2KLAA

Nmr structure of a putative dinitrogenase (mj0327) from methanococcus jannaschii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
GHMINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0327
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Oxidoreductase
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2klaA00
2KLAA 2YX6A 1RDUA 2WFBA 2RE2A 2QTDA 1P90A 1O13A 1EO1A 1T3VA
chains in the Genus database with same CATH superfamily
1K8AO 3LM2A 3UIQA 3AVFA 3ULDA 3QFPA 1EQYA 4GV3A 3NGZA 5AQMA 1BI4A 1KFDA 2NRTA 3HT3A 3ZT2A 4M63C 3HRGA 3O3GA 4O8KA 4JI4K 2P1JA 4LY7A 3CERA 4FCYA 3SUQA 5AQUA 4UY8O 1C1BA 4IFVA 4OKEA 3AVBA 2X74A 4CZKA 1EETA 5JLFA 2VWBA 4CFDA 2A1SA 1KCFA 4DTXA 5AQTA 3VEZA 3FFIA 1NWKA 1W9HA 2A3ZA 4EHTA 3J8AA 4WF9L 2ZJRL 2V51B 2NUBA 3SLCA 1C1CA 3HZ6A 4CFCA 1TUUA 4ILJA 3S41A 3CJCA 4OLBA 4KHPK 2RPIA 3ZX2A 4QAGA 4U67L 3QO9A 2ZJPL 4KH6A 2E2PA 3AO3A 1HR0K 4G9ZA 1T6CA 5FRNA 2A5XA 3M8QA 1HQUA 4M3XA 3SUOA 3I55N 2DY4A 3NGIA 4FZZA 2NRVA 4MDBA 3KLIA 3KJVA 3WXIA 3IUCA 5AQJA 4FZYA 4DSIA 2P9LA 4RW9A 3ATVA 3AVGA 3BY5A 5GIOA 2QXLA 2HOEA 3AVKA 3PSIA 5KPRA 1WSJA 1WOQA 3BP8A 3IS9A 1RNHA 3GL1A 5AZIA 4DCHA 3TAEA 4BVPA 1T03A 2HW3A 4JKHA 3QEIA 2IDOA 3C0BA 3PO5A 1TL3A 1YVUA 3AVMA 4PL8A 3MMVA 3TTDA 2IVPA 5AZJB 3LPTA 2FF6A 4F2RA 4O5FA 1G99A 5KPTA 2HSTA 1QVFM 3CPWM 4CVNE 4IOAL 3O1WA 1NOYA 5J2NA 3HYFA 5F2RA 2HBJA 3ZSXA 2BGGA 2ZQBA 2D0OA 4G1QA 4EAHD 3V1RA 4DWIA 5AQRA 5GADP 5M1QA 1RT4A 2AJQA 5C2DA 1VQPN 1GLEG 4H0XB 2Y1IA 4CGIA 2XRIA 3ZSWA 4NXNK 2HHXA 4I9QA 4AHRA 3JAMO 3LPUA 4M3WA 4OPAA 4FWMA 3O9RA 1DGKN 3CFOA 3HK2A 4M3UA 4HTLA 4F8RA 4W5TA 4FW1A 1VRUA 3FZMA 3H1VX 3FGUA 1BGXT 4W5OA 3OYNA 5E26A 5MLCQ 1U2VB 1LWFA 4LSLA 1HPMA 4LH5A 3C6UA 2DTUA 5AQFA 3T1AA 3LP0A 4E1MA 2KFZA 4ISFA 4CZIA 2QA4N 4YOXA 4ID5A 1CZ9A 5T7BA 5KTQA 4OKKA 3KD5E 2NZTA 2E6MA 1VSJA 1N34K 2P9SA 4HCCA 2Q3SA 3NF8A 1NGEA 3KVGA 1HPZA 4BC4A 3E66A 1NGJA 3CQ8A 4B8CA 3L3VA 3THXB 1U49A 3CMEN 4N47A 2BH1A 3BUZB 3RRHA 2GV9A 3THWB 3OYCA 5IT9O 1GLBG 3HP6A 3ZT4A 4Z94A 1XMQK 2O8FB 4CJTA 1UWBA 4IOXA 3EL2A 3CQYA 3V9WA 3O4NA 3O4QA 4DU3A 4JYAK 5F1XA 3KZBA 1HUXA 1BA0A 3DXKB 3L3UA 3QEXA 1IJJA 4F3OA 1Y97A 4DSEA 3AGRA 3D2FB 4CJ3A 1JXEA 2D0BA 4IO9L 5HRRA 3DMJA 1XHXA 1VSDA 4ISEA 4DR5K 3R8EA 2CGKA 5ELZA 3VEWA 4DV3K 5EOYA 3OYDA 3DRSA 2G8FA 4CJLA 1P8ZA 3DLKA 4JHDB 3HJFA 2ASPA 1CLQA 2Q1NA 4CZEA 4AHSA 4FJMA 4BREA 4GVMA 2HBLA 4CBUA 3OYMA 1NU0A 4B1WB 1YJNN 4J2EA 4H0OA 1NK9A 1ITGA 2UUAK 3A0IX 4BRAA 4WFAL 4JRPA 1M1KO 1XWLA 5BN8A 3V6DA 1VSMA 1Y64A 4H5NA 5M1PA 3QNOA 3WNFA 1RBSA 4CF0A 5KPZA 1JL1A 3CQXA 3CCMN 1T05A 2Z1HA 3VQPA 3SK3A 4KBOA 1VSEA 5C25A 3LDQA 1X3NA 3MXIA 2LSNA 1ASUA 4CD3A 5JS2A 4HHTA 5LY3A 4CJQA 5HLFA 4H0YB 1HMVA 1K6YA 3TI0A 3U4LA 2UU9K 3T1YK 3FLCO 1LWCA 4CJRA 4R5PA 2IGIA 1IBKK 1RILA 2OZMA 2NRXA 1VQ6N 4BC5A 2UYTA 3L2QA 4JI1K 4DV4K 3KWIA 2WTUA 2YNIA 3CCRN 4OJRA 4BDZA 4JRQA 1ZBIA 1YF5L 5AFUA 3OS1A 3TAPA 3PIPL 3MX2A 3VQEA 3F73A 3VEVA 5HRSA 2IVOA 3A2FA 2XY7A 4RTFD 3O3FA 3VA0A 3WT0A 3RMBA 1C0MA 4V19S 4W5RA 4JV5K 3TAQA 1VQLN 1IG8A 2YNFA 1RT1A 2ZGYA 1S1TA 4JKDA 1TKXA 3RWUA 1ESVA 3E9OA 4L3QA 3O9TA 3G4SN 1YTAA 3LWMA 3ZEUB 4AM6A 1ASVA 3AAPA 3H1QA 1QSYA 4KHNA 1S1UA 5BRFA 2YV0X 1KAZA 3CYMA 4FWOA 4BROA 1NJXA 2NRWA 1TAQA 3FZHA 5BRDA 1IH7A 3KIOA 3NH0A 4FO0A 1SL2A 1VSKA 4DV7K 5KI6A 4RW8A 3T69A 2YHXA 5GAGP 4DTUA 1NGIA 1RTHA 2WONA 2KZMA 1HJOA 4F3TA 4GKJK 5J1EA 5F0XA 4KKOA 4RG8A 3AA5X 1GOAA 4A62A 3CIPA 4JI8K 1HNXK 2VG5A 3CC7N 5C10A 3DXKA 3MK6A 3SUPA 5FPEA 4HUFA 3VQ8A 1VQON 1GLLO 1RDDA 3HL8A 1ATNA 3HVRA 3SAFA 3HP9A 3DXMB 1OH7A 1BI4B 1IBLK 3ZSOA 4AQYK 2GTDA 3DM2A 3U6FA 1BDGA 5HRNA 4IDHA 4BY9C 2ZF5O 3VETA 2E6LA 3ENHA 1JLBA 5KRSA 3IKMA 1WBBA 3VERA 5DK5A 4FLYA 4WFBL 1J9AA 1WN7A 4RWTA 1SL0A 4OKJA 2HF4A 4QCLA 1VQ7N 2YCHA 4RW7A 5AQPA 4FZXC 4WYBA 3F2KA 4TSXA 3QINA 2ZD1A 2P5GA 5FLXO 4K41A 4DTPA 4M42A 1X9JA 4NCGA 4FYDA 3EN9A 3WXLA 1RBVA 1S72N 3QEPA 3OY9A 1HNIA 1S5JA 3EZ5A 3ZCMA 3U8XA 4NO7A 5K14A 3G71N 3HPOA 4K25A 4JD2A 4R79A 4YOVA 4PY5A 3VQBA 4DQRA 1QQMA 3LAMA 1QSSA 4H03B 3OYJA 2F9TA 3TR8A 1XC9A 4FJ8A 3DJCA 3UB5A 4DQPA 3RR7A 2P9LB 2HNYA 1S6PA 1U4BA 4M3RA 4OGEA 3LP1A 3SQ2A 4HCBA 4W5NA 2FF3B 2YJEA 2HBMA 1EWRA 3KTQA 2D0PA 2YKMA 3TPQA 4CE9A 4CF8A 5AZIB 2E88A 4ELVA 4LSNA 3LALA 3HTVA 1QTMA 3V9SA 2HHQA 3TAMA 3PX6A 1BL3A 3U9ZA 3F5TA 1GLDG 1JLFA 2HMPA 1MWKA 3MN7A 4I6MB 3ZX0A 1KC8O 4DV0K 3ENBA 3G6EN 2HF3A 4IO8A 4ID1A 4OO1J 4JKEA 2DFEA 3CCLN 4B1XB 3SJJA 3AO5A 3CXCM 1X9WA 2FLOA 1ZBUA 5BR8K 5C0YA 2PZSA 2HHTA 1NK4A 3KLEA 4DB3A 3M5RA 4X64K 5LJWA 5A2QO 3DLBA 4CGDA 4IZ9A 2V7YA 4DFKA 1REVA 3MN5A 4Y1DA 3TTFA 1WSIA 1HYZA 1B9FA 1DEJA 1E4FT 4O55A 4FK2A 2D0CA 4CF9A 2ITMA 5AFUH 4HUEA 4KH5A 3TABA 4CBXA 4B9MA 4EP4A 4QS9A 3AVNA 1T8EA 3VQCA 2XY8A 4JK8A 3DLRA 3AVAA 4PKGA 1KQSM 1OH8A 3QLHA 2XY5A 5JVGL 1JLGA 4E7LA 4Q5VA 1Z05A 4JKBA 4C8LA 2PFUA 3L8BA 3VF4A 1QE1A 3WXKA 4CEOA 4KRFA 3QEVA 4I9LA 1U47A 2HHUA 5E41A 4DSLA 3H3OB 4Z4FA 1A5VA 3M3ZA 1C0FA 4BRNA 4XH5A 4YDUC 4GY2B 1NKEA 2P9SB 2QI2A 4CJFA 4A61A 4A2AA 2YHYA 4DU4A 4O44A 1YI2N 5KRTA 4FJIA 1KAXA 3NH1A 2UXDK 4CFAA 4LF4K 3BZKA 3DXMA 5AQHA 3KK2A 4EHUA 3ALYA 1S1WA 1JXBA 3RRGA 4KB1A 3I0RA 3TAGA 3EKUA 2W6LA 2QW9A 1BQNA 4Z4GA 3S3OA 3TU5A 4B9TA 3VF2A 2QWQA 3D45A 4FJ9A 4J8FA 5EXWA 1MU2A 4C8NA 4KAZA 4LFAK 4M7XA 3QBWA 2G8KA 3DRPA 3K5OA 1KSPA 4ELUA 4CEBA 4RCHA 2E4LA 3C6AA 3N4QA 4EZ6A 3LDPA 3CC4N 2F4VK 3CFPA 1XC3A 1JLQA 1NGAA 2D4WA 5HRPA 4OVLA 1TAUA 2QWLA 3TSPA 1YT3A 3C7NA 4DQSA 4F2SA 2QXFA 3AVIA 4GVEA 1TKZA 4LF9K 3U3GA 4H5VA 4BDYA 4DLEA 1HNZK 2VQFK 3GG4A 3J80O 1NGGA 5GAEP 4H5RA 4JEPA 1LWEA 1OVYA 5FPMA 3CFRA 1U6ZA 2O8CA 1HNVA 3NBPA 3ZT3A 2GUIA 2HNDA 2ITGA 4B3OA 1C0UA 4CHYA 1UA1A 4O5BA 4CEQA 2A40A 1RTDA 4BR0A 5DM6L 5JVHL 3LP2A 4RW4A 1W7AA 1TK5A 3JSMA 1FXXA 3H6EA 2E2QA 3PSFA 3VQAA 5JICA 3THYA 2OPSA 3LP3A 1QVGM 4HVJA 3KD1E 1IKVA 3CCUN 4BE2A 2XY6A 2X6NA 3QMLA 3EY1A 1WSGA 4CBWA 1BG3A 4FVUA 4X62K 4C1NI 2IOCA 4I6MA 1L3SA 4IOCL 4FK0A 3O9UA 2HHSA 3PX0A 4E1NA 3Q7CA 3SBGA 4WE1A 1HYVA 4EZ9A 2VGMA 2FC0A 4ILGB 3NH2A 4CZFA 2Q0UA 4JS4A 2F9WA 2WFBA 3QIPA 2YNHA 3FR0A 1GLJO 1XNQK 1BIUA 4FJ7A 3MN9A 3IFRA 1CZBA 4CJ5A 3H3NO 1MDUB 4DHYA 3CETA 3NFAA 2P5OA 3CHWA 4DFMA 2D5RA 4DMNA 3L6QA 4JI2K 1QSLA 4FWSA 4DR4K 5D3GA 3S3NA 2O8EA 4CHZA 3NGYA 2OCEA 1VSIA 2HVHA 2YHWA 1VSFA 1RDBA 5JMVA 4J2BA 1VK0A 3ZSYA 1CXQA 2P9NA 3EZWA 4BRQA 3BF1A 4DFJA 5C15A 3SQ4A 3FZFA 3G0ZA 4BQLA 4M41A 3VQ5A 3PY8A 3VEXA 4J2AA 