4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
3AV9A 3AVCA 3THVA 1LWFA 3ZCMA 1JLCA 4CJ5A 3KLGA 3RRGA 3HM9A 4M3TA 3K2PA 4RW9A 4Z0UA 4CEZA 4W5TA 1J54A 4FJ8A 3SV3A 4CK1A 2PYLA 4ZHRA 4B8CA 4CJEA 3ZSXA 4DSLA 4IKFA 2IAJA 1BI4A 1C1BA 3OY9A 1J53A 2HVIA 4FJ9A 4CIEA 3AVBA 4N41A 4M3RA 4KI4A 1S5JA 4KHYA 3OYAA 3QNOA 1LW0A 3DYAA 4KB0A 3HYFA 2QKKA 4AHTA 4FLXA 3TABA 4B9VA 3V9ZA 3I8DA 4DTRA 1SKSA 3ZSWA 4CJUA 3TI0A 1I3AA 3DLHA 4CFCA 3LP0A 4C8NA 4E3SA 2OPQA 2ITGA 3BGRA 2VWKA 1F21A 3MAQA 3P83D 4XIUA 4FLWA 4FXDA 4ID1A 2E6LA 1BCOA 4DLGA 3OYHA 4GVMA 3OYKA 3SQ1A 1D8YA 3OJSA 3F73A 3PX6A 2QKBA 1DTQA 4F3TA 2XRIA 2HMIA 3T19A 1B92A 1S9EA 3KKRA 4O55A 1X1PA 2E4LA 3WNFA 4CFAA 3B6PA 1SL1A 1LV5A 1RCHA 1LWEA 3V1OA 3VQ7A 2KZZA 3SYZA 1YT3A 4PQUA 3K5MA 4N47A 3NCIA 1RBSA 4CF1A 4C8LA 1W9HA 3VQ6A 3ULDA 4JRQA 1QTMA 2WONA 3VQ8A 4EP4A 3MEDA 3PO5A 4F2RA 4E7JA 3OYCA 4NCAA 4PA1A 3TANA 4KTZA 4CJTA 3BDPA 1S1VA 4DTXA 2R7YA 1VSDA 1TVRA 3FFIA 1BHLA 3L3UA 2PZSA 4O44A 2P5OA 1RDDA 3WNHA 3AO2A 3CG7A 3HVTA 1GOAA 5FDLA 3K57A 4DG1A 4DQSA 3ZSYA 2KFNA 4R5PA 1BQMA 4J2DA 3MEEA 1TAQA 5T7BA 2YNGA 4BDZA 1LWCA 1BIUA 3ASMA 1KLMA 4IG0A 4CGDA 4CJRA 3M8SA 3L2UA 3T3FA 4YNQA 3TARA 4K8XA 2BDPA 2XHBA 1J5OA 4W5NA 3AA5X 3AO1A 1NOYA 4NCBA 3CFPA 3MEGA 1N6QA 1HRHA 1RBUA 1U04A 3AVHA 2IS3A 1YTAA 3NAEA 4KHWA 2KTQA 3JSMA 3DRPA 4JRPA 3OYDA 1NK9A 1X9SA 4DSFA 3HP9A 3OS1A 3IS9A 3LP1A 3NGYA 3LAKA 3OS2A 4DFKA 4KV8A 4G1QA 3G0ZA 4RW4A 4C8KA 1QSYA 4OKEA 3HK2A 2YHBA 2W42A 4B8AB 4H8KA 5J2PA 1U48A 1JKHA 3LZJA 2ETJA 3MXMA 4DQRA 4M45A 3VQDA 4PWDA 3S3MA 1A5WA 1ASUA 4CFBA 3F9KA 2G8UA 4BDPA 4AH9A 1TKTA 2IDOA 3ZT3A 4FLZA 3SQ2A 3L2VA 1NKCA 1WAFA 3TWHA 1LAWA 4DQQA 3AO4A 1RDAA 1QSSA 4BWJA 5HRPA 5J2NA 4J2EA 1RBVA 4CJLA 4OPJA 3OYFA 2OZMA 3HXMA 1T03A 4FLVA 4NYFA 1KFSA 3OJUA 4B9LA 3L3VA 5SZTA 2DY4A 3DRSA 4CJFA 5JS2A 1EXQA 1IKVA 3LPTA 3VQCA 3KLEA 3OYNA 3MXIA 3SNNA 4FLUA 4AILC 1CZ9A 4CERA 1NKBA 3ZSQA 1JLFA 3G10A 1WLJA 1XI1A 1RTIA 1BIZA 3QERA 4B9SA 1XWLA 2LSNA 4FJMA 1HPZA 1U4BA 1VSHA 2I5JA 2F8TA 4I9QA 3CFRA 3PY8A 1TV6A 1ZBUA 2P1JA 3I0RA 3EZ5A 3S9HA 1TK8A 1U47A 1HJRA 5FROA 1CLQA 3AO3A 4DTOA 3AVMA 3VQBA 4CGFA 3V4IA 1WAJA 1HMVA 4ID5A 4KAZA 2A1RA 3NDKA 1R0AA 4HHTA 4DS4A 4WE1A 3VQQA 3RMDA 2YHAA 4OPKA 5C24A 2G8FA 4OGCA 1VSFA 4CJQA 2P5GA 3EYZA 3OYBA 4AHUA 3KK1A 4KHNA 2Z1IA 1RNHA 3B6OA 4LH4A 2X74A 1L5UA 1NK7A 4I7FA 3NHGA 3LDSA 3TAQA 3QEVA 4QOZB 1TKZA 1VRTA 4DWIA 4CHNA 2Z1HA 4BWMA 3PV8A 3OYIA 2EX3A 4CGJA 3KLIA 1U49A 3CYMA 2HW3A 3S3OA 4ZTFA 4Z4FA 1JXEA 1NK8A 4FJ5A 1S9GA 3NF9A 2VG7A 3RTVA 2F96A 4OLAA 1NJYA 4E19A 3SCXA 3O4NA 4F3OA 3OVNA 1LAVA 3NBPA 5CYQA 1VSEA 3DLEA 4E1NA 4OKKA 3M8PA 4FJ7A 3CM6A 2XY6A 2QK9A 3MXJA 4FLTA 4Z4IA 4MQ3A 1T05A 4H4MA 1N5YA 2OA8A 3RR7A 4J2BA 1RILA 4HUEA 3SPYA 5I3UA 1NK0A 4FJGA 4FVMA 1Z25A 4FW2A 1RTDA 4M3WA 1NOZA 1W0HA 4AHVA 4RG8A 2IOCA 4FZYA 1KLNA 1ZYQA 1D9DA 4DTNA 4DTMA 1XHXA 4CF2A 4Q0BA 3WNGA 5HP1A 1TK0A 4Y1CA 3SV4A 4B9TA 1UWBA 1KTQA 4IFVA 1TAUA 1JLEA 3D0PA 1L3UA 2YKMA 3VQEA 4LSNA 4MFBA 2JLEA 4KRFA 1JL1A 1NK5A 3WNEA 4CJKA 3TAPA 4KI6A 3O3GA 1Q8IA 2FBYA 3MECA 4ICLA 3V9SA 4E7HA 1B9FA 2OPSA 4LSLA 3QEIA 1C1CA 2B6AA 4FW1A 4KTQA 4AHCA 3KLFA 3C95A 1UAXA 4NCGA 4CF8A 1UA1A 4M42A 4EZ9A 1YVUA 3DOLA 1UOCA 2VWJA 1L3VA 3K5LA 1RDCA 5HROA 2BANA 4IG3A 5K14A 4O0IA 4B3OA 2GUIA 4LY7A 1JXBA 4CHYA 5D3GA 4KHUA 3SPZA 4DU3A 3A2FA 1TL1A 4KTWA 4PY5A 4FJXA 1RT4A 3DLKA 4RW6A 4N5SA 1NK6A 1X9MA 3CQ8A 3AA2A 1HYZA 2B4JA 2X78A 3AA4A 4KO0A 1ASVA 1WNSA 2HHSA 4QCLA 4Z4EA 3HPGA 3OYEA 2DFHA 4J2AA 4CEEA 2DTUA 2KFZA 4PUOA 1EETA 3QLHA 3VA3A 3ZT4A 1A5VA 5HRRA 3T1AA 3RMCA 4CK3A 2BGGA 1CXQA 1XC9A 3TR8A 3U3YA 4FCYA 3QIOA 4DFJA 4CFDA 3AO5A 3NH1A 4FZZA 2FBVA 2HHTA 4Y1DA 4E7LA 3CM5A 1KRPA 2F8SA 3AVAA 4BDYA 1C0MA 5KGWA 2VG6A 4DSEA 2AJQA 4BACA 2HNYA 3HSTB 3HVRA 4F4KA 3PX0A 2HHVA 4Z4CA 5EU7A 1YTUA 3DLGA 4FJJA 1GOCA 5CYMA 3LWLA 3EY1A 4FM2A 5JS1A 1BGXT 3AVLA 2O4GA 4B9NA 4RW8A 1LW2A 3SJJA 3KLHA 1RT5A 4C8OA 1ZBFA 4DU4A 2GBZA 2G8HA 4DSIA 1NJZA 4FJNA 4CHOA 3L2RA 1BISA 3JYTA 4N76A 4CK2A 3P1GA 2DFFA 4O5BA 1HQUA 1KFDA 1WSJA 5CZ1A 3HO1A 4TSXA 1RT2A 4FJIA 2VG5A 2P51A 1QS4A 2YNIA 3AA3A 3AVFA 3C6TA 3P5JA 3QINA 5DK5A 3NGIA 4DTPA 2OZSA 3V9XA 2ZQBA 2G8VA 4DQIA 3PX4A 3TAMA 1HYVA 4EP5A 3LPUA 3TAFA 2HHQA 1TKXA 3KD5E 3RMBA 1WSEA 1TL3A 2XY7A 4B08A 3HT3A 4LH5A 4KPYA 3NF6A 3E01A 5DMRA 4C8MA 1HQEA 2Z1JA 1IKYA 3AVIA 4OKJA 5E41A 3LZIA 4FJHA 3HL8A 4HUFA 1L3TA 5KGXA 4JS4A 5SWMA 3ZSRA 1Q9YA 3PO4A 3RWUA 3DMJA 2E6MA 2IC3A 3VQ5A 5KRTA 3L2WA 2D5RA 1T7PA 1IG9A 2PYJA 4KHSA 1DLOA 4KKOA 4ZTJA 3NFAA 1WSIA 4DFMA 4CGHA 2X6NA 1TKDA 3OYGA 4CECA 1CZBA 1JLQA 3AVNA 1S1TA 3QEWA 1RT6A 5FRMA 1FXXA 4N56A 4F8RA 4E0DA 3IRXA 3ZT0A 1G15A 1XHZA 4QAGA 1NKEA 1SUQA 4E1MA 2A1SA 3HPHA 4FK2A 4W5RA 3C94A 3VA0A 4CEBA 3V9UA 1RDBA 4Z4HA 1RBTA 1EX4A 1L3SA 3AVKA 4DQPA 4GW6A 4KHQA 4O0JA 3CFOA 4L8RB 3QO9A 1HNIA 1S1WA 1BL3A 3O3HA 4FM0A 4YFUA 5FRNA 4OGEA 1ASWA 4M3ZA 1QE1A 1WSGA 3QEXA 1SKWA 2O4IA 4DF4A 2NUBA 3SUOA 2Y1IA 1S1XA 3LWMA 1JLAA 3QESA 1KVAA 3ALYA 3LP3A 1S1UA 3DOKA 4FJLA 1VSIA 3DI6A 4E89A 3V9WA 3QNNA 2FC0A 5KI6A 4CHPA 5J2QA 4FJKA 2HVHA 5J1EA 3KK3A 3V6DA 5KRSA 2D0BA 4CJPA 4OLBA 2D0CA 5KTQA 2WOMA 3ZSZA 3M8RA 4CJ3A 4E7KA 1D5AA 4W5OA 1K6YA 3DLRA 2QXFA 1WSFA 4OJRA 1SKRA 5C42A 4CEDA 2ATQA 1EP4A 4BE1A 3SZ2A 3SUNA 3K5NA 4HCCA 1Z26A 1VSLA 3DRRA 1BQNA 4DFPA 3TAEA 3LP2A 1D9FA 3KK2A 3V1RA 2KQ2A 3SI6A 3U3GA 5C25A 1NK4A 1FKOA 2X6SA 3KKSA 4CF0A 3SQ4A 4BE2A 2HHUA 3C6UA 4H4OA 3HP6A 2HNDA 4FZXC 3KIOA 1SV5A 1X9WA 3IG1A 4DSJA 3DLBA 3NH2A 2YNHA 3LANA 1RTJA 4CESA 1QHTA 3VN5A 1S6QA 2RN2A 3VQ4A 3NH0A 1A5XA 2OPPA 1GOBA 3D45A 1VSKA 3H08A 4CEOA 3K58A 2OYQA 3K59A 3UIQA 2YNFA 3ZT1A 1Q9XA 4I2PA 1RBRA 2OPRA 1VSMA 4UQGA 4Z4GA 1WSHA 2EHGA 4CIGA 3NF8A 1T8EA 1IKXA 3L2QA 4M3UA 3IAYA 3KJVA 2XY5A 4CEQA 4KREA 3OYMA 4DMNA 1JLGA 1JL2A 3VQ9A 3S3NA 4IDKA 4F2SA 5CY4A 4AHRA 1C0TA 1BCMA 4CGIA 1RTHA 4W5QA 1UA0A 4DSKA 4FK4A 1FKPA 1C6VA 4CF9A 1IO2A 1C1AA 4Q5VA 2Y1JA 3VQAA 1IH7A 4FM1A 2YKNA 2ZE2A 3ZT2A 1SL0A 1REVA 3LAMA 4IFYA 4CEAA 1O1WA 2G8WA 3KTQA 1JLBA 2HB5A 2GV9A 4I2QA 4BE0A 3TAGA 4HCBA 1VK0A 4ELTA 1Y97A 4M41A 1ZBIA 4O4GA 4CCHA 4CJ4A 4CJVA 2HNZA 3ISNC 4DTJA 4GMJB 1HNVA 4B9MA 1RT3A 4ELVA 2G8IA 1I39A 3L8BA 2RPIA 3V1QA 3RRHA 1EKEA 3KD1E 1B9DA 5I42A 2Z1GA 1ITGA 4DTUA 1KSPA 1HYSA 4E7IA 1S6PA 4KFBA 4JLHA 5CZ2A 4IBNA 1RT7A 2ZD1A 3SUQA 1QQCA 4CHQA 3LALA 4M3YA 3SQ0A 4NYNA 1DTTA 3VQPA 1VRUA 1KVBA 3OYLA 3RR8A 4K8ZA 4CHZA 3DM2A 1C0UA 3SUPA 4CJWA 4CIFA 2HHWA 4DTSA 5HBMA 1J9AA 4HUGA 1BI4B 4AHSA 1IKWA 4CGGA 2BE2A 3NGZA 2XO7A 3AVGA 1TK5A 4HTUA 4I9LA 4EZ6A 1KCFA 2YV0X 3U6FA 4DU1A 1QSLA 1NJWA 2HHXA 3I0SA 2KW4A 3HPOA 5HLFA 2FBXA 1FK9A 1VSJA 2RKIA 3PUFA 4DF8A 2RF2A 3O4QA 4CE9A 3OS0A 1KVCA 4DLEA 1NJXA 2IGIA 3HJFA 2XY8A 4CEFA 3V81A 3NF7A 2Q3SA 4DS5A 2G8KA 1ZBHA 2DFEA 2FBTA 3ZSVA 1WN7A 4FLYA 1ZBLA 1U45A 2PY5A 4M3XA 2JGUA 1RT1A 4CJSA 2B5JA 3ITHA 3QEPA 4ELUA 3K5OA 1TGOA 1SL2A 4B9UA 4FYDA 2KZMA 4LD0A 5HRNA 4KB1A 3O3FA 1MU2A 3OYJA 4HVJA 3NE6A 3AVJA 2D0AA 4RW7A 3QETA 4JS5A 4FK0A 3RMAA 3ZSOA 3M8QA 4OVLA 1CXUA 5J2MA 5HRSA 3QIPA
chains in the Genus database with same CATH superfamily
4OO1J 3AVCA 2GEMA 5AQHA 3THVA 3ZCMA 4M3TA 3K2PA 2VWBA 4W5TA 3PIOL 3I55N 4IJAA 3SV3A 5JVGL 4DV6K 4BRDA 4ZHRA 4B8CA 4BR0A 3FR0A 3KWGA 3PIPL 2RHKA 2P9LB 3DYAA 3QFPA 3OBWA 4FLXA 4DTRA 4CJUA 4MDAA 3TI0A 3L4IA 3DLHA 3BGRA 3DXMA 1YHQN 4X65K 4JKGB 4CI6A 5AQSA 4JI4K 5A2QO 4FLWA 4FXDA 3SK3A 4DLGA 2QKBA 3SQ1A 3F73A 3PX6A 1B92A 4A57A 1LV5A 1LWEA 3V1OA 3NCIA 4C8LA 1W9HA 2WONA 3MEDA 3PO5A 4F2RA 3O9UA 4E7JA 4KTZA 4CJTA 1S1VA 4B1UB 4JKFA 1GLFO 3CG7A 3HVTA 4DQSA 4DG1A 4JK8A 4WQ4A 2VQFK 2P9LA 2YNGA 1LWCA 4BDZA 2O8BB 4CJRA 3T3FA 5KPTA 4K8XA 4FWOA 2BDPA 2XHBA 4W5NA 1HRHA 4B3SK 1U04A 1N32K 2IS3A 4JKGA 4BRNA 3NAEA 5BRDA 4YOTA 1NK9A 4JRPA 3PSIA 4DSFA 1X9SA 4DFKA 4KV8A 3CJAA 4RW4A 4YORA 2UUCK 2A3ZA 2YHBA 4KBOA 2W42A 5KPZA 3VEVA 3A5OC 3MXMA 4DQRA 4PKGA 4M45A 1HLUA 1A5WA 1ASUA 3VF4A 1NKCA 5BR9A 2D4WA 1LAWA 2E1YA 1RDAA 4BWJA 4OPJA 1NGJA 3A8YA 3OYFA 3HXMA 2A5XA 4NYFA 3CJ1A 3M5RA 4WYBA 3IUCA 1HKCA 5ELZA 2O8BA 1VQ4N 3VQCA 3KLEA 2QWRA 5E26A 5EY4A 4HWIA 4AILC 2HF3A 3EEQA 1JLFA 3G10A 3FLCO 4B9SA 1XWLA 2LSNA 1VSHA 5F1XA 3NMUA 4M7XA 1QHAA 5M1QA 3O1BA 2OTLN 3AO3A 4DTOA 3WUHA 4CW7B 3E9OA 3CIPA 3QDKA 3NDKA 3KHYA 4HHTA 3D2FB 1EQYA 4OPKA 2G8FA 1VSFA 3OYBA 3B6OA 3QEVA 1TKZA 1VRTA 4BRCA 4BWMA 3WXKA 5FPDA 4FWLA 2HW3A 3S3OA 3T69A 4ZTFA 4LFCK 4FJ5A 3RTVA 4OLAA 4X66K 3SCXA 3O4NA 4OKKA 3M8PA 3CQYA 5TKYA 1N5YA 4A62A 4DV3K 3RR7A 3PLAA 5C0YA 4K42A 4HUEA 3SPYA 1NK0A 1ILYA 1Q18A 4FW2A 4FWPA 3D2FA 4XH5A 4BRKA 4CZJA 3CCJN 1ESVA 1UWBA 2GX9A 4IDHA 4IFVA 1JLEA 3D0PA 1L3UA 4A5AA 5JLHA 1RFQA 3WNEA 4CJKA 4V19S 3MECA 4E7HA 3EZWA 4LSLA 1NGIA 4KTQA 3KLFA 1UAXA 3BEXA 2D0OA 1ATNA 4FO0A 1BA1A 1YVUA 1L3VA 1JCEA 5HROA 3H3OB 3H3NO 4IG3A 4WQ5C 4O0IA 4CHYA 5AQZA 