4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
1EKEA 4B9MA 1S1WA 4YNQA 2HVHA 4CHZA 2JGUA 3SYZA 2G8FA 3L2VA 2G8HA 3NGZA 4N5SA 4W5QA 3CFPA 3DLHA 3DYAA 4CEQA 3K2PA 1A5WA 2QK9A 4F8RA 1RDDA 3DOKA 4B3OA 5CYQA 3VQDA 3L2QA 4PY5A 1BCOA 1A5XA 3P83D 4CJVA 1TL1A 4DLEA 1QSSA 1RTDA 4ID5A 4O44A 4FLXA 1NOZA 2B6AA 2B5JA 3D0PA 1BISA 1LWCA 2VG5A 1CLQA 1YVUA 4CESA 4DFJA 2JLEA 2BE2A 3JYTA 3S9HA 3TI0A 1ASWA 4AILC 4QCLA 4PUOA 2Q3SA 3HP6A 1RTHA 3ZSZA 4E1NA 4DG1A 1KTQA 2GUIA 5KRTA 4XIUA 3LDSA 4DTOA 1FXXA 3AO5A 4OVLA 4CGIA 4CJLA 3RMCA 4KHWA 3SPZA 4AH9A 3SUQA 2Z1HA 3CFOA 2HNDA 4E0DA 1BQMA 3KTQA 3V6DA 4PWDA 4OKJA 4BDYA 3DLBA 2YNIA 1NKCA 4PQUA 1S1TA 4BE2A 1R0AA 4NYNA 2ZE2A 2D0AA 1B92A 4CEBA 1JLBA 2PYJA 2BGGA 4RW4A 3EYZA 5FDLA 4N76A 1IH7A 3P5JA 3VQAA 4B9VA 3HPHA 4RW9A 4CHYA 4CIGA 4E7IA 2FBTA 1D9DA 1Q9XA 1JLAA 2PY5A 2NUBA 2HHVA 1RCHA 2X78A 3WNGA 2FBYA 3M8PA 1HJRA 4FLVA 1RBRA 4CEDA 1HRHA 1RT3A 3AA4A 1ZBFA 2YKNA 3HXMA 1B9FA 1KVBA 4DSIA 4Z4GA 5J2MA 2OPRA 4BWJA 3SQ0A 2IOCA 5HRNA 4CEZA 4CEAA 3LANA 1NJYA 4B9LA 1U4BA 4B08A 4B8AB 5KRSA 3L2RA 5SWMA 1XHZA 3AO1A 3OJSA 4QAGA 3OYMA 2A1SA 1O1WA 1RT1A 1W9HA 2X6SA 3AVBA 3DRSA 4OKEA 1K6YA 3EZ5A 1SL2A 4DSLA 4HCCA 3MXJA 1NKBA 3SUPA 4EZ9A 3DLRA 2XY7A 4G1QA 3HM9A 4E3SA 4KREA 3NF6A 1HQEA 4MQ3A 2RF2A 4FM0A 5HROA 3ZSVA 4KAZA 4FJXA 3WNHA 3PX4A 5D3GA 4E7KA 3DLGA 1SL0A 4O0IA 3C6TA 3V1OA 2RN2A 1RNHA 5KI6A 3V9XA 4DTPA 5J2NA 4CJFA 2VG7A 3U6FA 5HRSA 4KHSA 3M8QA 4GMJB 4FK4A 1IO2A 1HQUA 4IBNA 1JLEA 4W5OA 3BDPA 4B9UA 4DTJA 4I9QA 4C8MA 3HPOA 3SV3A 4EP5A 4KTQA 2G8KA 3O3FA 1JKHA 1HYVA 4M3WA 1S1XA 4E7JA 4DFMA 2R7YA 3MEEA 4Y1CA 3TABA 4OGEA 3VQ5A 4JRQA 3L8BA 3G0ZA 2ZD1A 5CZ2A 4CK2A 1VSJA 1SKSA 1RDCA 1J54A 1U04A 2D0BA 4EP4A 1JXEA 5KGXA 3PX0A 2KTQA 1KLMA 1RBTA 4OPJA 4DS4A 3T3FA 2XY5A 2HHXA 4CF1A 3H08A 1TKZA 2DFHA 4NCAA 4LSLA 4H4MA 3SUNA 1TK5A 1JLCA 2Z1IA 1D8YA 4LH5A 4CGFA 3SUOA 3M8RA 5I3UA 5FROA 4AHUA 4DU1A 1Z25A 2VG6A 1VK0A 4I2PA 5KGWA 3O3GA 3AA3A 4BE1A 3SJJA 4IFVA 1NK4A 1X9MA 4ELTA 1DTTA 1JLQA 2ETJA 3ULDA 4Z4FA 4M45A 1HYZA 4FJ8A 4DSKA 4OPKA 4KO0A 4B9NA 3OYEA 3OY9A 4DFPA 4I2QA 3VA3A 1D9FA 3ZT4A 1JLFA 4KKOA 5KTQA 2QKKA 4M3UA 4Z0UA 2HHSA 3OS2A 2DTUA 4C8NA 3ZCMA 3V9WA 2EX3A 3UIQA 2HB5A 4Z4IA 4CGHA 4ZTJA 4L8RB 2E4LA 4DTNA 4ICLA 4M3YA 3I0RA 3QIOA 4R5PA 4AHVA 4E7LA 4F2RA 3PY8A 4KTWA 3G10A 3IS9A 3ISNC 2I5JA 3NF8A 4JS4A 1KLNA 4CGGA 1ITGA 4DLGA 3U3GA 4HVJA 2XO7A 4HUEA 1I3AA 1NK5A 4DSJA 3QESA 3S3MA 1EP4A 5HRRA 1SKWA 4F4KA 2O4GA 4J2AA 3AA5X 1TV6A 4FM1A 3QETA 1UOCA 3AVHA 1NK7A 4FJ9A 4FYDA 1IKVA 5K14A 2KW4A 3RR7A 4CJUA 3QINA 3DRRA 3LP3A 5E41A 3AVNA 4RG8A 4FCYA 3KJVA 1S6PA 1SKRA 4F3TA 3AVCA 1RTIA 2IS3A 5DMRA 1LWEA 2HHWA 4W5NA 3NH0A 4CEEA 4FJJA 1Y97A 4O5BA 2P5GA 1IKXA 1JL1A 1LAWA 2QXFA 3NGIA 2RKIA 3KKRA 3OYIA 3OYJA 3KKSA 3VQ9A 4BACA 4CE9A 3NCIA 1D5AA 1L5UA 4FJHA 1BHLA 4CFCA 2F8SA 5SZTA 3OYLA 4K8ZA 1XI1A 4OLAA 1ASUA 1RTJA 2Z1GA 4MFBA 3IAYA 1RT7A 4DTSA 4AHTA 1QE1A 2WONA 2Z1JA 1VSMA 3AO4A 4GVMA 3V81A 3LZIA 2B4JA 4LSNA 3ZT3A 3I8DA 3QEPA 3WNEA 3RMDA 4QOZB 4KRFA 2HW3A 3SQ4A 4HHTA 1IKWA 1WSHA 2HVIA 3TAGA 1RT5A 3AO3A 1HNVA 4CGDA 1QQCA 3U3YA 1HNIA 2YNGA 3CG7A 1JL2A 3LWMA 1BI4B 2HNZA 4Y1DA 2F8TA 3VQ6A 3AVIA 4FJ7A 1VRUA 4W5TA 4NCBA 3LALA 3CQ8A 1WSGA 4KHYA 3DM2A 3VQ4A 2YHBA 4RW7A 1WN7A 2P51A 4PA1A 4KPYA 1QS4A 1T05A 2GBZA 3C6UA 4FLTA 1N6QA 4KV8A 3VQ8A 3LP2A 3TAPA 3MEGA 4JS5A 4HUGA 3HT3A 3AVLA 1RDAA 1TVRA 2BANA 3B6PA 3NF9A 4CJEA 3OYAA 3TWHA 3MXIA 1TK0A 1NJXA 4CK1A 4CJRA 3WNFA 4Z4EA 1TKXA 3OVNA 1C1AA 3KLGA 1ZBUA 4ZHRA 4Q5VA 3OYBA 1KFDA 1C6VA 4FLYA 3C95A 2OPPA 3AVGA 3HSTB 4CJWA 4FZXC 1FKPA 5JS2A 4W5RA 3TANA 4KHNA 4M3TA 3B6OA 3DI6A 5EU7A 3ZSXA 4E89A 1KVAA 4UQGA 3AVMA 4FZYA 3RMAA 2YHAA 1NOYA 3NGYA 1NK0A 3OYKA 3SNNA 5HLFA 2FBXA 4AHCA 4Q0BA 4CEFA 1L3UA 1S1UA 2W42A 3NBPA 1CZ9A 3DRPA 4E19A 4C8LA 4GW6A 1J5OA 1FK9A 4FXDA 3DOLA 5C24A 1U48A 5CZ1A 1FKOA 4ID1A 2HHUA 1BIUA 4BWMA 3OYFA 3NAEA 3RR8A 4DQSA 1A5VA 4FM2A 4YFUA 4DQQA 3VQ7A 3KLEA 5FRMA 1TK8A 2WOMA 3V9ZA 3OYDA 3KLFA 3K5LA 2G8WA 1WNSA 4CHNA 1Q9YA 4JRPA 2OZSA 1LWFA 3K57A 4HCBA 4DF4A 2O4IA 4CJSA 4BDZA 2XRIA 4EZ6A 4KTZA 1DLOA 1TGOA 4KHQA 1NK6A 3RRGA 2P5OA 3VQQA 4KB0A 4Z4HA 1C1CA 4CK3A 1WSEA 4O55A 3OYGA 3L2WA 3SZ2A 2Y1JA 2ZQBA 1UA0A 2D5RA 3ALYA 1CXUA 1YT3A 3AV9A 3K5NA 4N56A 3T1AA 2XY8A 4OJRA 3QNNA 2ATQA 1EX4A 3MEDA 4FW2A 1T03A 4LY7A 1QTMA 4FK2A 3F73A 1QHTA 4DWIA 3PUFA 2XHBA 3KD5E 2KFNA 4H4OA 4OLBA 3OYCA 1J53A 4BDPA 3HVTA 3D45A 1LAVA 4CJPA 3PO4A 3KK1A 1U49A 5CY4A 4F3OA 4IDKA 3AVFA 3OYHA 2G8UA 2KZZA 1REVA 1TAUA 3VQBA 1KFSA 1BIZA 1NJWA 1W0HA 3NHGA 3CYMA 1L3VA 1JXBA 1LW2A 4FLZA 5JS1A 3KK2A 1BCMA 2P1JA 2VWKA 2YKMA 3VQEA 3LPUA 4LH4A 3ZT2A 4CIEA 1X9SA 1L3TA 4ELVA 4DTRA 4O4GA 3NH1A 3HL8A 2E6MA 3RRHA 1UA1A 3OS1A 1KRPA 1B9DA 2IAJA 1F21A 1I39A 4JLHA 4E1MA 3QEVA 2QKBA 4CFBA 1TAQA 4N41A 1WSIA 2PYLA 1EXQA 3HK2A 2F96A 3AVJA 3IG1A 3V1QA 3JSMA 1IKYA 5J1EA 4CF2A 3SV4A 3PO5A 1Q8IA 4K8XA 4J2BA 4FJKA 4M42A 3IRXA 4NYFA 3NF7A 4FK0A 3LAMA 4Z4CA 2X74A 4KI4A 4CECA 3QIPA 2HHQA 4J2EA 4H8KA 1WSFA 3ZSYA 4CIFA 1J9AA 1C1BA 3AO2A 1RDBA 3TAMA 3OS0A 4FLWA 4F2SA 4CF0A 3O4QA 2PZSA 5FRNA 1QSLA 3V9UA 4IG3A 1TL3A 2IGIA 3ZSOA 4CJ5A 1UAXA 3HYFA 4CGJA 3NDKA 1BGXT 2IDOA 4M41A 4IFYA 1YTAA 3AVAA 4DFKA 2OA8A 1NKEA 3SPYA 1VSIA 1VSDA 2OPSA 2G8VA 3HP9A 4TSXA 3LP0A 3SQ1A 3S3NA 4BE0A 4M3XA 1S5JA 4CFAA 2VWJA 2E6LA 4DTMA 3ZSRA 1ZYQA 1QSYA 1X1PA 1LW0A 4DMNA 1GOCA 2DFFA 1RT4A 4FVMA 1SL1A 3HPGA 3V1RA 3L3UA 1RBUA 1UWBA 4FLUA 3HVRA 3QNOA 1X9WA 4CERA 4B9SA 2AJQA 5CYMA 4CFDA 4HUFA 5C42A 3TAFA 1SV5A 1SUQA 4FW1A 2KQ2A 3QO9A 1WLJA 3AVKA 4CJKA 2A1RA 1VRTA 4KHUA 1DTQA 1Z26A 1TKDA 1S9EA 3E01A 4M3ZA 4CHOA 4DSFA 1HMVA 4N47A 1L3SA 1VSLA 3A2FA 4DQPA 3QERA 4ZTFA 2GV9A 4RW6A 3HO1A 3QEXA 2OPQA 3CM6A 4DS5A 3CM5A 4HTUA 1RT6A 2LSNA 3PV8A 5C25A 5HRPA 1RILA 4E7HA 3SQ2A 3RTVA 3C94A 4DQRA 1VSKA 4CF9A 5HP1A 1RBVA 2HNYA 3T19A 1G15A 4CJTA 3BGRA 4C8KA 3FFIA 1VSHA 2FC0A 4DTUA 3S3OA 1JLGA 2KZMA 3VQPA 1LV5A 3MAQA 3AA2A 3LAKA 1NK8A 3DLKA 4C8OA 1HYSA 3QLHA 2HMIA 2ITGA 2XY6A 2X6NA 5J2QA 1XC9A 1C0MA 3EY1A 3VQCA 1HPZA 1CXQA 1KCFA 4CJQA 4DF8A 3KLIA 3DLEA 1BQNA 1WSJA 4OKKA 3CFRA 1XHXA 4CHPA 3THVA 5DK5A 4KB1A 1ZBIA 1ZBHA 3KLHA 1ZBLA 4M3RA 3K5MA 1MU2A 1WAFA 1BL3A 1EETA 3RMBA 1WAJA 4CEOA 3TARA 1IG9A 2OZMA 4NCGA 2G8IA 3M8SA 3MECA 1XWLA 4CCHA 3KIOA 3MXMA 4CJ4A 1RBSA 3I0SA 4FJIA 4KFBA 4CJ3A 1VSEA 5T7BA 3TAQA 3KD1E 2DY4A 3DMJA 3OJUA 1GOBA 3NH2A 3QEWA 1T7PA 1TKTA 3ITHA 1U45A 3KK3A 3NE6A 4DU4A 1NK9A 1ASVA 1VSFA 4DSEA 4FJNA 4O0JA 2Y1IA 4DQIA 1S6QA 2D0CA 2YNFA 4I9LA 3L3VA 3K59A 4FJGA 2BDPA 2HHTA 2RPIA 3P1GA 5I42A 1BI4A 3SCXA 1N5YA 3O3HA 3ZSQA 3V9SA 4LD0A 4FJLA 1GOAA 3LWLA 5HBMA 3NFAA 4FJMA 4AHRA 4CF8A 4B8CA 3VN5A 3LP1A 3VA0A 3ZT0A 3SI6A 1KSPA 3O4NA 2KFZA 3V4IA 3TAEA 1U47A 3F9KA 4J2DA 3OYNA 1RT2A 2OYQA 1YTUA 3HJFA 4RW8A 1S1VA 2YNHA 3ASMA 4WE1A 3L2UA 3K58A 4DTXA 1NJZA 1C0TA 3QEIA 4FJ5A 3PX6A 4CHQA 4OGCA 1KVCA 3RWUA 4KI6A 4I7FA 3ZT1A 2YV0X 1CZBA 2FBVA 3LPTA 1C0UA 4AHSA 4ELUA 4B9TA 4IG0A 4DU3A 4IKFA 1T8EA 3TR8A 3K5OA 3ZSWA 3LZJA 1S9GA 2DFEA 2IC3A 2EHGA 5J2PA 4FZZA
chains in the Genus database with same CATH superfamily
3ZLJA 4B9MA 4YNQA 4N5SA 4W5QA 1YHQN 3DLHA 4WFBL 2IVPA 4CEQA 2QK9A 4B3OA 1RDDA 3DOKA 4C1NI 4PY5A 1JJ2M 1RTDA 4O44A 1BISA 2VG5A 4CESA 2JLEA 3MCAB 2NLXA 3S9HA 3H1VX 1ASWA 4PUOA 3HP6A 1I94K 5KRTA 4DG1A 1KTQA 4XIUA 4ILGB 3LDSA 2YCHA 2JWLA 2D0PA 4OVLA 4CGIA 4CJLA 2D0OA 3O9RA 4BR2A 3CFOA 4E0DA 2KKZA 3V6DA 5A2QO 3LM2A 2J4RA 2PFUA 4LFAK 3T1HK 4CEBA 1JLBA 2BGGA 4N76A 3R1XA 1IH7A 3P5JA 3HPHA 3O08A 1YITN 3THXB 2VCPA 4E7IA 4IOXA 2FBTA 3VTIA 1BWFO 1LCUA 4B3TK 3W3DA 3WNGA 3M8PA 1HNWK 1RBRA 4CEDA 1HRHA 3CJ7A 1KVBA 1BU6O 4DSIA 4BR0A 4BWJA 4BRQA 3VF6A 4CEZA 2P9PB 2QWMA 4CEAA 4EHUA 3OBYA 4Y0WA 5KRSA 3UKRB 3L2RA 1XHZA 3AO1A 5MLCQ 4A57A 1U6ZA 1W9HA 2X6SA 1SL2A 4CD1A 3S41A 3MXJA 3SUPA 3CC4N 3CJ9A 4PKIA 4KAZA 4FJXA 4OO1J 3CETA 4BQZA 3GL1A 2VGMA 3KZBA 3C6TA 5J2NA 2RN2A 1RNHA 3D6RA 5KI6A 5FRMA 2VG7A 3U9ZA 4GMJB 4GKJK 4IBNA 3BDPA 4B9UA 4I9QA 2FSJA 4KTQA 5AR0A 2O8DB 1JKHA 1ATNA 4WFNL 4OGEA 3BEXA 4JRQA 3L8BA 3F2KA 1NM1A 4OPJA 3H3NO 3T3FA 2XY5A 2HBMA 4FSVA 3H08A 2F9WA 4QS8A 1TK5A 2JWKA 5I3UA 5DM7L 4DU1A 4QS7A 4K43A 3A5LC 3THXA 4ELTA 4B3MK 4M45A 4FJ8A 4CI6A 4JK9A 3F9MA 2UUAK 1EO1A 3OYEA 4DFPA 3ZT4A 3G25A 2P9KB 4M3UA 3OS2A 4C8NA 4JKAA 3EO3A 3PLAA 2E4LA 4M3YA 1YJWN 2P9PA 4MDAA 1KC8O 1I3AA 2A5XA 3O1WA 3AVHA 3LDPA 3R6MA 4FJ9A 3SLCA 4CJUA 3DRRA 1S6PA 3AVCA 1RTIA 2ASMA 2IS3A 4W5NA 2P5GA 3NGIA 3KKRA 4BGBA 4BACA 3QBXA 4JNEA 2O8DA 3ZX0A 4OLAA 1YI2N 3IAYA 2QWNA 5ADXH 1RT7A 4DTSA 3QICA 1QE1A 2WONA 1VSMA 3EZWA 3V81A 5CE3A 3LZIA 1IG8A 3RMDA 5JLFA 4WFAL 1IKWA 4CZGA 5F1XA 4HHTA 2HVIA 3VF2A 3AO3A 4CGDA 3U3YA 3EKUA 4A2BA 4CBWA 1JL2A 1GLDG 3AARA 4W5TA 3J7ZO 3OW2M 3MX2A 3VQ4A 4G9ZA 2P9LB 4PKHA 1N6QA 1QVFM 3LP2A 1J6ZA 3MEGA 4U7BA 3B6PA 4C1NK 