4CF1A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf1A00
3ZSQA 4FJXA 1REVA 1BI4B 1XHXA 3VA0A 5DK5A 3ZSZA 3QNNA 1RT3A 4Q5VA 4FM1A 2RPIA 1IKVA 2YNGA 3DM2A 5SWMA 4F2SA 4IKFA 1J54A 3KKRA 3KLIA 3AVBA 2ATQA 3KD5E 2XRIA 1BCMA 3QINA 4W5OA 4KHNA 4E19A 3OYKA 4DS4A 2YHAA 2P5GA 3JSMA 3WNHA 1TKZA 4OKJA 4CHNA 3SUPA 1TK8A 1Z25A 1RT5A 4CFCA 4LD0A 1RDDA 3KD1E 3QEXA 4KHUA 4JRQA 2YHBA 2O4GA 2ZE2A 3LPUA 1KVCA 4E1MA 4FM0A 4DS5A 3LP2A 1C0TA 3QERA 4KTZA 3HO1A 4B9SA 4DLEA 4M3ZA 1NK4A 1NKBA 3U6FA 4CJLA 4FZXC 3AO5A 2BDPA 1LW0A 3FFIA 3LWLA 1O1WA 2HMIA 3LANA 4LH4A 4PY5A 3OYBA 4CF1A 3KK3A 4HUGA 1SL0A 2HHQA 3UIQA 2X78A 3OS0A 3DLHA 2D0BA 3DYAA 4K8ZA 3QIPA 2G8WA 2DFFA 1U04A 4OPJA 3TWHA 4B9UA 5KI6A 4FJHA 1RDAA 1VRUA 1HYZA 5SZTA 1GOAA 3MEEA 4DTNA 3TAFA 4KTQA 2A1RA 3IAYA 4B08A 3VQEA 4G1QA 3VQ4A 4CJUA 4J2AA 1JXBA 4CJKA 3T1AA 1RT2A 4BE1A 2OZMA 3ZT1A 4CHZA 3OYFA 1TGOA 1CZ9A 3ZSRA 5HRSA 4FLVA 4PWDA 4HVJA 2FBXA 4LSLA 4B8AB 1YTUA 3AO3A 4OKKA 1J5OA 3HVTA 4Z4IA 4CJPA 4TSXA 5HRRA 5EU7A 3NAEA 2QKBA 1RT7A 4F3TA 4NYNA 2F8SA 3NH1A 4M41A 1S5JA 4CEOA 4FJNA 3DOKA 4H4OA 3SUNA 4FK2A 1F21A 4KV8A 1YT3A 3ZSWA 3JYTA 3THVA 1NOYA 3NBPA 2G8HA 3AO1A 4F8RA 4NCGA 4M3WA 3M8PA 3PX6A 4CF2A 2P1JA 3SQ0A 4UQGA 3K5MA 2KFZA 2WOMA 2VWKA 4CEFA 4IBNA 4FLXA 3V1OA 3MAQA 1L3TA 4B9VA 3VQ5A 4CIEA 3V6DA 1KRPA 3PX4A 2IOCA 2OZSA 2F96A 4QAGA 3CFOA 3PX0A 5CYMA 4FK4A 1TAUA 2RN2A 1VSEA 4OLAA 1W9HA 3IG1A 5DMRA 5K14A 3EZ5A 2E6MA 4Z0UA 3HT3A 3AO4A 5J2QA 1QSLA 1GOCA 3EYZA 3TABA 3KTQA 4QCLA 1BL3A 1HYSA 2KFNA 4OGCA 2PZSA 4ELVA 1VRTA 1RT4A 4HUEA 3SZ2A 4B9NA 4B9MA 1IKXA 3M8SA 1WSGA 4FJJA 1WAFA 4AILC 4DFKA 4GVMA 4O4GA 3LALA 2YV0X 5I42A 2P5OA 2PYLA 3OYMA 3NF7A 3OYAA 3VQ9A 3SQ2A 1VSHA 1S9EA 4DFPA 1KCFA 1RBVA 4FJ7A 2RKIA 1K6YA 3K58A 3DRRA 1ASUA 1Y97A 3RWUA 4CJVA 1U48A 1KVAA 4CECA 2VWJA 1LWCA 3SQ1A 4W5QA 3K57A 3MXMA 1TK0A 3ZCMA 4DTJA 4DG1A 3ITHA 4DSIA 3DLGA 3MEGA 4DWIA 3NFAA 3IS9A 4LY7A 4RG8A 1JLFA 4OGEA 1EX4A 3DLEA 4QOZB 4CEBA 4JLHA 4CHQA 1VSMA 4DQQA 2HHTA 1T05A 1ASWA 1RDCA 2Q3SA 4CGIA 4ZHRA 4FJ9A 3U3YA 4M3YA 1BIUA 4N5SA 4O5BA 3OJUA 1SV5A 4E7IA 4DTUA 4ELTA 1UWBA 4W5NA 3V1QA 3P83D 4CEAA 3S3MA 2HHXA 4FW1A 3V9WA 3CFRA 4B8CA 1ASVA 3AVFA 3RRGA 4CHOA 4I9QA 1C6VA 3LP0A 4E7KA 3AV9A 2Z1GA 2LSNA 3LP3A 3ZT4A 4DLGA 2DFEA 1RTIA 3RTVA 3S3OA 3S3NA 3HSTB 1RILA 2ZQBA 3VQDA 1S1VA 3L8BA 4HHTA 4DU4A 5J2NA 1EETA 3TARA 3K2PA 4NYFA 4OVLA 3OYEA 5FRMA 5D3GA 4CJEA 2IDOA 3PY8A 1XWLA 3ZT2A 1UOCA 5FRNA 1QHTA 3AA5X 4CGJA 4KB1A 4E7LA 3NCIA 4DTPA 1IO2A 3MEDA 4DF4A 1HRHA 1SL1A 4EZ6A 1RBUA 3NF8A 3NHGA 1T8EA 2IGIA 2BANA 4NCBA 3CM6A 1BI4A 2HNDA 5FDLA 4IG0A 4DSFA 1TKXA 3AVLA 3SUOA 3NGIA 4RW6A 3KK1A 1NK5A 2HHVA 4E0DA 1RTJA 1BIZA 1NK9A 2OPRA 3AVHA 3ASMA 3HP9A 5FROA 3SPYA 5HRNA 2NUBA 1KVBA 4F3OA 4KFBA 3QIOA 3OS2A 5C42A 4MQ3A 3K59A 3MXJA 3PO5A 2KZZA 3K5NA 1YTAA 4I2QA 4ICLA 3VQ8A 4CK2A 4CJRA 3OYHA 5KRTA 3AVKA 4GMJB 3V9ZA 4E1NA 5CY4A 3MXIA 3K5LA 4DTMA 3I0RA 4KHSA 4DTOA 4DU3A 1JLEA 3NF6A 4AHCA 3DLRA 1SKSA 4CCHA 4KI6A 3KLEA 4WE1A 1R0AA 3I0SA 3AVAA 1C1AA 1L5UA 4EP4A 1QTMA 3HPGA 2IS3A 4JRPA 1BCOA 4FYDA 4AHVA 2IAJA 4M3RA 4CGGA 1HQUA 1Z26A 4KTWA 4LH5A 1S6QA 3V1RA 4CFAA 2PY5A 2XY6A 4H4MA 3O4NA 2W42A 2KQ2A 4CFBA 1ZBLA 4DMNA 2HVIA 2G8UA 1T03A 4KHQA 3G10A 4ID5A 3U3GA 2QK9A 3CQ8A 1S1TA 4KB0A 4ZTJA 1XC9A 2G8KA 4FXDA 4PQUA 3MECA 2HHSA 2XY8A 4DQPA 4PUOA 1VSFA 3SUQA 3TAGA 5CZ2A 5KGWA 4HUFA 1RTHA 4CJSA 3ZSXA 2YNFA 4DTXA 4J2EA 2EHGA 2OYQA 4B9LA 1S1WA 1W0HA 2A1SA 3AVGA 2ITGA 3PV8A 2B6AA 2E4LA 2FC0A 4FCYA 4ELUA 2D5RA 3NF9A 4CJWA 4EP5A 3TR8A 4CERA 4AH9A 4HCBA 4AHSA 4IFVA 1BHLA 4Z4FA 4Z4EA 4KRFA 2KZMA 3CFPA 3OVNA 3C95A 3V9XA 1A5VA 4DU1A 4C8NA 2FBVA 4BACA 3CYMA 3VQBA 1TVRA 3C94A 1S1XA 3OJSA 4DQSA 1L3VA 1L3UA 2IC3A 4CJ5A 1TKTA 1KFDA 3AA4A 4N56A 5CYQA 1TK5A 4M3TA 4IFYA 4DTSA 4Z4HA 4KAZA 2GUIA 1ZBIA 1U4BA 3H08A 1CLQA 1XHZA 3TANA 5HBMA 1BQMA 1DTQA 2HNYA 1EXQA 3B6PA 1C0UA 1QS4A 4CGDA 1FKOA 3OYDA 3SV4A 1NKEA 2Y1JA 3V81A 1NK0A 2OPSA 4CJQA 4CFDA 3SPZA 1TKDA 1RT1A 1HYVA 1JLCA 1C1BA 1D8YA 4RW8A 4CF9A 1Q8IA 4OJRA 3SCXA 4B3OA 5HLFA 1FXXA 4CK1A 1X1PA 4DSEA 4FLZA 3CM5A 2HW3A 4FK0A 4M42A 5J1EA 3VA3A 2HNZA 3VQCA 1U47A 1WSHA 2YKNA 1KTQA 3O3FA 1VSDA 2RF2A 4M3XA 1WLJA 1X9MA 4DSJA 4Y1DA 3L2RA 1WSFA 2Z1HA 4O0IA 2D0CA 4W5TA 3RR8A 1NJWA 1TL1A 4CHPA 2HHWA 5CZ1A 1SKWA 1NK6A 1CXQA 1SKRA 2XY7A 1DTTA 4MFBA 4FJMA 4CJTA 4IG3A 3RMCA 3AA2A 4JS5A 2KTQA 2ETJA 3OYJA 3VQ6A 3WNGA 2OPPA 1MU2A 3NH2A 5HP1A 5C24A 3LPTA 4FLTA 1VSJA 4K8XA 4R5PA 3QETA 4CGHA 2D0AA 4N41A 1NJXA 3V9UA 4CE9A 3QNOA 5J2MA 2GBZA 4OLBA 3HL8A 4DSLA 2G8IA 2QXFA 1NK7A 1DLOA 2WONA 1NKCA 2FBTA 4KI4A 3AVMA 1U49A 1JL2A 1HNIA 1WSEA 1WAJA 5J2PA 2DTUA 3IRXA 2XHBA 3RRHA 3PO4A 4FJ5A 1QE1A 2HHUA 3SV3A 4RW7A 4DSKA 4O0JA 3LZJA 3LP1A 3O4QA 1Q9YA 3F73A 2R7YA 4BE0A 2BE2A 4FM2A 2GV9A 2AJQA 1L3SA 4RW4A 3AO2A 4CF8A 3ULDA 1CXUA 1ITGA 1LAWA 1T7PA 3ZSYA 1TAQA 4FLWA 1VK0A 4FJKA 2B4JA 4GW6A 1JL1A 4CJFA 4C8OA 3DOLA 3L2WA 4FVMA 4ZTFA 2OA8A 4CIGA 1J53A 1WSIA 4HTUA 2G8FA 3T3FA 4DQIA 2HVHA 4DFJA 1G15A 3CG7A 1JLGA 3P1GA 3BGRA 4BDZA 3AVCA 3TI0A 1B9FA 3LWMA 2YNIA 3HPHA 4FJGA 2X6SA 2B5JA 5JS1A 1HNVA 4CEZA 1KFSA 3NE6A 4RW9A 3LAMA 1HJRA 5C25A 4E7JA 4CGFA 4I9LA 1S1UA 3L2VA 3SNNA 2E6LA 4J2DA 1A5XA 4F2RA 3NGZA 3KJVA 2P51A 1UA0A 3C6TA 1LWEA 1I3AA 3HVRA 2VG5A 3RMBA 1KLMA 1D9FA 1YVUA 3AVIA 1SL2A 3DLBA 3LDSA 1LV5A 1CZBA 3L2UA 3EY1A 1RNHA 3O3GA 4AHTA 1TL3A 4CEDA 3QEIA 3S9HA 1D9DA 4C8LA 4NCAA 3L3UA 4KKOA 1NJZA 4L8RB 1UA1A 3RR7A 3KK2A 1BISA 1RCHA 1SUQA 4M3UA 2DFHA 2I5JA 1KLNA 3M8QA 3BDPA 3TAQA 3DMJA 3KIOA 4CESA 3DI6A 1FKPA 4M45A 4Z4CA 3LZIA 3KLGA 4FJ8A 3DRSA 3D45A 4XIUA 4FZYA 4CEEA 3WNFA 3NDKA 2VG6A 3QEVA 2QKKA 3I8DA 4DTRA 2FBYA 1HQEA 1WNSA 3ZSVA 4FLUA 1ZBFA 1JXEA 4FLYA 4E7HA 3VQAA 4E89A 3HJFA 3SJJA 3OYGA 1S9GA 4HCCA 1RTDA 4Q0BA 2JGUA 4AHRA 4OPKA 1RBSA 4BWJA 5HRPA 1FK9A 3RMAA 2YKMA 1QQCA 1U45A 4BDPA 1ZBHA 3VN5A 3ZSOA 4FZZA 3LAKA 1VSKA 3TAMA 3HK2A 5E41A 4KPYA 3RMDA 2XO7A 1KSPA 4I2PA 1IKWA 1JKHA 4KO0A 1QSSA 4FJLA 5JS2A 4PA1A 3P5JA 3QO9A 3TAPA 1X9WA 1X9SA 1J9AA 1TV6A 3AVJA 4AHUA 1IKYA 3A2FA 4LSNA 4CHYA 3OY9A 1NJYA 1C1CA 4BWMA 3KLHA 4KHWA 1UAXA 3QLHA 5I3UA 3OYLA 3C6UA 1JLBA 3KLFA 2Z1IA 2PYJA 2DY4A 3DRPA 5KTQA 2HB5A 1RBTA 4JS4A 1QSYA 4B9TA 3ALYA 2BGGA 1LWFA 3VQPA 3V9SA 3OYIA 4F4KA 4Z4GA 3OS1A 1D5AA 5HROA 4W5RA 3M8RA 1JLAA 3SYZA 4Y1CA 4J2BA 4I7FA 1EKEA 4C8MA 3OYNA 2G8VA 1C0MA 4CJ4A 4C8KA 4KHYA 2KW4A 4O44A 1B92A 2EX3A 4E3SA 1LAVA 4EZ9A 1VSLA 2X6NA 3VQQA 1NOZA 4IDKA 4CK3A 1IG9A 3HYFA 1Q9XA 3HP6A 1RDBA 4DQRA 3PUFA 4FJIA 1HPZA 4N47A 3NH0A 3F9KA 3ZT3A 4FW2A 2Y1IA 1JLQA 2OPQA 5T7BA 1LW2A 1I39A 4OKEA 2X74A 3HM9A 3D0PA 3L3VA 3V4IA 3WNEA 1EP4A 3AA3A 1ZYQA 2YNHA 2XY5A 1XI1A 3KKSA 2F8TA 3O3HA 1N6QA 4DF8A 5KGXA 3HPOA 1RT6A 2ZD1A 4KREA 1HMVA 1A5WA 3AVNA 4O55A 3SQ4A 3NGYA 1ZBUA 4CEQA 4CIFA 1N5YA 4CF0A 3QESA 3QEWA 4CJ3A 1VSIA 4BDYA 3DLKA 3L2QA 3SI6A 4DFMA 4H8KA 1BGXT 3B6OA 3E01A 1BQNA 4N76A 2VG7A 2O4IA 3G0ZA 2Z1JA 1WSJA 1B9DA 1GOBA 5KRSA 4YNQA 3K5OA 1IH7A 3HXMA 4BE2A 3T19A 3QEPA 3ISNC 1WN7A 2JLEA 1S6PA 3ZT0A 4ID1A 4YFUA 1RBRA 1NK8A 3OYCA 3VQ7A 3TAEA
chains in the Genus database with same CATH superfamily
3VA0A 4B1ZA 1RT3A 3DM2A 2V51B 4F2SA 3AVBA 4GVEA 3QINA 5FPDA 4E19A 3OYKA 4CVNE 3JSMA 3LDOA 4DKWA 1TK8A 4CFCA 1RDDA 2E2QA 3VMFB 3LP2A 2W41A 5AQWA 1GLAG 3ULEB 4B9SA 3HO1A 1NKBA 4CJLA 4FZXC 2E2PA 2FXUA 4LH4A 1SL0A 3J80O 1SZ2A 3UIQA 2X78A 1T6CA 3OS0A 3DLHA 1U04A 4ILGB 4FJHA 1VRUA 1I94K 3CCQN 3LM9A 3MEEA 4DTNA 4FL9A 3TAFA 2A1RA 4BGAA 3EO3A 3ZT1A 4PL8A 1X3NA 3H1VX 4FLVA 4LSLA 3AO3A 4ISEA 1J5OA 3NAEA 2CGJA 2F8SA 1S5JA 4KV8A 1BU6O 3NBPA 3AO1A 3SMSA 4M3WA 3CMEN 1XNQK 1DGKN 3SQ0A 1TYQB 4QS9A 2KFZA 2WOMA 5BRDA 4B9VA 3V6DA 1NWKA 3P39A 1YHQN 3CFOA 2RN2A 2ZJRL 2Q2RA 3EZ5A 4KH6A 1K73O 2P9IA 4OPHA 3HT3A 1GOCA 3TABA 1HYSA 2HOEA 2PZSA 4B9NA 3AGRA 3O9SA 1WAFA 1M1KO 1VQMN 3QB0A 4DV7K 1XUPO 2YV0X 5I42A 1VQ5N 1XQSC 3CQXA 4Z94A 3NF7A 5HOOA 1S9EA 4DFPA 3K58A 3A5NC 4JK9A 1U48A 1KVAA 3MXMA 3ZCMA 2KLAA 4C1NK 1N36K 4OGEA 3FZFA 1YJ9N 4JLHA 4CHQA 4DQQA 2HF3A 1ASWA 4N5SA 4BRGA 3OJUA 4JYAK 3DXMB 4ELTA 3V1QA 3FZMA 1VQ8N 1YAGA 3AVFA 3M1FA 4CHOA 3AV9A 3ENHA 3ZT4A 3S3OA 5AQRA 4JV5K 1QQNA 3HSTB 1RILA 2ZQBA 3E66A 1S1VA 2D4WA 4OVLA 4A2AA 5BR9A 2P9KA 4DCHA 4CJEA 3PY8A 3ZT2A 1QHTA 4CGJA 1MWMA 3CIPA 4KB1A 4E7LA 4GV6A 1IV0A 4BC3A 4JK7A 2HNDA 4PKHA 5JICA 3BUZB 4RW6A 2P9LB 2HHVA 1BIZA 3D2FA 4B9QA 5FROA 1VQPN 2NUBA 4FWLA 4RCHA 3QIOA 1XC3A 5C42A 3PO5A 1YTAA 4I2QA 1OKJA 3R1XA 3LL3A 4BR9A 5ADXA 3ATVA 4JEPA 3K5LA 4B3MK 4H0TB 4AHCA 3DLRA 5LY3A 2ASOA 3I0SA 1C1AA 1HR0K 4FYDA 2IAJA 1HQUA 2A40A 4KTWA 4LH5A 1S6QA 4BR7A 3T7ZA 3DLLL 4DMNA 4CZJA 2QK9A 4BVPA 4KB0A 3DXMA 4FWNA 4ZTJA 4NLCA 3MECA 4JKGA 3TAGA 1NGFA 3ZSXA 2YNFA 3VF4A 4J2EA 1S1WA 2A1SA 3PV8A 2ITGA 3MN6A 3G71N 3NF9A 4JI3K 4HCBA 4KRFA 4AHSA 1BHLA 4BGBA 1GLJO 3V9XA 3R9PA 5BREA 3O6WA 1YI2N 