2KLAA

Nmr structure of a putative dinitrogenase (mj0327) from methanococcus jannaschii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
GHMINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein MJ0327
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanococcus jannaschii
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2klaA00
2YX6A 1O13A 2QTDA 1EO1A 2RE2A 2WFBA 1T3VA 1P90A 2KLAA 1RDUA
chains in the Genus database with same CATH superfamily
1JCEA 3LZJA 5KPRA 1ASWA 3DOKA 3HL8A 4XH4A 3HM9A 1NJXA 1ZBHA 1HUXA 4C8KA 3A8YA 1E4GT 2HNYA 5AQKA 3OS0A 4KTZA 4JI1K 1IH7A 3QEWA 4KB1A 1RNHA 1J54A 1DGKN 3AVJA 3KLFA 3N4PA 4B8AB 4ILJA 3AVAA 4NXMK 4BG9A 4HHTA 1K8KA 4U67L 4JI2K 2HHUA 4BC2A 3GE1A 1SL1A 4BRCA 2G8UA 3C95A 1EKEA 5M1PA 4DQSA 1X9JA 4DMNA 2UYTA 1FKOA 3DXMB 4N41A 1VQ6N 1TKTA 3KK2A 4HUGA 1WSFA 1KD1O 4FVUA 3SPYA 4DR5K 1WAFA 1NGIA 1HQUA 5C24A 3K0SA 4BDZA 3VEVA 4QS8A 3KWGA 3C6HA 1TKZA 3L3VA 3TAMA 4BROA 1UAXA 4DV6K 3ZCMA 1P90A 3NE6A 2G8WA 3OYGA 3RMDA 4B9MA 4DR4K 1VK0A 4FLUA 3K58A 4DU4A 4DSKA 3M3ZA 4OJRA 1S6QA 4BY9C 4CHZA 1LAVA 2VG5A 1YAGA 4H4OA 5AZIB 3KKRA 1EX4A 4DSIA 3C94A 2G8FA 4JKGB 3AO3A 4FLWA 4DKWA 2YHXA 4KHPK 3K2PA 3VTIA 2IVNA 5IT9O 3V9SA 5EXWA 4G1QA 4Y1DA 1HMVA 3OYEA 4BACA 5J2PA 2EX3A 4CFBA 4NXNK 3I0SA 2O8FB 5KRSA 2FBTA 2PZSA 3HBTA 1N8RO 3CJCA 1U04A 5LMUK 4EIAA 3IKMA 1BA0A 4FWOA 3CJ9A 1L3UA 4PKHA 5AQRA 1NWKA 5EOYA 1I39A 4YFUA 3NVMA 4YOTA 3OYCA 5BR8K 1J9AA 4X64K 4IWVA 3EKUA 2Q97A 3QICA 1FKPA 4MDAA 2IC3A 3MWTA 2IIRA 1V4TA 4AM7A 1GOBA 2IVPA 2NLXA 4CEZA 3AVKA 3CQYA 5AZJB 4NLCA 1IJJA 5GAGP 2P9IB 3AVLA 4CEDA 3CMEN 3IFRA 3LPUA 1RTDA 3AGRA 3P39A 5J1EA 5AQOA 1XI1A 4CJ3A 1K9MO 3FR0A 3ZSWA 2HBJA 2ZGZA 1S9GA 2V7YA 3OYAA 3QIPA 2I5JA 1S72N 4DQIA 1IKVA 4H5VA 4E7KA 3F9KA 1X9MA 3NDKA 4O0IA 2E6MA 3DAWA 3K5OA 5J2MA 3WNFA 2ZJPL 4LF8K 2QA4N 2O8DB 4Q5VA 2HF4A 4FZYA 4FJ7A 2Q36A 1NBWA 3VTHA 4KHNA 1M90O 1U45A 1K8KB 3LWLA 4DFJA 1TK5A 1RDBA 2HHHK 3O9UA 3JYTA 1C0GA 1DEJA 1YTUA 3KLIA 2ZGYA 4DTRA 1XWLA 3SMSA 5KGXA 5HLFA 3O3FA 4MLHA 4YOYA 2D0AA 5FLXO 4PL8A 3WXKA 4JI3K 5DK5A 5FRMA 3J7ZO 1S9EA 3TR8A 2NRWA 4JEPA 4A2BA 4B9TA 4KH5A 1VQKN 3RRGA 2Q2RA 4LY7A 1ILYA 3S3MA 4YNQA 4IKFA 3KLEA 2P9LB 2Q1NA 3MX5A 4L8RB 3PX0A 3PO4A 4ISGA 3NBPA 2HBLA 3MXJA 1JXEA 4RW7A 5DM7L 3M8RA 2I7NA 1SAZA 4BC4A 4BRKA 4B9LA 3GOIA 2E2NA 3MCAB 3O3GA 1VSFA 4YOVA 3NHGA 2NUBA 2YJFA 3THXB 1NGCA 3HJFA 1VSMA 1BG3A 4LH4A 3KK3A 3KK1A 1XUPO 5LJVA 4LF5K 3O8MA 1EO1A 1NM1A 2QWNA 4FJJA 4MDBA 4ELUA 2RKIA 1T8EA 4KKOA 4B1WB 4M45A 5KGWA 4AHUA 2GTDA 2VCPA 1BGXT 4KBOA 1ATRA 3NVKA 1YJWN 4FOIA 1JLQA 3SQ2A 4PWDA 3G25A 1BOTO 2YNHA 4BRMA 3EY1A 3CF5L 4NCAA 1U2VA 4CGFA 3R6MA 2ITGA 2EWSA 4RCHA 1T03A 4CEAA 2Z1IA 4ISFA 3DWLA 2IOCA 2HSTA 5AQTA 3R1XA 1XC9A 3CQ8A 3AVHA 4WQ4A 1JLEA 1NK7A 5LL6Z 4CFCA 4HCBA 3H08A 1NK4A 4WFAL 3PSFA 5CHIA 1JLFA 3NH0A 2VG7A 4LH5A 3HT3A 3DLKA 1RDCA 4IOCL 2RHKA 1WB9A 3O1BA 3HPGA 4WYBA 4GMJB 2XO7A 1C0MA 2A1RA 3JXUA 1L3SA 3U8XA 2ASOA 3VF6A 4JHDA 3BDPA 3KD1E 3SQ0A 1TL3A 1GLLO 2FSKA 3C7NB 1HRHA 2P9NB 3O5BA 3OYLA 4DTJA 3KKSA 3O9TA 2V51B 1SQKA 4CFAA 5C2FA 3VGMA 4CERA 3MEDA 2DFHA 3MCPA 4A2AA 3SMPA 2BGGA 3VQ5A 4KAZA 4BR9A 2YV0X 4EP4A 3KJVA 3V81A 3AVGA 4Z4FA 2FF6A 3AAPA 1HNWK 3DLEA 3C6TA 1QHAA 4RTFD 5BR9A 3MDQA 3OY9A 1BA1A 1Z6RA 3VQ9A 2HHWA 4DR1K 4CF1A 4FWSA 4YDUA 3VQ7A 3VA3A 2NZTA 4CGIA 2P5GA 5DMRA 5F2RA 2A6AA 1XHXA 3MX2A 1N6QA 2XRIA 3VEOA 2BDPA 1ZBIA 1YVNA 2DPNA 2KFNA 4IEEA 3TSQA 1KSPA 4KB0A 2YCHA 1TAQA 3S3NA 1SS6A 4K25A 1HPZA 3HYFA 4OPAA 5BPNA 3T19A 2HBKA 3LP2A 1QZ5A 1ZBSA 1ZBUA 1O13A 3LDQA 3QLHA 1OH6A 3RR7A 3P38A 5M1KA 1BHLA 1K73O 3QEXA 1J5EK 5C2DA 4FZXC 2YI1A 3FGUA 3PUFA 2V52B 5AQGA 4O8KA 4BR7A 3PX4A 4A5AA 4CZFA 4H5NA 5F0XA 3C0BA 1WSGA 2WTUA 3AY9A 3D0PA 1FJGK 2F9TA 3J7YP 3WNEA 4CF0A 1VRUA 3SJHA 1ZYQA 3MN9A 4GV6A 2YNFA 5C0YA 3PSIA 4J2BA 5LMNK 3CETA 3AO5A 2AP1A 5D3GA 3CCUN 3QO9A 1QZ6A 1WSIA 3VQCA 2F7TA 3L0QA 4DV4K 3LL3A 5JS2A 3AA3A 4DV5K 3QETA 1J53A 4IXCA 1QHTA 3DRPA 4H0OA 2O4GA 2O4IA 4MQ3A 3RR8A 4M7YA 3AVCA 2WBNA 1ASVA 3LAMA 1I3AA 2VGMA 2P5OA 4CBUA 1NOZA 5AQLA 5EVZA 1RDDA 3OS2A 3LZIA 4DQQA 4B1UB 3H45C 3ENBA 4W5OA 4DV0K 4EHUA 1NKCA 4OGCA 2HBMA 1C0FA 4ZHRA 4DR3K 3WQTA 3O4NA 2HVIA 2HB5A 3U9ZA 1UA0A 3DOLA 3DLHA 1WN7A 4JKGA 2VWKA 3D7EO 3HZ6A 5JLHA 1N5YA 3CCLN 1O1WA 4FLYA 1HNIA 3EE8A 4FJHA 4LSLA 4BVOA 2HNZA 1YUWA 3ULDA 1BISA 3SPZA 4B3TK 1NK8A 3IS9A 1Q9YA 4DB3A 4DTPA 3KHYA 4KI4A 4FJ5A 3WEEB 4JHDB 3TTDA 4CCHA 3TABA 2V7ZA 5EY4A 5I9EB 3ZSRA 4AH9A 2ITMA 4FOEA 1VQLN 4BR5A 2OZMA 4IJAA 2VWBA 3PV8A 3NMUA 3SUQA 3AARA 4GNIA 3IMXA 4A5BA 3HSCA 1NGEA 3QINA 4DQ8A 4NB4A 3P1GA 4CGJA 4A62A 2G8KA 4CK1A 4A59A 1JCFA 5FPDA 4GY2B 1NNEA 3BZKA 3O3HA 3LM2A 2QXFA 3OYFA 3Q7CA 1BDGA 3CXCM 3VQ8A 3VERA 5AZJA 4CE9A 3RTVA 3BP8A 4JKAA 4FJXA 2NRHA 1T6DA 2P9IA 1HX1A 3VQDA 3WQUA 1HYZA 4KPYA 5AJ3K 3SAGA 4PL7A 4B1ZA 4OO1J 3IG1A 3OHRA 2WFBA 4R79A 5KPTA 1IKWA 3MXIA 5FPEA 4J8FA 1V4SA 4DR7K 3GBTA 4DS5A 4K8XA 4HTUA 4BGBA 4FJKA 4ILGB 1ASUA 4JN4A 5TKYA 3L2RA 5HRSA 3DRSA 3AVMA 3HOTA 4XEIA 1VRTA 4K43A 3SLCA 4UQGA 1ITGA 5T7BA 4L3QA 4EP5A 2O8DA 3WXMB 2HHVA 4BE2A 5BRDA 2ATQA 4KREA 1TKDA 4JKFA 1S6PA 1X9WA 1C0TA 5FPNA 4BC3A 1LWFA 3MN7A 3E01A 5C10A 4DSFA 2KZMA 1Z05A 1Q86O 4QAGA 3VOVA 5KRTA 2Q31A 2BANA 4ID1A 2JLEA 3QESA 4LF9K 3MEEA 5GAHP 2CGKA 3K5MA 1G15A 3AVNA 3PLAA 1RFQA 4CJWA 4BRLA 3VESA 4DSJA 2JWKA 2GWKA 5KI6A 2P9LA 1TUYA 1YXQA 1EP4A 3I0RA 4E1JA 3VQBA 4AF1A 4CEEA 5AFUH 2GWJA 4BR2A 2QXLA 1P8ZA 1TVRA 4BRGA 3L2QA 1F21A 3THXA 1U47A 4NCBA 3H3NO 4CJRA 4K0KK 4E7HA 4FLTA 3QBXA 3ZT3A 2BTFA 1NK9A 4NCGA 4ILHA 3A5NC 3HVRA 3S3OA 1RT6A 1UOCA 5I3UA 3E9LA 1KTQA 4CGDA 2O8BA 2F96A 3NF9A 4WQ5C 3MN6A 3HOSA 4H5WA 3TTCA 4DQRA 3CM5A 5GINA 4AQYK 3AVFA 2OZSA 1L5UA 3ZLJA 3A0IX 3D2FA 5AQPA 4HVJA 2G8HA 4CBXA 2P9KA 1RGIA 3VQ4A 3KTQA 3V9XA 4X65K 3K9JA 4KHQA 4CF8A 1BCMA 2R7YA 2DFEA 3H6EA 2Q0RA 1G99A 3MN5A 2D5RA 1N33K 1SKSA 4J2AA 3VMFB 4DV1K 4JS5A 3AV9A 3CC7N 4AHRA 4FLVA 4FXDA 4CIGA 4EZ6A 3QFPA 3IRXA 1TL1A 5AQYA 1DLOA 4ZTJA 4E0DA 1J6ZA 4N76A 3VPZA 1R59O 2OANA 2QKBA 4FYDA 3SZ2A 2ZE2A 2KHOA 4ID5A 1I94K 1S22A 4CF9A 3QB0A 4PKIA 2OTLN 1QTMA 3TTFA 4F2SA 4E1NA 1TKXA 3K5NA 4DWIA 1XMQK 1U6ZA 3ZT2A 2WC9A 4GV3A 5M1OA 3O4QA 5IWAK 3TAFA 3IUCA 3N4QA 1Z25A 4NYNA 1C1BA 2NNWA 4E7LA 1BO5O 3AVBA 2QEXN 4HUFA 3C7NA 2P9NA 3SBGA 4BRFA 4WFBL 2UUCK 1UWBA 4Z4IA 3NAEA 1HPMA 3I33A 5GIOA 3TSPA 4LFBK 1NGGA 4MO5A 5GIPA 4CF2A 5C15A 2P1JA 4BR4A 3L8BA 2NRZA 