1RTIA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 143
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtiA05
4B9NA 4ZVHA 2ATQA 4RNFA 4Q44A 1S1XA 1WSEA 3GYNA 1JLCA 3QESA 5SZTA 4N76A 3CVKA 2HHTA 3TAMB 4FJ7A 4H8KA 3I5BA 3LAMA 2O5DA 2YHAA 3AVFA 1NKCA 2KTQA 2YHBA 4NCGA 1MU2B 4J9NA 4R0EA 4NLOA 4Z0UA 4DS4A 3HM9A 1FKPA 1IKVA 4PY5A 4ED7A 2W8KA 5C24B 2HHWA 1RT1A 3C6TA 1JIHA 1KHWA 4B8AB 1ZBHA 3Q8QB 3QZ8A 3CWJA 3O4NA 3EYZA 4B9SA 4IFVA 2HHVA 1G15A 3CFPA 2IMWP 4RW9B 1ZBFA 1WSJA 2YNGA 4DF4A 4BDZA 3ZSWA 1LWFA 3OYJA 1T94A 1TK0A 4C8LA 2E6MA 2WCXA 2W9BB 2IS3A 5KRSA 3PVXA 3CQ8A 5HRPA 3HVTA 1N56A 4KTWA 1RAJA 3I5CA 3T5JA 2OPSA 5I42A 2YKMB 2OYQA 1JLEB 4DTXA 4DMNA 4J2DA 4TQSA 4PUOA 4LY7A 5FRNA 4NLWA 2UUTA 1Q9YA 3U6FA 5JS2A 4DTMA 4DL3A 3UPFA 2UUWA 3QEWA 4KHMA 1JLAA 2BQRA 2F8SA 2IM1A 2BANA 2B5JA 3O3HA 1K1SA 4YFUA 4J9QA 4WZMA 1RT4B 2R8IA 3K59A 3RTVA 3SV4A 1N6QB 4M45A 2E9ZA 1TKZB 1D8YA 5HP1A 4CCHA 5HLFA 1RYSA 1BL3A 5KT5A 4CJVA 3GQCA 4RW6B 3DLGA 4FW2A 2AJQA 4FK4A 1I39A 5EWGA 4CHQA 4RUCA 1WAJA 4N56A 5F8HA 3KK3A 2XGQA 5KFYA 2ZKUA 3DRPB 1C0TB 1L3TA 4DWIA 3CDUA 1U04A 2BQUA 4G1QA 1TVRB 4RUAA 1TL1A 5KFZA 4MFBB 5KTQA 4GC6A 2VG6A 3HK2A 3HHKA 4IG0B 3HXMA 4FM2A 3PW4A 1T05A 1UA0A 3AO2A 5DLFA 4LSNB 1KVAA 3DLKA 5L1KA 1ASWA 1BGXT 3UIQA 3Q8RB 3PW7A 1HARA 4FJIA 4I9QA 4RNNA 4PA1A 3SUQA 3HYFA 3K5OA 3OYDA 4MKBA 4WFYA 1NK4A 3PZPA 1KLMA 3G6VA 4HUEA 5J2NB 1QE1B 3ALYA 4I2PA 5C25A 2JEJA 1D9FA 5FRMA 2RKIB 3QLHB 4Q5VA 4DTNA 1REVA 1HPZB 1HYVA 4CJLA 4DTJA 2XGPA 1Z26A 3V81B 4KFBB 4DFKA 2ZE2A 3VQCA 3V4IB 4H4OA 1RTDA 1EXQA 2XY8A 3OYNA 3DOKA 2AGPA 4CK2A 3V9ZA 4HCBA 1WLJA 3BQ0A 1TAUA 3C94A 5CYQB 1J54A 2QKKA 4KSEB 5KFGA 4FLYA 1RDCA 3OVNA 2HNYA 3QINA 1RBSA 2W42A 4M3ZA 4FYDA 4QWDA 5D3GA 4Y34A 4I2QB 3CJ2A 1XHXA 3ISNC 4LSLB 2JC1A 4ICLB 2KQ2A 2FBXA 2UVRA 4XO0A 1HMVB 4OLBA 4RW4B 4Y2CA 4KPYA 2GIRA 4Y2AA 2FJXA 4K4VA 1U45A 2YNHB 3HVRA 3N6NA 3VQDA 3NAIA 1W25A 1BIZA 4YMEA 4CGDA 1C1BA 4FK0A 2WTFA 2RDIA 3ZSXA 3M9NB 4ZTJA 3NKYA 1HQEA 4QOZB 4ELUA 1VSLA 4IRCA 4FBUA 4K8ZA 1T03B 5F8JA 2XY6A 4ZP9A 1TGOA 5DK5A 4OJRA 2FLNA 4CJ5A 4XPEA 4F2RA 4CK1A 1S49A 2ILZA 3NFAA 3QIOA 3CO9A 4LH5A 2FBVA 3PHEA 4WXWA 3MR2A 1NJYA 4J9SA 3RB6A 4O4GA 3LP0B 2WHOA 4IR9A 3PJWA 1U48A 2ASDA 1CXUA 5J1EA 4FJGA 1IKWA 3PUFA 2P1JA 3NHGA 2Y1JA 1HYSA 3E01B 5KFVA 2G8VA 4DFPA 3K2PA 3M8SA 4ZTFA 3SNNA 2WONA 3IGVA 1RDBA 2XY7A 2W7OA 2I1RA 3BDPA 3OSPA 3ITHB 4Q0BA 5E41A 4WYWA 4K4UA 3D0PA 3QIPA 2DFHA 3AVCA 3DI6A 3NGDA 4AHUA 4B3OB 4BWJA 4J2BA 1K1QA 1S9EA 1RT7B 3VQ8A 1RTJB 1VSHA 3OHAA 4KHUA 4R8UB 4QPXA 3K57A 1SKSA 1C0UA 1S1WB 4FVMA 3I0RA 2BE2B 1FKOB 1VSIA 5CY4A 4NLPA 1HRHA 3BGRB 2ITGA 3G6XA 1VSJA 4B9MA 3L2QA 2B4JA 4C8KA 3A2FA 1UWBA 3WNGA 3DM2A 5KFBA 4HUGA 4BDYA 4M94A 1RBUA 2QKBA 3KTQA 2KZMA 3E51A 2HWHA 4BWMA 4K4SA 3N6LA 2R2UA 4ECWA 4ED2A 3SQ0A 4J9OA 1VRTB 4LH4A 1CXQA 4OKEA 3BSNA 4W5RA 2OPPB 1EKEA 5KRTA 4FLWA 2XCPA 4R5PA 4NLTA 2YNIB 4ZHRA 3ZT2A 4ED6A 2OH2A 1CZBA 3SQ1A 1ASVA 1XHZA 2XWYA 4M41A 4CGFA 2E6LA 4KB0A 1TK8A 3H08A 1RTIB 3FSIA 4TYBA 3D28A 4EBEA 2G8FA 3OJUA 3MXIA 3SUNA 5KGXA 4CEDA 3T5LA 1SL0A 2I5JB 2W9CB 1VSFA 4CJPA 5KFNA 1WNEA 2HNDB 3NH1A 5L1LA 3FQLA 4DSFA 1TV6A 1S1VA 4N41A 5J2PB 3RBEA 3LP2A 2J6UA 4JS4A 1HJRA 5C42B 2FLPA 3AVIA 4ZVGA 2B6AA 1TKXB 1SUQB 1VSKA 3VN5A 2C2DA 1Q8IA 4AHCA 3KLHB 2ILYA 4F50A 4RW8A 1J5OB 1RT5B 4H4MA 4O44B 4E3SA 3H2LA 3ICLA 2BGGA 3MEEA 3Q8PB 3P5JA 4FJHA 1DTTB 3EZ5A 4F8RA 3ZT0A 4CF0A 4QWCA 3H5XA 4K4WA 3ULDA 2XO7A 1ZBIA 4IH7A 3M8QB 4HKQA 4FJLA 4RU9A 1JLGB 3IG1B 1XC9A 4J9RA 1NK9A 2IOCA 5KFQA 1NHVA 2IA6A 3DLHA 3HKWA 3KK2B 5K14A 4NCAA 4CHOA 4E7HA 2WOMB 2GBZA 1CLQA 3TAPA 1BQNA 3KLVA 1DLOA 3KLFB 3JYTB 3M9OB 1HNIB 3M8PB 5CYMB 3AVGA 1WAFA 2DFFA 4F4XA 3HSTB 5KGWA 4ECSA 4MKAA 1XI1A 4YQWA 3HJFA 4JRPA 5KFOA 2JC0A 1VSEA 2CJQA 4J2AA 4FJMA 4IDKB 4FLUA 4RW7B 3BQ1A 2HNZB 4FJ9A 1S1TB 4CESA 2R8HA 3LANA 1JLBB 3KKSA 2BR0A 2YKNA 4O3OA 1S48A 4LD0A 1ZETA 3NCIA 1IKXB 2AU0A 5SWMA 4FLVA 2AX0A 3HVAA 3QGIA 2ASLA 2JEFA 3Q8SB 3DMJA 2P5OA 3KK1A 2Y1IA 4ED8A 1XR7A 3NBPA 4O3QA 1S1XB 3SCXA 5HRNA 4CECA 1HNVB 4ELTA 4MK7A 1IKYA 4UQGA 4ECYA 3JSMA 4PWDB 4ID1A 1XR6A 1HQUA 5J2MB 1CZ9A 1SH3A 3V1OA 4KB7A 4B8CA 3D45A 4W5OA 3SQ2A 4RNOA 2IDOA 3HL8A 4IOBA 3QZ7A 1C1CA 3BSAA 3VA3A 3U3YA 1S9GB 1FKPB 3MFHA 5DLGA 3PO5A 3KD1E 4ZVEA 2YNFA 5JS1A 4CHNA 2R7YA 2UVVA 4E0DA 2X6NA 3OS0A 3AV9A 1R0AB 4LQ9A 4FLZA 3G10A 3DRSA 3ZSYA 4DL7A 5L1IA 3S3MA 4F4ZA 3CYMA 4CEBA 1KSPA 3KJVA 2XI2A 3NH0A 3TAMA 3KLGB 3TAQA 3MF5A 4TY8B 2OPSB 4Y3CA 1NJZA 3V6HA 5KFMA 1RT3B 4FJKA 1N48A 2FC0A 2FVQA 4J9PA 5EUHA 1EX4A 4OKJA 3QETA 4DSJA 4PUOB 5J2QB 3RRGA 1BCMA 4FJJA 4M3TA 1JLAB 1LW2B 5C24A 2IM2A 4I7FB 4E1NA 3TANA 5HLFB 1C2PA 4FK2A 3UDLA 4Q43A 3IGNA 1NK7A 3FRZA 3SUPA 4RW9A 2HHQA 1S97A 4OKKA 1J9AA 3G86A 2BDPA 2ETJA 4N47A 2W9BA 5F9LA 4F2SA 1MMLA 3DYAA 3OYIA 3KK3B 4ECTA 3O4QA 4Z4HA 3DRRA 2E9RX 5KG2A 2YKMA 1JLEA 3GV8B 4EO8A 1XWLA 3KHHA 3PW2A 1L5UA 4CJUA 4EZ9A 2RF2A 2VG6B 5JUMA 4CEOA 1S10A 4K4ZA 1S4FA 1KRPA 1RT4A 1T05B 1YVUA 1IG9A 1N6QA 2WB4A 