1RTIA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 143
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtiA05
4Y1DA 3PHEA 3MEGB 2VA2A 1C0TA 1WAFA 1XR5A 3L2RA 3GV8B 4DLGA 3H5XA 4DMNA 2G8IA 1LWCA 2ATQA 1HPZA 3L2UA 4KFBB 3AO5A 2Z1GA 1ZYQA 1S1XA 4LSLA 3UR0A 3OS2A 2X78A 4O3NA 4FZYA 3OSNA 3MR2A 1S6QB 2G8FA 2R8KA 1BI4B 5C42A 4RU9A 4I2PB 3AVMA 3ITHB 1S97A 4FS2A 3BREA 5KFAA 3G6VA 4K4UA 1N5YB 4RUAA 2I5JB 1KTQA 4R8UB 2V4RA 5KG5A 3OHBA 3AVCA 3RRHA 3I5CA 1WNSA 4K4TA 1SL2A 1W0HA 3AO1A 4CEDA 3BDPA 4NLVA 3TAGA 4ZTJA 1UOCA 1S9EB 4K4YA 5CZ1A 2D3UA 4Q45A 2YNGA 3FFIA 2FVSA 1C1BA 3QZ7A 3CYMA 5F9NA 1VSJA 1SKSA 3QGIA 5KFXA 3MECB 1JLEB 2PY5A 3AVNA 3GILA 1NJWA 2IAJB 3M9OB 3LP3A 3KLIA 1IM4A 1KLNA 4DL5A 1QE1A 4JS5A 2HNZB 5J2PA 2YNGB 1T05B 4YQWA 1IH7A 3N6NA 1S1VB 1DTQA 1MMLA 4CJTA 3RMCA 3DOKB 1TKXB 3O4QA 3P5JA 1YT3A 4CHQA 1G15A 1UWBA 1WSHA 1TKDA 3KHRA 1TKZA 4FW2A 2HWIA 4NYFA 1BIUA 4LSNA 1S1WA 4CHPA 4MK7A 4JV1A 4NLSA 1HRHA 3S3MA 3DM2A 1SH3A 3ITHA 1WAJA 4CJ5A 1I3AA 1REVB 4TYBA 2DY4A 3NAEA 3GV5B 1A5XA 4PWDA 3RR8A 2QXFA 4KB0A 3SUPA 2R2UA 3NGDA 1S48A 5JXSA 1L5UA 5KFTA 4DS5A 1HYVA 2FBTA 4FK4A 3OYLA 1C6VA 4DWIA 2A1RA 4F4XA 4CF9A 2ZD1A 3AO2A 2IMWP 1L3UA 4XPCA 4Q44A 1DTTB 1XR7A 4DQSA 1QAJA 4PA1A 3KLFB 5JS2A 4B9LA 3QIOA 2O4IA 2XY7A 3SCXA 3DLGA 1CZ9A 3TI0A 1QHTA 1RTHB 1TKXA 4MFBB 3V1OA 5L1LA 1S49A 3MXMA 3AO4A 3VQ9A 4FJIA 2AX1A 1R0AB 2E4LA 2JEIA 3CO9A 2KZZA 3OYDA 1RTJA 3CWJA 4FJLA 1RT2A 3SUNA 1S0OA 3MF5A 2FVPA 3NBPA 4JUZA 4KKOA 1RT1A 4Z0UA 4E7JA 3OYMA 5HROB 3JSMA 3QEVA 1J5OA 2F8TA 4F2RA 4DSIA 4KB7A 2ILZA 3GIMA 2W9BB 3HVTA 5DLGA 3M9MB 3IAYA 3M8QB 1A5VA 5DMRA 4WYWA 4NLTA 3VN5A 3EZ5A 1J9AA 4IFYA 3KNAA 1QSYA 2NUBA 3KKRA 4JV2A 2YKMB 1KLMA 2FVQA 1S5JA 1RA6A 3V6KA 4ICLA 4ZP8A 4J2AA 3ZSZA 3OS1A 3C95A 4M45A 4KHUA 1ITGA 1S6PA 3IRXB 3LP2B 5KFWA 1VSEA 1TL3A 4KTZA 2XGPA 3ZSRA 2V9WA 1CLQA 1S1XB 4LSLB 3G86A 3DLKA 1B9FA 2YKMA 4F4YA 4EO8A 3K57A 4CFDA 3RAQA 4AHRA 4E19A 4BACA 1K1SA 4CEEA 4URSA 3Q8RB 1S6PB 2HHUA 3QO9A 4FVMA 1IKWB 1D9FA 4KRFA 4BE2A 3KLHB 3I5BA 4CFAA 1IKXB 2IJFA 4IKFA 2GC8A 5KGXA 3LPUA 1C0UA 3HYFA 5KG3A 2WTFA 3T5JA 4F8RA 3QLHA 4XPEA 3DMJA 3BQ2A 2C2EA 2IM2A 3MXJA 1VSMA 4LH5A 4KE5A 3PR5B 3PR4A 4BWJA 3OJSA 3AVBA 3KJVB 3HVRA 3QNOA 5CZ2A 4ECUA 3G6YA 4DG1A 3QNNA 3OVNA 3UIQA 4FCYA 3PX4A 1F21A 3CJ3A 3FSIA 3AVKA 1LAVA 3O3HA 3AA3A 3QEXA 3U6FA 3V81A 3GYNA 3KHLA 2CKWA 2DPJA 4O3PA 4H4MB 4I7FB 3P83D 1T3NA 4FJXA 4DL4A 3DYAA 1QS4A 1W9HA 4RW9B 1Z4UA 1BQMA 4XO0A 2XCPA 3VQEA 2FJXA 5FDLA 1LW2A 4B9VA 2UUTA 4CHYA 1NKEA 2BRLA 4ECZA 3RMDA 3KIOA 3HXMA 3L8BA 4KHNA 3FFIB 2YKNB 1BL3A 2KFZA 4BE1A 2FLNA 1JLGA 1OS5A 5JUMA 2Y1IA 1TK8A 1I6JA 4ZPBA 4HYKA 5J2MA 1SH0A 3OYBA 3TABA 3AVGA 2RF2B 1Z25A 5K14A 1EETB 4ZHRB 4TY8A 4HTUA 2G8UA 1FKOA 3B6OA 4B08A 3QEPA 3BSOA 5HP1B 2GIQA 2BQRA 2HNYA 3I0RB 3BSCA 4DL3A 3BQ1A 5SZTA 1KFDA 2XRIA 4B3OB 1TGOA 5KFBA 1VRUB 5HRSA 3K59A 2HNYB 4ZPAA 1JIHA 4C8OA 4BWMA 1SV5B 4Y2CA 5HLFA 4QCLA 2AWZA 5T14A 1Z26A 2FVRA 1D0EA 3QIDA 4CGDA 4MIAA 2BE2B 5J2QA 4E1MA 4CF8A 1WSIA 4ID5B 1BHLA 1TAQA 5KT7A 3LZIA 3V9UA 4H4OB 3GV7B 2JEFA 4NLRA 2GUIA 3H5YA 4ID5A 3HHKA 1NOZA 4PY5A 3MEDB 1XWLA 4CJVA 2VG5B 5KFQA 3ZCMA 4N41A 3HP6A 3ZSOA 3ZT1A 1HYSB 2UVUA 3DOLA 4E3SA 3DI6A 3LWLA 3H08A 4KO0A 4RW7B 3A2FA 2IA6A 2GBZA 1LWFB 4DQIA 1VSLA 1XC9A 3DLGB 2J6SA 3NAIA 4KHYA 1NK7A 3ZT3A 1WSGA 1HARA 1N5YA 3OLBA 1JLAB 4E0DA 3L2WA 4TLRA 4B9NA 4OGEA 4RW6A 4PQUA 4TN2A 1ZETA 4B9UA 5DG7A 1ASVA 4CFCA 3AA2A 4WZMA 4E7KA 4FK0A 4O5BA 4B9MA 3DDKA 3NL0A 4RNFA 2YNFA 3Q8SB 4RW6B 1NK9A 3AVJA 3RB0A 2DTUA 1MU2A 4NZ0A 5E41A 2HWHA 4GC7A 4CGGA 1FKPB 3C6TB 1RDBA 1CXQA 4RNNA 3KMQA 5DG8A 4OKEA 3N6MA 4CHZA 3PO4A 4WFZA 3SUOA 4I2PA 4ZVEA 5EDWA 3HKWA 1TK0A 4N56A 5HBMA 1JLFB 4CEAA 1W25A 1HPZB 1RDDA 4KTQA 3QGGA 3M8PB 3SI8A 2D41A 5KFHA 5I3UA 2HMIA 1RBTA 2ZD1B 3ALYA 3MR3A 3NGZA 3PV8A 4FLYA 3LWMA 4CCHA 2XWYA 3RWUA 4FS1A 4DQPA 4O0JA 1C0UB 4FM1A 1RDCA 2O5DA 1RT1B 3O4NA 2YHBA 3BQ0A 3SFGA 2IDOA 2JC1A 4O4RA 2ZE2B 4FJGA 5JS1A 1NKBA 4K4WA 2AGQA 3HO1A 1N4LA 1XHXA 4RNOA 5KTQA 4CEQA 1NJZA 3TAFA 4IG0B 1WN7A 1HYSA 5L1IA 4OJRA 4CHNA 3DLHA 4WYLA 2OPQA 3KHHA 4KHSA 3ZT2A 3FQLA 5C5JA 1KVAA 1TL3B 1UAXA 1LAWA 4GVMA 3M8RA 1LWFA 4ECQA 3EY1A 3NE6A 1JLGB 3VQ8A 2WOMB 4CECA 1JL2A 4KV8A 1NOYA 5FRMA 4J9KA 4Z4IA 1JL1A 3BGRA 4E7IA 4C8NA 4FJHA 5J2QB 4EYHB 3T19A 2C28A 2YHAA 1GX5A 5C25A 3LP0A 5DK5A 4FLXA 3V9WA 1NK4A 5I3UB 4TXSA 5HLFB 1SV5A 4G3IA 5I42B 3OS0A 3V4IA 4H4OA 3QGHA 4Z4EA 2WONA 1JLBB 4ECYA 4DSLA 1JXEA 1FK9A 3SV4A 2VG7B 2IC3B 4CE9A 3OL8A 3NBPB 1T8EA 3I0RA 1KHWA 3U3GA 4Z4FA 4CESA 1JXBA 3AVLA 5HRNA 1RYSA 3VQAA 3NGYA 3K2PA 3OL7A 2W7OA 4CJFA 2AX0A 4DTXA 4QW9A 3PVXA 4MQ3A 4RW4A 1T7PA 4CGIA 4KHMA 4CGFA 4ZPCA 4ZVFA 3OL6A 3K5OA 4J9RA 3GIJA 2E9RX 4Z4CA 1TVRA 2OPRA 5KG4A 4CIEA 4O55A 4KFBA 4QWAA 2OA8A 3NF9A 1ZBFA 3SQ0A 1S10A 3G10A 4CK1A 5KFVA 4NCGA 3WNHA 3NDKA 2XY5A 4FK2A 3RRGA 3PJWA 3PW5A 5KRTA 2BE2A 3OYAA 4FXDA 4URQU 3QESA 1RTDB 2R2SA 3TANA 2G8HA 3QEWA 3EPIA 3K5NA 3DM2B 4CIFA 4PQUB 1XI1A 3HPGA 2R2RA 3MFHA 