4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
1TKDA 3V1OA 3V9XA 1TK5A 2Z1JA 2B6AA 2OPPA 1CXQA 4IFVA 1LWFA 4OKKA 1NK8A 1C1AA 4FLVA 4MQ3A 2VWJA 3G0ZA 4JLHA 4LSNA 1S1TA 3K57A 3PO5A 3RRGA 3QLHA 4H8KA 2XHBA 3V9SA 4TSXA 4CJSA 4O0IA 2VG7A 3LAKA 3WNGA 3SQ4A 3L2VA 3T19A 5HRRA 2QKBA 4B08A 1RBSA 3K5OA 3KLEA 1IH7A 5J2PA 1WSHA 2RPIA 4CK1A 2IOCA 4CERA 1ZBLA 1SKSA 1NJXA 2DY4A 2B4JA 4EZ6A 3AVGA 3LP1A 3ULDA 1XHZA 2HHXA 3S3MA 1WAFA 2QXFA 1FKOA 3LPUA 4NYNA 4CFCA 4M42A 4ZTFA 4ELVA 3HT3A 3ASMA 1HYSA 3TAEA 4FXDA 2E4LA 5FRNA 2ITGA 3P1GA 1RBVA 2DFEA 4CK3A 4R5PA 1VK0A 3PO4A 4BWMA 3SQ0A 3TAQA 4CGHA 5C42A 4M3UA 4Z4GA 1UAXA 5JS1A 3MEGA 3ZSXA 1X9SA 2YHBA 4IG0A 1JXEA 1KVBA 4DSJA 1D5AA 4DTMA 4PQUA 4EP5A 4E19A 2D0BA 2F96A 3ISNC 3QIPA 3DI6A 1JKHA 4PY5A 4CJRA 3DLGA 2HW3A 1S5JA 2ATQA 3OYFA 1EXQA 4RW6A 4CJUA 2FBVA 4Z4FA 2KZMA 1QQCA 3M8RA 3OYCA 4KHSA 1KVCA 1S9GA 1WSIA 3I0SA 4C8MA 1RT7A 4DSEA 4EZ9A 3C94A 3AO4A 3SYZA 4QCLA 4NCAA 5EU7A 4CJ3A 1RDAA 4I2PA 4Y1DA 4CIEA 4BDZA 4HVJA 4FK0A 3ITHA 4M3TA 2E6MA 3OS2A 1VSMA 1O1WA 2X6SA 1WSGA 1VRTA 3M8SA 4CF1A 4AHSA 4CJ4A 4CJFA 2BDPA 3KD1E 3AA5X 5CYMA 4M3WA 1JL2A 4N5SA 1VSFA 3NF8A 1TK0A 1QSYA 1BI4A 4ID1A 1YTUA 4B9SA 4CHYA 4GMJB 4FJKA 3AO3A 3NGIA 3U3YA 5HP1A 4DTRA 4FJ5A 4CJ5A 2IAJA 5J2MA 3HXMA 5C25A 3HSTB 4RG8A 4HUGA 3LP0A 3U6FA 1JLQA 3S3OA 2OPQA 4F8RA 4CEBA 2XRIA 4PA1A 3TABA 2D5RA 4CK2A 4KI6A 2HHUA 1RNHA 5HRPA 4B9VA 3AVKA 3SZ2A 4B9LA 1X9WA 1SKWA 4BE0A 3AA2A 3PX6A 2P1JA 3SI6A 4BDPA 4B3OA 1UA1A 1TKZA 1RTHA 1C0UA 1RT2A 2GUIA 3C95A 3DOKA 3LAMA 3O3GA 1KFSA 2PYJA 3M8PA 4CEQA 3ZCMA 4JRQA 2ZE2A 1J53A 1X1PA 3OYAA 4FLTA 4FJNA 2NUBA 4AHCA 3SUNA 4OPJA 4OPKA 3AVHA 1L3TA 2OA8A 3SPZA 4HCCA 3QNOA 4OLBA 3HJFA 3M8QA 3WNHA 2HHTA 3OS0A 3KJVA 4B9TA 1S6PA 3IG1A 4DQRA 1W0HA 3HL8A 4CJLA 3B6OA 1SUQA 1IKWA 1YTAA 4IFYA 5KGWA 1I3AA 5C24A 3VQ5A 5I42A 3AO5A 1NOYA 3HO1A 2DFHA 3PX4A 3DLBA 2Q3SA 1LWEA 1Q8IA 2KQ2A 4N47A 3OYIA 4M3XA 3V6DA 4BACA 3CM5A 3MXMA 2G8KA 1N5YA 1WSFA 3NBPA 1T05A 4F2RA 4CHQA 4AHUA 3OYJA 3PV8A 1R0AA 4FJIA 4G1QA 1NKCA 3VQPA 1T03A 1RBTA 4ZTJA 3QEWA 1NK6A 3K2PA 1S1WA 3KLHA 4L8RB 3CG7A 4CJVA 3KK2A 1C1CA 2XY6A 5HRSA 2G8UA 3KKSA 4LSLA 1LWCA 3QIOA 5D3GA 4DTPA 4DMNA 1KLNA 3ZSYA 3LANA 2F8TA 1J54A 3SQ2A 4CF0A 4AHVA 3HP6A 1QTMA 1T7PA 4HCBA 1K6YA 3AA4A 2Y1JA 3QEIA 1REVA 3VQ4A 4OKJA 3MEEA 3NGYA 1HMVA 2OPSA 5FROA 3L2QA 4CJKA 4FLWA 1WLJA 4Z0UA 3KD5E 1J5OA 3OYNA 4FW1A 3VA0A 1C6VA 1DTQA 3S9HA 4KHUA 2HVHA 3BDPA 1TAUA 2FBXA 4I9LA 4M3ZA 1RT5A 2JLEA 4DTOA 1B92A 3VQ7A 3SQ1A 4N41A 3RMDA 1QHTA 5J2QA 2HNYA 3VQEA 4CEEA 1HYVA 4CGFA 4CJTA 1RT6A 5HROA 4PUOA 2O4IA 1KSPA 3U3GA 3FFIA 4RW8A 4H4MA 2FBYA 2Y1IA 3AVNA 4CEAA 5KRSA 1U45A 4LH4A 2HHVA 4DSIA 3HYFA 3ZSRA 3L2WA 1IG9A 2HNZA 3AVLA 4C8OA 4M3YA 3RR7A 3K58A 3CM6A 3LZJA 2GBZA 3ZSOA 4DF8A 4KREA 2WOMA 4H4OA 1RDDA 2ETJA 5HRNA 3K5MA 3VA3A 3F9KA 2XY5A 1BCMA 3VQDA 1VSLA 3OS1A 3OYMA 4DQIA 3I0RA 1RILA 3NF9A 4KHNA 1EX4A 3TI0A 4DU3A 1CZBA 1ZBUA 4KTWA 1BIUA 3H08A 3SUQA 4CCHA 3O3HA 1TVRA 3L2UA 4CECA 1CLQA 3ZSVA 1B9FA 4M45A 4E1MA 3QNNA 2B5JA 1L3UA 4E0DA 4F4KA 4FJ9A 4J2DA 3NGZA 4DS5A 4O44A 3OYEA 1EKEA 1Z26A 3AVCA 5SWMA 3NHGA 4KKOA 1IKYA 3MAQA 4KI4A 2X78A 4CE9A 1WSJA 3LPTA 4FJXA 3P83D 1WN7A 4DTSA 2HHWA 4E3SA 4GW6A 3QO9A 1SKRA 4DTUA 2G8VA 3OJSA 4Q5VA 4KPYA 2E6LA 4CIGA 4CHOA 2GV9A 4E7JA 4E7IA 3TARA 1NKEA 3VQ9A 4C8KA 1TV6A 3NDKA 3ZSWA 3L3VA 2HB5A 1J9AA 3RMCA 1BL3A 4CGGA 1TAQA 4RW9A 3ZT1A 1JLEA 1WAJA 4ID5A 1KFDA 2BANA 5DMRA 3TWHA 2Z1GA 1S9EA 3LDSA 1JLBA 3O4QA 3TAFA 3S3NA 3E01A 4CHPA 4Z4CA 4NCBA 3MECA 1XI1A 4F3OA 4FZXC 4FZZA 1VSIA 3CQ8A 2P5OA 5SZTA 1L5UA 4CF9A 2BGGA 3HPHA 3SV3A 4KB0A 1TK8A 1RBRA 3VQ8A 4KTQA 3NFAA 3ZT2A 1VSJA 2KTQA 1RCHA 3HM9A 4RW7A 4DF4A 4FM0A 3AVJA 4OLAA 2BE2A 1D8YA 4I2QA 3OJUA 2G8IA 2KFNA 4Y1CA 3IRXA 1NOZA 3DMJA 4FJ7A 4BE2A 3TAPA 3NF7A 2YKMA 4KHWA 3EYZA 1NK5A 4B9MA 3HP9A 3AO2A 3K5LA 1RTIA 3OYGA 4E7KA 2PYLA 3NF6A 3OVNA 4FLXA 4CJEA 1U49A 4FZYA 4KHQA 2IS3A 4AILC 1X9MA 3PUFA 1L3VA 4BWJA 4K8ZA 2YNGA 3O3FA 3AVBA 4FJMA 4CFDA 2YKNA 4JRPA 1BCOA 2PZSA 3DLHA 1RT4A 3F73A 4CGJA 1NK4A 3NH2A 2KFZA 4DLEA 1VSDA 3L3UA 3MXIA 4M41A 1Q9XA 3AVFA 2OZMA 4ELUA 4IBNA 4XIUA 4N76A 4E89A 4F3TA 1RDBA 2AJQA 3HVRA 1U04A 1QSLA 3AA3A 4FM2A 3IAYA 2YNFA 3RMAA 4OKEA 4CEFA 3O4NA 3OYBA 3ZT4A 3SJJA 3AVMA 2RF2A 4HUFA 4EP4A 1BI4B 4CGIA 4FM1A 4DQPA 3OYHA 4J2AA 4KFBA 2QK9A 4C8NA 3ZT3A 4B9UA 2IC3A 5CZ2A 5HLFA 3EY1A 1FKPA 4FJLA 5DK5A 5CZ1A 2HNDA 3HK2A 4JS4A 3KKRA 3QEPA 4DS4A 1LAWA 1HJRA 1S1XA 4LH5A 3ZT0A 4DU4A 3CFOA 1A5VA 5KGXA 3KTQA 1ZYQA 3RR8A 3L2RA 2OPRA 4FK4A 1YVUA 4FJHA 1C1BA 1S1UA 1RBUA 4DSFA 2X74A 1C0TA 4E1NA 3SNNA 4CJQA 1RDCA 2KZZA 1JLFA 4FJJA 1XHXA 4NCGA 1XC9A 2ZQBA 3AV9A 4FJ8A 1HPZA 4BDYA 1A5WA 1KTQA 3SUOA 3MEDA 2XY8A 4CGDA 1TGOA 4DQSA 5E41A 1BIZA 1ZBIA 3QEXA 1HNVA 3HVTA 4HTUA 2PY5A 4CF2A 3DYAA 1Y97A 2F8SA 2HVIA 1A5XA 1T8EA 2VG6A 4OGCA 5J2NA 1Q9YA 4KO0A 4B8CA 1F21A 2I5JA 2JGUA 1U48A 4DFPA 4OJRA 4CEZA 4OGEA 4ELTA 3PX0A 4CHNA 4Q0BA 1CXUA 1FXXA 4KV8A 5FRMA 3NAEA 3QERA 2XY7A 4FK2A 1KCFA 4E7LA 1VSEA 4DLGA 4DWIA 2YNHA 2YHAA 2DFFA 1XWLA 1DTTA 5CYQA 1D9FA 3LWMA 4FJGA 3AO1A 3QINA 5T7BA 3RWUA 2Z1IA 3DLEA 3P5JA 1SL1A 1D9DA 1LW0A 1MU2A 1B9DA 1JLCA 3QESA 4KRFA 3ZSZA 4FVMA 1EETA 3ZSQA 1LV5A 3V1QA 2P5GA 3MXJA 3K59A 1L3SA 1ASVA 1RTJA 4KTZA 3OY9A 1KRPA 2KW4A 4FYDA 1ITGA 4YFUA 1GOAA 3DRPA 3VQBA 3A2FA 1S1VA 2LSNA 1FK9A 4DTXA 4O55A 4W5QA 3ALYA 4FLYA 1RT1A 1RTDA 1VRUA 3KLFA 1NK7A 1QE1A 2P51A 1TL1A 3SUPA 4HHTA 4LY7A 4F2SA 4HUEA 4CESA 2A1RA 4DQQA 3OYKA 4RW4A 3JSMA 2G8WA 2DTUA 2W42A 1BQNA 3KK1A 4PWDA 1I39A 3TAGA 3LALA 2EX3A 2Z1HA 3VQQA 1NK0A 1HNIA 4KB1A 4W5NA 3VN5A 4O0JA 3D0PA 1IKVA 1G15A 4FLZA 3VQ6A 4I9QA 4AHRA 3SV4A 3DRSA 3KLIA 1JXBA 2R7YA 2HHQA 3KIOA 1ASWA 4O5BA 3CFPA 4K8XA 4ICLA 1DLOA 5KTQA 3B6PA 5FDLA 1WSEA 1W9HA 2YNIA 1ZBFA 1IO2A 4AH9A 4ZHRA 3C6UA 3AVAA 1Z25A 3C6TA 4CIFA 3QETA 4QAGA 1NJWA 3NE6A 4DFJA 3WNEA 4MFBA 1NK9A 2O4GA 5HBMA 3V81A 1SL0A 1U47A 2QKKA 4DSKA 1NJYA 1UA0A 1S6QA 3OYLA 1ZBHA 4CEDA 4BE1A 3RTVA 4DSLA 3V1RA 4CF8A 3CYMA 2OYQA 2FC0A 2OZSA 3G10A 3RRHA 2X6NA 1KVAA 3HPGA 3DLRA 3TAMA 3TANA 1HYZA 2VG5A 3OYDA 4CJWA 1CZ9A 4B9NA 1C0MA 3V9WA 1LW2A 4LD0A 4OVLA 3T3FA 1HQUA 1IKXA 1LAVA 2RKIA 3EZ5A 1EP4A 3NH1A 4CEOA 1YT3A 5KRTA 2XO7A 4B8AB 4FLUA 1QSSA 1ASUA 1BQMA 4NYFA 4M3RA 1HRHA 1NKBA 2HHSA 1WNSA 3I8DA 3LWLA 3SCXA 2FBTA 1KLMA 4CHZA 4W5RA 2D0AA 3V9UA 3LP2A 1TKTA 2EHGA 2IGIA 4E7HA 3K5NA 4DG1A 2RN2A 4FW2A 4N56A 2ZD1A 4Z4EA 3KK3A 1VSKA 2VWKA 3WNFA 4DFKA 4J2EA 1BGXT 2IDOA 3V4IA 3T1AA 4Z4IA 1RT3A 2G8FA 4DTNA 1SL2A 3L8BA 2YV0X 1N6QA 4FCYA 1BISA 4Z4HA 4CFBA 3NCIA 5K14A 5CY4A 3DOLA 3NH0A 4C8LA 4CFAA 1JL1A 3CFRA 2WONA 3RMBA 1U4BA 2D0CA 4AHTA 4QOZB 3VQAA 3JYTA 2G8HA 3TR8A 4WE1A 2A1SA 3QEVA 4JS5A 3DLKA 1QS4A 3SPYA 3IS9A 3AVIA 1NJZA 5J1EA 1BHLA 4CJPA 4IDKA 3BGRA 5JS2A 1HQEA 4UQGA 4W5OA 2HMIA 3PY8A 4W5TA 4IKFA 4J2BA 4KAZA 1GOBA 1TKXA 3KLGA 3HPOA 5KI6A 3V9ZA 4I7FA 3UIQA 4DTJA 3VQCA 4IG3A 4O4GA 1TL3A 1GOCA 3DRRA 3LZIA 1JLGA 4KHYA 4DU1A 5I3UA 3THVA 3DM2A 3D45A 4YNQA 1VSHA 3LP3A 4GVMA 1JLAA 1UOCA 1SV5A 1UWBA 4DFMA
chains in the Genus database with same CATH superfamily
3V1OA 5A2QO 1TK5A 3F9MA 2OPPA 3S41A 5GINA 1NK8A 2FSJA 2VWJA 1W7AA 3LAKA 4GKJK 3T19A 3LDPA 1GLDG 2VQEK 4CK1A 2A5XA 4XH5A 3ULDA 2HHXA 1XHZA 1HX1A 1WAFA 2QXFA 4NYNA 3FR0A 3ASMA 1VQ4N 3JXUA 4FXDA 2O8FB 2ITGA 4CK3A 3R9PA 3G6EN 4M3UA 4Z4GA 1UAXA 5JS1A 3OW2M 3MEGA 3ZYYX 4DV2K 2E2OA 4DSJA 3K9JA 2D0BA 4PY5A 3M3ZA 3DLGA 3O6WA 2HW3A 4Z4FA 1EXQA 2CGJA 4CJUA 3M8RA 4KHSA 1KVCA 3I0SA 4BG9A 5JLHA 1BUPA 3U8XA 4BRMA 1BU6O 4C8MA 4BC4A 3MN7A 3UKUB 4BDZA 1XUPO 2Q97A 2CGKA 3T7ZA 4FK0A 1VSMA 1O1WA 1WSGA 1VRTA 3M8SA 4AHSA 4CJFA 5M1KA 4M3WA 1JL2A 4N5SA 1VSFA 4B9SA 4CHYA 4GMJB 1WB9A 4FJ5A 5HP1A 3A0IX 3TTCA 4RCHA 1YIJN 3U6FA 1MWKA 4WQ5A 2QXLA 4F8RA 1HNXK 5DM6L 4KI6A 4B9VA 3QICA 3A5LC 1E3MA 3MCAB 4ISGA 2P1JA 5LJVA 3HI0A 1UA1A 1TKZA 1C0UA 3UKRB 3M8PA 1YXQA 4B1YB 1NLVA 4FJNA 1YHQN 4KH6A 2P9IA 4AHCA 1VQ6N 2OA8A 3H45C 4OLBA 3M8QA 3OS0A 2QW9A 3VGLA 4CJLA 3B6OA 4X64K 2D0PA 1LWEA 2Q3SA 1Q7YO 3EEQA 3OYIA 3H6EA 3V6DA 4PL8A 4A2AA 3CM5A 3MXMA 4WQ4A 4CHQA 2UUBK 2BTFA 1BWFO 4G1QA 1KAYA 3QMLA 5HRSA 3MDQA 3THXB 1LWCA 3CETA 1KLNA 3VEZA 3DXKA 5AQUA 3ZSYA 3TSUA 3LANA 1J54A 2W40A 3VGKA 2I7NA 2Y1JA 3D2EB 2O8DA 4DV5K 2VGNA 3MEEA 2QWRA 3OHRA 3L2QA 5KQ8A 3PIPL 3GDQA 4DTOA 4KH4A 3T1HK 4IEEA 3RMDA 1NBWA 5J2QA 3VQEA 4CEEA 1HYVA 1R59O 4CGFA 5AR0A 5C2FA 1N36K 2O8CA 1Q18A 5C0YA 3AVNA 4CEAA 5KRSA 4LH4A 3ZSRA 3L2WA 1IG9A 4M3YA 3RR7A 3ZETB 3CM6A 4IJAA 4DF8A 5HRNA 1BCMA 3OYMA 1VSLA 3OS1A 3CIPA 4CCHA 1BIUA 4YORA 4BG8A 1QQNA 3ZSVA 1K8AO 4E0DA 4F4KA 4WFAL 2D1KA 4DS5A 4IO9L 1U6ZA 3NHGA 5DM7L 4CE9A 1HKCA 1WSJA 3LPTA 4DTSA 4E3SA 1HKBA 2H3GX 2G8VA 1KXPA 4Q5VA 4KPYA 2E6LA 1NMDA 2PAVA 3IUCA 4CHOA 3VERA 4B1XB 2IVOA 1BL3A 4CGGA 1TAQA 1N34K 1T6DA 5DMRA 2BANA 3TWHA 