4AH9A

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
156
structure length
154
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 59
structure length 154
sequence length 156
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ah9A00
3RMCA 2IDOA 2IOCA 4M3RA 4CJEA 2X6NA 4OJRA 4E1MA 4BWMA 5HBMA 3TR8A 4DTRA 1RBTA 3DLEA 4FLYA 1SKRA 1RNHA 4M45A 1RDCA 3S3MA 1VSHA 3V6DA 4EP5A 3SI6A 3HXMA 3SQ1A 1CZBA 1VSDA 2B5JA 3AVJA 3NF8A 1IO2A 2ETJA 3HM9A 3CQ8A 3K5MA 1U49A 4TSXA 4CGJA 1KVCA 1C0MA 3M8RA 4FLUA 5FDLA 3K5LA 2XO7A 4DFKA 3SUQA 4RW8A 3HP9A 3OYFA 1CLQA 3PV8A 3AVGA 5JS2A 3VQDA 4H4MA 3RMAA 3CG7A 5KGXA 4OLAA 2HW3A 1ASWA 4KTWA 1JLAA 2DFHA 2D5RA 3HT3A 2QKKA 3OJUA 3SNNA 4ELUA 4FK2A 3ULDA 2P51A 1JKHA 2FBVA 2IC3A 3P5JA 4OLBA 3ZSYA 1TK0A 1TL3A 4DU3A 4CJRA 3O3HA 1LWCA 4FJGA 3QERA 3MEGA 4CEOA 3HPOA 3QNOA 3T3FA 1N5YA 1Q9YA 4B9TA 4FLWA 4AHUA 3JYTA 1EX4A 4ELVA 4FJ7A 2KQ2A 3F9KA 3TAFA 3SUPA 2D0CA 3VQCA 4B3OA 4IFYA 3U3YA 1ITGA 1HYSA 1VRUA 3QINA 2ZE2A 1S5JA 1JL1A 1TKTA 4CHPA 4M3YA 3MXMA 1BIZA 4DF8A 3U3GA 3QIOA 2HNZA 3DM2A 4KREA 3VQBA 1IKVA 3DRPA 3QIPA 3LAMA 4IG3A 3LP1A 3V9SA 4I2PA 1U04A 3HK2A 2WONA 4CF1A 2OZSA 2X6SA 3VQ8A 3BDPA 2F8TA 3ZT2A 1TK8A 3AVIA 4KKOA 3QEWA 4CIEA 3ZSVA 1TK5A 4J2AA 3EZ5A 3AO1A 4DTUA 3KJVA 2HVHA 3LZIA 4AILC 4KAZA 4LSLA 3AVBA 3I0SA 3VQQA 2YHAA 1HNVA 1HYVA 4DSJA 1BQNA 1TKXA 1RILA 1X1PA 4B08A 4CJ5A 5J2MA 2OPQA 4DTSA 5HP1A 4DQPA 1SUQA 3O3FA 4DLGA 3C6UA 3M8QA 1BIUA 1SV5A 1NK5A 1RT5A 4DSLA 1RTJA 3ZSRA 1WNSA 4CHQA 2DY4A 3TARA 1RT1A 3TWHA 4BE2A 2KZMA 1UOCA 4GW6A 4DSFA 4KHUA 3ZT1A 4CFCA 3JSMA 3TAEA 2ZQBA 3UIQA 4CEZA 1S1TA 3OS0A 1KSPA 2Q3SA 3RMDA 4CE9A 4XIUA 4KPYA 2Y1JA 3LZJA 1CXUA 3LP0A 4N41A 1A5XA 1S6QA 2VWKA 4N56A 4J2EA 3CM6A 2B4JA 4FLTA 4PQUA 2VG7A 3FFIA 3KLIA 3OY9A 4E3SA 3SV4A 4B9LA 3KLEA 2P1JA 3MECA 3ZCMA 4CJWA 3NGZA 4JRQA 2G8FA 2ITGA 1VSMA 3CFPA 1B92A 3MXJA 4N47A 1UA1A 1T7PA 1HQEA 2PYLA 3G0ZA 4K8ZA 3DLBA 3HPGA 5HRSA 4DQQA 1VRTA 3KLGA 3TAQA 1S1WA 5K14A 3AVLA 4CEDA 5KGWA 3I0RA 3SPZA 3ZT3A 1QHTA 3V4IA 1BL3A 4CFDA 4CHNA 1NK7A 4Z0UA 3HJFA 2YNFA 3VQEA 3SQ4A 1QS4A 4MQ3A 1JLGA 4AHCA 2O4IA 4FJJA 4Z4CA 3AVAA 4OGEA 4DG1A 3RRGA 3ZSQA 2P5GA 3A2FA 4JS4A 4QAGA 2XY8A 4NYFA 1ZBLA 1C1BA 4DF4A 4CF2A 1YVUA 1O1WA 4E7LA 4FLZA 3K5NA 2E6LA 1RDBA 3AVNA 1QTMA 4F8RA 1RT3A 4PA1A 3L2UA 4DFMA 2G8VA 2DFFA 4DTXA 2G8IA 1J53A 2F96A 1JLCA 4ZTFA 1T05A 1NOYA 4KHSA 2BANA 1KVAA 2HHSA 2XHBA 3TANA 1GOBA 3HPHA 2IS3A 3NH1A 4E7JA 4DFPA 1SL0A 4CHYA 1LW2A 1TAQA 2HNYA 3PUFA 4OKKA 4CEQA 4CJLA 4Q5VA 3LWMA 4BACA 4ELTA 3LALA 3IG1A 2FBYA 1RT7A 3OYAA 3MAQA 4LH5A 3AO5A 2P5OA 3ZSWA 4I9QA 1RT2A 1D8YA 2HHQA 4KHNA 2R7YA 1X9WA 3ASMA 4I2QA 4O0JA 3OYMA 3THVA 3AVKA 5D3GA 4DS5A 4JRPA 1Y97A 4BDYA 3L2RA 3L2QA 4Z4EA 1WSGA 4E19A 1LW0A 3L2WA 2XRIA 2Z1GA 2WOMA 4FLXA 3QESA 4FJLA 4NCAA 2QK9A 4CJVA 1RBUA 4Z4GA 1QSYA 3AVCA 2VG5A 4CJQA 3QNNA 4KRFA 1IKXA 3DRRA 3ITHA 4KO0A 1YT3A 3V9XA 4DU1A 2KTQA 3VQ9A 3NF9A 1S1XA 1B9DA 1RDDA 1NK6A 5C24A 1VSEA 2IGIA 1Z25A 1RBSA 4JS5A 4IG0A 3TAMA 3SCXA 5CZ2A 1BQMA 3C94A 4OPKA 4FW2A 4BE0A 2G8KA 3TI0A 3QLHA 4AHVA 2YKMA 4AHSA 3ZT4A 3LP3A 3OS1A 4FJ9A 4H4OA 3WNFA 1R0AA 4M42A 3LPUA 4O44A 3HYFA 3AVFA 1C6VA 3LPTA 4ZHRA 4CEFA 3SYZA 4DSEA 4QCLA 3NF6A 4OKEA 4Y1CA 1HRHA 3LAKA 1W9HA 4KTZA 3V9WA 1N6QA 3IRXA 4IDKA 3S3NA 1BCOA 2RPIA 1HPZA 1XHZA 3RR8A 3EY1A 4B9UA 1JXEA 1VSKA 1NJWA 4FM2A 4FZXC 4OKJA 4DQRA 3MXIA 2KFNA 3KLHA 4KHWA 3C95A 3V1RA 4CJUA 4NCBA 5J2NA 3D0PA 1ZBIA 4W5NA 5JS1A 5HRNA 2D0BA 3DI6A 1Z26A 4Y1DA 3VQ5A 1GOAA 3NFAA 2HHTA 3HP6A 5KRSA 1JL2A 4CJ4A 3NDKA 1FKPA 3LANA 3AA5X 3K5OA 3OYDA 3OYIA 3WNGA 1CZ9A 4I9LA 3NH0A 3AA2A 4DQIA 4M3ZA 4C8LA 4CK1A 1NKCA 4NYNA 2YV0X 1JLBA 3NF7A 3K59A 5FROA 3V81A 1NK4A 1BI4B 4OVLA 5SWMA 4HUGA 3NCIA 3V9UA 1KRPA 3QEVA 3IS9A 3K2PA 4HCCA 2RKIA 4GMJB 3DLGA 4CJPA 3NE6A 3VA0A 3M8PA 1KLMA 1XC9A 3RWUA 4F3TA 5J2QA 2Z1HA 3OYGA 2RF2A 3TABA 1Q9XA 1HNIA 5KTQA 1RTHA 1LV5A 3ALYA 4C8MA 1JXBA 1S1UA 4GVMA 4CEAA 4K8XA 4PWDA 1C0UA 1TL1A 3B6PA 5C25A 4JLHA 4PUOA 2FBXA 4O4GA 3AVHA 1GOCA 3DLKA 4CECA 3KKRA 4BDZA 3RTVA 3PX0A 4M3XA 4FZZA 4FJKA 2FBTA 3HSTB 3KTQA 1HQUA 1EP4A 1LWFA 4LD0A 4E7IA 1S6PA 1L5UA 4G1QA 2XY7A 3B6OA 5J2PA 1L3UA 1KFSA 4L8RB 3LP2A 4BE1A 2QKBA 4KV8A 1ASVA 1I3AA 4E1NA 3DOKA 1KVBA 4KHYA 4C8OA 1ASUA 1WAFA 4FVMA 3U6FA 3HL8A 3AVMA 3PY8A 4AHTA 5KRTA 4UQGA 2B6AA 4EZ9A 4O5BA 4OPJA 2HHXA 2HHVA 3KK1A 5KI6A 3NHGA 4CIGA 4LSNA 1NKBA 1QSSA 3SUNA 4DTPA 2EX3A 2HVIA 3WNHA 1VK0A 1IG9A 1NJXA 4B8CA 1DLOA 5CYMA 1YTAA 1J5OA 3SPYA 4CEEA 3O3GA 1IH7A 1TVRA 3KK3A 4J2BA 1CXQA 4Z4IA 1EETA 3KKSA 1XI1A 2YHBA 4EP4A 1RBRA 1I39A 4B9VA 1C1CA 2A1SA 3CFRA 4HUFA 4C8KA 3NBPA 4CJFA 1U47A 1FXXA 3LDSA 4HVJA 4FM0A 1C0TA 2OPPA 1SKWA 4Z4FA 5E41A 3LWLA 4M3UA 3RMBA 4KI6A 4HUEA 2JLEA 4CFBA 3MEEA 4CHOA 3SV3A 1RT4A 4CGGA 1VSFA 3VA3A 1VSIA 4IBNA 3K57A 1VSLA 3BGRA 3L8BA 3RRHA 4FXDA 1WLJA 4B9MA 2E4LA 2GUIA 2X74A 4J2DA 5DMRA 1NJYA 3WNEA 4CJTA 4W5QA 1U4BA 1F21A 3VQPA 3MEDA 1S9GA 4CJKA 3AV9A 4DWIA 3K58A 4KB1A 5FRNA 2W42A 3NGYA 3SUOA 4O55A 4DS4A 1YTUA 2DTUA 3V9ZA 2G8HA 1RTDA 5J1EA 4E0DA 2HHUA 2LSNA 1EKEA 1LAVA 2G8WA 2A1RA 1HMVA 3OVNA 3CFOA 2XY5A 4CFAA 4HCBA 4CGHA 1BGXT 1WN7A 4W5OA 4H8KA 3QEIA 2OPSA 4F3OA 4DFJA 2DFEA 4CIFA 1WSEA 3VQ4A 4CF0A 3M8SA 1NK9A 4ZTJA 3OS2A 4CJ3A 4FJIA 1L3SA 3AA4A 2Z1JA 4FM1A 2YNHA 3RR7A 3OYBA 3DLHA 3HO1A 3AA3A 4FYDA 2PZSA 2YNIA 2YKNA 1S9EA 3AO3A 2G8UA 4CGDA 2OPRA 1REVA 4DTNA 3V1QA 1U48A 4ICLA 2EHGA 4DSKA 2HHWA 3ISNC 3VQ6A 4E7HA 3NAEA 1K6YA 4IKFA 1J54A 3VN5A 2Z1IA 3KLFA 2PY5A 3ZSOA 1ZBFA 1JLFA 4BDPA 2O4GA 1NOZA 4Z4HA 3G10A 1T03A 3L3UA 3SQ0A 1ZBUA 1TV6A 4HTUA 2ATQA 5C42A 4EZ6A 1KLNA 1NK0A 1LAWA 4FCYA 2OZMA 2ZD1A 1X9MA 3I8DA 4CESA 1ZBHA 4CK2A 4N5SA 3E01A 4DSIA 1XWLA 4KFBA 1L3TA 1TGOA 4M3TA 4FK4A 4CGFA 4DTJA 2F8SA 3C6TA 2I5JA 3KIOA 3KD1E 1RCHA 1UAXA 4M41A 4O0IA 4DU4A 4FJXA 1FK9A 1W0HA 3NH2A 2FC0A 1TKDA 2HNDA 1D5AA 3P1GA 1MU2A 4B9NA 4ID5A 3QEPA 1RBVA 2KW4A 3IAYA 3ZT0A 4DQSA 3OYNA 3DYAA 3D45A 5CZ1A 3QO9A 4CERA 4F4KA 4FK0A 3HVRA 5HLFA 3O4QA 4QOZB 1JLEA 4AHRA 5CYQA 1BCMA 1S1VA 2HMIA 3CYMA 1DTTA 4C8NA 4CGIA 4CK3A 4CEBA 1TAUA 2D0AA 4AH9A 4CJSA 4F2RA 1LWEA 2AJQA 3EYZA 4YNQA 1NJZA 4B9SA 4F2SA 4FJNA 2JGUA 4NCGA 4FJHA 1RTIA 2OYQA 3ZSZA 1WSHA 3PO4A 3QETA 4N76A 3PO5A 5DK5A 1B9FA 1L3VA 4KB0A 1IKYA 3OYHA 1BHLA 4ID1A 3S3OA 4CF9A 1SL1A 3HVTA 5EU7A 4BWJA 2NUBA 3DMJA 2GBZA 3P83D 4LY7A 3ZSXA 1WSFA 4B8AB 5SZTA 2QXFA 5T7BA 3SZ2A 2XY6A 4M3WA 4FJ8A 4FJMA 3SQ2A 3F73A 4MFBA 1KCFA 1IKWA 3QEXA 3VQAA 3H08A 5HRRA 5I42A 5FRMA 2VG6A 1A5VA 4DTOA 3OJSA 1ZYQA 5HRPA 1G15A 1FKOA 2GV9A 4KI4A 3V1OA 3T1AA 4DMNA 4W5TA 4DLEA 3T19A 3OYEA 1KFDA 3KD5E 3SJJA 3KK2A 1T8EA 1NKEA 2HB5A 1HJRA 1RDAA 3S9HA 1BISA 2BDPA 2PYJA 4Q0BA 1U45A 2RN2A 4YFUA 2X78A 4E89A 1J9AA 4FW1A 4DTMA 3VQ7A 4KTQA 5HROA 3NGIA 1VSJA 4RW4A 1C1AA 4RW9A 2BE2A 1UA0A 1NK8A 3DRSA 4FZYA 4KHQA 1X9SA 1KTQA 4CHZA 1QQCA 2Y1IA 1JLQA 3TAPA 1A5WA 1XHXA 3AO2A 3DOLA 4CCHA 2KZZA 1RT6A 2OA8A 2IAJA 4IFVA 4W5RA 3OYCA 1BI4A 3DLRA 5I3UA 1D9DA 1WAJA 3L2VA 4WE1A 1D9FA 4FJ5A 4RG8A 1DTQA 4CF8A 2KFZA 2VWJA 3TAGA 1SKSA 4OGCA 2YNGA 4RW6A 1EXQA 3CM5A 4I7FA 1SL2A 4LH4A 5CY4A 3PX4A 3L3VA 1UWBA 3AO4A 4R5PA 2BGGA 4PY5A 1QE1A 3OYLA 1HYZA 4FLVA 4RW7A 1WSJA 1TKZA 1Q8IA 3OYKA 3PX6A 4E7KA 3OYJA 2E6MA 1QSLA 3O4NA 4HHTA 1WSIA
chains in the Genus database with same CATH superfamily
3RMCA 2IDOA 4CJEA 3M3ZA 4E1MA 1E3MA 2E88A 2CH6A 5HBMA 3KK7A 1RBTA 4FLYA 1X3MA 3S3MA 3V6DA 3SI6A 5BN8A 3G6EN 3SQ1A 1CZBA 1VSDA 3CQ8A 4GV6A 1IO2A 3WXKA 4TSXA 1KVCA 3CMAN 4L3QA 2XO7A 3FLCO 4RW8A 3HP9A 1EWRA 2HF4A 4RCHA 5JS2A 4H4MA 3CG7A 5AZIB 1QHAA 4KTWA 1JLAA 1V4TA 1N36K 3ULDA 1JKHA 3ZSYA 1TK0A 3IFRA 4FJGA 1MWKA 3WXLA 3HPOA 1Q9YA 3JYTA 3HI0A 3U3YA 1ITGA 4JV5K 4BRGA 1HYSA 1QQMA 1QVFM 1T6DA 4CHPA 3MXMA 2NRXA 3FZHA 3QDKA 4BQLA 3BP8A 1YJWN 3DRPA 3TTFA 1NMDA 4NO7A 3PIOL 3BDPA 3F2KA 1TK8A 4WQ4A 4CIEA 4LC9B 3AO1A 3KJVA 4DSJA 3ATVA 1X1PA 4B08A 4CJ5A 4PL7A 4IJAA 2VCPA 4DQPA 4JKDA 4CZIA 4DLGA 4CD1A 5EXWA 1SV5A 3DXKB 4I6MA 3LDNA 1VQPN 5M1PA 3VOVA 4BE2A 4ILJA 2UUAK 4GY2B 3JSMA 5KPRA 1S1TA 3OS0A 2Y1JA 1NGIA 2VWKA 1TUUA 4N56A 3VEOA 4MLEA 3CM6A 5LJVA 3VESA 3E9PA 4J2EA 3FFIA 4DV7K 4E3SA 4AM6A 2YHYA 3ZCMA 4CJWA 3CJ7A 5EY4A 2ITGA 3BUZB 3CJBA 1KQSM 2W41A 2UYTA 1KAZA 2F9WA 3HPGA 4CZKA 5GAEP 1VRTA 4C1NK 2E5LK 3THWB 4CFDA 1E4GT 1NGDA 1YVNA 1QS4A 4MQ3A 4JI0K 3RSEA 4KH5A 4Z4CA 3AVAA 3D2FA 4DG1A 1Q81O 3A2FA 4H5VA 4QAGA 4NYFA 5AFUH 3O4WA 1SAZA 3O9TA 4CF2A 1O1WA 1KC8O 4E7LA 3AVNA 3CCQN 1QTMA 4KHPK 2G8VA 2DFFA 4ZTFA 2D0PA 1KVAA 2NRTA 3TANA 1GOBA 3NH1A 4CJLA 4ELTA 3LWMA 1WBBA 1RT7A 2ASMA 1BDGA 2P5OA 3OYMA 1RFQA 3C7NB 3J7AP 2P9UA 4FPBA 3L2RA 4BQZA 4Z4EA 1NLVA 4E19A 3L2WA 4FLXA 2Z1GA 1BWFO 3U4LA 2V51B 1RGIA 2ZF5O 3I55N 4WQ5C 2VG5A 3QNNA 4JI3K 1GLLO 1YT3A 2KTQA 1MWMA 1S1XA 1B9DA 1DGKN 5C24A 3W3DA 4IO8A 4IG0A 2A6AA 3SCXA 5AQMA 3O9UA 4FW2A 5FLXO 1C0FA 2YKMA 1C0GA 3O8MA 