2WTUA 4LF9K 1WOQA 2QWNA 4A57A 4CJ5A 2QWOA 4CZIA 3J7AP 4KH4A 4Z4HA 1M90O 4KAZA 4DHYA 2HBLA 4LF7K 1YJNN 5C12A 1EWRA 4BRNA 2HMPA 1C0GA 1NM1A 1EXQA 3GDQA 2NRHA 3OYDA 4CGDA 1NKEA 5LMNK 2OPSA 1KAYA 1NG9A 5C0YA 4ISGA 4RW8A 3SCXA 5AFUH 4B3OA 3GE1A 4DSEA 2HW3A 2E20A 3A5OC 1IBLK 4QS7A 4M42A 5ELZA 5M1OA 5KPZA 5C2FA 4M3XA 3F5TA 3FZLA 3D6RA 4A2BA 1WSFA 3F9MA 2D0CA 4W5TA 4DUZK 5AQKA 3WXMB 3C0BA 4CHPA 2O8CB 4IG3A 3VETA 4R79A 2WFBA 3OYJA 4JKFA 4WQ4A 3UKUB 3IFRA 4N41A 4CD1A 4R5PA 5HL7L 1SS6A 5J2MA 2GBZA 2V7YA 3HL8A 4O5FA 1HPMA 1DLOA 3TTDA 2WONA 3AVMA 2ZGYA 4DR6K 3RRHA 2HHUA 4RW7A 4O0JA 3A8YA 4BE0A 2R7YA 2BE2A 2NRRA 1L3SA 3AO2A 4CF8A 3LDPA 4DUYK 4JKBA 3KHYA 1LAWA 1T7PA 4FLWA 2E5LK 2B4JA 5LJVA 1JL1A 4CJFA 4FVMA 1QHAA 2OA8A 1J53A 3PSIA 2HVHA 4DFJA 1G15A 2O8BB 3BGRA 3TI0A 3HPHA 3U9DA 4DR7K 2W6LA 3DWLA 2F9TA 4RW9A 2O8BA 4E7JA 5C25A 2WBNA 3L2VA 2E6LA 4F2RA 3I55N 1D9FA 1KLMA 1HLUA 3CJ1A 3AVIA 4JI4K 1K8KB 2F4VK 1CZBA 1JCFA 3EY1A 1NJIO 4AHTA 2FSNA 3S9HA 1KQSM 4NCAA 4BRLA 1NJZA 3RR7A 3KK2A 2KHOA 2I5JA 1KLNA 2OANA 3BDPA 3TAQA 4CZFA 3DMJA 4CESA 2V7ZA 4FWMA 4M45A 4Z4CA 2YHXA 4LFAK 3DRSA 4CZHA 4FZYA 4CEEA 3J7ZO 3I8DA 5BPMA 1WBBA 5FLXO 4E7HA 3VQAA 4E89A 4K41A 2O8FA 3OYGA 4LF6K 2JGUA 4OPKA 1OH5A 4O8UA 3RMAA 2YKMA 3ZEUB 5IT9O 3ZSOA 4FZZA 4KPYA 4WQ5C 1JKHA 1RFQA 3ZETB 3MWPA 2YHYA 1TV6A 1VQ4N 4I6MB 1C1CA 1V4TA 3CCUN 3HOSA 3OYLA 4BQZA 3IUCA 4EFHA 2PYJA 3ZX0A 3DRPA 2W6KA 4B3SK 2HB5A 3A0IX 5M1KA 1LWFA 4F4KA 5E84A 1DKGD 1D5AA 4YOTA 5HROA 3CCSN 4Y1CA 4J2BA 3Q7BA 4I7FA 5EOYA 3UKRB 4BG8A 4KHYA 2HBJA 1NGCA 3VQQA 4K42A 4FJIA 1HPZA 3U8XA 4FW2A 2Y1IA 2P9KB 1JLQA 5LMUK 3CJ7A 1LW2A 3V4IA 3HM9A 4FWKA 1S22A 4WFNL 5KGXA 1BA1A 1S3XA 2BUPA 5CE3A 3HPOA 4KREA 1A5WA 2A6AA 3NGYA 1ZBUA 4CIFA 2HHHK 4WQ4C 2O8DA 3DLKA 1BGXT 3J7YP 1BQNA 1KAZA 2O4IA 3P31A 4AM7A 1B9DA 1GOBA 3VEVA 5KRSA 1MWKA 1W97L 1Z05A 2FF3B 1WN7A 2JLEA 2P9PA 3ZT0A 5AQGA 4ILJA 3ZSQA 2Q0RA 3AAPA 1REVA 4PY5A 4FM1A 4IKFA 5ADXH 4EHUA 1E3MA 3KLIA 3TSUA 1NU0A 4KHNA 1K8KA 4W5OA 3CERA 2O8CA 2VGMA 4CHNA 1RT5A 3KD1E 3QEXA 4FWPA 4JRQA 2YHBA 5BN9A 4E1MA 3O08A 5KQ8A 5AQYA 1JCEA 3CC7N 2UU9K 3VTIA 1NK4A 2ASMA 2P9IB 3FFIA 3LANA 1ATNA 4CF1A 3P4IA 3O9RA 2I7PA 5LJWA 4K8ZA 2DFFA 5KI6A 4JI2K 3NVKA 3DXKA 4XH1A 1NLVA 3KK7A 3IAYA 3L4IA 5DM7L 5KQDA 3G25A 1TGOA 1CZ9A 3P38A 4JKHA 4Z4IA 3TPQA 4CJPA 2FSKA 4TSXA 5BRFA 4RWTA 5EU7A 3THXB 1RT7A 4YOVA 4FJNA 4CEOA 5C2DA 1F21A 1NOYA 1NGJA 2OTJN 4B1YB 4BG9A 4CF2A 2VGNA 1FJGK 4UQGA 1DT9A 3V1OA 3VQ5A 4DQ8A 2QA4N 1KD1O 5AQUA 1KRPA 4L3QA 3PX0A 1TAUA 4OLAA 1VSEA 1QZ5A 3IG1A 5K14A 3AO4A 1OVYA 3EYZA 2KFNA 1VRTA 3S41A 2OTLN 3O8MA 4BR4A 3BP8A 3M8SA 1WSGA 4FJJA 4AILC 3O1BA 4DFKA 4GVMA 4O4GA 3LALA 4CZMA 2P5OA 1TYQA 3WXIA 2PYLA 3OYMA 4JK8A 4FJ7A 2YI1A 3DRRA 3WQUA 1Y97A 3RWUA 1Q18A 3J8AA 3TSQA 4JKCA 4JKEA 4CECA 3SQ1A 4DTJA 4BRAA 4DG1A 3MEGA 2DPNA 3NFAA 4B3RK 3IS9A 3ENBA 4H5TA 4RG8A 3BEXA 3FGUA 4QOZB 5AQJA 3K9JA 4YOUA 4NLBA 1VSMA 2HHTA 1RDCA 2Q3SA 4CGIA 4ZHRA 4FJ9A 3WT0A 2NRXA 1SV5A 4W5NA 3H45C 3P83D 4CEAA 2HHXA 3V9WA 4BRIA 3CFRA 3GG4A 1C6VA 4E7KA 4DLGA 3RTVA 1RTIA 3S3NA 3L8BA 4DU4A 1EETA 3OYEA 4JKAA 5FRMA 5FRNA 1XWLA 3CHWA 1T44A 2QTDA 1HX1A 1SL1A 4DTPA 4DF4A 4EZ6A 3THWB 1RBUA 3NHGA 4NCBA 1BI4A 4IG0A 1TKXA 3PSFA 4UY8O 3UB5A 1NK5A 1YUWA 2QWLA 4CJ7A 3ASMA 3SPYA 4F3OA 4JHDA 2AP1A 3OS2A 4MQ3A 1S72N 3MXJA 3K5NA 3VQ8A 1BO5O 4ICLA 3OYHA 5KRTA 4GMJB 4E1NA 3MXIA 1NGAA 2GTDA 4KHSA 4DTOA 4DU3A 1JLEA 3RVCA 3TTCA 2YJFA 1SKSA 3O1WA 4KI6A 4WE1A 1YF5L 4IFEA 1R0AA 3AVAA 2GEMA 4EP4A 1L5UA 1QTMA 1BCOA 2P9LA 2QWQA 4AHVA 4CGGA 1R59O 4BRFA 3A5MC 3V1RA 1ILYA 2W42A 3JAMO 5AZJA 4IEEA 2G8UA 1X3MA 5BPNA 3NVMA 3U3GA 2PBDA 4FXDA 5GAHP 4PQUA 2HHSA 2XY8A 3R8EA 3D2EA 3CCMN 4NB4A 4DTXA 3CI5A 4IO8A 1YVNA 2B6AA 4U7BA 4EP5A 4CERA 4IFVA 2KZMA 1QQOA 5DM6L 3EZWA 4H5WA 3TTFA 4CI6A 3VTHA 5AJ3K 2J4RA 3CYMA 4H0XB 3VQBA 1TVRA 4GKKK 1L3VA 3CPEA 1YJWN 3AA4A 5CYQA 1TK5A 4M3TA 2GUIA 3SLCA 4IXCA 1CLQA 5GAGP 3B6PA 5BN8A 3FR0A 2Y1JA 1NK0A 3O5BA 1GLBG 4CJQA 4CFDA 1C1BA 2HBMA 4CK1A 1X1PA 3CM5A 1NGDA 2YKNA 3EKSA 4MDBA 2RF2A 1X9MA 4DSJA 3THYA 3RR8A 4IJNA 1NJWA 1OH6A 5CZ1A 3VGKA 3HTVA 4MFBA 3CETA 4IJAA 2KTQA 2ETJA 4CZGA 3VQ6A 2OPPA 5HP1A 3NH2A 1W7AA 5C24A 4FLTA 2UUBK 1VSJA 2FSJA 3QETA 4CGHA 2QI2A 4OLBA 3CCJN 4JAXA 2G8IA 1NK7A 1NKCA 2FBTA 3SK3A 4BRHA 1JL2A 1WSEA 4OPAA 3IRXA 5JLFA 2XHBA 1QE1A 5CR4A 1Q9YA 5GIOA 2FLOA 3F73A 4YOWA 4FSVA 3C7NA 4KBOA 3ZSYA 1TAQA 3BY5A 1VK0A 3HZ6A 2UUCK 1W2BM 3DOLA 3EL2A 3DAWA 4CIGA 1QZ6A 4HTUA 4DQIA 3E9PA 3ZX3A 4X65K 2BH1A 4DV2K 2EWSA 3CQYA 1JLGA 3H46O 2JWLA 1BA0A 3LWMA 4LF4K 4FJGA 3VEZA 2B5JA 4CEZA 1KFSA 2IVPA 3LAMA 1HJRA 4DR3K 4I9LA 2ZJQL 1ZC6A 3EE8A 3T69A 1UA0A 3HVRA 1QVGM 1YVUA 3JS6A 1LOTB 1E4GT 2O8FB 1LV5A 4GKJK 4FWOA 2WC9A 5JLHA 1TL3A 4C8LA 3BF3A 4A62A 4L8RB 1UA1A 3ZEUA 1BISA 3BZCA 3LZIA 3RSEA 3D45A 4XIUA 3WNFA 2VG6A 2QKKA 3ZSVA 3HJFA 3SJJA 1RTDA 4BWJA 4BDPA 4IOXA 2P9NB 3LAKA 1VSKA 3TAMA 3HK2A 4FJLA 3VEOA 1X9WA 3TAPA 5AQNA 1HUXA 1C0FA 4AHUA 1XMOK 2QEXN 1IKYA 3A2FA 4LSNA 2QWMA 5I3UA 3C6UA 3KLFA 3FZHA 5KTQA 4YOYA 4FO0A 1QSYA 4AF1A 2BGGA 3ALYA 3OHRA 3VQPA 3BF1A 5C15A 2OCEA 3M8RA 1JLAA 5AQIA 1JCGA 4M63C 3IKMA 4C8MA 3OYNA 5JVHL 2NRZA 1B92A 3EN9A 1LAVA 1EO1A 1VSLA 1Q9XA 1RDBA 2QXLA 4CW7B 3ENOA 2CGLA 4CZLA 3NH0A 5AQTA 3CD6N 1I39A 3L3VA 4H0VB 1EP4A 4C1NI 2YNHA 3L4QA 2Q97A 3M6GA 3HM8A 4IEIA 4DF8A 2IIRA 1HMVA 2NRTA 3VEYA 4CEQA 4CF0A 3QESA 3GOIA 3B6OA 5KPRA 2ZWHA 3ZX2A 5LL6Z 4LF8K 2VG7A 2JWKA 3HI0A 1IH7A 3K5OA 3HXMA 3CJBA 3WUHA 4JN4A 5GAEP 4ID1A 1NK8A 1RBRA 3WEEB 4FJXA 4FOEA 4JI5K 2NRVA 5DK5A 3ZSZA 3QNNA 1N34K 1Q86O 2YNGA 1IKVA 5SWMA 3KKRA 2ATQA 3KD5E 1U2VB 2XRIA 4DS4A 2YHAA 2P5GA 3BZKA 5AR0A 3WNHA 4WFBL 3SUPA 3WXKA 1Z25A 2ZE2A 3LDNA 3QERA 4IZ9A 3THYB 4MO5A 3MN7A 4M3ZA 3OA9A 3U6FA 3VGMA 3THXA 3AO5A 2BDPA 1LW0A 3LWLA 1O1WA 4NO7A 3KK3A 1IG8A 1WBDA 1ZBSA 3DYAA 3CCRN 2Q1NA 1RDAA 4I6MA 1GOAA 1X9JA 4KTQA 2YJEA 3VQEA 3VQ4A 4CJUA 1G99A 4BE1A 3T1AA 2OZMA 4CHZA 4PWDA 5BPLA 3ZSRA 5HRSA 4HVJA 2FBXA 4B8AB 3H6EA 2F7TA 3HVTA 4DV5K 5HRRA 4F3TA 4NYNA 3VENA 3SUNA 3THVA 2G8HA 3JYTA 2Q36A 4YDUA 3K5MA 2ZJPL 2P9NA 3HRGA 2VWKA 4IBNA 4CBXA 4FLXA 1OH8A 3PX4A 4E1JA 2OZSA 5CYMA 1MDUB 1W9HA 5DMRA 2E6MA 4Z0UA 5J2QA 1QSLA 4QCLA 1BL3A 4WCEL 4FWSA 2P9PB 3VF6A 4BRQA 4B9MA 1HNXK 2HF4A 2CGKA 1E4FT 1HKCA 3DJCA 5AQMA 4DR2K 4BY9C 3U4LA 1VQON 4PKGA 3OYAA 5E26A 3VQ9A 3SQ2A 1KCFA 1RBVA 3MCPA 5JVGL 2RKIA 1K6YA 2CH5A 2VCPA 5M1FA 2VWJA 1LWCA 4W5QA 3ITHA 4DSIA 1N32K 3AAQA 4CBWA 3GBTA 1JLFA 2HSTA 1RDUA 4JHDB 1O13A 1EX4A 3D2EB 3WXLA 3VERA 2E2NA 3MCAB 3U3YA 3PLAA 4O5BA 4E7IA 4DTUA 4JD2B 3HSCA 5M1PA 5C10A 3S3MA 4FW1A 2Q31A 1GLCG 3LP0A 5AQFA 2Z1GA 3IMXA 2BTFA 3LP3A 2DFEA 4HHTA 2NLXA 5J2NA 3O9QA 5M1QA 3K2PA 4NYFA 1EQYA 5D3GA 2IDOA 2PAVA 3AA5X 2UXBK 1RGIA 3MEDA 1HRHA 5FPNA 3WEEA 4DR5K 2UXCK 2IGIA 1J5EK 3ULEA 4DSFA 1VAZA 1Q82O 2H3GX 2KKZA 4BR0A 3SUOA 3TSPA 2D0PA 3LM2A 3OBWA 4E0DA 1U2VA 3ATUA 3MN9A 4BROA 3HP9A 3AVHA 4HTLA 1KVBA 4B1WB 3M3ZA 3K59A 2KZZA 2ZM6K 4CK2A 4CJRA 3V9ZA 5CY4A 2P9SB 4K0KK 3NF6A 4CCHA 1NMNA 1KXPA 3AY9A 4JRPA 4M3RA 1Z26A 2GWKA 5EY4A 4CFAA 2XY6A 1OVQA 4FOIA 2HVIA 4H03B 3SBTA 1TUUA 5JMVA 1T03A 4YY3K 3G10A 4ID5A 3CQ8A 2G8KA 4DQPA 4PUOA 1VSFA 3CCEN 5CZ2A 2W40A 5KGWA 4HUFA 3K9KA 5BRHA 1HKGA 1V4SA 2EHGA 4B9LA 1W0HA 3AVGA 2FC0A 2D5RA 4Z4FA 5AQHA 3CFPA 3OVNA 4M7XA 4KH5A 4C8NA 2FBVA 3H1QA 3OJSA 1Q7YO 1EWQA 1TKTA 2WUSA 4IFYA 4DTSA 4A5AA 3TANA 5HBMA 4EIAA 1QS4A 3SV4A 1FKOA 2UXDK 3QFUA 1TKDA 3JXUA 1JLCA 2HBKA 3B8AX 2YCHA 5HLFA 5TKWA 4RTFD 5J1EA 3VA3A 3VQCA 1U47A 1WSHA 3RSEB 1IBKK 4BRMA 5GINA 2GELA 4BRCA 3L2RA 3UKUA 2Z1HA 2F9WA 4NXNK 3D7EO 2HHWA 5AZIA 1SKWA 1NK6A 1SKRA 3I8BA 1DTTA 4F9OA 3RMCA 4JS5A 3WNGA 1MU2A 1Y64A 3LPTA 1P90A 2D0AA 3MN5A 1NJXA 1JJ2M 4K43A 4CE9A 3QNOA 1VQKN 2QXFA 4FWQA 3M5RA 1YXQA 4KI4A 1WAJA 4DV1K 5J2PA 4FJ5A 4BRPA 4DSKA 3LZJA 1P8ZA 1BWFO 4FM2A 2GV9A 1CXUA 2ASPA 1ITGA 3A5LC 4FJKA 3ID8A 4GW6A 2O8DB 3L2WA 4ZTFA 1WSIA 2G8FA 5AQSA 3T3FA 3CG7A 1NGGA 5JS1A 1SAZA 5F2RA 3SAGA 3NE6A 3CCVN 1BUPA 1S1UA 4DR4K 3SNNA 1A5XA 1HNZK 3C6TA 1LWEA 1I3AA 3RMBA 2VG5A 4NXMK 4JNEA 1QQMA 2Q0UA 1SL2A 3DLBA 4BREA 3L2UA 2YHWA 3CXCM 3Q7CA 1H1VA 4CEDA 3QEIA 4YHHK 3VEWA 1RCHA 1SUQA 2D1KA 4M3UA 2DFHA 3M8QA 3CJCA 4Y0WA 3KIOA 1U6ZA 1FKPA 3KLGA 4FJ8A 1BOTO 4BC5A 4JI1K 2NNWA 4EAHD 1HQEA 1WNSA 4FLUA 4FLYA 1KAXA 1S9GA 5EVZA 1ATRA 4H5RA 4Q0BA 3K0SA 5HRPA 2E8AA 1FK9A 1ZBHA 4B1UB 3VN5A 3OTOK 4M7YA 5E41A 2A3ZA 4I2PA 1IKWA 4KO0A 1QSSA 3HBTA 5JS2A 4PA1A 4KHPK 2V52B 4JI6K 2UUAK 1X9SA 1J9AA 1N8RO 2ITMA 3THWA 4CHYA 1NJYA 4BWMA 4IDHA 1JLBA 2Z1IA 4BVOA 2DY4A 3L6QA 1HNWK 4JS4A 3VF2A 3V9SA 3N4QA 4Z4GA 3OS1A 1CZAN 3QBWA 3SYZA 5KPTA 2G8VA 1J6ZA 4C8KA 2KW4A 4O44A 2O8EA 4EZ9A 1NOZA 4IDKA 1IG9A 3HP6A 5H1SQ 3VEXA 3PIPL 1LCUA 2O8EB 1YIJN 1GLEG 3L0QA 4N47A 3F9KA 3ZT3A 2OPQA 5T7BA 2QWPA 4OKEA 2X74A 3AA3A 2XY5A 1XI1A 