4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
1MU2A 3AVGA 4KTZA 3HPOA 3A2FA 4DSLA 4NCAA 3K5LA 1ZBHA 4CCHA 4CEEA 4FJIA 2BE2A 1KSPA 3M8QA 2RKIA 4OPKA 4F8RA 1TL3A 1CXUA 3HVRA 5JS1A 4DWIA 3AA2A 1T8EA 4C8MA 3CYMA 2XY7A 3CFPA 5KI6A 4CFDA 3HL8A 4FJHA 4J2EA 4FW1A 3AVIA 2G8UA 4IKFA 1WAFA 1LW2A 2OPQA 2Z1HA 3QIPA 2RPIA 5FDLA 4CIFA 1HQEA 3QETA 1ZYQA 4FZXC 5KGWA 3SPZA 3PX4A 1RCHA 1RT5A 1DLOA 2OPRA 4Z4CA 1J5OA 4CHZA 4IFYA 1S6PA 2DFFA 4CGFA 1S1VA 3QLHA 3V4IA 4C8KA 2IGIA 3EZ5A 4E0DA 1RTJA 3LAKA 1XI1A 2ZQBA 1TAQA 3L2VA 4Z4FA 2HHSA 2ZD1A 1D9DA 1IKVA 1TGOA 4B9TA 2R7YA 1VSHA 2WOMA 3MXJA 3CM5A 4JRPA 4CJ4A 4CHYA 3KK2A 3L3VA 2LSNA 2KQ2A 1RTIA 4CJLA 3K57A 5KGXA 1C1AA 5I3UA 3LANA 1IH7A 3OYNA 4PA1A 1ASVA 4E3SA 3LP1A 4FJXA 1C1CA 4B08A 3S9HA 5HLFA 1EXQA 1RT1A 3VQCA 4DS4A 4I7FA 1UA0A 1JLBA 1RDDA 3P5JA 4F3TA 5KRTA 3PO5A 3MEEA 3OS0A 2OPPA 3F73A 3DRSA 1B92A 4M42A 1B9DA 1JL1A 1U4BA 1ZBIA 2FBXA 3V9XA 4DTXA 3QESA 4DSJA 4O5BA 1NK8A 1VSEA 4LH4A 3JSMA 4DFJA 2Y1JA 4CF1A 4DSKA 4CEAA 1HYZA 1RT7A 1U45A 2AJQA 1RBSA 2Z1IA 3SJJA 1NK0A 3T19A 3IS9A 4CJFA 4PUOA 4CHNA 3L2RA 4FK0A 3NH0A 4CK1A 2FC0A 3IG1A 4LH5A 3O3GA 2XY5A 3RTVA 4DQQA 4FLWA 1BQMA 4OKEA 3V6DA 2HHXA 1JLCA 4NYNA 3RMBA 4CEDA 3VQ4A 1B9FA 1BHLA 4OLBA 4ZTJA 4BE0A 3O4QA 3U3GA 3KTQA 1WSJA 3JYTA 2Q3SA 1EETA 3ZSVA 3AVCA 1WSIA 2O4IA 1RDAA 3MECA 1KFSA 1UOCA 4OGEA 2PY5A 1RBTA 1T05A 1FXXA 1WSFA 4AHTA 4DTNA 2OA8A 1LWCA 3ISNC 3NF6A 2QKKA 1IKYA 4CEQA 1TK5A 3KLGA 3C94A 4CK3A 4DSFA 4FJ9A 4OJRA 2A1SA 1NKEA 1YVUA 4W5NA 1LWEA 2IDOA 3D45A 4AILC 1A5WA 3AVNA 4R5PA 3EY1A 4DU3A 3QEXA 2P5GA 1F21A 1KTQA 1S1WA 4FZZA 4FLUA 3KK3A 3SUNA 3TARA 1Q9YA 4B9UA 1KVBA 4IG0A 4KREA 3QINA 1NK6A 1TL1A 2F96A 3DLGA 3CQ8A 1CZBA 3ZT1A 4JS4A 4W5QA 3QEPA 4KI6A 2Y1IA 2VG7A 3S3MA 1L3UA 1NOYA 1BGXT 4FZYA 1RT6A 4BDYA 2Z1GA 3AA5X 4B3OA 4FJJA 4NYFA 4FJGA 4CFBA 4CGJA 4Z0UA 4CEZA 2VWJA 5D3GA 3HO1A 1JXEA 4KHUA 3ZSYA 4CJVA 3VQBA 3DMJA 3NGZA 3ZT3A 4E1NA 4CJEA 1NKBA 4M3RA 3HK2A 3RRHA 3L2UA 1RTHA 1VSKA 3ZSXA 3HSTB 4KRFA 2QKBA 4E1MA 4CGHA 3TAEA 1UAXA 1L3TA 5HROA 4F4KA 2GBZA 4E7JA 4FJKA 3MAQA 3L2QA 1GOBA 2VG6A 1FKOA 1QHTA 4HUGA 3NGYA 4FK4A 2D0CA 3SCXA 5HP1A 4B9VA 4KPYA 3AVKA 3ASMA 1S5JA 3AO3A 4NCGA 5FRMA 4Z4GA 3F9KA 4TSXA 3D0PA 1HQUA 4KV8A 3ZSWA 3RRGA 1NK9A 1WAJA 3LZIA 3TAQA 1RT4A 1L3SA 3HXMA 3CG7A 2ATQA 2A1RA 5J2QA 3PUFA 2ETJA 2G8IA 3HVTA 1A5XA 1XHXA 1TKZA 4ZHRA 4CK2A 1QSSA 4GW6A 5HRNA 2HMIA 1ITGA 2HVHA 3B6OA 1HYVA 4FJMA 4EP5A 1I39A 1TKTA 4DTRA 1RT2A 4CJKA 3VQDA 3O3FA 3DRPA 2BDPA 4OGCA 2VWKA 4JS5A 2YNHA 1C1BA 1S6QA 3KKRA 4OPJA 4PQUA 1O1WA 4CGGA 3U3YA 1W0HA 4Z4HA 3NF7A 1QS4A 5C25A 3OY9A 3SQ4A 4CF0A 1VSLA 3WNGA 4CE9A 4F2SA 4FJNA 5HBMA 4KHQA 3BGRA 3VQAA 2GV9A 4W5TA 3SYZA 4C8OA 5FRNA 2IOCA 3OS1A 3HM9A 4DQPA 4Z4IA 3K5NA 3SQ1A 3SV4A 1R0AA 4ID5A 1X1PA 3SZ2A 2DY4A 2JLEA 4YFUA 4DU4A 3OYDA 4CJ3A 3WNEA 2IC3A 3ZT0A 1Z26A 2HVIA 2PZSA 1BI4A 3V1OA 3OYHA 1VSFA 4N5SA 4E89A 4DQSA 3OYIA 3TABA 4KB0A 4KFBA 3V9WA 1KLMA 4KHSA 1C0UA 1BIUA 3K58A 2ZE2A 2YHAA 3HYFA 4KTWA 2B4JA 5I42A 3DLEA 3OYJA 2RN2A 4Y1CA 1IO2A 3QO9A 3L8BA 1FK9A 1JLFA 1RDBA 4DTMA 2E6LA 5CYMA 2KZZA 2YNGA 4O4GA 3PX6A 1HPZA 5KTQA 3OYGA 1KRPA 4DFPA 3OS2A 2PYLA 4WE1A 4AH9A 1CLQA 3LALA 3V81A 1JLGA 3G10A 4HCBA 3AA3A 3QIOA 4RW8A 4CFAA 3K2PA 3AO2A 1RTDA 3ZSOA 3NDKA 3HPGA 1JLAA 3ITHA 1EP4A 4DQIA 2B6AA 4H4OA 1J9AA 3HT3A 2FBTA 3ZT4A 4KHWA 1S9EA 1Z25A 5CY4A 3AVFA 3ZSQA 3KJVA 3V9UA 5J2PA 2EX3A 3NHGA 1D9FA 2HW3A 1NK5A 3KLFA 4FLTA 5SWMA 3L3UA 2IAJA 3KLEA 1VSDA 1SKRA 4HCCA 3OYBA 4LD0A 3KK1A 2KTQA 3SPYA 4IFVA 3TWHA 3QNOA 2GUIA 2XHBA 1DTTA 1QE1A 4FM2A 3VQPA 1SL1A 3AVMA 4FJ5A 3MXIA 1SUQA 2RF2A 1NJZA 1REVA 3PX0A 1TVRA 1WSEA 3MEDA 5CYQA 3TAMA 3IRXA 2D5RA 3OYEA 3H08A 3KLHA 1G15A 4FCYA 4CJUA 1N5YA 3TAFA 4FK2A 3EYZA 1VSMA 4H8KA 1WSGA 1U04A 1X9WA 4E7IA 1FKPA 3SUPA 3QERA 4M41A 4HUFA 4KTQA 3M8PA 2DFHA 4CJRA 3ZSZA 4IBNA 1SV5A 3UIQA 2PYJA 4ICLA 4DTJA 3AVJA 4RW9A 1LV5A 4CESA 2YHBA 3LPTA 4LSNA 3RMCA 2X6NA 1KVCA 3VQ8A 5SZTA 2E6MA 3DOLA 2E4LA 2HNDA 2IS3A 4B9LA 1SKSA 4FLVA 3BDPA 1ZBFA 1EKEA 4N56A 1ASWA 4O55A 3MXMA 4EZ6A 2KW4A 5T7BA 1HNIA 3AA4A 4QAGA 4HVJA 3B6PA 1UA1A 1TAUA 2FBYA 4M3WA 3T3FA 4FJ8A 5JS2A 1BCOA 3VN5A 2X78A 3FFIA 5C42A 4CECA 4DG1A 1S1UA 1SL0A 3CM6A 1A5VA 1XHZA 2VG5A 4OKKA 1X9SA 1RBVA 1RDCA 4I2QA 3T1AA 3AO1A 5CZ2A 3AO5A 3OVNA 4CIGA 2HHVA 3NCIA 4CJTA 3K5OA 1ZBLA 3VA3A 4C8LA 4CEFA 1HYSA 3PV8A 2OZMA 4N47A 4AHCA 3DLHA 4J2DA 1YT3A 3DRRA 4N41A 1S1XA 3V9ZA 1BI4B 2F8SA 3RMAA 2I5JA 4CGIA 3TANA 3C6UA 4M3TA 3HJFA 3AO4A 3ZT2A 3IAYA 3TAGA 4F2RA 4LSLA 4MQ3A 3KKSA 3LAMA 3O4NA 3RMDA 4EZ9A 4DU1A 1BIZA 4CJ5A 2D0AA 4CEBA 3I8DA 1NKCA 2W42A 4FLZA 5J2MA 3NH1A 1VRTA 4L8RB 4JRQA 4N76A 4W5RA 3LZJA 1YTAA 2JGUA 3L2WA 3S3NA 2XRIA 4AHSA 2D0BA 2P1JA 1C6VA 1L5UA 2G8HA 1TV6A 1U47A 4ELVA 1HMVA 4I9LA 2NUBA 3NAEA 4HUEA 1BQNA 4DMNA 3NF9A 3E01A 4CJPA 4M3YA 3WNHA 4Q0BA 1QQCA 3ALYA 3DOKA 1QSLA 4CERA 4DFMA 1GOCA 5C24A 4IDKA 3TR8A 1RNHA 3LWLA 4CFCA 3VQ5A 1U49A 4QOZB 3KIOA 2XY6A 2BANA 2X6SA 5DK5A 5KRSA 1TKDA 2HHUA 4RW6A 5E41A 1LAWA 1KLNA 3NFAA 1SKWA 4FYDA 4CGDA 4BE2A 3MEGA 4ELUA 3ZCMA 4AHRA 4PWDA 3SUOA 1IG9A 3SNNA 4Y1DA 4KAZA 4BACA 2HHWA 3VQEA 3M8SA 5K14A 3AV9A 3ZSRA 3LP2A 4CF8A 1NJXA 2P5OA 4J2AA 3DLRA 4RG8A 4DQRA 4DF4A 1TK8A 3NE6A 4RW7A 1TKXA 2HHQA 1KCFA 3DLBA 4E19A 4GMJB 3NBPA 1HNVA 3LPUA 3LP3A 1XWLA 4O0JA 4CHQA 1SL2A 2QK9A 4FLYA 4CEOA 2EHGA 4CHPA 4ZTFA 1J53A 5J2NA 1WLJA 3I0SA 1S1TA 5CZ1A 2HB5A 5HRRA 3DYAA 5FROA 3DM2A 3OYKA 1RBUA 1S9GA 4FVMA 3V9SA 4ID1A 3VQ7A 3HPHA 4EP4A 3QEIA 3P83D 4AHUA 3OJSA 4DTUA 2G8FA 3U6FA 2F8TA 3AVLA 4C8NA 4DSIA 1WSHA 4IG3A 3TAPA 4FW2A 4CHOA 3S3OA 1JLEA 1NK4A 2DFEA 4FM0A 1JXBA 1X9MA 1LWFA 3DI6A 3NH2A 4O44A 3OYFA 4Z4EA 4OVLA 1CZ9A 3NF8A 4GVMA 2KFNA 3VQ9A 4ELTA 5HRSA 1C0TA 1W9HA 3NGIA 1BISA 1K6YA 2YKMA 4DTSA 1CXQA 3C6TA 1Q8IA 4CF9A 3SV3A 3O3HA 1NOZA 3AVHA 2WONA 4AHVA 4DF8A 1NK7A 2QXFA 4KI4A 4JLHA 4B9MA 1C0MA 4PY5A 3SI6A 4M3UA 4XIUA 1L3VA 2BGGA 2ITGA 4FJLA 2P51A 2Z1JA 3LP0A 4O0IA 2DTUA 4BWJA 4E7LA 1RT3A 4B9SA 1D5AA 4KHYA 4KO0A 1JLQA 2YKNA 4CJSA 2B5JA 2X74A 4RW4A 2XY8A 2HNZA 2G8KA 4K8XA 1WN7A 4DTPA 3OYAA 3QEVA 4KHNA 1UWBA 5J1EA 2YNIA 1VSIA 3LDSA 3KLIA 2G8VA 1KFDA 3OYCA 2HNYA 4M45A 2YNFA 3DLKA 4DLEA 1GOAA 1I3AA 5DMRA 3M8RA 3WNFA 1D8YA 2KFZA 3SQ0A 1T03A 2G8WA 1ASUA 1N6QA 4I9QA 3VA0A 3HP9A 3OYLA 3RR7A 1EX4A 4MFBA 1BCMA 3SQ2A 1LW0A 2OZSA 4BWMA 2O4GA 1DTQA 4YNQA 3AVAA 1QTMA 1WNSA 4E7HA 4DS5A 3V1QA 4BE1A 3V1RA 4B9NA 4K8ZA 1Q9XA 5HRPA 3CFOA 4CJWA 3TI0A 2HHTA 4HHTA 1ZBUA 2YV0X 1KVAA 1VK0A 1U48A 2XO7A 4BDPA 1RILA 4FJ7A 4FXDA 4OLAA 3K5MA 1IKWA 1HJRA 4DFKA 3G0ZA 3RR8A 3PO4A 1LAVA 4F3OA 4LY7A 4QCLA 1XC9A 4FLXA 1QSYA 1TK0A 1T7PA 3KD5E 4G1QA 4H4MA 4M3ZA 4M3XA 4FM1A 2FBVA 4CIEA 1Y97A 3OJUA 1YTUA 4W5OA 3LWMA 4B8AB 4I2PA 2OYQA 1BL3A 3P1GA 4OKJA 3SUQA 1NJWA 1JL2A 3THVA 3OYMA 3VQQA 1IKXA 1VRUA 3QNNA 1HRHA 4KB1A 4BDZA 3CFRA 1RBRA 1J54A 3C95A 4KKOA 4UQGA 4DLGA 4DSEA 3AVBA 1VSJA 5EU7A 3K59A 3HP6A 4J2BA 4E7KA 4CF2A 3PY8A 4Q5VA 2OPSA 4HTUA 4DTOA 3QEWA 4NCBA 2KZMA 1NJYA 3VQ6A 3I0RA 3RWUA 3ULDA 3KD1E 1JKHA 4B8CA 4CJQA
chains in the Genus database with same CATH superfamily
4JI6K 3G25A 4NB4A 2Q31A 3AVGA 3HPOA 3M6GA 5TKYA 4DSLA 4JD2B 3WT0A 4BC3A 3LDOA 3RSEA 3O9QA 2QXLA 2RKIA 1CXUA 1XC3A 3HVRA 4JI1K 3CYMA 5KI6A 3HL8A 4BRFA 4CIFA 5FDLA 5KGWA 1RCHA 1HUXA 4Z4CA 5DM6L 1YAGA 1FJGK 4C8KA 5C0YA 2IGIA 4JKGA 3EZ5A 1RTJA 3S41A 2E2NA 3VF2A 5AZIB 1D9DA 3NVKA 1VSHA 3MXJA 4CJ4A 4CJLA 1IJJA 1RTIA 1IH7A 1ZBSA 1ASVA 2W6LA 1LCUA 4B08A 3S9HA 5HLFA 1EXQA 4I7FA 1UA0A 1JLBA 3MEEA 3OS0A 2OPPA 3BZKA 4H0VB 1B92A 3CIPA 4FPBA 1U4BA 1YI2N 3C7NA 4O5BA 1VSEA 4DFJA 3IKMA 5AQXA 1RBSA 4PUOA 1DKGD 3T19A 4CJFA 4CHNA 3HBTA 3J81O 3CMAN 4CK1A 3IG1A 4LH5A 4BC4A 4BRDA 4U67L 3O6WA 1R59O 3WXMB 1JLCA 1HNXK 3FE1A 4JEPA 2AA4A 4JAXA 2Q3SA 1EETA 1QZ6A 3G4SN 2BTFA 4OGEA 1T05A 1WSFA 4AHTA 2OA8A 2A6AA 4H5WA 4DSFA 1RDWX 1CZAN 1U2VB 4W5NA 1LWEA 3UKRA 3D45A 1A5WA 3AVNA 3EY1A 3TTFA 1S1WA 3SUNA 1BG3A 1NGGA 4B9UA 1NK6A 2F96A 1CZBA 1TUUA 4W5QA 1BGXT 1RT6A 4FJJA 4CGJA 4Z0UA 4CEZA 3CF5L 3DMJA 3HK2A 3L2UA 3HSTB 4CVNE 1QVFM 3N4PA 2Q0UA 3KWIA 4FWKA 2GBZA 3DXKB 2PBDA 3CJ9A 4K41A 1HPMA 1FKOA 4FK4A 3DXMA 3SCXA 1X3MA 1YJ9N 3AVKA 3ASMA 3J7AP 1VQ5N 5EXWA 4Z4GA 5EY4A 1HQUA 4KV8A 3ZSWA 1WAJA 4BQLA 3LZIA 3TAQA 2IVOA 2ETJA 1TKZA 3QB0A 1T3VA 4CK2A 4GW6A 3WEEB 1ITGA 1ATSA 4U7BA 1HYVA 2KKZA 1I39A 3O5BA 4GV3A 4IEEA 3O3FA 3EEQA 3CC2N 4OGCA 2QI2A 2VWKA 4OPJA 3U3YA 4O5FA 5C25A 3SQ4A 2QA4N 1EWRA 3OY9A 3HRGA 1VQKN 4CE9A 1GLEG 4KHQA 1X9JA 4BC2A 4JI8K 4C8OA 1VHXA 4JI5K 4IOAL 4DCHA 4ID5A 1X1PA 3HM8A 3SZ2A 2F9WA 4YFUA 4CJ3A 2IC3A 5AQOA 3W3DA 2W6KA 1BI4A 4E89A 4CJ7A 4KHSA 1HX1A 1BIUA 3K58A 2ZE2A 2YHAA 4GVEA 4JYAK 2RN2A 1IO2A 3QO9A 3FZKA 3VTHA 1FK9A 2E6LA 1QQOA 1NBWA 4H0OA 3AA3A 3QIOA 1FW6A 1RTDA 2IVNA 3CQYA 2B6AA 4KHWA 1D9FA 2EX3A 2HW3A 2QWQA 4CZKA 