4KHUA 4DU3A 4KTWA 4FJXA 4FWSA 4JI8K 4N5SA 5LMNK 3CQ8A 2V51B 1ASVA 2DTUA 3VA3A 3RMCA 1A5VA 1HKBA 5BPLA 4CK3A 1CXQA 3U3YA 3DJCA 1SQKA 4FZZA 2FBVA 4BREA 3AVAA 4JKEA 4IOCL 3CF5L 5EU7A 3O80A 1NGHA 1GOCA 1LW2A 4MO4A 3CJ7A 4PHTX 2UUBK 3VF6A 1HNWK 1NJZA 5LJWA 2IVPA 3O5BA 3L2RA 4CK2A 4K25A 1HQUA 4FJIA 2VG5A 3AA3A 5ADXH 5DK5A 2NRTA 3NGIA 3A5NC 3V9XA 2ZQBA 3EO3A 1MDUB 3LL3A 3TAMA 1HYVA 4CZKA 1TKXA 3KD5E 1TL3A 2XY7A 2Q31A 4LH5A 1NGCA 3E01A 5BN9A 3HL8A 3HOTA 3PO4A 3EE8A 3L2WA 5KRTA 1NWKA 4ILHA 1IG9A 4KHSA 2NRVA 5BRHA 4CECA 1CZBA 1JLQA 3AVNA 2EWSA 1S1TA 1R59O 4F8RA 2P9UB 3CETA 4FK2A 3HPHA 3V9UA 3QBXA 4M63C 1IBLK 1BU6O 3AVKA 1P90A 1NGGA 3AAPA 5FRNA 4OGEA 1ASWA 1QE1A 3QEXA 4DF4A 2Y1IA 1JLAA 1QZ5A 3ALYA 3LP3A 1NU0A 3DOKA 3OA9A 4FJLA 4E89A 2H3GX 4A5BA 4CJPA 3M8RA 5AQTA 4E7KA 5IWAK 3I56N 4ILGB 4O8UA 3EL2A 2QXFA 4OJRA 3VF2A 5C42A 4JI7K 3SZ2A 3SUNA 4HCCA 4DKWA 1VSLA 1BQNA 3TAEA 1D9FA 3O9TA 4BVOA 4WFNL 3IMXA 2X6SA 3KKSA 4CF0A 2FXUA 4BE2A 3HP6A 2P9UA 4DB3A 3LM9A 4DSJA 3DLBA 1QHTA 3JS6A 3NH0A 2YNFA 4I2PA 4UQGA 3T7ZA 4U7BA 4M3UA 2XY5A 4CEQA 3OYMA 4DMNA 3GG4A 4F2SA 3CCUN 1C0FA 4CGIA 3VEWA 4YDUA 2YHYA 2Y1JA 1FJGK 5TKWA 1V4SA 4DR1K 5AQJA 4IFYA 4CEAA 1VQPN 4K0KK 4I2QA 2NLXA 4ELTA 4M41A 1ZBIA 4O4GA 4BROA 5E84A 1I94K 4CJVA 1X9JA 2IVOA 2Q0UA 4ELVA 2G8IA 3V1QA 3RRHA 3KD1E 1C0GA 1B9DA 4DTUA 1HYSA 4E7IA 1IJJA 3U9DA 5CZ2A 3ZX3A 1WB9A 5AQLA 4NYNA 1DTTA 3VQPA 1VRUA 3WXMB 4A61A 3OYLA 4K8ZA 4H0XB 3AAQA 3HM8A 3DM2A 3TSQA 4DR5K 3MN7A 2FSJA 4CIFA 1VQNN 3C0BA 1J5EK 3J7ZO 1IKWA 2BE2A 1ATRA 1TK5A 1KXPA 4AF1A 4DU1A 2KW4A 2FBXA 1VSJA 2E5LK 1QVFM 4CEFA 4LF6K 4NB4A 3HRGA 4FLYA 2FBTA 3ZSVA 1U45A 4CJSA 1RT1A 4EIAA 3J81O 4IOAL 4BR9A 3NE6A 1GLAG 2QTDA 3SAFA 5J2MA 4ISEA 5CR4A 3RRGA 4CK1A 3VEZA 3E9PA 3OY9A 1J53A 4CIEA 3AVBA 4N41A 1N34K 4KI4A 1S5JA 1XNQK 3OYAA 1LW0A 1GLJO 4AHTA 3J80O 3TABA 3V9ZA 3I8DA 1I3AA 3ZEUB 4CFCA 3LP0A 4C8NA 4E3SA 2ITGA 2VWKA 3MAQA 5M1OA 4FJMA 2NRWA 2NRRA 1SL1A 3W0LA 2KZZA 1T6CA 4CZEA 1RCHA 4PQUA 4N47A 1GLCG 4CF1A 2RE2A 4JRQA 3E1YA 4OX9K 1NGAA 3OYCA 3H1VX 3TANA 4JK9A 4IOXA 2R7YA 1VSDA 1TVRA 1BHLA 1XMOK 3TSUA 3CC2N 5FDLA 1QQMA 2KFNA 4R5PA 1KQSM 4J2DA 1TAQA 3M3ZA 3MXIA 2I7NA 4CGDA 3E66A 3TARA 3MX2A 3ZEUA 4IWVA 1J5OA 1NOYA 3MEGA 3VGLA 3O9SA 2ZF5O 4FWRA 4DV5K 1N6QA 4CD1A 1YTAA 3HP9A 3IS9A 4DQ8A 2YJFA 3LAKA 4BRHA 3HK2A 1S3XA 3G25A 4NXNK 4IFEA 4B8AB 1JKHA 4PWDA 3VQDA 3CCSN 4CFBA 3F9KA 5FPEA 3RSEB 4JKAA 2QWOA 1TUYA 3TWHA 4BY9C 3TTCA 4DV1K 4DQQA 4QS7A 2Q1NA 3SJHA 3OHRA 4CJLA 4GKJK 1VQMN 3GOIA 5EVZA 1QVGM 1BDGA 4B9LA 3SMSA 4DHYA 1JCFA 1NGFA 3OYNA 2HBKA 5EOYA 1H1VA 2VGNA 2QXLA 1Y64A 2VGMA 2PAVA 1TV6A 1ZBUA 2P1JA 3I0RA 4EFHA 2I7PA 5FROA 2A1RA 2KKZA 4DS4A 4B1YB 2YHAA 5C24A 3FZHA 4OGCA 3RSEA 2A41A 4AHUA 4JKDA 1RNHA 1L5UA 1NK7A 4I7FA 4DWIA 4CHNA 3OYIA 4LF5K 4WFAL 4JI6K 2GWJA 4R79A 3ULEB 3KVGA 1OH6A 1YIJN 4E19A 2ASOA 4F3OA 3W3DA 3NBPA 1VSEA 1X3MA 4FJ7A 3CM6A 2VYPA 4FLTA 2OA8A 2A42A 1K8KB 3C7NB 4FVMA 4AHVA 5AZJB 4H5NA 3TTFA 4DTNA 3VGKA 1SS6A 5AQWA 4CF2A 4Q0BA 3WNGA 4Y1CA 4DV2K 3SV4A 2IIRA 2YJEA 3VQEA 2QA4N 1HNXK 1NK5A 3O3GA 1Q8IA 2FBYA 4ICLA 2OPSA 3ULEA 3QEIA 1IBKK 4M42A 2GWKA 4CF8A 3R1XA 2UU9K 4YOVA 5IT9O 4JD2B 1S72N 1RDCA 5K14A 4B3OA 5D3GA 1FW6A 2QEXN 1TL1A 2HF4A 5AFUH 1K8KA 1NK6A 3C7NA 3WT0A 3CXCM 4DUYK 1VQON 1NGEA 1X9MA 3AA2A 5AZJA 2B4JA 2X78A 1WNSA 4Z4EA 3A0IX 2DFHA 2P9KB 5HRRA 1HR0K 4DFJA 2FLOA 2E2QA 3NH1A 2HHTA 4Y1DA 1YUWA 1SZ2A 4H0VB 4E7LA 1WBBA 3CM5A 1C0MA 2O8DB 2VG6A 2HNYA 3HSTB 3HVRA 4F4KA 3PX0A 1NGBA 4BG9A 3CCEN 5AQKA 4LF9K 3MDQA 3LWLA 4C8OA 4DU4A 4DSIA 4JD2A 5CE3A 4JHDB 3WQUA 3JYTA 4N76A 3TTDA 3P1GA 2DFFA 1KFDA 5AR0A 1QS4A 3P5JA 3QINA 3AVFA 4ILJA 4XH1A 2OZSA 2HMPA 3NVMA 3PX4A 3TAFA 3VEXA 2P9KA 4B9QA 3RMBA 1ZXOA 4KPYA 3NF6A 2PBDA 3QBWA 4OKJA 1IKYA 4HUFA 4BRFA 4JS4A 3ZSRA 3CPEA 2E6MA 1T7PA 2O8DA 1NGDA 1DLOA 4KKOA 2CH5A 3F9MA 1WSIA 3NFAA 4CBWA 4CGHA 3QEWA 1FXXA 2WC9A 3ZT0A 4E1MA 3R3LA 4JHDA 1G99A 3VA0A 1RDBA 4CBUA 3CJCA 1L3SA 4DQPA 1YI2N 3OTOK 3CFOA 4NXMK 2CGKA 3QO9A 3ATUA 2WTUA 2O8EB 2O4IA 1WSGA 5H1SQ 1VQLN 2NUBA 1KAZA 3FZKA 3LWMA 3LDNA 3QESA 1KVAA 3RVCA 4WFBL 4BRIA 3VTHA 3V9WA 3FZFA 2WFBA 5J2QA 4FJKA 4BRPA 5J1EA 3V6DA 5KRSA 2D0BA 2D0CA 4CJ3A 4W5OA 1K6YA 1MA9B 5AQPA 1SKRA 3OBYA 4DFPA 3EKSA 3MN5A 3U3GA 1NK4A 2A40A 3J8AA 4H4OA 2HNDA 2QWQA 3SMPA 2KLAA 3KIOA 1SV5A 1OH8A 3NH2A 2YNHA 3LANA 4CESA 2RN2A 3CPWM 1XQSC 1A5XA 2OPPA 1GOBA 3K58A 5BPNA 2NZTA 2O8EA 1YJNN 2OPRA 1T8EA 1OH5A 1IKXA 2BUPA 3KJVA 5BRFA 4BC5A 1JLGA 3VQ9A 1MWMA 3B8AX 3Q7CA 5LY3A 1YVNA 1RGIA 3ID6A 1UA0A 3IDHA 4CF9A 2FF3B 1IO2A 1M1KO 4FM1A 4JKBA 1QQNA 1P8ZA 5AQGA 3LDLA 1T6DA 2GV9A 4KH6A 1YJWN 1Y97A 1NLVA 2HNZA 5C15A 4MO5A 4GY2B 4B9MA 1RT3A 3QFUA 4JYAK 1EKEA 1V4TA 3ZYYX 3AGKA 4BC2A 5BPMA 4YDUC 3CI5A 3SUQA 3LALA 1KD1O 3RR8A 3PSFA 4C1NI 4WCEL 4CHZA 3A5LC 4HUGA 3BZKA 1BI4B 4IEIA 4AHSA 3MK6A 2DPNA 3THXA 3AVGA 4I9LA 3SLCA 1TYQB 2YV0X 1QSLA 5HLFA 3ENOA 3PUFA 3O4QA 3HBTA 4CBXA 4CE9A 3M6GA 3NF7A 4JNEA 2G8KA 2DFEA 2JGUA 4A2BA 3AGRA 3TSPA 3ITHA 3T1HK 3QEPA 3DWLA 4FYDA 1VHXA 3QETA 3AVJA 2D0AA 4RW7A 3HI0A 1K73O 1JLCA 3MWPA 4CJ5A 4RW9A 4Z0UA 4CEZA 3U9ZA 1SAZA 1J54A 4KH5A 1N36K 3J7AP 1Z6RA 3UKRB 2PYLA 3TU5A 4CJEA 3ZSXA 4BQLA 1NG9A 3D6RA 4IKFA 2IAJA 4DCHA 3CQXA 5GADP 1BI4A 1C1BA 5FPMA 4FJ9A 2F9WA 3WXLA 4BR2A 4MDBA 4KHYA 1TYQA 3QNOA 4B3RK 4KB0A 3HYFA 2QKKA 4B9VA 3EKUA 1SKSA 3ZSWA 4Z94A 4O8KA 4JI5K 2IVNA 3P31A 2OPQA 4FSVA 3ENHA 4MLHA 4K43A 2YI1A 4FWKA 1WOQA 2E6LA 3OYHA 4JEPA 1DTQA 2ASPA 3WQTA 2HMIA 2ZJPL 3T19A 1S9EA 4O55A 3KKRA 4CZLA 1X1PA 3B6PA 4FPBA 5F2RA 1YT3A 4M7YA 3K5MA 4WQ5A 3VQ6A 3ULDA 3VQ8A 2QI2A 4PA1A 2HHHK 1LOTB 4DTXA 3CERA 3UKRA 3FFIA 1HJOA 2PZSA 2P5OA 1RDDA 2P9SB 3WNHA 4CZFA 3AO2A 1GOAA 3K57A 1BQMA 4A59A 4LF8K 3GL1A 5T7BA 2WUSA 5AQMA 1K9MO 1KLMA 3L2UA 3FZLA 4YNQA 5EXWA 5AQUA 4FVUA 2AA4A 3AA5X 3AO1A 3CJ9A 4NCBA 3CFPA 1HNZK 3AVHA 2QWLA 3GDQA 3DRPA 2ZJQL 3OS1A 4DUZK 1Q81O 4LF7K 3OS2A 2UXBK 3G0ZA 4C8KA 1QSYA 3THWB 3G71N 2NRXA 4H8KA 1U48A 3LZJA 2G8UA 4BDPA 4AH9A 1TKTA 2IDOA 1W7AA 1IBMK 3ZT3A 1NMNA 1VAZA 1OVYA 1QSSA 1KAYA 1RBVA 4CZIA 2P9SA 5M1FA 4FLVA 1KFSA 3OJUA 3R8EA 3L3VA 2DY4A 3DRSA 4CJFA 5JS2A 1EXQA 3ZX0A 1D4XA 3HTVA 3SNNA 3TPQA 1CZ9A 2UUAK 4CERA 3G6EN 1WLJA 3Q7BA 1XI1A 1RTIA 1VQ7N 3ENBA 4IZ9A 5GIPA 1HPZA 3K0SA 2I5JA 4RTFD 3CFRA 3WXIA 2JWLA 5GAEP 5GAGP 3S9HA 2NNWA 3VMFB 3THWA 3AVMA 1HMVA 4FL9A 4H03B 1R0AA 1EWQA 3VQQA 4X64K 3RMDA 3UKUB 2P5GA 3EYZA 4EAHD 2Z1IA 4LH4A 2X74A 3NHGA 1N8RO 3SAGA 3PV8A 2EX3A 3KLIA 4CJ7A 1Q86O 3CYMA 4JI2K 2Q2RA 1JXEA 2FSNA 3ZLJA 4BRMA 4C1NK 2ZJRL 2W6KA 5CYQA 3DLEA 4E1NA 2QK9A 4ISGA 2XY6A 1Q7YO 3MXJA 4Z4IA 4MQ3A 1T05A 4IJNA 4B1WB 1KAXA 4H5RA 2D1KA 2Q97A 1RILA 3CCQN 5I3UA 4FJGA 1Z25A 4M3WA 1NOZA 1W0HA 4FPAA 4RG8A 2GTDA 1KLNA 1D9DA 4B3TK 3UKUA 1XHXA 5HP1A 4DR7K 1KTQA 3LDQA 1BWFO 3V9SA 4L3QA 1C1CA 2B6AA 3BUZB 4FW1A 4F9OA 3C95A 5M1PA 4NCGA 5FPNA 3ATVA 5AQIA 2E2PA 4EZ9A 2VWJA 3DOLA 2BANA 1CZAN 2GUIA 4LY7A 3SAHA 3SPZA 4PKHA 4PY5A 1XC3A 3DLKA 1Q82O 2GELA 4CZHA 3MCAB 4H0YB 4PKIA 2E2NA 1HYZA 4KO0A 3E9LA 4QCLA 4WQ4C 4J2AA 1OVQA 2E8AA 4CEEA 4KH4A 2ZM6K 1DGKN 3O1WA 3T1AA 3ZT4A 2BGGA 1XC9A 2CGJA 3GE1A 1BO5O 4CFDA 3AO5A 5AQYA 2F8SA 4BDYA 5KGWA 4DSEA 1TUUA 4B3MK 4IEEA 2ITMA 3O8MA 3EY1A 4FM2A 5JS1A 1BGXT 1JJ2M 2O4GA 4PL8A 4RW8A 5AZIB 4PL7A 3L4QA 1ZBFA 2GBZA 3F2KA 3MN9A 1U6ZA 3VETA 4FJNA 4FWNA 4CHOA 2ZGYA 1BISA 3I8BA 5CZ1A 1WSJA 3HO1A 4TSXA 1RT2A 1YTUA 2P9IB 2D0PA 4GV6A 4DQIA 4JI0K 5CHIA 2F4VK 4EP5A 2HHQA 1IV0A 3HT3A 1T44A 2Z1JA 5E41A 3ZX2A 2HOEA 5KGXA 4JKHA 1Q9YA 3RWUA 3DMJA 3VQ5A 3C6AA 4ZTJA 1HPMA 4H5VA 1E3MA 2X6NA 3OYGA 3HOSA 2QW9A 4MLEA 1RT6A 5AZIA 5FRMA 3C6HA 4E0DA 2AP1A 2P9PB 1G15A 1NKEA 1SUQA 2A1SA 2CGLA 4W5RA 4Z4HA 3MN6A 1RBTA 1VQ8N 2QWNA 4KHPK 3NVKA 4KHQA 4BVPA 2QWPA 1HNIA 1S1WA 1BL3A 3O3HA 4YFUA 4YOUA 4BR4A 2P9IA 3UB5A 2E2OA 1YJ9N 1S1UA 1VSIA 4BC3A 3BZCA 3QNNA 2FC0A 3ZETB 3LDOA 4BRAA 4LFAK 2WOMA 5MLCQ 4UY8O 4JV5K 5AQRA 4B1VA 4YOWA 3KZBA 3DLRA 3CMAN 4WF9L 5M1NA 4CEDA 2ATQA 1EP4A 1Z26A 2BH1A 3KK2A 3V1RA 5GAHP 2KQ2A 3SI6A 5C25A 1KC8O 2P9PA 4BRLA 5LL6Z 2ZWHA 3H46O 1W2BM 4JKCA 1S22A 4FZXC 1X9WA 3D2EB 3IG1A 3AARA 3CCMN 1T3VA 3VN5A 1S6QA 5LMUK 2VCPA 3D45A 3H08A 1VSKA 4QS8A 2HBJA 3D7EO 4NLCA 5ADXA 4RCHA 5AQXA 5C2DA 5BR8K 4Z4GA 2EHGA 1OKJA 3L2QA 3CJBA 3IAYA 1RDUA 4KREA 1JL2A 3CC7N 4DR6K 4IDKA 5CY4A 3ZETA 1NBWA 4AHRA 1BG3A 1C0TA 1BCMA 2O8CB 1RTHA 4DSKA 1C6VA 3MWTA 1GLBG 1IH7A 1J6ZA 2YKNA 2ZE2A 3ZT2A 2G8WA 3KTQA 3LAMA 3LDPA 1JLBA 4BE0A 4HCBA 2OCEA 3DAWA 5AQVA 1VK0A 1Z05A 5BREA 4DR3K 1K8AO 4CCHA 4FOEA 1E4FT 4BGBA 1EO1A 3L8BA 2RPIA 3D2EA 5I42A 2Z1GA 3K9JA 1KSPA 4AM7A 1S6PA 4JLHA 5FLXO 4IBNA 1RT7A 1GLLO 2UXCK 4CHQA 4M3YA 4H0PA 3VOVA 1C0UA 4JN4A 5C2FA 3SUPA 4CJWA 2HHWA 3IFRA 4DTSA 5HBMA 3SBTA 5HOOA 2O8CA 2XO7A 4A2AA 2QM1A 2V52B 4HTUA 1BUPA 4EZ6A 4IXCA 1NJWA 2YHWA 2HHXA 3I0SA 2RKIA 4DF8A 