2F8TA 3O3HA 1N6QA 1RT6A 2ZD1A 3E1YA 3KWGA 5AZJB 4O55A 3AVNA 4GY2B 1BG3A 2NRWA 3CJAA 1N5YA 2VQFK 3QEWA 3SJHA 4CJ3A 4A61A 1VSIA 4BDYA 4K25A 3L2QA 3O9TA 4U67L 3CC2N 2E88A 5AQQA 3QEPA 3T19A 3ISNC 3SAFA 3HOTA 4H0YB 1VQ7N 3CCLN 3WQTA 2P9SA 1BI4B 1XHXA 4Q5VA 2RPIA 1J54A 4O8KA 3GL1A 2P9UA 3FLCO 1BCMA 4G9ZA 1K9MO 1TKZA 4OKJA 4LD0A 4KHUA 4MDAA 2O4GA 3LPUA 4FM0A 1KVCA 4DS5A 4BQLA 4DV6K 3R6MA 1C0TA 4KTZA 4X66K 5I9EB 4DLEA 5F0XA 1Q81O 1TUYA 2HMIA 3OYBA 2HHQA 4HUGA 5AQXA 2D0OA 2D0BA 3H3NO 3QIPA 2G8WA 1NGIA 4OPJA 3TWHA 4B9UA 4BC2A 1HYZA 4V19S 5SZTA 4B08A 4YDUC 4G1QA 3SMPA 4J2AA 1IJJA 1JXBA 4CJKA 1RT2A 3OYFA 2AA4A 4BR2A 2E1YA 1YTUA 4OKKA 4MLEA 3VGLA 4LFCK 2QKBA 4H5VA 1OH7A 3NH1A 4M41A 1N33K 3DOKA 4H4OA 3ZETA 1YT3A 3ZSWA 4FPAA 3J81O 4NCGA 3M8PA 3PX6A 1HKBA 2P1JA 2A41A 4GNIA 3N4PA 4CEFA 1L3TA 3G4SN 3MAQA 4CIEA 3D2FB 2IOCA 4GV3A 2F96A 4QAGA 4FK4A 4WQ5A 1VQLN 1MA9B 3KTQA 3I33A 4OGCA 4ELVA 3C6HA 3VOVA 1RT4A 4HUEA 3SZ2A 1IKXA 5AZIB 3UKRA 5M1NA 4CBUA 5AQVA 4LC9B 4BRDA 1VSHA 1ASUA 4JKDA 4OO1J 4CJVA 3QICA 1TK0A 3K57A 3MMVA 5A2QO 3DLGA 4IOAL 4DWIA 3FZKA 4LY7A 3DLEA 4CEBA 4J8FA 1T05A 3W0LA 4M3YA 1BIUA 1UWBA 4X64K 4JI0K 3H3OB 4B8CA 1ASVA 4BRKA 3RRGA 4IO9L 5AQPA 4I9QA 4FVUA 2LSNA 1SQKA 1RDWX 4YOXA 4H0PA 4JI8K 3VQDA 3O80A 3TARA 2NZTA 3E9LA 1UOCA 2IVNA 3MDQA 4JI7K 3NCIA 1IO2A 3CJ9A 4XH5A 3NF8A 5EX5A 4WFAL 1T8EA 2BANA 3CM6A 5FDLA 3NMUA 2IVOA 3AVLA 3NGIA 3KK1A 1RTJA 4EHTA 1NK9A 2OPRA 5HRNA 2QW9A 4KFBA 4B1XB 5F1XA 3MK6A 4XEIA 4F8RA 3AVKA 1NNEA 1GLDG 4WF9L 4DTMA 3I0RA 3IDHA 3SBGA 3KLEA 2QWRA 1Z6RA 3HPGA 2IS3A 1BDGA 2YX6A 1VQ9N 2PY5A 4HWIA 4H4MA 3O4NA 2KQ2A 4CFBA 4PHTX 1ZBLA 4MLHA 4KHQA 1S1TA 2GWJA 1XC9A 1KC8O 3OBYA 1IBMK 3SUQA 3C65A 1RTHA 4CJSA 4OX9K 2OYQA 2E4LA 4ELUA 4FCYA 4JD2A 2GUPA 4CJWA 2VYPA 3TR8A 1ZXOA 4AH9A 4Z4EA 3C95A 1A5VA 4DU1A 5B8HA 3O4WA 4BACA 3C94A 4CD3A 3OW2M 1S1XA 3G6EN 4DQSA 4ISFA 1L3UA 2IC3A 1KFDA 4N56A 2P9UB 2PFUA 2UYTA 3O9UA 4BR5A 1U4BA 3H08A 1XHZA 1BQMA 1DTQA 2HNYA 3T1YK 1C0UA 4LFBK 3V81A 3SPZA 1RT1A 1HYVA 1D8YA 4CF9A 1Q8IA 4OJRA 2CH6A 3I56N 1FXXA 4FLZA 5AQLA 4FK0A 4PKIA 2HNZA 4JKGB 4DV4K 3O3FA 1KTQA 1VSDA 3VPZA 3UE5A 2RHKA 1WLJA 3MX5A 1GLLO 4Y1DA 3CF5L 4O0IA 1ATSA 2A42A 1TL1A 5FPEA 1CXQA 4MO4A 2XY7A 4FJMA 4CJTA 3AA2A 3C6AA 4X62K 3SAHA 5GADP 4FK2A 4IOCL 4K8XA 1ZBIA 4B3TK 3V9UA 4DSLA 5EXWA 1NBWA 1U49A 3MWTA 1HNIA 2DTUA 1T3VA 3PO4A 3SV3A 3WXJA 4QS8A 3LP1A 3O4QA 2AJQA 4RW4A 3TU5A 3ZLJA 3ULDA 4IWVA 4C8OA 1NMDA 1GLFO 3VESA 4DV3K 3PIOL 3P1GA 5AQZA 5CHIA 4BDZA 3AVCA 1VQ6N 1B9FA 2YNIA 4H0OA 1D4XA 3QFPA 2X6SA 3KVGA 1HNVA 3R3LA 2E1ZA 2A5XA 4CGFA 4J2DA 3NGZA 3KJVA 2P51A 2E2OA 2FF6A 3AARA 4DR1K 1VQNN 1XNRK 1ESVA 3E9OA 3LDSA 4DB3A 1RNHA 3O3GA 1NGEA 1D9DA 3L3UA 4KKOA 2I7NA 3T1HK 3FE1A 4BC4A 3AGKA 2GX9A 3ZYYX 5IWAK 3QMLA 3DI6A 1QVFM 3F2KA 2QM1A 3NDKA 3QEVA 4CZEA 4B1VA 3CC4N 2ZGZA 4CZKA 4LF5K 4DTRA 2FBYA 1K8AO 1ZBFA 1JXEA 3EEQA 4HCCA 4AHRA 1RBSA 4WYBA 5BR8K 3CPWM 1U45A 4GV9A 1QQCA 4C23A 5AQOA 3RMDA 2XO7A 1KSPA 3P5JA 3QO9A 4ILHA 4A59A 1YITN 5FPMA 3KZBA 3AVJA 3OY9A 3KLHA 4AQYK 4KHWA 3QBXA 1UAXA 3QLHA 5TKYA 1T6DA 1RBTA 3CMAN 4B9TA 2ZF5O 4XH4A 3OYIA 1DEJA 3ID6A 4W5RA 3W3DA 4FPBA 3KWIA 1EKEA 1FW6A 1C0MA 3DXKB 4CJ4A 1XMQK 2EX3A 4E3SA 1WB9A 1NGHA 5GIPA 2X6NA 1HJOA 3MX2A 4CK3A 3HYFA 4DQRA 3PUFA 4AM6A 3LDLA 4H5NA 5MLCQ 1VHXA 5AFUA 3D0PA 3WNEA 3EKUA 1ZYQA 3KKSA 2RE2A 4YORA 3LDQA 3QDKA 3SQ4A 4DV0K 3C7NB 3SI6A 4DFMA 3EE9A 4H8KA 3E01A 4FWRA 2VWBA 4N76A 3G0ZA 2Z1JA 1WSJA 4A5BA 4PL7A 4YNQA 4BE2A 2VQEK 3U9ZA 1NGBA 1S6PA 4YFUA 3OYCA 3VQ7A 3TAEA 3FFKB 1WUAA
chains in the Genus database with same CATH topology
3ZSQA 4FJXA 1REVA 1BI4B 1XHXA 3VA0A 5DK5A 3ZSZA 3QNNA 1RT3A 4Q5VA 4FM1A 2RPIA 1IKVA 2YNGA 3DM2A 5SWMA 4F2SA 4IKFA 1J54A 3KKRA 3KLIA 3AVBA 2ATQA 3KD5E 2XRIA 1BCMA 3QINA 4W5OA 4KHNA 4E19A 3OYKA 4DS4A 2YHAA 2P5GA 3JSMA 3WNHA 1TKZA 4OKJA 4CHNA 3SUPA 1TK8A 1Z25A 1RT5A 4CFCA 4LD0A 1RDDA 3KD1E 3QEXA 4KHUA 4JRQA 2YHBA 2O4GA 2ZE2A 3LPUA 1KVCA 4E1MA 4FM0A 4DS5A 3LP2A 1C0TA 3QERA 4KTZA 3HO1A 4B9SA 4DLEA 4M3ZA 1NK4A 1NKBA 3U6FA 4CJLA 4FZXC 3AO5A 2BDPA 1LW0A 3FFIA 3LWLA 1O1WA 2HMIA 3LANA 4LH4A 4PY5A 3OYBA 4CF1A 3KK3A 4HUGA 1SL0A 2HHQA 3UIQA 2X78A 3OS0A 3DLHA 2D0BA 3DYAA 4K8ZA 3QIPA 2G8WA 2DFFA 1U04A 4OPJA 3TWHA 4B9UA 5KI6A 4FJHA 1RDAA 1VRUA 1HYZA 5SZTA 1GOAA 3MEEA 4DTNA 3TAFA 4KTQA 2A1RA 3IAYA 4B08A 3VQEA 4G1QA 3VQ4A 4CJUA 4J2AA 1JXBA 4CJKA 3T1AA 1RT2A 4BE1A 2OZMA 3ZT1A 4CHZA 3OYFA 1TGOA 1CZ9A 3ZSRA 5HRSA 4FLVA 4PWDA 4HVJA 2FBXA 4LSLA 4B8AB 1YTUA 3AO3A 4OKKA 1J5OA 3HVTA 4Z4IA 4CJPA 4TSXA 5HRRA 5EU7A 3NAEA 2QKBA 1RT7A 4F3TA 4NYNA 2F8SA 3NH1A 4M41A 1S5JA 4CEOA 4FJNA 3DOKA 4H4OA 3SUNA 4FK2A 1F21A 4KV8A 1YT3A 3ZSWA 3JYTA 3THVA 1NOYA 3NBPA 2G8HA 3AO1A 4F8RA 4NCGA 4M3WA 3M8PA 3PX6A 4CF2A 2P1JA 3SQ0A 4UQGA 3K5MA 2KFZA 2WOMA 2VWKA 4CEFA 4IBNA 4FLXA 3V1OA 3MAQA 1L3TA 4B9VA 3VQ5A 4CIEA 3V6DA 1KRPA 3PX4A 2IOCA 2OZSA 2F96A 4QAGA 3CFOA 3PX0A 5CYMA 4FK4A 1TAUA 2RN2A 1VSEA 4OLAA 1W9HA 3IG1A 5DMRA 5K14A 3EZ5A 2E6MA 4Z0UA 3HT3A 3AO4A 5J2QA 1QSLA 1GOCA 3EYZA 3TABA 3KTQA 4QCLA 1BL3A 1HYSA 2KFNA 4OGCA 2PZSA 4ELVA 1VRTA 1RT4A 4HUEA 3SZ2A 4B9NA 4B9MA 1IKXA 3M8SA 1WSGA 4FJJA 1WAFA 4AILC 4DFKA 4GVMA 4O4GA 3LALA 2YV0X 5I42A 2P5OA 2PYLA 3OYMA 3NF7A 3OYAA 3VQ9A 3SQ2A 1VSHA 1S9EA 4DFPA 1KCFA 1RBVA 4FJ7A 2RKIA 1K6YA 3K58A 3DRRA 1ASUA 1Y97A 3RWUA 4CJVA 1U48A 1KVAA 4CECA 2VWJA 1LWCA 3SQ1A 4W5QA 3K57A 3MXMA 1TK0A 3ZCMA 4DTJA 4DG1A 3ITHA 4DSIA 3DLGA 3MEGA 4DWIA 3NFAA 3IS9A 4LY7A 4RG8A 1JLFA 4OGEA 1EX4A 3DLEA 4QOZB 4CEBA 4JLHA 4CHQA 1VSMA 4DQQA 2HHTA 1T05A 1ASWA 1RDCA 2Q3SA 4CGIA 4ZHRA 4FJ9A 3U3YA 4M3YA 1BIUA 4N5SA 4O5BA 3OJUA 1SV5A 4E7IA 4DTUA 4ELTA 1UWBA 4W5NA 3V1QA 3P83D 4CEAA 3S3MA 2HHXA 4FW1A 3V9WA 3CFRA 4B8CA 1ASVA 3AVFA 3RRGA 4CHOA 4I9QA 1C6VA 3LP0A 4E7KA 3AV9A 2Z1GA 2LSNA 3LP3A 3ZT4A 4DLGA 2DFEA 1RTIA 3RTVA 3S3OA 3S3NA 3HSTB 1RILA 2ZQBA 3VQDA 1S1VA 3L8BA 4HHTA 4DU4A 5J2NA 1EETA 3TARA 3K2PA 4NYFA 4OVLA 3OYEA 5FRMA 5D3GA 4CJEA 2IDOA 3PY8A 1XWLA 3ZT2A 1UOCA 5FRNA 1QHTA 3AA5X 4CGJA 4KB1A 4E7LA 3NCIA 4DTPA 1IO2A 3MEDA 4DF4A 1HRHA 1SL1A 4EZ6A 1RBUA 3NF8A 3NHGA 1T8EA 2IGIA 2BANA 4NCBA 3CM6A 1BI4A 2HNDA 5FDLA 4IG0A 4DSFA 1TKXA 3AVLA 3SUOA 3NGIA 4RW6A 3KK1A 1NK5A 2HHVA 4E0DA 1RTJA 1BIZA 1NK9A 2OPRA 3AVHA 3ASMA 3HP9A 5FROA 3SPYA 5HRNA 2NUBA 1KVBA 4F3OA 4KFBA 3QIOA 3OS2A 5C42A 4MQ3A 3K59A 3MXJA 3PO5A 2KZZA 3K5NA 1YTAA 4I2QA 4ICLA 3VQ8A 4CK2A 4CJRA 3OYHA 5KRTA 3AVKA 4GMJB 3V9ZA 4E1NA 5CY4A 3MXIA 3K5LA 4DTMA 3I0RA 4KHSA 4DTOA 4DU3A 1JLEA 3NF6A 4AHCA 3DLRA 1SKSA 4CCHA 4KI6A 3KLEA 4WE1A 1R0AA 3I0SA 3AVAA 1C1AA 1L5UA 4EP4A 1QTMA 3HPGA 2IS3A 4JRPA 1BCOA 4FYDA 4AHVA 2IAJA 4M3RA 4CGGA 1HQUA 1Z26A 4KTWA 4LH5A 1S6QA 3V1RA 4CFAA 2PY5A 2XY6A 4H4MA 3O4NA 2W42A 2KQ2A 4CFBA 1ZBLA 4DMNA 2HVIA 2G8UA 1T03A 4KHQA 3G10A 4ID5A 3U3GA 2QK9A 3CQ8A 1S1TA 4KB0A 4ZTJA 1XC9A 2G8KA 4FXDA 4PQUA 3MECA 2HHSA 2XY8A 4DQPA 4PUOA 1VSFA 3SUQA 3TAGA 5CZ2A 5KGWA 4HUFA 1RTHA 4CJSA 3ZSXA 2YNFA 4DTXA 4J2EA 2EHGA 2OYQA 4B9LA 1S1WA 1W0HA 2A1SA 3AVGA 2ITGA 3PV8A 2B6AA 2E4LA 2FC0A 4FCYA 4ELUA 2D5RA 3NF9A 4CJWA 4EP5A 3TR8A 4CERA 4AH9A 4HCBA 4AHSA 4IFVA 1BHLA 4Z4FA 4Z4EA 4KRFA 2KZMA 3CFPA 3OVNA 3C95A 3V9XA 1A5VA 4DU1A 4C8NA 2FBVA 4BACA 3CYMA 3VQBA 1TVRA 3C94A 1S1XA 3OJSA 4DQSA 1L3VA 1L3UA 2IC3A 4CJ5A 1TKTA 1KFDA 3AA4A 4N56A 5CYQA 1TK5A 4M3TA 4IFYA 4DTSA 4Z4HA 4KAZA 2GUIA 1ZBIA 1U4BA 3H08A 1CLQA 1XHZA 3TANA 5HBMA 1BQMA 1DTQA 2HNYA 1EXQA 3B6PA 1C0UA 1QS4A 4CGDA 1FKOA 3OYDA 3SV4A 1NKEA 2Y1JA 3V81A 1NK0A 2OPSA 4CJQA 4CFDA 3SPZA 1TKDA 1RT1A 1HYVA 1JLCA 1C1BA 1D8YA 4RW8A 4CF9A 1Q8IA 4OJRA 3SCXA 4B3OA 5HLFA 1FXXA 4CK1A 1X1PA 4DSEA 4FLZA 3CM5A 2HW3A 4FK0A 4M42A 5J1EA 3VA3A 2HNZA 3VQCA 1U47A 1WSHA 2YKNA 1KTQA 3O3FA 1VSDA 2RF2A 4M3XA 1WLJA 1X9MA 4DSJA 4Y1DA 3L2RA 1WSFA 2Z1HA 4O0IA 2D0CA 4W5TA 3RR8A 1NJWA 1TL1A 4CHPA 2HHWA 5CZ1A 1SKWA 1NK6A 1CXQA 1SKRA 2XY7A 1DTTA 4MFBA 4FJMA 4CJTA 4IG3A 3RMCA 3AA2A 4JS5A 2KTQA 2ETJA 3OYJA 3VQ6A 3WNGA 2OPPA 1MU2A 3NH2A 5HP1A 5C24A 3LPTA 4FLTA 1VSJA 4K8XA 4R5PA 3QETA 4CGHA 2D0AA 4N41A 1NJXA 3V9UA 4CE9A 3QNOA 5J2MA 2GBZA 4OLBA 3HL8A 4DSLA 2G8IA 2QXFA 1NK7A 1DLOA 2WONA 1NKCA 2FBTA 4KI4A 3AVMA 1U49A 1JL2A 1HNIA 1WSEA 1WAJA 5J2PA 2DTUA 3IRXA 2XHBA 3RRHA 3PO4A 4FJ5A 1QE1A 2HHUA 3SV3A 4RW7A 4DSKA 4O0JA 3LZJA 3LP1A 3O4QA 1Q9YA 3F73A 2R7YA 4BE0A 2BE2A 4FM2A 2GV9A 2AJQA 1L3SA 4RW4A 3AO2A 4CF8A 3ULDA 1CXUA 1ITGA 1LAWA 1T7PA 3ZSYA 1TAQA 4FLWA 1VK0A 4FJKA 2B4JA 4GW6A 1JL1A 4CJFA 4C8OA 3DOLA 3L2WA 4FVMA 4ZTFA 2OA8A 4CIGA 1J53A 1WSIA 4HTUA 2G8FA 3T3FA 4DQIA 2HVHA 4DFJA 1G15A 3CG7A 1JLGA 3P1GA 3BGRA 4BDZA 3AVCA 3TI0A 1B9FA 3LWMA 2YNIA 3HPHA 4FJGA 2X6SA 2B5JA 5JS1A 1HNVA 4CEZA 1KFSA 3NE6A 4RW9A 3LAMA 1HJRA 5C25A 4E7JA 4CGFA 4I9LA 1S1UA 3L2VA 3SNNA 2E6LA 4J2DA 1A5XA 4F2RA 3NGZA 3KJVA 2P51A 1UA0A 3C6TA 1LWEA 1I3AA 3HVRA 2VG5A 3RMBA 