1RTIA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 143
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtiA05
1EX4A 1TK0A 4CJRA 2BDPA 4K8XA 2R8JA 3HVTB 4DQIA 4ZHRA 3FRZA 4RW4A 3RB3A 1TVRA 3AVKA 1KFSA 4B3OB 5KFYA 2PZSA 4IG0B 4J2DA 4GMJB 3QEIA 3AVMA 1YVFA 2UVUA 4Y2AA 3KKSA 1RT4A 3H2LA 2E9ZA 1JXEA 3SFUA 4EBDA 2GIRA 3TAFA 2R8HA 4ZP9A 1VSHA 5EWGA 3IAYA 1TAUA 3VQSA 4EP5A 3U6FA 4FK4A 2V4RA 1TKTB 4RW7A 5KFPA 3MFIA 4IDKA 4Z4GA 3KJVA 5K14B 2FC0A 1J5OA 3ZSZA 4FZXC 3IS9A 2AWZA 3OL6A 5EU7A 3PUFA 3PV8A 3KLHB 3S3OA 1N4LA 4ED2A 1TQLA 4QWAA 1JLGA 1JLAB 3BQ2A 2HB5A 2QKKA 3OYCA 4OPKA 3RMDA 4Y1CA 3T19A 1QSSA 1D9DA 2X6NA 3BQ1A 3D45A 5HLFA 5KG1A 1BCOA 5T14A 1HPZA 1BHLA 1S9GB 4NCGB 3RBEA 1C1BB 5J2NA 3M8SA 5KG7A 1VRUA 1S4FA 4ZP6A 3RMAA 2VG7B 3ICLA 1HNVB 3CDUA 2IJFA 1X9SA 1VSEA 4Q0BA 3M9MB 5L1IA 2HAIA 3K58A 4O55A 1CXQA 3MECB 3T5HA 3Q8PB 1JL2A 1GOBA 2XCPA 5KT4A 4O4GB 3GILA 3AVJA 2Q3SA 3HVTA 2UVRA 4ICLB 3KIOA 2FBTA 5L1JA 4MKAA 2JEIA 4B3OA 4IG0A 3RAQA 4FYDA 2C28A 4FBUA 1TKZB 4B9UA 3IN5A 3BQ0A 1CZBA 1QE1B 4FS2A 4FLZA 5KFZA 4DTMA 2I5JB 2HWIA 1LWCB 5DQGA 3QZ7A 4E7HA 3SJJA 4WE1A 4J2EA 2AQ4A 1YVUA 3HPOA 3Q8SB 3KLVA 2E9RX 5KG4A 2OH2A 1QQCA 2KW4A 1VSIA 4B9NA 1TKTA 5HRNA 1K1SA 3EPIA 3U3YA 5K14A 1SKWA 3GIIA 3LPUA 3K5MA 1XHXA 3V6JA 3T5KA 3KLHA 4EP4A 1RBVA 1JLAA 4IR1A 3KLIB 1S0MA 3NCIA 3V9UA 4NLVA 2X6SA 4H8KA 4ECRA 4JV1A 4R8UB 4RNHA 5DQIA 3HP6A 1R0AB 3AA5X 4MKBA 5E41A 4ZPBA 1MU2B 2ZE2B 3QZ8A 1BI4B 2G8UA 3CVKA 1S9GA 4NCGA 3SYZA 2EHGA 4E1NA 4TN2A 4DF8A 1C1BA 4JRQA 4IR9A 5C24A 4IH6A 3K5NA 3I5AA 5I42B 2VG7A 1Z4UA 5HRSA 1HNVA 1NHVA 3VQ9A 2ZQBA 5KFIA 3VQPA 4E19A 4OKEA 3RRGA 4N47A 2HHUA 3SQ0A 3MFHA 3MECA 4FK2A 4W5QA 4K4VA 4O4GA 4KTQA 1A5WA 4DMNA 1SH3A 5D3GB 4OGCA 5KFQA 4ICLA 4DSEA 2NUBA 3OYNA 4FJMA 4UQGA 4IRCA 2WCXA 3AA3A 3MAQA 3AO2A 1TKZA 2FLNA 1QE1A 2GUIA 4TXSA 1KSPA 4KHSA 2P5OA 2I5JA 1LWCA 4FW2A 2F8SA 3PW0A 3KMQA 2IAJB 3L3UA 2Z1HA 4G1QB 2HHVA 1RT1B 3F9KA 3IG1B 3FQKA 4O0IA 4U7CA 1LW0B 3UDLA 3OYEA 4FCYA 1C6VA 3PX6A 4EO8A 1SH2A 3QEPA 1S5JA 1XI1A 3CDWA 4KHWA 5FROA 4FM2A 1F21A 3V9ZA 4C8OA 2HNYB 1S0NA 3HSTB 3K2PA 3CJ0A 3KLIA 4NCBA 3NMAA 1KFDA 1ZTWA 4R8UA 1RBTA 4CFBA 1R0AA 1BCMA 3PO5A 3GIJA 1FKPB 1MU2A 2ZE2A 3NGDA 1BI4A 2V0NA 4IG3B 3MR5A 3NF8A 1HQEB 4TQRA 3OS1A 4W5TA 1QUVA 3OYAA 1JX4A 4IH7A 5I42A 3CWJA 1HYZA 3GQCA 4NLWA 2ITGA 3ZSRA 4CJPA 1SL2A 1L3VA 2AGQA 3V1OA 4PQUB 3EY1A 5DK5A 3PZPA 3MEDB 2W9AA 4F50A 3PVXA 5D3GA 3V1RA 1C2PA 3EPGA 2ATQA 2JEGA 4QPXA 2JGUA 4OKJA 4CGIA 4JV0A 1WAFA 1VSFA 3I0SB 3IRXB 2IA6A 2HHXA 2R8GA 5CY4A 2FJWA 3Q8RB 3T3FA 4KO0B 3L2QA 5KFOA 3ITHB 4B9TA 3C95A 1NKEA 1CZ9A 2IAJA 4G1QA 1DTQB 1RT1A 3DYAB 3IG1A 4C8MA 1BL3A 3N6MA 5KFUA 1LWEB 3H5XA 1LW0A 4Z4EA 3E01B 4CECA 3K59A 3T1AA 3NAHA 3KLGB 4ECZA 4DQQA 4M41A 2HNYA 2VG6B 4DTUA 4B8AB 3NL0A 4DFJA 5HROB 4E7IA 3H98A 1N48A 3BSAA 2IOCA 2B5JB 1Q8IA 1KLNA 2VG5B 2QXFA 1IKWB 4FLYA 3AVBA 2RN2A 3P83D 2IBKA 4Z4FA 1FKPA 3OYLA 4IG3A 1HQEA 1RYSA 2XI3A 2BGGA 3QGIA 4ECQA 4QW8A 5J2MB 3GIKA 2YKMB 2CKWA 4L8RB 3HVWA 4PQUA 3LZJA 1SUQB 2WTFA 3LP2B 4GW6A 3OYIA 3MEDA 3VQCA 1VSJA 3DLGB 4LSLB 3UIQA 4HKQA 2WONB 3PX0A 3SV4A 2LSNA 1XWLA 4ZTJA 1L3TA 3I0SA 5KFJA 3IRXA 4J9MA 3OYJA 1RTJB 1KCFA 2HMIB 4K4YA 4DL4A 3TI0A 4WFYA 3L2RA 4HCBA 4F2RA 1YTAA 1JLEB 3G6YA 2AGOA 3OVNA 1WN7A 4KO0A 3ITHA 5DMRA 2W8KA 3MTKA 3KHLA 4ZP8A 2W7PA 3PW7A 2E6LA 4Q5VA 3GV5B 3DYAA 3OL9A 4CEZA 3KNAA 2RPIA 4W5RA 1LWEA 1Q9XA 3DLEB 3TABA 3T5LA 1RT6B 3E01A 4BE0A 4MIAA 1J9AA 3KLGA 1VSLA 4B9LA 2WB4A 3DLHA 3VQBA 4KB1A 2VG6A 4ED3A 4HUGA 1HQUB 2WRMA 2YNHB 1QAJA 1NKBA 5HROA 2B6AB 2B5JA 2VG5A 4CEDA 2ZKUA 3H4DA 2PY5A 3MR3A 3AVCA 3V9WA 3MXJA 4I2PB 5KGWA 3SPYA 2EX3A 5JS2A 2D7SA 4LSNB 4QW9A 5KRSA 4CHOA 1VK0A 5J2MA 1N5YB 4QAGA 3ULDA 2YKMA 2BANB 4CJQA 4F4WA 1UAXA 4AHVA 1JLFB 4B9MA 1SUQA 3LP2A 4CESA 2G8VA 1G15A 5KT2A 2KZZA 3DLGA 4LSLA 4CJ5A 3QERA 3HK2A 3NF9A 1L5UA 2WOMB 2Z1IA 4M3ZA 3L2UA 2P5GA 4KE5A 1VSDA 1X9WA 1RTHB 2HHWA 1C1CB 1RTJA 2JC1A 2HMIA 3SZ2A 3VQ4A 4ZVGA 1QHTA 1TL1B 4QWDA 1ASWA 2FBVA 4F2SA 1JLEA 4J9KA 3SI6A 5SWMA 1U4BA 5F8LA 4F4YA 2WK4A 1JLQB 4TLRA 4I7FB 2B4JA 1JKHB 4NYZA 4WYLA 2A1RA 4JS4A 3IGNA 4NLPA 1NHUA 3FQLA 2IC3B 4DTRA 3DM2B 3DLEA 1K6YA 1WSJA 4Y3CA 4TY9A 3K5LA 4NRTA 4M3YA 4FJNA 3HYFA 4FLTA 3NH1A 1HQUA 2YNHA 4JV2A 3HM9A 4CE9A 4DTXA 3RR7A 3PR5B 2B6AA 4EBEA 4ZVEA 4C8KA 1BQNB 3AVGA 4FS1A 4MQ3A 4NLUA 4FJ5A 3LAMA 4K4UA 1BGXT 3TR8A 2R2UA 4I2PA 3H40A 4RNFA 4LSNA 1RA6A 5L1KA 4EZ6A 4LY7A 4LD0A 4NLTA 4LQ3A 2RDIA 3LP3A 5KFAA 1N5YA 2DPJA 2KTQA 2BANA 1U04A 2XO7A 3F73A 2XY5A 1T8EA 4YQWA 5KFHA 1JLFA 3SPZA 2YNGB 5KFEA 4Q44A 4URQU 1SL0A 4OGEA 4FZZA 4H4MB 4CK2A 2WOMA 4K4TA 2HW3A 4XPCA 3AVFA 3KMSA 5I3UA 2FBYA 4FVMA 1RDBA 3RMCA 1NJWA 1RTHA 4I2QB 1C1CA 4KFBB 4CFCA 2GIQA 2HVIA 1NK0A 1TL1A 2FVRA 3DOLB 5F8HA 3QEWA 1HARA 4FLWA 3VQAA 4X2BA 3ASMA 4K4ZA 4Z4IA 3SUNA 4BWMA 5EWEA 3A2FA 1JLQA 3OLBA 4I7FA 2BRLA 4KB7A 1JKHA 2GV9A 5KG3A 4HVJA 2P1JA 2FVCA 1S49A 3AO4A 3ZT2A 4J9RA 1BQMB 2AX1A 4DL3A 3NE6A 2WHOA 2ASDA 2HNZB 3NGIA 1U49A 4AILC 