4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
4RG8A 1N6QA 3AVIA 3L2UA 1C1CA 3K5LA 4LD0A 4DTMA 3TANA 4CECA 3MEDA 3QIPA 5SZTA 3HVRA 3V4IA 3AA5X 2IGIA 4F3OA 2Y1JA 4CEDA 2F96A 3QO9A 4DTSA 3MXMA 4B3OA 1X9SA 3WNFA 3NH0A 3F9KA 1KTQA 3AVFA 3QEPA 5J2NA 4B9NA 2HHVA 1BIUA 3NGYA 4YFUA 1NK0A 4FZYA 4Q0BA 1S6PA 1NK7A 5DK5A 4B8AB 4CJWA 4ZTJA 1Q8IA 3KIOA 4G1QA 3CM6A 4HUFA 2RN2A 1VSIA 1SL1A 3DLGA 4Z4HA 2W42A 1TL1A 2HW3A 1K6YA 4DU3A 5EU7A 1LWCA 2D0AA 5I42A 1ASUA 1JLCA 4BWJA 5D3GA 1KCFA 3AA4A 4LSLA 3ZSXA 4W5QA 4FJHA 1BHLA 3G10A 1ZBFA 4CEOA 1REVA 3V6DA 3ZSWA 4K8XA 3QEVA 2P5GA 3OJUA 4L8RB 4J2DA 2OPPA 3NF8A 4J2BA 4O44A 4Z0UA 1CZ9A 4FLTA 1C0UA 4FZZA 4HCBA 3ZSRA 3OS1A 1XC9A 3SV4A 1QS4A 2HNYA 4CFBA 3OYDA 4O55A 1X9WA 1B92A 2KQ2A 3VQBA 1JL2A 2HVHA 4BE2A 1BQMA 4XIUA 3HL8A 2IS3A 4CJTA 3MECA 4W5OA 4DFJA 1XHXA 1TK8A 3JYTA 5HROA 3NF9A 1KLNA 1KRPA 4F8RA 4KREA 2YHBA 2GUIA 3L2RA 4CF8A 3SPZA 4CJUA 3LALA 4CHNA 5CZ1A 1DTTA 5HLFA 3HP6A 4NYNA 4RW9A 3NHGA 4N76A 3ZSYA 1RT2A 4RW6A 3ZSVA 1RBVA 3O3GA 3SQ1A 2AJQA 2ZD1A 4DFPA 1HPZA 1YVUA 3OYAA 3K58A 5FRMA 2FBVA 1TKDA 3RRGA 1UA0A 3I0SA 2G8IA 2P1JA 1RDCA 4C8OA 2B4JA 1SKRA 3ULDA 4DSKA 4CFCA 1TK5A 3C95A 4CEAA 4WE1A 3E01A 4CERA 3KKRA 1WLJA 4I2PA 4CEEA 2IDOA 4FCYA 3QINA 4ICLA 4DTJA 3KD5E 1TAQA 2VWKA 2VG6A 4CK2A 3BGRA 4Q5VA 3VQPA 3D0PA 1ITGA 2HVIA 1IKXA 1RT4A 5C24A 1L3SA 3RTVA 2QKKA 1DLOA 3NGZA 3VQ4A 3AO1A 4DTOA 4CGFA 4FJ7A 4AH9A 4CHOA 3AO5A 3U6FA 2HMIA 3NDKA 4N56A 3EZ5A 3V9WA 4OKKA 3C6UA 3DI6A 3OYIA 3OYJA 3K59A 3OYLA 1BI4A 3NFAA 4QCLA 1U45A 1KVCA 3A2FA 5HBMA 5KI6A 3ZCMA 4B8CA 3SI6A 4KB0A 2FBXA 1WSGA 1HNVA 3HPHA 1NK8A 3LP0A 1SL0A 4W5TA 1WAFA 1ASWA 1RNHA 4F3TA 3LP1A 3ZT3A 3PO4A 2X78A 4M3RA 1VSHA 3S9HA 3TAPA 1A5XA 1JLFA 2Z1GA 3V81A 1RTHA 5CY4A 3TWHA 3VQQA 3RR7A 1KSPA 3V9XA 4CEQA 1RBRA 1VSEA 4DTXA 3TAQA 3TI0A 3KTQA 4O0JA 2F8TA 3AVHA 4CIGA 1NK9A 3RMBA 2PYLA 1C6VA 1EP4A 2P51A 4OKEA 4CIEA 1VSJA 3OYMA 4YNQA 3NGIA 3RR8A 4KHSA 2ETJA 3KKSA 4I2QA 2HHUA 2HHQA 1SKSA 1LV5A 3PO5A 1L3UA 4KHQA 3K5OA 3VQ6A 4Z4CA 1QSYA 4PWDA 3SCXA 4Y1DA 1T03A 2D5RA 4LSNA 1TVRA 3O3FA 1GOBA 2G8HA 1KFDA 3OYBA 1B9DA 3CG7A 1J9AA 3T3FA 3HSTB 3DMJA 3K2PA 4M3XA 3OYFA 4E7HA 1S1VA 3OVNA 3RMAA 2G8WA 1D9DA 3QEWA 4DS5A 1HMVA 3SQ2A 1L5UA 4CHPA 1R0AA 3ZT4A 4CEFA 4HVJA 3LP3A 3LP2A 4HHTA 3RMDA 4M3YA 4FJMA 4E19A 4DQRA 1NJZA 1BCMA 2GV9A 5SWMA 2OPSA 5CYQA 4BACA 2XY5A 4E1MA 1F21A 4HCCA 2I5JA 1BISA 3IS9A 4DMNA 2O4GA 3SUOA 2R7YA 1LAWA 1JL1A 2ATQA 5K14A 3M8SA 3VQCA 2HHWA 5JS1A 1UA1A 4CF2A 4I9QA 4DG1A 2RF2A 1S5JA 5HRNA 4CGGA 3SNNA 1D8YA 4KI6A 1SL2A 3S3NA 4OLBA 2F8SA 1CXQA 5HRPA 2D0CA 2ZQBA 3B6OA 1BCOA 5HRRA 3C94A 4JS5A 3WNGA 3HM9A 4DF8A 2GBZA 3HPGA 2DTUA 4RW7A 4BDPA 4OVLA 4OPJA 4B9MA 4JRPA 1TKTA 3BDPA 4DLGA 3L2VA 4W5NA 4FJXA 3JSMA 2IC3A 4NCGA 3V9ZA 3L3UA 1X1PA 2HHSA 3TAFA 1RT6A 1QHTA 3HP9A 4E7JA 2OZSA 3ZT0A 3SYZA 1W9HA 1A5VA 4CJEA 5JS2A 4F2SA 4KHYA 3OJSA 4FW1A 4FLWA 2IAJA 4MQ3A 1A5WA 1NOYA 1TV6A 4FM2A 3SV3A 3KLIA 3EY1A 4KO0A 4OJRA 2X6SA 1FKOA 5CYMA 3AV9A 3ALYA 4M41A 3VQ9A 3ZSOA 1YT3A 2X74A 4AHSA 4KV8A 4FLVA 4E3SA 1ASVA 4AHCA 3OS2A 4KTQA 1RILA 4OLAA 3TAEA 4LH4A 3I8DA 1WSJA 1EKEA 3NH1A 4CJFA 4C8KA 5J2PA 2Z1HA 1VSLA 1S9GA 1RCHA 4RW8A 1S9EA 3VN5A 4CGIA 3KLFA 4B9LA 1RDDA 2XRIA 5HRSA 1JLGA 1RDAA 1S1UA 5FDLA 3KLGA 4B9VA 4H4OA 1C1AA 2ZE2A 1IKWA 4DQQA 3CFPA 2D0BA 4EZ9A 4FJ8A 3KK3A 1SV5A 3L8BA 3KJVA 1HQEA 4FJIA 1QSSA 2KFNA 1C0TA 2WOMA 3O3HA 3CYMA 4CJSA 1LWEA 1IKYA 1JKHA 4CFAA 3LAKA 3T1AA 1D5AA 4DSFA 4FJNA 4CF1A 4ELVA 1I3AA 1RBSA 1WN7A 4C8MA 3PX6A 1BQNA 3LPTA 4CJRA 1JXEA 3P5JA 1KVBA 1RBTA 3P83D 3K57A 3S3MA 1NKEA 4M3ZA 3VA0A 5KTQA 4FXDA 1HYZA 1Y97A 2YNIA 3V1QA 3QEXA 4B9TA 3ZT2A 5I3UA 4OGCA 4FJ5A 2KZZA 1I39A 3U3GA 4CF9A 4DFMA 1BL3A 1JLBA 2VG7A 1VSFA 1LW2A 3NAEA 4DQSA 1T8EA 4OGEA 3QLHA 3SUQA 4M3UA 4FYDA 1U49A 4OPKA 3NE6A 1SUQA 1QTMA 3HK2A 1TKXA 2VG5A 1B9FA 3AO4A 2G8UA 2A1SA 4Y1CA 4DU1A 3PX0A 4N5SA 4NCBA 3TAMA 5J1EA 4IBNA 4ZTFA 4GVMA 1VRTA 3S3OA 1NJYA 3TARA 4UQGA 1FXXA 3AVJA 1ZBIA 1CLQA 4KHUA 4GMJB 5J2MA 3PX4A 4CCHA 1W0HA 3HJFA 2EHGA 4FJJA 3P1GA 2E4LA 3OYHA 1HYVA 3AO2A 3OS0A 3ASMA 5CZ2A 2HNDA 4CE9A 3VQAA 1LW0A 2IOCA 2YHAA 3MXIA 2E6LA 4E1NA 4CHQA 4M3TA 3V9SA 3OY9A 3QESA 3M8RA 3AVBA 4PA1A 1ZBUA 4E0DA 4KPYA 1HNIA 3AVLA 3KK2A 4F4KA 5J2QA 3MAQA 3SQ0A 3CQ8A 1BI4B 1RTJA 4FLYA 1KFSA 1S1WA 4B9UA 4CF0A 2XY7A 3SUPA 2FBTA 4OKJA 4ZHRA 3MEGA 2JLEA 4ELTA 1WSFA 1IKVA 1EETA 3PY8A 2ITGA 3SZ2A 3QEIA 4DSLA 4KHNA 1NOZA 3HYFA 4FJGA 5FROA 2XHBA 2BGGA 1UAXA 3KD1E 2DFHA 1RT7A 4DTUA 3T19A 3AVGA 4CESA 1S6QA 1U48A 2QXFA 2Q3SA 3QNNA 1RTDA 4EZ6A 3K5MA 1FK9A 4CJ5A 1YTAA 3KK1A 4AILC 4DWIA 1VSKA 3C6TA 3D45A 1UOCA 3IAYA 4M42A 1VK0A 3AA2A 4IDKA 2DFEA 3L2WA 2A1RA 4O4GA 3QERA 3ZSQA 4N47A 4HUEA 4CJLA 2B5JA 3VQDA 4FLXA 4FLUA 4E7IA 2EX3A 3OYKA 2NUBA 3O4QA 1LWFA 4CJQA 2Z1JA 3AVKA 3RMCA 4N41A 4Z4EA 3AVCA 3L2QA 3NCIA 4M45A 3TAGA 3QIOA 1NJWA 5T7BA 3HPOA 2BDPA 3DLHA 4B08A 2P5OA 3LDSA 3QETA 4DSEA 3ZT1A 1IO2A 4CK1A 1MU2A 2XO7A 1VSDA 5KRTA 2QK9A 3DOLA 4DF4A 1ZBHA 2Y1IA 2QKBA 2DY4A 1QE1A 1RT5A 2OPRA 2VWJA 4KHWA 1HRHA 2WONA 1JLAA 1VSMA 4CIFA 4FM0A 3DLKA 1TAUA 4I9LA 4FVMA 2HB5A 1ZYQA 3AA3A 1QSLA 1XHZA 1C0MA 1QQCA 1WNSA 3DOKA 5KGXA 3VA3A 3DLRA 1J5OA 2G8VA 4DLEA 4AHRA 3THVA 1T05A 1HJRA 1HQUA 2LSNA 4GW6A 4H4MA 1D9FA 4KRFA 3HXMA 4PUOA 2XY8A 4HUGA 4H8KA 1U4BA 3KLHA 3RWUA 3LZJA 4IG0A 2G8KA 3AVNA 3ITHA 5E41A 3OYNA 1G15A 1XWLA 2G8FA 4DSIA 5FRNA 4FK4A 1KVAA 3AVAA 1IG9A 4KAZA 3NH2A 2RPIA 1XI1A 1L3TA 3VQ7A 2XY6A 4ID5A 3OYCA 3PV8A 3IG1A 4MFBA 3TABA 3OYEA 1ZBLA 4CGJA 2PY5A 3HVTA 3V1OA 4DTNA 3UIQA 1NK5A 2YNHA 4O5BA 4CGDA 4BE0A 1UWBA 4RW4A 1Z26A 4B9SA 1TGOA 2OYQA 3LAMA 4JLHA 3EYZA 3DRRA 3LANA 4CEBA 3HT3A 4E7KA 4KFBA 2YV0X 4JRQA 1RTIA 1Q9XA 2Z1IA 3LWMA 1TL3A 3SJJA 1U04A 1RT1A 1NKBA 2HHXA 3TR8A 4Z4FA 3DM2A 1LAVA 2RKIA 4BDZA 4KI4A 3DLEA 1GOAA 3ZSZA 4AHVA 3LPUA 1NK6A 1X9MA 1J53A 2HNZA 3DRSA 1J54A 3VQEA 4CJ3A 1TKZA 3H08A 4ID1A 4C8NA 4IKFA 2O4IA 4CJVA 1S1TA 4CHZA 4CEZA 2OPQA 4NCAA 3G0ZA 3OYGA 3U3YA 4Z4GA 4BE1A 2BE2A 4KTZA 4DTRA 4IG3A 2YNFA 3CM5A 2PZSA 3CFOA 1KLMA 1O1WA 4J2EA 2KZMA 3NF6A 1IH7A 4PY5A 3DRPA 4KTWA 4M3WA 4QOZB 2KTQA 1NK4A 4EP4A 4CHYA 2B6AA 2FBYA 3CFRA 4AHTA 3LWLA 3B6PA 4QAGA 4FJKA 4C8LA 5HP1A 4FK2A 4Z4IA 4AHUA 4IFYA 3SUNA 3MEEA 4FLZA 3RRHA 4LY7A 3VQ5A 1WSHA 4DQIA 2YKNA 2DFFA 4PQUA 1RBUA 4DTPA 1Z25A 1WSIA 1SKWA 1VRUA 4FK0A 4J2AA 3PUFA 1L3VA 1Q9YA 4FM1A 1EXQA 3AO3A 3M8PA 3SPYA 4W5RA 4F2RA 3DLBA 1JLEA 2FC0A 3NBPA 1DTQA 4CJKA 4DS4A 1N5YA 3F73A 3L3VA 1GOCA 4FW2A 5KRSA 3IRXA 4LH5A 2E6MA 4CJ4A 4DSJA 1S1XA 2BANA 3ISNC 3VQ8A 4K8ZA 2X6NA 3WNEA 1RDBA 4CGHA 4DFKA 1BGXT 1JXBA 4R5PA 4HTUA 4FJ9A 2HHTA 2OA8A 1CZBA 4BWMA 2YKMA 3M8QA 3V1RA 1YTUA 5C42A 3NF7A 4I7FA 4O0IA 4BDYA 4FZXC 1HYSA 3DYAA 1U47A 2PYJA 1NKCA 2JGUA 4E89A 1FKPA 3HO1A 3SQ4A 4FJLA 3K5NA 4CJPA 5C25A 2KFZA 4ELUA 1BIZA 3WNHA 3KLEA 1JLQA 1T7PA 1WAJA 3I0RA 4DQPA 2KW4A 2OZMA 1WSEA 3O4NA 4CFDA 4NYFA 1CXUA 4JS4A 4EP5A 2YNGA 3V9UA 4IFVA 5KGWA 4DU4A 1RT3A 3QNOA 1TK0A 4KB1A 4TSXA 1EX4A 4CK3A 3LZIA 4KKOA 1C1BA 3AVMA 4E7LA 1NJXA 3FFIA 5DMRA 3MXJA
chains in the Genus database with same CATH superfamily
2P9PB 3TTDA 4RG8A 1C1CA 4BY9C 4BR9A 4CECA 5AQIA 1U2VB 2WC9A 5LJWA 3WNFA 3F9KA 1V4SA 4WF9L 1BIUA 3O9QA 2HMPA 1YITN 4Q0BA 5GADP 1S6PA 4R79A 4ZTJA 1KD1O 3CMEN 2Q31A 1IG8A 4X64K 3DLGA 4PL7A 4Z4HA 1NGBA 4NXMK 4DU3A 5EU7A 2D0AA 1KCFA 5KQDA 1REVA 5FPMA 4X66K 3RSEA 4Z0UA 1BA0A 1C0UA 4FZZA 1J6ZA 3TSPA 4HCBA 3ZSRA 4DV5K 1FW6A 2KQ2A 3QB0A 3CC7N 4BE2A 3EZWA 2HVHA 3HL8A 4DFJA 1KLNA 3L2RA 1JJ2M 3O9TA 4L3QA 2ZD1A 4DFPA 3K58A 4EIAA 1TKDA 1UA0A 4BRKA 2A3ZA 1IBLK 2P1JA 1VQ7N 4DV6K 4CFCA 3KKRA 4JNEA 3MK6A 2E2PA 2HHHK 3KD5E 2UXBK 3WQUA 3VQPA 3HRGA 3E9PA 4DHYA 2QKKA 4OO1J 3AO1A 3EE9A 4CGFA 4CHOA 3QICA 1K8KA 1ATRA 3EZ5A 3BZCA 3OYIA 3K59A 2VQEK 3NFAA 1KVCA 4FWSA 2V52B 5KI6A 3VF4A 3SI6A 1HPMA 2FBXA 3LL3A 5AJ3K 3J80O 3B8AX 1NK8A 4BRCA 2YHWA 3CXCM 3PO4A 3U9ZA 3S9HA 3TAPA 3MWTA 1Z05A 3V81A 1RTHA 4BRDA 5CY4A 1HUXA 4KH6A 4FSVA 4CEQA 3TI0A 3AVHA 1NK9A 1C6VA 1EP4A 2P51A 1VQ4N 4C23A 4XH1A 3NGIA 4H0VB 4I2QA 5AQKA 2VWBA 1LV5A 1L3UA 1T03A 4ILHA 3O3FA 2G8HA 3O8MA 1B9DA 3T1YK 2VQFK 3THXA 2Q97A 3RMAA 2GUPA 3G6EN 1D9DA 3J7AP 4DS5A 3SQ2A 3ZX0A 1Q18A 3CQYA 3H46O 4YY3K 3CCSN 5CYQA 3SBTA 2XY5A 3IS9A 3L4IA 2O4GA 1LAWA 5AQXA 1UA1A 3LDNA 5AQJA 5HRNA 3CQXA 4LF7K 3CCVN 4I6MB 2KKZA 5LMUK 3P38A 4YORA 3CCEN 2D0CA 3BZKA 2GBZA 3HPGA 3ENOA 3BDPA 1ESVA 4FJXA 4K43A 2F7TA 2HHSA 3HP9A 2NRRA 4DKWA 4IJNA 1W9HA 4B1ZA 3OJSA 5BN9A 2W40A 1A5WA 3SLCA 1NGJA 1JCEA 1TV6A 3SV3A 3EY1A 1FKOA 4M41A 4FLVA 4E3SA 1ASVA 4QS8A 4KTQA 4MLEA 5LL6Z 5BR8K 3CC2N 4H0OA 5BPNA 1RDDA 2XRIA 5HRSA 5KPZA 1S1UA 1HR0K 4H4OA 3VEYA 4IZ9A 5HOOA 4FJ8A 4FJIA 3QDKA 1LWEA 4U67L 4JEPA 1ILYA 1I3AA 1WN7A 3THWB 1GLBG 3PX6A 4C1NI 5AQGA 3ZX3A 1KAXA 2ASMA 1Y97A 3I8BA 1N33K 5AZIA 4CW7B 2KZZA 1I39A 