2KLAA

Nmr structure of a putative dinitrogenase (mj0327) from methanococcus jannaschii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
106
structure length
106
Chain Sequence
GHMINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanococcus jannaschii
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein MJ0327
total genus 24
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2klaA00
1P90A 2RE2A 2YX6A 2WFBA 2KLAA 2QTDA 1RDUA 1EO1A 1T3VA 1O13A
chains in the Genus database with same CATH superfamily
4CJKA 4DR1K 4KAZA 1NGEA 2DFEA 4CZIA 3DLEA 1Z6RA 3LDNA 1JCFA 3SJJA 2I5JA 2P9NA 4FWPA 2RN2A 4FLVA 4DSKA 1BDGA 4CECA 3ULEA 1XUPO 2D0AA 4M7XA 3K5LA 3OS1A 4LFCK 4IOXA 5AFUH 2HHQA 1CXQA 3TAQA 4CJSA 5LMUK 1FKOA 4CJLA 4EP4A 5AQFA 1NGBA 4FK2A 3T3FA 2E20A 2BUPA 3CC2N 2BE2A 3OJUA 1KC8O 4DTOA 4O55A 4FK4A 1QHTA 1N33K 1TKTA 4N76A 3KLHA 4DQPA 3IDHA 2W42A 3PX6A 4YOYA 4KI6A 4FJMA 3DLGA 1C0UA 3TU5A 1QHAA 3OYIA 4CF1A 3A2FA 3VTHA 3KD5E 3DOKA 2YKNA 3HZ6A 3J8AA 4JS4A 3HTVA 3JAMO 3T1YK 1K9MO 4HUEA 4B9UA 4DF4A 4Z4EA 3DLBA 2O8BB 2QWOA 4RW8A 2W6LA 1YVNA 3VETA 4WQ5A 3TTCA 2QKKA 3H6EA 2OPPA 1YJ9N 1W7AA 1IO2A 2ITMA 1ZBFA 2EHGA 4OJRA 1GLEG 1VRTA 4IFEA 1YF5L 4CBUA 4B3MK 3G10A 2YCHA 1HQUA 2IOCA 4M41A 5KPTA 1VHXA 2HMPA 1L5UA 1BIUA 1RDWX 4FSVA 1HUXA 4H8KA 1HJOA 5HBMA 1VRUA 1NGGA 3I8BA 1C1AA 2PYJA 2BGGA 3O9TA 3CFRA 2YNFA 4KPYA 3KK7A 1KFDA 3R1XA 1SV5A 3THVA 3QMLA 4CJ5A 3DXMB 3OHRA 3DXMA 3SV3A 4CIGA 2OTJN 4CERA 1N5YA 4DV0K 2RF2A 1WN7A 5KRTA 1FJGK 2HOEA 4B8AB 4F3OA 1JLQA 3V9XA 2V51B 1U49A 3KK2A 4EZ9A 3SQ2A 4JI0K 1NK7A 1N34K 3ZSYA 3H45C 2ZE2A 4E7KA 2HBLA 3AGRA 4DU1A 3UKRA 4BC5A 1BOTO 5C24A 4FLZA 4PHTX 2QXLA 1GLDG 3IUCA 1RCHA 3ZSZA 1UOCA 1QSLA 3PY8A 4DF8A 2P9LA 4ELTA 1JXEA 1FXXA 4CZGA 4CJVA 3V1RA 4NLCA 4RW7A 4FOEA 4WE1A 3DI6A 4H5WA 1ASWA 4LD0A 4E7IA 4FLXA 3L6QA 1R59O 4F2RA 5E84A 3THXB 2RHKA 3K5MA 2KZZA 3SQ0A 2FBYA 1K6YA 2QEXN 2XY8A 2FBVA 1QQCA 3VQ6A 3VGKA 4CGFA 5C42A 3VQAA 4CJ7A 3OA9A 2IIRA 1ZBLA 4BRGA 3CCMN 4W5TA 1ATSA 3S3MA 2G8UA 1QVGM 4E19A 4KHNA 1WSGA 3VGMA 3ZT3A 3JSMA 3AY9A 5FPMA 4I2QA 3L2WA 3O1BA 3OVNA 5KI6A 3NCIA 5HRSA 1QVFM 1WSFA 1EO1A 1WSIA 4PKGA 1D8YA 1LWFA 1V4TA 1RDBA 2ZD1A 3HK2A 1EX4A 4B1XB 4FXDA 4BROA 1IH7A 3QEXA 1Q9XA 4HUFA 4L8RB 3SUPA 3G6EN 4B9MA 3CJ7A 3O3FA 1ZBIA 1LW2A 3QINA 3TTFA 1NGFA 4W5OA 3F9MA 2Q1NA 1O1WA 3K0SA 4BRLA 3R8EA 4JI8K 3RSEA 5ELZA 3WNEA 1ESVA 4Z4HA 1C1BA 4B1VA 4WCEL 1S6QA 4C8OA 4FWOA 2A42A 2NRXA 1TUYA 4A2AA 3MXMA 4FW1A 2YNGA 3QFUA 4OX9K 1VSDA 5BREA 5KTQA 3FZFA 3I56N 4LY7A 1YVUA 2IAJA 3AO3A 4FJNA 1TYQB 2EWSA 1S1TA 4JKFA 1NKBA 1WB9A 3Q7CA 3HXMA 4MLEA 4M42A 5JICA 4JKEA 1EQYA 4LFAK 3A8YA 4J2EA 4IXCA 5BR9A 3MX5A 3CCSN 3IS9A 2YI1A 3E9LA 3LDLA 4XH5A 4IFYA 5AQSA 3SMPA 1KCFA 3GE1A 4B1UB 2P9UA 4CK2A 3NGIA 3U6FA 4F4KA 4WYBA 2F7TA 4ILHA 4FVMA 3OYAA 1YTUA 2OA8A 4FYDA 4KB0A 3WEEB 1BIZA 3CQXA 3ZSWA 1UA0A 3N4QA 3ENHA 4A5BA 4DV6K 2HNDA 3O5BA 4FLWA 2Q3SA 4B3SK 4CJPA 5GIPA 4NCBA 5F1XA 3OYHA 1K8KA 3J7ZO 3KVGA 3VQ5A 2P9LB 4DV1K 4E7LA 5C12A 2AP1A 1G15A 3NMUA 1RT2A 3K9JA 5ADXH 2IVNA 3KLGA 3CJ9A 3OBWA 4PL7A 5ADXA 4CCHA 3C65A 3DRSA 2O4GA 3MXIA 3HT3A 1WSEA 4DKWA 2HNZA 2VYPA 4C8MA 4E7HA 3NGYA 4OKKA 1NJZA 4DSLA 5A2QO 1ASVA 1S6PA 2YHAA 1TKXA 1T03A 4OGEA 5AQYA 4BY9C 3OYNA 4CF9A 4KFBA 1NGJA 1HRHA 3OYDA 4OPKA 4IEEA 4R79A 4M45A 3AARA 3P39A 4FJ7A 4CJEA 3H3NO 3ID8A 4FLYA 1S5JA 3F2KA 3B8AX 4IJNA 4GNIA 4MLHA 4BACA 3J80O 3DLLL 3MDQA 1L3VA 4ISEA 4B9LA 2FSKA 4KH5A 4LH4A 1VK0A 2ZF5O 3LP1A 4OPHA 1O13A 5FROA 3CHWA 3E66A 4CGGA 4AM7A 5C2FA 5EVZA 3C6UA 3F5TA 1HX1A 1SUQA 3C7NB 3IMXA 3D0PA 3TSQA 3MX2A 4BRFA 3WNFA 2HVIA 3ENOA 4C23A 3RMBA 3V4IA 3K2PA 4OPAA 5MLCQ 1TL1A 1RTHA 4JN4A 4CHOA 4LSNA 1WBDA 3RSEB 4IOAL 4CZMA 3EZWA 3WT0A 1P8ZA 3J81O 4DU3A 3SYZA 2Y1IA 1WAJA 4BRCA 2E5LK 5EXWA 1RT1A 4FWQA 2Q0UA 4YOTA 3KLFA 4JEPA 1KXPA 4M3TA 4E0DA 4DLGA 1NJWA 1HPZA 3OJSA 1BCMA 3M6GA 4HVJA 1GLAG 4YFUA 1VQ5N 3THWB 5CE3A 3DXKB 4HCCA 5TKYA 1CXUA 1B9FA 4OLBA 1KVAA 1U04A 4HCBA 5IWAK 3L0QA 3SUNA 1TK5A 3F9KA 1JJ2M 2R7YA 4KHUA 5BPNA 4CESA 3LZIA 5JVHL 1XWLA 3NAEA 1TKDA 2O8BA 1Q9YA 5KRSA 2UU9K 2WBNA 3VESA 2NLXA 1YJNN 4LF9K 2VWJA 3HYFA 2ZQBA 2E88A 4GY2B 5SZTA 3THYB 5AQHA 4OKJA 3QBXA 2EX3A 3AO1A 5CZ2A 5BPLA 5FPDA 4IZ9A 3KKSA 5J2PA 3CCJN 3EE9A 1S1VA 3AVJA 4Z4FA 4FW2A 3ZLJA 5EU7A 5KQ8A 3OW2M 3TAEA 3MAQA 4DR5K 1EXQA 3EYZA 4BE0A 3DLRA 5BN9A 5AQLA 3VN5A 1BA0A 2KFZA 3ZX0A 3CMAN 2QA4N 3T1HK 3C7NA 1JLGA 1JLAA 3M5RA 5DMRA 3CQYA 1U45A 2P9IA 1N36K 3AVKA 4LF8K 3C0BA 3H1VX 1YXQA 4GVMA 4NCGA 1A5XA 3C95A 3FZKA 4JI2K 5C0YA 3VQ8A 5JLFA 3ATVA 3QBWA 3M8SA 4H5RA 2KLAA 4CJFA 3CC4N 1XC3A 5FRMA 2A6AA 4IDKA 5AZJA 3BF3A 1NKEA 3DYAA 4CEDA 3HOSA 5BRFA 3FZLA 1MDUB 3TWHA 4DU4A 2YJEA 1HKCA 3DMJA 2D0OA 3MEDA 2HF4A 1KSPA 2X6SA 4ZTJA 3HPOA 2Z1JA 3AVCA 2PBDA 3RTVA 3O6WA 3LP0A 1XI1A 3PIOL 3OTOK 3SMSA 5CY4A 4GVEA 3I33A 3CM6A 5EOYA 3OYEA 3BDPA 3T69A 5CR4A 4RCHA 3HO1A 1BU6O 1JCEA 2Q0RA 3MN5A 1DGKN 4YDUC 3GL1A 2UYTA 4KHPK 3MCAB 4KKOA 3C6AA 3ZX2A 3G25A 3HI0A 4BG9A 4FO0A 3K5NA 3LAKA 4Z0UA 4K43A 3VQBA 3VQQA 3CPWM 1QSYA 3TTDA 1VAZA 4Q5VA 3P1GA 3L4IA 5GAHP 4CGIA 3BF1A 3WUHA 3S41A 4X66K 3ZYYX 3WQTA 3HM8A 4HUGA 3CERA 4CF0A 1SQKA 1RBUA 4ZHRA 3G0ZA 1EETA 4U67L 3AVBA 3DLKA 1KQSM 4CK1A 1RTJA 3EE8A 4CZKA 1V4SA 4BGBA 3R6MA 4DB3A 2IC3A 2HBKA 4FM1A 1VSIA 1KLMA 3VA3A 4DTPA 1NK8A 2V7YA 3QDKA 1IBKK 4BR0A 2QM1A 1ATRA 1ASUA 4MDBA 4CEOA 5J2MA 2H3GX 3MEEA 4ZTFA 3J7YP 1HJRA 3WXKA 3NH0A 3O9QA 3KLIA 3O3GA 3CFOA 4ELUA 1TK8A 4QOZB 1LOTB 5BPMA 5DM7L 1RTIA 3CJBA 4CHQA 4I6MB 2NRTA 4F8RA 1R0AA 2E1YA 1I39A 1QZ5A 3ITHA 3MEGA 1HYZA 2HBMA 4CJTA 1HQEA 3SV4A 2Q97A 4FJLA 1DTQA 3VF4A 4CE9A 1WSHA 3KZBA 4BR9A 4M3RA 4E7JA 3QNOA 3LDQA 3QEPA 3M3ZA 4B9VA 2OPQA 3LDSA 3NH1A 3CM5A 1GOAA 3B6PA 4H5TA 5FPEA 3CCRN 1SL1A 4DQQA 2W40A 2D1KA 3ENBA 3JYTA 4JKBA 2E1ZA 4I6MA 5E41A 2BANA 2HVHA 4M3UA 1OKJA 1U4BA 4FJIA 4C8NA 3QERA 4EP5A 3NE6A 2YNHA 4BRAA 3QO9A 1JLCA 1JLFA 3A5OC 5CYQA 5LL6Z 4WFBL 3NDKA 1N6QA 4ILGB 2CH6A 2E2OA 4CJUA 1C0FA 3BEXA 4KH4A 4M3XA 5AQOA 3NVKA 1Q18A 5C15A 3PUFA 2YKMA 2Z1IA 2P9KA 2HHTA 1NG9A 4FWLA 2D0CA 1CZAN 2ASPA 1HPMA 2KTQA 4FM2A 1T6CA 3MCPA 4DG1A 2O8DB 3NF9A 3U9DA 1RGIA 2VWBA 5AQKA 1Q86O 4O5FA 1RT6A 3QIPA 2GUPA 1WBBA 4FWMA 4GKJK 4NO7A 2P51A 2OPRA 3O8MA 1SL0A 4AHCA 4EAHD 4B1WB 2XHBA 3A0IX 4LF6K 3AVAA 3HSTB 1NK9A 2O8FB 3GBTA 1TL3A 4DFPA 1KVCA 3RVCA 1VQPN 3ASMA 3HL8A 4FWKA 1OVQA 3HSCA 4GW6A 1RDAA 4A59A 4AM6A 2BH1A 4FJHA 1HLUA 1RDUA 