2R2SA 3DLKB 2BRKA 4GMJB 1TKZA 3T1AA 2D3UA 3IRXA 2IM0A 3N6MA 3RR7A 3LP3A 4RW6A 3P83D 4CJRA 3V9WA 2OA8A 4AILC 3GIKA 3SFUA 1VRUA 2B43A 1WSFA 1KVCA 4HVJA 5KG5A 4TQRA 1S0MA 3HPHA 3ZT1A 3NF9A 3FFIB 3DRPA 1C0TA 3OYGA 3VQSA 2OPRB 4KB1A 2G8HA 2X74A 3K5LA 3NL0A 3TAEA 4PQUA 1EETA 1EP4B 1TVRA 2OPQB 4F4WA 3I0SB 3KOAA 3OY9A 4OVLA 5KFPA 4FW1A 4MFBA 1S6QB 4KREA 1WNSA 1TAQA 4IG0A 1RTDB 3IS9B 2VG5A 1JL1A 1WSIA 2QXFA 3OYCA 4JV2A 3WNHA 4EO6A 3S3OA 3QERA 3U3GA 3HPOA 2PYLA 3MEGB 4JRQA 1NJXA 3V6DB 3NGYA 2G8IA 3OL6A 5J2NA 2IC3B 3BSOA 1QE1A 3AVLA 1KVBA 3GIJA 4U6PA 4ECXA 2D0AA 1JLFA 2RKIA 1RBVA 4CFAA 4Q8FA 1NK0A 3MECA 1VSMA 1HPZA 1RDAA 3LALA 4Q45A 4EBCA 2D41A 4ECVA 4EP4A 3QGHA 3OLBA 3V81A 4O3SA 2E4LA 4CEQA 2UVUA 5EWEA 3V4IA 1N5YA 5KFJA 3OHBA 2AX1A 3MFIA 1JX4A 1B9FA 3QO9A 3GIMA 4ECRA 4TYAA 2XI3A 4DQPA 1WSGA 5CYQA 2ATLA 3CJ4A 4HTUA 4B9TA 2DY4A 4IG3B 1GX6A 3MAQA 2IM3A 3OL7A 3KLEB 3LZIA 1B9DA 1F21A 3PX0A 3ZSQA 4LQ3A 4I2QA 4NRTA 4DTSA 5EDWA 1X1PA 1YT3A 4LSLA 4M3YA 5HBMA 2GC8A 5FROA 4CERA 5KFWA 4Z4FA 1RBRA 5JXSA 3AVHA 3LP1B 4RW4A 3RBDA 3PW0A 5DGBA 1I6JA 1TP7A 4CIFA 5F8LA 3OL9A 4NLDA 3TABA 5KG4A 5J1EB 4CF9A 3SPYA 2AGQA 4MK8A 1LWEB 1HYSB 4EYIB 3NAHA 1T03A 3RB4A 3OYKA 1C0MA 3OS1A 3AA3A 1T8EA 4NLUA 1TKTB 4DL2A 1FK9A 1JLQB 2ZD1B 4Q0BB 2QE5A 4KV8B 1D5AA 3OS2A 1W9HA 2IAJB 2X6SA 3DLEB 2HWIA 2GUIA 3OYEA 3DI6B 4EYHB 2BRLA 4I9LA 3L3VA 1S9EB 4WE1B 2Q3SA 1NOYA 4GC7A 4IFYA 4DLEA 3PX4A 4RG8A 1LW0B 3VQAA 3OLAA 1Z4UA 2C22A 3RRHA 3OYBA 3E01A 3VQ4A 3VQEA 4IRDA 4NLSA 3PV8A 3QEIA 1RYRA 4DU4A 5EU7A 1BCOA 4E7LA 3O3GA 4ZPBA 4DTUA 5KFKA 3ITHA 3SUOA 1RILA 5HROA 2FJVA 1D1UA 4EEYA 4FM0A 2A1SA 4JS5A 4CGHA 2PYJA 4RNHA 3IAYA 1W0HA 4Y1CA 1DTQB 2LSNA 4OPJA 4B3OA 5HRRA 1ZTWA 1NNDA 4E7KA 1RT7A 4DSEA 4B9LA 1QUVA 1X9MA 4DQIA 3MEDB 3WNFA 1RT6A 2WRMA 3AA2A 3ISND 1D9DA 2R8KA 4KE5A 4CFCA 4KBIA 5KFXA 2VG7B 1S1WA 1FKOA 2ALZA 2RPIA 1VK0A 3BGRA 4OGEA 1TL3B 2JGUA 4ZP8A 4QW9A 4KI4A 3LZJA 4K4XA 3L2RA 1QTMA 4O0JA 1JXEA 4NRUA 1A5XA 1TV6B 4ZVFA 3RMDA 4DG1A 4DSKA 3DOLB 1S9FA 2YNIA 1QHTA 1D0EA 4CJFA 5I3UB 2HAIA 4DQQA 4TXSA 2P5GA 3AVMA 2VWKA 5DQIA 1S6PB 3LWLA 3T3FA 1JKHB 3PR4A 1U4BA 2FJWA 1GOAA 3VQ6A 2HMIB 4CJSA 1GOBA 2HHSA 3QEXA 3EY1A 3MEEB 1LWCB 4ID5B 3MTKA 4KI6A 4CJEA 3AO5A 1K6YA 3LPTA 4URGA 3CDEA 3V9SA 4WXOA 4G3IA 2HNDA 5HRSA 5FDLB 4WZQA 4J9MA 3OYMA 4BE2A 4YR2A 3NDKA 3C6UB 3VQPA 1RTHB 5J2PA 3LDSA 4IKAA 4W5TA 4O3PA 3KLIA 1SV5B 3H5SA 3CM6A 5K14B 5L9XA 2IGIA 3RAQA 4ELVA 3L8BA 1DLOB 5C42A 3BJYA 4FS2A 2R2TA 1NHUA 4DF8A 1SUQA 4AHSA 3KLHA 1NKEA 4AHVA 3F73A 4ZP6A 4J9LA 1RT5A 4O44A 4CEFA 1RBTA 2R2RA 4QWBA 2VA3A 3ASMA 4AH9A 2XCAA 1S1UB 5DG9A 4J2EA 4B08A 3M8QA 4O3RA 3AVKA 1X9WA 1JLGA 4Z4GA 2YKNB 4H54A 3VQ9A 1LAWA 5KFSA 4Z4EA 4DQSA 4CGJA 3KD5E 1L3SA 3PO4A 2CKWA 4ED3A 4Y1DA 3DMJB 2FVRA 2V9WA 2WOMA 3RWUA 4KRFA 1WSHA 4MIAA 2AGOA 5F8NA 3KLFA 3JYTA 2FBTA 4KO0A 1HNIA 3H98A 4CGIA 4DTOA 3THVA 2D5RA 5CYMA 1IKYB 4WFZA 3ZSOA 4URSA 2G8KA 1UA1A 2DFEA 2HW3A 3TARA 1BQMA 3OYFA 3HP9A 1JLCB 3BSCA 4IBNA 4QW8A 3QIDA 4KKOA 4CFBA 1JLBA 3T19A 4CHZA 1SL2A 4C8MA 4O3NA 3NMAA 4NCGB 3SI8A 4JUZA 2ASJA 4XPCA 1IKVB 3V9UA 1ITGA 4HUFA 4MK9A 2G8WA 1U47A 1RT2A 2RDJA 1RT1B 3C6TB 3DRSB 4CF8A 4AHTA 2AWZA 1HNVA 3UQSA 4IFVB 4KTZA 4KHNA 3KJVB 3OL8A 1BI4A 3OJSA 4MH8A 1C6VA 4C8NA 3RR8A 2KW4A 4PWDA 2YNGB 4NLGA 2Z1GA 1LWFB 5J2MA 1RCHA 4IRKA 1I3AA 2X78A 5KFIA 3P1GA 4K4TA 3EZUA 2D0CA 1Y97A 5KT6A 3HVTB 1S9GA 2DPJA 5I42B 5DQGA 2FVPA 5KFFA 3S9HA 3CJ5A 4OLAA 3DLBA 4M42A 3M8RA 1MU2A 1HYZA 3ZSVA 1L3UA 4KHRA 1NJWA 1R0AA 4XIUA 2BQ3A 3PX6A 2BANB 2B5JB 1T7PA 2HHUA 4JV0A 3ZT4A 1OS5A 4DSIA 1SL1A 5HP1B 3CJ3A 3DYAB 3KHLA 1KFDA 5C5JA 3KLGA 1T3NA 3DLGB 3DRRB 4TY8A 3D5MA 4FJNA 1BIUA 1RT3A 4Z4IA 1KTQA 4CK3A 2QV6A 3SQ4A 2FBYA 5J2QA 3NF6A 3TR8A 3BR9A 4FZZA 2RF2B 4E1MA 1NK5A 4EP5A 1LW2A 3KMQA 4I7FA 3L2WA 1RA6A 4DL6A 3VQBA 4G1QB 4DU3A 4HCCA 2GV9A 3H5UA 1TL1B 4NYZA 2D7SA 1ZBLA 1QAJA 3IRXB 4KHQA 4E7IA 1JXBA 4HHTA 3HVWA 2KZZA 3DLRA 3I8DA 4B9UA 2V4QA 1QSYA 1S5JA 1U49A 3NE6A 4CJTA 1VRUB 3FDSA 4CEEA 2RN2A 3NH2A 3B6OA 4JV1A 3QGGA 5KFAA 3OYHA 1KCFA 2OZSA 3K58A 1KLMB 2D0BA 4PQUB 4I2PB 1EETB 3M9MB 5C25B 1NK8A 3V6JA 2EC0A 3SFGA 1REVB 2VG5B 4WFXA 4F3TA 3AVJA 2G8UA 3HPGA 5KFTA 3IN5A 5KI6A 4KHSA 4WYLA 2ZE2B 2Z1IA 2IJNA 3TQ1A 4H4OB 1VSDA 3AO3A 4FJ5A 2A1RA 3DOKB 4CEAA 1ZYQA 2JLEA 2VA2A 4LSNA 4KHWA 3CM5A 2F8TA 4TY9A 4EZ6A 5KG0A 2C2RA 1X9SA 5KT4A 3KHRA 2HNYB 3NF8A 1JLFB 1N4LA 3HT3A 4F4KA 5CZ1A 2PZSA 5D3GB 3FFIA 4ECQA 3MECB 4M3WA 5KG7A 2OPRA 4IH5A 3LPUA 4QWEA 1EP4A 5KG3A 2OZMA 2OPQA 3I0SA 1JL2A 1TQLA 3QLHA 1SH0A 1S6QA 2F8EX 3ZCMA 1N5YB 5CZ2A 1C1AA 3GV7B 3IS9A 3QO9B 4CF2A 4DFJA 4M3UA 3RB3A 5DG8A 2XC9A 1S0NA 1QS4A 3AVAA 4O0IA 1O1WA 4KFBA 3MEGA 3AA4A 3V6DA 1C1BB 4M3RA 5T7BA 1JXLA 4BE1A 2V0NA 3KHGA 1HQEB 2FVCA 4CF1A 2XY5A 2IC3A 3TVKA 4AHRA 5KT2A 4L8RB 1LV5A 5KFCA 3ZT3A 3QNOA 1ZTTA 5HBMB 3EPGA 4DQRA 3RMBA 1KLNA 2EX3A 4OPKA 3LWMA 4ICLA 1IM4A 4ZPAA 3PJXA 3B6PA 2FVSA 1HMVA 4ED0A 4O4GB 3BREA 3AO4A 4K8XA 2YNHA 4URQU 3CG7A 4NLXA 1RDDA 1YTUA 3NGIA 4CJ4A 