;  1KAY A;  3V81 A;  2Z1G A;  1NNE A;  3VQA A;  4AHC A;  2VGM A;  4ILH A;  1KFD A;  3R6M A;  3SQ0 A;  2WFB A;  2OPP A;  1U45 A;  1GLJ O;  3SYZ A;  5T7B A;  3M8P A;  1H1V A;  5DK5 A;  1JLE A;  3WT0 A;  2FSJ A;  4OGE A;  3F2K A;  3WNH A;  2E5L K;  3MMV A;  2HNZ A;  1OH8 A;  4CZH A;  1BQM A;  4H0V B;  3DI6 A;  4I2Q A;  4MFB A;  4NCB A;  2HHQ A;  4N76 A;  4KI4 A;  4DFP A;  3L2W A;  4IBN A;  1JLG A;  4FK4 A;  3IMX A;  2OPR A;  4LFB K;  4DSI A;  3AVI A;  1X9W A;  1WSF A;  3C94 A;  3ID6 A;  3B8A X;  5AQJ A;  3BF1 A;  3QBX A;  3TAB A;  4ILG B;  5EXW A;  3TAR A;  4E7L A;  5BPM A;  1QSS A;  4DTU A;  1WSE A;  1BL3 A;  3BZC A;  2HHV A;  3WNF A;  4FJK A;  3KWG A;  1NJW A;  3A5O C;  3DJC A;  1S72 N;  5JLH A;  4JRQ A;  4OJR A;  3VEY A;  5AQZ A;  3K2P A;  4F2S A;  1HKB A;  3VF2 A;  2V51 B;  2NRV A;  4K41 A;  2OZM A;  1U48 A;  5FPE A;  3KZB A;  3AVM A;  1BUP A;  3HVR A;  3CPW M;  5EVZ A;  2G8U A;  3TU5 A;  2HBM A;  1ITG A;  4JV5 K;  4FM1 A;  4H5T A;  3PSI A;  1NOZ A;  3CFP A;  4BC2 A;  3ZSX A;  4E7H A;  4FM0 A;  4NLB A;  2DFF A;  3VA3 A;  3SUN A;  4JD2 B;  1GLD G;  4ELU A;  3VET A;  2ITM A;  3U6F A;  1VSI A;  3TAF A;  4F9O A;  3AA4 A;  4I9L A;  4JKH A;  4CEO A;  3MN9 A;  2PZS A;  4O8U A;  2E2O A;  3VOV A;  1E3M A;  1LAW A;  4JKF A;  3JSM A;  4DR6 K;  4CEC A;  1FXX A;  1IG9 A;  2P9S B;  4H0Y B;  1P90 A;  4LY7 A;  5AQR A;  1VSH A;  4CIF A;  4YOT A;  1NGJ A;  1OH7 A;  1GOA A;  5IT9 O;  3PV8 A;  2P9I B;  1JKH A;  3G10 A;  1DT9 A;  4JI4 K;  4E1J A;  1K8K B;  3B6O A;  4M63 C;  1RBS A;  2FBT A;  1SV5 A;  4JD2 A;  4DFJ A;  1NK9 A;  4CCH A;  4QS7 A;  2BUP A;  1NU0 A;  3O4W A;  1Q82 O;  4BR4 A;  1O1W A;  2BGG A;  5JMV A;  4DFK A;  3M3Z A;  2QK9 A;  4KBO A;  3VQD A;  3V9S A;  3QFU A;  2YJE A;  4N5S A;  1GLF O;  4KHU A;  1ESV A;  1JLA A;  2IOC A;  4CZI A;  4WQ4 C;  2P9S A;  1ASV A;  3IRX A;  3NH2 A;  1YIT N;  3C6A A;  3OJU A;  4IDH A;  3EKS A;  4LSN A;  2QKK A;  3JXU A;  3TSP A;  4BVO A;  2P9I A;  1DTQ A;  1TK0 A;  2W40 A;  1BIS A;  3O9R A;  4ISG A;  4CF9 A;  4FJM A;  4XIU A;  4DV4 K;  4KH4 A;  4DFM A;  4B1Z A;  4IEE A;  2PAV A;  3KVG A;  5AQL A;  4ISF A;  4DU3 A;  3THY B;  3ATV A;  2P9P B;  2E1Z A;  3F73 A;  1S3X A;  5KGW A;  5KPT A;  2WBN A;  4GNI A;  1MU2 A;  2Z1J A;  1NLV A;  5SWM A;  4CW7 B;  1OVQ A;  4ID1 A;  4U67 L;  2Y1I A;  3S3O A;  5J2N A;  3CJ9 A;  4MO4 A;  4YOW A;  3THX B;  3PY8 A;  4IG3 A;  3QER A;  5JVG L;  1CZ9 A;  5GIP A;  4N41 A;  4O5B A;  2ZGY A;  1MDU B;  1W7A A;  4KB1 A;  4K25 A;  5KI6 A;  1KLM A;  3WQU A;  4BR9 A;  2NUB A;  3CM5 A;  3MN7 A;  4FW1 A;  3VES A;  3CI5 A;  1X1P A;  1RT3 A;  4LFC K;  1VRU A;  4ISE A;  4CJ4 A;  3H45 C;  3ITH A;  3VGM A;  1RCH A;  2G8V A;  5AQQ A;  3S3M A;  2P9K B;  4JEP A;  2ZQB A;  2NRR A;  5KQ8 A;  2P9P A;  2HBL A;  4AHV A;  3AVF A;  2A6A A;  4YHH K;  1QVF M;  3L2R A;  3CJ7 A;  3NMU A;  1Z25 A;  5FPD A;  1ZBF A;  3THX A;  4JS4 A;  3NE6 A;  3CFO A;  3HRG A;  4FJH A;  