4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
4Z4FA 2OYQA 1TK0A 4OJRA 3KLFA 1ZBUA 3H08A 4Y1CA 1C0UA 3V9UA 2G8FA 4F2SA 4HCCA 1S1XA 1W9HA 2G8KA 1WAFA 5HRSA 2Y1IA 3VN5A 2HW3A 3L2WA 2AJQA 1HYZA 1LWFA 3LWMA 3DYAA 3QIPA 2XHBA 4E19A 4EP5A 2PYJA 1RBTA 1TK8A 2OPSA 1C1CA 3IRXA 4OVLA 1VK0A 1JLQA 4OKKA 4M45A 5J2PA 4N47A 2IGIA 3EY1A 4CCHA 4HUFA 2FC0A 1CZBA 1JXEA 4CF8A 1BQMA 4MQ3A 3NDKA 5SWMA 1BQNA 1ZYQA 1D8YA 4FYDA 3S9HA 3U3GA 1D9DA 4Z4EA 3ZT3A 4KRFA 3QINA 3B6PA 4AHCA 1RNHA 1CZ9A 4FM0A 2RN2A 2QKKA 3RR8A 4QOZB 1T8EA 3NH0A 4DTUA 3WNGA 3QEPA 4NCBA 3CFPA 1IKVA 3RTVA 4M3ZA 1BHLA 1UOCA 3RR7A 2A1RA 3ALYA 3SUPA 4CHYA 3ZSYA 2BE2A 3SV4A 1N6QA 2HHTA 1QSLA 1WAJA 3RMBA 1TVRA 4CGFA 4IG3A 4JS5A 4NYFA 2FBTA 1B92A 3OYHA 3D0PA 3CFOA 4DTRA 3TANA 3QIOA 4DQQA 1NK7A 3TR8A 3KKSA 4E7IA 4FZZA 1HRHA 3TI0A 1C0TA 2F8SA 4I2QA 4CEDA 1C0MA 3AV9A 4HUEA 4KREA 3AO5A 1RBSA 1IKWA 2RF2A 1LV5A 4C8KA 5CYMA 3AVFA 1F21A 1S5JA 1A5VA 4ID1A 3ULDA 1NJZA 3ZSOA 4CEQA 4L8RB 4FJ9A 2PY5A 4PQUA 2HHXA 3V9SA 5I42A 1U49A 1VSJA 1NK5A 3KD1E 3K58A 3BGRA 2B5JA 1NOZA 4W5TA 4CERA 3SQ4A 1LW2A 3O4NA 1Z26A 3QO9A 1Z25A 4E7LA 3CM6A 2ATQA 4W5RA 4M3RA 1QE1A 4JS4A 1VRUA 3VA0A 4FJJA 3NAEA 2Y1JA 4O55A 1HNVA 4OKJA 3OJUA 2O4GA 3KLEA 4LSNA 1RBRA 4RW6A 3HJFA 4JLHA 3TABA 3ZT2A 3TAPA 4Z4CA 1BCOA 5HRNA 4OPJA 3AVCA 2Z1GA 4PWDA 1TL3A 4O0JA 1ITGA 3V9ZA 4FZXC 4E7HA 4J2DA 4Z4GA 1KFDA 1VSLA 5K14A 4PY5A 3P1GA 2BGGA 3C6TA 3VQCA 4I9QA 3C95A 1ZBHA 4GVMA 2Z1IA 3JYTA 5SZTA 4KTZA 3LWLA 1U48A 2YNGA 4DTOA 1BISA 2X78A 1HPZA 4OGCA 1QS4A 3QLHA 3RMCA 3AVAA 2WONA 3HT3A 4DS4A 4LD0A 5J2MA 2G8UA 2OPQA 1S1TA 1KTQA 1IG9A 1LAWA 3VQ4A 3K5NA 4M41A 4CEAA 1L3TA 1XI1A 1D9FA 1TAUA 2D0CA 4HHTA 3ZT0A 1GOCA 1GOAA 3AVLA 3LP0A 4CGJA 1O1WA 1GOBA 1ASWA 4FXDA 1WSJA 3AA3A 3NH1A 3MECA 4CJWA 3AVKA 2YKNA 4PA1A 4CJ4A 3RRHA 1JLGA 4HVJA 1DTQA 4O5BA 1KRPA 2P51A 5CYQA 3OS2A 1T7PA 5JS2A 4M3WA 1S9EA 1WSGA 1S9GA 3TAGA 3S3NA 3V9XA 3TAFA 2PZSA 1FXXA 5KGXA 1LWEA 3K5MA 3IG1A 1IKXA 4E1MA 1LAVA 3SI6A 3KJVA 3HYFA 4GW6A 4M3TA 4HTUA 1ZBLA 2Z1JA 3DM2A 4BWJA 3ASMA 3ZSVA 4CF0A 4J2AA 4B3OA 3HP9A 4MFBA 4RW9A 3OYCA 5J2QA 4BE2A 3AVGA 3EYZA 1NKEA 1Q8IA 3AVJA 4DF8A 4QAGA 3VQBA 1RT3A 1BIUA 2KFZA 4M3UA 4IFYA 1SUQA 5CZ2A 1TK5A 3P5JA 3NFAA 2IC3A 3HO1A 3MXIA 3DRPA 3D45A 4B08A 1KFSA 3SNNA 3MXMA 3VQAA 3L2UA 2XY8A 3DLRA 1I3AA 3M8PA 1T05A 3K5LA 3RMDA 1VSDA 5HROA 4NYNA 1KVBA 3V1RA 4N5SA 1TKDA 3VQ6A 3ZSZA 3O3GA 1YTUA 4G1QA 4DTJA 4DTNA 1JLAA 3MXJA 4FJLA 3OS0A 3E01A 3CYMA 4Y1DA 4DFMA 4DSKA 3OYBA 4IKFA 4QCLA 4Z4HA 4EZ9A 4O4GA 2IAJA 1G15A 1NK8A 4JRQA 3K57A 3DOKA 2HMIA 5CY4A 4DWIA 3RWUA 5KI6A 2NUBA 1C6VA 4I2PA 4OLBA 1RT6A 2XY6A 4CHPA 1J53A 4LSLA 4CF9A 2VWJA 3HXMA 4ELUA 4OKEA 4DFPA 4C8LA 4FJXA 3ZSRA 4J2BA 4B9NA 4B9SA 1VSEA 1X1PA 1JL1A 4FLWA 2X6SA 3DLBA 3C6UA 3ZSWA 4YFUA 1RTIA 3RRGA 4N41A 3M8SA 3QNNA 3HL8A 4DQIA 3PUFA 5I3UA 1S1UA 3AVIA 3LP1A 1RBUA 2KZMA 3HVRA 1ASUA 1VSMA 2E6LA 3IS9A 1JLCA 3VQDA 4CK1A 5J1EA 1RTHA 5C24A 4K8XA 4CF1A 4DSFA 1QSYA 1ASVA 4LY7A 2D5RA 4E89A 4JRPA 4CECA 3NHGA 4F4KA 3QESA 1CXUA 4R5PA 1TKTA 4TSXA 1NK6A 2ZE2A 1CLQA 3SQ0A 1VSKA 4B9VA 2ETJA 3ZSXA 3M8RA 4F8RA 4AHSA 3K5OA 5FRNA 3EZ5A 1EETA 1WSHA 1WNSA 4OLAA 4Q5VA 4K8ZA 3PO5A 4DSJA 3S3OA 4RG8A 1HMVA 4KI4A 3A2FA 4ZHRA 1EXQA 3LPTA 3NBPA 4Q0BA 3S3MA 4KHUA 3VQ7A 3PX0A 4CEEA 3B6OA 4FVMA 3LALA 4W5NA 3AVNA 4BE0A 4E1NA 1IKYA 4CJQA 2D0AA 2YHBA 1XHXA 4NCAA 4CJUA 3SV3A 2OPPA 1RDDA 4DU3A 4Z0UA 1SKSA 4DLEA 3MEEA 4KHWA 1J9AA 3G0ZA 2HNDA 3O4QA 2FBYA 4BWMA 4DU4A 3DMJA 2A1SA 3VQEA 2G8VA 4ZTFA 1L3UA 3LANA 5DK5A 4B8CA 3PV8A 3SUOA 1X9WA 4KI6A 1UA0A 4DLGA 4E7KA 3DOLA 3U3YA 1ZBFA 2EHGA 3UIQA 4CGHA 3SJJA 3T3FA 1A5WA 1BL3A 4BDYA 4DTPA 1J54A 3OYNA 4H4OA 1MU2A 4IFVA 4KO0A 4CFAA 4DU1A 2X74A 4FW2A 1HYVA 3ZSQA 4CK3A 1JLEA 2KQ2A 1RT2A 3LP2A 3NF6A 1S1WA 4RW7A 1HYSA 4CJVA 3PX4A 3O3HA 1NK0A 1RTDA 1TGOA 2HHQA 3ZT1A 4CF2A 3LDSA 1RTJA 2QK9A 4I9LA 2IDOA 3QERA 3QEXA 1B9FA 3HP6A 1S6QA 3DRSA 4BE1A 1C1BA 2BDPA 3U6FA 3KD5E 4CEFA 5HP1A 4FLXA 3MEGA 4FLTA 1JKHA 1IH7A 4ICLA 3L3UA 4XIUA 1B9DA 4FLYA 2YKMA 1RDCA 4CHQA 4DSLA 1R0AA 3L2QA 3SQ2A 2D0BA 3HVTA 4LH4A 1WSFA 4DSIA 1S1VA 3WNEA 3JSMA 2X6NA 4YNQA 1HQUA 3QEWA 4B9LA 2EX3A 2HNZA 1RDAA 2HHUA 3MEDA 3LPUA 1FKOA 1A5XA 4CIFA 5HBMA 2HB5A 1TKZA 3IAYA 4HCBA 1LW0A 2DFFA 4FJ7A 4EP4A 4AHTA 5FROA 4FJNA 4FJ5A 1EP4A 1YT3A 3V9WA 2YHAA 5KRSA 3NF7A 2B6AA 3LP3A 1RILA 4CFBA 3C94A 4W5QA 3KLHA 4DF4A 3SPYA 4F3OA 2HHVA 4FW1A 1XWLA 4AHVA 4CJPA 3WNHA 3OYFA 3OYAA 5J2NA 4F2RA 3NH2A 4B9UA 1S6PA 3LZJA 2G8WA 4BDPA 4CESA 4ID5A 4CJ3A 4KB1A 2FBXA 4CE9A 4IG0A 4O44A 4DQPA 3TAEA 2E6MA 3KK3A 3ZCMA 4DFJA 1I39A 2OA8A 2YNHA 4UQGA 3OYLA 3AA5X 3V1OA 1YVUA 5DMRA 5HLFA 3NGZA 1RCHA 3CFRA 3VQ9A 3SYZA 2XY7A 4J2EA 1NJWA 3KTQA 4E0DA 3DLGA 1SV5A 1Y97A 3SPZA 1WSIA 1JLBA 3DI6A 4IDKA 4W5OA 3BDPA 3SCXA 2XO7A 4DSEA 4FJIA 2P1JA 1DLOA 4F3TA 1REVA 1TV6A 5C42A 1EKEA 2GV9A 4BACA 3VQPA 1FKPA 2LSNA 4CHOA 2KTQA 5HRRA 3DLHA 4LH5A 1U47A 2O4IA 1KSPA 4FK4A 3NF9A 1BIZA 4RW8A 3K59A 2F8TA 3RMAA 4AHRA 3HK2A 3OYGA 3ITHA 3KK2A 1NKCA 4PUOA 1TKXA 4H4MA 2RKIA 5KTQA 2HHWA 4CHZA 1BI4B 3QEIA 1L3SA 3AO4A 1VSHA 4KFBA 3LZIA 3L3VA 3NCIA 2VG5A 4KV8A 4CIGA 5E41A 4IBNA 2JGUA 3KLIA 5JS1A 2WOMA 2RPIA 1CXQA 5C25A 3VQ5A 3I8DA 5FDLA 1RT4A 2PYLA 1HQEA 5EU7A 1T03A 3ISNC 1YTAA 1TL1A 2XY5A 1L3VA 2I5JA 4I7FA 3SQ1A 1RT5A 3OY9A 3HM9A 4KHQA 4KB0A 4Z4IA 4CGGA 4KHSA 4O0IA 2HHSA 5KGWA 1QSSA 1D5AA 3F9KA 3TWHA 1SKRA 3DLKA 2IOCA 2Q3SA 4C8NA 4FJHA 3TARA 1SL0A 1Q9XA 1HJRA 3OYEA 3HPHA 4E7JA 4FM2A 4FCYA 1QTMA 2JLEA 3SZ2A 3OYIA 2DTUA 1RT1A 3V81A 4KKOA 4CFDA 3OYMA 4FLVA 2BANA 4M3YA 1N5YA 2G8HA 1NOYA 2HNYA 4FJ8A 4N56A 3HPOA 1VSIA 4DFKA 4N76A 4M3XA 1W0HA 4CFCA 3ZT4A 3F73A 3L2RA 1DTTA 4CGIA 3P83D 1HNIA 3AVHA 1Q9YA 3SUQA 4FM1A 2VG6A 3OVNA 3NF8A 3NGIA 1BI4A 1WSEA 2IS3A 2DFHA 1U4BA 4CJFA 3KLGA 1NJXA 1SKWA 3QETA 3OYDA 4FK0A 4CEBA 3KKRA 2R7YA 3VA3A 3SUNA 2P5GA 4FJGA 1RT7A 4HUGA 2YNFA 4CEOA 1SL1A 1NKBA 3PX6A 3PO4A 4C8OA 4ELVA 1QHTA 2P5OA 3OYJA 2HVIA 3G10A 3I0RA 3VQ8A 1BCMA 2DFEA 2QKBA 4CGDA 2E4LA 1NK9A 4AH9A 3AA2A 2YNIA 1TAQA 4WE1A 2KZZA 3AVMA 1K6YA 1L5UA 4ELTA 1EX4A 4KTQA 1KVAA 4CJLA 3AO3A 3K2PA 4KHNA 1WN7A 3LAMA 2KFNA 1NK4A 4KAZA 3OJSA 1JLFA 4CK2A 3QNOA 1U45A 5KRTA 1KLMA 4DTXA 3CG7A 1RBVA 2F96A 1UA1A 4H8KA 1JXBA 3CM5A 4E3SA 1X9SA 1XC9A 1VSFA 3T1AA 4DG1A 4OGEA 1J5OA 3TAMA 4CEZA 4FJKA 1LWCA 1UAXA 3V1QA 1KCFA 4DS5A 4FK2A 5D3GA 4CHNA 4CIEA 3THVA 3DLEA 3T19A 4KTWA 2ZQBA 3V4IA 3OYKA 3L2VA 2OPRA 4CJTA 3CQ8A 3AVBA 4BDZA 2HVHA 5CZ1A 2Z1HA 4CJSA 3V6DA 5FRMA 1C1AA 2XRIA 4OPKA 4DQSA 2VG7A 3WNFA 4B8AB 1QQCA 1RDBA 3VQQA 1SL2A 4B9TA 4AHUA 2OZSA 4M42A 1FK9A 4FLUA 3HPGA 3FFIA 3TAQA 4NCGA 3NGYA 4CJKA 4B9MA 2GUIA 1VRTA 1JL2A 4KHYA 5T7BA 4EZ6A 3AA4A 1U04A 4FLZA 2QXFA 3PY8A 4CJ5A 3LAKA 3NE6A 1WLJA 4DMNA 3OS1A 3M8QA 3DRRA 4CJEA 1KVCA 3L8BA 4DTMA 4DQRA 2GBZA 2ZD1A 4ZTJA 1KLNA 3KIOA 4FZYA 4FJMA 2B4JA 2DY4A 3AO2A 3AO1A 1UWBA 3MAQA 1XHZA 4AILC 2G8IA 4KPYA 3I0SA 3HSTB 2YV0X 1BGXT 4GMJB 3KK1A 1X9MA 1NJYA 4DTSA 4C8MA 2W42A 4CJRA 2FBVA 2VWKA 1ZBIA 5HRPA 3O3FA 2ITGA 2OZMA 2KW4A 1IO2A 3QEVA 4RW4A
chains in the Genus database with same CATH superfamily
4ISFA 4B3MK 2OYQA 4Z4FA 4OJRA 4H0XB 3H08A 3V9UA 1C0UA 1U6ZA 4HCCA 1S1XA 2GWJA 2G8KA 2Y1IA 4V19S 4C1NK 2AJQA 3CJ9A 4IZ9A 4EP5A 1TK8A 2OPSA 1C1CA 4M45A 3EY1A 2QA4N 1BQMA 4A5AA 1DKGD 4FYDA 5AFUA 4B9QA 3S9HA 3SAGA 2P9PA 4WQ5A 3BEXA 3RR8A 1RNHA 1CZ9A 2QKKA 4QOZB 4BC4A 5BN8A 1XC3A 2PFUA 4NCBA 3E66A 2F7TA 5KPZA 2HBKA 4U7BA 3SUPA 2BE2A 3RVCA 4CGFA 3ZETA 4XH1A 1IBKK 4LFBK 4DTRA 4RWTA 1P90A 1NK7A 3AGRA 3TR8A 3KKSA 1T6DA 5BPMA 4CEDA 5ADXH 2RF2A 4C8KA 3C65A 4CEQA 3GOIA 2HHXA 3V9SA 5I42A 4WQ4C 1NK5A 1HNXK 4BRKA 1WOQA 1Z6RA 3SQ4A 1LW2A 3O4NA 1Z26A 4E7LA 3CM6A 2ATQA 4JS4A 3HJFA 2RE2A 3C6AA 3ZT2A 3AVCA 2Z1GA 3KZBA 1TL3A 5EOYA 2FSKA 4FZXC 5LJVA 1KFDA 5K14A 3H3NO 3LDNA 4FO0A 2KKZA 3VQCA 3C95A 4GVMA 1O13A 2YNGA 1BISA 4OGCA 5GAGP 3QBWA 4LD0A 2G8UA 4JI5K 3K5NA 2V7ZA 4M41A 1D9FA 1XI1A 1TAUA 3OA9A 2D0CA 1GOCA 3EO3A 3LP0A 4CGJA 1GOBA 1ASWA 5GIPA 1VQLN 3NH1A 4HVJA 4CZGA 2F9WA 4JK9A 4O5BA 2P51A 5JS2A 3SMSA 5GINA 1S9EA 1S9GA 3C7NA 3S3NA 4BR9A 5EY4A 5KGXA 3SAFA 3O8MA 1LWEA 3KJVA 3HYFA 3DM2A 3ZSVA 3ASMA 5JMVA 1OKJA 4NO7A 4RW9A 4QAGA 5BRHA 1RT3A 1BIUA 2P9KB 4IFYA 5CZ2A 4Y0WA 3SAHA 4KH6A 3HO1A 1NGGA 4B08A 3UE5A 2GELA 3MXMA 2QXLA 3L2UA 3M8PA 1T05A 3K5LA 5ELZA 3RMDA 4NYNA 3VQ6A 3MK6A 4DTJA 3E01A 4XEIA 4IKFA 1WB9A 2FXUA 1NK8A 4JRQA 3O9RA 3K57A 5KI6A 4I2PA 1C6VA 3MMVA 1RT6A 4OLBA 2XY6A 4LSLA 4WFBL 4CF9A 2VWJA 4OKEA 4C8LA 3D2EB 3TTCA 4J2BA 1T3VA 3D7EO 4FLWA 3C6UA 3A5OC 3UKRA 1VQNN 3PUFA 3WEEA 5C0YA 4H5WA 4LC9B 3AVIA 3LP1A 1RBUA 1VSMA 2P9UB 3O9SA 1QSYA 2D5RA 4E89A 4JRPA 4TSXA 2D0OA 1MDUB 4B9VA 3M8RA 4AHSA 5FRNA 1YVNA 2ZWHA 4JD2A 4LF5K 1HMVA 3O4WA 3CCQN 3LPTA 3S3MA 1NU0A 3PX0A 4BRDA 3LALA 4E1NA 1IKYA 5H1SQ 2D0AA 2YHBA 3FZKA 3SV3A 