4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
2ZQBA 5J2NA 4CESA 3U3GA 3MXIA 1UA0A 1MU2A 1ASUA 4DQRA 4KHUA 4Z4IA 3NF6A 2IOCA 1KRPA 1NK9A 3QNOA 2O4IA 3V1OA 1UA1A 3OYCA 3LAMA 3P83D 1Q9YA 1BHLA 1IKVA 1I3AA 1VSJA 3ITHA 1TAUA 1RDBA 1VSDA 2Z1IA 4CFCA 3DYAA 3OYAA 3NAEA 3ISNC 3V9XA 4KFBA 5HRRA 3PY8A 4CHQA 1C6VA 1S5JA 2E6MA 3K58A 1TV6A 4DTUA 2XY6A 4CGIA 4FJ8A 1TL1A 3LPUA 1YTAA 1B9DA 1YT3A 4CEDA 1VK0A 1G15A 3DRSA 4H4MA 4E7HA 3OYMA 1U47A 4B9NA 4B9SA 1JKHA 1C0UA 4DMNA 3AVJA 3VQDA 4RW7A 4DFKA 2HNDA 3KD5E 1J54A 3QLHA 4Z4GA 2QKBA 4B3OA 5FROA 4FJNA 1D9FA 1LAWA 1WSHA 1N5YA 1EP4A 3CYMA 4I9QA 1Z25A 1KFDA 2D0BA 1SL1A 3VQ7A 4R5PA 1ZYQA 1NK5A 4DFMA 5J2QA 3VQ4A 4CEBA 2GV9A 1WAFA 3ALYA 4KTWA 3LZIA 3OYHA 4ID5A 1GOBA 3KLEA 3OVNA 4CK1A 1NK8A 1EKEA 2EHGA 1HRHA 1X1PA 4CJSA 4M42A 3I8DA 1Y97A 1JLBA 3NGIA 4FJLA 3L2UA 2OPSA 3VQ8A 3ZSRA 3O3FA 2G8HA 2B5JA 1UAXA 2XO7A 1F21A 3AVNA 4DTNA 2B4JA 3AO1A 4NYFA 1QSLA 1NJZA 3KK3A 5HBMA 1RTJA 2BGGA 4CF1A 2RKIA 3V1RA 2FBTA 3OYEA 3ZSZA 3PO4A 4Z4CA 3D0PA 1B9FA 1WAJA 3HXMA 3QEXA 4DU3A 4KREA 3CG7A 4E1MA 2HMIA 1FKOA 5D3GA 3VQ5A 1RBRA 4CIFA 4ELTA 3PUFA 4KRFA 4BDYA 3MEDA 4IG3A 3LAKA 1TK8A 4LSNA 4CHOA 2JGUA 3PX6A 4FJMA 3HJFA 2VG6A 3DRPA 1S6QA 3E01A 4W5QA 1SKWA 1ZBHA 4FK4A 5C24A 3K5NA 4O0IA 1VSHA 3LWMA 4HUGA 4OPKA 4Q5VA 3RMDA 2HHSA 4BE0A 4FM2A 1W9HA 4PQUA 4O0JA 3CM5A 4TSXA 3QNNA 2OA8A 4FJXA 3ZSYA 1WSEA 4AHSA 4F2RA 4H8KA 1R0AA 3LP0A 3NGZA 4O44A 1Z26A 3VQPA 1LWFA 1QS4A 4CJ4A 4K8ZA 1DLOA 1UOCA 2RPIA 4GW6A 4CJWA 2DY4A 1U04A 3G0ZA 2ZD1A 4DSFA 3L2RA 3MXMA 4FJKA 2KQ2A 3LP1A 4DQQA 3THVA 1TKDA 4KTQA 4OLAA 3AVHA 1SUQA 2QXFA 4Y1CA 3V9ZA 1SKSA 4B9LA 4NYNA 3G10A 4I2PA 4EP5A 4N76A 2KZMA 1T05A 5SWMA 4FLUA 3AA5X 3LALA 4UQGA 3SQ4A 4IKFA 1UWBA 1HJRA 1S1TA 3ULDA 4PWDA 1QHTA 3VN5A 1NK4A 1QSSA 2XY8A 1FKPA 2X6SA 3K2PA 4KHSA 4B9MA 3AVFA 2HB5A 1EX4A 1RILA 4DU4A 4QOZB 1J9AA 4B9VA 4CJLA 1RT3A 3K5MA 1EETA 1S1WA 2HNYA 3ZSVA 5KRTA 4KB1A 3WNEA 3M8RA 4DSIA 1S1XA 1LWCA 4E89A 1SL0A 3HPGA 4FJHA 4C8OA 1XWLA 1RBUA 3DLGA 4Z0UA 1REVA 2PYJA 4ELUA 3D45A 2DFHA 1RT2A 2HHTA 1IKWA 1CZBA 3RR7A 4FZXC 3F9KA 3KKRA 1TK0A 4FVMA 4CHNA 2DFFA 1VSKA 3ZT3A 3DOKA 4CEOA 4FLTA 3KK2A 3TR8A 1BL3A 4FK2A 4NCBA 1LAVA 1KLNA 4B8CA 4LH4A 3V9WA 1HQUA 3QEPA 1KVAA 3DLKA 3QINA 3AV9A 3BGRA 4ELVA 3MXJA 4M3XA 2WOMA 3RR8A 4FJJA 1BCMA 3K59A 4Y1DA 1XHXA 2FBYA 1ZBLA 5JS2A 1RT1A 2YNIA 2KW4A 4DU1A 1BI4B 4CFBA 1HYZA 1BI4A 1KFSA 2HHQA 2KFZA 4E7JA 4W5RA 5HRSA 3QEIA 3KLFA 2I5JA 4JRPA 4N5SA 1RBTA 1B92A 3QIPA 4FJ7A 4B9UA 3WNFA 3BDPA 3TAEA 5T7BA 4M3YA 4FLVA 3TANA 2VWKA 1U49A 3PO5A 1DTTA 1VSEA 4M3WA 1L3VA 2R7YA 1KLMA 2A1SA 3ZT4A 4JRQA 4IG0A 3RTVA 4DTSA 4OGCA 1EXQA 3RMBA 3TAPA 1J53A 2IDOA 3VA0A 5J2PA 1BCOA 3AO4A 3L3UA 3T1AA 5E41A 1X9WA 1RDAA 4O55A 4JS5A 4C8KA 4M3ZA 4W5NA 4OPJA 2G8WA 4C8LA 2GUIA 4CHPA 5DMRA 4IFYA 3OYJA 4M45A 4OVLA 1BIUA 4MQ3A 4CIGA 3SJJA 1T7PA 5DK5A 4CJ5A 3U6FA 1VSMA 1K6YA 4EP4A 3V1QA 2HVHA 1L3SA 1HMVA 1RBSA 4CJUA 4HVJA 1LV5A 1D8YA 3KD1E 3VQBA 4DTJA 1SL2A 2G8FA 3DOLA 1ITGA 3OS1A 5HRNA 4CEFA 4FYDA 1SV5A 3C6UA 4W5TA 3CFPA 4DF4A 3IAYA 2DTUA 4CECA 4CK2A 3QEWA 2P51A 3VQCA 3PX4A 3AVIA 3C95A 3K5OA 3MAQA 4HTUA 4FLWA 2A1RA 2IS3A 1RBVA 2F96A 3AO5A 3HL8A 2B6AA 3V6DA 4KHQA 1TKXA 4F3TA 1BIZA 4CJKA 2QKKA 4DF8A 4M3TA 2G8KA 2YNHA 4CGFA 3DRRA 3S3MA 3SV4A 3LP2A 2YV0X 1HNVA 2KFNA 2HHVA 1TVRA 4CFAA 3IS9A 2PYLA 4JS4A 4AHVA 4Z4HA 4OJRA 3AO2A 5KGWA 1FK9A 1RTIA 3OYGA 4FCYA 1XI1A 4FM1A 3HPHA 3V81A 1CZ9A 3A2FA 3RWUA 2XY5A 3L2VA 1QQCA 4FM0A 1TK5A 4J2EA 3ZSQA 4FW2A 3LWLA 1RTHA 2YKMA 4IBNA 3VQAA 4E0DA 4LY7A 5J2MA 3NF8A 4C8NA 3AA4A 4KHNA 4CE9A 1W0HA 2X74A 4RW4A 3DLBA 1JLGA 2X6NA 3HVTA 4KTZA 4N47A 4RW9A 3OYBA 1KVCA 4J2BA 4KHWA 3I0SA 5SZTA 4KB0A 4ID1A 3ZSWA 3SV3A 3TAQA 3AVLA 3AVMA 4Q0BA 2ZE2A 1KSPA 1U45A 2G8UA 4FW1A 1WSIA 3DLEA 1QTMA 4FK0A 4FJ9A 2OZSA 3AA3A 1Q8IA 2HHUA 4FJGA 1S9GA 3OYDA 4DSKA 1VRTA 2PZSA 2P1JA 3TWHA 2PY5A 1TAQA 5KI6A 5KRSA 1CXUA 4DSEA 1VSIA 3SZ2A 2HNZA 3KK1A 1RT5A 2OPQA 5C25A 1DTQA 3KIOA 3LZJA 4CGHA 3KKSA 4FLYA 1IH7A 2RN2A 1JLQA 3HT3A 4CJVA 2OPRA 1NJWA 3KTQA 5CY4A 3VA3A 3TAFA 1L3TA 4KHYA 1XC9A 4K8XA 2ITGA 3AVBA 1ZBUA 3SI6A 2D0AA 2FBXA 5C42A 3SUNA 1NK6A 3SPYA 2ETJA 4FZYA 4O5BA 3OYIA 1WNSA 4OKJA 2HW3A 4ZTFA 2HHWA 4I9LA 1C0TA 2VG5A 4Z4EA 2E6LA 5K14A 4IDKA 4E19A 4BE1A 3OS0A 2D5RA 3KJVA 4J2AA 4WE1A 2IAJA 1IKXA 3CM6A 1WN7A 1IO2A 4CERA 3L2WA 3VQQA 4DS4A 3C94A 4LD0A 4CK3A 3OY9A 5HROA 1VRUA 4QAGA 2AJQA 2IC3A 3SQ0A 1WSFA 3TAMA 1XHZA 4BDPA 2W42A 2OYQA 1JL1A 4DQSA 3QO9A 4DG1A 3SQ1A 4I2QA 3NH2A 1GOCA 3IG1A 3UIQA 4KV8A 5FRNA 5HLFA 4NCAA 3DM2A 4PUOA 5CZ1A 4DQPA 2Z1JA 4H4OA 5J1EA 3KLHA 3NGYA 4OGEA 1C1AA 1S1VA 3SCXA 4AHTA 3NBPA 5KTQA 3AVGA 3P1GA 4FLXA 3SUPA 1WSGA 4O4GA 4F3OA 1HQEA 3OYLA 3I0RA 3WNGA 1WLJA 3DI6A 3HPOA 2BANA 3M8SA 3HVRA 3RMAA 1NK7A 3LANA 4GVMA 4I7FA 1JXEA 4E7IA 4LSLA 3SUQA 3HP6A 3M8PA 4CJFA 1RTDA 1TKTA 3OYFA 2G8VA 4M3UA 2QK9A 4CFDA 4CIEA 4AH9A 3OYKA 4DFJA 4ZTJA 1NOZA 3ZSOA 4IFVA 4BDZA 2X78A 3LP3A 3NF7A 4C8MA 1D9DA 5JS1A 2FBVA 4Z4FA 3VQ9A 1JXBA 3AA2A 3HO1A 1C1BA 1ZBFA 4CEZA 3NH1A 1N6QA 4KI6A 3PX0A 1HNIA 3TI0A 3S3OA 4ZHRA 1O1WA 1NOYA 1HYVA 2YHAA 5I3UA 3HK2A 4DSLA 2Y1IA 4J2DA 4MFBA 1ASVA 4B08A 4L8RB 1C1CA 3O3GA 4B9TA 4F4KA 4HCBA 1BQNA 4CF8A 2BE2A 3L2QA 1ASWA 3T19A 4HUFA 4FJIA 4FJ5A 1RCHA 4DLEA 1A5WA 3T3FA 3NH0A 3NFAA 1A5XA 3P5JA 1KTQA 3EZ5A 4CEQA 1A5VA 1JL2A 4XIUA 3PV8A 2OZMA 4EZ9A 2YNFA 3TAGA 2OPPA 4ICLA 3RMCA 4BWJA 3KLIA 1LW2A 4AILC 1VSLA 1S9EA 1NJYA 1LWEA 3K57A 4RW6A 2XRIA 1NKCA 1C0MA 1T8EA 4JLHA 4DQIA 3JSMA 3QETA 3JYTA 4KPYA 4PA1A 1LW0A 3HP9A 1NKBA 4NCGA 2KZZA 3SPZA 3SNNA 1D5AA 3H08A 3O4NA 4YFUA 3SUOA 2Q3SA 3DMJA 2GBZA 1L3UA 3MEGA 5KGXA 4CCHA 1TL3A 3ZSXA 2YNGA 3ZT0A 3B6OA 2O4GA 5HP1A 3ZT1A 2WONA 1FXXA 4RW8A 3OJUA 3ASMA 5FDLA 3V9SA 4BE2A 4FXDA 1JLAA 3QIOA 4DSJA 2G8IA 4AHRA 3HM9A 1NKEA 4HUEA 4HHTA 4B8AB 4YNQA 3KLGA 4DS5A 2KTQA 2Y1JA 1IKYA 3B6PA 4PY5A 4LH5A 2P5OA 4W5OA 4DTPA 4G1QA 4F8RA 2DFEA 2XHBA 4CJEA 2VWJA 1QSYA 1CLQA 3V9UA 4DTMA 1JLFA 5CYQA 4CF2A 3O4QA 3VQ6A 4E1NA 4E7KA 1RDDA 3CQ8A 3TABA 1U4BA 1NK0A 3K5LA 1NJXA 4BWMA 4E3SA 4DTXA 1JLCA 3LPTA 1Q9XA 1RNHA 1GOAA 2EX3A 3FFIA 3NE6A 4EZ6A 1RT4A 4CGJA 3C6TA 4GMJB 4N56A 1IG9A 4HCCA 1J5OA 3WNHA 3EYZA 2P5GA 4DTRA 1ZBIA 2HHXA 4DWIA 1JLEA 1RDCA 1I39A 5CZ2A 5EU7A 1QE1A 1YVUA 4CJ3A 1X9SA 1KVBA 5FRMA 4BACA 3IRXA 2ATQA 1BISA 1RT6A 2YKNA 3ZCMA 5HRPA 4CF9A 2HVIA 3RRGA 2NUBA 3OYNA 3ZT2A 2XY7A 4F2SA 1RT7A 2LSNA 3O3HA 3VQEA 3NDKA 4RG8A 3AO3A 3OJSA 3S3NA 3AVCA 1SKRA 4CHYA 1BQMA 2Z1GA 5CYMA 4AHCA 2JLEA 4DTOA 4DFPA 3MEEA 2D0CA 3SYZA 3QEVA 3MECA 4CHZA 1TGOA 3M8QA 3AVAA 4OKEA 3RRHA 3DLRA 1X9MA 2YHBA 2BDPA 3HSTB 4E7LA 3SQ2A 3NF9A 4N41A 4CJRA 4FLZA 3CFOA 2Z1HA 3U3YA 2VG7A 4KO0A 4M41A 3NHGA 3DLHA 4KAZA 3AVKA 4QCLA 1VSFA 3EY1A 3V4IA 1S6PA 1WSJA 1U48A 1YTUA 4CGGA 4OLBA 3S9HA 2E4LA 5I42A 4CEEA 3L8BA 4CF0A 4CJPA 3QERA 1BGXT 1S1UA 4AHUA 4CJTA 4OKKA 3HYFA 3OS2A 4FZZA 1HPZA 3NCIA 1T03A 4CJQA 2FC0A 3LDSA 4DLGA 3TARA 2IGIA 4M3RA 3QESA 1HYSA 2F8SA 4KKOA 4CGDA 2RF2A 1L5UA 4CEAA 3F73A 3L3VA 4KI4A 2F8TA 1TKZA 1KCFA 3CFRA 1CXQA
chains in the Genus database with same CATH superfamily
1UA0A 4Z4IA 3NF6A 2E2NA 1KRPA 3CJ7A 3THWB 3V1OA 2NRHA 1LCUA 3CCJN 1BHLA 1NM1A 5BN8A 5BRDA 3O9QA 4KFBA 5HRRA 1Q7YO 4NXNK 4CVNE 4CHQA 1C6VA 4DTUA 3PIPL 4IJNA 1YT3A 1B9DA 4B9SA 1U47A 1C0UA 5AQUA 4DFKA 2HNDA 1XQSC 3KD5E 3QLHA 4Z4GA 2QKBA 4GKJK 1D9FA 3CYMA 4CZKA 3O9RA 4BC3A 5KQDA 4DFMA 3I33A 3VQ4A 5E84A 3WXIA 4B1YB 4CK1A 2EHGA 1HRHA 4WQ4C 1JLBA 5AQHA 3OBYA 1NWKA 4BRKA 2B5JA 1F21A 3AVNA 3AO1A 1X3NA 1NJZA 2BGGA 3V1RA 2FBTA 1EO1A 4BRFA 3T69A 3ZSZA 4Z4CA 1T6DA 3I56N 3QEXA 3H6EA 4JI6K 5BN9A 4CIFA 3PUFA 2ZGYA 4I6MA 3MEDA 3LAKA 3A5NC 3GG4A 3LM2A 1KAZA 1S6QA 5AZIA 2I7PA 3K5NA 2HF4A 2I7NA 2NRTA 4YORA 4HUGA 4Q5VA 5C12A 3CM5A 3QNNA 1ZXOA 4AHSA 4JI7K 4BRLA 4F2RA 4H8KA 3U4LA 3CJ9A 4RCHA 4O44A 3VQPA 3FZLA 3VTIA 1QS4A 5JMVA 1DLOA 2RPIA 2DPNA 3CETA 2ZD1A 4FJKA 3L2RA 3MXMA 2KQ2A 4DQQA 4B9LA 3AAPA 3VGKA 2GUPA 4CZEA 3LALA 3THXA 4BRDA 4PWDA 1S1TA 3ULDA 1K8KB 3CCEN 4A61A 2XY8A 1FKPA 4KHSA 2Q2RA 2HB5A 1EX4A 4DU4A 4B9VA 1RT3A 2QI2A 4Y0WA 1Q82O 3WNEA 3LM9A 5I9EB 3M8RA 3QMLA 4IXCA 4E89A 4LF4K 5KQ8A 3ULEA 1RBUA 3DLGA 1GLFO 4A57A 2JWKA 2DFHA 5M1OA 4A2BA 4MLHA 3Q7BA 3F9KA 4FVMA 1RGIA 3VERA 1VSKA 3CCMN 4JD2A 4DR2K 1BL3A 2O8DA 3QEPA 3DLKA 3BGRA 3MXJA 4M3XA 3OW2M 1S22A 1HKCA 1ZBLA 4BRHA 3UKRB 4DU1A 3O9UA 1HYZA 1BI4A 4DQ8A 1KFSA 3CCQN 5HRSA 4K41A 4DB3A 2HHHK 5BPNA 1RBTA 3QDKA 2P9KA 3WNFA 4JKBA 4H0OA 3PO5A 3KK7A 3RTVA 2PFUA 4A5AA 1HNXK 2HBKA 5E41A 4C8KA 1RDAA 4O55A 4O8KA 4PHTX 4OPJA 5DMRA 3O4WA 1YJWN 5DK5A 3V1QA 2HVHA 1RBSA 4YOWA 3CCUN 3U9DA 1NU0A 2YJFA 4BRCA 2WFBA 1ITGA 4FYDA 4B3TK 1SV5A 2P9UB 4CECA 3O5BA 3K5OA 4HTUA 1RBVA 4ISGA 2D0PA 2CGKA 4F3TA 2QKKA 4DF8A 3E1YA 3SK3A 4M3TA 4IZ9A 1OH6A 4JK7A 3S3MA 3SV4A 4HWIA 4YY3K 2YV0X 3DXKA 