4IG3A 2Z1JA 4ECZA 4TN2A 1IKWB 3NGZA 1FK9B 3KLEA 3C95A 3FQKA 2YV0X 4OGCA 1UOCA 4NLRA 4YR3A 1IO2A 4CFDA 1KFSA 3GILA 4F4YA 3H4DA 4FLXA 2V4RA 2WONB 2JEIA 4K50A 3KIOA 4O55A 2D3ZA 4NLQA 2O4IA 1IH7A 4C8OA 5KG6A 2QK9A 3LP1A 4QWAA 4ZMMA 4HYKA 4FZXC 4DEZA 3VQ5A 2R8JA 2IBKA 4DS5A 1NKBA 3MXMA 4E7JA 3K5NA 3QIPB 4GW6A 4IFYB 3AVNA 3CFRA 4NYNA 4DTRA 1QSSA 5DMRA 3LP0A 4NLYA 1LWEA 4JLHA 3KKRA 4YR0A 4IH6A 5KFHA 4FJXA 3RB0A 4O5BA 3H40A 1NOZA 4CE9A 4FJ8A 1SKWA 1TKTA 1C0UB 3VA0A 3EPIA 2DTUA 3I0RB 1JLQA 2ZD1A 4ZPCA 5HROB 5KT7A 4DU1A 4KV8A 5KFLA 2IAJA 3DLEA 1UWBB 2GIQA 3DM2B 1QQCA 3L3UA 4CIGA 1QSLA 4MIBA 3S3NA 1S0OA 4WE1A 2IJFA 1BISA 2VWJA 2W7PA 2PY5A 3V6KA 1ASUA 4KAZA 1TK5A 1RT6B 3QYYA 3HP6A 3WNEA 1LW0A 4R5PB 5KT3A 3ZSZA 1FXXA 4DTPA 2J6SA 1RTJA 4CJ3A 1LAVA 4Q8EA 4ZHRB 1GOCA 3SV3A 4DL5A 5KFUA 4FLTA 4R8UA 3QEPA 2HB5A 4FXDA 4B9VA 5KFEA 3RAXA 1WN7A 4KHYA 2BE2A 1U09A 3L2UA 4QAGA 5DGAA 2WK4A 3PY8A 4CHPA 3TI0A 1NK6A 3CIZA 3SYZA 4NLVA 1RNHA 2UVWA 1DTQA 4DG1B 5KFDA 3TAFA 1SH2A 2XHBA 3CFOA 3VQQA 4CEZA 2C2EA 1UAXA 3RMAA 4FS1A 3AVBA 5DG7A 1VRTA 3TAGA 3MEDA 2OPPA 1S1VB 4OL8A 5F9NA 4CJQA 1TKDA 3LP2B 5F8MA 4TSXA 2VG7A 2C28A 3SJJA 3CJ0A 3PR5B 2AQ4A 5EWFA 4M95A 2F96A 4CJWA 4K4YA 3H4BA 1TL3A 2B6AB 4X2BA 2O4GA 4W5QA 3OYAA 5KFRA 2W8LA 4RW8B 3G6YA 1RTIA 1KHVA 2KFNA 5F8IA 4FZYA 4H4MB 4RNMA 4W5NA 3V1QA 3OYLA 5L1JA 2I5JA 2W9CA 3OSNA 4CGGA 3QNNA 3MXJA 3DOLA 3KLIB 3RMCA 3GIIA 1Q9XA 4E19A 3V1RA 4YNQA 3HO1A 1GX5A 3SZ2A 5I3UA 1YVFA 1A5WA 3CDWA 4J9KA 3MR3A 1L3VA 1Z25A 1S6PA 3MR5A 2P51A 4QCLA 4MQ3A 1JKHA 1BQNB 1SKRA 4U7CA 4NCBA 2HMIA 3K5MA 3O3FA 2JEGA 4F3OA 1LWCA 1TKXA 4ID5A 1RA7A 4CIEA 5KG1A 2J6TA 3H5YA 4N5SA 3QEVA 4O4RA 5F8GA 4RZRA 1J5OA 1RDRA 3T5KA 4FBTA 4ZPDA 3TWHA 4NYFA 5FDLA 4IKFA 3ZSRA 1DTTA 4IR1A 4KTQA 3AO1A 4E89A 3V9XA 3H59A 3C6UA 4YP3A 1RTHA 1SV5A 3LAKA 2W9AA 2EHGA 3DDKA 3IG1A 4BDPA 3KMSA 1XR5A 2HVHA 4ZP7A 2FLLA 4KO0B 2E9TA 4EBDA 3T5HA 2DPIA 3KK2A 1QAIA 4BACA 2Z1HA 4KAIA 2NUBA 3NF7A 1ZBUA 4DLGA 3KK1B 2R8GA 3NBPB 4ED1A 4FM1A 1BQMB 3KNAA 3VQ7A 4DL4A 3UR0A 2HVIA 3M8PA 4KKOB 1S1UA 3SPZA 3G0ZA 3I5AA 3JSMB 1YTAA 1HQUB 4M3XA 1A5VA 3F9KA 2ZQBA 4DFMA 1J53A 4BE0A 4IDKA 1BHLA 4RW7A 3L2VA 2XRIA 2HNZA 3SI6A 1S1TA 4ECUA 5T14A 1CSJA 1C1CB 1B92A 3GV5B 2HHXA 4GVMA 4CHYA 3NAEA 3AA5X 3MR6A 4IQXA 1RT2B 2YNFB 4DSLA 3PW5A 1IKXA 5DQHA 4Z4CA 4CJKA 4TLRA 4NZ0A 4FCYA 1BI4B 2KFZA 3BQ2A
chains in the Genus database with same CATH superfamily
2MZJA 5F0WA 1QVFR 3BDEA 1KKHA 1WSEA 3QESA 3O9QA 1FCAA 2AHOB 1I3OB 3CVKA 4OZ3A 3ZZPA 2HHTA 3QRPA 2KRBA 3I5BA 3NG8A 1SC3B 2YHAA 3AVFA 2HHHJ 2GAHC 2KTQA 3VF6A 4A61A 3MM5B 4NCGA 4J9NA 4R0EA 2AV5A 5IZHA 5AE2A 3OUYB 1PO6A 5HI7A 2MY7A 2DIUA 1KHWA 4LRAA 3NXZA 3QZ8A 5DZ6A 3K2YA 4DB3A 2LA6A 4DV2F 1UJ4A 1ZBFA 2WUSA 2JFDA 4CO4A 4DF4A 4DV3J 4DN0A 2O8FA 1HNZJ 4C8LA 1QDUB 4LIWA 2E6MA 3LF0A 2WCXA 2DHXA 2ZJQQ 3CQ8A 4JYAK 3PYFA 3IMXA 3HVTA 1N56A 2B7CB 1Q86O 1RAJA 2WBMA 4HL9A 1Q7YT 2OPSA 2P8IA 2W2NP 3O6WA 3DGPB 2YWEA 2CPDA 2ADBA 4DMNA 3R7SB 2WW8A 2UUTA 3IAM9 4PWUA 2CNNB 3UPFA 3QEWA 4KHMA 2XLJA 2F8SA 2IM1A 2B5JA 4JI0F 2JZ5A 2Q3PA 2R8IA 1ULRA 1YHQS 1N6QB 2LU2A 4CCHA 1BL3A 4CJVA 5EN1A 4RW6B 2CZ9A 3DLGA 1GXLA 4LFBJ 1KQKA 4FW2A 2MY8A 5EWGA 4RUCA 3CF5L 2K7KA 2ZWPA 2QN6B 1S72N 1I94K 1R8PA 2N7CA 1C0TB 3CCQN 1U04A 5HAOA 4WYBA 1IM6A 5LJVA 4LF7F 1Q81O 3ENVA 4BRGA 1U26A 3HHKA 4FM2A 3EGWB 1UA0A 3AO2A 1KVAA 4DV6J 3DLKA 5L1KA 1KWMA 1S79A 1IJEB 5GAEU 1HARA 3IC1A 1VC6A 4ZA1A 3PZPA 1KLMA 1WHVA 4FPAA 1AXQA 5BR8F 1QE1B 3ALYA 4I2PA 5C25A 3WXMB 1D9FA 2JEJA 3O8MA 2XQCA 3QLHB 3CD6N 2WZ1A 1C4CA 4X66F 1X0FA 2NRWA 3GE9A 4BRDA 1HYVA 4DTJA 2GEMA 3O2IA 1KTVA 3T1YK 1Z26A 3CJKB 3F56A 4KFBB 3P96A 3P5TL 4DFKA 2ZE2A 2EKYA 5H9EJ 3J80O 1MWZA 1EARA 4ZVUB 2Z8QA 1YJWN 2XS7A 5CYQB 2PBDA 1SXLA 4KSEB 2JX2A 5KFGA 4FLYA 4MLEA 1KBRA 2W42A 4U96A 4M3ZA 4QWDA 3F41A 2GWJA 2FF3B 1LKZA 2JC1A 4OZ1A 1QJHA 3UKRB 2UVRA 1HMVB 4OLBA 1U1RA 2J9DE 5A8RA 2MB0B 4Y2AA 5LXRA 2P9LB 1U45A 1SQFA 4IYQA 4KH1B 1W25A 2WVDA 4OQJA 1SC4B 4PG5A 5B0FA 4FK0A 1K47A 2VIHA 5G4DA 4BQLA 1BG3A 1HQEA 3W60A 4NXNJ 1N36J 3NCPA 2O66A 4C11A 2UXBJ 3UFCX 1ZAWA 3WIVA 4ZITA 5DK5A 3HFZB 4CJ5A 4XPEA 1RISA 3D6RA 3NFAA 5CE3A 3QIOA 4GVLA 2P9SB 4QIVA 1VQ6N 4RBTA 2LEBA 2AYBA 4MO5A 2Y8WA 4WXWA 1F3FA 3MR2A 3AH6A 3TVZA 2BJ9A 4J9SA 3CMES 2O67A 4FWPA 3LP0B 4XDDA 4K7QA 3CB4A 2DNGA 3LDQA 3SXLA 1X5TA 2LEAA 5I3QA 2ASDA 4NL5A 4CLKA 1Q81T 1IKWA 3R6GB 5DDPC 2Q66A 3ULHA 2G8VA 2BVZA 3CCJS 3M8SA 3HHNB 4OPAA 4ZTFA 3SNNA 2HFNA 3AA9A 2WONA 2HGLA 5HVGA 5CD4A 2FTRA 5ELZA 5JMVA 3BDPA 3OSPA 4L3QA 3CJAA 4OJ3A 2C1EB 4K4UA 2CDQA 2KI2A 3AVCA 1BE4A 3CJ7A 4LIRA 4YDDB 1YRUA 4PABA 2E2NA 3SAGA 2PAVA 3VQ8A 2DBBA 3CCEN 2NQPA 5HMWA 4KHUA 3HD1A 4R8UB 1UL3A 3M6WA 3CC2S 1SKSA 2OTLN 1C0UA 2BE2B 4WJBA 2FHJD 1NXIA 2KKHA 1VSJA 4C97A 4BLGA 3A2FA 2BM0A 5DO2A 5KFBA 2VQEF 1SJ1A 5AFUH 3C2PA 1X5PA 3CCVS 2CPJA 3UVJB 3E51A 3KTQA 4BWMA 4ED2A 2R2UA 4C48A 3SQ0A 5HQ8A 1YJNN 3OTCA 4FLWA 2L41A 2E5LF 3AY9A 4JNEA 3PFEA 4ED6A 5CAAA 2OH2A 3SQ1A 1YK9A 5G0RB 1W2BR 3PKMA 