2KLAA

Nmr structure of a putative dinitrogenase (mj0327) from methanococcus jannaschii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
GHMINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0327
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Oxidoreductase
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2klaA00
2RE2A 1RDUA 1T3VA 2YX6A 2QTDA 2KLAA 2WFBA 1EO1A 1O13A 1P90A
chains in the Genus database with same CATH superfamily
3PX4A 2NUBA 3R3LA 2CH6A 5EVZA 3ZSRA 4EHUA 1W2BM 3HYFA 5FPMA 3A5NC 3C6TA 3I8BA 4DU3A 5KGXA 5KGWA 1KFDA 2HB5A 1N6QA 1HQUA 1I94K 1E4GT 2DY4A 3ULEB 4DR5K 2YHYA 2E2NA 1W7AA 2YNGA 1NJYA 4BR2A 3AO1A 1U4BA 2A42A 2P9LA 3NBPA 4IOXA 3OJUA 3SUPA 4DV1K 1MU2A 5T7BA 1ZBUA 1VHXA 3BZCA 4JRQA 2HHVA 1C0MA 4FZZA 4FJLA 2GEMA 1BUPA 4JYAK 4DSLA 2NZTA 3IG1A 2VG6A 3SQ1A 3O9QA 3TABA 4AM6A 4NLBA 1M90O 2GBZA 4DSEA 2X74A 4JI6K 5BRHA 1TYQB 3ISNC 1OVQA 3KD5E 1K8AO 5KPZA 1NGGA 1CZBA 2HHQA 3U9ZA 2UXCK 4B1ZA 1RNHA 4CEZA 4KRFA 2QKBA 3EYZA 5LJVA 4XIUA 2FSNA 4CEFA 3RRGA 2QXLA 3R1XA 5HL7L 3THWA 3THYA 2A40A 3HTVA 4WQ5C 3BGRA 3O9UA 3LDLA 4ZTJA 1U6ZA 2P9KA 3ZLJA 4H0YB 1LWEA 2E1ZA 3QBWA 1HYVA 3E9PA 2KFNA 3HXMA 1ZBHA 4OPJA 3BUZB 3CJCA 3K59A 4E7KA 3CJ9A 4CK1A 2ZE2A 1S1WA 4CF1A 4FJ7A 1NGDA 3O9RA 3VF6A 4LF8K 4H03B 3N4PA 2QKKA 1B9FA 1MA9B 4N41A 2G8FA 3C65A 4FW2A 2KW4A 1VQ5N 2UUBK 1RBVA 4NCAA 3RMCA 5AR0A 4LF7K 1VK0A 4FYDA 4OLAA 1RDDA 4CJPA 1TL1A 1EO1A 3VTHA 1N33K 4O8KA 1YTUA 1K6YA 3KK3A 5HROA 4OPKA 1N34K 3NFAA 3D7EO 3GG4A 4ISGA 4CBXA 2RE2A 3OYBA 2YNHA 1VQON 3AVKA 2P9SA 3DOLA 5CR4A 5AQHA 4WE1A 4BGBA 3C95A 1QHTA 1YITN 4DTPA 4J2DA 3DRPA 1SKSA 1DLOA 5LMUK 3HP9A 1DEJA 3VQEA 3ZT2A 3M6GA 2ZWHA 1XHXA 1XMOK 4DSIA 1S22A 3HPHA 2QEXN 1RCHA 3DLRA 2FC0A 3O3HA 3K9JA 4R5PA 1GLAG 3WXMB 1MWKA 2VQFK 4DQ8A 3NMUA 4BVOA 4Q0BA 4IOAL 3HJFA 2OTLN 3O9TA 4O4GA 4KREA 1NGEA 3EN9A 4MLEA 5SWMA 2JGUA 4CIGA 3MCAB 3SK3A 3AVFA 2XY7A 4FLZA 4A61A 4F3TA 3OYGA 5IT9O 1UA1A 2HMIA 3J7YP 3HP6A 1YVNA 1T05A 4KB1A 4FW1A 3P39A 1M1KO 4W5QA 1NGJA 2Q0RA 4AHRA 2RPIA 4CHOA 3O6WA 2UUCK 1EETA 3LZIA 4CERA 4KHWA 3NVMA 3AGKA 5JS2A 2ITMA 1IKVA 5BRDA 3DWLA 2QWRA 4Z4GA 1BU6O 2GWKA 3QEWA 1VSDA 4DFMA 4U67L 4E89A 4C8LA 4DS5A 2YJFA 4HHTA 3E1YA 1Q9YA 3UKRA 1FXXA 3W0LA 3AO2A 4GVEA 1JXEA 3UB5A 4AHVA 3FR0A 3NF9A 4FJKA 4DTUA 3SPZA 3DYAA 4OLBA 1GLJO 4WFNL 3CETA 4YOWA 1MWMA 3CC4N 4W5OA 3SBGA 3SJHA 4BRCA 4CZGA 3AGRA 3VMFB 2KLAA 3QEXA 1EWRA 4Y1CA 4JKHA 5BR8K 4B1YB 1X9SA 1WSFA 4DV0K 2NRXA 4H0PA 5FPEA 1L3VA 1O13A 1KRPA 2KZZA 4DTRA 2G8IA 1IO2A 1JXBA 3V9UA 4M3YA 4BQZA 4CF8A 3LDPA 4E0DA 4DTNA 2P51A 4BRNA 3I8DA 1ILYA 1SV5A 4MO5A 1HUXA 5CZ2A 4FWNA 3U3GA 1NGCA 1HX1A 4FJHA 5AQVA 5AQMA 1SQKA 1HNZK 1Q81O 3VEZA 1EWQA 4BC3A 3MWTA 4EZ9A 2W6LA 1SAZA 1QZ5A 2AA4A 3G0ZA 4YOXA 3TI0A 3OYLA 4H5TA 1FKPA 3T19A 3NDKA 1BWFO 4RTFD 4DG1A 3VF2A 4AF1A 2O4GA 3CM5A 4DMNA 3QO9A 4ID1A 4BRPA 3C7NA 4YOTA 4DKWA 2O8EA 3KKSA 4PY5A 3L0QA 4CBUA 3CCEN 1IV0A 3WNEA 4IJNA 4IO8A 3D45A 4PKHA 3DLLL 3VA0A 2AJQA 3THXA 4N5SA 4CIEA 1LW2A 3EE8A 4XH5A 2NRRA 4JD2A 3L2WA 3T69A 1ATNA 3L2RA 3TARA 3O4NA 4X64K 4BR4A 1VSJA 1LWCA 5M1FA 4KBOA 4DR4K 3RR7A 1U47A 5AQZA 5BN8A 2O8CB 4LH5A 1MDUB 1RBRA 4BR0A 4LF4K 3C6UA 2VQEK 2GELA 4KKOA 4B1WB 3CFOA 2W6KA 5AQSA 5EOYA 3UKUA 4K42A 1KXPA 4PKGA 2VCPA 4O55A 1WAFA 3QNNA 3S3OA 1U2VB 3M8SA 4JKCA 3CQYA 5M1OA 3U3YA 1Z26A 5AQPA 2HBKA 3MEEA 1QSSA 4KFBA 3RSEA 4FK0A 2Z1JA 1BA1A 1KAZA 3C6HA 3K5NA 4X62K 5GIPA 3WQTA 1NGBA 5BR9A 3LP0A 5KTQA 3BF3A 4L3QA 1EQYA 3O4QA 4E1NA 1RT7A 1J9AA 4CEBA 2HBMA 1NK0A 2IOCA 2E2OA 4CGIA 4Z4FA 1S9EA 3J8AA 4I6MB 1ZBSA 2PFUA 3CYMA 3CJ7A 3LALA 3F9MA 5JICA 1O1WA 1VRUA 2D4WA 5BPNA 3MMVA 3H46O 1SL1A 1A5XA 2X6SA 1Y64A 1WUAA 3M8RA 4NCGA 3VQQA 2Q0UA 3FZMA 1T8EA 4CI6A 2VG5A 3P83D 3QMLA 2OYQA 1DT9A 4NXNK 3EKUA 2G8HA 1I3AA 1Q9XA 2A41A 5AZJA 4CF2A 3OYDA 1XC3A 1IKXA 3A5MC 4EP4A 5ADXH 4CZEA 2P9UB 3FZKA 1JLQA 1VQ6N 1NK9A 4PL8A 4RG8A 4H0OA 4WCEL 1C0FA 3MAQA 3DLEA 5EU7A 3CQXA 4V19S 3RRHA 5MLCQ 2KQ2A 2I5JA 3DXMB 1X9MA 5JLFA 1X3MA 5TKWA 1HJRA 4IBNA 1YAGA 4H5VA 4Z94A 4I9QA 1TKDA 3TSQA 2D0OA 5CZ1A 1VQPN 3VF4A 2VYPA 1SKRA 4BRFA 2HMPA 4C8MA 3VPZA 4A62A 2OCEA 1NM1A 4BR7A 3NF7A 5GAGP 3O9SA 1KSPA 4GV9A 2I7PA 4UQGA 4WQ5A 4YORA 1NMNA 4CD1A 3OW2M 4FOEA 4BE0A 2V7YA 3WXIA 5C12A 4JKEA 4DR1K 1IKYA 5J2NA 4AH9A 3NH1A 2OPQA 2WOMA 4JN4A 3KLFA 5H1SQ 4JKAA 4DSJA 4NYFA 4JAXA 4CZJA 4CGFA 2HNDA 4IFYA 1ATSA 3U4LA 3SQ0A 4BRAA 1X9WA 1TK0A 2QWLA 3AVCA 5FRMA 4Y0WA 4FJNA 5CE3A 1W0HA 5EX5A 2DPNA 1QVFM 2IC3A 4IFVA 4WFBL 4U7BA 1CXQA 1KTQA 3B6OA 4E1MA 5EY4A 4DV4K 1RBSA 5JMVA 4DV3K 1ZBIA 3ULDA 1OKJA 4LSNA 1TKTA 3VOVA 2G8KA 4CFDA 3VEYA 1VQ8N 2D1KA 1JKHA 5FLXO 2G8VA 5F2RA 4C8OA 4BRIA 3IFRA 2YI1A 4CEQA 4E7IA 1HPMA 1GOBA 3C6AA 3TAGA 3RVCA 3OVNA 1N8RO 2P9IA 4M7YA 2Y1IA 1QQCA 2IAJA 3H6EA 2YHBA 1GLBG 4LD0A 5I42A 1QZ6A 4KH5A 3HT3A 3AVIA 2B5JA 5LJWA 4NXMK 3OYCA 3ITHA 4B9LA 2XY8A 3DJCA 2UXBK 1BI4B 1HLUA 4CCHA 2ASPA 4DV7K 4JKBA 4FM0A 2QTDA 2NNWA 3ZSVA 2BTFA 1SUQA 3MK6A 3NHGA 1NU0A 3THWB 3T1AA 3SV4A 2FBVA 2X78A 3SJJA 4PKIA 2JWLA 3GL1A 1QS4A 1K8KA 1C0UA 3OYNA 3CJBA 3ZCMA 3V9ZA 3Q7CA 2DFHA 1S1XA 1RDUA 3U8XA 4CJEA 3JAMO 4EFHA 3CF5L 3RMDA 4CZIA 4C1NI 1KVAA 2KZMA 3VESA 2HBLA 4FPBA 5AQUA 3PSIA 2P9NB 1U45A 4JHDB 2XY6A 3EO3A 1XI1A 4GV3A 4IFEA 3WUHA 4M42A 1NWKA 5AQGA 4ZTFA 4DLEA 1S6PA 3F73A 1IBLK 3ALYA 1JLBA 3K2PA 4JKGA 4FWRA 4CF9A 2F8SA 1P8ZA 2YCHA 4B3OA 2DTUA 3L2QA 4IOCL 5TKYA 3HO1A 4DS4A 3NVKA 4FK2A 5E26A 2F7TA 4FWQA 4CIFA 1P90A 1RT5A 3AVNA 3FFKB 4HUGA 1SS6A 4ISFA 2ZJQL 1K9MO 4LFAK 4BC2A 2E1YA 3OHRA 3CQ8A 3KK7A 4DUZK 4F3OA 3HRGA 5AQFA 4CEEA 3AAPA 1QSLA 4FJMA 3JSMA 5JVHL 4KHSA 3KHYA 1NLVA 1N36K 1ZBFA 4C23A 1GOAA 1WSIA 1WN7A 4CVNE 5LMNK 2FSKA 4KHUA 4RW8A 1BIZA 4K8ZA 1YT3A 4WQ4C 4FWMA 4CGHA 5AQNA 2YNFA 4E7HA 3SQ2A 1KFSA 3QNOA 5AQRA 1IBKK 3HM9A 1UOCA 1QE1A 4QAGA 4DFKA 4FJJA 4MQ3A 4I7FA 3D0PA 4LSLA 4JI0K 4FJ5A 4CZFA 4FJIA 4X65K 3PO4A 2GX9A 3OS2A 4FO0A 4BRDA 1LCUA 1R0AA 1V4TA 2A1SA 1C1AA 3AY9A 4F4KA 3WXLA 3K5LA 3VQ4A 1RFQA 4H5WA 2O8DB 1TUYA 4M3TA 2NRTA 4BY9C 2LSNA 5J1EA 2QM1A 3KK2A 1GLFO 3TTFA 4BG8A 4BQLA 3VERA 4QS7A 3TAQA 1WOQA 3P38A 4YDUC 3VQDA 2E20A 4JS5A 4B3SK 4JKDA 4CESA 3QIPA 2NRWA 3ULEA 5FPDA 4CHPA 4JEPA 2O4IA 4PHTX 4X66K 3CCLN 3J7AP 2V51B 5C0YA 1XWLA 3AVMA 5AQLA 3LDNA 5AJ3K 1GLLO 4FVUA 1J54A 4Z0UA 3OYKA 1QQOA 3J81O 4MDBA 1HNXK 1KVBA 4CGDA 5HOOA 3G25A 1NKEA 1Z6RA 3LM9A 2ATQA 4DV6K 1FKOA 4H0XB 3ZETA 4RW7A 4JI2K 3HOSA 3DRRA 