4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
1HYSA 1C0MA 4CFCA 5SZTA 1Z25A 1DTTA 2D0BA 4BDZA 5C25A 2BANA 3K5OA 5HRNA 3OYDA 3MEGA 2Y1IA 1VK0A 4AHTA 3AO2A 3DOKA 1TL1A 4I9LA 1TKXA 3ZSOA 3ZT3A 4DS5A 1NKCA 1D9DA 1BQMA 4IFYA 3KKRA 3ZSYA 3S3NA 1C1AA 5HLFA 4Z4FA 4CIFA 1WN7A 4Y1DA 1RBUA 4Z4CA 4DTNA 2HHUA 2DFHA 2ETJA 4E89A 2E6MA 1RNHA 4CJSA 1JLEA 1NK6A 1IKVA 4YNQA 4LH4A 4W5OA 3S3MA 4O44A 1L5UA 1QSLA 3SV3A 4DTMA 1WSFA 4JRQA 1VSMA 1U47A 1HNIA 3O4QA 4KKOA 1A5WA 4AHCA 4CJVA 3LZJA 1TGOA 2WOMA 4CEAA 4E19A 1XI1A 1HNVA 4CF9A 1JL2A 1NK9A 2G8KA 4E7HA 4HVJA 3AVHA 4E3SA 1VSEA 4AHSA 2HHSA 3T1AA 1YTAA 2D0CA 4LD0A 4GW6A 1TAQA 2HHQA 4NCGA 4AH9A 4K8ZA 1NJZA 1NJXA 4PUOA 2BGGA 4M45A 1CZBA 4CF0A 1VRTA 2ATQA 4DTOA 1D9FA 4KO0A 4W5RA 3KLIA 5HROA 1NK0A 1SL2A 3U3GA 4DTSA 1RBRA 3NDKA 3RRGA 3LP3A 5CZ1A 3AVAA 1VSDA 3AA4A 2HMIA 2KFZA 1ASUA 1FK9A 1HJRA 3OYGA 3ZSWA 4KHWA 2XY7A 3DYAA 3NF8A 4Q5VA 3V9UA 4DU4A 1QS4A 3S9HA 4IKFA 1S9GA 3NAEA 3NFAA 4OLBA 1S6QA 4J2EA 1VSIA 1ZBFA 4F8RA 4OGEA 3LP0A 4EZ9A 2GBZA 3QINA 4KI4A 1JLCA 4H4OA 5E41A 4DF4A 2P5OA 4I9QA 1I3AA 3P5JA 3CM5A 4CJRA 3KKSA 4B9NA 4CEZA 4E0DA 1IKWA 3ULDA 5HRPA 2I5JA 4RW6A 4ZHRA 4FM2A 3AA5X 3KLFA 3M8PA 1FKOA 3DLBA 1NJYA 4GMJB 5KRTA 3ASMA 4CFDA 3OS2A 5DMRA 1WAJA 1Y97A 1BHLA 4OKJA 3WNHA 4CJKA 3V4IA 1S6PA 3PO4A 4B9VA 4FJ9A 3DRRA 3V9XA 4FJ5A 3ZSVA 4OLAA 1WLJA 1RBVA 1HPZA 3ZT0A 1X9WA 5D3GA 1N5YA 3DI6A 4CIEA 2BE2A 3CG7A 3NHGA 1WSIA 4DU1A 4KB0A 3HT3A 2AJQA 1B9DA 4CGJA 4CEOA 1XHZA 4OVLA 1RT7A 1YVUA 2QXFA 3V1QA 3S3OA 4ELUA 2VG5A 1GOAA 1VSKA 3AVIA 4M3UA 4IBNA 4HUGA 2P51A 4FJLA 3AVCA 3IRXA 3D45A 5EU7A 4FLTA 1QHTA 4CHZA 2IDOA 3H08A 3KK2A 5KGXA 3P1GA 2QK9A 1VSHA 3TAMA 1VSFA 4CGIA 4BWJA 4CJTA 3LANA 4DS4A 1WSJA 4FZZA 1RTHA 3CFOA 1RT1A 3LAMA 5KGWA 4QAGA 3VQDA 4CJLA 3C94A 3ZSQA 1JLFA 2X78A 2E4LA 1NOZA 3DLEA 3HPGA 3OYFA 1S1XA 1GOBA 2FBVA 3ZT4A 1CZ9A 3LP1A 2X6NA 3SQ4A 1LWEA 4RW7A 3L2RA 4LSNA 4F2RA 3PV8A 4DQIA 4M3ZA 2YKMA 4CHYA 1TK0A 2HHXA 1CLQA 4FJIA 3ZSRA 4I2QA 3HVRA 1JXBA 4C8LA 3RWUA 1IKYA 2KFNA 1CXQA 1UA0A 2YNFA 1D5AA 4MFBA 1RDCA 2ZQBA 3RR7A 3AVNA 4CECA 2PYJA 4EZ6A 3QLHA 4CJEA 2IS3A 1ZBIA 4BE2A 3AA3A 1U48A 3QEPA 1BL3A 1TK8A 4KHNA 2DFEA 1EXQA 4H8KA 4RW9A 2PYLA 1ASVA 4CGGA 3JSMA 4FW2A 1J9AA 3OS1A 1REVA 1TK5A 4F2SA 1LV5A 3KLHA 2VG6A 4DQRA 4DFMA 1NK4A 4M42A 1JLQA 4FLYA 4E7JA 5FDLA 4IG3A 3VQCA 4E7KA 4I2PA 5HP1A 3I0RA 4FLUA 2RF2A 1DLOA 5C24A 4OPKA 3TAGA 1N6QA 4FJJA 1BGXT 4DSJA 3VQ6A 2YV0X 4CJWA 3AVJA 2IC3A 1SL0A 2YNHA 3I0SA 4JRPA 2OZSA 1BIZA 2EHGA 2Z1GA 4Y1CA 2FC0A 3I8DA 4DTXA 1B9FA 4DG1A 3CYMA 1U4BA 1T8EA 4B8CA 3OYIA 2IAJA 3AO1A 4DF8A 3P83D 3LPUA 2B6AA 4KTQA 1S1UA 4AHVA 4DFKA 3MEEA 3QEWA 1BIUA 4N5SA 1RBSA 1RDDA 3K2PA 3QIOA 3FFIA 4CJQA 3SNNA 3DOLA 3DLGA 3CFRA 2Z1JA 1GOCA 5JS2A 2OZMA 1BCMA 3B6OA 4YFUA 4JS4A 4FLVA 1RT5A 3DMJA 1K6YA 1RILA 2RN2A 3L2QA 2BDPA 1L3SA 1FKPA 4FW1A 3L2WA 2FBTA 3DM2A 2Y1JA 1S5JA 4B3OA 4CHPA 4CF1A 5FRNA 4W5TA 4DU3A 5FRMA 4ID5A 1LW2A 3ZCMA 2HHVA 4FYDA 3NF7A 3TANA 1D8YA 3VA0A 4W5QA 4CK1A 1LAVA 4C8NA 4DWIA 3VQAA 5T7BA 1TKDA 4ELVA 4LY7A 4JLHA 3NGYA 3ZT1A 1KLNA 3NE6A 3AVLA 4KTWA 3VQ5A 2EX3A 1LWFA 4NYNA 1Q8IA 5SWMA 2FBYA 2XY8A 3JYTA 3OYLA 3HL8A 1RT4A 2XY6A 3MAQA 1KFSA 4KREA 1VSLA 4CFBA 1G15A 2VG7A 4HUFA 4FM0A 4B9MA 3SQ1A 3AVGA 4E1NA 1C6VA 4ICLA 4OGCA 3KK3A 3HO1A 1RTJA 3EYZA 4M3RA 1WSEA 3ZSXA 3SPZA 2OPPA 1ZBHA 3OJSA 3M8SA 3NGZA 4HTUA 3TAQA 4FLWA 4KFBA 3AVMA 4ID1A 4CF2A 4FZYA 4IDKA 3KK1A 3MECA 1S1TA 1JXEA 3CM6A 2QKKA 3VQEA 1S1WA 3NCIA 3TI0A 2OPSA 4IG0A 4Z4IA 1TAUA 4LH5A 4NYFA 1KLMA 1C0UA 4OKKA 4G1QA 4BE1A 3RRHA 1XWLA 3RTVA 2Z1IA 1IO2A 2G8HA 2PZSA 3M8RA 4B08A 1L3VA 3AVBA 4PY5A 1C1BA 3DRSA 4OJRA 3NH0A 1KSPA 4FJXA 1Q9YA 2XRIA 3HYFA 4B9SA 3L2UA 4CJPA 2A1SA 3KLGA 2X6SA 1WSHA 1EETA 3AO3A 3OYJA 3V1RA 4CEDA 4BDYA 4DLEA 4C8OA 3SZ2A 1NKEA 1IH7A 2HNDA 3QEIA 3M8QA 1XC9A 3LZIA 4F3TA 2YHBA 1HQUA 5KTQA 2HNZA 3HXMA 4CK2A 4EP5A 1J5OA 3ALYA 1TKTA 3L3UA 3NF9A 3QIPA 4FZXC 4KPYA 2GV9A 4AHUA 1IG9A 4Z4HA 3PX6A 4HCBA 3OYBA 1YT3A 4KHQA 1TV6A 3QESA 3RMCA 3HP6A 3V1OA 3THVA 3OY9A 3NGIA 4FJKA 3HPOA 4FK0A 4NCBA 3SUNA 4PQUA 3HK2A 4QCLA 3LALA 1KRPA 1SKWA 1JL1A 3AA2A 3K58A 4L8RB 1A5XA 4F4KA 4CIGA 2JLEA 2YHAA 4UQGA 4DTPA 1KTQA 3VA3A 1RT6A 5HRSA 2W42A 2P1JA 3AO4A 2IOCA 2ZE2A 4FVMA 4KV8A 4K8XA 3O3HA 1NOYA 1ASWA 5I3UA 3L2VA 1LAWA 4OKEA 3IS9A 4DTUA 1ZYQA 1BCOA 1CXUA 3VN5A 4AHRA 4B8AB 4CHNA 1J54A 4CJ4A 4FJHA 2KZZA 3OYEA 2DFFA 3QEXA 3RMBA 1RT2A 3QEVA 4O0JA 4BWMA 1LWCA 1KVAA 1RTIA 4CFAA 4FLXA 3G10A 2FBXA 4C8MA 3E01A 4EP4A 1UA1A 4KRFA 1TKZA 3CFPA 4FJMA 4HUEA 3D0PA 4E1MA 1X9SA 4B9LA 4CJ5A 3TABA 1RBTA 2HHTA 4FJGA 4DSIA 4BACA 1WAFA 1HRHA 4N76A 3PY8A 3SQ0A 4CHOA 1Z26A 3QNOA 3TAPA 3SCXA 1NKBA 4XIUA 4NCAA 3SYZA 1RDBA 1R0AA 5CZ2A 3WNGA 2NUBA 2G8UA 1QSYA 3VQ7A 1SKRA 3OYAA 3UIQA 4HCCA 3AO5A 1RDAA 1WNSA 1O1WA 3VQBA 2HVHA 3V6DA 2DY4A 4I7FA 4M3TA 4CCHA 4FM1A 1YTUA 4DFJA 1BI4B 1ZBUA 3VQ9A 2RKIA 3AVFA 1LW0A 3OYCA 4DSFA 4E7LA 3V81A 1U45A 3QNNA 2P5GA 1I39A 3HJFA 1KCFA 2F8SA 3V9WA 2VWKA 3KTQA 4DSEA 3OYKA 1SUQA 4RW8A 4WE1A 4DQQA 4N56A 3SJJA 3ITHA 3ZSZA 3PUFA 1KVBA 2OPQA 3NBPA 3NH2A 5HRRA 3OYNA 2A1RA 1L3TA 1T7PA 2YNGA 5J1EA 3K59A 1IKXA 5K14A 2E6LA 4KAZA 4RG8A 3OJUA 4FJNA 4CJ3A 4ZTJA 2WONA 4CGDA 4H4MA 3TAFA 2KW4A 3IG1A 4FLZA 2G8FA 3SUPA 3NF6A 3QO9A 4CESA 3OVNA 3VQQA 4FJ8A 2RPIA 4LSLA 3QETA 2HNYA 3RMDA 1BQNA 2G8WA 1HYZA 2OPRA 3MXJA 4FK2A 1NK8A 4CEFA 1ITGA 3VQ8A 1HQEA 4J2AA 3KD1E 1DTQA 4B9TA 1JLGA 2ITGA 1U49A 2KTQA 4M3YA 5JS1A 3RMAA 1JLAA 4B9UA 4O55A 3OYHA 3TAEA 3IAYA 1U04A 1SL1A 4CHQA 4KI6A 1XHXA 1NJWA 2OYQA 2O4GA 5J2PA 2YNIA 3KD5E 3HPHA 1JKHA 2IGIA 4AILC 1RCHA 1BI4A 1KFDA 4O5BA 1W9HA 1BISA 3AVKA 4DSKA 2Z1HA 4FK4A 4CF8A 4BE0A 4R5PA 2Q3SA 4MQ3A 1HMVA 3SUOA 4KB1A 4FXDA 3TARA 3WNEA 2YKNA 1UOCA 3HM9A 3C6TA 1A5VA 5CYQA 3ZT2A 3K5LA 3K5MA 3CQ8A 1NK5A 1FXXA 4OPJA 1SKSA 4N41A 5FROA 4Z4EA 1S1VA 1Q9XA 4F3OA 3U6FA 2G8IA 3T3FA 4DSLA 1VRUA 4J2BA 4DLGA 5CYMA 2XO7A 3HP9A 3WNFA 1X9MA 3TR8A 2F8TA 5I42A 1TVRA 2HHWA 1QQCA 3NH1A 3O3FA 4HHTA 1MU2A 4C8KA 1F21A 4M3XA 4CEEA 2X74A 4FJ7A 3C6UA 3PX0A 1EX4A 3SI6A 4CGHA 4BDPA 3KLEA 3VQPA 1B92A 3SQ2A 5J2MA 3F9KA 1RTDA 4ELTA 1NK7A 1C1CA 3AV9A 3LWLA 2VWJA 4IFVA 3K57A 2R7YA 4FCYA 4KTZA 4DTRA 4DFPA 4ZTFA 2PY5A 1TL3A 3DLKA 5J2NA 3OS0A 3EY1A 1J53A 2LSNA 2B5JA 3SV4A 2D0AA 1T03A 4PWDA 3PX4A 4CEBA 3LAKA 1ZBLA 4TSXA 4Q0BA 5DK5A 5CY4A 3TWHA 3A2FA 3BGRA 3B6PA 2DTUA 1T05A 2JGUA 4E7IA 3LPTA 3DLRA 5HBMA 4CEQA 3OYMA 4M41A 4DMNA 2F96A 3LP2A 1UAXA 4CGFA 1X1PA 2HVIA 3VQ4A 4CE9A 2KZMA 1VSJA 5J2QA 4JS5A 4KHYA 4RW4A 1EP4A 4O4GA 3QERA 2G8VA 4J2DA 3L8BA 4KHSA 3C95A 5KI6A 1EKEA 2O4IA 4Z4GA 1WSGA 2OA8A 3DRPA 2XY5A 3HSTB 4GVMA 1HYVA 3MXMA 1QTMA 5KRSA 4DQPA 4CK3A 3O3GA 2GUIA 4DTJA 4M3WA 3U3YA 1KVCA 5C42A 4CERA 2ZD1A 3MEDA 3PO5A 2HB5A 1RT3A 3O4NA 3T19A 4CJUA 3KJVA 1C0TA 1JLBA 3SPYA 3RR8A 4W5NA 3LDSA 1W0HA 4PA1A 4CJFA 3LWMA 4KHUA 2HW3A 2XHBA 3V9SA 4Z0UA 3G0ZA 3DLHA 1QE1A 1UWBA 2B4JA 3EZ5A 4DQSA 1SV5A 3BDPA 3K5NA 3HVTA 3ISNC 3SUQA 4N47A 2QKBA 1QSSA 2KQ2A 3MXIA 3L3VA 1L3UA 2D5RA 4QOZB 1S9EA 3KIOA 3V9ZA 3F73A 4O0IA
chains in the Genus database with same CATH superfamily
1HYSA 1C0MA 4CFCA 5SZTA 5HRNA 3VGKA 2Y1IA 4AHTA 1TKXA 4DS5A 5C15A 1BQMA 4KH6A 4Z4FA 4CIFA 1WN7A 4BRFA 5AQPA 4Y1DA 4CZMA 3CETA 4FOEA 4CJSA 4YNQA 4YORA 3UKUB 1U2VB 5E84A 1TYQB 4ISGA 4JHDB 4JRQA 1U47A 1HNIA 3O4QA 4KKOA 5BRFA 4AHCA 3LZJA 1NK9A 2G8KA 2FF3B 4GW6A 4AH9A 4K8ZA 5EOYA 3EL2A 3VF6A 2BGGA 4CF0A 1EO1A 4DTOA 5E26A 4KO0A 1D9FA 4IOCL 2VQFK 3LP3A 3AVAA 1QVGM 2HMIA 2F7TA 1ASUA 1HJRA 2YHXA 2XY7A 1OVYA 4Q5VA 1QS4A 3NFAA 3DJCA 1W97L 2AA4A 2IVOA 2GBZA 1QQNA 5JVGL 5AQIA 4I9QA 3P5JA 4E0DA 1Q86O 2VYPA 3CCMN 5BPLA 2A40A 2J4RA 5KRTA 1YAGA 2E1YA 3V4IA 4OKJA 3RSEA 3VTHA 4CJKA 1S6PA 1WLJA 5D3GA 3FZLA 3ZETA 1X9WA 1N5YA 3DI6A 4FWNA 3MN7A 4CGJA 4CEOA 3QBXA 4OVLA 4DV3K 1C0FA 2GEMA 1NGFA 2VG5A 3AVIA 1NU0A 2P51A 4FLTA 3BZKA 2O8DA 4CHZA 1S22A 4DCHA 3KK2A 5KGXA 3P1GA 1VSHA 4CJ7A 1VSFA 3OHRA 5B8HA 5KGWA 2KKZA 1RDUA 1JLFA 2X78A 3DLLL 3ZT4A 1CZ9A 3LP1A 2X6NA 4CD1A 1LWEA 2Q36A 2ZF5O 3L2RA 1K9MO 3FFKB 2YKMA 5JICA 2YCHA 1JXBA 2UUCK 3RWUA 1IKYA 3E9PA 1VQLN 2ZQBA 4CECA 3BY5A 1OH7A 3VPZA 5AQZA 4CJEA 1U48A 4KHNA 1EXQA 4H8KA 2PYLA 1KC8O 2E88A 1J9AA 4FW2A 1REVA 1TK5A 5FDLA 3VQCA 4I2PA 1DLOA 5C24A 1QZ6A 4B1VA 3AVJA 1OH6A 1NGJA 4V19S 4K43A 3D2EA 4CW7B 1ZBSA 2EHGA 4DG1A 3CYMA 3OYIA 2IAJA 5JVHL 3LPUA 2KHOA 2B6AA 5AQXA 1S1UA 4DFKA 4N5SA 5DM6L 3NVMA 3FFIA 5AZIA 3DLGA 2Z1JA 3SAGA 1GOCA 2Q0UA 4BC2A 4FLVA 3DMJA 3L2WA 3MN9A 4B3OA 2P9SB 3DWLA 5FRMA 4W5TA 4DU3A 3NF7A 5H1SQ 1D8YA 4C8NA 4DWIA 4LY7A 5AQHA 3ZT1A 2V7YA 5BR9A 2WUSA 2FBYA 3JYTA 3C0BA 3MAQA 1KFSA 5AFUH 3CC2N 1VSLA 4CFBA 4FM0A 4J8FA 3HO1A 4OGCA 3CJ7A 4OPHA 4F9OA 4I6MB 3U9DA 1WSEA 4XH1A 3ZSXA 2OPPA 3NGZA 4FLWA 3AVMA 4ID1A 4FZYA 4IDKA 1DKGD 4B1YB 3MECA 4K0KK 1JXEA 3CM6A 1IJJA 2QKKA 