3K5OA 4V19S 3KIOA 3HP9A 1C0MA 5D3GA 3CG7A 3VQ4A 4CZEA 4BDPA 1L3UA 2FBXA 2FF3B 4FLUA 4BRKA 2ZM6K 3EKUA 2JWLA 3KKRA 3U4LA 3VEWA 1J5EK 4YDUA 2D0BA 4R5PA 4CEQA 4K42A 3TR8A 1C6VA 3M8QA 2F9WA 4M7YA 2O8CB 4CZLA 1NGIA 3MWTA 3OYCA 5FPNA 2XRIA 3K59A 3QNNA 4OPJA 3OY9A 5HL7L 2QWNA 3TI0A 3I0RA 4PKHA 3M1FA 3MN6A 1QQMA 2VG7A 1XNRK 3W0LA 1KAXA 3D2FA 4BRNA 3D2FB 1L3SA 5LY3A 2F4VK 3CIPA 1RT7A 1TUUA 2A40A 3OYKA 4BWMA 3ZSQA 5AQGA 1BO5O 3HBTA 2ASMA 3F73A 1NGCA 3H08A 3ALYA 4IO9L 4B3OA 1BI4B 3L2VA 4CHZA 4JV5K 1JLBA 1IG8A 1NGDA 4OVLA 4BGAA 1OH7A 1KD1O 3SPYA 3U3YA 2KKZA 3QFPA 1S72N 3WEEA 2QW9A 2OPSA 1NMNA 5I3UA 4YOVA 4JI7K 3WNGA 3AVIA 4JYAK 4B9NA 2DY4A 1NBWA 4CJ4A 3DM2A 3BZKA 1WNSA 2FLOA 1XMOK 3ZT2A 1HKBA 2G8VA 2IGIA 1K8KB 2UXCK 2OANA 2HW3A 3FR0A 5AQTA 3ZSOA 2W41A 4JKHA 3OYJA 1BQMA 4G9ZA 4XEIA 4BQZA 4H4OA 1DT9A 4XH4A 2Q2RA 4IJAA 3CCVN 1ZYQA 4CIFA 4F3TA 4O8UA 3RMCA 1RDCA 2NZTA 4FJKA 2KZMA 4PUOA 1C1CA 5IT9O 2QXFA 3FLCO 4O0JA 4CZHA 4AQYK 1KRPA 1YI2N 1S1UA 1ZC6A 1IG9A 1RBSA 4JAXA 2F8TA 2A1RA 3ZT0A 3V9SA 3PSFA 5AQWA 4L3QA 4BE1A 3BGRA 4M3ZA 3LM9A 4FLTA 4DTRA 1T3VA 3N4PA 2GEMA 3W3DA 1Q7YO 1JCGA 4E1JA 4JI4K 4A2BA 1T8EA 3RRGA 2ZGZA 4K25A 3QEIA 1GLJO 3BUZB 2HHUA 2ZJRL 4N56A 2QKBA 4DQSA 2ZWHA 1VSLA 4DTJA 4QS9A 1SKWA 1IKYA 4CD3A 1LAVA 5HP1A 3V9UA 1SZ2A 3JXUA 4NLBA 1HNXK 4DHYA 4W5QA 3OYMA 3VQPA 2HHSA 4OKEA 1XMQK 4Q0BA 4CJWA 3C94A 4ISFA 5AQIA 4IOCL 3RMAA 4KBOA 3HPHA 1IBMK 3NGZA 4LFBK 1HR0K 4GMJB 4NB4A 3VEOA 2O8EB 4JKDA 4BRHA 2P5GA 4ELVA 5BR8K 3R3LA 3T1AA 1I94K 1ITGA 3ZETA 5SWMA 2OTLN 4AHVA 5AZJB 4KHWA 3H46O 4BR7A 2WTUA 4DFJA 2PYLA 5E26A 4BE2A 3HM9A 2AJQA 1LWCA 4KHYA 2IVOA 3KWIA 4M3WA 4Y1DA 4MO5A 3ZSXA 3HVRA 2UXDK 3QEVA 3THYA 1NWKA 4OLAA 3VEZA 3VF2A 3G71N 3WXIA 3SPZA 1MWMA 3ZEUA 4AHSA 4Y1CA 4FWNA 1J54A 1SL2A 4MO4A 4IBNA 3O4WA 1D9DA 3HJFA 3KHYA 4BC2A 1KAYA 3CF5L 3FGUA 1C0GA 4CZFA 4DR6K 4QS8A 4DTMA 2YV0X 3C6HA 2E6MA 1J53A 3MMVA 4LF7K 3THXA 4J2AA 2G8KA 3I0SA 2Z1HA 4RTFD 3H3OB 4CFDA 4WFNL 3KTQA 3DJCA 2DTUA 1HMVA 3CJCA 5M1QA 3NFAA 1VQ7N 4DV7K 4DFMA 2WUSA 1HNIA 2IVPA 5FRNA 1VQKN 3TSPA 1NKCA 4LF4K 2YHWA 4C8LA 1NK6A 3ZCMA 4PA1A 4H0YB 3ULDA 4C1NK 4BG8A 4FJ8A 3D7EO 2UUCK 3CC7N 4Y0WA 4DTSA 3AO5A 2HHXA 4DV4K 3VA0A 2P9IB 1MWKA 2Q31A 4YOWA 3O9RA 1J6ZA 3CETA 4B9TA 2CGKA 4B1YB 2KFNA 3QICA 4DS5A 1OH8A 4HHTA 1P90A 4CEZA 2A3ZA 2HNYA 3VEVA 3OYGA 2P9SB 3E9OA 3V1OA 2GELA 4DS4A 3CMEN 1F21A 4CEEA 1N8RO 1S9EA 3WQUA 4BVOA 2D4WA 5AQQA 4CFBA 1NK0A 1W2BM 1VSHA 3UKUA 1VSJA 3IKMA 4WQ5C 2KW4A 3D2EB 2WONA 3S9HA 1WSJA 1TV6A 1YT3A 2E4LA 1X9WA 3WNHA 4LH5A 3WXJA 3TARA 3BY5A 4NYFA 2NRRA 2XY5A 4CF8A 4WFAL 3PO5A 4OGCA 1HYVA 3NF7A 4JHDA 4AHUA 1HNVA 1SKRA 4DR2K 3VQ7A 4DLEA 4F2SA 2GTDA 2P9SA 1JL1A 4H4MA 1SAZA 5KPZA 3AVFA 1KVBA 4CEFA 4DUZK 4N5SA 1REVA 3L8BA 1KFSA 2QTDA 4QCLA 1G99A 1LCUA 4Z4CA 2GWJA 3AV9A 2CGLA 3PSIA 4RW6A 4A5AA 2PAVA 1J9AA 1YUWA 3CYMA 3MK6A 4A61A 4YY3K 4WF9L 2G8WA 4B3TK 4LSLA 4BRIA 5HRPA 1GOCA 3ULEB 4LC9B 5H1SQ 2GWKA 1VSEA 3CCQN 1YIJN 2E2NA 4DSFA 4B08A 4EIAA 1KAZA 2Q36A 3MWPA 3SBTA 2HHHK 2V7ZA 4X65K 1D5AA 5TKWA 1BA1A 4B9QA 4DR3K 2J4RA 4I9LA 5GINA 1LV5A 4BC4A 2GX9A 2FSNA 3FFKB 4N41A 2ZJQL 5AFUA 1NNEA 1IBLK 3A5MC 4FPAA 1VSKA 4RWTA 1S9GA 4EHTA 1QTMA 4DQ8A 2HHWA 2YHBA 4F9OA 3SBGA 1K73O 3L3VA 5DK5A 3A5LC 5BRDA 3IAYA 3D6RA 1N32K 2I7NA 4FJ5A 4YOUA 4CIEA 5F0XA 3R9PA 4IWVA 2XO7A 3V9ZA 3DLHA 2HHVA 4JD2A 3CCUN 1GLLO 3CXCM 1EKEA 1WUAA 4HTUA 1NJXA 2G8IA 2DPNA 4KTQA 4K41A 3E9PA 1B9DA 4DMNA 1E4GT 3LDOA 3DAWA 3QLHA 5J2QA 3CCEN 4AILC 4BVPA 4I9QA 4EFHA 4DR4K 1MU2A 1WLJA 4KO0A 3PX0A 4IKFA 3LWLA 2FBTA 3VEYA 4E89A 1BQNA 2QWQA 2WOMA 1XQSC 4Z4GA 2UXBK 1RDDA 1XHXA 4DTUA 4UY8O 5AQJA 4JI1K 3LP3A 4O5BA 5J1EA 2VWKA 1Z25A 1BUPA 1ATNA 4DV2K 3CD6N 1NOZA 1X9SA 4BRPA 2BDPA 3AVGA 3V6DA 3AVNA 3E1YA 3U3GA 3OS0A 4DV3K 1BL3A 4GKKK 1E4FT 3KK3A 2F96A 1J5OA 2IS3A 1W9HA 2P9PA 3EKSA 4CJ3A 1QZ6A 3LWMA 1NK4A 2QI2A 2YJFA 1CZ9A 4YNQA 5M1FA 2NRVA 5HRRA 3O3HA 4NXNK 3JS6A 3AGKA 3A5NC 3CQ8A 4GV9A 4HWIA 3SI6A 2NRWA 1GOBA 4O0IA 2E8AA 3NF6A 3AAPA 1GLBG 4CGHA 3I8DA 1ILYA 3GG4A 1I3AA 5KQDA 3AVMA 3HPGA 1U6ZA 3KLEA 5C2DA 2O8DA 1EP4A 1IKVA 4H5VA 2ASOA 2HB5A 3VF6A 4FWSA 4KHQA 4MDAA 2QWLA 2CGJA 2YNIA 2NUBA 4W5NA 3L2QA 1T44A 1Z05A 5T7BA 5EY4A 4BR2A 5KGXA 3TAFA 4JKCA 3PO4A 3SAGA 5C10A 5GADP 1TKZA 4ID1A 2D5RA 4IDHA 1MA9B 4PWDA 3WXLA 3VPZA 3J7AP 1BCOA 1DKGD 1VSFA 1QQNA 1VQ6N 3VENA 3O08A 3TAGA 5HRNA 4MFBA 3ZT4A 1NGHA 3SZ2A 4AH9A 1NJYA 4DWIA 1VQNN 2A41A 2VQEK 3UE5A 1RTDA 1UWBA 1X9MA 2JGUA 4FJ9A 1ZBUA 1VQON 1TGOA 3TAPA 4JD2B 3LPTA 3GDQA 3SUOA 3O4NA 2UUBK 4K0KK 3AA4A 2VCPA 3Q7BA 3O80A 3NVMA 4OO1J 2QK9A 1FK9A 1IKXA 4YORA 2VQFK 5C25A 4J8FA 1BG3A 4O8KA 1RT4A 3OYBA 2E2PA 3V1QA 4YOXA 2O4IA 3LP2A 2JLEA 3P4IA 3S3OA 5AQUA 3AO2A 4FCYA 3SQ1A 4DCHA 1D9FA 2O8CA 3SAFA 3PX4A 1YJWN 3M8RA 5AJ3K 3NF8A 3MXJA 5AQXA 3EEQA 2X78A 3QETA 4DSEA 2I7PA 1HNZK 3VMFB 4KB1A 2A5XA 3RWUA 3T7ZA 4NCAA 2GBZA 1X9JA 3ZETB 3D2EA 2G8HA 1K8AO 3GOIA 4EZ6A 4H0TB 1DEJA 4LF5K 4JI6K 1BI4A 2X6NA 3AAQA 4QS7A 4UQGA 1JLEA 3HRGA 1RBVA 4A57A 4CFAA 4CHNA 4JRQA 2NRZA 4JKAA 5LJWA 2VGMA 4H03B 5GIOA 3G4SN 4BWJA 3LANA 3ZEUB 5FDLA 2OZMA 4E3SA 4RG8A 3TPQA 4J2DA 3PV8A 5LJVA 3AVLA 5HOOA 3SCXA 3L3UA 3M8PA 1KLNA 3OS2A 2PFUA 1FKPA 4DSJA 3OYFA 1RFQA 1VQ4N 4CEBA 4BDZA 3VQ9A 4B9SA 3T19A 4H0VB 4CJQA 2ZGYA 1IV0A 1NM1A 1U48A 4IFVA 5JLHA 5AQMA 4KH6A 2RPIA 3DOLA 2NRHA 2P9UB 3VTIA 1ZBSA 2ZJPL 2W6KA 3CFPA 4WQ4C 4XH1A 2FXUA 4X64K 3TABA 1Y64A 1JXBA 2HSTA 2WC9A 4A62A 5EX5A 2P9KB 1IKWA 2WFBA 5AQRA 3U9ZA 4AF1A 5I9EB 3OBYA 1VQ8N 4BRMA 4M63C 1ZBHA 1Z26A 5BRHA 5AQZA 4AHTA 3U8XA 4CZJA 1BWFO 3CJAA 3VQEA 3QEWA 1XC9A 4RW4A 1NJIO 3VERA 1L3TA 4CGJA 3L2RA 1Q82O 1NU0A 3OYLA 3HOTA 3KD1E 3K58A 5CYMA 2VG5A 4JNEA 1OH5A 4PY5A 1YAGA 4FOIA 2HBJA 3QB0A 1RBRA 4E1NA 5BN8A 2UUAK 2DFHA 2FF6A 3WXMB 1XHZA 3EL2A 1RNHA 4DFKA 4CHPA 3SNNA 4BRDA 4NYNA 1A5VA 3CI5A 4BR5A 2O8EA 4Z94A 5HROA 1QQOA 4ID5A 4JHDB 4JI3K 3EO3A 4CFCA 5DM6L 4KREA 3EN9A 2G8FA 3VQDA 5AQVA 3HVTA 4KHSA 3UB5A 1EWQA 2E6LA 4FPBA 2LSNA 1VSMA 1KTQA 2GV9A 1M90O 2F8SA 1DTTA 3IRXA 2E2QA 1QS4A 1FW6A 1RT3A 4KTZA 4JK9A 1OVYA 4FK0A 3TANA 4KTWA 5B8HA 4DQRA 3HP6A 2PZSA 1WAFA 3SK3A 1HKGA 1H1VA 1QE1A 4NXMK 4EHUA 4JKGB 1LWEA 2GUIA 3UKUB 1CZBA 4FM0A 1X1PA 4IG3A 4N47A 4FVUA 3FFIA 2OYQA 2KHOA 2DFFA 1NGAA 3O9SA 1Q8IA 4I2PA 4JRPA 3BZCA 4CEAA 3LL3A 3UKRB 1GLFO 3P5JA 4CBWA 1WOQA 5CHIA 1YHQN 3LDPA 2B6AA 3CJ1A 4WQ4A 3TAMA 5KGWA 3QESA 4CHYA 5AQPA 4CF2A 1HYSA 4FZYA 4CI6A 3SAHA 