2NLXA 4FLTA 1SKRA 3L0QA 3THYB 1Q86O 2KTQA 1WUAA 2GX9A 3GL1A 3TWHA 3QNOA 4JKEA 1DTTA 3VQPA 3AVMA 4K42A 2A42A 1TVRA 1ZC6A 3T1YK 5LL6Z 1QQNA 3TAMA 1WSEA 2ZGZA 3MEDA 5CYQA 2D5RA 3OYEA 3H08A 3KLHA 2P9SA 4ILHA 4Y0WA 4NO7A 4X64K 4H8KA 3FZLA 3SUPA 3QERA 4HUFA 2F9TA 4KTQA 1SV5A 3UIQA 3GDQA 1LV5A 4JHDA 3RMCA 2X6NA 5IWAK 3DOLA 2HNDA 3GOIA 3Q7CA 5FPMA 4DQ8A 2YHWA 5BRFA 5GINA 4CI6A 1JJ2M 1BA0A 1ASWA 1YVNA 3MXMA 2KW4A 3AA4A 2NNWA 4YDUA 3B6PA 1TAUA 2FBYA 4CZIA 3CMEN 2V7ZA 3FFIA 4CECA 4DG1A 1XHZA 2Q1NA 2VG5A 3VA3A 4C8LA 1BWFO 5LMNK 1N34K 4N41A 4N47A 3DLHA 5FPDA 3CHWA 3AO4A 3ZLJA 4BR7A 3RMDA 4DU1A 1D4XA 4CEBA 3I8DA 2W41A 5J2MA 4L8RB 4JRQA 4FVUA 4N76A 2HHHK 4I6MA 1KC8O 2P9KB 4ELVA 1HMVA 2NUBA 4JKDA 4BRAA 3CQXA 4Q0BA 3WNHA 1HNZK 1T6DA 2YI1A 1GOCA 1RNHA 2BANA 2X6SA 5DK5A 1NGJA 1TKDA 5E41A 4YORA 3O1BA 3P39A 4DV1K 1NMNA 4Y1DA 4KAZA 2HHWA 3VQEA 3DAWA 4RG8A 1TK8A 4LFBK 3AAQA 4V19S 3DLBA 3SLCA 1YJNN 4GMJB 4CZJA 5EOYA 2EHGA 3LM2A 4ZTFA 1J53A 5J2NA 1S1TA 5HRRA 3QDKA 3DLLL 1RBUA 4EP4A 3M1FA 3P83D 5F2RA 4AHUA 4DTUA 4JD2A 2G8FA 3U6FA 1YHQN 1WB9A 5AQIA 1WSHA 1BO5O 3CCVN 4BRIA 3OYFA 4GVMA 3OBWA 5ADXH 5HRSA 1W9HA 4DTSA 5BPNA 3H6EA 3C6TA 4CF9A 4MDBA 4B1YB 3SV3A 3AVHA 4DF8A 5GAHP 1V4TA 4NLCA 4H0XB 4XH5A 1L3VA 2BGGA 5JLFA 3F5TA 2P51A 3FZFA 2Z1JA 5AZIA 2DTUA 4BWJA 4IFEA 4B9SA 1GLJO 4DV3K 4K25A 2YKNA 4RW4A 2HNZA 4XH1A 3QBWA 1WN7A 3C0BA 1UWBA 3W0LA 2G8VA 3KLIA 1KFDA 3OYCA 2E8AA 3DLKA 1D8YA 5DMRA 3M8RA 3WNFA 2KFZA 3SQ0A 1T03A 1ASUA 2J4RA 3HP9A 5C10A 5C2FA 1EX4A 4MFBA 1BCMA 1BOTO 2O4GA 1VQ4N 1E3MA 2QTDA 4DS5A 2WTUA 4BE1A 3V1RA 1HKCA 4B9NA 4K8ZA 2HHTA 4HHTA 3ULEB 1T6CA 1ZBUA 4BRPA 1U48A 1RILA 4CZHA 1HJRA 3ENOA 4LY7A 1XC9A 2VGMA 5FLXO 1QSYA 4FL9A 4IJAA 4IDHA 4H4MA 4M3ZA 4M3XA 4FM1A 2FBVA 5F1XA 3OJUA 1YTUA 5GAGP 1DEJA 3SUQA 1NJIO 4KH4A 1VRUA 5AQUA 4CZGA 1HRHA 1XMQK 3AVBA 5EU7A 1SZ2A 4Q5VA 2OPSA 1N5YA 4CJQA 4WQ4A 3R9PA 3O9SA 3TSPA 1VQLN 2PFUA 1QVGM 3K5LA 4WCEL 3H1VX 1KSPA 1N32K 3SBGA 3U9DA 1TL3A 4DWIA 3AA2A 4C8MA 3CFPA 4CFDA 2ASOA 3A8YA 4IKFA 3AVIA 1K73O 2Z1HA 3BY5A 3SPZA 4K0KK 3DXKA 1J5OA 1DLOA 2OPRA 2D0OA 1NGAA 1S6PA 2DFFA 3QLHA 1HR0K 4E0DA 2FLOA 1TAQA 3HSCA 5M1PA 4Z4FA 1TGOA 1ESVA 3MCAB 4JRPA 3G71N 3VEZA 2KQ2A 4A59A 3K57A 5KGXA 4AM6A 5I3UA 3LANA 4PA1A 4E3SA 3LP1A 3WEEA 4RWTA 1RT1A 3VQCA 5AQRA 1XNQK 4F3TA 3R8EA 3PO5A 1S22A 2YJEA 4J8FA 4OX9K 4M42A 1VQON 4DTXA 4DSJA 1MDUB 1VQNN 2E5LK 3JSMA 1BDGA 4DSKA 4B1XB 1HYZA 3SJJA 1NK0A 3IUCA 3QFPA 3O9UA 1WOQA 2EWSA 4KH5A 4FLWA 4NYNA 2QWRA 3RMBA 3VQ4A 1BHLA 2UXCK 2P9NA 1WSJA 3JYTA 3ZSVA 5H1SQ 1RDAA 3BZCA 1KFSA 1UOCA 2OTJN 3CERA 2QKKA 3ISNC 3NF6A 1IKYA 4CEQA 4H5TA 3KLGA 4YHHK 4FJ9A 4OJRA 2A1SA 4PKGA 3ZX2A 3KZBA 4JNEA 4R5PA 2CGLA 2OTLN 1K8AO 3KK3A 3TARA 3EE8A 5DM7L 1TL1A 3DLGA 3MWTA 4FWNA 3ZT1A 5F0XA 3CQ8A 3QEPA 3MN5A 3CC7N 4FWSA 4B3OA 4NYFA 3OBYA 4B3MK 2VWJA 3THYA 3VQBA 3NGZA 3ZT3A 5BPMA 3C65A 4BRCA 1RTHA 4JN4A 3I33A 2A41A 3MMVA 3TAEA 3MAQA 5AR0A 3GBTA 4KPYA 3NMUA 1S5JA 3K0SA 4TSXA 2HBLA 5AQJA 4BRQA 1MWMA 2V52B 3CG7A 2A1RA 4A61A 4YY3K 3HVTA 1A5XA 4DR2K 3JXUA 1RFQA 3B6OA 1W7AA 4AM7A 3VQDA 2BDPA 4JS5A 3KKRA 5GIPA 4PQUA 1O1WA 5JMVA 4LF4K 4CF0A 4FJNA 4DR6K 3EL2A 5HBMA 4C23A 1NGIA 3BGRA 3C6HA 2GV9A 1HNWK 3A5MC 4AF1A 1KAZA 2CH5A 5AFUH 3WNEA 1SS6A 2Q36A 2HVIA 1X3NA 1IBLK 3V1OA 3FGUA 4N5SA 4KB0A 1KLMA 1NMDA 3BUZB 1NGDA 5I42A 2B4JA 3DLEA 3CI5A 3UB5A 1RDBA 3PX6A 3OYGA 4DFPA 3OS2A 1CLQA 4AH9A 2P9KA 3G10A 4JK7A 1K9MO 1OVQA 4CFAA 3K2PA 3AO2A 3CJCA 3ITHA 4DQIA 4B1VA 3O1WA 2FBTA 1S9EA 2P9PB 3ZSQA 3AVFA 5J2PA 3NHGA 5CE3A 2O8FB 2NRZA 4RCHA 5SWMA 3KLEA 1VSDA 3LDLA 1GLDG 2UXBK 1ATRA 3SPYA 1QE1A 3K9JA 1SL1A 3F2KA 4O8UA 1SUQA 3D6RA 1EO1A 3IRXA 3LL3A 1XMOK 4CJUA 2IVPA 2O8BB 3TAFA 3Q7BA 3EYZA 5BR9A 3CCLN 1X9WA 1NM1A 4E7IA 1MA9B 4LF7K 5IT9O 4DV6K 3QMLA 4M41A 5AQHA 3DWLA 2DFHA 4CJRA 3ZSZA 5AQQA 3HI0A 2VCPA 3AVJA 3MK6A 5JLHA 3EE9A 3HTVA 1KVCA 2E4LA 2IS3A 1J6ZA 4FLVA 1EKEA 3AY9A 4N56A 1HNIA 1UA1A 3WUHA 3VMFB 4FJ8A 3KVGA 2X78A 5C42A 1YXQA 3CM6A 1A5VA 1V4SA 3MN6A 1RBVA 1VQ6N 3T1AA 3NCIA 4CJTA 1ZBLA 5EVZA 4M63C 1HYSA 1S1XA 2CH6A 3EN9A 3MN9A 2F8SA 2I5JA 3TANA 4GKJK 2E2QA 2E1YA 2QWLA 4M3TA 3HJFA 3IAYA 3TAGA 3BF3A 4LSLA 3KKSA 4GNIA 4BREA 1NKCA 4FLZA 4JI7K 3NH1A 1VRTA 4JKBA 3LZJA 3L2WA 3S3NA 2G8HA 2D0BA 3I8BA 2RE2A 3MX5A 1Y64A 4I9LA 4ILGB 3NAEA 1OH6A 4LC9B 3E01A 3C6AA 1QQCA 3DOKA 3WQTA 4DFMA 4OPHA 3ULEA 3TR8A 5BREA 1Z6RA 1YJWN 4CFCA 3VQ5A 1U49A 1IBMK 3KIOA 2XY6A 2P9NB 4RW6A 1LAWA 2E1ZA 1SKWA 2WC9A 4BE2A 3ZCMA 2W40A 3SNNA 1BUPA 3M3ZA 4YOXA 3TPQA 2P5OA 3DLRA 4DQRA 4NXMK 3NE6A 1VQ7N 2I7PA 1KCFA 4E19A 3LPUA 4BVPA 2HF3A 1XWLA 4O0JA 4CHQA 1SL2A 4FLYA 4CEOA 1WLJA 1J5EK 5FROA 4WFBL 1S9GA 4FVMA 2V51B 3AAPA 3HPHA 3QEIA 3OJSA 4JI3K 2F8TA 3AVLA 4DSIA 1VQPN 3TAPA 4FW2A 3S3OA 1JLEA 3NH2A 3VENA 4OVLA 1CZ9A 4ELTA 3CPEA 2NRWA 3NGIA 1Q7YO 1BISA 5TKWA 1IBKK 1CXQA 4BC5A 2ASMA 3PIPL 4XEIA 1LOTB 2WONA 2NZTA 4Z94A 1NK7A 2QXFA 3E66A 1NGEA 4DUZK 4DV7K 4XIUA 2ITGA 4FJLA 3LP0A 4E7LA 4KHYA 4KO0A 1JLQA 2X74A 2G8KA 5M1QA 1QZ5A 4A5AA 4DTPA 3OYAA 1NGBA 5J1EA 2YNIA 2HNYA 4WQ5A 4M45A 4LF8K 1GOAA 1I3AA 2G8WA 1N6QA 4I9QA 3OYLA 5C15A 3SQ2A 4DV2K 3E9OA 2A40A 3AVAA 4BGBA 5BN9A 3T69A 5KPRA 4CJWA 4FO0A 1OVYA 1VAZA 2ZJQL 1KVAA 4FXDA 3VGLA 4DFKA 4H0YB 3G0ZA 2FF6A 2FSNA 3PO4A 3RR8A 4QCLA 3OA9A 2P9UA 4FLXA 4HWIA 3KD5E 4LF6K 1E4FT 3MCPA 1JCFA 1Y97A 3WQUA 4BGAA 4PHTX 5KPZA 4B8AB 4I2PA 2OYQA 1BL3A 3P1GA 4OKJA 1NJWA 1JL2A 3THVA 3OYMA 4A2AA 3QNNA 4KB1A 3LDPA 4BDZA 1RBRA 4QS8A 3C95A 4KKOA 1VSJA 5BRHA 4H0TB 4CF2A 3PY8A 1HKGA 4HTUA 3ZEUB 1NJYA 2A3ZA 3VQ6A 4B8CA 3CCMN 4C1NI 3H3OB 4KTZA 2GWKA 3A2FA 3DJCA 4DR4K 4FWRA 4M7YA 4CCHA 4CEEA 2BE2A 3VPZA 1DT9A 5JS1A 5LJWA 1T8EA 2GTDA 4FJHA 3WXIA 4J2EA 3OHRA 3VTIA 3QIPA 4FZXC 3PX4A 4QS7A 1RT5A 4H0PA 4CGFA 1S1VA 3V4IA 3FZMA 4CBWA 4B3TK 3LAKA 2ZQBA 2H3GX 2HHSA 1IKVA 2YCHA 4BG9A 2WOMA 3CM5A 1GLBG 4CHYA 3KK2A 1C1AA 4FWMA 4DS4A 4BVOA 3P5JA 3J80O 5KRTA 2YHXA 1JCGA 4ISEA 3F73A 4K43A 5AQYA 3THWB 3L4IA 3QESA 4YOVA 3MN7A 3R1XA 1NK8A 4LH4A 2Y1JA 4CEAA 4IEIA 4FSVA 2Z1IA 2O8CB 4B3RK 4L3QA 3L2RA 4FK0A 4IO8A 2FC0A 4XH4A 2XY5A 3RTVA 3VF6A 5MLCQ 4OKEA 3VEWA 4CEDA 4OLBA 1RDUA 3O4QA 2O4IA 3KTQA 2D1KA 3AVCA 3FLCO 3EZWA 4DTNA 1LWCA 1TK5A 2NRTA 4CK3A 4FOIA 4BY9C 4JI4K 1NKEA 5C12A 4ISGA 4PL7A 1HLUA 4AILC 3BP8A 4DU3A 3QEXA 4FLUA 1KVBA 4UY8O 4O8KA 3R6MA 4KREA 4JS4A 3D2FB 2P9PA 2ITMA 3S3MA 1L3UA 1NOYA 4H5NA 4BDYA 4KBOA 3TSUA 2Z1GA 4IOXA 5AQTA 2O8FA 3CCJN 4CFBA 5D3GA 2UUCK 3VEYA 3PLAA 3U8XA 1JXEA 4B1UB 3ZSYA 4JI2K 4CJVA 4CJEA 3FZHA 4BRNA 5GIOA 4KRFA 2QEXN 1L3TA 5HROA 4F4KA 4E7JA 4FJKA 1GOBA 4EHUA 1QHTA 4HUGA 3QBXA 4B9VA 2O8BA 2HSTA 4GY2B 3O9RA 4NCGA 3ZETB 3F9KA 5E26A 1NK9A 5AQZA 2WFBA 1BU6O 1RT4A 2OANA 5J2QA 4X66K 1XHXA 4EIAA 1QSSA 4JKCA 3AGKA 3PSFA 2HVHA 3QFUA 3H45C 3ATVA 4CJKA 4CD3A 3DRPA 1ILYA 2ZGYA 1C1BA 1S6QA 3A5NC 4CGGA 1W0HA 3NF7A 1QS4A 1W2BM 3O9TA 1VSLA 4F2SA 1DGKN 1TYQB 4FWOA 3VQAA 4W5TA 3ZX0A 1YF5L 5FRNA 3MWPA 3HM9A 1W97L 3OS1A 4Z4IA 2E20A 3K5NA 3SQ1A 3SV4A 2FXUA 5A2QO 1P8ZA 2JLEA 4DU4A 2ZF5O 3ENBA 1NG9A 3EKUA 3ID6A 1VSFA 5AQWA 4PKHA 3TABA 4KFBA 3V9WA 3WXJA 1C0UA 4DB3A 3HYFA 3OYJA 4IJNA 4BROA 4DTMA 4O4GA 1KRPA 1HPZA 5KTQA 3CCSN 2PYLA 4MO4A 4YDUC 2JWLA 3LALA 3PIOL 3VETA 3GE1A 4RW8A 2P9IB 3NDKA 3HPGA 4H4OA 3HT3A 1J9AA 1Z25A 3KJVA 5CY4A 3V9UA 3FFKB 2E2PA 2VGNA 1NK5A 3KLFA 3L3UA 1YIJN 4HCCA 4LD0A 4GKKK 2O8DB 2P9UB 1K8KB 5FPEA 3KK1A 5HL7L 4A57A 1NGHA 2O8EB 3CJ1A 2XHBA 3T7ZA 5ADXA 3EO3A 4BR5A 3VF4A 2ASPA 3MXIA 4DUYK 5LJVA 2UXDK 3QEWA 4RTFD 2PAVA 1U6ZA 4JV5K 4GV6A 3LDNA 1VSMA 3ZYYX 1NGFA 1FKPA 3ATUA 1Q81O 2UU9K 4BQZA 4ICLA 4DTJA 5KQDA 5FPNA 1VQ9N 4RW9A 2GWJA 4CESA 3LPTA 1NU0A 4LSNA 3I55N 3P4IA 5SZTA 3CXCM 4B9LA 4DR7K 4FWPA 3SMPA 1ZBFA 4DV0K 2QM1A 4EZ6A 5T7BA 4QAGA 5AQMA 4IWVA 3G6EN 2FSJA 1SL0A 1X9SA 4OO1J 1RDCA 1Z05A 3AO1A 5AJ3K 5CZ2A 3AO5A 3OVNA 4CBUA 4CIGA 4WFNL 3VEVA 4YOYA 3K5OA 5AQGA 4J2DA 5LY3A 3DRRA 3CCEN 2HF4A 3JS6A 3RMAA 4CGIA 3A0IX 5AQLA 3T1HK 1HJOA 4F2RA 3N4QA 4MQ3A 3LAMA 1XQSC 1BIZA 2QW9A 4CBXA 4WFAL 2IIRA 3L6QA 5I9EB 2W42A 3O80A 1N36K 3J7YP 1YTAA 2ZWHA 2XRIA 4AHSA 2P1JA 1C6VA 1TV6A 1U47A 2Q97A 4HUEA 3NF9A 2YHYA 4M3YA 1ZXOA 3ALYA 1QSLA 5C24A 4IDKA 1P90A 4KH6A 2ZJRL 3SAHA 3IMXA 3LWLA 4ISFA 5KRSA 2GELA 1KLNA 3NFAA 4FYDA 4CGDA 3MEGA 4ELUA 3HOSA 1I94K 4AHRA 4PWDA 3O8MA 3SUOA 3AV9A 3ZSRA 3LP2A 4CF8A 1KAXA 4CZMA 3BF1A 1HNVA 3VGMA 3LP3A 2QK9A 4CHPA 3I0SA 3ZEUA 3DM2A 3V9SA 4ID1A 4EFHA 3VQ7A 3M5RA 1KQSM 4M7XA 4C8NA 3BEXA 4IG3A 4CHOA 5GAEP 1NK4A 2DFEA 4FM0A 3ENHA 5BRDA 4E1JA 1X9MA 2FF3B 1LWFA 3DI6A 3CCUN 4O44A 4Z4EA 3B8AX 2I7NA 5AQKA 3E9PA 1Q8IA 3O3HA 1NOZA 4PY5A 1NLVA 5JVGL 2WUSA 4NLBA 4O0IA 1OH7A 1RT3A 4WQ4C 4CJSA 2D0PA 4K8XA 2GUPA 3QEVA 4BRLA 1VSIA 3O4WA 4JKHA 2YNFA 3VA0A 3THWA 2HBMA 2KLAA 2QWMA 1QTMA 3V1QA 2CGJA 4LF9K 4A2BA 3CFOA 4MLEA 2F4VK 2O8CA 2YV0X 2XO7A 4FJ7A 4OLAA 