4B9UA 4DQ8A 2E5LK 1BO5O 4CK3A 1J6ZA 4DTOA 1SAZA 3MWTA 5FRMA 2ZWHA 1Z26A 2AP1A 1VQ4N 3O4WA 1FK9A 3MEGA 3ZX3A 4DG1A 3SMSA 1SUQA 4CJEA 4BRMA 3J7ZO 3UE5A 1BIZA 3DLGA 3LM9A 4DTNA 4B1YB 1M90O 1ATSA 3NE6A 1RT3A 1T44A 3WNHA 5BPLA 4YDUA 3OYGA 3PX4A 5C24A 4CGHA 2OTJN 2NNWA 3ATUA 4JKGA 4PHTX 1WAJA 3OYLA 4Z4IA 4BR4A 1TUYA 2P9UB 3LDNA 3J7AP 3WQUA 5H1SQ 1X3MA 4ILHA 4CZGA 3VTIA 3AA4A 4B9QA 2O4IA 4CJSA 4KREA 3SQ0A 2GEMA 3OYKA 4AM7A 1TKTA 2ATQA 2IAJA 5JS1A 4IJNA 2KFNA 1B9DA 2HBKA 1ZBLA 3TSQA 4LH4A 1HLUA 2UUCK 3PLAA 5J2MA 3HOTA 4IKFA 1KTQA 2IIRA 5C2FA 3OBYA 4CW7B 1J54A 4KV8A 3LZJA 3QNNA 2E1ZA 5BREA 4JI5K 1VQNN 3VN5A 2NLXA 4MFBA 3ULEB 2OYQA 1XUPO 2B5JA 4IWVA 4PL7A 4LF8K 1E3MA 2G8UA 1SV5A 4AF1A 4FWQA 2Z1JA 3EO3A 1A5XA 3OJSA 2RF2A 3V1QA 1TV6A 3WEEB 1D4XA 5I42A 1R59O 3K59A 4CEAA 4FJXA 2PY5A 4E19A 2B6AA 2O8BA 2BUPA 4BE1A 1NNEA 4CJ4A 3VA3A 4Z4EA 1ZBHA 3WUHA 4JKCA 3Q7BA 3EYZA 3MCAB 3A5OC 4BRDA 2PYLA 1N36K 5DM7L 4JD2B 1ZBFA 1BWFO 1JKHA 2QWPA 3MEDA 1BU6O 4B3SK 3A5LC 3EEQA 3NVMA 3WNEA 1JLCA 2GELA 1WAFA 1KD1O 3TTCA 5AQNA 1SZ2A 2PYJA 3P83D 4ISGA 4JI3K 4FOEA 5EU7A 5IWAK 3J81O 1RT6A 4CZMA 3MCPA 5J2PA 4XH1A 1QZ6A 4NYFA 1VSLA 1OKJA 2QM1A 5AQGA 1VQMN 5C42A 3L2VA 4OPKA 4DQQA 3SCXA 4B1VA 4CHQA 1L3UA 3AY9A 3M1FA 5SZTA 3MXMA 3IRXA 3AVCA 3QBXA 1NGDA 3RMCA 1D8YA 3MN6A 4DS5A 3K57A 4LF6K 4DFPA 2G8HA 4C8MA 4DUYK 4H5TA 4DR7K 1D9FA 1GLFO 2QK9A 1S1VA 1NJWA 5EY4A 3QIOA 3C95A 5AQIA 2OA8A 1VQ5N 3LL3A 2YX6A 1NK0A 4NCBA 4ZHRA 3DYAA 4DTMA 1K9MO 4B3TK 4FWRA 3DLLL 2CH6A 4E7JA 4FJ5A 3AVLA 1V4TA 2Y1JA 3LDOA 2O4GA 4YOYA 1L5UA 1ZC6A 2XO7A 4IDKA 2HB5A 2UXCK 1YHQN 4AHVA 3VEOA 1SS6A 1HRHA 4CIEA 2OANA 3ISNC 3CG7A 4LD0A 4JI0K 2V52B 3E01A 1N6QA 4CJUA 3KK3A 2I5JA 4DS4A 4MO4A 2P9UA 3CI5A 5ADXA 4O4GA 3HOSA 3ZSVA 2YNGA 4DSKA 3O80A 1W2BM 1IO2A 3T1HK 4MO5A 5M1FA 1XHZA 3T3FA 2KLAA 4K42A 1S22A 1BOTO 2ASMA 4CK1A 3ZT0A 4CIFA 4K8ZA 4JK9A 4WQ4C 4MLHA 1T6DA 3FZLA 4CFBA 2X78A 3GE1A 1NMNA 4PA1A 4BQZA 1VQ9N 1CZAN 5I9EB 5FROA 3D0PA 4OX9K 3BF3A 3ZSQA 3NDKA 4Q0BA 2A42A 1ZBSA 1C1AA 3ULEA 1S6QA 3G25A 1IKXA 3V4IA 2D1KA 4FWKA 3ZSZA 3C65A 1H1VA 1LAWA 3DAWA 5BPMA 3O8MA 2NRZA 3WEEA 5C12A 4EFHA 2GWJA 1RT2A 3OYAA 2HVIA 1YJ9N 1NM1A 3I0SA 2YKNA 5BRHA 3HVTA 3O3HA 2W42A 3C7NB 1ZXOA 3QESA 1Q8IA 4FXDA 3O1BA 4FPBA 1FW6A 2P9IA 1Q18A 4BR5A 5I3UA 3I33A 5AQQA 4KTZA 3SQ1A 4B9NA 1YITN 5JLHA 3OYEA 4EIAA 2HMIA 4BDPA 2O8CB 1V4SA 1L3VA 3DRRA 5AQKA 4FJHA 3P39A 4GW6A 1EKEA 2WBNA 3CPEA 4K0KK 2DPNA 3CJ7A 4F9OA 1S3XA 2G8VA 2YHAA 2OPQA 3HBTA 1OH5A 4C8OA 3THYB 2D0AA 3AAQA 3M8SA 2ETJA 4BRIA 3SMPA 4FJKA 4BRCA 4CHPA 3THVA 3BGRA 3RVCA 1BA1A 4JI6K 1CXUA 2ZE2A 3TWHA 4CIGA 1NGHA 3GDQA 4JS5A 2BDPA 1P90A 4QOZB 1QQNA 4DR2K 3V1OA 1RDCA 1WB9A 4BRGA 4WCEL 4B9SA 1D9DA 2J4RA 5LMUK 4YORA 3RSEA 1N32K 1I94K 1A5WA 2GBZA 1X9MA 3F9MA 4FLTA 1DKGD 3VGKA 3K5LA 4FLZA 4CHOA 3GOIA 3HSTB 3KK1A 2Q36A 1BUPA 4AHTA 4CI6A 2Q0RA 2OZSA 3CJAA 2WUSA 4IFYA 4A59A 1C0GA 4N5SA 4E3SA 5HBMA 1BCMA 3NAEA 2O8EB 1TL1A 1R0AA 3AGKA 3QB0A 3CJ1A 4BRFA 3S3MA 1VRTA 4U7BA 5DMRA 2F8TA 2YI1A 3CC2N 2JLEA 4MLEA 2NRHA 5EX5A 1KXPA 2P9NB 4DTSA 3OYBA 1SQKA 4IG0A 1N33K 3DOLA 1RT5A 5SWMA 1VHXA 5KGWA 4DTJA 1SKRA 4FM1A 2UUBK 4ICLA 2V7ZA 2BE2A 1MWMA 4WQ5C 1Q86O 1UAXA 1FJGK 4I7FA 5M1KA 4AH9A 3ZLJA 3LANA 5AQZA 5BPNA 3E1YA 4KTWA 4NLBA 2QKBA 4CJPA 4DQIA 2VWKA 3FE1A 2P9PA 3C6HA 1Q82O 2YJFA 3DWLA 1RBRA 4DV1K 3QEWA 3BEXA 1HKCA 1WBDA 4JKFA 2G8WA 3L2UA 4IEIA 5CE3A 2W6KA 2HHVA 3RMAA 5AR0A 4BRHA 3NVKA 3H45C 3SYZA 3FZKA 3MWPA 4E89A 4NXMK 4BRLA 1IBMK 4JKGB 4AILC 2QKKA 2O8DA 3MEEA 2Z1GA 1J5EK 4K8XA 4WQ4A 4CEFA 1NJYA 1RGIA 4DSFA 4PKIA 3AA3A 3VQQA 2KTQA 3JS6A 3D2EA 4BR7A 3NCIA 3CCSN 4BACA 5HP1A 2E2OA 3TSUA 2RHKA 3ZYYX 5ADXH 1RDAA 2ZM6K 5KQ8A 1TGOA 1EXQA 4DF8A 2I7PA 2ASOA 4CEZA 3H46O 5M1NA 3TAFA 4JAXA 5CZ1A 3V9ZA 4PWDA 3HSCA 4H0VB 4KO0A 2KHOA 3O5BA 3M8RA 1RDUA 1RFQA 1HX1A 1HKGA 2VG7A 4BVOA 3IG1A 4FLXA 3HM9A 3SJHA 4KHYA 1JCGA 2FSNA 4X66K 1RTIA 4A5BA 3RR8A 4LF5K 2G8IA 4CF2A 3SZ2A 4Z0UA 5TKWA 1SL1A 4MQ3A 3F9KA 4M7YA 1U04A 3OS2A 1BHLA 5LL6Z 2Z1IA 2BTFA 1U48A 2O8BB 4MDAA 4B08A 4KHQA 4DSJA 5B8HA 2A6AA 2F7TA 2P9KA 4KFBA 4M3YA 4E0DA 4CECA 4FK4A 1E4GT 3VGMA 1FKPA 3HPHA 2QWRA 3TANA 4B9VA 4DUZK 5HROA 4Y1CA 4BG9A 4GV9A 1EX4A 4C1NK 1QQCA 4GV6A 2IVNA 3EE9A 4BRPA 1WSHA 2X6SA 3V9UA 4FW2A 3P38A 1JL2A 3CCQN 2IS3A 4RW6A 1S1XA 4JLHA 1IV0A 3NF6A 4NLCA 3M6GA 3KHYA 1NK6A 1ATRA 1RBUA 3OVNA 3HXMA 3HM8A 3LDSA 1XI1A 3LWLA 3HI0A 3L0QA 3AVJA 4HUGA 3UKUA 4KHWA 5CHIA 3KLFA 1UA0A 1NJZA 1QS4A 2WC9A 3KLHA 5CZ2A 3D6RA 1WLJA 3CJBA 1MA9B 3OYFA 2FBXA 3C6TA 3R6MA 4W5QA 1BQMA 4Z4HA 4IG3A 1C6VA 4OGCA 4CJ7A 3I56N 1JCFA 3M8PA 3AA2A 3J7YP 3K2PA 4QS8A 5FDLA 3SPZA 5HOOA 3B6OA 3AVHA 1EP4A 3IDHA 3TARA 4OLAA 4CESA 5FPNA 3ZETB 1NGFA 2FSKA 3ZT1A 1HKBA 4DV2K 4C23A 3O9SA 2W40A 5LJVA 1U45A 3VQ6A 4E7HA 3OW2M 4CCHA 4WQ5A 1K8KB 4X65K 3CM5A 1JJ2M 2YHBA 2WOMA 1Q9XA 3U9DA 1ASWA 4FLVA 4ZTFA 4K43A 4C8KA 4DV5K 5GIPA 2GWKA 3AARA 3BDPA 4BGAA 3MECA 5KQDA 3K5NA 1NGBA 5CR4A 4JKAA 4CJWA 3U3YA 2F8SA 2QEXN 4H0TB 1G15A 4KI4A 3L2WA 3IMXA 3B6PA 4IFEA 3IAYA 4JN4A 4BR9A 2HNZA 1X9SA 3DLHA 1DLOA 2RKIA 4CERA 4DKWA 1J53A 4FSVA 3R9PA 1XQSC 1N8RO 2XHBA 4LFBK 5AQLA 1TYQB 3FFKB 2PBDA 4FJLA 2KQ2A 3VGLA 1I39A 3AO4A 3VPZA 4BR2A 2UXBK 4PUOA 4H8KA 1F21A 1LW0A 5AJ3K 1RT7A 2EHGA 4CF1A 2JWLA 4A5AA 4FPAA 3KLGA 1GLAG 4DF4A 4FJNA 5J2QA 5LMNK 3V81A 4JI7K 3ID8A 4LC9B 1RDWX 3K58A 1NK5A 1HQEA 2ZGZA 1IG9A 2VWJA 4HTUA 3A5NC 3VOVA 3W3DA 4M3TA 3VEYA 2FBYA 4PKHA 3P5JA 4H4OA 2P9IB 5CYMA 3C94A 1VQKN 4B9LA 4XEIA 2ZJQL 2B4JA 4XH4A 1W97L 1JLEA 4CGJA 4CHNA 4LF7K 2Q31A 4DTRA 4YOWA 1DT9A 3MX5A 3SI6A 3ENOA 1IKWA 3SUNA 4KH4A 1I3AA 4N76A 4O0IA 3E9LA 2E8AA 1S9EA 4BC3A 3KKRA 3LAKA 4DR3K 4CK2A 1TVRA 1BISA 2VYPA 1Z25A 1TK8A 5AZJA 1YUWA 1IKYA 3AO1A 3JXUA 4BC2A 4BWJA 1YAGA 2IC3A 3QERA 2JWKA 3OHRA 4KPYA 4YOUA 2PAVA 4A2BA 3PIOL 1Q9YA 2VG6A 5M1OA 3RTVA 3WXJA 3UKRB 1NMDA 4E1JA 2DFHA 4A57A 3MXJA 4CZLA 3MAQA 4IJAA 4F4KA 4I2QA 2CGLA 4GMJB 3T7ZA 3ASMA 4CJKA 1KAYA 3RSEB 4Y0WA 4KI6A 1WUAA 4FL9A 3SAGA 4CGGA 2Q2RA 5GAHP 1DTTA 1WSFA 1ILYA 2Q97A 3ZETA 5CYQA 3A5MC 4FWLA 4M3ZA 4FWPA 2GX9A 3G10A 1HNWK 3NF7A 3P4IA 4DU1A 4GKKK 1Z6RA 3HPGA 1QZ5A 2JGUA 1K8KA 2E2NA 1RCHA 1YVNA 4FM2A 4IEEA 1EWQA 3VENA 1U2VA 2QWOA 1D5AA 3VF6A 4N56A 3OYHA 1YXQA 4CJVA 2P51A 1SKWA 3VQ4A 3EE8A 2E1YA 5HL7L 3W0LA 3RMDA 4BWMA 1XMOK 4B1UB 3VMFB 4DR1K 4DV6K 3OYIA 3CM6A 2F96A 5AQWA 4FJJA 3P31A 1YTUA 1GOCA 3OA9A 1NBWA 3A8YA 3KK7A 3LDLA 