5KQDA 1JLBA 3TAFA 3S3NA 4Z4CA 1YITN 4FZXC 1VSIA 4CF9A 3DXMB 3L4QA 4LFBK 2KKZA 1RBRA 2QWQA 4KTQA 5AQVA 5KPTA 3NFAA 3CQXA 1RCHA 3CCVN 4RW7A 1ESVA 4OLAA 3KHYA 4I2QA 3OJUA 4CBUA 2O8BA 1IBKK 1NOZA 4L3QA 2UUAK 2O8EB 2WBNA 5C12A 2UUCK 4H03B 3NF6A 3OVNA 4FLXA 4KHQA 1CZAN 3PUFA 4K42A 1L3VA 4K8ZA 3HOTA 3O3FA 3AVBA 4CFDA 2PZSA 1QQMA 2YI1A 5GIPA 4JI8K 3R3LA 1DEJA 4NO7A 3HVRA 3O80A 3AA3A 3DXKB 4FM2A 1ZC6A 3IAYA 2YNFA 5AQNA 3OYBA 2RF2A 4EP4A 1BI4B 4FM1A 2VGMA 4BR2A 3ZT3A 3E66A 5CZ2A 3FZMA 3QFPA 4PKGA 4JKBA 2YHXA 4JKAA 1HJRA 4LH5A 3I33A 1A5VA 5KGXA 3KTQA 1ZYQA 3THWB 1MA9B 1YVUA 1C1BA 4DSFA 2X74A 4KBOA 3SNNA 2UU9K 2KZZA 4IOAL 1HPZA 1KTQA 4A62A 3WXLA 3SUOA 2XY8A 4CBXA 5IWAK 4GV6A 1BIZA 1ZBIA 2A42A 3M5RA 1HNVA 3JAMO 3UKRA 2QM1A 4FOEA 4CF2A 1Y97A 1T8EA 2VCPA 1F21A 2I5JA 4DFPA 1YF5L 3ZETA 3PX0A 4Q0BA 4KV8A 1FXXA 3CCMN 1QVGM 4FK2A 2YNHA 3K9KA 5CYQA 3AO1A 4MLHA 3FZHA 5T7BA 2YJEA 3P5JA 3HM8A 1B9DA 4KRFA 4FVMA 3K59A 1ASVA 1RTJA 3P31A 4PL7A 4JI2K 3WEEB 3DRPA 3FE1A 1FK9A 4DTXA 4O55A 4FLYA 1GLEG 1RT1A 2E2NA 5M1FA 1TL1A 5F1XA 3MK6A 2G8WA 3EO3A 2W42A 1NNEA 3TAGA 3LALA 4IO8A 2HBKA 2Z1HA 3VQQA 1NK0A 3VN5A 4O0JA 4FLZA 1VQNN 1GLJO 3SV4A 2R7YA 3L6QA 4K8XA 1DLOA 5CE3A 2O8FA 2NRWA 3AVAA 4CIFA 3O9SA 4QAGA 3NE6A 1NGAA 4DFJA 2QWMA 2O4GA 4DSKA 4I6MB 1NJYA 1UA0A 3FZKA 1DT9A 2FC0A 3RRHA 3TAMA 3C0BA 1LCUA 3V9WA 1LW2A 4WFNL 2ASOA 1VQ7N 1IKXA 2RKIA 5AZIB 4H5NA 3NH1A 4CEOA 2XO7A 1QSSA 1HRHA 1KLMA 4W5RA 2O8CB 3DJCA 4DG1A 4J2EA 1HKGA 1T3VA 2IDOA 2HBJA 3T1AA 4Z4IA 3VEXA 4DTNA 1VQ5N 1SL2A 1OH8A 3CJCA 1HR0K 1M1KO 5CY4A 3DOLA 3NH0A 2A3ZA 4WE1A 5GIOA 4JS5A 1QS4A 1C0GA 3THXA 4CJPA 1Q82O 5JS2A 3BGRA 4IKFA 3HO1A 3PY8A 5BRDA 1V4TA 5KI6A 4I7FA 4ISEA 3VQCA 3VOVA 4IG3A 3A5MC 3LZIA 1XNQK 4DU1A 1SZ2A 1VSHA 2W6KA 4GVMA 3N4PA 3ENHA 3BZKA 1TKDA 4FSVA 3V9XA 1U2VA 3CD6N 1C1AA 4O5FA 4FLVA 1RGIA 4BR4A 4O0IA 2VG7A 1GLBG 3W3DA 3SQ4A 3K5OA 3WEEA 4FOIA 1SKSA 4CERA 2DY4A 2B4JA 3SAGA 4EZ6A 4HTLA 1FKOA 3LPUA 4X66K 4ZTFA 4ELVA 3HT3A 4B1WB 2PFUA 2E4LA 5FRNA 3RSEB 3P1GA 4WYBA 3FLCO 1G99A 4FO0A 4CGHA 5C42A 2YHWA 4A59A 1D5AA 4PQUA 4EP5A 3ISNC 3I56N 1JKHA 2EWSA 3P4IA 1ATNA 1S5JA 2ATQA 2HF3A 3CHWA 4BRDA 3QDKA 4JKHA 3AO4A 4QCLA 4NCAA 1HJOA 5EU7A 4CJ3A 4CIEA 4Y1DA 4RWTA 4CZGA 3OS2A 2X6SA 2VWBA 5AQWA 1XQSC 3VETA 3VEVA 3F2KA 2BDPA 5CYMA 4K25A 3TTFA 2HBLA 5JICA 1YTUA 1BI4A 4DV3K 3C65A 5CR4A 3AO3A 3NGIA 3PSIA 3ULEB 2IAJA 4QS9A 2FF6A 4HUGA 1RDUA 2QEXN 2P9UB 1JLQA 4JV5K 4EAHD 2E2PA 3THYB 4CZKA 3GL1A 3CCUN 3TABA 2D5RA 2HHUA 4ILGB 3AVKA 4B9LA 1SKWA 4BE0A 1NJIO 3R1XA 1RTHA 1EWRA 4H5TA 5GAGP 4CEQA 3CF5L 4IEIA 2ZE2A 1X1PA 4OPHA 1O13A 3MX5A 4JN4A 4Y0WA 4OPJA 2ZF5O 2A40A 3HJFA 3WNHA 3KJVA 5EX5A 1S6PA 3IG1A 5JMVA 1W0HA 1SUQA 5AQQA 1YTAA 5KGWA 3RVCA 3VQ5A 3AO5A 3PX4A 3DLBA 3LDOA 1BOTO 5AQHA 2CGLA 4N47A 3I55N 3J80O 4BACA 1BA0A 2NLXA 3D2FB 4BRIA 4LC9B 4AHUA 3OYJA 3PV8A 1R0AA 2E20A 4FJIA 1T03A 4ZTJA 3K2PA 1S1WA 3KLHA 2XY6A 3KKSA 4LSLA 4DMNA 3O9QA 4DV4K 3SQ2A 3MN6A 4CF0A 3HP6A 1T7PA 2AP1A 3LM9A 2E88A 4OKJA 1HMVA 1WLJA 3KD5E 5FPEA 4FPBA 2HMPA 4LF9K 4CZJA 2OANA 2HNYA 5BN8A 1KSPA 3VENA 3FFIA 4H4MA 1WUAA 1QVFM 2Y1IA 3HYFA 2WFBA 2IVPA 3AVLA 5ADXH 4AF1A 3R8EA 4X62K 3LZJA 3ZSOA 4WQ4C 2WOMA 4H4OA 2ETJA 3K5MA 3VA3A 4KHNA 3I0RA 5AQSA 4KTWA 3H08A 1TVRA 3L2UA 4CECA 4M45A 4E1MA 4FJ9A 4JK8A 3ZEUB 2BUPA 3F5TA 3OYEA 1EKEA 5AZIA 5SWMA 4KI4A 3EE8A 4FJXA 3VPZA 1S72N 4WFBL 5LL6Z 3OJSA 2ZJRL 4DV0K 2ZM6K 3TARA 3IDHA 1M90O 1TV6A 4ISFA 3NDKA 4JKGB 3L3VA 3RMCA 3ZT1A 4ID5A 3LDSA 3O4QA 4CHPA 4NCBA 5BRHA 4MDAA 1LOTB 3HSCA 3CQ8A 3WQTA 3M6GA 4BC3A 5SZTA 2BGGA 3HPHA 3MCPA 1IBLK 3VQ8A 2KTQA 3GBTA 3HZ6A 3AVJA 3C7NA 1ZXOA 2G8IA 4KHPK 3IRXA 2KFNA 4BE2A 3SMSA 1YI2N 2YKMA 4DUYK 3HP9A 3AO2A 4NLCA 4E7KA 5AQZA 3CCEN 2IS3A 2IVNA 4H0VB 5E84A 1X9MA 2P9LB 4IZ9A 4DUZK 3OA9A 5F0XA 4B3MK 3F73A 3NH2A 4UY8O 1VSDA 3MXIA 3C6HA 1Q9XA 2OZMA 4ELUA 4N76A 2AA4A 1RDBA 5ADXA 1U04A 3EZWA 3SJJA 3AVMA 4HUFA 2QWNA 3TPQA 1OH5A 4J2AA 2ZJPL 4KFBA 4C8NA 4IFEA 5H1SQ 1FKPA 4JS4A 4YOTA 3KKRA 3O5BA 3GE1A 4DS4A 2UXBK 1S1XA 4FK4A 2OPRA 4FJHA 4BRGA 1S1UA 1RBUA 5GAHP 1ATSA 1C0FA 2V51B 5EXWA 2A41A 3EKSA 1JLFA 1TYQA 4NCGA 1XC9A 3AV9A 3MEDA 4DQSA 2OTJN 3QEXA 3QBXA 2PY5A 2FSKA 2HVIA 2F8SA 3DAWA 3VESA 1JCGA 2FXUA 4DV1K 4OGCA 5J2NA 1U2VB 4KO0A 1U48A 4OJRA 2P9KB 4JKDA 1MDUB 4FWKA 4CHNA 1N32K 1K8KB 3NAEA 2F7TA 2NRVA 4DWIA 1VSEA 3AY9A 4JD2A 1D9FA 3ZX3A 3QINA 4DB3A 3I8BA 1SAZA 3WQUA 1TYQB 1SL1A 3QESA 3ZX0A 1LV5A 3ATVA 4OX9K 3MXJA 4JKGA 4KTZA 3OY9A 4FYDA 1GOAA 1QQOA 1S1VA 2P9PB 3G25A 3ALYA 1NU0A 1VRUA 1NGDA 1NK7A 4LY7A 1N8RO 3CCQN 2QWPA 2A1RA 2JWLA 3JSMA 1ATRA 1NM1A 2CH5A 4PWDA 1I39A 1KQSM 4MDBA 3O1BA 1RDWX 2YJFA 4CW7B 1IKVA 3VQ6A 5BR8K 3EKUA 3DRSA 2HHQA 5BN9A 3CFPA 5AQFA 4ICLA 5FDLA 3CCJN 4XEIA 2P9PA 1IO2A 4AH9A 4ZHRA 4JI6K 1KC8O 1Z25A 4CI6A 4BRCA 3KK7A 4JI1K 4I6MA 5HBMA 1NK9A 4CD1A 3VMFB 4BE1A 2YHYA 3LDNA 4A61A 4CF8A 2OYQA 4DQ8A 3DLRA 1HYZA 1V4SA 3PLAA 1C0MA 1E4GT 3ZLJA 5M1QA 3T3FA 1YT3A 5KRTA 5AQXA 4FWQA 4NYFA 2QTDA 1WNSA 4DR6K 3I8DA 3K0SA 3LWLA 3E1YA 5AQKA 2FBTA 3VGMA 4B1ZA 2NRRA 3V9UA 1D4XA 2EHGA 4DR2K 2IGIA 2P9KA 4LF7K 4N56A 1K9MO 1VHXA 3LL3A 5FPNA 1RT3A 3L8BA 1N6QA 2WUSA 1HLUA 1BISA 4CFBA 3NCIA 3CC7N 4CFAA 1YJWN 2D0CA 3WXIA 3AARA 5BPMA 1EQYA 3E9LA 1VQON 3DLKA 3SPYA 1NJZA 2YCHA 1VQLN 2HMIA 4W5TA 5AQOA 3HPOA 3UIQA 3DRRA 4B3TK 5I3UA 3DM2A 5TKWA 1YJNN 4V19S 1JLAA 3RSEA 4CZIA 2B6AA 1CXQA 3N4QA 3WXJA 4IFVA 1LWFA 4OKKA 5AQIA 4MQ3A 3UE5A 4JLHA 4LSNA 1S1TA 3PO5A 3QLHA 4H8KA 3V9SA 5AZJB 3WNGA 3L2VA 5KPZA 5HRRA 4BVOA 5F2RA 3KLEA 1X3MA 1WSHA 2RPIA 2IOCA 5BREA 2KLAA 1NJXA 1NGCA 3AVGA 3LP1A 4ILHA 4M42A 3VF4A 2DPNA 3TAEA 1RBVA 2WC9A 2DFEA 3PO4A 1VK0A 4WF9L 3SQ0A 3ZSXA 1JXEA 1KVBA 5M1OA 1WOQA 4BRLA 4DTMA 3BEXA 4BQLA 4E19A 3QIPA 1W2BM 4CJRA 5FLXO 3EE9A 3OYFA 3OYCA 4O8UA 3SBGA 1S9GA 1YUWA 1RT7A 1T6CA 4DSEA 4BVPA 5LY3A 5C10A 4YHHK 4B1UB 4I2PA 4M3TA 3ITHA 1J6ZA 4CF1A 1GLFO 2O8EA 1KAZA 3AA5X 3TTDA 1NG9A 3NF8A 4FJKA 3U3YA 4DTRA 4CJ5A 3HXMA 1WBDA 3CJBA 2ITMA 3H1QA 4B3SK 5AQJA 4MLEA 5MLCQ 1QHAA 2XRIA 4LFCK 1X3NA 3BF3A 4BGBA 5I9EB 1X9WA 3THYA 4BDPA 2ASMA 4H5VA 3LAMA 2GUIA 3SAHA 3DOKA 2PYJA 4JRQA 1J53A 3R6MA 4FLTA 1NWKA 3FFKB 3SUNA 4OPKA 4HCCA 1NGIA 3QNOA 3LDLA 4LF8K 3J7AP 1RFQA 1IKWA 4CJ7A 2HSTA 4FWNA 1I3AA 5C24A 5I42A 2KQ2A 3TU5A 2ZGZA 4JI0K 1Q86O 5AFUA 1X9JA 3C7NB 3VQPA 3QEWA 4L8RB 3CG7A 3KK2A 2G8UA 2E2QA 2GX9A 4O8KA 3QIOA 4U7BA 2CH6A 4E1JA 2F8TA 4AHVA 1QTMA 4HCBA 1VQ8N 3VQ4A 5FROA 4BGAA 3SJHA 3MN5A 1VQPN 1J5OA 3OYNA 4FW1A 1OH6A 3QFUA 1S3XA 1YVNA 1C6VA 1DTQA 3VA0A 3S9HA 2HVHA 5FPMA 2FBXA 4DV6K 4I9LA 4JK9A 2JLEA 4M3ZA 3D2FA 1B92A 3JS6A 3SQ1A 3H46O 3SK3A 4N41A 1IJJA 3CJ1A 4H0OA 5HROA 2O4IA 4PUOA 4PKHA 5BRFA 4RW8A 1I94K 2FBYA 1NGHA 1U45A 2HHVA 4DSIA 2Q31A 4JK7A 4C8OA 3U4LA 3K58A 2GBZA 4KREA 3F9KA 2XY5A 4DQIA 4FZZA 2Q1NA 1RILA 3NF9A 4J8FA 1CZBA 1ZBUA 3SUQA 3DXMA 1NGEA 1CLQA 1B9FA 3QNNA 3CQYA 1L3UA 1GLLO 3NGZA 4IDHA 4O44A 3AVCA 1Z26A 2Q2RA 3MAQA 4KKOA 2E1YA 2X78A 3TSQA 2GWJA 3P83D 1WN7A 2P9NA 3QO9A 5AFUH 1SKRA 4DTUA 1J5EK 1GLAG 4CIGA 4E7IA 1NKEA 3ZSWA 5EVZA 1P90A 2HB5A 3CJ7A 1SQKA 1JLEA 4JEPA 2Z1GA 3AAPA 1S9EA 4IWVA 3E9PA 1XI1A 4F3OA 3AGRA 3WXMB 1FJGK 2UXCK 3CC4N 3SV3A 4KB0A 4H0TB 4FWPA 4DF4A 4FM0A 3G71N 2BE2A 2W41A 4H5RA 4CZMA 3VF6A 4Y1CA 3VTIA 3DMJA 4FJ7A 4KHWA 3WUHA 3PIOL 1NK5A 4BR5A 1QZ6A 1QZ5A 1RTIA 3OYGA 4H0PA 4M63C 2PYLA 3O9UA 4CJEA 4C23A 4AILC 4BC2A 4FJMA 3J8AA 2NRXA 2YKNA 3DLHA 1BCOA 1RT4A 4ILJA 1NK4A 2KFZA 4DLEA 3L3UA 3GOIA 2HF4A 1YJ9N 4IBNA 2AJQA 3O4WA 1FW6A 1SS6A 4OKEA 4CEFA 1IBMK 3O4NA 3A8YA 3SMPA 4EHUA 3OYHA 5CHIA 2QK9A 2IC3A 5HLFA 3VEYA 4FJLA 5CZ1A 2HNDA 1YAGA 3THWA 2I7PA 3QEPA 3ID6A 4DU4A 3ZT0A 5AZJA 4JI7K 3L2RA 4IOCL 1C0TA 4KH5A 3W0LA 4CJQA 4BRHA 4EFHA 4FWLA 5HL7L 1XHXA 4DCHA 3QB0A 4BY9C 3J81O 1TGOA 3FZFA 5E26A 3CXCM 4GY2B 5E41A 1BDGA 3KZBA 2OTLN 3HVTA 5IT9O 1IG8A 3DYAA 4RTFD 2NNWA 1OH7A 4A5AA 1Q9YA 2QWLA 2JGUA 2Q0RA 3UB5A 4CEZA 1NGJA 1XNRK 3QERA 2XY7A 1KCFA 3GG4A 4DLGA 1EO1A 2DFFA 1VQMN 4B1VA 4EIAA 4H0XB 3NVMA 1NGGA 2D4WA 4FJGA 4MO5A 1D9DA 1LW0A 3Q7CA 3FGUA 1JLCA 1EETA 4A5BA 1KRPA 3U9ZA 2KW4A 1ITGA 2V7ZA 4YFUA 1VQ9N 1HNZK 4YDUA 2QA4N 3D2EA 2O8DB 2P51A 3SUPA 4HHTA 4HUEA 4DQQA 4RW4A 1GLCG 2DTUA 3J7ZO 4NB4A 2YX6A 2EX3A 4W5NA 4KB1A 3D0PA 3M1FA 2HOEA 1XMOK 4I9QA 4AHRA 5AQMA 3KLIA 3H3OB 1WBBA 3KIOA 4O5BA 5JLFA 1WSEA 1W9HA 1ZBFA 3SAFA 3IMXA 3C6TA 5AQRA 2P9NB 4MFBA 3V81A 1SL0A 1U47A 2E1ZA 4OO1J 1S22A 4FVUA 1S6QA 1Z6RA 4DSLA 2F9TA 3G10A 3HPGA 4DHYA 4K0KK 2VG5A 4X65K 4CJWA 1OKJA 1CZ9A 4YOUA 4LD0A 1HQUA 3EZ5A 2FF3B 2ZGYA 1ASUA 4K43A 4M3RA 2JWKA 3KWGA 3C6AA 2HHSA 4BRQA 4YOXA 3SCXA 4B9QA 5AJ3K 4WCEL 2D0AA 3LP2A 3HBTA 3CPWM 4IJNA 2RN2A 4Z4EA 3KK3A 1VSKA 2VWKA 3WNFA 3H3NO 1BGXT 4CZLA 3OTOK 3V4IA 2P9UA 4BRPA 2GEMA 3KVGA 4Z4HA 4JD2B 4NXNK 4C8LA 1JL1A 4JKFA 4YOYA 3CFRA 4AHTA 4QS8A 3ENOA 3JYTA 2G8HA 3TR8A 