3K5MA 3CCQN 3NVMA 1LAVA 4F3OA 4JI0K 1S3XA 4H03B 1TK0A 4BR9A 3VERA 4CIEA 4W5OA 3LWMA 3CC4N 1M1KO 3SAGA 1Q82O 4CZLA 1H1VA 4DSEA 3GG4A 1SAZA 3TTDA 3K59A 3HP6A 3CETA 1VQ8N 4JKAA 1JKHA 3VEOA 3ID8A 2HHUA 1MU2A 3D2FA 1JCEA 1YITN 2HOEA 5E84A 2UUAK 4NCAA 3WXLA 2VYPA 3H3NO 1ZBHA 2Q0RA 3UKUB 4FJIA 3U9ZA 3M8QA 3D7EO 4F8RA 4FWQA 4OPKA 3THXB 4BRMA 4DHYA 2XY7A 4YOWA 4FW1A 2G8UA 3A5OC 1WAFA 1LW2A 2OPQA 3QETA 2BUPA 2RPIA 1ZYQA 1HQEA 3E1YA 4CHZA 4IFYA 2E88A 3MDQA 4CD1A 2NRXA 4H5RA 5AQSA 5AFUA 1XI1A 3I56N 3L2VA 4KHPK 2ZD1A 4B9TA 3ZETA 2R7YA 4IO9L 3L3VA 2LSNA 3OYNA 3OW2M 4FJXA 1C1CA 1NGCA 3O08A 3CJ7A 4EAHD 4A62A 1RDDA 1VQMN 3DRSA 1IG8A 1B9DA 1JL1A 1ZBIA 2FBXA 2OCEA 3V9XA 1T44A 1TYQA 4CF1A 1GLLO 1RT7A 1U45A 2AJQA 3IS9A 5EX5A 4FWLA 3HZ6A 3NH0A 3SK3A 3O3GA 3D2EB 1XUPO 4DQQA 4NXNK 4HTLA 1BQMA 3V6DA 2HHXA 1B9FA 5M1NA 3EKSA 4ZTJA 4BE0A 3KHYA 1NWKA 3U3GA 1MWKA 1WSIA 4BRKA 3MECA 1QHAA 2PY5A 1RBTA 5C2DA 1FXXA 2NRHA 3C94A 4JK8A 1YVUA 2P9LB 2IDOA 4ILJA 2P5GA 1F21A 1KTQA 2HBKA 4FZZA 3IFRA 2P9IA 1Q9YA 4IG0A 3QINA 2D4WA 5M1OA 4KI6A 2Y1IA 2VG7A 4FZYA 2QWOA 3AA5X 4FJGA 3RSEB 3HO1A 1ATNA 4KHUA 2F7TA 4R79A 4BRHA 2O8DA 4GV9A 1NKBA 1K8KA 4A5BA 4E1NA 4M3RA 3RRHA 2O8EA 1VSKA 3ZSXA 1IV0A 2QKBA 2YX6A 4E1MA 3VEXA 4CGHA 1UAXA 3L2QA 2UYTA 3LM9A 2VG6A 3NGYA 2D0CA 4JKGB 1E4GT 5HP1A 3AO3A 5BN8A 4FOEA 4B3SK 5FRMA 3D0PA 3RRGA 5BPLA 1L3SA 3HXMA 5AZJA 2ATQA 3PUFA 4IXCA 1NNEA 2G8IA 4X62K 4G9ZA 4JK9A 2VQFK 4ZHRA 4MDAA 5HRNA 4BG8A 2HMIA 5AQNA 4FJMA 4LFCK 4EP5A 5JICA 2ZM6K 1TKTA 4DTRA 1RT2A 4PL8A 4DR5K 2YNHA 3C7NB 4Z4HA 1OKJA 3WNGA 4DR1K 2AP1A 2BH1A 1QQMA 3SYZA 3F9MA 2IOCA 4DQPA 3CD6N 2HMPA 4B1ZA 1R0AA 3CPWM 3L4QA 1N33K 2DY4A 3OYDA 3ZT0A 1Z26A 3QICA 2PZSA 3OYHA 4DQSA 4C1NK 3OYIA 1GLCG 5LMUK 2HBJA 4IZ9A 4EHTA 4KTWA 5AQPA 5HOOA 4Y1CA 2QWNA 3L8BA 5AQFA 1JLFA 2KZZA 5CYMA 3UKRB 2YNGA 4AQYK 4WE1A 3V81A 1JLGA 4HCBA 4PKIA 1M90O 3ZSOA 1JLAA 1EP4A 3ZT4A 4F9OA 3E9LA 3U4LA 1Q18A 4X65K 2IAJA 3KK7A 3OYBA 4IFVA 2GUIA 4FM2A 4FJ5A 3VESA 2RF2A 1NJZA 1REVA 3PX0A 3TSQA 3J8AA 4FPAA 1G15A 4FCYA 3DXMB 1GLAG 4WYBA 2NRRA 4FK2A 2QWPA 1WSGA 1U04A 1N8RO 5KPTA 1BA1A 3M8PA 4B9QA 4IBNA 2PYJA 4YOUA 3TTCA 3CCRN 2YHBA 3VQ8A 2E6MA 3UE5A 5M1FA 1KAYA 3HOTA 4CZEA 1KD1O 1SKSA 3BDPA 2CGKA 4O55A 4HVJA 2FSKA 4M3WA 1KXPA 3T3FA 1GLFO 5JS2A 1BCOA 2Q2RA 3VN5A 2JWKA 1S1UA 4OKKA 2KHOA 4I2QA 1HKBA 3RVCA 1TUYA 2HHVA 4CEFA 4B1WB 3PV8A 2OZMA 4AHCA 4CW7B 4DV4K 1YT3A 3V9ZA 1BI4B 2RHKA 3C6UA 3SJHA 3ZT2A 3FR0A 3O4NA 4EZ9A 3IDHA 4CJ5A 2D0AA 4H5VA 1OH8A 4LF5K 4MO5A 3SBTA 1EWQA 4W5RA 1U2VA 2JGUA 2NRVA 1L5UA 3LDQA 1BQNA 4DMNA 4CJPA 1G99A 4CERA 4DR3K 5GADP 4QOZB 1S72N 3SAFA 3H1QA 4YOTA 1YUWA 1IG9A 3A5LC 4BACA 2WBNA 3M8SA 3ZX3A 5K14A 3AARA 4WQ5C 1NJXA 4J2AA 2VQEK 4DF4A 2P9SB 4RW7A 1TKXA 2HHQA 3NBPA 5BR8K 3CJAA 1OH5A 5CZ1A 3OTOK 2HB5A 4BR0A 3DYAA 3OYKA 5JVHL 2VWBA 1SQKA 2DPNA 3AGRA 4DV5K 3SMSA 3KWGA 4JHDB 3MX2A 4IOCL 3H46O 5B8HA 4LFAK 3UKUA 5CR4A 4OPAA 3P38A 3THXA 1JXBA 5M1KA 3NF8A 2KFNA 3VQ9A 1EQYA 1C0TA 3K9KA 1K6YA 2YKMA 3CJBA 1XNRK 3VOVA 4AHVA 4KI4A 4JLHA 4B9MA 1C0MA 3SI6A 4M3UA 2V7YA 2UUBK 3PSIA 2GEMA 1D5AA 5AZJB 2B5JA 2XY8A 4KHNA 3LDSA 4BR2A 3J7ZO 5CHIA 4DLEA 4I6MB 1C0FA 4BR4A 4DKWA 3RR7A 1LW0A 2OZSA 2ZJPL 4BWMA 1DTQA 4YNQA 1WNSA 4E7HA 4JKFA 1WBDA 1Q9XA 5HRPA 3TI0A 5AQVA 4BDPA 1VK0A 4WF9L 1IKWA 2A5XA 3TU5A 3D2EA 3P31A 1T7PA 3R3LA 4G1QA 4QS9A 3JAMO 4MLHA 2E2OA 1RGIA 4BRGA 5ELZA 3VQQA 1IKXA 3VGKA 1C0GA 3CFRA 1J54A 1O13A 3WXKA 4UQGA 2P9LA 2YJFA 4DLGA 4J2BA 4E7KA 5KQ8A 4CZFA 2KZMA 4DTOA 1WBBA 4NCBA 3I0RA 3RWUA 3ULDA 3KD1E
chains in the Genus database with same CATH topology
1MU2A 3AVGA 4KTZA 3HPOA 3A2FA 4DSLA 4NCAA 3K5LA 1ZBHA 4CCHA 4CEEA 4FJIA 2BE2A 1KSPA 3M8QA 2RKIA 4OPKA 4F8RA 1TL3A 1CXUA 3HVRA 5JS1A 4DWIA 3AA2A 1T8EA 4C8MA 3CYMA 2XY7A 3CFPA 5KI6A 4CFDA 3HL8A 4FJHA 4J2EA 4FW1A 3AVIA 2G8UA 4IKFA 1WAFA 1LW2A 2OPQA 2Z1HA 3QIPA 2RPIA 5FDLA 4CIFA 1HQEA 3QETA 1ZYQA 4FZXC 5KGWA 3SPZA 3PX4A 1RCHA 1RT5A 1DLOA 2OPRA 4Z4CA 1J5OA 4CHZA 4IFYA 1S6PA 2DFFA 4CGFA 1S1VA 3QLHA 3V4IA 4C8KA 2IGIA 3EZ5A 4E0DA 1RTJA 3LAKA 1XI1A 2ZQBA 1TAQA 3L2VA 4Z4FA 2HHSA 2ZD1A 1D9DA 1IKVA 1TGOA 4B9TA 2R7YA 1VSHA 2WOMA 3MXJA 3CM5A 4JRPA 4CJ4A 4CHYA 3KK2A 3L3VA 2LSNA 2KQ2A 1RTIA 4CJLA 3K57A 5KGXA 1C1AA 5I3UA 3LANA 1IH7A 3OYNA 4PA1A 1ASVA 4E3SA 3LP1A 4FJXA 1C1CA 4B08A 3S9HA 5HLFA 1EXQA 1RT1A 3VQCA 4DS4A 4I7FA 1UA0A 1JLBA 1RDDA 3P5JA 4F3TA 5KRTA 3PO5A 3MEEA 3OS0A 2OPPA 3F73A 3DRSA 1B92A 4M42A 1B9DA 1JL1A 1U4BA 1ZBIA 2FBXA 3V9XA 4DTXA 3QESA 4DSJA 4O5BA 1NK8A 1VSEA 4LH4A 3JSMA 4DFJA 2Y1JA 4CF1A 4DSKA 4CEAA 1HYZA 1RT7A 1U45A 2AJQA 1RBSA 2Z1IA 3SJJA 1NK0A 3T19A 3IS9A 4CJFA 4PUOA 4CHNA 3L2RA 4FK0A 3NH0A 4CK1A 2FC0A 3IG1A 4LH5A 3O3GA 2XY5A 3RTVA 4DQQA 4FLWA 1BQMA 4OKEA 3V6DA 2HHXA 1JLCA 4NYNA 3RMBA 4CEDA 3VQ4A 1B9FA 1BHLA 4OLBA 4ZTJA 4BE0A 3O4QA 3U3GA 3KTQA 1WSJA 3JYTA 2Q3SA 1EETA 3ZSVA 3AVCA 1WSIA 2O4IA 1RDAA 3MECA 1KFSA 1UOCA 4OGEA 2PY5A 1RBTA 1T05A 1FXXA 1WSFA 4AHTA 4DTNA 2OA8A 1LWCA 3ISNC 3NF6A 2QKKA 1IKYA 4CEQA 1TK5A 3KLGA 3C94A 4CK3A 4DSFA 4FJ9A 4OJRA 2A1SA 1NKEA 1YVUA 4W5NA 1LWEA 2IDOA 3D45A 4AILC 1A5WA 3AVNA 4R5PA 3EY1A 4DU3A 3QEXA 2P5GA 1F21A 1KTQA 1S1WA 4FZZA 4FLUA 3KK3A 3SUNA 3TARA 1Q9YA 4B9UA 1KVBA 4IG0A 4KREA 3QINA 1NK6A 1TL1A 2F96A 3DLGA 3CQ8A 1CZBA 3ZT1A 4JS4A 4W5QA 3QEPA 4KI6A 2Y1IA 2VG7A 3S3MA 1L3UA 1NOYA 1BGXT 4FZYA 1RT6A 4BDYA 2Z1GA 3AA5X 4B3OA 4FJJA 4NYFA 4FJGA 4CFBA 4CGJA 4Z0UA 4CEZA 2VWJA 5D3GA 3HO1A 1JXEA 4KHUA 3ZSYA 4CJVA 3VQBA 3DMJA 3NGZA 3ZT3A 4E1NA 4CJEA 1NKBA 4M3RA 3HK2A 3RRHA 3L2UA 1RTHA 1VSKA 3ZSXA 3HSTB 4KRFA 2QKBA 4E1MA 4CGHA 3TAEA 1UAXA 1L3TA 5HROA 4F4KA 2GBZA 4E7JA 4FJKA 3MAQA 3L2QA 1GOBA 2VG6A 1FKOA 1QHTA 4HUGA 3NGYA 4FK4A 2D0CA 3SCXA 5HP1A 4B9VA 4KPYA 3AVKA 3ASMA 1S5JA 3AO3A 4NCGA 5FRMA 4Z4GA 3F9KA 4TSXA 3D0PA 1HQUA 4KV8A 3ZSWA 3RRGA 1NK9A 1WAJA 3LZIA 3TAQA 1RT4A 1L3SA 3HXMA 3CG7A 2ATQA 2A1RA 5J2QA 3PUFA 2ETJA 2G8IA 3HVTA 1A5XA 1XHXA 1TKZA 4ZHRA 4CK2A 1QSSA 4GW6A 5HRNA 2HMIA 1ITGA 2HVHA 3B6OA 1HYVA 4FJMA 4EP5A 1I39A 1TKTA 4DTRA 1RT2A 4CJKA 3VQDA 3O3FA 3DRPA 2BDPA 4OGCA 2VWKA 4JS5A 2YNHA 1C1BA 1S6QA 3KKRA 4OPJA 4PQUA 1O1WA 4CGGA 3U3YA 1W0HA 4Z4HA 3NF7A 1QS4A 5C25A 3OY9A 3SQ4A 4CF0A 1VSLA 3WNGA 4CE9A 4F2SA 4FJNA 5HBMA 4KHQA 3BGRA 3VQAA 2GV9A 4W5TA 3SYZA 4C8OA 5FRNA 2IOCA 3OS1A 3HM9A 4DQPA 4Z4IA 3K5NA 3SQ1A 3SV4A 1R0AA 4ID5A 1X1PA 3SZ2A 2DY4A 2JLEA 4YFUA 4DU4A 3OYDA 4CJ3A 3WNEA 2IC3A 3ZT0A 1Z26A 2HVIA 2PZSA 1BI4A 3V1OA 3OYHA 1VSFA 4N5SA 4E89A 4DQSA 3OYIA 3TABA 4KB0A 4KFBA 3V9WA 1KLMA 4KHSA 1C0UA 1BIUA 3K58A 2ZE2A 2YHAA 3HYFA 4KTWA 2B4JA 5I42A 3DLEA 3OYJA 2RN2A 4Y1CA 1IO2A 3QO9A 3L8BA 1FK9A 1JLFA 1RDBA 4DTMA 2E6LA 5CYMA 2KZZA 2YNGA 4O4GA 3PX6A 1HPZA 5KTQA 3OYGA 1KRPA 4DFPA 3OS2A 2PYLA 4WE1A 4AH9A 1CLQA 3LALA 3V81A 1JLGA 3G10A 4HCBA 3AA3A 3QIOA 4RW8A 4CFAA 3K2PA 3AO2A 1RTDA 3ZSOA 3NDKA 3HPGA 1JLAA 3ITHA 1EP4A 4DQIA 2B6AA 4H4OA 1J9AA 3HT3A 2FBTA 3ZT4A 4KHWA 1S9EA 1Z25A 5CY4A 3AVFA 3ZSQA 3KJVA 3V9UA 5J2PA 2EX3A 3NHGA 1D9FA 2HW3A 1NK5A 3KLFA 4FLTA 5SWMA 3L3UA 2IAJA 3KLEA 1VSDA 1SKRA 4HCCA 3OYBA 4LD0A 3KK1A 2KTQA 3SPYA 4IFVA 3TWHA 3QNOA 2GUIA 2XHBA 1DTTA 1QE1A 4FM2A 3VQPA 1SL1A 3AVMA 4FJ5A 3MXIA 1SUQA 2RF2A 1NJZA 1REVA 3PX0A 1TVRA 1WSEA 3MEDA 5CYQA 3TAMA 3IRXA 2D5RA 3OYEA 3H08A 3KLHA 1G15A 4FCYA 4CJUA 1N5YA 3TAFA 4FK2A 3EYZA 1VSMA 4H8KA 1WSGA 1U04A 1X9WA 4E7IA 1FKPA 3SUPA 3QERA 4M41A 4HUFA 4KTQA 3M8PA 2DFHA 4CJRA 3ZSZA 4IBNA 1SV5A 3UIQA 2PYJA 4ICLA 4DTJA 3AVJA 4RW9A 1LV5A 4CESA 2YHBA 3LPTA 4LSNA 3RMCA 2X6NA 1KVCA 3VQ8A 5SZTA 2E6MA 3DOLA 2E4LA 2HNDA 2IS3A 4B9LA 1SKSA 4FLVA 3BDPA 1ZBFA 1EKEA 4N56A 1ASWA 4O55A 3MXMA 4EZ6A 2KW4A 5T7BA 1HNIA 3AA4A 4QAGA 4HVJA 3B6PA 1UA1A 1TAUA 2FBYA 4M3WA 3T3FA 4FJ8A 5JS2A 1BCOA 3VN5A 2X78A 3FFIA 5C42A 4CECA 4DG1A 1S1UA 1SL0A 3CM6A 1A5VA 1XHZA 2VG5A 4OKKA 1X9SA 1RBVA 1RDCA 4I2QA 3T1AA 3AO1A 5CZ2A 3AO5A 3OVNA 4CIGA 2HHVA 3NCIA 4CJTA 3K5OA 1ZBLA 3VA3A 4C8LA 4CEFA 1HYSA 3PV8A 2OZMA 4N47A 4AHCA 3DLHA 4J2DA 1YT3A 3DRRA 4N41A 1S1XA 3V9ZA 1BI4B 2F8SA 3RMAA 2I5JA 4CGIA 3TANA 3C6UA 4M3TA 3HJFA 3AO4A 3ZT2A 3IAYA 3TAGA 4F2RA 4LSLA 4MQ3A 3KKSA 3LAMA 3O4NA 3RMDA 4EZ9A 4DU1A 1BIZA 4CJ5A 2D0AA 4CEBA 3I8DA 1NKCA 2W42A 4FLZA 5J2MA 3NH1A 1VRTA 4L8RB 4JRQA 4N76A 4W5RA 3LZJA 1YTAA 2JGUA 3L2WA 3S3NA 2XRIA 4AHSA 2D0BA 2P1JA 1C6VA 1L5UA 2G8HA 1TV6A 1U47A 4ELVA 1HMVA 4I9LA 2NUBA 3NAEA 4HUEA 1BQNA 4DMNA 3NF9A 3E01A 4CJPA 4M3YA 3WNHA 4Q0BA 1QQCA 3ALYA 3DOKA 1QSLA 4CERA 4DFMA 1GOCA 5C24A 4IDKA 3TR8A 1RNHA 3LWLA 4CFCA 3VQ5A 1U49A 4QOZB 3KIOA 2XY6A 2BANA 2X6SA 5DK5A 5KRSA 1TKDA 2HHUA 4RW6A 5E41A 1LAWA 1KLNA 3NFAA 1SKWA 4FYDA 4CGDA 4BE2A 3MEGA 4ELUA 3ZCMA 4AHRA 4PWDA 3SUOA 1IG9A 3SNNA 4Y1DA 4KAZA 4BACA 2HHWA 3VQEA 3M8SA 5K14A 3AV9A 3ZSRA 3LP2A 4CF8A 1NJXA 2P5OA 4J2AA 3DLRA 4RG8A 4DQRA 4DF4A 1TK8A 3NE6A 4RW7A 1TKXA 2HHQA 1KCFA 3DLBA 