4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
1NK4A 1S1WA 2G8WA 1T03A 3V1QA 1NKEA 1SKWA 1IKVA 1I3AA 4TSXA 4IG0A 4AHVA 4CF0A 2VWKA 3WNHA 3M8QA 4CIEA 3KK3A 3K5NA 1UA1A 4CEZA 3PY8A 4FJMA 4CFAA 5JS1A 2R7YA 4CEOA 2DFFA 4AH9A 4OKJA 3LANA 2P5GA 3KKSA 4CECA 4FLZA 4FK0A 3ITHA 1J53A 3JYTA 4DTPA 4RW4A 4IBNA 3OYMA 4Z4FA 4CK3A 1NK0A 1B9FA 3LWMA 3AO5A 4FVMA 3OYGA 3EZ5A 3HK2A 3TAPA 1J5OA 2KFZA 4E3SA 4E7HA 3QEWA 3RMCA 4DLEA 4PWDA 5KI6A 4BE0A 1LW2A 4FLTA 1NJZA 3HSTB 4CFDA 1JL2A 4O5BA 3VQ9A 4IDKA 4E7LA 5FRMA 3OYEA 4W5TA 4FK4A 4DG1A 3C95A 4ELUA 3ZSYA 4F4KA 3OYNA 3OYFA 4HUGA 1F21A 5KRTA 3TABA 1D9FA 1TL3A 4IKFA 3DLEA 3ZSZA 4DFPA 1U04A 2YNFA 3AO2A 4LD0A 3S9HA 2KZMA 4AHSA 3DOKA 3LAKA 2P51A 4G1QA 1B9DA 2ITGA 3DMJA 3VQ6A 3SUNA 4FK2A 1KFDA 4KKOA 1JLFA 4I9LA 4CJEA 2IAJA 5EU7A 3EY1A 3SUQA 1K6YA 5CYMA 2A1RA 3MXIA 1TKTA 1KSPA 3H08A 2IC3A 2EHGA 3V6DA 3QINA 4FZYA 1WAFA 4CHYA 3AA4A 1C0TA 1UAXA 4O0IA 1L3TA 3RR8A 1JXBA 5KTQA 4YNQA 1U49A 1S1UA 4CHOA 4ID1A 2YKMA 3AVAA 4EZ6A 4KI6A 3U3YA 1DLOA 3NGZA 4EP5A 1L5UA 4M3ZA 4KAZA 4KREA 3NDKA 3PO5A 4IG3A 4I7FA 3EYZA 3KKRA 3PX4A 3K5MA 4Z4HA 2I5JA 2OPRA 3VA3A 3NF8A 2HHSA 1BQMA 2X78A 2KTQA 1YVUA 1DTTA 5J2PA 4N41A 4CFCA 3V81A 2F8TA 1FKOA 2FC0A 3VN5A 2XY7A 5CZ1A 4OPKA 4Z4GA 1J54A 1IG9A 3QEXA 1RT3A 3F9KA 1VSIA 1C0MA 3VQBA 4CFBA 2Q3SA 4CESA 1LWCA 4AHUA 5C25A 4FLYA 4FM2A 3QIOA 3QNNA 4B08A 4DSIA 3K58A 4CIGA 2PYLA 1TVRA 4CEQA 3LP0A 3DOLA 4I2QA 1T8EA 3RMAA 1HNVA 4OLBA 1IKXA 3P83D 1HNIA 4E19A 3KJVA 3TAQA 3QLHA 2RN2A 3S3NA 3IRXA 4DSKA 4LH4A 2JGUA 1WAJA 1QE1A 1QSSA 3LAMA 3ZT1A 4E0DA 1D9DA 3DRPA 4CHZA 3AO4A 1LW0A 3ZT0A 5FRNA 3SUOA 2G8IA 4CCHA 2HHVA 3HO1A 2OZMA 4DFMA 4KHNA 4O4GA 4DQIA 3OJSA 4CEEA 3IS9A 2G8UA 1A5VA 1C6VA 4ELVA 4GMJB 4EP4A 1SKSA 4DSJA 1O1WA 4O55A 5KGXA 3V1OA 4CK1A 1C1BA 3CFOA 1EETA 1NKBA 2FBXA 2QKKA 4M42A 1RDBA 3HXMA 4BE1A 4DU1A 3K57A 1JLBA 1ASVA 4C8OA 4CJRA 2DTUA 1TK8A 3SV4A 5SWMA 3V4IA 4LH5A 4KTQA 3DLGA 1RBRA 1TV6A 1EKEA 1RDCA 2OPSA 4FLUA 3THVA 4B9LA 1QSLA 2OZSA 1XHZA 1BGXT 1S9EA 3LWLA 2XY5A 2HVIA 3P1GA 1UOCA 1R0AA 2IDOA 3SPZA 4DS5A 4FW1A 4CGHA 3AA2A 4E7KA 1BI4B 3QEVA 1A5WA 5HLFA 1S5JA 4CJLA 3T1AA 3QESA 3MEDA 4HHTA 2YV0X 4FW2A 3AV9A 3QO9A 4YFUA 4FJNA 4FJ8A 1T05A 2YNHA 3VQ8A 2HHUA 3U3GA 4JRPA 1UA0A 1FKPA 2VG6A 1NK7A 4C8NA 3SQ1A 4N5SA 4JS4A 1VK0A 3MXMA 4M3UA 1RT6A 3OYJA 4Z0UA 4J2DA 2PY5A 1BIUA 1KLMA 4BWMA 4QAGA 4CGDA 3RR7A 4NYNA 4M3YA 3ULDA 3BDPA 1TK0A 4N76A 1RTJA 3SI6A 2VG5A 4LSNA 3OYHA 3HJFA 4Z4IA 2Z1IA 1L3SA 1REVA 3QEPA 1YTUA 3CG7A 2VG7A 3NGIA 4BDYA 1KLNA 3KLHA 4ICLA 1U48A 4DWIA 4FJLA 4HUFA 3SPYA 2BANA 4H8KA 4FJ5A 1C0UA 1WSIA 1IO2A 4K8XA 3V1RA 4CHQA 1KFSA 4FJGA 3VQQA 4DFKA 3WNEA 1BL3A 1LWFA 1WSGA 3E01A 1XHXA 4CJ3A 4CJKA 3VQEA 1T7PA 4B3OA 3BGRA 2QK9A 4N47A 1CXQA 2OPPA 3O4QA 5E41A 4XIUA 1HRHA 3PX0A 2OYQA 3VA0A 3ZSVA 1EXQA 4M41A 3C94A 1HYZA 3L2WA 1QS4A 4BE2A 4KHYA 1X1PA 3PUFA 1RBVA 4C8KA 3CQ8A 2G8FA 3SJJA 3NF9A 4E1NA 3AO1A 3OS1A 3LP3A 3T3FA 4DQPA 4CJVA 3AVGA 1JLCA 3VQ4A 3ZSXA 3DRSA 3RRGA 4DU3A 2HHQA 1SL2A 3KIOA 1BHLA 1RT7A 1TGOA 2RKIA 3T19A 3CFRA 1ZBLA 1VSJA 3IAYA 3L3UA 1JKHA 1HJRA 4CEBA 4C8MA 4HCCA 3CM5A 3B6OA 4HUEA 1KRPA 1RDAA 3WNGA 4CJ4A 4W5OA 5CY4A 1YT3A 4FJXA 2B5JA 3HP6A 4KHWA 3NE6A 1CLQA 2QXFA 1JXEA 4CJ5A 5FROA 1TKZA 1XWLA 3L2UA 1RT4A 4WE1A 1VSEA 3L3VA 1HYVA 1CZBA 2LSNA 3ASMA 5HROA 1NK5A 4KTZA 3D45A 3ZT2A 4FZXC 1VRTA 1ASUA 3DI6A 3AVNA 3NH2A 3OS0A 2Z1JA 4B8CA 5I3UA 3NF6A 3KD5E 4OKEA 3TI0A 1KVBA 2D5RA 1EX4A 2X6SA 1WSFA 1MU2A 3HVTA 1XC9A 1N5YA 2XY6A 1LAWA 1ZBFA 4R5PA 4CJFA 4FLXA 1RT5A 5DMRA 1QTMA 3KLIA 4M3XA 4B9MA 5HRRA 3HPHA 4KO0A 1VSMA 4PUOA 1SL1A 4B9TA 4QOZB 2D0CA 4FM1A 3C6TA 1BIZA 2ZE2A 4KV8A 2ETJA 3L2RA 2E6MA 3NH0A 3OYBA 1NK6A 4E7IA 3OYLA 4ELTA 2O4IA 1GOCA 3WNFA 4OLAA 4CF2A 1BQNA 3I8DA 3DLBA 3K2PA 3KTQA 3OYDA 3OYCA 3QIPA 1GOAA 4CGFA 4RW7A 3NCIA 4DQQA 5HRNA 3RMDA 2YKNA 2F96A 1S1TA 2HNZA 3AVFA 4GVMA 4N56A 3RTVA 2BGGA 3DLRA 4E1MA 4KB0A 2E6LA 2ATQA 3AVCA 3SQ4A 4FJHA 2GV9A 1NJYA 4F3OA 2A1SA 2W42A 4CJPA 4Z4EA 3TAFA 5HRPA 4DTMA 5SZTA 3KD1E 5DK5A 4FJ7A 4CJTA 5FDLA 1LV5A 3IG1A 4OGEA 1ASWA 1TK5A 1RCHA 4MFBA 4NYFA 2IGIA 4J2AA 1LAVA 1SL0A 1Z26A 5I42A 2JLEA 3V9WA 5KRSA 3G10A 4DFJA 3ZSQA 1RT2A 3MXJA 3A2FA 1WSJA 2ZD1A 3KK2A 1WSEA 4FJJA 1TKXA 4FLVA 5J2NA 4F2RA 2BDPA 4BDPA 2X6NA 4B8AB 2B6AA 1BCOA 3AVMA 3ISNC 3JSMA 4GW6A 3TR8A 3U6FA 3AVJA 1VSHA 2DFEA 3CFPA 4NCAA 1NK9A 1WNSA 2IS3A 2XY8A 1NJXA 2P5OA 1NOZA 2X74A 1S6PA 2NUBA 3SYZA 3AO3A 3DLHA 2HW3A 1EP4A 3NAEA 4RW6A 4DTSA 4E7JA 3LPTA 3PO4A 5CZ2A 3I0SA 1FXXA 1WN7A 3VQPA 4CEAA 4O44A 3M8RA 1Q9XA 4J2EA 3HPGA 3OS2A 3V9UA 4KPYA 4Q0BA 4KB1A 4FYDA 3LP1A 3TAGA 2QKBA 1VSKA 4BDZA 3L2QA 3KLEA 4DS4A 2KFNA 4W5RA 3MAQA 1BISA 1HQEA 2YHBA 4CJUA 4K8ZA 4FJKA 4HVJA 2GUIA 1U45A 4M3RA 3FFIA 4CJWA 2WONA 3HT3A 1JL1A 2YNIA 3K59A 3CM6A 4DTNA 1ZBHA 4QCLA 5CYQA 4IFVA 4W5QA 4FLWA 2OA8A 2KW4A 2EX3A 2B4JA 4LSLA 4CJQA 3LZIA 3ZT3A 4CK2A 3O3HA 3V9XA 1N6QA 2IOCA 3OYAA 3AVKA 4B9UA 4PQUA 4DU4A 2DY4A 4DTOA 4FJIA 1IKYA 5HRSA 4B9VA 3P5JA 3D0PA 1JLAA 4NCBA 3TANA 1X9SA 4F8RA 2HNDA 3VQCA 4KHSA 2D0AA 1TAQA 2VWJA 3SUPA 5KGWA 2G8VA 5D3GA 2HHXA 1ZBUA 2ZQBA 1D8YA 1RBTA 3ALYA 4CEDA 3OY9A 3HPOA 4JS5A 4Y1DA 4ZTFA 3PX6A 4DTUA 3HYFA 3KLFA 3F73A 3B6PA 5T7BA 4DSEA 4OVLA 5C42A 2Y1JA 3PV8A 3LP2A 1QSYA 3VQDA 4KHUA 2E4LA 1FK9A 2KQ2A 3AA3A 3ZSOA 4AHTA 4DTJA 4CGIA 4DTXA 1KVCA 2G8KA 1HMVA 3UIQA 1WSHA 1KVAA 1WLJA 4DF8A 3NGYA 1NJWA 3RWUA 3MECA 3KK1A 1XI1A 1TKDA 4J2BA 3VQ5A 3LZJA 4CF8A 1B92A 1JLQA 1KCFA 3AVBA 3K5OA 4BACA 3QERA 1HYSA 3AVIA 2FBVA 3OVNA 3NFAA 1RTDA 3NH1A 3SQ2A 4AHRA 4M45A 4FZZA 3OYIA 1JLGA 3MEEA 3OYKA 3OJUA 1TL1A 4KRFA 1Q8IA 3C6UA 1BI4A 4IFYA 1QHTA 3QNOA 4RG8A 3RMBA 2KZZA 3KLGA 2G8HA 3SQ0A 3O3GA 4DSFA 4EZ9A 1S1XA 2AJQA 1Q9YA 1IKWA 4DQSA 4Z4CA 2Y1IA 3NHGA 1W0HA 2YHAA 4PY5A 1QQCA 1S6QA 4NCGA 1S9GA 4ID5A 4CERA 4B9SA 1TAUA 1VSDA 2P1JA 3L2VA 1NKCA 4OGCA 5J2QA 1VSLA 5K14A 4FJ9A 3S3MA 1RILA 5HBMA 3QEIA 3SCXA 2OPQA 4ZHRA 2PYJA 4JLHA 1KTQA 4B9NA 3MEGA 4CHNA 1CXUA 2FBYA 4CHPA 1YTAA 2HB5A 5J2MA 1L3VA 2HHWA 2WOMA 4DLGA 1RNHA 4DF4A 1G15A 1SUQA 3DRRA 4AHCA 3CYMA 5JS2A 4HTUA 2D0BA 1GOBA 1RT1A 1X9MA 1ZBIA 1RBUA 1RTHA 3NF7A 4Y1CA 3ZSWA 4FXDA 4M3WA 3DM2A 4H4MA 3VQAA 4CGGA 4KFBA 3DLKA 2F8SA 1U47A 1VSFA 1ZYQA 3HL8A 4BWJA 3NBPA 3QETA 1BCMA 2YNGA 1D5AA 1HPZA 2Z1HA 4PA1A 3TARA 3S3OA 2RF2A 4FCYA 2HNYA 2XHBA 3LDSA 4W5NA 1L3UA 1VRUA 2DFHA 4Q5VA 2RPIA 3TAMA 3ZT4A 4E89A 3LALA 4AILC 4CE9A 3SV3A 3TAEA 2HMIA 4M3TA 1I39A 4RW9A 2XO7A 1NK8A 3SZ2A 4F3TA 3RRHA 3G0ZA 1HQUA 1RTIA 4CGJA 4FM0A 4L8RB 4CEFA 2HVHA 1S1VA 1X9WA 3I0RA 4MQ3A 4I9QA 4OJRA 4C8LA 5C24A 1ITGA 2O4GA 1DTQA 1CZ9A 1SV5A 4RW8A 2Z1GA 1J9AA 2GBZA 4KTWA 1A5XA 3AVLA 3K5LA 1LWEA 3V9SA 4H4OA 4DQRA 3TWHA 4DTRA 4CF1A 3V9ZA 4HCBA 3DYAA 2HHTA 2XRIA 2FBTA 4CIFA 1Y97A 3AA5X 1IH7A 3O3FA 3ZCMA 2BE2A 4DMNA 3SNNA 4LY7A 1NOYA 4CJSA 3O4NA 4KHQA 1SKRA 3LPUA 3L8BA 4OKKA 1JLEA 4CF9A 1C1AA 3AVHA 4DSLA 3M8SA 4F2SA 4I2PA 1UWBA 1Z25A 3ZSRA 4JRQA 3VQ7A 4OPJA 4ZTJA 3HP9A 1C1CA 4O0JA 5J1EA 3HVRA 5HP1A 2PZSA 4KI4A 1RBSA 1W9HA 1RDDA 3M8PA 3HM9A 1U4BA 4UQGA
chains in the Genus database with same CATH superfamily
4IFEA 1I3AA 1YUWA 4H0VB 2VWKA 3WNHA 1UA1A 4FWRA 1NGGA 4CEOA 4AH9A 3LANA 1KC8O 4QS8A 2P9NA 1NG9A 1J53A 3JYTA 3VENA 4IBNA 3L4QA 3CJ1A 5JLHA 3O4WA 4CZMA 3HK2A 4CZEA 1J5OA 4Z94A 3H46O 4FLTA 4DV7K 1KD1O 3VQ9A 4W5TA 1N8RO 3KWIA 4LD0A 1DKGD 1BA1A 1IG8A 5GADP 3FFKB 4G1QA 3DMJA 2YCHA 2ITMA 2IAJA 3EY1A 5CYMA 3MXIA 1BU6O 1TKTA 1KSPA 3Q7CA 3V6DA 1XQSC 2O8DB 4LC9B 1OH5A 4BR9A 1UAXA 4UY8O 5KTQA 4YNQA 1U49A 2ZJRL 4B3MK 1YAGA 1HR0K 3JXUA 3H3OB 4JI7K 3NGZA 2HOEA 4EP5A 3PO5A 3EYZA 3KKRA 4Z4HA 2PAVA 2OPRA 2X78A 1OH8A 2GX9A 1DTTA 4H5TA 4N41A 4JI6K 4JKAA 1FKOA 2FC0A 1RT3A 4DB3A 2E8AA 3KWGA 1NK4A 1SKWA 2QWPA 3QNNA 3S3NA 1KQSM 3TAQA 1RFQA 5AQTA 3M5RA 4IJAA 4BRQA 4LH4A 2JGUA 5AQGA 4CHZA 5FRNA 1YF5L 3NVMA 4M7YA 4KHNA 4O4GA 1GLCG 4CEEA 1A5VA 4CJ7A 2P9IA 4IOAL 3BUZB 5KGXA 1C1BA 3CFOA 3J81O 2HBJA 1RDBA 1JLBA 3F5TA 1ASVA 1TUYA 4CJRA 1U2VB 1TK8A 3SV4A 5SWMA 4LH5A 2NRWA 3DLGA 1RBRA 4JAXA 3QBWA 1QVFM 2ASMA 4B9LA 1K8KB 1BO5O 2XY5A 1R0AA 4JI0K 4DS5A 4FW1A 4BRHA 4CGHA 3AA2A 1BI4B 4JKCA 3T1AA 4CJLA 2WFBA 4PKGA 3MEDA 4HHTA 2YV0X 3M6GA 1N32K 4FJ8A 2YNHA 1UA0A 2VG6A 4N5SA 4JS4A 1VK0A 5M1NA 1WBBA 5GAEP 5A2QO 5TKWA 2I7PA 2V7YA 1BIUA 4LF7K 1KLMA 3HZ6A 3D7EO 4BC2A 3BDPA 4CVNE 3MN7A 1TK0A 2QWRA 5C0YA 5KQDA 4A57A 4A2BA 5AQQA 5M1OA 4IEIA 4FJLA 4ICLA 2BANA 1C0UA 4DHYA 3WNEA 4LF5K 4CJ3A 4B3OA 3QB0A 2J4RA 4LF4K 2OPPA 4BC4A 2O8BA 4X62K 3ID6A 1MWMA 4BR4A 3H1QA 3A5NC 3PUFA 1RBVA 2G8FA 3AO1A 3HTVA 3J7AP 4CJVA 1GLEG 1JLCA 3TTDA 3ZSXA 1NGFA 3OBYA 3KIOA 1BHLA 3N4PA 3UE5A 3T19A 1HKBA 1JKHA 1HJRA 4CEBA 3TSPA 4C8MA 3CM5A 1KRPA 1YT3A 5LY3A 5FROA 4F9OA 2NZTA 3WQTA 4WE1A 3ASMA 1CZBA 2LSNA 4FZXC 3DI6A 3AVNA 3UKRA 5F0XA 4B8CA 5I3UA 3NF6A 2E88A 3EKUA 2D5RA 