1SKSA 4DLEA 4RCHA 4EIAA 2HNDA 3CJAA 3DMJA 3VQEA 2G8VA 2O8FB 2ZJQL 3G71N 4DLGA 3DOLA 2EHGA 4BR7A 3T3FA 2O8BB 2E20A 5AQXA 4BG9A 2QWMA 4H4OA 2QI2A 5GIOA 2X74A 4FW2A 5KPRA 1MA9B 3THWB 1XMQK 3LP2A 3NF6A 1EWRA 3NMUA 1RTDA 3ZT1A 4CF2A 3LDSA 2O8DB 3FE1A 1KAZA 3QERA 2E2QA 3U6FA 2Q97A 1VQPN 3MEGA 1JKHA 1IH7A 4FLYA 2Q0UA 4CHQA 4DSLA 1R0AA 2D0BA 5BN9A 1H1VA 4DSIA 3WNEA 2YHWA 3MDQA 1HQUA 4B9LA 4GKKK 2NRXA 1RDAA 3ULEB 3LPUA 3CD6N 1GLAG 3U9ZA 4FJNA 2CGJA 1YT3A 2YHAA 3T69A 3WQTA 3I8BA 2CH5A 5KRSA 3LP3A 1RILA 4F3OA 4DF4A 2P9NA 4AHVA 4CJPA 3CC4N 1ILYA 3K0SA 4BDPA 3LDPA 4B3SK 2EWSA 1XQSC 3SMPA 3W0LA 3O5BA 4BRLA 3UB5A 1Z05A 2YNHA 4UQGA 3DXKB 3V1OA 5HLFA 5DMRA 1RCHA 3CFRA 3ZETB 1NJWA 3LDLA 3KTQA 4E0DA 1SV5A 1Y97A 3DI6A 4W5OA 3BUZB 3BDPA 1NGCA 4JI7K 2P1JA 4ILGB 5C42A 4DUZK 4BACA 1FKPA 1K8AO 4LH5A 1U47A 3DLHA 2O4IA 1KSPA 1ZXOA 4FL9A 3OYGA 3KVGA 3KK2A 3W3DA 5KTQA 5AQOA 1YIJN 4NXNK 2HHWA 3AO4A 4MDBA 5AQYA 2VG5A 2V7YA 5FDLA 3VEYA 5F2RA 2PYLA 1FJGK 1CZAN 3ISNC 5DM6L 3SQ1A 4KHSA 3CHWA 5DM7L 4O0IA 5KGWA 1SKRA 2Q3SA 3ATUA 4CZEA 3OYEA 4FM2A 4FCYA 2JLEA 3WXKA 2DTUA 2QWPA 4B1VA 1N5YA 4QS8A 3HPOA 4M3XA 4GV9A 5MLCQ 4DR6K 3AGKA 3F9MA 5M1OA 4NLCA 1HNIA 3H1VX 4H03B 2AA4A 4BRNA 3NGIA 1SS6A 1U4BA 1NJXA 3CCSN 3QETA 1M90O 4K0KK 3KKRA 2R7YA 4FJGA 5ADXA 4ELVA 3CC7N 4B1YB 5AQSA 1OH5A 1HNWK 2KZZA 1L5UA 1K6YA 4DR1K 4KHNA 5CE3A 5M1KA 3KWGA 4KAZA 3OJSA 1JLFA 2A5XA 2W6LA 3QNOA 2P9LA 4JI4K 4B3RK 5KRTA 2ZF5O 3VF4A 2PBDA 4K43A 4WQ4A 4ISGA 5JLFA 1JXBA 2UUBK 1XC9A 3T1AA 4DG1A 3V1QA 1KCFA 1DT9A 4BRHA 3JAMO 3THVA 4JN4A 3L2VA 4B1ZA 4DKWA 4CJTA 3CQ8A 3AVBA 4BDZA 2HVHA 1C1AA 4DR5K 4B8AB 3WXJA 4B9TA 1FK9A 3HPGA 3NGYA 4B9MA 1VRTA 4LF6K 5T7BA 3AA4A 3B8AX 3H45C 4CJ5A 3ENOA 3DRRA 2O8CB 2GBZA 3A5LC 2AP1A 1XHZA 4AILC 3HSTB 4JV5K 1BGXT 1X9MA 4LF9K 3EN9A 4DTSA 1VQ8N 2NZTA 4CJRA 2VWKA 1ZBIA 5HRPA 3O3FA 2ITGA 2OZMA 4IDHA 5E84A 3QEVA 1IO2A 1T44A 3CCVN 1BA1A 2QWNA 1EQYA 3KLFA 4Y1CA 2HOEA 3ID6A 5BPLA 4JKBA 3NVMA 1KQSM 4M7YA 3AAPA 3QIPA 2UUAK 4YOTA 2W40A 2PYJA 1RBTA 5C2FA 5J2PA 1QQMA 2IGIA 4CCHA 5JLHA 2FC0A 5AQNA 4JNEA 5SWMA 1BQNA 4KRFA 3ZT3A 2I7PA 3QINA 4K42A 4U67L 2NRRA 5AJ3K 5AQIA 4DTUA 5FPDA 3WNGA 3QEPA 1NJIO 2VWBA 1IKVA 3RTVA 1K8KB 1OH6A 4YHHK 1S22A 3ALYA 4A5BA 1QSLA 2UU9K 1N34K 4IG3A 5C10A 3TSQA 3OYHA 2VGNA 3P31A 4DQQA 5AQWA 4FZZA 1HRHA 5M1FA 2O8EA 4CZHA 4JI3K 1F21A 4ID1A 3ULDA 1X9JA 1N36K 4FJ9A 1VSJA 3K58A 2B5JA 1NOZA 4W5TA 1NLVA 2UYTA 3QO9A 1Z25A 1QE1A 3DXMA 3MN7A 4OKJA 4LSNA 1RBRA 1WBBA 4JLHA 1BA0A 5HRNA 1ITGA 4GY2B 4DR2K 1BOTO 1RGIA 4Z4GA 2BGGA 3C6TA 3BZCA 5M1QA 4I9QA 1ZBHA 1XNRK 3JYTA 4KTZA 5C2DA 3LWLA 4DTOA 1I94K 4XH5A 3CMEN 3RMCA 5J2MA 2OCEA 1IG9A 1LAWA 2ZM6K 3ZT0A 4QS7A 2P9NB 1O1WA 4FXDA 1WSJA 3WUHA 2YKNA 3VGKA 1J5EK 3FFKB 2P9SB 4EFHA 2NRHA 3KHYA 2UXBK 4A61A 1KRPA 2Q36A 3LDQA 3CPEA 1WSGA 3E9PA 2PZSA 3GL1A 5BR8K 5BRFA 3K5MA 4E1MA 1LAVA 3SI6A 4GW6A 4J2AA 4BWJA 3HP9A 5J2QA 4CD3A 3EYZA 1Q8IA 3AVJA 4DF8A 2UUCK 2KFZA 3HRGA 1TK5A 2IC3A 1LOTB 3DJCA 4DV4K 3DRPA 3VQAA 4BRQA 1VQKN 3DLRA 1I3AA 3WT0A 3M3ZA 2YI1A 1KVBA 3V1RA 4N5SA 1TKDA 3ZSZA 3O3GA 4M7XA 3H46O 4FJLA 3OS0A 3CYMA 4Y1DA 3CMAN 4DFMA 4DSKA 5BR9A 4O4GA 3RWUA 2HMIA 2QM1A 4H5TA 1J53A 1YITN 5AZIB 3VERA 4H0TB 4ELUA 2E2OA 2WBNA 4YOVA 3PIOL 4B9NA 3D2FA 1KD1O 3RSEA 5E26A 3HL8A 4DQIA 2CGLA 1KAYA 2KZMA 2W6KA 3JS6A 5AQFA 3HVRA 1ASUA 2E6LA 5LY3A 1VHXA 1JLCA 4CK1A 4JEPA 4YOXA 3P4IA 4K8XA 4LY7A 2FF6A 4CECA 3HI0A 3OBWA 1CXUA 3QESA 1QZ5A 4MO5A 1VSKA 2ETJA 3ZSXA 4CBWA 3K5OA 1EETA 1WSHA 4JI1K 3G25A 3N4QA 3NBPA 4IXCA 3MWPA 3VESA 3CC2N 4MLHA 2WC9A 2Q1NA 4W5NA 4BE0A 2KHOA 4CJUA 2OPPA 1RDDA 4DU3A 3I56N 1K9MO 3MEEA 4KHWA 2NRTA 2FBYA 3MN6A 4DU4A 2A1SA 1L3UA 3FGUA 5DK5A 3CCMN 4B8CA 3PV8A 3TSUA 1W97L 3SJJA 4BDYA 4DTPA 1NM1A 3FZHA 4H5RA 3OYNA 1MU2A 4KO0A 4CFAA 4DU1A 4IJNA 1XMOK 4BR4A 3ZSQA 4FOIA 5I9EB 4LFAK 3O3HA 1NK0A 3UKUA 2ZJRL 1E4FT 1T6CA 2IDOA 3VOVA 1S6QA 1X3MA 3DRSA 1C1BA 3MCPA 2BDPA 4CEFA 2NLXA 4FLXA 1KAXA 5AQUA 3CCEN 4OX9K 1B9DA 4QS9A 2YKMA 3L2QA 2P9IA 4CVNE 5IT9O 4LH4A 3QEWA 1HR0K 2YJFA 3MN5A 4CBUA 2HB5A 4CZIA 4OPHA 2ASOA 3O9UA 2F9TA 4EP4A 4FJ7A 1EP4A 4KH5A 2J4RA 1TYQB 1NGIA 2OANA 4FW1A 4FWMA 3IUCA 4H5VA 5FPMA 4BROA 3MWTA 1U2VA 4CESA 2FBXA 4IG0A 5TKYA 2IVOA 3ZCMA 1I39A 2OA8A 3OYLA 3AA5X 4A57A 4JYAK 1YVUA 4BRGA 4LF7K 3SYZA 4B1XB 2XY7A 3O1WA 1LCUA 1WSIA 4IDKA 2IVNA 4JKCA 4A62A 4DSEA 4F3TA 4BC5A 1REVA 2GV9A 4XH4A 2LSNA 4YORA 4RW8A 3K59A 4AHRA 4B3TK 4FWNA 2NRZA 2FSNA 1NKCA 3QFPA 4JHDB 4PUOA 1TKXA 5AQZA 4CZJA 1VQ4N 1BI4B 1L3SA 2QWRA 3L3VA 3HZ6A 4GNIA 2ITMA 3K9KA 3J80O 4PL8A 3I8DA 5JS1A 3VQ5A 1C0FA 1RT4A 1T03A 3ZLJA 1L3VA 4DR3K 3BP8A 3A8YA 4BRCA 1QSSA 1D5AA 2IOCA 3GE1A 3LM2A 3ZYYX 1Q9XA 3OYIA 3CETA 4CFDA 2NNWA 4IO8A 2G8HA 4FJ8A 5FLXO 4BR0A 1W0HA 4CFCA 4M63C 3ZT4A 4C1NI 4GKJK 3AVHA 1Q9YA 3VPZA 4FK0A 3VA3A 3SUNA 5BREA 2YNFA 3CIPA 3PX6A 1QHTA 2P5OA 4AM6A 3G10A 3VQ8A 4JKFA 1VQMN 3DAWA 2GUPA 4JK7A 2VQFK 3T1HK 2E2NA 1NNEA 4ELTA 1EX4A 1KVAA 1WN7A 3LAMA 4PL7A 1NK4A 3CCUN 4CK2A 1Q81O 1N32K 4ISEA 4BC3A 4E1JA 3CG7A 1RBVA 4EAHD 1UA1A 3CM5A 1VSFA 4OGEA 1E4GT 1BUPA 1LWCA 2NRVA 4DS5A 3CJ1A 5BRDA 3Q7BA 3T19A 3V4IA 1EO1A 4H0VB 1ATRA 1OH7A 2ZGYA 4H0YB 5CZ1A 4DQSA 2Q31A 2VG7A 3WNFA 2WTUA 4M42A 2QEXN 4AHUA 2OZSA 3FFIA 4NCGA 2GUIA 4KHYA 4EZ6A 2QXFA 3PY8A 4AF1A 3ZX3A 1WLJA 3OS1A 1VQ5N 1QQNA 3M8QA 5LMUK 1KLNA 4ZTJA 4FJMA 2P9PB 3AO2A 2RHKA 3AO1A 3D2FB 4KPYA 3I0SA 2YV0X 3KK1A 2IIRA 3I55N 2HSTA 2FBVA 4I6MA 4FWPA 2OTJN 2KW4A 4WQ5C 4YOWA 1TK0A 2G8FA 5AZJA 3VENA 1WAFA 5HRSA 5AR0A 2E1YA 1C0GA 3L2WA 1HYZA 3IKMA 3DYAA 4E19A 4OVLA 4OKKA 1JLQA 5AQPA 1R59O 1CZBA 4CF8A 3NDKA 1D8YA 3GBTA 4JI2K 3VTHA 3B6PA 3AARA 3NH0A 3VGMA 3CFPA 3MX5A 1UOCA 4B1UB 5M1NA 1N6QA 1WAJA 1W7AA 4JS5A 2FBTA 4X62K 3D0PA 3TANA 5AQLA 3L4IA 1QQOA 1HPMA 4HUEA 1C0MA 3AV9A 3AO5A 1IKWA 3F5TA 1LV5A 3AVFA 4NB4A 2F4VK 1A5VA 3O6WA 5EX5A 3ZSOA 3FLCO 3O1BA 3FR0A 1KC8O 2E2PA 1U49A 5EXWA 3KD1E 4DV3K 5F0XA 4CERA 3CQXA 1SZ2A 4BY9C 4W5RA 3VA0A 1VRUA 3NAEA 2D1KA 2Y1JA 1HNVA 3QDKA 2WUSA 4RW6A 3TABA 5F1XA 4YY3K 4Z4CA 3C7NB 4WF9L 3LDOA 4OPJA 2E88A 3QB0A 4O0JA 3V9ZA 4E7HA 1VSLA 3SLCA 4FSVA 1BWFO 4H0OA 1BU6O 4J8FA 1EWQA 1KXPA 1ZBSA 4O8KA 3SK3A 3QLHA 2YCHA 3AVAA 3HT3A 4DS4A 2HBMA 1S1TA 1KTQA 3VQ4A 3R3LA 1L3TA 5C12A 5AQKA 3BF1A 2UXCK 3MECA 4CJWA 1VQON 1VAZA 3RRHA 1JLGA 4A2AA 3PIPL 1DTQA 1YHQN 4X64K 4YOUA 3EE8A 3ZX0A 3C0BA 1T7PA 4M3WA 2V51B 1E3MA 3TAGA 4IJAA 3V9XA 3TAFA 5AQHA 3IG1A 1IKXA 4L3QA 5CR4A 4HTUA 2Z1JA 4CF0A 1MWMA 3L6QA 4BE2A 3AVGA 1NKEA 4IOCL 3UKRB 1SUQA 3WEEB 3NFAA 4FWRA 3D45A 3OW2M 2JWKA 3J7YP 1VSDA 3THXA 3D6RA 4DTNA 1JLAA 3MXJA 4Z4HA 2IAJA 1G15A 5M1PA 1HKGA 3DOKA 3M5RA 4JD2B 5CY4A 2NUBA 2HBLA 2GWKA 4CHPA 4F9OA 1WBDA 4B9SA 1VSEA 1X1PA 2X6SA 3VTIA 4WCEL 3R1XA 3DLBA 4YFUA 3RRGA 3M8SA 3QNNA 3O9TA 2P9KA 4GVEA 3EEQA 3BY5A 4BRFA 3IS9A 5J1EA 3VQDA 4DSFA 1ASVA 3TTFA 1VQ9N 1TKTA 3MCAB 2ZE2A 1CLQA 3SQ0A 1JCGA 1RDWX 3QMLA 1WNSA 3PO5A 4RG8A 4KI4A 1EXQA 4KHUA 4CEEA 4FVMA 3J7ZO 3AVNA 4CJQA 4NCAA 1XHXA 4BREA 1BG3A 2IVPA 1SQKA 4IFEA 5TKWA 3PSIA 3CQYA 3G0ZA 1XNQK 4LFCK 3LANA 4EHUA 3SUOA 3CJCA 3U3YA 1ZBFA 4CGHA 1HLUA 1A5WA 1BL3A 1OVYA 2Q2RA 4A2BA 4IO9L 4YDUC 4CZMA 3M1FA 4CI6A 4CK3A 3CCLN 1JLEA 1RT2A 1S1WA 1HYSA 1TGOA 3L0QA 2HHQA 1RTJA 3QEXA 2QTDA 3CCRN 4A59A 3HP6A 3AY9A 1W2BM 3KD5E 3WXIA 1S72N 4XIUA 4EHTA 4BRMA 1RDCA 2O8FA 3SQ2A 4DHYA 1V4SA 1IBMK 1WSFA 1S1VA 3JSMA 2X6NA 4YNQA 5IWAK 2O8BA 2V52B 1FKOA 4CIFA 1TKZA 3IAYA 1LW0A 4JKGA 4FWLA 5FROA 3THWA 4FJ5A 3V9WA 2HHVA 4CFBA 3C94A 1XWLA 1ESVA 2O8DA 3CJ7A 3WNHA 3OYFA 5J2NA 4F2RA 4R79A 3NH2A 1S6PA 2G8WA 4ID5A 4CE9A 4DQPA 3H6EA 3TAEA 4BRAA 3KK3A 2ASMA 3PLAA 5GAEP 3L4QA 3VQ9A 4J2EA 1YF5L 3DLGA 3SPZA 1YJ9N 3HSCA 3ULEA 2E5LK 3SCXA 1QVFM 4DR4K 1GLCG 5LMNK 2HF4A 2A3ZA 3OBYA 1P8ZA 1EKEA 4CW7B 4CHOA 2KTQA 4DB3A 5HRRA 1GLBG 1QZ6A 1Q18A 3NF9A 2F8TA 3RMAA 3R8EA 1GLDG 4KHPK 3ITHA 4UY8O 3HOSA 2RKIA 4NLBA 4CHZA 3QEIA 5HOOA 1FW6A 3LZIA 2VGMA 4KV8A 4IBNA 5JVHL 2JGUA 3KLIA 1CXQA 2RPIA 3HTVA 1JJ2M 5KQDA 3FZLA 2XY5A 2I5JA 1RT5A 3DXKA 2YX6A 3HM9A 3QICA 4KB0A 4KHQA 4Z4IA 1GLFO 2ASPA 4BR2A 3TWHA 3J81O 3DLKA 4C8NA 4FJHA 3TARA 1SL0A 2QWOA 1QTMA 2P9LB 4KKOA 3OYMA 2BANA 4M3YA 1RDUA 1NOYA 4N56A 1NG9A 4GV3A 3TPQA 4DFKA 4N76A 1Y64A 3F73A 1YAGA 3EE9A 1IBLK 4CGIA 3P83D 4FM1A 3TSPA 1WSEA 4WFNL 3KLGA 1S3XA 2BUPA 4CEBA 2P5GA 1YUWA 4HWIA 4HUGA 1NKBA 1SL1A 4C8OA 3OYJA 4X65K 3VEXA 4BRIA 3I0RA 3IMXA 4B1WB 2DFEA 4CGDA 2E4LA 1NK9A 4AH9A 3AA2A 1TAQA 4WE1A 3BZKA 4KTQA 4CJLA 3K2PA 2KFNA 1U45A 1KLMA 2F96A 3TTDA 4H8KA 1NGDA 3EZWA 4E3SA 1X9SA 2W41A 5GADP 3TAMA 4CEZA 4FJKA 1UAXA 5AQJA 5D3GA 3DLEA 2ZQBA 3OYKA 2Z1HA 3V6DA 5FRMA 2XRIA 4OPKA 3ENHA 3VF6A 3THXB 3E1YA 1Q82O 4JKEA 4CZKA 4CJKA 1JL2A 3CF5L 4FLZA 4GV6A 3ATVA 3NE6A 3LAKA 5CHIA 3GG4A 2CGKA 4LF4K 4CJEA 3L8BA 4DTMA 3ZEUA 2ZD1A 3KIOA 4FZYA 1K73O 3T7ZA 2B4JA 2DY4A 1UWBA 2G8IA 3IDHA 