3R5DA 2LECA 5BREA 2E6LA 3T6JA 5CZVA 3THTA 4LF1A 3OJUA 3SUNA 4JHDA 4DV5F 4CEDA 4DV1J 4M5GA 2I5JB 1G99A 4WK3A 1R0CB 1RHUB 1S6UA 2B9YA 1VSFA 2J5AA 4B3SK 3MMBA 2W24A 5ETTA 3CMQA 4OYOA 3NH1A 2FJAB 2OANA 1TV6A 3RBEA 3M2RB 3VEWA 2A42A 1CJKA 2OAUA 1FO1A 1NM2A 1Y00A 3DDIA 2FSKA 3AVIA 4EFHA 1BXNA 2B6AA 4JV5F 3SBMA 1SCJB 3VN5A 2DH9A 1FDNA 1OYEA 2Q1LA 2CNOB 3MMAA 1DQ9A 1J5OB 5HO4A 2HGNA 3H2LA 4QQBA 4CLFA 4FJHA 1DTTB 4F8RA 3ZT0A 2NXUA 4IQMA 3QBWA 2XO7A 2F8MA 2BKNA 1NNEA 4WIIA 2ZOMA 1NK9A 2FYXA 1XNQJ 1LNQA 4Y2KA 2PA8D 1NHVA 5U47A 3DLHA 1ZZNA 2CNLB 4A46A 4CHOA 1KP6A 3E9PA 4BVOA 4X65F 4J9VA 3JYTB 3M9OB 2Z0GA 1M0SA 4ER8A 4F7VA 3WXLA 1NZ8A 3HRGA 5ETPA 1TU0B 1FWKA 4OYXA 5LM7E 3ZZYA 2JC0A 1VSEA 4J2AA 1VK3A 4FJMA 1QQMA 2QWQA 1HX1A 1P1LA 2UUBJ 3QWUA 3C15A 2HQ3A 1KQSR 1ZETA 3CO0P 4LT6A 3NCIA 1MMNA 1WC5A 2AX0A 2CZ4A 3HVAA 3QGIA 2ASLA 3IFEA 2KN4A 5L46A 4YOEA 4XDCA 1WF0A 4HEA9 2ROEA 4UZBA 1XR7A 2BOAA 2W40A 3SCXA 3CC4N 2V6AA 2JLFA 4D3HA 4UQGA 3AA8A 3R5GA 2BTFA 4ID1A 1HQUA 3DAWA 4M63C 3MCAB 1CZ9A 3V1OA 4KB7A 4USMA 3SQ2A 2W2QP 2BUPA 4B3SF 3A5OC 3BSAA 1FKPB 2J7KA 3MFHA 3PO5A 4K5SA 4ZVEA 3NNAA 2QLBB 2R7YA 1T3OA 2UVVA 4B3TJ 3OS0A 1R0AB 4FLZA 2ZH3A 4TLQA 1M5PC 2MQMA 3DRSA 3ZSYA 5L1IA 3TNVA 4F3QA 3H7HB 3UD4P 4RR5A 2XB2D 4CT9A 1U1QA 1KSPA 1KD1O 1VQ7N 4I56A 3FMWA 1MNEA 2PT0A 2Z57B 4TY8B 2DEIA 1VQOS 1SJRA 1NJZA 4AM6A 3AJ2A 4DL0C 3CIMA 5KFMA 4RBUA 1C4AA 4C0OC 5JJBA 2PGCA 2F4FA 4NYOA 3A3NB 2O8DA 3OUYA 2GGPB 3FZ2A 3NEKA 1F1BB 5HSPA 5HLFB 3ZX2A 1NK7A 1YRXA 1Q79A 2HHQA 5SUHA 1S97A 4OKKA 3AAWB 2BDPA 4WFAQ 3ENAA 3CC7S 3TPQA 3DYAA 4CO1A 3A8IA 2PI5A 4FPRA 1OVQA 2AD9A 4A8SA 4HDHA 2ZFHA 4BR5A 1HNWK 2R7SA 4EO8A 1XWLA 8AT1B 4C0HA 3W63A 2M9KA 2VG6B 1ZA2B 3H45C 5FLXU 1S4FA 1K0TA 2C3OA 3WXIA 1N6QA 2WB4A 4IJNA 2ZUGA 2YHWA 2QWLA 3IRXA 5ITHA 1WKJA 3N6MA 1VQ5N 3DXSX 3BYPA 3KUGA 1FFWB 4LREA 3LP3A 4RW6A 3AD7C 1IBLF 4IFEA 3SAHA 4KBOA 4QR0A 4NOHA 1HW8A 1RCXB 1VRUA 4WQ5A 4HVJA 5KG5A 1S0MA 4I67A 3BKUA 2IJRA 1C0TA 3I9V9 4GY2B 2G8HA 2RUGA 4B9QA 3W1YC 2M88A 1EETA 1AFJA 2OPQB 4F4WA 3OY9A 3ZX0A 3FZBA 5ETVA 1S6QB 4H0XB 4KREA 1LWXA 2RSQA 2VF3A 3MPDA 1WSIA 3M8ZA 3ENOA 1LFWA 1LOUA 2PYLA 3MEGB 1NU0A 4G1IA 4KH4A 3NGYA 1Q8BA 3BB5A 4P74A 1VDHA 1Y3KA 3BSOA 4ZPTR 1QE1A 1UP1A 1TZ0A 1KD1T 4IEEA 3GJRB 4J7CA 3A12A 2GTDA 3MECA 3SQGB 3LALA 4Q45A 5AQYA 3W9HA 2RJZA 3D6FB 4O3SA 1R59O 4CEQA 3DC2A 5EWEA 2AX1A 1JX4A 2CPHA 2KB2A 3BZQA 5CYQA 2ATLA 4HTUA 4B9TA 1Q0NA 3E66A 1AW0A 1S77D 1VQPN 4FNHA 2IM3A 4OX9F 1YZ6A 3UNYA 2KJWA 3K0SA 4DTSA 4A8KA 1X1PA 5K5MA 2MSSA 4M3YA 5HBMA 4MT1A 4CERA 3UKRA 4Z4FA 1GLBG 3QSIA 2L48A 5I9EB 1KVJA 2ZWHA 3MTJA 5DGBA 2P9LA 4CIFA 4ILLA 4KGXB 3OL9A 4NLDA 2GVDB 3IKMA 3WIUA 1FJGJ 1ZBTA 4C23A 4EI2A 4YOTA 2MKJA 5IM0A 4WIQA 4CF9A 4OI0A 3LPEA 3I87A 4DCHA 1KONA 4MK8A 4UTGA 3OW2R 2A5XA 1F9EB 3ILIA 5B0DA 1HYSB 2RRAA 4ETXA 2BKOA 4EYIB 1YJ7A 4K0KF 2CJ9A 1VBZA 5AJ3F 1C0MA 1D3WA 1FESA 1T8EA 2KM8B 3WDOA 2M2BA 1FK9A 4ZLLA 2I0XA 5M1KA 4QBUA 2UXDJ 2ZD1B 2XZWA 2QE5A 1D5AA 2P9SA 3T1HJ 2V7ZA 3OS2A 1JJ4A 2X6SA 3L3CA 2UUAF 3MCNA 4N8OA 1UZHA 2HWIA 2GUIA 3OYEA 4RUBA 1UJ5A 1C0FA 4OO1J 3I82A 2CPIA 1S9EB 1T9WA 3IWLA 2E5IA 2MKHA 2QTDA 5BPMA 1JNZB 3TUPA 4RG8A 1HD0A 3OLAA 3G6ES 1Z4UA 2YHXA 1CBKA 4AXJA 3PRDA 3GFHA 4IRDA 1OH8A 2AIRB 5D6GA 4DU4A 2DGVA 4L74A 4E7LA 1UVJA 3WXJA 4BQZA 4OHYA 4DPWA 3DFEA 5HROA 2FJVA 1Y0HA 2RMLA 2X1BA 4X84A 2LDIA 2KH9A 4EEYA 4J37A 3FLCO 1RWPB 1DTQB 3I4PA 5HRRA 1TUUA 4E7KA 3CMAS 5LMUK 3RBZA 2RU9A 2EWHA 2WRMA 3VALA 2CJKA 4QS8A 4HI1A 4A8QA 2J4RA 2ERRA 1GLAG 1S4EA 3J80U 5FPEA 3G71N 2LLZA 5BPNA 2GUPA 2IYIA 2Q6CA 2HBZB 2BE7D 5JLFA 4ZP8A 4ZVOB 3IDHA 3UVJA 4O0JA 5AQXA 1JXEA 3BS9A 1UMJA 3KG4A 4YDXA 2DGTA 2EFQA 5GAEI 2A0FB 3DOLB 3I4HX 3SCIE 1S9FA 4BR7A 1TELA 5EOYA 4CO5A 2VICA 3R9PA 4CJFA 3BEXA 2FHKA 3AY0A 2DKOB 4DQQA 2P5GA 5G0RA 1VBKA 3AVMA 3VGVA 2MHNA 2VWKA 3MGJA 1S6PB 1N33F 1U4BA 5CZXA 1GOAA 1PJ6A 3T9ZA 2HHSA 1GOBA 3EY1A 3MEEB 4JI2J 4H0OA 4KI6A 2YX1A 1K6YA 2O8CB 2G0JA 1VCTA 5HRSA 4J9MA 2D69A 1GLFO 1GXUA 2FXUA 2HHHK 3C6UB 3OXFA 4IKAA 2F40A 4W5TA 4Z7CA 4X4UA 3M2RA 1SV5B 4KC5A 3CM6A 2JHEA 2IGIA 1R3NA 1JCGA 4B3RF 1FRXA 1RE1B 1XMBA 3ZZTA 1OH7A 1HR0F 1DLOB 4FS2A 2R2TA 1OY8A 4DF8A 3IR6B 4AHSA 4HTIA 2B7BB 2DD8S 5GAHU 1H0HB 3WUHA 2B51A 4DV3K 1RBTA 1HNZK 4QWBA 4NXMJ 2HQFA 1S1UB 4X4TA 2G9OA 4JI7J 4XTTA 5DG9A 3VGKA 4B08A 4JI1F 5AQPA 4O3RA 4DCOB 3I9ZA 2YKNB 1IJFB 3PEJA 3VQ9A 1LAWA 1PIEA 5KFSA 4DQSA 3KD5E 1L3SA 1HQ2A 1AUDA 4CBUA 3DMJB 3RWUA 2H5EA 1WSHA 2AGOA 3JYTA 1M90O 2FBTA 2HAFA 3D3CJ 3H98A 2YWKA 2W41A 4DTOA 3CERA 2FC8A 3ZSOA 1CQMA 2CZVC 2NNWA 2G8KA 1TFWA 3TARA 1X9JA 4DX8H 4LFBK 3MDFA 4A8YA 3FSYA 2ZM6F 3QIDA 4KKOA 1YLXA 3O3LA 1GNKA 1RWWB 1Q16B 2XLKA 2CJXB 2WW4A 1XMOJ 3R8YA 4OYBA 4WKRA 4WTOB 1EKSA 5E0OA 3BUZB 4CHZA 2PEBA 3M05A 5C0YA 3M30B 3SI8A 4JUZA 2MZQA 1IKVB 3ENQA 5E7OB 4GRSA 5GINA 2G8WA 1L3KA 1U47A 5EX5A 3BM7A 2RDJA 1RT1B 5CQGA 3SDEB 1LK5A 1VQ9N 4DV6K 2QLWA 1Q53A 4ATNA 4IFVB 4RLEA 3KJVB 3MCSA 2BJDA 4C8NA 1C6VA 2OI2A 2GNKA 3DRYA 2YNGB 1YBTA 4NLGA 