1RTIA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
543
structure length
542
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 143
structure length 542
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rtiA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rtiA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rtiA05
4U7CA 3AV9A 3MF5A 4ZTJA 3C6TA 3TAMA 1XR7A 1D9FA 4QWBA 1WSEA 1RT3A 3QINA 1C0UA 4DTMA 3WNGA 3G6XA 4RU9A 4RW9B 1NJWA 4WFZA 1QS4A 3V6DA 4C8LA 3AA2A 3EZ5A 3KLGA 4ECZA 3MAQA 3RMDA 3KHLA 4MFBA 4ED7A 4HUEA 4TQRA 5T7BA 2IAJB 4CJPA 5CY4A 4ED0A 4R0EA 1Q9XA 2YV0X 5KFXA 5KT5A 2HHUA 1S1UB 4EP5A 3KK1A 2AX0A 3SQ2A 2B5JB 4MKBA 3KLIA 4Z0UA 3CO9A 3LPTA 2NUBA 4E7KA 3AVAA 1K6YA 2C22A 4FLUA 2F96A 3UR0A 3S3MA 4F4XA 2G8VA 1RTJA 2P5OA 4MKAA 1JIHA 3QGHA 1RT7B 1HQEA 2G8IA 4H4OB 1A5WA 4EZ6A 1KCFA 3QEXA 2QKKA 3OYLA 3MR5A 1RYSA 1NK5A 3SJJA 4DFKA 4DF8A 3EYZA 1RTHB 4K4WA 1N48A 3WNFA 1IO2A 2BRLA 2OPPB 1I39A 3ZCMA 3M8PB 4FCYA 3NF6A 5J2MA 4CJEA 1RT5B 2JLEA 4KBIA 2YKNA 3AVFA 4DLEA 4ELTA 2Z1IA 5HROA 1LWEA 3PW7A 3KLFA 4B3OB 4ZTFA 5C42B 1VSEA 5KT4A 4NLSA 3HPGA 4NLPA 1S6PA 1JLAA 2X6NA 2AX1A 4M41A 2ZQBA 3TAFA 2OPQB 3CG7A 1ASVA 4OJRA 4I7FA 4CFDA 3K5NA 3V6KA 4MH8A 1SL0A 1TVRB 1VSIA 2C2EA 2DY4A 3CM5A 1N6QB 3VA0A 4NLVA 4J9RA 1O1WA 4PQUA 3IRXA 3TAPA 5I42A 4IH6A 2W9BB 3DRPB 4DTJA 1RBSA 4NCGB 4F3TA 2VA2A 1R0AA 4AH9A 4R8UB 4CJFA 1QTMA 4IFVA 4U6PA 4ELUA 3OYKA 2J6SA 4QAGA 3MEDB 4ZP9A 1JLBB 4XPEA 3HT3A 4ZVHA 1TL1B 5KFCA 4M3TA 4DL4A 3DRSB 3DRRA 4X2BA 4ED8A 3LP1B 4Z4FA 3NGZA 3KMQA 3DOKA 4K4XA 4DQQA 3NFAA 1XHZA 5J2QA 3QESA 3DLKA 2XHBA 1LW2B 3C6UA 3VQCA 3ASMA 5HRPA 3SI6A 1XR6A 3ITHA 2E9ZA 4KI4A 4ZPBA 4CEAA 1RBRA 4IG3B 1TKXB 1N6QA 3G6YA 3ULDA 4FM0A 3KK2A 1RTHA 3KLHA 3G86A 1KSPA 4RNOA 2RF2A 2O5DA 4Y3CA 2ZKUA 1S49A 3N6LA 4FLVA 3BR9A 3NBPB 1LWCB 1IKWB 4WE1A 2WHOA 4QW8A 3KKSA 4CEBA 3LP0B 4CJ5A 3D0PA 3CJ0A 3RB3A 1NK4A 3V4IB 4PUOB 3OYFA 1FKOB 3MEEB 5DQGA 3P83D 1XC9A 2IS3A 1LV5A 2IC3B 4EO6A 3MEDA 3OYAA 3HPHA 3FQLA 3AA5X 1K1QA 3L8BA 3BGRB 1L3UA 1HYVA 4TY8B 4DEZA 4J9PA 2WCXA 2BQUA 1Z25A 4EYIB 2IM0A 2D0AA 4MFBB 4HCBA 1T8EA 2DFHA 3CFRA 3ZT4A 2HHQA 4FJNA 2YNGB 4DFJA 2RKIA 3QO9B 4YR0A 1DLOB 3C6TB 2D0CA 1RT3B 3IS9B 1CXQA 3I5AA 5KFWA 2P51A 3T19A 4KHYA 4ECTA 3TAEA 1TL1A 1TK8A 3DRRB 3DRSA 3PV8A 3CYMA 4CFCA 5KT7A 1RT6A 5KG7A 2FC0A 2XY5A 4AILC 2RF2B 3GIIA 2A1RA 1C0TA 4CHNA 5J2QB 3NH2A 1SH2A 3DLEA 2VG5A 5DG8A 4NYNA 2G8WA 4CIGA 2HHVA 4L8RB 1TKXA 4ZMMA 5J2NB 3A2FA 4CGJA 2XY7A 1TKTB 2IC3A 4ZPDA 5FRNA 3GV7B 3ISNC 2J6UA 4MK7A 4DU1A 1T05A 4C8OA 3MR6A 3K5OA 1HNVA 3HO1A 4I9LA 3AO4A 3PZPA 5CYQB 1S1XB 4ED1A 3V9SA 4OKKA 2XO7A 3Q8RB 4RUCA 3PVXA 2YNGA 4DFPA 2ETJA 4TQSA 4FW1A 1RTIB 5HLFA 2QK9A 4B9NA 2D3UA 2FBYA 2ILZA 4HUGA 3DI6A 4JV0A 2R7YA 2C2RA 2WONA 1FK9A 5KG1A 4ZHRB 1BGXT 4YQWA 4IR9A 4C8NA 1S0NA 1KVCA 2YHBA 5KG2A 4TYBA 1XR5A 3L3VA 1JLCA 3OYGA 3RRHA 1GX6A 4CF0A 1T03A 3QEIA 1RT5A 2KFNA 3AVHA 1BQNB 1BL3A 4DSLA 3HM9A 2YKNB 2I5JA 4LSLB 5KFKA 4QW9A 4RW4B 2ALZA 1VSKA 4ICLA 4BWMA 3NH0A 4OLBA 4O3OA 4Y1CA 3AVCA 3VN5A 3U6FA 1RT4A 4BE1A 4J2AA 1I6JA 1JLGB 4TYAA 4FZXC 3RBEA 3DLKB 5HP1A 4IKAA 3QNOA 3BDPA 3Q8PB 3IAYA 1S1TA 2ILYA 3CDEA 4FM1A 3OJSA 3F9KA 3V9ZA 3TANA 2XRIA 4CHYA 1WN7A 3TVKA 2EC0A 4XO0A 3UQSA 3ZSWA 3OYHA 3I5BA 4NLOA 2HWHA 2GIRA 5F8GA 1VSJA 4O4GB 3VA3A 3DOKB 2V4RA 2QE5A 3QZ7A 4O3NA 1JL1A 2EX3A 3GQCA 3PX0A 1HYZA 1L3SA 4FBTA 4K8XA 4I2QB 3KD5E 1WSGA 4RW4A 3SUNA 3ITHB 4RW6B 1J5OB 2HMIA 3KLGB 4CEOA 3LP3A 5HRSA 1T7PA 4KAIA 2J6TA 4YMEA 4CHPA 5KFRA 1T03B 1HJRA 3AA3A 3LAKA 4I2PA 1WNSA 3LZJA 4LD0A 3TAMB 4BACA 3L2VA 3LP2A 5KRTA 1RDAA 4RNMA 4R5PA 4DFMA 3OSNA 1HQUB 4FM2A 4CEFA 1YT3A 2X78A 3H5SA 4NRUA 5SWMA 3OYJA 3MR2A 3KTQA 2FBXA 2AGPA 4CF9A 2VG6A 1W0HA 1J9AA 4IRCA 4EP4A 4DLGA 2R8HA 1HRHA 5D3GA 2AU0A 3K58A 2R2TA 1TKZA 2D5RA 2WK4A 4CFBA 2YNIB 3ISND 3V1RA 5F8LA 4NLYA 1RT4B 1KHVA 2HHXA 5J2MB 4Q0BB 3ALYA 1RT7A 3EZUA 4CGIA 1TV6A 3H4BA 3IN5A 1S1VB 3LP0A 3UIQA 4Y2CA 1U45A 4QWEA 1RDRA 2IM3A 2R8GA 4LQ3A 3DOLA 4IG0A 1EXQA 1VRTB 3SUQA 3KKRA 1C6VA 3N6MA 3OYEA 4MK9A 4DL2A 3ZT2A 1RA6A 3NAIA 1W9HA 2HNYA 3MEGA 5DLGA 4IDKB 2OPRA 4GMJB 1QAJA 1L3VA 3SUOA 2AGOA 5L1JA 4CGDA 4Z4EA 1NJZA 3KK3A 2GC8A 3MXIA 1CLQA 3PHEA 3FFIB 1GOAA 3OS2A 3NAEA 4F4YA 1RT6B 4F4KA 2HWIA 1S6QB 2HHWA 3T5HA 3L2RA 3RB0A 2G8HA 4DSFA 2FLNA 4DL3A 4K50A 1QQCA 4EBDA 4BWJA 3DDKA 3CFOA 2VWKA 2F8EX 3HKWA 5F8MA 4PA1A 2OZMA 3M9NB 4IG0B 5F9NA 4ECSA 3E51A 2KFZA 1RTDA 2Y1JA 3BSNA 3V1OA 1IM4A 2QKBA 1NOZA 1HPZB 1I3AA 4AHCA 4TY9A 3CJ4A 2HNDB 1JLQB 1QE1B 4DQRA 2RDIA 2IM1A 4E89A 4OPKA 1FK9B 5F8IA 3D45A 4OL8A 5L9XA 1J53A 3V9WA 3SQ1A 3BSCA 4K4VA 4ECYA 3FFIA 4KHQA 3H4DA 5HRNA 2FBTA 3QERA 3VQ5A 3TQ1A 1Y97A 4FJKA 1SV5A 2CKWA 4ECWA 1YVUA 1REVA 2BR0A 4JV1A 2I5JB 3SV3A 4CESA 4KKOA 1RILA 3CJ3A 1HNVB 1JX4A 4DU3A 3HYFA 5KFFA 3N6NA 3QNNA 4KV8B 4Q5VA 2DPIA 3GYNA 2Z1JA 1JLCB 3MEEA 4M3UA 4CJRA 4CF2A 3M8PA 1QUVA 4LH5A 2BQ3A 5L1LA 2UVRA 2XC9A 1U49A 3QEVA 3V6JA 4JV2A 1VSDA 5C42A 1J54A 3AO5A 4GC6A 4B9VA 2Q3SA 4RW9A 3B6PA 4FK4A 1FKPA 5KFGA 5J1EA 