1RTIA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 143
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtiA05
4RW6A 2HNDA 5I42A 4Q5VA 3PW0A 3SUNA 2IBKA 3OJUA 1NK9A 2IGIA 4E1MA 4KHMA 3T19A 1KFSA 4QW9A 4FJNA 4GW6A 3PX0A 1UWBA 3PX6A 3SQ0A 4DTUA 1QAJA 1JXBA 1GOCA 4O55A 5SWMA 4CF9A 4KAIA 3MEEB 1D8YA 4Z4EA 3OYDA 3CIZA 3M8PB 4O44B 2VWJA 2IC3B 3HPOA 4XO0A 5KFRA 2W7OA 1JLFA 4Z4IA 3CJ2A 4O5BA 4CFBA 5KFDA 4ECTA 1ZETA 1ITGA 3RTVA 3OYHA 5I3UA 3DDKA 4KB1A 3P1GA 1KRPA 2FC0A 3DOLA 2YNGB 2BGGA 2FVPA 1GOAA 1X9MA 4NLQA 3PR5B 4CJVA 4KFBA 3MFIA 4FZXC 2O4GA 4CK1A 2D0BA 1WLJA 1YVFA 4U7CA 2R8KA 2P1JA 4FK2A 1S1UB 3T5KA 4QWCA 2AWZA 4CHYA 1KHWA 2AGPA 3UPFA 2E6LA 5DK5A 3S3NA 5KFZA 1XHXA 1RNHA 1C1BB 4IH7A 4DSFA 4FM1A 3BSOA 2PYLA 1J5OA 3DRRB 4RW7A 3HJFA 3VQCA 3OSNA 3KHLA 3ZT3A 3UDLA 2HHQA 1B9FA 2HVIA 3QNNA 2ZQBA 3DRPB 4LQ3A 1MMLA 1TKDA 2BANA 5DGAA 3AVNA 4OKEA 2XCPA 2I1RA 3IS9B 4PWDB 4FJLA 4EO6A 3I5CA 4HTUA 2PY5A 5FDLB 4NLYA 5CYQA 4IG3B 5HROB 4BDZA 2B4JA 3SCXA 4TY8B 5KFPA 1ZBIA 4CESA 4MIAA 5JS2A 3CJ0A 4DFJA 1LWCA 4YR0A 2UUTA 4R5PA 1BCOA 1QSSA 4Y34A 3AA5X 5CYMB 1KTQA 3V81A 2BRLA 1IKYB 3L2UA 3T5LA 3OYGA 1HNIB 3PW4A 4CIFA 4BDPA 1HQEA 4NLOA 4ZP7A 3KOAA 2IJNA 1A5XA 3RMBA 1NK6A 2Z1IA 1TP7A 2YKMB 3BGRA 3VA0A 4ZPCA 4Q44A 2FBYA 1GX5A 2FJVA 3HHKA 1N4LA 3QLHB 1S97A 3HSTB 2G8WA 4PUOB 3AO2A 3PVXA 1HRHA 1TV6B 3Q8QB 4NYNA 4JV1A 2Z1HA 4OGCA 4B9VA 2GUIA 3M9MB 1N6QB 4U6PA 3D0PA 3H98A 2F8SA 1FKOA 2AGOA 4DG1A 3MXJA 1RTHA 2BRKA 3KK1A 1J53A 2G8VA 1TVRB 4DQPA 4O4GA 1TQLA 4ZPDA 3AVCA 2HWIA 4FJ8A 1RT5A 3OS1A 1S0NA 2AX0A 1U47A 3PV8A 1VRUB 2VG6A 1N5YA 4CJPA 4BACA 1JLEA 4K4WA 2DFHA 1NJZA 2IM0A 3E01A 2XWYA 3TAPA 1T05A 3TAMA 4CJFA 3OL7A 3EZ5A 3KLGB 3ZSVA 4DL7A 1TKZB 5HBMA 1SH0A 4HVJA 2QKBA 4HCCA 1D9DA 2W42A 2G8HA 1I6JA 3HKWA 1RTJA 4Y2CA 5L1LA 2J6UA 2V0NA 4CGFA 3QIOA 2YNFA 4G1QA 2VA2A 4CHPA 1C1CA 2C2EA 4DWIA 3KNAA 5KFVA 4JLHA 1S1WA 2R2TA 4MK7A 1LW0B 1RTIA 4QW8A 1VK0A 3NF9A 1RYSA 4KO0B 3OHBA 3QEWA 4ID5B 1RT3A 3N6MA 4OJRA 4DMNA 3O3GA 1REVA 1JKHA 3N6NA 3OSPA 5KGWA 4LSLA 4B9UA 2XY5A 3AA3A 3VQQA 3PO5A 5F8JA 3CJ5A 4CJ3A 3ZSQA 2WK4A 1J9AA 3MAQA 4W5RA 4B9LA 4N56A 1TL3B 4LSNA 3HPHA 5FRMA 3ZT4A 4DTNA 1UOCA 3I0RA 5J2QA 5KG1A 1ZBLA 4W5NA 3C6TA 2YNHB 2JEGA 3QO9A 1IKVA 1MU2A 3M8QB 1LAVA 4CF2A 3SFUA 1JLQB 3S9HA 2GC8A 2FJXA 4ECWA 2DPJA 4NLUA 4M3RA 2ZE2B 4ELTA 4DL5A 4GVMA 4IRDA 1WAFA 3K5MA 3H5SA 3MXMA 3MR3A 3M9NB 1UAXA 3LZJA 2R8IA 3G6VA 4DS5A 3KLFB 4R8UA 4QWEA 3G10A 5F8IA 1S49A 3VQSA 1S9EA 5KG7A 4B8CA 2XI3A 4NYFA 3UR0A 1XR5A 4DTMA 4EO8A 2R2UA 3MEEA 2XGPA 3M8PA 4O44A 3NKYA 4FJMA 2IC3A 1D0EA 1L3UA 4IRKA 4IKAA 1U04A 3OS2A 2HW3A 2XGQA 3LAMA 3QEIA 3UQSA 3QIDA 5HP1B 3BJYA 4FLTA 1FKPB 3OL6A 1KSPA 3IRXA 3GIKA 4CJTA 1T03B 4NLXA 2RKIB 4KB7A 4MQ3A 1S1UA 3ITHB 1JLCB 1Y97A 1RT6B 2JEIA 2Z1GA 4FJ7A 4CIGA 4J2EA 4EBDA 4IG0A 1QUVA 3NF6A 1NK7A 4MK8A 3I5AA 3AVGA 3CDWA 4IH6A 4M3XA 4QAGA 1C1BA 2P5OA 3OYIA 2FVRA 3VQAA 4C8MA 3FSIA 2W9CB 1IG9A 1LWFA 2HB5A 3DRPA 1QE1A 3NAIA 4O3NA 4ECQA 1XC9A 2ILYA 4HUGA 3RMCA 4H8KA 2BR0A 3JYTB 3E51A 4F50A 4L8RB 4OVLA 3IS9A 1IO2A 4CEEA 2OPSB 4YQWA 3SQ4A 2A1RA 1NKEA 5FDLA 4IG3A 1SV5B 2UUWA 2HAIA 3DLRA 1CXUA 3ZSRA 5HRSA 5HROA 4NLDA 4RZRA 5J2MB 2AX1A 3QEVA 4I9QA 1NOZA 4TY8A 3OL9A 3SYZA 1S1VB 3DYAB 3GILA 5KFBA 2W8LA 1IKYA 1HNVB 3NBPB 4DSJA 4KHQA 1TK8A 1BL3A 4HCBA 3L8BA 2YHAA 3TAQA 4Q0BB 3DM2A 2P5GA 3NCIA 5D3GA 2YKMA 3C94A 1I3AA 3FQKA 1S5JA 4CK2A 5KFKA 3NH2A 2Q3SA 2R7YA 3AO4A 4B08A 3QLHA 2VA3A 2IMWP 3PX4A 4FW1A 4PUOA 1QQCA 4E7KA 2FLLA 1TV6A 3AVIA 1RTDA 3CM5A 1HJRA 4OL8A 1CXQA 1N6QA 2RF2B 5KI6A 4OLBA 4CJUA 3L2QA 3LZIA 3H4BA 4FJXA 4CGIA 4CCHA 4URGA 4CFAA 4YFUA 4Z4CA 3QESA 4E1NA 1VRUA 1RBUA 3EYZA 4DQSA 3MECA 1GOBA 4ED2A 4XIUA 2ZD1B 3BR9A 5DG8A 5KG5A 1WSHA 1S6QA 4F3TA 3LP1B 3PUFA 2WONB 4KTQA 3KLGA 4K4VA 5HLFB 1TKZA 2HNYB 3AVAA 3TI0A 4LQ9A 4F4ZA 2VG7B 4AHUA 5J1EA 3P83D 5J2NB 1TL1B 1LV5A 2XHBA 1Z26A 4KBIA 3RAQA 3HVAA 4GC6A 1RAJA 1LW0A 4H4OA 2DY4A 2HHXA 1X9WA 4FZYA 4KO0A 3CFRA 4ID5A 1JX4A 4NZ0A 4NCBA 3G0ZA 4Z4GA 3OYJA 3TABA 4K4YA 4FM0A 5KFNA 2PZSA 3PW7A 4FBTA 4Q8FA 2QK9A 1RBTA 2JGUA 1XR6A 2AQ4A 4AILC 4DL6A 2ILZA 3OYNA 4PA1A 1NOYA 3ALYA 2RDJA 4J9KA 4CF8A 3OYEA 3MEGB 4KTWA 3M8QA 4KKOA 4JUZA 4BE0A 3NFAA 2ATQA 5KG6A 4O0IA 1ZBUA 2XY8A 1JLQA 1L3SA 1C0MA 4Q8EA 3SQ1A 1N56A 3DLBA 5KFEA 3MR6A 2ZE2A 3OLBA 3HP9A 4AHSA 5DQGA 2FJWA 1KVBA 4M42A 3KLIB 3HVRA 3P5JA 2ALZA 3AVJA 2IM3A 4FZZA 4FXDA 1VSMA 1HYVA 3KLFA 3RWUA 5KT6A 3MEDB 5T14A 4DL3A 4MKAA 4FS2A 4EEYA 3V6DB 4CEZA 4ICLA 3KLEA 3VQ6A 4KHYA 2JEFA 4KI4A 3L2VA 3G86A 4Z4FA 2CJQA 2YNIB 3DOKB 4FCYA 2HMIB 4MFBB 3O4QA 3VQ8A 2B6AB 1JLAB 4E19A 4AHTA 1LWEB 5F9LA 3RR8A 3T1AA 1VSJA 3VN5A 4KE5A 2D0AA 2OPQB 3C6UB 3CJ4A 2UVUA 3QINA 4RW8B 1FKPA 4Z0UA 4F3OA 3KIOA 4WYWA 1T03A 4C8NA 4DU4A 2RKIA 1ZTTA 2D3ZA 2XC9A 2DPIA 1W0HA 3NAEA 3MXIA 2HHSA 1RT6A 4IH5A 3T3FA 3Q8SB 4IFYB 1U49A 3SI8A 1QHTA 4KHRA 3PJWA 4ZHRB 4ZP6A 5KFFA 1HYZA 4M45A 3D45A 4DSIA 1S1TB 3M8RA 4FJGA 3DLKB 3RBDA 2FBXA 1HMVA 3VQPA 3ZT1A 2WB4A 4WFXA 4EZ9A 