3ATUA 3BGRA 3UB5A 1BI4B 4CJ7A 3OYHA 1NKBA 3CERA 3UKUB 3O9RA 3WXLA 2P51A 2QWMA 2D0PA 4FWNA 2P9SA 2KLAA 3RWUA 3HO1A 4DV3K 3CFOA 2OPPA 4GKKK 3AO2A 4H5RA 4CHYA 4QS7A 2O8EB 2Q0UA 1LV5A 1S1XA 1BQMA 1NGDA 4DFMA 2A40A 1FXXA 2GUPA 2ZJRL 1NGBA 5AQJA 4FK2A 1MA9B 4IOAL 4X66K 3ID8A 2KQ2A 4CJ4A 1TUUA 4BQLA 1Z26A 2E6LA 1KRPA 1HNXK 3FZMA 1U48A 2BE2A 5AQXA 4J2EA 2E5LK 3IAYA 5AQSA 2W40A 4B9NA 3U6FA 4HTLA 3ASMA 1Q9XA 4JKHA 4ELTA 3VEYA 3H46O 1JL1A 1ZBFA 3D6RA 3R3LA 4LF6K 1W7AA 1FW6A 1MWMA 3VETA 1HQEA 4CJ5A 3L3UA 1X1PA 3TAQA 3EEQA 1D9DA 4IDHA 3ZSOA 2RN2A 2HVHA 4YHHK 3K9KA 2AA4A 4FO0A 1QE1A 4E19A 1RBVA 4CHOA 2CH5A 3BY5A 1HNZK 3OYNA 1JXBA 2O8BB 3GG4A 5AQVA 5M1FA 4XIUA 4AM6A 3HPHA 4E89A 3T69A 3SCXA 1OH8A 3VF2A 1VAZA 1U4BA 3F5TA 2PFUA 3R8EA 5BPMA 4ZTFA 3D2FB 3LPTA 1NMDA 1VQ4N 1SZ2A 4DSLA 3THYB 3ZT4A 2D4WA 3NF6A 1IG9A 1NMNA 2W6LA 4I9QA 2P9KB 4CEFA 1XNQK 5AQNA 4FW2A 4LSNA 2YNGA 2YHBA 4OX9K 4FJNA 5LJWA 4B3OA 4IG3A 3MWPA 1TYQB 3MXMA 1VQ7N 3ITHA 5HBMA 3VEWA 4PUOA 3G10A 4FJ8A 2D0CA 4LC9B 1VQPN 4FJMA 4CJEA 3OYBA 4BREA 3GL1A 4DFPA 1NK5A 4JS4A 4O5FA 3L2WA 1Q18A 4O4GA 4JK7A 4WCEL 5J2QA 3KVGA 1EWRA 3CQXA 3WNGA 4CGGA 5CR4A 1N36K 2JWLA 2Y1JA 4FWMA 2CGLA 3A2FA 4FPAA 3HTVA 4AHSA 2FXUA 1WUAA 2ASMA 3SAFA 1H1VA 1BQNA 3M8QA 2KKZA 4CFDA 2HHQA 4CW7B 3ENHA 3V4IA 4R5PA 4BE0A 3CC2N 1OVQA 4M3XA 3WEEA 1GLCG 4C8LA 3HP9A 4DS4A 1RT3A 3O1WA 5LY3A 2A42A 3AO4A 1WNSA 3M8SA 2VGNA 3SYZA 2J4RA 4KI6A 1DTQA 3SBTA 3EE9A 4V19S 3FLCO 3M5RA 2RF2A 3AA2A 3G0ZA 4X62K 4DG1A 3U3YA 1NJZA 3DLBA 3CIPA 1CZBA 4E7IA 1NGAA 3BF1A 2P9SB 2GEMA 4BVPA 3SUPA 5JMVA 1K8AO 1ZXOA 4CZMA 1XMOK 3NF7A 4B3RK 4CGHA 1E4FT 3CCSN 1HJRA 1GOAA 2ZQBA 1OH5A 5JVHL 1GLDG 4CD3A 1REVA 3QEVA 4Y0WA 4CHPA 5BRFA 2OPQA 4BRAA 4EFHA 2FC0A 1KCFA 2HHTA 4JRPA 4WQ4C 1GLAG 2FSJA 3AAQA 3OA9A 3VENA 1QQOA 2E20A 1WAJA 4DR6K 2QWPA 4OKKA 1KVCA 4MFBA 3VF4A 1D9FA 4CZKA 5CY4A 1GLBG 2NRXA 1LAWA 1FK9A 4OPJA 2F8TA 3UKRA 4FJIA 3QEPA 1RBSA 1NK6A 3FZHA 1C0UA 1LOTB 3P4IA 3BUZB 5ADXH 3TAGA 5ADXA 5HRRA 2A1SA 1JLAA 2HOEA 4CHNA 5E84A 3S41A 4CZIA 4CZEA 3V6DA 3W3DA 2WUSA 4DV2K 2P9PA 4LD0A 1LCUA 3V1OA 3L2UA 3L4QA 2QM1A 4FM0A 3C6UA 2IS3A 2X78A 1U49A 2BUPA 1JKHA 4JI0K 3P83D 4YDUC 1HKCA 3THVA 3CPEA 3H1VX 3VQAA 4F3OA 2D0BA 4EHTA 4KTQA 3ZT0A 1ATSA 1HKBA 3KZBA 1HLUA 4AHTA 3HPOA 1HR0K 5SWMA 2YJEA 4NYFA 4F8RA 3T1YK 1HYSA 3CJBA 5BREA 1ATNA 3FE1A 3UIQA 1EQYA 4I7FA 4IFYA 5SZTA 3ALYA 3SJJA 3TPQA 4HWIA 3EO3A 4DLEA 5KQ8A 2UXDK 2NRVA 3E9OA 3SNNA 2X6NA 4FL9A 3NFAA 2ZF5O 4JKDA 2YX6A 1YTAA 3EN9A 4NLBA 4Z4GA 4C1NI 4Z4CA 2XHBA 1LWCA 1W0HA 4JI6K 3PX6A 2KTQA 1A5WA 4KRFA 2HHSA 4DUZK 3QDKA 4FJLA 3CCEN 5JS1A 2GUIA 3C65A 4FCYA 4JI7K 1ZC6A 2YKMA 5MLCQ 4DHYA 3S9HA 3QMLA 2B5JA 3CCMN 2HMIA 4Z0UA 2Z1HA 1TAUA 2KZZA 3Q7BA 2ETJA 4I2PA 4F2RA 2GBZA 4I2QA 2RPIA 4FWPA 3KIOA 4FZZA 3KLGA 3DLGA 3DJCA 1WSEA 4UY8O 5BRHA 3LDOA 4OKJA 4O44A 4BRDA 1BIZA 1KAXA 3O6WA 1LWEA 4KHSA 2Q3SA 4CK3A 1QQMA 1X9SA 3ZYYX 4BRIA 1EETA 3DXKB 5KPZA 2QI2A 1YI2N 1KFDA 1X3MA 4CK2A 2LSNA 3VQEA 3DMJA 1KLNA 4FWKA 4W5NA 5DM6L 4YY3K 3E1YA 4IBNA 3L4IA 4CVNE 2CH6A 5AQQA 4M3RA 3ZETA 2HHXA 3ULEA 3VEZA 2DFFA 4K42A 3EZWA 4RW9A 1NKEA 3VN5A 4LF7K 4IJNA 3K57A 4FJ9A 2IAJA 3ZX2A 4BDYA 4FJGA 4H0YB 4KHWA 1HNVA 4DTMA 3CD6N 4FSVA 3SI6A 1YVUA 1KC8O 4DTNA 1Q8IA 4Y1CA 4PA1A 5JICA 1YITN 1L3VA 2O8CA 3L6QA 2OPSA 1OH7A 3ZT1A 3ZSVA 1JLBA 1VQ8N 3UKRB 3B8AX 4OVLA 4LFCK 3B6PA 1WBBA 1BI4A 4K8ZA 4EZ9A 3UKUA 4O5BA 1VSIA 3WT0A 1CZ9A 5AQZA 1Q82O 2O8EA 3OYMA 3HM8A 4B8CA 5EU7A 3TARA 1RBTA 2PBDA 1YT3A 1CXQA 3NGIA 2HMPA 3JS6A 2P9PB 4JK8A 1NJYA 4IEIA 5AQMA 1CLQA 4KHUA 5AQUA 4JKCA 4ELVA 3ISNC 3THWA 1NK0A 1YF5L 4B08A 4BR0A 4IO8A 4DQPA 3BF3A 2QKKA 3O4WA 4CJSA 4KV8A 1JCGA 2KW4A 4I6MA 4EAHD 4CJKA 3DLLL 3RRHA 1QSYA 3JAMO 3HK2A 3EL2A 4E7JA 3U9DA 1VQ9N 1SV5A 3AGKA 4JI4K 1D8YA 1IV0A 5AFUA 4YOXA 1SL2A 2W41A 1S5JA 5E26A 4QOZB 4DF8A 4LFAK 3QFUA 1KXPA 4M3ZA 4M7XA 1KAYA 2YNIA 4BE1A 4AILC 3P5JA 1X3NA 4JNEA 3SAHA 2WONA 2JGUA 2OPRA 4FWQA 1JLCA 1LW0A 3KK7A 4KO0A 1WSHA 1RTIA 4JD2B 4QS9A 2PY5A 5FROA 4Q0BA 3ENOA 4CIFA 2W6KA 1HYVA 3HI0A 3OW2M 2VYPA 1CZAN 3CG7A 3QIOA 3MECA 2YHYA 5AR0A 3THYA 3LAKA 4DTUA 2P9UB 4JRQA 4PY5A 1CXUA 3O9QA 1WLJA 3O9SA 1KFSA 1NU0A 2H3GX 1TYQA 2UUAK 3T7ZA 5KQDA 5JVGL 3I56N 1BWFO 2FSNA 4GVEA 3VEXA 3L2VA 4M41A 4JKEA 5J2NA 1W9HA 2FF3B 2PYLA 2AJQA 4M63C 1UA1A 1M1KO 3NH2A 4OGEA 3EZ5A 4IZ9A 3CCJN 3F73A 3LDNA 4DF4A 3B6OA 4Z4HA 3TI0A 1RT7A 4KHYA 4JI8K 1BIUA 3PO5A 1N32K 1JJ2M 1T7PA 3GDQA 4BGAA 2Z1GA 2ASPA 4H5TA 1KVAA 2HF3A 3G6EN 2XY6A 1RBRA 1LW2A 5I42A 3ZETB 3ULEB 1RTJA 3OBYA 5CE3A 1VHXA 4RW4A 3ZEUB 4J2DA 1HKGA 3MK6A 1S1UA 2D0OA 4OPHA 2WOMA 2OCEA 5M1QA 3U3GA 2A5XA 5AQIA 4DR2K 3FZLA 4I9LA 4M3TA 1BL3A 1Y97A 5HRPA 3TANA 3ZX3A 2UUBK 1DT9A 4FW1A 5TKWA 4O8UA 2O8CB 3OYJA 3RSEA 2F4VK 1JL2A 3WUHA 1RT4A 3PIPL 2ZJQL 4DUYK 1SUQA 4G9ZA 4JK9A 3R9PA 4CJTA 4GVMA 1NGFA 3J8AA 1S1WA 1XHZA 1QS4A 1VQMN 3CYMA 3SV4A 1Q81O 3K5LA 3KD5E 3LANA 2DTUA 1K6YA 1NLVA 2FBXA 3NGZA 3ATVA 2XY5A 1VSLA 1DTTA 3ZSYA 2G8VA 1TV6A 3M1FA 1RT1A 4B1XB 3QNNA 4DLGA 1IBKK 3CFRA 3EKSA 5KTQA 5H1SQ 1VSHA 3VQPA 2NRTA 1E3MA 5BN9A 3VA0A 3THWB 4DCHA 2B4JA 2BH1A 3QEIA 1TK0A 3LWMA 4OLAA 1RCHA 4I6MB 3H3OB 4C1NK 4CJVA 2ZM6K 4YOUA 3FFKB 5CYMA 3OTOK 2HNDA 4AHVA 1QSLA 1S3XA 1YHQN 5FPMA 1C1AA 5CZ2A 3CC4N 1TK8A 4A57A 3RMBA 3D2EA 2FLOA 4KTWA 4FLZA 4PQUA 3CI5A 2UXBK 4DV7K 4FK0A 3T1AA 1RTHA 4O55A 1RT2A 3EYZA 1RT5A 5FDLA 1YIJN 3SQ1A 4FVMA 2E88A 3CMAN 4M42A 3H1QA 4GW6A 1HJOA 1GLJO 4PHTX 1VQON 3TAEA 4PKGA 3V9ZA 1Q7YO 1C6VA 3MEGA 3WNHA 4JKBA 1MU2A 5AQWA 4XH1A 1SKRA 1SKWA 4FM2A 3AA4A 5BN8A 1VSJA 2IGIA 3NGYA 1RILA 4BRQA 3PY8A 2E4LA 2XY7A 4CI6A 3E9PA 3SK3A 2OYQA 4E1MA 4FM1A 1RDWX 1IBMK 3QBWA 3OYKA 4FLXA 3HXMA 4Z4EA 3RMAA 4CHQA 4N5SA 3AA5X 3CPWM 2ZD1A 3ID6A 4CZLA 1NG9A 5E41A 1NJIO 2UU9K 2IDOA 4H0XB 1BUPA 4XH5A 3LDSA 4GKJK 1KLMA 4KH6A 1R0AA 4FWRA 4IFVA 4W5TA 5B8HA 2E2OA 3OYDA 1NOYA 5AQFA 2QWLA 3MAQA 3BEXA 4CZHA 4FPBA 4A61A 1D5AA 4B9QA 2IVOA 3NF8A 4WF9L 3KWIA 3U4LA 4RG8A 1A5XA 2X6SA 3OS1A 2KFZA 4B9SA 2PAVA 3V1QA 4MO4A 1T3VA 1OVYA 1C1CA 2FBYA 1IO2A 3C6AA 1IKYA 1QQCA 2E8AA 3CJ1A 3TAPA 2QWOA 2E2QA 3DRRA 3RSEB 3AO1A 1N34K 3SQ4A 2PYJA 1W2BM 1TGOA 4JYAK 3SV3A 1QSSA 5ELZA 3IDHA 5HL7L 3NCIA 3WXIA 3CCQN 3OJUA 4YORA 3DLRA 3TU5A 3MMVA 5BPLA 1S1VA 3DXKA 4W5QA 3FZKA 5F1XA 4U7BA 3OVNA 4M3UA 4DTOA 2NRRA 4BDPA 3CM6A 3RVCA 3T1HK 4H0VB 1S1TA 3M8PA 3J81O 1GOCA 3HVTA 3KLHA 4BQZA 1OKJA 1KVBA 1ESVA 1VSEA 4BC5A 4F3TA 1ZBLA 4ISEA 