4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
3SV4A 1F21A 3P1GA 1D9DA 2KZMA 4E7JA 4CJFA 4CFBA 3FFIA 2GV9A 2OPRA 4UQGA 2HHQA 3SZ2A 4OVLA 1U48A 2VG7A 3KKRA 3ZSQA 4DG1A 2R7YA 1C1BA 4AHUA 2IS3A 2G8VA 4YNQA 3CQ8A 4FW2A 1NK9A 1D9FA 3S3NA 4CFCA 4FJHA 1HYZA 4H4MA 3O3GA 1QE1A 4NCGA 3KD1E 4DU4A 2FC0A 4CECA 4M3WA 4CJVA 1D5AA 1WAFA 1Z26A 1QSSA 4OLBA 4C8OA 1TL1A 1ASUA 3QINA 2X78A 3LPUA 4NCAA 4FZYA 3E01A 3AVBA 5J2NA 3KK2A 4CJRA 2Z1HA 3AA3A 3HT3A 3SV3A 3V9WA 1C0UA 1NJZA 3DLGA 1A5WA 1KVCA 1RBUA 4DSKA 3D45A 3IG1A 5JS1A 1NJYA 4OKKA 1J53A 1RCHA 2RPIA 4OGCA 1BGXT 4LSNA 4CJ3A 3AVMA 4W5QA 3HPOA 3K5LA 4M41A 1JL2A 4CEQA 2PZSA 3LANA 3QIOA 4Z0UA 4DS5A 4RG8A 1K6YA 4DF4A 3U6FA 1C0TA 1FKOA 1W9HA 1VRUA 4PWDA 3ASMA 3L2WA 1NJWA 4FJJA 1L3VA 3HL8A 2B5JA 4CEDA 4BDPA 4KTZA 3VQPA 4BDYA 1RT2A 1RT1A 4ZTFA 3PX4A 3AA2A 4DSLA 1J9AA 1JLFA 3CM6A 3T1AA 5FRMA 2HNZA 1W0HA 2BANA 2YNIA 3L2RA 1SL0A 4K8XA 3SUPA 3AO1A 2Z1IA 1FKPA 1NK7A 3V1OA 4M3UA 1EX4A 2ZE2A 3CFPA 4Z4EA 3MECA 5C24A 1TK0A 2KFNA 1QTMA 3OYKA 1FXXA 3P83D 5SWMA 1QHTA 3HSTB 1IKXA 3V4IA 3OYGA 4B9MA 1R0AA 2LSNA 1VSKA 4J2EA 2BGGA 4FJGA 3T19A 3OYDA 1WSHA 3DOKA 2PY5A 3C95A 4CGIA 4R5PA 3JYTA 4W5NA 2KZZA 3TAPA 3LP2A 2FBXA 1A5VA 3VQCA 4RW7A 3S3OA 1T03A 1J5OA 2EHGA 3ZCMA 4FJKA 4KKOA 1DTTA 4QAGA 5HBMA 3OYJA 2WONA 4AILC 4DTNA 3QEIA 2F8TA 2KFZA 1S9GA 2A1SA 4RW8A 3VQ6A 3VA0A 4BACA 1UWBA 5HP1A 4JLHA 4CGDA 1JLBA 3EY1A 4CCHA 3EZ5A 2X6NA 1X1PA 4OPJA 3TAMA 4IFVA 3OYHA 4RW4A 1X9SA 1LAWA 1G15A 1RDBA 2IDOA 1VSFA 1TL3A 2YKMA 3O3FA 3S3MA 4L8RB 1ZBLA 2O4GA 4DS4A 3ALYA 3VQ8A 4FZZA 4QOZB 1RTJA 2I5JA 1BI4A 1HRHA 3KLIA 3PUFA 5CYMA 2X6SA 3OYMA 1TV6A 4BE1A 3KLHA 1QSYA 3HYFA 5J1EA 3JSMA 4DMNA 1WLJA 2EX3A 4CF8A 3MXJA 3TANA 4FYDA 5T7BA 2ZD1A 1TK8A 4B08A 1NK8A 4CIEA 4FLTA 3DLRA 1EETA 5HRNA 3NGYA 3PX6A 4F4KA 1L3SA 1KRPA 2HHWA 4I2QA 4HUEA 3UIQA 3KIOA 4C8MA 4DQRA 5J2PA 4CEFA 4DWIA 3HJFA 1JLEA 1JLAA 3ZSRA 3DLHA 2QKBA 1S1UA 4CHQA 3SUOA 3SJJA 1CZBA 1I3AA 2XY6A 1C6VA 4H4OA 3KK1A 4E7HA 4W5RA 4O4GA 4LH5A 4J2AA 1EP4A 4CEAA 3IAYA 4FJ5A 3SPYA 4CHOA 1CZ9A 1C1CA 1KLMA 3SUNA 3S9HA 3G10A 1SKRA 2D5RA 4DTJA 3L2VA 2G8IA 4LY7A 4CHPA 2W42A 4CEOA 4ID1A 3RMBA 5HROA 3KTQA 2HVIA 1UOCA 4JS5A 3HK2A 2JGUA 2IOCA 4IG3A 4MQ3A 3NBPA 3ZSYA 3ZSZA 4CE9A 4EP4A 1GOAA 3AO4A 3LPTA 5SZTA 3ZSOA 1C0MA 1O1WA 4CK2A 4BDZA 4E7KA 3DLBA 1TKXA 4FJMA 1IO2A 4GMJB 2X74A 3QLHA 4F2SA 2QKKA 1RTIA 1RDAA 4FJLA 1U04A 4FJNA 4JRQA 4CEEA 4IBNA 4FLZA 3AVFA 3WNHA 4HTUA 4Q5VA 1IKYA 3B6PA 4E89A 3AV9A 1VSMA 2Z1JA 4CJSA 2KQ2A 4E0DA 4F2RA 4I9LA 1TKTA 3I8DA 2E6MA 4KREA 1KVAA 1U49A 3C6TA 4CGGA 4N5SA 3V81A 4DFPA 2NUBA 1IH7A 1BIZA 1YT3A 1IG9A 4CEZA 3ZT2A 3M8PA 3QEVA 4IKFA 3O4NA 3A2FA 3LALA 4CEBA 3B6OA 1B9DA 4CK1A 1SKSA 3DRRA 3VQEA 4M3YA 1QQCA 3ZSXA 3ZSVA 3HM9A 4PY5A 1S6QA 5C42A 3SI6A 3DRSA 3G0ZA 4AHCA 3CYMA 2ETJA 4HUGA 4KHUA 1GOCA 3AVJA 2HVHA 2QK9A 3OYCA 3RRGA 4FLYA 1TKZA 4CJPA 4F3OA 2Q3SA 4FK0A 5HRPA 1NJXA 1SUQA 3CG7A 5KRTA 4Y1DA 1U45A 3V6DA 2PYLA 4O0JA 4OKJA 3WNEA 3DLKA 3K5MA 1LW2A 2YNFA 4CJUA 3TWHA 4OLAA 3SQ4A 3OY9A 3TAFA 2HNYA 4B9TA 4Y1CA 1DLOA 1FK9A 2G8FA 1HQEA 4CK3A 4DLGA 4HUFA 4JRPA 4ELUA 2F96A 4DTRA 1B92A 1SV5A 1WSFA 1Q9XA 1SKWA 4DSJA 1N6QA 1JLQA 3PO5A 3NH0A 2IAJA 5KRSA 5FDLA 3L2UA 4E19A 3T3FA 3ZSWA 4DSFA 2HHUA 2B6AA 1KCFA 4AHVA 1RDCA 1S5JA 3OYFA 1RDDA 2G8UA 2AJQA 4CJTA 1VSEA 3VQ5A 5HRRA 4FW1A 1D8YA 4N76A 1YVUA 1WSGA 5CZ1A 4CGJA 3SPZA 4KRFA 3PX0A 3RMCA 2OPQA 1S6PA 4CF1A 3RMDA 3OYNA 3ZT0A 4KI6A 2P51A 1KLNA 1ZBIA 1CXUA 4Z4GA 1SL1A 3OYIA 4CJLA 3M8RA 4M45A 4K8ZA 4CFAA 4GVMA 3LP1A 3NE6A 4DTMA 4RW9A 1LWCA 1RBRA 4O55A 1LWFA 5HLFA 4NCBA 4FLVA 3HP6A 1LW0A 1TAQA 2P1JA 5DMRA 3MEGA 1N5YA 1ZBUA 3MEDA 4HHTA 1A5XA 4DTSA 2F8SA 5DK5A 3C94A 1YTAA 1XHZA 4C8KA 3RRHA 1Q8IA 4HCBA 2RF2A 3HVTA 3OS2A 3PO4A 1BQNA 3I0SA 4IDKA 4AHTA 1KVBA 4YFUA 2HMIA 3L3UA 4CJ5A 3VA3A 3SCXA 4ZTJA 4DSEA 4F8RA 1S1VA 4LD0A 3TAGA 4FM2A 4Z4IA 3ZT3A 3OJUA 3SNNA 3VQAA 3NHGA 4ELTA 4Z4CA 2G8WA 3KD5E 4BWJA 1VSIA 2E6LA 3HPGA 4B9NA 3NF8A 4C8NA 2ATQA 3HPHA 2OZSA 1BCMA 4I7FA 1IKVA 2IGIA 3NF6A 3P5JA 5CY4A 5CYQA 3SYZA 1NKCA 1UAXA 2E4LA 3TABA 1RBTA 1XHXA 3DMJA 1X9WA 1HNIA 3NGZA 3NCIA 4Z4HA 2FBYA 5KGWA 4KHYA 1ASWA 3IS9A 1WSJA 3OJSA 1HYVA 5J2QA 4CJEA 3DRPA 3TAEA 2XHBA 3NGIA 3IRXA 3PV8A 4J2BA 1WNSA 1GOBA 1RILA 4CIGA 1JLCA 1X9MA 1T7PA 4KTQA 5E41A 4DFMA 2OPSA 4CHZA 4CHYA 2XRIA 3V9ZA 1XI1A 4XIUA 3AA5X 4N41A 2XO7A 4KB0A 3AVKA 1NKEA 1LAVA 3DLEA 3BGRA 3HXMA 4CGFA 4OPKA 3KJVA 4PUOA 5D3GA 3CFOA 4E1MA 4WE1A 4ELVA 2D0CA 1RT6A 2YHAA 2KTQA 4DFJA 1KFDA 2DFHA 4BWMA 1VK0A 3OYBA 4M42A 4DTOA 4FCYA 1KTQA 3OYLA 4LSLA 1HMVA 3NFAA 2G8KA 2WOMA 2ZQBA 1VSDA 3KKSA 4NYFA 1WAJA 3AVNA 2DFFA 3M8QA 3LAKA 4O44A 4N47A 3QEWA 1BL3A 5I42A 4J2DA 1BISA 4C8LA 1BQMA 4ICLA 4DLEA 5KTQA 1DTQA 4FLWA 2IC3A 3VQ7A 4DU3A 4DU1A 1BIUA 3QERA 5JS2A 2GUIA 3THVA 2DFEA 5I3UA 4B3OA 4DQQA 3K57A 1S9EA 2XY5A 2OZMA 2HNDA 4EZ9A 3HP9A 3V1QA 4E7IA 1Q9YA 4TSXA 5CZ2A 4B9SA 3RR8A 4DQIA 2DY4A 2HHVA 3LP0A 4OKEA 3K59A 4FK2A 1HQUA 5C25A 1HNVA 3VQBA 4B8CA 3F73A 3QNNA 3OYEA 1U47A 4PQUA 2YV0X 2DTUA 4CHNA 4LH4A 1S1XA 3MAQA 3AO2A 1TK5A 1NK0A 2G8HA 3DM2A 4CESA 4B9UA 4CIFA 2VWKA 1BHLA 2HHXA 3NAEA 1RT7A 4E3SA 4HCCA 3U3GA 3AO5A 3DYAA 4FLXA 1XWLA 3V9UA 1SL2A 1Y97A 3CFRA 1RT5A 2Y1JA 4OJRA 4AHSA 4CJKA 2BDPA 5KI6A 3AVCA 3O4QA 2RN2A 1NK4A 1UA0A 3L2QA 1I39A 2YNGA 4CGHA 1REVA 3NH1A 1U4BA 2HW3A 5K14A 2OA8A 4KHWA 2HB5A 5J2MA 2GBZA 1RTHA 2D0AA 4CJ4A 3MEEA 4EZ6A 4DF8A 4FM0A 3QESA 4W5OA 3DI6A 3DOLA 1ITGA 3WNGA 2P5GA 3I0RA 4FJ7A 2XY8A 4FXDA 4DQSA 3AVAA 3TR8A 3HVRA 3SQ0A 3SUQA 1IKWA 1RBSA 4FJ8A 3LDSA 1NOZA 1JXEA 1B9FA 3TAQA 1HPZA 4GW6A 4O5BA 3WNFA 4CF0A 2P5OA 2BE2A 3VQ9A 2QXFA 1ZYQA 3BDPA 1JXBA 4EP5A 1RTDA 3RR7A 4NYNA 4DTPA 4QCLA 1WSEA 3K58A 3V1RA 3C6UA 4PA1A 3H08A 5HRSA 4DTUA 3ZT4A 3MXIA 1EXQA 2YKNA 4B8AB 1TVRA 1TKDA 1L5UA 4FJXA 3LP3A 3OVNA 3QIPA 2FBVA 4M3TA 3AA4A 4KV8A 4DFKA 3TARA 2YNHA 4E7LA 4FJ9A 3OS1A 1L3TA 4BE2A 3RMAA 4M3XA 4CJWA 3LZJA 4FJIA 1HJRA 4MFBA 4AHRA 2B4JA 3M8SA 3QETA 4CF9A 3V9SA 4ID5A 3MXMA 4H8KA 4CF2A 1NK5A 1NKBA 1YTUA 2JLEA 4BE0A 4DTXA 1CLQA 3QNOA 3QO9A 3RTVA 1JKHA 1CXQA 4FK4A 4FVMA 1QS4A 2RKIA 3U3YA 3OYAA 4I9QA 3K5NA 1ZBHA 3KK3A 3LWLA 3QEPA 1NOYA 4KI4A 3NH2A 4IG0A 1VRTA 1WSIA 3KLEA 1BI4B 1WN7A 3LWMA 2O4IA 3HO1A 3AVLA 4I2PA 4Z4FA 1VSLA 3LAMA 1RNHA 1UA1A 4KO0A 3ITHA 2VG5A 1XC9A 3D0PA 1LWEA 2KW4A 3AO3A 2ITGA 4KPYA 1L3UA 3AVHA 1TGOA 3F9KA 4DQPA 4CFDA 2HHTA 1TAUA 1NK6A 2YHBA 4Q0BA 1VSJA 1S1TA 3VQDA 4B9LA 3ULDA 4DSIA 5KGXA 4O0IA 2Y1IA 1RT3A 4N56A 4W5TA 3L8BA 2A1RA 4ZHRA 2OPPA 3L3VA 1JLGA 3NDKA 2XY7A 1KFSA 4KAZA 3OS0A 4CJQA 3PY8A 3NF9A 1EKEA 4E1NA 4IFYA 4FLUA 4KTWA 4M3ZA 2FBTA 4KHNA 3QEXA 1JL1A 3ISNC 3EYZA 5FROA 4CERA 4G1QA 1KSPA 4B9VA 2D0BA 4JS4A 4M3RA 3VN5A 2VWJA 3V9XA 1LV5A 2OYQA 1QSLA 5FRNA 3KLGA 3SQ2A 1MU2A 3AVGA 4AH9A 3LZIA 3SQ1A 3NF7A 1J54A 3TI0A 4OGEA 4KB1A 1T05A 3CM5A 1BCOA 1S1WA 3VQ4A 1T8EA 3K5OA 4FZXC 4KHQA 5EU7A 1RBVA 2PYJA 3RWUA 3K2PA 1RT4A 1Z25A 4F3TA 4HVJA 3KLFA 1HYSA 1ASVA 4KFBA 3ZT1A 2HHSA 1C1AA 3O3HA 1ZBFA 2VG6A 1VSHA 4RW6A 4FM1A 3VQQA 4KHSA 2Z1GA 3AVIA
chains in the Genus database with same CATH superfamily
3HTVA 3P1GA 5AQPA 4CJFA 4CFBA 2QWNA 2HHQA 2VG7A 3KKRA 2R7YA 4AHUA 1VQ6N 5HOOA 4FJHA 3KD1E 4NCGA 4DU4A 3ZX2A 2WC9A 1QQOA 1D5AA 1Z26A 4FWKA 2X78A 4FZYA 3CJAA 2GUPA 2CGJA 3V9WA 2Z1HA 3OTOK 3DLGA 4BGBA 1A5WA 1RBUA 2P9KA 1NJYA 3D2FB 2RPIA 4OGCA 1VQMN 1G99A 4IJAA 3AVMA 4BC5A 2QEXN 4DR3K 3CI5A 4DS5A 1VQ5N 4NXMK 3SBTA 1FKOA 1W9HA 3LDNA 3GBTA 3FE1A 5FLXO 3PX4A 4BC4A 3T1AA 4K8XA 4H03B 3SUPA 1FKPA 4C23A 2E2PA 3MECA 2KFNA 1NGGA 3OYKA 4IO9L 4BRGA 3V4IA 1R0AA 3HI0A 1VSKA 2VYPA 4FJGA 3GE1A 5JLHA 3AY9A 3JYTA 4A61A 3K0SA 2O8DB 4BR9A 1A5VA 3ZCMA 1GLDG 3QEIA 3OBYA 2F8TA 4DTNA 2KFZA 3VA0A 3QICA 1WBBA 1HUXA 4JLHA 4CGDA 3T1YK 1E4FT 4NLBA 3C6HA 3OYHA 1RDBA 2YKMA 1TL3A 4DS4A 1HLUA 3ALYA 2I5JA 1BI4A 5CYMA 3LDOA 1MWKA 5AQXA 1RGIA 3Q7CA 4PKGA 1VQ7N 3CC7N 2H3GX 4DQRA 5J2PA 4CEFA 1JLEA 1JLAA 4K41A 3DLHA 1BO5O 1I3AA 2XY6A 2P9LA 3OHRA 3VETA 1SZ2A 2EWSA 2ITMA 3SUNA 1VQKN 3S9HA 2W40A 1XMOK 2G8IA 2FF6A 3MN5A 4CEOA 4ID1A 5HROA 3KTQA 5CHIA 3VMFB 1UOCA 2O8BB 3KZBA 3HRGA 3HK2A 4GV3A 3D7EO 4ZTJA 3TSUA 3FZLA 5FPNA 3AO4A 3I56N 4GMJB 2X74A 4F2SA 3WXLA 4JN4A 4JKAA 3O9RA 1YAGA 4E89A 3AV9A 1VSMA 3UKRB 4I9LA 4KREA 1KVAA 3HZ6A 3C6TA 5C2DA 3CCJN 4B3MK 2W6KA 5AQWA 4BR5A 1Q18A 4I6MB 4YOVA 1IG9A 4IKFA 4CEBA 3B6OA 4CK1A 1QQCA 3ZSVA 4MDBA 1S6QA 2A6AA 4AHCA 4M63C 2VWBA 4MO4A 1GOCA 3AVJA 2HVHA 4B3SK 2QK9A 1M1KO 2Q3SA 5HRPA 1NJXA 1SUQA 1LOTB 2Q0UA 1U45A 2ASOA 3WNEA 4CJUA 3CJCA 3OY9A 2HNYA 4B9TA 5KPRA 4CK3A 2UXDK 4JK9A 5TKYA 3IKMA 1HKBA 2QI2A 3PIOL 1NLVA 3PO5A 5FDLA 2E2OA 2FSKA 1D4XA 4OX9K 4E19A 3T3FA 3PSIA 3ZSWA 3PSFA 4A5BA 1YVNA 1RDCA 1S5JA 4AHVA 3OYFA 2AJQA 5HRRA 1D8YA 1YIJN 4N76A 5ADXH 5CZ1A 4KRFA 2WTUA 3SBGA 2WFBA 2D0OA 2FLOA 2P51A 3DXMA 1SL1A 