4GMJB 4BVPA 4C8MA 2BH1A 4H0PA 2BTFA 2A6AA 4KH4A 4DR7K 2VYPA 4RW4A 4BGBA 3U4LA 1ZBUA 3CPWM 4F2SA 1W9HA 3A0IX 3H1QA 4FOEA 2UXDK 3VN5A 3Q7CA 2HW3A 1LWFA 3LWMA 2A42A 2XHBA 2ZGZA 2O8EB 3IRXA 3SBTA 4BC2A 1VK0A 4N47A 4KBOA 4HUFA 3SJHA 1JXEA 2GX9A 3MX2A 4MQ3A 2O8CA 2YHYA 1ZYQA 3NVKA 4Z4EA 3QBXA 3U3GA 1D9DA 3SBGA 5A2QO 3VEVA 3VEZA 4AHCA 4FM0A 2FLOA 2RN2A 1T8EA 3DXMB 3VMFB 1WUAA 1V4TA 4M3ZA 1BHLA 3RR7A 1NBWA 2A1RA 4CHYA 3ZSYA 3SV4A 2HHTA 4DV6K 4FPAA 3RMBA 1TVRA 1IV0A 2I7NA 4FWSA 4NYFA 3GDQA 5C15A 1B92A 3CFOA 4ILHA 1JCFA 3FZMA 3QIOA 3R9PA 4E7IA 4ILJA 5AQRA 1DGKN 5GAHP 1C0TA 4IEEA 1TUUA 4JI0K 4I2QA 4AQYK 2F8SA 3OTOK 4KREA 1RBSA 1QHAA 2A41A 5CYMA 1S5JA 1NGHA 1NJZA 4L8RB 4PQUA 2PY5A 4BGAA 3BGRA 1ATNA 3EL2A 3G6EN 1X3NA 4DV7K 4FJJA 2JWLA 4M3RA 2YJEA 4O55A 3G4SN 3OJUA 2O4GA 1K8KA 3KLEA 5B8HA 3M6GA 3TAPA 1BCOA 4LF8K 4C23A 4PWDA 4J2DA 4PY5A 3P1GA 2Z1IA 2VQEK 5SZTA 2HBJA 1U48A 2X78A 1BO5O 1HPZA 1QS4A 4MDAA 5HL7L 2WONA 4JKGB 2OPQA 1ATSA 5AQVA 4G9ZA 3DWLA 3WQUA 4CEAA 4JI6K 4HHTA 1JCEA 2QWQA 5JICA 1GOAA 3AVLA 4JAXA 4DUYK 3AA3A 2E1ZA 4OPAA 3AVKA 4BG8A 2A40A 4PA1A 4CJ4A 4AM7A 2GEMA 4JKAA 1OVQA 1GLEG 2HMPA 5CYQA 3OS2A 1NGEA 1FXXA 3K9JA 5AQTA 3U8XA 4HTLA 4YDUA 4M3TA 1ZBLA 1IJJA 4PHTX 4B3OA 4MFBA 3OYCA 1SAZA 3P38A 3VQBA 3RSEB 4M3UA 3P5JA 3MXIA 1KFSA 3SNNA 2XY8A 1HKCA 4RTFD 3CJBA 3T1YK 5HROA 3THYA 2NRWA 5AFUH 2WFBA 3CXCM 3E9LA 1YTUA 2P9SA 4G1QA 3U9DA 1NMNA 4QCLA 3OYBA 2VCPA 3OHRA 4EZ9A 4DWIA 3O9QA 2HVIA 3EKUA 2HF3A 4PKIA 3HXMA 4IOXA 4DFPA 4FJXA 3ZSRA 2GTDA 1OH8A 1JL1A 3ZSWA 4N41A 1RTIA 1MWKA 2OTLN 3PSFA 5I3UA 1S1UA 3IFRA 2D4WA 3I33A 3KK7A 1RTHA 5C24A 5FPNA 4CF1A 1RFQA 4O8UA 1Q86O 4FPBA 3NHGA 4F4KA 3CERA 5JVGL 4R5PA 4BQZA 1HJOA 1NK6A 4JI8K 4F8RA 4IWVA 3EZ5A 4OLAA 4Q5VA 4K8ZA 4DSJA 3S3OA 5AQGA 5AZIA 5LJWA 1NGFA 3A2FA 4ZHRA 4PKHA 4Q0BA 4BR5A 3VQ7A 3B6OA 3WXMB 3UKUB 1HNZK 4K41A 4Z0UA 1HKBA 1J9AA 4IEIA 3O4QA 4BWMA 4CZLA 4ZTFA 2P9IB 1X9WA 4KI6A 1UA0A 4E7KA 3UIQA 3R6MA 1Q7YO 1J54A 4JK8A 4FWKA 4IFVA 4FVUA 4CZFA 1HYVA 4WFAL 2H3GX 3VEWA 2ZJPL 2KQ2A 5BPNA 2HHHK 4JKHA 4RW7A 3VF2A 4CJVA 3PX4A 3ZEUB 2QK9A 4MLEA 3O80A 4I9LA 1B9FA 1U2VB 4BE1A 2E8AA 2KLAA 1VQ7N 5HP1A 4FLTA 4ICLA 3L3UA 4DCHA 1G99A 4DV1K 3HVTA 3BF3A 4OO1J 3J8AA 1DEJA 2EX3A 2HNZA 2HHUA 3MEDA 1A5XA 1J6ZA 3A5MC 3N4PA 5HBMA 4HCBA 2DFFA 4AHTA 4YOYA 4Z94A 4O5FA 3NF7A 2PAVA 2B6AA 4W5QA 3SPYA 3KLHA 1QVGM 3OYAA 4B9UA 1NMDA 1NGAA 3LZJA 4CJ3A 4KB1A 4O44A 4FWOA 1N33K 2E6MA 4DFJA 2FSJA 3NGZA 3J7AP 3H3OB 3TU5A 1JLBA 1GLJO 2XO7A 4FJIA 2FF3B 5AQMA 1NWKA 1DLOA 1TV6A 3VQPA 3VEOA 4FK4A 2D0PA 5FPEA 4H5NA 1BIZA 1TYQA 2DPNA 3HK2A 2CH6A 4BVOA 3LL3A 4H4MA 1VSHA 4KFBA 4BQLA 3NCIA 4CIGA 5E41A 2WOMA 5C25A 5EU7A 1HQEA 3A5NC 1YTAA 1TL1A 4FWQA 4K25A 4CBXA 4I7FA 3OY9A 4CGGA 2HHSA 1M1KO 1TUYA 3ID8A 3F9KA 3D2EA 4DV5K 1HJRA 4E7JA 3HPHA 2Q0RA 3SZ2A 4JKDA 1RT1A 2QW9A 3V81A 4FLVA 3WXLA 2HNYA 4WYBA 5EVZA 3CI5A 1VSIA 2QWLA 4DQ8A 1D4XA 3L2RA 1DTTA 3EKSA 2P9UA 3LM9A 4JHDA 3SUQA 2VG6A 3OVNA 3NF8A 1NGBA 1XUPO 1BI4A 2IS3A 2DFHA 4CJFA 3KWIA 1SKWA 3VETA 3OYDA 2YHXA 1RT7A 4CEOA 3PO4A 3JXUA 3P39A 1BCMA 4DV2K 2QKBA 5KQ8A 2YNIA 3AVMA 3FZFA 3AO3A 1HUXA 3HBTA 1NGJA 4DTXA 3ENBA 3HM8A 1YJNN 1J5OA 1ZC6A 3DLLL 1N8RO 4DV0K 4FK2A 4CHNA 4CIEA 4KTWA 4I6MB 3E9OA 4MO4A 2OPRA 4CD1A 4CJSA 4BRPA 1YJWN 1BDGA 5LL6Z 3THYB 5AQQA 1QQCA 1RDBA 3VQQA 5AZJB 5KPTA 1IG8A 1SL2A 4FLUA 3TAQA 3S41A 1HX1A 3F2KA 1U04A 3AAQA 3CCJN 1YI2N 4DMNA 3HOTA 1KVCA 1YXQA 4DQRA 1VQ6N 4CJ7A 4IOAL 4NXMK 3MAQA 3O08A 1NJYA 3C6HA 2W42A 4X66K 3MN9A 3VGLA 3QFUA 1GLLO 3TI0A 4PKGA 3ZX2A
chains in the Genus database with same CATH topology
4Z4FA 2OYQA 1TK0A 4OJRA 3KLFA 1ZBUA 3H08A 4Y1CA 1C0UA 3V9UA 2G8FA 4F2SA 4HCCA 1S1XA 1W9HA 2G8KA 1WAFA 5HRSA 2Y1IA 3VN5A 2HW3A 3L2WA 2AJQA 1HYZA 1LWFA 3LWMA 3DYAA 3QIPA 2XHBA 4E19A 4EP5A 2PYJA 1RBTA 1TK8A 2OPSA 1C1CA 3IRXA 4OVLA 1VK0A 1JLQA 4OKKA 4M45A 5J2PA 4N47A 2IGIA 3EY1A 4CCHA 4HUFA 2FC0A 1CZBA 1JXEA 4CF8A 1BQMA 4MQ3A 3NDKA 5SWMA 1BQNA 1ZYQA 1D8YA 4FYDA 3S9HA 3U3GA 1D9DA 4Z4EA 3ZT3A 4KRFA 3QINA 3B6PA 4AHCA 1RNHA 1CZ9A 4FM0A 2RN2A 2QKKA 3RR8A 4QOZB 1T8EA 3NH0A 4DTUA 3WNGA 3QEPA 4NCBA 3CFPA 1IKVA 3RTVA 4M3ZA 1BHLA 1UOCA 3RR7A 2A1RA 3ALYA 3SUPA 4CHYA 3ZSYA 2BE2A 3SV4A 1N6QA 2HHTA 1QSLA 1WAJA 3RMBA 1TVRA 4CGFA 4IG3A 4JS5A 4NYFA 2FBTA 1B92A 3OYHA 3D0PA 3CFOA 4DTRA 3TANA 3QIOA 4DQQA 1NK7A 3TR8A 3KKSA 4E7IA 4FZZA 1HRHA 3TI0A 1C0TA 2F8SA 4I2QA 4CEDA 1C0MA 3AV9A 4HUEA 4KREA 3AO5A 1RBSA 1IKWA 2RF2A 1LV5A 4C8KA 5CYMA 3AVFA 1F21A 1S5JA 1A5VA 4ID1A 3ULDA 1NJZA 3ZSOA 4CEQA 4L8RB 4FJ9A 2PY5A 4PQUA 2HHXA 3V9SA 5I42A 1U49A 1VSJA 1NK5A 3KD1E 3K58A 3BGRA 2B5JA 1NOZA 4W5TA 4CERA 3SQ4A 1LW2A 3O4NA 1Z26A 3QO9A 1Z25A 4E7LA 3CM6A 2ATQA 4W5RA 4M3RA 1QE1A 4JS4A 1VRUA 3VA0A 4FJJA 3NAEA 2Y1JA 4O55A 1HNVA 4OKJA 3OJUA 2O4GA 3KLEA 4LSNA 1RBRA 4RW6A 3HJFA 4JLHA 3TABA 3ZT2A 3TAPA 4Z4CA 1BCOA 5HRNA 4OPJA 3AVCA 2Z1GA 4PWDA 1TL3A 4O0JA 1ITGA 3V9ZA 4FZXC 4E7HA 4J2DA 4Z4GA 1KFDA 1VSLA 5K14A 4PY5A 3P1GA 2BGGA 3C6TA 3VQCA 4I9QA 3C95A 1ZBHA 4GVMA 2Z1IA 3JYTA 5SZTA 4KTZA 3LWLA 1U48A 2YNGA 4DTOA 1BISA 2X78A 1HPZA 4OGCA 1QS4A 3QLHA 3RMCA 3AVAA 2WONA 3HT3A 4DS4A 4LD0A 5J2MA 2G8UA 2OPQA 1S1TA 1KTQA 1IG9A 1LAWA 3VQ4A 3K5NA 4M41A 4CEAA 1L3TA 1XI1A 1D9FA 1TAUA 2D0CA 4HHTA 3ZT0A 1GOCA 1GOAA 3AVLA 3LP0A 4CGJA 1O1WA 1GOBA 1ASWA 4FXDA 1WSJA 3AA3A 3NH1A 3MECA 4CJWA 3AVKA 2YKNA 4PA1A 4CJ4A 3RRHA 1JLGA 4HVJA 1DTQA 4O5BA 1KRPA 2P51A 5CYQA 3OS2A 1T7PA 5JS2A 4M3WA 1S9EA 1WSGA 1S9GA 3TAGA 3S3NA 3V9XA 3TAFA 2PZSA 1FXXA 5KGXA 1LWEA 3K5MA 3IG1A 1IKXA 4E1MA 1LAVA 3SI6A 3KJVA 3HYFA 4GW6A 4M3TA 4HTUA 1ZBLA 2Z1JA 3DM2A 4BWJA 3ASMA 3ZSVA 4CF0A 4J2AA 4B3OA 3HP9A 4MFBA 4RW9A 3OYCA 5J2QA 4BE2A 3AVGA 3EYZA 1NKEA 1Q8IA 3AVJA 4DF8A 4QAGA 3VQBA 1RT3A 1BIUA 2KFZA 4M3UA 4IFYA 1SUQA 5CZ2A 1TK5A 3P5JA 3NFAA 2IC3A 3HO1A 3MXIA 3DRPA 3D45A 4B08A 1KFSA 3SNNA 3MXMA 3VQAA 3L2UA 2XY8A 3DLRA 1I3AA 3M8PA 1T05A 3K5LA 3RMDA 1VSDA 5HROA 4NYNA 1KVBA 3V1RA 4N5SA 1TKDA 3VQ6A 3ZSZA 3O3GA 1YTUA 4G1QA 4DTJA 4DTNA 1JLAA 3MXJA 4FJLA 3OS0A 3E01A 3CYMA 4Y1DA 4DFMA 4DSKA 3OYBA 4IKFA 4QCLA 4Z4HA 4EZ9A 4O4GA 2IAJA 1G15A 1NK8A 4JRQA 3K57A 3DOKA 2HMIA 5CY4A 4DWIA 3RWUA 5KI6A 2NUBA 1C6VA 4I2PA 4OLBA 1RT6A 2XY6A 4CHPA 1J53A 4LSLA 4CF9A 2VWJA 3HXMA 4ELUA 4OKEA 4DFPA 4C8LA 4FJXA 3ZSRA 4J2BA 4B9NA 4B9SA 1VSEA 1X1PA 1JL1A 4FLWA 2X6SA 3DLBA 3C6UA 3ZSWA 4YFUA 1RTIA 3RRGA 4N41A 3M8SA 3QNNA 3HL8A 4DQIA 3PUFA 5I3UA 1S1UA 3AVIA 3LP1A 1RBUA 2KZMA 3HVRA 1ASUA 1VSMA 2E6LA 3IS9A 1JLCA 3VQDA 4CK1A 5J1EA 1RTHA 5C24A 4K8XA 4CF1A 4DSFA 1QSYA 1ASVA 4LY7A 2D5RA 4E89A 4JRPA 4CECA 3NHGA 4F4KA 3QESA 1CXUA 4R5PA 1TKTA 4TSXA 1NK6A 2ZE2A 1CLQA 3SQ0A 1VSKA 4B9VA 2ETJA 3ZSXA 3M8RA 4F8RA 4AHSA 3K5OA 5FRNA 3EZ5A 1EETA 1WSHA 1WNSA 4OLAA 4Q5VA 4K8ZA 3PO5A 4DSJA 3S3OA 4RG8A 1HMVA 4KI4A 3A2FA 4ZHRA 1EXQA 3LPTA 3NBPA 4Q0BA 3S3MA 4KHUA 3VQ7A 3PX0A 4CEEA 3B6OA 4FVMA 3LALA 4W5NA 3AVNA 4BE0A 4E1NA 1IKYA 4CJQA 2D0AA 2YHBA 1XHXA 4NCAA 4CJUA 3SV3A 2OPPA 1RDDA 4DU3A 4Z0UA 1SKSA 4DLEA 3MEEA 4KHWA 1J9AA 3G0ZA 2HNDA 3O4QA 2FBYA 4BWMA 4DU4A 3DMJA 2A1SA 3VQEA 2G8VA 4ZTFA 1L3UA 3LANA 5DK5A 4B8CA 3PV8A 3SUOA 1X9WA 4KI6A 1UA0A 4DLGA 4E7KA 3DOLA 3U3YA 1ZBFA 2EHGA 3UIQA 4CGHA 3SJJA 3T3FA 1A5WA 1BL3A 4BDYA 4DTPA 1J54A 3OYNA 4H4OA 1MU2A 4IFVA 4KO0A 4CFAA 4DU1A 2X74A 4FW2A 1HYVA 3ZSQA 4CK3A 1JLEA 2KQ2A 1RT2A 3LP2A 3NF6A 1S1WA 4RW7A 1HYSA 4CJVA 3PX4A 3O3HA 1NK0A 1RTDA 1TGOA 2HHQA 3ZT1A 4CF2A 3LDSA 1RTJA 2QK9A 4I9LA 2IDOA 3QERA 3QEXA 1B9FA 3HP6A 1S6QA 3DRSA 4BE1A 1C1BA 2BDPA 3U6FA 3KD5E 4CEFA 5HP1A 4FLXA 3MEGA 4FLTA 1JKHA 1IH7A 4ICLA 3L3UA 4XIUA 1B9DA 4FLYA 2YKMA 1RDCA 4CHQA 4DSLA 1R0AA 3L2QA 3SQ2A 2D0BA 3HVTA 4LH4A 1WSFA 4DSIA 1S1VA 3WNEA 3JSMA 2X6NA 4YNQA 1HQUA 3QEWA 4B9LA 2EX3A 2HNZA 1RDAA 2HHUA 3MEDA 3LPUA 1FKOA 1A5XA 4CIFA 5HBMA 2HB5A 1TKZA 3IAYA 4HCBA 1LW0A 2DFFA 4FJ7A 4EP4A 4AHTA 5FROA 4FJNA 4FJ5A 1EP4A 1YT3A 3V9WA 2YHAA 5KRSA 3NF7A 2B6AA 3LP3A 1RILA 4CFBA 3C94A 4W5QA 3KLHA 4DF4A 3SPYA 4F3OA 2HHVA 4FW1A 1XWLA 4AHVA 4CJPA 3WNHA 3OYFA 3OYAA 5J2NA 4F2RA 3NH2A 4B9UA 1S6PA 3LZJA 2G8WA 4BDPA 4CESA 4ID5A 4CJ3A 4KB1A 2FBXA 4CE9A 4IG0A 4O44A 4DQPA 3TAEA 2E6MA 3KK3A 3ZCMA 4DFJA 1I39A 2OA8A 2YNHA 4UQGA 3OYLA 3AA5X 3V1OA 1YVUA 5DMRA 5HLFA 3NGZA 1RCHA 3CFRA 3VQ9A 3SYZA 2XY7A 4J2EA 1NJWA 3KTQA 4E0DA 3DLGA 1SV5A 1Y97A 3SPZA 1WSIA 1JLBA 3DI6A 4IDKA 4W5OA 3BDPA 3SCXA 2XO7A 4DSEA 4FJIA 2P1JA 1DLOA 4F3TA 1REVA 1TV6A 5C42A 1EKEA 2GV9A 4BACA 3VQPA 1FKPA 2LSNA 4CHOA 2KTQA 5HRRA 3DLHA 4LH5A 1U47A 2O4IA 1KSPA 4FK4A 3NF9A 1BIZA 4RW8A 3K59A 2F8TA 3RMAA 4AHRA 3HK2A 3OYGA 3ITHA 3KK2A 1NKCA 4PUOA 1TKXA 4H4MA 2RKIA 5KTQA 2HHWA 4CHZA 1BI4B 3QEIA 1L3SA 3AO4A 1VSHA 4KFBA 3LZIA 3L3VA 3NCIA 2VG5A 4KV8A 4CIGA 5E41A 4IBNA 2JGUA 3KLIA 5JS1A 2WOMA 2RPIA 1CXQA 5C25A 3VQ5A 3I8DA 5FDLA 1RT4A 2PYLA 1HQEA 5EU7A 1T03A 3ISNC 1YTAA 1TL1A 2XY5A 