4DFMA 3D7EO 1HNZK 1DT9A 2NNWA 5KPRA 1VSFA 4DR1K 1LW2A 3NAEA 2QWQA 4BRQA 3SUQA 4OPKA 2G8UA 2A1SA 4JI4K 3NMUA 2FSNA 3C65A 2FSKA 1VRTA 3K9JA 3UKRB 1J5EK 3M6GA 4UQGA 2KLAA 1CLQA 3DWLA 3PX4A 4DUZK 3RVCA 2I7NA 2A40A 3WXLA 2HNDA 5B8HA 4A2AA 2IOCA 3MXIA 2E6LA 4E1NA 4BC3A 1KQSM 2P9UA 4F4KA 1NGFA 1BI4B 4FLYA 4RCHA 3MEGA 1D4XA 2JLEA 1WSFA 2O8BB 5FPNA 3SZ2A 4KHNA 5FROA 2NRXA 4BRGA 1UAXA 4BROA 2QXFA 1RTDA 4JKBA 4HTLA 3C6TA 3D45A 1OH6A 1UOCA 4M42A 1VK0A 2DFEA 2B5JA 4E7IA 4FLXA 2O8CB 1YI2N 2NRZA 3O4QA 4CJQA 4B3MK 5AQUA 3RMCA 5BN8A 3AVCA 3L2QA 2A5XA 3NCIA 3QIOA 3CCMN 3HM8A 2P5OA 4Y0WA 4JKDA 4JI5K 4DV4K 3MX2A 1YJWN 1VSDA 4PKHA 3DOLA 2QKBA 1ZBHA 2PAVA 1QQMA 4XH5A 2IIRA 3CHWA 2FLOA 4O8UA 2VWJA 4BG8A 4CIFA 3DLKA 3RSEB 4I9LA 2HB5A 1QSLA 4LF9K 3D2FA 3HOSA 1NGHA 3J7ZO 4DLEA 1T05A 4H4MA 2LSNA 1HJOA 3QBWA 2XY8A 4HUGA 1U4BA 3KLHA 5GIOA 1XWLA 5AQQA 3VQ7A 3CF5L 3BF3A 3OYCA 3PV8A 4MFBA 5AQRA 3HVTA 3V1OA 3CCQN 4DTNA 4FPAA 2OYQA 5GINA 1BDGA 4KFBA 3F5TA 4JRQA 1RTIA 3LWMA 5C12A 1TL3A 3SJJA 1RT1A 5LY3A 3TR8A 3H1QA 2E5LK 4KI4A 2RKIA 3DLEA 1JCGA 1VQON 1X9MA 3VQEA 4A57A 4CJ3A 4B1WB 1KAYA 3VESA 3G0ZA 4ISGA 3U3YA 2ASOA 3C0BA 2UYTA 2PZSA 3CFOA 3NF6A 1IH7A 2VCPA 4CZHA 4K42A 2KTQA 1BOTO 2FBYA 3AAPA 4C1NK 3BF1A 4QAGA 4C8LA 3SUNA 3RRHA 4PQUA 3CPEA 1RBUA 3F9MA 4WFAL 5JVGL 4BRFA 2E2OA 4J2AA 1Q9YA 3HZ6A 3M8PA 3SPYA 1NBWA 4DS4A 3NBPA 3M3ZA 1N5YA 3F73A 1GOCA 5KRSA 3PIPL 4JD2B 1S1XA 3QMLA 3VQ8A 5AQNA 4K8ZA 3ZX2A 4CGHA 5BREA 4BWMA 3M8QA 2QA4N 1YTUA 3A5MC 4I7FA 4LF8K 3DYAA 1U47A 2JGUA 3WUHA 4PHTX 3R3LA 4CJPA 4ELUA 4AM7A 2KW4A 4E7LA 3J81O 1EWRA 1HLUA 4CFDA 4EHTA 4EP5A 4LFAK 5KGWA 4DU4A 3FFIA 2QWRA 3AVIA 5M1OA 3R8EA 4LD0A 3TANA 1QVFM 3QIPA 2A6AA 2QXLA 3MX5A 1IJJA 5IT9O 4NXNK 4GNIA 1KTQA 3N4QA 1QHAA 3QEPA 4DCHA 2HHVA 4YFUA 3D2EB 1NK0A 1NK7A 1T6CA 2IVPA 2QM1A 3MCPA 2W42A 3ZETA 1TL1A 3TTCA 5EXWA 4BQZA 3GDQA 1ASUA 2ITMA 2ZJQL 5D3GA 3ZSXA 3AA4A 4JI7K 1BHLA 1ZBFA 4K8XA 3ZSWA 2NRTA 3OJUA 4JI0K 4BRIA 2OPPA 1C0FA 4H5RA 3OS1A 3OYDA 4O55A 1X9WA 1B92A 4FWNA 4JI2K 1NG9A 4IJAA 4CJTA 2WUSA 3LM2A 5BRDA 1RDUA 4BQLA 1KRPA 4KREA 4CBXA 1HNWK 2GUIA 1SAZA 4CVNE 4CF8A 3MN6A 4CJUA 4CHNA 5CZ1A 1DTTA 3HP6A 5AQTA 3ULEA 4BG9A 4JKGA 2AJQA 3FR0A 4O5FA 4BGBA 3OYAA 5EOYA 5FRMA 3UKUA 3HSCA 1EWQA 1W2BM 3AAQA 3DXMA 3L6QA 2B4JA 1SKRA 3FLCO 2E1YA 1TK5A 3OBWA 4CEAA 3O4WA 4WE1A 3ID6A 4I2PA 4ICLA 4DTJA 4BR0A 1TAQA 2VG6A 4CK2A 3VTHA 4A61A 4EFHA 4Q5VA 1ITGA 3CCJN 2D4WA 1L3SA 3EKUA 3RTVA 1DLOA 4DTOA 4FWOA 3AO5A 3U6FA 2A42A 5AZJB 3NDKA 3OYJA 2ZM6K 5GAHP 2ZGYA 3A2FA 2EWSA 4KB0A 4BRAA 3FZHA 3IFRA 4AQYK 5ELZA 4W5TA 3QFUA 4M3RA 3J8AA 1HX1A 4KH4A 3SAFA 4DTXA 2F8TA 2HHTA 4OKEA 2J4RA 5GIPA 2ZWHA 2W6KA 5AQWA 2HHQA 1NGCA 2O8CA 4K41A 3VQ6A 1QSYA 2WTUA 3SCXA 4Y1DA 2D5RA 4V19S 5FPDA 4H5VA 3T3FA 5ADXH 3CJ1A 3K2PA 3LDPA 4M3XA 4WFNL 5F0XA 3OVNA 1TUYA 5KPTA 1L5UA 4CHPA 3ZT4A 4HVJA 3LP2A 3RMDA 4LF6K 4FJMA 3AARA 1NJZA 2GV9A 2O8DB 2OPSA 3BUZB 1F21A 4E1MA 4A59A 3DLLL 1BISA 3ZYYX 4B3RK 3M8SA 4FWKA 4PKGA 3VQCA 5MLCQ 4ILJA 1S5JA 1D8YA 2IVNA 4PKIA 5AFUA 2ASPA 3S3NA 1T3VA 5IWAK 2FSJA 1BCOA 5HRRA 3WNGA 3HM9A 4DF8A 1E3MA 2DTUA 1W7AA 4B9MA 1XMOK 3L2VA 3V9ZA 1X1PA 2OZSA 3ENHA 3SYZA 3WT0A 4DV2K 2QW9A 5JS2A 4FLWA 4FM2A 4KO0A 3O1WA 4OJRA 5JICA 5CYMA 3TPQA 3ALYA 2F4VK 3GOIA 3ZSOA 4BR4A 5C10A 4CD1A 4AHCA 1RILA 4OLAA 5M1KA 3I8DA 1WSJA 4YOVA 1EKEA 3NH1A 1KXPA 5J2PA 1VSLA 4CZEA 4CZFA 1RCHA 3KLFA 1S9EA 2P9IB 1JLGA 4BRNA 3KLGA 4B9VA 1C1AA 4H0XB 4DQQA 3VGLA 3DXMB 3CFPA 4EZ9A 3L8BA 1HQEA 2NRWA 1YHQN 1QSSA 3O3HA 3KWIA 1IKYA 4CFAA 4DSFA 4CF1A 4ELVA 1NGAA 3CJ7A 4BRHA 1N36K 1I94K 4CJRA 1JXEA 3A5LC 1KVBA 4M3ZA 3K57A 4GV6A 5KTQA 4FXDA 1HYZA 2VGMA 3V1QA 1NGIA 4KH5A 1Z6RA 4FJ5A 2O8EB 3U3GA 1OH5A 1JLBA 2VG7A 2E20A 3QLHA 4FYDA 1QTMA 3HK2A 1TKXA 2VG5A 1B9FA 4N5SA 5J1EA 3TARA 3A5OC 3O08A 1ZBIA 4KHUA 4GMJB 1VQPN 1W0HA 3WQTA 4A62A 2E4LA 3AO2A 3FFKB 3OS0A 4CE9A 3VQAA 2YHAA 1X3NA 4PA1A 1ZBUA 4KPYA 3AVLA 3CC4N 3SQ0A 3SUPA 2FBTA 4YOTA 2O8FA 3PY8A 2ITGA 4BRMA 4FJGA 5AQPA 1OH8A 3KD1E 4AF1A 3CETA 4CESA 5I9EB 4DR4K 3K5MA 4CJ5A 3FE1A 1VSKA 1NU0A 5AFUH 3VEOA 3L2WA 2A1RA 3Q7CA 2BTFA 4O4GA 3ZSQA 4HUEA 4CJLA 4MLHA 4FLUA 3T7ZA 2EX3A 3OYKA 2RE2A 3THYA 2Z1JA 3AVKA 1MDUB 5M1NA 4M45A 1NJWA 1XC3A 2V51B 3E1YA 3QETA 4CZLA 1MU2A 1IV0A 2Q0UA 1U2VA 1OH7A 4KHWA 2WONA 1IBKK 1JLAA 4FM0A 2OCEA 4BR5A 4FVMA 3FZFA 4DV0K 3TSQA 1QQCA 3ZEUB 3EO3A 5KGXA 3S41A 5C15A 2G8VA 1D9FA 3THVA 1HQUA 1P90A 3O5BA 5HL7L 3G71N 3THWA 4JI8K 4PUOA 4BVOA 4O8KA 5E26A 3LZJA 4IG0A 5FRNA 4FK4A 1KVAA 4DB3A 3AVAA 3D6RA 3MDQA 4FWPA 1R59O 1X3MA 1L3TA 1NM1A 3IG1A 3EEQA 3P4IA 1VQ9N 2PY5A 4DUYK 1XMQK 3UIQA 2YNHA 4O5BA 1VHXA 4B9SA 3LAMA 3DRRA 3FZKA 2HBLA 2OANA 1Q9XA 1MWKA 2P9LA 4BDZA 3SJHA 4YOWA 3ZSZA 3LPUA 3CJ9A 1VAZA 3DRSA 1J54A 4C8NA 3CJBA 4CJVA 3ZETB 3OYGA 4ISFA 3GE1A 5LMNK 4IG3A 2YNFA 2KZMA 1O1WA 4RWTA 3DRPA 5AQYA 2NZTA 4EP4A 1H1VA 4A5BA 2CH6A 3H3NO 5HP1A 4FK2A 1VQKN 4AHUA 4Z4IA 3MEEA 4GV3A 3O9SA 3WXMB 2QWNA 1WSHA 4DQIA 1NGGA 1BA1A 2NRHA 5DM6L 1Z25A 4CZJA 1VRUA 2H3GX 4FM1A 4W5RA 1JLEA 2F9WA 4IFEA 4FW2A 2E6MA 4CJ4A 3P31A 4IO8A 4NLBA 4IOCL 4FL9A 4LC9B 3WNEA 1RDBA 5DM7L 1Q82O 1ATNA 4R5PA 1YVNA 2UUBK 4BDYA 1LOTB 1HYSA 3H1VX 1NKCA 4E89A 1FKPA 3KWGA 1OVQA 2KFZA 3OA9A 3WNHA 3KLEA 1T7PA 1WAJA 3I0RA 4EAHD 1EQYA 5AQHA 5BPMA 4B1XB 4IFVA 1RT3A 1TK0A 2PBDA 4FOEA 2E88A 3BEXA 1N6QA 3L2UA 1WUAA 3K5LA 2YHXA 4JHDB 4DTMA 3MEDA 3HVRA 3V4IA 4BR7A 3KK7A 2HOEA 4F3OA 2Y1JA 4CEDA 2F96A 3MXMA 4B3OA 4JI1K 4Z94A 3AVFA 4FZYA 1S3XA 4CJWA 3WEEA 1Q8IA 2CGKA 4G1QA 4HUFA 1VSIA 1SL1A 4MDAA 4B3SK 2P9SA 3VTIA 1K6YA 1LWCA 4FWMA 3ULEB 3I33A 4W5QA 2UUCK 1NMNA 4CEOA 3V6DA 1X9JA 4JKAA 2P5GA 4L8RB 2P9IA 3NF8A 1BG3A 4O44A 1CZ9A 4FLTA 1YF5L 1W97L 1KAZA 1Q81O 1QS4A 2HNYA 4CFBA 5TKYA 4WYBA 4H5NA 3U8XA 3ZLJA 1BQMA 1QQNA 2IS3A 3MECA 4F8RA 1XHXA 3NF9A 3VEWA 2YHBA 4J8FA 3LALA 3G25A 5HLFA 1YAGA 3CERA 3NHGA 3AGRA 1RT2A 4RW6A 3ZSVA 2YCHA 3SQ1A 1HPZA 5EVZA 4WFBL 4DV3K 2FBVA 3I0SA 4YHHK 5C0YA 4JV5K 1TYQA 3C95A 3WXIA 1VQNN 3E01A 1WLJA 2D0OA 3FZMA 4MDBA 1NGEA 2VWKA 1N34K 3BGRA 2HVIA 1IKXA 5C24A 3SK3A 3NGZA 3VQ4A 4FJ7A 4AH9A 4YOYA 1KC8O 2HMIA 4IEIA 4KHPK 5CE3A 2ZF5O 4N56A 2YX6A 3V9WA 4H0PA 3C6UA 4OKKA 4QCLA 1U45A 5HBMA 4YDUC 3ZCMA 5JLFA 3H6EA 4XEIA 3C7NB 5EX5A 1WSGA 1HNVA 3LP0A 1ATSA 2OTJN 2HSTA 1WAFA 1ASWA 1RNHA 4F3TA 3KHYA 3LP1A 3ZT3A 1VSHA 3T69A 1A5XA 1JLFA 4ILGB 3EE8A 3O9RA 3RR7A 1RBRA 1VSEA 3TAQA 1QQOA 3KZBA 1OKJA 4J2DA 3RR8A 4NLCA 3OYMA 4KHSA 4YNQA 2ETJA 2P9NB 2WBNA 5GAEP 3W0LA 1N8RO 3PO5A 2KHOA 4QS9A 2GTDA 4KHQA 3W3DA 2ZJRL 4DR2K 1WBDA 4JD2A 1TVRA 3SBGA 3O6WA 1GOBA 5M1FA 3HSTB 2P9PA 4IXCA 4E7HA 1S1VA 2G8WA 2CH5A 3NVKA 3QEWA 1K8AO 2UXDK 1HMVA 3U9DA 3IUCA 4CEFA 4HHTA 3JXUA 3OTOK 3IMXA 1BCMA 5SWMA 5AQOA 4FVUA 1ZC6A 2I5JA 1O13A 4DMNA 1JCFA 2HHWA 5K14A 4BGAA 5JS1A 1GLFO 4I9QA 4DG1A 2RF2A 2P9KA 4CGGA 4KI6A 3ATVA 2HBKA 5HRPA 1NJIO 4LFBK 3B6OA 4WQ4C 4RW7A 4BDPA 4OVLA 4OPAA 1TKTA 4B1YB 4DR5K 2IVOA 3JSMA 4F9OA 2OTLN 3A8YA 3L3UA 3TAFA 1RT6A 1QHTA 4F2SA 4KHYA 4CJEA 4CZKA 2IAJA 3D2EA 4MQ3A 4GVEA 3KLIA 3F2KA 4JK8A 1XUPO 1XNQK 5CHIA 1GLEG 3HTVA 3VQ9A 1YJNN 1YT3A 4KV8A 3CCLN 3TAEA 4LH4A 4CJFA 4C8KA 3VENA 3A0IX 3VN5A 4EHUA 1GLAG 1IKWA 2D0BA 3KK3A 3KJVA 2KFNA 1C0TA 4JN4A 3LAKA 1D5AA 1RBSA 4C8MA 4GY2B 3LPTA 4CD3A 1RFQA 3P83D 5AQFA 5EY4A 4BREA 2YNIA 3QEXA 2QI2A 4B9TA 4GV9A 5M1PA 4OGCA 3Q7BA 4CF9A 3VF6A 4JKGB 1RGIA 4H0YB 1YUWA 4CBUA 1U49A 4XH4A 4FWRA 4Y1CA 4DU1A 4BC4A 2BH1A 4GVMA 3S3OA 1NJYA 4GKKK 1FXXA 4FOIA 5J2MA 3A5NC 4CCHA 2EHGA 4MO5A 4JK9A 3ASMA 3SMSA 1LW0A 1QZ5A 3V9SA 3QESA 2AP1A 3AVBA 1YIJN 2O8EA 4E0DA 4JI6K 1HNIA 5J2QA 1KFSA 3CQ8A 1RTJA 1QVGM 2E2QA 3C6AA 3MN9A 3GBTA 1BU6O 2HBJA 4ZHRA 4ELTA 2NLXA 3QEIA 1U6ZA 1MA9B 1NOZA 3HYFA 2BGGA 1RT7A 1XQSC 4DTUA 3T19A 3AVGA 1WBBA 1S6QA 1U48A 3QNNA 2Q3SA 4Z4EA 2NRVA 4AILC 1YTAA 1YXQA 3ZEUA 3AA2A 1WOQA 4DQ8A 1NLVA 5JVHL 3QERA 3VQDA 2NUBA 1LWFA 2Q1NA 5JMVA 3TAGA 2BDPA 5T7BA 3HPOA 4I6MA 3DLHA 4B08A 2Q0RA 4WQ4A 4DSEA 2O8FB 2HF3A 4YDUA 2XO7A 2BUPA 4H0TB 5KRTA 2QK9A 5BR9A 4JKCA 1QE1A 4WQ5A 1VSMA 2D1KA 3P39A 1ZYQA 1XHZA 3DOKA 3ATUA 3CIPA 3DLRA 3VA3A 1BUPA 4CJ7A 5C2FA 4H8KA 4WQ5C 4IKFA 2G8KA 3AVNA 3VMFB 5E41A 1G15A 3I56N 4KAZA 3NH2A 2RPIA 1XI1A 4ID5A 3TABA 3OYEA 3T1HK 4BE0A 1UWBA 4RW4A 1Z26A 1YJ9N 2A41A 3EYZA 3LANA 4DV7K 1GLCG 3PSFA 2GX9A 1NKBA 1U04A 2HHXA 3DM2A 2E2NA 1LAVA 4AHVA 1NK6A 1VQMN 2QWLA 1J53A 2HNZA 1TKZA 4ID1A 3MN5A 3TSUA 5AQSA 1S1TA 4CHZA 2FF3B 1N32K 4BRPA 4BE1A 4DTRA 4J2EA 4PL8A 4PY5A 4NO7A 1HKBA 2GWJA 4QOZB 1NK4A 1QZ6A 4NB4A 2HBMA 4FO0A 2ZJPL 3QBXA 3B6PA 3LWLA 3AY9A 4FJKA 4IFYA 5C2DA 4FLZA 4LY7A 3VQ5A 1ZBSA 3FZLA 2DFFA 4DTPA 2GEMA 1WSIA 1SKWA 1L3VA 3AO3A 5AZJA 2RHKA 3CJAA 5AQZA 2FC0A 3DLBA 5KQ8A 3L3VA 3QFPA 2BANA 2QTDA 1WB9A 3THXB 1DGKN 1JXBA 3VOVA 4FJ9A 2OA8A 1CZBA 2YHYA 3V1RA 2YKMA 4FZXC 5H1SQ 3HO1A 3L0QA 3SQ4A 4FJLA 3IDHA 3O1BA 