4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
3SQ4A 1RTDA 1TKZA 2QXFA 4O5BA 4IKFA 1ASVA 1MU2A 4DFJA 3LWLA 3RMDA 4CF1A 1WNSA 1EKEA 4E89A 3V9XA 4PWDA 3AVIA 4CEBA 2OZSA 3ZSVA 3IRXA 1L3TA 2D0BA 2F96A 3V1OA 2E6MA 3HVRA 1WLJA 4RW9A 1IKYA 3ZSRA 2XRIA 1RT4A 4OKKA 3L2RA 4FCYA 1SKWA 1B9DA 1L3UA 1S1XA 3LANA 4ID5A 4K8XA 2YNFA 3DLKA 1VSDA 1JL2A 1U48A 4DTOA 4F8RA 1BI4A 3EYZA 1S9GA 4CJVA 4JS5A 2HHVA 3IAYA 3MXMA 1IG9A 4HUEA 3AVMA 1B92A 2E4LA 5SWMA 4IBNA 3CFRA 5HRSA 2G8HA 2YKNA 3ZT3A 1IO2A 1UA1A 5CZ2A 1FKOA 3VQ7A 3DOLA 2P5OA 4OLAA 3NHGA 3TANA 3HK2A 3C6UA 3OVNA 3B6PA 1WAFA 3QLHA 3DI6A 3SUOA 4FLZA 4LH4A 3LAMA 4CHPA 4FLTA 4FZYA 1KTQA 3LP2A 1VSHA 3ZSYA 4CESA 1U49A 2D0AA 3F9KA 1QQCA 1Q9YA 5FRNA 1BQMA 1K6YA 1RBRA 3AA4A 3TWHA 4QCLA 4O55A 3NF6A 1NKEA 1NK8A 2PYLA 2AJQA 1S1WA 1S6PA 4CJUA 3E01A 5C24A 3VQAA 4OKEA 3L8BA 3T3FA 2IGIA 4QAGA 1BCMA 4CEZA 1HNVA 2DFFA 3P1GA 4BE2A 3OYFA 1ZBUA 3HP9A 3QEWA 1NK6A 1I39A 3OJUA 3K5OA 3K5NA 1NKBA 4BDZA 3QINA 4ZHRA 3K5LA 4FM2A 4MQ3A 3TAGA 3F73A 4JRPA 4CJRA 3THVA 1VSKA 1N6QA 1JLCA 4DTJA 4ELTA 2W42A 1JLAA 2WONA 1LWFA 4HTUA 3KK2A 2YKMA 1S9EA 3LZIA 1GOAA 4B8CA 4FM0A 1DLOA 3LZJA 1U04A 1J53A 3OS2A 3NGIA 3DOKA 4DQPA 1KSPA 4FJMA 3CFPA 4ZTFA 1VSFA 3VQ4A 4BE0A 1TK0A 1LW2A 3DLHA 1TV6A 1DTTA 1S1UA 2KFZA 1JXBA 4M3YA 3DLEA 4CJ3A 3CM6A 2OZMA 4DF4A 4I2PA 1D9FA 2F8SA 3OS0A 1RT6A 5HRRA 3V9ZA 1N5YA 1TK8A 1NOYA 3VQCA 3HM9A 3A2FA 4B9UA 2LSNA 1JLQA 1RT2A 3G10A 4BWMA 3NCIA 1RBVA 3K59A 3VA3A 3O3FA 3OJSA 1YTUA 2BGGA 3K57A 3ZSQA 1CZ9A 4CEFA 4B3OA 2E6LA 3VQ9A 5J1EA 4OGEA 4FLYA 1NK4A 1L5UA 3DRPA 5KGWA 4E0DA 3HJFA 3TAEA 4F3TA 2O4IA 3TABA 4M3RA 1HRHA 4CHQA 1TKTA 1QTMA 4FJNA 2HW3A 1KVBA 3HL8A 3HPOA 3AA5X 1ZYQA 4DSJA 4OPJA 1Y97A 2IAJA 1ZBLA 3DM2A 4C8NA 4FK4A 4IFVA 4KRFA 4JS4A 4KO0A 4B9NA 1Q9XA 4M3ZA 2HNZA 2RN2A 3M8QA 4CGFA 4G1QA 2BDPA 4Y1DA 1TL1A 3WNEA 2JLEA 4KTZA 4F4KA 4B9LA 5CYMA 2B5JA 1BQNA 4DFKA 4HUFA 4I7FA 3CFOA 3S3OA 4CEDA 4H4OA 3RMAA 1RT7A 2F8TA 2DFHA 3I0RA 3OYKA 3SUNA 1REVA 1HQEA 1J9AA 2YNIA 4E7KA 1X9SA 3L3VA 4HCCA 2JGUA 4CGGA 3DLGA 3NF9A 1HJRA 3OYAA 3AO4A 1XHXA 2YNGA 1I3AA 5FROA 4C8LA 3QNNA 3RRGA 3MEGA 1C0TA 3KIOA 4NCGA 3ZT1A 3HXMA 5I3UA 3V9SA 4CHOA 5KRSA 2IS3A 3AVKA 4KKOA 1LWEA 1NJWA 1TK5A 3HPHA 5KGXA 1NJXA 3NH2A 1D9DA 4FZZA 1Q8IA 5DMRA 4C8MA 4DQIA 1IH7A 3RTVA 4K8ZA 2HHTA 1CXUA 4DSIA 4F3OA 2VG6A 1X9MA 4FZXC 3TR8A 1VSEA 3QERA 5CY4A 3ZT4A 4Q5VA 4BACA 3LALA 2P51A 1QS4A 5T7BA 2NUBA 3ISNC 4LD0A 5HBMA 3L2VA 2RKIA 4CJSA 2XHBA 3AO2A 4C8OA 3LPTA 5CYQA 4CEEA 4FJKA 4N41A 2X78A 3BGRA 2ATQA 1RBTA 2OA8A 5K14A 3LWMA 2FBYA 1BL3A 1G15A 3EZ5A 1HYVA 3ULDA 1SKSA 3SQ1A 1SKRA 3JSMA 3AO1A 4W5NA 4BDYA 2GBZA 4MFBA 1BCOA 3VQBA 3TARA 3CG7A 4NYFA 3SNNA 4XIUA 4DG1A 4CJTA 1RDAA 3SJJA 1SL1A 2QKKA 1UAXA 1FXXA 4CHYA 4FM1A 4DFPA 1KFDA 2WOMA 5FDLA 4Z0UA 4J2DA 3L3UA 3SPYA 4I2QA 3ZT0A 4FJIA 4FJ8A 3NE6A 3TI0A 1KLMA 4DTPA 4FXDA 4EP4A 1NK9A 4KHWA 2ZD1A 3KKRA 2G8UA 2Z1JA 3C94A 2KW4A 3OYIA 1RDDA 3OYHA 2B4JA 4KTWA 2ZQBA 4KB0A 3SV4A 3QEXA 2DFEA 3IS9A 4ICLA 3NH0A 3U3YA 2PY5A 3KJVA 4CF9A 3M8RA 3KKSA 1LAWA 3OYBA 3RRHA 4OGCA 3AVAA 3VQDA 4YNQA 5KRTA 1A5VA 1U47A 1S5JA 3OYMA 4CGDA 1HNIA 1RDBA 1W9HA 4FW2A 4OVLA 2G8FA 1Z25A 3FFIA 3M8PA 4C8KA 2Q3SA 1CXQA 4H8KA 3LDSA 4DTNA 1RBSA 2ETJA 3KLGA 3QO9A 3ZSZA 3RMBA 3U6FA 3VQ6A 2EX3A 2XY7A 4KI4A 4M3TA 3MAQA 1RBUA 4LH5A 1Z26A 4CF2A 2QK9A 1ZBFA 4KV8A 4DQRA 3QEPA 1SL0A 1JLEA 3CQ8A 3ZSOA 1U4BA 3IG1A 3P5JA 2HHQA 4OLBA 4FJ5A 4CJ4A 4DFMA 4CK1A 4E1MA 1QSLA 2Z1GA 2PZSA 3KTQA 2QKBA 4CJWA 3KD1E 1LAVA 2HNDA 2IDOA 4RW4A 4DTSA 1JKHA 3VQQA 4B8AB 1T8EA 4W5RA 3K58A 1C0MA 3SZ2A 1C6VA 2YNHA 4N76A 3VN5A 4N56A 1JLFA 4DTRA 2Y1IA 2KZMA 1RNHA 1C1AA 3QIPA 3NDKA 3PY8A 4I9QA 1JLBA 4PY5A 1BHLA 3DRSA 2HHUA 3PX0A 4B9MA 4M3WA 1QSYA 4DU4A 1F21A 4CHNA 4KTQA 2KFNA 4E19A 1VRTA 5EU7A 2FBXA 4DS4A 3V6DA 1XC9A 2XY8A 4N5SA 3SV3A 2HHSA 2KZZA 5J2NA 2I5JA 1UWBA 3HP6A 3PX4A 4DU3A 3O4NA 3RMCA 1NK5A 3LP3A 4J2AA 4B08A 1SV5A 4B9SA 4FJLA 4PUOA 4NCBA 3M8SA 1X9WA 1T03A 2G8VA 3PV8A 4CJFA 4Q0BA 1BIZA 4L8RB 4AHSA 4CIGA 1ZBIA 2X6SA 1L3VA 4IDKA 3LAKA 3SQ2A 3VQ8A 3HSTB 3MEDA 4DQQA 4B9VA 4OKJA 1WAJA 4CF8A 1BGXT 5HLFA 3NGZA 3P83D 1D5AA 3O3HA 5HP1A 3TAPA 1UOCA 3ZCMA 4B9TA 2X6NA 4M3UA 1TGOA 1LV5A 1X1PA 4CHZA 4CFDA 3T19A 4BE1A 1RTJA 2OPRA 1NJYA 1HMVA 3AO5A 1A5XA 3K2PA 1TAUA 1W0HA 3NAEA 2OPQA 3TAMA 3DLRA 4E7LA 1HYZA 2O4GA 1R0AA 3B6OA 1RDCA 3NBPA 3DLBA 4HHTA 5JS1A 4CGJA 3L2QA 3ZT2A 1C0UA 4RW6A 4DSLA 4FJ7A 3S3MA 1VSJA 5CZ1A 4O44A 4DMNA 2HHWA 1RT3A 1VSMA 3MEEA 4FW1A 3WNGA 4CJ5A 1BI4B 4JRQA 4CFBA 2BANA 1T7PA 4KHYA 1VK0A 4FYDA 4DSKA 1FKPA 2RF2A 3NFAA 4FJHA 2HHXA 3ZSXA 4Z4HA 2YHAA 1EXQA 2DTUA 3AVFA 4F2SA 3AVLA 3AVNA 1GOBA 3ZSWA 3ALYA 4I9LA 3U3GA 4AHVA 3PO5A 1WSFA 4Z4CA 3H08A 3SUPA 2OYQA 4WE1A 1S6QA 1HQUA 4KHQA 1XHZA 1QE1A 4BDPA 3QESA 2HB5A 3HVTA 3AVCA 3TAFA 4IG3A 4DSEA 1TVRA 4BWJA 1EX4A 3I0SA 4AHTA 2XY6A 4H4MA 1ASWA 3QEIA 4HCBA 4CJKA 1WSEA 2FBVA 1ITGA 4DS5A 2X74A 3BDPA 3MXIA 2BE2A 3AA3A 4RG8A 1J54A 2RPIA 1NK7A 1HYSA 4CGHA 1EP4A 3CM5A 3D0PA 2G8WA 3VQ5A 1ASUA 4KHUA 1J5OA 4O0JA 2IC3A 4AHUA 3KK3A 3SUQA 4GVMA 4CE9A 1D8YA 2IOCA 3EY1A 4DTMA 1KFSA 4FK2A 1QHTA 4KHSA 2KTQA 1JLGA 3SCXA 3OYDA 4AILC 4EZ6A 3LP0A 4CJPA 2A1SA 3PUFA 1U45A 1NOZA 4KPYA 3HO1A 2Z1IA 5E41A 4ELUA 5D3GA 4CJQA 4FLXA 4AHCA 3V9WA 1BIUA 4ELVA 3KK1A 3OYJA 1RCHA 1RT5A 3KLFA 4KB1A 4N47A 5J2MA 4E7HA 3S3NA 4R5PA 1KVCA 2OPSA 4FLWA 3RR8A 4CIFA 3D45A 4W5TA 3PX6A 4KREA 3K5MA 2YHBA 2Z1HA 4GMJB 4UQGA 1T05A 4LSLA 4W5QA 4CJLA 4HUGA 4DLEA 4EP5A 4AHRA 4CFAA 3QNOA 3JYTA 2XY5A 4FJ9A 4DTXA 2FC0A 5SZTA 5DK5A 1KCFA 4RW8A 1WSIA 3MXJA 4FJXA 1KVAA 4JLHA 4LY7A 4KAZA 4OJRA 3V1QA 4Z4FA 2GV9A 3C6TA 2XO7A 3AA2A 1UA0A 3TAQA 3KLEA 4NYNA 4DF8A 5HROA 4KFBA 1VRUA 1CZBA 4M45A 3OYEA 4Z4IA 4CF0A 4O4GA 3CYMA 3WNFA 4CJEA 4E1NA 3KLHA 3QETA 2G8KA 4KHNA 1ZBHA 3L2UA 3NGYA 2D0CA 5KI6A 5J2QA 4E7IA 3NF7A 4M42A 4DQSA 1WSJA 1CLQA 1IKXA 4RW7A 1TKXA 4QOZB 3HPGA 4FJGA 2Y1JA 1JL1A 1TAQA 2HMIA 3NF8A 4E7JA 4DWIA 3I8DA 4NCAA 2YV0X 3MECA 2R7YA 4PQUA 4J2BA 5C42A 3HT3A 4FJJA 4IFYA 3SQ0A 4M3XA 4CK2A 1KRPA 3HYFA 3LPUA 4CEOA 2DY4A 3DRRA 3OS1A 3WNHA 1SL2A 1JXEA 4IG0A 1DTQA 4CEQA 2D5RA 4OPKA 1KLNA 4CIEA 4CK3A 1NJZA 3OYLA 1WSGA 5HRNA 4Y1CA 3G0ZA 4DLGA 2HVHA 4HVJA 1NK0A 2EHGA 3AVHA 3AV9A 3ASMA 3DMJA 4ID1A 1WSHA 1YT3A 5J2PA 3SI6A 2G8IA 3V4IA 3QEVA 2KQ2A 1O1WA 2VWKA 3L2WA 4F2RA 1C1BA 3T1AA 3RWUA 4KI6A 4FLVA 4CECA 1WN7A 1YVUA 2FBTA 3ITHA 3AVBA 4DTUA 3VA0A 1IKWA 3QIOA 3PO4A 4FLUA 1TKDA 5C25A 4Z4GA 1IKVA 3DYAA 1VSIA 3KLIA 1LW0A 1L3SA 4CEAA 4CGIA 4M41A 1BISA 2P5GA 4DU1A 4AH9A 1QSSA 1RT1A 5KTQA 3SYZA 1S1TA 3NH1A 3VQPA 4CERA 3O3GA 4CCHA 4E3SA 3O4QA 4FVMA 4PA1A 4O0IA 1RTIA 4GW6A 1S1VA 5HRPA 2ZE2A 1XI1A 4YFUA 3OY9A 3AO3A 3S9HA 4Z4EA 4LSNA 4ZTJA 3OYCA 2OPPA 3OYGA 1VSLA 2ITGA 2GUIA 3AVGA 3VQEA 2PYJA 3KD5E 4J2EA 4FK0A 2P1JA 4DSFA 1B9FA 5JS2A 3RR7A 5I42A 4TSXA 2VWJA 3SPZA 1A5WA 1C1CA 1SUQA 4EZ9A 1LWCA 5FRMA 3LP1A 1RILA 1NKCA 2A1RA 1YTAA 1RTHA 2VG5A 2HVIA 3V1RA 3UIQA 4CFCA 3AVJA 4W5OA 1EETA 1HPZA 2VG7A 3V9UA 3OYNA 1GOCA 2B6AA 1XWLA 1TL3A 3V81A 1FK9A 3C95A 2HNYA
chains in the Genus database with same CATH superfamily
3LWLA 3D7EO 4E89A 2RHKA 3AVIA 3ZSVA 3IRXA 3V1OA 3GL1A 5AQVA 1IKYA 3VETA 3L2RA 1GLLO 3PSFA 1VSDA 1JCGA 5JLFA 2E1YA 3CPEA 3WEEA 5EXWA 2E4LA 4IBNA 2P9PB 5CZ2A 3HK2A 3N4QA 3Q7CA 4ISFA 4QS7A 3CIPA 3QLHA 3DI6A 3SUOA 4FLZA 4PL8A 3VMFB 1VQ9N 4DR4K 4CHPA 4FZYA 1KTQA 2QWNA 4FOIA 4CESA 5AQMA 1QQCA 4YOXA 4ILGB 1BQMA 3TWHA 1RBRA 4WQ5C 4QCLA 3VF6A 3NF6A 5AQTA 4C1NI 1BA0A 1XUPO 4JKBA 2OCEA 4CD1A 4CEZA 4YDUA 1ZBUA 5BRDA 3K5NA 3QINA 3DXKA 3K5LA 4H03B 3TAGA 3F73A 1N6QA 4CJRA 3CPWM 2WONA 3SAGA 4FM0A 3O80A 3OS2A 1J53A 4BE0A 1LW2A 3ZX2A 1M90O 4CJ3A 3QBXA 1D9FA 3BZCA 5LMNK 2NRZA 1GLDG 1TK8A 3A2FA 4B9UA 1RT2A 3K59A 3G10A 1RBVA 3CXCM 3VA3A 3ZSQA 4CEFA 5FPMA 2HBMA 3J7ZO 1C0GA 3O1BA 1QVFM 3HJFA 4FVUA 3TAEA 3ZETB 1IBLK 4CHQA 2YJFA 3HPOA 2VCPA 3AA5X 2IAJA 3IMXA 4IFVA 4M3ZA 1GLBG 4B9NA 2HNZA 1HR0K 2BDPA 4Y1DA 1TL1A 4B1UB 4KTZA 3A5OC 2JWLA 5F0XA 4DB3A 4H4OA 1RT7A 2F8TA 3E9LA 4L3QA 3IUCA 4E7KA 1MWMA 2A5XA 4NCGA 1QHAA 2QWRA 1LWEA 4PHTX 1NJXA 4C8MA 4DQIA 3OW2M 1CXUA 2ZF5O 5DM6L 2VG6A 2UUBK 2E2NA 3O4WA 1X9MA 3TR8A 3QERA 3HI0A 2P51A 2NUBA 3VTHA 3E1YA 4LD0A 4JHDA 2RKIA 3L2VA 5AQWA 3AO2A 2XHBA 1YJWN 2X78A 4B3TK 2CGKA 5BPLA 2OA8A 4BQZA 3CQYA 4JI4K 2V52B 3EZ5A 4W5NA 3SQ1A 4DG1A 4CJTA 3VTIA 2QKKA 3SJJA 1SL1A 1UAXA 4CZKA 2QWOA 4DFPA 4GY2B 1KFDA 2WOMA 3L4QA 3L3UA 4HWIA 3JXUA 4FJ8A 3CJ1A 2O8CB 1NK9A 2ZD1A 3R6MA 2KW4A 3OYHA 2IVOA 5ADXA 3HRGA 4U7BA 5BRFA 1VQ5N 3SV4A 3F9MA 2W6LA 3IS9A 3NH0A 3U3YA 2UUCK 5EVZA 3KKSA 4YNQA 2ZGYA 3VQDA 1KD1O 1W9HA 4BR7A 4OVLA 3CCMN 1Z25A 3M6GA 1BU6O 3HSCA 4DTNA 2ETJA 5KQDA 3ZSZA 3VQ6A 3A0IX 2XY7A 2W41A 4MLHA 4LH5A 1Z26A 1ZBFA 2FF6A 4DQRA 3T1YK 3ZSOA 1J5EK 3O8MA 5JLHA 4DFMA 3JS6A 2QKBA 5H1SQ 3ULEA 4BRDA 4K0KK 