4E19A 4GMJB 3NBPA 1HNVA 3LPUA 3LP3A 1XWLA 4O0JA 4CHQA 1SL2A 2QK9A 4FLYA 4CEOA 2EHGA 4CHPA 4ZTFA 1J53A 5J2NA 1WLJA 3I0SA 1S1TA 5CZ1A 2HB5A 5HRRA 3DYAA 5FROA 3DM2A 3OYKA 1RBUA 1S9GA 4FVMA 3V9SA 4ID1A 3VQ7A 3HPHA 4EP4A 3QEIA 3P83D 4AHUA 3OJSA 4DTUA 2G8FA 3U6FA 2F8TA 3AVLA 4C8NA 4DSIA 1WSHA 4IG3A 3TAPA 4FW2A 4CHOA 3S3OA 1JLEA 1NK4A 2DFEA 4FM0A 1JXBA 1X9MA 1LWFA 3DI6A 3NH2A 4O44A 3OYFA 4Z4EA 4OVLA 1CZ9A 3NF8A 4GVMA 2KFNA 3VQ9A 4ELTA 5HRSA 1C0TA 1W9HA 3NGIA 1BISA 1K6YA 2YKMA 4DTSA 1CXQA 3C6TA 1Q8IA 4CF9A 3SV3A 3O3HA 1NOZA 3AVHA 2WONA 4AHVA 4DF8A 1NK7A 2QXFA 4KI4A 4JLHA 4B9MA 1C0MA 4PY5A 3SI6A 4M3UA 4XIUA 1L3VA 2BGGA 2ITGA 4FJLA 2P51A 2Z1JA 3LP0A 4O0IA 2DTUA 4BWJA 4E7LA 1RT3A 4B9SA 1D5AA 4KHYA 4KO0A 1JLQA 2YKNA 4CJSA 2B5JA 2X74A 4RW4A 2XY8A 2HNZA 2G8KA 4K8XA 1WN7A 4DTPA 3OYAA 3QEVA 4KHNA 1UWBA 5J1EA 2YNIA 1VSIA 3LDSA 3KLIA 2G8VA 1KFDA 3OYCA 2HNYA 4M45A 2YNFA 3DLKA 4DLEA 1GOAA 1I3AA 5DMRA 3M8RA 3WNFA 1D8YA 2KFZA 3SQ0A 1T03A 2G8WA 1ASUA 1N6QA 4I9QA 3VA0A 3HP9A 3OYLA 3RR7A 1EX4A 4MFBA 1BCMA 3SQ2A 1LW0A 2OZSA 4BWMA 2O4GA 1DTQA 4YNQA 3AVAA 1QTMA 1WNSA 4E7HA 4DS5A 3V1QA 4BE1A 3V1RA 4B9NA 4K8ZA 1Q9XA 5HRPA 3CFOA 4CJWA 3TI0A 2HHTA 4HHTA 1ZBUA 2YV0X 1KVAA 1VK0A 1U48A 2XO7A 4BDPA 1RILA 4FJ7A 4FXDA 4OLAA 3K5MA 1IKWA 1HJRA 4DFKA 3G0ZA 3RR8A 3PO4A 1LAVA 4F3OA 4LY7A 4QCLA 1XC9A 4FLXA 1QSYA 1TK0A 1T7PA 3KD5E 4G1QA 4H4MA 4M3ZA 4M3XA 4FM1A 2FBVA 4CIEA 1Y97A 3OJUA 1YTUA 4W5OA 3LWMA 4B8AB 4I2PA 2OYQA 1BL3A 3P1GA 4OKJA 3SUQA 1NJWA 1JL2A 3THVA 3OYMA 3VQQA 1IKXA 1VRUA 3QNNA 1HRHA 4KB1A 4BDZA 3CFRA 1RBRA 1J54A 3C95A 4KKOA 4UQGA 4DLGA 4DSEA 3AVBA 1VSJA 5EU7A 3K59A 3HP6A 4J2BA 4E7KA 4CF2A 3PY8A 4Q5VA 2OPSA 4HTUA 4DTOA 3QEWA 4NCBA 2KZMA 1NJYA 3VQ6A 3I0RA 3RWUA 3ULDA 3KD1E 1JKHA 4B8CA 4CJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MU2 A;  3AVG A;  4KTZ A;  3HPO A;  3A2F A;  4DSL A;  4NCA A;  3K5L A;  1ZBH A;  4CCH A;  4CEE A;  4FJI A;  2BE2 A;  1KSP A;  3M8Q A;  2RKI A;  4OPK A;  4F8R A;  1TL3 A;  1CXU A;  3HVR A;  5JS1 A;  4DWI A;  3AA2 A;  1T8E A;  4C8M A;  3CYM A;  2XY7 A;  3CFP A;  5KI6 A;  4CFD A;  3HL8 A;  4FJH A;  4J2E A;  4FW1 A;  3AVI A;  2G8U A;  4IKF A;  1WAF A;  1LW2 A;  2OPQ A;  2Z1H A;  3QIP A;  2RPI A;  5FDL A;  4CIF A;  1HQE A;  3QET A;  1ZYQ A;  4FZX C;  5KGW A;  3SPZ A;  3PX4 A;  1RCH A;  1RT5 A;  1DLO A;  2OPR A;  4Z4C A;  1J5O A;  4CHZ A;  4IFY A;  1S6P A;  2DFF A;  4CGF A;  1S1V A;  3QLH A;  3V4I A;  4C8K A;  2IGI A;  3EZ5 A;  4E0D A;  1RTJ A;  3LAK A;  1XI1 A;  2ZQB A;  1TAQ A;  3L2V A;  4Z4F A;  2HHS A;  2ZD1 A;  1D9D A;  1IKV A;  1TGO A;  4B9T A;  2R7Y A;  1VSH A;  2WOM A;  3MXJ A;  3CM5 A;  4JRP A;  4CJ4 A;  4CHY A;  3KK2 A;  3L3V A;  2LSN A;  2KQ2 A;  1RTI A;  4CJL A;  3K57 A;  5KGX A;  1C1A A;  5I3U A;  3LAN A;  1IH7 A;  3OYN A;  4PA1 A;  1ASV A;  4E3S A;  3LP1 A;  4FJX A;  1C1C A;  4B08 A;  3S9H A;  5HLF A;  1EXQ A;  1RT1 A;  3VQC A;  4DS4 A;  4I7F A;  1UA0 A;  1JLB A;  1RDD A;  3P5J A;  4F3T A;  5KRT A;  3PO5 A;  3MEE A;  3OS0 A;  2OPP A;  3F73 A;  3DRS A;  1B92 A;  4M42 A;  1B9D A;  1JL1 A;  1U4B A;  1ZBI A;  2FBX A;  3V9X A;  4DTX A;  3QES A;  4DSJ A;  4O5B A;  1NK8 A;  1VSE A;  4LH4 A;  3JSM A;  4DFJ A;  2Y1J A;  4CF1 A;  4DSK A;  4CEA A;  1HYZ A;  1RT7 A;  1U45 A;  2AJQ A;  1RBS A;  2Z1I A;  3SJJ A;  1NK0 A;  3T19 A;  3IS9 A;  4CJF A;  4PUO A;  4CHN A;  3L2R A;  4FK0 A;  3NH0 A;  4CK1 A;  2FC0 A;  3IG1 A;  4LH5 A;  3O3G A;  2XY5 A;  3RTV A;  4DQQ A;  4FLW A;  1BQM A;  4OKE A;  3V6D A;  2HHX A;  1JLC A;  4NYN A;  3RMB A;  4CED A;  3VQ4 A;  1B9F A;  1BHL A;  4OLB A;  4ZTJ A;  4BE0 A;  3O4Q A;  3U3G A;  3KTQ A;  1WSJ A;  3JYT A;  2Q3S A;  1EET A;  3ZSV A;  3AVC A;  1WSI A;  2O4I A;  1RDA A;  3MEC A;  1KFS A;  1UOC A;  4OGE A;  2PY5 A;  1RBT A;  1T05 A;  1FXX A;  1WSF A;  4AHT A;  4DTN A;  2OA8 A;  1LWC A;  3ISN C;  3NF6 A;  2QKK A;  1IKY A;  4CEQ A;  1TK5 A;  3KLG A;  3C94 A;  4CK3 A;  4DSF A;  4FJ9 A;  4OJR A;  2A1S A;  1NKE A;  1YVU A;  4W5N A;  1LWE A;  2IDO A;  3D45 A;  4AIL C;  1A5W A;  3AVN A;  4R5P A;  3EY1 A;  4DU3 A;  3QEX A;  2P5G A;  1F21 A;  1KTQ A;  1S1W A;  4FZZ A;  4FLU A;  3KK3 A;  3SUN A;  3TAR A;  1Q9Y A;  4B9U A;  1KVB A;  4IG0 A;  4KRE A;  3QIN A;  1NK6 A;  1TL1 A;  2F96 A;  3DLG A;  3CQ8 A;  1CZB A;  3ZT1 A;  4JS4 A;  4W5Q A;  3QEP A;  4KI6 A;  2Y1I A;  2VG7 A;  3S3M A;  1L3U A;  1NOY A;  1BGX T;  4FZY A;  1RT6 A;  4BDY A;  2Z1G A;  3AA5 X;  4B3O A;  4FJJ A;  4NYF A;  4FJG A;  4CFB A;  4CGJ A;  4Z0U A;  4CEZ A;  2VWJ A;  5D3G A;  3HO1 A;  1JXE A;  4KHU A;  3ZSY A;  4CJV A;  3VQB A;  3DMJ A;  3NGZ A;  3ZT3 A;  4E1N A;  4CJE A;  1NKB A;  4M3R A;  3HK2 A;  3RRH A;  3L2U A;  1RTH A;  1VSK A;  3ZSX A;  3HST B;  4KRF A;  2QKB A;  4E1M A;  4CGH A;  3TAE A;  1UAX A;  1L3T A;  5HRO A;  4F4K A;  2GBZ A;  4E7J A;  4FJK A;  3MAQ A;  3L2Q A;  1GOB A;  2VG6 A;  1FKO A;  1QHT A;  4HUG A;  3NGY A;  4FK4 A;  2D0C A;  3SCX A;  5HP1 A;  4B9V A;  4KPY A;  3AVK A;  3ASM A;  1S5J A;  3AO3 A;  4NCG A;  5FRM A;  4Z4G A;  3F9K A;  4TSX A;  3D0P A;  1HQU A;  4KV8 A;  3ZSW A;  3RRG A;  1NK9 A;  1WAJ A;  3LZI A;  3TAQ A;  1RT4 A;  1L3S A;  3HXM A;  3CG7 A;  2ATQ A;  2A1R A;  5J2Q A;  3PUF A;  2ETJ A;  2G8I A;  3HVT A;  1A5X A;  1XHX A;  1TKZ A;  4ZHR A;  4CK2 A;  1QSS A;  4GW6 A;  5HRN A;  2HMI A;  1ITG A;  2HVH A;  3B6O A;  1HYV A;  4FJM A;  4EP5 A;  1I39 A;  1TKT A;  4DTR A;  1RT2 A;  4CJK A;  3VQD A;  3O3F A;  3DRP A;  2BDP A;  4OGC A;  2VWK A;  4JS5 A;  2YNH A;  1C1B A;  1S6Q A;  3KKR A;  4OPJ A;  4PQU A;  1O1W A;  4CGG A;  3U3Y A;  1W0H A;  4Z4H A;  3NF7 A;  1QS4 A;  5C25 A;  3OY9 A;  3SQ4 A;  4CF0 A;  1VSL A;  3WNG A;  4CE9 A;  4F2S A;  4FJN A;  5HBM A;  4KHQ A;  3BGR A;  3VQA A;  2GV9 A;  4W5T A;  3SYZ A;  4C8O A;  5FRN A;  2IOC A;  3OS1 A;  3HM9 A;  4DQP A;  4Z4I A;  3K5N A;  3SQ1 A;  3SV4 A;  1R0A A;  4ID5 A;  1X1P A;  3SZ2 A;  2DY4 A;  2JLE A;  4YFU A;  4DU4 A;  3OYD A;  4CJ3 A;  3WNE A;  2IC3 A;  3ZT0 A;  1Z26 A;  2HVI A;  2PZS A;  1BI4 A;  3V1O A;  3OYH A;  1VSF A;  4N5S A;  4E89 A;  4DQS A;  3OYI A;  3TAB A;  4KB0 A;  4KFB A;  3V9W A;  1KLM A;  4KHS A;  1C0U A;  1BIU A;  3K58 A;  2ZE2 A;  2YHA A;  3HYF A;  4KTW A;  2B4J A;  5I42 A;  3DLE A;  3OYJ A;  2RN2 A;  4Y1C A;  1IO2 A;  3QO9 A;  3L8B A;  1FK9 A;  1JLF A;  1RDB A;  4DTM A;  2E6L A;  5CYM A;  2KZZ A;  2YNG A;  4O4G A;  3PX6 A;  1HPZ A;  5KTQ A;  3OYG A;  1KRP A;  4DFP A;  3OS2 A;  2PYL A;  4WE1 A;  4AH9 A;  1CLQ A;  3LAL A;  3V81 A;  1JLG A;  3G10 A;  4HCB A;  3AA3 A;  3QIO A;  4RW8 A;  4CFA A;  3K2P A;  3AO2 A;  1RTD A;  3ZSO A;  3NDK A;  3HPG A;  1JLA A;  3ITH A;  1EP4 A;  4DQI A;  2B6A A;  4H4O A;  1J9A A;  3HT3 A;  2FBT A;  3ZT4 A;  4KHW A;  1S9E A;  1Z25 A;  5CY4 A;  3AVF A;  3ZSQ A;  3KJV A;  3V9U A;  5J2P A;  2EX3 A;  3NHG A;  1D9F A;  2HW3 A;  1NK5 A;  3KLF A;  4FLT A;  5SWM A;  3L3U A;  2IAJ A;  3KLE A;  1VSD A;  1SKR A;  4HCC A;  3OYB A;  4LD0 A;  3KK1 A;  2KTQ A;  3SPY A;  4IFV A;  3TWH A;  3QNO A;  2GUI A;  2XHB A;  1DTT A;  1QE1 A;  4FM2 A;  3VQP A;  1SL1 A;  3AVM A;  4FJ5 A;  3MXI A;  1SUQ A;  2RF2 A;  1NJZ A;  1REV A;  3PX0 A;  1TVR A;  1WSE A;  3MED A;  5CYQ A;  3TAM A;  3IRX A;  2D5R A;  3OYE A;  3H08 A;  3KLH A;  1G15 A;  4FCY A;  4CJU A;  1N5Y A;  3TAF A;  4FK2 A;  3EYZ A;  1VSM A;  4H8K A;  1WSG A;  1U04 A;  1X9W A;  4E7I A;  1FKP A;  3SUP A;  3QER A;  4M41 A;  4HUF A;  4KTQ A;  3M8P A;  2DFH A;  4CJR A;  3ZSZ A;  4IBN A;  1SV5 A;  3UIQ A;  2PYJ A;  4ICL A;  4DTJ A;  3AVJ A;  4RW9 A;  1LV5 A;  4CES A;  2YHB A;  3LPT A;  4LSN A;  3RMC A;  2X6N A;  1KVC A;  3VQ8 A;  5SZT A;  2E6M A;  3DOL A;  2E4L A;  2HND A;  2IS3 A;  4B9L A;  1SKS A;  4FLV A;  3BDP A;  1ZBF A;  1EKE A;  4N56 A;  1ASW A;  4O55 A;  3MXM A;  4EZ6 A;  2KW4 A;  5T7B A;  1HNI A;  3AA4 A;  4QAG A;  4HVJ A;  3B6P A;  1UA1 A;  1TAU A;  2FBY A;  4M3W A;  3T3F A;  4FJ8 A;  5JS2 A;  1BCO A;  3VN5 A;  2X78 A;  3FFI A;  5C42 A;  4CEC A;  4DG1 A;  1S1U A;  1SL0 A;  3CM6 A;  1A5V A;  1XHZ A;  2VG5 A;  4OKK A;  1X9S A;  1RBV A;  1RDC A;  4I2Q A;  3T1A A;  3AO1 A;  5CZ2 A;  3AO5 A;  3OVN A;  4CIG A;  2HHV A;  3NCI A;  4CJT A;  3K5O A;  1ZBL A;  3VA3 A;  4C8L A;  4CEF A;  1HYS A;  3PV8 A;  2OZM A;  4N47 A;  4AHC A;  3DLH A;  4J2D A;  1YT3 A;  3DRR A;  4N41 A;  1S1X A;  3V9Z A;  1BI4 B;  2F8S A;  3RMA A;  2I5J A;  4CGI A;  3TAN A;  3C6U A;  4M3T A;  3HJF A;  3AO4 A;  3ZT2 A;  3IAY A;  3TAG A;  4F2R A;  4LSL A;  4MQ3 A;  3KKS A;  3LAM A;  3O4N A;  3RMD A;  4EZ9 A;  4DU1 A;  1BIZ A;  4CJ5 A;  2D0A A;  4CEB A;  3I8D A;  1NKC A;  2W42 A;  4FLZ A;  5J2M A;  3NH1 A;  1VRT A;  4L8R B;  4JRQ A;  4N76 A;  4W5R A;  3LZJ A;  1YTA A;  2JGU A;  3L2W A;  3S3N A;  2XRI A;  4AHS