1L3VA 2I5JA 4I7FA 3SQ1A 1RT5A 3OY9A 3HM9A 4KHQA 4KB0A 4Z4IA 4CGGA 4KHSA 4O0IA 2HHSA 5KGWA 1QSSA 1D5AA 3F9KA 3TWHA 1SKRA 3DLKA 2IOCA 2Q3SA 4C8NA 4FJHA 3TARA 1SL0A 1Q9XA 1HJRA 3OYEA 3HPHA 4E7JA 4FM2A 4FCYA 1QTMA 2JLEA 3SZ2A 3OYIA 2DTUA 1RT1A 3V81A 4KKOA 4CFDA 3OYMA 4FLVA 2BANA 4M3YA 1N5YA 2G8HA 1NOYA 2HNYA 4FJ8A 4N56A 3HPOA 1VSIA 4DFKA 4N76A 4M3XA 1W0HA 4CFCA 3ZT4A 3F73A 3L2RA 1DTTA 4CGIA 3P83D 1HNIA 3AVHA 1Q9YA 3SUQA 4FM1A 2VG6A 3OVNA 3NF8A 3NGIA 1BI4A 1WSEA 2IS3A 2DFHA 1U4BA 4CJFA 3KLGA 1NJXA 1SKWA 3QETA 3OYDA 4FK0A 4CEBA 3KKRA 2R7YA 3VA3A 3SUNA 2P5GA 4FJGA 1RT7A 4HUGA 2YNFA 4CEOA 1SL1A 1NKBA 3PX6A 3PO4A 4C8OA 4ELVA 1QHTA 2P5OA 3OYJA 2HVIA 3G10A 3I0RA 3VQ8A 1BCMA 2DFEA 2QKBA 4CGDA 2E4LA 1NK9A 4AH9A 3AA2A 2YNIA 1TAQA 4WE1A 2KZZA 3AVMA 1K6YA 1L5UA 4ELTA 1EX4A 4KTQA 1KVAA 4CJLA 3AO3A 3K2PA 4KHNA 1WN7A 3LAMA 2KFNA 1NK4A 4KAZA 3OJSA 1JLFA 4CK2A 3QNOA 1U45A 5KRTA 1KLMA 4DTXA 3CG7A 1RBVA 2F96A 1UA1A 4H8KA 1JXBA 3CM5A 4E3SA 1X9SA 1XC9A 1VSFA 3T1AA 4DG1A 4OGEA 1J5OA 3TAMA 4CEZA 4FJKA 1LWCA 1UAXA 3V1QA 1KCFA 4DS5A 4FK2A 5D3GA 4CHNA 4CIEA 3THVA 3DLEA 3T19A 4KTWA 2ZQBA 3V4IA 3OYKA 3L2VA 2OPRA 4CJTA 3CQ8A 3AVBA 4BDZA 2HVHA 5CZ1A 2Z1HA 4CJSA 3V6DA 5FRMA 1C1AA 2XRIA 4OPKA 4DQSA 2VG7A 3WNFA 4B8AB 1QQCA 1RDBA 3VQQA 1SL2A 4B9TA 4AHUA 2OZSA 4M42A 1FK9A 4FLUA 3HPGA 3FFIA 3TAQA 4NCGA 3NGYA 4CJKA 4B9MA 2GUIA 1VRTA 1JL2A 4KHYA 5T7BA 4EZ6A 3AA4A 1U04A 4FLZA 2QXFA 3PY8A 4CJ5A 3LAKA 3NE6A 1WLJA 4DMNA 3OS1A 3M8QA 3DRRA 4CJEA 1KVCA 3L8BA 4DTMA 4DQRA 2GBZA 2ZD1A 4ZTJA 1KLNA 3KIOA 4FZYA 4FJMA 2B4JA 2DY4A 3AO2A 3AO1A 1UWBA 3MAQA 1XHZA 4AILC 2G8IA 4KPYA 3I0SA 3HSTB 2YV0X 1BGXT 4GMJB 3KK1A 1X9MA 1NJYA 4DTSA 4C8MA 2W42A 4CJRA 2FBVA 2VWKA 1ZBIA 5HRPA 3O3FA 2ITGA 2OZMA 2KW4A 1IO2A 3QEVA 4RW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4F A;  2OYQ A;  1TK0 A;  4OJR A;  3KLF A;  1ZBU A;  3H08 A;  4Y1C A;  1C0U A;  3V9U A;  2G8F A;  4F2S A;  4HCC A;  1S1X A;  1W9H A;  2G8K A;  1WAF A;  5HRS A;  2Y1I A;  3VN5 A;  2HW3 A;  3L2W A;  2AJQ A;  1HYZ A;  1LWF A;  3LWM A;  3DYA A;  3QIP A;  2XHB A;  4E19 A;  4EP5 A;  2PYJ A;  1RBT A;  1TK8 A;  2OPS A;  1C1C A;  3IRX A;  4OVL A;  1VK0 A;  1JLQ A;  4OKK A;  4M45 A;  5J2P A;  4N47 A;  2IGI A;  3EY1 A;  4CCH A;  4HUF A;  2FC0 A;  1CZB A;  1JXE A;  4CF8 A;  1BQM A;  4MQ3 A;  3NDK A;  5SWM A;  1BQN A;  1ZYQ A;  1D8Y A;  4FYD A;  3S9H A;  3U3G A;  1D9D A;  4Z4E A;  3ZT3 A;  4KRF A;  3QIN A;  3B6P A;  4AHC A;  1RNH A;  1CZ9 A;  4FM0 A;  2RN2 A;  2QKK A;  3RR8 A;  4QOZ B;  1T8E A;  3NH0 A;  4DTU A;  3WNG A;  3QEP A;  4NCB A;  3CFP A;  1IKV A;  3RTV A;  4M3Z A;  1BHL A;  1UOC A;  3RR7 A;  2A1R A;  3ALY A;  3SUP A;  4CHY A;  3ZSY A;  2BE2 A;  3SV4 A;  1N6Q A;  2HHT A;  1QSL A;  1WAJ A;  3RMB A;  1TVR A;  4CGF A;  4IG3 A;  4JS5 A;  4NYF A;  2FBT A;  1B92 A;  3OYH A;  3D0P A;  3CFO A;  4DTR A;  3TAN A;  3QIO A;  4DQQ A;  1NK7 A;  3TR8 A;  3KKS A;  4E7I A;  4FZZ A;  1HRH A;  3TI0 A;  1C0T A;  2F8S A;  4I2Q A;  4CED A;  1C0M A;  3AV9 A;  4HUE A;  4KRE A;  3AO5 A;  1RBS A;  1IKW A;  2RF2 A;  1LV5 A;  4C8K A;  5CYM A;  3AVF A;  1F21 A;  1S5J A;  1A5V A;  4ID1 A;  3ULD A;  1NJZ A;  3ZSO A;  4CEQ A;  4L8R B;  4FJ9 A;  2PY5 A;  4PQU A;  2HHX A;  3V9S A;  5I42 A;  1U49 A;  1VSJ A;  1NK5 A;  3KD1 E;  3K58 A;  3BGR A;  2B5J A;  1NOZ A;  4W5T A;  4CER A;  3SQ4 A;  1LW2 A;  3O4N A;  1Z26 A;  3QO9 A;  1Z25 A;  4E7L A;  3CM6 A;  2ATQ A;  4W5R A;  4M3R A;  1QE1 A;  4JS4 A;  1VRU A;  3VA0 A;  4FJJ A;  3NAE A;  2Y1J A;  4O55 A;  1HNV A;  4OKJ A;  3OJU A;  2O4G A;  3KLE A;  4LSN A;  1RBR A;  4RW6 A;  3HJF A;  4JLH A;  3TAB A;  3ZT2 A;  3TAP A;  4Z4C A;  1BCO A;  5HRN A;  4OPJ A;  3AVC A;  2Z1G A;  4PWD A;  1TL3 A;  4O0J A;  1ITG A;  3V9Z A;  4FZX C;  4E7H A;  4J2D A;  4Z4G A;  1KFD A;  1VSL A;  5K14 A;  4PY5 A;  3P1G A;  2BGG A;  3C6T A;  3VQC A;  4I9Q A;  3C95 A;  1ZBH A;  4GVM A;  2Z1I A;  3JYT A;  5SZT A;  4KTZ A;  3LWL A;  1U48 A;  2YNG A;  4DTO A;  1BIS A;  2X78 A;  1HPZ A;  4OGC A;  1QS4 A;  3QLH A;  3RMC A;  3AVA A;  2WON A;  3HT3 A;  4DS4 A;  4LD0 A;  5J2M A;  2G8U A;  2OPQ A;  1S1T A;  1KTQ A;  1IG9 A;  1LAW A;  3VQ4 A;  3K5N A;  4M41 A;  4CEA A;  1L3T A;  1XI1 A;  1D9F A;  1TAU A;  2D0C A;  4HHT A;  3ZT0 A;  1GOC A;  1GOA A;  3AVL A;  3LP0 A;  4CGJ A;  1O1W A;  1GOB A;  1ASW A;  4FXD A;  1WSJ A;  3AA3 A;  3NH1 A;  3MEC A;  4CJW A;  3AVK A;  2YKN A;  4PA1 A;  4CJ4 A;  3RRH A;  1JLG A;  4HVJ A;  1DTQ A;  4O5B A;  1KRP A;  2P51 A;  5CYQ A;  3OS2 A;  1T7P A;  5JS2 A;  4M3W A;  1S9E A;  1WSG A;  1S9G A;  3TAG A;  3S3N A;  3V9X A;  3TAF A;  2PZS A;  1FXX A;  5KGX A;  1LWE A;  3K5M A;  3IG1 A;  1IKX A;  4E1M A;  1LAV A;  3SI6 A;  3KJV A;  3HYF A;  4GW6 A;  4M3T A;  4HTU A;  1ZBL A;  2Z1J A;  3DM2 A;  4BWJ A;  3ASM A;  3ZSV A;  4CF0 A;  4J2A A;  4B3O A;  3HP9 A;  4MFB A;  4RW9 A;  3OYC A;  5J2Q A;  4BE2 A;  3AVG A;  3EYZ A;  1NKE A;  1Q8I A;  3AVJ A;  4DF8 A;  4QAG A;  3VQB A;  1RT3 A;  1BIU A;  2KFZ A;  4M3U A;  4IFY A;  1SUQ A;  5CZ2 A;  1TK5 A;  3P5J A;  3NFA A;  2IC3 A;  3HO1 A;  3MXI A;  3DRP A;  3D45 A;  4B08 A;  1KFS A;  3SNN A;  3MXM A;  3VQA A;  3L2U A;  2XY8 A;  3DLR A;  1I3A A;  3M8P A;  1T05 A;  3K5L A;  3RMD A;  1VSD A;  5HRO A;  4NYN A;  1KVB A;  3V1R A;  4N5S A;  1TKD A;  3VQ6 A;  3ZSZ A;  3O3G A;  1YTU A;  4G1Q A;  4DTJ A;  4DTN A;  1JLA A;  3MXJ A;  4FJL A;  3OS0 A;  3E01 A;  3CYM A;  4Y1D A;  4DFM A;  4DSK A;  3OYB A;  4IKF A;  4QCL A;  4Z4H A;  4EZ9 A;  4O4G A;  2IAJ A;  1G15 A;  1NK8 A;  4JRQ A;  3K57 A;  3DOK A;  2HMI A;  5CY4 A;  4DWI A;  3RWU A;  5KI6 A;  2NUB A;  1C6V A;  4I2P A;  4OLB A;  1RT6 A;  2XY6 A;  4CHP A;  1J53 A;  4LSL A;  4CF9 A;  2VWJ A;  3HXM A;  4ELU A;  4OKE A;  4DFP A;  4C8L A;  4FJX A;  3ZSR A;  4J2B A;  4B9N A;  4B9S A;  1VSE A;  1X1P A;  1JL1 A;  4FLW A;  2X6S A;  3DLB A;  3C6U A;  3ZSW A;  4YFU A;  1RTI A;  3RRG A;  4N41 A;  3M8S A;  3QNN A;  3HL8 A;  4DQI A;  3PUF A;  5I3U A;  1S1U A;  3AVI A;  3LP1 A;  1RBU A;  2KZM A;  3HVR A;  1ASU A;  1VSM A;  2E6L A;  3IS9 A;  1JLC A;  3VQD A;  4CK1 A;  5J1E A;  1RTH A;  5C24 A;  4K8X A;  4CF1 A;  4DSF A;  1QSY A;  1ASV A;  4LY7 A;  2D5R A;  4E89 A;  4JRP A;  4CEC A;  3NHG A;  4F4K A;  3QES A;  1CXU A;  4R5P A;  1TKT A;  4TSX A;  1NK6 A;  2ZE2 A;  1CLQ A;  3SQ0 A;  1VSK A;  4B9V A;  2ETJ A;  3ZSX A;  3M8R A;  4F8R A;  4AHS A;  3K5O A;  5FRN A;  3EZ5 A;  1EET A;  1WSH A;  1WNS A;  4OLA A;  4Q5V A;  4K8Z A;  3PO5 A;  4DSJ A;  3S3O A;  4RG8 A;  1HMV A;  4KI4 A;  3A2F A;  4ZHR A;  1EXQ A;  3LPT A;  3NBP A;  4Q0B A;  3S3M A;  4KHU A;  3VQ7 A;  3PX0 A;  4CEE A;  3B6O A;  4FVM A;  3LAL A;  4W5N A;  3AVN A;  4BE0 A;  4E1N A;  1IKY A;  4CJQ A;  2D0A A;  2YHB A;  1XHX A;  4NCA A;  4CJU A;  3SV3 A;  2OPP A;  1RDD A;  4DU3 A;  4Z0U A;  1SKS A;  4DLE A;  3MEE A;  4KHW A;  1J9A A;  3G0Z A;  2HND A;  3O4Q A;  2FBY A;  4BWM A;  4DU4 A;  3DMJ A;  2A1S A;  3VQE A;  2G8V A;  4ZTF A;  1L3U A;  3LAN A;  5DK5 A;  4B8C A;  3PV8 A;  3SUO A;  1X9W A;  4KI6 A;  1UA0 A;  4DLG A;  4E7K A;  3DOL A;  3U3Y A;  1ZBF A;  2EHG A;  3UIQ A;  4CGH A;  3SJJ A;  3T3F A;  1A5W A;  1BL3 A;  4BDY A;  4DTP A;  1J54 A;  3OYN A;  4H4O A;  1MU2 A;  4IFV A;  4KO0 A;  4CFA A;  4DU1 A;  2X74 A;  4FW2 A;  1HYV A;  3ZSQ A;  4CK3 A;  1JLE A;  2KQ2 A;  1RT2 A;  3LP2 A;  3NF6 A;  1S1W A;  4RW7 A;  1HYS A;  4CJV A;  3PX4 A;  3O3H A;  1NK0 A;  1RTD A;  1TGO A;  2HHQ A;  3ZT1 A;  4CF2 A;  3LDS A;  1RTJ A;  2QK9 A;  4I9L A;  2IDO A;  3QER A;  3QEX A;  1B9F A;  3HP6 A;  1S6Q A;  3DRS A;  4BE1 A;  1C1B A;  2BDP A;  3U6F A;  3KD5 E;  4CEF A;  5HP1 A;  4FLX A;  3MEG A;  4FLT A;  1JKH A;  1IH7 A;  4ICL A;  3L3U A;  4XIU A;  1B9D A;  4FLY A;  2YKM A;  1RDC A;  4CHQ A;  4DSL A;  1R0A A;  3L2Q A;  3SQ2 A;  2D0B A;  3HVT A;  4LH4 A;  1WSF A;  4DSI A;  1S1V A;  3WNE A;  3JSM A;  2X6N A;  4YNQ A;  1HQU A;  3QEW A;  4B9L A;  2EX3 A;  2HNZ A;  1RDA A;  2HHU A;  3MED A;  3LPU A;  1FKO A;  1A5X A;  4CIF A;  5HBM A;  2HB5 A;  1TKZ A;  3IAY A;  4HCB A;  1LW0 A;  2DFF A;  4FJ7 A;  4EP4 A;  4AHT A;  5FRO A;  4FJN A;  4FJ5 A;  1EP4 A;  1YT3 A;  3V9W A;  2YHA A;  5KRS A;  3NF7 A;  2B6A A;  3LP3 A;  1RIL A;  4CFB A;  3C94 A;  4W5Q A;  3KLH A;  4DF4 A;  3SPY A;  4F3O A;  2HHV A;  4FW1 A;  1XWL A;  4AHV A;  4CJP A;  3WNH A;  3OYF A;  3OYA A;  5J2N A;  4F2R A;  3NH2 A;  4B9U A;  1S6P A;  3LZJ A;  2G8W A;  4BDP A;  4CES A;  4ID5 A;  4CJ3 A;  4KB1 A;  2FBX A;  4CE9 A;  4IG0 A;  4O44 A;  4DQP A;  3TAE A;  2E6M A;  3KK3 A;  3ZCM A;  4DFJ A;  1I39 A;  2OA8 A;  2YNH A;  4UQG A;  3OYL A;  3AA5 X;  3V1O A;  1YVU A;  5DMR A;  5HLF A;  3NGZ A;  1RCH A;  3CFR A;  3VQ9 A;  3SYZ A;  2XY7 A;  4J2E A;  1NJW A;  3KTQ A;  4E0D