3ZETA 3ZT4A 4H4OA 1U2VA 5M1QA 1QVGM 1HX1A 1J6ZA 4CEFA 5DM7L 4BR2A 3EKUA 4NB4A 4QCLA 3JS6A 3LAKA 1N6QA 3G71N 4B3SK 2O8BA 1Z05A 2AP1A 1BUPA 2ZGYA 3M1FA 4FM2A 4DQRA 3U9ZA 5HRNA 5EOYA 5AQQA 4H5WA 3NFAA 1JL2A 4HUFA 3AA5X 3IDHA 1CZ9A 1SS6A 4I9LA 4C8LA 3A5MC 3O9QA 4NYNA 4CK1A 3K59A 3CD6N 4OVLA 5AQHA 5KQDA 3NCIA 1KRPA 3K2PA 3ENOA 2RKIA 4GMJB 4XH5A 3A0IX 1XC9A 4F3TA 2RF2A 3TABA 1HNIA 5KTQA 1RTHA 3ALYA 4K8XA 3UKUA 3WT0A 1HUXA 2ZGZA 3B6PA 5AQTA 5C25A 1IBMK 1GOCA 3RTVA 3PX0A 3EKSA 1N34K 3KTQA 4BRPA 4JI7K 5AQWA 1S6PA 4G1QA 2XY7A 4WFBL 1YF5L 4L8RB 2UXBK 5AZIA 1KVBA 5AQYA 4RTFD 3WUHA 3ZYYX 4K25A 4C8OA 1WAFA 1HNZK 3HL8A 3AVMA 4B1UB 2NLXA 2HHXA 1QSSA 1GLAG 1BA1A 3D2EB 1NJXA 4B8CA 4JK8A 5M1NA 4LF9K 3MCAB 1IJJA 3SPYA 1TVRA 3BZKA 1CXQA 4Z4IA 1EETA 3KKSA 2A1SA 3NBPA 2FF3B 3LDSA 2P9PB 3VF6A 2IVPA 4JK9A 2OPPA 4Z4FA 4JKBA 1GLDG 4HUEA 2HBMA 1QZ6A 2JLEA 3MEEA 4CHOA 1VSFA 1VQ6N 4CI6A 1BG3A 4EAHD 4B9MA 2IVNA 2GUIA 2X74A 4MDBA 4J2DA 3T7ZA 5DMRA 3CCSN 4FWSA 3QB0A 3DXKA 3CCRN 3AV9A 4DWIA 3SUOA 3NGYA 2G8HA 3O08A 4E0DA 1EKEA 3P4IA 4HWIA 2FLOA 1HMVA 3OVNA 2F4VK 2XY5A 3TSPA 1WN7A 3LDOA 3EE9A 3LM2A 2P9KA 3H45C 3CHWA 2UUCK 3AA4A 4JEPA 4CJ7A 4FM1A 2YNHA 3OYBA 3QFPA 3HO1A 1K8KB 3AA3A 3L4IA 3P31A 3SAHA 2YKNA 3AO3A 4DTNA 2E2PA 3ISNC 4FOEA 3CI5A 4IKFA 3VN5A 2D1KA 5AFUA 3ZSOA 4BDPA 4Z4HA 5AQVA 1TV6A 4KH4A 2O8FA 3UB5A 3T1HK 1LAWA 2ZD1A 1GLCG 3I8DA 1G99A 3EEQA 3TU5A 2QWQA 4DTJA 2VQFK 3C6TA 2JWKA 1RCHA 1UAXA 4DUYK 1W0HA 4FWNA 1W97L 1I94K 4H0YB 2YCHA 2F9TA 3TSQA 5EX5A 3QEPA 1RBVA 3WXIA 3ZT0A 3O5BA 3DYAA 3OYNA 3QO9A 4FK0A 2Q0RA 4QOZB 3AAQA 4FWMA 5BPLA 2HMIA 1DTTA 4CK3A 1TAUA 4F2RA 1LWEA 3A8YA 3EYZA 4YNQA 4FJNA 1HJOA 5A2QO 4NCGA 5M1KA 4DV3K 2OYQA 4N76A 1CZAN 3PO5A 5DK5A 1B9FA 1L3VA 3CPWM 1BHLA 4QS8A 5CE3A 3HVTA 5H1SQ 1NNEA 1VQKN 2NUBA 1N8RO 5T7BA 3ZSXA 4M3WA 2E2QA 3MDQA 5AQGA 3SQ2A 3EN9A 3VQAA 5I42A 1G15A 1D4XA 1FW6A 5BRFA 4X65K 3T1AA 4DLEA 5C12A 2QA4N 1KFDA 1NKEA 4JKFA 2HB5A 1QQOA 4E89A 1EO1A 4FW1A 4JKGB 2RE2A 4KTQA 3NGIA 4DV1K 4X62K 2YJFA 2WUSA 4CHZA 3S41A 2PAVA 1JLQA 3C65A 4BVPA 3DOLA 1RT6A 2OA8A 1DT9A 3MK6A 3DLRA 1WAJA 3L2VA 4FJ5A 3U8XA 4CF8A 4H0TB 3TAGA 5AQRA 4RW6A 3CQYA 4MO4A 3RVCA 3W0LA 3PX4A 1UWBA 2BGGA 4R5PA 3FZKA 4RW7A 5LJWA 1TKZA 3PX6A 1QSLA 3O4NA 4HHTA 1HR0K 1J5EK 4M3RA 3JAMO 4DTRA 4M45A 3ID6A 5FPDA 1RDCA 1VSHA 4EP5A 3HXMA 3I56N 2B5JA 2D0OA 3AVJA 3NF8A 3SUQA 2BH1A 5KGXA 2QKKA 4EHUA 3OJUA 4JKAA 3ENHA 2FBVA 4DU3A 4CVNE 3O3HA 1LWCA 2YJEA 3MEGA 3T3FA 4B9TA 4FLWA 3HBTA 2KQ2A 2D0CA 1VRUA 3A5LC 4BC3A 2QWRA 1YI2N 3VPZA 4ISGA 1BIZA 3U3GA 1ATSA 4IG3A 1U6ZA 2WONA 4CF1A 2P9LA 3VQ8A 3F5TA 4JAXA 1VQ5N 3L0QA 4KKOA 3QEWA 5BN9A 2V52B 2HVHA 4KAZA 5GADP 3KHYA 3VQQA 2YHAA 1HNVA 3DXMB 3ZX0A 4FL9A 2OPQA 4DTSA 3SMPA 3C6UA 1YJ9N 3FR0A 4IEIA 1NK5A 1RT5A 3ZEUA 3ZSRA 2DY4A 1WNSA 4YDUC 2WTUA 3TARA 2KZMA 4XEIA 1S72N 1XNRK 3UIQA 5KPZA 3UKUB 4CEZA 4QS7A 4XIUA 1CXUA 3LP0A 4IXCA 4N41A 1S6QA 3WXMB 2O8DA 4PQUA 5AQNA 4YOWA 3VGLA 4LF5K 3KLIA 1NM1A 3IMXA 3OY9A 3SV4A 3KLEA 2P1JA 3MECA 4JRQA 3T69A 4N47A 4BRAA 3BEXA 3DLBA 4DR4K 1OVQA 2QM1A 5HRSA 4DQQA 3VMFB 3MX2A 4YOUA 3KLGA 1QHTA 3AARA 3DLLL 4BY9C 2A41A 3VQEA 3SQ4A 1JLGA 4FJJA 1NGFA 4OGEA 3RRGA 3CC2N 2E20A 3D6RA 2CGKA 4FLZA 2E6LA 1RDBA 4YHHK 4F8RA 1RT3A 4WQ5A 4PA1A 4LF8K 1JLCA 2HHSA 2XHBA 3C0BA 4BG8A 4E7JA 4DFPA 2P9SA 1SL0A 4B3TK 2Y1IA 4OKKA 3MN6A 4Q5VA 2GUPA 4K42A 5IWAK 4BRQA 3ZSWA 3B8AX 3VEYA 2HHQA 4I2QA 4FWPA 4O0JA 4V19S 3THVA 4U7BA 1XC3A 1RDUA 3L2QA 2P9IB 2HMPA 2WOMA 4CJVA 4JK7A 3IKMA 1QSYA 3O80A 4CJQA 5TKWA 5AQFA 1IKXA 1SQKA 1YUWA 3NF9A 1RBSA 5LMUK 5F2RA 3TAMA 4IZ9A 5CZ2A 4AHVA 4AHSA 1R0AA 4BRIA 3AVFA 4BRCA 1C6VA 3LPTA 4WF9L 1NGJA 2YX6A 4DSEA 5LL6Z 1W9HA 3V9WA 1YHQN 3SJHA 1JXEA 4FZXC 1K8AO 2WC9A 2P9LB 2W6KA 3V1RA 3D0PA 4BR4A 3CCMN 4Y1DA 4IO9L 4WYBA 4CBUA 4B1VA 3K5OA 3OYIA 3WNGA 3NH0A 1OH8A 4OO1J 4DQIA 1NKCA 1JLBA 3N4QA 3NF7A 1NK4A 3IS9A 3H6EA 3DLGA 3RWUA 3K0SA 4DV6K 1IBKK 3H3NO 4GVMA 1C0UA 3G4SN 2FBXA 4O4GA 3DLKA 1NG9A 4CECA 3KKRA 2IIRA 4FZZA 2FBTA 1LWFA 4LD0A 3LP2A 1ASVA 4FSVA 4O8KA 1MA9B 1ESVA 1ASUA 3U6FA 5KRTA 4UQGA 1HKCA 4O5BA 3NHGA 4CIGA 4DTPA 4AM7A 2HVIA 3WNHA 3J80O 1IG9A 3THWA 1DLOA 4HTLA 3CCJN 2IVOA 2QWOA 4JHDA 2NRRA 2YHBA 1RBRA 3CFRA 4C8KA 1HPMA 3OBWA 4OX9K 4K0KK 5BRHA 4FM0A 1C0TA 3LWLA 4KI6A 4MLHA 4A61A 2O8FB 3EO3A 3VA3A 4IBNA 3K57A 1VSLA 3IUCA 3RRHA 4X66K 4DR5K 3UKRB 1BU6O 1F21A 3MN7A 4DCHA 5FRNA 2W42A 3ZLJA 1IV0A 2DTUA 3V9ZA 2QWPA 2A1RA 4CFAA 1H1VA 1BGXT 1TYQA 4PKHA 1VQMN 5M1FA 2OPSA 2UUBK 2NNWA 1NK9A 2E2NA 5I9EB 4CJ3A 3SMSA 1OH7A 5CR4A 2O8EB 3RR7A 3DLHA 3R8EA 4FYDA 2YNIA 1S9EA 3CERA 2G8UA 4CGDA 2OPRA 4AF1A 2HHWA 4DSKA 2EHGA 5JLHA 3HOSA 4DV5K 3NAEA 5BR9A 2GEMA 2ZJRL 3KLFA 3KWIA 1ZBFA 1JLFA 1NOZA 2QWLA 2QXLA 3EL2A 4H0OA 3L3UA 1ZBUA 5KQ8A 1QZ5A 1KLNA 5MLCQ 4FCYA 3PSIA 2NRVA 4KFBA 1L3TA 4IJNA 2CH5A 4CGFA 2CGJA 3DAWA 2F8SA 3KIOA 3KD1E 5AQLA 4O0IA 1VQ8N 1FK9A 3D2FB 2A3ZA 2HNDA 1D5AA 3L4QA 4B9NA 5AQPA 4ID5A 1NGEA 1ZC6A 3J7ZO 3O6WA 4WFNL 1YITN 4CERA 1TYQB 1T3VA 5HL7L 4BREA 4CZGA 3GDQA 4CGIA 4C8NA 3N4PA 1OH5A 4CEBA 3WEEA 2D0AA 4CJSA 4F2SA 4B9SA 1N32K 2JGUA 1WSHA 3ZEUB 5ADXA 4KB0A 3S3OA 3HSCA 5EU7A 3DMJA 4LY7A 3P83D 4B8AB 5SZTA 2XY6A 4FJ8A 1V4SA 3M5RA 4BGBA 1IKWA 5FRMA 5HRRA 4DTOA 1A5VA 1FKOA 2GV9A 3V1OA 3BF1A 5IT9O 3KD5E 3KK2A 3S9HA 1HJRA 5B8HA 4IWVA 2BDPA 2VYPA 4Q0BA 2RN2A 1J9AA 3DWLA 4G9ZA 2BUPA 3MN9A 4FWLA 1VSJA 1DEJA 3O1BA 3MCPA 3J7YP 3DRSA 1X9SA 2P9NA 4LFCK 4PL8A 1A5WA 1XHXA 3AO2A 3CCUN 1YIJN 3ENBA 4W5RA 3OYCA 1D9DA 3CIPA 1QQNA 2VWJA 1SKSA 4LF6K 4OGCA 2YNGA 4I7FA 4JKGA 3J81O 3CJ9A 3OYKA 1HKGA 4E7KA 2E6MA 1X9JA 1WSIA 2IOCA 3CCLN 4OJRA 3CC7N 4BWMA 5AQJA 5GINA 1SKRA 4BGAA 1RNHA 2I7PA 3PIPL 2QI2A 3GL1A 5KPTA 1U49A 4FWRA 4FLUA 4NLBA 5FDLA 2UU9K 1JCGA 3RMAA 2HW3A 2V7YA 5HOOA 1ASWA 2DFHA 2D5RA 3EE8A 2QWMA 4ELUA 2P51A 2IC3A 3P5JA 4OLBA 1TL3A 1XNQK 1S22A 4ELVA 4AHUA 1EX4A 3F9KA 3TAFA 4X64K 3VQCA 4YORA 3QBXA 4IFYA 2PFUA 2ZE2A 3QFUA 2VGMA 5AQUA 4JI2K 4F9OA 4JHDB 4DF8A 4YOXA 4BC2A 3E9OA 4YOTA 3DM2A 4GKKK 3VQBA 3V9SA 3QIPA 1U04A 3HK2A 1Q7YO 2X6SA 2F8TA 3ZT2A 5JLFA 3AVIA 5C10A 2F7TA 3ZSVA 4K41A 4DTUA 3LZIA 5AR0A 4AILC 1NWKA 3AVBA 3H1QA 1HYVA 4A5BA 5HP1A 1M1KO 1SUQA 3O3FA 3O1WA 3M8QA 1BIUA 4DSLA 1NGAA 4CHQA 4CD3A 3OBYA 1JCEA 3VERA 2FXUA 1S3XA 4BR0A 4CFCA 3TAEA 2ZQBA 2W40A 3RMDA 2GWJA 4JI4K 1W2BM 1A5XA 2B4JA 2VG7A 4NXMK 2FF6A 3GOIA 4B9LA 3ULEA 2G8FA 4JI8K 1B92A 3MXJA 1UA1A 1T7PA 1HQEA 2PYLA 3G0ZA 4BR5A 2HF3A 2OANA 3TAQA 1S1WA 5K14A 4CEDA 3ZT3A 3V4IA 1BL3A 3Q7BA 4CHNA 3OW2M 3CCVN 1NK7A 2YNFA 2O4IA 4LF4K 4JS4A 2XY8A 3H3OB 4CZEA 2GX9A 4DF4A 1ZBLA 3I33A 3K5NA 3LL3A 1J53A 2F96A 2BANA 5JVGL 2A40A 2KLAA 4BRKA 3HPHA 2HOEA 2IS3A 4PHTX 3PUFA 1TAQA 1LOTB 2HNYA 4CEQA 4BACA 3VENA 1P90A 2QEXN 2FBYA 3MAQA 4LH5A 1KAXA 3AO5A 2OCEA 4PKIA 2O8CB 2O8DB 4KH6A 5F1XA 2HBLA 2R7YA 3ASMA 3TSUA 3OHRA 1NGBA 3AVKA 2OTJN 3A5OC 4A2BA 4FJLA 1LW0A 3QESA 4NCAA 1RBUA 3AVCA 3P39A 1T44A 5BPMA 3V9XA 4GVEA 1BOTO 1NK6A 2IGIA 1Z25A 4IFEA 4H0XB 5AQSA 4FOIA 4BE0A 2G8KA 3TI0A 3QLHA 3LP3A 4FJ9A 3WNFA 3OA9A 2YI1A 3LPUA 3HYFA 3QBWA 1XQSC 3A5NC 3SYZA 2WFBA 3H46O 2HBJA 3GBTA 2H3GX 4OKEA 4ISEA 5C2DA 3IRXA 4H5RA 3S3NA 3RR8A 1HPZA 1XHZA 4GKJK 2KFNA 3AGRA 4OKJA 4OPAA 3MXIA 5F0XA 3C95A 4NCBA 4CJUA 5J2NA 4W5NA 5JS1A 3DI6A 1Y64A 4MDAA 1GOAA 3FZLA 2HHTA 3NDKA 3LANA 3VTIA 3AA2A 3HZ6A 2YV0X 1BI4B 2NRHA 5SWMA 3V9UA 4YDUA 3QEVA 4HCCA 4CJPA 4DV0K 4KBOA 3R1XA 3NE6A 1KLMA 2Z1HA 2O8BB 1SZ2A 1Q9XA 4FWOA 5AQOA 4C8MA 1S1UA 4CEAA 4PWDA 4BDZA 4JNEA 4CZLA 4BRFA 1K9MO 4FJKA 1EP4A 2UXDK 3DJCA 1L5UA 3B6OA 3I8BA 4J8FA 1KFSA 4BE1A 3THXA 5C2FA 2D4WA 4KV8A 1I3AA 2E8AA 3DOKA 2VWBA 1OKJA 3THYA 4AHTA 5AQZA 4A62A 4EZ9A 4OPJA 4UY8O 4H5NA 1VQNN 5KI6A 3PLAA 4LSNA 4BRHA 3SUNA 1HLUA 1WB9A 4B3MK 4C1NI 1DKGD 3SBGA 5GIOA 1VK0A 5FPNA 1NJIO 3JXUA 4JKEA 4DR6K 1IH7A 5BRDA 3RSEB 4EP4A 1C1CA 4CJFA 4R79A 1U47A 1FXXA 3ZX3A 4HVJA 4U67L 1SKWA 5E41A 2Q1NA 3RMBA 1VQLN 1VQ7N 3SV3A 1RT4A 2P9KB 5BREA 2ZWHA 1GLEG 1VSIA 3BGRA 4IOCL 2E4LA 2CGLA 3CJAA 3AY9A 1NJYA 4W5QA 3MEDA 4CJKA 4O55A 4DS4A 2HHUA 2LSNA 2GELA 2G8WA 4CGHA 4W5OA 1P8ZA 4H8KA 3KVGA 4I6MB 3FGUA 4CIFA 5AQIA 3M8SA 3VQ4A 4ZTJA 5EVZA 3OS2A 4FJIA 3HRGA 2Z1JA 1YJNN 3FFKB 2QWNA 1GLFO 2NZTA 4JD2A 1REVA 2Q0UA 1U48A 3VQ6A 2UXCK 1K6YA 1Q86O 2O4GA 1NGHA 4A5AA 1T03A 3SQ0A 3NVMA 4MO5A 1Q82O 2ATQA 2GWKA 3VETA 2KKZA 4BRLA 1NK0A 4EZ6A 2ZJPL 2OZMA 4H03B 4CESA 1X3NA 1ZBHA 1XWLA 5GAHP 1TGOA 4FK4A 2DPNA 1BA0A 4JI5K 4DR3K 4FJXA 3E1YA 1ZXOA 3NH2A 3VEVA 3VTHA 4ILHA 1TKDA 3VEXA 2Q36A 1MU2A 3R9PA 3CJ1A 2KW4A 4JI1K 3IAYA 5DM6L 4DQSA 4PKGA 3D45A 4F4KA 5HLFA 4AHRA 3VEZA 4H0PA 5CYQA 1S1VA 4YOYA 3LDPA 4XH4A 4RWTA 4AH9A 3LM9A 2AJQA 1GLBG 1NJZA 1RTIA 3PO4A 3C6HA 3NMUA 1RDWX 4ID1A 1SL1A 4BRNA 2P9UB 5JMVA 3SZ2A 2QXFA 5LMNK 2AA4A 4FJMA 2EWSA 4MFBA 1KCFA 3QEXA 1GLJO 2VG6A 1ZYQA 4BR9A 5HRPA 2P9NB 4KI4A 2A5XA 4DMNA 4W5TA 3T19A 