3WXJA 2VQEK 4JI5K 2VG6A 1B92A 1IG8A 4CJLA 3DM2A 5M1NA 1QQNA 1DKGD 1SL0A 4C8MA 1WBDA 4IOXA 3BZCA 4YOWA 3NH1A 4FK4A 4H8KA 2GX9A 4K41A 4IG0A 4B3SK 5HOOA 1T6CA 2ZWHA 3QERA 1YJ9N 4C8NA 3D2EB 1B9DA 4B9VA 3O80A 5C12A 2QWQA 3OBWA 3UE5A 5HRNA 4H4MA 1GLEG 2D1KA 4W5RA 3FFIA 5AQHA 2UXCK 1XNRK 1XC3A 4BRNA 2I7PA 3CCVN 2B6AA 3VGLA 2X74A 4Z94A 4QCLA 4O0JA 3A5OC 3LALA 3TWHA 4ICLA 1QVFM 2DY4A 4DSEA 4M3WA 4JV5K 4GV9A 2F8SA 2A41A 3ZSQA 4WFNL 4LF4K 1NGHA 4IFEA 2FBVA 2RE2A 1YJNN 3HSTB 4OKEA 3D45A 4WE1A 4CJUA 3F9MA 4M3YA 2YHWA 3CHWA 3TSUA 4JAXA 4JLHA 1KAZA 3V9UA 5HROA 3DXMA 2OA8A 1U2VB 4N47A 1Y64A 4HCCA 3CJAA 4CZJA 1EWQA 3LP1A 1IKXA 3J7AP 3ZSZA 3PIOL 4HUEA 3I55N 4DU3A 5A2QO 4MLEA 1RDAA 1BU6O 3CJ7A 3CFPA 1EXQA 2VQFK 1GLFO 3DYAA 3P31A 4H0PA 4CESA 5GAEP 3OJSA 4B9UA 3VQQA 1MWKA 3I8BA 2OTJN 3O08A 1RBUA 3ZSXA 3T3FA 4BG8A 4JD2A 4RW6A 2CGJA 3SUOA 4KFBA 4DTXA 4RW8A 3A5MC 1VSDA 4H0TB 5AZIA 5HP1A 1NGJA 4B1VA 4B1YB 2F9WA 4C23A 5C42A 4N56A 1WOQA 4CECA 3CCRN 4NO7A 2QK9A 5GADP 3ZX0A 2P9UA 3LP3A 5EX5A 4IO9L 4RWTA 3OYIA 1XQSC 3VGKA 2XY8A 2O8FA 2YHAA 5FRNA 3E66A 2QWRA 4CBWA 4AHCA 4DFKA 1NJWA 1IBLK 4BWJA 3F2KA 3SUNA 1L3TA 2EHGA 3W0LA 2A3ZA 3G71N 4CJFA 4FWLA 4OPKA 3A5LC 4DTSA 5C25A 2GELA 4CJPA 2QW9A 1T05A 3I8DA 1WSJA 2VWJA 3DI6A 5JLFA 3K59A 4OLBA 1T44A 3V1RA 4CEBA 4CJQA 4F9OA 1QVGM 4B3MK 5CYQA 3J80O 1A5VA 1JLGA 3JSMA 2G8IA 4TSXA 4E3SA 3ZEUA 4F4KA 4KH4A 5CZ1A 1VQNN 5K14A 4CIEA 4CZGA 1BCOA 2HW3A 1B9FA 1MDUB 2QTDA 4BRHA 2E1ZA 3VQ6A 2YKNA 3M6GA 4CEQA 3LM9A 3HRGA 2W42A 1D4XA 2E1YA 3V9WA 4CEOA 1KQSM 3RMCA 4BWMA 2E2PA 3HP6A 3LDLA 1VQ5N 2Z1JA 4CD1A 3G4SN 1J5OA 3LDPA 4H03B 3LP0A 2Y1IA 3QNOA 3AVIA 4WQ5A 1VSKA 3FZFA 4IDKA 4C8OA 1RDUA 1W97L 2GV9A 4BRPA 4DU1A
chains in the Genus database with same CATH topology
3ZX3A 1DT9A 1JCEA 2F7TA 3KVGA 3L0QA 5KPRA 3LL3A 5TKWA 4XH4A 3CQXA 4O8UA 1HUXA 5CR4A 2JWLA 3A8YA 1E4GT 4IXCA 5AQKA 4H0OA 4FWMA 2CGLA 3RSEA 4FPAA 3HTVA 1DGKN 2FXUA 3N4PA 4M7YA 1WUAA 2ASMA 4ILJA 3WUHA 3SAFA 1H1VA 2WBNA 3PIPL 4BG9A 2ZJQL 2KKZA 1K8KA 4U67L 2VGMA 4G9ZA 4JK9A 4BC2A 3GE1A 3R9PA 3ENHA 4CBUA 1NGFA 4BRCA 3J8AA 5AQLA 5EVZA 1VQMN 4B1UB 3H45C 1Q81O 3CC2N 5M1PA 3WEEA 1X9JA 1NLVA 3ENBA 2UYTA 1GLCG 4EHUA 3ATVA 3DXMB 1VQ6N 3O1WA 2HBMA 1C0FA 3M1FA 3WQTA 5LY3A 2A42A 4B1XB 3U9ZA 1KD1O 4FVUA 2VGNA 3EKSA 2J4RA 4JKGA 1NGIA 5H1SQ 3SBTA 3EE9A 2NRTA 3FLCO 3M5RA 4QS8A 3D7EO 3VEVA 3HZ6A 3KWGA 5JLHA 5BN9A 3C6HA 3CCLN 4BROA 4DCHA 3EE8A 4BVOA 1P90A 1YUWA 2BH1A 3CIPA 1NGAA 4DB3A 3BF1A 4I6MB 3KHYA 3H3OB 2P9SB 4C1NK 2GEMA 4JHDB 3WEEB 3TTDA 3M3ZA 4BVPA 5JMVA 1K8AO 4BY9C 1ZXOA 4YOUA 3FFKB 2V7ZA 5EY4A 4CZMA 5I9EB 1YAGA 5AZIB 1E4FT 3CCSN 1VQNN 1S3XA 2ITMA 1YHQN 4FOEA 1VQLN 4BR5A 4IJAA 4JKGB 2VWBA 5FPMA 4DKWA 2YHXA 5JVHL 3CC4N 3NMUA 1GLDG 4CD3A 4A57A 3D2EA 3AARA 2FLOA 3IMXA 2IVNA 4GNIA 3CI5A 4Y0WA 3VTIA 5EXWA 4A5BA 5BRFA 4BRAA 4BRKA 4EFHA 3HSCA 1YIJN 1NGEA 3CMAN 2E88A 4DQ8A 3H1QA 4NB4A 1HJOA 1GLJO 4PHTX 4WQ4C 1GLAG 1VQON 3HBTA 2FSJA 3AAQA 4PKGA 4A62A 1Q7YO 1N8RO 4A59A 1JCFA 5FPDA 3CJCA 3OA9A 4GY2B 3VENA 1QQOA 2E20A 4EIAA 3IKMA 4JKBA 1BA0A 4FWOA 3CJ9A 2QWPA 3VF4A 4PKHA 3LM2A 5AQRA 1NWKA 5AQWA 5EOYA 3Q7CA 4XH1A 1BDGA 3CXCM 3VERA 4CZKA 5AZJA 1GLBG 2NRXA 3NVMA 5BN8A 3BP8A 4YOTA 4BRQA 4JKAA 2NRHA 1T6DA 2P9IA 3UKRA 1HX1A 3WQUA 4CI6A 3SAGA 4PL7A 4B1ZA 3E9PA 3FZHA 4IWVA 1LOTB 3SK3A 3P4IA 3EKUA 4OO1J 3BUZB 1RDWX 3OHRA 3QBWA 5ADXH 2Q97A 2WFBA 3QICA 4MDAA 4R79A 5KPTA 5ADXA 3CPWM 3ID6A 4CZLA 5FPEA 4J8FA 2HOEA 1V4SA 1NJIO 4H0XB 5E84A 3S41A 3GBTA 4CZIA 1BUPA 4CZEA 4XH5A 3MWTA 4BGBA 4KH6A 3W3DA 2WUSA 2IIRA 4ILGB 4JN4A 1V4TA 5TKYA 4AM7A 4FWRA 3HOTA 2IVPA 5B8HA 2E2OA 2NLXA 4K43A 2P9PA 3CQYA 4XEIA 5AZJB 3SLCA 4L3QA 1LCUA 4NLCA 5AQFA 2QWLA 1IJJA 3BEXA 2P9IB 4CZHA 5GAGP 3L4QA 3CMEN 2QM1A 3WXMB 3IFRA 3AGRA 5BRDA 3P39A 4FPBA 4A61A 4B9QA 2BUPA 2IVOA 5AQOA 4WF9L 4JKFA 1K9MO 3FR0A 4YDUC 1HKCA 5FPNA 3KWIA 4BC3A 3CPEA 3H1VX 2HBJA 3MN7A 3U4LA 4EHTA 5C10A 1ATSA 1HKBA 2ZGZA 1HLUA 3KZBA 2YJEA 2V7YA 3CJBA 1Z05A 5BREA 1Q86O 1ATNA 2PAVA 3FE1A 1S72N 3VOVA 1EQYA 2Q31A 4H5VA 4MO4A 1T3VA 1OVYA 3DAWA 5GAHP 2ZJPL 2CGKA 3C6AA 2QA4N 3TPQA 4HWIA 3EO3A 5KQ8A 2E8AA 2NRVA 2HF4A 3CJ1A 3E9OA 3PLAA 1RFQA 2Q36A 2QWOA 2E2QA 3RSEB 4BRLA 4FL9A 3VESA 4JKDA 2ZF5O 2JWKA 2GWKA 1NBWA 3VTHA 2YX6A 3EN9A 2P9LA 1TUYA 1YXQA 4NLBA 1M90O 1W2BM 4C1NI 4E1JA 1K8KB 4AF1A 3O9UA 5AFUH 5ELZA 1C0GA 1DEJA 3IDHA 5HL7L 2GWJA 3WXIA 4BR2A 3CCQN 2QXLA 2ZGYA 4YORA 3QDKA 1P8ZA 3SMSA 4BRGA 3TU5A 3CCEN 3C65A 3MMVA 5BPLA 3DXKA 4MLHA 3H3NO 4YOYA 3FZKA 1ZC6A 4PL8A 3WXKA 5F1XA 3QBXA 5MLCQ 4U7BA 3J7ZO 4DHYA 2BTFA 2NRWA 3QMLA 4JEPA 2NRRA 3CCMN 3RVCA 4A2BA 4ILHA 3A5NC 4KH5A 1VQKN 3Q7BA 4H0VB 2Q2RA 1ILYA 2P9LB 3E9LA 2Q1NA 3MX5A 4FWPA 3DJCA 1OKJA 4BQZA 1ESVA 4UY8O 4BC5A 5BRHA 4ISGA 4WQ5C 3MN6A 3LDOA 2HBLA 4ISEA 3WXJA 4BRDA 4H5WA 3TTCA 3HOSA 5GINA 1IG8A 1KAXA 3O6WA 5DM7L 2I7NA 1QQMA 5M1NA 1SAZA 1QQNA 1DKGD 3ZYYX 4BC4A 3A0IX 2E2NA 3GOIA 3D2FA 3DXKB 3MCAB 4BRIA 2YJFA 2QI2A 5AQPA 1NGCA 4IOXA 5KPZA 4YOVA 1BG3A 1YI2N 1X3MA 4CBXA 4YOWA 2P9KA 1RGIA 1XUPO 5LJVA 3K9JA 3O8MA 2GX9A 4FWKA 4K41A 1EO1A 3H6EA 5DM6L 2Q0RA 1G99A 3MN5A 1NM1A 1T6CA 2ZWHA 3E1YA 2QWNA 3L4IA 5HOOA 1YJ9N 3D2EB 2CH6A 5AQQA 4MDBA 3VMFB 3O80A 3ZETA 3ULEA 3VEZA 5C12A 2QWQA 3OBWA 4K42A 3EZWA 3UE5A 1GLEG 3CC7N 4B1WB 2OTJN 2D1KA 3QFPA 5AQHA 4IJNA 2GTDA 1XC3A 2VCPA 4KBOA 1ATRA 4BRNA 3NVKA 5AQYA 1YJWN 4FOIA 3ZX2A 2I7PA 3CCVN 4H0YB 3CD6N 3G25A 1BOTO 1J6ZA 1R59O 2OANA 3VGLA 3VPZA 4Z94A 3A5OC 2KHOA 4FSVA 4BRMA 1KC8O 1S22A 3CF5L 3QB0A 1U2VA 4PKIA 3R6MA 1QVFM 5JICA 1YITN 2OTLN 2EWSA 3L6QA 4RCHA 3TTFA 4GV9A 2A41A 4WFNL 1NGHA 4ISFA 1U6ZA 2WC9A 1VQ8N 3UKRB 3B8AX 3DWLA 4IFEA 4GV3A 2HSTA 5AQTA 3R1XA 2RE2A 5M1OA 1YJNN 3IUCA 3N4QA 3UKUA 3F9MA 4WQ4A 2YHWA 2NNWA 3CHWA 1BO5O 3TSUA 4JAXA 2QEXN 1KAZA 3WT0A 3C7NA 5AQZA 1Q82O 2P9NA 3SBGA 4BRFA 4WFBL 4WFAL 3HM8A 3DXMA 1U2VB 2PBDA 1Y64A 1HPMA 3CJAA 4CZJA 3I33A 2HMPA 3JS6A 5CHIA 2P9PB 4JK8A 3PIOL 4IEIA 5GIOA 3TSPA 3I55N 5AQMA 1NGGA 4MO5A 4IOCL 2RHKA 5AQUA 5GIPA 4JKCA 5C15A 4MLEA 1BU6O 3CJ7A 3O1BA 4BR4A 1YF5L 4WYBA 2NRZA 4BR0A 4IO8A 3ATUA 3BF3A 3UB5A 4CJ7A 1GLFO 3O4WA 3P31A 5GAEP 4H0PA 3CERA 3UKUB 3JXUA 3O9RA 1MWKA 3I8BA 2QWMA 3WXLA 1JCGA 3O08A 4I6MA 2D0PA 4FWNA 3U8XA 2P9SA 2KLAA 2ASOA 4JD2A 3VF6A 4JHDA 4BG8A 3DLLL 2CGJA 3EL2A 1GLLO 2FSKA 3C7NB 4H5RA 2P9NB 3U9DA 3O5BA 4QS7A 3A5MC 2Q0UA 1VQ9N 3AGKA 3O9TA 2V51B 1NGDA 4H0TB 5AZIA 5AFUA 1SQKA 4YOXA 2A40A 