1B92A 2CGJA 1NLVA 4FLUA 3VTHA 4PQUA 3K9KA 3THXA 1LW2A 3S9HA 3P1GA 2P9PB 2QWNA 4UQGA 2KKZA 5AQOA 5AQSA 1YJWN 1LOTB 3THWA 3B8AX 4Z4CA 4H4MA 2O8FA 1J5OA 1O1WA 2HHHK 2W41A 1KRPA 1DTQA 1NKBA 4B3RK 3K9JA 2FXUA 1NKCA 1TYQA 4BRKA 4HWIA 3OS0A 2O8DB 3DLEA 3V9XA 3CCVN 4H0PA 4FM0A 3D2FA 1N5YA 3NMUA 3CMAN 1LCUA 4O8UA 4GNIA 2KZZA 2DFFA 4CGFA 3WNGA 3D2EB 1LV5A 1NJIO 3WXMB 1Q7YO 1RBTA 4I2PA 3QDKA 2H3GX 3H08A 4JHDA 3CJ9A 1Q81O 3L4IA 1KLNA 4KB0A 3NF9A 3DOKA 2HHWA 5AQYA 3K5MA 4L8RB 1WNSA 5CY4A 4NB4A 3CF5L 1EO1A 4AHUA 4DLGA 3QFUA 1VQ8N 1GLCG 2VQEK 4YFUA 1KVBA 4CD1A 4DR6K 3SAHA 2RE2A 4YOTA 4B8AB 3ID6A 1NOZA 3OTOK 3ZSRA 2FSJA 4XIUA 1BCOA 2EWSA 3OBWA 1FKOA 3L2RA 2KW4A 2R7YA 2GUPA 5E84A 3T19A 3SBTA 4YY3K 2P9KB 1O13A 4J2DA 4CZHA 3O9QA 4BGBA 3AV9A 4BE0A 4NCAA 1NG9A 1VAZA 4IBNA 1JLAA 4FLWA 1QHAA 3UKRA 4CZJA 3QETA 4B3MK 3KWGA 3O08A 4YHHK 1TK0A 2E20A 3VQ9A 3LZIA 4QS7A 2EX3A 4KHUA 3GBTA 3ITHA 3CCEN 1W0HA 1NK8A 2BANA 5AQXA 4AHCA 1NK7A 3UKUB 1KVCA 2QWMA 1UOCA 4YNQA 3MDQA 3QICA 3NHGA 3SV4A 4OPJA 3EKSA 1ZYQA 4O0JA 4BG8A 3CCJN 3AO2A 3SPYA 5BN9A 1QHTA 4E7IA 5BR9A 3I8DA 4FWNA 2AA4A 4FOIA 2OPRA 2NRRA 3VESA 1OVQA 3OJUA 1S9GA 4M45A 1TKDA 3DI6A 1JCEA 1SKSA 1OH6A 4FJGA 3HO1A 3K0SA 3R1XA 2I7NA 2RN2A 1K73O 3BZCA 4KHSA 3ZEUA 2A41A 4B1ZA 1YIJN 3KKSA 4JK7A 2VCPA 2VGNA 2CH5A 3SV3A 4H5WA 3PV8A 2A1RA 3WQTA 1HYSA 2OPPA 1HJRA 2QTDA 5GINA 2FBTA 4CEDA 3JYTA 1NGCA 1X1PA 4ZTJA 1T7PA 1C0TA 4LFCK 1VSHA 3L4QA 4KTQA 3E9PA 1QQOA 3PUFA 3CD6N 1GOBA 1XNRK 1L3TA 4E7KA 4JNEA 3R3LA 5KGXA 3PO4A 5AQVA 4NYNA 1KLMA 4EP5A 1KFSA 2OTLN 2FBVA 4WFNL 4N41A 3N4PA 5EVZA 1WSEA 4CEEA 1LAVA 5TKYA 3VQ7A 3I8BA 1RTJA 3VQDA 4FVMA 3SNNA 1T3VA 3D7EO 4ELTA 3O6WA 1KVAA 5FPDA 4OPHA 4IXCA
chains in the Genus database with same CATH topology
4CZMA 3MCPA 1K8AO 4C23A 1S72N 3LM2A 3O9SA 4XH1A 1QZ6A 1OKJA 2W40A 2QM1A 1EQYA 3QFPA 5AQGA 3U8XA 5LJVA 1VQMN 4GV3A 4NO7A 5AQMA 2NRTA 3OW2M 4WQ5A 1K8KB 3G71N 4M63C 3HRGA 4O8KA 4K25A 4JD2A 4R79A 4B1VA 1JJ2M 3CERA 3AY9A 4YOVA 3M1FA 5AQUA 4UY8O 1QQMA 3U9DA 3QBXA 4H03B 1NGDA 2F9TA 4K43A 4CZKA 3MN6A 5JLFA 5GIPA 2VWBA 3DJCA 3UB5A 2GWKA 3AARA 4BGAA 2P9LB 4H5TA 5KQDA 5AQTA 1NGBA 3VEZA 1GLFO 5CR4A 1NWKA 2A3ZA 4JKAA 2FF3B 4EHTA 3J8AA 4WF9L 2YJEA 2ZJRL 2HBMA 2V51B 3SLCA 5EY4A 2D0PA 2QEXN 3HZ6A 4H0TB 3TPQA 1TUUA 4ILJA 3S41A 5AQIA 2E88A 3CJCA 5AZIB 3HTVA 3IMXA 1VQ5N 3ZX2A 4IFEA 4U67L 4JN4A 2ZJPL 4BR9A 4KH6A 2E2PA 2YX6A 3LL3A 4G9ZA 1T6CA 3U9ZA 3F5TA 1GLDG 2HMPA 1MWKA 1K9MO 4FWRA 2A5XA 3MN7A 4I6MB 4DKWA 3ZX0A 1KC8O 3ENBA 3I55N 4FSVA 3DLLL 2CH6A 3G6EN 2HF3A 3R9PA 1XQSC 4IO8A 1V4TA 1N8RO 4OO1J 4JKEA 2NRVA 4MDBA 3LDOA 5AQLA 3CCLN 4YOYA 1TYQB 3FFKB 3IUCA 3WXIA 4B1XB 1ZC6A 2PBDA 5AQJA 3CXCM 3VGLA 4BR2A 1YHQN 3VPZA 3VEOA 2P9LA 1SS6A 2FLOA 2OANA 2V52B 3ATVA 5GIOA 5C0YA 2QXLA 2HOEA 5KPRA 1WOQA 3BP8A 4DB3A 3GL1A 5AZIA 4MO4A 3M5RA 2JWLA 4A5AA 4BVPA 2P9UA 3CI5A 4FPAA 4JKHA 5ADXA 5LJWA 3HOSA 1GLAG 3C0BA 4DCHA 4IZ9A 2V7YA 3ID8A 4LC9B 3MN5A 1RDWX 3O80A 1W2BM 3TTFA 4MO5A 4PL8A 5M1FA 2ZGZA 3MMVA 2IVPA 5AZJB 3TTDA 2KLAA 1DEJA 1E4FT 1S22A 2FF6A 4K42A 4O5FA 3A5NC 2ITMA 5AFUH 1BOTO 4KH5A 1G99A 3VOVA 3W3DA 2ASMA 2HSTA 3VEYA 4CBXA 5KPTA 1QVFM 4QS9A 4PKHA 4JK9A 4WQ4C 2P9IB 1VQKN 4MLHA 1T6DA 3FZLA 3CPWM 3GE1A 4JK8A 4XEIA 4BQZA 2ZJQL 1VQ9N 3O1WA 4PKGA 1KQSM 4XH4A 1CZAN 5I9EB 1W97L 4IOAL 5F2RA 3BF3A 2HBJA 5JVGL 2A42A 1ZBSA 2Q31A 2D0OA 4YOWA 3ULEA 4EAHD 1Z05A 4JKBA 1DT9A 2PFUA 5AQRA 5GADP 3VF4A 3G25A 3MX5A 3ENOA 3WXKA 5M1QA 2D1KA 4FWKA 5C2DA 4KH4A 1VQPN 3C65A 1GLEG 1H1VA 3DAWA 4H0XB 3E9LA 3H3OB 2E8AA 3O8MA 5BPMA 4BC3A 2NRZA 3M3ZA 3WEEA 1C0FA 4BRNA 4EFHA 4XH5A 4YDUC 5C12A 4GY2B 2GWJA 2VYPA 2P9SB 2QI2A 4A61A 4A2AA 5AZJA 1YUWA 2YHYA 1NM1A 1YJ9N 3JXUA 4BC2A 5BRHA 4OPAA 1YAGA 4FWMA 3C7NB 1ZXOA 1YI2N 3O9RA 3O1BA 4FPBA 1DGKN 1KAXA 2JWKA 3OHRA 2P9IA 4HTLA 1Q18A 4BR5A 3DXMA 4YOUA 3I33A 2PAVA 5AQHA 5AQQA 4EHUA 1YITN 3FZMA 4A2BA 3PIOL 3H1VX 3FGUA 5M1OA 5JLHA 3EKUA 4EIAA 3WXJA 5E26A 5MLCQ 1U2VB 1V4SA 2QW9A 3UKRB 1HPMA 1NMDA 5AQKA 3TU5A 4E1JA 3VF2A 3P39A 4A57A 2QWQA 5AQFA 4CZLA 4IJAA 2WBNA 2CGLA 3CPEA 4J8FA 3T7ZA 1KAYA 2DPNA 5EXWA 3CJ7A 3RSEB 4ISFA 4CZIA 4Y0WA 2QA4N 1WUAA 4F9OA 4YOXA 4FL9A 4M7XA 1S3XA 3SAGA 3QBWA 2Q2RA 5GAHP 3HBTA 2NZTA 4RCHA 1ILYA 3C6AA 2Q97A 3N4QA 3LDPA 3CC4N 3ZETA 3AAQA 1XC3A 2P9SA 3A5MC 4FWLA 1NGAA 4BRIA 2D4WA 3SMPA 1NGEA 4FWPA 4BRCA 2GX9A 3KVGA 2QWLA 4BC4A 3TSPA 3E66A 1NGJA 3C7NA 3RVCA 1BA1A 3P4IA 4GVEA 1Z6RA 4H5VA 3CMEN 2BH1A 3BUZB 1QZ5A 3GG4A 1NGHA 1K8KA 1NGGA 4H5RA 2E2NA 3GDQA 5GAEP 4JEPA 1YVNA 1OVYA 5FPMA 1GLBG 1P90A 1U6ZA 4IEEA 3VENA 4Z94A 1U2VA 1QQNA 2QWOA 3VF6A 4IOXA 3EL2A 3CQYA 1YXQA 4BRGA 4WCEL 2J4RA 2A40A 5F1XA 3EE8A 2E1YA 4YORA 4BR0A 5HL7L 3RSEA 5DM6L 3W0LA 5JVHL 3KZBA 1HUXA 1BA0A 4B1UB 3VMFB 3H6EA 3DXKB 3F9MA 2E2QA 1DKGD 1IJJA 3VGKA 5AQWA 5JICA 3AGRA 3D2FB 3P31A 3GOIA 2Q36A 3OA9A 4IO9L 1QVGM 1BUPA 4CI6A 1NBWA 2Q0RA 3A8YA 3CJAA 3KK7A 2WUSA 3LDLA 2CGJA 1NLVA 4A59A 3VTHA 1C0GA 4ISEA 3CCUN 3R8EA 2CGKA 3K9KA 3QMLA 5ELZA 3VEWA 4CBWA 1BG3A 2P9PB 2QWNA 5EOYA 3AGKA 3QB0A 4FVUA 2KKZA 5AQOA 3CJ1A 5AQSA 4BRFA 4C1NI 1YJWN 4U7BA 1LOTB 1P8ZA 4JHDB 2ASPA 2Q1NA 4CZEA 4BREA 3B8AX 2YI1A 2HBLA 4CBUA 4I6MA 3CC2N 4MLEA 4B1WB 4IOCL 2NRHA 5EX5A 3O9UA 1KXPA 2P9NB 1YJNN 4H0OA 1SQKA 2W41A 3Q7CA 3SBGA 3K9JA 3A0IX 2FXUA 2VGMA 4BRAA 1TYQA 4WFAL 4BRKA 4HWIA 4ILGB 1M1KO 2V7ZA 4CZFA 5BN8A 2Q0UA 1MWMA 1Y64A 4H5NA 4WQ5C 5M1PA 2F9WA 1Q86O 2WFBA 3CCVN 3FR0A 1GLJO 4H0PA 5M1KA 3D2FA 3NMUA 5KPZA 1LCUA 3MN9A 3CMAN 3IFRA 3CQXA 4O8UA 3CCMN 3H3NO 4GNIA 1MDUB 4DHYA 5AQZA 3CETA 3SK3A 3D2EB 4KBOA 5BPNA 3CHWA 3LDQA 1NJIO 3E1YA 1X3NA 3L6QA 3WXMB 1Q7YO 4NLBA 4FWSA 4CD3A 3FE1A 2P9PA 3C6HA 3QDKA 2H3GX 5LY3A 1Q82O 4H0YB 2YJFA 4JHDA 2YHWA 3CJ9A 3DWLA 5JMVA 1Q81O 3BEXA 1HKCA 3L4IA 4JKFA 2P9NA 4IEIA 5AQYA 5CE3A 3EZWA 4BRQA 3BF1A 4NB4A 3U4LA 5AR0A 4BRHA 3CF5L 3H45C 3NVKA 1EO1A 3FLCO 3FZKA 3MWPA 5C15A 3QFUA 3FZFA 1VQ8N 4BRLA 1GLCG 4BQLA 4JKGB 4CD1A 3VEXA 3SAHA 2NRXA 4DQ8A 2RE2A 1BO5O 4WQ4A 4YOTA 1VQ6N 1J6ZA 3ID6A 4BC5A 1RGIA 1SAZA 3MWTA 2UYTA 4PKIA 2ZWHA 3JS6A 2FSJA 3D2EA 3KWIA 4BR7A 3CCRN 2AP1A 3CCSN 1VQ4N 2E2OA 2EWSA 3OBWA 1YF5L 2RHKA 3O4WA 3TSUA 3ZYYX 5ADXH 5AFUA 5KQ8A 3PIPL 3ZX3A 3MX2A 3SMSA 4BRMA 2I7PA 2GUPA 3UE5A 5E84A 3LM9A 2IVOA 2ASOA 3VEVA 4B1YB 3J7ZO 4RTFD 3H46O 5M1NA 1M90O 1ATSA 3SBTA 1T44A 4JAXA 2P9KB 3WT0A 1O13A 5BPLA 4CZHA 4YDUA 3O9QA 4BGBA 3HSCA 4H0VB 2OTJN 1VAZA 1VQLN 1IG8A 2KHOA 3O5BA 