2A1SA 2PBDA 4CZFA 1BHLA 2KHOA 2UYTA 4KAZA 1GOBA 1TKXA 3CJ9A 3KLGA 1HUXA 3BY5A 4O4GA 1TL3A 2QI2A 2J4RA 3MN9A 4KHYA 2E8AA 4HWIA 3ULEA 1UOCA 1UWBA 4DFMA 4BR9A 4DKWA 2Z1JA 3SLCA 5JVHL 3HTVA 3G0ZA 3E9OA 4NXMK 3K57A 3VF2A 3RRGA 2XHBA 4TSXA 4CJSA 3WXKA 2QKBA 4B08A 1RBSA 1IH7A 3CCSN 5J2PA 1ZBLA 2NRTA 3S3MA 4CFCA 4C1NK 1HYSA 3CCRN 4BROA 1E4FT 3DWLA 4R5PA 4BWMA 3TAQA 1X9SA 2YHBA 4QS7A 4IG0A 3VEOA 4AM7A 3Q7BA 5BR9A 2F96A 3DI6A 4DR1K 2V52B 4AM6A 2KZMA 4RW6A 2FBVA 1QQCA 3EN9A 1WSIA 4LF5K 3L4IA 4EZ9A 3C94A 3SYZA 4DR7K 4YOVA 4R79A 1RDAA 4NLBA 4HVJA 2E6MA 3EL2A 4CJ4A 3KD1E 2HBMA 5FPDA 4BRNA 2ZJQL 1TK0A 1QSYA 4ID1A 1DKGD 3L0QA 2Q0UA 4FWMA 1DGKN 5J2MA 5C25A 3HSTB 4RG8A 3LP0A 3S3OA 5AQGA 3H1VX 2OPQA 3IKMA 1K8KA 1TUYA 1EWQA 4CEBA 3A5OC 1JJ2M 4PA1A 4CK2A 1RNHA 3ENBA 5HRPA 4DR5K 1ZBSA 4YY3K 3SZ2A 4FWSA 3AA2A 3PX6A 3SI6A 4B3OA 3O3GA 1RT2A 3C95A 1KFSA 4JAXA 3ZCMA 3O9TA 4JI5K 4JHDB 3OYAA 2A6AA 2NUBA 2UXDK 3AVHA 1L3TA 3SPZA 3CMEN 4CBWA 2HHTA 4B9TA 3CERA 4DQRA 3HL8A 4BR0A 3U9DA 4IOXA 4IFYA 1NOYA 4DR4K 2DFHA 1Q8IA 4M3XA 2VYPA 4B3RK 3ZEUA 2G8KA 5M1NA 1HNWK 1N5YA 5EOYA 1WSFA 3NBPA 2OCEA 1T05A 4F2RA 4A57A 3O08A 1NKCA 5GADP 1RBTA 2ASPA 1NK6A 4GKKK 4CJVA 2BH1A 1C1CA 3NMUA 3D7EO 5D3GA 5LJWA 4DTPA 3O8MA 3CMAN 1K6YA 3AA4A 3T69A 3QEIA 2WTUA 1REVA 3NGYA 2OPSA 4XH4A 4CJKA 4FLWA 4Z0UA 4CZHA 4H5WA 4KHUA 1NMNA 3BDPA 1Q81O 1TAUA 1RT5A 2NRHA 3CC2N 3VQ7A 1VAZA 5AQTA 4Z94A 3DLLL 1QHTA 4BRKA 3BUZB 3MMVA 4CJTA 1RT6A 3U3GA 3CCLN 4BQZA 3SBTA 1MWMA 3VEWA 2HNZA 5C15A 2NRZA 1RDDA 5C2DA 3QBWA 5M1PA 3VQDA 2ZWHA 1EX4A 3TI0A 4DU3A 1P8ZA 3BF1A 3O3HA 1K73O 2B5JA 3T1YK 4GV9A 4J2DA 4CZEA 1OVYA 1IKYA 1W97L 1N33K 2HHWA 4GW6A 3NVKA 4JKEA 2GV9A 4M7XA 3UKUA 4E7JA 3VQ9A 4C8KA 4JYAK 1J9AA 4RW9A 3ATUA 1WAJA 5BPLA 1KFDA 5AQYA 3ID8A 4JI3K 4GVEA 4AQYK 3E01A 1NGBA 3MECA 3LDQA 2P5OA 1L5UA 1H1VA 1KAXA 4F9OA 1TK8A 4G9ZA 3ZT2A 1VSJA 3HM9A 3FZLA 1JCEA 5TKYA 1D8YA 3KWIA 3BP8A 2FSNA 2GTDA 3TAPA 4GV3A 3NF7A 3TSPA 3EYZA 4B9MA 3K5LA 1U49A 2W6LA 4FZYA 1KD1O 2F4VK 4A2BA 4BWJA 2YNGA 4BC5A 4EHTA 4JRPA 4CGJA 4BRFA 4M41A 3AVFA 4XH1A 1Y64A 4E89A 4XIUA 4F3TA 1QSLA 2O8BB 1IV0A 4OPAA 3RMAA 1TUUA 4FPAA 5AQPA 3ZT4A 3O1WA 4DQPA 4CGIA 2GELA 4BR7A 4B9UA 3EY1A 4PKIA 5DK5A 1OVQA 3HK2A 2F9WA 4DR3K 1LAWA 3MWTA 1Z05A 3CFOA 4YDUC 1VQKN 2GWKA 3RR8A 5EY4A 2P9LA 3OBWA 4E1NA 1RDCA 4YOWA 4FJJA 4U67L 2ZQBA 3PSFA 4FJ8A 4BDYA 4K41A 1A5WA 4CGDA 4DV7K 3HRGA 4H0YB 4JHDA 1ILYA 4WQ5C 4HTUA 1A5XA 4LF4K 2VG6A 3A5NC 4B8CA 4OGEA 4ELTA 1CXUA 5FRMA 3HOSA 4BREA 4E7LA 4C1NI 2YHAA 2HHHK 1XWLA 1DTTA 3OBYA 3LWMA 1XC3A 5GAEP 1BO5O 3RWUA 2RE2A 2Z1IA 3DLEA 1MU2A 3IFRA 2QWOA 3ZSZA 3ZSQA 3V1QA 2P5GA 1L3SA 2P9SA 3VQBA 3A2FA 1BA1A 2LSNA 1NGFA 4JNEA 4W5QA 2E5LK 2P9IB 1RTDA 3KLFA 5LMNK 1QE1A 4F2SA 4CESA 3OYKA 1BQNA 3KK1A 4FWRA 1HNIA 1G15A 3CJAA 2IIRA 1JXBA 4FL9A 1ASWA 3ZX2A 5KTQA 3B6PA 2YNIA 4JKCA 2RHKA 2P9SB 3C6UA 5B8HA 3D6RA 3QETA 1BG3A 1NJWA 4BRAA 3WNEA 3O9RA 2QKKA 3OYLA 1ZBHA 4CEDA 3RTVA 5HOOA 5AQLA 3V1RA 3CYMA 2OZSA 3TANA 2X6NA 1KVAA 3AAQA 3OYDA 4GNIA 4B9NA 1JCFA 4OVLA 4M7YA 3P38A 3P39A 1LAVA 5ELZA 1EP4A 4LF6K 4B8AB 4FLUA 1BQMA 1NKBA 3B8AX 3CI5A 2Q36A 4FWOA 4CD3A 2D0OA 4CHZA 1TKTA 4E7HA 3K5NA 4FW2A 2ZD1A 2NZTA 4DFKA 2V7YA 3LM2A 4IXCA 2GUPA 2G8FA 3MWPA 2YV0X 5JVGL 4FCYA 3J7YP 5BPNA 1HPMA 5K14A 3RMBA 1U4BA 2WONA 4QOZB 3AGKA 3VQAA 4MO4A 3G4SN 5LMUK 4PHTX 3QEVA 4LFAK 4JI4K 3MX2A 3IS9A 3AVIA 3BZCA 1XMQK 5J1EA 2FLOA 3CPEA 4IDKA 1HQEA 3VTHA 4CVNE 4UQGA 4W5OA 2VQFK 4J2BA 3V9ZA 4DTJA 1GOCA 1T44A 1JLGA 3WT0A 5KPRA 3THVA 3D45A 4YNQA 3LP3A 1SV5A
chains in the Genus database with same CATH topology
1TKDA 3V1OA 3V9XA 1TK5A 2Z1JA 2B6AA 2OPPA 1CXQA 4IFVA 1LWFA 4OKKA 1NK8A 1C1AA 4FLVA 4MQ3A 2VWJA 3G0ZA 4JLHA 4LSNA 1S1TA 3K57A 3PO5A 3RRGA 3QLHA 4H8KA 2XHBA 3V9SA 4TSXA 4CJSA 4O0IA 2VG7A 3LAKA 3WNGA 3SQ4A 3L2VA 3T19A 5HRRA 2QKBA 4B08A 1RBSA 3K5OA 3KLEA 1IH7A 5J2PA 1WSHA 2RPIA 4CK1A 2IOCA 4CERA 1ZBLA 1SKSA 1NJXA 2DY4A 2B4JA 4EZ6A 3AVGA 3LP1A 3ULDA 1XHZA 2HHXA 3S3MA 1WAFA 2QXFA 1FKOA 3LPUA 4NYNA 4CFCA 4M42A 4ZTFA 4ELVA 3HT3A 3ASMA 1HYSA 3TAEA 4FXDA 2E4LA 5FRNA 2ITGA 3P1GA 1RBVA 2DFEA 4CK3A 4R5PA 1VK0A 3PO4A 4BWMA 3SQ0A 3TAQA 4CGHA 5C42A 4M3UA 4Z4GA 1UAXA 5JS1A 3MEGA 3ZSXA 1X9SA 2YHBA 4IG0A 1JXEA 1KVBA 4DSJA 1D5AA 4DTMA 4PQUA 4EP5A 4E19A 2D0BA 2F96A 3ISNC 3QIPA 3DI6A 1JKHA 4PY5A 4CJRA 3DLGA 2HW3A 1S5JA 2ATQA 3OYFA 1EXQA 4RW6A 4CJUA 2FBVA 4Z4FA 2KZMA 1QQCA 3M8RA 3OYCA 4KHSA 1KVCA 1S9GA 1WSIA 3I0SA 4C8MA 1RT7A 4DSEA 4EZ9A 3C94A 3AO4A 3SYZA 4QCLA 4NCAA 5EU7A 4CJ3A 1RDAA 4I2PA 4Y1DA 4CIEA 4BDZA 4HVJA 4FK0A 3ITHA 4M3TA 2E6MA 3OS2A 1VSMA 1O1WA 2X6SA 1WSGA 1VRTA 3M8SA 4CF1A 4AHSA 4CJ4A 4CJFA 2BDPA 3KD1E 3AA5X 5CYMA 4M3WA 1JL2A 4N5SA 1VSFA 3NF8A 1TK0A 1QSYA 1BI4A 4ID1A 1YTUA 4B9SA 4CHYA 4GMJB 4FJKA 3AO3A 3NGIA 3U3YA 5HP1A 4DTRA 4FJ5A 4CJ5A 2IAJA 5J2MA 3HXMA 5C25A 3HSTB 4RG8A 4HUGA 3LP0A 3U6FA 1JLQA 3S3OA 2OPQA 4F8RA 4CEBA 2XRIA 4PA1A 3TABA 2D5RA 4CK2A 4KI6A 2HHUA 1RNHA 5HRPA 4B9VA 3AVKA 3SZ2A 4B9LA 1X9WA 1SKWA 4BE0A 3AA2A 3PX6A 2P1JA 3SI6A 4BDPA 4B3OA 1UA1A 1TKZA 1RTHA 1C0UA 1RT2A 2GUIA 3C95A 3DOKA 3LAMA 3O3GA 1KFSA 2PYJA 3M8PA 4CEQA 3ZCMA 4JRQA 2ZE2A 1J53A 1X1PA 3OYAA 4FLTA 4FJNA 2NUBA 4AHCA 3SUNA 4OPJA 4OPKA 3AVHA 1L3TA 2OA8A 3SPZA 4HCCA 3QNOA 4OLBA 3HJFA 3M8QA 3WNHA 2HHTA 3OS0A 3KJVA 4B9TA 1S6PA 3IG1A 4DQRA 1W0HA 3HL8A 4CJLA 3B6OA 1SUQA 1IKWA 1YTAA 4IFYA 5KGWA 1I3AA 5C24A 3VQ5A 5I42A 3AO5A 1NOYA 3HO1A 2DFHA 3PX4A 3DLBA 2Q3SA 1LWEA 1Q8IA 2KQ2A 4N47A 3OYIA 4M3XA 3V6DA 4BACA 3CM5A 3MXMA 2G8KA 1N5YA 1WSFA 3NBPA 1T05A 4F2RA 4CHQA 4AHUA 3OYJA 3PV8A 1R0AA 4FJIA 4G1QA 1NKCA 3VQPA 1T03A 1RBTA 4ZTJA 3QEWA 1NK6A 3K2PA 1S1WA 3KLHA 4L8RB 3CG7A 4CJVA 3KK2A 1C1CA 2XY6A 5HRSA 2G8UA 3KKSA 4LSLA 1LWCA 3QIOA 5D3GA 4DTPA 4DMNA 1KLNA 3ZSYA 3LANA 2F8TA 1J54A 3SQ2A 4CF0A 4AHVA 3HP6A 1QTMA 1T7PA 4HCBA 1K6YA 3AA4A 2Y1JA 3QEIA 1REVA 3VQ4A 4OKJA 3MEEA 3NGYA 1HMVA 2OPSA 5FROA 3L2QA 4CJKA 4FLWA 1WLJA 4Z0UA 3KD5E 1J5OA 3OYNA 4FW1A 3VA0A 1C6VA 1DTQA 3S9HA 4KHUA 2HVHA 3BDPA 1TAUA 2FBXA 4I9LA 4M3ZA 1RT5A 2JLEA 4DTOA 1B92A 3VQ7A 3SQ1A 4N41A 3RMDA 1QHTA 5J2QA 2HNYA 3VQEA 4CEEA 1HYVA 4CGFA 4CJTA 1RT6A 5HROA 4PUOA 2O4IA 1KSPA 3U3GA 3FFIA 4RW8A 4H4MA 2FBYA 2Y1IA 3AVNA 4CEAA 5KRSA 1U45A 4LH4A 2HHVA 4DSIA 3HYFA 3ZSRA 3L2WA 1IG9A 2HNZA 3AVLA 4C8OA 4M3YA 3RR7A 3K58A 3CM6A 3LZJA 2GBZA 3ZSOA 4DF8A 4KREA 2WOMA 4H4OA 1RDDA 2ETJA 5HRNA 3K5MA 3VA3A 3F9KA 2XY5A 1BCMA 3VQDA 1VSLA 3OS1A 3OYMA 4DQIA 3I0RA 1RILA 3NF9A 4KHNA 1EX4A 3TI0A 4DU3A 1CZBA 1ZBUA 4KTWA 1BIUA 3H08A 3SUQA 4CCHA 3O3HA 1TVRA 3L2UA 4CECA 1CLQA 3ZSVA 1B9FA 4M45A 4E1MA 3QNNA 2B5JA 1L3UA 4E0DA 4F4KA 4FJ9A 4J2DA 3NGZA 4DS5A 4O44A 3OYEA 1EKEA 1Z26A 3AVCA 5SWMA 3NHGA 4KKOA 1IKYA 3MAQA 4KI4A 2X78A 4CE9A 1WSJA 3LPTA 4FJXA 3P83D 1WN7A 4DTSA 2HHWA 4E3SA 4GW6A 3QO9A 1SKRA 4DTUA 2G8VA 3OJSA 4Q5VA 4KPYA 2E6LA 4CIGA 4CHOA 2GV9A 4E7JA 4E7IA 3TARA 1NKEA 3VQ9A 4C8KA 1TV6A 3NDKA 3ZSWA 3L3VA 2HB5A 1J9AA 3RMCA 1BL3A 4CGGA 1TAQA 4RW9A 3ZT1A 1JLEA 1WAJA 4ID5A 1KFDA 2BANA 5DMRA 3TWHA 2Z1GA 1S9EA 3LDSA 1JLBA 3O4QA 3TAFA 3S3NA 3E01A 4CHPA 4Z4CA 4NCBA 3MECA 1XI1A 4F3OA 4FZXC 4FZZA 1VSIA 3CQ8A 2P5OA 5SZTA 1L5UA 4CF9A 2BGGA 3HPHA 3SV3A 4KB0A 1TK8A 1RBRA 3VQ8A 4KTQA 3NFAA 3ZT2A 1VSJA 2KTQA 1RCHA 3HM9A 4RW7A 4DF4A 4FM0A 3AVJA 4OLAA 2BE2A 1D8YA 4I2QA 3OJUA 2G8IA 2KFNA 4Y1CA 3IRXA 1NOZA 3DMJA 4FJ7A 4BE2A 3TAPA 3NF7A 2YKMA 4KHWA 3EYZA 1NK5A 4B9MA 3HP9A 3AO2A 3K5LA 1RTIA 3OYGA 4E7KA 2PYLA 3NF6A 3OVNA 4FLXA 4CJEA 1U49A 4FZYA 4KHQA 2IS3A 4AILC 1X9MA 3PUFA 1L3VA 4BWJA 4K8ZA 2YNGA 3O3FA 3AVBA 4FJMA 4CFDA 2YKNA 4JRPA 1BCOA 2PZSA 3DLHA 1RT4A 3F73A 4CGJA 1NK4A 3NH2A 2KFZA 4DLEA 1VSDA 3L3UA 3MXIA 4M41A 1Q9XA 3AVFA 2OZMA 4ELUA 4IBNA 4XIUA 4N76A 4E89A 4F3TA 1RDBA 2AJQA 3HVRA 1U04A 1QSLA 3AA3A 4FM2A 3IAYA 2YNFA 3RMAA 4OKEA 4CEFA 3O4NA 3OYBA 3ZT4A 3SJJA 3AVMA 2RF2A 4HUFA 4EP4A 1BI4B 4CGIA 4FM1A 4DQPA 3OYHA 4J2AA 4KFBA 2QK9A 4C8NA 3ZT3A 4B9UA 2IC3A 5CZ2A 5HLFA 3EY1A 1FKPA 4FJLA 5DK5A 5CZ1A 2HNDA 3HK2A 4JS4A 3KKRA 3QEPA 4DS4A 1LAWA 1HJRA 1S1XA 4LH5A 3ZT0A 4DU4A 3CFOA 1A5VA 5KGXA 3KTQA 1ZYQA 3RR8A 3L2RA 2OPRA 4FK4A 1YVUA 4FJHA 1C1BA 1S1UA 1RBUA 4DSFA 2X74A 1C0TA 4E1NA 3SNNA 4CJQA 1RDCA 2KZZA 1JLFA 4FJJA 1XHXA 4NCGA 1XC9A 2ZQBA 3AV9A 4FJ8A 1HPZA 4BDYA 1A5WA 1KTQA 3SUOA 3MEDA 2XY8A 4CGDA 1TGOA 4DQSA 5E41A 1BIZA 1ZBIA 3QEXA 1HNVA 3HVTA 4HTUA 2PY5A 4CF2A 3DYAA 1Y97A 2F8SA 2HVIA 1A5XA 1T8EA 2VG6A 4OGCA 5J2NA 1Q9YA 4KO0A 4B8CA 1F21A 2I5JA 2JGUA 1U48A 4DFPA 4OJRA 4CEZA 4OGEA 4ELTA 3PX0A 4CHNA 4Q0BA 1CXUA 1FXXA 4KV8A 5FRMA 3NAEA 3QERA 2XY7A 4FK2A 1KCFA 4E7LA 1VSEA 4DLGA 4DWIA 2YNHA 2YHAA 2DFFA 1XWLA 1DTTA 5CYQA 1D9FA 3LWMA 4FJGA 3AO1A 3QINA 5T7BA 3RWUA 2Z1IA 3DLEA 3P5JA 1SL1A 1D9DA 1LW0A 1MU2A 1B9DA 1JLCA 3QESA 4KRFA 3ZSZA 4FVMA 1EETA 3ZSQA 1LV5A 3V1QA 2P5GA 3MXJA 3K59A 1L3SA 1ASVA 1RTJA 4KTZA 