1EX4A 1MU2A 1N5YA 1LAWA 4R5PA 2PFUA 4CJFA 4FLXA 1RT5A 1QTMA 3KLIA 3QMLA 4B9MA 1SL1A 3O1BA 4FM1A 3J8AA 3VEYA 3UKUB 3C6TA 5CE3A 4KV8A 2E6MA 3NH0A 3OYBA 3CCLN 1NK6A 3OYLA 4ELTA 3AGRA 5E84A 3RMDA 2HNZA 2E2OA 3T1YK 2ATQA 1NMDA 3VF6A 2DPNA 4NXNK 4CJPA 4Z4EA 3HOSA 5DK5A 5EXWA 1QZ5A 1LV5A 2UYTA 1TK5A 1ASWA 1RCHA 4MFBA 2YJEA 3PSIA 2GWJA 2JLEA 3G10A 3ZSQA 3MXJA 1K73O 2YHYA 3VEZA 5J2NA 1N34K 2BDPA 4BDPA 3HM8A 2FF6A 4H0PA 3O9RA 4B1VA 3E66A 1VSHA 3ENOA 4WQ5C 3CFPA 3VEWA 3EE9A 1NK9A 3ATUA 2NUBA 1SS6A 4WFAL 5CZ2A 3DWLA 3M8RA 4J2EA 1Q9XA 3VEVA 3TAGA 2QKBA 4BDZA 1M90O 5LL6Z 2OCEA 4H5VA 3A0IX 1HQEA 2GUIA 2D0OA 4FWPA 4CJWA 4IWVA 3K59A 3CM6A 4BGAA 4X66K 4DTNA 1EWRA 2KW4A 2EX3A 4LSLA 4B9UA 4M7XA 3AVKA 4B9VA 4HTLA 2VWJA 2G8VA 5KPZA 3ZX3A 1D8YA 3OY9A 4JS5A 3PX6A 4DTUA 3KLFA 3B6PA 5T7BA 3VMFB 4OVLA 2Y1JA 3BZKA 1EWQA 1FK9A 3TSQA 4DTJA 4I6MB 5FLXO 1QQNA 1NJWA 4BRKA 1NGEA 3CERA 3VTIA 3O6WA 1B92A 1JLQA 4FL9A 3M3ZA 2GEMA 3R3LA 3NH1A 5C2FA 3U9DA 3OYIA 2QW9A 1Q81O 3BP8A 5M1FA 4RG8A 4BRFA 4YDUC 3T69A 3IMXA 3O3GA 3SQ0A 1S1XA 3CIPA 3CJBA 3OA9A 3NHGA 2YHAA 4PY5A 5GIOA 1S9GA 4J8FA 1NGIA 4OGCA 5J2QA 3THXA 5F2RA 4FJ9A 2ZM6K 3WQUA 3CQXA 2OPQA 3FZHA 4L3QA 4B1WB 3SAGA 2NRHA 2FBYA 1L3VA 2HB5A 4DF4A 2RE2A 1G15A 1SUQA 3DRRA 2P9SB 5JS2A 3WXJA 2D0BA 1HNWK 4Y1CA 4H4MA 4CW7B 4KFBA 3DLKA 2QA4N 3QETA 2E2NA 4JK8A 2ASOA 2YNGA 4PA1A 1HPZA 2V7ZA 3L6QA 3D6RA 2FSKA 4FCYA 3A8YA 1VRUA 2DFHA 4Q5VA 1VQMN 2RPIA 3BF3A 3LALA 4CE9A 4KHPK 3SZ2A 4F3TA 4FM0A 4DUZK 1X3NA 4CEFA 4AQYK 1J5EK 3I0RA 4MQ3A 3ZYYX 4C8LA 4H0YB 2O4GA 3Q7BA 1CZ9A 1A5XA 3K5LA 1LWEA 4A59A 5CR4A 3TWHA 2NLXA 4HCBA 3ZEUA 1Y97A 3J80O 1IH7A 4JYAK 4RCHA 2BE2A 2O8DA 5JLFA 4KHQA 2EWSA 4OKKA 3D2FA 4MO5A 4I2PA 2F4VK 3ZSRA 5LMNK 1RBSA 1W9HA 5AQSA 1WB9A 1U4BA 4UQGA 3KTQA 3KK3A 5JS1A 4FJMA 2NRXA 2P5GA 2P9PB 2QWMA 3BF1A 3VEOA 4CECA 1TYQB 4FLZA 1NGCA 4DTPA 4RW4A 4Z4FA 4CK3A 3OYGA 2HF4A 1O13A 4BE0A 1NJZA 1TUUA 3HSTB 4CZLA 1JL2A 4E7LA 4ISEA 4ELUA 3OYFA 4DUYK 1F21A 2Q0RA 2Q31A 3AO2A 3P39A 5AQMA 3QBXA 4AHSA 5MLCQ 1BA0A 3H45C 1B9DA 3SUNA 3WEEB 4KKOA 5C12A 3O9TA 3OHRA 1VQ4N 3THYA 4OPAA 4BG9A 3AA4A 1L3TA 3R1XA 1JXBA 3J7YP 2YKMA 4BRGA 3AVAA 4EZ6A 3LDQA 3GDQA 4B1UB 3CPEA 1VQ9N 5AQOA 5TKYA 4KREA 3NDKA 1IBKK 3NF8A 4DV1K 1YVUA 4U7BA 4BGBA 4CFCA 3RSEB 1IG9A 3F9KA 2CH5A 3R8EA 1VSIA 4CFBA 4DSIA 2WUSA 4CIGA 3DOLA 4I2QA 1T8EA 3QFUA 2OTLN 1IKXA 2IVPA 1HNIA 2QWNA 3KJVA 2RN2A 4BR2A 3AARA 2E5LK 3LAMA 4E0DA 3AO4A 1LW0A 3ZT0A 4KBOA 4CCHA 2HHVA 1VQPN 4ISGA 3OJSA 1GLFO 1SKSA 1O1WA 1NKBA 2FBXA 1JJ2M 3HXMA 3KHYA 3K57A 3GG4A 2ZF5O 4JI2K 4C8OA 2DTUA 3CC2N 3HOTA 3V4IA 2P9KA 4BRDA 1EKEA 1QQMA 1DEJA 3MN5A 1YIJN 2D0PA 3THVA 2WC9A 1QSLA 1XHZA 1S9EA 5KPTA 3G4SN 3VESA 3ZETA 2HVIA 3SPZA 1Q7YO 3QEVA 1A5WA 1S5JA 1NJIO 3QO9A 5AZJA 4YFUA 4BRIA 3U3GA 4JRPA 3MN6A 4J2DA 4CGDA 3RR7A 4M3YA 3F2KA 2VG5A 2Z1IA 1YTUA 3CG7A 4PKHA 4H8KA 4WQ4C 4A5BA 3OBWA 1WSIA 3V1RA 1KFSA 3VQQA 1BL3A 3O9QA 3K9JA 3PIPL 1T7PA 3BGRA 5BREA 1E4FT 1CXQA 1WBDA 3ZSVA 1EXQA 2E2PA 1SQKA 1HYZA 2QI2A 3L2WA 2P9SA 4BE2A 5C2DA 5AQFA 2YI1A 4MLEA 3NF9A 4E1NA 1HLUA 3OS1A 1T6CA 3VQ4A 3DRSA 5AQWA 4DU3A 1RT7A 2UUBK 2UXDK 1FW6A 3N4QA 4HCCA 4JKDA 1RDAA 3WNGA 4CJ4A 2YHXA 3HP6A 3CCVN 1JXEA 4DKWA 5AZJB 1N36K 1TKZA 2VGMA 3THYB 1VSEA 3L3VA 4JKBA 1BG3A 2NRTA 3SBGA 5F1XA 4IZ9A 1ASUA 3RVCA 1ILYA 2V52B 2X6SA 4PHTX 3MX2A 3HVTA 2FSNA 3TTCA 2XY6A 5HRRA 1VSMA 4PUOA 4B9TA 2D0CA 1YHQN 4XH5A 1QVGM 2ZE2A 3L2RA 4CI6A 3SMSA 3OYDA 3OYCA 3QIPA 3NCIA 4RW7A 1OVYA 3SQ4A 4FJHA 2GV9A 2W42A 1JCFA 3TAFA 5SZTA 4LF8K 2FXUA 5FDLA 2IVNA 2FF3B 4BR7A 1LAVA 3THWA 3VTHA 2QWLA 3I33A 4B3RK 1WSEA 1OVQA 2QXLA 4F2RA 3DAWA 4YOTA 2PBDA 4B8AB 1BCOA 4IEEA 3MK6A 3ENHA 4GW6A 3AVJA 1XNRK 4H03B 2P5OA 4FWNA 4MDAA 2X74A 3SYZA 3AO3A 1EP4A 4CZHA 2P9UA 4DTSA 4E7JA 3LPTA 1CZAN 1FXXA 1WN7A 3VQPA 3HPGA 3V9UA 4KPYA 3AAQA 4Q0BA 4G9ZA 4FYDA 3LDOA 4BQLA 2KFNA 3L2QA 3AGKA 4A62A 2YHBA 4FJKA 3W0LA 4M3RA 3WEEA 1D4XA 2A40A 1JL1A 5CYQA 4FLWA 2NRVA 2OA8A 2O8EB 1N6QA 4H0XB 4CJQA 4M3ZA 3O3HA 2IOCA 3IFRA 4OO1J 4PQUA 3JS6A 2DY4A 1IKYA 3D0PA 1X9SA 2Q2RA 2HNDA 5D3GA 5ADXH 3FZLA 1RBTA 4DR7K 4ZTFA 2BTFA 3HYFA 1WUAA 5ELZA 1VHXA 4DSEA 1QSYA 3R9PA 3VQDA 2E4LA 1HMVA 1WSHA 3RWUA 3MECA 3KK1A 1XI1A 4J2BA 1KCFA 1Q86O 3QERA 3QICA 1HYSA 2VQFK 2FBVA 3OVNA 1RTDA 3SQ2A 4M45A 3WXLA 4FZZA 4JI4K 4HWIA 3OJUA 4KRFA 3C6UA 1BI4A 1FJGK 5CHIA 3CD6N 3ZETB 1DGKN 3TU5A 3AAPA 4DQSA 4FWKA 1W0HA 1QQCA 4NCGA 4B9SA 2P1JA 4C1NI 2W6KA 3CCEN 1U2VA 2A5XA 1VSLA 4E1JA 2D4WA 5ADXA 1RILA 3SCXA 3SJHA 4QS7A 5BR9A 1KTQA 3MEGA 2VGNA 3PSFA 4BVPA 2HHWA 3O1WA 4WYBA 4AHCA 1RT1A 1X9MA 1MDUB 1E3MA 1RBUA 3NF7A 3T1HK 3VQAA 2ZGYA 2F8SA 4BRCA 4BWJA 2O8EA 3S3OA 1D5AA 3TARA 2CGLA 1ZBSA 3MMVA 2HNYA 2JWKA 2XHBA 1L3UA 3DXMA 5AQVA 1Z6RA 2E1ZA 3SV3A 3K0SA 4FVUA 2A42A 4JHDB 3RRHA 3G0ZA 1X9WA 5C24A 2P9UB 1DTQA 1QHAA 3V9SA 5C10A 1J9AA 3ZX2A 4DTRA 4O5FA 2XRIA 4BRNA 3CHWA 5AQRA 3SNNA 2A41A 3DJCA 1NOYA 5JVHL 1W7AA 1SKRA 4DV0K 4NLCA 5EY4A 3AVHA 1UWBA 4JRQA 4BY9C 4OPJA 1RDDA 5HLFA 4K0KK 1S1WA 2G8WA 1IKVA 4CF0A 4TSXA 4IG0A 4AHVA 3K5NA 5AZIB 3PY8A 3M8QA 4CIEA 5AJ3K 4DR4K 2R7YA 4B3SK 4OKJA 5BRDA 1OH7A 5BRFA 2FLOA 5AQIA 2WTUA 2Q0UA 3CPWM 4NLBA 3OYMA 4YY3K 1NK0A 1NGHA 4FVMA 3TAPA 2KFZA 1WOQA 4E3SA 3RMCA 4DLEA 3TPQA 5GIPA 5C15A 3FZMA 4JD2A 5FRMA 3OYEA 2Q36A 3WUHA 3C95A 3ZSYA 3OYNA 4HUGA 1D9FA 3TABA 3ZSZA 4DFPA 2YNFA 1XMQK 2KZMA 3DOKA 1NWKA 5DM7L 2P51A 2ITGA 1KFDA 1JLFA 3CJ7A 4CJEA 5AQPA 3SUQA 1K6YA 2EHGA 3AY9A 1WAFA 3LDLA 4FZYA 4CHYA 3L4IA 5BPMA 4IDHA 4ID1A 4C1NK 5BPNA 3U3YA 1YJNN 2GUPA 3U8XA 3SK3A 4IG3A 4DR6K 3QFPA 3K5MA 2KTQA 3V81A 2QTDA 4A2AA 3VF4A 4OPKA 1J54A 1NM1A 3QEXA 4IOXA 4FJ5A 4CESA 2W41A 1LWCA 4AHUA 5C25A 3QIOA 3K58A 2PYLA 1TVRA 3LP0A 4OLBA 3P83D 3CCRN 1YITN 3QLHA 2F7TA 4FWSA 4AM6A 2GTDA 1QE1A 1QSSA 3DRPA 2G8IA 3ZLJA 3CXCM 3IDHA 5AQNA 4DFMA 1NGBA 3IS9A 2G8UA 1IBMK 3LM2A 5E26A 4B1XB 4EP4A 4DSJA 4O55A 3V1OA 4NO7A 4LFCK 1EETA 4BRPA 2P9NB 1XNQK 4BE1A 3CI5A 4WQ5A 3GOIA 3H1VX 2ZGZA 3U4LA 2OPSA 4FLUA 2F9TA 4BRLA 1BGXT 3MWTA 4ILHA 4NXMK 1VQLN 3R6MA 4FW2A 5GAHP 5AQKA 3AV9A 4FJNA 1T05A 3VQ8A 4GV6A 4MO4A 3CCJN 3CF5L 1RT6A 4H5RA 3LDNA 4Z0UA 5EOYA 4FSVA 2QWQA 4B3TK 4BWMA 2WBNA 1P90A 4DV3K 3ULDA 2BUPA 4BRMA 4BR5A 1U6ZA 3EE8A 3NGIA 2VG7A 4DWIA 4BDYA 1KLNA 1RGIA 1U48A 4JKGB 3SPYA 5B8HA 3UB5A 5BN9A 3I56N 4FJGA 4GKKK 4DFKA 1LWFA 1T6DA 3E01A 1XHXA 2UUAK 1HKGA 3VQEA 2UU9K 3MX5A 4O8UA 1C0GA 4N47A 2IVOA 3O4QA 2AA4A 4JK9A 1NGAA 1X1PA 4C8KA 1VQNN 1P8ZA 4JKHA 3SJJA 2HF3A 1S72N 4YHHK 1RDWX 4FOEA 2YHWA 1TGOA 3A5LC 3O80A 3CFRA 3THXB 1ZBLA 2YJFA 3IAYA 3L3UA 4YORA 1V4SA 3CJ9A 4FJXA 4KHWA 3DXKA 2B5JA 2HBLA 1CLQA 5AQHA 3BY5A 1KAYA 3ZX0A 2UUCK 4LFBK 4JI3K 3I8BA 3HBTA 3ZT2A 3D45A 3NH2A 3OS0A 2Z1JA 3HI0A 2V51B 4OKEA 1RDUA 5M1QA 1XC9A 1I94K 3CC4N 4M3XA 3HPHA 4KO0A 4CBUA 4QOZB 2GELA 4ILJA 1VQON 4JK7A 4YOVA 4RWTA 4E7IA 2O4IA 3WNFA 4CF2A 1BQNA 3MDQA 3P38A 5EX5A 3K2PA 3DLBA 4CGFA 4DQQA 1TYQA 5HRNA 2YKNA 4N56A 3RTVA 3AVFA 2IIRA 2BGGA 4KB0A 3AVCA 3O9UA 4F3OA 1QZ6A 2A1SA 5AZIA 5HRPA 4FJ7A 3IG1A 1IJJA 3IKMA 4NYFA 3EEQA 1SL0A 1ESVA 3ULEB 1TKXA 4FLVA 4DCHA 5M1KA 1VQ7N 2X6NA 2E20A 1HPMA 4WFBL 3AVMA 3ISNC 3JSMA 3DXKB 3TR8A 4AM7A 3U6FA 4NCAA 1WNSA 2IS3A 3C65A 1NJXA 1Q82O 5LJVA 3NAEA 4RW6A 3C6HA 3I0SA 4GVEA 4KH5A 4FPAA 1VSKA 4DS4A 4W5RA 3MAQA 1N33K 2O8FB 3MCAB 4HVJA 2I7NA 4DV6K 3FFIA 3HT3A 2YNIA 1X3MA 1YI2N 4K41A 1VQ8N 3ATVA 3ZT3A 3OYAA 4DU4A 3DLLL 5HRSA 1JLAA 4JD2B 3TANA 3VQCA 3FLCO 2D0AA 3SUPA 5KGWA 2CGKA 4KH4A 4BREA 2ZQBA 3ALYA 4CEDA 4YOWA 4Y1DA 3F73A 3VGKA 3PV8A 5C42A 4BC3A 3LP2A 4AHTA 3AA3A 3ZSOA 2G8KA 4BR0A 4CGIA 1LOTB 1S3XA 4DTXA 4JI5K 1KVAA 1WLJA 3NGYA 3SAHA 1W2BM 5BR8K 3H6EA 1W97L 3OTOK 3VQ5A 3LZJA 1NLVA 1JCGA 3HSCA 1SZ2A 4H0OA 3AVBA 3K5OA 3T7ZA 3AVIA 3NFAA 2CH6A 3CETA 4FOIA 1JLGA 4BG8A 2E1YA 1Q8IA 1QHTA 3QNOA 3RMBA 3D2FB 3K9KA 2KZZA 2G8HA 4EZ9A 3HRGA 2Y1IA 1ZC6A 3GBTA 1S6QA 4CERA 4ID5A 2UXBK 3CMAN 1TAUA 3L2VA 4FO0A 4V19S 4IOCL 4X65K 4Y0WA 5K14A 3S3MA 5HBMA 4CZFA 1KXPA 5JMVA 4JLHA 4JN4A 4B9NA 4GV3A 4CHPA 1YTAA 1VQ5N 5AFUH 4DLGA 4EAHD 1HUXA 3CYMA 1Q18A 1ZBIA 1RTHA 3ZSWA 1BWFO 4CGGA 1VAZA 1T3VA 3S41A 2HSTA 5BPLA 1U47A 1VSFA 3NBPA 4FWMA 1BCMA 2Z1HA 2JWLA 3SMPA 2RF2A 4RTFD 3M1FA 4GKJK 4KH6A 2O8CA 3RSEA 2VYPA 3TAEA 3O5BA 4M3TA 3C7NB 4JKFA 4RW9A 2XO7A 1HQUA 1RTIA 4L8RB 3PLAA 4DR3K 3C0BA 4I9QA 4DR1K 4DQRA 1ATSA 5BN8A 3V9ZA 3DYAA 4ILGB 1R59O 2FBTA 4CIFA 3AA5X 3F9MA 3I55N 3O3FA 3ZCMA 2YX6A 3O4NA 3LPUA 4CF9A 1C1AA 3M8SA 1Z25A 3E9LA 3VQ7A 4ZTJA 1C1CA 5J1EA 2PZSA 1K8KA 3TSUA 3WXKA 4ISFA 4B9QA 2KHOA 1T03A 3EN9A 3V1QA 1NKEA 3KVGA 4CEZA 4CFAA 3SAFA 3D2EB 2DFFA 3KKSA 4FWOA 3J7ZO 4FK0A 1YXQA 3ITHA 4AF1A 1HJOA 4DV4K 1B9FA 3LWMA 3AO5A 3EZ5A 4LF6K 3QEWA 4E7HA 3CC7N 4PWDA 5KI6A 1LW2A 3UKUA 4CFDA 4O5BA 4IDKA 4PL8A 4FK4A 1VQ6N 4DG1A 4F4KA 1XC3A 4YOXA 5KRTA 4H5NA 1TL3A 1GLJO 4IKFA 3DLEA 1U04A 3S9HA 