4LSNA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 131
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lsnA05
2HNZB 4J9QA 2XHBA 3OYMA 3I5BA 4KSEB 4RG8A 1SV5A 4X2BA 2FLNA 3AO4A 4FK4A 1D5AA 1IKWA 2XGPA 3VQPA 3UR0A 4LSNB 3MAQA 3Q8QB 4FM1A 4I2QB 3RMAA 2EHGA 2HHTA 3QEIA 4RNMA 2D3ZA 1S6PB 4DU4A 3ZT2A 3VQ4A 3H5YA 1S5JA 3N6NA 2IM3A 4LQ3A 4Y34A 3RR7A 2ATQA 2RN2A 4W5TA 3GQCA 5KT7A 2A1RA 1REVB 3CIZA 5F9NA 3K57A 3N6MA 3AVFA 1C1CB 4FK2A 1RT1B 4HTUA 4B9NA 3VQQA 4FLTA 4BDPA 4CJTA 3ISNC 2BQUA 4KHYA 3V9ZA 1RAJA 3KK3A 2W42A 3DI6B 1RTDA 3RWUA 5KTQA 1JLCB 4NCGA 1CXUA 3RTVA 3ZSRA 2W8KA 2ZKUA 4KTZA 1EP4A 4CFDA 2JC0A 2RKIB 4JRQA 4ID1A 2R8JA 4N5SA 3DRSA 3IRXB 3NH2A 4LSNA 3CYMA 4Z4GA 4CEFA 1I6JA 2EC0A 2YKMB 4DG1A 4KI4A 5I3UB 4MFBA 3B6PA 3VA3A 1S1XA 3FQLA 3HKWA 2HB5A 3VQ9A 4NCGB 5HP1A 4F4XA 3FSIA 1L3TA 2JLEA 4CEZA 3Q8SB 2DFEA 5DQGA 4TY8B 3M8SA 1N5YB 1S0NA 4CGJA 1N48A 3KJVB 1C6VA 4YR3A 4BWJA 3NKYA 4CFBA 4B9MA 4NLGA 1YTAA 4IFYA 4DL3A 4LSLB 3HO1A 3QYYA 4URQU 5HBMB 4RNOA 2B5JB 2XC9A 1QHTA 4J2AA 4IOBA 1TP7A 1U09A 3G6XA 2DFFA 1ZBHA 1JL1A 3CJ0A 3E51A 4EYHB 1SH3A 1S1WB 2D0AA 4PWDA 4LSLA 1G15A 3HM9A 2HMIA 4WZQA 1JLFB 2WTFA 4ZP9A 5KT2A 1HQEB 5EUHA 1S0MA 1O1WA 1CLQA 4TQRA 4PY5A 4IH7A 4NYFA 1S1UB 3KHGA 3NGZA 1DTQA 1LWEA 3D45A 4H8KA 4KKOA 5KFCA 1EXQA 4ELTA 4WE1A 3NH0A 4DLEA 3NCIA 3QLHA 2R8IA 5JS1A 4O3OA 2FBXA 1Q9XA 5KI6A 4CJRA 3MR6A 4ICLA 3Q8PB 4FJMA 3T1AA 4N76A 3ZCMA 4CECA 1UAXA 3BQ2A 4QPXA 1RT1A 1A5VA 4W5NA 1JLEB 2W9BB 2E6LA 4HVJA 1S1WA 3CO9A 2V4QA 4DTJA 1UWBB 4EZ6A 2VG6A 3SUQA 2GC8A 4DL2A 5KFLA 1TVRB 1S1VB 5L1JA 2FBVA 4JRPA 1RT7A 1WN7A 2JC1A 3ZSZA 3ZT3A 1EX4A 1VK0A 3LPTA 3QLHB 3U6FA 4KAZA 2XY6A 3KIOA 5I42B 3QZ8A 4I2PB 3V9XA 3LP1A 4HUGA 4DG1B 4WE1B 4KHRA 4OJRA 4W5OA 1BI4B 1KLNA 2HNZA 4DTMA 3BSAA 2QK9A 1QE1B 1J5OA 2YNFB 3H08A 