1KLMA 1D9FA 1YVUA 3AVIA 1SL2A 3DLBA 3LDSA 1LV5A 1CZBA 3L2UA 3EY1A 1RNHA 3O3GA 4AHTA 1TL3A 4CEDA 3QEIA 3S9HA 1D9DA 4C8LA 4NCAA 3L3UA 4KKOA 1NJZA 4L8RB 1UA1A 3RR7A 3KK2A 1BISA 1RCHA 1SUQA 4M3UA 2DFHA 2I5JA 1KLNA 3M8QA 3BDPA 3TAQA 3DMJA 3KIOA 4CESA 3DI6A 1FKPA 4M45A 4Z4CA 3LZIA 3KLGA 4FJ8A 3DRSA 3D45A 4XIUA 4FZYA 4CEEA 3WNFA 3NDKA 2VG6A 3QEVA 2QKKA 3I8DA 4DTRA 2FBYA 1HQEA 1WNSA 3ZSVA 4FLUA 1ZBFA 1JXEA 4FLYA 4E7HA 3VQAA 4E89A 3HJFA 3SJJA 3OYGA 1S9GA 4HCCA 1RTDA 4Q0BA 2JGUA 4AHRA 4OPKA 1RBSA 4BWJA 5HRPA 1FK9A 3RMAA 2YKMA 1QQCA 1U45A 4BDPA 1ZBHA 3VN5A 3ZSOA 4FZZA 3LAKA 1VSKA 3TAMA 3HK2A 5E41A 4KPYA 3RMDA 2XO7A 1KSPA 4I2PA 1IKWA 1JKHA 4KO0A 1QSSA 4FJLA 5JS2A 4PA1A 3P5JA 3QO9A 3TAPA 1X9WA 1X9SA 1J9AA 1TV6A 3AVJA 4AHUA 1IKYA 3A2FA 4LSNA 4CHYA 3OY9A 1NJYA 1C1CA 4BWMA 3KLHA 4KHWA 1UAXA 3QLHA 5I3UA 3OYLA 3C6UA 1JLBA 3KLFA 2Z1IA 2PYJA 2DY4A 3DRPA 5KTQA 2HB5A 1RBTA 4JS4A 1QSYA 4B9TA 3ALYA 2BGGA 1LWFA 3VQPA 3V9SA 3OYIA 4F4KA 4Z4GA 3OS1A 1D5AA 5HROA 4W5RA 3M8RA 1JLAA 3SYZA 4Y1CA 4J2BA 4I7FA 1EKEA 4C8MA 3OYNA 2G8VA 1C0MA 4CJ4A 4C8KA 4KHYA 2KW4A 4O44A 1B92A 2EX3A 4E3SA 1LAVA 4EZ9A 1VSLA 2X6NA 3VQQA 1NOZA 4IDKA 4CK3A 1IG9A 3HYFA 1Q9XA 3HP6A 1RDBA 4DQRA 3PUFA 4FJIA 1HPZA 4N47A 3NH0A 3F9KA 3ZT3A 4FW2A 2Y1IA 1JLQA 2OPQA 5T7BA 1LW2A 1I39A 4OKEA 2X74A 3HM9A 3D0PA 3L3VA 3V4IA 3WNEA 1EP4A 3AA3A 1ZYQA 2YNHA 2XY5A 1XI1A 3KKSA 2F8TA 3O3HA 1N6QA 4DF8A 5KGXA 3HPOA 1RT6A 2ZD1A 4KREA 1HMVA 1A5WA 3AVNA 4O55A 3SQ4A 3NGYA 1ZBUA 4CEQA 4CIFA 1N5YA 4CF0A 3QESA 3QEWA 4CJ3A 1VSIA 4BDYA 3DLKA 3L2QA 3SI6A 4DFMA 4H8KA 1BGXT 3B6OA 3E01A 1BQNA 4N76A 2VG7A 2O4IA 3G0ZA 2Z1JA 1WSJA 1B9DA 1GOBA 5KRSA 4YNQA 3K5OA 1IH7A 3HXMA 4BE2A 3T19A 3QEPA 3ISNC 1WN7A 2JLEA 1S6PA 3ZT0A 4ID1A 4YFUA 1RBRA 1NK8A 3OYCA 3VQ7A 3TAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSQ A;  4FJX A;  1REV A;  1BI4 B;  1XHX A;  3VA0 A;  5DK5 A;  3ZSZ A;  3QNN A;  1RT3 A;  4Q5V A;  4FM1 A;  2RPI A;  1IKV A;  2YNG A;  3DM2 A;  5SWM A;  4F2S A;  4IKF A;  1J54 A;  3KKR A;  3KLI A;  3AVB A;  2ATQ A;  3KD5 E;  2XRI A;  1BCM A;  3QIN A;  4W5O A;  4KHN A;  4E19 A;  3OYK A;  4DS4 A;  2YHA A;  2P5G A;  3JSM A;  3WNH A;  1TKZ A;  4OKJ A;  4CHN A;  3SUP A;  1TK8 A;  1Z25 A;  1RT5 A;  4CFC A;  4LD0 A;  1RDD A;  3KD1 E;  3QEX A;  4KHU A;  4JRQ A;  2YHB A;  2O4G A;  2ZE2 A;  3LPU A;  1KVC A;  4E1M A;  4FM0 A;  4DS5 A;  3LP2 A;  1C0T A;  3QER A;  4KTZ A;  3HO1 A;  4B9S A;  4DLE A;  4M3Z A;  1NK4 A;  1NKB A;  3U6F A;  4CJL A;  4FZX C;  3AO5 A;  2BDP A;  1LW0 A;  3FFI A;  3LWL A;  1O1W A;  2HMI A;  3LAN A;  4LH4 A;  4PY5 A;  3OYB A;  4CF1 A;  3KK3 A;  4HUG A;  1SL0 A;  2HHQ A;  3UIQ A;  2X78 A;  3OS0 A;  3DLH A;  2D0B A;  3DYA A;  4K8Z A;  3QIP A;  2G8W A;  2DFF A;  1U04 A;  4OPJ A;  3TWH A;  4B9U A;  5KI6 A;  4FJH A;  1RDA A;  1VRU A;  1HYZ A;  5SZT A;  1GOA A;  3MEE A;  4DTN A;  3TAF A;  4KTQ A;  2A1R A;  3IAY A;  4B08 A;  3VQE A;  4G1Q A;  3VQ4 A;  4CJU A;  4J2A A;  1JXB A;  4CJK A;  3T1A A;  1RT2 A;  4BE1 A;  2OZM A;  3ZT1 A;  4CHZ A;  3OYF A;  1TGO A;  1CZ9 A;  3ZSR A;  5HRS A;  4FLV A;  4PWD A;  4HVJ A;  2FBX A;  4LSL A;  4B8A B;  1YTU A;  3AO3 A;  4OKK A;  1J5O A;  3HVT A;  4Z4I A;  4CJP A;  4TSX A;  5HRR A;  5EU7 A;  3NAE A;  2QKB A;  1RT7 A;  4F3T A;  4NYN A;  2F8S A;  3NH1 A;  4M41 A;  1S5J A;  4CEO A;  4FJN A;  3DOK A;  4H4O A;  3SUN A;  4FK2 A;  1F21 A;  4KV8 A;  1YT3 A;  3ZSW A;  3JYT A;  3THV A;  1NOY A;  3NBP A;  2G8H A;  3AO1 A;  4F8R A;  4NCG A;  4M3W A;  3M8P A;  3PX6 A;  4CF2 A;  2P1J A;  3SQ0 A;  4UQG A;  3K5M A;  2KFZ A;  2WOM A;  2VWK A;  4CEF A;  4IBN A;  4FLX A;  3V1O A;  3MAQ A;  1L3T A;  4B9V A;  3VQ5 A;  4CIE A;  3V6D A;  1KRP A;  3PX4 A;  2IOC A;  2OZS A;  2F96 A;  4QAG A;  3CFO A;  3PX0 A;  5CYM A;  4FK4 A;  1TAU A;  2RN2 A;  1VSE A;  4OLA A;  1W9H A;  3IG1 A;  5DMR A;  5K14 A;  3EZ5 A;  2E6M A;  4Z0U A;  3HT3 A;  3AO4 A;  5J2Q A;  1QSL A;  1GOC A;  3EYZ A;  3TAB A;  3KTQ A;  4QCL A;  1BL3 A;  1HYS A;  2KFN A;  4OGC A;  2PZS A;  4ELV A;  1VRT A;  1RT4 A;  4HUE A;  3SZ2 A;  4B9N A;  4B9M A;  1IKX A;  3M8S A;  1WSG A;  4FJJ A;  1WAF A;  4AIL C;  4DFK A;  4GVM A;  4O4G A;  3LAL A;  2YV0 X;  5I42 A;  2P5O A;  2PYL A;  3OYM A;  3NF7 A;  3OYA A;  3VQ9 A;  3SQ2 A;  1VSH A;  1S9E A;  4DFP A;  1KCF A;  1RBV A;  4FJ7 A;  2RKI A;  1K6Y A;  3K58 A;  3DRR A;  1ASU A;  1Y97 A;  3RWU A;  4CJV A;  1U48 A;  1KVA A;  4CEC A;  2VWJ A;  1LWC A;  3SQ1 A;  4W5Q A;  3K57 A;  3MXM A;  1TK0 A;  3ZCM A;  4DTJ A;  4DG1 A;  3ITH A;  4DSI A;  3DLG A;  3MEG A;  4DWI A;  3NFA A;  3IS9 A;  4LY7 A;  4RG8 A;  1JLF A;  4OGE A;  1EX4 A;  3DLE A;  4QOZ B;  4CEB A;  4JLH A;  4CHQ A;  1VSM A;  4DQQ A;  2HHT A;  1T05 A;  1ASW A;  1RDC A;  2Q3S A;  4CGI A;  4ZHR A;  4FJ9 A;  3U3Y A;  4M3Y A;  1BIU A;  4N5S A;  4O5B A;  3OJU A;  1SV5 A;  4E7I A;  4DTU A;  4ELT A;  1UWB A;  4W5N A;  3V1Q A;  3P83 D;  4CEA A;  3S3M A;  2HHX A;  4FW1 A;  3V9W A;  3CFR A;  4B8C A;  1ASV A;  3AVF A;  3RRG A;  4CHO A;  4I9Q A;  1C6V A;  3LP0 A;  4E7K A;  3AV9 A;  2Z1G A;  2LSN A;  3LP3 A;  3ZT4 A;  4DLG A;  2DFE A;  1RTI A;  3RTV A;  3S3O A;  3S3N A;  3HST B;  1RIL A;  2ZQB A;  3VQD A;  1S1V A;  3L8B A;  4HHT A;  4DU4 A;  5J2N A;  1EET A;  3TAR A;  3K2P A;  4NYF A;  4OVL A;  3OYE A;  5FRM A;  5D3G A;  4CJE A;  2IDO A;  3PY8 A;  1XWL A;  3ZT2 A;  1UOC A;  5FRN A;  1QHT A;  3AA5 X;  4CGJ A;  4KB1 A;  4E7L A;  3NCI A;  4DTP A;  1IO2 A;  3MED A;  4DF4 A;  1HRH A;  1SL1 A;  4EZ6 A;  1RBU A;  3NF8 A;  3NHG A;  1T8E A;  2IGI A;  2BAN A;  4NCB A;  3CM6 A;  1BI4 A;  2HND A;  5FDL A;  4IG0 A;  4DSF A;  1TKX A;  3AVL A;  3SUO A;  3NGI A;  4RW6 A;  3KK1 A;  1NK5 A;  2HHV A;  4E0D A;  1RTJ A;  1BIZ A;  1NK9 A;  2OPR A;  3AVH A;  3ASM A;  3HP9 A;  5FRO A;  3SPY A;  5HRN A;  2NUB A;  1KVB A;  4F3O A;  4KFB A;  3QIO A;  3OS2 A;  5C42 A;  4MQ3 A;  3K59 A;  3MXJ A;  3PO5 A;  2KZZ A;  3K5N A;  1YTA A;  4I2Q A;  4ICL A;  3VQ8 A;  4CK2 A;  4CJR A;  3OYH A;  5KRT A;  3AVK A;  4GMJ B;  3V9Z A;  4E1N A;  5CY4 A;  3MXI A;  3K5L A;  4DTM A;  3I0R A;  4KHS A;  4DTO A;  4DU3 A;  1JLE A;  3NF6 A;  4AHC A;  3DLR A;  1SKS A;  4CCH A;  4KI6 A;  3KLE A;  4WE1 A;  1R0A A;  3I0S A;  3AVA A;  1C1A A;  1L5U A;  4EP4 A;  1QTM A;  3HPG A;  2IS3 A;  4JRP A;  1BCO A;  4FYD A;  4AHV A;  2IAJ A;  4M3R A;  4CGG A;  1HQU A;  1Z26 A;  4KTW A;  4LH5 A;  1S6Q A;  3V1R A;  4CFA A;  2PY5 A;  2XY6 A;  4H4M A;  3O4N A;  2W42 A;  2KQ2 A;  4CFB A;  1ZBL A;  4DMN A;  2HVI A;  2G8U A;  1T03 A;  4KHQ A;  3G10 A;  4ID5 A;  3U3G A;  2QK9 A;  3CQ8 A;  1S1T A;  4KB0 A;  4ZTJ A;  1XC9 A;  2G8K A;  4FXD A;  4PQU A;  3MEC A;  2HHS A;  2XY8 A;  4DQP A;  4PUO A;  1VSF A;  3SUQ A;  3TAG A;  5CZ2 A;  5KGW A;  4HUF A;  1RTH A;  4CJS A;  3ZSX A;  2YNF A;  4DTX A;  4J2E A;  2EHG A;  2OYQ A;  4B9L A;  1S1W A;  1W0H A;  2A1S A;  3AVG A;  2ITG A;  3PV8 A;  2B6A A;  2E4L A;  2FC0 A;  4FCY A;  4ELU A;  2D5R A;  3NF9 A;  4CJW A;  4EP5 A;  3TR8 A;  4CER A;  4AH9 A;  4HCB A;  4AHS A;  4IFV A;  1BHL A;  4Z4F A;  4Z4E A;  4KRF A;  2KZM A;  3CFP A;  3OVN A;  3C95 A;  3V9X A;  1A5V A;  4DU1 A;  4C8N A;  2FBV A;  4BAC A;  3CYM A;  3VQB A;  1TVR A;  3C94 A;  1S1X A;  3OJS A;  4DQS A;  1L3V A;  1L3U A;  2IC3 A;  4CJ5 A;  1TKT A;  1KFD A;  3AA4 A;  4N56 A;  5CYQ A;  1TK5 A;  4M3T A;  4IFY A;  4DTS A;  4Z4H A;  4KAZ A;  2GUI A;  1ZBI A;  1U4B A;  3H08 A;  1CLQ A;  1XHZ A;  3TAN A;  5HBM A;  1BQM A;  1DTQ A;  2HNY A;  1EXQ A;  3B6P A;  1C0U A;  1QS4 A;  4CGD A;  1FKO A;  3OYD A;  3SV4 A;  1NKE A;  2Y1J A;  3V81 A;  1NK0 A;  2OPS A;  4CJQ A;  4CFD A;  3SPZ A;  1TKD A;  1RT1 A;  1HYV A;  1JLC A;  1C1B A;  1D8Y A;  4RW8 A;  4CF9 A;  1Q8I A;  4OJR A;  3SCX A;  4B3O A;  5HLF A;  1FXX A;  4CK1 A;  1X1P A;  4DSE A;  4FLZ A;  3CM5 A;  2HW3 A;  4FK0 A;  4M42 A;  5J1E A;  3VA3 A;  2HNZ A;  3VQC A;  1U47 A;  1WSH A;  2YKN A;  1KTQ A;  3O3F A;  1VSD A;  2RF2 A;  4M3X A;  1WLJ A;  1X9M A;  4DSJ A;  4Y1D A;  3L2R A;  1WSF A;  2Z1H A;  4O0I A;  2D0C A;  4W5T A;  3RR8 A;  1NJW A;  1TL1 A;  4CHP A;  2HHW A;  5CZ1 A;  1SKW A;  1NK6 A;  1CXQ A;  1SKR A;  2XY7 A;  1DTT A;  4MFB A;  4FJM A;  4CJT A;  4IG3 A;  3RMC A;  3AA2 A;  4JS5 A;  2KTQ A;  2ETJ A;  3OYJ A;  3VQ6 A;  3WNG A;  2OPP A;  1MU2 A;  3NH2 A;  5HP1 A;  5C24 A;  3LPT A;  4FLT A;  1VSJ A;  4K8X A;  4R5P A;  3QET A;  4CGH A;  2D0A A;  4N41 A;  1NJX A;  3V9U A;  4CE9 A;  3QNO A;  5J2M A;  2GBZ A;  4OLB A;  3HL8 A;  4DSL A;  2G8I A;  2QXF A;  1NK7 A;  1DLO A;  2WON A;  1NKC A;  2FBT A;  4KI4 A;  3AVM A;  1U49 A;  1JL2 A;  1HNI A;  1WSE A;  1WAJ A;  5J2P A;  2DTU A;  3IRX A;  2XHB A;  3RRH A;  3PO4 A;  4FJ5 A;  1QE1 A;  2HHU A;  3SV3 A;  4RW7 A;  4DSK A;  4O0J A;  3LZJ A;  