4CJLA 3VGLA 5C12A 4GVMA 3LP1A 3NE6A 4O55A 5HLFA 4NCBA 1LW0A 2P1JA 2PFUA 3SAGA 1N5YA 3MEDA 3ZETA 2F8SA 1IJJA 3RRHA 4HCBA 2HBKA 3OS2A 2GTDA 1EWRA 4AHTA 4XH1A 3L3UA 4CJ5A 3P38A 3TAGA 3ZT3A 5M1QA 3OJUA 3NHGA 3EKUA 2F7TA 3I8BA 3KD5E 4CZEA 1VSIA 3C6AA 3R9PA 3A5LC 4FWOA 1OH7A 3ULEB 1BCMA 4EHUA 2YHWA 1IKVA 2IGIA 3NF6A 3SYZA 4BC3A 3TABA 1XHXA 3ZX3A 3NCIA 3GDQA 5KGWA 3IS9A 1KAXA 3SMSA 2UUAK 3TAEA 3CPEA 3NGIA 5JICA 3AAQA 4CIGA 1T7PA 3D2FA 3GL1A 2OPSA 1XI1A 1XNQK 4JI1K 5EY4A 4N41A 3AVKA 4CVNE 1LAVA 1NMDA 2UU9K 1QZ6A 3HXMA 3O4WA 4WE1A 4IJNA 2D0CA 4KH5A 2P9UB 2YHAA 4NLCA 4DFJA 4CZKA 2DFHA 3E9OA 4DTOA 3U9DA 4LSLA 1HMVA 4MO5A 2WOMA 3AVNA 5HL7L 3M8QA 1VQ8N 4O44A 4B3TK 3MWPA 4J2DA 1BISA 2QWPA 1VQ4N 5A2QO 1DTQA 4FLWA 3VQ7A 3QERA 5JS2A 3CJ9A 3K57A 3PLAA 3KVGA 4A2BA 1Q9YA 4TSXA 5CZ2A 4C1NK 3M1FA 4PL8A 3LP0A 4FK2A 2P9PB 3A0IX 3EO3A 1HNVA 4BRDA 1U47A 4YDUA 5AQZA 1Q7YO 4H0YB 4JK7A 4CHNA 1NBWA 3MAQA 3AO2A 3DM2A 1BHLA 2QTDA 3NAEA 2QW9A 4BGAA 1NGHA 2BTFA 3D2EB 2NNWA 2E8AA 4JKEA 5C15A 1UA0A 1RDUA 3C0BA 2YNGA 2HW3A 1REVA 1U4BA 3VERA 3MX5A 5K14A 1M90O 4KHWA 5J2MA 4H0OA 2D0AA 2UUBK 3BUZB 3LM2A 2IVOA 4BRFA 3L4IA 4FM0A 4W5OA 3DI6A 1ITGA 3I0RA 4B9QA 3AGKA 1YXQA 4DQSA 4ISGA 3SUQA 1IKWA 3CD6N 1JXEA 1B9FA 2QM1A 3TAQA 1HPZA 4O5BA 3WNFA 2A5XA 3VQ9A 3A5NC 4BC2A 4NYNA 1WSEA 4PKIA 1TKDA 1L5UA 4NB4A 4M3TA 3LDPA 4DFKA 1TYQA 1QQNA 3RMAA 4FJIA 4OPAA 3M8SA 4CF9A 1NK5A 4JI5K 4LFAK 1YI2N 1JKHA 1QS4A 3U3YA 4CZIA 3QEPA 4KI4A 3JXUA 1BI4B 1WN7A 2O4IA 4HWIA 3HO1A 3SLCA 4I2PA 4K0KK 1VQON 5EOYA 1L3UA 3AVHA 4CD1A 3F9KA 3THWA 2HHTA 3VQDA 4GV6A 3M6GA 5KGXA 4O0IA 2Y1IA 4N56A 3EN9A 3L8BA 2O8DA 2XY7A 1KD1O 3BZCA 4DV4K 1KFSA 3OS0A 1RDWX 4E1NA 4BVPA 3ID6A 4KHNA 4X64K 1LCUA 4CERA 3F2KA 4M3RA 2VWJA 4AM7A 2D4WA 4AH9A 3TU5A 4KB1A 4YY3K 3QMLA 3VQ4A 1BUPA 3OW2M 3K5OA 2HBJA 3CQXA 1RBVA 2NRRA 1HYSA 5TKWA 3C7NA 4F9OA 1ZBFA 1VQPN 2F9WA 4JI3K 4H0XB 3VQQA 4KHSA 4B9LA 4O8UA 2KZMA 4E7JA 1ATSA 4A62A 4LFBK 3ZSQA 4DG1A 1C1BA 4YNQA 1NK9A 4FW2A 1D9FA 3S3NA 4CFCA 4DB3A 1WOQA 5BN8A 2O8CA 4OLBA 1TUUA 2NRTA 3E01A 3CCSN 5J2NA 1C0UA 2DPNA 1IBMK 3DLLL 1KVCA 3CERA 4B1YB 4IOCL 5JS1A 5AQNA 1RCHA 3UE5A 2HF4A 3ZEUA 1KXPA 3QIOA 5C2FA 3H3NO 4PWDA 5LY3A 1S72N 2KHOA 1L3VA 4O8KA 3VQPA 3EL2A 5AZJA 1P90A 4DSLA 4JHDA 2O8FA 4ILJA 2HNZA 5M1PA 2YNIA 3L2RA 4ILHA 1DEJA 4M3UA 1HKCA 2ZE2A 3CFPA 3O9UA 4BVOA 3P83D 3H3OB 5SWMA 1NGDA 3HSTB 1NGEA 4LF4K 1DGKN 1NGIA 4CZFA 1T6CA 3WXIA 4J2EA 1S22A 3OYDA 2PY5A 2QWMA 3DOKA 3CJ1A 2E20A 4R5PA 4DR4K 2OTJN 4WCEL 2KZZA 2FBXA 1Y64A 3OYJA 4QAGA 4CJ7A 2WONA 1S9GA 2A1SA 5GADP 4DUYK 4BACA 3SAHA 1UWBA 1JLBA 1XQSC 2FF3B 3EZ5A 2X6NA 3IUCA 4IFVA 2P5GA 2QWRA 1G15A 3O3FA 1VSFA 5AQOA 3HSCA 1ZBLA 4IXCA 3VQ8A 4FZZA 1RTJA 3PUFA 3N4PA 3R1XA 4GKKK 2CGLA 3KLHA 2OANA 1VQNN 1WLJA 2EX3A 4FYDA 1W2BM 4FLTA 3CF5L 2FSNA 1NGFA 1EETA 3DLRA 3NGYA 3WEEA 1NG9A 1KRPA 4I2QA 4HUEA 3UIQA 3ENHA 3KIOA 4C8MA 3DAWA 3M5RA 4CHQA 1OVQA 1C6VA 4H4OA 3O8MA 4LH5A 3BP8A 3IAYA 4FJ5A 4OO1J 1CZ9A 1SKRA 2GX9A 3VEVA 2VQFK 2W42A 1MDUB 2E1YA 2HVIA 3IFRA 4JS5A 2JGUA 4MQ3A 4CE9A 3VF4A 4FJNA 4E7KA 1IO2A 1JCEA 3QLHA 3E9PA 1RTIA 1RDAA 3L4QA 4JI4K 4FLZA 4BR0A 3AVFA 3WNHA 4HTUA 1IKYA 3B6PA 1GLBG 4BROA 4CJSA 5AQLA 1U49A 2Q36A 4FO0A 4DFPA 2NUBA 1J5EK 1IH7A 4CEZA 3GG4A 3M8PA 3MK6A 3BZKA 4X65K 5CE3A 5JVGL 3LALA 4M3YA 5F1XA 1SKSA 3ZSXA 5C42A 2O8EB 3DRSA 3CYMA 2ETJA 5AQKA 1VHXA 5LJWA 1SS6A 5AZIA 4Y1DA 4FPAA 4JKGB 4YOUA 1LW2A 2YNFA 5E84A 4GVEA 3P4IA 3O1BA 4X62K 1DLOA 3EZWA 2G8FA 4DLGA 4A57A 1SV5A 3IDHA 1SKWA 1JLQA 2IAJA 3R8EA 3QFPA 2HHUA 1KCFA 2G8UA 3EE9A 3VTIA 3VQ5A 2WBNA 1X3MA 2HF3A 4BG8A 1YVUA 3SPZA 3WQUA 5AQJA 3LDQA 3VGKA 3PX0A 1S6PA 4CF1A 4AQYK 3OYNA 1KLNA 1N34K 3E9LA 1N33K 3SJHA 3G71N 4Z4GA 3M8RA 3TPQA 4FLVA 3HP6A 1TAQA 1A5XA 4FWRA 5AQYA 5DK5A 3C94A 1YTAA 4C8KA 1Q81O 1YHQN 3I0SA 3S41A 4GKJK 4Z4IA 1S1VA 1DT9A 4YORA 5AQHA 1BU6O 1VAZA 3HPHA 2OZSA 5M1KA 4I7FA 5CY4A 5CYQA 2UXBK 4WQ5C 1UAXA 1WUAA 4C1NI 1RBTA 1YITN 3DMJA 3UB5A 1HNIA 1OVYA 3FZFA 4Z4HA 2FBYA 1WSJA 5J2QA 1HYVA 3THXA 3DRPA 2XHBA 3IRXA 1NGCA 1WNSA 1JLCA 5E41A 4DFMA 4O5FA 4CHYA 2XRIA 2ZJPL 1GLAG 3BGRA 4CGFA 4OPKA 3VENA 1V4SA 3RSEB 3CFOA 4CZLA 2Q31A 1RT6A 4KH4A 2KTQA 1W7AA 2QWQA 1KFDA 4IDHA 4BWMA 3PIPL 3MN9A 4FCYA 1KTQA 3OYLA 1KC8O 1VSDA 4NYFA 3MWTA 5AFUA 2Q0RA 2AP1A 2DFFA 4BRQA 4N47A 3QEWA 3H1QA 4C8LA 1BQMA 3DWLA 3CXCM 4DU1A 3THVA 4B3OA 2ZWHA 3V1QA 3THYA 4DQIA 3K59A 5C25A 1JJ2M 3VQBA 2RHKA 3QNNA 4LH4A 4CW7B 1NK0A 2VWKA 3SK3A 3M3ZA 1RT7A 4HCCA 3U3GA 3AO5A 1XWLA 3V9UA 5KQ8A 1Y97A 3CFRA 1SL2A 1RT5A 4AHSA 4BREA 5KI6A 1GLFO 3AVCA 4PKHA 1I39A 4U67L 4H5RA 1HR0K 3FLCO 3CQYA 1WB9A 3WUHA 4CJ4A 2VQEK 3MEEA 5BR9A 4DF8A 4QS7A 2GWJA 3CCRN 3DOLA 3AVAA 3SQ0A 1V4TA 1RBSA 5KPZA 1NOZA 5EVZA 2E1ZA 4GW6A 2P9SA 3LDLA 1ZYQA 3BDPA 4CBWA 2P9SB 4KBOA 4DTPA 5F0XA 3THWB 5ELZA 3K58A 3V1RA 5BPLA 1ESVA 4IEIA 3ZT4A 4B8AB 4FJXA 1TVRA 2IVPA 2QWLA 3QIPA 2FBVA 1BDGA 3AA4A 4KV8A 2YNHA 4E7LA 3OS1A 5GINA 3LZJA 3Q7BA 2P9LB 3WXJA 4CF2A 2JLEA 4DTXA 5GAHP 1IBLK 3QNOA 1BG3A 1CXQA 4IO8A 4FVMA 1N32K 2NRWA 3K5NA 3O5BA 3NH2A 3MX2A 1WSIA 2UYTA 4H5WA 4JKDA 3LWMA 5AQRA 3AVLA 3VTHA 3LAMA 3CJ7A 1UA1A 4DV1K 2IIRA 3O1WA 4KO0A 4V19S 3H45C 4BRKA 1XC9A 3D0PA 3MCPA 2KW4A 3AO3A 2VGMA 1TGOA 4CFDA 2ZGYA 5LMUK 1VSJA 1S1TA 2YX6A 2A1RA 4ZHRA 1RFQA 1JLGA 3BEXA 3L3VA 3NDKA 1ZXOA 1EKEA 4M3ZA 2FBTA 4BRIA 1Z6RA 4JEPA 4H5VA 3KLGA 1OH8A 1MU2A 4OGEA 3CM5A 1T6DA 1T8EA 4FZXC 3ZYYX 3G4SN 2PYJA 3RWUA 4DV6K 1Z25A 2NRVA 1ASVA 1C1AA 2VCPA 4YOYA 1VSHA 3J81O 3E66A 2NLXA 3AVIA 1BOTO 3O9TA 4L3QA 3FZHA 5FPDA 2P9IB 4UQGA 5AQQA 4OVLA 3SZ2A 1U48A 2G8VA 3WXKA 4B1WB 2HBLA 3CQ8A 4DV3K 2V51B 2ASMA 4GY2B 1HYZA 3O3GA 1QE1A 1X3NA 2F9TA 4BRAA 4CECA 3CC2N 5B8HA 5EXWA 2Q1NA 4JKGA 4C8OA 1HNXK 1TL1A 3EEQA 3QINA 3LPUA 5LJVA 3KK2A 4CJRA 3AA3A 3HT3A 3SV3A 1NJZA 2ASPA 1ZBSA 3IG1A 4LSNA 3K5LA 4FWNA 3A8YA 3HPOA 4M41A 4RWTA 3LANA 4Z0UA 4DF4A 1K6YA 4M7XA 3U6FA 3ASMA 3L2WA 3CCMN 3THXB 1NJWA 3FZKA 4CEDA 3HL8A 2B5JA 2OCEA 4KTZA 5F2RA 1TYQB 1RT2A 1RT1A 4BDYA 4ZTFA 3AA2A 5JMVA 1TUYA 3SAFA 4BY9C 1ILYA 3CM6A 5FRMA 2BANA 3UKUB 1K9MO 1EX4A 3G6EN 5C24A 2JWKA 1TK0A 3DXKB 3QDKA 1IKXA 3OYGA 4B9MA 5ADXA 2LSNA 4A59A 1WSHA 3C95A 4CGIA 4W5NA 3TAPA 3LP2A 3WXMB 3VQCA 4RW7A 1J5OA 4FJKA 3KWIA 2NRHA 2BUPA 1U6ZA 4RW8A 3VQ6A 3CPWM 2OTLN 5HP1A 4FL9A 1X1PA 4OPJA 3TAMA 5AQSA 5DM7L 4RW4A 2IDOA 3O08A 2O4GA 4QOZB 1XUPO 4G9ZA 1EQYA 1HRHA 1IV0A 3KLIA 3OYMA 3ZLJA 3HYFA 4DMNA 4CF8A 3TANA 1NK8A 1T3VA 4JV5K 4CIEA 5M1NA 5AQVA 4QS9A 5HRNA 4F4KA 4DUZK 4MDAA 1L3SA 2E2QA 2HHWA 1HNWK 5BRDA 4DWIA 4FWLA 3ZSRA 2QKBA 2P9IA 1CZBA 3KK1A 4CEAA 4YOWA 2O8FB 5BN9A 1W97L 4CHOA 1C1CA 1KLMA 4CHPA 5M1FA 3RMBA 1NWKA 3U9ZA 4LF6K 2I7NA 4IG3A 4EP4A 3NBPA 3O80A 4JD2B 3T69A 3RMDA 1K8AO 4BDZA 3ZSOA 1C0MA 1O1WA 4CK2A 1TKXA 1E3MA 3HJFA 2QKKA 4FJLA 1U04A 4CEEA 4IBNA 3DJCA 4BR7A 5M1OA 3VF2A 2Z1JA 4E0DA 1TKTA 3I8DA 1BWFO 2JWLA 4BR4A 4CGGA 4JI2K 3V81A 1BIZA 3H6EA 4JNEA 3QEVA 3O4NA 1ZC6A 3A2FA 3TTFA 1B9DA 3DRRA 3HM9A 5GAGP 3SI6A 2A40A 3G0ZA 4HUGA 4B1ZA 4KHUA 1J6ZA 3OYCA 3RRGA 4FLYA 4ISFA 1TKZA 4CJPA 4F3OA 3HOSA 3NVKA 5KRTA 4CD3A 4OKJA 2KLAA 3TWHA 3JAMO 3SQ4A 4EHTA 4Y0WA 3TAFA 4Y1CA 1FK9A 2YI1A 2VGNA 1ATRA 4JRPA 4ELUA 2F96A 4DTRA 1WSFA 1Q9XA 1N6QA 3NH0A 3VOVA 1EO1A 5KRSA 1NGJA 4DSFA 4JI6K 3T1HK 1QQMA 4FW1A 4CGJA 4EFHA 3T7ZA 1KAZA 4YOTA 3U4LA 4K8ZA 4DTMA 4DV7K 1LWCA 1RBRA 4FWSA 1NNEA 4WFAL 1Z05A 4DV2K 1K73O 2QWOA 5DMRA 1ZBUA 1N36K 3FR0A 4DTSA 1R59O 1XHZA 2RF2A 3CCEN 1BQNA 3ATVA 2D0PA 4YOXA 3VA3A 1DKGD 4IZ9A 3SCXA 5AQUA 4DSEA 1QVFM 4LD0A 3NMUA 4FM2A 5IWAK 4BQLA 3VQAA 4Z4CA 2G8WA 3EKSA 2UXCK 1JCGA 3R3LA 4B9NA 3NF8A 4C8NA 4I6MA 2ZJRL 4XH4A 1NKCA 4EAHD 2V52B 1X9WA 3J7AP 3NGZA 1EWQA 3OJSA 4CJEA 3J80O 1K8KA 4CBUA 3PV8A 4J2BA 1X9MA 4CHZA 4DHYA 5AR0A 3QBXA 3MCAB 3DLEA 3CCVN 3KJVA 4PUOA 4E1MA 3CMAN 3W0LA 1HJOA 4ELVA 2F4VK 3ENOA 5BRFA 3OYBA 1VK0A 3J7ZO 4M42A 3SMPA 2P9KB 3NFAA 3DXKA 2G8KA 2ZQBA 1WAJA 4JKCA 4KHPK 5I42A 1CZAN 1BL3A 1KQSM 4GV9A 1YJNN 2GUIA 2DFEA 4DQQA 4BRHA 4B9SA 5KPTA 5AZJB 2DY4A 2HHVA 3O9SA 2A41A 1X9JA 2V7ZA 3F73A 2FSJA 4ISEA 3J7YP 1S1XA 1TK5A 2G8HA 4CESA 4CIFA 4WFBL 4E3SA 3AARA 2Y1JA 4CJKA 4IFEA 4CBXA 1MA9B 3O4QA 1NK4A 3ZEUB 3L2QA 2O8CB 3NH1A 2QXLA 2WUSA 1KAYA 5GIOA 2OA8A 3P39A 3CCQN 1FW6A 1HKGA 1NM1A 3L6QA 3QESA 3WNGA 4FJ7A 2XY8A 3HVRA 4FJ8A 4IEEA 4KH6A 3LDSA 2NZTA 4IOXA 3F5TA 4RCHA 4CF0A 2P5OA 4LF9K 3IMXA 2QXFA 4YDUC 4E1JA 1RTDA 4EP5A 2V7YA 1OH6A 4QCLA 4NO7A 3WEEB 3C6UA 4DTUA 1ATNA 3MXIA 4WQ4A 2YKNA 3QBWA 3LP3A 4DQ8A 1L3TA 3TTDA 4M3XA 4CJWA 3V9SA 4ID5A 1YTUA 2ZM6K 4K25A 4BE0A 1XC3A 5EX5A 3RTVA 1S3XA 2P9NB 3OYAA 4BG9A 2P9NA 5AQGA 4BRPA 3KK3A 1NU0A 4JI0K 3KLEA 3FFKB 4BQZA 3B8AX 4FVUA 2QA4N 1RNHA 3D6RA 2D1KA 1LWEA 2FXUA 4KPYA 3KWGA 2A3ZA 1IBKK 1TAUA 4FSVA 1NK6A 4Q0BA 4DSIA 1RT3A 4MLEA 4W5TA 3K9JA 3TSQA 1XNRK 4CJQA 2CH5A 3I33A 4KTWA 4FLUA 3CCUN 3ISNC 