1RT5A 1TYQA 5M1PA 4CVNE 4B1ZA 4BQLA 1CLQA 4JKGA 3FZMA 4FZZA 4PKIA 1U2VA 4BREA 1DLOA 5JVGL 4C8KA 4ILJA 3ZSVA 2VGNA 4H5NA 2P9NB 4X62K 4JS5A 5HLFA 1BHLA 5AQNA 2PY5A 3P38A 2RKIA 4C1NI 1YTAA 2ITGA 1NMDA 5JS2A 4FJGA 3ID6A 1A5WA 3LPUA 1T7PA 1W0HA 1VQLN 4ICLA 4XIUA 4DTNA 4RW9A 1S3XA 2OCEA 1VQ9N 3B6OA 2FSJA 3MN9A 2P5OA 4BR4A 3V81A 1QSSA 2QWRA 1JL2A 3LAMA 4BDYA 4G1QA 4DTXA 2QWPA 2F9TA 5AZIA 3NH2A 3IFRA 5F2RA 5GAEP 2CH5A 3EZ5A 5J2NA 3LALA 4MQ3A 1TVRA 2HF3A 5GAGP 2O8FA 3VOVA 5M1KA 3S3NA 4FL9A 2YHXA 3VQCA 3NHGA 2B4JA 1OH6A 3ZSRA 3I55N 5M1OA 3CCLN 4CK3A 2JWKA 5CZ1A 2HMIA 3DRRA 4BC3A 3AA5X 1XNQK 1TAQA 4J2BA 4O44A 3K9KA 1T05A 1S1XA 3KJVA 3QIOA 3E01A 3UIQA 1TAUA 4CGDA 3DRPA 4H0PA 4DSIA 4O4GA 2QWMA 1B92A 4H0XB 1JKHA 2KQ2A 3RRHA 4IEIA 1D4XA 5LMNK 1UAXA 2A1SA 4CJRA 4BRQA 2P1JA 3RMDA 4CW7B 1TK0A 2X74A 3SJHA 3FZHA 5JMVA 5M1NA 3DWLA 3L4QA 4JLHA 1Y97A 4PL8A 4IG0A 2FC0A 5AR0A 4U7BA 1C0TA 2OZSA 4YHHK 1ZXOA 3AA3A 3ISNC 3ZT1A 4DV5K 3H1QA 4CD1A 1LAWA 2P9PB 2AA4A 3L2UA 2Z1GA 4KV8A 3RR7A 3DXKA 1BGXT 3IG1A 1NOYA 4KRFA 4W5RA 1SKSA 4B8CA 1T6DA 4DR7K 2V52B 3SQ4A 3P83D 4TSXA 3NBPA 2NNWA 2D0PA 1RBTA 3VEXA 3V9WA 1LW0A 2BTFA 5AZIB 4JI5K 1RILA 1UA1A 2ATQA 3CPEA 3C6TA 1GLCG 1IJJA 4FJJA 1VQMN 4QAGA 3ZX3A 1S1WA 2XY7A 2B5JA 3THWA 3SLCA 1W97L 1U2VB 3KK1A 3ATUA 4KI4A 3BP8A 4JK8A 1HNWK 4DUYK 5JS1A 4PQUA 2IDOA 5KPRA 3RR8A 4FJXA 4GV6A 2VG6A 3O4QA 4I7FA 4DQIA 3AA2A 5I42A 3FE1A 3MN7A 3P31A 3KWGA 1Q81O 4E1MA 3D45A 1X3MA 3LM2A 4ISGA 4JK7A 2YHYA 1S22A 3AVHA 4FWRA 3MECA 1YITN 5K14A 4K8ZA 4FZXC 4IO8A 1NK5A 3SUQA 3PLAA 4K8XA 2Y1JA 3TSUA 4GV3A 1X3NA 1U47A 3EY1A 4M3YA 3O1WA 4CBXA 3LZJA 4HTLA 3K57A 3PIPL 5FLXO 3O9UA 2XY6A 1SS6A 2YX6A 1NLVA 4H0OA 3VGLA 4AHRA 1E3MA 2RE2A 4Z4IA 4B3RK 3AO4A 1M1KO 1BISA 2ETJA 1EWRA
chains in the Genus database with same CATH topology
4XH4A 2Q2RA 4IJAA 3CCVN 2I7PA 3L0QA 1NGEA 4O8UA 3VMFB 1JJ2M 4CZIA 2A5XA 2NZTA 5BPNA 3T7ZA 1Z6RA 3LDNA 1JCFA 5JVHL 2P9NA 4FWPA 1X9JA 3ZETB 3FLCO 3D2EA 4CZHA 1YI2N 2WBNA 1K8AO 3VESA 1ZC6A 1BDGA 2NLXA 3GOIA 3ULEA 4JAXA 1YJNN 1XUPO 4H0TB 1DEJA 4M7XA 3AAQA 2E88A 5AQWA 4L3QA 4GY2B 4QS7A 5AQHA 3HRGA 3QBXA 4IOXA 5BPLA 5FPDA 3LM9A 4A57A 4IZ9A 5AFUH 1T3VA 3CCJN 3N4PA 2NRZA 4JKAA 5LJWA 2GEMA 2VGMA 4H03B 1JCGA 3EE9A 3W3DA 5GIOA 3G4SN 4E1JA 1Q7YO 3ZEUB 4A2BA 5AQFA 2ZGZA 4K25A 1GLJO 3BUZB 5KQ8A 2ZJRL 3TPQA 5LJVA 1NGBA 3OW2M 2ZWHA 2E20A 2BUPA 4QS9A 3CC2N 4CD3A 5HOOA 1SZ2A 1KC8O 5BN9A 2PFUA 3JXUA 1BA0A 5AQLA 4NLBA 3ZX0A 4DHYA 3CMAN 2QA4N 1RFQA 1VQ4N 3C7NA 3M5RA 4H0VB 3CQYA 2ZGYA 4ISFA 5AQIA 1NM1A 4IOCL 4KBOA 2P9IA 5JLHA 3IDHA 5AQMA 4KH6A 4YOYA 3C0BA 2NRHA 2P9UB 3H1VX 3TU5A 1YXQA 1QHAA 4NB4A 3VEOA 1ZBSA 3VTIA 4JKDA 3FZKA 2ZJPL 3VTHA 4BRHA 4WQ4C 5C0YA 4XH1A 2FXUA 3HZ6A 3J8AA 3HTVA 5JLFA 1Y64A 2HSTA 2WC9A 4A62A 3ATVA 3R3LA 5EX5A 1K9MO 3QBWA 2P9KB 4H5RA 3ZETA 2QWOA 2OTLN 2WFBA 5AZJB 2KLAA 5AQRA 3U9ZA 1YVNA 3VETA 4WQ5A 3TTCA 4AF1A 3H46O 4BR7A 5I9EB 1XC3A 3H6EA 5E26A 2A6AA 3CC4N 3OBYA 2IVOA 1YJ9N 5AZJA 1VQ8N 3BF3A 3KWIA 4BRMA 4M63C 5BRHA 5AQZA 4MO5A 3U8XA 2ITMA 4CZJA 3HOSA 1BWFO 3CJAA 1GLEG 5BRFA 1NWKA 3FZLA 1MDUB 4IFEA 1YF5L 4CBUA 3VEZA 3VF2A 3G71N 2YCHA 3WXIA 2YJEA 1NJIO 3VERA 1HKCA 5KPTA 1MWMA 2HMPA 1RDWX 2D0OA 4FSVA 3ZEUA 1HUXA 2HF4A 4FWNA 1Q82O 3HOTA 1HJOA 4MO4A 3O4WA 2PBDA 3O6WA 4JNEA 1NGGA 1YAGA 3KHYA 4BC2A 1KAYA 4FOIA 3I8BA 3CF5L 3PIOL 2HBJA 3FGUA 3QB0A 1C0GA 3SMSA 3O9TA 4CZFA 5BN8A 2FF6A 3WXMB 4QS8A 3KK7A 4GVEA 3I33A 3C6HA 5EOYA 3R1XA 3EL2A 3T69A 3QMLA 5CR4A 3DXMB 3MMVA 3OHRA 4RCHA 3DXMA 1BU6O 1JCEA 2Q0RA 2OTJN 3MN5A 1DGKN 4BRDA 4YDUC 3GL1A 4RTFD 3H3OB 2UYTA 2HOEA 3CI5A 3C6AA 3MCAB 3ZX2A 4BR5A 4WFNL 4Z94A 3G25A 2V51B 3DJCA 1QQOA 3HI0A 4FO0A 4JHDB 4BG9A 4K43A 3CJCA 3EO3A 5M1QA 1VQ7N 5DM6L 2WUSA 3EN9A 5AQVA 3CPWM 2IVPA 3H45C 1VQKN 3TSPA 3UB5A 2HBLA 4FPBA 3AGRA 2YHWA 3TTDA 1VAZA 3UKRA 4BC5A 1BOTO 3L4IA 5GAHP 4PHTX 2QXLA 1GLDG 3BF1A 3IUCA 4H0YB 1M90O 4C1NK 3WUHA 4BG8A 3S41A 3D7EO 3CC7N 3ZYYX 4Y0WA 3WQTA 3HM8A 3CERA 2E2QA 2P9IB 1MWKA 2Q31A 4YOWA 1SQKA 4JK9A 2P9LA 1OVYA 3O9RA 1J6ZA 3CETA 2CGKA 4B1YB 3QICA 4CZGA 4U67L 5B8HA 4NLCA 1P90A 2A3ZA 1HKGA 1H1VA 3SK3A 1KQSM 3VEVA 4EHUA 2P9SB 3E9OA 3EE8A 4FOEA 1V4SA 2GELA 4H5WA 4JKGB 4BGBA 4CZKA 3CMEN 1N8RO 3R6MA 3UKUB 3WQUA 4BVOA 3L6QA 4DB3A 2D4WA 1R59O 5AQQA 4FVUA 2KHOA 1NGAA 5E84A 3O9SA 1W2BM 2HBKA 3UKUA 3IKMA 2RHKA 4WQ5C 3D2EB 3LL3A 2QEXN 3UKRB 1GLFO 4CBWA 1WOQA 5CHIA 2V7YA 3WXJA 1YHQN 3VGKA 3QDKA 3LDPA 4CJ7A 3OA9A 3CJ1A 2IIRA 4WQ4A 2NRRA 2QM1A 1ATRA 4BRGA 4BR0A 3CCMN 4MDBA 5AQPA 1ATSA 4WFAL 4JHDA 2H3GX 4CI6A 3SAHA 1QVGM 1TYQA 3WXKA 3O9QA 5M1PA 3VGMA 4B1ZA 4BQLA 2GTDA 3AY9A 5FPMA 2P9SA 3FZMA 4JKGA 4PKIA 1U2VA 4BREA 3O1BA 1LOTB 5BPMA 5DM7L 1SAZA 3CJBA 5KPZA 5JVGL 4ILJA 2VGNA 4H5NA 4I6MB 2P9NB 2QTDA 2NRTA 1G99A 1LCUA 1QVFM 1EO1A 2GWJA 2E1YA 4PKGA 2CGLA 1QZ5A 5AQNA 4A5AA 2PAVA 1V4TA 3P38A 1YUWA 3MK6A 4C1NI 4A61A 4WF9L 4BRIA 4B1XB 2HBMA 1NMDA 4BROA 2Q97A 3ID6A 4LC9B 3ULEB 5H1SQ 2GWKA 1VQLN 3VF4A 3CCQN 1YIJN 4BR9A 3KZBA 2E2NA 1S3XA 3LDQA 3M3ZA 3G6EN 1VQ9N 3CJ7A 4EIAA 1KAZA 2Q36A 3MWPA 3SBTA 5FPEA 4H5TA 2V7ZA 3CCRN 2FSJA 3MN9A 5TKWA 4BR4A 1BA1A 2W40A 2QWRA 3TTFA 2J4RA 1NGFA 4B9QA 2D1KA 5GINA 3ENBA 3F9MA 4BC4A 2QWPA 2F9TA 2GX9A 2Q1NA 4JKBA 4BRLA 5AZIA 2E1ZA 3R8EA 3RSEA 4I6MA 5ELZA 3IFRA 2FSNA 5F2RA 5GAEP 3FFKB 1ESVA 2CH5A 4B1VA 4WCEL 2ZJQL 5AFUA 2HF3A 3A5MC 5GAGP 4FWOA 4FPAA 1OKJA 2A42A 2NRXA 1TUYA 4A2AA 4RWTA 3VOVA 5M1KA 3QFUA 4EHTA 4FL9A 2YHXA 4DQ8A 4F9OA 3SBGA 4BRAA 5BREA 3FZFA 1K73O 3I56N 3A5LC 3A5OC 5BRDA 3I55N 5M1OA 4WFBL 3CCLN 1TYQB 2EWSA 3D6RA 2JWKA 4ILGB 4JKFA 2I7NA 2CH6A 2E2OA 4YOUA 5F0XA 3Q7CA 4BC3A 3R9PA 4MLEA 1C0FA 3BEXA 4IWVA 4KH4A 5AQOA 3K9KA 5JICA 1Q18A 4JD2A 1GLLO 5C15A 4JKEA 1EQYA 3CXCM 3CCUN 3NVKA 3A8YA 1WUAA 2DPNA 4IXCA 5BR9A 3MX5A 4K41A 3CCSN 2P9KA 4H0PA 3E9PA 2QWMA 2YI1A 1E4GT 3E9LA 3LDOA 3LDLA 4FWLA 4XH5A 1CZAN 4H0XB 5AQSA 3DAWA 2ASPA 1HPMA 3CCEN 3SMPA 4IEIA 4BVPA 3GE1A 1D4XA 4EFHA 1T6CA 4B1UB 2P9UA 3MCPA 4WYBA 2F7TA 1RGIA 2VWBA 4ILHA 3U9DA 5AQKA 3VEYA 4BRQA 1Q86O 4O5FA 2GUPA 2QWQA 3SJHA 3FZHA 1XQSC 5JMVA 3WEEB 4FWMA 5M1NA 3CQXA 3DWLA 4NO7A 3N4QA 4UY8O 3ENHA 4A5BA 5AQJA 3L4QA 3O8MA 4PL8A 5AR0A 3O5BA 4EAHD 4B1WB 4U7BA 1BUPA 3A0IX 1ATNA 3CD6N 4BRPA 3GBTA 1ZXOA 3RVCA 5GIPA 5F1XA 1VQPN 3E1YA 3H1QA 1K8KA 4CD1A 3J7ZO 3KVGA 4FWKA 2P9PB 1E4FT 2P9LB 2AA4A 3HSCA 5C12A 2AP1A 4A59A 3NMUA 3K9JA 4AM6A 2BH1A 1HLUA 5ADXH 1RDUA 2IVNA 2P9PA 3DXKA 3CJ9A 3EKSA 