2W41A 1NGJA 2GUPA 3VGMA 4B1VA 5C2FA 3MCPA 5E26A 2F9WA 4B1YB 4C23A 1NGBA 5AQJA 4A2AA 3SMPA 2ZJRL 1MA9B 4BR9A 4IOAL 1WOQA 3ID8A 3CCRN 2FF6A 4NO7A 3QFUA 1KXPA 5GADP 3AAPA 4M7XA 3ZX0A 2P9UA 5EX5A 4IO9L 1KAYA 1TUUA 4BQLA 4RWTA 1QHAA 1X3NA 1XQSC 3FZMA 4JNEA 4RTFD 5BR9A 3SAHA 3MDQA 1BA1A 1Z6RA 3VGKA 5AQXA 4FWQA 4EAHD 3E66A 2QWRA 3KK7A 4FWSA 4YDUA 4CBWA 5AQSA 3F2KA 2W40A 2NZTA 4HTLA 4JD2B 4QS9A 4JKHA 3W0LA 2A3ZA 3VEYA 3G71N 5F2RA 2A6AA 3H46O 4FWLA 3A5LC 3D6RA 2GELA 3MX2A 3R3LA 3ENOA 1MWMA 3VETA 2QW9A 3HI0A 3VEOA 1YVNA 2DPNA 3OW2M 2VYPA 1CZAN 5AR0A 2YHYA 4IDHA 4IEEA 2P9UB 3TSQA 3O9QA 3K9KA 2AA4A 4FO0A 5JLFA 3O9SA 1T44A 2CH5A 2YCHA 4F9OA 1QVGM 2H3GX 1SS6A 1TYQA 3T7ZA 4K25A 5KQDA 4OPAA 5BPNA 3GG4A 5JVGL 2HBKA 3I56N 5AQVA 1BWFO 3ZEUA 2FSNA 5M1FA 4GVEA 4KH4A 3VEXA 4JKEA 1QZ5A 1ZBSA 2FF3B 1O13A 3LDQA 3T69A 4AM6A 3VF2A 3P38A 4CZGA 1VAZA 5M1KA 1K73O 4M63C 3F5TA 1MDUB 2PFUA 2QTDA 4BRHA 1M1KO 4IZ9A 3R8EA 3CCJN 5BPMA 2E1ZA 5C2DA 3D2FB 3LDNA 2YI1A 1NMDA 3FGUA 1SZ2A 3M6GA 1VQ4N 2D4WA 2V52B 3HRGA 3LM9A 5AQGA 2P9KB 4O8KA 4BR7A 1D4XA 2E1YA 4A5AA 1JJ2M 4CZFA 3GDQA 5AQNA 4BGAA 1KQSM 4H5NA 2ASPA 5F0XA 2E2PA 3C0BA 4H5TA 5LJWA 2HF3A 3G6EN 3LDLA 3AY9A 3MWPA 1VQ5N 1TYQB 2F9TA 1VQ7N 4CD1A 3ZETB 3ULEB 3VEWA 3OBYA 3G4SN 3LDPA 4H03B 3SJHA 5CE3A 3MN9A 4LC9B 4WQ5A 1VQPN 3ZEUB 4GV6A 5C0YA 1HKGA 3FZFA 3MK6A 2D0OA 4OPHA 4BREA 3GL1A 5M1QA 1RDUA 1W97L 2A5XA 3CETA 4O5FA 5AQIA 1Q18A 2AP1A 3FZLA 4BRPA 4JK7A 3CCUN 1QZ6A 4WCEL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX6 A;  1O13 A;  2QTD A;  1EO1 A;  2RE2 A;  2WFB A;  1T3V A;  1P90 A;  2KLA A;  1RDU A; 
#chains in the Genus database with same CATH topology
 1JCE A;  3LZJ A;  5KPR A;  1ASW A;  3DOK A;  3HL8 A;  4XH4 A;  3HM9 A;  1NJX A;  1ZBH A;  1HUX A;  4C8K A;  3A8Y A;  1E4G T;  2HNY A;  5AQK A;  3OS0 A;  4KTZ A;  4JI1 K;  1IH7 A;  3QEW A;  4KB1 A;  1RNH A;  1J54 A;  1DGK N;  3AVJ A;  3KLF A;  3N4P A;  4B8A B;  4ILJ A;  3AVA A;  4NXM K;  4BG9 A;  4HHT A;  1K8K A;  4U67 L;  4JI2 K;  2HHU A;  4BC2 A;  3GE1 A;  1SL1 A;  4BRC A;  2G8U A;  3C95 A;  1EKE A;  5M1P A;  4DQS A;  1X9J A;  4DMN A;  2UYT A;  1FKO A;  3DXM B;  4N41 A;  1VQ6 N;  1TKT A;  3KK2 A;  4HUG A;  1WSF A;  1KD1 O;  4FVU A;  3SPY A;  4DR5 K;  1WAF A;  1NGI A;  1HQU A;  5C24 A;  3K0S A;  4BDZ A;  3VEV A;  4QS8 A;  3KWG A;  3C6H A;  1TKZ A;  3L3V A;  3TAM A;  4BRO A;  1UAX A;  4DV6 K;  3ZCM A;  1P90 A;  3NE6 A;  2G8W A;  3OYG A;  3RMD A;  4B9M A;  4DR4 K;  1VK0 A;  4FLU A;  3K58 A;  4DU4 A;  4DSK A;  3M3Z A;  4OJR A;  1S6Q A;  4BY9 C;  4CHZ A;  1LAV A;  2VG5 A;  1YAG A;  4H4O A;  5AZI B;  3KKR A;  1EX4 A;  4DSI A;  3C94 A;  2G8F A;  4JKG B;  3AO3 A;  4FLW A;  4DKW A;  2YHX A;  4KHP K;  3K2P A;  3VTI A;  2IVN A;  5IT9 O;  3V9S A;  5EXW A;  4G1Q A;  4Y1D A;  1HMV A;  3OYE A;  4BAC A;  5J2P A;  2EX3 A;  4CFB A;  4NXN K;  3I0S A;  2O8F B;  5KRS A;  2FBT A;  2PZS A;  3HBT A;  1N8R O;  3CJC A;  1U04 A;  5LMU K;  4EIA A;  3IKM A;  1BA0 A;  4FWO A;  3CJ9 A;  1L3U A;  4PKH A;  5AQR A;  1NWK A;  5EOY A;  1I39 A;  4YFU A;  3NVM A;  4YOT A;  3OYC A;  5BR8 K;  1J9A A;  4X64 K;  4IWV A;  3EKU A;  2Q97 A;  3QIC A;  1FKP A;  4MDA A;  2IC3 A;  3MWT A;  2IIR A;  1V4T A;  4AM7 A;  1GOB A;  2IVP A;  2NLX A;  4CEZ A;  3AVK A;  3CQY A;  5AZJ B;  4NLC A;  1IJJ A;  5GAG P;  2P9I B;  3AVL A;  4CED A;  3CME N;  3IFR A;  3LPU A;  1RTD A;  3AGR A;  3P39 A;  5J1E A;  5AQO A;  1XI1 A;  4CJ3 A;  1K9M O;  3FR0 A;  3ZSW A;  2HBJ A;  2ZGZ A;  1S9G A;  2V7Y A;  3OYA A;  3QIP A;  2I5J A;  1S72 N;  4DQI A;  1IKV A;  4H5V A;  4E7K A;  3F9K A;  1X9M A;  3NDK A;  4O0I A;  2E6M A;  3DAW A;  3K5O A;  5J2M A;  3WNF A;  2ZJP L;  4LF8 K;  2QA4 N;  2O8D B;  4Q5V A;  2HF4 A;  4FZY A;  4FJ7 A;  2Q36 A;  1NBW A;  3VTH A;  4KHN A;  1M90 O;  1U45 A;  1K8K B;  3LWL A;  4DFJ A;  1TK5 A;  1RDB A;  2HHH K;  3O9U A;  3JYT A;  1C0G A;  1DEJ A;  1YTU A;  3KLI A;  2ZGY A;  4DTR A;  1XWL A;  3SMS A;  5KGX A;  5HLF A;  3O3F A;  4MLH A;  4YOY A;  2D0A A;  5FLX O;  4PL8 A;  3WXK A;  4JI3 K;  5DK5 A;  5FRM A;  3J7Z O;  1S9E A;  3TR8 A;  2NRW A;  4JEP A;  4A2B A;  4B9T A;  4KH5 A;  1VQK N;  3RRG A;  2Q2R A;  4LY7 A;  1ILY A;  3S3M A;  4YNQ A;  4IKF A;  3KLE A;  2P9L B;  2Q1N A;  3MX5 A;  4L8R B;  3PX0 A;  3PO4 A;  4ISG A;  3NBP A;  2HBL A;  3MXJ A;  1JXE A;  4RW7 A;  5DM7 L;  3M8R A;  2I7N A;  1SAZ A;  4BC4 A;  4BRK A;  4B9L A;  3GOI A;  2E2N A;  3MCA B;  3O3G A;  1VSF A;  4YOV A;  3NHG A;  2NUB A;  2YJF A;  3THX B;  1NGC A;  3HJF A;  1VSM A;  1BG3 A;  4LH4 A;  3KK3 A;  3KK1 A;  1XUP O;  5LJV A;  4LF5 K;  3O8M A;  1EO1 A;  1NM1 A;  2QWN A;  4FJJ A;  4MDB A;  4ELU A;  2RKI A;  1T8E A;  4KKO A;  4B1W B;  4M45 A;  5KGW A;  4AHU A;  2GTD A;  2VCP A;  1BGX T;  4KBO A;  1ATR A;  3NVK A;  1YJW N;  4FOI A;  1JLQ A;  3SQ2 A;  4PWD A;  3G25 A;  1BOT O;  2YNH A;  4BRM A;  3EY1 A;  3CF5 L;  4NCA A;  1U2V A;  4CGF A;  3R6M A;  2ITG A;  2EWS A;  4RCH A;  1T03 A;  4CEA A;  2Z1I A;  4ISF A;  3DWL A;  2IOC A;  2HST A;  5AQT A;  3R1X A;  1XC9 A;  3CQ8 A;  3AVH A;  4WQ4 A;  1JLE A;  1NK7 A;  5LL6 Z;  4CFC A;  4HCB A;  3H08 A;  1NK4 A;  4WFA L;  3PSF A;  5CHI A;  1JLF A;  3NH0 A;  2VG7 A;  4LH5 A;  3HT3 A;  3DLK A;  1RDC A;  4IOC L;  2RHK A;  1WB9 A;  3O1B A;  3HPG A;  4WYB A;  4GMJ B;  2XO7 A;  1C0M A;  2A1R A;  3JXU A;  1L3S A;  3U8X A;  2ASO A;  3VF6 A;  4JHD A;  3BDP A;  3KD1 E;  3SQ0 A;  1TL3 A;  1GLL O;  2FSK A;  3C7N B;  1HRH A;  2P9N B;  3O5B A;  3OYL A;  4DTJ A;  3KKS A;  3O9T A;  2V51 B;  1SQK A;  4CFA A;  5C2F A;  3VGM A;  4CER A;  3MED A;  2DFH A;  3MCP A;  4A2A A;  3SMP A;  2BGG A;  3VQ5 A;  4KAZ A;  4BR9 A;  2YV0 X;  4EP4 A;  3KJV A;  3V81 A;  3AVG A;  4Z4F A;  2FF6 A;  3AAP A;  1HNW K;  3DLE A;  3C6T A;  1QHA A;  4RTF D;  5BR9 A;  3MDQ A;  3OY9 A;  1BA1 A;  1Z6R A;  3VQ9 A;  2HHW A;  4DR1 K;  4CF1 A;  4FWS A;  4YDU A;  3VQ7 A;  3VA3 A;  2NZT A;  4CGI A;  2P5G A;  5DMR A;  5F2R A;  2A6A A;  1XHX A;  3MX2 A;  1N6Q A;  2XRI A;  3VEO A;  2BDP A;  1ZBI A;  1YVN A;  2DPN A;  2KFN A;  4IEE A;  3TSQ A;  1KSP A;  4KB0 A;  2YCH A;  1TAQ A;  3S3N A;  1SS6 A;  4K25 A;  1HPZ A;  3HYF A;  4OPA A;  5BPN A;  3T19 A;  2HBK A;  3LP2 A;  1QZ5 A;  1ZBS A;  1ZBU A;  1O13 A;  3LDQ A;  3QLH A;  1OH6 A;  3RR7 A;  3P38 A;  5M1K A;  1BHL A;  1K73 O;  3QEX A;  1J5E K;  5C2D A;  4FZX C;  2YI1 