3E01A 1EX4A 1Q8IA 1D9DA 4KREA 1XI1A 3DLRA 3BQ0A 1NJXA 4KSEB 3MFIA 2KQ2A 1BCMA 3NF9A 1SUQA 3NMAA 5KFOA 2D41A 3NGDA 1SKSA 4M3XA 5KFEA 3L2UA 4ID5A 4ID1A 1T3NA 4JUZA 4K4SA 3DLGB 2XWYA 1U4BA 1KRPA 1U09A 1WSJA 4NCBA 4EBEA 3QEWA 5KGWA 4IOBA 5I3UB 2W7PA 2E9TA 4DG1A 1TGOA 2PYLA 4FJJA 4CERA 4ZPCA 1Q9YA 5EU7A 2XY6A 2HNZB 3HVAA 1T94A 3UPFA 3I5CA 3RB4A 1IKXA 3E01B 4KB7A 1TP7A 2BANB 2IBKA 4KRFA 4AHSA 2OYQA 1BISA 4H8KA 3EY1A 5KT2A 1UA1A 1C1CA 5CZ2A 3TARA 4K4YA 3RAXA 2BRKA 4FJ7A 3B6OA 3KLFB 3NL0A 1VK0A 3PW5A 1ZBHA 3ZSOA 3ZSZA 1MU2A 3KJVA 3TAGA 1LAWA 5SZTA 4K4TA 1TK5A 5DG7A 1DTQA 1CZ9A 2FVSA 1UOCA 5K14B 4BDYA 4FJMA 4B9LA 4ZP7A 1QSLA 3OHAA 3DLHA 3FRZA 3SFGA 4XPCA 4RZRA 2EHGA 3RMAA 4N41A 3H59A 4HYKA 5JUMA 4FZYA 1N5YB 4G1QB 4J2BA 3SNNA 2YNIA 4FLXA 1C0MA 4NLQA 4ECXA 4O0JA 5KFSA 1FKOA 1EETB 2B43A 2W9CB 4W5TA 4J9KA 4FLYA 2W9AA 3LP1A 3KK2B 3H40A 1RT2A 4ZPAA 4MQ3A 4JS4A 3OYMA 3NGYA 1WAJA 3SCXA 4PWDB 3G6VA 2YNHB 4CGGA 3ZT1A 1LWCA 4FJHA 4RW8A 3V6HA 1JLFB 2R8IA 1BIZA 4CCHA 1D5AA 3DMJA 4O3PA 4NCAA 4NLDA 3KLHB 4YR3A 4Q8EA 2PY5A 1HPZA 2CJQA 3G0ZA 1C1CB 1JLQA 1QE1A 3H5XA 4QWAA 2UUWA 1ZBIA 4OGEA 3IS9A 1LW2A 1EP4A 1VSLA 2PZSA 2OA8A 4QCLA 4G1QA 4CECA 1HNIA 2W7OA 4URGA 2HNZA 2JC0A 3OL9A 2XCAA 3VQ4A 2D0BA 1Z26A 2F8SA 5C24A 5DLFA 4FJ9A 2V9WA 1RNHA 2OPPA 1UWBA 1RTJB 4M42A 1JKHB 3T1AA 2ZD1A 3IG1B 1WLJA 1LWFA 4B3OA 2B5JA 3GILA 1MMLA 4FZZA 5F8HA 1EKEA 3NH1A 2DFEA 3KK3B 2X6SA 3SQ4A 2YKMA 2DFFA 4M3RA 4DL7A 3DLBA 3VQQA 3MTKA 4B9SA 4HTUA 4FW2A 1NHUA 1NNDA 3JYTA 3V1QA 1RAJA 1C0TB 1BIUA 1X9MA 1LWEB 2FBVA 5HRRA 2GBZA 1HMVB 2HHTA 2JEFA 3S3OA 1S1XA 4F8RA 4RW7A 4CJVA 2VG7A 4CIFA 5EWFA 2JC1A 3TABA 5JXSA 4I2PB 4KE5A 1IKYB 2R8JA 4F50A 2W42A 2IJNA 5HROB 1JXEA 4KHUA 4W5OA 2HVIA 3LDSA 3FDSA 4ECVA 3SYZA 2GV9A 3PY8A 1ITGA 4K4ZA 3M8RA 3KLEA 3HVRA 4PQUB 1X9WA 4E1NA 4HCCA 4WFXA 4Y2AA 3L2QA 5KT3A 3UDLA 2JEJA 4OLAA 4DSKA 4J2EA 1DTTB 1S9GB 2WTFA 4CEDA 4I7FB 4DTPA 2ZE2B 1EP4B 3O4QA 3NDKA 3QETA 2YNFB 3THVA 4IFYB 5D3GB 4PY5A 3V81B 2OPSB 4WFYA 4CK3A 2VG7B 4EZ9A 3DRPA 3ICLA 3GV5B 5KG0A 3WNHA 3I8DA 3H5YA 3KHRA 3SV4A 2BDPA 1S1WA 3PX4A 3KK1B 2YHAA 4QWDA 2VA3A 3AVKA 1NKEA 3LAMA 2C28A 3V4IA 5CYQA 3QIPB 3WNEA 3QZ8A 3VQ6A 3O3HA 3TAQA 5KG6A 4DTOA 5I3UA 3OL6A 5HBMB 4WXOA 5FDLB 4CEZA 4B9TA 1S1UA 1RBVA 2BE2A 3RRGA 4RUAA 2V0NA 5F9LA 1GOBA 4WYLA 4H54A 2X74A 4KI6A 2FLPA 3BSAA 1SL2A 4RW7B 1RT2B 5KFLA 4IR1A 3C94A 4QPXA 3HHKA 4O4GA 4URQU 1ZBLA 4KB1A 4KHWA 3VQSA 4M3WA 4LQ9A 4WZQA 4CJWA 3AO1A 2ZE2A 4FXDA 3TWHA 1N5YA 3NF8A 3DM2B 3CDUA 1HQUA 3ZT3A 2E6LA 4O3RA 4F2RA 4ZVGA 4PUOA 4DF4A 1ZTTA 1WSFA 4CJKA 1LW0A 4F4ZA 1DTQB 1UAXA 4FS2A 1RT1A 3QLHB 2DTUA 4IRKA 4C8KA 2VWJA 4IQXA 3HPOA 1S1WB 4FYDA 5EDWA 1NOYA 1XHXA 4J9QA 2BE2B 3O4NA 1ASWA 4KKOB 4M95A 3V9XA 3SZ2A 1YVFA 4NLRA 5DG9A 4OKEA 3PO5A 5J2PB 3KNAA 4R5PB 1VSHA 4E19A 4CGHA 3JSMB 4O55A 5DQHA 4DTRA 4W5QA 1K1SA 5JS1A 3PW0A 1YTAA 3I0SA 4B8CA 3OLAA 1U04A 1TKTA 2R8KA 3QEPA 4TN2A 1NJYA 1GX5A 1DLOA 4IFVB 2P5GA 4JRQA 3PUFA 5DGAA 4KO0B 2P1JA 4NLWA 1Z4UA 4NZ0A 3GIKA 4O0IA 5KGXA 4FS1A 3IRXB 2WOMA 3GIJA 5DK5A 4NLUA 3RR7A 4B8AB 3HVWA 1GOCA 5T14A 3QIOA 2RN2A 3LWMA 4KTZA 1A5XA 4DL6A 2FJXA 5KFZA 1C0UB 5KG3A 1LWFB 4E1MA 2E4LA 4DTXA 1QSSA 2YNHA 2XI3A 1ZBFA 2WRMA 5F8JA 3VQPA 5FRMA 3VQDA 4RNNA 4FK0A 4FJ8A 3FSIA 4Q43A 4Q0BA 2XI2A 3VQ8A 4LSNB 2JEIA 1QAIA 1IG9A 2ZD1B 3KIOA 4YP3A 4FBUA 3MXJA 1BQMB 4FK2A 4RG8A 1KVAA 4E7JA 3G10A 4CF8A 1NK7A 2E9RX 1RDBA 1CZBA 3SPZA 3CIZA 3JSMA 2YKMB 4FLZA 3P5JA 2HVHA 3OL8A 2ASDA 1RTIA 5HLFB 1CSJA 3BJYA 4H4OA 4EBCA 3OSPA 4Z4CA 1CXUA 4GC7A 3IG1A 4EO8A 1UA0A 4JRPA 4KTWA 4KFBA 4TY8A 1N4LA 3H2LA 4IG3A 1S5JA 5DQIA 2BANA 2I1RA 4FJIA 2B6AB 4N76A 4DMNA 1VRTA 1JL2A 3NGIA 1B9DA 4H4MB 1TKDA 2XCPA 2RKIB 3QO9A 1KVBA 4B9UA 4CEQA 3SUPA 1IH7A 1U48A 3CDWA 3M9MB 4CJ4A 4DSJA 1C1BB 1QHTA 4ICLB 4AHUA 3KHHA 1LAVA 3KLEB 3QIPA 2W9CA 4IBNA 3VQBA 3QIDA 3D5MA 1RTDB 3NE6A 4RNFA 3FQKA 4FLTA 4LSNA 4DQSA 1HQEB 1C2PA 3BREA 3OYDA 4IRDA 2GUIA 2HW3A 4IH5A 5KFDA 3TI0A 3I0RA 2OPSA 3DMJB 4CFAA 4F2SA 3LWLA 1SKWA 4MIAA 3AVMA 2GIQA 4J2DA 4K4UA 3H08A 4H4MA 3NCIA 1NK8A 5FDLA 4FLWA 5L1IA 1S9GA 1RCHA 2A1SA 4CJSA 3SQ0A 3SFUA 3AO2A 2AQ4A 4RW6A 5KT6A 3KOAA 1TVRA 3LANA 4IFYA 1S9FA 5C24B 4DS4A 3LALA 2KZMA 4KHSA 1D0EA 1ZETA 2QXFA 2LSNA 4CHOA 4BDPA 2OPQA 4KHRA 1JKHA 3BQ1A 5C25A 3LP2B 1N56A 4DQIA 2FVRA 4EEYA 4OGCA 1B92A 3O3GA 2AJQA 3DLEB 2UVVA 3T3FA 3F73A 2XGPA 3MXMA 5EWGA 1IKVA 3K5MA 4QOZB 3OJUA 3NAHA 4I9QA 1KFDA 4UQGA 3VQEA 5HBMA 4ZP6A 4XIUA 3AVLA 3TR8A 2IMWP 4J9OA 1JXBA 3KMSA 3PW4A 3I0RB 2G8FA 2IA6A 1QSYA 3KD1E 4ZP8A 3AA4A 3VQ9A 4O5BA 3OS1A 3NHGA 5KG4A 5CZ1A 1S6QA 2IJFA 3O3FA 5FROA 3VQAA 1NK0A 3ZSYA 5KFJA 4GW6A 4MK8A 1W25A 1IKYA 3ZSXA 5KFAA 1G15A 3OLBA 1SUQB 4URSA 1TV6B 4LSLA 4DTUA 3OS0A 4W5RA 3OL7A 4EYHB 4CE9A 3AVIA 4TLRA 1EETA 1VSFA 4KHMA 3KJVB 3DOLB 3NF7A 1TQLA 4HVJA 4E7IA 1JLGA 4OVLA 2FVPA 3KHGA 1IKVB 4O4RA 3CM6A 2KTQA 3ZT0A 2FVQA 3MECA 1DTTA 3PO4A 3M8QB 5CYMB 4Z4HA 2OZSA 3CVKA 2WB4A 4N56A 4CF1A 3V9UA 4GVMA 5KFBA 4NRTA 1VRUA 3HP6A 1L3TA 1IKXB 2Z1GA 3HVTA 2JEGA 2XGQA 3K2PA 