2KFNA 2PYLA 1ATRA 1BO5O 2YHWA 3OYGA 1H1VA 3HPHA 3N4PA 3ZYYX 3A2FA 4FM1A 2XY5A 3ZSQA 4FW2A 3LWLA 4E0DA 4LY7A 1QVFM 3L6QA 3CXCM 2P9NA 1KVCA 5SZTA 3CMAN 4M7YA 3FZFA 3ZSWA 3AVMA 2ZE2A 2G8UA 4B1UB 4BGAA 1WSIA 4CZLA 3OYDA 3WXLA 2JWLA 2PY5A 4DSEA 2E1YA 5KRSA 1VSIA 2P9SA 4U7BA 3SZ2A 1NGFA 2HNZA 2WTUA 4LF6K 1QZ5A 4B1VA 4FLYA 1IH7A 4GY2B 1JLQA 3HT3A 4K43A 2OPRA 3ENHA 5CY4A 3TAFA 3M6GA 4OPHA 3AVBA 5FPDA 5BPLA 3HOTA 3SI6A 1OH5A 5C42A 4C1NI 3SUNA 1NK6A 5E26A 2QM1A 3OYIA 1WNSA 2BH1A 4CBUA 3O8MA 4Z4EA 4E19A 4DV7K 4WE1A 2IAJA 3CM6A 4JK8A 3MN9A 1FW6A 1VRUA 1X9JA 2O8FB 4H0VB 2W42A 3QFUA 2OYQA 5FRNA 3VEYA 2UUAK 4A5BA 4WCEL 4JI2K 4AHTA 4LC9B 1WSGA 5C0YA 2ASMA 3D7EO 3OYLA 1K9MO 3HVRA 3RMAA 1VQ5N 3M8PA 1GLBG 1TKTA 2QK9A 3NVMA 3CF5L 4DFJA 3P31A 3NVKA 1NOZA 1QHAA 3ZSOA 1D9DA 5JS1A 1XC3A 4PKIA 3EEQA 1R59O 3EN9A 3VQ9A 1C1BA 3TI0A 1O1WA 4JKAA 1HYVA 5AFUA 5I3UA 1N34K 2Q0UA 2Y1IA 1WBDA 1ASVA 1C1CA 4CBXA 2ASOA 3F2KA 4K0KK 2FF6A 4DLEA 3NH0A 1A5XA 1KTQA 1GLDG 1Y64A 3PV8A 1BU6O 3KZBA 2OPPA 3G4SN 4AILC 3ENBA 2UUBK 4LFCK 4JI5K 1LWEA 1GLEG 4EIAA 4JKEA 5JVHL 2E1ZA 1LW0A 3O08A 1NKBA 1YHQN 3RVCA 2ZJPL 3ZX0A 3TU5A 4LF5K 3O4NA 3OA9A 4WFAL 2Q3SA 1L3UA 5AQSA 4CCHA 1TL3A 2YNGA 4E1JA 5HP1A 1WB9A 4RW8A 3BY5A 3OJUA 3P38A 5FPMA 4DSJA 2G8IA 1NKEA 3HM9A 1VQ8N 4LH5A 4NO7A 3WXKA 4WYBA 4DTPA 3SMSA 1QSYA 2E2QA 1JLFA 4CF2A 3TABA 1U4BA 1NK0A 4KHPK 2F9TA 4DTXA 1Q9XA 1RNHA 1GOAA 1RT4A 2P9PA 3C6TA 4GMJB 4HCCA 3EYZA 2HHXA 1RDCA 1I39A 5BR9A 3SAHA 1TYQB 2E2PA 1X9SA 3VEWA 5BR8K 4BREA 2ATQA 1EWRA 4BC2A 1VQON 3D6RA 3O3HA 3VQEA 3NDKA 3FZHA 3QB0A 1BQMA 5BRFA 4DTOA 1YIJN 3G25A 1J5EK 3MEEA 4DR4K 3MECA 4KH5A 3M8QA 3RRHA 5AQGA 2YHBA 1N36K 3VTHA 4E7LA 4FLZA 1XNRK 3H45C 4JHDB 3O6WA 3NHGA 3AVKA 3BF1A 5M1PA 1YTUA 1WSJA 2E4LA 5I42A 3AGKA 5AQVA 5LMUK 5F0XA 3QFPA 3CC7N 4IOXA 5FLXO 4CJQA 2FC0A 3LDSA 3TARA 4WFNL 3QESA 1HYSA 4CJ7A 4CGDA 2ZJRL 2RF2A 3F73A 3L3VA 3LDQA 4IEIA 1E4FT 1TKZA 4CZMA 1NJIO 1CXQA 2ZQBA 3GOIA 4CESA 3U3GA 4KHUA 3OYCA 3P83D 3THWA 1WUAA 5AQWA 1VSDA 4CFCA 4PL7A 3ISNC 3V9XA 4BVOA 3WEEB 1S5JA 2F8SA 4WQ5A 1TV6A 2GEMA 4FJ8A 3LPUA 4BR9A 4G9ZA 1YTAA 2IVNA 4CEDA 1YI2N 1VK0A 4PKHA 4E7HA 4B9NA 3AVJA 5KPTA 3VQDA 1YITN 5AQFA 4BRIA 4MO4A 5KPRA 2D0BA 1SL1A 3BEXA 4CEBA 2GV9A 3DXMB 4C1NK 3LZIA 3THYB 1GOBA 3KLEA 2AP1A 2YJEA 4CJSA 4M42A 3BZCA 3I8DA 1Y97A 3ZLJA 3VQ8A 3K0SA 4MDBA 1UAXA 2XO7A 1VHXA 4DTNA 2B4JA 3ID8A 5HBMA 3TSPA 1RTJA 3PO4A 1U2VB 4MLEA 1XMQK 1B9FA 5CHIA 4KREA 3CG7A 4E1MA 2HMIA 3HBTA 4WQ4A 1Z6RA 2JGUA 3LDPA 1NGAA 3HJFA 3DJCA 1SKWA 4FK4A 4ILHA 3I55N 2HHSA 3VF4A 5M1FA 5H1SQ 4BE0A 4X62K 1W9HA 4DCHA 1NNEA 3MK6A 2OA8A 1R0AA 3LP0A 1Z26A 4MDAA 4CJ4A 4GW6A 3G0ZA 4DSFA 3LP1A 3THVA 4YDUA 3AVHA 1SUQA 5MLCQ 4NYNA 1LOTB 3EKSA 1XUPO 4I2PA 4EP5A 1QQMA 1T05A 3HSCA 4GVEA 3AA5X 4FLUA 1VQLN 1UWBA 1W2BM 3BP8A 2IVOA 2BUPA 1QSSA 4DUYK 1K8KA 4XH4A 4B9MA 4YOVA 4IOAL 4ILGB 4CJLA 3J80O 1S1WA 3EE8A 4KB1A 3R6MA 1LWCA 2OCEA 1SL0A 1JCEA 4FJHA 4DV2K 5LL6Z 4AM7A 4DR3K 3D45A 1RT2A 2HHTA 3KKRA 1VQKN 3TSUA 4FLTA 3KK2A 5GINA 1VQ9N 4NCBA 3PSFA 3V9WA 1HQUA 3C7NB 1KVAA 5AZJB 4WQ5C 3RR8A 4FJJA 2H3GX 4Y1DA 2FBYA 5AQXA 1RT1A 2YNIA 3AAQA 4DR1K 4CFBA 3UKRA 1EQYA 3ID6A 3W0LA 4E7JA 1KQSM 2I5JA 4H0PA 1B92A 3QIPA 4M7XA 4R79A 2GX9A 4FLVA 3TANA 4M3WA 3ZT4A 1NBWA 1J53A 3AO4A 2ASPA 1X9WA 3T1AA 4CBWA 2GUIA 2AA4A 3CJBA 4M45A 4CIGA 3SJJA 3UKUB 1HMVA 4BR7A 4CJUA 1BA0A 4BRMA 2D4WA 2G8FA 2GTDA 3CQYA 3DOLA 3OS1A 2E5LK 4DF4A 2P9UA 3VQCA 3C95A 2QWLA 3MAQA 4EAHD 3HL8A 2B6AA 3CCSN 4KHQA 4UY8O 4CJKA 2YNHA 4AF1A 4CGFA 3DRRA 3SAFA 2O8BB 4DKWA 2HBJA 2HHVA 4CFAA 4AHVA 5ELZA 4Z4HA 1FK9A 1RTIA 3ZETB 4DV0K 4FCYA 4YDUC 3O9SA 2Q1NA 3RWUA 4FM0A 4YOYA 2HBLA 4KH6A 5J2MA 3M1FA 3NF8A 3AA4A 3G71N 1W0HA 2X74A 3DLBA 1JLGA 2X6NA 4N47A 3OYBA 1TUYA 3TPQA 3I0SA 5AQOA 4FVUA 3VGMA 2ZM6K 3SV3A 3TAQA 3SBTA 4JAXA 3SMPA 4FW1A 2OZSA 2PBDA 3AA3A 1S9GA 4DSKA 1VRTA 4PKGA 1CXUA 1C0FA 2YHXA 3KK1A 1RT5A 2OPQA 1DTQA 2P9LB 4CJVA 3AGRA 3VA3A 1XC9A 4DR7K 1ZBUA 1S3XA 2FBXA 3PSIA 2ETJA 4FZYA 4ISEA 4I9LA 1C0TA 2VG5A 4BE1A 4DV4K 3VEOA 3MWPA 1HR0K 1IKXA 1WN7A 1IO2A 2P9IA 4IEEA 3AY9A 3VQQA 3L2WA 3C94A 4LD0A 1NGHA 4CK3A 3DWLA 4BDPA 4DQSA 1ATNA 3SQ1A 2O8FA 4I2QA 3NH2A 3IG1A 3UIQA 4KV8A 4NCAA 5CZ1A 4H4OA 1V4TA 2QXLA 5TKYA 2Q97A 1IBLK 3NGYA 1S1VA 4ILJA 3BUZB 4BC4A 3AVGA 3SUPA 1SAZA 2BANA 1P8ZA 1QZ6A 3LANA 4JNEA 4M3UA 2G8VA 1MA9B 4DHYA 4AH9A 4IFVA 4C8MA 1HNZK 4BRPA 3AA2A 3S3OA 4ZHRA 5B8HA 4AQYK 4B1WB 3HK2A 4J2DA 4MFBA 4B08A 4LFAK 3O3GA 4B9TA 4IO8A 4O5FA 2BE2A 1IV0A 3L2QA 1VQ4N 3P5JA 1JL2A 1U6ZA 2HBMA 4EZ9A 1KD1O 4ICLA 4BRQA 1LW2A 3LL3A 4B9QA 3GDQA 3K57A 3H3OB 4M63C 3CPWM 1MWMA 1T44A 1C0MA 3MN6A 4F9OA 3QETA 2ZJQL 4JI3K 3VOVA 4IOCL 3TTFA 4KPYA 3FR0A 4NCGA 3SPZA 3SNNA 5LJVA 3DMJA 5JVGL 2ZGZA 3O1WA 1WOQA 3B6OA 3ZT1A 2WONA 1N32K 1T6CA 1FXXA 4DR5K 3V9SA 5FDLA 3M5RA 4PL8A 1W7AA 4IWVA 2KTQA 3FE1A 3B6PA 4W5OA 2DFEA 2VWJA 4CJEA 4E7KA 4E1NA 3MWTA 3K5LA 1DEJA 4BWMA 2QW9A 4E3SA 4JK9A 4EZ6A 3A5LC 2QA4N 4BR5A 3VENA 2BTFA 3H46O 1S72N 3ENOA 1IG9A 3E66A 3IMXA 5AQYA 4CD1A 4DTRA 1EWQA 4DWIA 1JLEA 5AR0A 3U8XA 1QE1A 3CC4N 3QBXA 4CJ3A 5FRMA 1TYQA 3SJHA 3IRXA 1RT6A 3ZCMA 3SLCA 2EWSA 3RRGA 3C0BA 3ZT2A 2XY7A 1RT7A 4LF7K 3S3NA 5FPEA 3EL2A 3ZEUB 4XH1A 4CHYA 4AHCA 4DFPA 2JLEA 2D0OA 2P9IB 1GLCG 3QEVA 1TGOA 3AVAA 3HSTB 4JKHA 2NLXA 2Q0RA 4N41A 1NGEA 2HF3A 4YHHK 3KWIA 2VG7A 3VGLA 4JHDA 3DLHA 4QCLA 3MX5A 3EKUA 1GLJO 4JKGB 4CGGA 5GIOA 4OLBA 5AQIA 4CEEA 3L8BA 3T1HK 1IBMK 2HOEA 4FWNA 4OKKA 3NCIA 5C2DA 4KKOA 1L5UA 1RDUA 2QWRA 4GKKK 2D1KA 3MXIA 1MU2A 5BREA 1ASUA 4DV1K 3WUHA 2IOCA 3LAMA 5C2FA 4A59A 2NRVA 1X3MA 3ITHA 1TAUA 2Z1IA 5GAEP 3PIOL 3FLCO 3PY8A 3O80A 4KBOA 2E6MA 1YVNA 2XY6A 3WEEA 4CGIA 1TL1A 3A0IX 3LDLA 5AQNA 2FXUA 1G15A 4H4MA 3OYMA 2IIRA 1JCGA 1JKHA 4DMNA 1VQ6N 4RW7A 2O8CB 1J54A 4B3OA 1NGGA 4FJNA 1WSHA 1EP4A 4I9QA 1YAGA 1KFDA 3VQ7A 4BQZA 1ZYQA 4BR2A 3TTDA 1NGJA 1WAFA 3ALYA 3DXMA 4KTWA 4ID5A 3OVNA 1NK8A 3THYA 1X1PA 3VEVA 3N4QA 3PLAA 3ZSRA 2A6AA 3IUCA 1G99A 1QSLA 1V4SA 3OHRA 5A2QO 3HI0A 1M90O 1NMDA 1CZAN 5JLFA 3SAGA 3OYEA 4DU3A 1U2VA 4FWPA 3CI5A 5D3GA 3VQ5A 1RBRA 1ILYA 1HKBA 1GLAG 1KXPA 4BDYA 1ESVA 1TK8A 4LSNA 4CHOA 4JKCA 4LF9K 2VG6A 3DRPA 4W5QA 1ZBHA 3NMUA 5EXWA 2GELA 3RMDA 4FM2A 2HMPA 4O0JA 4FJXA 3ZSYA 4BG8A 2PAVA 2RHKA 2RE2A 1UOCA 4CJWA 2DY4A 4IDHA 4NLBA 4H5NA 3T7ZA 1SZ2A 1TKDA 4KTQA 1M1KO 4Y1CA 4OLAA 2QXFA 4GV6A 4N76A 2KZMA 2A42A 5SWMA 3SQ4A 4NXMK 4CI6A 1HJRA 1VQMN 1QHTA 1NK4A 2V51B 2E8AA 3AVFA 3I8BA 2V52B 1J9AA 1I94K 2HNYA 3ZSVA 1S1XA 3HPGA 4X65K 1XWLA 4ELUA 3RR7A 4FZXC 3T1YK 3ZT3A 3DOKA 3HOSA 3BF3A 2CH6A 4FK2A 2HSTA 1LAVA 3L4IA 3AV9A 3C7NA 4NLCA 5AZJA 4ELVA 2UXCK 4B1ZA 4FL9A 1XHXA 5FPNA 2HHQA 1OVQA 1KAXA 3G6EN 4FJ7A 3HTVA 5T7BA 4M3YA 1Q18A 2F9WA 1DTTA 5F2RA 4JI4K 1L3VA 4QOZB 2A1SA 4JRQA 4DTSA 3MCAB 4IG0A 4MO5A 4OGCA 1EXQA 2KKZA 1BG3A 5GAHP 3TAPA 3EO3A 2IDOA 5KPZA 3VA0A 5J2PA 2UUCK 3ATVA 1W97L 1HUXA 4IFYA 1N33K 1BIUA 1T7PA 3U6FA 1VSMA 3UKUA 3MCPA 4EP4A 1DT9A 4HVJA 1LV5A 4DTJA 1SL2A 2CH5A 5HRNA 4CEFA 3VMFB 4W5TA 3CFPA 3IAYA 2DTUA 3C6HA 5EX5A 4FPBA 4CK2A 2P51A 3PX4A 1OVYA 3AVIA 5ADXA 5EY4A 4A2AA 4FLWA 3OBWA 5AFUH 2IS3A 2F96A 3AO5A 5JICA 3V6DA 1TKXA 3CMEN 3WT0A 5BRHA 2OTLN 4J8FA 3LP2A 2O8BA 4JI1K 3MMVA 4BRGA 4JS4A 5M1QA 3CCRN 4BVPA 4OJRA 3AO2A 4CZHA 3ZETA 3V81A 1CZ9A 4BRNA 3B8AX 3L2VA 1QQCA 2YKMA 4DUZK 4BR4A 4C8NA 4KHNA 4CE9A 3QBWA 3L4QA 4RW4A 4KTZA 4J2BA 2FLOA 4KHWA 4KB0A 3UB5A 2NRXA 2VCPA 2YI1A 4ID1A 3AVLA 1KSPA 1U45A 4B3SK 3DLEA 4FJ9A 4FK0A 4X66K 1HKGA 2PZSA 3TWHA 5C10A 1TAQA 3WXMB 3KWGA 4CZJA 1RDWX 4O8UA 1KC8O 4QS8A 3KIOA 2RN2A 3KTQA 3GL1A 2P9LA 3UE5A 3HM8A 2D0AA 3SPYA 3M3ZA 3E9PA 1OH7A 4OKJA 2HHWA 2E6LA 3U9ZA 4IDKA 5AQZA 3OS0A 3VEZA 2D5RA 4J2AA 4CERA 3OY9A 3VETA 3SQ0A 1WSFA 3TAMA 5LJWA 1JL1A 3QO9A 4DG1A 3R1XA 2VWBA 3DM2A 3P4IA 4PUOA 2Z1JA 3KLHA 1C1AA 1NGIA 3RSEB 1Q81O 3C6AA 5IT9O 4FLXA 1K73O 1SS6A 4F3OA 3HPOA 1WLJA 3C65A 1NK7A 4GVMA 4LSLA 3HP6A 2W6KA 4WFBL 1JJ2M 2UYTA 3OYFA 1RTDA 4CFDA 4CIEA 3OYKA 4H5RA 4BDZA 2X78A 3LP3A 3NF7A 1JXBA 3IFRA 3HO1A 4FWQA 3NH1A 3A8YA 1WBBA 4KI6A 1NOYA 3WXJA 2ITMA 4JKFA 3OTOK 4FSVA 4L8RB 1ATSA 4H5TA 4HCBA 4CF8A 2A3ZA 3JAMO 3F9MA 1ASWA 4HUFA 4FJIA 1RCHA 1A5WA 2WUSA 3NFAA 3EZ5A 2OTJN 2QWQA 3CHWA 2OZMA 3TAGA 3RMCA 1XNQK 4BWJA 4U67L 3KLIA 1S9EA 5CE3A 1NJYA 2A41A 2XRIA 3D2FB 3JSMA 5AQTA 3JYTA 1BOTO 3HP9A 3CIPA 2GWKA 3H08A 3MX2A 3SUOA 2GBZA 5M1KA 2O4GA 3HRGA 2FSNA 4GV9A 4DV6K 4HHTA 4YNQA 4HUEA 1IKYA 3K9KA 4PY5A 4F8RA 2XHBA 1CLQA 3D2EB 3VPZA 1VQ7N 1J6ZA 5ADXH 2CGLA 5CYQA 3O4QA 3VQ6A 3E9LA 1NJXA 1JLCA 2EX3A 3NE6A 1E4GT 2O8EB 4N56A 3DLLL 5HL7L 5IWAK 3WNHA 2P5GA 1ZBIA 4H03B 5CZ2A 5EU7A 4BACA 1MWKA 2E2OA 3O9TA 1BISA 4GV3A 2YKNA 2NUBA 2NRWA 5LY3A 2LSNA 3AO3A 3OJSA 3AVCA 3VF2A 4CZFA 2UU9K 2Z1GA 3ZEUA 2FSKA 1X9MA 3DLRA 3E9OA 3NF9A 4CJRA 4H0XB 4WF9L 3CFOA 1YXQA 4M41A 5AQMA 1VSFA 3EY1A 3V4IA 