2DPNA 3M5RA 4AM7A 4CZGA 1FW6A 3CETA 4B1ZA 2ZJRL 4DTRA 2V7ZA 5E26A 1RNHA 3PY8A 1JLBA 4CZIA 2F9WA 1R59O 1F21A 3ENOA 4E19A 1OH7A 4DS4A 5F2RA 2P9IB 5LMUK 2KKZA 1Q7YO 2KZZA 2I5JA 3LDNA 3PX4A 4WFNL 1NK5A 1FJGK 3VOVA 4B9SA 4X64K 4Q0BA 4BC3A 3HM8A 1XMOK 5LL6Z 1BGXT 4CF8A 3EE9A 3L0QA 3ZCMA 1NJYA 4BE1A 1RTJA 3C0BA 5EOYA 4A5AA 3NAEA 4E7LA 4IO9L 1LCUA 3DLBA 1VHXA 4RW6A 3MCPA 5CZ1A 4DMNA 4BRHA 1RT3A 1VSMA 2WUSA 3MEEA 3WNGA 4CJ5A 2P9LA 4JRQA 2BANA 3WXIA 1VK0A 2E88A 5AZJB 1TUYA 3NFAA 4Y0WA 3ZSXA 3WXLA 2YHAA 4H0OA 4HTLA 4B1YB 4JI0K 2O8EB 4I9LA 1U2VB 4AHVA 3PO5A 3MN9A 1NG9A 3EKUA 3H08A 2OYQA 2YCHA 4WE1A 1S6QA 1KQSM 3CC4N 4BDPA 4BRNA 1E3MA 1OH5A 4IG3A 1TVRA 4BWJA 5M1FA 4CJ7A 1X3NA 3H45C 2I7NA 1WSEA 4DS5A 1GLAG 2A40A 3AA3A 2RPIA 3OBWA 3N4PA 3CM5A 4ILHA 1YAGA 1ASUA 4AHUA 3SUQA 1RDWX 4GVMA 4KHSA 1D8YA 2KTQA 1JLGA 4JD2B 4EZ6A 2A1SA 3HO1A 3P39A 3THWB 3PLAA 1NGFA 1RCHA 3EKSA 2NRXA 4N47A 3VEOA 4CIFA 3D45A 5KPZA 2P9IA 2YHBA 3AGKA 2P9NA 2Z1HA 1IV0A 4DLEA 4CJLA 4KH4A 4FJ9A 2FC0A 3ENHA 5AQSA 1KXPA 4RWTA 1KVAA 4FJXA 5HOOA 4LY7A 3RVCA 4CBUA 1N33K 2GV9A 2XO7A 4DR7K 3AA2A 4CZEA 4BRMA 3CF5L 2QEXN 3ENBA 4CJEA 3KLHA 3F2KA 4EHTA 3L2UA 3NMUA 5AQPA 1YITN 4WQ4C 5KI6A 3D2EB 4BRGA 3NF7A 3WEEB 4RW7A 4QOZB 3HPGA 4FJGA 1TAQA 1HLUA 3KWIA 3HT3A 1NMNA 4FJJA 4IFYA 3LPUA 1SL2A 1JXEA 1DTQA 3LDQA 4CEQA 3FZHA 4CIEA 1NJZA 5HRNA 4DLGA 5KPTA 1NK0A 2EHGA 3AVHA 3ASMA 4PKIA 4DR5K 3V4IA 5AR0A 2KQ2A 5IWAK 1WN7A 4DTUA 1NGCA 1X9JA 1TKDA 5C25A 4DHYA 3CQXA 1HPMA 5LJWA 1NJIO 4M41A 1BISA 1LOTB 3SYZA 3VQPA 1S1VA 4YFUA 3AO3A 1O13A 4H5VA 2OPPA 3VQEA 2GUIA 4DSFA 1B9FA 5JS2A 5I42A 2VWJA 1Q18A 2ZJQL 5KQ8A 3K0SA 3QICA 4BRLA 1WUAA 1HPZA 4O8KA 3V9UA 4FWNA 2UXBK 3CCUN 1P8ZA 3SQ4A 1RTDA 4O5BA 3G6EN 5M1KA 1WNSA 1EKEA 1V4TA 3V9XA 4BRIA 4PWDA 5M1NA 1ESVA 3CCSN 2F96A 2E6MA 4JI2K 1SKWA 4K8XA 2YNFA 5C12A 3FGUA 4WYBA 1JL2A 3LDPA 1U48A 1BI4A 3EYZA 3ZLJA 4OPAA 3IAYA 3MXMA 3SAFA 4DV0K 3ZYYX 5HRSA 1IO2A 2CGJA 1FKOA 3VQ7A 1NGIA 3NHGA 3THXA 3TANA 2A6AA 1G99A 3OVNA 3CMEN 2Q36A 1ZC6A 3H3OB 1E4FT 4LH4A 3GOIA 4FLTA 4NLBA 1VSHA 3ZSYA 1KAYA 4R79A 2HF4A 3MCAB 4GV6A 2D0AA 3VPZA 1NGGA 3F9KA 3R1XA 5FRNA 1DGKN 3AA4A 3U8XA 1NLVA 1NKEA 2W40A 3H1VX 2PYLA 3OHRA 4G9ZA 1S1WA 1S6PA 2W6KA 3VQAA 3L8BA 2IGIA 3D2FB 3OYFA 4JD2A 1NBWA 5TKYA 1NK6A 4ZHRA 4FM2A 4MQ3A 4JRPA 2Q2RA 4ELTA 2W42A 1JLAA 4HTUA 2IVPA 1S9EA 1GOAA 5ADXH 3LZJA 1U04A 1RDUA 3DOKA 2FSJA 4FJMA 4ZTFA 1VSFA 1BWFO 3DLEA 2O8CA 4I2PA 4OO1J 1NWKA 3V9ZA 1N5YA 4FSVA 3R9PA 1D4XA 3HM9A 3CCEN 2LSNA 1JLQA 2WTUA 4BWMA 3OJSA 4H5RA 5GAHP 4KBOA 5J1EA 4FLYA 3DRPA 5KGWA 4E0DA 5BPNA 3EL2A 3TABA 4M3RA 1QTMA 3J7YP 2YHWA 4DSJA 1Y97A 5F1XA 3K9JA 5AFUH 4C8NA 2GEMA 2UUAK 2E1ZA 3RSEA 3C6HA 3UB5A 4DFKA 2O8EA 4HUFA 3C7NB 4CEDA 1VQ6N 2DFHA 3SUNA 1N8RO 4JK7A 4DV7K 1HQEA 1J9AA 4HCCA 2JWKA 1XNRK 5AZIA 3OYAA 3DLGA 1VQ7N 4H0PA 4OX9K 3ZT1A 4CZJA 3HXMA 2D1KA 5BPMA 5KRSA 3AVKA 4KKOA 3HPHA 5KGXA 4DR3K 1YXQA 4H0XB 3L4IA 1IH7A 3H46O 4K8ZA 4AM6A 2HHTA 4F3OA 4GV9A 1HKCA 3ZT4A 3FLCO 3MN6A 5T7BA 4B3SK 5HBMA 4CJSA 4FJKA 5CYQA 3GBTA 3O6WA 2ATQA 4E1JA 5K14A 1SKSA 1G15A 3ULDA 1HYVA 3DXKB 3F5TA 3JSMA 4JKGB 2GBZA 3VQBA 4LF5K 2P9KA 4NYFA 3SNNA 4WQ4A 4CI6A 4CHYA 4FM1A 3QFPA 4CBWA 4JI3K 3WXKA 4Z0UA 2CH6A 2Q0UA 3SPYA 4I2QA 4FJIA 3NE6A 2ASPA 1HKBA 4PKHA 2G8UA 1TUUA 4M7XA 3SMSA 3OYIA 5AQUA 2B4JA 3O08A 3QEXA 4ICLA 1S72N 2ASOA 2PY5A 3KJVA 4CF9A 3RRHA 2YJEA 3AVAA 1U47A 1A5VA 3M3ZA 2G8FA 4JI7K 1VQPN 2O8BB 1CXQA 4H8KA 4B1WB 1RBSA 5GIOA 4A62A 1NGHA 3KLGA 3QO9A 3RMBA 3RSEB 3EO3A 5BR9A 4KI4A 4M3TA 2QI2A 3AAQA 4CF2A 4KV8A 3QEPA 1JLEA 3CQ8A 2F9TA 4OLBA 4E1MA 1QSLA 2PZSA 3KTQA 1X3MA 4CJWA 1LAVA 2IDOA 4DTSA 1S22A 1T8EA 3K58A 1C0MA 4XH5A 4N76A 3ZX3A 4N56A 3CMAN 4C1NK 2V7YA 2ZJPL 2HHUA 1BHLA 2A41A 3LL3A 1QSYA 3FFKB 2KFNA 3SMPA 1XC9A 5J2NA 1UWBA 3O4NA 4FPBA 3RMCA 2KLAA 3LP3A 4FPAA 1KC8O 1SV5A 4J2AA 3EZWA 5CR4A 4NCBA 3M8SA 1ZXOA 3A5NC 5C0YA 4CJFA 4AHSA 4BRAA 4LF8K 3LAKA 3SQ2A 3HSTB 4DQQA 1WAJA 3I56N 3NGZA 3TAPA 2NRVA 1LV5A 1X1PA 3T19A 4BG8A 5BREA 4JYAK 4CD3A 3KZBA 3AO5A 3TAMA 4I6MA 1J6ZA 1HYZA 1P90A 1R0AA 4V19S 3NBPA 4JV5K 4HHTA 4CGJA 3L2QA 1YF5L 4DSLA 4X66K 3S3MA 1VSJA 5GAGP 3VERA 3MWPA 1T7PA 4KHYA 3HOSA 4YOUA 1Q81O 4FJHA 4PKGA 4F2SA 3AVLA 3CCJN 3ALYA 3IDHA 2VQFK 2YHXA 1HQUA 5AQYA 3CHWA 4UY8O 3HVTA 3TAFA 3I0SA 3QEIA 1ITGA 1RFQA 5AQFA 4BRFA 4FWOA 4RG8A 1NK7A 1J54A 1JJ2M 2QWPA 1JCEA 2NZTA 1HYSA 1EP4A 2G8WA 5M1QA 2IC3A 4FYDA 4CE9A 2IOCA 4DTMA 1NGDA 1QHTA 3GDQA 3SCXA 1QQOA 4BC5A 4BR4A 3PUFA 5M1PA 3JAMO 1NOZA 1NNEA 1VQMN 4ELUA 4CJQA 3MDQA 3V9WA 1BIUA 4ELVA 3FE1A 3KK1A 3G25A 3L6QA 1RT5A 3OYJA 3LM2A 3BP8A 4E7HA 3S3NA 1OVQA 4R5PA 1W7AA 5AQHA 3PX6A 1HJOA 5AQQA 2FF3B 1T6DA 3CJBA 1N32K 3WT0A 4HUGA 4CFAA 4BC4A 5DK5A 1KCFA 4RW8A 1YVNA 4JLHA 1XNQK 2E2OA 3U9ZA 4OJRA 3V1QA 3C6TA 3SBTA 1BUPA 4KFBA 4CF0A 3WNFA 3QETA 2G8KA 1ZBHA 3HOTA 2QWQA 4KHNA 1T6CA 3TPQA 4WFAL 5I9EB 2D0CA 4JI6K 4E7IA 3SJHA 1TKXA 1JL1A 2HMIA 4DWIA 3I8DA 4J2BA 5GINA 1TYQA 4CK2A 1KRPA 4GV3A 3HYFA 3J7AP 1OH8A 3DRRA 5FPNA 3OS1A 3WNHA 2OTLN 4C23A 3MX2A 3VF2A 3ID6A 3G0ZA 5AZIB 3DJCA 4DR2K 4HVJA 3DMJA 4ID1A 3AV9A 2G8IA 3QEVA 1O1WA 5C2DA 3T1AA 4KI6A 4FLVA 4CECA 2PFUA 1YVUA 3OA9A 3AVBA 2HSTA 3PO4A 4NXMK 4MDAA 3DLLL 3KLIA 2QM1A 4DU1A 4ISEA 2P9SB 3U9DA 4CERA 4E3SA 2A3ZA 3O4QA 1K8AO 4O0IA 5HRPA 2ZE2A 4BREA 3BF3A 3OY9A 3S9HA 4Z4EA 1VSLA 2ITGA 2D0OA 2P1JA 1I94K 1DEJA 3RR7A 2P9KB 5JMVA 4H5NA 4IEEA 3SPZA 1A5WA 1SUQA 2ZM6K 5FRMA 1RTHA 3ZEUB 3UIQA 3CCLN 2IIRA 4CFCA 1EETA 3IFRA 1GOCA 1XWLA 1TL3A 3QMLA 1FK9A 1GLFO 4IKFA 2QWLA 2QXFA 4FOEA 4DFJA 2O8DB 3RMDA 4BY9C 1C0FA 3CJAA 1L3TA 1OVYA 3HVRA 3ATVA 1WLJA 2GWKA 4BRQA 5A2QO 1L3UA 2I7PA 2XRIA 4OKKA 4FCYA 4HCBA 1B9DA 1S1XA 3LANA 4IOCL 2NRWA 1M1KO 2NRHA 4DTOA 4YOVA 4F8RA 1S9GA 3I8BA 4CJVA 4CZLA 2QWMA 2NLXA 4HUEA 3AVMA 4LF4K 3CFRA 4DUZK 3MX5A 1BDGA 4ISGA 1UA1A 3DOLA 1U2VA 4M7YA 3C6UA 3B6PA 3ZX0A 3LAMA 3LP2A 5B8HA 4PL7A 1EWRA 4OPHA 1NK8A 3UE5A 3SBGA 2AJQA 4CJUA 3E01A 5C24A 3LDLA 4OKEA 4QAGA 1RGIA 5LJVA 4DV4K 2E2PA 4WFBL 2WFBA 4IJNA 3HP9A 1I39A 3OJUA 1NKBA 3G4SN 1KAXA 1HUXA 2PBDA 5GAEP 1VSKA 1JLCA 4DTJA 3KVGA 3HBTA 3FZFA 3KK2A 2YKMA 4B8CA 1DLOA 4DQPA 3VEZA 2O8FB 1KSPA 4LF6K 3VQ4A 5JVHL 1TK0A 2P9NB 1TV6A 3HTVA 1DTTA 1S1UA 4M3YA 3A5LC 3CM6A 4DF4A 2BH1A 3SLCA 2F8SA 3AGRA 2H3GX 5AJ3K 1VQON 4B9QA 3VQCA 2BGGA 3K57A 1CZ9A 2E6LA 3CCVN 4F3TA 2O4IA 4QS8A 1S3XA 3E66A 2O8DA 1KVBA 3HL8A 4WF9L 1ZYQA 5FPDA 4DV1K 2O8BA 3TU5A 4QS9A 1BOTO 4KRFA 4JS4A 4KO0A 2NNWA 2Q97A 5BRHA 1Q9XA 4CGFA 4JKFA 3TSQA 5BN9A 3WNEA 4F4KA 5CYMA 2B5JA 1TYQB 4DV5K 4I7FA 3S3OA 3RMAA 1REVA 3AY9A 3VEYA 2YNIA 1X9SA 5AQGA 2JGUA 4LFCK 3NF9A 1HNXK 3ULEB 1XHXA 2YNGA 2GX9A 4C8LA 5BN8A 3QNNA 3RRGA 5C10A 2QTDA 1C0TA 3CC2N 5I3UA 1IBKK 4CHOA 2IS3A 4FZZA 3NH2A 1D9DA 1EWQA 2PAVA 1Q8IA 3MN5A 4DSIA 1VSEA 4GVEA 4BACA 3LALA 3THWA 3ISNC 5HL7L 2D0PA 4N41A 3BGRA 4DR1K 4FWRA 2QK9A 1BL3A 1SKRA 3AO1A 4BDYA 1YI2N 4IFEA 3TARA 2HHHK 3H1QA 4XIUA 3PIPL 4JKEA 1DT9A 4RTFD 1ATRA 4YHHK 4X62K 3TSUA 1KLMA 4DTPA 4FXDA 4BR0A 2WBNA 3KKRA 3VGMA 2Z1JA 1CZAN 1YJNN 1RDDA 4KB0A 4DV2K 4CZHA 5AZJA 1H1VA 3J8AA 4H0TB 3CJCA 1YJ9N 3M8RA 1LAWA 1IG8A 3GG4A 5KRTA 4FO0A 3QB0A 1S5JA 3OYMA 4CGDA 1RDBA 2IVNA 3VENA 3LM9A 3M8PA 3I55N 4C8KA 4GKJK 2Q3SA 1MA9B 3LDSA 1OH6A 2HBKA 1ATSA 1MDUB 4JKAA 1VQKN 1RBUA 1SL0A 3C7NA 1U4BA 2WC9A 2HHQA 2HBLA 4FJ5A 1HKGA 4FWKA 1WOQA 2Z1GA 3KD1E 2HNDA 4RCHA 4JAXA 2FSKA 4A57A 1YHQN 3VQQA 4W5RA 3SZ2A 1VQ4N 3D6RA 3NDKA 4I9QA 4PY5A 3CERA 3T69A 3PX0A 1WBDA 4B9MA 4KTQA 4CHNA 3V6DA 5GIPA 2XY8A 2ITMA 4B1VA 3SV3A 2HHSA 1OKJA 1VAZA 3HP6A 3W0LA 2QW9A 4FJLA 4PUOA 1X9WA 3IKMA 1T03A 2G8VA 1JCFA 1BIZA 3ZEUA 4L8RB 4CIGA 1ZBIA 2X6SA 4JKGA 3VQ8A 3MEDA 4A2BA 4OKJA 4NXNK 5HLFA 3P83D 1D5AA 3O3HA 2X6NA 4M3UA 1QZ6A 1TGOA 1QVGM 4CHZA 2OPRA 1HMVA 3K2PA 1A5XA 4FL9A 1TAUA 2HMPA 4XH4A 2OPQA 3O9UA 3DLRA 4EIAA 2O4GA 3DAWA 4IO8A 5JS1A 1QZ5A 1C0UA 4AQYK 4O44A 2E2QA 1BI4B 3NVMA 1NU0A 3LDOA 3OBYA 4FWLA 2HHXA 4Z4HA 3P38A 1EXQA 3AVFA 3AVNA 3THXB 4BC2A 4Z4CA 3SUPA 4KHPK 4KHQA 1QE1A 1WB9A 3QESA 2HB5A 3EE8A 1EX4A 4BR2A 1KAZA 3AAPA 2XY6A 3CD6N 4H4MA 1ASWA 2F4VK 3BDPA 5AQIA 3MXIA 1NGEA 2BE2A 3D0PA 1SZ2A 3VQ5A 3TTCA 4O0JA 3KK3A 1KFSA 3EY1A 1HNZK 1W97L 3UKUA 2YI1A 4X65K 4JI5K 1U45A 1SAZA 5D3GA 2P9UB 4A59A 4FLXA 4AHCA 5DM7L 1W2BM 1XMQK 4JKDA 4KB1A 2RE2A 2OPSA 3RR8A 4H0VB 3CJ7A 1T05A 4W5QA 4DV3K 4EP5A 4AHRA 3JYTA 2BUPA 3CJ9A 3VEVA 1EO1A 1WSIA 4BRPA 2UXDK 4BR9A 2GELA 1WBBA 4Z4FA 3WXJA 1UA0A 1K9MO 4IEIA 3KLEA 4NYNA 4DF8A 4LF7K 1VRUA 1CZBA 2BTFA 4M45A 3OYEA 4Z4IA 4E1NA 3I33A 4EFHA 4IOAL 3J80O 4M42A 4DQSA 1WSJA 2HF3A 2Y1JA 2FXUA 3NF8A 4GNIA 4E7JA 4NCAA 3VESA 3MECA 2R7YA 4PQUA 4BGAA 1IJJA 4CEOA 3BY5A 2UYTA 3GE1A 2J4RA 4CK3A 1WSGA 4Y1CA 4O8UA 4ILJA 2F7TA 1WSHA 1YT3A 3SI6A 5KPRA 1Z6RA 3MK6A 3L2WA 4F2RA 1C1BA 3BUZB 3R3LA 3BZKA 3ITHA 3QIOA 4MDBA 1IKVA 1VSIA 3WXMB 4DR6K 