2QW9A 4CJRA 2P9KA 4FO0A 4Q5VA 5EY4A 3C95A 2HBJA 1FKPA 2E2QA 3B6OA 3CHWA 1NGJA 2YHAA 1NOYA 4K42A 5HLFA 2ZF5O 5AQMA 4CBUA 3LL3A 5LJVA 3E1YA 3TTFA 1U48A 1OH8A 5CZ1A 1FKOA 3EE9A 4DQSA 5AFUA 4YFUA 4FWMA 3VQ7A 1VQ4N 3KLEA 4CZMA 5KPRA 3V9ZA 4LF7K 5GINA 4CZIA 5EXWA 1Q9YA 3SJHA 4JRPA 2XRIA 4H5WA 2GUPA 2V7YA 4KB0A 4Z4HA 3L2WA 4QOZB 1WSEA 1Z05A 4PKGA 3K5NA 3ZX3A 4JD2B 2XY8A 4MLEA 1HPMA 2ATQA 1OH5A 4FK2A 4I6MB 1QHTA 5AJ3K 3PUFA 3KD5E 2KFNA 3OYCA 3HVTA 3OYHA 2P9LA 1KFSA 5C0YA 1O13A 1QZ5A 2VWKA 2YKMA 3VQEA 3OBWA 4LH4A 3C6AA 4M7YA 1NGCA 4O4GA 4FWOA 2E6MA 3RRHA 1UA1A 1WBDA 4DKWA 4OPHA 4N41A 2UXDK 5JLHA 4FJIA 5J1EA 4CF2A 4CZLA 4FJKA 4O8KA 4JKHA 4CECA 4KH5A 4K25A 1WSFA 1HX1A 1RDBA 3P39A 3O4QA 2PZSA 3WXJA 4CJ5A 1E3MA 3O4WA 1UAXA 4JK8A 1BGXT 5KQ8A 1YTAA 3AVAA 1NBWA 4AM7A 3T1YK 1DEJA 4M3XA 1S5JA 4DV7K 4DTMA 3ZSRA 1WBBA 1LW0A 4DMNA 2DFFA 1N33K 4B3SK 1SL1A 3V1RA 1YJ9N 1UWBA 4FLUA 3HVRA 3QNOA 2IVNA 3TSPA 2QA4N 3BF1A 3QO9A 3VERA 5GAGP 5EOYA 4JN4A 2A1RA 2D4WA 2RHKA 3BF3A 1ESVA 1DTQA 3CF5L 4H5NA 4I6MA 3DWLA 4DQPA 3A2FA 5FPNA 4RW6A 5AQGA 2ZGYA 3HO1A 4JYAK 5HRPA 4DR1K 3RTVA 1GLFO 4PL7A 3CMEN 3T19A 4C8KA 4CJTA 4JKBA 3AAPA 3THYA 3D2FA 1ZC6A 2D1KA 2KZMA 4BR7A 3VQPA 3EKSA 1GLAG 3AA2A 1NK8A 3G6EN 2ITGA 2XY6A 1XC9A 3VETA 3VQCA 2CGKA 4BR4A 3VGLA 3THVA 3CFRA 4CHPA 2UU9K 1YJNN 1KAZA 3K5MA 3MWTA 1EETA 3RMBA 3CI5A 1WAJA 1IG9A 3MECA 4V19S 2I7PA 3MXMA 3I56N 3ULEB 3KD1E 2DY4A 2E5LK 3QEWA 3NH2A 1TKTA 4GV3A 3VENA 2ZM6K 5AQFA 4FWNA 4EHTA 1VSFA 4FJNA 3BP8A 1TUUA 4IFEA 3K59A 2RPIA 5I42A 1BI4A 3O3HA 4JKFA 3E9PA 5HBMA 2ZGZA 4FJMA 3EEQA 4CF8A 3LP1A 3ZT0A 3WXKA 3ZEUB 3O4NA 1NGEA 3SBGA 4LF5K 3V4IA 1U47A 3F9KA 3OYNA 2OYQA 4A59A 4LFCK 1QHAA 4WE1A 4FJ5A 1C0TA 2Q97A 3FZKA 4OGCA 4HTLA 2BTFA 3VEVA 1G99A 4WF9L 3CCLN 4B9TA 4IG0A 3FGUA 3TR8A 3ZSWA 3LZJA 1S9GA 2DFEA 4JI4K 1VQNN 3J7YP 1Q7YO 4GV9A 3NGZA 3CFPA 3DYAA 5GAEP 3K2PA 4AF1A 4F8RA 4BRIA 1YVNA 1U2VB 1BCOA 1A5XA 3P83D 4CJVA 4DR7K 1TL1A 3FFKB 4ID5A 3HM8A 3D0PA 2B5JA 1CLQA 2GELA 3O9UA 3JYTA 4QCLA 4BRMA 4JI8K 3K9JA 2Q3SA 4E1NA 2GUIA 5GADP 1YIJN 4A5AA 3CPEA 3CCQN 1VQ8N 4AH9A 3CMAN 1BQMA 4BDYA 2PBDA 2YNIA 2E2OA 4BE2A 2QWPA 2E1ZA 2ZE2A 3E9OA 1Z6RA 2D0AA 2GEMA 2PYJA 5FDLA 1FW6A 2CH6A 3VQAA 3H1QA 2FF6A 3KHYA 4QS9A 1YXQA 3ZEUA 2PY5A 3R8EA 1GLJO 3ENOA 3ID6A 3A5MC 2FBYA 4H0TB 1HJRA 1RT3A 1ZBFA 3HXMA 4OX9K 5J2MA 3SQ0A 2IOCA 3EE8A 4ISFA 1NJYA 1U4BA 4B08A 4B8AB 4B9LA 5AQIA 4U67L 3OJSA 2KLAA 2OTJN 5AQJA 1FJGK 1K6YA 2NRXA 2NRHA 2QXLA 4K0KK 4M7XA 4G1QA 3HM9A 1W97L 4BRGA 1HQEA 4MQ3A 3U8XA 3K0SA 3WNHA 4LF8K 3U4LA 4E7KA 4O0IA 1U2VA 4XEIA 3M8QA 4FK4A 1IO2A 1HQUA 3LDLA 5AFUH 4EP5A 1OVQA 2QWLA 1HYVA 4M3WA 4DFMA 3MEEA 4Y1CA 2YHWA 3CPWM 3L4IA 2YJFA 1OH6A 2ZD1A 4CK2A 1SKSA 4EP4A 1J54A 3TTDA 5KGXA 1KLMA 1RBTA 4DS4A 4X66K 4CF1A 1TKZA 4LSLA 3L0QA 4IXCA 4RWTA 3SUOA 4KBOA 3SJJA 4BE1A 4JI2K 4IFVA 4O5FA 1JLQA 3ULDA 3WT0A 3UB5A 4KO0A 4B9NA 1GLEG 1JLFA 5KTQA 3SAFA 2QKKA 2DTUA 3UIQA 2EX3A 4CGHA 4L8RB 5LL6Z 4R5PA 3OA9A 1S3XA 4KTWA 3G10A 2I5JA 4FOEA 4JS4A 1KLNA 4HVJA 3C0BA 4HUEA 1NK5A 4DSJA 3QESA 5M1KA 1SKWA 4H0XB 2O4GA 2A40A 1TV6A 4FYDA 1IKVA 3QINA 2F4VK 3LP3A 5E41A 4RG8A 1HNXK 1LWEA 4CEEA 1P90A 3AAQA 1JL1A 4GV6A 3BY5A 3OYIA 2O8CB 1NWKA 4X65K 4CE9A 1D5AA 1BHLA 3CJCA 3OYLA 3KVGA 1ASUA 2NNWA 4MFBA 4AHTA 5AQVA 4GVMA 2B4JA 4LSNA 2HW3A 3WNEA 1VQKN 3GG4A 3TAGA 1P8ZA 3FZLA 4A62A 5B8HA 1QQCA 1QQOA 5E26A 3VQ6A 2FXUA 4JI5K 4FJ7A 5AQNA 4JAXA 5TKYA 4KHYA 2QTDA 3DM2A 3O6WA 2HF4A 3SAGA 4RW7A 4KPYA 3D2EB 1QS4A 1T05A 3C6UA 1NG9A 4JS5A 4NXMK 3HT3A 1TVRA 2GWKA 2YX6A 1NJXA 3OVNA 3VEYA 1ZBUA 4ZHRA 3OYBA 1IBMK 4IEIA 2OPPA 3AVGA 3HSTB 4CJWA 3TANA 4KHNA 2P9UB 1D4XA 3ZSXA 5EU7A 4E89A 3JAMO 5C10A 1KVAA 4UQGA 1BA0A 1NK0A 3MWPA 3FR0A 1L3UA 1S1UA 2W42A 3NBPA 4CZFA 1XMOK 4FXDA 5BPNA 1WUAA 4XH5A 4BC3A 1BIUA 3NAEA 3OYFA 3RR8A 2O8BB 4FM2A 4DQQA 5FPEA 1TK8A 2WC9A 1YUWA 4BRLA 4FWPA 5GAHP 1LWFA 4DF4A 5AQSA 4KTZA 5AQWA 1N32K 3VQQA 3HOSA 1C1CA 2ZQBA 2D5RA 3WXMB 3TU5A 3AV9A 5TKWA 3G71N 3QNNA 2ZJPL 1EX4A 3ENBA 3W0LA 1T03A 1C0GA 2XHBA 1T44A 4OLBA 1J53A 4BDPA 2P9SB 4BREA 3QMLA 2AA4A 3D45A 3PO4A 5CY4A 4F3OA 1BIZA 1L3VA 3NHGA 1JXBA 1KQSM 1BOTO 4ELVA 2QEXN 3UKRA 2HMPA 4DR2K 4X64K 3NH1A 2IAJA 4E1MA 1YF5L 1WSIA 1EXQA 3CCUN 2F96A 3V1QA 2P9UA 1C0FA 3WXLA 3SV4A 4NYFA 3NF7A 3LAMA 4Z4CA 2X74A 4KI4A 2HHQA 4H8KA 3OS0A 4IO9L 3PIPL 1C1BA 5BN8A 3TAMA 4DR4K 4FLWA 4H0OA 5FRNA 2P9NB 3RSEB 3C6HA 2IGIA 5EX5A 1OKJA 3CJ1A 2OA8A 4GVEA 3JS6A 4B9QA 1VSIA 4TSXA 3CQYA 4DV1K 2VWJA 2E6LA 1X1PA 4FVMA 3HPGA 4H03B 3L3UA 3VOVA 1X9WA 4FWQA 4CFDA 5C42A 4FW1A 5JVGL 5AZJB 5BPLA 4GY2B 4CJKA 3I8BA 5CHIA 3MCPA 1VRTA 1VHXA 3DXMB 4KHPK 4N47A 2NRZA 2P9SA 4DS5A 3P38A 3GDQA 3C94A 2I7NA 4CBXA 3MMVA 4CF9A 2HNYA 4IZ9A 3FFIA 1VSHA 1ATSA 1JLGA 1LV5A 3MAQA 4XH4A 3DLKA 4C8OA 1HYSA 5AQYA 3QLHA 2X6NA 3O1BA 3EY1A 4YOVA 1CXQA 4CJQA 1WSJA 3LDQA 1ZBHA 1MU2A 2ZWHA 1BL3A 1T6CA 3TARA 4NCGA 3ID8A 3M8SA 1XWLA 4MO5A 4Z94A 1JCEA 1V4TA 4BC4A 4BRPA 1VQLN 3I0SA 4KFBA 3TAQA 4X62K 3OJUA 1T7PA 4B1WB 2W40A 3ITHA 4DU4A 2CH5A 4DSEA 5AQOA 2Y1IA 4DR6K 4DQIA 2YNFA 4I9LA 2UUBK 1RFQA 3L3VA 3VEXA 2VWBA 1DT9A 3P1GA 3TSUA 3CCVN 1N5YA 3ZSQA 4AM6A 3LWLA 2WUSA 3FZHA 3SI6A 5AZJA 3TAEA 3A0IX 4H5TA 5AQUA 1YTUA 3DXMA 3L2UA 1S1VA 3ASMA 3K58A 2HHVA 4JEPA 4F9OA 3GE1A 4CJ7A 3U9DA 3ZT1A 2HOEA 1QQMA 1CZBA 2YV0X 4AHSA 3WQUA 4DU3A 1T8EA 5AQHA 2IC3A 2YHYA 1OVYA 2UUCK 4FZZA 4FL9A 1S1WA 3TSQA 5BRDA 3A5NC 4BRNA 2G8FA 3L2VA 2G8HA 3OTOK 2WTUA 2AP1A 5IWAK 4DV5K 5CYQA 3L2QA 4BRAA 3CCSN 5M1FA 2E2PA 4FLXA 3HZ6A 3M5RA 4BC5A 1YVUA 4DFJA 3IKMA 5KPTA 4AILC 3O9SA 3OHRA 2OTLN 2ZJRL 1RTHA 4DTOA 5JVHL 3RMCA 2HF3A 1ILYA 2Q2RA 1NGIA 3SPZA 2Z1HA 2HNDA 3KTQA 3HTVA 4PWDA 4JD2A 4JI6K 1NKCA 4IDHA 1R0AA 5JICA 5M1OA 5AQPA 3QBWA 4RW4A 3BZCA 3EYZA 3KWIA 4B3RK 2OCEA 1D9DA 1Q9XA 3VEWA 4EIAA 2Q0UA 4FLVA 5FPDA 4IJAA 3AA4A 2YKNA 1B9FA 3MN9A 5HRNA 3LANA 2E8AA 1SS6A 5SWMA 3Q7CA 2A41A 2Q31A 2A1SA 1O1WA 1RT1A 3AVBA 4OKEA 5AQKA 3EZ5A 1R59O 5AQRA 4EZ9A 2XY7A 1CZAN 4E3SA 2RF2A 3ZETB 3ZSVA 3O9TA 1KD1O 3DLGA 4H0PA 1SL0A 3V1OA 4DTPA 4FPAA 4KHSA 3NMUA 2P9IB 4CJFA 3O5BA 1JLEA 4W5OA 4DTJA 4C8MA 5M1PA 2G8KA 3O3FA 3B8AX 5AQXA 2R7YA 3TABA 4B1YB 2CGJA 3VQ5A 4BRDA 3G0ZA 5CZ2A 1VSJA 2D0BA 4FWRA 1K9MO 1JXEA 3PX0A 2KTQA 4CZHA 1M1KO 2HHXA 2DFHA 4NCAA 2QWRA 3CCEN 4H4MA 2ZJQL 4BR9A 3GBTA 2GWJA 4LH5A 4CGFA 2QI2A 3M8RA 5FROA 1Z25A 5KGWA 4I2PA 3O3GA 4ISEA 1ATRA 1VQ6N 1X9MA 1HR0K 4CVNE 1K8KB 1DTTA 2ETJA 5AQQA 4YHHK 1IV0A 3H46O 4FWLA 1HJOA 3VA3A 2HHSA 3Q7BA 1S72N 2HB5A 4Z4IA 5BR8K 4DTNA 2NRWA 3QIOA 4E7LA 3O80A 4F2RA 3IS9A 3THWB 1ITGA 2H3GX 2IIRA 3U3GA 2XO7A 2F9TA 1LOTB 3S3MA 1EP4A 4F4KA 4J2AA 1UOCA 4BG8A 4AQYK 5K14A 4DUYK 2WBNA 3T7ZA 4FCYA 1GLBG 4F3TA 2HHWA 1GLCG 4FJJA 1IKXA 2QXFA 3ULEA 2RKIA 3OYJA 1Y64A 1OH7A 1NGHA 3KKSA 4DV0K 1EQYA 1L5UA 2Q0RA 4YORA 4K8ZA 5FPMA 1XI1A 1RTJA 2Z1JA 4A61A 5ADXA 3ZT3A 4KRFA 3DLLL 3SQ4A 1WSHA 3SMSA 1RT5A 3KWGA 1HNIA 3AY9A 4C23A 4EAHD 2HNZA 3NVKA 4Y1DA 4NCBA 3LALA 2BUPA 4YY3K 3CQ8A 2RE2A 4JI7K 4BROA 1SAZA 2GBZA 4FLTA 4KV8A 3VQ8A 3TAPA 1MDUB 3SZ2A 3AVLA 1RDAA 4CJEA 3TWHA 3MXIA 1EWRA 4CK1A 1QVGM 2E1YA 3WNFA 1C1AA 5E84A 1KFDA 3IUCA 4FZXC 3ENHA 1GLLO 5JS2A 3J8AA 3E9LA 3SK3A 4CW7B 1VQON 4FZYA 3ZYYX 4CZKA 4A5BA 5AQLA 3R9PA 3OYKA 5M1QA 5AQTA 1CZ9A 4E19A 2OANA 3DOLA 4ID1A 1T3VA 4BWMA 5BN9A 2WOMA 3OYDA 3KLFA 2G8WA 1WNSA 1KAYA 4CHNA 5AZIB 2OZSA 3K57A 3H45C 3VEOA 4IOCL 4BDZA 3R3LA 4EZ6A 4NO7A 1DLOA 4KHQA 1NK6A 3RRGA 2P5OA 4DCHA 3J81O 4CK3A 4KH4A 2Y1JA 1UA0A 3ALYA 1CXUA 5GIPA 3EN9A 3T1AA 3VPZA 1NGFA 4BG9A 3MEDA 4PHTX 3HOTA 3MN7A 4FW2A 2V52B 3N4PA 3WXIA 4H4OA 3ATUA 2ASPA 4CJPA 1NNEA 4NB4A 3KK1A 4IOAL 4IDKA 3AVFA 2KZZA 2G8UA 1REVA 3VQBA 1W0HA 1LW2A 3KK2A 3BZKA 3LPUA 1MWMA 1X9SA 1L3TA 4B1ZA 1NGAA 3RVCA 3HL8A 5GIOA 2EWSA 3C7NB 1KRPA 1F21A 1I39A 3QEVA 3I33A 4E1JA 1TAQA 3ATVA 1IJJA 3HK2A 3IG1A 1IKYA 3PO5A 1Q8IA 4M42A 4RTFD 4JI1K 4JHDB 3QIPA 5CR4A 4J2EA 1Q81O 4WQ5C 1J9AA 2ASOA 1N36K 1QSLA 3V9UA 4IG3A 4LC9B 5C2DA 3HYFA 1NU0A 3NDKA 1H1VA 2IDOA 4IFYA 4DFKA 1HNZK 3PSIA 4YOTA 1VSDA 2OPSA 2G8VA 3HP9A 3SQ1A 3S3NA 3CQXA 3DXKB 4BE0A 5AZIA 3WQTA 4CFAA 1ZYQA 1QSYA 1GOCA 1RT4A 1BUPA 1RDWX 1RBUA 1NGBA 4B9SA 1E4FT 3TAFA 3VTHA 2KQ2A 3L6QA 3AVKA 1HKBA 5ELZA 1Z26A 4M3ZA 4CHOA 4DSFA 1HMVA 1L3SA 3FZFA 1Q82O 3QERA 4ZTFA 2GV9A 4LF4K 4B1VA 3QEXA 3CM5A 4UY8O 1RT6A 1RDUA 3PV8A 5C25A 2A6AA 1RILA 3WEEB 4E7HA 3SQ2A 2YJEA 4B1UB 1NGDA 1RBVA 1G15A 4H0YB 3BGRA 1HKGA 1IBLK 3C7NA 4DR5K 2PAVA 3LAKA 4IEEA 1XQSC 5J2QA 1C0MA 5C2FA 5F2RA 3DLEA 4JHDA 1BQNA 1XHXA 3CJBA 3KLHA 4M3RA 3MX5A 4BRFA 1XMQK 4CEOA 2OZMA 2VGNA 4CCHA 2O8CA 3KIOA 4JKEA 2E2NA 4WQ5A 4CJ4A 1RBSA 4H0VB 2IVOA 4CJ3A 5T7BA 4JK7A 2ITMA 1ZXOA 1NMNA 3DXKA 3KK3A 2NZTA 3NE6A 4WCEL 1NK9A 1XNRK 4EFHA 1S6QA 2D0CA 5M1NA 4J8FA 4FJGA 2BDPA 3SCXA 4BVPA 4DR3K 4LD0A 1GOAA 3NFAA 4AHRA 3VA0A 3VN5A 4H5RA 1KSPA 1N8RO 2FF3B 