3HPOA 4BRGA 2O8FA 4M45A 1BISA 4CJ5A 3P31A 3O5BA 3D2FB 4EHTA 1WBBA 4YOYA 1JCGA 3VEXA 4LC9B 1ASWA 4KTWA 3TAPA 2HF3A 4JKFA 3PUFA 1RDAA 3K58A 3ZSQA 3P1GA 4O5BA 3E01A 4N47A 4XH1A 1T03A 3TAFA 4RCHA 3QERA 1BIUA 1OH5A 1QTMA 3ZT3A 1IJJA 4A5AA 1HYSA 3AA2A 2D0CA 4CZKA 1QQMA 4E19A 1LAWA 3OY9A 1SZ2A 1HPZA 3DLKA 5E41A 2H3GX 3EE9A 3V4IA 4ELUA 3TAEA 2KHOA 4W5NA 4JLHA 4E7JA 2KTQA 3O1BA 4PL7A 1VSIA 2WUSA 3AO3A 3NH0A 3K0SA 1N5YA 5C2DA 3SZ2A 5HBMA 3DXKB 2OA8A 1WLJA 5CYMA 3ID8A 5J2MA 1HNWK 1VQ4N 3OYIA 5KI6A 3MX5A 5DMRA 2YX6A 4O0IA 4BACA 3C7NB 4K8XA 1RT3A 4AHCA 4JI7K 1E4FT 3QIOA 4M3UA 3A2FA 3MXJA 4OKKA 3CC2N 1XUPO 5KPTA 4KI6A 1VSHA 4CZLA 5BRFA 3KLGA 2NRZA 4JD2B 3AA3A 4MLHA 1JL1A 3WT0A 5HP1A 2O8BA 1VQ9N 3VQCA 1IG8A 2YV0X 3V81A 1XC9A 4H0TB 2W41A 1FW6A 3SCXA 3IDHA 4DB3A 5ADXA 3WEEB 1S9GA 3CPWM 1NGFA 3P5JA 4B08A 4FVMA 4M3ZA 3HL8A 3KWGA 3IMXA 4NYNA 2J4RA 3C0BA 3KD1E 4Z4IA 4WFAL 4FWOA 1N32K 3QLHA 3SAHA 2E4LA 3SUNA 5I3UA 3KLHA 3ZEUB 4ISEA 3RSEB 1RTIA 4CHZA 4DFPA 3PX6A 4DF8A 1TKZA 1HKBA 3MN5A 3NH2A 2YNIA 2Q1NA 1GLCG 3I0RA 2PAVA 3W3DA 4KHPK 1J53A 3EL2A 1U48A 4OPHA 5I9EB 4CZMA 3TU5A 1ZBLA 1X1PA 3UIQA 3GOIA 3I55N 2F4VK 3A0IX 4KTZA 4O5FA 4W5RA 1NJIO 2A3ZA 3KJVA 3M1FA 3FGUA 3OYEA 1WNSA 3ZT0A 3CCRN 4FM2A 4YY3K 4HUEA 4FK4A 3N4QA 4J2EA 5EXWA 2Q36A 1RT6A 4DV5K 3O1WA 3VEOA 2HVIA 3MECA 3ZSOA 1KAXA 5JLHA 2JWKA 5AQJA 2WFBA 2E6MA 3VTIA 4CE9A 3MN7A 2F9WA 2VGNA 4H4MA 2IVPA 4FCYA 2EX3A 5CYQA 4FLTA 1HNVA 1YJ9N 1X3NA 5GIOA 1TK8A 3LPUA 4HCBA 4BROA 2FBTA 1C1CA 3P4IA 4IZ9A 3V1RA 3CCMN 4JK8A 1CXUA 3LDSA 1YIJN 2E5LK 4GKJK 3WNFA 1TGOA 1H1VA 4CK3A 3ZSWA 5KRTA 2UU9K 3L4QA 3G6EN 4B9QA 4K25A 4IG3A 4AM7A 1BO5O 5KRSA 1VQNN 3LWLA 2BDPA 3H3OB 4A2BA 1A5VA 3S41A 2QWPA 3VQ6A 5FRNA 1V4SA 3AVJA 2IS3A 5ELZA 3U6FA 2FF3B 3NF8A 4BE2A 4CJ4A 4M41A 4CFCA 4JS4A 5HRNA 3LDQA 3HM8A 2CGJA 1OVYA 1DTQA 4MO4A 1ZYQA 4H5RA 4FJ8A 2NRHA 3AAQA 4KHNA 1Q82O 5C25A 2IVNA 4K43A 3ENHA 4DR6K 4YNQA 3K57A 2W40A 3A8YA 4HWIA 1F21A 3AV9A 3SI6A 4CJUA 3QEVA 1L3SA 3TSPA 3ZX3A 4BDYA 3ID6A 3OJSA 3LZJA 4CHYA 4NB4A 3CFPA 4CJWA 2ITGA 3G10A 5M1QA 3K5OA 2RF2A 3D2EA 3LANA 3TR8A 4RW6A 5A2QO 4ILGB 5BN9A 4JI5K 1VQ7N 1D4XA 5C15A 3F2KA 1TL3A 3R9PA 2KFZA 3OBWA 4NCBA 4BDPA 4JI1K 3QESA 5AZIB 4HTUA 4OVLA 1BA0A 4DLGA 4FJXA 3AO4A 1WSJA 4RW4A 2R7YA 2WTUA 1YVUA 3L4IA 3IAYA 2A6AA 4A5BA 1KAYA 1SL2A 2WONA 1XMQK 2O8CA 4CW7B 4EIAA 1JL2A 1LW0A 1B9DA 4BR9A 4F2SA 5LL6Z 1WSGA 4CK2A 3ASMA 3G71N 4DU4A 4C8KA 1NK5A 1LOTB 3S9HA 2GWJA 1S1TA 4CFBA 1ASVA 4PUOA 1FK9A 5F0XA 3AVBA 1U2VA 1KC8O 3E9LA 5BPMA 3MEDA 4EP5A 3V6DA 3DI6A 1DTTA 4ID5A 4XH4A 5K14A 4GV6A 4B1UB 3R6MA 4J2AA 4IDHA 2OPPA 2GTDA 5C2FA 3NE6A 1W9HA 4Z4EA 4DHYA 2PYJA 1JLGA 2BGGA 1OH7A 4YOVA 4Z4CA 2VWJA 4Q5VA 3VGKA 3WQUA 3SLCA 3FZLA 2XO7A 3OS1A 2PY5A 2BANA 4PQUA 5KQ8A 5J2PA 3L8BA 1IBMK 4I6MA 4IXCA 3GE1A 5GAHP 1K8KB 3HVRA 1E3MA 1YJNN 2P9PA 2RN2A 5C24A 3ZYYX 2HNYA 4CJTA 3QBXA 2FF6A 4YDUA 2OPSA 3J80O 3SUOA 1IG9A 1GLDG 1UWBA 4KV8A 1ESVA 1T6CA 2P9LB 4B8CA 1QHAA 4WF9L 1HMVA 3MCPA 4CHNA 4FPAA 3PX0A 4JKGB 1RDWX 1JCEA 4DFJA 2Z1IA 2YJEA 3LWMA 4H8KA 4JI4K 3TTCA 3BZKA 2P9UA 1VSMA 3QETA 3H1QA 3AVLA 4B3MK 5SZTA 3KLIA 4DQSA 3CI5A 4I9LA 1NG9A 2QWQA 3DXMA 4H5NA 3WNGA 3L2UA 4IWVA 1JLEA 3KK1A 3PV8A 4FLXA 2VG7A 2F9TA 5DM7L 1B92A 4F8RA 1YF5L 3DLBA 1VSKA 1Q18A 3CJ1A 2E88A 3SMSA 3LAMA 5AQYA 3THYB 1A5WA 4NLCA 3LM2A 1HYZA 3S3MA 5B8HA 4WYBA 3RWUA 3HOTA 4YFUA 1RT4A 1J6ZA 2QWNA 2P9KB 1SKWA 3M8PA 4BDZA 4CJ7A 1RDCA 4DR2K 4O8UA 1X9JA 3V9WA 3ZSXA 4FXDA 1YXQA 1LV5A 2PYLA 2ZJPL 3KZBA 4KHYA 3PLAA 5JS1A 3NGIA 1HRHA 3I0SA 4FLVA 1VAZA 4ILHA 3I33A 3F9KA 2IIRA 1HQEA 3DRSA 2HSTA 3TAMA 4ICLA 5F1XA 2V52B 4KPYA 3QB0A 1S1UA 5E84A 4M3WA 3CFRA 1S6QA 2GUIA 4A59A 3HPGA 3VQ8A 4ELTA 3CMEN 1C0GA 3D6RA 2B4JA 5AQOA 4OO1J 5CY4A 4XEIA 3QINA 2P9SB 1TK5A 4LF6K 3HK2A 3ZX0A 3V1QA 4IEEA 2ZM6K 3THVA 2G8UA 2WC9A 4JNEA 3VQ9A 1TKXA 3CXCM 1BDGA 3LDOA 2UYTA 3PY8A 4QS8A 3ZETB 2P1JA 3UE5A 1VQLN 1BHLA 3HVTA 1VSEA 1J5OA 5AQWA 4BWMA 3TSUA 1C6VA 4I2PA 2O8FB 2QWOA 1NJWA 3K9KA 2NRVA 4DU1A 2V7ZA 2RKIA 1S72N 4ZHRA 2HHXA 2D5RA 1BI4A 4IO9L 3OA9A 4CEDA 4FLUA 4BWJA 4BRMA 3FZHA 3QEPA 2UXDK 4H4OA 4BGAA 3VEWA 1L5UA 1VRTA 4BG9A 3QDKA 5AFUA 4AHTA 1Q86O 4DSKA 3SBTA 1WB9A 4FWSA 5GAEP 2P5GA 5CHIA 3OS0A 4DQQA 2YHAA 1Y97A 1NOYA 3EEQA 1BCMA 1BOTO 3SAGA 4OKEA 1UA0A 5M1PA 2P9NA 4JHDA 3VQPA 3EZ5A 3U9DA 1R59O 3BP8A 3NAEA 3CMAN 2HHTA 3BDPA 1REVA 3DLHA 4KO0A 1NGAA 3AA4A 3M3ZA 3C94A 3EZWA 3CC7N 3AO5A 4L8RB 1NK4A 3UKRB 1T44A 4BC4A 5C10A 1CZ9A 1NKBA 3IUCA 1L3TA 1T3VA 1S5JA 2Y1JA 3Q7BA 2XRIA 4KHQA 4LFBK 3A5LC 3AARA 3OYFA 3NGYA 1C0TA 4E7LA 1QSYA 4R79A 4CHQA 3MX2A 4J8FA 4W5TA 3TPQA 1TYQA 3VETA 4KAZA 4BRKA 4DTMA 1L3UA 2PBDA 1U49A 2FXUA 4QS9A 3OBYA 4CJKA 4DTXA 3SMPA 3JYTA 4DCHA 3FLCO 3DAWA 5AQIA 4CECA 1K73O 2O8BB 3O3GA 1HKCA 3T3FA 3CJAA 4FJ9A 3KTQA 4N76A 2EWSA 3IS9A 4IJAA 5AQXA 3QFUA 2W42A 1EXQA 1YHQN 4CEOA 1NK7A 1VSLA 3HI0A 1RILA 4DTJA 3CHWA 4CF0A 1NKCA 3CERA 3O4WA 2HF4A 4GNIA 3DM2A 1XNQK 4AHUA 3LP2A 5GADP 3O08A 1ATRA 4F9OA 3CM6A 2OZSA 4DTOA 4GVMA 2O8DA 2ZD1A 3QICA 4KH6A 4PWDA 4DWIA 2XHBA 3L6QA 4KH4A 4B9UA 2Z1GA 2G8WA 1U04A 2HOEA 3VEVA 3PSFA 1JLFA 1BL3A 4FZXC 1ZC6A 5HLFA 1NNEA 3NF6A 2Q31A 3H45C 2CH5A 2O8EB 3FFIA 5M1NA 3VQ7A 1SL0A 4LFCK 1RTJA 1JLAA 4FWLA 4CBWA 3HZ6A 4DR3K 2OANA 3THXB 4FL9A 4B9NA 4C8NA 1RT1A 5HRPA 5AQTA 4M3XA 1UAXA 2QA4N 1CLQA 4LY7A 4C1NK 1Z25A 3ATVA 4BE1A 3VQ5A 3QFPA 3KLEA 1DGKN 2HHSA 1YTAA 4QOZB 1QVGM 3PIPL 1S3XA 1HJOA 3CPEA 3V1OA 3D2FA 4CJRA 1ASUA 3UKUB 1YUWA 3SAFA 3MN6A 4FWPA 3SUQA 3VN5A 4IG0A 5AFUH 4CJFA 4BRLA 1RBTA 4DV2K 4YHHK 4I2QA 3LP3A 1KQSM 3KVGA 3M8QA 2HBJA 4OJRA 4MFBA 4GW6A 1HR0K 4B9SA 3MWPA 4DUYK 4M3RA 1NOZA 1OH6A 3CD6N 3RMBA 3L3VA 3BF1A 1QQNA 3WXKA 4IEIA 4RWTA 3K5MA 1GLEG 3IKMA 1JCFA 3ZSYA 2ZF5O 1XQSC 3FZFA 2UUAK 2DFFA 3R8EA 1Q7YO 3T7ZA 2RHKA 5FROA 3E66A 4JI3K 4OX9K 4E3SA 2BUPA 5AQQA 3TANA 4HCCA 3H3NO 3VQBA 2BH1A 4OGEA 4FLWA 1WSHA 4BVPA 4CJSA 1D5AA 4KI4A 4B9MA 4EAHD 2OZMA 4AHSA 2CGLA 3DXKA 1T6DA 1NGHA 4FSVA 3CCUN 2QK9A 2Q2RA 3DLGA 4LH4A 2F8TA 2OPRA 4QCLA 2ZGYA 1KVCA 1NBWA 2AP1A 4GKKK 2HHUA 2ETJA 3D2EB 5IWAK 4YOUA 3GBTA 2JLEA 4CGJA 3M5RA 1CZAN 5LY3A 5AZJB 3CCQN 1XHZA 5FDLA 3ZT1A 1RTDA 2YKNA 2I7NA 1TAQA 2QI2A 1JLCA 4KB0A 3E9OA 3MDQA 4N56A 4HTLA 3SNNA 4JV5K 3CCJN 3VGMA 2VWKA 2FSJA 4JK7A 3WXJA 1TAUA 1WSEA 2IVOA 4H0VB 3V9XA 4FJGA 4B1VA 3WEEA 3SV3A 2PZSA 4B3RK 3NGZA 1LWFA 1TVRA 4DQPA 3JXUA 3J7ZO 5AQKA 4GMJB 4IKFA 3EY1A 1YI2N 3FE1A 