3LP1 A;  3O4Q A;  1Q9Y A;  3F73 A;  2R7Y A;  4BE0 A;  2BE2 A;  4FM2 A;  2GV9 A;  2AJQ A;  1L3S A;  4RW4 A;  3AO2 A;  4CF8 A;  3ULD A;  1CXU A;  1ITG A;  1LAW A;  1T7P A;  3ZSY A;  1TAQ A;  4FLW A;  1VK0 A;  4FJK A;  2B4J A;  4GW6 A;  1JL1 A;  4CJF A;  4C8O A;  3DOL A;  3L2W A;  4FVM A;  4ZTF A;  2OA8 A;  4CIG A;  1J53 A;  1WSI A;  4HTU A;  2G8F A;  3T3F A;  4DQI A;  2HVH A;  4DFJ A;  1G15 A;  3CG7 A;  1JLG A;  3P1G A;  3BGR A;  4BDZ A;  3AVC A;  3TI0 A;  1B9F A;  3LWM A;  2YNI A;  3HPH A;  4FJG A;  2X6S A;  2B5J A;  5JS1 A;  1HNV A;  4CEZ A;  1KFS A;  3NE6 A;  4RW9 A;  3LAM A;  1HJR A;  5C25 A;  4E7J A;  4CGF A;  4I9L A;  1S1U A;  3L2V A;  3SNN A;  2E6L A;  4J2D A;  1A5X A;  4F2R A;  3NGZ A;  3KJV A;  2P51 A;  1UA0 A;  3C6T A;  1LWE A;  1I3A A;  3HVR A;  2VG5 A;  3RMB A;  1KLM A;  1D9F A;  1YVU A;  3AVI A;  1SL2 A;  3DLB A;  3LDS A;  1LV5 A;  1CZB A;  3L2U A;  3EY1 A;  1RNH A;  3O3G A;  4AHT A;  1TL3 A;  4CED A;  3QEI A;  3S9H A;  1D9D A;  4C8L A;  4NCA A;  3L3U A;  4KKO A;  1NJZ A;  4L8R B;  1UA1 A;  3RR7 A;  3KK2 A;  1BIS A;  1RCH A;  1SUQ A;  4M3U A;  2DFH A;  2I5J A;  1KLN A;  3M8Q A;  3BDP A;  3TAQ A;  3DMJ A;  3KIO A;  4CES A;  3DI6 A;  1FKP A;  4M45 A;  4Z4C A;  3LZI A;  3KLG A;  4FJ8 A;  3DRS A;  3D45 A;  4XIU A;  4FZY A;  4CEE A;  3WNF A;  3NDK A;  2VG6 A;  3QEV A;  2QKK A;  3I8D A;  4DTR A;  2FBY A;  1HQE A;  1WNS A;  3ZSV A;  4FLU A;  1ZBF A;  1JXE A;  4FLY A;  4E7H A;  3VQA A;  4E89 A;  3HJF A;  3SJJ A;  3OYG A;  1S9G A;  4HCC A;  1RTD A;  4Q0B A;  2JGU A;  4AHR A;  4OPK A;  1RBS A;  4BWJ A;  5HRP A;  1FK9 A;  3RMA A;  2YKM A;  1QQC A;  1U45 A;  4BDP A;  1ZBH A;  3VN5 A;  3ZSO A;  4FZZ A;  3LAK A;  1VSK A;  3TAM A;  3HK2 A;  5E41 A;  4KPY A;  3RMD A;  2XO7 A;  1KSP A;  4I2P A;  1IKW A;  1JKH A;  4KO0 A;  1QSS A;  4FJL A;  5JS2 A;  4PA1 A;  3P5J A;  3QO9 A;  3TAP A;  1X9W A;  1X9S A;  1J9A A;  1TV6 A;  3AVJ A;  4AHU A;  1IKY A;  3A2F A;  4LSN A;  4CHY A;  3OY9 A;  1NJY A;  1C1C A;  4BWM A;  3KLH A;  4KHW A;  1UAX A;  3QLH A;  5I3U A;  3OYL A;  3C6U A;  1JLB A;  3KLF A;  2Z1I A;  2PYJ A;  2DY4 A;  3DRP A;  5KTQ A;  2HB5 A;  1RBT A;  4JS4 A;  1QSY A;  4B9T A;  3ALY A;  2BGG A;  1LWF A;  3VQP A;  3V9S A;  3OYI A;  4F4K A;  4Z4G A;  3OS1 A;  1D5A A;  5HRO A;  4W5R A;  3M8R A;  1JLA A;  3SYZ A;  4Y1C A;  4J2B A;  4I7F A;  1EKE A;  4C8M A;  3OYN A;  2G8V A;  1C0M A;  4CJ4 A;  4C8K A;  4KHY A;  2KW4 A;  4O44 A;  1B92 A;  2EX3 A;  4E3S A;  1LAV A;  4EZ9 A;  1VSL A;  2X6N A;  3VQQ A;  1NOZ A;  4IDK A;  4CK3 A;  1IG9 A;  3HYF A;  1Q9X A;  3HP6 A;  1RDB A;  4DQR A;  3PUF A;  4FJI A;  1HPZ A;  4N47 A;  3NH0 A;  3F9K A;  3ZT3 A;  4FW2 A;  2Y1I A;  1JLQ A;  2OPQ A;  5T7B A;  1LW2 A;  1I39 A;  4OKE A;  2X74 A;  3HM9 A;  3D0P A;  3L3V A;  3V4I A;  3WNE A;  1EP4 A;  3AA3 A;  1ZYQ A;  2YNH A;  2XY5 A;  1XI1 A;  3KKS A;  2F8T A;  3O3H A;  1N6Q A;  4DF8 A;  5KGX A;  3HPO A;  1RT6 A;  2ZD1 A;  4KRE A;  1HMV A;  1A5W A;  3AVN A;  4O55 A;  3SQ4 A;  3NGY A;  1ZBU A;  4CEQ A;  4CIF A;  1N5Y A;  4CF0 A;  3QES A;  3QEW A;  4CJ3 A;  1VSI A;  4BDY A;  3DLK A;  3L2Q A;  3SI6 A;  4DFM A;  4H8K A;  1BGX T;  3B6O A;  3E01 A;  1BQN A;  4N76 A;  2VG7 A;  2O4I A;  3G0Z A;  2Z1J A;  1WSJ A;  1B9D A;  1GOB A;  5KRS A;  4YNQ A;  3K5O A;  1IH7 A;  3HXM A;  4BE2 A;  3T19 A;  3QEP A;  3ISN C;  1WN7 A;  2JLE A;  1S6P A;  3ZT0 A;  4ID1 A;  4YFU A;  1RBR A;  1NK8 A;  3OYC A;  3VQ7 A;  3TAE A; 
#chains in the Genus database with same CATH topology
 3VA0 A;  4B1Z A;  1RT3 A;  3DM2 A;  2V51 B;  4F2S A;  3AVB A;  4GVE A;  3QIN A;  5FPD A;  4E19 A;  3OYK A;  4CVN E;  3JSM A;  3LDO A;  4DKW A;  1TK8 A;  4CFC A;  1RDD A;  2E2Q A;  3VMF B;  3LP2 A;  2W41 A;  5AQW A;  1GLA G;  3ULE B;  4B9S A;  3HO1 A;  1NKB A;  4CJL A;  4FZX C;  2E2P A;  2FXU A;  4LH4 A;  1SL0 A;  3J80 O;  1SZ2 A;  3UIQ A;  2X78 A;  1T6C A;  3OS0 A;  3DLH A;  1U04 A;  4ILG B;  4FJH A;  1VRU A;  1I94 K;  3CCQ N;  3LM9 A;  3MEE A;  4DTN A;  4FL9 A;  3TAF A;  2A1R A;  4BGA A;  3EO3 A;  3ZT1 A;  4PL8 A;  1X3N A;  3H1V X;  4FLV A;  4LSL A;  3AO3 A;  4ISE A;  1J5O A;  3NAE A;  2CGJ A;  2F8S A;  1S5J A;  4KV8 A;  1BU6 O;  3NBP A;  3AO1 A;  3SMS A;  4M3W A;  3CME N;  1XNQ K;  1DGK N;  3SQ0 A;  1TYQ B;  4QS9 A;  2KFZ A;  2WOM A;  5BRD A;  4B9V A;  3V6D A;  1NWK A;  3P39 A;  1YHQ N;  3CFO A;  2RN2 A;  2ZJR L;  2Q2R A;  3EZ5 A;  4KH6 A;  1K73 O;  2P9I A;  4OPH A;  3HT3 A;  1GOC A;  3TAB A;  1HYS A;  2HOE A;  2PZS A;  4B9N A;  3AGR A;  3O9S A;  1WAF A;  1M1K O;  1VQM N;  3QB0 A;  4DV7 K;  1XUP O;  2YV0 X;  5I42 A;  1VQ5 N;  1XQS C;  3CQX A;  4Z94 A;  3NF7 A;  5HOO A;  1S9E A;  4DFP A;  3K58 A;  3A5N C;  4JK9 A;  1U48 A;  1KVA A;  3MXM A;  3ZCM A;  2KLA A;  4C1N K;  1N36 K;  4OGE A;  3FZF A;  1YJ9 N;  4JLH A;  4CHQ A;  4DQQ A;  2HF3 A;  1ASW A;  4N5S A;  4BRG A;  3OJU A;  4JYA K;  3DXM B;  4ELT A;  3V1Q A;  3FZM A;  1VQ8 N;  1YAG A;  3AVF A;  3M1F A;  4CHO A;  3AV9 A;  3ENH A;  3ZT4 A;  3S3O A;  5AQR A;  4JV5 K;  1QQN A;  3HST B;  1RIL A;  2ZQB A;  3E66 A;  1S1V A;  2D4W A;  4OVL A;  4A2A A;  5BR9 A;  2P9K A;  4DCH A;  4CJE A;  3PY8 A;  3ZT2 A;  1QHT A;  4CGJ A;  1MWM A;  3CIP A;  4KB1 A;  4E7L A;  4GV6 A;  1IV0 A;  4BC3 A;  4JK7 A;  2HND A;  4PKH A;  5JIC A;  3BUZ B;  4RW6 A;  2P9L B;  2HHV A;  1BIZ A;  3D2F A;  4B9Q A;  5FRO A;  1VQP N;  2NUB A;  4FWL A;  4RCH A;  3QIO A;  1XC3 A;  5C42 A;  3PO5 A;  1YTA A;  4I2Q A;  1OKJ A;  3R1X A;  3LL3 A;  4BR9 A;  5ADX A;  3ATV A;  4JEP A;  3K5L A;  4B3M K;  4H0T B;  4AHC A;  3DLR A;  5LY3 A;  2ASO A;  3I0S A;  1C1A A;  1HR0 K;  4FYD A;  2IAJ A;  1HQU A;  2A40 A;  4KTW A;  4LH5 A;  1S6Q A;  4BR7 A;  3T7Z A;  3DLL L;  4DMN A;  4CZJ A;  2QK9 A;  4BVP A;  4KB0 A;  3DXM A;  4FWN A;  4ZTJ A;  4NLC A;  3MEC A;  4JKG A;  3TAG A;  1NGF A;  3ZSX A;  2YNF A;  3VF4 A;  4J2E A;  1S1W A;  2A1S A;  3PV8 A;  2ITG A;  3MN6 A;  3G71 N;  3NF9 A;  4JI3 K;  4HCB A;  4KRF A;  4AHS A;  1BHL A;  4BGB A;  1GLJ O;  3V9X A;  3R9P A;  5BRE A;  3O6W A;  1YI2 N;  2WTU A;  4LF9 K;  1WOQ A;  2QWN A;  4A57 A;  4CJ5 A;  2QWO A;  4CZI A;  3J7A P;  4KH4 A;  4Z4H A;  1M90 O;  4KAZ A;  4DHY A;  2HBL A;  4LF7 K;  1YJN N;  5C12 A;  1EWR A;  4BRN A;  2HMP A;  1C0G A;  1NM1 A;  1EXQ A;  3GDQ A;  2NRH A;  3OYD A;  4CGD A;  1NKE A;  5LMN K;  2OPS A;  1KAY A;  1NG9 A;  5C0Y A;  4ISG A;  4RW8 A;  3SCX A;  5AFU H;  4B3O A;  3GE1 A;  4DSE A;  2HW3 A;  2E20 A;  3A5O C;  1IBL K;  4QS7 A;  4M42 A;  5ELZ A;  5M1O A;  5KPZ A;  5C2F A;  4M3X A;  3F5T A;  3FZL A;  3D6R A;  4A2B A;  1WSF A;  3F9M A;  2D0C A;  4W5T A;  4DUZ K;  5AQK A;  3WXM B;  3C0B A;  4CHP A;  2O8C B;  4IG3 A;  3VET A;  4R79 A;  2WFB A;  3OYJ A;  4JKF A;  4WQ4 A;  3UKU B;  3IFR A;  4N41 A;  4CD1 A;  4R5P A;  5HL7 L;  1SS6 A;  5J2M A;  2GBZ A;  2V7Y A;  3HL8 A;  4O5F A;  1HPM A;  1DLO A;  3TTD A;  2WON A;  3AVM A;  2ZGY A;  4DR6 K;  3RRH A;  2HHU A;  4RW7 A;  4O0J A;  3A8Y A;  4BE0 A;  2R7Y A;  2BE2 A;  2NRR A;  1L3S A;  3AO2 A;  4CF8 A;  3LDP A;  4DUY K;  4JKB A;  3KHY A;  1LAW A;  1T7P A;  4FLW A;  2E5L K;  2B4J A;  5LJV A;  1JL1 A;  4CJF A;  4FVM A;  1QHA A;  2OA8 A;  1J53 A;  3PSI A;  2HVH A;  4DFJ A;  1G15 A;  2O8B B;  3BGR A;  3TI0 A;  3HPH A;  3U9D A;  4DR7 K;  2W6L A;  3DWL A;  2F9T A;  4RW9 A;  2O8B A;  4E7J A;  5C25 A;  2WBN A;  3L2V A;  2E6L A;  4F2R A;  3I55 N;  1D9F A;  1KLM A;  1HLU A;  3CJ1 A;  3AVI A;  4JI4 K;  1K8K B;  2F4V K;  1CZB A;  1JCF A;  3EY1 A;  1NJI O;  4AHT A;  2FSN A;  3S9H A;  1KQS M;  4NCA A;  4BRL A;  1NJZ A;  3RR7 A;  3KK2 A;  2KHO A;  2I5J A;  1KLN A;  2OAN A;  3BDP A;  3TAQ A;  4CZF A;  3DMJ A;  4CES A;  2V7Z A;  4FWM A;  4M45 A;  4Z4C A;  2YHX A;  4LFA K;  3DRS A;  4CZH A;  4FZY A;  4CEE A;  3J7Z O;  3I8D A;  5BPM A;  1WBB A;  5FLX O;  4E7H A;  3VQA A;  4E89 A;  4K41 A;  2O8F A;  3OYG A;  4LF6 K;  2JGU A;  4OPK A;  1OH5 A;  4O8U A;  3RMA A;  2YKM A;  3ZEU B;  5IT9 O;  3ZSO A;  4FZZ A;  4KPY A;  4WQ5 C;  1JKH A;  1RFQ A;  3ZET B;  3MWP A;  2YHY A;  1TV6 A;  1VQ4 N;  4I6M B;  1C1C A;  1V4T A;  3CCU N;  3HOS A;  3OYL A;  4BQZ A;  3IUC A;  4EFH A;  2PYJ A;  3ZX0 A;  3DRP A;  2W6K A;  4B3S K;  2HB5 A;  3A0I X;  5M1K A;  1LWF A;  4F4K A;  5E84 A;  1DKG D;  1D5A A;  4YOT A;  5HRO A;  3CCS N;  4Y1C A;  4J2B A;  3Q7B A;  4I7F A;  5EOY A;  3UKR B;  4BG8 A;  4KHY A;  2HBJ A;  1NGC A;  3VQQ A;  4K42 A;  4FJI A;  1HPZ A;  3U8X A;  4FW2 A;  2Y1I A;  2P9K B;  1JLQ A;  5LMU K;  3CJ7 A;  1LW2 A;  3V4I A;  3HM9 A;  4FWK A;  1S22 A;  4WFN L;  5KGX A;  1BA1 A;  1S3X A;  2BUP A;  5CE3 A;  3HPO A;  4KRE A;  1A5W A;  2A6A A;  3NGY A;  1ZBU A;  4CIF A;  2HHH K;  4WQ4 C;  2O8D A;  3DLK A;  1BGX T;  3J7Y P;  1BQN A;  1KAZ A;  