3OY9A 1KRPA 2KW4A 4FYDA 1ITGA 4YFUA 1GOAA 3DRPA 3VQBA 3A2FA 1S1VA 2LSNA 1FK9A 4DTXA 4O55A 4W5QA 3ALYA 4FLYA 1RT1A 1RTDA 1VRUA 3KLFA 1NK7A 1QE1A 2P51A 1TL1A 3SUPA 4HHTA 4LY7A 4F2SA 4HUEA 4CESA 2A1RA 4DQQA 3OYKA 4RW4A 3JSMA 2G8WA 2DTUA 2W42A 1BQNA 3KK1A 4PWDA 1I39A 3TAGA 3LALA 2EX3A 2Z1HA 3VQQA 1NK0A 1HNIA 4KB1A 4W5NA 3VN5A 4O0JA 3D0PA 1IKVA 1G15A 4FLZA 3VQ6A 4I9QA 4AHRA 3SV4A 3DRSA 3KLIA 1JXBA 2R7YA 2HHQA 3KIOA 1ASWA 4O5BA 3CFPA 4K8XA 4ICLA 1DLOA 5KTQA 3B6PA 5FDLA 1WSEA 1W9HA 2YNIA 1ZBFA 1IO2A 4AH9A 4ZHRA 3C6UA 3AVAA 1Z25A 3C6TA 4CIFA 3QETA 4QAGA 1NJWA 3NE6A 4DFJA 3WNEA 4MFBA 1NK9A 2O4GA 5HBMA 3V81A 1SL0A 1U47A 2QKKA 4DSKA 1NJYA 1UA0A 1S6QA 3OYLA 1ZBHA 4CEDA 4BE1A 3RTVA 4DSLA 3V1RA 4CF8A 3CYMA 2OYQA 2FC0A 2OZSA 3G10A 3RRHA 2X6NA 1KVAA 3HPGA 3DLRA 3TAMA 3TANA 1HYZA 2VG5A 3OYDA 4CJWA 1CZ9A 4B9NA 1C0MA 3V9WA 1LW2A 4LD0A 4OVLA 3T3FA 1HQUA 1IKXA 1LAVA 2RKIA 3EZ5A 1EP4A 3NH1A 4CEOA 1YT3A 5KRTA 2XO7A 4B8AB 4FLUA 1QSSA 1ASUA 1BQMA 4NYFA 4M3RA 1HRHA 1NKBA 2HHSA 1WNSA 3I8DA 3LWLA 3SCXA 2FBTA 1KLMA 4CHZA 4W5RA 2D0AA 3V9UA 3LP2A 1TKTA 2EHGA 2IGIA 4E7HA 3K5NA 4DG1A 2RN2A 4FW2A 4N56A 2ZD1A 4Z4EA 3KK3A 1VSKA 2VWKA 3WNFA 4DFKA 4J2EA 1BGXT 2IDOA 3V4IA 3T1AA 4Z4IA 1RT3A 2G8FA 4DTNA 1SL2A 3L8BA 2YV0X 1N6QA 4FCYA 1BISA 4Z4HA 4CFBA 3NCIA 5K14A 5CY4A 3DOLA 3NH0A 4C8LA 4CFAA 1JL1A 3CFRA 2WONA 3RMBA 1U4BA 2D0CA 4AHTA 4QOZB 3VQAA 3JYTA 2G8HA 3TR8A 4WE1A 2A1SA 3QEVA 4JS5A 3DLKA 1QS4A 3SPYA 3IS9A 3AVIA 1NJZA 5J1EA 1BHLA 4CJPA 4IDKA 3BGRA 5JS2A 1HQEA 4UQGA 4W5OA 2HMIA 3PY8A 4W5TA 4IKFA 4J2BA 4KAZA 1GOBA 1TKXA 3KLGA 3HPOA 5KI6A 3V9ZA 4I7FA 3UIQA 4DTJA 3VQCA 4IG3A 4O4GA 1TL3A 1GOCA 3DRRA 3LZIA 1JLGA 4KHYA 4DU1A 5I3UA 3THVA 3DM2A 3D45A 4YNQA 1VSHA 3LP3A 4GVMA 1JLAA 1UOCA 1SV5A 1UWBA 4DFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKD A;  3V1O A;  3V9X A;  1TK5 A;  2Z1J A;  2B6A A;  2OPP A;  1CXQ A;  4IFV A;  1LWF A;  4OKK A;  1NK8 A;  1C1A A;  4FLV A;  4MQ3 A;  2VWJ A;  3G0Z A;  4JLH A;  4LSN A;  1S1T A;  3K57 A;  3PO5 A;  3RRG A;  3QLH A;  4H8K A;  2XHB A;  3V9S A;  4TSX A;  4CJS A;  4O0I A;  2VG7 A;  3LAK A;  3WNG A;  3SQ4 A;  3L2V A;  3T19 A;  5HRR A;  2QKB A;  4B08 A;  1RBS A;  3K5O A;  3KLE A;  1IH7 A;  5J2P A;  1WSH A;  2RPI A;  4CK1 A;  2IOC A;  4CER A;  1ZBL A;  1SKS A;  1NJX A;  2DY4 A;  2B4J A;  4EZ6 A;  3AVG A;  3LP1 A;  3ULD A;  1XHZ A;  2HHX A;  3S3M A;  1WAF A;  2QXF A;  1FKO A;  3LPU A;  4NYN A;  4CFC A;  4M42 A;  4ZTF A;  4ELV A;  3HT3 A;  3ASM A;  1HYS A;  3TAE A;  4FXD A;  2E4L A;  5FRN A;  2ITG A;  3P1G A;  1RBV A;  2DFE A;  4CK3 A;  4R5P A;  1VK0 A;  3PO4 A;  4BWM A;  3SQ0 A;  3TAQ A;  4CGH A;  5C42 A;  4M3U A;  4Z4G A;  1UAX A;  5JS1 A;  3MEG A;  3ZSX A;  1X9S A;  2YHB A;  4IG0 A;  1JXE A;  1KVB A;  4DSJ A;  1D5A A;  4DTM A;  4PQU A;  4EP5 A;  4E19 A;  2D0B A;  2F96 A;  3ISN C;  3QIP A;  3DI6 A;  1JKH A;  4PY5 A;  4CJR A;  3DLG A;  2HW3 A;  1S5J A;  2ATQ A;  3OYF A;  1EXQ A;  4RW6 A;  4CJU A;  2FBV A;  4Z4F A;  2KZM A;  1QQC A;  3M8R A;  3OYC A;  4KHS A;  1KVC A;  1S9G A;  1WSI A;  3I0S A;  4C8M A;  1RT7 A;  4DSE A;  4EZ9 A;  3C94 A;  3AO4 A;  3SYZ A;  4QCL A;  4NCA A;  5EU7 A;  4CJ3 A;  1RDA A;  4I2P A;  4Y1D A;  4CIE A;  4BDZ A;  4HVJ A;  4FK0 A;  3ITH A;  4M3T A;  2E6M A;  3OS2 A;  1VSM A;  1O1W A;  2X6S A;  1WSG A;  1VRT A;  3M8S A;  4CF1 A;  4AHS A;  4CJ4 A;  4CJF A;  2BDP A;  3KD1 E;  3AA5 X;  5CYM A;  4M3W A;  1JL2 A;  4N5S A;  1VSF A;  3NF8 A;  1TK0 A;  1QSY A;  1BI4 A;  4ID1 A;  1YTU A;  4B9S A;  4CHY A;  4GMJ B;  4FJK A;  3AO3 A;  3NGI A;  3U3Y A;  5HP1 A;  4DTR A;  4FJ5 A;  4CJ5 A;  2IAJ A;  5J2M A;  3HXM A;  5C25 A;  3HST B;  4RG8 A;  4HUG A;  3LP0 A;  3U6F A;  1JLQ A;  3S3O A;  2OPQ A;  4F8R A;  4CEB A;  2XRI A;  4PA1 A;  3TAB A;  2D5R A;  4CK2 A;  4KI6 A;  2HHU A;  1RNH A;  5HRP A;  4B9V A;  3AVK A;  3SZ2 A;  4B9L A;  1X9W A;  1SKW A;  4BE0 A;  3AA2 A;  3PX6 A;  2P1J A;  3SI6 A;  4BDP A;  4B3O A;  1UA1 A;  1TKZ A;  1RTH A;  1C0U A;  1RT2 A;  2GUI A;  3C95 A;  3DOK A;  3LAM A;  3O3G A;  1KFS A;  2PYJ A;  3M8P A;  4CEQ A;  3ZCM A;  4JRQ A;  2ZE2 A;  1J53 A;  1X1P A;  3OYA A;  4FLT A;  4FJN A;  2NUB A;  4AHC A;  3SUN A;  4OPJ A;  4OPK A;  3AVH A;  1L3T A;  2OA8 A;  3SPZ A;  4HCC A;  3QNO A;  4OLB A;  3HJF A;  3M8Q A;  3WNH A;  2HHT A;  3OS0 A;  3KJV A;  4B9T A;  1S6P A;  3IG1 A;  4DQR A;  1W0H A;  3HL8 A;  4CJL A;  3B6O A;  1SUQ A;  1IKW A;  1YTA A;  4IFY A;  5KGW A;  1I3A A;  5C24 A;  3VQ5 A;  5I42 A;  3AO5 A;  1NOY A;  3HO1 A;  2DFH A;  3PX4 A;  3DLB A;  2Q3S A;  1LWE A;  1Q8I A;  2KQ2 A;  4N47 A;  3OYI A;  4M3X A;  3V6D A;  4BAC A;  3CM5 A;  3MXM A;  2G8K A;  1N5Y A;  1WSF A;  3NBP A;  1T05 A;  4F2R A;  4CHQ A;  4AHU A;  3OYJ A;  3PV8 A;  1R0A A;  4FJI A;  4G1Q A;  1NKC A;  3VQP A;  1T03 A;  1RBT A;  4ZTJ A;  3QEW A;  1NK6 A;  3K2P A;  1S1W A;  3KLH A;  4L8R B;  3CG7 A;  4CJV A;  3KK2 A;  1C1C A;  2XY6 A;  5HRS A;  2G8U A;  3KKS A;  4LSL A;  1LWC A;  3QIO A;  5D3G A;  4DTP A;  4DMN A;  1KLN A;  3ZSY A;  3LAN A;  2F8T A;  1J54 A;  3SQ2 A;  4CF0 A;  4AHV A;  3HP6 A;  1QTM A;  1T7P A;  4HCB A;  1K6Y A;  3AA4 A;  2Y1J A;  3QEI A;  1REV A;  3VQ4 A;  4OKJ A;  3MEE A;  3NGY A;  1HMV A;  2OPS A;  5FRO A;  3L2Q A;  4CJK A;  4FLW A;  1WLJ A;  4Z0U A;  3KD5 E;  1J5O A;  3OYN A;  4FW1 A;  3VA0 A;  1C6V A;  1DTQ A;  3S9H A;  4KHU A;  2HVH A;  3BDP A;  1TAU A;  2FBX A;  4I9L A;  4M3Z A;  1RT5 A;  2JLE A;  4DTO A;  1B92 A;  3VQ7 A;  3SQ1 A;  4N41 A;  3RMD A;  1QHT A;  5J2Q A;  2HNY A;  3VQE A;  4CEE A;  1HYV A;  4CGF A;  4CJT A;  1RT6 A;  5HRO A;  4PUO A;  2O4I A;  1KSP A;  3U3G A;  3FFI A;  4RW8 A;  4H4M A;  2FBY A;  2Y1I A;  3AVN A;  4CEA A;  5KRS A;  1U45 A;  4LH4 A;  2HHV A;  4DSI A;  3HYF A;  3ZSR A;  3L2W A;  1IG9 A;  2HNZ A;  3AVL A;  4C8O A;  4M3Y A;  3RR7 A;  3K58 A;  3CM6 A;  3LZJ A;  2GBZ A;  3ZSO A;  4DF8 A;  4KRE A;  2WOM A;  4H4O A;  1RDD A;  2ETJ A;  5HRN A;  3K5M A;  3VA3 A;  3F9K A;  2XY5 A;  1BCM A;  3VQD A;  1VSL A;  3OS1 A;  3OYM A;  4DQI A;  3I0R A;  1RIL A;  3NF9 A;  4KHN A;  1EX4 A;  3TI0 A;  4DU3 A;  1CZB A;  1ZBU A;  4KTW A;  1BIU A;  3H08 A;  3SUQ A;  4CCH A;  3O3H A;  1TVR A;  3L2U A;  4CEC A;  1CLQ A;  3ZSV A;  1B9F A;  4M45 A;  4E1M A;  3QNN A;  2B5J A;  1L3U A;  4E0D A;  4F4K A;  4FJ9 A;  4J2D A;  3NGZ A;  4DS5 A;  4O44 A;  3OYE A;  1EKE A;  1Z26 A;  3AVC A;  5SWM A;  3NHG A;  4KKO A;  1IKY A;  3MAQ A;  4KI4 A;  2X78 A;  4CE9 A;  1WSJ A;  3LPT A;  4FJX A;  3P83 D;  1WN7 A;  4DTS A;  2HHW A;  4E3S A;  4GW6 A;  3QO9 A;  1SKR A;  4DTU A;  2G8V A;  3OJS A;  4Q5V A;  4KPY A;  2E6L A;  4CIG A;  4CHO A;  2GV9 A;  4E7J A;  4E7I A;  3TAR A;  1NKE A;  3VQ9 A;  4C8K A;  1TV6 A;  3NDK A;  3ZSW A;  3L3V A;  2HB5 A;  1J9A A;  3RMC A;  1BL3 A;  4CGG A;  1TAQ A;  4RW9 A;  3ZT1 A;  1JLE A;  1WAJ A;  4ID5 A;  1KFD A;  2BAN A;  5DMR A;  3TWH A;  2Z1G A;  1S9E A;  3LDS A;  1JLB A;  3O4Q A;  3TAF A;  3S3N A;  3E01 A;  4CHP A;  4Z4C A;  4NCB A;  3MEC A;  1XI1 A;  4F3O A;  4FZX C;  4FZZ A;  1VSI A;  3CQ8 A;  2P5O A;  5SZT A;  1L5U A;  4CF9 A;  2BGG A;  3HPH A;  3SV3 A;  4KB0 A;  1TK8 A;  1RBR A;  3VQ8 A;  4KTQ A;  3NFA A;  3ZT2 A;  1VSJ A;  2KTQ A;  1RCH A;  3HM9 A;  4RW7 A;  4DF4 A;  4FM0 A;  3AVJ A;  4OLA A;  2BE2 A;  1D8Y A;  4I2Q A;  3OJU A;  2G8I A;  2KFN A;  4Y1C A;  3IRX A;  1NOZ A;  3DMJ A;  4FJ7 A;  4BE2 A;  3TAP A;  3NF7 A;  2YKM A;  4KHW A;  3EYZ A;  1NK5 A;  4B9M A;  3HP9 A;  3AO2 A;  3K5L A;  1RTI A;  3OYG A;  4E7K A;  2PYL A;  3NF6 A;  3OVN A;  4FLX A;  4CJE A;  1U49 A;  4FZY A;  4KHQ A;  2IS3 A;  4AIL C;  1X9M A;  3PUF A;  1L3V A;  4BWJ A;  4K8Z A;  2YNG A;  3O3F A;  3AVB A;  4FJM A;  4CFD A;  2YKN A;  4JRP A;  1BCO A;  2PZS A;  3DLH A;  1RT4 A;  3F73 A;  4CGJ A;  1NK4 A;  3NH2 A;  2KFZ A;  4DLE A;  1VSD A;  3L3U A;  3MXI A;  4M41 A;  1Q9X A;  3AVF A;  2OZM A;  4ELU A;  4IBN A;  4XIU A;  4N76 A;  4E89 A;  4F3T A;  1RDB A;  2AJQ A;  3HVR A;  1U04 A;  1QSL A;  3AA3 A;  4FM2 A;  3IAY A;  2YNF A;  3RMA A;  4OKE A;  4CEF A;  3O4N A;  3OYB A;  3ZT4 A;  3SJJ A;  3AVM A;  2RF2 A;  4HUF A;  4EP4 A;  1BI4 B;  4CGI A;  4FM1 A;  4DQP A;  3OYH A;  4J2A A;  4KFB A;  2QK9 A;  4C8N A;  3ZT3 A;  4B9U A;  2IC3 A;  5CZ2 A;  5HLF A;  3EY1 A;  1FKP A;  4FJL A;  5DK5 A;  5CZ1 A;  2HND A;  3HK2 A;  4JS4 A;  3KKR A;  3QEP A;  4DS4 A;  1LAW A;  1HJR A;  1S1X A;  4LH5 A;  3ZT0 A;  4DU4 A;  3CFO A;  1A5V A;  5KGX A;  3KTQ A;  1ZYQ A;  3RR8 A;  3L2R A;  2OPR A;  4FK4 A;  1YVU A;  4FJH A;  1C1B A;  1S1U A;  1RBU A;  4DSF A;  2X74 A;  1C0T A;  4E1N A;  3SNN A;  4CJQ A;  1RDC A;  2KZZ A;  1JLF A;  4FJJ A;  1XHX A;  4NCG A;  1XC9 A;  2ZQB A;  3AV9 A;  4FJ8 A;  1HPZ A;  4BDY A;  1A5W A;  1KTQ A;  3SUO A;  3MED