4DQPA 2QEXN 5JLHA 2OZMA 3N4PA 3V9UA 4KB1A 4TSXA 1EX4A 4CK3A 1C1BA 3AVMA 5DMRA 3MXJA 5BRHA 4JYAK 4DR6K 3MWPA 5SZTA 3AA5X 2IGIA 3QO9A 4DTSA 2O8DA 2D0PA 1X9SA 3VGKA 5LJVA 3NH0A 2P9LB 4E1JA 5J2NA 4B9NA 4RTFD 2UXCK 3NGYA 1EO1A 5DK5A 4B8AB 2P9NA 3DAWA 3DXKB 3OHRA 3KIOA 3CM6A 2RN2A 4BR2A 2YI1A 2HW3A 1T6DA 2VGNA 5I42A 5BPLA 2QWMA 1JLCA 4BWJA 4B1UB 4FJHA 5F2RA 2WFBA 4LSLA 3G10A 3QEVA 4J2BA 1TYQB 1XC9A 4G9ZA 5FPEA 3SV4A 3MCAB 4FWQA 3VQBA 3SAHA 1JL2A 4XIUA 4W5OA 2PYJA 3E9LA 3JYTA 5HROA 1TK8A 2P9KB 3OBYA 3FGUA 3SPZA 4NYNA 4RW9A 5ADXA 4N76A 3ZSYA 4OX9K 4CZGA 1RBVA 3O3GA 1YVUA 4IWVA 3RRGA 1RDWX 2G8IA 3C7NA 3DJCA 3SAGA 1VQ8N 5AQVA 1RDCA 4C8OA 4LFCK 3ULDA 4DSKA 3MMVA 4CERA 4CEEA 2IDOA 4FCYA 3QINA 1SS6A 3D0PA 1RT4A 1CZAN 3J7YP 2JWLA 4GKJK 4IOAL 3DI6A 3OYLA 1BI4A 2V7ZA 4B8CA 3CJCA 5BRFA 1XNRK 3BP8A 3HPHA 1SL0A 3HOTA 2X78A 2JWKA 2Z1GA 4JKHA 5M1QA 3TWHA 3VERA 3VQQA 1KSPA 1SQKA 3V9XA 3KTQA 4BVPA 4O0JA 1GLLO 4CIGA 2PYLA 3RMBA 4CIEA 1VSJA 1T44A 3KKSA 3WEEB 2HHUA 1SKSA 3K5OA 4Z4CA 4IDHA 4PWDA 2P9SB 1LCUA 4LF5K 2CGLA 4LSNA 4K25A 4DV1K 3K9KA 1KFDA 3OYBA 3CG7A 1J9AA 3DMJA 4JI3K 3OYFA 5E84A 1R0AA 3LP3A 3UKRA 4M3YA 4E19A 4DQRA 3WXJA 4BACA 4HCCA 2QWPA 3SUOA 4B9QA 2R7YA 1JL1A 2ATQA 3VF2A 1DKGD 4CF2A 4UY8O 3TU5A 3SNNA 1GLDG 1SL2A 4OLBA 2F8SA 1NMDA 1OVYA 1CXQA 3CCUN 3NVMA 2W6LA 2ZQBA 2VYPA 5F1XA 3C94A 4JS5A 3AGKA 4JHDA 3VEXA 4JKFA 4OPJA 4JRPA 3GL1A 4DLGA 2HF4A 1VQ6N 4W5NA 4IO9L 1C0GA 2IC3A 4NCGA 4CZIA 4E7JA 2GWKA 3ZT0A 1S72N 1A5VA 1Q7YO 1MWMA 1NWKA 4FW1A 4DR3K 3LDQA 1NOYA 4AM6A 3VEZA 3CD6N 2X6SA 1GLJO 3AV9A 4AHSA 2X74A 3O80A 3OS2A 3L4QA 3CMAN 1VQ5N 2Z1HA 4M63C 3G4SN 1S9GA 4RW8A 4CGIA 4B9LA 1HKCA 3E66A 4B3TK 1TUUA 1RDAA 5FDLA 2ZE2A 4K0KK 3LM9A 4X62K 1SV5A 4A2BA 2WOMA 2AA4A 3CYMA 4CJSA 1JKHA 3T1AA 4FJNA 2V7YA 1BQNA 1NKEA 3P5JA 3S3MA 1RBTA 3VA0A 4DR7K 3ZT2A 5I3UA 2GELA 3MN7A 1BL3A 4DQSA 1T8EA 4OGEA 2I7PA 3R6MA 4M3UA 4B1VA 3NE6A 1SUQA 3AO4A 3PX0A 4NCBA 1IBMK 3TAMA 4IBNA 4ZTFA 3UB5A 4YOXA 3AVJA 3EN9A 4FPBA 2UU9K 3HJFA 4FJJA 4H5WA 3P1GA 2W41A 3OYHA 1HYVA 5CZ2A 1BO5O 4CHQA 4M3TA 3OY9A 4JAXA 3M8RA 3ENBA 5AZIB 3KK2A 1K73O 3MAQA 4B9UA 1S1WA 4CF0A 2XY7A 1HKGA 3BY5A 4OKJA 1VQLN 1IKVA 1EETA 5CR4A 4DSLA 3SMPA 3M5RA 2ZGZA 4U7BA 2XHBA 1BWFO 3CI5A 3LDOA 2DFHA 3EKSA 5GAGP 1HNXK 4EZ6A 1FK9A 3KK1A 4DWIA 3D2FB 4CI6A 5TKWA 4X65K 3IAYA 3LDLA 4IDKA 1NNEA 4N47A 5AR0A 3TTFA 4QS7A 4N41A 2UUAK 1Y64A 2DPNA 1FJGK 3PLAA 1E4FT 3LDSA 3ZT1A 1IO2A 2PFUA 4CK1A 4ISEA 4WCEL 4YOUA 4DF4A 2Y1IA 3M1FA 2DY4A 1RT5A 2OPRA 2Q36A 1TAUA 1HRHA 3H3OB 3AA3A 3VPZA 1C0MA 3KVGA 1WNSA 3C6HA 3ID8A 3OW2M 1J5OA 4AHRA 1HJRA 1S22A 4GW6A 3VETA 4KRFA 4LF4K 3HXMA 1M1KO 3WXKA 5A2QO 3RWUA 3ITHA 3OYNA 2G8FA 4DSIA 1IG9A 2XY6A 2E1ZA 3H45C 1ZBLA 4CGJA 2F9TA 4BRLA 5AQLA 3U4LA 3E9OA 3JAMO 1NK5A 4CGDA 1TGOA 4H5TA 4JLHA 4CEBA 3HT3A 4E7KA 4A5AA 3PSIA 2YV0X 2Z1IA 4OPHA 1K9MO 4M7YA 3R9PA 2Q2RA 3UE5A 4Z4FA 1SZ2A 4CZMA 4FWLA 1GOAA 1V4TA 3VGMA 2YJFA 3DXKA 3H08A 4M7XA 2YJEA 2O4IA 4MO4A 4CEZA 2OPQA 4NCAA 2P9UB 5AQMA 4Z4GA 2BE2A 4CBWA 4KTZA 3HI0A 3CM5A 1KLMA 3I55N 3K0SA 2O8BA 3JS6A 4HWIA 4KTWA 1E4GT 4M3WA 4IOXA 4JK7A 4CHYA 2B6AA 3CFRA 3HBTA 3EL2A 4AHTA 3VEVA 2E8AA 1G99A 3O9UA 2YKNA 3GG4A 5FLXO 4FK0A 1K8KB 3PUFA 1EXQA 3IKMA 4F2RA 4CJKA 1DTQA 1DEJA 3IRXA 4LH5A 4DSJA 1P8ZA 3ISNC 2FF6A 3UKUB 3R1XA 1Q86O 2X6NA 4DFKA 3CCRN 1BGXT 2FXUA 4JKEA 4KBOA 4HTUA 4BC5A 5C42A 3NF7A 4O0IA 4H03B 3K5NA 5C25A 1BIZA 1JLQA 4BC2A 1ZXOA 1WSEA 3O4NA 3CPWM 1M90O 4NYFA 1CXUA 4JS4A 2QWOA 1NGDA 3THYB 2YNGA 3QNOA 1NJXA 3LZIA 4KKOA 4IEEA 3PIOL 2CGJA
chains in the Genus database with same CATH topology
4RG8A 1N6QA 3AVIA 3L2UA 1C1CA 3K5LA 4LD0A 4DTMA 3TANA 4CECA 3MEDA 3QIPA 5SZTA 3HVRA 3V4IA 3AA5X 2IGIA 4F3OA 2Y1JA 4CEDA 2F96A 3QO9A 4DTSA 3MXMA 4B3OA 1X9SA 3WNFA 3NH0A 3F9KA 1KTQA 3AVFA 3QEPA 5J2NA 4B9NA 2HHVA 1BIUA 3NGYA 4YFUA 1NK0A 4FZYA 4Q0BA 1S6PA 1NK7A 5DK5A 4B8AB 4CJWA 4ZTJA 1Q8IA 3KIOA 4G1QA 3CM6A 4HUFA 2RN2A 1VSIA 1SL1A 3DLGA 4Z4HA 2W42A 1TL1A 2HW3A 1K6YA 4DU3A 5EU7A 1LWCA 2D0AA 5I42A 1ASUA 1JLCA 4BWJA 5D3GA 1KCFA 3AA4A 4LSLA 3ZSXA 4W5QA 4FJHA 1BHLA 3G10A 1ZBFA 4CEOA 1REVA 3V6DA 3ZSWA 4K8XA 3QEVA 2P5GA 3OJUA 4L8RB 4J2DA 2OPPA 3NF8A 4J2BA 4O44A 4Z0UA 1CZ9A 4FLTA 1C0UA 4FZZA 4HCBA 3ZSRA 3OS1A 1XC9A 3SV4A 1QS4A 2HNYA 4CFBA 3OYDA 4O55A 1X9WA 1B92A 2KQ2A 3VQBA 1JL2A 2HVHA 4BE2A 1BQMA 4XIUA 3HL8A 2IS3A 4CJTA 3MECA 4W5OA 4DFJA 1XHXA 1TK8A 3JYTA 5HROA 3NF9A 1KLNA 1KRPA 4F8RA 4KREA 2YHBA 2GUIA 3L2RA 4CF8A 3SPZA 4CJUA 3LALA 4CHNA 5CZ1A 1DTTA 5HLFA 3HP6A 4NYNA 4RW9A 3NHGA 4N76A 3ZSYA 1RT2A 4RW6A 3ZSVA 1RBVA 3O3GA 3SQ1A 2AJQA 2ZD1A 4DFPA 1HPZA 1YVUA 3OYAA 3K58A 5FRMA 2FBVA 1TKDA 3RRGA 1UA0A 3I0SA 2G8IA 2P1JA 1RDCA 4C8OA 2B4JA 1SKRA 3ULDA 4DSKA 4CFCA 1TK5A 3C95A 4CEAA 4WE1A 3E01A 4CERA 3KKRA 1WLJA 4I2PA 4CEEA 2IDOA 4FCYA 3QINA 4ICLA 4DTJA 3KD5E 1TAQA 2VWKA 2VG6A 4CK2A 3BGRA 4Q5VA 3VQPA 3D0PA 1ITGA 2HVIA 1IKXA 1RT4A 5C24A 1L3SA 3RTVA 2QKKA 1DLOA 3NGZA 3VQ4A 3AO1A 4DTOA 4CGFA 4FJ7A 4AH9A 4CHOA 3AO5A 3U6FA 2HMIA 3NDKA 4N56A 3EZ5A 3V9WA 4OKKA 3C6UA 3DI6A 3OYIA 3OYJA 3K59A 3OYLA 1BI4A 3NFAA 4QCLA 1U45A 1KVCA 3A2FA 5HBMA 5KI6A 3ZCMA 4B8CA 3SI6A 4KB0A 2FBXA 1WSGA 1HNVA 3HPHA 1NK8A 3LP0A 1SL0A 4W5TA 1WAFA 1ASWA 1RNHA 4F3TA 3LP1A 3ZT3A 3PO4A 2X78A 4M3RA 1VSHA 3S9HA 3TAPA 1A5XA 1JLFA 2Z1GA 3V81A 1RTHA 5CY4A 3TWHA 3VQQA 3RR7A 1KSPA 3V9XA 4CEQA 1RBRA 1VSEA 4DTXA 3TAQA 3TI0A 3KTQA 4O0JA 2F8TA 3AVHA 4CIGA 1NK9A 3RMBA 2PYLA 1C6VA 1EP4A 2P51A 4OKEA 4CIEA 1VSJA 3OYMA 4YNQA 3NGIA 3RR8A 4KHSA 2ETJA 3KKSA 4I2QA 2HHUA 2HHQA 1SKSA 1LV5A 3PO5A 1L3UA 4KHQA 3K5OA 3VQ6A 4Z4CA 1QSYA 4PWDA 3SCXA 4Y1DA 1T03A 2D5RA 4LSNA 1TVRA 3O3FA 1GOBA 2G8HA 1KFDA 3OYBA 1B9DA 3CG7A 1J9AA 3T3FA 3HSTB 3DMJA 3K2PA 4M3XA 3OYFA 4E7HA 1S1VA 3OVNA 3RMAA 2G8WA 1D9DA 3QEWA 4DS5A 1HMVA 3SQ2A 1L5UA 4CHPA 1R0AA 3ZT4A 4CEFA 4HVJA 3LP3A 3LP2A 4HHTA 3RMDA 4M3YA 4FJMA 4E19A 4DQRA 1NJZA 1BCMA 2GV9A 5SWMA 2OPSA 5CYQA 4BACA 2XY5A 4E1MA 1F21A 4HCCA 2I5JA 1BISA 3IS9A 4DMNA 2O4GA 3SUOA 2R7YA 1LAWA 1JL1A 2ATQA 5K14A 3M8SA 3VQCA 2HHWA 5JS1A 1UA1A 4CF2A 4I9QA 4DG1A 2RF2A 1S5JA 5HRNA 4CGGA 3SNNA 1D8YA 4KI6A 1SL2A 3S3NA 4OLBA 2F8SA 1CXQA 5HRPA 2D0CA 2ZQBA 3B6OA 1BCOA 5HRRA 3C94A 4JS5A 3WNGA 3HM9A 4DF8A 2GBZA 3HPGA 2DTUA 4RW7A 4BDPA 4OVLA 4OPJA 4B9MA 4JRPA 1TKTA 3BDPA 4DLGA 3L2VA 4W5NA 4FJXA 3JSMA 2IC3A 4NCGA 3V9ZA 3L3UA 1X1PA 2HHSA 3TAFA 1RT6A 1QHTA 3HP9A 4E7JA 2OZSA 3ZT0A 3SYZA 1W9HA 1A5VA 4CJEA 5JS2A 4F2SA 4KHYA 3OJSA 4FW1A 4FLWA 2IAJA 4MQ3A 1A5WA 1NOYA 1TV6A 4FM2A 3SV3A 3KLIA 3EY1A 4KO0A 4OJRA 2X6SA 1FKOA 5CYMA 3AV9A 3ALYA 4M41A 3VQ9A 3ZSOA 1YT3A 2X74A 4AHSA 4KV8A 4FLVA 4E3SA 1ASVA 4AHCA 3OS2A 4KTQA 1RILA 4OLAA 3TAEA 4LH4A 3I8DA 1WSJA 1EKEA 3NH1A 4CJFA 4C8KA 5J2PA 2Z1HA 1VSLA 1S9GA 1RCHA 4RW8A 1S9EA 3VN5A 4CGIA 3KLFA 4B9LA 1RDDA 2XRIA 5HRSA 1JLGA 1RDAA 1S1UA 5FDLA 3KLGA 4B9VA 4H4OA 1C1AA 2ZE2A 1IKWA 4DQQA 3CFPA 2D0BA 4EZ9A 4FJ8A 3KK3A 1SV5A 3L8BA 3KJVA 1HQEA 4FJIA 1QSSA 2KFNA 1C0TA 2WOMA 3O3HA 3CYMA 4CJSA 1LWEA 1IKYA 1JKHA 4CFAA 3LAKA 3T1AA 1D5AA 4DSFA 4FJNA 4CF1A 4ELVA 1I3AA 1RBSA 1WN7A 4C8MA 3PX6A 1BQNA 3LPTA 4CJRA 1JXEA 3P5JA 1KVBA 1RBTA 3P83D 3K57A 3S3MA 1NKEA 4M3ZA 3VA0A 5KTQA 4FXDA 1HYZA 1Y97A 2YNIA 3V1QA 3QEXA 4B9TA 3ZT2A 5I3UA 4OGCA 4FJ5A 2KZZA 1I39A 3U3GA 4CF9A 4DFMA 1BL3A 1JLBA 2VG7A 1VSFA 1LW2A 3NAEA 4DQSA 1T8EA 4OGEA 3QLHA 3SUQA 4M3UA 4FYDA 1U49A 4OPKA 3NE6A 1SUQA 1QTMA 3HK2A 1TKXA 2VG5A 1B9FA 3AO4A 2G8UA 2A1SA 4Y1CA 4DU1A 3PX0A 4N5SA 4NCBA 3TAMA 5J1EA 4IBNA 4ZTFA 4GVMA 1VRTA 3S3OA 1NJYA 3TARA 4UQGA 1FXXA 3AVJA 1ZBIA 1CLQA 4KHUA 4GMJB 5J2MA 3PX4A 4CCHA 1W0HA 3HJFA 2EHGA 4FJJA 3P1GA 2E4LA 3OYHA 1HYVA 3AO2A 3OS0A 3ASMA 5CZ2A 2HNDA 4CE9A 3VQAA 1LW0A 2IOCA 2YHAA 3MXIA 2E6LA 4E1NA 4CHQA 4M3TA 3V9SA 3OY9A 3QESA 3M8RA 3AVBA 4PA1A 1ZBUA 4E0DA 4KPYA 1HNIA 3AVLA 3KK2A 4F4KA 5J2QA 3MAQA 3SQ0A 3CQ8A 1BI4B 1RTJA 4FLYA 1KFSA 1S1WA 4B9UA 4CF0A 2XY7A 3SUPA 2FBTA 4OKJA 4ZHRA 3MEGA 2JLEA 4ELTA 1WSFA 1IKVA 1EETA 3PY8A 2ITGA 3SZ2A 3QEIA 4DSLA 4KHNA 1NOZA 3HYFA 4FJGA 5FROA 2XHBA 2BGGA 1UAXA 3KD1E 2DFHA 1RT7A 4DTUA 3T19A 3AVGA 4CESA 1S6QA 1U48A 2QXFA 2Q3SA 3QNNA 1RTDA 4EZ6A 3K5MA 1FK9A 4CJ5A 1YTAA 3KK1A 4AILC 4DWIA 1VSKA 3C6TA 3D45A 1UOCA 3IAYA 4M42A 1VK0A 3AA2A 4IDKA 2DFEA 3L2WA 2A1RA 4O4GA 3QERA 3ZSQA 4N47A 4HUEA 4CJLA 2B5JA 3VQDA 4FLXA 4FLUA 4E7IA 2EX3A 3OYKA 2NUBA 3O4QA 1LWFA 4CJQA 2Z1JA 3AVKA 3RMCA 4N41A 4Z4EA 3AVCA 3L2QA 3NCIA 4M45A 3TAGA 3QIOA 1NJWA 5T7BA 3HPOA 2BDPA 3DLHA 4B08A 2P5OA 3LDSA 3QETA 4DSEA 3ZT1A 1IO2A 4CK1A 1MU2A 2XO7A 1VSDA 5KRTA 2QK9A 3DOLA 4DF4A 1ZBHA 2Y1IA 2QKBA 2DY4A 1QE1A 1RT5A 2OPRA 2VWJA 4KHWA 1HRHA 2WONA 1JLAA 1VSMA 4CIFA 4FM0A 3DLKA 1TAUA 4I9LA 4FVMA 2HB5A 1ZYQA 3AA3A 1QSLA 1XHZA 1C0MA 1QQCA 1WNSA 3DOKA 5KGXA 3VA3A 3DLRA 1J5OA 2G8VA 4DLEA 4AHRA 3THVA 1T05A 1HJRA 1HQUA 2LSNA 4GW6A 4H4MA 1D9FA 4KRFA 