4N5SA 5KI6A 2AWZA 1NK9A 1REVB 1ZTWA 1S9EB 1TL3B 4HUFA 5KFNA 4FJ5A 3CWJA 4LY7A 1NKCA 4KFBB 4OPJA 4WE1B 1TAQA 2ITGA 4CJ3A 4O44A 2YNFA 4RW8B 3V81A 2D3ZA 1BHLA 3CQ8A 4K8ZA 3BSOA 4CJUA 4WXWA 2XY8A 4IKFA 2F8TA 3OY9A 1TAUA 2O4GA 2HHSA 2HNDA 4PWDA 1F21A 4M3YA 1NHVA 1XWLA 2IOCA 3IGVA 2ASLA 3OYIA 2RDJA 1JLFA 4ECUA 3T5LA 3RR8A 4CIEA 1VRUB 4ZVEA 3SI8A 4DTNA 4R8UA 3C95A 2OH2A 1S9EA 5KFMA 4ZHRA 5JS2A 1VSMA 4KHNA 3M8SA 1KTQA 2UUTA 1HMVA 3D28A 2VG5B 1C1BA 1BQMA 3OYBA 2O4IA 4G3IA 2IDOA 4JS5A 1HYSA 1WSIA 3HL8A 5C5JA 4E7HA 2Z1HA 3HVTB 3T5JA 5KFIA 3S3NA 4HKQA 2ATQA 3HSTB 4LH4A 4AHTA 4KPYA 2HAIA 3MFHA 2R2SA 3JYTB 1TL3A 2HNYB 4IDKA 3L3UA 2VG6B 4Q44A 4RNHA 1WSHA 4C8MA 5J2PA 4Y1DA 4CJLA 1X1PA 4J9NA 5J1EB 3DYAA 3QYYA 3RAQA 1D1UA 4M94A 1SH0A 2ASJA 4YNQA 3I0SB 5KFYA 4CJQA 1S10A 3HP9A 5KFVA 1UWBB 4DTSA 1BI4A 4DG1B 2FVCA 5KFHA 3MEGB 2AGQA 3K57A 3ZSQA 4N47A 3QGIA 1S1TB 4DL5A 3PR4A 1S0OA 1SH3A 3ZSRA 4E3SA 3CFPA 4W5NA 3RBDA 3DLGA 4TXSA 1ZYQA 3K59A 2IAJA 3M9OB 3PW2A 4M3ZA 1S0MA 3AVGA 3AVBA 1RBTA 4I2QA 2R2UA 2OPRB 3RWUA 1KHWA 3NBPA 1RDCA 3KLVA 2DPJA 4ELVA 2WONB 3NKYA 1FXXA 3H5UA 1RBUA 3K5LA 3V6DB 1C1AA 3H98A 4NYFA 1BCOA 2B4JA 2KZZA 3GV8B 3OYCA 4BE0A 2IGIA 4B9MA 1SL1A 1NKBA 4E0DA 4Y34A 3OHBA 3Q8QB 1SV5B 4BDZA 3AO3A 2G8UA 4FJLA 1WNEA 1S97A 5DMRA 4NLTA 1JLEA 1MU2B 1J5OA 2HMIB 1U47A 4KAZA 4NCGA 5KFTA 1R0AB 1OS5A 3CJ2A 2Y1IA 3IGNA 4ECRA 4HHTA 2UVWA 1NK6A 4CJTA 4CEEA 4ED3A 4DSEA 2HB5A 5EUHA 5F8NA 4M45A 3RB6A 1S48A 4CK2A 5KFUA 1KLMA 1RA7A 2QV6A 5KG5A 4E7LA 5KFQA 2D7SA 1RT1B 3QLHA 1JLAB 3MR3A 3AVNA 3SPYA 4FJXA 4Q45A 2W8KA 3OYNA 4FVMA 2E6MA 1BI4B 1WAFA 3M8QA 5CYMA 2FJVA 2FLLA 4AHVA 3RTVA 2C2DA 4MIBA 4DWIA 1SKRA 3DM2A 1HNIB 3BQ2A 2V4QA 4KV8A 4J9SA 4IH7A 4CHQA 5J2NA 2FJWA 4NLGA 3VQ7A 2B6AA 5EWEA 3PJWA 1S4FA 5DGBA 3U3YA 1KLNA 3DI6B 1X9SA 2IM2A 1T05B 3Q8SB 1D8YA 4B08A 2R2RA 3HK2A 4Z4GA 3RMCA 1JLEB 4CHZA 2UVUA 1FKPB 4KB0A 4F3OA 3AVJA 1LW0B 4TSXA 4FJGA 2BGGA 3PR5B 5I42B 4ZVFA 4O3QA 2W9BA 4WZMA 3L2WA 4ED6A 4BE2A 3MECB 4J9MA 4CGFA 2ATLA 5KTQA 3C6UB 3KLIB 1ASUA 4KO0A 1JLBA 3S9HA 4Z4IA 3ZSVA 1B9FA 1HYSB 4Q8FA 4ID5B 4DS5A 1JXLA 3HJFA 1TKZB 4ED2A 2KW4A 1KFSA 1HARA 1BQNA 4J9LA 4NYZA 3RMBA 2BQRA 5C25B 4O3SA 1A5VA 4DSIA 1IKWA 1L5UA 1RDDA 4WYWA 3DYAB 2G8KA 2PYJA 1S1VA 1KLMB 5KRSA 4O44B 3LPUA 3EPGA 2WOMB 4OKJA 4NLXA 1RYRA 5L1KA 4YFUA 3QGGA 5E41A 4DQPA 3PJXA 3U3GA 3T5KA 5HP1B 3HXMA 4QWCA 3BGRA 3EPIA 4YR2A 1TK0A 3OVNA 3GIMA 1YTUA 4F4WA 3P1GA 4JLHA 3CJ5A 4AHRA 2RPIA 2JGUA 1S6PB 5KFPA 4CK1A 3PX6A 4DU4A 4ECQA 2W8LA 5K14A 3LZIA 1ZBUA 4KTQA
chains in the Genus database with same CATH superfamily
3AV9A 4OZJA 5DDRC 4RUBA 4U96A 3RVCA 1WI6A 1D9FA 4BROA 1RT3A 1UJ6A 1IBCB 4FOEA 3G6XA 4RW9B 1NJWA 1QS4A 1RWOB 3AA2A 3EZ5A 2HZVA 4KR0B 4HT7A 3BN7A 1OY9A 2I8EA 1PO6A 5HO4A 2NLXA 3RMDA 1NG9A 3AOAA 2IAJB 3EICA 1XBWA 2ZC3A 2HHUA 5HMWA 4EP5A 5B0AA 4Z0UA 4O8KA 4BC7A 2CYYA 2DGTA 2NREA 4WCEL 3UR0A 4DUZJ 4F4XA 2CADA 2BUNA 4YY3K 1RTJA 3T7ZA 2BH1A 4KGXB 3R3TA 1HQEA 1A5WA 2V4JA 3QEXA 2ZFHA 3MR5A 4LF8K 1XUPO 4C4WA 3RBZA 3RG6A 4DCJB 3SJJA 1YQHA 2Y8YA 4FWKA 1O5JA 1ATSA 3CULA 1J2VA 2Y0SD 3H46O 1I39A 1X4AA 3ZCMA 5D0HA 5J2MA 2JLEA 3ENQA 2FD2A 2AJ1A 3UE5A 1NGHA 3BH6B 1LWEA 1IQZA 4TNOA 4B3OB 1S76D 5C42B 2LQBA 3LA0A 2M52A 5K8OA 2G4BA 5AQMA 4CW7B 4NLPA 3IBFB 4DU7A 2AEMA 1UAWA 2IRYA 4M41A 3DXMA 3T1YF 1IBLK 3OTOJ 3W9HA 3D2FB 3V6KA 4JI0J 1TVRB 2C2EA 4NLVA 4PQUA 3IRXA 4K25A 4IH6A 3MURP 1XNQF 4LIRA 4DXLA 3N79A 3IWNC 5LM7E 4FXVA 3J7ZT 2GWJA 5FD1A 3HFVA 1MW7A 2DB1A 2VFVA 4JOUA 2G0IA 2MMYA 4ED8A 2HQCA 4Z4FA 3NGZA 4I69A 3GCXP 4K4XA 1U2FA 2FIUA 3ASMA 2BUPA 1SBRA 4A8WA 1FERA 3D2EA 1NHKL 2UV8G 4CT9A 2ASOA 3KLHA 1X0FA 3AARA 4LF5J 4BRGA 5CABA 3OHRA 2O5DA 1Q8BA 4B3RJ 1DFDA 1U24A 3BR9A 4A8SA 1IKWB 4QW8A 3KKSA 4FVUA 3L7UA 4CJ5A 4DR1K 4ZJQA 2UUBJ 1G6BA 1Q0NA 1IWGA 2Z2YB 2ZM6J 3W64A 3U8XA 2P2CB 3Q8VA 3MEEB 1NGDA 1BHNA 5HSPA 3P83D 2IVYA 2EK1A 2IS3A 2IC3B 1ZM3A 3HPHA 3POTB 4X62F 1WI8A 1HYVA 3OTCA 1QZ5A 2BJ3A 2HQIA 2IVFB 4EYIB 1G3OA 1T95A 2E7XA 1V3RA 2KVQE 4PKHA 1T8EA 3ZT4A 4RU2A 2HHQA 1NDCA 1FJ7A 2A6AA 4NMLA 2CXEA 4YR0A 3CC4S 3L7PA 3R97A 2YWEA 1KAYA 4ID8A 3IS9B 5B0FA 1WG4A 2YWWA 2HBZB 2V5HG 1TTHB 5FPEA 1WJ9A 1X7VA 2NNWA 3PV8A 3HHEA 3A13A 5KT7A 1KKHA 1RT6A 2VKZG 1HI0P 5KG7A 1NU0A 3ZNUA 3G8TA 2ZBQA 3RSEB 2A1RA 1N0VC 2O8CA 3QFUA 1QQNA 3NH2A 1SH2A 3MDFA 4EMDA 4NYNA 3IAS9 1S7HA 4CIGA 4BR9A 2LEAA 1WKJA 4ZMMA 5J2NB 1TYQB 3MPUB 3A2FA 3GTYX 3GPAA 2ZH1A 4RX6A 3ZLJA 1R8PA 2XY7A 3CNQP 5AQQA 5FRNA 1B7YB 2GHWA 2DVIA 4F9OA 4UOCA 4DR5J 3T6BA 2W2MP 1UJ4A 4B1UB 1U2CA 1FEEA 1NPRA 2MQOA 3Q8RB 1Q5YA 3PIPL 3BO4A 2KKZA 2YNGA 2JLFA 4DFPA 4C8ZA 4TQSA 5HLFA 3C66A 4B9NA 2FBYA 3C7NA 1R6YA 2PEBA 2FF6A 4ZHRB 2J9DA 2KG1A 5SUHA 1KVCA 2WW4A 3OYGA 1U25A 3RRHA 1IR1A 3ENWA 1T03A 1GFWB 2MLZA 4A5BA 4KH6A 1BL3A 2ACYA 3P38A 2GZOA 2V8PA 2I5JA 5CQGA 2YQ0A 4GNIA 3GONA 2WTUA 4QS8A 3ZZ0A 4QW9A 3W2WA 4RW4B 3OVSA 1VSKA 2DO0A 4BWMA 3S6EA 1OQ3A 5A2QU 3OTOF 4Y1CA 3MCMA 3U6FA 3PRBA 4BE1A 4TYAA 4FZXC 1ZAWA 2DR9A 3WXLA 3F5TA 4DCHA 2R7RA 3C19A 3Q8PB 1C0GA 