2O4I A;  3P31 A;  4AM7 A;  1B9D A;  1GOB A;  3VEV A;  5KRS A;  1MWK A;  1W97 L;  1Z05 A;  2FF3 B;  1WN7 A;  2JLE A;  2P9P A;  3ZT0 A;  5AQG A;  4ILJ A;  3ZSQ A;  2Q0R A;  3AAP A;  1REV A;  4PY5 A;  4FM1 A;  4IKF A;  5ADX H;  4EHU A;  1E3M A;  3KLI A;  3TSU A;  1NU0 A;  4KHN A;  1K8K A;  4W5O A;  3CER A;  2O8C A;  2VGM A;  4CHN A;  1RT5 A;  3KD1 E;  3QEX A;  4FWP A;  4JRQ A;  2YHB A;  5BN9 A;  4E1M A;  3O08 A;  5KQ8 A;  5AQY A;  1JCE A;  3CC7 N;  2UU9 K;  3VTI A;  1NK4 A;  2ASM A;  2P9I B;  3FFI A;  3LAN A;  1ATN A;  4CF1 A;  3P4I A;  3O9R A;  2I7P A;  5LJW A;  4K8Z A;  2DFF A;  5KI6 A;  4JI2 K;  3NVK A;  3DXK A;  4XH1 A;  1NLV A;  3KK7 A;  3IAY A;  3L4I A;  5DM7 L;  5KQD A;  3G25 A;  1TGO A;  1CZ9 A;  3P38 A;  4JKH A;  4Z4I A;  3TPQ A;  4CJP A;  2FSK A;  4TSX A;  5BRF A;  4RWT A;  5EU7 A;  3THX B;  1RT7 A;  4YOV A;  4FJN A;  4CEO A;  5C2D A;  1F21 A;  1NOY A;  1NGJ A;  2OTJ N;  4B1Y B;  4BG9 A;  4CF2 A;  2VGN A;  1FJG K;  4UQG A;  1DT9 A;  3V1O A;  3VQ5 A;  4DQ8 A;  2QA4 N;  1KD1 O;  5AQU A;  1KRP A;  4L3Q A;  3PX0 A;  1TAU A;  4OLA A;  1VSE A;  1QZ5 A;  3IG1 A;  5K14 A;  3AO4 A;  1OVY A;  3EYZ A;  2KFN A;  1VRT A;  3S41 A;  2OTL N;  3O8M A;  4BR4 A;  3BP8 A;  3M8S A;  1WSG A;  4FJJ A;  4AIL C;  3O1B A;  4DFK A;  4GVM A;  4O4G A;  3LAL A;  4CZM A;  2P5O A;  1TYQ A;  3WXI A;  2PYL A;  3OYM A;  4JK8 A;  4FJ7 A;  2YI1 A;  3DRR A;  3WQU A;  1Y97 A;  3RWU A;  1Q18 A;  3J8A A;  3TSQ A;  4JKC A;  4JKE A;  4CEC A;  3SQ1 A;  4DTJ A;  4BRA A;  4DG1 A;  3MEG A;  2DPN A;  3NFA A;  4B3R K;  3IS9 A;  3ENB A;  4H5T A;  4RG8 A;  3BEX A;  3FGU A;  4QOZ B;  5AQJ A;  3K9J A;  4YOU A;  4NLB A;  1VSM A;  2HHT A;  1RDC A;  2Q3S A;  4CGI A;  4ZHR A;  4FJ9 A;  3WT0 A;  2NRX A;  1SV5 A;  4W5N A;  3H45 C;  3P83 D;  4CEA A;  2HHX A;  3V9W A;  4BRI A;  3CFR A;  3GG4 A;  1C6V A;  4E7K A;  4DLG A;  3RTV A;  1RTI A;  3S3N A;  3L8B A;  4DU4 A;  1EET A;  3OYE A;  4JKA A;  5FRM A;  5FRN A;  1XWL A;  3CHW A;  1T44 A;  2QTD A;  1HX1 A;  1SL1 A;  4DTP A;  4DF4 A;  4EZ6 A;  3THW B;  1RBU A;  3NHG A;  4NCB A;  1BI4 A;  4IG0 A;  1TKX A;  3PSF A;  4UY8 O;  3UB5 A;  1NK5 A;  1YUW A;  2QWL A;  4CJ7 A;  3ASM A;  3SPY A;  4F3O A;  4JHD A;  2AP1 A;  3OS2 A;  4MQ3 A;  1S72 N;  3MXJ A;  3K5N A;  3VQ8 A;  1BO5 O;  4ICL A;  3OYH A;  5KRT A;  4GMJ B;  4E1N A;  3MXI A;  1NGA A;  2GTD A;  4KHS A;  4DTO A;  4DU3 A;  1JLE A;  3RVC A;  3TTC A;  2YJF A;  1SKS A;  3O1W A;  4KI6 A;  4WE1 A;  1YF5 L;  4IFE A;  1R0A A;  3AVA A;  2GEM A;  4EP4 A;  1L5U A;  1QTM A;  1BCO A;  2P9L A;  2QWQ A;  4AHV A;  4CGG A;  1R59 O;  4BRF A;  3A5M C;  3V1R A;  1ILY A;  2W42 A;  3JAM O;  5AZJ A;  4IEE A;  2G8U A;  1X3M A;  5BPN A;  3NVM A;  3U3G A;  2PBD A;  4FXD A;  5GAH P;  4PQU A;  2HHS A;  2XY8 A;  3R8E A;  3D2E A;  3CCM N;  4NB4 A;  4DTX A;  3CI5 A;  4IO8 A;  1YVN A;  2B6A A;  4U7B A;  4EP5 A;  4CER A;  4IFV A;  2KZM A;  1QQO A;  5DM6 L;  3EZW A;  4H5W A;  3TTF A;  4CI6 A;  3VTH A;  5AJ3 K;  2J4R A;  3CYM A;  4H0X B;  3VQB A;  1TVR A;  4GKK K;  1L3V A;  3CPE A;  1YJW N;  3AA4 A;  5CYQ A;  1TK5 A;  4M3T A;  2GUI A;  3SLC A;  4IXC A;  1CLQ A;  5GAG P;  3B6P A;  5BN8 A;  3FR0 A;  2Y1J A;  1NK0 A;  3O5B A;  1GLB G;  4CJQ A;  4CFD A;  1C1B A;  2HBM A;  4CK1 A;  1X1P A;  3CM5 A;  1NGD A;  2YKN A;  3EKS A;  4MDB A;  2RF2 A;  1X9M A;  4DSJ A;  3THY A;  3RR8 A;  4IJN A;  1NJW A;  1OH6 A;  5CZ1 A;  3VGK A;  3HTV A;  4MFB A;  3CET A;  4IJA A;  2KTQ A;  2ETJ A;  4CZG A;  3VQ6 A;  2OPP A;  5HP1 A;  3NH2 A;  1W7A A;  5C24 A;  4FLT A;  2UUB K;  1VSJ A;  2FSJ A;  3QET A;  4CGH A;  2QI2 A;  4OLB A;  3CCJ N;  4JAX A;  2G8I A;  1NK7 A;  1NKC A;  2FBT A;  3SK3 A;  4BRH A;  1JL2 A;  1WSE A;  4OPA A;  3IRX A;  5JLF A;  2XHB A;  1QE1 A;  5CR4 A;  1Q9Y A;  5GIO A;  2FLO A;  3F73 A;  4YOW A;  4FSV A;  3C7N A;  4KBO A;  3ZSY A;  1TAQ A;  3BY5 A;  1VK0 A;  3HZ6 A;  2UUC K;  1W2B M;  3DOL A;  3EL2 A;  3DAW A;  4CIG A;  1QZ6 A;  4HTU A;  4DQI A;  3E9P A;  3ZX3 A;  4X65 K;  2BH1 A;  4DV2 K;  2EWS A;  3CQY A;  1JLG A;  3H46 O;  2JWL A;  1BA0 A;  3LWM A;  4LF4 K;  4FJG A;  3VEZ A;  2B5J A;  4CEZ A;  1KFS A;  2IVP A;  3LAM A;  1HJR A;  4DR3 K;  4I9L A;  2ZJQ L;  1ZC6 A;  3EE8 A;  3T69 A;  1UA0 A;  3HVR A;  1QVG M;  1YVU A;  3JS6 A;  1LOT B;  1E4G T;  2O8F B;  1LV5 A;  4GKJ K;  4FWO A;  2WC9 A;  5JLH A;  1TL3 A;  4C8L A;  3BF3 A;  4A62 A;  4L8R B;  1UA1 A;  3ZEU A;  1BIS A;  3BZC A;  3LZI A;  3RSE A;  3D45 A;  4XIU A;  3WNF A;  2VG6 A;  2QKK A;  3ZSV A;  3HJF A;  3SJJ A;  1RTD A;  4BWJ A;  4BDP A;  4IOX A;  2P9N B;  3LAK A;  1VSK A;  3TAM A;  3HK2 A;  4FJL A;  3VEO A;  1X9W A;  3TAP A;  5AQN A;  1HUX A;  1C0F A;  4AHU A;  1XMO K;  2QEX N;  1IKY A;  3A2F A;  4LSN A;  2QWM A;  5I3U A;  3C6U A;  3KLF A;  3FZH A;  5KTQ A;  4YOY A;  4FO0 A;  1QSY A;  4AF1 A;  2BGG A;  3ALY A;  3OHR A;  3VQP A;  3BF1 A;  5C15 A;  2OCE A;  3M8R A;  1JLA A;  5AQI A;  1JCG A;  4M63 C;  3IKM A;  4C8M A;  3OYN A;  5JVH L;  2NRZ A;  1B92 A;  3EN9 A;  1LAV A;  1EO1 A;  1VSL A;  1Q9X A;  1RDB A;  2QXL A;  4CW7 B;  3ENO A;  2CGL A;  4CZL A;  3NH0 A;  5AQT A;  3CD6 N;  1I39 A;  3L3V A;  4H0V B;  1EP4 A;  4C1N I;  2YNH A;  3L4Q A;  2Q97 A;  3M6G A;  3HM8 A;  4IEI A;  4DF8 A;  2IIR A;  1HMV A;  2NRT A;  3VEY A;  4CEQ A;  4CF0 A;  3QES A;  3GOI A;  3B6O A;  5KPR A;  2ZWH A;  3ZX2 A;  5LL6 Z;  4LF8 K;  2VG7 A;  2JWK A;  3HI0 A;  1IH7 A;  3K5O A;  3HXM A;  3CJB A;  3WUH A;  4JN4 A;  5GAE P;  4ID1 A;  1NK8 A;  1RBR A;  3WEE B;  4FJX A;  4FOE A;  4JI5 K;  2NRV A;  5DK5 A;  3ZSZ A;  3QNN A;  1N34 K;  1Q86 O;  2YNG A;  1IKV A;  5SWM A;  3KKR A;  2ATQ A;  3KD5 E;  1U2V B;  2XRI A;  4DS4 A;  2YHA A;  2P5G A;  3BZK A;  5AR0 A;  3WNH A;  4WFB L;  3SUP A;  3WXK A;  1Z25 A;  2ZE2 A;  3LDN A;  3QER A;  4IZ9 A;  3THY B;  4MO5 A;  3MN7 A;  4M3Z A;  3OA9 A;  3U6F A;  3VGM A;  3THX A;  3AO5 A;  2BDP A;  1LW0 A;  3LWL A;  1O1W A;  4NO7 A;  3KK3 A;  1IG8 A;  1WBD A;  1ZBS A;  3DYA A;  3CCR N;  2Q1N A;  1RDA A;  4I6M A;  1GOA A;  1X9J A;  4KTQ A;  2YJE A;  3VQE A;  3VQ4 A;  4CJU A;  1G99 A;  4BE1 A;  3T1A A;  2OZM A;  4CHZ A;  4PWD A;  5BPL A;  3ZSR A;  5HRS A;  4HVJ A;  2FBX A;  4B8A B;  3H6E A;  2F7T A;  3HVT A;  4DV5 K;  5HRR A;  4F3T A;  4NYN A;  3VEN A;  3SUN A;  3THV A;  2G8H A;  3JYT A;  2Q36 A;  4YDU A;  3K5M A;  2ZJP L;  2P9N A;  3HRG A;  2VWK A;  4IBN A;  4CBX A;  4FLX A;  1OH8 A;  3PX4 A;  4E1J A;  2OZS A;  5CYM A;  1MDU B;  1W9H A;  5DMR A;  2E6M A;  4Z0U A;  5J2Q A;  1QSL A;  4QCL A;  1BL3 A;  4WCE L;  4FWS A;  2P9P B;  3VF6 A;  4BRQ A;  4B9M A;  1HNX K;  2HF4 A;  2CGK A;  1E4F T;  1HKC A;  3DJC A;  5AQM A;  4DR2 K;  4BY9 C;  3U4L A;  1VQO N;  4PKG A;  3OYA A;  5E26 A;  3VQ9 A;  3SQ2 A;  1KCF A;  1RBV A;  3MCP A;  5JVG L;  2RKI A;  1K6Y A;  2CH5 A;  2VCP A;  5M1F A;  2VWJ A;  1LWC A;  4W5Q A;  3ITH A;  4DSI A;  1N32 K;  3AAQ A;  4CBW A;  3GBT A;  1JLF A;  2HST A;  1RDU A;  4JHD B;  1O13 A;  1EX4 A;  3D2E B;  3WXL A;  3VER A;  2E2N A;  3MCA B;  3U3Y A;  3PLA A;  4O5B A;  4E7I A;  4DTU A;  4JD2 B;  3HSC A;  5M1P A;  5C10 A;  3S3M A;  4FW1 A;  2Q31 A;  1GLC G;  3LP0 A;  5AQF A;  2Z1G A;  3IMX A;  2BTF A;  3LP3 A;  2DFE A;  4HHT A;  2NLX A;  5J2N A;  3O9Q A;  5M1Q A;  3K2P A;  4NYF A;  1EQY A;  5D3G A;  2IDO A;  2PAV A;  3AA5 X;  2UXB K;  1RGI A;  3MED A;  1HRH A;  5FPN A;  3WEE A;  4DR5 K;  2UXC K;  2IGI A;  1J5E K;  3ULE A;  4DSF A;  1VAZ A;  1Q82 O;  2H3G X;  2KKZ A;  4BR0 A;  3SUO A;  3TSP A;  2D0P A;  3LM2 A;  3OBW A;  4E0D A;  1U2V A;  3ATU A;  3MN9 A;  4BRO A;  3HP9 A;  3AVH A;  4HTL A;  1KVB A;  4B1W B;  3M3Z A;  3K59 A;  2KZZ A;  2ZM6 K;  4CK2 A;  4CJR A;  3V9Z A;  5CY4 A;  2P9S B;  4K0K K;  3NF6 A;  4CCH A;  1NMN A;  1KXP A;  3AY9 A;  4JRP A;  4M3R A;  1Z26 A;  2GWK A;  5EY4 A;  4CFA A;  2XY6 A;  1OVQ A;  4FOI A;  2HVI A;  4H03 B;  3SBT A;  1TUU A;  5JMV A;  1T03 A;  4YY3 K;  3G10 A;  4ID5 A;  3CQ8 A;  2G8K A;  4DQP A;  4PUO A;  1VSF A;  3CCE N;  5CZ2 A;  2W40 A;  5KGW A;  4HUF A;  3K9K A;  5BRH A;  1HKG A;  1V4S A;  2EHG A;  4B9L A;  1W0H A;  3AVG A;  2FC0 A;  2D5R A;  4Z4F A;  5AQH A;  3CFP A;  3OVN A;  4M7X A;  4KH5 A;  4C8N A;  2FBV A;  3H1Q A;  3OJS A;  1Q7Y O;  1EWQ A;  1TKT A;  2WUS A;  4IFY A;  4DTS A;  4A5A A;  3TAN A;  5HBM A;  4EIA A;  1QS4 A;  3SV4 A;  1FKO A;  2UXD K;  3QFU A;  1TKD A;  3JXU A;  1JLC A;  2HBK A;  3B8A X;  2YCH A;  5HLF A;  5TKW A;  4RTF D;  5J1E A;  3VA3 A;  3VQC A;  1U47 A;  1WSH A;  3RSE B;  1IBK K;  4BRM A;  5GIN A;  2GEL A;  4BRC A;  3L2R A;  3UKU A;  2Z1H A;  2F9W A;  4NXN K;  3D7E O;  2HHW A;  5AZI A;  1SKW A;  1NK6 A;  1SKR A;  3I8B A;  1DTT A;  4F9O A;  3RMC A;  4JS5 A;  3WNG A;  1MU2 A;  1Y64 A;  3LPT