A;  3FGU A;  3PUF A;  2V52 B;  5AQG A;  4O8K A;  4BR7 A;  3PX4 A;  4A5A A;  4CZF A;  4H5N A;  5F0X A;  3C0B A;  1WSG A;  2WTU A;  3AY9 A;  3D0P A;  1FJG K;  2F9T A;  3J7Y P;  3WNE A;  4CF0 A;  1VRU A;  3SJH A;  1ZYQ A;  3MN9 A;  4GV6 A;  2YNF A;  5C0Y A;  3PSI A;  4J2B A;  5LMN K;  3CET A;  3AO5 A;  2AP1 A;  5D3G A;  3CCU N;  3QO9 A;  1QZ6 A;  1WSI A;  3VQC A;  2F7T A;  3L0Q A;  4DV4 K;  3LL3 A;  5JS2 A;  3AA3 A;  4DV5 K;  3QET A;  1J53 A;  4IXC A;  1QHT A;  3DRP A;  4H0O A;  2O4G A;  2O4I A;  4MQ3 A;  3RR8 A;  4M7Y A;  3AVC A;  2WBN A;  1ASV A;  3LAM A;  1I3A A;  2VGM A;  2P5O A;  4CBU A;  1NOZ A;  5AQL A;  5EVZ A;  1RDD A;  3OS2 A;  3LZI A;  4DQQ A;  4B1U B;  3H45 C;  3ENB A;  4W5O A;  4DV0 K;  4EHU A;  1NKC A;  4OGC A;  2HBM A;  1C0F A;  4ZHR A;  4DR3 K;  3WQT A;  3O4N A;  2HVI A;  2HB5 A;  3U9Z A;  1UA0 A;  3DOL A;  3DLH A;  1WN7 A;  4JKG A;  2VWK A;  3D7E O;  3HZ6 A;  5JLH A;  1N5Y A;  3CCL N;  1O1W A;  4FLY A;  1HNI A;  3EE8 A;  4FJH A;  4LSL A;  4BVO A;  2HNZ A;  1YUW A;  3ULD A;  1BIS A;  3SPZ A;  4B3T K;  1NK8 A;  3IS9 A;  1Q9Y A;  4DB3 A;  4DTP A;  3KHY A;  4KI4 A;  4FJ5 A;  3WEE B;  4JHD B;  3TTD A;  4CCH A;  3TAB A;  2V7Z A;  5EY4 A;  5I9E B;  3ZSR A;  4AH9 A;  2ITM A;  4FOE A;  1VQL N;  4BR5 A;  2OZM A;  4IJA A;  2VWB A;  3PV8 A;  3NMU A;  3SUQ A;  3AAR A;  4GNI A;  3IMX A;  4A5B A;  3HSC A;  1NGE A;  3QIN A;  4DQ8 A;  4NB4 A;  3P1G A;  4CGJ A;  4A62 A;  2G8K A;  4CK1 A;  4A59 A;  1JCF A;  5FPD A;  4GY2 B;  1NNE A;  3BZK A;  3O3H A;  3LM2 A;  2QXF A;  3OYF A;  3Q7C A;  1BDG A;  3CXC M;  3VQ8 A;  3VER A;  5AZJ A;  4CE9 A;  3RTV A;  3BP8 A;  4JKA A;  4FJX A;  2NRH A;  1T6D A;  2P9I A;  1HX1 A;  3VQD A;  3WQU A;  1HYZ A;  4KPY A;  5AJ3 K;  3SAG A;  4PL7 A;  4B1Z A;  4OO1 J;  3IG1 A;  3OHR A;  2WFB A;  4R79 A;  5KPT A;  1IKW A;  3MXI A;  5FPE A;  4J8F A;  1V4S A;  4DR7 K;  3GBT A;  4DS5 A;  4K8X A;  4HTU A;  4BGB A;  4FJK A;  4ILG B;  1ASU A;  4JN4 A;  5TKY A;  3L2R A;  5HRS A;  3DRS A;  3AVM A;  3HOT A;  4XEI A;  1VRT A;  4K43 A;  3SLC A;  4UQG A;  1ITG A;  5T7B A;  4L3Q A;  4EP5 A;  2O8D A;  3WXM B;  2HHV A;  4BE2 A;  5BRD A;  2ATQ A;  4KRE A;  1TKD A;  4JKF A;  1S6P A;  1X9W A;  1C0T A;  5FPN A;  4BC3 A;  1LWF A;  3MN7 A;  3E01 A;  5C10 A;  4DSF A;  2KZM A;  1Z05 A;  1Q86 O;  4QAG A;  3VOV A;  5KRT A;  2Q31 A;  2BAN A;  4ID1 A;  2JLE A;  3QES A;  4LF9 K;  3MEE A;  5GAH P;  2CGK A;  3K5M A;  1G15 A;  3AVN A;  3PLA A;  1RFQ A;  4CJW A;  4BRL A;  3VES A;  4DSJ A;  2JWK A;  2GWK A;  5KI6 A;  2P9L A;  1TUY A;  1YXQ A;  1EP4 A;  3I0R A;  4E1J A;  3VQB A;  4AF1 A;  4CEE A;  5AFU H;  2GWJ A;  4BR2 A;  2QXL A;  1P8Z A;  1TVR A;  4BRG A;  3L2Q A;  1F21 A;  3THX A;  1U47 A;  4NCB A;  3H3N O;  4CJR A;  4K0K K;  4E7H A;  4FLT A;  3QBX A;  3ZT3 A;  2BTF A;  1NK9 A;  4NCG A;  4ILH A;  3A5N C;  3HVR A;  3S3O A;  1RT6 A;  1UOC A;  5I3U A;  3E9L A;  1KTQ A;  4CGD A;  2O8B A;  2F96 A;  3NF9 A;  4WQ5 C;  3MN6 A;  3HOS A;  4H5W A;  3TTC A;  4DQR A;  3CM5 A;  5GIN A;  4AQY K;  3AVF A;  2OZS A;  1L5U A;  3ZLJ A;  3A0I X;  3D2F A;  5AQP A;  4HVJ A;  2G8H A;  4CBX A;  2P9K A;  1RGI A;  3VQ4 A;  3KTQ A;  3V9X A;  4X65 K;  3K9J A;  4KHQ A;  4CF8 A;  1BCM A;  2R7Y A;  2DFE A;  3H6E A;  2Q0R A;  1G99 A;  3MN5 A;  2D5R A;  1N33 K;  1SKS A;  4J2A A;  3VMF B;  4DV1 K;  4JS5 A;  3AV9 A;  3CC7 N;  4AHR A;  4FLV A;  4FXD A;  4CIG A;  4EZ6 A;  3QFP A;  3IRX A;  1TL1 A;  5AQY A;  1DLO A;  4ZTJ A;  4E0D A;  1J6Z A;  4N76 A;  3VPZ A;  1R59 O;  2OAN A;  2QKB A;  4FYD A;  3SZ2 A;  2ZE2 A;  2KHO A;  4ID5 A;  1I94 K;  1S22 A;  4CF9 A;  3QB0 A;  4PKI A;  2OTL N;  1QTM A;  3TTF A;  4F2S A;  4E1N A;  1TKX A;  3K5N A;  4DWI A;  1XMQ K;  1U6Z A;  3ZT2 A;  2WC9 A;  4GV3 A;  5M1O A;  3O4Q A;  5IWA K;  3TAF A;  3IUC A;  3N4Q A;  1Z25 A;  4NYN A;  1C1B A;  2NNW A;  4E7L A;  1BO5 O;  3AVB A;  2QEX N;  4HUF A;  3C7N A;  2P9N A;  3SBG A;  4BRF A;  4WFB L;  2UUC K;  1UWB A;  4Z4I A;  3NAE A;  1HPM A;  3I33 A;  5GIO A;  3TSP A;  4LFB K;  1NGG A;  4MO5 A;  5GIP A;  4CF2 A;  5C15 A;  2P1J A;  4BR4 A;  3L8B A;  2NRZ A;  3ATU A;  3BGR A;  3UB5 A;  1BI4 B;  4CJ7 A;  3OYH A;  1NKB A;  3CER A;  3UKU B;  3O9R A;  3WXL A;  2P51 A;  2QWM A;  2D0P A;  4FWN A;  2P9S A;  2KLA A;  3RWU A;  3HO1 A;  4DV3 K;  3CFO A;  2OPP A;  4GKK K;  3AO2 A;  4H5R A;  4CHY A;  4QS7 A;  2O8E B;  2Q0U A;  1LV5 A;  1S1X A;  1BQM A;  1NGD A;  4DFM A;  2A40 A;  1FXX A;  2GUP A;  2ZJR L;  1NGB A;  5AQJ A;  4FK2 A;  1MA9 B;  4IOA L;  4X66 K;  3ID8 A;  2KQ2 A;  4CJ4 A;  1TUU A;  4BQL A;  1Z26 A;  2E6L A;  1KRP A;  1HNX K;  3FZM A;  1U48 A;  2BE2 A;  5AQX A;  4J2E A;  2E5L K;  3IAY A;  5AQS A;  2W40 A;  4B9N A;  3U6F A;  4HTL A;  3ASM A;  1Q9X A;  4JKH A;  4ELT A;  3VEY A;  3H46 O;  1JL1 A;  1ZBF A;  3D6R A;  3R3L A;  4LF6 K;  1W7A A;  1FW6 A;  1MWM A;  3VET A;  1HQE A;  4CJ5 A;  3L3U A;  1X1P A;  3TAQ A;  3EEQ A;  1D9D A;  4IDH A;  3ZSO A;  2RN2 A;  2HVH A;  4YHH K;  3K9K A;  2AA4 A;  4FO0 A;  1QE1 A;  4E19 A;  1RBV A;  4CHO A;  2CH5 A;  3BY5 A;  1HNZ K;  3OYN A;  1JXB A;  2O8B B;  3GG4 A;  5AQV A;  5M1F A;  4XIU A;  4AM6 A;  3HPH A;  4E89 A;  3T69 A;  3SCX A;  1OH8 A;  3VF2 A;  1VAZ A;  1U4B A;  3F5T A;  2PFU A;  3R8E A;  5BPM A;  4ZTF A;  3D2F B;  3LPT A;  1NMD A;  1VQ4 N;  1SZ2 A;  4DSL A;  3THY B;  3ZT4 A;  2D4W A;  3NF6 A;  1IG9 A;  1NMN A;  2W6L A;  4I9Q A;  2P9K B;  4CEF A;  1XNQ K;  5AQN A;  4FW2 A;  4LSN A;  2YNG A;  2YHB A;  4OX9 K;  4FJN A;  5LJW A;  4B3O A;  4IG3 A;  3MWP A;  1TYQ B;  3MXM A;  1VQ7 N;  3ITH A;  5HBM A;  3VEW A;  4PUO A;  3G10 A;  4FJ8 A;  2D0C A;  4LC9 B;  1VQP N;  4FJM A;  4CJE A;  3OYB A;  4BRE A;  3GL1 A;  4DFP A;  1NK5 A;  4JS4 A;  4O5F A;  3L2W A;  1Q18 A;  4O4G A;  4JK7 A;  4WCE L;  5J2Q A;  3KVG A;  1EWR A;  3CQX A;  3WNG A;  4CGG A;  5CR4 A;  1N36 K;  2JWL A;  2Y1J A;  4FWM A;  2CGL A;  3A2F A;  4FPA A;  3HTV A;  4AHS A;  2FXU A;  1WUA A;  2ASM A;  3SAF A;  1H1V A;  1BQN A;  3M8Q A;  2KKZ A;  4CFD A;  2HHQ A;  4CW7 B;  3ENH A;  3V4I A;  4R5P A;  4BE0 A;  3CC2 N;  1OVQ A;  4M3X A;  3WEE A;  1GLC G;  4C8L A;  3HP9 A;  4DS4 A;  1RT3 A;  3O1W A;  5LY3 A;  2A42 A;  3AO4 A;  1WNS A;  3M8S A;  2VGN A;  3SYZ A;  2J4R A;  4KI6 A;  1DTQ A;  3SBT A;  3EE9 A;  4V19 S;  3FLC O;  3M5R A;  2RF2 A;  3AA2 A;  3G0Z A;  4X62 K;  4DG1 