3LAKA 1ATNA 3VQ6A 5LMUK 4FK2A 4I9LA 1J6ZA 5EU7A 2D1KA 4CZKA 5IWAK 2A1RA 1NGDA 4GY2B 3H08A 2IC3A 3QINA 4EHUA 3BEXA 3FE1A 3LM9A 4EIAA 4LFAK 1C0TA 4O0IA 3RR8A 1S1UA 4CHOA 4K25A 4KI6A 3P31A 1DLOA 1E4GT 3VGMA 3G71N 1L5UA 4KAZA 4I7FA 3PX4A 2I5JA 3VA3A 2HHSA 4H0TB 1BQMA 1DT9A 2HBMA 4CZIA 5J2PA 3C7NA 2F8TA 3VN5A 2XY7A 5CZ1A 3QDKA 4Z4GA 4A5AA 5GINA 5HL7L 4GNIA 3VQBA 1C0MA 4FLYA 1XUPO 2Q3SA 3O9SA 4FM2A 4B08A 3THWB 4CEQA 4CBXA 3CQYA 3RMAA 1HNVA 1GLLO 4E19A 2W6LA 4DSKA 3IRXA 4PL7A 4EFHA 4GV9A 1Z05A 1WAJA 2OTJN 3ZT1A 1HX1A 1D9DA 4H5WA 3SUOA 4XH1A 3HO1A 2OZMA 1NU0A 4DQIA 1C6VA 4ELVA 4GMJB 5DM6L 1OKJA 4CK1A 2QKKA 4BC5A 4NB4A 4M42A 4DU1A 1ZXOA 3D2EA 4KTQA 1TV6A 2HBKA 3EZWA 1RDCA 4FWQA 1LCUA 4K43A 2OZSA 3LWLA 2HHHK 5AQUA 4EHTA 3P1GA 1HNXK 1UOCA 2IDOA 3MWPA 3NVKA 4JI1K 1V4TA 4E7KA 3EO3A 2A3ZA 5FPMA 2ZJPL 3QESA 3E9PA 2HHUA 2QM1A 3P4IA 4OPHA 1FKPA 4WF9L 2P9KB 1NK7A 4C8NA 3SQ1A 3G6EN 4JV5K 3MXMA 4M3UA 5GAGP 3OYJA 4I6MA 2OANA 2PY5A 4QAGA 5AQLA 4BROA 4NYNA 3EKSA 4N76A 1KAZA 1RTJA 3O08A 4LSNA 3SI6A 3OYHA 4A61A 3HJFA 4Z4IA 1L3SA 2E2QA 1REVA 3C6AA 3QEPA 5EVZA 3SLCA 5KPRA 3KLHA 4DV5K 4HUFA 3E9OA 1HNZK 4WCEL 1IO2A 4K8XA 2A6AA 4B1YB 4CHQA 1HKCA 1IBLK 1WSGA 4CJKA 4IO8A 5LJWA 5AQZA 2QK9A 5E41A 2OYQA 4XIUA 1HRHA 3PX0A 3VA0A 4M41A 3C94A 2O8FA 3FR0A 4M63C 5FPDA 5M1PA 1QS4A 3BZCA 3VERA 4KHYA 1T44A 4YDUA 3CQ8A 2QEXN 3LP3A 3T3FA 4DQPA 3AVGA 3RRGA 2HHQA 1SL2A 1SAZA 1MA9B 2RKIA 2HMPA 1VSJA 4X64K 1IV0A 3B6OA 4HUEA 4W5OA 5CY4A 3NE6A 2QXFA 4CJ5A 1XWLA 3A5MC 1Y64A 2KLAA 3IUCA 1RT4A 2F9WA 3L2UA 3VGLA 1HYVA 5HROA 3W3DA 4CBWA 3B8AX 4KTZA 5H1SQ 5FPNA 1NK5A 1VRTA 5HOOA 5JVGL 3KD5E 3TI0A 3A5OC 1KVBA 1WSFA 4YOUA 1ZBFA 5DMRA 1OH6A 1G99A 4XEIA 4IJNA 1BIZA 4MDBA 2ETJA 1GLBG 4JI8K 1GOCA 4OLAA 1BUPA 3I8DA 2P9IB 2GWKA 2ZWHA 1GOAA 5IT9O 4IO9L 2F96A 1S1TA 4GVMA 3DLRA 4E1MA 2E6LA 2P9PA 4CZGA 5BRHA 1NJYA 4DR2K 4DTMA 3KD1E 4CJTA 3E1YA 1GLAG 4OGEA 1NMNA 5AFUA 5AQXA 3FZKA 2IGIA 3VF2A 4J2AA 1VQKN 2BH1A 1Z26A 5I42A 3V9WA 5KRSA 4DFJA 1RT2A 1QQOA 3A2FA 1WSJA 2ZD1A 3KK2A 4FJJA 3VPZA 3GE1A 4CD1A 3MN9A 2B6AA 1XMOK 4QS9A 4U67L 2DFEA 3ZEUB 2XY8A 1EQYA 1NOZA 4WQ4A 1BOTO 1S6PA 2HW3A 3DLHA 2CGJA 3FGUA 4IXCA 3CJCA 3PO4A 4CEAA 4O44A 3OS2A 4KB1A 4JHDA 3LP1A 3WXIA 3KLEA 1BISA 4CJUA 4K8ZA 5JICA 3ULEA 3CCQN 1NBWA 1U45A 3CCUN 5AQJA 2QWOA 2WONA 4BQZA 1ZBHA 4QCLA 3LDPA 4IFVA 4W5QA 2VQEK 3VOVA 4PKIA 2B4JA 3LZIA 3V9XA 4CK2A 4DTOA 4FJIA 4NCBA 3P5JA 3EL2A 1EO1A 4F8RA 1K8AO 4KHSA 1TAQA 2HHXA 3TTFA 1BDGA 1ZBUA 4CZJA 3HPOA 3MCPA 2Q1NA 1KAXA 4CD3A 3SBTA 4KHUA 1JCEA 4C23A 2KQ2A 4BRAA 3UIQA 1KVCA 4DF8A 5AQYA 1TKDA 5FPEA 3CCSN 4CF8A 3L0QA 4BACA 1GLDG 1ATRA 1NGJA 4AHRA 3ENBA 3MEEA 4WFNL 3OYKA 4MLHA 1TL1A 4IFYA 3UKRB 3U9ZA 2P9LA 2Q97A 2VCPA 3KLGA 3VETA 4DSFA 1YJ9N 2FSJA 2AJQA 1Q9YA 1IKWA 4Z4CA 4DQ8A 2VWBA 1K9MO 4O8KA 3WXMB 4YOYA 3LL3A 1VSDA 2W40A 2AP1A 4JNEA 1NKCA 2KKZA 4DV2K 2ASPA 2NRRA 3QEIA 1NNEA 3KZBA 4ZHRA 2PYJA 4FPBA 3WT0A 4CHNA 1CXUA 2NRZA 5J2MA 2WOMA 3ID8A 1RNHA 1YJWN 4HTUA 1GOBA 3GL1A 4FXDA 4LF9K 2O8CB 1M1KO 3DM2A 3DXMB 4M3WA 2O8BB 5KQ8A 4JEPA 2UXCK 3G25A 1ZYQA 3CMEN 3HL8A 3CCMN 2NNWA 3PIOL 4BVOA 3LDSA 4W5NA 2RHKA 3VEXA 3CJAA 3TAMA 3ZT4A 4E89A 2ZJQL 4JKGA 1H1VA 4AILC 2H3GX 1YVNA 5I9EB 2HMIA 1I39A 1X9JA 3H3NO 4DR5K 4OX9K 1NK8A 2HVHA 4CGJA 5AR0A 1S1VA 4K42A 4OJRA 1ITGA 1MWKA 1SV5A 4RW8A 2Z1GA 2GBZA 4KTWA 3AVLA 4H4OA 4CF1A 3NMUA 4JKEA 2HHTA 4DMNA 4R79A 4LY7A 4CJSA 3OW2M 3L8BA 1JLEA 1S22A 4DSLA 4F2SA 2P9LB 1C0FA 4B1ZA 3FZFA 4FWLA 3HP9A 4O0JA 3O8MA 3HVRA 5HP1A 4KI4A 3JAMO 3M8PA 4XH4A 3KK7A 3HM9A
chains in the Genus database with same CATH topology
1NK4A 1S1WA 2G8WA 1T03A 3V1QA 1NKEA 1SKWA 1IKVA 1I3AA 4TSXA 4IG0A 4AHVA 4CF0A 2VWKA 3WNHA 3M8QA 4CIEA 3KK3A 3K5NA 1UA1A 4CEZA 3PY8A 4FJMA 4CFAA 5JS1A 2R7YA 4CEOA 2DFFA 4AH9A 4OKJA 3LANA 2P5GA 3KKSA 4CECA 4FLZA 4FK0A 3ITHA 1J53A 3JYTA 4DTPA 4RW4A 4IBNA 3OYMA 4Z4FA 4CK3A 1NK0A 1B9FA 3LWMA 3AO5A 4FVMA 3OYGA 3EZ5A 3HK2A 3TAPA 1J5OA 2KFZA 4E3SA 4E7HA 3QEWA 3RMCA 4DLEA 4PWDA 5KI6A 4BE0A 1LW2A 4FLTA 1NJZA 3HSTB 4CFDA 1JL2A 4O5BA 3VQ9A 4IDKA 4E7LA 5FRMA 3OYEA 4W5TA 4FK4A 4DG1A 3C95A 4ELUA 3ZSYA 4F4KA 3OYNA 3OYFA 4HUGA 1F21A 5KRTA 3TABA 1D9FA 1TL3A 4IKFA 3DLEA 3ZSZA 4DFPA 1U04A 2YNFA 3AO2A 4LD0A 3S9HA 2KZMA 4AHSA 3DOKA 3LAKA 2P51A 4G1QA 1B9DA 2ITGA 3DMJA 3VQ6A 3SUNA 4FK2A 1KFDA 4KKOA 1JLFA 4I9LA 4CJEA 2IAJA 5EU7A 3EY1A 3SUQA 1K6YA 5CYMA 2A1RA 3MXIA 1TKTA 1KSPA 3H08A 2IC3A 2EHGA 3V6DA 3QINA 4FZYA 1WAFA 4CHYA 3AA4A 1C0TA 1UAXA 4O0IA 1L3TA 3RR8A 1JXBA 5KTQA 4YNQA 1U49A 1S1UA 4CHOA 4ID1A 2YKMA 3AVAA 4EZ6A 4KI6A 3U3YA 1DLOA 3NGZA 4EP5A 1L5UA 4M3ZA 4KAZA 4KREA 3NDKA 3PO5A 4IG3A 4I7FA 3EYZA 3KKRA 3PX4A 3K5MA 4Z4HA 2I5JA 2OPRA 3VA3A 3NF8A 2HHSA 1BQMA 2X78A 2KTQA 1YVUA 1DTTA 5J2PA 4N41A 4CFCA 3V81A 2F8TA 1FKOA 2FC0A 3VN5A 2XY7A 5CZ1A 4OPKA 4Z4GA 1J54A 1IG9A 3QEXA 1RT3A 3F9KA 1VSIA 1C0MA 3VQBA 4CFBA 2Q3SA 4CESA 1LWCA 4AHUA 5C25A 4FLYA 4FM2A 3QIOA 3QNNA 4B08A 4DSIA 3K58A 4CIGA 2PYLA 1TVRA 4CEQA 3LP0A 3DOLA 4I2QA 1T8EA 3RMAA 1HNVA 4OLBA 1IKXA 3P83D 1HNIA 4E19A 3KJVA 3TAQA 3QLHA 2RN2A 3S3NA 3IRXA 4DSKA 4LH4A 2JGUA 1WAJA 1QE1A 1QSSA 3LAMA 3ZT1A 4E0DA 1D9DA 3DRPA 4CHZA 3AO4A 1LW0A 3ZT0A 5FRNA 3SUOA 2G8IA 4CCHA 2HHVA 3HO1A 2OZMA 4DFMA 4KHNA 4O4GA 4DQIA 3OJSA 4CEEA 3IS9A 2G8UA 1A5VA 1C6VA 4ELVA 4GMJB 4EP4A 1SKSA 4DSJA 1O1WA 4O55A 5KGXA 3V1OA 4CK1A 1C1BA 3CFOA 1EETA 1NKBA 2FBXA 2QKKA 4M42A 1RDBA 3HXMA 4BE1A 4DU1A 3K57A 1JLBA 1ASVA 4C8OA 4CJRA 2DTUA 1TK8A 3SV4A 5SWMA 3V4IA 4LH5A 4KTQA 3DLGA 1RBRA 1TV6A 1EKEA 1RDCA 2OPSA 4FLUA 3THVA 4B9LA 1QSLA 2OZSA 1XHZA 1BGXT 1S9EA 3LWLA 2XY5A 2HVIA 3P1GA 1UOCA 1R0AA 2IDOA 3SPZA 4DS5A 4FW1A 4CGHA 3AA2A 4E7KA 1BI4B 3QEVA 1A5WA 5HLFA 1S5JA 4CJLA 3T1AA 3QESA 3MEDA 4HHTA 2YV0X 4FW2A 3AV9A 3QO9A 4YFUA 4FJNA 4FJ8A 1T05A 2YNHA 3VQ8A 2HHUA 3U3GA 4JRPA 1UA0A 1FKPA 2VG6A 1NK7A 4C8NA 3SQ1A 4N5SA 4JS4A 1VK0A 3MXMA 4M3UA 1RT6A 3OYJA 4Z0UA 4J2DA 2PY5A 1BIUA 1KLMA 4BWMA 4QAGA 4CGDA 3RR7A 4NYNA 4M3YA 3ULDA 3BDPA 1TK0A 4N76A 1RTJA 3SI6A 2VG5A 4LSNA 3OYHA 3HJFA 4Z4IA 2Z1IA 1L3SA 1REVA 3QEPA 1YTUA 3CG7A 2VG7A 3NGIA 4BDYA 1KLNA 3KLHA 4ICLA 1U48A 4DWIA 4FJLA 4HUFA 3SPYA 2BANA 4H8KA 4FJ5A 1C0UA 1WSIA 1IO2A 4K8XA 3V1RA 4CHQA 1KFSA 4FJGA 3VQQA 4DFKA 3WNEA 1BL3A 1LWFA 1WSGA 3E01A 1XHXA 4CJ3A 4CJKA 3VQEA 1T7PA 4B3OA 3BGRA 2QK9A 4N47A 1CXQA 2OPPA 3O4QA 5E41A 4XIUA 1HRHA 3PX0A 2OYQA 3VA0A 3ZSVA 1EXQA 4M41A 3C94A 1HYZA 3L2WA 1QS4A 4BE2A 4KHYA 1X1PA 3PUFA 1RBVA 4C8KA 3CQ8A 2G8FA 3SJJA 3NF9A 4E1NA 3AO1A 3OS1A 3LP3A 3T3FA 4DQPA 4CJVA 3AVGA 1JLCA 3VQ4A 3ZSXA 3DRSA 3RRGA 4DU3A 2HHQA 1SL2A 3KIOA 1BHLA 1RT7A 1TGOA 2RKIA 3T19A 3CFRA 1ZBLA 1VSJA 3IAYA 3L3UA 1JKHA 1HJRA 4CEBA 4C8MA 4HCCA 3CM5A 3B6OA 4HUEA 1KRPA 1RDAA 3WNGA 4CJ4A 4W5OA 5CY4A 1YT3A 4FJXA 2B5JA 3HP6A 4KHWA 3NE6A 1CLQA 2QXFA 1JXEA 4CJ5A 5FROA 1TKZA 1XWLA 3L2UA 1RT4A 4WE1A 1VSEA 3L3VA 1HYVA 1CZBA 2LSNA 3ASMA 5HROA 1NK5A 4KTZA 3D45A 3ZT2A 4FZXC 1VRTA 1ASUA 3DI6A 3AVNA 3NH2A 3OS0A 2Z1JA 4B8CA 5I3UA 3NF6A 3KD5E 4OKEA 3TI0A 1KVBA 2D5RA 1EX4A 2X6SA 1WSFA 1MU2A 3HVTA 1XC9A 1N5YA 2XY6A 1LAWA 1ZBFA 4R5PA 4CJFA 4FLXA 1RT5A 5DMRA 1QTMA 3KLIA 4M3XA 4B9MA 5HRRA 3HPHA 4KO0A 1VSMA 4PUOA 1SL1A 4B9TA 4QOZB 2D0CA 4FM1A 3C6TA 1BIZA 2ZE2A 4KV8A 2ETJA 3L2RA 2E6MA 3NH0A 3OYBA 1NK6A 4E7IA 3OYLA 4ELTA 2O4IA 1GOCA 3WNFA 4OLAA 4CF2A 1BQNA 3I8DA 3DLBA 3K2PA 3KTQA 3OYDA 3OYCA 3QIPA 1GOAA 4CGFA 4RW7A 3NCIA 4DQQA 5HRNA 3RMDA 2YKNA 2F96A 1S1TA 2HNZA 3AVFA 4GVMA 4N56A 3RTVA 2BGGA 3DLRA 4E1MA 4KB0A 2E6LA 2ATQA 3AVCA 3SQ4A 4FJHA 2GV9A 1NJYA 4F3OA 2A1SA 2W42A 4CJPA 4Z4EA 3TAFA 5HRPA 4DTMA 5SZTA 3KD1E 5DK5A 4FJ7A 4CJTA 5FDLA 1LV5A 3IG1A 4OGEA 1ASWA 1TK5A 1RCHA 4MFBA 4NYFA 2IGIA 4J2AA 1LAVA 1SL0A 1Z26A 5I42A 2JLEA 3V9WA 5KRSA 3G10A 4DFJA 3ZSQA 1RT2A 3MXJA 3A2FA 1WSJA 2ZD1A 3KK2A 1WSEA 4FJJA 1TKXA 4FLVA 5J2NA 4F2RA 2BDPA 4BDPA 2X6NA 4B8AB 2B6AA 1BCOA 3AVMA 3ISNC 3JSMA 4GW6A 3TR8A 3U6FA 3AVJA 1VSHA 2DFEA 3CFPA 4NCAA 1NK9A 1WNSA 2IS3A 2XY8A 1NJXA 2P5OA 1NOZA 2X74A 1S6PA 2NUBA 3SYZA 3AO3A 3DLHA 2HW3A 1EP4A 3NAEA 4RW6A 4DTSA 4E7JA 3LPTA 3PO4A 5CZ2A 3I0SA 1FXXA 1WN7A 3VQPA 4CEAA 4O44A 3M8RA 1Q9XA 4J2EA 3HPGA 3OS2A 3V9UA 4KPYA 4Q0BA 4KB1A 4FYDA 3LP1A 3TAGA 2QKBA 1VSKA 4BDZA 3L2QA 3KLEA 4DS4A 2KFNA 4W5RA 3MAQA 1BISA 1HQEA 2YHBA 4CJUA 4K8ZA 4FJKA 4HVJA 2GUIA 1U45A 4M3RA 3FFIA 4CJWA 2WONA 3HT3A 1JL1A 2YNIA 3K59A 3CM6A 4DTNA 1ZBHA 4QCLA 5CYQA 4IFVA 4W5QA 4FLWA 2OA8A 2KW4A 2EX3A 2B4JA 4LSLA 4CJQA 3LZIA 3ZT3A 4CK2A 3O3HA 3V9XA 1N6QA 2IOCA 3OYAA 3AVKA 4B9UA 4PQUA 4DU4A 2DY4A 4DTOA 4FJIA 1IKYA 5HRSA 4B9VA 3P5JA 3D0PA 1JLAA 4NCBA 3TANA 1X9SA 4F8RA 2HNDA 3VQCA 4KHSA 2D0AA 1TAQA 2VWJA 3SUPA 5KGWA 2G8VA 5D3GA 2HHXA 1ZBUA 2ZQBA 1D8YA 1RBTA 3ALYA 4CEDA 3OY9A 3HPOA 4JS5A 4Y1DA 4ZTFA 3PX6A 4DTUA 3HYFA 3KLFA 3F73A 3B6PA 5T7BA 4DSEA 4OVLA 5C42A 2Y1JA 3PV8A 3LP2A 1QSYA 3VQDA 