3P5JA 1IKVA 3DRRB 1NK4A 1RBVA 5FDLB 5F8LA 4YMEA 1RBTA 1U49A 3OYJA 3GV7B 2QKKA 3I0SB 2XY8A 3DMJB 1RTJB 4B9SA 4FJLA 3MFHA 2W9AA 4DQIA 3DLGA 4KB7A 3ZT0A 1FKOA 4IFYB 4ECQA 3PVXA 3OS1A 4KPYA 3QO9B 5CYMB 1SL2A 2VWJA 3D0PA 3AVLA 1HMVB 4NCBA 4KB1A 1ASWA 3PZPA 1K1QA 5F9LA 3DLEA 1RILA 1RT2A 3IAYA 2O4IA 3KD5E 4O0JA 1C0UA 5F8GA 2IM2A 4KO0B 3S9HA 4WZMA 1QUVA 1LW2A 4ED1A 4Y2AA 4CEBA 3H4DA 3HP9A 4YNQA 4ED7A 4KV8B 4O4GA 1XR6A 3L3VA 2HHXA 3ZSYA 3LZIA 1B92A 1HNIB 4FK0A 4CEAA 4J9NA 4K4YA 3EPGA 1TL1A 1LW0A 3CFRA 4E7LA 4ED3A 1EKEA 3V6JA 3L8BA 2WOMA 1X9WA 4E7JA 4DMNA 3UDLA 3NAEA 3MR2A 5K14A 5C24B 4CHZA 3E01B 3NAHA 4C8LA 4Q8FA 1GX5A 4FJ7A 2QE5A 2IS3A 2C28A 3MR3A 1NK5A 4B8CA 3VQSA 1LWCB 1C1CA 4NYNA 4TSXA 5HLFA 3CG7A 4KE5A 4N47A 3KKSA 1RT5B 3LAMA 4M3RA 3RBEA 4M45A 3PV8A 2KFNA 1BCMA 1I3AA 3LWMA 2HHSA 3SUPA 3V1RA 1TK5A 3BSCA 3PO5A 4CGHA 3L2QA 1TKZB 3WNGA 3TARA 2AWZA 1DTQB 4DTXA 2PZSA 4JLHA 4Q0BB 3VA0A 1HQEA 1RT5A 1S9EA 5JS2A 3AVKA 4QAGA 5HRSA 4Z4FA 2HWIA 4AHCA 4NLXA 4FJHA 3SNNA 3H5UA 1HRHA 4IG0B 3KOAA 3S3MA 1KLMB 3FRZA 3NMAA 4CJKA 2BRLA 3M8RA 3OVNA 2HVIA 1HYZA 3RB6A 5J2NB 2RDJA 5KFKA 4IBNA 3NFAA 4IH6A 4Q45A 4IDKA 3MFIA 3K5OA 4L8RB 2NUBA 1TVRA 2HHUA 1U04A 3QIOA 1S6PA 2KW4A 3AA2A 4FJXA 4NZ0A 2KQ2A 1BIZA 4MIAA 4M41A 1RCHA 1TAQA 5KFPA 3OYIA 2OPSB 2IAJB 5SZTA 1C1BA 4ECTA 4QW8A 1J53A 1IG9A 2Z1HA 5KG4A 4ECSA 3GV5B 1VSKA 3NBPA 1JLFA 4BDYA 4RW9A 4CJVA 4Y1CA 3RB3A 4KKOB 3DLRA 1WSGA 2CKWA 2FBYA 3M8QA 5J2PB 4I9QA 1Z4UA 1LWFA 2UVRA 3QEXA 2ZD1B 4NLUA 2OPRB 4AHTA 3AO5A 4ELVA 3ZSOA 1R0AB 2FJWA 1QSYA 2W7OA 2OZMA 3GIKA 3M9NB 4EEYA 1WLJA 3ZSWA 3H40A 5KT4A 1JL2A 4CEQA 4ECVA 5KFEA 2P5OA 1S9GB 3OSPA 4KI6A 4K4XA 3DRPB 4EBDA 1XHZA 4U7CA 1RA6A 4ID5A 2ILZA 2ZQBA 4F2RA 1BIUA 1NNDA 4TXSA 1BQMB 3HPHA 5HP1B 4O3SA 1IKYB 5C25A 3L2RA 5F8MA 1WSIA 5E41A 5CYQB 