1NK8A 2IC3A 5KTQA 5KFNA 3C6TB 4BDZA 3DM2A 4TYBA 4DS4A 1LV5A 4FJGA 1WSHA 5KFCA 3NF6A 3V81B 2BE2B 3ISNC 3HT3A 3TAEA 2UVVA 3VA3A 4KAZA 1KVBA 4FJHA 1SKRA 5HRRA 3G0ZA 3O3FA 4DTSA 2V9WA 1NOZA 1HMVB 4NCAA 2E9TA 2VWJA 1QSYA 3HP9A 1BQNA 3ZSYA 1JLCB 1NK9A 1L3UA 3DLRA 3QIDA 4M45A 3SQ1A 1WNEA 4ELTA 4O3PA 1NK7A 5KFKA 3TARA 3QEXA 1EXQA 4TQSA 4BDPA 4Z4CA 3HJFA 1ZBHA 4CK3A 3EZ5A 1I39A 1W25A 3G6VA 4KSEB 3ZT3A 1Q9YA 5KFRA 4R5PB 4CEEA 4U6PA 3KTQA 2YNGA 4IQXA 3SV3A 1QSLA 4DFPA 4O0JA 2YV0X 1S48A 4Q43A 2YHBA 3KHHA 3ZSQA 3OS2A 1S1TB 4H4MA 5KFSA 3MR2A 4O4RA 4CFAA 1IG9A 1U09A 1B92A 3D5MA 2OPQB 5DGAA 1KTQA 1ZTTA 4W5OA 5SZTA 1IM4A 3HKWA 3HPGA 1WSIA 4I2QA 4ZVHA 4R0EA 4KFBA 2XY6A 2FVSA 2DFEA 3D0PA 3BSNA 3H5YA 4O44B 1SKSA 4ED6A 2R2TA 1IKYB 4RW8B 4O3RA 4Q8FA 1RDDA 1BQMA 3WNGA 2HNZA 1IH7A 3LWLA 1ZETA 3C6TA 1GX5A 3KKRA 1S9FA 2D5RA 3OYFA 4DQRA 1FK9B 4ED0A 2BE2A 4DS5A 2F8TA 4IKAA 1SH0A 5F8GA 3HHKA 3NH2A 2ETJA 3NGZA 4ID5B 4DLGA 1HMVA 3DRSB 2D0BA 4GC6A 2HHQA 1OS5A 4ZPAA 1JLCA 3QNOA 1D9FA 1TP7A 3BJYA 4NLXA 4AH9A 3AV9A 3TAQA 3LWMA 3DDKA 3VQ6A 4RU9A 4AHUA 5KT7A 2CJQA 1EETB 1ZBLA 4CEAA 2XRIA 1B9DA 1TKXB 4FJ8A 4DWIA 3S9HA 2C2DA 2J6SA 4EO6A 4CHYA 4R5PA 3C94A 3RTVA 3PJXA 3FDSA 5EUHA 1D5AA 3LPTA 1S1TA 3SI8A 2ILYA 4EYHB 5KG6A 4O3OA 3VQ5A 1U48A 5DGBA 5F8NA 3HXMA 2I1RA 3AA2A 2G8FA 3CDEA 2D0CA 1S1WB 4KV8B 4MFBB 4B8CA 4LH4A 5F8MA 2ALZA 2D0AA 4KHRA 4XPEA 4DSJA 2HHTA 5KI6A 3CFRA 4PWDB 5DLGA 4WFZA 3TWHA 4O44A 4IH5A 3B6PA 3OSNA 3H5UA 3M8PB 2QV6A 4TYAA 1NOYA 1IKYA 4RW8A 3RRHA 2KQ2A 4E1MA 3DMJB 4CJTA 4DFKA 3ZT0A 3G86A 3MEEB 3UPFA 3P1GA 3BREA 5KRTA 3OJUA 5KT6A 1TK5A 4M3RA 1LWFB 3CIZA 1FK9A 4CK1A 4NRUA 3EYZA 2G8WA 2XY8A 4DL2A 2W9BB 5KFTA 1YTUA 3NAEA 1WNSA 4M94A 4XO0A 1XR6A 1ZBUA 3L2VA 1D8YA 4ID5A 3DRSA 2J6UA 3AA4A 4N5SA 4RNNA 3HO1A 3QINA 2FVPA 5F8IA 1TK8A 1T3NA 2G8HA 4CHQA 3SUPA 1FKOB 2BQRA 2HVHA 5DLFA 3VQ8A 4ZP7A 5FRNA 1EETA 3PW5A 1RT7B 1TKXA 2W42A 1CXUA 3LZIA 4IKFA 3OSPA 1A5XA 3S3MA 4RW6B 2QE5A 3H5SA 2PYJA 2DFFA 4GVMA 1X9MA 1UA1A 1JL1A 3U3GA 1WSFA 4BWJA 4DQPA 2RDJA 3BDPA 1JXLA 4E7JA 3RMBA 2XHBA 2W8LA 3QETA 5J2QB 1WAJA 3I5BA 2ZD1B 4C8LA 3M9NB 2HNDB 4ECSA 4TSXA 4B9SA 1LAVA 4KV8A 4MFBA 2C22A 5KG5A 2KFZA 2HWHA 3PX4A 1RT2B 4KHNA 4FBTA 4DTOA 2IMWP 4ECVA 5J2PB 4PWDA 4NLQA 4W5NA 1TV6B 5EWFA 3M8PA 3V4IB 4WXOA 4PY5A 3MR6A 4KB0A 4NYFA 4JS5A 2HHSA 2YNFB 1IO2A 4I9LA 4RUAA 1DTTB 1J54A 4J2BA 3DMJA 1RTDB 1RDCA 3MEEA 4FJXA 1T05B 4NZ0A 3L8BA 4M3WA 4CFDA 4O3NA 5HP1B 2IM2A 3AVIA 4KRFA 4DU4A 1LWFA 4O5BA 3MF5A 2RF2B 1ITGA 3PR4A 4Y2CA 3QESA 3OLAA 1RILA 4CCHA 2W9BA 4RW9B 1DTQA 1I3AA 1ZBIA 3OS0A 1JLBB 1ZBFA 1TAQA 1SL1A 2A1SA 1XC9A 4ECXA 4KBIA 3I0RB 3KHGA 2D3UA 1S1VB 3VN5A 3DLKB 2ATLA 1SV5B 4M3UA 1CLQA 2C2RA 4CGFA 1RT7A 4CJLA 4CIFA 4FM1A 2IGIA 2DPIA 4RW6A 4FZYA 1IKWA 4YMEA 3TAPA 3KK3B 3VQDA 4N56A 1LW2B 1EKEA 3RB6A 4DF4A 1K1QA 4CJVA 3CJ4A 4KKOB 1VRTB 5KG0A 1I6JA 5KT5A 4J9OA 4ED7A 5J2QA 2ZD1A 1UOCA 3CJ3A 4DSLA 3MXMA 1C1AA 2HNDA 4ED1A 1T03B 5CZ1A 4BACA 3LANA 1W0HA 4OLAA 1X1PA 3OJSA 3OY9A 4H54A 1JLGB 3HVAA 1RT2A 2B43A 2JEJA 2WONA 3QNNA 4KHQA 5J2PA 4WYWA 4F4XA 1TGOA 1C0UB 1TV6A 3V4IA 2VWKA 3SQ4A 3RR8A 3PW2A 4YR3A 2YNFA 4E7LA 1EP4B 4WFXA 3CFOA 1DTTA 2OZMA 1REVB 1RTDA 3CM6A 3JSMB 1LAWA 4DSIA 3QO9B 1T05A 4F4KA 3EZUA 3SCXA 5HP1A 4O3SA 3NH0A 5HBMB 2RF2A 4PUOB 3KHRA 4JUZA 4HTUA 2Y1IA 4MIBA 4RW9A 4HHTA 3KK1B 1S1XB 2J6TA 2P51A 1S1UB 5DQHA 1JLBA 4EYIB 4JLHA 3PJWA 3I0RA 1RT6A 4LH5A 3O3HA 4CF2A 1KRPA 1VSMA 3BSCA 1S1VA 3DLKA 4ZTFA 4YR0A 3G6XA 3QGHA 1SV5A 5KG2A 2F8EX 4YP3A 1N56A 1IKXB 2G8KA 3NHGA 3PY8A 3CJ2A 4OVLA 2IM3A 5KFBA 5CZ2A 1C0TB 4ZPCA 2XY7A 4HYKA 3KK3A 1NK5A 4CJSA 1LW2A 4WE1B 1WLJA 4ID1A 2DY4A 4QWEA 1RT3B 3B6OA 4KKOA 2R8IA 1VRTA 4ZMMA 4NYNA 4I9QA 4CGJA 4CJKA 1TKDA 2VA2A 2BQUA 4HCCA 2ASLA 4E3SA 4NLRA 3TVKA 3L2WA 3BGRB 2OA8A 2OZSA 4ZVFA 1T03A 4J9PA 3DRPB 3GV7B 4WXWA 1QS4A 4AHCA 4ELVA 4DL5A 3AO1A 5J1EB 2W9CB 1HYVA 2YNIB 3IGVA 4J9QA 4KHYA 3PW4A 4KI6A 3OL8A 1C0UA 2D41A 1U45A 4ED8A 2C2EA 4ELUA 2AJQA 4DTNA 3VQQA 4NLGA 1RA7A 3WNEA 1EP4A 5JXSA 2D3ZA 2JEFA 5DG7A 3PO4A 1REVA 4CEQA 3SQ2A 3JSMA 2UUTA 3V9XA 3QO9A 2IM0A 5C24B 3VQEA 4F8RA 3NBPB 5HBMA 1WSGA 4PUOA 2R2RA 2AGPA 4BDYA 3I8DA 1RBSA 1NK6A 2IS3A 4F3OA 1UWBB 3KK1A 4CHZA 4DLEA 1S1XA 3OYDA 4ECUA 1S1UA 3QLHB 1JXBA 1IKVB 1S97A 2F96A 1ZYQA 1KVCA 4FJ7A 2XGQA 3TANA 4E89A 1GOAA 1Y97A 4OL8A 3DOKB 4CF1A 2G8IA 1IKXA 3ZCMA 5KFMA 5F9NA 4RNOA 1NNDA 3LAKA 2FJVA 1C0TA 5DG8A 4IRDA 3CFPA 4CHNA 3G10A 3K5OA 4IFYB 2OPPB 1BIZA 4RNMA 2R7YA 1RT3A 3QIPB 3V6DB 4CJ3A 3CQ8A 2FJXA 4FK0A 2JC0A 3GIMA 1DLOB 4IFVB 1RNHA 5HRPA 5KFDA 3BGRA 4ZPDA 4K4SA 3DRPA 4Y1DA 1RDRA 2VA3A 5J1EA 4GC7A 2W9CA 2YNIA 3KLEB 4ECWA 3RWUA 1MMLA 1QAIA 3OHBA 4F3TA 4AHSA 2O4IA 1RT5B 4URSA 4Z4HA 3LP1B 4K8ZA 3N6LA 3QGGA 4CF8A 3MEGB 1HYSB 3GYNA 4FM0A 1RBRA 1ASUA 1XR5A 4NLYA 4IRKA 3C6UB 1GX6A 4M3XA 1S9EB 3L3VA 2E6MA 4OJRA 3DOLA 5JS1A 3NBPA 2GC8A 3V9SA 5KT3A 1KLMB 4FJ9A 1UWBA 2QKBA 5C25B 3HPHA 3N6NA 4KHMA 4CEOA 3QLHA 1J53A 3NDKA 1IKVA 1NJYA 1Z25A 4AHTA 4CGDA 1NK4A 3FSIA 1W9HA 