4DSKA 3K57A 4NCGB 4CJRA 4DFPA 4WYLA 3LALA 5J2PB 4DLEA 4FJ9A 4TQSA 4CEAA 4IOBA 4J9LA 3JYTA 1WSEA 1BQMA 5HRRA 1TKTA 4URSA 2OPSA 1VSDA 4IDKB 4TYAA 1SV5A 5KFJA 3NGZA 3SUOA 4URQU 4DTPA 4J9QA 2G8FA 5J2MA 4B3OB 4LY7A 4CK3A 1DLOB 4K8XA 2RPIA 5KG0A 1VSKA 2VWKA 2JC1A 1TK0A 3DYAA 1Z25A 1S1XB 4K4ZA 5KG3A 1HNVA 3NBPA 3QGIA 4ZVGA 1BI4A 1I39A 1NJYA 3V6JA 3V9WA 3HM9A 2W9AA 2IM1A 2IAJB 4Q0BA 1D9FA 1RDRA 3MR5A 4J9PA 1IKWA 4K4TA 4EYIB 3VQ9A 4MKBA 3CYMA 3OYKA 1XWLA 3G6YA 1RDDA 3SNNA 1JL1A 1NK4A 3FDSA 4FLWA 3DLEB 3EPIA 4CHOA 2KZMA 3LP0B 4WE1A 4UQGA 3KLHB 5KGXA 4DU3A 3I0SB 1WSJA 1NKCA 2RF2A 1RDAA 2KW4A 4M94A 5DGBA 4QWDA 4BE2A 1RT2B 3V9XA 4EP4A 2V4RA 3HYFA 1YVUA 3HVTB 1WAJA 3F73A 1S6PB 3U3YA 3LANA 3L3UA 3I8DA 4F2RA 1T94A 1T3NA 1HQUB 1ASVA 2R8GA 3JSMA 2BQUA 2B5JB 2BDPA 2WONA 2F8TA 1VRTA 3OVNA 3OL8A 4KHUA 1NHUA 1KVCA 2YV0X 5JS1A 5HLFA 2HNYA 4C8LA 4TN2A 2VG7A 2YHBA 4ZTFA 2C2DA 4CE9A 3TAGA 2OYQA 3CFPA 3HL8A 4CHNA 5J2NA 3VQ5A 1TL1A 1QAIA 4JRQA 3OHAA 3H5XA 4W5TA 5CZ2A 5EUHA 5DG7A 2QE5A 3KMQA 4M3UA 2AGQA 1TGOA 5KFSA 4BWMA 3QIPA 3KKRA 3TANA 4CGGA 1DTTB 1NHVA 1RYRA 4AH9A 3OYLA 3CVKA 4F4YA 2O4IA 4HKQA 4Y3CA 1RT7B 2WTFA 3QZ8A 3FFIB 3V4IB 2F96A 4FM2A 3THVA 4ED8A 4JV2A 1Q8IA 4QCLA 4CERA 4B9MA 2R8JA 4FS1A 3HK2A 2E4LA 4RW6B 5I42B 4XPEA 4I2PB 4GMJB 2XI2A 3ZCMA 3AO3A 4EYHB 4HUFA 4K4XA 4DS4A 1C1AA 1C0TB 4ECRA 3SFGA 3MEGA 1G15A 1SKWA 3V1QA 3VQEA 3U6FA 1CZ9A 1KLNA 1RT1B 1UWBB 4HHTA 2FBVA 3L2RA 4X2BA 4KPYA 4CEQA 1TKXB 2C28A 4IFVB 4I2QB 3H5YA 2JC0A 4ZVEA 1EP4B 4PQUB 2JEJA 4CJSA 5KFAA 1XI1A 4ECZA 2J6SA 4M95A 1JLFB 3ICLA 3OY9A 3MEDA 1VSLA 2BQRA 1IH7A 1R0AB 4KHWA 3V6DA 4K50A 2WCXA 2YNGA 4J9OA 2YNIA 3DOKA 1KCFA 3LP3A 4WZQA 5F9NA 3NE6A 4MFBA 1XHZA 2B6AA 1JLAA 4IRCA 5L1IA 4ECUA 4CIEA 5C42B 1JLBB 5KFQA 1IM4A 1A5WA 1LWEA 4YMEA 4LD0A 2DFEA 3C6UA 4MH8A 2F8EX 4LH5A 4HUEA 3FRZA 4RW7B 3S3MA 1JLGB 5KFUA 3DRRA 4B9SA 4OLAA 1NK5A 2V4QA 2WHOA 3K2PA 4ZHRA 3S3OA 3IG1B 4KHSA 3RAXA 1S1TA 4RUCA 3DLKA 4PWDA 3OYAA 3NGDA 4CEBA 3N6LA 4DQQA 3KD1E 1WNEA 2G8UA 4K4UA 1BCMA 1RILA 4G3IA 4NCGA 3ZSZA 3PJXA 3V9UA 5J2PA 5HRNA 4KV8B 4QWBA 3QYYA 1KFDA 5EWEA 4C8OA 5KT3A 4N41A 5CYMA 3EZUA 4ELVA 3V81B 4IDKA 2OH2A 5KFTA 3SI6A 3RB0A 4K4SA 3PR4A 3SUQA 4IQXA 4CJ5A 1HNIA 2R8HA 4IR1A 3RB4A 4B3OA 3SZ2A 3NF8A 1T7PA 3RB6A 5DQIA 2J6TA 4ZVHA 1SH3A 4W5QA 4DTRA 4ECYA 4RNFA 3RB3A 1ZBHA 3OYCA 3BGRB 3KLVA 1S1XA 2UVVA 5CY4A 3QGGA 3DRSB 3TQ1A 1YTUA 3LPTA 2FBTA 3LWLA 2IAJA 4ED6A 1Z4UA 1YTAA 3MFHA 4XPCA 3AVMA 4KAZA 2ETJA 3ZSOA 1SL1A 2I5JB 3WNGA 4MK9A 1W9HA 2VG5B 4JS4A 5KT5A 1K6YA 4O3PA 3KHGA 4M3TA 3OLAA 2HNZB 1FKOB 5KFGA 3LAKA 3KK1B 3AVKA 2OPRB 2WOMB 3HP6A 4O4GB 4RNMA 1TVRA 3K59A 5K14B 3DLEA 1WSFA 3AVFA 4M3WA 3LP0A 3Q8RB 3KKSA 3KLHA 3IGNA 2ASJA 2C22A 1N5YB 1QTMA 1BIUA 4C8KA 3GV5B 4N76A 3I0SA 3ULDA 4CECA 1JL2A 4TY9A 2XY7A 3O3HA 3ZT2A 1RT2A 3IN5A 3VA3A 4FK4A 3HVTA 1GX6A 4Q43A 3PW2A 3AO5A 1RDBA 3M9OB 4KRFA 2D5RA 1S9GB 4NLGA 4OKJA 4QWAA 1S6PA 3RMAA 1RTJB 3FQLA 1ZYQA 4J2AA 4CGDA 1C1CB 3K58A 1UA0A 2E9RX 3LWMA 5F8LA 1RA6A 4ZVFA 5CZ1A 4B9TA 3DLHA 2IA6A 3NHGA 3QGHA 3RRGA 1NK8A 5EWGA 3GV7B 4ZP8A 4DQIA 4KI6A 4R0EA 1S10A 2FLPA 5KFOA 5KFYA 5KRSA 1HPZB 2GIRA 3V9ZA 1U4BA 3BQ0A 1LW2B 3HO1A 4EP5A 4FLVA 2O5DA 2JLEA 4O0JA 4OKKA 1WN7A 3BSCA 1SH2A 4LSNB 2Z1JA 1TL3A 1DTTA 2LSNA 3NGIA 4J9MA 2EC0A 1TAQA 1C0UB 2YNHA 1RT7A 5EU7A 4WZMA 3SJJA 4RW9B 3QERA 3FFIA 3V4IA 2KFZA 3IGVA 1B92A 3L2WA 5F8GA 1LAWA 3F9KA 2FLNA 2WRMA 3EPGA 1NJWA 4I2PA 3AA4A 4M41A 1J54A 5C25B 3DI6B 4F4WA 3OYFA 2NUBA 1C0TA 4K8ZA 1U48A 4RW4B 4J9NA 4YNQA 4R8UB 4CF0A 1RT1A 1K1SA 1NNDA 4F4KA 4DSEA 4H4MB 2ASLA 1S9EB 1TKXA 1IKXB 3PZPA 4FJ5A 5KFWA 5DQHA 4ECVA 3T5JA 4IFVA 2HVHA 4I2QA 3KJVB 3BREA 4RG8A 1EP4A 4PQUA 1KHVA 4M3YA 2X6NA 2IDOA 1ZBFA 5KG4A 4N5SA 2W7PA 3ZSYA 3B6PA 1R0AA 3SV4A 4I7FB 4JV0A 3ZT0A 5HP1A 3LP2B 4FLYA 4FBUA 4FJIA 2HHVA 2D0CA 2RDIA 1VSIA 4RUAA 3IRXB 3H2LA 3DMJB 1NKBA 5KFHA 1C2PA 5F8HA 1EETB 5F8NA 5C42A 1RBVA 3ITHA 1JLBA 1JLCA 1L3TA 4DTSA 4ECXA 1T8EA 3H40A 4IG0B 2YKNB 3ISND 2UVRA 1SUQB 3AO1A 1S0OA 3LDSA 2CKWA 1TAUA 1EX4A 2R2RA 1JLGA 5L1JA 4QOZB 3C95A 4CF1A 2IS3A 1LWFB 2W9CA 1JXEA 5KG2A 1QE1B 3RRHA 4KB0A 3IG1A 3OS0A 2G8KA 3QNOA 4YR3A 3V6KA 3NH1A 4E0DA 3CFOA 3ZSWA 4ZMMA 3V1OA 3EY1A 1F21A 3GV8B 4DLGA 4RNHA 4CJ4A 1KVAA 4E7JA 4KV8A 3WNFA 2IJFA 3NL0A 3MR2A 3BQ1A 3H08A 3TAFA 4DEZA 3H4DA 2XCAA 1S1VA 3MTKA 4NLWA 4RNOA 3AVLA 3TR8A 1JXLA 3NAHA 4NCAA 4Q45A 1DTQB 3NGYA 2KFNA 5HRPA 4I9LA 2IOCA 2QXFA 3VQ7A 4OPJA 3QEXA 3K5LA 4ID1A 3DM2B 4CJQA 4NLVA 4O3RA 5D3GB 2D7SA 5T7BA 3KK3B 2KTQA 3AA2A 3TAEA 5KFXA 3DRSA 3M8SA 4O3SA 4FJJA 4CJEA 3UIQA 5KFCA 4JRPA 1RTDB 1BQNB 3DLGB 2I5JA 3H5UA 3KMSA 3GIIA 4FJKA 1HYSB 2VG5A 5FROA 2HNZA 1NK0A 1SKSA 2DTUA 4OGEA 4ZTJA 2OPRA 2WOMA 2D41A 2W8KA 4CEOA 1ZTWA 2R2SA 2X78A 4B9NA 5K14A 4JS5A 3L3VA 4CHQA 1ASUA 4CEDA 1CSJA 5C5JA 1EKEA 1SL0A 4KREA 3MECB 4YP3A 4CGJA 2FVQA 4DSLA 3AVBA 2ZD1A 2W9BB 1RCHA 3TARA 1S6QB 3OJSA 1FXXA 5EWFA 3LP1A 1KLMB 3CM6A 3KK2B 4TLRA 1W25A 4NLPA 2DFFA 3PHEA 4FJHA 2OA8A 1S9GA 1D5AA 3AV9A 3BSAA 