3CDEA 5A8WA 3VERA 2XRIA 1WN7A 3TVKA 2EC0A 3OYHA 4NLOA 2HWHA 1VSJA 3UI3A 3VETA 3QZ7A 4O3NA 1Q1KA 1HYZA 4K8XA 2Z30B 3HHLC 3SUNA 2QLBB 2PMHA 1QAXA 3VMFB 2ZUAA 3KLGB 3SAGA 5HRSA 1T7PA 4CHPA 3WXMB 1KOOA 4IO1A 4KHPK 3AA3A 3FNNA 4B3TJ 3LAKA 1UEKA 2RRAA 5I3PA 1K0TA 3JS6A 5BN9A 4QIWD 2EFOA 2HPUA 3ILIA 1UVJA 5KRTA 1WF0A 3Q8UA 4DV3F 2BW2A 5BYQA 3ENBA 4DFMA 3OSNA 1HQUB 4S0MA 3CI5A 4CEFA 2YKPA 3B54A 1YT3A 2X78A 4DR4K 5CHCB 3OYJA 3M1VB 2CDRB 1YJWS 2AGPA 2FBXA 4JKDA 5JLFA 4DV7F 2GA7A 3OPKA 1J9AA 4IRCA 4JI7K 1M90O 3O9QA 1K73T 2AU0A 3K58A 5ETPA 1TKZA 4CFBA 2YNIB 4ED5A 1GXTA 4J91A 5LL6d 1MN9A 4NLYA 3ZNJ1 2BJ1A 2MZQA 2CPXA 1KHVA 3G82B 5AQGA 2HFZA 4DV6J 1TV6A 3H4BA 5AQYA 4ILLA 1ZXOA 4DPYA 7AT1B 4H5VA 1U45A 1F5BA 4LQ3A 1TFWA 3DOLA 2CUYA 1HLWA 4DUTA 2WZ1A 3N6MA 2EI5A 1NM1A 2Z2ZA 4DL2A 1KOHA 2IFXA 3MEGA 1VC5A 4AM7A 2OPRA 1EB0A 3EVWA 2L9DA 3C8YA 2G9OA 5HOOA 3HRGA 4GVEA 1H1VA 3ZX0A 3MXIA 1CLQA 3ISZA 4A57A 2P9IA 1GOAA 2HS4A 1VCTA 5IM0A 1RT6B 1RAEB 1LOUA 4USMA 2F5GA 4BWJA 4I6YA 2OI2A 2VWKA 3FJ2A 1H98A 2F8EX 4OV6A 1RHKB 5E3CA 4YDUA 2WVFA 3P5BP 2WBMA 4AYBD 2LQ5A 3ZC4A 3J7YI 3J80O 3A0IX 4NZ6A 4FP9A 1I3AA 4TY9A 3VGVA 2F9WA 2MDAA 1OO0B 2JX2A 3V9WA 4X66K 1HWJA 1V5VA 2P9IB 3H4DA 2D3O1 4I4BA 5ETSA 5HRNA 3QERA 1O6XA 1ULRA 5LXRA 4FJKA 2KFYA 1UJ5A 5GMKa 3WX8A 1X4BA 2UXDF 4A2AA 3SV3A 2D1CA 1RHQB 3DGVA 4KKOA 5DS7A 1KQKA 2UXDK 4KV8B 4Q5VA 4BGBA 3FLCO 1NRKA 2E1PA 1BOTO 4M3UA 4CF2A 2DNMA 3M8PA 4LF4F 2KXHA 1QUVA 4BG9A 1FDNA 4JI2J 3M2RB 2DGXA 1PYSB 2BQ3A 2BJ9A 2UVRA 2FZCB 3V6JA 5C42A 3MWBA 4E98A 5D0EA 4LMZA 2Q3SA 5KFGA 3E01A 1EX4A 3ONQA 2CQBA 5HI7A 3DLRA 3BQ0A 3IM8A 2NXCA 3CCJN 3MFIA 2KQ2A 1SUQA 3NMAA 2D41A 2LQ8A 3ZTQA 4F02A 3AHPA 1U26A 2V6AA 3W3DA 4I6MB 4BRPA 4QIFA 4EBEA 3QEWA 4DG1A 5ELZA 4I64A 4FJJA 4F04B 1Q9YA 2GMJA 4Y65A 1WEYA 5EU7A 1FCAA 1VHIA 2HNZB 4K0KK 1NMNA 3AQPA 3CD7A 3I5CA 2HFUA 5EXWA 5E2QA 4ZCMA 4KB7A 1WOOA 3UKUB 2OYQA 5U47A 3EL2A 5KT2A 3A5MC 1C1CA 2CPFA 2UUAK 3TVZA 1NPPA 4IEEA 4P2FA 3N01A 3M32A 1HHTP 2PIIA 1RKIA 3KLFB 3ENOA 2XNRA 2AZ3A 1RQ0A 3I33A 1MN7A 1TK5A 2GJ2A 2FSKA 1CZ9A 2FVSA 1UOCA 3A5OC 4BDYA 2RT3A 2ZBCA 2QYCA 2GQ2A 4C9DA 3FRZA 3SFGA 2V34A 3QWUA 4XPCA 2YXLA 4PCQA 2EHGA 3RMAA 1N5YB 4G1QB 1W97L 2HHHK 4H5NA 4A2BA 2AEJA 4FLXA 4USKA 4AQYF 3QSYB 1FE4A 3KJQB 3MAHA 1FKOA 5M2PA 4FLYA 2K1RA 3WQUA 4HI2A 3CQYA 1X60A 3H40A 1VQ6N 4HI1A 2CZ4A 2X1FA 3OYMA 2QZ8A 3THPA 3TVYA 1F60B 1WAJA 3SCXA 3GFYA 2CIMA 2H48B 1VBYA 1RDWX 3G6VA 3DGPB 3K2YA 1WHVA 1FFSB 3A5NC 2A41A 4ZVRB 4GVLA 1KONA 4YR3A 3HHLA 3UCGA 3M6WA 2O8FA 1FRMA 2PY5A 2W01A 4HTIA 1TUUA 3LDQA 4R79A 2BOAA 3LGHA 4JI4F 1FJGK 3U9DA 3IS9A 2B7BB 4OLOA 4YN3B 5T7LB 1RWKB 2OA8A 4QCLA 4G1QA 4DR2K 2OFHX 2W7OA 3GE1A 4MDAA 4URGA 2CNNB 4J5OA 3VQ4A 1XNRJ 2D0BA 2ZNYA 3LL3A 2KLAA 2G2ZA 1WG5A 1P9QC 1RNHA 1H7XA 1RTJB 4HHJA 1HBNB 2XLJA 1EQ0A 4QBUA 1CC7A 3DLLL 2ZD1A 4B3OA 2NLWA 1Z2ZA 4QQBA 4KPCA 1EKEA 2OTJN 4DHYA 2DFEA 1VQON 4A47A 3CCSS 3KK3B 1UFWA 3O9SA 4M3RA 1K8AO 2ZH9A 1VQ6S 4BR2A 2UU9F 1LFPA 4XH5A 5L9NA 1NNDA 3WX4A 1RAJA 5C10A 4NA2A 1LWEB 1RACB 2HHTA 2JEFA 3ID8A 4F8RA 4WQ4A 5HQLA 2ZWHA 1T9YA 2VG7A 1RWPB 4K7QA 2W2PP 1YI2S 4MKYA 3DU5A 5D0RA 2R8JA 2W42A 2Z2MA 5EX3A 2HF3A 4Q2MA 1JXEA 4KHUA 2XZDB 4W5OA 4C7QA 7FDRA 2GV9A 3PY8A 1ITGA 3U1LA 4QYZJ 2HLTA 3L2QA 5KT3A 3UDLA 3D7SB 4HR2A 4TVAB 1I3OB 5AJ3F 5H9FK 1XN9A 3OR2B 3CCLS 5IQQA 3AB2B 3NGRA 3O4QA 2DT9A 4IFYB 5D3GB 3V81B 5LL6Z 2QG9B 4BY9C 2RDDA 4DV2F 4P2MA 2VG7B 4EZ9A 1GLDG 2AA4A 1GLBG 4UQTA 3KHRA 1EJ7L 1TELA 2ZVIA 3PX4A 5M1OA 4CP5A 3MK6A 1IUJA 4QWDA 3LAMA 4GV6A 1ZM2A 2NRWA 5CYQA 1SPBP 5EX0A 3QZ8A 3TAQA 4OI1A 5KG6A 3MN5A 3OL6A 5HBMB 5ETOA 3JQKA 2QMXA 4WU2A 4CEZA 4B9TA 1BDGA 4RUAA 3QDKA 2V0NA 3GR1A 4H54A 4WYLA 3BSAA 3G87A 3M6UA 1XEZA 4IR1A 1ZBLA 4KB1A 5IC6B 1E3MA 3MMCA 4CJWA 4M63C 3GP9A 1YJ7A 2AJ0A 4FOIA 3CCLN 1N5YA 2VV5A 3NF8A 4FYXB 4KH0B 4LT6A 4CI6A 4F2RA 2D74B 3QT7A 4B1VA 2DXDA 4PPDA 4CJKA 1SC4B 1WUUA 1UAXA 4FS2A 1XQSC 2DTUA 4IRKA 4C8KA 2O8CB 3O6WA 2Z2LA 3H7HB 3UDEA 1NOYA 4O5FA 4BRIA 1DAXA 2VFUA 2QW9A 4OKEA 3R5AA 4XEIA 2PT0A 3UN3A 5DZ7A 5DQHA 2BW7A 3PW0A 1YTAA 3QJLA 1WBDA 3OLAA 2KRRA 4BRMA 1GX5A 2V2ZA 4FWRA 3JTPA 5AE3A 4JRQA 2VC1A 3MMBA 4DV5F 5LJ3Y 2F7TA 4DV3K 1YAGA 3ZX3A 3MCNA 5T7LA 4YHHK 4NZ0A 5M2UA 1YF5L 2OJ3A 2NRTA 1M1KT 4WYBA 1T44A 4EWTA 4CTAB 4ILGB 2FZKB 4RR5A 4B8AB 4FPBA 3CJKB 3PKMA 2PFUA 2EVZA 4OHWA 2MKSA 2P9PA 1A5XA 4L3QA 1WKKA 3T69A 2CG8A 5AXMA 1K0VA 4DR6K 2XMAA 1QSSA 3NG8A 1R7IA 3DGPA 1AZSA 1IBLJ 2DIVA 4CZLA 3DCAA 3Q7BA 2YWGA 4Q43A 1N36F 1QAIA 3ZYYX 1IG9A 2ZD1B 4AXJA 4FBUA 4U8VA 1HFEL 1BQMB 2O3DA 4E7JA 1QVFM 4DDFA 1DQAA 2E9RX 1KN6A 1RDBA 3BN4A 3SPZA 4J9VA 4P2SA 2YKMB 4LRAA 2ZJPL 3OL8A 2ASDA 1RTIA 1H0HB 3BJYA 4EBCA 3RW7A 1JCGA 4Z4CA 4C11B 3TTDA 2DHAA 4HHHA 2DRBA 3R5DA 2I1RA 1XNQJ 3WT0A 2QJ3A 1JL2A 1BG3A 4H4MB 1E4FT 4OFZA 3TWZA 4CEQA 4PABA 1J5EK 3QPIA 4CJ4A 1D9AA 1QHTA 3R2DJ 2E5GA 2W4DA 2MQQA 3KHHA 1YBUA 3KLEB 3VQBA 1SVDA 2FHOB 3THXA 4Q2LA 3DLLQ 3NE6A 3FQKA 1Q16B 4YY3F 5AJ3K 4FLTA 3BREA 2UUBK 1F0XA 4IRDA 1DY3A 3VGTA 1N32F 5KOWA 3W9IA 4DX7A 