4KHUA 2E4LA 1FK9A 2KQ2A 3AA3A 3ZSOA 4AHTA 4DTJA 4CGIA 4DTXA 1KVCA 2G8KA 1HMVA 3UIQA 1WSHA 1KVAA 1WLJA 4DF8A 3NGYA 1NJWA 3RWUA 3MECA 3KK1A 1XI1A 1TKDA 4J2BA 3VQ5A 3LZJA 4CF8A 1B92A 1JLQA 1KCFA 3AVBA 3K5OA 4BACA 3QERA 1HYSA 3AVIA 2FBVA 3OVNA 3NFAA 1RTDA 3NH1A 3SQ2A 4AHRA 4M45A 4FZZA 3OYIA 1JLGA 3MEEA 3OYKA 3OJUA 1TL1A 4KRFA 1Q8IA 3C6UA 1BI4A 4IFYA 1QHTA 3QNOA 4RG8A 3RMBA 2KZZA 3KLGA 2G8HA 3SQ0A 3O3GA 4DSFA 4EZ9A 1S1XA 2AJQA 1Q9YA 1IKWA 4DQSA 4Z4CA 2Y1IA 3NHGA 1W0HA 2YHAA 4PY5A 1QQCA 1S6QA 4NCGA 1S9GA 4ID5A 4CERA 4B9SA 1TAUA 1VSDA 2P1JA 3L2VA 1NKCA 4OGCA 5J2QA 1VSLA 5K14A 4FJ9A 3S3MA 1RILA 5HBMA 3QEIA 3SCXA 2OPQA 4ZHRA 2PYJA 4JLHA 1KTQA 4B9NA 3MEGA 4CHNA 1CXUA 2FBYA 4CHPA 1YTAA 2HB5A 5J2MA 1L3VA 2HHWA 2WOMA 4DLGA 1RNHA 4DF4A 1G15A 1SUQA 3DRRA 4AHCA 3CYMA 5JS2A 4HTUA 2D0BA 1GOBA 1RT1A 1X9MA 1ZBIA 1RBUA 1RTHA 3NF7A 4Y1CA 3ZSWA 4FXDA 4M3WA 3DM2A 4H4MA 3VQAA 4CGGA 4KFBA 3DLKA 2F8SA 1U47A 1VSFA 1ZYQA 3HL8A 4BWJA 3NBPA 3QETA 1BCMA 2YNGA 1D5AA 1HPZA 2Z1HA 4PA1A 3TARA 3S3OA 2RF2A 4FCYA 2HNYA 2XHBA 3LDSA 4W5NA 1L3UA 1VRUA 2DFHA 4Q5VA 2RPIA 3TAMA 3ZT4A 4E89A 3LALA 4AILC 4CE9A 3SV3A 3TAEA 2HMIA 4M3TA 1I39A 4RW9A 2XO7A 1NK8A 3SZ2A 4F3TA 3RRHA 3G0ZA 1HQUA 1RTIA 4CGJA 4FM0A 4L8RB 4CEFA 2HVHA 1S1VA 1X9WA 3I0RA 4MQ3A 4I9QA 4OJRA 4C8LA 5C24A 1ITGA 2O4GA 1DTQA 1CZ9A 1SV5A 4RW8A 2Z1GA 1J9AA 2GBZA 4KTWA 1A5XA 3AVLA 3K5LA 1LWEA 3V9SA 4H4OA 4DQRA 3TWHA 4DTRA 4CF1A 3V9ZA 4HCBA 3DYAA 2HHTA 2XRIA 2FBTA 4CIFA 1Y97A 3AA5X 1IH7A 3O3FA 3ZCMA 2BE2A 4DMNA 3SNNA 4LY7A 1NOYA 4CJSA 3O4NA 4KHQA 1SKRA 3LPUA 3L8BA 4OKKA 1JLEA 4CF9A 1C1AA 3AVHA 4DSLA 3M8SA 4F2SA 4I2PA 1UWBA 1Z25A 3ZSRA 4JRQA 3VQ7A 4OPJA 4ZTJA 3HP9A 1C1CA 4O0JA 5J1EA 3HVRA 5HP1A 2PZSA 4KI4A 1RBSA 1W9HA 1RDDA 3M8PA 3HM9A 1U4BA 4UQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK4 A;  1S1W A;  2G8W A;  1T03 A;  3V1Q A;  1NKE A;  1SKW A;  1IKV A;  1I3A A;  4TSX A;  4IG0 A;  4AHV A;  4CF0 A;  2VWK A;  3WNH A;  3M8Q A;  4CIE A;  3KK3 A;  3K5N A;  1UA1 A;  4CEZ A;  3PY8 A;  4FJM A;  4CFA A;  5JS1 A;  2R7Y A;  4CEO A;  2DFF A;  4AH9 A;  4OKJ A;  3LAN A;  2P5G A;  3KKS A;  4CEC A;  4FLZ A;  4FK0 A;  3ITH A;  1J53 A;  3JYT A;  4DTP A;  4RW4 A;  4IBN A;  3OYM A;  4Z4F A;  4CK3 A;  1NK0 A;  1B9F A;  3LWM A;  3AO5 A;  4FVM A;  3OYG A;  3EZ5 A;  3HK2 A;  3TAP A;  1J5O A;  2KFZ A;  4E3S A;  4E7H A;  3QEW A;  3RMC A;  4DLE A;  4PWD A;  5KI6 A;  4BE0 A;  1LW2 A;  4FLT A;  1NJZ A;  3HST B;  4CFD A;  1JL2 A;  4O5B A;  3VQ9 A;  4IDK A;  4E7L A;  5FRM A;  3OYE A;  4W5T A;  4FK4 A;  4DG1 A;  3C95 A;  4ELU A;  3ZSY A;  4F4K A;  3OYN A;  3OYF A;  4HUG A;  1F21 A;  5KRT A;  3TAB A;  1D9F A;  1TL3 A;  4IKF A;  3DLE A;  3ZSZ A;  4DFP A;  1U04 A;  2YNF A;  3AO2 A;  4LD0 A;  3S9H A;  2KZM A;  4AHS A;  3DOK A;  3LAK A;  2P51 A;  4G1Q A;  1B9D A;  2ITG A;  3DMJ A;  3VQ6 A;  3SUN A;  4FK2 A;  1KFD A;  4KKO A;  1JLF A;  4I9L A;  4CJE A;  2IAJ A;  5EU7 A;  3EY1 A;  3SUQ A;  1K6Y A;  5CYM A;  2A1R A;  3MXI A;  1TKT A;  1KSP A;  3H08 A;  2IC3 A;  2EHG A;  3V6D A;  3QIN A;  4FZY A;  1WAF A;  4CHY A;  3AA4 A;  1C0T A;  1UAX A;  4O0I A;  1L3T A;  3RR8 A;  1JXB A;  5KTQ A;  4YNQ A;  1U49 A;  1S1U A;  4CHO A;  4ID1 A;  2YKM A;  3AVA A;  4EZ6 A;  4KI6 A;  3U3Y A;  1DLO A;  3NGZ A;  4EP5 A;  1L5U A;  4M3Z A;  4KAZ A;  4KRE A;  3NDK A;  3PO5 A;  4IG3 A;  4I7F A;  3EYZ A;  3KKR A;  3PX4 A;  3K5M A;  4Z4H A;  2I5J A;  2OPR A;  3VA3 A;  3NF8 A;  2HHS A;  1BQM A;  2X78 A;  2KTQ A;  1YVU A;  1DTT A;  5J2P A;  4N41 A;  4CFC A;  3V81 A;  2F8T A;  1FKO A;  2FC0 A;  3VN5 A;  2XY7 A;  5CZ1 A;  4OPK A;  4Z4G A;  1J54 A;  1IG9 A;  3QEX A;  1RT3 A;  3F9K A;  1VSI A;  1C0M A;  3VQB A;  4CFB A;  2Q3S A;  4CES A;  1LWC A;  4AHU A;  5C25 A;  4FLY A;  4FM2 A;  3QIO A;  3QNN A;  4B08 A;  4DSI A;  3K58 A;  4CIG A;  2PYL A;  1TVR A;  4CEQ A;  3LP0 A;  3DOL A;  4I2Q A;  1T8E A;  3RMA A;  1HNV A;  4OLB A;  1IKX A;  3P83 D;  1HNI A;  4E19 A;  3KJV A;  3TAQ A;  3QLH A;  2RN2 A;  3S3N A;  3IRX A;  4DSK A;  4LH4 A;  2JGU A;  1WAJ A;  1QE1 A;  1QSS A;  3LAM A;  3ZT1 A;  4E0D A;  1D9D A;  3DRP A;  4CHZ A;  3AO4 A;  1LW0 A;  3ZT0 A;  5FRN A;  3SUO A;  2G8I A;  4CCH A;  2HHV A;  3HO1 A;  2OZM A;  4DFM A;  4KHN A;  4O4G A;  4DQI A;  3OJS A;  4CEE A;  3IS9 A;  2G8U A;  1A5V A;  1C6V A;  4ELV A;  4GMJ B;  4EP4 A;  1SKS A;  4DSJ A;  1O1W A;  4O55 A;  5KGX A;  3V1O A;  4CK1 A;  1C1B A;  3CFO A;  1EET A;  1NKB A;  2FBX A;  2QKK A;  4M42 A;  1RDB A;  3HXM A;  4BE1 A;  4DU1 A;  3K57 A;  1JLB A;  1ASV A;  4C8O A;  4CJR A;  2DTU A;  1TK8 A;  3SV4 A;  5SWM A;  3V4I A;  4LH5 A;  4KTQ A;  3DLG A;  1RBR A;  1TV6 A;  1EKE A;  1RDC A;  2OPS A;  4FLU A;  3THV A;  4B9L A;  1QSL A;  2OZS A;  1XHZ A;  1BGX T;  1S9E A;  3LWL A;  2XY5 A;  2HVI A;  3P1G A;  1UOC A;  1R0A A;  2IDO A;  3SPZ A;  4DS5 A;  4FW1 A;  4CGH A;  3AA2 A;  4E7K A;  1BI4 B;  3QEV A;  1A5W A;  5HLF A;  1S5J A;  4CJL A;  3T1A A;  3QES A;  3MED A;  4HHT A;  2YV0 X;  4FW2 A;  3AV9 A;  3QO9 A;  4YFU A;  4FJN A;  4FJ8 A;  1T05 A;  2YNH A;  3VQ8 A;  2HHU A;  3U3G A;  4JRP A;  1UA0 A;  1FKP A;  2VG6 A;  1NK7 A;  4C8N A;  3SQ1 A;  4N5S A;  4JS4 A;  1VK0 A;  3MXM A;  4M3U A;  1RT6 A;  3OYJ A;  4Z0U A;  4J2D A;  2PY5 A;  1BIU A;  1KLM A;  4BWM A;  4QAG A;  4CGD A;  3RR7 A;  4NYN A;  4M3Y A;  3ULD A;  3BDP A;  1TK0 A;  4N76 A;  1RTJ A;  3SI6 A;  2VG5 A;  4LSN A;  3OYH A;  3HJF A;  4Z4I A;  2Z1I A;  1L3S A;  1REV A;  3QEP A;  1YTU A;  3CG7 A;  2VG7 A;  3NGI A;  4BDY A;  1KLN A;  3KLH A;  4ICL A;  1U48 A;  4DWI A;  4FJL A;  4HUF A;  3SPY A;  2BAN A;  4H8K A;  4FJ5 A;  1C0U A;  1WSI A;  1IO2 A;  4K8X A;  3V1R A;  4CHQ A;  1KFS A;  4FJG A;  3VQQ A;  4DFK A;  3WNE A;  1BL3 A;  1LWF A;  1WSG A;  3E01 A;  1XHX A;  4CJ3 A;  4CJK A;  3VQE A;  1T7P A;  4B3O A;  3BGR A;  2QK9 A;  4N47 A;  1CXQ A;  2OPP A;  3O4Q A;  5E41 A;  4XIU A;  1HRH A;  3PX0 A;  2OYQ A;  3VA0 A;  3ZSV A;  1EXQ A;  4M41 A;  3C94 A;  1HYZ A;  3L2W A;  1QS4 A;  4BE2 A;  4KHY A;  1X1P A;  3PUF A;  1RBV A;  4C8K A;  3CQ8 A;  2G8F A;  3SJJ A;  3NF9 A;  4E1N A;  3AO1 A;  3OS1 A;  3LP3 A;  3T3F A;  4DQP A;  4CJV A;  3AVG A;  1JLC A;  3VQ4 A;  3ZSX A;  3DRS A;  3RRG A;  4DU3 A;  2HHQ A;  1SL2 A;  3KIO A;  1BHL A;  1RT7 A;  1TGO A;  2RKI A;  3T19 A;  3CFR A;  1ZBL A;  1VSJ A;  3IAY A;  3L3U A;  1JKH A;  1HJR A;  4CEB A;  4C8M A;  4HCC A;  3CM5 A;  3B6O A;  4HUE A;  1KRP A;  1RDA A;  3WNG A;  4CJ4 A;  4W5O A;  5CY4 A;  1YT3 A;  4FJX A;  2B5J A;  3HP6 A;  4KHW A;  3NE6 A;  1CLQ A;  2QXF A;  1JXE A;  4CJ5 A;  5FRO A;  1TKZ A;  1XWL A;  3L2U A;  1RT4 A;  4WE1 A;  1VSE A;  3L3V A;  1HYV A;  1CZB A;  2LSN A;  3ASM A;  5HRO A;  1NK5 A;  4KTZ A;  3D45 A;  3ZT2 A;  4FZX C;  1VRT A;  1ASU A;  3DI6 A;  3AVN A;  3NH2 A;  3OS0 A;  2Z1J A;  4B8C A;  5I3U A;  3NF6 A;  3KD5 E;  4OKE A;  3TI0 A;  1KVB A;  2D5R A;  1EX4 A;  2X6S A;  1WSF A;  1MU2 A;  3HVT A;  1XC9 A;  1N5Y A;  2XY6 A;  1LAW A;  1ZBF A;  4R5P A;  4CJF A;  4FLX A;  1RT5 A;  5DMR A;  1QTM A;  3KLI A;  4M3X A;  4B9M A;  5HRR A;  3HPH A;  4KO0 A;  1VSM A;  4PUO A;  1SL1 A;  4B9T A;  4QOZ B;  2D0C A;  4FM1 A;  3C6T A;  1BIZ A;  2ZE2 A;  4KV8 A;  2ETJ A;  3L2R A;  2E6M A;  3NH0 A;  3OYB A;  1NK6 A;  4E7I A;  3OYL A;  4ELT A;  2O4I A;  1GOC A;  3WNF A;  4OLA A;  4CF2 A;  1BQN A;  3I8D A;  3DLB A;  3K2P A;  3KTQ A;  3OYD A;  3OYC A;  3QIP A;  1GOA A;  4CGF A;  4RW7 A;  3NCI A;  4DQQ A;  5HRN A;  3RMD A;  2YKN A;  2F96 A;  1S1T A;  2HNZ A;  3AVF A;  4GVM A;  4N56 A;  3RTV A;  2BGG A;  3DLR A;  4E1M A;  4KB0 A;  2E6L A;  2ATQ A;  3AVC A;  3SQ4 A;  4FJH A;  2GV9 A;  1NJY A;  4F3O A;  2A1S A;  2W42 A;  4CJP A;  4Z4E A;  3TAF A;  5HRP A;  4DTM A;  5SZT A;  3KD1 E;  5DK5 A;  4FJ7 A;  4CJT A;  5FDL A;  1LV5 A;  3IG1 A;  4OGE A;  1ASW A;  1TK5 A;  1RCH A;  4MFB A;  4NYF A;  2IGI A;  4J2A A;  1LAV A;  1SL0 A;  1Z26 A;  5I42 A;  2JLE A;  3V9W A;  5KRS A;  3G10 A;  4DFJ A;  3ZSQ A;  1RT2 A;  3MXJ A;  3A2F A;  1WSJ A;  2ZD1 A;  3KK2 A;  1WSE A;  4FJJ A;  1TKX A;  4FLV A;  5J2N A;  4F2R A;  2BDP A;  4BDP A;  2X6N A;  4B8A B;  2B6A A;  1BCO A;  3AVM A;  3ISN C;  3JSM A;  4GW6 A;  3TR8 A;  3U6F A;  3AVJ A;  1VSH A;  2DFE A;  3CFP A;  4NCA A;  1NK9 A;  1WNS A;  2IS3 A;  2XY8 A;  1NJX A;  2P5O A;  1NOZ A;  2X74 A;  1S6P A;  2NUB A;  3SYZ A;  3AO3 A;  3DLH A;  2HW3 A;  1EP4 A;  3NAE A;  4RW6 A;  4DTS A;  4E7J A;  3LPT A;  3PO4 A;  5CZ2 A;  3I0S A;  1FXX A;  1WN7 A;  3VQP A;  4CEA A;  4O44 A;  3M8R A;  1Q9X A;  4J2E A;  3HPG A;  3OS2 A;  3V9U A;  4KPY A;  4Q0B A;  4KB1 A;  4FYD A;  3LP1 A;  3TAG A;  2QKB A;  1VSK A;  4BDZ A;  3L2Q A;  3KLE A;  4DS4 A;  2KFN A;  4W5R A;  3MAQ A;  1BIS A;  1HQE A;  2YHB A;  4CJU A;  4K8Z A;  4FJK