4DLEA 4I7FA 2FLLA 3DLKB 5F8LA 5HBMB 5J1EA 4Z4HA 1TK5A 5FDLB 3FDSA 4E7LA 4O3RA 1FK9B 2GIRA 1REVA 4ICLB 3Q8QB 4O3SA 4KI6A 2OPSB 4F4WA 3ZSYA 1ASUA 1J54A 3IG1B 4ZHRA 4TY8B 3PUFA 1T94A 1JKHB 5F8JA 3SQ4A 4OKKA 3SUQA 5KFRA 4F4ZA 2ASLA 1YTAA 4QWBA 3MFIA 4HKQA 3KLFA 4KV8B 4BDZA 2R8GA 4Q43A 4ELVA 4CF1A 3KK1A 2UVVA 1D5AA 3VQCA 1GOCA 3M8SA 4HUFA 1CXUA 4H54A 3T3FA 1NJXA 2UVWA 2DFEA 3H2LA 5KFOA 1EKEA 4DU4A 1BGXT 4IFVB 4E7HA 2E9ZA 4E1NA 4KPYA 2W42A 1BIZA 1JLFA 4IDKA 1DLOB 3TAMA 2RPIA 4IH6A 4YMEA 4LH4A 4DTRA 1TL1A 3PW0A 4ZVGA 5KI6A 4FW1A 3DOLB 4LSNB 1WSEA 2D0BA 5C24B 5KFZA 3KJVA 1TL1B 1NNDA 4WZQA 2ZE2A 1TV6B 2F8EX 1QUVA 2V4QA 5F8HA 1C1CA 2HAIA 4JS4A 4YR3A 4TYAA 2B6AA 3KK2B 1K6YA 4FJ7A 4AHUA 3L3UA 4LQ3A 2WCXA 1HQEA 2WK4A 4GW6A 1KLMB 1QAIA 3LDSA 4J2DA 4IG3A 4TY9A 4FJ8A 1JLQA 4KAZA 4YNQA 1RDRA 4CEBA 4KI4A 3LAMA 2W9CA 4EO6A 2W9AA 3PW7A 1RTJB 2A1SA 3BSNA 1N56A 4QWEA 3JSMB 4CFBA 3BSAA 3ISNC 3PX6A 1NJYA 2AJQA 4RNHA 2G8KA 4IH5A 3V81B 2Z1HA 4DSFA 2RKIB 3OL9A 2E6LA 2IC3A 1I39A 2RKIA 1NHUA 2PZSA 3D5MA 1MU2B 1K1QA 4DTMA 4NLWA 4B8CA 4CERA 1VRTA 3NHGA 3CIZA 5KT2A 2YNFB 3PZPA 2HHXA 4Y34A 4ED0A 4TSXA 4C8KA 5C42B 3ZSVA 3SPYA 1RT5A 1T03B 5KRSA 3KHGA 1U45A 2ILYA 3MECA 2IOCA 1KFSA 3B6PA 2AU0A 5DGBA 2ETJA 1JLQB 2W9BA 4ED2A 2BQ3A 3CG7A 5CYQA 4JRQA 3QERA 1RBUA 5EWEA 4Q0BA 4EZ9A 3NKYA 4ED8A 2XO7A 3H4DA 3PO5A 3LZJA 1C1CB 4Q5VA 2G8VA 3V9XA 5KFIA 3T5LA 3DRPA 4DL2A 2C2RA 3DI6B 3OYGA 3H4BA 3NGIA 4KHWA 3H40A 1ZBUA 3IS9B 2DFFA 3NMAA 4ZP7A 5KT3A 1LW0A 4Q8FA 1VRUA 3V6JA 3OYHA 2VA3A 4OPJA 1BQNA 5J2NB 4O4GA 4NLQA 1EX4A 1S1VA 4RW7A 1QTMA 1NK0A 4F4KA 1FKOB 1BISA 2Z1JA 1GOBA 3ZSXA 3RB3A 1JLEA 3KLVA 3KK1B 2KQ2A 4M41A 2HHQA 2R8JA 3TAEA 3L2VA 1SKRA 1HQEB 2HHVA 4EYIB 5FRNA 3OYNA 3H98A 2B5JA 3RAXA 4NLDA 5C25B 4AHCA 4CJQA 3QINA 2W8KA 3QO9B 1LW2B 2P5GA 4CJ3A 4HCBA 3KLGA 1KSPA 2OH2A 4U6PA 2JLEA 4JV0A 4CEOA 3I0SB 4CJPA 3T5KA 4CF2A 4BDPA 4RZRA 1BCOA 3HVAA 3FRZA 5DQHA 4FJ5A 4N5SA 4W5RA 4MKAA 1S6QA 3HPOA 3IRXA 2EHGA 4NLGA 3HPHA 1WSFA 3IS9A 2R8IA 1HNVB 4J9PA 3S3NA 4OL8A 2F8SA 1HMVA 4DTSA 1DTTA 2JGUA 5KG2A 2YNHA 1IG9A 4ECRA 3OYFA 1C2PA 2D0CA 5F9LA 1X9SA 1J53A 3DMJB 4FJNA 1EXQA 1HQUA 1SKWA 1HNVA 4CEFA 4F50A 3AV9A 1ZBHA 1JLAA 3BJYA 2BR0A 4DFJA 1YTUA 4LY7A 4B9SA 3NF7A 4NLPA 3TQ1A 3E51A 3DLEA 3MEEA 4RW9A 4WFYA 1N48A 1R0AA 1ZTWA 3NFAA 3ASMA 2W7PA 2XC9A 2W9CB 1BI4A 1UWBB 1A5WA 2P5OA 2HVHA 4IR1A 4NCAA 1X9MA 4J9SA 3CJ4A 5F8IA 4QW8A 3QLHB 2CJQA 3C94A 2R2TA 2XGQA 1U48A 3HM9A 5F8GA 4DSEA 4HUGA 5KFSA 1C1AA 3LPTA 3FQKA 3CJ0A 2WHOA 1S1TA 4J2BA 4OLBA 1TKTB 5KT5A 3NCIA 1S1TB 4Y3CA 5CYMA 4U7CA 4DSJA 3UPFA 1NK5A 1J5OB 5KFUA 3PY8A 2ZKUA 2OPRB 3DRRB 4ZPDA 1CSJA 1WNEA 2VWKA 4IQXA 4CK2A 3RB4A 4EP4A 3KLHA 3ZSWA 3SQ2A 2RDJA 3NH0A 3VQ4A 4CIGA 4KB1A 5L1KA 1C0MA 4J9LA 4F3OA 4Q8EA 2OZMA 3F9KA 4IBNA 4KO0B 4DFMA 3ZT4A 1O1WA 4KREA 2B43A 3VQDA 3KK3A 2OZSA 4H4MA 1YVUA 1RTHA 4HHTA 1U09A 1LV5A 4NLOA 1CZBA 4O0IA 1D1UA 1RDAA 1RT4A 1HJRA 1ZBLA 1UA1A 3VQ7A 1VK0A 4M3UA 4R5PB 5D3GB 2J6UA 2HNZA 5J2PB 1T05A 1RNHA 1RCHA 4Y2AA 3KLGB 4DEZA 1SL1A 2JEGA 1EP4B 4G1QA 4KKOB 4KHRA 4DTJA 2YNHB 1JKHA 3TR8A 4I9QA 4FBTA 1NK8A 4NCGB 1BQMB 2RDIA 5F8MA 4ZVHA 4J9MA 4ECTA 4B9TA 4KTWA 2ASJA 2OPSA 1GOAA 3AA5X 1IKXA 3PW4A 4ZP9A 4FLZA 5EWGA 3KLEB 2XCAA 1RBVA 2XHBA 4NYNA 3T1AA 4PWDB 1TV6A 5KG6A 1TP7A 4MH8A 1VSFA 3TARA 3LALA 2I5JA 1VSDA 2FJWA 4K4VA 2IS3A 3VQBA 3DLEB 2OPPA 1IKVA 3NH1A 1UA0A 4ED7A 4CJLA 1XHZA 2O4GA 3OJUA 1TKZB 2FBXA 1NK6A 4CGHA 4JRPA 3QEIA 4OPKA 2VG7A 3OHAA 3D45A 4ED6A 5J1EB 2B5JB 3WNFA 2WONB 2FC0A 2WB4A 4IG3B 4IFVA 3BR9A 4OVLA 1S1UB 4I2QA 5F8NA 2FBVA 4RNMA 3E01B 2IJNA 1RYRA 4DTUA 4DSKA 2C22A 2QK9A 4FLUA 2QKBA 3HVTB 4M95A 4EBDA 3CQ8A 4M3TA 4K4XA 3QETA 3QYYA 3NAHA 3S3OA 4MK8A 4WE1B 1B9DA 5KFEA 2FVCA 3UDLA 4OLAA 3GIKA 3LP2A 1RT5B 1L3VA 3SNNA 2G8WA 2ITGA 4O44A 3DOKA 5HP1A 1S0MA 5I42A 1U49A 3VA0A 4DTOA 4O44B 2UUWA 5K14B 2VG5A 3SV3A 2P51A 3LP0B 3TAPA 3HSTB 3ZT0A 2HW3A 2C2DA 4CJUA 4ELTA 4PUOA 4EBCA 3CFOA 4M94A 1WSJA 2IM0A 2HNDA 2XI3A 3U3YA 4K8ZA 4GC6A 3WNEA 3CM6A 3MAQA 1RA7A 3H5SA 4PUOB 5DGAA 1RTIA 4DL7A 3CJ2A 3QIPA 1HYZA 2YV0X 2ATLA 2VWJA 1RT7A 4CJEA 1LWEA 4G1QB 4FLVA 3E01A 3RBEA 2UVRA 1KRPA 2OYQA 4Y1CA 4ED1A 1HMVB 4HVJA 3RTVA 4NLXA 4CGJA 4HCCA 1YVFA 3DLBA 4NLYA 3TVKA 3HK2A 2IGIA 3GIIA 3G0ZA 5J2NA 4IOBA 1TAUA 2JEJA 2YNIA 3HVWA 4IR9A 1X9WA 3QZ8A 3IN5A 5FROA 3VA3A 1BCMA 5KG7A 4EP5A 3AO3A 2KFNA 3DRPB 1KCFA 4CJKA 3CDUA 5KFLA 2KZMA 1ZTTA 3EPGA 3V9SA 3HT3A 4O3QA 4KHQA 4X2BA 1JLBA 2ALZA 1HNIB 3GQCA 1KVBA 3TWHA 4WFXA 4TQRA 4ZP6A 2IM3A 2QKKA 3KLIB 4ECVA 2PYJA 4FLTA 4DFPA 4C8LA 3NH2A 2QV6A 2D3ZA 4AHTA 3QIPB 4FZZA 4ID1A 4O3OA 1RTIB 4AILC 4K4SA 5DLFA 4IH7A 1VRTB 3IGVA 3L2QA 5HROA 5KFJA 1SUQA 4CJRA 3DRSB 3LP1B 1S4FA 1S9GB 3AVAA 5KG1A 1T03A 4LQ9A 4YFUA 2OPQB 4E89A 1LW0B 1QSLA 4K50A 5KFFA 2J6TA 3K5MA 4N76A 4QWCA 2Y1JA 1B92A 4NLUA 1X1PA 1TQLA 1SL0A 4W5NA 3UQSA 4DQQA 4XIUA 3VQ5A 3F73A 5DG9A 2KW4A 1EP4A 3RMBA 4NRUA 1N6QB 4Q0BB 3MR6A 3MTKA 3CDEA 3RB6A 5EU7A 2HNDB 5KFGA 3SYZA 3V6DB 3DLRA 3OYEA 1IO2A 4I9LA 