3TAGA 5L9XA 3V81A 3TAMB 3DOKA 2RKIB 3I5CA 4EEYA 3KD1E 4WZQA 4BE1A 1BISA 3O4QA 3T5JA 3LALA 4CIEA 3SFGA 1HRHA 3UQSA 4H4OB 2IDOA 4YFUA 1NJXA 3CM5A 1BIUA 3DI6B 4C8NA 4IFYA 3NAIA 5KFLA 1B9FA 2OPPA 4KPYA 4K50A 4CHPA 5C42B 3QIPA 3V6DA 4CJFA 3OHAA 4CEFA 5F8JA 2Z1JA 2GBZA 3SUQA 2OPRB 4CJ4A 1DLOA 4IFVA 1RBUA 3D28A 5C5JA 3OYBA 4FJIA 4AHRA 1L3SA 4FJJA 4Q45A 5JUMA 2XC9A 2IM1A 3KLEA 1D1UA 1A5VA 3H59A 1RT5A 1S10A 3KK2B 3TQ1A 4E0DA 3LP1A 2OPQA 3MEGA 1HYSA 4RG8A 1RAJA 1XHZA 4NLSA 3MXIA 3Q8QB 1NKCA 5CYQB 1D0EA 3C6UA 2FVQA 2ILZA 4QOZB 4KREA 1KVAA 1S9EA 4M95A 2DTUA 1S0OA 2UUWA 4DL7A 1ASVA 1RTIB 4JRPA 4HUEA 3VA0A 3RB0A 4YNQA 1RDAA 2IJNA 2EC0A 4URGA 4B08A 4BE2A 3JYTB 1KLMA 1WSEA 3M8RA 5C25A 4FLUA 1NJZA 4KTWA 3LDSA 3AVHA 4J2AA 4RUCA 2V4QA 3P5JA 2W7OA 2XGPA 3QEVA 1T7PA 5DG9A 4CGHA 5KFGA 3ISND 4MK9A 3TAMA 4QWBA 2YHAA 2KZMA 2RKIA 4CIGA 5KFXA 3M9OB 2AX0A 2OYQA 5L1LA 2OPSB 4OKKA 3WNFA 2PYLA 1TL3B 4H4OA 4QWCA 3RBDA 4FXDA 5F9LA 5CYMB 3ZT4A 4DU3A 3DI6A 4CJUA 3AVLA 3ZT1A 4XIUA 5C42A 4TY8B 3ZSXA 3DLBA 3NGYA 3QYYA 4NLDA 4CJEA 5FRMA 3UR0A 2OPRA 3CJ5A 3DRRB 2DFHA 4DFMA 1S6QB 1FXXA 3V6KA 3V1QA 4LQ9A 4DG1B 3OL7A 3FFIB 3ZSOA 2FLPA 3V6HA 3AVAA 5FDLB 5KFVA 4PA1A 3OYGA 1S6PB 4FJLA 4KAIA 5T7BA 3KK2A 3KLFB 4M3TA 1N6QB 3NKYA 4N41A 1S1WA 4RZRA 3M8QB 3GV8B 4DSKA 3NFAA 4IBNA 3AVNA 5CYQA 3AO3A 3AO5A 4WZMA 2O5DA 3OYHA 3LP0B 4CERA 4O3QA 1RTIA 4J9NA 4ECTA 2UVWA 4MK8A 3O3GA 4K4WA 3HL8A 1RYRA 3BSOA 3KD5E 1CSJA 2XCAA 4M42A 4DQSA 3JYTA 1VSKA 2KFNA 3HVRA 4DEZA 2QK9A 4DSFA 3SNNA 1UA0A 3VQ7A 5KFWA 4E7KA 3CO9A 3H08A 2ASJA 4Y34A 4YR2A 2JLEA 1HNIB 4KHUA 1JIHA 2X78A 2YKNB 1C0MA 3OYKA 2OPSA 2BRKA 4MK7A 3RAXA 4DTPA 3E51A 1TL3A 4MH8A 2XWYA 4CGGA 3CYMA 4CEBA 3H4BA 5CYMA 4ZHRB 2BR0A 1FKOA 4DTJA 4RW4B 1TVRB 3RB4A 4KI4A 4TY8A 1YT3A 4N76A 4KTZA 2R2SA 4Z0UA 3NF7A 3SUOA 4J9LA 4EZ9A 3QIOA 3DRRA 4FLVA 1RT4B 1S6QA 4J9SA 4OLBA 1QTMA 4DG1A 3FFIA 2Z1GA 2FLLA 1Z26A 4FJKA 5FDLA 1S6PA 4B9VA 2FBXA 4OPJA 5KFFA 2BQ3A 3KLFA 4RW7B 4Q8EA 3ZSVA 4IDKB 4CJWA 1N6QA 3KJVB 1KHVA 3WNHA 1J5OB 4IOBA 3IS9B 3M8QA 4DL6A 2O4GA 4ECYA 3ZSWA 2AU0A 1U47A 4CF9A 1HJRA 4NLOA 3CG7A 4FLXA 3LP0A 4HUFA 4K4XA 2Y1JA 2E4LA 1T94A 2X74A 1GOCA 3PHEA 5HLFB 2R8KA 4DU1A 4EBCA 4QCLA 5KGXA 1O1WA 1HPZB 3K57A 4CF0A 3KOAA 4G3IA 5J2NB 3OYMA 4F4ZA 1RCHA 1VRUB 2XI2A 3BR9A 3O4NA 3ALYA 1XR7A 5I3UB 1KHWA 4Q0BB 1HNIA 3S3NA 5EDWA 4FW1A 3THVA 2YKNA
chains in the Genus database with same CATH superfamily
1YUWA 1EX4A 4WCEQ 1TK0A 4AM7A 2EI5A 2OAUA 4A62A 5ETKA 1OYDA 3VERA 4ZOSA 1RHKB 2HF4A 1JJ2M 4ZHRA 1RBLA 2P5VA 2HQCA 1TUWA 5KFYA 1AZSB 3QEIA 4AQYF 2GA7A 4ZLLA 4PPDA 2E9ZA 1RKJA 1XTZA 3SFUA 3ZTSA 4RX6A 3WQTA 2DH8A 3R5AA 5AQHA 2MKIA 3JSBA 4OPAA 4ZP9A 5EWGA 3IAYA 3VQSA 2DEJA 1HKCA 4EP5A 4NA3A 4X62J 4RW7A 1B0TA 4FZXC 4DZ6A 2AWZA 4YDUC 3OL6A 3M2UB 2BJDA 4FVUA 4MLHA 2NXCA 2R3VA 4I64A 4A4JA 2CVEA 1JLAB 2HB5A 4OPKA 4Y1CA 1RWXB 2GIFA 4J5OA 4K59A 3T19A 1VIXA 1D9DA 3JB9k 3BQ1A 2XLKA 5HLFA 4KGKA 5T14A 2QRRA 5FD1A 3BPSP 3VGLA 5JVGL 1GAOA 3DFEA 3RBEA 5J2NA 3PEHA 3NVKA 4PQAA 1VRUA 4WYBA 4YHHK 1HNVB 1X9SA 3O6QA 1NH7A 4Y2MA 1PG5B 1Q16B 3M9MB 5L1IA 3K58A 4MIWA 3GMGA 5AJ3K 3RU0A 5KT4A 1M1GA 3GILA 2JWNA 3U02A 1G2EA 1XNQJ 2Q3SA 3HHLB 3CD5A 3SXLA 1KEKA 3RGIA 2J7UA 5F0XA 3KIOA 4FPAA 3N28A 5L1JA 5K8OA 5IS2A 2EFOA 2ZJRL 2EKYA 4PR6A 1AZSA 3RAQA 1PGZA 2C28A 1TU0B 5EGYA 3IN5A 5D0HA 3CMAS 3P4UB 1QE1B 1S5ZA 3VF4A 1DZ5A 4ZPWR 1RWMB 2CWKA 4E7HA 2QMWA 4WE1A 1G6BA 3LH2S 4YB5A 4CTAB 3HPOA 1FO1A 5A2QU 1NDCA 4H03B 2LQ5A 4P2SA 2KW4A 4PG6A 3F44A 4DI6A 5BREA 4H0VB 1HKGA 1K1SA 1S99A 3OTOK 1SKWA 3LPUA 3HJVA 3V6JA 3M2UA 4JI1J 2MZJA 3K9JA 2IVYA 1WHWA 1APSA 1JLAA 4M5NA 2CQ0A 4NXNK 3BV8A 5ETSA 2X6SA 4ECRA 4JV1A 4R8UB 4ITSA 4RNHA 2YX4A 4B1WB 1R0AB 4MKBA 5E41A 2ZE2B 1WKJA 1BI4B 3LDOA 2KYXA 4TN2A 4ILGB 2V5HG 5C24A 4FKXA 3K5NA 4DR7J 2BH1A 3QPIA 5B0BA 5E3RA 4FF4A 1YVNA 1FFGB 1UP1A 5C10A 1HNVA 5KFIA 4E19A 2J0QD 1NNEA 3KJFB 4OKEA 4CO0A 5I9EB 2PC6A 4W5QA 3UKRB 1ZH5A 2N4DA 3CMAN 3TR5A 5D3GB 3RVCA 5KQ8A 2VASA 4FXWA 2ZZTA 5HN0A 4LFBK 3KG1A 3MX2A 2ZH3A 1VJWA 2EK6A 1ESVA 4FJMA 2J0SD 1NM1A 4ZN3A 4F26A 1RI7A 3MAQA 2X1AA 1QE1A 3D54A 3Q86A 2BA9A 4FW2A 5MLCQ 1AFIA 4P72A 2VBWA 1Z05A 2MKYA 2Z1HA 4CTAA 1KKHA 1SI9A 2DD8S 2M52A 4NI2B 3F9KA 1VHFA 5IXUA 3OBIA 2X1BA 1MN9A 1XMOJ 4C1NI 5I3QA 1LW0B 5B09A 3QAEA 3PX6A 2XMTA 3VAFA 3MMBB 2XZWA 3EO3A 3FC9A 4C8OA 1IM6A 2XS2A 3ILJA 3BDEA 1S0NA 1XERA 3CJ0A 2QWRA 1I1GA 1SBRA 3IBFB 2QC3A 1Z6RA 2HSTA 4WQ5A 4R8UA 4CFBA 1R0AA 1FKPB 2ZE2A 4YB6A 3NGDA 1PAUB 1O6XA 2IBOA 1BI4A 3GFZA 3TNVA 1HQEB 3M8YA 3OS1A 1Y5NB 1AW0A 3R5DA 4IH7A 4JP8A 2OUGA 1HYZA 3VALA 1SL2A 4CJPA 3ZC4A 4IDHA 4X62K 4PQUB 2GMLA 3E1YA 4EAHD 5DK5A 4WU2A 3ZFVA 3UKRA 5D15A 4LF5J 2GFFA 5D3GA 3V1RA 3EPGA 1E6VB 1M5SA 1WSVA 2JGUA 4BC9A 2UXCF 4K5RA 1Q82O 1FXLA 3CPWM 2WW8A 1VSFA 3OUYB 1N32K 3UKUB 1KQSM 4A8YA 2R8GA 1TELA 3DHXA 1NRKA 1WWHA 3Q8RB 1WG4A 4JKDA 1ZC6A 1T9YA 1FWPA 2WZ1A 4CZKA 4NI2A 2CGLA 2LEBA 3PYDA 1BL3A 3DXMB 3N6MA 1QDUB 4R0JA 2ZZNA 4I1TA 4ETXA 1XNRF 1LW0A 1XNQK 3E01B 