2RF2A 3OS0A 3HJFA 2IGIA 3V81A 1HKGA 1ZBLA 2HBLA 2PY5A 4M3XA 1ZBSA 4BC4A 1TGOA 4CZGA 4LD0A 1YITN 1DT9A 4HVJA 2O8FB 4FK0A 3CCVN 3M8QA 5HRSA 4DLEA 5I9EB 3QIPA 3AV9A 1LWFA 3KLGA 3HM9A 4AQYK 3O6WA 4FJ8A 3O9RA 4YOXA 4DR2K 3CD6N 3HSCA 4BRGA 2HVIA 4M3RA 5AQFA 4YHHK 4KHNA 4IO8A 3VESA 1F21A 3IKMA 3P83D 4XIUA 4GKKK 4HTLA 4YOYA 4ID1A 1BCOA 4GVMA 3OYKA 1D8YA 3OJSA 2HSTA 4F3TA 2XRIA 4DSLA 2E4LA 3WNFA 2YHXA 4CFAA 3VQ7A 2O8FA 3SYZA 3QICA 1RBSA 4O5FA 1VQ6N 1QTMA 2NRHA 4EP4A 1HX1A 4NCAA 3BDPA 2P9NB 4NO7A 3L0QA 5JMVA 1E4GT 4BG8A 3L3UA 4O44A 3U4LA 2WBNA 4FWMA 2CH6A 3QMLA 3ZSYA 1YF5L 3MEEA 1N33K 3ASMA 1BIUA 3M8SA 4L8RB 4IG0A 3THXB 3MMVA 4DV4K 3F5TA 3WEEB 1RBUA 4KHWA 2KTQA 3JSMA 3OYDA 4JAXA 3LP1A 3NGYA 4G1QA 4OKEA 3P39A 1NMDA 5J2PA 3VENA 2ETJA 3S3MA 5AQNA 3SQ2A 4FLZA 2UXDK 3L2VA 1WAFA 2P9NA 1WUAA 3L6QA 4CVNE 3AO4A 5HRPA 4J2EA 3BF1A 5J2NA 2GUPA 2OZMA 4G9ZA 1T03A 1BA0A 5BN8A 1BOTO 5SZTA 3VEOA 1XMQK 1IKVA 3LPTA 3CMEN 4FLUA 1NKBA 3ZSQA 1HUXA 3WEEA 3G4SN 1BIZA 4DR4K 3QERA 1U4BA 2F8TA 2UYTA 4B1ZA 4I9QA 3PY8A 2W41A 3EZ5A 1TK8A 1U47A 1HJRA 1CLQA 3DXKB 3V4IA 3O08A 3VQBA 4CGFA 5HL7L 1WAJA 4ID5A 4KAZA 3J7YP 1RDWX 4WE1A 4J8FA 4CJQA 3VGMA 3KK1A 3ID8A 4XEIA 4QOZB 3LDSA 3TAQA 2Z1HA 5KPRA 4CGJA 3K9KA 1U49A 1XNRK 4Z4FA 2FF6A 3H6EA 1NK8A 1S9GA 3NF9A 2VG7A 2F96A 1NJYA 4CD3A 3OVNA 1LAVA 4DV7K 4E1JA 3VEYA 4H4MA 3CCLN 1YXQA 5F0XA 5GINA 4J2BA 3LM2A 3DXKA 3H1QA 2NRZA 2OANA 1RTDA 2IOCA 2F7TA 4FZYA 1ZYQA 4OPHA 4DTMA 1X3NA 1TK0A 4LC9B 4B9TA 1TAUA 5DM7L 3EE9A 2YKMA 4LSNA 4MFBA 2JLEA 1DKGD 5EX5A 1JL1A 4KRFA 3TAPA 1ZC6A 4KI6A 3EN9A 1B9FA 5KQ8A 5C10A 3JXUA 4AHCA 3O4WA 1UA1A 3N4PA 1VQ9N 2JWKA 1UOCA 3K5LA 2J4RA 1DEJA 1JXBA 1EWRA 3A2FA 1RT4A 3DLLL 4RW6A 1ATSA 4I6MB 2V7ZA 2W6LA 4OPAA 2YX6A 4K41A 5AQOA 3AA4A 4EHUA 2HHSA 3HPGA 3OYEA 1OH7A 2KFZA 4PUOA 1EETA 3QLHA 4FOIA 3TR8A 3OW2M 4FCYA 3QIOA 3T1YK 3UE5A 1YAGA 1KRPA 2HBMA 2AJQA 4BACA 2HHVA 4Z4CA 4H0TB 3DLGA 4FJJA 1U2VB 4GV9A 5CYMA 3AVLA 4B9NA 3SJJA 3KLHA 1WBDA 1RT5A 4IO9L 4GNIA 1XUPO 2G8HA 2E88A 4AM6A 4B1XB 4NLBA 4O5BA 1GLEG 2QWMA 2P51A 2YNIA 3C6TA 4LF4K 3QB0A 4DTPA 4I6MA 3THYB 1MWKA 2G8VA 5GIOA 4GV3A 3VERA 3LPUA 3H45C 5AJ3K 1WSEA 3FGUA 4B08A 2W40A 4C8MA 5DMRA 1QZ6A 5JLFA 1HQEA 3AVIA 4RWTA 1W97L 3LZIA 4FJHA 5B8HA 1L3TA 5SWMA 2IC3A 2D5RA 2PYJA 4DFMA 3R9PA 1TKDA 1U2VA 4BR5A 3I33A 4H5WA 4N56A 3IRXA 2F9TA 1XHZA 4QAGA 1VQKN 3C94A 4CEBA 1QQOA 5KQDA 1EX4A 4GW6A 4O0JA 5AFUA 3GBTA 4FM0A 2ZGZA 3THYA 4M3ZA 2OTJN 1SKWA 3SUOA 3VPZA 1S1XA 3DI6A 5M1KA 5KI6A 4CHPA 2HVHA 2BTFA 3KK3A 4OLBA 2Q0RA 5KTQA 3ZSZA 3S41A 3M1FA 1D5AA 3MCPA 3U8XA 3O9QA 4X62K 1VQ5N 1WSFA 4C23A 4BE1A 3K5NA 3DRRA 3LP2A 4GVEA 3KWIA 1FKOA 3SQ4A 2HHUA 3C6UA 3P38A 3BY5A 2ASMA 4BRQA 1RTJA 3VTIA 5DM6L 3VQ4A 4BQZA 4CEOA 1M90O 2OYQA 3K59A 3UIQA 3ZT1A 1Q9XA 1RBRA 1VSMA 4BGAA 1WSHA 4CIGA 3NF8A 3KK7A 3S3NA 1JCGA 4W5QA 1IG8A 4FK4A 4JK7A 1FKPA 1GLDG 3MX5A 2FSKA 1C1AA 4Q5VA 3VQAA 4EHTA 4DV0K 4ISFA 2PFUA 4YY3K 1SL0A 1REVA 2E1ZA 3N4QA 1O1WA 5C12A 2HB5A 3TAGA 2V7YA 4H0OA 3CC4N 5AQQA 4CJ4A 2A6AA 4BR7A 3ISNC 4DTJA 4GMJB 1HNVA 1I39A 1ITGA 4JI3K 4XH4A 4QS9A 4KFBA 5LJVA 2ZD1A 3CHWA 1QQCA 3FFKB 3SQ0A 1KVBA 4FWQA 4U67L 4CZMA 3C65A 3FZMA 3P4IA 1J9AA 3R6MA 1LCUA 4CGGA 3JAMO 3NGZA 1NNEA 3FE1A 1KCFA 4Y0WA 3CCRN 3U6FA 2YCHA 1NM1A 3WXJA 1O13A 5JICA 3HPOA 1FK9A 2E20A 1KVCA 3A5MC 1NJXA 2VQEK 2XY8A 3DXMB 4DS5A 2Q3SA 1ZBHA 3HZ6A 1WN7A 5JVHL 3BF3A 4JI1K 2B5JA 3BP8A 4ELUA 3K5OA 2KHOA 1SL2A 4B9UA 3AY9A 2KZMA 5HRNA 4KB1A 3O3FA 1MU2A 3SBGA 3OYJA 4H5TA 4JS5A 3RMAA 3ZSOA 4OVLA 1CXUA 1NJIO 4LFBK 2Q36A
chains in the Genus database with same CATH topology
3AV9A 3AVCA 3THVA 1LWFA 3ZCMA 1JLCA 4CJ5A 3KLGA 3RRGA 3HM9A 4M3TA 3K2PA 4RW9A 4Z0UA 4CEZA 4W5TA 1J54A 4FJ8A 3SV3A 4CK1A 2PYLA 4ZHRA 4B8CA 4CJEA 3ZSXA 4DSLA 4IKFA 2IAJA 1BI4A 1C1BA 3OY9A 1J53A 2HVIA 4FJ9A 4CIEA 3AVBA 4N41A 4M3RA 4KI4A 1S5JA 4KHYA 3OYAA 3QNOA 1LW0A 3DYAA 4KB0A 3HYFA 2QKKA 4AHTA 4FLXA 3TABA 4B9VA 3V9ZA 3I8DA 4DTRA 1SKSA 3ZSWA 4CJUA 3TI0A 1I3AA 3DLHA 4CFCA 3LP0A 4C8NA 4E3SA 2OPQA 2ITGA 3BGRA 2VWKA 1F21A 3MAQA 3P83D 4XIUA 4FLWA 4FXDA 4ID1A 2E6LA 1BCOA 4DLGA 3OYHA 4GVMA 3OYKA 3SQ1A 1D8YA 3OJSA 3F73A 3PX6A 2QKBA 1DTQA 4F3TA 2XRIA 2HMIA 3T19A 1B92A 1S9EA 3KKRA 4O55A 1X1PA 2E4LA 3WNFA 4CFAA 3B6PA 1SL1A 1LV5A 1RCHA 1LWEA 3V1OA 3VQ7A 2KZZA 3SYZA 1YT3A 4PQUA 3K5MA 4N47A 3NCIA 1RBSA 4CF1A 4C8LA 1W9HA 3VQ6A 3ULDA 4JRQA 1QTMA 2WONA 3VQ8A 4EP4A 3MEDA 3PO5A 4F2RA 4E7JA 3OYCA 4NCAA 4PA1A 3TANA 4KTZA 4CJTA 3BDPA 1S1VA 4DTXA 2R7YA 1VSDA 1TVRA 3FFIA 1BHLA 3L3UA 2PZSA 4O44A 2P5OA 1RDDA 3WNHA 3AO2A 3CG7A 3HVTA 1GOAA 5FDLA 3K57A 4DG1A 4DQSA 3ZSYA 2KFNA 4R5PA 1BQMA 4J2DA 3MEEA 1TAQA 5T7BA 2YNGA 4BDZA 1LWCA 1BIUA 3ASMA 1KLMA 4IG0A 4CGDA 4CJRA 3M8SA 3L2UA 3T3FA 4YNQA 3TARA 4K8XA 2BDPA 2XHBA 1J5OA 4W5NA 3AA5X 3AO1A 1NOYA 4NCBA 3CFPA 3MEGA 1N6QA 1HRHA 1RBUA 1U04A 3AVHA 2IS3A 1YTAA 3NAEA 4KHWA 2KTQA 3JSMA 3DRPA 4JRPA 3OYDA 1NK9A 1X9SA 4DSFA 3HP9A 3OS1A 3IS9A 3LP1A 3NGYA 3LAKA 3OS2A 4DFKA 4KV8A 4G1QA 3G0ZA 4RW4A 4C8KA 1QSYA 4OKEA 3HK2A 2YHBA 2W42A 4B8AB 4H8KA 5J2PA 1U48A 1JKHA 3LZJA 2ETJA 3MXMA 4DQRA 4M45A 3VQDA 4PWDA 3S3MA 1A5WA 1ASUA 4CFBA 3F9KA 2G8UA 4BDPA 4AH9A 1TKTA 2IDOA 3ZT3A 4FLZA 3SQ2A 3L2VA 1NKCA 1WAFA 3TWHA 1LAWA 4DQQA 3AO4A 1RDAA 1QSSA 4BWJA 5HRPA 5J2NA 4J2EA 1RBVA 4CJLA 4OPJA 3OYFA 2OZMA 3HXMA 1T03A 4FLVA 4NYFA 1KFSA 3OJUA 4B9LA 3L3VA 5SZTA 2DY4A 3DRSA 4CJFA 5JS2A 1EXQA 1IKVA 3LPTA 3VQCA 3KLEA 3OYNA 3MXIA 3SNNA 4FLUA 4AILC 1CZ9A 4CERA 1NKBA 3ZSQA 1JLFA 3G10A 1WLJA 1XI1A 1RTIA 1BIZA 3QERA 4B9SA 1XWLA 2LSNA 4FJMA 1HPZA 1U4BA 1VSHA 2I5JA 2F8TA 4I9QA 3CFRA 3PY8A 1TV6A 1ZBUA 2P1JA 3I0RA 3EZ5A 3S9HA 1TK8A 1U47A 1HJRA 5FROA 1CLQA 3AO3A 4DTOA 3AVMA 3VQBA 4CGFA 3V4IA 1WAJA 1HMVA 4ID5A 4KAZA 2A1RA 3NDKA 1R0AA 4HHTA 4DS4A 4WE1A 3VQQA 3RMDA 2YHAA 4OPKA 5C24A 2G8FA 4OGCA 1VSFA 4CJQA 2P5GA 3EYZA 3OYBA 4AHUA 3KK1A 4KHNA 2Z1IA 1RNHA 3B6OA 4LH4A 2X74A 1L5UA 1NK7A 4I7FA 3NHGA 3LDSA 3TAQA 3QEVA 4QOZB 1TKZA 1VRTA 4DWIA 4CHNA 2Z1HA 4BWMA 3PV8A 3OYIA 2EX3A 4CGJA 3KLIA 1U49A 3CYMA 2HW3A 3S3OA 4ZTFA 4Z4FA 1JXEA 1NK8A 4FJ5A 1S9GA 3NF9A 2VG7A 3RTVA 2F96A 4OLAA 1NJYA 4E19A 3SCXA 3O4NA 4F3OA 3OVNA 1LAVA 3NBPA 5CYQA 1VSEA 3DLEA 4E1NA 4OKKA 3M8PA 4FJ7A 3CM6A 2XY6A 2QK9A 3MXJA 4FLTA 4Z4IA 4MQ3A 1T05A 4H4MA 1N5YA 2OA8A 3RR7A 4J2BA 1RILA 4HUEA 3SPYA 5I3UA 1NK0A 4FJGA 4FVMA 1Z25A 4FW2A 1RTDA 4M3WA 1NOZA 1W0HA 4AHVA 4RG8A 2IOCA 4FZYA 1KLNA 1ZYQA 1D9DA 4DTNA 4DTMA 1XHXA 4CF2A 4Q0BA 3WNGA 5HP1A 1TK0A 4Y1CA 3SV4A 4B9TA 1UWBA 1KTQA 4IFVA 1TAUA 1JLEA 3D0PA 1L3UA 2YKMA 3VQEA 4LSNA 4MFBA 2JLEA 4KRFA 1JL1A 1NK5A 3WNEA 4CJKA 3TAPA 4KI6A 3O3GA 1Q8IA 2FBYA 3MECA 4ICLA 3V9SA 4E7HA 1B9FA 2OPSA 4LSLA 3QEIA 1C1CA 2B6AA 4FW1A 4KTQA 4AHCA 3KLFA 3C95A 1UAXA 4NCGA 4CF8A 1UA1A 4M42A 4EZ9A 1YVUA 3DOLA 1UOCA 2VWJA 1L3VA 3K5LA 1RDCA 5HROA 2BANA 4IG3A 5K14A 4O0IA 4B3OA 2GUIA 4LY7A 1JXBA 4CHYA 5D3GA 4KHUA 3SPZA 4DU3A 3A2FA 1TL1A 4KTWA 4PY5A 4FJXA 1RT4A 3DLKA 4RW6A 4N5SA 1NK6A 1X9MA 3CQ8A 3AA2A 1HYZA 2B4JA 2X78A 3AA4A 4KO0A 1ASVA 1WNSA 2HHSA 4QCLA 4Z4EA 3HPGA 3OYEA 2DFHA 4J2AA 4CEEA 2DTUA 2KFZA 4PUOA 1EETA 3QLHA 3VA3A 3ZT4A 1A5VA 5HRRA 3T1AA 3RMCA 4CK3A 2BGGA 1CXQA 1XC9A 3TR8A 3U3YA 4FCYA 3QIOA 4DFJA 4CFDA 3AO5A 3NH1A 4FZZA 2FBVA 2HHTA 4Y1DA 4E7LA 3CM5A 1KRPA 2F8SA 3AVAA 4BDYA 1C0MA 5KGWA 2VG6A 4DSEA 2AJQA 4BACA 2HNYA 3HSTB 3HVRA 4F4KA 3PX0A 2HHVA 4Z4CA 5EU7A 1YTUA 3DLGA 4FJJA 1GOCA 5CYMA 3LWLA 3EY1A 4FM2A 5JS1A 1BGXT 3AVLA 2O4GA 4B9NA 4RW8A 1LW2A 3SJJA 3KLHA 1RT5A 4C8OA 1ZBFA 4DU4A 2GBZA 2G8HA 4DSIA 1NJZA 4FJNA 4CHOA 3L2RA 1BISA 3JYTA 4N76A 4CK2A 3P1GA 2DFFA 4O5BA 1HQUA 1KFDA 1WSJA 5CZ1A 3HO1A 4TSXA 1RT2A 4FJIA 2VG5A 2P51A 1QS4A 2YNIA 3AA3A 3AVFA 3C6TA 3P5JA 3QINA 5DK5A 3NGIA 4DTPA 2OZSA 3V9XA 2ZQBA 2G8VA 4DQIA 3PX4A 3TAMA 1HYVA 4EP5A 3LPUA 3TAFA 2HHQA 1TKXA 3KD5E 3RMBA 1WSEA 1TL3A 2XY7A 4B08A 3HT3A 4LH5A 4KPYA 3NF6A 3E01A 5DMRA 4C8MA 1HQEA 2Z1JA 1IKYA 3AVIA 4OKJA 5E41A 3LZIA 4FJHA 3HL8A 4HUFA 1L3TA 5KGXA 4JS4A 5SWMA 3ZSRA 1Q9YA 3PO4A 3RWUA 3DMJA 2E6MA 2IC3A 3VQ5A 5KRTA 3L2WA 2D5RA 1T7PA 1IG9A 2PYJA 4KHSA 1DLOA 4KKOA 4ZTJA 3NFAA 1WSIA 4DFMA 4CGHA 2X6NA 1TKDA 3OYGA 4CECA 1CZBA 1JLQA 3AVNA 1S1TA 3QEWA 1RT6A 5FRMA 1FXXA 4N56A 4F8RA 4E0DA 3IRXA 3ZT0A 1G15A 1XHZA 4QAGA 1NKEA 1SUQA 4E1MA 2A1SA 3HPHA 4FK2A 4W5RA 3C94A 3VA0A 4CEBA 3V9UA 1RDBA 4Z4HA 1RBTA 1EX4A 1L3SA 3AVKA 4DQPA 4GW6A 4KHQA 4O0JA 3CFOA 4L8RB 3QO9A 1HNIA 1S1WA 1BL3A 3O3HA 4FM0A 4YFUA 5FRNA 4OGEA 1ASWA 4M3ZA 1QE1A 1WSGA 3QEXA 1SKWA 2O4IA 4DF4A 2NUBA 3SUOA 2Y1IA 1S1XA 3LWMA 1JLAA 3QESA 1KVAA 3ALYA 3LP3A 1S1UA 3DOKA 4FJLA 1VSIA 3DI6A 4E89A 3V9WA 3QNNA 2FC0A 5KI6A 4CHPA 5J2QA 4FJKA 2HVHA 5J1EA 3KK3A 3V6DA 5KRSA 2D0BA 4CJPA 4OLBA 2D0CA 5KTQA 2WOMA 3ZSZA 3M8RA 4CJ3A 4E7KA 1D5AA 4W5OA 1K6YA 3DLRA 2QXFA 1WSFA 4OJRA 1SKRA 5C42A 4CEDA 2ATQA 1EP4A 4BE1A 3SZ2A 