A;  2D0B A;  2P1J A;  1C6V A;  1L5U A;  2G8H A;  1TV6 A;  1U47 A;  4ELV A;  1HMV A;  4I9L A;  2NUB A;  3NAE A;  4HUE A;  1BQN A;  4DMN A;  3NF9 A;  3E01 A;  4CJP A;  4M3Y A;  3WNH A;  4Q0B A;  1QQC A;  3ALY A;  3DOK A;  1QSL A;  4CER A;  4DFM A;  1GOC A;  5C24 A;  4IDK A;  3TR8 A;  1RNH A;  3LWL A;  4CFC A;  3VQ5 A;  1U49 A;  4QOZ B;  3KIO A;  2XY6 A;  2BAN A;  2X6S A;  5DK5 A;  5KRS A;  1TKD A;  2HHU A;  4RW6 A;  5E41 A;  1LAW A;  1KLN A;  3NFA A;  1SKW A;  4FYD A;  4CGD A;  4BE2 A;  3MEG A;  4ELU A;  3ZCM A;  4AHR A;  4PWD A;  3SUO A;  1IG9 A;  3SNN A;  4Y1D A;  4KAZ A;  4BAC A;  2HHW A;  3VQE A;  3M8S A;  5K14 A;  3AV9 A;  3ZSR A;  3LP2 A;  4CF8 A;  1NJX A;  2P5O A;  4J2A A;  3DLR A;  4RG8 A;  4DQR A;  4DF4 A;  1TK8 A;  3NE6 A;  4RW7 A;  1TKX A;  2HHQ A;  1KCF A;  3DLB A;  4E19 A;  4GMJ B;  3NBP A;  1HNV A;  3LPU A;  3LP3 A;  1XWL A;  4O0J A;  4CHQ A;  1SL2 A;  2QK9 A;  4FLY A;  4CEO A;  2EHG A;  4CHP A;  4ZTF A;  1J53 A;  5J2N A;  1WLJ A;  3I0S A;  1S1T A;  5CZ1 A;  2HB5 A;  5HRR A;  3DYA A;  5FRO A;  3DM2 A;  3OYK A;  1RBU A;  1S9G A;  4FVM A;  3V9S A;  4ID1 A;  3VQ7 A;  3HPH A;  4EP4 A;  3QEI A;  3P83 D;  4AHU A;  3OJS A;  4DTU A;  2G8F A;  3U6F A;  2F8T A;  3AVL A;  4C8N A;  4DSI A;  1WSH A;  4IG3 A;  3TAP A;  4FW2 A;  4CHO A;  3S3O A;  1JLE A;  1NK4 A;  2DFE A;  4FM0 A;  1JXB A;  1X9M A;  1LWF A;  3DI6 A;  3NH2 A;  4O44 A;  3OYF A;  4Z4E A;  4OVL A;  1CZ9 A;  3NF8 A;  4GVM A;  2KFN A;  3VQ9 A;  4ELT A;  5HRS A;  1C0T A;  1W9H A;  3NGI A;  1BIS A;  1K6Y A;  2YKM A;  4DTS A;  1CXQ A;  3C6T A;  1Q8I A;  4CF9 A;  3SV3 A;  3O3H A;  1NOZ A;  3AVH A;  2WON A;  4AHV A;  4DF8 A;  1NK7 A;  2QXF A;  4KI4 A;  4JLH A;  4B9M A;  1C0M A;  4PY5 A;  3SI6 A;  4M3U A;  4XIU A;  1L3V A;  2BGG A;  2ITG A;  4FJL A;  2P51 A;  2Z1J A;  3LP0 A;  4O0I A;  2DTU A;  4BWJ A;  4E7L A;  1RT3 A;  4B9S A;  1D5A A;  4KHY A;  4KO0 A;  1JLQ A;  2YKN A;  4CJS A;  2B5J A;  2X74 A;  4RW4 A;  2XY8 A;  2HNZ A;  2G8K A;  4K8X A;  1WN7 A;  4DTP A;  3OYA A;  3QEV A;  4KHN A;  1UWB A;  5J1E A;  2YNI A;  1VSI A;  3LDS A;  3KLI A;  2G8V A;  1KFD A;  3OYC A;  2HNY A;  4M45 A;  2YNF A;  3DLK A;  4DLE A;  1GOA A;  1I3A A;  5DMR A;  3M8R A;  3WNF A;  1D8Y A;  2KFZ A;  3SQ0 A;  1T03 A;  2G8W A;  1ASU A;  1N6Q A;  4I9Q A;  3VA0 A;  3HP9 A;  3OYL A;  3RR7 A;  1EX4 A;  4MFB A;  1BCM A;  3SQ2 A;  1LW0 A;  2OZS A;  4BWM A;  2O4G A;  1DTQ A;  4YNQ A;  3AVA A;  1QTM A;  1WNS A;  4E7H A;  4DS5 A;  3V1Q A;  4BE1 A;  3V1R A;  4B9N A;  4K8Z A;  1Q9X A;  5HRP A;  3CFO A;  4CJW A;  3TI0 A;  2HHT A;  4HHT A;  1ZBU A;  2YV0 X;  1KVA A;  1VK0 A;  1U48 A;  2XO7 A;  4BDP A;  1RIL A;  4FJ7 A;  4FXD A;  4OLA A;  3K5M A;  1IKW A;  1HJR A;  4DFK A;  3G0Z A;  3RR8 A;  3PO4 A;  1LAV A;  4F3O A;  4LY7 A;  4QCL A;  1XC9 A;  4FLX A;  1QSY A;  1TK0 A;  1T7P A;  3KD5 E;  4G1Q A;  4H4M A;  4M3Z A;  4M3X A;  4FM1 A;  2FBV A;  4CIE A;  1Y97 A;  3OJU A;  1YTU A;  4W5O A;  3LWM A;  4B8A B;  4I2P A;  2OYQ A;  1BL3 A;  3P1G A;  4OKJ A;  3SUQ A;  1NJW A;  1JL2 A;  3THV A;  3OYM A;  3VQQ A;  1IKX A;  1VRU A;  3QNN A;  1HRH A;  4KB1 A;  4BDZ A;  3CFR A;  1RBR A;  1J54 A;  3C95 A;  4KKO A;  4UQG A;  4DLG A;  4DSE A;  3AVB A;  1VSJ A;  5EU7 A;  3K59 A;  3HP6 A;  4J2B A;  4E7K A;  4CF2 A;  3PY8 A;  4Q5V A;  2OPS A;  4HTU A;  4DTO A;  3QEW A;  4NCB A;  2KZM A;  1NJY A;  3VQ6 A;  3I0R A;  3RWU A;  3ULD A;  3KD1 E;  1JKH A;  4B8C A;  4CJQ A; 
#chains in the Genus database with same CATH topology
 4JI6 K;  3G25 A;  4NB4 A;  2Q31 A;  3AVG A;  3HPO A;  3M6G A;  5TKY A;  4DSL A;  4JD2 B;  3WT0 A;  4BC3 A;  3LDO A;  3RSE A;  3O9Q A;  2QXL A;  2RKI A;  1CXU A;  1XC3 A;  3HVR A;  4JI1 K;  3CYM A;  5KI6 A;  3HL8 A;  4BRF A;  4CIF A;  5FDL A;  5KGW A;  1RCH A;  1HUX A;  4Z4C A;  5DM6 L;  1YAG A;  1FJG K;  4C8K A;  5C0Y A;  2IGI A;  4JKG A;  3EZ5 A;  1RTJ A;  3S41 A;  2E2N A;  3VF2 A;  5AZI B;  1D9D A;  3NVK A;  1VSH A;  3MXJ A;  4CJ4 A;  4CJL A;  1IJJ A;  1RTI A;  1IH7 A;  1ZBS A;  1ASV A;  2W6L A;  1LCU A;  4B08 A;  3S9H A;  5HLF A;  1EXQ A;  4I7F A;  1UA0 A;  1JLB A;  3MEE A;  3OS0 A;  2OPP A;  3BZK A;  4H0V B;  1B92 A;  3CIP A;  4FPB A;  1U4B A;  1YI2 N;  3C7N A;  4O5B A;  1VSE A;  4DFJ A;  3IKM A;  5AQX A;  1RBS A;  4PUO A;  1DKG D;  3T19 A;  4CJF A;  4CHN A;  3HBT A;  3J81 O;  3CMA N;  4CK1 A;  3IG1 A;  4LH5 A;  4BC4 A;  4BRD A;  4U67 L;  3O6W A;  1R59 O;  3WXM B;  1JLC A;  1HNX K;  3FE1 A;  4JEP A;  2AA4 A;  4JAX A;  2Q3S A;  1EET A;  1QZ6 A;  3G4S N;  2BTF A;  4OGE A;  1T05 A;  1WSF A;  4AHT A;  2OA8 A;  2A6A A;  4H5W A;  4DSF A;  1RDW X;  1CZA N;  1U2V B;  4W5N A;  1LWE A;  3UKR A;  3D45 A;  1A5W A;  3AVN A;  3EY1 A;  3TTF A;  1S1W A;  3SUN A;  1BG3 A;  1NGG A;  4B9U A;  1NK6 A;  2F96 A;  1CZB A;  1TUU A;  4W5Q A;  1BGX T;  1RT6 A;  4FJJ A;  4CGJ A;  4Z0U A;  4CEZ A;  3CF5 L;  3DMJ A;  3HK2 A;  3L2U A;  3HST B;  4CVN E;  1QVF M;  3N4P A;  2Q0U A;  3KWI A;  4FWK A;  2GBZ A;  3DXK B;  2PBD A;  3CJ9 A;  4K41 A;  1HPM A;  1FKO A;  4FK4 A;  3DXM A;  3SCX A;  1X3M A;  1YJ9 N;  3AVK A;  3ASM A;  3J7A P;  1VQ5 N;  5EXW A;  4Z4G A;  5EY4 A;  1HQU A;  4KV8 A;  3ZSW A;  1WAJ A;  4BQL A;  3LZI A;  3TAQ A;  2IVO A;  2ETJ A;  1TKZ A;  3QB0 A;  1T3V A;  4CK2 A;  4GW6 A;  3WEE B;  1ITG A;  1ATS A;  4U7B A;  1HYV A;  2KKZ A;  1I39 A;  3O5B A;  4GV3 A;  4IEE A;  3O3F A;  3EEQ A;  3CC2 N;  4OGC A;  2QI2 A;  2VWK A;  4OPJ A;  3U3Y A;  4O5F A;  5C25 A;  3SQ4 A;  2QA4 N;  1EWR A;  3OY9 A;  3HRG A;  1VQK N;  4CE9 A;  1GLE G;  4KHQ A;  1X9J A;  4BC2 A;  4JI8 K;  4C8O A;  1VHX A;  4JI5 K;  4IOA L;  4DCH A;  4ID5 A;  1X1P A;  3HM8 A;  3SZ2 A;  2F9W A;  4YFU A;  4CJ3 A;  2IC3 A;  5AQO A;  3W3D A;  2W6K A;  1BI4 A;  4E89 A;  4CJ7 A;  4KHS A;  1HX1 A;  1BIU A;  3K58 A;  2ZE2 A;  2YHA A;  4GVE A;  4JYA K;  2RN2 A;  1IO2 A;  3QO9 A;  3FZK A;  3VTH A;  1FK9 A;  2E6L A;  1QQO A;  1NBW A;  4H0O A;  3AA3 A;  3QIO A;  1FW6 A;  1RTD A;  2IVN A;  3CQY A;  2B6A A;  4KHW A;  1D9F A;  2EX3 A;  2HW3 A;  2QWQ A;  4CZK A;  2NLX A;  4FLT A;  1SKR A;  3L0Q A;  3THY B;  1Q86 O;  2KTQ A;  1WUA A;  2GX9 A;  3GL1 A;  3TWH A;  3QNO A;  4JKE A;  1DTT A;  3VQP A;  3AVM A;  4K42 A;  2A42 A;  1TVR A;  1ZC6 A;  3T1Y K;  5LL6 Z;  1QQN A;  3TAM A;  1WSE A;  2ZGZ A;  3MED A;  5CYQ A;  2D5R A;  3OYE A;  3H08 A;  3KLH A;  2P9S A;  4ILH A;  4Y0W A;  4NO7 A;  4X64 K;  4H8K A;  3FZL A;  3SUP A;  3QER A;  4HUF A;  2F9T A;  4KTQ A;  1SV5 A;  3UIQ A;  3GDQ A;  1LV5 A;  4JHD A;  3RMC A;  2X6N A;  5IWA K;  3DOL A;  2HND A;  3GOI A;  3Q7C A;  5FPM A;  4DQ8 A;  2YHW A;  5BRF A;  5GIN A;  4CI6 A;  1JJ2 M;  1BA0 A;  1ASW A;  1YVN A;  3MXM A;  2KW4 A;  3AA4 A;  2NNW A;  4YDU A;  3B6P A;  1TAU A;  2FBY A;  4CZI A;  3CME N;  2V7Z A;  3FFI A;  4CEC A;  4DG1 A;  1XHZ A;  2Q1N A;  2VG5 A;  3VA3 A;  4C8L A;  1BWF O;  5LMN K;  1N34 K;  4N41 A;  4N47 A;  3DLH A;  5FPD A;  3CHW A;  3AO4 A;  3ZLJ A;  4BR7 A;  3RMD A;  4DU1 A;  1D4X A;  4CEB A;  3I8D A;  2W41 A;  5J2M A;  4L8R B;  4JRQ A;  4FVU A;  4N76 A;  2HHH K;  4I6M A;  1KC8 O;  2P9K B;  4ELV A;  1HMV A;  2NUB A;  4JKD A;  4BRA A;  3CQX A;  4Q0B A;  3WNH A;  1HNZ K;  1T6D A;  2YI1 A;  1GOC A;  1RNH A;  2BAN A;  2X6S A;  5DK5 A;  1NGJ A;  1TKD A;  5E41 A;  4YOR A;  3O1B A;  3P39 A;  4DV1 K;  1NMN A;  4Y1D A;  4KAZ A;  2HHW A;  3VQE A;  3DAW A;  4RG8 A;  1TK8 A;  4LFB K;  3AAQ A;  4V19 S;  3DLB A;  3SLC A;  1YJN N;  4GMJ B;  4CZJ A;  5EOY A;  2EHG A;  3LM2 A;  4ZTF A;  1J53 A;  5J2N A;  1S1T A;  5HRR A;  3QDK A;  3DLL L;  1RBU A;  4EP4 A;  3M1F A;  3P83 D;  5F2R A;  4AHU A;  4DTU A;  4JD2 A;  2G8F A;  3U6F A;  1YHQ N;  1WB9 A;  5AQI A;  1WSH A;  1BO5 O;  3CCV N;  4BRI A;  3OYF A;  4GVM A;  3OBW A;  5ADX H;  5HRS A;  1W9H A;  4DTS A;  5BPN A;  3H6E A;  3C6T A;  4CF9 A;  4MDB A;  4B1Y B;  3SV3 A;  3AVH A;  4DF8 A;  5GAH P;  1V4T A;  4NLC A;  4H0X B;  4XH5 A;  1L3V A;  2BGG A;  5JLF A;  3F5T A;  2P51 A;  3FZF A;  2Z1J A;  5AZI A;  2DTU A;  4BWJ A;  4IFE A;  4B9S A;  1GLJ O;  4DV3 K;  4K25 A;  2YKN A;  4RW4 A;  2HNZ A;  4XH1 A;  3QBW A;  1WN7 A;  3C0B A;  1UWB A;  3W0L A;  2G8V A;  3KLI A;  1KFD A;  3OYC A;  2E8A A;  3DLK A;  1D8Y A;  5DMR A;  3M8R A;  3WNF A;  2KFZ A;  3SQ0 A;  1T03 A;  1ASU A;  2J4R A;  3HP9 A;  5C10 A;  5C2F A;  1EX4 A;  4MFB A;  1BCM A;  1BOT O;  2O4G A;  1VQ4 N;  1E3M A;  2QTD A;  4DS5 A;  2WTU A;  4BE1 A;  3V1R A;  1HKC A;  4B9N A;  4K8Z A;  2HHT A;  4HHT A;  3ULE B;  1T6C A;  1ZBU A;  4BRP A;  1U48 A;  1RIL A;  4CZH A;  1HJR A;  3ENO A;  4LY7 A;  1XC9 A;  2VGM A;  5FLX O;  1QSY A;  4FL9 A;  4IJA A;  4IDH A;  4H4M A;  4M3Z A;  4M3X A;  4FM1 A;  2FBV A;  5F1X A;  3OJU A;  1YTU A;  5GAG P;  1DEJ A;  