5AFUH 4FOIA 2BH1A 4WQ4C 3C65A 4PHTX 4B9VA 2D0BA 4JS4A 3V9XA 4B1UB 5FRNA 3AVGA 3K9KA 3LZIA 3SQ1A 3NF7A 1J54A 1T05A 1P8ZA 1S1WA 4FWQA 4DV5K 1K8KB 4LF5K 3BF3A 3HBTA 4RW6A 3RVCA 1SAZA 3TSPA 2E88A 2Z1GA 3SV4A 1F21A 3LL3A 1D9DA 2O8BA 4JAXA 3FFIA 2GV9A 2OPRA 3U8XA 2IS3A 2P9PA 4H4MA 2FC0A 4M3WA 3FZMA 4CJVA 1WAFA 5JLFA 1QSSA 1ASUA 3HM8A 4K43A 1YF5L 2P9UA 4LC9B 4NCAA 3AVBA 1N8RO 2RE2A 2I7PA 4H0VB 4DCHA 4DSKA 3D45A 3O9QA 4A5AA 1VQLN 1NGAA 4OKKA 1J53A 1BGXT 2AA4A 4CJ3A 4W5QA 1I94K 4CEQA 1JL2A 2PZSA 4JK8A 3L0QA 4RG8A 1C0TA 1VRUA 4FJJA 1Q86O 4BDPA 4CZMA 3THYB 1J9AA 4K42A 1JLFA 1W0HA 1SL0A 4J8FA 3AO1A 2Z1IA 4X66K 1NK7A 3V1OA 4Z4EA 1QTMA 5AQMA 1FXXA 1QHTA 3P31A 5AQIA 1YJ9N 2BGGA 1JCFA 3T19A 3J8AA 2IVNA 1WBDA 3F9MA 1T03A 3S3OA 2EHGA 3CMEN 4KKOA 1DTTA 5HBMA 4AILC 3DXMB 4ILGB 4DR2K 2UUCK 4CZJA 3KK7A 3EY1A 4CCHA 1U2VB 3MN6A 1X9SA 1LAWA 4B1XB 1OH5A 3S3MA 4L8RB 3ZETB 2W6LA 1MWMA 2X6SA 1TV6A 4BE1A 1QSYA 5J1EA 3JSMA 3R6MA 3MXJA 5T7BA 1HX1A 2ZD1A 1TK8A 4B08A 1QVGM 3MMVA 5H1SQ 3H1VX 1NGBA 3PX6A 4EIAA 2HBMA 1E4GT 4M7YA 1S1UA 3OBWA 4CZHA 3SUOA 4DR5K 3SJJA 1O13A 4E7HA 4W5RA 4O4GA 4J2AA 1EP4A 3SPYA 3ATUA 3G10A 4FPBA 2D5RA 4DTJA 4A2AA 3W3DA 3L2VA 2GELA 4LY7A 4XH5A 3RSEA 4DKWA 4LF7K 4H0PA 4IWVA 2IOCA 3ZSZA 3ZSYA 2HMPA 4HHTA 1GOAA 3LPTA 5SZTA 2ZJQL 3DLBA 4FJMA 3QB0A 3LM9A 1GLCG 4JRQA 5BREA 5IT9O 3VF6A 1QZ5A 4Q5VA 2KQ2A 4F2RA 1NJIO 2E6MA 3TTCA 4N5SA 4BRCA 1YT3A 3ZT2A 1C0FA 3CCLN 4LF8K 3VQEA 4PY5A 4FWMA 3HOTA 3N4QA 2CH6A 3AGRA 3VPZA 4DR7K 4OPHA 5C0YA 2GEMA 4WYBA 3CHWA 4FK0A 4JKBA 3CG7A 3VGMA 2YHXA 3V6DA 2PYLA 4O0JA 5CR4A 5MLCQ 3DLKA 3K5MA 4OLAA 2CGKA 1OKJA 1HQEA 4HUFA 1B92A 4DSJA 5DM6L 5AQTA 3UKRA 4Z94A 3L2UA 2YJEA 2B6AA 1RDDA 4CJTA 1VSEA 2W41A 2HSTA 3CIPA 1WSGA 3QFUA 5AJ3K 3RMCA 2OPQA 3ZT0A 4KI6A 4AF1A 3VEWA 1ZBIA 1CXUA 5GIPA 3OYIA 3ZX0A 4M45A 4WFNL 3A5MC 4CFAA 2ZGZA 4RW9A 4CZGA 1LWFA 3VEXA 3MEGA 1HPMA 1Q8IA 3HVTA 5E26A 3PO4A 4IDKA 4H0TB 1KVBA 4YFUA 2HMIA 4WQ5A 4F8RA 3SNNA 1SQKA 4ELTA 5AQFA 4B1VA 4BWJA 2E6LA 3HPGA 2ATQA 3NVMA 2GWKA 4B3RK 3P5JA 3VESA 2E4LA 2Q2RA 1YUWA 3KHYA 4KHYA 1ASWA 3AAPA 4YHHK 3BY5A 3EE8A 1GOBA 1RILA 4KTQA 3V9ZA 4XIUA 3AA5X 2XO7A 4KB0A 1NKEA 3FGUA 2PBDA 1YJWN 5C10A 5D3GA 3WQTA 5I9EB 1VQ9N 5LMNK 4QS8A 3I55N 4GNIA 3KKSA 3CETA 3LAKA 1T44A 4LFCK 4DLEA 4ICLA 4H5NA 5KTQA 2NRZA 4NXNK 2IC3A 4DU3A 1BIUA 1H1VA 5I3UA 1NMNA 2HHHK 1S9EA 1GLLO 5GAEP 2HNDA 2XY5A 2OZMA 4EZ9A 2PAVA 3HP9A 4JKFA 4E7IA 3RR8A 2YHYA 4OKEA 4FWPA 2O8EA 1HQUA 5FPEA 1Q82O 4B8CA 1XMQK 3OYEA 4PQUA 2YV0X 4XEIA 2DTUA 5BPNA 3MN7A 4B9UA 5LL6Z 5BRHA 5AZIB 3GOIA 2HHXA 3DYAA 4FLXA 4BR2A 2J4RA 2E5LK 4OJRA 2BDPA 4CI6A 2E2NA 4JI7K 2RN2A 3O6WA 2ZF5O 4CGHA 3ID8A 2HB5A 1BA0A 1HNZK 2GBZA 1RTHA 3MDQA 4DR1K 4EZ6A 1GLEG 2A42A 3CJBA 3OA9A 4FXDA 3TR8A 3H46O 1QHAA 2BE2A 3A5OC 3VEZA 3RR7A 1JXBA 4BRLA 4R79A 2YJFA 3ENBA 5HRSA 4PA1A 3H08A 4DV0K 1EXQA 3G25A 3OVNA 3WT0A 3TARA 4FJ9A 5FPMA 4FOEA 4BE2A 4JHDB 1HJRA 4MFBA 4AHRA 2B4JA 3BF1A 3QETA 3MXMA 3C7NB 5KQDA 4H8KA 1NKBA 5BR8K 4MLHA 1CLQA 3QO9A 3CC4N 4FK4A 2Q97A 2RKIA 1U2VA 4IOAL 4I9QA 4JKHA 1ZBHA 3LWLA 1NOYA 4U7BA 3VEYA 5JVHL 4IG0A 1VRTA 4JI8K 4Z4FA 1VSLA 4JYAK 2YCHA 4UY8O 3ULEA 1IG8A 3ITHA 2VG5A 2ITGA 1GLJO 3JS6A 4DR6K 4DQPA 2YHBA 5BPMA 3ULDA 4RTFD 3VEOA 2HOEA 2OPPA 4KAZA 3PY8A 3NF9A 4PL7A 4HTLA 4IFYA 2KKZA 3UKUA 4AM6A 3QEXA 4BRNA 1JL1A 3E1YA 3EYZA 5FROA 4G1QA 1KSPA 3VN5A 2OYQA 1LV5A 1QSLA 4JD2A 3SQ2A 3TI0A 1BCOA 4H5TA 4KHQA 4BRMA 4WF9L 1BA1A 5EU7A 3K2PA 1RT4A 3D2EA 1FJGK 4F3TA 4HVJA 3KLFA 1C0GA 4KFBA 3ZT1A 2HHSA 3O3HA 2VG6A 2NRXA 4FM1A
chains in the Genus database with same CATH topology
3SV4A 1F21A 3P1GA 1D9DA 2KZMA 4E7JA 4CJFA 4CFBA 3FFIA 2GV9A 2OPRA 4UQGA 2HHQA 3SZ2A 4OVLA 1U48A 2VG7A 3KKRA 3ZSQA 4DG1A 2R7YA 1C1BA 4AHUA 2IS3A 2G8VA 4YNQA 3CQ8A 4FW2A 1NK9A 1D9FA 3S3NA 4CFCA 4FJHA 1HYZA 4H4MA 3O3GA 1QE1A 4NCGA 3KD1E 4DU4A 2FC0A 4CECA 4M3WA 4CJVA 1D5AA 1WAFA 1Z26A 1QSSA 4OLBA 4C8OA 1TL1A 1ASUA 3QINA 2X78A 3LPUA 4NCAA 4FZYA 3E01A 3AVBA 5J2NA 3KK2A 4CJRA 2Z1HA 3AA3A 3HT3A 3SV3A 3V9WA 1C0UA 1NJZA 3DLGA 1A5WA 1KVCA 1RBUA 4DSKA 3D45A 3IG1A 5JS1A 1NJYA 4OKKA 1J53A 1RCHA 2RPIA 4OGCA 1BGXT 4LSNA 4CJ3A 3AVMA 4W5QA 3HPOA 3K5LA 4M41A 1JL2A 4CEQA 2PZSA 3LANA 3QIOA 4Z0UA 4DS5A 4RG8A 1K6YA 4DF4A 3U6FA 1C0TA 1FKOA 1W9HA 1VRUA 4PWDA 3ASMA 3L2WA 1NJWA 4FJJA 1L3VA 3HL8A 2B5JA 4CEDA 4BDPA 4KTZA 3VQPA 4BDYA 1RT2A 1RT1A 4ZTFA 3PX4A 3AA2A 4DSLA 1J9AA 1JLFA 3CM6A 3T1AA 5FRMA 2HNZA 1W0HA 2BANA 2YNIA 3L2RA 1SL0A 4K8XA 3SUPA 3AO1A 2Z1IA 1FKPA 1NK7A 3V1OA 4M3UA 1EX4A 2ZE2A 3CFPA 4Z4EA 3MECA 5C24A 1TK0A 2KFNA 1QTMA 3OYKA 1FXXA 3P83D 5SWMA 1QHTA 3HSTB 1IKXA 3V4IA 3OYGA 4B9MA 1R0AA 2LSNA 1VSKA 4J2EA 2BGGA 4FJGA 3T19A 3OYDA 1WSHA 3DOKA 2PY5A 3C95A 4CGIA 4R5PA 3JYTA 4W5NA 2KZZA 3TAPA 3LP2A 2FBXA 1A5VA 3VQCA 4RW7A 3S3OA 1T03A 1J5OA 2EHGA 3ZCMA 4FJKA 4KKOA 1DTTA 4QAGA 5HBMA 3OYJA 2WONA 4AILC 4DTNA 3QEIA 2F8TA 2KFZA 1S9GA 2A1SA 4RW8A 3VQ6A 3VA0A 4BACA 1UWBA 5HP1A 4JLHA 4CGDA 1JLBA 3EY1A 4CCHA 3EZ5A 2X6NA 1X1PA 4OPJA 3TAMA 4IFVA 3OYHA 4RW4A 1X9SA 1LAWA 1G15A 1RDBA 2IDOA 1VSFA 1TL3A 2YKMA 3O3FA 3S3MA 4L8RB 1ZBLA 2O4GA 4DS4A 3ALYA 3VQ8A 4FZZA 4QOZB 1RTJA 2I5JA 1BI4A 1HRHA 3KLIA 3PUFA 5CYMA 2X6SA 3OYMA 1TV6A 4BE1A 3KLHA 1QSYA 3HYFA 5J1EA 3JSMA 4DMNA 1WLJA 2EX3A 4CF8A 3MXJA 3TANA 4FYDA 5T7BA 2ZD1A 1TK8A 4B08A 1NK8A 4CIEA 4FLTA 3DLRA 1EETA 5HRNA 3NGYA 3PX6A 4F4KA 1L3SA 1KRPA 2HHWA 4I2QA 4HUEA 3UIQA 3KIOA 4C8MA 4DQRA 5J2PA 4CEFA 4DWIA 3HJFA 1JLEA 1JLAA 3ZSRA 3DLHA 2QKBA 1S1UA 4CHQA 3SUOA 3SJJA 1CZBA 1I3AA 2XY6A 1C6VA 4H4OA 3KK1A 4E7HA 4W5RA 4O4GA 4LH5A 4J2AA 1EP4A 4CEAA 3IAYA 4FJ5A 3SPYA 4CHOA 1CZ9A 1C1CA 1KLMA 3SUNA 3S9HA 3G10A 1SKRA 2D5RA 4DTJA 3L2VA 2G8IA 4LY7A 4CHPA 2W42A 4CEOA 4ID1A 3RMBA 5HROA 3KTQA 2HVIA 1UOCA 4JS5A 3HK2A 2JGUA 2IOCA 4IG3A 4MQ3A 3NBPA 3ZSYA 3ZSZA 4CE9A 4EP4A 1GOAA 3AO4A 3LPTA 5SZTA 3ZSOA 1C0MA 1O1WA 4CK2A 4BDZA 4E7KA 3DLBA 1TKXA 4FJMA 1IO2A 4GMJB 2X74A 3QLHA 4F2SA 2QKKA 1RTIA 1RDAA 4FJLA 1U04A 4FJNA 4JRQA 4CEEA 4IBNA 4FLZA 3AVFA 3WNHA 4HTUA 4Q5VA 1IKYA 3B6PA 4E89A 3AV9A 1VSMA 2Z1JA 4CJSA 2KQ2A 4E0DA 4F2RA 4I9LA 1TKTA 3I8DA 2E6MA 4KREA 1KVAA 1U49A 3C6TA 4CGGA 4N5SA 3V81A 4DFPA 2NUBA 1IH7A 1BIZA 1YT3A 1IG9A 4CEZA 3ZT2A 3M8PA 3QEVA 4IKFA 3O4NA 3A2FA 3LALA 4CEBA 3B6OA 1B9DA 4CK1A 1SKSA 3DRRA 3VQEA 4M3YA 1QQCA 3ZSXA 3ZSVA 3HM9A 4PY5A 1S6QA 5C42A 3SI6A 3DRSA 3G0ZA 4AHCA 3CYMA 2ETJA 4HUGA 4KHUA 1GOCA 3AVJA 2HVHA 2QK9A 3OYCA 3RRGA 4FLYA 1TKZA 4CJPA 4F3OA 2Q3SA 4FK0A 5HRPA 1NJXA 1SUQA 3CG7A 5KRTA 4Y1DA 1U45A 3V6DA 2PYLA 4O0JA 4OKJA 3WNEA 3DLKA 3K5MA 1LW2A 2YNFA 4CJUA 3TWHA 4OLAA 3SQ4A 3OY9A 3TAFA 2HNYA 4B9TA 4Y1CA 1DLOA 1FK9A 2G8FA 1HQEA 4CK3A 4DLGA 4HUFA 4JRPA 4ELUA 2F96A 4DTRA 1B92A 1SV5A 1WSFA 1Q9XA 1SKWA 4DSJA 1N6QA 1JLQA 3PO5A 3NH0A 2IAJA 5KRSA 5FDLA 3L2UA 4E19A 3T3FA 3ZSWA 4DSFA 2HHUA 2B6AA 1KCFA 4AHVA 1RDCA 1S5JA 3OYFA 1RDDA 2G8UA 2AJQA 4CJTA 1VSEA 3VQ5A 5HRRA 4FW1A 1D8YA 4N76A 1YVUA 1WSGA 5CZ1A 4CGJA 3SPZA 4KRFA 3PX0A 3RMCA 2OPQA 1S6PA 4CF1A 3RMDA 3OYNA 3ZT0A 4KI6A 2P51A 1KLNA 1ZBIA 1CXUA 4Z4GA 1SL1A 3OYIA 4CJLA 3M8RA 4M45A 4K8ZA 4CFAA 4GVMA 3LP1A 3NE6A 4DTMA 4RW9A 1LWCA 1RBRA 4O55A 1LWFA 5HLFA 4NCBA 4FLVA 3HP6A 1LW0A 1TAQA 2P1JA 5DMRA 3MEGA 1N5YA 1ZBUA 3MEDA 4HHTA 1A5XA 4DTSA 2F8SA 5DK5A 3C94A 1YTAA 1XHZA 4C8KA 3RRHA 1Q8IA 4HCBA 2RF2A 3HVTA 3OS2A 3PO4A 1BQNA 3I0SA 4IDKA 4AHTA 1KVBA 4YFUA 2HMIA 3L3UA 4CJ5A 3VA3A 3SCXA 4ZTJA 4DSEA 4F8RA 1S1VA 4LD0A 3TAGA 4FM2A 4Z4IA 3ZT3A 3OJUA 3SNNA 3VQAA 3NHGA 4ELTA 4Z4CA 2G8WA 3KD5E 4BWJA 1VSIA 2E6LA 3HPGA 4B9NA 3NF8A 4C8NA 2ATQA 3HPHA 2OZSA 1BCMA 4I7FA 1IKVA 2IGIA 3NF6A 3P5JA 5CY4A 5CYQA 3SYZA 1NKCA 1UAXA 2E4LA 3TABA 1RBTA 1XHXA 3DMJA 1X9WA 1HNIA 3NGZA 3NCIA 4Z4HA 2FBYA 5KGWA 4KHYA 1ASWA 3IS9A 1WSJA 3OJSA 1HYVA 5J2QA 4CJEA 3DRPA 3TAEA 2XHBA 3NGIA 3IRXA 3PV8A 4J2BA 1WNSA 1GOBA 1RILA 4CIGA 1JLCA 1X9MA 1T7PA 4KTQA 5E41A 4DFMA 2OPSA 4CHZA 4CHYA 2XRIA 3V9ZA 1XI1A 4XIUA 3AA5X 4N41A 2XO7A 4KB0A 3AVKA 1NKEA 1LAVA 3DLEA 3BGRA 3HXMA 4CGFA 4OPKA 3KJVA 4PUOA 5D3GA 3CFOA 4E1MA 4WE1A 4ELVA 2D0CA 1RT6A 2YHAA 2KTQA 4DFJA 1KFDA 2DFHA 4BWMA 1VK0A 3OYBA 4M42A 4DTOA 4FCYA 1KTQA 3OYLA 4LSLA 1HMVA 3NFAA 2G8KA 2WOMA 2ZQBA 1VSDA 3KKSA 4NYFA 1WAJA 3AVNA 2DFFA 3M8QA 3LAKA 4O44A 4N47A 3QEWA 1BL3A 5I42A 4J2DA 1BISA 4C8LA 1BQMA 4ICLA 4DLEA 5KTQA 1DTQA 4FLWA 2IC3A 3VQ7A 4DU3A 4DU1A 1BIUA 3QERA 5JS2A 2GUIA 3THVA 2DFEA 5I3UA 4B3OA 4DQQA 3K57A 1S9EA 2XY5A 2OZMA 2HNDA 4EZ9A 3HP9A 3V1QA 4E7IA 1Q9YA 4TSXA 5CZ2A 4B9SA 3RR8A 4DQIA 2DY4A 2HHVA 3LP0A 4OKEA 3K59A 4FK2A 1HQUA 5C25A 1HNVA 3VQBA 4B8CA 3F73A 3QNNA 3OYEA 1U47A 4PQUA 2YV0X 2DTUA 4CHNA 4LH4A 1S1XA 3MAQA 3AO2A 1TK5A 1NK0A 2G8HA 3DM2A 4CESA 4B9UA 4CIFA 2VWKA 1BHLA 2HHXA 3NAEA 1RT7A 4E3SA 4HCCA 3U3GA 3AO5A 3DYAA 4FLXA 1XWLA 3V9UA 1SL2A 1Y97A 3CFRA 1RT5A 2Y1JA 4OJRA 4AHSA 4CJKA 2BDPA 5KI6A 3AVCA 