3H5UA 4FJ9A 2XY8A 1D9DA 4R8UA 3M8PA 2AGPA 3RMAA 3HL8A 1D8YA 4I2QB 5KFMA 4CEZA 4IG0A 4DF4A 4ZTFA 5T7BA 2VG6A 4DF8A 5DQIA 5D3GA 1Y97A 3CVKA 3ISND 3KMSA 2Q3SA 4FZXC 3MR5A 2PYLA 1S9GA 4K4ZA 4KBIA 4AHSA 4IRKA 3K5LA 3LP1A 4L8RB 1S0NA 3DRRA 1U04A 2XI2A 3EZUA 3C6UB 4M42A 3KK3B 3KTQA 4DG1B 2HB5A 2BRKA 4AH9A 4J9QA 4RW8A 1QQCA 3NF6A 4OKJA 4CJ4A 4DTPA 1RT3B 5HRRA 3PJXA 3OYCA 4BDYA 4URGA 1Q9XA 3V6DA 1DTQB 3KKSA 2YKNA 3SFUA 4UQGA 2X74A 4QAGA 1ZBIA 4QPXA 2E9TA 1HNIA 4CK3A 4DS4A 1RT6A 3HP9A 4F3TA 2X6NA 4B3OA 2BGGA 4W5QA 4FJMA 2WRMA 4RW4B 4DFKA 3DYAB 5C24A 4EBEA 5KT6A 3ICLA 4EZ6A 4NCBA 5SWMA 4CJSA 1JLCB 2BDPA 4ECXA 3CFPA 5CY4A 4MK9A 4FYDA 4ECWA 4OGCA 3VQ6A 3OY9A 1L3TA 3T5HA 4WE1A 3D28A 4R0EA 3V6HA 3IG1A 4IKAA 2VG6B 2D7SA 2FBYA 3V9ZA 3I0SA 5KFCA 1QE1B 1C0TB 3V1QA 3Q8PB 4FM0A 5J2MB 4M3ZA 4J9NA 1Q8IA 4M3YA 2R8HA 4RG8A 2AGOA 3CFRA 3M8QA 1RBSA 3SZ2A 3G6XA 2IBKA 2KTQA 3JYTA 1C1BB 1S1UA 1FXXA 1LWCB 4H8KA 4WXOA 2DPIA 3O3GA 4R5PA 3JYTB 5KFNA 4ELUA 4HUEA 4J9OA 5L9XA 1RT4B 3SQ1A 2HMIB 1JXLA 3RR7A 1JLCA 3V1RA 3SJJA 1S1WB 3H59A 4ED3A 4W5OA 1IKYA 3KD1E 5KFKA 3PW2A 3N6LA 2BANB 4IRDA 2R7YA 2FLPA 2YNIB 3TAQA 4ECSA 5HRPA 2BANA 5KFDA 1XR6A 4AHVA 1SUQB 2OPPB 3CJ5A 2DFHA 2AQ4A 3AVHA 1S9FA 4ZMMA 4DQRA 1NKCA 3I5AA 4TQSA 5KGWA 4IFYB 2Z1IA 1L3SA 4M3RA 5EWFA 2X6SA 2E6MA 1RT3A 2BQUA 5L1JA 2F96A 3VQQA 3ULDA 3OYIA 3PX0A 4B8AB 3AA4A 3OLAA 3CM5A 2HVIA 2EX3A 5CYQB 4K8XA 3HJFA 4CJWA 3CDWA 2WOMA 3L3VA 1TVRB 1S9EA 4WXWA 3O3FA 3KK2A 4C8MA 2ZQBA 4YR0A 4DU3A 2P1JA 4M3WA 2IM1A 3EYZA 3MXIA 1SH2A 3AVFA 2D0AA 4RUCA 1IKVB 2GV9A 4DTNA 5KT4A 1KVCA 2FJVA 4CF0A 5KFYA 5EUHA 3MEEB 2W8LA 3IGNA 3OYJA 4NRTA 1BQNB 1RAJA 2XY6A 5DQGA 3KOAA 3DRSA 4IDKB 4F2SA 1U4BA 4DL6A 1U47A 1Q9YA 2HHWA 2I1RA 2EC0A 1HQUB 4W5TA 5CYMB 4GMJB 1KHVA 4KAIA 4KSEB 1ASWA 2IAJA 4Z4GA 4FM2A 2HHSA 1RT7B 1QSSA 4QOZB 3KD5E 3WNGA 1RT6B 3OYKA 3VQSA 4JLHA 2V0NA 3S9HA 2D5RA 3VQPA 4FLWA 1VSKA 2LSNA 4N47A 1RBRA 3K58A 1JX4A 2B4JA 1N6QA 3SI6A 1IKWA 1WLJA 4IRCA 1TKTA 2JC0A 4NYZA 4RW8B 1RT2B 3RBDA 4J2EA 3C6UA 2HHTA 3M9NB 3C6TA 1RILA 5KG0A 4LD0A 4FBUA 4MFBA 1VSIA 3OSPA 4O4GB 3MEDA 1GX6A 4FJJA 3KLEA 4FJKA 3NF8A 4DU1A 1DLOA 3TAMB 5KFPA 1NHVA 3I8DA 3THVA 4YR2A 4EEYA 3P1GA 1IKYB 3ZSQA 2QE5A 3V4IB 4M3XA 2ASDA 4MIBA 3SPZA 1EETA 4QWDA 2RN2A 3AVIA 3MEGA 3LAKA 2RF2A 1FKPA 2B6AB 1LWEB 3D0PA 1RTDA 3LANA 4MKBA 4BE0A 1VSHA 4YP3A 4CHOA 3BGRB
chains in the Genus database with same CATH superfamily
1RDUA 4Y1DA 3IAS9 2VA2A 2DGXA 5CD4A 2AZ1A 3NGKA 1WAFA 1XR5A 5L46A 4DLGA 4DMNA 2XLKA 1IWGA 1RSCA 4WK1A 3CCRS 1GEHA 1S1XA 4LSLA 2KG0A 3OS2A 5THWA 4O3NA 2Z8QA 3D2EA 2G8FA 5C42A 4DPWA 4I2PB 1S97A 4DPUA 5DM6L 4ES2A 4UF4A 4F0KA 1CEZA 4H03B 4ETZA 2E1AA 5BN8A 2DNLA 4OYIA 3RRHA 3EMTA 4K4TA 3M8YA 3HSZA 4CEDA 2LKZA 1GMVA 1FX4A 2V63A 4K4YA 1UL3A 4X4OA 1Z2LA 2YNGA 2ZH9A 2FVSA 2GO8A 1AZSB 4NXNK 4Z37A 5KFXA 3QMQA 2DK2A 3AVNA 2F63A 2E88A 4CDIA 4DL5A 1QE1A 2V7YA 4JS5A 3CC4S 2HNZB 5J2PA 4CO5A 3N6NA 2K1RA 4CJTA 3C16A 3O4QA 4WQ5C 2P9IB 3GWCA 1YT3A 2BJ9A 1TKDA 3S7RA 1KTVA 2XYGB 3QFWA 5HMXA 1HNWJ 4CHPA 4ZVPB 3W61A 4W98A 4JI7F 4LF8J 5AQOA 2UYTA 2AV5A 1VK8A 1REVB 3GV5B 5LM7E 2K06A 5EX3A 3BM7A 4JN4A 3VALA 1KXPA 2E7XA 3D3BJ 4KB0A 4C8ZA 2EKNA 1S48A 3BN4A 4C4WA 4KBOA 4B1VA 3LGNA 1YJ7A 2ZHAA 1BY9A 2QWRA 3N9UC 1X4BA 2A1RA 4F4XA 1U7LA 4X64J 3AO2A 2LMIA 2IMWP 4Q44A 1DTTB 4DQSA 1VMBA 4PA1A 4AQYK 5AE1A 1WUAA 1MWYA 2DISA 4B9LA 3W5ZA 3AOCA 5JVGL 1QVGR 1CZ9A 1QHTA 1NDCA 1SQKA 1RTHB 4EU0A 1RUSA 5CA5A 3ZYYX 4EI2A 3AO4A 3VQ9A 4X4NA 2AX1A 2NREA 3PSFA 4IJNA 3CC2N 1G4CA 3ETMA 2KN4A 4NPOA 1FO1A 3P39A 1S0OA 3SUNA 2GWKA 3EGZA 4C48A 2HAFA 1YRXA 5HMYA 1RT1A 5CYJA 5HROB 2DR6A 3JSMA 5CABA 5BR8J 4F2RA 3FEYB 4DSIA 1UFKA 3GIMA 1HL6A 1O5JA 4YORA 2W9BB 5DLGA 3A12A 1A5VA 3R6MA 4WYWA 2O8CB 4NLTA 2PDAA 2K3KA 3OXLA 2DY1A 1MN7A 2CADA 2YKMB 2JFDA 3FZ2A 1KLMA 4USIA 5F3TA 5B09A 1S5JA 2YI1A 1RA6A 3W2VA 5ITHA 4ICLA 4ZP8A 1ZBTA 2C3PA 4J2AA 3MR7A 3PYEA 1BLUA 4M45A 5EOYA 1LFWA 3PG9A 5KFWA 3QFHA 2XGPA 3ZSRA 2HZAA 5IOLA 1S1XB 4LSLB 3G86A 3P3DA 2HMPA 2KYZA 5E3PA 4EO8A 4QIGA 2DEJA 3EKSA 4E19A 2NYHA 4BVOA 4A8OA 2AA4A 1S6PB 4EIAA 1C0GA 1OYEA 5KPTA 2BABA 3I5BA 2GC8A 3MPVA 5KGXA 1ZM9A 2P9KA 3LPUA 3DOMA 4BRDA 2MKIA 3POTA 4KH1B 2CZVC 3T5JA 4F8RA 5EY4A 1VQPN 3BQ2A 2OMOA 1OMSA 3OT9A 2IM2A 2RMLA 2VOPA 1NGFA 2FPHX 1KR4A 3AVBA 5AQVA 4JI5J 3QNOA 2O8DB 2UUAF 4G9ZA 2KFYA 3PX4A 3A5MC 2CQHA 1Q81O 2ZNZA 1YSJA 3DAWA 1GXLA 1LAVA 1KQGB 3U6FA 3VF4A 1XC3A 3KHLA 3H90A 4H4MB 4ZLLA 4I7FB 2QWOA 3RSEB 1XMBA 3WQUA 3A8JA 4LBHA 4LFCJ 1GH8A 1BQMA 1KAYA 2XCPA 3VQEA 2LDIA 1KQFB 2RQKA 1QM9A 4DCJB 3GCXP 2DO4A 4B9VA 3DNCA 3BO3A 2NLXA 3AQPA 5BRDA 5AXNA 3KIOA 2BXJA 3FFIB 1VGYA 2KFZA 1BL3A 1WC3A 3RVCA 5FLXO 2C2MB 1GLJO 4BE1A 2FLNA 2QMWA 4HT5A 3IA0A 4WKRA 4NA2A 3SXLA 1S4EA 3CJ9A 2CNKB 1SH0A 2RF2B 1SXLA 3T1HF 4BRMA 4ZHRB 4TY8A 2G8UA 3UN3A 2WW8A 3QEPA 1BWVA 4GMKA 5HP1B 5AQYA 2GIQA 2BQRA 1RAEB 3H3NO 3BN7A 4JI3J 2E2NA 3BQ1A 5SZTA 3EEQA 3E8OA 4B3OB 3CCES 1VRUB 5HRSA 5KAKA 5H1SQ 1REGX 1RU1A 2O8EA 2HNYB 3VAMA 