3SUQ A;  1NJI O;  4KH4 A;  1VRU A;  5AQU A;  4CZG A;  1HRH A;  1XMQ K;  3AVB A;  5EU7 A;  1SZ2 A;  4Q5V A;  2OPS A;  1N5Y A;  4CJQ A;  4WQ4 A;  3R9P A;  3O9S A;  3TSP A;  1VQL N;  2PFU A;  1QVG M;  3K5L A;  4WCE L;  3H1V X;  1KSP A;  1N32 K;  3SBG A;  3U9D A;  1TL3 A;  4DWI A;  3AA2 A;  4C8M A;  3CFP A;  4CFD A;  2ASO A;  3A8Y A;  4IKF A;  3AVI A;  1K73 O;  2Z1H A;  3BY5 A;  3SPZ A;  4K0K K;  3DXK A;  1J5O A;  1DLO A;  2OPR A;  2D0O A;  1NGA A;  1S6P A;  2DFF A;  3QLH A;  1HR0 K;  4E0D A;  2FLO A;  1TAQ A;  3HSC A;  5M1P A;  4Z4F A;  1TGO A;  1ESV A;  3MCA B;  4JRP A;  3G71 N;  3VEZ A;  2KQ2 A;  4A59 A;  3K57 A;  5KGX A;  4AM6 A;  5I3U A;  3LAN A;  4PA1 A;  4E3S A;  3LP1 A;  3WEE A;  4RWT A;  1RT1 A;  3VQC A;  5AQR A;  1XNQ K;  4F3T A;  3R8E A;  3PO5 A;  1S22 A;  2YJE A;  4J8F A;  4OX9 K;  4M42 A;  1VQO N;  4DTX A;  4DSJ A;  1MDU B;  1VQN N;  2E5L K;  3JSM A;  1BDG A;  4DSK A;  4B1X B;  1HYZ A;  3SJJ A;  1NK0 A;  3IUC A;  3QFP A;  3O9U A;  1WOQ A;  2EWS A;  4KH5 A;  4FLW A;  4NYN A;  2QWR A;  3RMB A;  3VQ4 A;  1BHL A;  2UXC K;  2P9N A;  1WSJ A;  3JYT A;  3ZSV A;  5H1S Q;  1RDA A;  3BZC A;  1KFS A;  1UOC A;  2OTJ N;  3CER A;  2QKK A;  3ISN C;  3NF6 A;  1IKY A;  4CEQ A;  4H5T A;  3KLG A;  4YHH K;  4FJ9 A;  4OJR A;  2A1S A;  4PKG A;  3ZX2 A;  3KZB A;  4JNE A;  4R5P A;  2CGL A;  2OTL N;  1K8A O;  3KK3 A;  3TAR A;  3EE8 A;  5DM7 L;  1TL1 A;  3DLG A;  3MWT A;  4FWN A;  3ZT1 A;  5F0X A;  3CQ8 A;  3QEP A;  3MN5 A;  3CC7 N;  4FWS A;  4B3O A;  4NYF A;  3OBY A;  4B3M K;  2VWJ A;  3THY A;  3VQB A;  3NGZ A;  3ZT3 A;  5BPM A;  3C65 A;  4BRC A;  1RTH A;  4JN4 A;  3I33 A;  2A41 A;  3MMV A;  3TAE A;  3MAQ A;  5AR0 A;  3GBT A;  4KPY A;  3NMU A;  1S5J A;  3K0S A;  4TSX A;  2HBL A;  5AQJ A;  4BRQ A;  1MWM A;  2V52 B;  3CG7 A;  2A1R A;  4A61 A;  4YY3 K;  3HVT A;  1A5X A;  4DR2 K;  3JXU A;  1RFQ A;  3B6O A;  1W7A A;  4AM7 A;  3VQD A;  2BDP A;  4JS5 A;  3KKR A;  5GIP A;  4PQU A;  1O1W A;  5JMV A;  4LF4 K;  4CF0 A;  4FJN A;  4DR6 K;  3EL2 A;  5HBM A;  4C23 A;  1NGI A;  3BGR A;  3C6H A;  2GV9 A;  1HNW K;  3A5M C;  4AF1 A;  1KAZ A;  2CH5 A;  5AFU H;  3WNE A;  1SS6 A;  2Q36 A;  2HVI A;  1X3N A;  1IBL K;  3V1O A;  3FGU A;  4N5S A;  4KB0 A;  1KLM A;  1NMD A;  3BUZ B;  1NGD A;  5I42 A;  2B4J A;  3DLE A;  3CI5 A;  3UB5 A;  1RDB A;  3PX6 A;  3OYG A;  4DFP A;  3OS2 A;  1CLQ A;  4AH9 A;  2P9K A;  3G10 A;  4JK7 A;  1K9M O;  1OVQ A;  4CFA A;  3K2P A;  3AO2 A;  3CJC A;  3ITH A;  4DQI A;  4B1V A;  3O1W A;  2FBT A;  1S9E A;  2P9P B;  3ZSQ A;  3AVF A;  5J2P A;  3NHG A;  5CE3 A;  2O8F B;  2NRZ A;  4RCH A;  5SWM A;  3KLE A;  1VSD A;  3LDL A;  1GLD G;  2UXB K;  1ATR A;  3SPY A;  1QE1 A;  3K9J A;  1SL1 A;  3F2K A;  4O8U A;  1SUQ A;  3D6R A;  1EO1 A;  3IRX A;  3LL3 A;  1XMO K;  4CJU A;  2IVP A;  2O8B B;  3TAF A;  3Q7B A;  3EYZ A;  5BR9 A;  3CCL N;  1X9W A;  1NM1 A;  4E7I A;  1MA9 B;  4LF7 K;  5IT9 O;  4DV6 K;  3QML A;  4M41 A;  5AQH A;  3DWL A;  2DFH A;  4CJR A;  3ZSZ A;  5AQQ A;  3HI0 A;  2VCP A;  3AVJ A;  3MK6 A;  5JLH A;  3EE9 A;  3HTV A;  1KVC A;  2E4L A;  2IS3 A;  1J6Z A;  4FLV A;  1EKE A;  3AY9 A;  4N56 A;  1HNI A;  1UA1 A;  3WUH A;  3VMF B;  4FJ8 A;  3KVG A;  2X78 A;  5C42 A;  1YXQ A;  3CM6 A;  1A5V A;  1V4S A;  3MN6 A;  1RBV A;  1VQ6 N;  3T1A A;  3NCI A;  4CJT A;  1ZBL A;  5EVZ A;  4M63 C;  1HYS A;  1S1X A;  2CH6 A;  3EN9 A;  3MN9 A;  2F8S A;  2I5J A;  3TAN A;  4GKJ K;  2E2Q A;  2E1Y A;  2QWL A;  4M3T A;  3HJF A;  3IAY A;  3TAG A;  3BF3 A;  4LSL A;  3KKS A;  4GNI A;  4BRE A;  1NKC A;  4FLZ A;  4JI7 K;  3NH1 A;  1VRT A;  4JKB A;  3LZJ A;  3L2W A;  3S3N A;  2G8H A;  2D0B A;  3I8B A;  2RE2 A;  3MX5 A;  1Y64 A;  4I9L A;  4ILG B;  3NAE A;  1OH6 A;  4LC9 B;  3E01 A;  3C6A A;  1QQC A;  3DOK A;  3WQT A;  4DFM A;  4OPH A;  3ULE A;  3TR8 A;  5BRE A;  1Z6R A;  1YJW N;  4CFC A;  3VQ5 A;  1U49 A;  1IBM K;  3KIO A;  2XY6 A;  2P9N B;  4RW6 A;  1LAW A;  2E1Z A;  1SKW A;  2WC9 A;  4BE2 A;  3ZCM A;  2W40 A;  3SNN A;  1BUP A;  3M3Z A;  4YOX A;  3TPQ A;  2P5O A;  3DLR A;  4DQR A;  4NXM K;  3NE6 A;  1VQ7 N;  2I7P A;  1KCF A;  4E19 A;  3LPU A;  4BVP A;  2HF3 A;  1XWL A;  4O0J A;  4CHQ A;  1SL2 A;  4FLY A;  4CEO A;  1WLJ A;  1J5E K;  5FRO A;  4WFB L;  1S9G A;  4FVM A;  2V51 B;  3AAP A;  3HPH A;  3QEI A;  3OJS A;  4JI3 K;  2F8T A;  3AVL A;  4DSI A;  1VQP N;  3TAP A;  4FW2 A;  3S3O A;  1JLE A;  3NH2 A;  3VEN A;  4OVL A;  1CZ9 A;  4ELT A;  3CPE A;  2NRW A;  3NGI A;  1Q7Y O;  1BIS A;  5TKW A;  1IBK K;  1CXQ A;  4BC5 A;  2ASM A;  3PIP L;  4XEI A;  1LOT B;  2WON A;  2NZT A;  4Z94 A;  1NK7 A;  2QXF A;  3E66 A;  1NGE A;  4DUZ K;  4DV7 K;  4XIU A;  2ITG A;  4FJL A;  3LP0 A;  4E7L A;  4KHY A;  4KO0 A;  1JLQ A;  2X74 A;  2G8K A;  5M1Q A;  1QZ5 A;  4A5A A;  4DTP A;  3OYA A;  1NGB A;  5J1E A;  2YNI A;  2HNY A;  4WQ5 A;  4M45 A;  4LF8 K;  1GOA A;  1I3A A;  2G8W A;  1N6Q A;  4I9Q A;  3OYL A;  5C15 A;  3SQ2 A;  4DV2 K;  3E9O A;  2A40 A;  3AVA A;  4BGB A;  5BN9 A;  3T69 A;  5KPR A;  4CJW A;  4FO0 A;  1OVY A;  1VAZ A;  2ZJQ L;  1KVA A;  4FXD A;  3VGL A;  4DFK A;  4H0Y B;  3G0Z A;  2FF6 A;  2FSN A;  3PO4 A;  3RR8 A;  4QCL A;  3OA9 A;  2P9U A;  4FLX A;  4HWI A;  3KD5 E;  4LF6 K;  1E4F T;  3MCP A;  1JCF A;  1Y97 A;  3WQU A;  4BGA A;  4PHT X;  5KPZ A;  4B8A B;  4I2P A;  2OYQ A;  1BL3 A;  3P1G A;  4OKJ A;  1NJW A;  1JL2 A;  3THV A;  3OYM A;  4A2A A;  3QNN A;  4KB1 A;  3LDP A;  4BDZ A;  1RBR A;  4QS8 A;  3C95 A;  4KKO A;  1VSJ A;  5BRH A;  4H0T B;  4CF2 A;  3PY8 A;  1HKG A;  4HTU A;  3ZEU B;  1NJY A;  2A3Z A;  3VQ6 A;  4B8C A;  3CCM N;  4C1N I;  3H3O B;  4KTZ A;  2GWK A;  3A2F A;  3DJC A;  4DR4 K;  4FWR A;  4M7Y A;  4CCH A;  4CEE A;  2BE2 A;  3VPZ A;  1DT9 A;  5JS1 A;  5LJW A;  1T8E A;  2GTD A;  4FJH A;  3WXI A;  4J2E A;  3OHR A;  3VTI A;  3QIP A;  4FZX C;  3PX4 A;  4QS7 A;  1RT5 A;  4H0P A;  4CGF A;  1S1V A;  3V4I A;  3FZM A;  4CBW A;  4B3T K;  3LAK A;  2ZQB A;  2H3G X;  2HHS A;  1IKV A;  2YCH A;  4BG9 A;  2WOM A;  3CM5 A;  1GLB G;  4CHY A;  3KK2 A;  1C1A A;  4FWM A;  4DS4 A;  4BVO A;  3P5J A;  3J80 O;  5KRT A;  2YHX A;  1JCG A;  4ISE A;  3F73 A;  4K43 A;  5AQY A;  3THW B;  3L4I A;  3QES A;  4YOV A;  3MN7 A;  3R1X A;  1NK8 A;  4LH4 A;  2Y1J A;  4CEA A;  4IEI A;  4FSV A;  2Z1I A;  2O8C B;  4B3R K;  4L3Q A;  3L2R A;  4FK0 A;  4IO8 A;  2FC0 A;  4XH4 A;  2XY5 A;  3RTV A;  3VF6 A;  5MLC Q;  4OKE A;  3VEW A;  4CED A;  4OLB A;  1RDU A;  3O4Q A;  2O4I A;  3KTQ A;  2D1K A;  3AVC A;  3FLC O;  3EZW A;  4DTN A;  1LWC A;  1TK5 A;  2NRT A;  4CK3 A;  4FOI A;  4BY9 C;  4JI4 K;  1NKE A;  5C12 A;  4ISG A;  4PL7 A;  1HLU A;  4AIL C;  3BP8 A;  4DU3 A;  3QEX A;  4FLU A;  1KVB A;  4UY8 O;  4O8K A;  3R6M A;  4KRE A;  4JS4 A;  3D2F B;  2P9P A;  2ITM A;  3S3M A;  1L3U A;  1NOY A;  4H5N A;  4BDY A;  4KBO A;  3TSU A;  2Z1G A;  4IOX A;  5AQT A;  2O8F A;  3CCJ N;  4CFB A;  5D3G A;  2UUC K;  3VEY A;  3PLA A;  3U8X A;  1JXE A;  4B1U B;  3ZSY A;  4JI2 K;  4CJV A;  4CJE A;  3FZH A;  4BRN A;  5GIO A;  4KRF A;  2QEX N;  1L3T A;  5HRO A;  4F4K A;  4E7J A;  4FJK A;  1GOB A;  4EHU A;  1QHT A;  4HUG A;  3QBX A;  4B9V A;  2O8B A;  2HST A;  4GY2 B;  3O9R A;  4NCG A;  3ZET B;  3F9K A;  5E26 A;  1NK9 A;  5AQZ A;  2WFB A;  1BU6 O;  1RT4 A;  2OAN A;  5J2Q A;  4X66 K;  1XHX A;  4EIA A;  1QSS A;  4JKC A;  3AGK A;  3PSF A;  2HVH A;  3QFU A;  3H45 C;  3ATV A;  4CJK A;  4CD3 A;  3DRP A;  1ILY A;  2ZGY A;  1C1B A;  1S6Q A;  3A5N C;  4CGG A;  1W0H A;  3NF7 A;  1QS4 A;  1W2B M;  3O9T A;  1VSL A;  4F2S A;  1DGK N;  1TYQ B;  4FWO A;  3VQA A;  4W5T A;  3ZX0 A;  1YF5 L;  5FRN A;  3MWP A;  3HM9 A;  1W97 L;  3OS1 A;  4Z4I A;  2E20 A;  3K5N A;  3SQ1 A;  3SV4 A;  2FXU A;  5A2Q O;  1P8Z A;  2JLE A;  4DU4 A;  2ZF5 O;  3ENB A;  1NG9 A;  3EKU A;  3ID6 A;  1VSF A;  5AQW A;  4PKH A;  3TAB A;  4KFB A;  3V9W A;  3WXJ A;  1C0U A;  4DB3 A;  3HYF A;  3OYJ A;  4IJN A;  4BRO A;  4DTM A;  4O4G A;  1KRP A;  1HPZ A;  5KTQ A;  3CCS N;  2PYL A;  4MO4 A;  4YDU C;  2JWL A;  3LAL A;  3PIO L;  3VET A;  3GE1 A;  4RW8 A;  2P9I B;  3NDK A;  3HPG A;  4H4O A;  3HT3 A;  1J9A A;  1Z25 A;  3KJV A;  5CY4 A;  3V9U A;  3FFK B;  2E2P A;  2VGN A;  1NK5 A;  3KLF A;  3L3U A;  1YIJ N;  4HCC A;  4LD0 A;  4GKK K;  2O8D B;  2P9U B;  1K8K B;  5FPE A;  3KK1 A;  5HL7 L;  4A57 A;  1NGH A;  2O8E B;  3CJ1 A;  2XHB A;  3T7Z A;  5ADX A;  3EO3 A;  4BR5 A;  3VF4 A;  2ASP A;  3MXI A;  4DUY K;  5LJV A;  2UXD K;  3QEW A;  4RTF D;  2PAV A;  1U6Z A;  4JV5 K;  4GV6 A;  3LDN A;  1VSM A;  3ZYY X;  1NGF A;  1FKP A;  3ATU A;  1Q81 O;  2UU9 K;  4BQZ A;  4ICL A;  4DTJ A;  5KQD A;  5FPN A;  1VQ9 N;  4RW9 A;  2GWJ A;  4CES A;  3LPT A;  1NU0 A;  4LSN A;  3I55 N;  3P4I A;  5SZT A;  3CXC M;  4B9L A;  4DR7 