2NNWA 3ATUA 2ZGYA 4JKGA 1QHAA 3UKRA 4CZJA 1RDUA 1RFQA 3KWGA 1HX1A 3O08A 4JKDA 4PHTX 1HKGA 4BVOA 2E20A 4BR4A 1TUYA 1ESVA 2P9UB 3E9OA 3O9TA 4L3QA 3G4SN 3LDNA 3SJHA 3WQUA 1JCGA 2FSNA 3ZEUB 4A5BA 5H1SQ 4AM6A 4QS7A 1X3MA 4ILHA 3GBTA 5TKWA 3CCEN 4CZGA 3VTIA 3AAPA 3H1QA 5AQXA 5BRFA 4B9QA 1KAZA 2GEMA 4FWOA 4AM7A 4M7YA 4BROA 3UKUB 4IJNA 2QWMA 2BTFA 2NRWA 2HBKA 3TSQA 1HLUA 3FZHA 4MDAA 5BRDA 3MDQA 3PLAA 3QICA 3HOTA 2IIRA 3EKSA 4FO0A 3OBYA 5B8HA 5C2FA 2A6AA 2F7TA 2P9KA 4BG8A 3CCJN 2E1ZA 5BN9A 3T69A 2YHXA 5GAGP 5BREA 5BR9A 1VQNN 4FWNA 1E4GT 2AA4A 2NLXA 4FOIA 1NGIA 2NRRA 3VGMA 3VESA 2QWRA 3ULEB 1HJOA 1XUPO 4IWVA 1JCEA 4BG9A 4GV9A 4C1NK 4PL7A 5F0XA 2IVNA 4GV6A 3EE9A 4BRPA 4AF1A 4FWQA 3R1XA 2I7NA 1K73O 3EO3A 4A62A 3P38A 3ZEUA 3CIPA 3CCQN 3CC7N 5C10A 3WEEB 2A41A 4B1ZA 1D4XA 1YIJN 3DXKA 4NLCA 3M6GA 3KHYA 1ATRA 1R59O 3HM8A 3MK6A 3HI0A 2VCPA 2VGNA 2CH5A 3L0QA 4H5WA 4JK7A 5FPEA 3WQTA 3UKUA 1VQON 2QTDA 5GINA 2BUPA 1GLLO 5CHIA 2WC9A 1ATNA 1NGCA 3D6RA 3SAFA 3DXMB 4JKCA 3WUHA 3CJBA 1MA9B 3Q7BA 2GTDA 3MCAB 3A5OC 4BRDA 3L4QA 1BDGA 4IDHA 4BY9C 2ZF5O 3E9PA 1QQOA 3VETA 3R6MA 5DM7L 4JD2B 3CD6N 3ENHA 4CJ7A 3I56N 3IKMA 1JCFA 4JNEA 3R3LA 1BWFO 3VERA 2QWPA 1BU6O 5AQVA 3A5LC 4WFBL 2OTLN 4RWTA 4WFNL 4QS8A 3N4PA 3NVMA 5EVZA 2GELA 2HF4A 5TKYA 1KD1O 1VQ7N 5HOOA 2YCHA 5AQPA 3I8BA 3TTCA 5AQNA 1SZ2A 4WYBA 3F2KA 3IDHA 1T3VA 3D7EO 4K41A 3O6WA 5FPNA 3ZETB 1NGFA 5FPDA 4ISGA 2FSKA 4OPHA 1X9JA 4FOEA 4IXCA 1HKBA 3EN9A 3WXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLA A;  2YX6 A;  1RDU A;  2WFB A;  2RE2 A;  2QTD A;  1P90 A;  1O13 A;  1EO1 A;  1T3V A; 
#chains in the Genus database with same CATH topology
 1K8A O;  3LM2 A;  3UIQ A;  3AVF A;  3ULD A;  3QFP A;  1EQY A;  4GV3 A;  3NGZ A;  5AQM A;  1BI4 A;  1KFD A;  2NRT A;  3HT3 A;  3ZT2 A;  4M63 C;  3HRG A;  3O3G A;  4O8K A;  4JI4 K;  2P1J A;  4LY7 A;  3CER A;  4FCY A;  3SUQ A;  5AQU A;  4UY8 O;  1C1B A;  4IFV A;  4OKE A;  3AVB A;  2X74 A;  4CZK A;  1EET A;  5JLF A;  2VWB A;  4CFD A;  2A1S A;  1KCF A;  4DTX A;  5AQT A;  3VEZ A;  3FFI A;  1NWK A;  1W9H A;  2A3Z A;  4EHT A;  3J8A A;  4WF9 L;  2ZJR L;  2V51 B;  2NUB A;  3SLC A;  1C1C A;  3HZ6 A;  4CFC A;  1TUU A;  4ILJ A;  3S41 A;  3CJC A;  4OLB A;  4KHP K;  2RPI A;  3ZX2 A;  4QAG A;  4U67 L;  3QO9 A;  2ZJP L;  4KH6 A;  2E2P A;  3AO3 A;  1HR0 K;  4G9Z A;  1T6C A;  5FRN A;  2A5X A;  3M8Q A;  1HQU A;  4M3X A;  3SUO A;  3I55 N;  2DY4 A;  3NGI A;  4FZZ A;  2NRV A;  4MDB A;  3KLI A;  3KJV A;  3WXI A;  3IUC A;  5AQJ A;  4FZY A;  4DSI A;  2P9L A;  4RW9 A;  3ATV A;  3AVG A;  3BY5 A;  5GIO A;  2QXL A;  2HOE A;  3AVK A;  3PSI A;  5KPR A;  1WSJ A;  1WOQ A;  3BP8 A;  3IS9 A;  1RNH A;  3GL1 A;  5AZI A;  4DCH A;  3TAE A;  4BVP A;  1T03 A;  2HW3 A;  4JKH A;  3QEI A;  2IDO A;  3C0B A;  3PO5 A;  1TL3 A;  1YVU A;  3AVM A;  4PL8 A;  3MMV A;  3TTD A;  2IVP A;  5AZJ B;  3LPT A;  2FF6 A;  4F2R A;  4O5F A;  1G99 A;  5KPT A;  2HST A;  1QVF M;  3CPW M;  4CVN E;  4IOA L;  3O1W A;  1NOY A;  5J2N A;  3HYF A;  5F2R A;  2HBJ A;  3ZSX A;  2BGG A;  2ZQB A;  2D0O A;  4G1Q A;  4EAH D;  3V1R A;  4DWI A;  5AQR A;  5GAD P;  5M1Q A;  1RT4 A;  2AJQ A;  5C2D A;  1VQP N;  1GLE G;  4H0X B;  2Y1I A;  4CGI A;  2XRI A;  3ZSW A;  4NXN K;  2HHX A;  4I9Q A;  4AHR A;  3JAM O;  3LPU A;  4M3W A;  4OPA A;  4FWM A;  3O9R A;  1DGK N;  3CFO A;  3HK2 A;  4M3U A;  4HTL A;  4F8R A;  4W5T A;  4FW1 A;  1VRU A;  3FZM A;  3H1V X;  3FGU A;  1BGX T;  4W5O A;  3OYN A;  5E26 A;  5MLC Q;  1U2V B;  1LWF A;  4LSL A;  1HPM A;  4LH5 A;  3C6U A;  2DTU A;  5AQF A;  3T1A A;  3LP0 A;  4E1M A;  2KFZ A;  4ISF A;  4CZI A;  2QA4 N;  4YOX A;  4ID5 A;  1CZ9 A;  5T7B A;  5KTQ A;  4OKK A;  3KD5 E;  2NZT A;  2E6M A;  1VSJ A;  1N34 K;  2P9S A;  4HCC A;  2Q3S A;  3NF8 A;  1NGE A;  3KVG A;  1HPZ A;  4BC4 A;  3E66 A;  1NGJ A;  3CQ8 A;  4B8C A;  3L3V A;  3THX B;  1U49 A;  3CME N;  4N47 A;  2BH1 A;  3BUZ B;  3RRH A;  2GV9 A;  3THW B;  3OYC A;  5IT9 O;  1GLB G;  3HP6 A;  3ZT4 A;  4Z94 A;  1XMQ K;  2O8F B;  4CJT A;  1UWB A;  4IOX A;  3EL2 A;  3CQY A;  3V9W A;  3O4N A;  3O4Q A;  4DU3 A;  4JYA K;  5F1X A;  3KZB A;  1HUX A;  1BA0 A;  3DXK B;  3L3U A;  3QEX A;  1IJJ A;  4F3O A;  1Y97 A;  4DSE A;  3AGR A;  3D2F B;  4CJ3 A;  1JXE A;  2D0B A;  4IO9 L;  5HRR A;  3DMJ A;  1XHX A;  1VSD A;  4ISE A;  4DR5 K;  3R8E A;  2CGK A;  5ELZ A;  3VEW A;  4DV3 K;  5EOY A;  3OYD A;  3DRS A;  2G8F A;  4CJL A;  1P8Z A;  3DLK A;  4JHD B;  3HJF A;  2ASP A;  1CLQ A;  2Q1N A;  4CZE A;  4AHS A;  4FJM A;  4BRE A;  4GVM A;  2HBL A;  4CBU A;  3OYM A;  1NU0 A;  4B1W B;  1YJN N;  4J2E A;  4H0O A;  1NK9 A;  1ITG A;  2UUA K;  3A0I X;  4BRA A;  4WFA L;  4JRP A;  1M1K O;  1XWL A;  5BN8 A;  3V6D A;  1VSM A;  1Y64 A;  4H5N A;  5M1P A;  3QNO A;  3WNF A;  1RBS A;  4CF0 A;  5KPZ A;  1JL1 A;  3CQX A;  3CCM N;  1T05 A;  2Z1H A;  3VQP A;  3SK3 A;  4KBO A;  1VSE A;  5C25 A;  3LDQ A;  1X3N A;  3MXI A;  2LSN A;  1ASU A;  4CD3 A;  5JS2 A;  4HHT A;  5LY3 A;  4CJQ A;  5HLF A;  4H0Y B;  1HMV A;  1K6Y A;  3TI0 A;  3U4L A;  2UU9 K;  3T1Y K;  3FLC O;  1LWC A;  4CJR A;  4R5P A;  2IGI A;  1IBK K;  1RIL A;  2OZM A;  2NRX A;  1VQ6 N;  4BC5 A;  2UYT A;  3L2Q A;  4JI1 K;  4DV4 K;  3KWI A;  2WTU A;  2YNI A;  3CCR N;  4OJR A;  4BDZ A;  4JRQ A;  1ZBI A;  1YF5 L;  5AFU A;  3OS1 A;  3TAP A;  3PIP L;  3MX2 A;  3VQE A;  3F73 A;  3VEV A;  5HRS A;  2IVO A;  3A2F A;  2XY7 A;  4RTF D;  3O3F A;  3VA0 A;  3WT0 A;  3RMB A;  1C0M A;  4V19 S;  4W5R A;  4JV5 K;  3TAQ A;  1VQL N;  1IG8 A;  2YNF A;  1RT1 A;  2ZGY A;  1S1T A;  4JKD A;  1TKX A;  3RWU A;  1ESV A;  3E9O A;  4L3Q A;  3O9T A;  3G4S N;  1YTA A;  3LWM A;  3ZEU B;  4AM6 A;  1ASV A;  3AAP A;  3H1Q A;  1QSY A;  4KHN A;  1S1U A;  5BRF A;  2YV0 X;  1KAZ A;  3CYM A;  4FWO A;  4BRO A;  1NJX A;  2NRW A;  1TAQ A;  3FZH A;  5BRD A;  1IH7 A;  3KIO A;  3NH0 A;  4FO0 A;  1SL2 A;  1VSK A;  4DV7 K;  5KI6 A;  4RW8 A;  3T69 A;  2YHX A;  5GAG P;  4DTU A;  1NGI A;  1RTH A;  2WON A;  2KZM A;  1HJO A;  4F3T A;  4GKJ K;  5J1E A;  5F0X A;  4KKO A;  4RG8 A;  3AA5 X;  1GOA A;  4A62 A;  3CIP A;  4JI8 K;  1HNX K;  2VG5 A;  3CC7 N;  5C10 A;  3DXK A;  3MK6 A;  3SUP A;  5FPE A;  4HUF A;  3VQ8 A;  1VQO N;  1GLL O;  1RDD A;  3HL8 A;  1ATN A;  3HVR A;  3SAF A;  3HP9 A;  3DXM B;  1OH7 A;  1BI4 B;  1IBL K;  3ZSO A;  4AQY K;  2GTD A;  3DM2 A;  3U6F A;  1BDG A;  