3L4Q A;  1HYS A;  4C8M A;  3D45 A;  1IKV A;  3ZSY A;  4W5R A;  5J2Q A;  4O0J A;  2G8F A;  3BZK A;  1LW2 A;  4DQP A;  5I42 A;  2O4I A;  1OKJ A;  2HHU A;  3SBG A;  4FJN A;  5FRN A;  2UXC K;  3P1G A;  4BRL A;  1UA1 A;  1RBR A;  1FK9 A;  1VK0 A;  2IIR A;  2A5X A;  1TK5 A;  4DTS A;  5LMN K;  4BRH A;  4E1N A;  3LPT A;  4FO0 A;  3I8B A;  4NB4 A;  2YKN A;  3O9U A;  4ZHR A;  1LV5 A;  4V19 S;  2QXL A;  4FVU A;  3A5M C;  5JS1 A;  4YOR A;  4NCG A;  2F8T A;  3OJS A;  1XWL A;  2UUC K;  4FLV A;  4L8R B;  3MEE A;  1YJN N;  2JLE A;  3LDP A;  4OPK A;  1EWR A;  2UU9 K;  1SUQ A;  5ADX H;  3OBW A;  4H8K A;  4CI6 A;  1VHX A;  2YNI A;  4JNE A;  5EY4 A;  3CCJ N;  5JS2 A;  3CJ1 A;  3CCV N;  5CYM A;  2CGL A;  2OZS A;  2VWJ A;  1VQL N;  4JHD A;  4LF6 K;  1YHQ N;  3TTF A;  3KK3 A;  1YVU A;  3HXM A;  3T19 A;  4O8K A;  3WXK A;  4PUO A;  4FJL A;  3CJC A;  4FLU A;  4BG8 A;  4BRN A;  1NGG A;  1IJJ A;  4FW2 A;  4NYN A;  3GL1 A;  4BWM A;  3OS1 A;  4DTN A;  3M8R A;  2O8C B;  1WBD A;  3I56 N;  3VEO A;  5C2F A;  3PX4 A;  4K0K K;  3NF6 A;  4JK7 A;  1JLB A;  4IFV A;  4CE9 A;  3AAQ A;  4B3T K;  3FLC O;  3MWT A;  2KFN A;  1SS6 A;  3SBT A;  1HX1 A;  1VSL A;  1DTT A;  3U9D A;  4FLY A;  2E2N A;  4A57 A;  4JI8 K;  2X6N A;  3WXI A;  2ASM A;  4ZTJ A;  4H5N A;  1B9D A;  4TSX A;  5EX5 A;  1GOB A;  4CZM A;  4KFB A;  2HHS A;  2EHG A;  4DV6 K;  5A2Q O;  1ZBL A;  3WUH A;  2A3Z A;  3OS0 A;  1NJI O;  1VQ4 N;  1X9S A;  1M90 O;  1BG3 A;  4CED A;  2KZZ A;  4E3S A;  2FSN A;  4DR1 K;  3CCM N;  4EHT A;  4IDK A;  4AHS A;  1TGO A;  4H0O A;  2O8C A;  1NM1 A;  5DM7 L;  4CEF A;  2ETJ A;  2QWQ A;  3OYL A;  3I8D A;  5CE3 A;  3V9W A;  1KQS M;  4O4G A;  3ZSR A;  4DF8 A;  1REV A;  5KTQ A;  1YUW A;  3NCI A;  3G25 A;  4AM7 A;  3CPE A;  1E4G T;  4KRF A;  1JL2 A;  1X3M A;  2PFU A;  3GBT A;  4B9M A;  3NVK A;  4DKW A;  1OH5 A;  5M1F A;  3O3G A;  4CJS A;  1S9E A;  4YOU A;  1Y64 A;  4CD3 A;  4CZF A;  5DMR A;  4GKK K;  3DLL L;  4FZY A;  4Q0B A;  4FJ8 A;  1S6Q A;  1LWF A;  4FJX A;  5FDL A;  2YKM A;  2ZGZ A;  3K57 A;  3M8S A;  3D2F B;  1N5Y A;  1T03 A;  1RT2 A;  4FWM A;  3KLH A;  4Y0W A;  1U49 A;  3CET A;  3MK6 A;  2PYJ A;  4BRG A;  3BF3 A;  5EU7 A;  4E1M A;  1TKZ A;  2E2P A;  3ZSO A;  4DB3 A;  1TUU A;  1S6P A;  4O0I A;  2VG6 A;  1NG9 A;  2YNH A;  1KFS A;  4CBX A;  5HBM A;  5AQF A;  5KQD A;  3TAE A;  2GV9 A;  3V1O A;  3KKR A;  3V1R A;  4U7B A;  1GLE G;  4KI6 A;  2YHB A;  1U2V A;  3O9T A;  1WSH A;  4NO7 A;  4CJK A;  4FXD A;  2FBV A;  4FWN A;  3TI0 A;  4FLX A;  1CLQ A;  2UUA K;  4JKC A;  3D2F A;  5AQO A;  1JCE A;  3ULE B;  1RT7 A;  4AHT A;  4WFA L;  3CER A;  4CGF A;  2IS3 A;  4JKE A;  1HPZ A;  1VSK A;  4EHU A;  3VQE A;  2B4J A;  3CHW A;  3BUZ B;  3IKM A;  3AVL A;  4CBU A;  1EWQ A;  4R5P A;  4C1N I;  3AO4 A;  3DXK B;  3TAN A;  1YF5 L;  2DFE A;  4CVN E;  4O55 A;  2WTU A;  4DSK A;  2NZT A;  2D0P A;  1V4T A;  3NGI A;  4B8A B;  4CJQ A;  4JI6 K;  1HQU A;  3LL3 A;  4YY3 K;  4PKH