3O4QA 2RN2A 1NK4A 1UA0A 3L2QA 1I39A 2YNGA 4CGHA 1REVA 3NH1A 1U4BA 2HW3A 5K14A 2OA8A 4KHWA 2HB5A 5J2MA 2GBZA 1RTHA 2D0AA 4CJ4A 3MEEA 4EZ6A 4DF8A 4FM0A 3QESA 4W5OA 3DI6A 3DOLA 1ITGA 3WNGA 2P5GA 3I0RA 4FJ7A 2XY8A 4FXDA 4DQSA 3AVAA 3TR8A 3HVRA 3SQ0A 3SUQA 1IKWA 1RBSA 4FJ8A 3LDSA 1NOZA 1JXEA 1B9FA 3TAQA 1HPZA 4GW6A 4O5BA 3WNFA 4CF0A 2P5OA 2BE2A 3VQ9A 2QXFA 1ZYQA 3BDPA 1JXBA 4EP5A 1RTDA 3RR7A 4NYNA 4DTPA 4QCLA 1WSEA 3K58A 3V1RA 3C6UA 4PA1A 3H08A 5HRSA 4DTUA 3ZT4A 3MXIA 1EXQA 2YKNA 4B8AB 1TVRA 1TKDA 1L5UA 4FJXA 3LP3A 3OVNA 3QIPA 2FBVA 4M3TA 3AA4A 4KV8A 4DFKA 3TARA 2YNHA 4E7LA 4FJ9A 3OS1A 1L3TA 4BE2A 3RMAA 4M3XA 4CJWA 3LZJA 4FJIA 1HJRA 4MFBA 4AHRA 2B4JA 3M8SA 3QETA 4CF9A 3V9SA 4ID5A 3MXMA 4H8KA 4CF2A 1NK5A 1NKBA 1YTUA 2JLEA 4BE0A 4DTXA 1CLQA 3QNOA 3QO9A 3RTVA 1JKHA 1CXQA 4FK4A 4FVMA 1QS4A 2RKIA 3U3YA 3OYAA 4I9QA 3K5NA 1ZBHA 3KK3A 3LWLA 3QEPA 1NOYA 4KI4A 3NH2A 4IG0A 1VRTA 1WSIA 3KLEA 1BI4B 1WN7A 3LWMA 2O4IA 3HO1A 3AVLA 4I2PA 4Z4FA 1VSLA 3LAMA 1RNHA 1UA1A 4KO0A 3ITHA 2VG5A 1XC9A 3D0PA 1LWEA 2KW4A 3AO3A 2ITGA 4KPYA 1L3UA 3AVHA 1TGOA 3F9KA 4DQPA 4CFDA 2HHTA 1TAUA 1NK6A 2YHBA 4Q0BA 1VSJA 1S1TA 3VQDA 4B9LA 3ULDA 4DSIA 5KGXA 4O0IA 2Y1IA 1RT3A 4N56A 4W5TA 3L8BA 2A1RA 4ZHRA 2OPPA 3L3VA 1JLGA 3NDKA 2XY7A 1KFSA 4KAZA 3OS0A 4CJQA 3PY8A 3NF9A 1EKEA 4E1NA 4IFYA 4FLUA 4KTWA 4M3ZA 2FBTA 4KHNA 3QEXA 1JL1A 3ISNC 3EYZA 5FROA 4CERA 4G1QA 1KSPA 4B9VA 2D0BA 4JS4A 4M3RA 3VN5A 2VWJA 3V9XA 1LV5A 2OYQA 1QSLA 5FRNA 3KLGA 3SQ2A 1MU2A 3AVGA 4AH9A 3LZIA 3SQ1A 3NF7A 1J54A 3TI0A 4OGEA 4KB1A 1T05A 3CM5A 1BCOA 1S1WA 3VQ4A 1T8EA 3K5OA 4FZXC 4KHQA 5EU7A 1RBVA 2PYJA 3RWUA 3K2PA 1RT4A 1Z25A 4F3TA 4HVJA 3KLFA 1HYSA 1ASVA 4KFBA 3ZT1A 2HHSA 1C1AA 3O3HA 1ZBFA 2VG6A 1VSHA 4RW6A 4FM1A 3VQQA 4KHSA 2Z1GA 3AVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SV4 A;  1F21 A;  3P1G A;  1D9D A;  2KZM A;  4E7J A;  4CJF A;  4CFB A;  3FFI A;  2GV9 A;  2OPR A;  4UQG A;  2HHQ A;  3SZ2 A;  4OVL A;  1U48 A;  2VG7 A;  3KKR A;  3ZSQ A;  4DG1 A;  2R7Y A;  1C1B A;  4AHU A;  2IS3 A;  2G8V A;  4YNQ A;  3CQ8 A;  4FW2 A;  1NK9 A;  1D9F A;  3S3N A;  4CFC A;  4FJH A;  1HYZ A;  4H4M A;  3O3G A;  1QE1 A;  4NCG A;  3KD1 E;  4DU4 A;  2FC0 A;  4CEC A;  4M3W A;  4CJV A;  1D5A A;  1WAF A;  1Z26 A;  1QSS A;  4OLB A;  4C8O A;  1TL1 A;  1ASU A;  3QIN A;  2X78 A;  3LPU A;  4NCA A;  4FZY A;  3E01 A;  3AVB A;  5J2N A;  3KK2 A;  4CJR A;  2Z1H A;  3AA3 A;  3HT3 A;  3SV3 A;  3V9W A;  1C0U A;  1NJZ A;  3DLG A;  1A5W A;  1KVC A;  1RBU A;  4DSK A;  3D45 A;  3IG1 A;  5JS1 A;  1NJY A;  4OKK A;  1J53 A;  1RCH A;  2RPI A;  4OGC A;  1BGX T;  4LSN A;  4CJ3 A;  3AVM A;  4W5Q A;  3HPO A;  3K5L A;  4M41 A;  1JL2 A;  4CEQ A;  2PZS A;  3LAN A;  3QIO A;  4Z0U A;  4DS5 A;  4RG8 A;  1K6Y A;  4DF4 A;  3U6F A;  1C0T A;  1FKO A;  1W9H A;  1VRU A;  4PWD A;  3ASM A;  3L2W A;  1NJW A;  4FJJ A;  1L3V A;  3HL8 A;  2B5J A;  4CED A;  4BDP A;  4KTZ A;  3VQP A;  4BDY A;  1RT2 A;  1RT1 A;  4ZTF A;  3PX4 A;  3AA2 A;  4DSL A;  1J9A A;  1JLF A;  3CM6 A;  3T1A A;  5FRM A;  2HNZ A;  1W0H A;  2BAN A;  2YNI A;  3L2R A;  1SL0 A;  4K8X A;  3SUP A;  3AO1 A;  2Z1I A;  1FKP A;  1NK7 A;  3V1O A;  4M3U A;  1EX4 A;  2ZE2 A;  3CFP A;  4Z4E A;  3MEC A;  5C24 A;  1TK0 A;  2KFN A;  1QTM A;  3OYK A;  1FXX A;  3P83 D;  5SWM A;  1QHT A;  3HST B;  1IKX A;  3V4I A;  3OYG A;  4B9M A;  1R0A A;  2LSN A;  1VSK A;  4J2E A;  2BGG A;  4FJG A;  3T19 A;  3OYD A;  1WSH A;  3DOK A;  2PY5 A;  3C95 A;  4CGI A;  4R5P A;  3JYT A;  4W5N A;  2KZZ A;  3TAP A;  3LP2 A;  2FBX A;  1A5V A;  3VQC A;  4RW7 A;  3S3O A;  1T03 A;  1J5O A;  2EHG A;  3ZCM A;  4FJK A;  4KKO A;  1DTT A;  4QAG A;  5HBM A;  3OYJ A;  2WON A;  4AIL C;  4DTN A;  3QEI A;  2F8T A;  2KFZ A;  1S9G A;  2A1S A;  4RW8 A;  3VQ6 A;  3VA0 A;  4BAC A;  1UWB A;  5HP1 A;  4JLH A;  4CGD A;  1JLB A;  3EY1 A;  4CCH A;  3EZ5 A;  2X6N A;  1X1P A;  4OPJ A;  3TAM A;  4IFV A;  3OYH A;  4RW4 A;  1X9S A;  1LAW A;  1G15 A;  1RDB A;  2IDO A;  1VSF A;  1TL3 A;  2YKM A;  3O3F A;  3S3M A;  4L8R B;  1ZBL A;  2O4G A;  4DS4 A;  3ALY A;  3VQ8 A;  4FZZ A;  4QOZ B;  1RTJ A;  2I5J A;  1BI4 A;  1HRH A;  3KLI A;  3PUF A;  5CYM A;  2X6S A;  3OYM A;  1TV6 A;  4BE1 A;  3KLH A;  1QSY A;  3HYF A;  5J1E A;  3JSM A;  4DMN A;  1WLJ A;  2EX3 A;  4CF8 A;  3MXJ A;  3TAN A;  4FYD A;  5T7B A;  2ZD1 A;  1TK8 A;  4B08 A;  1NK8 A;  4CIE A;  4FLT A;  3DLR A;  1EET A;  5HRN A;  3NGY A;  3PX6 A;  4F4K A;  1L3S A;  1KRP A;  2HHW A;  4I2Q A;  4HUE A;  3UIQ A;  3KIO A;  4C8M A;  4DQR A;  5J2P A;  4CEF A;  4DWI A;  3HJF A;  1JLE A;  1JLA A;  3ZSR A;  3DLH A;  2QKB A;  1S1U A;  4CHQ A;  3SUO A;  3SJJ A;  1CZB A;  1I3A A;  2XY6 A;  1C6V A;  4H4O A;  3KK1 A;  4E7H A;  4W5R A;  4O4G A;  4LH5 A;  4J2A A;  1EP4 A;  4CEA A;  3IAY A;  4FJ5 A;  3SPY A;  4CHO A;  1CZ9 A;  1C1C A;  1KLM A;  3SUN A;  3S9H A;  3G10 A;  1SKR A;  2D5R A;  4DTJ A;  3L2V A;  2G8I A;  4LY7 A;  4CHP A;  2W42 A;  4CEO A;  4ID1 A;  3RMB A;  5HRO A;  3KTQ A;  2HVI A;  1UOC A;  4JS5 A;  3HK2 A;  2JGU A;  2IOC A;  4IG3 A;  4MQ3 A;  3NBP A;  3ZSY A;  3ZSZ A;  4CE9 A;  4EP4 A;  1GOA A;  3AO4 A;  3LPT A;  5SZT A;  3ZSO A;  1C0M A;  1O1W A;  4CK2 A;  4BDZ A;  4E7K A;  3DLB A;  1TKX A;  4FJM A;  1IO2 A;  4GMJ B;  2X74 A;  3QLH A;  4F2S A;  2QKK A;  1RTI A;  1RDA A;  4FJL A;  1U04 A;  4FJN A;  4JRQ A;  4CEE A;  4IBN A;  4FLZ A;  3AVF A;  3WNH A;  4HTU A;  4Q5V A;  1IKY A;  3B6P A;  4E89 A;  3AV9 A;  1VSM A;  2Z1J A;  4CJS A;  2KQ2 A;  4E0D A;  4F2R A;  4I9L A;  1TKT A;  3I8D A;  2E6M A;  4KRE A;  1KVA A;  1U49 A;  3C6T A;  4CGG A;  4N5S A;  3V81 A;  4DFP A;  2NUB A;  1IH7 A;  1BIZ A;  1YT3 A;  1IG9 A;  4CEZ A;  3ZT2 A;  3M8P A;  3QEV A;  4IKF A;  3O4N A;  3A2F A;  3LAL A;  4CEB A;  3B6O A;  1B9D A;  4CK1 A;  1SKS A;  3DRR A;  3VQE A;  4M3Y A;  1QQC A;  3ZSX A;  3ZSV A;  3HM9 A;  4PY5 A;  1S6Q A;  5C42 A;  3SI6 A;  3DRS A;  3G0Z A;  4AHC A;  3CYM A;  2ETJ A;  4HUG A;  4KHU A;  1GOC A;  3AVJ A;  2HVH A;  2QK9 A;  3OYC A;  3RRG A;  4FLY A;  1TKZ A;  4CJP A;  4F3O A;  2Q3S A;  4FK0 A;  5HRP A;  1NJX A;  1SUQ A;  3CG7 A;  5KRT A;  4Y1D A;  1U45 A;  3V6D A;  2PYL A;  4O0J A;  4OKJ A;  3WNE A;  3DLK A;  3K5M A;  1LW2 A;  2YNF A;  4CJU A;  3TWH A;  4OLA A;  3SQ4 A;  3OY9 A;  3TAF A;  2HNY A;  4B9T A;  4Y1C A;  1DLO A;  1FK9 A;  2G8F A;  1HQE A;  4CK3 A;  4DLG A;  4HUF A;  4JRP A;  4ELU A;  2F96 A;  4DTR A;  1B92 A;  1SV5 A;  1WSF A;  1Q9X A;  1SKW A;  4DSJ A;  1N6Q A;  1JLQ A;  3PO5 A;  3NH0 A;  2IAJ A;  5KRS A;  5FDL A;  3L2U A;  4E19 A;  3T3F A;  3ZSW A;  4DSF A;  2HHU A;  2B6A A;  1KCF A;  4AHV A;  1RDC A;  1S5J A;  3OYF A;  1RDD A;  2G8U A;  2AJQ A;  4CJT A;  1VSE A;  3VQ5 A;  5HRR A;  4FW1 A;  1D8Y A;  4N76 A;  1YVU A;  1WSG A;  5CZ1 A;  4CGJ A;  3SPZ A;  4KRF A;  3PX0 A;  3RMC A;  2OPQ A;  1S6P A;  4CF1 A;  3RMD A;  3OYN A;  3ZT0 A;  4KI6 A;  2P51 A;  1KLN A;  1ZBI A;  1CXU A;  4Z4G A;  1SL1 A;  3OYI A;  4CJL A;  3M8R A;  4M45 A;  4K8Z A;  4CFA A;  4GVM A;  3LP1 A;  3NE6 A;  4DTM A;  4RW9 A;  1LWC A;  1RBR A;  4O55 A;  1LWF A;  5HLF A;  4NCB A;  4FLV A;  3HP6 A;  1LW0 A;  1TAQ A;  2P1J A;  5DMR A;  3MEG A;  1N5Y A;  1ZBU A;  3MED A;  4HHT A;  1A5X A;  4DTS A;  2F8S A;  5DK5 A;  3C94 A;  1YTA A;  1XHZ A;  4C8K A;  3RRH A;  1Q8I A;  4HCB A;  2RF2 A;  3HVT A;  3OS2 A;  3PO4 A;  1BQN A;  3I0S A;  4IDK A;  4AHT A;  1KVB A;  4YFU A;  2HMI A;  3L3U A;  4CJ5 A;  3VA3 A;  3SCX A;  4ZTJ A;  4DSE A;  4F8R A;  1S1V A;  4LD0 A;  3TAG A;  4FM2 A;  4Z4I A;  3ZT3 A;  3OJU A;  3SNN A;  3VQA A;  3NHG A;  4ELT A;  4Z4C A;  2G8W A;  3KD5 E;  4BWJ A;  1VSI A;  2E6L A;  3HPG A;  4B9N A;  3NF8 A;  4C8N A;  2ATQ A;  3HPH A;  2OZS A;  1BCM A;  4I7F A;  1IKV A;  2IGI A;  3NF6 A;  3P5J A;  5CY4 A;  5CYQ A;  3SYZ A;  1NKC A;  1UAX A;  2E4L A;  3TAB A;  1RBT A;  1XHX A;  3DMJ A;  1X9W A;  1HNI A;  3NGZ A;  3NCI A;  4Z4H A;  2FBY A;  5KGW A;  4KHY A;  1ASW A;  3IS9 A;  1WSJ A;  3OJS A;  1HYV A;  5J2Q A;  4CJE A;  3DRP A;  3TAE A;  2XHB A;  3NGI A;  3IRX A;  3PV8 A;  4J2B A;  1WNS A;  1GOB A;  1RIL A;  4CIG A;  1JLC A;  1X9M A;  1T7P A;  4KTQ A;  5E41 A;  4DFM A;  2OPS A;  4CHZ A;  4CHY A;  2XRI A;  3V9Z A;  1XI1 A;  4XIU A;  3AA5 X;  4N41 A;  2XO7 A;  4KB0 A;  3AVK A;  1NKE A;  1LAV A;  3DLE A;  3BGR A;  3HXM A;  4CGF A;  4OPK A;  3KJV A;  4PUO A;  5D3G A;  3CFO A;  4E1M A;  4WE1 A;  4ELV A;  2D0C A;  1RT6 A;  2YHA A;  2KTQ A;  4DFJ A;  1KFD A;  2DFH A;  4BWM A;  1VK0 A;  3OYB A;  4M42 A;  4DTO A;  4FCY A;  1KTQ A;  3OYL A;  4LSL A;  1HMV A;  3NFA A;  2G8K A;  2WOM A;  2ZQB A;  1VSD A;  3KKS A;  4NYF A;  1WAJ A;  3AVN A;  2DFF A;  3M8Q A;  3LAK A;  4O44 A;  4N47 A;  3QEW A;  1BL3 A;  5I42 A;  4J2D A;  1BIS A;  4C8L A;  1BQM