1LW0A 4H5TA 4U67L 4CGIA 2P5GA 1QSSA 3M1FA 5GADP 1S1TA 3QBWA 4B3RK 3O3GA 5FPEA 4CCHA 4FVMA 1V4SA 1XI1A 4IXCA 2VGNA 4LSNA 4ZTJA 5CE3A 1BO5O 3OYCA 3OYGA 3KD5E 1SQKA 4IZ9A 2PYJA 4FK0A 4J2EA 4AF1A 2YX6A 1NGJA 3SAHA 4TSXA 4O5FA 1K8KA 1RILA 1NKCA 2A1RA 2VG5A 5C15A 4YDUC 3AVJA 2VG7A 4M63C 3OYNA 1Q86O 3V81A 1U6ZA 2HNYA 1TKZA 4YOWA 1ASVA 1MU2A 4NO7A 1ZBSA 4CF1A 4CEBA 2OZSA 5TKWA 3E9OA 2D0BA 1VQNN 1SS6A 3EEQA 4RW9A 3ZSRA 4FJNA 1RT4A 4ID5A 1YIJN 1ILYA 3EN9A 3DLKA 4CBXA 3UKRB 2P9LB 4JS5A 2HHVA 1IG9A 2HOEA 1B92A 5SWMA 4JK8A 1MWKA 2G8HA 2YKNA 3ZT3A 2EWSA 2P5OA 4OLAA 1DKGD 3DXMA 3KHYA 1WAFA 3H6EA 3R8EA 1VQLN 4BRCA 3BEXA 1U49A 1NGAA 1Q9YA 1K6YA 4K25A 2E8AA 3PSIA 4O55A 4JI8K 4CZMA 1GLEG 4A5BA 3T3FA 1BCMA 1HNVA 2DFFA 3P1GA 4BE2A 3VEXA 3UKUB 3O5BA 3O9RA 3QEWA 3K5OA 4BDZA 3VEWA 2P9SA 3THVA 4CZFA 1XC3A 1LWFA 3LZIA 3NGIA 4DCHA 3CFPA 5LY3A 3DLHA 2KFZA 1JXBA 1IBMK 2OZMA 2QXLA 4CW7B 3OS0A 1RT6A 4KH6A 5HRRA 1HNWK 1NOYA 3CI5A 1NGBA 3MN7A 3NCIA 4FWPA 3O3FA 1YTUA 3W3DA 4B3OA 3VQ9A 4OGEA 5IT9O 1NK4A 1L5UA 1HRHA 1TKTA 2NRRA 2HW3A 3TTFA 4OPJA 2E5LK 1ZBLA 1Q82O 3DM2A 4FK4A 3B8AX 3FZKA 2RN2A 2ASMA 3M8QA 3HZ6A 4JI1K 4G1QA 3ATUA 2OANA 2JLEA 4K43A 4B9LA 3KWGA 1BQNA 4DQ8A 4A61A 3CFOA 4XEIA 3I0RA 1ATNA 3OYKA 4DKWA 3OTOK 3L3VA 5AQOA 1NM1A 4CGGA 2QA4N 1HJRA 3AO4A 5AQXA 3CC7N 1Y64A 3H3NO 1I3AA 5FROA 4B1XB 4MO4A 3MEGA 3KIOA 3TSPA 3V9SA 1NJWA 2UXCK 1TK5A 5DMRA 5AQKA 3RTVA 1GLCG 4YORA 3CCRN 4FZXC 5CY4A 4Q5VA 2P9UA 4IWVA 1QS4A 4IJAA 3ID8A 3THYB 4C8OA 3LPTA 4BVOA 4CEEA 1RBTA 3J81O 3LWMA 2FBYA 4JEPA 2UU9K 3VF4A 3MWTA 4MFBA 1BCOA 3CG7A 1RDAA 1K8KB 1FXXA 2HBJA 3FZLA 4BRKA 5FDLA 4J2DA 5FLXO 3ZT0A 1E4GT 3TI0A 4EP4A 4K41A 3Q7BA 4LFAK 4BR5A 4JKCA 1BG3A 3C94A 4WQ5A 4KTWA 2ZQBA 2DFEA 4JNEA 3U4LA 2FSNA 4KHWA 3OYBA 4OGCA 4J8FA 1HNIA 5EY4A 4FW2A 2GWJA 3FFIA 3CCQN 3P31A 3MMVA 2FLOA 3U6FA 2EX3A 3MAQA 2P9PA 3DXMB 3O9QA 3IG1A 3P5JA 2VWBA 1N36K 4CJ4A 4CK1A 3T1HK 4KH5A 4RW4A 1JKHA 4NLCA 5JICA 4B8AB 4EHUA 5BR8K 1C6VA 2YNHA 3VN5A 1JLFA 2Y1IA 2KZMA 1XQSC 1C1AA 3QIPA 3S41A 3DRSA 2Q31A 4M3WA 4DU4A 1GLJO 1VRTA 2VYPA 5EU7A 2FBXA 5ELZA 1Z05A 4N5SA 2Q0RA 4DU3A 3THYA 4B08A 2Q1NA 4IDHA 3PV8A 1L3VA 4IDKA 4FWSA 4B9VA 3VGLA 5HP1A 1UOCA 4B9TA 2ZWHA 4CFDA 3WUHA 1VQ8N 4YY3K 5E84A 2ZGZA 1W0HA 3D2EA 5C2FA 3B6OA 1RDCA 3ZETA 3ZT2A 4FJ7A 4JKHA 4DUYK 2VGMA 2HHWA 4FW1A 4BGBA 4CFBA 4YOYA 4DSKA 1FKPA 1T3VA 2RF2A 5AQNA 2DTUA 5AQJA 1GOBA 3ZSWA 1K73O 3C65A 3U3GA 1WSFA 2AP1A 1EQYA 3O9SA 2GUPA 1XHZA 2CGLA 2YHYA 3AVCA 4DSEA 4JK9A 4AHTA 4FWQA 4IOXA 3VGKA 4LC9B 4CJKA 2FBVA 4GKKK 4F9OA 2X74A 2V51B 4CGHA 5CHIA 4BQLA 4KHUA 1J5OA 1BA1A 4FK2A 4BG9A 2A42A 3OYDA 4AILC 3LP0A 4CJPA 3DWLA 2D4WA 2E20A 5M1OA 4KPYA 2Z1IA 3E9PA 5E41A 3A8YA 3KLFA 4JHDB 4MO5A 3G71N 5J2MA 3BF1A 1KVCA 4LFBK 4FLWA 4YOTA 3FR0A 4W5TA 4KREA 2O8FA 1QQNA 4H0YB 3K5MA 2CH5A 4GMJB 4UQGA 4LSLA 3QNOA 2XY5A 4EAHD 4DTXA 5SZTA 3MXJA 4JN4A 4KAZA 3FZMA 3TAQA 1QQMA 5HROA 4O4GA 3CYMA 2AA4A 3NGYA 3UKRA 5JVGL 5J2QA 3TTDA 3O9TA 4I6MB 1CLQA 2VQEK 1IKXA 3QDKA 2YV0X 5C42A 3WQTA 4M3XA 4DV6K 3SQ0A 1N34K 2OTJN 2DY4A 4BVPA 3QFUA 3PIOL 3K9KA 4IG0A 4WCEL 2D5RA 4OPKA 1KLNA 4K42A 3OYLA 5EX5A 5AQRA 2HVHA 3A5MC 4XH1A 1YUWA 5J2PA 2VWKA 4A2AA 5AQZA 3RWUA 4BROA 2FBTA 3VA0A 1IKWA 4B3MK 5AFUA 4FLUA 4Z4GA 3DYAA 3D2FA 3O1WA 1L3SA 4CEAA 4MLEA 1NMDA 3KK7A 3P4IA 4AH9A 3NVKA 1RT1A 5KTQA 3NH1A 3AARA 4Z94A 2GTDA 4PA1A 1RTIA 4GW6A 3WQUA 3AVGA 5AQLA 2KHOA 4H5WA 3T7ZA 1C1CA 4EZ9A 1LWCA 3LP1A 5MLCQ 4LF9K 3SK3A 1YTAA 1T44A 2HVIA 3V1RA 4W5OA 4FWMA 3C6AA 4NB4A 2B6AA 4CVNE 2NRTA 3C95A 1HX1A
chains in the Genus database with same CATH topology
3SQ4A 1RTDA 1TKZA 2QXFA 4O5BA 4IKFA 1ASVA 1MU2A 4DFJA 3LWLA 3RMDA 4CF1A 1WNSA 1EKEA 4E89A 3V9XA 4PWDA 3AVIA 4CEBA 2OZSA 3ZSVA 3IRXA 1L3TA 2D0BA 2F96A 3V1OA 2E6MA 3HVRA 1WLJA 4RW9A 1IKYA 3ZSRA 2XRIA 1RT4A 4OKKA 3L2RA 4FCYA 1SKWA 1B9DA 1L3UA 1S1XA 3LANA 4ID5A 4K8XA 2YNFA 3DLKA 1VSDA 1JL2A 1U48A 4DTOA 4F8RA 1BI4A 3EYZA 1S9GA 4CJVA 4JS5A 2HHVA 3IAYA 3MXMA 1IG9A 4HUEA 3AVMA 1B92A 2E4LA 5SWMA 4IBNA 3CFRA 5HRSA 2G8HA 2YKNA 3ZT3A 1IO2A 1UA1A 5CZ2A 1FKOA 3VQ7A 3DOLA 2P5OA 4OLAA 3NHGA 3TANA 3HK2A 3C6UA 3OVNA 3B6PA 1WAFA 3QLHA 3DI6A 3SUOA 4FLZA 4LH4A 3LAMA 4CHPA 4FLTA 4FZYA 1KTQA 3LP2A 1VSHA 3ZSYA 4CESA 1U49A 2D0AA 3F9KA 1QQCA 1Q9YA 5FRNA 1BQMA 1K6YA 1RBRA 3AA4A 3TWHA 4QCLA 4O55A 3NF6A 1NKEA 1NK8A 2PYLA 2AJQA 1S1WA 1S6PA 4CJUA 3E01A 5C24A 3VQAA 4OKEA 3L8BA 3T3FA 2IGIA 4QAGA 1BCMA 4CEZA 1HNVA 2DFFA 3P1GA 4BE2A 3OYFA 1ZBUA 3HP9A 3QEWA 1NK6A 1I39A 3OJUA 3K5OA 3K5NA 1NKBA 4BDZA 3QINA 4ZHRA 3K5LA 4FM2A 4MQ3A 3TAGA 3F73A 4JRPA 4CJRA 3THVA 1VSKA 1N6QA 1JLCA 4DTJA 4ELTA 2W42A 1JLAA 2WONA 1LWFA 4HTUA 3KK2A 2YKMA 1S9EA 3LZIA 1GOAA 4B8CA 4FM0A 1DLOA 3LZJA 1U04A 1J53A 3OS2A 3NGIA 3DOKA 4DQPA 1KSPA 4FJMA 3CFPA 4ZTFA 1VSFA 3VQ4A 4BE0A 1TK0A 1LW2A 3DLHA 1TV6A 1DTTA 1S1UA 2KFZA 1JXBA 4M3YA 3DLEA 4CJ3A 3CM6A 2OZMA 4DF4A 4I2PA 1D9FA 2F8SA 3OS0A 1RT6A 5HRRA 3V9ZA 1N5YA 1TK8A 1NOYA 3VQCA 3HM9A 3A2FA 4B9UA 2LSNA 1JLQA 1RT2A 3G10A 4BWMA 3NCIA 1RBVA 3K59A 3VA3A 3O3FA 3OJSA 1YTUA 2BGGA 3K57A 3ZSQA 1CZ9A 4CEFA 4B3OA 2E6LA 3VQ9A 5J1EA 4OGEA 4FLYA 1NK4A 1L5UA 3DRPA 5KGWA 4E0DA 3HJFA 3TAEA 4F3TA 2O4IA 3TABA 4M3RA 1HRHA 4CHQA 1TKTA 1QTMA 4FJNA 2HW3A 1KVBA 3HL8A 3HPOA 3AA5X 1ZYQA 4DSJA 4OPJA 1Y97A 2IAJA 1ZBLA 3DM2A 4C8NA 4FK4A 4IFVA 4KRFA 4JS4A 4KO0A 4B9NA 1Q9XA 4M3ZA 2HNZA 2RN2A 3M8QA 4CGFA 4G1QA 2BDPA 4Y1DA 1TL1A 3WNEA 2JLEA 4KTZA 4F4KA 4B9LA 5CYMA 2B5JA 1BQNA 4DFKA 4HUFA 4I7FA 3CFOA 3S3OA 4CEDA 4H4OA 3RMAA 1RT7A 2F8TA 2DFHA 3I0RA 3OYKA 3SUNA 1REVA 1HQEA 1J9AA 2YNIA 4E7KA 1X9SA 3L3VA 4HCCA 2JGUA 4CGGA 3DLGA 3NF9A 1HJRA 3OYAA 3AO4A 1XHXA 2YNGA 1I3AA 5FROA 4C8LA 3QNNA 3RRGA 3MEGA 1C0TA 3KIOA 4NCGA 3ZT1A 3HXMA 5I3UA 3V9SA 4CHOA 5KRSA 2IS3A 3AVKA 4KKOA 1LWEA 1NJWA 1TK5A 3HPHA 5KGXA 1NJXA 3NH2A 1D9DA 4FZZA 1Q8IA 5DMRA 4C8MA 4DQIA 1IH7A 3RTVA 4K8ZA 2HHTA 1CXUA 4DSIA 4F3OA 2VG6A 1X9MA 4FZXC 3TR8A 1VSEA 3QERA 5CY4A 3ZT4A 4Q5VA 4BACA 3LALA 2P51A 1QS4A 5T7BA 2NUBA 3ISNC 4LD0A 5HBMA 3L2VA 2RKIA 4CJSA 2XHBA 3AO2A 4C8OA 3LPTA 5CYQA 4CEEA 4FJKA 4N41A 2X78A 3BGRA 2ATQA 1RBTA 2OA8A 5K14A 3LWMA 2FBYA 1BL3A 1G15A 3EZ5A 1HYVA 3ULDA 1SKSA 3SQ1A 1SKRA 3JSMA 3AO1A 4W5NA 4BDYA 2GBZA 4MFBA 1BCOA 3VQBA 3TARA 3CG7A 4NYFA 3SNNA 4XIUA 4DG1A 4CJTA 1RDAA 3SJJA 1SL1A 2QKKA 1UAXA 1FXXA 4CHYA 4FM1A 4DFPA 1KFDA 2WOMA 5FDLA 4Z0UA 4J2DA 3L3UA 3SPYA 4I2QA 3ZT0A 4FJIA 4FJ8A 3NE6A 3TI0A 1KLMA 4DTPA 4FXDA 4EP4A 1NK9A 4KHWA 2ZD1A 3KKRA 2G8UA 2Z1JA 3C94A 2KW4A 3OYIA 1RDDA 3OYHA 2B4JA 4KTWA 2ZQBA 4KB0A 3SV4A 3QEXA 2DFEA 3IS9A 4ICLA 3NH0A 3U3YA 2PY5A 3KJVA 4CF9A 3M8RA 3KKSA 1LAWA 3OYBA 3RRHA 4OGCA 3AVAA 3VQDA 4YNQA 5KRTA 1A5VA 1U47A 1S5JA 3OYMA 4CGDA 1HNIA 1RDBA 1W9HA 4FW2A 4OVLA 2G8FA 1Z25A 3FFIA 3M8PA 4C8KA 2Q3SA 1CXQA 4H8KA 3LDSA 4DTNA 1RBSA 2ETJA 3KLGA 3QO9A 3ZSZA 3RMBA 3U6FA 3VQ6A 2EX3A 2XY7A 4KI4A 4M3TA 3MAQA 1RBUA 4LH5A 1Z26A 4CF2A 2QK9A 1ZBFA 4KV8A 4DQRA 3QEPA 1SL0A 1JLEA 3CQ8A 3ZSOA 1U4BA 3IG1A 3P5JA 2HHQA 4OLBA 4FJ5A 4CJ4A 4DFMA 4CK1A 4E1MA 1QSLA 2Z1GA 2PZSA 3KTQA 2QKBA 4CJWA 3KD1E 1LAVA 2HNDA 2IDOA 4RW4A 4DTSA 1JKHA 3VQQA 4B8AB 1T8EA 4W5RA 3K58A 1C0MA 3SZ2A 1C6VA 2YNHA 4N76A 3VN5A 4N56A 1JLFA 4DTRA 2Y1IA 2KZMA 1RNHA 1C1AA 3QIPA 3NDKA 3PY8A 4I9QA 1JLBA 4PY5A 1BHLA 3DRSA 2HHUA 3PX0A 4B9MA 4M3WA 1QSYA 4DU4A 1F21A 4CHNA 4KTQA 2KFNA 4E19A 1VRTA 5EU7A 2FBXA 4DS4A 3V6DA 1XC9A 2XY8A 4N5SA 3SV3A 2HHSA 2KZZA 5J2NA 2I5JA 1UWBA 3HP6A 3PX4A 4DU3A 3O4NA 3RMCA 1NK5A 3LP3A 4J2AA 4B08A 1SV5A 4B9SA 4FJLA 4PUOA 4NCBA 3M8SA 1X9WA 1T03A 2G8VA 3PV8A 4CJFA 4Q0BA 1BIZA 4L8RB 4AHSA 4CIGA 1ZBIA 2X6SA 1L3VA 4IDKA 3LAKA 3SQ2A 3VQ8A 3HSTB 3MEDA 4DQQA 4B9VA 4OKJA 1WAJA 4CF8A 1BGXT 5HLFA 3NGZA 3P83D 1D5AA 3O3HA 5HP1A 3TAPA 1UOCA 3ZCMA 4B9TA 2X6NA 4M3UA 1TGOA 1LV5A 1X1PA 4CHZA 4CFDA 3T19A 4BE1A 1RTJA 2OPRA 1NJYA 1HMVA 3AO5A 1A5XA 3K2PA 1TAUA 1W0HA 3NAEA 2OPQA 3TAMA 3DLRA 4E7LA 1HYZA 2O4GA 1R0AA 3B6OA 1RDCA 3NBPA 3DLBA 4HHTA 5JS1A 4CGJA 3L2QA 3ZT2A 1C0UA 4RW6A 4DSLA 4FJ7A 3S3MA 1VSJA 5CZ1A 4O44A 4DMNA 2HHWA 1RT3A 1VSMA 3MEEA 4FW1A 3WNGA 4CJ5A 1BI4B 4JRQA 4CFBA 2BANA 1T7PA 4KHYA 1VK0A 4FYDA 4DSKA 1FKPA 2RF2A 3NFAA 4FJHA 2HHXA 3ZSXA 4Z4HA 2YHAA 1EXQA 2DTUA 3AVFA 4F2SA 3AVLA 3AVNA 1GOBA 3ZSWA 3ALYA 4I9LA 3U3GA 4AHVA 3PO5A 1WSFA 4Z4CA 3H08A 3SUPA 2OYQA 4WE1A 1S6QA 1HQUA 4KHQA 1XHZA 1QE1A 4BDPA 3QESA 2HB5A 3HVTA 3AVCA 3TAFA 4IG3A 4DSEA 1TVRA 4BWJA 1EX4A 3I0SA 4AHTA 2XY6A 4H4MA 1ASWA 3QEIA 4HCBA 4CJKA 1WSEA 2FBVA 1ITGA 4DS5A 2X74A 3BDPA 3MXIA 2BE2A 3AA3A 4RG8A 1J54A 2RPIA 1NK7A 1HYSA 4CGHA 1EP4A 3CM5A 3D0PA 2G8WA 3VQ5A 1ASUA 4KHUA 1J5OA 4O0JA 2IC3A 4AHUA 3KK3A 3SUQA 4GVMA 4CE9A 1D8YA 2IOCA 3EY1A 4DTMA 1KFSA 4FK2A 1QHTA 4KHSA 2KTQA 1JLGA 3SCXA 3OYDA 4AILC 4EZ6A 3LP0A 4CJPA 2A1SA 3PUFA 1U45A 1NOZA 4KPYA 3HO1A 2Z1IA 5E41A 4ELUA 5D3GA 4CJQA 4FLXA 4AHCA 3V9WA 