2FC0A 4E1MA 1U48A 2E9ZA 4H54A 5KG5A 2W7PA 1S1XB 3CJ3A 3TAMA 5C42A 4OLBA 2ZE2B 4O3QA 4ED2A 3PR5B 3D5MA 3C6UB 4TYBA 3QIDA 3MTKA 3OHAA 5J2MA 5KFDA 1S6QB 5J2NA 1JLAB 3G10A 2D41A 1U45A 3KLHA 1RNHA 3ZT4A 1RTIB 2D0BA 3PHEA 3ASMA 5L1LA 3CFPA 1DTTB 1YTUA 3TVKA 4DTUA 2WB4A 4N56A 2G8KA 2XI2A 4KRFA 4TYAA 1IKXB 4CJSA 2F8EX 3I0SA 3HYFA 3OL9A 2X78A 3OYFA 2C2EA 5FDLA 2W8LA 3HXMA 2QXFA 4KREA 3SV4A 3AVAA 3VQEA 1N4LA 1S4FA 1NJYA 1ZBIA 2RF2A 4ED0A 4TN2A 3PX0A 1HQUB 4FS2A 3NAIA 4E7HA 3QGIA 3DLEB 1N6QB 3NGYA 4Z0UA 1NK8A 1T8EA 1WAJA 3V1OA 2YHBA 4K4UA 3HSTB 2GIRA 4E7KA 3EY1A 3BQ0A 4I7FB 5J1EA 5DG7A 3DLHA 2FVCA 1HYSA 3BQ1A 4K8ZA 3DYAB 1Q9YA 4OGCA 4IG0A 2DY4A 5J2PA 1IKXA 2WRMA 3MECB 3A2FA 4OL8A 3HVAA 4FLVA 2FJVA 2ITGA 4W5RA 5JUMA 1KLMA 4QWCA 3V6HA 3T5KA 4CJFA 3V1QA 3H2LA 1JXLA 1TL1B 4F4WA 3QINA 1JKHB 4LQ9A 2F8TA 4WFYA 1BQMA 3V9UA 1OS5A 3OS2A 1NJXA 2YKNA 2IC3A 1ZBFA 3U3YA 1A5XA 4Z4CA 2RKIA 4ZMMA 1JLQA 2E6MA 3AO1A 4CGDA 1GX6A 5KG0A 5EWEA 2OPQA 3S3NA 4KHQA 4JS4A 4O44B 1EETB 3MEDA 3TAEA 4IFVA 4WYLA 5KFOA 5KFXA 3QEWA 4ED6A 3SUNA 4C8KA 2B6AA 1C2PA 4F2SA 4TY9A 3NF8A 1LWFB 1TKTA 2DPJA 1KVBA 4DSFA 4JS5A 2Y1JA 4CK2A 4CJEA 1XI1A 2VG5B 1DLOB 4G1QA 5HRRA 2W9CB 1TKDA 4O4RA 1IKWB 3PJXA 2P51A 3CWJA 4CERA 3EYZA 1MU2A 4DFKA 4FJJA 2V9WA 4GW6A 2LSNA 1BHLA 4B8AB 4MKAA 1BQNB 4QOZB 3KLEA 2PYJA 4AHSA 1D8YA 4C8NA 4ZHRA 3UIQA 4XO0A 5DG9A 4CF1A 3KHRA 3THVA 3DYAA 1BGXT 2KTQA 3HHKA 1S9FA 4EP5A 3HVTA 3LP2B 3DI6A 1RTDB 1RDRA 3H5SA 4J2BA 2YNHB 3MECA 1HMVA 4NLWA 5EDWA 1JX4A 3CVKA 2DFHA 3KLHB 4FVMA 1TKXB 1VSEA 3RAXA 3DLGB 4ZVFA 1LAVA 1NK9A 3HVTB 3LP2A 4CJQA 4DSKA 1C0TA 4EBCA 1S9EB 3IS9B 4KHMA 2YNIA 5EWGA 4AHRA 3GYNA 4QWDA 4NRUA 2WCXA 1QAIA 3EPIA 3AO2A 1ITGA 4OPKA 2YNGA 3K5NA 3KLEB 3QZ7A 2UVWA 4O0IA 4B3OB 3O4QA 3ALYA 3V9WA 3CJ2A 1ASVA 3ICLA 1S97A 4J9RA 2C2RA 