4LRDA 3QT6A 1RCHA 3P1GA 5DM6L 3H90A 5AQRA 2VZ9A 3EZUA 4LF9J 5DQGA 3X1LB 5CYJA 2QWRA 3S9HA 3CJ5A 4OLAA 4ZVTB 3OVBA 4CD1A 1MU2A 5BYQA 2AW0A 4DV7J 1R0AA 5H9EK 2BQ3A 4CVNE 3BGOP 4JV0A 2IVPA 3R1HA 1HUXA 1T6DA 3ILLA 4ZJOA 4DSIA 5HP1B 1N34F 4A5AA 2MJUA 4P2SA 4TY8A 1T9TA 4CZLA 4OIXA 2ZHAA 4Z4IA 4K43A 5BN9A 3NOCA 3SQ4A 5IWAF 3GOIA 4LF2A 2DNLA 2RF2B 4E1MA 1NK5A 3C7NB 4CZMA 2GGPA 4AFFA 2YWFA 3HSGA 4JI5F 2AZ1A 2LQJA 1GAOA 2Q97A 1ZBLA 1QAJA 4ZDNA 5LMNJ 3SCJE 4BR9A 4E7IA 3M2UB 4HHTA 2DNYA 2KZZA 2P9PB 3DLRA 3I8DA 3H42A 1M90T 3F44A 1XMQJ 4NXNK 3NE6A 1N36K 4CJTA 3PDNA 2UXBK 4H0TB 2RN2A 2YPZA 3W9JA 1T11A 3B6OA 5E26A 3QGGA 5KQDA 2ZC3A 3OYHA 3ID6A 1LEOA 3PFOA 3CJ1A 1APSA 2F9DA 2MMYA 2XEXA 3V6JA 4CJ7A 1U1LA 3BY5A 4ZPVR 4FKXA 1DRZA 2GX8A 4WKYA 3THYB 1VOMA 1HW9A 4IO9Q 1NMNA 2ASOA 2NPFA 5KFTA 4WYLA 4OHWA 4IOCQ 3N01A 2A1RA 2GHVC 1X4CA 4YB6A 2VGNA 2DY9A 2VA2A 4LSNA 3GG4A 3F2KA 4TY9A 3KWMA 1X9SA 3GR1A 2MQ8A 1WHWA 4KR0B 3KHRA 4PG8A 1U25A 3M6XA 5CZ1A 2VBYA 3EKUA 4NA2A 5KG7A 4JEPA 4QWEA 5KG3A 2OZMA 2OPQA 2YJFA 3QMLA 3WQTA 3CD0A 1MA9B 1S6QA 4NYPA 1C1AA 4M3UA 3RB3A 4OX6A 4DDFA 5DG8A 4JI3J 3AVAA 4JK7A 1Q7LB 3MEGA 3VMFB 3BBCA 3MX2A 3GSIA 2F3JA 4BE1A 2Z2YB 1ZM9A 2V0NA 2ZKTA 4MMOA 2XY5A 2QSFA 3VEVA 3MPWA 3A5MC 1W97L 2IVOA 5BN8A 2FPHX 2GHPA 3PJ9A 1SBRA 4DQRA 3RMBA 3AD9C 4CO2A 3L4IA 3W5ZA 3SQGA 3ILJA 4PG4A 4WF9Q 4ICLA 3B6PA 3MCMA 2YH0A 4ED0A 2QWNA 1N5QA 4CO3A 5K8PA 1BUPA 4K8XA 5CHIA 4URQU 3P3DA 4RL1A 3BH6B 1YTUA 3NGIA 1D9AA 2Z2MA 3RW7A 5LL6Z 3TSPA 2M52A 3R5BA 2PD1A 3KDOA 3FZFA 1H73A 1IXKA 3FQKA 3HHLB 1XJWB 4NLRA 1H74A 5LJ5Y 1QD1A 3B4MA 1QQNA 3C16B 4DV1K 2D3ZA 4AF1A 1IH7A 2ITMA 5KG6A 2QK9A 3QJPA 4GKJJ 4I69A 1RP5A 2HBJA 1KEKA 2IBKA 3QIPB 2GVDA 4GW6A 4QZVB 4M5LA 3AD8C 2JWNA 4DTRA 2CPZA 5JVHQ 1UWAA 1NGEA 5DMRA 1CJTB 2ALYB 3HD2A 2FZCB 4IH6A 5KFHA 5A2QY 4M7YA 1TUYA 1NOZA 1H1VA 3OVAA 4FJ8A 1HHSA 2HFOA 3QFHA 3W64A 3I0RB 1OPZA 3RSEB 2ZD1A 1R27B 5B7WA 2E2QA 5KFLA 1QQCA 3M6VA 4CIGA 4NMLA 2NZCA 2W7PA 4ZKAA 1ASUA 3QYYA 1XNQK 4J5OA 2DVIA 4MKVA 3WNEA 4IDHA 1TUGB 1RHJB 3PIOQ 1FDAA 3W3SA 4AE5A 1UJ6A 1PCAA 1U2FA 3MMCA 4Q8EA 1GOCA 3SV3A 2NUHA 4M5HA 4OPHA 4JOUA 3MEKA 2VL1A 2HB5A 3QATA 1YDLA 1XQIA 3ZO7A 2AEJA 3RAXA 4KHYA 2CXEA 2CVIA 1QLNA 1KAYA 1OWXA 5DGAA 2B3TB 4NLVA 1DTQA 2CQGA 5KFDA 2P9UB 2UUBK 2YKQA 4DUYJ 3VCDA 3VQQA 4USWA 2C2EA 1UAXA 2BEFA 3EGNA 4RO0A 1Z1ZA 1YI2S 3VQTA 1VRTA 4C9DA 3TAGA 2OPPA 1S1VB 2J0QD 5F9NA 2XMWA 3SBTA 3LP2B 1OMSA 3L7UA 4L75A 3PR5B 2AQ4A 2D9OA 1K73O 1SKUB 1YJ9S 1WELA 4PEOA 4M95A 1WF1A 5CH7B 1FJEB 2O4GA 1UCNA 4W5QA 4RW8B 3G6YA 1KHVA 3IUCA 4FZYA 4H4MB 1TFYA 4RNMA 4C3KA 4X62J 2WVEA 3HMJG 2UYTA 2EKNA 2I7PA 5EGYA 3UKUB 3OSNA 4CGGA 3DOLA 2QFIA 4B02A 3KLIB 3CJRA 1NG9A 1U2CA 2VFSA 3EICA 4E19A 4DPXA 4CT8A 4FYWB 1YVFA 1VC0A 4AQYJ 1SJ3P 4B3TK 4I4BA 1X5SA 3MR3A 2XSFA 1S6PA 3MR5A 2P51A 4MQ3A 1BA0A 5AQUA 4WU2A 1TKXA 1RA7A 4CIEA 2DXFA 1VQLS 2FF6A 1MW7A 2CQCA 4BR2A 5CA5A 3H59A 3C6UA 1X4FA 4N8NA 1SV5A 4YOVA 4M7XA 3LAKA 4DR6J 4AL6A 3DDKA 4RKUC 2YHYA 1FRMA 2HVHA 2FLLA 1SQGA 5D4PA 3T5HA 2A6AA 4CI0B 4DLGA 3NBPB 4ED1A 3C14A 3CIPA 3VAFA 1T6CA 4FXWA 4AT1B 2XYHB 2HVIA 3M8PA 3HULA 1S1UA 3W65A 2G4BA 4RUHA 5FPDA 1WC4A 2P9CA 2MLXA 3LM9A 2IYGA 4J90A 2N3LA 5BYSA 2HHXA 4JI4F 5C7PA 3AA5X 4IQXA 4DSLA 1AZSB 2E20A 1EQYA 2DRAA 4CJKA 2MLZA 1FDDA 3R3LA 4B9NA 2MZTA 2GFFA 2IVMA 2LQBA 2E44A 3GYNA 5SZTA 4N76A 1UVNA 1T02A 1YQHA 3UI3A 2P6SA 4FOIA 2QTWA 3TAMB 1Z2LA 1CJVB 3N4QA 3J7AP 4RWTA 1GMVA 2RILA 1BC6A 1F5AA 3M30A 5CABA 4Z0UA 1PJ5A 3K89A 1IKVA 4DV2J 3FSXA 1RT1A 1JIHA 5A8WB 1ZBHA 3IFRA 3Q8QB 2XMVA 3CWJA 2KT5A 3GP9A 4OHVA 4IFVA 4ZIVA 2IMWP 1QAXA 4RW9B 1WSJA 2YNGA 2EPIA 3DGVA 4YOYA 1TK0A 2G1HA 2IS3A 5KRSA 3PVXA 4A2BA 2D9PA 5HRPA 4JAXA 4ANEA 3M32B 4KTWA 1RWMB 1WI6A 3W9IA 3G82B 1Q82T 3M2VB 2CRLA 3HM8A 4ES2A 2OYQA 3OXGA 3HCXA 4JI0J 2DISA 1Y11A 4J2DA 2BACA 4LY7A 4OHXA 2ZOFA 4DL3A 1JLAA 3HHLC 5A0YB 4LR8A 2CH6A 1NCLA 1K1SA 4YFUA 2Y3YA 4WZMA 4JKBA 1RT4B 4M45A 5HP1A 5C12A 5KT5A 3G8QA 5A2QO 5KPZA 3B8HA 2CQDA 2AJQA 4CTAB 1Q4RA 1BMQB 5LJ3Y 2FUG9 2BBEA 4ILRA 2CPXA 4LF7J 3KK3A 5KFYA 3PSIA 1RABB 4UOGA 2NXNA 6AT1B 2ZKUA 1J5EF 1L3TA 3ULEB 2DNHA 4UQTA 2ZBPA 1NPRA 2BQUA 1MMDA 3H2VE 1FJGK 2P9IB 1NMEB 3FZLA 2NXCA 3ZEUB 3HJVA 2P9PA 2OEJA 5DLFA 2DITA 1EWQA 2LU1A 5GAEP 5BR8J 1BGXT 4FWRA 2MGZB 5GAGU 3D1QA 3Q8RB 3KG0A 3PW7A 4Z37A 3QFUA 4Y2MA 3J81O 4I9QA 1NGGA 3SUQA 5AZJB 4MKBA 4WFYA 3GCXP 4X66J 2KG1A 3G6VA 4HUEA 3U9ZA 2UXDK 4BREA 2Z30B 3T1HK 2B4PA 1IN0A 1ZPVA 4LF5F 2NPIA 4DTNA 1RBOB 2HIQA 3UNGC 5GAHI 1HPZB 2K1RB 3THYA 3PXGa 4MLHA 3V81B 5LJWA 2IY5B 2XY8A 3N79A 4CK2A 3ELHA 1NDPA 3BQ0A 3C94A 2PC6A 3TSUA 2OEKA 4PZVA 3OVNA 3SLCA 3QINA 4JB8B 1EIYB 5AZIB 5A6WA 5DS7A 2Z2ZA 4U95A 2YX7A 1EO1A 1IR0A 1WG1A 2KQ2A 1F0XA 4XO0A 1Q5VA 4AYBD 1KC8O 4KPYA 2DTJA 3OV7A 4USTA 1N0UA 2QT7A 4ZIWA 2YNHB 1KNZA 3OBIA 4C8YA 3NCQA 1N32F 3FJ2A 4G65A 3MM9B 4OV6A 4DR2F 1EB0A 2ZJRL 3ZSXA 3NKYA 4QOZB 1DEJA 3L4BC 2LP4A 2F7VA 5F8JA 2XY6A 1T3VA 2DO0A 4DX5A 4ZP9A 1BLUA 1VMBA 4EWTA 2C3MA 2QEXS 3CJ8A 3M8YA 