A;  3DLG A;  1SV5 A;  1Y97 A;  3SPZ A;  1WSI A;  1JLB A;  3DI6 A;  4IDK A;  4W5O A;  3BDP A;  3SCX A;  2XO7 A;  4DSE A;  4FJI A;  2P1J A;  1DLO A;  4F3T A;  1REV A;  1TV6 A;  5C42 A;  1EKE A;  2GV9 A;  4BAC A;  3VQP A;  1FKP A;  2LSN A;  4CHO A;  2KTQ A;  5HRR A;  3DLH A;  4LH5 A;  1U47 A;  2O4I A;  1KSP A;  4FK4 A;  3NF9 A;  1BIZ A;  4RW8 A;  3K59 A;  2F8T A;  3RMA A;  4AHR A;  3HK2 A;  3OYG A;  3ITH A;  3KK2 A;  1NKC A;  4PUO A;  1TKX A;  4H4M A;  2RKI A;  5KTQ A;  2HHW A;  4CHZ A;  1BI4 B;  3QEI A;  1L3S A;  3AO4 A;  1VSH A;  4KFB A;  3LZI A;  3L3V A;  3NCI A;  2VG5 A;  4KV8 A;  4CIG A;  5E41 A;  4IBN A;  2JGU A;  3KLI A;  5JS1 A;  2WOM A;  2RPI A;  1CXQ A;  5C25 A;  3VQ5 A;  3I8D A;  5FDL A;  1RT4 A;  2PYL A;  1HQE A;  5EU7 A;  1T03 A;  3ISN C;  1YTA A;  1TL1 A;  2XY5 A;  1L3V A;  2I5J A;  4I7F A;  3SQ1 A;  1RT5 A;  3OY9 A;  3HM9 A;  4KHQ A;  4KB0 A;  4Z4I A;  4CGG A;  4KHS A;  4O0I A;  2HHS A;  5KGW A;  1QSS A;  1D5A A;  3F9K A;  3TWH A;  1SKR A;  3DLK A;  2IOC A;  2Q3S A;  4C8N A;  4FJH A;  3TAR A;  1SL0 A;  1Q9X A;  1HJR A;  3OYE A;  3HPH A;  4E7J A;  4FM2 A;  4FCY A;  1QTM A;  2JLE A;  3SZ2 A;  3OYI A;  2DTU A;  1RT1 A;  3V81 A;  4KKO A;  4CFD A;  3OYM A;  4FLV A;  2BAN A;  4M3Y A;  1N5Y A;  2G8H A;  1NOY A;  2HNY A;  4FJ8 A;  4N56 A;  3HPO A;  1VSI A;  4DFK A;  4N76 A;  4M3X A;  1W0H A;  4CFC A;  3ZT4 A;  3F73 A;  3L2R A;  1DTT A;  4CGI A;  3P83 D;  1HNI A;  3AVH A;  1Q9Y A;  3SUQ A;  4FM1 A;  2VG6 A;  3OVN A;  3NF8 A;  3NGI A;  1BI4 A;  1WSE A;  2IS3 A;  2DFH A;  1U4B A;  4CJF A;  3KLG A;  1NJX A;  1SKW A;  3QET A;  3OYD A;  4FK0 A;  4CEB A;  3KKR A;  2R7Y A;  3VA3 A;  3SUN A;  2P5G A;  4FJG A;  1RT7 A;  4HUG A;  2YNF A;  4CEO A;  1SL1 A;  1NKB A;  3PX6 A;  3PO4 A;  4C8O A;  4ELV A;  1QHT A;  2P5O A;  3OYJ A;  2HVI A;  3G10 A;  3I0R A;  3VQ8 A;  1BCM A;  2DFE A;  2QKB A;  4CGD A;  2E4L A;  1NK9 A;  4AH9 A;  3AA2 A;  2YNI A;  1TAQ A;  4WE1 A;  2KZZ A;  3AVM A;  1K6Y A;  1L5U A;  4ELT A;  1EX4 A;  4KTQ A;  1KVA A;  4CJL A;  3AO3 A;  3K2P A;  4KHN A;  1WN7 A;  3LAM A;  2KFN A;  1NK4 A;  4KAZ A;  3OJS A;  1JLF A;  4CK2 A;  3QNO A;  1U45 A;  5KRT A;  1KLM A;  4DTX A;  3CG7 A;  1RBV A;  2F96 A;  1UA1 A;  4H8K A;  1JXB A;  3CM5 A;  4E3S A;  1X9S A;  1XC9 A;  1VSF A;  3T1A A;  4DG1 A;  4OGE A;  1J5O A;  3TAM A;  4CEZ A;  4FJK A;  1LWC A;  1UAX A;  3V1Q A;  1KCF A;  4DS5 A;  4FK2 A;  5D3G A;  4CHN A;  4CIE A;  3THV A;  3DLE A;  3T19 A;  4KTW A;  2ZQB A;  3V4I A;  3OYK A;  3L2V A;  2OPR A;  4CJT A;  3CQ8 A;  3AVB A;  4BDZ A;  2HVH A;  5CZ1 A;  2Z1H A;  4CJS A;  3V6D A;  5FRM A;  1C1A A;  2XRI A;  4OPK A;  4DQS A;  2VG7 A;  3WNF A;  4B8A B;  1QQC A;  1RDB A;  3VQQ A;  1SL2 A;  4B9T A;  4AHU A;  2OZS A;  4M42 A;  1FK9 A;  4FLU A;  3HPG A;  3FFI A;  3TAQ A;  4NCG A;  3NGY A;  4CJK A;  4B9M A;  2GUI A;  1VRT A;  1JL2 A;  4KHY A;  5T7B A;  4EZ6 A;  3AA4 A;  1U04 A;  4FLZ A;  2QXF A;  3PY8 A;  4CJ5 A;  3LAK A;  3NE6 A;  1WLJ A;  4DMN A;  3OS1 A;  3M8Q A;  3DRR A;  4CJE A;  1KVC A;  3L8B A;  4DTM A;  4DQR A;  2GBZ A;  2ZD1 A;  4ZTJ A;  1KLN A;  3KIO A;  4FZY A;  4FJM A;  2B4J A;  2DY4 A;  3AO2 A;  3AO1 A;  1UWB A;  3MAQ A;  1XHZ A;  4AIL C;  2G8I A;  4KPY A;  3I0S A;  3HST B;  2YV0 X;  1BGX T;  4GMJ B;  3KK1 A;  1X9M A;  1NJY A;  4DTS A;  4C8M A;  2W42 A;  4CJR A;  2FBV A;  2VWK A;  1ZBI A;  5HRP A;  3O3F A;  2ITG A;  2OZM A;  2KW4 A;  1IO2 A;  3QEV A;  4RW4 A; 
#chains in the Genus database with same CATH topology
 4ISF A;  4B3M K;  2OYQ A;  4Z4F A;  4OJR A;  4H0X B;  3H08 A;  3V9U A;  1C0U A;  1U6Z A;  4HCC A;  1S1X A;  2GWJ A;  2G8K A;  2Y1I A;  4V19 S;  4C1N K;  2AJQ A;  3CJ9 A;  4IZ9 A;  4EP5 A;  1TK8 A;  2OPS A;  1C1C A;  4M45 A;  3EY1 A;  2QA4 N;  1BQM A;  4A5A A;  1DKG D;  4FYD A;  5AFU A;  4B9Q A;  3S9H A;  3SAG A;  2P9P A;  4WQ5 A;  3BEX A;  3RR8 A;  1RNH A;  1CZ9 A;  2QKK A;  4QOZ B;  4BC4 A;  5BN8 A;  1XC3 A;  2PFU A;  4NCB A;  3E66 A;  2F7T A;  5KPZ A;  2HBK A;  4U7B A;  3SUP A;  2BE2 A;  3RVC A;  4CGF A;  3ZET A;  4XH1 A;  1IBK K;  4LFB K;  4DTR A;  4RWT A;  1P90 A;  1NK7 A;  3AGR A;  3TR8 A;  3KKS A;  1T6D A;  5BPM A;  4CED A;  5ADX H;  2RF2 A;  4C8K A;  3C65 A;  4CEQ A;  3GOI A;  2HHX A;  3V9S A;  5I42 A;  4WQ4 C;  1NK5 A;  1HNX K;  4BRK A;  1WOQ A;  1Z6R A;  3SQ4 A;  1LW2 A;  3O4N A;  1Z26 A;  4E7L A;  3CM6 A;  2ATQ A;  4JS4 A;  3HJF A;  2RE2 A;  3C6A A;  3ZT2 A;  3AVC A;  2Z1G A;  3KZB A;  1TL3 A;  5EOY A;  2FSK A;  4FZX C;  5LJV A;  1KFD A;  5K14 A;  3H3N O;  3LDN A;  4FO0 A;  2KKZ A;  3VQC A;  3C95 A;  4GVM A;  1O13 A;  2YNG A;  1BIS A;  4OGC A;  5GAG P;  3QBW A;  4LD0 A;  2G8U A;  4JI5 K;  3K5N A;  2V7Z A;  4M41 A;  1D9F A;  1XI1 A;  1TAU A;  3OA9 A;  2D0C A;  1GOC A;  3EO3 A;  3LP0 A;  4CGJ A;  1GOB A;  1ASW A;  5GIP A;  1VQL N;  3NH1 A;  4HVJ A;  4CZG A;  2F9W A;  4JK9 A;  4O5B A;  2P51 A;  5JS2 A;  3SMS A;  5GIN A;  1S9E A;  1S9G A;  3C7N A;  3S3N A;  4BR9 A;  5EY4 A;  5KGX A;  3SAF A;  3O8M A;  1LWE A;  3KJV A;  3HYF A;  3DM2 A;  3ZSV A;  3ASM A;  5JMV A;  1OKJ A;  4NO7 A;  4RW9 A;  4QAG A;  5BRH A;  1RT3 A;  1BIU A;  2P9K B;  4IFY A;  5CZ2 A;  4Y0W A;  3SAH A;  4KH6 A;  3HO1 A;  1NGG A;  4B08 A;  3UE5 A;  2GEL A;  3MXM A;  2QXL A;  3L2U A;  3M8P A;  1T05 A;  3K5L A;  5ELZ A;  3RMD A;  4NYN A;  3VQ6 A;  3MK6 A;  4DTJ A;  3E01 A;  4XEI A;  4IKF A;  1WB9 A;  2FXU A;  1NK8 A;  4JRQ A;  3O9R A;  3K57 A;  5KI6 A;  4I2P A;  1C6V A;  3MMV A;  1RT6 A;  4OLB A;  2XY6 A;  4LSL A;  4WFB L;  4CF9 A;  2VWJ A;  4OKE A;  4C8L A;  3D2E B;  3TTC A;  4J2B A;  1T3V A;  3D7E O;  4FLW A;  3C6U A;  3A5O C;  3UKR A;  1VQN N;  3PUF A;  3WEE A;  5C0Y A;  4H5W A;  4LC9 B;  3AVI A;  3LP1 A;  1RBU A;  1VSM A;  2P9U B;  3O9S A;  1QSY A;  2D5R A;  4E89 A;  4JRP A;  4TSX A;  2D0O A;  1MDU B;  4B9V A;  3M8R A;  4AHS A;  5FRN A;  1YVN A;  2ZWH A;  4JD2 A;  4LF5 K;  1HMV A;  3O4W A;  3CCQ N;  3LPT A;  3S3M A;  1NU0 A;  3PX0 A;  4BRD A;  3LAL A;  4E1N A;  1IKY A;  5H1S Q;  2D0A A;  2YHB A;  3FZK A;  3SV3 A;  1SKS A;  4DLE A;  4RCH A;  4EIA A;  2HND A;  3CJA A;  3DMJ A;  3VQE A;  2G8V A;  2O8F B;  2ZJQ L;  3G71 N;  4DLG A;  3DOL A;  2EHG A;  4BR7 A;  3T3F A;  2O8B B;  2E20 A;  5AQX A;  4BG9 A;  2QWM A;  4H4O A;  2QI2 A;  5GIO A;  2X74 A;  4FW2 A;  5KPR A;  1MA9 B;  3THW B;  1XMQ K;  3LP2 A;  3NF6 A;  1EWR A;  3NMU A;  1RTD A;  3ZT1 A;  4CF2 A;  3LDS A;  2O8D B;  3FE1 A;  1KAZ A;  3QER A;  2E2Q A;  3U6F A;  2Q97 A;  1VQP N;  3MEG A;  1JKH A;  1IH7 A;  4FLY A;  2Q0U A;  4CHQ A;  4DSL A;  1R0A A;  2D0B A;  5BN9 A;  1H1V A;  4DSI A;  3WNE A;  2YHW A;  3MDQ A;  1HQU A;  4B9L A;  4GKK K;  2NRX A;  1RDA A;  3ULE B;  3LPU A;  3CD6 N;  1GLA G;  3U9Z A;  4FJN A;  2CGJ A;  1YT3 A;  2YHA A;  3T69 A;  3WQT A;  3I8B A;  2CH5 A;  5KRS A;  3LP3 A;  1RIL A;  4F3O A;  4DF4 A;  2P9N A;  4AHV A;  4CJP A;  3CC4 N;  1ILY A;  3K0S A;  4BDP A;  3LDP A;  4B3S K;  2EWS A;  1XQS C;  3SMP A;  3W0L A;  3O5B A;  4BRL A;  3UB5 A;  1Z05 A;  2YNH A;  4UQG A;  3DXK B;  3V1O A;  5HLF A;  5DMR A;  1RCH A;  3CFR A;  3ZET B;  1NJW A;  3LDL A;  3KTQ A;  4E0D A;  1SV5 A;  1Y97 A;  3DI6 A;  4W5O A;  3BUZ B;  3BDP A;  1NGC A;  4JI7 K;  2P1J A;  4ILG B;  5C42 A;  4DUZ K;  4BAC A;  1FKP A;  1K8A O;  4LH5 A;  1U47 A;  3DLH A;  2O4I A;  1KSP A;  1ZXO A;  4FL9 A;  3OYG A;  3KVG A;  3KK2 A;  3W3D A;  5KTQ A;  5AQO A;  1YIJ N;  4NXN K;  2HHW A;  3AO4 A;  4MDB A;  5AQY A;  2VG5 A;  2V7Y A;  5FDL A;  3VEY A;  5F2R A;  2PYL A;  1FJG K;  1CZA N;  3ISN C;  5DM6 L;  3SQ1 A;  4KHS A;  3CHW A;  5DM7 L;  4O0I A;  5KGW A;  1SKR A;  2Q3S A;  3ATU A;  4CZE A;  3OYE A;  4FM2 A;  4FCY A;  2JLE A;  3WXK A;  2DTU A;  2QWP A;  4B1V A;  1N5Y A;  4QS8 A;  3HPO A;  4M3X A;  4GV9 A;  5MLC Q;  4DR6 K;  3AGK A;  3F9M A;  5M1O A;  4NLC A;  1HNI A;  3H1V X;  4H03 B;  2AA4 A;  4BRN A;  3NGI A;  1SS6 A;  1U4B A;  1NJX A;  3CCS N;  3QET A;  1M90 O;  4K0K K;  3KKR A;  2R7Y A;  4FJG A;  5ADX A;  4ELV A;  3CC7 N;  4B1Y B;  5AQS A;  1OH5 A;  1HNW K;  2KZZ A;  1L5U A;  1K6Y A;  4DR1 K;  4KHN A;  5CE3 A;  5M1K A;  3KWG A;  4KAZ A;  3OJS A;  1JLF A;  2A5X A;  2W6L A;  3QNO A;  2P9L A;  4JI4 K;  4B3R K;  5KRT A;  2ZF5 O;  3VF4 A;  2PBD A;  4K43 A;  4WQ4 A;  4ISG A;  5JLF A;  1JXB A;  2UUB K;  1XC9 A;  3T1A A;  4DG1 A;  3V1Q A;  1KCF A;  1DT9 A;  4BRH A;  3JAM O;  3THV A;  4JN4 A;  3L2V A;  4B1Z A;  4DKW A;  4CJT A;  3CQ8 A;  3AVB A;  4BDZ A;  2HVH A;  1C1A A;  4DR5 K;  4B8A B;  3WXJ A;  4B9T A;  1FK9 A;  3HPG A;  3NGY A;  4B9M A;  1VRT A;  4LF6 K;  5T7B A;  3AA4 A;  3B8A X;  3H45 C;  4CJ5 A;  3ENO A;  3DRR A;  2O8C B;  2GBZ A;  3A5L C;  2AP1 A;  1XHZ A;  4AIL C;  3HST B;  4JV5 K;  1BGX T;  1X9M A;  