A;  4ICL A;  4DLE A;  5KTQ A;  1DTQ A;  4FLW A;  2IC3 A;  3VQ7 A;  4DU3 A;  4DU1 A;  1BIU A;  3QER A;  5JS2 A;  2GUI A;  3THV A;  2DFE A;  5I3U A;  4B3O A;  4DQQ A;  3K57 A;  1S9E A;  2XY5 A;  2OZM A;  2HND A;  4EZ9 A;  3HP9 A;  3V1Q A;  4E7I A;  1Q9Y A;  4TSX A;  5CZ2 A;  4B9S A;  3RR8 A;  4DQI A;  2DY4 A;  2HHV A;  3LP0 A;  4OKE A;  3K59 A;  4FK2 A;  1HQU A;  5C25 A;  1HNV A;  3VQB A;  4B8C A;  3F73 A;  3QNN A;  3OYE A;  1U47 A;  4PQU A;  2YV0 X;  2DTU A;  4CHN A;  4LH4 A;  1S1X A;  3MAQ A;  3AO2 A;  1TK5 A;  1NK0 A;  2G8H A;  3DM2 A;  4CES A;  4B9U A;  4CIF A;  2VWK A;  1BHL A;  2HHX A;  3NAE A;  1RT7 A;  4E3S A;  4HCC A;  3U3G A;  3AO5 A;  3DYA A;  4FLX A;  1XWL A;  3V9U A;  1SL2 A;  1Y97 A;  3CFR A;  1RT5 A;  2Y1J A;  4OJR A;  4AHS A;  4CJK A;  2BDP A;  5KI6 A;  3AVC A;  3O4Q A;  2RN2 A;  1NK4 A;  1UA0 A;  3L2Q A;  1I39 A;  2YNG A;  4CGH A;  1REV A;  3NH1 A;  1U4B A;  2HW3 A;  5K14 A;  2OA8 A;  4KHW A;  2HB5 A;  5J2M A;  2GBZ A;  1RTH A;  2D0A A;  4CJ4 A;  3MEE A;  4EZ6 A;  4DF8 A;  4FM0 A;  3QES A;  4W5O A;  3DI6 A;  3DOL A;  1ITG A;  3WNG A;  2P5G A;  3I0R A;  4FJ7 A;  2XY8 A;  4FXD A;  4DQS A;  3AVA A;  3TR8 A;  3HVR A;  3SQ0 A;  3SUQ A;  1IKW A;  1RBS A;  4FJ8 A;  3LDS A;  1NOZ A;  1JXE A;  1B9F A;  3TAQ A;  1HPZ A;  4GW6 A;  4O5B A;  3WNF A;  4CF0 A;  2P5O A;  2BE2 A;  3VQ9 A;  2QXF A;  1ZYQ A;  3BDP A;  1JXB A;  4EP5 A;  1RTD A;  3RR7 A;  4NYN A;  4DTP A;  4QCL A;  1WSE A;  3K58 A;  3V1R A;  3C6U A;  4PA1 A;  3H08 A;  5HRS A;  4DTU A;  3ZT4 A;  3MXI A;  1EXQ A;  2YKN A;  4B8A B;  1TVR A;  1TKD A;  1L5U A;  4FJX A;  3LP3 A;  3OVN A;  3QIP A;  2FBV A;  4M3T A;  3AA4 A;  4KV8 A;  4DFK A;  3TAR A;  2YNH A;  4E7L A;  4FJ9 A;  3OS1 A;  1L3T A;  4BE2 A;  3RMA A;  4M3X A;  4CJW A;  3LZJ A;  4FJI A;  1HJR A;  4MFB A;  4AHR A;  2B4J A;  3M8S A;  3QET A;  4CF9 A;  3V9S A;  4ID5 A;  3MXM A;  4H8K A;  4CF2 A;  1NK5 A;  1NKB A;  1YTU A;  2JLE A;  4BE0 A;  4DTX A;  1CLQ A;  3QNO A;  3QO9 A;  3RTV A;  1JKH A;  1CXQ A;  4FK4 A;  4FVM A;  1QS4 A;  2RKI A;  3U3Y A;  3OYA A;  4I9Q A;  3K5N A;  1ZBH A;  3KK3 A;  3LWL A;  3QEP A;  1NOY A;  4KI4 A;  3NH2 A;  4IG0 A;  1VRT A;  1WSI A;  3KLE A;  1BI4 B;  1WN7 A;  3LWM A;  2O4I A;  3HO1 A;  3AVL A;  4I2P A;  4Z4F A;  1VSL A;  3LAM A;  1RNH A;  1UA1 A;  4KO0 A;  3ITH A;  2VG5 A;  1XC9 A;  3D0P A;  1LWE A;  2KW4 A;  3AO3 A;  2ITG A;  4KPY A;  1L3U A;  3AVH A;  1TGO A;  3F9K A;  4DQP A;  4CFD A;  2HHT A;  1TAU A;  1NK6 A;  2YHB A;  4Q0B A;  1VSJ A;  1S1T A;  3VQD A;  4B9L A;  3ULD A;  4DSI A;  5KGX A;  4O0I A;  2Y1I A;  1RT3 A;  4N56 A;  4W5T A;  3L8B A;  2A1R A;  4ZHR A;  2OPP A;  3L3V A;  1JLG A;  3NDK A;  2XY7 A;  1KFS A;  4KAZ A;  3OS0 A;  4CJQ A;  3PY8 A;  3NF9 A;  1EKE A;  4E1N A;  4IFY A;  4FLU A;  4KTW A;  4M3Z A;  2FBT A;  4KHN A;  3QEX A;  1JL1 A;  3ISN C;  3EYZ A;  5FRO A;  4CER A;  4G1Q A;  1KSP A;  4B9V A;  2D0B A;  4JS4 A;  4M3R A;  3VN5 A;  2VWJ A;  3V9X A;  1LV5 A;  2OYQ A;  1QSL A;  5FRN A;  3KLG A;  3SQ2 A;  1MU2 A;  3AVG A;  4AH9 A;  3LZI A;  3SQ1 A;  3NF7 A;  1J54 A;  3TI0 A;  4OGE A;  4KB1 A;  1T05 A;  3CM5 A;  1BCO A;  1S1W A;  3VQ4 A;  1T8E A;  3K5O A;  4FZX C;  4KHQ A;  5EU7 A;  1RBV A;  2PYJ A;  3RWU A;  3K2P A;  1RT4 A;  1Z25 A;  4F3T A;  4HVJ A;  3KLF A;  1HYS A;  1ASV A;  4KFB A;  3ZT1 A;  2HHS A;  1C1A A;  3O3H A;  1ZBF A;  2VG6 A;  1VSH A;  4RW6 A;  4FM1 A;  3VQQ A;  4KHS A;  2Z1G A;  3AVI A; 
#chains in the Genus database with same CATH topology
 3HTV A;  3P1G A;  5AQP A;  4CJF A;  4CFB A;  2QWN A;  2HHQ A;  2VG7 A;  3KKR A;  2R7Y A;  4AHU A;  1VQ6 N;  5HOO A;  4FJH A;  3KD1 E;  4NCG A;  4DU4 A;  3ZX2 A;  2WC9 A;  1QQO A;  1D5A A;  1Z26 A;  4FWK A;  2X78 A;  4FZY A;  3CJA A;  2GUP A;  2CGJ A;  3V9W A;  2Z1H A;  3OTO K;  3DLG A;  4BGB A;  1A5W A;  1RBU A;  2P9K A;  1NJY A;  3D2F B;  2RPI A;  4OGC A;  1VQM N;  1G99 A;  4IJA A;  3AVM A;  4BC5 A;  2QEX N;  4DR3 K;  3CI5 A;  4DS5 A;  1VQ5 N;  4NXM K;  3SBT A;  1FKO A;  1W9H A;  3LDN A;  3GBT A;  3FE1 A;  5FLX O;  3PX4 A;  4BC4 A;  3T1A A;  4K8X A;  4H03 B;  3SUP A;  1FKP A;  4C23 A;  2E2P A;  3MEC A;  2KFN A;  1NGG A;  3OYK A;  4IO9 L;  4BRG A;  3V4I A;  1R0A A;  3HI0 A;  1VSK A;  2VYP A;  4FJG A;  3GE1 A;  5JLH A;  3AY9 A;  3JYT A;  4A61 A;  3K0S A;  2O8D B;  4BR9 A;  1A5V A;  3ZCM A;  1GLD G;  3QEI A;  3OBY A;  2F8T A;  4DTN A;  2KFZ A;  3VA0 A;  3QIC A;  1WBB A;  1HUX A;  4JLH A;  4CGD A;  3T1Y K;  1E4F T;  4NLB A;  3C6H A;  3OYH A;  1RDB A;  2YKM A;  1TL3 A;  4DS4 A;  1HLU A;  3ALY A;  2I5J A;  1BI4 A;  5CYM A;  3LDO A;  1MWK A;  5AQX A;  1RGI A;  3Q7C A;  4PKG A;  1VQ7 N;  3CC7 N;  2H3G X;  4DQR A;  5J2P A;  4CEF A;  1JLE A;  1JLA A;  4K41 A;  3DLH A;  1BO5 O;  1I3A A;  2XY6 A;  2P9L A;  3OHR A;  3VET A;  1SZ2 A;  2EWS A;  2ITM A;  3SUN A;  1VQK N;  3S9H A;  2W40 A;  1XMO K;  2G8I A;  2FF6 A;  3MN5 A;  4CEO A;  4ID1 A;  5HRO A;  3KTQ A;  5CHI A;  3VMF B;  1UOC A;  2O8B B;  3KZB A;  3HRG A;  3HK2 A;  4GV3 A;  3D7E O;  4ZTJ A;  3TSU A;  3FZL A;  5FPN A;  3AO4 A;  3I56 N;  4GMJ B;  2X74 A;  4F2S A;  3WXL A;  4JN4 A;  4JKA A;  3O9R A;  1YAG A;  4E89 A;  3AV9 A;  1VSM A;  3UKR B;  4I9L A;  4KRE A;  1KVA A;  3HZ6 A;  3C6T A;  5C2D A;  3CCJ N;  4B3M K;  2W6K A;  5AQW A;  4BR5 A;  1Q18 A;  4I6M B;  4YOV A;  1IG9 A;  4IKF A;  4CEB A;  3B6O A;  4CK1 A;  1QQC A;  3ZSV A;  4MDB A;  1S6Q A;  2A6A A;  4AHC A;  4M63 C;  2VWB A;  4MO4 A;  1GOC A;  3AVJ A;  2HVH A;  4B3S K;  2QK9 A;  1M1K O;  2Q3S A;  5HRP A;  1NJX A;  1SUQ A;  1LOT B;  2Q0U A;  1U45 A;  2ASO A;  3WNE A;  4CJU A;  3CJC A;  3OY9 A;  2HNY A;  4B9T A;  5KPR A;  4CK3 A;  2UXD K;  4JK9 A;  5TKY A;  3IKM A;  1HKB A;  2QI2 A;  3PIO L;  1NLV A;  3PO5 A;  5FDL A;  2E2O A;  2FSK A;  1D4X A;  4OX9 K;  4E19 A;  3T3F A;  3PSI A;  3ZSW A;  3PSF A;  4A5B A;  1YVN A;  1RDC A;  1S5J A;  4AHV A;  3OYF A;  2AJQ A;  5HRR A;  1D8Y A;  1YIJ N;  4N76 A;  5ADX H;  5CZ1 A;  4KRF A;  2WTU A;  3SBG A;  2WFB A;  2D0O A;  2FLO A;  2P51 A;  3DXM A;  1SL1 A;  4CJL A;  3VGL A;  5C12 A;  4GVM A;  3LP1 A;  3NE6 A;  4O55 A;  5HLF A;  4NCB A;  1LW0 A;  2P1J A;  2PFU A;  3SAG A;  1N5Y A;  3MED A;  3ZET A;  2F8S A;  1IJJ A;  3RRH A;  4HCB A;  2HBK A;  3OS2 A;  2GTD A;  1EWR A;  4AHT A;  4XH1 A;  3L3U A;  4CJ5 A;  3P38 A;  3TAG A;  3ZT3 A;  5M1Q A;  3OJU A;  3NHG A;  3EKU A;  2F7T A;  3I8B A;  3KD5 E;  4CZE A;  1VSI A;  3C6A A;  3R9P A;  3A5L C;  4FWO A;  1OH7 A;  3ULE B;  1BCM A;  4EHU A;  2YHW A;  1IKV A;  2IGI A;  3NF6 A;  3SYZ A;  4BC3 A;  3TAB A;  1XHX A;  3ZX3 A;  3NCI A;  3GDQ A;  5KGW A;  3IS9 A;  1KAX A;  3SMS A;  2UUA K;  3TAE A;  3CPE A;  3NGI A;  5JIC A;  3AAQ A;  4CIG A;  1T7P A;  3D2F A;  3GL1 A;  2OPS A;  1XI1 A;  1XNQ K;  4JI1 K;  5EY4 A;  4N41 A;  3AVK A;  4CVN E;  1LAV A;  1NMD A;  2UU9 K;  1QZ6 A;  3HXM A;  3O4W A;  4WE1 A;  4IJN A;  2D0C A;  4KH5 A;  2P9U B;  2YHA A;  4NLC A;  4DFJ A;  4CZK A;  2DFH A;  3E9O A;  4DTO A;  3U9D A;  4LSL A;  1HMV A;  4MO5 A;  2WOM A;  3AVN A;  5HL7 L;  3M8Q A;  1VQ8 N;  4O44 A;  4B3T K;  3MWP A;  4J2D A;  1BIS A;  2QWP A;  1VQ4 N;  5A2Q O;  1DTQ A;  4FLW A;  3VQ7 A;  3QER A;  5JS2 A;  3CJ9 A;  3K57 A;  3PLA A;  3KVG A;  4A2B A;  1Q9Y A;  4TSX A;  5CZ2 A;  4C1N K;  3M1F A;  4PL8 A;  3LP0 A;  4FK2 A;  2P9P B;  3A0I X;  3EO3 A;  1HNV A;  4BRD A;  1U47 A;  4YDU A;  5AQZ A;  1Q7Y O;  4H0Y B;  4JK7 A;  4CHN A;  1NBW A;  3MAQ A;  3AO2 A;  3DM2 A;  1BHL A;  2QTD A;  3NAE A;  2QW9 A;  4BGA A;  1NGH A;  2BTF A;  3D2E B;  2NNW A;  2E8A A;  4JKE A;  5C15 A;  1UA0 A;  1RDU A;  3C0B A;  2YNG A;  2HW3 A;  1REV A;  1U4B A;  3VER A;  3MX5 A;  5K14 A;  1M90 O;  4KHW A;  5J2M A;  4H0O A;  2D0A A;  2UUB K;  3BUZ B;  3LM2 A;  2IVO A;  4BRF A;  3L4I A;  4FM0 A;  4W5O A;  3DI6 A;  1ITG A;  3I0R A;  4B9Q A;  3AGK A;  1YXQ A;  4DQS A;  4ISG A;  3SUQ A;  1IKW A;  3CD6 N;  1JXE A;  1B9F A;  2QM1 A;  3TAQ A;  1HPZ A;  4O5B A;  3WNF A;  2A5X A;  3VQ9 A;  3A5N C;  4BC2 A;  4NYN A;  1WSE A;  4PKI A;  1TKD A;  1L5U A;  4NB4 A;  4M3T A;  3LDP A;  4DFK A;  1TYQ A;  1QQN A;  3RMA A;  4FJI A;  4OPA A;  3M8S A;  4CF9 A;  1NK5 A;  4JI5 K;  4LFA K;  1YI2 N;  1JKH A;  1QS4 A;  3U3Y A;  4CZI A;  3QEP A;  4KI4 A;  3JXU A;  1BI4 B;  1WN7 A;  2O4I A;  4HWI A;  3HO1 A;  3SLC A;  4I2P A;  4K0K K;  1VQO N;  5EOY A;  1L3U A;  3AVH A;  4CD1 A;  3F9K A;  3THW A;  2HHT A;  3VQD A;  4GV6 A;  3M6G A;  5KGX A;  4O0I A;  2Y1I A;  4N56 A;  3EN9 A;  3L8B A;  2O8D A;  2XY7 A;  1KD1 O;  3BZC A;  4DV4 K;  1KFS A;  3OS0 A;  1RDW X;  4E1N A;  4BVP A;  3ID6 A;  4KHN A;  4X64 K;  1LCU A;  4CER A;  3F2K A;  4M3R A;  2VWJ A;  4AM7 A;  2D4W A;  4AH9 A;  3TU5 A;  4KB1 A;  4YY3 K;  3QML A;  