1W2IA 4C8OA 2WZ1A 4OHWA 4JI5F 2CGLA 4MLEA 3G4SN 1RTZA 4CGDA 2BE2B 4P2XA 1WSIA 1TAQA 2HQ3A 3T1HK 3V9UA 2O67A 1S6OA 3CTRA 3BBFA 2V5HG 2GUIA 4OJGA 4JV5F 1NH8A 5LSLA 1NOZA 4PY5A 1MW7A 2CQ3A 3FBEA 1D3WA 3ZT1A 4KPCA 1NGEA 1M1GA 5LJ5Y 3WZ0A 4E3SA 3DI6A 3G9CA 3H08A 3BR8A 2GBZA 4RUHA 2HLTA 1WOSA 3VR1A 1KWMA 3ZZPA 2GWJA 1NPKA 5BYRA 2HFOA 4E0DA 1C4CA 4B9NA 4OGEA 4PQUA 4X65K 3KUGA 2F5GA 4FXWA 2ITMA 1YITS 5CQGA 3UB5A 4FK0A 4O5BA 4K41A 2YNFA 5M2UA 1NK9A 4FVCA 1SIZA 2DTUA 1ZXOA 2QA2A 3O8MA 1NGCA 3CC7N 1E6VB 1RB0A 4WFZA 2CNOB 2L3MA 1F3VA 4WKYA 2WVBA 2JSXA 3MZIA 2MYFA 2ASMA 4CEAA 1W25A 1RDDA 2KLAA 3D3CJ 4D3HA 3H3OB 3D1OA 5KFHA 5I3UA 2DGOA 4MMOA 3H20A 3P5TL 2ZD1B 2WSFC 1RBTA 2CJ9A 1XMOK 2DNPA 3NGZA 3FZBA 1UJ6A 2XSFA 3U1LA 2P9PA 1HNZK 1WHWA 4ZPVR 3DWLA 2B9EA 3A8IA 1AXQA 3THWA 2H48B 2IDOA 2UUBJ 2BOAA 1Q5YA 3QWUA 5D6GA 4O4RA 5JVHL 2ZE2B 5JS1A 2F8HA 2AGQA 3C0BA 4DV1J 4RNOA 1T95A 3CPWM 2FY1A 1QY7A 4FYWB 3NS7B 4WYLA 3ZT2A 3B54A 1KVAA 3F5TA 3QNWB 1LAWA 4GVMA 1FDNA 1DURA 3H25A 2BW7A 2R9LA 2HFVA 2WOMB 2KT3A 1NOYA 2GVDB 2IPOB 2HBJA 3SK3A 2FSNA 5FRMA 4J9KA 4WCEQ 2ZDOA 1UVNA 2U1AA 1V4SA 1P6TA 2C28A 1GX5A 3CJBA 1UETA 3SSRA 4FLXA 1NK4A 2FHMA 4TXSA 2DXDA 3OA9A 1WC0A 3V4IA 4H4OA 1U26A 4Z4EA 2WONA 4ECYA 2HEKA 1FK9A 3SV4A 3TZWA 5D4PA 2HF4A 3GSIA 3NBPB 1NZ8A 2G9OA 3I0RA 1KHWA 3S41A 2EI5A 1KKHA 5H9FJ 3EKUA 2M4MA 2HURA 1RYSA 4R0JA 4DTXA 2AX0A 3PVXA 2BH1A 5FJ4A 5JMVA 4HEA9 3EGWB 4WP8A 2P5VA 4Z7CA 2XNRA 1T7PA 4KHMA 1LNQA 3OL6A 3K5OA 5HAOA 3FZHA 4OHXA 4U8YA 4KFBA 4QWAA 3NF9A 1ZBFA 1VQ5N 4MO5A 2DKOB 1YJ9N 5K8OA 4FK2A 1W26A 1ILYA 2BE2A 1IR2A 2M0GB 3QESA 3FGVA 3QDKA 2R2SA 1EARA 4X64F 5B0AA 4DR2J 3R6GB 1GMWD 2G8HA 3ZTRA 1P1TA 4AUKA 4OI3A 1P9YA 4I7FA 2CQ1A 5DZ7A 4K0KF 1LXJA 3JAMO 1DKGD 4Z4HA 3P4IA 4E7LA 4CZJA 1FK9B 1KAZA 4XEIA 3FC9A 4I6MB 4C2MA 1GNKA 2VKZG 1R8PA 1CC8A 1J54A 4PRFA 2J4RA 2Q6CA 3JTPA 1NHKL 2ZJPQ 4ZHRA 4TY8B 3BY5A 1DJ0A 1F2GA 2AYMA 5F8JA 1OY8A 5B0EA 4WP9A 4OKKA 4RLEA 3W7BA 2EFOA 3RW6A 2CH5A 3HHEA 5AQJA 4KV8B 3GYGA 3I56N 4Q43A 3U9DA 2OHDA 4AFFA 3VEWA 1WF0A 2NXNA 3L7PA 2J0QD 2KRBA 2OEJA 1SZ2A 1O51A 3MMAB 1EKEA 2PI4A 4IFVB 2I2YA 1WOOA 2W42A 1JLFA 1VLYA 4IDKA 1SVDA 1DLOB 1IBLK 2IIHA 4BRQA 4G6VB 2BOPA 4YMEA 2A6AA 4LH4A 4DTRA 1KQKA 1X0FA 1N36F 2QA4G 4DUYK 5HI7A 3TX8A 4NYPA 1RHJB 1Q8BA 3TUJC 3W60A 2ZE2A 2Y1LB 4GKJJ 2ZGZA 1HX1A 3UWTA 2DTJA 2HAIA 3CD5A 2VQFJ 1Z05A 1CVJA 5ETNA 4LQ3A 2WK4A 1KLMB 1QAIA 3I96A 5HOOA 1Y7PA 1HWUA 1V5IB 1UJ5A 4UOGA 1TFYA 6FDRA 4LRDA 2IVOA 4CEBA 3QT5A 2NXJA 1U24A 2W9AA 3O08A 1YAGA 3TJ8A 1N56A 2KB2A 4WTOB 3JSMB 2VJUA 4ZJOA 4X84A 3BKUA 4RNHA 1HWIA 1RAAB 2BM0A 3V81B 3PFEA 4DSFA 3TYTA 3OL9A 2VD3A 5BJRA 2NSCA 1I39A 3JB9k 2D1KA 2RKIA 2PZSA 4YB1P 4CTAA 4Z94A 3H2VE 4DTMA 1URNA 4B8CA 4N8NA 3NHGA 3CIZA 4FOIA 5KT2A 2YNFB 3DC2A 2OELA 4WK3A 3VTIA 2LA4A 2VOOA 4NLBA 2Z56B 2ABYA 1RT5A 3LDQA 3MECA 2ETJA 1X3MA 5CYQA 4JRQA 2EPIA 5EWEA 2GGPA 4PG8A 2XO7A 3MDQA 1YQHA 3PO5A 3ZC4A 4Q5VA 3LZJA 2G8VA 3H7HB 3FCVA 3QT8A 2MKKA 1P8ZA 2B9WA 2ZWPA 3DI6B 3H4BA 3NGIA 1K8KB 3IS9B 5BPNA 1VBYA 5KT3A 2E2QA 1EB0A 2BJ1A 2YCHA 3V6JA 4FPAA 3JTOA 3OYHA 4OPJA 2UXCK 3MOZA 3PRDA 3M1FA 1RHQB 4UY85 5A0YA 1RADB 1XMQK 1XNQK 3WQTA 1WF2A 1HNXK 1Y3JA 1IG8A 5HL7Q 3P4UB 1X5TA 2GA7A 3KK1B 2HHQA 1NGJA 3ET6A 1ZM2A 5AJ3J 2HFUA 2R8JA 4LFAK 4BQLA 2M88A 3L2VA 4CO0A 4ZLJA 3I33A 1VAZA 2B5JA 3M6WA 4I6AA 2CAJA 2D69A 3QO9B 1KSPA 2JLEA 3CCWA 4JV0A 3GONA 2DNRA 3HVAA 1YIJS 4C9DA 4CTAB 1HW9A 3BB5A 3QB0A 8AT1B 4MKAA 4I69A 5E3QA 2MXYA 4Q7AA 2VPWB 3HPHA 1HR0K 2O8FA 2R8IA 3GR0A 2XSJB 4FWMA 4ANDA 1HKAA 4K0KK 3UR3C 3HHLB 5F3ZA 1KONA 1IG9A 1TUGB 1WC4A 1X9SA 2PA3A 2RRNA 1EXQA 1HQUA 4F50A 1X5PA 1EQ0A 1JLAA 3SMZA 1HLUA 4UY8O 2ZH7A 4DFJA 3JQMA 5ETMA 1DHMA 1YTUA 4CD1A 2FJDB 4LY7A 4DPXA 3NF7A 1DRZA 4CT9A 3TU5A 5H9EJ 4RW9A 5M1NA 1N48A 5E3AA 1Q86O 1NRKA 1XNQF 2YJFA 3I55N 3E9PA 3THYB 2WVEA 3ENHA 1BI4A 2PMHA 4ZVTB 1X9MA 1IBKF 3DXKB 3CJ4A 2CJBA 1F1BB 4L3KA 3C94A 4DSEA 4HUGA 1H0HB 3LPTA 3QFPA 3FQKA 2J5AA 3CJ0A 2FHJD 4FNIA 1A7GE 1S1TA 4J2BA 3N01A 3UDCA 1W7WA 5D0RA 2P9NB 3G82B 3AH6A 1S1TB 1RHUB 4Y3CA 5CYMA 2ROEA 1S22A 2ROPA 3DRRB 1CSJA 1EAYC 4CK2A 3RB4A 3HF5A 3SQ2A 1HD1A 4ER8A 4OZLA 2ZM6F 3EE9A 5MAOA 3IKMA 4PG4A 5L1KA 4CIGA 1KD1T 1LFPA 4F3OA 3BEXA 4IBNA 1VLOA 2R7SA 3ZT4A 1V3RA 1O1WA 1NUEA 3NGSA 4HACB 1U09A 1LV5A 5IXUA 4NLOA 1CZBA 1RDAA 2GX8A 1WBDA 2G1DA 1ZBLA 2J0SD 3VQ7A 3MMJA 1OSDA 1RNHA 1X4AA 5EN1A 3KLGB 2Y8WA 1NEEA 4U96A 5DM6Q 2FHKA 4DV3K 1VQ4N 3UKUA 4NXMJ 5BRFA 4M5DA 4DV1F 4NCGB 4ECTA 5HMWA 3CDAA 5J1NA 2B7CB 4L75A 5B7WA 3AA5X 2D0PA 1IKXA 1BDGA 4ZP9A 2YKAA 2XCAA 1SC3B 3M32B 4MH8A 1BD6A 1N5SA 2YQ1A 3TP2A 3LALA 2I5JA 4P2SA 1NSKL 4MT1A 2WB1D 1XNRK 2OPPA 1UA0A 2I9SA 3OJUA 2FBXA 5CCLA 1XERA 5C7PA 5D77A 3QEIA 1NB7A 3T1YK 1OO0B 4PYDA 2C2OB 2VBXA 4JI2J 4DX7A 3BYPA 2WONB 4CO1A 4IG3B 3BR9A 1R0CB 1S1UB 4I2QA 4RBTA 1OY6A 2ZJRQ 4AL6A 1VQ7N 1RP5A 2IJNA 4DV2F 1S7IA 1RYRA 4B3SK 2J9EA 4DTUA 1MMNA 2NR0A 4OZJA 2HQFA 4KQZA 1ZA1B 3P96A 3TW0A 2QKBA 4K4XA 3NAHA 2FHJA 2NRHA 5IC6B 1I94K 