3OR1B 3MCSA 1HL6A 3DMJB 2DKOB 3V2UC 1SKWA 1PJ6A 4ZCKA 2WFBA 3H20A 4JI3F 4K4UA 3PYDA 1IBMJ 3U1NA 2W6KA 2A6MA 5BR8K 4CWBA 3BM7A 1RCHA 5BPLA 1AW0A 2AQ4A 3DFEA 3ZTRA 2HBQB 4KHSA 1D0EA 3NRBA 3G8QA 2GHPA 2VBWA 1ZETA 5GMEA 2OPQA 4KHRA 3CO0P 3G25A 2GEMA 4BS2A 3UR3C 3J7YU 5BREA 3G2XA 1B92A 3DLEB 3T3FA 5GAEU 3F73A 5EWGA 3O8WA 2M7SA 1VQYA 1FDBA 1KFDA 4M8LA 5HBMA 2IMWP 3TYTA 4PG7A 5F0WA 3KMSA 3PW4A 2O01C 3KD1E 4ZP8A 3VQ9A 4O5BA 2F9JA 4OYAA 2H51B 3R1HA 1NK0A 2GGPB 5KFJA 3O2IA 4DJBA 1G15A 2VPWB 4URSA 4YOVA 1UVKA 3MN6A 4CE9A 2MLYA 4M5NA 4KHMA 3DOLB 3QB0A 4XDDA 3NF7A 2XZTB 2DK2A 1MWQA 2CRLA 4JK7A 3MM9A 3W1YC 4H0PA 4W92B 5AQRA 4F0KA 4C98A 3MECA 1NDLA 1F2GA 1DTTA 2OMOA 3FMWA 1HNXK 1HNZF 3CVKA 5A0YA 1KWMA 2ACMA 2E44A 3HSCA 2OKQA 1FVSA 2O8DB 3K9KA 4M5LA 5KFBA 2CWXA 3MXHP 3HP6A 1MG7A 2K06A 2JEGA 2HIYA 3BBFA 5KI6A 3CE8A 3GG1A 1NK9A 2AT1B 1S9EB 1TL3B 3EZWA 5BPMA 5DO2A 2Y3YA 3CWJA 4LY7A 1N33F 4OPJA 4O44A 2YNFA 4RW8B 2AIRB 2ZJQL 3SBGA 2C2KB 2D3ZA 5J1NA 4CJUA 4WFBL 4HTLA 4K5SA 2FHMA 4IUFA 2E2QA 5HL7L 2HNDA 2RAQA 4PWDA 2OMLA 3DJCA 5CR4A 1NHVA 1V4TA 1XWLA 4ZVTB 1G4CA 2ASLA 2W25A 3KG0A 3KUGA 4ECUA 5IC4B 1T9XA 5IV3A 4YHHJ 3CXCM 4WFNQ 4DTNA 3S8SA 1QQMA 5FLXO 3JTNA 3N0VA 4E2FB 4Y2MA 4ZHRA 5JS2A 2RHSB 3OR1A 3D28A 2VG5B 3OYBA 1VLYA 3TA0A 1HYSA 3ZZRA 1Q7YO 1MWZA 1UETA 3HVTB 1KDNA 3CMES 3S3NA 2QMWA 2ATQA 4KPYA 2ZVSA 2MQPA 2PA3A 3MFHA 2MHEA 1HUXA 2HNYB 3W61A 1MMNA 4FO0A 1XMQK 4IDKA 2VG6B 1NDKA 1YWXA 3P3DA 4CJLA 1X1PA 3PIPQ 3G96A 3QYYA 1SH0A 3I0SB 3D54A 4CJQA 3HP9A 2HQDA 3BGOP 4MYUA 4FNHA 4N47A 4DBQA 3P39A 2QXLA 3H25A 4E3SA 1T3OA 4Y28C 3CFPA 3O9TA 2CVEA 4DV1F 3M9OB 2YPZA 2MKJA 1VC6A 3AVGA 3TZYA 5LJVA 1OIAA 1RDCA 2DPJA 4ELVA 2PMWA 2WONB 4CI0B 4RTFD 1RBUA 4JD2A 2Z58B 4OJ3A 3V6DB 3EGZA 3H98A 2KZZA 5A8KB 2N7CA 1NGEA 1VQ7N 2ASYA 4B9MA 2H5EA 1SL1A 1NKBA 2E7VA 1SV5B 4MKVA 2D1KA 2G8UA 4WTOB 1VQ9S 3AXKA 1BO5O 4OX7A 2NZCA 4NLTA 1YX2A 2M70A 2HMIB 2VOOA 5AQLA 3OFEA 4CD3A 1R0AB 1U6FA 2Y1IA 4ECRA 4HHTA 2UVWA 3E2EA 1BC6A 3SCKE 4CEEA 2VWBA 4DSEA 4DKWA 3OBWA 4KHPJ 1YRTA 2APOA 4R25A 1S48A 5CZVA 5KFUA 4CYUA 1KLMA 4E7LA 4JHDA 2ZF5O 5KFQA 4FYYB 4MLEA 1BU6O 2C3MA 3MR3A 1HBNA 2ZZNA 4LFCK 4CZGA 3KUEA 3OYNA 5ADZA 4FVMA 2E6MA 4LFCF 2UYTA 2FJVA 2FLLA 5CD4H 2CFXA 2C2DA 1QZ6A 4DWIA 5C2GA 1SKRA 5CYJA 2YY3A 2PGCA 3HM8A 2RRBA 4DQ8A 4OYWA 1RP5A 4J9SA 2H54B 1WG1A 2VIHA 1MSWD 2HBLA 3D0IE 4K43A 2IVPA 4PPZA 1UPMB 2RU9A 5AQWA 1U2RA 1GMUA 5ETKA 1KLNA 3C7NB 3CCRN 2Q3PA 1X9SA 1T05B 1FF2A 1YBAA 4Z4GA 4GKJK 3FSYA 2P9CA 2UVUA 1FKPB 4F3OA 5GAEP 5E3QA 3H45C 3F41A 4FJGA 2V8GA 5FPDA 2W9BA 4WZMA 3CCMN 1WWHA 3TO8A 3MCAB 3S1TA 3FBFA 3THYA 1NCLA 1EQMA 2VQEF 4DR7K 2M88A 3KLIB 1GAOA 3S9HA 3K8VA 1GMVA 1B9FA 4ID5B 4DS5A 1JXLA 2K8GA 2AW0A 2KW4A 1YXQA 1WSRA 1VQLS 1HARA 2MY8A 1BWFO 3HHDA 4L74A 5AJ3J 4J9LA 4NYZA 5C25B 3P4IA 2BE7D 4UUWA 5FIIA 2PYJA 4L6V3 4O44B 4EHTA 2OO4A 1UFKA 4LIWA 2VICA 2UXCK 1U1KA 3NOCA 3QGGA 3W60A 3IUCA 1R6VA 1XERA 4I56A 1WDTA 3G71N 3OVNA 3GIMA 2CGKA 1YTUA 2ERRA 3CJ5A 2LECA 4J37A 9ATCB 2JGUA 4LREA 2BX6A 1S6PB 1ROFA 5BJRA 5KFPA 2W8LA 1PYOB 4KTQA 3G8SA 1M5KC 3I9ZA 4ZTJA 3C6TA 4YY3J 3TJAA 3SSSA 2OSQA 1GNKA 3WNGA 1JNRB 4FN5A 4WFBQ 3V6DA 3TU5A 3VEYA 3ATVA 1HBMA 3KLGA 4ECZA 3KHLA 3IFRA 3DRXA 4MFBA 4HH0A 3CPEA 2P9KA 1XNRF 3VF4A 2KI2A 5ETLA 3UCZP 2WW8A 5K8MA 1Q9XA 5KT5A 1GLLO 2AX0A 4ILHA 3CO9A 1B0PA 3LPTA 1TUGB 2VBXA 3O1BA 2Z0GA 3AVAA 1K6YA 4EU0A 2NRHA 2RB7A 2V69A 2P5OA 1MA9B 4BRCA 2G8IA 4H4OB 2QKKA 5L38A 4MJKA 1NK5A 1T02A 1DGKN 3H6EA 2PFFB 3EJMA 2W41A 5D4LA 2C3UA 3VESA 2OPPB 3PKYA 4JI0F 3NF6A 4DUYJ 3M2UB 1RT5B 2V2VA 1UP1A 2VBZA 2YKNA 3MN7A 2Z1IA 5HROA 1NSQA 2HBJA 1N8RO 3D66A 4OPHA 3HPGA 2NYIA 3O9UA 4IO9L 2J0SD 1H2TZ 3OTDA 2EG1A 2E2NA 1S7IA 4NXNJ 2V8HA 3TA2A 5KQ8A 3HKZD 4F0HA 4CFDA 4USVA 4D3GA 1S72S 3E8OA 4I68A 1GLEG 3MMAA 5AQNA 3EGWB 4NB4A 1VJWA 2DY4A 3CM5A 3CMEN 3VA0A 1O1WA 3TAPA 3DHWC 1ICEB 2W9BB 3AD7C 2AYEA 2MLXA 3DRPB 2P9SB 2CQGA 1FJEB 4R8UB 4BCAA 1QTMA 4CJFA 4IFVA 4U6PA 3MEDB 4ZP9A 2OHDA 1LFWA 1PYTA 4XPEA 2UXBF 3MPVA 3Q7CA 5BR8F 1HA1A 2OCEA 3RU0A 3LP1B 3KMQA 2CQ2A 4JI2F 4DQQA 4OZNA 3NFAA 3N28A 4JI0K 3H3NO 2XHBA 2J76E 1LW2B 4GKKJ 4K8RA 3BGLA 3ITHA 4JI1F 2E9ZA 4KI4A 4ZPBA 4CEAA 4TU7A 4UOGA 5DZ6A 3G6YA 3W63A 3AA9A 4ZKAA 4FM0A 4USUA 3MPYA 2KJVA 1KSPA 1AA1B 3IMXA 3R1LA 3D2FA 2RUSA 4Y00A 2ZKUA 1S49A 2CAJA 3N6LA 4FLVA 1LWCB 1VK8A 4NA3A 2L41A 2F7VA 3RB3A 4CJ7A 3MAAA 1NK4A 4PYAA 1LXJA 3VGMA 3V4IB 4PUOB 4EIAA 1YUWA 3WEEA 3OYFA 5LSRA 2ITMA 3GYXB 3F56A 4PKDB 1Q95G 3SQOP 1CJUB 1LV5A 4EO6A 1C4CA 3FQLA 1WF2A 2LDIA 4PL8A 3ZZTA 4J9PA 2BQUA 2A18A 4M5MA 4MFBB 4HCBA 1N32J 3PM9A 2YNGB 3I9V9 1RHJB 1DLOB 2IVMA 5G0RB 2I2YA 4OV1A 3D4JA 2Q6BA 1P27B 2W2NP 5KFWA 4RUHA 3H2UB 2FJDB 3D6TB 2JJ4D 1YJ9S 3I4PA 3ET6B 2Q66A 2DGUA 1WACA 2FC0A 4C0HA 3MHYA 1PKUA 4AILC 2RF2B 4LF4K 5GAHU 1C0TA 1NJIT 4CHNA 5ETTA 2IVOA 4BRAA 2VG5A 1WHXA 2E5LK 2G8WA 3K0JA 1WD6A 2ZH2A 4MYTA 1LK7A 3GJSB 2HHVA 1TKXA 1OYDA 3SAFA 4C97A 3CPWM 4ZLLA 3QQCD 2IC3A 4M63A 3GV7B 2XLKA 2J6UA 2VJUA 4DU1A 4DV7J 2UXCJ 5E26A 3M5RA 3HO1A 3FCVA 