4LF9 K;  3EN9 A;  4DTS A;  1VQ8 N;  2NZT A;  4CJR A;  2VWK A;  1ZBI A;  5HRP A;  3O3F A;  2ITG A;  2OZM A;  4IDH A;  5E84 A;  3QEV A;  1IO2 A;  1T44 A;  3CCV N;  1BA1 A;  2QWN A;  1EQY A;  3KLF A;  4Y1C A;  2HOE A;  3ID6 A;  5BPL A;  4JKB A;  3NVM A;  1KQS M;  4M7Y A;  3AAP A;  3QIP A;  2UUA K;  4YOT A;  2W40 A;  2PYJ A;  1RBT A;  5C2F A;  5J2P A;  1QQM A;  2IGI A;  4CCH A;  5JLH A;  2FC0 A;  5AQN A;  4JNE A;  5SWM A;  1BQN A;  4KRF A;  3ZT3 A;  2I7P A;  3QIN A;  4K42 A;  4U67 L;  2NRR A;  5AJ3 K;  5AQI A;  4DTU A;  5FPD A;  3WNG A;  3QEP A;  1NJI O;  2VWB A;  1IKV A;  3RTV A;  1K8K B;  1OH6 A;  4YHH K;  1S22 A;  3ALY A;  4A5B A;  1QSL A;  2UU9 K;  1N34 K;  4IG3 A;  5C10 A;  3TSQ A;  3OYH A;  2VGN A;  3P31 A;  4DQQ A;  5AQW A;  4FZZ A;  1HRH A;  5M1F A;  2O8E A;  4CZH A;  4JI3 K;  1F21 A;  4ID1 A;  3ULD A;  1X9J A;  1N36 K;  4FJ9 A;  1VSJ A;  3K58 A;  2B5J A;  1NOZ A;  4W5T A;  1NLV A;  2UYT A;  3QO9 A;  1Z25 A;  1QE1 A;  3DXM A;  3MN7 A;  4OKJ A;  4LSN A;  1RBR A;  1WBB A;  4JLH A;  1BA0 A;  5HRN A;  1ITG A;  4GY2 B;  4DR2 K;  1BOT O;  1RGI A;  4Z4G A;  2BGG A;  3C6T A;  3BZC A;  5M1Q A;  4I9Q A;  1ZBH A;  1XNR K;  3JYT A;  4KTZ A;  5C2D A;  3LWL A;  4DTO A;  1I94 K;  4XH5 A;  3CME N;  3RMC A;  5J2M A;  2OCE A;  1IG9 A;  1LAW A;  2ZM6 K;  3ZT0 A;  4QS7 A;  2P9N B;  1O1W A;  4FXD A;  1WSJ A;  3WUH A;  2YKN A;  3VGK A;  1J5E K;  3FFK B;  2P9S B;  4EFH A;  2NRH A;  3KHY A;  2UXB K;  4A61 A;  1KRP A;  2Q36 A;  3LDQ A;  3CPE A;  1WSG A;  3E9P A;  2PZS A;  3GL1 A;  5BR8 K;  5BRF A;  3K5M A;  4E1M A;  1LAV A;  3SI6 A;  4GW6 A;  4J2A A;  4BWJ A;  3HP9 A;  5J2Q A;  4CD3 A;  3EYZ A;  1Q8I A;  3AVJ A;  4DF8 A;  2UUC K;  2KFZ A;  3HRG A;  1TK5 A;  2IC3 A;  1LOT B;  3DJC A;  4DV4 K;  3DRP A;  3VQA A;  4BRQ A;  1VQK N;  3DLR A;  1I3A A;  3WT0 A;  3M3Z A;  2YI1 A;  1KVB A;  3V1R A;  4N5S A;  1TKD A;  3ZSZ A;  3O3G A;  4M7X A;  3H46 O;  4FJL A;  3OS0 A;  3CYM A;  4Y1D A;  3CMA N;  4DFM A;  4DSK A;  5BR9 A;  4O4G A;  3RWU A;  2HMI A;  2QM1 A;  4H5T A;  1J53 A;  1YIT N;  5AZI B;  3VER A;  4H0T B;  4ELU A;  2E2O A;  2WBN A;  4YOV A;  3PIO L;  4B9N A;  3D2F A;  1KD1 O;  3RSE A;  5E26 A;  3HL8 A;  4DQI A;  2CGL A;  1KAY A;  2KZM A;  2W6K A;  3JS6 A;  5AQF A;  3HVR A;  1ASU A;  2E6L A;  5LY3 A;  1VHX A;  1JLC A;  4CK1 A;  4JEP A;  4YOX A;  3P4I A;  4K8X A;  4LY7 A;  2FF6 A;  4CEC A;  3HI0 A;  3OBW A;  1CXU A;  3QES A;  1QZ5 A;  4MO5 A;  1VSK A;  2ETJ A;  3ZSX A;  4CBW A;  3K5O A;  1EET A;  1WSH A;  4JI1 K;  3G25 A;  3N4Q A;  3NBP A;  4IXC A;  3MWP A;  3VES A;  3CC2 N;  4MLH A;  2WC9 A;  2Q1N A;  4W5N A;  4BE0 A;  2KHO A;  4CJU A;  2OPP A;  1RDD A;  4DU3 A;  3I56 N;  1K9M O;  3MEE A;  4KHW A;  2NRT A;  2FBY A;  3MN6 A;  4DU4 A;  2A1S A;  1L3U A;  3FGU A;  5DK5 A;  3CCM N;  4B8C A;  3PV8 A;  3TSU A;  1W97 L;  3SJJ A;  4BDY A;  4DTP A;  1NM1 A;  3FZH A;  4H5R A;  3OYN A;  1MU2 A;  4KO0 A;  4CFA A;  4DU1 A;  4IJN A;  1XMO K;  4BR4 A;  3ZSQ A;  4FOI A;  5I9E B;  4LFA K;  3O3H A;  1NK0 A;  3UKU A;  2ZJR L;  1E4F T;  1T6C A;  2IDO A;  3VOV A;  1S6Q A;  1X3M A;  3DRS A;  1C1B A;  3MCP A;  2BDP A;  4CEF A;  2NLX A;  4FLX A;  1KAX A;  5AQU A;  3CCE N;  4OX9 K;  1B9D A;  4QS9 A;  2YKM A;  3L2Q A;  2P9I A;  4CVN E;  5IT9 O;  4LH4 A;  3QEW A;  1HR0 K;  2YJF A;  3MN5 A;  4CBU A;  2HB5 A;  4CZI A;  4OPH A;  2ASO A;  3O9U A;  2F9T A;  4EP4 A;  4FJ7 A;  1EP4 A;  4KH5 A;  2J4R A;  1TYQ B;  1NGI A;  2OAN A;  4FW1 A;  4FWM A;  3IUC A;  4H5V A;  5FPM A;  4BRO A;  3MWT A;  1U2V A;  4CES A;  2FBX A;  4IG0 A;  5TKY A;  2IVO A;  3ZCM A;  1I39 A;  2OA8 A;  3OYL A;  3AA5 X;  4A57 A;  4JYA K;  1YVU A;  4BRG A;  4LF7 K;  3SYZ A;  4B1X B;  2XY7 A;  3O1W A;  1LCU A;  1WSI A;  4IDK A;  2IVN A;  4JKC A;  4A62 A;  4DSE A;  4F3T A;  4BC5 A;  1REV A;  2GV9 A;  4XH4 A;  2LSN A;  4YOR A;  4RW8 A;  3K59 A;  4AHR A;  4B3T K;  4FWN A;  2NRZ A;  2FSN A;  1NKC A;  3QFP A;  4JHD B;  4PUO A;  1TKX A;  5AQZ A;  4CZJ A;  1VQ4 N;  1BI4 B;  1L3S A;  2QWR A;  3L3V A;  3HZ6 A;  4GNI A;  2ITM A;  3K9K A;  3J80 O;  4PL8 A;  3I8D A;  5JS1 A;  3VQ5 A;  1C0F A;  1RT4 A;  1T03 A;  3ZLJ A;  1L3V A;  4DR3 K;  3BP8 A;  3A8Y A;  4BRC A;  1QSS A;  1D5A A;  2IOC A;  3GE1 A;  3LM2 A;  3ZYY X;  1Q9X A;  3OYI A;  3CET A;  4CFD A;  2NNW A;  4IO8 A;  2G8H A;  4FJ8 A;  5FLX O;  4BR0 A;  1W0H A;  4CFC A;  4M63 C;  3ZT4 A;  4C1N I;  4GKJ K;  3AVH A;  1Q9Y A;  3VPZ A;  4FK0 A;  3VA3 A;  3SUN A;  5BRE A;  2YNF A;  3CIP A;  3PX6 A;  1QHT A;  2P5O A;  4AM6 A;  3G10 A;  3VQ8 A;  4JKF A;  1VQM N;  3DAW A;  2GUP A;  4JK7 A;  2VQF K;  3T1H K;  2E2N A;  1NNE A;  4ELT A;  1EX4 A;  1KVA A;  1WN7 A;  3LAM A;  4PL7 A;  1NK4 A;  3CCU N;  4CK2 A;  1Q81 O;  1N32 K;  4ISE A;  4BC3 A;  4E1J A;  3CG7 A;  1RBV A;  4EAH D;  1UA1 A;  3CM5 A;  1VSF A;  4OGE A;  1E4G T;  1BUP A;  1LWC A;  2NRV A;  4DS5 A;  3CJ1 A;  5BRD A;  3Q7B A;  3T19 A;  3V4I A;  1EO1 A;  4H0V B;  1ATR A;  1OH7 A;  2ZGY A;  4H0Y B;  5CZ1 A;  4DQS A;  2Q31 A;  2VG7 A;  3WNF A;  2WTU A;  4M42 A;  2QEX N;  4AHU A;  2OZS A;  3FFI A;  4NCG A;  2GUI A;  4KHY A;  4EZ6 A;  2QXF A;  3PY8 A;  4AF1 A;  3ZX3 A;  1WLJ A;  3OS1 A;  1VQ5 N;  1QQN A;  3M8Q A;  5LMU K;  1KLN A;  4ZTJ A;  4FJM A;  2P9P B;  3AO2 A;  2RHK A;  3AO1 A;  3D2F B;  4KPY A;  3I0S A;  2YV0 X;  3KK1 A;  2IIR A;  3I55 N;  2HST A;  2FBV A;  4I6M A;  4FWP A;  2OTJ N;  2KW4 A;  4WQ5 C;  4YOW A;  1TK0 A;  2G8F A;  5AZJ A;  3VEN A;  1WAF A;  5HRS A;  5AR0 A;  2E1Y A;  1C0G A;  3L2W A;  1HYZ A;  3IKM A;  3DYA A;  4E19 A;  4OVL A;  4OKK A;  1JLQ A;  5AQP A;  1R59 O;  1CZB A;  4CF8 A;  3NDK A;  1D8Y A;  3GBT A;  4JI2 K;  3VTH A;  3B6P A;  3AAR A;  3NH0 A;  3VGM A;  3CFP A;  3MX5 A;  1UOC A;  4B1U B;  5M1N A;  1N6Q A;  1WAJ A;  1W7A A;  4JS5 A;  2FBT A;  4X62 K;  3D0P A;  3TAN A;  5AQL A;  3L4I A;  1QQO A;  1HPM A;  4HUE A;  1C0M A;  3AV9 A;  3AO5 A;  1IKW A;  3F5T A;  1LV5 A;  3AVF A;  4NB4 A;  2F4V K;  1A5V A;  3O6W A;  5EX5 A;  3ZSO A;  3FLC O;  3O1B A;  3FR0 A;  1KC8 O;  2E2P A;  1U49 A;  5EXW A;  3KD1 E;  4DV3 K;  5F0X A;  4CER A;  3CQX A;  1SZ2 A;  4BY9 C;  4W5R A;  3VA0 A;  1VRU A;  3NAE A;  2D1K A;  2Y1J A;  1HNV A;  3QDK A;  2WUS A;  4RW6 A;  3TAB A;  5F1X A;  4YY3 K;  4Z4C A;  3C7N B;  4WF9 L;  3LDO A;  4OPJ A;  2E88 A;  3QB0 A;  4O0J A;  3V9Z A;  4E7H A;  1VSL A;  3SLC A;  4FSV A;  1BWF O;  4H0O A;  1BU6 O;  4J8F A;  1EWQ A;  1KXP A;  1ZBS A;  4O8K A;  3SK3 A;  3QLH A;  2YCH A;  3AVA A;  3HT3 A;  4DS4 A;  2HBM A;  1S1T A;  1KTQ A;  3VQ4 A;  3R3L A;  1L3T A;  5C12 A;  5AQK A;  3BF1 A;  2UXC K;  3MEC A;  4CJW A;  1VQO N;  1VAZ A;  3RRH A;  1JLG A;  4A2A A;  3PIP L;  1DTQ A;  1YHQ N;  4X64 K;  4YOU A;  3EE8 A;  3ZX0 A;  3C0B A;  1T7P A;  4M3W A;  2V51 B;  1E3M A;  3TAG A;  4IJA A;  3V9X A;  3TAF A;  5AQH A;  3IG1 A;  1IKX A;  4L3Q A;  5CR4 A;  4HTU A;  2Z1J A;  4CF0 A;  1MWM A;  3L6Q A;  4BE2 A;  3AVG A;  1NKE A;  4IOC L;  3UKR B;  1SUQ A;  3WEE B;  3NFA A;  4FWR A;  3D45 A;  3OW2 M;  2JWK A;  3J7Y P;  1VSD A;  3THX A;  3D6R A;  4DTN A;  1JLA A;  3MXJ A;  4Z4H A;  2IAJ A;  1G15 A;  5M1P A;  1HKG A;  3DOK A;  3M5R A;  4JD2 B;  5CY4 A;  2NUB A;  2HBL A;  2GWK A;  4CHP A;  4F9O A;  1WBD A;  4B9S A;  1VSE A;  1X1P A;  2X6S A;  3VTI A;  4WCE L;  3R1X A;  3DLB A;  4YFU A;  3RRG A;  3M8S A;  3QNN A;  3O9T A;  2P9K A;  4GVE A;  3EEQ A;  3BY5 A;  4BRF A;  3IS9 A;  5J1E A;  3VQD A;  4DSF A;  1ASV A;  3TTF A;  1VQ9 N;  1TKT A;  3MCA B;  2ZE2 A;  1CLQ A;  3SQ0 A;  1JCG A;  1RDW X;  3QML A;  1WNS A;  3PO5 A;  4RG8 A;  4KI4 A;  1EXQ A;  4KHU A;  4CEE A;  4FVM A;  3J7Z O;  3AVN A;  4CJQ A;  4NCA A;  1XHX A;  4BRE A;  1BG3 A;  2IVP A;  1SQK A;  4IFE A;  5TKW A;  3PSI A;  3CQY A;  3G0Z A;  1XNQ K;  4LFC K;  3LAN A;  4EHU A;  3SUO A;  3CJC A;  3U3Y A;  1ZBF A;  4CGH A;  1HLU A;  1A5W A;  1BL3 A;  1OVY A;  2Q2R A;  4A2B A;  4IO9 L;  4YDU C;  4CZM A;  3M1F A;  4CI6 A;  4CK3 A;  3CCL N;  1JLE A;  1RT2 A;  1S1W A;  1HYS A;  1TGO A;  3L0Q A;  2HHQ A;  1RTJ A;  3QEX A;  2QTD A;  3CCR N;  4A59 A;  3HP6 A;  3AY9 A;  1W2B M;  3KD5 E;  3WXI A;  1S72 N;  4XIU A;  4EHT A;  4BRM A;  1RDC A;  2O8F A;  3SQ2 A;  4DHY A;  1V4S A;  1IBM K;  1WSF A;  1S1V A;  3JSM A;  2X6N A;  4YNQ A;  5IWA K;  2O8B A;  2V52 B;  1FKO A;  4CIF A;  1TKZ A;  3IAY A;  1LW0 A;  4JKG A;  4FWL A;  5FRO A;  3THW A;  4FJ5 A;  3V9W A;  2HHV A;  4CFB A;  3C94 A;  1XWL A;  1ESV A;  2O8D A;  3CJ7 A;  3WNH A;  3OYF A;  5J2N A;  4F2R A;  4R79 A;  3NH2 A;  1S6P A;  2G8W A;  4ID5 A;  4CE9 A;  4DQP A;  3H6E A;  3TAE A;  4BRA A;  3KK3 A;  2ASM A;  3PLA A;  5GAE P;  3L4Q A;  3VQ9 A;  4J2E A;  1YF5 L;  3DLG A;  3SPZ A;  1YJ9 N;  3HSC A;  3ULE A;  2E5L K;  3SCX