3K9JA 4XEIA 1ZC6A 4JKGA 1XMOK 4CJPA 3QERA 1BGXT 1S1UA 4AHUA 3HYFA 4FZZA 3TSQA 1HPZA 3H3NO 1T03A 3J7YP 3AARA 4RTFD 3EZWA 4M3RA 5BPMA 1KAYA 1GLLO 3W3DA 4KI4A 3CFRA 4JRPA 5J2NA 4DQRA 4EHUA 4FPAA 1NK9A 3QNOA 2O4IA 1UA1A 1Q86O 2E20A 1Q9YA 3HZ6A 1IKVA 3MN5A 1I3AA 1VSJA 2QWMA 1RDBA 3NAEA 3DYAA 3OYAA 2NZTA 4LFBK 3K58A 4B3MK 4CZIA 3DRSA 1NLVA 4JYAK 2VGNA 2O8CA 3FGUA 5FROA 1LAWA 1N5YA 1Z25A 4Z94A 4JKDA 2QWPA 4R5PA 1NK5A 5J2QA 3L0QA 3OYHA 3GBTA 1EKEA 1K8AO 2V7ZA 4JEPA 4FJLA 3NGIA 3L2UA 2OPSA 4BRAA 1IJJA 3CD6N 3CCLN 3O3FA 2G8HA 4NYFA 2ZWHA 3IDHA 3KK3A 4CF1A 2RKIA 5HOOA 3VF6A 4EFHA 1DKGD 3D0PA 1WAJA 3HXMA 1FKOA 4I6MB 4ELTA 2F7TA 4KRFA 4IG3A 3CERA 3CQXA 5AQKA 3PX6A 4FJMA 3E01A 5AZIB 5C24A 4O0IA 1VSHA 3ATUA 3LWMA 4OPKA 2CGJA 3S41A 4PQUA 4TSXA 1NGDA 3Q7CA 3CPEA 1WSEA 3NGZA 4K8ZA 1LWFA 3BZKA 4FWSA 1U04A 5GADP 3VESA 3V9ZA 1SKSA 3G10A 2Q36A 3THXB 4UQGA 4IKFA 3VN5A 2X6SA 3K2PA 2W6LA 3J8AA 1RILA 2W40A 3K5MA 1EETA 4EHTA 4DR6K 5AQJA 1HPMA 5KRTA 2F4VK 4DSIA 5GAGP 3ULEB 4C8OA 4Z0UA 1REVA 2PYJA 4XH5A 2IVPA 2QWNA 1IKWA 1CZBA 2ZF5O 1TK0A 4CHNA 1T3VA 2DFFA 4JD2B 4CEOA 4OPAA 4V19S 3TR8A 2O8DB 1KLNA 4B1XB 4B8CA 4LH4A 3QINA 1C0GA 2WOMA 1BCMA 3K59A 3MDQA 2Q31A 5JS2A 2KW4A 1BI4B 3FZKA 3P39A 4BGBA 2KFZA 4K25A 4W5RA 1HNWK 3QEIA 3KLFA 3A5OC 4N5SA 2P9KB 1SQKA 4B9UA 3BDPA 4BQLA 3TAEA 3FFKB 1U49A 2VWKA 5AQLA 1VSEA 2R7YA 1KLMA 3RMBA 2UXBK 3CC2N 1BCOA 2FSJA 4JI8K 4YOXA 1VQNN 3L3UA 4W5NA 4JS5A 4M3ZA 4C8LA 2G8WA 4CHPA 4IO9L 3OYJA 4OVLA 4MQ3A 3H1QA 4CJ5A 2VQFK 1K6YA 1L3SA 1D8YA 2UXDK 3KD1E 3VQBA 4FWKA 3C6UA 1QQNA 3H1VX 4JV5K 3QEWA 3J81O 1BA1A 2J4RA 3VEXA 3J7ZO 2A1RA 4YOUA 4FWMA 3CJ1A 3J7AP 5EOYA 1BIZA 2G8KA 3TTCA 4GNIA 3JS6A 4QS7A 3DXKB 3QICA 1HNVA 1TVRA 3IS9A 2VGMA 1BWFO 4FWOA 5DM7L 4FWRA 5KGWA 2E88A 4ISFA 4CZGA 1XI1A 3DAWA 1TK5A 4J2EA 1RTHA 4IBNA 4JI0K 3VQAA 2P9NB 1N8RO 3HVTA 4RW9A 2VQEK 3KVGA 4H0YB 3MN7A 3ZX3A 4Q0BA 4H0TB 4QS9A 3JXUA 1QTMA 1HX1A 1Q8IA 2HHUA 1NMNA 4FJGA 1BUPA 2P1JA 2P9SB 5KI6A 1DGKN 5AQRA 4BROA 1OH8A 5C25A 3LZJA 4CGHA 3KKSA 3ZX2A 1NJWA 2V7YA 3SBGA 5LMNK 1L3TA 4KHYA 4CD3A 4K8XA 2ITGA 3CJAA 2QWOA 4IFEA 3LDOA 4LF8K 2NRZA 4O5BA 2HW3A 4ZTFA 5JLHA 5K14A 4OX9K 3LDNA 1P90A 3KJVA 4DV3K 4DS4A 5HROA 2AJQA 4QAGA 4FOIA 2IC3A 1MDUB 1XHZA 1GOCA 4BR0A 1O13A 5HLFA 4DQPA 5J1EA 1HLUA 4FO0A 4OGEA 3SCXA 3NBPA 5KTQA 3P1GA 3RSEA 4O4GA 1FJGK 3CJCA 1HQEA 1QVGM 3I0RA 5GIPA 3WNGA 3M8SA 3DI6A 4I7FA 1JXEA 4E7IA 3KHYA 3SUQA 4CJFA 3A5MC 4ZTJA 2OANA 3FZMA 4RWTA 2FBVA 4Z4FA 4YOTA 4L3QA 4NB4A 1ZBFA 4CEZA 1N6QA 5CR4A 1HNIA 3PX0A 1IBKK 2YHAA 2YCHA 1Z05A 4DSLA 4B3RK 1HJOA 2WBNA 4F4KA 3R9PA 1BQNA 3T19A 4FJ5A 3T3FA 4CEQA 5AQQA 1A5VA 4K42A 4XIUA 2YNFA 1RFQA 3F5TA 1BDGA 1VSLA 4RW6A 1NKCA 1YJ9N 1T8EA 4JLHA 4DQIA 3D2FA 4H5VA 4PA1A 4IJAA 2KZZA 1D5AA 1QQOA 3WQTA 4YFUA 3MEGA 5KGXA 3ZSXA 3ZT0A 2QTDA 1D4XA 2NNWA 2WC9A 1NGBA 3ASMA 4KH4A 4BE2A 4FXDA 1JLAA 3QIOA 3EE9A 4AHRA 5M1NA 4BG9A 4B8AB 3KLGA 4DS5A 2Y1JA 2P5OA 4A62A 4G1QA 3V9UA 4DTMA 3D2EA 1ZBSA 5C15A 1RDDA 3CQ8A 2VYPA 3GE1A 1IG8A 3LPTA 3FFIA 2P9PB 2FF3B 3R8EA 2A40A 2YHYA 4CGJA 2O8EA 1J5OA 4CW7B 2YX6A 2KHOA 4X64K 1YVUA 1KVBA 4DV5K 1TUUA 1JCFA 1YF5L 4BY9C 5AQPA 5TKWA 5HRPA 4CF9A 2HVIA 4H5WA 3OYNA 1VQPN 5EVZA 4OO1J 3IKMA 4F2SA 5DM6L 4AM6A 4RG8A 2KLAA 1SKRA 1NG9A 5CYMA 4JN4A 4FWLA 2GWJA 2D0CA 3SYZA 1NGCA 4CHZA 4OKEA 2W41A 2BDPA 4FOEA 3SQ2A 4HTLA 2A5XA 2Z1HA 3U3YA 4KO0A 2NRRA 4KAZA 5AJ3K 3WQUA 1U48A 1S6PA 1VAZA 3R3LA 1E3MA 3S9HA 1OKJA 4CF0A 2QEXN 4CJTA 3OS2A 4DLGA 4BC5A 2IGIA 4CEAA 3O1BA 1YJNN 4C23A 5F1XA 3CCVN 1KCFA 2F8TA 1YUWA
chains in the Genus database with same CATH topology
2ZQBA 5J2NA 4CESA 3U3GA 3MXIA 1UA0A 1MU2A 1ASUA 4DQRA 4KHUA 4Z4IA 3NF6A 2IOCA 1KRPA 1NK9A 3QNOA 2O4IA 3V1OA 1UA1A 3OYCA 3LAMA 3P83D 1Q9YA 1BHLA 1IKVA 1I3AA 1VSJA 3ITHA 1TAUA 1RDBA 1VSDA 2Z1IA 4CFCA 3DYAA 3OYAA 3NAEA 3ISNC 3V9XA 4KFBA 5HRRA 3PY8A 4CHQA 1C6VA 1S5JA 2E6MA 3K58A 1TV6A 4DTUA 2XY6A 4CGIA 4FJ8A 1TL1A 3LPUA 1YTAA 1B9DA 1YT3A 4CEDA 1VK0A 1G15A 3DRSA 4H4MA 4E7HA 3OYMA 1U47A 4B9NA 4B9SA 1JKHA 1C0UA 4DMNA 3AVJA 3VQDA 4RW7A 4DFKA 2HNDA 3KD5E 1J54A 3QLHA 4Z4GA 2QKBA 4B3OA 5FROA 4FJNA 1D9FA 1LAWA 1WSHA 1N5YA 1EP4A 3CYMA 4I9QA 1Z25A 1KFDA 2D0BA 1SL1A 3VQ7A 4R5PA 1ZYQA 1NK5A 4DFMA 5J2QA 3VQ4A 4CEBA 2GV9A 1WAFA 3ALYA 4KTWA 3LZIA 3OYHA 4ID5A 1GOBA 3KLEA 3OVNA 4CK1A 1NK8A 1EKEA 2EHGA 1HRHA 1X1PA 4CJSA 4M42A 3I8DA 1Y97A 1JLBA 3NGIA 4FJLA 3L2UA 2OPSA 3VQ8A 3ZSRA 3O3FA 2G8HA 2B5JA 1UAXA 2XO7A 1F21A 3AVNA 4DTNA 2B4JA 3AO1A 4NYFA 1QSLA 1NJZA 3KK3A 5HBMA 1RTJA 2BGGA 4CF1A 2RKIA 3V1RA 2FBTA 3OYEA 3ZSZA 3PO4A 4Z4CA 3D0PA 1B9FA 1WAJA 3HXMA 3QEXA 4DU3A 4KREA 3CG7A 4E1MA 2HMIA 1FKOA 5D3GA 3VQ5A 1RBRA 4CIFA 4ELTA 3PUFA 4KRFA 4BDYA 3MEDA 4IG3A 3LAKA 1TK8A 4LSNA 4CHOA 2JGUA 3PX6A 4FJMA 3HJFA 2VG6A 3DRPA 1S6QA 3E01A 4W5QA 1SKWA 1ZBHA 4FK4A 5C24A 3K5NA 4O0IA 1VSHA 3LWMA 4HUGA 4OPKA 4Q5VA 3RMDA 2HHSA 4BE0A 4FM2A 1W9HA 4PQUA 4O0JA 3CM5A 4TSXA 3QNNA 2OA8A 4FJXA 3ZSYA 1WSEA 4AHSA 4F2RA 4H8KA 1R0AA 3LP0A 3NGZA 4O44A 1Z26A 3VQPA 1LWFA 1QS4A 4CJ4A 4K8ZA 1DLOA 1UOCA 2RPIA 4GW6A 4CJWA 2DY4A 1U04A 3G0ZA 2ZD1A 4DSFA 3L2RA 3MXMA 4FJKA 2KQ2A 3LP1A 4DQQA 3THVA 1TKDA 4KTQA 4OLAA 3AVHA 1SUQA 2QXFA 4Y1CA 3V9ZA 1SKSA 4B9LA 4NYNA 3G10A 4I2PA 4EP5A 4N76A 2KZMA 1T05A 5SWMA 4FLUA 3AA5X 3LALA 4UQGA 3SQ4A 4IKFA 1UWBA 1HJRA 1S1TA 3ULDA 4PWDA 1QHTA 3VN5A 1NK4A 1QSSA 2XY8A 1FKPA 2X6SA 3K2PA 4KHSA 4B9MA 3AVFA 2HB5A 1EX4A 1RILA 4DU4A 4QOZB 1J9AA 4B9VA 4CJLA 1RT3A 3K5MA 1EETA 1S1WA 2HNYA 3ZSVA 5KRTA 4KB1A 3WNEA 3M8RA 4DSIA 1S1XA 1LWCA 4E89A 1SL0A 3HPGA 4FJHA 4C8OA 1XWLA 1RBUA 3DLGA 4Z0UA 1REVA 2PYJA 4ELUA 3D45A 2DFHA 1RT2A 2HHTA 1IKWA 1CZBA 3RR7A 4FZXC 3F9KA 3KKRA 1TK0A 4FVMA 4CHNA 2DFFA 1VSKA 3ZT3A 3DOKA 4CEOA 4FLTA 3KK2A 3TR8A 1BL3A 4FK2A 4NCBA 1LAVA 1KLNA 4B8CA 4LH4A 3V9WA 1HQUA 3QEPA 1KVAA 3DLKA 3QINA 3AV9A 3BGRA 4ELVA 3MXJA 4M3XA 2WOMA 3RR8A 4FJJA 1BCMA 3K59A 4Y1DA 1XHXA 2FBYA 1ZBLA 5JS2A 1RT1A 2YNIA 2KW4A 4DU1A 1BI4B 4CFBA 1HYZA 1BI4A 1KFSA 2HHQA 2KFZA 4E7JA 4W5RA 5HRSA 3QEIA 3KLFA 2I5JA 4JRPA 4N5SA 1RBTA 1B92A 3QIPA 4FJ7A 4B9UA 3WNFA 3BDPA 3TAEA 5T7BA 4M3YA 4FLVA 3TANA 2VWKA 1U49A 3PO5A 1DTTA 1VSEA 4M3WA 1L3VA 2R7YA 1KLMA 2A1SA 3ZT4A 4JRQA 4IG0A 3RTVA 4DTSA 4OGCA 1EXQA 3RMBA 3TAPA 1J53A 2IDOA 3VA0A 5J2PA 1BCOA 3AO4A 3L3UA 3T1AA 5E41A 1X9WA 1RDAA 4O55A 4JS5A 4C8KA 4M3ZA 4W5NA 4OPJA 2G8WA 4C8LA 2GUIA 4CHPA 5DMRA 4IFYA 3OYJA 4M45A 4OVLA 1BIUA 4MQ3A 4CIGA 3SJJA 1T7PA 5DK5A 4CJ5A 3U6FA 1VSMA 1K6YA 4EP4A 3V1QA 2HVHA 1L3SA 1HMVA 1RBSA 4CJUA 4HVJA 1LV5A 1D8YA 3KD1E 3VQBA 4DTJA 1SL2A 2G8FA 3DOLA 1ITGA 3OS1A 5HRNA 4CEFA 4FYDA 1SV5A 3C6UA 4W5TA 3CFPA 4DF4A 3IAYA 2DTUA 4CECA 4CK2A 3QEWA 2P51A 3VQCA 3PX4A 3AVIA 3C95A 3K5OA 3MAQA 4HTUA 4FLWA 2A1RA 2IS3A 1RBVA 2F96A 3AO5A 3HL8A 2B6AA 3V6DA 4KHQA 1TKXA 4F3TA 1BIZA 4CJKA 2QKKA 4DF8A 4M3TA 2G8KA 2YNHA 4CGFA 3DRRA 3S3MA 3SV4A 3LP2A 2YV0X 1HNVA 2KFNA 2HHVA 1TVRA 4CFAA 3IS9A 2PYLA 4JS4A 4AHVA 4Z4HA 4OJRA 3AO2A 5KGWA 1FK9A 1RTIA 3OYGA 4FCYA 1XI1A 4FM1A 3HPHA 3V81A 1CZ9A 3A2FA 3RWUA 2XY5A 3L2VA 1QQCA 4FM0A 1TK5A 4J2EA 3ZSQA 4FW2A 3LWLA 1RTHA 2YKMA 4IBNA 3VQAA 4E0DA 4LY7A 5J2MA 3NF8A 4C8NA 3AA4A 4KHNA 4CE9A 1W0HA 2X74A 4RW4A 3DLBA 1JLGA 2X6NA 3HVTA 4KTZA 4N47A 4RW9A 3OYBA 1KVCA 4J2BA 4KHWA 3I0SA 5SZTA 4KB0A 4ID1A 3ZSWA 3SV3A 3TAQA 3AVLA 3AVMA 4Q0BA 2ZE2A 1KSPA 1U45A 2G8UA 4FW1A 1WSIA 3DLEA 1QTMA 4FK0A 4FJ9A 2OZSA 3AA3A 1Q8IA 2HHUA 4FJGA 1S9GA 3OYDA 4DSKA 1VRTA 2PZSA 2P1JA 3TWHA 2PY5A 1TAQA 5KI6A 5KRSA 1CXUA 4DSEA 1VSIA 3SZ2A 2HNZA 3KK1A 1RT5A 2OPQA 5C25A 1DTQA 3KIOA 3LZJA 4CGHA 3KKSA 4FLYA 1IH7A 2RN2A 1JLQA 3HT3A 4CJVA 2OPRA 1NJWA 3KTQA 5CY4A 3VA3A 3TAFA 1L3TA 4KHYA 1XC9A 4K8XA 2ITGA 3AVBA 1ZBUA 3SI6A 2D0AA 2FBXA 5C42A 3SUNA 1NK6A 3SPYA 2ETJA 4FZYA 4O5BA 3OYIA 1WNSA 4OKJA 2HW3A 4ZTFA 2HHWA 4I9LA 1C0TA 2VG5A 4Z4EA 2E6LA 5K14A 4IDKA 4E19A 4BE1A 3OS0A 2D5RA 3KJVA 4J2AA 4WE1A 2IAJA 1IKXA 3CM6A 1WN7A 1IO2A 4CERA 3L2WA 3VQQA 4DS4A 3C94A 4LD0A 4CK3A 3OY9A 5HROA 1VRUA 4QAGA 2AJQA 2IC3A 3SQ0A 1WSFA 3TAMA 1XHZA 4BDPA 2W42A 2OYQA 1JL1A 4DQSA 3QO9A 4DG1A 3SQ1A 4I2QA 3NH2A 1GOCA 3IG1A 3UIQA 4KV8A 5FRNA 5HLFA 4NCAA 3DM2A 4PUOA 5CZ1A 4DQPA 2Z1JA 4H4OA 5J1EA 3KLHA 3NGYA 4OGEA 1C1AA 1S1VA 3SCXA 4AHTA 3NBPA 5KTQA 3AVGA 3P1GA 4FLXA 3SUPA 1WSGA 4O4GA 4F3OA 1HQEA 3OYLA 3I0RA 3WNGA 1WLJA 3DI6A 3HPOA 2BANA 3M8SA 3HVRA 3RMAA 1NK7A 3LANA 4GVMA 4I7FA 1JXEA 4E7IA 4LSLA 3SUQA 3HP6A 3M8PA 4CJFA 1RTDA 1TKTA 3OYFA 2G8VA 4M3UA 2QK9A 4CFDA 4CIEA 4AH9A 3OYKA 4DFJA 4ZTJA 1NOZA 3ZSOA 4IFVA 4BDZA 2X78A 3LP3A 3NF7A 4C8MA 1D9DA 5JS1A 2FBVA 4Z4FA 3VQ9A 1JXBA 3AA2A 3HO1A 1C1BA 1ZBFA 4CEZA 3NH1A 1N6QA 4KI6A 3PX0A 1HNIA 3TI0A 3S3OA 4ZHRA 1O1WA 1NOYA 1HYVA 2YHAA 5I3UA 3HK2A 4DSLA 2Y1IA 4J2DA 4MFBA 1ASVA 4B08A 4L8RB 1C1CA 3O3GA 4B9TA 4F4KA 4HCBA 1BQNA 4CF8A 2BE2A 3L2QA 1ASWA 3T19A 4HUFA 4FJIA 4FJ5A 1RCHA 