1HNXK 1XMQK 1G99A 1TUUA 3NCIA 2OPSA 5JLFA 1TAUA 5LY3A 4G1QA 4BE1A 2G8HA 2Z1IA 5ADXH 1L3VA 3AVBA 3WEEA 4H0YB 3SAHA 4B9SA 2ASMA 4BRGA 1P8ZA 5EVZA 3KLGA 3L0QA 3CCRN 5LL6Z 2YI1A 4DLEA 5I9EB 4JI3K 2HNDA 3LZIA 4FPBA 5EXWA 3HXMA 4EP5A 4R79A 5M1PA 3NF9A 4FZXC 4AHUA 3WXJA 4Z4HA 1YT3A 3RMCA 4GV3A 1EWRA 3MWPA 3OY9A 3NGIA 5AQQA 4A2BA 3AA2A 4L8RB 4F4KA 2JLEA 4DTPA 2AP1A 1BG3A 3VA3A 1RT6A 1K73O 4M63C 3AO4A 1HKCA 4FWSA 4KV8A 2YJFA 4DV4K 3L2VA 3U4LA 1ZYQA 4IOXA 3L4IA 3VN5A 1VQ7N 4B8AB 1J54A 2QWOA 1BO5O 2DFFA 1XUPO 4O0JA 4FLXA 1NLVA 2E20A 4IDHA 1N33K 3E01A 3VEYA 3WXIA 2ZJPL 3D0PA 1X9SA 4B9LA 3G25A 4LF6K 3BZCA 4KHPK 4H0XB 4NCAA 1SKRA 4Y0WA 3AO5A 2HVHA 4GNIA 4I7FA 3ZEUA 2V52B 4FM1A 2P9KB 4DFJA 2QW9A 2RKIA 3QNNA 4MO4A 3KTQA 4DSEA 1HX1A 4JKEA 3E9OA 3PUFA 3QDKA 5J1EA 1IKXA 5K14A 2PFUA 4BY9C 4CJ3A 1NGBA 4FLZA 3KVGA 3W3DA 3NF6A 3SUPA 2RPIA 3QFUA 2NRXA 4LSLA 3QETA 1J5EK 4JI6K 2OPRA 4YOVA 3MXJA 4AF1A 3VQ8A 4JD2B 1D4XA 1JLGA 3HM8A 4CZHA 1U49A 4B9UA 3TAEA 4CHQA 3UKRB 5J2PA 1ATSA 4JKCA 1JKHA 2IGIA 5FPEA 3ULEB 4O5BA 3UB5A 3VEZA 4MQ3A 3TTCA 3VGMA 1HMVA 3SUOA 4KB1A 5F2RA 3IMXA 2E1ZA 5AR0A 2YKNA 2ITMA 3HM9A 1VQMN 4FWQA 5FROA 3ID8A 4JI7K 3ATUA 1Q9XA 3U6FA 4DSLA 4H0OA 1XNQK 1X9MA 3HP9A 3WNFA 4BG9A 2E2NA 2P9IB 5GAEP 1EX4A 3SI6A 1LOTB 1NMDA 5BREA 4ELTA 1C1CA 2R7YA 5DM7L 2P9UB 3K57A 2PY5A 4IWVA 3DLKA 5J2NA 2W6LA 3HZ6A 4BRQA 1YJNN 1J53A 2GWKA 3KZBA 2E5LK 2D0AA 3PX4A 4CEBA 3TWHA 3B6PA 3CJBA 4E7IA 5HBMA 4CEQA 4DMNA 3LP2A 4FWMA 2GELA 2YHYA 3O9SA 2HVIA 1VSJA 4KHYA 4RW4A 5GIOA 4JI5K 5BN9A 3F9MA 3WXMB 1OVQA 2WFBA 5C12A 5KI6A 3MX2A 2OA8A 3DRPA 3MXMA 1VQ6N 3MCPA 4JK7A 1KAYA 2NZTA 3SK3A 2HB5A 3D6RA 1C0TA 1JLBA 3SPYA 4IEEA 4CJFA 3LWMA 2HW3A 3Q7BA 1UWBA 3EZ5A 2VGMA 3DXMA 3SUQA 4DR5K 4UY8O 2O8BA 5AQGA 2KQ2A 3LM2A 5HOOA 4O0IA 4CZKA 3BUZB 1Z25A 1DTTA 4PKGA 2BANA 4LF7K 3K9JA 1NGIA 3RRGA 3O8MA 3AO2A 4IFYA 3S3NA 1C1AA 2NNWA 4B1ZA 1RBUA 2HHUA 3N4QA 2ETJA 3PSFA 4YOYA 2E6MA 2QTDA 3CPWM 4EHTA 1QSLA 3SV3A 2HBMA 2FF6A 3T1YK 1VSMA 3RSEB 1A5WA 2OTLN 1QZ5A 1TGOA 5JS1A 4CF9A 1JL2A 3ZETB 4E7HA 3AVHA 2HHSA 4DV2K 1VQKN 4LD0A 3TU5A 3MWTA 1NJZA 1NJXA 4XEIA 2ATQA 4WFNL 4WFAL 2Q31A 3U3GA 1OH5A 5CZ1A 2O8DB 5AQLA 1S9GA 1T3VA 4OLBA 1VSIA 1ZBFA 4F8RA 1NJIO 4H03B 2Q2RA 4WYBA 1JLCA 3H46O 1I3AA 2HBJA 4CEZA 5EY4A 5HRPA 3CI5A 3SMSA 3A5LC 4RW6A 4ZHRA 3R1XA 2CGKA 4H5TA 2ZM6K 1NJYA 2UXDK 5DMRA 4B9VA 1BHLA 4FJ9A 4JK9A 4OLAA 3ZSVA 3ZT0A 2QWRA 4IEIA 4BVPA 4CIEA 2BE2A 4DU1A 1WSIA 1N32K 4ELUA 1GOAA 4LF5K 3H1VX 4B1WB 2ASOA 4HUGA 3AVCA 5LJVA 3D45A 4JKAA 2QWLA 5AQVA 3R3LA 3J7AP 2D1KA 2IDOA 3EE8A 3H08A 3LM9A 4O8KA 4PKIA 4EIAA 4CGIA 3FE1A 4CJTA 3LANA 3CCSN 1WSJA 4FZZA 5AQOA 1RTHA 1X3NA 3CFOA 3D2EB 3LAMA 2GTDA 3VQDA 4CJLA 1BUPA 3ZSQA 2P9IA 2E4LA 4BRKA 1S1XA 2FBVA 2QEXN 5LMUK 3RVCA 4CHYA 2HHXA 1KAZA 3AARA 3ENOA 3ZSRA 4JKGB 1N36K 3JXUA 2UUAK 1UA0A 3RR7A 4MFBA 2PYJA 3P38A 1BDGA 3ENHA 4WQ5C 2VQEK 3ATVA 3CHWA 5AQMA 4DR1K 4WQ5A 3QEPA 3JSMA 3OS1A 1T6CA 1JJ2M 3C65A 3KLHA 4M42A 1JCEA 4IG3A 1NJWA 1N6QA 4OPKA 4CJWA 1SL0A 2YNHA 3I0SA 5AQRA 3VF2A 4B8CA 3KWIA 4JKHA 4FO0A 3P83D 5BR8K 4KTQA 4AHVA 1NGEA 1RBSA 1RDDA 1DT9A 3CFRA 1Q18A 4JS4A 1L3SA 2Y1JA 3D2FA 4OO1J 3CD6N 3WEEB 2Q1NA 4CF1A 5AZJA 4FYDA 3TANA 4W5QA 4CK1A 3P4IA 1HPMA 4O8UA 5T7BA 2YHWA 3NGYA 3VQ5A 1IBKK 2ZWHA 5SWMA 2XY8A 5AQWA 3I56N 3HL8A 1RT4A 2XY6A 3TSPA 4KREA 2E2OA 2F9WA 1G15A 2VG7A 4HUFA 4B9MA 3AVGA 1C6VA 4ICLA 3KK3A 5AQKA 3EYZA 3OJSA 3TAQA 2BTFA 4B3MK 3VQEA 1S1WA 1MWKA 4IG0A 3THXA 4NYFA 4OKKA 1IO2A 3M8RA 2NRWA 1C1BA 3DRSA 3NH0A 2NRZA 4CJPA 2X6SA 5C2FA 1EETA 3OYJA 4BDYA 4C8OA 3QICA 1IH7A 3C7NA 1GLCG 3L6QA 4DR7K 3GBTA 2HNZA 4H5RA 1VQ5N 1TKTA 2GWJA 4JV5K 2RE2A 2I7NA 4HCBA 5M1FA 4MDBA 1TV6A 4FL9A 4NCBA 4IFEA 3LALA 1SKWA 1VQ8N 3EKUA 1JL1A 4CZFA 1A5XA 4CIGA 3ZEUB 5HRSA 2W42A 2KLAA 2P1JA 4RWTA 2ZE2A 5M1NA 3O3HA 1NOYA 3NVKA 4OKEA 4CBXA 4DTUA 1CXUA 4CHNA 3CXCM 2QA4N 3OYEA 4A57A 4X62K 3QEXA 1RT2A 1KVAA 3O08A 4WQ4C 3G10A 2FBXA 4WQ4A 4DV1K 1UA1A 2I7PA 4A62A 3FR0A 4FJMA 4E1MA 3J7ZO 1Z6RA 4BR4A 3CJAA 1M90O 3BEXA 1HRHA 4CHOA 3SCXA 4BVOA 2ZJRL 1NKBA 3WNGA 2NUBA 2G8UA 2UUBK 1O1WA 4C23A 1GLEG 4PL8A 1U45A 2P9LA 2P5GA 5MLCQ 3SAFA 3V9WA 4ILJA 1SUQA 4JKGA 4N56A 3SJJA 3ITHA 3ZSZA 1N34K 3OYNA 1IV0A 1T7PA 1VQ4N 3HI0A 4RG8A 3OJUA 4FJNA 4ZTJA 3QFPA 2KW4A 4B3RK 1QVFM 3VQQA 4FJ8A 3VTIA 3RMDA 2HNYA 4LFCK 1IG8A 5CR4A 4CEFA 2ITGA 2KTQA 1JLAA 3A0IX 4O55A 3HRGA 3IAYA 1U04A 3J80O 4GKKK 3KD5E 1RCHA 1KFDA 2HBLA 1BISA 3AVKA 2E2PA 5BN8A 4FK4A 4CF8A 4BE0A 4CI6A 4DUZK 4FXDA 3TARA 1BOTO 3WNEA 3K5LA 3O80A 3ZT2A 3CQ8A 4CBWA 1NK5A 1SKSA 4N41A 2GUPA 4Z4EA 4H0VB 1YF5L 2G8IA 4DQ8A 3KK7A 5CYMA 2XO7A 5I42A 4O5FA 3MN6A 3NH1A 1I94K 1ATNA 4HHTA 4LFAK 1F21A 2A6AA 3O6WA 4FJ7A 3C6UA 1M1KO 4CGHA 3WQUA 3VQPA 4BREA 3OW2M 3F9KA 1NK7A 3OTOK 1VQ9N 3AV9A 3EE9A 4JKDA 2VWJA 4FCYA 4ZTFA 4JNEA 3TTFA 1TL3A 4HTLA 5ELZA 2LSNA 2ZJQL 1NMNA 3SV4A 1YIJN 1GLFO 4TSXA 4Q0BA 3A2FA 3BGRA 3DXMB 2O8BB 2DTUA 2JGUA 2D0OA 3VESA 3AAQA 1WB9A 4BC3A 2PBDA 3ZX3A 3CMEN 5J2QA 3LDLA 4CBUA 4EFHA 3QERA 3THYA 4J2DA 3L8BA 4KHSA 4K42A 3G4SN 4Z4GA 2P9PA 4FWLA 3A5NC 5AFUA 3O9QA 1ZXOA 4M3WA 5C42A 4CERA 2Q97A 3O4NA 4CJUA 3A5MC 3RR8A 5KQDA 4W5NA 4KHUA 2XHBA 3CQXA 1YJWN 1QE1A 4PHTX 3FZHA 5C10A 3CMAN 2QKBA 3L3VA 1L3UA 2HOEA 5ADXA 1TUYA 5M1QA 2IIRA 3LDPA 4IJNA 4BDZA 1VK0A 3DOKA 3FGUA 1TL1A 3ZSOA 3ZT3A 3ZSYA 3KKRA 3GDQA 1U6ZA 3O9RA 2DFHA 4K25A 4E89A 1RNHA 1JLEA 3CCUN 1L5UA 5C0YA 3S3MA 4O44A 2F4VK 5A2QO 4DTMA 2VGNA 1WSFA 2HF3A 4XH5A 2WOMA 4WF9L 1HNVA 4JK8A 3OBWA 4HVJA 4E3SA 4AHSA 1N8RO 4CZLA 4DR3K 4M45A 1VRTA 2QWMA 3J8AA 4FWRA 4NXMK 4W5RA 1NK0A 1BA1A 3NDKA 2W41A 2JWKA 3AA4A 4DUYK 2KFZA 4IO9L 3R8EA 1BA0A 3V9UA 4DU4A 1GLBG 3S9HA 3NAEA 4JI1K 1S6QA 4OGEA 1W7AA 4KI4A 4H4OA 2WTUA 3CM5A 4CJRA 3ULDA 3M1FA 3BP8A 2YX6A 4FM2A 3AA5X 3KLFA 3M8PA 1T44A 2QXLA 3CJCA 1VQON 3OS2A 3ASMA 4CFDA 3N4PA 3PO4A 3WNHA 3V9XA 4FJ5A 1RBVA 4U67L 1JCGA 2RHKA 4KB0A 3NHGA 2VWBA 1B9DA 1S3XA 4M7YA 3V1QA 2QXFA 3G6EN 4GV9A 4M3UA 1VSKA 4GVEA 3IRXA 5EU7A 5IWAK 1QHTA 2O8FA 3VEWA 2QK9A 3TAMA 4BWJA 2FSKA 4DS4A 1P90A 3H45C 1RT1A 3C94A 3IFRA 3WQTA 1NOZA 1MDUB 3WXLA 4NLBA 3VETA 3SQ4A 4F2RA 4RW7A 4AM6A 3KHYA 4M3ZA 4FWOA 1OKJA 4FPAA 3ZX2A 4I2QA 2ZGZA 1XC3A 2P9NA 1D5AA 3D2FB 3AVNA 5CE3A 1FJGK 3QLHA 5AZJB 4JYAK 4FSVA 4BE2A 3AA3A 4JKBA 3T7ZA 1ASVA 4CGGA 4OPAA 2VG6A 2IVNA 3H3OB 4FOIA 4DFMA 1NK4A 4FLYA 5HP1A 4BGBA 3TAGA 2RF2A 2QWQA 4FJJA 1BGXT 2WC9A 2UXCK 3AGRA 2IC3A 4JRPA 1S72N 3I8DA 2FC0A 1ZC6A 4DTXA 4YOXA 3AO1A 4DF8A 1NM1A 1IBLK 4YY3K 1BIUA 3BF1A 4DR6K 2A3ZA 3K2PA 3QIOA 4CJQA 3SNNA 3DOLA 3THXB 5JS2A 2OZMA 1BCMA 3B6OA 4YFUA 1XHZA 3AY9A 1RT5A 2BDPA 1RILA 4FW1A 2FBTA 2UYTA 3DM2A 3R9PA 3TPQA 4CHPA 1SAZA 2HHVA 3CCVN 3VA0A 1LAVA 4ISEA 4MDAA 3VQAA 4ELVA 5IT9O 3SLCA 4JLHA 2EX3A 4NLCA 4JEPA 4NYNA 3C7NB 3E66A 4BC5A 5AQYA 2QM1A 3SQ1A 4E1NA 5HL7L 2W6KA 5AQSA 3P31A 4M3RA 2UXBK 4X66K 4HTUA 2F9TA 3LDQA 2DPNA 1E4FT 4BRMA 1KQSM 4DR4K 2FLOA 3TI0A 4LFBK 4Z4IA 4LH5A 1KLMA 2NRTA 3RTVA 2PZSA 2FSNA 3M6GA 5GIPA 4OJRA 3L2UA 2A1SA 1GLLO 1WSHA 2UU9K 3LDNA 2E2QA 3V1RA 4CEDA 1OH8A 4MO5A 3QEIA 3QB0A 4B9QA 1HQUA 4YHHK 5KTQA 4CZJA 4CK2A 1J5OA 1HNWK 3L3UA 3FLCO 2FSJA 1YUWA 1NWKA 4MLEA 1W2BM 3OYBA 3QESA 1X3MA 3V1OA 2O8CA 3HPOA 3K0SA 3LL3A 4NXNK 3HOTA 3SBTA 4PQUA 4U7BA 3HK2A 1KRPA 5M1OA 1O13A 1Y64A 1HJOA 2QI2A 2YHAA 4BC4A 3FZFA 3ZX0A 4K8XA 2P9LB 1ASWA 3O1BA 1E3MA 4DHYA 3IS9A 4BRIA 4PL7A 1BCOA 4H5NA 3FZKA 3CERA 4CJ4A 2KZZA 3RMBA 4BWMA 1LWCA 4BROA 4CFAA 2ASPA 4DV5K 1TKZA 4BRAA 1NG9A 1VAZA 1DGKN 4CJ5A 3TABA 1SQKA 1RBTA 3G71N 2HHTA 4FJGA 4BACA 4N76A 2E8AA 3SQ0A 3PY8A 1Z26A 3QNOA 3MX5A 3SYZA 1RDBA 1R0AA 5CZ2A 4YDUC 3VQ7A 3UIQA 4HCCA 4YDUA 3VQBA 3CIPA 1MWMA 1YTUA 1YVNA 4JI8K 1ZBUA 3AVFA 3OYCA 4DSFA 4E7LA 3TTDA 1XMOK 2VWKA 3OYKA 3CPEA 4WE1A 4DQQA 4NO7A 2OPQA 3NH2A 1L3TA 5HRRA 2A1RA 3E1YA 2YNGA 4QS9A 2WONA 4H0PA 4CGDA 4H4MA 2WBNA 3UE5A 3IG1A 2O8EA 2G8FA 1BWFO 3QO9A 3ID6A 3L4QA 5KPZA 1WOQA 1BQNA 3CC4N 2G8WA 2D0PA 5AJ3K 2Q0RA 1NK8A 1HLUA 2BH1A 4H5WA 4QS8A 1DTQA 4M3YA 3BF3A 1K8KA 3WT0A 3RMAA 3OYHA 3M5RA 2OYQA 1V4TA 3AAPA 3HPHA 1BI4A 1GLAG 4DSKA 2Z1HA 4R5PA 3K9KA 2Q3SA 1UOCA 3C6TA 3T69A 1H1VA 1QQMA 4GY2B 4F3OA 3T3FA 4BRDA 3THYB 4DLGA 2F8TA 4OX9K 4E1JA 5KPRA 2NLXA 1QQCA 3VGLA 3O3FA 1MU2A 2P9PB 4A5AA 4CEEA 4X64K 5GAHP 2X74A 2NRHA 3PIPL 3PX0A 3U9ZA 5AQUA 3KWGA 1B92A 3SQ2A 5J2MA 3DXKA 1XNRK 4IFVA 4DFPA 4KTZA 3OS0A 4H0TB 3EY1A 3J7YP 1YI2N 2B5JA 5LJWA 3LAKA 1ZBLA 1Q82O 5DK5A 5CY4A 3VEOA 2V51B 1ILYA 1T05A 3LPTA 2F96A 2FXUA 3DAWA 1HNZK 4CGFA 3MK6A 2KZMA 1HUXA 2G8VA 4EHUA 3C95A 4B3TK 1EKEA 2O4IA 3IKMA 3R6MA 3J81O 1WSGA 5GINA 4DQPA 1CZAN 4CK3A 3O3GA 1KD1O 2GUIA 3VEVA 4EAHD 3U3YA 1KVCA 4BR5A 3T19A 3O1WA 3KJVA 5FLXO 3AGKA 3SMPA 3LDSA 4PA1A 3O4WA 2QWNA 4BR7A 4B3SK 2QWPA 3V9SA 4Z0UA 3DLHA 4DR2K 2B4JA 4DQSA 3B8AX 3ISNC 4GKJK 4N47A 1QSSA 4LC9B 3H3NO 3V9ZA 3NMUA 