3VQ4 A;  1BUP A;  3OW2 M;  3K5O A;  2HBJ A;  3CQX A;  1RBV A;  2NRR A;  1HYS A;  5TKW A;  3C7N A;  4F9O A;  1ZBF A;  1VQP N;  2F9W A;  4JI3 K;  4H0X B;  3VQQ A;  4KHS A;  4B9L A;  4O8U A;  2KZM A;  4E7J A;  1ATS A;  4A62 A;  4LFB K;  3ZSQ A;  4DG1 A;  1C1B A;  4YNQ A;  1NK9 A;  4FW2 A;  1D9F A;  3S3N A;  4CFC A;  4DB3 A;  1WOQ A;  5BN8 A;  2O8C A;  4OLB A;  1TUU A;  2NRT A;  3E01 A;  3CCS N;  5J2N A;  1C0U A;  2DPN A;  1IBM K;  3DLL L;  1KVC A;  3CER A;  4B1Y B;  4IOC L;  5JS1 A;  5AQN A;  1RCH A;  3UE5 A;  2HF4 A;  3ZEU A;  1KXP A;  3QIO A;  5C2F A;  3H3N O;  4PWD A;  5LY3 A;  1S72 N;  2KHO A;  1L3V A;  4O8K A;  3VQP A;  3EL2 A;  5AZJ A;  1P90 A;  4DSL A;  4JHD A;  2O8F A;  4ILJ A;  2HNZ A;  5M1P A;  2YNI A;  3L2R A;  4ILH A;  1DEJ A;  4M3U A;  1HKC A;  2ZE2 A;  3CFP A;  3O9U A;  4BVO A;  3P83 D;  3H3O B;  5SWM A;  1NGD A;  3HST B;  1NGE A;  4LF4 K;  1DGK N;  1NGI A;  4CZF A;  1T6C A;  3WXI A;  4J2E A;  1S22 A;  3OYD A;  2PY5 A;  2QWM A;  3DOK A;  3CJ1 A;  2E20 A;  4R5P A;  4DR4 K;  2OTJ N;  4WCE L;  2KZZ A;  2FBX A;  1Y64 A;  3OYJ A;  4QAG A;  4CJ7 A;  2WON A;  1S9G A;  2A1S A;  5GAD P;  4DUY K;  4BAC A;  3SAH A;  1UWB A;  1JLB A;  1XQS C;  2FF3 B;  3EZ5 A;  2X6N A;  3IUC A;  4IFV A;  2P5G A;  2QWR A;  1G15 A;  3O3F A;  1VSF A;  5AQO A;  3HSC A;  1ZBL A;  4IXC A;  3VQ8 A;  4FZZ A;  1RTJ A;  3PUF A;  3N4P A;  3R1X A;  4GKK K;  2CGL A;  3KLH A;  2OAN A;  1VQN N;  1WLJ A;  2EX3 A;  4FYD A;  1W2B M;  4FLT A;  3CF5 L;  2FSN A;  1NGF A;  1EET A;  3DLR A;  3NGY A;  3WEE A;  1NG9 A;  1KRP A;  4I2Q A;  4HUE A;  3UIQ A;  3ENH A;  3KIO A;  4C8M A;  3DAW A;  3M5R A;  4CHQ A;  1OVQ A;  1C6V A;  4H4O A;  3O8M A;  4LH5 A;  3BP8 A;  3IAY A;  4FJ5 A;  4OO1 J;  1CZ9 A;  1SKR A;  2GX9 A;  3VEV A;  2VQF K;  2W42 A;  1MDU B;  2E1Y A;  2HVI A;  3IFR A;  4JS5 A;  2JGU A;  4MQ3 A;  4CE9 A;  3VF4 A;  4FJN A;  4E7K A;  1IO2 A;  1JCE A;  3QLH A;  3E9P A;  1RTI A;  1RDA A;  3L4Q A;  4JI4 K;  4FLZ A;  4BR0 A;  3AVF A;  3WNH A;  4HTU A;  1IKY A;  3B6P A;  1GLB G;  4BRO A;  4CJS A;  5AQL A;  1U49 A;  2Q36 A;  4FO0 A;  4DFP A;  2NUB A;  1J5E K;  1IH7 A;  4CEZ A;  3GG4 A;  3M8P A;  3MK6 A;  3BZK A;  4X65 K;  5CE3 A;  5JVG L;  3LAL A;  4M3Y A;  5F1X A;  1SKS A;  3ZSX A;  5C42 A;  2O8E B;  3DRS A;  3CYM A;  2ETJ A;  5AQK A;  1VHX A;  5LJW A;  1SS6 A;  5AZI A;  4Y1D A;  4FPA A;  4JKG B;  4YOU A;  1LW2 A;  2YNF A;  5E84 A;  4GVE A;  3P4I A;  3O1B A;  4X62 K;  1DLO A;  3EZW A;  2G8F A;  4DLG A;  4A57 A;  1SV5 A;  3IDH A;  1SKW A;  1JLQ A;  2IAJ A;  3R8E A;  3QFP A;  2HHU A;  1KCF A;  2G8U A;  3EE9 A;  3VTI A;  3VQ5 A;  2WBN A;  1X3M A;  2HF3 A;  4BG8 A;  1YVU A;  3SPZ A;  3WQU A;  5AQJ A;  3LDQ A;  3VGK A;  3PX0 A;  1S6P A;  4CF1 A;  4AQY K;  3OYN A;  1KLN A;  1N34 K;  3E9L A;  1N33 K;  3SJH A;  3G71 N;  4Z4G A;  3M8R A;  3TPQ A;  4FLV A;  3HP6 A;  1TAQ A;  1A5X A;  4FWR A;  5AQY A;  5DK5 A;  3C94 A;  1YTA A;  4C8K A;  1Q81 O;  1YHQ N;  3I0S A;  3S41 A;  4GKJ K;  4Z4I A;  1S1V A;  1DT9 A;  4YOR A;  5AQH A;  1BU6 O;  1VAZ A;  3HPH A;  2OZS A;  5M1K A;  4I7F A;  5CY4 A;  5CYQ A;  2UXB K;  4WQ5 C;  1UAX A;  1WUA A;  4C1N I;  1RBT A;  1YIT N;  3DMJ A;  3UB5 A;  1HNI A;  1OVY A;  3FZF A;  4Z4H A;  2FBY A;  1WSJ A;  5J2Q A;  1HYV A;  3THX A;  3DRP A;  2XHB A;  3IRX A;  1NGC A;  1WNS A;  1JLC A;  5E41 A;  4DFM A;  4O5F A;  4CHY A;  2XRI A;  2ZJP L;  1GLA G;  3BGR A;  4CGF A;  4OPK A;  3VEN A;  1V4S A;  3RSE B;  3CFO A;  4CZL A;  2Q31 A;  1RT6 A;  4KH4 A;  2KTQ A;  1W7A A;  2QWQ A;  1KFD A;  4IDH A;  4BWM A;  3PIP L;  3MN9 A;  4FCY A;  1KTQ A;  3OYL A;  1KC8 O;  1VSD A;  4NYF A;  3MWT A;  5AFU A;  2Q0R A;  2AP1 A;  2DFF A;  4BRQ A;  4N47 A;  3QEW A;  3H1Q A;  4C8L A;  1BQM A;  3DWL A;  3CXC M;  4DU1 A;  3THV A;  4B3O A;  2ZWH A;  3V1Q A;  3THY A;  4DQI A;  3K59 A;  5C25 A;  1JJ2 M;  3VQB A;  2RHK A;  3QNN A;  4LH4 A;  4CW7 B;  1NK0 A;  2VWK A;  3SK3 A;  3M3Z A;  1RT7 A;  4HCC A;  3U3G A;  3AO5 A;  1XWL A;  3V9U A;  5KQ8 A;  1Y97 A;  3CFR A;  1SL2 A;  1RT5 A;  4AHS A;  4BRE A;  5KI6 A;  1GLF O;  3AVC A;  4PKH A;  1I39 A;  4U67 L;  4H5R A;  1HR0 K;  3FLC O;  3CQY A;  1WB9 A;  3WUH A;  4CJ4 A;  2VQE K;  3MEE A;  5BR9 A;  4DF8 A;  4QS7 A;  2GWJ A;  3CCR N;  3DOL A;  3AVA A;  3SQ0 A;  1V4T A;  1RBS A;  5KPZ A;  1NOZ A;  5EVZ A;  2E1Z A;  4GW6 A;  2P9S A;  3LDL A;  1ZYQ A;  3BDP A;  4CBW A;  2P9S B;  4KBO A;  4DTP A;  5F0X A;  3THW B;  5ELZ A;  3K58 A;  3V1R A;  5BPL A;  1ESV A;  4IEI A;  3ZT4 A;  4B8A B;  4FJX A;  1TVR A;  2IVP A;  2QWL A;  3QIP A;  2FBV A;  1BDG A;  3AA4 A;  4KV8 A;  2YNH A;  4E7L A;  3OS1 A;  5GIN A;  3LZJ A;  3Q7B A;  2P9L B;  3WXJ A;  4CF2 A;  2JLE A;  4DTX A;  5GAH P;  1IBL K;  3QNO A;  1BG3 A;  1CXQ A;  4IO8 A;  4FVM A;  1N32 K;  2NRW A;  3K5N A;  3O5B A;  3NH2 A;  3MX2 A;  1WSI A;  2UYT A;  4H5W A;  4JKD A;  3LWM A;  5AQR A;  3AVL A;  3VTH A;  3LAM A;  3CJ7 A;  1UA1 A;  4DV1 K;  2IIR A;  3O1W A;  4KO0 A;  4V19 S;  3H45 C;  4BRK A;  1XC9 A;  3D0P A;  3MCP A;  2KW4 A;  3AO3 A;  2VGM A;  1TGO A;  4CFD A;  2ZGY A;  5LMU K;  1VSJ A;  1S1T A;  2YX6 A;  2A1R A;  4ZHR A;  1RFQ A;  1JLG A;  3BEX A;  3L3V A;  3NDK A;  1ZXO A;  1EKE A;  4M3Z A;  2FBT A;  4BRI A;  1Z6R A;  4JEP A;  4H5V A;  3KLG A;  1OH8 A;  1MU2 A;  4OGE A;  3CM5 A;  1T6D A;  1T8E A;  4FZX C;  3ZYY X;  3G4S N;  2PYJ A;  3RWU A;  4DV6 K;  1Z25 A;  2NRV A;  1ASV A;  1C1A A;  2VCP A;  4YOY A;  1VSH A;  3J81 O;  3E66 A;  2NLX A;  3AVI A;  1BOT O;  3O9T A;  4L3Q A;  3FZH A;  5FPD A;  2P9I B;  4UQG A;  5AQQ A;  4OVL A;  3SZ2 A;  1U48 A;  2G8V A;  3WXK A;  4B1W B;  2HBL A;  3CQ8 A;  4DV3 K;  2V51 B;  2ASM A;  4GY2 B;  1HYZ A;  3O3G A;  1QE1 A;  1X3N A;  2F9T A;  4BRA A;  4CEC A;  3CC2 N;  5B8H A;  5EXW A;  2Q1N A;  4JKG A;  4C8O A;  1HNX K;  1TL1 A;  3EEQ A;  3QIN A;  3LPU A;  5LJV A;  3KK2 A;  4CJR A;  3AA3 A;  3HT3 A;  3SV3 A;  1NJZ A;  2ASP A;  1ZBS A;  3IG1 A;  4LSN A;  3K5L A;  4FWN A;  3A8Y A;  3HPO A;  4M41 A;  4RWT A;  3LAN A;  4Z0U A;  4DF4 A;  1K6Y A;  4M7X A;  3U6F A;  3ASM A;  3L2W A;  3CCM N;  3THX B;  1NJW A;  3FZK A;  4CED A;  3HL8 A;  2B5J A;  2OCE A;  4KTZ A;  5F2R A;  1TYQ B;  1RT2 A;  1RT1 A;  4BDY A;  4ZTF A;  3AA2 A;  5JMV A;  1TUY A;  3SAF A;  4BY9 C;  1ILY A;  3CM6 A;  5FRM A;  2BAN A;  3UKU B;  1K9M O;  1EX4 A;  3G6E N;  5C24 A;  2JWK A;  1TK0 A;  3DXK B;  3QDK A;  1IKX A;  3OYG A;  4B9M A;  5ADX A;  2LSN A;  4A59 A;  1WSH A;  3C95 A;  4CGI A;  4W5N A;  3TAP A;  3LP2 A;  3WXM B;  3VQC A;  4RW7 A;  1J5O A;  4FJK A;  3KWI A;  2NRH A;  2BUP A;  1U6Z A;  4RW8 A;  3VQ6 A;  3CPW M;  2OTL N;  5HP1 A;  4FL9 A;  1X1P A;  4OPJ A;  3TAM A;  5AQS A;  5DM7 L;  4RW4 A;  2IDO A;  3O08 A;  2O4G A;  4QOZ B;  1XUP O;  4G9Z A;  1EQY A;  1HRH A;  1IV0 A;  3KLI A;  3OYM A;  3ZLJ A;  3HYF A;  4DMN A;  4CF8 A;  3TAN A;  1NK8 A;  1T3V A;  4JV5 K;  4CIE A;  5M1N A;  5AQV A;  4QS9 A;  5HRN A;  4F4K A;  4DUZ K;  4MDA A;  1L3S A;  2E2Q A;  2HHW A;  1HNW K;  5BRD A;  4DWI A;  4FWL A;  3ZSR A;  2QKB A;  2P9I A;  1CZB A;  3KK1 A;  4CEA A;  4YOW A;  2O8F B;  5BN9 A;  1W97 L;  4CHO A;  1C1C A;  1KLM A;  4CHP A;  5M1F A;  3RMB A;  1NWK A;  3U9Z A;  4LF6 K;  2I7N A;  4IG3 A;  4EP4 A;  3NBP A;  3O80 A;  4JD2 B;  3T69 A;  3RMD A;  1K8A O;  4BDZ A;  3ZSO A;  1C0M A;  1O1W A;  4CK2 A;  1TKX A;  1E3M A;  3HJF A;  2QKK A;  4FJL A;  1U04 A;  4CEE A;  4IBN A;  3DJC A;  4BR7 A;  5M1O A;  3VF2 A;  2Z1J A;  4E0D A;  1TKT A;  3I8D A;  1BWF O;  2JWL A;  4BR4 A;  4CGG A;  4JI2 K;  3V81 A;  1BIZ A;  3H6E A;  4JNE A;  3QEV A;  3O4N A;  1ZC6 A;  3A2F A;  3TTF A;  1B9D A;  3DRR A;  3HM9 A;  5GAG P;  3SI6 A;  2A40 A;  3G0Z A;  4HUG A;  4B1Z A;  4KHU A;  1J6Z A;  3OYC A;  3RRG A;  4FLY A;  4ISF A;  1TKZ A;  4CJP A;  4F3O A;  3HOS A;  3NVK A;  5KRT A;  4CD3 A;  4OKJ A;  2KLA A;  3TWH A;  3JAM O;  3SQ4 A;  4EHT A;  4Y0W A;  3TAF A;  4Y1C A;  1FK9 A;  2YI1 A;  2VGN A;  1ATR A;  4JRP A;  4ELU A;  2F96 A;  4DTR A;  1WSF A;  1Q9X A;  1N6Q A;  3NH0 A;  3VOV A;  1EO1 A;  5KRS A;  1NGJ A;  4DSF A;  4JI6 K;  3T1H K;  1QQM A;  4FW1 A;  4CGJ A;  4EFH A;  3T7Z A;  1KAZ A;  4YOT A;  3U4L A;  4K8Z A;  4DTM A;  4DV7 K;  1LWC A;  1RBR A;  4FWS A;  1NNE A;  4WFA L;  1Z05 A;  4DV2 K;  1K73 O;  2QWO A;  5DMR A;  1ZBU A;  1N36 K;  3FR0 A;  4DTS A;  1R59 O;  1XHZ A;  2RF2 A;  3CCE N;  1BQN A;  3ATV A;  2D0P A;  4YOX A;  3VA3 A;  1DKG D;  4IZ9 A;  3SCX A;  5AQU A;  4DSE A;  1QVF M;  4LD0 A;  3NMU A;  4FM2 A;  5IWA K;  4BQL A;  3VQA A;  4Z4C A;  2G8W A;  3EKS A;  2UXC K;  1JCG A;  3R3L A;  4B9N A;  3NF8 A;  4C8N A;  4I6M A;  2ZJR L;  4XH4 A;  1NKC A;  4EAH D;  2V52 B;  1X9W A;  3J7A P;  3NGZ A;  1EWQ A;  3OJS A;  4CJE A;  3J80 