A;  4HVJ A;  2GUI A;  1U45 A;  4M3R A;  3FFI A;  4CJW A;  2WON A;  3HT3 A;  1JL1 A;  2YNI A;  3K59 A;  3CM6 A;  4DTN A;  1ZBH A;  4QCL A;  5CYQ A;  4IFV A;  4W5Q A;  4FLW A;  2OA8 A;  2KW4 A;  2EX3 A;  2B4J A;  4LSL A;  4CJQ A;  3LZI A;  3ZT3 A;  4CK2 A;  3O3H A;  3V9X A;  1N6Q A;  2IOC A;  3OYA A;  3AVK A;  4B9U A;  4PQU A;  4DU4 A;  2DY4 A;  4DTO A;  4FJI A;  1IKY A;  5HRS A;  4B9V A;  3P5J A;  3D0P A;  1JLA A;  4NCB A;  3TAN A;  1X9S A;  4F8R A;  2HND A;  3VQC A;  4KHS A;  2D0A A;  1TAQ A;  2VWJ A;  3SUP A;  5KGW A;  2G8V A;  5D3G A;  2HHX A;  1ZBU A;  2ZQB A;  1D8Y A;  1RBT A;  3ALY A;  4CED A;  3OY9 A;  3HPO A;  4JS5 A;  4Y1D A;  4ZTF A;  3PX6 A;  4DTU A;  3HYF A;  3KLF A;  3F73 A;  3B6P A;  5T7B A;  4DSE A;  4OVL A;  5C42 A;  2Y1J A;  3PV8 A;  3LP2 A;  1QSY A;  3VQD A;  4KHU A;  2E4L A;  1FK9 A;  2KQ2 A;  3AA3 A;  3ZSO A;  4AHT A;  4DTJ A;  4CGI A;  4DTX A;  1KVC A;  2G8K A;  1HMV A;  3UIQ A;  1WSH A;  1KVA A;  1WLJ A;  4DF8 A;  3NGY A;  1NJW A;  3RWU A;  3MEC A;  3KK1 A;  1XI1 A;  1TKD A;  4J2B A;  3VQ5 A;  3LZJ A;  4CF8 A;  1B92 A;  1JLQ A;  1KCF A;  3AVB A;  3K5O A;  4BAC A;  3QER A;  1HYS A;  3AVI A;  2FBV A;  3OVN A;  3NFA A;  1RTD A;  3NH1 A;  3SQ2 A;  4AHR A;  4M45 A;  4FZZ A;  3OYI A;  1JLG A;  3MEE A;  3OYK A;  3OJU A;  1TL1 A;  4KRF A;  1Q8I A;  3C6U A;  1BI4 A;  4IFY A;  1QHT A;  3QNO A;  4RG8 A;  3RMB A;  2KZZ A;  3KLG A;  2G8H A;  3SQ0 A;  3O3G A;  4DSF A;  4EZ9 A;  1S1X A;  2AJQ A;  1Q9Y A;  1IKW A;  4DQS A;  4Z4C A;  2Y1I A;  3NHG A;  1W0H A;  2YHA A;  4PY5 A;  1QQC A;  1S6Q A;  4NCG A;  1S9G A;  4ID5 A;  4CER A;  4B9S A;  1TAU A;  1VSD A;  2P1J A;  3L2V A;  1NKC A;  4OGC A;  5J2Q A;  1VSL A;  5K14 A;  4FJ9 A;  3S3M A;  1RIL A;  5HBM A;  3QEI A;  3SCX A;  2OPQ A;  4ZHR A;  2PYJ A;  4JLH A;  1KTQ A;  4B9N A;  3MEG A;  4CHN A;  1CXU A;  2FBY A;  4CHP A;  1YTA A;  2HB5 A;  5J2M A;  1L3V A;  2HHW A;  2WOM A;  4DLG A;  1RNH A;  4DF4 A;  1G15 A;  1SUQ A;  3DRR A;  4AHC A;  3CYM A;  5JS2 A;  4HTU A;  2D0B A;  1GOB A;  1RT1 A;  1X9M A;  1ZBI A;  1RBU A;  1RTH A;  3NF7 A;  4Y1C A;  3ZSW A;  4FXD A;  4M3W A;  3DM2 A;  4H4M A;  3VQA A;  4CGG A;  4KFB A;  3DLK A;  2F8S A;  1U47 A;  1VSF A;  1ZYQ A;  3HL8 A;  4BWJ A;  3NBP A;  3QET A;  1BCM A;  2YNG A;  1D5A A;  1HPZ A;  2Z1H A;  4PA1 A;  3TAR A;  3S3O A;  2RF2 A;  4FCY A;  2HNY A;  2XHB A;  3LDS A;  4W5N A;  1L3U A;  1VRU A;  2DFH A;  4Q5V A;  2RPI A;  3TAM A;  3ZT4 A;  4E89 A;  3LAL A;  4AIL C;  4CE9 A;  3SV3 A;  3TAE A;  2HMI A;  4M3T A;  1I39 A;  4RW9 A;  2XO7 A;  1NK8 A;  3SZ2 A;  4F3T A;  3RRH A;  3G0Z A;  1HQU A;  1RTI A;  4CGJ A;  4FM0 A;  4L8R B;  4CEF A;  2HVH A;  1S1V A;  1X9W A;  3I0R A;  4MQ3 A;  4I9Q A;  4OJR A;  4C8L A;  5C24 A;  1ITG A;  2O4G A;  1DTQ A;  1CZ9 A;  1SV5 A;  4RW8 A;  2Z1G A;  1J9A A;  2GBZ A;  4KTW A;  1A5X A;  3AVL A;  3K5L A;  1LWE A;  3V9S A;  4H4O A;  4DQR A;  3TWH A;  4DTR A;  4CF1 A;  3V9Z A;  4HCB A;  3DYA A;  2HHT A;  2XRI A;  2FBT A;  4CIF A;  1Y97 A;  3AA5 X;  1IH7 A;  3O3F A;  3ZCM A;  2BE2 A;  4DMN A;  3SNN A;  4LY7 A;  1NOY A;  4CJS A;  3O4N A;  4KHQ A;  1SKR A;  3LPU A;  3L8B A;  4OKK A;  1JLE A;  4CF9 A;  1C1A A;  3AVH A;  4DSL A;  3M8S A;  4F2S A;  4I2P A;  1UWB A;  1Z25 A;  3ZSR A;  4JRQ A;  3VQ7 A;  4OPJ A;  4ZTJ A;  3HP9 A;  1C1C A;  4O0J A;  5J1E A;  3HVR A;  5HP1 A;  2PZS A;  4KI4 A;  1RBS A;  1W9H A;  1RDD A;  3M8P A;  3HM9 A;  1U4B A;  4UQG A; 
#chains in the Genus database with same CATH topology
 4IFE A;  1I3A A;  1YUW A;  4H0V B;  2VWK A;  3WNH A;  1UA1 A;  4FWR A;  1NGG A;  4CEO A;  4AH9 A;  3LAN A;  1KC8 O;  4QS8 A;  2P9N A;  1NG9 A;  1J53 A;  3JYT A;  3VEN A;  4IBN A;  3L4Q A;  3CJ1 A;  5JLH A;  3O4W A;  4CZM A;  3HK2 A;  4CZE A;  1J5O A;  4Z94 A;  3H46 O;  4FLT A;  4DV7 K;  1KD1 O;  3VQ9 A;  4W5T A;  1N8R O;  3KWI A;  4LD0 A;  1DKG D;  1BA1 A;  1IG8 A;  5GAD P;  3FFK B;  4G1Q A;  3DMJ A;  2YCH A;  2ITM A;  2IAJ A;  3EY1 A;  5CYM A;  3MXI A;  1BU6 O;  1TKT A;  1KSP A;  3Q7C A;  3V6D A;  1XQS C;  2O8D B;  4LC9 B;  1OH5 A;  4BR9 A;  1UAX A;  4UY8 O;  5KTQ A;  4YNQ A;  1U49 A;  2ZJR L;  4B3M K;  1YAG A;  1HR0 K;  3JXU A;  3H3O B;  4JI7 K;  3NGZ A;  2HOE A;  4EP5 A;  3PO5 A;  3EYZ A;  3KKR A;  4Z4H A;  2PAV A;  2OPR A;  2X78 A;  1OH8 A;  2GX9 A;  1DTT A;  4H5T A;  4N41 A;  4JI6 K;  4JKA A;  1FKO A;  2FC0 A;  1RT3 A;  4DB3 A;  2E8A A;  3KWG A;  1NK4 A;  1SKW A;  2QWP A;  3QNN A;  3S3N A;  1KQS M;  3TAQ A;  1RFQ A;  5AQT A;  3M5R A;  4IJA A;  4BRQ A;  4LH4 A;  2JGU A;  5AQG A;  4CHZ A;  5FRN A;  1YF5 L;  3NVM A;  4M7Y A;  4KHN A;  4O4G A;  1GLC G;  4CEE A;  1A5V A;  4CJ7 A;  2P9I A;  4IOA L;  3BUZ B;  5KGX A;  1C1B A;  3CFO A;  3J81 O;  2HBJ A;  1RDB A;  1JLB A;  3F5T A;  1ASV A;  1TUY A;  4CJR A;  1U2V B;  1TK8 A;  3SV4 A;  5SWM A;  4LH5 A;  2NRW A;  3DLG A;  1RBR A;  4JAX A;  3QBW A;  1QVF M;  2ASM A;  4B9L A;  1K8K B;  1BO5 O;  2XY5 A;  1R0A A;  4JI0 K;  4DS5 A;  4FW1 A;  4BRH A;  4CGH A;  3AA2 A;  1BI4 B;  4JKC A;  3T1A A;  4CJL A;  2WFB A;  4PKG A;  3MED A;  4HHT A;  2YV0 X;  3M6G A;  1N32 K;  4FJ8 A;  2YNH A;  1UA0 A;  2VG6 A;  4N5S A;  4JS4 A;  1VK0 A;  5M1N A;  1WBB A;  5GAE P;  5A2Q O;  5TKW A;  2I7P A;  2V7Y A;  1BIU A;  4LF7 K;  1KLM A;  3HZ6 A;  3D7E O;  4BC2 A;  3BDP A;  4CVN E;  3MN7 A;  1TK0 A;  2QWR A;  5C0Y A;  5KQD A;  4A57 A;  4A2B A;  5AQQ A;  5M1O A;  4IEI A;  4FJL A;  4ICL A;  2BAN A;  1C0U A;  4DHY A;  3WNE A;  4LF5 K;  4CJ3 A;  4B3O A;  3QB0 A;  2J4R A;  4LF4 K;  2OPP A;  4BC4 A;  2O8B A;  4X62 K;  3ID6 A;  1MWM A;  4BR4 A;  3H1Q A;  3A5N C;  3PUF A;  1RBV A;  2G8F A;  3AO1 A;  3HTV A;  3J7A P;  4CJV A;  1GLE G;  1JLC A;  3TTD A;  3ZSX A;  1NGF A;  3OBY A;  3KIO A;  1BHL A;  3N4P A;  3UE5 A;  3T19 A;  1HKB A;  1JKH A;  1HJR A;  4CEB A;  3TSP A;  4C8M A;  3CM5 A;  1KRP A;  1YT3 A;  5LY3 A;  5FRO A;  4F9O A;  2NZT A;  3WQT A;  4WE1 A;  3ASM A;  1CZB A;  2LSN A;  4FZX C;  3DI6 A;  3AVN A;  3UKR A;  5F0X A;  4B8C A;  5I3U A;  3NF6 A;  2E88 A;  3EKU A;  2D5R A;  1EX4 A;  1MU2 A;  1N5Y A;  1LAW A;  4R5P A;  2PFU A;  4CJF A;  4FLX A;  1RT5 A;  1QTM A;  3KLI A;  3QML A;  4B9M A;  1SL1 A;  3O1B A;  4FM1 A;  3J8A A;  3VEY A;  3UKU B;  3C6T A;  5CE3 A;  4KV8 A;  2E6M A;  3NH0 A;  3OYB A;  3CCL N;  1NK6 A;  3OYL A;  4ELT A;  3AGR A;  5E84 A;  3RMD A;  2HNZ A;  2E2O A;  3T1Y K;  2ATQ A;  1NMD A;  3VF6 A;  2DPN A;  4NXN K;  4CJP A;  4Z4E A;  3HOS A;  5DK5 A;  5EXW A;  1QZ5 A;  1LV5 A;  2UYT A;  1TK5 A;  1ASW A;  1RCH A;  4MFB A;  2YJE A;  3PSI A;  2GWJ A;  2JLE A;  3G10 A;  3ZSQ A;  3MXJ A;  1K73 O;  2YHY A;  3VEZ A;  5J2N A;  1N34 K;  2BDP A;  4BDP A;  3HM8 A;  2FF6 A;  4H0P A;  3O9R A;  4B1V A;  3E66 A;  1VSH A;  3ENO A;  4WQ5 C;  3CFP A;  3VEW A;  3EE9 A;  1NK9 A;  3ATU A;  2NUB A;  1SS6 A;  4WFA L;  5CZ2 A;  3DWL A;  3M8R A;  4J2E A;  1Q9X A;  3VEV A;  3TAG A;  2QKB A;  4BDZ A;  1M90 O;  5LL6 Z;  2OCE A;  4H5V A;  3A0I X;  1HQE A;  2GUI A;  2D0O A;  4FWP A;  4CJW A;  4IWV A;  3K59 A;  3CM6 A;  4BGA A;  4X66 K;  4DTN A;  1EWR A;  2KW4 A;  2EX3 A;  4LSL A;  4B9U A;  4M7X A;  3AVK A;  4B9V A;  4HTL A;  2VWJ A;  2G8V A;  5KPZ A;  3ZX3 A;  1D8Y A;  3OY9 A;  4JS5 A;  3PX6 A;  4DTU A;  3KLF A;  3B6P A;  5T7B A;  3VMF B;  4OVL A;  2Y1J A;  3BZK A;  1EWQ A;  1FK9 A;  3TSQ A;  4DTJ A;  4I6M B;  5FLX O;  1QQN A;  1NJW A;  4BRK A;  1NGE A;  3CER A;  3VTI A;  3O6W A;  1B92 A;  1JLQ A;  4FL9 A;  3M3Z A;  2GEM A;  3R3L A;  3NH1 A;  5C2F A;  3U9D A;  3OYI A;  2QW9 A;  1Q81 O;  3BP8 A;  5M1F A;  4RG8 A;  4BRF A;  4YDU C;  3T69 A;  3IMX A;  3O3G A;  3SQ0 A;  1S1X A;  3CIP A;  3CJB A;  3OA9 A;  3NHG A;  2YHA A;  4PY5 A;  5GIO A;  1S9G A;  4J8F A;  1NGI A;  4OGC A;  5J2Q A;  3THX A;  5F2R A;  4FJ9 A;  2ZM6 K;  3WQU A;  3CQX A;  2OPQ A;  3FZH A;  4L3Q A;  4B1W B;  3SAG A;  2NRH A;  2FBY A;  1L3V A;  2HB5 A;  4DF4 A;  2RE2 A;  1G15 A;  1SUQ A;  3DRR A;  2P9S B;  5JS2 A;  3WXJ A;  2D0B A;  1HNW K;  4Y1C A;  4H4M A;  4CW7 B;  4KFB A;  3DLK A;  2QA4 N;  3QET A;  2E2N A;  4JK8 A;  2ASO A;  2YNG A;  4PA1 A;  1HPZ A;  2V7Z A;  3L6Q A;  3D6R A;  2FSK A;  4FCY A;  3A8Y A;  1VRU A;  2DFH A;  4Q5V A;  1VQM N;  2RPI A;  3BF3 A;  3LAL A;  4CE9 A;  4KHP K;  3SZ2 A;  4F3T A;  4FM0 A;  4DUZ K;  1X3N A;  4CEF A;  4AQY K;  1J5E K;  3I0R A;  4MQ3 A;  3ZYY X;  4C8L A;  4H0Y B;  2O4G A;  3Q7B A;  1CZ9 A;  1A5X A;  3K5L A;  1LWE A;  4A59 A;  5CR4 A;  3TWH A;  2NLX A;  4HCB A;  3ZEU A;  1Y97 A;  3J80 O;  1IH7 A;  4JYA K;  4RCH A;  2BE2 A;  2O8D A;  5JLF A;  4KHQ A;  2EWS A;  4OKK A;  3D2F A;  4MO5 A;  4I2P A;  2F4V K;  3ZSR A;  5LMN K;  1RBS A;  1W9H A;  5AQS A;  1WB9 A;  1U4B A;  4UQG A;  3KTQ A;  3KK3 A;  5JS1 A;  