1GOCA 4B9VA 4B1XB 3PO5A 4JK9A 4OKJA 1S1VA 3ZEUA 2IGIA 5DM6L 4LF9K 4FM1A 1D9FA 4BRQA 3EKSA 1RGIA 3RTVA 3VQAA 3CIPA 4A2AA 3L2VA 4M63C 3OYHA 2ZJRL 5DK5A 2FBYA 3SQ4A 2BE2A 1EKEA 1Q8IA 4K0KK 4DQRA 4OGCA 3B6PA 3RMAA 3MXMA 4CJQA 3TWHA 3LAKA 1JJ2M 3ZSZA 4RW9A 4K41A 1Z05A 2VWBA 2Z1HA 2CGKA 3BY5A 4DSFA 2XY5A 4CEAA 1C1BA 2ASMA 4CGGA 2P9PB 3KWIA 4HUFA 1I39A 4A57A 5KPRA 3KIOA 3ENOA 4BRHA 4CD3A 2HHHK 2YHXA 5BREA 1KD1O 5KQDA 3OYJA 1NJXA 1RDBA 5HRSA 2OTJN 1NMDA 4EZ6A 2D0PA 3T1YK 1FJGK 5GINA 4FOIA 2D0AA 4B9TA 2HNZA 1IKWA 3CG7A 4FLYA 1WBDA 3L3UA 4JI8K 1RBUA 5JVGL 3O80A 2X6NA 2KKZA 3KKRA 1T7PA 3MEGA 3HBTA 1OH8A 4B3TK 3LP1A 1D9DA 2GUPA 5C42A 1WAJA 2E2QA 4FWKA 2F96A 3ZX2A 2P9IB 3AA5X 3A5OC 4E1JA 1G99A 4WQ4A 1BQMA 4LF5K 5D3GA 1DKGD 3F5TA 1EX4A 4Z4HA 4ILJA 1HNIA 1TV6A 2A5XA 3T1HK 2P5OA 4F2RA 2B6AA 4M7XA 1BCOA 2VGMA 5FPNA 3S3NA 4O44A 3OYAA 3AVHA 1D8YA 4DR7K 1EP4A 3I56N 1KLMA 2NLXA 1IH7A 3CCSN 4GY2B 3GDQA 5J2QA 4B8AB 1NK8A 1VQKN 4G1QA 4BR5A 3MXIA 1BG3A 4DTSA 3LL3A 4G9ZA 2QXFA 4DF4A 5M1KA 3OYMA 1RTHA 4AILC 1ITGA 4CJLA 3QEIA 4BREA 1BQNA 3JS6A 3ATUA 2A1RA 4TSXA 4HVJA 1LAVA 2HHWA 2QWMA 4OPAA 3ZT4A 2ZGZA 2GV9A 2QW9A 5AZIA 4IDKA 3DOKA 5BPLA 4CJ3A 2E6LA 1W97L 1KLNA 2Q97A 3IRXA 3HSCA 2YHWA 3TTDA 4JRPA 4AQYK 3CCVN 2ZQBA 4CZHA 2WBNA 3O3FA 2FLOA 1RT2A 1NK6A 4NO7A 2Q3SA 3BEXA 4FZYA 1KCFA 4DQIA 3AVGA 3VENA 2EHGA 4O0JA 2ASOA 4MDAA 3AVAA 3SYZA 2YKMA 3H08A 3SPYA 1VSFA 1NGIA 3V9SA 3OTOK 1VQMN 4UY8O 1TUUA 1XNRK 1BGXT 2FBXA 1YJWN 2HW3A 4PA1A 3O8MA 3RR8A 1G15A 1ZXOA 3ENBA 4CFAA 2IDOA 3H1VX 4Y1DA 4J2BA 3B8AX 3VA3A 2HVHA 4CJVA 1HKGA 2E8AA 3G4SN 3DMJA 5HRRA 4KTQA 3HSTB 1J5EK 1NJZA 3PIOL 3NCIA 3VGLA 3MN9A 4ELVA 2E2PA 3WNHA 4BC5A 2DFEA 2D0BA 3LPTA
chains in the Genus database with same CATH topology
2PBDA 1C0FA 2FXUA 3R3LA 3GOIA 2CH6A 5EVZA 3I55N 4QS9A 3A0IX 3OBYA 4EHUA 1W2BM 3CQXA 4O5FA 5FPMA 3SMPA 3A5NC 3I8BA 4DCHA 1NJIO 3FLCO 5MLCQ 2A3ZA 3DAWA 5AQIA 3M1FA 3FGUA 3DXMB 1K73O 5JLFA 1X3MA 1HKCA 5TKWA 3CJAA 4Z94A 1YAGA 4H5VA 3CCRN 3TSQA 1E4GT 2D0OA 3ULEB 2EWSA 3N4QA 2YHYA 4IJAA 2Q36A 3QFUA 5AQXA 5EXWA 1VQPN 1YHQN 2E2NA 3VF4A 2VYPA 3O1WA 3VEOA 4BR2A 4BRFA 1KAXA 2HMPA 3VPZA 4A62A 5JLHA 2A42A 1NM1A 2JWKA 2P9LA 2WFBA 3HI0A 4IOXA 5AQJA 3O9SA 3MN7A 3VTIA 4BR7A 2I7PA 3CHWA 5GAGP 2F9WA 4GV9A 2VGNA 3CERA 4WQ5A 4YORA 4CD1A 2IVPA 3OW2M 3O4WA 4FOEA 2HF4A 4GNIA 2GEMA 1BUPA 2V7YA 3WXIA 5C12A 4JKEA 1YJ9N 1X3NA 5GIOA 4BROA 2NZTA 5GADP 3O08A 1ATRA 3O9QA 4F9OA 3P4IA 4IZ9A 4JN4A 3CCMN 4AM6A 4NLBA 1M90O 4JK8A 5H1SQ 4JKAA 3QICA 1YIJN 4JAXA 4CZJA 5BRHA 4KH6A 1TYQB 1H1VA 1ATSA 3U4LA 1K8AO 3L4QA 3L6QA 4KH4A 4BRAA 5KPZA 3G6EN 2QWLA 1NGGA 4K25A 4B9QA 4AM7A 1BO5O 2HOEA 4Y0WA 3U9ZA 1VQNN 3VEVA 4B1ZA 5CE3A 1ZC6A 5EX5A 3H3OB 4A2BA 2DPNA 1QVFM 5LJVA 3S41A 2QWPA 2Q31A 3H45C 2CH5A 2FSNA 1V4SA 2QXLA 3R1XA 5HL7L 5M1NA 5ELZA 4WFBL 4U7BA 2A40A 5EY4A 2FF3B 3HTVA 4WQ5C 4FWLA 5JMVA 4CBWA 3HZ6A 3O9UA 2OANA 3LDLA 4FL9A 1OKJA 3LDQA 1U6ZA 2P9KA 3HM8A 3VOVA 5AQTA 2CGJA 4H0YB 1OVYA 2E1ZA 4MO4A 3VEYA 2QA4N 3QBWA 1VQ8N 3E9PA 2D1KA 4H5RA 4C1NK 2NRHA 3AAQA 3ATVA 1Q82O 3BUZB 5F2RA 3CJCA 3CJ9A 3IFRA 4BRIA 2YI1A 3QFPA 2IVNA 4K43A 1HPMA 3C6AA 3ENHA 1DGKN 3RVCA 1N8RO 2W40A 2P9IA 3A8YA 1NGDA 3O9RA 4HWIA 4M7YA 1S3XA 3VF6A 3PIPL 1QVGM 1HJOA 4H03B 3N4PA 3CPEA 3D2FA 3H6EA 3TSPA 1MA9B 1GLBG 3UKUB 3ZX3A 1YUWA 3ID6A 3SAFA 3C65A 3MN6A 4FWPA 1VQ5N 1QZ6A 4KH5A 5AFUH 4BRLA 4NB4A 1KQSM 3KVGA 5LJWA 5M1QA 2HBJA 5AR0A 3D2EA 4ILGB 5BN9A 3DJCA 1EO1A 3MWPA 1HLUA 3VTHA 1VQ7N 1D4XA 4O8KA 2ASPA 5C15A 3F2KA 3CD6N 4JKBA 3BF1A 2QTDA 3R9PA 2NNWA 3OBWA 1QQNA 5AZIB 3WXKA 3D7EO 3GG4A 2BTFA 3MK6A 1GLEG 4IEIA 4ISGA 2RE2A 3IKMA 1JCFA 4CBXA 1BA0A 2ZF5O 1XQSC 3FZFA 1VQON 2P9SA 3R8EA 1Q7YO 4PKIA 3T7ZA 2RHKA 5CR4A 2JWLA 3GL1A 3E66A 5AQHA 1K8KA 4BGBA 3L4IA 2A6AA 4A5BA 1YITN 2BUPA 3CJBA 1KAYA 3Q7CA 5AQQA 3H3NO 1RDUA 3U8XA 4EIAA 2BH1A 4EFHA 4BVPA 4BR9A 3CF5L 1DEJA 4CZIA 4C1NI 4EAHD 3M6GA 3G71N 3VESA 2HBLA 2ZWHA 4FPBA 2CGLA 1LOTB 1T6DA 1NGHA 2GWJA 3DXKA 4FSVA 5AQUA 2P9NB 5F0XA 3CCUN 4JHDB 1S22A 3EO3A 1U2VA 2QEXN 4GV3A 4IFEA 3WUHA 1KC8O 3E9LA 1NWKA 2Q2RA 5BPMA 5AQGA 3K9JA 1GLAG 3WXMB 1MWKA 4XH4A 4DQ8A 4GV6A 4JKGA 3NMUA 4B1UB 2ZGYA 4FWRA 4BVOA 4IOAL 1NBWA 3R6MA 1P8ZA 2OTLN 2AP1A 2YCHA 3O9TA 1NGEA 3EN9A 4MLEA 3D2EB 4IDHA 5C2FA 2GTDA 4YOUA 4IOCL 5TKYA 3GBTA 4DHYA 3M5RA 3MCAB 3SK3A 4YOVA 3NVKA 5E26A 1CZAN 4A61A 5LY3A 5AZJB 3CCQN 2F7TA 4FWQA 3VGKA 3WQUA 1P90A 3FFKB 3SLCA 3FZLA 2I7NA 2QI2A 1SS6A 1YVNA 4ISFA 3P39A 2ZJQL 5KQ8A 4BC2A 1K9MO 2E1YA 3E9OA 3MDQA 1M1KO 1NGJA 3OHRA 4HTLA 3KK7A 2Q0RA 4I6MA 4IXCA 3CCJN 3VGMA 3GE1A 3O6WA 2FSJA 3HRGA 4JK7A 1K8KB 5GAHP 3WXJA 5AQFA 1YJNN 3AAPA 2P9PA 3NVMA 2IVOA 3AGKA 5JVHL 4H0VB 2ITMA 3KHYA 3ZYYX 4B1VA 1NLVA 3WEEA 5BRDA 3DWLA 2QWRA 3QBXA 2FF6A 1BU6O 4C23A 2GWKA 4YDUA 3JXUA 2FSKA 3J7ZO 5AQKA 4U67L 1YI2N 3FE1A 4WQ4C 4FWMA 1GLDG 2YJFA 3E1YA 5AQNA 4B1XB 3UKRA 4JK9A 1ESVA 1T6CA 3W0LA 2P9LB 4GVEA 1QHAA 5AQRA 3ZEUA 4WF9L 3MCPA 5DM6L 3UB5A 4FPAA 3FR0A 4BRQA 4JKGB 3EKSA 1RGIA 1RDWX 3CIPA 4A2AA 1JCEA 4M63C 2YJEA 2ZJRL 1GLJO 4WFNL 3CETA 3TTCA 4CZFA 4YOWA 2GX9A 2P9UA 3TU5A 1MWMA 4FO0A 4BRDA 1LCUA 3CC4N 1V4TA 3AY9A 3WXLA 3H1QA 1RFQA 3SBGA 4H5WA 3SJHA 1TUYA 4BRCA 4CZGA 2NRTA 3AGRA 3CI5A 3VMFB 4BY9C 2KLAA 2QM1A 1GLFO 2QWQA 3DXMA 3TTFA 4H5NA 4BG8A 4BQLA 3VERA 1JJ2M 4IWVA 4QS7A 4K41A 1WOQA 1Z05A 3P38A 2VWBA 2E20A 4JKHA 4YDUC 2CGKA 4JKDA 4B1YB 2NRXA 2ASMA 2NRWA 4H0PA 3ULEA 2P9PB 1O13A 2F9TA 4JEPA 5FPDA 5FPEA 4PHTX 5DM7L 3KWIA 4A57A 5KPRA 3CCLN 2V51B 3ENOA 4BRHA 4CD3A 5C0YA 2YHXA 1YF5L 5BREA 1KD1O 5KQDA 1Q18A 3CJ1A 2E88A 3SMSA 5AQLA 4BQZA 3LDNA 5AQYA 4NLCA 3LDPA 3LM2A 2OTJN 5B8HA 1NMDA 4WYBA 2D0PA 1GLLO 4BRNA 4FVUA 3HOTA 1ILYA 5GINA 4FOIA 4MO5A 1QQOA 1J6ZA 1HUXA 2P9KB 2QWNA 4MDBA 4FWNA 5HOOA 3G25A 1NGCA 1HX1A 4CJ7A 5JVGL 1Z6RA 3O80A 2KKZA 3LM9A 4O8UA 3HBTA 5AQVA 5AQMA 1SQKA 1X9JA 1Q81O 3VEZA 4H0XB 3ZETA 2GUPA 4BC3A 3MWTA 3HOSA 1YXQA 2E2QA 4FWKA 1SAZA 2ZJPL 1QZ5A 2AA4A 3KZBA 4BRGA 3ZX2A 4YOXA 3PLAA 2P9IB 3A5OC 4H5TA 4E1JA 1VAZA 3O5BA 3P31A 3D2FB 4ILHA 3I33A 4EHTA 1G99A 2IIRA 4YOYA 2HSTA 1JCGA 1BWFO 4LC9B 4RTFD 4WQ4A 3VEXA 3VF2A 4AF1A 2HF3A 4JKFA 4BRPA 3C7NA 5F1XA 2V52B 4YOTA 3QB0A 4DKWA 1DKGD 3F5TA 5E84A 3L0QA 4ILJA 4CBUA 3CCEN 4IJNA 4IO8A 4PKHA 4A59A 2A5XA 4XH1A 3DLLL 4RCHA 4M7XA 2VGMA 3CMEN 5FPNA 1C0GA 3D6RA 3EE8A 4XH5A 2NRRA 4JD2A 5AQOA 3T69A 4OO1J 1ATNA 3I56N 1IJJA 4A5AA 4XEIA 2NLXA 2P9SB 4BR4A 4CZKA 