4DF4A 5J1EB 2BE2B 1RBRA 2HWHA 5KFLA 3A2FA 4F8RA 3PW5A 1WSGA 1Q9YA 2E6MA 1FK9B 1VSFA 1L3VA 4Z4HA 2GBZA 3ISNC 1S4FA 2HHWA 3G6XA 1RT4B 1QSYA 4H4OB 4N47A 4DU1A 2PYJA 1S9FA 4CEFA 2Y1IA 3V6HA 5C24B 2OPPB 3O4NA 3VQDA 5FRNA 4WXOA 3NMAA 4WXWA 3BQ2A 4O3QA 1HPZA 2E9TA 2B43A 3NDKA 1S0MA 5E41A 4Y1DA 1LW2A 1EXQA 3CQ8A 2V9WA 4DL4A 5KTQA 1BGXT 1VSEA 1B9DA 2HNDB 3T5HA 2ZKUA 4O3OA 1HARA 1C0UA 1X9SA 4FLZA 2AJQA 2BQ3A 1K1QA 1WSIA 4E3SA 4KKOB 5DLGA 4RW9A 1SKRA 3CDUA 2ATLA 1RBSA 1X1PA 3VQ4A 5KT7A 2FVSA 4NRUA 5JUMA 4J9RA 2FVCA 5L1KA 5C25A 3DI6A 1SL2A 3KLIA 3Q8PB 4NLTA 4J2DA 4FLXA 4RW4A 4ECSA 1U45A 4BE1A 5KFMA 2OZSA 5I3UB 3OYBA 4H4MA 4ICLB 4DF8A 3KLEB 3DOLB 5DMRA 3KTQA 1IKXA 1BISA 2IM2A 4EBCA 1N48A 2QV6A 4CJKA 3KJVA 4KFBB 2HMIA 4E7IA 2RN2A 3CDEA 4NYZA 5KT4A 3PY8A 4ED1A 4CGHA 3D28A 3HT3A 5SZTA 2HHTA 1OS5A 4TQRA 2XRIA 4I7FA 3WNHA 2AU0A 4TYBA 2EX3A 5DLFA 2OPQA 3LP2A 2D3UA 4F2SA 2XY6A 4RW8A 4IBNA 3DMJA 1J5OB 4ELUA 1EETA 4J2BA 4AHVA 3HXMA 4ED7A 3RR7A 3MF5A 4IFYA 5F8MA 3ZSXA 2P51A 4IR9A 3PO4A 2YKNA 3LPUA 1SUQA 2BANB 5EDWA 3KHRA 4ED3A 1VSHA 4GC7A 4ZP9A 2XO7A 1HMVB 3QZ7A 5DG9A 4CJLA 2G8IA 5CYQB 3SUPA 4FK0A 4DL2A 1C6VA 3VQBA 4CFCA 1TK5A 4FVMA 5KFIA 3K5NA 1BQMB 4CHZA 3V9SA 1LWCB 4ED0A 1NJXA 1TKTB 2QKKA 4R5PB 3BSNA 2KQ2A 3GIJA 4NLRA 1D1UA 4AHCA 1CLQA 4RU9A 2GV9A 4LH4A 4CJWA 2KZZA 2UVWA 4CFDA 2E9ZA 1HQEB 2GIQA 2A1SA 3RBEA 4O4RA 3K5OA 3H59A 4FYDA 1S48A 1DLOA 1U09A 5L9XA 1O1WA 2HHUA 4W5OA 1BI4B 3QETA 1DTQA 3AVHA 4PY5A 4EBEA 4E7HA 3NF7A 3IAYA 3GIMA 1CZBA 3KK3A 1IKWB 4OPKA 4AHRA 3TWHA 2Y1JA 3SV3A 4DG1B 4B8AB 1RTHB 3CWJA 3CJ3A 2C2RA 3V1RA 3SQ2A 4WFZA 1RT5B 4WE1B 4M3ZA 3HPGA 1RDCA 1BQNA 3DLGA 4NRTA 1QS4A 2VG6B 2X6SA 1HYSA 1JLEB 4KTZA 3GYNA 3CO9A 4DTXA 3E01B 3GQCA 1ASWA 2ASDA 1T05B 4ZPAA 1BHLA 3TAMB 4FLUA 4DFKA 3HVWA 4BDYA 2ITGA 3O3FA 4E7LA 5HBMB 1YT3A 1A5VA 4F4XA 4WFYA 1L5UA 3BDPA 2W9BA 4NLSA 4DQRA 2YNFB 4G1QB 1HQUA 3I5BA 3JSMB 4EZ6A 2B5JA 3SPZA 1S1WB 1VRTB 1KLMA 3KK2A 4FW2A 3KD5E 4E89A 3SPYA 1RTIB 3U3GA 4YR2A 3D5MA 4BWJA 5KT2A 3KHHA 4ZPBA 4QPXA 1RT3B 3ASMA 2BE2A 3NH0A 4Y1CA 1REVB 3B6OA 1JKHB 4KHNA 4LSLB 1FK9A 3TVKA 4DTJA 3WNEA 1WNSA 1RT4A 4H54A 2OZMA 3QIPB 1Q9XA 4RNNA 4J9SA 3I0RB 5C24A 2OPPA 5J2QB 1RA7A 4DTOA 1QSLA 3C6TB 4Y2AA 1JIHA 3QO9B 1IKVB 1MU2B 4HYKA 3OYMA 4TXSA 3QEPA 5JXSA 3CG7A 4DFMA 4KSEB 2EHGA 2X74A 5KRTA 4MIBA 1XR7A 1BIZA 4IKFA 4TSXA 1UA1A 3RMDA
chains in the Genus database with same CATH superfamily
4RW6A 2HNDA 3A8EA 2ZH7A 1WDTA 2HAFA 4ZJOA 1WELA 2KT3A 1EQ0A 1VHIA 3UD3P 1QAJA 3GE1A 4O55A 3JQMA 4KAIA 1D8YA 3IBFB 1S22A 4WP3A 1RAAB 3HPOA 5KFRA 4DR5K 1AT1B 3RTVA 2YKQA 3OYHA 1DBDA 4KB1A 1KRPA 1XJWB 5BPMA 2CQIA 3WT0A 2BGGA 2Z2ZA 4K0KK 2O4GA 1UVNA 2P1JA 1SC3B 4JI6F 1S1UB 4Y0FA 1GTEA 2AWZA 1OQ3A 1ZZNA 3WQUA 1HPMA 2DRBA 4C9DA 1RNHA 1RAHB 3ILLA 3CCRS 3R6MA 4DSFA 2PYLA 3TEGA 2FUG9 4GVEA 3HJFA 1HI8A 3VALA 3UDLA 1GXUA 4USMA 3DRPB 4LQ3A 3AVNA 1WF2A 5AE1A 2XCPA 1SCJB 1U0HB 2I1RA 3HCXA 1UVIA 1VQKS 5L39A 3I5CA 2PFFB 2XMTA 5AQGA 1WSRA 2PY5A 5FDLB 4NLYA 4IG3B 3H46O 2P9KB 5HROB 4BDZA 1HBUA 4CO2A 3SCXA 5DDRC 4JI2F 2V50A 4EU0A 4YR0A 2ADBA 1QSSA 4Y34A 5E26A 4BY9C 3V81A 4OYBA 3WBZA 4A5BA 3L2UA 4LRBA 5A8RA 2G1DA 3EKSA 2JVRA 2LEBA 3OYGA 2VB6A 1KC8O 4BDPA 1HQEA 4NLOA 4BBYA 2IVPA 2UXBK 2VWBA 3CF5L 2Z1IA 1TMMA 2KJWA 2YPZA 3BGRA 3LO3A 1GX5A 2LXIA 3J7ZT 2H48B 1X3NA 1LOUA 2LXUA 3HHKA 1NMNA 4CTAB 2Q97A 3AJ1A 1N4LA 3QLHB 4IQMA 4CO0A 3QJLA 3HI9A 2CRLA 1HRHA 3CJKA 3Q8QB 4JV1A 1N32F 3BF3A 1U2RA 3TZYA 4IO8A 1U2FA 2GUIA 2NS1B 3SK3A 3VAHA 4DCJB 3PYDA 2C1EB 3JS9A 5LSRA 2YJFA 3AY9A 4DQPA 4J8FA 1TQLA 2AHOB 4P74A 2YI1A 2YKPA 1N36F 3T1HF 3OS1A 4YOWA 1U47A 4LF7K 2C2OB 4CJPA 1JLEA 3GZ7A 4K4WA 2R7TA 3K0SA 3E01A 4DV1J 2COLA 4MJKA 2LA4A 4CJFA 4I56A 4KQZA 1YITS 2WVEA 1SH0A 3R5CA 2QWRA 1GAOA 2RDDA 2HQDA 1I6JA 1RTJA 4J90A 5L1LA 4RWTA 2NREA 1FWPA 3SQGA 2YNFA 3UR3C 4IEEA 2AYBA 1SS6A 1NJIO 2R2TA 3L6QA 2E5LF 4Y2KA 3POTA 1LW0B 2UUBF 1APSA 3NF9A 1S0VA 3DXKB 3W64A 1H7XA 4IO9Q 4DMNA 1REVA 2KN4A 5AXNA 5KGWA 1HFEL 5HQMA 3AA3A 1T95A 4CJ3A 1B3TA 3FMWA 4EI2A 5AE2A 2G2ZA 3P5TL 5GAGP 3GFYA 4JKGA 4DTNA 2EFOA 2QTWA 4ZVPB 3VQTA 1ZBLA 1VC0A 3C6TA 1IKVA 2YTCA 4CF2A 3O5TB 3S9HA 4V19J 2GC8A 4JI2J 3G6ES 4M3RA 1UMJA 4JI7K 2ZE2B 4A62A 4GVMA 2HIYA 3FRYA 4JI4K 5B08A 3JAMO 2ZNZA 2R8IA 2Y0SD 3G6VA 4Y2MA 1S49A 4K7QA 2ZVSA 3VQSA 3J8AA 5KG7A 1XN9A 3UR0A 3QBWA 4CW7B 4LT6A 2R2UA 2GWJA 3KNGA 3M8PA 1N54B 4OZJA 4FJMA 2V8DA 2IDEA 2ZH6A 1D0EA 5DRKA 4IRKA 1BQXA 4FWKA 3GLJA 1NMDA 5BR9A 3OS2A 1FA0A 1KOHA 1EB0A 2HW3A 2G1HA 1HLUA 2NRVA 4OI1A 3B8HA 5E2QA 1N32J 3LAMA 2VBZA 4CO4A 5HP1B 3BJYA 2ZBQA 3ZZPA 1VC6A 3IRXA 2MZTA 4DJBA 4IOXA 4DPUA 3ITHB 1Y97A 3DHXA 3MCAB 4BROA 2ZBRA 2Y1LB 4AT1B 4CIGA 4J2EA 4EBDA 1U25A 2XLJA 4M3XA 1KQGB 1C1BA 1WEXA 4YOYA 2FVRA 2UV8A 4ED5A 3VQAA 2K7KA 2AYGA 5DM6Q 5D0EA 1HKBA 3HZGA 4L3NA 1UJ5A 1LWFA 2GJIA 2UXCF 2XHCA 4ECQA 2WTUA 2ILYA 4N77A 1YJWN 1BLUA 3R2CJ 2BR0A 3JYTB 4OVLA 1BXNA 2WB1D 3EL2A 4O0NA 1NKEA 4X4VA 2A42A 3VR1A 1SV5B 2HAIA 3DLRA 2E5LJ 3ZSRA 3D6RA 1NH7A 