3BF3A 3UE5A 2PBDA 1BISA 4Y0WA 2PYJA 4EHTA 1U45A 3D7EO 1YAGA 3LDLA 3R3LA 1XMOK 4IOAL 4DTMA 4RW4A 1C1AA 1UA0A 1KTQA 3TAPA 5AZJA 3CPEA 1VQ9N 4O8UA 4IFVA 1BI4A 1D9FA 4IEEA 1SL2A 1HNXK 1EXQA 4LH4A 3P38A 3AO4A 3OYLA 1HYZA 1Q8IA 2YHWA 2O8CA 3EZWA 1X9WA 4B9QA 2X6NA 3TR8A 5GAGP 4WCEL 3DLEA 4DR1K 4B1YB 2O8EA 3HM9A 2ETJA 3K5MA 1LCUA 3CQXA 3MN5A 4CGJA 1C0MA 3M8RA 5FPEA 1NGGA 3VF2A 3K5LA 4DFKA 3OYFA 1CLQA 1VQ4N 3PV8A 4IOXA 5M1OA 3AVGA 3VQDA 1OVYA 4OLAA 3HT3A 4FK2A 3SNNA 3E9LA 3THYB 4CJRA 3QERA 5FPMA 4CEOA 3QNOA 1N5YA 4FO0A 4FJ7A 4EIAA 1NBWA 4DQ8A 3SUPA 5C0YA 4GV3A 1U2VB 4B3OA 4WFAL 1M90O 3QINA 3WQTA 1S5JA 1JL1A 1TKTA 1EWQA 4M3YA 4A2AA 2J4RA 3FE1A 3QIOA 2HNZA 4IDHA 4KREA 1IKVA 3WXJA 3LAMA 3LP1A 4I2PA 3TTCA 2OZSA 3MX5A 5LY3A 3CJCA 1ILYA 1TK5A 4J2AA 3EZ5A 4A57A 4LSLA 3I0SA 1BQNA 1TKXA 1RILA 5J2MA 4DR2K 3UKRA 1RTJA 2E1ZA 5E26A 1RT1A 3TWHA 1UOCA 4GW6A 5CHIA 3KZBA 4DSFA 4KHUA 3ZT1A 1KSPA 2Q3SA 4BC5A 4CE9A 4KPYA 1O13A 3LZJA 4B1WB 4FLTA 2Q2RA 4ISFA 3MWPA 3SAGA 1EQYA 3THXB 4FWQA 3NGZA 1K73O 1VSMA 3VGKA 3O9SA 3AAPA 3CFPA 2FSJA 4ILGB 2BTFA 4K8ZA 5TKYA 1T6CA 2ZM6K 3HOTA 3AVLA 2QTDA 5KGWA 3I0RA 3SPZA 1W7AA 4Z0UA 3HJFA 1NU0A 4AHCA 2FSKA 5BR8K 3FZMA 1E4FT 4FPAA 4BRMA 4AQYK 1MDUB 4H5TA 4JI6K 3ZSQA 3SAFA 2P5GA 1C1BA 1YVUA 3ID8A 3QMLA 3CMEN 2NRZA 3L2UA 2G8IA 4DFMA 3WQUA 3LDQA 4DTXA 1NOYA 1T05A 4KHSA 1YXQA 4NXNK 2KHOA 4EFHA 1IG8A 4CHYA 1LW2A 3VGMA 4O5FA 3LALA 3IG1A 3OYAA 4LFBK 4I9QA 1RT2A 1D8YA 1HNWK 4KHNA 4FWKA 4NLCA 1XUPO 5D3GA 4DS5A 4JRPA 1JJ2M 1R59O 1Y97A 5JICA 4BDYA 1WSGA 2XRIA 2QK9A 1ATNA 4Z4GA 3VEWA 4DR7K 4KRFA 3DRRA 3ITHA 4KO0A 4DU1A 3VQ9A 1RDDA 3CC4N 1VSEA 4OPHA 4JS5A 2QW9A 4JD2B 4QS9A 1BQMA 1NGCA 3C94A 4OPKA 3OS1A 3SBTA 4BROA 4M42A 3H1VX 4O44A 4ZHRA 2Q97A 3NF6A 4Y1CA 1HRHA 4KTZA 4IDKA 1BCOA 2RPIA 3AGKA 3EY1A 4B9UA 1VSKA 4JKHA 1NJWA 3KLHA 4KHWA 1ZBIA 2D0BA 3VQ5A 1Z26A 3TTDA 3HP6A 5KRSA 2FSNA 3GE1A 4CJ4A 1FKPA 3OYDA 4M3ZA 3L6QA 3M6GA 3DXMA 3V81A 5FROA 4BVOA 4HUGA 3G25A 4BR7A 3QICA 2ZJQL 3VA0A 3M8PA 2ASPA 5J2QA 3OYGA 3GG4A 1LV5A 1JXBA 3K9KA 1TL1A 2YHXA 3SK3A 4PUOA 4JLHA 2OTLN 3AVHA 3HM8A 2HSTA 4WQ4C 4BRDA 4CZJA 4M3XA 3HSTB 1HQUA 4K43A 4E7IA 5J2PA 1L3UA 3F9MA 3FZFA 2QKBA 2ASOA 4E1NA 2GTDA 4KHYA 1VQON 4FVMA 3R6MA 3PY8A 5AQKA 2B6AA 2HHVA 3KK1A 2I7NA 1NKBA 1WUAA 2EX3A 2E1YA 4CZMA 5BPNA 5CYMA 4CZFA 1YTAA 5GIPA 3CXCM 4DV4K 1J5OA 4CEEA 3O3GA 3KK3A 4J2BA 1XI1A 3K9JA 2Q31A 1I39A 4E1JA 4B9VA 1Z6RA 4CW7B 2ITMA 4LFAK 3J8AA 4M3UA 3Q7CA 4CFBA 1VHXA 4CGGA 3L8BA 4FXDA 1TUYA 1WLJA 3O9RA 1K8KA 1Q18A 3WNEA 4CJTA 1U4BA 4GNIA 3VQPA 1S9GA 2RHKA 3K58A 4KB1A 1YTUA 1RTDA 5J1EA 1LAVA 3C7NA 4DUZK 3CFOA 4HCBA 4CBXA 4M63C 1N33K 2V7ZA 3QEIA 4F3OA 4DFJA 2DFEA 1WSEA 4CF0A 2NRWA 4DB3A 1L3SA 4H0VB 2PZSA 2A42A 3E66A 3VF4A 3V1QA 4ICLA 4E7HA 3ZETB 1WBDA 1J54A 2Z1IA 2PY5A 2E2OA 4BC4A 3G10A 4BG9A 4JYAK 3MMVA 4HTUA 5C42A 2HHHK 1X9MA 1NMNA 4CK2A 4N5SA 3E01A 4DSIA 4M3TA 4DV2K 2I5JA 1IBLK 1VAZA 4M41A 4DU4A 2FC0A 4M7YA 4DKWA 2W6LA 3P1GA 3T1YK 4DHYA 5CZ1A 5E84A 3HVRA 2VQEK 4YOVA 3ZX2A 3O4QA 1HKBA 1JLEA 1JCFA 1BCMA 3U9DA 3CYMA 4JN4A 4B1XB 4B1ZA 4CBWA 1KAYA 3NVKA 2P9SB 1XMQK 5AZJB 4C23A 3OTOK 4FJHA 2P9IA 1ATRA 3ZSZA 5AJ3K 5ELZA 5C15A 3QETA 3TPQA 3BZCA 4FVUA 5AQXA 3BY5A 1IKYA 3OYHA 5ADXH 4CF9A 4BWJA 2GBZA 1WSFA 2JWLA 3KWGA 3F73A 3H08A 2HBKA 3OJSA 3CETA 3WEEB 4A59A 4M7XA 1BO5O 1ZBSA 3ULEB 4Z94A 1KXPA 3ATUA 3OYEA 3SJJA 1T8EA 1OH6A 3D2EA 1RDAA 4YY3K 4YFUA 2X78A 3HTVA 4B3RK 3C6AA 4JKCA 3VQ7A 5HROA 3CCEN 2P9PA 5JVHL 4RW9A 2BE2A 1NK8A 4KHQA 3PSFA 4FZYA 1QQCA 4GV9A 4CCHA 2KZZA 2IAJA 4LF7K 3SLCA 5I3UA 4CZHA 2WBNA 4WE1A 4RG8A 2VGNA 1DTQA 3MWTA 2KFZA 3CM5A 5CY4A 1FJGK 3L3VA 3CF5L 4PY5A 1QE1A 4FLVA 1WSJA 1WOQA 3OYJA 1KD1O 4XH1A
chains in the Genus database with same CATH topology
3RMCA 2IDOA 2IOCA 4M3RA 4CJEA 2X6NA 4OJRA 4E1MA 4BWMA 5HBMA 3TR8A 4DTRA 1RBTA 3DLEA 4FLYA 1SKRA 1RNHA 4M45A 1RDCA 3S3MA 1VSHA 3V6DA 4EP5A 3SI6A 3HXMA 3SQ1A 1CZBA 1VSDA 2B5JA 3AVJA 3NF8A 1IO2A 2ETJA 3HM9A 3CQ8A 3K5MA 1U49A 4TSXA 4CGJA 1KVCA 1C0MA 3M8RA 4FLUA 5FDLA 3K5LA 2XO7A 4DFKA 3SUQA 4RW8A 3HP9A 3OYFA 1CLQA 3PV8A 3AVGA 5JS2A 3VQDA 4H4MA 3RMAA 3CG7A 5KGXA 4OLAA 2HW3A 1ASWA 4KTWA 1JLAA 2DFHA 2D5RA 3HT3A 2QKKA 3OJUA 3SNNA 4ELUA 4FK2A 3ULDA 2P51A 1JKHA 2FBVA 2IC3A 3P5JA 4OLBA 3ZSYA 1TK0A 1TL3A 4DU3A 4CJRA 3O3HA 1LWCA 4FJGA 3QERA 3MEGA 4CEOA 3HPOA 3QNOA 3T3FA 1N5YA 1Q9YA 4B9TA 4FLWA 4AHUA 3JYTA 1EX4A 4ELVA 4FJ7A 2KQ2A 3F9KA 3TAFA 3SUPA 2D0CA 3VQCA 4B3OA 4IFYA 3U3YA 1ITGA 1HYSA 1VRUA 3QINA 2ZE2A 1S5JA 1JL1A 1TKTA 4CHPA 4M3YA 3MXMA 1BIZA 4DF8A 3U3GA 3QIOA 2HNZA 3DM2A 4KREA 3VQBA 1IKVA 3DRPA 3QIPA 3LAMA 4IG3A 3LP1A 3V9SA 4I2PA 1U04A 3HK2A 2WONA 4CF1A 2OZSA 2X6SA 3VQ8A 3BDPA 2F8TA 3ZT2A 1TK8A 3AVIA 4KKOA 3QEWA 4CIEA 3ZSVA 1TK5A 4J2AA 3EZ5A 3AO1A 4DTUA 3KJVA 2HVHA 3LZIA 4AILC 4KAZA 4LSLA 3AVBA 3I0SA 3VQQA 2YHAA 1HNVA 1HYVA 4DSJA 1BQNA 1TKXA 1RILA 1X1PA 4B08A 4CJ5A 5J2MA 2OPQA 4DTSA 5HP1A 4DQPA 1SUQA 3O3FA 4DLGA 3C6UA 3M8QA 1BIUA 1SV5A 1NK5A 1RT5A 4DSLA 1RTJA 3ZSRA 1WNSA 4CHQA 2DY4A 3TARA 1RT1A 3TWHA 4BE2A 2KZMA 1UOCA 4GW6A 4DSFA 4KHUA 3ZT1A 4CFCA 3JSMA 3TAEA 2ZQBA 3UIQA 4CEZA 1S1TA 3OS0A 1KSPA 2Q3SA 3RMDA 4CE9A 4XIUA 4KPYA 2Y1JA 3LZJA 1CXUA 3LP0A 4N41A 1A5XA 1S6QA 2VWKA 4N56A 4J2EA 3CM6A 2B4JA 4FLTA 4PQUA 2VG7A 3FFIA 3KLIA 3OY9A 4E3SA 3SV4A 4B9LA 3KLEA 2P1JA 3MECA 3ZCMA 4CJWA 3NGZA 4JRQA 2G8FA 2ITGA 1VSMA 3CFPA 1B92A 3MXJA 4N47A 1UA1A 1T7PA 1HQEA 2PYLA 3G0ZA 4K8ZA 3DLBA 3HPGA 5HRSA 4DQQA 1VRTA 3KLGA 3TAQA 1S1WA 5K14A 3AVLA 4CEDA 5KGWA 3I0RA 3SPZA 3ZT3A 1QHTA 3V4IA 1BL3A 4CFDA 4CHNA 1NK7A 4Z0UA 3HJFA 2YNFA 3VQEA 3SQ4A 1QS4A 4MQ3A 1JLGA 4AHCA 2O4IA 4FJJA 4Z4CA 3AVAA 4OGEA 4DG1A 3RRGA 3ZSQA 2P5GA 3A2FA 4JS4A 4QAGA 2XY8A 4NYFA 1ZBLA 1C1BA 4DF4A 4CF2A 1YVUA 1O1WA 4E7LA 4FLZA 3K5NA 2E6LA 1RDBA 3AVNA 1QTMA 4F8RA 1RT3A 4PA1A 3L2UA 4DFMA 2G8VA 2DFFA 4DTXA 2G8IA 1J53A 2F96A 1JLCA 4ZTFA 1T05A 1NOYA 4KHSA 2BANA 1KVAA 2HHSA 2XHBA 3TANA 1GOBA 3HPHA 2IS3A 3NH1A 4E7JA 4DFPA 1SL0A 4CHYA 1LW2A 1TAQA 2HNYA 3PUFA 4OKKA 4CEQA 4CJLA 4Q5VA 3LWMA 4BACA 4ELTA 3LALA 3IG1A 2FBYA 1RT7A 3OYAA 3MAQA 4LH5A 3AO5A 2P5OA 3ZSWA 4I9QA 1RT2A 1D8YA 2HHQA 4KHNA 2R7YA 1X9WA 3ASMA 4I2QA 4O0JA 3OYMA 3THVA 3AVKA 5D3GA 4DS5A 4JRPA 1Y97A 4BDYA 3L2RA 3L2QA 4Z4EA 1WSGA 4E19A 1LW0A 3L2WA 2XRIA 2Z1GA 2WOMA 4FLXA 3QESA 4FJLA 4NCAA 2QK9A 4CJVA 1RBUA 4Z4GA 1QSYA 3AVCA 2VG5A 4CJQA 3QNNA 4KRFA 1IKXA 3DRRA 3ITHA 4KO0A 1YT3A 3V9XA 4DU1A 2KTQA 3VQ9A 3NF9A 1S1XA 1B9DA 1RDDA 1NK6A 5C24A 1VSEA 2IGIA 1Z25A 1RBSA 4JS5A 4IG0A 3TAMA 3SCXA 5CZ2A 1BQMA 3C94A 4OPKA 4FW2A 4BE0A 2G8KA 3TI0A 3QLHA 4AHVA 2YKMA 4AHSA 3ZT4A 3LP3A 3OS1A 4FJ9A 4H4OA 3WNFA 1R0AA 4M42A 3LPUA 4O44A 3HYFA 3AVFA 1C6VA 3LPTA 4ZHRA 4CEFA 3SYZA 4DSEA 4QCLA 3NF6A 4OKEA 4Y1CA 1HRHA 3LAKA 1W9HA 4KTZA 3V9WA 1N6QA 3IRXA 4IDKA 3S3NA 1BCOA 2RPIA 1HPZA 1XHZA 3RR8A 3EY1A 4B9UA 1JXEA 1VSKA 1NJWA 4FM2A 4FZXC 4OKJA 4DQRA 3MXIA 2KFNA 3KLHA 4KHWA 3C95A 3V1RA 4CJUA 4NCBA 5J2NA 3D0PA 1ZBIA 4W5NA 5JS1A 5HRNA 2D0BA 3DI6A 1Z26A 4Y1DA 3VQ5A 1GOAA 3NFAA 2HHTA 3HP6A 5KRSA 1JL2A 4CJ4A 3NDKA 1FKPA 3LANA 3AA5X 3K5OA 3OYDA 3OYIA 3WNGA 1CZ9A 4I9LA 3NH0A 3AA2A 4DQIA 4M3ZA 4C8LA 4CK1A 1NKCA 4NYNA 2YV0X 1JLBA 3NF7A 3K59A 5FROA 3V81A 1NK4A 1BI4B 4OVLA 5SWMA 4HUGA 3NCIA 3V9UA 1KRPA 3QEVA 3IS9A 3K2PA 4HCCA 2RKIA 4GMJB 3DLGA 4CJPA 3NE6A 3VA0A 3M8PA 1KLMA 1XC9A 3RWUA 4F3TA 5J2QA 2Z1HA 3OYGA 2RF2A 3TABA 1Q9XA 1HNIA 5KTQA 1RTHA 1LV5A 3ALYA 4C8MA 1JXBA 1S1UA 4GVMA 4CEAA 4K8XA 4PWDA 1C0UA 1TL1A 3B6PA 5C25A 4JLHA 4PUOA 2FBXA 4O4GA 3AVHA 1GOCA 3DLKA 4CECA 3KKRA 4BDZA 3RTVA 3PX0A 4M3XA 4FZZA 4FJKA 2FBTA 3HSTB 3KTQA 1HQUA 1EP4A 1LWFA 4LD0A 4E7IA 1S6PA 1L5UA 4G1QA 2XY7A 3B6OA 5J2PA 1L3UA 1KFSA 4L8RB 3LP2A 4BE1A 2QKBA 4KV8A 1ASVA 1I3AA 4E1NA 3DOKA 1KVBA 4KHYA 4C8OA 1ASUA 1WAFA 4FVMA 3U6FA 3HL8A 3AVMA 3PY8A 4AHTA 5KRTA 4UQGA 2B6AA 4EZ9A 4O5BA 4OPJA 2HHXA 2HHVA 3KK1A 5KI6A 3NHGA 4CIGA 4LSNA 1NKBA 1QSSA 3SUNA 4DTPA 2EX3A 2HVIA 3WNHA 1VK0A 1IG9A 1NJXA 4B8CA 1DLOA 5CYMA 1YTAA 1J5OA 3SPYA 4CEEA 3O3GA 1IH7A 1TVRA 3KK3A 4J2BA 1CXQA 4Z4IA 1EETA 3KKSA 1XI1A 2YHBA 4EP4A 1RBRA 1I39A 4B9VA 1C1CA 2A1SA 3CFRA 4HUFA 4C8KA 3NBPA 4CJFA 1U47A 1FXXA 3LDSA 4HVJA 4FM0A 1C0TA 2OPPA 1SKWA 4Z4FA 5E41A 3LWLA 4M3UA 3RMBA 4KI6A 4HUEA 2JLEA 4CFBA 3MEEA 4CHOA 3SV3A 1RT4A 4CGGA 1VSFA 3VA3A 1VSIA 4IBNA 3K57A 1VSLA 3BGRA 3L8BA 3RRHA 4FXDA 1WLJA 4B9MA 2E4LA 2GUIA 2X74A 4J2DA 5DMRA 1NJYA 3WNEA 4CJTA 4W5QA 1U4BA 1F21A 3VQPA 3MEDA 1S9GA 4CJKA 3AV9A 4DWIA 3K58A 4KB1A 5FRNA 2W42A 3NGYA 3SUOA 4O55A 4DS4A 1YTUA 2DTUA 3V9ZA 2G8HA 1RTDA 5J1EA 4E0DA 2HHUA 2LSNA 1EKEA 1LAVA 2G8WA 2A1RA 1HMVA 3OVNA 3CFOA 2XY5A 4CFAA 4HCBA 4CGHA 1BGXT 1WN7A 4W5OA 4H8KA 3QEIA 2OPSA 4F3OA 4DFJA 2DFEA 4CIFA 1WSEA 3VQ4A 4CF0A 3M8SA 1NK9A 4ZTJA 3OS2A 4CJ3A 4FJIA 1L3SA 3AA4A 2Z1JA 4FM1A 2YNHA 3RR7A 3OYBA 3DLHA 3HO1A 3AA3A 4FYDA 2PZSA 2YNIA 2YKNA 