A;  2XY8 A;  4CGD A;  1TGO A;  4DQS A;  5E41 A;  1BIZ A;  1ZBI A;  3QEX A;  1HNV A;  3HVT A;  4HTU A;  2PY5 A;  4CF2 A;  3DYA A;  1Y97 A;  2F8S A;  2HVI A;  1A5X A;  1T8E A;  2VG6 A;  4OGC A;  5J2N A;  1Q9Y A;  4KO0 A;  4B8C A;  1F21 A;  2I5J A;  2JGU A;  1U48 A;  4DFP A;  4OJR A;  4CEZ A;  4OGE A;  4ELT A;  3PX0 A;  4CHN A;  4Q0B A;  1CXU A;  1FXX A;  4KV8 A;  5FRM A;  3NAE A;  3QER A;  2XY7 A;  4FK2 A;  1KCF A;  4E7L A;  1VSE A;  4DLG A;  4DWI A;  2YNH A;  2YHA A;  2DFF A;  1XWL A;  1DTT A;  5CYQ A;  1D9F A;  3LWM A;  4FJG A;  3AO1 A;  3QIN A;  5T7B A;  3RWU A;  2Z1I A;  3DLE A;  3P5J A;  1SL1 A;  1D9D A;  1LW0 A;  1MU2 A;  1B9D A;  1JLC A;  3QES A;  4KRF A;  3ZSZ A;  4FVM A;  1EET A;  3ZSQ A;  1LV5 A;  3V1Q A;  2P5G A;  3MXJ A;  3K59 A;  1L3S A;  1ASV A;  1RTJ A;  4KTZ A;  3OY9 A;  1KRP A;  2KW4 A;  4FYD A;  1ITG A;  4YFU A;  1GOA A;  3DRP A;  3VQB A;  3A2F A;  1S1V A;  2LSN A;  1FK9 A;  4DTX A;  4O55 A;  4W5Q A;  3ALY A;  4FLY A;  1RT1 A;  1RTD A;  1VRU A;  3KLF A;  1NK7 A;  1QE1 A;  2P51 A;  1TL1 A;  3SUP A;  4HHT A;  4LY7 A;  4F2S A;  4HUE A;  4CES A;  2A1R A;  4DQQ A;  3OYK A;  4RW4 A;  3JSM A;  2G8W A;  2DTU A;  2W42 A;  1BQN A;  3KK1 A;  4PWD A;  1I39 A;  3TAG A;  3LAL A;  2EX3 A;  2Z1H A;  3VQQ A;  1NK0 A;  1HNI A;  4KB1 A;  4W5N A;  3VN5 A;  4O0J A;  3D0P A;  1IKV A;  1G15 A;  4FLZ A;  3VQ6 A;  4I9Q A;  4AHR A;  3SV4 A;  3DRS A;  3KLI A;  1JXB A;  2R7Y A;  2HHQ A;  3KIO A;  1ASW A;  4O5B A;  3CFP A;  4K8X A;  4ICL A;  1DLO A;  5KTQ A;  3B6P A;  5FDL A;  1WSE A;  1W9H A;  2YNI A;  1ZBF A;  1IO2 A;  4AH9 A;  4ZHR A;  3C6U A;  3AVA A;  1Z25 A;  3C6T A;  4CIF A;  3QET A;  4QAG A;  1NJW A;  3NE6 A;  4DFJ A;  3WNE A;  4MFB A;  1NK9 A;  2O4G A;  5HBM A;  3V81 A;  1SL0 A;  1U47 A;  2QKK A;  4DSK A;  1NJY A;  1UA0 A;  1S6Q A;  3OYL A;  1ZBH A;  4CED A;  4BE1 A;  3RTV A;  4DSL A;  3V1R A;  4CF8 A;  3CYM A;  2OYQ A;  2FC0 A;  2OZS A;  3G10 A;  3RRH A;  2X6N A;  1KVA A;  3HPG A;  3DLR A;  3TAM A;  3TAN A;  1HYZ A;  2VG5 A;  3OYD A;  4CJW A;  1CZ9 A;  4B9N A;  1C0M A;  3V9W A;  1LW2 A;  4LD0 A;  4OVL A;  3T3F A;  1HQU A;  1IKX A;  1LAV A;  2RKI A;  3EZ5 A;  1EP4 A;  3NH1 A;  4CEO A;  1YT3 A;  5KRT A;  2XO7 A;  4B8A B;  4FLU A;  1QSS A;  1ASU A;  1BQM A;  4NYF A;  4M3R A;  1HRH A;  1NKB A;  2HHS A;  1WNS A;  3I8D A;  3LWL A;  3SCX A;  2FBT A;  1KLM A;  4CHZ A;  4W5R A;  2D0A A;  3V9U A;  3LP2 A;  1TKT A;  2EHG A;  2IGI A;  4E7H A;  3K5N A;  4DG1 A;  2RN2 A;  4FW2 A;  4N56 A;  2ZD1 A;  4Z4E A;  3KK3 A;  1VSK A;  2VWK A;  3WNF A;  4DFK A;  4J2E A;  1BGX T;  2IDO A;  3V4I A;  3T1A A;  4Z4I A;  1RT3 A;  2G8F A;  4DTN A;  1SL2 A;  3L8B A;  2YV0 X;  1N6Q A;  4FCY A;  1BIS A;  4Z4H A;  4CFB A;  3NCI A;  5K14 A;  5CY4 A;  3DOL A;  3NH0 A;  4C8L A;  4CFA A;  1JL1 A;  3CFR A;  2WON A;  3RMB A;  1U4B A;  2D0C A;  4AHT A;  4QOZ B;  3VQA A;  3JYT A;  2G8H A;  3TR8 A;  4WE1 A;  2A1S A;  3QEV A;  4JS5 A;  3DLK A;  1QS4 A;  3SPY A;  3IS9 A;  3AVI A;  1NJZ A;  5J1E A;  1BHL A;  4CJP A;  4IDK A;  3BGR A;  5JS2 A;  1HQE A;  4UQG A;  4W5O A;  2HMI A;  3PY8 A;  4W5T A;  4IKF A;  4J2B A;  4KAZ A;  1GOB A;  1TKX A;  3KLG A;  3HPO A;  5KI6 A;  3V9Z A;  4I7F A;  3UIQ A;  4DTJ A;  3VQC A;  4IG3 A;  4O4G A;  1TL3 A;  1GOC A;  3DRR A;  3LZI A;  1JLG A;  4KHY A;  4DU1 A;  5I3U A;  3THV A;  3DM2 A;  3D45 A;  4YNQ A;  1VSH A;  3LP3 A;  4GVM A;  1JLA A;  1UOC A;  1SV5 A;  1UWB A;  4DFM A; 
#chains in the Genus database with same CATH topology
 3V1O A;  5A2Q O;  1TK5 A;  3F9M A;  2OPP A;  3S41 A;  5GIN A;  1NK8 A;  2FSJ A;  2VWJ A;  1W7A A;  3LAK A;  4GKJ K;  3T19 A;  3LDP A;  1GLD G;  2VQE K;  4CK1 A;  2A5X A;  4XH5 A;  3ULD A;  2HHX A;  1XHZ A;  1HX1 A;  1WAF A;  2QXF A;  4NYN A;  3FR0 A;  3ASM A;  1VQ4 N;  3JXU A;  4FXD A;  2O8F B;  2ITG A;  4CK3 A;  3R9P A;  3G6E N;  4M3U A;  4Z4G A;  1UAX A;  5JS1 A;  3OW2 M;  3MEG A;  3ZYY X;  4DV2 K;  2E2O A;  4DSJ A;  3K9J A;  2D0B A;  4PY5 A;  3M3Z A;  3DLG A;  3O6W A;  2HW3 A;  4Z4F A;  1EXQ A;  2CGJ A;  4CJU A;  3M8R A;  4KHS A;  1KVC A;  3I0S A;  4BG9 A;  5JLH A;  1BUP A;  3U8X A;  4BRM A;  1BU6 O;  4C8M A;  4BC4 A;  3MN7 A;  3UKU B;  4BDZ A;  1XUP O;  2Q97 A;  2CGK A;  3T7Z A;  4FK0 A;  1VSM A;  1O1W A;  1WSG A;  1VRT A;  3M8S A;  4AHS A;  4CJF A;  5M1K A;  4M3W A;  1JL2 A;  4N5S A;  1VSF A;  4B9S A;  4CHY A;  4GMJ B;  1WB9 A;  4FJ5 A;  5HP1 A;  3A0I X;  3TTC A;  4RCH A;  1YIJ N;  3U6F A;  1MWK A;  4WQ5 A;  2QXL A;  4F8R A;  1HNX K;  5DM6 L;  4KI6 A;  4B9V A;  3QIC A;  3A5L C;  1E3M A;  3MCA B;  4ISG A;  2P1J A;  5LJV A;  3HI0 A;  1UA1 A;  1TKZ A;  1C0U A;  3UKR B;  3M8P A;  1YXQ A;  4B1Y B;  1NLV A;  4FJN A;  1YHQ N;  4KH6 A;  2P9I A;  4AHC A;  1VQ6 N;  2OA8 A;  3H45 C;  4OLB A;  3M8Q A;  3OS0 A;  2QW9 A;  3VGL A;  4CJL A;  3B6O A;  4X64 K;  2D0P A;  1LWE A;  2Q3S A;  1Q7Y O;  3EEQ A;  3OYI A;  3H6E A;  3V6D A;  4PL8 A;  4A2A A;  3CM5 A;  3MXM A;  4WQ4 A;  4CHQ A;  2UUB K;  2BTF A;  1BWF O;  4G1Q A;  1KAY A;  3QML A;  5HRS A;  3MDQ A;  3THX B;  1LWC A;  3CET A;  1KLN A;  3VEZ A;  3DXK A;  5AQU A;  3ZSY A;  3TSU A;  3LAN A;  1J54 A;  2W40 A;  3VGK A;  2I7N A;  2Y1J A;  3D2E B;  2O8D A;  4DV5 K;  2VGN A;  3MEE A;  2QWR A;  3OHR A;  3L2Q A;  5KQ8 A;  3PIP L;  3GDQ A;  4DTO A;  4KH4 A;  3T1H K;  4IEE A;  3RMD A;  1NBW A;  5J2Q A;  3VQE A;  4CEE A;  1HYV A;  1R59 O;  4CGF A;  5AR0 A;  5C2F A;  1N36 K;  2O8C A;  1Q18 A;  5C0Y A;  3AVN A;  4CEA A;  5KRS A;  4LH4 A;  3ZSR A;  3L2W A;  1IG9 A;  4M3Y A;  3RR7 A;  3ZET B;  3CM6 A;  4IJA A;  4DF8 A;  5HRN A;  1BCM A;  3OYM A;  1VSL A;  3OS1 A;  3CIP A;  4CCH A;  1BIU A;  4YOR A;  4BG8 A;  1QQN A;  3ZSV A;  1K8A O;  4E0D A;  4F4K A;  4WFA L;  2D1K A;  4DS5 A;  4IO9 L;  1U6Z A;  3NHG A;  5DM7 L;  4CE9 A;  1HKC A;  1WSJ A;  3LPT A;  4DTS A;  4E3S A;  1HKB A;  2H3G X;  2G8V A;  1KXP A;  4Q5V A;  4KPY A;  2E6L A;  1NMD A;  2PAV A;  3IUC A;  4CHO A;  3VER A;  4B1X B;  2IVO A;  1BL3 A;  4CGG A;  1TAQ A;  1N34 K;  1T6D A;  5DMR A;  2BAN A;  3TWH A;  5KQD A;  1JLB A;  3TAF A;  3S3N A;  4Z4C A;  1YIT N;  4FZX C;  1VSI A;  4CF9 A;  3DXM B;  3L4Q A;  4LFB K;  2KKZ A;  1RBR A;  2QWQ A;  4KTQ A;  5AQV A;  5KPT A;  3NFA A;  3CQX A;  1RCH A;  3CCV N;  4RW7 A;  1ESV A;  4OLA A;  3KHY A;  4I2Q A;  3OJU A;  4CBU A;  2O8B A;  1IBK K;  1NOZ A;  4L3Q A;  2UUA K;  2O8E B;  2WBN A;  5C12 A;  2UUC K;  4H03 B;  3NF6 A;  3OVN A;  4FLX A;  4KHQ A;  1CZA N;  3PUF A;  4K42 A;  1L3V A;  4K8Z A;  3HOT A;  3O3F A;  3AVB A;  4CFD A;  2PZS A;  1QQM A;  2YI1 A;  5GIP A;  4JI8 K;  3R3L A;  1DEJ A;  4NO7 A;  3HVR A;  3O80 A;  3AA3 A;  3DXK B;  4FM2 A;  1ZC6 A;  3IAY A;  2YNF A;  5AQN A;  3OYB A;  2RF2 A;  4EP4 A;  1BI4 B;  4FM1 A;  2VGM A;  4BR2 A;  3ZT3 A;  3E66 A;  5CZ2 A;  3FZM A;  3QFP A;  4PKG A;  4JKB A;  2YHX A;  4JKA A;  1HJR A;  4LH5 A;  3I33 A;  1A5V A;  5KGX A;  3KTQ A;  1ZYQ A;  3THW B;  1MA9 B;  1YVU A;  1C1B A;  4DSF A;  2X74 A;  4KBO A;  3SNN A;  2UU9 K;  2KZZ A;  4IOA L;  1HPZ A;  1KTQ A;  4A62 A;  3WXL A;  3SUO A;  2XY8 A;  4CBX A;  5IWA K;  4GV6 A;  1BIZ A;  1ZBI A;  2A42 A;  3M5R A;  1HNV A;  3JAM O;  3UKR A;  2QM1 A;  4FOE A;  4CF2 A;  1Y97 A;  1T8E A;  2VCP A;  1F21 A;  2I5J A;  4DFP A;  1YF5 L;  3ZET A;  3PX0 A;  4Q0B A;  4KV8 A;  1FXX A;  3CCM N;  1QVG M;  4FK2 A;  2YNH A;  3K9K A;  5CYQ A;  3AO1 A;  4MLH A;  3FZH A;  5T7B A;  2YJE A;  3P5J A;  3HM8 A;  1B9D A;  4KRF A;  4FVM A;  3K59 A;  1ASV A;  1RTJ A;  3P31 A;  4PL7 A;  4JI2 K;  3WEE B;  3DRP A;  3FE1 A;  1FK9 A;  4DTX A;  4O55 A;  4FLY A;  1GLE G;  1RT1 A;  2E2N A;  5M1F A;  1TL1 A;  5F1X A;  3MK6 A;  2G8W A;  3EO3 A;  2W42 A;  1NNE A;  3TAG A;  3LAL A;  4IO8 A;  2HBK A;  2Z1H A;  3VQQ A;  1NK0 A;  3VN5 A;  4O0J A;  4FLZ A;  1VQN N;  1GLJ O;  3SV4 A;  2R7Y A;  3L6Q A;  4K8X A;  1DLO A;  5CE3 A;  2O8F A;  2NRW A;  3AVA A;  4CIF A;  3O9S A;  4QAG A;  3NE6 A;  1NGA A;  4DFJ A;  2QWM A;  2O4G A;  4DSK A;  4I6M B;  1NJY A;  1UA0 A;  3FZK A;  1DT9 A;  2FC0 A;  3RRH A;  3TAM A;  3C0B A;  1LCU A;  3V9W A;  1LW2 A;  4WFN L;  2ASO A;  1VQ7 N;  1IKX A;  2RKI A;  5AZI B;  4H5N A;  3NH1 A;  4CEO A;  2XO7 A;  1QSS A;  1HRH A;  1KLM A;  4W5R A;  2O8C B;  3DJC A;  4DG1 A;  4J2E A;  1HKG A;  1T3V A;  2IDO A;  2HBJ A;  3T1A A;  4Z4I A;  3VEX A;  4DTN A;  1VQ5 N;  1SL2 A;  1OH8 A;  3CJC A;  1HR0 K;  1M1K O;  5CY4 A;  3DOL A;  3NH0 A;  2A3Z A;  4WE1 A;  5GIO A;  4JS5 A;  1QS4 A;  1C0G A;  3THX A;  4CJP A;  1Q82 O;  5JS2 A;  3BGR A;  4IKF A;  3HO1 A;  3PY8 A;  5BRD A;  1V4T A;  5KI6 A;  4I7F A;  4ISE A;  3VQC A;  3VOV A;  4IG3 A;  3A5M C;  3LZI A;  1XNQ K;  4DU1 A;  1SZ2 A;  1VSH A;  2W6K A;  4GVM A;  3N4P A;  3ENH A;  3BZK A;  