3C65A 4CECA 3MMBA 1U7LA 5D4NA 4KGZB 3KLGB 5BPNA 4PHTX 2A0FB 3U9ZA 2CNOB 3EGNA 2JFKA 4E7IA 1IJJA 5HQLA 3VETA 1N48A 2IOCA 3IFEA 3VF2A 1XBWA 2D9PA 4CLKA 4Z4FA 1FKPA 2POKA 2LXFA 3LOUA 1HQEA 3MMAB 1RYSA 2DNYA 3T1HJ 2HMPA 1OYEA 2K06A 4WIQA 4QU6A 2DH7A 5HATA 4KPCA 5J2MB 1VQSA 2YKMB 1DBDA 2AZ3A 4CYUB 2HZCA 4LUBA 3VAHA 4FF2A 4PQUA 2HS4A 1EJ7L 2PI4A 3C16B 2YHWA 2ZH6A 2GS8A 3O8MA 1QD1A 2FF3B 4FOEA 3UIQA 4HKQA 1E6VA 2W6KA 1PJ5A 1AUDA 2LSNA 4CI0B 2W24A 1URRA 2W25A 4A5BA 4KH1B 1ZA2B 5KFJA 4W90B 3OYJA 1HR0J 3UKUA 1Q4RA 1KCFA 1FEHA 4K4YA 4RBUA 1NGJA 1KC8T 4JI6K 3AB4B 3FUYA 5IC6B 4DR7K 2HHHF 3OTBA 4OHVA 5AQJA 1KVKA 4BR0A 2V7ZA 4QS9A 1QVGM 2OSRA 1NWKA 3PW7A 3GV5B 3OL9A 2RPIA 4C9DA 3FBBA 4GV9A 3E01A 4Q2MA 3KLGA 4B9LA 2P9CA 3DLHA 1O13A 3VQBA 3O1LA 1ZM2A 2XG8A 1HQUB 1NKBA 3BKTA 3I55S 4MYTA 5A6WA 3BS9A 5HAOA 4H5TA 2Z2ZA 2WB1D 4LF7F 3AVCA 3CUNA 3FBFA 2QA4G 3KHYA 3B8AX 1WOPA 3BEXA 3SPYA 2D7SA 3MMAA 5E3QA 2P9IB 2VBYA 5J2MA 4QAGA 3ULDA 2YKMA 4IO9Q 4CYUA 1XMOK 5DJBA 4F4WA 4AHVA 3C16A 3J7YP 2I6WA 3CF5L 3HZGA 3ETMA 2ROPA 2GAGC 3CETA 3H6EA 4PPZA 1VSDA 1MN7A 1VQ6S 1Q79A 1U1RA 1ILYA 4I6WA 2DO4A 1X9WA 1RTHB 3W8GA 2H4WB 3M6GA 3SAHA 1BO5O 2CPJA 4QR0A 3VEOA 1NSKL 4J9KA 5AQNA 1XIQA 1U4BA 3GFXA 4F4YA 2WK4A 4WYLA 4NYZA 2FHOB 4CBWA 3IGNA 3FMBA 4DKWA 3I55N 1DFDA 4LBIA 2IC3B 4DTRA 1Z1ZA 4LF5K 1WSJA 4Y2KA 3K5LA 3MDFA 4FL9A 4NRTA 1N36F 4FJNA 3R6MA 2K3IA 4DPTA 3P6YC 4DOZA 5SUHA 4FLTA 2HRYA 2QIFA 2KXNB 1U24A 1HQUA 3HM9A 3MOJB 5JVHQ 3RR7A 1MMDA 1P8GA 2GWKA 1CJKB 3HZEA 4FJ5A 1GLFO 1BGXT 2ASPA 2CFXA 3J81U 2R2UA 3BF3A 2ZJQQ 1RWPB 5E26A 1RA6A 4EZ6A 4LR8A 4NZ6A 4JI0J 2P9IA 4NLTA 2RDIA 4Q7AA 4OYWA 3LP3A 4YOTA 4YQWA 1VQ6N 1IQZA 4CWBA 1X60A 4URQU 4B1VA 4IOCQ 2CPIA 1JCFA 2VGMA 1RGIA 3B8HA 1ZPWX 3AVFA 3KMSA 4NLBA 5I3UA 2FBYA 4N77A 4CRJA 4FVMA 1U1LA 3PDNA 1RTHA 2CPXA 2XHWA 3HRGA 3T1HK 2QX0A 1HARA 4Z4IA 5EWEA 2BRLA 5KG3A 2P1JA 2O01C 3AO4A 3ZT2A 1BQMB 2AX1A 2Q36A 1FRXA 3AODA 3CD0A 2N3LA 2IC3A 5KTQA 3UVJB 1S72S 2LKZA 1WSHA 3DU6A 3N5FA 4OZ0A 2AP6A 1N88A 3V81B 2BE2B 1T9WA 1KVBA 4FJHA 1SKRA 2KHCA 4W92B 3GTYX 2IRUA 3SK3A 4BQZA 2YX6A 1HR0K 1QSYA 1NK9A 1CJKA 2DGVA 4A46A 3QIDA 2QWMA 1H2TZ 2A42A 5CA5A 2YWKA 3LGMA 4DR1F 4EU0A 4Z4CA 1H74A 4CK3A 1Q9YA 5KFRA 4DV0F 4R5PB 2CQ4A 2CJKA 3HF5A 4O0JA 2SXLA 3I33A 4G1PA 5KFSA 4DPOA 4JK9A 4O4RA 5LMUJ 5ETNA 5A2QY 4KH5A 1U09A 1RHRB 3Q89A 4JI8J 4UTGA 5AQZA 2DNZA 1ZTTA 4W5OA 2X1FA 3HPGA 1WSIA 2FSJA 4BQLA 3WUHA 1SVDA 4DPWA 4CP5A 3D0PA 1S72N 3MWPA 1W97L 1FVQA 2FDNA 1IBKJ 3M7VA 4RW8B 1YBAA 4MLEA 1EKRA 1RDDA 1VOMA 4ZCIA 1BQMA 3WNGA 2JWKA 2BX6A 4GV3A 1LK7A 3LWLA 3UVJA 1GX5A 1BY9A 3KKRA 1S9FA 2EFQA 1CPZA 2BE2A 3BF4A 2F9JA 1HKBA 3EM1A 4FNHA 5H1SV 1EKSA 3CJKA 2ZHAA 2HYIB 4KGMA 2ETJA 3JS6A 2HHQA 4GC6A 2D0BA 5LJ3Y 2ZM6F 1X5PA 3QNOA 3I4HX 3BJYA 3DDKA 1Q78A 4NA2A 3ZXWA 2J7WA 4RU9A 5KT7A 2CJQA 3VEZA 4DWIA 2QWPA 3O9TA 1RWUA 2C2DA 1Q7YT 4ZS6A 4ED5A 1UL3A 1P90A 1ZPVA 4R5PA 1VK8A 2K1RB 3BGFA 3PJXA 4NOHA 4DQ8A 5EUHA 2YWWA 3C6AA 2CH6A 4PXEA 3LPTA 3PLAA 4ANDA 3MM7A 2HURA 3SI8A 2IHR1 5KG6A 3CJ1A 1WI8A 1FESA 4DU7A 3CW2C 1TZ0A 2DXEA 2U2FA 3AA2A 2V2VA 4USUA 1OY6A 2FHMA 3J7ZT 4B8CA 4KHRA 4XPEA 4DSJA 3BN4A 3J7Z5 2XS7A 3VAGA 2HHTA 3VV2B 5KI6A 4JI0K 4PWDB 2M8DB 4WFZA 2H5IB 4IH5A 3B6PA 3OSNA 2CH5A 3DXSX 1PBAA 3KJNB 4B3SJ 4RW8A 2IJRA 1FJEB 1HBOB 2KQ2A 2ZWPA 5FJ4A 2EW9A 1X4EA 4E1MA 3ZT0A 3A13A 2Q0RA 1TK5A 3I8BA 2CDRB 2KM8B 2U1AA 1ZM9A 4CK1A 2GJFA 2XB2D 2APOA 4HI2A 2KB2A 5A8KB 1KQGB 1YTUA 4LFAJ 3NAEA 2BM1A 5AT1B 3OXLA 3J80U 5DRKA 2Z2LA 2NRTA 1X5OA 5F8IA 1F6TA 3L7OA 3LL3A 1U2CA 3HHEA 3SUPA 2CQ2A 1FKOB 3VQ8A 5FRNA 2PAVA 3KUEA 1NUEA 4RW6B 4EHTA 3H5SA 3FCVA 2PYJA 4GVMA 1X9MA 2QLFB 2K1RA 1UA1A 2GZOA 2J9CA 1VQMS 2BKOA 3R3TA 4X65F 2RDJA 4DQPA 1JXLA 3BZQA 4E7JA 5AQYA 4LC9B 4WPAA 1BDGA 5M2PA 1U8SA 1WAJA 2AA4A 4U9RA 2WVCA 2IRYA 1IVZA 4BGAA 1QZ5A 4JV5J 1LAVA 1Z2LA 5JMNA 5KG5A 5LL6Z 1VQ5N 1WTBA 2FTRA 3PX4A 3QSYB 3CEDA 4FBTA 1CLFA 4ECVA 4A61A 4PWDA 4W5NA 1NGBA 1N5VA 3KDNA 1IWAA 3GONA 3MR6A 4KB0A 4NYFA 4UOGA 2YNFB 1HBOA 2CQHA 1J54A 4J2BA 3WEEA 1RTDB 2PMHA 2M70A 8RUCA 1OY9A 1U2FA 4FJXA 3DLLL 1T05B 3L8BA 3GIRA 4M3WA 2BJEA 4O3NA 1KP6A 2IM2A 1XMQJ 2D74B 4KQZA 5LMUK 4O5BA 4DU4A 2RF2B 1ITGA 2PE8A 5CAAA 3QESA 3OLAA 2AV5A 4CCHA 1JLBB 5B0GA 1NSPA 4FYXB 3C14B 1SL1A 5ADXA 2QO3A 4KBIA 3I0RB 2RD5C 2VBXA 4A2AA 3VN5A 2OEKA 3C15A 3QT6A 4JI2J 1YRXA 3BPDA 4L72B 1VQMN 4AM6A 4U8VA 4CGFA 5EX0A 3L3CA 2IGIA 4RW6A 4YMEA 4CO3A 3R97A 3TAPA 4F02A 1EKEA 1V3RA 3MI7X 1Q7LB 1M1KT 4DF4A 4CJVA 2MKJA 4FWLA 2B56A 2AF6A 1ATSA 1UPPA 5KG0A 4LREA 2R7TA 1IBMJ 5KT5A 2AJ1A 1FX4A 4ED7A 1YK9A 1HNZJ 2HRTA 5D78A 1VHXA 1IG8A 3LANA 3OJSA 5AQXA 3QNWB 4A8OA 3HVAA 3SIPB 2B43A 2V6AA 2YH0A 1PIEA 1R8AA 4WP9A 2FJDB 1UVMA 2LYVA 4YR3A 2QEXS 2YNFA 3CGIA 2OZMA 2K7KA 4BRAA 1RTDA 2PA8D 4AQYJ 2N7YA 1T05A 2CNKB 4FWQA 4F4KA 2VQFJ 1FRLA 3NH0A 3SDEB 2BJ9A 5DS7A 2RF2A 3KHRA 3TUJC 4RL1A 2L3MA 2QL5B 3KK1B 1K8AT 5J1PA 4L3QA 2HS0A 1JLBA 2P9KA 1O8BA 3C14A 1Y00A 2UUCF 2WVDA 3I0RA 1OKJA 4QIFA 2Y1LB 1RT6A 1KRPA 