3SUNA 3K5NA 4HCCA 1Z26A 1VSLA 3DRRA 1BQNA 4DFPA 3TAEA 3LP2A 1D9FA 3KK2A 3V1RA 2KQ2A 3SI6A 3U3GA 5C25A 1NK4A 1FKOA 2X6SA 3KKSA 4CF0A 3SQ4A 4BE2A 2HHUA 3C6UA 4H4OA 3HP6A 2HNDA 4FZXC 3KIOA 1SV5A 1X9WA 3IG1A 4DSJA 3DLBA 3NH2A 2YNHA 3LANA 1RTJA 4CESA 1QHTA 3VN5A 1S6QA 2RN2A 3VQ4A 3NH0A 1A5XA 2OPPA 1GOBA 3D45A 1VSKA 3H08A 4CEOA 3K58A 2OYQA 3K59A 3UIQA 2YNFA 3ZT1A 1Q9XA 4I2PA 1RBRA 2OPRA 1VSMA 4UQGA 4Z4GA 1WSHA 2EHGA 4CIGA 3NF8A 1T8EA 1IKXA 3L2QA 4M3UA 3IAYA 3KJVA 2XY5A 4CEQA 4KREA 3OYMA 4DMNA 1JLGA 1JL2A 3VQ9A 3S3NA 4IDKA 4F2SA 5CY4A 4AHRA 1C0TA 1BCMA 4CGIA 1RTHA 4W5QA 1UA0A 4DSKA 4FK4A 1FKPA 1C6VA 4CF9A 1IO2A 1C1AA 4Q5VA 2Y1JA 3VQAA 1IH7A 4FM1A 2YKNA 2ZE2A 3ZT2A 1SL0A 1REVA 3LAMA 4IFYA 4CEAA 1O1WA 2G8WA 3KTQA 1JLBA 2HB5A 2GV9A 4I2QA 4BE0A 3TAGA 4HCBA 1VK0A 4ELTA 1Y97A 4M41A 1ZBIA 4O4GA 4CCHA 4CJ4A 4CJVA 2HNZA 3ISNC 4DTJA 4GMJB 1HNVA 4B9MA 1RT3A 4ELVA 2G8IA 1I39A 3L8BA 2RPIA 3V1QA 3RRHA 1EKEA 3KD1E 1B9DA 5I42A 2Z1GA 1ITGA 4DTUA 1KSPA 1HYSA 4E7IA 1S6PA 4KFBA 4JLHA 5CZ2A 4IBNA 1RT7A 2ZD1A 3SUQA 1QQCA 4CHQA 3LALA 4M3YA 3SQ0A 4NYNA 1DTTA 3VQPA 1VRUA 1KVBA 3OYLA 3RR8A 4K8ZA 4CHZA 3DM2A 1C0UA 3SUPA 4CJWA 4CIFA 2HHWA 4DTSA 5HBMA 1J9AA 4HUGA 1BI4B 4AHSA 1IKWA 4CGGA 2BE2A 3NGZA 2XO7A 3AVGA 1TK5A 4HTUA 4I9LA 4EZ6A 1KCFA 2YV0X 3U6FA 4DU1A 1QSLA 1NJWA 2HHXA 3I0SA 2KW4A 3HPOA 5HLFA 2FBXA 1FK9A 1VSJA 2RKIA 3PUFA 4DF8A 2RF2A 3O4QA 4CE9A 3OS0A 1KVCA 4DLEA 1NJXA 2IGIA 3HJFA 2XY8A 4CEFA 3V81A 3NF7A 2Q3SA 4DS5A 2G8KA 1ZBHA 2DFEA 2FBTA 3ZSVA 1WN7A 4FLYA 1ZBLA 1U45A 2PY5A 4M3XA 2JGUA 1RT1A 4CJSA 2B5JA 3ITHA 3QEPA 4ELUA 3K5OA 1TGOA 1SL2A 4B9UA 4FYDA 2KZMA 4LD0A 5HRNA 4KB1A 3O3FA 1MU2A 3OYJA 4HVJA 3NE6A 3AVJA 2D0AA 4RW7A 3QETA 4JS5A 4FK0A 3RMAA 3ZSOA 3M8QA 4OVLA 1CXUA 5J2MA 5HRSA 3QIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AV9 A;  3AVC A;  3THV A;  1LWF A;  3ZCM A;  1JLC A;  4CJ5 A;  3KLG A;  3RRG A;  3HM9 A;  4M3T A;  3K2P A;  4RW9 A;  4Z0U A;  4CEZ A;  4W5T A;  1J54 A;  4FJ8 A;  3SV3 A;  4CK1 A;  2PYL A;  4ZHR A;  4B8C A;  4CJE A;  3ZSX A;  4DSL A;  4IKF A;  2IAJ A;  1BI4 A;  1C1B A;  3OY9 A;  1J53 A;  2HVI A;  4FJ9 A;  4CIE A;  3AVB A;  4N41 A;  4M3R A;  4KI4 A;  1S5J A;  4KHY A;  3OYA A;  3QNO A;  1LW0 A;  3DYA A;  4KB0 A;  3HYF A;  2QKK A;  4AHT A;  4FLX A;  3TAB A;  4B9V A;  3V9Z A;  3I8D A;  4DTR A;  1SKS A;  3ZSW A;  4CJU A;  3TI0 A;  1I3A A;  3DLH A;  4CFC A;  3LP0 A;  4C8N A;  4E3S A;  2OPQ A;  2ITG A;  3BGR A;  2VWK A;  1F21 A;  3MAQ A;  3P83 D;  4XIU A;  4FLW A;  4FXD A;  4ID1 A;  2E6L A;  1BCO A;  4DLG A;  3OYH A;  4GVM A;  3OYK A;  3SQ1 A;  1D8Y A;  3OJS A;  3F73 A;  3PX6 A;  2QKB A;  1DTQ A;  4F3T A;  2XRI A;  2HMI A;  3T19 A;  1B92 A;  1S9E A;  3KKR A;  4O55 A;  1X1P A;  2E4L A;  3WNF A;  4CFA A;  3B6P A;  1SL1 A;  1LV5 A;  1RCH A;  1LWE A;  3V1O A;  3VQ7 A;  2KZZ A;  3SYZ A;  1YT3 A;  4PQU A;  3K5M A;  4N47 A;  3NCI A;  1RBS A;  4CF1 A;  4C8L A;  1W9H A;  3VQ6 A;  3ULD A;  4JRQ A;  1QTM A;  2WON A;  3VQ8 A;  4EP4 A;  3MED A;  3PO5 A;  4F2R A;  4E7J A;  3OYC A;  4NCA A;  4PA1 A;  3TAN A;  4KTZ A;  4CJT A;  3BDP A;  1S1V A;  4DTX A;  2R7Y A;  1VSD A;  1TVR A;  3FFI A;  1BHL A;  3L3U A;  2PZS A;  4O44 A;  2P5O A;  1RDD A;  3WNH A;  3AO2 A;  3CG7 A;  3HVT A;  1GOA A;  5FDL A;  3K57 A;  4DG1 A;  4DQS A;  3ZSY A;  2KFN A;  4R5P A;  1BQM A;  4J2D A;  3MEE A;  1TAQ A;  5T7B A;  2YNG A;  4BDZ A;  1LWC A;  1BIU A;  3ASM A;  1KLM A;  4IG0 A;  4CGD A;  4CJR A;  3M8S A;  3L2U A;  3T3F A;  4YNQ A;  3TAR A;  4K8X A;  2BDP A;  2XHB A;  1J5O A;  4W5N A;  3AA5 X;  3AO1 A;  1NOY A;  4NCB A;  3CFP A;  3MEG A;  1N6Q A;  1HRH A;  1RBU A;  1U04 A;  3AVH A;  2IS3 A;  1YTA A;  3NAE A;  4KHW A;  2KTQ A;  3JSM A;  3DRP A;  4JRP A;  3OYD A;  1NK9 A;  1X9S A;  4DSF A;  3HP9 A;  3OS1 A;  3IS9 A;  3LP1 A;  3NGY A;  3LAK A;  3OS2 A;  4DFK A;  4KV8 A;  4G1Q A;  3G0Z A;  4RW4 A;  4C8K A;  1QSY A;  4OKE A;  3HK2 A;  2YHB A;  2W42 A;  4B8A B;  4H8K A;  5J2P A;  1U48 A;  1JKH A;  3LZJ A;  2ETJ A;  3MXM A;  4DQR A;  4M45 A;  3VQD A;  4PWD A;  3S3M A;  1A5W A;  1ASU A;  4CFB A;  3F9K A;  2G8U A;  4BDP A;  4AH9 A;  1TKT A;  2IDO A;  3ZT3 A;  4FLZ A;  3SQ2 A;  3L2V A;  1NKC A;  1WAF A;  3TWH A;  1LAW A;  4DQQ A;  3AO4 A;  1RDA A;  1QSS A;  4BWJ A;  5HRP A;  5J2N A;  4J2E A;  1RBV A;  4CJL A;  4OPJ A;  3OYF A;  2OZM A;  3HXM A;  1T03 A;  4FLV A;  4NYF A;  1KFS A;  3OJU A;  4B9L A;  3L3V A;  5SZT A;  2DY4 A;  3DRS A;  4CJF A;  5JS2 A;  1EXQ A;  1IKV A;  3LPT A;  3VQC A;  3KLE A;  3OYN A;  3MXI A;  3SNN A;  4FLU A;  4AIL C;  1CZ9 A;  4CER A;  1NKB A;  3ZSQ A;  1JLF A;  3G10 A;  1WLJ A;  1XI1 A;  1RTI A;  1BIZ A;  3QER A;  4B9S A;  1XWL A;  2LSN A;  4FJM A;  1HPZ A;  1U4B A;  1VSH A;  2I5J A;  2F8T A;  4I9Q A;  3CFR A;  3PY8 A;  1TV6 A;  1ZBU A;  2P1J A;  3I0R A;  3EZ5 A;  3S9H A;  1TK8 A;  1U47 A;  1HJR A;  5FRO A;  1CLQ A;  3AO3 A;  4DTO A;  3AVM A;  3VQB A;  4CGF A;  3V4I A;  1WAJ A;  1HMV A;  4ID5 A;  4KAZ A;  2A1R A;  3NDK A;  1R0A A;  4HHT A;  4DS4 A;  4WE1 A;  3VQQ A;  3RMD A;  2YHA A;  4OPK A;  5C24 A;  2G8F A;  4OGC A;  1VSF A;  4CJQ A;  2P5G A;  3EYZ A;  3OYB A;  4AHU A;  3KK1 A;  4KHN A;  2Z1I A;  1RNH A;  3B6O A;  4LH4 A;  2X74 A;  1L5U A;  1NK7 A;  4I7F A;  3NHG A;  3LDS A;  3TAQ A;  3QEV A;  4QOZ B;  1TKZ A;  1VRT A;  4DWI A;  4CHN A;  2Z1H A;  4BWM A;  3PV8 A;  3OYI A;  2EX3 A;  4CGJ A;  3KLI A;  1U49 A;  3CYM A;  2HW3 A;  3S3O A;  4ZTF A;  4Z4F A;  1JXE A;  1NK8 A;  4FJ5 A;  1S9G A;  3NF9 A;  2VG7 A;  3RTV A;  2F96 A;  4OLA A;  1NJY A;  4E19 A;  3SCX A;  3O4N A;  4F3O A;  3OVN A;  1LAV A;  3NBP A;  5CYQ A;  1VSE A;  3DLE A;  4E1N A;  4OKK A;  3M8P A;  4FJ7 A;  3CM6 A;  2XY6 A;  2QK9 A;  3MXJ A;  4FLT A;  4Z4I A;  4MQ3 A;  1T05 A;  4H4M A;  1N5Y A;  2OA8 A;  3RR7 A;  4J2B A;  1RIL A;  4HUE A;  3SPY A;  5I3U A;  1NK0 A;  4FJG A;  4FVM A;  1Z25 A;  4FW2 A;  1RTD A;  4M3W A;  1NOZ A;  1W0H A;  4AHV A;  4RG8 A;  2IOC A;  4FZY A;  1KLN A;  1ZYQ A;  1D9D A;  4DTN A;  4DTM A;  1XHX A;  4CF2 A;  4Q0B A;  3WNG A;  5HP1 A;  1TK0 A;  4Y1C A;  3SV4 A;  4B9T A;  1UWB A;  1KTQ A;  4IFV A;  1TAU A;  1JLE A;  3D0P A;  1L3U A;  2YKM A;  3VQE A;  4LSN A;  4MFB A;  2JLE A;  4KRF A;  1JL1 A;  1NK5 A;  3WNE A;  4CJK A;  3TAP A;  4KI6 A;  3O3G A;  1Q8I A;  2FBY A;  3MEC A;  4ICL A;  3V9S A;  4E7H A;  1B9F A;  2OPS A;  4LSL A;  3QEI A;  1C1C A;  2B6A A;  4FW1 A;  4KTQ A;  4AHC A;  3KLF A;  3C95 A;  1UAX A;  4NCG A;  4CF8 A;  1UA1 A;  4M42 A;  4EZ9 A;  1YVU A;  3DOL A;  1UOC A;  2VWJ A;  1L3V A;  3K5L A;  1RDC A;  5HRO A;  2BAN A;  4IG3 A;  5K14 A;  4O0I A;  4B3O A;  2GUI A;  4LY7 A;  1JXB A;  4CHY A;  5D3G A;  4KHU A;  3SPZ A;  4DU3 A;  3A2F A;  1TL1 A;  4KTW A;  4PY5 A;  4FJX A;  1RT4 A;  3DLK A;  4RW6 A;  4N5S A;  1NK6 A;  1X9M A;  3CQ8 A;  3AA2 A;  1HYZ A;  2B4J A;  2X78 A;  3AA4 A;  4KO0 A;  1ASV A;  1WNS A;  2HHS A;  4QCL A;  4Z4E A;  3HPG A;  3OYE A;  2DFH A;  4J2A A;  4CEE A;  2DTU A;  2KFZ A;  4PUO A;  1EET A;  3QLH A;  3VA3 A;  3ZT4 A;  1A5V A;  5HRR A;  3T1A A;  3RMC A;  4CK3 A;  2BGG A;  1CXQ A;  1XC9 A;  3TR8 A;  3U3Y A;  4FCY A;  3QIO A;  4DFJ A;  4CFD A;  3AO5 A;  3NH1 A;  4FZZ A;  2FBV A;  2HHT A;  4Y1D A;  4E7L A;  3CM5 A;  1KRP A;  2F8S A;  3AVA A;  4BDY A;  1C0M A;  5KGW A;  2VG6 A;  4DSE A;  2AJQ A;  4BAC A;  2HNY A;  3HST B;  3HVR A;  4F4K A;  3PX0 A;  2HHV A;  4Z4C A;  5EU7 A;  1YTU A;  3DLG A;  4FJJ A;  1GOC A;  5CYM A;  3LWL A;  3EY1 A;  4FM2 A;  5JS1 A;  1BGX T;  3AVL A;  2O4G A;  4B9N A;  4RW8 A;  1LW2 A;  3SJJ A;  3KLH A;  1RT5 A;  4C8O A;  1ZBF A;  4DU4 A;  2GBZ A;  2G8H A;  4DSI A;  1NJZ A;  4FJN A;  4CHO A;  3L2R A;  1BIS A;  3JYT A;  4N76 A;  4CK2 A;  3P1G A;  2DFF A;  4O5B A;  1HQU A;  1KFD A;  1WSJ A;  5CZ1 A;  3HO1 A;  4TSX A;  1RT2 A;  4FJI A;  2VG5 A;  2P51 A;  1QS4 A;  2YNI A;  3AA3 A;  3AVF A;  3C6T A;  3P5J A;  3QIN A;  5DK5 A;  3NGI A;  4DTP A;  2OZS A;  3V9X A;  2ZQB A;  2G8V A;  4DQI A;  3PX4 A;  3TAM A;  1HYV A;  4EP5 A;  3LPU A;  3TAF A;  2HHQ A;  1TKX A;  3KD5 E;  3RMB A;  1WSE A;  1TL3 A;  2XY7 A;  4B08 A;  3HT3 A;  4LH5 A;  4KPY A;  3NF6 A;  3E01 A;  5DMR A;  4C8M A;  1HQE A;  2Z1J A;  1IKY A;  3AVI A;  4OKJ A;  5E41 A;  3LZI A;  4FJH A;  3HL8 A;  4HUF A;  1L3T A;  5KGX A;  4JS4 A;  5SWM A;  3ZSR A;  1Q9Y A;  3PO4 A;  3RWU A;  3DMJ A;  2E6M A;  2IC3 A;  3VQ5 A;  5KRT A;  3L2W A;  2D5R A;  1T7P A;  1IG9 A;  2PYJ A;  4KHS A;  1DLO A;  4KKO A;  4ZTJ A;  3NFA A;  1WSI A;  4DFM A;  4CGH A;  2X6N A;  1TKD A;  3OYG A;  4CEC A;  1CZB A;  1JLQ A;  3AVN A;  1S1T A;  3QEW A;  1RT6 A;  5FRM A;  1FXX A;  4N56 A;  4F8R A;  4E0D A;  3IRX A;  3ZT0 A;  1G15 A;  1XHZ A;  4QAG A;  1NKE A;  1SUQ A;  4E1M A;  2A1S A;  3HPH