1LOTB 3PRBA 4A2AA 2RB7A 3CO9A 4HLBA 4NO7A 3NGRA 3WC2A 2OCEA 1NJYA 3FR0A 4U7UK 3RB6A 3O9UA 4RU2A 4YY3F 3PJWA 4CZKA 1B0TA 1M1HA 1U48A 4QS9A 1CXUA 4DPYA 3D2EB 4FJGA 3AT1B 3EXCX 3HI0A 1U0HA 2Y1JA 4OI2A 3E01B 2QL5B 3VOVA 3OFFA 4K8RA 5FPMA 2HLTA 2ZGZA 3CDBA 5F2RA 1CC7A 3TVYA 4JI2K 2XY7A 2I1RA 1NPKA 2ZH7A 3CHWA 2VUGA 3ITHB 3TX8A 4AM7A 4Q0BA 2MTLA 3QIPA 3OQ2A 1HKCA 3DI6A 1PJ7A 2V69A 1CJTA 1RT7B 2AP6A 1VSHA 4ZN3A 4PL7A 1KVIA 4KH6A 2QMUB 3UDCA 3I0RA 2KHCA 1FKOB 5CY4A 1VS3A 2VQEJ 1HRHA 3G6XA 2X51A 3L2QA 2Y0SD 3KXDA 1HWUA 4NXMK 1LXJA 4JI7K 4JKFA 2E5LJ 1VQKN 5EHHA 2HWHA 4CP5A 4KT0C 3Q83A 1V4TA 4LH4A 3AOAA 3FCVA 2BX6A 5D78A 2Q43A 2XCPA 2MJNA 2D0PA 4FO0A 1KC8T 1VQ8S 3CPWM 3D7EO 5M1FA 2GJIA 1SB6A 1ZBSA 1ATNA 5M1OA 5B0CA 4DV5J 5F41A 3DDNA 2XWYA 4M41A 3H08A 1RTIB 3FSIA 2KYXA 4TYBA 4YDUA 3FGUA 2MYFA 4ZLNA 3CXCM 3AGRA 2W9CB 4CW7B 2XMTA 1XMOK 1VLYA 2V8GA 1HKAA 2ZZNA 2C3UA 3ZZZA 5L1LA 3FQLA 1KR4A 1UPPA 4BHQA 1S1VA 5J2PB 1PC4A 4JV5J 4KGVB 3LP2A 1K0VA 5B08A 1XBWA 5K8OA 1SUQB 3GG1A 4AHCA 3P6YC 4F50A 4RW8A 4LFAF 1ZA1B 4FP9A 4H4MA 3ICLA 2BGGA 3P5JA 4ZJQA 3M4XA 3G4SS 3UKUA 3CCMN 2RQMA 3M8QB 4FJLA 4LF9K 4UT4A 4RU9A 4OJ1A 4PKHA 3IG1B 4J9RA 7FDRA 3CCRN 2KDOA 4X65J 1NDCA 2IOCA 3I55S 2DH7A 3NY0A 2IA6A 2FQQB 2QC3A 4CZEA 5AQFA 1XQSC 4DV7K 4N7TA 3O6QA 4K2XA 3KFWX 2WOMB 4E7HA 1F6TA 2BJ3A 3R5CA 3KLFB 2W4CA 1HNIB 5E33A 1RU1A 3DRXA 2ASPA 4CD3A 1H6KX 3DXMB 5CYMB 1WAFA 4F4XA 2DCLA 3PACA 3W2VB 1XI1A 1GK8A 5DM7L 2P9NB 5H1SV 3HJFA 2DR6A 4IDKB 4FLUA 4RW7B 1VK8A 2QWMA 1VJQA 2HNZB 2WB1D 3LDOA 4CNYA 2BW7A 2FSNA 2R8HA 4GNIA 4FYXB 2VH7A 3L7OA 1B7FA 2IVNA 3J7AN 1JLBB 2BR0A 4A8OA 5K8MA 1S48A 4LD0A 4ZOSA 3FE1A 2M7SA 1IKXB 2AU0A 4FLVA 2O01C 4LVOP 3ZNUA 2JEFA 5LMNK 1UW4A 2QA4S 4PRFA 3NBPA 4O3QA 3OFGA 3PNIA 1XMQK 1G1XA 2CYYA 5J2MB 3WZ0A 1XK8A 4FWLA 4B8CA 3D45A 4W5OA 2XZDB 2IDOA 4IOBA 3JSYA 3O8WA 3U3YA 1S9GB 3KYLA 2CQHA 4OMFG 2LXFA 4H03B 4PXEA 5DLGA 2OTJS 3LM2A 3GFYA 1TUVA 1AZSA 5AQHA 4E0DA 4CZHA 1Q8KA 4CBXA 3VAKA 4ISGA 2F5GA 4E2FB 4LQ9A 3IA0A 2CPYA 4H4KC 1DGKN 2QI2A 4ZPWR 4DL7A 3U9DA 2O8FB 3VERA 4F4ZA 4LR7A 2ACYA 2PFUA 3TAMA 3KLGB 3TAQA 1FX4A 1SVDA 4K2JA 4X64F 1CJVA 2OPSB 2XZTB 1RWNB 2UV8G 2HQCA 3V6HA 2FC0A 3DLLL 1CLFA 1EX4A 4OKJA 3B82A 3T6BA 5J2QB 4TVAB 4N77A 3H3OB 4FJJA 4M3TA 1KDNA 1P9YA 3SSQA 3TX0A 4JI3K 3O08A 4FK2A 4L3KA 4CM0A 4Q43A 3J7YI 4OZLA 4BR4A 1WUUA 5DRKA 2A10A 3SUPA 4RW9A 3HFKA 2Z4PA 5F9LA 4B1XB 1Y9OA 1NDKA 4ECTA 2GJFA 3M32A 3Q8UA 4Z4HA 4LRFA 2OO4A 1M5HA 4JK9A 5KG2A 1T9UA 3QSYB 1IR2A 1WBDA 1DKGD 4A4JA 3AAPA 3SAFA 2UU9F 3PTWA 3V2UC 3AQPA 3MWTA 2QFJA 5A0YA 2ZOGA 1IBLJ 4CWBA 1YZ7A 1RT4A 1YVUA 1IG9A 2A3JA 3HKZD 5HOOA 4W4MA 3DLKB 2BRKA 2IM0A 1NGBA 3M5RA 3P83D 4CJRA 2PE8A 2YKPA 4AILC 3EWGA 4DR7F 3GIKA 4CTAA 1OY9A 3CCSS 1WHXA 2Q0RA 4TQRA 3ZC4A 5LT5A 1QZ5A 4H5TA 3FFIB 1UEUA 2I8EA 4KB1A 4GKJK 3ULEA 4PQUA 1EP4B 3I0SB 1NHKL 2XM3A 2BJEA 5D77A 3ZEUA 3IS9B 2VG5A 2FD2A 3LGHA 4JV2A 5ETRA 1X31C 2Q31A 3QERA 3S3OA 1O6XA 1NJXA 2DRBA 4QS7A 5AZJA 2V2QA 5JICA 2CA9A 3OL6A 4HH1A 2IC3B 3CW2C 4F0KA 1RAIB 3AVLA 3TU5A 2KU7A 4DPOA 1FEEA 3CCUS 1RBVA 1ACMB 4ED4A 4Q8FA 2NRZA 1NK0A 2WAQD 2GVZA 1HPZA 1BUXA 2K1RA 2LYVA 4EP4A 3V81A 1BWVA 3L7PA 2VODA 1HI1A 4FYYB 2C2ZB 3WQUA 3AGKA 4OX9J 3GIMA 2XI3A 2QJ3A 4DQPA 1WSGA 1IBKF 2DY4A 4IG3B 3A8YA 1U7LA 2HF4A 3JB9k 3OL7A 4BC7A 1U0SA 3LZIA 5AZIA 1F21A 3MM6B 4C98A 2W6LA 4NRTA 3HHLD 5D4NA 5C2GA 4X4NA 2I7NA 4YOUA 3TR5A 3MN9A 2GC8A 2VPWB 5JXSA 2YCHA 3AVHA 4P9SA 3QJJA 1U1KA 2DR9A 3D1HA 3MWPA 1RWVB 4DUYK 4WQ4C 3RBXA 2M8DB 1TP7A 3J7Z5 5CCMA 2HFUA 3RGIA 2NCKL 5KG4A 4K0KJ 3SPYA 2V5HG 5AJ3J 3THWB 2AGQA 4B3MF 4CH1A 4K42A 3GZ7A 3NAHA 1TYQB 1FRHA 3OYKA 1K8KA 5D4OA 2UUAJ 3DCAA 2BM1A 5A2QU 3BPSP 4L3NA 2F1FA 4X62K 2IAJB 1HNXF 4ZCLA 2ZZMA 3DLEB 1BWEA 3UCUP 4E98A 1X4HA 2C3YA 2Q3SA 1Q1KA 2COLA 3BO4A 4IFYA 4DLEA 3PX4A 1VI7A 3NGUA 1LW0B 2HRTA 1JK9B 4AQYK 4M5MA 3G9CA 3OYBA 1WG4A 3E01A 3EVMA 1EKRA 5D4LA 2RQKA 3PV8A 3QEIA 3W8GA 5BPLA 2JFKA 3O3GA 4ZPBA 3L9ZA 3J81U 1OKJA 4DTUA 3ITHA 3SUOA 1WD6A 1D1UA 3BH7B 4FM0A 1S7HA 4QU7A 3DLJA 5DZ7A 1NM1A 3P39A 4DR1F 1HLWA 2OFHX 4RNHA 3IAYA 4ZS6A 4Y1CA 3WQPA 1NNDA 4DR4F 4FWOA 1RT7A 2U2FA 4DR6K 3VF2A 4B9LA 3TA1A 3MEDB 1XNRF 4DCPB 1RT6A 4BRQA 5T7LA 1R8BA 5AQSA 1D9DA 3O9RA 3CEDA 4W98A 4KE5A 4DPTA 1FA0A 3CCSN 5DETA 1FKOA 2ALZA 2B8QA 3MOJB 4OGEA 1TL3B 3R7NB 4I6YA 4ILMA 1IQZA 4YB5A 1H72C 4QW9A 4V19X 4KI4A 4OX8A 2MQPA 1VLOA 4GO7X 4F3MA 3MMBB 1QHAA 2VQFF 4Y0FA 2UXCF 5HN0A 1TV6B 4ZVFA 3RMDA 4DG1A 1GMWA 1I5OB 3EVWA 1MROB 1LCUA 1R8HA 1N33J 2HAIA 4UF4A 1QVGR 3HFVA 4TXSA 3NP5A 2LVWA 3C65A 3LWLA 3PR4A 4X4RA 5D0GA 1EWRA 1KXPA 4KY3A 3MR7A 2HBRB 1FNXH 4X4QA 3AO5A 4PQAA 3I56S 3LPTA 4URGA 5IFMA 4ED5A 2V63A 3V9SA 1X0PA 2FY1A 4B3RJ 1N8RT 4WZQA 2I6WA 3CT9A 3OYMA 4YN3B 1HR0J 4USKA 2E2OA 1RTHB 5J2PA 2VWBA 4QYZJ 3BO2A 4OYMA 5L9XA 2OIHA 5AXNA 2J0WA 2DGSA 1JJCB 4DV2K 3L8BA 2VFRA 1WUAA 1OYDA 3BJYA 1NHUA 2DHSA 1QZ6A 4GKKF 1SUQA 7AT1B 2Y9HA 2MHEA 5GAHP 4QIFA 5GMEA 3CQXA 4JI1J 5AQMA 4Y6IA 2R2RA 2IRUA 2WVFA 3VAJA 1VQNN 