1S9EA 3AO3A 2G8UA 4CGDA 2OPRA 1REVA 4DTNA 3V1QA 1U48A 4ICLA 2EHGA 4DSKA 2HHWA 3ISNC 3VQ6A 4E7HA 3NAEA 1K6YA 4IKFA 1J54A 3VN5A 2Z1IA 3KLFA 2PY5A 3ZSOA 1ZBFA 1JLFA 4BDPA 2O4GA 1NOZA 4Z4HA 3G10A 1T03A 3L3UA 3SQ0A 1ZBUA 1TV6A 4HTUA 2ATQA 5C42A 4EZ6A 1KLNA 1NK0A 1LAWA 4FCYA 2OZMA 2ZD1A 1X9MA 3I8DA 4CESA 1ZBHA 4CK2A 4N5SA 3E01A 4DSIA 1XWLA 4KFBA 1L3TA 1TGOA 4M3TA 4FK4A 4CGFA 4DTJA 2F8SA 3C6TA 2I5JA 3KIOA 3KD1E 1RCHA 1UAXA 4M41A 4O0IA 4DU4A 4FJXA 1FK9A 1W0HA 3NH2A 2FC0A 1TKDA 2HNDA 1D5AA 3P1GA 1MU2A 4B9NA 4ID5A 3QEPA 1RBVA 2KW4A 3IAYA 3ZT0A 4DQSA 3OYNA 3DYAA 3D45A 5CZ1A 3QO9A 4CERA 4F4KA 4FK0A 3HVRA 5HLFA 3O4QA 4QOZB 1JLEA 4AHRA 5CYQA 1BCMA 1S1VA 2HMIA 3CYMA 1DTTA 4C8NA 4CGIA 4CK3A 4CEBA 1TAUA 2D0AA 4AH9A 4CJSA 4F2RA 1LWEA 2AJQA 3EYZA 4YNQA 1NJZA 4B9SA 4F2SA 4FJNA 2JGUA 4NCGA 4FJHA 1RTIA 2OYQA 3ZSZA 1WSHA 3PO4A 3QETA 4N76A 3PO5A 5DK5A 1B9FA 1L3VA 4KB0A 1IKYA 3OYHA 1BHLA 4ID1A 3S3OA 4CF9A 1SL1A 3HVTA 5EU7A 4BWJA 2NUBA 3DMJA 2GBZA 3P83D 4LY7A 3ZSXA 1WSFA 4B8AB 5SZTA 2QXFA 5T7BA 3SZ2A 2XY6A 4M3WA 4FJ8A 4FJMA 3SQ2A 3F73A 4MFBA 1KCFA 1IKWA 3QEXA 3VQAA 3H08A 5HRRA 5I42A 5FRMA 2VG6A 1A5VA 4DTOA 3OJSA 1ZYQA 5HRPA 1G15A 1FKOA 2GV9A 4KI4A 3V1OA 3T1AA 4DMNA 4W5TA 4DLEA 3T19A 3OYEA 1KFDA 3KD5E 3SJJA 3KK2A 1T8EA 1NKEA 2HB5A 1HJRA 1RDAA 3S9HA 1BISA 2BDPA 2PYJA 4Q0BA 1U45A 2RN2A 4YFUA 2X78A 4E89A 1J9AA 4FW1A 4DTMA 3VQ7A 4KTQA 5HROA 3NGIA 1VSJA 4RW4A 1C1AA 4RW9A 2BE2A 1UA0A 1NK8A 3DRSA 4FZYA 4KHQA 1X9SA 1KTQA 4CHZA 1QQCA 2Y1IA 1JLQA 3TAPA 1A5WA 1XHXA 3AO2A 3DOLA 4CCHA 2KZZA 1RT6A 2OA8A 2IAJA 4IFVA 4W5RA 3OYCA 1BI4A 3DLRA 5I3UA 1D9DA 1WAJA 3L2VA 4WE1A 1D9FA 4FJ5A 4RG8A 1DTQA 4CF8A 2KFZA 2VWJA 3TAGA 1SKSA 4OGCA 2YNGA 4RW6A 1EXQA 3CM5A 4I7FA 1SL2A 4LH4A 5CY4A 3PX4A 3L3VA 1UWBA 3AO4A 4R5PA 2BGGA 4PY5A 1QE1A 3OYLA 1HYZA 4FLVA 4RW7A 1WSJA 1TKZA 1Q8IA 3OYKA 3PX6A 4E7KA 3OYJA 2E6MA 1QSLA 3O4NA 4HHTA 1WSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMC A;  2IDO A;  2IOC A;  4M3R A;  4CJE A;  2X6N A;  4OJR A;  4E1M A;  4BWM A;  5HBM A;  3TR8 A;  4DTR A;  1RBT A;  3DLE A;  4FLY A;  1SKR A;  1RNH A;  4M45 A;  1RDC A;  3S3M A;  1VSH A;  3V6D A;  4EP5 A;  3SI6 A;  3HXM A;  3SQ1 A;  1CZB A;  1VSD A;  2B5J A;  3AVJ A;  3NF8 A;  1IO2 A;  2ETJ A;  3HM9 A;  3CQ8 A;  3K5M A;  1U49 A;  4TSX A;  4CGJ A;  1KVC A;  1C0M A;  3M8R A;  4FLU A;  5FDL A;  3K5L A;  2XO7 A;  4DFK A;  3SUQ A;  4RW8 A;  3HP9 A;  3OYF A;  1CLQ A;  3PV8 A;  3AVG A;  5JS2 A;  3VQD A;  4H4M A;  3RMA A;  3CG7 A;  5KGX A;  4OLA A;  2HW3 A;  1ASW A;  4KTW A;  1JLA A;  2DFH A;  2D5R A;  3HT3 A;  2QKK A;  3OJU A;  3SNN A;  4ELU A;  4FK2 A;  3ULD A;  2P51 A;  1JKH A;  2FBV A;  2IC3 A;  3P5J A;  4OLB A;  3ZSY A;  1TK0 A;  1TL3 A;  4DU3 A;  4CJR A;  3O3H A;  1LWC A;  4FJG A;  3QER A;  3MEG A;  4CEO A;  3HPO A;  3QNO A;  3T3F A;  1N5Y A;  1Q9Y A;  4B9T A;  4FLW A;  4AHU A;  3JYT A;  1EX4 A;  4ELV A;  4FJ7 A;  2KQ2 A;  3F9K A;  3TAF A;  3SUP A;  2D0C A;  3VQC A;  4B3O A;  4IFY A;  3U3Y A;  1ITG A;  1HYS A;  1VRU A;  3QIN A;  2ZE2 A;  1S5J A;  1JL1 A;  1TKT A;  4CHP A;  4M3Y A;  3MXM A;  1BIZ A;  4DF8 A;  3U3G A;  3QIO A;  2HNZ A;  3DM2 A;  4KRE A;  3VQB A;  1IKV A;  3DRP A;  3QIP A;  3LAM A;  4IG3 A;  3LP1 A;  3V9S A;  4I2P A;  1U04 A;  3HK2 A;  2WON A;  4CF1 A;  2OZS A;  2X6S A;  3VQ8 A;  3BDP A;  2F8T A;  3ZT2 A;  1TK8 A;  3AVI A;  4KKO A;  3QEW A;  4CIE A;  3ZSV A;  1TK5 A;  4J2A A;  3EZ5 A;  3AO1 A;  4DTU A;  3KJV A;  2HVH A;  3LZI A;  4AIL C;  4KAZ A;  4LSL A;  3AVB A;  3I0S A;  3VQQ A;  2YHA A;  1HNV A;  1HYV A;  4DSJ A;  1BQN A;  1TKX A;  1RIL A;  1X1P A;  4B08 A;  4CJ5 A;  5J2M A;  2OPQ A;  4DTS A;  5HP1 A;  4DQP A;  1SUQ A;  3O3F A;  4DLG A;  3C6U A;  3M8Q A;  1BIU A;  1SV5 A;  1NK5 A;  1RT5 A;  4DSL A;  1RTJ A;  3ZSR A;  1WNS A;  4CHQ A;  2DY4 A;  3TAR A;  1RT1 A;  3TWH A;  4BE2 A;  2KZM A;  1UOC A;  4GW6 A;  4DSF A;  4KHU A;  3ZT1 A;  4CFC A;  3JSM A;  3TAE A;  2ZQB A;  3UIQ A;  4CEZ A;  1S1T A;  3OS0 A;  1KSP A;  2Q3S A;  3RMD A;  4CE9 A;  4XIU A;  4KPY A;  2Y1J A;  3LZJ A;  1CXU A;  3LP0 A;  4N41 A;  1A5X A;  1S6Q A;  2VWK A;  4N56 A;  4J2E A;  3CM6 A;  2B4J A;  4FLT A;  4PQU A;  2VG7 A;  3FFI A;  3KLI A;  3OY9 A;  4E3S A;  3SV4 A;  4B9L A;  3KLE A;  2P1J A;  3MEC A;  3ZCM A;  4CJW A;  3NGZ A;  4JRQ A;  2G8F A;  2ITG A;  1VSM A;  3CFP A;  1B92 A;  3MXJ A;  4N47 A;  1UA1 A;  1T7P A;  1HQE A;  2PYL A;  3G0Z A;  4K8Z A;  3DLB A;  3HPG A;  5HRS A;  4DQQ A;  1VRT A;  3KLG A;  3TAQ A;  1S1W A;  5K14 A;  3AVL A;  4CED A;  5KGW A;  3I0R A;  3SPZ A;  3ZT3 A;  1QHT A;  3V4I A;  1BL3 A;  4CFD A;  4CHN A;  1NK7 A;  4Z0U A;  3HJF A;  2YNF A;  3VQE A;  3SQ4 A;  1QS4 A;  4MQ3 A;  1JLG A;  4AHC A;  2O4I A;  4FJJ A;  4Z4C A;  3AVA A;  4OGE A;  4DG1 A;  3RRG A;  3ZSQ A;  2P5G A;  3A2F A;  4JS4 A;  4QAG A;  2XY8 A;  4NYF A;  1ZBL A;  1C1B A;  4DF4 A;  4CF2 A;  1YVU A;  1O1W A;  4E7L A;  4FLZ A;  3K5N A;  2E6L A;  1RDB A;  3AVN A;  1QTM A;  4F8R A;  1RT3 A;  4PA1 A;  3L2U A;  4DFM A;  2G8V A;  2DFF A;  4DTX A;  2G8I A;  1J53 A;  2F96 A;  1JLC A;  4ZTF A;  1T05 A;  1NOY A;  4KHS A;  2BAN A;  1KVA A;  2HHS A;  2XHB A;  3TAN A;  1GOB A;  3HPH A;  2IS3 A;  3NH1 A;  4E7J A;  4DFP A;  1SL0 A;  4CHY A;  1LW2 A;  1TAQ A;  2HNY A;  3PUF A;  4OKK A;  4CEQ A;  4CJL A;  4Q5V A;  3LWM A;  4BAC A;  4ELT A;  3LAL A;  3IG1 A;  2FBY A;  1RT7 A;  3OYA A;  3MAQ A;  4LH5 A;  3AO5 A;  2P5O A;  3ZSW A;  4I9Q A;  1RT2 A;  1D8Y A;  2HHQ A;  4KHN A;  2R7Y A;  1X9W A;  3ASM A;  4I2Q A;  4O0J A;  3OYM A;  3THV A;  3AVK A;  5D3G A;  4DS5 A;  4JRP A;  1Y97 A;  4BDY A;  3L2R A;  3L2Q A;  4Z4E A;  1WSG A;  4E19 A;  1LW0 A;  3L2W A;  2XRI A;  2Z1G A;  2WOM A;  4FLX A;  3QES A;  4FJL A;  4NCA A;  2QK9 A;  4CJV A;  1RBU A;  4Z4G A;  1QSY A;  3AVC A;  2VG5 A;  4CJQ A;  3QNN A;  4KRF A;  1IKX A;  3DRR A;  3ITH A;  4KO0 A;  1YT3 A;  3V9X A;  4DU1 A;  2KTQ A;  3VQ9 A;  3NF9 A;  1S1X A;  1B9D A;  1RDD A;  1NK6 A;  5C24 A;  1VSE A;  2IGI A;  1Z25 A;  1RBS A;  4JS5 A;  4IG0 A;  3TAM A;  3SCX A;  5CZ2 A;  1BQM A;  3C94 A;  4OPK A;  4FW2 A;  4BE0 A;  2G8K A;  3TI0 A;  3QLH A;  4AHV A;  2YKM A;  4AHS A;  3ZT4 A;  3LP3 A;  3OS1 A;  4FJ9 A;  4H4O A;  3WNF A;  1R0A A;  4M42 A;  3LPU A;  4O44 A;  3HYF A;  3AVF A;  1C6V A;  3LPT A;  4ZHR A;  4CEF A;  3SYZ A;  4DSE A;  4QCL A;  3NF6 A;  4OKE A;  4Y1C A;  1HRH A;  3LAK A;  1W9H A;  4KTZ A;  3V9W A;  1N6Q A;  3IRX A;  4IDK A;  3S3N A;  1BCO A;  2RPI A;  1HPZ A;  1XHZ A;  3RR8 A;  3EY1 A;  4B9U A;  1JXE A;  1VSK A;  1NJW A;  4FM2 A;  4FZX C;  4OKJ A;  4DQR A;  3MXI A;  2KFN A;  3KLH A;  4KHW A;  3C95 A;  3V1R A;  4CJU A;  4NCB A;  5J2N A;  3D0P A;  1ZBI A;  4W5N A;  5JS1 A;  5HRN A;  2D0B A;  3DI6 A;  1Z26 A;  4Y1D A;  3VQ5 A;  1GOA A;  3NFA A;  2HHT A;  3HP6 A;  5KRS A;  1JL2 A;  4CJ4 A;  3NDK A;  1FKP A;  3LAN A;  3AA5 X;  3K5O A;  3OYD A;  3OYI A;  3WNG A;  1CZ9 A;  4I9L A;  3NH0 A;  3AA2 A;  4DQI A;  4M3Z A;  4C8L A;  4CK1 A;  1NKC A;  4NYN A;  2YV0 X;  1JLB A;  3NF7 A;  3K59 A;  5FRO A;  3V81 A;  1NK4 A;  1BI4 B;  4OVL A;  5SWM A;  4HUG A;  3NCI A;  3V9U A;  1KRP A;  3QEV A;  3IS9 A;  3K2P A;  4HCC A;  2RKI A;  4GMJ B;  3DLG A;  4CJP A;  3NE6 A;  3VA0 A;  3M8P A;  1KLM A;  1XC9 A;  3RWU A;  4F3T A;  5J2Q A;  2Z1H A;  3OYG A;  2RF2 A;  3TAB A;  1Q9X A;  1HNI A;  5KTQ A;  1RTH A;  1LV5 A;  3ALY A;  4C8M A;  1JXB A;  1S1U A;  4GVM A;  4CEA A;  4K8X A;  4PWD A;  1C0U A;  1TL1 A;  3B6P A;  5C25 A;  4JLH A;  4PUO A;  2FBX A;  4O4G A;  3AVH A;  1GOC A;  3DLK A;  4CEC A;  3KKR A;  4BDZ A;  3RTV A;  3PX0 A;  4M3X A;  4FZZ A;  4FJK A;  2FBT A;  3HST B;  3KTQ A;  1HQU A;  1EP4 A;  1LWF A;  4LD0 A;  4E7I A;  1S6P A;  1L5U A;  4G1Q A;  2XY7 A;  3B6O A;  5J2P A;  1L3U A;  1KFS A;  4L8R B;  3LP2 A;  4BE1 A;  2QKB A;  4KV8 A;  1ASV A;  1I3A A;  4E1N A;  3DOK A;  1KVB A;  4KHY A;  4C8O A;  1ASU A;  1WAF A;  4FVM A;  3U6F A;  3HL8 A;  3AVM A;  3PY8 A;  4AHT A;  5KRT A;  4UQG A;  2B6A A;  4EZ9 A;  4O5B A;  4OPJ A;  2HHX A;  2HHV A;  3KK1 A;  5KI6 A;  3NHG A;  4CIG A;  4LSN A;  1NKB A;  1QSS A;  3SUN A;  4DTP A;  2EX3 A;  2HVI A;  3WNH A;  1VK0 A;  1IG9 A;  1NJX A;  4B8C A;  1DLO A;  5CYM A;  1YTA A;  1J5O A;  3SPY A;  4CEE A;  3O3G A;  1IH7 A;  1TVR A;  3KK3 A;  4J2B A;  1CXQ A;  4Z4I A;  1EET A;  3KKS A;  1XI1 A;  2YHB A;  4EP4 A;  1RBR A;  1I39 A;  4B9V A;  1C1C A;  2A1S A;  3CFR A;  4HUF A;  4C8K A;  3NBP A;  4CJF A;  1U47 A;  1FXX A;  3LDS A;  4HVJ A;  4FM0 A;  1C0T A;  2OPP A;  1SKW A;  4Z4F A;  5E41 A;  3LWL A;  4M3U A;  3RMB A;  4KI6 A;  4HUE A;  2JLE A;  4CFB A;  3MEE A;  4CHO A;  3SV3 A;  1RT4 A;  4CGG A;  1VSF A;  3VA3 A;  1VSI A;  4IBN A;  3K57 A;  1VSL A;  3BGR A;  3L8B A;  3RRH A;  4FXD A;  1WLJ A;  4B9M A;  