2A41A 1NGGA 2HMPA 1J6ZA 2D0BA 5C25A 3K5OA 3CCQN 4BR9A 3OYDA 1SZ2A 3MEGA 1D9DA 4I9LA 1NKCA 5HLFA 4Z4CA 4DTNA 4BRCA 2CGLA 3HOSA 1NK6A 1IKVA 4W5OA 4LH4A 2D4WA 4BRHA 4CJVA 1WUAA 3H1QA 4BG8A 4CEAA 3O5BA 4E19A 2EWSA 4DKWA 1XI1A 1VSEA 3VF4A 3T1AA 1YTAA 2D0CA 3MCAB 1TAQA 2HHQA 2YJEA 4NCGA 4PUOA 1CZBA 3A8YA 3KLIA 3THWA 5HROA 4JI2K 1SL2A 4DTSA 4QS7A 1RBRA 1RGIA 1KXPA 1NGCA 1VSDA 3M3ZA 1FK9A 4WFBL 3OYGA 3ZSWA 4KHWA 3GL1A 3DYAA 2O8FB 3NF8A 4CZGA 4IKFA 3F2KA 4J2EA 3LP0A 4EZ9A 3QINA 4DF4A 5E41A 3VMFB 2P5OA 3KKSA 4B9NA 1IKWA 4C1NK 3EN9A 3W0LA 2I5JA 4YOTA 1DEJA 3UKUA 4C1NI 1V4SA 1FKOA 3DLBA 1U2VA 2HF4A 1TYQA 4GMJB 4JHDA 3S41A 3CCJN 1WAJA 1Y97A 4CZIA 3DRRA 1HPZA 2V7ZA 3I8BA 2P9NB 3P39A 3CG7A 2AJQA 3TSQA 3HT3A 3QBWA 3OA9A 3EKSA 1RT7A 1YVUA 3S3OA 4FWPA 4IBNA 4FJLA 1VQPN 2A5XA 4GV6A 1ESVA 3MDQA 5BPNA 5BRDA 3MN5A 4IOAL 4QAGA 4JAXA 5F1XA 3DLEA 3HPGA 3OYFA 5C2DA 4B1XB 1GOBA 3QMLA 4LSNA 5AQTA 3PV8A 4DQIA 1TK0A 1T6DA 1CLQA 2BUPA 4FJIA 1NNEA 4A61A 3HVRA 3U8XA 4C8LA 2KFNA 1CXQA 2YNFA 2HSTA 1RDCA 4BQZA 3HSCA 4EZ6A 5FPNA 2IS3A 2PAVA 3MMVA 5BRHA 1ZBIA 4A5BA 1TK8A 1BL3A 2DFEA 3D7EO 4RW9A 1YXQA 5AQNA 3SJHA 4F2SA 5KQ8A 1LV5A 3PIOL 4DQRA 1Q7YO 1JLQA 4E7JA 4M7XA 4PKHA 4E7KA 3I0RA 4FLUA 1YJ9N 4DSJA 3VENA 4G9ZA 5TKWA 1Z05A 2YV0X 3VQ6A 1K8AO 2OZSA 3C6HA 1BIZA 2Z1GA 4Y1CA 1U4BA 1T8EA 1B9FA 4NB4A 2VCPA 4BRLA 2NRRA 3MEEA 3QEWA 3A5OC 5LMNK 1EQYA 4HWIA 3VERA 4LF9K 4IZ9A 3L2QA 1K6YA 1GLJO 2RN2A 5BPMA 1FKPA 1S5JA 2JWLA 5JMVA 3CJ9A 5FRNA 4ID5A 1LW2A 3ZCMA 3H6EA 4CZEA 4KBOA 4A2AA 4BQLA 4DB3A 4RTFD 1TKDA 1KLNA 3NE6A 3AVLA 4KTWA 4CD3A 1LWFA 1Q8IA 3OYLA 1HKGA 3HBTA 4JI0K 1RTJA 4BGAA 3LDOA 1ZBHA 3SPZA 2O8CB 3M8SA 1Q81O 4KFBA 2OTJN 3CCLN 1LCUA 4CF2A 3KK1A 1S1TA 1RDWX 1XQSC 4IO8A 1C0UA 1WBDA 3RRHA 1XWLA 4ISFA 2P9SA 4B08A 4PY5A 1KSPA 4FJXA 4FVUA 1Q9YA 2XRIA 3HYFA 4RCHA 4YOWA 3AO3A 4IXCA 3SZ2A 1NKEA 1NGHA 1XC9A 3M8QA 4FWKA 4F3TA 2YHBA 1GLDG 5TKYA 2HBKA 3ZYYX 3ALYA 3QIPA 4KPYA 2GV9A 3C6AA 5EX5A 3JS6A 1IG9A 1RFQA 3PX6A 1QHAA 3CCEN 4KHQA 3ZLJA 3HP6A 4I6MA 3I55N 3THVA 4FJKA 4FK0A 3EO3A 4ILHA 3SUNA 4QCLA 5JLHA 3K58A 4UQGA 1KTQA 4JN4A 2IOCA 4FVMA 3CC7N 1YITN 2IVPA 4X65K 5I3UA 1LAWA 5GADP 4LF4K 4AHRA 4FJHA 4DV0K 3Q7CA 3QEVA 1NGAA 3E9LA 3OBYA 1RTIA 5F0XA 4C8MA 4EP4A 1ATRA 4K41A 2O8EB 4KRFA 3CFPA 4A59A 4HUEA 2H3GX 2CH5A 3IDHA 1VQNN 4H5VA 3TSUA 4DSIA 1WAFA 3TAPA 5FPDA 4XIUA 1K8KB 1QSYA 3OYAA 1RDAA 1WNSA 4AQYK 3V6DA 2DY4A 5FPMA 3CQYA 3T1HK 4CCHA 4MLHA 5M1KA 4M3TA 2CH6A 1BI4B 3VQ9A 3SBGA 1LW0A 3EEQA 3V81A 1I39A 2GX9A 1KCFA 3EZWA 3HJFA 2F8SA 3FZMA 3GE1A 1C0GA 4RW8A 1KVBA 3NBPA 3WXKA 2W40A 3K59A 3GG4A 2E6LA 4L3QA 4KAZA 3HTVA 4CVNE 3TAFA 3PLAA 1X9JA 4CESA 4DV7K 3OVNA 4BR2A 1VHXA 1HYZA 4BRNA 4KH4A 4FK2A 1ITGA 4J2AA 1HQEA 4IJAA 3VOVA 1YHQN 3KD1E 4B9TA 3DXKB 1MA9B 5AQFA 1SL1A 4KI6A 1XHXA 2O4GA 2YNIA 2OANA 2P9KA 4AILC 1HR0K 1W9HA 4BDPA 5CYQA 1A5VA 3K5MA 1FXXA 4OPJA 1S1VA 2A42A 1VRUA 4J2BA 4ILGB 1QQOA 3TR8A 1TVRA 2HHWA 1R59O 3VEXA 4C8KA 4M3XA 3O9UA 4JD2A 3KLEA 3WUHA 2NRVA 1RTDA 3LWLA 4DTRA 3UKRA 3CJ1A 1T03A 4PWDA 3ULEA 3CF5L 4Z94A 3PSIA 4KH5A 3DLRA 3OYMA 4M41A 2CGJA 4WCEL 1UAXA 1X1PA 2ZGYA 3VQ4A 4CE9A 4XH4A 4JS5A 1HKBA 1EP4A 3IUCA 4O4GA 4JKFA 2OCEA 3ENBA 3F5TA 1NBWA 3JAMO 5KPTA 2XY5A 3HSTB 3O9TA 1HYVA 4GVMA 5AQJA 4YOUA 5KRSA 5CHIA 1QTMA 4DTJA 1IBMK 5AZIB 2ZD1A 2P9UA 3MEDA 2HHHK 3PO5A 1RT3A 1SS6A 1WBBA 1W0HA 3GOIA 1EWQA 4AM7A 4LF8K 3G0ZA 4BR0A 1FW6A 1SV5A 3BDPA 3K5NA 3HVTA 1E4GT 1JCFA 5GAGP 1NGDA 3MXIA 4JI4K 1KAXA 2D5RA 4QOZB 4BRPA 4DV6K 1S9EA 3KIOA 3F73A 3THWB 3I33A 1BU6O 4B1UB
chains in the Genus database with same CATH topology
1HYSA 1C0MA 4CFCA 5SZTA 1Z25A 1DTTA 2D0BA 4BDZA 5C25A 2BANA 3K5OA 5HRNA 3OYDA 3MEGA 2Y1IA 1VK0A 4AHTA 3AO2A 3DOKA 1TL1A 4I9LA 1TKXA 3ZSOA 3ZT3A 4DS5A 1NKCA 1D9DA 1BQMA 4IFYA 3KKRA 3ZSYA 3S3NA 1C1AA 5HLFA 4Z4FA 4CIFA 1WN7A 4Y1DA 1RBUA 4Z4CA 4DTNA 2HHUA 2DFHA 2ETJA 4E89A 2E6MA 1RNHA 4CJSA 1JLEA 1NK6A 1IKVA 4YNQA 4LH4A 4W5OA 3S3MA 4O44A 1L5UA 1QSLA 3SV3A 4DTMA 1WSFA 4JRQA 1VSMA 1U47A 1HNIA 3O4QA 4KKOA 1A5WA 4AHCA 4CJVA 3LZJA 1TGOA 2WOMA 4CEAA 4E19A 1XI1A 1HNVA 4CF9A 1JL2A 1NK9A 2G8KA 4E7HA 4HVJA 3AVHA 4E3SA 1VSEA 4AHSA 2HHSA 3T1AA 1YTAA 2D0CA 4LD0A 4GW6A 1TAQA 2HHQA 4NCGA 4AH9A 4K8ZA 1NJZA 1NJXA 4PUOA 2BGGA 4M45A 1CZBA 4CF0A 1VRTA 2ATQA 4DTOA 1D9FA 4KO0A 4W5RA 3KLIA 5HROA 1NK0A 1SL2A 3U3GA 4DTSA 1RBRA 3NDKA 3RRGA 3LP3A 5CZ1A 3AVAA 1VSDA 3AA4A 2HMIA 2KFZA 1ASUA 1FK9A 1HJRA 3OYGA 3ZSWA 4KHWA 2XY7A 3DYAA 3NF8A 4Q5VA 3V9UA 4DU4A 1QS4A 3S9HA 4IKFA 1S9GA 3NAEA 3NFAA 4OLBA 1S6QA 4J2EA 1VSIA 1ZBFA 4F8RA 4OGEA 3LP0A 4EZ9A 2GBZA 3QINA 4KI4A 1JLCA 4H4OA 5E41A 4DF4A 2P5OA 4I9QA 1I3AA 3P5JA 3CM5A 4CJRA 3KKSA 4B9NA 4CEZA 4E0DA 1IKWA 3ULDA 5HRPA 2I5JA 4RW6A 4ZHRA 4FM2A 3AA5X 3KLFA 3M8PA 1FKOA 3DLBA 1NJYA 4GMJB 5KRTA 3ASMA 4CFDA 3OS2A 5DMRA 1WAJA 1Y97A 1BHLA 4OKJA 3WNHA 4CJKA 3V4IA 1S6PA 3PO4A 4B9VA 4FJ9A 3DRRA 3V9XA 4FJ5A 3ZSVA 4OLAA 1WLJA 1RBVA 1HPZA 3ZT0A 1X9WA 5D3GA 1N5YA 3DI6A 4CIEA 2BE2A 3CG7A 3NHGA 1WSIA 4DU1A 4KB0A 3HT3A 2AJQA 1B9DA 4CGJA 4CEOA 1XHZA 4OVLA 1RT7A 1YVUA 2QXFA 3V1QA 3S3OA 4ELUA 2VG5A 1GOAA 1VSKA 3AVIA 4M3UA 4IBNA 4HUGA 2P51A 4FJLA 3AVCA 3IRXA 3D45A 5EU7A 4FLTA 1QHTA 4CHZA 2IDOA 3H08A 3KK2A 5KGXA 3P1GA 2QK9A 1VSHA 3TAMA 1VSFA 4CGIA 4BWJA 4CJTA 3LANA 4DS4A 1WSJA 4FZZA 1RTHA 3CFOA 1RT1A 3LAMA 5KGWA 4QAGA 3VQDA 4CJLA 3C94A 3ZSQA 1JLFA 2X78A 2E4LA 1NOZA 3DLEA 3HPGA 3OYFA 1S1XA 1GOBA 2FBVA 3ZT4A 1CZ9A 3LP1A 2X6NA 3SQ4A 1LWEA 4RW7A 3L2RA 4LSNA 4F2RA 3PV8A 4DQIA 4M3ZA 2YKMA 4CHYA 1TK0A 2HHXA 1CLQA 4FJIA 3ZSRA 4I2QA 3HVRA 1JXBA 4C8LA 3RWUA 1IKYA 2KFNA 1CXQA 1UA0A 2YNFA 1D5AA 4MFBA 1RDCA 2ZQBA 3RR7A 3AVNA 4CECA 2PYJA 4EZ6A 3QLHA 4CJEA 2IS3A 1ZBIA 4BE2A 3AA3A 1U48A 3QEPA 1BL3A 1TK8A 4KHNA 2DFEA 1EXQA 4H8KA 4RW9A 2PYLA 1ASVA 4CGGA 3JSMA 4FW2A 1J9AA 3OS1A 1REVA 1TK5A 4F2SA 1LV5A 3KLHA 2VG6A 4DQRA 4DFMA 1NK4A 4M42A 1JLQA 4FLYA 4E7JA 5FDLA 4IG3A 3VQCA 4E7KA 4I2PA 5HP1A 3I0RA 4FLUA 2RF2A 1DLOA 5C24A 4OPKA 3TAGA 1N6QA 4FJJA 1BGXT 4DSJA 3VQ6A 2YV0X 4CJWA 3AVJA 2IC3A 1SL0A 2YNHA 3I0SA 4JRPA 2OZSA 1BIZA 2EHGA 2Z1GA 4Y1CA 2FC0A 3I8DA 4DTXA 1B9FA 4DG1A 3CYMA 1U4BA 1T8EA 4B8CA 3OYIA 2IAJA 3AO1A 4DF8A 3P83D 3LPUA 2B6AA 4KTQA 1S1UA 4AHVA 4DFKA 3MEEA 3QEWA 1BIUA 4N5SA 1RBSA 1RDDA 3K2PA 3QIOA 3FFIA 4CJQA 3SNNA 3DOLA 3DLGA 3CFRA 2Z1JA 1GOCA 5JS2A 2OZMA 1BCMA 3B6OA 4YFUA 4JS4A 4FLVA 1RT5A 3DMJA 1K6YA 1RILA 2RN2A 3L2QA 2BDPA 1L3SA 1FKPA 4FW1A 3L2WA 2FBTA 3DM2A 2Y1JA 1S5JA 4B3OA 4CHPA 4CF1A 5FRNA 4W5TA 4DU3A 5FRMA 4ID5A 1LW2A 3ZCMA 2HHVA 4FYDA 3NF7A 3TANA 1D8YA 3VA0A 4W5QA 4CK1A 1LAVA 4C8NA 4DWIA 3VQAA 5T7BA 1TKDA 4ELVA 4LY7A 4JLHA 3NGYA 3ZT1A 1KLNA 3NE6A 3AVLA 4KTWA 3VQ5A 2EX3A 1LWFA 4NYNA 1Q8IA 5SWMA 2FBYA 2XY8A 3JYTA 3OYLA 3HL8A 1RT4A 2XY6A 3MAQA 1KFSA 4KREA 1VSLA 4CFBA 1G15A 2VG7A 4HUFA 4FM0A 4B9MA 3SQ1A 3AVGA 4E1NA 1C6VA 4ICLA 4OGCA 3KK3A 3HO1A 1RTJA 3EYZA 4M3RA 1WSEA 3ZSXA 3SPZA 2OPPA 1ZBHA 3OJSA 3M8SA 3NGZA 4HTUA 3TAQA 4FLWA 4KFBA 3AVMA 4ID1A 4CF2A 4FZYA 4IDKA 3KK1A 3MECA 1S1TA 1JXEA 3CM6A 2QKKA 3VQEA 1S1WA 3NCIA 3TI0A 2OPSA 4IG0A 4Z4IA 1TAUA 4LH5A 4NYFA 1KLMA 1C0UA 4OKKA 4G1QA 4BE1A 3RRHA 1XWLA 3RTVA 2Z1IA 1IO2A 2G8HA 2PZSA 3M8RA 4B08A 1L3VA 3AVBA 4PY5A 1C1BA 3DRSA 4OJRA 3NH0A 1KSPA 4FJXA 1Q9YA 2XRIA 3HYFA 4B9SA 3L2UA 4CJPA 2A1SA 3KLGA 2X6SA 1WSHA 1EETA 3AO3A 3OYJA 3V1RA 4CEDA 4BDYA 4DLEA 4C8OA 3SZ2A 1NKEA 1IH7A 2HNDA 3QEIA 3M8QA 1XC9A 3LZIA 4F3TA 2YHBA 1HQUA 5KTQA 2HNZA 3HXMA 4CK2A 4EP5A 1J5OA 3ALYA 1TKTA 3L3UA 3NF9A 3QIPA 4FZXC 4KPYA 2GV9A 4AHUA 1IG9A 4Z4HA 3PX6A 4HCBA 3OYBA 1YT3A 4KHQA 1TV6A 3QESA 3RMCA 3HP6A 3V1OA 3THVA 3OY9A 3NGIA 4FJKA 3HPOA 4FK0A 4NCBA 3SUNA 4PQUA 3HK2A 4QCLA 3LALA 1KRPA 1SKWA 1JL1A 3AA2A 3K58A 4L8RB 1A5XA 4F4KA 4CIGA 2JLEA 2YHAA 4UQGA 4DTPA 1KTQA 3VA3A 1RT6A 5HRSA 2W42A 2P1JA 3AO4A 2IOCA 2ZE2A 4FVMA 4KV8A 4K8XA 3O3HA 1NOYA 1ASWA 5I3UA 3L2VA 1LAWA 4OKEA 3IS9A 4DTUA 1ZYQA 1BCOA 1CXUA 3VN5A 4AHRA 4B8AB 4CHNA 1J54A 4CJ4A 4FJHA 2KZZA 3OYEA 2DFFA 3QEXA 3RMBA 1RT2A 3QEVA 4O0JA 4BWMA 1LWCA 1KVAA 1RTIA 4CFAA 4FLXA 3G10A 2FBXA 4C8MA 3E01A 4EP4A 1UA1A 4KRFA 1TKZA 3CFPA 4FJMA 4HUEA 3D0PA 4E1MA 1X9SA 4B9LA 4CJ5A 3TABA 1RBTA 2HHTA 4FJGA 4DSIA 4BACA 1WAFA 1HRHA 4N76A 3PY8A 3SQ0A 4CHOA 1Z26A 3QNOA 3TAPA 3SCXA 1NKBA 4XIUA 4NCAA 3SYZA 1RDBA 1R0AA 5CZ2A 3WNGA 2NUBA 2G8UA 1QSYA 3VQ7A 1SKRA 3OYAA 3UIQA 4HCCA 3AO5A 1RDAA 1WNSA 1O1WA 3VQBA 2HVHA 3V6DA 2DY4A 4I7FA 4M3TA 4CCHA 4FM1A 1YTUA 4DFJA 1BI4B 1ZBUA 3VQ9A 2RKIA 3AVFA 1LW0A 3OYCA 4DSFA 4E7LA 3V81A 1U45A 3QNNA 2P5GA 1I39A 3HJFA 1KCFA 2F8SA 3V9WA 2VWKA 3KTQA 4DSEA 3OYKA 1SUQA 4RW8A 4WE1A 4DQQA 4N56A 3SJJA 3ITHA 3ZSZA 3PUFA 1KVBA 2OPQA 3NBPA 3NH2A 5HRRA 3OYNA 2A1RA 1L3TA 1T7PA 2YNGA 5J1EA 3K59A 1IKXA 5K14A 2E6LA 4KAZA 4RG8A 3OJUA 4FJNA 4CJ3A 4ZTJA 2WONA 4CGDA 4H4MA 3TAFA 2KW4A 3IG1A 4FLZA 2G8FA 3SUPA 3NF6A 3QO9A 