1BIUA 4ELVA 3KK1A 3OYJA 1RCHA 1RT5A 3KLFA 4KB1A 4N47A 5J2MA 4E7HA 3S3NA 4R5PA 1KVCA 2OPSA 4FLWA 3RR8A 4CIFA 3D45A 4W5TA 3PX6A 4KREA 3K5MA 2YHBA 2Z1HA 4GMJB 4UQGA 1T05A 4LSLA 4W5QA 4CJLA 4HUGA 4DLEA 4EP5A 4AHRA 4CFAA 3QNOA 3JYTA 2XY5A 4FJ9A 4DTXA 2FC0A 5SZTA 5DK5A 1KCFA 4RW8A 1WSIA 3MXJA 4FJXA 1KVAA 4JLHA 4LY7A 4KAZA 4OJRA 3V1QA 4Z4FA 2GV9A 3C6TA 2XO7A 3AA2A 1UA0A 3TAQA 3KLEA 4NYNA 4DF8A 5HROA 4KFBA 1VRUA 1CZBA 4M45A 3OYEA 4Z4IA 4CF0A 4O4GA 3CYMA 3WNFA 4CJEA 4E1NA 3KLHA 3QETA 2G8KA 4KHNA 1ZBHA 3L2UA 3NGYA 2D0CA 5KI6A 5J2QA 4E7IA 3NF7A 4M42A 4DQSA 1WSJA 1CLQA 1IKXA 4RW7A 1TKXA 4QOZB 3HPGA 4FJGA 2Y1JA 1JL1A 1TAQA 2HMIA 3NF8A 4E7JA 4DWIA 3I8DA 4NCAA 2YV0X 3MECA 2R7YA 4PQUA 4J2BA 5C42A 3HT3A 4FJJA 4IFYA 3SQ0A 4M3XA 4CK2A 1KRPA 3HYFA 3LPUA 4CEOA 2DY4A 3DRRA 3OS1A 3WNHA 1SL2A 1JXEA 4IG0A 1DTQA 4CEQA 2D5RA 4OPKA 1KLNA 4CIEA 4CK3A 1NJZA 3OYLA 1WSGA 5HRNA 4Y1CA 3G0ZA 4DLGA 2HVHA 4HVJA 1NK0A 2EHGA 3AVHA 3AV9A 3ASMA 3DMJA 4ID1A 1WSHA 1YT3A 5J2PA 3SI6A 2G8IA 3V4IA 3QEVA 2KQ2A 1O1WA 2VWKA 3L2WA 4F2RA 1C1BA 3T1AA 3RWUA 4KI6A 4FLVA 4CECA 1WN7A 1YVUA 2FBTA 3ITHA 3AVBA 4DTUA 3VA0A 1IKWA 3QIOA 3PO4A 4FLUA 1TKDA 5C25A 4Z4GA 1IKVA 3DYAA 1VSIA 3KLIA 1LW0A 1L3SA 4CEAA 4CGIA 4M41A 1BISA 2P5GA 4DU1A 4AH9A 1QSSA 1RT1A 5KTQA 3SYZA 1S1TA 3NH1A 3VQPA 4CERA 3O3GA 4CCHA 4E3SA 3O4QA 4FVMA 4PA1A 4O0IA 1RTIA 4GW6A 1S1VA 5HRPA 2ZE2A 1XI1A 4YFUA 3OY9A 3AO3A 3S9HA 4Z4EA 4LSNA 4ZTJA 3OYCA 2OPPA 3OYGA 1VSLA 2ITGA 2GUIA 3AVGA 3VQEA 2PYJA 3KD5E 4J2EA 4FK0A 2P1JA 4DSFA 1B9FA 5JS2A 3RR7A 5I42A 4TSXA 2VWJA 3SPZA 1A5WA 1C1CA 1SUQA 4EZ9A 1LWCA 5FRMA 3LP1A 1RILA 1NKCA 2A1RA 1YTAA 1RTHA 2VG5A 2HVIA 3V1RA 3UIQA 4CFCA 3AVJA 4W5OA 1EETA 1HPZA 2VG7A 3V9UA 3OYNA 1GOCA 2B6AA 1XWLA 1TL3A 3V81A 1FK9A 3C95A 2HNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ4 A;  1RTD A;  1TKZ A;  2QXF A;  4O5B A;  4IKF A;  1ASV A;  1MU2 A;  4DFJ A;  3LWL A;  3RMD A;  4CF1 A;  1WNS A;  1EKE A;  4E89 A;  3V9X A;  4PWD A;  3AVI A;  4CEB A;  2OZS A;  3ZSV A;  3IRX A;  1L3T A;  2D0B A;  2F96 A;  3V1O A;  2E6M A;  3HVR A;  1WLJ A;  4RW9 A;  1IKY A;  3ZSR A;  2XRI A;  1RT4 A;  4OKK A;  3L2R A;  4FCY A;  1SKW A;  1B9D A;  1L3U A;  1S1X A;  3LAN A;  4ID5 A;  4K8X A;  2YNF A;  3DLK A;  1VSD A;  1JL2 A;  1U48 A;  4DTO A;  4F8R A;  1BI4 A;  3EYZ A;  1S9G A;  4CJV A;  4JS5 A;  2HHV A;  3IAY A;  3MXM A;  1IG9 A;  4HUE A;  3AVM A;  1B92 A;  2E4L A;  5SWM A;  4IBN A;  3CFR A;  5HRS A;  2G8H A;  2YKN A;  3ZT3 A;  1IO2 A;  1UA1 A;  5CZ2 A;  1FKO A;  3VQ7 A;  3DOL A;  2P5O A;  4OLA A;  3NHG A;  3TAN A;  3HK2 A;  3C6U A;  3OVN A;  3B6P A;  1WAF A;  3QLH A;  3DI6 A;  3SUO A;  4FLZ A;  4LH4 A;  3LAM A;  4CHP A;  4FLT A;  4FZY A;  1KTQ A;  3LP2 A;  1VSH A;  3ZSY A;  4CES A;  1U49 A;  2D0A A;  3F9K A;  1QQC A;  1Q9Y A;  5FRN A;  1BQM A;  1K6Y A;  1RBR A;  3AA4 A;  3TWH A;  4QCL A;  4O55 A;  3NF6 A;  1NKE A;  1NK8 A;  2PYL A;  2AJQ A;  1S1W A;  1S6P A;  4CJU A;  3E01 A;  5C24 A;  3VQA A;  4OKE A;  3L8B A;  3T3F A;  2IGI A;  4QAG A;  1BCM A;  4CEZ A;  1HNV A;  2DFF A;  3P1G A;  4BE2 A;  3OYF A;  1ZBU A;  3HP9 A;  3QEW A;  1NK6 A;  1I39 A;  3OJU A;  3K5O A;  3K5N A;  1NKB A;  4BDZ A;  3QIN A;  4ZHR A;  3K5L A;  4FM2 A;  4MQ3 A;  3TAG A;  3F73 A;  4JRP A;  4CJR A;  3THV A;  1VSK A;  1N6Q A;  1JLC A;  4DTJ A;  4ELT A;  2W42 A;  1JLA A;  2WON A;  1LWF A;  4HTU A;  3KK2 A;  2YKM A;  1S9E A;  3LZI A;  1GOA A;  4B8C A;  4FM0 A;  1DLO A;  3LZJ A;  1U04 A;  1J53 A;  3OS2 A;  3NGI A;  3DOK A;  4DQP A;  1KSP A;  4FJM A;  3CFP A;  4ZTF A;  1VSF A;  3VQ4 A;  4BE0 A;  1TK0 A;  1LW2 A;  3DLH A;  1TV6 A;  1DTT A;  1S1U A;  2KFZ A;  1JXB A;  4M3Y A;  3DLE A;  4CJ3 A;  3CM6 A;  2OZM A;  4DF4 A;  4I2P A;  1D9F A;  2F8S A;  3OS0 A;  1RT6 A;  5HRR A;  3V9Z A;  1N5Y A;  1TK8 A;  1NOY A;  3VQC A;  3HM9 A;  3A2F A;  4B9U A;  2LSN A;  1JLQ A;  1RT2 A;  3G10 A;  4BWM A;  3NCI A;  1RBV A;  3K59 A;  3VA3 A;  3O3F A;  3OJS A;  1YTU A;  2BGG A;  3K57 A;  3ZSQ A;  1CZ9 A;  4CEF A;  4B3O A;  2E6L A;  3VQ9 A;  5J1E A;  4OGE A;  4FLY A;  1NK4 A;  1L5U A;  3DRP A;  5KGW A;  4E0D A;  3HJF A;  3TAE A;  4F3T A;  2O4I A;  3TAB A;  4M3R A;  1HRH A;  4CHQ A;  1TKT A;  1QTM A;  4FJN A;  2HW3 A;  1KVB A;  3HL8 A;  3HPO A;  3AA5 X;  1ZYQ A;  4DSJ A;  4OPJ A;  1Y97 A;  2IAJ A;  1ZBL A;  3DM2 A;  4C8N A;  4FK4 A;  4IFV A;  4KRF A;  4JS4 A;  4KO0 A;  4B9N A;  1Q9X A;  4M3Z A;  2HNZ A;  2RN2 A;  3M8Q A;  4CGF A;  4G1Q A;  2BDP A;  4Y1D A;  1TL1 A;  3WNE A;  2JLE A;  4KTZ A;  4F4K A;  4B9L A;  5CYM A;  2B5J A;  1BQN A;  4DFK A;  4HUF A;  4I7F A;  3CFO A;  3S3O A;  4CED A;  4H4O A;  3RMA A;  1RT7 A;  2F8T A;  2DFH A;  3I0R A;  3OYK A;  3SUN A;  1REV A;  1HQE A;  1J9A A;  2YNI A;  4E7K A;  1X9S A;  3L3V A;  4HCC A;  2JGU A;  4CGG A;  3DLG A;  3NF9 A;  1HJR A;  3OYA A;  3AO4 A;  1XHX A;  2YNG A;  1I3A A;  5FRO A;  4C8L A;  3QNN A;  3RRG A;  3MEG A;  1C0T A;  3KIO A;  4NCG A;  3ZT1 A;  3HXM A;  5I3U A;  3V9S A;  4CHO A;  5KRS A;  2IS3 A;  3AVK A;  4KKO A;  1LWE A;  1NJW A;  1TK5 A;  3HPH A;  5KGX A;  1NJX A;  3NH2 A;  1D9D A;  4FZZ A;  1Q8I A;  5DMR A;  4C8M A;  4DQI A;  1IH7 A;  3RTV A;  4K8Z A;  2HHT A;  1CXU A;  4DSI A;  4F3O A;  2VG6 A;  1X9M A;  4FZX C;  3TR8 A;  1VSE A;  3QER A;  5CY4 A;  3ZT4 A;  4Q5V A;  4BAC A;  3LAL A;  2P51 A;  1QS4 A;  5T7B A;  2NUB A;  3ISN C;  4LD0 A;  5HBM A;  3L2V A;  2RKI A;  4CJS A;  2XHB A;  3AO2 A;  4C8O A;  3LPT A;  5CYQ A;  4CEE A;  4FJK A;  4N41 A;  2X78 A;  3BGR A;  2ATQ A;  1RBT A;  2OA8 A;  5K14 A;  3LWM A;  2FBY A;  1BL3 A;  1G15 A;  3EZ5 A;  1HYV A;  3ULD A;  1SKS A;  3SQ1 A;  1SKR A;  3JSM A;  3AO1 A;  4W5N A;  4BDY A;  2GBZ A;  4MFB A;  1BCO A;  3VQB A;  3TAR A;  3CG7 A;  4NYF A;  3SNN A;  4XIU A;  4DG1 A;  4CJT A;  1RDA A;  3SJJ A;  1SL1 A;  2QKK A;  1UAX A;  1FXX A;  4CHY A;  4FM1 A;  4DFP A;  1KFD A;  2WOM A;  5FDL A;  4Z0U A;  4J2D A;  3L3U A;  3SPY A;  4I2Q A;  3ZT0 A;  4FJI A;  4FJ8 A;  3NE6 A;  3TI0 A;  1KLM A;  4DTP A;  4FXD A;  4EP4 A;  1NK9 A;  4KHW A;  2ZD1 A;  3KKR A;  2G8U A;  2Z1J A;  3C94 A;  2KW4 A;  3OYI A;  1RDD A;  3OYH A;  2B4J A;  4KTW A;  2ZQB A;  4KB0 A;  3SV4 A;  3QEX A;  2DFE A;  3IS9 A;  4ICL A;  3NH0 A;  3U3Y A;  2PY5 A;  3KJV A;  4CF9 A;  3M8R A;  3KKS A;  1LAW A;  3OYB A;  3RRH A;  4OGC A;  3AVA A;  3VQD A;  4YNQ A;  5KRT A;  1A5V A;  1U47 A;  1S5J A;  3OYM A;  4CGD A;  1HNI A;  1RDB A;  1W9H A;  4FW2 A;  4OVL A;  2G8F A;  1Z25 A;  3FFI A;  3M8P A;  4C8K A;  2Q3S A;  1CXQ A;  4H8K A;  3LDS A;  4DTN A;  1RBS A;  2ETJ A;  3KLG A;  3QO9 A;  3ZSZ A;  3RMB A;  3U6F A;  3VQ6 A;  2EX3 A;  2XY7 A;  4KI4 A;  4M3T A;  3MAQ A;  1RBU A;  4LH5 A;  1Z26 A;  4CF2 A;  2QK9 A;  1ZBF A;  4KV8 A;  4DQR A;  3QEP A;  1SL0 A;  1JLE A;  3CQ8 A;  3ZSO A;  1U4B A;  3IG1 A;  3P5J A;  2HHQ A;  4OLB A;  4FJ5 A;  4CJ4 A;  4DFM A;  4CK1 A;  4E1M A;  1QSL A;  2Z1G A;  2PZS A;  3KTQ A;  2QKB A;  4CJW A;  3KD1 E;  1LAV A;  2HND A;  2IDO A;  4RW4 A;  4DTS A;  1JKH A;  3VQQ A;  4B8A B;  1T8E A;  4W5R A;  3K58 A;  1C0M A;  3SZ2 A;  1C6V A;  2YNH A;  4N76 A;  3VN5 A;  4N56 A;  1JLF A;  4DTR A;  2Y1I A;  2KZM A;  1RNH A;  1C1A A;  3QIP A;  3NDK A;  3PY8 A;  4I9Q A;  1JLB A;  4PY5 A;  1BHL A;  3DRS A;  2HHU A;  3PX0 A;  4B9M A;  4M3W A;  1QSY A;  4DU4 A;  1F21 A;  4CHN A;  4KTQ A;  2KFN A;  4E19 A;  1VRT A;  5EU7 A;  2FBX A;  4DS4 A;  3V6D A;  1XC9 A;  2XY8 A;  4N5S A;  3SV3 A;  2HHS A;  2KZZ A;  5J2N A;  2I5J A;  1UWB A;  3HP6 A;  3PX4 A;  4DU3 A;  3O4N A;  3RMC A;  1NK5 A;  3LP3 A;  4J2A A;  4B08 A;  1SV5 A;  4B9S A;  4FJL A;  4PUO A;  4NCB A;  3M8S A;  1X9W A;  1T03 A;  2G8V A;  3PV8 A;  4CJF A;  4Q0B A;  1BIZ A;  4L8R B;  4AHS A;  4CIG A;  1ZBI A;  2X6S A;  1L3V A;  4IDK A;  3LAK A;  3SQ2 A;  3VQ8 A;  3HST B;  3MED A;  4DQQ A;  4B9V A;  4OKJ A;  1WAJ A;  4CF8 A;  1BGX T;  5HLF A;  3NGZ A;  3P83 D;  1D5A A;  3O3H A;  5HP1 A;  3TAP A;  1UOC A;  3ZCM A;  4B9T A;  2X6N A;  4M3U A;  1TGO A;  1LV5 A;  1X1P A;  4CHZ A;  4CFD A;  3T19 A;  4BE1 A;  1RTJ A;  2OPR A;  1NJY A;  1HMV A;  3AO5 A;  1A5X A;  3K2P A;  1TAU A;  1W0H A;  3NAE A;  2OPQ A;  3TAM A;  3DLR A;  4E7L A;  1HYZ A;  2O4G A;  1R0A A;  3B6O A;  1RDC A;  3NBP A;  3DLB A;  4HHT A;  5JS1 A;  4CGJ A;  3L2Q A;  3ZT2 A;  1C0U A;  4RW6 A;  4DSL A;  4FJ7 A;  3S3M A;  1VSJ A;  5CZ1 A;  4O44 A;  4DMN A;  2HHW A;  1RT3 A;  1VSM A;  3MEE A;  4FW1 A;  3WNG A;  4CJ5 A;  1BI4 B;  4JRQ A;  4CFB A;  2BAN A;  1T7P A;  4KHY A;  1VK0 A;  4FYD A;  4DSK A;  1FKP A;  2RF2 A;  3NFA A;  4FJH A;  2HHX A;  3ZSX A;  4Z4H A;  2YHA A;  1EXQ A;  2DTU A;  3AVF A;  4F2S A;  3AVL A;  3AVN A;  1GOB A;  3ZSW A;  3ALY A;  4I9L A;  3U3G A;  4AHV A;  3PO5 A;  1WSF A;  4Z4C A;  3H08 A;  