5HRSA 3GP9A 3HF5A 1NNEA 1OY9A 1VHFA 4I9QA 1NOZA 6FDRA 2M88A 3WEEB 2J0QD 4IFEA 3DYAB 1HWKA 3BS9A 4NXNK 1IKYA 4KHQA 3HHLD 3CCLS 4LR7A 1NGGA 2GGPA 2FPHX 3ZX2A 1W26A 3VF4A 5D3GA 1S5JA 5KFKA 3NH2A 2BJ9A 2NXUA 2R7YA 3HLUA 2M8DB 4LF9K 1FVSA 1CLFA 2CPHA 3SCIE 2FLLA 1BO5O 3AVIA 4ZLPA 4M5KA 1HJRA 4DN0A 3HOSA 3B54A 5A8WA 1CXQA 1XERA 2RF2B 2QGFB 2P9PB 3DDNA 4YFUA 3X1LB 1D3WA 1X4GA 1VRUA 2HHHF 4O5FA 2W41A 1YJVA 1GOBA 3JQKA 4XIUA 5RUBA 2ZD1B 3G71S 1NSKL 2HBJA 4MLEA 1Q8KA 1TKZA 3ID8A 4CZFA 4X4NA 2EPIA 3CSKA 5F0WA 1RWKB 4CD1A 2M9KA 1PBAA 3A13A 2NLXA 1XK8A 3GR1A 5AXLA 1LV5A 4GC6A 3CCUN 4IOAL 2BUPA 4BQLA 1VQ5N 5THWA 3AOBA 1X9WA 2C42A 4KO0A 3F2KA 2UXBJ 3CFRA 3LGHA 3VGUA 2EKNA 2HZCA 1JX4A 2VPYB 3NGTA 2HQFA 3UO0A 4K43A 3OYJA 3TABA 4K4YA 1NPRA 4OZNA 2XMMA 5JVHL 1UFWA 2UXCJ 1V4TA 3NNHA 2OAUA 2IPOB 4OX7A 4X84A 2QK9A 4EFAC 4AILC 1WG5A 4JI1F 1NDCA 2KI2A 2ILZA 1EQYA 2DH7A 3OYNA 4DUTA 1TYQB 3IUCA 2AEFA 4UOHA 2ERRA 2QSWA 3MEGB 4KTWA 3M8QA 4KKOA 2CQ4A 2CNKB 4JUZA 4D3GA 2GA7A 2V8GA 3VTHA 4HWIA 1J6ZA 3LDQA 3P39A 5CD4A 3SQ1A 3DLBA 4WTYA 1B7FA 3HULA 1KVBA 5G0RA 3QT8A 3GPAA 4LF7J 5D15A 5BJRA 3RWUA 1BA1A 4KGKA 1YX2A 2JEFA 1ZZFA 2DNHA 1XNRK 3SSRA 5E7OB 4P2XA 2FJBB 4NEZA 3O4QA 4DUZK 2B6AB 4AD6A 2FC8A 2JFKA 1FT8A 8RUCA 4AHTA 2R7XA 3VZHA 1VSJA 3VN5A 2Q0UA 3CJ4A 2DISA 2UVUA 1Q86O 4DCHA 1FKPA 5A76A 4Z0UA 4WYWA 3D2EA 1HNZF 2XC9A 4LFCK 2DPIA 2WSEC 1AYEA 4UT4A 4QU6A 2G0CA 4DI6A 3PJWA 3PHTA 3QT5A 4ZP6A 3WXJA 1HYZA 2E2NA 3D45A 4M45A 3M8RA 5AFUA 5M2RA 2FBXA 2GMLA 3W60A 3CCVN 3C15B 4EZ9A 4FWRA 4NB4A 1E6VA 2MQLA 1YJ7A 5JVGL 4DFPA 4WYLA 3M1FA 3R6LB 4IO1A 3O1LA 2OJ3A 2NUHA 2KYXA 4RKUC 4URSA 3I56S 2CQDA 1B0VA 5BYSA 2UXDK 3TJAA 4JI7J 5KFJA 1T3OA 3F9MA 3IFEA 1YUWA 2A1BA 1PBUA 2G8FA 2XSFA 4JI4J 4USIA 2MLYA 1VQOS 4CK3A 3LTOA 4K8XA 4ANDA 5IS2A 1VSKA 4DR6K 1KTVA 3ZTSA 3NBPA 3QGIA 4ZVGA 1B7YB 1J5EK 1FRHA 4OZ0A 4KHPF 3V9WA 3HM9A 4Q0BA 3KKFA 2R7SA 3HHEA 1RDRA 3MR5A 4I6AA 3OR1A 1IKWA 4K4TA 4CI6A 1RBAA 1ZM3A 2JNJA 3OYKA 5K8OA 2H3GX 2HBQB 5HO4A 2O8BB 2RRBA 1GLFO 4CLWA 1NK4A 4RCHA 2KZMA 1RDWX 3D6FB 3TPQA 4LF5J 2YX6A 3BZQA 3LP0B 5KGXA 3PTWA 1HBMA 1NKCA 1RDAA 1UCNA 4B3RF 2KW4A 1L3KA 1YAGA 1RT2B 3V9XA 4EP4A 1N0VC 2F40A 1NGEA 4ZA1A 4Z7YA 3M2UA 3HVTB 1WAJA 2YHWA 5C7PA 2IBOA 4FF4A 4U9RA 2D1CA 3CJ8A 1T3NA 1ASVA 5ETKA 3JSMA 2BDPA 2WONA 3F44A 2F8TA 5IT0A 4J9VA 3RBXA 5JS1A 5HLFA 4C8LA 5F0UA 2F4FA 1RHUB 1Y00A 2QZ8A 1HNZJ 2MKKA 4CE9A 1FDDA 3CD6S 3R3LA 2NZCA 2XHWA 4NXNJ 1Q4RA 3O1BA 3CCSS 3E9LA 4W5TA 5CZ2A 3KMQA 1V5VA 3VV2B 2AGQA 4BWMA 2I0XA 1R89A 3KKRA 3TANA 1T0TV 1HWUA 2O1PA 3TO8A 1E3MA 5A8KB 1DTTB 4AH9A 2O4IA 4KH1B 3D0HE 4Y3CA 2F96A 4GMKA 2Q36A 3ILJA 4WKYA 4JV2A 1Q8IA 3MUVP 1KEKA 2DXEA 2E4LA 4RWWA 3L09A 2F4VK 4RW6B 4I2PB 2XI2A 3ZCMA 1Z2LA 3AO3A 4EYHB 4HUFA 4K4XA 2D9PA 1C1AA 4G1PA 3W9HA 1C0TB 3SFGA 1G15A 1WI6A 5EXWA 1CS4B 4M5NA 2RILA 4X4QA 3U6FA 4M63C 1KLNA 1RT1B 4HHTA 4X2BA 3U1NA 4J91A 4CEQA 3HSZA 1TKXB 2C28A 1U2CA 2MKYA 1EP4B 3P8BB 5KFAA 3D68A 4ECZA 2E8AA 5BR8F 3A8KA 3J81U 4M95A 1WG4A 3MX2A 3MEDA 4B1VA 3L0QA 4CNYA 2XS5A 2WCXA 2RH3A 1R8CA 3FBFA 1X4CA 4PKGA 3HSCA 1UJ4A 3M30A 3DOKA 4DR7F 5H1SQ 3OQ2A 4NYPA 1ITPA 4ECUA 1UPMB 2J9CA 4MO5A 5C42B 5AQKA 1LQ9A 3HFZB 3KUHA 1MA9B 1LXJA 4F36A 1NM2A 2F9WA 1KD1T 3PFEA 4YMEA 2ZH9A 1UW4A 3VEOA 2P9EA 1VQ7N 2RE1A 3Q23A 4CZEA 1T9TA 4B3RJ 3AFGA 1HR0K 3S3MA 5KFUA 4V1Ak 1ZM2A 3AOCA 3K2PA 1XC3A 2Z58B 3IG1B 4JI6K 1X8DA 4KHSA 3BO4A 3A12A 1S1TA 2O66A 2LU1A 3DLKA 2HRYA 1NGFA 3NGDA 2W25A 1FDNA 2NR0A 1WNEA 4PKIA 1BCMA 4G3IA 3O4WA 4NCGA 1OH8A 3KJNB 4UZBA 3D2WA 1X60A 2VU5A 2QG9B 5J2PA 3ZTOA 4ZVSB 3BV8A 4KV8B 3FZHA 4JYAK 5BPNA 3HJVA 1KFDA 4LBPA 5KT3A 3QMLA 4CZCA 3ZEUA 3A3NB 4AL5A 2AKWB 1JK9B 1YJRA 3V81B 3R2DJ 3MOZA 3SI6A 5A8RB 3PR4A 3CETA 4CJ5A 1HNIA 3RB4A 1N33F 1FI4A 1WI8A 1SH3A 3PCOB 3RB3A 2ZC3A 3BYRA 3BGRB 4CYUA 5AQSA 1XNRJ 5E33A 2RAQA 3QGGA 1K47A 1PAUB 2KHDA 3CNQP 5A0YA 3LPTA 3SEOA 1S7IA 4UOCA 1YTAA 3O9UA 4KAZA 1J27A 3AVMA 1QAYA 4U8YA 2OD4A 3WNGA 3DC2A 4BCAA 1UWAA 3OT9A 3KHGA 4M3TA 2L48A 1QD1A 2WOMB 3MR7A 3VGSA 3RRKA 4FWNA 2A2DA 3CULA 3D6HB 3AVFA 3Q8RB 2ASJA 4JKBA 2LKZA 4C8KA 4OYPA 3ULDA 3R27A 3O3HA 1VQ9S 3CCQS 4FK4A 1GMWD 1KAYA 1S9GB 2LCWA 4DR7J 3HSGA 3HKZD 3RMAA 1RTJB 3FQLA 1ZYQA 4A2BA 4KBOA 4DV2K 3SQGB 4NEYA 4AE5A 3T1HK 1UA0A 3CMEN 1NM1A 3POTB 4ZVFA 2UXDJ 3P38A 5A2QO 2HHPA 5AE3A 1X0PA 1B99A 2V68A 3LF0A 3J81Y 3RVCA 2DH9A 4H0PA 2QMUB 2E20A 4HHHA 4R0EA 1S10A 5KFOA 1F9HA 2BE9B 4K25A 1HPZB 2GIRA 1VCTA 5BRDA 1RGIA 3C8YA 5EX0A 4EP5A 2O5DA 2VZ9A 4O0JA 3O6WA 1WD6A 2HGLA 3ILIA 3AOAA 2LSNA 3U1LA 4PG7A 4J9MA 1AB8A 2MZSA 3HMJG 1C0UB 3P45B 3GMGA 2NNWA 4E98A 3SJJA 4HACA 3V4IA 3K2YA 2P9IA 3GYGA 1EHWA 4XTTA 5F8GA 5IM0A 1RE1B 4WU2A 1LAWA 4U96A 1Q53A 3MD3A 3EPGA 2CPXA 4M41A 2MQPA 1YLXA 1HBNA 1N33J 4FZVA 1NNDA 4DV4F 2ZOFA 4WF9Q 3PZPA 1S7HA 1XMQJ 5DQHA 3T5JA 2R3VA 2HVHA 4RG8A 4PQUA 2A3ZA 1F5BA 2X51A 2GQCA 3CB4A 2X6NA 3U4LA 2L3MA 4N5SA 4O23A 4L3KA 1R0AA 1N88A 3TSQA 4JV0A 2DHAA 3QRRA 2RHKA 2U1AA 2LQ9A 4FBUA 4FJIA 2HHVA 2D0CA 3IRXB 