4CESA 3OVNA 3VQQA 4FJ8A 2RPIA 4LSLA 3QETA 2HNYA 3RMDA 1BQNA 2G8WA 1HYZA 2OPRA 3MXJA 4FK2A 1NK8A 4CEFA 1ITGA 3VQ8A 1HQEA 4J2AA 3KD1E 1DTQA 4B9TA 1JLGA 2ITGA 1U49A 2KTQA 4M3YA 5JS1A 3RMAA 1JLAA 4B9UA 4O55A 3OYHA 3TAEA 3IAYA 1U04A 1SL1A 4CHQA 4KI6A 1XHXA 1NJWA 2OYQA 2O4GA 5J2PA 2YNIA 3KD5E 3HPHA 1JKHA 2IGIA 4AILC 1RCHA 1BI4A 1KFDA 4O5BA 1W9HA 1BISA 3AVKA 4DSKA 2Z1HA 4FK4A 4CF8A 4BE0A 4R5PA 2Q3SA 4MQ3A 1HMVA 3SUOA 4KB1A 4FXDA 3TARA 3WNEA 2YKNA 1UOCA 3HM9A 3C6TA 1A5VA 5CYQA 3ZT2A 3K5LA 3K5MA 3CQ8A 1NK5A 1FXXA 4OPJA 1SKSA 4N41A 5FROA 4Z4EA 1S1VA 1Q9XA 4F3OA 3U6FA 2G8IA 3T3FA 4DSLA 1VRUA 4J2BA 4DLGA 5CYMA 2XO7A 3HP9A 3WNFA 1X9MA 3TR8A 2F8TA 5I42A 1TVRA 2HHWA 1QQCA 3NH1A 3O3FA 4HHTA 1MU2A 4C8KA 1F21A 4M3XA 4CEEA 2X74A 4FJ7A 3C6UA 3PX0A 1EX4A 3SI6A 4CGHA 4BDPA 3KLEA 3VQPA 1B92A 3SQ2A 5J2MA 3F9KA 1RTDA 4ELTA 1NK7A 1C1CA 3AV9A 3LWLA 2VWJA 4IFVA 3K57A 2R7YA 4FCYA 4KTZA 4DTRA 4DFPA 4ZTFA 2PY5A 1TL3A 3DLKA 5J2NA 3OS0A 3EY1A 1J53A 2LSNA 2B5JA 3SV4A 2D0AA 1T03A 4PWDA 3PX4A 4CEBA 3LAKA 1ZBLA 4TSXA 4Q0BA 5DK5A 5CY4A 3TWHA 3A2FA 3BGRA 3B6PA 2DTUA 1T05A 2JGUA 4E7IA 3LPTA 3DLRA 5HBMA 4CEQA 3OYMA 4M41A 4DMNA 2F96A 3LP2A 1UAXA 4CGFA 1X1PA 2HVIA 3VQ4A 4CE9A 2KZMA 1VSJA 5J2QA 4JS5A 4KHYA 4RW4A 1EP4A 4O4GA 3QERA 2G8VA 4J2DA 3L8BA 4KHSA 3C95A 5KI6A 1EKEA 2O4IA 4Z4GA 1WSGA 2OA8A 3DRPA 2XY5A 3HSTB 4GVMA 1HYVA 3MXMA 1QTMA 5KRSA 4DQPA 4CK3A 3O3GA 2GUIA 4DTJA 4M3WA 3U3YA 1KVCA 5C42A 4CERA 2ZD1A 3MEDA 3PO5A 2HB5A 1RT3A 3O4NA 3T19A 4CJUA 3KJVA 1C0TA 1JLBA 3SPYA 3RR8A 4W5NA 3LDSA 1W0HA 4PA1A 4CJFA 3LWMA 4KHUA 2HW3A 2XHBA 3V9SA 4Z0UA 3G0ZA 3DLHA 1QE1A 1UWBA 2B4JA 3EZ5A 4DQSA 1SV5A 3BDPA 3K5NA 3HVTA 3ISNC 3SUQA 4N47A 2QKBA 1QSSA 2KQ2A 3MXIA 3L3VA 1L3UA 2D5RA 4QOZB 1S9EA 3KIOA 3V9ZA 3F73A 4O0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYS A;  1C0M A;  4CFC A;  5SZT A;  1Z25 A;  1DTT A;  2D0B A;  4BDZ A;  5C25 A;  2BAN A;  3K5O A;  5HRN A;  3OYD A;  3MEG A;  2Y1I A;  1VK0 A;  4AHT A;  3AO2 A;  3DOK A;  1TL1 A;  4I9L A;  1TKX A;  3ZSO A;  3ZT3 A;  4DS5 A;  1NKC A;  1D9D A;  1BQM A;  4IFY A;  3KKR A;  3ZSY A;  3S3N A;  1C1A A;  5HLF A;  4Z4F A;  4CIF A;  1WN7 A;  4Y1D A;  1RBU A;  4Z4C A;  4DTN A;  2HHU A;  2DFH A;  2ETJ A;  4E89 A;  2E6M A;  1RNH A;  4CJS A;  1JLE A;  1NK6 A;  1IKV A;  4YNQ A;  4LH4 A;  4W5O A;  3S3M A;  4O44 A;  1L5U A;  1QSL A;  3SV3 A;  4DTM A;  1WSF A;  4JRQ A;  1VSM A;  1U47 A;  1HNI A;  3O4Q A;  4KKO A;  1A5W A;  4AHC A;  4CJV A;  3LZJ A;  1TGO A;  2WOM A;  4CEA A;  4E19 A;  1XI1 A;  1HNV A;  4CF9 A;  1JL2 A;  1NK9 A;  2G8K A;  4E7H A;  4HVJ A;  3AVH A;  4E3S A;  1VSE A;  4AHS A;  2HHS A;  3T1A A;  1YTA A;  2D0C A;  4LD0 A;  4GW6 A;  1TAQ A;  2HHQ A;  4NCG A;  4AH9 A;  4K8Z A;  1NJZ A;  1NJX A;  4PUO A;  2BGG A;  4M45 A;  1CZB A;  4CF0 A;  1VRT A;  2ATQ A;  4DTO A;  1D9F A;  4KO0 A;  4W5R A;  3KLI A;  5HRO A;  1NK0 A;  1SL2 A;  3U3G A;  4DTS A;  1RBR A;  3NDK A;  3RRG A;  3LP3 A;  5CZ1 A;  3AVA A;  1VSD A;  3AA4 A;  2HMI A;  2KFZ A;  1ASU A;  1FK9 A;  1HJR A;  3OYG A;  3ZSW A;  4KHW A;  2XY7 A;  3DYA A;  3NF8 A;  4Q5V A;  3V9U A;  4DU4 A;  1QS4 A;  3S9H A;  4IKF A;  1S9G A;  3NAE A;  3NFA A;  4OLB A;  1S6Q A;  4J2E A;  1VSI A;  1ZBF A;  4F8R A;  4OGE A;  3LP0 A;  4EZ9 A;  2GBZ A;  3QIN A;  4KI4 A;  1JLC A;  4H4O A;  5E41 A;  4DF4 A;  2P5O A;  4I9Q A;  1I3A A;  3P5J A;  3CM5 A;  4CJR A;  3KKS A;  4B9N A;  4CEZ A;  4E0D A;  1IKW A;  3ULD A;  5HRP A;  2I5J A;  4RW6 A;  4ZHR A;  4FM2 A;  3AA5 X;  3KLF A;  3M8P A;  1FKO A;  3DLB A;  1NJY A;  4GMJ B;  5KRT A;  3ASM A;  4CFD A;  3OS2 A;  5DMR A;  1WAJ A;  1Y97 A;  1BHL A;  4OKJ A;  3WNH A;  4CJK A;  3V4I A;  1S6P A;  3PO4 A;  4B9V A;  4FJ9 A;  3DRR A;  3V9X A;  4FJ5 A;  3ZSV A;  4OLA A;  1WLJ A;  1RBV A;  1HPZ A;  3ZT0 A;  1X9W A;  5D3G A;  1N5Y A;  3DI6 A;  4CIE A;  2BE2 A;  3CG7 A;  3NHG A;  1WSI A;  4DU1 A;  4KB0 A;  3HT3 A;  2AJQ A;  1B9D A;  4CGJ A;  4CEO A;  1XHZ A;  4OVL A;  1RT7 A;  1YVU A;  2QXF A;  3V1Q A;  3S3O A;  4ELU A;  2VG5 A;  1GOA A;  1VSK A;  3AVI A;  4M3U A;  4IBN A;  4HUG A;  2P51 A;  4FJL A;  3AVC A;  3IRX A;  3D45 A;  5EU7 A;  4FLT A;  1QHT A;  4CHZ A;  2IDO A;  3H08 A;  3KK2 A;  5KGX A;  3P1G A;  2QK9 A;  1VSH A;  3TAM A;  1VSF A;  4CGI A;  4BWJ A;  4CJT A;  3LAN A;  4DS4 A;  1WSJ A;  4FZZ A;  1RTH A;  3CFO A;  1RT1 A;  3LAM A;  5KGW A;  4QAG A;  3VQD A;  4CJL A;  3C94 A;  3ZSQ A;  1JLF A;  2X78 A;  2E4L A;  1NOZ A;  3DLE A;  3HPG A;  3OYF A;  1S1X A;  1GOB A;  2FBV A;  3ZT4 A;  1CZ9 A;  3LP1 A;  2X6N A;  3SQ4 A;  1LWE A;  4RW7 A;  3L2R A;  4LSN A;  4F2R A;  3PV8 A;  4DQI A;  4M3Z A;  2YKM A;  4CHY A;  1TK0 A;  2HHX A;  1CLQ A;  4FJI A;  3ZSR A;  4I2Q A;  3HVR A;  1JXB A;  4C8L A;  3RWU A;  1IKY A;  2KFN A;  1CXQ A;  1UA0 A;  2YNF A;  1D5A A;  4MFB A;  1RDC A;  2ZQB A;  3RR7 A;  3AVN A;  4CEC A;  2PYJ A;  4EZ6 A;  3QLH A;  4CJE A;  2IS3 A;  1ZBI A;  4BE2 A;  3AA3 A;  1U48 A;  3QEP A;  1BL3 A;  1TK8 A;  4KHN A;  2DFE A;  1EXQ A;  4H8K A;  4RW9 A;  2PYL A;  1ASV A;  4CGG A;  3JSM A;  4FW2 A;  1J9A A;  3OS1 A;  1REV A;  1TK5 A;  4F2S A;  1LV5 A;  3KLH A;  2VG6 A;  4DQR A;  4DFM A;  1NK4 A;  4M42 A;  1JLQ A;  4FLY A;  4E7J A;  5FDL A;  4IG3 A;  3VQC A;  4E7K A;  4I2P A;  5HP1 A;  3I0R A;  4FLU A;  2RF2 A;  1DLO A;  5C24 A;  4OPK A;  3TAG A;  1N6Q A;  4FJJ A;  1BGX T;  4DSJ A;  3VQ6 A;  2YV0 X;  4CJW A;  3AVJ A;  2IC3 A;  1SL0 A;  2YNH A;  3I0S A;  4JRP A;  2OZS A;  1BIZ A;  2EHG A;  2Z1G A;  4Y1C A;  2FC0 A;  3I8D A;  4DTX A;  1B9F A;  4DG1 A;  3CYM A;  1U4B A;  1T8E A;  4B8C A;  3OYI A;  2IAJ A;  3AO1 A;  4DF8 A;  3P83 D;  3LPU A;  2B6A A;  4KTQ A;  1S1U A;  4AHV A;  4DFK A;  3MEE A;  3QEW A;  1BIU A;  4N5S A;  1RBS A;  1RDD A;  3K2P A;  3QIO A;  3FFI A;  4CJQ A;  3SNN A;  3DOL A;  3DLG A;  3CFR A;  2Z1J A;  1GOC A;  5JS2 A;  2OZM A;  1BCM A;  3B6O A;  4YFU A;  4JS4 A;  4FLV A;  1RT5 A;  3DMJ A;  1K6Y A;  1RIL A;  2RN2 A;  3L2Q A;  2BDP A;  1L3S A;  1FKP A;  4FW1 A;  3L2W A;  2FBT A;  3DM2 A;  2Y1J A;  1S5J A;  4B3O A;  4CHP A;  4CF1 A;  5FRN A;  4W5T A;  4DU3 A;  5FRM A;  4ID5 A;  1LW2 A;  3ZCM A;  2HHV A;  4FYD A;  3NF7 A;  3TAN A;  1D8Y A;  3VA0 A;  4W5Q A;  4CK1 A;  1LAV A;  4C8N A;  4DWI A;  3VQA A;  5T7B A;  1TKD A;  4ELV A;  4LY7 A;  4JLH A;  3NGY A;  3ZT1 A;  1KLN A;  3NE6 A;  3AVL A;  4KTW A;  3VQ5 A;  2EX3 A;  1LWF A;  4NYN A;  1Q8I A;  5SWM A;  2FBY A;  2XY8 A;  3JYT A;  3OYL A;  3HL8 A;  1RT4 A;  2XY6 A;  3MAQ A;  1KFS A;  4KRE A;  1VSL A;  4CFB A;  1G15 A;  2VG7 A;  4HUF A;  4FM0 A;  4B9M A;  3SQ1 A;  3AVG A;  4E1N A;  1C6V A;  4ICL A;  4OGC A;  3KK3 A;  3HO1 A;  1RTJ A;  3EYZ A;  4M3R A;  1WSE A;  3ZSX A;  3SPZ A;  2OPP A;  1ZBH A;  3OJS A;  3M8S A;  3NGZ A;  4HTU A;  3TAQ A;  4FLW A;  4KFB A;  3AVM A;  4ID1 A;  4CF2 A;  4FZY A;  4IDK A;  3KK1 A;  3MEC A;  1S1T A;  1JXE A;  3CM6 A;  2QKK A;  3VQE A;  1S1W A;  3NCI A;  3TI0 A;  2OPS A;  4IG0 A;  4Z4I A;  1TAU A;  4LH5 A;  4NYF A;  1KLM A;  1C0U A;  4OKK A;  4G1Q A;  4BE1 A;  3RRH A;  1XWL A;  3RTV A;  2Z1I A;  1IO2 A;  2G8H A;  2PZS A;  3M8R A;  4B08 A;  1L3V A;  3AVB A;  4PY5 A;  1C1B A;  3DRS A;  4OJR A;  3NH0 A;  1KSP A;  4FJX A;  1Q9Y A;  2XRI A;  3HYF A;  4B9S A;  3L2U A;  4CJP A;  2A1S A;  3KLG A;  2X6S A;  1WSH A;  1EET A;  3AO3 A;  3OYJ A;  3V1R A;  4CED A;  4BDY A;  4DLE A;  4C8O A;  3SZ2 A;  1NKE A;  1IH7 A;  2HND A;  3QEI A;  3M8Q A;  1XC9 A;  3LZI A;  4F3T A;  2YHB A;  1HQU A;  5KTQ A;  2HNZ A;  3HXM A;  4CK2 A;  4EP5 A;  1J5O A;  3ALY A;  1TKT A;  3L3U A;  3NF9 A;  3QIP A;  4FZX C;  4KPY A;  2GV9 A;  4AHU A;  1IG9 A;  4Z4H A;  3PX6 A;  4HCB A;  3OYB A;  1YT3 A;  4KHQ A;  1TV6 A;  3QES A;  3RMC A;  3HP6 A;  3V1O A;  3THV A;  3OY9 A;  3NGI A;  4FJK A;  3HPO A;  4FK0 A;  4NCB A;  3SUN A;  4PQU A;  3HK2 A;  4QCL A;  3LAL A;  1KRP A;  1SKW A;  1JL1 A;  3AA2 A;  3K58 A;  4L8R B;  1A5X A;  4F4K A;  4CIG A;  2JLE A;  2YHA A;  4UQG A;  4DTP A;  1KTQ A;  3VA3 A;  1RT6 A;  5HRS A;  2W42 A;  2P1J A;  3AO4 A;  2IOC A;  2ZE2 A;  4FVM A;  4KV8 A;  4K8X A;  3O3H A;  1NOY A;  1ASW A;  5I3U A;  3L2V A;  1LAW A;  4OKE A;  3IS9 A;  4DTU A;  1ZYQ A;  1BCO A;  1CXU A;  3VN5 A;  4AHR A;  4B8A B;  4CHN A;  1J54 A;  4CJ4 A;  4FJH A;  2KZZ A;  3OYE A;  2DFF A;  3QEX A;  3RMB A;  1RT2 A;  3QEV A;  4O0J A;  4BWM A;  1LWC A;  1KVA A;  1RTI A;  4CFA A;  4FLX A;  3G10 A;  2FBX A;  4C8M A;  3E01 A;  4EP4 A;  1UA1 A;  4KRF A;  1TKZ A;  3CFP A;  4FJM A;  4HUE A;  3D0P A;  4E1M A;  1X9S A;  4B9L A;  4CJ5 A;  3TAB A;  1RBT A;  2HHT A;  4FJG A;  4DSI A;  4BAC A;  1WAF A;  1HRH A;  4N76 A;  3PY8 A;  3SQ0 A;  4CHO A;  1Z26 A;  3QNO A;  3TAP A;  3SCX A;  1NKB A;  4XIU A;  4NCA A;  3SYZ A;  1RDB A;  1R0A