A;  1QVF M;  4DR4 K;  1GLC G;  5LMN K;  2HF4 A;  2A3Z A;  3OBY A;  1P8Z A;  1EKE A;  4CW7 B;  4CHO A;  2KTQ A;  4DB3 A;  5HRR A;  1GLB G;  1QZ6 A;  1Q18 A;  3NF9 A;  2F8T A;  3RMA A;  3R8E A;  1GLD G;  4KHP K;  3ITH A;  4UY8 O;  3HOS A;  2RKI A;  4NLB A;  4CHZ A;  3QEI A;  5HOO A;  1FW6 A;  3LZI A;  2VGM A;  4KV8 A;  4IBN A;  5JVH L;  2JGU A;  3KLI A;  1CXQ A;  2RPI A;  3HTV A;  1JJ2 M;  5KQD A;  3FZL A;  2XY5 A;  2I5J A;  1RT5 A;  3DXK A;  2YX6 A;  3HM9 A;  3QIC A;  4KB0 A;  4KHQ A;  4Z4I A;  1GLF O;  2ASP A;  4BR2 A;  3TWH A;  3J81 O;  3DLK A;  4C8N A;  4FJH A;  3TAR A;  1SL0 A;  2QWO A;  1QTM A;  2P9L B;  4KKO A;  3OYM A;  2BAN A;  4M3Y A;  1RDU A;  1NOY A;  4N56 A;  1NG9 A;  4GV3 A;  3TPQ A;  4DFK A;  4N76 A;  1Y64 A;  3F73 A;  1YAG A;  3EE9 A;  1IBL K;  4CGI A;  3P83 D;  4FM1 A;  3TSP A;  1WSE A;  4WFN L;  3KLG A;  1S3X A;  2BUP A;  4CEB A;  2P5G A;  1YUW A;  4HWI A;  4HUG A;  1NKB A;  1SL1 A;  4C8O A;  3OYJ A;  4X65 K;  3VEX A;  4BRI A;  3I0R A;  3IMX A;  4B1W B;  2DFE A;  4CGD A;  2E4L A;  1NK9 A;  4AH9 A;  3AA2 A;  1TAQ A;  4WE1 A;  3BZK A;  4KTQ A;  4CJL A;  3K2P A;  2KFN A;  1U45 A;  1KLM A;  2F96 A;  3TTD A;  4H8K A;  1NGD A;  3EZW A;  4E3S A;  1X9S A;  2W41 A;  5GAD P;  3TAM A;  4CEZ A;  4FJK A;  1UAX A;  5AQJ A;  5D3G A;  3DLE A;  2ZQB A;  3OYK A;  2Z1H A;  3V6D A;  5FRM A;  2XRI A;  4OPK A;  3ENH A;  3VF6 A;  3THX B;  3E1Y A;  1Q82 O;  4JKE A;  4CZK A;  4CJK A;  1JL2 A;  3CF5 L;  4FLZ A;  4GV6 A;  3ATV A;  3NE6 A;  3LAK A;  5CHI A;  3GG4 A;  2CGK A;  4LF4 K;  4CJE A;  3L8B A;  4DTM A;  3ZEU A;  2ZD1 A;  3KIO A;  4FZY A;  1K73 O;  3T7Z A;  2B4J A;  2DY4 A;  1UWB A;  2G8I A;  3IDH A;  4GMJ B;  4BVP A;  4C8M A;  2BH1 A;  4H0P A;  2BTF A;  2A6A A;  4KH4 A;  4DR7 K;  2VYP A;  4RW4 A;  4BGB A;  3U4L A;  1ZBU A;  3CPW M;  4F2S A;  1W9H A;  3A0I X;  3H1Q A;  4FOE A;  2UXD K;  3VN5 A;  3Q7C A;  2HW3 A;  1LWF A;  3LWM A;  2A42 A;  2XHB A;  2ZGZ A;  2O8E B;  3IRX A;  3SBT A;  4BC2 A;  1VK0 A;  4N47 A;  4KBO A;  4HUF A;  3SJH A;  1JXE A;  2GX9 A;  3MX2 A;  4MQ3 A;  2O8C A;  2YHY A;  1ZYQ A;  3NVK A;  4Z4E A;  3QBX A;  3U3G A;  1D9D A;  3SBG A;  5A2Q O;  3VEV A;  3VEZ A;  4AHC A;  4FM0 A;  2FLO A;  2RN2 A;  1T8E A;  3DXM B;  3VMF B;  1WUA A;  1V4T A;  4M3Z A;  1BHL A;  3RR7 A;  1NBW A;  2A1R A;  4CHY A;  3ZSY A;  3SV4 A;  2HHT A;  4DV6 K;  4FPA A;  3RMB A;  1TVR A;  1IV0 A;  2I7N A;  4FWS A;  4NYF A;  3GDQ A;  5C15 A;  1B92 A;  3CFO A;  4ILH A;  1JCF A;  3FZM A;  3QIO A;  3R9P A;  4E7I A;  4ILJ A;  5AQR A;  1DGK N;  5GAH P;  1C0T A;  4IEE A;  1TUU A;  4JI0 K;  4I2Q A;  4AQY K;  2F8S A;  3OTO K;  4KRE A;  1RBS A;  1QHA A;  2A41 A;  5CYM A;  1S5J A;  1NGH A;  1NJZ A;  4L8R B;  4PQU A;  2PY5 A;  4BGA A;  3BGR A;  1ATN A;  3EL2 A;  3G6E N;  1X3N A;  4DV7 K;  4FJJ A;  2JWL A;  4M3R A;  2YJE A;  4O55 A;  3G4S N;  3OJU A;  2O4G A;  1K8K A;  3KLE A;  5B8H A;  3M6G A;  3TAP A;  1BCO A;  4LF8 K;  4C23 A;  4PWD A;  4J2D A;  4PY5 A;  3P1G A;  2Z1I A;  2VQE K;  5SZT A;  2HBJ A;  1U48 A;  2X78 A;  1BO5 O;  1HPZ A;  1QS4 A;  4MDA A;  5HL7 L;  2WON A;  4JKG B;  2OPQ A;  1ATS A;  5AQV A;  4G9Z A;  3DWL A;  3WQU A;  4CEA A;  4JI6 K;  4HHT A;  1JCE A;  2QWQ A;  5JIC A;  1GOA A;  3AVL A;  4JAX A;  4DUY K;  3AA3 A;  2E1Z A;  4OPA A;  3AVK A;  4BG8 A;  2A40 A;  4PA1 A;  4CJ4 A;  4AM7 A;  2GEM A;  4JKA A;  1OVQ A;  1GLE G;  2HMP A;  5CYQ A;  3OS2 A;  1NGE A;  1FXX A;  3K9J A;  5AQT A;  3U8X A;  4HTL A;  4YDU A;  4M3T A;  1ZBL A;  1IJJ A;  4PHT X;  4B3O A;  4MFB A;  3OYC A;  1SAZ A;  3P38 A;  3VQB A;  3RSE B;  4M3U A;  3P5J A;  3MXI A;  1KFS A;  3SNN A;  2XY8 A;  1HKC A;  4RTF D;  3CJB A;  3T1Y K;  5HRO A;  3THY A;  2NRW A;  5AFU H;  2WFB A;  3CXC M;  3E9L A;  1YTU A;  2P9S A;  4G1Q A;  3U9D A;  1NMN A;  4QCL A;  3OYB A;  2VCP A;  3OHR A;  4EZ9 A;  4DWI A;  3O9Q A;  2HVI A;  3EKU A;  2HF3 A;  4PKI A;  3HXM A;  4IOX A;  4DFP A;  4FJX A;  3ZSR A;  2GTD A;  1OH8 A;  1JL1 A;  3ZSW A;  4N41 A;  1RTI A;  1MWK A;  2OTL N;  3PSF A;  5I3U A;  1S1U A;  3IFR A;  2D4W A;  3I33 A;  3KK7 A;  1RTH A;  5C24 A;  5FPN A;  4CF1 A;  1RFQ A;  4O8U A;  1Q86 O;  4FPB A;  3NHG A;  4F4K A;  3CER A;  5JVG L;  4R5P A;  4BQZ A;  1HJO A;  1NK6 A;  4JI8 K;  4F8R A;  4IWV A;  3EZ5 A;  4OLA A;  4Q5V A;  4K8Z A;  4DSJ A;  3S3O A;  5AQG A;  5AZI A;  5LJW A;  1NGF A;  3A2F A;  4ZHR A;  4PKH A;  4Q0B A;  4BR5 A;  3VQ7 A;  3B6O A;  3WXM B;  3UKU B;  1HNZ K;  4K41 A;  4Z0U A;  1HKB A;  1J9A A;  4IEI A;  3O4Q A;  4BWM A;  4CZL A;  4ZTF A;  2P9I B;  1X9W A;  4KI6 A;  1UA0 A;  4E7K A;  3UIQ A;  3R6M A;  1Q7Y O;  1J54 A;  4JK8 A;  4FWK A;  4IFV A;  4FVU A;  4CZF A;  1HYV A;  4WFA L;  2H3G X;  3VEW A;  2ZJP L;  2KQ2 A;  5BPN A;  2HHH K;  4JKH A;  4RW7 A;  3VF2 A;  4CJV A;  3PX4 A;  3ZEU B;  2QK9 A;  4MLE A;  3O80 A;  4I9L A;  1B9F A;  1U2V B;  4BE1 A;  2E8A A;  2KLA A;  1VQ7 N;  5HP1 A;  4FLT A;  4ICL A;  3L3U A;  4DCH A;  1G99 A;  4DV1 K;  3HVT A;  3BF3 A;  4OO1 J;  3J8A A;  1DEJ A;  2EX3 A;  2HNZ A;  2HHU A;  3MED A;  1A5X A;  1J6Z A;  3A5M C;  3N4P A;  5HBM A;  4HCB A;  2DFF A;  4AHT A;  4YOY A;  4Z94 A;  4O5F A;  3NF7 A;  2PAV A;  2B6A A;  4W5Q A;  3SPY A;  3KLH A;  1QVG M;  3OYA A;  4B9U A;  1NMD A;  1NGA A;  3LZJ A;  4CJ3 A;  4KB1 A;  4O44 A;  4FWO A;  1N33 K;  2E6M A;  4DFJ A;  2FSJ A;  3NGZ A;  3J7A P;  3H3O B;  3TU5 A;  1JLB A;  1GLJ O;  2XO7 A;  4FJI A;  2FF3 B;  5AQM A;  1NWK A;  1DLO A;  1TV6 A;  3VQP A;  3VEO A;  4FK4 A;  2D0P A;  5FPE A;  4H5N A;  1BIZ A;  1TYQ A;  2DPN A;  3HK2 A;  2CH6 A;  4BVO A;  3LL3 A;  4H4M A;  1VSH A;  4KFB A;  4BQL A;  3NCI A;  4CIG A;  5E41 A;  2WOM A;  5C25 A;  5EU7 A;  1HQE A;  3A5N C;  1YTA A;  1TL1 A;  4FWQ A;  4K25 A;  4CBX A;  4I7F A;  3OY9 A;  4CGG A;  2HHS A;  1M1K O;  1TUY A;  3ID8 A;  3F9K A;  3D2E A;  4DV5 K;  1HJR A;  4E7J A;  3HPH A;  2Q0R A;  3SZ2 A;  4JKD A;  1RT1 A;  2QW9 A;  3V81 A;  4FLV A;  3WXL A;  2HNY A;  4WYB A;  5EVZ A;  3CI5 A;  1VSI A;  2QWL A;  4DQ8 A;  1D4X A;  3L2R A;  1DTT A;  3EKS A;  2P9U A;  3LM9 A;  4JHD A;  3SUQ A;  2VG6 A;  3OVN A;  3NF8 A;  1NGB A;  1XUP O;  1BI4 A;  2IS3 A;  2DFH A;  4CJF A;  3KWI A;  1SKW A;  3VET A;  3OYD A;  2YHX A;  1RT7 A;  4CEO A;  3PO4 A;  3JXU A;  3P39 A;  1BCM A;  4DV2 K;  2QKB A;  5KQ8 A;  2YNI A;  3AVM A;  3FZF A;  3AO3 A;  1HUX A;  3HBT A;  1NGJ A;  4DTX A;  3ENB A;  3HM8 A;  1YJN N;  1J5O A;  1ZC6 A;  3DLL L;  1N8R O;  4DV0 K;  4FK2 A;  4CHN A;  4CIE A;  4KTW A;  4I6M B;  3E9O A;  4MO4 A;  2OPR A;  4CD1 A;  4CJS A;  4BRP A;  1YJW N;  1BDG A;  5LL6 Z;  3THY B;  5AQQ A;  1QQC A;  1RDB A;  3VQQ A;  5AZJ B;  5KPT A;  1IG8 A;  1SL2 A;  4FLU A;  3TAQ A;  3S41 A;  1HX1 A;  3F2K A;  1U04 A;  3AAQ A;  3CCJ N;  1YI2 N;  4DMN A;  3HOT A;  1KVC A;  1YXQ A;  4DQR A;  1VQ6 N;  4CJ7 A;  4IOA L;  4NXM K;  3MAQ A;  3O08 A;  1NJY A;  3C6H A;  2W42 A;  4X66 K;  3MN9 A;  3VGL A;  3QFU A;  1GLL O;  3TI0 A;  4PKG A;  3ZX2 A; 
#chains in the Genus database with same CATH homology
 4Z4F A;  2OYQ A;  1TK0 A;  4OJR A;  3KLF A;  1ZBU A;  3H08 A;  4Y1C A;  1C0U A;  3V9U A;  2G8F A;  4F2S A;  4HCC A;  1S1X A;  1W9H A;  2G8K A;  1WAF A;  5HRS A;  2Y1I A;  3VN5 A;  2HW3 A;  3L2W A;  2AJQ A;  1HYZ A;  1LWF A;  3LWM A;  3DYA A;  3QIP A;  2XHB A;  4E19 A;  4EP5 A;  2PYJ A;  1RBT A;  1TK8 A;  2OPS A;  1C1C A;  3IRX A;  4OVL A;  1VK0 A;  1JLQ A;  4OKK A;  4M45 A;  5J2P A;  4N47 A;  2IGI A;  3EY1 A;  4CCH A;  4HUF A;  2FC0 A;  1CZB A;  1JXE A;  4CF8 A;  1BQM A;  4MQ3 A;  3NDK A;  5SWM A;  1BQN A;  1ZYQ A;  1D8Y A;  4FYD A;  3S9H A;  3U3G A;  1D9D A;  4Z4E A;  3ZT3 A;  4KRF A;  3QIN A;  3B6P A;  4AHC A;  1RNH A;  1CZ9 A;  4FM0 A;  2RN2 A;  2QKK A;  3RR8 A;  4QOZ B;  1T8E A;  3NH0 A;  4DTU A;  3WNG A;  3QEP A;  4NCB A;  3CFP A;  1IKV A;  3RTV A;  4M3Z A;  1BHL A;  1UOC A;  3RR7 A;  2A1R A;  3ALY A;  3SUP A;  4CHY A;  3ZSY A;  2BE2 A;  3SV4 A;  1N6Q A;  2HHT A;  1QSL A;  1WAJ A;  3RMB A;  1TVR A;  4CGF A;  4IG3 A;  4JS5 A;  4NYF A;  2FBT A;  1B92 A;  3OYH A;  3D0P A;  3CFO A;  4DTR A;  3TAN A;  3QIO A;  4DQQ A;  1NK7 A;  3TR8 A;  3KKS A;  4E7I A;  4FZZ A;  1HRH A;  3TI0 A;  1C0T A;  2F8S A;  4I2Q A;  4CED A;  1C0M A;  3AV9 A;  4HUE A;  4KRE A;  3AO5 A;  1RBS A;  1IKW A;  2RF2 A;  1LV5 A;  4C8K A;  5CYM A;  3AVF A;  1F21 A;  1S5J A;  1A5V A;  4ID1 A;  3ULD A;  1NJZ A;  3ZSO A;  4CEQ A;  4L8R B;  4FJ9 A;  2PY5 A;  4PQU A;  2HHX A;  3V9S A;  5I42 A;  1U49 A;  1VSJ A;  1NK5 A;  3KD1 E;  3K58 A;  3BGR A;  2B5J A;  1NOZ A;  4W5T A;  4CER A;  3SQ4 A;  1LW2 A;  3O4N A;  1Z26 A;  3QO9 A;  1Z25 A;  4E7L A;  3CM6 A;  2ATQ A;  4W5R A;  4M3R A;  1QE1 A;  4JS4 A;  1VRU A;  3VA0 A;  4FJJ A;  3NAE A;  2Y1J A;  