5HRN A;  4IDH A;  4BY9 C;  2ZF5 O;  3VET A;  2E6L A;  3ENH A;  1JLB A;  5KRS A;  3IKM A;  1WBB A;  3VER A;  5DK5 A;  4FLY A;  4WFB L;  1J9A A;  1WN7 A;  4RWT A;  1SL0 A;  4OKJ A;  2HF4 A;  4QCL A;  1VQ7 N;  2YCH A;  4RW7 A;  5AQP A;  4FZX C;  4WYB A;  3F2K A;  4TSX A;  3QIN A;  2ZD1 A;  2P5G A;  5FLX O;  4K41 A;  4DTP A;  4M42 A;  1X9J A;  4NCG A;  4FYD A;  3EN9 A;  3WXL A;  1RBV A;  1S72 N;  3QEP A;  3OY9 A;  1HNI A;  1S5J A;  3EZ5 A;  3ZCM A;  3U8X A;  4NO7 A;  5K14 A;  3G71 N;  3HPO A;  4K25 A;  4JD2 A;  4R79 A;  4YOV A;  4PY5 A;  3VQB A;  4DQR A;  1QQM A;  3LAM A;  1QSS A;  4H03 B;  3OYJ A;  2F9T A;  3TR8 A;  1XC9 A;  4FJ8 A;  3DJC A;  3UB5 A;  4DQP A;  3RR7 A;  2P9L B;  2HNY A;  1S6P A;  1U4B A;  4M3R A;  4OGE A;  3LP1 A;  3SQ2 A;  4HCB A;  4W5N A;  2FF3 B;  2YJE A;  2HBM A;  1EWR A;  3KTQ A;  2D0P A;  2YKM A;  3TPQ A;  4CE9 A;  4CF8 A;  5AZI B;  2E88 A;  4ELV A;  4LSN A;  3LAL A;  3HTV A;  1QTM A;  3V9S A;  2HHQ A;  3TAM A;  3PX6 A;  1BL3 A;  3U9Z A;  3F5T A;  1GLD G;  1JLF A;  2HMP A;  1MWK A;  3MN7 A;  4I6M B;  3ZX0 A;  1KC8 O;  4DV0 K;  3ENB A;  3G6E N;  2HF3 A;  4IO8 A;  4ID1 A;  4OO1 J;  4JKE A;  2DFE A;  3CCL N;  4B1X B;  3SJJ A;  3AO5 A;  3CXC M;  1X9W A;  2FLO A;  1ZBU A;  5BR8 K;  5C0Y A;  2PZS A;  2HHT A;  1NK4 A;  3KLE A;  4DB3 A;  3M5R A;  4X64 K;  5LJW A;  5A2Q O;  3DLB A;  4CGD A;  4IZ9 A;  2V7Y A;  4DFK A;  1REV A;  3MN5 A;  4Y1D A;  3TTF A;  1WSI A;  1HYZ A;  1B9F A;  1DEJ A;  1E4F T;  4O55 A;  4FK2 A;  2D0C A;  4CF9 A;  2ITM A;  5AFU H;  4HUE A;  4KH5 A;  3TAB A;  4CBX A;  4B9M A;  4EP4 A;  4QS9 A;  3AVN A;  1T8E A;  3VQC A;  2XY8 A;  4JK8 A;  3DLR A;  3AVA A;  4PKG A;  1KQS M;  1OH8 A;  3QLH A;  2XY5 A;  5JVG L;  1JLG A;  4E7L A;  4Q5V A;  1Z05 A;  4JKB A;  4C8L A;  2PFU A;  3L8B A;  3VF4 A;  1QE1 A;  3WXK A;  4CEO A;  4KRF A;  3QEV A;  4I9L A;  1U47 A;  2HHU A;  5E41 A;  4DSL A;  3H3O B;  4Z4F A;  1A5V A;  3M3Z A;  1C0F A;  4BRN A;  4XH5 A;  4YDU C;  4GY2 B;  1NKE A;  2P9S B;  2QI2 A;  4CJF A;  4A61 A;  4A2A A;  2YHY A;  4DU4 A;  4O44 A;  1YI2 N;  5KRT A;  4FJI A;  1KAX A;  3NH1 A;  2UXD K;  4CFA A;  4LF4 K;  3BZK A;  3DXM A;  5AQH A;  3KK2 A;  4EHU A;  3ALY A;  1S1W A;  1JXB A;  3RRG A;  4KB1 A;  3I0R A;  3TAG A;  3EKU A;  2W6L A;  2QW9 A;  1BQN A;  4Z4G A;  3S3O A;  3TU5 A;  4B9T A;  3VF2 A;  2QWQ A;  3D45 A;  4FJ9 A;  4J8F A;  5EXW A;  1MU2 A;  4C8N A;  4KAZ A;  4LFA K;  4M7X A;  3QBW A;  2G8K A;  3DRP A;  3K5O A;  1KSP A;  4ELU A;  4CEB A;  4RCH A;  2E4L A;  3C6A A;  3N4Q A;  4EZ6 A;  3LDP A;  3CC4 N;  2F4V K;  3CFP A;  1XC3 A;  1JLQ A;  1NGA A;  2D4W A;  5HRP A;  4OVL A;  1TAU A;  2QWL A;  3TSP A;  1YT3 A;  3C7N A;  4DQS A;  4F2S A;  2QXF A;  3AVI A;  4GVE A;  1TKZ A;  4LF9 K;  3U3G A;  4H5V A;  4BDY A;  4DLE A;  1HNZ K;  2VQF K;  3GG4 A;  3J80 O;  1NGG A;  5GAE P;  4H5R A;  4JEP A;  1LWE A;  1OVY A;  5FPM A;  3CFR A;  1U6Z A;  2O8C A;  1HNV A;  3NBP A;  3ZT3 A;  2GUI A;  2HND A;  2ITG A;  4B3O A;  1C0U A;  4CHY A;  1UA1 A;  4O5B A;  4CEQ A;  2A40 A;  1RTD A;  4BR0 A;  5DM6 L;  5JVH L;  3LP2 A;  4RW4 A;  1W7A A;  1TK5 A;  3JSM A;  1FXX A;  3H6E A;  2E2Q A;  3PSF A;  3VQA A;  5JIC A;  3THY A;  2OPS A;  3LP3 A;  1QVG M;  4HVJ A;  3KD1 E;  1IKV A;  3CCU N;  4BE2 A;  2XY6 A;  2X6N A;  3QML A;  3EY1 A;  1WSG A;  4CBW A;  1BG3 A;  4FVU A;  4X62 K;  4C1N I;  2IOC A;  4I6M A;  1L3S A;  4IOC L;  4FK0 A;  3O9U A;  2HHS A;  3PX0 A;  4E1N A;  3Q7C A;  3SBG A;  4WE1 A;  1HYV A;  4EZ9 A;  2VGM A;  2FC0 A;  4ILG B;  3NH2 A;  4CZF A;  2Q0U A;  4JS4 A;  2F9W A;  2WFB A;  3QIP A;  2YNH A;  3FR0 A;  1GLJ O;  1XNQ K;  1BIU A;  4FJ7 A;  3MN9 A;  3IFR A;  1CZB A;  4CJ5 A;  3H3N O;  1MDU B;  4DHY A;  3CET A;  3NFA A;  2P5O A;  3CHW A;  4DFM A;  2D5R A;  4DMN A;  3L6Q A;  4JI2 K;  1QSL A;  4FWS A;  4DR4 K;  5D3G A;  3S3N A;  2O8E A;  4CHZ A;  3NGY A;  2OCE A;  1VSI A;  2HVH A;  2YHW A;  1VSF A;  1RDB A;  5JMV A;  4J2B A;  1VK0 A;  3ZSY A;  1CXQ A;  2P9N A;  3EZW A;  4BRQ A;  3BF1 A;  4DFJ A;  5C15 A;  3SQ4 A;  3FZF A;  3G0Z A;  4BQL A;  4M41 A;  3VQ5 A;  3PY8 A;  3VEX A;  4J2A A;  4B9U A;  4DQ8 A;  2E5L K;  1BO5 O;  4CK3 A;  1J6Z A;  4DTO A;  1SAZ A;  3MWT A;  5FRM A;  2ZWH A;  1Z26 A;  2AP1 A;  1VQ4 N;  3O4W A;  1FK9 A;  3MEG A;  3ZX3 A;  4DG1 A;  3SMS A;  1SUQ A;  4CJE A;  4BRM A;  3J7Z O;  3UE5 A;  1BIZ A;  3DLG A;  3LM9 A;  4DTN A;  4B1Y B;  1M90 O;  1ATS A;  3NE6 A;  1RT3 A;  1T44 A;  3WNH A;  5BPL A;  4YDU A;  3OYG A;  3PX4 A;  5C24 A;  4CGH A;  2OTJ N;  2NNW A;  3ATU A;  4JKG A;  4PHT X;  1WAJ A;  3OYL A;  4Z4I A;  4BR4 A;  1TUY A;  2P9U B;  3LDN A;  3J7A P;  3WQU A;  5H1S Q;  1X3M A;  4ILH A;  4CZG A;  3VTI A;  3AA4 A;  4B9Q A;  2O4I A;  4CJS A;  4KRE A;  3SQ0 A;  2GEM A;  3OYK A;  4AM7 A;  1TKT A;  2ATQ A;  2IAJ A;  5JS1 A;  4IJN A;  2KFN A;  1B9D A;  2HBK A;  1ZBL A;  3TSQ A;  4LH4 A;  1HLU A;  2UUC K;  3PLA A;  5J2M A;  3HOT A;  4IKF A;  1KTQ A;  2IIR A;  5C2F A;  3OBY A;  4CW7 B;  1J54 A;  4KV8 A;  3LZJ A;  3QNN A;  2E1Z A;  5BRE A;  4JI5 K;  1VQN N;  3VN5 A;  2NLX A;  4MFB A;  3ULE B;  2OYQ A;  1XUP O;  2B5J A;  4IWV A;  4PL7 A;  4LF8 K;  1E3M A;  2G8U A;  1SV5 A;  4AF1 A;  4FWQ A;  2Z1J A;  3EO3 A;  1A5X A;  3OJS A;  2RF2 A;  3V1Q A;  1TV6 A;  3WEE B;  1D4X A;  5I42 A;  1R59 O;  3K59 A;  4CEA A;  4FJX A;  2PY5 A;  4E19 A;  2B6A A;  2O8B A;  2BUP A;  4BE1 A;  1NNE A;  4CJ4 A;  3VA3 A;  4Z4E A;  1ZBH A;  3WUH A;  4JKC A;  3Q7B A;  3EYZ A;  3MCA B;  3A5O C;  4BRD A;  2PYL A;  1N36 K;  5DM7 L;  4JD2 B;  1ZBF A;  1BWF O;  1JKH A;  2QWP A;  3MED A;  1BU6 O;  4B3S K;  3A5L C;  3EEQ A;  3NVM A;  3WNE A;  1JLC A;  2GEL A;  1WAF A;  1KD1 O;  3TTC A;  5AQN A;  1SZ2 A;  2PYJ A;  3P83 D;  4ISG A;  4JI3 K;  4FOE A;  5EU7 A;  5IWA K;  3J81 O;  1RT6 A;  4CZM A;  3MCP A;  5J2P A;  4XH1 A;  1QZ6 A;  4NYF A;  1VSL A;  1OKJ A;  2QM1 A;  5AQG A;  1VQM N;  5C42 A;  3L2V A;  4OPK A;  4DQQ A;  3SCX A;  4B1V A;  4CHQ A;  1L3U A;  3AY9 A;  3M1F A;  5SZT A;  3MXM A;  3IRX A;  3AVC A;  3QBX A;  1NGD A;  3RMC A;  1D8Y A;  3MN6 A;  4DS5 A;  3K57 A;  4LF6 K;  4DFP A;  2G8H A;  4C8M A;  4DUY K;  4H5T A;  4DR7 K;  1D9F A;  1GLF O;  2QK9 A;  1S1V A;  1NJW A;  5EY4 A;  3QIO A;  3C95 A;  5AQI A;  2OA8 A;  1VQ5 N;  3LL3 A;  2YX6 A;  1NK0 A;  4NCB A;  4ZHR A;  3DYA A;  4DTM A;  1K9M O;  