1TKD A;  4FSV A;  3V9X A;  1U2V A;  3CD6 N;  1C1A A;  4O5F A;  4FLV A;  1RGI A;  4BR4 A;  4O0I A;  2VG7 A;  1GLB G;  3W3D A;  3SQ4 A;  3K5O A;  3WEE A;  4FOI A;  1SKS A;  4CER A;  2DY4 A;  2B4J A;  3SAG A;  4EZ6 A;  4HTL A;  1FKO A;  3LPU A;  4X66 K;  4ZTF A;  4ELV A;  3HT3 A;  4B1W B;  2PFU A;  2E4L A;  5FRN A;  3RSE B;  3P1G A;  4WYB A;  3FLC O;  1G99 A;  4FO0 A;  4CGH A;  5C42 A;  2YHW A;  4A59 A;  1D5A A;  4PQU A;  4EP5 A;  3ISN C;  3I56 N;  1JKH A;  2EWS A;  3P4I A;  1ATN A;  1S5J A;  2ATQ A;  2HF3 A;  3CHW A;  4BRD A;  3QDK A;  4JKH A;  3AO4 A;  4QCL A;  4NCA A;  1HJO A;  5EU7 A;  4CJ3 A;  4CIE A;  4Y1D A;  4RWT A;  4CZG A;  3OS2 A;  2X6S A;  2VWB A;  5AQW A;  1XQS C;  3VET A;  3VEV A;  3F2K A;  2BDP A;  5CYM A;  4K25 A;  3TTF A;  2HBL A;  5JIC A;  1YTU A;  1BI4 A;  4DV3 K;  3C65 A;  5CR4 A;  3AO3 A;  3NGI A;  3PSI A;  3ULE B;  2IAJ A;  4QS9 A;  2FF6 A;  4HUG A;  1RDU A;  2QEX N;  2P9U B;  1JLQ A;  4JV5 K;  4EAH D;  2E2P A;  3THY B;  4CZK A;  3GL1 A;  3CCU N;  3TAB A;  2D5R A;  2HHU A;  4ILG B;  3AVK A;  4B9L A;  1SKW A;  4BE0 A;  1NJI O;  3R1X A;  1RTH A;  1EWR A;  4H5T A;  5GAG P;  4CEQ A;  3CF5 L;  4IEI A;  2ZE2 A;  1X1P A;  4OPH A;  1O13 A;  3MX5 A;  4JN4 A;  4Y0W A;  4OPJ A;  2ZF5 O;  2A40 A;  3HJF A;  3WNH A;  3KJV A;  5EX5 A;  1S6P A;  3IG1 A;  5JMV A;  1W0H A;  1SUQ A;  5AQQ A;  1YTA A;  5KGW A;  3RVC A;  3VQ5 A;  3AO5 A;  3PX4 A;  3DLB A;  3LDO A;  1BOT O;  5AQH A;  2CGL A;  4N47 A;  3I55 N;  3J80 O;  4BAC A;  1BA0 A;  2NLX A;  3D2F B;  4BRI A;  4LC9 B;  4AHU A;  3OYJ A;  3PV8 A;  1R0A A;  2E20 A;  4FJI A;  1T03 A;  4ZTJ A;  3K2P A;  1S1W A;  3KLH A;  2XY6 A;  3KKS A;  4LSL A;  4DMN A;  3O9Q A;  4DV4 K;  3SQ2 A;  3MN6 A;  4CF0 A;  3HP6 A;  1T7P A;  2AP1 A;  3LM9 A;  2E88 A;  4OKJ A;  1HMV A;  1WLJ A;  3KD5 E;  5FPE A;  4FPB A;  2HMP A;  4LF9 K;  4CZJ A;  2OAN A;  2HNY A;  5BN8 A;  1KSP A;  3VEN A;  3FFI A;  4H4M A;  1WUA A;  1QVF M;  2Y1I A;  3HYF A;  2WFB A;  2IVP A;  3AVL A;  5ADX H;  4AF1 A;  3R8E A;  4X62 K;  3LZJ A;  3ZSO A;  4WQ4 C;  2WOM A;  4H4O A;  2ETJ A;  3K5M A;  3VA3 A;  4KHN A;  3I0R A;  5AQS A;  4KTW A;  3H08 A;  1TVR A;  3L2U A;  4CEC A;  4M45 A;  4E1M A;  4FJ9 A;  4JK8 A;  3ZEU B;  2BUP A;  3F5T A;  3OYE A;  1EKE A;  5AZI A;  5SWM A;  4KI4 A;  3EE8 A;  4FJX A;  3VPZ A;  1S72 N;  4WFB L;  5LL6 Z;  3OJS A;  2ZJR L;  4DV0 K;  2ZM6 K;  3TAR A;  3IDH A;  1M90 O;  1TV6 A;  4ISF A;  3NDK A;  4JKG B;  3L3V A;  3RMC A;  3ZT1 A;  4ID5 A;  3LDS A;  3O4Q A;  4CHP A;  4NCB A;  5BRH A;  4MDA A;  1LOT B;  3HSC A;  3CQ8 A;  3WQT A;  3M6G A;  4BC3 A;  5SZT A;  2BGG A;  3HPH A;  3MCP A;  1IBL K;  3VQ8 A;  2KTQ A;  3GBT A;  3HZ6 A;  3AVJ A;  3C7N A;  1ZXO A;  2G8I A;  4KHP K;  3IRX A;  2KFN A;  4BE2 A;  3SMS A;  1YI2 N;  2YKM A;  4DUY K;  3HP9 A;  3AO2 A;  4NLC A;  4E7K A;  5AQZ A;  3CCE N;  2IS3 A;  2IVN A;  4H0V B;  5E84 A;  1X9M A;  2P9L B;  4IZ9 A;  4DUZ K;  3OA9 A;  5F0X A;  4B3M K;  3F73 A;  3NH2 A;  4UY8 O;  1VSD A;  3MXI A;  3C6H A;  1Q9X A;  2OZM A;  4ELU A;  4N76 A;  2AA4 A;  1RDB A;  5ADX A;  1U04 A;  3EZW A;  3SJJ A;  3AVM A;  4HUF A;  2QWN A;  3TPQ A;  1OH5 A;  4J2A A;  2ZJP L;  4KFB A;  4C8N A;  4IFE A;  5H1S Q;  1FKP A;  4JS4 A;  4YOT A;  3KKR A;  3O5B A;  3GE1 A;  4DS4 A;  2UXB K;  1S1X A;  4FK4 A;  2OPR A;  4FJH A;  4BRG A;  1S1U A;  1RBU A;  5GAH P;  1ATS A;  1C0F A;  2V51 B;  5EXW A;  2A41 A;  3EKS A;  1JLF A;  1TYQ A;  4NCG A;  1XC9 A;  3AV9 A;  3MED A;  4DQS A;  2OTJ N;  3QEX A;  3QBX A;  2PY5 A;  2FSK A;  2HVI A;  2F8S A;  3DAW A;  3VES A;  1JCG A;  2FXU A;  4DV1 K;  4OGC A;  5J2N A;  1U2V B;  4KO0 A;  1U48 A;  4OJR A;  2P9K B;  4JKD A;  1MDU B;  4FWK A;  4CHN A;  1N32 K;  1K8K B;  3NAE A;  2F7T A;  2NRV A;  4DWI A;  1VSE A;  3AY9 A;  4JD2 A;  1D9F A;  3ZX3 A;  3QIN A;  4DB3 A;  3I8B A;  1SAZ A;  3WQU A;  1TYQ B;  1SL1 A;  3QES A;  3ZX0 A;  1LV5 A;  3ATV A;  4OX9 K;  3MXJ A;  4JKG A;  4KTZ A;  3OY9 A;  4FYD A;  1GOA A;  1QQO A;  1S1V A;  2P9P B;  3G25 A;  3ALY A;  1NU0 A;  1VRU A;  1NGD A;  1NK7 A;  4LY7 A;  1N8R O;  3CCQ N;  2QWP A;  2A1R A;  2JWL A;  3JSM A;  1ATR A;  1NM1 A;  2CH5 A;  4PWD A;  1I39 A;  1KQS M;  4MDB A;  3O1B A;  1RDW X;  2YJF A;  4CW7 B;  1IKV A;  3VQ6 A;  5BR8 K;  3EKU A;  3DRS A;  2HHQ A;  5BN9 A;  3CFP A;  5AQF A;  4ICL A;  5FDL A;  3CCJ N;  4XEI A;  2P9P A;  1IO2 A;  4AH9 A;  4ZHR A;  4JI6 K;  1KC8 O;  1Z25 A;  4CI6 A;  4BRC A;  3KK7 A;  4JI1 K;  4I6M A;  5HBM A;  1NK9 A;  4CD1 A;  3VMF B;  4BE1 A;  2YHY A;  3LDN A;  4A61 A;  4CF8 A;  2OYQ A;  4DQ8 A;  3DLR A;  1HYZ A;  1V4S A;  3PLA A;  1C0M A;  1E4G T;  3ZLJ A;  5M1Q A;  3T3F A;  1YT3 A;  5KRT A;  5AQX A;  4FWQ A;  4NYF A;  2QTD A;  1WNS A;  4DR6 K;  3I8D A;  3K0S A;  3LWL A;  3E1Y A;  5AQK A;  2FBT A;  3VGM A;  4B1Z A;  2NRR A;  3V9U A;  1D4X A;  2EHG A;  4DR2 K;  2IGI A;  2P9K A;  4LF7 K;  4N56 A;  1K9M O;  1VHX A;  3LL3 A;  5FPN A;  1RT3 A;  3L8B A;  1N6Q A;  2WUS A;  1HLU A;  1BIS A;  4CFB A;  3NCI A;  3CC7 N;  4CFA A;  1YJW N;  2D0C A;  3WXI A;  3AAR A;  5BPM A;  1EQY A;  3E9L A;  1VQO N;  3DLK A;  3SPY A;  1NJZ A;  2YCH A;  1VQL N;  2HMI A;  4W5T A;  5AQO A;  3HPO A;  3UIQ A;  3DRR A;  4B3T K;  5I3U A;  3DM2 A;  5TKW A;  1YJN N;  4V19 S;  1JLA A;  3RSE A;  4CZI A;  2B6A A;  1CXQ A;  3N4Q A;  3WXJ A;  4IFV A;  1LWF A;  4OKK A;  5AQI A;  4MQ3 A;  3UE5 A;  4JLH A;  4LSN A;  1S1T A;  3PO5 A;  3QLH A;  4H8K A;  3V9S A;  5AZJ B;  3WNG A;  3L2V A;  5KPZ A;  5HRR A;  4BVO A;  5F2R A;  3KLE A;  1X3M A;  1WSH A;  2RPI A;  2IOC A;  5BRE A;  2KLA A;  1NJX A;  1NGC A;  3AVG A;  3LP1 A;  4ILH A;  4M42 A;  3VF4 A;  2DPN A;  3TAE A;  1RBV A;  2WC9 A;  2DFE A;  3PO4 A;  1VK0 A;  4WF9 L;  3SQ0 A;  3ZSX A;  1JXE A;  1KVB A;  5M1O A;  1WOQ A;  4BRL A;  4DTM A;  3BEX A;  4BQL A;  4E19 A;  3QIP A;  1W2B M;  4CJR A;  5FLX O;  3EE9 A;  3OYF A;  3OYC A;  4O8U A;  3SBG A;  1S9G A;  1YUW A;  1RT7 A;  1T6C A;  4DSE A;  4BVP A;  5LY3 A;  5C10 A;  4YHH K;  4B1U B;  4I2P A;  4M3T A;  3ITH A;  1J6Z A;  4CF1 A;  1GLF O;  2O8E A;  1KAZ A;  3AA5 X;  3TTD A;  1NG9 A;  3NF8 A;  4FJK A;  3U3Y A;  4DTR A;  4CJ5 A;  3HXM A;  1WBD A;  3CJB A;  2ITM A;  3H1Q A;  4B3S K;  5AQJ A;  4MLE A;  5MLC Q;  1QHA A;  2XRI A;  4LFC K;  1X3N A;  3BF3 A;  4BGB A;  5I9E B;  1X9W A;  3THY A;  4BDP A;  2ASM A;  4H5V A;  3LAM A;  2GUI A;  3SAH A;  3DOK A;  2PYJ A;  4JRQ A;  1J53 A;  3R6M A;  4FLT A;  1NWK A;  3FFK B;  3SUN A;  4OPK A;  4HCC A;  1NGI A;  3QNO A;  3LDL A;  4LF8 K;  3J7A P;  1RFQ A;  1IKW A;  4CJ7 A;  2HST A;  4FWN A;  1I3A A;  5C24 A;  5I42 A;  2KQ2 A;  3TU5 A;  2ZGZ A;  4JI0 K;  1Q86 O;  5AFU A;  1X9J A;  3C7N B;  3VQP A;  3QEW A;  4L8R B;  3CG7 A;  3KK2 A;  2G8U A;  2E2Q A;  2GX9 A;  4O8K A;  3QIO A;  4U7B A;  2CH6 A;  4E1J A;  2F8T A;  4AHV A;  1QTM A;  4HCB A;  1VQ8 N;  3VQ4 A;  5FRO A;  4BGA A;  3SJH A;  3MN5 A;  1VQP N;  1J5O A;  3OYN A;  4FW1 A;  1OH6 A;  3QFU A;  1S3X A;  1YVN A;  1C6V A;  1DTQ A;  3VA0 A;  3S9H A;  2HVH A;  5FPM A;  2FBX A;  4DV6 K;  4I9L A;  4JK9 A;  2JLE A;  4M3Z A;  3D2F A;  1B92 A;  3JS6 A;  3SQ1 A;  3H46 O;  3SK3 A;  4N41 A;  1IJJ A;  3CJ1 A;  4H0O A;  5HRO A;  2O4I A;  4PUO A;  4PKH A;  5BRF A;  4RW8 A;  1I94 K;  2FBY A;  1NGH A;  1U45 A;  2HHV A;  4DSI A;  2Q31 A;  4JK7 A;  4C8O A;  3U4L A;  3K58 A;  2GBZ A;  4KRE A;  3F9K A;  2XY5 A;  4DQI A;  4FZZ A;  2Q1N A;  1RIL A;  3NF9 A;  4J8F A;  1CZB A;  1ZBU A;  3SUQ A;  3DXM A;  1NGE A;  1CLQ A;  1B9F A;  3QNN A;  3CQY A;  1L3U A;  1GLL O;  3NGZ A;  4IDH A;  4O44 A;  3AVC A;  1Z26 A;  2Q2R A;  3MAQ A;  4KKO A;  2E1Y A;  2X78 A;  3TSQ A;  2GWJ A;  3P83 D;  1WN7 A;  2P9N A;  3QO9 A;  5AFU H;  1SKR A;  4DTU A;  1J5E K;  1GLA G;  4CIG A;  4E7I A;  1NKE A;  3ZSW A;  5EVZ A;  1P90 A;  2HB5 A;  3CJ7 A;  1SQK A;  1JLE A;  4JEP A;  2Z1G A;  3AAP A;  1S9E A;  4IWV A;  3E9P A;  1XI1 A;  4F3O A;  3AGR A;  3WXM B;  1FJG K;  2UXC K;  3CC4 N;  3SV3 A;  4KB0 A;  4H0T B;  4FWP A;  4DF4 A;  4FM0 A;  3G71 N;  2BE2 A;  2W41 A;  4H5R A;  4CZM A;  3VF6 A;  4Y1C A;  3VTI A;  3DMJ A;  4FJ7 A;  4KHW A;  3WUH A;  3PIO L;  1NK5 A;  4BR5 A;  1QZ6 A;  1QZ5 A;  1RTI A;  3OYG A;  4H0P A;  4M63 C;  2PYL A;  3O9U A;  4CJE A;  4C23 A;  4AIL C;  4BC2 A;  4FJM A;  3J8A A;  2NRX A;  2YKN A;  3DLH A;  1BCO A;  1RT4 A;  4ILJ A;  1NK4 A;  2KFZ A;  4DLE A;  3L3U A;  3GOI A;  2HF4 A;  1YJ9 N;  4IBN A;  2AJQ A;  3O4W A;  1FW6 A;  1SS6 A;  4OKE A;  4CEF A;  1IBM K;  3O4N A;  3A8Y A;  3SMP A;  4EHU A;  3OYH A;  5CHI A;  2QK9 A;  2IC3 A;  5HLF A;  3VEY A;  4FJL A;  5CZ1 A;  2HND A;  1YAG A;  3THW A;  2I7P A;  3QEP A;  3ID6 A;  4DU4 A;  3ZT0 A;  5AZJ A;  4JI7 K;  3L2R A;  4IOC L;  1C0T A;  4KH5 