2E4L A;  2GUI A;  2X74 A;  4J2D A;  5DMR A;  1NJY A;  3WNE A;  4CJT A;  4W5Q A;  1U4B A;  1F21 A;  3VQP A;  3MED A;  1S9G A;  4CJK A;  3AV9 A;  4DWI A;  3K58 A;  4KB1 A;  5FRN A;  2W42 A;  3NGY A;  3SUO A;  4O55 A;  4DS4 A;  1YTU A;  2DTU A;  3V9Z A;  2G8H A;  1RTD A;  5J1E A;  4E0D A;  2HHU A;  2LSN A;  1EKE A;  1LAV A;  2G8W A;  2A1R A;  1HMV A;  3OVN A;  3CFO A;  2XY5 A;  4CFA A;  4HCB A;  4CGH A;  1BGX T;  1WN7 A;  4W5O A;  4H8K A;  3QEI A;  2OPS A;  4F3O A;  4DFJ A;  2DFE A;  4CIF A;  1WSE A;  3VQ4 A;  4CF0 A;  3M8S A;  1NK9 A;  4ZTJ A;  3OS2 A;  4CJ3 A;  4FJI A;  1L3S A;  3AA4 A;  2Z1J A;  4FM1 A;  2YNH A;  3RR7 A;  3OYB A;  3DLH A;  3HO1 A;  3AA3 A;  4FYD A;  2PZS A;  2YNI A;  2YKN A;  1S9E A;  3AO3 A;  2G8U A;  4CGD A;  2OPR A;  1REV A;  4DTN A;  3V1Q A;  1U48 A;  4ICL A;  2EHG A;  4DSK A;  2HHW A;  3ISN C;  3VQ6 A;  4E7H A;  3NAE A;  1K6Y A;  4IKF A;  1J54 A;  3VN5 A;  2Z1I A;  3KLF A;  2PY5 A;  3ZSO A;  1ZBF A;  1JLF A;  4BDP A;  2O4G A;  1NOZ A;  4Z4H A;  3G10 A;  1T03 A;  3L3U A;  3SQ0 A;  1ZBU A;  1TV6 A;  4HTU A;  2ATQ A;  5C42 A;  4EZ6 A;  1KLN A;  1NK0 A;  1LAW A;  4FCY A;  2OZM A;  2ZD1 A;  1X9M A;  3I8D A;  4CES A;  1ZBH A;  4CK2 A;  4N5S A;  3E01 A;  4DSI A;  1XWL A;  4KFB A;  1L3T A;  1TGO A;  4M3T A;  4FK4 A;  4CGF A;  4DTJ A;  2F8S A;  3C6T A;  2I5J A;  3KIO A;  3KD1 E;  1RCH A;  1UAX A;  4M41 A;  4O0I A;  4DU4 A;  4FJX A;  1FK9 A;  1W0H A;  3NH2 A;  2FC0 A;  1TKD A;  2HND A;  1D5A A;  3P1G A;  1MU2 A;  4B9N A;  4ID5 A;  3QEP A;  1RBV A;  2KW4 A;  3IAY A;  3ZT0 A;  4DQS A;  3OYN A;  3DYA A;  3D45 A;  5CZ1 A;  3QO9 A;  4CER A;  4F4K A;  4FK0 A;  3HVR A;  5HLF A;  3O4Q A;  4QOZ B;  1JLE A;  4AHR A;  5CYQ A;  1BCM A;  1S1V A;  2HMI A;  3CYM A;  1DTT A;  4C8N A;  4CGI A;  4CK3 A;  4CEB A;  1TAU A;  2D0A A;  4AH9 A;  4CJS A;  4F2R A;  1LWE A;  2AJQ A;  3EYZ A;  4YNQ A;  1NJZ A;  4B9S A;  4F2S A;  4FJN A;  2JGU A;  4NCG A;  4FJH A;  1RTI A;  2OYQ A;  3ZSZ A;  1WSH A;  3PO4 A;  3QET A;  4N76 A;  3PO5 A;  5DK5 A;  1B9F A;  1L3V A;  4KB0 A;  1IKY A;  3OYH A;  1BHL A;  4ID1 A;  3S3O A;  4CF9 A;  1SL1 A;  3HVT A;  5EU7 A;  4BWJ A;  2NUB A;  3DMJ A;  2GBZ A;  3P83 D;  4LY7 A;  3ZSX A;  1WSF A;  4B8A B;  5SZT A;  2QXF A;  5T7B A;  3SZ2 A;  2XY6 A;  4M3W A;  4FJ8 A;  4FJM A;  3SQ2 A;  3F73 A;  4MFB A;  1KCF A;  1IKW A;  3QEX A;  3VQA A;  3H08 A;  5HRR A;  5I42 A;  5FRM A;  2VG6 A;  1A5V A;  4DTO A;  3OJS A;  1ZYQ A;  5HRP A;  1G15 A;  1FKO A;  2GV9 A;  4KI4 A;  3V1O A;  3T1A A;  4DMN A;  4W5T A;  4DLE A;  3T19 A;  3OYE A;  1KFD A;  3KD5 E;  3SJJ A;  3KK2 A;  1T8E A;  1NKE A;  2HB5 A;  1HJR A;  1RDA A;  3S9H A;  1BIS A;  2BDP A;  2PYJ A;  4Q0B A;  1U45 A;  2RN2 A;  4YFU A;  2X78 A;  4E89 A;  1J9A A;  4FW1 A;  4DTM A;  3VQ7 A;  4KTQ A;  5HRO A;  3NGI A;  1VSJ A;  4RW4 A;  1C1A A;  4RW9 A;  2BE2 A;  1UA0 A;  1NK8 A;  3DRS A;  4FZY A;  4KHQ A;  1X9S A;  1KTQ A;  4CHZ A;  1QQC A;  2Y1I A;  1JLQ A;  3TAP A;  1A5W A;  1XHX A;  3AO2 A;  3DOL A;  4CCH A;  2KZZ A;  1RT6 A;  2OA8 A;  2IAJ A;  4IFV A;  4W5R A;  3OYC A;  1BI4 A;  3DLR A;  5I3U A;  1D9D A;  1WAJ A;  3L2V A;  4WE1 A;  1D9F A;  4FJ5 A;  4RG8 A;  1DTQ A;  4CF8 A;  2KFZ A;  2VWJ A;  3TAG A;  1SKS A;  4OGC A;  2YNG A;  4RW6 A;  1EXQ A;  3CM5 A;  4I7F A;  1SL2 A;  4LH4 A;  5CY4 A;  3PX4 A;  3L3V A;  1UWB A;  3AO4 A;  4R5P A;  2BGG A;  4PY5 A;  1QE1 A;  3OYL A;  1HYZ A;  4FLV A;  4RW7 A;  1WSJ A;  1TKZ A;  1Q8I A;  3OYK A;  3PX6 A;  4E7K A;  3OYJ A;  2E6M A;  1QSL A;  3O4N A;  4HHT A;  1WSI A; 
#chains in the Genus database with same CATH topology
 3RMC A;  2IDO A;  4CJE A;  3M3Z A;  4E1M A;  1E3M A;  2E88 A;  2CH6 A;  5HBM A;  3KK7 A;  1RBT A;  4FLY A;  1X3M A;  3S3M A;  3V6D A;  3SI6 A;  5BN8 A;  3G6E N;  3SQ1 A;  1CZB A;  1VSD A;  3CQ8 A;  4GV6 A;  1IO2 A;  3WXK A;  4TSX A;  1KVC A;  3CMA N;  4L3Q A;  2XO7 A;  3FLC O;  4RW8 A;  3HP9 A;  1EWR A;  2HF4 A;  4RCH A;  5JS2 A;  4H4M A;  3CG7 A;  5AZI B;  1QHA A;  4KTW A;  1JLA A;  1V4T A;  1N36 K;  3ULD A;  1JKH A;  3ZSY A;  1TK0 A;  3IFR A;  4FJG A;  1MWK A;  3WXL A;  3HPO A;  1Q9Y A;  3JYT A;  3HI0 A;  3U3Y A;  1ITG A;  4JV5 K;  4BRG A;  1HYS A;  1QQM A;  1QVF M;  1T6D A;  4CHP A;  3MXM A;  2NRX A;  3FZH A;  3QDK A;  4BQL A;  3BP8 A;  1YJW N;  3DRP A;  3TTF A;  1NMD A;  4NO7 A;  3PIO L;  3BDP A;  3F2K A;  1TK8 A;  4WQ4 A;  4CIE A;  4LC9 B;  3AO1 A;  3KJV A;  4DSJ A;  3ATV A;  1X1P A;  4B08 A;  4CJ5 A;  4PL7 A;  4IJA A;  2VCP A;  4DQP A;  4JKD A;  4CZI A;  4DLG A;  4CD1 A;  5EXW A;  1SV5 A;  3DXK B;  4I6M A;  3LDN A;  1VQP N;  5M1P A;  3VOV A;  4BE2 A;  4ILJ A;  2UUA K;  4GY2 B;  3JSM A;  5KPR A;  1S1T A;  3OS0 A;  2Y1J A;  1NGI A;  2VWK A;  1TUU A;  4N56 A;  3VEO A;  4MLE A;  3CM6 A;  5LJV A;  3VES A;  3E9P A;  4J2E A;  3FFI A;  4DV7 K;  4E3S A;  4AM6 A;  2YHY A;  3ZCM A;  4CJW A;  3CJ7 A;  5EY4 A;  2ITG A;  3BUZ B;  3CJB A;  1KQS M;  2W41 A;  2UYT A;  1KAZ A;  2F9W A;  3HPG A;  4CZK A;  5GAE P;  1VRT A;  4C1N K;  2E5L K;  3THW B;  4CFD A;  1E4G T;  1NGD A;  1YVN A;  1QS4 A;  4MQ3 A;  4JI0 K;  3RSE A;  4KH5 A;  4Z4C A;  3AVA A;  3D2F A;  4DG1 A;  1Q81 O;  3A2F A;  4H5V A;  4QAG A;  4NYF A;  5AFU H;  3O4W A;  1SAZ A;  3O9T A;  4CF2 A;  1O1W A;  1KC8 O;  4E7L A;  3AVN A;  3CCQ N;  1QTM A;  4KHP K;  2G8V A;  2DFF A;  4ZTF A;  2D0P A;  1KVA A;  2NRT A;  3TAN A;  1GOB A;  3NH1 A;  4CJL A;  4ELT A;  3LWM A;  1WBB A;  1RT7 A;  2ASM A;  1BDG A;  2P5O A;  3OYM A;  1RFQ A;  3C7N B;  3J7A P;  2P9U A;  4FPB A;  3L2R A;  4BQZ A;  4Z4E A;  1NLV A;  4E19 A;  3L2W A;  4FLX A;  2Z1G A;  1BWF O;  3U4L A;  2V51 B;  1RGI A;  2ZF5 O;  3I55 N;  4WQ5 C;  2VG5 A;  3QNN A;  4JI3 K;  1GLL O;  1YT3 A;  2KTQ A;  1MWM A;  1S1X A;  1B9D A;  1DGK N;  5C24 A;  3W3D A;  4IO8 A;  4IG0 A;  2A6A A;  3SCX A;  5AQM A;  3O9U A;  4FW2 A;  5FLX O;  1C0F A;  2YKM A;  1C0G A;  3O8M A;  3ZET A;  3ZT4 A;  4H4O A;  1U2V A;  5M1Q A;  1QVG M;  1HX1 A;  1J6Z A;  4CEF A;  5DM7 L;  4BR2 A;  3EKU A;  4NB4 A;  4QCL A;  3JS6 A;  3LAK A;  1N6Q A;  3G71 N;  4B3S K;  2O8B A;  1Z05 A;  2AP1 A;  1BUP A;  2ZGY A;  3M1F A;  4FM2 A;  4DQR A;  3U9Z A;  5HRN A;  5EOY A;  5AQQ A;  4H5W A;  3NFA A;  1JL2 A;  4HUF A;  3AA5 X;  3IDH A;  1CZ9 A;  1SS6 A;  4I9L A;  4C8L A;  3A5M C;  3O9Q A;  4NYN A;  4CK1 A;  3K59 A;  3CD6 N;  4OVL A;  5AQH A;  5KQD A;  3NCI A;  1KRP A;  3K2P A;  3ENO A;  2RKI A;  4GMJ B;  4XH5 A;  3A0I X;  1XC9 A;  4F3T A;  2RF2 A;  3TAB A;  1HNI A;  5KTQ A;  1RTH A;  3ALY A;  4K8X A;  3UKU A;  3WT0 A;  1HUX A;  2ZGZ A;  3B6P A;  5AQT A;  5C25 A;  1IBM K;  1GOC A;  3RTV A;  3PX0 A;  3EKS A;  1N34 K;  3KTQ A;  4BRP A;  4JI7 K;  5AQW A;  1S6P A;  4G1Q A;  2XY7 A;  4WFB L;  1YF5 L;  4L8R B;  2UXB K;  5AZI A;  1KVB A;  5AQY A;  4RTF D;  3WUH A;  3ZYY X;  4K25 A;  4C8O A;  1WAF A;  1HNZ K;  3HL8 A;  3AVM A;  4B1U B;  2NLX A;  2HHX A;  1QSS A;  1GLA G;  1BA1 A;  3D2E B;  1NJX A;  4B8C A;  4JK8 A;  5M1N A;  4LF9 K;  3MCA B;  1IJJ A;  3SPY A;  1TVR A;  3BZK A;  1CXQ A;  4Z4I A;  1EET A;  3KKS A;  2A1S A;  3NBP A;  2FF3 B;  3LDS A;  2P9P B;  3VF6 A;  2IVP A;  4JK9 A;  2OPP A;  4Z4F A;  4JKB A;  1GLD G;  4HUE A;  2HBM A;  1QZ6 A;  2JLE A;  3MEE A;  4CHO A;  1VSF A;  1VQ6 N;  4CI6 A;  1BG3 A;  4EAH D;  4B9M A;  2IVN A;  2GUI A;  2X74 A;  4MDB A;  4J2D A;  3T7Z A;  5DMR A;  3CCS N;  4FWS A;  3QB0 A;  3DXK A;  3CCR N;  3AV9 A;  4DWI A;  3SUO A;  3NGY A;  2G8H A;  3O08 A;  4E0D A;  1EKE A;  3P4I A;  4HWI A;  2FLO A;  1HMV A;  3OVN A;  2F4V K;  2XY5 A;  3TSP A;  1WN7 A;  3LDO A;  3EE9 A;  3LM2 A;  2P9K A;  3H45 C;  3CHW A;  2UUC K;  3AA4 A;  4JEP A;  4CJ7 A;  4FM1 A;  2YNH A;  3OYB A;  3QFP A;  3HO1 A;  1K8K B;  3AA3 A;  3L4I A;  3P31 A;  3SAH A;  2YKN A;  3AO3 A;  4DTN A;  2E2P A;  3ISN C;  4FOE A;  3CI5 A;  4IKF A;  3VN5 A;  2D1K A;  5AFU A;  3ZSO A;  4BDP A;  4Z4H A;  5AQV A;  1TV6 A;  4KH4 A;  2O8F A;  3UB5 A;  3T1H K;  1LAW A;  2ZD1 A;  1GLC G;  3I8D A;  1G99 A;  3EEQ A;  3TU5 A;  2QWQ A;  4DTJ A;  2VQF K;  3C6T A;  2JWK A;  1RCH A;  1UAX A;  4DUY K;  1W0H A;  4FWN A;  1W97 L;  1I94 K;  4H0Y B;  2YCH A;  2F9T A;  3TSQ A;  5EX5 A;  3QEP A;  1RBV A;  3WXI A;  3ZT0 A;  3O5B A;  3DYA A;  3OYN A;  3QO9 A;  4FK0 A;  2Q0R A;  4QOZ B;  3AAQ A;  4FWM A;  5BPL A;  2HMI A;  1DTT A;  4CK3 A;  1TAU A;  4F2R A;  1LWE A;  3A8Y A;  3EYZ A;  4YNQ A;  4FJN A;  1HJO A;  5A2Q O;  4NCG A;  5M1K A;  4DV3 K;  2OYQ A;  4N76 A;  1CZA N;  3PO5 A;  5DK5 A;  1B9F A;  1L3V A;  3CPW M;  1BHL A;  4QS8 A;  5CE3 A;  3HVT A;  5H1S Q;  1NNE A;  1VQK N;  2NUB A;  1N8R O;  5T7B A;  3ZSX A;  4M3W A;  2E2Q A;  3MDQ A;  5AQG A;  3SQ2 A;  3EN9 A;  3VQA A;  5I42 A;  1G15 A;  1D4X A;  1FW6 A;  5BRF A;  4X65 K;  3T1A A;  4DLE