3CDBA 4MK8A 5KFEA 4OV1A 2MMYA 2RHSB 4B3SJ 1NBWA 1RT5B 4ZIVA 3NGRA 1L3VA 3K0JA 2G8WA 1IR1A 4H5VA 4IO1A 5HP1A 1N52B 1U49A 3MCAB 4QIFA 4WQ4A 4Z7YA 1S3XA 1KVJA 5LOQA 4FKXA 2W6LA 4M94A 1WSJA 3AJDA 1FRKA 3DOMB 1MN9A 4BR0A 3B4DA 3H5SA 3SAFA 4PUOB 2CPXA 4DL7A 3MAAA 1HYZA 2YV0X 2ATLA 4F0HA 3L4BC 4C97A 1F2HA 1LWEA 1ZAWA 3GG4A 2E1RA 4TNOA 2RD5C 4ED1A 2OSQA 4I6YA 4HVJA 3RTVA 1AROP 3J80O 3MWTA 2GVDA 1YVFA 3DLBA 2CPDA 4CM0A 3DLJA 1MWZA 1WORA 1UEUA 1N33K 2IGIA 1MA9B 3HULA 1M90O 1JJCB 2AKWB 5DJBA 1BCMA 5KG7A 4EP5A 2MQMA 2GJ2A 3Q8VA 1FESA 3DRPB 1KCFA 2J0WA 3EPGA 1VQ7S 4QQBA 1BU6O 1FW6A 2AJ0A 3P5BP 4KHQA 3VETA 3W5YA 1HNIB 2ALZA 4WFXA 1DBDA 3MMCB 1EZZB 4TQRA 3KLIB 1UFLA 2PYJA 4QOTA 3C65A 2P9NA 2MB0B 1IN0A 2QO3A 4JI0J 4JI3K 4O3OA 4DPTA 1YI2N 3D6TB 4K4SA 4M5NA 4OMFG 2QM1A 2DIUA 1E6VA 3IGVA 4QR1A 1QTNB 4CJRA 4DR1F 3DRSB 4K59A 4HVZA 4CH0S 1Q1KA 3LP1B 1NM2A 3K2YA 3TZZA 1S4FA 1T03A 1DQAA 4LQ9A 3FEXB 1QHAA 2OSRA 1QSLA 1UPMB 4LF1A 4AXIA 2Y1JA 1B92A 1TQLA 2ZH8A 3O9UA 2XS5A 1Q0NA 2XMJA 4FN5A 4W5NA 4XIUA 2KHDA 3NGUA 2AJFE 1SC6A 4DPYA 3CCSN 1ULRA 4IDHA 5HVFA 3RMBA 2QJ3A 4NRUA 3A5OC 3M2UB 4H0TB 1Q79A 1RWUA 3I56S 2G0CA 2DD8S 3Q7CA 3CD0A 2UUAK 3SYZA 2UUBF 4I0WA 1YITN 5LL6Z 4I9LA 4Y28C 3H5UA 4FJ9A 2XY8A 3KDOA 2RVJA 4I2QB 1GT8A 1R6VA 4IG0A 2HBKA 2O8FB 2HQIA 2HBMA 2W4DA 3AD9C 1R6YA 3CVKA 4NASA 1Q7YT 5HK4A 4KBIA 2E44A 4L8RB 5K8PA 3C6UB 5DS7A 3K17A 3KTQA 3IBFB 4OV6A 1Y5IB 4M5MA 1FDAA 3R5BA 3MUVP 2Q43A 4OZ2A 1FJGJ 1FWLA 3PJXA 4NXMK 4A61A 3OYCA 1WC5A 1WOQA 1ZM3A 3MCNA 2QSWA 2E9TA 2ERRA 3B6BA 4HTIA 2XWXA 4C3KA 3HP9A 3OW2R 1RKJA 1YVNA 2X6NA 4B3OA 4CVNE 4OJ3A 4RWWA 2E1ZA 4XDDA 4FJMA 1FT8A 1VQ8N 4DFKA 2PO4A 4X4QA 1N8RT 4C3MA 4DB3A 3ATVA 1JLCB 1X4HA 2BDPA 4QU7A 1PBUA 3R27A 4MK9A 4YHHF 3R5CA 1LOUA 2EWHA 4ECWA 1EO1A 3OY9A 3ZTSA 3T5HA 3CCSS 2DRDA 4OZ5A 4P73A 1K8KA 5KFCA 1MROB 3UN2A 2BEFA 2DNZA 3ZFVA 5J2MB 2XYHB 3O1LA 3BGFA 1M5OC 4RG8A 4OX9J 2DY9A 2QLFB 3M8QA 4N8OA 3IXQA 3SZ2A 2JOQA 2E66A 2GIFA 1HHQA 2ROGA 1LWCB 3U1NA 2O1PA 5LXYA 3ZEUA 1WB9A 3R7SB 2F1FA 1N0VC 4ELUA 4HUEA 4J9OA 5L9XA 2Q3PA 3UKRA 1HNZJ 3SQ1A 5E5NA 2DRAA 3RR7A 1H6KX 3D2WA 2Y0BB 2EEYA 3V1RA 1XK8A 3N79A 1S1WB 4AD6A 1OVQA 3N6LA 2BANB 1RAGB 5AQMA 2FLPA 1OPZA 2CIMA 2A3JA 1B99A 3C14A 3L0QA 5HRPA 2KRRA 3UE2A 2WSEC 3MGJA 4AHVA 3CJ5A 2YWEA 5AXMA 1S9FA 1L3KA 4ZMMA 3KJNB 2P6SA 4A47A 3E66A 2E6MA 1GLLO 1RT3A 3VQQA 2W41A 2W40A 4QS9A 4R25A 5BRHA 4IOXA 2W2MP 4DV6K 3CM5A 2HVIA 2EX3A 2X3DA 3W9HA 3HJFA 1HBUA 4J90A 1S9EA 1CPZA 3O3FA 1CS4A 5IT9O 4FWKA 3I8BA 1YTYA 2Q66A 4DR6J 4H5WA 2WBMA 2P1JA 4M3WA 4TU7A 3C19A 3MXIA 2CA9A 1H98A 3AVFA 2D0AA 4O0NA 2OD6A 3AXKA 5ETSA 1NDPA 3HZ6A 4CF0A 5KFYA 5EUHA 3W5XA 3IGNA 1N33J 2EBEA 1VRQC 1YJTA 2D4WA 2J7KA 2R7XA 3S6EA 1BQNB 5DQGA 3ENBA 5F41A 4DV6F 2EC0A 1HQUB 4W5TA 1KHVA 3TPQA 3ZX2A 1ICEB 4F3MA 4KAIA 2FD2A 3OW2M 3IMXA 2ZM6J 2HHSA 1RT7B 2ZWHA 3AARA 4NL5A 2O3DA 3KD5E 3DGPB 1GTHA 3AXMA 4I6WA 5IM0B 4FLWA 5BN9A 2G0IA 3GJQB 3K58A 1JX4A 5KOWA 2B4JA 1N6QA 3BUZB 1NWKA 3SI6A 1IKWA 4WIQA 4IRCA 4DV7J 1PSDA 2B8PA 4NYZA 4RW8B 1RT2B 3ILOA 4K2XA 2BW2A 3LW5C 4WU2A 2IVPA 1R8HA 2CPJA 3I32A 4IYQA 4LUBA 3ZTPA 1SBRA 3D6FB 5KG0A 4FBUA 2C1EB 2IBOA 3TAMB 5BR9A 3I8DA 3THVA 2GQCA 4USMA 3ILJA 3P1GA 5AE2A 3ZSQA 3V4IB 3CMAS 1N36K 4M3XA 1APSA 2MZJA 4BVPA 3SPZA 2RN2A 3LAKA 2RF2A 2B6AB 1RTDA 3LANA 2IY5B 4CHOA 3SQOP 2EFGA 3PHEA 3MEGB 3FEZA 1C0TA 2N82B 3L2RA 2XEXA 2G8IA 2M70A 3L2UA 4KY3A 1XBWA 2X78A 3QJLA 4FZYA 1AA1B 3OSNA 3MR2A 1FJ7A 3A13A 3RG6A 5DDPC 2VFVA 4RU9A 2VUGA 1PCAA 4FYYB 4FS2A 3RSEA 1U1KA 1HWJA 4JI8J 3G6VA 1WEXA 1N5YB 2I5JB 1KTQA 2Z4PA 3CCUS 3AVCA 3OHBA 3BH6B 3ZZZA 3I5CA 3D2FB 3LPEA 4BRGA 3BDPA 1WHXA 2VJVA 4PAAA 1Q95G 1HKCA 3FFIA 4GKJF 1C1BA 3QZ7A 3HKZD 3CYMA 1DARA 5F9NA 4HWIA 3ATUA 3M2RA 1SKSA 2V4JA 3VMFB 3MECB 4I56A 2PY5A 3HFZB 2YKOA 2F4VJ 1NJWA 3MUMP 5ELZA 3PYFA 5IT0A 4NWBA 3SCJE 3TR5A 1KLNA 3O6QA 1VQMN 4HTLA 2KT5A 4OJHA 1IH7A 1I51B 2YNGB 3O80A 4I1TA 1S1VB 4UTGA 4YOTA 2F9DA 2NXCA 1IJJA 2D0OA 1RBOB 3RMCA 3DOKB 4M5JA 3P5JA 4CHQA 1G15A 1FJGF 1UWBA 3KHRA 2CNNB 2W2NP 2AF6A 4UT4A 1Q18A 4CBXA 1ZOTA 1S1WA 3TZYA 4JV1A 2Y9HA 3SCKE 2KT2A 3S3MA 3J8AA 1SH3A 3ITHA 1FDBA 4LF9J 4RR5A 1UVKA 3WC2A 3NAEA 3JS9A 4PWDA 4CLKA 3TJAA 4PWUA 2QIFA 3SUPA 4NZ7A 4BRLA 3THTA 5KFTA 2VGMA 2GJIA 1CJTB 4I64A 4CF9A 2ZD1A 1G7CB 3MAAB 1L3UA 1XR7A 3CF5Q 3U9ZA 2HHHJ 3GBTA 4A62A 2WAQD 3N5BA 3VGMA 4LF7K 3L09A 2YWFA 3VGSA 3PRVA 4K0KJ 5IT9Y 2O4IA 2M5YA 1TL7B 4DR1J 3SCXA 2CQ0A 3TI0A 3PYGA 3V1OA 2B3TB 5L1LA 4QS7A 3MM5A 1WTFA 2HRYA 4FJIA 1XUPO 2E4LA 1CJUB 5GADU 3OYDA 3CWJA 4FJLA 1KC8T 1S72N 3KG0A 3HSJA 3D68A 2XG8A 4KKOA 1X5OA 3J80U 1D4XA 4WBFA 1UEVA 3LH2S 1EJ7L 2G0JA 3MM8A 3I31A 3K7RA 4KB7A 2QC3A 3H6EA 3KYLA 3A3PB 3LDLA 1R59O 2XQCA 1V3ZA 5AJ3K 4OZ0A 4UOHA 4FF2A 5ETPA 4M5GA 5AQNA 4MKVA 1R89A 2ZJQQ 4JI6F 4JV2A 1VC0A 2FVQA 2IVMA 4BBYA 2YJEA 1XNQJ 3ZSZA 1VI7A 2QN6B 1NMNA 5AQSA 3LP2B 1VSEA 1X4FA 2RHKA 4J91A 2V9WA 2APOA 1H1VA 1CLQA 1PG5B 3DLKA 1ZM4A 3CCRN 2UXCJ 4F4YA 5IT4A 2ASPA 2DNGA 2QMXA 2QLXA 1K1SA 3HD2A 