2QWOA 3TTDA 4J2EA 3M8QA 4Y65A 1U2VB 3AVKA 4Z4GA 1ZM4A 4OYWA 2QLXA 2R42A 4JI0K 4QU6A 3ATUA 2DR5A 3HX9A 2WOMA 3RU0A 4BRFA 1JJ2R 5F8NA 3KLFA 1AUSL 2IDEA 1HNIA 4PPZA 2ZM6J 3DXMA 3BGLA 5CYMA 4F67A 4C3LA 5KQ8A 2MQQA 1RBAA 3W2VA 5GMKa 4URSA 1UA1A 2DFEA 2P9NA 2HW3A 1BQMA 4Z7YA 1JLCB 3BSCA 3PIPL 4QW8A 3NGSA 4O0NA 1NGFA 5EY4A 4FWKA 3UW1A 3PG9A 4LF7K 4FVCA 1JLBA 3T19A 3RAMA 2E66A 3FEZA 1SL2A 3JSRA 1UZDA 1U2RA 2QLFB 1B64A 3SMSA 2DJWA 4J9UE 2H5IB 2ZH1A 4IUFA 2NYHA 4LFCF 3ONQA 2UUCF 4XPCA 3V9UA 1R6VA 5BRFA 1RT2A 2RRNA 3C6TB 3DRSB 4CF8A 1P27B 2WVBA 3N0VA 2VD3A 5BR8K 1RDUA 4KTZA 3OL8A 1BI4A 4WU3A 3OJSA 1OQ3A 1WEYA 2KW4A 5J2MA 4ZCMA 2IFXA 1I3AA 2X78A 4X66K 2RVJA 3Q7BA 2D0CA 1S9GA 1WOOA 1YF5L 1H7WA 2O8DB 2FVPA 2U1AA 3GJSB 3U8XA 2MLYA 2HIYA 3Q7CA 1VBYA 1HYZA 3JS9A 2CQPA 1N34J 4XIUA 4BRHA 3PX6A 4FF3A 3AHPA 3W7BA 2HHUA 3HF5A 2GW8A 3NOGA 3IWXA 3CJ3A 4CH0S 1JMTA 4KGKA 2QO3A 3DYAB 2RQ4A 2CWKA 1QVFM 2J9EA 3QWPA 4P73A 5IWAJ 1CPZA 3KLGA 4UUWA 2XHWA 3D6HB 2WTUA 4FJNA 4GO5X 2Y1LB 1V5IB 2QV6A 4FXVA 4IWVA 3MAAB 4JI5J 5J2QA 3KVGA 3PEHA 2O1PA 4FZZA 5LSRA 2DNKA 1X4BA 2VDHA 4PR6A 2AEFA 1IWGA 2EK1A 3VQBA 4G1QB 3GYXB 1Q18A 2BMBA 1YIJS 2XMUA 1TL1B 3IRXB 1R8AA 1HLUA 1W7WA 3HVWA 1WKLA 4FWQA 5EXWA 4B9UA 2V4QA 1QSYA 4P2MA 1S5JA 5M2RA 1WWHA 1VRUB 2PI4A 2V50A 5LL6d 3NH2A 3K58A 3A3OB 3CCLN 2MSTA 2D0BA 4OV1A 1EETB 3M9MB 3GTYX 1H2TZ 2EC0A 2V8VA 3NMRA 2NZTA 2UV8A 2Z1IA 5D0HA 3TQ1A 4H4OB 1VSDA 1DHMA 1DARA 3A1YG 4OJHA 1ZOTA 2KXFA 2KKZA 2C2RA 2GQ2A 3GL1A 4OZ0A 2QZ8A 2PZSA 3H46O 5HATA 3FFIA 4ECQA 3MECB 4ZVPB 3MPVA 3PYEA 2MKKA 3CJQA 4XH1A 1EP4A 3I0SA 1JL2A 1SH0A 3ZCMA 1I1GA 1UFLA 4PXCA 3IS9A 4CF2A 1DAXA 1S0NA 5HANA 1QS4A 2EFGA 5AXKA 1WI8A 4O0IA 5MLCQ 4M8LA 1C1BB 2YWHA 8ATCB 3LGMA 3KHGA 4CF1A 2CQBA 2IC3A 2VQEK 4MDBA 1S22A 1LV5A 3ZT3A 3FEXB 5HBMB 3EPGA 4DUZJ 3EKSA 3E2EA 3SEOA 4DQ8A 5CD4H 2EX3A 2E5LK 4OPKA 4CQ1A 4DR5F 1IM4A 4ZPAA 2D3O1 5GIOA 5IM0B 2R7VA 2O8EB 2K3KA 4O4GB 2F7TA 3HZEA 2VU5A 3BREA 3Q24A 2D3OR 1RWUA 3CG7A 1CULA 3HSCA 3PIOL 3ZXWA 1MLAA 3OFHA 2XS2A 4IG3A 3D6MB 3OTOF 4TN2A 2F4VF 1W7AA 4DV5K 3C6AA 1FK9B 2MKSA 1UOCA 2DB1A 3ZTQA 3MM6A 3SMZA 4CFDA 2BABA 3GILA 3KJQB 2JEIA 1RSCA 1GLJO 2LKZA 4A8WA 3IXQA 4AL7A 4FZXC 3HZGA 2R8JA 3THXB 4DS5A 1NKBA 4E7JA 3K5NA 3F9MA 4GMKA 3AVNA 4NYNA 1Z6RA 3THWA 4BS2A 4FWMA 4JV5K 3BV8A 2QL9B 4USVA 3CPWR 4FJXA 3Q2SC 3RB0A 2WSEC 3IWNC 1TYQA 3MOZA 3MN6A 1R7IA 4CLZA 3CE8A 2XMAA 1QM9A 1SKWA 3BF4A 4BY9C 1NB7A 4KGMA 3ID8A 5F3TA 5HROB 4U67Q 1U6FA 1H2UX 4DU1A 2V68A 1W26A 2IAJA 3DLEA 4LBHA 1YHQN 5HJYA 3L3UA 5TKYA 4MIBA 2PY5A 1X4DA 4X65K 1TK5A 1LW0A 4R5PB 1FXXA 1RTJA 1Y10A 2W4DA 4NWBA 3J81j 4ZHRB 4DL5A 4FLTA 2XG8A 4FXDA 3LDNA 4B9VA 5KFEA 2ZGYA 1RGIA 2LCWA 2ZBCA 1WTBA 1GT8A 3L2UA 4QAGA 3R1XA 2RH3A 1IUJA 3C19A 4CHPA 3CDAA 2DGOA 4CZGA 3TI0A 1RNHA 2A18A 2NS1B 2XHBA 1S3XA 1ICEB 4FS1A 3AVBA 1KQGB 5DG7A 3MEDA 3P31A 3QPIA 3MZIA 4M5DB 2YQ1A 3WBZA 3O9SA 2Q79A 4JP8A 3T41A 2QMWA 2MQLA 3CJ0A 2QX0A 5EWFA 3UCZP 2F96A 4K4YA 3H4BA 1TL3A 4A57A 2EBEA 5KFRA 2W8LA 1WG5A 8RUCA 5F8IA 3V1QA 5BRDA 5L1JA 1CG2A 4HHJA 2RDDA 5HVFA 2QGFB 2W2MP 3BF3A 5ETSA 1MROA 1P90A 2J0XA 3ZZ0A 4YNQA 2GJ2A 2IVFB 1NSPA 1X4GA 3BGFA 2HHPA 1A5WA 2KJVA 4KIAA 1V3SA 4J9KA 1FD2A 5THWA 1YXQA 1BQNB 4PKDB 4NA1A 4R79A 4Q2LA 2VPXB 3KUHA 3K5MA 3O3FA 1W2BM 4OYIA 5E3AA 2JEGA 4F3OA 4ZCIA 2W2OP 4PG7A 2BE9B 5KOXA 5HK4A 3CULA 3T5KA 3R8EA 2R4FA 5DJBA 2CFXA 4YP3A 5LXYA 1RTHA 3M1VA 1HPMA 4CZJA 4FPIA 3IP0A 1HIYA 2EHGA 1RHQB 4BDPA 4QIGA 2VJUA 3KMSA 3PM9A 2E9TA 1B3TA 4WQ5C 3KK2A 1QAIA 2Z1HA 1ZBUA 1Y5NB 3OFEA 3KK1B 3GJQB 3FBBA 2I38A 2AJFE 3CMEN 4DL4A 1MWMA 4KKOB 2P9EA 1B99A 2K8GA 3G0ZA 3LDPA 2VBWA 3V4MA 3JSMB 5FJ4A 4JI4J 1U2VA 1KVKA 3K8VA 1UEKA 1BHLA 2XRIA 3PRVA 4Q2MA 1S1TA 2VC0A 1B92A 2K3IA 3JXOA 3CCJN 1PAUB 3HOTA 3NAEA 1IBLK 5DQHA 1FXDA 4Z4CA 1J2VA 4KHPF 4TLRA 4NZ0A 4I1TA 1AYEA 3Q2TC 2FVSA 2LQ9A 4ZVHA 1XEZA 4Q44A 1S1XA 3MM8B 2HSEB 1JLCA 4USHA 3VEOA 1AROP 1FFSB 1IBMF 2P5VA 2W7AA 4H8KA 4B17A 2VGMA 1H98A 3IRWP 2O5DA 3CC2N 1UPMB 1NKCA 4OYZA 1UFWA 4ID8A 2YX6A 2DNQA 3U27A 4BRIA 3BBFA 1MU2B 4RPFA 3MURP 4PY5A 5C24B 3C6TA 3HDSA 4B8AB 4KJIA 4EK2A 3CCVN 2QM1A 3EYZA 4B9SA 2HHVA 1N52B 1EAYC 3CFPA 4OYPA 3EZOA 3GBTA 3OTEA 4M5NA 1F3VA 4RWWA 2ROGA 2DH8A 4YOXA 2W9BB 4I64A 3DKDA 3D6TB 3I5CA 2V52B 1JLEB 4DTXA 3DOMB 2GWKA 1HHQA 2YXLA 3D67A 4PUOA 3FK4A 3SIPB 3UE2A 5FRNA 1Q9YA 3U6FA 4ZLJA 3ETOA 3ZLJA 4MDAA 2BQRA 3RG6A 2E1ZA 4OX9K 4A8XA 3SV4A 5C10A 2XYGB 1TKZB 1D8YA 3VAMA 1AB8A 1IBCB 2E1RA 2FB0A 3GQCA 4R25A 1BU6O 3HT0A 3KG1A 1RTZA 4JI8F 1FEHA 1J5EJ 2VBZA 2AT1B 2K06A 1I39A 3D7SB 1YITS 2V4JA 3MAAA 7FD1A 4N56A 4JKAA 2APOA 2BKPA 5DM6Q 2ZJPL 1M5KC 3DRPB 4MKYA 4DWIA 3CDUA 4ANCA 4G1QA 4A59A 3M3ZA 1TL1A 5KFZA 4MFBB 3D2WA 4K0KK 5KTQA 3K8WA 5HVHA 5AJ3K 2RUSA 4GC6A 1G2EA 3O44A 3HK2A 3HXMA 4IG0B 3SMPA 3PW4A 2HBKA 5CXTA 3VEXA 1T05A 4X4SA 2MDAA 2PA3A 4LSNB 4LF8F 3IAS9 5GAGP 2DHAA 3UIQA 3TJ9A 4FJIA 4RNNA 2UUAK 4PA1A 3OYDA 1NK4A 3GFXA 4ISEA 4LF5J 2E5JA 4OZ5A 5E3CA 1E6VB 2VC1A 4BRLA 2OD6A 5FRMA 4Q5VA 