3SUP A;  2OYQ A;  4WE1 A;  1S6Q A;  1HQU A;  4KHQ A;  1XHZ A;  1QE1 A;  4BDP A;  3QES A;  2HB5 A;  3HVT A;  3AVC A;  3TAF A;  4IG3 A;  4DSE A;  1TVR A;  4BWJ A;  1EX4 A;  3I0S A;  4AHT A;  2XY6 A;  4H4M A;  1ASW A;  3QEI A;  4HCB A;  4CJK A;  1WSE A;  2FBV A;  1ITG A;  4DS5 A;  2X74 A;  3BDP A;  3MXI A;  2BE2 A;  3AA3 A;  4RG8 A;  1J54 A;  2RPI A;  1NK7 A;  1HYS A;  4CGH A;  1EP4 A;  3CM5 A;  3D0P A;  2G8W A;  3VQ5 A;  1ASU A;  4KHU A;  1J5O A;  4O0J A;  2IC3 A;  4AHU A;  3KK3 A;  3SUQ A;  4GVM A;  4CE9 A;  1D8Y A;  2IOC A;  3EY1 A;  4DTM A;  1KFS A;  4FK2 A;  1QHT A;  4KHS A;  2KTQ A;  1JLG A;  3SCX A;  3OYD A;  4AIL C;  4EZ6 A;  3LP0 A;  4CJP A;  2A1S A;  3PUF A;  1U45 A;  1NOZ A;  4KPY A;  3HO1 A;  2Z1I A;  5E41 A;  4ELU A;  5D3G A;  4CJQ A;  4FLX A;  4AHC A;  3V9W A;  1BIU A;  4ELV A;  3KK1 A;  3OYJ A;  1RCH A;  1RT5 A;  3KLF A;  4KB1 A;  4N47 A;  5J2M A;  4E7H A;  3S3N A;  4R5P A;  1KVC A;  2OPS A;  4FLW A;  3RR8 A;  4CIF A;  3D45 A;  4W5T A;  3PX6 A;  4KRE A;  3K5M A;  2YHB A;  2Z1H A;  4GMJ B;  4UQG A;  1T05 A;  4LSL A;  4W5Q A;  4CJL A;  4HUG A;  4DLE A;  4EP5 A;  4AHR A;  4CFA A;  3QNO A;  3JYT A;  2XY5 A;  4FJ9 A;  4DTX A;  2FC0 A;  5SZT A;  5DK5 A;  1KCF A;  4RW8 A;  1WSI A;  3MXJ A;  4FJX A;  1KVA A;  4JLH A;  4LY7 A;  4KAZ A;  4OJR A;  3V1Q A;  4Z4F A;  2GV9 A;  3C6T A;  2XO7 A;  3AA2 A;  1UA0 A;  3TAQ A;  3KLE A;  4NYN A;  4DF8 A;  5HRO A;  4KFB A;  1VRU A;  1CZB A;  4M45 A;  3OYE A;  4Z4I A;  4CF0 A;  4O4G A;  3CYM A;  3WNF A;  4CJE A;  4E1N A;  3KLH A;  3QET A;  2G8K A;  4KHN A;  1ZBH A;  3L2U A;  3NGY A;  2D0C A;  5KI6 A;  5J2Q A;  4E7I A;  3NF7 A;  4M42 A;  4DQS A;  1WSJ A;  1CLQ A;  1IKX A;  4RW7 A;  1TKX A;  4QOZ B;  3HPG A;  4FJG A;  2Y1J A;  1JL1 A;  1TAQ A;  2HMI A;  3NF8 A;  4E7J A;  4DWI A;  3I8D A;  4NCA A;  2YV0 X;  3MEC A;  2R7Y A;  4PQU A;  4J2B A;  5C42 A;  3HT3 A;  4FJJ A;  4IFY A;  3SQ0 A;  4M3X A;  4CK2 A;  1KRP A;  3HYF A;  3LPU A;  4CEO A;  2DY4 A;  3DRR A;  3OS1 A;  3WNH A;  1SL2 A;  1JXE A;  4IG0 A;  1DTQ A;  4CEQ A;  2D5R A;  4OPK A;  1KLN A;  4CIE A;  4CK3 A;  1NJZ A;  3OYL A;  1WSG A;  5HRN A;  4Y1C A;  3G0Z A;  4DLG A;  2HVH A;  4HVJ A;  1NK0 A;  2EHG A;  3AVH A;  3AV9 A;  3ASM A;  3DMJ A;  4ID1 A;  1WSH A;  1YT3 A;  5J2P A;  3SI6 A;  2G8I A;  3V4I A;  3QEV A;  2KQ2 A;  1O1W A;  2VWK A;  3L2W A;  4F2R A;  1C1B A;  3T1A A;  3RWU A;  4KI6 A;  4FLV A;  4CEC A;  1WN7 A;  1YVU A;  2FBT A;  3ITH A;  3AVB A;  4DTU A;  3VA0 A;  1IKW A;  3QIO A;  3PO4 A;  4FLU A;  1TKD A;  5C25 A;  4Z4G A;  1IKV A;  3DYA A;  1VSI A;  3KLI A;  1LW0 A;  1L3S A;  4CEA A;  4CGI A;  4M41 A;  1BIS A;  2P5G A;  4DU1 A;  4AH9 A;  1QSS A;  1RT1 A;  5KTQ A;  3SYZ A;  1S1T A;  3NH1 A;  3VQP A;  4CER A;  3O3G A;  4CCH A;  4E3S A;  3O4Q A;  4FVM A;  4PA1 A;  4O0I A;  1RTI A;  4GW6 A;  1S1V A;  5HRP A;  2ZE2 A;  1XI1 A;  4YFU A;  3OY9 A;  3AO3 A;  3S9H A;  4Z4E A;  4LSN A;  4ZTJ A;  3OYC A;  2OPP A;  3OYG A;  1VSL A;  2ITG A;  2GUI A;  3AVG A;  3VQE A;  2PYJ A;  3KD5 E;  4J2E A;  4FK0 A;  2P1J A;  4DSF A;  1B9F A;  5JS2 A;  3RR7 A;  5I42 A;  4TSX A;  2VWJ A;  3SPZ A;  1A5W A;  1C1C A;  1SUQ A;  4EZ9 A;  1LWC A;  5FRM A;  3LP1 A;  1RIL A;  1NKC A;  2A1R A;  1YTA A;  1RTH A;  2VG5 A;  2HVI A;  3V1R A;  3UIQ A;  4CFC A;  3AVJ A;  4W5O A;  1EET A;  1HPZ A;  2VG7 A;  3V9U A;  3OYN A;  1GOC A;  2B6A A;  1XWL A;  1TL3 A;  3V81 A;  1FK9 A;  3C95 A;  2HNY A; 
#chains in the Genus database with same CATH topology
 3LWL A;  3D7E O;  4E89 A;  2RHK A;  3AVI A;  3ZSV A;  3IRX A;  3V1O A;  3GL1 A;  5AQV A;  1IKY A;  3VET A;  3L2R A;  1GLL O;  3PSF A;  1VSD A;  1JCG A;  5JLF A;  2E1Y A;  3CPE A;  3WEE A;  5EXW A;  2E4L A;  4IBN A;  2P9P B;  5CZ2 A;  3HK2 A;  3N4Q A;  3Q7C A;  4ISF A;  4QS7 A;  3CIP A;  3QLH A;  3DI6 A;  3SUO A;  4FLZ A;  4PL8 A;  3VMF B;  1VQ9 N;  4DR4 K;  4CHP A;  4FZY A;  1KTQ A;  2QWN A;  4FOI A;  4CES A;  5AQM A;  1QQC A;  4YOX A;  4ILG B;  1BQM A;  3TWH A;  1RBR A;  4WQ5 C;  4QCL A;  3VF6 A;  3NF6 A;  5AQT A;  4C1N I;  1BA0 A;  1XUP O;  4JKB A;  2OCE A;  4CD1 A;  4CEZ A;  4YDU A;  1ZBU A;  5BRD A;  3K5N A;  3QIN A;  3DXK A;  3K5L A;  4H03 B;  3TAG A;  3F73 A;  1N6Q A;  4CJR A;  3CPW M;  2WON A;  3SAG A;  4FM0 A;  3O80 A;  3OS2 A;  1J53 A;  4BE0 A;  1LW2 A;  3ZX2 A;  1M90 O;  4CJ3 A;  3QBX A;  1D9F A;  3BZC A;  5LMN K;  2NRZ A;  1GLD G;  1TK8 A;  3A2F A;  4B9U A;  1RT2 A;  3K59 A;  3G10 A;  1RBV A;  3CXC M;  3VA3 A;  3ZSQ A;  4CEF A;  5FPM A;  2HBM A;  3J7Z O;  1C0G A;  3O1B A;  1QVF M;  3HJF A;  4FVU A;  3TAE A;  3ZET B;  1IBL K;  4CHQ A;  2YJF A;  3HPO A;  2VCP A;  3AA5 X;  2IAJ A;  3IMX A;  4IFV A;  4M3Z A;  1GLB G;  4B9N A;  2HNZ A;  1HR0 K;  2BDP A;  4Y1D A;  1TL1 A;  4B1U B;  4KTZ A;  3A5O C;  2JWL A;  5F0X A;  4DB3 A;  4H4O A;  1RT7 A;  2F8T A;  3E9L A;  4L3Q A;  3IUC A;  4E7K A;  1MWM A;  2A5X A;  4NCG A;  1QHA A;  2QWR A;  1LWE A;  4PHT X;  1NJX A;  4C8M A;  4DQI A;  3OW2 M;  1CXU A;  2ZF5 O;  5DM6 L;  2VG6 A;  2UUB K;  2E2N A;  3O4W A;  1X9M A;  3TR8 A;  3QER A;  3HI0 A;  2P51 A;  2NUB A;  3VTH A;  3E1Y A;  4LD0 A;  4JHD A;  2RKI A;  3L2V A;  5AQW A;  3AO2 A;  2XHB A;  1YJW N;  2X78 A;  4B3T K;  2CGK A;  5BPL A;  2OA8 A;  4BQZ A;  3CQY A;  4JI4 K;  2V52 B;  3EZ5 A;  4W5N A;  3SQ1 A;  4DG1 A;  4CJT A;  3VTI A;  2QKK A;  3SJJ A;  1SL1 A;  1UAX A;  4CZK A;  2QWO A;  4DFP A;  4GY2 B;  1KFD A;  2WOM A;  3L4Q A;  3L3U A;  4HWI A;  3JXU A;  4FJ8 A;  3CJ1 A;  2O8C B;  1NK9 A;  2ZD1 A;  3R6M A;  2KW4 A;  3OYH A;  2IVO A;  5ADX A;  3HRG A;  4U7B A;  5BRF A;  1VQ5 N;  3SV4 A;  3F9M A;  2W6L A;  3IS9 A;  3NH0 A;  3U3Y A;  2UUC K;  5EVZ A;  3KKS A;  4YNQ A;  2ZGY A;  3VQD A;  1KD1 O;  1W9H A;  4BR7 A;  4OVL A;  3CCM N;  1Z25 A;  3M6G A;  1BU6 O;  3HSC A;  4DTN A;  2ETJ A;  5KQD A;  3ZSZ A;  3VQ6 A;  3A0I X;  2XY7 A;  2W41 A;  4MLH A;  4LH5 A;  1Z26 A;  1ZBF A;  2FF6 A;  4DQR A;  3T1Y K;  3ZSO A;  1J5E K;  3O8M A;  5JLH A;  4DFM A;  3JS6 A;  2QKB A;  5H1S Q;  3ULE A;  4BRD A;  4K0K K;  2DPN A;  3M5R A;  4AM7 A;  4CZG A;  1FW6 A;  3CET A;  4B1Z A;  2ZJR L;  4DTR A;  2V7Z A;  5E26 A;  1RNH A;  3PY8 A;  1JLB A;  4CZI A;  2F9W A;  1R59 O;  1F21 A;  3ENO A;  4E19 A;  1OH7 A;  4DS4 A;  5F2R A;  2P9I B;  5LMU K;  2KKZ A;  1Q7Y O;  2KZZ A;  2I5J A;  3LDN A;  3PX4 A;  4WFN L;  1NK5 A;  1FJG K;  3VOV A;  4B9S A;  4X64 K;  4Q0B A;  4BC3 A;  3HM8 A;  1XMO K;  5LL6 Z;  1BGX T;  4CF8 A;  3EE9 A;  3L0Q A;  3ZCM A;  1NJY A;  4BE1 A;  1RTJ A;  3C0B A;  5EOY A;  4A5A A;  3NAE A;  4E7L A;  4IO9 L;  1LCU A;  3DLB A;  1VHX A;  4RW6 A;  3MCP A;  5CZ1 A;  4DMN A;  4BRH A;  1RT3 A;  1VSM A;  2WUS A;  3MEE A;  3WNG A;  4CJ5 A;  2P9L A;  4JRQ A;  2BAN A;  3WXI A;  1VK0 A;  2E88 A;  5AZJ B;  1TUY A;  3NFA A;  4Y0W A;  3ZSX A;  3WXL A;  2YHA A;  4H0O A;  4HTL A;  4B1Y B;  4JI0 K;  2O8E B;  4I9L A;  1U2V B;  4AHV A;  3PO5 A;  3MN9 A;  1NG9 A;  3EKU A;  3H08 A;  2OYQ A;  2YCH A;  4WE1 A;  1S6Q A;  1KQS M;  3CC4 N;  4BDP A;  4BRN A;  1E3M A;  1OH5 A;  4IG3 A;  1TVR A;  4BWJ A;  5M1F A;  4CJ7 A;  1X3N A;  3H45 C;  2I7N A;  1WSE A;  4DS5 A;  1GLA G;  2A40 A;  3AA3 A;  2RPI A;  3OBW A;  3N4P A;  3CM5 A;  4ILH A;  1YAG A;  1ASU A;  4AHU A;  3SUQ A;  1RDW X;  4GVM A;  4KHS A;  1D8Y A;  2KTQ A;  1JLG A;  4JD2 B;  4EZ6 A;  2A1S A;  3HO1 A;  3P39 A;  3THW B;  3PLA A;  1NGF A;  1RCH A;  3EKS A;  2NRX A;  4N47 A;  3VEO A;  4CIF A;  3D45 A;  5KPZ A;  2P9I A;  2YHB A;  3AGK A;  2P9N A;  2Z1H A;  1IV0 A;  4DLE A;  4CJL A;  4KH4 A;  4FJ9 A;  2FC0 A;  3ENH A;  5AQS A;  1KXP A;  4RWT A;  1KVA A;  4FJX A;  5HOO A;  4LY7 A;  3RVC A;  4CBU A;  1N33 K;  2GV9 A;  2XO7 A;  4DR7 K;  3AA2 A;  4CZE A;  4BRM A;  3CF5 L;  2QEX N;  3ENB A;  4CJE A;  3KLH A;  3F2K A;  4EHT A;  3L2U A;  3NMU A;  5AQP A;  1YIT N;  4WQ4 C;  5KI6 A;  3D2E B;  4BRG A;  3NF7 A;  3WEE B;  4RW7 A;  4QOZ B;  3HPG A;  4FJG A;  1TAQ A;  1HLU A;  3KWI A;  3HT3 A;  1NMN A;  4FJJ A;  4IFY A;  3LPU A;  1SL2 A;  1JXE A;  1DTQ A;  3LDQ A;  4CEQ A;  3FZH A;  4CIE A;  1NJZ A;  5HRN A;  4DLG A;  5KPT A;  1NK0 A;  2EHG A;  3AVH A;  3ASM A;  4PKI A;  4DR5 K;  3V4I A;  5AR0 A;  2KQ2 A;  5IWA K;  1WN7 A;  4DTU A;  1NGC A;  1X9J A;  1TKD A;  5C25 A;  4DHY A;  3CQX A;  1HPM A;  5LJW A;  1NJI O;  4M41 A;  1BIS A;  1LOT B;  3SYZ A;  3VQP A;  1S1V A;  4YFU A;  3AO3 A;  1O13 A;  4H5V A;  2OPP A;  3VQE A;  2GUI A;  4DSF A;  1B9F A;  5JS2 A;  5I42 A;  2VWJ A;  1Q18 A;  2ZJQ L;  5KQ8 A;  3K0S A;  3QIC A;  4BRL A;  1WUA A;  1HPZ A;  4O8K A;  3V9U A;  4FWN A;  2UXB K;  3CCU N;  1P8Z A;  3SQ4 A;  1RTD A;  4O5B A;  3G6E N;  5M1K A;  1WNS A;  1EKE A;  1V4T A;  3V9X A;  4BRI A;  4PWD A;  5M1N A;  1ESV A;  