3FMBA 4FWQA 4URSA 2L41A 3F41A 4B3MF 4MYTA 2B4PA 1IKWB 3J81O 4ZITA 4KRFA 4CFAA 1IKXB 2RUSA 2XMAA 1TTHB 4ENOA 3UVJB 2PFFB 1SJRA 3VZIA 2WTFA 3BZQA 3ADAC 3MXJA 4KH6A 1VSMA 4X4PA 3ENOA 3AFGA 3KJVB 4BC2A 4ECUA 3G6YA 3T1HJ 3OVNA 5D0GA 3PIPQ 4HH0A 5M1FA 3M32A 3KDNA 2J9CA 1TL7A 1R7IA 1NAQA 2AJ2A 3IBWA 3D6MB 4USKA 3L7OA 4DHVA 1T3NA 4DL4A 4DR4F 2CH6A 2KJWA 4WIIA 4CP5A 2CQPA 3C7NB 4XO0A 2YQ0A 3VWSA 2FJXA 2B9XA 1LW2A 4ZIWA 1BQXA 2MDAA 1BUPA 3THPA 1CS4B 4F36A 1FD2A 3KHYA 2BRLA 4ECZA 1HBUB 3HXMA 3L8BA 1DY3A 4DV5F 4UZBA 2YKNB 3MM8B 2XS7A 3IM8A 2YWGA 1DT9A 4LSZB 1TK8A 1I6JA 4HYKA 1NJIO 4JI1F 1Z25A 5K14A 4CZIA 3IC1A 3BSOA 1QDUB 3EXYA 1AFIA 1AT1B 4J9UE 4ZA1A 2LQ9A 4OYAA 1KFDA 2PMZD 5KFBA 1FVQA 2HSEB 3CHWA 3GYXB 2HRUA 5HLFA 4QCLA 2CZ4A 5T14A 1J5EK 1Z26A 2FVRA 4U7BA 1D0EA 5J2QA 3W62A 4CF8A 3LOUA 4AT1B 4AQYF 4YOEA 3GV7B 2HQCA 2GHWA 1FRXA 3H5YA 4ID5A 1J5EJ 3HHKA 3MEDB 1BXNA 5T7LB 4B3SF 3AOBA 1XWLA 3CCQS 5KFQA 3R5AA 4N41A 3FBBA 5LT5A 1N34F 2UVUA 1GLFO 4JNEA 1URRA 3LWLA 4RW7B 4FWLA 1VQ5S 2IA6A 3O5TB 1HD0A 4KHYA 4LRFA 4WJBA 1NK7A 3TUIC 4GKKJ 5L38A 4HI1A 3R8YA 4TN2A 5AT1B 3KUEA 3I4PA 1HQ2A 4B9UA 2BKNA 3C46A 1ASVA 2GFFA 4ED4A 3P6YC 4CFCA 4E7KA 4OFZA 4FP9A 4B9MA 2QA4S 1QAXA 5EGYA 3DDKA 2F8MA 1NDLA 3QSIA 1UW9A 5IS2A 3EE8A 3K8WA 2YHWA 4KGXB 5AQTA 4ZVUB 1YWXA 2GMJA 3H0PA 1RDBA 2QYCA 1MG7A 3KG1A 4OKEA 1VYAA 3W8GA 3N6MA 2XULA 3A0IX 2HIQA 2BYCA 5C0YA 1NSQA 1GLEG 2XNQA 5EDWA 4A8KA 3HKWA 1TK0A 2DEIA 5IC4B 1VQYA 4JI6J 2MZRA 2Y3YA 3TA1A 2MJNA 1HPMA 4KTQA 5M2PA 1V4TA 3SI8A 5A6PA 4PXCA 2CNLB 4HTJA 3ALYA 3MR3A 3LWMA 1RE1B 2ZVSA 4BLGA 4DQPA 1EX8A 3UVJA 3W65A 4DU7A 2YBVA 5IM0A 3CMQA 2VH7A 3BQ0A 4M5IA 3SFGA 1HI8A 3M5RA 2JC1A 1WC6A 4FJGA 1NKBA 4K4WA 1N4LA 2MSSA 5KTQA 1NJZA 3H2UB 4IG0B 5L1IA 2KVQE 4H5NA 1B7YB 2HLUA 3KHHA 1GMUA 2E1CA 2DNHA 1NGGA 3WX8A 1UAXA 2FC8A 3KUHA 3W9IA 3EY1A 1PAEX 3NE6A 1HKGA 1JLGB 1ZS6A 3VQ8A 1T44A 1NGDA 2MEWA 3S01A 1NXIA 3HTVA 2CQCA 4BRNA 3DRXA 1HI0P 3BS9A 3BGRA 2CG4A 1JL1A 4HT7A 4C8NA 4QYZJ 4DV0K 5J2QB 3KNGA 2GVZB 2YWHA 1YUWA 2BM1A 2YHAA 5C25A 3VAIA 3V9WA 4LBIA 2H1YA 5LMNF 5HLFB 1G3OA 5I42B 1AYEA 2ZZTA 5BREA 2CJAA 4DSLA 1JXEA 3RJMB 2LXFA 2QA4N 4IEEA 2CRLA 3U3GA 4OX9K 1JXBA 5ADZA 1BA1A 1OKJA 3AVLA 4IO8A 1FWKA 2ZH3A 3O9SA 2JWNA 3SAHA 4PWWA 4ISEA 1RWMB 3UNYA 4H0OA 2Q36A 5H1SV 1RJJA 2E9RX 3DHWC 4MJKA 2OPRA 5KG4A 1J2VA 2NXEA 4O55A 4CH7A 1IBMJ 1S10A 3G10A 1QAYA 3NDKA 2XY5A 3NCPA 3C15B 1U25A 4NE9C 3PJWA 5KRTA 3OYAA 4URQU 2BUNA 1X4DA 1AB8A 2HIYA 1HIYA 4K2JA 1IQZA 4P10A 4GY2B 3EPIA 3K5NA 4CIFA 3MFHA 1UJ4A 4ILJA 5H9FK 1LK7A 2XHCA 2NYIA 3W1YC 4FWOA 3VF0B 4OZNA 3MX5A 3FDSA 1R0BG 2GIRA 4DUZK 3LPYA 1PYSB 1TU0B 2CJXB 5EX0A 2CJYB 3ZSYA 1ASUA 2NUUG 3PUFA 1IBKJ 1T94A 1JKHB 2XMKA 2JWLA 4CZLA 4DJBA 3O8WA 2QMUB 1XMOF 4HL9A 3M2RB 3GE9A 3SUQA 1GXTA 5KFRA 1ESVA 1VHXA 4HKQA 3KLFA 3DJCA 4NI2B 4BDZA 2HSTA 4G1PA 2FJBB 3TUZC 1D5AA 3VQCA 3M8SA 4CLFA 1CXUA 3T3FA 1NJXA 2VC0A 3MPUB 1MWMA 4ILGB 1BUXA 2HG4A 1Y0HA 1BGXT 1FEEA 2HBZB 3FVYA 2FZCB 3TAMA 2RSQA 1I94J 2RPIA 1K8AT 4LFBF 2L08A 5AQLA 2FYXA 1TUVA 2R7VA 2RUGA 1TL1A 3SSSA 3IM9A 4FW1A 3VAKA 3D4JA 4LF7J 5C24B 4OX6A 5KFZA 3KJVA 1VDHA 1Y9OA 4DPOA 5E26A 1TV6B 4FOEA 3I9V9 1MNEA 2HS3A 3RUBL 3SBTA 1H72C 2B6AA 3KK2B 5B8HA 2HGNA 4AL5A 4AHUA 2PC6A 5MLCV 1VQLS 1FFSB 4IG3A 2PFUA 4FJ8A 1JLQA 2CDQA 2MY8A 2P9SB 1WHYA 1HBOA 2WC9A 4KAZA 4DR6F 3LAMA 4MAKA 1FNOA 1RTJB 4BQZA 3BSNA 2HBRB 4OYXA 4QZVB 4QWEA 3NS5A 3PEJA 4A8MP 3ISNC 4DV3F 4IH5A 3R5JB 2RKIB 4XDCA 1UCNA 2E6LA 3UO0A 1ZC6A 1FRIA 5LL6d 3D5MA 1MU2B 3EL2A 2PAVA 1PJ6A 4X4TA 3ULHA 3Q22A 1S72S 4C0BA 3CSKA 5C42B 3M05A 2PGCA 1T03B 3KHGA 1YBUA 2HQDA 2L48A 1WDTA 3OBYA 5C10A 1TL5A 3WXKA 5AQUA 3H42A 3ONQA 4V1Ak 4E98A 4Q0BA 1CQNA 4ED8A 3H4DA 1R43A 2NRWA 3G8TA 1YF5L 3V9XA 5KFIA 1OVYA 1XQSC 4IEIA 4QIVA 2ASYA 3DRPA 2IMOA 3OYGA 2COLA 1F9FA 2P9UB 1JQGA 2Q79A 3GG1A 2V9KA 3NMAA 4Q8FA 1U0HB 3FGUA 1FERA 2UV8G 3K9KA 1BQNA 3EVWA 4O4GA 4WQ5A 4UOFA 2YKQA 2MKCA 2LEAA 1OY9A 3CD6N 1YIJN 2LEPA 3JTNA 4IXCA 3QFUA 1FKOB 1EHWA 4R79A 3RB3A 1T0TV 5T7LA 3KLVA 2RQCA 2MSTA 2KQ2A 2JFKA 5FLXY 2ZDPA 4PKGA 3DFEA 2HHVA 3L7UA 4YHHK 2CPHA 2IVYA 2IRXA 4NLDA 5C25B 4AHCA 3QINA 1LW2B 3TUPA 4CJ3A 3E2EA 4U6PA 3TSPA 2FJAB 4CEOA 3I0SB 4ES1A 4CJPA 3T5KA 4CF2A 4BDPA 4RZRA 1BCOA 3TTFA 2IRUA 3T69A 1MWKA 4W5RA 4YHHJ 1LK5A 4BR7A 2HF3A 3D2FA 1VQ8S 2EHGA 2FDNA 2YHYA 2RE2A 1OH6A 4P71A 1HNVB 2HPUA 2Q31A 4CLPA 3S3NA 2EFQA 4JKHA 4JV5J 4DTSA 1DTTA 2JGUA 3P8BB 2WBRA 3J7ZT 3BH7B 5DDRC 2IVNA 1C2PA 3GJRB 1J53A 3R1LA 4FJNA 1BWEA 2YPYA 2J8AA 3R8EA 4QR2A 3M3ZA 4L73A 3G6ES 2CQBA 3EZWA 2F4VK 5JVGQ 3D7EO 6AT1B 1NBEB 1YJNS 2WBNA 2R7UA 5IQ6A 2MGZA 3E51A 5AQIA 4WFYA 2BBEA 3NFAA 3ASMA 3UCUP 2XC9A 1U2CA 1BC6A 4B1ZA 2P5OA 1B3TA 3J7YU 3CCJN 2EC2A 3NCRA 4DR2F 2MKYA 4F02A 1QLNA 5I3QA 5KFSA 2WHOA 3KVGA 2P6TA 2GHVC 4LR8A 4BRKA 4M63A 4W90B 4DSJA 3OFHA 3J81Y 3UPFA 2AEMA 3W3DA 3PY8A 1NLKL 1OIAA 5C12A 3CPEA 4IQXA 4EP4A 3DXSX 3KLHA 1TYQB 3NH0A 1VQON 4BROA 4Q8EA 2OZMA 3CC4N 3F9KA 4KO0B 3MN7A 4DFMA 2KO1A 2V34A 3VQDA 