3HXMA 4PUOA 2XY8A 4HUGA 4H8KA 1U4BA 3KLHA 3RWUA 3LZJA 4IG0A 2G8KA 3AVNA 3ITHA 5E41A 3OYNA 1G15A 1XWLA 2G8FA 4DSIA 5FRNA 4FK4A 1KVAA 3AVAA 1IG9A 4KAZA 3NH2A 2RPIA 1XI1A 1L3TA 3VQ7A 2XY6A 4ID5A 3OYCA 3PV8A 3IG1A 4MFBA 3TABA 3OYEA 1ZBLA 4CGJA 2PY5A 3HVTA 3V1OA 4DTNA 3UIQA 1NK5A 2YNHA 4O5BA 4CGDA 4BE0A 1UWBA 4RW4A 1Z26A 4B9SA 1TGOA 2OYQA 3LAMA 4JLHA 3EYZA 3DRRA 3LANA 4CEBA 3HT3A 4E7KA 4KFBA 2YV0X 4JRQA 1RTIA 1Q9XA 2Z1IA 3LWMA 1TL3A 3SJJA 1U04A 1RT1A 1NKBA 2HHXA 3TR8A 4Z4FA 3DM2A 1LAVA 2RKIA 4BDZA 4KI4A 3DLEA 1GOAA 3ZSZA 4AHVA 3LPUA 1NK6A 1X9MA 1J53A 2HNZA 3DRSA 1J54A 3VQEA 4CJ3A 1TKZA 3H08A 4ID1A 4C8NA 4IKFA 2O4IA 4CJVA 1S1TA 4CHZA 4CEZA 2OPQA 4NCAA 3G0ZA 3OYGA 3U3YA 4Z4GA 4BE1A 2BE2A 4KTZA 4DTRA 4IG3A 2YNFA 3CM5A 2PZSA 3CFOA 1KLMA 1O1WA 4J2EA 2KZMA 3NF6A 1IH7A 4PY5A 3DRPA 4KTWA 4M3WA 4QOZB 2KTQA 1NK4A 4EP4A 4CHYA 2B6AA 2FBYA 3CFRA 4AHTA 3LWLA 3B6PA 4QAGA 4FJKA 4C8LA 5HP1A 4FK2A 4Z4IA 4AHUA 4IFYA 3SUNA 3MEEA 4FLZA 3RRHA 4LY7A 3VQ5A 1WSHA 4DQIA 2YKNA 2DFFA 4PQUA 1RBUA 4DTPA 1Z25A 1WSIA 1SKWA 1VRUA 4FK0A 4J2AA 3PUFA 1L3VA 1Q9YA 4FM1A 1EXQA 3AO3A 3M8PA 3SPYA 4W5RA 4F2RA 3DLBA 1JLEA 2FC0A 3NBPA 1DTQA 4CJKA 4DS4A 1N5YA 3F73A 3L3VA 1GOCA 4FW2A 5KRSA 3IRXA 4LH5A 2E6MA 4CJ4A 4DSJA 1S1XA 2BANA 3ISNC 3VQ8A 4K8ZA 2X6NA 3WNEA 1RDBA 4CGHA 4DFKA 1BGXT 1JXBA 4R5PA 4HTUA 4FJ9A 2HHTA 2OA8A 1CZBA 4BWMA 2YKMA 3M8QA 3V1RA 1YTUA 5C42A 3NF7A 4I7FA 4O0IA 4BDYA 4FZXC 1HYSA 3DYAA 1U47A 2PYJA 1NKCA 2JGUA 4E89A 1FKPA 3HO1A 3SQ4A 4FJLA 3K5NA 4CJPA 5C25A 2KFZA 4ELUA 1BIZA 3WNHA 3KLEA 1JLQA 1T7PA 1WAJA 3I0RA 4DQPA 2KW4A 2OZMA 1WSEA 3O4NA 4CFDA 4NYFA 1CXUA 4JS4A 4EP5A 2YNGA 3V9UA 4IFVA 5KGWA 4DU4A 1RT3A 3QNOA 1TK0A 4KB1A 4TSXA 1EX4A 4CK3A 3LZIA 4KKOA 1C1BA 3AVMA 4E7LA 1NJXA 3FFIA 5DMRA 3MXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG8 A;  1N6Q A;  3AVI A;  3L2U A;  1C1C A;  3K5L A;  4LD0 A;  4DTM A;  3TAN A;  4CEC A;  3MED A;  3QIP A;  5SZT A;  3HVR A;  3V4I A;  3AA5 X;  2IGI A;  4F3O A;  2Y1J A;  4CED A;  2F96 A;  3QO9 A;  4DTS A;  3MXM A;  4B3O A;  1X9S A;  3WNF A;  3NH0 A;  3F9K A;  1KTQ A;  3AVF A;  3QEP A;  5J2N A;  4B9N A;  2HHV A;  1BIU A;  3NGY A;  4YFU A;  1NK0 A;  4FZY A;  4Q0B A;  1S6P A;  1NK7 A;  5DK5 A;  4B8A B;  4CJW A;  4ZTJ A;  1Q8I A;  3KIO A;  4G1Q A;  3CM6 A;  4HUF A;  2RN2 A;  1VSI A;  1SL1 A;  3DLG A;  4Z4H A;  2W42 A;  1TL1 A;  2HW3 A;  1K6Y A;  4DU3 A;  5EU7 A;  1LWC A;  2D0A A;  5I42 A;  1ASU A;  1JLC A;  4BWJ A;  5D3G A;  1KCF A;  3AA4 A;  4LSL A;  3ZSX A;  4W5Q A;  4FJH A;  1BHL A;  3G10 A;  1ZBF A;  4CEO A;  1REV A;  3V6D A;  3ZSW A;  4K8X A;  3QEV A;  2P5G A;  3OJU A;  4L8R B;  4J2D A;  2OPP A;  3NF8 A;  4J2B A;  4O44 A;  4Z0U A;  1CZ9 A;  4FLT A;  1C0U A;  4FZZ A;  4HCB A;  3ZSR A;  3OS1 A;  1XC9 A;  3SV4 A;  1QS4 A;  2HNY A;  4CFB A;  3OYD A;  4O55 A;  1X9W A;  1B92 A;  2KQ2 A;  3VQB A;  1JL2 A;  2HVH A;  4BE2 A;  1BQM A;  4XIU A;  3HL8 A;  2IS3 A;  4CJT A;  3MEC A;  4W5O A;  4DFJ A;  1XHX A;  1TK8 A;  3JYT A;  5HRO A;  3NF9 A;  1KLN A;  1KRP A;  4F8R A;  4KRE A;  2YHB A;  2GUI A;  3L2R A;  4CF8 A;  3SPZ A;  4CJU A;  3LAL A;  4CHN A;  5CZ1 A;  1DTT A;  5HLF A;  3HP6 A;  4NYN A;  4RW9 A;  3NHG A;  4N76 A;  3ZSY A;  1RT2 A;  4RW6 A;  3ZSV A;  1RBV A;  3O3G A;  3SQ1 A;  2AJQ A;  2ZD1 A;  4DFP A;  1HPZ A;  1YVU A;  3OYA A;  3K58 A;  5FRM A;  2FBV A;  1TKD A;  3RRG A;  1UA0 A;  3I0S A;  2G8I A;  2P1J A;  1RDC A;  4C8O A;  2B4J A;  1SKR A;  3ULD A;  4DSK A;  4CFC A;  1TK5 A;  3C95 A;  4CEA A;  4WE1 A;  3E01 A;  4CER A;  3KKR A;  1WLJ A;  4I2P A;  4CEE A;  2IDO A;  4FCY A;  3QIN A;  4ICL A;  4DTJ A;  3KD5 E;  1TAQ A;  2VWK A;  2VG6 A;  4CK2 A;  3BGR A;  4Q5V A;  3VQP A;  3D0P A;  1ITG A;  2HVI A;  1IKX A;  1RT4 A;  5C24 A;  1L3S A;  3RTV A;  2QKK A;  1DLO A;  3NGZ A;  3VQ4 A;  3AO1 A;  4DTO A;  4CGF A;  4FJ7 A;  4AH9 A;  4CHO A;  3AO5 A;  3U6F A;  2HMI A;  3NDK A;  4N56 A;  3EZ5 A;  3V9W A;  4OKK A;  3C6U A;  3DI6 A;  3OYI A;  3OYJ A;  3K59 A;  3OYL A;  1BI4 A;  3NFA A;  4QCL A;  1U45 A;  1KVC A;  3A2F A;  5HBM A;  5KI6 A;  3ZCM A;  4B8C A;  3SI6 A;  4KB0 A;  2FBX A;  1WSG A;  1HNV A;  3HPH A;  1NK8 A;  3LP0 A;  1SL0 A;  4W5T A;  1WAF A;  1ASW A;  1RNH A;  4F3T A;  3LP1 A;  3ZT3 A;  3PO4 A;  2X78 A;  4M3R A;  1VSH A;  3S9H A;  3TAP A;  1A5X A;  1JLF A;  2Z1G A;  3V81 A;  1RTH A;  5CY4 A;  3TWH A;  3VQQ A;  3RR7 A;  1KSP A;  3V9X A;  4CEQ A;  1RBR A;  1VSE A;  4DTX A;  3TAQ A;  3TI0 A;  3KTQ A;  4O0J A;  2F8T A;  3AVH A;  4CIG A;  1NK9 A;  3RMB A;  2PYL A;  1C6V A;  1EP4 A;  2P51 A;  4OKE A;  4CIE A;  1VSJ A;  3OYM A;  4YNQ A;  3NGI A;  3RR8 A;  4KHS A;  2ETJ A;  3KKS A;  4I2Q A;  2HHU A;  2HHQ A;  1SKS A;  1LV5 A;  3PO5 A;  1L3U A;  4KHQ A;  3K5O A;  3VQ6 A;  4Z4C A;  1QSY A;  4PWD A;  3SCX A;  4Y1D A;  1T03 A;  2D5R A;  4LSN A;  1TVR A;  3O3F A;  1GOB A;  2G8H A;  1KFD A;  3OYB A;  1B9D A;  3CG7 A;  1J9A A;  3T3F A;  3HST B;  3DMJ A;  3K2P A;  4M3X A;  3OYF A;  4E7H A;  1S1V A;  3OVN A;  3RMA A;  2G8W A;  1D9D A;  3QEW A;  4DS5 A;  1HMV A;  3SQ2 A;  1L5U A;  4CHP A;  1R0A A;  3ZT4 A;  4CEF A;  4HVJ A;  3LP3 A;  3LP2 A;  4HHT A;  3RMD A;  4M3Y A;  4FJM A;  4E19 A;  4DQR A;  1NJZ A;  1BCM A;  2GV9 A;  5SWM A;  2OPS A;  5CYQ A;  4BAC A;  2XY5 A;  4E1M A;  1F21 A;  4HCC A;  2I5J A;  1BIS A;  3IS9 A;  4DMN A;  2O4G A;  3SUO A;  2R7Y A;  1LAW A;  1JL1 A;  2ATQ A;  5K14 A;  3M8S A;  3VQC A;  2HHW A;  5JS1 A;  1UA1 A;  4CF2 A;  4I9Q A;  4DG1 A;  2RF2 A;  1S5J A;  5HRN A;  4CGG A;  3SNN A;  1D8Y A;  4KI6 A;  1SL2 A;  3S3N A;  4OLB A;  2F8S A;  1CXQ A;  5HRP A;  2D0C A;  2ZQB A;  3B6O A;  1BCO A;  5HRR A;  3C94 A;  4JS5 A;  3WNG A;  3HM9 A;  4DF8 A;  2GBZ A;  3HPG A;  2DTU A;  4RW7 A;  4BDP A;  4OVL A;  4OPJ A;  4B9M A;  4JRP A;  1TKT A;  3BDP A;  4DLG A;  3L2V A;  4W5N A;  4FJX A;  3JSM A;  2IC3 A;  4NCG A;  3V9Z A;  3L3U A;  1X1P A;  2HHS A;  3TAF A;  1RT6 A;  1QHT A;  3HP9 A;  4E7J A;  2OZS A;  3ZT0 A;  3SYZ A;  1W9H A;  1A5V A;  4CJE A;  5JS2 A;  4F2S A;  4KHY A;  3OJS A;  4FW1 A;  4FLW A;  2IAJ A;  4MQ3 A;  1A5W A;  1NOY A;  1TV6 A;  4FM2 A;  3SV3 A;  3KLI A;  3EY1 A;  4KO0 A;  4OJR A;  2X6S A;  1FKO A;  5CYM A;  3AV9 A;  3ALY A;  4M41 A;  3VQ9 A;  3ZSO A;  1YT3 A;  2X74 A;  4AHS A;  4KV8 A;  4FLV A;  4E3S A;  1ASV A;  4AHC A;  3OS2 A;  4KTQ A;  1RIL A;  4OLA A;  3TAE A;  4LH4 A;  3I8D A;  1WSJ A;  1EKE A;  3NH1 A;  4CJF A;  4C8K A;  5J2P A;  2Z1H A;  1VSL A;  1S9G A;  1RCH A;  4RW8 A;  1S9E A;  3VN5 A;  4CGI A;  3KLF A;  4B9L A;  1RDD A;  2XRI A;  5HRS A;  1JLG A;  1RDA A;  1S1U A;  5FDL A;  3KLG A;  4B9V A;  4H4O A;  1C1A A;  2ZE2 A;  1IKW A;  4DQQ A;  3CFP A;  2D0B A;  4EZ9 A;  4FJ8 A;  3KK3 A;  1SV5 A;  3L8B A;  3KJV A;  1HQE A;  4FJI A;  1QSS A;  2KFN A;  1C0T A;  2WOM A;  3O3H A;  3CYM A;  4CJS A;  1LWE A;  1IKY A;  1JKH A;  4CFA A;  3LAK A;  3T1A A;  1D5A A;  4DSF A;  4FJN A;  4CF1 A;  4ELV A;  1I3A A;  1RBS A;  1WN7 A;  4C8M A;  3PX6 A;  1BQN A;  3LPT A;  4CJR A;  1JXE A;  3P5J A;  1KVB A;  1RBT A;  3P83 D;  3K57 A;  3S3M A;  1NKE A;  4M3Z A;  3VA0 A;  5KTQ A;  4FXD A;  1HYZ A;  1Y97 A;  2YNI A;  3V1Q A;  3QEX A;  4B9T A;  3ZT2 A;  5I3U A;  4OGC A;  4FJ5 A;  2KZZ A;  1I39 A;  3U3G A;  4CF9 A;  4DFM A;  1BL3 A;  1JLB A;  2VG7 A;  1VSF A;  1LW2 A;  3NAE A;  4DQS A;  1T8E A;  4OGE A;  3QLH A;  3SUQ A;  4M3U A;  4FYD A;  1U49 A;  4OPK A;  3NE6 A;  1SUQ A;  1QTM A;  3HK2 A;  1TKX A;  2VG5 A;  1B9F A;  3AO4 A;  2G8U A;  2A1S A;  4Y1C A;  4DU1 A;  3PX0 A;  4N5S A;  4NCB A;  3TAM A;  5J1E A;  4IBN A;  4ZTF A;  4GVM A;  1VRT A;  3S3O A;  1NJY A;  3TAR A;  4UQG A;  1FXX A;  3AVJ A;  1ZBI A;  1CLQ A;  4KHU A;  4GMJ B;  5J2M A;  3PX4 A;  4CCH A;  1W0H A;  3HJF A;  2EHG A;  4FJJ A;  3P1G A;  2E4L A;  3OYH A;  1HYV A;  3AO2 A;  3OS0 A;  3ASM A;  5CZ2 A;  2HND A;  4CE9 A;  3VQA A;  1LW0 A;  2IOC A;  2YHA A;  3MXI A;  2E6L A;  4E1N A;  4CHQ A;  4M3T A;  3V9S A;  3OY9 A;  3QES A;  3M8R A;  3AVB A;  4PA1 A;  1ZBU A;  4E0D A;  4KPY A;  1HNI A;  3AVL A;  3KK2 A;  4F4K A;  5J2Q A;  3MAQ A;  3SQ0 A;  3CQ8 A;  1BI4 B;  1RTJ A;  4FLY A;  1KFS A;  1S1W A;  4B9U A;  4CF0 A;  2XY7 A;  3SUP A;  2FBT A;  4OKJ A;  4ZHR A;  3MEG A;  2JLE A;  4ELT A;  1WSF A;  1IKV A;  1EET A;  3PY8 A;  2ITG A;  3SZ2 A;  3QEI A;  4DSL A;  4KHN A;  1NOZ A;  3HYF A;  4FJG A;  5FRO A;  2XHB A;  2BGG A;  1UAX A;  3KD1 E;  2DFH A;  1RT7 A;  4DTU A;  3T19 A;  3AVG A;  4CES A;  1S6Q A;  1U48 A;  2QXF A;  2Q3S A;  3QNN A;  1RTD A;  4EZ6 A;  3K5M A;  1FK9 A;  4CJ5 A;  1YTA A;  3KK1 A;  4AIL C;  4DWI A;  1VSK A;  3C6T A;  3D45 A;  1UOC A;  3IAY A;  4M42 A;  1VK0 A;  3AA2 A;  4IDK A;  2DFE A;  3L2W A;  2A1R A;  4O4G A;  3QER A;  3ZSQ A;  4N47 A;  4HUE