A;  1RT4 A;  4YDU A;  4M7Y A;  3SJH A;  4KTZ A;  4FWQ A;  3KTQ A;  4I7F A;  4BRM A;  1UAX A;  1XQS C;  4MQ3 A;  4WQ4 A;  5BRF A;  4KV8 A;  4M3R A;  3IFR A;  3SMS A;  1D5A A;  4JKB A;  3VMF B;  2V7Y A;  4X66 K;  4QOZ B;  4CEB A;  4Z4H A;  1EO1 A;  3ULE A;  3H6E A;  1ZBH A;  2E2Q A;  5GIN A;  4IKF A;  2F4V K;  4CJU A;  2QWM A;  1BQN A;  3VQ6 A;  1G99 A;  4OPA A;  4QS8 A;  3SPZ A;  4K8X A;  4CHP A;  3V6D A;  2QWL A;  1LWC A;  1VQ7 N;  2IVO A;  2E88 A;  2NRH A;  1QQO A;  2B5J A;  2UUB K;  1NGC A;  3DXK A;  4DCH A;  3AA5 X;  1HNW K;  2VWB A;  1A5W A;  4IOX A;  2A1S A;  4B1U B;  1XMO K;  3O9S A;  4FYD A;  1L3U A;  1TAQ A;  4HCB A;  4G1Q A;  3HOS A;  1K9M O;  3C95 A;  4FVM A;  3TAQ A;  4W5T A;  3FZM A;  5AFU H;  2QWP A;  1WAJ A;  3C6U A;  4PQU A;  1LOT B;  4CZL A;  4FK0 A;  1RDW X;  3D6R A;  4EP4 A;  5J2M A;  1T05 A;  1KD1 O;  1VSF A;  2O4G A;  1EQY A;  5BR9 A;  1NGD A;  1S5J A;  3HM8 A;  5AQU A;  4W5Q A;  3CF5 L;  3TPQ A;  4Y1C A;  2Q3S A;  3HJF A;  3WNG A;  3TAG A;  3VEX A;  4WQ5 C;  1NOY A;  5CZ2 A;  1NK7 A;  3CCS N;  4DTM A;  3OYJ A;  4LFA K;  1VQM N;  3OYB A;  1W9H A;  1JJ2 M;  1TKD A;  5C15 A;  5AQW A;  5CR4 A;  4CHY A;  3DLE A;  1Z05 A;  1TL3 A;  4RCH A;  1VQ9 N;  3HST B;  5CY4 A;  3SV4 A;  1JCG A;  1EP4 A;  3IS9 A;  2GTD A;  4NLC A;  5HRR A;  2QWR A;  4BRC A;  1VQK N;  4BGB A;  4BR5 A;  4CGG A;  3VN5 A;  5AQG A;  2F7T A;  2V52 B;  4DHY A;  4IOC L;  2HNY A;  4FJ9 A;  3MED A;  1SL1 A;  1QSL A;  4WF9 L;  3VQC A;  1BIZ A;  3J7Z O;  2KTQ A;  4CZE A;  4BDP A;  1NJX A;  2CGK A;  3CYM A;  5AJ3 K;  3VQQ A;  3RTV A;  3DWL A;  4CFD A;  2A42 A;  3TWH A;  4FM2 A;  4ILJ A;  2VG5 A;  3V9X A;  3UKR B;  3QLH A;  1O13 A;  5LL6 Z;  3CC2 N;  2RN2 A;  4YOY A;  4BRO A;  4DV3 K;  3TAP A;  4HHT A;  4RW4 A;  2Q36 A;  1C0M A;  4ZTF A;  4IFY A;  3CFR A;  4DV1 K;  5FRM A;  3I0S A;  2GUP A;  4RG8 A;  4CHO A;  2ZJQ L;  3PSF A;  1NK8 A;  3TSQ A;  4KH5 A;  4G9Z A;  4JI0 K;  3NH1 A;  3ZYY X;  3OA9 A;  3AGR A;  3MXI A;  3QB0 A;  3HSC A;  3QES A;  3L2V A;  4A2B A;  3THW B;  3SUO A;  3LDL A;  1SKS A;  3QML A;  3DLK A;  1ZBI A;  5AQN A;  2G8K A;  4DR5 K;  3HVT A;  1KAZ A;  2DPN A;  2D0O A;  5GIO A;  3T3F A;  3FFI A;  3O5B A;  3TTC A;  1IH7 A;  3KHY A;  1ATN A;  3ZET B;  4OPJ A;  1XNR K;  4OVL A;  3ZSQ A;  3O80 A;  5AQX A;  5C12 A;  3MXM A;  1Q9Y A;  3CD6 N;  2VWK A;  3G6E N;  3QIO A;  1OVY A;  3UKR A;  3K5L A;  2BE2 A;  1ASU A;  1S22 A;  3K0S A;  5LMU K;  1JL1 A;  3LP0 A;  1XMQ K;  4PY5 A;  1KTQ A;  2FF3 B;  3LDS A;  3AVB A;  4KTW A;  3ZCM A;  4CJV A;  2ZM6 K;  3CCQ N;  4DLG A;  2KHO A;  1XHX A;  1IKW A;  1FJG K;  4AHR A;  3THW A;  4Z0U A;  3HP6 A;  4AHU A;  2NRZ A;  4BWJ A;  1RT1 A;  2YHA A;  4CGD A;  4CJW A;  3ULD A;  4B08 A;  4ELT A;  3ZT4 A;  1HNV A;  3OY9 A;  5JVH L;  4M3T A;  3LM9 A;  4M3Y A;  3KLE A;  4CJL A;  3LWL A;  1TUY A;  3EYZ A;  4F2R A;  1Y97 A;  3E9O A;  4H0T B;  4DSL A;  1F21 A;  2KLA A;  4BVP A;  4YDU C;  