A;  5CZ2 A;  3WNG A;  2NUB A;  2G8U A;  1QSY A;  3VQ7 A;  1SKR A;  3OYA A;  3UIQ A;  4HCC A;  3AO5 A;  1RDA A;  1WNS A;  1O1W A;  3VQB A;  2HVH A;  3V6D A;  2DY4 A;  4I7F A;  4M3T A;  4CCH A;  4FM1 A;  1YTU A;  4DFJ A;  1BI4 B;  1ZBU A;  3VQ9 A;  2RKI A;  3AVF A;  1LW0 A;  3OYC A;  4DSF A;  4E7L A;  3V81 A;  1U45 A;  3QNN A;  2P5G A;  1I39 A;  3HJF A;  1KCF A;  2F8S A;  3V9W A;  2VWK A;  3KTQ A;  4DSE A;  3OYK A;  1SUQ A;  4RW8 A;  4WE1 A;  4DQQ A;  4N56 A;  3SJJ A;  3ITH A;  3ZSZ A;  3PUF A;  1KVB A;  2OPQ A;  3NBP A;  3NH2 A;  5HRR A;  3OYN A;  2A1R A;  1L3T A;  1T7P A;  2YNG A;  5J1E A;  3K59 A;  1IKX A;  5K14 A;  2E6L A;  4KAZ A;  4RG8 A;  3OJU A;  4FJN A;  4CJ3 A;  4ZTJ A;  2WON A;  4CGD A;  4H4M A;  3TAF A;  2KW4 A;  3IG1 A;  4FLZ A;  2G8F A;  3SUP A;  3NF6 A;  3QO9 A;  4CES A;  3OVN A;  3VQQ A;  4FJ8 A;  2RPI A;  4LSL A;  3QET A;  2HNY A;  3RMD A;  1BQN A;  2G8W A;  1HYZ A;  2OPR A;  3MXJ A;  4FK2 A;  1NK8 A;  4CEF A;  1ITG A;  3VQ8 A;  1HQE A;  4J2A A;  3KD1 E;  1DTQ A;  4B9T A;  1JLG A;  2ITG A;  1U49 A;  2KTQ A;  4M3Y A;  5JS1 A;  3RMA A;  1JLA A;  4B9U A;  4O55 A;  3OYH A;  3TAE A;  3IAY A;  1U04 A;  1SL1 A;  4CHQ A;  4KI6 A;  1XHX A;  1NJW A;  2OYQ A;  2O4G A;  5J2P A;  2YNI A;  3KD5 E;  3HPH A;  1JKH A;  2IGI A;  4AIL C;  1RCH A;  1BI4 A;  1KFD A;  4O5B A;  1W9H A;  1BIS A;  3AVK A;  4DSK A;  2Z1H A;  4FK4 A;  4CF8 A;  4BE0 A;  4R5P A;  2Q3S A;  4MQ3 A;  1HMV A;  3SUO A;  4KB1 A;  4FXD A;  3TAR A;  3WNE A;  2YKN A;  1UOC A;  3HM9 A;  3C6T A;  1A5V A;  5CYQ A;  3ZT2 A;  3K5L A;  3K5M A;  3CQ8 A;  1NK5 A;  1FXX A;  4OPJ A;  1SKS A;  4N41 A;  5FRO A;  4Z4E A;  1S1V A;  1Q9X A;  4F3O A;  3U6F A;  2G8I A;  3T3F A;  4DSL A;  1VRU A;  4J2B A;  4DLG A;  5CYM A;  2XO7 A;  3HP9 A;  3WNF A;  1X9M A;  3TR8 A;  2F8T A;  5I42 A;  1TVR A;  2HHW A;  1QQC A;  3NH1 A;  3O3F A;  4HHT A;  1MU2 A;  4C8K A;  1F21 A;  4M3X A;  4CEE A;  2X74 A;  4FJ7 A;  3C6U A;  3PX0 A;  1EX4 A;  3SI6 A;  4CGH A;  4BDP A;  3KLE A;  3VQP A;  1B92 A;  3SQ2 A;  5J2M A;  3F9K A;  1RTD A;  4ELT A;  1NK7 A;  1C1C A;  3AV9 A;  3LWL A;  2VWJ A;  4IFV A;  3K57 A;  2R7Y A;  4FCY A;  4KTZ A;  4DTR A;  4DFP A;  4ZTF A;  2PY5 A;  1TL3 A;  3DLK A;  5J2N A;  3OS0 A;  3EY1 A;  1J53 A;  2LSN A;  2B5J A;  3SV4 A;  2D0A A;  1T03 A;  4PWD A;  3PX4 A;  4CEB A;  3LAK A;  1ZBL A;  4TSX A;  4Q0B A;  5DK5 A;  5CY4 A;  3TWH A;  3A2F A;  3BGR A;  3B6P A;  2DTU A;  1T05 A;  2JGU A;  4E7I A;  3LPT A;  3DLR A;  5HBM A;  4CEQ A;  3OYM A;  4M41 A;  4DMN A;  2F96 A;  3LP2 A;  1UAX A;  4CGF A;  1X1P A;  2HVI A;  3VQ4 A;  4CE9 A;  2KZM A;  1VSJ A;  5J2Q A;  4JS5 A;  4KHY A;  4RW4 A;  1EP4 A;  4O4G A;  3QER A;  2G8V A;  4J2D A;  3L8B A;  4KHS A;  3C95 A;  5KI6 A;  1EKE A;  2O4I A;  4Z4G A;  1WSG A;  2OA8 A;  3DRP A;  2XY5 A;  3HST B;  4GVM A;  1HYV A;  3MXM A;  1QTM A;  5KRS A;  4DQP A;  4CK3 A;  3O3G A;  2GUI A;  4DTJ A;  4M3W A;  3U3Y A;  1KVC A;  5C42 A;  4CER A;  2ZD1 A;  3MED A;  3PO5 A;  2HB5 A;  1RT3 A;  3O4N A;  3T19 A;  4CJU A;  3KJV A;  1C0T A;  1JLB A;  3SPY A;  3RR8 A;  4W5N A;  3LDS A;  1W0H A;  4PA1 A;  4CJF A;  3LWM A;  4KHU A;  2HW3 A;  2XHB A;  3V9S A;  4Z0U A;  3G0Z A;  3DLH A;  1QE1 A;  1UWB A;  2B4J A;  3EZ5 A;  4DQS A;  1SV5 A;  3BDP A;  3K5N A;  3HVT A;  3ISN C;  3SUQ A;  4N47 A;  2QKB A;  1QSS A;  2KQ2 A;  3MXI A;  3L3V A;  1L3U A;  2D5R A;  4QOZ B;  1S9E A;  3KIO A;  3V9Z A;  3F73 A;  4O0I A; 
#chains in the Genus database with same CATH topology
 1HYS A;  1C0M A;  4CFC A;  5SZT A;  5HRN A;  3VGK A;  2Y1I A;  4AHT A;  1TKX A;  4DS5 A;  5C15 A;  1BQM A;  4KH6 A;  4Z4F A;  4CIF A;  1WN7 A;  4BRF A;  5AQP A;  4Y1D A;  4CZM A;  3CET A;  4FOE A;  4CJS A;  4YNQ A;  4YOR A;  3UKU B;  1U2V B;  5E84 A;  1TYQ B;  4ISG A;  4JHD B;  4JRQ A;  1U47 A;  1HNI A;  3O4Q A;  4KKO A;  5BRF A;  4AHC A;  3LZJ A;  1NK9 A;  2G8K A;  2FF3 B;  4GW6 A;  4AH9 A;  4K8Z A;  5EOY A;  3EL2 A;  3VF6 A;  2BGG A;  4CF0 A;  1EO1 A;  4DTO A;  5E26 A;  4KO0 A;  1D9F A;  4IOC L;  2VQF K;  3LP3 A;  3AVA A;  1QVG M;  2HMI A;  2F7T A;  1ASU A;  1HJR A;  2YHX A;  2XY7 A;  1OVY A;  4Q5V A;  1QS4 A;  3NFA A;  3DJC A;  1W97 L;  2AA4 A;  2IVO A;  2GBZ A;  1QQN A;  5JVG L;  5AQI A;  4I9Q A;  3P5J A;  4E0D A;  1Q86 O;  2VYP A;  3CCM N;  5BPL A;  2A40 A;  2J4R A;  5KRT A;  1YAG A;  2E1Y A;  3V4I A;  4OKJ A;  3RSE A;  3VTH A;  4CJK A;  1S6P A;  1WLJ A;  5D3G A;  3FZL A;  3ZET A;  1X9W A;  1N5Y A;  3DI6 A;  4FWN A;  3MN7 A;  4CGJ A;  4CEO A;  3QBX A;  4OVL A;  4DV3 K;  1C0F A;  2GEM A;  1NGF A;  2VG5 A;  3AVI A;  1NU0 A;  2P51 A;  4FLT A;  3BZK A;  2O8D A;  4CHZ A;  1S22 A;  4DCH A;  3KK2 A;  5KGX A;  3P1G A;  1VSH A;  4CJ7 A;  1VSF A;  3OHR A;  5B8H A;  5KGW A;  2KKZ A;  1RDU A;  1JLF A;  2X78 A;  3DLL L;  3ZT4 A;  1CZ9 A;  3LP1 A;  2X6N A;  4CD1 A;  1LWE A;  2Q36 A;  2ZF5 O;  3L2R A;  1K9M O;  3FFK B;  2YKM A;  5JIC A;  2YCH A;  1JXB A;  2UUC K;  3RWU A;  1IKY A;  3E9P A;  1VQL N;  2ZQB A;  4CEC A;  3BY5 A;  1OH7 A;  3VPZ A;  5AQZ A;  4CJE A;  1U48 A;  4KHN A;  1EXQ A;  4H8K A;  2PYL A;  1KC8 O;  2E88 A;  1J9A A;  4FW2 A;  1REV A;  1TK5 A;  5FDL A;  3VQC A;  4I2P A;  1DLO A;  5C24 A;  1QZ6 A;  4B1V A;  3AVJ A;  1OH6 A;  1NGJ A;  4V19 S;  4K43 A;  3D2E A;  4CW7 B;  1ZBS A;  2EHG A;  4DG1 A;  3CYM A;  3OYI A;  2IAJ A;  5JVH L;  3LPU A;  2KHO A;  2B6A A;  5AQX A;  1S1U A;  4DFK A;  4N5S A;  5DM6 L;  3NVM A;  3FFI A;  5AZI A;  3DLG A;  2Z1J A;  3SAG A;  1GOC A;  2Q0U A;  4BC2 A;  4FLV A;  3DMJ A;  3L2W A;  3MN9 A;  4B3O A;  2P9S B;  3DWL A;  5FRM A;  4W5T A;  4DU3 A;  3NF7 A;  5H1S Q;  1D8Y A;  4C8N A;  4DWI A;  4LY7 A;  5AQH A;  3ZT1 A;  2V7Y A;  5BR9 A;  2WUS A;  2FBY A;  3JYT A;  3C0B A;  3MAQ A;  1KFS A;  5AFU H;  3CC2 N;  1VSL A;  4CFB A;  4FM0 A;  4J8F A;  3HO1 A;  4OGC A;  3CJ7 A;  4OPH A;  4F9O A;  4I6M B;  3U9D A;  1WSE A;  4XH1 A;  3ZSX A;  2OPP A;  3NGZ A;  4FLW A;  3AVM A;  4ID1 A;  4FZY A;  4IDK A;  1DKG D;  4B1Y B;  3MEC A;  4K0K K;  1JXE A;  3CM6 A;  1IJJ A;  2QKK A;  1HNX K;  1XMQ K;  1G99 A;  1TUU A;  3NCI A;  2OPS A;  5JLF A;  1TAU A;  5LY3 A;  4G1Q A;  4BE1 A;  2G8H A;  2Z1I A;  5ADX H;  1L3V A;  3AVB A;  3WEE A;  4H0Y B;  3SAH A;  4B9S A;  2ASM A;  4BRG A;  1P8Z A;  5EVZ A;  3KLG A;  3L0Q A;  3CCR N;  5LL6 Z;  2YI1 A;  4DLE A;  5I9E B;  4JI3 K;  2HND A;  3LZI A;  4FPB A;  5EXW A;  3HXM A;  4EP5 A;  4R79 A;  5M1P A;  3NF9 A;  4FZX C;  4AHU A;  3WXJ A;  4Z4H A;  1YT3 A;  3RMC A;  4GV3 A;  1EWR A;  3MWP A;  3OY9 A;  3NGI A;  5AQQ A;  4A2B A;  3AA2 A;  4L8R B;  4F4K A;  2JLE A;  4DTP A;  2AP1 A;  1BG3 A;  3VA3 A;  1RT6 A;  1K73 O;  4M63 C;  3AO4 A;  1HKC A;  4FWS A;  4KV8 A;  2YJF A;  4DV4 K;  3L2V A;  3U4L A;  1ZYQ A;  4IOX A;  3L4I A;  3VN5 A;  1VQ7 N;  4B8A B;  1J54 A;  2QWO A;  1BO5 O;  2DFF A;  1XUP O;  4O0J A;  4FLX A;  1NLV A;  2E20 A;  4IDH A;  1N33 K;  3E01 A;  3VEY A;  3WXI A;  2ZJP L;  3D0P A;  1X9S A;  4B9L A;  3G25 A;  4LF6 K;  3BZC A;  4KHP K;  4H0X B;  4NCA A;  1SKR A;  4Y0W A;  3AO5 A;  2HVH A;  4GNI A;  4I7F A;  3ZEU A;  2V52 B;  4FM1 A;  2P9K B;  4DFJ A;  2QW9 A;  2RKI A;  3QNN A;  4MO4 A;  3KTQ A;  4DSE A;  1HX1 A;  4JKE A;  3E9O A;  3PUF A;  3QDK A;  5J1E A;  1IKX A;  5K14 A;  2PFU A;  4BY9 C;  4CJ3 A;  1NGB A;  4FLZ A;  3KVG A;  3W3D A;  3NF6 A;  3SUP A;  2RPI A;  3QFU A;  2NRX A;  4LSL A;  3QET A;  1J5E K;  4JI6 K;  2OPR A;  4YOV A;  3MXJ A;  4AF1 A;  3VQ8 A;  4JD2 B;  1D4X A;  1JLG A;  3HM8 A;  4CZH A;  1U49 A;  4B9U A;  3TAE A;  4CHQ A;  3UKR B;  5J2P A;  1ATS A;  4JKC A;  1JKH A;  2IGI A;  5FPE A;  3ULE B;  4O5B A;  3UB5 A;  3VEZ A;  4MQ3 A;  3TTC A;  3VGM A;  1HMV A;  3SUO A;  4KB1 A;  5F2R A;  3IMX A;  2E1Z A;  5AR0 A;  2YKN A;  2ITM A;  3HM9 A;  1VQM N;  4FWQ A;  5FRO A;  3ID8 A;  4JI7 K;  3ATU A;  1Q9X A;  3U6F A;  4DSL A;  4H0O A;  1XNQ K;  1X9M A;  3HP9 A;  3WNF A;  4BG9 A;  2E2N A;  2P9I B;  5GAE P;  1EX4 A;  3SI6 A;  1LOT B;  1NMD A;  5BRE A;  4ELT A;  1C1C A;  2R7Y A;  5DM7 L;  2P9U B;  3K57 A;  2PY5 A;  4IWV A;  3DLK A;  5J2N A;  2W6L A;  3HZ6 A;  4BRQ A;  1YJN N;  1J53 A;  2GWK A;  3KZB A;  2E5L K;  2D0A A;  3PX4 A;  4CEB A;  3TWH A;  3B6P A;  3CJB A;  4E7I A;  5HBM A;  4CEQ A;  4DMN A;  3LP2 A;  4FWM A;  2GEL A;  2YHY A;  3O9S A;  2HVI A;  1VSJ A;  4KHY A;  4RW4 A;  5GIO A;  4JI5 K;  5BN9 A;  3F9M A;  3WXM B;  1OVQ A;  2WFB A;  5C12 A;  5KI6 A;  3MX2 A;  2OA8 A;  3DRP A;  3MXM A;  1VQ6 N;  3MCP A;  4JK7 A;  1KAY A;  2NZT A;  3SK3 A;  2HB5 A;  3D6R A;  1C0T A;  1JLB A;  3SPY A;  4IEE A;  4CJF A;  3LWM A;  2HW3 A;  3Q7B A;  1UWB A;  3EZ5 A;  2VGM A;  3DXM A;  3SUQ A;  4DR5 K;  4UY8 O;  2O8B A;  5AQG A;  2KQ2 A;  3LM2 A;  5HOO A;  4O0I A;  