A;  4CJL A;  2B5J A;  3VQD A;  4FLX A;  4FLU A;  4E7I A;  2EX3 A;  3OYK A;  2NUB A;  3O4Q A;  1LWF A;  4CJQ A;  2Z1J A;  3AVK A;  3RMC A;  4N41 A;  4Z4E A;  3AVC A;  3L2Q A;  3NCI A;  4M45 A;  3TAG A;  3QIO A;  1NJW A;  5T7B A;  3HPO A;  2BDP A;  3DLH A;  4B08 A;  2P5O A;  3LDS A;  3QET A;  4DSE A;  3ZT1 A;  1IO2 A;  4CK1 A;  1MU2 A;  2XO7 A;  1VSD A;  5KRT A;  2QK9 A;  3DOL A;  4DF4 A;  1ZBH A;  2Y1I A;  2QKB A;  2DY4 A;  1QE1 A;  1RT5 A;  2OPR A;  2VWJ A;  4KHW A;  1HRH A;  2WON A;  1JLA A;  1VSM A;  4CIF A;  4FM0 A;  3DLK A;  1TAU A;  4I9L A;  4FVM A;  2HB5 A;  1ZYQ A;  3AA3 A;  1QSL A;  1XHZ A;  1C0M A;  1QQC A;  1WNS A;  3DOK A;  5KGX A;  3VA3 A;  3DLR A;  1J5O A;  2G8V A;  4DLE A;  4AHR A;  3THV A;  1T05 A;  1HJR A;  1HQU A;  2LSN A;  4GW6 A;  4H4M A;  1D9F A;  4KRF A;  3HXM A;  4PUO A;  2XY8 A;  4HUG A;  4H8K A;  1U4B A;  3KLH A;  3RWU A;  3LZJ A;  4IG0 A;  2G8K A;  3AVN A;  3ITH A;  5E41 A;  3OYN A;  1G15 A;  1XWL A;  2G8F A;  4DSI A;  5FRN A;  4FK4 A;  1KVA A;  3AVA A;  1IG9 A;  4KAZ A;  3NH2 A;  2RPI A;  1XI1 A;  1L3T A;  3VQ7 A;  2XY6 A;  4ID5 A;  3OYC A;  3PV8 A;  3IG1 A;  4MFB A;  3TAB A;  3OYE A;  1ZBL A;  4CGJ A;  2PY5 A;  3HVT A;  3V1O A;  4DTN A;  3UIQ A;  1NK5 A;  2YNH A;  4O5B A;  4CGD A;  4BE0 A;  1UWB A;  4RW4 A;  1Z26 A;  4B9S A;  1TGO A;  2OYQ A;  3LAM A;  4JLH A;  3EYZ A;  3DRR A;  3LAN A;  4CEB A;  3HT3 A;  4E7K A;  4KFB A;  2YV0 X;  4JRQ A;  1RTI A;  1Q9X A;  2Z1I A;  3LWM A;  1TL3 A;  3SJJ A;  1U04 A;  1RT1 A;  1NKB A;  2HHX A;  3TR8 A;  4Z4F A;  3DM2 A;  1LAV A;  2RKI A;  4BDZ A;  4KI4 A;  3DLE A;  1GOA A;  3ZSZ A;  4AHV A;  3LPU A;  1NK6 A;  1X9M A;  1J53 A;  2HNZ A;  3DRS A;  1J54 A;  3VQE A;  4CJ3 A;  1TKZ A;  3H08 A;  4ID1 A;  4C8N A;  4IKF A;  2O4I A;  4CJV A;  1S1T A;  4CHZ A;  4CEZ A;  2OPQ A;  4NCA A;  3G0Z A;  3OYG A;  3U3Y A;  4Z4G A;  4BE1 A;  2BE2 A;  4KTZ A;  4DTR A;  4IG3 A;  2YNF A;  3CM5 A;  2PZS A;  3CFO A;  1KLM A;  1O1W A;  4J2E A;  2KZM A;  3NF6 A;  1IH7 A;  4PY5 A;  3DRP A;  4KTW A;  4M3W A;  4QOZ B;  2KTQ A;  1NK4 A;  4EP4 A;  4CHY A;  2B6A A;  2FBY A;  3CFR A;  4AHT A;  3LWL A;  3B6P A;  4QAG A;  4FJK A;  4C8L A;  5HP1 A;  4FK2 A;  4Z4I A;  4AHU A;  4IFY A;  3SUN A;  3MEE A;  4FLZ A;  3RRH A;  4LY7 A;  3VQ5 A;  1WSH A;  4DQI A;  2YKN A;  2DFF A;  4PQU A;  1RBU A;  4DTP A;  1Z25 A;  1WSI A;  1SKW A;  1VRU A;  4FK0 A;  4J2A A;  3PUF A;  1L3V A;  1Q9Y A;  4FM1 A;  1EXQ A;  3AO3 A;  3M8P A;  3SPY A;  4W5R A;  4F2R A;  3DLB A;  1JLE A;  2FC0 A;  3NBP A;  1DTQ A;  4CJK A;  4DS4 A;  1N5Y A;  3F73 A;  3L3V A;  1GOC A;  4FW2 A;  5KRS A;  3IRX A;  4LH5 A;  2E6M A;  4CJ4 A;  4DSJ A;  1S1X A;  2BAN A;  3ISN C;  3VQ8 A;  4K8Z A;  2X6N A;  3WNE A;  1RDB A;  4CGH A;  4DFK A;  1BGX T;  1JXB A;  4R5P A;  4HTU A;  4FJ9 A;  2HHT A;  2OA8 A;  1CZB A;  4BWM A;  2YKM A;  3M8Q A;  3V1R A;  1YTU A;  5C42 A;  3NF7 A;  4I7F A;  4O0I A;  4BDY A;  4FZX C;  1HYS A;  3DYA A;  1U47 A;  2PYJ A;  1NKC A;  2JGU A;  4E89 A;  1FKP A;  3HO1 A;  3SQ4 A;  4FJL A;  3K5N A;  4CJP A;  5C25 A;  2KFZ A;  4ELU A;  1BIZ A;  3WNH A;  3KLE A;  1JLQ A;  1T7P A;  1WAJ A;  3I0R A;  4DQP A;  2KW4 A;  2OZM A;  1WSE A;  3O4N A;  4CFD A;  4NYF A;  1CXU A;  4JS4 A;  4EP5 A;  2YNG A;  3V9U A;  4IFV A;  5KGW A;  4DU4 A;  1RT3 A;  3QNO A;  1TK0 A;  4KB1 A;  4TSX A;  1EX4 A;  4CK3 A;  3LZI A;  4KKO A;  1C1B A;  3AVM A;  4E7L A;  1NJX A;  3FFI A;  5DMR A;  3MXJ A; 
#chains in the Genus database with same CATH topology
 2P9P B;  3TTD A;  4RG8 A;  1C1C A;  4BY9 C;  4BR9 A;  4CEC A;  5AQI A;  1U2V B;  2WC9 A;  5LJW A;  3WNF A;  3F9K A;  1V4S A;  4WF9 L;  1BIU A;  3O9Q A;  2HMP A;  1YIT N;  4Q0B A;  5GAD P;  1S6P A;  4R79 A;  4ZTJ A;  1KD1 O;  3CME N;  2Q31 A;  1IG8 A;  4X64 K;  3DLG A;  4PL7 A;  4Z4H A;  1NGB A;  4NXM K;  4DU3 A;  5EU7 A;  2D0A A;  1KCF A;  5KQD A;  1REV A;  5FPM A;  4X66 K;  3RSE A;  4Z0U A;  1BA0 A;  1C0U A;  4FZZ A;  1J6Z A;  3TSP A;  4HCB A;  3ZSR A;  4DV5 K;  1FW6 A;  2KQ2 A;  3QB0 A;  3CC7 N;  4BE2 A;  3EZW A;  2HVH A;  3HL8 A;  4DFJ A;  1KLN A;  3L2R A;  1JJ2 M;  3O9T A;  4L3Q A;  2ZD1 A;  4DFP A;  3K58 A;  4EIA A;  1TKD A;  1UA0 A;  4BRK A;  2A3Z A;  1IBL K;  2P1J A;  1VQ7 N;  4DV6 K;  4CFC A;  3KKR A;  4JNE A;  3MK6 A;  2E2P A;  2HHH K;  3KD5 E;  2UXB K;  3WQU A;  3VQP A;  3HRG A;  3E9P A;  4DHY A;  2QKK A;  4OO1 J;  3AO1 A;  3EE9 A;  4CGF A;  4CHO A;  3QIC A;  1K8K A;  1ATR A;  3EZ5 A;  3BZC A;  3OYI A;  3K59 A;  2VQE K;  3NFA A;  1KVC A;  4FWS A;  2V52 B;  5KI6 A;  3VF4 A;  3SI6 A;  1HPM A;  2FBX A;  3LL3 A;  5AJ3 K;  3J80 O;  3B8A X;  1NK8 A;  4BRC A;  2YHW A;  3CXC M;  3PO4 A;  3U9Z A;  3S9H A;  3TAP A;  3MWT A;  1Z05 A;  3V81 A;  1RTH A;  4BRD A;  5CY4 A;  1HUX A;  4KH6 A;  4FSV A;  4CEQ A;  3TI0 A;  3AVH A;  1NK9 A;  1C6V A;  1EP4 A;  2P51 A;  1VQ4 N;  4C23 A;  4XH1 A;  3NGI A;  4H0V B;  4I2Q A;  5AQK A;  2VWB A;  1LV5 A;  1L3U A;  1T03 A;  4ILH A;  3O3F A;  2G8H A;  3O8M A;  1B9D A;  3T1Y K;  2VQF K;  3THX A;  2Q97 A;  3RMA A;  2GUP A;  3G6E N;  1D9D A;  3J7A P;  4DS5 A;  3SQ2 A;  3ZX0 A;  1Q18 A;  3CQY A;  3H46 O;  4YY3 K;  3CCS N;  5CYQ A;  3SBT A;  2XY5 A;  3IS9 A;  3L4I A;  2O4G A;  1LAW A;  5AQX A;  1UA1 A;  3LDN A;  5AQJ A;  5HRN A;  3CQX A;  4LF7 K;  3CCV N;  4I6M B;  2KKZ A;  5LMU K;  3P38 A;  4YOR A;  3CCE N;  2D0C A;  3BZK A;  2GBZ A;  3HPG A;  3ENO A;  3BDP A;  1ESV A;  4FJX A;  4K43 A;  2F7T A;  2HHS A;  3HP9 A;  2NRR A;  4DKW A;  4IJN A;  1W9H A;  4B1Z A;  3OJS A;  5BN9 A;  2W40 A;  1A5W A;  3SLC A;  1NGJ A;  1JCE A;  1TV6 A;  3SV3 A;  3EY1 A;  1FKO A;  4M41 A;  4FLV A;  4E3S A;  1ASV A;  4QS8 A;  4KTQ A;  4MLE A;  5LL6 Z;  5BR8 K;  3CC2 N;  4H0O A;  5BPN A;  1RDD A;  2XRI A;  5HRS A;  5KPZ A;  1S1U A;  1HR0 K;  4H4O A;  3VEY A;  4IZ9 A;  5HOO A;  4FJ8 A;  4FJI A;  3QDK A;  1LWE A;  4U67 L;  4JEP A;  1ILY A;  1I3A A;  1WN7 A;  3THW B;  1GLB G;  3PX6 A;  4C1N I;  5AQG A;  3ZX3 A;  1KAX A;  2ASM A;  1Y97 A;  3I8B A;  1N33 K;  5AZI A;  4CW7 B;  2KZZ A;  1I39 A;  4DFM A;  3D7E O;  1HNZ K;  1DT9 A;  2NNW A;  5KPR A;  1VSF A;  4DR1 K;  1LW2 A;  3NAE A;  2QWQ A;  4BRQ A;  3SUQ A;  4OPK A;  2G8U A;  2A1S A;  4JI4 K;  3NMU A;  2FSN A;  3C65 A;  2FSK A;  1VRT A;  3K9J A;  3UKR B;  1J5E K;  3M6G A;  4UQG A;  2KLA A;  1CLQ A;  3DWL A;  3PX4 A;  4DUZ K;  3RVC A;  2I7N A;  2A40 A;  3WXL A;  2HND A;  5B8H A;  4A2A A;  2IOC A;  3MXI A;  2E6L A;  4E1N A;  4BC3 A;  1KQS M;  2P9U A;  4F4K A;  1NGF A;  1BI4 B;  4FLY A;  4RCH A;  3MEG A;  1D4X A;  2JLE A;  1WSF A;  2O8B B;  5FPN A;  3SZ2 A;  4KHN A;  5FRO A;  2NRX A;  4BRG A;  1UAX A;  4BRO A;  2QXF A;  1RTD A;  4JKB A;  4HTL A;  3C6T A;  3D45 A;  1OH6 A;  1UOC A;  4M42 A;  1VK0 A;  2DFE A;  2B5J A;  4E7I A;  4FLX A;  2O8C B;  1YI2 N;  2NRZ A;  3O4Q A;  4CJQ A;  4B3M K;  5AQU A;  3RMC A;  5BN8 A;  3AVC A;  3L2Q A;  2A5X A;  3NCI A;  3QIO A;  3CCM N;  3HM8 A;  2P5O A;  4Y0W A;  4JKD A;  4JI5 K;  4DV4 K;  3MX2 A;  1YJW N;  1VSD A;  4PKH A;  3DOL A;  2QKB A;  1ZBH A;  2PAV A;  1QQM A;  4XH5 A;  2IIR A;  3CHW A;  2FLO A;  4O8U A;  2VWJ A;  4BG8 A;  4CIF A;  3DLK A;  3RSE B;  4I9L A;  2HB5 A;  1QSL A;  4LF9 K;  3D2F A;  3HOS A;  1NGH A;  3J7Z O;  4DLE A;  1T05 A;  4H4M A;  2LSN A;  1HJO A;  3QBW A;  2XY8 A;  4HUG A;  1U4B A;  3KLH A;  5GIO A;  1XWL A;  5AQQ A;  3VQ7 A;  3CF5 L;  3BF3 A;  3OYC A;  3PV8 A;  4MFB A;  5AQR A;  3HVT A;  3V1O A;  3CCQ N;  4DTN A;  4FPA A;  2OYQ A;  5GIN A;  1BDG A;  4KFB A;  3F5T A;  4JRQ A;  1RTI A;  3LWM A;  5C12 A;  1TL3 A;  3SJJ A;  1RT1 A;  5LY3 A;  3TR8 A;  3H1Q A;  2E5L K;  4KI4 A;  2RKI A;  3DLE A;  1JCG A;  1VQO N;  1X9M A;  3VQE A;  4A57 A;  4CJ3 A;  4B1W B;  1KAY A;  3VES A;  3G0Z A;  4ISG A;  3U3Y A;  2ASO A;  3C0B A;  2UYT A;  2PZS A;  3CFO A;  3NF6 A;  1IH7 A;  2VCP A;  4CZH A;  4K42 A;  2KTQ A;  1BOT O;  2FBY A;  3AAP A;  4C1N K;  3BF1 A;  4QAG A;  4C8L A;  3SUN A;  3RRH A;  4PQU A;  3CPE A;  1RBU A;  3F9M A;  4WFA L;  5JVG L;  4BRF A;  2E2O A;  4J2A A;  1Q9Y A;  3HZ6 A;  3M8P A;  3SPY A;  1NBW A;  4DS4 A;  3NBP A;  3M3Z A;  1N5Y A;  3F73 A;  1GOC A;  5KRS A;  3PIP L;  4JD2 B;  1S1X A;  3QML A;  3VQ8 A;  5AQN A;  4K8Z A;  3ZX2 A;  4CGH A;  5BRE A;  4BWM A;  3M8Q A;  2QA4 N;  1YTU A;  3A5M C;  4I7F A;  4LF8 K;  3DYA A;  1U47 A;  2JGU A;  3WUH A;  4PHT X;  3R3L A;  4CJP A;  4ELU A;  4AM7 A;  2KW4 A;  4E7L A;  3J81 O;  1EWR A;  1HLU A;  4CFD A;  4EHT A;  4EP5 A;  4LFA K;  5KGW A;  4DU4 A;  3FFI A;  2QWR A;  3AVI A;  5M1O A;  3R8E A;  4LD0 A;  3TAN A;  1QVF M;  3QIP A;  2A6A A;  2QXL A;  3MX5 A;  1IJJ A;  5IT9 O;  4NXN K;  4GNI A;  1KTQ A;  3N4Q A;  1QHA A;  3QEP A;  4DCH A;  2HHV A;  4YFU A;  3D2E B;  