A;  3U3Y A;  1NJZ A;  3DLB A;  3CIP A;  1CZB A;  4E7I A;  1NGA A;  3BF1 A;  2P9S B;  2GEM A;  4BVP A;  3SUP A;  5JMV A;  1K8A O;  1ZXO A;  4CZM A;  1XMO K;  3NF7 A;  4B3R K;  4CGH A;  1E4F T;  3CCS N;  1HJR A;  1GOA A;  2ZQB A;  1OH5 A;  5JVH L;  1GLD G;  4CD3 A;  1REV A;  3QEV A;  4Y0W A;  4CHP A;  5BRF A;  2OPQ A;  4BRA A;  4EFH A;  2FC0 A;  1KCF A;  2HHT A;  4JRP A;  4WQ4 C;  1GLA G;  2FSJ A;  3AAQ A;  3OA9 A;  3VEN A;  1QQO A;  2E20 A;  1WAJ A;  4DR6 K;  2QWP A;  4OKK A;  1KVC A;  4MFB A;  3VF4 A;  1D9F A;  4CZK A;  5CY4 A;  1GLB G;  2NRX A;  1LAW A;  1FK9 A;  4OPJ A;  2F8T A;  3UKR A;  4FJI A;  3QEP A;  1RBS A;  1NK6 A;  3FZH A;  1C0U A;  1LOT B;  3P4I A;  3BUZ B;  5ADX H;  3TAG A;  5ADX A;  5HRR A;  2A1S A;  1JLA A;  2HOE A;  4CHN A;  5E84 A;  3S41 A;  4CZI A;  4CZE A;  3V6D A;  3W3D A;  2WUS A;  4DV2 K;  2P9P A;  4LD0 A;  1LCU A;  3V1O A;  3L2U A;  3L4Q A;  2QM1 A;  4FM0 A;  3C6U A;  2IS3 A;  2X78 A;  1U49 A;  2BUP A;  1JKH A;  4JI0 K;  3P83 D;  4YDU C;  1HKC A;  3THV A;  3CPE A;  3H1V X;  3VQA A;  4F3O A;  2D0B A;  4EHT A;  4KTQ A;  3ZT0 A;  1ATS A;  1HKB A;  3KZB A;  1HLU A;  4AHT A;  3HPO A;  1HR0 K;  5SWM A;  2YJE A;  4NYF A;  4F8R A;  3T1Y K;  1HYS A;  3CJB A;  5BRE A;  1ATN A;  3FE1 A;  3UIQ A;  1EQY A;  4I7F A;  4IFY A;  5SZT A;  3ALY A;  3SJJ A;  3TPQ A;  4HWI A;  3EO3 A;  4DLE A;  5KQ8 A;  2UXD K;  2NRV A;  3E9O A;  3SNN A;  2X6N A;  4FL9 A;  3NFA A;  2ZF5 O;  4JKD A;  2YX6 A;  1YTA A;  3EN9 A;  4NLB A;  4Z4G A;  4C1N I;  4Z4C A;  2XHB A;  1LWC A;  1W0H A;  4JI6 K;  3PX6 A;  2KTQ A;  1A5W A;  4KRF A;  2HHS A;  4DUZ K;  3QDK A;  4FJL A;  3CCE N;  5JS1 A;  2GUI A;  3C65 A;  4FCY A;  4JI7 K;  1ZC6 A;  2YKM A;  5MLC Q;  4DHY A;  3S9H A;  3QML A;  2B5J A;  3CCM N;  2HMI A;  4Z0U A;  2Z1H A;  1TAU A;  2KZZ A;  3Q7B A;  2ETJ A;  4I2P A;  4F2R A;  2GBZ A;  4I2Q A;  2RPI A;  4FWP A;  3KIO A;  4FZZ A;  3KLG A;  3DLG A;  3DJC A;  1WSE A;  4UY8 O;  5BRH A;  3LDO A;  4OKJ A;  4O44 A;  4BRD A;  1BIZ A;  1KAX A;  3O6W A;  1LWE A;  4KHS A;  2Q3S A;  4CK3 A;  1QQM A;  1X9S A;  3ZYY X;  4BRI A;  1EET A;  3DXK B;  5KPZ A;  2QI2 A;  1YI2 N;  1KFD A;  1X3M A;  4CK2 A;  2LSN A;  3VQE A;  3DMJ A;  1KLN A;  4FWK A;  4W5N A;  5DM6 L;  4YY3 K;  3E1Y A;  4IBN A;  3L4I A;  4CVN E;  2CH6 A;  5AQQ A;  4M3R A;  3ZET A;  2HHX A;  3ULE A;  3VEZ A;  2DFF A;  4K42 A;  3EZW A;  4RW9 A;  1NKE A;  3VN5 A;  4LF7 K;  4IJN A;  3K57 A;  4FJ9 A;  2IAJ A;  3ZX2 A;  4BDY A;  4FJG A;  4H0Y B;  4KHW A;  1HNV A;  4DTM A;  3CD6 N;  4FSV A;  3SI6 A;  1YVU A;  1KC8 O;  4DTN A;  1Q8I A;  4Y1C A;  4PA1 A;  5JIC A;  1YIT N;  1L3V A;  2O8C A;  3L6Q A;  2OPS A;  1OH7 A;  3ZT1 A;  3ZSV A;  1JLB A;  1VQ8 N;  3UKR B;  3B8A X;  4OVL A;  4LFC K;  3B6P A;  1WBB A;  1BI4 A;  4K8Z A;  4EZ9 A;  3UKU A;  4O5B A;  1VSI A;  3WT0 A;  1CZ9 A;  5AQZ A;  1Q82 O;  2O8E A;  3OYM A;  3HM8 A;  4B8C A;  5EU7 A;  3TAR A;  1RBT A;  2PBD A;  1YT3 A;  1CXQ A;  3NGI A;  2HMP A;  3JS6 A;  2P9P B;  4JK8 A;  1NJY A;  4IEI A;  5AQM A;  1CLQ A;  4KHU A;  5AQU A;  4JKC A;  4ELV A;  3ISN C;  3THW A;  1NK0 A;  1YF5 L;  4B08 A;  4BR0 A;  4IO8 A;  4DQP A;  3BF3 A;  2QKK A;  3O4W A;  4CJS A;  4KV8 A;  1JCG A;  2KW4 A;  4I6M A;  4EAH D;  4CJK A;  3DLL L;  3RRH A;  1QSY A;  3JAM O;  3HK2 A;  3EL2 A;  4E7J A;  3U9D A;  1VQ9 N;  1SV5 A;  3AGK A;  4JI4 K;  1D8Y A;  1IV0 A;  5AFU A;  4YOX A;  1SL2 A;  2W41 A;  1S5J A;  5E26 A;  4QOZ B;  4DF8 A;  4LFA K;  3QFU A;  1KXP A;  4M3Z A;  4M7X A;  1KAY A;  2YNI A;  4BE1 A;  4AIL C;  3P5J A;  1X3N A;  4JNE A;  3SAH A;  2WON A;  2JGU A;  2OPR A;  4FWQ A;  1JLC A;  1LW0 A;  3KK7 A;  4KO0 A;  1WSH A;  1RTI A;  4JD2 B;  4QS9 A;  2PY5 A;  5FRO A;  4Q0B A;  3ENO A;  4CIF A;  2W6K A;  1HYV A;  3HI0 A;  3OW2 M;  2VYP A;  1CZA N;  3CG7 A;  3QIO A;  3MEC A;  2YHY A;  5AR0 A;  3THY A;  3LAK A;  4DTU A;  2P9U B;  4JRQ A;  4PY5 A;  1CXU A;  3O9Q A;  1WLJ A;  3O9S A;  1KFS A;  1NU0 A;  2H3G X;  1TYQ A;  2UUA K;  3T7Z A;  5KQD A;  5JVG L;  3I56 N;  1BWF O;  2FSN A;  4GVE A;  3VEX A;  3L2V A;  4M41 A;  4JKE A;  5J2N A;  1W9H A;  2FF3 B;  2PYL A;  2AJQ A;  4M63 C;  1UA1 A;  1M1K O;  3NH2 A;  4OGE A;  3EZ5 A;  4IZ9 A;  3CCJ N;  3F73 A;  3LDN A;  4DF4 A;  3B6O A;  4Z4H A;  3TI0 A;  1RT7 A;  4KHY A;  4JI8 K;  1BIU A;  3PO5 A;  1N32 K;  1JJ2 M;  1T7P A;  3GDQ A;  4BGA A;  2Z1G A;  2ASP A;  4H5T A;  1KVA A;  2HF3 A;  3G6E N;  2XY6 A;  1RBR A;  1LW2 A;  5I42 A;  3ZET B;  3ULE B;  1RTJ A;  3OBY A;  5CE3 A;  1VHX A;  4RW4 A;  3ZEU B;  4J2D A;  1HKG A;  3MK6 A;  1S1U A;  2D0O A;  4OPH A;  2WOM A;  2OCE A;  5M1Q A;  3U3G A;  2A5X A;  5AQI A;  4DR2 K;  3FZL A;  4I9L A;  4M3T A;  1BL3 A;  1Y97 A;  5HRP A;  3TAN A;  3ZX3 A;  2UUB K;  1DT9 A;  4FW1 A;  5TKW A;  4O8U A;  2O8C B;  3OYJ A;  3RSE A;  2F4V K;  1JL2 A;  3WUH A;  1RT4 A;  3PIP L;  2ZJQ L;  4DUY K;  1SUQ A;  4G9Z A;  4JK9 A;  3R9P A;  4CJT A;  4GVM A;  1NGF A;  3J8A A;  1S1W A;  1XHZ A;  1QS4 A;  1VQM N;  3CYM A;  3SV4 A;  1Q81 O;  3K5L A;  3KD5 E;  3LAN A;  2DTU A;  1K6Y A;  1NLV A;  2FBX A;  3NGZ A;  3ATV A;  2XY5 A;  1VSL A;  1DTT A;  3ZSY A;  2G8V A;  1TV6 A;  3M1F A;  1RT1 A;  4B1X B;  3QNN A;  4DLG A;  1IBK K;  3CFR A;  3EKS A;  5KTQ A;  5H1S Q;  1VSH A;  3VQP A;  2NRT A;  1E3M A;  5BN9 A;  3VA0 A;  3THW B;  4DCH A;  2B4J A;  2BH1 A;  3QEI A;  1TK0 A;  3LWM A;  4OLA A;  1RCH A;  4I6M B;  3H3O B;  4C1N K;  4CJV A;  2ZM6 K;  4YOU A;  3FFK B;  5CYM A;  3OTO K;  2HND A;  4AHV A;  1QSL A;  1S3X A;  1YHQ N;  5FPM A;  1C1A A;  5CZ2 A;  3CC4 N;  1TK8 A;  4A57 A;  3RMB A;  3D2E A;  2FLO A;  4KTW A;  4FLZ A;  4PQU A;  3CI5 A;  2UXB K;  4DV7 K;  4FK0 A;  3T1A A;  1RTH A;  4O55 A;  1RT2 A;  3EYZ A;  1RT5 A;  5FDL A;  1YIJ N;  3SQ1 A;  4FVM A;  2E88 A;  3CMA N;  4M42 A;  3H1Q A;  4GW6 A;  1HJO A;  1GLJ O;  4PHT X;  1VQO N;  3TAE A;  4PKG A;  3V9Z A;  1Q7Y O;  1C6V A;  3MEG A;  3WNH A;  4JKB A;  1MU2 A;  5AQW A;  4XH1 A;  1SKR A;  1SKW A;  4FM2 A;  3AA4 A;  5BN8 A;  1VSJ A;  2IGI A;  3NGY A;  1RIL A;  4BRQ A;  3PY8 A;  2E4L A;  2XY7 A;  4CI6 A;  3E9P A;  3SK3 A;  2OYQ A;  4E1M A;  4FM1 A;  1RDW X;  1IBM K;  3QBW A;  3OYK A;  4FLX A;  3HXM A;  4Z4E A;  3RMA A;  4CHQ A;  4N5S A;  3AA5 X;  3CPW M;  2ZD1 A;  3ID6 A;  4CZL A;  1NG9 A;  5E41 A;  1NJI O;  2UU9 K;  2IDO A;  4H0X B;  1BUP A;  4XH5 