4HLBA 1FERA 1ROFA 1RQ0A 4LBPA 2D1KA 1N56A 1Q7YO 4B3SK 2WVEA 2D0PA 5AQSA 2VBZA 2RU3A 2VC0A 2IM3A 2PIIA 2MQMA 4HYKA 3A3NB 1FJGF 4U7UK 1NK5A 2DEIA 3A4TA 4ID1A 7AT1B 2DY4A 2UXBJ 2G1DA 3B6OA 4WQ5C 1YLXA 4LFAK 4ETZA 2R8IA 1IQTA 1EQYA 4NYNA 4NLRA 3L2WA 3BGRB 4ZVFA 2QEXN 4WXWA 3D1QA 4ELVA 5J1EB 1X4GA 2W9CB 2QSWA 1U1MA 3RSEB 4KHYA 2H54B 2YPYA 5GAEP 2QSFA 1WC6A 4ED8A 2KL8A 1C4AA 2IFXA 1PCAA 3T9ZA 1RA7A 2ZDPA 2JEFA 3NOCA 3J81Y 4XH4A 2E5IA 3SDEA 4IO8A 2FC8A 2CQGA 4G1IA 1QTNB 1UZDA 2HS3A 5JVGQ 1NK6A 4DPYA 3I8DA 5DETA 5AFUA 4F3OA 3KK1A 4DLEA 4CHZA 1WG1A 4DR6F 4ECUA 4JV5K 3I56S 4JK7A 5IZHA 5HO4A 1SJ4P 3OBWA 2F96A 2XGQA 1GOAA 2M9KA 1RWWB 4CW7B 4KHPF 2QI2A 1LXNA 4DUTA 2J76E 2A5XA 4O5FA 4IRDA 3G10A 2ZJRQ 2XMMA 4BLGA 4DJBA 1R7IA 2NPFA 1RBAA 1Y4ZB 1BIZA 2F4VK 3LDQA 3GG1A 2PN6A 4YB1P 4FK0A 2IVNA 2CZVC 5HRPA 5KFDA 3BGRA 1ZAXA 5H1SQ 1B99A 1RDRA 2C3PA 2FJAB 4CNZA 2V2QA 4HDGA 4JI2K 5J1EA 4WKYA 2W9CA 3RSEA 2KHDA 3OHBA 4AHSA 2GJIA 8ATCB 5ETLA 2V8DA 3QGGA 3MEGB 1RBRA 1ASUA 2HSEB 1V4SA 3I56N 4JAXA 3MD3A 4M3XA 1S9EB 2BW7A 3L3VA 1TFYA 2O3DA 3J7AN 2GC8A 1IBMK 4TU9A 4DR5F 1HNZK 1IJFB 4ES3A 3HPHA 1S12A 4CEOA 2N4CA 3EGWB 3N0VA 1NJIT 1Z25A 4AHTA 3F5TA 3D6RA 3W5YA 4DCPB 2RKIB 1RBOB 4EEYA 2DISA 4YB7A 4BE1A 4CIEA 5LJ5Y 3CCTA 4NMXA 1HRHA 3UQSA 4AQYK 5ETRA 1F9FA 2KI2A 2CXEA 4CLYA 2OMOA 1BIUA 1M1KO 2ZUAA 2BV3A 1JNRB 4C8NA 3D2WA 5KFLA 4KPYA 2HBMA 4P7VA 3OHAA 2Z1JA 3I87A 4L3NA 2JL9A 3L9ZA 1RBUA 1WKKA 3EN9A 2ITMA 3GSIA 1L3SA 3MEKA 1SJ3P 1A9NB 1D1UA 1MG7A 4BRIA 3AD9C 1S10A 2MHNA 1NAQA 3MEGA 3MWTA 3RJMB 3ENAA 1HWJA 5LL6d 3MXIA 3K89A 1D0EA 2FVQA 4F36A 2R7XA 3DKDA 2UXBK 1S9EA 2DTUA 4LT6A 4LF6F 2ZHOA 3VF0B 4HUEA 2MPUA 4YNQA 2EC0A 4B08A 4EFHA 2IRXA 4P6QA 2YWGA 2GNKA 2V68A 3M8RA 1IBLF 3BO3A 2V4QA 1XNRJ 3P5JA 2YHYA 3M05A 3MCNA 5LY3A 2RKIA 4K5SA 5KFXA 3GL1A 2HQIA 5D6GA 3TU5A 3FGUA 2OPSB 4OKKA 1VHIA 3B78A 1TL3B 2M8HA 1UEUA 4ZVPB 3IA0A 5L46A 3I32A 3ZT1A 5HQ8A 3WXMB 5AXKA 1HHTP 2YWHA 4TY8B 3UE2A 1D9AA 3B4DA 3A3PB 1KWMA 5FRMA 2DHSA 5HI7A 2QN6B 2DFHA 4I69A 3MM6B 1AXQA 4JBCA 3R2CJ 4X4OA 2B8PA 3D0GE 4QYZJ 1M5PC 3ZSOA 1TUVA 3V6HA 1YJVA 3OYGA 2NR0A 3BKUA 4X4QA 4M3TA 1N6QB 5FPDA 1S1WA 4DSKA 3NFAA 3AVNA 1S57A 4OI1A 2O5DA 3OYHA 3A1YG 3EVWA 4O3QA 3HHNB 2UVWA 2HHHJ 4MK8A 3N4QA 3O3GA 4C2MA 3HL8A 3BSOA 1S79A 1CSJA 3GFYA 3SQGB 1ICEB 1X5TA 3QFPA 2KFNA 2QZ8A 3HVRA 3QBCA 1OJ4A 2QK9A 3T6JA 3R8EA 3SNNA 3E2EA 5LOQA 3CPEA 1KBRA 5KFWA 4CT9A 2MQQA 2G0IA 2ASJA 4R25A 2XHCA 4YR2A 3NLCA 2JLEA 3ATVA 4YOEA 4KHUA 5GADI 1SJRA 1C0MA 3QGPA 4HEA9 3POTB 2OPSA 1UZHA 2BRKA 3E51A 5LMNF 1TL3A 3TP2A 4CGGA 4CEBA 4DUYJ 2DR5A 4LF7J 3LDPA 4OYPA 1RHJB 1S4EA 4Z2XA 2AIRB 5C15A 4TY8A 3BO2A 4JNEA 4Z0UA 4MT1A 4EZ9A 3QIOA 3MDQA 5E84A 4OLBA 1HKAA 3MM6A 3MCAB 2EXUA 5BYQA 2QYGA 1DKGD 2LA4A 4BRGA 1ACMB 4BY9C 3K5PA 3TJ9A 4B9VA 1NGIA 3ZSVA 1LKZA 1N6QA 5L9NA 1RACB 2DHAA 4XAKA 2J7KA 2EFGA 3IUCA 1VLOA 3ZSWA 3FRYA 2VQEF 4NLOA 3CG7A 3SSSA 3TEHB 4K4XA 2KT5A 1T94A 1ZS6A 3R5JB 1WC3A 3SQGA 1B0VA 2LMIA 4AFFA 1O1WA 4CF0A 2UYTA 4G3IA 4GKKF 3SMZA 1RCHA 1CEZA 1RAFB 5C2DA 3EX7B 3O4NA 2UXCK 1N36J 2HZVA 3UI3A 4Q0BB 2BOAA 4BC2A 1Q18A 1X0PA 3K0SA 4S0MA 1PO6A 3POTA 5M2UA 5HSPA 1WOQA 5E5NA 4K8XA 2GELA 4DV1F 1Q53A 3RB3A 1CVJA 2HBQB 1KFSA 1Y10A 1NBWA 3QAUA 4J2DA 4YOUA 3DCAA 4ANCA 4M5IA 4QR1A 1YVFA 4CLFA 2W2PP 1TR0A 4LJMA 4KH6A 3H2LA 1XNRK 1X8DA 1SB6A 2VOOA 3PCOB 4EBDA 3TAFA 3RW6A 5D0GA 2VFUA 1VSHA 2XTJP 3TVZA 1M90T 1D3WA 4GO5X 2PSZA 1QY7A 5KFPA 3MFIA 1E4GT 2CJYB 2FC0A 3ZSZA 5EU7A 3HHDA 2RHSB 3PV8A 3D6TB 1F5CA 3KLHB 2E1AA 2F8MA 2XULA 3M2RB 4QS7A 1UCNA 3JQKA 3U9DA 1GFWB 4WTYA 3ZO7A 2AJ0A 3OYCA 3W3SA 2O8EB 1U25A 3U4LA 3MUTP 3FZFA 1BHLA 4NCGB 2WVFA 4QYZK 5KG7A 2O1PA 4ISFA 2VG7B 2KU7A 1FD8A 1N33J 5KAKA 2DGSA 4Q0BA 2DNMA 2ROGA 4Y0WA 2NREA 4WK1A 4ATNA 2HAIA 3TZXA 3Q8PB 1GOBA 4CLPA 3GSDA 3AVJA 3LUYA 4B3MF 2HHHK 3PYEA 2FBTA 1WD6A 4KGXB 2JEIA 3EL2A 3UN2A 5B0CA 3R27A 5LM7E 1ZZNA 1TKZB 3AD7C 5GADU 3BQ0A 1CZBA 2F4FA 4FS2A 4FLZA 3G8SA 2ZVSA 3RUBL 4DV0J 1LWCB 1HHSA 1SXLA 4KH0B 2RS2A 1VAZA 5ADZA 1GLBG 4AE5A 3WBZA 3C19A 4B9NA 2OI2A 1PILA 1UJ5A 5CE3A 3GIIA 4LF7K 3R5GA 3AARA 2OTJS 3K5MA 4QOTA 3T5KA 3KLHA 1SC6A 2VU5A 3M2RA 2HK3A 4FN5A 5M1KA 2F63A 5D0EA 2ZDOA 3K8WA 4IR1A 4F0MA 3MHYA 3GYGA 3VGKA 3HFZB 4NLVA 4JI4F 2O8EA 5DQIA 5LJWA 2LLZA 3AA5X 1R0BG 4ZPBA 1MU2B 3QZ8A 1RAOA 4NCGA 3SYZA 3S7RA 2EHGA 2RRBA 1Q0NA 5D4OA 3I5AA 2VG7A 2ZF5O 3VQ9A 2ZQBA 3CJTA 3MPDA 4DX7A 4WJBA 5GIOA 1V9OA 1T9VA 2OO4A 2W4PA 3CJ7A 3G4SS 2HHUA 3MFHA 4A8WA 4K4VA 4QBUA 4JI1F 3P31A 1A5WA 4OGCA 5KFQA 3QRRA 2NUBA 3OYNA 3Q0AA 1VQ4S 5KPRA 4UQGA 4IRCA 1MMNA 4GVBB 3AA3A 2VDHA 1TKZA 2XO6A 1U1KA 4DR7F 4DB3A 1E6YB 2P5OA 1LWCA 2OTJN 1RAAB 1QLNA 1N36K 3KMQA 2LA6A 3R9PA 1RT1B 4P7TA 4CH1A 5EXWA 1DRZA 1YSJA 1CS4B 1YTYA 2I7NA 2Q1LA 5CD4H 1SH2A 1WEXA 3QEPA 1S5JA 2R7RA 1F21A 1FW6A 1AA1B 2MQLA 4YDDB 1CULB 1JXVA 3NMAA 3AOAA 1R8CA 3PO5A 5E3AA 3GIJA 1MU2A 1DQ8A 3G4SN 2V0NA 1UMJA 4TQRA 4W5TA 3BH7B 1GXUA 2A3ZA 2OD4A 1JX4A 1GMUA 1M0SA 3WX4A 3CWJA 3GQCA 4NLWA 2X51A 1YX2A 4ENOA 