4C8O A;  4OLB A;  1J53 A;  3VF4 A;  3NAE A;  4BE0 A;  2A41 A;  3DLG A;  4DR7 K;  4XH4 A;  2UXD K;  1BO5 O;  4QS9 A;  3DM2 A;  4IO9 L;  2Q97 A;  3DLB A;  5K14 A;  2DFH A;  2FXU A;  4KHY A;  1VSM A;  1VAZ A;  4FOE A;  2QXF A;  1UWB A;  2HHH K;  3CC7 N;  4DR3 K;  1K8K A;  1BWF O;  2FBX A;  3NVM A;  3S3N A;  3HPO A;  4OKK A;  1S1U A;  5FPM A;  3CM6 A;  3QEP A;  4X62 K;  1NK4 A;  3AVA A;  2E8A A;  2F9T A;  4BR7 A;  2RPI A;  3T1A A;  3OYN A;  3AA3 A;  1HMV A;  2GEL A;  2XRI A;  2QM1 A;  4DTX A;  4DTP A;  3M6G A;  1QHA A;  3LAM A;  1NKC A;  3EEQ A;  3Q7B A;  4NXM K;  1J54 A;  2CH6 A;  2OPQ A;  4CFA A;  2WUS A;  4MDA A;  4CIE A;  2V7Z A;  1NJZ A;  5AQP A;  3GE1 A;  5C10 A;  4DU1 A;  4LF9 K;  3AVK A;  3V1Q A;  1BOT O;  4YFU A;  1C6V A;  2Z1H A;  3OYM A;  3ZSW A;  3AY9 A;  4J2B A;  3CMA N;  3B6P A;  3UE5 A;  1L3S A;  4O5F A;  3ZT2 A;  1RTH A;  3RMD A;  3KLG A;  1EX4 A;  3LPU A;  4GV9 A;  3M5R A;  4KHQ A;  4W5O A;  3QNN A;  3RRH A;  3T7Z A;  3VGL A;  3EE8 A;  3E01 A;  1RFQ A;  3THY A;  3DYA A;  3LWM A;  4DV0 K;  3NF7 A;  2P5G A;  4FJG A;  2HMI A;  2F9W A;  3O4N A;  1BCM A;  4H5W A;  2WON A;  3EZ5 A;  1NJY A;  4Z4C A;  1RBT A;  1N8R O;  5H1S Q;  4M7X A;  1NGF A;  3VQ8 A;  3KK2 A;  4JK9 A;  4M41 A;  3LDO A;  1KC8 O;  3KLF A;  1RDB A;  5HRS A;  1I39 A;  4GVM A;  4E7J A;  3VQ5 A;  4HVJ A;  3DLH A;  1VQ5 N;  3RSE B;  1Q9X A;  2NRW A;  4GKJ K;  4DR4 K;  2O8F B;  2Q31 A;  3MEG A;  2ZD1 A;  2P9K A;  1WUA A;  4HUF A;  5C24 A;  4FZZ A;  5BRD A;  1N34 K;  3L3V A;  3SQ1 A;  4Z4F A;  4Z4E A;  2HVI A;  5BN9 A;  4MLE A;  3ATU A;  1IKY A;  3SV3 A;  3FFK B;  3UKU B;  4I6M B;  4FJ5 A;  1GLC G;  3OYK A;  4CF2 A;  3NHG A;  4B9Q A;  5DM6 L;  1CXU A;  3AO2 A;  4K42 A;  4BAC A;  3SAH A;  3OYA A;  1HYZ A;  4RW6 A;  4QCL A;  3SNN A;  1XC9 A;  3N4P A;  2IAJ A;  3EY1 A;  1T3V A;  3PLA A;  1D8Y A;  1U04 A;  3RSE A;  3M8Q A;  3AV9 A;  4CK2 A;  4BE2 A;  4CJR A;  4DSJ A;  4XH5 A;  4Z4G A;  3QIP A;  3JYT A;  4BRF A;  2XY8 A;  2KW4 A;  4Q5V A;  2P9L B;  2CH5 A;  3ALY A;  2HW3 A;  4WFN L;  4CJF A;  2BTF A;  3AVJ A;  3C0B A;  3EN9 A;  4JLH A;  4AQY K;  5M1N A;  3OYG A;  3OYC A;  4QAG A;  4I6M A;  3U3G A;  3LP2 A;  4WQ5 A;  3G4S N;  4Z94 A;  5BR8 K;  2W41 A;  1HR0 K;  3CQX A;  1TV6 A;  3ENH A;  3MN5 A;  5JLF A;  4GVE A;  3GG4 A;  1K73 O;  1ZBS A;  4ID5 A;  2Q1N A;  5ADX A;  1A5X A;  4FJI A;  2GWJ A;  1IO2 A;  3WEE B;  3C6T A;  4FLT A;  4AIL C;  1XHZ A;  3LDN A;  4JI7 K;  4CJ7 A;  3H3O B;  3PIO L;  3AA2 A;  1YI2 N;  4DS5 A;  3A8Y A;  5KPZ A;  3F9K A;  1TKX A;  3A5N C;  2P9N B;  1MA9 B;  1Q8I A;  2P9L A;  2HVH A;  3OS2 A;  2RF2 A;  1WSI A;  5AQM A;  2E4L A;  3MCA B;  3ZX2 A;  5F1X A;  1HUX A;  4KHN A;  4DQ8 A;  3S41 A;  1QS4 A;  5C42 A;  3VTH A;  3OHR A;  1HKG A;  3VGK A;  2KQ2 A;  2OAN A;  1BA1 A;  2O8D B;  5HOO A;  1TVR A;  1DKG D;  3UB5 A;  2GWK A;  2NRX A;  4O44 A;  2VG7 A;  4CEZ A;  4JYA K;  2RE2 A;  3OTO K;  3LDQ A;  5B8H A;  