4AL7A 2Q6BA 3NEKA 1M5HA 3E9OA 3VF2A 4H4MA 4DKWA 1YVUA 2J8SA 4GNIA 3PTWA 4KYZA 4FPBA 1RT4A 2CYYA 2DYAA 3THWB 5AQHA 2V69A 4QJVA 4CLSA 4PXBA 1SCJB 4B9QA 4ES3A 1RCHA 1YBAA 3O5BA 2NXUA 3Q83A 3GP9A 1SJ4P 1EP4B 4G1QA 4Q2LA 4KKOB 1XJWB 2OO4A 4J8FA 3U8XA 1M5PC 1WKLA 1JKHA 3ZTQA 4I9QA 1BQMB 4FSVA 2DNYA 2HGLA 5AXKA 1GOAA 2ZZMA 4D3GA 2AP6A 2FTRA 3KLEB 1Q82O 1U8WA 5GINA 1TP7A 2HQGA 2LVWA 3L95X 1VSFA 1RWVB 2X1AA 3TARA 3IR6B 2FJWA 5HO4A 1AUDA 2A18A 3CMAN 4WFNQ 3I9ZA 1XHZA 4CJLA 2ZOMA 2VICA 2O4GA 1YX2A 4X64K 2OKQA 4H5RA 2VG7A 3HFVA 4ED6A 1JNRB 3WNFA 2UXBK 4AM6A 2WB4A 3MMAA 1VBKA 3MK6A 2VQEJ 1IBLF 4DSKA 4LFCK 2PT0A 3CJSA 2EBGA 3T1YF 4H0YB 1MROA 4M3TA 1UWAA 3S3OA 4FWRA 3T6BA 2FVCA 5HATA 2ZWOA 3GTYX 2HGMA 2XTJP 3QT6A 1RISA 3SNNA 2ITGA 3DOKA 3FZLA 4DR7F 2LDYA 2YTCA 3H1QA 1A0OB 3GJSB 2BVZA 4P75A 5I42A 3V4MA 1FHTA 4DTOA 2GV1A 1ZBSA 2UUWA 3SV3A 2P51A 2E1YA 5AXLA 4C0HA 1NGBA 2C2DA 2QG9B 3CUNA 4PUOA 4EBCA 1UVJA 3OVAA 1M5VC 3L6QA 2WVCA 4CZCA 2UUAJ 4L72B 1IJEB 3U3YA 4GC6A 1T6DA 5M2RA 3CM6A 4UY8T 5F0UA 2KL8A 4HHHA 4YB5A 3T7ZA 3VTHA 4L74A 4PXEA 1N34J 3KJFB 4G1QB 4FLVA 3E01A 3RBEA 2UVRA 1JK9B 5GMEA 2OYQA 3U02A 4PQAA 2G1HA 2UUCJ 1TELA 4CGJA 2VFUA 2CQ2A 4NLYA 3TVKA 4YN3B 4Y2IA 3PSIA 2BV3A 4IOBA 5A2QY 4L76A 1X9WA 4OI1A 3QZ8A 4QR0A 2R3VA 3IFRA 1KOOA 2B7BB 1T6CA 3RRKA 5FPNA 1U1MA 1RHKB 1ZPVA 4A8XA 4CJKA 4OI4A 5KFLA 2D3OR 3CCMN 2VYPA 3BYRA 3JXOA 4DUTA 3V9SA 4JEPA 3GQCA 3FCWA 2ZNYA 3WXJA 5E33A 2QKKA 3GG0A 4BC5A 5A8RB 4M63C 2QV6A 2V6AA 4AHTA 2QLJB 2KXHA 3GR1A 3O9RA 2VZ9A 3B78A 2GQ2A 2CQIA 3QQCD 1VRTB 3L2QA 1H7XA 5A2QU 4O23A 5KFJA 3P31A 4ZLPA 4DV7F 2X1GA 3D9BA 1VIOA 1YJNN 3T9ZA 2VGNA 1S9GB 2MTLA 1FWPA 2V7ZA 1G1XA 4U67Q 2A5XA 4N77A 4K50A 5KFFA 2XMTA 2J6TA 3K5MA 4NLUA 3KWGA 3CE8A 1U1PA 1DFDA 3VQ5A 2DXEA 4P2MA 3CCEN 5DG9A 1UP1A 3HSGA 4LRAA 4K42A 1N6QB 5E0OA 3ETOA 2GGPB 3MTKA 3CDEA 5EU7A 1QUPA 2HNDB 4DV3J 5KFGA 3DLRA 2HYIB 2BKOA 4JHDB 5G0RB 5CE3A 1HW8A 3WIVA 4LF5J 4M8LA 2X51A 2AGPA 3RMAA 1YJRA 4KRWA 5KFMA 1PC4A 4DF4A 2VG6A 5DQIA 1Y97A 2E5LJ 3MM5B 1Y4ZB 2OTJS 1SIWB 3VOVA 2OD4A 2PYLA 4JKDA 3VV2B 4K4ZA 4IRKA 1S0NA 2ZJQL 2F40A 2W01A 4M42A 4JI0F 1XMOJ 4DG1B 1PO6A 2E2PA 1TZ0A 2BRKA 4J9QA 2GS8A 4CJ4A 2YX6A 2MQ8A 2Z30B 3OFFA 2E29A 1NU4A 2VB6A 4F7VA 4URGA 3O9TA 3V6DA 2YKNA 4LF5K 1HNIA 4PG7A 4CK3A 4K5RA 1G99A 1N5VA 1UAWA 1V9OA 1JCGA 2WW4A 2D9PA 4X62F 2DIVA 2BGGA 1RI7A 2WRMA 5MLCQ 3DYAB 2RE1A 3TWZA 2H3GX 4EBEA 5KT6A 5AR0A 4NCBA 5SWMA 1H74A 4CJSA 4RJVA 4Y00A 2RH3A 3GB0A 2O01C 3FFKB 4KHPF 2I7NA 4Y0WA 1RBAA 3UCGA 4NO7A 3PFOA 2LXIA 3VEOA 5LJVA 4RCHA 2HVDA 3IG1A 4IKAA 1KC8O 4LF5F 2D7SA 1H2TZ 3BO4A 2P9UA 5AQXA 2ACMA 4GVBB 3Q8PB 1UVLA 1J6ZA 3G96A 2R8HA 2PFDA 2DCUB 3ZLJA 5ADXH 2AGOA 2CG8A 1WWHA 5C2CA 1GLAG 3VAHA 1FXXA 1S1UA 4ZVRB 4GO7X 4H8KA 2DPIA 1N5QA 3O3GA 3JYTB 5LMUJ 5KFNA 2KG1A 2DCLA 1RDWX 2HMIB 1PAUB 3C3LA 1JXLA 1HR0J 5D4OA 1WKKA 1JLCA 3WC0A 3OUYB 2QFIA 4BRAA 5CH7B 4W5OA 3TSUA 5KFKA 1FVSA 3W63A 1FE0A 2F4FA 4CZHA 1HBNA 3M6VA 5KFDA 2OPPB 2JVRA 4DUYJ 4TQSA 2ZJRL 2VASA 3QWPA 4I67A 5GAGU 3R7BB 4KGKA 1TUWA 3SMSA 2X6SA 3FR0A 1I3OB 3BZCA 2F96A 4BCAA 4EUVA 4LRCA 3GE1A 2P9SA 4B8AB 3AA4A 4MKYA 4OYPA 2WOMA 4P72A 1TVRB 3CC7S 4C8MA 4ID8A 4IO9L 1S7HA 4YR0A 1B70B 1FDDA 2Q1LA 3N4PA 1SH2A 2FLOA 2GV9A 1KVCA 1M90T 1YKWA 1QQOA 3MWPA 7FDRA 2VFTA 1YXQA 3OUYA 2GJFA 3M7VA 4NRTA 4DR3F 4OLOA 2RHQB 3JAMU 5L8RC 1XNRJ 2DGSA 4F2SA 3BF4A 3CJRA 4YDUC 2VFSA 2I1RA 3QATA 4CLUA 4LF9K 5U47A 4GMJB 2VPXB 4M5DB 4J9VA 2IAJA 4CLWA 3BEGB 1QSSA 1U1NA 2KKZA 3OYKA 3MX2A 1FE4A 3D0IE 2IDLA 3MMCA 1YRUA 2K8GA 2HHPA 1VSKA 4CRJA 3LUYA 2E7VA 1IQTA 3CJAA 1UEKA 3AODA 3CB4A 2V8DA 2JC0A 4RBUA 2ZF5O 4J2EA 4DR5F 2HHTA 1RILA 4LD0A 4CI6A 3GFYA 4FZVA 4MFBA 4Q2MA 3MUTP 4OPAA 3OSPA 4O4GB 3NNCA 3MEDA 2ZBRA 5GMKa 3HI0A 2VKRA 3JSRA 1BG3A 4U67L 5KFPA 1NHVA 2JJ4D 3AHPA 2J76E 1IKYB 2QE5A 4BRHA 4GKKF 3PLAA 4ALZA 2JLFA 1FKPA 1VQKS 4LIWA 4UOCA 1VSHA 3ZZ0A 4YP3A 2MHEA 3BGRB 5LSRA 4HHUA 2ADCA 3GV8B 1LWCA 2UUBK 1R8CA 2Z1GA 5CHCB 2YWKA 3UDEA 4JBCA 1S6QB 2DXFA 2VQFF 3MPYA 1BI4B 4CO3A 5D0EA 3ITHB 3CCJS 3VAFA 3NWRA 3BGOP 4R8UB 2V4RA 2XMUA 5KG5A 2AMCB 1SL2A 3Q2SC 4L3QA 4ZTJA 1P27B 4Q45A 4BC9A 2OAUA 2CPIA 1R8BA 1YHQS 4WP3A 3M6GA 3GILA 1RZMA 2IAJB 3M9OB 5CCMA 3LP3A 1IM4A 2CPFA 4YQWA 4P74A 2GX9A 3WEEB 3CEDA 2LQBA 1DTQA 1MMLA 1ATSA 3J7YI 5HQMA 3QGPA 4FW2A 3NS6A 2HWIA 4NYFA 4WQ4C 1CG2A 4GRSA 1KD1O 1BIUA 4LSNA 2BJ8A 3VQTA 3DM2A 1WAJA 1U2FA 3SCIE 4CJ5A 1PKUA 1I3AA 4TYBA 4B3TJ 2DY4A 1JWWA 1A5XA 3LDOA 1FXRA 3RR8A 1U0SA 2KXNB 2Z2LA 3C2PA 1YK9A 2GMLA 3ZETB 2C3YA 5JXSA 2H51B 2AZ3A 2FBTA 4DWIA 2GNKA 5E3CA 1VIXA 3VGUA 2QWLA 4GVBA 3TNVA 3TA0A 2XM3A 4DOZA 5IFMA 5IV4A 1ZH5A 1FFGB 3KLFB 5JS2A 3GU0A 1YJWN 3KK7A 3QIOA 2XY7A 1Y00A 1QVFR 3E1YA 1WKJA 3MXMA 3I87A 4ILRA 2JEIA 3CO9A 2KZZA 4K5SA 1P1LA 4O8KA 2FUG9 1RT2A 4FPRA 3NBPA 4JUZA 3U7JA 4E7JA 3OYMA 1CBKA 4EGLA 1J5OA 1SKUB 5LJ3Y 4C6AA 3H46O 3M9MB 4CZEA 4A5BA 5DMRA 4IFYA 1O13A 1VK3A 2NUBA 1FXDA 2OEKA 4DZ6A 2AW0A 2DHAA 5KOXA 2V68A 1JB0C 1S6PA 4IO9Q 4C11A 1Y11A 5BPMA 