2AGQA 2BMBA 3EY1A 1VQ4N 2XEXA 3QT8A 1JCGA 2QGFB 2W9AA 4I0WA 4V19X 2PBDA 2RU9A 2V8PA 4BC3A 2JEGA 1MWZA 3G96A 3HSGA 4PXBA 3FK4A 2QTDA 1HNXF 1RKIA 4YY3F 3BM7A 4GVBA 2IA6A 2HHXA 1B7FA 2J8AA 4FPRA 1E6YA 2ZZMA 2YX7A 2LCWA 2HBZB 3M1FA 4KO0B 3L2QA 5KFOA 3ITHB 3C2PA 1RT1A 3DYAB 1HW8A 3J80O 5KFUA 4LF5F 3H5XA 1CS4A 1F3VA 2FY8A 3VAIA 2W1BA 3H45C 2MJNA 2PO4A 4JK8A 2JVRA 4M41A 1N54B 2VG6B 3TJ8A 2UU9J 4DTUA 4B8AB 4ANEA 5HROB 4WK3A 2E5GA 2QFIA 2KG1A 1T44A 3BSAA 1CULA 3HFKA 2VG5B 1W2IA 4FLYA 4DR3F 3P83D 4DV0K 3HD1A 2GCFA 3QBWA 5DZ7A 2HQDA 2KRRA 3MUMP 1SJFA 2BGGA 3VGVA 4QW8A 1FFSB 2A1BA 1F5AA 2EFNA 4W98A 3HVWA 1SUQB 2EG1A 5B08A 1TL5A 5A0YB 4XTTA 3VQCA 2W2MP 1F1BB 3IAS9 4MYUA 1PAEX 5FLXY 4C3MA 4ZTJA 2LEPA 3EMTA 2DNKA 2HPUA 1DGKN 3TI0A 4ID8A 4UY8T 5FPNA 4GNIA 3G6YA 5H9EK 4KO0A 1WC5A 2HZAA 2UUAF 4UY85 1RUSA 3ITHA 2C2NA 4ES2A 2W8KA 3MTKA 4ZP8A 2W7PA 3VAKA 2MZTA 5IQQA 3DLLQ 2OFGX 3DYAA 2FHKA 3Q2TC 2VFVA 3KNAA 1VQNS 2DITA 3TABA 3W65A 2ZM6K 4BE0A 1MWKA 4MIAA 1VSLA 4ZK7M 2VG6A 4ED3A 3UDEA 2YNHB 5HROA 2Q3PA 2VG5A 4P75A 4A8QA 3K9KA 4EFAC 4NEYA 2EX3A 3UNYA 2I2YA 1YHQN 2CZ9A 2G4BA 1JLFB 1TMMA 1SUQA 4B9MA 2EK1A 5A0YA 4RUBA 4BCAA 1G15A 2LQ9A 4RTFD 2QG9B 3W60A 3QERA 3NNCA 1G1XA 3NF9A 3ENWA 3QJLA 4M3ZA 4Y2IA 2DNHA 4FO0A 1KOOA 2XNRA 2Z4PA 2FJBB 3WC2A 3CC2S 2HHWA 4KRWA 2H9ZA 3H90A 3T1YF 3OR2B 1VQNN 3NMRA 1TL1B 1ASWA 5EX5A 1JWWA 2FBVA 2IMOA 3VOVA 3CCUS 5SWMA 2VIHA 1ITPA 1JLQB 5AQUA 1HI0P 4OYMA 1MA9B 3TUZC 1J5EJ 1WI6A 2BJ1A 4OYAA 1K9MT 1GEHA 1UWAA 2K7JA 1HWLA 4Y3CA 3TJAA 3Q83A 3HYFA 3O44A 4NA1A 1F9HA 3CJCA 4BR9A 2NLXA 4OX6A 2A41A 1RHQB 2YNHA 1Y9OA 4CE9A 2H1YA 4ZVEA 2HBJA 4FS1A 4NLUA 2PMZD 2V7YA 5FPMA 2HK2A 3TR8A 1OWXA 3X1LB 4IFEA 2VPZB 4RNFA 1X4BA 1BD6A 3P5TL 5L1KA 4X65K 4LQ3A 3FVYA 1RLCL 3WXJA 4DV6F 2ZWHA 2DPJA 2A6AA 4FF1A 3CXCR 1U04A 1T8EA 2XY5A 5GAHP 4DR2J 1HWUA 1JLFA 1SIZA 3SPZA 2YNGB 4DR6J 3CC2N 2DHXA 1WELA 3ZZZA 1DJ0A 4B17A 2EVZA 2HIQA 4CK2A 1QQOA 2UU9K 3PIOL 2LU1A 2B9EA 4X4PA 3CCUN 5B8HA 4NE9C 4AF1A 3OD2A 3QATA 3J7YI 3RMCA 4KFBB 3C8YA 4CFCA 1RU1A 2GIQA 2HVIA 3OR2A 1TL1A 2CPYA 1KD1O 3DOLB 3QEWA 4JYAJ 1SAZA 4FLWA 4X2BA 4K4ZA 2OEMA 4LF9J 2LXIA 2MQPA 1FCAA 3A2FA 1JLQA 4KB7A 2MY7A 1RGVA 3PFOA 1S49A 1GMVA 4HTLA 2ABYA 2UXDJ 4H5RA 4O8KA 3VGUA 4DL3A 1ATRA 2H51B 3NE6A 4N8NA 2HNZB 1NK8A 2HQ3A 3C6TB 4TYBA 2E88A 3KWMA 3NF6A 3K2YA 3G0ZA 2ZNYA 3Q2SC 4DTSA 2V9WA 1NOZA 2F65A 2L9NA 1HMVB 4NCAA 2E9TA 2HVDA 1VQ9S 3HP9A 1W7WA 3ZSYA 4CD1A 2HFSA 2RNEA 2J4RA 4O3PA 3C6HA 2R7OA 2PFDA 8AT1B 3P4IA 1W2BR 4BDPA 4TQSA 1EXQA 3HJFA 2P8IA 2AEJA 1I39A 4ZJOA 3ENQA 4IOXA 1LWXA 2OGUA 4O0NA 2OEJA 1JCEA 3BP8A 4M5MA 2YNGA 2XSFA 3O9SA 3ZSQA 1WORA 1J6ZA 2MSTA 4ZPVR 3FBEA 1YRUA 1B92A 3D5MA 3DHWC 4NASA 2OPQB 1H72C 1KTQA 1MSWD 5ETOA 1VQPS 1QVFR 5LJVA 3HFVA 2B9YA 4KFBA 2XY6A 2DFEA 2RVJA 5IT0A 3MN6A 1SKSA 2XS5A 1SCJB 4ED6A 3O2IA 1NG9A 4IYQA 4CD3A 2HNZA 3GCWP 1IH7A 3C6TA 3NVMA 4CDIA 3CCLS 5BR9A 3VQTA 4ED0A 4DS5A 4JI8F 1OVYA 2F8TA 3M8WA 4IKAA 1SH0A 3BBCA 4AL5A 3AOBA 4ZJQA 2ALYB 4HVZA 1HMVA 4USHA 2EFPA 3L4IA 4ZPAA 1URNA 1TP7A 4AH9A 5HMWA 3AV9A 2JX2A 1FJGK 2G2YA 3VQ6A 1IBKF 3JS9A 1OMSA 1QQNA 4AHUA 1KOHA 2LDYA 1J5EK 1B9DA 4FJ8A 4BG9A 1CJVA 3S9HA 3ZZUA 2J6SA 4JI7F 1HWKA 1BWFO 2QWQA 2WVBA 1U48A 3THYB 3GCXP 3A8JA 5F8NA 2DHHA 2MZQA 2DJWA 3HXMA 2KHOA 2GW8A 4KV8B 4MFBB 3SQOP 5F8MA 2D0AA 4YOXA 2B4VA 3CCLN 1X7VA 3W62A 1BA0A 2QV6A 1YWXA 1Q8LA 3HI0A 3RRHA 3HCXA 3DMJB 4DFKA 4CJTA 4DR6K 3J7YU 4AL7A 1YF5L 3BREA 5KT6A 4YOYA 1NM2A 4M3RA 5CZXA 2IIHA 3ZX0A 1X4FA 3ZEUB 3EYZA 2XY8A 4DL2A 3O9RA 3H1QA 4XO0A 5ETMA 3L0QA 4KHPK 1XR6A 1ZBUA 4B1ZA 3L2VA 3AOCA 2J6UA 3VMFB 1QUPA 4RBVA 3FCHA 3T41A 1FNXH 4N5SA 4RNNA 2LQBA 3F56A 4U8YA 1WBBA 1T3NA 4JYAK 1BWEA 4LF9K 4RKUC 4BHQA 3VEXA 4OI0A 2UXDK 1N34J 1CXUA 3R6LB 3LZIA 4IKFA 3IRWP 1FT8A 1JL1A 4IUFA 3OA9A 5BN9A 3U3GA 1I94F 3DRXA 1OH7A 4BC5A 4DHYA 4BWJA 3BDPA 3GBTA 2XHBA 4F4AA 3THYA 4LF8J 3QETA 2M3DA 5BR8F 3I5BA 2ZD1B 4TNOA 3D66A 4C8LA 4ECSA 1FE0A 2DXDA 4KV8A 4MFBA 3E9OA 2C22A 4DPXA 2CJBA 4OYBA 3OTEA 4F0HA 3CI5A 5LMNJ 1RT2B 4KHNA 2BM0A 5J2PB 3M8ZA 4ILJA 4L76A 1TV6B 4WXOA 4PY5A 4DR5K 2JWLA 4JS5A 2M2BA 2HHSA 3OTCA 4FWKA 2YQ0A 4RUAA 3DMJA 4FWPA 4I6AA 3LGNA 2QMXA 2B4OA 4CFDA 4BRKA 5HP1B 1UW9A 4KRFA 3ILLA 3MF5A 3TA1A 3PR4A 3ZEUA 1OQ3A 2Z0GA 4RW9B 4BR5A 2B7CB 3MUVP 1I5OB 1GXLA 4JV5F 1DTQA 4WKRA 1I3AA 2ZH1A 3OS0A 2WSFC 1VYAA 5HVGA 3RG6A 3KHGA 5MAOA 4ISEA 2CZ4A 2ATLA 1CLQA 3W5ZA 3DWLA 3IMQJ 2C2RA 2F9DA 2VQEJ 2CJ9A 3CERA 4UOFA 3M5RA 4CIFA 2M4MA 2L41A 2R7WA 3ENBA 1IKWA 1EQMA 1V6HA 1XMQF 4GY2B 2JVOA 4N56A 2KRBA 4X64F 1EWRA 1LW2B 4GKKJ 4BROA 3BUZB 3I96A 3KNGA 2DIVA 2YQ1A 1VRTB 1NMNA 2ZH9A 3C3LA 1I6JA 4J9OA 1R59O 3PYGA 3U1NA 2ZD1A 3CJ3A 1C1AA 1T03B 5CZ1A 4BACA 2LVWA 3LQVA 5KPTA 4M1KA 1NH8A 1RT2A 3AY0A 2WONA 2WFBA 5J2PA 4CJ7A 4DV4F 2NXEA 1TV6A 2J8SA 3RR8A 4LR7A 3SQ4A 4DV1J 2F5GA 3PW2A 3DGVA 1NSAA 1EP4B 2MDAA 3CFOA 1REVB 1IXKA 3J7AP 4QIGA 1IBLK 3SCXA 5HP1A 2AMCB 4O3SA 2E2OA 5HBMB 4PUOB 1V3SA 4JUZA 1FE4A 2CQ3A 2B7BB 2RHQB 3D2FB 4RW9A 4HHTA 