3C6H A;  3LP1 A;  5AQS A;  1S9G A;  1VQP N;  3H08 A;  4H4M A;  1VSE A;  2ZF5 O;  2O8B B;  3ZX3 A;  3QO9 A;  2NLX A;  3WEE A;  1HJO A;  4OGC A;  3SUP A;  4FJ7 A;  5FRO A;  3OYE A;  1YT3 A;  1ATS A;  4BRP A;  3ZX0 A;  1C1C A;  1VSD A;  2OA8 A;  1ATR A;  1U47 A;  1NMN A;  4HTL A;  3CIP A;  1B92 A;  1N33 K;  2PBD A;  2EWS A;  1HRH A;  4JKG B;  3L2U A;  2XHB A;  2E20 A;  5AR0 A;  1RDC A;  5FPN A;  1CZA N;  3SQ2 A;  4J8F A;  4KHW A;  5AQY A;  4IEI A;  4CEA A;  4BRD A;  2ATQ A;  3LM2 A;  2O8D A;  1LWE A;  4Z4I A;  3WXM B;  3SK3 A;  4H5R A;  4LF7 K;  5F0X A;  2NRT A;  4N47 A;  1UOC A;  3IAY A;  1RDU A;  3A5L C;  4HWI A;  4JI2 K;  4GMJ B;  2R7Y A;  4E19 A;  4KAZ A;  3EO3 A;  4ICL A;  4IWV A;  3HP9 A;  1GLL O;  3H46 O;  1BHL A;  3MN6 A;  2O8B A;  1KAX A;  3DRS A;  5BRE A;  5LY3 A;  3AVN A;  4E7I A;  3I0R A;  2G8W A;  3QIN A;  1IBL K;  4LH5 A;  2QI2 A;  3VEW A;  1BI4 B;  1VQ8 N;  3KKS A;  1A5V A;  1NK0 A;  1BGX T;  1Z6R A;  2IDO A;  3P38 A;  2YNF A;  4B3R K;  2O8E B;  3PX0 A;  4JKG A;  4GY2 B;  1IBM K;  1IV0 A;  4LF5 K;  4B3S K;  1YTU A;  4AF1 A;  4PKG A;  3D0P A;  4E7K A;  5JIC A;  4E0D A;  4M3W A;  2IC3 A;  3LAK A;  2HBJ A;  2OTJ N;  3ENB A;  3KLI A;  2UYT A;  4B9V A;  2HHX A;  1MWK A;  1BCO A;  2AP1 A;  3BY5 A;  3E9L A;  2QKB A;  1RDD A;  4IJN A;  3P5J A;  2Z1I A;  4RTF D;  4JRP A;  3K9K A;  3DOK A; 
#chains in the Genus database with same CATH homology
 3F73 A;  5KGW A;  1LAV A;  2F96 A;  2JGU A;  2XO7 A;  3TAP A;  1MU2 A;  2Z1J A;  3AO3 A;  3SUQ A;  5SWM A;  2W42 A;  4RW4 A;  4HHT A;  3RR8 A;  4CJE A;  1C0M A;  4ID1 A;  4ZTF A;  1NK5 A;  4IFY A;  3CFR A;  2Y1I A;  3S3O A;  5FRM A;  1QQC A;  4OKE A;  4DU4 A;  1BI4 A;  3I0S A;  5J2N A;  3PY8 A;  4RG8 A;  4CHO A;  3BDP A;  1NK8 A;  4IG3 A;  3O4Q A;  4DG1 A;  3QER A;  1CZ9 A;  3K5M A;  3K59 A;  3NH1 A;  4J2A A;  4N41 A;  3QET A;  4O5B A;  3MXI A;  4KB1 A;  3QES A;  3L2V A;  5KI6 A;  1KLM A;  5E41 A;  3SUO A;  2NUB A;  1SKS A;  1XI1 A;  3DLK A;  3CM5 A;  3MEC A;  4FW1 A;  4CEE A;  1ZBI A;  1X1P A;  2G8K A;  1WSG A;  1KCF A;  3HVT A;  1RT3 A;  4BE1 A;  1KSP A;  1VRU A;  4CJ4 A;  1KVA A;  3T3F A;  4K8Z A;  3FFI A;  3ITH A;  1RCH A;  5HRO A;  2G8V A;  1IH7 A;  4OPJ A;  3S3M A;  4C8L A;  3LZJ A;  1EXQ A;  3S9H A;  4OVL A;  1TAU A;  3ZSQ A;  1TL1 A;  3MXM A;  1Q9Y A;  2ZQB A;  2VWK A;  2DY4 A;  5KRS A;  3PO4 A;  3QIO A;  3K5L A;  3NH0 A;  2BE2 A;  1ASU A;  3AO5 A;  3VQ4 A;  3OYD A;  2X78 A;  4LH4 A;  4H4O A;  4AHV A;  3AVF A;  1JL1 A;  4J2E A;  3LP0 A;  4PY5 A;  1S1T A;  1C0U A;  1QE1 A;  3L2R A;  1KTQ A;  2X74 A;  3LDS A;  4CES A;  3AVB A;  1Z25 A;  4KTW A;  3ZCM A;  4CJV A;  4DLG A;  1ZBF A;  1C1A A;  1XHX A;  3QNO A;  1ASW A;  3RMC A;  1SKR A;  2P5O A;  2Y1J A;  3O3H A;  4JS4 A;  1T8E A;  1IKW A;  3NE6 A;  3CFO A;  4I2P A;  5CZ1 A;  4FJH A;  3OYI A;  3O3F A;  1HYS A;  4CEQ A;  4UQG A;  4C8M A;  4AHR A;  3D45 A;  4Z0U A;  3HP6 A;  4AHU A;  1IKV A;  3ZSY