3CCSN 1QQMA 4GY2B 3GDQA 5M1FA 1VQKN 1SZ2A 4KBOA 3ZX0A 4IEEA 2H3GX 3EE9A 4BR5A 2WC9A 4JNEA 2KHOA 5AQZA 5BN8A 1MDUB 4BR0A 3CXCM 1BDGA 1BG3A 3O1BA 2GELA 3LDOA 4PL7A 4B1WB 2WUSA 2UYTA 3LL3A 4QS8A 5AQSA 5EOYA 3UKUA 3ZETB 4G9ZA 3UE5A 1VQLN 5C2DA 5M1KA 4K42A 1KXPA 4PKGA 5AQWA 2VCPA 3DXKB 3TSUA 1U2VB 2QWOA 4BREA 4JKCA 3CQYA 2NRVA 3K9KA 5M1OA 2V7ZA 3ATUA 3ID8A 2HBKA 3JS6A 5AQPA 1S72N 1VQ4N 2QWMA 3RSEA 4IO9L 3OA9A 4OPAA 3MX5A 2YX6A 2ZGZA 2QW9A 4BRMA 3C7NB 4RWTA 5AZIA 1BA1A 1KAZA 3FZHA 3C6HA 1E4FT 4BGAA 5GIPA 3WQTA 1NGBA 3VEWA 5BR9A 4BG9A 5BPLA 3QDKA 5AFUA 3CC2N 3BF3A 4L3QA 1W97L 1XUPO 1EQYA 5KPTA 1Q86O 2Q97A 4CZLA 5BRFA 3HSCA 2YHWA 3SBTA 3TTDA 2NRZA 4JD2B 3CCVN 4FWSA 4CZHA 2HBMA 5GAEP 2WBNA 5CHIA 4MLHA 3WT0A 2E2OA 2FLOA 1VQ9N 3J8AA 4I6MB 4NO7A 3BEXA 1IG8A 1ZBSA 3VENA 4H0TB 2PFUA 1BOTO 3CJ7A 2W41A 3SAGA 3IDHA 3F9MA 5M1PA 2ASOA 4DB3A 2P9NA 5JICA 5BPNA 2D4WA 4JHDA 5ADXA 3WEEB 4MDAA 3U9DA 1R59O 3MMVA 3BP8A 3CPWM 3CMAN 1NGFA 3H46O 3KWGA 3IMXA 1Y64A 1NGIA 2J4RA 1WUAA 3C0BA 1VQMN 4UY8O 2Q0UA 1NGAA 3FZMA 4WFAL 3M3ZA 4FWOA 3EZWA 1TUUA 4CI6A 3CC7N 3QMLA 1YJWN 3SAHA 1DT9A 3O8MA 3UKRB 1T44A 4BC4A 5C10A 1ZXOA 3ENBA 3EKUA 3IUCA 3ZEUB 1T3VA 4ISEA 3H1VX 3Q7BA 3RSEB 3B8AX 2A41A 3A5LC 5AZJA 3AARA 1HKGA 2E8AA 3G4SN 1HKBA 3MN5A 4R79A 3MX2A 4J8FA 2Q1NA 1GLCG 3TPQA 1XC3A 2PAVA 1TYQA 3EL2A 3W3DA 3A5MC 3VGLA 3VETA 3PIOL 5ADXH 4CZEA 3MN9A 4OPHA 2P9UB 2E2PA 3FZKA 5I9EB 4BC5A 4CZMA 4PL8A 1VQ6N 4H0OA 4BRKA 4WCEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RE2 A;  1RDU A;  1T3V A;  2YX6 A;  2QTD A;  2KLA A;  2WFB A;  1EO1 A;  1O13 A;  1P90 A; 
#chains in the Genus database with same CATH topology
 3PX4 A;  2NUB A;  3R3L A;  2CH6 A;  5EVZ A;  3ZSR A;  4EHU A;  1W2B M;  3HYF A;  5FPM A;  3A5N C;  3C6T A;  3I8B A;  4DU3 A;  5KGX A;  5KGW A;  1KFD A;  2HB5 A;  1N6Q A;  1HQU A;  1I94 K;  1E4G T;  2DY4 A;  3ULE B;  4DR5 K;  2YHY A;  2E2N A;  1W7A A;  2YNG A;  1NJY A;  4BR2 A;  3AO1 A;  1U4B A;  2A42 A;  2P9L A;  3NBP A;  4IOX A;  3OJU A;  3SUP A;  4DV1 K;  1MU2 A;  5T7B A;  1ZBU A;  1VHX A;  3BZC A;  4JRQ A;  2HHV A;  1C0M A;  4FZZ A;  4FJL A;  2GEM A;  1BUP A;  4JYA K;  4DSL A;  2NZT A;  3IG1 A;  2VG6 A;  3SQ1 A;  3O9Q A;  3TAB A;  4AM6 A;  4NLB A;  1M90 O;  2GBZ A;  4DSE A;  2X74 A;  4JI6 K;  5BRH A;  1TYQ B;  3ISN C;  1OVQ A;  3KD5 E;  1K8A O;  5KPZ A;  1NGG A;  1CZB A;  2HHQ A;  3U9Z A;  2UXC K;  4B1Z A;  1RNH A;  4CEZ A;  4KRF A;  2QKB A;  3EYZ A;  5LJV A;  4XIU A;  2FSN A;  4CEF A;  3RRG A;  2QXL A;  3R1X A;  5HL7 L;  3THW A;  3THY A;  2A40 A;  3HTV A;  4WQ5 C;  3BGR A;  3O9U A;  3LDL A;  4ZTJ A;  1U6Z A;  2P9K A;  3ZLJ A;  4H0Y B;  1LWE A;  2E1Z A;  3QBW A;  1HYV A;  3E9P A;  2KFN A;  3HXM A;  1ZBH A;  4OPJ A;  3BUZ B;  3CJC A;  3K59 A;  4E7K A;  3CJ9 A;  4CK1 A;  2ZE2 A;  1S1W A;  4CF1 A;  4FJ7 A;  1NGD A;  3O9R A;  3VF6 A;  4LF8 K;  4H03 B;  3N4P A;  2QKK A;  1B9F A;  1MA9 B;  4N41 A;  2G8F A;  3C65 A;  4FW2 A;  2KW4 A;  1VQ5 N;  2UUB K;  1RBV A;  4NCA A;  3RMC A;  5AR0 A;  4LF7 K;  1VK0 A;  4FYD A;  4OLA A;  1RDD A;  4CJP A;  1TL1 A;  1EO1 A;  3VTH A;  1N33 K;  4O8K A;  1YTU A;  1K6Y A;  3KK3 A;  5HRO A;  4OPK A;  1N34 K;  3NFA A;  3D7E O;  3GG4 A;  4ISG A;  4CBX A;  2RE2 A;  3OYB A;  2YNH A;  1VQO N;  3AVK A;  2P9S A;  3DOL A;  5CR4 A;  5AQH A;  4WE1 A;  4BGB A;  3C95 A;  1QHT A;  1YIT N;  4DTP A;  4J2D A;  3DRP A;  1SKS A;  1DLO A;  5LMU K;  3HP9 A;  1DEJ A;  3VQE A;  3ZT2 A;  3M6G A;  2ZWH A;  1XHX A;  1XMO K;  4DSI A;  1S22 A;  3HPH A;  2QEX N;  1RCH A;  3DLR A;  2FC0 A;  3O3H A;  3K9J A;  4R5P A;  1GLA G;  3WXM B;  1MWK A;  2VQF K;  4DQ8 A;  3NMU A;  4BVO A;  4Q0B A;  4IOA L;  3HJF A;  2OTL N;  3O9T A;  4O4G A;  4KRE A;  1NGE A;  3EN9 A;  4MLE A;  5SWM A;  2JGU A;  4CIG A;  3MCA B;  3SK3 A;  3AVF A;  2XY7 A;  4FLZ A;  4A61 A;  4F3T A;  3OYG A;  5IT9 O;  1UA1 A;  2HMI A;  3J7Y P;  3HP6 A;  1YVN A;  1T05 A;  4KB1 A;  4FW1 A;  3P39 A;  1M1K O;  4W5Q A;  1NGJ A;  2Q0R A;  4AHR A;  2RPI A;  4CHO A;  3O6W A;  2UUC K;  1EET A;  3LZI A;  4CER A;  4KHW A;  3NVM A;  3AGK A;  5JS2 A;  2ITM A;  1IKV A;  5BRD A;  3DWL A;  2QWR A;  4Z4G A;  1BU6 O;  2GWK A;  3QEW A;  1VSD A;  4DFM A;  4U67 L;  4E89 A;  4C8L A;  4DS5 A;  2YJF A;  4HHT A;  3E1Y A;  1Q9Y A;  3UKR A;  1FXX A;  3W0L A;  3AO2 A;  4GVE A;  1JXE A;  3UB5 A;  4AHV A;  3FR0 A;  3NF9 A;  4FJK A;  4DTU A;  3SPZ A;  3DYA A;  4OLB A;  1GLJ O;  4WFN L;  3CET A;  4YOW A;  1MWM A;  3CC4 N;  4W5O A;  3SBG A;  3SJH A;  4BRC A;  4CZG A;  3AGR A;  3VMF B;  2KLA A;  3QEX A;  1EWR A;  4Y1C A;  4JKH A;  5BR8 K;  4B1Y B;  1X9S A;  1WSF A;  4DV0 K;  2NRX A;  4H0P A;  5FPE A;  1L3V A;  1O13 A;  1KRP A;  2KZZ A;  4DTR A;  2G8I A;  1IO2 A;  1JXB A;  3V9U A;  4M3Y A;  4BQZ A;  4CF8 A;  3LDP A;  4E0D A;  4DTN A;  2P51 A;  4BRN A;  3I8D A;  1ILY A;  1SV5 A;  4MO5 A;  1HUX A;  5CZ2 A;  4FWN A;  3U3G A;  1NGC A;  1HX1 A;  4FJH A;  5AQV A;  5AQM A;  1SQK A;  1HNZ K;  1Q81 O;  3VEZ A;  1EWQ A;  4BC3 A;  3MWT A;  4EZ9 A;  2W6L A;  1SAZ A;  1QZ5 A;  2AA4 A;  3G0Z A;  4YOX A;  3TI0 A;  3OYL A;  4H5T A;  1FKP A;  3T19 A;  3NDK A;  1BWF O;  4RTF D;  4DG1 A;  3VF2 A;  4AF1 A;  2O4G A;  3CM5 A;  4DMN A;  3QO9 A;  4ID1 A;  4BRP A;  3C7N A;  4YOT A;  4DKW A;  2O8E A;  3KKS A;  4PY5 A;  3L0Q A;  4CBU A;  3CCE N;  1IV0 A;  3WNE A;  4IJN A;  4IO8 A;  3D45 A;  4PKH A;  3DLL L;  3VA0 A;  2AJQ A;  3THX A;  4N5S A;  4CIE A;  1LW2 A;  3EE8 A;  4XH5 A;  2NRR A;  4JD2 A;  3L2W A;  3T69 A;  1ATN A;  3L2R A;  3TAR A;  3O4N A;  4X64 K;  4BR4 A;  1VSJ A;  1LWC A;  5M1F A;  4KBO A;  4DR4 K;  3RR7 A;  1U47 A;  5AQZ A;  5BN8 A;  2O8C B;  4LH5 A;  1MDU B;  1RBR A;  4BR0 A;  4LF4 K;  3C6U A;  2VQE K;  2GEL A;  4KKO A;  4B1W B;  3CFO A;  2W6K A;  5AQS A;  5EOY A;  3UKU A;  4K42 A;  1KXP A;  4PKG A;  2VCP A;  4O55 A;  1WAF A;  3QNN A;  3S3O A;  1U2V B;  3M8S A;  4JKC A;  3CQY A;  5M1O A;  3U3Y A;  1Z26 A;  5AQP A;  2HBK A;  3MEE A;  1QSS A;  4KFB A;  3RSE A;  4FK0 A;  2Z1J A;  1BA1 A;  1KAZ A;  3C6H A;  3K5N A;  4X62 K;  5GIP A;  3WQT A;  1NGB A;  5BR9 A;  3LP0 A;  5KTQ A;  3BF3 A;  4L3Q A;  1EQY A;  3O4Q A;  4E1N A;  1RT7 A;  1J9A A;  4CEB A;  2HBM A;  1NK0 A;  2IOC A;  2E2O A;  4CGI A;  4Z4F A;  1S9E A;  3J8A A;  4I6M B;  1ZBS A;  2PFU A;  3CYM A;  3CJ7 A;  3LAL A;  3F9M A;  5JIC A;  1O1W A;  1VRU A;  