4B3T K;  4FWR A;  3DLL L;  2CH6 A;  4E7J A;  4FJ5 A;  3AVL A;  1V4T A;  2Y1J A;  3LDO A;  2O4G A;  4YOY A;  1L5U A;  1ZC6 A;  2XO7 A;  4IDK A;  2HB5 A;  2UXC K;  1YHQ N;  4AHV A;  3VEO A;  1SS6 A;  1HRH A;  4CIE A;  2OAN A;  3ISN C;  3CG7 A;  4LD0 A;  4JI0 K;  2V52 B;  3E01 A;  1N6Q A;  4CJU A;  3KK3 A;  2I5J A;  4DS4 A;  4MO4 A;  2P9U A;  3CI5 A;  5ADX A;  4O4G A;  3HOS A;  3ZSV A;  2YNG A;  4DSK A;  3O80 A;  1W2B M;  1IO2 A;  3T1H K;  4MO5 A;  5M1F A;  1XHZ A;  3T3F A;  2KLA A;  4K42 A;  1S22 A;  1BOT O;  2ASM A;  4CK1 A;  3ZT0 A;  4CIF A;  4K8Z A;  4JK9 A;  4WQ4 C;  4MLH A;  1T6D A;  3FZL A;  4CFB A;  2X78 A;  3GE1 A;  1NMN A;  4PA1 A;  4BQZ A;  1VQ9 N;  1CZA N;  5I9E B;  5FRO A;  3D0P A;  4OX9 K;  3BF3 A;  3ZSQ A;  3NDK A;  4Q0B A;  2A42 A;  1ZBS A;  1C1A A;  3ULE A;  1S6Q A;  3G25 A;  1IKX A;  3V4I A;  2D1K A;  4FWK A;  3ZSZ A;  3C65 A;  1H1V A;  1LAW A;  3DAW A;  5BPM A;  3O8M A;  2NRZ A;  3WEE A;  5C12 A;  4EFH A;  2GWJ A;  1RT2 A;  3OYA A;  2HVI A;  1YJ9 N;  1NM1 A;  3I0S A;  2YKN A;  5BRH A;  3HVT A;  3O3H A;  2W42 A;  3C7N B;  1ZXO A;  3QES A;  1Q8I A;  4FXD A;  3O1B A;  4FPB A;  1FW6 A;  2P9I A;  1Q18 A;  4BR5 A;  5I3U A;  3I33 A;  5AQQ A;  4KTZ A;  3SQ1 A;  4B9N A;  1YIT N;  5JLH A;  3OYE A;  4EIA A;  2HMI A;  4BDP A;  2O8C B;  1V4S A;  1L3V A;  3DRR A;  5AQK A;  4FJH A;  3P39 A;  4GW6 A;  1EKE A;  2WBN A;  3CPE A;  4K0K K;  2DPN A;  3CJ7 A;  4F9O A;  1S3X A;  2G8V A;  2YHA A;  2OPQ A;  3HBT A;  1OH5 A;  4C8O A;  3THY B;  2D0A A;  3AAQ A;  3M8S A;  2ETJ A;  4BRI A;  3SMP A;  4FJK A;  4BRC A;  4CHP A;  3THV A;  3BGR A;  3RVC A;  1BA1 A;  4JI6 K;  1CXU A;  2ZE2 A;  3TWH A;  4CIG A;  1NGH A;  3GDQ A;  4JS5 A;  2BDP A;  1P90 A;  4QOZ B;  1QQN A;  4DR2 K;  3V1O A;  1RDC A;  1WB9 A;  4BRG A;  4WCE L;  4B9S A;  1D9D A;  2J4R A;  5LMU K;  4YOR A;  3RSE A;  1N32 K;  1I94 K;  1A5W A;  2GBZ A;  1X9M A;  3F9M A;  4FLT A;  1DKG D;  3VGK A;  3K5L A;  4FLZ A;  4CHO A;  3GOI A;  3HST B;  3KK1 A;  2Q36 A;  1BUP A;  4AHT A;  4CI6 A;  2Q0R A;  2OZS A;  3CJA A;  2WUS A;  4IFY A;  4A59 A;  1C0G A;  4N5S A;  4E3S A;  5HBM A;  1BCM A;  3NAE A;  2O8E B;  1TL1 A;  1R0A A;  3AGK A;  3QB0 A;  3CJ1 A;  4BRF A;  3S3M A;  1VRT A;  4U7B A;  5DMR A;  2F8T A;  2YI1 A;  3CC2 N;  2JLE A;  4MLE A;  2NRH A;  5EX5 A;  1KXP A;  2P9N B;  4DTS A;  3OYB A;  1SQK A;  4IG0 A;  1N33 K;  3DOL A;  1RT5 A;  5SWM A;  1VHX A;  5KGW A;  4DTJ A;  1SKR A;  4FM1 A;  2UUB K;  4ICL A;  2V7Z A;  2BE2 A;  1MWM A;  4WQ5 C;  1Q86 O;  1UAX A;  1FJG K;  4I7F A;  5M1K A;  4AH9 A;  3ZLJ A;  3LAN A;  5AQZ A;  5BPN A;  3E1Y A;  4KTW A;  4NLB A;  2QKB A;  4CJP A;  4DQI A;  2VWK A;  3FE1 A;  2P9P A;  3C6H A;  1Q82 O;  2YJF A;  3DWL A;  1RBR A;  4DV1 K;  3QEW A;  3BEX A;  1HKC A;  1WBD A;  4JKF A;  2G8W A;  3L2U A;  4IEI A;  5CE3 A;  2W6K A;  2HHV A;  3RMA A;  5AR0 A;  4BRH A;  3NVK A;  3H45 C;  3SYZ A;  3FZK A;  3MWP A;  4E89 A;  4NXM K;  4BRL A;  1IBM K;  4JKG B;  4AIL C;  2QKK A;  2O8D A;  3MEE A;  2Z1G A;  1J5E K;  4K8X A;  4WQ4 A;  4CEF A;  1NJY A;  1RGI A;  4DSF A;  4PKI A;  3AA3 A;  3VQQ A;  2KTQ A;  3JS6 A;  3D2E A;  4BR7 A;  3NCI A;  3CCS N;  4BAC A;  5HP1 A;  2E2O A;  3TSU A;  2RHK A;  3ZYY X;  5ADX H;  1RDA A;  2ZM6 K;  5KQ8 A;  1TGO A;  1EXQ A;  4DF8 A;  2I7P A;  2ASO A;  4CEZ A;  3H46 O;  5M1N A;  3TAF A;  4JAX A;  5CZ1 A;  3V9Z A;  4PWD A;  3HSC A;  4H0V B;  4KO0 A;  2KHO A;  3O5B A;  3M8R A;  1RDU A;  1RFQ A;  1HX1 A;  1HKG A;  2VG7 A;  4BVO A;  3IG1 A;  4FLX A;  3HM9 A;  3SJH A;  4KHY A;  1JCG A;  2FSN A;  4X66 K;  1RTI A;  4A5B A;  3RR8 A;  4LF5 K;  2G8I A;  4CF2 A;  3SZ2 A;  4Z0U A;  5TKW A;  1SL1 A;  4MQ3 A;  3F9K A;  4M7Y A;  1U04 A;  3OS2 A;  1BHL A;  5LL6 Z;  2Z1I A;  2BTF A;  1U48 A;  2O8B B;  4MDA A;  4B08 A;  4KHQ A;  4DSJ A;  5B8H A;  2A6A A;  2F7T A;  2P9K A;  4KFB A;  4M3Y A;  4E0D A;  4CEC A;  4FK4 A;  1E4G T;  3VGM A;  1FKP A;  3HPH A;  2QWR A;  3TAN A;  4B9V A;  4DUZ K;  5HRO A;  4Y1C A;  4BG9 A;  4GV9 A;  1EX4 A;  4C1N K;  1QQC A;  4GV6 A;  2IVN A;  3EE9 A;  4BRP A;  1WSH A;  2X6S A;  3V9U A;  4FW2 A;  3P38 A;  1JL2 A;  3CCQ N;  2IS3 A;  4RW6 A;  1S1X A;  4JLH A;  1IV0 A;  3NF6 A;  4NLC A;  3M6G A;  3KHY A;  1NK6 A;  1ATR A;  1RBU A;  3OVN A;  3HXM A;  3HM8 A;  3LDS A;  1XI1 A;  3LWL A;  3HI0 A;  3L0Q A;  3AVJ A;  4HUG A;  3UKU A;  4KHW A;  5CHI A;  3KLF A;  1UA0 A;  1NJZ A;  1QS4 A;  2WC9 A;  3KLH A;  5CZ2 A;  3D6R A;  1WLJ A;  3CJB A;  1MA9 B;  3OYF A;  2FBX A;  3C6T A;  3R6M A;  4W5Q A;  1BQM A;  4Z4H A;  4IG3 A;  1C6V A;  4OGC A;  4CJ7 A;  3I56 N;  1JCF A;  3M8P A;  3AA2 A;  3J7Y P;  3K2P A;  4QS8 A;  5FDL A;  3SPZ A;  5HOO A;  3B6O A;  3AVH A;  1EP4 A;  3IDH A;  3TAR A;  4OLA A;  4CES A;  5FPN A;  3ZET B;  1NGF A;  2FSK A;  3ZT1 A;  1HKB A;  4DV2 K;  4C23 A;  3O9S A;  2W40 A;  5LJV A;  1U45 A;  3VQ6 A;  4E7H A;  3OW2 M;  4CCH A;  4WQ5 A;  1K8K B;  4X65 K;  3CM5 A;  1JJ2 M;  2YHB A;  2WOM A;  1Q9X A;  3U9D A;  1ASW A;  4FLV A;  4ZTF A;  4K43 A;  4C8K A;  4DV5 K;  5GIP A;  2GWK A;  3AAR A;  3BDP A;  4BGA A;  3MEC A;  5KQD A;  3K5N A;  1NGB A;  5CR4 A;  4JKA A;  4CJW A;  3U3Y A;  2F8S A;  2QEX N;  4H0T B;  1G15 A;  4KI4 A;  3L2W A;  3IMX A;  3B6P A;  4IFE A;  3IAY A;  4JN4 A;  4BR9 A;  2HNZ A;  1X9S A;  3DLH A;  1DLO A;  2RKI A;  4CER A;  4DKW A;  1J53 A;  4FSV A;  3R9P A;  1XQS C;  1N8R O;  2XHB A;  4LFB K;  5AQL A;  1TYQ B;  3FFK B;  2PBD A;  4FJL A;  2KQ2 A;  3VGL A;  1I39 A;  3AO4 A;  3VPZ A;  4BR2 A;  2UXB K;  4PUO A;  4H8K A;  1F21 A;  1LW0 A;  5AJ3 K;  1RT7 A;  2EHG A;  4CF1 A;  2JWL A;  4A5A A;  4FPA A;  3KLG A;  1GLA G;  4DF4 A;  4FJN A;  5J2Q A;  5LMN K;  3V81 A;  4JI7 K;  3ID8 A;  4LC9 B;  1RDW X;  3K58 A;  1NK5 A;  1HQE A;  2ZGZ A;  1IG9 A;  2VWJ A;  4HTU A;  3A5N C;  3VOV A;  3W3D A;  4M3T A;  3VEY A;  2FBY A;  4PKH A;  3P5J A;  4H4O A;  2P9I B;  5CYM A;  3C94 A;  1VQK N;  4B9L A;  4XEI A;  2ZJQ L;  2B4J A;  4XH4 A;  1W97 L;  1JLE A;  4CGJ A;  4CHN A;  4LF7 K;  2Q31 A;  4DTR A;  4YOW A;  1DT9 A;  3MX5 A;  3SI6 A;  3ENO A;  1IKW A;  3SUN A;  4KH4 A;  1I3A A;  4N76 A;  4O0I A;  3E9L A;  2E8A A;  1S9E A;  4BC3 A;  3KKR A;  3LAK A;  4DR3 K;  4CK2 A;  1TVR A;  1BIS A;  2VYP A;  1Z25 A;  1TK8 A;  5AZJ A;  1YUW A;  1IKY A;  3AO1 A;  3JXU A;  4BC2 A;  4BWJ A;  1YAG A;  2IC3 A;  3QER A;  