O;  1K8K A;  4CBU A;  3PV8 A;  4J2B A;  1X9M A;  4CHZ A;  4DHY A;  5AR0 A;  3QBX A;  3MCA B;  3DLE A;  3CCV N;  3KJV A;  4PUO A;  4E1M A;  3CMA N;  3W0L A;  1HJO A;  4ELV A;  2F4V K;  3ENO A;  5BRF A;  3OYB A;  1VK0 A;  3J7Z O;  4M42 A;  3SMP A;  2P9K B;  3NFA A;  3DXK A;  2G8K A;  2ZQB A;  1WAJ A;  4JKC A;  4KHP K;  5I42 A;  1CZA N;  1BL3 A;  1KQS M;  4GV9 A;  1YJN N;  2GUI A;  2DFE A;  4DQQ A;  4BRH A;  4B9S A;  5KPT A;  5AZJ B;  2DY4 A;  2HHV A;  3O9S A;  2A41 A;  1X9J A;  2V7Z A;  3F73 A;  2FSJ A;  4ISE A;  3J7Y P;  1S1X A;  1TK5 A;  2G8H A;  4CES A;  4CIF A;  4WFB L;  4E3S A;  3AAR A;  2Y1J A;  4CJK A;  4IFE A;  4CBX A;  1MA9 B;  3O4Q A;  1NK4 A;  3ZEU B;  3L2Q A;  2O8C B;  3NH1 A;  2QXL A;  2WUS A;  1KAY A;  5GIO A;  2OA8 A;  3P39 A;  3CCQ N;  1FW6 A;  1HKG A;  1NM1 A;  3L6Q A;  3QES A;  3WNG A;  4FJ7 A;  2XY8 A;  3HVR A;  4FJ8 A;  4IEE A;  4KH6 A;  3LDS A;  2NZT A;  4IOX A;  3F5T A;  4RCH A;  4CF0 A;  2P5O A;  4LF9 K;  3IMX A;  2QXF A;  4YDU C;  4E1J A;  1RTD A;  4EP5 A;  2V7Y A;  1OH6 A;  4QCL A;  4NO7 A;  3WEE B;  3C6U A;  4DTU A;  1ATN A;  3MXI A;  4WQ4 A;  2YKN A;  3QBW A;  3LP3 A;  4DQ8 A;  1L3T A;  3TTD A;  4M3X A;  4CJW A;  3V9S A;  4ID5 A;  1YTU A;  2ZM6 K;  4K25 A;  4BE0 A;  1XC3 A;  5EX5 A;  3RTV A;  1S3X A;  2P9N B;  3OYA A;  4BG9 A;  2P9N A;  5AQG A;  4BRP A;  3KK3 A;  1NU0 A;  4JI0 K;  3KLE A;  3FFK B;  4BQZ A;  3B8A X;  4FVU A;  2QA4 N;  1RNH A;  3D6R A;  2D1K A;  1LWE A;  2FXU A;  4KPY A;  3KWG A;  2A3Z A;  1IBK K;  1TAU A;  4FSV A;  1NK6 A;  4Q0B A;  4DSI A;  1RT3 A;  4MLE A;  4W5T A;  3K9J A;  3TSQ A;  1XNR K;  4CJQ A;  2CH5 A;  3I33 A;  4KTW A;  4FLU A;  3CCU N;  3ISN C;  5AFU H;  4FOI A;  2BH1 A;  4WQ4 C;  3C65 A;  4PHT X;  4B9V A;  2D0B A;  4JS4 A;  3V9X A;  4B1U B;  5FRN A;  3AVG A;  3K9K A;  3LZI A;  3SQ1 A;  3NF7 A;  1J54 A;  1T05 A;  1P8Z A;  1S1W A;  4FWQ A;  4DV5 K;  1K8K B;  4LF5 K;  3BF3 A;  3HBT A;  4RW6 A;  3RVC A;  1SAZ A;  3TSP A;  2E88 A;  2Z1G A;  3SV4 A;  1F21 A;  3LL3 A;  1D9D A;  2O8B A;  4JAX A;  3FFI A;  2GV9 A;  2OPR A;  3U8X A;  2IS3 A;  2P9P A;  4H4M A;  2FC0 A;  4M3W A;  3FZM A;  4CJV A;  1WAF A;  5JLF A;  1QSS A;  1ASU A;  3HM8 A;  4K43 A;  1YF5 L;  2P9U A;  4LC9 B;  4NCA A;  3AVB A;  1N8R O;  2RE2 A;  2I7P A;  4H0V B;  4DCH A;  4DSK A;  3D45 A;  3O9Q A;  4A5A A;  1VQL N;  1NGA A;  4OKK A;  1J53 A;  1BGX T;  2AA4 A;  4CJ3 A;  4W5Q A;  1I94 K;  4CEQ A;  1JL2 A;  2PZS A;  4JK8 A;  3L0Q A;  4RG8 A;  1C0T A;  1VRU A;  4FJJ A;  1Q86 O;  4BDP A;  4CZM A;  3THY B;  1J9A A;  4K42 A;  1JLF A;  1W0H A;  1SL0 A;  4J8F A;  3AO1 A;  2Z1I A;  4X66 K;  1NK7 A;  3V1O A;  4Z4E A;  1QTM A;  5AQM A;  1FXX A;  1QHT A;  3P31 A;  5AQI A;  1YJ9 N;  2BGG A;  1JCF A;  3T19 A;  3J8A A;  2IVN A;  1WBD A;  3F9M A;  1T03 A;  3S3O A;  2EHG A;  3CME N;  4KKO A;  1DTT A;  5HBM A;  4AIL C;  3DXM B;  4ILG B;  4DR2 K;  2UUC K;  4CZJ A;  3KK7 A;  3EY1 A;  4CCH A;  1U2V B;  3MN6 A;  1X9S A;  1LAW A;  4B1X B;  1OH5 A;  3S3M A;  4L8R B;  3ZET B;  2W6L A;  1MWM A;  2X6S A;  1TV6 A;  4BE1 A;  1QSY A;  5J1E A;  3JSM A;  3R6M A;  3MXJ A;  5T7B A;  1HX1 A;  2ZD1 A;  1TK8 A;  4B08 A;  1QVG M;  3MMV A;  5H1S Q;  3H1V X;  1NGB A;  3PX6 A;  4EIA A;  2HBM A;  1E4G T;  4M7Y A;  1S1U A;  3OBW A;  4CZH A;  3SUO A;  4DR5 K;  3SJJ A;  1O13 A;  4E7H A;  4W5R A;  4O4G A;  4J2A A;  1EP4 A;  3SPY A;  3ATU A;  3G10 A;  4FPB A;  2D5R A;  4DTJ A;  4A2A A;  3W3D A;  3L2V A;  2GEL A;  4LY7 A;  4XH5 A;  3RSE A;  4DKW A;  4LF7 K;  4H0P A;  4IWV A;  2IOC A;  3ZSZ A;  3ZSY A;  2HMP A;  4HHT A;  1GOA A;  3LPT A;  5SZT A;  2ZJQ L;  3DLB A;  4FJM A;  3QB0 A;  3LM9 A;  1GLC G;  4JRQ A;  5BRE A;  5IT9 O;  3VF6 A;  1QZ5 A;  4Q5V A;  2KQ2 A;  4F2R A;  1NJI O;  2E6M A;  3TTC A;  4N5S A;  4BRC A;  1YT3 A;  3ZT2 A;  1C0F A;  3CCL N;  4LF8 K;  3VQE A;  4PY5 A;  4FWM A;  3HOT A;  3N4Q A;  2CH6 A;  3AGR A;  3VPZ A;  4DR7 K;  4OPH A;  5C0Y A;  2GEM A;  4WYB A;  3CHW A;  4FK0 A;  4JKB A;  3CG7 A;  3VGM A;  2YHX A;  3V6D A;  2PYL A;  4O0J A;  5CR4 A;  5MLC Q;  3DLK A;  3K5M A;  4OLA A;  2CGK A;  1OKJ A;  1HQE A;  4HUF A;  1B92 A;  4DSJ A;  5DM6 L;  5AQT A;  3UKR A;  4Z94 A;  3L2U A;  2YJE A;  2B6A A;  1RDD A;  4CJT A;  1VSE A;  2W41 A;  2HST A;  3CIP A;  1WSG A;  3QFU A;  5AJ3 K;  3RMC A;  2OPQ A;  3ZT0 A;  4KI6 A;  4AF1 A;  3VEW A;  1ZBI A;  1CXU A;  5GIP A;  3OYI A;  3ZX0 A;  4M45 A;  4WFN L;  3A5M C;  4CFA A;  2ZGZ A;  4RW9 A;  4CZG A;  1LWF A;  3VEX A;  3MEG A;  1HPM A;  1Q8I A;  3HVT A;  5E26 A;  3PO4 A;  4IDK A;  4H0T B;  1KVB A;  4YFU A;  2HMI A;  4WQ5 A;  4F8R A;  3SNN A;  1SQK A;  4ELT A;  5AQF A;  4B1V A;  4BWJ A;  2E6L A;  3HPG A;  2ATQ A;  3NVM A;  2GWK A;  4B3R K;  3P5J A;  3VES A;  2E4L A;  2Q2R A;  1YUW A;  3KHY A;  4KHY A;  1ASW A;  3AAP A;  4YHH K;  3BY5 A;  3EE8 A;  1GOB A;  1RIL A;  4KTQ A;  3V9Z A;  4XIU A;  3AA5 X;  2XO7 A;  4KB0 A;  1NKE A;  3FGU A;  2PBD A;  1YJW N;  5C10 A;  5D3G A;  3WQT A;  5I9E B;  1VQ9 N;  5LMN K;  4QS8 A;  3I55 N;  4GNI A;  3KKS A;  3CET A;  3LAK A;  1T44 A;  4LFC K;  4DLE A;  4ICL A;  4H5N A;  5KTQ A;  2NRZ A;  4NXN K;  2IC3 A;  4DU3 A;  1BIU A;  1H1V A;  5I3U A;  1NMN A;  2HHH K;  1S9E A;  1GLL O;  5GAE P;  2HND A;  2XY5 A;  2OZM A;  4EZ9 A;  2PAV A;  3HP9 A;  4JKF A;  4E7I A;  3RR8 A;  2YHY A;  4OKE A;  4FWP A;  2O8E A;  1HQU A;  5FPE A;  1Q82 O;  4B8C A;  1XMQ K;  3OYE A;  4PQU A;  2YV0 X;  4XEI A;  2DTU A;  5BPN A;  3MN7 A;  4B9U A;  5LL6 Z;  5BRH A;  5AZI B;  3GOI A;  2HHX A;  3DYA A;  4FLX A;  4BR2 A;  2J4R A;  2E5L K;  4OJR A;  2BDP A;  4CI6 A;  2E2N A;  4JI7 K;  2RN2 A;  3O6W A;  2ZF5 O;  4CGH A;  3ID8 A;  2HB5 A;  1BA0 A;  1HNZ K;  2GBZ A;  1RTH A;  3MDQ A;  4DR1 K;  4EZ6 A;  1GLE G;  2A42 A;  3CJB A;  3OA9 A;  4FXD A;  3TR8 A;  3H46 O;  1QHA A;  2BE2 A;  3A5O C;  3VEZ A;  3RR7 A;  1JXB A;  4BRL A;  4R79 A;  2YJF A;  3ENB A;  5HRS A;  4PA1 A;  3H08 A;  4DV0 K;  1EXQ A;  3G25 A;  3OVN A;  3WT0 A;  3TAR A;  4FJ9 A;  5FPM A;  4FOE A;  4BE2 A;  4JHD B;  1HJR A;  4MFB A;  4AHR A;  2B4J A;  3BF1 A;  3QET A;  3MXM A;  3C7N B;  5KQD A;  4H8K A;  1NKB A;  5BR8 K;  4MLH A;  1CLQ A;  3QO9 A;  3CC4 N;  4FK4 A;  2Q97 A;  2RKI A;  1U2V A;  4IOA L;  4I9Q A;  4JKH A;  1ZBH A;  3LWL A;  1NOY A;  4U7B A;  3VEY A;  5JVH L;  4IG0 A;  1VRT A;  4JI8 K;  4Z4F A;  1VSL A;  4JYA K;  2YCH A;  4UY8 O;  3ULE A;  1IG8 A;  3ITH A;  2VG5 A;  2ITG A;  1GLJ O;  3JS6 A;  4DR6 K;  4DQP A;  2YHB A;  5BPM A;  3ULD A;  4RTF D;  3VEO A;  2HOE A;  2OPP A;  4KAZ A;  3PY8 A;  3NF9 A;  4PL7 A;  4HTL A;  4IFY A;  2KKZ A;  3UKU A;  4AM6 A;  3QEX A;  4BRN A;  1JL1 A;  3E1Y A;  3EYZ A;  5FRO A;  4G1Q A;  1KSP A;  3VN5 A;  2OYQ A;  1LV5 A;  1QSL A;  4JD2 A;  3SQ2 A;  3TI0 A;  1BCO A;  4H5T A;  4KHQ A;  4BRM A;  4WF9 L;  1BA1 A;  5EU7 A;  3K2P A;  1RT4 A;  3D2E A;  1FJG K;  4F3T A;  4HVJ A;  3KLF A;  1C0G A;  4KFB A;  3ZT1 A;  2HHS A;  3O3H A;  2VG6 A;  2NRX A;  4FM1 A; 
#chains in the Genus database with same CATH homology
 3SV4 A;  1F21 A;  3P1G A;  1D9D A;  2KZM A;  4E7J A;  4CJF A;  4CFB A;  3FFI A;  2GV9 A;  2OPR A;  4UQG A;  2HHQ A;  3SZ2 A;  4OVL A;  1U48 A;  2VG7 A;  3KKR A;  3ZSQ A;  4DG1 A;  2R7Y A;  1C1B A;  4AHU A;  2IS3 A;  2G8V A;  4YNQ A;  3CQ8 A;  4FW2 A;  1NK9 A;  1D9F A;  3S3N A;  4CFC A;  4FJH A;  1HYZ A;  4H4M A;  3O3G A;  1QE1 A;  4NCG A;  3KD1 E;  4DU4 A;  2FC0 A;  4CEC A;  4M3W A;  4CJV A;  1D5A A;  1WAF A;  1Z26 A;  1QSS A;  4OLB A;  4C8O A;  1TL1 A;  1ASU A;  3QIN A;  2X78 A;  3LPU A;  4NCA A;  4FZY A;  3E01 A;  3AVB A;  5J2N A;  3KK2 A;  4CJR A;  2Z1H A;  3AA3 A;  3HT3 A;  3SV3 A;  3V9W A;  1C0U A;  1NJZ A;  3DLG A;  1A5W A;  1KVC A;  1RBU A;  4DSK A;  3D45 A;  3IG1 A;  5JS1 A;  1NJY A;  4OKK A;  1J53 A;  1RCH A;  2RPI A;  4OGC A;  1BGX T;  4LSN A;  4CJ3 A;  3AVM A;  4W5Q A;  3HPO A;  3K5L A;  4M41 A;  1JL2 A;  4CEQ A;  2PZS A;  3LAN A;  3QIO A;  4Z0U A;  4DS5 A;  4RG8 A;  1K6Y A;  4DF4 A;  3U6F A;  1C0T A;  1FKO A;  1W9H A;  1VRU A;  4PWD A;  3ASM A;  3L2W A;  1NJW A;  4FJJ A;  1L3V A;  3HL8 A;  2B5J A;  4CED A;  4BDP A;  4KTZ A;  3VQP A;  4BDY A;  1RT2 A;  1RT1 A;  4ZTF A;  3PX4 A;  3AA2 A;  4DSL A;  1J9A A;  1JLF A;  3CM6 A;  3T1A A;  5FRM A;  2HNZ A;  1W0H A;  2BAN A;  2YNI A;  3L2R A;  1SL0 A;  4K8X A;  3SUP A;  3AO1 A;  2Z1I A;  1FKP A;  1NK7 A;  3V1O A;  4M3U A;  1EX4 A;  2ZE2 A;  3CFP A;  4Z4E A;  3MEC A;  5C24 A;  1TK0 A;  2KFN A;  1QTM A;  3OYK A;  1FXX A;  3P83 D;  5SWM A;  1QHT A;  3HST B;  1IKX A;  3V4I A;  3OYG A;  4B9M A;  1R0A A;  2LSN A;  1VSK A;  4J2E A;  2BGG A;  4FJG A;  3T19 A;  3OYD A;  1WSH A;  3DOK A;  2PY5 A;  3C95 A;  4CGI A;  4R5P A;  3JYT A;  4W5N A;  2KZZ A;  3TAP A;  