4DLEA 1A5WA 3T3FA 3NH0A 3NFAA 1A5XA 3P5JA 1KTQA 3EZ5A 4CEQA 1A5VA 1JL2A 4XIUA 3PV8A 2OZMA 4EZ9A 2YNFA 3TAGA 2OPPA 4ICLA 3RMCA 4BWJA 3KLIA 1LW2A 4AILC 1VSLA 1S9EA 1NJYA 1LWEA 3K57A 4RW6A 2XRIA 1NKCA 1C0MA 1T8EA 4JLHA 4DQIA 3JSMA 3QETA 3JYTA 4KPYA 4PA1A 1LW0A 3HP9A 1NKBA 4NCGA 2KZZA 3SPZA 3SNNA 1D5AA 3H08A 3O4NA 4YFUA 3SUOA 2Q3SA 3DMJA 2GBZA 1L3UA 3MEGA 5KGXA 4CCHA 1TL3A 3ZSXA 2YNGA 3ZT0A 3B6OA 2O4GA 5HP1A 3ZT1A 2WONA 1FXXA 4RW8A 3OJUA 3ASMA 5FDLA 3V9SA 4BE2A 4FXDA 1JLAA 3QIOA 4DSJA 2G8IA 4AHRA 3HM9A 1NKEA 4HUEA 4HHTA 4B8AB 4YNQA 3KLGA 4DS5A 2KTQA 2Y1JA 1IKYA 3B6PA 4PY5A 4LH5A 2P5OA 4W5OA 4DTPA 4G1QA 4F8RA 2DFEA 2XHBA 4CJEA 2VWJA 1QSYA 1CLQA 3V9UA 4DTMA 1JLFA 5CYQA 4CF2A 3O4QA 3VQ6A 4E1NA 4E7KA 1RDDA 3CQ8A 3TABA 1U4BA 1NK0A 3K5LA 1NJXA 4BWMA 4E3SA 4DTXA 1JLCA 3LPTA 1Q9XA 1RNHA 1GOAA 2EX3A 3FFIA 3NE6A 4EZ6A 1RT4A 4CGJA 3C6TA 4GMJB 4N56A 1IG9A 4HCCA 1J5OA 3WNHA 3EYZA 2P5GA 4DTRA 1ZBIA 2HHXA 4DWIA 1JLEA 1RDCA 1I39A 5CZ2A 5EU7A 1QE1A 1YVUA 4CJ3A 1X9SA 1KVBA 5FRMA 4BACA 3IRXA 2ATQA 1BISA 1RT6A 2YKNA 3ZCMA 5HRPA 4CF9A 2HVIA 3RRGA 2NUBA 3OYNA 3ZT2A 2XY7A 4F2SA 1RT7A 2LSNA 3O3HA 3VQEA 3NDKA 4RG8A 3AO3A 3OJSA 3S3NA 3AVCA 1SKRA 4CHYA 1BQMA 2Z1GA 5CYMA 4AHCA 2JLEA 4DTOA 4DFPA 3MEEA 2D0CA 3SYZA 3QEVA 3MECA 4CHZA 1TGOA 3M8QA 3AVAA 4OKEA 3RRHA 3DLRA 1X9MA 2YHBA 2BDPA 3HSTB 4E7LA 3SQ2A 3NF9A 4N41A 4CJRA 4FLZA 3CFOA 2Z1HA 3U3YA 2VG7A 4KO0A 4M41A 3NHGA 3DLHA 4KAZA 3AVKA 4QCLA 1VSFA 3EY1A 3V4IA 1S6PA 1WSJA 1U48A 1YTUA 4CGGA 4OLBA 3S9HA 2E4LA 5I42A 4CEEA 3L8BA 4CF0A 4CJPA 3QERA 1BGXT 1S1UA 4AHUA 4CJTA 4OKKA 3HYFA 3OS2A 4FZZA 1HPZA 3NCIA 1T03A 4CJQA 2FC0A 3LDSA 4DLGA 3TARA 2IGIA 4M3RA 3QESA 1HYSA 2F8SA 4KKOA 4CGDA 2RF2A 1L5UA 4CEAA 3F73A 3L3VA 4KI4A 2F8TA 1TKZA 1KCFA 3CFRA 1CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQB A;  5J2N A;  4CES A;  3U3G A;  3MXI A;  1UA0 A;  1MU2 A;  1ASU A;  4DQR A;  4KHU A;  4Z4I A;  3NF6 A;  2IOC A;  1KRP A;  1NK9 A;  3QNO A;  2O4I A;  3V1O A;  1UA1 A;  3OYC A;  3LAM A;  3P83 D;  1Q9Y A;  1BHL A;  1IKV A;  1I3A A;  1VSJ A;  3ITH A;  1TAU A;  1RDB A;  1VSD A;  2Z1I A;  4CFC A;  3DYA A;  3OYA A;  3NAE A;  3ISN C;  3V9X A;  4KFB A;  5HRR A;  3PY8 A;  4CHQ A;  1C6V A;  1S5J A;  2E6M A;  3K58 A;  1TV6 A;  4DTU A;  2XY6 A;  4CGI A;  4FJ8 A;  1TL1 A;  3LPU A;  1YTA A;  1B9D A;  1YT3 A;  4CED A;  1VK0 A;  1G15 A;  3DRS A;  4H4M A;  4E7H A;  3OYM A;  1U47 A;  4B9N A;  4B9S A;  1JKH A;  1C0U A;  4DMN A;  3AVJ A;  3VQD A;  4RW7 A;  4DFK A;  2HND A;  3KD5 E;  1J54 A;  3QLH A;  4Z4G A;  2QKB A;  4B3O A;  5FRO A;  4FJN A;  1D9F A;  1LAW A;  1WSH A;  1N5Y A;  1EP4 A;  3CYM A;  4I9Q A;  1Z25 A;  1KFD A;  2D0B A;  1SL1 A;  3VQ7 A;  4R5P A;  1ZYQ A;  1NK5 A;  4DFM A;  5J2Q A;  3VQ4 A;  4CEB A;  2GV9 A;  1WAF A;  3ALY A;  4KTW A;  3LZI A;  3OYH A;  4ID5 A;  1GOB A;  3KLE A;  3OVN A;  4CK1 A;  1NK8 A;  1EKE A;  2EHG A;  1HRH A;  1X1P A;  4CJS A;  4M42 A;  3I8D A;  1Y97 A;  1JLB A;  3NGI A;  4FJL A;  3L2U A;  2OPS A;  3VQ8 A;  3ZSR A;  3O3F A;  2G8H A;  2B5J A;  1UAX A;  2XO7 A;  1F21 A;  3AVN A;  4DTN A;  2B4J A;  3AO1 A;  4NYF A;  1QSL A;  1NJZ A;  3KK3 A;  5HBM A;  1RTJ A;  2BGG A;  4CF1 A;  2RKI A;  3V1R A;  2FBT A;  3OYE A;  3ZSZ A;  3PO4 A;  4Z4C A;  3D0P A;  1B9F A;  1WAJ A;  3HXM A;  3QEX A;  4DU3 A;  4KRE A;  3CG7 A;  4E1M A;  2HMI A;  1FKO A;  5D3G A;  3VQ5 A;  1RBR A;  4CIF A;  4ELT A;  3PUF A;  4KRF A;  4BDY A;  3MED A;  4IG3 A;  3LAK A;  1TK8 A;  4LSN A;  4CHO A;  2JGU A;  3PX6 A;  4FJM A;  3HJF A;  2VG6 A;  3DRP A;  1S6Q A;  3E01 A;  4W5Q A;  1SKW A;  1ZBH A;  4FK4 A;  5C24 A;  3K5N A;  4O0I A;  1VSH A;  3LWM A;  4HUG A;  4OPK A;  4Q5V A;  3RMD A;  2HHS A;  4BE0 A;  4FM2 A;  1W9H A;  4PQU A;  4O0J A;  3CM5 A;  4TSX A;  3QNN A;  2OA8 A;  4FJX A;  3ZSY A;  1WSE A;  4AHS A;  4F2R A;  4H8K A;  1R0A A;  3LP0 A;  3NGZ A;  4O44 A;  1Z26 A;  3VQP A;  1LWF A;  1QS4 A;  4CJ4 A;  4K8Z A;  1DLO A;  1UOC A;  2RPI A;  4GW6 A;  4CJW A;  2DY4 A;  1U04 A;  3G0Z A;  2ZD1 A;  4DSF A;  3L2R A;  3MXM A;  4FJK A;  2KQ2 A;  3LP1 A;  4DQQ A;  3THV A;  1TKD A;  4KTQ A;  4OLA A;  3AVH A;  1SUQ A;  2QXF A;  4Y1C A;  3V9Z A;  1SKS A;  4B9L A;  4NYN A;  3G10 A;  4I2P A;  4EP5 A;  4N76 A;  2KZM A;  1T05 A;  5SWM A;  4FLU A;  3AA5 X;  3LAL A;  4UQG A;  3SQ4 A;  4IKF A;  1UWB A;  1HJR A;  1S1T A;  3ULD A;  4PWD A;  1QHT A;  3VN5 A;  1NK4 A;  1QSS A;  2XY8 A;  1FKP A;  2X6S A;  3K2P A;  4KHS A;  4B9M A;  3AVF A;  2HB5 A;  1EX4 A;  1RIL A;  4DU4 A;  4QOZ B;  1J9A A;  4B9V A;  4CJL A;  1RT3 A;  3K5M A;  1EET A;  1S1W A;  2HNY A;  3ZSV A;  5KRT A;  4KB1 A;  3WNE A;  3M8R A;  4DSI A;  1S1X A;  1LWC A;  4E89 A;  1SL0 A;  3HPG A;  4FJH A;  4C8O A;  1XWL A;  1RBU A;  3DLG A;  4Z0U A;  1REV A;  2PYJ A;  4ELU A;  3D45 A;  2DFH A;  1RT2 A;  2HHT A;  1IKW A;  1CZB A;  3RR7 A;  4FZX C;  3F9K A;  3KKR A;  1TK0 A;  4FVM A;  4CHN A;  2DFF A;  1VSK A;  3ZT3 A;  3DOK A;  4CEO A;  4FLT A;  3KK2 A;  3TR8 A;  1BL3 A;  4FK2 A;  4NCB A;  1LAV A;  1KLN A;  4B8C A;  4LH4 A;  3V9W A;  1HQU A;  3QEP A;  1KVA A;  3DLK A;  3QIN A;  3AV9 A;  3BGR A;  4ELV A;  3MXJ A;  4M3X A;  2WOM A;  3RR8 A;  4FJJ A;  1BCM A;  3K59 A;  4Y1D A;  1XHX A;  2FBY A;  1ZBL A;  5JS2 A;  1RT1 A;  2YNI A;  2KW4 A;  4DU1 A;  1BI4 B;  4CFB A;  1HYZ A;  1BI4 A;  1KFS A;  2HHQ A;  2KFZ A;  4E7J A;  4W5R A;  5HRS A;  3QEI A;  3KLF A;  2I5J A;  4JRP A;  4N5S A;  1RBT A;  1B92 A;  3QIP A;  4FJ7 A;  4B9U A;  3WNF A;  3BDP A;  3TAE A;  5T7B A;  4M3Y A;  4FLV A;  3TAN A;  2VWK A;  1U49 A;  3PO5 A;  1DTT A;  1VSE A;  4M3W A;  1L3V A;  2R7Y A;  1KLM A;  2A1S A;  3ZT4 A;  4JRQ A;  4IG0 A;  3RTV A;  4DTS A;  4OGC A;  1EXQ A;  3RMB A;  3TAP A;  1J53 A;  2IDO A;  3VA0 A;  5J2P A;  1BCO A;  3AO4 A;  3L3U A;  3T1A A;  5E41 A;  1X9W A;  1RDA A;  4O55 A;  4JS5 A;  4C8K A;  4M3Z A;  4W5N A;  4OPJ A;  2G8W A;  4C8L A;  2GUI A;  4CHP A;  5DMR A;  4IFY A;  3OYJ A;  4M45 A;  4OVL A;  1BIU A;  4MQ3 A;  4CIG A;  3SJJ A;  1T7P A;  5DK5 A;  4CJ5 A;  3U6F A;  1VSM A;  1K6Y A;  4EP4 A;  3V1Q A;  2HVH A;  1L3S A;  1HMV A;  1RBS A;  4CJU A;  4HVJ A;  1LV5 A;  1D8Y A;  3KD1 E;  3VQB A;  4DTJ A;  1SL2 A;  2G8F A;  3DOL A;  1ITG A;  3OS1 A;  5HRN A;  4CEF A;  4FYD A;  1SV5 A;  3C6U A;  4W5T A;  3CFP A;  4DF4 A;  3IAY A;  2DTU A;  4CEC A;  4CK2 A;  3QEW A;  2P51 A;  3VQC A;  3PX4 A;  3AVI A;  3C95 A;  3K5O A;  3MAQ A;  4HTU A;  4FLW A;  2A1R A;  2IS3 A;  1RBV A;  2F96 A;  3AO5 A;  3HL8 A;  2B6A A;  3V6D A;  4KHQ A;  1TKX A;  4F3T A;  1BIZ A;  4CJK A;  2QKK A;  4DF8 A;  4M3T A;  2G8K A;  2YNH A;  4CGF A;  3DRR A;  3S3M A;  3SV4 A;  3LP2 A;  2YV0 X;  1HNV A;  2KFN A;  2HHV A;  1TVR A;  4CFA A;  3IS9 A;  2PYL A;  4JS4 A;  4AHV A;  4Z4H A;  4OJR A;  3AO2 A;  5KGW A;  1FK9 A;  1RTI A;  3OYG A;  4FCY A;  1XI1 A;  4FM1 A;  3HPH A;  3V81 A;  1CZ9 A;  3A2F A;  3RWU A;  2XY5 A;  3L2V A;  1QQC A;  4FM0 A;  1TK5 A;  4J2E A;  3ZSQ A;  4FW2 A;  3LWL A;  1RTH A;  2YKM A;  4IBN A;  3VQA A;  4E0D A;  4LY7 A;  5J2M A;  3NF8 A;  4C8N A;  3AA4 A;  4KHN A;  4CE9 A;  1W0H A;  2X74 A;  4RW4 A;  3DLB A;  1JLG A;  2X6N A;  3HVT A;  4KTZ A;  4N47 A;  4RW9 A;  3OYB A;  1KVC A;  4J2B A;  4KHW A;  3I0S A;  5SZT A;  4KB0 A;  4ID1 A;  3ZSW A;  3SV3 A;  3TAQ A;  3AVL A;  3AVM A;  4Q0B A;  2ZE2 A;  1KSP A;  1U45 A;  2G8U A;  4FW1 A;  1WSI A;  3DLE A;  1QTM A;  4FK0 A;  4FJ9 A;  2OZS A;  3AA3 A;  1Q8I A;  2HHU A;  4FJG A;  1S9G A;  3OYD A;  4DSK A;  1VRT A;  2PZS A;  2P1J A;  3TWH A;  2PY5 A;  1TAQ A;  5KI6 A;  5KRS A;  1CXU A;  4DSE A;  1VSI A;  3SZ2 A;  2HNZ A;  3KK1 A;  1RT5 A;  2OPQ A;  5C25 A;  1DTQ A;  3KIO A;  3LZJ A;  4CGH A;  3KKS A;  4FLY A;  1IH7 A;  2RN2 A;  1JLQ A;  3HT3 A;  4CJV A;  2OPR A;  1NJW A;  3KTQ A;  5CY4 A;  3VA3 A;  3TAF A;  1L3T A;  4KHY A;  1XC9 A;  4K8X A;  2ITG A;  3AVB A;  1ZBU A;  3SI6 A;  2D0A A;  2FBX A;  5C42 A;  3SUN A;  1NK6 A;  3SPY A;  2ETJ A;  4FZY A;  4O5B A;  3OYI A;  1WNS A;  4OKJ A;  2HW3 A;  4ZTF A;  2HHW A;  4I9L A;  1C0T A;  2VG5 A;  4Z4E A;  2E6L A;  5K14 A;  4IDK A;  4E19 A;  4BE1 A;  3OS0 A;  2D5R A;  3KJV A;  4J2A A;  4WE1 A;  2IAJ A;  1IKX A;  3CM6 A;  1WN7 A;  1IO2 A;  4CER A;  3L2W A;  3VQQ A;  4DS4 A;  3C94 A;  4LD0 A;  4CK3 A;  3OY9 A;  5HRO A;  1VRU A;  4QAG A;  2AJQ A;  2IC3 A;  3SQ0 A;  1WSF A;  3TAM A;  1XHZ A;  4BDP A;  2W42 A;  2OYQ A;  1JL1 A;  4DQS A;  3QO9 A;  4DG1 A;  3SQ1 A;  4I2Q A;  3NH2 A;  1GOC A;  3IG1 A;  3UIQ A;  4KV8 A;  5FRN A;  5HLF A;  4NCA A;  3DM2 A;  4PUO A;  5CZ1 A;  4DQP A;  2Z1J A;  4H4O A;  5J1E A;  3KLH A;  3NGY A;  4OGE A;  1C1A A;  1S1V A;  3SCX A;  4AHT A;  3NBP A;  5KTQ A;  3AVG A;  3P1G A;  4FLX A;  3SUP A;  1WSG A;  4O4G A;  4F3O A;  1HQE A;  3OYL