A;  5C12 A;  2QA4 N;  1KFD A;  1NKE A;  4JKF A;  2HB5 A;  1QQO A;  4E89 A;  1EO1 A;  4FW1 A;  4JKG B;  2RE2 A;  4KTQ A;  3NGI A;  4DV1 K;  4X62 K;  2YJF A;  2WUS A;  4CHZ A;  3S41 A;  2PAV A;  1JLQ A;  3C65 A;  4BVP A;  3DOL A;  1RT6 A;  2OA8 A;  1DT9 A;  3MK6 A;  3DLR A;  1WAJ A;  3L2V A;  4FJ5 A;  3U8X A;  4CF8 A;  4H0T B;  3TAG A;  5AQR A;  4RW6 A;  3CQY A;  4MO4 A;  3RVC A;  3W0L A;  3PX4 A;  1UWB A;  2BGG A;  4R5P A;  3FZK A;  4RW7 A;  5LJW A;  1TKZ A;  3PX6 A;  1QSL A;  3O4N A;  4HHT A;  1HR0 K;  1J5E K;  4M3R A;  3JAM O;  4DTR A;  4M45 A;  3ID6 A;  5FPD A;  1RDC A;  1VSH A;  4EP5 A;  3HXM A;  3I56 N;  2B5J A;  2D0O A;  3AVJ A;  3NF8 A;  3SUQ A;  2BH1 A;  5KGX A;  2QKK A;  4EHU A;  3OJU A;  4JKA A;  3ENH A;  2FBV A;  4DU3 A;  4CVN E;  3O3H A;  1LWC A;  2YJE A;  3MEG A;  3T3F A;  4B9T A;  4FLW A;  3HBT A;  2KQ2 A;  2D0C A;  1VRU A;  3A5L C;  4BC3 A;  2QWR A;  1YI2 N;  3VPZ A;  4ISG A;  1BIZ A;  3U3G A;  1ATS A;  4IG3 A;  1U6Z A;  2WON A;  4CF1 A;  2P9L A;  3VQ8 A;  3F5T A;  4JAX A;  1VQ5 N;  3L0Q A;  4KKO A;  3QEW A;  5BN9 A;  2V52 B;  2HVH A;  4KAZ A;  5GAD P;  3KHY A;  3VQQ A;  2YHA A;  1HNV A;  3DXM B;  3ZX0 A;  4FL9 A;  2OPQ A;  4DTS A;  3SMP A;  3C6U A;  1YJ9 N;  3FR0 A;  4IEI A;  1NK5 A;  1RT5 A;  3ZEU A;  3ZSR A;  2DY4 A;  1WNS A;  4YDU C;  2WTU A;  3TAR A;  2KZM A;  4XEI A;  1S72 N;  1XNR K;  3UIQ A;  5KPZ A;  3UKU B;  4CEZ A;  4QS7 A;  4XIU A;  1CXU A;  3LP0 A;  4IXC A;  4N41 A;  1S6Q A;  3WXM B;  2O8D A;  4PQU A;  5AQN A;  4YOW A;  3VGL A;  4LF5 K;  3KLI A;  1NM1 A;  3IMX A;  3OY9 A;  3SV4 A;  3KLE A;  2P1J A;  3MEC A;  4JRQ A;  3T69 A;  4N47 A;  4BRA A;  3BEX A;  3DLB A;  4DR4 K;  1OVQ A;  2QM1 A;  5HRS A;  4DQQ A;  3VMF B;  3MX2 A;  4YOU A;  3KLG A;  1QHT A;  3AAR A;  3DLL L;  4BY9 C;  2A41 A;  3VQE A;  3SQ4 A;  1JLG A;  4FJJ A;  1NGF A;  4OGE A;  3RRG A;  3CC2 N;  2E20 A;  3D6R A;  2CGK A;  4FLZ A;  2E6L A;  1RDB A;  4YHH K;  4F8R A;  1RT3 A;  4WQ5 A;  4PA1 A;  4LF8 K;  1JLC A;  2HHS A;  2XHB A;  3C0B A;  4BG8 A;  4E7J A;  4DFP A;  2P9S A;  1SL0 A;  4B3T K;  2Y1I A;  4OKK A;  3MN6 A;  4Q5V A;  2GUP A;  4K42 A;  5IWA K;  4BRQ A;  3ZSW A;  3B8A X;  3VEY A;  2HHQ A;  4I2Q A;  4FWP A;  4O0J A;  4V19 S;  3THV A;  4U7B A;  1XC3 A;  1RDU A;  3L2Q A;  2P9I B;  2HMP A;  2WOM A;  4CJV A;  4JK7 A;  3IKM A;  1QSY A;  3O80 A;  4CJQ A;  5TKW A;  5AQF A;  1IKX A;  1SQK A;  1YUW A;  3NF9 A;  1RBS A;  5LMU K;  5F2R A;  3TAM A;  4IZ9 A;  5CZ2 A;  4AHV A;  4AHS A;  1R0A A;  4BRI A;  3AVF A;  4BRC A;  1C6V A;  3LPT A;  4WF9 L;  1NGJ A;  2YX6 A;  4DSE A;  5LL6 Z;  1W9H A;  3V9W A;  1YHQ N;  3SJH A;  1JXE A;  4FZX C;  1K8A O;  2WC9 A;  2P9L B;  2W6K A;  3V1R A;  3D0P A;  4BR4 A;  3CCM N;  4Y1D A;  4IO9 L;  4WYB A;  4CBU A;  4B1V A;  3K5O A;  3OYI A;  3WNG A;  3NH0 A;  1OH8 A;  4OO1 J;  4DQI A;  1NKC A;  1JLB A;  3N4Q A;  3NF7 A;  1NK4 A;  3IS9 A;  3H6E A;  3DLG A;  3RWU A;  3K0S A;  4DV6 K;  1IBK K;  3H3N O;  4GVM A;  1C0U A;  3G4S N;  2FBX A;  4O4G A;  3DLK A;  1NG9 A;  4CEC A;  3KKR A;  2IIR A;  4FZZ A;  2FBT A;  1LWF A;  4LD0 A;  3LP2 A;  1ASV A;  4FSV A;  4O8K A;  1MA9 B;  1ESV A;  1ASU A;  3U6F A;  5KRT A;  4UQG A;  1HKC A;  4O5B A;  3NHG A;  4CIG A;  4DTP A;  4AM7 A;  2HVI A;  3WNH A;  3J80 O;  1IG9 A;  3THW A;  1DLO A;  4HTL A;  3CCJ N;  2IVO A;  2QWO A;  4JHD A;  2NRR A;  2YHB A;  1RBR A;  3CFR A;  4C8K A;  1HPM A;  3OBW A;  4OX9 K;  4K0K K;  5BRH A;  4FM0 A;  1C0T A;  3LWL A;  4KI6 A;  4MLH A;  4A61 A;  2O8F B;  3EO3 A;  3VA3 A;  4IBN A;  3K57 A;  1VSL A;  3IUC A;  3RRH A;  4X66 K;  4DR5 K;  3UKR B;  1BU6 O;  1F21 A;  3MN7 A;  4DCH A;  5FRN A;  2W42 A;  3ZLJ A;  1IV0 A;  2DTU A;  3V9Z A;  2QWP A;  2A1R A;  4CFA A;  1H1V A;  1BGX T;  1TYQ A;  4PKH A;  1VQM N;  5M1F A;  2OPS A;  2UUB K;  2NNW A;  1NK9 A;  2E2N A;  5I9E B;  4CJ3 A;  3SMS A;  1OH7 A;  5CR4 A;  2O8E B;  3RR7 A;  3DLH A;  3R8E A;  4FYD A;  2YNI A;  1S9E A;  3CER A;  2G8U A;  4CGD A;  2OPR A;  4AF1 A;  2HHW A;  4DSK A;  2EHG A;  5JLH A;  3HOS A;  4DV5 K;  3NAE A;  5BR9 A;  2GEM A;  2ZJR L;  3KLF A;  3KWI A;  1ZBF A;  1JLF A;  1NOZ A;  2QWL A;  2QXL A;  3EL2 A;  4H0O A;  3L3U A;  1ZBU A;  5KQ8 A;  1QZ5 A;  1KLN A;  5MLC Q;  4FCY A;  3PSI A;  2NRV A;  4KFB A;  1L3T A;  4IJN A;  2CH5 A;  4CGF A;  2CGJ A;  3DAW A;  2F8S A;  3KIO A;  3KD1 E;  5AQL A;  4O0I A;  1VQ8 N;  1FK9 A;  3D2F B;  2A3Z A;  2HND A;  1D5A A;  3L4Q A;  4B9N A;  5AQP A;  4ID5 A;  1NGE A;  1ZC6 A;  3J7Z O;  3O6W A;  4WFN L;  1YIT N;  4CER A;  1TYQ B;  1T3V A;  5HL7 L;  4BRE A;  4CZG A;  3GDQ A;  4CGI A;  4C8N A;  3N4P A;  1OH5 A;  4CEB A;  3WEE A;  2D0A A;  4CJS A;  4F2S A;  4B9S A;  1N32 K;  2JGU A;  1WSH A;  3ZEU B;  5ADX A;  4KB0 A;  3S3O A;  3HSC A;  5EU7 A;  3DMJ A;  4LY7 A;  3P83 D;  4B8A B;  5SZT A;  2XY6 A;  4FJ8 A;  1V4S A;  3M5R A;  4BGB A;  1IKW A;  5FRM A;  5HRR A;  4DTO A;  1A5V A;  1FKO A;  2GV9 A;  3V1O A;  3BF1 A;  5IT9 O;  3KD5 E;  3KK2 A;  3S9H A;  1HJR A;  5B8H A;  4IWV A;  2BDP A;  2VYP A;  4Q0B A;  2RN2 A;  1J9A A;  3DWL A;  4G9Z A;  2BUP A;  3MN9 A;  4FWL A;  1VSJ A;  1DEJ A;  3O1B A;  3MCP A;  3J7Y P;  3DRS A;  1X9S A;  2P9N A;  4LFC K;  4PL8 A;  1A5W A;  1XHX A;  3AO2 A;  3CCU N;  1YIJ N;  3ENB A;  4W5R A;  3OYC A;  1D9D A;  3CIP A;  1QQN A;  2VWJ A;  1SKS A;  4LF6 K;  4OGC A;  2YNG A;  4I7F A;  4JKG A;  3J81 O;  3CJ9 A;  3OYK A;  1HKG A;  4E7K A;  2E6M A;  1X9J A;  1WSI A;  2IOC A;  3CCL N;  4OJR A;  3CC7 N;  4BWM A;  5AQJ A;  5GIN A;  1SKR A;  4BGA A;  1RNH A;  2I7P A;  3PIP L;  2QI2 A;  3GL1 A;  5KPT A;  1U49 A;  4FWR A;  4FLU A;  4NLB A;  5FDL A;  2UU9 K;  1JCG A;  3RMA A;  2HW3 A;  2V7Y A;  5HOO A;  1ASW A;  2DFH A;  2D5R A;  3EE8 A;  2QWM A;  4ELU A;  2P51 A;  2IC3 A;  3P5J A;  4OLB A;  1TL3 A;  1XNQ K;  1S22 A;  4ELV A;  4AHU A;  1EX4 A;  3F9K A;  3TAF A;  4X64 K;  3VQC A;  4YOR A;  3QBX A;  4IFY A;  2PFU A;  2ZE2 A;  3QFU A;  2VGM A;  5AQU A;  4JI2 K;  4F9O A;  4JHD B;  4DF8 A;  4YOX A;  4BC2 A;  3E9O A;  4YOT A;  3DM2 A;  4GKK K;  3VQB A;  3V9S A;  3QIP A;  1U04 A;  3HK2 A;  1Q7Y O;  2X6S A;  2F8T A;  3ZT2 A;  5JLF A;  3AVI A;  5C10 A;  2F7T A;  3ZSV A;  4K41 A;  4DTU A;  3LZI A;  5AR0 A;  4AIL C;  1NWK A;  3AVB A;  3H1Q A;  1HYV A;  4A5B A;  5HP1 A;  1M1K O;  1SUQ A;  3O3F A;  3O1W A;  3M8Q A;  1BIU A;  4DSL A;  1NGA A;  4CHQ A;  4CD3 A;  3OBY A;  1JCE A;  3VER A;  2FXU A;  1S3X A;  4BR0 A;  4CFC A;  3TAE A;  2ZQB A;  2W40 A;  3RMD A;  2GWJ A;  4JI4 K;  1W2B M;  1A5X A;  2B4J A;  2VG7 A;  4NXM K;  2FF6 A;  3GOI A;  4B9L A;  3ULE A;  2G8F A;  4JI8 K;  1B92 A;  3MXJ A;  1UA1 A;  1T7P A;  1HQE A;  2PYL A;  3G0Z A;  4BR5 A;  2HF3 A;  2OAN A;  3TAQ A;  1S1W A;  5K14 A;  4CED A;  3ZT3 A;  3V4I A;  1BL3 A;  3Q7B A;  4CHN A;  3OW2 M;  3CCV N;  1NK7 A;  2YNF A;  2O4I A;  4LF4 K;  4JS4 A;  2XY8 A;  3H3O B;  4CZE A;  2GX9 A;  4DF4 A;  1ZBL A;  3I33 A;  3K5N A;  3LL3 A;  1J53 A;  2F96 A;  2BAN A;  5JVG L;  2A40 A;  2KLA A;  4BRK A;  3HPH A;  2HOE A;  2IS3 A;  4PHT X;  3PUF A;  1TAQ A;  1LOT B;  2HNY A;  4CEQ A;  4BAC A;  3VEN A;  1P90 A;  2QEX N;  2FBY A;  3MAQ A;  4LH5 A;  1KAX A;  3AO5 A;  2OCE A;  4PKI A;  2O8C B;  2O8D B;  4KH6 A;  5F1X A;  2HBL A;  2R7Y A;  3ASM A;  3TSU A;  3OHR A;  1NGB A;  3AVK A;  2OTJ N;  3A5O C;  4A2B A;  4FJL A;  1LW0 A;  3QES A;  4NCA A;  1RBU A;  3AVC A;  3P39 A;  1T44 A;  5BPM A;  3V9X A;  4GVE A;  1BOT O;  1NK6 A;  2IGI A;  1Z25 A;  4IFE A;  4H0X B;  5AQS A;  4FOI A;  4BE0 A;  2G8K A;  3TI0 A;  3QLH A;  3LP3 A;  4FJ9 A;  3WNF A;  3OA9 A;  2YI1 A;  3LPU A;  3HYF A;  3QBW A;  1XQS C;  3A5N C;  3SYZ A;  2WFB A;  3H46 O;  2HBJ A;  3GBT A;  2H3G X;  4OKE A;  4ISE A;  5C2D A;  3IRX A;  4H5R A;  3S3N A;  3RR8 A;  1HPZ A;  1XHZ A;  4GKJ K;  2KFN A;  3AGR A;  4OKJ A;  4OPA A;  3MXI A;  5F0X A;  3C95 A;  4NCB A;  4CJU A;  5J2N A;  4W5N A;  5JS1 A;  3DI6 A;  1Y64 A;  4MDA A;  1GOA A;  3FZL A;  2HHT A;  3NDK A;  3LAN A;  3VTI A;  3AA2 A;  3HZ6 A;  2YV0 X;  1BI4 B;  2NRH A;  5SWM A;  3V9U A;  4YDU A;  3QEV A;  4HCC A;  4CJP A;  4DV0 K;  4KBO A;  3R1X A;  3NE6 A;  1KLM A;  2Z1H A;  2O8B B;  1SZ2 A;  1Q9X A;  4FWO A;  5AQO A;  4C8M A;  1S1U A;  4CEA A;  4PWD A;  4BDZ A;  4JNE A;  4CZL A;  4BRF A;  1K9M O;  4FJK A;  1EP4 A;  2UXD K;  3DJC A;  1L5U A;  3B6O A;  3I8B A;  4J8F A;  1KFS A;  4BE1 A;  3THX A;  5C2F A;  2D4W A;  4KV8 A;  1I3A A;  2E8A A;  3DOK A;  2VWB A;  1OKJ A;  3THY A;  4AHT A;  5AQZ A;  4A62 A;  4EZ9 A;  4OPJ A;  4UY8 O;  4H5N A;  1VQN N;  5KI6 A;  3PLA A;  4LSN A;  4BRH A;  3SUN A;  1HLU A;  1WB9 A;  4B3M K;  4C1N I;  1DKG D;  3SBG A;  5GIO A;  1VK0 A;  5FPN A;  1NJI O;  3JXU A;  4JKE A;  4DR6 K;  1IH7 A;  5BRD A;  3RSE B;  4EP4 A;  1C1C