3DMJB 5KFHA 3W2VB 4DU8A 4UZCA 2HBKA 2DK2A 1JLCA 4I67A 2BW2A 5AQFA 4DTSA 3IR7B 4F26A 2CWXA 1BG3A 4UUWA 4WQ4A 2D74B 2GAHC 1PIEA 3H20A 3LDSA 3WC0A 4CDIA 2VBXA 4EHTA 2JLFA 4FF2A 2E29A 3GTYX 2JVOA 2DNZA 2JRSA 1LWFB 2W9CA 3FCWA 1OY8A 5KG2A 3BYPA 3PIPQ 4IO9L 4ILLA 3BEGB 4E0DA 3ZSWA 3V1OA 3HSDA 4ZCLA 5F0XA 3EX7B 2F4VJ 5B8HA 3THXB 3GV8B 2Z57B 2H5JB 4CJ4A 1C0FA 1REGX 4CT8A 1KVAA 1P90A 4XH1A 3JTNA 3VVUA 2FHJA 2NQPA 3CW2C 3RSEA 3MTKA 4PABA 3EDQB 4Q45A 4M5IA 4GVBA 4RUBA 2GGPB 1MN7A 1IJFB 2LDYA 3WQTA 3QEXA 4OX8A 3ZTQA 3MN7A 5D3GB 2QLFB 3KK3B 2VQFF 3FNNA 2DJWA 1X9JA 4USUA 3TAEA 4X64F 2LECA 2QXLA 5CQGA 2DNPA 1FNXH 3A0IX 3DRSA 3MZIA 2YQ1A 4O3SA 3TZZA 3FCHA 3EN9A 4NLBA 4LRDA 4BC7A 4JRPA 3JQJA 4GV3A 3SMSA 4P52A 3KMSA 1ROFA 1Y11A 3GIIA 2MZQA 5A8WB 1HWJA 2WFBA 5FROA 1NK0A 2M3DA 2I2YA 3JTOA 2OPRA 2W8KA 1O8BA 2B0GA 4FWPA 5CXTA 2XO6A 5GIPA 4LF4K 3IAM9 5K14A 1JCGA 1ASUA 3CQXA 5AJ3K 1EKEA 3IMQJ 1PG5B 4YP3A 4CGJA 3VAGA 3NRBA 3ELHA 5M1QA 4KH5A 3RG6A 3MCMA 3CM6A 3O9RA 4TLRA 1FRLA 2PFDA 3PHEA 3R8EA 4X62K 2R7RA 1YKWA 4X66F 4DF4A 1ZA2B 2DT9A 2ZDPA 2MKIA 4L6V3 2SXLA 2QRRA 5DM6L 4S0MA 1RWPB 4JYAJ 3OBIA 4F8RA 1RBRA 3A2FA 1WSGA 4DPYA 1HWLA 2N3OA 2VD3A 4CM2A 3DDIA 1OH5A 1RT4B 2CNLB 2PAVA 4XK8C 1CJTA 3FZBA 1S9FA 1CJVA 3D67A 5C24B 2OPPB 3VQDA 3NMAA 4F02A 4O3QA 4K5SA 2VFRA 2ZUAA 1DQAA 1S76D 5MLCV 2VOPA 1KNZA 1RHKB 2V7ZA 2W2PP 2IVFB 2DEIA 4OPAA 2IRYA 2QWPA 2WUSA 3D54A 4OYIA 4BG9A 3OTDA 3UD5A 2Q1LA 1WSIA 4KKOB 4ZITA 2RS2A 2ATLA 4OIXA 3W63A 5KT7A 3TA1A 2FVSA 1H2VZ 2JSXA 4HHUA 4DU7A 1SL2A 2H3EB 5G0RB 3KLIA 3OVAA 2OFHX 3MMCA 3I8BA 1BDGA 3FJ2A 3QT7A 4BRGA 4FF1A 1VQ6N 4H4MA 2OP5A 3M3ZA 3MMJA 2NUUG 1IWAA 4ANCA 1VQ8S 1TUYA 4QIWD 4KFBB 2HMIA 2BUNA 1HUXA 2RN2A 2ZM6F 4ED1A 4CGHA 2JWNA 3L9ZA 3RJMB 1FRXA 1IBLF 5LMUF 1XEZA 2D3UA 5KOXA 2XY6A 3I4PA 2E1CA 3LPYA 3NNCA 1SKUB 1NDLA 3EUNA 3PRVA 2XEXA 4J2BA 1BOTO 4JI3F 3RR7A 1P9YA 4OHWA 3UI3A 4IFYA 3BKTA 3ZSXA 4GKJK 4IWVA 1SUQA 1NHKL 1FXDA 5EDWA 3KHRA 3CI5A 1U1QA 1GK8A 2XO7A 4ZP9A 5LMNF 3HHLA 4JI8F 3VQBA 4CFCA 3JXOA 4X66J 1NPPA 4R5PB 5F3TA 1FW6A 2OGUA 5CA5A 2QMWA 4Y65A 2VUGA 1RAFB 4DV3F 2X7IA 1TL4A 1ULRA 4BGAA 2GIQA 1LXNA 1YHQS 1A9NB 4YOVA 5AQIA 2OEJA 3H59A 1DLOA 1U09A 3UCZP 1RWNB 2QA4S 1VBZA 1O1WA 4BC9A 4U95A 3J80U 3MAAA 4W5OA 1DTQA 2P9SA 3CIMA 4OHZA 3JTPA 3W2WA 3IAYA 2YBVA 3UN5A 4YHHK 3OR1B 1IKWB 1VQ4N 3P3DA 1U6FA 3TWHA 2UU9F 2Y1JA 1EKRA 2HOEA 3CJ3A 4LMZA 3OR2B 5ETPA 2NZ4A 2V2VA 4WFZA 1BQNA 3CPWM 4NRTA 1QS4A 6FD1A 1HYSA 4KTZA 1K8KA 2O8CB 4PXDA 3D6MB 3M6XA 4MIWA 4WFNQ 2JX2A 5J1PA 4E7LA 1NH8A 2P8IA 4KYZA 4JI5F 2P9CA 3KJQB 3UVJB 2FJDB 1NGAA 4ZPWR 2AEMA 1H1VA 1P9QC 2W9BA 1N34F 1S99A 3O9TA 1HQUA 3JSMB 4EZ6A 2BOPA 3NGRA 1KP6A 1KLMA 3DN9A 4FW2A 3CMQA 4C48A 2M2BA 3P4UB 4DHYA 3KHHA 4QPXA 2BH1A 3CC2N 4YDDB 4K8RA 3V2UC 2BE2A 4Y1CA 4GNIA 3MCNA 2H54B 4JI3J 3KUGA 4LSLB 4GKKK 2KXHA 1NO8A 1FK9A 3TVKA 4JBCA 3OVSA 3WNEA 1LWXA 4H54A 1RADB 5IT9O 3D0IE 5GADU 2CYYA 1OQ6A 3KWIA 4LVOP 5LMNJ 1Z6RA 3EJMA 5J2QB 4DTOA 1QSLA 3DLLQ 4DKWA 5GAEP 2FZCB 2HBZB 3OYMA 4TXSA 1YI2S 2J8SA 1ZAVA 1FJCA 5ETOA 4NMLA 1RLDA 2JWKA 5GAGU 1UA1A 2CGLA 4Q5VA 2CGJA 3D3BJ 1YJUA 3PW0A 3OJUA 4OZ3A 5CYJA 1FD2A 4DV3J 3ENHA 4A47A 2MQQA 3PX0A 4ETXA 4GW6A 4LF4J 3MEEB 4Z4EA 3A8YA 4O44B 2ZWPA 2IC3B 5AJ3J 5C12A 1JLFA 3CJ2A 3PEJA 1ELOA 4CFBA 4EAHD 4CZMA 2FC0A 4H0YB 3DOLA 4ATNA 4BRCA 4JKFA 2FVPA 1R8BA 4OYMA 3M30B 1FJGF 1QZ6A 2UU9J 3PR5B 4CJVA 3VCDA 2DO0A 4FK2A 5C2FA 2RQ4A 3PXGa 4K59A 2J0XA 2ZJRL 4QWCA 1U0SA 3JSYA 3AAWB 3UPFA 2QLWA 3J80Y 3HM8A 3S3NA 1XHXA 3TUIC 5FPDA 5D8HB 3ZX3A 1SQEA 2KH9A 3VQCA 4FL9A 1PO6A 3ZT3A 1B9FA 2WBMA 2ZQBA 4JI5J 2BANA 4XDDA 2HS4A 5L46A 3CQYA 3IS9B 1MMDA 3QJPA 4EO6A 1NGJA 1CC7A 1TL7A 3IRWP 3PRDA 5CYQA 2K8GA 2VKRA 4HH0A 2B4JA 1QAXA 1I3OB 3GCXP 3MM9B 4TY8B 5KFPA 1ZBIA 4MIAA 4OI2A 4DFJA 1HNXF 1LWCA 3ZEUB 2BRLA 1NAQA 2QWQA 2V8VA 1HNIB 2OMOA 3CCRN 2IJNA 1I94F 4L3QA 5GIOA 1YRUA 2PMWA 2CJXB 5A6WA 2P9UB 4UY8T 4ZCKA 4Q44A 1TFWA 3IR5B 2FBYA 2FJVA 1QJHA 2BX6A 4HTIA 5DM7Q 1WKJA 1RHQB 1M90O 3ZZRA 5KQ8A 3A1YG 1S97A 1VQKN 1VLYA 3EKUA 2G8WA 4PUOB 3Q83A 5BN9A 1BU6O 4OGCA 4KY3A 1RWXB 2A0FB 3C66A 3M9MB 4U6PA 5IT4A 2AEJA 1FKOA 2AGOA 4DG1A 2FJEB 3SIPB 3NY0A 4FJ8A 1RT5A 3TUPA 1IWGA 2AX0A 3NS7B 3TR5A 4GKJJ 2VG6A 4U7UD 2Y8YA 3UD4P 1T05A 2XB2D 3NP5A 2DH8A 4DL7A 1S4EA 2B56A 5SUHA 1I5OB 2WVBA 1FJGJ 4G65A 3VF2A 1TZ0A 1UVLA 2G2OA 3CXCM 4PG5A 3OUYB 3QIOA 4X4OA 1C1CA 4C7QA 4HTJA 1JMTA 4A8MP 1UZHA 4CIOA 2MB0B 4QW8A 1VK0A 2NYHA 1QUPA 1KKHA 1RYSA 3OHBA 3QEWA 1JCFA 1U1LA 4ID5B 5FD1A 4U7BA 1PILA 2ACMA 4FYVB 4DV5F 2NSCA 3R8YA 3UKUB 1QM9A 4TKTA 5F8JA 3CJ5A 2FF3B 3SAGA 3ENBA 4ALZA 2WK4A 1N5TA 1J9AA 3GG1A 4MDBA 4K2XA 4B9LA 4N56A 3HPHA 1UOCA 1M1KT 3H42A 1YITN 4W5NA 3IDHA 2W2OP 1MU2A 1HX1A 1LAVA 4BC4A 1JLQB 4WBFA 2QA1A 2FJXA 5IM0B 1VRQC 1HNXJ 3OXGA 5HVGA 4ELTA 1Q7YO 1MROA 3HDSA 4IRDA 1WAFA 1VQ7S 2DR6A 2HFVA 1UAXA 3LZJA 1HBNB 2AJ4A 4DS5A 3TA0A 4BR4A 3H6EA 4QWEA 1O0PA 3M6VA 4RL1A 1S9EA 4B8CA 2RQCA 2XI3A 1XR5A 4X4PA 2YHYA 1VGYA 1XTZA 4PAAA 2VJUA 1U1PA 2MZJA 