4CZK A;  3BUZ B;  1Z25 A;  1DTT A;  4PKG A;  2BAN A;  4LF7 K;  3K9J A;  1NGI A;  3RRG A;  3O8M A;  3AO2 A;  4IFY A;  3S3N A;  1C1A A;  2NNW A;  4B1Z A;  1RBU A;  2HHU A;  3N4Q A;  2ETJ A;  3PSF A;  4YOY A;  2E6M A;  2QTD A;  3CPW M;  4EHT A;  1QSL A;  3SV3 A;  2HBM A;  2FF6 A;  3T1Y K;  1VSM A;  3RSE B;  1A5W A;  2OTL N;  1QZ5 A;  1TGO A;  5JS1 A;  4CF9 A;  1JL2 A;  3ZET B;  4E7H A;  3AVH A;  2HHS A;  4DV2 K;  1VQK N;  4LD0 A;  3TU5 A;  3MWT A;  1NJZ A;  1NJX A;  4XEI A;  2ATQ A;  4WFN L;  4WFA L;  2Q31 A;  3U3G A;  1OH5 A;  5CZ1 A;  2O8D B;  5AQL A;  1S9G A;  1T3V A;  4OLB A;  1VSI A;  1ZBF A;  4F8R A;  1NJI O;  4H03 B;  2Q2R A;  4WYB A;  1JLC A;  3H46 O;  1I3A A;  2HBJ A;  4CEZ A;  5EY4 A;  5HRP A;  3CI5 A;  3SMS A;  3A5L C;  4RW6 A;  4ZHR A;  3R1X A;  2CGK A;  4H5T A;  2ZM6 K;  1NJY A;  2UXD K;  5DMR A;  4B9V A;  1BHL A;  4FJ9 A;  4JK9 A;  4OLA A;  3ZSV A;  3ZT0 A;  2QWR A;  4IEI A;  4BVP A;  4CIE A;  2BE2 A;  4DU1 A;  1WSI A;  1N32 K;  4ELU A;  1GOA A;  4LF5 K;  3H1V X;  4B1W B;  2ASO A;  4HUG A;  3AVC A;  5LJV A;  3D45 A;  4JKA A;  2QWL A;  5AQV A;  3R3L A;  3J7A P;  2D1K A;  2IDO A;  3EE8 A;  3H08 A;  3LM9 A;  4O8K A;  4PKI A;  4EIA A;  4CGI A;  3FE1 A;  4CJT A;  3LAN A;  3CCS N;  1WSJ A;  4FZZ A;  5AQO A;  1RTH A;  1X3N A;  3CFO A;  3D2E B;  3LAM A;  2GTD A;  3VQD A;  4CJL A;  1BUP A;  3ZSQ A;  2P9I A;  2E4L A;  4BRK A;  1S1X A;  2FBV A;  2QEX N;  5LMU K;  3RVC A;  4CHY A;  2HHX A;  1KAZ A;  3AAR A;  3ENO A;  3ZSR A;  4JKG B;  1N36 K;  3JXU A;  2UUA K;  1UA0 A;  3RR7 A;  4MFB A;  2PYJ A;  3P38 A;  1BDG A;  3ENH A;  4WQ5 C;  2VQE K;  3ATV A;  3CHW A;  5AQM A;  4DR1 K;  4WQ5 A;  3QEP A;  3JSM A;  3OS1 A;  1T6C A;  1JJ2 M;  3C65 A;  3KLH A;  4M42 A;  1JCE A;  4IG3 A;  1NJW A;  1N6Q A;  4OPK A;  4CJW A;  1SL0 A;  2YNH A;  3I0S A;  5AQR A;  3VF2 A;  4B8C A;  3KWI A;  4JKH A;  4FO0 A;  3P83 D;  5BR8 K;  4KTQ A;  4AHV A;  1NGE A;  1RBS A;  1RDD A;  1DT9 A;  3CFR A;  1Q18 A;  4JS4 A;  1L3S A;  2Y1J A;  3D2F A;  4OO1 J;  3CD6 N;  3WEE B;  2Q1N A;  4CF1 A;  5AZJ A;  4FYD A;  3TAN A;  4W5Q A;  4CK1 A;  3P4I A;  1HPM A;  4O8U A;  5T7B A;  2YHW A;  3NGY A;  3VQ5 A;  1IBK K;  2ZWH A;  5SWM A;  2XY8 A;  5AQW A;  3I56 N;  3HL8 A;  1RT4 A;  2XY6 A;  3TSP A;  4KRE A;  2E2O A;  2F9W A;  1G15 A;  2VG7 A;  4HUF A;  4B9M A;  3AVG A;  1C6V A;  4ICL A;  3KK3 A;  5AQK A;  3EYZ A;  3OJS A;  3TAQ A;  2BTF A;  4B3M K;  3VQE A;  1S1W A;  1MWK A;  4IG0 A;  3THX A;  4NYF A;  4OKK A;  1IO2 A;  3M8R A;  2NRW A;  1C1B A;  3DRS A;  3NH0 A;  2NRZ A;  4CJP A;  2X6S A;  5C2F A;  1EET A;  3OYJ A;  4BDY A;  4C8O A;  3QIC A;  1IH7 A;  3C7N A;  1GLC G;  3L6Q A;  4DR7 K;  3GBT A;  2HNZ A;  4H5R A;  1VQ5 N;  1TKT A;  2GWJ A;  4JV5 K;  2RE2 A;  2I7N A;  4HCB A;  5M1F A;  4MDB A;  1TV6 A;  4FL9 A;  4NCB A;  4IFE A;  3LAL A;  1SKW A;  1VQ8 N;  3EKU A;  1JL1 A;  4CZF A;  1A5X A;  4CIG A;  3ZEU B;  5HRS A;  2W42 A;  2KLA A;  2P1J A;  4RWT A;  2ZE2 A;  5M1N A;  3O3H A;  1NOY A;  3NVK A;  4OKE A;  4CBX A;  4DTU A;  1CXU A;  4CHN A;  3CXC M;  2QA4 N;  3OYE A;  4A57 A;  4X62 K;  3QEX A;  1RT2 A;  1KVA A;  3O08 A;  4WQ4 C;  3G10 A;  2FBX A;  4WQ4 A;  4DV1 K;  1UA1 A;  2I7P A;  4A62 A;  3FR0 A;  4FJM A;  4E1M A;  3J7Z O;  1Z6R A;  4BR4 A;  3CJA A;  1M90 O;  3BEX A;  1HRH A;  4CHO A;  3SCX A;  4BVO A;  2ZJR L;  1NKB A;  3WNG A;  2NUB A;  2G8U A;  2UUB K;  1O1W A;  4C23 A;  1GLE G;  4PL8 A;  1U45 A;  2P9L A;  2P5G A;  5MLC Q;  3SAF A;  3V9W A;  4ILJ A;  1SUQ A;  4JKG A;  4N56 A;  3SJJ A;  3ITH A;  3ZSZ A;  1N34 K;  3OYN A;  1IV0 A;  1T7P A;  1VQ4 N;  3HI0 A;  4RG8 A;  3OJU A;  4FJN A;  4ZTJ A;  3QFP A;  2KW4 A;  4B3R K;  1QVF M;  3VQQ A;  4FJ8 A;  3VTI A;  3RMD A;  2HNY A;  4LFC K;  1IG8 A;  5CR4 A;  4CEF A;  2ITG A;  2KTQ A;  1JLA A;  3A0I X;  4O55 A;  3HRG A;  3IAY A;  1U04 A;  3J80 O;  4GKK K;  3KD5 E;  1RCH A;  1KFD A;  2HBL A;  1BIS A;  3AVK A;  2E2P A;  5BN8 A;  4FK4 A;  4CF8 A;  4BE0 A;  4CI6 A;  4DUZ K;  4FXD A;  3TAR A;  1BOT O;  3WNE A;  3K5L A;  3O80 A;  3ZT2 A;  3CQ8 A;  4CBW A;  1NK5 A;  1SKS A;  4N41 A;  2GUP A;  4Z4E A;  4H0V B;  1YF5 L;  2G8I A;  4DQ8 A;  3KK7 A;  5CYM A;  2XO7 A;  5I42 A;  4O5F A;  3MN6 A;  3NH1 A;  1I94 K;  1ATN A;  4HHT A;  4LFA K;  1F21 A;  2A6A A;  3O6W A;  4FJ7 A;  3C6U A;  1M1K O;  4CGH A;  3WQU A;  3VQP A;  4BRE A;  3OW2 M;  3F9K A;  1NK7 A;  3OTO K;  1VQ9 N;  3AV9 A;  3EE9 A;  4JKD A;  2VWJ A;  4FCY A;  4ZTF A;  4JNE A;  3TTF A;  1TL3 A;  4HTL A;  5ELZ A;  2LSN A;  2ZJQ L;  1NMN A;  3SV4 A;  1YIJ N;  1GLF O;  4TSX A;  4Q0B A;  3A2F A;  3BGR A;  3DXM B;  2O8B B;  2DTU A;  2JGU A;  2D0O A;  3VES A;  3AAQ A;  1WB9 A;  4BC3 A;  2PBD A;  3ZX3 A;  3CME N;  5J2Q A;  3LDL A;  4CBU A;  4EFH A;  3QER A;  3THY A;  4J2D A;  3L8B A;  4KHS A;  4K42 A;  3G4S N;  4Z4G A;  2P9P A;  4FWL A;  3A5N C;  5AFU A;  3O9Q A;  1ZXO A;  4M3W A;  5C42 A;  4CER A;  2Q97 A;  3O4N A;  4CJU A;  3A5M C;  3RR8 A;  5KQD A;  4W5N A;  4KHU A;  2XHB A;  3CQX A;  1YJW N;  1QE1 A;  4PHT X;  3FZH A;  5C10 A;  3CMA N;  2QKB A;  3L3V A;  1L3U A;  2HOE A;  5ADX A;  1TUY A;  5M1Q A;  2IIR A;  3LDP A;  4IJN A;  4BDZ A;  1VK0 A;  3DOK A;  3FGU A;  1TL1 A;  3ZSO A;  3ZT3 A;  3ZSY A;  3KKR A;  3GDQ A;  1U6Z A;  3O9R A;  2DFH A;  4K25 A;  4E89 A;  1RNH A;  1JLE A;  3CCU N;  1L5U A;  5C0Y A;  3S3M A;  4O44 A;  2F4V K;  5A2Q O;  4DTM A;  2VGN A;  1WSF A;  2HF3 A;  4XH5 A;  2WOM A;  4WF9 L;  1HNV A;  4JK8 A;  3OBW A;  4HVJ A;  4E3S A;  4AHS A;  1N8R O;  4CZL A;  4DR3 K;  4M45 A;  1VRT A;  2QWM A;  3J8A A;  4FWR A;  4NXM K;  4W5R A;  1NK0 A;  1BA1 A;  3NDK A;  2W41 A;  2JWK A;  3AA4 A;  4DUY K;  2KFZ A;  4IO9 L;  3R8E A;  1BA0 A;  3V9U A;  4DU4 A;  1GLB G;  3S9H A;  3NAE A;  4JI1 K;  1S6Q A;  4OGE A;  1W7A A;  4KI4 A;  4H4O A;  2WTU A;  3CM5 A;  4CJR A;  3ULD A;  3M1F A;  3BP8 A;  2YX6 A;  4FM2 A;  3AA5 X;  3KLF A;  3M8P A;  1T44 A;  2QXL A;  3CJC A;  1VQO N;  3OS2 A;  3ASM A;  4CFD A;  3N4P A;  3PO4 A;  3WNH A;  3V9X A;  4FJ5 A;  1RBV A;  4U67 L;  1JCG A;  2RHK A;  4KB0 A;  3NHG A;  2VWB A;  1B9D A;  1S3X A;  4M7Y A;  3V1Q A;  2QXF A;  3G6E N;  4GV9 A;  4M3U A;  1VSK A;  4GVE A;  3IRX A;  5EU7 A;  5IWA K;  1QHT A;  2O8F A;  3VEW A;  2QK9 A;  3TAM A;  4BWJ A;  2FSK A;  4DS4 A;  1P90 A;  3H45 C;  1RT1 A;  3C94 A;  3IFR A;  3WQT A;  1NOZ A;  1MDU B;  3WXL A;  4NLB A;  3VET A;  3SQ4 A;  4F2R A;  4RW7 A;  4AM6 A;  3KHY A;  4M3Z A;  4FWO A;  1OKJ A;  4FPA A;  3ZX2 A;  4I2Q A;  2ZGZ A;  1XC3 A;  2P9N A;  1D5A A;  3D2F B;  3AVN A;  5CE3 A;  1FJG K;  3QLH A;  5AZJ B;  4JYA K;  4FSV A;  4BE2 A;  3AA3 A;  4JKB A;  3T7Z A;  1ASV A;  4CGG A;  4OPA A;  2VG6 A;  2IVN A;  3H3O B;  4FOI A;  4DFM A;  1NK4 A;  4FLY A;  5HP1 A;  4BGB A;  3TAG A;  2RF2 A;  2QWQ A;  4FJJ A;  1BGX T;  2WC9 A;  2UXC K;  3AGR A;  2IC3 A;  4JRP A;  1S72 N;  3I8D A;  2FC0 A;  1ZC6 A;  4DTX A;  4YOX A;  3AO1 A;  4DF8 A;  1NM1 A;  1IBL K;  4YY3 K;  1BIU A;  3BF1 A;  4DR6 K;  2A3Z A;  3K2P A;  3QIO A;  4CJQ A;  3SNN A;  3DOL A;  3THX B;  5JS2 A;  2OZM A;  1BCM A;  3B6O A;  4YFU A;  1XHZ A;  3AY9 A;  1RT5 A;  2BDP A;  1RIL A;  4FW1 A;  2FBT A;  2UYT A;  3DM2 A;  3R9P A;  3TPQ A;  4CHP A;  1SAZ A;  2HHV A;  3CCV N;  3VA0 A;  1LAV A;  4ISE A;  4MDA A;  3VQA A;  4ELV A;  5IT9 O;  3SLC A;  4JLH A;  2EX3 A;  4NLC A;  4JEP A;  4NYN A;  3C7N B;  3E66 A;  4BC5 A;  5AQY A;  2QM1 A;  3SQ1 A;  4E1N A;  5HL7 L;  2W6K A;  5AQS A;  3P31 A;  4M3R A;  2UXB K;  4X66 K;  4HTU A;  2F9T A;  3LDQ A;  2DPN A;  1E4F T;  4BRM A;  1KQS M;  4DR4 K;  2FLO A;  3TI0 A;  4LFB K;  4Z4I A;  4LH5 A;  1KLM A;  2NRT A;  3RTV A;  2PZS A;  2FSN A;  3M6G A;  5GIP A;  4OJR A;  3L2U A;  2A1S A;  1GLL O;  1WSH A;  2UU9 K;  3LDN A;  2E2Q A;  3V1R A;  4CED A;  1OH8 A;  4MO5 A;  3QEI A;  3QB0 A;  4B9Q A;  1HQU A;  4YHH K;  5KTQ A;  4CZJ A;  4CK2 A;  1J5O A;  1HNW K;  3L3U A;  3FLC O;  2FSJ A;  1YUW A;  1NWK A;  4MLE A;  1W2B M;  3OYB A;  3QES A;  1X3M A;  3V1O A;  2O8C A;  3HPO A;  3K0S A;  3LL3 A;  4NXN K;  3HOT A;  3SBT A;  4PQU A;  4U7B A;  3HK2 A;  1KRP A;  5M1O A;  1O13 A;  1Y64 A;  1HJO A;  2QI2 A;  2YHA A;  4BC4 A;  3FZF A;  3ZX0 A;  4K8X A;  2P9L B;  1ASW A;  3O1B A;  1E3M A;  4DHY A;  3IS9 A;  4BRI A;  4PL7 A;  1BCO A;  4H5N A;  3FZK A;  3CER A;  4CJ4 A;  2KZZ A;  3RMB A;  4BWM A;  1LWC A;  4BRO A;  4CFA A;  2ASP A;  4DV5 K;  1TKZ A;  4BRA A;  1NG9 A;  1VAZ A;  1DGK N;  4CJ5 A;  3TAB A;  1SQK A;  1RBT A;  3G71 N;  2HHT A;  4FJG A;  4BAC A;  4N76 A;  2E8A A;  3SQ0 A;  3PY8 A;  1Z26 A;  3QNO A;  3MX5 A;  3SYZ A;  1RDB A;  1R0A A;  5CZ2 A;  4YDU C;  3VQ7 A;  3UIQ A;  4HCC A;  4YDU A;  3VQB A;  3CIP A;  1MWM A;  1YTU A;  1YVN A;  4JI8 K;  1ZBU