A;  4CJF A;  4R79 A;  1U47 A;  1FXX A;  3ZX3 A;  4HVJ A;  4U67 L;  1SKW A;  5E41 A;  2Q1N A;  3RMB A;  1VQL N;  1VQ7 N;  3SV3 A;  1RT4 A;  2P9K B;  5BRE A;  2ZWH A;  1GLE G;  1VSI A;  3BGR A;  4IOC L;  2E4L A;  2CGL A;  3CJA A;  3AY9 A;  1NJY A;  4W5Q A;  3MED A;  4CJK A;  4O55 A;  4DS4 A;  2HHU A;  2LSN A;  2GEL A;  2G8W A;  4CGH A;  4W5O A;  1P8Z A;  4H8K A;  3KVG A;  4I6M B;  3FGU A;  4CIF A;  5AQI A;  3M8S A;  3VQ4 A;  4ZTJ A;  5EVZ A;  3OS2 A;  4FJI A;  3HRG A;  2Z1J A;  1YJN N;  3FFK B;  2QWN A;  1GLF O;  2NZT A;  4JD2 A;  1REV A;  2Q0U A;  1U48 A;  3VQ6 A;  2UXC K;  1K6Y A;  1Q86 O;  2O4G A;  1NGH A;  4A5A A;  1T03 A;  3SQ0 A;  3NVM A;  4MO5 A;  1Q82 O;  2ATQ A;  2GWK A;  3VET A;  2KKZ A;  4BRL A;  1NK0 A;  4EZ6 A;  2ZJP L;  2OZM A;  4H03 B;  4CES A;  1X3N A;  1ZBH A;  1XWL A;  5GAH P;  1TGO A;  4FK4 A;  2DPN A;  1BA0 A;  4JI5 K;  4DR3 K;  4FJX A;  3E1Y A;  1ZXO A;  3NH2 A;  3VEV A;  3VTH A;  4ILH A;  1TKD A;  3VEX A;  2Q36 A;  1MU2 A;  3R9P A;  3CJ1 A;  2KW4 A;  4JI1 K;  3IAY A;  5DM6 L;  4DQS A;  4PKG A;  3D45 A;  4F4K A;  5HLF A;  4AHR A;  3VEZ A;  4H0P A;  5CYQ A;  1S1V A;  4YOY A;  3LDP A;  4XH4 A;  4RWT A;  4AH9 A;  3LM9 A;  2AJQ A;  1GLB G;  1NJZ A;  1RTI A;  3PO4 A;  3C6H A;  3NMU A;  1RDW X;  4ID1 A;  1SL1 A;  4BRN A;  2P9U B;  5JMV A;  3SZ2 A;  2QXF A;  5LMN K;  2AA4 A;  4FJM A;  2EWS A;  4MFB A;  1KCF A;  3QEX A;  1GLJ O;  2VG6 A;  1ZYQ A;  4BR9 A;  5HRP A;  2P9N B;  4KI4 A;  2A5X A;  4DMN A;  4W5T A;  3T19 A;  3BF3 A;  3UE5 A;  2PBD A;  1BIS A;  4Y0W A;  2PYJ A;  4EHT A;  1U45 A;  3D7E O;  1YAG A;  3LDL A;  3R3L A;  1XMO K;  4IOA L;  4DTM A;  4RW4 A;  1C1A A;  1UA0 A;  1KTQ A;  3TAP A;  5AZJ A;  3CPE A;  1VQ9 N;  4O8U A;  4IFV A;  1BI4 A;  1D9F A;  4IEE A;  1SL2 A;  1HNX K;  1EXQ A;  4LH4 A;  3P38 A;  3AO4 A;  3OYL A;  1HYZ A;  1Q8I A;  2YHW A;  2O8C A;  3EZW A;  1X9W A;  4B9Q A;  2X6N A;  3TR8 A;  5GAG P;  4WCE L;  3DLE A;  4DR1 K;  4B1Y B;  2O8E A;  3HM9 A;  2ETJ A;  3K5M A;  1LCU A;  3CQX A;  3MN5 A;  4CGJ A;  1C0M A;  3M8R A;  5FPE A;  1NGG A;  3VF2 A;  3K5L A;  4DFK A;  3OYF A;  1CLQ A;  1VQ4 N;  3PV8 A;  4IOX A;  5M1O A;  3AVG A;  3VQD A;  1OVY A;  4OLA A;  3HT3 A;  4FK2 A;  3SNN A;  3E9L A;  3THY B;  4CJR A;  3QER A;  5FPM A;  4CEO A;  3QNO A;  1N5Y A;  4FO0 A;  4FJ7 A;  4EIA A;  1NBW A;  4DQ8 A;  3SUP A;  5C0Y A;  4GV3 A;  1U2V B;  4B3O A;  4WFA L;  1M90 O;  3QIN A;  3WQT A;  1S5J A;  1JL1 A;  1TKT A;  1EWQ A;  4M3Y A;  4A2A A;  2J4R A;  3FE1 A;  3QIO A;  2HNZ A;  4IDH A;  4KRE A;  1IKV A;  3WXJ A;  3LAM A;  3LP1 A;  4I2P A;  3TTC A;  2OZS A;  3MX5 A;  5LY3 A;  3CJC A;  1ILY A;  1TK5 A;  4J2A A;  3EZ5 A;  4A57 A;  4LSL A;  3I0S A;  1BQN A;  1TKX A;  1RIL A;  5J2M A;  4DR2 K;  3UKR A;  1RTJ A;  2E1Z A;  5E26 A;  1RT1 A;  3TWH A;  1UOC A;  4GW6 A;  5CHI A;  3KZB A;  4DSF A;  4KHU A;  3ZT1 A;  1KSP A;  2Q3S A;  4BC5 A;  4CE9 A;  4KPY A;  1O13 A;  3LZJ A;  4B1W B;  4FLT A;  2Q2R A;  4ISF A;  3MWP A;  3SAG A;  1EQY A;  3THX B;  4FWQ A;  3NGZ A;  1K73 O;  1VSM A;  3VGK A;  3O9S A;  3AAP A;  3CFP A;  2FSJ A;  4ILG B;  2BTF A;  4K8Z A;  5TKY A;  1T6C A;  2ZM6 K;  3HOT A;  3AVL A;  2QTD A;  5KGW A;  3I0R A;  3SPZ A;  1W7A A;  4Z0U A;  3HJF A;  1NU0 A;  4AHC A;  2FSK A;  5BR8 K;  3FZM A;  1E4F T;  4FPA A;  4BRM A;  4AQY K;  1MDU B;  4H5T A;  4JI6 K;  3ZSQ A;  3SAF A;  2P5G A;  1C1B A;  1YVU A;  3ID8 A;  3QML A;  3CME N;  2NRZ A;  3L2U A;  2G8I A;  4DFM A;  3WQU A;  3LDQ A;  4DTX A;  1NOY A;  1T05 A;  4KHS A;  1YXQ A;  4NXN K;  2KHO A;  4EFH A;  1IG8 A;  4CHY A;  1LW2 A;  3VGM A;  4O5F A;  3LAL A;  3IG1 A;  3OYA A;  4LFB K;  4I9Q A;  1RT2 A;  1D8Y A;  1HNW K;  4KHN A;  4FWK A;  4NLC A;  1XUP O;  5D3G A;  4DS5 A;  4JRP A;  1JJ2 M;  1R59 O;  1Y97 A;  5JIC A;  4BDY A;  1WSG A;  2XRI A;  2QK9 A;  1ATN A;  4Z4G A;  3VEW A;  4DR7 K;  4KRF A;  3DRR A;  3ITH A;  4KO0 A;  4DU1 A;  3VQ9 A;  1RDD A;  3CC4 N;  1VSE A;  4OPH A;  4JS5 A;  2QW9 A;  4JD2 B;  4QS9 A;  1BQM A;  1NGC A;  3C94 A;  4OPK A;  3OS1 A;  3SBT A;  4BRO A;  4M42 A;  3H1V X;  4O44 A;  4ZHR A;  2Q97 A;  3NF6 A;  4Y1C A;  1HRH A;  4KTZ A;  4IDK A;  1BCO A;  2RPI A;  3AGK A;  3EY1 A;  4B9U A;  1VSK A;  4JKH A;  1NJW A;  3KLH A;  4KHW A;  1ZBI A;  2D0B A;  3VQ5 A;  1Z26 A;  3TTD A;  3HP6 A;  5KRS A;  2FSN A;  3GE1 A;  4CJ4 A;  1FKP A;  3OYD A;  4M3Z A;  3L6Q A;  3M6G A;  3DXM A;  3V81 A;  5FRO A;  4BVO A;  4HUG A;  3G25 A;  4BR7 A;  3QIC A;  2ZJQ L;  3VA0 A;  3M8P A;  2ASP A;  5J2Q A;  3OYG A;  3GG4 A;  1LV5 A;  1JXB A;  3K9K A;  1TL1 A;  2YHX A;  3SK3 A;  4PUO A;  4JLH A;  2OTL N;  3AVH A;  3HM8 A;  2HST A;  4WQ4 C;  4BRD A;  4CZJ A;  4M3X A;  3HST B;  1HQU A;  4K43 A;  4E7I A;  5J2P A;  1L3U A;  3F9M A;  3FZF A;  2QKB A;  2ASO A;  4E1N A;  2GTD A;  4KHY A;  1VQO N;  4FVM A;  3R6M A;  3PY8 A;  5AQK A;  2B6A A;  2HHV A;  3KK1 A;  2I7N A;  1NKB A;  1WUA A;  2EX3 A;  2E1Y A;  4CZM A;  5BPN A;  5CYM A;  4CZF A;  1YTA A;  5GIP A;  3CXC M;  4DV4 K;  1J5O A;  4CEE A;  3O3G A;  3KK3 A;  4J2B A;  1XI1 A;  3K9J A;  2Q31 A;  1I39 A;  4E1J A;  4B9V A;  1Z6R A;  4CW7 B;  2ITM A;  4LFA K;  3J8A A;  4M3U A;  3Q7C A;  4CFB A;  1VHX A;  4CGG A;  3L8B A;  4FXD A;  1TUY A;  1WLJ A;  3O9R A;  1K8K A;  1Q18 A;  3WNE A;  4CJT A;  1U4B A;  4GNI A;  3VQP A;  1S9G A;  2RHK A;  3K58 A;  4KB1 A;  1YTU A;  1RTD A;  5J1E A;  1LAV A;  3C7N A;  4DUZ K;  3CFO A;  4HCB A;  4CBX A;  4M63 C;  1N33 K;  2V7Z A;  3QEI A;  4F3O A;  4DFJ A;  2DFE A;  1WSE A;  4CF0 A;  2NRW A;  4DB3 A;  1L3S A;  4H0V B;  2PZS A;  2A42 A;  3E66 A;  3VF4 A;  3V1Q A;  4ICL A;  4E7H A;  3ZET B;  1WBD A;  1J54 A;  2Z1I A;  2PY5 A;  2E2O A;  4BC4 A;  3G10 A;  4BG9 A;  4JYA K;  3MMV A;  4HTU A;  5C42 A;  2HHH K;  1X9M A;  1NMN A;  4CK2 A;  4N5S A;  3E01 A;  4DSI A;  4M3T A;  4DV2 K;  2I5J A;  1IBL K;  1VAZ A;  4M41 A;  4DU4 A;  2FC0 A;  4M7Y A;  4DKW A;  2W6L A;  3P1G A;  3T1Y K;  4DHY A;  5CZ1 A;  5E84 A;  3HVR A;  2VQE K;  4YOV A;  3ZX2 A;  3O4Q A;  1HKB A;  1JLE A;  1JCF A;  1BCM A;  3U9D A;  3CYM A;  4JN4 A;  4B1X B;  4B1Z A;  4CBW A;  1KAY A;  3NVK A;  2P9S B;  1XMQ K;  5AZJ B;  4C23 A;  3OTO K;  4FJH A;  2P9I A;  1ATR A;  3ZSZ A;  5AJ3 K;  5ELZ A;  5C15 A;  3QET A;  3TPQ A;  3BZC A;  4FVU A;  5AQX A;  3BY5 A;  1IKY A;  3OYH A;  5ADX H;  4CF9 A;  4BWJ A;  2GBZ A;  1WSF A;  2JWL A;  3KWG A;  3F73 A;  3H08 A;  2HBK A;  3OJS A;  3CET A;  3WEE B;  4A59 A;  4M7X A;  1BO5 O;  1ZBS A;  3ULE B;  4Z94 A;  1KXP A;  3ATU A;  3OYE A;  3SJJ A;  1T8E A;  1OH6 A;  3D2E A;  1RDA A;  4YY3 K;  4YFU A;  2X78 A;  3HTV A;  4B3R K;  3C6A A;  4JKC A;  3VQ7 A;  5HRO A;  3CCE N;  2P9P A;  5JVH L;  4RW9 A;  2BE2 A;  1NK8 A;  4KHQ A;  3PSF A;  4FZY A;  1QQC A;  4GV9 A;  4CCH A;  2KZZ A;  2IAJ A;  4LF7 K;  3SLC A;  5I3U A;  4CZH A;  2WBN A;  4WE1 A;  4RG8 A;  2VGN A;  1DTQ A;  3MWT A;  2KFZ A;  3CM5 A;  5CY4 A;  1FJG K;  3L3V A;  3CF5 L;  4PY5 A;  1QE1 A;  4FLV A;  1WSJ A;  1WOQ A;  3OYJ A;  1KD1 O;  4XH1 A; 
#chains in the Genus database with same CATH homology
 3RMC A;  2IDO A;  2IOC A;  4M3R A;  4CJE A;  2X6N A;  4OJR A;  4E1M A;  4BWM A;  5HBM A;  3TR8 A;  4DTR A;  1RBT A;  3DLE A;  4FLY A;  1SKR A;  1RNH A;  4M45 A;  1RDC A;  3S3M A;  1VSH A;  3V6D A;  4EP5 A;  3SI6 A;  3HXM A;  3SQ1 A;  1CZB A;  1VSD A;  2B5J A;  3AVJ A;  3NF8 A;  1IO2 A;  2ETJ A;  3HM9 A;  3CQ8 A;  3K5M A;  1U49 A;  4TSX A;  4CGJ A;  1KVC A;  1C0M A;  3M8R A;  4FLU A;  5FDL A;  3K5L A;  2XO7 A;  4DFK A;  3SUQ A;  4RW8 A;  3HP9 A;  3OYF A;  1CLQ A;  3PV8 A;  3AVG A;  5JS2 A;  3VQD A;  4H4M A;  3RMA A;  3CG7 A;  5KGX A;  4OLA A;  2HW3 A;  1ASW A;  4KTW A;  1JLA A;  2DFH A;  2D5R A;  3HT3 A;  2QKK A;  3OJU A;  3SNN A;  4ELU A;  4FK2 A;  3ULD A;  2P51 A;  1JKH A;  2FBV A;  2IC3 A;  3P5J A;  4OLB A;  3ZSY A;  1TK0 A;  1TL3 A;  4DU3 A;  4CJR A;  3O3H A;  1LWC A;  4FJG A;  3QER A;  3MEG A;  4CEO A;  3HPO A;  3QNO A;  3T3F A;  1N5Y A;  1Q9Y A;  4B9T A;  4FLW A;  4AHU A;  3JYT A;  1EX4 A;  4ELV A;  4FJ7 A;  2KQ2 A;  3F9K A;  3TAF A;  3SUP A;  2D0C A;  3VQC A;  4B3O A;  4IFY A;  3U3Y A;  1ITG A;  1HYS A;  1VRU A;  3QIN A;  2ZE2 A;  1S5J A;  1JL1 A;  1TKT A;  4CHP A;  4M3Y A;  3MXM A;  1BIZ A;  4DF8 A;  3U3G A;  3QIO A;  2HNZ A;  3DM2 A;  4KRE A;  3VQB A;  1IKV A;  3DRP A;  3QIP A;  3LAM A;  4IG3 A;  3LP1 A;  3V9S A;  4I2P A;  1U04 A;  3HK2 A;  2WON A;  4CF1 A;  2OZS A;  2X6S A;  3VQ8 A;  3BDP A;  2F8T A;  3ZT2 A;  1TK8 A;  3AVI A;  4KKO A;  3QEW A;  4CIE A;  3ZSV A;  1TK5 A;  4J2A A;  3EZ5 A;  3AO1 A;  4DTU A;  3KJV A;  2HVH A;  3LZI A;  4AIL C;  4KAZ A;  4LSL A;  3AVB A;  3I0S A;  3VQQ A;  2YHA A;  1HNV A;  1HYV A;  4DSJ A;  1BQN A;  1TKX A;  1RIL A;  1X1P A;  4B08 A;  4CJ5 