1NK0 A;  1NK7 A;  1T6C A;  2IVP A;  2QM1 A;  3MCP A;  2W42 A;  3ZET A;  1TL1 A;  3TTC A;  5EXW A;  4BQZ A;  3GDQ A;  1ASU A;  2ITM A;  2ZJQ L;  5D3G A;  3ZSX A;  3AA4 A;  4JI7 K;  1BHL A;  1ZBF A;  4K8X A;  3ZSW A;  2NRT A;  3OJU A;  4JI0 K;  4BRI A;  2OPP A;  1C0F A;  4H5R A;  3OS1 A;  3OYD A;  4O55 A;  1X9W A;  1B92 A;  4FWN A;  4JI2 K;  1NG9 A;  4IJA A;  4CJT A;  2WUS A;  3LM2 A;  5BRD A;  1RDU A;  4BQL A;  1KRP A;  4KRE A;  4CBX A;  1HNW K;  2GUI A;  1SAZ A;  4CVN E;  4CF8 A;  3MN6 A;  4CJU A;  4CHN A;  5CZ1 A;  1DTT A;  3HP6 A;  5AQT A;  3ULE A;  4BG9 A;  4JKG A;  2AJQ A;  3FR0 A;  4O5F A;  4BGB A;  3OYA A;  5EOY A;  5FRM A;  3UKU A;  3HSC A;  1EWQ A;  1W2B M;  3AAQ A;  3DXM A;  3L6Q A;  2B4J A;  1SKR A;  3FLC O;  2E1Y A;  1TK5 A;  3OBW A;  4CEA A;  3O4W A;  4WE1 A;  3ID6 A;  4I2P A;  4ICL A;  4DTJ A;  4BR0 A;  1TAQ A;  2VG6 A;  4CK2 A;  3VTH A;  4A61 A;  4EFH A;  4Q5V A;  1ITG A;  3CCJ N;  2D4W A;  1L3S A;  3EKU A;  3RTV A;  1DLO A;  4DTO A;  4FWO A;  3AO5 A;  3U6F A;  2A42 A;  5AZJ B;  3NDK A;  3OYJ A;  2ZM6 K;  5GAH P;  2ZGY A;  3A2F A;  2EWS A;  4KB0 A;  4BRA A;  3FZH A;  3IFR A;  4AQY K;  5ELZ A;  4W5T A;  3QFU A;  4M3R A;  3J8A A;  1HX1 A;  4KH4 A;  3SAF A;  4DTX A;  2F8T A;  2HHT A;  4OKE A;  2J4R A;  5GIP A;  2ZWH A;  2W6K A;  5AQW A;  2HHQ A;  1NGC A;  2O8C A;  4K41 A;  3VQ6 A;  1QSY A;  2WTU A;  3SCX A;  4Y1D A;  2D5R A;  4V19 S;  5FPD A;  4H5V A;  3T3F A;  5ADX H;  3CJ1 A;  3K2P A;  3LDP A;  4M3X A;  4WFN L;  5F0X A;  3OVN A;  1TUY A;  5KPT A;  1L5U A;  4CHP A;  3ZT4 A;  4HVJ A;  3LP2 A;  3RMD A;  4LF6 K;  4FJM A;  3AAR A;  1NJZ A;  2GV9 A;  2O8D B;  2OPS A;  3BUZ B;  1F21 A;  4E1M A;  4A59 A;  3DLL L;  1BIS A;  3ZYY X;  4B3R K;  3M8S A;  4FWK A;  4PKG A;  3VQC A;  5MLC Q;  4ILJ A;  1S5J A;  1D8Y A;  2IVN A;  4PKI A;  5AFU A;  2ASP A;  3S3N A;  1T3V A;  5IWA K;  2FSJ A;  1BCO A;  5HRR A;  3WNG A;  3HM9 A;  4DF8 A;  1E3M A;  2DTU A;  1W7A A;  4B9M A;  1XMO K;  3L2V A;  3V9Z A;  1X1P A;  2OZS A;  3ENH A;  3SYZ A;  3WT0 A;  4DV2 K;  2QW9 A;  5JS2 A;  4FLW A;  4FM2 A;  4KO0 A;  3O1W A;  4OJR A;  5JIC A;  5CYM A;  3TPQ A;  3ALY A;  2F4V K;  3GOI A;  3ZSO A;  4BR4 A;  5C10 A;  4CD1 A;  4AHC A;  1RIL A;  4OLA A;  5M1K A;  3I8D A;  1WSJ A;  4YOV A;  1EKE A;  3NH1 A;  1KXP A;  5J2P A;  1VSL A;  4CZE A;  4CZF A;  1RCH A;  3KLF A;  1S9E A;  2P9I B;  1JLG A;  4BRN A;  3KLG A;  4B9V A;  1C1A A;  4H0X B;  4DQQ A;  3VGL A;  3DXM B;  3CFP A;  4EZ9 A;  3L8B A;  1HQE A;  2NRW A;  1YHQ N;  1QSS A;  3O3H A;  3KWI A;  1IKY A;  4CFA A;  4DSF A;  4CF1 A;  4ELV A;  1NGA A;  3CJ7 A;  4BRH A;  1N36 K;  1I94 K;  4CJR A;  1JXE A;  3A5L C;  1KVB A;  4M3Z A;  3K57 A;  4GV6 A;  5KTQ A;  4FXD A;  1HYZ A;  2VGM A;  3V1Q A;  1NGI A;  4KH5 A;  1Z6R A;  4FJ5 A;  2O8E B;  3U3G A;  1OH5 A;  1JLB A;  2VG7 A;  2E20 A;  3QLH A;  4FYD A;  1QTM A;  3HK2 A;  1TKX A;  2VG5 A;  1B9F A;  4N5S A;  5J1E A;  3TAR A;  3A5O C;  3O08 A;  1ZBI A;  4KHU A;  4GMJ B;  1VQP N;  1W0H A;  3WQT A;  4A62 A;  2E4L A;  3AO2 A;  3FFK B;  3OS0 A;  4CE9 A;  3VQA A;  2YHA A;  1X3N A;  4PA1 A;  1ZBU A;  4KPY A;  3AVL A;  3CC4 N;  3SQ0 A;  3SUP A;  2FBT A;  4YOT A;  2O8F A;  3PY8 A;  2ITG A;  4BRM A;  4FJG A;  5AQP A;  1OH8 A;  3KD1 E;  4AF1 A;  3CET A;  4CES A;  5I9E B;  4DR4 K;  3K5M A;  4CJ5 A;  3FE1 A;  1VSK A;  1NU0 A;  5AFU H;  3VEO A;  3L2W A;  2A1R A;  3Q7C A;  2BTF A;  4O4G A;  3ZSQ A;  4HUE A;  4CJL A;  4MLH A;  4FLU A;  3T7Z A;  2EX3 A;  3OYK A;  2RE2 A;  3THY A;  2Z1J A;  3AVK A;  1MDU B;  5M1N A;  4M45 A;  1NJW A;  1XC3 A;  2V51 B;  3E1Y A;  3QET A;  4CZL A;  1MU2 A;  1IV0 A;  2Q0U A;  1U2V A;  1OH7 A;  4KHW A;  2WON A;  1IBK K;  1JLA A;  4FM0 A;  2OCE A;  4BR5 A;  4FVM A;  3FZF A;  4DV0 K;  3TSQ A;  1QQC A;  3ZEU B;  3EO3 A;  5KGX A;  3S41 A;  5C15 A;  2G8V A;  1D9F A;  3THV A;  1HQU A;  1P90 A;  3O5B A;  5HL7 L;  3G71 N;  3THW A;  4JI8 K;  4PUO A;  4BVO A;  4O8K A;  5E26 A;  3LZJ A;  4IG0 A;  5FRN A;  4FK4 A;  1KVA A;  4DB3 A;  3AVA A;  3D6R A;  3MDQ A;  4FWP A;  1R59 O;  1X3M A;  1L3T A;  1NM1 A;  3IG1 A;  3EEQ A;  3P4I A;  1VQ9 N;  2PY5 A;  4DUY K;  1XMQ K;  3UIQ A;  2YNH A;  4O5B A;  1VHX A;  4B9S A;  3LAM A;  3DRR A;  3FZK A;  2HBL A;  2OAN A;  1Q9X A;  1MWK A;  2P9L A;  4BDZ A;  3SJH A;  4YOW A;  3ZSZ A;  3LPU A;  3CJ9 A;  1VAZ A;  3DRS A;  1J54 A;  4C8N A;  3CJB A;  4CJV A;  3ZET B;  3OYG A;  4ISF A;  3GE1 A;  5LMN K;  4IG3 A;  2YNF A;  2KZM A;  1O1W A;  4RWT A;  3DRP A;  5AQY A;  2NZT A;  4EP4 A;  1H1V A;  4A5B A;  2CH6 A;  3H3N O;  5HP1 A;  4FK2 A;  1VQK N;  4AHU A;  4Z4I A;  3MEE A;  4GV3 A;  3O9S A;  3WXM B;  2QWN A;  1WSH A;  4DQI A;  1NGG A;  1BA1 A;  2NRH A;  5DM6 L;  1Z25 A;  4CZJ A;  1VRU A;  2H3G X;  4FM1 A;  4W5R A;  1JLE A;  2F9W A;  4IFE A;  4FW2 A;  2E6M A;  4CJ4 A;  3P31 A;  4IO8 A;  4NLB A;  4IOC L;  4FL9 A;  4LC9 B;  3WNE A;  1RDB A;  5DM7 L;  1Q82 O;  1ATN A;  4R5P A;  1YVN A;  2UUB K;  4BDY A;  1LOT B;  1HYS A;  3H1V X;  1NKC A;  4E89 A;  1FKP A;  3KWG A;  1OVQ A;  2KFZ A;  3OA9 A;  3WNH A;  3KLE A;  1T7P A;  1WAJ A;  3I0R A;  4EAH D;  1EQY A;  5AQH A;  5BPM A;  4B1X B;  4IFV A;  1RT3 A;  1TK0 A;  2PBD A;  4FOE A;  2E88 A;  3BEX A;  1N6Q A;  3L2U A;  1WUA A;  3K5L A;  2YHX A;  4JHD B;  4DTM A;  3MED A;  3HVR A;  3V4I A;  4BR7 A;  3KK7 A;  2HOE A;  4F3O A;  2Y1J A;  4CED A;  2F96 A;  3MXM A;  4B3O A;  4JI1 K;  4Z94 A;  3AVF A;  4FZY A;  1S3X A;  4CJW A;  3WEE A;  1Q8I A;  2CGK A;  4G1Q A;  4HUF A;  1VSI A;  1SL1 A;  4MDA A;  4B3S K;  2P9S A;  3VTI A;  1K6Y A;  1LWC A;  4FWM A;  3ULE B;  3I33 A;  4W5Q A;  2UUC K;  1NMN A;  4CEO A;  3V6D A;  1X9J A;  4JKA A;  2P5G A;  4L8R B;  2P9I A;  3NF8 A;  1BG3 A;  4O44 A;  1CZ9 A;  4FLT A;  1YF5 L;  1W97 L;  1KAZ A;  1Q81 O;  1QS4 A;  2HNY A;  4CFB A;  5TKY A;  4WYB A;  4H5N A;  3U8X A;  3ZLJ A;  1BQM A;  1QQN A;  2IS3 A;  3MEC A;  4F8R A;  1XHX A;  3NF9 A;  3VEW A;  2YHB A;  4J8F A;  3LAL A;  3G25 A;  5HLF A;  1YAG A;  3CER A;  3NHG A;  3AGR A;  1RT2 A;  4RW6 A;  3ZSV A;  2YCH A;  3SQ1 A;  1HPZ A;  5EVZ A;  4WFB L;  4DV3 K;  2FBV A;  3I0S A;  4YHH K;  5C0Y A;  4JV5 K;  1TYQ A;  3C95 A;  3WXI A;  1VQN N;  3E01 A;  1WLJ A;  2D0O A;  3FZM A;  4MDB A;  1NGE A;  2VWK A;  1N34 K;  3BGR A;  2HVI A;  1IKX A;  5C24 A;  3SK3 A;  3NGZ A;  3VQ4 A;  4FJ7 A;  4AH9 A;  4YOY A;  1KC8 O;  2HMI A;  4IEI A;  4KHP K;  5CE3 A;  2ZF5 O;  4N56 A;  2YX6 A;  3V9W A;  4H0P A;  3C6U A;  4OKK A;  4QCL A;  1U45 A;  5HBM A;  4YDU C;  3ZCM A;  5JLF A;  3H6E A;  4XEI A;  3C7N B;  5EX5 A;  1WSG A;  1HNV A;  3LP0 A;  1ATS A;  2OTJ N;  2HST A;  1WAF A;  1ASW A;  1RNH A;  4F3T A;  3KHY A;  3LP1 A;  3ZT3 A;  1VSH A;  3T69 A;  1A5X A;  1JLF A;  4ILG B;  3EE8 A;  3O9R A;  3RR7 A;  1RBR A;  1VSE A;  3TAQ A;  1QQO A;  3KZB A;  1OKJ A;  4J2D A;  3RR8 A;  4NLC A;  3OYM A;  4KHS A;  4YNQ A;  2ETJ A;  2P9N B;  2WBN A;  5GAE P;  3W0L A;  1N8R O;  3PO5 A;  2KHO A;  4QS9 A;  2GTD A;  4KHQ A;  3W3D A;  2ZJR L;  4DR2 K;  1WBD A;  4JD2 A;  1TVR A;  3SBG A;  3O6W A;  1GOB A;  5M1F A;  3HST B;  2P9P A;  4IXC A;  4E7H A;  1S1V A;  2G8W A;  2CH5 A;  3NVK A;  3QEW A;  1K8A O;  2UXD K;  1HMV A;  3U9D A;  3IUC A;  4CEF A;  4HHT A;  3JXU A;  3OTO K;  3IMX A;  1BCM A;  5SWM A;  5AQO A;  4FVU A;  1ZC6 A;  2I5J A;  1O13 A;  4DMN A;  1JCF A;  2HHW A;  5K14 A;  4BGA A;  5JS1 A;  1GLF O;  4I9Q A;  4DG1 A;  2RF2 A;  2P9K A;  4CGG A;  4KI6 A;  3ATV A;  2HBK A;  5HRP A;  1NJI O;  4LFB K;  3B6O A;  4WQ4 C;  4RW7 A;  4BDP A;  4OVL A;  4OPA A;  1TKT A;  4B1Y B;  4DR5 K;  2IVO A;  3JSM A;  4F9O A;  2OTL N;  3A8Y A;  3L3U A;  3TAF A;  1RT6 A;  1QHT A;  4F2S A;  4KHY A;  4CJE A;  4CZK A;  2IAJ A;  3D2E A;  4MQ3 A;  4GVE A;  3KLI A;  3F2K A;  4JK8 A;  1XUP O;  1XNQ K;  5CHI A;  1GLE G;  3HTV A;  3VQ9 A;  1YJN N;  1YT3 A;  4KV8 A;  3CCL N;  3TAE A;  4LH4 A;  4CJF A;  4C8K A;  3VEN A;  3A0I X;  3VN5 A;  4EHU A;  1GLA G;  1IKW A;  2D0B A;  3KK3 A;  3KJV A;  2KFN A;  1C0T A;  4JN4 A;  3LAK A;  1D5A A;  1RBS A;  4C8M A;  4GY2 B;  3LPT A;  4CD3 A;  1RFQ A;  3P83 D;  5AQF A;  5EY4 A;  4BRE A;  2YNI A;  3QEX A;  2QI2 A;  4B9T A;  4GV9 A;  5M1P A;  4OGC A;  3Q7B A;  4CF9 A;  3VF6 A;  4JKG B;  1RGI A;  4H0Y B;  1YUW A;  4CBU A;  1U49 A;  4XH4 A;  4FWR A;  4Y1C A;  4DU1 A;  4BC4 A;  2BH1 A;  4GVM A;  3S3O A;  1NJY A;  4GKK K;  1FXX A;  4FOI A;  5J2M A;  3A5N C;  4CCH A;  2EHG A;  4MO5 A;  4JK9 A;  3ASM A;  3SMS A;  1LW0 A;  1QZ5 A;  3V9S A;  3QES A;  2AP1 A;  3AVB A;  1YIJ N;  2O8E A;  4E0D A;  4JI6 K;  1HNI A;  5J2Q A;  1KFS A;  3CQ8 A;  1RTJ A;  1QVG M;  2E2Q A;  3C6A A;  3MN9 A;  3GBT A;  1BU6 O;  2HBJ A;  4ZHR A;  4ELT A;  2NLX A;  3QEI A;  1U6Z A;  1MA9 