4O55 A;  1HNV A;  4OKJ A;  3OJU A;  2O4G A;  3KLE A;  4LSN A;  1RBR A;  4RW6 A;  3HJF A;  4JLH A;  3TAB A;  3ZT2 A;  3TAP A;  4Z4C A;  1BCO A;  5HRN A;  4OPJ A;  3AVC A;  2Z1G A;  4PWD A;  1TL3 A;  4O0J A;  1ITG A;  3V9Z A;  4FZX C;  4E7H A;  4J2D A;  4Z4G A;  1KFD A;  1VSL A;  5K14 A;  4PY5 A;  3P1G A;  2BGG A;  3C6T A;  3VQC A;  4I9Q A;  3C95 A;  1ZBH A;  4GVM A;  2Z1I A;  3JYT A;  5SZT A;  4KTZ A;  3LWL A;  1U48 A;  2YNG A;  4DTO A;  1BIS A;  2X78 A;  1HPZ A;  4OGC A;  1QS4 A;  3QLH A;  3RMC A;  3AVA A;  2WON A;  3HT3 A;  4DS4 A;  4LD0 A;  5J2M A;  2G8U A;  2OPQ A;  1S1T A;  1KTQ A;  1IG9 A;  1LAW A;  3VQ4 A;  3K5N A;  4M41 A;  4CEA A;  1L3T A;  1XI1 A;  1D9F A;  1TAU A;  2D0C A;  4HHT A;  3ZT0 A;  1GOC A;  1GOA A;  3AVL A;  3LP0 A;  4CGJ A;  1O1W A;  1GOB A;  1ASW A;  4FXD A;  1WSJ A;  3AA3 A;  3NH1 A;  3MEC A;  4CJW A;  3AVK A;  2YKN A;  4PA1 A;  4CJ4 A;  3RRH A;  1JLG A;  4HVJ A;  1DTQ A;  4O5B A;  1KRP A;  2P51 A;  5CYQ A;  3OS2 A;  1T7P A;  5JS2 A;  4M3W A;  1S9E A;  1WSG A;  1S9G A;  3TAG A;  3S3N A;  3V9X A;  3TAF A;  2PZS A;  1FXX A;  5KGX A;  1LWE A;  3K5M A;  3IG1 A;  1IKX A;  4E1M A;  1LAV A;  3SI6 A;  3KJV A;  3HYF A;  4GW6 A;  4M3T A;  4HTU A;  1ZBL A;  2Z1J A;  3DM2 A;  4BWJ A;  3ASM A;  3ZSV A;  4CF0 A;  4J2A A;  4B3O A;  3HP9 A;  4MFB A;  4RW9 A;  3OYC A;  5J2Q A;  4BE2 A;  3AVG A;  3EYZ A;  1NKE A;  1Q8I A;  3AVJ A;  4DF8 A;  4QAG A;  3VQB A;  1RT3 A;  1BIU A;  2KFZ A;  4M3U A;  4IFY A;  1SUQ A;  5CZ2 A;  1TK5 A;  3P5J A;  3NFA A;  2IC3 A;  3HO1 A;  3MXI A;  3DRP A;  3D45 A;  4B08 A;  1KFS A;  3SNN A;  3MXM A;  3VQA A;  3L2U A;  2XY8 A;  3DLR A;  1I3A A;  3M8P A;  1T05 A;  3K5L A;  3RMD A;  1VSD A;  5HRO A;  4NYN A;  1KVB A;  3V1R A;  4N5S A;  1TKD A;  3VQ6 A;  3ZSZ A;  3O3G A;  1YTU A;  4G1Q A;  4DTJ A;  4DTN A;  1JLA A;  3MXJ A;  4FJL A;  3OS0 A;  3E01 A;  3CYM A;  4Y1D A;  4DFM A;  4DSK A;  3OYB A;  4IKF A;  4QCL A;  4Z4H A;  4EZ9 A;  4O4G A;  2IAJ A;  1G15 A;  1NK8 A;  4JRQ A;  3K57 A;  3DOK A;  2HMI A;  5CY4 A;  4DWI A;  3RWU A;  5KI6 A;  2NUB A;  1C6V A;  4I2P A;  4OLB A;  1RT6 A;  2XY6 A;  4CHP A;  1J53 A;  4LSL A;  4CF9 A;  2VWJ A;  3HXM A;  4ELU A;  4OKE A;  4DFP A;  4C8L A;  4FJX A;  3ZSR A;  4J2B A;  4B9N A;  4B9S A;  1VSE A;  1X1P A;  1JL1 A;  4FLW A;  2X6S A;  3DLB A;  3C6U A;  3ZSW A;  4YFU A;  1RTI A;  3RRG A;  4N41 A;  3M8S A;  3QNN A;  3HL8 A;  4DQI A;  3PUF A;  5I3U A;  1S1U A;  3AVI A;  3LP1 A;  1RBU A;  2KZM A;  3HVR A;  1ASU A;  1VSM A;  2E6L A;  3IS9 A;  1JLC A;  3VQD A;  4CK1 A;  5J1E A;  1RTH A;  5C24 A;  4K8X A;  4CF1 A;  4DSF A;  1QSY A;  1ASV A;  4LY7 A;  2D5R A;  4E89 A;  4JRP A;  4CEC A;  3NHG A;  4F4K A;  3QES A;  1CXU A;  4R5P A;  1TKT A;  4TSX A;  1NK6 A;  2ZE2 A;  1CLQ A;  3SQ0 A;  1VSK A;  4B9V A;  2ETJ A;  3ZSX A;  3M8R A;  4F8R A;  4AHS A;  3K5O A;  5FRN A;  3EZ5 A;  1EET A;  1WSH A;  1WNS A;  4OLA A;  4Q5V A;  4K8Z A;  3PO5 A;  4DSJ A;  3S3O A;  4RG8 A;  1HMV A;  4KI4 A;  3A2F A;  4ZHR A;  1EXQ A;  3LPT A;  3NBP A;  4Q0B A;  3S3M A;  4KHU A;  3VQ7 A;  3PX0 A;  4CEE A;  3B6O A;  4FVM A;  3LAL A;  4W5N A;  3AVN A;  4BE0 A;  4E1N A;  1IKY A;  4CJQ A;  2D0A A;  2YHB A;  1XHX A;  4NCA A;  4CJU A;  3SV3 A;  2OPP A;  1RDD A;  4DU3 A;  4Z0U A;  1SKS A;  4DLE A;  3MEE A;  4KHW A;  1J9A A;  3G0Z A;  2HND A;  3O4Q A;  2FBY A;  4BWM A;  4DU4 A;  3DMJ A;  2A1S A;  3VQE A;  2G8V A;  4ZTF A;  1L3U A;  3LAN A;  5DK5 A;  4B8C A;  3PV8 A;  3SUO A;  1X9W A;  4KI6 A;  1UA0 A;  4DLG A;  4E7K A;  3DOL A;  3U3Y A;  1ZBF A;  2EHG A;  3UIQ A;  4CGH A;  3SJJ A;  3T3F A;  1A5W A;  1BL3 A;  4BDY A;  4DTP A;  1J54 A;  3OYN A;  4H4O A;  1MU2 A;  4IFV A;  4KO0 A;  4CFA A;  4DU1 A;  2X74 A;  4FW2 A;  1HYV A;  3ZSQ A;  4CK3 A;  1JLE A;  2KQ2 A;  1RT2 A;  3LP2 A;  3NF6 A;  1S1W A;  4RW7 A;  1HYS A;  4CJV A;  3PX4 A;  3O3H A;  1NK0 A;  1RTD A;  1TGO A;  2HHQ A;  3ZT1 A;  4CF2 A;  3LDS A;  1RTJ A;  2QK9 A;  4I9L A;  2IDO A;  3QER A;  3QEX A;  1B9F A;  3HP6 A;  1S6Q A;  3DRS A;  4BE1 A;  1C1B A;  2BDP A;  3U6F A;  3KD5 E;  4CEF A;  5HP1 A;  4FLX A;  3MEG A;  4FLT A;  1JKH A;  1IH7 A;  4ICL A;  3L3U A;  4XIU A;  1B9D A;  4FLY A;  2YKM A;  1RDC A;  4CHQ A;  4DSL A;  1R0A A;  3L2Q A;  3SQ2 A;  2D0B A;  3HVT A;  4LH4 A;  1WSF A;  4DSI A;  1S1V A;  3WNE A;  3JSM A;  2X6N A;  4YNQ A;  1HQU A;  3QEW A;  4B9L A;  2EX3 A;  2HNZ A;  1RDA A;  2HHU A;  3MED A;  3LPU A;  1FKO A;  1A5X A;  4CIF A;  5HBM A;  2HB5 A;  1TKZ A;  3IAY A;  4HCB A;  1LW0 A;  2DFF A;  4FJ7 A;  4EP4 A;  4AHT A;  5FRO A;  4FJN A;  4FJ5 A;  1EP4 A;  1YT3 A;  3V9W A;  2YHA A;  5KRS A;  3NF7 A;  2B6A A;  3LP3 A;  1RIL A;  4CFB A;  3C94 A;  4W5Q A;  3KLH A;  4DF4 A;  3SPY A;  4F3O A;  2HHV A;  4FW1 A;  1XWL A;  4AHV A;  4CJP A;  3WNH A;  3OYF A;  3OYA A;  5J2N A;  4F2R A;  3NH2 A;  4B9U A;  1S6P A;  3LZJ A;  2G8W A;  4BDP A;  4CES A;  4ID5 A;  4CJ3 A;  4KB1 A;  2FBX A;  4CE9 A;  4IG0 A;  4O44 A;  4DQP A;  3TAE A;  2E6M A;  3KK3 A;  3ZCM A;  4DFJ A;  1I39 A;  2OA8 A;  2YNH A;  4UQG A;  3OYL A;  3AA5 X;  3V1O A;  1YVU A;  5DMR A;  5HLF A;  3NGZ A;  1RCH A;  3CFR A;  3VQ9 A;  3SYZ A;  2XY7 A;  4J2E A;  1NJW A;  3KTQ A;  4E0D A;  3DLG A;  1SV5 A;  1Y97 A;  3SPZ A;  1WSI A;  1JLB A;  3DI6 A;  4IDK A;  4W5O A;  3BDP A;  3SCX A;  2XO7 A;  4DSE A;  4FJI A;  2P1J A;  1DLO A;  4F3T A;  1REV A;  1TV6 A;  5C42 A;  1EKE A;  2GV9 A;  4BAC A;  3VQP A;  1FKP A;  2LSN A;  4CHO A;  2KTQ A;  5HRR A;  3DLH A;  4LH5 A;  1U47 A;  2O4I A;  1KSP A;  4FK4 A;  3NF9 A;  1BIZ A;  4RW8 A;  3K59 A;  2F8T A;  3RMA A;  4AHR A;  3HK2 A;  3OYG A;  3ITH A;  3KK2 A;  1NKC A;  4PUO A;  1TKX A;  4H4M A;  2RKI A;  5KTQ A;  2HHW A;  4CHZ A;  1BI4 B;  3QEI A;  1L3S A;  3AO4 A;  1VSH A;  4KFB A;  3LZI A;  3L3V A;  3NCI A;  2VG5 A;  4KV8 A;  4CIG A;  5E41 A;  4IBN A;  2JGU A;  3KLI A;  5JS1 A;  2WOM A;  2RPI A;  1CXQ A;  5C25 A;  3VQ5 A;  3I8D A;  5FDL A;  1RT4 A;  2PYL A;  1HQE A;  5EU7 A;  1T03 A;  3ISN C;  1YTA A;  1TL1 A;  2XY5 A;  1L3V A;  2I5J A;  4I7F A;  3SQ1 A;  1RT5 A;  3OY9 A;  3HM9 A;  4KHQ A;  4KB0 A;  4Z4I A;  4CGG A;  4KHS A;  4O0I A;  2HHS A;  5KGW A;  1QSS A;  1D5A A;  3F9K A;  3TWH A;  1SKR A;  3DLK A;  2IOC A;  2Q3S A;  4C8N A;  4FJH A;  3TAR A;  1SL0 A;  1Q9X A;  1HJR A;  3OYE A;  3HPH A;  4E7J A;  4FM2 A;  4FCY A;  1QTM A;  2JLE A;  3SZ2 A;  3OYI A;  2DTU A;  1RT1 A;  3V81 A;  4KKO A;  4CFD A;  3OYM A;  4FLV A;  2BAN A;  4M3Y A;  1N5Y A;  2G8H A;  1NOY A;  2HNY A;  4FJ8 A;  4N56 A;  3HPO A;  1VSI A;  4DFK A;  4N76 A;  4M3X A;  1W0H A;  4CFC A;  3ZT4 A;  3F73 A;  3L2R A;  1DTT A;  4CGI A;  3P83 D;  1HNI A;  3AVH A;  1Q9Y A;  3SUQ A;  4FM1 A;  2VG6 A;  3OVN A;  3NF8 A;  3NGI A;  1BI4 A;  1WSE A;  2IS3 A;  2DFH A;  1U4B A;  4CJF A;  3KLG A;  1NJX A;  1SKW A;  3QET A;  3OYD A;  4FK0 A;  4CEB A;  3KKR A;  2R7Y A;  3VA3 A;  3SUN A;  2P5G A;  4FJG A;  1RT7 A;  4HUG A;  2YNF A;  4CEO A;  1SL1 A;  1NKB A;  3PX6 A;  3PO4 A;  4C8O A;  4ELV A;  1QHT A;  2P5O A;  3OYJ A;  2HVI A;  3G10 A;  3I0R A;  3VQ8 A;  1BCM A;  2DFE A;  2QKB A;  4CGD A;  2E4L A;  1NK9 A;  4AH9 A;  3AA2 A;  2YNI A;  1TAQ A;  4WE1 A;  2KZZ A;  3AVM A;  1K6Y A;  1L5U A;  4ELT A;  1EX4 A;  4KTQ A;  1KVA A;  4CJL A;  3AO3 A;  3K2P A;  4KHN A;  1WN7 A;  3LAM A;  2KFN A;  1NK4 A;  4KAZ A;  3OJS A;  1JLF A;  4CK2 A;  3QNO A;  1U45 A;  5KRT A;  1KLM A;  4DTX A;  3CG7 A;  1RBV A;  2F96 A;  1UA1 A;  4H8K A;  1JXB A;  3CM5 A;  4E3S A;  1X9S A;  1XC9 A;  1VSF A;  3T1A A;  4DG1 A;  4OGE A;  1J5O A;  3TAM A;  4CEZ A;  4FJK A;  1LWC A;  1UAX A;  3V1Q A;  1KCF A;  4DS5 A;  4FK2 A;  5D3G A;  4CHN A;  4CIE A;  3THV A;  3DLE A;  3T19 A;  4KTW A;  2ZQB A;  3V4I A;  3OYK A;  3L2V A;  2OPR A;  4CJT A;  3CQ8 A;  3AVB A;  4BDZ A;  2HVH A;  5CZ1 A;  2Z1H A;  4CJS A;  3V6D A;  5FRM A;  1C1A A;  2XRI A;  4OPK A;  4DQS A;  2VG7 A;  3WNF A;  4B8A B;  1QQC A;  1RDB A;  3VQQ A;  1SL2 A;  4B9T A;  4AHU A;  2OZS A;  4M42 A;  1FK9 A;  4FLU A;  3HPG A;  3FFI A;  3TAQ A;  4NCG A;  3NGY A;  4CJK A;  4B9M A;  2GUI A;  1VRT A;  1JL2 A;  4KHY A;  5T7B A;  4EZ6 A;  3AA4 A;  1U04 A;  4FLZ A;  2QXF A;  3PY8 A;  4CJ5 A;  3LAK A;  3NE6 A;  1WLJ A;  4DMN A;  3OS1 A;  3M8Q A;  3DRR A;  4CJE A;  1KVC A;  3L8B A;  4DTM A;  4DQR A;  2GBZ A;  2ZD1 A;  4ZTJ A;  1KLN A;  3KIO A;  4FZY A;  4FJM A;  2B4J A;  2DY4 A;  3AO2 A;  3AO1 A;  1UWB A;  3MAQ A;  1XHZ A;  4AIL C;  2G8I A;  4KPY A;  3I0S A;  3HST B;  2YV0 X;  1BGX T;  4GMJ B;  3KK1 A;  1X9M A;  1NJY A;  4DTS A;  4C8M A;  2W42 A;  4CJR A;  2FBV A;  2VWK A;  1ZBI A;  5HRP A;  3O3F A;  2ITG A;  2OZM A;  2KW4 A;  1IO2 A;  3QEV A;  4RW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...