4FJM A;  2NRX A;  2P5G A;  2P9P B;  2QWM A;  3BF1 A;  3VEO A;  4CEC A;  1TYQ B;  4FLZ A;  1NGC A;  4DTP A;  4RW4 A;  4Z4F A;  4CK3 A;  3OYG A;  2HF4 A;  1O13 A;  4BE0 A;  1NJZ A;  1TUU A;  3HST B;  4CZL A;  1JL2 A;  4E7L A;  4ISE A;  4ELU A;  3OYF A;  4DUY K;  1F21 A;  2Q0R A;  2Q31 A;  3AO2 A;  3P39 A;  5AQM A;  3QBX A;  4AHS A;  5MLC Q;  1BA0 A;  3H45 C;  1B9D A;  3SUN A;  3WEE B;  4KKO A;  5C12 A;  3O9T A;  3OHR A;  1VQ4 N;  3THY A;  4OPA A;  4BG9 A;  3AA4 A;  1L3T A;  3R1X A;  1JXB A;  3J7Y P;  2YKM A;  4BRG A;  3AVA A;  4EZ6 A;  3LDQ A;  3GDQ A;  4B1U B;  3CPE A;  1VQ9 N;  5AQO A;  5TKY A;  4KRE A;  3NDK A;  1IBK K;  3NF8 A;  4DV1 K;  1YVU A;  4U7B A;  4BGB A;  4CFC A;  3RSE B;  1IG9 A;  3F9K A;  2CH5 A;  3R8E A;  1VSI A;  4CFB A;  4DSI A;  2WUS A;  4CIG A;  3DOL A;  4I2Q A;  1T8E A;  3QFU A;  2OTL N;  1IKX A;  2IVP A;  1HNI A;  2QWN A;  3KJV A;  2RN2 A;  4BR2 A;  3AAR A;  2E5L K;  3LAM A;  4E0D A;  3AO4 A;  1LW0 A;  3ZT0 A;  4KBO A;  4CCH A;  2HHV A;  1VQP N;  4ISG A;  3OJS A;  1GLF O;  1SKS A;  1O1W A;  1NKB A;  2FBX A;  1JJ2 M;  3HXM A;  3KHY A;  3K57 A;  3GG4 A;  2ZF5 O;  4JI2 K;  4C8O A;  2DTU A;  3CC2 N;  3HOT A;  3V4I A;  2P9K A;  4BRD A;  1EKE A;  1QQM A;  1DEJ A;  3MN5 A;  1YIJ N;  2D0P A;  3THV A;  2WC9 A;  1QSL A;  1XHZ A;  1S9E A;  5KPT A;  3G4S N;  3VES A;  3ZET A;  2HVI A;  3SPZ A;  1Q7Y O;  3QEV A;  1A5W A;  1S5J A;  1NJI O;  3QO9 A;  5AZJ A;  4YFU A;  4BRI A;  3U3G A;  4JRP A;  3MN6 A;  4J2D A;  4CGD A;  3RR7 A;  4M3Y A;  3F2K A;  2VG5 A;  2Z1I A;  1YTU A;  3CG7 A;  4PKH A;  4H8K A;  4WQ4 C;  4A5B A;  3OBW A;  1WSI A;  3V1R A;  1KFS A;  3VQQ A;  1BL3 A;  3O9Q A;  3K9J A;  3PIP L;  1T7P A;  3BGR A;  5BRE A;  1E4F T;  1CXQ A;  1WBD A;  3ZSV A;  1EXQ A;  2E2P A;  1SQK A;  1HYZ A;  2QI2 A;  3L2W A;  2P9S A;  4BE2 A;  5C2D A;  5AQF A;  2YI1 A;  4MLE A;  3NF9 A;  4E1N A;  1HLU A;  3OS1 A;  1T6C A;  3VQ4 A;  3DRS A;  5AQW A;  4DU3 A;  1RT7 A;  2UUB K;  2UXD K;  1FW6 A;  3N4Q A;  4HCC A;  4JKD A;  1RDA A;  3WNG A;  4CJ4 A;  2YHX A;  3HP6 A;  3CCV N;  1JXE A;  4DKW A;  5AZJ B;  1N36 K;  1TKZ A;  2VGM A;  3THY B;  1VSE A;  3L3V A;  4JKB A;  1BG3 A;  2NRT A;  3SBG A;  5F1X A;  4IZ9 A;  1ASU A;  3RVC A;  1ILY A;  2V52 B;  2X6S A;  4PHT X;  3MX2 A;  3HVT A;  2FSN A;  3TTC A;  2XY6 A;  5HRR A;  1VSM A;  4PUO A;  4B9T A;  2D0C A;  1YHQ N;  4XH5 A;  1QVG M;  2ZE2 A;  3L2R A;  4CI6 A;  3SMS A;  3OYD A;  3OYC A;  3QIP A;  3NCI A;  4RW7 A;  1OVY A;  3SQ4 A;  4FJH A;  2GV9 A;  2W42 A;  1JCF A;  3TAF A;  5SZT A;  4LF8 K;  2FXU A;  5FDL A;  2IVN A;  2FF3 B;  4BR7 A;  1LAV A;  3THW A;  3VTH A;  2QWL A;  3I33 A;  4B3R K;  1WSE A;  1OVQ A;  2QXL A;  4F2R A;  3DAW A;  4YOT A;  2PBD A;  4B8A B;  1BCO A;  4IEE A;  3MK6 A;  3ENH A;  4GW6 A;  3AVJ A;  1XNR K;  4H03 B;  2P5O A;  4FWN A;  4MDA A;  2X74 A;  3SYZ A;  3AO3 A;  1EP4 A;  4CZH A;  2P9U A;  4DTS A;  4E7J A;  3LPT A;  1CZA N;  1FXX A;  1WN7 A;  3VQP A;  3HPG A;  3V9U A;  4KPY A;  3AAQ A;  4Q0B A;  4G9Z A;  4FYD A;  3LDO A;  4BQL A;  2KFN A;  3L2Q A;  3AGK A;  4A62 A;  2YHB A;  4FJK A;  3W0L A;  4M3R A;  3WEE A;  1D4X A;  2A40 A;  1JL1 A;  5CYQ A;  4FLW A;  2NRV A;  2OA8 A;  2O8E B;  1N6Q A;  4H0X B;  4CJQ A;  4M3Z A;  3O3H A;  2IOC A;  3IFR A;  4OO1 J;  4PQU A;  3JS6 A;  2DY4 A;  1IKY A;  3D0P A;  1X9S A;  2Q2R A;  2HND A;  5D3G A;  5ADX H;  3FZL A;  1RBT A;  4DR7 K;  4ZTF A;  2BTF A;  3HYF A;  1WUA A;  5ELZ A;  1VHX A;  4DSE A;  1QSY A;  3R9P A;  3VQD A;  2E4L A;  1HMV A;  1WSH A;  3RWU A;  3MEC A;  3KK1 A;  1XI1 A;  4J2B A;  1KCF A;  1Q86 O;  3QER A;  3QIC A;  1HYS A;  2VQF K;  2FBV A;  3OVN A;  1RTD A;  3SQ2 A;  4M45 A;  3WXL A;  4FZZ A;  4JI4 K;  4HWI A;  3OJU A;  4KRF A;  3C6U A;  1BI4 A;  1FJG K;  5CHI A;  3CD6 N;  3ZET B;  1DGK N;  3TU5 A;  3AAP A;  4DQS A;  4FWK A;  1W0H A;  1QQC A;  4NCG A;  4B9S A;  2P1J A;  4C1N I;  2W6K A;  3CCE N;  1U2V A;  2A5X A;  1VSL A;  4E1J A;  2D4W A;  5ADX A;  1RIL A;  3SCX A;  3SJH A;  4QS7 A;  5BR9 A;  1KTQ A;  3MEG A;  2VGN A;  3PSF A;  4BVP A;  2HHW A;  3O1W A;  4WYB A;  4AHC A;  1RT1 A;  1X9M A;  1MDU B;  1E3M A;  1RBU A;  3NF7 A;  3T1H K;  3VQA A;  2ZGY A;  2F8S A;  4BRC A;  4BWJ A;  2O8E A;  3S3O A;  1D5A A;  3TAR A;  2CGL A;  1ZBS A;  3MMV A;  2HNY A;  2JWK A;  2XHB A;  1L3U A;  3DXM A;  5AQV A;  1Z6R A;  2E1Z A;  3SV3 A;  3K0S A;  4FVU A;  2A42 A;  4JHD B;  3RRH A;  3G0Z A;  1X9W A;  5C24 A;  2P9U B;  1DTQ A;  1QHA A;  3V9S A;  5C10 A;  1J9A A;  3ZX2 A;  4DTR A;  4O5F A;  2XRI A;  4BRN A;  3CHW A;  5AQR A;  3SNN A;  2A41 A;  3DJC A;  1NOY A;  5JVH L;  1W7A A;  1SKR A;  4DV0 K;  4NLC A;  5EY4 A;  3AVH A;  1UWB A;  4JRQ A;  4BY9 C;  4OPJ A;  1RDD A;  5HLF A;  4K0K K;  1S1W A;  2G8W A;  1IKV A;  4CF0 A;  4TSX A;  4IG0 A;  4AHV A;  3K5N A;  5AZI B;  3PY8 A;  3M8Q A;  4CIE A;  5AJ3 K;  4DR4 K;  2R7Y A;  4B3S K;  4OKJ A;  5BRD A;  1OH7 A;  5BRF A;  2FLO A;  5AQI A;  2WTU A;  2Q0U A;  3CPW M;  4NLB A;  3OYM A;  4YY3 K;  1NK0 A;  1NGH A;  4FVM A;  3TAP A;  2KFZ A;  1WOQ A;  4E3S A;  3RMC A;  4DLE A;  3TPQ A;  5GIP A;  5C15 A;  3FZM A;  4JD2 A;  5FRM A;  3OYE A;  2Q36 A;  3WUH A;  3C95 A;  3ZSY A;  3OYN A;  4HUG A;  1D9F A;  3TAB A;  3ZSZ A;  4DFP A;  2YNF A;  1XMQ K;  2KZM A;  3DOK A;  1NWK A;  5DM7 L;  2P51 A;  2ITG A;  1KFD A;  1JLF A;  3CJ7 A;  4CJE A;  5AQP A;  3SUQ A;  1K6Y A;  2EHG A;  3AY9 A;  1WAF A;  3LDL A;  4FZY A;  4CHY A;  3L4I A;  5BPM A;  4IDH A;  4ID1 A;  4C1N K;  5BPN A;  3U3Y A;  1YJN N;  2GUP A;  3U8X A;  3SK3 A;  4IG3 A;  4DR6 K;  3QFP A;  3K5M A;  2KTQ A;  3V81 A;  2QTD A;  4A2A A;  3VF4 A;  4OPK A;  1J54 A;  1NM1 A;  3QEX A;  4IOX A;  4FJ5 A;  4CES A;  2W41 A;  1LWC A;  4AHU A;  5C25 A;  3QIO A;  3K58 A;  2PYL A;  1TVR A;  3LP0 A;  4OLB A;  3P83 D;  3CCR N;  1YIT N;  3QLH A;  2F7T A;  4FWS A;  4AM6 A;  2GTD A;  1QE1 A;  1QSS A;  3DRP A;  2G8I A;  3ZLJ A;  3CXC M;  3IDH A;  5AQN A;  4DFM A;  1NGB A;  3IS9 A;  2G8U A;  1IBM K;  3LM2 A;  5E26 A;  4B1X B;  4EP4 A;  4DSJ A;  4O55 A;  3V1O A;  4NO7 A;  4LFC K;  1EET A;  4BRP A;  2P9N B;  1XNQ K;  4BE1 A;  3CI5 A;  4WQ5 A;  3GOI A;  3H1V X;  2ZGZ A;  3U4L A;  2OPS A;  4FLU A;  2F9T A;  4BRL A;  1BGX T;  3MWT A;  4ILH A;  4NXM K;  1VQL N;  3R6M A;  4FW2 A;  5GAH P;  5AQK A;  3AV9 A;  4FJN A;  1T05 A;  3VQ8 A;  4GV6 A;  4MO4 A;  3CCJ N;  3CF5 L;  1RT6 A;  4H5R A;  3LDN A;  4Z0U A;  5EOY A;  4FSV A;  2QWQ A;  4B3T K;  4BWM A;  2WBN A;  1P90 A;  4DV3 K;  3ULD A;  2BUP A;  4BRM A;  4BR5 A;  1U6Z A;  3EE8 A;  3NGI A;  2VG7 A;  4DWI A;  4BDY A;  1KLN A;  1RGI A;  1U48 A;  4JKG B;  3SPY A;  5B8H A;  3UB5 A;  5BN9 A;  3I56 N;  4FJG A;  4GKK K;  4DFK A;  1LWF A;  1T6D A;  3E01 A;  1XHX A;  2UUA K;  1HKG A;  3VQE A;  2UU9 K;  3MX5 A;  4O8U A;  1C0G A;  4N47 A;  2IVO A;  3O4Q A;  2AA4 A;  4JK9 A;  1NGA A;  1X1P A;  4C8K A;  1VQN N;  1P8Z A;  4JKH A;  3SJJ A;  2HF3 A;  1S72 N;  4YHH K;  1RDW X;  4FOE A;  2YHW A;  1TGO A;  3A5L C;  3O80 A;  3CFR A;  3THX B;  1ZBL A;  2YJF A;  3IAY A;  3L3U A;  4YOR A;  1V4S A;  3CJ9 A;  4FJX A;  4KHW A;  3DXK A;  2B5J A;  2HBL A;  1CLQ A;  5AQH A;  3BY5 A;  1KAY A;  3ZX0 A;  2UUC K;  4LFB K;  4JI3 K;  3I8B A;  3HBT A;  3ZT2 A;  3D45 A;  3NH2 A;  3OS0 A;  2Z1J A;  3HI0 A;  2V51 B;  4OKE A;  1RDU A;  5M1Q A;  1XC9 A;  1I94 K;  3CC4 N;  4M3X A;  3HPH A;  4KO0 A;  4CBU A;  4QOZ B;  2GEL A;  4ILJ A;  1VQO N;  4JK7 A;  4YOV A;  4RWT A;  4E7I A;  2O4I A;  3WNF A;  4CF2 A;  1BQN A;  3MDQ A;  3P38 A;  5EX5 A;  3K2P A;  3DLB A;  4CGF A;  4DQQ A;  1TYQ A;  5HRN A;  2YKN A;  4N56 A;  3RTV A;  3AVF A;  2IIR A;  2BGG A;  4KB0 A;  3AVC A;  3O9U A;  4F3O A;  1QZ6 A;  2A1S A;  5AZI A;  5HRP A;  4FJ7 A;  3IG1 A;  1IJJ A;  3IKM A;  4NYF A;  3EEQ A;  1SL0 A;  1ESV A;  3ULE B;  1TKX A;  4FLV A;  4DCH A;  5M1K A;  1VQ7 N;  2X6N A;  2E20 A;  1HPM A;  4WFB L;  3AVM A;  3ISN C;  3JSM A;  3DXK B;  3TR8 A;  4AM7 A;  3U6F A;  4NCA A;  1WNS A;  2IS3 A;  3C65 A;  1NJX A;  1Q82 O;  5LJV A;  3NAE A;  4RW6 A;  3C6H A;  3I0S A;  4GVE A;  4KH5 A;  4FPA A;  1VSK A;  4DS4 A;  4W5R A;  3MAQ A;  1N33 K;  2O8F B;  3MCA B;  4HVJ A;  2I7N A;  4DV6 K;  3FFI A;  3HT3 A;  2YNI A;  1X3M A;  1YI2 N;  4K41 A;  1VQ8 N;  3ATV A;  3ZT3 A;  3OYA A;  4DU4 A;  3DLL L;  5HRS A;  1JLA A;  4JD2 B;  3TAN A;  3VQC A;  3FLC O;  2D0A A;  3SUP A;  5KGW A;  2CGK A;  4KH4 A;  4BRE A;  2ZQB A;  3ALY A;  4CED A;  4YOW A;  4Y1D A;  3F73 A;  3VGK A;  3PV8 A;  5C42 A;  4BC3 A;  3LP2 A;  4AHT A;  3AA3 A;  3ZSO A;  2G8K A;  4BR0 A;  4CGI A;  1LOT B;  1S3X A;  4DTX A;  4JI5 K;  1KVA A;  1WLJ A;  3NGY A;  3SAH A;  1W2B M;  5BR8 K;  3H6E A;  1W97 L;  3OTO K;  3VQ5 A;  3LZJ A;  1NLV A;  1JCG A;  3HSC