B;  1NOZ A;  3HYF A;  2BGG A;  1RT7 A;  1XQS C;  4DTU A;  3T19 A;  3AVG A;  1WBB A;  1S6Q A;  1U48 A;  3QNN A;  2Q3S A;  4Z4E A;  2NRV A;  4AIL C;  1YTA A;  1YXQ A;  3ZEU A;  3AA2 A;  1WOQ A;  4DQ8 A;  1NLV A;  5JVH L;  3QER A;  3VQD A;  2NUB A;  1LWF A;  2Q1N A;  5JMV A;  3TAG A;  2BDP A;  5T7B A;  3HPO A;  4I6M A;  3DLH A;  4B08 A;  2Q0R A;  4WQ4 A;  4DSE A;  2O8F B;  2HF3 A;  4YDU A;  2XO7 A;  2BUP A;  4H0T B;  5KRT A;  2QK9 A;  5BR9 A;  4JKC A;  1QE1 A;  4WQ5 A;  1VSM A;  2D1K A;  3P39 A;  1ZYQ A;  1XHZ A;  3DOK A;  3ATU A;  3CIP A;  3DLR A;  3VA3 A;  1BUP A;  4CJ7 A;  5C2F A;  4H8K A;  4WQ5 C;  4IKF A;  2G8K A;  3AVN A;  3VMF B;  5E41 A;  1G15 A;  3I56 N;  4KAZ A;  3NH2 A;  2RPI A;  1XI1 A;  4ID5 A;  3TAB A;  3OYE A;  3T1H K;  4BE0 A;  1UWB A;  4RW4 A;  1Z26 A;  1YJ9 N;  2A41 A;  3EYZ A;  3LAN A;  4DV7 K;  1GLC G;  3PSF A;  2GX9 A;  1NKB A;  1U04 A;  2HHX A;  3DM2 A;  2E2N A;  1LAV A;  4AHV A;  1NK6 A;  1VQM N;  2QWL A;  1J53 A;  2HNZ A;  1TKZ A;  4ID1 A;  3MN5 A;  3TSU A;  5AQS A;  1S1T A;  4CHZ A;  2FF3 B;  1N32 K;  4BRP A;  4BE1 A;  4DTR A;  4J2E A;  4PL8 A;  4PY5 A;  4NO7 A;  1HKB A;  2GWJ A;  4QOZ B;  1NK4 A;  1QZ6 A;  4NB4 A;  2HBM A;  4FO0 A;  2ZJP L;  3QBX A;  3B6P A;  3LWL A;  3AY9 A;  4FJK A;  4IFY A;  5C2D A;  4FLZ A;  4LY7 A;  3VQ5 A;  1ZBS A;  3FZL A;  2DFF A;  4DTP A;  2GEM A;  1WSI A;  1SKW A;  1L3V A;  3AO3 A;  5AZJ A;  2RHK A;  3CJA A;  5AQZ A;  2FC0 A;  3DLB A;  5KQ8 A;  3L3V A;  3QFP A;  2BAN A;  2QTD A;  1WB9 A;  3THX B;  1DGK N;  1JXB A;  3VOV A;  4FJ9 A;  2OA8 A;  1CZB A;  2YHY A;  3V1R A;  2YKM A;  4FZX C;  5H1S Q;  3HO1 A;  3L0Q A;  3SQ4 A;  4FJL A;  3IDH A;  3O1B A;  4DQP A;  2QEX N;  5JLH A;  2OZM A;  3N4P A;  3V9U A;  4KB1 A;  4TSX A;  1EX4 A;  4CK3 A;  1C1B A;  3AVM A;  5DMR A;  3MXJ A;  5BRH A;  4JYA K;  4DR6 K;  3MWP A;  5SZT A;  3AA5 X;  2IGI A;  3QO9 A;  4DTS A;  2O8D A;  2D0P A;  1X9S A;  3VGK A;  5LJV A;  3NH0 A;  2P9L B;  4E1J A;  5J2N A;  4B9N A;  4RTF D;  2UXC K;  3NGY A;  1EO1 A;  5DK5 A;  4B8A B;  2P9N A;  3DAW A;  3DXK B;  3OHR A;  3KIO A;  3CM6 A;  2RN2 A;  4BR2 A;  2YI1 A;  2HW3 A;  1T6D A;  2VGN A;  5I42 A;  5BPL A;  2QWM A;  1JLC A;  4BWJ A;  4B1U B;  4FJH A;  5F2R A;  2WFB A;  4LSL A;  3G10 A;  3QEV A;  4J2B A;  1TYQ B;  1XC9 A;  4G9Z A;  5FPE A;  3SV4 A;  3MCA B;  4FWQ A;  3VQB A;  3SAH A;  1JL2 A;  4XIU A;  4W5O A;  2PYJ A;  3E9L A;  3JYT A;  5HRO A;  1TK8 A;  2P9K B;  3OBY A;  3FGU A;  3SPZ A;  4NYN A;  4RW9 A;  5ADX A;  4N76 A;  3ZSY A;  4OX9 K;  4CZG A;  1RBV A;  3O3G A;  1YVU A;  4IWV A;  3RRG A;  1RDW X;  2G8I A;  3C7N A;  3DJC A;  3SAG A;  1VQ8 N;  5AQV A;  1RDC A;  4C8O A;  4LFC K;  3ULD A;  4DSK A;  3MMV A;  4CER A;  4CEE A;  2IDO A;  4FCY A;  3QIN A;  1SS6 A;  3D0P A;  1RT4 A;  1CZA N;  3J7Y P;  2JWL A;  4GKJ K;  4IOA L;  3DI6 A;  3OYL A;  1BI4 A;  2V7Z A;  4B8C A;  3CJC A;  5BRF A;  1XNR K;  3BP8 A;  3HPH A;  1SL0 A;  3HOT A;  2X78 A;  2JWK A;  2Z1G A;  4JKH A;  5M1Q A;  3TWH A;  3VER A;  3VQQ A;  1KSP A;  1SQK A;  3V9X A;  3KTQ A;  4BVP A;  4O0J A;  1GLL O;  4CIG A;  2PYL A;  3RMB A;  4CIE A;  1VSJ A;  1T44 A;  3KKS A;  3WEE B;  2HHU A;  1SKS A;  3K5O A;  4Z4C A;  4IDH A;  4PWD A;  2P9S B;  1LCU A;  4LF5 K;  2CGL A;  4LSN A;  4K25 A;  4DV1 K;  3K9K A;  1KFD A;  3OYB A;  3CG7 A;  1J9A A;  3DMJ A;  4JI3 K;  3OYF A;  5E84 A;  1R0A A;  3LP3 A;  3UKR A;  4M3Y A;  4E19 A;  4DQR A;  3WXJ A;  4BAC A;  4HCC A;  2QWP A;  3SUO A;  4B9Q A;  2R7Y A;  1JL1 A;  2ATQ A;  3VF2 A;  1DKG D;  4CF2 A;  4UY8 O;  3TU5 A;  3SNN A;  1GLD G;  1SL2 A;  4OLB A;  2F8S A;  1NMD A;  1OVY A;  1CXQ A;  3CCU N;  3NVM A;  2W6L A;  2ZQB A;  2VYP A;  5F1X A;  3C94 A;  4JS5 A;  3AGK A;  4JHD A;  3VEX A;  4JKF A;  4OPJ A;  4JRP A;  3GL1 A;  4DLG A;  2HF4 A;  1VQ6 N;  4W5N A;  4IO9 L;  1C0G A;  2IC3 A;  4NCG A;  4CZI A;  4E7J A;  2GWK A;  3ZT0 A;  1S72 N;  1A5V A;  1Q7Y O;  1MWM A;  1NWK A;  4FW1 A;  4DR3 K;  3LDQ A;  1NOY A;  4AM6 A;  3VEZ A;  3CD6 N;  2X6S A;  1GLJ O;  3AV9 A;  4AHS A;  2X74 A;  3O80 A;  3OS2 A;  3L4Q A;  3CMA N;  1VQ5 N;  2Z1H A;  4M63 C;  3G4S N;  1S9G A;  4RW8 A;  4CGI A;  4B9L A;  1HKC A;  3E66 A;  4B3T K;  1TUU A;  1RDA A;  5FDL A;  2ZE2 A;  4K0K K;  3LM9 A;  4X62 K;  1SV5 A;  4A2B A;  2WOM A;  2AA4 A;  3CYM A;  4CJS A;  1JKH A;  3T1A A;  4FJN A;  2V7Y A;  1BQN A;  1NKE A;  3P5J A;  3S3M A;  1RBT A;  3VA0 A;  4DR7 K;  3ZT2 A;  5I3U A;  2GEL A;  3MN7 A;  1BL3 A;  4DQS A;  1T8E A;  4OGE A;  2I7P A;  3R6M A;  4M3U A;  4B1V A;  3NE6 A;  1SUQ A;  3AO4 A;  3PX0 A;  4NCB A;  1IBM K;  3TAM A;  4IBN A;  4ZTF A;  3UB5 A;  4YOX A;  3AVJ A;  3EN9 A;  4FPB A;  2UU9 K;  3HJF A;  4FJJ A;  4H5W A;  3P1G A;  2W41 A;  3OYH A;  1HYV A;  5CZ2 A;  1BO5 O;  4CHQ A;  4M3T A;  3OY9 A;  4JAX A;  3M8R A;  3ENB A;  5AZI B;  3KK2 A;  1K73 O;  3MAQ A;  4B9U A;  1S1W A;  4CF0 A;  2XY7 A;  1HKG A;  3BY5 A;  4OKJ A;  1VQL N;  1IKV A;  1EET A;  5CR4 A;  4DSL A;  3SMP A;  3M5R A;  2ZGZ A;  4U7B A;  2XHB A;  1BWF O;  3CI5 A;  3LDO A;  2DFH A;  3EKS A;  5GAG P;  1HNX K;  4EZ6 A;  1FK9 A;  3KK1 A;  4DWI A;  3D2F B;  4CI6 A;  5TKW A;  4X65 K;  3IAY A;  3LDL A;  4IDK A;  1NNE A;  4N47 A;  5AR0 A;  3TTF A;  4QS7 A;  4N41 A;  2UUA K;  1Y64 A;  2DPN A;  1FJG K;  3PLA A;  1E4F T;  3LDS A;  3ZT1 A;  1IO2 A;  2PFU A;  4CK1 A;  4ISE A;  4WCE L;  4YOU A;  4DF4 A;  2Y1I A;  3M1F A;  2DY4 A;  1RT5 A;  2OPR A;  2Q36 A;  1TAU A;  1HRH A;  3H3O B;  3AA3 A;  3VPZ A;  1C0M A;  3KVG A;  1WNS A;  3C6H A;  3ID8 A;  3OW2 M;  1J5O A;  4AHR A;  1HJR A;  1S22 A;  4GW6 A;  3VET A;  4KRF A;  4LF4 K;  3HXM A;  1M1K O;  3WXK A;  5A2Q O;  3RWU A;  3ITH A;  3OYN A;  2G8F A;  4DSI A;  1IG9 A;  2XY6 A;  2E1Z A;  3H45 C;  1ZBL A;  4CGJ A;  2F9T A;  4BRL A;  5AQL A;  3U4L A;  3E9O A;  3JAM O;  1NK5 A;  4CGD A;  1TGO A;  4H5T A;  4JLH A;  4CEB A;  3HT3 A;  4E7K A;  4A5A A;  3PSI A;  2YV0 X;  2Z1I A;  4OPH A;  1K9M O;  4M7Y A;  3R9P A;  2Q2R A;  3UE5 A;  4Z4F A;  1SZ2 A;  4CZM A;  4FWL A;  1GOA A;  1V4T A;  3VGM A;  2YJF A;  3DXK A;  3H08 A;  4M7X A;  2YJE A;  2O4I A;  4MO4 A;  4CEZ A;  2OPQ A;  4NCA A;  2P9U B;  5AQM A;  4Z4G A;  2BE2 A;  4CBW A;  4KTZ A;  3HI0 A;  3CM5 A;  1KLM A;  3I55 N;  3K0S A;  2O8B A;  3JS6 A;  4HWI A;  4KTW A;  1E4G T;  4M3W A;  4IOX A;  4JK7 A;  4CHY A;  2B6A A;  3CFR A;  3HBT A;  3EL2 A;  4AHT A;  3VEV A;  2E8A A;  1G99 A;  3O9U A;  2YKN A;  3GG4 A;  5FLX O;  4FK0 A;  1K8K B;  3PUF A;  1EXQ A;  3IKM A;  4F2R A;  4CJK A;  1DTQ A;  1DEJ A;  3IRX A;  4LH5 A;  4DSJ A;  1P8Z A;  3ISN C;  2FF6 A;  3UKU B;  3R1X A;  1Q86 O;  2X6N A;  4DFK A;  3CCR N;  1BGX T;  2FXU A;  4JKE A;  4KBO A;  4HTU A;  4BC5 A;  5C42 A;  3NF7 A;  4O0I A;  4H03 B;  3K5N A;  5C25 A;  1BIZ A;  1JLQ A;  4BC2 A;  1ZXO A;  1WSE A;  3O4N A;  3CPW M;  1M90 O;  4NYF A;  1CXU A;  4JS4 A;  2QWO A;  1NGD A;  3THY B;  2YNG A;  3QNO A;  1NJX A;  3LZI A;  4KKO A;  4IEE A;  3PIO L;  2CGJ A; 
#chains in the Genus database with same CATH homology
 4RG8 A;  1N6Q A;  3AVI A;  3L2U A;  1C1C A;  3K5L A;  4LD0 A;  4DTM A;  3TAN A;  4CEC A;  3MED A;  3QIP A;  5SZT A;  3HVR A;  3V4I A;  3AA5 X;  2IGI A;  4F3O A;  2Y1J A;  4CED A;  2F96 A;  3QO9 A;  4DTS A;  3MXM A;  4B3O A;  1X9S A;  3WNF A;  3NH0 A;  3F9K A;  1KTQ A;  3AVF A;  3QEP A;  5J2N A;  4B9N A;  2HHV A;  1BIU A;  3NGY A;  4YFU A;  1NK0 A;  4FZY A;  4Q0B A;  1S6P A;  1NK7 A;  5DK5 A;  4B8A B;  4CJW A;  4ZTJ A;  1Q8I A;  3KIO A;  4G1Q A;  3CM6 A;  4HUF A;  2RN2 A;  1VSI A;  1SL1 A;  3DLG A;  4Z4H A;  2W42 A;  1TL1 A;  2HW3 A;  1K6Y A;  4DU3 A;  5EU7 A;  1LWC A;  2D0A A;  5I42 A;  1ASU A;  1JLC A;  4BWJ A;  5D3G A;  1KCF A;  3AA4 A;  4LSL A;  3ZSX A;  4W5Q A;  4FJH A;  1BHL A;  3G10 A;  1ZBF A;  4CEO A;  1REV A;  3V6D A;  3ZSW A;  4K8X A;  3QEV A;  2P5G A;  3OJU A;  4L8R B;  4J2D A;  2OPP A;  3NF8 A;  4J2B A;  4O44 A;  4Z0U A;  1CZ9 A;  4FLT A;  1C0U A;  4FZZ A;  4HCB A;  3ZSR A;  3OS1 A;  1XC9 A;  3SV4 A;  1QS4 A;  2HNY A;  4CFB A;  3OYD A;  4O55 A;  1X9W A;  1B92 A;  2KQ2 A;  3VQB A;  1JL2 A;  2HVH A;  4BE2 A;  1BQM A;  4XIU A;  3HL8 A;  2IS3 A;  4CJT A;  3MEC A;  4W5O A;  4DFJ A;  1XHX A;  1TK8 A;  3JYT A;  5HRO A;  3NF9 A;  1KLN A;  1KRP A;  4F8R A;  4KRE A;  2YHB A;  2GUI A;  3L2R A;  4CF8 A;  3SPZ A;  4CJU A;  3LAL A;  4CHN A;  5CZ1 A;  1DTT A;  5HLF A;  3HP6 A;  4NYN A;  4RW9 A;  3NHG A;  4N76 A;  3ZSY A;  1RT2 A;  4RW6 A;  3ZSV A;  1RBV A;  3O3G A;  3SQ1 A;  2AJQ A;  2ZD1 A;  4DFP A;  1HPZ A;  1YVU A;  3OYA A;  3K58 A;  5FRM A;  2FBV A;  1TKD A;  3RRG A;  1UA0 A;  3I0S A;  2G8I A;  2P1J A;  1RDC A;  4C8O A;  2B4J A;  1SKR A;  3ULD A;  4DSK A;  4CFC A;  1TK5 A;  3C95 A;  4CEA A;  4WE1 A;  