3CCS N;  2F96 A;  2E6M A;  4JI2 K;  1SKW A;  4K8X A;  2YNF A;  5C12 A;  3FGU A;  4WYB A;  1JL2 A;  3LDP A;  1U48 A;  1BI4 A;  3EYZ A;  3ZLJ A;  4OPA A;  3IAY A;  3MXM A;  3SAF A;  4DV0 K;  3ZYY X;  5HRS A;  1IO2 A;  2CGJ A;  1FKO A;  3VQ7 A;  1NGI A;  3NHG A;  3THX A;  3TAN A;  2A6A A;  1G99 A;  3OVN A;  3CME N;  2Q36 A;  1ZC6 A;  3H3O B;  1E4F T;  4LH4 A;  3GOI A;  4FLT A;  4NLB A;  1VSH A;  3ZSY A;  1KAY A;  4R79 A;  2HF4 A;  3MCA B;  4GV6 A;  2D0A A;  3VPZ A;  1NGG A;  3F9K A;  3R1X A;  5FRN A;  1DGK N;  3AA4 A;  3U8X A;  1NLV A;  1NKE A;  2W40 A;  3H1V X;  2PYL A;  3OHR A;  4G9Z A;  1S1W A;  1S6P A;  2W6K A;  3VQA A;  3L8B A;  2IGI A;  3D2F B;  3OYF A;  4JD2 A;  1NBW A;  5TKY A;  1NK6 A;  4ZHR A;  4FM2 A;  4MQ3 A;  4JRP A;  2Q2R A;  4ELT A;  2W42 A;  1JLA A;  4HTU A;  2IVP A;  1S9E A;  1GOA A;  5ADX H;  3LZJ A;  1U04 A;  1RDU A;  3DOK A;  2FSJ A;  4FJM A;  4ZTF A;  1VSF A;  1BWF O;  3DLE A;  2O8C A;  4I2P A;  4OO1 J;  1NWK A;  3V9Z A;  1N5Y A;  4FSV A;  3R9P A;  1D4X A;  3HM9 A;  3CCE N;  2LSN A;  1JLQ A;  2WTU A;  4BWM A;  3OJS A;  4H5R A;  5GAH P;  4KBO A;  5J1E A;  4FLY A;  3DRP A;  5KGW A;  4E0D A;  5BPN A;  3EL2 A;  3TAB A;  4M3R A;  1QTM A;  3J7Y P;  2YHW A;  4DSJ A;  1Y97 A;  5F1X A;  3K9J A;  5AFU H;  4C8N A;  2GEM A;  2UUA K;  2E1Z A;  3RSE A;  3C6H A;  3UB5 A;  4DFK A;  2O8E A;  4HUF A;  3C7N B;  4CED A;  1VQ6 N;  2DFH A;  3SUN A;  1N8R O;  4JK7 A;  4DV7 K;  1HQE A;  1J9A A;  4HCC A;  2JWK A;  1XNR K;  5AZI A;  3OYA A;  3DLG A;  1VQ7 N;  4H0P A;  4OX9 K;  3ZT1 A;  4CZJ A;  3HXM A;  2D1K A;  5BPM A;  5KRS A;  3AVK A;  4KKO A;  3HPH A;  5KGX A;  4DR3 K;  1YXQ A;  4H0X B;  3L4I A;  1IH7 A;  3H46 O;  4K8Z A;  4AM6 A;  2HHT A;  4F3O A;  4GV9 A;  1HKC A;  3ZT4 A;  3FLC O;  3MN6 A;  5T7B A;  4B3S K;  5HBM A;  4CJS A;  4FJK A;  5CYQ A;  3GBT A;  3O6W A;  2ATQ A;  4E1J A;  5K14 A;  1SKS A;  1G15 A;  3ULD A;  1HYV A;  3DXK B;  3F5T A;  3JSM A;  4JKG B;  2GBZ A;  3VQB A;  4LF5 K;  2P9K A;  4NYF A;  3SNN A;  4WQ4 A;  4CI6 A;  4CHY A;  4FM1 A;  3QFP A;  4CBW A;  4JI3 K;  3WXK A;  4Z0U A;  2CH6 A;  2Q0U A;  3SPY A;  4I2Q A;  4FJI A;  3NE6 A;  2ASP A;  1HKB A;  4PKH A;  2G8U A;  1TUU A;  4M7X A;  3SMS A;  3OYI A;  5AQU A;  2B4J A;  3O08 A;  3QEX A;  4ICL A;  1S72 N;  2ASO A;  2PY5 A;  3KJV A;  4CF9 A;  3RRH A;  2YJE A;  3AVA A;  1U47 A;  1A5V A;  3M3Z A;  2G8F A;  4JI7 K;  1VQP N;  2O8B B;  1CXQ A;  4H8K A;  4B1W B;  1RBS A;  5GIO A;  4A62 A;  1NGH A;  3KLG A;  3QO9 A;  3RMB A;  3RSE B;  3EO3 A;  5BR9 A;  4KI4 A;  4M3T A;  2QI2 A;  3AAQ A;  4CF2 A;  4KV8 A;  3QEP A;  1JLE A;  3CQ8 A;  2F9T A;  4OLB A;  4E1M A;  1QSL A;  2PZS A;  3KTQ A;  1X3M A;  4CJW A;  1LAV A;  2IDO A;  4DTS A;  1S22 A;  1T8E A;  3K58 A;  1C0M A;  4XH5 A;  4N76 A;  3ZX3 A;  4N56 A;  3CMA N;  4C1N K;  2V7Y A;  2ZJP L;  2HHU A;  1BHL A;  2A41 A;  3LL3 A;  1QSY A;  3FFK B;  2KFN A;  3SMP A;  1XC9 A;  5J2N A;  1UWB A;  3O4N A;  4FPB A;  3RMC A;  2KLA A;  3LP3 A;  4FPA A;  1KC8 O;  1SV5 A;  4J2A A;  3EZW A;  5CR4 A;  4NCB A;  3M8S A;  1ZXO A;  3A5N C;  5C0Y A;  4CJF A;  4AHS A;  4BRA A;  4LF8 K;  3LAK A;  3SQ2 A;  3HST B;  4DQQ A;  1WAJ A;  3I56 N;  3NGZ A;  3TAP A;  2NRV A;  1LV5 A;  1X1P A;  3T19 A;  4BG8 A;  5BRE A;  4JYA K;  4CD3 A;  3KZB A;  3AO5 A;  3TAM A;  4I6M A;  1J6Z A;  1HYZ A;  1P90 A;  1R0A A;  4V19 S;  3NBP A;  4JV5 K;  4HHT A;  4CGJ A;  3L2Q A;  1YF5 L;  4DSL A;  4X66 K;  3S3M A;  1VSJ A;  5GAG P;  3VER A;  3MWP A;  1T7P A;  4KHY A;  3HOS A;  4YOU A;  1Q81 O;  4FJH A;  4PKG A;  4F2S A;  3AVL A;  3CCJ N;  3ALY A;  3IDH A;  2VQF K;  2YHX A;  1HQU A;  5AQY A;  3CHW A;  4UY8 O;  3HVT A;  3TAF A;  3I0S A;  3QEI A;  1ITG A;  1RFQ A;  5AQF A;  4BRF A;  4FWO A;  4RG8 A;  1NK7 A;  1J54 A;  1JJ2 M;  2QWP A;  1JCE A;  2NZT A;  1HYS A;  1EP4 A;  2G8W A;  5M1Q A;  2IC3 A;  4FYD A;  4CE9 A;  2IOC A;  4DTM A;  1NGD A;  1QHT A;  3GDQ A;  3SCX A;  1QQO A;  4BC5 A;  4BR4 A;  3PUF A;  5M1P A;  3JAM O;  1NOZ A;  1NNE A;  1VQM N;  4ELU A;  4CJQ A;  3MDQ A;  3V9W A;  1BIU A;  4ELV A;  3FE1 A;  3KK1 A;  3G25 A;  3L6Q A;  1RT5 A;  3OYJ A;  3LM2 A;  3BP8 A;  4E7H A;  3S3N A;  1OVQ A;  4R5P A;  1W7A A;  5AQH A;  3PX6 A;  1HJO A;  5AQQ A;  2FF3 B;  1T6D A;  3CJB A;  1N32 K;  3WT0 A;  4HUG A;  4CFA A;  4BC4 A;  5DK5 A;  1KCF A;  4RW8 A;  1YVN A;  4JLH A;  1XNQ K;  2E2O A;  3U9Z A;  4OJR A;  3V1Q A;  3C6T A;  3SBT A;  1BUP A;  4KFB A;  4CF0 A;  3WNF A;  3QET A;  2G8K A;  1ZBH A;  3HOT A;  2QWQ A;  4KHN A;  1T6C A;  3TPQ A;  4WFA L;  5I9E B;  2D0C A;  4JI6 K;  4E7I A;  3SJH A;  1TKX A;  1JL1 A;  2HMI A;  4DWI A;  3I8D A;  4J2B A;  5GIN A;  1TYQ A;  4CK2 A;  1KRP A;  4GV3 A;  3HYF A;  3J7A P;  1OH8 A;  3DRR A;  5FPN A;  3OS1 A;  3WNH A;  2OTL N;  4C23 A;  3MX2 A;  3VF2 A;  3ID6 A;  3G0Z A;  5AZI B;  3DJC A;  4DR2 K;  4HVJ A;  3DMJ A;  4ID1 A;  3AV9 A;  2G8I A;  3QEV A;  1O1W A;  5C2D A;  3T1A A;  4KI6 A;  4FLV A;  4CEC A;  2PFU A;  1YVU A;  3OA9 A;  3AVB A;  2HST A;  3PO4 A;  4NXM K;  4MDA A;  3DLL L;  3KLI A;  2QM1 A;  4DU1 A;  4ISE A;  2P9S B;  3U9D A;  4CER A;  4E3S A;  2A3Z A;  3O4Q A;  1K8A O;  4O0I A;  5HRP A;  2ZE2 A;  4BRE A;  3BF3 A;  3OY9 A;  3S9H A;  4Z4E A;  1VSL A;  2ITG A;  2D0O A;  2P1J A;  1I94 K;  1DEJ A;  3RR7 A;  2P9K B;  5JMV A;  4H5N A;  4IEE A;  3SPZ A;  1A5W A;  1SUQ A;  2ZM6 K;  5FRM A;  1RTH A;  3ZEU B;  3UIQ A;  3CCL N;  2IIR A;  4CFC A;  1EET A;  3IFR A;  1GOC A;  1XWL A;  1TL3 A;  3QML A;  1FK9 A;  1GLF O;  4IKF A;  2QWL A;  2QXF A;  4FOE A;  4DFJ A;  2O8D B;  3RMD A;  4BY9 C;  1C0F A;  3CJA A;  1L3T A;  1OVY A;  3HVR A;  3ATV A;  1WLJ A;  2GWK A;  4BRQ A;  5A2Q O;  1L3U A;  2I7P A;  2XRI A;  4OKK A;  4FCY A;  4HCB A;  1B9D A;  1S1X A;  3LAN A;  4IOC L;  2NRW A;  1M1K O;  2NRH A;  4DTO A;  4YOV A;  4F8R A;  1S9G A;  3I8B A;  4CJV A;  4CZL A;  2QWM A;  2NLX A;  4HUE A;  3AVM A;  4LF4 K;  3CFR A;  4DUZ K;  3MX5 A;  1BDG A;  4ISG A;  1UA1 A;  3DOL A;  1U2V A;  4M7Y A;  3C6U A;  3B6P A;  3ZX0 A;  3LAM A;  3LP2 A;  5B8H A;  4PL7 A;  1EWR A;  4OPH A;  1NK8 A;  3UE5 A;  3SBG A;  2AJQ A;  4CJU A;  3E01 A;  5C24 A;  3LDL A;  4OKE A;  4QAG A;  1RGI A;  5LJV A;  4DV4 K;  2E2P A;  4WFB L;  2WFB A;  4IJN A;  3HP9 A;  1I39 A;  3OJU A;  1NKB A;  3G4S N;  1KAX A;  1HUX A;  2PBD A;  5GAE P;  1VSK A;  1JLC A;  4DTJ A;  3KVG A;  3HBT A;  3FZF A;  3KK2 A;  2YKM A;  4B8C A;  1DLO A;  4DQP A;  3VEZ A;  2O8F B;  1KSP A;  4LF6 K;  3VQ4 A;  5JVH L;  1TK0 A;  2P9N B;  1TV6 A;  3HTV A;  1DTT A;  1S1U A;  4M3Y A;  3A5L C;  3CM6 A;  4DF4 A;  2BH1 A;  3SLC A;  2F8S A;  3AGR A;  2H3G X;  5AJ3 K;  1VQO N;  4B9Q A;  3VQC A;  2BGG A;  3K57 A;  1CZ9 A;  2E6L A;  3CCV N;  4F3T A;  2O4I A;  4QS8 A;  1S3X A;  3E66 A;  2O8D A;  1KVB A;  3HL8 A;  4WF9 L;  1ZYQ A;  5FPD A;  4DV1 K;  2O8B A;  3TU5 A;  4QS9 A;  1BOT O;  4KRF A;  4JS4 A;  4KO0 A;  2NNW A;  2Q97 A;  5BRH A;  1Q9X A;  4CGF A;  4JKF A;  3TSQ A;  5BN9 A;  3WNE A;  4F4K A;  5CYM A;  2B5J A;  1TYQ B;  4DV5 K;  4I7F A;  3S3O A;  3RMA A;  1REV A;  3AY9 A;  3VEY A;  2YNI A;  1X9S A;  5AQG A;  2JGU A;  4LFC K;  3NF9 A;  1HNX K;  3ULE B;  1XHX A;  2YNG A;  2GX9 A;  4C8L A;  5BN8 A;  3QNN A;  3RRG A;  5C10 A;  2QTD A;  1C0T A;  3CC2 N;  5I3U A;  1IBK K;  4CHO A;  2IS3 A;  4FZZ A;  3NH2 A;  1D9D A;  1EWQ A;  2PAV A;  1Q8I A;  3MN5 A;  4DSI A;  1VSE A;  4GVE A;  4BAC A;  3LAL A;  3THW A;  3ISN C;  5HL7 L;  2D0P A;  4N41 A;  3BGR A;  4DR1 K;  4FWR A;  2QK9 A;  1BL3 A;  1SKR A;  3AO1 A;  4BDY A;  1YI2 N;  4IFE A;  3TAR A;  2HHH K;  3H1Q A;  4XIU A;  3PIP L;  4JKE A;  1DT9 A;  4RTF D;  1ATR A;  4YHH K;  4X62 K;  3TSU A;  1KLM A;  4DTP A;  4FXD A;  4BR0 A;  2WBN A;  3KKR A;  3VGM A;  2Z1J A;  1CZA N;  1YJN N;  1RDD A;  4KB0 A;  4DV2 K;  4CZH A;  5AZJ A;  1H1V A;  3J8A A;  4H0T B;  3CJC A;  1YJ9 N;  3M8R A;  1LAW A;  1IG8 A;  3GG4 A;  5KRT A;  4FO0 A;  3QB0 A;  1S5J A;  3OYM A;  4CGD A;  1RDB A;  2IVN A;  3VEN A;  3LM9 A;  3M8P A;  3I55 N;  4C8K A;  4GKJ K;  2Q3S A;  1MA9 B;  3LDS A;  1OH6 A;  2HBK A;  1ATS A;  1MDU B;  4JKA A;  1VQK N;  1RBU A;  1SL0 A;  3C7N A;  1U4B A;  2WC9 A;  2HHQ A;  2HBL A;  4FJ5 A;  1HKG A;  4FWK A;  1WOQ A;  2Z1G A;  3KD1 E;  2HND A;  4RCH A;  4JAX A;  2FSK A;  4A57 A;  1YHQ N;  3VQQ A;  4W5R A;  3SZ2 A;  1VQ4 N;  3D6R A;  3NDK A;  4I9Q A;  4PY5 A;  3CER A;  3T69 A;  3PX0 A;  1WBD A;  4B9M A;  4KTQ A;  4CHN A;  3V6D A;  5GIP A;  2XY8 A;  2ITM A;  4B1V A;  3SV3 A;  2HHS A;  1OKJ A;  1VAZ A;  3HP6 A;  3W0L A;  2QW9 A;  4FJL A;  4PUO A;  1X9W A;  3IKM A;  1T03 A;  2G8V A;  1JCF A;  1BIZ A;  3ZEU A;  4L8R B;  4CIG A;  1ZBI A;  2X6S A;  4JKG A;  3VQ8 A;  3MED A;  4A2B A;  4OKJ A;  4NXN K;  5HLF