A;  4W5R A;  5J2Q A;  3SJJ A;  4O0J A;  4BWJ A;  2G8F A;  1RT1 A;  4B9N A;  2YHA A;  3KJV A;  1LW2 A;  1TKT A;  1W0H A;  4CGD A;  5HRN A;  5KRT A;  4BDZ A;  4CJW A;  3ULD A;  5I42 A;  4B08 A;  4ELT A;  3ZT4 A;  4C8K A;  2O4I A;  1HNV A;  3OY9 A;  2HHU A;  1CXQ A;  4AH9 A;  4FJN A;  4M3T A;  5FRN A;  3PUF A;  3P1G A;  1UA1 A;  1RBR A;  4NCA A;  3KLE A;  1FK9 A;  4CJL A;  4M3Y A;  1VK0 A;  4B8C A;  1TK5 A;  4CJT A;  2IGI A;  3LWL A;  2E6M A;  3KD5 E;  3DLR A;  2HND A;  4DTS A;  3EYZ A;  4F2R A;  4EP5 A;  3OYH A;  3SZ2 A;  1Y97 A;  2G8H A;  1HQE A;  1Z26 A;  4E1N A;  3LPT A;  2GUI A;  3TR8 A;  4CFC A;  4DSL A;  4FCY A;  4KHS A;  1X9M A;  1F21 A;  1JXB A;  2YKN A;  4B9T A;  4CF1 A;  4ZHR A;  4RW9 A;  1LV5 A;  5JS1 A;  4CGH A;  1RTI A;  4FK2 A;  1GOC A;  4NCG A;  4DTO A;  4C8O A;  5KGX A;  1ZBU A;  4OLB A;  2F8T A;  3V9U A;  1J53 A;  3OJS A;  1XWL A;  2HHW A;  3NAE A;  4BE0 A;  4FLV A;  3DLG A;  4L8R B;  4KPY A;  1UA0 A;  1S1X A;  1RNH A;  3MEE A;  2JLE A;  3V9Z A;  1L3T A;  4OPK A;  1D9D A;  1SUQ A;  4H8K A;  3K5O A;  1DLO A;  4FLW A;  2YNI A;  3DM2 A;  1IKX A;  3THV A;  5JS2 A;  2WOM A;  1HJR A;  3DLB A;  3CG7 A;  4CJ5 A;  5K14 A;  1KRP A;  5CYM A;  1T7P A;  4M3Z A;  4FJJ A;  2DFH A;  4DWI A;  4KHY A;  3DOL A;  1VSM A;  2OZS A;  2VWJ A;  2QXF A;  1UWB A;  1RBU A;  2I5J A;  1VSJ A;  2RKI A;  3KK3 A;  2FBX A;  3OYF A;  3S3N A;  1YVU A;  3HXM A;  4CK1 A;  3T19 A;  3HPO A;  3HM9 A;  4OKK A;  1S1U A;  3QEP A;  3CM6 A;  5J1E A;  1EET A;  1NK4 A;  3AVA A;  4PUO A;  3AO1 A;  2F8S A;  4FJL A;  4Y1D A;  4FLU A;  4DLE A;  4KTQ A;  2RPI A;  3T1A A;  4DQR A;  4YNQ A;  3KK1 A;  1JLQ A;  3OYN A;  3AA3 A;  5HLF A;  4FW2 A;  1HMV A;  2XRI A;  1WAF A;  4FLZ A;  4DTX A;  4HTU A;  3BGR A;  1K6Y A;  4DTP A;  4RW8 A;  1JLF A;  4NYN A;  4BWM A;  3OS1 A;  1S1W A;  3AVC A;  3LAM A;  4DTN A;  1NKC A;  3M8R A;  4KKO A;  1J54 A;  1WSJ A;  1WN7 A;  3IG1 A;  3PX4 A;  3RR7 A;  2OPQ A;  3HPG A;  3NF9 A;  3NF6 A;  4B9U A;  3RMB A;  4CFA A;  3HL8 A;  3PX6 A;  1JLB A;  2YNG A;  4IFV A;  1KVC A;  4F8R A;  4CE9 A;  1RTJ A;  1RDA A;  2KFN A;  2XY7 A;  4CIE A;  3QEI A;  1R0A A;  1J9A A;  1VSL A;  1DTT A;  3ISN C;  3TAM A;  2ZE2 A;  1QHT A;  4FLY A;  1NJZ A;  2D5R A;  4DU1 A;  3AVK A;  5CYQ A;  3V1Q A;  5HRP A;  4YFU A;  1C0T A;  1C6V A;  2X6N A;  4IG0 A;  4ZTJ A;  2Z1H A;  4TSX A;  1B9D A;  3OYM A;  3ZSW A;  4DF4 A;  3V4I A;  5HP1 A;  2OYQ A;  1GOB A;  4DSE A;  1SL0 A;  4J2B A;  1YTA A;  3B6P A;  4KFB A;  2EHG A;  1L3S A;  3L8B A;  2PY5 A;  3DRR A;  2HHS A;  3ZT2 A;  1RTH A;  3RMD A;  3ASM A;  1ZBL A;  4HCC A;  3KLG A;  4DQI A;  1EX4 A;  1VRT A;  3QEV A;  3OS0 A;  3LPU A;  4CF8 A;  1X9S A;  3LP3 A;  1WNS A;  4F3O A;  4FZX C;  3QEX A;  1U4B A;  2YV0 X;  3NGZ A;  4KHQ A;  4W5O A;  3QNN A;  3RRH A;  2LSN A;  4CED A;  2KZZ A;  3A2F A;  4E3S A;  3E01 A;  4B3O A;  3DYA A;  1FKP A;  3LWM A;  5D3G A;  3NF7 A;  4IDK A;  2P5G A;  2HMI A;  