A;  3I0R A;  3WNG A;  1WLJ A;  3DI6 A;  3HPO A;  2BAN A;  3M8S A;  3HVR A;  3RMA A;  1NK7 A;  3LAN A;  4GVM A;  4I7F A;  1JXE A;  4E7I A;  4LSL A;  3SUQ A;  3HP6 A;  3M8P A;  4CJF A;  1RTD A;  1TKT A;  3OYF A;  2G8V A;  4M3U A;  2QK9 A;  4CFD A;  4CIE A;  4AH9 A;  3OYK A;  4DFJ A;  4ZTJ A;  1NOZ A;  3ZSO A;  4IFV A;  4BDZ A;  2X78 A;  3LP3 A;  3NF7 A;  4C8M A;  1D9D A;  5JS1 A;  2FBV A;  4Z4F A;  3VQ9 A;  1JXB A;  3AA2 A;  3HO1 A;  1C1B A;  1ZBF A;  4CEZ A;  3NH1 A;  1N6Q A;  4KI6 A;  3PX0 A;  1HNI A;  3TI0 A;  3S3O A;  4ZHR A;  1O1W A;  1NOY A;  1HYV A;  2YHA A;  5I3U A;  3HK2 A;  4DSL A;  2Y1I A;  4J2D A;  4MFB A;  1ASV A;  4B08 A;  4L8R B;  1C1C A;  3O3G A;  4B9T A;  4F4K A;  4HCB A;  1BQN A;  4CF8 A;  2BE2 A;  3L2Q A;  1ASW A;  3T19 A;  4HUF A;  4FJI A;  4FJ5 A;  1RCH A;  4DLE A;  1A5W A;  3T3F A;  3NH0 A;  3NFA A;  1A5X A;  3P5J A;  1KTQ A;  3EZ5 A;  4CEQ A;  1A5V A;  1JL2 A;  4XIU A;  3PV8 A;  2OZM A;  4EZ9 A;  2YNF A;  3TAG A;  2OPP A;  4ICL A;  3RMC A;  4BWJ A;  3KLI A;  1LW2 A;  4AIL C;  1VSL A;  1S9E A;  1NJY A;  1LWE A;  3K57 A;  4RW6 A;  2XRI A;  1NKC A;  1C0M A;  1T8E A;  4JLH A;  4DQI A;  3JSM A;  3QET A;  3JYT A;  4KPY A;  4PA1 A;  1LW0 A;  3HP9 A;  1NKB A;  4NCG A;  2KZZ A;  3SPZ A;  3SNN A;  1D5A A;  3H08 A;  3O4N A;  4YFU A;  3SUO A;  2Q3S A;  3DMJ A;  2GBZ A;  1L3U A;  3MEG A;  5KGX A;  4CCH A;  1TL3 A;  3ZSX A;  2YNG A;  3ZT0 A;  3B6O A;  2O4G A;  5HP1 A;  3ZT1 A;  2WON A;  1FXX A;  4RW8 A;  3OJU A;  3ASM A;  5FDL A;  3V9S A;  4BE2 A;  4FXD A;  1JLA A;  3QIO A;  4DSJ A;  2G8I A;  4AHR A;  3HM9 A;  1NKE A;  4HUE A;  4HHT A;  4B8A B;  4YNQ A;  3KLG A;  4DS5 A;  2KTQ A;  2Y1J A;  1IKY A;  3B6P A;  4PY5 A;  4LH5 A;  2P5O A;  4W5O A;  4DTP A;  4G1Q A;  4F8R A;  2DFE A;  2XHB A;  4CJE A;  2VWJ A;  1QSY A;  1CLQ A;  3V9U A;  4DTM A;  1JLF A;  5CYQ A;  4CF2 A;  3O4Q A;  3VQ6 A;  4E1N A;  4E7K A;  1RDD A;  3CQ8 A;  3TAB A;  1U4B A;  1NK0 A;  3K5L A;  1NJX A;  4BWM A;  4E3S A;  4DTX A;  1JLC A;  3LPT A;  1Q9X A;  1RNH A;  1GOA A;  2EX3 A;  3FFI A;  3NE6 A;  4EZ6 A;  1RT4 A;  4CGJ A;  3C6T A;  4GMJ B;  4N56 A;  1IG9 A;  4HCC A;  1J5O A;  3WNH A;  3EYZ A;  2P5G A;  4DTR A;  1ZBI A;  2HHX A;  4DWI A;  1JLE A;  1RDC A;  1I39 A;  5CZ2 A;  5EU7 A;  1QE1 A;  1YVU A;  4CJ3 A;  1X9S A;  1KVB A;  5FRM A;  4BAC A;  3IRX A;  2ATQ A;  1BIS A;  1RT6 A;  2YKN A;  3ZCM A;  5HRP A;  4CF9 A;  2HVI A;  3RRG A;  2NUB A;  3OYN A;  3ZT2 A;  2XY7 A;  4F2S A;  1RT7 A;  2LSN A;  3O3H A;  3VQE A;  3NDK A;  4RG8 A;  3AO3 A;  3OJS A;  3S3N A;  3AVC A;  1SKR A;  4CHY A;  1BQM A;  2Z1G A;  5CYM A;  4AHC A;  2JLE A;  4DTO A;  4DFP A;  3MEE A;  2D0C A;  3SYZ A;  3QEV A;  3MEC A;  4CHZ A;  1TGO A;  3M8Q A;  3AVA A;  4OKE A;  3RRH A;  3DLR A;  1X9M A;  2YHB A;  2BDP A;  3HST B;  4E7L A;  3SQ2 A;  3NF9 A;  4N41 A;  4CJR A;  4FLZ A;  3CFO A;  2Z1H A;  3U3Y A;  2VG7 A;  4KO0 A;  4M41 A;  3NHG A;  3DLH A;  4KAZ A;  3AVK A;  4QCL A;  1VSF A;  3EY1 A;  3V4I A;  1S6P A;  1WSJ A;  1U48 A;  1YTU A;  4CGG A;  4OLB A;  3S9H A;  2E4L A;  5I42 A;  4CEE A;  3L8B A;  4CF0 A;  4CJP A;  3QER A;  1BGX T;  1S1U A;  4AHU A;  4CJT A;  4OKK A;  3HYF A;  3OS2 A;  4FZZ A;  1HPZ A;  3NCI A;  1T03 A;  4CJQ A;  2FC0 A;  3LDS A;  4DLG A;  3TAR A;  2IGI A;  4M3R A;  3QES A;  1HYS A;  2F8S A;  4KKO A;  4CGD A;  2RF2 A;  1L5U A;  4CEA A;  3F73 A;  3L3V A;  4KI4 A;  2F8T A;  1TKZ A;  1KCF A;  3CFR A;  1CXQ A; 
#chains in the Genus database with same CATH topology
 1UA0 A;  4Z4I A;  3NF6 A;  2E2N A;  1KRP A;  3CJ7 A;  3THW B;  3V1O A;  2NRH A;  1LCU A;  3CCJ N;  1BHL A;  1NM1 A;  5BN8 A;  5BRD A;  3O9Q A;  4KFB A;  5HRR A;  1Q7Y O;  4NXN K;  4CVN E;  4CHQ A;  1C6V A;  4DTU A;  3PIP L;  4IJN A;  1YT3 A;  1B9D A;  4B9S A;  1U47 A;  1C0U A;  5AQU A;  4DFK A;  2HND A;  1XQS C;  3KD5 E;  3QLH A;  4Z4G A;  2QKB A;  4GKJ K;  1D9F A;  3CYM A;  4CZK A;  3O9R A;  4BC3 A;  5KQD A;  4DFM A;  3I33 A;  3VQ4 A;  5E84 A;  3WXI A;  4B1Y B;  4CK1 A;  2EHG A;  1HRH A;  4WQ4 C;  1JLB A;  5AQH A;  3OBY A;  1NWK A;  4BRK A;  2B5J A;  1F21 A;  3AVN A;  3AO1 A;  1X3N A;  1NJZ A;  2BGG A;  3V1R A;  2FBT A;  1EO1 A;  4BRF A;  3T69 A;  3ZSZ A;  4Z4C A;  1T6D A;  3I56 N;  3QEX A;  3H6E A;  4JI6 K;  5BN9 A;  4CIF A;  3PUF A;  2ZGY A;  4I6M A;  3MED A;  3LAK A;  3A5N C;  3GG4 A;  3LM2 A;  1KAZ A;  1S6Q A;  5AZI A;  2I7P A;  3K5N A;  2HF4 A;  2I7N A;  2NRT A;  4YOR A;  4HUG A;  4Q5V A;  5C12 A;  3CM5 A;  3QNN A;  1ZXO A;  4AHS A;  4JI7 K;  4BRL A;  4F2R A;  4H8K A;  3U4L A;  3CJ9 A;  4RCH A;  4O44 A;  3VQP A;  3FZL A;  3VTI A;  1QS4 A;  5JMV A;  1DLO A;  2RPI A;  2DPN A;  3CET A;  2ZD1 A;  4FJK A;  3L2R A;  3MXM A;  2KQ2 A;  4DQQ A;  4B9L A;  3AAP A;  3VGK A;  2GUP A;  4CZE A;  3LAL A;  3THX A;  4BRD A;  4PWD A;  1S1T A;  3ULD A;  1K8K B;  3CCE N;  4A61 A;  2XY8 A;  1FKP A;  4KHS A;  2Q2R A;  2HB5 A;  1EX4 A;  4DU4 A;  4B9V A;  1RT3 A;  2QI2 A;  4Y0W A;  1Q82 O;  3WNE A;  3LM9 A;  5I9E B;  3M8R A;  3QML A;  4IXC A;  4E89 A;  4LF4 K;  5KQ8 A;  3ULE A;  1RBU A;  3DLG A;  1GLF O;  4A57 A;  2JWK A;  2DFH A;  5M1O A;  4A2B A;  4MLH A;  3Q7B A;  3F9K A;  4FVM A;  1RGI A;  3VER A;  1VSK A;  3CCM N;  4JD2 A;  4DR2 K;  1BL3 A;  2O8D A;  3QEP A;  3DLK A;  3BGR A;  3MXJ A;  4M3X A;  3OW2 M;  1S22 A;  1HKC A;  1ZBL A;  4BRH A;  3UKR B;  4DU1 A;  3O9U A;  1HYZ A;  1BI4 A;  4DQ8 A;  1KFS A;  3CCQ N;  5HRS A;  4K41 A;  4DB3 A;  2HHH K;  5BPN A;  1RBT A;  3QDK A;  2P9K A;  3WNF A;  4JKB A;  4H0O A;  3PO5 A;  3KK7 A;  3RTV A;  2PFU A;  4A5A A;  1HNX K;  2HBK A;  5E41 A;  4C8K A;  1RDA A;  4O55 A;  4O8K A;  4PHT X;  4OPJ A;  5DMR A;  3O4W A;  1YJW N;  5DK5 A;  3V1Q A;  2HVH A;  1RBS A;  4YOW A;  3CCU N;  3U9D A;  1NU0 A;  2YJF A;  4BRC A;  2WFB A;  1ITG A;  4FYD A;  4B3T K;  1SV5 A;  2P9U B;  4CEC A;  3O5B A;  3K5O A;  4HTU A;  1RBV A;  4ISG A;  2D0P A;  2CGK A;  4F3T A;  2QKK A;  4DF8 A;  3E1Y A;  3SK3 A;  4M3T A;  4IZ9 A;  1OH6 A;  4JK7 A;  3S3M A;  3SV4 A;  4HWI A;  4YY3 K;  2YV0 X;  3DXK A;  2KFN A;  2PYL A;  1ATR A;  1BO5 O;  2YHW A;  3OYG A;  1H1V A;  3HPH A;  3N4P A;  3ZYY X;  3A2F A;  4FM1 A;  2XY5 A;  3ZSQ A;  4FW2 A;  3LWL A;  4E0D A;  4LY7 A;  1QVF M;  3L6Q A;  3CXC M;  2P9N A;  1KVC A;  5SZT A;  3CMA N;  4M7Y A;  3FZF A;  3ZSW A;  3AVM A;  2ZE2 A;  2G8U A;  4B1U B;  4BGA A;  1WSI A;  4CZL A;  3OYD A;  3WXL A;  2JWL A;  2PY5 A;  4DSE A;  2E1Y A;  5KRS A;  1VSI A;  2P9S A;  4U7B A;  3SZ2 A;  1NGF A;  2HNZ A;  2WTU A;  4LF6 K;  1QZ5 A;  4B1V A;  4FLY A;  1IH7 A;  4GY2 B;  1JLQ A;  3HT3 A;  4K43 A;  2OPR A;  3ENH A;  5CY4 A;  3TAF A;  3M6G A;  4OPH A;  3AVB A;  5FPD A;  5BPL A;  3HOT A;  3SI6 A;  1OH5 A;  5C42 A;  4C1N I;  3SUN A;  1NK6 A;  5E26 A;  2QM1 A;  3OYI A;  1WNS A;  2BH1 A;  4CBU A;  3O8M A;  4Z4E A;  4E19 A;  4DV7 K;  4WE1 A;  2IAJ A;  3CM6 A;  4JK8 A;  3MN9 A;  1FW6 A;  1VRU A;  1X9J A;  2O8F B;  4H0V B;  2W42 A;  3QFU A;  2OYQ A;  5FRN A;  3VEY A;  2UUA K;  4A5B A;  4WCE L;  4JI2 K;  4AHT A;  4LC9 B;  1WSG A;  5C0Y A;  2ASM A;  3D7E O;  3OYL A;  1K9M O;  3HVR A;  3RMA A;  1VQ5 N;  3M8P A;  1GLB G;  1TKT A;  2QK9 A;  3NVM A;  3CF5 L;  4DFJ A;  3P31 A;  3NVK A;  1NOZ A;  1QHA A;  3ZSO A;  1D9D A;  5JS1 A;  1XC3 A;  4PKI A;  3EEQ A;  1R59 O;  3EN9 A;  3VQ9 A;  1C1B A;  3TI0 A;  1O1W A;  4JKA A;  1HYV A;  5AFU A;  5I3U A;  1N34 K;  2Q0U A;  2Y1I A;  1WBD A;  1ASV A;  1C1C A;  4CBX A;  2ASO A;  3F2K A;  4K0K K;  2FF6 A;  4DLE A;  3NH0 A;  1A5X A;  1KTQ A;  1GLD G;  1Y64 A;  3PV8 A;  1BU6 O;  3KZB A;  2OPP A;  3G4S N;  4AIL C;  3ENB A;  2UUB K;  4LFC K;  4JI5 K;  1LWE A;  1GLE G;  4EIA A;  4JKE A;  5JVH L;  2E1Z A;  1LW0 A;  3O08 A;  1NKB A;  1YHQ N;  3RVC A;  2ZJP L;  3ZX0 A;  3TU5 A;  4LF5 K;  3O4N A;  3OA9 A;  4WFA L;  2Q3S A;  1L3U A;  5AQS A;  4CCH A;  1TL3 A;  2YNG A;  4E1J A;  5HP1 A;  1WB9 A;  4RW8 A;  3BY5 A;  3OJU A;  3P38 A;  5FPM A;  4DSJ A;  2G8I A;  1NKE A;  3HM9 A;  1VQ8 N;  4LH5 A;  4NO7 A;  3WXK A;  4WYB A;  4DTP A;  3SMS A;  1QSY A;  2E2Q A;  1JLF A;  4CF2 A;  3TAB A;  1U4B A;  1NK0 A;  4KHP K;  2F9T A;  4DTX A;  1Q9X A;  1RNH A;  1GOA A;  1RT4 A;  2P9P A;  3C6T A;  4GMJ B;  4HCC A;  3EYZ A;  2HHX A;  1RDC A;  1I39 A;  5BR9 A;  3SAH A;  1TYQ B;  2E2P A;  1X9S A;  3VEW A;  5BR8 K;  4BRE A;  2ATQ A;  1EWR A;  4BC2 A;  1VQO N;  3D6R A;  3O3H A;  3VQE A;  3NDK A;  3FZH A;  3QB0 A;  1BQM A;  5BRF A;  4DTO A;  1YIJ N;  3G25 A;  1J5E K;  3MEE A;  4DR4 K;  3MEC A;  4KH5 A;  3M8Q A;  3RRH A;  5AQG A;  2YHB A;  1N36 K;  3VTH A;  4E7L A;  4FLZ A;  1XNR K;  3H45 C;  4JHD B;  3O6W A;  3NHG A;  3AVK A;  3BF1 A;  5M1P A;  1YTU A;  1WSJ A;  2E4L A;  5I42 A;  3AGK A;  5AQV A;  5LMU K;  