A;  4FK2 A;  4W5R A;  3C94 A;  3VA0 A;  4CEB A;  3V9U A;  1RDB A;  4Z4H A;  1RBT A;  1EX4 A;  1L3S A;  3AVK A;  4DQP A;  4GW6 A;  4KHQ A;  4O0J A;  3CFO A;  4L8R B;  3QO9 A;  1HNI A;  1S1W A;  1BL3 A;  3O3H A;  4FM0 A;  4YFU A;  5FRN A;  4OGE A;  1ASW A;  4M3Z A;  1QE1 A;  1WSG A;  3QEX A;  1SKW A;  2O4I A;  4DF4 A;  2NUB A;  3SUO A;  2Y1I A;  1S1X A;  3LWM A;  1JLA A;  3QES A;  1KVA A;  3ALY A;  3LP3 A;  1S1U A;  3DOK A;  4FJL A;  1VSI A;  3DI6 A;  4E89 A;  3V9W A;  3QNN A;  2FC0 A;  5KI6 A;  4CHP A;  5J2Q A;  4FJK A;  2HVH A;  5J1E A;  3KK3 A;  3V6D A;  5KRS A;  2D0B A;  4CJP A;  4OLB A;  2D0C A;  5KTQ A;  2WOM A;  3ZSZ A;  3M8R A;  4CJ3 A;  4E7K A;  1D5A A;  4W5O A;  1K6Y A;  3DLR A;  2QXF A;  1WSF A;  4OJR A;  1SKR A;  5C42 A;  4CED A;  2ATQ A;  1EP4 A;  4BE1 A;  3SZ2 A;  3SUN A;  3K5N A;  4HCC A;  1Z26 A;  1VSL A;  3DRR A;  1BQN A;  4DFP A;  3TAE A;  3LP2 A;  1D9F A;  3KK2 A;  3V1R A;  2KQ2 A;  3SI6 A;  3U3G A;  5C25 A;  1NK4 A;  1FKO A;  2X6S A;  3KKS A;  4CF0 A;  3SQ4 A;  4BE2 A;  2HHU A;  3C6U A;  4H4O A;  3HP6 A;  2HND A;  4FZX C;  3KIO A;  1SV5 A;  1X9W A;  3IG1 A;  4DSJ A;  3DLB A;  3NH2 A;  2YNH A;  3LAN A;  1RTJ A;  4CES A;  1QHT A;  3VN5 A;  1S6Q A;  2RN2 A;  3VQ4 A;  3NH0 A;  1A5X A;  2OPP A;  1GOB A;  3D45 A;  1VSK A;  3H08 A;  4CEO A;  3K58 A;  2OYQ A;  3K59 A;  3UIQ A;  2YNF A;  3ZT1 A;  1Q9X A;  4I2P A;  1RBR A;  2OPR A;  1VSM A;  4UQG A;  4Z4G A;  1WSH A;  2EHG A;  4CIG A;  3NF8 A;  1T8E A;  1IKX A;  3L2Q A;  4M3U A;  3IAY A;  3KJV A;  2XY5 A;  4CEQ A;  4KRE A;  3OYM A;  4DMN A;  1JLG A;  1JL2 A;  3VQ9 A;  3S3N A;  4IDK A;  4F2S A;  5CY4 A;  4AHR A;  1C0T A;  1BCM A;  4CGI A;  1RTH A;  4W5Q A;  1UA0 A;  4DSK A;  4FK4 A;  1FKP A;  1C6V A;  4CF9 A;  1IO2 A;  1C1A A;  4Q5V A;  2Y1J A;  3VQA A;  1IH7 A;  4FM1 A;  2YKN A;  2ZE2 A;  3ZT2 A;  1SL0 A;  1REV A;  3LAM A;  4IFY A;  4CEA A;  1O1W A;  2G8W A;  3KTQ A;  1JLB A;  2HB5 A;  2GV9 A;  4I2Q A;  4BE0 A;  3TAG A;  4HCB A;  1VK0 A;  4ELT A;  1Y97 A;  4M41 A;  1ZBI A;  4O4G A;  4CCH A;  4CJ4 A;  4CJV A;  2HNZ A;  3ISN C;  4DTJ A;  4GMJ B;  1HNV A;  4B9M A;  1RT3 A;  4ELV A;  2G8I A;  1I39 A;  3L8B A;  2RPI A;  3V1Q A;  3RRH A;  1EKE A;  3KD1 E;  1B9D A;  5I42 A;  2Z1G A;  1ITG A;  4DTU A;  1KSP A;  1HYS A;  4E7I A;  1S6P A;  4KFB A;  4JLH A;  5CZ2 A;  4IBN A;  1RT7 A;  2ZD1 A;  3SUQ A;  1QQC A;  4CHQ A;  3LAL A;  4M3Y A;  3SQ0 A;  4NYN A;  1DTT A;  3VQP A;  1VRU A;  1KVB A;  3OYL A;  3RR8 A;  4K8Z A;  4CHZ A;  3DM2 A;  1C0U A;  3SUP A;  4CJW A;  4CIF A;  2HHW A;  4DTS A;  5HBM A;  1J9A A;  4HUG A;  1BI4 B;  4AHS A;  1IKW A;  4CGG A;  2BE2 A;  3NGZ A;  2XO7 A;  3AVG A;  1TK5 A;  4HTU A;  4I9L A;  4EZ6 A;  1KCF A;  2YV0 X;  3U6F A;  4DU1 A;  1QSL A;  1NJW A;  2HHX A;  3I0S A;  2KW4 A;  3HPO A;  5HLF A;  2FBX A;  1FK9 A;  1VSJ A;  2RKI A;  3PUF A;  4DF8 A;  2RF2 A;  3O4Q A;  4CE9 A;  3OS0 A;  1KVC A;  4DLE A;  1NJX A;  2IGI A;  3HJF A;  2XY8 A;  4CEF A;  3V81 A;  3NF7 A;  2Q3S A;  4DS5 A;  2G8K A;  1ZBH A;  2DFE A;  2FBT A;  3ZSV A;  1WN7 A;  4FLY A;  1ZBL A;  1U45 A;  2PY5 A;  4M3X A;  2JGU A;  1RT1 A;  4CJS A;  2B5J A;  3ITH A;  3QEP A;  4ELU A;  3K5O A;  1TGO A;  1SL2 A;  4B9U A;  4FYD A;  2KZM A;  4LD0 A;  5HRN A;  4KB1 A;  3O3F A;  1MU2 A;  3OYJ A;  4HVJ A;  3NE6 A;  3AVJ A;  2D0A A;  4RW7 A;  3QET A;  4JS5 A;  4FK0 A;  3RMA A;  3ZSO A;  3M8Q A;  4OVL A;  1CXU A;  5J2M A;  5HRS A;  3QIP A; 
#chains in the Genus database with same CATH topology
 4OO1 J;  3AVC A;  2GEM A;  5AQH A;  3THV A;  3ZCM A;  4M3T A;  3K2P A;  2VWB A;  4W5T A;  3PIO L;  3I55 N;  4IJA A;  3SV3 A;  5JVG L;  4DV6 K;  4BRD A;  4ZHR A;  4B8C A;  4BR0 A;  3FR0 A;  3KWG A;  3PIP L;  2RHK A;  2P9L B;  3DYA A;  3QFP A;  3OBW A;  4FLX A;  4DTR A;  4CJU A;  4MDA A;  3TI0 A;  3L4I A;  3DLH A;  3BGR A;  3DXM A;  1YHQ N;  4X65 K;  4JKG B;  4CI6 A;  5AQS A;  4JI4 K;  5A2Q O;  4FLW A;  4FXD A;  3SK3 A;  4DLG A;  2QKB A;  3SQ1 A;  3F73 A;  3PX6 A;  1B92 A;  4A57 A;  1LV5 A;  1LWE A;  3V1O A;  3NCI A;  4C8L A;  1W9H A;  2WON A;  3MED A;  3PO5 A;  4F2R A;  3O9U A;  4E7J A;  4KTZ A;  4CJT A;  1S1V A;  4B1U B;  4JKF A;  1GLF O;  3CG7 A;  3HVT A;  4DQS A;  4DG1 A;  4JK8 A;  4WQ4 A;  2VQF K;  2P9L A;  2YNG A;  1LWC A;  4BDZ A;  2O8B B;  4CJR A;  3T3F A;  5KPT A;  4K8X A;  4FWO A;  2BDP A;  2XHB A;  4W5N A;  1HRH A;  4B3S K;  1U04 A;  1N32 K;  2IS3 A;  4JKG A;  4BRN A;  3NAE A;  5BRD A;  4YOT A;  1NK9 A;  4JRP A;  3PSI A;  4DSF A;  1X9S A;  4DFK A;  4KV8 A;  3CJA A;  4RW4 A;  4YOR A;  2UUC K;  2A3Z A;  2YHB A;  4KBO A;  2W42 A;  5KPZ A;  3VEV A;  3A5O C;  3MXM A;  4DQR A;  4PKG A;  4M45 A;  1HLU A;  1A5W A;  1ASU A;  3VF4 A;  1NKC A;  5BR9 A;  2D4W A;  1LAW A;  2E1Y A;  1RDA A;  4BWJ A;  4OPJ A;  1NGJ A;  3A8Y A;  3OYF A;  3HXM A;  2A5X A;  4NYF A;  3CJ1 A;  3M5R A;  4WYB A;  3IUC A;  1HKC A;  5ELZ A;  2O8B A;  1VQ4 N;  3VQC A;  3KLE A;  2QWR A;  5E26 A;  5EY4 A;  4HWI A;  4AIL C;  2HF3 A;  3EEQ A;  1JLF A;  3G10 A;  3FLC O;  4B9S A;  1XWL A;  2LSN A;  1VSH A;  5F1X A;  3NMU A;  4M7X A;  1QHA A;  5M1Q A;  3O1B A;  2OTL N;  3AO3 A;  4DTO A;  3WUH A;  4CW7 B;  3E9O A;  3CIP A;  3QDK A;  3NDK A;  3KHY A;  4HHT A;  3D2F B;  1EQY A;  4OPK A;  2G8F A;  1VSF A;  3OYB A;  3B6O A;  3QEV A;  1TKZ A;  1VRT A;  4BRC A;  4BWM A;  3WXK A;  5FPD A;  4FWL A;  2HW3 A;  3S3O A;  3T69 A;  4ZTF A;  4LFC K;  4FJ5 A;  3RTV A;  4OLA A;  4X66 K;  3SCX A;  3O4N A;  4OKK A;  3M8P A;  3CQY A;  5TKY A;  1N5Y A;  4A62 A;  4DV3 K;  3RR7 A;  3PLA A;  5C0Y A;  4K42 A;  4HUE A;  3SPY A;  1NK0 A;  1ILY A;  1Q18 A;  4FW2 A;  4FWP A;  3D2F A;  4XH5 A;  4BRK A;  4CZJ A;  3CCJ N;  1ESV A;  1UWB A;  2GX9 A;  4IDH A;  4IFV A;  1JLE A;  3D0P A;  1L3U A;  4A5A A;  5JLH A;  1RFQ A;  3WNE A;  4CJK A;  4V19 S;  3MEC A;  4E7H A;  3EZW A;  4LSL A;  1NGI A;  4KTQ A;  3KLF A;  1UAX A;  3BEX A;  2D0O A;  1ATN A;  4FO0 A;  1BA1 A;  1YVU A;  1L3V A;  1JCE A;  5HRO A;  3H3O B;  3H3N O;  4IG3 A;  4WQ5 C;  4O0I A;  4CHY A;  5AQZ A;  4KHU A;  4DU3 A;  4KTW A;  4FJX A;  4FWS A;  4JI8 K;  4N5S A;  5LMN K;  3CQ8 A;  2V51 B;  1ASV A;  2DTU A;  3VA3 A;  3RMC A;  1A5V A;  1HKB A;  5BPL A;  4CK3 A;  1CXQ A;  3U3Y A;  3DJC A;  1SQK A;  4FZZ A;  2FBV A;  4BRE A;  3AVA A;  4JKE A;  4IOC L;  3CF5 L;  5EU7 A;  3O80 A;  1NGH A;  1GOC A;  1LW2 A;  4MO4 A;  3CJ7 A;  4PHT X;  2UUB K;  3VF6 A;  1HNW K;  1NJZ A;  5LJW A;  2IVP A;  3O5B A;  3L2R A;  4CK2 A;  4K25 A;  1HQU A;  4FJI A;  2VG5 A;  3AA3 A;  5ADX H;  5DK5 A;  2NRT A;  3NGI A;  3A5N C;  3V9X A;  2ZQB A;  3EO3 A;  1MDU B;  3LL3 A;  3TAM A;  1HYV A;  4CZK A;  1TKX A;  3KD5 E;  1TL3 A;  2XY7 A;  2Q31 A;  4LH5 A;  1NGC A;  3E01 A;  5BN9 A;  3HL8 A;  3HOT A;  3PO4 A;  3EE8 A;  3L2W A;  5KRT A;  1NWK A;  4ILH A;  1IG9 A;  4KHS A;  2NRV A;  5BRH A;  4CEC A;  1CZB A;  1JLQ A;  3AVN A;  2EWS A;  1S1T A;  1R59 O;  4F8R A;  2P9U B;  3CET A;  4FK2 A;  3HPH A;  3V9U A;  3QBX A;  4M63 C;  1IBL K;  1BU6 O;  3AVK A;  1P90 A;  1NGG A;  3AAP A;  5FRN A;  4OGE A;  1ASW A;  1QE1 A;  3QEX A;  4DF4 A;  2Y1I A;  1JLA A;  1QZ5 A;  3ALY A;  3LP3 A;  1NU0 A;  3DOK A;  3OA9 A;  4FJL A;  4E89 A;  2H3G X;  4A5B A;  4CJP A;  3M8R A;  5AQT A;  4E7K A;  5IWA K;  3I56 N;  4ILG B;  4O8U A;  3EL2 A;  2QXF A;  4OJR A;  3VF2 A;  5C42 A;  4JI7 K;  3SZ2 A;  3SUN A;  4HCC A;  4DKW A;  1VSL A;  1BQN A;  3TAE A;  1D9F A;  3O9T A;  4BVO A;  4WFN L;  3IMX A;  2X6S A;  3KKS A;  4CF0 A;  2FXU A;  4BE2 A;  3HP6 A;  2P9U A;  4DB3 A;  3LM9 A;  4DSJ A;  3DLB A;  1QHT A;  3JS6 A;  3NH0 A;  2YNF A;  4I2P A;  4UQG A;  3T7Z A;  4U7B A;  4M3U A;  2XY5 A;  4CEQ A;  3OYM A;  4DMN A;  3GG4 A;  4F2S A;  3CCU N;  1C0F A;  4CGI A;  3VEW A;  4YDU A;  2YHY A;  2Y1J A;  1FJG K;  5TKW A;  1V4S A;  4DR1 K;  5AQJ A;  4IFY A;  4CEA A;  1VQP N;  4K0K K;  4I2Q A;  2NLX A;  4ELT A;  4M41 A;  1ZBI A;  4O4G A;  4BRO A;  5E84 A;  1I94 K;  4CJV A;  1X9J A;  2IVO A;  2Q0U A;  4ELV A;  2G8I A;  3V1Q A;  3RRH A;  3KD1 E;  1C0G A;  1B9D A;  4DTU A;  1HYS A;  4E7I A;  1IJJ A;  3U9D A;  5CZ2 A;  3ZX3 A;  1WB9 A;  5AQL A;  4NYN A;  1DTT A;  3VQP A;  1VRU A;  3WXM B;  4A61 A;  3OYL A;  4K8Z A;  4H0X B;  3AAQ A;  3HM8 A;  3DM2 A;  3TSQ A;  4DR5 K;  3MN7 A;  2FSJ A;  4CIF A;  1VQN N;  3C0B A;  1J5E K;  3J7Z O;  1IKW A;  2BE2 A;  1ATR A;  1TK5 A;  1KXP A;  4AF1 A;  4DU1 A;  2KW4 A;  2FBX A;  1VSJ A;  2E5L K;  1QVF M;  4CEF A;  4LF6 K;  4NB4 A;  3HRG A;  4FLY A;  2FBT A;  3ZSV A;  1U45 A;  4CJS A;  1RT1 A;  4EIA A;  3J81 O;  4IOA L;  4BR9 A;  3NE6 A;  1GLA G;  2QTD A;  3SAF A;  5J2M A;  4ISE A;  5CR4 A;  3RRG A;  4CK1 A;  3VEZ A;  3E9P A;  3OY9 A;  1J53 A;  4CIE A;  3AVB A;  4N41 A;  