2JWK A;  3OHR A;  4KPY A;  4YOU A;  2PAV A;  4A2B A;  3PIO L;  1Q9Y A;  2VG6 A;  5M1O A;  3RTV A;  3WXJ A;  3UKR B;  1NMD A;  4E1J A;  2DFH A;  4A57 A;  3MXJ A;  4CZL A;  3MAQ A;  4IJA A;  4F4K A;  4I2Q A;  2CGL A;  4GMJ B;  3T7Z A;  3ASM A;  4CJK A;  1KAY A;  3RSE B;  4Y0W A;  4KI6 A;  1WUA A;  4FL9 A;  3SAG A;  4CGG A;  2Q2R A;  5GAH P;  1DTT A;  1WSF A;  1ILY A;  2Q97 A;  3ZET A;  5CYQ A;  3A5M C;  4FWL A;  4M3Z A;  4FWP A;  2GX9 A;  3G10 A;  1HNW K;  3NF7 A;  3P4I A;  4DU1 A;  4GKK K;  1Z6R A;  3HPG A;  1QZ5 A;  2JGU A;  1K8K A;  2E2N A;  1RCH A;  1YVN A;  4FM2 A;  4IEE A;  1EWQ A;  3VEN A;  1U2V A;  2QWO A;  1D5A A;  3VF6 A;  4N56 A;  3OYH A;  1YXQ A;  4CJV A;  2P51 A;  1SKW A;  3VQ4 A;  3EE8 A;  2E1Y A;  5HL7 L;  3W0L A;  3RMD A;  4BWM A;  1XMO K;  4B1U B;  3VMF B;  4DR1 K;  4DV6 K;  3OYI A;  3CM6 A;  2F96 A;  5AQW A;  4FJJ A;  3P31 A;  1YTU A;  1GOC A;  3OA9 A;  1NBW A;  3A8Y A;  3KK7 A;  3LDL A;  1B92 A;  2CGJ A;  1NLV A;  4FLU A;  3VTH A;  4PQU A;  3K9K A;  3THX A;  1LW2 A;  3S9H A;  3P1G A;  2P9P B;  2QWN A;  4UQG A;  2KKZ A;  5AQO A;  5AQS A;  1YJW N;  1LOT B;  3THW A;  3B8A X;  4Z4C A;  4H4M A;  2O8F A;  1J5O A;  1O1W A;  2HHH K;  2W41 A;  1KRP A;  1DTQ A;  1NKB A;  4B3R K;  3K9J A;  2FXU A;  1NKC A;  1TYQ A;  4BRK A;  4HWI A;  3OS0 A;  2O8D B;  3DLE A;  3V9X A;  3CCV N;  4H0P A;  4FM0 A;  3D2F A;  1N5Y A;  3NMU A;  3CMA N;  1LCU A;  4O8U A;  4GNI A;  2KZZ A;  2DFF A;  4CGF A;  3WNG A;  3D2E B;  1LV5 A;  1NJI O;  3WXM B;  1Q7Y O;  1RBT A;  4I2P A;  3QDK A;  2H3G X;  3H08 A;  4JHD A;  3CJ9 A;  1Q81 O;  3L4I A;  1KLN A;  4KB0 A;  3NF9 A;  3DOK A;  2HHW A;  5AQY A;  3K5M A;  4L8R B;  1WNS A;  5CY4 A;  4NB4 A;  3CF5 L;  1EO1 A;  4AHU A;  4DLG A;  3QFU A;  1VQ8 N;  1GLC G;  2VQE K;  4YFU A;  1KVB A;  4CD1 A;  4DR6 K;  3SAH A;  2RE2 A;  4YOT A;  4B8A B;  3ID6 A;  1NOZ A;  3OTO K;  3ZSR A;  2FSJ A;  4XIU A;  1BCO A;  2EWS A;  3OBW A;  1FKO A;  3L2R A;  2KW4 A;  2R7Y A;  2GUP A;  5E84 A;  3T19 A;  3SBT A;  4YY3 K;  2P9K B;  1O13 A;  4J2D A;  4CZH A;  3O9Q A;  4BGB A;  3AV9 A;  4BE0 A;  4NCA A;  1NG9 A;  1VAZ A;  4IBN A;  1JLA A;  4FLW A;  1QHA A;  3UKR A;  4CZJ A;  3QET A;  4B3M K;  3KWG A;  3O08 A;  4YHH K;  1TK0 A;  2E20 A;  3VQ9 A;  3LZI A;  4QS7 A;  2EX3 A;  4KHU A;  3GBT A;  3ITH A;  3CCE N;  1W0H A;  1NK8 A;  2BAN A;  5AQX A;  4AHC A;  1NK7 A;  3UKU B;  1KVC A;  2QWM A;  1UOC A;  4YNQ A;  3MDQ A;  3QIC A;  3NHG A;  3SV4 A;  4OPJ A;  3EKS A;  1ZYQ A;  4O0J A;  4BG8 A;  3CCJ N;  3AO2 A;  3SPY A;  5BN9 A;  1QHT A;  4E7I A;  5BR9 A;  3I8D A;  4FWN A;  2AA4 A;  4FOI A;  2OPR A;  2NRR A;  3VES A;  1OVQ A;  3OJU A;  1S9G A;  4M45 A;  1TKD A;  3DI6 A;  1JCE A;  1SKS A;  1OH6 A;  4FJG A;  3HO1 A;  3K0S A;  3R1X A;  2I7N A;  2RN2 A;  1K73 O;  3BZC A;  4KHS A;  3ZEU A;  2A41 A;  4B1Z A;  1YIJ N;  3KKS A;  4JK7 A;  2VCP A;  2VGN A;  2CH5 A;  3SV3 A;  4H5W A;  3PV8 A;  2A1R A;  3WQT A;  1HYS A;  2OPP A;  1HJR A;  2QTD A;  5GIN A;  2FBT A;  4CED A;  3JYT A;  1NGC A;  1X1P A;  4ZTJ A;  1T7P A;  1C0T A;  4LFC K;  1VSH A;  3L4Q A;  4KTQ A;  3E9P A;  1QQO A;  3PUF A;  3CD6 N;  1GOB A;  1XNR K;  1L3T A;  4E7K A;  4JNE A;  3R3L A;  5KGX A;  3PO4 A;  5AQV A;  4NYN A;  1KLM A;  4EP5 A;  1KFS A;  2OTL N;  2FBV A;  4WFN L;  4N41 A;  3N4P A;  5EVZ A;  1WSE A;  4CEE A;  1LAV A;  5TKY A;  3VQ7 A;  3I8B A;  1RTJ A;  3VQD A;  4FVM A;  3SNN A;  1T3V A;  3D7E O;  4ELT A;  3O6W A;  1KVA A;  5FPD A;  4OPH A;  4IXC A; 
#chains in the Genus database with same CATH homology
 4CZM A;  3MCP A;  1K8A O;  4C23 A;  1S72 N;  3LM2 A;  3O9S A;  4XH1 A;  1QZ6 A;  1OKJ A;  2W40 A;  2QM1 A;  1EQY A;  3QFP A;  5AQG A;  3U8X A;  5LJV A;  1VQM N;  4GV3 A;  4NO7 A;  5AQM A;  2NRT A;  3OW2 M;  4WQ5 A;  1K8K B;  3G71 N;  4M63 C;  3HRG A;  4O8K A;  4K25 A;  4JD2 A;  4R79 A;  4B1V A;  1JJ2 M;  3CER A;  3AY9 A;  4YOV A;  3M1F A;  5AQU A;  4UY8 O;  1QQM A;  3U9D A;  3QBX A;  4H03 B;  1NGD A;  2F9T A;  4K43 A;  4CZK A;  3MN6 A;  5JLF A;  5GIP A;  2VWB A;  3DJC A;  3UB5 A;  2GWK A;  3AAR A;  4BGA A;  2P9L B;  4H5T A;  5KQD A;  5AQT A;  1NGB A;  3VEZ A;  1GLF O;  5CR4 A;  1NWK A;  2A3Z A;  4JKA A;  2FF3 B;  4EHT A;  3J8A A;  4WF9 L;  2YJE A;  2ZJR L;  2HBM A;  2V51 B;  3SLC A;  5EY4 A;  2D0P A;  2QEX N;  3HZ6 A;  4H0T B;  3TPQ A;  1TUU A;  4ILJ A;  3S41 A;  5AQI A;  2E88 A;  3CJC A;  5AZI B;  3HTV A;  3IMX A;  1VQ5 N;  3ZX2 A;  4IFE A;  4U67 L;  4JN4 A;  2ZJP L;  4BR9 A;  4KH6 A;  2E2P A;  2YX6 A;  3LL3 A;  4G9Z A;  1T6C A;  3U9Z A;  3F5T A;  1GLD G;  2HMP A;  1MWK A;  1K9M O;  4FWR A;  2A5X A;  3MN7 A;  4I6M B;  4DKW A;  3ZX0 A;  1KC8 O;  3ENB A;  3I55 N;  4FSV A;  3DLL L;  2CH6 A;  3G6E N;  2HF3 A;  3R9P A;  1XQS C;  4IO8 A;  1V4T A;  1N8R O;  4OO1 J;  4JKE A;  2NRV A;  4MDB A;  3LDO A;  5AQL A;  3CCL N;  4YOY A;  1TYQ B;  3FFK B;  3IUC A;  3WXI A;  4B1X B;  1ZC6 A;  2PBD A;  5AQJ A;  3CXC M;  3VGL A;  4BR2 A;  1YHQ N;  3VPZ A;  3VEO A;  2P9L A;  1SS6 A;  2FLO A;  2OAN A;  2V52 B;  3ATV A;  5GIO A;  5C0Y A;  2QXL A;  2HOE A;  5KPR A;  1WOQ A;  3BP8 A;  4DB3 A;  3GL1 A;  5AZI A;  4MO4 A;  3M5R A;  2JWL A;  4A5A A;  4BVP A;  2P9U A;  3CI5 A;  4FPA A;  4JKH A;  5ADX A;  5LJW A;  3HOS A;  1GLA G;  3C0B A;  4DCH A;  4IZ9 A;  2V7Y A;  3ID8 A;  4LC9 B;  3MN5 A;  1RDW X;  3O80 A;  1W2B M;  3TTF A;  4MO5 A;  4PL8 A;  5M1F A;  2ZGZ A;  3MMV A;  2IVP A;  5AZJ B;  3TTD A;  2KLA A;  1DEJ A;  1E4F T;  1S22 A;  2FF6 A;  4K42 A;  4O5F A;  3A5N C;  2ITM A;  5AFU H;  1BOT O;  4KH5 A;  1G99 A;  3VOV A;  3W3D A;  2ASM A;  2HST A;  3VEY A;  4CBX A;  5KPT A;  1QVF M;  4QS9 A;  4PKH A;  4JK9 A;  4WQ4 C;  2P9I B;  1VQK N;  4MLH A;  1T6D A;  3FZL A;  3CPW M;  3GE1 A;  4JK8 A;  4XEI A;  4BQZ A;  2ZJQ L;  1VQ9 N;  3O1W A;  4PKG A;  1KQS M;  4XH4 A;  1CZA N;  5I9E B;  1W97 L;  4IOA L;  5F2R A;  3BF3 A;  2HBJ A;  5JVG L;  2A42 A;  1ZBS A;  2Q31 A;  2D0O A;  4YOW A;  3ULE A;  4EAH D;  1Z05 A;  4JKB A;  1DT9 A;  2PFU A;  5AQR A;  5GAD P;  3VF4 A;  3G25 A;  3MX5 A;  3ENO A;  3WXK A;  5M1Q A;  2D1K A;  4FWK A;  5C2D A;  4KH4 A;  1VQP N;  3C65 A;  1GLE G;  1H1V A;  3DAW A;  4H0X B;  3E9L A;  3H3O B;  2E8A A;  3O8M A;  5BPM A;  4BC3 A;  2NRZ A;  3M3Z A;  3WEE A;  1C0F A;  4BRN A;  4EFH A;  4XH5 A;  4YDU C;  5C12 A;  4GY2 B;  2GWJ A;  2VYP A;  2P9S