5F0X A;  3QFP A;  3CC7 N;  4IOX A;  5FLX O;  4CJQ A;  2FC0 A;  3LDS A;  3TAR A;  4WFN L;  3QES A;  1HYS A;  4CJ7 A;  4CGD A;  2ZJR L;  2RF2 A;  3F73 A;  3L3V A;  3LDQ A;  4IEI A;  1E4F T;  1TKZ A;  4CZM A;  1NJI O;  1CXQ A;  2ZQB A;  3GOI A;  4CES A;  3U3G A;  4KHU A;  3OYC A;  3P83 D;  3THW A;  1WUA A;  5AQW A;  1VSD A;  4CFC A;  4PL7 A;  3ISN C;  3V9X A;  4BVO A;  3WEE B;  1S5J A;  2F8S A;  4WQ5 A;  1TV6 A;  2GEM A;  4FJ8 A;  3LPU A;  4BR9 A;  4G9Z A;  1YTA A;  2IVN A;  4CED A;  1YI2 N;  1VK0 A;  4PKH A;  4E7H A;  4B9N A;  3AVJ A;  5KPT A;  3VQD A;  1YIT N;  5AQF A;  4BRI A;  4MO4 A;  5KPR A;  2D0B A;  1SL1 A;  3BEX A;  4CEB A;  2GV9 A;  3DXM B;  4C1N K;  3LZI A;  3THY B;  1GOB A;  3KLE A;  2AP1 A;  2YJE A;  4CJS A;  4M42 A;  3BZC A;  3I8D A;  1Y97 A;  3ZLJ A;  3VQ8 A;  3K0S A;  4MDB A;  1UAX A;  2XO7 A;  1VHX A;  4DTN A;  2B4J A;  3ID8 A;  5HBM A;  3TSP A;  1RTJ A;  3PO4 A;  1U2V B;  4MLE A;  1XMQ K;  1B9F A;  5CHI A;  4KRE A;  3CG7 A;  4E1M A;  2HMI A;  3HBT A;  4WQ4 A;  1Z6R A;  2JGU A;  3LDP A;  1NGA A;  3HJF A;  3DJC A;  1SKW A;  4FK4 A;  4ILH A;  3I55 N;  2HHS A;  3VF4 A;  5M1F A;  5H1S Q;  4BE0 A;  4X62 K;  1W9H A;  4DCH A;  1NNE A;  3MK6 A;  2OA8 A;  1R0A A;  3LP0 A;  1Z26 A;  4MDA A;  4CJ4 A;  4GW6 A;  3G0Z A;  4DSF A;  3LP1 A;  3THV A;  4YDU A;  3AVH A;  1SUQ A;  5MLC Q;  4NYN A;  1LOT B;  3EKS A;  1XUP O;  4I2P A;  4EP5 A;  1QQM A;  1T05 A;  3HSC A;  4GVE A;  3AA5 X;  4FLU A;  1VQL N;  1UWB A;  1W2B M;  3BP8 A;  2IVO A;  2BUP A;  1QSS A;  4DUY K;  1K8K A;  4XH4 A;  4B9M A;  4YOV A;  4IOA L;  4ILG B;  4CJL A;  3J80 O;  1S1W A;  3EE8 A;  4KB1 A;  3R6M A;  1LWC A;  2OCE A;  1SL0 A;  1JCE A;  4FJH A;  4DV2 K;  5LL6 Z;  4AM7 A;  4DR3 K;  3D45 A;  1RT2 A;  2HHT A;  3KKR A;  1VQK N;  3TSU A;  4FLT A;  3KK2 A;  5GIN A;  1VQ9 N;  4NCB A;  3PSF A;  3V9W A;  1HQU A;  3C7N B;  1KVA A;  5AZJ B;  4WQ5 C;  3RR8 A;  4FJJ A;  2H3G X;  4Y1D A;  2FBY A;  5AQX A;  1RT1 A;  2YNI A;  3AAQ A;  4DR1 K;  4CFB A;  3UKR A;  1EQY A;  3ID6 A;  3W0L A;  4E7J A;  1KQS M;  2I5J A;  4H0P A;  1B92 A;  3QIP A;  4M7X A;  4R79 A;  2GX9 A;  4FLV A;  3TAN A;  4M3W A;  3ZT4 A;  1NBW A;  1J53 A;  3AO4 A;  2ASP A;  1X9W A;  3T1A A;  4CBW A;  2GUI A;  2AA4 A;  3CJB A;  4M45 A;  4CIG A;  3SJJ A;  3UKU B;  1HMV A;  4BR7 A;  4CJU A;  1BA0 A;  4BRM A;  2D4W A;  2G8F A;  2GTD A;  3CQY A;  3DOL A;  3OS1 A;  2E5L K;  4DF4 A;  2P9U A;  3VQC A;  3C95 A;  2QWL A;  3MAQ A;  4EAH D;  3HL8 A;  2B6A A;  3CCS N;  4KHQ A;  4UY8 O;  4CJK A;  2YNH A;  4AF1 A;  4CGF A;  3DRR A;  3SAF A;  2O8B B;  4DKW A;  2HBJ A;  2HHV A;  4CFA A;  4AHV A;  5ELZ A;  4Z4H A;  1FK9 A;  1RTI A;  3ZET B;  4DV0 K;  4FCY A;  4YDU C;  3O9S A;  2Q1N A;  3RWU A;  4FM0 A;  4YOY A;  2HBL A;  4KH6 A;  5J2M A;  3M1F A;  3NF8 A;  3AA4 A;  3G71 N;  1W0H A;  2X74 A;  3DLB A;  1JLG A;  2X6N A;  4N47 A;  3OYB A;  1TUY A;  3TPQ A;  3I0S A;  5AQO A;  4FVU A;  3VGM A;  2ZM6 K;  3SV3 A;  3TAQ A;  3SBT A;  4JAX A;  3SMP A;  4FW1 A;  2OZS A;  2PBD A;  3AA3 A;  1S9G A;  4DSK A;  1VRT A;  4PKG A;  1CXU A;  1C0F A;  2YHX A;  3KK1 A;  1RT5 A;  2OPQ A;  1DTQ A;  2P9L B;  4CJV A;  3AGR A;  3VA3 A;  1XC9 A;  4DR7 K;  1ZBU A;  1S3X A;  2FBX A;  3PSI A;  2ETJ A;  4FZY A;  4ISE A;  4I9L A;  1C0T A;  2VG5 A;  4BE1 A;  4DV4 K;  3VEO A;  3MWP A;  1HR0 K;  1IKX A;  1WN7 A;  1IO2 A;  2P9I A;  4IEE A;  3AY9 A;  3VQQ A;  3L2W A;  3C94 A;  4LD0 A;  1NGH A;  4CK3 A;  3DWL A;  4BDP A;  4DQS A;  1ATN A;  3SQ1 A;  2O8F A;  4I2Q A;  3NH2 A;  3IG1 A;  3UIQ A;  4KV8 A;  4NCA A;  5CZ1 A;  4H4O A;  1V4T A;  2QXL A;  5TKY A;  2Q97 A;  1IBL K;  3NGY A;  1S1V A;  4ILJ A;  3BUZ B;  4BC4 A;  3AVG A;  3SUP A;  1SAZ A;  2BAN A;  1P8Z A;  1QZ6 A;  3LAN A;  4JNE A;  4M3U A;  2G8V A;  1MA9 B;  4DHY A;  4AH9 A;  4IFV A;  4C8M A;  1HNZ K;  4BRP A;  3AA2 A;  3S3O A;  4ZHR A;  5B8H A;  4AQY K;  4B1W B;  3HK2 A;  4J2D A;  4MFB A;  4B08 A;  4LFA K;  3O3G A;  4B9T A;  4IO8 A;  4O5F A;  2BE2 A;  1IV0 A;  3L2Q A;  1VQ4 N;  3P5J A;  1JL2 A;  1U6Z A;  2HBM A;  4EZ9 A;  1KD1 O;  4ICL A;  4BRQ A;  1LW2 A;  3LL3 A;  4B9Q A;  3GDQ A;  3K57 A;  3H3O B;  4M63 C;  3CPW M;  1MWM A;  1T44 A;  1C0M A;  3MN6 A;  4F9O A;  3QET A;  2ZJQ L;  4JI3 K;  3VOV A;  4IOC L;  3TTF A;  4KPY A;  3FR0 A;  4NCG A;  3SPZ A;  3SNN A;  5LJV A;  3DMJ A;  5JVG L;  2ZGZ A;  3O1W A;  1WOQ A;  3B6O A;  3ZT1 A;  2WON A;  1N32 K;  1T6C A;  1FXX A;  4DR5 K;  3V9S A;  5FDL A;  3M5R A;  4PL8 A;  1W7A A;  4IWV A;  2KTQ A;  3FE1 A;  3B6P A;  4W5O A;  2DFE A;  2VWJ A;  4CJE A;  4E7K A;  4E1N A;  3MWT A;  3K5L A;  1DEJ A;  4BWM A;  2QW9 A;  4E3S A;  4JK9 A;  4EZ6 A;  3A5L C;  2QA4 N;  4BR5 A;  3VEN A;  2BTF A;  3H46 O;  1S72 N;  3ENO A;  1IG9 A;  3E66 A;  3IMX A;  5AQY A;  4CD1 A;  4DTR A;  1EWQ A;  4DWI A;  1JLE A;  5AR0 A;  3U8X A;  1QE1 A;  3CC4 N;  3QBX A;  4CJ3 A;  5FRM A;  1TYQ A;  3SJH A;  3IRX A;  1RT6 A;  3ZCM A;  3SLC A;  2EWS A;  3RRG A;  3C0B A;  3ZT2 A;  2XY7 A;  1RT7 A;  4LF7 K;  3S3N A;  5FPE A;  3EL2 A;  3ZEU B;  4XH1 A;  4CHY A;  4AHC A;  4DFP A;  2JLE A;  2D0O A;  2P9I B;  1GLC G;  3QEV A;  1TGO A;  3AVA A;  3HST B;  4JKH A;  2NLX A;  2Q0R A;  4N41 A;  1NGE A;  2HF3 A;  4YHH K;  3KWI A;  2VG7 A;  3VGL A;  4JHD A;  3DLH A;  4QCL A;  3MX5 A;  3EKU A;  1GLJ O;  4JKG B;  4CGG A;  5GIO A;  4OLB A;  5AQI A;  4CEE A;  3L8B A;  3T1H K;  1IBM K;  2HOE A;  4FWN A;  4OKK A;  3NCI A;  5C2D A;  4KKO A;  1L5U A;  1RDU A;  2QWR A;  4GKK K;  2D1K A;  3MXI A;  1MU2 A;  5BRE A;  1ASU A;  4DV1 K;  3WUH A;  2IOC A;  3LAM A;  5C2F A;  4A59 A;  2NRV A;  1X3M A;  3ITH A;  1TAU A;  2Z1I A;  5GAE P;  3PIO L;  3FLC O;  3PY8 A;  3O80 A;  4KBO A;  2E6M A;  1YVN A;  2XY6 A;  3WEE A;  4CGI A;  1TL1 A;  3A0I X;  3LDL A;  5AQN A;  2FXU A;  1G15 A;  4H4M A;  3OYM A;  2IIR A;  1JCG A;  1JKH A;  4DMN A;  1VQ6 N;  4RW7 A;  2O8C B;  1J54 A;  4B3O A;  1NGG A;  4FJN A;  1WSH A;  1EP4 A;  4I9Q A;  1YAG A;  1KFD A;  3VQ7 A;  4BQZ A;  1ZYQ A;  4BR2 A;  3TTD A;  1NGJ A;  1WAF A;  3ALY A;  3DXM A;  4KTW A;  4ID5 A;  3OVN A;  1NK8 A;  3THY A;  1X1P A;  3VEV A;  3N4Q A;  3PLA A;  3ZSR A;  2A6A A;  3IUC A;  1G99 A;  1QSL A;  1V4S A;  3OHR A;  5A2Q O;  3HI0 A;  1M90 O;  1NMD A;  1CZA N;  5JLF A;  3SAG A;  3OYE A;  4DU3 A;  1U2V A;  4FWP A;  3CI5 A;  5D3G A;  3VQ5 A;  1RBR A;  1ILY A;  1HKB A;  1GLA G;  1KXP A;  4BDY A;  1ESV A;  1TK8 A;  4LSN A;  4CHO A;  4JKC A;  4LF9 K;  2VG6 A;  3DRP A;  4W5Q A;  1ZBH A;  3NMU A;  5EXW A;  2GEL A;  3RMD A;  4FM2 A;  2HMP A;  4O0J A;  4FJX A;  3ZSY A;  4BG8 A;  2PAV A;  2RHK A;  2RE2 A;  1UOC A;  4CJW A;  2DY4 A;  4IDH A;  4NLB A;  4H5N A;  3T7Z A;  1SZ2 A;  1TKD A;  4KTQ A;  1M1K O;  4Y1C A;  4OLA A;  2QXF A;  4GV6 A;  4N76 A;  2KZM A;  2A42 A;  5SWM A;  3SQ4 A;  4NXM K;  4CI6 A;  1HJR A;  1VQM N;  1QHT A;  1NK4 A;  2V51 B;  2E8A A;  3AVF A;  3I8B A;  2V52 B;  1J9A A;  1I94 K;  2HNY A;  3ZSV A;  1S1X A;  3HPG A;  4X65 K;  1XWL A;  4ELU A;  3RR7 A;  4FZX C;  3T1Y K;  3ZT3 A;  3DOK A;  3HOS A;  3BF3 A;  2CH6 A;  4FK2 A;  2HST A;  1LAV A;  3L4I A;  3AV9 A;  3C7N A;  4NLC A;  5AZJ A;  4ELV A;  2UXC K;  4B1Z A;  4FL9 A;  1XHX A;  5FPN A;  2HHQ A;  1OVQ A;  1KAX A;  3G6E N;  4FJ7 A;  3HTV A;  5T7B A;  4M3Y A;  1Q18 A;  2F9W A;  1DTT A;  5F2R A;  4JI4 K;  1L3V A;  4QOZ B;  2A1S A;  4JRQ A;  4DTS A;  3MCA B;  4IG0 A;  4MO5 A;  4OGC A;  1EXQ A;  2KKZ A;  1BG3 A;  5GAH P;  3TAP A;  3EO3 A;  2IDO A;  5KPZ A;  3VA0 A;  5J2P A;  2UUC K;  3ATV A;  1W97 L;  1HUX A;  4IFY A;  1N33 K;  1BIU A;  1T7P A;  3U6F A;  1VSM A;  3UKU A;  3MCP A;  4EP4 A;  1DT9 A;  4HVJ A;  1LV5 A;  4DTJ A;  1SL2 A;  2CH5 A;  5HRN A;  4CEF A;  3VMF B;  4W5T A;  3CFP A;  3IAY A;  2DTU A;  3C6H A;  5EX5 A;  4FPB A;  4CK2 A;  2P51 A;  3PX4 A;  1OVY A;  3AVI A;  5ADX A;  5EY4 A;  4A2A A;  4FLW A;  3OBW A;  5AFU H;  2IS3 A;  2F96 A;  3AO5 A;  5JIC A;  3V6D A;  1TKX A;  3CME N;  3WT0 A;  5BRH A;  2OTL N;  4J8F A;  3LP2 A;  2O8B A;  4JI1 K;  3MMV A;  4BRG A;  4JS4 A;  5M1Q A;  3CCR N;  4BVP A;  4OJR A;  3AO2 A;  4CZH A;  3ZET A;  3V81 A;  1CZ9 A;  4BRN A;  3B8A X;  3L2V A;  1QQC A;  2YKM A;  4DUZ K;  4BR4 A;  4C8N A;  4KHN A;  4CE9 A;  3QBW A;  3L4Q A;  4RW4 A;  4KTZ A;  4J2B A;  2FLO A;  4KHW A;  4KB0 A;  3UB5 A;  2NRX A;  2VCP A;  2YI1 A;  4ID1 A;  3AVL A;  1KSP A;  1U45 A;  4B3S K;  3DLE A;  4FJ9 A;  4FK0 A;  4X66 K;  1HKG A;  2PZS A;  3TWH A;  5C10 A;  1TAQ A;  3WXM B;  3KWG A;  4CZJ A;  1RDW X;  4O8U A;  1KC8 O;  4QS8 A;  3KIO A;  2RN2 A;  3KTQ A;  3GL1 A;  2P9L A;  3UE5 A;  3HM8 A;  2D0A A;  3SPY A;  3M3Z A;  3E9P A;  1OH7 A;  4OKJ A;  2HHW A;  2E6L A;  3U9Z A;  4IDK A;  5AQZ A;  3OS0 A;  3VEZ A;  2D5R A;  4J2A