3H42A 4I9LA 1LXNA 1T0TV 4WP8A 4ED1A 4O0NA 4OKKA 4OZ5A 2B4VA 3PVXA 4BQLA 2EBGA 1KQGB 4NEZA 4FW1A 3O08A 3M2UA 3AAWB 1A0OB 2ILZA 2R7YA 2H4WB 2C2RA 3VEZA 4DV6F 5KG1A 4EHUA 4YQWA 4C8NA 1S0NA 2KXNB 2YHBA 5KG2A 5A8KA 1FRHA 2CZVC 2J9CA 1QTNB 1GX6A 1KNZA 2MY7A 3VGUA 3O8MA 4P6QA 5B09A 2YKNB 2ZHBA 2E1CA 1TUYA 3IR7B 1S3XA 3E9PA 5KFKA 1UVIA 4ICLA 2UXBK 3BS9A 5D77A 2XHCA 4O3OA 1M5VC 3P8BB 2PEHA 2VOPA 3Q0AA 4K59A 3RBEA 1P1LA 5H1SV 4M5IA 4AUKA 5HP1A 4IKAA 3QNOA 4ZN1A 3BDPA 1S1TA 4JKEA 3M8WA 2ZJRL 1VFJA 3TANA 4KH5A 5BPNA 3PHTA 1SC1B 2V52B 4JI5K 4DUZF 2FY1A 3UQSA 1TL4A 2HZAA 5F8GA 2V4RA 4OX6A 4HACA 3DDNA 1L3SA 4LRBA 4I2QB 1RGIA 3KD5E 1WUAA 4ATNA 2VF3A 3ITHB 4RW6B 2KU7A 1N5TA 3GG4A 3L4IA 4CEOA 1HI8A 2HQ3A 1AT1B 2V7YA 2J6TA 1NGIA 5KFRA 1T03B 4OO1J 1WF1A 1WNSA 2RVJA 4CM0A 3DXKB 3L2VA 1NPKA 1Y0HA 1RDAA 4RNMA 2Q1LA 1Y11A 3PJ9A 4LR9A 2F4VK 1AUDA 4FM2A 3CD5A 2UUCK 5SWMA 3FR0A 1BUPA 4CF9A 1HWKA 3OVAA 4DLGA 1SQEA 2R8HA 3A3OB 1HRHA 5D3GA 5LOQA 2R2TA 2D5RA 2WK4A 2GVZB 3BBCA 4ED4A 1A7GE 2KG0A 5F8LA 5FJ4A 2HOEA 2IVNA 4U7UK 5IV4A 1T9UA 3R8YA 5J2MB 5AE2A 3UNYA 3BGUA 1Y00A 1RT7A 2ASPA 2VFTA 2ZC4A 4HWIA 3EZUA 4CGIA 2QFIA 3IN5A 3AFGA 4UY85 4QWEA 3CERA 3TZZA 3WHIA 2R8GA 4B1WB 2XO6A 4IG0A 3RZAA 2M8DB 3OYEA 1C6VA 2VHGA 2CPYA 3BEGB 2WC9A 4G65A 1RA6A 3NAIA 5DLGA 4IDKB 5GVQA 1RWXB 3NNCA 4ES1A 4GMJB 4C11A 1RWNB 3LQVA 4WK1A 3FBCA 3DXBA 4Z4EA 2GC8A 4OZ3A 3OS2A 3NAEA 4F4YA 4X65F 2MZRA 1S6QB 1RDUA 2VYPA 3L2RA 4GVBB 3RB0A 2R42A 4DSFA 3TTFA 2IMOA 1OQ6A 1U02A 3D6FB 1QQCA 4ZA1A 2QWOA 1SS6A 2GVDB 3UE2A 4DN0A 1HBOB 2OZMA 4ISFA 4JI4K 1HNXF 4XK8C 4M5DB 4IG0B 2KFZA 2QKBA 1NOZA 2UU9K 4DQRA 9RUBA 5HMZA 1SJ3P 1VBKA 2HS3A 3MR7A 2R7WA 3OA9A 4H0XB 1AROP 1FK9B 4YOEA 3JQJA 1J53A 2F9TA 1DHMA 3B4MA 4NZ7A 4NOHA 4IOAQ 4YOYA 2P9UB 3DNCA 5B0CA 1Y97A 1SV5A 2QN6B 2R7SA 2YQ3A 5AQVA 1REVA 4BREA 4JV1A 2YPYA 1RILA 4BG8A 2CPEA 4YB5A 3VENA 3HYFA 4GKJF 5KFFA 3N6NA 3NGUA 2ZDPA 3HCXA 5AXNA 2Z1JA 1HNWF 1CG2A 2AKWB 1HHSA 4LF7K 1EKSA 3MEEA 3PIOL 3MM6B 3UW1A 2MQLA 3HF5A 5FPNA 1N5QA 1U49A 2B9XA 1DKGD 3QEVA 1VSDA 5CCMA 4B9VA 1FKPA 2V68A 5J1EA 3PFEA 3CCES 1HKCA 1Q8IA 1D9DA 4ZLNA 4KREA 1XI1A 1NJXA 2HRYA 4KSEB 4PZVA 3CC4N 1Q79A 3L6QA 4MO4A 2V8VA 3LUYA 3FCWA 3KJNB 4P2XA 1B3TA 1SIWB 3L2UA 4ID5A 3POTA 4ID1A 1IQTA 4JUZA 3Q89A 1Q82T 3F2KA 4K4SA 4WKRA 3DLGB 1ZA1B 1CC8A 4MTPA 2U1AA 1U4BA 2OTLS 3TUIC 4BC4A 1U09A 4NCBA 5KGWA 2W7PA 2E9TA 2PYLA 4HT5A 3U7JA 4LRDA 7FD1A 2JNJA 1HWLA 3KDOA 1T94A 3UPFA 2EWSA 3ETOA 3TTCA 4AHSA 2WB1D 4PG4A 4H8KA 2XEXA 1ZC6A 3R6MA 1HWIA 2LDYA 2QX0A 1RAHB 1KVKA 2MKKA 2YKAA 1NGJA 3ZSZA 3MN9A 3KJVA 3VV2B 1LAWA 2IPOB 3A8KA 5DG7A 5K14B 5CZXA 3UKRA 1KTVA 1PAUB 4RBUA 1XMQJ 4N41A 4HYKA 4FZYA 1RUSA 1NO8A 5D4OA 2KM8B 2J0QD 2CH6A 2DJWA 1VQOS 1C0MA 4JP8A 4K41A 1EETB 4BR0A 2D69A 2ZH3A 4J9KA 4W5TA 3UD5A 3CCUN 1OY6A 3AODA 4ZPAA 1CBKA 2E5IA 1XQIA 3BYPA 3EEQA 1BWEA 3B6BA 4PWDB 2OGUA 1NSPA 3ZT1A 1LWCA 2LVWA 2PC6A 3O3LA 4AL5A 1HBOA 4DX5A 3BO3A 1IV0A 4H4KA 2QIFA 4DR7F 5C12A 4A4JA 3KLHB 1WOQA 4WP9A 1HPZA 4J90A 1I94K 1C1CB 1FTCA 1GTEA 2W2OP 1IN0A 3H8YA 4QWAA 1PC5A 3CJ1A 2HURA 2UUWA 1KAZA 4P10A 1ZBIA 2O8BA 2AHOB 3LPEA 1CLFA 1SJQA 4C1NK 2DGWA 2XYHB 2YHYA 2OAUA 4WFNL 4H5WA 2HNZA 4I6AA 2JC0A 5LMNK 4LFAK 2B56A 4QS9A 3TUZC 5DLFA 4FJ9A 5BRFA 2PFDA 2V9WA 2OPPA 4BQZA 4DI6A 3QRQA 4M42A 1KD1O 2C42A 4ITSA 1JKHB 1SI9A 3IG1B 2DITA 2QL7B 4X66F 5L46A 2MGZB 2BTFA 2ROGA 3GJTB 3O6QA 4FW2A 1NHUA 1N88A 3JYTA 1VLOA 1FFWB 2CQIA 1C0TB 5HMXA 4H5RA 4BRLA 2FJAB 5F1XA 4OYMA 3THWA 4JYAJ 3ZEUA 1N33K 5MLCV 3NNAA 4CIFA 2Z57B 2QA4G 3HHLB 1FT8A 3T9ZA 2XNQA 3NCQA 4JK8A 4MLHA 5JXSA 3ZX2A 1IKYB 4F50A 3G4SN 4A48A 2IJNA 5HROB 3VGSA 1YRUA 4A8YA 3IXQA 2RQ4A 4DX6A 2HVIA 3LDSA 1NB2A 4ECVA 2DCLA 5RUBA 3VWSA 1DJ0A 4HCCA 4WFXA 3P5TL 2A40A 2GJIA 2JEJA 4OLAA 1ILYA 1BY9A 4FWLA 1PSDA 1EIYB 2Y1LB 1DTTB 1S9GB 2WTFA 4I7FB 4AF1A 1NDPA 1EP4B 4NE9C 3NDKA 3QETA 1ZOTA 4PY5A 2IRUA 4P75A 3H90A 4FYVB 1XMOF 4CK3A 5GAGI 4WPAA 2FLOA 2X1AA 3ICLA 3WNHA 1U0HB 5DM6Q 4WK3A 3VAJA 5H9EJ 3SV4A 2BDPA 2ZBIA 1UVMA 4A8OA 3EE3A 2P5VA 3AVKA 4USIA 1NKEA 4RWTA 1S79A 2X1GA 4P9SA 2C28A 3V4IA 2CJAA 2VONA 3O3HA 4PG5A 2E1ZA 3CCRS 4PQAA 5FDLB 3EN9A 1S1UA 2FTRA 2E88A 1SIZA 1H72C 4ZVUB 1NLKL 3A8YA 1Q7YT 1JQGA 1YJNN 4QZVB 3FGVA 2J8AA 4LF6J 4KI6A 3CCMS 2B4PA 1SL2A 4M5HA 1RT2B 5KFLA 1JJ2R 4QPXA 1J6ZA 3I4HX 1PJ7A 3VQSA 2KH9A 4WZQA 2ZZMA 2ZE2A 2ZEJA 3TWHA 2MEWA 5EY4A 2HWTA 3MAAB 1R89A 2LXFA 3R6GB 2HMPA 1ZTTA 1WSFA 1LW0A 2V7ZA 4F4ZA 1RT1A 3PEHA 2W6LA 2CQCA 3W9JA 4K2XA 4ZLPA 2KRBA 3FEYB 3HPOA 2AD9A 5EDWA 1R8HA 3CMAS 3KHYA 1Y4ZB 3AQOA 3HHNB 2MHNA 2V51B 3OW2R 1CJVA 3CD0A 3V9XA 4NLRA 5KPTA 3DOMA 4DR3F 4WF9L 4PAAA 4CGHA 2H1YA 1N36J 4DTRA 4W5QA 1UMJA 5JS1A 5M1KA 3I0SA 4B8CA 3GSIA 2R8KA 3SDEB 1U8WA 1NJYA 2IYGA 1T6DA 5C0YA 3MOJB 1AXQA 1FRXA 4JI6K 2P1JA 3SK3A 3US5A 3EE9A 4X4OA 1J5EF 2WOMA 3GIJA 5AQXA 2RN2A 3M1VA 3LWMA 2JL9A 2FJXA 2KT2A 4AD6A 2L08A 2QC3A 4E1MA 2E4LA 2QWNA 1NMDA 3AH6A 3ID6A 3TJ9A 3CJTA 2XMVA 3ZZUA 1ZBFA 2WRMA 1VDHA 3E1YA 1AFJA 3VQPA 1HNZK 3AOBA 3M8YA 4YDUC 4RNNA 4FK0A 