1QZ6A 3OBWA 4PL7A 5ADXA 3C65A 2QI2A 2YJFA 4DKWA 1T6DA 5M1FA 2NRVA 2V52B 2VYPA 3JS6A 4CZEA 3AGKA 3A5NC 2FF3B 4GV9A 4HWIA 4BRKA 2NRWA 2NNWA 2D0PA 3EKUA 2JWLA 3U4LA 2E8AA 3VEXA 3VEWA 3AAPA 4YDUA 5AQYA 1GLBG 2BTFA 5AZIB 4BY9C 1ILYA 3GG4A 3CPEA 5KQDA 1NGJA 1U6ZA 4K42A 4IEEA 4R79A 1GLCG 1IJJA 3AARA 3P39A 5C2DA 1VQMN 2F9WA 4H5VA 4M7YA 3ZX3A 4CZLA 1NGIA 3MWTA 3H3NO 3ID8A 5FPNA 2ASOA 3VF6A 4FWSA 5HL7L 2QWNA 3F2KA 3B8AX 3SLCA 4PKHA 3M1FA 1W97L 3MN6A 2QWLA 1QQMA 4GNIA 4IJNA 4MDAA 4MLHA 3W0LA 1U2VB 3ATUA 2CGJA 1KAXA 3D2FA 3MDQA 4BRNA 3DLLL 1T44A 1Z05A 3D2FB 4ISEA 3BP8A 2FSKA 4JK8A 4KH5A 5EY4A 4BR2A 5LY3A 2ZF5O 4OPHA 1O13A 3CHWA 5KPRA 3CIPA 1TUUA 3E66A 4JKCA 2A40A 4AM7A 5C2FA 5AQGA 3F5TA 5EVZA 3SAGA 4GV6A 1HX1A 1BO5O 3HBTA 5C10A 5GADP 2ASMA 3C7NB 4IDHA 1MA9B 3WXLA 3VPZA 3IMXA 1DKGD 3FE1A 1QQNA 3MN7A 1NGCA 3O08A 3TSQA 3VENA 3MX2A 1VQ6N 4BRFA 1NGHA 3P31A 4IO9L 1VQNN 3KWGA 1Q81O 3ENOA 1IG8A 1NGDA 2A41A 4BGAA 4C23A 3UE5A 1KD1O 2KKZA 3QFPA 1VQON 1X3MA 3LM2A 4ISGA 4JK7A 2YHYA 1S72N 1S22A 4OPAA 3WEEA 4FWRA 2QW9A 5MLCQ 4JD2B 4JN4A 3GDQA 4YOVA 1YITN 3RSEB 4IO8A 1NBWA 4CZMA 2VCPA 3EZWA 3PLAA 4IOAL 3WT0A 2FLOA 3Q7BA 1P8ZA 3O80A 3NVMA 3TSUA 4GV3A 4OO1J 1X3NA 4YORA 3O1WA 4CBXA 4J8FA 1BG3A 4BRCA 1HKBA 4O8KA 2E2PA 4HTLA 5EXWA 4YOXA 4FWQA 3PIPL 2Q0UA 3O9UA 4YOTA 1K8KB 4JEPA 3P4IA 1KXPA 1SS6A 2OANA 2YX6A 3FR0A 5AQTA 5AQUA 2W41A 1NLVA 4H0OA 4JKHA 3VGLA 4DCHA 3M6GA 3SAFA 1GLAG 4G9ZA 2RE2A 4XEIA 1YJWN 1VQ5N 4BQZA 1DT9A 5CE3A 1M1KO 3DXKB 5AQXA 5TKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  2RE2 A;  2YX6 A;  2WFB A;  2KLA A;  2QTD A;  1RDU A;  1EO1 A;  1T3V A;  1O13 A; 
#chains in the Genus database with same CATH topology
 4CJK A;  4DR1 K;  4KAZ A;  1NGE A;  2DFE A;  4CZI A;  3DLE A;  1Z6R A;  3LDN A;  1JCF A;  3SJJ A;  2I5J A;  2P9N A;  4FWP A;  2RN2 A;  4FLV A;  4DSK A;  1BDG A;  4CEC A;  3ULE A;  1XUP O;  2D0A A;  4M7X A;  3K5L A;  3OS1 A;  4LFC K;  4IOX A;  5AFU H;  2HHQ A;  1CXQ A;  3TAQ A;  4CJS A;  5LMU K;  1FKO A;  4CJL A;  4EP4 A;  5AQF A;  1NGB A;  4FK2 A;  3T3F A;  2E20 A;  2BUP A;  3CC2 N;  2BE2 A;  3OJU A;  1KC8 O;  4DTO A;  4O55 A;  4FK4 A;  1QHT A;  1N33 K;  1TKT A;  4N76 A;  3KLH A;  4DQP A;  3IDH A;  2W42 A;  3PX6 A;  4YOY A;  4KI6 A;  4FJM A;  3DLG A;  1C0U A;  3TU5 A;  1QHA A;  3OYI A;  4CF1 A;  3A2F A;  3VTH A;  3KD5 E;  3DOK A;  2YKN A;  3HZ6 A;  3J8A A;  4JS4 A;  3HTV A;  3JAM O;  3T1Y K;  1K9M O;  4HUE A;  4B9U A;  4DF4 A;  4Z4E A;  3DLB A;  2O8B B;  2QWO A;  4RW8 A;  2W6L A;  1YVN A;  3VET A;  4WQ5 A;  3TTC A;  2QKK A;  3H6E A;  2OPP A;  1YJ9 N;  1W7A A;  1IO2 A;  2ITM A;  1ZBF A;  2EHG A;  4OJR A;  1GLE G;  1VRT A;  4IFE A;  1YF5 L;  4CBU A;  4B3M K;  3G10 A;  2YCH A;  1HQU A;  2IOC A;  4M41 A;  5KPT A;  1VHX A;  2HMP A;  1L5U A;  1BIU A;  1RDW X;  4FSV A;  1HUX A;  4H8K A;  1HJO A;  5HBM A;  1VRU A;  1NGG A;  3I8B A;  1C1A A;  2PYJ A;  2BGG A;  3O9T A;  3CFR A;  2YNF A;  4KPY A;  3KK7 A;  1KFD A;  3R1X A;  1SV5 A;  3THV A;  3QML A;  4CJ5 A;  3DXM B;  3OHR A;  3DXM A;  3SV3 A;  4CIG A;  2OTJ N;  4CER A;  1N5Y A;  4DV0 K;  2RF2 A;  1WN7 A;  5KRT A;  1FJG K;  2HOE A;  4B8A B;  4F3O A;  1JLQ A;  3V9X A;  2V51 B;  1U49 A;  3KK2 A;  4EZ9 A;  3SQ2 A;  4JI0 K;  1NK7 A;  1N34 K;  3ZSY A;  3H45 C;  2ZE2 A;  4E7K A;  2HBL A;  3AGR A;  4DU1 A;  3UKR A;  4BC5 A;  1BOT O;  5C24 A;  4FLZ A;  4PHT X;  2QXL A;  1GLD G;  3IUC A;  1RCH A;  3ZSZ A;  1UOC A;  1QSL A;  3PY8 A;  4DF8 A;  2P9L A;  4ELT A;  1JXE A;  1FXX A;  4CZG A;  4CJV A;  3V1R A;  4NLC A;  4RW7 A;  4FOE A;  4WE1 A;  3DI6 A;  4H5W A;  1ASW A;  4LD0 A;  4E7I A;  4FLX A;  3L6Q A;  1R59 O;  4F2R A;  5E84 A;  3THX B;  2RHK A;  3K5M A;  2KZZ A;  3SQ0 A;  2FBY A;  1K6Y A;  2QEX N;  2XY8 A;  2FBV A;  1QQC A;  3VQ6 A;  3VGK A;  4CGF A;  5C42 A;  3VQA A;  4CJ7 A;  3OA9 A;  2IIR A;  1ZBL A;  4BRG A;  3CCM N;  4W5T A;  1ATS A;  3S3M A;  2G8U A;  1QVG M;  4E19 A;  4KHN A;  1WSG A;  3VGM A;  3ZT3 A;  3JSM A;  3AY9 A;  5FPM A;  4I2Q A;  3L2W A;  3O1B A;  3OVN A;  5KI6 A;  3NCI A;  5HRS A;  1QVF M;  1WSF A;  1EO1 A;  1WSI A;  4PKG A;  1D8Y A;  1LWF A;  1V4T A;  1RDB A;  2ZD1 A;  3HK2 A;  1EX4 A;  4B1X B;  4FXD A;  4BRO A;  1IH7 A;  3QEX A;  1Q9X A;  4HUF A;  4L8R B;  3SUP A;  3G6E N;  4B9M A;  3CJ7 A;  3O3F A;  1ZBI A;  1LW2 A;  3QIN A;  3TTF A;  1NGF A;  4W5O A;  3F9M A;  2Q1N A;  1O1W A;  3K0S A;  4BRL A;  3R8E A;  4JI8 K;  3RSE A;  5ELZ A;  3WNE A;  1ESV A;  4Z4H A;  1C1B A;  4B1V A;  4WCE L;  1S6Q A;  4C8O A;  4FWO A;  2A42 A;  2NRX A;  1TUY A;  4A2A A;  3MXM A;  4FW1 A;  2YNG A;  3QFU A;  4OX9 K;  1VSD A;  5BRE A;  5KTQ A;  3FZF A;  3I56 N;  4LY7 A;  1YVU A;  2IAJ A;  3AO3 A;  4FJN A;  1TYQ B;  2EWS A;  1S1T A;  4JKF A;  1NKB A;  1WB9 A;  3Q7C A;  3HXM A;  4MLE A;  4M42 A;  5JIC A;  4JKE A;  1EQY A;  4LFA K;  3A8Y A;  4J2E A;  4IXC A;  5BR9 A;  3MX5 A;  3CCS N;  3IS9 A;  2YI1 A;  3E9L A;  3LDL A;  4XH5 A;  4IFY A;  5AQS A;  3SMP A;  1KCF A;  3GE1 A;  4B1U B;  2P9U A;  4CK2 A;  3NGI A;  3U6F A;  4F4K A;  4WYB A;  2F7T A;  4ILH A;  4FVM A;  3OYA A;  1YTU A;  2OA8 A;  4FYD A;  4KB0 A;  3WEE B;  1BIZ A;  3CQX A;  3ZSW A;  1UA0 A;  3N4Q A;  3ENH A;  4A5B A;  4DV6 K;  2HND A;  3O5B A;  4FLW A;  2Q3S A;  4B3S K;  4CJP A;  5GIP A;  4NCB A;  5F1X A;  3OYH A;  1K8K A;  3J7Z O;  3KVG A;  3VQ5 A;  2P9L B;  4DV1 K;  4E7L A;  5C12 A;  2AP1 A;  1G15 A;  3NMU A;  1RT2 A;  3K9J A;  5ADX H;  2IVN A;  3KLG A;  3CJ9 A;  3OBW A;  4PL7 A;  5ADX A;  4CCH A;  3C65 A;  3DRS A;  2O4G A;  3MXI A;  3HT3 A;  1WSE A;  4DKW A;  2HNZ A;  2VYP A;  4C8M A;  4E7H A;  3NGY A;  4OKK A;  1NJZ A;  4DSL A;  5A2Q O;  1ASV A;  1S6P A;  2YHA A;  1TKX A;  1T03 A;  4OGE A;  5AQY A;  4BY9 C;  3OYN A;  4CF9 A;  4KFB A;  1NGJ A;  1HRH A;  3OYD A;  4OPK A;  4IEE A;  4R79 A;  4M45 A;  3AAR A;  3P39 A;  4FJ7 A;  4CJE A;  3H3N O;  3ID8 A;  4FLY A;  1S5J A;  3F2K A;  3B8A X;  4IJN A;  4GNI A;  4MLH A;  4BAC A;  3J80 O;  3DLL L;  3MDQ A;  1L3V A;  4ISE A;  4B9L A;  2FSK A;  4KH5 A;  4LH4 A;  1VK0 A;  2ZF5 O;  3LP1 A;  4OPH A;  1O13 A;  5FRO A;  3CHW A;  3E66 A;  4CGG A;  4AM7 A;  5C2F A;  5EVZ A;  3C6U A;  3F5T A;  1HX1 A;  1SUQ A;  3C7N B;  3IMX A;  3D0P A;  3TSQ A;  3MX2 A;  4BRF A;  3WNF A;  2HVI A;  3ENO A;  4C23 A;  3RMB A;  3V4I A;  3K2P A;  4OPA A;  5MLC Q;  1TL1 A;  1RTH A;  4JN4 