A;  3AVF A;  3OYC A;  4DSF A;  4E7L A;  3TTD A;  1XMO K;  2VWK A;  3OYK A;  3CPE A;  4WE1 A;  4DQQ A;  4NO7 A;  2OPQ A;  3NH2 A;  1L3T A;  5HRR A;  2A1R A;  3E1Y A;  2YNG A;  4QS9 A;  2WON A;  4H0P A;  4CGD A;  4H4M A;  2WBN A;  3UE5 A;  3IG1 A;  2O8E A;  2G8F A;  1BWF O;  3QO9 A;  3ID6 A;  3L4Q A;  5KPZ A;  1WOQ A;  1BQN A;  3CC4 N;  2G8W A;  2D0P A;  5AJ3 K;  2Q0R A;  1NK8 A;  1HLU A;  2BH1 A;  4H5W A;  4QS8 A;  1DTQ A;  4M3Y A;  3BF3 A;  1K8K A;  3WT0 A;  3RMA A;  3OYH A;  3M5R A;  2OYQ A;  1V4T A;  3AAP A;  3HPH A;  1BI4 A;  1GLA G;  4DSK A;  2Z1H A;  4R5P A;  3K9K A;  2Q3S A;  1UOC A;  3C6T A;  3T69 A;  1H1V A;  1QQM A;  4GY2 B;  4F3O A;  3T3F A;  4BRD A;  3THY B;  4DLG A;  2F8T A;  4OX9 K;  4E1J A;  5KPR A;  2NLX A;  1QQC A;  3VGL A;  3O3F A;  1MU2 A;  2P9P B;  4A5A A;  4CEE A;  4X64 K;  5GAH P;  2X74 A;  2NRH A;  3PIP L;  3PX0 A;  3U9Z A;  5AQU A;  3KWG A;  1B92 A;  3SQ2 A;  5J2M A;  3DXK A;  1XNR K;  4IFV A;  4DFP A;  4KTZ A;  3OS0 A;  4H0T B;  3EY1 A;  3J7Y P;  1YI2 N;  2B5J A;  5LJW A;  3LAK A;  1ZBL A;  1Q82 O;  5DK5 A;  5CY4 A;  3VEO A;  2V51 B;  1ILY A;  1T05 A;  3LPT A;  2F96 A;  2FXU A;  3DAW A;  1HNZ K;  4CGF A;  3MK6 A;  2KZM A;  1HUX A;  2G8V A;  4EHU A;  3C95 A;  4B3T K;  1EKE A;  2O4I A;  3IKM A;  3R6M A;  3J81 O;  1WSG A;  5GIN A;  4DQP A;  1CZA N;  4CK3 A;  3O3G A;  1KD1 O;  2GUI A;  3VEV A;  4EAH D;  3U3Y A;  1KVC A;  4BR5 A;  3T19 A;  3O1W A;  3KJV A;  5FLX O;  3AGK A;  3SMP A;  3LDS A;  4PA1 A;  3O4W A;  2QWN A;  4BR7 A;  4B3S K;  2QWP A;  3V9S A;  4Z0U A;  3DLH A;  4DR2 K;  2B4J A;  4DQS A;  3B8A X;  3ISN C;  4GKJ K;  4N47 A;  1QSS A;  4LC9 B;  3H3N O;  3V9Z A;  3NMU A;  2A41 A;  1NGG A;  2HMP A;  1J6Z A;  2D0B A;  5C25 A;  3K5O A;  3CCQ N;  4BR9 A;  3OYD A;  1SZ2 A;  3MEG A;  1D9D A;  4I9L A;  1NKC A;  5HLF A;  4Z4C A;  4DTN A;  4BRC A;  2CGL A;  3HOS A;  1NK6 A;  1IKV A;  4W5O A;  4LH4 A;  2D4W A;  4BRH A;  4CJV A;  1WUA A;  3H1Q A;  4BG8 A;  4CEA A;  3O5B A;  4E19 A;  2EWS A;  4DKW A;  1XI1 A;  1VSE A;  3VF4 A;  3T1A A;  1YTA A;  2D0C A;  3MCA B;  1TAQ A;  2HHQ A;  2YJE A;  4NCG A;  4PUO A;  1CZB A;  3A8Y A;  3KLI A;  3THW A;  5HRO A;  4JI2 K;  1SL2 A;  4DTS A;  4QS7 A;  1RBR A;  1RGI A;  1KXP A;  1NGC A;  1VSD A;  3M3Z A;  1FK9 A;  4WFB L;  3OYG A;  3ZSW A;  4KHW A;  3GL1 A;  3DYA A;  2O8F B;  3NF8 A;  4CZG A;  4IKF A;  3F2K A;  4J2E A;  3LP0 A;  4EZ9 A;  3QIN A;  4DF4 A;  5E41 A;  3VMF B;  2P5O A;  3KKS A;  4B9N A;  1IKW A;  4C1N K;  3EN9 A;  3W0L A;  2I5J A;  4YOT A;  1DEJ A;  3UKU A;  4C1N I;  1V4S A;  1FKO A;  3DLB A;  1U2V A;  2HF4 A;  1TYQ A;  4GMJ B;  4JHD A;  3S41 A;  3CCJ N;  1WAJ A;  1Y97 A;  4CZI A;  3DRR A;  1HPZ A;  2V7Z A;  3I8B A;  2P9N B;  3P39 A;  3CG7 A;  2AJQ A;  3TSQ A;  3HT3 A;  3QBW A;  3OA9 A;  3EKS A;  1RT7 A;  1YVU A;  3S3O A;  4FWP A;  4IBN A;  4FJL A;  1VQP N;  2A5X A;  4GV6 A;  1ESV A;  3MDQ A;  5BPN A;  5BRD A;  3MN5 A;  4IOA L;  4QAG A;  4JAX A;  5F1X A;  3DLE A;  3HPG A;  3OYF A;  5C2D A;  4B1X B;  1GOB A;  3QML A;  4LSN A;  5AQT A;  3PV8 A;  4DQI A;  1TK0 A;  1T6D A;  1CLQ A;  2BUP A;  4FJI A;  1NNE A;  4A61 A;  3HVR A;  3U8X A;  4C8L A;  2KFN A;  1CXQ A;  2YNF A;  2HST A;  1RDC A;  4BQZ A;  3HSC A;  4EZ6 A;  5FPN A;  2IS3 A;  2PAV A;  3MMV A;  5BRH A;  1ZBI A;  4A5B A;  1TK8 A;  1BL3 A;  2DFE A;  3D7E O;  4RW9 A;  1YXQ A;  5AQN A;  3SJH A;  4F2S A;  5KQ8 A;  1LV5 A;  3PIO L;  4DQR A;  1Q7Y O;  1JLQ A;  4E7J A;  4M7X A;  4PKH A;  4E7K A;  3I0R A;  4FLU A;  1YJ9 N;  4DSJ A;  3VEN A;  4G9Z A;  5TKW A;  1Z05 A;  2YV0 X;  3VQ6 A;  1K8A O;  2OZS A;  3C6H A;  1BIZ A;  2Z1G A;  4Y1C A;  1U4B A;  1T8E A;  1B9F A;  4NB4 A;  2VCP A;  4BRL A;  2NRR A;  3MEE A;  3QEW A;  3A5O C;  5LMN K;  1EQY A;  4HWI A;  3VER A;  4LF9 K;  4IZ9 A;  3L2Q A;  1K6Y A;  1GLJ O;  2RN2 A;  5BPM A;  1FKP A;  1S5J A;  2JWL A;  5JMV A;  3CJ9 A;  5FRN A;  4ID5 A;  1LW2 A;  3ZCM A;  3H6E A;  4CZE A;  4KBO A;  4A2A A;  4BQL A;  4DB3 A;  4RTF D;  1TKD A;  1KLN A;  3NE6 A;  3AVL A;  4KTW A;  4CD3 A;  1LWF A;  1Q8I A;  3OYL A;  1HKG A;  3HBT A;  4JI0 K;  1RTJ A;  4BGA A;  3LDO A;  1ZBH A;  3SPZ A;  2O8C B;  3M8S A;  1Q81 O;  4KFB A;  2OTJ N;  3CCL N;  1LCU A;  4CF2 A;  3KK1 A;  1S1T A;  1RDW X;  1XQS C;  4IO8 A;  1C0U A;  1WBD A;  3RRH A;  1XWL A;  4ISF A;  2P9S A;  4B08 A;  4PY5 A;  1KSP A;  4FJX A;  4FVU A;  1Q9Y A;  2XRI A;  3HYF A;  4RCH A;  4YOW A;  3AO3 A;  4IXC A;  3SZ2 A;  1NKE A;  1NGH A;  1XC9 A;  3M8Q A;  4FWK A;  4F3T A;  2YHB A;  1GLD G;  5TKY A;  2HBK A;  3ZYY X;  3ALY A;  3QIP A;  4KPY A;  2GV9 A;  3C6A A;  5EX5 A;  3JS6 A;  1IG9 A;  1RFQ A;  3PX6 A;  1QHA A;  3CCE N;  4KHQ A;  3ZLJ A;  3HP6 A;  4I6M A;  3I55 N;  3THV A;  4FJK A;  4FK0 A;  3EO3 A;  4ILH A;  3SUN A;  4QCL A;  5JLH A;  3K58 A;  4UQG A;  1KTQ A;  4JN4 A;  2IOC A;  4FVM A;  3CC7 N;  1YIT N;  2IVP A;  4X65 K;  5I3U A;  1LAW A;  5GAD P;  4LF4 K;  4AHR A;  4FJH A;  4DV0 K;  3Q7C A;  3QEV A;  1NGA A;  3E9L A;  3OBY A;  1RTI A;  5F0X A;  4C8M A;  4EP4 A;  1ATR A;  4K41 A;  2O8E B;  4KRF A;  3CFP A;  4A59 A;  4HUE A;  2H3G X;  2CH5 A;  3IDH A;  1VQN N;  4H5V A;  3TSU A;  4DSI A;  1WAF A;  3TAP A;  5FPD A;  4XIU A;  1K8K B;  1QSY A;  3OYA A;  1RDA A;  1WNS A;  4AQY K;  3V6D A;  2DY4 A;  5FPM A;  3CQY A;  3T1H K;  4CCH A;  4MLH A;  5M1K A;  4M3T A;  2CH6 A;  1BI4 B;  3VQ9 A;  3SBG A;  1LW0 A;  3EEQ A;  3V81 A;  1I39 A;  2GX9 A;  1KCF A;  3EZW A;  3HJF A;  2F8S A;  3FZM A;  3GE1 A;  1C0G A;  4RW8 A;  1KVB A;  3NBP A;  3WXK A;  2W40 A;  3K59 A;  3GG4 A;  2E6L A;  4L3Q A;  4KAZ A;  3HTV A;  4CVN E;  3TAF A;  3PLA A;  1X9J A;  4CES A;  4DV7 K;  3OVN A;  4BR2 A;  1VHX A;  1HYZ A;  4BRN A;  4KH4 A;  4FK2 A;  1ITG A;  4J2A A;  1HQE A;  4IJA A;  3VOV A;  1YHQ N;  3KD1 E;  4B9T A;  3DXK B;  1MA9 B;  5AQF A;  1SL1 A;  4KI6 A;  1XHX A;  2O4G A;  2YNI A;  2OAN A;  2P9K A;  4AIL C;  1HR0 K;  1W9H A;  4BDP A;  5CYQ A;  1A5V A;  3K5M A;  1FXX A;  4OPJ A;  1S1V A;  2A42 A;  1VRU A;  4J2B A;  4ILG B;  1QQO A;  3TR8 A;  1TVR A;  2HHW A;  1R59 O;  3VEX A;  4C8K A;  4M3X A;  3O9U A;  4JD2 A;  3KLE A;  3WUH A;  2NRV A;  1RTD A;  3LWL A;  4DTR A;  3UKR A;  3CJ1 A;  1T03 A;  4PWD A;  3ULE A;  3CF5 L;  4Z94 A;  3PSI A;  4KH5 A;  3DLR A;  3OYM A;  4M41 A;  2CGJ A;  4WCE L;  1UAX A;  1X1P A;  2ZGY A;  3VQ4 A;  4CE9 A;  4XH4 A;  4JS5 A;  1HKB A;  1EP4 A;  3IUC A;  4O4G A;  4JKF A;  2OCE A;  3ENB A;  3F5T A;  1NBW A;  3JAM O;  5KPT A;  2XY5 A;  3HST B;  3O9T A;  1HYV A;  4GVM A;  5AQJ A;  4YOU A;  5KRS A;  5CHI A;  1QTM A;  4DTJ A;  1IBM K;  5AZI B;  2ZD1 A;  2P9U A;  3MED A;  2HHH K;  3PO5 A;  1RT3 A;  1SS6 A;  1WBB A;  1W0H A;  3GOI A;  1EWQ A;  4AM7 A;  4LF8 K;  3G0Z A;  4BR0 A;  1FW6 A;  1SV5 A;  3BDP A;  3K5N A;  3HVT A;  1E4G T;  1JCF A;  5GAG P;  1NGD A;  3MXI A;  4JI4 K;  1KAX A;  2D5R A;  4QOZ B;  4BRP A;  4DV6 K;  1S9E A;  3KIO A;  3F73 A;  3THW B;  3I33 A;  1BU6 O;  4B1U B; 
#chains in the Genus database with same CATH homology
 1HYS A;  1C0M A;  4CFC A;  5SZT A;  1Z25 A;  1DTT A;  2D0B A;  4BDZ A;  5C25 A;  2BAN A;  3K5O A;  5HRN A;  3OYD A;  3MEG A;  2Y1I A;  1VK0 A;  4AHT A;  3AO2 A;  3DOK A;  1TL1 A;  4I9L A;  1TKX A;  3ZSO A;  3ZT3 A;  4DS5 A;  1NKC A;  1D9D A;  1BQM A;  4IFY A;  3KKR A;  3ZSY A;  3S3N A;  1C1A A;  5HLF A;  4Z4F A;  4CIF A;  1WN7 A;  4Y1D A;  1RBU A;  4Z4C A;  4DTN A;  2HHU A;  2DFH A;  2ETJ A;  4E89 A;  2E6M A;  1RNH A;  4CJS A;  1JLE A;  1NK6 A;  1IKV A;  4YNQ A;  4LH4 A;  4W5O A;  3S3M A;  4O44 A;  1L5U A;  1QSL A;  3SV3 A;  4DTM A;  1WSF A;  4JRQ A;  1VSM A;  1U47 A;  1HNI A;  3O4Q A;  4KKO A;  1A5W A;  4AHC A;  4CJV A;  3LZJ A;  1TGO A;  2WOM A;  4CEA A;  4E19 A;  1XI1 A;  1HNV A;  4CF9 A;  1JL2 A;  1NK9 A;  2G8K A;  4E7H A;  4HVJ A;  3AVH A;  4E3S A;  1VSE A;  4AHS A;  2HHS A;  3T1A A;  1YTA A;  2D0C A;  4LD0 A;  4GW6 A;  1TAQ A;  2HHQ A;  4NCG A;  4AH9 A;  4K8Z A;  1NJZ A;  1NJX A;  4PUO A;  2BGG A;  4M45 A;  1CZB A;  4CF0 A;  1VRT A;  2ATQ A;  4DTO A;  1D9F A;  4KO0 A;  4W5R A;  3KLI A;  5HRO A;  1NK0 A;  1SL2 A;  3U3G A;  4DTS A;  1RBR A;  3NDK A;  3RRG A;  3LP3 A;  5CZ1 A;  3AVA A;  1VSD A;  3AA4 A;  2HMI A;  2KFZ A;  1ASU A;  1FK9 A;  1HJR A;  3OYG A;  3ZSW A;  4KHW A;  2XY7 A;  3DYA A;  3NF8 A;  4Q5V A;  3V9U A;  4DU4 A;  1QS4 A;  3S9H A;  4IKF A;  1S9G A;  3NAE A;  3NFA A;  4OLB A;  1S6Q A;  4J2E A;  1VSI A;  1ZBF A;  4F8R A;  4OGE A;  3LP0 A;  4EZ9 A;  2GBZ A;  3QIN A;  4KI4 A;  1JLC A;  4H4O A;  5E41 A;  4DF4 A;  2P5O A;  4I9Q A;  1I3A A;  3P5J A;  3CM5 A;  4CJR A;  3KKS A;  4B9N A;  4CEZ A;  4E0D A;  1IKW A;  3ULD A;  5HRP A;  2I5J A;  4RW6 A;  4ZHR A;  4FM2 A;  3AA5 X;  3KLF A;  3M8P A;  