A;  3P83 D;  1D5A A;  3O3H A;  2X6N A;  4M3U A;  1QZ6 A;  1TGO A;  1QVG M;  4CHZ A;  2OPR A;  1HMV A;  3K2P A;  1A5X A;  4FL9 A;  1TAU A;  2HMP A;  4XH4 A;  2OPQ A;  3O9U A;  3DLR A;  4EIA A;  2O4G A;  3DAW A;  4IO8 A;  5JS1 A;  1QZ5 A;  1C0U A;  4AQY K;  4O44 A;  2E2Q A;  1BI4 B;  3NVM A;  1NU0 A;  3LDO A;  3OBY A;  4FWL A;  2HHX A;  4Z4H A;  3P38 A;  1EXQ A;  3AVF A;  3AVN A;  3THX B;  4BC2 A;  4Z4C A;  3SUP A;  4KHP K;  4KHQ A;  1QE1 A;  1WB9 A;  3QES A;  2HB5 A;  3EE8 A;  1EX4 A;  4BR2 A;  1KAZ A;  3AAP A;  2XY6 A;  3CD6 N;  4H4M A;  1ASW A;  2F4V K;  3BDP A;  5AQI A;  3MXI A;  1NGE A;  2BE2 A;  3D0P A;  1SZ2 A;  3VQ5 A;  3TTC A;  4O0J A;  3KK3 A;  1KFS A;  3EY1 A;  1HNZ K;  1W97 L;  3UKU A;  2YI1 A;  4X65 K;  4JI5 K;  1U45 A;  1SAZ A;  5D3G A;  2P9U B;  4A59 A;  4FLX A;  4AHC A;  5DM7 L;  1W2B M;  1XMQ K;  4JKD A;  4KB1 A;  2RE2 A;  2OPS A;  3RR8 A;  4H0V B;  3CJ7 A;  1T05 A;  4W5Q A;  4DV3 K;  4EP5 A;  4AHR A;  3JYT A;  2BUP A;  3CJ9 A;  3VEV A;  1EO1 A;  1WSI A;  4BRP A;  2UXD K;  4BR9 A;  2GEL A;  1WBB A;  4Z4F A;  3WXJ A;  1UA0 A;  1K9M O;  4IEI A;  3KLE A;  4NYN A;  4DF8 A;  4LF7 K;  1VRU A;  1CZB A;  2BTF A;  4M45 A;  3OYE A;  4Z4I A;  4E1N A;  3I33 A;  4EFH A;  4IOA L;  3J80 O;  4M42 A;  4DQS A;  1WSJ A;  2HF3 A;  2Y1J A;  2FXU A;  3NF8 A;  4GNI A;  4E7J A;  4NCA A;  3VES A;  3MEC A;  2R7Y A;  4PQU A;  4BGA A;  1IJJ A;  4CEO A;  3BY5 A;  2UYT A;  3GE1 A;  2J4R A;  4CK3 A;  1WSG A;  4Y1C A;  4O8U A;  4ILJ A;  2F7T A;  1WSH A;  1YT3 A;  3SI6 A;  5KPR A;  1Z6R A;  3MK6 A;  3L2W A;  4F2R A;  1C1B A;  3BUZ B;  3R3L A;  3BZK A;  3ITH A;  3QIO A;  4MDB A;  1IKV A;  1VSI A;  3WXM B;  4DR6 K;  1LW0 A;  4H5T A;  4U67 L;  4CGI A;  2P5G A;  1QSS A;  3M1F A;  5GAD P;  1S1T A;  3QBW A;  4B3R K;  3O3G A;  5FPE A;  4CCH A;  4FVM A;  1V4S A;  1XI1 A;  4IXC A;  2VGN A;  4LSN A;  4ZTJ A;  5CE3 A;  1BO5 O;  3OYC A;  3OYG A;  3KD5 E;  1SQK A;  4IZ9 A;  2PYJ A;  4FK0 A;  4J2E A;  4AF1 A;  2YX6 A;  1NGJ A;  3SAH A;  4TSX A;  4O5F A;  1K8K A;  1RIL A;  1NKC A;  2A1R A;  2VG5 A;  5C15 A;  4YDU C;  3AVJ A;  2VG7 A;  4M63 C;  3OYN A;  1Q86 O;  3V81 A;  1U6Z A;  2HNY A;  1TKZ A;  4YOW A;  1ASV A;  1MU2 A;  4NO7 A;  1ZBS A;  4CF1 A;  4CEB A;  2OZS A;  5TKW A;  3E9O A;  2D0B A;  1VQN N;  1SS6 A;  3EEQ A;  4RW9 A;  3ZSR A;  4FJN A;  1RT4 A;  4ID5 A;  1YIJ N;  1ILY A;  3EN9 A;  3DLK A;  4CBX A;  3UKR B;  2P9L B;  4JS5 A;  2HHV A;  1IG9 A;  2HOE A;  1B92 A;  5SWM A;  4JK8 A;  1MWK A;  2G8H A;  2YKN A;  3ZT3 A;  2EWS A;  2P5O A;  4OLA A;  1DKG D;  3DXM A;  3KHY A;  1WAF A;  3H6E A;  3R8E A;  1VQL N;  4BRC A;  3BEX A;  1U49 A;  1NGA A;  1Q9Y A;  1K6Y A;  4K25 A;  2E8A A;  3PSI A;  4O55 A;  4JI8 K;  4CZM A;  1GLE G;  4A5B A;  3T3F A;  1BCM A;  1HNV A;  2DFF A;  3P1G A;  4BE2 A;  3VEX A;  3UKU B;  3O5B A;  3O9R A;  3QEW A;  3K5O A;  4BDZ A;  3VEW A;  2P9S A;  3THV A;  4CZF A;  1XC3 A;  1LWF A;  3LZI A;  3NGI A;  4DCH A;  3CFP A;  5LY3 A;  3DLH A;  2KFZ A;  1JXB A;  1IBM K;  2OZM A;  2QXL A;  4CW7 B;  3OS0 A;  1RT6 A;  4KH6 A;  5HRR A;  1HNW K;  1NOY A;  3CI5 A;  1NGB A;  3MN7 A;  3NCI A;  4FWP A;  3O3F A;  1YTU A;  3W3D A;  4B3O A;  3VQ9 A;  4OGE A;  5IT9 O;  1NK4 A;  1L5U A;  1HRH A;  1TKT A;  2NRR A;  2HW3 A;  3TTF A;  4OPJ A;  2E5L K;  1ZBL A;  1Q82 O;  3DM2 A;  4FK4 A;  3B8A X;  3FZK A;  2RN2 A;  2ASM A;  3M8Q A;  3HZ6 A;  4JI1 K;  4G1Q A;  3ATU A;  2OAN A;  2JLE A;  4K43 A;  4B9L A;  3KWG A;  1BQN A;  4DQ8 A;  4A61 A;  3CFO A;  4XEI A;  3I0R A;  1ATN A;  3OYK A;  4DKW A;  3OTO K;  3L3V A;  5AQO A;  1NM1 A;  4CGG A;  2QA4 N;  1HJR A;  3AO4 A;  5AQX A;  3CC7 N;  1Y64 A;  3H3N O;  1I3A A;  5FRO A;  4B1X B;  4MO4 A;  3MEG A;  3KIO A;  3TSP A;  3V9S A;  1NJW A;  2UXC K;  1TK5 A;  5DMR A;  5AQK A;  3RTV A;  1GLC G;  4YOR A;  3CCR N;  4FZX C;  5CY4 A;  4Q5V A;  2P9U A;  4IWV A;  1QS4 A;  4IJA A;  3ID8 A;  3THY B;  4C8O A;  3LPT A;  4BVO A;  4CEE A;  1RBT A;  3J81 O;  3LWM A;  2FBY A;  4JEP A;  2UU9 K;  3VF4 A;  3MWT A;  4MFB A;  1BCO A;  3CG7 A;  1RDA A;  1K8K B;  1FXX A;  2HBJ A;  3FZL A;  4BRK A;  5FDL A;  4J2D A;  5FLX O;  3ZT0 A;  1E4G T;  3TI0 A;  4EP4 A;  4K41 A;  3Q7B A;  4LFA K;  4BR5 A;  4JKC A;  1BG3 A;  3C94 A;  4WQ5 A;  4KTW A;  2ZQB A;  2DFE A;  4JNE A;  3U4L A;  2FSN A;  4KHW A;  3OYB A;  4OGC A;  4J8F A;  1HNI A;  5EY4 A;  4FW2 A;  2GWJ A;  3FFI A;  3CCQ N;  3P31 A;  3MMV A;  2FLO A;  3U6F A;  2EX3 A;  3MAQ A;  2P9P A;  3DXM B;  3O9Q A;  3IG1 A;  3P5J A;  2VWB A;  1N36 K;  4CJ4 A;  4CK1 A;  3T1H K;  4KH5 A;  4RW4 A;  1JKH A;  4NLC A;  5JIC A;  4B8A B;  4EHU A;  5BR8 K;  1C6V A;  2YNH A;  3VN5 A;  1JLF A;  2Y1I A;  2KZM A;  1XQS C;  1C1A A;  3QIP A;  3S41 A;  3DRS A;  2Q31 A;  4M3W A;  4DU4 A;  1GLJ O;  1VRT A;  2VYP A;  5EU7 A;  2FBX A;  5ELZ A;  1Z05 A;  4N5S A;  2Q0R A;  4DU3 A;  3THY A;  4B08 A;  2Q1N A;  4IDH A;  3PV8 A;  1L3V A;  4IDK A;  4FWS A;  4B9V A;  3VGL A;  5HP1 A;  1UOC A;  4B9T A;  2ZWH A;  4CFD A;  3WUH A;  1VQ8 N;  4YY3 K;  5E84 A;  2ZGZ A;  1W0H A;  3D2E A;  5C2F A;  3B6O A;  1RDC A;  3ZET A;  3ZT2 A;  4FJ7 A;  4JKH A;  4DUY K;  2VGM A;  2HHW A;  4FW1 A;  4BGB A;  4CFB A;  4YOY A;  4DSK A;  1FKP A;  1T3V A;  2RF2 A;  5AQN A;  2DTU A;  5AQJ A;  1GOB A;  3ZSW A;  1K73 O;  3C65 A;  3U3G A;  1WSF A;  2AP1 A;  1EQY A;  3O9S A;  2GUP A;  1XHZ A;  2CGL A;  2YHY A;  3AVC A;  4DSE A;  4JK9 A;  4AHT A;  4FWQ A;  4IOX A;  3VGK A;  4LC9 B;  4CJK A;  2FBV A;  4GKK K;  4F9O A;  2X74 A;  2V51 B;  4CGH A;  5CHI A;  4BQL A;  4KHU A;  1J5O A;  1BA1 A;  4FK2 A;  4BG9 A;  2A42 A;  3OYD A;  4AIL C;  3LP0 A;  4CJP A;  3DWL A;  2D4W A;  2E20 A;  5M1O A;  4KPY A;  2Z1I A;  3E9P A;  5E41 A;  3A8Y A;  3KLF A;  4JHD B;  4MO5 A;  3G71 N;  5J2M A;  3BF1 A;  1KVC A;  4LFB K;  4FLW A;  4YOT A;  3FR0 A;  4W5T A;  4KRE A;  2O8F A;  1QQN A;  4H0Y B;  3K5M A;  2CH5 A;  4GMJ B;  4UQG A;  4LSL A;  3QNO A;  2XY5 A;  4EAH D;  4DTX A;  5SZT A;  3MXJ A;  4JN4 A;  4KAZ A;  3FZM A;  3TAQ A;  1QQM A;  5HRO A;  4O4G A;  3CYM A;  2AA4 A;  3NGY A;  3UKR A;  5JVG L;  5J2Q A;  3TTD A;  3O9T A;  4I6M B;  1CLQ A;  2VQE K;  1IKX A;  3QDK A;  2YV0 X;  5C42 A;  3WQT A;  4M3X A;  4DV6 K;  3SQ0 A;  1N34 K;  2OTJ N;  2DY4 A;  4BVP A;  3QFU A;  3PIO L;  3K9K A;  4IG0 A;  4WCE L;  2D5R A;  4OPK A;  1KLN A;  4K42 A;  3OYL A;  5EX5 A;  5AQR A;  2HVH A;  3A5M C;  4XH1 A;  1YUW A;  5J2P A;  2VWK A;  4A2A A;  5AQZ A;  3RWU A;  4BRO A;  2FBT A;  3VA0 A;  1IKW A;  4B3M K;  5AFU A;  4FLU A;  4Z4G A;  3DYA A;  3D2F A;  3O1W A;  1L3S A;  4CEA A;  4MLE A;  1NMD A;  3KK7 A;  3P4I A;  4AH9 A;  3NVK A;  1RT1 A;  5KTQ A;  3NH1 A;  3AAR A;  4Z94 A;  2GTD A;  4PA1 A;  1RTI A;  4GW6 A;  3WQU A;  3AVG A;  5AQL A;  2KHO A;  4H5W A;  3T7Z A;  1C1C A;  4EZ9 A;  1LWC A;  3LP1 A;  5MLC Q;  4LF9 K;  3SK3 A;  1YTA A;  1T44 A;  2HVI A;  3V1R A;  4W5O A;  4FWM A;  3C6A A;  4NB4 A;  2B6A A;  4CVN E;  2NRT A;  3C95 A;  1HX1 A; 
#chains in the Genus database with same CATH homology
 3SQ4 A;  1RTD A;  1TKZ A;  2QXF A;  4O5B A;  4IKF A;  1ASV A;  1MU2 A;  4DFJ A;  3LWL A;  3RMD A;  4CF1 A;  1WNS A;  1EKE A;  4E89 A;  3V9X A;  4PWD A;  3AVI A;  4CEB A;  2OZS A;  3ZSV A;  3IRX A;  1L3T A;  2D0B A;  2F96 A;  3V1O A;  2E6M A;  3HVR A;  1WLJ A;  4RW9 A;  1IKY A;  3ZSR A;  2XRI A;  1RT4 A;  4OKK A;  3L2R A;  4FCY A;  1SKW A;  1B9D A;  1L3U A;  1S1X A;  3LAN A;  4ID5 A;  4K8X A;  2YNF A;  3DLK A;  1VSD A;  1JL2 A;  1U48 A;  4DTO A;  4F8R A;  1BI4 A;  3EYZ A;  1S9G A;  4CJV A;  4JS5 A;  2HHV A;  3IAY A;  3MXM A;  1IG9 A;  4HUE A;  3AVM A;  1B92 A;  2E4L A;  5SWM A;  4IBN A;  3CFR A;  5HRS A;  2G8H A;  2YKN A;  3ZT3 A;  1IO2 A;  1UA1 A;  5CZ2 A;  1FKO A;  3VQ7 A;  3DOL A;  2P5O A;  4OLA A;  3NHG A;  3TAN A;  3HK2 A;  3C6U A;  3OVN A;  3B6P A;  1WAF A;  3QLH A;  3DI6 A;  3SUO A;  4FLZ A;  4LH4 A;  3LAM A;  4CHP A;  4FLT A;  4FZY A;  1KTQ A;  3LP2 A;  1VSH A;  3ZSY A;  4CES A;  1U49 A;  2D0A A;  3F9K A;  1QQC A;  1Q9Y A;  5FRN A;  1BQM A;  1K6Y A;  1RBR A;  3AA4 A;  3TWH A;  4QCL A;  4O55 A;  3NF6 A;  1NKE A;  1NK8 A;  2PYL A;  2AJQ A;  1S1W A;  1S6P A;  4CJU A;  3E01 A;  5C24 A;  3VQA A;  4OKE A;  3L8B A;  3T3F A;  2IGI A;  4QAG A;  1BCM A;  4CEZ A;  1HNV A;  2DFF A;  3P1G A;  4BE2 A;  3OYF A;  1ZBU A;  3HP9 A;  3QEW A;  1NK6 A;  1I39 A;  3OJU A;  3K5O A;  3K5N A;  1NKB A;  4BDZ A;  3QIN A;  4ZHR A;  3K5L A;  4FM2 A;  4MQ3 A;  3TAG A;  3F73 A;  4JRP A;  4CJR A;  3THV A;  1VSK A;  1N6Q A;  1JLC A;  4DTJ A;  4ELT A;  2W42 A;  1JLA A;  2WON A;  1LWF A;  4HTU A;  3KK2 A;  2YKM A;  1S9E A;  3LZI A;  1GOA A;  4B8C A;  4FM0 A;  1DLO A;  3LZJ A;  1U04 A;  1J53 A;  3OS2 A;  3NGI A;  3DOK A;  4DQP A;  