2KFZA 2F7TA 3D7EO 2W41A 1X3NA 3SBTA 4J2DA 3D2EA 3HJFA 2GTDA 3M3ZA 4RW8A 2YNHA 1XNQK 4DHYA 3CCMN 3PX6A 4DV3K 3CIPA 3MN6A 3P4IA 4KI6A 1MA9B 1XUPO 2FBVA 2HBLA 3LPTA 3WEEA 2YI1A 4ELUA 2HSTA 2GX9A 4BRHA 3IDHA 5J2PA 1JCGA 4FPBA 1EKEA 3CXCM 2HVHA 1K8AO 4BY9C 4CHZA 2JGUA 3SYZA 4R79A 3H3OB 4LF9K 5LY3A 3ZX2A 2O8BA 1A5WA 3VQDA 3VEZA 3HRGA 4DLEA 1QSSA 3FLCO 1NOZA 2B6AA 1LWCA 2BE2A 3TI0A 4FWKA 5FLXO 5BRFA 3ZSZA 1NKBA 2NRRA 2FLOA 1FXXA 3AO5A 2VYPA 3VF4A 3MK6A 3IFRA 1S22A 4KHWA 3SUQA 4OKJA 3JXUA 3DLBA 4PQUA 1S1TA 3BUZB 1KAXA 4FWSA 1HLUA 4NYNA 1B92A 5LMUK 3C65A 5HL7L 4DUZK 4B9VA 4RW9A 4CHYA 4CIGA 3LDOA 1JLAA 1SQKA 2NUBA 3LDNA 1RCHA 2X78A 2FSNA 1XC3A 3A5OC 4H5VA 5KQDA 4JV5K 2OPRA 4Z4GA 4B1XB 4QAGA 4JI3K 3J80O 3IMXA 2QWQA 3OYMA 4DSLA 3DRSA 4HCCA 3UE5A 1MWKA 3DLRA 3K9KA 4KREA 3NF6A 2P9NA 3RSEA 4FM0A 5HROA 3PX4A 5D3GA 3O9QA 1DKGD 3V9XA 4CZJA 3QFPA 3U6FA 5HRSA 3CERA 3HPOA 2V51B 1WOQA 3SV3A 3SMPA 2UXBK 4O8UA 1S1XA 4WQ4C 4E7JA 1N34K 1NGGA 4LF6K 3HI0A 3VMFB 1RDCA 1U04A 3E66A 3SAHA 3L4QA 3SUNA 1D8YA 1JLCA 2Z1IA 3CCRN 4AHUA 2VG6A 1VK0A 3AA3A 1NK4A 5H1SQ 4NXNK 4Z4FA 5LJWA 1HYZA 4DSKA 4OPKA 1M90O 4A2AA 1KXPA 3OY9A 4I2QA 1D9FA 4KKOA 1NJIO 4Z0UA 2O8FB 3ZCMA 3V9WA 4ZTJA 4ICLA 3I0RA 4AHVA 3HBTA 3PY8A 3ISNC 3NF8A 4CGGA 4DLGA 2V7ZA 3THYB 1X9JA 3D2FB 1DGKN 5HRRA 3AA5X 3KK7A 4FM1A 3QETA 1NK7A 2KW4A 3RR7A 5BRHA 3AVNA 3KJVA 3CJAA 1BO5O 5AQZA 1SKRA 3M6GA 1NLVA 5DMRA 3NH0A 1NMDA 4KH6A 1Y97A 4O5BA 1LAWA 3VQ9A 3NCIA 3WUHA 4FJHA 1VQ5N 4CFCA 2F8SA 5SZTA 2Z1GA 3PIOL 2VQFK 1BDGA 2O8EB 3DJCA 4DV4K 3AO4A 3I8DA 3QEPA 4DV2K 5JMVA 4WQ4A 1HNVA 4BQLA 1WB9A 2YNGA 3CG7A 3PSFA 3LWMA 1BI4B 3GOIA 3AVIA 1VRUA 4DQ8A 4BR5A 1WSGA 3M1FA 5BPMA 2YHBA 2FSKA 1WN7A 2P51A 4PA1A 1YAGA 4RCHA 1SZ2A 4HUGA 5F0XA 2BANA 3NF9A 3TPQA 4MLHA 3OYAA 1TK0A 4Z4EA 1TKXA 2O8FA 1T6DA 3T69A 4ISGA 2VQEK 3KLGA 4FLYA 1C6VA 1JCFA 2UYTA 4W5RA 3DI6A 4ILJA 3AVMA 3RMAA 5HOOA 4GKKK 3HSCA 3NGYA 4HWIA 3CC2N 3SNNA 4Q0BA 2FBXA 4AHCA 1QQNA 4CEFA 4C8LA 3DRPA 4JKDA 4GW6A 4BRKA 1FK9A 1J5OA 5C24A 4LFBK 2YHXA 2HHUA 2QWOA 4IO8A 4BRCA 1A5VA 5I9EB 4CZEA 4DV6K 2NRVA 4JKCA 4FVUA 3K5LA 3FE1A 2HBKA 4YDUC 4HCBA 2O4IA 4CJSA 3VGKA 1TGOA 5DM6L 1RGIA 3OYGA 1VQMN 4O55A 3DAWA 2O8EA 1YT3A 2W6KA 1V4SA 4N56A 3MN5A 4YOWA 4OJRA 5LMNK 2E20A 2QM1A 4NLCA 4LY7A 1QTMA 3F73A 4DWIA 3LM9A 4BVOA 2CGLA 1LAVA 1U49A 1TAUA 4K41A 2A42A 1NJWA 3CYMA 4FLZA 3VESA 5JS1A 1BCMA 2P1JA 3ZT2A 4CIEA 3O8MA 4DTRA 3AGRA 4PL8A 5C15A 2E88A 4XH1A 3OS1A 1B9DA 2QKBA 3TTCA 4JLHA 3UKUB 4CFBA 5C12A 4ILHA 2PYLA 3CCJN 1W7AA 3AVJA 3JSMA 1J5EK 4K8XA 1TYQB 4M3TA 2WFBA 4J2BA 3IRXA 4FK0A 1W2BM 3F5TA 2NRTA 3ZETA 1HUXA 1BA1A 4IJNA 3P31A 3ZSYA 4CIFA 3AO2A 4F2SA 4CF0A 1HKCA 2P9IA 1TL3A 3AGKA 3ZSOA 4CGJA 4M41A 2BH1A 4WYBA 1NKEA 3SPYA 3LP0A 1EWQA 1BG3A 3I55N 2KHOA 5KPZA 3EL2A 3NVMA 4YDUA 1VQ7N 4YOUA 4BC2A 3G4SN 2AJQA 4CERA 5CYMA 4HUFA 1SV5A 1SUQA 1WLJA 1K8KA 1VQPN 3H6EA 4KHUA 1TKDA 1QZ6A 1S9EA 3MDQA 3E01A 1VQ9N 2Q36A 1VSLA 4MO4A 2OPQA 3CM6A 4HTUA 2LSNA 4JKGB 4MDBA 5BREA 4DQRA 1VSKA 1X3MA 1TUYA 3THWA 5HP1A 2FC0A 4DTUA 4IWVA 3S3OA 3UKUA 3J7AP 3QB0A 2HMIA 1TYQA 1VAZA 1HPZA 1KCFA 3N4QA 1K73O 4DF8A 3KLIA 4KB1A 4OKKA 1ZBIA 4FOIA 5DK5A 3QFUA 5EVZA 1ZBLA 1WAFA 2UXCK 2G8IA 1E4GT 4NLBA 4YOYA 4GNIA 2DPNA 1VSEA 2W6LA 1Q86O 3DMJA 1GOBA 3FZMA 4JI0K 1U45A 3CC7N 4YOXA 4OPAA 1IBKK 1ASVA 4O0JA 4CD3A 5IT9O 2HHTA 2A3ZA 3VGMA 1Q18A 3V9SA 4FJLA 4B8CA 2Q1NA 4BGAA 4L3QA 4DB3A 1RT2A 1ZBSA 3QDKA 2HHHK 4DTXA 2F8TA 1NJZA 3QEIA 4CHQA 3CD6N 1KVCA 5BR9A 3A8YA 3RWUA 4I7FA 1C0UA 4JKGA 4IKFA 3K5OA 4M63C 2EHGA
chains in the Genus database with same CATH topology
1EKEA 4B9MA 1S1WA 4YNQA 2HVHA 4CHZA 2JGUA 3SYZA 2G8FA 3L2VA 2G8HA 3NGZA 4N5SA 4W5QA 3CFPA 3DLHA 3DYAA 4CEQA 3K2PA 1A5WA 2QK9A 4F8RA 1RDDA 3DOKA 4B3OA 5CYQA 3VQDA 3L2QA 4PY5A 1BCOA 1A5XA 3P83D 4CJVA 1TL1A 4DLEA 1QSSA 1RTDA 4ID5A 4O44A 4FLXA 1NOZA 2B6AA 2B5JA 3D0PA 1BISA 1LWCA 2VG5A 1CLQA 1YVUA 4CESA 4DFJA 2JLEA 2BE2A 3JYTA 3S9HA 3TI0A 1ASWA 4AILC 4QCLA 4PUOA 2Q3SA 3HP6A 1RTHA 3ZSZA 4E1NA 4DG1A 1KTQA 2GUIA 5KRTA 4XIUA 3LDSA 4DTOA 1FXXA 3AO5A 4OVLA 4CGIA 4CJLA 3RMCA 4KHWA 3SPZA 4AH9A 3SUQA 2Z1HA 3CFOA 2HNDA 4E0DA 1BQMA 3KTQA 3V6DA 4PWDA 4OKJA 4BDYA 3DLBA 2YNIA 1NKCA 4PQUA 1S1TA 4BE2A 1R0AA 4NYNA 2ZE2A 2D0AA 1B92A 4CEBA 1JLBA 2PYJA 2BGGA 4RW4A 3EYZA 5FDLA 4N76A 1IH7A 3P5JA 3VQAA 4B9VA 3HPHA 4RW9A 4CHYA 4CIGA 4E7IA 2FBTA 1D9DA 1Q9XA 1JLAA 2PY5A 2NUBA 2HHVA 1RCHA 2X78A 3WNGA 2FBYA 3M8PA 1HJRA 4FLVA 1RBRA 4CEDA 1HRHA 1RT3A 3AA4A 1ZBFA 2YKNA 3HXMA 1B9FA 1KVBA 4DSIA 4Z4GA 5J2MA 2OPRA 4BWJA 3SQ0A 2IOCA 5HRNA 4CEZA 4CEAA 3LANA 1NJYA 4B9LA 1U4BA 4B08A 4B8AB 5KRSA 3L2RA 5SWMA 1XHZA 3AO1A 3OJSA 4QAGA 3OYMA 2A1SA 1O1WA 1RT1A 1W9HA 2X6SA 3AVBA 3DRSA 4OKEA 1K6YA 3EZ5A 1SL2A 4DSLA 4HCCA 3MXJA 1NKBA 3SUPA 4EZ9A 3DLRA 2XY7A 4G1QA 3HM9A 4E3SA 4KREA 3NF6A 1HQEA 4MQ3A 2RF2A 4FM0A 5HROA 3ZSVA 4KAZA 4FJXA 3WNHA 3PX4A 5D3GA 4E7KA 3DLGA 1SL0A 4O0IA 3C6TA 3V1OA 2RN2A 1RNHA 5KI6A 3V9XA 4DTPA 5J2NA 4CJFA 2VG7A 3U6FA 5HRSA 4KHSA 3M8QA 4GMJB 4FK4A 1IO2A 1HQUA 4IBNA 1JLEA 4W5OA 3BDPA 4B9UA 4DTJA 4I9QA 4C8MA 3HPOA 3SV3A 4EP5A 4KTQA 2G8KA 3O3FA 1JKHA 1HYVA 4M3WA 1S1XA 4E7JA 4DFMA 2R7YA 3MEEA 4Y1CA 3TABA 4OGEA 3VQ5A 4JRQA 3L8BA 3G0ZA 2ZD1A 5CZ2A 4CK2A 1VSJA 1SKSA 1RDCA 1J54A 1U04A 2D0BA 4EP4A 1JXEA 5KGXA 3PX0A 2KTQA 1KLMA 1RBTA 4OPJA 4DS4A 3T3FA 2XY5A 2HHXA 4CF1A 3H08A 1TKZA 2DFHA 4NCAA 4LSLA 4H4MA 3SUNA 1TK5A 1JLCA 2Z1IA 1D8YA 4LH5A 4CGFA 3SUOA 3M8RA 5I3UA 5FROA 4AHUA 4DU1A 1Z25A 2VG6A 1VK0A 4I2PA 5KGWA 3O3GA 3AA3A 4BE1A 3SJJA 4IFVA 1NK4A 1X9MA 4ELTA 1DTTA 1JLQA 2ETJA 3ULDA 4Z4FA 4M45A 1HYZA 4FJ8A 4DSKA 4OPKA 4KO0A 4B9NA 3OYEA 3OY9A 4DFPA 4I2QA 3VA3A 1D9FA 3ZT4A 1JLFA 4KKOA 5KTQA 2QKKA 4M3UA 4Z0UA 2HHSA 3OS2A 2DTUA 4C8NA 3ZCMA 3V9WA 2EX3A 3UIQA 2HB5A 4Z4IA 4CGHA 4ZTJA 4L8RB 2E4LA 4DTNA 4ICLA 4M3YA 3I0RA 3QIOA 4R5PA 4AHVA 4E7LA 4F2RA 3PY8A 4KTWA 3G10A 3IS9A 3ISNC 2I5JA 3NF8A 4JS4A 1KLNA 4CGGA 1ITGA 4DLGA 3U3GA 4HVJA 2XO7A 4HUEA 1I3AA 1NK5A 4DSJA 3QESA 3S3MA 1EP4A 5HRRA 1SKWA 4F4KA 2O4GA 4J2AA 3AA5X 1TV6A 4FM1A 3QETA 1UOCA 3AVHA 1NK7A 4FJ9A 4FYDA 1IKVA 5K14A 2KW4A 3RR7A 4CJUA 3QINA 3DRRA 3LP3A 5E41A 3AVNA 4RG8A 4FCYA 3KJVA 1S6PA 1SKRA 4F3TA 3AVCA 1RTIA 2IS3A 5DMRA 1LWEA 2HHWA 4W5NA 3NH0A 4CEEA 4FJJA 1Y97A 4O5BA 2P5GA 1IKXA 1JL1A 1LAWA 2QXFA 3NGIA 2RKIA 3KKRA 3OYIA 3OYJA 3KKSA 3VQ9A 4BACA 4CE9A 3NCIA 1D5AA 1L5UA 4FJHA 1BHLA 4CFCA 2F8SA 5SZTA 3OYLA 4K8ZA 1XI1A 4OLAA 1ASUA 1RTJA 2Z1GA 4MFBA 3IAYA 1RT7A 4DTSA 4AHTA 1QE1A 2WONA 2Z1JA 1VSMA 3AO4A 4GVMA 3V81A 3LZIA 2B4JA 4LSNA 3ZT3A 3I8DA 3QEPA 3WNEA 3RMDA 4QOZB 4KRFA 2HW3A 3SQ4A 4HHTA 1IKWA 1WSHA 2HVIA 3TAGA 1RT5A 3AO3A 1HNVA 4CGDA 1QQCA 3U3YA 1HNIA 2YNGA 3CG7A 1JL2A 3LWMA 1BI4B 2HNZA 4Y1DA 2F8TA 3VQ6A 3AVIA 4FJ7A 1VRUA 4W5TA 4NCBA 3LALA 3CQ8A 1WSGA 4KHYA 3DM2A 3VQ4A 2YHBA 4RW7A 1WN7A 2P51A 4PA1A 4KPYA 1QS4A 1T05A 2GBZA 3C6UA 4FLTA 1N6QA 4KV8A 3VQ8A 3LP2A 3TAPA 3MEGA 4JS5A 4HUGA 3HT3A 3AVLA 1RDAA 1TVRA 2BANA 3B6PA 3NF9A 4CJEA 3OYAA 3TWHA 3MXIA 1TK0A 1NJXA 4CK1A 4CJRA 3WNFA 4Z4EA 1TKXA 3OVNA 1C1AA 3KLGA 1ZBUA 4ZHRA 4Q5VA 3OYBA 1KFDA 1C6VA 4FLYA 3C95A 2OPPA 3AVGA 3HSTB 4CJWA 4FZXC 1FKPA 5JS2A 4W5RA 3TANA 4KHNA 4M3TA 3B6OA 3DI6A 5EU7A 3ZSXA 4E89A 1KVAA 4UQGA 3AVMA 4FZYA 3RMAA 2YHAA 1NOYA 3NGYA 1NK0A 3OYKA 3SNNA 5HLFA 2FBXA 4AHCA 4Q0BA 4CEFA 1L3UA 1S1UA 2W42A 3NBPA 1CZ9A 3DRPA 4E19A 4C8LA 4GW6A 1J5OA 1FK9A 4FXDA 3DOLA 5C24A 1U48A 5CZ1A 1FKOA 4ID1A 2HHUA 1BIUA 4BWMA 3OYFA 3NAEA 3RR8A 4DQSA 1A5VA 4FM2A 4YFUA 4DQQA 3VQ7A 3KLEA 5FRMA 1TK8A 2WOMA 3V9ZA 3OYDA 3KLFA 3K5LA 2G8WA 1WNSA 4CHNA 1Q9YA 4JRPA 2OZSA 1LWFA 3K57A 4HCBA 4DF4A 2O4IA 4CJSA 4BDZA 2XRIA 4EZ6A 4KTZA 1DLOA 1TGOA 4KHQA 1NK6A 3RRGA 2P5OA 3VQQA 4KB0A 4Z4HA 1C1CA 4CK3A 1WSEA 4O55A 3OYGA 3L2WA 3SZ2A 2Y1JA 2ZQBA 1UA0A 2D5RA 3ALYA 1CXUA 1YT3A 3AV9A 3K5NA 4N56A 3T1AA 2XY8A 4OJRA 3QNNA 2ATQA 1EX4A 3MEDA 4FW2A 1T03A 4LY7A 1QTMA 4FK2A 3F73A 1QHTA 4DWIA 3PUFA 2XHBA 3KD5E 2KFNA 4H4OA 4OLBA 3OYCA 1J53A 4BDPA 3HVTA 3D45A 1LAVA 4CJPA 3PO4A 3KK1A 1U49A 5CY4A 4F3OA 4IDKA 3AVFA 3OYHA 2G8UA 2KZZA 1REVA 1TAUA 3VQBA 1KFSA 1BIZA 1NJWA 1W0HA 3NHGA 3CYMA 1L3VA 1JXBA 1LW2A 4FLZA 5JS1A 3KK2A 1BCMA 2P1JA 2VWKA 2YKMA 3VQEA 3LPUA 4LH4A 3ZT2A 4CIEA 1X9SA 1L3TA 4ELVA 4DTRA 4O4GA 3NH1A 3HL8A 2E6MA 3RRHA 1UA1A 3OS1A 1KRPA 1B9DA 2IAJA 1F21A 1I39A 4JLHA 4E1MA 3QEVA 2QKBA 4CFBA 1TAQA 4N41A 1WSIA 2PYLA 1EXQA 3HK2A 2F96A 3AVJA 3IG1A 3V1QA 3JSMA 1IKYA 5J1EA 4CF2A 3SV4A 3PO5A 1Q8IA 4K8XA 4J2BA 4FJKA 4M42A 3IRXA 4NYFA 3NF7A 4FK0A 3LAMA 4Z4CA 2X74A 4KI4A 4CECA 3QIPA 2HHQA 4J2EA 4H8KA 1WSFA 3ZSYA 4CIFA 1J9AA 1C1BA 3AO2A 1RDBA 3TAMA 3OS0A 4FLWA 4F2SA 4CF0A 3O4QA 2PZSA 5FRNA 1QSLA 3V9UA 4IG3A 1TL3A 2IGIA 3ZSOA 4CJ5A 1UAXA 3HYFA 4CGJA 3NDKA 1BGXT 2IDOA 4M41A 4IFYA 1YTAA 3AVAA 4DFKA 2OA8A 1NKEA 3SPYA 1VSIA 1VSDA 2OPSA 2G8VA 3HP9A 