K;  4FWP A;  3SMP A;  1ZBF A;  4DV0 K;  2QM1 A;  4EZ6 A;  5T7B A;  4QAG A;  5AQM A;  4IWV A;  3G6E N;  2FSJ A;  1SL0 A;  1X9S A;  4OO1 J;  1RDC A;  1Z05 A;  3AO1 A;  5AJ3 K;  5CZ2 A;  3AO5 A;  3OVN A;  4CBU A;  4CIG A;  4WFN L;  3VEV A;  4YOY A;  3K5O A;  5AQG A;  4J2D A;  5LY3 A;  3DRR A;  3CCE N;  2HF4 A;  3JS6 A;  3RMA A;  4CGI A;  3A0I X;  5AQL A;  3T1H K;  1HJO A;  4F2R A;  3N4Q A;  4MQ3 A;  3LAM A;  1XQS C;  1BIZ A;  2QW9 A;  4CBX A;  4WFA L;  2IIR A;  3L6Q A;  5I9E B;  2W42 A;  3O80 A;  1N36 K;  3J7Y P;  1YTA A;  2ZWH A;  2XRI A;  4AHS A;  2P1J A;  1C6V A;  1TV6 A;  1U47 A;  2Q97 A;  4HUE A;  3NF9 A;  2YHY A;  4M3Y A;  1ZXO A;  3ALY A;  1QSL A;  5C24 A;  4IDK A;  1P90 A;  4KH6 A;  2ZJR L;  3SAH A;  3IMX A;  3LWL A;  4ISF A;  5KRS A;  2GEL A;  1KLN A;  3NFA A;  4FYD A;  4CGD A;  3MEG A;  4ELU A;  3HOS A;  1I94 K;  4AHR A;  4PWD A;  3O8M A;  3SUO A;  3AV9 A;  3ZSR A;  3LP2 A;  4CF8 A;  1KAX A;  4CZM A;  3BF1 A;  1HNV A;  3VGM A;  3LP3 A;  2QK9 A;  4CHP A;  3I0S A;  3ZEU A;  3DM2 A;  3V9S A;  4ID1 A;  4EFH A;  3VQ7 A;  3M5R A;  1KQS M;  4M7X A;  4C8N A;  3BEX A;  4IG3 A;  4CHO A;  5GAE P;  1NK4 A;  2DFE A;  4FM0 A;  3ENH A;  5BRD A;  4E1J A;  1X9M A;  2FF3 B;  1LWF A;  3DI6 A;  3CCU N;  4O44 A;  4Z4E A;  3B8A X;  2I7N A;  5AQK A;  3E9P A;  1Q8I A;  3O3H A;  1NOZ A;  4PY5 A;  1NLV A;  5JVG L;  2WUS A;  4NLB A;  4O0I A;  1OH7 A;  1RT3 A;  4WQ4 C;  4CJS A;  2D0P A;  4K8X A;  2GUP A;  3QEV A;  4BRL A;  1VSI A;  3O4W A;  4JKH A;  2YNF A;  3VA0 A;  3THW A;  2HBM A;  2KLA A;  2QWM A;  1QTM A;  3V1Q A;  2CGJ A;  4LF9 K;  4A2B A;  3CFO A;  4MLE A;  2F4V K;  2O8C A;  2YV0 X;  2XO7 A;  4FJ7 A;  4OLA A;  3K5M A;  3CCQ N;  3NVM A;  1LAV A;  4F3O A;  4JI0 K;  1S3X A;  4H03 B;  1TK0 A;  4BR9 A;  3VER A;  4CIE A;  4W5O A;  3LWM A;  3CC4 N;  1M1K O;  3SAG A;  1Q82 O;  4CZL A;  1H1V A;  4DSE A;  3GG4 A;  1SAZ A;  3TTD A;  3K59 A;  3HP6 A;  3CET A;  1VQ8 N;  4JKA A;  1JKH A;  3VEO A;  3ID8 A;  2HHU A;  1MU2 A;  3D2F A;  1JCE A;  1YIT N;  2HOE A;  5E84 A;  2UUA K;  4NCA A;  3WXL A;  2VYP A;  3H3N O;  1ZBH A;  2Q0R A;  3UKU B;  4FJI A;  3U9Z A;  3M8Q A;  3D7E O;  4F8R A;  4FWQ A;  4OPK A;  3THX B;  4BRM A;  4DHY A;  2XY7 A;  4YOW A;  4FW1 A;  2G8U A;  3A5O C;  1WAF A;  1LW2 A;  2OPQ A;  3QET A;  2BUP A;  2RPI A;  1ZYQ A;  1HQE A;  3E1Y A;  4CHZ A;  4IFY A;  2E88 A;  3MDQ A;  4CD1 A;  2NRX A;  4H5R A;  5AQS A;  5AFU A;  1XI1 A;  3I56 N;  3L2V A;  4KHP K;  2ZD1 A;  4B9T A;  3ZET A;  2R7Y A;  4IO9 L;  3L3V A;  2LSN A;  3OYN A;  3OW2 M;  4FJX A;  1C1C A;  1NGC A;  3O08 A;  3CJ7 A;  4EAH D;  4A62 A;  1RDD A;  1VQM N;  3DRS A;  1IG8 A;  1B9D A;  1JL1 A;  1ZBI A;  2FBX A;  2OCE A;  3V9X A;  1T44 A;  1TYQ A;  4CF1 A;  1GLL O;  1RT7 A;  1U45 A;  2AJQ A;  3IS9 A;  5EX5 A;  4FWL A;  3HZ6 A;  3NH0 A;  3SK3 A;  3O3G A;  3D2E B;  1XUP O;  4DQQ A;  4NXN K;  4HTL A;  1BQM A;  3V6D A;  2HHX A;  1B9F A;  5M1N A;  3EKS A;  4ZTJ A;  4BE0 A;  3KHY A;  1NWK A;  3U3G A;  1MWK A;  1WSI A;  4BRK A;  3MEC A;  1QHA A;  2PY5 A;  1RBT A;  5C2D A;  1FXX A;  2NRH A;  3C94 A;  4JK8 A;  1YVU A;  2P9L B;  2IDO A;  4ILJ A;  2P5G A;  1F21 A;  1KTQ A;  2HBK A;  4FZZ A;  3IFR A;  2P9I A;  1Q9Y A;  4IG0 A;  3QIN A;  2D4W A;  5M1O A;  4KI6 A;  2Y1I A;  2VG7 A;  4FZY A;  2QWO A;  3AA5 X;  4FJG A;  3RSE B;  3HO1 A;  1ATN A;  4KHU A;  2F7T A;  4R79 A;  4BRH A;  2O8D A;  4GV9 A;  1NKB A;  1K8K A;  4A5B A;  4E1N A;  4M3R A;  3RRH A;  2O8E A;  1VSK A;  3ZSX A;  1IV0 A;  2QKB A;  2YX6 A;  4E1M A;  3VEX A;  4CGH A;  1UAX A;  3L2Q A;  2UYT A;  3LM9 A;  2VG6 A;  3NGY A;  2D0C A;  4JKG B;  1E4G T;  5HP1 A;  3AO3 A;  5BN8 A;  4FOE A;  4B3S K;  5FRM A;  3D0P A;  3RRG A;  5BPL A;  1L3S A;  3HXM A;  5AZJ A;  2ATQ A;  3PUF A;  4IXC A;  1NNE A;  2G8I A;  4X62 K;  4G9Z A;  4JK9 A;  2VQF K;  4ZHR A;  4MDA A;  5HRN A;  4BG8 A;  2HMI A;  5AQN A;  4FJM A;  4LFC K;  4EP5 A;  5JIC A;  2ZM6 K;  1TKT A;  4DTR A;  1RT2 A;  4PL8 A;  4DR5 K;  2YNH A;  3C7N B;  4Z4H A;  1OKJ A;  3WNG A;  4DR1 K;  2AP1 A;  2BH1 A;  1QQM A;  3SYZ A;  3F9M A;  2IOC A;  4DQP A;  3CD6 N;  2HMP A;  4B1Z A;  1R0A A;  3CPW M;  3L4Q A;  1N33 K;  2DY4 A;  3OYD A;  3ZT0 A;  1Z26 A;  3QIC A;  2PZS A;  3OYH A;  4DQS A;  4C1N K;  3OYI A;  1GLC G;  5LMU K;  2HBJ A;  4IZ9 A;  4EHT A;  4KTW A;  5AQP A;  5HOO A;  4Y1C A;  2QWN A;  3L8B A;  5AQF A;  1JLF A;  2KZZ A;  5CYM A;  3UKR B;  2YNG A;  4AQY K;  4WE1 A;  3V81 A;  1JLG A;  4HCB A;  4PKI A;  1M90 O;  3ZSO A;  1JLA A;  1EP4 A;  3ZT4 A;  4F9O A;  3E9L A;  3U4L A;  1Q18 A;  4X65 K;  2IAJ A;  3KK7 A;  3OYB A;  4IFV A;  2GUI A;  4FM2 A;  4FJ5 A;  3VES A;  2RF2 A;  1NJZ A;  1REV A;  3PX0 A;  3TSQ A;  3J8A A;  4FPA A;  1G15 A;  4FCY A;  3DXM B;  1GLA G;  4WYB A;  2NRR A;  4FK2 A;  2QWP A;  1WSG A;  1U04 A;  1N8R O;  5KPT A;  1BA1 A;  3M8P A;  4B9Q A;  4IBN A;  2PYJ A;  4YOU A;  3TTC A;  3CCR N;  2YHB A;  3VQ8 A;  2E6M A;  3UE5 A;  5M1F A;  1KAY A;  3HOT A;  4CZE A;  1KD1 O;  1SKS A;  3BDP A;  2CGK A;  4O55 A;  4HVJ A;  2FSK A;  4M3W A;  1KXP A;  3T3F A;  1GLF O;  5JS2 A;  1BCO A;  2Q2R A;  3VN5 A;  2JWK A;  1S1U A;  4OKK A;  2KHO A;  4I2Q A;  1HKB A;  3RVC A;  1TUY A;  2HHV A;  4CEF A;  4B1W B;  3PV8 A;  2OZM A;  4AHC A;  4CW7 B;  4DV4 K;  1YT3 A;  3V9Z A;  1BI4 B;  2RHK A;  3C6U A;  3SJH A;  3ZT2 A;  3FR0 A;  3O4N A;  4EZ9 A;  3IDH A;  4CJ5 A;  2D0A A;  4H5V A;  1OH8 A;  4LF5 K;  4MO5 A;  3SBT A;  1EWQ A;  4W5R A;  1U2V A;  2JGU A;  2NRV A;  1L5U A;  3LDQ A;  1BQN A;  4DMN A;  4CJP A;  1G99 A;  4CER A;  4DR3 K;  5GAD P;  4QOZ B;  1S72 N;  3SAF A;  3H1Q A;  4YOT A;  1YUW A;  1IG9 A;  3A5L C;  4BAC A;  2WBN A;  3M8S A;  3ZX3 A;  5K14 A;  3AAR A;  4WQ5 C;  1NJX A;  4J2A A;  2VQE K;  4DF4 A;  2P9S B;  4RW7 A;  1TKX A;  2HHQ A;  3NBP A;  5BR8 K;  3CJA A;  1OH5 A;  5CZ1 A;  3OTO K;  2HB5 A;  4BR0 A;  3DYA A;  3OYK A;  5JVH L;  2VWB A;  1SQK A;  2DPN A;  3AGR A;  4DV5 K;  3SMS A;  3KWG A;  4JHD B;  3MX2 A;  4IOC L;  3H46 O;  5B8H A;  4LFA K;  3UKU A;  5CR4 A;  4OPA A;  3P38 A;  3THX A;  1JXB A;  5M1K A;  3NF8 A;  2KFN A;  3VQ9 A;  1EQY A;  1C0T A;  3K9K A;  1K6Y A;  2YKM A;  3CJB A;  1XNR K;  3VOV A;  4AHV A;  4KI4 A;  4JLH A;  4B9M A;  1C0M A;  3SI6 A;  4M3U A;  2V7Y A;  2UUB K;  3PSI A;  2GEM A;  1D5A A;  5AZJ B;  2B5J A;  2XY8 A;  4KHN A;  3LDS A;  4BR2 A;  3J7Z O;  5CHI A;  4DLE A;  4I6M B;  1C0F A;  4BR4 A;  4DKW A;  3RR7 A;  1LW0 A;  2OZS A;  2ZJP L;  4BWM A;  1DTQ A;  4YNQ A;  1WNS A;  4E7H A;  4JKF A;  1WBD A;  1Q9X A;  5HRP A;  3TI0 A;  5AQV A;  4BDP A;  1VK0 A;  4WF9 L;  1IKW A;  2A5X A;  3TU5 A;  3D2E A;  3P31 A;  1T7P A;  3R3L A;  4G1Q A;  4QS9 A;  3JAM O;  4MLH A;  2E2O A;  1RGI A;  4BRG A;  5ELZ A;  3VQQ A;  1IKX A;  3VGK A;  1C0G A;  3CFR A;  1J54 A;  1O13 A;  3WXK A;  4UQG A;  2P9L A;  2YJF A;  4DLG A;  4J2B A;  4E7K A;  5KQ8 A;  4CZF A;  2KZM A;  4DTO A;  1WBB A;  4NCB A;  3I0R A;  3RWU A;  3ULD A;  3KD1 E; 
#chains in the Genus database with same CATH homology
 1MU2 A;  3AVG A;  4KTZ A;  3HPO A;  3A2F A;  4DSL A;  4NCA A;  3K5L A;  1ZBH A;  4CCH A;  4CEE A;  4FJI A;  2BE2 A;  1KSP A;  3M8Q A;  2RKI A;  4OPK A;  4F8R A;  1TL3 A;  1CXU A;  3HVR A;  5JS1 A;  4DWI A;  3AA2 A;  1T8E A;  4C8M A;  3CYM A;  2XY7 A;  3CFP A;  5KI6 A;  4CFD A;  3HL8 A;  4FJH A;  4J2E A;  4FW1 A;  3AVI A;  2G8U A;  4IKF A;  1WAF A;  1LW2 A;  2OPQ A;  2Z1H A;  3QIP A;  2RPI A;  5FDL A;  4CIF A;  1HQE A;  3QET A;  1ZYQ A;  4FZX C;  5KGW A;  3SPZ A;  3PX4 A;  1RCH A;  1RT5 A;  1DLO A;  2OPR A;  4Z4C A;  1J5O A;  4CHZ A;  4IFY A;  1S6P A;  2DFF A;  4CGF A;  1S1V A;  3QLH A;  3V4I A;  4C8K A;  2IGI A;  3EZ5 A;  4E0D A;  1RTJ A;  3LAK A;  1XI1 A;  2ZQB A;  1TAQ A;  3L2V A;  4Z4F A;  2HHS A;  2ZD1 A;  1D9D A;  1IKV A;  1TGO A;  4B9T A;  2R7Y A;  1VSH A;  2WOM A;  3MXJ A;  3CM5 A;  4JRP A;  4CJ4 A;  4CHY A;  3KK2 A;  3L3V A;  2LSN A;  2KQ2 A;  1RTI A;  4CJL A;  3K57 A;  5KGX A;  1C1A A;  5I3U A;  3LAN A;  1IH7 A;  3OYN A;  4PA1 A;  1ASV A;  4E3S A;  3LP1 A;  4FJX A;  1C1C A;  4B08 A;  3S9H A;  5HLF A;  1EXQ A;  1RT1 A;  3VQC A;  4DS4 A;  4I7F A;  1UA0 A;  1JLB A;  1RDD A;  3P5J A;  4F3T A;  5KRT A;  3PO5 A;  3MEE A;  3OS0 A;  2OPP A;  3F73 A;  3DRS A;  1B92 A;  4M42 A;  1B9D A;  1JL1 A;  1U4B A;  1ZBI A;  2FBX A;  3V9X A;  4DTX A;  3QES A;  4DSJ A;  4O5B A;  1NK8 A;  1VSE A;  4LH4 A;  3JSM A;  4DFJ A;  2Y1J A;  4CF1 A;  4DSK A;  4CEA A;  1HYZ A;  1RT7 A;  1U45 A;  2AJQ A;  1RBS A;  2Z1I A;  3SJJ A;  1NK0 A;  3T19 A;  3IS9 A;  4CJF A;  4PUO A;  4CHN A;  3L2R A;  4FK0 A;  3NH0 A;  4CK1 A;  2FC0 A;  3IG1 A;  4LH5 A;  3O3G A;  2XY5 A;  3RTV A;  4DQQ A;  4FLW A;  1BQM A;  4OKE A;  3V6D A;  2HHX A;  