A;  4CER A;  3OY9 A;  3VET A;  3SQ0 A;  1WSF A;  3TAM A;  5LJW A;  1JL1 A;  3QO9 A;  4DG1 A;  3R1X A;  2VWB A;  3DM2 A;  3P4I A;  4PUO A;  2Z1J A;  3KLH A;  1C1A A;  1NGI A;  3RSE B;  1Q81 O;  3C6A A;  5IT9 O;  4FLX A;  1K73 O;  1SS6 A;  4F3O A;  3HPO A;  1WLJ A;  3C65 A;  1NK7 A;  4GVM A;  4LSL A;  3HP6 A;  2W6K A;  4WFB L;  1JJ2 M;  2UYT A;  3OYF A;  1RTD A;  4CFD A;  4CIE A;  3OYK A;  4H5R A;  4BDZ A;  2X78 A;  3LP3 A;  3NF7 A;  1JXB A;  3IFR A;  3HO1 A;  4FWQ A;  3NH1 A;  3A8Y A;  1WBB A;  4KI6 A;  1NOY A;  3WXJ A;  2ITM A;  4JKF A;  3OTO K;  4FSV A;  4L8R B;  1ATS A;  4H5T A;  4HCB A;  4CF8 A;  2A3Z A;  3JAM O;  3F9M A;  1ASW A;  4HUF A;  4FJI A;  1RCH A;  1A5W A;  2WUS A;  3NFA A;  3EZ5 A;  2OTJ N;  2QWQ A;  3CHW A;  2OZM A;  3TAG A;  3RMC A;  1XNQ K;  4BWJ A;  4U67 L;  3KLI A;  1S9E A;  5CE3 A;  1NJY A;  2A41 A;  2XRI A;  3D2F B;  3JSM A;  5AQT A;  3JYT A;  1BOT O;  3HP9 A;  3CIP A;  2GWK A;  3H08 A;  3MX2 A;  3SUO A;  2GBZ A;  5M1K A;  2O4G A;  3HRG A;  2FSN A;  4GV9 A;  4DV6 K;  4HHT A;  4YNQ A;  4HUE A;  1IKY A;  3K9K A;  4PY5 A;  4F8R A;  2XHB A;  1CLQ A;  3D2E B;  3VPZ A;  1VQ7 N;  1J6Z A;  5ADX H;  2CGL A;  5CYQ A;  3O4Q A;  3VQ6 A;  3E9L A;  1NJX A;  1JLC A;  2EX3 A;  3NE6 A;  1E4G T;  2O8E B;  4N56 A;  3DLL L;  5HL7 L;  5IWA K;  3WNH A;  2P5G A;  1ZBI A;  4H03 B;  5CZ2 A;  5EU7 A;  4BAC A;  1MWK A;  2E2O A;  3O9T A;  1BIS A;  4GV3 A;  2YKN A;  2NUB A;  2NRW A;  5LY3 A;  2LSN A;  3AO3 A;  3OJS A;  3AVC A;  3VF2 A;  4CZF A;  2UU9 K;  2Z1G A;  3ZEU A;  2FSK A;  1X9M A;  3DLR A;  3E9O A;  3NF9 A;  4CJR A;  4H0X B;  4WF9 L;  3CFO A;  1YXQ A;  4M41 A;  5AQM A;  1VSF A;  3EY1 A;  3V4I A;  3K9J A;  4XEI A;  1ZC6 A;  4JKG A;  1XMO K;  4CJP A;  3QER A;  1BGX T;  1S1U A;  4AHU A;  3HYF A;  4FZZ A;  3TSQ A;  1HPZ A;  3H3N O;  1T03 A;  3J7Y P;  3AAR A;  4RTF D;  3EZW A;  4M3R A;  5BPM A;  1KAY A;  1GLL O;  3W3D A;  4KI4 A;  3CFR A;  4JRP A;  5J2N A;  4DQR A;  4EHU A;  4FPA A;  1NK9 A;  3QNO A;  2O4I A;  1UA1 A;  1Q86 O;  2E20 A;  1Q9Y A;  3HZ6 A;  1IKV A;  3MN5 A;  1I3A A;  1VSJ A;  2QWM A;  1RDB A;  3NAE A;  3DYA A;  3OYA A;  2NZT A;  4LFB K;  3K58 A;  4B3M K;  4CZI A;  3DRS A;  1NLV A;  4JYA K;  2VGN A;  2O8C A;  3FGU A;  5FRO A;  1LAW A;  1N5Y A;  1Z25 A;  4Z94 A;  4JKD A;  2QWP A;  4R5P A;  1NK5 A;  5J2Q A;  3L0Q A;  3OYH A;  3GBT A;  1EKE A;  1K8A O;  2V7Z A;  4JEP A;  4FJL A;  3NGI A;  3L2U A;  2OPS A;  4BRA A;  1IJJ A;  3CD6 N;  3CCL N;  3O3F A;  2G8H A;  4NYF A;  2ZWH A;  3IDH A;  3KK3 A;  4CF1 A;  2RKI A;  5HOO A;  3VF6 A;  4EFH A;  1DKG D;  3D0P A;  1WAJ A;  3HXM A;  1FKO A;  4I6M B;  4ELT A;  2F7T A;  4KRF A;  4IG3 A;  3CER A;  3CQX A;  5AQK A;  3PX6 A;  4FJM A;  3E01 A;  5AZI B;  5C24 A;  4O0I A;  1VSH A;  3ATU A;  3LWM A;  4OPK A;  2CGJ A;  3S41 A;  4PQU A;  4TSX A;  1NGD A;  3Q7C A;  3CPE A;  1WSE A;  3NGZ A;  4K8Z A;  1LWF A;  3BZK A;  4FWS A;  1U04 A;  5GAD P;  3VES A;  3V9Z A;  1SKS A;  3G10 A;  2Q36 A;  3THX B;  4UQG A;  4IKF A;  3VN5 A;  2X6S A;  3K2P A;  2W6L A;  3J8A A;  1RIL A;  2W40 A;  3K5M A;  1EET A;  4EHT A;  4DR6 K;  5AQJ A;  1HPM A;  5KRT A;  2F4V K;  4DSI A;  5GAG P;  3ULE B;  4C8O A;  4Z0U A;  1REV A;  2PYJ A;  4XH5 A;  2IVP A;  2QWN A;  1IKW A;  1CZB A;  2ZF5 O;  1TK0 A;  4CHN A;  1T3V A;  2DFF A;  4JD2 B;  4CEO A;  4OPA A;  4V19 S;  3TR8 A;  2O8D B;  1KLN A;  4B1X B;  4B8C A;  4LH4 A;  3QIN A;  1C0G A;  2WOM A;  1BCM A;  3K59 A;  3MDQ A;  2Q31 A;  5JS2 A;  2KW4 A;  1BI4 B;  3FZK A;  3P39 A;  4BGB A;  2KFZ A;  4K25 A;  4W5R A;  1HNW K;  3QEI A;  3KLF A;  3A5O C;  4N5S A;  2P9K B;  1SQK A;  4B9U A;  3BDP A;  4BQL A;  3TAE A;  3FFK B;  1U49 A;  2VWK A;  5AQL A;  1VSE A;  2R7Y A;  1KLM A;  3RMB A;  2UXB K;  3CC2 N;  1BCO A;  2FSJ A;  4JI8 K;  4YOX A;  1VQN N;  3L3U A;  4W5N A;  4JS5 A;  4M3Z A;  4C8L A;  2G8W A;  4CHP A;  4IO9 L;  3OYJ A;  4OVL A;  4MQ3 A;  3H1Q A;  4CJ5 A;  2VQF K;  1K6Y A;  1L3S A;  1D8Y A;  2UXD K;  3KD1 E;  3VQB A;  4FWK A;  3C6U A;  1QQN A;  3H1V X;  4JV5 K;  3QEW A;  3J81 O;  1BA1 A;  2J4R A;  3VEX A;  3J7Z O;  2A1R A;  4YOU A;  4FWM A;  3CJ1 A;  3J7A P;  5EOY A;  1BIZ A;  2G8K A;  3TTC A;  4GNI A;  3JS6 A;  4QS7 A;  3DXK B;  3QIC A;  1HNV A;  1TVR A;  3IS9 A;  2VGM A;  1BWF O;  4FWO A;  5DM7 L;  4FWR A;  5KGW A;  2E88 A;  4ISF A;  4CZG A;  1XI1 A;  3DAW A;  1TK5 A;  4J2E A;  1RTH A;  4IBN A;  4JI0 K;  3VQA A;  2P9N B;  1N8R O;  3HVT A;  4RW9 A;  2VQE K;  3KVG A;  4H0Y B;  3MN7 A;  3ZX3 A;  4Q0B A;  4H0T B;  4QS9 A;  3JXU A;  1QTM A;  1HX1 A;  1Q8I A;  2HHU A;  1NMN A;  4FJG A;  1BUP A;  2P1J A;  2P9S B;  5KI6 A;  1DGK N;  5AQR A;  4BRO A;  1OH8 A;  5C25 A;  3LZJ A;  4CGH A;  3KKS A;  3ZX2 A;  1NJW A;  2V7Y A;  3SBG A;  5LMN K;  1L3T A;  4KHY A;  4CD3 A;  4K8X A;  2ITG A;  3CJA A;  2QWO A;  4IFE A;  3LDO A;  4LF8 K;  2NRZ A;  4O5B A;  2HW3 A;  4ZTF A;  5JLH A;  5K14 A;  4OX9 K;  3LDN A;  1P90 A;  3KJV A;  4DV3 K;  4DS4 A;  5HRO A;  2AJQ A;  4QAG A;  4FOI A;  2IC3 A;  1MDU B;  1XHZ A;  1GOC A;  4BR0 A;  1O13 A;  5HLF A;  4DQP A;  5J1E A;  1HLU A;  4FO0 A;  4OGE A;  3SCX A;  3NBP A;  5KTQ A;  3P1G A;  3RSE A;  4O4G A;  1FJG K;  3CJC A;  1HQE A;  1QVG M;  3I0R A;  5GIP A;  3WNG A;  3M8S A;  3DI6 A;  4I7F A;  1JXE A;  4E7I A;  3KHY A;  3SUQ A;  4CJF A;  3A5M C;  4ZTJ A;  2OAN A;  3FZM A;  4RWT A;  2FBV A;  4Z4F A;  4YOT A;  4L3Q A;  4NB4 A;  1ZBF A;  4CEZ A;  1N6Q A;  5CR4 A;  1HNI A;  3PX0 A;  1IBK K;  2YHA A;  2YCH A;  1Z05 A;  4DSL A;  4B3R K;  1HJO A;  2WBN A;  4F4K A;  3R9P A;  1BQN A;  3T19 A;  4FJ5 A;  3T3F A;  4CEQ A;  5AQQ A;  1A5V A;  4K42 A;  4XIU A;  2YNF A;  1RFQ A;  3F5T A;  1BDG A;  1VSL A;  4RW6 A;  1NKC A;  1YJ9 N;  1T8E A;  4JLH A;  4DQI A;  3D2F A;  4H5V A;  4PA1 A;  4IJA A;  2KZZ A;  1D5A A;  1QQO A;  3WQT A;  4YFU A;  3MEG A;  5KGX A;  3ZSX A;  3ZT0 A;  2QTD A;  1D4X A;  2NNW A;  2WC9 A;  1NGB A;  3ASM A;  4KH4 A;  4BE2 A;  4FXD A;  1JLA A;  3QIO A;  3EE9 A;  4AHR A;  5M1N A;  4BG9 A;  4B8A B;  3KLG A;  4DS5 A;  2Y1J A;  2P5O A;  4A62 A;  4G1Q A;  3V9U A;  4DTM A;  3D2E A;  1ZBS A;  5C15 A;  1RDD A;  3CQ8 A;  2VYP A;  3GE1 A;  1IG8 A;  3LPT A;  3FFI A;  2P9P B;  2FF3 B;  3R8E A;  2A40 A;  2YHY A;  4CGJ A;  2O8E A;  1J5O A;  4CW7 B;  2YX6 A;  2KHO A;  4X64 K;  1YVU A;  1KVB A;  4DV5 K;  1TUU A;  1JCF A;  1YF5 L;  4BY9 C;  5AQP A;  5TKW A;  5HRP A;  4CF9 A;  2HVI A;  4H5W A;  3OYN A;  1VQP N;  5EVZ A;  4OO1 J;  3IKM A;  4F2S A;  5DM6 L;  4AM6 A;  4RG8 A;  2KLA A;  1SKR A;  1NG9 A;  5CYM A;  4JN4 A;  4FWL A;  2GWJ A;  2D0C A;  3SYZ A;  1NGC A;  4CHZ A;  4OKE A;  2W41 A;  2BDP A;  4FOE A;  3SQ2 A;  4HTL A;  2A5X A;  2Z1H A;  3U3Y A;  4KO0 A;  2NRR A;  4KAZ A;  5AJ3 K;  3WQU A;  1U48 A;  1S6P A;  1VAZ A;  3R3L A;  1E3M A;  3S9H A;  1OKJ A;  4CF0 A;  2QEX N;  4CJT A;  3OS2 A;  4DLG A;  4BC5 A;  2IGI A;  4CEA A;  3O1B A;  1YJN N;  4C23 A;  5F1X A;  3CCV N;  1KCF A;  2F8T A;  1YUW A; 
#chains in the Genus database with same CATH homology
 2ZQB A;  5J2N A;  4CES A;  3U3G A;  3MXI A;  1UA0 A;  1MU2 A;  1ASU A;  4DQR A;  4KHU A;  4Z4I A;  3NF6 A;  2IOC A;  1KRP A;  1NK9 A;  3QNO A;  2O4I A;  3V1O A;  1UA1 A;  3OYC A;  3LAM A;  3P83 D;  1Q9Y A;  1BHL A;  1IKV A;  1I3A A;  1VSJ A;  3ITH A;  1TAU A;  1RDB A;  1VSD A;  2Z1I A;  4CFC A;  3DYA A;  3OYA A;  3NAE A;  3ISN C;  3V9X A;  4KFB A;  5HRR A;  3PY8 A;  4CHQ A;  1C6V A;  1S5J A;  2E6M A;  3K58 A;  1TV6 A;  4DTU A;  2XY6 A;  4CGI A;  4FJ8 A;  1TL1 A;  3LPU A;  1YTA A;  1B9D A;  1YT3 A;  4CED A;  1VK0 A;  1G15 A;  3DRS A;  4H4M A;  4E7H A;  3OYM A;  1U47 A;  4B9N A;  4B9S A;  1JKH A;  1C0U A;  4DMN A;  3AVJ A;  3VQD A;  4RW7 A;  4DFK A;  2HND A;  3KD5 E;  1J54 A;  3QLH A;  4Z4G A;  2QKB A;  4B3O A;  5FRO A;  4FJN A;  1D9F A;  1LAW A;  1WSH A;  1N5Y A;  1EP4 A;  3CYM A;  4I9Q A;  1Z25 A;  1KFD A;  2D0B A;  1SL1 A;  3VQ7 A;  4R5P A;  1ZYQ A;  1NK5 A;  4DFM A;  5J2Q A;  3VQ4 A;  4CEB A;  2GV9 A;  1WAF A;  3ALY A;  4KTW A;  3LZI A;  3OYH A;  4ID5 A;  1GOB A;  3KLE A;  3OVN A;  4CK1 A;  1NK8 A;  1EKE A;  2EHG A;  1HRH A;  1X1P A;  4CJS A;  4M42 A;  3I8D A;  1Y97 A;  1JLB A;  3NGI A;  4FJL A;  3L2U A;  2OPS A;  3VQ8 A;  3ZSR A;  3O3F A;  2G8H A;  2B5J A;  1UAX A;  2XO7 A;  1F21 A;  3AVN A;  4DTN A;  2B4J A;  3AO1 A;  4NYF A;  1QSL A;  1NJZ A;  3KK3 A;  5HBM A;  1RTJ A;  2BGG A;  4CF1 A;  2RKI A;  3V1R A;  2FBT A;  3OYE A;  3ZSZ A;  3PO4 A;  4Z4C A;  3D0P A;  1B9F A;  1WAJ A;  3HXM A;  3QEX A;  4DU3 A;  4KRE A;  3CG7 A;  4E1M A;  2HMI A;  1FKO A;  5D3G A;  3VQ5 A;  1RBR A;  4CIF A;  4ELT A;  3PUF A;  4KRF A;  4BDY A;  3MED A;  4IG3 A;  3LAK A;  1TK8 A;  4LSN A;  4CHO A;  2JGU A;  3PX6 A;  4FJM A;  