3E01 A;  4CER A;  3KKR A;  1WLJ A;  4I2P A;  4CEE A;  2IDO A;  4FCY A;  3QIN A;  4ICL A;  4DTJ A;  3KD5 E;  1TAQ A;  2VWK A;  2VG6 A;  4CK2 A;  3BGR A;  4Q5V A;  3VQP A;  3D0P A;  1ITG A;  2HVI A;  1IKX A;  1RT4 A;  5C24 A;  1L3S A;  3RTV A;  2QKK A;  1DLO A;  3NGZ A;  3VQ4 A;  3AO1 A;  4DTO A;  4CGF A;  4FJ7 A;  4AH9 A;  4CHO A;  3AO5 A;  3U6F A;  2HMI A;  3NDK A;  4N56 A;  3EZ5 A;  3V9W A;  4OKK A;  3C6U A;  3DI6 A;  3OYI A;  3OYJ A;  3K59 A;  3OYL A;  1BI4 A;  3NFA A;  4QCL A;  1U45 A;  1KVC A;  3A2F A;  5HBM A;  5KI6 A;  3ZCM A;  4B8C A;  3SI6 A;  4KB0 A;  2FBX A;  1WSG A;  1HNV A;  3HPH A;  1NK8 A;  3LP0 A;  1SL0 A;  4W5T A;  1WAF A;  1ASW A;  1RNH A;  4F3T A;  3LP1 A;  3ZT3 A;  3PO4 A;  2X78 A;  4M3R A;  1VSH A;  3S9H A;  3TAP A;  1A5X A;  1JLF A;  2Z1G A;  3V81 A;  1RTH A;  5CY4 A;  3TWH A;  3VQQ A;  3RR7 A;  1KSP A;  3V9X A;  4CEQ A;  1RBR A;  1VSE A;  4DTX A;  3TAQ A;  3TI0 A;  3KTQ A;  4O0J A;  2F8T A;  3AVH A;  4CIG A;  1NK9 A;  3RMB A;  2PYL A;  1C6V A;  1EP4 A;  2P51 A;  4OKE A;  4CIE A;  1VSJ A;  3OYM A;  4YNQ A;  3NGI A;  3RR8 A;  4KHS A;  2ETJ A;  3KKS A;  4I2Q A;  2HHU A;  2HHQ A;  1SKS A;  1LV5 A;  3PO5 A;  1L3U A;  4KHQ A;  3K5O A;  3VQ6 A;  4Z4C A;  1QSY A;  4PWD A;  3SCX A;  4Y1D A;  1T03 A;  2D5R A;  4LSN A;  1TVR A;  3O3F A;  1GOB A;  2G8H A;  1KFD A;  3OYB A;  1B9D A;  3CG7 A;  1J9A A;  3T3F A;  3HST B;  3DMJ A;  3K2P A;  4M3X A;  3OYF A;  4E7H A;  1S1V A;  3OVN A;  3RMA A;  2G8W A;  1D9D A;  3QEW A;  4DS5 A;  1HMV A;  3SQ2 A;  1L5U A;  4CHP A;  1R0A A;  3ZT4 A;  4CEF A;  4HVJ A;  3LP3 A;  3LP2 A;  4HHT A;  3RMD A;  4M3Y A;  4FJM A;  4E19 A;  4DQR A;  1NJZ A;  1BCM A;  2GV9 A;  5SWM A;  2OPS A;  5CYQ A;  4BAC A;  2XY5 A;  4E1M A;  1F21 A;  4HCC A;  2I5J A;  1BIS A;  3IS9 A;  4DMN A;  2O4G A;  3SUO A;  2R7Y A;  1LAW A;  1JL1 A;  2ATQ A;  5K14 A;  3M8S A;  3VQC A;  2HHW A;  5JS1 A;  1UA1 A;  4CF2 A;  4I9Q A;  4DG1 A;  2RF2 A;  1S5J A;  5HRN A;  4CGG A;  3SNN A;  1D8Y A;  4KI6 A;  1SL2 A;  3S3N A;  4OLB A;  2F8S A;  1CXQ A;  5HRP A;  2D0C A;  2ZQB A;  3B6O A;  1BCO A;  5HRR A;  3C94 A;  4JS5 A;  3WNG A;  3HM9 A;  4DF8 A;  2GBZ A;  3HPG A;  2DTU A;  4RW7 A;  4BDP A;  4OVL A;  4OPJ A;  4B9M A;  4JRP A;  1TKT A;  3BDP A;  4DLG A;  3L2V A;  4W5N A;  4FJX A;  3JSM A;  2IC3 A;  4NCG A;  3V9Z A;  3L3U A;  1X1P A;  2HHS A;  3TAF A;  1RT6 A;  1QHT A;  3HP9 A;  4E7J A;  2OZS A;  3ZT0 A;  3SYZ A;  1W9H A;  1A5V A;  4CJE A;  5JS2 A;  4F2S A;  4KHY A;  3OJS A;  4FW1 A;  4FLW A;  2IAJ A;  4MQ3 A;  1A5W A;  1NOY A;  1TV6 A;  4FM2 A;  3SV3 A;  3KLI A;  3EY1 A;  4KO0 A;  4OJR A;  2X6S A;  1FKO A;  5CYM A;  3AV9 A;  3ALY A;  4M41 A;  3VQ9 A;  3ZSO A;  1YT3 A;  2X74 A;  4AHS A;  4KV8 A;  4FLV A;  4E3S A;  1ASV A;  4AHC A;  3OS2 A;  4KTQ A;  1RIL A;  4OLA A;  3TAE A;  4LH4 A;  3I8D A;  1WSJ A;  1EKE A;  3NH1 A;  4CJF A;  4C8K A;  5J2P A;  2Z1H A;  1VSL A;  1S9G A;  1RCH A;  4RW8 A;  1S9E A;  3VN5 A;  4CGI A;  3KLF A;  4B9L A;  1RDD A;  2XRI A;  5HRS A;  1JLG A;  1RDA A;  1S1U A;  5FDL A;  3KLG A;  4B9V A;  4H4O A;  1C1A A;  2ZE2 A;  1IKW A;  4DQQ A;  3CFP A;  2D0B A;  4EZ9 A;  4FJ8 A;  3KK3 A;  1SV5 A;  3L8B A;  3KJV A;  1HQE A;  4FJI A;  1QSS A;  2KFN A;  1C0T A;  2WOM A;  3O3H A;  3CYM A;  4CJS A;  1LWE A;  1IKY A;  1JKH A;  4CFA A;  3LAK A;  3T1A A;  1D5A A;  4DSF A;  4FJN A;  4CF1 A;  4ELV A;  1I3A A;  1RBS A;  1WN7 A;  4C8M A;  3PX6 A;  1BQN A;  3LPT A;  4CJR A;  1JXE A;  3P5J A;  1KVB A;  1RBT A;  3P83 D;  3K57 A;  3S3M A;  1NKE A;  4M3Z A;  3VA0 A;  5KTQ A;  4FXD A;  1HYZ A;  1Y97 A;  2YNI A;  3V1Q A;  3QEX A;  4B9T A;  3ZT2 A;  5I3U A;  4OGC A;  4FJ5 A;  2KZZ A;  1I39 A;  3U3G A;  4CF9 A;  4DFM A;  1BL3 A;  1JLB A;  2VG7 A;  1VSF A;  1LW2 A;  3NAE A;  4DQS A;  1T8E A;  4OGE A;  3QLH A;  3SUQ A;  4M3U A;  4FYD A;  1U49 A;  4OPK A;  3NE6 A;  1SUQ A;  1QTM A;  3HK2 A;  1TKX A;  2VG5 A;  1B9F A;  3AO4 A;  2G8U A;  2A1S A;  4Y1C A;  4DU1 A;  3PX0 A;  4N5S A;  4NCB A;  3TAM A;  5J1E A;  4IBN A;  4ZTF A;  4GVM A;  1VRT A;  3S3O A;  1NJY A;  3TAR A;  4UQG A;  1FXX A;  3AVJ A;  1ZBI A;  1CLQ A;  4KHU A;  4GMJ B;  5J2M A;  3PX4 A;  4CCH A;  1W0H A;  3HJF A;  2EHG A;  4FJJ A;  3P1G A;  2E4L A;  3OYH A;  1HYV A;  3AO2 A;  3OS0 A;  3ASM A;  5CZ2 A;  2HND A;  4CE9 A;  3VQA A;  1LW0 A;  2IOC A;  2YHA A;  3MXI A;  2E6L A;  4E1N A;  4CHQ A;  4M3T A;  3V9S A;  3OY9 A;  3QES A;  3M8R A;  3AVB A;  4PA1 A;  1ZBU A;  4E0D A;  4KPY A;  1HNI A;  3AVL A;  3KK2 A;  4F4K A;  5J2Q A;  3MAQ A;  3SQ0 A;  3CQ8 A;  1BI4 B;  1RTJ A;  4FLY A;  1KFS A;  1S1W A;  4B9U A;  4CF0 A;  2XY7 A;  3SUP A;  2FBT A;  4OKJ A;  4ZHR A;  3MEG A;  2JLE A;  4ELT A;  1WSF A;  1IKV A;  1EET A;  3PY8 A;  2ITG A;  3SZ2 A;  3QEI A;  4DSL A;  4KHN A;  1NOZ A;  3HYF A;  4FJG A;  5FRO A;  2XHB A;  2BGG A;  1UAX A;  3KD1 E;  2DFH A;  1RT7 A;  4DTU A;  3T19 A;  3AVG A;  4CES A;  1S6Q A;  1U48 A;  2QXF A;  2Q3S A;  3QNN A;  1RTD A;  4EZ6 A;  3K5M A;  1FK9 A;  4CJ5 A;  1YTA A;  3KK1 A;  4AIL C;  4DWI A;  1VSK A;  3C6T A;  3D45 A;  1UOC A;  3IAY A;  4M42 A;  1VK0 A;  3AA2 A;  4IDK A;  2DFE A;  3L2W A;  2A1R A;  4O4G A;  3QER A;  3ZSQ A;  4N47 A;  4HUE A;  4CJL A;  2B5J A;  3VQD A;  4FLX A;  4FLU A;  4E7I A;  2EX3 A;  3OYK A;  2NUB A;  3O4Q A;  1LWF A;  4CJQ A;  2Z1J A;  3AVK A;  3RMC A;  4N41 A;  4Z4E A;  3AVC A;  3L2Q A;  3NCI A;  4M45 A;  3TAG A;  3QIO A;  1NJW A;  5T7B A;  3HPO A;  2BDP A;  3DLH A;  4B08 A;  2P5O A;  3LDS A;  3QET A;  4DSE A;  3ZT1 A;  1IO2 A;  4CK1 A;  1MU2 A;  2XO7 A;  1VSD A;  5KRT A;  2QK9 A;  3DOL A;  4DF4 A;  1ZBH A;  2Y1I A;  2QKB A;  2DY4 A;  1QE1 A;  1RT5 A;  2OPR A;  2VWJ A;  4KHW A;  1HRH A;  2WON A;  1JLA A;  1VSM A;  4CIF A;  4FM0 A;  3DLK A;  1TAU A;  4I9L A;  4FVM A;  2HB5 A;  1ZYQ A;  3AA3 A;  1QSL A;  1XHZ A;  1C0M A;  1QQC A;  1WNS A;  3DOK A;  5KGX A;  3VA3 A;  3DLR A;  1J5O A;  2G8V A;  4DLE A;  4AHR A;  3THV A;  1T05 A;  1HJR A;  1HQU A;  2LSN A;  4GW6 A;  4H4M A;  1D9F A;  4KRF A;  3HXM A;  4PUO A;  2XY8 A;  4HUG A;  4H8K A;  1U4B A;  3KLH A;  3RWU A;  3LZJ A;  4IG0 A;  2G8K A;  3AVN A;  3ITH A;  5E41 A;  3OYN A;  1G15 A;  1XWL A;  2G8F A;  4DSI A;  5FRN A;  4FK4 A;  1KVA A;  3AVA A;  1IG9 A;  4KAZ A;  3NH2 A;  2RPI A;  1XI1 A;  1L3T A;  3VQ7 A;  2XY6 A;  4ID5 A;  3OYC A;  3PV8 A;  3IG1 A;  4MFB A;  3TAB A;  3OYE A;  1ZBL A;  4CGJ A;  2PY5 A;  3HVT A;  3V1O A;  4DTN A;  3UIQ A;  1NK5 A;  2YNH A;  4O5B A;  4CGD A;  4BE0 A;  1UWB A;  4RW4 A;  1Z26 A;  4B9S A;  1TGO A;  2OYQ A;  3LAM A;  4JLH A;  3EYZ A;  3DRR A;  3LAN A;  4CEB A;  3HT3 A;  4E7K A;  4KFB A;  2YV0 X;  4JRQ A;  1RTI A;  1Q9X A;  2Z1I A;  3LWM A;  1TL3 A;  3SJJ A;  1U04 A;  1RT1 A;  1NKB A;  2HHX A;  3TR8 A;  4Z4F A;  3DM2 A;  1LAV A;  2RKI A;  4BDZ A;  4KI4 A;  3DLE A;  1GOA A;  3ZSZ A;  4AHV A;  3LPU A;  1NK6 A;  1X9M A;  1J53 A;  2HNZ A;  3DRS A;  1J54 A;  3VQE A;  4CJ3 A;  1TKZ A;  3H08 A;  4ID1 A;  4C8N A;  4IKF A;  2O4I A;  4CJV A;  1S1T A;  4CHZ A;  4CEZ A;  2OPQ A;  4NCA A;  3G0Z A;  3OYG A;  3U3Y A;  4Z4G A;  4BE1 A;  2BE2 A;  4KTZ A;  4DTR A;  4IG3 A;  2YNF A;  3CM5 A;  2PZS A;  3CFO A;  1KLM A;  1O1W A;  4J2E A;  2KZM A;  3NF6 A;  1IH7 A;  4PY5 A;  3DRP A;  4KTW A;  4M3W A;  4QOZ B;  2KTQ A;  1NK4 A;  4EP4 A;  4CHY A;  2B6A A;  2FBY A;  3CFR A;  4AHT A;  3LWL A;  3B6P A;  4QAG A;  4FJK A;  4C8L A;  5HP1 A;  4FK2 A;  4Z4I A;  4AHU A;  4IFY A;  3SUN A;  3MEE A;  4FLZ A;  3RRH A;  4LY7 A;  3VQ5 A;  1WSH A;  4DQI A;  2YKN A;  2DFF A;  4PQU A;  1RBU A;  4DTP A;  1Z25 A;  1WSI A;  1SKW A;  1VRU A;  4FK0 A;  4J2A A;  3PUF A;  1L3V A;  1Q9Y A;  4FM1 A;  1EXQ A;  3AO3 A;  3M8P A;  3SPY A;  4W5R A;  4F2R A;  3DLB A;  1JLE A;  2FC0 A;  3NBP A;  1DTQ A;  4CJK A;  4DS4 A;  1N5Y A;  3F73 A;  3L3V A;  1GOC A;  4FW2 A;  5KRS A;  3IRX A;  4LH5 A;  2E6M A;  4CJ4 A;  4DSJ A;  1S1X A;  2BAN A;  3ISN C;  3VQ8 A;  4K8Z A;  2X6N A;  3WNE A;  1RDB A;  4CGH A;  4DFK A;  1BGX T;  1JXB A;  4R5P A;  4HTU A;  4FJ9 A;  2HHT A;  2OA8 A;  1CZB A;  4BWM A;  2YKM A;  3M8Q A;  3V1R A;  1YTU A;  5C42 A;  3NF7 A;  4I7F A;  4O0I A;  4BDY A;  4FZX C;  1HYS A;  3DYA A;  1U47 A;  2PYJ A;  1NKC A;  2JGU A;  4E89 A;  1FKP A;  3HO1 A;  3SQ4 A;  4FJL A;  3K5N A;  4CJP A;  5C25 A;  2KFZ A;  4ELU A;  1BIZ A;  3WNH A;  3KLE A;  1JLQ A;  1T7P A;  1WAJ A;  3I0R A;  4DQP A;  2KW4 A;  2OZM A;  1WSE A;  3O4N A;  4CFD A;  4NYF A;  1CXU A;  4JS4 A;  4EP5 A;  2YNG A;  3V9U A;  4IFV A;  5KGW A;  4DU4 A;  1RT3 A;  3QNO A;  1TK0 A;  4KB1 A;  4TSX A;  1EX4 A;  4CK3 A;  3LZI A;  4KKO A;  1C1B A;  3AVM A;  4E7L A;  1NJX A;  3FFI A;  5DMR A;  3MXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...