1N34 K;  4KI4 A;  1S5J A;  1XNQ K;  3OYA A;  1LW0 A;  1GLJ O;  4AHT A;  3J80 O;  3TAB A;  3V9Z A;  3I8D A;  1I3A A;  3ZEU B;  4CFC A;  3LP0 A;  4C8N A;  4E3S A;  2ITG A;  2VWK A;  3MAQ A;  5M1O A;  4FJM A;  2NRW A;  2NRR A;  1SL1 A;  3W0L A;  2KZZ A;  1T6C A;  4CZE A;  1RCH A;  4PQU A;  4N47 A;  1GLC G;  4CF1 A;  2RE2 A;  4JRQ A;  3E1Y A;  4OX9 K;  1NGA A;  3OYC A;  3H1V X;  3TAN A;  4JK9 A;  4IOX A;  2R7Y A;  1VSD A;  1TVR A;  1BHL A;  1XMO K;  3TSU A;  3CC2 N;  5FDL A;  1QQM A;  2KFN A;  4R5P A;  1KQS M;  4J2D A;  1TAQ A;  3M3Z A;  3MXI A;  2I7N A;  4CGD A;  3E66 A;  3TAR A;  3MX2 A;  3ZEU A;  4IWV A;  1J5O A;  1NOY A;  3MEG A;  3VGL A;  3O9S A;  2ZF5 O;  4FWR A;  4DV5 K;  1N6Q A;  4CD1 A;  1YTA A;  3HP9 A;  3IS9 A;  4DQ8 A;  2YJF A;  3LAK A;  4BRH A;  3HK2 A;  1S3X A;  3G25 A;  4NXN K;  4IFE A;  4B8A B;  1JKH A;  4PWD A;  3VQD A;  3CCS N;  4CFB A;  3F9K A;  5FPE A;  3RSE B;  4JKA A;  2QWO A;  1TUY A;  3TWH A;  4BY9 C;  3TTC A;  4DV1 K;  4DQQ A;  4QS7 A;  2Q1N A;  3SJH A;  3OHR A;  4CJL A;  4GKJ K;  1VQM N;  3GOI A;  5EVZ A;  1QVG M;  1BDG A;  4B9L A;  3SMS A;  4DHY A;  1JCF A;  1NGF A;  3OYN A;  2HBK A;  5EOY A;  1H1V A;  2VGN A;  2QXL A;  1Y64 A;  2VGM A;  2PAV A;  1TV6 A;  1ZBU A;  2P1J A;  3I0R A;  4EFH A;  2I7P A;  5FRO A;  2A1R A;  2KKZ A;  4DS4 A;  4B1Y B;  2YHA A;  5C24 A;  3FZH A;  4OGC A;  3RSE A;  2A41 A;  4AHU A;  4JKD A;  1RNH A;  1L5U A;  1NK7 A;  4I7F A;  4DWI A;  4CHN A;  3OYI A;  4LF5 K;  4WFA L;  4JI6 K;  2GWJ A;  4R79 A;  3ULE B;  3KVG A;  1OH6 A;  1YIJ N;  4E19 A;  2ASO A;  4F3O A;  3W3D A;  3NBP A;  1VSE A;  1X3M A;  4FJ7 A;  3CM6 A;  2VYP A;  4FLT A;  2OA8 A;  2A42 A;  1K8K B;  3C7N B;  4FVM A;  4AHV A;  5AZJ B;  4H5N A;  3TTF A;  4DTN A;  3VGK A;  1SS6 A;  5AQW A;  4CF2 A;  4Q0B A;  3WNG A;  4Y1C A;  4DV2 K;  3SV4 A;  2IIR A;  2YJE A;  3VQE A;  2QA4 N;  1HNX K;  1NK5 A;  3O3G A;  1Q8I A;  2FBY A;  4ICL A;  2OPS A;  3ULE A;  3QEI A;  1IBK K;  4M42 A;  2GWK A;  4CF8 A;  3R1X A;  2UU9 K;  4YOV A;  5IT9 O;  4JD2 B;  1S72 N;  1RDC A;  5K14 A;  4B3O A;  5D3G A;  1FW6 A;  2QEX N;  1TL1 A;  2HF4 A;  5AFU H;  1K8K A;  1NK6 A;  3C7N A;  3WT0 A;  3CXC M;  4DUY K;  1VQO N;  1NGE A;  1X9M A;  3AA2 A;  5AZJ A;  2B4J A;  2X78 A;  1WNS A;  4Z4E A;  3A0I X;  2DFH A;  2P9K B;  5HRR A;  1HR0 K;  4DFJ A;  2FLO A;  2E2Q A;  3NH1 A;  2HHT A;  4Y1D A;  1YUW A;  1SZ2 A;  4H0V B;  4E7L A;  1WBB A;  3CM5 A;  1C0M A;  2O8D B;  2VG6 A;  2HNY A;  3HST B;  3HVR A;  4F4K A;  3PX0 A;  1NGB A;  4BG9 A;  3CCE N;  5AQK A;  4LF9 K;  3MDQ A;  3LWL A;  4C8O A;  4DU4 A;  4DSI A;  4JD2 A;  5CE3 A;  4JHD B;  3WQU A;  3JYT A;  4N76 A;  3TTD A;  3P1G A;  2DFF A;  1KFD A;  5AR0 A;  1QS4 A;  3P5J A;  3QIN A;  3AVF A;  4ILJ A;  4XH1 A;  2OZS A;  2HMP A;  3NVM A;  3PX4 A;  3TAF A;  3VEX A;  2P9K A;  4B9Q A;  3RMB A;  1ZXO A;  4KPY A;  3NF6 A;  2PBD A;  3QBW A;  4OKJ A;  1IKY A;  4HUF A;  4BRF A;  4JS4 A;  3ZSR A;  3CPE A;  2E6M A;  1T7P A;  2O8D A;  1NGD A;  1DLO A;  4KKO A;  2CH5 A;  3F9M A;  1WSI A;  3NFA A;  4CBW A;  4CGH A;  3QEW A;  1FXX A;  2WC9 A;  3ZT0 A;  4E1M A;  3R3L A;  4JHD A;  1G99 A;  3VA0 A;  1RDB A;  4CBU A;  3CJC A;  1L3S A;  4DQP A;  1YI2 N;  3OTO K;  3CFO A;  4NXM K;  2CGK A;  3QO9 A;  3ATU A;  2WTU A;  2O8E B;  2O4I A;  1WSG A;  5H1S Q;  1VQL N;  2NUB A;  1KAZ A;  3FZK A;  3LWM A;  3LDN A;  3QES A;  1KVA A;  3RVC A;  4WFB L;  4BRI A;  3VTH A;  3V9W A;  3FZF A;  2WFB A;  5J2Q A;  4FJK A;  4BRP A;  5J1E A;  3V6D A;  5KRS A;  2D0B A;  2D0C A;  4CJ3 A;  4W5O A;  1K6Y A;  1MA9 B;  5AQP A;  1SKR A;  3OBY A;  4DFP A;  3EKS A;  3MN5 A;  3U3G A;  1NK4 A;  2A40 A;  3J8A A;  4H4O A;  2HND A;  2QWQ A;  3SMP A;  2KLA A;  3KIO A;  1SV5 A;  1OH8 A;  3NH2 A;  2YNH A;  3LAN A;  4CES A;  2RN2 A;  3CPW M;  1XQS C;  1A5X A;  2OPP A;  1GOB A;  3K58 A;  5BPN A;  2NZT A;  2O8E A;  1YJN N;  2OPR A;  1T8E A;  1OH5 A;  1IKX A;  2BUP A;  3KJV A;  5BRF A;  4BC5 A;  1JLG A;  3VQ9 A;  1MWM A;  3B8A X;  3Q7C A;  5LY3 A;  1YVN A;  1RGI A;  3ID6 A;  1UA0 A;  3IDH A;  4CF9 A;  2FF3 B;  1IO2 A;  1M1K O;  4FM1 A;  4JKB A;  1QQN A;  1P8Z A;  5AQG A;  3LDL A;  1T6D A;  2GV9 A;  4KH6 A;  1YJW N;  1Y97 A;  1NLV A;  2HNZ A;  5C15 A;  4MO5 A;  4GY2 B;  4B9M A;  1RT3 A;  3QFU A;  4JYA K;  1EKE A;  1V4T A;  3ZYY X;  3AGK A;  4BC2 A;  5BPM A;  4YDU C;  3CI5 A;  3SUQ A;  3LAL A;  1KD1 O;  3RR8 A;  3PSF A;  4C1N I;  4WCE L;  4CHZ A;  3A5L C;  4HUG A;  3BZK A;  1BI4 B;  4IEI A;  4AHS A;  3MK6 A;  2DPN A;  3THX A;  3AVG A;  4I9L A;  3SLC A;  1TYQ B;  2YV0 X;  1QSL A;  5HLF A;  3ENO A;  3PUF A;  3O4Q A;  3HBT A;  4CBX A;  4CE9 A;  3M6G A;  3NF7 A;  4JNE A;  2G8K A;  2DFE A;  2JGU A;  4A2B A;  3AGR A;  3TSP A;  3ITH A;  3T1H K;  3QEP A;  3DWL A;  4FYD A;  1VHX A;  3QET A;  3AVJ A;  2D0A A;  4RW7 A;  3HI0 A;  1K73 O;  1JLC A;  3MWP A;  4CJ5 A;  4RW9 A;  4Z0U A;  4CEZ A;  3U9Z A;  1SAZ A;  1J54 A;  4KH5 A;  1N36 K;  3J7A P;  1Z6R A;  3UKR B;  2PYL A;  3TU5 A;  4CJE A;  3ZSX A;  4BQL A;  1NG9 A;  3D6R A;  4IKF A;  2IAJ A;  4DCH A;  3CQX A;  5GAD P;  1BI4 A;  1C1B A;  5FPM A;  4FJ9 A;  2F9W A;  3WXL A;  4BR2 A;  4MDB A;  4KHY A;  1TYQ A;  3QNO A;  4B3R K;  4KB0 A;  3HYF A;  2QKK A;  4B9V A;  3EKU A;  1SKS A;  3ZSW A;  4Z94 A;  4O8K A;  4JI5 K;  2IVN A;  3P31 A;  2OPQ A;  4FSV A;  3ENH A;  4MLH A;  4K43 A;  2YI1 A;  4FWK A;  1WOQ A;  2E6L A;  3OYH A;  4JEP A;  1DTQ A;  2ASP A;  3WQT A;  2HMI A;  2ZJP L;  3T19 A;  1S9E A;  4O55 A;  3KKR A;  4CZL A;  1X1P A;  3B6P A;  4FPB A;  5F2R A;  1YT3 A;  4M7Y A;  3K5M A;  4WQ5 A;  3VQ6 A;  3ULD A;  3VQ8 A;  2QI2 A;  4PA1 A;  2HHH K;  1LOT B;  4DTX A;  3CER A;  3UKR A;  3FFI A;  1HJO A;  2PZS A;  2P5O A;  1RDD A;  2P9S B;  3WNH A;  4CZF A;  3AO2 A;  1GOA A;  3K57 A;  1BQM A;  4A59 A;  4LF8 K;  3GL1 A;  5T7B A;  2WUS A;  5AQM A;  1K9M O;  1KLM A;  3L2U A;  3FZL A;  4YNQ A;  5EXW A;  5AQU A;  4FVU A;  2AA4 A;  3AA5 X;  3AO1 A;  3CJ9 A;  4NCB A;  3CFP A;  1HNZ K;  3AVH A;  2QWL A;  3GDQ A;  3DRP A;  2ZJQ L;  3OS1 A;  4DUZ K;  1Q81 O;  4LF7 K;  3OS2 A;  2UXB K;  3G0Z A;  4C8K A;  1QSY A;  3THW B;  3G71 N;  2NRX A;  4H8K A;  1U48 A;  3LZJ A;  2G8U A;  4BDP A;  4AH9 A;  1TKT A;  2IDO A;  1W7A A;  1IBM K;  3ZT3 A;  1NMN A;  1VAZ A;  1OVY A;  1QSS A;  1KAY A;  1RBV A;  4CZI A;  2P9S A;  5M1F A;  4FLV A;  1KFS A;  3OJU A;  3R8E A;  3L3V A;  2DY4 A;  3DRS A;  4CJF A;  5JS2 A;  1EXQ A;  3ZX0 A;  1D4X A;  3HTV A;  3SNN A;  3TPQ A;  1CZ9 A;  2UUA K;  4CER A;  3G6E N;  1WLJ A;  3Q7B A;  1XI1 A;  1RTI A;  1VQ7 N;  3ENB A;  4IZ9 A;  5GIP A;  1HPZ A;  3K0S A;  2I5J A;  4RTF D;  3CFR A;  3WXI A;  2JWL A;  5GAE P;  5GAG P;  3S9H A;  2NNW A;  3VMF B;  3THW A;  3AVM A;  1HMV A;  4FL9 A;  4H03 B;  1R0A A;  1EWQ A;  3VQQ A;  4X64 K;  3RMD A;  3UKU B;  2P5G A;  3EYZ A;  4EAH D;  2Z1I A;  4LH4 A;  2X74 A;  3NHG A;  1N8R O;  3SAG A;  3PV8 A;  2EX3 A;  3KLI A;  4CJ7 A;  1Q86 O;  3CYM A;  4JI2 K;  2Q2R A;  1JXE A;  2FSN A;  3ZLJ A;  4BRM A;  4C1N K;  2ZJR L;  2W6K A;  5CYQ A;  3DLE A;  4E1N A;  2QK9 A;  4ISG A;  2XY6 A;  1Q7Y O;  3MXJ A;  4Z4I A;  4MQ3 A;  1T05 A;  4IJN A;  4B1W B;  1KAX A;  4H5R A;  2D1K A;  2Q97 A;  1RIL A;  3CCQ N;  5I3U A;  4FJG A;  1Z25 A;  4M3W A;  1NOZ A;  1W0H A;  4FPA A;  4RG8 A;  2GTD A;  1KLN A;  1D9D A;  4B3T K;  3UKU A;  1XHX A;  5HP1 A;  4DR7 K;  1KTQ A;  3LDQ A;  1BWF O;  3V9S A;  4L3Q A;  1C1C A;  2B6A A;  3BUZ B;  4FW1 A;  4F9O A;  3C95 A;  5M1P A;  4NCG A;  5FPN A;  3ATV A;  5AQI A;  2E2P A;  4EZ9 A;  2VWJ A;  3DOL A;  2BAN A;  1CZA N;  2GUI A;  4LY7 A;  3SAH A;  3SPZ A;  4PKH A;  4PY5 A;  1XC3 A;  3DLK A;  1Q82 O;  2GEL A;  4CZH A;  3MCA B;  4H0Y B;  4PKI A;  2E2N A;  1HYZ A;  4KO0 A;  3E9L A;  4QCL A;  4WQ4 C;  4J2A A;  1OVQ A;  2E8A A;  4CEE A;  4KH4 A;  2ZM6 K;  1DGK N;  3O1W A;  3T1A A;  3ZT4 A;  2BGG A;  1XC9 A;  2CGJ A;  3GE1 A;  1BO5 O;  4CFD A;  3AO5 A;  5AQY A;  2F8S A;  4BDY A;  5KGW A;  4DSE A;  1TUU A;  4B3M K;  4IEE A;  2ITM A;  3O8M A;  3EY1 A;  4FM2 A;  5JS1 A;  1BGX T;  1JJ2 M;  2O4G A;  4PL8 A;  4RW8 A;  5AZI B;  4PL7 A;  3L4Q A;  1ZBF A;  2GBZ A;  3F2K A;  3MN9 A;  1U6Z A;  3VET A;  4FJN A;  4FWN A;  4CHO A;  2ZGY A;  1BIS A;  3I8B A;  5CZ1 A;  1WSJ A;  3HO1 A;  4TSX A;  1RT2 A;  1YTU A;  2P9I B;  2D0P A;  4GV6 A;  4DQI A;  4JI0 K;  5CHI A;  2F4V K;  4EP5 A;  2HHQ A;  1IV0 A;  3HT3 A;  1T44 A;  2Z1J A;  5E41 A;  3ZX2 A;  2HOE A;  5KGX A;  4JKH A;  1Q9Y A;  3RWU A;  3DMJ A;  3VQ5 A;  3C6A A;  4ZTJ A;  1HPM A;  4H5V A;  1E3M A;  2X6N A;  3OYG A;  3HOS A;  2QW9 A;  4MLE A;  1RT6 A;  5AZI A;  5FRM A;  3C6H A;  4E0D A;  2AP1 A;  2P9P B;  1G15 A;  1NKE A;  1SUQ A;  2A1S A;  2CGL A;  4W5R A;  4Z4H