1BUPA 3ZZ0A 1UZDA 3WX8A 4CNZA 1GEHA 1ESVA 2XGQA 2V2ZA 2V9KA 4C98A 5AQVA 3Q24A 2ZNYA 3QIDA 1NCLA 2MKJA 3ZLJA 4A8KA 1T03B 1WHXA 4NLXA 1Q82T 4MQ3A 1S1UA 3G6EN 2BJ8A 1JLCB 1RT6B 4DUYK 2W2QP 2OKQA 2Z1GA 2R7QA 2LMIA 3EXYA 3A8JA 2HMPA 3AVGA 1GLCG 3IWLA 2BACA 4M5DB 2ZZNA 3QB0A 1RCOB 2P5OA 2HIQA 4DR1K 5JICA 3NMUA 3O5BA 2QLXA 4IEIA 3EWGA 2W9CB 1IG9A 2HB5A 3DRPA 3BGFA 3CDBA 3NAIA 1XC9A 4CRJA 1U0HA 4F50A 4ZLJA 3CIPA 2WAQD 4FSVA 3E1YA 2OPSB 3SQ4A 2A1RA 4BVPA 1RISA 1EWRA 5FDLA 1V6HA 4IG3A 4ZIWA 4LSZB 2X1GA 2P9KA 3CJRA 5HROA 2DCLA 3VGVA 1F6TA 1XMBA 3ENWA 4NLDA 4RZRA 1Q81O 3QEVA 2RQMA 1VR6A 3OV7A 2XYGB 3UCUP 1Y0HA 2NXNA 4QZVB 5KFBA 2W8LA 4HH1A 3WUHA 1HNVB 2CQGA 3A3PB 3E3XA 3EXCX 1IBMK 4CM0A 3PYEA 4U8VA 1HD0A 3GOIA 4P10A 2E5IA 3L8BA 2YHAA 4DV6K 1YSJA 1C4CA 2IHR1 2P5GA 3M7VA 3E66A 3C94A 1NU4A 4U7UK 4CK2A 2B4UA 3AD8C 2E2OA 3M5RA 2Q1NA 3QLHA 3BBBA 4ETZA 2VA3A 4WF9L 4CT9A 1QQCA 4E7KA 2AF6A 2BW7A 3MMBB 3EGZA 3CM5A 1YZ6A 4OL8A 2ZH5A 1WBBA 4WU3A 1M5OC 4USJC 4OLBA 1G6BA 4FJXA 4CGIA 4GV6A 4URGA 1VQPN 2EK1A 1G2EA 1XNQF 4Z4CA 3DRYA 2J4RA 3EYZA 1LFPA 1SC6A 2CWKA 3MECA 5T7LA 1WOPA 5DG8A 1WSHA 2UUAF 5FPMA 4F3TA 4DZ6A 2FSJA 3OVBA 4DZDA 2HNYB 4MAKA 3TI0A 4LQ9A 4F4ZA 4CLKA 2VG7B 2DNKA 3T1YF 1DAXA 4AHUA 4QYZK 1CG2A 1WG1A 1KS2A 3P83D 3DKDA 4DBQA 1TL1B 4J7CA 4UW2A 1RAJA 1LW0A 3GDQA 1RHMB 3US5A 2QL9B 4H4OA 2GHVC 4K41A 4I64A 4F7VA 5IWAK 2QYGA 3ULHA 5EN1A 4G9ZA 4Q2LA 3G0ZA 3QBCA 5KFNA 2HVDA 4A8OA 3PW7A 3N4PA 1TUGB 4OZ2A 3HT0A 1SVDA 2DGQA 4Q8FA 1RBTA 2JGUA 5BRFA 1HKGA 1XR6A 2AQ4A 3G71N 4YY3K 3UNGC 2VICA 3IP0A 2RDJA 5B0AA 4J9KA 2CQ3A 3J7YU 1WHYA 2XY8A 2DHHA 1C0MA 3G8SA 4DQ8A 3MHYA 2KM8C 4PRFA 1Y5LB 4NOHA 4DOZA 5KFEA 4M7YA 2ZE2A 4NWBA 4M7XA 4OX9F 3OD2A 3HP9A 4AHSA 4M42A 3KLIB 3EVWA 3N5FA 5B0CA 3AVJA 5AQLA 5DS7A 4FZZA 4FXDA 1URNA 2Q43A 1HYVA 4CBWA 4DL3A 2C3MA 3AJ2A 4EEYA 4C0BA 3P31A 3VQ6A 4KHYA 4DR2F 3L2VA 1IUJA 3G86A 3MWPA 4Z4FA 1HA1A 1SPBP 3NGUA 2HMIB 4MFBB 1Z05A 2IY5B 2VOOA 2KXFA 4LF8K 3NVMA 1F1BB 1M5PC 1LWEB 3TX0A 5F9LA 3RW6A 2ASPA 3UB5A 4CQ1A 2KG0A 3T1AA 3C6UB 3PYGA 2FSKA 4PR6A 3CCTA 2WBRA 1S12A 2D3ZA 1ZTTA 3THPA 5B7WA 1RU2A 4IH5A 4IFYB 1Q5VA 4LF6F 1FESA 4ZHRB 4JV5F 5KPZA 3CCJN 4DSIA 3MEKA 4DV0F 4FJGA 1NB2A 3RBDA 4BRQA 1HMVA 2V94A 2UUAJ 1ATRA 2WB4A 2HF4A 4WFXA 4Y0WA 2GVDA 3HHLB 4A57A 2HF3A 4IJNA 3TW0A 3LALA 5JJBA 1U2VB 3WXMB 3JYTA 1BQMA 5HRRA 3MX5A 2DR8A 5ADXH 4DN9A 1U26A 4B1XB 1NDPA 1VSDA 4IDKB 3CD0A 3O1WA 1LEOA 3T9ZA 3TSPA 1SV5A 3NGZA 3CGIA 3QRQA 4RBUA 2EKYA 1U24A 3AH6A 4LY7A 4HLBA 1UJ6A 3CDAA 1DLOB 4QR0A 5K8MA 1TUUA 2FZGB 4A59A 2WZ1A 5AQQA 2E66A 1ZM9A 5KG0A 2VWKA 1C0GA 3DYAA 3C19A 2MLXA 5K9FA 1M5VC 4P9SA 4IXCA 1N52B 2IVMA 2BJEA 3NEKA 2PEBA 1R0CB 3AY0A 3HI0A 1HWIA 2NRTA 1WC5A 1D9FA 2Z8QA 3LGMA 3QFHA 5AXMA 4J9PA 2QC3A 3VQ9A 3P49B 2MEWA 1XWLA 3SNNA 1JL1A 3QSYB 2XWXA 1FEEA 3I56N 2HBYB 3FDSA 3UE5A 4WCEQ 3GJSB 4CHOA 1R27B 4PXBA 4BGBA 4OX9J 4WE1A 2Y9HA 3KLHB 4HT5A 2DGTA 2G2YA 4DU3A 1K8KB 3I0SB 2RF2A 1VQON 4LBHA 2JZ5A 4BE2A 3BGOP 1SIZA 2DNMA 2E5GA 4IOCQ 4A8SA 2CNOB 2B3TB 4JI0F 2QWMA 3I8DA 4F2RA 1T94A 3L95X 2EK6A 5FJ4A 1HQUB 3VENA 1VRTA 3OL8A 1NHUA 3N01A 4C3LA 1VK3A 1LFWA 2GCFA 2YHBA 3FZ2A 3MM6B 3BDEA 4TLQA 3CFPA 3HL8A 4B3SK 4CHNA 3VQ5A 1QAIA 4Y2IA 4LF6J 3VAFA 4CLUA 3G25A 4JV5J 2PMZD 3H5XA 1IBMJ 1OO0B 1TGOA 2D0PA 1IBKK 3QIPA 4BC5A 3N0VA 4DV6J 1RYRA 4OJGA 4Z7CA 4F4YA 2F1FA 2NYIA 5B0BA 4HKQA 3UFCX 1VBXA 2WTFA 1B64A 1HI1A 4WQ4C 1U6BA 4ED8A 1FX4A 4CERA 2R8JA 3HD2A 2P9LB 3MK6A 4Q7AA 2NXJA 5KPRA 5HANA 3FCVA 1TYQA 3AA8A 2KVIA 3MEGA 1SKWA 3TTFA 3THYA 3V1QA 4B1UB 2FBVA 1T6DA 3SJHA 4KPYA 4ZLNA 4QR2A 4LREA 5D78A 1FO1A 3GE9A 4ZVEA 3CCSN 5FPEA 2W2MP 3EGNA 2J6SA 1JLFB 3HSJA 1HHSA 4UQTA 3OY9A 4ID8A 3EO3A 1K73T 1IH7A 3M8YA 3D7SB 3N4WA 4AQYK 3K0JA 4CJ7A 4NLCA 4F4AA 4FOIA 1KCFA 5F9NA 1TFYA 2B6AA 4PG6A 4WFNL 2M8HA 2W4PA 4CIEA 3PSIA 1JLBB 5KFQA 1IM4A 1OSDA 3GG0A 1H2UX 3ETOA 4EMDA 2DFEA 2FSNA 3VEVA 1BY9A 4B1ZA 2W4CA 3TTDA 2DNYA 4FPAA 1GLJO 1JLGB 4ANEA 5IWAJ 1WJ9A 1NK5A 2WHOA 1BWVA 2M5YA 3DOMB 4JI0J 5IV4A 3SAFA 4QQBA 5CH7B 2GAGC 1JJCB 1FXRA 3N6LA 3C15A 4RLEA 2FTRA 1RILA 3ZSZA 4MKYA 1VQ4S 2DY9A 4KC5A 4OZ5A 2C3PA 3V9UA 4DX5A 4E2FB 2ZZMA 3MN6A 4YORA 1PC4A 3EE8A 3KVGA 3AD7C 5EWEA 3QRPA 2MKSA 1K8AT 3DLLL 3O9QA 5AQHA 3TZXA 5CYMA 3EZUA 4ELVA 4AYBD 2NLWA 4KGVB 2F3JA 3I55S 4K4SA 4IQXA 4P73A 2V8HA 2R8HA 4IR1A 3RB6A 2A6OA 4ZVHA 2Q6CA 4BR5A 1NU0A 5AQXA 4DTRA 4ECYA 4CLTA 3BPDA 1OWXA 3KG1A 2UVVA 4NO7A 2Y0BB 1JWWA 1IQZA 2FBTA 1Q7LB 3B4MA 3DFEA 4HEA9 1H73A 1RACB 3TTCA 1K9MT 4DPXA 2ETJA 1SL1A 3AQOA 3N5BA 5GMKa 4MK9A 2GV1A 2C2KB 5KT5A 2EFNA 5CZXA 2HNZB 1FKOB 3LAKA 2O8BA 2AYEA 1JJ2R 4RNMA 3H25A 3CPWR 2P2CB 3FZLA 3OHRA 4M3WA 1WUUA 3LP0A 2NCKL 2C22A 4P6QA 1ACMB 3NGKA 3GV5B 2JDJA 4CECA 2PA8D 3ZT2A 1RT2A 2HQIA 5HVHA 2FYXA 5GAHI 3HVTA 3PW2A 4Q43A 3AO5A 4JKAA 2RQKA 3M9OB 4KRFA 4RBTA 4OKJA 1AW0A 3W66A 1S6OA 2VQEF 2BTFA 3R5BA 3J81O 5C0YA 3BY5A 4CGDA 1C1CB 4NX9A 2E9RX 3C16B 1RA6A 1P6TA 2HKEA 4A8FA 4CLSA 3ULEB 2ADCA 3RRGA 3GV7B 4WQ5A 4ZP8A 4DQIA 4FYXB 