4FJG A;  4M42 A;  4AHS A;  3O4N A;  1BCM A;  4M3U A;  1TGO A;  2WON A;  3EZ5 A;  1NJY A;  4Z4C A;  3HT3 A;  5I3U A;  1RBT A;  4CEF A;  2ETJ A;  4CJ3 A;  3OYL A;  3NF8 A;  3I8D A;  3V9W A;  4B9S A;  1JLC A;  4O4G A;  3VQ8 A;  3ZSR A;  3KK2 A;  4DF8 A;  4M41 A;  2A1R A;  4KB0 A;  1REV A;  5KTQ A;  3KLF A;  3NCI A;  1RDB A;  1QSY A;  4DSF A;  4DTR A;  3MXJ A;  5HRS A;  4B9L A;  2BDP A;  5J2P A;  1JL2 A;  1I39 A;  4GVM A;  4CGI A;  4B9M A;  2G8I A;  4KRF A;  1RT6 A;  3NFA A;  4E7J A;  3VQ5 A;  4HVJ A;  5SZT A;  4OKJ A;  3O3G A;  1JXE A;  4CJS A;  3LZI A;  3DLH A;  1S9E A;  4CER A;  1Q9X A;  1D9F A;  2KFZ A;  1RTD A;  5DMR A;  3MEG A;  3P83 D;  4FZY A;  4Q0B A;  2ZD1 A;  4ELV A;  1S6Q A;  1LWF A;  4FJ8 A;  4FJX A;  5FDL A;  2D0B A;  4HUF A;  4HUG A;  5C24 A;  2YKM A;  4N56 A;  3K57 A;  3M8S A;  4DQS A;  1SKW A;  3KD1 E;  1N5Y A;  4FZZ A;  1T03 A;  1RT2 A;  4Z4F A;  3L3V A;  3SQ1 A;  3KLH A;  1U49 A;  4Z4E A;  3SPY A;  2HVI A;  1NKB A;  3U3Y A;  2PYJ A;  4DS4 A;  4PWD A;  1IKY A;  3SV3 A;  5EU7 A;  4C8N A;  3NGY A;  3DMJ A;  3DRP A;  4FJ5 A;  4E1M A;  2P1J A;  4CK3 A;  3OYK A;  3V81 A;  4CF2 A;  2HB5 A;  3NHG A;  2Z1G A;  1TKZ A;  3RRG A;  1CXU A;  3AO2 A;  3RMA A;  3VQA A;  3ZSO A;  1S6P A;  4AHC A;  4BAC A;  4CHQ A;  4O0I A;  3OYA A;  3ZT1 A;  4WE1 A;  2VG6 A;  1HYZ A;  1KFD A;  2YNH A;  4RW6 A;  1KFS A;  4QCL A;  5HBM A;  3SQ0 A;  3SNN A;  3TAE A;  1HNI A;  1XC9 A;  1WLJ A;  2IAJ A;  2GV9 A;  2OPS A;  3EY1 A;  3V1O A;  3KKR A;  3V1R A;  2XY5 A;  2OPP A;  3SQ4 A;  1D8Y A;  1U45 A;  1U04 A;  4KI6 A;  2YHB A;  3SYZ A;  3HPH A;  5T7B A;  3M8Q A;  3AV9 A;  1WSH A;  4CK2 A;  4BE2 A;  4CJK A;  3M8P A;  4CJR A;  4DSJ A;  4Z4G A;  5DK5 A;  4FXD A;  3SI6 A;  2FBV A;  1JLE A;  3QIP A;  4OGE A;  3WNH A;  3TI0 A;  4FLX A;  1CLQ A;  3JYT A;  2XY8 A;  2KW4 A;  2HNZ A;  4Q5V A;  4E89 A;  1RT5 A;  1BQM A;  4I2Q A;  3DI6 A;  4MFB A;  4NCB A;  3ALY A;  2HW3 A;  2HHQ A;  4AHT A;  3WNE A;  4CGF A;  3NDK A;  4N76 A;  2IS3 A;  4KI4 A;  4DFP A;  1G15 A;  1HPZ A;  1VSK A;  4IBN A;  4CJF A;  3L2W A;  3VQE A;  2B4J A;  3K5N A;  1JLG A;  4FK4 A;  3AVJ A;  3LAL A;  4JLH A;  3OYG A;  3AVL A;  4EZ6 A;  3OYC A;  4QAG A;  2OPR A;  3U3G A;  3VQB A;  3ZSV A;  4CHZ A;  4R5P A;  4DSI A;  3AVI A;  3NBP A;  3LP2 A;  4I9Q A;  1X9W A;  3AO4 A;  3TAN A;  4OLA A;  1WSF A;  3C94 A;  2DFE A;  4O55 A;  1TV6 A;  3TAB A;  4DSK A;  3TAR A;  4E7L A;  1S1V A;  1QSS A;  4ID5 A;  3NGI A;  4B8A B;  1A5X A;  1WSE A;  4DTU A;  1BL3 A;  4FJI A;  1TK8 A;  1IO2 A;  4CJQ A;  2HHV A;  3C6T A;  3WNF A;  4FLT A;  4AIL C;  1HQU A;  1XHZ A;  4FJK A;  4LD0 A;  1RT4 A;  3AVH A;  1NJW A;  3CQ8 A;  1SL2 A;  4KTZ A;  2HHT A;  1RBV A;  3AA2 A;  3HK2 A;  4DS5 A;  3KTQ A;  4I7F A;  3HYF A;  3G0Z A;  1UAX A;  4MQ3 A;  4JRQ A;  4OJR A;  4KV8 A;  4M3R A;  3F9K A;  3K2P A;  1KLN A;  1TKX A;  4CF0 A;  1D5A A;  4PA1 A;  4F2S A;  3VQP A;  4HUE A;  4CJP A;  2OZM A;  