2D4W A;  5BPN A;  3MMV A;  3H46 O;  1SL1 A;  1A5X A;  2X6S A;  1Y64 A;  1WUA A;  3M8R A;  4NCG A;  3VQQ A;  2Q0U A;  3FZM A;  1T8E A;  4CI6 A;  2VG5 A;  3P83 D;  3QML A;  2OYQ A;  1DT9 A;  4NXN K;  3EKU A;  2G8H A;  1I3A A;  1Q9X A;  2A41 A;  5AZJ A;  4CF2 A;  3OYD A;  1XC3 A;  1IKX A;  3A5M C;  4EP4 A;  5ADX H;  4CZE A;  2P9U B;  3FZK A;  1JLQ A;  1VQ6 N;  1NK9 A;  4PL8 A;  4RG8 A;  4H0O A;  4WCE L;  1C0F A;  3MAQ A;  3DLE A;  5EU7 A;  3CQX A;  4V19 S;  3RRH A;  5MLC Q;  2KQ2 A;  2I5J A;  3DXM B;  1X9M A;  5JLF A;  1X3M A;  5TKW A;  1HJR A;  4IBN A;  1YAG A;  4H5V A;  4Z94 A;  4I9Q A;  1TKD A;  3TSQ A;  2D0O A;  5CZ1 A;  1VQP N;  3VF4 A;  2VYP A;  1SKR A;  4BRF A;  2HMP A;  4C8M A;  3VPZ A;  4A62 A;  2OCE A;  1NM1 A;  4BR7 A;  3NF7 A;  5GAG P;  3O9S A;  1KSP A;  4GV9 A;  2I7P A;  4UQG A;  4WQ5 A;  4YOR A;  1NMN A;  4CD1 A;  3OW2 M;  4FOE A;  4BE0 A;  2V7Y A;  3WXI A;  5C12 A;  4JKE A;  4DR1 K;  1IKY A;  5J2N A;  4AH9 A;  3NH1 A;  2OPQ A;  2WOM A;  4JN4 A;  3KLF A;  5H1S Q;  4JKA A;  4DSJ A;  4NYF A;  4JAX A;  4CZJ A;  4CGF A;  2HND A;  4IFY A;  1ATS A;  3U4L A;  3SQ0 A;  4BRA A;  1X9W A;  1TK0 A;  2QWL A;  3AVC A;  5FRM A;  4Y0W A;  4FJN A;  5CE3 A;  1W0H A;  5EX5 A;  2DPN A;  1QVF M;  2IC3 A;  4IFV A;  4WFB L;  4U7B A;  1CXQ A;  1KTQ A;  3B6O A;  4E1M A;  5EY4 A;  4DV4 K;  1RBS A;  5JMV A;  4DV3 K;  1ZBI A;  3ULD A;  1OKJ A;  4LSN A;  1TKT A;  3VOV A;  2G8K A;  4CFD A;  3VEY A;  1VQ8 N;  2D1K A;  1JKH A;  5FLX O;  2G8V A;  5F2R A;  4C8O A;  4BRI A;  3IFR A;  2YI1 A;  4CEQ A;  4E7I A;  1HPM A;  1GOB A;  3C6A A;  3TAG A;  3RVC A;  3OVN A;  1N8R O;  2P9I A;  4M7Y A;  2Y1I A;  1QQC A;  2IAJ A;  3H6E A;  2YHB A;  1GLB G;  4LD0 A;  5I42 A;  1QZ6 A;  4KH5 A;  3HT3 A;  3AVI A;  2B5J A;  5LJW A;  4NXM K;  3OYC A;  3ITH A;  4B9L A;  2XY8 A;  3DJC A;  2UXB K;  1BI4 B;  1HLU A;  4CCH A;  2ASP A;  4DV7 K;  4JKB A;  4FM0 A;  2QTD A;  2NNW A;  3ZSV A;  2BTF A;  1SUQ A;  3MK6 A;  3NHG A;  1NU0 A;  3THW B;  3T1A A;  3SV4 A;  2FBV A;  2X78 A;  3SJJ A;  4PKI A;  2JWL A;  3GL1 A;  1QS4 A;  1K8K A;  1C0U A;  3OYN A;  3CJB A;  3ZCM A;  3V9Z A;  3Q7C A;  2DFH A;  1S1X A;  1RDU A;  3U8X A;  4CJE A;  3JAM O;  4EFH A;  3CF5 L;  3RMD A;  4CZI A;  4C1N I;  1KVA A;  2KZM A;  3VES A;  2HBL A;  4FPB A;  5AQU A;  3PSI A;  2P9N B;  1U45 A;  4JHD B;  2XY6 A;  3EO3 A;  1XI1 A;  4GV3 A;  4IFE A;  3WUH A;  4M42 A;  1NWK A;  5AQG A;  4ZTF A;  4DLE A;  1S6P A;  3F73 A;  1IBL K;  3ALY A;  1JLB A;  3K2P A;  4JKG A;  4FWR A;  4CF9 A;  2F8S A;  1P8Z A;  2YCH A;  4B3O A;  2DTU A;  3L2Q A;  4IOC L;  5TKY A;  3HO1 A;  4DS4 A;  3NVK A;  4FK2 A;  5E26 A;  2F7T A;  4FWQ A;  4CIF A;  1P90 A;  1RT5 A;  3AVN A;  3FFK B;  4HUG A;  1SS6 A;  4ISF A;  2ZJQ L;  1K9M O;  4LFA K;  4BC2 A;  2E1Y A;  3OHR A;  3CQ8 A;  3KK7 A;  4DUZ K;  4F3O A;  3HRG A;  5AQF A;  4CEE A;  3AAP A;  1QSL A;  4FJM A;  3JSM A;  5JVH L;  4KHS A;  3KHY A;  1NLV A;  1N36 K;  1ZBF A;  4C23 A;  1GOA A;  1WSI A;  1WN7 A;  4CVN E;  5LMN K;  2FSK A;  4KHU A;  4RW8 A;  1BIZ A;  4K8Z A;  1YT3 A;  4WQ4 C;  4FWM A;  4CGH A;  5AQN A;  2YNF A;  4E7H A;  3SQ2 A;  1KFS A;  3QNO A;  5AQR A;  1IBK K;  3HM9 A;  1UOC A;  1QE1 A;  4QAG A;  4DFK A;  4FJJ A;  4MQ3 A;  4I7F A;  3D0P A;  4LSL A;  4JI0 K;  4FJ5 A;  4CZF A;  4FJI A;  4X65 K;  3PO4 A;  2GX9 A;  3OS2 A;  4FO0 A;  4BRD A;  1LCU A;  1R0A A;  1V4T A;  2A1S A;  1C1A A;  3AY9 A;  4F4K A;  3WXL A;  3K5L A;  3VQ4 A;  1RFQ A;  4H5W A;  2O8D B;  1TUY A;  4M3T A;  2NRT A;  4BY9 C;  2LSN A;  5J1E A;  2QM1 A;  3KK2 A;  1GLF O;  3TTF A;  4BG8 A;  4BQL A;  3VER A;  4QS7 A;  3TAQ A;  1WOQ A;  3P38 A;  4YDU C;  3VQD A;  2E20 A;  4JS5 A;  4B3S K;  4JKD A;  4CES A;  3QIP A;  2NRW A;  3ULE A;  5FPD A;  4CHP A;  4JEP A;  2O4I A;  4PHT X;  4X66 K;  3CCL N;  3J7A P;  2V51 B;  5C0Y A;  1XWL A;  3AVM A;  5AQL A;  3LDN A;  5AJ3 K;  1GLL O;  4FVU A;  1J54 A;  4Z0U A;  3OYK A;  1QQO A;  3J81 O;  4MDB A;  1HNX K;  1KVB A;  4CGD A;  5HOO A;  3G25 A;  1NKE A;  1Z6R A;  3LM9 A;  2ATQ A;  4DV6 K;  1FKO A;  4H0X B;  3ZET A;  4RW7 A;  4JI2 K;  3HOS A;  3DRR A;  3HPO A;  4BRG A;  2O8F A;  4M45 A;  1BIS A;  4CJ5 A;  3P31 A;  3O5B A;  3D2F B;  4EHT A;  1WBB A;  4YOY A;  1JCG A;  3VEX A;  4LC9 B;  1ASW A;  4KTW A;  3TAP A;  2HF3 A;  4JKF A;  3PUF A;  1RDA A;  3K58 A;  3ZSQ A;  3P1G A;  4O5B A;  3E01 A;  4N47 A;  4XH1 A;  1T03 A;  3TAF A;  4RCH A;  3QER A;  1BIU A;  1OH5 A;  1QTM A;  3ZT3 A;  1IJJ A;  4A5A A;  1HYS A;  3AA2 A;  2D0C A;  4CZK A;  1QQM A;  4E19 A;  1LAW A;  3OY9 A;  1SZ2 A;  1HPZ A;  3DLK A;  5E41 A;  2H3G X;  3EE9 A;  3V4I A;  4ELU A;  3TAE A;  2KHO A;  4W5N A;  4JLH A;  4E7J A;  2KTQ A;  3O1B A;  4PL7 A;  1VSI A;  2WUS A;  3AO3 A;  3NH0 A;  3K0S A;  1N5Y A;  5C2D A;  3SZ2 A;  5HBM A;  3DXK B;  2OA8 A;  1WLJ A;  5CYM A;  3ID8 A;  5J2M A;  1HNW K;  1VQ4 N;  3OYI A;  5KI6 A;  3MX5 A;  5DMR A;  2YX6 A;  4O0I A;  4BAC A;  3C7N B;  4K8X A;  1RT3 A;  4AHC A;  4JI7 K;  1E4F T;  3QIO A;  4M3U A;  3A2F A;  3MXJ A;  4OKK A;  3CC2 N;  1XUP O;  5KPT A;  4KI6 A;  1VSH A;  4CZL A;  5BRF A;  3KLG A;  2NRZ A;  4JD2 B;  3AA3 A;  4MLH A;  1JL1 A;  3WT0 A;  5HP1 A;  2O8B A;  1VQ9 N;  3VQC A;  1IG8 A;  2YV0 X;  3V81 A;  1XC9 A;  4H0T B;  2W41 A;  1FW6 A;  3SCX A;  3IDH A;  4DB3 A;  5ADX A;  3WEE B;  1S9G A;  3CPW M;  1NGF A;  3P5J A;  4B08 A;  4FVM A;  4M3Z A;  3HL8 A;  3KWG A;  3IMX A;  4NYN A;  2J4R A;  3C0B A;  3KD1 E;  4Z4I A;  4WFA L;  4FWO A;  1N32 K;  3QLH A;  3SAH A;  2E4L A;  3SUN A;  5I3U A;  3KLH A;  3ZEU B;  4ISE A;  3RSE B;  1RTI A;  4CHZ A;  4DFP A;  3PX6 A;  4DF8 A;  1TKZ A;  1HKB A;  3MN5 A;  3NH2 A;  2YNI A;  2Q1N A;  1GLC G;  3I0R A;  2PAV A;  3W3D A;  4KHP K;  1J53 A;  3EL2 A;  1U48 A;  4OPH A;  5I9E B;  4CZM A;  3TU5 A;  1ZBL A;  1X1P A;  3UIQ A;  3GOI A;  3I55 N;  2F4V K;  3A0I X;  4KTZ A;  4O5F A;  4W5R A;  1NJI O;  2A3Z A;  3KJV A;  3M1F A;  3FGU A;  3OYE A;  1WNS A;  3ZT0 A;  3CCR N;  4FM2 A;  4YY3 K;  4HUE A;  4FK4 A;  3N4Q A;  4J2E A;  5EXW A;  2Q36 A;  1RT6 A;  4DV5 K;  3O1W A;  3VEO A;  2HVI A;  3MEC A;  3ZSO A;  1KAX A;  5JLH A;  2JWK A;  5AQJ A;  2WFB A;  2E6M A;  3VTI A;  4CE9 A;  3MN7 A;  2F9W A;  2VGN A;  4H4M A;  2IVP A;  4FCY A;  2EX3 A;  5CYQ A;  4FLT A;  1HNV A;  1YJ9 N;  1X3N A;  5GIO A;  1TK8 A;  3LPU A;  4HCB A;  