2GVZA 5KFYA 4ZN1A 3BQ0A 1LW2B 3HO1A 4FLVA 4YB7A 1T9YA 2JLEA 1ZM4A 2Z2MA 5GINA 2B8QA 4R25A 4FWMA 1SH2A 2RU9A 1F3VA 2R7VA 3NWRA 2Z1JA 1VQ9N 5A8KA 1DTTA 3NGIA 3CJQA 3F5TA 2EC0A 2JJ4D 1T44A 2HZVA 4WZMA 3CERA 1R8AA 2KFZA 4DX7A 3WX4A 3L2WA 5AQJA 3ADAC 3O44A 1GXLA 1RWWB 2FLNA 4I2PA 3AA4A 1SB6A 5C25B 1MROB 4BVOA 4B02A 4F4WA 4PKDB 4C8ZA 1NBEB 3GSDA 5DM7L 3HHLC 1C0TA 2GQQA 2ZDOA 4BG8A 1CS4A 2LLZA 1RJJA 4RW4B 4CF0A 1RT1A 1R43A 5LJ3Y 2WC9A 2ASLA 1S9EB 3MM8B 2HVZA 2DD8S 1TKXA 1IKXB 5KFWA 4ECVA 5JMNA 3KJVB 1FFWB 1EP4A 1KHVA 3D9BA 3PDNA 1YTYA 2IDOA 2PFUA 3DRXA 4DV1F 4OV1A 4AF1A 4L74A 1WTBA 1GLDG 2DEJA 3AJDA 3JSRA 4B3MK 2YH1A 1HI0P 2RDIA 1HKCA 3ONQA 1P8GA 2MQ8A 1KVIA 1C2PA 1RUSA 3IAS9 5C42A 5F8NA 3GG4A 1L3TA 4WWSA 2KHOA 4B3SJ 1XMOF 3TJ8A 1ZAWA 1R6YA 3NS6A 2YKNB 2H9ZA 2CKWA 2PMHA 2CZVC 1IN0A 5M1PA 1HNWK 2CPYA 1NGHA 2HG4A 2R2RA 3MAHA 5L1JA 3FSYA 3IM9A 4QIGA 3PIOQ 2IS3A 2B4PA 3N79A 1U7LA 2WBNA 3RRHA 3NXZA 3IG1A 2H1YA 4KH4A 4YR3A 2VQEJ 1T9XA 3V6KA 3NH1A 3CFOA 3D7EO 3CC7S 5L9NA 1HW9A 2DNNA 2AJ2A 4KRWA 1E6YB 2A3JA 2K06A 3Q22A 1W7WA 3W0LA 1WB9A 6AT1B 5FLXU 4KV8A 3HHNB 2IJFA 3NL0A 3ZTRA 3MR2A 3H45C 2XCAA 3IC1A 1EJ7L 2H5EA 1JXLA 2R4FA 8ATCB 4HI1A 1NRKA 2KFNA 2D0OA 2O67A 4JKHA 2WSCC 2QXFA 4ISGA 4OPJA 1YRXA 3K5LA 4ID1A 4H4KA 4O3RA 5FIIA 3C0BA 3MUMP 2I38A 4OV6A 3AA2A 1U1OA 4Y6IA 4I69A 7AT1B 1RABB 2GX9A 3V4MA 5DJBA 4FJJA 4LRCA 4OMFG 4KH6A 3UIQA 2V34A 5KFCA 1MNEA 2VPZB 1UEVA 3DLGB 2KB2A 4FJKA 4C3MA 4WFBQ 5AR0A 1K0TA 4CZIA 1O13A 3Q86A 2N82B 1MDUB 4OGEA 1N8RO 4DV7F 2HGMA 2WOMA 4CEOA 4UOGA 1ZTWA 4B9NA 4ED4A 3B82A 3DAWA 1XBWA 4CHQA 1CSJA 1SL0A 4KREA 3MECB 5T7LB 2WVDA 3BN4A 3LGNA 3NWGA 1RCHA 4A2AA 5EWFA 2NSBA 3LP1A 1XUPO 1LOTB 4KT0C 3KK2B 4ZCMA 1W25A 1Y4ZB 4FJHA 3U02A 1S9GA 3G2XA 3CXCR 2C2ZB 1KC8T 1T6CA 1O6XA 2ZJPQ 1U1KA 3R9LA 2BM1A 2LQ8A 3PW5A 1Q9YA 5AQRA 5D77A 1H38A 1XMOJ 1DFDA 3FEZA 4Z4HA 4JD2A 2CZ9A 2HHWA 3G6XA 4H4OB 2AP1A 2E7VA 4DU1A 2PYJA 4BRLA 2GEMA 2NRHA 1CQNA 3O4NA 5HSPA 2KLAA 4WXOA 4YOXA 1HPZA 1FNMA 3NDKA 1S0MA 2V7YA 3E8OA 2RVJA 4DL4A 2AYMA 5KTQA 3NCPA 4DR5F 2F8MA 1VSEA 2OHDA 3Q8VA 2Y3YA 4H5TA 3CF5Q 4JKDA 4O3OA 5IV3A 1C0UA 1CEZA 2AJQA 2CQHA 5DLGA 2DHGA 4JP8A 4K0KF 1RBSA 4F9OA 4DR3K 4BRNA 2D1KA 1UEUA 3QWPA 4J9RA 4K5RA 2AJ1A 3LDOA 3O8MA 1AA1B 3M6WA 3Q8PB 2E1ZA 4U67Q 4LFBK 2YWWA 4ECSA 3SBGA 2POKA 4BE1A 2QLBB 5I3UB 2ABYA 4WP9A 3KTQA 2EG1A 1BISA 5HJXA 1NJIT 3QSIA 4EBCA 4C3KA 4CJKA 2YX4A 5FLXY 3H2UB 2XS7A 2GX8A 3CDEA 3RBZA 5EX5A 4RU2A 3HT3A 5SZTA 1TTHB 1OS5A 4TQRA 3CMAN 3OBWA 2N4CA 3OFEA 2BYCA 2EX3A 5DLFA 2OPQA 3BGLA 3TQEA 3BB5A 4IBNA 3DMJA 1LK5A 4OI6A 4DV7J 1J5OB 4ELUA 4UF4A 1Q8LA 3W2VA 4CZGA 3NVKA 1MG7A 5D4NA 3MF5A 1UEKA 2V6AA 2EI5A 1V9OA 2P51A 5B09A 3LPUA 1FJEB 4ITSA 5LL6Z 2PD1A 4ED3A 4BRMA 2HQ3A 1HMVB 3QZ7A 2UXBF 2FDNA 2ZFHA 5DG9A 2G8IA 2GVDB 5LSLA 3WIVA 2NZTA 3Q7BA 4FK0A 5CD4H 1FRMA 4XDCA 2VC0A 2ROGA 1VQ8N 4DL2A 4YB5A 3BF1A 1FDBA 1PJ7A 3OTBA 3OTEA 3VEXA 3QFPA 1TK5A 4NA2A 4USTA 5AQZA 3MM7A 2H4WB 2OI2A 3SXLA 3K5NA 3KK7A 4BRDA 1BQMB 3AB4B 1IR1A 1NJXA 2QKKA 5H9FJ 3GIJA 2DPNA 1D1UA 4QPTA 1QQOA 2F9DA 3VTIA 3THXA 1FRKA 2Q3PA 3W9JA 2VASA 3Q8UA 3K5OA 1RI7A 2MQMA 4NA3A 1ZH5A 1S48A 5JLFA 5HL7L 3NG8A 5LJWA 3VOVA 5L9XA 1VQPS 4PQAA 4BR9A 2VC1A 1HQ2A 4CLPA 3AVHA 5G4DA 4LF7F 2ZITA 3ZZTA 2OTLS 4DR5J 4E7HA 3MXHP 3VHQA 5AZIB 2VFVA 3KK3A 2VFTA 2C3OA 2IDLA 4B3MJ 1GFWB 2ROEA 1RTZA 3BP8A 4LF2A 2XMWA 3SV3A 4K0KJ 3GL1A 4B8AB 1RTHB 2CH6A 3CWJA 1ZS6A 2XS2A 5AFUH 2DR7A 3GFHA 4NXMK 4BRPA 3V1RA 1QQMA 4M3ZA 4WE1B 2L9WA 2X6SA 1AZSB 2HBRB 3SCLE 2DGXA 1YHQN 3N28A 3GQCA 2ASDA 3CD7A 2D3O1 4ZPAA 3TAMB 2QA4N 4FKXA 3MD1A 4DFKA 3JB9k 4N8NA 5HBMB 3WHIA 4FYWB 4F4XA 1VBKA 3CCES 2FLOA 4P2FA 1CPZA 3WXLA 4DQRA 4G1QB 3SPZA 1S1WB 1VRTB 4P7VA 4JAXA 1RTIB 5LXYA 3ISZA 3U3GA 3D5MA 2UV8G 3OTOK 4ZPBA 3S1TA 5GAEI 4ES1A 1RT3B 4CLLA 3B6OA 1JKHB 4FWSA 1BWEA 2A10A 4JI7F 2ZGZA 3H2VE 2W6KA 1WNSA 4JI4F 3D0GE 1RT4A 3F41A 3ZZOA 2OZMA 2X3DA 3QIPB 2HBLA 3ZETA 1Q9XA 3ATVA 1X5SA 2BV3A 3I0RB 5C24A 3I4HX 2OPPA 4H5VA 2VGNA 2OANA 3MPYA 3QO9B 1CVJA 5HQ8A 5D4OA 2MGZA 5JXSA 3CG7A 4D3HA 2QEXN 4GY2B 3S6EA 3CTRA 4MIBA 1WORA 4TSXA 5I42A 3DGPB 4ZVUB 3LOUA 3A5OC 3SUNA 1NK9A 1BA0A 3THYB 2GO8A 4B3TK 1Q95G 4FJNA 1UVMA 1PJ5A 1UWBA 1Q5YA 4DHVA 1VFJA 2IJRA 1JXBA 1GOCA 4CF9A 2KJVA 4LF5F 3M8ZA 2GW8A 3J81j 3OYDA 2BOAA 5C10A 1X4BA 3CIZA 2M52A 1C4AA 1UFKA 3CCJS 2F7VA 1DHMA 4LFAK 2W7OA 4Z4IA 3S01A 4O5BA 3VESA 4WCEL 4ECTA 1ITGA 1Y3JA 4CBUA 4H0TB 1QVFR 1T9UA 3JSBA 3P1GA 3T6BA 1IJJA 4JK9A 3J80O 1YI2N 4FZXC 4KFBA 1WLJA 1YVFA 4U7CA 2R8KA 1TMJA 1S6UA 1QDUB 1NPKA 2MQOA 1U1RA 3O08A 3WQPA 3T5KA 4PXCA 1MLAA 1ATNA 2AGPA 4OYOA 3M2RA 5B0GA 2VL1A 2ZBCA 4CI0B 5EX3A 4BR0A 2IYGA 4IH7A 3DGVA 4HL9A 3MN5A 4RW7A 2DXFA 3D66A 1CC8A 3OSNA 4WIIA 3KHLA 1Y64A 2AZ3A 3W5ZA 2HVIA 2HHQA 3T69A 1QTNB 2DGOA 4EIAA 1MMLA 4NXNF 4OJ3A 4RJVA 4OKEA 1K0VA 3QICA 1FERA 2OO4A 4FJLA 3I87A 4WP8A 2B9XA 2KKHA 4XAKA 4WKRA 2VYPA 2QLJB 1MSWD 2H5IB 4CESA 5I4MA 3CJ0A 1F5CA 2O8FB 4DR4K 4R5PA 1BCOA 4LF9F 5CYMB 3T5LA 4A61A 2UUCK 