A;  4CHO A;  4LSN A;  1WBD A;  3RSE B;  4IOA L;  4CZM A;  3EZW A;  3WT0 A;  1P8Z A;  3J81 O;  4DU3 A;  3SYZ A;  2Y1I A;  1WAJ A;  4BRC A;  2E5L K;  5EXW A;  1RT1 A;  4FWQ A;  2Q0U A;  4YOT A;  3KLF A;  4JEP A;  1KXP A;  4M3T A;  4E0D A;  4DLG A;  1NJW A;  1HPZ A;  3OJS A;  1BCM A;  3M6G A;  4HVJ A;  1GLA G;  4YFU A;  1VQ5 N;  3THW B;  5CE3 A;  3DXK B;  4HCC A;  5TKY A;  1CXU A;  1B9F A;  4OLB A;  1KVA A;  1U04 A;  4HCB A;  5IWA K;  3L0Q A;  3SUN A;  1TK5 A;  3F9K A;  1JJ2 M;  2R7Y A;  4KHU A;  5BPN A;  4CES A;  3LZI A;  5JVH L;  1XWL A;  3NAE A;  1TKD A;  2O8B A;  1Q9Y A;  5KRS A;  2UU9 K;  2WBN A;  3VES A;  2NLX A;  1YJN N;  4LF9 K;  2VWJ A;  3HYF A;  2ZQB A;  2E88 A;  4GY2 B;  5SZT A;  3THY B;  5AQH A;  4OKJ A;  3QBX A;  2EX3 A;  3AO1 A;  5CZ2 A;  5BPL A;  5FPD A;  4IZ9 A;  3KKS A;  5J2P A;  3CCJ N;  3EE9 A;  1S1V A;  3AVJ A;  4Z4F A;  4FW2 A;  3ZLJ A;  5EU7 A;  5KQ8 A;  3OW2 M;  3TAE A;  3MAQ A;  4DR5 K;  1EXQ A;  3EYZ A;  4BE0 A;  3DLR A;  5BN9 A;  5AQL A;  3VN5 A;  1BA0 A;  2KFZ A;  3ZX0 A;  3CMA N;  2QA4 N;  3T1H K;  3C7N A;  1JLG A;  1JLA A;  3M5R A;  5DMR A;  3CQY A;  1U45 A;  2P9I A;  1N36 K;  3AVK A;  4LF8 K;  3C0B A;  3H1V X;  1YXQ A;  4GVM A;  4NCG A;  1A5X A;  3C95 A;  3FZK A;  4JI2 K;  5C0Y A;  3VQ8 A;  5JLF A;  3ATV A;  3QBW A;  3M8S A;  4H5R A;  2KLA A;  4CJF A;  3CC4 N;  1XC3 A;  5FRM A;  2A6A A;  4IDK A;  5AZJ A;  3BF3 A;  1NKE A;  3DYA A;  4CED A;  3HOS A;  5BRF A;  3FZL A;  1MDU B;  3TWH A;  4DU4 A;  2YJE A;  1HKC A;  3DMJ A;  2D0O A;  3MED A;  2HF4 A;  1KSP A;  2X6S A;  4ZTJ A;  3HPO A;  2Z1J A;  3AVC A;  2PBD A;  3RTV A;  3O6W A;  3LP0 A;  1XI1 A;  3PIO L;  3OTO K;  3SMS A;  5CY4 A;  4GVE A;  3I33 A;  3CM6 A;  5EOY A;  3OYE A;  3BDP A;  3T69 A;  5CR4 A;  4RCH A;  3HO1 A;  1BU6 O;  1JCE A;  2Q0R A;  3MN5 A;  1DGK N;  4YDU C;  3GL1 A;  2UYT A;  4KHP K;  3MCA B;  4KKO A;  3C6A A;  3ZX2 A;  3G25 A;  3HI0 A;  4BG9 A;  4FO0 A;  3K5N A;  3LAK A;  4Z0U A;  4K43 A;  3VQB A;  3VQQ A;  3CPW M;  1QSY A;  3TTD A;  1VAZ A;  4Q5V A;  3P1G A;  3L4I A;  5GAH P;  4CGI A;  3BF1 A;  3WUH A;  3S41 A;  4X66 K;  3ZYY X;  3WQT A;  3HM8 A;  4HUG A;  3CER A;  4CF0 A;  1SQK A;  1RBU A;  4ZHR A;  3G0Z A;  1EET A;  4U67 L;  3AVB A;  3DLK A;  1KQS M;  4CK1 A;  1RTJ A;  3EE8 A;  4CZK A;  1V4S A;  4BGB A;  3R6M A;  4DB3 A;  2IC3 A;  2HBK A;  4FM1 A;  1VSI A;  1KLM A;  3VA3 A;  4DTP A;  1NK8 A;  2V7Y A;  3QDK A;  1IBK K;  4BR0 A;  2QM1 A;  1ATR A;  1ASU A;  4MDB A;  4CEO A;  5J2M A;  2H3G X;  3MEE A;  4ZTF A;  3J7Y P;  1HJR A;  3WXK A;  3NH0 A;  3O9Q A;  3KLI A;  3O3G A;  3CFO A;  4ELU A;  1TK8 A;  4QOZ B;  1LOT B;  5BPM A;  5DM7 L;  1RTI A;  3CJB A;  4CHQ A;  4I6M B;  2NRT A;  4F8R A;  1R0A A;  2E1Y A;  1I39 A;  1QZ5 A;  3ITH A;  3MEG A;  1HYZ A;  2HBM A;  4CJT A;  1HQE A;  3SV4 A;  2Q97 A;  4FJL A;  1DTQ A;  3VF4 A;  4CE9 A;  1WSH A;  3KZB A;  4BR9 A;  4M3R A;  4E7J A;  3QNO A;  3LDQ A;  3QEP A;  3M3Z A;  4B9V A;  2OPQ A;  3LDS A;  3NH1 A;  3CM5 A;  1GOA A;  3B6P A;  4H5T A;  5FPE A;  3CCR N;  1SL1 A;  4DQQ A;  2W40 A;  2D1K A;  3ENB A;  3JYT A;  4JKB A;  2E1Z A;  4I6M A;  5E41 A;  2BAN A;  2HVH A;  4M3U A;  1OKJ A;  1U4B A;  4FJI A;  4C8N A;  3QER A;  4EP5 A;  3NE6 A;  2YNH A;  4BRA A;  3QO9 A;  1JLC A;  1JLF A;  3A5O C;  5CYQ A;  5LL6 Z;  4WFB L;  3NDK A;  1N6Q A;  4ILG B;  2CH6 A;  2E2O A;  4CJU A;  1C0F A;  3BEX A;  4KH4 A;  4M3X A;  5AQO A;  3NVK A;  1Q18 A;  5C15 A;  3PUF A;  2YKM A;  2Z1I A;  2P9K A;  2HHT A;  1NG9 A;  4FWL A;  2D0C A;  1CZA N;  2ASP A;  1HPM A;  2KTQ A;  4FM2 A;  1T6C A;  3MCP A;  4DG1 A;  2O8D B;  3NF9 A;  3U9D A;  1RGI A;  2VWB A;  5AQK A;  1Q86 O;  4O5F A;  1RT6 A;  3QIP A;  2GUP A;  1WBB A;  4FWM A;  4GKJ K;  4NO7 A;  2P51 A;  2OPR A;  3O8M A;  1SL0 A;  4AHC A;  4EAH D;  4B1W B;  2XHB A;  3A0I X;  4LF6 K;  3AVA A;  3HST B;  1NK9 A;  2O8F B;  3GBT A;  1TL3 A;  4DFP A;  1KVC A;  3RVC A;  1VQP N;  3ASM A;  3HL8 A;  4FWK A;  1OVQ A;  3HSC A;  4GW6 A;  1RDA A;  4A59 A;  4AM6 A;  2BH1 A;  4FJH A;  1HLU A;  1RDU A;  3K5O A;  4V19 S;  3KIO A;  3HP9 A;  1C0M A;  5D3G A;  3CG7 A;  3VQ4 A;  4CZE A;  4BDP A;  1L3U A;  2FBX A;  2FF3 B;  4FLU A;  4BRK A;  2ZM6 K;  3EKU A;  2JWL A;  3KKR A;  3U4L A;  3VEW A;  1J5E K;  4YDU A;  2D0B A;  4R5P A;  4CEQ A;  4K42 A;  3TR8 A;  1C6V A;  3M8Q A;  2F9W A;  4M7Y A;  2O8C B;  4CZL A;  1NGI A;  3MWT A;  3OYC A;  5FPN A;  2XRI A;  3K59 A;  3QNN A;  4OPJ A;  3OY9 A;  5HL7 L;  2QWN A;  3TI0 A;  3I0R A;  4PKH A;  3M1F A;  3MN6 A;  1QQM A;  2VG7 A;  1XNR K;  3W0L A;  1KAX A;  3D2F A;  4BRN A;  3D2F B;  1L3S A;  5LY3 A;  2F4V K;  3CIP A;  1RT7 A;  1TUU A;  2A40 A;  3OYK A;  4BWM A;  3ZSQ A;  5AQG A;  1BO5 O;  3HBT A;  2ASM A;  3F73 A;  1NGC A;  3H08 A;  3ALY A;  4IO9 L;  4B3O A;  1BI4 B;  3L2V A;  4CHZ A;  4JV5 K;  1JLB A;  1IG8 A;  1NGD A;  4OVL A;  4BGA A;  1OH7 A;  1KD1 O;  3SPY A;  3U3Y A;  2KKZ A;  3QFP A;  1S72 N;  3WEE A;  2QW9 A;  2OPS A;  1NMN A;  5I3U A;  4YOV A;  4JI7 K;  3WNG A;  3AVI A;  4JYA K;  4B9N A;  2DY4 A;  1NBW A;  4CJ4 A;  3DM2 A;  3BZK A;  1WNS A;  2FLO A;  1XMO K;  3ZT2 A;  1HKB A;  2G8V A;  2IGI A;  1K8K B;  2UXC K;  2OAN A;  2HW3 A;  3FR0 A;  5AQT A;  3ZSO A;  2W41 A;  4JKH A;  3OYJ A;  1BQM A;  4G9Z A;  4XEI A;  4BQZ A;  4H4O A;  1DT9 A;  4XH4 A;  2Q2R A;  4IJA A;  3CCV N;  1ZYQ A;  4CIF A;  4F3T A;  4O8U A;  3RMC A;  1RDC A;  2NZT A;  4FJK A;  2KZM A;  4PUO A;  1C1C A;  5IT9 O;  2QXF A;  3FLC O;  4O0J A;  4CZH A;  4AQY K;  1KRP A;  1YI2 N;  1S1U A;  1ZC6 A;  1IG9 A;  1RBS A;  4JAX A;  2F8T A;  2A1R A;  3ZT0 A;  3V9S A;  3PSF A;  5AQW A;  4L3Q A;  4BE1 A;  3BGR A;  4M3Z A;  3LM9 A;  4FLT A;  4DTR A;  1T3V A;  3N4P A;  2GEM A;  3W3D A;  1Q7Y O;  1JCG A;  4E1J A;  4JI4 K;  4A2B A;  1T8E A;  3RRG A;  2ZGZ A;  4K25 A;  3QEI A;  1GLJ O;  3BUZ B;  2HHU A;  2ZJR L;  4N56 A;  2QKB A;  4DQS A;  2ZWH A;  1VSL A;  4DTJ A;  4QS9 A;  1SKW A;  1IKY A;  4CD3 A;  1LAV A;  5HP1 A;  3V9U A;  1SZ2 A;  3JXU A;  4NLB A;  1HNX K;  4DHY A;  4W5Q A;  3OYM A;  3VQP A;  2HHS A;  4OKE A;  1XMQ K;  4Q0B A;  4CJW A;  3C94 A;  4ISF A;  5AQI A;  4IOC L;  3RMA A;  4KBO A;  3HPH A;  1IBM K;  3NGZ A;  4LFB K;  1HR0 K;  4GMJ B;  4NB4 A;  3VEO A;  2O8E B;  4JKD A;  4BRH A;  2P5G A;  4ELV A;  5BR8 K;  3R3L A;  3T1A A;  1I94 K;  1ITG A;  3ZET A;  5SWM