4M42A 3QNOA 5DGBA 3LP1B 1B9FA 3PX4A 1TGOA 3BSOA 1LW2B 5SWMA 3PW5A 1NKBA 4Q5VA 2FJXA 4KTQA 2ALZA 1L5UA 4RW4A 3PW4A 2OPQB 2AGQA 4F4YA 4YR0A 4I7FA 4DSJA 4I9LA 3V6KA 5HROA 3KHHA 4PUOA 2D0CA 1HJRA 2UVVA 4IFVB 4M3UA 3OLBA 2O4GA 4DFMA 5C24A 3CM6A 4F50A 4LY7A 4M3XA 5KFIA 2KFZA 3MEGA 2HVHA 3BDPA 4DTOA 2R2UA 1RT4A 3MXMA 3KHLA 3JSMA 4M3WA 3SJJA 1SH0A 2AJQA 3K5LA 4LD0A 4TY8A 3JYTB 2XI3A 1GOBA 4Q43A 3QESA 5EWFA 4CEDA 3L3UA 3MEGB 1SUQB 3V81A 2JEFA 4DTSA 4DTRA 2HNDB 2X6NA 1SKWA 4Y2CA 4MQ3A 2R8GA 4DU1A 4DSIA 1VSDA 4J9MA 4R5PB 2KZZA 2IA6A 1S9GA 3T5JA 1S1VA 1WSFA 2EX3A 2XRIA 4J9LA 4OPJA 3SYZA 4FJ8A 1REVA 4Y1DA 2OA8A 2ASLA 3SFUA 4FW1A 4CIGA 4E1NA 4CHYA 1XR5A 5CY4A 4CGFA 2ATLA 1RT7B 1CXQA 4Z4IA 3QERA 4HCBA 4EP4A 3AV9A 2AX1A 3VQAA 1TV6B 4O44A 4NRTA 5HRPA 2FLLA 4KTWA 3AO3A 2BDPA 4ZPCA 3NGIA 3KLFA 5C42B 1TK8A 1NJWA 2YNFA 3N6LA 1QQCA 3SPZA 4YFUA 3D28A 3QGGA 3T19A 3HT3A 1FK9B 2IAJA 3GV8B 4E3SA 4RW6A 1C1BB 5I3UA 4B3OA 2W9CA 5KFSA 4KAIA 4NLTA 3DOKB 3V4IA 3OYHA 2UVUA 1RTHB 5C5JA 1LWCA 2DPIA 1Q8IA 4NLVA 3UQSA 4ZP8A 4YQWA 1JLCA 2UUWA 2XY7A 3CFOA 4FYDA 4FLZA 2OH2A 3SV3A 5KFMA 3SI6A 4NYZA 4PQUA 3QEVA 4CJ5A 2WK4A 3AVHA 2XCPA 3LANA 4ZVEA 5D3GA 3K59A 1RTIA 3CQ8A 1ZYQA 4KV8A 3OYLA 4I2QA 2YNHA 1B9DA 4IRCA 3AVGA 3H5XA 5KFZA 5KFBA 1EETA 5FRNA 4FJ9A 4K4TA 5C25B 4DU3A 1UOCA 4FZXC 3NH1A 4FXDA 3IGVA 4Q44A 4J9OA 1YVFA 4RNNA 2V0NA 3KJVA 2BR0A 3P1GA 4CJ4A 3OLAA 4RNFA 1JLBB 5KFTA 4DFPA 3O3GA 3OHBA 4RUAA 4WYWA 1X1PA 3IS9A 4MH8A 3SQ0A 3KKRA 2HW3A 3OYKA 3QETA 1RTJA 3M8PA 4MK8A 3RR8A 3MXIA 4CJWA 3IG1A 1KHWA 1KFSA 4R8UB 1S0OA 3LZJA 4QWAA 3G6VA 2ASDA 1SL0A 2I5JB 3NHGA 4IG3B 3I5CA 3PJWA 4HUFA 3CDEA 1S10A 4CIEA 5HROB 1NK7A 4Q0BA 1J9AA 3QNNA 3SI8A 4J9SA 4KBIA 1K6YA 3T3FA 1NK0A 3LAKA 4MFBB 1TQLA 4CGGA 5DGAA 4OLAA 1L3VA 1W9HA 3JSMB 2R2RA 2XCAA 4ZP7A 3NE6A 