3HJF A;  2VG6 A;  3DRP A;  1S6Q A;  3E01 A;  4W5Q A;  1SKW A;  1ZBH A;  4FK4 A;  5C24 A;  3K5N A;  4O0I A;  1VSH A;  3LWM A;  4HUG A;  4OPK A;  4Q5V A;  3RMD A;  2HHS A;  4BE0 A;  4FM2 A;  1W9H A;  4PQU A;  4O0J A;  3CM5 A;  4TSX A;  3QNN A;  2OA8 A;  4FJX A;  3ZSY A;  1WSE A;  4AHS A;  4F2R A;  4H8K A;  1R0A A;  3LP0 A;  3NGZ A;  4O44 A;  1Z26 A;  3VQP A;  1LWF A;  1QS4 A;  4CJ4 A;  4K8Z A;  1DLO A;  1UOC A;  2RPI A;  4GW6 A;  4CJW A;  2DY4 A;  1U04 A;  3G0Z A;  2ZD1 A;  4DSF A;  3L2R A;  3MXM A;  4FJK A;  2KQ2 A;  3LP1 A;  4DQQ A;  3THV A;  1TKD A;  4KTQ A;  4OLA A;  3AVH A;  1SUQ A;  2QXF A;  4Y1C A;  3V9Z A;  1SKS A;  4B9L A;  4NYN A;  3G10 A;  4I2P A;  4EP5 A;  4N76 A;  2KZM A;  1T05 A;  5SWM A;  4FLU A;  3AA5 X;  3LAL A;  4UQG A;  3SQ4 A;  4IKF A;  1UWB A;  1HJR A;  1S1T A;  3ULD A;  4PWD A;  1QHT A;  3VN5 A;  1NK4 A;  1QSS A;  2XY8 A;  1FKP A;  2X6S A;  3K2P A;  4KHS A;  4B9M A;  3AVF A;  2HB5 A;  1EX4 A;  1RIL A;  4DU4 A;  4QOZ B;  1J9A A;  4B9V A;  4CJL A;  1RT3 A;  3K5M A;  1EET A;  1S1W A;  2HNY A;  3ZSV A;  5KRT A;  4KB1 A;  3WNE A;  3M8R A;  4DSI A;  1S1X A;  1LWC A;  4E89 A;  1SL0 A;  3HPG A;  4FJH A;  4C8O A;  1XWL A;  1RBU A;  3DLG A;  4Z0U A;  1REV A;  2PYJ A;  4ELU A;  3D45 A;  2DFH A;  1RT2 A;  2HHT A;  1IKW A;  1CZB A;  3RR7 A;  4FZX C;  3F9K A;  3KKR A;  1TK0 A;  4FVM A;  4CHN A;  2DFF A;  1VSK A;  3ZT3 A;  3DOK A;  4CEO A;  4FLT A;  3KK2 A;  3TR8 A;  1BL3 A;  4FK2 A;  4NCB A;  1LAV A;  1KLN A;  4B8C A;  4LH4 A;  3V9W A;  1HQU A;  3QEP A;  1KVA A;  3DLK A;  3QIN A;  3AV9 A;  3BGR A;  4ELV A;  3MXJ A;  4M3X A;  2WOM A;  3RR8 A;  4FJJ A;  1BCM A;  3K59 A;  4Y1D A;  1XHX A;  2FBY A;  1ZBL A;  5JS2 A;  1RT1 A;  2YNI A;  2KW4 A;  4DU1 A;  1BI4 B;  4CFB A;  1HYZ A;  1BI4 A;  1KFS A;  2HHQ A;  2KFZ A;  4E7J A;  4W5R A;  5HRS A;  3QEI A;  3KLF A;  2I5J A;  4JRP A;  4N5S A;  1RBT A;  1B92 A;  3QIP A;  4FJ7 A;  4B9U A;  3WNF A;  3BDP A;  3TAE A;  5T7B A;  4M3Y A;  4FLV A;  3TAN A;  2VWK A;  1U49 A;  3PO5 A;  1DTT A;  1VSE A;  4M3W A;  1L3V A;  2R7Y A;  1KLM A;  2A1S A;  3ZT4 A;  4JRQ A;  4IG0 A;  3RTV A;  4DTS A;  4OGC A;  1EXQ A;  3RMB A;  3TAP A;  1J53 A;  2IDO A;  3VA0 A;  5J2P A;  1BCO A;  3AO4 A;  3L3U A;  3T1A A;  5E41 A;  1X9W A;  1RDA A;  4O55 A;  4JS5 A;  4C8K A;  4M3Z A;  4W5N A;  4OPJ A;  2G8W A;  4C8L A;  2GUI A;  4CHP A;  5DMR A;  4IFY A;  3OYJ A;  4M45 A;  4OVL A;  1BIU A;  4MQ3 A;  4CIG A;  3SJJ A;  1T7P A;  5DK5 A;  4CJ5 A;  3U6F A;  1VSM A;  1K6Y A;  4EP4 A;  3V1Q A;  2HVH A;  1L3S A;  1HMV A;  1RBS A;  4CJU A;  4HVJ A;  1LV5 A;  1D8Y A;  3KD1 E;  3VQB A;  4DTJ A;  1SL2 A;  2G8F A;  3DOL A;  1ITG A;  3OS1 A;  5HRN A;  4CEF A;  4FYD A;  1SV5 A;  3C6U A;  4W5T A;  3CFP A;  4DF4 A;  3IAY A;  2DTU A;  4CEC A;  4CK2 A;  3QEW A;  2P51 A;  3VQC A;  3PX4 A;  3AVI A;  3C95 A;  3K5O A;  3MAQ A;  4HTU A;  4FLW A;  2A1R A;  2IS3 A;  1RBV A;  2F96 A;  3AO5 A;  3HL8 A;  2B6A A;  3V6D A;  4KHQ A;  1TKX A;  4F3T A;  1BIZ A;  4CJK A;  2QKK A;  4DF8 A;  4M3T A;  2G8K A;  2YNH A;  4CGF A;  3DRR A;  3S3M A;  3SV4 A;  3LP2 A;  2YV0 X;  1HNV A;  2KFN A;  2HHV A;  1TVR A;  4CFA A;  3IS9 A;  2PYL A;  4JS4 A;  4AHV A;  4Z4H A;  4OJR A;  3AO2 A;  5KGW A;  1FK9 A;  1RTI A;  3OYG A;  4FCY A;  1XI1 A;  4FM1 A;  3HPH A;  3V81 A;  1CZ9 A;  3A2F A;  3RWU A;  2XY5 A;  3L2V A;  1QQC A;  4FM0 A;  1TK5 A;  4J2E A;  3ZSQ A;  4FW2 A;  3LWL A;  1RTH A;  2YKM A;  4IBN A;  3VQA A;  4E0D A;  4LY7 A;  5J2M A;  3NF8 A;  4C8N A;  3AA4 A;  4KHN A;  4CE9 A;  1W0H A;  2X74 A;  4RW4 A;  3DLB A;  1JLG A;  2X6N A;  3HVT A;  4KTZ A;  4N47 A;  4RW9 A;  3OYB A;  1KVC A;  4J2B A;  4KHW A;  3I0S A;  5SZT A;  4KB0 A;  4ID1 A;  3ZSW A;  3SV3 A;  3TAQ A;  3AVL A;  3AVM A;  4Q0B A;  2ZE2 A;  1KSP A;  1U45 A;  2G8U A;  4FW1 A;  1WSI A;  3DLE A;  1QTM A;  4FK0 A;  4FJ9 A;  2OZS A;  3AA3 A;  1Q8I A;  2HHU A;  4FJG A;  1S9G A;  3OYD A;  4DSK A;  1VRT A;  2PZS A;  2P1J A;  3TWH A;  2PY5 A;  1TAQ A;  5KI6 A;  5KRS A;  1CXU A;  4DSE A;  1VSI A;  3SZ2 A;  2HNZ A;  3KK1 A;  1RT5 A;  2OPQ A;  5C25 A;  1DTQ A;  3KIO A;  3LZJ A;  4CGH A;  3KKS A;  4FLY A;  1IH7 A;  2RN2 A;  1JLQ A;  3HT3 A;  4CJV A;  2OPR A;  1NJW A;  3KTQ A;  5CY4 A;  3VA3 A;  3TAF A;  1L3T A;  4KHY A;  1XC9 A;  4K8X A;  2ITG A;  3AVB A;  1ZBU A;  3SI6 A;  2D0A A;  2FBX A;  5C42 A;  3SUN A;  1NK6 A;  3SPY A;  2ETJ A;  4FZY A;  4O5B A;  3OYI A;  1WNS A;  4OKJ A;  2HW3 A;  4ZTF A;  2HHW A;  4I9L A;  1C0T A;  2VG5 A;  4Z4E A;  2E6L A;  5K14 A;  4IDK A;  4E19 A;  4BE1 A;  3OS0 A;  2D5R A;  3KJV A;  4J2A A;  4WE1 A;  2IAJ A;  1IKX A;  3CM6 A;  1WN7 A;  1IO2 A;  4CER A;  3L2W A;  3VQQ A;  4DS4 A;  3C94 A;  4LD0 A;  4CK3 A;  3OY9 A;  5HRO A;  1VRU A;  4QAG A;  2AJQ A;  2IC3 A;  3SQ0 A;  1WSF A;  3TAM A;  1XHZ A;  4BDP A;  2W42 A;  2OYQ A;  1JL1 A;  4DQS A;  3QO9 A;  4DG1 A;  3SQ1 A;  4I2Q A;  3NH2 A;  1GOC A;  3IG1 A;  3UIQ A;  4KV8 A;  5FRN A;  5HLF A;  4NCA A;  3DM2 A;  4PUO A;  5CZ1 A;  4DQP A;  2Z1J A;  4H4O A;  5J1E A;  3KLH A;  3NGY A;  4OGE A;  1C1A A;  1S1V A;  3SCX A;  4AHT A;  3NBP A;  5KTQ A;  3AVG A;  3P1G A;  4FLX A;  3SUP A;  1WSG A;  4O4G A;  4F3O A;  1HQE A;  3OYL A;  3I0R A;  3WNG A;  1WLJ A;  3DI6 A;  3HPO A;  2BAN A;  3M8S A;  3HVR A;  3RMA A;  1NK7 A;  3LAN A;  4GVM A;  4I7F A;  1JXE A;  4E7I A;  4LSL A;  3SUQ A;  3HP6 A;  3M8P A;  4CJF A;  1RTD A;  1TKT A;  3OYF A;  2G8V A;  4M3U A;  2QK9 A;  4CFD A;  4CIE A;  4AH9 A;  3OYK A;  4DFJ A;  4ZTJ A;  1NOZ A;  3ZSO A;  4IFV A;  4BDZ A;  2X78 A;  3LP3 A;  3NF7 A;  4C8M A;  1D9D A;  5JS1 A;  2FBV A;  4Z4F A;  3VQ9 A;  1JXB A;  3AA2 A;  3HO1 A;  1C1B A;  1ZBF A;  4CEZ A;  3NH1 A;  1N6Q A;  4KI6 A;  3PX0 A;  1HNI A;  3TI0 A;  3S3O A;  4ZHR A;  1O1W A;  1NOY A;  1HYV A;  2YHA A;  5I3U A;  3HK2 A;  4DSL A;  2Y1I A;  4J2D A;  4MFB A;  1ASV A;  4B08 A;  4L8R B;  1C1C A;  3O3G A;  4B9T A;  4F4K A;  4HCB A;  1BQN A;  4CF8 A;  2BE2 A;  3L2Q A;  1ASW A;  3T19 A;  4HUF A;  4FJI A;  4FJ5 A;  1RCH A;  4DLE A;  1A5W A;  3T3F A;  3NH0 A;  3NFA A;  1A5X A;  3P5J A;  1KTQ A;  3EZ5 A;  4CEQ A;  1A5V A;  1JL2 A;  4XIU A;  3PV8 A;  2OZM A;  4EZ9 A;  2YNF A;  3TAG A;  2OPP A;  4ICL A;  3RMC A;  4BWJ A;  3KLI A;  1LW2 A;  4AIL C;  1VSL A;  1S9E A;  1NJY A;  1LWE A;  3K57 A;  4RW6 A;  2XRI A;  1NKC A;  1C0M A;  1T8E A;  4JLH A;  4DQI A;  3JSM A;  3QET A;  3JYT A;  4KPY A;  4PA1 A;  1LW0 A;  3HP9 A;  1NKB A;  4NCG A;  2KZZ A;  3SPZ A;  3SNN A;  1D5A A;  3H08 A;  3O4N A;  4YFU A;  3SUO A;  2Q3S A;  3DMJ A;  2GBZ A;  1L3U A;  3MEG A;  5KGX A;  4CCH A;  1TL3 A;  3ZSX A;  2YNG A;  3ZT0 A;  3B6O A;  2O4G A;  5HP1 A;  3ZT1 A;  2WON A;  1FXX A;  4RW8 A;  3OJU A;  3ASM A;  5FDL A;  3V9S A;  4BE2 A;  4FXD A;  1JLA A;  3QIO A;  4DSJ A;  2G8I A;  4AHR A;  3HM9 A;  1NKE A;  4HUE A;  4HHT A;  4B8A B;  4YNQ A;  3KLG A;  4DS5 A;  2KTQ A;  2Y1J A;  1IKY A;  3B6P A;  4PY5 A;  4LH5 A;  2P5O A;  4W5O A;  4DTP A;  4G1Q A;  4F8R A;  2DFE A;  2XHB A;  4CJE A;  2VWJ A;  1QSY A;  1CLQ A;  3V9U A;  4DTM A;  1JLF A;  5CYQ A;  4CF2 A;  3O4Q A;  3VQ6 A;  4E1N A;  4E7K A;  1RDD A;  3CQ8 A;  3TAB A;  1U4B A;  1NK0 A;  3K5L A;  1NJX A;  4BWM A;  4E3S A;  4DTX A;  1JLC A;  3LPT A;  1Q9X A;  1RNH A;  1GOA A;  2EX3 A;  3FFI A;  3NE6 A;  4EZ6 A;  1RT4 A;  4CGJ A;  3C6T A;  4GMJ B;  4N56 A;  1IG9 A;  4HCC A;  1J5O A;  3WNH A;  3EYZ A;  2P5G A;  4DTR A;  1ZBI A;  2HHX A;  4DWI A;  1JLE A;  1RDC A;  1I39 A;  5CZ2 A;  5EU7 A;  1QE1 A;  1YVU A;  4CJ3 A;  1X9S A;  1KVB A;  5FRM A;  4BAC A;  3IRX A;  2ATQ A;  1BIS A;  1RT6 A;  2YKN A;  3ZCM A;  5HRP A;  4CF9 A;  2HVI A;  3RRG A;  2NUB A;  3OYN A;  3ZT2 A;  2XY7 A;  4F2S A;  1RT7 A;  2LSN A;  3O3H A;  3VQE A;  3NDK A;  4RG8 A;  3AO3 A;  3OJS A;  3S3N A;  3AVC A;  1SKR A;  4CHY A;  1BQM A;  2Z1G A;  5CYM A;  4AHC A;  2JLE A;  4DTO A;  4DFP A;  3MEE A;  2D0C A;  3SYZ A;  3QEV A;  3MEC A;  4CHZ A;  1TGO A;  3M8Q A;  3AVA A;  4OKE A;  3RRH A;  3DLR A;  1X9M A;  2YHB A;  2BDP A;  3HST B;  4E7L A;  3SQ2 A;  3NF9 A;  4N41 A;  4CJR A;  4FLZ A;  3CFO A;  2Z1H A;  3U3Y A;  2VG7 A;  4KO0 A;  4M41 A;  3NHG A;  3DLH A;  4KAZ A;  3AVK A;  4QCL A;  1VSF A;  3EY1 A;  3V4I A;  1S6P A;  1WSJ A;  1U48 A;  1YTU A;  4CGG A;  4OLB A;  3S9H A;  2E4L A;  5I42 A;  4CEE A;  3L8B A;  4CF0 A;  4CJP A;  3QER A;  1BGX T;  1S1U A;  4AHU A;  4CJT A;  4OKK A;  3HYF A;  3OS2 A;  4FZZ A;  1HPZ A;  3NCI A;  1T03 A;  4CJQ A;  2FC0 A;  3LDS A;  4DLG A;  3TAR A;  2IGI A;  4M3R A;  3QES A;  1HYS A;  2F8S A;  4KKO A;  4CGD A;  2RF2 A;  1L5U A;  4CEA A;  3F73 A;  3L3V A;  4KI4 A;  2F8T A;  1TKZ A;  1KCF A;  3CFR A;  1CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...