1ZPVA 1MWKA 2DHXA 3FSIA 1NU4A 2ZJQQ 3VQ8A 2L9NA 1FEHA 3WUHA 1IVZA 3KIOA 1FX4A 4YP3A 1GMWA 4OYBA 2HBYB 3CF5Q 2ZH5A 4CF8A 3EZOA 1NK7A 4C3KA 3CJCA 4A8KA 4LR8A 1HBMB 2C1EB 1P6TA 4JKAA 1JJ4A 1YIJN 3C16A 3F9MA 4ZPTR 3P5JA 3JSRA 1U6ZA 1YJRA 3L4BC 3MD1A 3T1HK 2D3OR 4Z7YA 1UA0A 4NXMF 5AT1B 4KTWA 5B0BA 3H2LA 3I87A 5I9EB 3X1LB 4DR2F 1S5JA 5TKYA 4FJIA 2B6AB 1B9DA 1BQXA 3A4TA 2P9PB 5BYSA 4RBTA 1K9MT 3DHXA 1IH7A 1U48A 2IY5B 2JSXA 3CGIA 3NCRA 3T6JA 1C1BB 1G99A 3TOQA 3OUYB 4ICLB 3W66A 1DEJA 1WC1A 4IBNA 5EN1A 2A0FB 2E66A 1Y3JA 1RTDB 4RNFA 5EVZA 4LSNA 2RILA 2XBPA 3MTJA 1C2PA 4F67A 1LQ9A 1ZH5A 3GDQA 5IQ6A 4IH5A 2QEXS 5KFDA 4CFAA 4F2SA 5D15A 3FZHA 3LWLA 2HHHF 4MIAA 1GLFO 5HQMA 2MXYA 4X62J 3A8EA 1TUWA 8AT1B 1OMSA 1YIJS 2HHPA 4U67L 4ENOA 3H08A 1W7AA 5FDLA 1KQSR 3N5BA 4FLWA 1IJFB 2PN6A 2B51A 3MM7A 4RW6A 4GY2B 3HHLD 1ZBTA 5KT6A 3CCEN 3LANA 1ATNA 4KGZB 1QY7A 1QHAA 1Q8KA 4HEA9 4B3SJ 2QXFA 3OXFA 3CCJS 2MJNA 3EKUA 4BDPA 2WSFC 4OYPA 3BQ1A 3CT9A 2Y9HA 2KYXA 5AQFA 5C25A 1V3ZA 3SQGB 4DQIA 1FXDA 2XLIA 2DXFA 2VB6A 2OTLN 2XGPA 3MXMA 4UY8O 3L0QA 3SMZA 2DNYA 3K5MA 4QOZB 3IFEA 2QRRA 3OJUA 3UFCX 2D0OA 2XMJA 3FZ2A 4I9QA 2EFVA 4UQGA 1F3FA 3VQEA 3R6LB 1F5AA 3CJQA 3AVLA 3TR8A 3DWLA 4J9OA 1JXBA 3I0RB 1ATRA 4JEPA 2E5LF 3AA4A 4C3MA 1VIXA 4I6MA 5KG4A 2VZ9A 5CZ1A 1S6QA 2UUCF 5FROA 3THXB 3VQAA 1ZAXA 3MUTP 3ZSYA 4MK8A 1W25A 4AL6A 3SDEA 1TL7B 2NSBA 1SUQB 1Q81O 4DTUA 3EVOA 1R31A 1JB0C 4TLRA 1EETA 1VSFA 1IBKJ 4PWUA 4Z94A 1TQLA 4HVJA 1W2IA 4E7IA 4HTJA 2HFNA 4O4RA 2KTQA 1C0FA 2QLXA 1HQ2A 2OUGA 2CGJA 3M8QB 5CYMB 4Z4HA 3QBXA 4C0BA 2OZSA 2DEIA 4QU7A 1YJVA 2NRXA 1R3NA 3W2WB 3HT0A 3V9UA 4NRTA 3R27A 4B9QA 5E7OB 1HJOA 2Z1GA 4N5SA 2XGQA 1X4HA 2XSJA 2AWZA 3BUZB 1REVB 1M5SA 2E1RA 1H73A 1GEHA 3BR8A 5MLCQ 1NKCA 4KFBB 1TAQA 4CJ3A 5LY3A 1PG5B 1RB0A 4NI2A 1PC4A 2XSFA 3BSOA 1K73O 4WXWA 4V19J 4L72B 4ETXA 1M1GA 4CO4A 3B78A 4BRDA 1NLVA 1F21A 3SCIE 5K5MA 1SJ4P 5B08A 2NCKL 1UL3A 3OYIA 4LR7A 2DTJA 1JLFA 1LEOA 1VRUB 4ZVEA 2HF4A 4CZHA 3SI8A 2EC2A 4CDIA 4L3KA 3M8ZA 2E5LJ 4R8UA 5LJ5Y 2DH9A 2G0CA 4PKIA 4KHNA 3M8SA 4BHQA 1Q86T 3D68A 4JS5A 5IWAK 3VOVA 4JI5J 4NX9A 5GMDA 3T5JA 3TSUA 3R8EA 1O0PA 4OYOA 2FXUA 3CMAN 2CG4A 3JYTB 4KGMA 2DY1A 2KKHA 1E6VA 3WBZA 3NWGA 3K89A 3DLJA 1VK3A 4RNHA 4C8MA 5J2PA 5K20B 4Y1DA 4QR1A 4J9NA 2KHDA 1Z2LA 3RAQA 1D1UA 3UVJB 4LF6F 4M94A 2ASJA 1NGCA 4JBCA 5KFYA 2NRZA 1VQ5S 1M1HA 3P45B 1EWRA 2DR7A 1UEVA 2VGNA 4OYZA 2AGQA 3ZFVA 3D0HE 3QGIA 4DL5A 4Z7CA 4B1XB 3MM8A 1SH3A 3ZSRA 3RBDA 4X84A 1VI7A 2Q6CA 3I55N 3T1HJ 2FZGB 4CZJA 2OTJS 2BKNA 2AJFE 5C7PA 4IFEA 1ZYQA 1U1LA 3K59A 2IAJA 2UXBJ 3KUHA 4NPOA 4PL7A 2UUCJ 2FY8A 2DHSA 2CQ4A 4GV3A 2GMLA 1RBTA 4I2QA 4QYZK 2IBOA 2R2UA 3RWUA 3HSJA 1FXXA 1X4GA 3K5LA 2ZJPQ 1C1AA 2VC0A 2OELA 2ZKTA 3OYCA 4BE0A 3BPSP 2IGIA 2GCFA 1B70B 4E0DA 3Q8QB 2QA1A 3AO3A 4RCHA 1FNOA 2XS7A 1U7LA 3GB0A 3WXIA 1Q81T 1P9YA 5KAKA 1QJHA 1S97A 4DR5F 4P71A 4WWSA 1CEZA 3VAKA 4B3RF 3TRGA 1OS5A 3I56N 4FXWA 3UKRB 4OI4A 1NK6A 3C46A 4QU6A 3VAMA 2XZWA 5E3RA 5F8NA 2HEKA 1PIEA 4M45A 3RB6A 4ANEA 3R2CJ 4CK2A 1FVQA 5HVGA 4U67Q 5KG5A 2D7SA 1OPIA 3CC2S 2QGFB 3P49B 3AVNA 3IO1A 2JOQA 3SPYA 4CH7A 4Q45A 4BVOA 4BRFA 1IBMF 4DPXA 1X0PA 2M5YA 2CQDA 3RTVA 4PR6A 4DR7J 2D9OA 3DM2A 1HNIB 3KWMA 3BQ2A 2DEJA 4G9ZA 1SJ1A 4PG8A 3PYGA 4UOHA 1NEEA 3PJWA 1S4FA 3VVTA 2FJEB 4YOXA 2MZSA 1RAIB 2E2PA 5IOLA 1U1MA 3M1FA 2Y0BB 3U3YA 2QA2A 3DI6B 5A8RB 2R9LA 4V1Ak 5JJBA 1YDLA 4CHZA 2G1HA 4DMZA 1RCXB 4NI2B 4KB0A 4TSXA 3PSFA 2BGGA 4G1PA 1VISA 4AL7A 3BH7B 3L2WA 2KM8C 2AYMA 5KTQA 2ATLA 3C6UB 3BV8A 4KO0A 4IOCQ 1M90T 4FWOA 2DCUB 3PFOA 2KXFA 3RBXA 1TKZB 4ED2A 2MSTA 1KFSA 3Q8YA 2VQEK 3PACA 4WQ4C 4ISGA 3RMBA 4F25A 2QA4S 1IKWA 4USTA 3DYAB 4AM6A 1S1VA 1HR0F 2DPNA 2HZCA 1WHWA 2H5IB 4RWWA 4USWA 3ZO7A 3OTEA 5L1KA 2I0XA 3R3LA 4BC5A 4DQPA 4CO0A 5B0EA 3T5KA 3QAEA 5HP1B 4ZJLA 4CRJA 3BGRA 1CS4B 3WXJA 5IT4A 3W5YA 2GX9A 3BBBA 4F4WA 2AZ1A 3SMPA 4NASA 2KHCA 4H4KC 4IEIA 3J7Z5 4CK1A 4DU4A 4DZ6A 4ECQA 2YWFA 1SQFA 3LZIA 1NAQA 2ABYA 3TAMA 1F9HA 1WSEA 1SCJB 3TNVA 3QINA 1QDUB 2ZITA 1OSDA 4RU9A 4JV5J 3AJ2A 4WFZA 4C8LA 3CETA 4FWSA 4E8UA 4AQYJ 4OZ0A 3MAQA 3CQXA 3MWPA 5IS2A 1HWUA 3QNWB 2K1RB 4LVNP 4TQRA 3FVYA 4OX9J 3GBTA 3D3BJ 4CJPA 5CY4A 4ED0A 3FMBA 4R0EA 2YV0X 5KFXA 2VJVA 3FE1A 1S72N 1S1UB 2J0WA 3KK1A 3KLIA 2MZ1A 4NYPA 2HK3A 3RRKA 2NUBA 4E7KA 1HIYA 3PNIA 4FLUA 5FPMA 4HDGA 3PLAA 1NH7A 3RGIA 5I4MA 4MKAA 1JIHA 2X1BA 2HFSA 1RT7B 4N77A 4JKFA 2QL5B 2VUGA 5KOXA 4EZ6A 3OYLA 1RYSA 4B1YB 3J7AN 5B7WA 2D9PA 4WIIA 5HL7Q 3EYZA 1N48A 2VGMA 3WNFA 1IO2A 3M8PB 4FCYA 4CJEA 1U1NA 1JJ2M 2B4UA 3A1YG 2FSJA 1R8CA 1SC3B 4ZS6A 4ZTFA 3LPYA 2QWLA 2DNOA 5KT4A 2NZ4A 4P52A 1RISA 4NLCA 2O66A 5HATA 3WEEB 3X3UA 1S6PA 2AX1A 4NA1A 3TAFA 1P8ZA 1X4FA 3CG7A 3W7BA 3H1VX 1ZAVA 1LCUA 1ASVA 1QVGM 4DV2K 1RHRB 4ETZA 4MH8A 3H1QA 2OFGX 2VDHA 1VSIA 1K8KA 2AP6A 3P6YC 5AQKA 1EHWA 4DTJA 3A3PB 3KJFB 4F3TA 3PTWA 2VA2A 5AQPA 4JYAK 2J6SA 4KH4A 4QAGA 2IRXA 1JLBB 1GQEA 4ZCIA 2F8HA 1F9EB 2GVDA 4ALZA 4BC9A 8RUCA 3BY5A 3QT5A 1CULB 1TL1B 3DRRA 4X2BA 1CQMA 2DNPA 4X4PA 1O51A 1XHZA 3ILJA 