1VJWA 1M5HA 4ZP7A 3KOAA 4RR5A 4LFBJ 1WC4A 2YKMB 1AUSL 2FXUA 3EEQA 5AQMA 4ZPCA 2OIHA 3ZZZA 3VPZA 1Q86T 1ZXOA 4FWLA 2W24A 1WKLA 3HX9A 1KQFB 1TV6B 2XSJA 1G3OA 2Z1HA 5EVZA 2EVZA 4CH1A 3RYLA 3D0PA 1N6QB 4CBXA 2F8SA 4YDXA 3MXJA 5B0DA 1M5KC 2BRKA 2NRWA 2EBEA 4O4GA 3OR2A 1BMQB 4ZPDA 2LU2A 3H8YA 2N3LA 2OCEA 1S0NA 3PV8A 3MPVA 4BACA 2RHSB 1T11A 2O8CA 2DFHA 3R3TA 1NJZA 2IM0A 2XWYA 2HQGA 3TAPA 5DDPC 2FJAB 2DCUB 3OL7A 4QIFA 3KLGB 3ZSVA 5DETA 1IV0A 4USKA 2QYCA 1NMEB 2BXJA 5HOOA 2AJFE 3UVJA 1D9DA 2G8HA 3HKWA 2BBEA 2ZBIA 2J6UA 2V0NA 4CGFA 4PL7A 4CHPA 2C2EA 4DWIA 1CJKA 3KNAA 2EEYA 4C11B 4JLHA 2X1AA 1O51A 4I1TA 3LDPA 5JVGQ 2EG2A 2V69A 2DNQA 2QX0A 3N6MA 1SAZA 2GVZB 4RPFA 2XBPA 2KL8A 2QW9A 4LSLA 2XY5A 2YY3A 3W1YC 2WVFA 3PO5A 5K5MA 3GWCA 4TU8A 3FUYA 4L73A 3ZSQA 3MAQA 4FXVA 1OH7A 4LSNA 2YWEA 2RB7A 5FRMA 3ZT4A 4OYXA 4ERDA 4CH0S 4XH4A 5J2QA 1FRIA 5KG1A 4WTOB 1AUDA 1P8ZA 4HTLA 1XNRF 3R5GA 5HJYA 4DUZF 1DZ5A 1YZ7A 4ECWA 2V4JB 3CJ1A 4X65K 1S72S 4LF9J 4NLUA 5B0FA 5IC6B 3K5MA 1H98A 5ELZA 3MR3A 3M9NB 3FZKA 3K8VA 1S59A 3KLFB 4R8UA 3G10A 3VAIA 3BZKA 4LFCF 4NYFA 3KWMA 5LSOA 4EO8A 2F5GA 3MEEA 2IFXA 2XGPA 1VQYA 4LIWA 4O44A 3NKYA 2IC3A 1JJHA 4Y28C 4IKAA 1EIYB 3VF6A 3MPDA 3UNYA 4YN3B 3MM5B 4W90B 2A18A 3BH7B 2HRUA 2V63A 1NEEA 4A8XA 4OLOA 2DNRA 1XQSC 2DNLA 5CAAA 3OL6A 1KSPA 4HDHA 2CPZA 3DNCA 2RKIB 4KB7A 1FWLA 1VOMA 2JEIA 3C46A 4FJ7A 3NMRA 2XYHB 2MSSA 1QUVA 1G4CA 2UXDF 2B4OA 1CULB 2QWLA 3CDWA 1NGIA 4JNEA 5KOWA 4C8MA 1H2TZ 2E5HA 4ENOA 2C3YA 3HRGA 3FSIA 4QIVA 3C14A 4GV9A 3AD9C 5HMYA 1T3VA 4DR6F 1VQLN 1QVGM 1FHTA 2Q6BA 2KKZA 1EQMA 4HUGA 1J5EF 3RMCA 4H8KA 3TWZA 3E51A 4L8RB 3IS9A 4CEEA 1GQEA 5M1NA 5ETNA 2OFGX 3R5DA 2UUWA 1CXUA 2ZH3A 4V19X 5J2MB 2AX1A 4YB6A 1WBDA 3MM9A 4TY8A 3OL9A 1RAOA 3K17A 3SSQA 2GQ2A 1B4SA 3RW7A 8AT1B 4OO1J 3SYZA 2AV5A 2QA4G 3DU6A 1ZBTA 3W3DA 4KIAA 2JLGA 4DSJA 1RQ0A 2MDAA 5D4LA 5M1KA 2DKOB 2DB1A 4HR2A 1BL3A 4HCBA 1GLBG 5CABA 4LFAJ 4IUFA 3TAQA 2VPXB 2GMHA 2O8DB 3DM2A 2ZJQQ 2P9UA 3FQKA 1XMQF 2MKHA 2PN6A 2Q3SA 4JI2K 4DUZJ 3DXBA 4B08A 4PCQA 4E8UA 2IMWP 1VHXA 2VJVA 4FW1A 5EY4A 4JKCA 2KXNB 4PUOA 1RU1A 1W2BM 2LQJA 4P2MA 4CZJA 4GRSA 2IIHA 3O9SA 3L2QA 3H4BA 5LJ5Y 2HFNA 4LFCJ 3W5XA 1VAZA 2Z2YB 2YJEA 3MOJB 2WW8A 1RBUA 2FHMA 3BR9A 5KG5A 3W8PA 1S6QA 3DWLA 1N32K 3LP1B 3TJ9A 4KTQA 3EVOA 5DDQC 5E84A 1KXPA 4M5MA 1FE4A 1V3SA 1I1GA 1NLVA 4YDUA 3ATUA 1Q79A 5IZHA 1RXOB 1RAGB 3OUYA 1N36K 5J2NB 4DR4J 1RK8A 2F4VF 1F2HA 3PJ9A 4KBIA 3HVAA 4JD2B 3CCWA 3C65A 4MT1A 5FPNA 2HHXA 4YOEA 5GAHP 3R7SB 4ID5A 4NZ6A 3F56A 2R7UA 2G13A 4NZ0A 4NCBA 4Z4GA 2BMBA 4DR6J 4DPWA 4FM0A 2O8EB 5J1NA 3UKUA 1J5EJ 1HBOB 2HFUA 4FBTA 4DMZA 3E9PA 4BR2A 4DL6A 3ZO7A 1PYTA 2LQBA 2E5LK 3D6TB 4PA1A 3NNAA 1Z2ZA 2UUBK 1NOYA 3ALYA 1Y7PA 2B9YA 3OYEA 1RKJA 3FZFA 4EHUA 1NXIA 4O0IA 3S8SA 4PG8A 1JLQA 1L3SA 3AQPA 4Q8EA 1NLKL 4LC9B 4ZJLA 3OLBA 3MGJA 3ZC4A 3TZWA 3HVRA 3M1VB 1GLAG 2IM3A 1VSMA 1HR0F 3V6DB 2VPWB 4ICLA 3KLEA 1H3DA 2C3UA 2YWFA 2DXDA 4KI4A 3VEZA 4WFBL 5HN0A 1PJ6A 4OQJA 2CJQA 2YNIB 1A6LA 1WC6A 1NSPA 4DPTA 4JB8B 1WKKA 3VQ8A 4HVZA 1JLAB 2PT0A 4DX6A 1UW9A 3JS6A 2CG8A 2YVSA 2B9EA 1XQIA 3RAMA 3RR8A 4LRAA 3J7ZO 3TU5A 4ZOSA 2D0AA 2OPQB 2KT5A 3QINA 2CPJA 3KIOA 4BRHA 1T03A 4C8NA 1DKGD 4JYAF 4CO5A 3NAEA 1RT6A 2EWHA 1D9AA 2YKAA 3T3FA 1U49A 3SI8A 1QHTA 4KHRA 3SAHA 2LYVA 5KFFA 2ZJPL 2BJ3A 1P1TA 2OEKA 4M5DA 1PSDA 2CH5A 3VQPA 3ZT1A 4PXEA 3MDFA 2R42A 3OFGA 2DYAA 3FKBA 3C3LA 4DSKA 3EE9A 3PRBA 3K57A 2RRNA 1W97L 5AZJB 3G82B 4CJRA 1VYAA 3W3SA 1UAWA 2A5XA 4TQSA 4IOBA 3A3OB 3MM7B 4J9LA 2GO9A 1WSEA 3K5PA 1WSVA 1TKTA 2X1BA 2OPSA 4Z2XA 4AM6A 2ZBPA 4X65J 2PGCA 3MMVA 2BA9A 1YWXA 4J9QA 3CO0P 2LEPA 5HI7A 4B3OB 5CCMA 2AZ1A 2RPIA 5ETLA 5E3PA 3QWUA 2RUGA 1S1XB 4K4ZA 1OVYA 4BS2A 1ZPVA 3W5YA 5KG3A 1HNVA 4OPHA 2UXCK 3D1OA 2OTJS 1BI4A 1I39A 4AL6A 4OYZA 3CJTA 3V6JA 2W9AA 3ET6A 2IAJB 4WQ5C 2FIUA 3CE8A 2ZKTA 3X3UA 2FHJD 4RBVA 4IZ9A 2KG1A 4U67L 4MKBA 3B8AX 3CYMA 1RDDA 3OFFA 4I6MB 1SI9A 2N7YA 2E1RA 4FLWA 3VGTA 4DV2F 5ETQA 5GMEA 3DLEB 3EPIA 1RWMB 3KG0A 3MMBA 4USWA 4UQGA 2AP6A 2BJ1A 3PACA 1WSJA 1X4FA 4M94A 3GSIA 3VAMA 1ZOTA 1HR0J 2ZHOA 1NDKA 5CZVA 1JNZB 3HYFA 5BXIA 3I9V9 1VQNS 3F73A 1S6PB 3DU5A 2E1PA 3LANA 4JI6J 3QPIA 1P27B 4CH7A 1WOSA 2XMAA 3D2FA 4C97A 2R8GA 4FWOA 3OVNA 4KHUA 2HNYA 5HMWA 1YJ9S 4TN2A 5KPTA 2I9SA 1KAZA 4LR9A 5ETVA 2VG7A 4ZTFA 2MJNA 2CFXA 5GADP 2FGCA 2OYQA 3G9CA 1R31A 1Y9OA 3RZAA 4ZJQA 4BRKA 1TL1A 2ASOA 2I8EA 3B4DA 2HHHK 2V5HG 1WEYA 2GMJA 4M3UA 5IC4B 3ZETB 1CJUB 2IVNA 1A0OB 1NHVA 3R1LA 3BKFA 3N4QA 2EFQA 3G4SS 1RT7B 3FFIB 2MGZB 4FM2A 3THVA 5AT1B 1VQSA 3HK2A 4BRFA 1EZZB 5I42B 3CMAS 4ECRA 3H3OB 5JMVA 2EFGA 2J9DE 1YF5L 3VQEA 1FNOA 2MZ1A 3OXFA 1CZ9A 1UWBB 3L2RA 3W62A 4IFVB 1SQGA 4I2QB 3H5YA 2Q31A 2JC0A 2CQPA 2DITA 3ENVA 2R7WA 1YIJS 1KAXA 2JEJA 4CJSA 1Q78A 3ICLA 2V2KA 2OSQA 2QA2A 4JI1K 2BQRA 1DQ8A 4JEPA 4K50A 3I96A 4ILHA 4V19S 2J0SD 2YNGA 1DT9A 4J9OA 4KH0B 3LP3A 4WZQA 3NE6A 4MFBA 1XHZA 2WW4A 1NZ8A 3CJCA 4CWBA 4DV2J 2HLTA 4LF5K 1N36J 4H4KC 1LWEA 2E5JA 3M2RB 1B0TA 5HAOA 3W9IA 4ZN3A 2DGUA