4TSXA 3LP0A 3SQ1A 3S3NA 4BE0A 4M3XA 1S5JA 4CFAA 2VWJA 2E6LA 4DTMA 3ZSRA 1ZYQA 1QSYA 1X1PA 1LW0A 4DMNA 1GOCA 2DFFA 1RT4A 4FVMA 1SL1A 3HPGA 3V1RA 3L3UA 1RBUA 1UWBA 4FLUA 3HVRA 3QNOA 1X9WA 4CERA 4B9SA 2AJQA 5CYMA 4CFDA 4HUFA 5C42A 3TAFA 1SV5A 1SUQA 4FW1A 2KQ2A 3QO9A 1WLJA 3AVKA 4CJKA 2A1RA 1VRTA 4KHUA 1DTQA 1Z26A 1TKDA 1S9EA 3E01A 4M3ZA 4CHOA 4DSFA 1HMVA 4N47A 1L3SA 1VSLA 3A2FA 4DQPA 3QERA 4ZTFA 2GV9A 4RW6A 3HO1A 3QEXA 2OPQA 3CM6A 4DS5A 3CM5A 4HTUA 1RT6A 2LSNA 3PV8A 5C25A 5HRPA 1RILA 4E7HA 3SQ2A 3RTVA 3C94A 4DQRA 1VSKA 4CF9A 5HP1A 1RBVA 2HNYA 3T19A 1G15A 4CJTA 3BGRA 4C8KA 3FFIA 1VSHA 2FC0A 4DTUA 3S3OA 1JLGA 2KZMA 3VQPA 1LV5A 3MAQA 3AA2A 3LAKA 1NK8A 3DLKA 4C8OA 1HYSA 3QLHA 2HMIA 2ITGA 2XY6A 2X6NA 5J2QA 1XC9A 1C0MA 3EY1A 3VQCA 1HPZA 1CXQA 1KCFA 4CJQA 4DF8A 3KLIA 3DLEA 1BQNA 1WSJA 4OKKA 3CFRA 1XHXA 4CHPA 3THVA 5DK5A 4KB1A 1ZBIA 1ZBHA 3KLHA 1ZBLA 4M3RA 3K5MA 1MU2A 1WAFA 1BL3A 1EETA 3RMBA 1WAJA 4CEOA 3TARA 1IG9A 2OZMA 4NCGA 2G8IA 3M8SA 3MECA 1XWLA 4CCHA 3KIOA 3MXMA 4CJ4A 1RBSA 3I0SA 4FJIA 4KFBA 4CJ3A 1VSEA 5T7BA 3TAQA 3KD1E 2DY4A 3DMJA 3OJUA 1GOBA 3NH2A 3QEWA 1T7PA 1TKTA 3ITHA 1U45A 3KK3A 3NE6A 4DU4A 1NK9A 1ASVA 1VSFA 4DSEA 4FJNA 4O0JA 2Y1IA 4DQIA 1S6QA 2D0CA 2YNFA 4I9LA 3L3VA 3K59A 4FJGA 2BDPA 2HHTA 2RPIA 3P1GA 5I42A 1BI4A 3SCXA 1N5YA 3O3HA 3ZSQA 3V9SA 4LD0A 4FJLA 1GOAA 3LWLA 5HBMA 3NFAA 4FJMA 4AHRA 4CF8A 4B8CA 3VN5A 3LP1A 3VA0A 3ZT0A 3SI6A 1KSPA 3O4NA 2KFZA 3V4IA 3TAEA 1U47A 3F9KA 4J2DA 3OYNA 1RT2A 2OYQA 1YTUA 3HJFA 4RW8A 1S1VA 2YNHA 3ASMA 4WE1A 3L2UA 3K58A 4DTXA 1NJZA 1C0TA 3QEIA 4FJ5A 3PX6A 4CHQA 4OGCA 1KVCA 3RWUA 4KI6A 4I7FA 3ZT1A 2YV0X 1CZBA 2FBVA 3LPTA 1C0UA 4AHSA 4ELUA 4B9TA 4IG0A 4DU3A 4IKFA 1T8EA 3TR8A 3K5OA 3ZSWA 3LZJA 1S9GA 2DFEA 2IC3A 2EHGA 5J2PA 4FZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EKE A;  4B9M A;  1S1W A;  4YNQ A;  2HVH A;  4CHZ A;  2JGU A;  3SYZ A;  2G8F A;  3L2V A;  2G8H A;  3NGZ A;  4N5S A;  4W5Q A;  3CFP A;  3DLH A;  3DYA A;  4CEQ A;  3K2P A;  1A5W A;  2QK9 A;  4F8R A;  1RDD A;  3DOK A;  4B3O A;  5CYQ A;  3VQD A;  3L2Q A;  4PY5 A;  1BCO A;  1A5X A;  3P83 D;  4CJV A;  1TL1 A;  4DLE A;  1QSS A;  1RTD A;  4ID5 A;  4O44 A;  4FLX A;  1NOZ A;  2B6A A;  2B5J A;  3D0P A;  1BIS A;  1LWC A;  2VG5 A;  1CLQ A;  1YVU A;  4CES A;  4DFJ A;  2JLE A;  2BE2 A;  3JYT A;  3S9H A;  3TI0 A;  1ASW A;  4AIL C;  4QCL A;  4PUO A;  2Q3S A;  3HP6 A;  1RTH A;  3ZSZ A;  4E1N A;  4DG1 A;  1KTQ A;  2GUI A;  5KRT A;  4XIU A;  3LDS A;  4DTO A;  1FXX A;  3AO5 A;  4OVL A;  4CGI A;  4CJL A;  3RMC A;  4KHW A;  3SPZ A;  4AH9 A;  3SUQ A;  2Z1H A;  3CFO A;  2HND A;  4E0D A;  1BQM A;  3KTQ A;  3V6D A;  4PWD A;  4OKJ A;  4BDY A;  3DLB A;  2YNI A;  1NKC A;  4PQU A;  1S1T A;  4BE2 A;  1R0A A;  4NYN A;  2ZE2 A;  2D0A A;  1B92 A;  4CEB A;  1JLB A;  2PYJ A;  2BGG A;  4RW4 A;  3EYZ A;  5FDL A;  4N76 A;  1IH7 A;  3P5J A;  3VQA A;  4B9V A;  3HPH A;  4RW9 A;  4CHY A;  4CIG A;  4E7I A;  2FBT A;  1D9D A;  1Q9X A;  1JLA A;  2PY5 A;  2NUB A;  2HHV A;  1RCH A;  2X78 A;  3WNG A;  2FBY A;  3M8P A;  1HJR A;  4FLV A;  1RBR A;  4CED A;  1HRH A;  1RT3 A;  3AA4 A;  1ZBF A;  2YKN A;  3HXM A;  1B9F A;  1KVB A;  4DSI A;  4Z4G A;  5J2M A;  2OPR A;  4BWJ A;  3SQ0 A;  2IOC A;  5HRN A;  4CEZ A;  4CEA A;  3LAN A;  1NJY A;  4B9L A;  1U4B A;  4B08 A;  4B8A B;  5KRS A;  3L2R A;  5SWM A;  1XHZ A;  3AO1 A;  3OJS A;  4QAG A;  3OYM A;  2A1S A;  1O1W A;  1RT1 A;  1W9H A;  2X6S A;  3AVB A;  3DRS A;  4OKE A;  1K6Y A;  3EZ5 A;  1SL2 A;  4DSL A;  4HCC A;  3MXJ A;  1NKB A;  3SUP A;  4EZ9 A;  3DLR A;  2XY7 A;  4G1Q A;  3HM9 A;  4E3S A;  4KRE A;  3NF6 A;  1HQE A;  4MQ3 A;  2RF2 A;  4FM0 A;  5HRO A;  3ZSV A;  4KAZ A;  4FJX A;  3WNH A;  3PX4 A;  5D3G A;  4E7K A;  3DLG A;  1SL0 A;  4O0I A;  3C6T A;  3V1O A;  2RN2 A;  1RNH A;  5KI6 A;  3V9X A;  4DTP A;  5J2N A;  4CJF A;  2VG7 A;  3U6F A;  5HRS A;  4KHS A;  3M8Q A;  4GMJ B;  4FK4 A;  1IO2 A;  1HQU A;  4IBN A;  1JLE A;  4W5O A;  3BDP A;  4B9U A;  4DTJ A;  4I9Q A;  4C8M A;  3HPO A;  3SV3 A;  4EP5 A;  4KTQ A;  2G8K A;  3O3F A;  1JKH A;  1HYV A;  4M3W A;  1S1X A;  4E7J A;  4DFM A;  2R7Y A;  3MEE A;  4Y1C A;  3TAB A;  4OGE A;  3VQ5 A;  4JRQ A;  3L8B A;  3G0Z A;  2ZD1 A;  5CZ2 A;  4CK2 A;  1VSJ A;  1SKS A;  1RDC A;  1J54 A;  1U04 A;  2D0B A;  4EP4 A;  1JXE A;  5KGX A;  3PX0 A;  2KTQ A;  1KLM A;  1RBT A;  4OPJ A;  4DS4 A;  3T3F A;  2XY5 A;  2HHX A;  4CF1 A;  3H08 A;  1TKZ A;  2DFH A;  4NCA A;  4LSL A;  4H4M A;  3SUN A;  1TK5 A;  1JLC A;  2Z1I A;  1D8Y A;  4LH5 A;  4CGF A;  3SUO A;  3M8R A;  5I3U A;  5FRO A;  4AHU A;  4DU1 A;  1Z25 A;  2VG6 A;  1VK0 A;  4I2P A;  5KGW A;  3O3G A;  3AA3 A;  4BE1 A;  3SJJ A;  4IFV A;  1NK4 A;  1X9M A;  4ELT A;  1DTT A;  1JLQ A;  2ETJ A;  3ULD A;  4Z4F A;  4M45 A;  1HYZ A;  4FJ8 A;  4DSK A;  4OPK A;  4KO0 A;  4B9N A;  3OYE A;  3OY9 A;  4DFP A;  4I2Q A;  3VA3 A;  1D9F A;  3ZT4 A;  1JLF A;  4KKO A;  5KTQ A;  2QKK A;  4M3U A;  4Z0U A;  2HHS A;  3OS2 A;  2DTU A;  4C8N A;  3ZCM A;  3V9W A;  2EX3 A;  3UIQ A;  2HB5 A;  4Z4I A;  4CGH A;  4ZTJ A;  4L8R B;  2E4L A;  4DTN A;  4ICL A;  4M3Y A;  3I0R A;  3QIO A;  4R5P A;  4AHV A;  4E7L A;  4F2R A;  3PY8 A;  4KTW A;  3G10 A;  3IS9 A;  3ISN C;  2I5J A;  3NF8 A;  4JS4 A;  1KLN A;  4CGG A;  1ITG A;  4DLG A;  3U3G A;  4HVJ A;  2XO7 A;  4HUE A;  1I3A A;  1NK5 A;  4DSJ A;  3QES A;  3S3M A;  1EP4 A;  5HRR A;  1SKW A;  4F4K A;  2O4G A;  4J2A A;  3AA5 X;  1TV6 A;  4FM1 A;  3QET A;  1UOC A;  3AVH A;  1NK7 A;  4FJ9 A;  4FYD A;  1IKV A;  5K14 A;  2KW4 A;  3RR7 A;  4CJU A;  3QIN A;  3DRR A;  3LP3 A;  5E41 A;  3AVN A;  4RG8 A;  4FCY A;  3KJV A;  1S6P A;  1SKR A;  4F3T A;  3AVC A;  1RTI A;  2IS3 A;  5DMR A;  1LWE A;  2HHW A;  4W5N A;  3NH0 A;  4CEE A;  4FJJ A;  1Y97 A;  4O5B A;  2P5G A;  1IKX A;  1JL1 A;  1LAW A;  2QXF A;  3NGI A;  2RKI A;  3KKR A;  3OYI A;  3OYJ A;  3KKS A;  3VQ9 A;  4BAC A;  4CE9 A;  3NCI A;  1D5A A;  1L5U A;  4FJH A;  1BHL A;  4CFC A;  2F8S A;  5SZT A;  3OYL A;  4K8Z A;  1XI1 A;  4OLA A;  1ASU A;  1RTJ A;  2Z1G A;  4MFB A;  3IAY A;  1RT7 A;  4DTS A;  4AHT A;  1QE1 A;  2WON A;  2Z1J A;  1VSM A;  3AO4 A;  4GVM A;  3V81 A;  3LZI A;  2B4J A;  4LSN A;  3ZT3 A;  3I8D A;  3QEP A;  3WNE A;  3RMD A;  4QOZ B;  4KRF A;  2HW3 A;  3SQ4 A;  4HHT A;  1IKW A;  1WSH A;  2HVI A;  3TAG A;  1RT5 A;  3AO3 A;  1HNV A;  4CGD A;  1QQC A;  3U3Y A;  1HNI A;  2YNG A;  3CG7 A;  1JL2 A;  3LWM A;  1BI4 B;  2HNZ A;  4Y1D A;  2F8T A;  3VQ6 A;  3AVI A;  4FJ7 A;  1VRU A;  4W5T A;  4NCB A;  3LAL A;  3CQ8 A;  1WSG A;  4KHY A;  3DM2 A;  3VQ4 A;  2YHB A;  4RW7 A;  1WN7 A;  2P51 A;  4PA1 A;  4KPY A;  1QS4 A;  1T05 A;  2GBZ A;  3C6U A;  4FLT A;  1N6Q A;  4KV8 A;  3VQ8 A;  3LP2 A;  3TAP A;  3MEG A;  4JS5 A;  4HUG A;  3HT3 A;  3AVL A;  1RDA A;  1TVR A;  2BAN A;  3B6P A;  3NF9 A;  4CJE A;  3OYA A;  3TWH A;  3MXI A;  1TK0 A;  1NJX A;  4CK1 A;  4CJR A;  3WNF A;  4Z4E A;  1TKX A;  3OVN A;  1C1A A;  3KLG A;  1ZBU A;  4ZHR A;  4Q5V A;  3OYB A;  1KFD A;  1C6V A;  4FLY A;  3C95 A;  2OPP A;  3AVG A;  3HST B;  4CJW A;  4FZX C;  1FKP A;  5JS2 A;  4W5R A;  3TAN A;  4KHN A;  4M3T A;  3B6O A;  3DI6 A;  5EU7 A;  3ZSX A;  4E89 A;  1KVA A;  4UQG A;  3AVM A;  4FZY A;  3RMA A;  2YHA A;  1NOY A;  3NGY A;  1NK0 A;  3OYK A;  3SNN A;  5HLF A;  2FBX A;  4AHC A;  4Q0B A;  4CEF A;  1L3U A;  1S1U A;  2W42 A;  3NBP A;  1CZ9 A;  3DRP A;  4E19 A;  4C8L A;  4GW6 A;  1J5O A;  1FK9 A;  4FXD A;  3DOL A;  5C24 A;  1U48 A;  5CZ1 A;  1FKO A;  4ID1 A;  2HHU A;  1BIU A;  4BWM A;  3OYF A;  3NAE A;  3RR8 A;  4DQS A;  1A5V A;  4FM2 A;  4YFU A;  4DQQ A;  3VQ7 A;  3KLE A;  5FRM A;  1TK8 A;  2WOM A;  3V9Z A;  3OYD A;  3KLF A;  3K5L A;  2G8W A;  1WNS A;  4CHN A;  1Q9Y A;  4JRP A;  2OZS A;  1LWF A;  3K57 A;  4HCB A;  4DF4 A;  2O4I A;  4CJS A;  4BDZ A;  2XRI A;  4EZ6 A;  4KTZ A;  1DLO A;  1TGO A;  4KHQ A;  1NK6 A;  3RRG A;  2P5O A;  3VQQ A;  4KB0 A;  4Z4H A;  1C1C A;  4CK3 A;  1WSE A;  4O55 A;  3OYG A;  3L2W A;  3SZ2 A;  2Y1J A;  2ZQB A;  1UA0 A;  2D5R A;  3ALY A;  1CXU A;  1YT3 A;  3AV9 A;  3K5N A;  4N56 A;  3T1A A;  2XY8 A;  4OJR A;  3QNN A;  2ATQ A;  1EX4 A;  3MED A;  4FW2 A;  1T03 A;  4LY7 A;  1QTM A;  4FK2 A;  3F73 A;  1QHT A;  4DWI A;  3PUF A;  2XHB A;  3KD5 E;  2KFN A;  4H4O A;  4OLB A;  3OYC A;  1J53 A;  4BDP A;  3HVT A;  3D45 A;  1LAV A;  4CJP A;  3PO4 A;  3KK1 A;  1U49 A;  5CY4 A;  4F3O A;  4IDK A;  3AVF A;  3OYH A;  2G8U A;  2KZZ A;  1REV A;  1TAU A;  3VQB A;  1KFS A;  1BIZ A;  1NJW A;  1W0H A;  3NHG A;  3CYM A;  1L3V A;  1JXB A;  1LW2 A;  4FLZ A;  5JS1 A;  3KK2 A;  1BCM A;  2P1J A;  2VWK A;  2YKM A;  3VQE A;  3LPU A;  4LH4 A;  3ZT2 A;  4CIE A;  1X9S A;  1L3T A;  4ELV A;  4DTR A;  4O4G A;  3NH1 A;  3HL8 A;  2E6M A;  3RRH