A;  1P90 A;  2D0A A;  3MN5 A;  1NJX A;  1JJ2 M;  4K43 A;  4CE9 A;  3QNO A;  1VQK N;  2QXF A;  4FWQ A;  3M5R A;  1YXQ A;  4KI4 A;  1WAJ A;  4DV1 K;  5J2P A;  4FJ5 A;  4BRP A;  4DSK A;  3LZJ A;  1P8Z A;  1BWF O;  4FM2 A;  2GV9 A;  1CXU A;  2ASP A;  1ITG A;  3A5L C;  4FJK A;  3ID8 A;  4GW6 A;  2O8D B;  3L2W A;  4ZTF A;  1WSI A;  2G8F A;  5AQS A;  3T3F A;  3CG7 A;  1NGG A;  5JS1 A;  1SAZ A;  5F2R A;  3SAG A;  3NE6 A;  3CCV N;  1BUP A;  1S1U A;  4DR4 K;  3SNN A;  1A5X A;  1HNZ K;  3C6T A;  1LWE A;  1I3A A;  3RMB A;  2VG5 A;  4NXM K;  4JNE A;  1QQM A;  2Q0U A;  1SL2 A;  3DLB A;  4BRE A;  3L2U A;  2YHW A;  3CXC M;  3Q7C A;  1H1V A;  4CED A;  3QEI A;  4YHH K;  3VEW A;  1RCH A;  1SUQ A;  2D1K A;  4M3U A;  2DFH A;  3M8Q A;  3CJC A;  4Y0W A;  3KIO A;  1U6Z A;  1FKP A;  3KLG A;  4FJ8 A;  1BOT O;  4BC5 A;  4JI1 K;  2NNW A;  4EAH D;  1HQE A;  1WNS A;  4FLU A;  4FLY A;  1KAX A;  1S9G A;  5EVZ A;  1ATR A;  4H5R A;  4Q0B A;  3K0S A;  5HRP A;  2E8A A;  1FK9 A;  1ZBH A;  4B1U B;  3VN5 A;  3OTO K;  4M7Y A;  5E41 A;  2A3Z A;  4I2P A;  1IKW A;  4KO0 A;  1QSS A;  3HBT A;  5JS2 A;  4PA1 A;  4KHP K;  2V52 B;  4JI6 K;  2UUA K;  1X9S A;  1J9A A;  1N8R O;  2ITM A;  3THW A;  4CHY A;  1NJY A;  4BWM A;  4IDH A;  1JLB A;  2Z1I A;  4BVO A;  2DY4 A;  3L6Q A;  1HNW K;  4JS4 A;  3VF2 A;  3V9S A;  3N4Q A;  4Z4G A;  3OS1 A;  1CZA N;  3QBW A;  3SYZ A;  5KPT A;  2G8V A;  1J6Z A;  4C8K A;  2KW4 A;  4O44 A;  2O8E A;  4EZ9 A;  1NOZ A;  4IDK A;  1IG9 A;  3HP6 A;  5H1S Q;  3VEX A;  3PIP L;  1LCU A;  2O8E B;  1YIJ N;  1GLE G;  3L0Q A;  4N47 A;  3F9K A;  3ZT3 A;  2OPQ A;  5T7B A;  2QWP A;  4OKE A;  2X74 A;  3AA3 A;  2XY5 A;  1XI1 A;  2F8T A;  3O3H A;  1N6Q A;  1RT6 A;  2ZD1 A;  3E1Y A;  3KWG A;  5AZJ B;  4O55 A;  3AVN A;  4GY2 B;  1BG3 A;  2NRW A;  3CJA A;  1N5Y A;  2VQF K;  3QEW A;  3SJH A;  4CJ3 A;  4A61 A;  1VSI A;  4BDY A;  4K25 A;  3L2Q A;  3O9T A;  4U67 L;  3CC2 N;  2E88 A;  5AQQ A;  3QEP A;  3T19 A;  3ISN C;  3SAF A;  3HOT A;  4H0Y B;  1VQ7 N;  3CCL N;  3WQT A;  2P9S A;  1BI4 B;  1XHX A;  4Q5V A;  2RPI A;  1J54 A;  4O8K A;  3GL1 A;  2P9U A;  3FLC O;  1BCM A;  4G9Z A;  1K9M O;  1TKZ A;  4OKJ A;  4LD0 A;  4KHU A;  4MDA A;  2O4G A;  3LPU A;  4FM0 A;  1KVC A;  4DS5 A;  4BQL A;  4DV6 K;  3R6M A;  1C0T A;  4KTZ A;  4X66 K;  5I9E B;  4DLE A;  5F0X A;  1Q81 O;  1TUY A;  2HMI A;  3OYB A;  2HHQ A;  4HUG A;  5AQX A;  2D0O A;  2D0B A;  3H3N O;  3QIP A;  2G8W A;  1NGI A;  4OPJ A;  3TWH A;  4B9U A;  4BC2 A;  1HYZ A;  4V19 S;  5SZT A;  4B08 A;  4YDU C;  4G1Q A;  3SMP A;  4J2A A;  1IJJ A;  1JXB A;  4CJK A;  1RT2 A;  3OYF A;  2AA4 A;  4BR2 A;  2E1Y A;  1YTU A;  4OKK A;  4MLE A;  3VGL A;  4LFC K;  2QKB A;  4H5V A;  1OH7 A;  3NH1 A;  4M41 A;  1N33 K;  3DOK A;  4H4O A;  3ZET A;  1YT3 A;  3ZSW A;  4FPA A;  3J81 O;  4NCG A;  3M8P A;  3PX6 A;  1HKB A;  2P1J A;  2A41 A;  4GNI A;  3N4P A;  4CEF A;  1L3T A;  3G4S N;  3MAQ A;  4CIE A;  3D2F B;  2IOC A;  4GV3 A;  2F96 A;  4QAG A;  4FK4 A;  4WQ5 A;  1VQL N;  1MA9 B;  3KTQ A;  3I33 A;  4OGC A;  4ELV A;  3C6H A;  3VOV A;  1RT4 A;  4HUE A;  3SZ2 A;  1IKX A;  5AZI B;  3UKR A;  5M1N A;  4CBU A;  5AQV A;  4LC9 B;  4BRD A;  1VSH A;  1ASU A;  4JKD A;  4OO1 J;  4CJV A;  3QIC A;  1TK0 A;  3K57 A;  3MMV A;  5A2Q O;  3DLG A;  4IOA L;  4DWI A;  3FZK A;  4LY7 A;  3DLE A;  4CEB A;  4J8F A;  1T05 A;  3W0L A;  4M3Y A;  1BIU A;  1UWB A;  4X64 K;  4JI0 K;  3H3O B;  4B8C A;  1ASV A;  4BRK A;  3RRG A;  4IO9 L;  5AQP A;  4I9Q A;  4FVU A;  2LSN A;  1SQK A;  1RDW X;  4YOX A;  4H0P A;  4JI8 K;  3VQD A;  3O80 A;  3TAR A;  2NZT A;  3E9L A;  1UOC A;  2IVN A;  3MDQ A;  4JI7 K;  3NCI A;  1IO2 A;  3CJ9 A;  4XH5 A;  3NF8 A;  5EX5 A;  4WFA L;  1T8E A;  2BAN A;  3CM6 A;  5FDL A;  3NMU A;  2IVO A;  3AVL A;  3NGI A;  3KK1 A;  1RTJ A;  4EHT A;  1NK9 A;  2OPR A;  5HRN A;  2QW9 A;  4KFB A;  4B1X B;  5F1X A;  3MK6 A;  4XEI A;  4F8R A;  3AVK A;  1NNE A;  1GLD G;  4WF9 L;  4DTM A;  3I0R A;  3IDH A;  3SBG A;  3KLE A;  2QWR A;  1Z6R A;  3HPG A;  2IS3 A;  1BDG A;  2YX6 A;  1VQ9 N;  2PY5 A;  4HWI A;  4H4M A;  3O4N A;  2KQ2 A;  4CFB A;  4PHT X;  1ZBL A;  4MLH A;  4KHQ A;  1S1T A;  2GWJ A;  1XC9 A;  1KC8 O;  3OBY A;  1IBM K;  3SUQ A;  3C65 A;  1RTH A;  4CJS A;  4OX9 K;  2OYQ A;  2E4L A;  4ELU A;  4FCY A;  4JD2 A;  2GUP A;  4CJW A;  2VYP A;  3TR8 A;  1ZXO A;  4AH9 A;  4Z4E A;  3C95 A;  1A5V A;  4DU1 A;  5B8H A;  3O4W A;  4BAC A;  3C94 A;  4CD3 A;  3OW2 M;  1S1X A;  3G6E N;  4DQS A;  4ISF A;  1L3U A;  2IC3 A;  1KFD A;  4N56 A;  2P9U B;  2PFU A;  2UYT A;  3O9U A;  4BR5 A;  1U4B A;  3H08 A;  1XHZ A;  1BQM A;  1DTQ A;  2HNY A;  3T1Y K;  1C0U A;  4LFB K;  3V81 A;  3SPZ A;  1RT1 A;  1HYV A;  1D8Y A;  4CF9 A;  1Q8I A;  4OJR A;  2CH6 A;  3I56 N;  1FXX A;  4FLZ A;  5AQL A;  4FK0 A;  4PKI A;  2HNZ A;  4JKG B;  4DV4 K;  3O3F A;  1KTQ A;  1VSD A;  3VPZ A;  3UE5 A;  2RHK A;  1WLJ A;  3MX5 A;  1GLL O;  4Y1D A;  3CF5 L;  4O0I A;  1ATS A;  2A42 A;  1TL1 A;  5FPE A;  1CXQ A;  4MO4 A;  2XY7 A;  4FJM A;  4CJT A;  3AA2 A;  3C6A A;  4X62 K;  3SAH A;  5GAD P;  4FK2 A;  4IOC L;  4K8X A;  1ZBI A;  4B3T K;  3V9U A;  4DSL A;  5EXW A;  1NBW A;  1U49 A;  3MWT A;  1HNI A;  2DTU A;  1T3V A;  3PO4 A;  3SV3 A;  3WXJ A;  4QS8 A;  3LP1 A;  3O4Q A;  2AJQ A;  4RW4 A;  3TU5 A;  3ZLJ A;  3ULD A;  4IWV A;  4C8O A;  1NMD A;  1GLF O;  3VES A;  4DV3 K;  3PIO L;  3P1G A;  5AQZ A;  5CHI A;  4BDZ A;  3AVC A;  1VQ6 N;  1B9F A;  2YNI A;  4H0O A;  1D4X A;  3QFP A;  2X6S A;  3KVG A;  1HNV A;  3R3L A;  2E1Z A;  2A5X A;  4CGF A;  4J2D A;  3NGZ A;  3KJV A;  2P51 A;  2E2O A;  2FF6 A;  3AAR A;  4DR1 K;  1VQN N;  1XNR K;  1ESV A;  3E9O A;  3LDS A;  4DB3 A;  1RNH A;  3O3G A;  1NGE A;  1D9D A;  3L3U A;  4KKO A;  2I7N A;  3T1H K;  3FE1 A;  4BC4 A;  3AGK A;  2GX9 A;  3ZYY X;  5IWA K;  3QML A;  3DI6 A;  1QVF M;  3F2K A;  2QM1 A;  3NDK A;  3QEV A;  4CZE A;  4B1V A;  3CC4 N;  2ZGZ A;  4CZK A;  4LF5 K;  4DTR A;  2FBY A;  1K8A O;  1ZBF A;  1JXE A;  3EEQ A;  4HCC A;  4AHR A;  1RBS A;  4WYB A;  5BR8 K;  3CPW M;  1U45 A;  4GV9 A;  1QQC A;  4C23 A;  5AQO A;  3RMD A;  2XO7 A;  1KSP A;  3P5J A;  3QO9 A;  4ILH A;  4A59 A;  1YIT N;  5FPM A;  3KZB A;  3AVJ A;  3OY9 A;  3KLH A;  4AQY K;  4KHW A;  3QBX A;  1UAX A;  3QLH A;  5TKY A;  1T6D A;  1RBT A;  3CMA N;  4B9T A;  2ZF5 O;  4XH4 A;  3OYI A;  1DEJ A;  3ID6 A;  4W5R A;  3W3D A;  4FPB A;  3KWI A;  1EKE A;  1FW6 A;  1C0M A;  3DXK B;  4CJ4 A;  1XMQ K;  2EX3 A;  4E3S A;  1WB9 A;  1NGH A;  5GIP A;  2X6N A;  1HJO A;  3MX2 A;  4CK3 A;  3HYF A;  4DQR A;  3PUF A;  4AM6 A;  3LDL A;  4H5N A;  5MLC Q;  1VHX A;  5AFU A;  3D0P A;  3WNE A;  3EKU A;  1ZYQ A;  3KKS A;  2RE2 A;  4YOR A;  3LDQ A;  3QDK A;  3SQ4 A;  4DV0 K;  3C7N B;  3SI6 A;  4DFM A;  3EE9 A;  4H8K A;  3E01 A;  4FWR A;  2VWB A;  4N76 A;  3G0Z A;  2Z1J A;  1WSJ A;  4A5B A;  4PL7 A;  4YNQ A;  4BE2 A;  2VQE K;  3U9Z A;  1NGB A;  1S6P A;  4YFU A;  3OYC A;  3VQ7 A;  3TAE A;  3FFK B;  1WUA A; 
#chains in the Genus database with same CATH homology
 3ZSQ A;  4FJX A;  1REV A;  1BI4 B;  1XHX A;  3VA0 A;  5DK5 A;  3ZSZ A;  3QNN A;  1RT3 A;  4Q5V A;  4FM1 A;  2RPI A;  1IKV A;  2YNG A;  3DM2 A;  5SWM A;  4F2S A;  4IKF A;  1J54 A;  3KKR A;  3KLI A;  3AVB A;  2ATQ A;  3KD5 E;  2XRI A;  1BCM A;  3QIN A;  4W5O A;  4KHN A;  4E19 A;  3OYK A;  4DS4 A;  2YHA A;  2P5G A;  3JSM A;  3WNH A;  1TKZ A;  4OKJ A;  4CHN A;  3SUP A;  1TK8 A;  1Z25 A;  1RT5 A;  4CFC A;  4LD0 A;  1RDD A;  3KD1 E;  3QEX A;  4KHU A;  4JRQ A;  2YHB A;  2O4G A;  2ZE2 A;  3LPU A;  1KVC A;  4E1M A;  4FM0 A;  4DS5 A;  3LP2 A;  1C0T A;  3QER A;  4KTZ A;  3HO1 A;  4B9S A;  4DLE A;  4M3Z A;  1NK4 A;  1NKB A;  3U6F A;  4CJL A;  4FZX C;  3AO5 A;  2BDP A;  1LW0 A;  3FFI A;  3LWL A;  1O1W A;  2HMI A;  3LAN A;  4LH4 A;  4PY5 A;  3OYB A;  4CF1 A;  3KK3 A;  4HUG A;  1SL0 A;  2HHQ A;  3UIQ A;  2X78 A;  3OS0 A;  3DLH A;  2D0B A;  3DYA A;  4K8Z A;  3QIP A;  2G8W A;  2DFF A;  1U04 A;  4OPJ A;  3TWH A;  4B9U A;  5KI6 A;  4FJH A;  1RDA A;  1VRU A;  1HYZ A;  5SZT A;  1GOA A;  3MEE A;  4DTN A;  3TAF A;  4KTQ A;  2A1R A;  3IAY A;  4B08 A;  3VQE A;  4G1Q A;  3VQ4 A;  4CJU A;  4J2A A;  1JXB A;  4CJK A;  3T1A A;  1RT2 A;  4BE1 A;  2OZM A;  3ZT1 A;  4CHZ A;  3OYF A;  1TGO A;  1CZ9 A;  3ZSR A;  5HRS A;  4FLV A;  4PWD A;  4HVJ A;  2FBX A;  4LSL A;  4B8A B;  1YTU A;  3AO3 A;  4OKK A;  1J5O A;  3HVT A;  4Z4I A;  4CJP A;  4TSX A;  5HRR A;  5EU7 A;  3NAE A;  2QKB A;  1RT7 A;  4F3T A;  4NYN A;  2F8S A;  3NH1 A;  4M41 A;  1S5J A;  4CEO A;  4FJN A;  3DOK A;  4H4O A;  3SUN A;  4FK2 A;  1F21 A;  4KV8 A;  1YT3 A;  3ZSW A;  3JYT A;  3THV A;  1NOY A;  3NBP A;  2G8H A;  3AO1 A;  4F8R A;  4NCG A;  4M3W A;  3M8P A;  3PX6 A;  4CF2 A;  