A;  5J2M A;  2OPQ A;  4DTS A;  5HP1 A;  4DQP A;  1SUQ A;  3O3F A;  4DLG A;  3C6U A;  3M8Q A;  1BIU A;  1SV5 A;  1NK5 A;  1RT5 A;  4DSL A;  1RTJ A;  3ZSR A;  1WNS A;  4CHQ A;  2DY4 A;  3TAR A;  1RT1 A;  3TWH A;  4BE2 A;  2KZM A;  1UOC A;  4GW6 A;  4DSF A;  4KHU A;  3ZT1 A;  4CFC A;  3JSM A;  3TAE A;  2ZQB A;  3UIQ A;  4CEZ A;  1S1T A;  3OS0 A;  1KSP A;  2Q3S A;  3RMD A;  4CE9 A;  4XIU A;  4KPY A;  2Y1J A;  3LZJ A;  1CXU A;  3LP0 A;  4N41 A;  1A5X A;  1S6Q A;  2VWK A;  4N56 A;  4J2E A;  3CM6 A;  2B4J A;  4FLT A;  4PQU A;  2VG7 A;  3FFI A;  3KLI A;  3OY9 A;  4E3S A;  3SV4 A;  4B9L A;  3KLE A;  2P1J A;  3MEC A;  3ZCM A;  4CJW A;  3NGZ A;  4JRQ A;  2G8F A;  2ITG A;  1VSM A;  3CFP A;  1B92 A;  3MXJ A;  4N47 A;  1UA1 A;  1T7P A;  1HQE A;  2PYL A;  3G0Z A;  4K8Z A;  3DLB A;  3HPG A;  5HRS A;  4DQQ A;  1VRT A;  3KLG A;  3TAQ A;  1S1W A;  5K14 A;  3AVL A;  4CED A;  5KGW A;  3I0R A;  3SPZ A;  3ZT3 A;  1QHT A;  3V4I A;  1BL3 A;  4CFD A;  4CHN A;  1NK7 A;  4Z0U A;  3HJF A;  2YNF A;  3VQE A;  3SQ4 A;  1QS4 A;  4MQ3 A;  1JLG A;  4AHC A;  2O4I A;  4FJJ A;  4Z4C A;  3AVA A;  4OGE A;  4DG1 A;  3RRG A;  3ZSQ A;  2P5G A;  3A2F A;  4JS4 A;  4QAG A;  2XY8 A;  4NYF A;  1ZBL A;  1C1B A;  4DF4 A;  4CF2 A;  1YVU A;  1O1W A;  4E7L A;  4FLZ A;  3K5N A;  2E6L A;  1RDB A;  3AVN A;  1QTM A;  4F8R A;  1RT3 A;  4PA1 A;  3L2U A;  4DFM A;  2G8V A;  2DFF A;  4DTX A;  2G8I A;  1J53 A;  2F96 A;  1JLC A;  4ZTF A;  1T05 A;  1NOY A;  4KHS A;  2BAN A;  1KVA A;  2HHS A;  2XHB A;  3TAN A;  1GOB A;  3HPH A;  2IS3 A;  3NH1 A;  4E7J A;  4DFP A;  1SL0 A;  4CHY A;  1LW2 A;  1TAQ A;  2HNY A;  3PUF A;  4OKK A;  4CEQ A;  4CJL A;  4Q5V A;  3LWM A;  4BAC A;  4ELT A;  3LAL A;  3IG1 A;  2FBY A;  1RT7 A;  3OYA A;  3MAQ A;  4LH5 A;  3AO5 A;  2P5O A;  3ZSW A;  4I9Q A;  1RT2 A;  1D8Y A;  2HHQ A;  4KHN A;  2R7Y A;  1X9W A;  3ASM A;  4I2Q A;  4O0J A;  3OYM A;  3THV A;  3AVK A;  5D3G A;  4DS5 A;  4JRP A;  1Y97 A;  4BDY A;  3L2R A;  3L2Q A;  4Z4E A;  1WSG A;  4E19 A;  1LW0 A;  3L2W A;  2XRI A;  2Z1G A;  2WOM A;  4FLX A;  3QES A;  4FJL A;  4NCA A;  2QK9 A;  4CJV A;  1RBU A;  4Z4G A;  1QSY A;  3AVC A;  2VG5 A;  4CJQ A;  3QNN A;  4KRF A;  1IKX A;  3DRR A;  3ITH A;  4KO0 A;  1YT3 A;  3V9X A;  4DU1 A;  2KTQ A;  3VQ9 A;  3NF9 A;  1S1X A;  1B9D A;  1RDD A;  1NK6 A;  5C24 A;  1VSE A;  2IGI A;  1Z25 A;  1RBS A;  4JS5 A;  4IG0 A;  3TAM A;  3SCX A;  5CZ2 A;  1BQM A;  3C94 A;  4OPK A;  4FW2 A;  4BE0 A;  2G8K A;  3TI0 A;  3QLH A;  4AHV A;  2YKM A;  4AHS A;  3ZT4 A;  3LP3 A;  3OS1 A;  4FJ9 A;  4H4O A;  3WNF A;  1R0A A;  4M42 A;  3LPU A;  4O44 A;  3HYF A;  3AVF A;  1C6V A;  3LPT A;  4ZHR A;  4CEF A;  3SYZ A;  4DSE A;  4QCL A;  3NF6 A;  4OKE A;  4Y1C A;  1HRH A;  3LAK A;  1W9H A;  4KTZ A;  3V9W A;  1N6Q A;  3IRX A;  4IDK A;  3S3N A;  1BCO A;  2RPI A;  1HPZ A;  1XHZ A;  3RR8 A;  3EY1 A;  4B9U A;  1JXE A;  1VSK A;  1NJW A;  4FM2 A;  4FZX C;  4OKJ A;  4DQR A;  3MXI A;  2KFN A;  3KLH A;  4KHW A;  3C95 A;  3V1R A;  4CJU A;  4NCB A;  5J2N A;  3D0P A;  1ZBI A;  4W5N A;  5JS1 A;  5HRN A;  2D0B A;  3DI6 A;  1Z26 A;  4Y1D A;  3VQ5 A;  1GOA A;  3NFA A;  2HHT A;  3HP6 A;  5KRS A;  1JL2 A;  4CJ4 A;  3NDK A;  1FKP A;  3LAN A;  3AA5 X;  3K5O A;  3OYD A;  3OYI A;  3WNG A;  1CZ9 A;  4I9L A;  3NH0 A;  3AA2 A;  4DQI A;  4M3Z A;  4C8L A;  4CK1 A;  1NKC A;  4NYN A;  2YV0 X;  1JLB A;  3NF7 A;  3K59 A;  5FRO A;  3V81 A;  1NK4 A;  1BI4 B;  4OVL A;  5SWM A;  4HUG A;  3NCI A;  3V9U A;  1KRP A;  3QEV A;  3IS9 A;  3K2P A;  4HCC A;  2RKI A;  4GMJ B;  3DLG A;  4CJP A;  3NE6 A;  3VA0 A;  3M8P A;  1KLM A;  1XC9 A;  3RWU A;  4F3T A;  5J2Q A;  2Z1H A;  3OYG A;  2RF2 A;  3TAB A;  1Q9X A;  1HNI A;  5KTQ A;  1RTH A;  1LV5 A;  3ALY A;  4C8M A;  1JXB A;  1S1U A;  4GVM A;  4CEA A;  4K8X A;  4PWD A;  1C0U A;  1TL1 A;  3B6P A;  5C25 A;  4JLH A;  4PUO A;  2FBX A;  4O4G A;  3AVH A;  1GOC A;  3DLK A;  4CEC A;  3KKR A;  4BDZ A;  3RTV A;  3PX0 A;  4M3X A;  4FZZ A;  4FJK A;  2FBT A;  3HST B;  3KTQ A;  1HQU A;  1EP4 A;  1LWF A;  4LD0 A;  4E7I A;  1S6P A;  1L5U A;  4G1Q A;  2XY7 A;  3B6O A;  5J2P A;  1L3U A;  1KFS A;  4L8R B;  3LP2 A;  4BE1 A;  2QKB A;  4KV8 A;  1ASV A;  1I3A A;  4E1N A;  3DOK A;  1KVB A;  4KHY A;  4C8O A;  1ASU A;  1WAF A;  4FVM A;  3U6F A;  3HL8 A;  3AVM A;  3PY8 A;  4AHT A;  5KRT A;  4UQG A;  2B6A A;  4EZ9 A;  4O5B A;  4OPJ A;  2HHX A;  2HHV A;  3KK1 A;  5KI6 A;  3NHG A;  4CIG A;  4LSN A;  1NKB A;  1QSS A;  3SUN A;  4DTP A;  2EX3 A;  2HVI A;  3WNH A;  1VK0 A;  1IG9 A;  1NJX A;  4B8C A;  1DLO A;  5CYM A;  1YTA A;  1J5O A;  3SPY A;  4CEE A;  3O3G A;  1IH7 A;  1TVR A;  3KK3 A;  4J2B A;  1CXQ A;  4Z4I A;  1EET A;  3KKS A;  1XI1 A;  2YHB A;  4EP4 A;  1RBR A;  1I39 A;  4B9V A;  1C1C A;  2A1S A;  3CFR A;  4HUF A;  4C8K A;  3NBP A;  4CJF A;  1U47 A;  1FXX A;  3LDS A;  4HVJ A;  4FM0 A;  1C0T A;  2OPP A;  1SKW A;  4Z4F A;  5E41 A;  3LWL A;  4M3U A;  3RMB A;  4KI6 A;  4HUE A;  2JLE A;  4CFB A;  3MEE A;  4CHO A;  3SV3 A;  1RT4 A;  4CGG A;  1VSF A;  3VA3 A;  1VSI A;  4IBN A;  3K57 A;  1VSL A;  3BGR A;  3L8B A;  3RRH A;  4FXD A;  1WLJ A;  4B9M A;  2E4L A;  2GUI A;  2X74 A;  4J2D A;  5DMR A;  1NJY A;  3WNE A;  4CJT A;  4W5Q A;  1U4B A;  1F21 A;  3VQP A;  3MED A;  1S9G A;  4CJK A;  3AV9 A;  4DWI A;  3K58 A;  4KB1 A;  5FRN A;  2W42 A;  3NGY A;  3SUO A;  4O55 A;  4DS4 A;  1YTU A;  2DTU A;  3V9Z A;  2G8H A;  1RTD A;  5J1E A;  4E0D A;  2HHU A;  2LSN A;  1EKE A;  1LAV A;  2G8W A;  2A1R A;  1HMV A;  3OVN A;  3CFO A;  2XY5 A;  4CFA A;  4HCB A;  4CGH A;  1BGX T;  1WN7 A;  4W5O A;  4H8K A;  3QEI A;  2OPS A;  4F3O A;  4DFJ A;  2DFE A;  4CIF A;  1WSE A;  3VQ4 A;  4CF0 A;  3M8S A;  1NK9 A;  4ZTJ A;  3OS2 A;  4CJ3 A;  4FJI A;  1L3S A;  3AA4 A;  2Z1J A;  4FM1 A;  2YNH A;  3RR7 A;  3OYB A;  3DLH A;  3HO1 A;  3AA3 A;  4FYD A;  2PZS A;  2YNI A;  2YKN A;  1S9E A;  3AO3 A;  2G8U A;  4CGD A;  2OPR A;  1REV A;  4DTN A;  3V1Q A;  1U48 A;  4ICL A;  2EHG A;  4DSK A;  2HHW A;  3ISN C;  3VQ6 A;  4E7H A;  3NAE A;  1K6Y A;  4IKF A;  1J54 A;  3VN5 A;  2Z1I A;  3KLF A;  2PY5 A;  3ZSO A;  1ZBF A;  1JLF A;  4BDP A;  2O4G A;  1NOZ A;  4Z4H A;  3G10 A;  1T03 A;  3L3U A;  3SQ0 A;  1ZBU A;  1TV6 A;  4HTU A;  2ATQ A;  5C42 A;  4EZ6 A;  1KLN A;  1NK0 A;  1LAW A;  4FCY A;  2OZM A;  2ZD1 A;  1X9M A;  3I8D A;  4CES A;  1ZBH A;  4CK2 A;  4N5S A;  3E01 A;  4DSI A;  1XWL A;  4KFB A;  1L3T A;  1TGO A;  4M3T A;  4FK4 A;  4CGF A;  4DTJ A;  2F8S A;  3C6T A;  2I5J A;  3KIO A;  3KD1 E;  1RCH A;  1UAX A;  4M41 A;  4O0I A;  4DU4 A;  4FJX A;  1FK9 A;  1W0H A;  3NH2 A;  2FC0 A;  1TKD A;  2HND A;  1D5A A;  3P1G A;  1MU2 A;  4B9N A;  4ID5 A;  3QEP A;  1RBV A;  2KW4 A;  3IAY A;  3ZT0 A;  4DQS A;  3OYN A;  3DYA A;  3D45 A;  5CZ1 A;  3QO9 A;  4CER A;  4F4K A;  4FK0 A;  3HVR A;  5HLF A;  3O4Q A;  4QOZ B;  1JLE A;  4AHR A;  5CYQ A;  1BCM A;  1S1V A;  2HMI A;  3CYM A;  1DTT A;  4C8N A;  4CGI A;  4CK3 A;  4CEB A;  1TAU A;  2D0A A;  4AH9 A;  4CJS A;  4F2R A;  1LWE A;  2AJQ A;  3EYZ A;  4YNQ A;  1NJZ A;  4B9S A;  4F2S A;  4FJN A;  2JGU A;  4NCG A;  4FJH A;  1RTI A;  2OYQ A;  3ZSZ A;  1WSH A;  3PO4 A;  3QET A;  4N76 A;  3PO5 A;  5DK5 A;  1B9F A;  1L3V A;  4KB0 A;  1IKY A;  3OYH A;  1BHL A;  4ID1 A;  3S3O A;  4CF9 A;  1SL1 A;  3HVT A;  5EU7 A;  4BWJ A;  2NUB A;  3DMJ A;  2GBZ A;  3P83 D;  4LY7 A;  3ZSX A;  1WSF A;  4B8A B;  5SZT A;  2QXF A;  5T7B A;  3SZ2 A;  2XY6 A;  4M3W A;  4FJ8 A;  4FJM A;  3SQ2 A;  3F73 A;  4MFB A;  1KCF A;  1IKW A;  3QEX A;  3VQA A;  3H08 A;  5HRR A;  5I42 A;  5FRM A;  2VG6 A;  1A5V A;  4DTO A;  3OJS A;  1ZYQ A;  5HRP A;  1G15 A;  1FKO A;  2GV9 A;  4KI4 A;  3V1O A;  3T1A A;  4DMN A;  4W5T A;  4DLE A;  3T19 A;  3OYE A;  1KFD A;  3KD5 E;  3SJJ A;  3KK2 A;  1T8E A;  1NKE A;  2HB5 A;  1HJR A;  1RDA A;  3S9H A;  1BIS A;  2BDP A;  2PYJ A;  4Q0B A;  1U45 A;  2RN2 A;  4YFU A;  2X78 A;  4E89 A;  1J9A A;  4FW1 A;  4DTM A;  3VQ7 A;  4KTQ A;  5HRO A;  3NGI A;  1VSJ A;  4RW4 A;  1C1A A;  4RW9 A;  2BE2 A;  1UA0 A;  1NK8 A;  3DRS A;  4FZY A;  4KHQ A;  1X9S A;  1KTQ A;  4CHZ A;  1QQC A;  2Y1I A;  1JLQ A;  3TAP A;  1A5W A;  1XHX A;  3AO2 A;  3DOL A;  4CCH A;  2KZZ A;  1RT6 A;  2OA8 A;  2IAJ A;  4IFV A;  4W5R A;  3OYC A;  1BI4 A;  3DLR A;  5I3U A;  1D9D A;  1WAJ A;  3L2V A;  4WE1 A;  1D9F A;  4FJ5 A;  4RG8 A;  1DTQ A;  4CF8 A;  2KFZ A;  2VWJ A;  3TAG A;  1SKS A;  4OGC A;  2YNG A;  4RW6 A;  1EXQ A;  3CM5 A;  4I7F A;  1SL2 A;  4LH4 A;  5CY4 A;  3PX4 A;  3L3V A;  1UWB A;  3AO4 A;  4R5P A;  2BGG A;  4PY5 A;  1QE1 A;  3OYL A;  1HYZ A;  4FLV A;  4RW7 A;  1WSJ A;  1TKZ A;  1Q8I A;  3OYK A;  3PX6 A;  4E7K A;  3OYJ A;  2E6M A;  1QSL A;  3O4N A;  4HHT A;  1WSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...