1FKO A;  3DLB A;  1NJY A;  4GMJ B;  5KRT A;  3ASM A;  4CFD A;  3OS2 A;  5DMR A;  1WAJ A;  1Y97 A;  1BHL A;  4OKJ A;  3WNH A;  4CJK A;  3V4I A;  1S6P A;  3PO4 A;  4B9V A;  4FJ9 A;  3DRR A;  3V9X A;  4FJ5 A;  3ZSV A;  4OLA A;  1WLJ A;  1RBV A;  1HPZ A;  3ZT0 A;  1X9W A;  5D3G A;  1N5Y A;  3DI6 A;  4CIE A;  2BE2 A;  3CG7 A;  3NHG A;  1WSI A;  4DU1 A;  4KB0 A;  3HT3 A;  2AJQ A;  1B9D A;  4CGJ A;  4CEO A;  1XHZ A;  4OVL A;  1RT7 A;  1YVU A;  2QXF A;  3V1Q A;  3S3O A;  4ELU A;  2VG5 A;  1GOA A;  1VSK A;  3AVI A;  4M3U A;  4IBN A;  4HUG A;  2P51 A;  4FJL A;  3AVC A;  3IRX A;  3D45 A;  5EU7 A;  4FLT A;  1QHT A;  4CHZ A;  2IDO A;  3H08 A;  3KK2 A;  5KGX A;  3P1G A;  2QK9 A;  1VSH A;  3TAM A;  1VSF A;  4CGI A;  4BWJ A;  4CJT A;  3LAN A;  4DS4 A;  1WSJ A;  4FZZ A;  1RTH A;  3CFO A;  1RT1 A;  3LAM A;  5KGW A;  4QAG A;  3VQD A;  4CJL A;  3C94 A;  3ZSQ A;  1JLF A;  2X78 A;  2E4L A;  1NOZ A;  3DLE A;  3HPG A;  3OYF A;  1S1X A;  1GOB A;  2FBV A;  3ZT4 A;  1CZ9 A;  3LP1 A;  2X6N A;  3SQ4 A;  1LWE A;  4RW7 A;  3L2R A;  4LSN A;  4F2R A;  3PV8 A;  4DQI A;  4M3Z A;  2YKM A;  4CHY A;  1TK0 A;  2HHX A;  1CLQ A;  4FJI A;  3ZSR A;  4I2Q A;  3HVR A;  1JXB A;  4C8L A;  3RWU A;  1IKY A;  2KFN A;  1CXQ A;  1UA0 A;  2YNF A;  1D5A A;  4MFB A;  1RDC A;  2ZQB A;  3RR7 A;  3AVN A;  4CEC A;  2PYJ A;  4EZ6 A;  3QLH A;  4CJE A;  2IS3 A;  1ZBI A;  4BE2 A;  3AA3 A;  1U48 A;  3QEP A;  1BL3 A;  1TK8 A;  4KHN A;  2DFE A;  1EXQ A;  4H8K A;  4RW9 A;  2PYL A;  1ASV A;  4CGG A;  3JSM A;  4FW2 A;  1J9A A;  3OS1 A;  1REV A;  1TK5 A;  4F2S A;  1LV5 A;  3KLH A;  2VG6 A;  4DQR A;  4DFM A;  1NK4 A;  4M42 A;  1JLQ A;  4FLY A;  4E7J A;  5FDL A;  4IG3 A;  3VQC A;  4E7K A;  4I2P A;  5HP1 A;  3I0R A;  4FLU A;  2RF2 A;  1DLO A;  5C24 A;  4OPK A;  3TAG A;  1N6Q A;  4FJJ A;  1BGX T;  4DSJ A;  3VQ6 A;  2YV0 X;  4CJW A;  3AVJ A;  2IC3 A;  1SL0 A;  2YNH A;  3I0S A;  4JRP A;  2OZS A;  1BIZ A;  2EHG A;  2Z1G A;  4Y1C A;  2FC0 A;  3I8D A;  4DTX A;  1B9F A;  4DG1 A;  3CYM A;  1U4B A;  1T8E A;  4B8C A;  3OYI A;  2IAJ A;  3AO1 A;  4DF8 A;  3P83 D;  3LPU A;  2B6A A;  4KTQ A;  1S1U A;  4AHV A;  4DFK A;  3MEE A;  3QEW A;  1BIU A;  4N5S A;  1RBS A;  1RDD A;  3K2P A;  3QIO A;  3FFI A;  4CJQ A;  3SNN A;  3DOL A;  3DLG A;  3CFR A;  2Z1J A;  1GOC A;  5JS2 A;  2OZM A;  1BCM A;  3B6O A;  4YFU A;  4JS4 A;  4FLV A;  1RT5 A;  3DMJ A;  1K6Y A;  1RIL A;  2RN2 A;  3L2Q A;  2BDP A;  1L3S A;  1FKP A;  4FW1 A;  3L2W A;  2FBT A;  3DM2 A;  2Y1J A;  1S5J A;  4B3O A;  4CHP A;  4CF1 A;  5FRN A;  4W5T A;  4DU3 A;  5FRM A;  4ID5 A;  1LW2 A;  3ZCM A;  2HHV A;  4FYD A;  3NF7 A;  3TAN A;  1D8Y A;  3VA0 A;  4W5Q A;  4CK1 A;  1LAV A;  4C8N A;  4DWI A;  3VQA A;  5T7B A;  1TKD A;  4ELV A;  4LY7 A;  4JLH A;  3NGY A;  3ZT1 A;  1KLN A;  3NE6 A;  3AVL A;  4KTW A;  3VQ5 A;  2EX3 A;  1LWF A;  4NYN A;  1Q8I A;  5SWM A;  2FBY A;  2XY8 A;  3JYT A;  3OYL A;  3HL8 A;  1RT4 A;  2XY6 A;  3MAQ A;  1KFS A;  4KRE A;  1VSL A;  4CFB A;  1G15 A;  2VG7 A;  4HUF A;  4FM0 A;  4B9M A;  3SQ1 A;  3AVG A;  4E1N A;  1C6V A;  4ICL A;  4OGC A;  3KK3 A;  3HO1 A;  1RTJ A;  3EYZ A;  4M3R A;  1WSE A;  3ZSX A;  3SPZ A;  2OPP A;  1ZBH A;  3OJS A;  3M8S A;  3NGZ A;  4HTU A;  3TAQ A;  4FLW A;  4KFB A;  3AVM A;  4ID1 A;  4CF2 A;  4FZY A;  4IDK A;  3KK1 A;  3MEC A;  1S1T A;  1JXE A;  3CM6 A;  2QKK A;  3VQE A;  1S1W A;  3NCI A;  3TI0 A;  2OPS A;  4IG0 A;  4Z4I A;  1TAU A;  4LH5 A;  4NYF A;  1KLM A;  1C0U A;  4OKK A;  4G1Q A;  4BE1 A;  3RRH A;  1XWL A;  3RTV A;  2Z1I A;  1IO2 A;  2G8H A;  2PZS A;  3M8R A;  4B08 A;  1L3V A;  3AVB A;  4PY5 A;  1C1B A;  3DRS A;  4OJR A;  3NH0 A;  1KSP A;  4FJX A;  1Q9Y A;  2XRI A;  3HYF A;  4B9S A;  3L2U A;  4CJP A;  2A1S A;  3KLG A;  2X6S A;  1WSH A;  1EET A;  3AO3 A;  3OYJ A;  3V1R A;  4CED A;  4BDY A;  4DLE A;  4C8O A;  3SZ2 A;  1NKE A;  1IH7 A;  2HND A;  3QEI A;  3M8Q A;  1XC9 A;  3LZI A;  4F3T A;  2YHB A;  1HQU A;  5KTQ A;  2HNZ A;  3HXM A;  4CK2 A;  4EP5 A;  1J5O A;  3ALY A;  1TKT A;  3L3U A;  3NF9 A;  3QIP A;  4FZX C;  4KPY A;  2GV9 A;  4AHU A;  1IG9 A;  4Z4H A;  3PX6 A;  4HCB A;  3OYB A;  1YT3 A;  4KHQ A;  1TV6 A;  3QES A;  3RMC A;  3HP6 A;  3V1O A;  3THV A;  3OY9 A;  3NGI A;  4FJK A;  3HPO A;  4FK0 A;  4NCB A;  3SUN A;  4PQU A;  3HK2 A;  4QCL A;  3LAL A;  1KRP A;  1SKW A;  1JL1 A;  3AA2 A;  3K58 A;  4L8R B;  1A5X A;  4F4K A;  4CIG A;  2JLE A;  2YHA A;  4UQG A;  4DTP A;  1KTQ A;  3VA3 A;  1RT6 A;  5HRS A;  2W42 A;  2P1J A;  3AO4 A;  2IOC A;  2ZE2 A;  4FVM A;  4KV8 A;  4K8X A;  3O3H A;  1NOY A;  1ASW A;  5I3U A;  3L2V A;  1LAW A;  4OKE A;  3IS9 A;  4DTU A;  1ZYQ A;  1BCO A;  1CXU A;  3VN5 A;  4AHR A;  4B8A B;  4CHN A;  1J54 A;  4CJ4 A;  4FJH A;  2KZZ A;  3OYE A;  2DFF A;  3QEX A;  3RMB A;  1RT2 A;  3QEV A;  4O0J A;  4BWM A;  1LWC A;  1KVA A;  1RTI A;  4CFA A;  4FLX A;  3G10 A;  2FBX A;  4C8M A;  3E01 A;  4EP4 A;  1UA1 A;  4KRF A;  1TKZ A;  3CFP A;  4FJM A;  4HUE A;  3D0P A;  4E1M A;  1X9S A;  4B9L A;  4CJ5 A;  3TAB A;  1RBT A;  2HHT A;  4FJG A;  4DSI A;  4BAC A;  1WAF A;  1HRH A;  4N76 A;  3PY8 A;  3SQ0 A;  4CHO A;  1Z26 A;  3QNO A;  3TAP A;  3SCX A;  1NKB A;  4XIU A;  4NCA A;  3SYZ A;  1RDB A;  1R0A A;  5CZ2 A;  3WNG A;  2NUB A;  2G8U A;  1QSY A;  3VQ7 A;  1SKR A;  3OYA A;  3UIQ A;  4HCC A;  3AO5 A;  1RDA A;  1WNS A;  1O1W A;  3VQB A;  2HVH A;  3V6D A;  2DY4 A;  4I7F A;  4M3T A;  4CCH A;  4FM1 A;  1YTU A;  4DFJ A;  1BI4 B;  1ZBU A;  3VQ9 A;  2RKI A;  3AVF A;  1LW0 A;  3OYC A;  4DSF A;  4E7L A;  3V81 A;  1U45 A;  3QNN A;  2P5G A;  1I39 A;  3HJF A;  1KCF A;  2F8S A;  3V9W A;  2VWK A;  3KTQ A;  4DSE A;  3OYK A;  1SUQ A;  4RW8 A;  4WE1 A;  4DQQ A;  4N56 A;  3SJJ A;  3ITH A;  3ZSZ A;  3PUF A;  1KVB A;  2OPQ A;  3NBP A;  3NH2 A;  5HRR A;  3OYN A;  2A1R A;  1L3T A;  1T7P A;  2YNG A;  5J1E A;  3K59 A;  1IKX A;  5K14 A;  2E6L A;  4KAZ A;  4RG8 A;  3OJU A;  4FJN A;  4CJ3 A;  4ZTJ A;  2WON A;  4CGD A;  4H4M A;  3TAF A;  2KW4 A;  3IG1 A;  4FLZ A;  2G8F A;  3SUP A;  3NF6 A;  3QO9 A;  4CES A;  3OVN A;  3VQQ A;  4FJ8 A;  2RPI A;  4LSL A;  3QET A;  2HNY A;  3RMD A;  1BQN A;  2G8W A;  1HYZ A;  2OPR A;  3MXJ A;  4FK2 A;  1NK8 A;  4CEF A;  1ITG A;  3VQ8 A;  1HQE A;  4J2A A;  3KD1 E;  1DTQ A;  4B9T A;  1JLG A;  2ITG A;  1U49 A;  2KTQ A;  4M3Y A;  5JS1 A;  3RMA A;  1JLA A;  4B9U A;  4O55 A;  3OYH A;  3TAE A;  3IAY A;  1U04 A;  1SL1 A;  4CHQ A;  4KI6 A;  1XHX A;  1NJW A;  2OYQ A;  2O4G A;  5J2P A;  2YNI A;  3KD5 E;  3HPH A;  1JKH A;  2IGI A;  4AIL C;  1RCH A;  1BI4 A;  1KFD A;  4O5B A;  1W9H A;  1BIS A;  3AVK A;  4DSK A;  2Z1H A;  4FK4 A;  4CF8 A;  4BE0 A;  4R5P A;  2Q3S A;  4MQ3 A;  1HMV A;  3SUO A;  4KB1 A;  4FXD A;  3TAR A;  3WNE A;  2YKN A;  1UOC A;  3HM9 A;  3C6T A;  1A5V A;  5CYQ A;  3ZT2 A;  3K5L A;  3K5M A;  3CQ8 A;  1NK5 A;  1FXX A;  4OPJ A;  1SKS A;  4N41 A;  5FRO A;  4Z4E A;  1S1V A;  1Q9X A;  4F3O A;  3U6F A;  2G8I A;  3T3F A;  4DSL A;  1VRU A;  4J2B A;  4DLG A;  5CYM A;  2XO7 A;  3HP9 A;  3WNF A;  1X9M A;  3TR8 A;  2F8T A;  5I42 A;  1TVR A;  2HHW A;  1QQC A;  3NH1 A;  3O3F A;  4HHT A;  1MU2 A;  4C8K A;  1F21 A;  4M3X A;  4CEE A;  2X74 A;  4FJ7 A;  3C6U A;  3PX0 A;  1EX4 A;  3SI6 A;  4CGH A;  4BDP A;  3KLE A;  3VQP A;  1B92 A;  3SQ2 A;  5J2M A;  3F9K A;  1RTD A;  4ELT A;  1NK7 A;  1C1C A;  3AV9 A;  3LWL A;  2VWJ A;  4IFV A;  3K57 A;  2R7Y A;  4FCY A;  4KTZ A;  4DTR A;  4DFP A;  4ZTF A;  2PY5 A;  1TL3 A;  3DLK A;  5J2N A;  3OS0 A;  3EY1 A;  1J53 A;  2LSN A;  2B5J A;  3SV4 A;  2D0A A;  1T03 A;  4PWD A;  3PX4 A;  4CEB A;  3LAK A;  1ZBL A;  4TSX A;  4Q0B A;  5DK5 A;  5CY4 A;  3TWH A;  3A2F A;  3BGR A;  3B6P A;  2DTU A;  1T05 A;  2JGU A;  4E7I A;  3LPT A;  3DLR A;  5HBM A;  4CEQ A;  3OYM A;  4M41 A;  4DMN A;  2F96 A;  3LP2 A;  1UAX A;  4CGF A;  1X1P A;  2HVI A;  3VQ4 A;  4CE9 A;  2KZM A;  1VSJ A;  5J2Q A;  4JS5 A;  4KHY A;  4RW4 A;  1EP4 A;  4O4G A;  3QER A;  2G8V A;  4J2D A;  3L8B A;  4KHS A;  3C95 A;  5KI6 A;  1EKE A;  2O4I A;  4Z4G A;  1WSG A;  2OA8 A;  3DRP A;  2XY5 A;  3HST B;  4GVM A;  1HYV A;  3MXM A;  1QTM A;  5KRS A;  4DQP A;  4CK3 A;  3O3G A;  2GUI A;  4DTJ A;  4M3W A;  3U3Y A;  1KVC A;  5C42 A;  4CER A;  2ZD1 A;  3MED A;  3PO5 A;  2HB5 A;  1RT3 A;  3O4N A;  3T19 A;  4CJU A;  3KJV A;  1C0T A;  1JLB A;  3SPY A;  3RR8 A;  4W5N A;  3LDS A;  1W0H A;  4PA1 A;  4CJF A;  3LWM A;  4KHU A;  2HW3 A;  2XHB A;  3V9S A;  4Z0U A;  3G0Z A;  3DLH A;  1QE1 A;  1UWB A;  2B4J A;  3EZ5 A;  4DQS A;  1SV5 A;  3BDP A;  3K5N A;  3HVT A;  3ISN C;  3SUQ A;  4N47 A;  2QKB A;  1QSS A;  2KQ2 A;  3MXI A;  3L3V A;  1L3U A;  2D5R A;  4QOZ B;  1S9E A;  3KIO A;  3V9Z A;  3F73 A;  4O0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...