A;  2OTL N;  4AHV A;  5AZJ B;  4KHW A;  3H46 O;  4BR7 A;  2WTU A;  4DFJ A;  2PYL A;  5E26 A;  4BE2 A;  3HM9 A;  2AJQ A;  1LWC A;  4KHY A;  2IVO A;  3KWI A;  4M3W A;  4Y1D A;  4MO5 A;  3ZSX A;  3HVR A;  2UXD K;  3QEV A;  3THY A;  1NWK A;  4OLA A;  3VEZ A;  3VF2 A;  3G71 N;  3WXI A;  3SPZ A;  1MWM A;  3ZEU A;  4AHS A;  4Y1C A;  4FWN A;  1J54 A;  1SL2 A;  4MO4 A;  4IBN A;  3O4W A;  1D9D A;  3HJF A;  3KHY A;  4BC2 A;  1KAY A;  3CF5 L;  3FGU A;  1C0G A;  4CZF A;  4DR6 K;  4QS8 A;  4DTM A;  2YV0 X;  3C6H A;  2E6M A;  1J53 A;  3MMV A;  4LF7 K;  3THX A;  4J2A A;  2G8K A;  3I0S A;  2Z1H A;  4RTF D;  3H3O B;  4CFD A;  4WFN L;  3KTQ A;  3DJC A;  2DTU A;  1HMV A;  3CJC A;  5M1Q A;  3NFA A;  1VQ7 N;  4DV7 K;  4DFM A;  2WUS A;  1HNI A;  2IVP A;  5FRN A;  1VQK N;  3TSP A;  1NKC A;  4LF4 K;  2YHW A;  4C8L A;  1NK6 A;  3ZCM A;  4PA1 A;  4H0Y B;  3ULD A;  4C1N K;  4BG8 A;  4FJ8 A;  3D7E O;  2UUC K;  3CC7 N;  4Y0W A;  4DTS A;  3AO5 A;  2HHX A;  4DV4 K;  3VA0 A;  2P9I B;  1MWK A;  2Q31 A;  4YOW A;  3O9R A;  1J6Z A;  3CET A;  4B9T A;  2CGK A;  4B1Y B;  2KFN A;  3QIC A;  4DS5 A;  1OH8 A;  4HHT A;  1P90 A;  4CEZ A;  2A3Z A;  2HNY A;  3VEV A;  3OYG A;  2P9S B;  3E9O A;  3V1O A;  2GEL A;  4DS4 A;  3CME N;  1F21 A;  4CEE A;  1N8R O;  1S9E A;  3WQU A;  4BVO A;  2D4W A;  5AQQ A;  4CFB A;  1NK0 A;  1W2B M;  1VSH A;  3UKU A;  1VSJ A;  3IKM A;  4WQ5 C;  2KW4 A;  3D2E B;  2WON A;  3S9H A;  1WSJ A;  1TV6 A;  1YT3 A;  2E4L A;  1X9W A;  3WNH A;  4LH5 A;  3WXJ A;  3TAR A;  3BY5 A;  4NYF A;  2NRR A;  2XY5 A;  4CF8 A;  4WFA L;  3PO5 A;  4OGC A;  1HYV A;  3NF7 A;  4JHD A;  4AHU A;  1HNV A;  1SKR A;  4DR2 K;  3VQ7 A;  4DLE A;  4F2S A;  2GTD A;  2P9S A;  1JL1 A;  4H4M A;  1SAZ A;  5KPZ A;  3AVF A;  1KVB A;  4CEF A;  4DUZ K;  4N5S A;  1REV A;  3L8B A;  1KFS A;  2QTD A;  4QCL A;  1G99 A;  1LCU A;  4Z4C A;  2GWJ A;  3AV9 A;  2CGL A;  3PSI A;  4RW6 A;  4A5A A;  2PAV A;  1J9A A;  1YUW A;  3CYM A;  3MK6 A;  4A61 A;  4YY3 K;  4WF9 L;  2G8W A;  4B3T K;  4LSL A;  4BRI A;  5HRP A;  1GOC A;  3ULE B;  4LC9 B;  5H1S Q;  2GWK A;  1VSE A;  3CCQ N;  1YIJ N;  2E2N A;  4DSF A;  4B08 A;  4EIA A;  1KAZ A;  2Q36 A;  3MWP A;  3SBT A;  2HHH K;  2V7Z A;  4X65 K;  1D5A A;  5TKW A;  1BA1 A;  4B9Q A;  4DR3 K;  2J4R A;  4I9L A;  5GIN A;  1LV5 A;  4BC4 A;  2GX9 A;  2FSN A;  3FFK B;  4N41 A;  2ZJQ L;  5AFU A;  1NNE A;  1IBL K;  3A5M C;  4FPA A;  1VSK A;  4RWT A;  1S9G A;  4EHT A;  1QTM A;  4DQ8 A;  2HHW A;  2YHB A;  4F9O A;  3SBG A;  1K73 O;  3L3V A;  5DK5 A;  3A5L C;  5BRD A;  3IAY A;  3D6R A;  1N32 K;  2I7N A;  4FJ5 A;  4YOU A;  4CIE A;  5F0X A;  3R9P A;  4IWV A;  2XO7 A;  3V9Z A;  3DLH A;  2HHV A;  4JD2 A;  3CCU N;  1GLL O;  3CXC M;  1EKE A;  1WUA A;  4HTU A;  1NJX A;  2G8I A;  2DPN A;  4KTQ A;  4K41 A;  3E9P A;  1B9D A;  4DMN A;  1E4G T;  3LDO A;  3DAW A;  3QLH A;  5J2Q A;  3CCE N;  4AIL C;  4BVP A;  4I9Q A;  4EFH A;  4DR4 K;  1MU2 A;  1WLJ A;  4KO0 A;  3PX0 A;  4IKF A;  3LWL A;  2FBT A;  3VEY A;  4E89 A;  1BQN A;  2QWQ A;  2WOM A;  1XQS C;  4Z4G A;  2UXB K;  1RDD A;  1XHX A;  4DTU A;  4UY8 O;  5AQJ A;  4JI1 K;  3LP3 A;  4O5B A;  5J1E A;  2VWK A;  1Z25 A;  1BUP A;  1ATN A;  4DV2 K;  3CD6 N;  1NOZ A;  1X9S A;  4BRP A;  2BDP A;  3AVG A;  3V6D A;  3AVN A;  3E1Y A;  3U3G A;  3OS0 A;  4DV3 K;  1BL3 A;  4GKK K;  1E4F T;  3KK3 A;  2F96 A;  1J5O A;  2IS3 A;  1W9H A;  2P9P A;  3EKS A;  4CJ3 A;  1QZ6 A;  3LWM A;  1NK4 A;  2QI2 A;  2YJF A;  1CZ9 A;  4YNQ A;  5M1F A;  2NRV A;  5HRR A;  3O3H A;  4NXN K;  3JS6 A;  3AGK A;  3A5N C;  3CQ8 A;  4GV9 A;  4HWI A;  3SI6 A;  2NRW A;  1GOB A;  4O0I A;  2E8A A;  3NF6 A;  3AAP A;  1GLB G;  4CGH A;  3I8D A;  1ILY A;  3GG4 A;  1I3A A;  5KQD A;  3AVM A;  3HPG A;  1U6Z A;  3KLE A;  5C2D A;  2O8D A;  1EP4 A;  1IKV A;  4H5V A;  2ASO A;  2HB5 A;  3VF6 A;  4FWS A;  4KHQ A;  4MDA A;  2QWL A;  2CGJ A;  2YNI A;  2NUB A;  4W5N A;  3L2Q A;  1T44 A;  1Z05 A;  5T7B A;  5EY4 A;  4BR2 A;  5KGX A;  3TAF A;  4JKC A;  3PO4 A;  3SAG A;  5C10 A;  5GAD P;  1TKZ A;  4ID1 A;  2D5R A;  4IDH A;  1MA9 B;  4PWD A;  3WXL A;  3VPZ A;  3J7A P;  1BCO A;  1DKG D;  1VSF A;  1QQN A;  1VQ6 N;  3VEN A;  3O08 A;  3TAG A;  5HRN A;  4MFB A;  3ZT4 A;  1NGH A;  3SZ2 A;  4AH9 A;  1NJY A;  4DWI A;  1VQN N;  2A41 A;  2VQE K;  3UE5 A;  1RTD A;  1UWB A;  1X9M A;  2JGU A;  4FJ9 A;  1ZBU A;  1VQO N;  1TGO A;  3TAP A;  4JD2 B;  3LPT A;  3GDQ A;  3SUO A;  3O4N A;  2UUB K;  4K0K K;  3AA4 A;  2VCP A;  3Q7B A;  3O80 A;  3NVM A;  4OO1 J;  2QK9 A;  1FK9 A;  1IKX A;  4YOR A;  2VQF K;  5C25 A;  4J8F A;  1BG3 A;  4O8K A;  1RT4 A;  3OYB A;  2E2P A;  3V1Q A;  4YOX A;  2O4I A;  3LP2 A;  2JLE A;  3P4I A;  3S3O A;  5AQU A;  3AO2 A;  4FCY A;  3SQ1 A;  4DCH A;  1D9F A;  2O8C A;  3SAF A;  3PX4 A;  1YJW N;  3M8R A;  5AJ3 K;  3NF8 A;  3MXJ A;  5AQX A;  3EEQ A;  2X78 A;  3QET A;  4DSE A;  2I7P A;  1HNZ K;  3VMF B;  4KB1 A;  2A5X A;  3RWU A;  3T7Z A;  4NCA A;  2GBZ A;  1X9J A;  3ZET B;  3D2E A;  2G8H A;  1K8A O;  3GOI A;  4EZ6 A;  4H0T B;  1DEJ A;  4LF5 K;  4JI6 K;  1BI4 A;  2X6N A;  3AAQ A;  4QS7 A;  4UQG A;  1JLE A;  3HRG A;  1RBV A;  4A57 A;  4CFA A;  4CHN A;  4JRQ A;  2NRZ A;  4JKA A;  5LJW A;  2VGM A;  4H03 B;  5GIO A;  3G4S N;  4BWJ A;  3LAN A;  3ZEU B;  5FDL A;  2OZM A;  4E3S A;  4RG8 A;  3TPQ A;  4J2D A;  3PV8 A;  5LJV A;  3AVL A;  5HOO A;  3SCX A;  3L3U A;  3M8P A;  1KLN A;  3OS2 A;  2PFU A;  1FKP A;  4DSJ A;  3OYF A;  1RFQ A;  1VQ4 N;  4CEB A;  4BDZ A;  3VQ9 A;  4B9S A;  3T19 A;  4H0V B;  4CJQ A;  2ZGY A;  1IV0 A;  1NM1 A;  1U48 A;  4IFV A;  5JLH A;  5AQM A;  4KH6 A;  2RPI A;  3DOL A;  2NRH A;  2P9U B;  3VTI A;  1ZBS A;  2ZJP L;  2W6K A;  3CFP A;  4WQ4 C;  4XH1 A;  2FXU A;  4X64 K;  3TAB A;  1Y64 A;  1JXB A;  2HST A;  2WC9 A;  4A62 A;  5EX5 A;  2P9K B;  1IKW A;  2WFB A;  5AQR A;  3U9Z A;  4AF1 A;  5I9E B;  3OBY A;  1VQ8 N;  4BRM A;  4M63 C;  1ZBH A;  1Z26 A;  5BRH A;  5AQZ A;  4AHT A;  3U8X A;  4CZJ A;  1BWF O;  3CJA A;  3VQE A;  3QEW A;  1XC9 A;  4RW4 A;  1NJI O;  3VER A;  1L3T A;  4CGJ A;  3L2R A;  1Q82 O;  1NU0 A;  3OYL A;  3HOT A;  3KD1 E;  3K58 A;  5CYM A;  2VG5 A;  4JNE A;  1OH5 A;  4PY5 A;  1YAG A;  4FOI A;  2HBJ A;  3QB0 A;  1RBR A;  4E1N A;  5BN8 A;  2UUA K;  2DFH A;  2FF6 A;  3WXM B;  1XHZ A;  3EL2 A;  1RNH A;  4DFK A;  4CHP A;  3SNN A;  4BRD A;  4NYN A;  1A5V A;  