3LP2 A;  2FBX A;  1A5V A;  3VQC A;  4RW7 A;  3S3O A;  1T03 A;  1J5O A;  2EHG A;  3ZCM A;  4FJK A;  4KKO A;  1DTT A;  4QAG A;  5HBM A;  3OYJ A;  2WON A;  4AIL C;  4DTN A;  3QEI A;  2F8T A;  2KFZ A;  1S9G A;  2A1S A;  4RW8 A;  3VQ6 A;  3VA0 A;  4BAC A;  1UWB A;  5HP1 A;  4JLH A;  4CGD A;  1JLB A;  3EY1 A;  4CCH A;  3EZ5 A;  2X6N A;  1X1P A;  4OPJ A;  3TAM A;  4IFV A;  3OYH A;  4RW4 A;  1X9S A;  1LAW A;  1G15 A;  1RDB A;  2IDO A;  1VSF A;  1TL3 A;  2YKM A;  3O3F A;  3S3M A;  4L8R B;  1ZBL A;  2O4G A;  4DS4 A;  3ALY A;  3VQ8 A;  4FZZ A;  4QOZ B;  1RTJ A;  2I5J A;  1BI4 A;  1HRH A;  3KLI A;  3PUF A;  5CYM A;  2X6S A;  3OYM A;  1TV6 A;  4BE1 A;  3KLH A;  1QSY A;  3HYF A;  5J1E A;  3JSM A;  4DMN A;  1WLJ A;  2EX3 A;  4CF8 A;  3MXJ A;  3TAN A;  4FYD A;  5T7B A;  2ZD1 A;  1TK8 A;  4B08 A;  1NK8 A;  4CIE A;  4FLT A;  3DLR A;  1EET A;  5HRN A;  3NGY A;  3PX6 A;  4F4K A;  1L3S A;  1KRP A;  2HHW A;  4I2Q A;  4HUE A;  3UIQ A;  3KIO A;  4C8M A;  4DQR A;  5J2P A;  4CEF A;  4DWI A;  3HJF A;  1JLE A;  1JLA A;  3ZSR A;  3DLH A;  2QKB A;  1S1U A;  4CHQ A;  3SUO A;  3SJJ A;  1CZB A;  1I3A A;  2XY6 A;  1C6V A;  4H4O A;  3KK1 A;  4E7H A;  4W5R A;  4O4G A;  4LH5 A;  4J2A A;  1EP4 A;  4CEA A;  3IAY A;  4FJ5 A;  3SPY A;  4CHO A;  1CZ9 A;  1C1C A;  1KLM A;  3SUN A;  3S9H A;  3G10 A;  1SKR A;  2D5R A;  4DTJ A;  3L2V A;  2G8I A;  4LY7 A;  4CHP A;  2W42 A;  4CEO A;  4ID1 A;  3RMB A;  5HRO A;  3KTQ A;  2HVI A;  1UOC A;  4JS5 A;  3HK2 A;  2JGU A;  2IOC A;  4IG3 A;  4MQ3 A;  3NBP A;  3ZSY A;  3ZSZ A;  4CE9 A;  4EP4 A;  1GOA A;  3AO4 A;  3LPT A;  5SZT A;  3ZSO A;  1C0M A;  1O1W A;  4CK2 A;  4BDZ A;  4E7K A;  3DLB A;  1TKX A;  4FJM A;  1IO2 A;  4GMJ B;  2X74 A;  3QLH A;  4F2S A;  2QKK A;  1RTI A;  1RDA A;  4FJL A;  1U04 A;  4FJN A;  4JRQ A;  4CEE A;  4IBN A;  4FLZ A;  3AVF A;  3WNH A;  4HTU A;  4Q5V A;  1IKY A;  3B6P A;  4E89 A;  3AV9 A;  1VSM A;  2Z1J A;  4CJS A;  2KQ2 A;  4E0D A;  4F2R A;  4I9L A;  1TKT A;  3I8D A;  2E6M A;  4KRE A;  1KVA A;  1U49 A;  3C6T A;  4CGG A;  4N5S A;  3V81 A;  4DFP A;  2NUB A;  1IH7 A;  1BIZ A;  1YT3 A;  1IG9 A;  4CEZ A;  3ZT2 A;  3M8P A;  3QEV A;  4IKF A;  3O4N A;  3A2F A;  3LAL A;  4CEB A;  3B6O A;  1B9D A;  4CK1 A;  1SKS A;  3DRR A;  3VQE A;  4M3Y A;  1QQC A;  3ZSX A;  3ZSV A;  3HM9 A;  4PY5 A;  1S6Q A;  5C42 A;  3SI6 A;  3DRS A;  3G0Z A;  4AHC A;  3CYM A;  2ETJ A;  4HUG A;  4KHU A;  1GOC A;  3AVJ A;  2HVH A;  2QK9 A;  3OYC A;  3RRG A;  4FLY A;  1TKZ A;  4CJP A;  4F3O A;  2Q3S A;  4FK0 A;  5HRP A;  1NJX A;  1SUQ A;  3CG7 A;  5KRT A;  4Y1D A;  1U45 A;  3V6D A;  2PYL A;  4O0J A;  4OKJ A;  3WNE A;  3DLK A;  3K5M A;  1LW2 A;  2YNF A;  4CJU A;  3TWH A;  4OLA A;  3SQ4 A;  3OY9 A;  3TAF A;  2HNY A;  4B9T A;  4Y1C A;  1DLO A;  1FK9 A;  2G8F A;  1HQE A;  4CK3 A;  4DLG A;  4HUF A;  4JRP A;  4ELU A;  2F96 A;  4DTR A;  1B92 A;  1SV5 A;  1WSF A;  1Q9X A;  1SKW A;  4DSJ A;  1N6Q A;  1JLQ A;  3PO5 A;  3NH0 A;  2IAJ A;  5KRS A;  5FDL A;  3L2U A;  4E19 A;  3T3F A;  3ZSW A;  4DSF A;  2HHU A;  2B6A A;  1KCF A;  4AHV A;  1RDC A;  1S5J A;  3OYF A;  1RDD A;  2G8U A;  2AJQ A;  4CJT A;  1VSE A;  3VQ5 A;  5HRR A;  4FW1 A;  1D8Y A;  4N76 A;  1YVU A;  1WSG A;  5CZ1 A;  4CGJ A;  3SPZ A;  4KRF A;  3PX0 A;  3RMC A;  2OPQ A;  1S6P A;  4CF1 A;  3RMD A;  3OYN A;  3ZT0 A;  4KI6 A;  2P51 A;  1KLN A;  1ZBI A;  1CXU A;  4Z4G A;  1SL1 A;  3OYI A;  4CJL A;  3M8R A;  4M45 A;  4K8Z A;  4CFA A;  4GVM A;  3LP1 A;  3NE6 A;  4DTM A;  4RW9 A;  1LWC A;  1RBR A;  4O55 A;  1LWF A;  5HLF A;  4NCB A;  4FLV A;  3HP6 A;  1LW0 A;  1TAQ A;  2P1J A;  5DMR A;  3MEG A;  1N5Y A;  1ZBU A;  3MED A;  4HHT A;  1A5X A;  4DTS A;  2F8S A;  5DK5 A;  3C94 A;  1YTA A;  1XHZ A;  4C8K A;  3RRH A;  1Q8I A;  4HCB A;  2RF2 A;  3HVT A;  3OS2 A;  3PO4 A;  1BQN A;  3I0S A;  4IDK A;  4AHT A;  1KVB A;  4YFU A;  2HMI A;  3L3U A;  4CJ5 A;  3VA3 A;  3SCX A;  4ZTJ A;  4DSE A;  4F8R A;  1S1V A;  4LD0 A;  3TAG A;  4FM2 A;  4Z4I A;  3ZT3 A;  3OJU A;  3SNN A;  3VQA A;  3NHG A;  4ELT A;  4Z4C A;  2G8W A;  3KD5 E;  4BWJ A;  1VSI A;  2E6L A;  3HPG A;  4B9N A;  3NF8 A;  4C8N A;  2ATQ A;  3HPH A;  2OZS A;  1BCM A;  4I7F A;  1IKV A;  2IGI A;  3NF6 A;  3P5J A;  5CY4 A;  5CYQ A;  3SYZ A;  1NKC A;  1UAX A;  2E4L A;  3TAB A;  1RBT A;  1XHX A;  3DMJ A;  1X9W A;  1HNI A;  3NGZ A;  3NCI A;  4Z4H A;  2FBY A;  5KGW A;  4KHY A;  1ASW A;  3IS9 A;  1WSJ A;  3OJS A;  1HYV A;  5J2Q A;  4CJE A;  3DRP A;  3TAE A;  2XHB A;  3NGI A;  3IRX A;  3PV8 A;  4J2B A;  1WNS A;  1GOB A;  1RIL A;  4CIG A;  1JLC A;  1X9M A;  1T7P A;  4KTQ A;  5E41 A;  4DFM A;  2OPS A;  4CHZ A;  4CHY A;  2XRI A;  3V9Z A;  1XI1 A;  4XIU A;  3AA5 X;  4N41 A;  2XO7 A;  4KB0 A;  3AVK A;  1NKE A;  1LAV A;  3DLE A;  3BGR A;  3HXM A;  4CGF A;  4OPK A;  3KJV A;  4PUO A;  5D3G A;  3CFO A;  4E1M A;  4WE1 A;  4ELV A;  2D0C A;  1RT6 A;  2YHA A;  2KTQ A;  4DFJ A;  1KFD A;  2DFH A;  4BWM A;  1VK0 A;  3OYB A;  4M42 A;  4DTO A;  4FCY A;  1KTQ A;  3OYL A;  4LSL A;  1HMV A;  3NFA A;  2G8K A;  2WOM A;  2ZQB A;  1VSD A;  3KKS A;  4NYF A;  1WAJ A;  3AVN A;  2DFF A;  3M8Q A;  3LAK A;  4O44 A;  4N47 A;  3QEW A;  1BL3 A;  5I42 A;  4J2D A;  1BIS A;  4C8L A;  1BQM A;  4ICL A;  4DLE A;  5KTQ A;  1DTQ A;  4FLW A;  2IC3 A;  3VQ7 A;  4DU3 A;  4DU1 A;  1BIU A;  3QER A;  5JS2 A;  2GUI A;  3THV A;  2DFE A;  5I3U A;  4B3O A;  4DQQ A;  3K57 A;  1S9E A;  2XY5 A;  2OZM A;  2HND A;  4EZ9 A;  3HP9 A;  3V1Q A;  4E7I A;  1Q9Y A;  4TSX A;  5CZ2 A;  4B9S A;  3RR8 A;  4DQI A;  2DY4 A;  2HHV A;  3LP0 A;  4OKE A;  3K59 A;  4FK2 A;  1HQU A;  5C25 A;  1HNV A;  3VQB A;  4B8C A;  3F73 A;  3QNN A;  3OYE A;  1U47 A;  4PQU A;  2YV0 X;  2DTU A;  4CHN A;  4LH4 A;  1S1X A;  3MAQ A;  3AO2 A;  1TK5 A;  1NK0 A;  2G8H A;  3DM2 A;  4CES A;  4B9U A;  4CIF A;  2VWK A;  1BHL A;  2HHX A;  3NAE A;  1RT7 A;  4E3S A;  4HCC A;  3U3G A;  3AO5 A;  3DYA A;  4FLX A;  1XWL A;  3V9U A;  1SL2 A;  1Y97 A;  3CFR A;  1RT5 A;  2Y1J A;  4OJR A;  4AHS A;  4CJK A;  2BDP A;  5KI6 A;  3AVC A;  3O4Q A;  2RN2 A;  1NK4 A;  1UA0 A;  3L2Q A;  1I39 A;  2YNG A;  4CGH A;  1REV A;  3NH1 A;  1U4B A;  2HW3 A;  5K14 A;  2OA8 A;  4KHW A;  2HB5 A;  5J2M A;  2GBZ A;  1RTH A;  2D0A A;  4CJ4 A;  3MEE A;  4EZ6 A;  4DF8 A;  4FM0 A;  3QES A;  4W5O A;  3DI6 A;  3DOL A;  1ITG A;  3WNG A;  2P5G A;  3I0R A;  4FJ7 A;  2XY8 A;  4FXD A;  4DQS A;  3AVA A;  3TR8 A;  3HVR A;  3SQ0 A;  3SUQ A;  1IKW A;  1RBS A;  4FJ8 A;  3LDS A;  1NOZ A;  1JXE A;  1B9F A;  3TAQ A;  1HPZ A;  4GW6 A;  4O5B A;  3WNF A;  4CF0 A;  2P5O A;  2BE2 A;  3VQ9 A;  2QXF A;  1ZYQ A;  3BDP A;  1JXB A;  4EP5 A;  1RTD A;  3RR7 A;  4NYN A;  4DTP A;  4QCL A;  1WSE A;  3K58 A;  3V1R A;  3C6U A;  4PA1 A;  3H08 A;  5HRS A;  4DTU A;  3ZT4 A;  3MXI A;  1EXQ A;  2YKN A;  4B8A B;  1TVR A;  1TKD A;  1L5U A;  4FJX A;  3LP3 A;  3OVN A;  3QIP A;  2FBV A;  4M3T A;  3AA4 A;  4KV8 A;  4DFK A;  3TAR A;  2YNH A;  4E7L A;  4FJ9 A;  3OS1 A;  1L3T A;  4BE2 A;  3RMA A;  4M3X A;  4CJW A;  3LZJ A;  4FJI A;  1HJR A;  4MFB A;  4AHR A;  2B4J A;  3M8S A;  3QET A;  4CF9 A;  3V9S A;  4ID5 A;  3MXM A;  4H8K A;  4CF2 A;  1NK5 A;  1NKB A;  1YTU A;  2JLE A;  4BE0 A;  4DTX A;  1CLQ A;  3QNO A;  3QO9 A;  3RTV A;  1JKH A;  1CXQ A;  4FK4 A;  4FVM A;  1QS4 A;  2RKI A;  3U3Y A;  3OYA A;  4I9Q A;  3K5N A;  1ZBH A;  3KK3 A;  3LWL A;  3QEP A;  1NOY A;  4KI4 A;  3NH2 A;  4IG0 A;  1VRT A;  1WSI A;  3KLE A;  1BI4 B;  1WN7 A;  3LWM A;  2O4I A;  3HO1 A;  3AVL A;  4I2P A;  4Z4F A;  1VSL A;  3LAM A;  1RNH A;  1UA1 A;  4KO0 A;  3ITH A;  2VG5 A;  1XC9 A;  3D0P A;  1LWE A;  2KW4 A;  3AO3 A;  2ITG A;  4KPY A;  1L3U A;  3AVH A;  1TGO A;  3F9K A;  4DQP A;  4CFD A;  2HHT A;  1TAU A;  1NK6 A;  2YHB A;  4Q0B A;  1VSJ A;  1S1T A;  3VQD A;  4B9L A;  3ULD A;  4DSI A;  5KGX A;  4O0I A;  2Y1I A;  1RT3 A;  4N56 A;  4W5T A;  3L8B A;  2A1R A;  4ZHR A;  2OPP A;  3L3V A;  1JLG A;  3NDK A;  2XY7 A;  1KFS A;  4KAZ A;  3OS0 A;  4CJQ A;  3PY8 A;  3NF9 A;  1EKE A;  4E1N A;  4IFY A;  4FLU A;  4KTW A;  4M3Z A;  2FBT A;  4KHN A;  3QEX A;  1JL1 A;  3ISN C;  3EYZ A;  5FRO A;  4CER A;  4G1Q A;  1KSP A;  4B9V A;  2D0B A;  4JS4 A;  4M3R A;  3VN5 A;  2VWJ A;  3V9X A;  1LV5 A;  2OYQ A;  1QSL A;  5FRN A;  3KLG A;  3SQ2 A;  1MU2 A;  3AVG A;  4AH9 A;  3LZI A;  3SQ1 A;  3NF7 A;  1J54 A;  3TI0 A;  4OGE A;  4KB1 A;  1T05 A;  3CM5 A;  1BCO A;  1S1W A;  3VQ4 A;  1T8E A;  3K5O A;  4FZX C;  4KHQ A;  5EU7 A;  1RBV A;  2PYJ A;  3RWU A;  3K2P A;  1RT4 A;  1Z25 A;  4F3T A;  4HVJ A;  3KLF A;  1HYS A;  1ASV A;  4KFB A;  3ZT1 A;  2HHS A;  1C1A A;  3O3H A;  1ZBF A;  2VG6 A;  1VSH A;  4RW6 A;  4FM1 A;  3VQQ A;  4KHS A;  2Z1G A;  3AVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...