4BRO A;  2FBT A;  1C1C A;  3P4I A;  4IZ9 A;  3V1R A;  3CCM N;  4JK8 A;  1CXU A;  3LDS A;  1YIJ N;  2E5L K;  4GKJ K;  3WNF A;  1TGO A;  1H1V A;  4CK3 A;  3ZSW A;  5KRT A;  2UU9 K;  3L4Q A;  3G6E N;  4B9Q A;  4K25 A;  4IG3 A;  4AM7 A;  1BO5 O;  5KRS A;  1VQN N;  3LWL A;  2BDP A;  3H3O B;  4A2B A;  1A5V A;  3S41 A;  2QWP A;  3VQ6 A;  5FRN A;  1V4S A;  3AVJ A;  2IS3 A;  5ELZ A;  3U6F A;  2FF3 B;  3NF8 A;  4BE2 A;  4CJ4 A;  4M41 A;  4CFC A;  4JS4 A;  5HRN A;  3LDQ A;  3HM8 A;  2CGJ A;  1OVY A;  1DTQ A;  4MO4 A;  1ZYQ A;  4H5R A;  4FJ8 A;  2NRH A;  3AAQ A;  4KHN A;  1Q82 O;  5C25 A;  2IVN A;  4K43 A;  3ENH A;  4DR6 K;  4YNQ A;  3K57 A;  2W40 A;  3A8Y A;  4HWI A;  1F21 A;  3AV9 A;  3SI6 A;  4CJU A;  3QEV A;  1L3S A;  3TSP A;  3ZX3 A;  4BDY A;  3ID6 A;  3OJS A;  3LZJ A;  4CHY A;  4NB4 A;  3CFP A;  4CJW A;  2ITG A;  3G10 A;  5M1Q A;  3K5O A;  2RF2 A;  3D2E A;  3LAN A;  3TR8 A;  4RW6 A;  5A2Q O;  4ILG B;  5BN9 A;  4JI5 K;  1VQ7 N;  1D4X A;  5C15 A;  3F2K A;  1TL3 A;  3R9P A;  2KFZ A;  3OBW A;  4NCB A;  4BDP A;  4JI1 K;  3QES A;  5AZI B;  4HTU A;  4OVL A;  1BA0 A;  4DLG A;  4FJX A;  3AO4 A;  1WSJ A;  4RW4 A;  2R7Y A;  2WTU A;  1YVU A;  3L4I A;  3IAY A;  2A6A A;  4A5B A;  1KAY A;  1SL2 A;  2WON A;  1XMQ K;  2O8C A;  4CW7 B;  4EIA A;  1JL2 A;  1LW0 A;  1B9D A;  4BR9 A;  4F2S A;  5LL6 Z;  1WSG A;  4CK2 A;  3ASM A;  3G71 N;  4DU4 A;  4C8K A;  1NK5 A;  1LOT B;  3S9H A;  2GWJ A;  1S1T A;  4CFB A;  1ASV A;  4PUO A;  1FK9 A;  5F0X A;  3AVB A;  1U2V A;  1KC8 O;  3E9L A;  5BPM A;  3MED A;  4EP5 A;  3V6D A;  3DI6 A;  1DTT A;  4ID5 A;  4XH4 A;  5K14 A;  4GV6 A;  4B1U B;  3R6M A;  4J2A A;  4IDH A;  2OPP A;  2GTD A;  5C2F A;  3NE6 A;  1W9H A;  4Z4E A;  4DHY A;  2PYJ A;  1JLG A;  2BGG A;  1OH7 A;  4YOV A;  4Z4C A;  2VWJ A;  4Q5V A;  3VGK A;  3WQU A;  3SLC A;  3FZL A;  2XO7 A;  3OS1 A;  2PY5 A;  2BAN A;  4PQU A;  5KQ8 A;  5J2P A;  3L8B A;  1IBM K;  4I6M A;  4IXC A;  3GE1 A;  5GAH P;  1K8K B;  3HVR A;  1E3M A;  1YJN N;  2P9P A;  2RN2 A;  5C24 A;  3ZYY X;  2HNY A;  4CJT A;  3QBX A;  2FF6 A;  4YDU A;  2OPS A;  3J80 O;  3SUO A;  1IG9 A;  1GLD G;  1UWB A;  4KV8 A;  1ESV A;  1T6C A;  2P9L B;  4B8C A;  1QHA A;  4WF9 L;  1HMV A;  3MCP A;  4CHN A;  4FPA A;  3PX0 A;  4JKG B;  1RDW X;  1JCE A;  4DFJ A;  2Z1I A;  2YJE A;  3LWM A;  4H8K A;  4JI4 K;  3TTC A;  3BZK A;  2P9U A;  1VSM A;  3QET A;  3H1Q A;  3AVL A;  4B3M K;  5SZT A;  3KLI A;  4DQS A;  3CI5 A;  4I9L A;  1NG9 A;  2QWQ A;  3DXM A;  4H5N A;  3WNG A;  3L2U A;  4IWV A;  1JLE A;  3KK1 A;  3PV8 A;  4FLX A;  2VG7 A;  2F9T A;  5DM7 L;  1B92 A;  4F8R A;  1YF5 L;  3DLB A;  1VSK A;  1Q18 A;  3CJ1 A;  2E88 A;  3SMS A;  3LAM A;  5AQY A;  3THY B;  1A5W A;  4NLC A;  3LM2 A;  1HYZ A;  3S3M A;  5B8H A;  4WYB A;  3RWU A;  3HOT A;  4YFU A;  1RT4 A;  1J6Z A;  2QWN A;  2P9K B;  1SKW A;  3M8P A;  4BDZ A;  4CJ7 A;  1RDC A;  4DR2 K;  4O8U A;  1X9J A;  3V9W A;  3ZSX A;  4FXD A;  1YXQ A;  1LV5 A;  2PYL A;  2ZJP L;  3KZB A;  4KHY A;  3PLA A;  5JS1 A;  3NGI A;  1HRH A;  3I0S A;  4FLV A;  1VAZ A;  4ILH A;  3I33 A;  3F9K A;  2IIR A;  1HQE A;  3DRS A;  2HST A;  3TAM A;  4ICL A;  5F1X A;  2V52 B;  4KPY A;  3QB0 A;  1S1U A;  5E84 A;  4M3W A;  3CFR A;  1S6Q A;  2GUI A;  4A59 A;  3HPG A;  3VQ8 A;  4ELT A;  3CME N;  1C0G A;  3D6R A;  2B4J A;  5AQO A;  4OO1 J;  5CY4 A;  4XEI A;  3QIN A;  2P9S B;  1TK5 A;  4LF6 K;  3HK2 A;  3ZX0 A;  3V1Q A;  4IEE A;  2ZM6 K;  3THV A;  2G8U A;  2WC9 A;  4JNE A;  3VQ9 A;  1TKX A;  3CXC M;  1BDG A;  3LDO A;  2UYT A;  3PY8 A;  4QS8 A;  3ZET B;  2P1J A;  3UE5 A;  1VQL N;  1BHL A;  3HVT A;  1VSE A;  1J5O A;  5AQW A;  4BWM A;  3TSU A;  1C6V A;  4I2P A;  2O8F B;  2QWO A;  1NJW A;  3K9K A;  2NRV A;  4DU1 A;  2V7Z A;  2RKI A;  1S72 N;  4ZHR A;  2HHX A;  2D5R A;  1BI4 A;  4IO9 L;  3OA9 A;  4CED A;  4FLU A;  4BWJ A;  4BRM A;  3FZH A;  3QEP A;  2UXD K;  4H4O A;  4BGA A;  3VEW A;  1L5U A;  1VRT A;  4BG9 A;  3QDK A;  5AFU A;  4AHT A;  1Q86 O;  4DSK A;  3SBT A;  1WB9 A;  4FWS A;  5GAE P;  2P5G A;  5CHI A;  3OS0 A;  4DQQ A;  2YHA A;  1Y97 A;  1NOY A;  3EEQ A;  1BCM A;  1BOT O;  3SAG A;  4OKE A;  1UA0 A;  5M1P A;  2P9N A;  4JHD A;  3VQP A;  3EZ5 A;  3U9D A;  1R59 O;  3BP8 A;  3NAE A;  3CMA N;  2HHT A;  3BDP A;  1REV A;  3DLH A;  4KO0 A;  1NGA A;  3AA4 A;  3M3Z A;  3C94 A;  3EZW A;  3CC7 N;  3AO5 A;  4L8R B;  1NK4 A;  3UKR B;  1T44 A;  4BC4 A;  5C10 A;  1CZ9 A;  1NKB A;  3IUC A;  1L3T A;  1T3V A;  1S5J A;  2Y1J A;  3Q7B A;  2XRI A;  4KHQ A;  4LFB K;  3A5L C;  3AAR A;  3OYF A;  3NGY A;  1C0T A;  4E7L A;  1QSY A;  4R79 A;  4CHQ A;  3MX2 A;  4J8F A;  4W5T A;  3TPQ A;  1TYQ A;  3VET A;  4KAZ A;  4BRK A;  4DTM A;  1L3U A;  2PBD A;  1U49 A;  2FXU A;  4QS9 A;  3OBY A;  4CJK A;  4DTX A;  3SMP A;  3JYT A;  4DCH A;  3FLC O;  3DAW A;  5AQI A;  4CEC A;  1K73 O;  2O8B B;  3O3G A;  1HKC A;  3T3F A;  3CJA A;  4FJ9 A;  3KTQ A;  4N76 A;  2EWS A;  3IS9 A;  4IJA A;  5AQX A;  3QFU A;  2W42 A;  1EXQ A;  1YHQ N;  4CEO A;  1NK7 A;  1VSL A;  3HI0 A;  1RIL A;  4DTJ A;  3CHW A;  4CF0 A;  1NKC A;  3CER A;  3O4W A;  2HF4 A;  4GNI A;  3DM2 A;  1XNQ K;  4AHU A;  3LP2 A;  5GAD P;  3O08 A;  1ATR A;  4F9O A;  3CM6 A;  2OZS A;  4DTO A;  4GVM A;  2O8D A;  2ZD1 A;  3QIC A;  4KH6 A;  4PWD A;  4DWI A;  2XHB A;  3L6Q A;  4KH4 A;  4B9U A;  2Z1G A;  2G8W A;  1U04 A;  2HOE A;  3VEV A;  3PSF A;  1JLF A;  1BL3 A;  4FZX C;  1ZC6 A;  5HLF A;  1NNE A;  3NF6 A;  2Q31 A;  3H45 C;  2CH5 A;  2O8E B;  3FFI A;  5M1N A;  3VQ7 A;  1SL0 A;  4LFC K;  1RTJ A;  1JLA A;  4FWL A;  4CBW A;  3HZ6 A;  4DR3 K;  2OAN A;  3THX B;  4FL9 A;  4B9N A;  4C8N A;  1RT1 A;  5HRP A;  5AQT A;  4M3X A;  1UAX A;  2QA4 N;  1CLQ A;  4LY7 A;  4C1N K;  1Z25 A;  3ATV A;  4BE1 A;  3VQ5 A;  3QFP A;  3KLE A;  1DGK N;  2HHS A;  1YTA A;  4QOZ B;  1QVG M;  3PIP L;  1S3X A;  1HJO A;  3CPE A;  3V1O A;  3D2F A;  4CJR A;  1ASU A;  3UKU B;  1YUW A;  3SAF A;  3MN6 A;  4FWP A;  3SUQ A;  3VN5 A;  4IG0 A;  5AFU H;  4CJF A;  4BRL A;  1RBT A;  4DV2 K;  4YHH K;  4I2Q A;  3LP3 A;  1KQS M;  3KVG A;  3M8Q A;  2HBJ A;  4OJR A;  4MFB A;  4GW6 A;  1HR0 K;  4B9S A;  3MWP A;  4DUY K;  4M3R A;  1NOZ A;  1OH6 A;  3CD6 N;  3RMB A;  3L3V A;  3BF1 A;  1QQN A;  3WXK A;  4IEI A;  4RWT A;  3K5M A;  1GLE G;  3IKM A;  1JCF A;  3ZSY A;  2ZF5 O;  1XQS C;  3FZF A;  2UUA K;  2DFF A;  3R8E A;  