1KSP A;  4FJM A;  3CFP A;  4ZTF A;  1VSF A;  3VQ4 A;  4BE0 A;  1TK0 A;  1LW2 A;  3DLH A;  1TV6 A;  1DTT A;  1S1U A;  2KFZ A;  1JXB A;  4M3Y A;  3DLE A;  4CJ3 A;  3CM6 A;  2OZM A;  4DF4 A;  4I2P A;  1D9F A;  2F8S A;  3OS0 A;  1RT6 A;  5HRR A;  3V9Z A;  1N5Y A;  1TK8 A;  1NOY A;  3VQC A;  3HM9 A;  3A2F A;  4B9U A;  2LSN A;  1JLQ A;  1RT2 A;  3G10 A;  4BWM A;  3NCI A;  1RBV A;  3K59 A;  3VA3 A;  3O3F A;  3OJS A;  1YTU A;  2BGG A;  3K57 A;  3ZSQ A;  1CZ9 A;  4CEF A;  4B3O A;  2E6L A;  3VQ9 A;  5J1E A;  4OGE A;  4FLY A;  1NK4 A;  1L5U A;  3DRP A;  5KGW A;  4E0D A;  3HJF A;  3TAE A;  4F3T A;  2O4I A;  3TAB A;  4M3R A;  1HRH A;  4CHQ A;  1TKT A;  1QTM A;  4FJN A;  2HW3 A;  1KVB A;  3HL8 A;  3HPO A;  3AA5 X;  1ZYQ A;  4DSJ A;  4OPJ A;  1Y97 A;  2IAJ A;  1ZBL A;  3DM2 A;  4C8N A;  4FK4 A;  4IFV A;  4KRF A;  4JS4 A;  4KO0 A;  4B9N A;  1Q9X A;  4M3Z A;  2HNZ A;  2RN2 A;  3M8Q A;  4CGF A;  4G1Q A;  2BDP A;  4Y1D A;  1TL1 A;  3WNE A;  2JLE A;  4KTZ A;  4F4K A;  4B9L A;  5CYM A;  2B5J A;  1BQN A;  4DFK A;  4HUF A;  4I7F A;  3CFO A;  3S3O A;  4CED A;  4H4O A;  3RMA A;  1RT7 A;  2F8T A;  2DFH A;  3I0R A;  3OYK A;  3SUN A;  1REV A;  1HQE A;  1J9A A;  2YNI A;  4E7K A;  1X9S A;  3L3V A;  4HCC A;  2JGU A;  4CGG A;  3DLG A;  3NF9 A;  1HJR A;  3OYA A;  3AO4 A;  1XHX A;  2YNG A;  1I3A A;  5FRO A;  4C8L A;  3QNN A;  3RRG A;  3MEG A;  1C0T A;  3KIO A;  4NCG A;  3ZT1 A;  3HXM A;  5I3U A;  3V9S A;  4CHO A;  5KRS A;  2IS3 A;  3AVK A;  4KKO A;  1LWE A;  1NJW A;  1TK5 A;  3HPH A;  5KGX A;  1NJX A;  3NH2 A;  1D9D A;  4FZZ A;  1Q8I A;  5DMR A;  4C8M A;  4DQI A;  1IH7 A;  3RTV A;  4K8Z A;  2HHT A;  1CXU A;  4DSI A;  4F3O A;  2VG6 A;  1X9M A;  4FZX C;  3TR8 A;  1VSE A;  3QER A;  5CY4 A;  3ZT4 A;  4Q5V A;  4BAC A;  3LAL A;  2P51 A;  1QS4 A;  5T7B A;  2NUB A;  3ISN C;  4LD0 A;  5HBM A;  3L2V A;  2RKI A;  4CJS A;  2XHB A;  3AO2 A;  4C8O A;  3LPT A;  5CYQ A;  4CEE A;  4FJK A;  4N41 A;  2X78 A;  3BGR A;  2ATQ A;  1RBT A;  2OA8 A;  5K14 A;  3LWM A;  2FBY A;  1BL3 A;  1G15 A;  3EZ5 A;  1HYV A;  3ULD A;  1SKS A;  3SQ1 A;  1SKR A;  3JSM A;  3AO1 A;  4W5N A;  4BDY A;  2GBZ A;  4MFB A;  1BCO A;  3VQB A;  3TAR A;  3CG7 A;  4NYF A;  3SNN A;  4XIU A;  4DG1 A;  4CJT A;  1RDA A;  3SJJ A;  1SL1 A;  2QKK A;  1UAX A;  1FXX A;  4CHY A;  4FM1 A;  4DFP A;  1KFD A;  2WOM A;  5FDL A;  4Z0U A;  4J2D A;  3L3U A;  3SPY A;  4I2Q A;  3ZT0 A;  4FJI A;  4FJ8 A;  3NE6 A;  3TI0 A;  1KLM A;  4DTP A;  4FXD A;  4EP4 A;  1NK9 A;  4KHW A;  2ZD1 A;  3KKR A;  2G8U A;  2Z1J A;  3C94 A;  2KW4 A;  3OYI A;  1RDD A;  3OYH A;  2B4J A;  4KTW A;  2ZQB A;  4KB0 A;  3SV4 A;  3QEX A;  2DFE A;  3IS9 A;  4ICL A;  3NH0 A;  3U3Y A;  2PY5 A;  3KJV A;  4CF9 A;  3M8R A;  3KKS A;  1LAW A;  3OYB A;  3RRH A;  4OGC A;  3AVA A;  3VQD A;  4YNQ A;  5KRT A;  1A5V A;  1U47 A;  1S5J A;  3OYM A;  4CGD A;  1HNI A;  1RDB A;  1W9H A;  4FW2 A;  4OVL A;  2G8F A;  1Z25 A;  3FFI A;  3M8P A;  4C8K A;  2Q3S A;  1CXQ A;  4H8K A;  3LDS A;  4DTN A;  1RBS A;  2ETJ A;  3KLG A;  3QO9 A;  3ZSZ A;  3RMB A;  3U6F A;  3VQ6 A;  2EX3 A;  2XY7 A;  4KI4 A;  4M3T A;  3MAQ A;  1RBU A;  4LH5 A;  1Z26 A;  4CF2 A;  2QK9 A;  1ZBF A;  4KV8 A;  4DQR A;  3QEP A;  1SL0 A;  1JLE A;  3CQ8 A;  3ZSO A;  1U4B A;  3IG1 A;  3P5J A;  2HHQ A;  4OLB A;  4FJ5 A;  4CJ4 A;  4DFM A;  4CK1 A;  4E1M A;  1QSL A;  2Z1G A;  2PZS A;  3KTQ A;  2QKB A;  4CJW A;  3KD1 E;  1LAV A;  2HND A;  2IDO A;  4RW4 A;  4DTS A;  1JKH A;  3VQQ A;  4B8A B;  1T8E A;  4W5R A;  3K58 A;  1C0M A;  3SZ2 A;  1C6V A;  2YNH A;  4N76 A;  3VN5 A;  4N56 A;  1JLF A;  4DTR A;  2Y1I A;  2KZM A;  1RNH A;  1C1A A;  3QIP A;  3NDK A;  3PY8 A;  4I9Q A;  1JLB A;  4PY5 A;  1BHL A;  3DRS A;  2HHU A;  3PX0 A;  4B9M A;  4M3W A;  1QSY A;  4DU4 A;  1F21 A;  4CHN A;  4KTQ A;  2KFN A;  4E19 A;  1VRT A;  5EU7 A;  2FBX A;  4DS4 A;  3V6D A;  1XC9 A;  2XY8 A;  4N5S A;  3SV3 A;  2HHS A;  2KZZ A;  5J2N A;  2I5J A;  1UWB A;  3HP6 A;  3PX4 A;  4DU3 A;  3O4N A;  3RMC A;  1NK5 A;  3LP3 A;  4J2A A;  4B08 A;  1SV5 A;  4B9S A;  4FJL A;  4PUO A;  4NCB A;  3M8S A;  1X9W A;  1T03 A;  2G8V A;  3PV8 A;  4CJF A;  4Q0B A;  1BIZ A;  4L8R B;  4AHS A;  4CIG A;  1ZBI A;  2X6S A;  1L3V A;  4IDK A;  3LAK A;  3SQ2 A;  3VQ8 A;  3HST B;  3MED A;  4DQQ A;  4B9V A;  4OKJ A;  1WAJ A;  4CF8 A;  1BGX T;  5HLF A;  3NGZ A;  3P83 D;  1D5A A;  3O3H A;  5HP1 A;  3TAP A;  1UOC A;  3ZCM A;  4B9T A;  2X6N A;  4M3U A;  1TGO A;  1LV5 A;  1X1P A;  4CHZ A;  4CFD A;  3T19 A;  4BE1 A;  1RTJ A;  2OPR A;  1NJY A;  1HMV A;  3AO5 A;  1A5X A;  3K2P A;  1TAU A;  1W0H A;  3NAE A;  2OPQ A;  3TAM A;  3DLR A;  4E7L A;  1HYZ A;  2O4G A;  1R0A A;  3B6O A;  1RDC A;  3NBP A;  3DLB A;  4HHT A;  5JS1 A;  4CGJ A;  3L2Q A;  3ZT2 A;  1C0U A;  4RW6 A;  4DSL A;  4FJ7 A;  3S3M A;  1VSJ A;  5CZ1 A;  4O44 A;  4DMN A;  2HHW A;  1RT3 A;  1VSM A;  3MEE A;  4FW1 A;  3WNG A;  4CJ5 A;  1BI4 B;  4JRQ A;  4CFB A;  2BAN A;  1T7P A;  4KHY A;  1VK0 A;  4FYD A;  4DSK A;  1FKP A;  2RF2 A;  3NFA A;  4FJH A;  2HHX A;  3ZSX A;  4Z4H A;  2YHA A;  1EXQ A;  2DTU A;  3AVF A;  4F2S A;  3AVL A;  3AVN A;  1GOB A;  3ZSW A;  3ALY A;  4I9L A;  3U3G A;  4AHV A;  3PO5 A;  1WSF A;  4Z4C A;  3H08 A;  3SUP A;  2OYQ A;  4WE1 A;  1S6Q A;  1HQU A;  4KHQ A;  1XHZ A;  1QE1 A;  4BDP A;  3QES A;  2HB5 A;  3HVT A;  3AVC A;  3TAF A;  4IG3 A;  4DSE A;  1TVR A;  4BWJ A;  1EX4 A;  3I0S A;  4AHT A;  2XY6 A;  4H4M A;  1ASW A;  3QEI A;  4HCB A;  4CJK A;  1WSE A;  2FBV A;  1ITG A;  4DS5 A;  2X74 A;  3BDP A;  3MXI A;  2BE2 A;  3AA3 A;  4RG8 A;  1J54 A;  2RPI A;  1NK7 A;  1HYS A;  4CGH A;  1EP4 A;  3CM5 A;  3D0P A;  2G8W A;  3VQ5 A;  1ASU A;  4KHU A;  1J5O A;  4O0J A;  2IC3 A;  4AHU A;  3KK3 A;  3SUQ A;  4GVM A;  4CE9 A;  1D8Y A;  2IOC A;  3EY1 A;  4DTM A;  1KFS A;  4FK2 A;  1QHT A;  4KHS A;  2KTQ A;  1JLG A;  3SCX A;  3OYD A;  4AIL C;  4EZ6 A;  3LP0 A;  4CJP A;  2A1S A;  3PUF A;  1U45 A;  1NOZ A;  4KPY A;  3HO1 A;  2Z1I A;  5E41 A;  4ELU A;  5D3G A;  4CJQ A;  4FLX A;  4AHC A;  3V9W A;  1BIU A;  4ELV A;  3KK1 A;  3OYJ A;  1RCH A;  1RT5 A;  3KLF A;  4KB1 A;  4N47 A;  5J2M A;  4E7H A;  3S3N A;  4R5P A;  1KVC A;  2OPS A;  4FLW A;  3RR8 A;  4CIF A;  3D45 A;  4W5T A;  3PX6 A;  4KRE A;  3K5M A;  2YHB A;  2Z1H A;  4GMJ B;  4UQG A;  1T05 A;  4LSL A;  4W5Q A;  4CJL A;  4HUG A;  4DLE A;  4EP5 A;  4AHR A;  4CFA A;  3QNO A;  3JYT A;  2XY5 A;  4FJ9 A;  4DTX A;  2FC0 A;  5SZT A;  5DK5 A;  1KCF A;  4RW8 A;  1WSI A;  3MXJ A;  4FJX A;  1KVA A;  4JLH A;  4LY7 A;  4KAZ A;  4OJR A;  3V1Q A;  4Z4F A;  2GV9 A;  3C6T A;  2XO7 A;  3AA2 A;  1UA0 A;  3TAQ A;  3KLE A;  4NYN A;  4DF8 A;  5HRO A;  4KFB A;  1VRU A;  1CZB A;  4M45 A;  3OYE A;  4Z4I A;  4CF0 A;  4O4G A;  3CYM A;  3WNF A;  4CJE A;  4E1N A;  3KLH A;  3QET A;  2G8K A;  4KHN A;  1ZBH A;  3L2U A;  3NGY A;  2D0C A;  5KI6 A;  5J2Q A;  4E7I A;  3NF7 A;  4M42 A;  4DQS A;  1WSJ A;  1CLQ A;  1IKX A;  4RW7 A;  1TKX A;  4QOZ B;  3HPG A;  4FJG A;  2Y1J A;  1JL1 A;  1TAQ A;  2HMI A;  3NF8 A;  4E7J A;  4DWI A;  3I8D A;  4NCA A;  2YV0 X;  3MEC A;  2R7Y A;  4PQU A;  4J2B A;  5C42 A;  3HT3 A;  4FJJ A;  4IFY A;  3SQ0 A;  4M3X A;  4CK2 A;  1KRP A;  3HYF A;  3LPU A;  4CEO A;  2DY4 A;  3DRR A;  3OS1 A;  3WNH A;  1SL2 A;  1JXE A;  4IG0 A;  1DTQ A;  4CEQ A;  2D5R A;  4OPK A;  1KLN A;  4CIE A;  4CK3 A;  1NJZ A;  3OYL A;  1WSG A;  5HRN A;  4Y1C A;  3G0Z A;  4DLG A;  2HVH A;  4HVJ A;  1NK0 A;  2EHG A;  3AVH A;  3AV9 A;  3ASM A;  3DMJ A;  4ID1 A;  1WSH A;  1YT3 A;  5J2P A;  3SI6 A;  2G8I A;  3V4I A;  3QEV A;  2KQ2 A;  1O1W A;  2VWK A;  3L2W A;  4F2R A;  1C1B A;  3T1A A;  3RWU A;  4KI6 A;  4FLV A;  4CEC A;  1WN7 A;  1YVU A;  2FBT A;  3ITH A;  3AVB A;  4DTU A;  3VA0 A;  1IKW A;  3QIO A;  3PO4 A;  4FLU A;  1TKD A;  5C25 A;  4Z4G A;  1IKV A;  3DYA A;  1VSI A;  3KLI A;  1LW0 A;  1L3S A;  4CEA A;  4CGI A;  4M41 A;  1BIS A;  2P5G A;  4DU1 A;  4AH9 A;  1QSS A;  1RT1 A;  5KTQ A;  3SYZ A;  1S1T A;  3NH1 A;  3VQP A;  4CER A;  3O3G A;  4CCH A;  4E3S A;  3O4Q A;  4FVM A;  4PA1 A;  4O0I A;  1RTI A;  4GW6 A;  1S1V A;  5HRP A;  2ZE2 A;  1XI1 A;  4YFU A;  3OY9 A;  3AO3 A;  3S9H A;  4Z4E A;  4LSN A;  4ZTJ A;  3OYC A;  2OPP A;  3OYG A;  1VSL A;  2ITG A;  2GUI A;  3AVG A;  3VQE A;  2PYJ A;  3KD5 E;  4J2E A;  4FK0 A;  2P1J A;  4DSF A;  1B9F A;  5JS2 A;  3RR7 A;  5I42 A;  4TSX A;  2VWJ A;  3SPZ A;  1A5W A;  1C1C A;  1SUQ A;  4EZ9 A;  1LWC A;  5FRM A;  3LP1 A;  1RIL A;  1NKC A;  2A1R A;  1YTA A;  1RTH A;  2VG5 A;  2HVI A;  3V1R A;  3UIQ A;  4CFC A;  3AVJ A;  4W5O A;  1EET A;  1HPZ A;  2VG7 A;  3V9U A;  3OYN A;  1GOC A;  2B6A A;  1XWL A;  1TL3 A;  3V81 A;  1FK9 A;  3C95 A;  2HNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...