A;  1UA1 A;  3OS1 A;  1KRP A;  1B9D A;  2IAJ A;  1F21 A;  1I39 A;  4JLH A;  4E1M A;  3QEV A;  2QKB A;  4CFB A;  1TAQ A;  4N41 A;  1WSI A;  2PYL A;  1EXQ A;  3HK2 A;  2F96 A;  3AVJ A;  3IG1 A;  3V1Q A;  3JSM A;  1IKY A;  5J1E A;  4CF2 A;  3SV4 A;  3PO5 A;  1Q8I A;  4K8X A;  4J2B A;  4FJK A;  4M42 A;  3IRX A;  4NYF A;  3NF7 A;  4FK0 A;  3LAM A;  4Z4C A;  2X74 A;  4KI4 A;  4CEC A;  3QIP A;  2HHQ A;  4J2E A;  4H8K A;  1WSF A;  3ZSY A;  4CIF A;  1J9A A;  1C1B A;  3AO2 A;  1RDB A;  3TAM A;  3OS0 A;  4FLW A;  4F2S A;  4CF0 A;  3O4Q A;  2PZS A;  5FRN A;  1QSL A;  3V9U A;  4IG3 A;  1TL3 A;  2IGI A;  3ZSO A;  4CJ5 A;  1UAX A;  3HYF A;  4CGJ A;  3NDK A;  1BGX T;  2IDO A;  4M41 A;  4IFY A;  1YTA A;  3AVA A;  4DFK A;  2OA8 A;  1NKE A;  3SPY A;  1VSI A;  1VSD A;  2OPS A;  2G8V A;  3HP9 A;  4TSX A;  3LP0 A;  3SQ1 A;  3S3N A;  4BE0 A;  4M3X A;  1S5J A;  4CFA A;  2VWJ A;  2E6L A;  4DTM A;  3ZSR A;  1ZYQ A;  1QSY A;  1X1P A;  1LW0 A;  4DMN A;  1GOC A;  2DFF A;  1RT4 A;  4FVM A;  1SL1 A;  3HPG A;  3V1R A;  3L3U A;  1RBU A;  1UWB A;  4FLU A;  3HVR A;  3QNO A;  1X9W A;  4CER A;  4B9S A;  2AJQ A;  5CYM A;  4CFD A;  4HUF A;  5C42 A;  3TAF A;  1SV5 A;  1SUQ A;  4FW1 A;  2KQ2 A;  3QO9 A;  1WLJ A;  3AVK A;  4CJK A;  2A1R A;  1VRT A;  4KHU A;  1DTQ A;  1Z26 A;  1TKD A;  1S9E A;  3E01 A;  4M3Z A;  4CHO A;  4DSF A;  1HMV A;  4N47 A;  1L3S A;  1VSL A;  3A2F A;  4DQP A;  3QER A;  4ZTF A;  2GV9 A;  4RW6 A;  3HO1 A;  3QEX A;  2OPQ A;  3CM6 A;  4DS5 A;  3CM5 A;  4HTU A;  1RT6 A;  2LSN A;  3PV8 A;  5C25 A;  5HRP A;  1RIL A;  4E7H A;  3SQ2 A;  3RTV A;  3C94 A;  4DQR A;  1VSK A;  4CF9 A;  5HP1 A;  1RBV A;  2HNY A;  3T19 A;  1G15 A;  4CJT A;  3BGR A;  4C8K A;  3FFI A;  1VSH A;  2FC0 A;  4DTU A;  3S3O A;  1JLG A;  2KZM A;  3VQP A;  1LV5 A;  3MAQ A;  3AA2 A;  3LAK A;  1NK8 A;  3DLK A;  4C8O A;  1HYS A;  3QLH A;  2HMI A;  2ITG A;  2XY6 A;  2X6N A;  5J2Q A;  1XC9 A;  1C0M A;  3EY1 A;  3VQC A;  1HPZ A;  1CXQ A;  1KCF A;  4CJQ A;  4DF8 A;  3KLI A;  3DLE A;  1BQN A;  1WSJ A;  4OKK A;  3CFR A;  1XHX A;  4CHP A;  3THV A;  5DK5 A;  4KB1 A;  1ZBI A;  1ZBH A;  3KLH A;  1ZBL A;  4M3R A;  3K5M A;  1MU2 A;  1WAF A;  1BL3 A;  1EET A;  3RMB A;  1WAJ A;  4CEO A;  3TAR A;  1IG9 A;  2OZM A;  4NCG A;  2G8I A;  3M8S A;  3MEC A;  1XWL A;  4CCH A;  3KIO A;  3MXM A;  4CJ4 A;  1RBS A;  3I0S A;  4FJI A;  4KFB A;  4CJ3 A;  1VSE A;  5T7B A;  3TAQ A;  3KD1 E;  2DY4 A;  3DMJ A;  3OJU A;  1GOB A;  3NH2 A;  3QEW A;  1T7P A;  1TKT A;  3ITH A;  1U45 A;  3KK3 A;  3NE6 A;  4DU4 A;  1NK9 A;  1ASV A;  1VSF A;  4DSE A;  4FJN A;  4O0J A;  2Y1I A;  4DQI A;  1S6Q A;  2D0C A;  2YNF A;  4I9L A;  3L3V A;  3K59 A;  4FJG A;  2BDP A;  2HHT A;  2RPI A;  3P1G A;  5I42 A;  1BI4 A;  3SCX A;  1N5Y A;  3O3H A;  3ZSQ A;  3V9S A;  4LD0 A;  4FJL A;  1GOA A;  3LWL A;  5HBM A;  3NFA A;  4FJM A;  4AHR A;  4CF8 A;  4B8C A;  3VN5 A;  3LP1 A;  3VA0 A;  3ZT0 A;  3SI6 A;  1KSP A;  3O4N A;  2KFZ A;  3V4I A;  3TAE A;  1U47 A;  3F9K A;  4J2D A;  3OYN A;  1RT2 A;  2OYQ A;  1YTU A;  3HJF A;  4RW8 A;  1S1V A;  2YNH A;  3ASM A;  4WE1 A;  3L2U A;  3K58 A;  4DTX A;  1NJZ A;  1C0T A;  3QEI A;  4FJ5 A;  3PX6 A;  4CHQ A;  4OGC A;  1KVC A;  3RWU A;  4KI6 A;  4I7F A;  3ZT1 A;  2YV0 X;  1CZB A;  2FBV A;  3LPT A;  1C0U A;  4AHS A;  4ELU A;  4B9T A;  4IG0 A;  4DU3 A;  4IKF A;  1T8E A;  3TR8 A;  3K5O A;  3ZSW A;  3LZJ A;  1S9G A;  2DFE A;  2IC3 A;  2EHG A;  5J2P A;  4FZZ A; 
#chains in the Genus database with same CATH topology
 3ZLJ A;  4B9M A;  4YNQ A;  4N5S A;  4W5Q A;  1YHQ N;  3DLH A;  4WFB L;  2IVP A;  4CEQ A;  2QK9 A;  4B3O A;  1RDD A;  3DOK A;  4C1N I;  4PY5 A;  1JJ2 M;  1RTD A;  4O44 A;  1BIS A;  2VG5 A;  4CES A;  2JLE A;  3MCA B;  2NLX A;  3S9H A;  3H1V X;  1ASW A;  4PUO A;  3HP6 A;  1I94 K;  5KRT A;  4DG1 A;  1KTQ A;  4XIU A;  4ILG B;  3LDS A;  2YCH A;  2JWL A;  2D0P A;  4OVL A;  4CGI A;  4CJL A;  2D0O A;  3O9R A;  4BR2 A;  3CFO A;  4E0D A;  2KKZ A;  3V6D A;  5A2Q O;  3LM2 A;  2J4R A;  2PFU A;  4LFA K;  3T1H K;  4CEB A;  1JLB A;  2BGG A;  4N76 A;  3R1X A;  1IH7 A;  3P5J A;  3HPH A;  3O08 A;  1YIT N;  3THX B;  2VCP A;  4E7I A;  4IOX A;  2FBT A;  3VTI A;  1BWF O;  1LCU A;  4B3T K;  3W3D A;  3WNG A;  3M8P A;  1HNW K;  1RBR A;  4CED A;  1HRH A;  3CJ7 A;  1KVB A;  1BU6 O;  4DSI A;  4BR0 A;  4BWJ A;  4BRQ A;  3VF6 A;  4CEZ A;  2P9P B;  2QWM A;  4CEA A;  4EHU A;  3OBY A;  4Y0W A;  5KRS A;  3UKR B;  3L2R A;  1XHZ A;  3AO1 A;  5MLC Q;  4A57 A;  1U6Z A;  1W9H A;  2X6S A;  1SL2 A;  4CD1 A;  3S41 A;  3MXJ A;  3SUP A;  3CC4 N;  3CJ9 A;  4PKI A;  4KAZ A;  4FJX A;  4OO1 J;  3CET A;  4BQZ A;  3GL1 A;  2VGM A;  3KZB A;  3C6T A;  5J2N A;  2RN2 A;  1RNH A;  3D6R A;  5KI6 A;  5FRM A;  2VG7 A;  3U9Z A;  4GMJ B;  4GKJ K;  4IBN A;  3BDP A;  4B9U A;  4I9Q A;  2FSJ A;  4KTQ A;  5AR0 A;  2O8D B;  1JKH A;  1ATN A;  4WFN L;  4OGE A;  3BEX A;  4JRQ A;  3L8B A;  3F2K A;  1NM1 A;  4OPJ A;  3H3N O;  3T3F A;  2XY5 A;  2HBM A;  4FSV A;  3H08 A;  2F9W A;  4QS8 A;  1TK5 A;  2JWK A;  5I3U A;  5DM7 L;  4DU1 A;  4QS7 A;  4K43 A;  3A5L C;  3THX A;  4ELT A;  4B3M K;  4M45 A;  4FJ8 A;  4CI6 A;  4JK9 A;  3F9M A;  2UUA K;  1EO1 A;  3OYE A;  4DFP A;  3ZT4 A;  3G25 A;  2P9K B;  4M3U A;  3OS2 A;  4C8N A;  4JKA A;  3EO3 A;  3PLA A;  2E4L A;  4M3Y A;  1YJW N;  2P9P A;  4MDA A;  1KC8 O;  1I3A A;  2A5X A;  3O1W A;  3AVH A;  3LDP A;  3R6M A;  4FJ9 A;  3SLC A;  4CJU A;  3DRR A;  1S6P A;  3AVC A;  1RTI A;  2ASM A;  2IS3 A;  4W5N A;  2P5G A;  3NGI A;  3KKR A;  4BGB A;  4BAC A;  3QBX A;  4JNE A;  2O8D A;  3ZX0 A;  4OLA A;  1YI2 N;  3IAY A;  2QWN A;  5ADX H;  1RT7 A;  4DTS A;  3QIC A;  1QE1 A;  2WON A;  1VSM A;  3EZW A;  3V81 A;  5CE3 A;  3LZI A;  1IG8 A;  3RMD A;  5JLF A;  4WFA L;  1IKW A;  4CZG A;  5F1X A;  4HHT A;  2HVI A;  3VF2 A;  3AO3 A;  4CGD A;  3U3Y A;  3EKU A;  4A2B A;  4CBW A;  1JL2 A;  1GLD G;  3AAR A;  4W5T A;  3J7Z O;  3OW2 M;  3MX2 A;  3VQ4 A;  4G9Z A;  2P9L B;  4PKH A;  1N6Q A;  1QVF M;  3LP2 A;  1J6Z A;  3MEG A;  4U7B A;  3B6P A;  4C1N K;  2QW9 A;  4CJR A;  2P9K A;  4FO0 A;  4Q5V A;  5EY4 A;  3C95 A;  2HBJ A;  1FKP A;  2E2Q A;  3B6O A;  3CHW A;  1NGJ A;  2YHA A;  1NOY A;  4K42 A;  5HLF A;  2ZF5 O;  5AQM A;  4CBU A;  3LL3 A;  5LJV A;  3E1Y A;  3TTF A;  1U48 A;  1OH8 A;  5CZ1 A;  1FKO A;  3EE9 A;  4DQS A;  5AFU A;  4YFU A;  4FWM A;  3VQ7 A;  1VQ4 N;  3KLE A;  4CZM A;  5KPR A;  3V9Z A;  4LF7 K;  5GIN A;  4CZI A;  5EXW A;  1Q9Y A;  3SJH A;  4JRP A;  2XRI A;  4H5W A;  2GUP A;  2V7Y A;  4KB0 A;  4Z4H A;  3L2W A;  4QOZ B;  1WSE A;  1Z05 A;  4PKG A;  3K5N A;  3ZX3 A;  4JD2 B;  2XY8 A;  4MLE A;  1HPM A;  2ATQ A;  1OH5 A;  4FK2 A;  4I6M B;  1QHT A;  5AJ3 K;  3PUF A;  3KD5 E;  2KFN A;  3OYC A;  3HVT A;  3OYH A;  2P9L A;  1KFS A;  5C0Y A;  1O13 A;  1QZ5 A;  2VWK A;  2YKM A;  3VQE A;  3OBW A;  4LH4 A;  3C6A A;  4M7Y A;  1NGC A;  4O4G A;  4FWO A;  2E6M A;  3RRH A;  1UA1 A;  1WBD A;  4DKW A;  4OPH A;  4N41 A;  2UXD K;  5JLH A;  4FJI A;  5J1E A;  4CF2 A;  4CZL A;  4FJK A;  4O8K A;  4JKH A;  4CEC A;  4KH5 A;  4K25 A;  1WSF A;  1HX1 A;  1RDB A;  3P39 A;  3O4Q A;  2PZS A;  3WXJ A;  4CJ5 A;  1E3M A;  3O4W A;  1UAX A;  4JK8 A;  1BGX T;  5KQ8 A;  1YTA A;  3AVA A;  1NBW A;  4AM7 A;  3T1Y K;  1DEJ A;  4M3X A;  1S5J A;  4DV7 K;  4DTM A;  3ZSR A;  1WBB A;  1LW0 A;  4DMN A;  2DFF A;  1N33 K;  4B3S K;  1SL1 A;  3V1R A;  1YJ9 N;  1UWB A;  4FLU A;  3HVR A;  3QNO A;  2IVN A;  3TSP A;  2QA4 N;  3BF1 A;  3QO9 A;  3VER A;  5GAG P;  5EOY A;  4JN4 A;  2A1R A;  2D4W A;  2RHK A;  3BF3 A;  1ESV A;  1DTQ A;  3CF5 L;  4H5N A;  4I6M A;  3DWL A;  4DQP A;  3A2F A;  5FPN A;  4RW6 A;  5AQG A;  2ZGY A;  3HO1 A;  4JYA K;  5HRP A;  4DR1 K;  3RTV A;  1GLF O;  4PL7 A;  3CME N;  3T19 A;  4C8K A;  4CJT A;  4JKB A;  3AAP A;  3THY A;  3D2F A;  1ZC6 A;  2D1K A;  2KZM A;  4BR7 A;  3VQP A;  3EKS A;  1GLA G;  3AA2 A;  1NK8 A;  3G6E N;  2ITG A;  2XY6 A;  1XC9 A;  3VET A;  3VQC A;  2CGK A;  4BR4 A;  3VGL A;  3THV A;  3CFR A;  4CHP A;  2UU9 K;  1YJN N;  1KAZ A;  3K5M A;  3MWT A;  1EET A;  3RMB A;  3CI5 A;  1WAJ A;  1IG9 A;  3MEC A;  4V19 S;  2I7P A;  3MXM A;  3I56 N;  3ULE B;  3KD1 E;  2DY4 A;  2E5L K;  3QEW A;  3NH2 A;  1TKT A;  4GV3 A;  3VEN A;  2ZM6 K;  5AQF A;  4FWN A;  4EHT A;  1VSF A;  4FJN A;  3BP8 A;  1TUU A;  4IFE A;  3K59 A;  2RPI A;  5I42 A;  1BI4 A;  3O3H A;  4JKF A;  3E9P A;  5HBM A;  2ZGZ A;  4FJM A;  3EEQ A;  4CF8 A;  3LP1 A;  3ZT0 A;  3WXK A;  3ZEU B;  3O4N A;  1NGE A;  3SBG A;  4LF5 K;  3V4I A;  1U47 A;  3F9K A;  3OYN A;  2OYQ A;  4A59 A;  4LFC K;  1QHA A;  4WE1 A;  4FJ5 A;  1C0T A;  2Q97 A;  3FZK A;  4OGC A;  4HTL A;  2BTF A;  3VEV A;  1G99 A;  4WF9 L;  3CCL N;  4B9T A;  4IG0 A;  3FGU A;  