A;  3MN6 A;  1RBT A;  1VQ8 N;  2QWN A;  4KHP K;  3NVK A;  4KHQ A;  4BVP A;  2QWP A;  1HNI A;  1S1W A;  1BL3 A;  3O3H A;  4YFU A;  4YOU A;  4BR4 A;  2P9I A;  3UB5 A;  2E2O A;  1YJ9 N;  1S1U A;  1VSI A;  4BC3 A;  3BZC A;  3QNN A;  2FC0 A;  3ZET B;  3LDO A;  4BRA A;  4LFA K;  2WOM A;  5MLC Q;  4UY8 O;  4JV5 K;  5AQR A;  4B1V A;  4YOW A;  3KZB A;  3DLR A;  3CMA N;  4WF9 L;  5M1N A;  4CED A;  2ATQ A;  1EP4 A;  1Z26 A;  2BH1 A;  3KK2 A;  3V1R A;  5GAH P;  2KQ2 A;  3SI6 A;  5C25 A;  1KC8 O;  2P9P A;  4BRL A;  5LL6 Z;  2ZWH A;  3H46 O;  1W2B M;  4JKC A;  1S22 A;  4FZX C;  1X9W A;  3D2E B;  3IG1 A;  3AAR A;  3CCM N;  1T3V A;  3VN5 A;  1S6Q A;  5LMU K;  2VCP A;  3D45 A;  3H08 A;  1VSK A;  4QS8 A;  2HBJ A;  3D7E O;  4NLC A;  5ADX A;  4RCH A;  5AQX A;  5C2D A;  5BR8 K;  4Z4G A;  2EHG A;  1OKJ A;  3L2Q A;  3CJB A;  3IAY A;  1RDU A;  4KRE A;  1JL2 A;  3CC7 N;  4DR6 K;  4IDK A;  5CY4 A;  3ZET A;  1NBW A;  4AHR A;  1BG3 A;  1C0T A;  1BCM A;  2O8C B;  1RTH A;  4DSK A;  1C6V A;  3MWT A;  1GLB G;  1IH7 A;  1J6Z A;  2YKN A;  2ZE2 A;  3ZT2 A;  2G8W A;  3KTQ A;  3LAM A;  3LDP A;  1JLB A;  4BE0 A;  4HCB A;  2OCE A;  3DAW A;  5AQV A;  1VK0 A;  1Z05 A;  5BRE A;  4DR3 K;  1K8A O;  4CCH A;  4FOE A;  1E4F T;  4BGB A;  1EO1 A;  3L8B A;  2RPI A;  3D2E A;  5I42 A;  2Z1G A;  3K9J A;  1KSP A;  4AM7 A;  1S6P A;  4JLH A;  5FLX O;  4IBN A;  1RT7 A;  1GLL O;  2UXC K;  4CHQ A;  4M3Y A;  4H0P A;  3VOV A;  1C0U A;  4JN4 A;  5C2F A;  3SUP A;  4CJW A;  2HHW A;  3IFR A;  4DTS A;  5HBM A;  3SBT A;  5HOO A;  2O8C A;  2XO7 A;  4A2A A;  2QM1 A;  2V52 B;  4HTU A;  1BUP A;  4EZ6 A;  4IXC A;  1NJW A;  2YHW A;  2HHX A;  3I0S A;  2RKI A;  4DF8 A;  2RF2 A;  3OS0 A;  3HJF A;  2IGI A;  3V81 A;  1HKG A;  1ZBL A;  2HBL A;  2PY5 A;  4M3X A;  1ZBS A;  4BC4 A;  1TGO A;  4CZG A;  4LD0 A;  1YIT N;  1DT9 A;  4HVJ A;  2O8F B;  4FK0 A;  3CCV N;  3M8Q A;  5HRS A;  4DLE A;  5I9E B;  3QIP A;  3AV9 A;  1LWF A;  3KLG A;  3HM9 A;  4AQY K;  3O6W A;  4FJ8 A;  3O9R A;  4YOX A;  4DR2 K;  3CD6 N;  3HSC A;  4BRG A;  2HVI A;  4M3R A;  5AQF A;  4YHH K;  4KHN A;  4IO8 A;  3VES A;  1F21 A;  3IKM A;  3P83 D;  4XIU A;  4GKK K;  4HTL A;  4YOY A;  4ID1 A;  1BCO A;  4GVM A;  3OYK A;  1D8Y A;  3OJS A;  2HST A;  4F3T A;  2XRI A;  4DSL A;  2E4L A;  3WNF A;  2YHX A;  4CFA A;  3VQ7 A;  2O8F A;  3SYZ A;  3QIC A;  1RBS A;  4O5F A;  1VQ6 N;  1QTM A;  2NRH A;  4EP4 A;  1HX1 A;  4NCA A;  3BDP A;  2P9N B;  4NO7 A;  3L0Q A;  5JMV A;  1E4G T;  4BG8 A;  3L3U A;  4O44 A;  3U4L A;  2WBN A;  4FWM A;  2CH6 A;  3QML A;  3ZSY A;  1YF5 L;  3MEE A;  1N33 K;  3ASM A;  1BIU A;  3M8S A;  4L8R B;  4IG0 A;  3THX B;  3MMV A;  4DV4 K;  3F5T A;  3WEE B;  1RBU A;  4KHW A;  2KTQ A;  3JSM A;  3OYD A;  4JAX A;  3LP1 A;  3NGY A;  4G1Q A;  4OKE A;  3P39 A;  1NMD A;  5J2P A;  3VEN A;  2ETJ A;  3S3M A;  5AQN A;  3SQ2 A;  4FLZ A;  2UXD K;  3L2V A;  1WAF A;  2P9N A;  1WUA A;  3L6Q A;  4CVN E;  3AO4 A;  5HRP A;  4J2E A;  3BF1 A;  5J2N A;  2GUP A;  2OZM A;  4G9Z A;  1T03 A;  1BA0 A;  5BN8 A;  1BOT O;  5SZT A;  3VEO A;  1XMQ K;  1IKV A;  3LPT A;  3CME N;  4FLU A;  1NKB A;  3ZSQ A;  1HUX A;  3WEE A;  3G4S N;  1BIZ A;  4DR4 K;  3QER A;  1U4B A;  2F8T A;  2UYT A;  4B1Z A;  4I9Q A;  3PY8 A;  2W41 A;  3EZ5 A;  1TK8 A;  1U47 A;  1HJR A;  1CLQ A;  3DXK B;  3V4I A;  3O08 A;  3VQB A;  4CGF A;  5HL7 L;  1WAJ A;  4ID5 A;  4KAZ A;  3J7Y P;  1RDW X;  4WE1 A;  4J8F A;  4CJQ A;  3VGM A;  3KK1 A;  3ID8 A;  4XEI A;  4QOZ B;  3LDS A;  3TAQ A;  2Z1H A;  5KPR A;  4CGJ A;  3K9K A;  1U49 A;  1XNR K;  4Z4F A;  2FF6 A;  3H6E A;  1NK8 A;  1S9G A;  3NF9 A;  2VG7 A;  2F96 A;  1NJY A;  4CD3 A;  3OVN A;  1LAV A;  4DV7 K;  4E1J A;  3VEY A;  4H4M A;  3CCL N;  1YXQ A;  5F0X A;  5GIN A;  4J2B A;  3LM2 A;  3DXK A;  3H1Q A;  2NRZ A;  2OAN A;  1RTD A;  2IOC A;  2F7T A;  4FZY A;  1ZYQ A;  4OPH A;  4DTM A;  1X3N A;  1TK0 A;  4LC9 B;  4B9T A;  1TAU A;  5DM7 L;  3EE9 A;  2YKM A;  4LSN A;  4MFB A;  2JLE A;  1DKG D;  5EX5 A;  1JL1 A;  4KRF A;  3TAP A;  1ZC6 A;  4KI6 A;  3EN9 A;  1B9F A;  5KQ8 A;  5C10 A;  3JXU A;  4AHC A;  3O4W A;  1UA1 A;  3N4P A;  1VQ9 N;  2JWK A;  1UOC A;  3K5L A;  2J4R A;  1DEJ A;  1JXB A;  1EWR A;  3A2F A;  1RT4 A;  3DLL L;  4RW6 A;  1ATS A;  4I6M B;  2V7Z A;  2W6L A;  4OPA A;  2YX6 A;  4K41 A;  5AQO A;  3AA4 A;  4EHU A;  2HHS A;  3HPG A;  3OYE A;  1OH7 A;  2KFZ A;  4PUO A;  1EET A;  3QLH A;  4FOI A;  3TR8 A;  3OW2 M;  4FCY A;  3QIO A;  3T1Y K;  3UE5 A;  1YAG A;  1KRP A;  2HBM A;  2AJQ A;  4BAC A;  2HHV A;  4Z4C A;  4H0T B;  3DLG A;  4FJJ A;  1U2V B;  4GV9 A;  5CYM A;  3AVL A;  4B9N A;  3SJJ A;  3KLH A;  1WBD A;  1RT5 A;  4IO9 L;  4GNI A;  1XUP O;  2G8H A;  2E88 A;  4AM6 A;  4B1X B;  4NLB A;  4O5B A;  1GLE G;  2QWM A;  2P51 A;  2YNI A;  3C6T A;  4LF4 K;  3QB0 A;  4DTP A;  4I6M A;  3THY B;  1MWK A;  2G8V A;  5GIO A;  4GV3 A;  3VER A;  3LPU A;  3H45 C;  5AJ3 K;  1WSE A;  3FGU A;  4B08 A;  2W40 A;  4C8M A;  5DMR A;  1QZ6 A;  5JLF A;  1HQE A;  3AVI A;  4RWT A;  1W97 L;  3LZI A;  4FJH A;  5B8H A;  1L3T A;  5SWM A;  2IC3 A;  2D5R A;  2PYJ A;  4DFM A;  3R9P A;  1TKD A;  1U2V A;  4BR5 A;  3I33 A;  4H5W A;  4N56 A;  3IRX A;  2F9T A;  1XHZ A;  4QAG A;  1VQK N;  3C94 A;  4CEB A;  1QQO A;  5KQD A;  1EX4 A;  4GW6 A;  4O0J A;  5AFU A;  3GBT A;  4FM0 A;  2ZGZ A;  3THY A;  4M3Z A;  2OTJ N;  1SKW A;  3SUO A;  3VPZ A;  1S1X A;  3DI6 A;  5M1K A;  5KI6 A;  4CHP A;  2HVH A;  2BTF A;  3KK3 A;  4OLB A;  2Q0R A;  5KTQ A;  3ZSZ A;  3S41 A;  3M1F A;  1D5A A;  3MCP A;  3U8X A;  3O9Q A;  4X62 K;  1VQ5 N;  1WSF A;  4C23 A;  4BE1 A;  3K5N A;  3DRR A;  3LP2 A;  4GVE A;  3KWI A;  1FKO A;  3SQ4 A;  2HHU A;  3C6U A;  3P38 A;  3BY5 A;  2ASM A;  4BRQ A;  1RTJ A;  3VTI A;  5DM6 L;  3VQ4 A;  4BQZ A;  4CEO A;  1M90 O;  2OYQ A;  3K59 A;  3UIQ A;  3ZT1 A;  1Q9X A;  1RBR A;  1VSM A;  4BGA A;  1WSH A;  4CIG A;  3NF8 A;  3KK7 A;  3S3N A;  1JCG A;  4W5Q A;  1IG8 A;  4FK4 A;  4JK7 A;  1FKP A;  1GLD G;  3MX5 A;  2FSK A;  1C1A A;  4Q5V A;  3VQA A;  4EHT A;  4DV0 K;  4ISF A;  2PFU A;  4YY3 K;  1SL0 A;  1REV A;  2E1Z A;  3N4Q A;  1O1W A;  5C12 A;  2HB5 A;  3TAG A;  2V7Y A;  4H0O A;  3CC4 N;  5AQQ A;  4CJ4 A;  2A6A A;  4BR7 A;  3ISN C;  4DTJ A;  4GMJ B;  1HNV A;  1I39 A;  1ITG A;  4JI3 K;  4XH4 A;  4QS9 A;  4KFB A;  5LJV A;  2ZD1 A;  3CHW A;  1QQC A;  3FFK B;  3SQ0 A;  1KVB A;  4FWQ A;  4U67 L;  4CZM A;  3C65 A;  3FZM A;  3P4I A;  1J9A A;  3R6M A;  1LCU A;  4CGG A;  3JAM O;  3NGZ A;  1NNE A;  3FE1 A;  1KCF A;  4Y0W A;  3CCR N;  3U6F A;  2YCH A;  1NM1 A;  3WXJ A;  1O13 A;  5JIC A;  3HPO A;  1FK9 A;  2E20 A;  1KVC A;  3A5M C;  1NJX A;  2VQE K;  2XY8 A;  3DXM B;  4DS5 A;  2Q3S A;  1ZBH A;  3HZ6 A;  1WN7 A;  5JVH L;  3BF3 A;  4JI1 K;  2B5J A;  3BP8 A;  4ELU A;  3K5O A;  2KHO A;  1SL2 A;  4B9U A;  3AY9 A;  2KZM A;  5HRN A;  4KB1 A;  3O3F A;  1MU2 A;  3SBG A;  3OYJ A;  4H5T A;  4JS5 A;  3RMA A;  3ZSO A;  4OVL A;  1CXU A;  1NJI O;  4LFB K;  2Q36 A; 
#chains in the Genus database with same CATH homology
 3AV9 A;  3AVC A;  3THV A;  1LWF A;  3ZCM A;  1JLC A;  4CJ5 A;  3KLG A;  3RRG A;  3HM9 A;  4M3T A;  3K2P A;  4RW9 A;  4Z0U A;  4CEZ A;  4W5T A;  1J54 A;  4FJ8 A;  3SV3 A;  4CK1 A;  2PYL A;  4ZHR A;  4B8C A;  4CJE A;  3ZSX A;  4DSL A;  4IKF A;  2IAJ A;  1BI4 A;  1C1B A;  3OY9 A;  1J53 A;  2HVI A;  4FJ9 A;  4CIE A;  3AVB A;  4N41 A;  4M3R A;  4KI4 A;  1S5J A;  4KHY A;  3OYA A;  3QNO A;  1LW0 A;  3DYA A;  4KB0 A;  3HYF A;  2QKK A;  4AHT A;  4FLX A;  3TAB A;  4B9V A;  3V9Z A;  3I8D A;  4DTR A;  1SKS A;  3ZSW A;  4CJU A;  3TI0 A;  1I3A A;  3DLH A;  4CFC A;  3LP0 A;  4C8N A;  4E3S A;  2OPQ A;  2ITG A;  3BGR A;  2VWK A;  1F21 A;  3MAQ A;  3P83 D;  4XIU A;  4FLW A;  4FXD A;  4ID1 A;  2E6L A;  1BCO A;  4DLG A;  3OYH A;  4GVM A;  3OYK A;  3SQ1 A;  1D8Y A;  3OJS A;  3F73 A;  3PX6 A;  2QKB A;  1DTQ A;  4F3T A;  2XRI A;  2HMI A;  3T19 A;  1B92 A;  1S9E A;  3KKR A;  4O55 A;  1X1P A;  2E4L A;  3WNF A;  4CFA A;  3B6P A;  1SL1 A;  1LV5 A;  1RCH A;  1LWE A;  3V1O A;  3VQ7 A;  2KZZ A;  3SYZ A;  1YT3 A;  4PQU A;  3K5M A;  4N47 A;  3NCI A;  1RBS A;  4CF1 A;  4C8L A;  1W9H A;  3VQ6 A;  3ULD A;  4JRQ A;  1QTM A;  2WON A;  3VQ8 A;  4EP4 A;  3MED A;  3PO5 A;  4F2R A;  4E7J A;  3OYC A;  4NCA A;  4PA1 A;  3TAN A;  4KTZ A;  4CJT A;  3BDP A;  1S1V A;  4DTX A;  2R7Y A;  1VSD A;  1TVR A;  3FFI A;  1BHL A;  3L3U A;  2PZS A;  4O44 A;  2P5O A;  1RDD A;  3WNH A;  3AO2 A;  3CG7 A;  3HVT A;  1GOA A;  5FDL A;  3K57 A;  4DG1 A;  4DQS A;  3ZSY A;  2KFN A;  4R5P A;  1BQM A;  4J2D A;  3MEE A;  1TAQ A;  5T7B A;  2YNG A;  4BDZ A;  1LWC A;  1BIU A;  3ASM A;  1KLM A;  4IG0 A;  4CGD A;  4CJR A;  3M8S A;  3L2U A;  3T3F A;  4YNQ A;  3TAR A;  4K8X A;  