1VJQA 3OBYA 5J2QA 3QESA 4HLBA 5GADU 3PXGa 3C6UA 2BA9A 2MQ8A 1U1PA 3RAMA 3VQCA 3SI6A 1XR6A 2QWMA 1UCNA 1EKRA 3C15B 1JJHA 4GKKF 1DBDA 1RBRA 4IG3B 3O1WA 4HL9A 1TKXB 1FO1A 5D4PA 3OFFA 3MWTA 3KK2A 1RTHA 3MM6A 3CMQA 2NXNA 3G86A 1VYAA 4P7VA 4C1NI 2RF2A 3A5LC 2K2PA 2WHOA 1H7WA 4CEBA 3QMQA 3CJ0A 1MWYA 2DNKA 4JV5F 3WDOA 4ZJOA 1FKOB 4UOFA 2OSRA 3NP5A 1X5OA 3MMCB 4NXNF 4N7TA 2RQCA 3OYAA 3MEDA 3AA5X 3WC2A 3BGRB 2EWHA 3HJVA 1L3UA 3FC9A 1H2VZ 4DEZA 4ZK7M 2WCXA 2IM0A 3D2EB 2DY9A 4USHA 2D0AA 1YHQN 2DFHA 4YEAA 1RKJA 3ZXWA 4IO8A 2CQ0A 1RFQA 1OPZA 1CJTB 1RT3B 3VEVA 3NY0A 2P51A 3QFPA 3T19A 4ECTA 5AQIA 4B3MJ 2F8MA 3DRSA 3CYMA 1ZS6A 4MAKA 4CLPA 1HD0A 3N4WA 3ZTPA 4FDFA 3GIIA 3LM9A 5F0UA 4FF4A 2EFPA 3OTBA 3W8GA 2YH0A 1Q4RA 2DXEA 3EDRB 2EW9A 1KQFB 3MUMP 1TKTB 4ZPDA 4FWQA 3ISNC 3M7VA 1VRQC 4CQ1A 1T05A 3K5OA 4JV5K 3M3ZA 4F26A 2C2ZB 3D6MB 1AZSB 3PZPA 4F36A 5D8HB 4B3SF 5LT5A 4KH1B 1XMQF 1S1XB 4JK9A 2XO7A 2QTWA 5D0GA 4RUCA 4ES2A 4CLWA 4V19X 2ETJA 1NZ8A 2ADBA 1RTIB 5G0RA 2QK9A 2EXUA 2MQNA 3IWLA 2G2OA 5AQZA 2AF6A 1RZMA 1GLCG 1BGXT 5D6GA 3FCHA 1K8KB 1BXNA 1HNXJ 4J8FA 5B0GA 2MJUA 4PWWA 3I6PA 1XR5A 2G0JA 3BKUA 5ETMA 1ZBSA 2PBDA 4OZLA 1ZZFA 2KFNA 1BQNB 3L4QA 4DSLA 5CHIA 3BEXA 1D8ZA 3HM9A 5J1PA 4CLFA 4LF4J 1LKZA 4LSLB 2KL8A 5IFMA 3VEWA 1SKUB 1FW6A 4DV4J 3NWRA 3QT6A 3EDQB 2LA6A 2L9WA 2VASA 2MKYA 1XIQA 1RT4A 4AXIA 5ETRA 4LF9J 1I6JA 1JLGB 2EKNA 2HQFA 3ENHA 2EPIA 3D1QA 1RGVA 4H0VB 3FZFA 6AT1B 3ZZOA 3OJSA 3U27A 2YJFA 3V9ZA 2M8HA 3FGUA 3KVGA 1S4EA 3I31A 3ZSWA 3AA8A 2VQEJ 1JMTA 4F3QA 2UXCF 2UUAJ 4ZVSB 1WSGA 4RW4A 2HMIA 2M3DA 4KAIA 2LXIA 3LOUA 3O4WA 2W24A 2ATCB 4LFCJ 2P9NA 4R5PA 4QIVA 1UWAA 4DV2J 3H2VE 5DDPC 3CSKA 2KVIA 2CNKB 2Z56B 5BRHA 3H5SA 4CLKA 2QSFA 4OZ1A 1N52B 4CBXA 5IWAF 1E6VB 1W0HA 4FPRA 2AYBA 2J9DE 4EP4A 3ISND 2YWHA 5EX5A 2BJ7A 3UKUA 4DV4F 1IR0A 4Q0BB 1JNZB 3ALYA 4DCPB 4PYDA 2NUUG 5HANA 5EGYA 3QBWA 2VD3A 2NXUA 1S1VB 3UIQA 4Y2CA 3LDOA 2IM3A 6FD1A 3PSIA 2Q43A 3ULEA 4C2MA 3SUQA 3BO2A 4L73A 4MK9A 2YHWA 3ZT2A 1U0HA 1W9HA 4JN4A 4OYIA 3GE9A 2KN4A 1B0TA 1L3VA 3SUOA 3HD1A 2JWNA 4CGDA 2DRDA 2QO3A 3KK3A 3PHEA 3FFIB 4CO3A 3AD9C 3G9CA 4D3HA 1BLUA 3QJPA 3HSZA 2HHWA 4DPOA 3T5HA 2J8SA 2G8HA 2FLNA 4DL3A 2CJXB 5IZHA 4LBPA 5ADXA 3EVMA 3HKWA 5F8MA 1R8AA 3DKDA 3FEZA 3RUBL 2OP5A 3AJ1A 5F9NA 3AT1B 3E51A 1RTDA 3BSNA 4ERDA 3AAQA 3PYFA 4WBFA 4AHCA 2HNDB 2R7UA 2IM1A 1SJRA 4E89A 2E8AA 3D45A 3HLUA 5L9XA 3VHQA 3SQ1A 1S59A 1AYEA 3CJRA 3IR5B 3NVMA 1SXLA 1FTRA 2PSZA 4ECYA 3FFIA 4KHQA 3MI7X 1BMQB 2RIJA 2FBTA 2OANA 3DXSX 2XG8A 2HYIB 1B64A 1S0VA 4C8YA 3VQ5A 1Q82O 1X5TA 2CKWA 4DR6J 4BGAA 4ECWA 2CQHA 2Q0UA 1YVUA 3IR6B 2VDIA 2I5JB 2F3JA 2LKZA 4CESA 1CJVB 1JX4A 4DU3A 4PKGA 2LQ9A 3QNNA 3GYNA 1QAYA 1JJCB 2A1BA 3TUJC 1TMMA 3R9LA 4CJRA 3EMTA 5BYRA 4FF2A 4WQ5C 1OY8A 2XC9A 1EAYC 1J54A 4M5KA 1SB6A 2XB2D 3QWPA 3GWCA 3TW0A 2P6TA 4M5DA 1TUVA 1WEXA 3U4LA 2K7KA 1A6LA 3VAFA 1OH8A 1BCMA 2JFDA 3NF9A 1IJJA 5KFOA 2HFVA 3NGDA 4M3XA 5KFEA 5EOYA 1HW8A 3VQTA 2JWLA 4A8QA 2KT5A 3KFWX 4DV0J 2XWYA 1KRPA 2CPDA 1FHTA 3BKFA 1B0VA 1CJKA 1PJ5A 4IOBA 2HBMA 3EKSA 1PBAA 5LSOA 2UV8A 4CERA 3HVAA 1Y64A 3RB4A 2JVOA 1IKXA 3E01B 2IBKA 1TP7A 2BANB 4KRFA 1F1BB 1BISA 4WCEQ 3C16B 3CCWA 2F63A 3GJRB 4F4AA 5A2QY 3CD6N 5L39A 4ZOSA 3SXLA 1UA1A 1F3VA 2FJBB 3W2VB 3TARA 3LGNA 5AZJA 4LUBA 4FJ7A 4LFAJ 2I7PA 5HQ8A 3NL0A 3VPZA 1VK0A 3ZSOA 5EHHA 3J7AP 5E33A 1DTQA 4B9LA 3Q86A 4ZP7A 3OHAA 3DLHA 1XJWB 4QPTA 4A8XA 2H5JB 4BRNA 1HW9A 4XH4A 3BP8A 2YNIA 3FK4A 3VR1A 4H03B 2WVDA 2W9CB 2W9AA 3LP1A 3KK2B 2BOPA 3SCLE 4MQ3A 2RMLA 4X4TA 4JS4A 2ZH6A 3NGYA 2KYZA 2HVZA 3GFXA 2IIHA 2YNHB 2W4CA 3NS6A 4CGGA 5JLHA 2J7UA 4RW8A 3V6HA 1JLFB 2R8IA 1BIZA 2UUAF 1FRIA 1D5AA 4NCAA 4YB7A 2I7NA 1XMBA 4Q8EA 2CJQA 2ZM6F 3OVBA 4EUVA 2DGOA 4OGEA 1LW2A 1EP4A 1VSLA 2RHQB 4TU8A 1Z26A 3HI9A 3RJMB 2IHR1 2HLUA 5KPRA 3IA0A 3T1AA 1WLJA 5LJWA 1DZ5A 3GILA 3I55S 2AP1A 1N32K 2F40A 3P96A 3NH1A 1BA1A 5TKWA 1WB9A 2AYGA 3SQ4A 2YKMA 4LRCA 2DFFA 3O1LA 4DL7A 3DLBA 3I32A 4OPAA 3VQQA 3MTKA 1RWVB 3D3CJ 4B9SA 5HJXA 2GIFA 3CHWA 4LVOP 3K17A 2R4FA 3Q24A 5LMNJ 1BIUA 3NMUA 1O13A 2V9KA 3GIRA 1HMVB 2CPIA 1R43A 5A6WA 3IBCB 4JI8J 1S1XA 1VQ7S 1JCEA 4RW7A 4CJVA 2BJEA 2JC1A 1UZHA 2H9ZA 4IYQA 4C23A 3TABA 3IC1A 3OXGA 3CXCR 4YS2A 4I2PB 4JI3K 4CIOA 3GL1A 1TL7A 4ZCLA 4GMKA 1D09B 2XS5A 1YJNS 3ENVA 1X5PA 3M8RA 3KLEA 4PQUB 3UD4P 4OIXA 1X9WA 1Z05A 4PRFA 1YJ9N 2E5HA 5JVGQ 4UW2A 1Y3KA 4NEYA 4DSKA 2CQ1A 4ZVPB 5LXYA 1OSCA 4CEDA 3E66A 2ZE2B 3KZBA 4KT0C 1IJEB 1RHUB 1FNXH 5THWA 1DQ8A 3A12A 1KC8O 1LWXA 3D9BA 1E6YA 2OPSB 2LFVA 4WFYA 2A3ZA 2XMTA 3GV5B 5KG0A 3I8DA 4WFAL 3W0LA 4OHZA 4RO0A 2F1FA 1GLJO 1S1WA 5HK4A 1VQMN 1SZ2A 1PILA 1ZA2B 5A8WB 1VQNS 2GQQA 5HVHA 1KEKA 2FB0A 3CJBA 4N8NA 4EK2A 3UNGC 4Y6IA 3QIPB 1PGZA 1JXVA 3VQ6A 1GH8A 5DM7L 4DTOA 1Y5IB 2B8PA 3N4QA 4YOTA 4JI6J 3FEXB 3I8BA 2QL9B 5F9LA 2E2OA 4L3NA 3CCZA 1NNEA 2X74A 2FLPA 1FRLA 4XTTA 2ZJRQ 2DGSA 5IXUA 4DV5J 4CLZA 4KHWA 3KG4A 4BRHA 4CZKA 5K9FA 2RH3A 3TP2A 4AQYK 4FXDA 3CJ7A 4BVPA 3NGSA 2W1BA 2NZTA 3U9ZA 1YJUA 2P9NB 3MZIA 2LEBA 1HQUA 2CNLB 2K7JA 2YWKA