3CI5 A;  4BR5 A;  2O8E A;  4Z94 A;  5HRO A;  1QQO A;  4ID5 A;  4JHD B;  4JI3 K;  3EO3 A;  4CFC A;  5DM6 L;  4KRE A;  3EN9 A;  2G8F A;  3VQD A;  5AQV A;  3HVT A;  4KHS A;  3UB5 A;  1EWQ A;  2E6L A;  4FPB A;  2LSN A;  1VSM A;  1KTQ A;  2GV9 A;  1M90 O;  2F8S A;  1DTT A;  3IRX A;  2E2Q A;  1QS4 A;  1FW6 A;  1RT3 A;  4KTZ A;  4JK9 A;  1OVY A;  4FK0 A;  3TAN A;  4KTW A;  5B8H A;  4DQR A;  3HP6 A;  2PZS A;  1WAF A;  3SK3 A;  1HKG A;  1H1V A;  1QE1 A;  4NXM K;  4EHU A;  4JKG B;  1LWE A;  2GUI A;  3UKU B;  1CZB A;  4FM0 A;  1X1P A;  4IG3 A;  4N47 A;  4FVU A;  3FFI A;  2OYQ A;  2KHO A;  2DFF A;  1NGA A;  3O9S A;  1Q8I A;  4I2P A;  4JRP A;  3BZC A;  4CEA A;  3LL3 A;  3UKR B;  1GLF O;  3P5J A;  4CBW A;  1WOQ A;  5CHI A;  1YHQ N;  3LDP A;  2B6A A;  3CJ1 A;  4WQ4 A;  3TAM A;  5KGW A;  3QES A;  4CHY A;  5AQP A;  4CF2 A;  1HYS A;  4FZY A;  4CI6 A;  3SAH A;  1RT5 A;  1TYQ A;  5M1P A;  4CVN E;  4B1Z A;  4BQL A;  1CLQ A;  4JKG A;  3FZM A;  4FZZ A;  4PKI A;  1U2V A;  4BRE A;  1DLO A;  5JVG L;  4C8K A;  4ILJ A;  3ZSV A;  2VGN A;  4H5N A;  2P9N B;  4X62 K;  4JS5 A;  5HLF A;  1BHL A;  5AQN A;  2PY5 A;  3P38 A;  2RKI A;  4C1N I;  1YTA A;  2ITG A;  1NMD A;  5JS2 A;  4FJG A;  3ID6 A;  1A5W A;  3LPU A;  1T7P A;  1W0H A;  1VQL N;  4ICL A;  4XIU A;  4DTN A;  4RW9 A;  1S3X A;  2OCE A;  1VQ9 N;  3B6O A;  2FSJ A;  3MN9 A;  2P5O A;  4BR4 A;  3V81 A;  1QSS A;  2QWR A;  1JL2 A;  3LAM A;  4BDY A;  4G1Q A;  4DTX A;  2QWP A;  2F9T A;  5AZI A;  3NH2 A;  3IFR A;  5F2R A;  5GAE P;  2CH5 A;  3EZ5 A;  5J2N A;  3LAL A;  4MQ3 A;  1TVR A;  2HF3 A;  5GAG P;  2O8F A;  3VOV A;  5M1K A;  3S3N A;  4FL9 A;  2YHX A;  3VQC A;  3NHG A;  2B4J A;  1OH6 A;  3ZSR A;  3I55 N;  5M1O A;  3CCL N;  4CK3 A;  2JWK A;  5CZ1 A;  2HMI A;  3DRR A;  4BC3 A;  3AA5 X;  1XNQ K;  1TAQ A;  4J2B A;  4O44 A;  3K9K A;  1T05 A;  1S1X A;  3KJV A;  3QIO A;  3E01 A;  3UIQ A;  1TAU A;  4CGD A;  3DRP A;  4H0P A;  4DSI A;  4O4G A;  2QWM A;  1B92 A;  4H0X B;  1JKH A;  2KQ2 A;  3RRH A;  4IEI A;  1D4X A;  5LMN K;  1UAX A;  2A1S A;  4CJR A;  4BRQ A;  2P1J A;  3RMD A;  4CW7 B;  1TK0 A;  2X74 A;  3SJH A;  3FZH A;  5JMV A;  5M1N A;  3DWL A;  3L4Q A;  4JLH A;  1Y97 A;  4PL8 A;  4IG0 A;  2FC0 A;  5AR0 A;  4U7B A;  1C0T A;  2OZS A;  4YHH K;  1ZXO A;  3AA3 A;  3ISN C;  3ZT1 A;  4DV5 K;  3H1Q A;  4CD1 A;  1LAW A;  2P9P B;  2AA4 A;  3L2U A;  2Z1G A;  4KV8 A;  3RR7 A;  3DXK A;  1BGX T;  3IG1 A;  1NOY A;  4KRF A;  4W5R A;  1SKS A;  4B8C A;  1T6D A;  4DR7 K;  2V52 B;  3SQ4 A;  3P83 D;  4TSX A;  3NBP A;  2NNW A;  2D0P A;  1RBT A;  3VEX A;  3V9W A;  1LW0 A;  2BTF A;  5AZI B;  4JI5 K;  1RIL A;  1UA1 A;  2ATQ A;  3CPE A;  3C6T A;  1GLC G;  1IJJ A;  4FJJ A;  1VQM N;  4QAG A;  3ZX3 A;  1S1W A;  2XY7 A;  2B5J A;  3THW A;  3SLC A;  1W97 L;  1U2V B;  3KK1 A;  3ATU A;  4KI4 A;  3BP8 A;  4JK8 A;  1HNW K;  4DUY K;  5JS1 A;  4PQU A;  2IDO A;  5KPR A;  3RR8 A;  4FJX A;  4GV6 A;  2VG6 A;  3O4Q A;  4I7F A;  4DQI A;  3AA2 A;  5I42 A;  3FE1 A;  3MN7 A;  3P31 A;  3KWG A;  1Q81 O;  4E1M A;  3D45 A;  1X3M A;  3LM2 A;  4ISG A;  4JK7 A;  2YHY A;  1S22 A;  3AVH A;  4FWR A;  3MEC A;  1YIT N;  5K14 A;  4K8Z A;  4FZX C;  4IO8 A;  1NK5 A;  3SUQ A;  3PLA A;  4K8X A;  2Y1J A;  3TSU A;  4GV3 A;  1X3N A;  1U47 A;  3EY1 A;  4M3Y A;  3O1W A;  4CBX A;  3LZJ A;  4HTL A;  3K57 A;  3PIP L;  5FLX O;  3O9U A;  2XY6 A;  1SS6 A;  2YX6 A;  1NLV A;  4H0O A;  3VGL A;  4AHR A;  1E3M A;  2RE2 A;  4Z4I A;  4B3R K;  3AO4 A;  1M1K O;  1BIS A;  2ETJ A;  1EWR A; 
#chains in the Genus database with same CATH homology
 4XH4 A;  2Q2R A;  4IJA A;  3CCV N;  2I7P A;  3L0Q A;  1NGE A;  4O8U A;  3VMF B;  1JJ2 M;  4CZI A;  2A5X A;  2NZT A;  5BPN A;  3T7Z A;  1Z6R A;  3LDN A;  1JCF A;  5JVH L;  2P9N A;  4FWP A;  1X9J A;  3ZET B;  3FLC O;  3D2E A;  4CZH A;  1YI2 N;  2WBN A;  1K8A O;  3VES A;  1ZC6 A;  1BDG A;  2NLX A;  3GOI A;  3ULE A;  4JAX A;  1YJN N;  1XUP O;  4H0T B;  1DEJ A;  4M7X A;  3AAQ A;  2E88 A;  5AQW A;  4L3Q A;  4GY2 B;  4QS7 A;  5AQH A;  3HRG A;  3QBX A;  4IOX A;  5BPL A;  5FPD A;  3LM9 A;  4A57 A;  4IZ9 A;  5AFU H;  1T3V A;  3CCJ N;  3N4P A;  2NRZ A;  4JKA A;  5LJW A;  2GEM A;  2VGM A;  4H03 B;  1JCG A;  3EE9 A;  3W3D A;  5GIO A;  3G4S N;  4E1J A;  1Q7Y O;  3ZEU B;  4A2B A;  5AQF A;  2ZGZ A;  4K25 A;  1GLJ O;  3BUZ B;  5KQ8 A;  2ZJR L;  3TPQ A;  5LJV A;  1NGB A;  3OW2 M;  2ZWH A;  2E20 A;  2BUP A;  4QS9 A;  3CC2 N;  4CD3 A;  5HOO A;  1SZ2 A;  1KC8 O;  5BN9 A;  2PFU A;  3JXU A;  1BA0 A;  5AQL A;  4NLB A;  3ZX0 A;  4DHY A;  3CMA N;  2QA4 N;  1RFQ A;  1VQ4 N;  3C7N A;  3M5R A;  4H0V B;  3CQY A;  2ZGY A;  4ISF A;  5AQI A;  1NM1 A;  4IOC L;  4KBO A;  2P9I A;  5JLH A;  3IDH A;  5AQM A;  4KH6 A;  4YOY A;  3C0B A;  2NRH A;  2P9U B;  3H1V X;  3TU5 A;  1YXQ A;  1QHA A;  4NB4 A;  3VEO A;  1ZBS A;  3VTI A;  4JKD A;  3FZK A;  2ZJP L;  3VTH A;  4BRH A;  4WQ4 C;  5C0Y A;  4XH1 A;  2FXU A;  3HZ6 A;  3J8A A;  3HTV A;  5JLF A;  1Y64 A;  2HST A;  2WC9 A;  4A62 A;  3ATV A;  3R3L A;  5EX5 A;  1K9M O;  3QBW A;  2P9K B;  4H5R A;  3ZET A;  2QWO A;  2OTL N;  2WFB A;  5AZJ B;  2KLA A;  5AQR A;  3U9Z A;  1YVN A;  3VET A;  4WQ5 A;  3TTC A;  4AF1 A;  3H46 O;  4BR7 A;  5I9E B;  1XC3 A;  3H6E A;  5E26 A;  2A6A A;  3CC4 N;  3OBY A;  2IVO A;  1YJ9 N;  5AZJ A;  1VQ8 N;  3BF3 A;  3KWI A;  4BRM A;  4M63 C;  5BRH A;  5AQZ A;  4MO5 A;  3U8X A;  2ITM A;  4CZJ A;  3HOS A;  1BWF O;  3CJA A;  1GLE G;  5BRF A;  1NWK A;  3FZL A;  1MDU B;  4IFE A;  1YF5 L;  4CBU A;  3VEZ A;  3VF2 A;  3G71 N;  2YCH A;  3WXI A;  2YJE A;  1NJI O;  3VER A;  1HKC A;  5KPT A;  1MWM A;  2HMP A;  1RDW X;  2D0O A;  4FSV A;  3ZEU A;  1HUX A;  2HF4 A;  4FWN A;  1Q82 O;  3HOT A;  1HJO A;  4MO4 A;  3O4W A;  2PBD A;  3O6W A;  4JNE A;  1NGG A;  1YAG A;  3KHY A;  4BC2 A;  1KAY A;  4FOI A;  3I8B A;  3CF5 L;  3PIO L;  2HBJ A;  3FGU A;  3QB0 A;  1C0G A;  3SMS A;  3O9T A;  4CZF A;  5BN8 A;  2FF6 A;  3WXM B;  4QS8 A;  3KK7 A;  4GVE A;  3I33 A;  3C6H A;  5EOY A;  3R1X A;  3EL2 A;  3T69 A;  3QML A;  5CR4 A;  3DXM B;  3MMV A;  3OHR A;  4RCH A;  3DXM A;  1BU6 O;  1JCE A;  2Q0R A;  2OTJ N;  3MN5 A;  1DGK N;  4BRD A;  4YDU C;  3GL1 A;  4RTF D;  3H3O B;  2UYT A;  2HOE A;  3CI5 A;  3C6A A;  3MCA B;  3ZX2 A;  4BR5 A;  4WFN L;  4Z94 A;  3G25 A;  2V51 B;  3DJC A;  1QQO A;  3HI0 A;  4FO0 A;  4JHD B;  4BG9 A;  4K43 A;  