A;  3W0L A;  4CJQ A;  4BRH A;  4EFH A;  4FWL A;  5HL7 L;  1XHX A;  4DCH A;  3QB0 A;  4BY9 C;  3J81 O;  1TGO A;  3FZF A;  5E26 A;  3CXC M;  4GY2 B;  5E41 A;  1BDG A;  3KZB A;  2OTL N;  3HVT A;  5IT9 O;  1IG8 A;  3DYA A;  4RTF D;  2NNW A;  1OH7 A;  4A5A A;  1Q9Y A;  2QWL A;  2JGU A;  2Q0R A;  3UB5 A;  4CEZ A;  1NGJ A;  1XNR K;  3QER A;  2XY7 A;  1KCF A;  3GG4 A;  4DLG A;  1EO1 A;  2DFF A;  1VQM N;  4B1V A;  4EIA A;  4H0X B;  3NVM A;  1NGG A;  2D4W A;  4FJG A;  4MO5 A;  1D9D A;  1LW0 A;  3Q7C A;  3FGU A;  1JLC A;  1EET A;  4A5B A;  1KRP A;  3U9Z A;  2KW4 A;  1ITG A;  2V7Z A;  4YFU A;  1VQ9 N;  1HNZ K;  4YDU A;  2QA4 N;  3D2E A;  2O8D B;  2P51 A;  3SUP A;  4HHT A;  4HUE A;  4DQQ A;  4RW4 A;  1GLC G;  2DTU A;  3J7Z O;  4NB4 A;  2YX6 A;  2EX3 A;  4W5N A;  4KB1 A;  3D0P A;  3M1F A;  2HOE A;  1XMO K;  4I9Q A;  4AHR A;  5AQM A;  3KLI A;  3H3O B;  1WBB A;  3KIO A;  4O5B A;  5JLF A;  1WSE A;  1W9H A;  1ZBF A;  3SAF A;  3IMX A;  3C6T A;  5AQR A;  2P9N B;  4MFB A;  3V81 A;  1SL0 A;  1U47 A;  2E1Z A;  4OO1 J;  1S22 A;  4FVU A;  1S6Q A;  1Z6R A;  4DSL A;  2F9T A;  3G10 A;  3HPG A;  4DHY A;  4K0K K;  2VG5 A;  4X65 K;  4CJW A;  1OKJ A;  1CZ9 A;  4YOU A;  4LD0 A;  1HQU A;  3EZ5 A;  2FF3 B;  2ZGY A;  1ASU A;  4K43 A;  4M3R A;  2JWK A;  3KWG A;  3C6A A;  2HHS A;  4BRQ A;  4YOX A;  3SCX A;  4B9Q A;  5AJ3 K;  4WCE L;  2D0A A;  3LP2 A;  3HBT A;  3CPW M;  4IJN A;  2RN2 A;  4Z4E A;  3KK3 A;  1VSK A;  2VWK A;  3WNF A;  3H3N O;  1BGX T;  4CZL A;  3OTO K;  3V4I A;  2P9U A;  4BRP A;  2GEM A;  3KVG A;  4Z4H A;  4JD2 B;  4NXN K;  4C8L A;  1JL1 A;  4JKF A;  4YOY A;  3CFR A;  4AHT A;  4QS8 A;  3ENO A;  3JYT A;  2G8H A;  3TR8 A;  2A1S A;  2PBD A;  4CZF A;  1BHL A;  2KHO A;  2UYT A;  4KAZ A;  1GOB A;  1TKX A;  3CJ9 A;  3KLG A;  1HUX A;  3BY5 A;  4O4G A;  1TL3 A;  2QI2 A;  2J4R A;  3MN9 A;  4KHY A;  2E8A A;  4HWI A;  3ULE A;  1UOC A;  1UWB A;  4DFM A;  4BR9 A;  4DKW A;  2Z1J A;  3SLC A;  5JVH L;  3HTV A;  3G0Z A;  3E9O A;  4NXM K;  3K57 A;  3VF2 A;  3RRG A;  2XHB A;  4TSX A;  4CJS A;  3WXK A;  2QKB A;  4B08 A;  1RBS A;  1IH7 A;  3CCS N;  5J2P A;  1ZBL A;  2NRT A;  3S3M A;  4CFC A;  4C1N K;  1HYS A;  3CCR N;  4BRO A;  1E4F T;  3DWL A;  4R5P A;  4BWM A;  3TAQ A;  1X9S A;  2YHB A;  4QS7 A;  4IG0 A;  3VEO A;  4AM7 A;  3Q7B A;  5BR9 A;  2F96 A;  3DI6 A;  4DR1 K;  2V52 B;  4AM6 A;  2KZM A;  4RW6 A;  2FBV A;  1QQC A;  3EN9 A;  1WSI A;  4LF5 K;  3L4I A;  4EZ9 A;  3C94 A;  3SYZ A;  4DR7 K;  4YOV A;  4R79 A;  1RDA A;  4NLB A;  4HVJ A;  2E6M A;  3EL2 A;  4CJ4 A;  3KD1 E;  2HBM A;  5FPD A;  4BRN A;  2ZJQ L;  1TK0 A;  1QSY A;  4ID1 A;  1DKG D;  3L0Q A;  2Q0U A;  4FWM A;  1DGK N;  5J2M A;  5C25 A;  3HST B;  4RG8 A;  3LP0 A;  3S3O A;  5AQG A;  3H1V X;  2OPQ A;  3IKM A;  1K8K A;  1TUY A;  1EWQ A;  4CEB A;  3A5O C;  1JJ2 M;  4PA1 A;  4CK2 A;  1RNH A;  3ENB A;  5HRP A;  4DR5 K;  1ZBS A;  4YY3 K;  3SZ2 A;  4FWS A;  3AA2 A;  3PX6 A;  3SI6 A;  4B3O A;  3O3G A;  1RT2 A;  3C95 A;  1KFS A;  4JAX A;  3ZCM A;  3O9T A;  4JI5 K;  4JHD B;  3OYA A;  2A6A A;  2NUB A;  2UXD K;  3AVH A;  1L3T A;  3SPZ A;  3CME N;  4CBW A;  2HHT A;  4B9T A;  3CER A;  4DQR A;  3HL8 A;  4BR0 A;  3U9D A;  4IOX A;  4IFY A;  1NOY A;  4DR4 K;  2DFH A;  1Q8I A;  4M3X A;  2VYP A;  4B3R K;  3ZEU A;  2G8K A;  5M1N A;  1HNW K;  1N5Y A;  5EOY A;  1WSF A;  3NBP A;  2OCE A;  1T05 A;  4F2R A;  4A57 A;  3O08 A;  1NKC A;  5GAD P;  1RBT A;  2ASP A;  1NK6 A;  4GKK K;  4CJV A;  2BH1 A;  1C1C A;  3NMU A;  3D7E O;  5D3G A;  5LJW A;  4DTP A;  3O8M A;  3CMA N;  1K6Y A;  3AA4 A;  3T69 A;  3QEI A;  2WTU A;  1REV A;  3NGY A;  2OPS A;  4XH4 A;  4CJK A;  4FLW A;  4Z0U A;  4CZH A;  4H5W A;  4KHU A;  1NMN A;  3BDP A;  1Q81 O;  1TAU A;  1RT5 A;  2NRH A;  3CC2 N;  3VQ7 A;  1VAZ A;  5AQT A;  4Z94 A;  3DLL L;  1QHT A;  4BRK A;  3BUZ B;  3MMV A;  4CJT A;  1RT6 A;  3U3G A;  3CCL N;  4BQZ A;  3SBT A;  1MWM A;  3VEW A;  2HNZ A;  5C15 A;  2NRZ A;  1RDD A;  5C2D A;  3QBW A;  5M1P A;  3VQD A;  2ZWH A;  1EX4 A;  3TI0 A;  4DU3 A;  1P8Z A;  3BF1 A;  3O3H A;  1K73 O;  2B5J A;  3T1Y K;  4GV9 A;  4J2D A;  4CZE A;  1OVY A;  1IKY A;  1W97 L;  1N33 K;  2HHW A;  4GW6 A;  3NVK A;  4JKE A;  2GV9 A;  4M7X A;  3UKU A;  4E7J A;  3VQ9 A;  4C8K A;  4JYA K;  1J9A A;  4RW9 A;  3ATU A;  1WAJ A;  5BPL A;  1KFD A;  5AQY A;  3ID8 A;  4JI3 K;  4GVE A;  4AQY K;  3E01 A;  1NGB A;  3MEC A;  3LDQ A;  2P5O A;  1L5U A;  1H1V A;  1KAX A;  4F9O A;  1TK8 A;  4G9Z A;  3ZT2 A;  1VSJ A;  3HM9 A;  3FZL A;  1JCE A;  5TKY A;  1D8Y A;  3KWI A;  3BP8 A;  2FSN A;  2GTD A;  3TAP A;  4GV3 A;  3NF7 A;  3TSP A;  3EYZ A;  4B9M A;  3K5L A;  1U49 A;  2W6L A;  4FZY A;  1KD1 O;  2F4V K;  4A2B A;  4BWJ A;  2YNG A;  4BC5 A;  4EHT A;  4JRP A;  4CGJ A;  4BRF A;  4M41 A;  3AVF A;  4XH1 A;  1Y64 A;  4E89 A;  4XIU A;  4F3T A;  1QSL A;  2O8B B;  1IV0 A;  4OPA A;  3RMA A;  1TUU A;  4FPA A;  5AQP A;  3ZT4 A;  3O1W A;  4DQP A;  4CGI A;  2GEL A;  4BR7 A;  4B9U A;  3EY1 A;  4PKI A;  5DK5 A;  1OVQ A;  3HK2 A;  2F9W A;  4DR3 K;  1LAW A;  3MWT A;  1Z05 A;  3CFO A;  4YDU C;  1VQK N;  2GWK A;  3RR8 A;  5EY4 A;  2P9L A;  3OBW A;  4E1N A;  1RDC A;  4YOW A;  4FJJ A;  4U67 L;  2ZQB A;  3PSF A;  4FJ8 A;  4BDY A;  4K41 A;  1A5W A;  4CGD A;  4DV7 K;  3HRG A;  4H0Y B;  4JHD A;  1ILY A;  4WQ5 C;  4HTU A;  1A5X A;  4LF4 K;  2VG6 A;  3A5N C;  4B8C A;  4OGE A;  4ELT A;  1CXU A;  5FRM A;  3HOS A;  4BRE A;  4E7L A;  4C1N I;  2YHA A;  2HHH K;  1XWL A;  1DTT A;  3OBY A;  3LWM A;  1XC3 A;  5GAE P;  1BO5 O;  3RWU A;  2RE2 A;  2Z1I A;  3DLE A;  1MU2 A;  3IFR A;  2QWO A;  3ZSZ A;  3ZSQ A;  3V1Q A;  2P5G A;  1L3S A;  2P9S A;  3VQB A;  3A2F A;  1BA1 A;  2LSN A;  1NGF A;  4JNE A;  4W5Q A;  2E5L K;  2P9I B;  1RTD A;  3KLF A;  5LMN K;  1QE1 A;  4F2S A;  4CES A;  3OYK A;  1BQN A;  3KK1 A;  4FWR A;  1HNI A;  1G15 A;  3CJA A;  2IIR A;  1JXB A;  4FL9 A;  1ASW A;  3ZX2 A;  5KTQ A;  3B6P A;  2YNI A;  4JKC A;  2RHK A;  2P9S B;  3C6U A;  5B8H A;  3D6R A;  3QET A;  1BG3 A;  1NJW A;  4BRA A;  3WNE A;  3O9R A;  2QKK A;  3OYL A;  1ZBH A;  4CED A;  3RTV A;  5HOO A;  5AQL A;  3V1R A;  3CYM A;  2OZS A;  3TAN A;  2X6N A;  1KVA A;  3AAQ A;  3OYD A;  4GNI A;  4B9N A;  1JCF A;  4OVL A;  4M7Y A;  3P38 A;  3P39 A;  1LAV A;  5ELZ A;  1EP4 A;  4LF6 K;  4B8A B;  4FLU A;  1BQM A;  1NKB A;  3B8A X;  3CI5 A;  2Q36 A;  4FWO A;  4CD3 A;  2D0O A;  4CHZ A;  1TKT A;  4E7H A;  3K5N A;  4FW2 A;  2ZD1 A;  2NZT A;  4DFK A;  2V7Y A;  3LM2 A;  4IXC A;  2GUP A;  2G8F A;  3MWP A;  2YV0 X;  5JVG L;  4FCY A;  3J7Y P;  5BPN A;  1HPM A;  5K14 A;  3RMB A;  1U4B A;  2WON A;  4QOZ B;  3AGK A;  3VQA A;  4MO4 A;  3G4S N;  5LMU K;  4PHT X;  3QEV A;  4LFA K;  4JI4 K;  3MX2 A;  3IS9 A;  3AVI A;  3BZC A;  1XMQ K;  5J1E A;  2FLO A;  3CPE A;  4IDK A;  1HQE A;  3VTH A;  4CVN E;  4UQG A;  4W5O A;  2VQF K;  4J2B A;  3V9Z A;  4DTJ A;  1GOC A;  1T44 A;  1JLG A;  3WT0 A;  5KPR A;  3THV A;  3D45 A;  4YNQ A;  3LP3 A;  1SV5 A; 
#chains in the Genus database with same CATH homology
 1TKD A;  3V1O A;  3V9X A;  1TK5 A;  2Z1J A;  2B6A A;  2OPP A;  1CXQ A;  4IFV A;  1LWF A;  4OKK A;  1NK8 A;  1C1A A;  4FLV A;  4MQ3 A;  2VWJ A;  3G0Z A;  4JLH A;  4LSN A;  1S1T A;  3K57 A;  3PO5 A;  3RRG A;  3QLH A;  4H8K A;  2XHB A;  3V9S A;  4TSX A;  4CJS A;  4O0I A;  2VG7 A;  3LAK A;  3WNG A;  3SQ4 A;  3L2V A;  3T19 A;  5HRR A;  2QKB A;  4B08 A;  1RBS A;  3K5O A;  3KLE A;  1IH7 A;  5J2P A;  1WSH A;  2RPI A;  4CK1 A;  2IOC A;  4CER A;  1ZBL A;  1SKS A;  1NJX A;  2DY4 A;  2B4J A;  4EZ6 A;  3AVG A;  3LP1 A;  3ULD A;  1XHZ A;  2HHX A;  3S3M A;  1WAF A;  2QXF A;  1FKO A;  3LPU A;  4NYN A;  4CFC A;  4M42 A;  4ZTF A;  4ELV A;  3HT3 A;  3ASM A;  1HYS A;  3TAE A;  4FXD A;  2E4L A;  5FRN A;  2ITG A;  3P1G A;  1RBV A;  2DFE A;  4CK3 A;  4R5P A;  1VK0 A;  3PO4 A;  4BWM A;  3SQ0 A;  3TAQ A;  4CGH A;  5C42 A;  4M3U A;  4Z4G A;  1UAX A;  5JS1 A;  3MEG A;  3ZSX A;  1X9S A;  2YHB A;  4IG0 A;  1JXE A;  1KVB A;  4DSJ A;  1D5A A;  4DTM A;  4PQU A;  4EP5 A;  4E19 A;  2D0B A;  2F96 A;  3ISN C;  3QIP A;  3DI6 A;  1JKH A;  4PY5 A;  4CJR A;  3DLG A;  2HW3 A;  1S5J A;  2ATQ A;  3OYF A;  1EXQ A;  4RW6 A;  4CJU A;  2FBV A;  4Z4F A;  2KZM A;  1QQC A;  3M8R A;  3OYC A;  4KHS A;  1KVC A;  1S9G A;  1WSI A;  3I0S A;  4C8M A;  1RT7 A;  4DSE A;  4EZ9 A;  3C94 A;  3AO4 A;  3SYZ A;  4QCL A;  4NCA A;  5EU7 A;  4CJ3 A;  1RDA A;  4I2P A;  4Y1D A;  4CIE A;  4BDZ A;  4HVJ A;  4FK0 A;  3ITH A;  4M3T A;  2E6M A;  3OS2 A;  1VSM A;  1O1W A;  2X6S A;  1WSG A;  1VRT A;  3M8S A;  4CF1 A;  4AHS A;  4CJ4 A;  4CJF A;  2BDP A;  3KD1 E;  3AA5 X;  5CYM A;  4M3W A;  1JL2 A;  4N5S A;  1VSF A;  3NF8 A;  1TK0 A;  1QSY A;  1BI4 A;  4ID1 A;  1YTU A;  4B9S A;  