3TR8 A;  3ZSW A;  3LZJ A;  1S9G A;  2DFE A;  4JI4 K;  1VQN N;  3J7Y P;  1Q7Y O;  4GV9 A;  3NGZ A;  3CFP A;  3DYA A;  5GAE P;  3K2P A;  4AF1 A;  4F8R A;  4BRI A;  1YVN A;  1U2V B;  1BCO A;  1A5X A;  3P83 D;  4CJV A;  4DR7 K;  1TL1 A;  3FFK B;  4ID5 A;  3HM8 A;  3D0P A;  2B5J A;  1CLQ A;  2GEL A;  3O9U A;  3JYT A;  4QCL A;  4BRM A;  4JI8 K;  3K9J A;  2Q3S A;  4E1N A;  2GUI A;  5GAD P;  1YIJ N;  4A5A A;  3CPE A;  3CCQ N;  1VQ8 N;  4AH9 A;  3CMA N;  1BQM A;  4BDY A;  2PBD A;  2YNI A;  2E2O A;  4BE2 A;  2QWP A;  2E1Z A;  2ZE2 A;  3E9O A;  1Z6R A;  2D0A A;  2GEM A;  2PYJ A;  5FDL A;  1FW6 A;  2CH6 A;  3VQA A;  3H1Q A;  2FF6 A;  3KHY A;  4QS9 A;  1YXQ A;  3ZEU A;  2PY5 A;  3R8E A;  1GLJ O;  3ENO A;  3ID6 A;  3A5M C;  2FBY A;  4H0T B;  1HJR A;  1RT3 A;  1ZBF A;  3HXM A;  4OX9 K;  5J2M A;  3SQ0 A;  2IOC A;  3EE8 A;  4ISF A;  1NJY A;  1U4B A;  4B08 A;  4B8A B;  4B9L A;  5AQI A;  4U67 L;  3OJS A;  2KLA A;  2OTJ N;  5AQJ A;  1FJG K;  1K6Y A;  2NRX A;  2NRH A;  2QXL A;  4K0K K;  4M7X A;  4G1Q A;  3HM9 A;  1W97 L;  4BRG A;  1HQE A;  4MQ3 A;  3U8X A;  3K0S A;  3WNH A;  4LF8 K;  3U4L A;  4E7K A;  4O0I A;  1U2V A;  4XEI A;  3M8Q A;  4FK4 A;  1IO2 A;  1HQU A;  3LDL A;  5AFU H;  4EP5 A;  1OVQ A;  2QWL A;  1HYV A;  4M3W A;  4DFM A;  3MEE A;  4Y1C A;  2YHW A;  3CPW M;  3L4I A;  2YJF A;  1OH6 A;  2ZD1 A;  4CK2 A;  1SKS A;  4EP4 A;  1J54 A;  3TTD A;  5KGX A;  1KLM A;  1RBT A;  4DS4 A;  4X66 K;  4CF1 A;  1TKZ A;  4LSL A;  3L0Q A;  4IXC A;  4RWT A;  3SUO A;  4KBO A;  3SJJ A;  4BE1 A;  4JI2 K;  4IFV A;  4O5F A;  1JLQ A;  3ULD A;  3WT0 A;  3UB5 A;  4KO0 A;  4B9N A;  1GLE G;  1JLF A;  5KTQ A;  3SAF A;  2QKK A;  2DTU A;  3UIQ A;  2EX3 A;  4CGH A;  4L8R B;  5LL6 Z;  4R5P A;  3OA9 A;  1S3X A;  4KTW A;  3G10 A;  2I5J A;  4FOE A;  4JS4 A;  1KLN A;  4HVJ A;  3C0B A;  4HUE A;  1NK5 A;  4DSJ A;  3QES A;  5M1K A;  1SKW A;  4H0X B;  2O4G A;  2A40 A;  1TV6 A;  4FYD A;  1IKV A;  3QIN A;  2F4V K;  3LP3 A;  5E41 A;  4RG8 A;  1HNX K;  1LWE A;  4CEE A;  1P90 A;  3AAQ A;  1JL1 A;  4GV6 A;  3BY5 A;  3OYI A;  2O8C B;  1NWK A;  4X65 K;  4CE9 A;  1D5A A;  1BHL A;  3CJC A;  3OYL A;  3KVG A;  1ASU A;  2NNW A;  4MFB A;  4AHT A;  5AQV A;  4GVM A;  2B4J A;  4LSN A;  2HW3 A;  3WNE A;  1VQK N;  3GG4 A;  3TAG A;  1P8Z A;  3FZL A;  4A62 A;  5B8H A;  1QQC A;  1QQO A;  5E26 A;  3VQ6 A;  2FXU A;  4JI5 K;  4FJ7 A;  5AQN A;  4JAX A;  5TKY A;  4KHY A;  2QTD A;  3DM2 A;  3O6W A;  2HF4 A;  3SAG A;  4RW7 A;  4KPY A;  3D2E B;  1QS4 A;  1T05 A;  3C6U A;  1NG9 A;  4JS5 A;  4NXM K;  3HT3 A;  1TVR A;  2GWK A;  2YX6 A;  1NJX A;  3OVN A;  3VEY A;  1ZBU A;  4ZHR A;  3OYB A;  1IBM K;  4IEI A;  2OPP A;  3AVG A;  3HST B;  4CJW A;  3TAN A;  4KHN A;  2P9U B;  1D4X A;  3ZSX A;  5EU7 A;  4E89 A;  3JAM O;  5C10 A;  1KVA A;  4UQG A;  1BA0 A;  1NK0 A;  3MWP A;  3FR0 A;  1L3U A;  1S1U A;  2W42 A;  3NBP A;  4CZF A;  1XMO K;  4FXD A;  5BPN A;  1WUA A;  4XH5 A;  4BC3 A;  1BIU A;  3NAE A;  3OYF A;  3RR8 A;  2O8B B;  4FM2 A;  4DQQ A;  5FPE A;  1TK8 A;  2WC9 A;  1YUW A;  4BRL A;  4FWP A;  5GAH P;  1LWF A;  4DF4 A;  5AQS A;  4KTZ A;  5AQW A;  1N32 K;  3VQQ A;  3HOS A;  1C1C A;  2ZQB A;  2D5R A;  3WXM B;  3TU5 A;  3AV9 A;  5TKW A;  3G71 N;  3QNN A;  2ZJP L;  1EX4 A;  3ENB A;  3W0L A;  1T03 A;  1C0G A;  2XHB A;  1T44 A;  4OLB A;  1J53 A;  4BDP A;  2P9S B;  4BRE A;  3QML A;  2AA4 A;  3D45 A;  3PO4 A;  5CY4 A;  4F3O A;  1BIZ A;  1L3V A;  3NHG A;  1JXB A;  1KQS M;  1BOT O;  4ELV A;  2QEX N;  3UKR A;  2HMP A;  4DR2 K;  4X64 K;  3NH1 A;  2IAJ A;  4E1M A;  1YF5 L;  1WSI A;  1EXQ A;  3CCU N;  2F96 A;  3V1Q A;  2P9U A;  1C0F A;  3WXL A;  3SV4 A;  4NYF A;  3NF7 A;  3LAM A;  4Z4C A;  2X74 A;  4KI4 A;  2HHQ A;  4H8K A;  3OS0 A;  4IO9 L;  3PIP L;  1C1B A;  5BN8 A;  3TAM A;  4DR4 K;  4FLW A;  4H0O A;  5FRN A;  2P9N B;  3RSE B;  3C6H A;  2IGI A;  5EX5 A;  1OKJ A;  3CJ1 A;  2OA8 A;  4GVE A;  3JS6 A;  4B9Q A;  1VSI A;  4TSX A;  3CQY A;  4DV1 K;  2VWJ A;  2E6L A;  1X1P A;  4FVM A;  3HPG A;  4H03 B;  3L3U A;  3VOV A;  1X9W A;  4FWQ A;  4CFD A;  5C42 A;  4FW1 A;  5JVG L;  5AZJ B;  5BPL A;  4GY2 B;  4CJK A;  3I8B A;  5CHI A;  3MCP A;  1VRT A;  1VHX A;  3DXM B;  4KHP K;  4N47 A;  2NRZ A;  2P9S A;  4DS5 A;  3P38 A;  3GDQ A;  3C94 A;  2I7N A;  4CBX A;  3MMV A;  4CF9 A;  2HNY A;  4IZ9 A;  3FFI A;  1VSH A;  1ATS A;  1JLG A;  1LV5 A;  3MAQ A;  4XH4 A;  3DLK A;  4C8O A;  1HYS A;  5AQY A;  3QLH A;  2X6N A;  3O1B A;  3EY1 A;  4YOV A;  1CXQ A;  4CJQ A;  1WSJ A;  3LDQ A;  1ZBH A;  1MU2 A;  2ZWH A;  1BL3 A;  1T6C A;  3TAR A;  4NCG A;  3ID8 A;  3M8S A;  1XWL A;  4MO5 A;  4Z94 A;  1JCE A;  1V4T A;  4BC4 A;  4BRP A;  1VQL N;  3I0S A;  4KFB A;  3TAQ A;  4X62 K;  3OJU A;  1T7P A;  4B1W B;  2W40 A;  3ITH A;  4DU4 A;  2CH5 A;  4DSE A;  5AQO A;  2Y1I A;  4DR6 K;  4DQI A;  2YNF A;  4I9L A;  2UUB K;  1RFQ A;  3L3V A;  3VEX A;  2VWB A;  1DT9 A;  3P1G A;  3TSU A;  3CCV N;  1N5Y A;  3ZSQ A;  4AM6 A;  3LWL A;  2WUS A;  3FZH A;  3SI6 A;  5AZJ A;  3TAE A;  3A0I X;  4H5T A;  5AQU A;  1YTU A;  3DXM A;  3L2U A;  1S1V A;  3ASM A;  3K58 A;  2HHV A;  4JEP A;  4F9O A;  3GE1 A;  4CJ7 A;  3U9D A;  3ZT1 A;  2HOE A;  1QQM A;  1CZB A;  2YV0 X;  4AHS A;  3WQU A;  4DU3 A;  1T8E A;  5AQH A;  2IC3 A;  2YHY A;  1OVY A;  2UUC K;  4FZZ A;  4FL9 A;  1S1W A;  3TSQ A;  5BRD A;  3A5N C;  4BRN A;  2G8F A;  3L2V A;  2G8H A;  3OTO K;  2WTU A;  2AP1 A;  5IWA K;  4DV5 K;  5CYQ A;  3L2Q A;  4BRA A;  3CCS N;  5M1F A;  2E2P A;  4FLX A;  3HZ6 A;  3M5R A;  4BC5 A;  1YVU A;  4DFJ A;  3IKM A;  5KPT A;  4AIL C;  3O9S A;  3OHR A;  2OTL N;  2ZJR L;  1RTH A;  4DTO A;  5JVH L;  3RMC A;  2HF3 A;  1ILY A;  2Q2R A;  1NGI A;  3SPZ A;  2Z1H A;  2HND A;  3KTQ A;  3HTV A;  4PWD A;  4JD2 A;  4JI6 K;  1NKC A;  4IDH A;  1R0A A;  5JIC A;  5M1O A;  5AQP A;  3QBW A;  4RW4 A;  3BZC A;  3EYZ A;  3KWI A;  4B3R K;  2OCE A;  1D9D A;  1Q9X A;  3VEW A;  4EIA A;  2Q0U A;  4FLV A;  5FPD A;  4IJA A;  3AA4 A;  2YKN A;  1B9F A;  3MN9 A;  5HRN A;  3LAN A;  2E8A A;  1SS6 A;  5SWM A;  3Q7C A;  2A41 A;  2Q31 A;  2A1S A;  1O1W A;  1RT1 A;  3AVB A;  4OKE A;  5AQK A;  3EZ5 A;  1R59 O;  5AQR A;  4EZ9 A;  2XY7 A;  1CZA N;  4E3S A;  2RF2 A;  3ZET B;  3ZSV A;  3O9T A;  1KD1 O;  3DLG A;  4H0P A;  1SL0 A;  3V1O A;  4DTP A;  4FPA A;  4KHS A;  3NMU A;  2P9I B;  4CJF A;  3O5B A;  1JLE A;  4W5O A;  4DTJ A;  4C8M A;  5M1P A;  2G8K A;  3O3F A;  3B8A X;  5AQX A;  2R7Y A;  3TAB A;  4B1Y B;  2CGJ A;  3VQ5 A;  4BRD A;  3G0Z A;  5CZ2 A;  1VSJ A;  2D0B A;  4FWR A;  1K9M O;  1JXE A;  3PX0 A;  2KTQ A;  4CZH A;  1M1K O;  2HHX A;  2DFH A;  4NCA A;  2QWR A;  3CCE N;  4H4M A;  2ZJQ L;  4BR9 A;  3GBT A;  2GWJ A;  4LH5 A;  4CGF A;  2QI2 A;  3M8R A;  5FRO A;  1Z25 A;  5KGW A;  4I2P A;  3O3G A;  4ISE A;  1ATR A;  1VQ6 N;  1X9M A;  1HR0 K;  4CVN E;  1K8K B;  1DTT A;  2ETJ A;  5AQQ A;  4YHH K;  1IV0 A;  3H46 O;  4FWL A;  1HJO A;  3VA3 A;  2HHS A;  3Q7B A;  1S72 N;  2HB5 A;  4Z4I A;  5BR8 K;  4DTN A;  2NRW A;  3QIO A;  4E7L A;  3O80 A;  4F2R A;  3IS9 A;  3THW B;  1ITG A;  2H3G X;  2IIR A;  3U3G A;  2XO7 A;  2F9T A;  1LOT B;  3S3M A;  1EP4 A;  4F4K A;  4J2A A;  1UOC A;  4BG8 A;  4AQY K;  5K14 A;  4DUY K;  2WBN A;  3T7Z A;  4FCY A;  1GLB G;  4F3T A;  2HHW A;  1GLC G;  4FJJ A;  1IKX A;  2QXF A;  3ULE A;  2RKI A;  3OYJ A;  1Y64 A;  1OH7 A;  1NGH A;  3KKS A;  4DV0 K;  1EQY A;  1L5U A;  2Q0R A;  4YOR A;  4K8Z A;  5FPM A;  1XI1 A;  1RTJ A;  2Z1J A;  4A61 A;  5ADX A;  3ZT3 A;  4KRF A;  3DLL L;  3SQ4 A;  1WSH A;  3SMS A;  1RT5 A;  3KWG A;  1HNI A;  3AY9 A;  4C23 A;  4EAH D;  2HNZ A;  3NVK A;  4Y1D A;  4NCB A;  3LAL A;  2BUP A;  4YY3 K;  3CQ8 A;  2RE2 A;  4JI7 K;  4BRO A;  1SAZ A;  2GBZ A;  4FLT A;  4KV8 A;  3VQ8 A;  3TAP A;  1MDU B;  3SZ2 A;  3AVL A;  1RDA A;  4CJE A;  3TWH A;  3MXI A;  1EWR A;  4CK1 A;  1QVG M;  2E1Y A;  3WNF A;  1C1A A;  5E84 A;  1KFD A;  3IUC A;  4FZX C;  3ENH A;  1GLL O;  5JS2 A;  3J8A A;  3E9L A;  3SK3 A;  4CW7 B;  1VQO N;  4FZY A;  3ZYY X;  4CZK A;  4A5B A;  5AQL A;  3R9P A;  3OYK A;  5M1Q A;  5AQT A;  1CZ9 A;  4E19 A;  2OAN A;  3DOL A;  4ID1 A;  1T3V A;  4BWM A;  5BN9 A;  2WOM A;  3OYD A;  3KLF A;  2G8W A;  1WNS A;  1KAY A;  4CHN A;  5AZI B;  2OZS A;  3K57 A;  3H45 C;  3VEO A;  4IOC L;  4BDZ A;  3R3L A;  4EZ6 A;  4NO7 A;  1DLO A;  4KHQ A;  1NK6 A;  3RRG A;  2P5O A;  4DCH A;  3J81 O;  4CK3 A;  4KH4 A;  2Y1J A;  1UA0 A;  3ALY A;  1CXU A;  5GIP A;  3EN9 A;  3T1A A;  3VPZ A;  1NGF A;  4BG9 A;  3MED A;  4PHT X;  3HOT A;  3MN7 A;  4FW2 A;  2V52 B;  3N4P A;  3WXI A;  4H4O A;  3ATU A;  2ASP A;  4CJP A;  1NNE A;  4NB4 A;  3KK1 A;  4IOA L;  4IDK A;  3AVF A;  2KZZ A;  2G8U A;  1REV A;  3VQB A;  1W0H A;  1LW2 A;  3KK2 A;  3BZK A;  3LPU