4I2PA 2P1JA 1FKPA 3VQDA 3MR5A 2Z1GA 4CK3A 4CHOA 1KTQA 1RT6A 1BCOA 5F8IA 4CF9A 4E89A 3AVNA 4CIFA 4H4OB 2B43A 2YNIB 2B4JA 4IG3A 3T5LA 2FVRA 5FRMA 1YVUA 1CSJA 2BANA 1IM4A 3SFGA 4IR9A 3TAMB 3M9MB 5DQHA 1T94A 4F4ZA 3FQKA 3V6DA 1T03B 1NKCA 4H4OA 1RBUA 4H4MA 3OL8A 4FJIA 4ZVGA 4PA1A 1L3SA 1TKZA 1WNEA 4WFXA 2X6SA 4XPCA 1KHVA 1U47A 1FKPB 3C6UA 2YKNB 4IR1A 4DL4A 2AGPA 1C0UB 4K4VA 1HNVA 2FLPA 5HRNA 3U3GA 4AHVA 5KFQA 3CDWA 3HVWA 4QWEA 5DMRA 4URGA 3OYDA 1VSJA 3G0ZA 1JIHA 3P83D 2D3UA 4IRKA 1ZBUA 4QCLA 4KO0A 2D5RA 3IN5A 1UWBA 3ZSVA 1HARA 3OYCA 1SV5B 4CJUA 3DM2A 3I8DA 4NCAA 4M3TA 5KFGA 2J6UA 4F3OA 4KHSA 5KFFA 3AVCA 3KD1E 2BE2A 3HL8A 5CZ1A 2B5JA 1VRUB 2G8WA 1RYSA 1KVAA 2I5JA 4F4KA 1XC9A 4B9LA 5KGWA 3DLKB 4FJNA 3DMJA 1C1AA 1WSEA 4CHQA 3HPOA 4NLDA 2BRKA 2G8VA 3MEDB 4U6PA 2E9TA 4FBTA 5F8HA 1EP4B 4DL6A 1VRTB 3L2WA 3NF9A 3TAQA 3VQ8A 3PO4A 1N56A 4XIUA 4C8OA 4RW9B 1KRPA 1L3UA 3BJYA 4FCYA 1IH7A 3GILA 4GVMA 2IMWP 1LWEB 2YNGB 1A5WA 3QO9A 3QIPA 4NLPA 3IGNA 4HYKA 3GIMA 4JUZA 2KZMA 2J6TA 2JEIA 4BDZA 4CEEA 5DK5A 5KG3A 1S1TB 3OSNA 3C6TB 3MEEB 4DQSA 1VRUA 2CJQA 4LH5A 1DTTA 5DQIA 3QEPA 5J2QA 3BREA 1N5YA 3M8PB 4URSA 1T3NA 4WXOA 3RB4A 3OJUA 5HBMA 1RT3B 3S3OA 4M3ZA 4TQSA 3DOKA 3V4IB 3SCXA 2G8UA 3ZT1A 5DLGA 1T05B 2WOMB 3IG1B 1ZETA 1SKSA 4LH4A 5F8NA 3OJSA 3BR9A 1D9DA 2R2TA 4OKJA 1QSSA 5KRSA 1ZTWA 1RTHA 5CYQA 3ISND 4ECRA 5J1EB 4O3RA 5KG1A 4K8XA 2F8SA 3HJFA 3NDKA 5I42A 1J54A 4J9KA 2HHVA 4NLYA 2RPIA 3MXJA 2HMIB 1SL1A 3PW7A 1DLOA 1W0HA 1YT3A 3DDKA 1TK0A 5HLFB 3K5MA 4JV0A 3B6OA 4HUEA 3MF5A 4BE0A 4Z4EA 4BWMA 1RDBA 2IOCA 4AH9A 3SPYA 4EO6A 4ZVHA 1XR7A 2BGGA 1NHVA 4RNHA 3C94A 2R8HA 1HPZB 4G1QB 3T5HA 4EZ9A 4FLUA 3RBDA 1RT3A 2WHOA 3L2UA 4GMJB 3PUFA 5KFWA 1NK6A 2OPRA 3VQ6A 4YR2A 1SKRA 4AILC 4FLXA 3I5AA 2PYLA 4DSEA 3M8QB 1BQNA 1CZ9A 1WNSA 4F3TA 4NLSA 