A;  1SZ2 A;  4H0O A;  3AVB A;  3K5O A;  3T7Z A;  3AVI A;  3NFA A;  2CH6 A;  3CET A;  4FOI A;  1JLG A;  4BG8 A;  2E1Y A;  1Q8I A;  1QHT A;  3QNO A;  3RMB A;  3D2F B;  3K9K A;  2KZZ A;  2G8H A;  4EZ9 A;  3HRG A;  2Y1I A;  1ZC6 A;  3GBT A;  1S6Q A;  4CER A;  4ID5 A;  2UXB K;  3CMA N;  1TAU A;  3L2V A;  4FO0 A;  4V19 S;  4IOC L;  4X65 K;  4Y0W A;  5K14 A;  3S3M A;  5HBM A;  4CZF A;  1KXP A;  5JMV A;  4JLH A;  4JN4 A;  4B9N A;  4GV3 A;  4CHP A;  1YTA A;  1VQ5 N;  5AFU H;  4DLG A;  4EAH D;  1HUX A;  3CYM A;  1Q18 A;  1ZBI A;  1RTH A;  3ZSW A;  1BWF O;  4CGG A;  1VAZ A;  1T3V A;  3S41 A;  2HST A;  5BPL A;  1U47 A;  1VSF A;  3NBP A;  4FWM A;  1BCM A;  2Z1H A;  2JWL A;  3SMP A;  2RF2 A;  4RTF D;  3M1F A;  4GKJ K;  4KH6 A;  2O8C A;  3RSE A;  2VYP A;  3TAE A;  3O5B A;  4M3T A;  3C7N B;  4JKF A;  4RW9 A;  2XO7 A;  1HQU A;  1RTI A;  4L8R B;  3PLA A;  4DR3 K;  3C0B A;  4I9Q A;  4DR1 K;  4DQR A;  1ATS A;  5BN8 A;  3V9Z A;  3DYA A;  4ILG B;  1R59 O;  2FBT A;  4CIF A;  3AA5 X;  3F9M A;  3I55 N;  3O3F A;  3ZCM A;  2YX6 A;  3O4N A;  3LPU A;  4CF9 A;  1C1A A;  3M8S A;  1Z25 A;  3E9L A;  3VQ7 A;  4ZTJ A;  1C1C A;  5J1E A;  2PZS A;  1K8K A;  3TSU A;  3WXK A;  4ISF A;  4B9Q A;  2KHO A;  1T03 A;  3EN9 A;  3V1Q A;  1NKE A;  3KVG A;  4CEZ A;  4CFA A;  3SAF A;  3D2E B;  2DFF A;  3KKS A;  4FWO A;  3J7Z O;  4FK0 A;  1YXQ A;  3ITH A;  4AF1 A;  1HJO A;  4DV4 K;  1B9F A;  3LWM A;  3AO5 A;  3EZ5 A;  4LF6 K;  3QEW A;  4E7H A;  3CC7 N;  4PWD A;  5KI6 A;  1LW2 A;  3UKU A;  4CFD A;  4O5B A;  4IDK A;  4PL8 A;  4FK4 A;  1VQ6 N;  4DG1 A;  4F4K A;  1XC3 A;  4YOX A;  5KRT A;  4H5N A;  1TL3 A;  1GLJ O;  4IKF A;  3DLE A;  1U04 A;  3S9H A;  3LAK A;  1ATN A;  3VQ6 A;  5LMU K;  4FK2 A;  4I9L A;  1J6Z A;  5EU7 A;  2D1K A;  4CZK A;  5IWA K;  2A1R A;  1NGD A;  4GY2 B;  3H08 A;  2IC3 A;  3QIN A;  4EHU A;  3BEX A;  3FE1 A;  3LM9 A;  4EIA A;  4LFA K;  1C0T A;  4O0I A;  3RR8 A;  1S1U A;  4CHO A;  4K25 A;  4KI6 A;  3P31 A;  1DLO A;  1E4G T;  3VGM A;  3G71 N;  1L5U A;  4KAZ A;  4I7F A;  3PX4 A;  2I5J A;  3VA3 A;  2HHS A;  4H0T B;  1BQM A;  1DT9 A;  2HBM A;  4CZI A;  5J2P A;  3C7N A;  2F8T A;  3VN5 A;  2XY7 A;  5CZ1 A;  3QDK A;  4Z4G A;  4A5A A;  5GIN A;  5HL7 L;  4GNI A;  3VQB A;  1C0M A;  4FLY A;  1XUP O;  2Q3S A;  3O9S A;  4FM2 A;  4B08 A;  3THW B;  4CEQ A;  4CBX A;  3CQY A;  3RMA A;  1HNV A;  1GLL O;  4E19 A;  2W6L A;  4DSK A;  3IRX A;  4PL7 A;  4EFH A;  4GV9 A;  1Z05 A;  1WAJ A;  2OTJ N;  3ZT1 A;  1HX1 A;  1D9D A;  4H5W A;  3SUO A;  4XH1 A;  3HO1 A;  2OZM A;  1NU0 A;  4DQI A;  1C6V A;  4ELV A;  4GMJ B;  5DM6 L;  1OKJ A;  4CK1 A;  2QKK A;  4BC5 A;  4NB4 A;  4M42 A;  4DU1 A;  1ZXO A;  3D2E A;  4KTQ A;  1TV6 A;  2HBK A;  3EZW A;  1RDC A;  4FWQ A;  1LCU A;  4K43 A;  2OZS A;  3LWL A;  2HHH K;  5AQU A;  4EHT A;  3P1G A;  1HNX K;  1UOC A;  2IDO A;  3MWP A;  3NVK A;  4JI1 K;  1V4T A;  4E7K A;  3EO3 A;  2A3Z A;  5FPM A;  2ZJP L;  3QES A;  3E9P A;  2HHU A;  2QM1 A;  3P4I A;  4OPH A;  1FKP A;  4WF9 L;  2P9K B;  1NK7 A;  4C8N A;  3SQ1 A;  3G6E N;  4JV5 K;  3MXM A;  4M3U A;  5GAG P;  3OYJ A;  4I6M A;  2OAN A;  2PY5 A;  4QAG A;  5AQL A;  4BRO A;  4NYN A;  3EKS A;  4N76 A;  1KAZ A;  1RTJ A;  3O08 A;  4LSN A;  3SI6 A;  3OYH A;  4A61 A;  3HJF A;  4Z4I A;  1L3S A;  2E2Q A;  1REV A;  3C6A A;  3QEP A;  5EVZ A;  3SLC A;  5KPR A;  3KLH A;  4DV5 K;  4HUF A;  3E9O A;  1HNZ K;  4WCE L;  1IO2 A;  4K8X A;  2A6A A;  4B1Y B;  4CHQ A;  1HKC A;  1IBL K;  1WSG A;  4CJK A;  4IO8 A;  5LJW A;  5AQZ A;  2QK9 A;  5E41 A;  2OYQ A;  4XIU A;  1HRH A;  3PX0 A;  3VA0 A;  4M41 A;  3C94 A;  2O8F A;  3FR0 A;  4M63 C;  5FPD A;  5M1P A;  1QS4 A;  3BZC A;  3VER A;  4KHY A;  1T44 A;  4YDU A;  3CQ8 A;  2QEX N;  3LP3 A;  3T3F A;  4DQP A;  3AVG A;  3RRG A;  2HHQ A;  1SL2 A;  1SAZ A;  1MA9 B;  2RKI A;  2HMP A;  1VSJ A;  4X64 K;  1IV0 A;  3B6O A;  4HUE A;  4W5O A;  5CY4 A;  3NE6 A;  2QXF A;  4CJ5 A;  1XWL A;  3A5M C;  1Y64 A;  2KLA A;  3IUC A;  1RT4 A;  2F9W A;  3L2U A;  3VGL A;  1HYV A;  5HRO A;  3W3D A;  4CBW A;  3B8A X;  4KTZ A;  5H1S Q;  5FPN A;  1NK5 A;  1VRT A;  5HOO A;  5JVG L;  3KD5 E;  3TI0 A;  3A5O C;  1KVB A;  1WSF A;  4YOU A;  1ZBF A;  5DMR A;  1OH6 A;  1G99 A;  4XEI A;  4IJN A;  1BIZ A;  4MDB A;  2ETJ A;  1GLB G;  4JI8 K;  1GOC A;  4OLA A;  1BUP A;  3I8D A;  2P9I B;  2GWK A;  2ZWH A;  1GOA A;  5IT9 O;  4IO9 L;  2F96 A;  1S1T A;  4GVM A;  3DLR A;  4E1M A;  2E6L A;  2P9P A;  4CZG A;  5BRH A;  1NJY A;  4DR2 K;  4DTM A;  3KD1 E;  4CJT A;  3E1Y A;  1GLA G;  4OGE A;  1NMN A;  5AFU A;  5AQX A;  3FZK A;  2IGI A;  3VF2 A;  4J2A A;  1VQK N;  2BH1 A;  1Z26 A;  5I42 A;  3V9W A;  5KRS A;  4DFJ A;  1RT2 A;  1QQO A;  3A2F A;  1WSJ A;  2ZD1 A;  3KK2 A;  4FJJ A;  3VPZ A;  3GE1 A;  4CD1 A;  3MN9 A;  2B6A A;  1XMO K;  4QS9 A;  4U67 L;  2DFE A;  3ZEU B;  2XY8 A;  1EQY A;  1NOZ A;  4WQ4 A;  1BOT O;  1S6P A;  2HW3 A;  3DLH A;  2CGJ A;  3FGU A;  4IXC A;  3CJC A;  3PO4 A;  4CEA A;  4O44 A;  3OS2 A;  4KB1 A;  4JHD A;  3LP1 A;  3WXI A;  3KLE A;  1BIS A;  4CJU A;  4K8Z A;  5JIC A;  3ULE A;  3CCQ N;  1NBW A;  1U45 A;  3CCU N;  5AQJ A;  2QWO A;  2WON A;  4BQZ A;  1ZBH A;  4QCL A;  3LDP A;  4IFV A;  4W5Q A;  2VQE K;  3VOV A;  4PKI A;  2B4J A;  3LZI A;  3V9X A;  4CK2 A;  4DTO A;  4FJI A;  4NCB A;  3P5J A;  3EL2 A;  1EO1 A;  4F8R A;  1K8A O;  4KHS A;  1TAQ A;  2HHX A;  3TTF A;  1BDG A;  1ZBU A;  4CZJ A;  3HPO A;  3MCP A;  2Q1N A;  1KAX A;  4CD3 A;  3SBT A;  4KHU A;  1JCE A;  4C23 A;  2KQ2 A;  4BRA A;  3UIQ A;  1KVC A;  4DF8 A;  5AQY A;  1TKD A;  5FPE A;  3CCS N;  4CF8 A;  3L0Q A;  4BAC A;  1GLD G;  1ATR A;  1NGJ A;  4AHR A;  3ENB A;  3MEE A;  4WFN L;  3OYK A;  4MLH A;  1TL1 A;  4IFY A;  3UKR B;  3U9Z A;  2P9L A;  2Q97 A;  2VCP A;  3KLG A;  3VET A;  4DSF A;  1YJ9 N;  2FSJ A;  2AJQ A;  1Q9Y A;  1IKW A;  4Z4C A;  4DQ8 A;  2VWB A;  1K9M O;  4O8K A;  3WXM B;  4YOY A;  3LL3 A;  1VSD A;  2W40 A;  2AP1 A;  4JNE A;  1NKC A;  2KKZ A;  4DV2 K;  2ASP A;  2NRR A;  3QEI A;  1NNE A;  3KZB A;  4ZHR A;  2PYJ A;  4FPB A;  3WT0 A;  4CHN A;  1CXU A;  2NRZ A;  5J2M A;  2WOM A;  3ID8 A;  1RNH A;  1YJW N;  4HTU A;  1GOB A;  3GL1 A;  4FXD A;  4LF9 K;  2O8C B;  1M1K O;  3DM2 A;  3DXM B;  4M3W A;  2O8B B;  5KQ8 A;  4JEP A;  2UXC K;  3G25 A;  1ZYQ A;  3CME N;  3HL8 A;  3CCM N;  2NNW A;  3PIO L;  4BVO A;  3LDS A;  4W5N A;  2RHK A;  3VEX A;  3CJA A;  3TAM A;  3ZT4 A;  4E89 A;  2ZJQ L;  4JKG A;  1H1V A;  4AIL C;  2H3G X;  1YVN A;  5I9E B;  2HMI A;  1I39 A;  1X9J A;  3H3N O;  4DR5 K;  4OX9 K;  1NK8 A;  2HVH A;  4CGJ A;  5AR0 A;  1S1V A;  4K42 A;  4OJR A;  1ITG A;  1MWK A;  1SV5 A;  4RW8 A;  2Z1G A;  2GBZ A;  4KTW A;  3AVL A;  4H4O A;  4CF1 A;  3NMU A;  4JKE A;  2HHT A;  4DMN A;  4R79 A;  4LY7 A;  4CJS A;  3OW2 M;  3L8B A;  1JLE A;  1S22 A;  4DSL A;  4F2S A;  2P9L B;  1C0F A;  4B1Z A;  3FZF A;  4FWL A;  3HP9 A;  4O0J A;  3O8M A;  3HVR A;  5HP1 A;  4KI4 A;  3JAM O;  3M8P A;  4XH4 A;  3KK7 A;  3HM9 A; 
#chains in the Genus database with same CATH homology
 1NK4 A;  1S1W A;  2G8W A;  1T03 A;  3V1Q A;  1NKE A;  1SKW A;  1IKV A;  1I3A A;  4TSX A;  4IG0 A;  4AHV A;  4CF0 A;  2VWK A;  3WNH A;  3M8Q A;  4CIE A;  3KK3 A;  3K5N A;  1UA1 A;  4CEZ A;  3PY8 A;  4FJM A;  4CFA A;  5JS1 A;  2R7Y A;  4CEO A;  2DFF A;  4AH9 A;  4OKJ A;  3LAN A;  2P5G A;  3KKS A;  4CEC A;  4FLZ A;  4FK0 A;  3ITH A;  1J53 A;  3JYT A;  4DTP A;  4RW4 A;  4IBN A;  3OYM A;  4Z4F A;  4CK3 A;  1NK0 A;  1B9F A;  3LWM A;  3AO5 A;  4FVM A;  3OYG A;  3EZ5 A;  3HK2 A;  3TAP A;  1J5O A;  2KFZ A;  4E3S A;  4E7H A;  3QEW A;  3RMC A;  4DLE A;  4PWD A;  5KI6 A;  4BE0 A;  1LW2 A;  4FLT A;  1NJZ A;  3HST B;  4CFD A;  1JL2 A;  4O5B A;  3VQ9 A;  4IDK A;  4E7L A;  5FRM A;  3OYE A;  4W5T A;  4FK4 A;  4DG1 A;  3C95 A;  4ELU A;  3ZSY A;  4F4K A;  3OYN A;  3OYF A;  4HUG A;  1F21 A;  5KRT A;  3TAB A;  1D9F A;  1TL3 A;  4IKF A;  3DLE A;  3ZSZ A;  4DFP A;  1U04 A;  2YNF A;  3AO2 A;  4LD0 A;  3S9H A;  2KZM A;  4AHS A;  3DOK A;  3LAK A;  2P51 A;  4G1Q A;  1B9D A;  2ITG A;  3DMJ A;  3VQ6 A;  3SUN A;  4FK2 A;  1KFD A;  4KKO A;  1JLF A;  4I9L A;  4CJE A;  2IAJ A;  5EU7 A;  3EY1 A;  3SUQ A;  1K6Y A;  5CYM A;  2A1R A;  3MXI A;  1TKT A;  1KSP A;  3H08 A;  2IC3 A;  2EHG A;  3V6D A;  3QIN A;  4FZY A;  1WAF A;  4CHY A;  3AA4 A;  1C0T A;  1UAX A;  4O0I A;  1L3T A;  3RR8 A;  1JXB A;  5KTQ A;  4YNQ A;  1U49 A;  1S1U A;  4CHO A;  4ID1 A;  2YKM A;  3AVA A;  4EZ6 A;  4KI6 A;  3U3Y A;  1DLO A;  3NGZ A;  4EP5 A;  1L5U A;  4M3Z A;  4KAZ A;  4KRE A;  3NDK A;  3PO5 A;  4IG3 A;  4I7F A;  3EYZ A;  3KKR A;  3PX4 A;  3K5M A;  4Z4H A;  2I5J A;  2OPR A;  3VA3 A;  3NF8 A;  2HHS A;  1BQM A;  2X78 A;  2KTQ A;  1YVU A;  1DTT A;  5J2P A;  4N41 A;  