A;  1MWM A;  1X9S A;  1L3T A;  4B1Z A;  1NGA A;  3RVC A;  3HL8 A;  5GIO A;  2EWS A;  3C7N B;  1KRP A;  1F21 A;  1I39 A;  3QEV A;  3I33 A;  4E1J A;  1TAQ A;  3ATV A;  1IJJ A;  3HK2 A;  3IG1 A;  1IKY A;  3PO5 A;  1Q8I A;  4M42 A;  4RTF D;  4JI1 K;  4JHD B;  3QIP A;  5CR4 A;  4J2E A;  1Q81 O;  4WQ5 C;  1J9A A;  2ASO A;  1N36 K;  1QSL A;  3V9U A;  4IG3 A;  4LC9 B;  5C2D A;  3HYF A;  1NU0 A;  3NDK A;  1H1V A;  2IDO A;  4IFY A;  4DFK A;  1HNZ K;  3PSI A;  4YOT A;  1VSD A;  2OPS A;  2G8V A;  3HP9 A;  3SQ1 A;  3S3N A;  3CQX A;  3DXK B;  4BE0 A;  5AZI A;  3WQT A;  4CFA A;  1ZYQ A;  1QSY A;  1GOC A;  1RT4 A;  1BUP A;  1RDW X;  1RBU A;  1NGB A;  4B9S A;  1E4F T;  3TAF A;  3VTH A;  2KQ2 A;  3L6Q A;  3AVK A;  1HKB A;  5ELZ A;  1Z26 A;  4M3Z A;  4CHO A;  4DSF A;  1HMV A;  1L3S A;  3FZF A;  1Q82 O;  3QER A;  4ZTF A;  2GV9 A;  4LF4 K;  4B1V A;  3QEX A;  3CM5 A;  4UY8 O;  1RT6 A;  1RDU A;  3PV8 A;  5C25 A;  2A6A A;  1RIL A;  3WEE B;  4E7H A;  3SQ2 A;  2YJE A;  4B1U B;  1NGD A;  1RBV A;  1G15 A;  4H0Y B;  3BGR A;  1HKG A;  1IBL K;  3C7N A;  4DR5 K;  2PAV A;  3LAK A;  4IEE A;  1XQS C;  5J2Q A;  1C0M A;  5C2F A;  5F2R A;  3DLE A;  4JHD A;  1BQN A;  1XHX A;  3CJB A;  3KLH A;  4M3R A;  3MX5 A;  4BRF A;  1XMQ K;  4CEO A;  2OZM A;  2VGN A;  4CCH A;  2O8C A;  3KIO A;  4JKE A;  2E2N A;  4WQ5 A;  4CJ4 A;  1RBS A;  4H0V B;  2IVO A;  4CJ3 A;  5T7B A;  4JK7 A;  2ITM A;  1ZXO A;  1NMN A;  3DXK A;  3KK3 A;  2NZT A;  3NE6 A;  4WCE L;  1NK9 A;  1XNR K;  4EFH A;  1S6Q A;  2D0C A;  5M1N A;  4J8F A;  4FJG A;  2BDP A;  3SCX A;  4BVP A;  4DR3 K;  4LD0 A;  1GOA A;  3NFA A;  4AHR A;  3VA0 A;  3VN5 A;  4H5R A;  1KSP A;  1N8R O;  2FF3 B;  2KFZ A;  2F7T A;  3D7E O;  2W41 A;  1X3N A;  3SBT A;  4J2D A;  3D2E A;  3HJF A;  2GTD A;  3M3Z A;  4RW8 A;  2YNH A;  1XNQ K;  4DHY A;  3CCM N;  3PX6 A;  4DV3 K;  3CIP A;  3MN6 A;  3P4I A;  4KI6 A;  1MA9 B;  1XUP O;  2FBV A;  2HBL A;  3LPT A;  3WEE A;  2YI1 A;  4ELU A;  2HST A;  2GX9 A;  4BRH A;  3IDH A;  5J2P A;  1JCG A;  4FPB A;  1EKE A;  3CXC M;  2HVH A;  1K8A O;  4BY9 C;  4CHZ A;  2JGU A;  3SYZ A;  4R79 A;  3H3O B;  4LF9 K;  5LY3 A;  3ZX2 A;  2O8B A;  1A5W A;  3VQD A;  3VEZ A;  3HRG A;  4DLE A;  1QSS A;  3FLC O;  1NOZ A;  2B6A A;  1LWC A;  2BE2 A;  3TI0 A;  4FWK A;  5FLX O;  5BRF A;  3ZSZ A;  1NKB A;  2NRR A;  2FLO A;  1FXX A;  3AO5 A;  2VYP A;  3VF4 A;  3MK6 A;  3IFR A;  1S22 A;  4KHW A;  3SUQ A;  4OKJ A;  3JXU A;  3DLB A;  4PQU A;  1S1T A;  3BUZ B;  1KAX A;  4FWS A;  1HLU A;  4NYN A;  1B92 A;  5LMU K;  3C65 A;  5HL7 L;  4DUZ K;  4B9V A;  4RW9 A;  4CHY A;  4CIG A;  3LDO A;  1JLA A;  1SQK A;  2NUB A;  3LDN A;  1RCH A;  2X78 A;  2FSN A;  1XC3 A;  3A5O C;  4H5V A;  5KQD A;  4JV5 K;  2OPR A;  4Z4G A;  4B1X B;  4QAG A;  4JI3 K;  3J80 O;  3IMX A;  2QWQ A;  3OYM A;  4DSL A;  3DRS A;  4HCC A;  3UE5 A;  1MWK A;  3DLR A;  3K9K A;  4KRE A;  3NF6 A;  2P9N A;  3RSE A;  4FM0 A;  5HRO A;  3PX4 A;  5D3G A;  3O9Q A;  1DKG D;  3V9X A;  4CZJ A;  3QFP A;  3U6F A;  5HRS A;  3CER A;  3HPO A;  2V51 B;  1WOQ A;  3SV3 A;  3SMP A;  2UXB K;  4O8U A;  1S1X A;  4WQ4 C;  4E7J A;  1N34 K;  1NGG A;  4LF6 K;  3HI0 A;  3VMF B;  1RDC A;  1U04 A;  3E66 A;  3SAH A;  3L4Q A;  3SUN A;  1D8Y A;  1JLC A;  2Z1I A;  3CCR N;  4AHU A;  2VG6 A;  1VK0 A;  3AA3 A;  1NK4 A;  5H1S Q;  4NXN K;  4Z4F A;  5LJW A;  1HYZ A;  4DSK A;  4OPK A;  1M90 O;  4A2A A;  1KXP A;  3OY9 A;  4I2Q A;  1D9F A;  4KKO A;  1NJI O;  4Z0U A;  2O8F B;  3ZCM A;  3V9W A;  4ZTJ A;  4ICL A;  3I0R A;  4AHV A;  3HBT A;  3PY8 A;  3ISN C;  3NF8 A;  4CGG A;  4DLG A;  2V7Z A;  3THY B;  1X9J A;  3D2F B;  1DGK N;  5HRR A;  3AA5 X;  3KK7 A;  4FM1 A;  3QET A;  1NK7 A;  2KW4 A;  3RR7 A;  5BRH A;  3AVN A;  3KJV A;  3CJA A;  1BO5 O;  5AQZ A;  1SKR A;  3M6G A;  1NLV A;  5DMR A;  3NH0 A;  1NMD A;  4KH6 A;  1Y97 A;  4O5B A;  1LAW A;  3VQ9 A;  3NCI A;  3WUH A;  4FJH A;  1VQ5 N;  4CFC A;  2F8S A;  5SZT A;  2Z1G A;  3PIO L;  2VQF K;  1BDG A;  2O8E B;  3DJC A;  4DV4 K;  3AO4 A;  3I8D A;  3QEP A;  4DV2 K;  5JMV A;  4WQ4 A;  1HNV A;  4BQL A;  1WB9 A;  2YNG A;  3CG7 A;  3PSF A;  3LWM A;  1BI4 B;  3GOI A;  3AVI A;  1VRU A;  4DQ8 A;  4BR5 A;  1WSG A;  3M1F A;  5BPM A;  2YHB A;  2FSK A;  1WN7 A;  2P51 A;  4PA1 A;  1YAG A;  4RCH A;  1SZ2 A;  4HUG A;  5F0X A;  2BAN A;  3NF9 A;  3TPQ A;  4MLH A;  3OYA A;  1TK0 A;  4Z4E A;  1TKX A;  2O8F A;  1T6D A;  3T69 A;  4ISG A;  2VQE K;  3KLG A;  4FLY A;  1C6V A;  1JCF A;  2UYT A;  4W5R A;  3DI6 A;  4ILJ A;  3AVM A;  3RMA A;  5HOO A;  4GKK K;  3HSC A;  3NGY A;  4HWI A;  3CC2 N;  3SNN A;  4Q0B A;  2FBX A;  4AHC A;  1QQN A;  4CEF A;  4C8L A;  3DRP A;  4JKD A;  4GW6 A;  4BRK A;  1FK9 A;  1J5O A;  5C24 A;  4LFB K;  2YHX A;  2HHU A;  2QWO A;  4IO8 A;  4BRC A;  1A5V A;  5I9E B;  4CZE A;  4DV6 K;  2NRV A;  4JKC A;  4FVU A;  3K5L A;  3FE1 A;  2HBK A;  4YDU C;  4HCB A;  2O4I A;  4CJS A;  3VGK A;  1TGO A;  5DM6 L;  1RGI A;  3OYG A;  1VQM N;  4O55 A;  3DAW A;  2O8E A;  1YT3 A;  2W6K A;  1V4S A;  4N56 A;  3MN5 A;  4YOW A;  4OJR A;  5LMN K;  2E20 A;  2QM1 A;  4NLC A;  4LY7 A;  1QTM A;  3F73 A;  4DWI A;  3LM9 A;  4BVO A;  2CGL A;  1LAV A;  1U49 A;  1TAU A;  4K41 A;  2A42 A;  1NJW A;  3CYM A;  4FLZ A;  3VES A;  5JS1 A;  1BCM A;  2P1J A;  3ZT2 A;  4CIE A;  3O8M A;  4DTR A;  3AGR A;  4PL8 A;  5C15 A;  2E88 A;  4XH1 A;  3OS1 A;  1B9D A;  2QKB A;  3TTC A;  4JLH A;  3UKU B;  4CFB A;  5C12 A;  4ILH A;  2PYL A;  3CCJ N;  1W7A A;  3AVJ A;  3JSM A;  1J5E K;  4K8X A;  1TYQ B;  4M3T A;  2WFB A;  4J2B A;  3IRX A;  4FK0 A;  1W2B M;  3F5T A;  2NRT A;  3ZET A;  1HUX A;  1BA1 A;  4IJN A;  3P31 A;  3ZSY A;  4CIF A;  3AO2 A;  4F2S A;  4CF0 A;  1HKC A;  2P9I A;  1TL3 A;  3AGK A;  3ZSO A;  4CGJ A;  4M41 A;  2BH1 A;  4WYB A;  1NKE A;  3SPY A;  3LP0 A;  1EWQ A;  1BG3 A;  3I55 N;  2KHO A;  5KPZ A;  3EL2 A;  3NVM A;  4YDU A;  1VQ7 N;  4YOU A;  4BC2 A;  3G4S N;  2AJQ A;  4CER A;  5CYM A;  4HUF A;  1SV5 A;  1SUQ A;  1WLJ A;  1K8K A;  1VQP N;  3H6E A;  4KHU A;  1TKD A;  1QZ6 A;  1S9E A;  3MDQ A;  3E01 A;  1VQ9 N;  2Q36 A;  1VSL A;  4MO4 A;  2OPQ A;  3CM6 A;  4HTU A;  2LSN A;  4JKG B;  4MDB A;  5BRE A;  4DQR A;  1VSK A;  1X3M A;  1TUY A;  3THW A;  5HP1 A;  2FC0 A;  4DTU A;  4IWV A;  3S3O A;  3UKU A;  3J7A P;  3QB0 A;  2HMI A;  1TYQ A;  1VAZ A;  1HPZ A;  1KCF A;  3N4Q A;  1K73 O;  4DF8 A;  3KLI A;  4KB1 A;  4OKK A;  1ZBI A;  4FOI A;  5DK5 A;  3QFU A;  5EVZ A;  1ZBL A;  1WAF A;  2UXC K;  2G8I A;  1E4G T;  4NLB A;  4YOY A;  4GNI A;  2DPN A;  1VSE A;  2W6L A;  1Q86 O;  3DMJ A;  1GOB A;  3FZM A;  4JI0 K;  1U45 A;  3CC7 N;  4YOX A;  4OPA A;  1IBK K;  1ASV A;  4O0J A;  4CD3 A;  5IT9 O;  2HHT A;  2A3Z A;  3VGM A;  1Q18 A;  3V9S A;  4FJL A;  4B8C A;  2Q1N A;  4BGA A;  4L3Q A;  4DB3 A;  1RT2 A;  1ZBS A;  3QDK A;  2HHH K;  4DTX A;  2F8T A;  1NJZ A;  3QEI A;  4CHQ A;  3CD6 N;  1KVC A;  5BR9 A;  3A8Y A;  3RWU A;  4I7F A;  1C0U A;  4JKG A;  4IKF A;  3K5O A;  4M63 C;  2EHG A; 
#chains in the Genus database with same CATH homology
 1EKE A;  4B9M A;  1S1W A;  4YNQ A;  2HVH A;  4CHZ A;  2JGU A;  3SYZ A;  2G8F A;  3L2V A;  2G8H A;  3NGZ A;  4N5S A;  4W5Q A;  3CFP A;  3DLH A;  3DYA A;  4CEQ A;  3K2P A;  1A5W A;  2QK9 A;  4F8R A;  1RDD A;  3DOK A;  4B3O A;  5CYQ A;  3VQD A;  3L2Q A;  4PY5 A;  1BCO A;  1A5X A;  3P83 D;  4CJV A;  1TL1 A;  4DLE A;  1QSS A;  1RTD A;  4ID5 A;  4O44 A;  4FLX A;  1NOZ A;  2B6A A;  2B5J A;  3D0P A;  1BIS A;  1LWC A;  2VG5 A;  1CLQ A;  1YVU A;  4CES A;  4DFJ A;  2JLE A;  2BE2 A;  3JYT A;  3S9H A;  3TI0 A;  1ASW A;  4AIL C;  4QCL A;  4PUO A;  2Q3S A;  3HP6 A;  1RTH A;  3ZSZ A;  4E1N A;  4DG1 A;  1KTQ A;  2GUI A;  5KRT A;  4XIU A;  3LDS A;  4DTO A;  1FXX A;  3AO5 A;  4OVL A;  4CGI A;  4CJL A;  3RMC A;  4KHW A;  3SPZ A;  4AH9 A;  3SUQ A;  2Z1H A;  3CFO A;  2HND A;  4E0D A;  1BQM A;  3KTQ A;  3V6D A;  4PWD A;  4OKJ A;  4BDY A;  3DLB A;  2YNI A;  1NKC A;  4PQU A;  1S1T A;  4BE2 A;  1R0A A;  4NYN A;  2ZE2 A;  2D0A A;  1B92 A;  4CEB A;  1JLB A;  2PYJ A;  2BGG A;  4RW4 A;  3EYZ A;  5FDL A;  4N76 A;  1IH7 A;  3P5J A;  3VQA A;  4B9V A;  3HPH A;  4RW9 A;  4CHY A;  4CIG A;  4E7I A;  2FBT A;  1D9D A;  1Q9X A;  1JLA A;  2PY5 A;  2NUB A;  2HHV A;  1RCH A;  2X78 A;  3WNG A;  2FBY A;  3M8P A;  1HJR A;  4FLV A;  1RBR A;  4CED A;  1HRH A;  1RT3 A;  3AA4 A;  1ZBF A;  2YKN A;  3HXM A;  1B9F A;  1KVB A;  4DSI A;  4Z4G A;  5J2M A;  2OPR A;  4BWJ A;  3SQ0 A;  2IOC A;  5HRN A;  4CEZ A;  4CEA A;  3LAN A;  1NJY A;  4B9L A;  1U4B A;  4B08 A;  4B8A B;  5KRS A;  3L2R A;  5SWM A;  1XHZ A;  3AO1 A;  3OJS A;  4QAG A;  3OYM A;  2A1S A;  1O1W A;  1RT1 A;  1W9H A;  2X6S A;  3AVB A;  3DRS A;  4OKE A;  1K6Y A;  3EZ5 A;  1SL2 A;  4DSL A;  4HCC A;  