4CHY A;  4GMJ B;  4FJK A;  3AO3 A;  3NGI A;  3U3Y A;  5HP1 A;  4DTR A;  4FJ5 A;  4CJ5 A;  2IAJ A;  5J2M A;  3HXM A;  5C25 A;  3HST B;  4RG8 A;  4HUG A;  3LP0 A;  3U6F A;  1JLQ A;  3S3O A;  2OPQ A;  4F8R A;  4CEB A;  2XRI A;  4PA1 A;  3TAB A;  2D5R A;  4CK2 A;  4KI6 A;  2HHU A;  1RNH A;  5HRP A;  4B9V A;  3AVK A;  3SZ2 A;  4B9L A;  1X9W A;  1SKW A;  4BE0 A;  3AA2 A;  3PX6 A;  2P1J A;  3SI6 A;  4BDP A;  4B3O A;  1UA1 A;  1TKZ A;  1RTH A;  1C0U A;  1RT2 A;  2GUI A;  3C95 A;  3DOK A;  3LAM A;  3O3G A;  1KFS A;  2PYJ A;  3M8P A;  4CEQ A;  3ZCM A;  4JRQ A;  2ZE2 A;  1J53 A;  1X1P A;  3OYA A;  4FLT A;  4FJN A;  2NUB A;  4AHC A;  3SUN A;  4OPJ A;  4OPK A;  3AVH A;  1L3T A;  2OA8 A;  3SPZ A;  4HCC A;  3QNO A;  4OLB A;  3HJF A;  3M8Q A;  3WNH A;  2HHT A;  3OS0 A;  3KJV A;  4B9T A;  1S6P A;  3IG1 A;  4DQR A;  1W0H A;  3HL8 A;  4CJL A;  3B6O A;  1SUQ A;  1IKW A;  1YTA A;  4IFY A;  5KGW A;  1I3A A;  5C24 A;  3VQ5 A;  5I42 A;  3AO5 A;  1NOY A;  3HO1 A;  2DFH A;  3PX4 A;  3DLB A;  2Q3S A;  1LWE A;  1Q8I A;  2KQ2 A;  4N47 A;  3OYI A;  4M3X A;  3V6D A;  4BAC A;  3CM5 A;  3MXM A;  2G8K A;  1N5Y A;  1WSF A;  3NBP A;  1T05 A;  4F2R A;  4CHQ A;  4AHU A;  3OYJ A;  3PV8 A;  1R0A A;  4FJI A;  4G1Q A;  1NKC A;  3VQP A;  1T03 A;  1RBT A;  4ZTJ A;  3QEW A;  1NK6 A;  3K2P A;  1S1W A;  3KLH A;  4L8R B;  3CG7 A;  4CJV A;  3KK2 A;  1C1C A;  2XY6 A;  5HRS A;  2G8U A;  3KKS A;  4LSL A;  1LWC A;  3QIO A;  5D3G A;  4DTP A;  4DMN A;  1KLN A;  3ZSY A;  3LAN A;  2F8T A;  1J54 A;  3SQ2 A;  4CF0 A;  4AHV A;  3HP6 A;  1QTM A;  1T7P A;  4HCB A;  1K6Y A;  3AA4 A;  2Y1J A;  3QEI A;  1REV A;  3VQ4 A;  4OKJ A;  3MEE A;  3NGY A;  1HMV A;  2OPS A;  5FRO A;  3L2Q A;  4CJK A;  4FLW A;  1WLJ A;  4Z0U A;  3KD5 E;  1J5O A;  3OYN A;  4FW1 A;  3VA0 A;  1C6V A;  1DTQ A;  3S9H A;  4KHU A;  2HVH A;  3BDP A;  1TAU A;  2FBX A;  4I9L A;  4M3Z A;  1RT5 A;  2JLE A;  4DTO A;  1B92 A;  3VQ7 A;  3SQ1 A;  4N41 A;  3RMD A;  1QHT A;  5J2Q A;  2HNY A;  3VQE A;  4CEE A;  1HYV A;  4CGF A;  4CJT A;  1RT6 A;  5HRO A;  4PUO A;  2O4I A;  1KSP A;  3U3G A;  3FFI A;  4RW8 A;  4H4M A;  2FBY A;  2Y1I A;  3AVN A;  4CEA A;  5KRS A;  1U45 A;  4LH4 A;  2HHV A;  4DSI A;  3HYF A;  3ZSR A;  3L2W A;  1IG9 A;  2HNZ A;  3AVL A;  4C8O A;  4M3Y A;  3RR7 A;  3K58 A;  3CM6 A;  3LZJ A;  2GBZ A;  3ZSO A;  4DF8 A;  4KRE A;  2WOM A;  4H4O A;  1RDD A;  2ETJ A;  5HRN A;  3K5M A;  3VA3 A;  3F9K A;  2XY5 A;  1BCM A;  3VQD A;  1VSL A;  3OS1 A;  3OYM A;  4DQI A;  3I0R A;  1RIL A;  3NF9 A;  4KHN A;  1EX4 A;  3TI0 A;  4DU3 A;  1CZB A;  1ZBU A;  4KTW A;  1BIU A;  3H08 A;  3SUQ A;  4CCH A;  3O3H A;  1TVR A;  3L2U A;  4CEC A;  1CLQ A;  3ZSV A;  1B9F A;  4M45 A;  4E1M A;  3QNN A;  2B5J A;  1L3U A;  4E0D A;  4F4K A;  4FJ9 A;  4J2D A;  3NGZ A;  4DS5 A;  4O44 A;  3OYE A;  1EKE A;  1Z26 A;  3AVC A;  5SWM A;  3NHG A;  4KKO A;  1IKY A;  3MAQ A;  4KI4 A;  2X78 A;  4CE9 A;  1WSJ A;  3LPT A;  4FJX A;  3P83 D;  1WN7 A;  4DTS A;  2HHW A;  4E3S A;  4GW6 A;  3QO9 A;  1SKR A;  4DTU A;  2G8V A;  3OJS A;  4Q5V A;  4KPY A;  2E6L A;  4CIG A;  4CHO A;  2GV9 A;  4E7J A;  4E7I A;  3TAR A;  1NKE A;  3VQ9 A;  4C8K A;  1TV6 A;  3NDK A;  3ZSW A;  3L3V A;  2HB5 A;  1J9A A;  3RMC A;  1BL3 A;  4CGG A;  1TAQ A;  4RW9 A;  3ZT1 A;  1JLE A;  1WAJ A;  4ID5 A;  1KFD A;  2BAN A;  5DMR A;  3TWH A;  2Z1G A;  1S9E A;  3LDS A;  1JLB A;  3O4Q A;  3TAF A;  3S3N A;  3E01 A;  4CHP A;  4Z4C A;  4NCB A;  3MEC A;  1XI1 A;  4F3O A;  4FZX C;  4FZZ A;  1VSI A;  3CQ8 A;  2P5O A;  5SZT A;  1L5U A;  4CF9 A;  2BGG A;  3HPH A;  3SV3 A;  4KB0 A;  1TK8 A;  1RBR A;  3VQ8 A;  4KTQ A;  3NFA A;  3ZT2 A;  1VSJ A;  2KTQ A;  1RCH A;  3HM9 A;  4RW7 A;  4DF4 A;  4FM0 A;  3AVJ A;  4OLA A;  2BE2 A;  1D8Y A;  4I2Q A;  3OJU A;  2G8I A;  2KFN A;  4Y1C A;  3IRX A;  1NOZ A;  3DMJ A;  4FJ7 A;  4BE2 A;  3TAP A;  3NF7 A;  2YKM A;  4KHW A;  3EYZ A;  1NK5 A;  4B9M A;  3HP9 A;  3AO2 A;  3K5L A;  1RTI A;  3OYG A;  4E7K A;  2PYL A;  3NF6 A;  3OVN A;  4FLX A;  4CJE A;  1U49 A;  4FZY A;  4KHQ A;  2IS3 A;  4AIL C;  1X9M A;  3PUF A;  1L3V A;  4BWJ A;  4K8Z A;  2YNG A;  3O3F A;  3AVB A;  4FJM A;  4CFD A;  2YKN A;  4JRP A;  1BCO A;  2PZS A;  3DLH A;  1RT4 A;  3F73 A;  4CGJ A;  1NK4 A;  3NH2 A;  2KFZ A;  4DLE A;  1VSD A;  3L3U A;  3MXI A;  4M41 A;  1Q9X A;  3AVF A;  2OZM A;  4ELU A;  4IBN A;  4XIU A;  4N76 A;  4E89 A;  4F3T A;  1RDB A;  2AJQ A;  3HVR A;  1U04 A;  1QSL A;  3AA3 A;  4FM2 A;  3IAY A;  2YNF A;  3RMA A;  4OKE A;  4CEF A;  3O4N A;  3OYB A;  3ZT4 A;  3SJJ A;  3AVM A;  2RF2 A;  4HUF A;  4EP4 A;  1BI4 B;  4CGI A;  4FM1 A;  4DQP A;  3OYH A;  4J2A A;  4KFB A;  2QK9 A;  4C8N A;  3ZT3 A;  4B9U A;  2IC3 A;  5CZ2 A;  5HLF A;  3EY1 A;  1FKP A;  4FJL A;  5DK5 A;  5CZ1 A;  2HND A;  3HK2 A;  4JS4 A;  3KKR A;  3QEP A;  4DS4 A;  1LAW A;  1HJR A;  1S1X A;  4LH5 A;  3ZT0 A;  4DU4 A;  3CFO A;  1A5V A;  5KGX A;  3KTQ A;  1ZYQ A;  3RR8 A;  3L2R A;  2OPR A;  4FK4 A;  1YVU A;  4FJH A;  1C1B A;  1S1U A;  1RBU A;  4DSF A;  2X74 A;  1C0T A;  4E1N A;  3SNN A;  4CJQ A;  1RDC A;  2KZZ A;  1JLF A;  4FJJ A;  1XHX A;  4NCG A;  1XC9 A;  2ZQB A;  3AV9 A;  4FJ8 A;  1HPZ A;  4BDY A;  1A5W A;  1KTQ A;  3SUO A;  3MED A;  2XY8 A;  4CGD A;  1TGO A;  4DQS A;  5E41 A;  1BIZ A;  1ZBI A;  3QEX A;  1HNV A;  3HVT A;  4HTU A;  2PY5 A;  4CF2 A;  3DYA A;  1Y97 A;  2F8S A;  2HVI A;  1A5X A;  1T8E A;  2VG6 A;  4OGC A;  5J2N A;  1Q9Y A;  4KO0 A;  4B8C A;  1F21 A;  2I5J A;  2JGU A;  1U48 A;  4DFP A;  4OJR A;  4CEZ A;  4OGE A;  4ELT A;  3PX0 A;  4CHN A;  4Q0B A;  1CXU A;  1FXX A;  4KV8 A;  5FRM A;  3NAE A;  3QER A;  2XY7 A;  4FK2 A;  1KCF A;  4E7L A;  1VSE A;  4DLG A;  4DWI A;  2YNH A;  2YHA A;  2DFF A;  1XWL A;  1DTT A;  5CYQ A;  1D9F A;  3LWM A;  4FJG A;  3AO1 A;  3QIN A;  5T7B A;  3RWU A;  2Z1I A;  3DLE A;  3P5J A;  1SL1 A;  1D9D A;  1LW0 A;  1MU2 A;  1B9D A;  1JLC A;  3QES A;  4KRF A;  3ZSZ A;  4FVM A;  1EET A;  3ZSQ A;  1LV5 A;  3V1Q A;  2P5G A;  3MXJ A;  3K59 A;  1L3S A;  1ASV A;  1RTJ A;  4KTZ A;  3OY9 A;  1KRP A;  2KW4 A;  4FYD A;  1ITG A;  4YFU A;  1GOA A;  3DRP A;  3VQB A;  3A2F A;  1S1V A;  2LSN A;  1FK9 A;  4DTX A;  4O55 A;  4W5Q A;  3ALY A;  4FLY A;  1RT1 A;  1RTD A;  1VRU A;  3KLF A;  1NK7 A;  1QE1 A;  2P51 A;  1TL1 A;  3SUP A;  4HHT A;  4LY7 A;  4F2S A;  4HUE A;  4CES A;  2A1R A;  4DQQ A;  3OYK A;  4RW4 A;  3JSM A;  2G8W A;  2DTU A;  2W42 A;  1BQN A;  3KK1 A;  4PWD A;  1I39 A;  3TAG A;  3LAL A;  2EX3 A;  2Z1H A;  3VQQ A;  1NK0 A;  1HNI A;  4KB1 A;  4W5N A;  3VN5 A;  4O0J A;  3D0P A;  1IKV A;  1G15 A;  4FLZ A;  3VQ6 A;  4I9Q A;  4AHR A;  3SV4 A;  3DRS A;  3KLI A;  1JXB A;  2R7Y A;  2HHQ A;  3KIO A;  1ASW A;  4O5B A;  3CFP A;  4K8X A;  4ICL A;  1DLO A;  5KTQ A;  3B6P A;  5FDL A;  1WSE A;  1W9H A;  2YNI A;  1ZBF A;  1IO2 A;  4AH9 A;  4ZHR A;  3C6U A;  3AVA A;  1Z25 A;  3C6T A;  4CIF A;  3QET A;  4QAG A;  1NJW A;  3NE6 A;  4DFJ A;  3WNE A;  4MFB A;  1NK9 A;  2O4G A;  5HBM A;  3V81 A;  1SL0 A;  1U47 A;  2QKK A;  4DSK A;  1NJY A;  1UA0 A;  1S6Q A;  3OYL A;  1ZBH A;  4CED A;  4BE1 A;  3RTV A;  4DSL A;  3V1R A;  4CF8 A;  3CYM A;  2OYQ A;  2FC0 A;  2OZS A;  3G10 A;  3RRH A;  2X6N A;  1KVA A;  3HPG A;  3DLR A;  3TAM A;  3TAN A;  1HYZ A;  2VG5 A;  3OYD A;  4CJW A;  1CZ9 A;  4B9N A;  1C0M A;  3V9W A;  1LW2 A;  4LD0 A;  4OVL A;  3T3F A;  1HQU A;  1IKX A;  1LAV A;  2RKI A;  3EZ5 A;  1EP4 A;  3NH1 A;  4CEO A;  1YT3 A;  5KRT A;  2XO7 A;  4B8A B;  4FLU A;  1QSS A;  1ASU A;  1BQM A;  4NYF A;  4M3R A;  1HRH A;  1NKB A;  2HHS A;  1WNS A;  3I8D A;  3LWL A;  3SCX A;  2FBT A;  1KLM A;  4CHZ A;  4W5R A;  2D0A A;  3V9U A;  3LP2 A;  1TKT A;  2EHG A;  2IGI A;  4E7H A;  3K5N A;  4DG1 A;  2RN2 A;  4FW2 A;  4N56 A;  2ZD1 A;  4Z4E A;  3KK3 A;  1VSK A;  2VWK A;  3WNF A;  4DFK A;  4J2E A;  1BGX T;  2IDO A;  3V4I A;  3T1A A;  4Z4I A;  1RT3 A;  2G8F A;  4DTN A;  1SL2 A;  3L8B A;  2YV0 X;  1N6Q A;  4FCY A;  1BIS A;  4Z4H A;  4CFB A;  3NCI A;  5K14 A;  5CY4 A;  3DOL A;  3NH0 A;  4C8L A;  4CFA A;  1JL1 A;  3CFR A;  2WON A;  3RMB A;  1U4B A;  2D0C A;  4AHT A;  4QOZ B;  3VQA A;  3JYT A;  2G8H A;  3TR8 A;  4WE1 A;  2A1S A;  3QEV A;  4JS5 A;  3DLK A;  1QS4 A;  3SPY A;  3IS9 A;  3AVI A;  1NJZ A;  5J1E A;  1BHL A;  4CJP A;  4IDK A;  3BGR A;  5JS2 A;  1HQE A;  4UQG A;  4W5O A;  2HMI A;  3PY8 A;  4W5T A;  4IKF A;  4J2B A;  4KAZ A;  1GOB A;  1TKX A;  3KLG A;  3HPO A;  5KI6 A;  3V9Z A;  4I7F A;  3UIQ A;  4DTJ A;  3VQC A;  4IG3 A;  4O4G A;  1TL3 A;  1GOC A;  3DRR A;  3LZI A;  1JLG A;  4KHY A;  4DU1 A;  5I3U A;  3THV A;  3DM2 A;  3D45 A;  4YNQ A;  1VSH A;  3LP3 A;  4GVM A;  1JLA A;  1UOC A;  1SV5 A;  1UWB A;  4DFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...