2BDP A;  2XHB A;  1J5O A;  4W5N A;  3AA5 X;  3AO1 A;  1NOY A;  4NCB A;  3CFP A;  3MEG A;  1N6Q A;  1HRH A;  1RBU A;  1U04 A;  3AVH A;  2IS3 A;  1YTA A;  3NAE A;  4KHW A;  2KTQ A;  3JSM A;  3DRP A;  4JRP A;  3OYD A;  1NK9 A;  1X9S A;  4DSF A;  3HP9 A;  3OS1 A;  3IS9 A;  3LP1 A;  3NGY A;  3LAK A;  3OS2 A;  4DFK A;  4KV8 A;  4G1Q A;  3G0Z A;  4RW4 A;  4C8K A;  1QSY A;  4OKE A;  3HK2 A;  2YHB A;  2W42 A;  4B8A B;  4H8K A;  5J2P A;  1U48 A;  1JKH A;  3LZJ A;  2ETJ A;  3MXM A;  4DQR A;  4M45 A;  3VQD A;  4PWD A;  3S3M A;  1A5W A;  1ASU A;  4CFB A;  3F9K A;  2G8U A;  4BDP A;  4AH9 A;  1TKT A;  2IDO A;  3ZT3 A;  4FLZ A;  3SQ2 A;  3L2V A;  1NKC A;  1WAF A;  3TWH A;  1LAW A;  4DQQ A;  3AO4 A;  1RDA A;  1QSS A;  4BWJ A;  5HRP A;  5J2N A;  4J2E A;  1RBV A;  4CJL A;  4OPJ A;  3OYF A;  2OZM A;  3HXM A;  1T03 A;  4FLV A;  4NYF A;  1KFS A;  3OJU A;  4B9L A;  3L3V A;  5SZT A;  2DY4 A;  3DRS A;  4CJF A;  5JS2 A;  1EXQ A;  1IKV A;  3LPT A;  3VQC A;  3KLE A;  3OYN A;  3MXI A;  3SNN A;  4FLU A;  4AIL C;  1CZ9 A;  4CER A;  1NKB A;  3ZSQ A;  1JLF A;  3G10 A;  1WLJ A;  1XI1 A;  1RTI A;  1BIZ A;  3QER A;  4B9S A;  1XWL A;  2LSN A;  4FJM A;  1HPZ A;  1U4B A;  1VSH A;  2I5J A;  2F8T A;  4I9Q A;  3CFR A;  3PY8 A;  1TV6 A;  1ZBU A;  2P1J A;  3I0R A;  3EZ5 A;  3S9H A;  1TK8 A;  1U47 A;  1HJR A;  5FRO A;  1CLQ A;  3AO3 A;  4DTO A;  3AVM A;  3VQB A;  4CGF A;  3V4I A;  1WAJ A;  1HMV A;  4ID5 A;  4KAZ A;  2A1R A;  3NDK A;  1R0A A;  4HHT A;  4DS4 A;  4WE1 A;  3VQQ A;  3RMD A;  2YHA A;  4OPK A;  5C24 A;  2G8F A;  4OGC A;  1VSF A;  4CJQ A;  2P5G A;  3EYZ A;  3OYB A;  4AHU A;  3KK1 A;  4KHN A;  2Z1I A;  1RNH A;  3B6O A;  4LH4 A;  2X74 A;  1L5U A;  1NK7 A;  4I7F A;  3NHG A;  3LDS A;  3TAQ A;  3QEV A;  4QOZ B;  1TKZ A;  1VRT A;  4DWI A;  4CHN A;  2Z1H A;  4BWM A;  3PV8 A;  3OYI A;  2EX3 A;  4CGJ A;  3KLI A;  1U49 A;  3CYM A;  2HW3 A;  3S3O A;  4ZTF A;  4Z4F A;  1JXE A;  1NK8 A;  4FJ5 A;  1S9G A;  3NF9 A;  2VG7 A;  3RTV A;  2F96 A;  4OLA A;  1NJY A;  4E19 A;  3SCX A;  3O4N A;  4F3O A;  3OVN A;  1LAV A;  3NBP A;  5CYQ A;  1VSE A;  3DLE A;  4E1N A;  4OKK A;  3M8P A;  4FJ7 A;  3CM6 A;  2XY6 A;  2QK9 A;  3MXJ A;  4FLT A;  4Z4I A;  4MQ3 A;  1T05 A;  4H4M A;  1N5Y A;  2OA8 A;  3RR7 A;  4J2B A;  1RIL A;  4HUE A;  3SPY A;  5I3U A;  1NK0 A;  4FJG A;  4FVM A;  1Z25 A;  4FW2 A;  1RTD A;  4M3W A;  1NOZ A;  1W0H A;  4AHV A;  4RG8 A;  2IOC A;  4FZY A;  1KLN A;  1ZYQ A;  1D9D A;  4DTN A;  4DTM A;  1XHX A;  4CF2 A;  4Q0B A;  3WNG A;  5HP1 A;  1TK0 A;  4Y1C A;  3SV4 A;  4B9T A;  1UWB A;  1KTQ A;  4IFV A;  1TAU A;  1JLE A;  3D0P A;  1L3U A;  2YKM A;  3VQE A;  4LSN A;  4MFB A;  2JLE A;  4KRF A;  1JL1 A;  1NK5 A;  3WNE A;  4CJK A;  3TAP A;  4KI6 A;  3O3G A;  1Q8I A;  2FBY A;  3MEC A;  4ICL A;  3V9S A;  4E7H A;  1B9F A;  2OPS A;  4LSL A;  3QEI A;  1C1C A;  2B6A A;  4FW1 A;  4KTQ A;  4AHC A;  3KLF A;  3C95 A;  1UAX A;  4NCG A;  4CF8 A;  1UA1 A;  4M42 A;  4EZ9 A;  1YVU A;  3DOL A;  1UOC A;  2VWJ A;  1L3V A;  3K5L A;  1RDC A;  5HRO A;  2BAN A;  4IG3 A;  5K14 A;  4O0I A;  4B3O A;  2GUI A;  4LY7 A;  1JXB A;  4CHY A;  5D3G A;  4KHU A;  3SPZ A;  4DU3 A;  3A2F A;  1TL1 A;  4KTW A;  4PY5 A;  4FJX A;  1RT4 A;  3DLK A;  4RW6 A;  4N5S A;  1NK6 A;  1X9M A;  3CQ8 A;  3AA2 A;  1HYZ A;  2B4J A;  2X78 A;  3AA4 A;  4KO0 A;  1ASV A;  1WNS A;  2HHS A;  4QCL A;  4Z4E A;  3HPG A;  3OYE A;  2DFH A;  4J2A A;  4CEE A;  2DTU A;  2KFZ A;  4PUO A;  1EET A;  3QLH A;  3VA3 A;  3ZT4 A;  1A5V A;  5HRR A;  3T1A A;  3RMC A;  4CK3 A;  2BGG A;  1CXQ A;  1XC9 A;  3TR8 A;  3U3Y A;  4FCY A;  3QIO A;  4DFJ A;  4CFD A;  3AO5 A;  3NH1 A;  4FZZ A;  2FBV A;  2HHT A;  4Y1D A;  4E7L A;  3CM5 A;  1KRP A;  2F8S A;  3AVA A;  4BDY A;  1C0M A;  5KGW A;  2VG6 A;  4DSE A;  2AJQ A;  4BAC A;  2HNY A;  3HST B;  3HVR A;  4F4K A;  3PX0 A;  2HHV A;  4Z4C A;  5EU7 A;  1YTU A;  3DLG A;  4FJJ A;  1GOC A;  5CYM A;  3LWL A;  3EY1 A;  4FM2 A;  5JS1 A;  1BGX T;  3AVL A;  2O4G A;  4B9N A;  4RW8 A;  1LW2 A;  3SJJ A;  3KLH A;  1RT5 A;  4C8O A;  1ZBF A;  4DU4 A;  2GBZ A;  2G8H A;  4DSI A;  1NJZ A;  4FJN A;  4CHO A;  3L2R A;  1BIS A;  3JYT A;  4N76 A;  4CK2 A;  3P1G A;  2DFF A;  4O5B A;  1HQU A;  1KFD A;  1WSJ A;  5CZ1 A;  3HO1 A;  4TSX A;  1RT2 A;  4FJI A;  2VG5 A;  2P51 A;  1QS4 A;  2YNI A;  3AA3 A;  3AVF A;  3C6T A;  3P5J A;  3QIN A;  5DK5 A;  3NGI A;  4DTP A;  2OZS A;  3V9X A;  2ZQB A;  2G8V A;  4DQI A;  3PX4 A;  3TAM A;  1HYV A;  4EP5 A;  3LPU A;  3TAF A;  2HHQ A;  1TKX A;  3KD5 E;  3RMB A;  1WSE A;  1TL3 A;  2XY7 A;  4B08 A;  3HT3 A;  4LH5 A;  4KPY A;  3NF6 A;  3E01 A;  5DMR A;  4C8M A;  1HQE A;  2Z1J A;  1IKY A;  3AVI A;  4OKJ A;  5E41 A;  3LZI A;  4FJH A;  3HL8 A;  4HUF A;  1L3T A;  5KGX A;  4JS4 A;  5SWM A;  3ZSR A;  1Q9Y A;  3PO4 A;  3RWU A;  3DMJ A;  2E6M A;  2IC3 A;  3VQ5 A;  5KRT A;  3L2W A;  2D5R A;  1T7P A;  1IG9 A;  2PYJ A;  4KHS A;  1DLO A;  4KKO A;  4ZTJ A;  3NFA A;  1WSI A;  4DFM A;  4CGH A;  2X6N A;  1TKD A;  3OYG A;  4CEC A;  1CZB A;  1JLQ A;  3AVN A;  1S1T A;  3QEW A;  1RT6 A;  5FRM A;  1FXX A;  4N56 A;  4F8R A;  4E0D A;  3IRX A;  3ZT0 A;  1G15 A;  1XHZ A;  4QAG A;  1NKE A;  1SUQ A;  4E1M A;  2A1S A;  3HPH A;  4FK2 A;  4W5R A;  3C94 A;  3VA0 A;  4CEB A;  3V9U A;  1RDB A;  4Z4H A;  1RBT A;  1EX4 A;  1L3S A;  3AVK A;  4DQP A;  4GW6 A;  4KHQ A;  4O0J A;  3CFO A;  4L8R B;  3QO9 A;  1HNI A;  1S1W A;  1BL3 A;  3O3H A;  4FM0 A;  4YFU A;  5FRN A;  4OGE A;  1ASW A;  4M3Z A;  1QE1 A;  1WSG A;  3QEX A;  1SKW A;  2O4I A;  4DF4 A;  2NUB A;  3SUO A;  2Y1I A;  1S1X A;  3LWM A;  1JLA A;  3QES A;  1KVA A;  3ALY A;  3LP3 A;  1S1U A;  3DOK A;  4FJL A;  1VSI A;  3DI6 A;  4E89 A;  3V9W A;  3QNN A;  2FC0 A;  5KI6 A;  4CHP A;  5J2Q A;  4FJK A;  2HVH A;  5J1E A;  3KK3 A;  3V6D A;  5KRS A;  2D0B A;  4CJP A;  4OLB A;  2D0C A;  5KTQ A;  2WOM A;  3ZSZ A;  3M8R A;  4CJ3 A;  4E7K A;  1D5A A;  4W5O A;  1K6Y A;  3DLR A;  2QXF A;  1WSF A;  4OJR A;  1SKR A;  5C42 A;  4CED A;  2ATQ A;  1EP4 A;  4BE1 A;  3SZ2 A;  3SUN A;  3K5N A;  4HCC A;  1Z26 A;  1VSL A;  3DRR A;  1BQN A;  4DFP A;  3TAE A;  3LP2 A;  1D9F A;  3KK2 A;  3V1R A;  2KQ2 A;  3SI6 A;  3U3G A;  5C25 A;  1NK4 A;  1FKO A;  2X6S A;  3KKS A;  4CF0 A;  3SQ4 A;  4BE2 A;  2HHU A;  3C6U A;  4H4O A;  3HP6 A;  2HND A;  4FZX C;  3KIO A;  1SV5 A;  1X9W A;  3IG1 A;  4DSJ A;  3DLB A;  3NH2 A;  2YNH A;  3LAN A;  1RTJ A;  4CES A;  1QHT A;  3VN5 A;  1S6Q A;  2RN2 A;  3VQ4 A;  3NH0 A;  1A5X A;  2OPP A;  1GOB A;  3D45 A;  1VSK A;  3H08 A;  4CEO A;  3K58 A;  2OYQ A;  3K59 A;  3UIQ A;  2YNF A;  3ZT1 A;  1Q9X A;  4I2P A;  1RBR A;  2OPR A;  1VSM A;  4UQG A;  4Z4G A;  1WSH A;  2EHG A;  4CIG A;  3NF8 A;  1T8E A;  1IKX A;  3L2Q A;  4M3U A;  3IAY A;  3KJV A;  2XY5 A;  4CEQ A;  4KRE A;  3OYM A;  4DMN A;  1JLG A;  1JL2 A;  3VQ9 A;  3S3N A;  4IDK A;  4F2S A;  5CY4 A;  4AHR A;  1C0T A;  1BCM A;  4CGI A;  1RTH A;  4W5Q A;  1UA0 A;  4DSK A;  4FK4 A;  1FKP A;  1C6V A;  4CF9 A;  1IO2 A;  1C1A A;  4Q5V A;  2Y1J A;  3VQA A;  1IH7 A;  4FM1 A;  2YKN A;  2ZE2 A;  3ZT2 A;  1SL0 A;  1REV A;  3LAM A;  4IFY A;  4CEA A;  1O1W A;  2G8W A;  3KTQ A;  1JLB A;  2HB5 A;  2GV9 A;  4I2Q A;  4BE0 A;  3TAG A;  4HCB A;  1VK0 A;  4ELT A;  1Y97 A;  4M41 A;  1ZBI A;  4O4G A;  4CCH A;  4CJ4 A;  4CJV A;  2HNZ A;  3ISN C;  4DTJ A;  4GMJ B;  1HNV A;  4B9M A;  1RT3 A;  4ELV A;  2G8I A;  1I39 A;  3L8B A;  2RPI A;  3V1Q A;  3RRH A;  1EKE A;  3KD1 E;  1B9D A;  5I42 A;  2Z1G A;  1ITG A;  4DTU A;  1KSP A;  1HYS A;  4E7I A;  1S6P A;  4KFB A;  4JLH A;  5CZ2 A;  4IBN A;  1RT7 A;  2ZD1 A;  3SUQ A;  1QQC A;  4CHQ A;  3LAL A;  4M3Y A;  3SQ0 A;  4NYN A;  1DTT A;  3VQP A;  1VRU A;  1KVB A;  3OYL A;  3RR8 A;  4K8Z A;  4CHZ A;  3DM2 A;  1C0U A;  3SUP A;  4CJW A;  4CIF A;  2HHW A;  4DTS A;  5HBM A;  1J9A A;  4HUG A;  1BI4 B;  4AHS A;  1IKW A;  4CGG A;  2BE2 A;  3NGZ A;  2XO7 A;  3AVG A;  1TK5 A;  4HTU A;  4I9L A;  4EZ6 A;  1KCF A;  2YV0 X;  3U6F A;  4DU1 A;  1QSL A;  1NJW A;  2HHX A;  3I0S A;  2KW4 A;  3HPO A;  5HLF A;  2FBX A;  1FK9 A;  1VSJ A;  2RKI A;  3PUF A;  4DF8 A;  2RF2 A;  3O4Q A;  4CE9 A;  3OS0 A;  1KVC A;  4DLE A;  1NJX A;  2IGI A;  3HJF A;  2XY8 A;  4CEF A;  3V81 A;  3NF7 A;  2Q3S A;  4DS5 A;  2G8K A;  1ZBH A;  2DFE A;  2FBT A;  3ZSV A;  1WN7 A;  4FLY A;  1ZBL A;  1U45 A;  2PY5 A;  4M3X A;  2JGU A;  1RT1 A;  4CJS A;  2B5J A;  3ITH A;  3QEP A;  4ELU A;  3K5O A;  1TGO A;  1SL2 A;  4B9U A;  4FYD A;  2KZM A;  4LD0 A;  5HRN A;  4KB1 A;  3O3F A;  1MU2 A;  3OYJ A;  4HVJ A;  3NE6 A;  3AVJ A;  2D0A A;  4RW7 A;  3QET A;  4JS5 A;  4FK0 A;  3RMA A;  3ZSO A;  3M8Q A;  4OVL A;  1CXU A;  5J2M A;  5HRS A;  3QIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...