1RDAA 4N41A 1JLEA 2W9BA 3UPFA 4RW8A 4NLOA 3JYTA 1JKHA 1JLQB 4O3NA 2YHAA 4ZHRB 4OVLA 1JXEA 2WONA 4WXWA 2HNYB 1TL3B 3BSNA 5KFVA 1SUQA 3LP0A 3TQ1A 1NKEA 5JXSA 1QAJA 4NLRA 4ECZA 2VA3A 4AHUA 4CK1A 3NF7A 4PWDB 2R8KA 1C0TB 2UUTA 2JGUA 4H4MB 3TAFA 4IKAA 2R2SA 4M3YA 1RT4B 1TKXA 4DTPA 3MEEA 3KK1A 1NOYA 1Z25A 2C22A 3WNHA 5KG7A 4NLQA 1GOAA 2V4RA 4KFBB 4IDKB 1C0MA 2X74A 2DTUA 1Z26A 3NBPB 3GIJA 3PW2A 5KFJA 4IH5A 5J2QB 2G8FA 2O5DA 2G8IA 3E01A 4KHWA 1LAWA 3DM2B 5KFAA 4FM2A 2OPSA 4DLGA 3LPUA 4R0EA 3CJ4A 3OYAA 5KFRA 3HP6A 1JLBA 4CEOA 3KLIB 4DWIA 4G3IA 4ECXA 2IC3B 2AGOA 4FJ5A 4M95A 5KT6A 2JEGA 3HK2A 3DLKA 3AVBA 3NF6A 4O4GB 1SH2A 2YKMA 2BQRA 2AU0A 4RW7A 1CZBA 2JEJA 4XPEA 3KLIA 5F8JA 3TANA 3QGHA 1BI4A 4B9TA 4DEZA 3F9KA 1VSHA 4B9UA 4TLRA 4M94A 2GBZA 4FLWA 1HYVA 4CCHA 4ED8A 4W5QA 3RMCA 1HPZA 4GC6A 3ULDA 1X9MA 3DLBA 5KFNA 5KRTA 2P5GA 3EZUA 4RZRA 2F96A 4C8MA 2IDOA 3KLGA 1KCFA 3RRHA 1VSIA 4F8RA 1T7PA 3CJ5A 3DOLB 2IJNA 1IKVB 3DRRA 2HWHA 1RBRA 4RUCA 3RAQA 3PY8A 1TL3A 1UA1A 2YV0X 3OYNA 4QW9A 3TWHA 4FS1A 1KFDA 2E4LA 2XY5A 4CF0A 4Q8EA 1KSPA 1BISA 4RU9A 4ICLB 3EZ5A 4QWBA 2QV6A 1NHUA 5KFYA 3AVIA 3LP0B 4HKQA 4MIBA 2Z1JA 1RT2B 3ITHA 4CE9A 3V9SA 1TV6A 4FLYA 2GV9A 3OYGA 2ILYA 4E0DA 2IM1A 1UA0A 4GC7A 4ECWA 4O55A 4Y3CA 2G8HA 1VSFA 4DS4A 3KK2B 3QIPB 4K4WA 4O3PA 4DQPA 4R8UA 2B6AB 3OYEA 3O3HA 4HHTA 1LW0B 4E7IA 3VQBA 3M9OB 1HYSB 2GIQA 2OZSA 4CGIA 2I1RA 1S1TA 1NOZA 1U4BA 2ETJA 5T14A 1ASUA 3V81B 3KMQA 2FBTA 2OPPB 4KHUA 3O4NA 4ZPBA 3SQ4A 4ID5B 4EBEA 3TABA 3O3FA 4ZTJA 4WFZA 1QSLA 4J2EA 1GOCA 4BE1A 3WNFA 4J9PA 1RDCA 1IKYA 4ZTFA 4EO8A 4DTNA 4PQUB 1MU2B 3Q8RB 1TKTB 3KK3B 5KG2A 3AVJA 4IQXA 1S1UA 2HNYA 3KLVA 3H98A 4JV1A 5L9XA 2BE2B 4FZYA 2RDIA 3LP3A 4PUOB 3HPGA 4CF8A 1RT6B 2E9RX 4FW2A 3VN5A 3GIIA 5J2MB 4KFBA 4OKEA 4MKBA 2XO7A 2FVSA 3NGDA 2ZD1A 4KHNA 