B;  2QI2 A;  4A61 A;  4A2A A;  5AZJ A;  1YUW A;  2YHY A;  1NM1 A;  1YJ9 N;  3JXU A;  4BC2 A;  5BRH A;  4OPA A;  1YAG A;  4FWM A;  3C7N B;  1ZXO A;  1YI2 N;  3O9R A;  3O1B A;  4FPB A;  1DGK N;  1KAX A;  2JWK A;  3OHR A;  2P9I A;  4HTL A;  1Q18 A;  4BR5 A;  3DXM A;  4YOU A;  3I33 A;  2PAV A;  5AQH A;  5AQQ A;  4EHU A;  1YIT N;  3FZM A;  4A2B A;  3PIO L;  3H1V X;  3FGU A;  5M1O A;  5JLH A;  3EKU A;  4EIA A;  3WXJ A;  5E26 A;  5MLC Q;  1U2V B;  1V4S A;  2QW9 A;  3UKR B;  1HPM A;  1NMD A;  5AQK A;  3TU5 A;  4E1J A;  3VF2 A;  3P39 A;  4A57 A;  2QWQ A;  5AQF A;  4CZL A;  4IJA A;  2WBN A;  2CGL A;  3CPE A;  4J8F A;  3T7Z A;  1KAY A;  2DPN A;  5EXW A;  3CJ7 A;  3RSE B;  4ISF A;  4CZI A;  4Y0W A;  2QA4 N;  1WUA A;  4F9O A;  4YOX A;  4FL9 A;  4M7X A;  1S3X A;  3SAG A;  3QBW A;  2Q2R A;  5GAH P;  3HBT A;  2NZT A;  4RCH A;  1ILY A;  3C6A A;  2Q97 A;  3N4Q A;  3LDP A;  3CC4 N;  3ZET A;  3AAQ A;  1XC3 A;  2P9S A;  3A5M C;  4FWL A;  1NGA A;  4BRI A;  2D4W A;  3SMP A;  1NGE A;  4FWP A;  4BRC A;  2GX9 A;  3KVG A;  2QWL A;  4BC4 A;  3TSP A;  3E66 A;  1NGJ A;  3C7N A;  3RVC A;  1BA1 A;  3P4I A;  4GVE A;  1Z6R A;  4H5V A;  3CME N;  2BH1 A;  3BUZ B;  1QZ5 A;  3GG4 A;  1NGH A;  1K8K A;  1NGG A;  4H5R A;  2E2N A;  3GDQ A;  5GAE P;  4JEP A;  1YVN A;  1OVY A;  5FPM A;  1GLB G;  1P90 A;  1U6Z A;  4IEE A;  3VEN A;  4Z94 A;  1U2V A;  1QQN A;  2QWO A;  3VF6 A;  4IOX A;  3EL2 A;  3CQY A;  1YXQ A;  4BRG A;  4WCE L;  2J4R A;  2A40 A;  5F1X A;  3EE8 A;  2E1Y A;  4YOR A;  4BR0 A;  5HL7 L;  3RSE A;  5DM6 L;  3W0L A;  5JVH L;  3KZB A;  1HUX A;  1BA0 A;  4B1U B;  3VMF B;  3H6E A;  3DXK B;  3F9M A;  2E2Q A;  1DKG D;  1IJJ A;  3VGK A;  5AQW A;  5JIC A;  3AGR A;  3D2F B;  3P31 A;  3GOI A;  2Q36 A;  3OA9 A;  4IO9 L;  1QVG M;  1BUP A;  4CI6 A;  1NBW A;  2Q0R A;  3A8Y A;  3CJA A;  3KK7 A;  2WUS A;  3LDL A;  2CGJ A;  1NLV A;  4A59 A;  3VTH A;  1C0G A;  4ISE A;  3CCU N;  3R8E A;  2CGK A;  3K9K A;  3QML A;  5ELZ A;  3VEW A;  4CBW A;  1BG3 A;  2P9P B;  2QWN A;  5EOY A;  3AGK A;  3QB0 A;  4FVU A;  2KKZ A;  5AQO A;  3CJ1 A;  5AQS A;  4BRF A;  4C1N I;  1YJW N;  4U7B A;  1LOT B;  1P8Z A;  4JHD B;  2ASP A;  2Q1N A;  4CZE A;  4BRE A;  3B8A X;  2YI1 A;  2HBL A;  4CBU A;  4I6M A;  3CC2 N;  4MLE A;  4B1W B;  4IOC L;  2NRH A;  5EX5 A;  3O9U A;  1KXP A;  2P9N B;  1YJN N;  4H0O A;  1SQK A;  2W41 A;  3Q7C A;  3SBG A;  3K9J A;  3A0I X;  2FXU A;  2VGM A;  4BRA A;  1TYQ A;  4WFA L;  4BRK A;  4HWI A;  4ILG B;  1M1K O;  2V7Z A;  4CZF A;  5BN8 A;  2Q0U A;  1MWM A;  1Y64 A;  4H5N A;  4WQ5 C;  5M1P A;  2F9W A;  1Q86 O;  2WFB A;  3CCV N;  3FR0 A;  1GLJ O;  4H0P A;  5M1K A;  3D2F A;  3NMU A;  5KPZ A;  1LCU A;  3MN9 A;  3CMA N;  3IFR A;  3CQX A;  4O8U A;  3CCM N;  3H3N O;  4GNI A;  1MDU B;  4DHY A;  5AQZ A;  3CET A;  3SK3 A;  3D2E B;  4KBO A;  5BPN A;  3CHW A;  3LDQ A;  1NJI O;  3E1Y A;  1X3N A;  3L6Q A;  3WXM B;  1Q7Y O;  4NLB A;  4FWS A;  4CD3 A;  3FE1 A;  2P9P A;  3C6H A;  3QDK A;  2H3G X;  5LY3 A;  1Q82 O;  4H0Y B;  2YJF A;  4JHD A;  2YHW A;  3CJ9 A;  3DWL A;  5JMV A;  1Q81 O;  3BEX A;  1HKC A;  3L4I A;  4JKF A;  2P9N A;  4IEI A;  5AQY A;  5CE3 A;  3EZW A;  4BRQ A;  3BF1 A;  4NB4 A;  3U4L A;  5AR0 A;  4BRH A;  3CF5 L;  3H45 C;  3NVK A;  1EO1 A;  3FLC O;  3FZK A;  3MWP A;  5C15 A;  3QFU A;  3FZF A;  1VQ8 N;  4BRL A;  1GLC G;  4BQL A;  4JKG B;  4CD1 A;  3VEX A;  3SAH A;  2NRX A;  4DQ8 A;  2RE2 A;  1BO5 O;  4WQ4 A;  4YOT A;  1VQ6 N;  1J6Z A;  3ID6 A;  4BC5 A;  1RGI A;  1SAZ A;  3MWT A;  2UYT A;  4PKI A;  2ZWH A;  3JS6 A;  2FSJ A;  3D2E A;  3KWI A;  4BR7 A;  3CCR N;  2AP1 A;  3CCS N;  1VQ4 N;  2E2O A;  2EWS A;  3OBW A;  1YF5 L;  2RHK A;  3O4W A;  3TSU A;  3ZYY X;  5ADX H;  5AFU A;  5KQ8 A;  3PIP L;  3ZX3 A;  3MX2 A;  3SMS A;  4BRM A;  2I7P A;  2GUP A;  3UE5 A;  5E84 A;  3LM9 A;  2IVO A;  2ASO A;  3VEV A;  4B1Y B;  3J7Z O;  4RTF D;  3H46 O;  5M1N A;  1M90 O;  1ATS A;  3SBT A;  1T44 A;  4JAX A;  2P9K B;  3WT0 A;  1O13 A;  5BPL A;  4CZH A;  4YDU A;  3O9Q A;  4BGB A;  3HSC A;  4H0V B;  2OTJ N;  1VAZ A;  1VQL N;  1IG8 A;  2KHO A;  3O5B A;  2NNW A;  3ATU A;  2ZGY A;  4JKG A;  1QHA A;  3UKR A;  4CZJ A;  1RDU A;  1RFQ A;  3KWG A;  1HX1 A;  3O08 A;  4JKD A;  4PHT X;  1HKG A;  4BVO A;  2E20 A;  4BR4 A;  1TUY A;  1ESV A;  2P9U B;  3E9O A;  3O9T A;  4L3Q A;  3G4S N;  3LDN A;  3SJH A;  3WQU A;  1JCG A;  2FSN A;  3ZEU B;  4A5B A;  5H1S Q;  4AM6 A;  4QS7 A;  1X3M A;  4ILH A;  3GBT A;  5TKW A;  3CCE N;  4CZG A;  3VTI A;  3AAP A;  3H1Q A;  5AQX A;  5BRF A;  4B9Q A;  1KAZ A;  2GEM A;  4FWO A;  4AM7 A;  4M7Y A;  4BRO A;  3UKU B;  4IJN A;  2QWM A;  2BTF A;  2NRW A;  2HBK A;  3TSQ A;  1HLU A;  3FZH A;  4MDA A;  5BRD A;  3MDQ A;  3PLA A;  3QIC A;  3HOT A;  2IIR A;  3EKS A;  4FO0 A;  3OBY A;  5B8H A;  5C2F A;  2A6A A;  2F7T A;  2P9K A;  4BG8 A;  3CCJ N;  2E1Z A;  5BN9 A;  3T69 A;  2YHX A;  5GAG P;  5BRE A;  5BR9 A;  1VQN N;  4FWN A;  1E4G T;  2AA4 A;  2NLX A;  4FOI A;  1NGI A;  2NRR A;  3VGM A;  3VES A;  2QWR A;  3ULE B;  1HJO A;  1XUP O;  4IWV A;  1JCE A;  4BG9 A;  4GV9 A;  4C1N K;  4PL7 A;  5F0X A;  2IVN A;  4GV6 A;  3EE9 A;  4BRP A;  4AF1 A;  4FWQ A;  3R1X A;  2I7N A;  1K73 O;  3EO3 A;  4A62 A;  3P38 A;  3ZEU A;  3CIP A;  3CCQ N;  3CC7 N;  5C10 A;  3WEE B;  2A41 A;  4B1Z A;  1D4X A;  1YIJ N;  3DXK A;  4NLC A;  3M6G A;  3KHY A;  1ATR A;  1R59 O;  3HM8 A;  3MK6 A;  3HI0 A;  2VCP A;  2VGN A;  2CH5 A;  3L0Q A;  4H5W A;  4JK7 A;  5FPE A;  3WQT A;  3UKU A;  1VQO N;  2QTD A;  5GIN A;  2BUP A;  1GLL O;  5CHI A;  2WC9 A;  1ATN A;  1NGC A;  3D6R A;  3SAF A;  3DXM B;  4JKC A;  3WUH A;  3CJB A;  1MA9 B;  3Q7B A;  2GTD A;  3MCA B;  3A5O C;  4BRD A;  3L4Q A;  1BDG A;  4IDH A;  4BY9 C;  2ZF5 O;  3E9P A;  1QQO A;  3VET A;  3R6M A;  5DM7 L;  4JD2 B;  3CD6 N;  3ENH A;  4CJ7 A;  3I56 N;  3IKM A;  1JCF A;  4JNE A;  3R3L A;  1BWF O;  3VER A;  2QWP A;  1BU6 O;  5AQV A;  3A5L C;  4WFB L;  2OTL N;  4RWT A;  4WFN L;  4QS8 A;  3N4P A;  3NVM A;  5EVZ A;  2GEL A;  2HF4 A;  5TKY A;  1KD1 O;  1VQ7 N;  5HOO A;  2YCH A;  5AQP A;  3I8B A;  3TTC A;  5AQN A;  1SZ2 A;  4WYB A;  3F2K A;  3IDH A;  1T3V A;  3D7E O;  4K41 A;  3O6W A;  5FPN A;  3ZET B;  1NGF A;  5FPD A;  4ISG A;  2FSK A;  4OPH A;  1X9J A;  4FOE A;  4IXC A;  1HKB A;  3EN9 A;  3WXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...