3MXJ A;  1NKB A;  3SUP A;  4EZ9 A;  3DLR A;  2XY7 A;  4G1Q A;  3HM9 A;  4E3S A;  4KRE A;  3NF6 A;  1HQE A;  4MQ3 A;  2RF2 A;  4FM0 A;  5HRO A;  3ZSV A;  4KAZ A;  4FJX A;  3WNH A;  3PX4 A;  5D3G A;  4E7K A;  3DLG A;  1SL0 A;  4O0I A;  3C6T A;  3V1O A;  2RN2 A;  1RNH A;  5KI6 A;  3V9X A;  4DTP A;  5J2N A;  4CJF A;  2VG7 A;  3U6F A;  5HRS A;  4KHS A;  3M8Q A;  4GMJ B;  4FK4 A;  1IO2 A;  1HQU A;  4IBN A;  1JLE A;  4W5O A;  3BDP A;  4B9U A;  4DTJ A;  4I9Q A;  4C8M A;  3HPO A;  3SV3 A;  4EP5 A;  4KTQ A;  2G8K A;  3O3F A;  1JKH A;  1HYV A;  4M3W A;  1S1X A;  4E7J A;  4DFM A;  2R7Y A;  3MEE A;  4Y1C A;  3TAB A;  4OGE A;  3VQ5 A;  4JRQ A;  3L8B A;  3G0Z A;  2ZD1 A;  5CZ2 A;  4CK2 A;  1VSJ A;  1SKS A;  1RDC A;  1J54 A;  1U04 A;  2D0B A;  4EP4 A;  1JXE A;  5KGX A;  3PX0 A;  2KTQ A;  1KLM A;  1RBT A;  4OPJ A;  4DS4 A;  3T3F A;  2XY5 A;  2HHX A;  4CF1 A;  3H08 A;  1TKZ A;  2DFH A;  4NCA A;  4LSL A;  4H4M A;  3SUN A;  1TK5 A;  1JLC A;  2Z1I A;  1D8Y A;  4LH5 A;  4CGF A;  3SUO A;  3M8R A;  5I3U A;  5FRO A;  4AHU A;  4DU1 A;  1Z25 A;  2VG6 A;  1VK0 A;  4I2P A;  5KGW A;  3O3G A;  3AA3 A;  4BE1 A;  3SJJ A;  4IFV A;  1NK4 A;  1X9M A;  4ELT A;  1DTT A;  1JLQ A;  2ETJ A;  3ULD A;  4Z4F A;  4M45 A;  1HYZ A;  4FJ8 A;  4DSK A;  4OPK A;  4KO0 A;  4B9N A;  3OYE A;  3OY9 A;  4DFP A;  4I2Q A;  3VA3 A;  1D9F A;  3ZT4 A;  1JLF A;  4KKO A;  5KTQ A;  2QKK A;  4M3U A;  4Z0U A;  2HHS A;  3OS2 A;  2DTU A;  4C8N A;  3ZCM A;  3V9W A;  2EX3 A;  3UIQ A;  2HB5 A;  4Z4I A;  4CGH A;  4ZTJ A;  4L8R B;  2E4L A;  4DTN A;  4ICL A;  4M3Y A;  3I0R A;  3QIO A;  4R5P A;  4AHV A;  4E7L A;  4F2R A;  3PY8 A;  4KTW A;  3G10 A;  3IS9 A;  3ISN C;  2I5J A;  3NF8 A;  4JS4 A;  1KLN A;  4CGG A;  1ITG A;  4DLG A;  3U3G A;  4HVJ A;  2XO7 A;  4HUE A;  1I3A A;  1NK5 A;  4DSJ A;  3QES A;  3S3M A;  1EP4 A;  5HRR A;  1SKW A;  4F4K A;  2O4G A;  4J2A A;  3AA5 X;  1TV6 A;  4FM1 A;  3QET A;  1UOC A;  3AVH A;  1NK7 A;  4FJ9 A;  4FYD A;  1IKV A;  5K14 A;  2KW4 A;  3RR7 A;  4CJU A;  3QIN A;  3DRR A;  3LP3 A;  5E41 A;  3AVN A;  4RG8 A;  4FCY A;  3KJV A;  1S6P A;  1SKR A;  4F3T A;  3AVC A;  1RTI A;  2IS3 A;  5DMR A;  1LWE A;  2HHW A;  4W5N A;  3NH0 A;  4CEE A;  4FJJ A;  1Y97 A;  4O5B A;  2P5G A;  1IKX A;  1JL1 A;  1LAW A;  2QXF A;  3NGI A;  2RKI A;  3KKR A;  3OYI A;  3OYJ A;  3KKS A;  3VQ9 A;  4BAC A;  4CE9 A;  3NCI A;  1D5A A;  1L5U A;  4FJH A;  1BHL A;  4CFC A;  2F8S A;  5SZT A;  3OYL A;  4K8Z A;  1XI1 A;  4OLA A;  1ASU A;  1RTJ A;  2Z1G A;  4MFB A;  3IAY A;  1RT7 A;  4DTS A;  4AHT A;  1QE1 A;  2WON A;  2Z1J A;  1VSM A;  3AO4 A;  4GVM A;  3V81 A;  3LZI A;  2B4J A;  4LSN A;  3ZT3 A;  3I8D A;  3QEP A;  3WNE A;  3RMD A;  4QOZ B;  4KRF A;  2HW3 A;  3SQ4 A;  4HHT A;  1IKW A;  1WSH A;  2HVI A;  3TAG A;  1RT5 A;  3AO3 A;  1HNV A;  4CGD A;  1QQC A;  3U3Y A;  1HNI A;  2YNG A;  3CG7 A;  1JL2 A;  3LWM A;  1BI4 B;  2HNZ A;  4Y1D A;  2F8T A;  3VQ6 A;  3AVI A;  4FJ7 A;  1VRU A;  4W5T A;  4NCB A;  3LAL A;  3CQ8 A;  1WSG A;  4KHY A;  3DM2 A;  3VQ4 A;  2YHB A;  4RW7 A;  1WN7 A;  2P51 A;  4PA1 A;  4KPY A;  1QS4 A;  1T05 A;  2GBZ A;  3C6U A;  4FLT A;  1N6Q A;  4KV8 A;  3VQ8 A;  3LP2 A;  3TAP A;  3MEG A;  4JS5 A;  4HUG A;  3HT3 A;  3AVL A;  1RDA A;  1TVR A;  2BAN A;  3B6P A;  3NF9 A;  4CJE A;  3OYA A;  3TWH A;  3MXI A;  1TK0 A;  1NJX A;  4CK1 A;  4CJR A;  3WNF A;  4Z4E A;  1TKX A;  3OVN A;  1C1A A;  3KLG A;  1ZBU A;  4ZHR A;  4Q5V A;  3OYB A;  1KFD A;  1C6V A;  4FLY A;  3C95 A;  2OPP A;  3AVG A;  3HST B;  4CJW A;  4FZX C;  1FKP A;  5JS2 A;  4W5R A;  3TAN A;  4KHN A;  4M3T A;  3B6O A;  3DI6 A;  5EU7 A;  3ZSX A;  4E89 A;  1KVA A;  4UQG A;  3AVM A;  4FZY A;  3RMA A;  2YHA A;  1NOY A;  3NGY A;  1NK0 A;  3OYK A;  3SNN A;  5HLF A;  2FBX A;  4AHC A;  4Q0B A;  4CEF A;  1L3U A;  1S1U A;  2W42 A;  3NBP A;  1CZ9 A;  3DRP A;  4E19 A;  4C8L A;  4GW6 A;  1J5O A;  1FK9 A;  4FXD A;  3DOL A;  5C24 A;  1U48 A;  5CZ1 A;  1FKO A;  4ID1 A;  2HHU A;  1BIU A;  4BWM A;  3OYF A;  3NAE A;  3RR8 A;  4DQS A;  1A5V A;  4FM2 A;  4YFU A;  4DQQ A;  3VQ7 A;  3KLE A;  5FRM A;  1TK8 A;  2WOM A;  3V9Z A;  3OYD A;  3KLF A;  3K5L A;  2G8W A;  1WNS A;  4CHN A;  1Q9Y A;  4JRP A;  2OZS A;  1LWF A;  3K57 A;  4HCB A;  4DF4 A;  2O4I A;  4CJS A;  4BDZ A;  2XRI A;  4EZ6 A;  4KTZ A;  1DLO A;  1TGO A;  4KHQ A;  1NK6 A;  3RRG A;  2P5O A;  3VQQ A;  4KB0 A;  4Z4H A;  1C1C A;  4CK3 A;  1WSE A;  4O55 A;  3OYG A;  3L2W A;  3SZ2 A;  2Y1J A;  2ZQB A;  1UA0 A;  2D5R A;  3ALY A;  1CXU A;  1YT3 A;  3AV9 A;  3K5N A;  4N56 A;  3T1A A;  2XY8 A;  4OJR A;  3QNN A;  2ATQ A;  1EX4 A;  3MED A;  4FW2 A;  1T03 A;  4LY7 A;  1QTM A;  4FK2 A;  3F73 A;  1QHT A;  4DWI A;  3PUF A;  2XHB A;  3KD5 E;  2KFN A;  4H4O A;  4OLB A;  3OYC A;  1J53 A;  4BDP A;  3HVT A;  3D45 A;  1LAV A;  4CJP A;  3PO4 A;  3KK1 A;  1U49 A;  5CY4 A;  4F3O A;  4IDK A;  3AVF A;  3OYH A;  2G8U A;  2KZZ A;  1REV A;  1TAU A;  3VQB A;  1KFS A;  1BIZ A;  1NJW A;  1W0H A;  3NHG A;  3CYM A;  1L3V A;  1JXB A;  1LW2 A;  4FLZ A;  5JS1 A;  3KK2 A;  1BCM A;  2P1J A;  2VWK A;  2YKM A;  3VQE A;  3LPU A;  4LH4 A;  3ZT2 A;  4CIE A;  1X9S A;  1L3T A;  4ELV A;  4DTR A;  4O4G A;  3NH1 A;  3HL8 A;  2E6M A;  3RRH A;  1UA1 A;  3OS1 A;  1KRP A;  1B9D A;  2IAJ A;  1F21 A;  1I39 A;  4JLH A;  4E1M A;  3QEV A;  2QKB A;  4CFB A;  1TAQ A;  4N41 A;  1WSI A;  2PYL A;  1EXQ A;  3HK2 A;  2F96 A;  3AVJ A;  3IG1 A;  3V1Q A;  3JSM A;  1IKY A;  5J1E A;  4CF2 A;  3SV4 A;  3PO5 A;  1Q8I A;  4K8X A;  4J2B A;  4FJK A;  4M42 A;  3IRX A;  4NYF A;  3NF7 A;  4FK0 A;  3LAM A;  4Z4C A;  2X74 A;  4KI4 A;  4CEC A;  3QIP A;  2HHQ A;  4J2E A;  4H8K A;  1WSF A;  3ZSY A;  4CIF A;  1J9A A;  1C1B A;  3AO2 A;  1RDB A;  3TAM A;  3OS0 A;  4FLW A;  4F2S A;  4CF0 A;  3O4Q A;  2PZS A;  5FRN A;  1QSL A;  3V9U A;  4IG3 A;  1TL3 A;  2IGI A;  3ZSO A;  4CJ5 A;  1UAX A;  3HYF A;  4CGJ A;  3NDK A;  1BGX T;  2IDO A;  4M41 A;  4IFY A;  1YTA A;  3AVA A;  4DFK A;  2OA8 A;  1NKE A;  3SPY A;  1VSI A;  1VSD A;  2OPS A;  2G8V A;  3HP9 A;  4TSX A;  3LP0 A;  3SQ1 A;  3S3N A;  4BE0 A;  4M3X A;  1S5J A;  4CFA A;  2VWJ A;  2E6L A;  4DTM A;  3ZSR A;  1ZYQ A;  1QSY A;  1X1P A;  1LW0 A;  4DMN A;  1GOC A;  2DFF A;  1RT4 A;  4FVM A;  1SL1 A;  3HPG A;  3V1R A;  3L3U A;  1RBU A;  1UWB A;  4FLU A;  3HVR A;  3QNO A;  1X9W A;  4CER A;  4B9S A;  2AJQ A;  5CYM A;  4CFD A;  4HUF A;  5C42 A;  3TAF A;  1SV5 A;  1SUQ A;  4FW1 A;  2KQ2 A;  3QO9 A;  1WLJ A;  3AVK A;  4CJK A;  2A1R A;  1VRT A;  4KHU A;  1DTQ A;  1Z26 A;  1TKD A;  1S9E A;  3E01 A;  4M3Z A;  4CHO A;  4DSF A;  1HMV A;  4N47 A;  1L3S A;  1VSL A;  3A2F A;  4DQP A;  3QER A;  4ZTF A;  2GV9 A;  4RW6 A;  3HO1 A;  3QEX A;  2OPQ A;  3CM6 A;  4DS5 A;  3CM5 A;  4HTU A;  1RT6 A;  2LSN A;  3PV8 A;  5C25 A;  5HRP A;  1RIL A;  4E7H A;  3SQ2 A;  3RTV A;  3C94 A;  4DQR A;  1VSK A;  4CF9 A;  5HP1 A;  1RBV A;  2HNY A;  3T19 A;  1G15 A;  4CJT A;  3BGR A;  4C8K A;  3FFI A;  1VSH A;  2FC0 A;  4DTU A;  3S3O A;  1JLG A;  2KZM A;  3VQP A;  1LV5 A;  3MAQ A;  3AA2 A;  3LAK A;  1NK8 A;  3DLK A;  4C8O A;  1HYS A;  3QLH A;  2HMI A;  2ITG A;  2XY6 A;  2X6N A;  5J2Q A;  1XC9 A;  1C0M A;  3EY1 A;  3VQC A;  1HPZ A;  1CXQ A;  1KCF A;  4CJQ A;  4DF8 A;  3KLI A;  3DLE A;  1BQN A;  1WSJ A;  4OKK A;  3CFR A;  1XHX A;  4CHP A;  3THV A;  5DK5 A;  4KB1 A;  1ZBI A;  1ZBH A;  3KLH A;  1ZBL A;  4M3R A;  3K5M A;  1MU2 A;  1WAF A;  1BL3 A;  1EET A;  3RMB A;  1WAJ A;  4CEO A;  3TAR A;  1IG9 A;  2OZM A;  4NCG A;  2G8I A;  3M8S A;  3MEC A;  1XWL A;  4CCH A;  3KIO A;  3MXM A;  4CJ4 A;  1RBS A;  3I0S A;  4FJI A;  4KFB A;  4CJ3 A;  1VSE A;  5T7B A;  3TAQ A;  3KD1 E;  2DY4 A;  3DMJ A;  3OJU A;  1GOB A;  3NH2 A;  3QEW A;  1T7P A;  1TKT A;  3ITH A;  1U45 A;  3KK3 A;  3NE6 A;  4DU4 A;  1NK9 A;  1ASV A;  1VSF A;  4DSE A;  4FJN A;  4O0J A;  2Y1I A;  4DQI A;  1S6Q A;  2D0C A;  2YNF A;  4I9L A;  3L3V A;  3K59 A;  4FJG A;  2BDP A;  2HHT A;  2RPI A;  3P1G A;  5I42 A;  1BI4 A;  3SCX A;  1N5Y A;  3O3H A;  3ZSQ A;  3V9S A;  4LD0 A;  4FJL A;  1GOA A;  3LWL A;  5HBM A;  3NFA A;  4FJM A;  4AHR A;  4CF8 A;  4B8C A;  3VN5 A;  3LP1 A;  3VA0 A;  3ZT0 A;  3SI6 A;  1KSP A;  3O4N A;  2KFZ A;  3V4I A;  3TAE A;  1U47 A;  3F9K A;  4J2D A;  3OYN A;  1RT2 A;  2OYQ A;  1YTU A;  3HJF A;  4RW8 A;  1S1V A;  2YNH A;  3ASM A;  4WE1 A;  3L2U A;  3K58 A;  4DTX A;  1NJZ A;  1C0T A;  3QEI A;  4FJ5 A;  3PX6 A;  4CHQ A;  4OGC A;  1KVC A;  3RWU A;  4KI6 A;  4I7F A;  3ZT1 A;  2YV0 X;  1CZB A;  2FBV A;  3LPT A;  1C0U A;  4AHS A;  4ELU A;  4B9T A;  4IG0 A;  4DU3 A;  4IKF A;  1T8E A;  3TR8 A;  3K5O A;  3ZSW A;  3LZJ A;  1S9G A;  2DFE A;  2IC3 A;  2EHG A;  5J2P A;  4FZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...