2P1J A;  3SQ0 A;  4UQG A;  3K5M A;  2KFZ A;  2WOM A;  2VWK A;  4CEF A;  4IBN A;  4FLX A;  3V1O A;  3MAQ A;  1L3T A;  4B9V A;  3VQ5 A;  4CIE A;  3V6D A;  1KRP A;  3PX4 A;  2IOC A;  2OZS A;  2F96 A;  4QAG A;  3CFO A;  3PX0 A;  5CYM A;  4FK4 A;  1TAU A;  2RN2 A;  1VSE A;  4OLA A;  1W9H A;  3IG1 A;  5DMR A;  5K14 A;  3EZ5 A;  2E6M A;  4Z0U A;  3HT3 A;  3AO4 A;  5J2Q A;  1QSL A;  1GOC A;  3EYZ A;  3TAB A;  3KTQ A;  4QCL A;  1BL3 A;  1HYS A;  2KFN A;  4OGC A;  2PZS A;  4ELV A;  1VRT A;  1RT4 A;  4HUE A;  3SZ2 A;  4B9N A;  4B9M A;  1IKX A;  3M8S A;  1WSG A;  4FJJ A;  1WAF A;  4AIL C;  4DFK A;  4GVM A;  4O4G A;  3LAL A;  2YV0 X;  5I42 A;  2P5O A;  2PYL A;  3OYM A;  3NF7 A;  3OYA A;  3VQ9 A;  3SQ2 A;  1VSH A;  1S9E A;  4DFP A;  1KCF A;  1RBV A;  4FJ7 A;  2RKI A;  1K6Y A;  3K58 A;  3DRR A;  1ASU A;  1Y97 A;  3RWU A;  4CJV A;  1U48 A;  1KVA A;  4CEC A;  2VWJ A;  1LWC A;  3SQ1 A;  4W5Q A;  3K57 A;  3MXM A;  1TK0 A;  3ZCM A;  4DTJ A;  4DG1 A;  3ITH A;  4DSI A;  3DLG A;  3MEG A;  4DWI A;  3NFA A;  3IS9 A;  4LY7 A;  4RG8 A;  1JLF A;  4OGE A;  1EX4 A;  3DLE A;  4QOZ B;  4CEB A;  4JLH A;  4CHQ A;  1VSM A;  4DQQ A;  2HHT A;  1T05 A;  1ASW A;  1RDC A;  2Q3S A;  4CGI A;  4ZHR A;  4FJ9 A;  3U3Y A;  4M3Y A;  1BIU A;  4N5S A;  4O5B A;  3OJU A;  1SV5 A;  4E7I A;  4DTU A;  4ELT A;  1UWB A;  4W5N A;  3V1Q A;  3P83 D;  4CEA A;  3S3M A;  2HHX A;  4FW1 A;  3V9W A;  3CFR A;  4B8C A;  1ASV A;  3AVF A;  3RRG A;  4CHO A;  4I9Q A;  1C6V A;  3LP0 A;  4E7K A;  3AV9 A;  2Z1G A;  2LSN A;  3LP3 A;  3ZT4 A;  4DLG A;  2DFE A;  1RTI A;  3RTV A;  3S3O A;  3S3N A;  3HST B;  1RIL A;  2ZQB A;  3VQD A;  1S1V A;  3L8B A;  4HHT A;  4DU4 A;  5J2N A;  1EET A;  3TAR A;  3K2P A;  4NYF A;  4OVL A;  3OYE A;  5FRM A;  5D3G A;  4CJE A;  2IDO A;  3PY8 A;  1XWL A;  3ZT2 A;  1UOC A;  5FRN A;  1QHT A;  3AA5 X;  4CGJ A;  4KB1 A;  4E7L A;  3NCI A;  4DTP A;  1IO2 A;  3MED A;  4DF4 A;  1HRH A;  1SL1 A;  4EZ6 A;  1RBU A;  3NF8 A;  3NHG A;  1T8E A;  2IGI A;  2BAN A;  4NCB A;  3CM6 A;  1BI4 A;  2HND A;  5FDL A;  4IG0 A;  4DSF A;  1TKX A;  3AVL A;  3SUO A;  3NGI A;  4RW6 A;  3KK1 A;  1NK5 A;  2HHV A;  4E0D A;  1RTJ A;  1BIZ A;  1NK9 A;  2OPR A;  3AVH A;  3ASM A;  3HP9 A;  5FRO A;  3SPY A;  5HRN A;  2NUB A;  1KVB A;  4F3O A;  4KFB A;  3QIO A;  3OS2 A;  5C42 A;  4MQ3 A;  3K59 A;  3MXJ A;  3PO5 A;  2KZZ A;  3K5N A;  1YTA A;  4I2Q A;  4ICL A;  3VQ8 A;  4CK2 A;  4CJR A;  3OYH A;  5KRT A;  3AVK A;  4GMJ B;  3V9Z A;  4E1N A;  5CY4 A;  3MXI A;  3K5L A;  4DTM A;  3I0R A;  4KHS A;  4DTO A;  4DU3 A;  1JLE A;  3NF6 A;  4AHC A;  3DLR A;  1SKS A;  4CCH A;  4KI6 A;  3KLE A;  4WE1 A;  1R0A A;  3I0S A;  3AVA A;  1C1A A;  1L5U A;  4EP4 A;  1QTM A;  3HPG A;  2IS3 A;  4JRP A;  1BCO A;  4FYD A;  4AHV A;  2IAJ A;  4M3R A;  4CGG A;  1HQU A;  1Z26 A;  4KTW A;  4LH5 A;  1S6Q A;  3V1R A;  4CFA A;  2PY5 A;  2XY6 A;  4H4M A;  3O4N A;  2W42 A;  2KQ2 A;  4CFB A;  1ZBL A;  4DMN A;  2HVI A;  2G8U A;  1T03 A;  4KHQ A;  3G10 A;  4ID5 A;  3U3G A;  2QK9 A;  3CQ8 A;  1S1T A;  4KB0 A;  4ZTJ A;  1XC9 A;  2G8K A;  4FXD A;  4PQU A;  3MEC A;  2HHS A;  2XY8 A;  4DQP A;  4PUO A;  1VSF A;  3SUQ A;  3TAG A;  5CZ2 A;  5KGW A;  4HUF A;  1RTH A;  4CJS A;  3ZSX A;  2YNF A;  4DTX A;  4J2E A;  2EHG A;  2OYQ A;  4B9L A;  1S1W A;  1W0H A;  2A1S A;  3AVG A;  2ITG A;  3PV8 A;  2B6A A;  2E4L A;  2FC0 A;  4FCY A;  4ELU A;  2D5R A;  3NF9 A;  4CJW A;  4EP5 A;  3TR8 A;  4CER A;  4AH9 A;  4HCB A;  4AHS A;  4IFV A;  1BHL A;  4Z4F A;  4Z4E A;  4KRF A;  2KZM A;  3CFP A;  3OVN A;  3C95 A;  3V9X A;  1A5V A;  4DU1 A;  4C8N A;  2FBV A;  4BAC A;  3CYM A;  3VQB A;  1TVR A;  3C94 A;  1S1X A;  3OJS A;  4DQS A;  1L3V A;  1L3U A;  2IC3 A;  4CJ5 A;  1TKT A;  1KFD A;  3AA4 A;  4N56 A;  5CYQ A;  1TK5 A;  4M3T A;  4IFY A;  4DTS A;  4Z4H A;  4KAZ A;  2GUI A;  1ZBI A;  1U4B A;  3H08 A;  1CLQ A;  1XHZ A;  3TAN A;  5HBM A;  1BQM A;  1DTQ A;  2HNY A;  1EXQ A;  3B6P A;  1C0U A;  1QS4 A;  4CGD A;  1FKO A;  3OYD A;  3SV4 A;  1NKE A;  2Y1J A;  3V81 A;  1NK0 A;  2OPS A;  4CJQ A;  4CFD A;  3SPZ A;  1TKD A;  1RT1 A;  1HYV A;  1JLC A;  1C1B A;  1D8Y A;  4RW8 A;  4CF9 A;  1Q8I A;  4OJR A;  3SCX A;  4B3O A;  5HLF A;  1FXX A;  4CK1 A;  1X1P A;  4DSE A;  4FLZ A;  3CM5 A;  2HW3 A;  4FK0 A;  4M42 A;  5J1E A;  3VA3 A;  2HNZ A;  3VQC A;  1U47 A;  1WSH A;  2YKN A;  1KTQ A;  3O3F A;  1VSD A;  2RF2 A;  4M3X A;  1WLJ A;  1X9M A;  4DSJ A;  4Y1D A;  3L2R A;  1WSF A;  2Z1H A;  4O0I A;  2D0C A;  4W5T A;  3RR8 A;  1NJW A;  1TL1 A;  4CHP A;  2HHW A;  5CZ1 A;  1SKW A;  1NK6 A;  1CXQ A;  1SKR A;  2XY7 A;  1DTT A;  4MFB A;  4FJM A;  4CJT A;  4IG3 A;  3RMC A;  3AA2 A;  4JS5 A;  2KTQ A;  2ETJ A;  3OYJ A;  3VQ6 A;  3WNG A;  2OPP A;  1MU2 A;  3NH2 A;  5HP1 A;  5C24 A;  3LPT A;  4FLT A;  1VSJ A;  4K8X A;  4R5P A;  3QET A;  4CGH A;  2D0A A;  4N41 A;  1NJX A;  3V9U A;  4CE9 A;  3QNO A;  5J2M A;  2GBZ A;  4OLB A;  3HL8 A;  4DSL A;  2G8I A;  2QXF A;  1NK7 A;  1DLO A;  2WON A;  1NKC A;  2FBT A;  4KI4 A;  3AVM A;  1U49 A;  1JL2 A;  1HNI A;  1WSE A;  1WAJ A;  5J2P A;  2DTU A;  3IRX A;  2XHB A;  3RRH A;  3PO4 A;  4FJ5 A;  1QE1 A;  2HHU A;  3SV3 A;  4RW7 A;  4DSK A;  4O0J A;  3LZJ A;  3LP1 A;  3O4Q A;  1Q9Y A;  3F73 A;  2R7Y A;  4BE0 A;  2BE2 A;  4FM2 A;  2GV9 A;  2AJQ A;  1L3S A;  4RW4 A;  3AO2 A;  4CF8 A;  3ULD A;  1CXU A;  1ITG A;  1LAW A;  1T7P A;  3ZSY A;  1TAQ A;  4FLW A;  1VK0 A;  4FJK A;  2B4J A;  4GW6 A;  1JL1 A;  4CJF A;  4C8O A;  3DOL A;  3L2W A;  4FVM A;  4ZTF A;  2OA8 A;  4CIG A;  1J53 A;  1WSI A;  4HTU A;  2G8F A;  3T3F A;  4DQI A;  2HVH A;  4DFJ A;  1G15 A;  3CG7 A;  1JLG A;  3P1G A;  3BGR A;  4BDZ A;  3AVC A;  3TI0 A;  1B9F A;  3LWM A;  2YNI A;  3HPH A;  4FJG A;  2X6S A;  2B5J A;  5JS1 A;  1HNV A;  4CEZ A;  1KFS A;  3NE6 A;  4RW9 A;  3LAM A;  1HJR A;  5C25 A;  4E7J A;  4CGF A;  4I9L A;  1S1U A;  3L2V A;  3SNN A;  2E6L A;  4J2D A;  1A5X A;  4F2R A;  3NGZ A;  3KJV A;  2P51 A;  1UA0 A;  3C6T A;  1LWE A;  1I3A A;  3HVR A;  2VG5 A;  3RMB A;  1KLM A;  1D9F A;  1YVU A;  3AVI A;  1SL2 A;  3DLB A;  3LDS A;  1LV5 A;  1CZB A;  3L2U A;  3EY1 A;  1RNH A;  3O3G A;  4AHT A;  1TL3 A;  4CED A;  3QEI A;  3S9H A;  1D9D A;  4C8L A;  4NCA A;  3L3U A;  4KKO A;  1NJZ A;  4L8R B;  1UA1 A;  3RR7 A;  3KK2 A;  1BIS A;  1RCH A;  1SUQ A;  4M3U A;  2DFH A;  2I5J A;  1KLN A;  3M8Q A;  3BDP A;  3TAQ A;  3DMJ A;  3KIO A;  4CES A;  3DI6 A;  1FKP A;  4M45 A;  4Z4C A;  3LZI A;  3KLG A;  4FJ8 A;  3DRS A;  3D45 A;  4XIU A;  4FZY A;  4CEE A;  3WNF A;  3NDK A;  2VG6 A;  3QEV A;  2QKK A;  3I8D A;  4DTR A;  2FBY A;  1HQE A;  1WNS A;  3ZSV A;  4FLU A;  1ZBF A;  1JXE A;  4FLY A;  4E7H A;  3VQA A;  4E89 A;  3HJF A;  3SJJ A;  3OYG A;  1S9G A;  4HCC A;  1RTD A;  4Q0B A;  2JGU A;  4AHR A;  4OPK A;  1RBS A;  4BWJ A;  5HRP A;  1FK9 A;  3RMA A;  2YKM A;  1QQC A;  1U45 A;  4BDP A;  1ZBH A;  3VN5 A;  3ZSO A;  4FZZ A;  3LAK A;  1VSK A;  3TAM A;  3HK2 A;  5E41 A;  4KPY A;  3RMD A;  2XO7 A;  1KSP A;  4I2P A;  1IKW A;  1JKH A;  4KO0 A;  1QSS A;  4FJL A;  5JS2 A;  4PA1 A;  3P5J A;  3QO9 A;  3TAP A;  1X9W A;  1X9S A;  1J9A A;  1TV6 A;  3AVJ A;  4AHU A;  1IKY A;  3A2F A;  4LSN A;  4CHY A;  3OY9 A;  1NJY A;  1C1C A;  4BWM A;  3KLH A;  4KHW A;  1UAX A;  3QLH A;  5I3U A;  3OYL A;  3C6U A;  1JLB A;  3KLF A;  2Z1I A;  2PYJ A;  2DY4 A;  3DRP A;  5KTQ A;  2HB5 A;  1RBT A;  4JS4 A;  1QSY A;  4B9T A;  3ALY A;  2BGG A;  1LWF A;  3VQP A;  3V9S A;  3OYI A;  4F4K A;  4Z4G A;  3OS1 A;  1D5A A;  5HRO A;  4W5R A;  3M8R A;  1JLA A;  3SYZ A;  4Y1C A;  4J2B A;  4I7F A;  1EKE A;  4C8M A;  3OYN A;  2G8V A;  1C0M A;  4CJ4 A;  4C8K A;  4KHY A;  2KW4 A;  4O44 A;  1B92 A;  2EX3 A;  4E3S A;  1LAV A;  4EZ9 A;  1VSL A;  2X6N A;  3VQQ A;  1NOZ A;  4IDK A;  4CK3 A;  1IG9 A;  3HYF A;  1Q9X A;  3HP6 A;  1RDB A;  4DQR A;  3PUF A;  4FJI A;  1HPZ A;  4N47 A;  3NH0 A;  3F9K A;  3ZT3 A;  4FW2 A;  2Y1I A;  1JLQ A;  2OPQ A;  5T7B A;  1LW2 A;  1I39 A;  4OKE A;  2X74 A;  3HM9 A;  3D0P A;  3L3V A;  3V4I A;  3WNE A;  1EP4 A;  3AA3 A;  1ZYQ A;  2YNH A;  2XY5 A;  1XI1 A;  3KKS A;  2F8T A;  3O3H A;  1N6Q A;  4DF8 A;  5KGX A;  3HPO A;  1RT6 A;  2ZD1 A;  4KRE A;  1HMV A;  1A5W A;  3AVN A;  4O55 A;  3SQ4 A;  3NGY A;  1ZBU A;  4CEQ A;  4CIF A;  1N5Y A;  4CF0 A;  3QES A;  3QEW A;  4CJ3 A;  1VSI A;  4BDY A;  3DLK A;  3L2Q A;  3SI6 A;  4DFM A;  4H8K A;  1BGX T;  3B6O A;  3E01 A;  1BQN A;  4N76 A;  2VG7 A;  2O4I A;  3G0Z A;  2Z1J A;  1WSJ A;  1B9D A;  1GOB A;  5KRS A;  4YNQ A;  3K5O A;  1IH7 A;  3HXM A;  4BE2 A;  3T19 A;  3QEP A;  3ISN C;  1WN7 A;  2JLE A;  1S6P A;  3ZT0 A;  4ID1 A;  4YFU A;  1RBR A;  1NK8 A;  3OYC A;  3VQ7 A;  3TAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...