3CJC A;  3EO3 A;  5M1Q A;  1VQ7 N;  5DM6 L;  2WUS A;  3EN9 A;  5AQV A;  3CPW M;  2IVP A;  3H45 C;  1VQK N;  3TSP A;  3UB5 A;  2HBL A;  4FPB A;  3AGR A;  2YHW A;  3TTD A;  1VAZ A;  3UKR A;  4BC5 A;  1BOT O;  3L4I A;  5GAH P;  4PHT X;  2QXL A;  1GLD G;  3BF1 A;  3IUC A;  4H0Y B;  1M90 O;  4C1N K;  3WUH A;  4BG8 A;  3S41 A;  3D7E O;  3CC7 N;  3ZYY X;  4Y0W A;  3WQT A;  3HM8 A;  3CER A;  2E2Q A;  2P9I B;  1MWK A;  2Q31 A;  4YOW A;  1SQK A;  4JK9 A;  2P9L A;  1OVY A;  3O9R A;  1J6Z A;  3CET A;  2CGK A;  4B1Y B;  3QIC A;  4CZG A;  4U67 L;  5B8H A;  4NLC A;  1P90 A;  2A3Z A;  1HKG A;  1H1V A;  3SK3 A;  1KQS M;  3VEV A;  4EHU A;  2P9S B;  3E9O A;  3EE8 A;  4FOE A;  1V4S A;  2GEL A;  4H5W A;  4JKG B;  4BGB A;  4CZK A;  3CME N;  1N8R O;  3R6M A;  3UKU B;  3WQU A;  4BVO A;  3L6Q A;  4DB3 A;  2D4W A;  1R59 O;  5AQQ A;  4FVU A;  2KHO A;  1NGA A;  5E84 A;  3O9S A;  1W2B M;  2HBK A;  3UKU A;  3IKM A;  2RHK A;  4WQ5 C;  3D2E B;  3LL3 A;  2QEX N;  3UKR B;  1GLF O;  4CBW A;  1WOQ A;  5CHI A;  2V7Y A;  3WXJ A;  1YHQ N;  3VGK A;  3QDK A;  3LDP A;  4CJ7 A;  3OA9 A;  3CJ1 A;  2IIR A;  4WQ4 A;  2NRR A;  2QM1 A;  1ATR A;  4BRG A;  4BR0 A;  3CCM N;  4MDB A;  5AQP A;  1ATS A;  4WFA L;  4JHD A;  2H3G X;  4CI6 A;  3SAH A;  1QVG M;  1TYQ A;  3WXK A;  3O9Q A;  5M1P A;  3VGM A;  4B1Z A;  4BQL A;  2GTD A;  3AY9 A;  5FPM A;  2P9S A;  3FZM A;  4JKG A;  4PKI A;  1U2V A;  4BRE A;  3O1B A;  1LOT B;  5BPM A;  5DM7 L;  1SAZ A;  3CJB A;  5KPZ A;  5JVG L;  4ILJ A;  2VGN A;  4H5N A;  4I6M B;  2P9N B;  2QTD A;  2NRT A;  1G99 A;  1LCU A;  1QVF M;  1EO1 A;  2GWJ A;  2E1Y A;  4PKG A;  2CGL A;  1QZ5 A;  5AQN A;  4A5A A;  2PAV A;  1V4T A;  3P38 A;  1YUW A;  3MK6 A;  4C1N I;  4A61 A;  4WF9 L;  4BRI A;  4B1X B;  2HBM A;  1NMD A;  4BRO A;  2Q97 A;  3ID6 A;  4LC9 B;  3ULE B;  5H1S Q;  2GWK A;  1VQL N;  3VF4 A;  3CCQ N;  1YIJ N;  4BR9 A;  3KZB A;  2E2N A;  1S3X A;  3LDQ A;  3M3Z A;  3G6E N;  1VQ9 N;  3CJ7 A;  4EIA A;  1KAZ A;  2Q36 A;  3MWP A;  3SBT A;  5FPE A;  4H5T A;  2V7Z A;  3CCR N;  2FSJ A;  3MN9 A;  5TKW A;  4BR4 A;  1BA1 A;  2W40 A;  2QWR A;  3TTF A;  2J4R A;  1NGF A;  4B9Q A;  2D1K A;  5GIN A;  3ENB A;  3F9M A;  4BC4 A;  2QWP A;  2F9T A;  2GX9 A;  2Q1N A;  4JKB A;  4BRL A;  5AZI A;  2E1Z A;  3R8E A;  3RSE A;  4I6M A;  5ELZ A;  3IFR A;  2FSN A;  5F2R A;  5GAE P;  3FFK B;  1ESV A;  2CH5 A;  4B1V A;  4WCE L;  2ZJQ L;  5AFU A;  2HF3 A;  3A5M C;  5GAG P;  4FWO A;  4FPA A;  1OKJ A;  2A42 A;  2NRX A;  1TUY A;  4A2A A;  4RWT A;  3VOV A;  5M1K A;  3QFU A;  4EHT A;  4FL9 A;  2YHX A;  4DQ8 A;  4F9O A;  3SBG A;  4BRA A;  5BRE A;  3FZF A;  1K73 O;  3I56 N;  3A5L C;  3A5O C;  5BRD A;  3I55 N;  5M1O A;  4WFB L;  3CCL N;  1TYQ B;  2EWS A;  3D6R A;  2JWK A;  4ILG B;  4JKF A;  2I7N A;  2CH6 A;  2E2O A;  4YOU A;  5F0X A;  3Q7C A;  4BC3 A;  3R9P A;  4MLE A;  1C0F A;  3BEX A;  4IWV A;  4KH4 A;  5AQO A;  3K9K A;  5JIC A;  1Q18 A;  4JD2 A;  1GLL O;  5C15 A;  4JKE A;  1EQY A;  3CXC M;  3CCU N;  3NVK A;  3A8Y A;  1WUA A;  2DPN A;  4IXC A;  5BR9 A;  3MX5 A;  4K41 A;  3CCS N;  2P9K A;  4H0P A;  3E9P A;  2QWM A;  2YI1 A;  1E4G T;  3E9L A;  3LDO A;  3LDL A;  4FWL A;  4XH5 A;  1CZA N;  4H0X B;  5AQS A;  3DAW A;  2ASP A;  1HPM A;  3CCE N;  3SMP A;  4IEI A;  4BVP A;  3GE1 A;  1D4X A;  4EFH A;  1T6C A;  4B1U B;  2P9U A;  3MCP A;  4WYB A;  2F7T A;  1RGI A;  2VWB A;  4ILH A;  3U9D A;  5AQK A;  3VEY A;  4BRQ A;  1Q86 O;  4O5F A;  2GUP A;  2QWQ A;  3SJH A;  3FZH A;  1XQS C;  5JMV A;  3WEE B;  4FWM A;  5M1N A;  3CQX A;  3DWL A;  4NO7 A;  3N4Q A;  4UY8 O;  3ENH A;  4A5B A;  5AQJ A;  3L4Q A;  3O8M A;  4PL8 A;  5AR0 A;  3O5B A;  4EAH D;  4B1W B;  4U7B A;  1BUP A;  3A0I X;  1ATN A;  3CD6 N;  4BRP A;  3GBT A;  1ZXO A;  3RVC A;  5GIP A;  5F1X A;  1VQP N;  3E1Y A;  3H1Q A;  1K8K A;  4CD1 A;  3J7Z O;  3KVG A;  4FWK A;  2P9P B;  1E4F T;  2P9L B;  2AA4 A;  3HSC A;  5C12 A;  2AP1 A;  4A59 A;  3NMU A;  3K9J A;  4AM6 A;  2BH1 A;  1HLU A;  5ADX H;  1RDU A;  2IVN A;  2P9P A;  3DXK A;  3CJ9 A;  3EKS A;  1QZ6 A;  3OBW A;  4PL7 A;  5ADX A;  3C65 A;  2QI2 A;  2YJF A;  4DKW A;  1T6D A;  5M1F A;  2NRV A;  2V52 B;  2VYP A;  3JS6 A;  4CZE A;  3AGK A;  3A5N C;  2FF3 B;  4GV9 A;  4HWI A;  4BRK A;  2NRW A;  2NNW A;  2D0P A;  3EKU A;  2JWL A;  3U4L A;  2E8A A;  3VEX A;  3VEW A;  3AAP A;  4YDU A;  5AQY A;  1GLB G;  2BTF A;  5AZI B;  4BY9 C;  1ILY A;  3GG4 A;  3CPE A;  5KQD A;  1NGJ A;  1U6Z A;  4K42 A;  4IEE A;  4R79 A;  1GLC G;  1IJJ A;  3AAR A;  3P39 A;  5C2D A;  1VQM N;  2F9W A;  4H5V A;  4M7Y A;  3ZX3 A;  4CZL A;  1NGI A;  3MWT A;  3H3N O;  3ID8 A;  5FPN A;  2ASO A;  3VF6 A;  4FWS A;  5HL7 L;  2QWN A;  3F2K A;  3B8A X;  3SLC A;  4PKH A;  3M1F A;  1W97 L;  3MN6 A;  2QWL A;  1QQM A;  4GNI A;  4IJN A;  4MDA A;  4MLH A;  3W0L A;  1U2V B;  3ATU A;  2CGJ A;  1KAX A;  3D2F A;  3MDQ A;  4BRN A;  3DLL L;  1T44 A;  1Z05 A;  3D2F B;  4ISE A;  3BP8 A;  2FSK A;  4JK8 A;  4KH5 A;  5EY4 A;  4BR2 A;  5LY3 A;  2ZF5 O;  4OPH A;  1O13 A;  3CHW A;  5KPR A;  3CIP A;  1TUU A;  3E66 A;  4JKC A;  2A40 A;  4AM7 A;  5C2F A;  5AQG A;  3F5T A;  5EVZ A;  3SAG A;  4GV6 A;  1HX1 A;  1BO5 O;  3HBT A;  5C10 A;  5GAD P;  2ASM A;  3C7N B;  4IDH A;  1MA9 B;  3WXL A;  3VPZ A;  3IMX A;  1DKG D;  3FE1 A;  1QQN A;  3MN7 A;  1NGC A;  3O08 A;  3TSQ A;  3VEN A;  3MX2 A;  1VQ6 N;  4BRF A;  1NGH A;  3P31 A;  4IO9 L;  1VQN N;  3KWG A;  1Q81 O;  3ENO A;  1IG8 A;  1NGD A;  2A41 A;  4BGA A;  4C23 A;  3UE5 A;  1KD1 O;  2KKZ A;  3QFP A;  1VQO N;  1X3M A;  3LM2 A;  4ISG A;  4JK7 A;  2YHY A;  1S72 N;  1S22 A;  4OPA A;  3WEE A;  4FWR A;  2QW9 A;  5MLC Q;  4JD2 B;  4JN4 A;  3GDQ A;  4YOV A;  1YIT N;  3RSE B;  4IO8 A;  1NBW A;  4CZM A;  2VCP A;  3EZW A;  3PLA A;  4IOA L;  3WT0 A;  2FLO A;  3Q7B A;  1P8Z A;  3O80 A;  3NVM A;  3TSU A;  4GV3 A;  4OO1 J;  1X3N A;  4YOR A;  3O1W A;  4CBX A;  4J8F A;  1BG3 A;  4BRC A;  1HKB A;  4O8K A;  2E2P A;  4HTL A;  5EXW A;  4YOX A;  4FWQ A;  3PIP L;  2Q0U A;  3O9U A;  4YOT A;  1K8K B;  4JEP A;  3P4I A;  1KXP A;  1SS6 A;  2OAN A;  2YX6 A;  3FR0 A;  5AQT A;  5AQU A;  2W41 A;  1NLV A;  4H0O A;  4JKH A;  3VGL A;  4DCH A;  3M6G A;  3SAF A;  1GLA G;  4G9Z A;  2RE2 A;  4XEI A;  1YJW N;  1VQ5 N;  4BQZ A;  1DT9 A;  5CE3 A;  1M1K O;  3DXK B;  5AQX A;  5TKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...