2ASYA 1H38A 2NSBA 5L38A 2ZH5A 5D0EA 3S7RA 1WACA 4G6VB 2MEWA 4H4OA 1WBBA 1RTDA 2LFVA 4Y0WA 2AGPA 4YOWA 2BJ8A 1WLJA 3I33A 1RAHB 5AQIA 2QKKA 1X60A 3UB5A 1RDCA 3LL3A 4Y34A 3MN5A 2H54B 4IO8A 4ALZA 4LSLB 4ICLB 2DNPA 1N54B 1N32J 4Y2CA 2HK3A 2GIRA 2HQIA 1X7VA 2H3EB 2XWXA 4DN9A 4DR2J 3HVRA 3VQDA 2HVDA 3NAIA 2V8PA 1BIZA 2AJ4A 4YMEA 2EW9A 1C1BA 2WTFA 4JKGB 5IT9U 3M9NB 4BC4A 4A62A 4ELUA 5HL7L 4IRCA 4K8ZA 2V9KA 3A5NC 4BRAA 2R7QA 5EX0A 4XEIA 1TGOA 4JI6F 4TU8A 4TKTA 4HACA 1RI7A 3B4DA 1V6HA 5JLHA 4CK1A 1FNMA 1S49A 3M6GA 4ZK7M 2ILZA 1V3RA 4YY3J 1Y4ZB 1KQFB 1BHNA 2D0OA 4LH5A 3EVOA 2FBVA 3PHEA 3VPZA 2O8EA 4O4GA 1RQ0A 1RAGB 2WHOA 4IR9A 3WX4A 2CDRB 1N33K 4DV4F 1VQMS 4F0HA 5IQ6A 1VQON 3D2FA 5AQKA 5J1EA 1XUPO 1RLDA 1FWPA 3SJHA 1VQ4S 2OUGA 1IVZA 3N28A 2C2OB 4DFPA 3ZTPA 3TTCA 3KWGA 2W6KA 5J1PA 3O4WA 3U4LA 3IGVA 5FIIA 2QYCA 4UY85 4DMZA 3LDLA 1PYOB 2DNZA 5E41A 4NLBA 3THXA 2J8SA 2KLAA 3FCWA 4B3RK 3D0PA 1HR0K 4AHUA 4B3OB 4BWJA 4QYZK 4J2BA 1CEZA 3QNWB 4PHTX 2OEMA 3CC7N 2OMLA 2X1GA 3MMCB 3M8WA 3LA0A 3OHAA 4QPXA 4FDFA 3HSJA 3K57A 4HR2A 2HVZA 4PKIA 1VSIA 4NLPA 3GU0A 4G1PA 3AARA 4WP9A 3BGRB 4JI1K 4B9MA 4C8KA 3FNNA 4ZN1A 3WNGA 2DY1A 4HUGA 4BDYA 5B0GA 2KZMA 3SCLE 4J9OA 1VRTB 5M1QA 4WFNQ 3BSNA 2OPPB 4GV6A 4ISFA 4ES3A 3MUTP 4R5PA 5F3ZA 4LF4F 3S01A 3TJAA 3W5XA 4NLTA 2YNIB 3KZBA 2DO4A 1B0PA 2L3MA 4ZHRA 3ZT2A 5E2QA 3PYGA 3EE9A 1ASVA 1XHZA 2ZM6K 4CGFA 2FHJA 3TYTA 4HHHA 4X4OA 5K8NA 3D28A 4EBEA 2ZH9A 3T5LA 4BVPA 1UFKA 1FVSA 2CQIA 4GV9A 2KYZA 4CJPA 1WOQA 1WNEA 3L95X 2ZNZA 1NEEA 3GYGA 2OGUA 4DSFA 3MAHA 2F65A 1RWKB 4DR3F 4PWWA 3R2DJ 4M5DA 1NPPA 1HJRA 4LFAJ 4NX9A 2J76E 2FLPA 4ZVGA 2E8AA 1S72S 2AP1A 2H1YA 4S0MA 3CCQS 1TKXB 1VSKA 1Q8IA 2EG1A 1RT5B 4E1JA 2FJEB 4O44B 5KPTA 4E3SA 4NI2A 3Q8PB 5KAKA 1S0VA 2LEPA 1MSWD 3J7A1 4K4WA 2HBYB 3MMVA 1ZBIA 1RWXB 9RUBA 1VHIA 4IH7A 4HKQA 1FKAF 2Z58B 1JLGB 1JJHA 1OSDA 1XC9A 2YI1A 2RD5C 2ADCA 4AUKA 2G2ZA 5KFQA 1LK7A 3HKWA 2E1CA 4M5IA 5K14A 2OP5A 2A3ZA 1N34K 2ZEJA 3TAPA 1CLQA 1BQNA 3CD6S 3C14B 3M8PB 5IXUA 3AVGA 2BZ2A 2DFFA 3HSTB 4ECSA 1HBUA 5IWAK 3EM1A 1YGYA 4YQWA 3UN5A 4CDIA 5KFOA 4V19J 2CJQA 4P75A 3BQ1A 2PMHA 3US5A 4FJ9A 2MPUA 4JI5K 2HS3A 4CESA 1YJWS 1HHTP 1EJ7L 2DRDA 3LANA 5ETNA 1ESVA 3KKSA 1PAEX 2MZ1A 3HOSA 1B0VA 3Q8SB 2E1MC 3E3XA 2P5OA 3KK1A 2Y1IA 5HRNA 3BZCA 3J8AA 3I6PA 4CECA 4LJMA 1HNVB 4ELTA 1ITPA 1IKYA 4D3GA 1SQEA 3JSMA 1XR6A 3GJTB 3G6EN 2QSWA 4RNOA 3HL8A 2E88A 3WC0A 4CZCA 1B4SA 4BGBA 1DQAA 3TEHB 3FZKA 1ZAXA 2J9DA 5JS1A 4CHNA 1CJUB 2E29A 3O9TA 1O8BA 2X6NA 5L39A 3AV9A 3G10A 4P71A 1VQ6S 2ZHBA 1KN6A 1VAZA 2V2ZA 2EFVA 4X64J 2NRXA 2JSXA 3S3MA 3MM8A 3CMAN 3CYMA 4CEBA 4BC3A 2XI2A 4O8KA 3NH0A 3MF5A 4Y3CA 1RT3B 2XLIA 1X4AA 1N48A 5EUHA 3QETA 2MZSA 3D4JA 4DSJA 3RRGA 1PYSB 3ZX3A 5AXLA 3TA0A 1MG7A 3NNHA 1JLAB 2F9JA 3CUNA 5C24A 4UZCA 5E3PA 2IM2A 1SC1B 2R3VA 2H48B 1ZS6A 1RAOA 2IVYA 4OJGA 2HWTA 3ETMA 4E1NA 1C2PA 3VGUA 4LF6F 1H3DA 1J9AA 2ETJA 1NB2A 2W9BA 4F2SA 1MMLA 3CCES 3THPA 4DX6A 3TEGA 3KK3B 3IO1A 2UU9J 4DUZK 3DRRA 1NWKA 4USJC 1LXNA 1JLEA 1HBMB 3GV8B 3DOMA 2OTLS 4H0PA 2DGWA 3PW2A 1L5UA 1YWXA 3CJSA 2KM8C 4CJUA 1VIOA 5M2PA 4HT7A 1RDWX 4K4ZA 4MTPA 1JCEA 1Q8LA 2R2SA 1TKZA 4DR7J 2PDAA 2D3UA 4P2FA 2B0GA 2AYEA 2N82B 1YJNS 2OA8A 1VHFA 3SFUA 1KVCA 4BRKA 2N7YA 3TW0A 2XYPB 3DRPA 4I6MB 3OYGA 3VQSA 2GIFA 2OPRB 3T7ZA 5IT4A 3S8SA 3KWIA 3TAEA 1B70B 4LSZB 2NYIA 3KOAA 4OVLA 5KFPA 4MFBA 2XO6A 1B7YB 1WNSA 1TAQA 4WK1A 4IG0A 3ENBA 2IIRA 3M7VA 3OYCA 2QA1A 4K25A 4EO6A 3D9BA 3U3GA 3HPOA 3EXYA 3V6DB 1U1PA 4FWNA 4YHHJ 3FCHA 1JCFA 1CQNA 4JBCA 3AODA 2CQ4A 3AXKA 2ABYA 2IA0A 1KVBA 1E6VA 1VQSA 3GWCA 2D4WA 5JVGL 1JLFA 4CFAA 1MWYA 1OH5A 1VSMA 1E3MA 2VPZB 4JYAF 2V2VA 3QBCA 2QG9B 1IBKJ 3QGHA 3VETA 3OLBA 3M1FA 2FGCA 2E4LA 1Q86T 1N5YA 3A4TA 3FBEA 1B9FA 2Y1RI 1CS4B 3QO9A 3VGSA 3QAEA 2O3DA 3F0NA 3GR0A 3H2UB 3CJ4A 2XNRA 2ZF5O 4P52A 2H3GX 4YB7A 4LQ3A 1PYTA 1RHRB 2P9KB 1NSAA 3EGVA 3QAUA 4HDGA 5EDWA 4LSLA 4DUZF 1J6ZA 1RBRA 2CIMA 3LP1B 1P8GA 4LBIA 4A8MP 3PW0A 1I6JA 4B3MJ 2WSCC 5F8LA 3BKTA 3OPKA 4V19S 3TABA 1I94F 2WFBA 2OELA 1U0HB 1LWEB 4JKGA 3B8AX 3JAMY 2GO9A 2RQCA 2VBXA 3GLJA 2K2PA 3LUYA 1HNXJ 4NLUA 1TKTB 2XMKA 4DL2A 2BA9A 2Q1NA 3GMGA 5E5NA 3UO0A 3G96A 4JN4A 4Q0BB 1CC8A 2IMOA 2JVRA 3GCWP 5BRHA 1W9HA 3JQJA 1GLDG 2O8BB 3DI6B 2XBPA 2G1DA 3CC4S 4I9LA 3L3VA 1S12A 4FWSA 4WE1B 3UE5A 2HVEA 5M1NA 2EG2A 2DK2A 2HRUA 4GC7A 4WCEL 3BO3A 4UW2A 1XC3A 4BRCA 2C22A 1FWLA 3T1YF 3VQEA 3EL2A 2F9TA 3GG0A 1RYRA 2ZJRQ 4CLTA 5EU7A 3RW6A 1FVQA 3DJCA 4DR1J 3P38A 2WSFC 5KFKA 1U24A 4DR4J 3R6MA 2JLGA 1RJJA 2A1SA 1XNRJ 2PYJA 1W0HA 4XAKA 1V4SA 4B3OA 4XK8C 1ZTWA 4UOHA 3J81Y 3Q8YA 4KGZB 3UR3C 2DGQA 2AMCB 4DQIA 1VQ7S 3CJCA 3AA2A 3I96A 3OXLA 2R8KA 3L09A 3FFKB 4NEZA 1Y5LB 4CFCA 4KBIA 5KFXA 4BC9A 1E4FT 2RPIA 1VK0A 3BGRA 2GX9A 2VQFJ 3A5LC 5BXIA 1OJ4A 2UXCJ 3LZJA 3ISZA 4FYVB 3VENA 4B1WB 1X4EA 4OI6A 3J7YU 3L2RA 2ZC4A 2JJ4D 2GZOA 4JI4K 2SXLA 4NRUA 1A5XA 4IOAL 4BR0A 2YNIA 3D0HE 1D0EA 3SCKE 3GFZA 2NRTA 2ATCB 4M5KA 4BGAA 1KAZA 3T3FA 1JKHB 3VQ6A 5A76A 2HMIB 4CJSA 1DZ5A 3UCGA