1TL3A 2JX2A 1JJ4A 2QEXS 4LF7F 1B9FA 3CW2C 2F9WA 2YKMA 2PMWA 3K9JA 3K57A 1ATRA 3RAQA 4BACA 3KKFA 4CEEA 1M5SA 2YHXA 4Z2XA 2PI5A 1D9FA 4BE2A 2N7CA 1WI6A 2IJFA 4IKFA 3A4TA 1H2UX 3W66A 4CLZA 3HYFA 1NH7A 3IMQJ 3QLHA 3DMJA 4BRFA 1XMQF 4CO2A 3L3CA 4LH5A 4AM7A 2G2ZA 4LJMA 3C6AA 4BWJA 3O44A 3OTOJ 2IA0A 3J81j 3HVRA 4ETXA 5CZ2A 4DG1A 1H73A 3AY9A 3GZ7A 4FCYA 1F21A 1B0VA 3CJ3A 3FSIA 1P90A 3MCOA 3O3HA 3AA3A 2RU9A 5FIIA 3GYNA 2DPJA 4O3PA 5M1PA 1ITPA 3VENA 4H5TA 1W9HA 4RW9B 3J7YP 5FDLA 1YJWS 4FVUA 2B0GA 2ZHBA 3B82A 2E5HA 3FNNA 2V4JB 4CHYA 3HJVA 4NX9A 1NKEA 2QRRA 2MKJA 3RMDA 1GK8A 3WHIA 1UTAA 4KHNA 4JI7K 4DR4K 4GV3A 3SJHA 4KHPJ 1JLGA 1HI1A 1OS5A 5JUMA 2Y1IA 3H8YA 4GVLA 1VBXA 2V8PA 3MCSA 3J81U 4CH1A 4U7UD 5J2MA 3CJ8A 1W2BR 3AVGA 3UD4P 4HTUA 3HDSA 1T02A 4B3MJ 1E6YA 1OQ3A 2QWMA 2UXDK 2HNYA 4GVEA 3I0RB 1SQFA 1TGOA 1LXNA 1Q82T 3K59A 5A2QO 4ZPAA 3I4HX 5C2FA 3WEEA 2N7YA 1JIHA 4MO4A 4BWMA 4F0MA 1SV5B 1K73T 3PIPL 4Y2CA 1NCLA 4PZVA 3WXIA 4P9SA 3UKUB 2B56A 2AEJA 3LDNA 3N28A 2PE8A 2BZ2A 1AUSL 3M6XA 5A8RA 1EWQA 3G71S 1BHLA 5KT7A 3T1YJ 4H4OB 1OWXA 5JLHA 2JEFA 4YB6A 1CZAN 1B7FA 1Q4RA 2XZDB 4XAKA 6FD1A 1NGAA 5IZHA 1KBRA 2YQ3A 4DR4J 3D0HE 5LY3A 3HZGA 1WG5A 4RX6A 4AQYJ 1Q5VA 2VG5B 2LU1A 4CJVA 1F5BA 1LEOA 3ZCMA 3ZSOA 3BF1A 3WT0A 3D1HA 2NZTA 2GO9A 3DOLA 4A8YA 1PYOB 3A2FA 3Q7BA 5M1KA 3D1QA 1X4EA 2UXDJ 2ZKTA 3DLGB 4NZ6A 5E84A 3PM9A 2I7PA 3ZT3A 4CLYA 2I38A 3L2WA 4RW6A 1KOHA 4OHVA 4EFAC 3OXGA 5AQPA 5DG7A 1S99A 5HVHA 2ZC4A 4WPAA 2OUGA 3AA2A 2NRVA 1U6ZA 4RNFA 3Q8SB 1X7VA 5LXRA 4MIWA 1HBMB 3AVJA 3RB0A 4MDBA 2DJWA 2FF3B 7FD1A 4GC7A 1N32F 2VBYA 3R1HA 4WTYA 3QMLA 1FKPB 3C6TB 4RNNA 4FF1A 3MD1A 1R27B 2EFPA 1W7AA 2EG1A 4CHZA 4OPHA 3WIUA 3PO4A 1RGVA 1I1GA 4ILLA 1M1KT 2DVIA 4I2PA 4ZVEA 1T9WA 2JDJA 2V8HA 2VBZA 3K89A 2DBBA 4JI3F 2P8IA 4RWTA 3THYA 1VQ4S 5HBMA 1JLFB 4A46A 3ULEB 3IRWP 1S77D 1U1RA 2UUCK 4CLTA 1VQ9S 2MZSA 4OX7A 3A5NC 5GVQA 3PV8A 1V6HA 1N32K 3JQJA 2DT9A 2KKHA 3NGTA 4CCHA 4IUFA 3RWUA 4WYBA 2W2QP 3DRYA 4FM1A 1RT1B 2QL9B 3O4NA 2YHBA 5EHHA 1SAZA 1K47A 2E2OA 3HO1A 1HUXA 2C2NA 1U2RA 5AQKA 3TAFA 3MN5A 2VFRA 1WN7A 4LF4J 5DRKA 1S76D 1RACB 2OPQA 1CULB 3FQLA 4JKGB 3TTCA 1UKUA 1TL3B 4E1JA 1WBBA 3QSYB 2QWPA 3CJKB 3ZZRA 3M8RA 3MD3A 1CLFA 4PKIA 2CWXA 4WU3A 1EIYB 3Q24A 1JL2A 4KV8A 1B4SA 1T9VA 1WC1A 3WXLA 2DHGA 2NS1B 4E7IA 4CZGA 1CJKA 3R6LB 4FJHA 4LMZA 3UN5A 5B0FA 5AQRA 2ZM6K 2F3JA 3A5LC 1LQ9A 2OTLN 1SV5A 5F1XA 3UFCX 3FE1A 2KYXA 3OS0A 3QGHA 2NSBA 1JLBB 3D0GE 2FQQB 2QWQA 2A40A 2XHWA 2Q2RA 1SQGA 2IC3B 4DX8H 4CE9A 3M6UA 2QT7A 1YRTA 2YWWA 3PNIA 4YY3J 3FZFA 4CESA 1U1OA 2JVOA 2OI2A 3VQAA 3K2PA 2W7OA 4I6MA 4QW9A 4MQ3A 4LFCF 1HBNB 4CGIA 2ZGYA 4CGFA 4JKFA 2VWBA 4NA3A 3GIJA 4Z4CA 1TVRA 5DETA 2VL1A 4PKDB 1H7WA 5K5MA 2OA8A 3SQ0A 3PYDA 4CO4A 4CK1A 3WBZA 4NCGA 1S59A 1FA0A 3CJTA 4FXDA 1RTDB 3TANA 2XS2A 1F6TA 3DM2B 4IZ9A 2FC9A 1F3FA 4A2BA 5HL7L 1XI1A 4DLEA 2R2RA 1SI9A 3DLKB 5F8LA 4CNZA 3EDQB 5J1EA 4PPDA 3BPDA 2CPZA 5FDLB 4O3RA 2IYIA 3D6HB 1REVA 5ETLA 3Q8QB 3LGHA 2OPSB 3EWGA 4F4WA 3ID8A 3IG1B 3ENQA 1GAOA 2ZOGA 2G2OA 4GV9A 2DGVA 3SQ4A 1OH7A 2HBLA 5AFUA 4OX9F 4X66K 4NMXA 4F4ZA 4QWBA 2UXDF 2O8DA 4JKCA 3NNAA 2R8GA 3EGVA 4CF1A 3OTOF 2QI2A 3V5RA 4HUFA 1WDDA 2A6MA 2ZUGA 2DNMA 3MTJA 3FLCO 4XH5A 3R5GA 5ETQA 4E7HA 4BR5A 2DNKA 4E1NA 4KPYA 4GKJK 1WSRA 1BIZA 4Y65A 3LA0A 1HA1A 1K73O 4CW7B 2FGOA 5A8KB 1IWAA 1PIEA 4M1KA 1XIQA 1U0HA 2MJUA 3AT1B 3PW0A 4ZVGA 5KI6A 3IWLA 3EE3A 5D4NA 4JI2F 4V19X 2R7RA 4BREA 1RLCL 3THXB 2XZWA 2D0BA 4B02A 4AF1A 1HWKA 1SJFA 5BPLA 4RTFD 1QUVA 3CJ1A 5F8HA 4YR3A 3DDIA 1OH8A 4LREA 3G87A 1K6YA 1M1KO 4FJ7A 4JI1K 4JI4F 1HQEA 5GADP 4MDAA 3LDSA 4J2DA 4TY9A 2CXEA 1G2EA 4YDXA 1RK8A 3NMRA 2HOEA 2FF6A 4BC3A 1R8AA 2HZCA 2NRXA 1U6BA 4DI6A 4KI4A 3CCZA 4JI4J 3U4LA 3MWBA 4A5AA 3PW7A 2H65B 4LT6A 3AAQA 1W97L 4CFBA 2AJQA 4CLLA 5I9EB 2BJEA 3QRRA 2Z1HA 3X1LB 1N36J 3U27A 2UV8A 2HFZA 1NHUA 1W2BM 5C15A 1MSWD 2H5JB 1S0VA 2LXUA 2W25A 1IXKA 1K1QA 1NM1A 3G71N 1VRTA 4B1WB 2HHXA 4DN0A 1CQMA 4Y34A 4TSXA 3ZSVA 4CIOA 5KRSA 3SDEA 1IUJA 1U45A 1WACA 2ILYA 2IOCA 1KFSA 3B6PA 3M30A 2AU0A 3CQYA 1JLQB 2W9BA 3HMJG 3BZKA 1VQ9N 4DV4F 4YS2A 3QERA 3FSYA 1RBUA 4EZ9A 3NKYA 1OSCA 2LP4A 3MEKA 4LR9A 3MN9A 2AYEA 1C1CB 1FRJA 2D74B 3T5LA 1NO8A 5GAGP 2C2RA 5D78A 1ZBUA 3G2XA 2DFFA 1F5CA 4ZP7A 1VQKN 1VRUA 4G65A 2C3OA 1EX4A 4JD2A 1O8BA 2FHOB 4JI7J 1HKBA 4FPIA 4FL9A 1BISA 4ZS6A 3QRPA 2HS4A 1GOBA 3ZSXA 1Q16B 2IHR1 3CO0P 4M41A 2EFNA 3TX0A 2ZITA 3OYNA 3H98A 3RAXA 2ZUAA 2R7TA 2LQ5A 2W8KA 3SSQA 5IWAJ 4HCBA 3KLGA 1AZSA 4YY3K 1Q8LA 4HHJA 3AA8A 2V8GA 2G4BA 3FBFA 1LOTB 1BA0A 4FJ5A 4N5SA 3R2DJ 1WUUA 4CT8A 1ELOA 3N4WA 1ZA2B 1S6QA 2MQPA 3MCPA 2V2KA 3HPOA 3IRXA 4DV1K 5TKYA 4NLGA 2QTDA 3VHQA 4DUZF 1WSFA 3IS9A 2O66A 3LL3A 1N0UA 1X9JA 4PKHA 3OTEA 2P9EA 4OL8A 2F8SA 1HMVA 1AW0A 3CETA 5KG2A 3T6JA 3UNGC 3MHYA 1X0PA 5HN0A 3BPSP 4XH4A 3DMJB 4OYZA 4YY3F 2QFJA 2AYGA 1U02A 3ZTOA 4EK2A 1SKWA 1HNVA 4CEFA 1YG0A 4XK8C 4DCOB 4PG5A 1DZ5A 4ZCMA 2CPYA 1F0XA 3WXMB 4EWTA 3JSYA 4QS8A 1K44A 1RWXB 3OFEA 3VESA 3TQ1A 4LF6F 3DLEA