2NUUG 3TRGA 3MN9A 1S1XB 2J6TA 1KONA 4MJKA 3O3HA 1NDLA 1VSMA 4ZTFA 1K73T 4B02A 5KG2A 4YP3A 2VCPA 1Q82T 2GJ2A 1HQ2A 1U8WA 1UETA 1CJUB 2ZUGA 1X0FA 2ASYA 5CZ2A 2VQFF 1VC0A 2MQNA 2V9KA 4NPOA 5AE2A 2JLGA 1LW2A 4WE1B 3RBZA 2XLIA 4QWEA 4IJNA 5B0AA 3N9UC 1VRTA 2AEFA 3GR1A 3PJ9A 4X4SA 4E3SA 1FDBA 2OA8A 1T03A 3DRPB 3GWCA 1QS4A 3D2EB 1YDLA 2YNIB 3IAM9 3RZAA 3OL8A 2KFYA 4B3MJ 5DDQC 2D41A 2C2EA 4ELUA 5M1QA 5F3TA 3CIPA 3VQQA 3WNEA 1EP4A 5JXSA 1NGFA 3PO4A 1REVA 4CEQA 2UXBF 3FSYA 3V9XA 5C24B 4F04B 2V8VA 4F8RA 2C1EB 5HBMA 4PUOA 2AGPA 4P9SA 3D2FA 2IS3A 3GB0A 4HTIA 1S1XA 3OYDA 3QLHB 1S77D 1JXBA 5HQMA 5LMNK 2DT9A 3RBXA 2FY1A 1FJ7A 2DR8A 3DOKB 2NZ4A 2AW0A 3OW2R 1BE4A 1UEVA 1CJUA 4EUVA 3ONQA 2FJVA 4FF3A 4LIRA 4JI4J 4H0XB 4CHNA 2OPPB 2DY9A 1XMBA 2R7YA 3MX5A 4CJ3A 3CQ8A 1NPKA 3G8QA 1Y11A 4OI6A 3DRPA 4Y1DA 2C42A 3D2EA 3NS5A 2YNIA 2VQEK 2AYEA 1MMLA 1QAIA 3SCKE 3SEOA 3LP1B 3N6LA 4CF8A 4KIAA 1XR5A 2CG8A 3U7JA 3D6HB 2O8FB 4IRKA 2H48B 2KVQE 4ALZA 4CLUA 3OR1B 5HJYA 2FD2A 4GKKK 2YXLA 4OJRA 4ZLJA 5JLHA 3ATUA 5GAEI 1GTEA 4C3LA 4NZ7A 4XK8C 2IA0A 1SC4B 1SIWB 1BQXA 2YPZA 2M5YA 2RAQA 2Z2YB 5C25B 2QKBA 3F0NA 1HLWA 2XZTB 2ZOFA 4DX5A 5B0FA 2HAFA 3QLHA 1J53A 2Q2RA 5F41A 4CGDA 4UUWA 1W9HA 5LSRA 1RABB 3TAMB 3DOKA 4DV1K 1BISA 3O4QA 5J1NA 3LALA 4GRSA 1XEZA 3B82A 4JKHA 5M1OA 5C2FA 4H4OB 1R8PA 3TX0A 1NJXA 4OJHA 2BYCA 3VGTA 3FZBA 2GX8A 3W1YC 2YKOA 3CMQA 3NAIA 2OPPA 3WZ0A 3MPWA 5C42B 3FZKA 3CC7S 2GBZA 2QA4S 3SUQA 2OPRB 4LF2A 3UE5A 4CJ4A 1RTZA 2F8HA 5IT9U 4FYWB 4Q45A 5C7PA 1HBMB 2XC9A 2CA9A 3BGOP 4HHJA 4PG7A 4UOHA 3P49B 2PMWA 3H59A 1H3DA 3LP1A 4B9QA 4I6YA 1R6YA 4RG8A 1XHZA 1HNXJ 4NLSA 4GV6A 3Q8QB 2O8FA 3CIMA 4YY3J 5CYQB 3OR1A 2XZDB 5DDRC 4B1XB 4M95A 1S0OA 1ASVA 3BN7A 4IZ9A 4JRPA 3C0BA 1JJ4A 3QWUA 3VA0A 3WQUA 3RB0A 3DXKB 2D69A 2BABA 2MY8A 4C1NK 1CQNA 1WSEA 2Y8WA 1GTHA 5C25A 2GO9A 4LBHA 2DNNA 4RUCA 1N8RO 3H0PA 2I38A 4C7QA 1K73O 4DX6A 4CM2A 4LF4J 3ISND 4B3MK 3TAMA 2E5LJ 2LEAA 5L1LA 1UFKA 3CC7N 1K44A 2QA4N 4J37A 4AYBD 4H4OA 4OI3A 4QWCA 4DR3J 5F9LA 3ZT4A 3PACA 3SAGA 1GH8A 2GHPA 3PXGa 4CJUA 4XIUA 5C42A 3ZSXA 2VUGA 1FXRA 2OPRA 3NCRA 4C23A 4DV5F 3CNQP 2PA3A 3OL7A 5A76A 4U67Q 3VESA 1HBMA 4K41A 3EUNA 4GMKA 3AVAA 5KFVA 2G13A 3BEGB 2F7TA 1BMQB 4OJ1A 4CZIA 4JI4K 4RZRA 3NWGA 4HWIA 5CYQA 3AO5A 1KS2A 4OQJA 4OZ3A 4JOUA 4BS2A 4CERA 3TA2A 3GZ7A 3KUGA 3KD5E 3DXKA 2UUAJ 3CCES 4M42A 1VSKA 5AE3A 4FVCA 3OFGA 1FKAF 4ILRA 4DEZA 2GGPB 3H3OB 4JI1K 2MSSA 5KOXA 2RQCA 3C7NB 1GQEA 1U2RA 4L3KA 1PC4A 1CJTB 4OYZA 3WT0A 3GJTB 2Z2MA 5GAEU 5U47A 2E7WA 4K25A 2X78A 2YKNB 3AAQA 2KVIA 3FE1A 4LF1A 4WP3A 9RUBA 3ELHA 3THTA 3R1HA 3RAXA 1WUUA 1RAEB 4MH8A 2XWYA 3W63A 3IO1A 4USJC 1TVRB 3RB4A 3TYTA 3D67A 4M5GA 4QQBA 4KTZA 2R2SA 3NF7A 4OX9J 2EFVA 3Q22A 3QRPA 1MWYA 1WHYA 3CJ8A 3CQXA 2FBXA 2OJ3A 2DIUA 5KFFA 2BQ3A 4MAKA 2OANA 3CCEN 4IDKB 3CJBA 3KJVB 4DUYF 3WNHA 1J5OB 2CGKA 4WU3A 4IOBA 3IS9B 3G9CA 4ECYA 3O1WA 2VKZG 3T1YJ 2AU0A 3ID6A 1HJRA 3F2KA 4FLXA 4LVNP 4RR5A 4JN4A 3CCWA 2X74A 2DNRA 5H9FJ 1GOCA 2RILA 2FZKB 3VWSA 3HSDA 2EWHA 3AJ2A 2R8KA 4DU1A 3JAMO 2GGPA 1ZM3A 3S41A 2EEYA 2DGUA 3C7NA 2WBRA 3QT5A 3CDAA 2RQMA 2P6TA 3ALYA 1CJTA 5I3UB 4C4WA 3L95X 3H2UB 3SBGA 2BBEA 3VCDA 2G1HA 3THVA 2YKNA 3EXCX 1HNXK 1C0GA 4YY3K 1RDUA 4CJRA 1Q5VA 4X66F 4G9ZA 2BDPA 4IOAL 3SMPA 2R8JA 3Q24A 3HVTB 5F2RA 2E8AA 4Z37A 2ZOGA 1UPMB 2HGNA 3UCUP 3FRZA 2BUPA 2K3KA 1TVRA 3AVKA 3NGKA 4CZHA 4B3OB 2H4YB 4GMJB 4AD6A 1FDAA 3AVMA 4DV6J 2UVUA 2FUG9 3P45B 1LFWA 5EY4A 2IDLA 2YKPA 1JXEA 3M30A 5EHHA 4DV7J 2GIRA 4LF4K 2R8HA 1H2VZ 1BUPA 1N5SA 2N82B 4DV2J 3TUIC 3BYRA 3IBWA 1TAUA 2OIHA 3QDKA 5GMDA 4FK4A 4ED4A 4OZ2A 2V4RA 1DQAA 3WXIA 4IDKA 1Q81T 3KJVA 2GV1A 3DN9A 2GQCA 1J5OA 4DR3K 3IS9A 1WF2A 3PUFA 3GG4A 4PL7A 3S3OA 1VQ7S 4FPBA 1JLGA 2V8HA 3BQ2A 3TTDA 3RMDA 4B1YB 4DCOB 1I3OB 2X6NA 5BN8A 4LRAA 5KG1A 2ZNZA 1BCOA 3NMUA 1C1BB 2I7PA 1VFJA 4NXMJ 4OIXA 1TMJA 1MROB 5AQMA 1CQMA 2IJFA 2ZBRA 2VFTA 1CZAN 4NYPA 3W8PA 3PNIA 4ILLA 3MECB 3T5HA 2YI1A 2VV5A 2XCPA 3PIOQ 4O4GB 3G71S 3SLCA 1U1QA 1AT1B 4M7YA 3TZZA 4TKTA 1KNZA 4CZGA 2GVZB 1IR1A 3D3BJ 3HVTA 4RO0A 2WUSA 2CYYA 2MXYA 2UUAK 5G0RB 5HVHA 1B7YB 2AP1A 1VDHA 4B3OA 1HW9A 4FNIA 3D3CJ 4DXLA 2E5HA 2MKHA 4FYDA 2ASOA 4P71A 4J7CA 2HFVA 3WX8A 4C97A 5AE1A 4C98A 4DTMA 2I5JB 2HWIA 3SJJA 3QZ7A 1N33F 1CC7A 3P8BB 4TU8A 4OX7A 1NHKL 2CQCA 3HULA 2DNGA 5CCLA 2LECA 3U8XA 2I0XA 1YVUA 3CJKB 3DLJA 3AQPA 1S0VA 3KLVA 2E9RX 2VDIA 3QMLA 1RE1B 5KG4A 1VQ7N 2OH2A 1QQCA 4OLOA 3N4WA 3QMQA 3MM8B 1VIOA 4UW2A 4J90A 3J7A1 3OXFA 4ZLPA 2A2DA 2DRDA 1XHXA 1SQGA 2MHEA 4USIA 3KLIB 3C66A 3O6WA 4M5LA 2KO1A 3EDRB 4H8KA 3HP6A 2QWLA 4PXDA 3CVKA 5M1FA 4ER8A 1EAYC 3MM7B 3VTHA 3G71N 4DF8A 1VI7A 1C1BA 4JRQA 4IR9A 1WG5A 2LXUA 4PKHA 3HKZD 4ILMA 4NLCA 3I9ZA 5I42B 3M3ZA 1PC5A 1MROA 4PYAA 1KAXA 4Y0FA 4OV1A 1N52B 4E8UA 4WFNL 3RRGA 3CCJS 4FK2A 3MECA 5AXLA 1TFWA 2CQIA 4O4GA 4KTQA 1TTHB 1SH3A 3T1YK 2GVZA 3H2VE 2GAHC 4IEIA 4KC5A 4DSEA 2W4DA 2ZC3A 1HLUA 5H9FK 2AJ2A 5G0RA 3O5BA 2E1CA 2VF3A 2F40A 1VQLS 2KJVA 2YQ3A 1B4SA 2R9LA 4JI7J 2GUIA 