1Q7Y O;  3T7Z A;  2RHK A;  5FRO A;  3E66 A;  4JI3 K;  4OX9 K;  4E3S A;  2BUP A;  5AQQ A;  3TAN A;  4HCC A;  3H3N O;  3VQB A;  2BH1 A;  4OGE A;  4FLW A;  1WSH A;  4BVP A;  4CJS A;  1D5A A;  4KI4 A;  4B9M A;  4EAH D;  2OZM A;  4AHS A;  2CGL A;  3DXK A;  1T6D A;  1NGH A;  4FSV A;  3CCU N;  2QK9 A;  2Q2R A;  3DLG A;  4LH4 A;  2F8T A;  2OPR A;  4QCL A;  2ZGY A;  1KVC A;  1NBW A;  2AP1 A;  4GKK K;  2HHU A;  2ETJ A;  3D2E B;  5IWA K;  4YOU A;  3GBT A;  2JLE A;  4CGJ A;  3M5R A;  1CZA N;  5LY3 A;  5AZJ B;  3CCQ N;  1XHZ A;  5FDL A;  3ZT1 A;  1RTD A;  2YKN A;  2I7N A;  1TAQ A;  2QI2 A;  1JLC A;  4KB0 A;  3E9O A;  3MDQ A;  4N56 A;  4HTL A;  3SNN A;  4JV5 K;  3CCJ N;  3VGM A;  2VWK A;  2FSJ A;  4JK7 A;  3WXJ A;  1TAU A;  1WSE A;  2IVO A;  4H0V B;  3V9X A;  4FJG A;  4B1V A;  3WEE A;  3SV3 A;  2PZS A;  4B3R K;  3NGZ A;  1LWF A;  1TVR A;  4DQP A;  3JXU A;  3J7Z O;  5AQK A;  4GMJ B;  4IKF A;  3EY1 A;  1YI2 N;  3FE1 A;  1GOC A;  4B9V A;  4B1X B;  3PO5 A;  4JK9 A;  4OKJ A;  1S1V A;  3ZEU A;  2IGI A;  5DM6 L;  4LF9 K;  4FM1 A;  1D9F A;  4BRQ A;  3EKS A;  1RGI A;  3RTV A;  3VQA A;  3CIP A;  4A2A A;  3L2V A;  4M63 C;  3OYH A;  2ZJR L;  5DK5 A;  2FBY A;  3SQ4 A;  2BE2 A;  1EKE A;  1Q8I A;  4K0K K;  4DQR A;  4OGC A;  3B6P A;  3RMA A;  3MXM A;  4CJQ A;  3TWH A;  3LAK A;  1JJ2 M;  3ZSZ A;  4RW9 A;  4K41 A;  1Z05 A;  2VWB A;  2Z1H A;  2CGK A;  3BY5 A;  4DSF A;  2XY5 A;  4CEA A;  1C1B A;  2ASM A;  4CGG A;  2P9P B;  3KWI A;  4HUF A;  1I39 A;  4A57 A;  5KPR A;  3KIO A;  3ENO A;  4BRH A;  4CD3 A;  2HHH K;  2YHX A;  5BRE A;  1KD1 O;  5KQD A;  3OYJ A;  1NJX A;  1RDB A;  5HRS A;  2OTJ N;  1NMD A;  4EZ6 A;  2D0P A;  3T1Y K;  1FJG K;  5GIN A;  4FOI A;  2D0A A;  4B9T A;  2HNZ A;  1IKW A;  3CG7 A;  4FLY A;  1WBD A;  3L3U A;  4JI8 K;  1RBU A;  5JVG L;  3O80 A;  2X6N A;  2KKZ A;  3KKR A;  1T7P A;  3MEG A;  3HBT A;  1OH8 A;  4B3T K;  3LP1 A;  1D9D A;  2GUP A;  5C42 A;  1WAJ A;  2E2Q A;  4FWK A;  2F96 A;  3ZX2 A;  2P9I B;  3AA5 X;  3A5O C;  4E1J A;  1G99 A;  4WQ4 A;  1BQM A;  4LF5 K;  5D3G A;  1DKG D;  3F5T A;  1EX4 A;  4Z4H A;  4ILJ A;  1HNI A;  1TV6 A;  2A5X A;  3T1H K;  2P5O A;  4F2R A;  2B6A A;  4M7X A;  1BCO A;  2VGM A;  5FPN A;  3S3N A;  4O44 A;  3OYA A;  3AVH A;  1D8Y A;  4DR7 K;  1EP4 A;  3I56 N;  1KLM A;  2NLX A;  1IH7 A;  3CCS N;  4GY2 B;  3GDQ A;  5J2Q A;  4B8A B;  1NK8 A;  1VQK N;  4G1Q A;  4BR5 A;  3MXI A;  1BG3 A;  4DTS A;  3LL3 A;  4G9Z A;  2QXF A;  4DF4 A;  5M1K A;  3OYM A;  1RTH A;  4AIL C;  1ITG A;  4CJL A;  3QEI A;  4BRE A;  1BQN A;  3JS6 A;  3ATU A;  2A1R A;  4TSX A;  4HVJ A;  1LAV A;  2HHW A;  2QWM A;  4OPA A;  3ZT4 A;  2ZGZ A;  2GV9 A;  2QW9 A;  5AZI A;  4IDK A;  3DOK A;  5BPL A;  4CJ3 A;  2E6L A;  1W97 L;  1KLN A;  2Q97 A;  3IRX A;  3HSC A;  2YHW A;  3TTD A;  4JRP A;  4AQY K;  3CCV N;  2ZQB A;  4CZH A;  2WBN A;  3O3F A;  2FLO A;  1RT2 A;  1NK6 A;  4NO7 A;  2Q3S A;  3BEX A;  4FZY A;  1KCF A;  4DQI A;  3AVG A;  3VEN A;  2EHG A;  4O0J A;  2ASO A;  4MDA A;  3AVA A;  3SYZ A;  2YKM A;  3H08 A;  3SPY A;  1VSF A;  1NGI A;  3V9S A;  3OTO K;  1VQM N;  4UY8 O;  1TUU A;  1XNR K;  1BGX T;  2FBX A;  1YJW N;  2HW3 A;  4PA1 A;  3O8M A;  3RR8 A;  1G15 A;  1ZXO A;  3ENB A;  4CFA A;  2IDO A;  3H1V X;  4Y1D A;  4J2B A;  3B8A X;  3VA3 A;  2HVH A;  4CJV A;  1HKG A;  2E8A A;  3G4S N;  3DMJ A;  5HRR A;  4KTQ A;  3HST B;  1J5E K;  1NJZ A;  3PIO L;  3NCI A;  3VGL A;  3MN9 A;  4ELV A;  2E2P A;  3WNH A;  4BC5 A;  2DFE A;  2D0B A;  3LPT A; 
#chains in the Genus database with same CATH homology
 2PBD A;  1C0F A;  2FXU A;  3R3L A;  3GOI A;  2CH6 A;  5EVZ A;  3I55 N;  4QS9 A;  3A0I X;  3OBY A;  4EHU A;  1W2B M;  3CQX A;  4O5F A;  5FPM A;  3SMP A;  3A5N C;  3I8B A;  4DCH A;  1NJI O;  3FLC O;  5MLC Q;  2A3Z A;  3DAW A;  5AQI A;  3M1F A;  3FGU A;  3DXM B;  1K73 O;  5JLF A;  1X3M A;  1HKC A;  5TKW A;  3CJA A;  4Z94 A;  1YAG A;  4H5V A;  3CCR N;  3TSQ A;  1E4G T;  2D0O A;  3ULE B;  2EWS A;  3N4Q A;  2YHY A;  4IJA A;  2Q36 A;  3QFU A;  5AQX A;  5EXW A;  1VQP N;  1YHQ N;  2E2N A;  3VF4 A;  2VYP A;  3O1W A;  3VEO A;  4BR2 A;  4BRF A;  1KAX A;  2HMP A;  3VPZ A;  4A62 A;  5JLH A;  2A42 A;  1NM1 A;  2JWK A;  2P9L A;  2WFB A;  3HI0 A;  4IOX A;  5AQJ A;  3O9S A;  3MN7 A;  3VTI A;  4BR7 A;  2I7P A;  3CHW A;  5GAG P;  2F9W A;  4GV9 A;  2VGN A;  3CER A;  4WQ5 A;  4YOR A;  4CD1 A;  2IVP A;  3OW2 M;  3O4W A;  4FOE A;  2HF4 A;  4GNI A;  2GEM A;  1BUP A;  2V7Y A;  3WXI A;  5C12 A;  4JKE A;  1YJ9 N;  1X3N A;  5GIO A;  4BRO A;  2NZT A;  5GAD P;  3O08 A;  1ATR A;  3O9Q A;  4F9O A;  3P4I A;  4IZ9 A;  4JN4 A;  3CCM N;  4AM6 A;  4NLB A;  1M90 O;  4JK8 A;  5H1S Q;  4JKA A;  3QIC A;  1YIJ N;  4JAX A;  4CZJ A;  5BRH A;  4KH6 A;  1TYQ B;  1H1V A;  1ATS A;  3U4L A;  1K8A O;  3L4Q A;  3L6Q A;  4KH4 A;  4BRA A;  5KPZ A;  3G6E N;  2QWL A;  1NGG A;  4K25 A;  4B9Q A;  4AM7 A;  1BO5 O;  2HOE A;  4Y0W A;  3U9Z A;  1VQN N;  3VEV A;  4B1Z A;  5CE3 A;  1ZC6 A;  5EX5 A;  3H3O B;  4A2B A;  2DPN A;  1QVF M;  5LJV A;  3S41 A;  2QWP A;  2Q31 A;  3H45 C;  2CH5 A;  2FSN A;  1V4S A;  2QXL A;  3R1X A;  5HL7 L;  5M1N A;  5ELZ A;  4WFB L;  4U7B A;  2A40 A;  5EY4 A;  2FF3 B;  3HTV A;  4WQ5 C;  4FWL A;  5JMV A;  4CBW A;  3HZ6 A;  3O9U A;  2OAN A;  3LDL A;  4FL9 A;  1OKJ A;  3LDQ A;  1U6Z A;  2P9K A;  3HM8 A;  3VOV A;  5AQT A;  2CGJ A;  4H0Y B;  1OVY A;  2E1Z A;  4MO4 A;  3VEY A;  2QA4 N;  3QBW A;  1VQ8 N;  3E9P A;  2D1K A;  4H5R A;  4C1N K;  2NRH A;  3AAQ A;  3ATV A;  1Q82 O;  3BUZ B;  5F2R A;  3CJC A;  3CJ9 A;  3IFR A;  4BRI A;  2YI1 A;  3QFP A;  2IVN A;  4K43 A;  1HPM A;  3C6A A;  3ENH A;  1DGK N;  3RVC A;  1N8R O;  2W40 A;  2P9I A;  3A8Y A;  1NGD A;  3O9R A;  4HWI A;  4M7Y A;  1S3X A;  3VF6 A;  3PIP L;  1QVG M;  1HJO A;  4H03 B;  3N4P A;  3CPE A;  3D2F A;  3H6E A;  3TSP A;  1MA9 B;  1GLB G;  3UKU B;  3ZX3 A;  1YUW A;  3ID6 A;  3SAF A;  3C65 A;  3MN6 A;  4FWP A;  1VQ5 N;  1QZ6 A;  4KH5 A;  5AFU H;  4BRL A;  4NB4 A;  1KQS M;  3KVG A;  5LJW A;  5M1Q A;  2HBJ A;  5AR0 A;  3D2E A;  4ILG B;  5BN9 A;  3DJC A;  1EO1 A;  3MWP A;  1HLU A;  3VTH A;  1VQ7 N;  1D4X A;  4O8K A;  2ASP A;  5C15 A;  3F2K A;  3CD6 N;  4JKB A;  3BF1 A;  2QTD A;  3R9P A;  2NNW A;  3OBW A;  1QQN A;  5AZI B;  3WXK A;  3D7E O;  3GG4 A;  2BTF A;  3MK6 A;  1GLE G;  4IEI A;  4ISG A;  2RE2 A;  3IKM A;  1JCF