A;  3LDS A;  4GKJ K;  1KLM A;  4KH6 A;  1R0A A;  4FWR A;  4IFV A;  4W5T A;  5B8H A;  2E2O A;  3OYD A;  1NOY A;  5AQF A;  2QWL A;  3MAQ A;  3BEX A;  4CZH A;  4FPB A;  4A61 A;  1D5A A;  4B9Q A;  2IVO A;  3NF8 A;  4WF9 L;  3KWI A;  3U4L A;  4RG8 A;  1A5X A;  2X6S A;  3OS1 A;  2KFZ A;  4B9S A;  2PAV A;  3V1Q A;  4MO4 A;  1T3V A;  1OVY A;  1C1C A;  2FBY A;  1IO2 A;  3C6A A;  1IKY A;  1QQC A;  2E8A A;  3CJ1 A;  3TAP A;  2QWO A;  2E2Q A;  3DRR A;  3RSE B;  3AO1 A;  1N34 K;  3SQ4 A;  2PYJ A;  1W2B M;  1TGO A;  4JYA K;  3SV3 A;  1QSS A;  5ELZ A;  3IDH A;  5HL7 L;  3NCI A;  3WXI A;  3CCQ N;  3OJU A;  4YOR A;  3DLR A;  3TU5 A;  3MMV A;  5BPL A;  1S1V A;  3DXK A;  4W5Q A;  3FZK A;  5F1X A;  4U7B A;  3OVN A;  4M3U A;  4DTO A;  2NRR A;  4BDP A;  3CM6 A;  3RVC A;  3T1H K;  4H0V B;  1S1T A;  3M8P A;  3J81 O;  1GOC A;  3HVT A;  3KLH A;  4BQZ A;  1OKJ A;  1KVB A;  1ESV A;  1VSE A;  4BC5 A;  4F3T A;  1ZBL A;  4ISE A;  3WXJ A;  2VQE K;  4JI5 K;  2VG6 A;  1B92 A;  1IG8 A;  4CJL A;  3DM2 A;  5M1N A;  1QQN A;  1DKG D;  1SL0 A;  4C8M A;  1WBD A;  4IOX A;  3BZC A;  4YOW A;  3NH1 A;  4FK4 A;  4H8K A;  2GX9 A;  4K41 A;  4IG0 A;  4B3S K;  5HOO A;  1T6C A;  2ZWH A;  3QER A;  1YJ9 N;  4C8N A;  3D2E B;  1B9D A;  4B9V A;  3O80 A;  5C12 A;  2QWQ A;  3OBW A;  3UE5 A;  5HRN A;  4H4M A;  1GLE G;  2D1K A;  4W5R A;  3FFI A;  5AQH A;  2UXC K;  1XNR K;  1XC3 A;  4BRN A;  2I7P A;  3CCV N;  2B6A A;  3VGL A;  2X74 A;  4Z94 A;  4QCL A;  4O0J A;  3A5O C;  3LAL A;  3TWH A;  4ICL A;  1QVF M;  2DY4 A;  4DSE A;  4M3W A;  4JV5 K;  4GV9 A;  2F8S A;  2A41 A;  3ZSQ A;  4WFN L;  4LF4 K;  1NGH A;  4IFE A;  2FBV A;  2RE2 A;  1YJN N;  3HST B;  4OKE A;  3D45 A;  4WE1 A;  4CJU A;  3F9M A;  4M3Y A;  2YHW A;  3CHW A;  3TSU A;  4JAX A;  4JLH A;  1KAZ A;  3V9U A;  5HRO A;  3DXM A;  2OA8 A;  1U2V B;  4N47 A;  1Y64 A;  4HCC A;  3CJA A;  4CZJ A;  1EWQ A;  3LP1 A;  1IKX A;  3J7A P;  3ZSZ A;  3PIO L;  4HUE A;  3I55 N;  4DU3 A;  5A2Q O;  4MLE A;  1RDA A;  1BU6 O;  3CJ7 A;  3CFP A;  1EXQ A;  2VQF K;  1GLF O;  3DYA A;  3P31 A;  4H0P A;  4CES A;  5GAE P;  3OJS A;  4B9U A;  3VQQ A;  1MWK A;  3I8B A;  2OTJ N;  3O08 A;  1RBU A;  3ZSX A;  3T3F A;  4BG8 A;  4JD2 A;  4RW6 A;  2CGJ A;  3SUO A;  4KFB A;  4DTX A;  4RW8 A;  3A5M C;  1VSD A;  4H0T B;  5AZI A;  5HP1 A;  1NGJ A;  4B1V A;  4B1Y B;  2F9W A;  4C23 A;  5C42 A;  4N56 A;  1WOQ A;  4CEC A;  3CCR N;  4NO7 A;  2QK9 A;  5GAD P;  3ZX0 A;  2P9U A;  3LP3 A;  5EX5 A;  4IO9 L;  4RWT A;  3OYI A;  1XQS C;  3VGK A;  2XY8 A;  2O8F A;  2YHA A;  5FRN A;  3E66 A;  2QWR A;  4CBW A;  4AHC A;  4DFK A;  1NJW A;  1IBL K;  4BWJ A;  3F2K A;  3SUN A;  1L3T A;  2EHG A;  3W0L A;  2A3Z A;  3G71 N;  4CJF A;  4FWL A;  4OPK A;  3A5L C;  4DTS A;  5C25 A;  2GEL A;  4CJP A;  2QW9 A;  1T05 A;  3I8D A;  1WSJ A;  2VWJ A;  3DI6 A;  5JLF A;  3K59 A;  4OLB A;  1T44 A;  3V1R A;  4CEB A;  4CJQ A;  4F9O A;  1QVG M;  4B3M K;  5CYQ A;  3J80 O;  1A5V A;  1JLG A;  3JSM A;  2G8I A;  4TSX A;  4E3S A;  3ZEU A;  4F4K A;  4KH4 A;  5CZ1 A;  1VQN N;  5K14 A;  4CIE A;  4CZG A;  1BCO A;  2HW3 A;  1B9F A;  1MDU B;  2QTD A;  4BRH A;  2E1Z A;  3VQ6 A;  2YKN A;  3M6G A;  4CEQ A;  3LM9 A;  3HRG A;  2W42 A;  1D4X A;  2E1Y A;  3V9W A;  4CEO A;  1KQS M;  3RMC A;  4BWM A;  2E2P A;  3HP6 A;  3LDL A;  1VQ5 N;  2Z1J A;  4CD1 A;  3G4S N;  1J5O A;  3LDP A;  4H03 B;  3LP0 A;  2Y1I A;  3QNO A;  3AVI A;  4WQ5 A;  1VSK A;  3FZF A;  4IDK A;  4C8O A;  1RDU A;  1W97 L;  2GV9 A;  4BRP A;  4DU1 A; 
#chains in the Genus database with same CATH homology
 3ZX3 A;  1DT9 A;  1JCE A;  2F7T A;  3KVG A;  3L0Q A;  5KPR A;  3LL3 A;  5TKW A;  4XH4 A;  3CQX A;  4O8U A;  1HUX A;  5CR4 A;  2JWL A;  3A8Y A;  1E4G T;  4IXC A;  5AQK A;  4H0O A;  4FWM A;  2CGL A;  3RSE A;  4FPA A;  3HTV A;  1DGK N;  2FXU A;  3N4P A;  4M7Y A;  1WUA A;  2ASM A;  4ILJ A;  3WUH A;  3SAF A;  1H1V A;  2WBN A;  3PIP L;  4BG9 A;  2ZJQ L;  2KKZ A;  1K8K A;  4U67 L;  2VGM A;  4G9Z A;  4JK9 A;  4BC2 A;  3GE1 A;  3R9P A;  3ENH A;  4CBU A;  1NGF A;  4BRC A;  3J8A A;  5AQL A;  5EVZ A;  1VQM N;  4B1U B;  3H45 C;  1Q81 O;  3CC2 N;  5M1P A;  3WEE A;  1X9J A;  1NLV A;  3ENB A;  2UYT A;  1GLC G;  4EHU A;  3ATV A;  3DXM B;  1VQ6 N;  3O1W A;  2HBM A;  1C0F A;  3M1F A;  3WQT A;  5LY3 A;  2A42 A;  4B1X B;  3U9Z A;  1KD1 O;  4FVU A;  2VGN A;  3EKS A;  2J4R A;  4JKG A;  1NGI A;  5H1S Q;  3SBT A;  3EE9 A;  2NRT A;  3FLC O;  3M5R A;  4QS8 A;  3D7E O;  3VEV A;  3HZ6 A;  3KWG A;  5JLH A;  5BN9 A;  3C6H A;  3CCL N;  4BRO A;  4DCH A;  3EE8 A;  4BVO A;  1P90 A;  1YUW A;  2BH1 A;  3CIP A;  1NGA A;  4DB3 A;  3BF1 A;  4I6M B;  3KHY A;  3H3O B;  2P9S B;  4C1N K;  2GEM A;  4JHD B;  3WEE B;  3TTD A;  3M3Z A;  4BVP A;  5JMV A;  1K8A O;  4BY9 C;  1ZXO A;  4YOU A;  3FFK B;  2V7Z A;  5EY4 A;  4CZM A;  5I9E B;  1YAG A;  5AZI B;  1E4F T;  3CCS N;  1VQN N;  1S3X A;  2ITM A;  1YHQ N;  4FOE A;  1VQL N;  4BR5 A;  4IJA A;  4JKG B;  2VWB A;  5FPM A;  4DKW A;  2YHX A;  5JVH L;  3CC4 N;  3NMU A;  1GLD G;  4CD3 A;  4A57 A;  3D2E A;  3AAR A;  2FLO A;  3IMX A;  2IVN A;  4GNI A;  3CI5 A;  4Y0W A;  3VTI A;  5EXW A;  4A5B A;  5BRF A;  4BRA A;  4BRK A;  4EFH A;  3HSC A;  1YIJ N;  1NGE A;  3CMA N;  2E88 A;  4DQ8 A;  3H1Q A;  4NB4 A;  1HJO A;  1GLJ O;  4PHT X;  4WQ4 C;  1GLA G;  1VQO N;  3HBT A;  2FSJ A;  3AAQ A;  4PKG A;  4A62 A;  1Q7Y O;  1N8R O;  4A59 A;  1JCF A;  5FPD A;  3CJC A;  3OA9 A;  4GY2 B;  3VEN A;  1QQO A;  2E20 A;  4EIA A;  3IKM A;  4JKB A;  1BA0 A;  4FWO A;  3CJ9 A;  2QWP A;  3VF4 A;  4PKH A;  3LM2 A;  5AQR A;  1NWK A;  5AQW A;  5EOY A;  3Q7C A;  4XH1 A;  1BDG A;  3CXC M;  3VER A;  4CZK A;  5AZJ A;  1GLB G;  2NRX A;  3NVM A;  5BN8 A;  3BP8 A;  4YOT A;  4BRQ A;  4JKA A;  2NRH A;  1T6D A;  2P9I A;  3UKR A;  1HX1 A;  3WQU A;  4CI6 A;  3SAG A;  4PL7 A;  4B1Z A;  3E9P A;  3FZH A;  4IWV A;  1LOT B;  3SK3 A;  3P4I A;  3EKU A;  4OO1 J;  3BUZ B;  1RDW X;  3OHR A;  3QBW A;  5ADX H;  2Q97 A;  2WFB A;  3QIC A;  4MDA A;  4R79 A;  5KPT A;  5ADX A;  3CPW M;  3ID6 A;  4CZL A;  5FPE A;  4J8F A;  2HOE A;  1V4S A;  1NJI O;  4H0X B;  5E84 A;  3S41 A;  3GBT A;  4CZI A;  1BUP A;  4CZE A;  4XH5 A;  3MWT A;  4BGB A;  4KH6 A;  3W3D A;  2WUS A;  2IIR A;  4ILG B;  4JN4 A;  1V4T A;  5TKY A;  4AM7 A;  4FWR A;  3HOT A;  2IVP A;  5B8H A;  2E2O A;  2NLX A;  4K43 A;  2P9P A;  3CQY