3CMES 4TXSA 1KSPA 3D6MB 4KHSA 3KVGA 2I5JA 2F8SA 3I82A 1A0OB 1JK9B 2GUPA 2IAJB 4OHXA 4G1QB 1WC0A 2YWEA 2R7UA 3IG1B 4P52A 4O0IA 4U7CA 1YG0A 2GEMA 3CJQA 3G25A 3MM8A 3UDLA 4FCYA 1C6VA 2XYHB 4EO8A 3HDSA 1ZXOA 3EZOA 4KHWA 5FROA 4FM2A 4NX9A 2XWXA 5KPZA 3B54A 1WACA 3E66A 3HSTB 3K2PA 3S6EA 3KLIA 5JLFA 4NCBA 1KQKA 3MK6A 1KFDA 4DV6K 2H5JB 3V5RA 2N7CA 3ETOA 1RBTA 3CCJN 5DM6Q 4K0KF 4IG3B 4DV7K 1VBKA 3L4BC 2E44A 1QUVA 3OBYA 4DHVA 5I42A 1IUJA 2D3O1 2ITGA 1BA1A 3O5TB 4M5DB 3TSQA 3MAAB 3PZPA 1VQLN 2NRXA 3MEDB 1H0HB 2G9OA 3M1VB 4F50A 2E2NA 1YJWS 3PVXA 3CMEN 1C2PA 1BU6O 2P9EA 3OQ2A 4QPXA 1IR2A 4CGIA 2KKZA 3C46A 1WAFA 3I0SB 3IRXB 5IV4A 4P2XA 3WEEB 3TPQA 1ZA1B 1HJOA 3W5XA 4FWOA 1T95A 4NXMK 5T41A 4K2XA 3W3DA 2RMLA 4H0YB 4LFCF 1I94J 2AEMA 1NKEA 1CZ9A 3MTJA 2IAJA 3IBCB 4G1QA 5AZJB 4CH0S 3IG1A 2V2ZA 4FDFA 4C8MA 1Q81O 3VPZA 1LWEB 5BR8J 1DARA 2VYPA 1WDTA 3T1AA 3C15B 4DQQA 4M5HA 2MQOA 4DFJA 1UFWA 3H98A 2GTDA 2X3GA 1HA1A 1Q8IA 2B3TB 1KLNA 1C4CA 2QXFA 1MWQA 2VPYB 3AVBA 2K2PA 2K8GA 2RN2A 2C3OA 1OH5A 2IBKA 3FZ2A 3OYLA 3KWIA 4IG3A 2Z58B 5A6PA 4DCJB 2ZEJA 1YJWN 1NXIA 4P74A 5HJXA 2CG4A 2V8GA 3AJ1A 3GIKA 1RFQA 2CKWA 1MW7A 5HMXA 4X4UA 1X31C 3PHTA 4M5DA 5BPMA 3MAAA 4ZVSB 3LP2B 2HG4A 4GW6A 3UWTA 3OYIA 1F2GA 3MEDA 5TKWA 4CNYA 3M1VA 4LMZA 2UU9F 1VSJA 3QRQA 3DLGB 4AL6A 3PX0A 2MYFA 3SV4A 3R5BA 2NRZA 2EC2A 3A5NC 3LF0A 1WEYA 3I0SA 4BR4A 3NNHA 3IRXA 4EK2A 1YZ7A 4J9MA 3H20A 4H0PA 4TVAB 3ZTPA 2HMIB 4DL4A 3KFWX 4WFYA 2HLUA 3L2RA 4HCBA 2V51B 4QPTA 2HQGA 3OTOJ 1JLEB 2LDIA 1B70B 2ASMA 2NQPA 4J8FA 4X64J 1NLVA 4JI8K 2O8BB 3RYLA 3ISZA 4Q5VA 5AZJA 4NXNJ 4CEZA 2P9KB 3IXQA 4CO5A 3DAWA 1LWEA 4AT1B 1RT6B 3OXGA 3DU5A 2XSJB 2RS8A 1EWQA 3ULHA 1J9AA 3CCZA 3TX8A 3CJSA 2WB4A 5HL7L 2HEKA 2QLBB 1IBKK 4KB1A 4CQ1A 5K9FA 3H1VX 3GU0A 4DV4J 2B6AB 1O5JA 2ZKUA 4JI7K 3JTNA 3MR3A 1BG3A 3MXJA 4I2PB 3FGVA 2OFHX 4C8YA 1U6FA 5JS2A 4LSNB 4NYOA 2DCUB 1YIJS 3ENHA 1OSDA 4CHOA 4ZVTB 1VK0A 4MKVA 3W9IA 2W6LA 3P96A 3BF1A 1XJWB 2PDAA 1M5VC 3W64A 3LP2A 4FYYB 4CESA 4WFAL 2OMLA 4Y28C 5KT2A 9ATCB 3DLGA 3R7SB 3CC4S 2ZH8A 2V94A 3HK2A 1L5UA 2YJEA 2WOMB 2Z1IA 3L2UA 2P5GA 3D7SB 1TYQB 1FX2A 4EWTA 2NSCA 1FRHA 1PYSB 3PEJA 1C1CB 2JC1A 2HMIA 2WBMA 1U6BA 1RAGB 4ZVGA 1MDUB 3EICA 1YJTA 1JLEA 5JMVA 2RB7A 3O8WA 4TLRA 1P1LA 2O8BA 4JS4A 1Y3JA 4NLPA 1RJJA 4I56A 2XSJA 1DURA 2IYGA 2BXJA 1HBNB 2OCEA 2CPZA 4DTXA 1YIJN 3PR5B 2B6AA 2X7IA 2ZH2A 1BQNB 3N5BA 2KDOA 4MQ3A 1VC5A 2KJWA 1NMDA 3Q23A 4I2PA 3MZIA 5L38A 1I94K 4LSNA 2DNLA 2Z30B 4ZIWA 1J5EF 5M2RA 2QW9A 4LY7A 3CC4N 2E5JA 5BR8K 3N4PA 1N32J 4PAAA 1XK8A 2MTLA 1BWVA 2NRRA 5KFEA 4FWNA 4Q44A 1SL0A 3BKFA 3TO8A 4FZZA 5K8PA 3UW1A 4MO4A 4P2FA 4B1UB 2WOMA 2JFDA 4K4TA 4XPCA 1TYQA 3T69A 2VONA 2HOEA 4LR9A 3GPAA 4UQTA 3THXB 2BUNA 2UV8G 4I2QB 3GR0A 1C1CA 2D4WA 2E7VA 2FVRA 4XDDA 3JXUA 1OQ6A 3VQAA 3ASMA 4HACB 3PRBA 4DR2F 2GV9A 3I9V9 3KUHA 2L48A 4JKEA 5TKYA 2WHOA 1U49A 4AILC 5IM0B 2G2ZA 4JKGB 1LV5A 4FJGA 2W4CA 4DN0A 3ISNC 4KAZA 1HBNA 1R43A 2QWOA 5ETTA 4ZVQB 2J9DE 5HRRA 3ILIA 1SJ1A 4L6V3 3HZ6A 3SMSA 2VWJA 1BQNA 1JLCB 1L3UA 3DLRA 4JYAF 3UD5A 4M45A 3SQ1A 1XMQK 1U1OA 4ELTA 4LF9F 1WNEA 2Q66A 2NRWA 4N7TA 4X64K 3TARA 2NZTA 3A0IX 2JJ4D 2UXDF 1ZBHA 2XYGB 1W25A 3G6VA 4KSEB 4C6AA 1Q86T 4C0BA 1P8ZA 3CCQS 3IC1A 4CEEA 3HHLD 5AR0A 4IQXA 1QSLA 1S48A 4Q43A 2YHBA 3KHHA 1T6CA 1S1TB 1FNMA 3MR2A 4JI6J 2CVIA 4CFAA 1OO0B 2CIMA 2DK2A 3AAWB 5GAHI 4DV4K 4IJAA 4FXVA 2LQJA 3THXA 3HKWA 3TW0A 1BLUA 4I2QA 4ZVHA 1VJQA 3VEWA 4R0EA 1CG2A 2FVSA 1RB0A 3VHQA 3BSNA 3HHLA 2VWBA 2C3UA 3RAMA 1S59A 4HACA 4KYZA 2ZVIA 1IKYB 4O3RA 4QU7A 3QSIA 3LO3A 3BH6B 2VL1A 2PEBA 2GQ2A 5IM0A 1RU2A 5LXRA 1ZETA 4JKGA 2RE1A 2BVZA 2OP5A 4PKDB 4DQRA 3OYFA 3LM2A 3G82B 2H5EA 1HL6A 3P39A 1FTRA 4DU8A 3LDLA 5F8GA 2IDEA 4TU7A 3HHKA 2NCKL 4DLGA 3DRSB 2NSBA 2GWJA 2P9PB 3IWLA 3NWRA 4RUHA 3CCQN 1JLCA 3DRYA 4HDHA 5CCMA 4NLXA 2VQFK 3LWMA 2AD9A 2C2KB 3RRKA 4OO1J 3SBMA 1YKWA 2YH1A 2KXFA 4WQ4A 1U6ZA 2PGCA 4BVOA 1EETB 1B3TA 2XRIA 2CQ1A 4OZLA 3SJHA 3GJQB 2XMAA 3OFHA 2F1FA 3RTVA 3FDSA 4CZCA 5IT9O 2COLA 2JSXA 1S1TA 4JKCA 4CZJA 4BRLA 4EYHB 2XMWA 1JJHA 3VQ5A 3AGKA 2J9DA 5DGBA 3HD2A 2I1RA 2G8FA 3CDEA 1S1WB 5KOWA 4LH4A 4GKJF 3FEZA 2ALZA 4P73A 1UFLA 3VZHA 3CFRA 1LCUA 3MAHA 1VQ8S 3TWHA 4ISGA 3H5UA 1G99A 2ADBA 2R7SA 1NOYA 4V1Ak 1IKYA 4KY3A 5GVQA 1U0HB 5KRTA 3P1GA 2YX1A 2B9XA 2NYHA 3CIZA 3G82A 4DV5J 4NRUA 2ZH7A 1BC6A 4MDBA 2G8WA 2J5AA 4BR7A 4QR2A 1B64A 2Q43A 1WNSA 1D8YA 3DRSA 3AA4A 2YKQA 3ZTOA 3CTRA 2P9PA 3H7HB 2V67A 3ZZRA 3QINA 2FVPA 2G8HA 3PKYA 1GLCG 2FGCA 4QZVB 4CHQA 1SKUB 4BBYA 3UO0A 2HVHA 1KTVA 1R3NA 3L09A 1EETA 1S6UA 3OFEA 1RT7B 2W42A 5AQWA 3T9NA 2QE5A 1FHTA 1KN6A 2CPEA 3BGUA 3A5OC 4XH1A 3CT9A 3B4MA 4CLLA 1UW4A 3HOTA 3A5MC 4AXIA 4CZMA 5B0DA 3RMBA 4LIWA 2W8LA 4F67A 1VQ8N 3J80Y 5J2QB 4H0OA 3M9NB 2MQ8A 4TSXA 4XDCA 4B9SA 2DGXA 2MLZA 4F3QA 1NEEA 2HWHA 4PABA 2IMWP 1MWMA 4RJVA 1N34F 1YGYA 2AYBA 1JNZB 4CBUA 5GAHU 3Q7CA 3OUYA 4I9LA 2ZOMA 1DTTB 1U0HA 5GAGP 1BXNA 2HIYA 2ZBQA 1RDCA 2VODA 4PWUA 4NZ0A 1RWKB 2I9SA 1R0CB 1ELOA 2GVDB 2WSEC 4LF8F