1JLC A;  4NYN A;  3RMB A;  4CED A;  3VQ4 A;  1B9F A;  1BHL A;  4OLB A;  4ZTJ A;  4BE0 A;  3O4Q A;  3U3G A;  3KTQ A;  1WSJ A;  3JYT A;  2Q3S A;  1EET A;  3ZSV A;  3AVC A;  1WSI A;  2O4I A;  1RDA A;  3MEC A;  1KFS A;  1UOC A;  4OGE A;  2PY5 A;  1RBT A;  1T05 A;  1FXX A;  1WSF A;  4AHT A;  4DTN A;  2OA8 A;  1LWC A;  3ISN C;  3NF6 A;  2QKK A;  1IKY A;  4CEQ A;  1TK5 A;  3KLG A;  3C94 A;  4CK3 A;  4DSF A;  4FJ9 A;  4OJR A;  2A1S A;  1NKE A;  1YVU A;  4W5N A;  1LWE A;  2IDO A;  3D45 A;  4AIL C;  1A5W A;  3AVN A;  4R5P A;  3EY1 A;  4DU3 A;  3QEX A;  2P5G A;  1F21 A;  1KTQ A;  1S1W A;  4FZZ A;  4FLU A;  3KK3 A;  3SUN A;  3TAR A;  1Q9Y A;  4B9U A;  1KVB A;  4IG0 A;  4KRE A;  3QIN A;  1NK6 A;  1TL1 A;  2F96 A;  3DLG A;  3CQ8 A;  1CZB A;  3ZT1 A;  4JS4 A;  4W5Q A;  3QEP A;  4KI6 A;  2Y1I A;  2VG7 A;  3S3M A;  1L3U A;  1NOY A;  1BGX T;  4FZY A;  1RT6 A;  4BDY A;  2Z1G A;  3AA5 X;  4B3O A;  4FJJ A;  4NYF A;  4FJG A;  4CFB A;  4CGJ A;  4Z0U A;  4CEZ A;  2VWJ A;  5D3G A;  3HO1 A;  1JXE A;  4KHU A;  3ZSY A;  4CJV A;  3VQB A;  3DMJ A;  3NGZ A;  3ZT3 A;  4E1N A;  4CJE A;  1NKB A;  4M3R A;  3HK2 A;  3RRH A;  3L2U A;  1RTH A;  1VSK A;  3ZSX A;  3HST B;  4KRF A;  2QKB A;  4E1M A;  4CGH A;  3TAE A;  1UAX A;  1L3T A;  5HRO A;  4F4K A;  2GBZ A;  4E7J A;  4FJK A;  3MAQ A;  3L2Q A;  1GOB A;  2VG6 A;  1FKO A;  1QHT A;  4HUG A;  3NGY A;  4FK4 A;  2D0C A;  3SCX A;  5HP1 A;  4B9V A;  4KPY A;  3AVK A;  3ASM A;  1S5J A;  3AO3 A;  4NCG A;  5FRM A;  4Z4G A;  3F9K A;  4TSX A;  3D0P A;  1HQU A;  4KV8 A;  3ZSW A;  3RRG A;  1NK9 A;  1WAJ A;  3LZI A;  3TAQ A;  1RT4 A;  1L3S A;  3HXM A;  3CG7 A;  2ATQ A;  2A1R A;  5J2Q A;  3PUF A;  2ETJ A;  2G8I A;  3HVT A;  1A5X A;  1XHX A;  1TKZ A;  4ZHR A;  4CK2 A;  1QSS A;  4GW6 A;  5HRN A;  2HMI A;  1ITG A;  2HVH A;  3B6O A;  1HYV A;  4FJM A;  4EP5 A;  1I39 A;  1TKT A;  4DTR A;  1RT2 A;  4CJK A;  3VQD A;  3O3F A;  3DRP A;  2BDP A;  4OGC A;  2VWK A;  4JS5 A;  2YNH A;  1C1B A;  1S6Q A;  3KKR A;  4OPJ A;  4PQU A;  1O1W A;  4CGG A;  3U3Y A;  1W0H A;  4Z4H A;  3NF7 A;  1QS4 A;  5C25 A;  3OY9 A;  3SQ4 A;  4CF0 A;  1VSL A;  3WNG A;  4CE9 A;  4F2S A;  4FJN A;  5HBM A;  4KHQ A;  3BGR A;  3VQA A;  2GV9 A;  4W5T A;  3SYZ A;  4C8O A;  5FRN A;  2IOC A;  3OS1 A;  3HM9 A;  4DQP A;  4Z4I A;  3K5N A;  3SQ1 A;  3SV4 A;  1R0A A;  4ID5 A;  1X1P A;  3SZ2 A;  2DY4 A;  2JLE A;  4YFU A;  4DU4 A;  3OYD A;  4CJ3 A;  3WNE A;  2IC3 A;  3ZT0 A;  1Z26 A;  2HVI A;  2PZS A;  1BI4 A;  3V1O A;  3OYH A;  1VSF A;  4N5S A;  4E89 A;  4DQS A;  3OYI A;  3TAB A;  4KB0 A;  4KFB A;  3V9W A;  1KLM A;  4KHS A;  1C0U A;  1BIU A;  3K58 A;  2ZE2 A;  2YHA A;  3HYF A;  4KTW A;  2B4J A;  5I42 A;  3DLE A;  3OYJ A;  2RN2 A;  4Y1C A;  1IO2 A;  3QO9 A;  3L8B A;  1FK9 A;  1JLF A;  1RDB A;  4DTM A;  2E6L A;  5CYM A;  2KZZ A;  2YNG A;  4O4G A;  3PX6 A;  1HPZ A;  5KTQ A;  3OYG A;  1KRP A;  4DFP A;  3OS2 A;  2PYL A;  4WE1 A;  4AH9 A;  1CLQ A;  3LAL A;  3V81 A;  1JLG A;  3G10 A;  4HCB A;  3AA3 A;  3QIO A;  4RW8 A;  4CFA A;  3K2P A;  3AO2 A;  1RTD A;  3ZSO A;  3NDK A;  3HPG A;  1JLA A;  3ITH A;  1EP4 A;  4DQI A;  2B6A A;  4H4O A;  1J9A A;  3HT3 A;  2FBT A;  3ZT4 A;  4KHW A;  1S9E A;  1Z25 A;  5CY4 A;  3AVF A;  3ZSQ A;  3KJV A;  3V9U A;  5J2P A;  2EX3 A;  3NHG A;  1D9F A;  2HW3 A;  1NK5 A;  3KLF A;  4FLT A;  5SWM A;  3L3U A;  2IAJ A;  3KLE A;  1VSD A;  1SKR A;  4HCC A;  3OYB A;  4LD0 A;  3KK1 A;  2KTQ A;  3SPY A;  4IFV A;  3TWH A;  3QNO A;  2GUI A;  2XHB A;  1DTT A;  1QE1 A;  4FM2 A;  3VQP A;  1SL1 A;  3AVM A;  4FJ5 A;  3MXI A;  1SUQ A;  2RF2 A;  1NJZ A;  1REV A;  3PX0 A;  1TVR A;  1WSE A;  3MED A;  5CYQ A;  3TAM A;  3IRX A;  2D5R A;  3OYE A;  3H08 A;  3KLH A;  1G15 A;  4FCY A;  4CJU A;  1N5Y A;  3TAF A;  4FK2 A;  3EYZ A;  1VSM A;  4H8K A;  1WSG A;  1U04 A;  1X9W A;  4E7I A;  1FKP A;  3SUP A;  3QER A;  4M41 A;  4HUF A;  4KTQ A;  3M8P A;  2DFH A;  4CJR A;  3ZSZ A;  4IBN A;  1SV5 A;  3UIQ A;  2PYJ A;  4ICL A;  4DTJ A;  3AVJ A;  4RW9 A;  1LV5 A;  4CES A;  2YHB A;  3LPT A;  4LSN A;  3RMC A;  2X6N A;  1KVC A;  3VQ8 A;  5SZT A;  2E6M A;  3DOL A;  2E4L A;  2HND A;  2IS3 A;  4B9L A;  1SKS A;  4FLV A;  3BDP A;  1ZBF A;  1EKE A;  4N56 A;  1ASW A;  4O55 A;  3MXM A;  4EZ6 A;  2KW4 A;  5T7B A;  1HNI A;  3AA4 A;  4QAG A;  4HVJ A;  3B6P A;  1UA1 A;  1TAU A;  2FBY A;  4M3W A;  3T3F A;  4FJ8 A;  5JS2 A;  1BCO A;  3VN5 A;  2X78 A;  3FFI A;  5C42 A;  4CEC A;  4DG1 A;  1S1U A;  1SL0 A;  3CM6 A;  1A5V A;  1XHZ A;  2VG5 A;  4OKK A;  1X9S A;  1RBV A;  1RDC A;  4I2Q A;  3T1A A;  3AO1 A;  5CZ2 A;  3AO5 A;  3OVN A;  4CIG A;  2HHV A;  3NCI A;  4CJT A;  3K5O A;  1ZBL A;  3VA3 A;  4C8L A;  4CEF A;  1HYS A;  3PV8 A;  2OZM A;  4N47 A;  4AHC A;  3DLH A;  4J2D A;  1YT3 A;  3DRR A;  4N41 A;  1S1X A;  3V9Z A;  1BI4 B;  2F8S A;  3RMA A;  2I5J A;  4CGI A;  3TAN A;  3C6U A;  4M3T A;  3HJF A;  3AO4 A;  3ZT2 A;  3IAY A;  3TAG A;  4F2R A;  4LSL A;  4MQ3 A;  3KKS A;  3LAM A;  3O4N A;  3RMD A;  4EZ9 A;  4DU1 A;  1BIZ A;  4CJ5 A;  2D0A A;  4CEB A;  3I8D A;  1NKC A;  2W42 A;  4FLZ A;  5J2M A;  3NH1 A;  1VRT A;  4L8R B;  4JRQ A;  4N76 A;  4W5R A;  3LZJ A;  1YTA A;  2JGU A;  3L2W A;  3S3N A;  2XRI A;  4AHS A;  2D0B A;  2P1J A;  1C6V A;  1L5U A;  2G8H A;  1TV6 A;  1U47 A;  4ELV A;  1HMV A;  4I9L A;  2NUB A;  3NAE A;  4HUE A;  1BQN A;  4DMN A;  3NF9 A;  3E01 A;  4CJP A;  4M3Y A;  3WNH A;  4Q0B A;  1QQC A;  3ALY A;  3DOK A;  1QSL A;  4CER A;  4DFM A;  1GOC A;  5C24 A;  4IDK A;  3TR8 A;  1RNH A;  3LWL A;  4CFC A;  3VQ5 A;  1U49 A;  4QOZ B;  3KIO A;  2XY6 A;  2BAN A;  2X6S A;  5DK5 A;  5KRS A;  1TKD A;  2HHU A;  4RW6 A;  5E41 A;  1LAW A;  1KLN A;  3NFA A;  1SKW A;  4FYD A;  4CGD A;  4BE2 A;  3MEG A;  4ELU A;  3ZCM A;  4AHR A;  4PWD A;  3SUO A;  1IG9 A;  3SNN A;  4Y1D A;  4KAZ A;  4BAC A;  2HHW A;  3VQE A;  3M8S A;  5K14 A;  3AV9 A;  3ZSR A;  3LP2 A;  4CF8 A;  1NJX A;  2P5O A;  4J2A A;  3DLR A;  4RG8 A;  4DQR A;  4DF4 A;  1TK8 A;  3NE6 A;  4RW7 A;  1TKX A;  2HHQ A;  1KCF A;  3DLB A;  4E19 A;  4GMJ B;  3NBP A;  1HNV A;  3LPU A;  3LP3 A;  1XWL A;  4O0J A;  4CHQ A;  1SL2 A;  2QK9 A;  4FLY A;  4CEO A;  2EHG A;  4CHP A;  4ZTF A;  1J53 A;  5J2N A;  1WLJ A;  3I0S A;  1S1T A;  5CZ1 A;  2HB5 A;  5HRR A;  3DYA A;  5FRO A;  3DM2 A;  3OYK A;  1RBU A;  1S9G A;  4FVM A;  3V9S A;  4ID1 A;  3VQ7 A;  3HPH A;  4EP4 A;  3QEI A;  3P83 D;  4AHU A;  3OJS A;  4DTU A;  2G8F A;  3U6F A;  2F8T A;  3AVL A;  4C8N A;  4DSI A;  1WSH A;  4IG3 A;  3TAP A;  4FW2 A;  4CHO A;  3S3O A;  1JLE A;  1NK4 A;  2DFE A;  4FM0 A;  1JXB A;  1X9M A;  1LWF A;  3DI6 A;  3NH2 A;  4O44 A;  3OYF A;  4Z4E A;  4OVL A;  1CZ9 A;  3NF8 A;  4GVM A;  2KFN A;  3VQ9 A;  4ELT A;  5HRS A;  1C0T A;  1W9H A;  3NGI A;  1BIS A;  1K6Y A;  2YKM A;  4DTS A;  1CXQ A;  3C6T A;  1Q8I A;  4CF9 A;  3SV3 A;  3O3H A;  1NOZ A;  3AVH A;  2WON A;  4AHV A;  4DF8 A;  1NK7 A;  2QXF A;  4KI4 A;  4JLH A;  4B9M A;  1C0M A;  4PY5 A;  3SI6 A;  4M3U A;  4XIU A;  1L3V A;  2BGG A;  2ITG A;  4FJL A;  2P51 A;  2Z1J A;  3LP0 A;  4O0I A;  2DTU A;  4BWJ A;  4E7L A;  1RT3 A;  4B9S A;  1D5A A;  4KHY A;  4KO0 A;  1JLQ A;  2YKN A;  4CJS A;  2B5J A;  2X74 A;  4RW4 A;  2XY8 A;  2HNZ A;  2G8K A;  4K8X A;  1WN7 A;  4DTP A;  3OYA A;  3QEV A;  4KHN A;  1UWB A;  5J1E A;  2YNI A;  1VSI A;  3LDS A;  3KLI A;  2G8V A;  1KFD A;  3OYC A;  2HNY A;  4M45 A;  2YNF A;  3DLK A;  4DLE A;  1GOA A;  1I3A A;  5DMR A;  3M8R A;  3WNF A;  1D8Y A;  2KFZ A;  3SQ0 A;  1T03 A;  2G8W A;  1ASU A;  1N6Q A;  4I9Q A;  3VA0 A;  3HP9 A;  3OYL A;  3RR7 A;  1EX4 A;  4MFB A;  1BCM A;  3SQ2 A;  1LW0 A;  2OZS A;  4BWM A;  2O4G A;  1DTQ A;  4YNQ A;  3AVA A;  1QTM A;  1WNS A;  4E7H A;  4DS5 A;  3V1Q A;  4BE1 A;  3V1R A;  4B9N A;  4K8Z A;  1Q9X A;  5HRP A;  3CFO A;  4CJW A;  3TI0 A;  2HHT A;  4HHT A;  1ZBU A;  2YV0 X;  1KVA A;  1VK0 A;  1U48 A;  2XO7 A;  4BDP A;  1RIL A;  4FJ7 A;  4FXD A;  4OLA A;  3K5M A;  1IKW A;  1HJR A;  4DFK A;  3G0Z A;  3RR8 A;  3PO4 A;  1LAV A;  4F3O A;  4LY7 A;  4QCL A;  1XC9 A;  4FLX A;  1QSY A;  1TK0 A;  1T7P A;  3KD5 E;  4G1Q A;  4H4M A;  4M3Z A;  4M3X A;  4FM1 A;  2FBV A;  4CIE A;  1Y97 A;  3OJU A;  1YTU A;  4W5O A;  3LWM A;  4B8A B;  4I2P A;  2OYQ A;  1BL3 A;  3P1G A;  4OKJ A;  3SUQ A;  1NJW A;  1JL2 A;  3THV A;  3OYM A;  3VQQ A;  1IKX A;  1VRU A;  3QNN A;  1HRH A;  4KB1 A;  4BDZ A;  3CFR A;  1RBR A;  1J54 A;  3C95 A;  4KKO A;  4UQG A;  4DLG A;  4DSE A;  3AVB A;  1VSJ A;  5EU7 A;  3K59 A;  3HP6 A;  4J2B A;  4E7K A;  4CF2 A;  3PY8 A;  4Q5V A;  2OPS A;  4HTU A;  4DTO A;  3QEW A;  4NCB A;  2KZM A;  1NJY A;  3VQ6 A;  3I0R A;  3RWU A;  3ULD A;  3KD1 E;  1JKH A;  4B8C A;  4CJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...