4CFC A;  3V81 A;  2F8T A;  1FKO A;  2FC0 A;  3VN5 A;  2XY7 A;  5CZ1 A;  4OPK A;  4Z4G A;  1J54 A;  1IG9 A;  3QEX A;  1RT3 A;  3F9K A;  1VSI A;  1C0M A;  3VQB A;  4CFB A;  2Q3S A;  4CES A;  1LWC A;  4AHU A;  5C25 A;  4FLY A;  4FM2 A;  3QIO A;  3QNN A;  4B08 A;  4DSI A;  3K58 A;  4CIG A;  2PYL A;  1TVR A;  4CEQ A;  3LP0 A;  3DOL A;  4I2Q A;  1T8E A;  3RMA A;  1HNV A;  4OLB A;  1IKX A;  3P83 D;  1HNI A;  4E19 A;  3KJV A;  3TAQ A;  3QLH A;  2RN2 A;  3S3N A;  3IRX A;  4DSK A;  4LH4 A;  2JGU A;  1WAJ A;  1QE1 A;  1QSS A;  3LAM A;  3ZT1 A;  4E0D A;  1D9D A;  3DRP A;  4CHZ A;  3AO4 A;  1LW0 A;  3ZT0 A;  5FRN A;  3SUO A;  2G8I A;  4CCH A;  2HHV A;  3HO1 A;  2OZM A;  4DFM A;  4KHN A;  4O4G A;  4DQI A;  3OJS A;  4CEE A;  3IS9 A;  2G8U A;  1A5V A;  1C6V A;  4ELV A;  4GMJ B;  4EP4 A;  1SKS A;  4DSJ A;  1O1W A;  4O55 A;  5KGX A;  3V1O A;  4CK1 A;  1C1B A;  3CFO A;  1EET A;  1NKB A;  2FBX A;  2QKK A;  4M42 A;  1RDB A;  3HXM A;  4BE1 A;  4DU1 A;  3K57 A;  1JLB A;  1ASV A;  4C8O A;  4CJR A;  2DTU A;  1TK8 A;  3SV4 A;  5SWM A;  3V4I A;  4LH5 A;  4KTQ A;  3DLG A;  1RBR A;  1TV6 A;  1EKE A;  1RDC A;  2OPS A;  4FLU A;  3THV A;  4B9L A;  1QSL A;  2OZS A;  1XHZ A;  1BGX T;  1S9E A;  3LWL A;  2XY5 A;  2HVI A;  3P1G A;  1UOC A;  1R0A A;  2IDO A;  3SPZ A;  4DS5 A;  4FW1 A;  4CGH A;  3AA2 A;  4E7K A;  1BI4 B;  3QEV A;  1A5W A;  5HLF A;  1S5J A;  4CJL A;  3T1A A;  3QES A;  3MED A;  4HHT A;  2YV0 X;  4FW2 A;  3AV9 A;  3QO9 A;  4YFU A;  4FJN A;  4FJ8 A;  1T05 A;  2YNH A;  3VQ8 A;  2HHU A;  3U3G A;  4JRP A;  1UA0 A;  1FKP A;  2VG6 A;  1NK7 A;  4C8N A;  3SQ1 A;  4N5S A;  4JS4 A;  1VK0 A;  3MXM A;  4M3U A;  1RT6 A;  3OYJ A;  4Z0U A;  4J2D A;  2PY5 A;  1BIU A;  1KLM A;  4BWM A;  4QAG A;  4CGD A;  3RR7 A;  4NYN A;  4M3Y A;  3ULD A;  3BDP A;  1TK0 A;  4N76 A;  1RTJ A;  3SI6 A;  2VG5 A;  4LSN A;  3OYH A;  3HJF A;  4Z4I A;  2Z1I A;  1L3S A;  1REV A;  3QEP A;  1YTU A;  3CG7 A;  2VG7 A;  3NGI A;  4BDY A;  1KLN A;  3KLH A;  4ICL A;  1U48 A;  4DWI A;  4FJL A;  4HUF A;  3SPY A;  2BAN A;  4H8K A;  4FJ5 A;  1C0U A;  1WSI A;  1IO2 A;  4K8X A;  3V1R A;  4CHQ A;  1KFS A;  4FJG A;  3VQQ A;  4DFK A;  3WNE A;  1BL3 A;  1LWF A;  1WSG A;  3E01 A;  1XHX A;  4CJ3 A;  4CJK A;  3VQE A;  1T7P A;  4B3O A;  3BGR A;  2QK9 A;  4N47 A;  1CXQ A;  2OPP A;  3O4Q A;  5E41 A;  4XIU A;  1HRH A;  3PX0 A;  2OYQ A;  3VA0 A;  3ZSV A;  1EXQ A;  4M41 A;  3C94 A;  1HYZ A;  3L2W A;  1QS4 A;  4BE2 A;  4KHY A;  1X1P A;  3PUF A;  1RBV A;  4C8K A;  3CQ8 A;  2G8F A;  3SJJ A;  3NF9 A;  4E1N A;  3AO1 A;  3OS1 A;  3LP3 A;  3T3F A;  4DQP A;  4CJV A;  3AVG A;  1JLC A;  3VQ4 A;  3ZSX A;  3DRS A;  3RRG A;  4DU3 A;  2HHQ A;  1SL2 A;  3KIO A;  1BHL A;  1RT7 A;  1TGO A;  2RKI A;  3T19 A;  3CFR A;  1ZBL A;  1VSJ A;  3IAY A;  3L3U A;  1JKH A;  1HJR A;  4CEB A;  4C8M A;  4HCC A;  3CM5 A;  3B6O A;  4HUE A;  1KRP A;  1RDA A;  3WNG A;  4CJ4 A;  4W5O A;  5CY4 A;  1YT3 A;  4FJX A;  2B5J A;  3HP6 A;  4KHW A;  3NE6 A;  1CLQ A;  2QXF A;  1JXE A;  4CJ5 A;  5FRO A;  1TKZ A;  1XWL A;  3L2U A;  1RT4 A;  4WE1 A;  1VSE A;  3L3V A;  1HYV A;  1CZB A;  2LSN A;  3ASM A;  5HRO A;  1NK5 A;  4KTZ A;  3D45 A;  3ZT2 A;  4FZX C;  1VRT A;  1ASU A;  3DI6 A;  3AVN A;  3NH2 A;  3OS0 A;  2Z1J A;  4B8C A;  5I3U A;  3NF6 A;  3KD5 E;  4OKE A;  3TI0 A;  1KVB A;  2D5R A;  1EX4 A;  2X6S A;  1WSF A;  1MU2 A;  3HVT A;  1XC9 A;  1N5Y A;  2XY6 A;  1LAW A;  1ZBF A;  4R5P A;  4CJF A;  4FLX A;  1RT5 A;  5DMR A;  1QTM A;  3KLI A;  4M3X A;  4B9M A;  5HRR A;  3HPH A;  4KO0 A;  1VSM A;  4PUO A;  1SL1 A;  4B9T A;  4QOZ B;  2D0C A;  4FM1 A;  3C6T A;  1BIZ A;  2ZE2 A;  4KV8 A;  2ETJ A;  3L2R A;  2E6M A;  3NH0 A;  3OYB A;  1NK6 A;  4E7I A;  3OYL A;  4ELT A;  2O4I A;  1GOC A;  3WNF A;  4OLA A;  4CF2 A;  1BQN A;  3I8D A;  3DLB A;  3K2P A;  3KTQ A;  3OYD A;  3OYC A;  3QIP A;  1GOA A;  4CGF A;  4RW7 A;  3NCI A;  4DQQ A;  5HRN A;  3RMD A;  2YKN A;  2F96 A;  1S1T A;  2HNZ A;  3AVF A;  4GVM A;  4N56 A;  3RTV A;  2BGG A;  3DLR A;  4E1M A;  4KB0 A;  2E6L A;  2ATQ A;  3AVC A;  3SQ4 A;  4FJH A;  2GV9 A;  1NJY A;  4F3O A;  2A1S A;  2W42 A;  4CJP A;  4Z4E A;  3TAF A;  5HRP A;  4DTM A;  5SZT A;  3KD1 E;  5DK5 A;  4FJ7 A;  4CJT A;  5FDL A;  1LV5 A;  3IG1 A;  4OGE A;  1ASW A;  1TK5 A;  1RCH A;  4MFB A;  4NYF A;  2IGI A;  4J2A A;  1LAV A;  1SL0 A;  1Z26 A;  5I42 A;  2JLE A;  3V9W A;  5KRS A;  3G10 A;  4DFJ A;  3ZSQ A;  1RT2 A;  3MXJ A;  3A2F A;  1WSJ A;  2ZD1 A;  3KK2 A;  1WSE A;  4FJJ A;  1TKX A;  4FLV A;  5J2N A;  4F2R A;  2BDP A;  4BDP A;  2X6N A;  4B8A B;  2B6A A;  1BCO A;  3AVM A;  3ISN C;  3JSM A;  4GW6 A;  3TR8 A;  3U6F A;  3AVJ A;  1VSH A;  2DFE A;  3CFP A;  4NCA A;  1NK9 A;  1WNS A;  2IS3 A;  2XY8 A;  1NJX A;  2P5O A;  1NOZ A;  2X74 A;  1S6P A;  2NUB A;  3SYZ A;  3AO3 A;  3DLH A;  2HW3 A;  1EP4 A;  3NAE A;  4RW6 A;  4DTS A;  4E7J A;  3LPT A;  3PO4 A;  5CZ2 A;  3I0S A;  1FXX A;  1WN7 A;  3VQP A;  4CEA A;  4O44 A;  3M8R A;  1Q9X A;  4J2E A;  3HPG A;  3OS2 A;  3V9U A;  4KPY A;  4Q0B A;  4KB1 A;  4FYD A;  3LP1 A;  3TAG A;  2QKB A;  1VSK A;  4BDZ A;  3L2Q A;  3KLE A;  4DS4 A;  2KFN A;  4W5R A;  3MAQ A;  1BIS A;  1HQE A;  2YHB A;  4CJU A;  4K8Z A;  4FJK A;  4HVJ A;  2GUI A;  1U45 A;  4M3R A;  3FFI A;  4CJW A;  2WON A;  3HT3 A;  1JL1 A;  2YNI A;  3K59 A;  3CM6 A;  4DTN A;  1ZBH A;  4QCL A;  5CYQ A;  4IFV A;  4W5Q A;  4FLW A;  2OA8 A;  2KW4 A;  2EX3 A;  2B4J A;  4LSL A;  4CJQ A;  3LZI A;  3ZT3 A;  4CK2 A;  3O3H A;  3V9X A;  1N6Q A;  2IOC A;  3OYA A;  3AVK A;  4B9U A;  4PQU A;  4DU4 A;  2DY4 A;  4DTO A;  4FJI A;  1IKY A;  5HRS A;  4B9V A;  3P5J A;  3D0P A;  1JLA A;  4NCB A;  3TAN A;  1X9S A;  4F8R A;  2HND A;  3VQC A;  4KHS A;  2D0A A;  1TAQ A;  2VWJ A;  3SUP A;  5KGW A;  2G8V A;  5D3G A;  2HHX A;  1ZBU A;  2ZQB A;  1D8Y A;  1RBT A;  3ALY A;  4CED A;  3OY9 A;  3HPO A;  4JS5 A;  4Y1D A;  4ZTF A;  3PX6 A;  4DTU A;  3HYF A;  3KLF A;  3F73 A;  3B6P A;  5T7B A;  4DSE A;  4OVL A;  5C42 A;  2Y1J A;  3PV8 A;  3LP2 A;  1QSY A;  3VQD A;  4KHU A;  2E4L A;  1FK9 A;  2KQ2 A;  3AA3 A;  3ZSO A;  4AHT A;  4DTJ A;  4CGI A;  4DTX A;  1KVC A;  2G8K A;  1HMV A;  3UIQ A;  1WSH A;  1KVA A;  1WLJ A;  4DF8 A;  3NGY A;  1NJW A;  3RWU A;  3MEC A;  3KK1 A;  1XI1 A;  1TKD A;  4J2B A;  3VQ5 A;  3LZJ A;  4CF8 A;  1B92 A;  1JLQ A;  1KCF A;  3AVB A;  3K5O A;  4BAC A;  3QER A;  1HYS A;  3AVI A;  2FBV A;  3OVN A;  3NFA A;  1RTD A;  3NH1 A;  3SQ2 A;  4AHR A;  4M45 A;  4FZZ A;  3OYI A;  1JLG A;  3MEE A;  3OYK A;  3OJU A;  1TL1 A;  4KRF A;  1Q8I A;  3C6U A;  1BI4 A;  4IFY A;  1QHT A;  3QNO A;  4RG8 A;  3RMB A;  2KZZ A;  3KLG A;  2G8H A;  3SQ0 A;  3O3G A;  4DSF A;  4EZ9 A;  1S1X A;  2AJQ A;  1Q9Y A;  1IKW A;  4DQS A;  4Z4C A;  2Y1I A;  3NHG A;  1W0H A;  2YHA A;  4PY5 A;  1QQC A;  1S6Q A;  4NCG A;  1S9G A;  4ID5 A;  4CER A;  4B9S A;  1TAU A;  1VSD A;  2P1J A;  3L2V A;  1NKC A;  4OGC A;  5J2Q A;  1VSL A;  5K14 A;  4FJ9 A;  3S3M A;  1RIL A;  5HBM A;  3QEI A;  3SCX A;  2OPQ A;  4ZHR A;  2PYJ A;  4JLH A;  1KTQ A;  4B9N A;  3MEG A;  4CHN A;  1CXU A;  2FBY A;  4CHP A;  1YTA A;  2HB5 A;  5J2M A;  1L3V A;  2HHW A;  2WOM A;  4DLG A;  1RNH A;  4DF4 A;  1G15 A;  1SUQ A;  3DRR A;  4AHC A;  3CYM A;  5JS2 A;  4HTU A;  2D0B A;  1GOB A;  1RT1 A;  1X9M A;  1ZBI A;  1RBU A;  1RTH A;  3NF7 A;  4Y1C A;  3ZSW A;  4FXD A;  4M3W A;  3DM2 A;  4H4M A;  3VQA A;  4CGG A;  4KFB A;  3DLK A;  2F8S A;  1U47 A;  1VSF A;  1ZYQ A;  3HL8 A;  4BWJ A;  3NBP A;  3QET A;  1BCM A;  2YNG A;  1D5A A;  1HPZ A;  2Z1H A;  4PA1 A;  3TAR A;  3S3O A;  2RF2 A;  4FCY A;  2HNY A;  2XHB A;  3LDS A;  4W5N A;  1L3U A;  1VRU A;  2DFH A;  4Q5V A;  2RPI A;  3TAM A;  3ZT4 A;  4E89 A;  3LAL A;  4AIL C;  4CE9 A;  3SV3 A;  3TAE A;  2HMI A;  4M3T A;  1I39 A;  4RW9 A;  2XO7 A;  1NK8 A;  3SZ2 A;  4F3T A;  3RRH A;  3G0Z A;  1HQU A;  1RTI A;  4CGJ A;  4FM0 A;  4L8R B;  4CEF A;  2HVH A;  1S1V A;  1X9W A;  3I0R A;  4MQ3 A;  4I9Q A;  4OJR A;  4C8L A;  5C24 A;  1ITG A;  2O4G A;  1DTQ A;  1CZ9 A;  1SV5 A;  4RW8 A;  2Z1G A;  1J9A A;  2GBZ A;  4KTW A;  1A5X A;  3AVL A;  3K5L A;  1LWE A;  3V9S A;  4H4O A;  4DQR A;  3TWH A;  4DTR A;  4CF1 A;  3V9Z A;  4HCB A;  3DYA A;  2HHT A;  2XRI A;  2FBT A;  4CIF A;  1Y97 A;  3AA5 X;  1IH7 A;  3O3F A;  3ZCM A;  2BE2 A;  4DMN A;  3SNN A;  4LY7 A;  1NOY A;  4CJS A;  3O4N A;  4KHQ A;  1SKR A;  3LPU A;  3L8B A;  4OKK A;  1JLE A;  4CF9 A;  1C1A A;  3AVH A;  4DSL A;  3M8S A;  4F2S A;  4I2P A;  1UWB A;  1Z25 A;  3ZSR A;  4JRQ A;  3VQ7 A;  4OPJ A;  4ZTJ A;  3HP9 A;  1C1C A;  4O0J A;  5J1E A;  3HVR A;  5HP1 A;  2PZS A;  4KI4 A;  1RBS A;  1W9H A;  1RDD A;  3M8P A;  3HM9 A;  1U4B A;  4UQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...