A;  4XEI A;  5AZJ B;  3SLC A;  4L3Q A;  1LCU A;  4NLC A;  5AQF A;  2QWL A;  1IJJ A;  3BEX A;  2P9I B;  4CZH A;  5GAG P;  3L4Q A;  3CME N;  2QM1 A;  3WXM B;  3IFR A;  3AGR A;  5BRD A;  3P39 A;  4FPB A;  4A61 A;  4B9Q A;  2BUP A;  2IVO A;  5AQO A;  4WF9 L;  4JKF A;  1K9M O;  3FR0 A;  4YDU C;  1HKC A;  5FPN A;  3KWI A;  4BC3 A;  3CPE A;  3H1V X;  2HBJ A;  3MN7 A;  3U4L A;  4EHT A;  5C10 A;  1ATS A;  1HKB A;  2ZGZ A;  1HLU A;  3KZB A;  2YJE A;  2V7Y A;  3CJB A;  1Z05 A;  5BRE A;  1Q86 O;  1ATN A;  2PAV A;  3FE1 A;  1S72 N;  3VOV A;  1EQY A;  2Q31 A;  4H5V A;  4MO4 A;  1T3V A;  1OVY A;  3DAW A;  5GAH P;  2ZJP L;  2CGK A;  3C6A A;  2QA4 N;  3TPQ A;  4HWI A;  3EO3 A;  5KQ8 A;  2E8A A;  2NRV A;  2HF4 A;  3CJ1 A;  3E9O A;  3PLA A;  1RFQ A;  2Q36 A;  2QWO A;  2E2Q A;  3RSE B;  4BRL A;  4FL9 A;  3VES A;  4JKD A;  2ZF5 O;  2JWK A;  2GWK A;  1NBW A;  3VTH A;  2YX6 A;  3EN9 A;  2P9L A;  1TUY A;  1YXQ A;  4NLB A;  1M90 O;  1W2B M;  4C1N I;  4E1J A;  1K8K B;  4AF1 A;  3O9U A;  5AFU H;  5ELZ A;  1C0G A;  1DEJ A;  3IDH A;  5HL7 L;  2GWJ A;  3WXI A;  4BR2 A;  3CCQ N;  2QXL A;  2ZGY A;  4YOR A;  3QDK A;  1P8Z A;  3SMS A;  4BRG A;  3TU5 A;  3CCE N;  3C65 A;  3MMV A;  5BPL A;  3DXK A;  4MLH A;  3H3N O;  4YOY A;  3FZK A;  1ZC6 A;  4PL8 A;  3WXK A;  5F1X A;  3QBX A;  5MLC Q;  4U7B A;  3J7Z O;  4DHY A;  2BTF A;  2NRW A;  3QML A;  4JEP A;  2NRR A;  3CCM N;  3RVC A;  4A2B A;  4ILH A;  3A5N C;  4KH5 A;  1VQK N;  3Q7B A;  4H0V B;  2Q2R A;  1ILY A;  2P9L B;  3E9L A;  2Q1N A;  3MX5 A;  4FWP A;  3DJC A;  1OKJ A;  4BQZ A;  1ESV A;  4UY8 O;  4BC5 A;  5BRH A;  4ISG A;  4WQ5 C;  3MN6 A;  3LDO A;  2HBL A;  4ISE A;  3WXJ A;  4BRD A;  4H5W A;  3TTC A;  3HOS A;  5GIN A;  1IG8 A;  1KAX A;  3O6W A;  5DM7 L;  2I7N A;  1QQM A;  5M1N A;  1SAZ A;  1QQN A;  1DKG D;  3ZYY X;  4BC4 A;  3A0I X;  2E2N A;  3GOI A;  3D2F A;  3DXK B;  3MCA B;  4BRI A;  2YJF A;  2QI2 A;  5AQP A;  1NGC A;  4IOX A;  5KPZ A;  4YOV A;  1BG3 A;  1YI2 N;  1X3M A;  4CBX A;  4YOW A;  2P9K A;  1RGI A;  1XUP O;  5LJV A;  3K9J A;  3O8M A;  2GX9 A;  4FWK A;  4K41 A;  1EO1 A;  3H6E A;  5DM6 L;  2Q0R A;  1G99 A;  3MN5 A;  1NM1 A;  1T6C A;  2ZWH A;  3E1Y A;  2QWN A;  3L4I A;  5HOO A;  1YJ9 N;  3D2E B;  2CH6 A;  5AQQ A;  4MDB A;  3VMF B;  3O80 A;  3ZET A;  3ULE A;  3VEZ A;  5C12 A;  2QWQ A;  3OBW A;  4K42 A;  3EZW A;  3UE5 A;  1GLE G;  3CC7 N;  4B1W B;  2OTJ N;  2D1K A;  3QFP A;  5AQH A;  4IJN A;  2GTD A;  1XC3 A;  2VCP A;  4KBO A;  1ATR A;  4BRN A;  3NVK A;  5AQY A;  1YJW N;  4FOI A;  3ZX2 A;  2I7P A;  3CCV N;  4H0Y B;  3CD6 N;  3G25 A;  1BOT O;  1J6Z A;  1R59 O;  2OAN A;  3VGL A;  3VPZ A;  4Z94 A;  3A5O C;  2KHO A;  4FSV A;  4BRM A;  1KC8 O;  1S22 A;  3CF5 L;  3QB0 A;  1U2V A;  4PKI A;  3R6M A;  1QVF M;  5JIC A;  1YIT N;  2OTL N;  2EWS A;  3L6Q A;  4RCH A;  3TTF A;  4GV9 A;  2A41 A;  4WFN L;  1NGH A;  4ISF A;  1U6Z A;  2WC9 A;  1VQ8 N;  3UKR B;  3B8A X;  3DWL A;  4IFE A;  4GV3 A;  2HST A;  5AQT A;  3R1X A;  2RE2 A;  5M1O A;  1YJN N;  3IUC A;  3N4Q A;  3UKU A;  3F9M A;  4WQ4 A;  2YHW A;  2NNW A;  3CHW A;  1BO5 O;  3TSU A;  4JAX A;  2QEX N;  1KAZ A;  3WT0 A;  3C7N A;  5AQZ A;  1Q82 O;  2P9N A;  3SBG A;  4BRF A;  4WFB L;  4WFA L;  3HM8 A;  3DXM A;  1U2V B;  2PBD A;  1Y64 A;  1HPM A;  3CJA A;  4CZJ A;  3I33 A;  2HMP A;  3JS6 A;  5CHI A;  2P9P B;  4JK8 A;  3PIO L;  4IEI A;  5GIO A;  3TSP A;  3I55 N;  5AQM A;  1NGG A;  4MO5 A;  4IOC L;  2RHK A;  5AQU A;  5GIP A;  4JKC A;  5C15 A;  4MLE A;  1BU6 O;  3CJ7 A;  3O1B A;  4BR4 A;  1YF5 L;  4WYB A;  2NRZ A;  4BR0 A;  4IO8 A;  3ATU A;  3BF3 A;  3UB5 A;  4CJ7 A;  1GLF O;  3O4W A;  3P31 A;  5GAE P;  4H0P A;  3CER A;  3UKU B;  3JXU A;  3O9R A;  1MWK A;  3I8B A;  2QWM A;  3WXL A;  1JCG A;  3O08 A;  4I6M A;  2D0P A;  4FWN A;  3U8X A;  2P9S A;  2KLA A;  2ASO A;  4JD2 A;  3VF6 A;  4JHD A;  4BG8 A;  3DLL L;  2CGJ A;  3EL2 A;  1GLL O;  2FSK A;  3C7N B;  4H5R A;  2P9N B;  3U9D A;  3O5B A;  4QS7 A;  3A5M C;  2Q0U A;  1VQ9 N;  3AGK A;  3O9T A;  2V51 B;  1NGD A;  4H0T B;  5AZI A;  5AFU A;  1SQK A;  4YOX A;  2A40 A;  2W41 A;  1NGJ A;  2GUP A;  3VGM A;  4B1V A;  5C2F A;  3MCP A;  5E26 A;  2F9W A;  4B1Y B;  4C23 A;  1NGB A;  5AQJ A;  4A2A A;  3SMP A;  2ZJR L;  1MA9 B;  4BR9 A;  4IOA L;  1WOQ A;  3ID8 A;  3CCR N;  2FF6 A;  4NO7 A;  3QFU A;  1KXP A;  5GAD P;  3AAP A;  4M7X A;  3ZX0 A;  2P9U A;  5EX5 A;  4IO9 L;  1KAY A;  1TUU A;  4BQL A;  4RWT A;  1QHA A;  1X3N A;  1XQS C;  3FZM A;  4JNE A;  4RTF D;  5BR9 A;  3SAH A;  3MDQ A;  1BA1 A;  1Z6R A;  3VGK A;  5AQX A;  4FWQ A;  4EAH D;  3E66 A;  2QWR A;  3KK7 A;  4FWS A;  4YDU A;  4CBW A;  5AQS A;  3F2K A;  2W40 A;  2NZT A;  4HTL A;  4JD2 B;  4QS9 A;  4JKH A;  3W0L A;  2A3Z A;  3VEY A;  3G71 N;  5F2R A;  2A6A A;  3H46 O;  4FWL A;  3A5L C;  3D6R A;  2GEL A;  3MX2 A;  3R3L A;  3ENO A;  1MWM A;  3VET A;  2QW9 A;  3HI0 A;  3VEO A;  1YVN A;  2DPN A;  3OW2 M;  2VYP A;  1CZA N;  5AR0 A;  2YHY A;  4IDH A;  4IEE A;  2P9U B;  3TSQ A;  3O9Q A;  3K9K A;  2AA4 A;  4FO0 A;  5JLF A;  3O9S A;  1T44 A;  2CH5 A;  2YCH A;  4F9O A;  1QVG M;  2H3G X;  1SS6 A;  1TYQ A;  3T7Z A;  4K25 A;  5KQD A;  4OPA A;  5BPN A;  3GG4 A;  5JVG L;  2HBK A;  3I56 N;  5AQV A;  1BWF O;  3ZEU A;  2FSN A;  5M1F A;  4GVE A;  4KH4 A;  3VEX A;  4JKE A;  1QZ5 A;  1ZBS A;  2FF3 B;  1O13 A;  3LDQ A;  3T69 A;  4AM6 A;  3VF2 A;  3P38 A;  4CZG A;  1VAZ A;  5M1K A;  1K73 O;  4M63 C;  3F5T A;  1MDU B;  2PFU A;  2QTD A;  4BRH A;  1M1K O;  4IZ9 A;  3R8E A;  3CCJ N;  5BPM A;  2E1Z A;  5C2D A;  3D2F B;  3LDN A;  2YI1 A;  1NMD A;  3FGU A;  1SZ2 A;  3M6G A;  1VQ4 N;  2D4W A;  2V52 B;  3HRG A;  3LM9 A;  5AQG A;  2P9K B;  4O8K A;  4BR7 A;  1D4X A;  2E1Y A;  4A5A A;  1JJ2 M;  4CZF A;  3GDQ A;  5AQN A;  4BGA A;  1KQS M;  4H5N A;  2ASP A;  5F0X A;  2E2P A;  3C0B A;  4H5T A;  5LJW A;  2HF3 A;  3G6E N;  3LDL A;  3AY9 A;  3MWP A;  1VQ5 N;  1TYQ B;  2F9T A;  1VQ7 N;  4CD1 A;  3ZET B;  3ULE B;  3VEW A;  3OBY A;  3G4S N;  3LDP A;  4H03 B;  3SJH A;  5CE3 A;  3MN9 A;  4LC9 B;  4WQ5 A;  1VQP N;  3ZEU B;  4GV6 A;  5C0Y A;  1HKG A;  3FZF A;  3MK6 A;  2D0O A;  4OPH A;  4BRE A;  3GL1 A;  5M1Q A;  1RDU A;  1W97 L;  2A5X A;  3CET A;  4O5F A;  5AQI A;  1Q18 A;  2AP1 A;  3FZL A;  4BRP A;  4JK7 A;  3CCU N;  1QZ6 A;  4WCE L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...