1U48 A;  1Q8I A;  4CEB A;  4Z4H A;  3RWU A;  4QOZ B;  2P51 A;  3AVM A;  3HVR A;  4J2D A;  2HVH A;  3OS2 A;  2G8U A;  1ZBH A;  2RF2 A;  1WSI A;  1ITG A;  2E4L A;  3VA0 A;  4FM1 A;  4IKF A;  4KHN A;  4CJU A;  2GBZ A;  1QS4 A;  1BQN A;  3VQ6 A;  5C42 A;  1BIU A;  1NOZ A;  3CFP A;  2KQ2 A;  2AJQ A;  1HYV A;  3SPZ A;  4K8X A;  3UIQ A;  4BDY A;  4CHP A;  3V6D A;  1TVR A;  1LWC A;  3ZSX A;  3ZSZ A;  4E7H A;  4FM0 A;  4O44 A;  2EX3 A;  2VG7 A;  4CEZ A;  1LW0 A;  2DFF A;  3ZT3 A;  3VA3 A;  3SUN A;  2B5J A;  4ELU A;  3U6F A;  3AA5 X;  1VSI A;  3K58 A;  3LP1 A;  3TAF A;  3AA4 A;  3OVN A;  1A5W A;  1S9G A;  4I9L A;  3SCX A;  3H08 A;  4CEO A;  2A1S A;  4FYD A;  4H4M A;  2PZS A;  1VSE A;  1L3U A;  1NKE A;  3VQ9 A;  1TAQ A;  1NK6 A;  4HCB A;  4G1Q A;  3C95 A;  3QO9 A;  4FVM A;  4W5T A;  1LAW A;  4OGC A;  3JSM A;  4JS5 A;  3QEW A;  3SUP A;  3TAQ A;  4FJ7 A;  5FRO A;  4CEC A;  1FXX A;  1WAJ A;  3C6U A;  4CGJ A;  1IG9 A;  3OYE A;  4PQU A;  1YT3 A;  4FK0 A;  4LY7 A;  1VSH A;  1C1C A;  1VSD A;  2OA8 A;  4EP4 A;  5J2M A;  1U47 A;  4CIF A;  1T05 A;  2KZM A;  4DQQ A;  4M3X A;  1B92 A;  2BAN A;  1VSF A;  2O4G A;  1GOA A;  1J5O A;  3PV8 A;  2ITG A;  5C25 A;  1HRH A;  3L2U A;  1JKH A;  2XHB A;  1RDC A;  1S5J A;  3LAN A;  4W5Q A;  3G10 A;  3SQ2 A;  4KHW A;  4CEA A;  4Y1C A;  2ATQ A;  4GW6 A;  2Q3S A;  3HJF A;  1N6Q A;  3WNG A;  2DTU A;  1LWE A;  4Z4I A;  3B6O A;  4CHN A;  3TAG A;  2FBY A;  4N47 A;  1NOY A;  1UOC A;  5CZ2 A;  1NK7 A;  1L3V A;  3IAY A;  1RBS A;  2FBT A;  1EKE A;  1SV5 A;  4DFJ A;  4DTM A;  3OYJ A;  2PYL A;  4GMJ B;  3KIO A;  2R7Y A;  1NK9 A;  4CCH A;  4E19 A;  2E6L A;  4KAZ A;  3OYB A;  4ICL A;  1W9H A;  3HP9 A;  3AVG A;  1TKD A;  4DTJ A;  1O1W A;  2BGG A;  4CIG A;  4DFK A;  1BHL A;  4CHY A;  4NYF A;  3DRS A;  2QK9 A;  3VQD A;  4DMN A;  3V9S A;  3HO1 A;  3DLE A;  4N5S A;  1TL3 A;  3AVN A;  4KHU A;  4E7I A;  3I0R A;  4LSL A;  4F3T A;  1JLA A;  2G8W A;  1B9F A;  1CZB A;  3QIN A;  2IOC A;  3HST B;  4KRE A;  5CY4 A;  4LH5 A;  3SV4 A;  1ASV A;  1EP4 A;  3IRX A;  3IS9 A;  3NH2 A;  4F4K A;  1BI4 B;  3OJU A;  3KKS A;  1A5V A;  5HRR A;  1NK0 A;  1BGX T;  2D0C A;  3PO5 A;  2QKK A;  2IDO A;  1FKO A;  4LSN A;  2X6S A;  4EZ9 A;  2YNF A;  4CGG A;  4RW7 A;  3VN5 A;  1DTQ A;  1I3A A;  4CFB A;  3PX0 A;  2XY6 A;  4KO0 A;  1TK0 A;  1BIS A;  1C1B A;  1RIL A;  4CF9 A;  4FJM A;  2HNY A;  4FJ9 A;  3MED A;  3ZT0 A;  1SL1 A;  1QSL A;  4XIU A;  1YTU A;  3VQC A;  4E7K A;  3D0P A;  3MAQ A;  1L5U A;  1BIZ A;  4E0D A;  2FC0 A;  2KTQ A;  4M3W A;  1ZYQ A;  4BDP A;  2IC3 A;  1NJX A;  4DFM A;  3CYM A;  3LAK A;  3VQQ A;  3L2Q A;  4DQP A;  3RTV A;  3KLI A;  4CFD A;  4B9V A;  2HHX A;  4M45 A;  3TWH A;  1BCO A;  2D0A A;  4FM2 A;  2B6A A;  2QKB A;  1RDD A;  2VG5 A;  3V9X A;  4DU3 A;  3QLH A;  4W5N A;  1KVB A;  3P5J A;  1QTM A;  2Z1I A;  3VQ7 A;  2RN2 A;  3L3U A;  4JRP A;  1RT7 A;  3DOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...