A;  4CBX A;  1BA0 A;  2ZF5 O;  1XQS C;  3FZF A;  1VQO N;  2P9S A;  3R8E A;  1Q7Y O;  4PKI A;  3T7Z A;  2RHK A;  5CR4 A;  2JWL A;  3GL1 A;  3E66 A;  5AQH A;  1K8K A;  4BGB A;  3L4I A;  2A6A A;  4A5B A;  1YIT N;  2BUP A;  3CJB A;  1KAY A;  3Q7C A;  5AQQ A;  3H3N O;  1RDU A;  3U8X A;  4EIA A;  2BH1 A;  4EFH A;  4BVP A;  4BR9 A;  3CF5 L;  1DEJ A;  4CZI A;  4C1N I;  4EAH D;  3M6G A;  3G71 N;  3VES A;  2HBL A;  2ZWH A;  4FPB A;  2CGL A;  1LOT B;  1T6D A;  1NGH A;  2GWJ A;  3DXK A;  4FSV A;  5AQU A;  2P9N B;  5F0X A;  3CCU N;  4JHD B;  1S22 A;  3EO3 A;  1U2V A;  2QEX N;  4GV3 A;  4IFE A;  3WUH A;  1KC8 O;  3E9L A;  1NWK A;  2Q2R A;  5BPM A;  5AQG A;  3K9J A;  1GLA G;  3WXM B;  1MWK A;  4XH4 A;  4DQ8 A;  4GV6 A;  4JKG A;  3NMU A;  4B1U B;  2ZGY A;  4FWR A;  4BVO A;  4IOA L;  1NBW A;  3R6M A;  1P8Z A;  2OTL N;  2AP1 A;  2YCH A;  3O9T A;  1NGE A;  3EN9 A;  4MLE A;  3D2E B;  4IDH A;  5C2F A;  2GTD A;  4YOU A;  4IOC L;  5TKY A;  3GBT A;  4DHY A;  3M5R A;  3MCA B;  3SK3 A;  4YOV A;  3NVK A;  5E26 A;  1CZA N;  4A61 A;  5LY3 A;  5AZJ B;  3CCQ N;  2F7T A;  4FWQ A;  3VGK A;  3WQU A;  1P90 A;  3FFK B;  3SLC A;  3FZL A;  2I7N A;  2QI2 A;  1SS6 A;  1YVN A;  4ISF A;  3P39 A;  2ZJQ L;  5KQ8 A;  4BC2 A;  1K9M O;  2E1Y A;  3E9O A;  3MDQ A;  1M1K O;  1NGJ A;  3OHR A;  4HTL A;  3KK7 A;  2Q0R A;  4I6M A;  4IXC A;  3CCJ N;  3VGM A;  3GE1 A;  3O6W A;  2FSJ A;  3HRG A;  4JK7 A;  1K8K B;  5GAH P;  3WXJ A;  5AQF A;  1YJN N;  3AAP A;  2P9P A;  3NVM A;  2IVO A;  3AGK A;  5JVH L;  4H0V B;  2ITM A;  3KHY A;  3ZYY X;  4B1V A;  1NLV A;  3WEE A;  5BRD A;  3DWL A;  2QWR A;  3QBX A;  2FF6 A;  1BU6 O;  4C23 A;  2GWK A;  4YDU A;  3JXU A;  2FSK A;  3J7Z O;  5AQK A;  4U67 L;  1YI2 N;  3FE1 A;  4WQ4 C;  4FWM A;  1GLD G;  2YJF A;  3E1Y A;  5AQN A;  4B1X B;  3UKR A;  4JK9 A;  1ESV A;  1T6C A;  3W0L A;  2P9L B;  4GVE A;  1QHA A;  5AQR A;  3ZEU A;  4WF9 L;  3MCP A;  5DM6 L;  3UB5 A;  4FPA A;  3FR0 A;  4BRQ A;  4JKG B;  3EKS A;  1RGI A;  1RDW X;  3CIP A;  4A2A A;  1JCE A;  4M63 C;  2YJE A;  2ZJR L;  1GLJ O;  4WFN L;  3CET A;  3TTC A;  4CZF A;  4YOW A;  2GX9 A;  2P9U A;  3TU5 A;  1MWM A;  4FO0 A;  4BRD A;  1LCU A;  3CC4 N;  1V4T A;  3AY9 A;  3WXL A;  3H1Q A;  1RFQ A;  3SBG A;  4H5W A;  3SJH A;  1TUY A;  4BRC A;  4CZG A;  2NRT A;  3AGR A;  3CI5 A;  3VMF B;  4BY9 C;  2KLA A;  2QM1 A;  1GLF O;  2QWQ A;  3DXM A;  3TTF A;  4H5N A;  4BG8 A;  4BQL A;  3VER A;  1JJ2 M;  4IWV A;  4QS7 A;  4K41 A;  1WOQ A;  1Z05 A;  3P38 A;  2VWB A;  2E20 A;  4JKH A;  4YDU C;  2CGK A;  4JKD A;  4B1Y B;  2NRX A;  2ASM A;  2NRW A;  4H0P A;  3ULE A;  2P9P B;  1O13 A;  2F9T A;  4JEP A;  5FPD A;  5FPE A;  4PHT X;  5DM7 L;  3KWI A;  4A57 A;  5KPR A;  3CCL N;  2V51 B;  3ENO A;  4BRH A;  4CD3 A;  5C0Y A;  2YHX A;  1YF5 L;  5BRE A;  1KD1 O;  5KQD A;  1Q18 A;  3CJ1 A;  2E88 A;  3SMS A;  5AQL A;  4BQZ A;  3LDN A;  5AQY A;  4NLC A;  3LDP A;  3LM2 A;  2OTJ N;  5B8H A;  1NMD A;  4WYB A;  2D0P A;  1GLL O;  4BRN A;  4FVU A;  3HOT A;  1ILY A;  5GIN A;  4FOI A;  4MO5 A;  1QQO A;  1J6Z A;  1HUX A;  2P9K B;  2QWN A;  4MDB A;  4FWN A;  5HOO A;  3G25 A;  1NGC A;  1HX1 A;  4CJ7 A;  5JVG L;  1Z6R A;  3O80 A;  2KKZ A;  3LM9 A;  4O8U A;  3HBT A;  5AQV A;  5AQM A;  1SQK A;  1X9J A;  1Q81 O;  3VEZ A;  4H0X B;  3ZET A;  2GUP A;  4BC3 A;  3MWT A;  3HOS A;  1YXQ A;  2E2Q A;  4FWK A;  1SAZ A;  2ZJP L;  1QZ5 A;  2AA4 A;  3KZB A;  4BRG A;  3ZX2 A;  4YOX A;  3PLA A;  2P9I B;  3A5O C;  4H5T A;  4E1J A;  1VAZ A;  3O5B A;  3P31 A;  3D2F B;  4ILH A;  3I33 A;  4EHT A;  1G99 A;  2IIR A;  4YOY A;  2HST A;  1JCG A;  1BWF O;  4LC9 B;  4RTF D;  4WQ4 A;  3VEX A;  3VF2 A;  4AF1 A;  2HF3 A;  4JKF A;  4BRP A;  3C7N A;  5F1X A;  2V52 B;  4YOT A;  3QB0 A;  4DKW A;  1DKG D;  3F5T A;  5E84 A;  3L0Q A;  4ILJ A;  4CBU A;  3CCE N;  4IJN A;  4IO8 A;  4PKH A;  4A59 A;  2A5X A;  4XH1 A;  3DLL L;  4RCH A;  4M7X A;  2VGM A;  3CME N;  5FPN A;  1C0G A;  3D6R A;  3EE8 A;  4XH5 A;  2NRR A;  4JD2 A;  5AQO A;  3T69 A;  4OO1 J;  1ATN A;  3I56 N;  1IJJ A;  4A5A A;  4XEI A;  2NLX A;  2P9S B;  4BR4 A;  4CZK A;  3CCS N;  1QQM A;  4GY2 B;  3GDQ A;  5M1F A;  1VQK N;  1SZ2 A;  4KBO A;  3ZX0 A;  4IEE A;  2H3G X;  3EE9 A;  4BR5 A;  2WC9 A;  4JNE A;  2KHO A;  5AQZ A;  5BN8 A;  1MDU B;  4BR0 A;  3CXC M;  1BDG A;  1BG3 A;  3O1B A;  2GEL A;  3LDO A;  4PL7 A;  4B1W B;  2WUS A;  2UYT A;  3LL3 A;  4QS8 A;  5AQS A;  5EOY A;  3UKU A;  3ZET B;  4G9Z A;  3UE5 A;  1VQL N;  5C2D A;  5M1K A;  4K42 A;  1KXP A;  4PKG A;  5AQW A;  2VCP A;  3DXK B;  3TSU A;  1U2V B;  2QWO A;  4BRE A;  4JKC A;  3CQY A;  2NRV A;  3K9K A;  5M1O A;  2V7Z A;  3ATU A;  3ID8 A;  2HBK A;  3JS6 A;  5AQP A;  1S72 N;  1VQ4 N;  2QWM A;  3RSE A;  4IO9 L;  3OA9 A;  4OPA A;  3MX5 A;  2YX6 A;  2ZGZ A;  2QW9 A;  4BRM A;  3C7N B;  4RWT A;  5AZI A;  1BA1 A;  1KAZ A;  3FZH A;  3C6H A;  1E4F T;  4BGA A;  5GIP A;  3WQT A;  1NGB A;  3VEW A;  5BR9 A;  4BG9 A;  5BPL A;  3QDK A;  5AFU A;  3CC2 N;  3BF3 A;  4L3Q A;  1W97 L;  1XUP O;  1EQY A;  5KPT A;  1Q86 O;  2Q97 A;  4CZL A;  5BRF A;  3HSC A;  2YHW A;  3SBT A;  3TTD A;  2NRZ A;  4JD2 B;  3CCV N;  4FWS A;  4CZH A;  2HBM A;  5GAE P;  2WBN A;  5CHI A;  4MLH A;  3WT0 A;  2E2O A;  2FLO A;  1VQ9 N;  3J8A A;  4I6M B;  4NO7 A;  3BEX A;  1IG8 A;  1ZBS A;  3VEN A;  4H0T B;  2PFU A;  1BOT O;  3CJ7 A;  2W41 A;  3SAG A;  3IDH A;  3F9M A;  5M1P A;  2ASO A;  4DB3 A;  2P9N A;  5JIC A;  5BPN A;  2D4W A;  4JHD A;  5ADX A;  3WEE B;  4MDA A;  3U9D A;  1R59 O;  3MMV A;  3BP8 A;  3CPW M;  3CMA N;  1NGF A;  3H46 O;  3KWG A;  3IMX A;  1Y64 A;  1NGI A;  2J4R A;  1WUA A;  3C0B A;  1VQM N;  4UY8 O;  2Q0U A;  1NGA A;  3FZM A;  4WFA L;  3M3Z A;  4FWO A;  3EZW A;  1TUU A;  4CI6 A;  3CC7 N;  3QML A;  1YJW N;  3SAH A;  1DT9 A;  3O8M A;  3UKR B;  1T44 A;  4BC4 A;  5C10 A;  1ZXO A;  3ENB A;  3EKU A;  3IUC A;  3ZEU B;  1T3V A;  4ISE A;  3H1V X;  3Q7B A;  3RSE B;  3B8A X;  2A41 A;  3A5L C;  5AZJ A;  3AAR A;  1HKG A;  2E8A A;  3G4S N;  1HKB A;  3MN5 A;  4R79 A;  3MX2 A;  4J8F A;  2Q1N A;  1GLC G;  3TPQ A;  1XC3 A;  2PAV A;  1TYQ A;  3EL2 A;  3W3D A;  3A5M C;  3VGL A;  3VET A;  3PIO L;  5ADX H;  4CZE A;  3MN9 A;  4OPH A;  2P9U B;  2E2P A;  3FZK A;  5I9E B;  4BC5 A;  4CZM A;  4PL8 A;  1VQ6 N;  4H0O A;  4BRK A;  4WCE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...