4CHNA 3CM5A 3KK1B 1R0AA 3TI0A 3PR4A 4IKFA 4IRDA 4DFJA 1RDDA 3TAPA 3G6YA 1HNIA 1LV5A 4FJGA 3VQ5A 2RF2B 1XWLA 1WSHA 3OY9A 1RA7A 2VA2A 2AX0A 2PY5A 4CHPA 3KMSA 1KVCA 3V6DB 3DRPA 1VSMA 2BQ3A 5CZ2A 1HNVB 2Q3SA 3PX6A 1S48A 2HAIA 3VQ7A 1D1UA 3WNEA 4CJ3A 2D7SA 2QKBA 1VSLA 5K14B 5KFHA 4J2DA 1FXXA 1D0EA 2XGQA 4CJLA 3KTQA 5KFUA 4E19A 5CYMA 4DS5A 4RW8B 1K1SA 2HHQA 3KK2A 4R5PA 5D3GB 1S6QA 2Y1IA 4DQQA 1T05A 1QS4A 2OYQA 4ECUA 1F21A 4CESA 4DSLA 4CFAA 4DF4A 4ELUA 3PW0A 3TAGA 4K4ZA 2IM0A 2VG6B 3H59A 2C2DA 2IJFA 3VQCA 2Z1IA 2R7YA 3FDSA 4MK9A 4BACA 4RW6B 4FZZA 1ZTTA 4UQGA 3KLGB 3I0RB 1NJZA 1X9SA 2HHWA 2J6SA 1T03A 1Y97A 2ASJA 4FM0A 1D9FA 3K58A 4FJKA 4MK7A 1QTMA 4OKKA 5FROA 5L1KA 1XHXA 3RMDA 3SQ1A 1VRTA 5T7BA 2IBKA 1WSJA 1I39A 4DF8A 1JXBA 5KGXA 4ECYA 3CDUA 5EU7A 3SUOA 4K50A 3FFIB 2HNDA 1W25A 2VG5A 3HVRA 4DQRA 1ZBLA 3KNAA 4ZPDA 2ZE2A 4YP3A 3F73A 2FVPA 3AA3A 1BL3A 3OS0A 2IGIA 4CF2A 5L1IA 3LWLA 1JLAA 1QE1A 2VG7A 4K4SA 5DLFA 3C6TA 3OL6A 1JLGB 3DRSB 3IRXA 4RW7B 3G86A 2XWYA 3RB0A 1S49A 3ZSXA 4ZP6A 3I0RA 3BGRB 3KLFB 4HCCA 3AVMA 1WAFA 4FBUA 2VG7B 2WONB 3LDSA 3K2PA 1JLGA 3SQ2A 2VWKA 3RMBA 4CJPA 1IO2A 2OPPA 1FKOB 5KG6A 2A1SA 3ZSQA 3BGRA 4CFCA 4BE2A 4JV2A 3H4BA 1RBSA 4B08A 3AA5X 4RW4B 4B9VA 3SZ2A 3DOLA 2BANB 4ZPAA 2GUIA 1TAUA 3FFIA 3L2VA 2AQ4A 3AA4A 4EYIB 4DL5A 5KT3A 1MMLA 3NL0A 4KB0A 4O5BA 3LALA 1RYRA 3RRGA 3ITHB 3OYBA 3TR8A 3C95A 1HQUA 4OGEA 5DG8A 1FK9A 5KT5A 1J5OB 4Z4HA 1N6QA 3OL7A 4DL7A 2FVQA
chains in the Genus database with same CATH superfamily
4ANCA 5E5NA 3E1YA 3WIUA 3BN4A 5IT4A 1I1GA 2R7UA 1ZA2B 3ELHA 3WZ0A 4LSNB 2ZH4A 3RMAA 2CNLB 2HHTA 3QEIA 1YJRA 3KJQB 4USKA 4DU4A 4O23A 4CO1A 1KVIA 3H5YA 3N5FA 4DV5F 3RR7A 3NOCA 1REVB 5JVGL 2F5GA 1C1CB 3MWPA 3VQQA 4KGZB 4BDPA 4NA1A 4CJTA 4Y2IA 4K0KF 2HKEA 2R7VA 4L72B 2BBEA 5DO2A 1W2IA 3KK3A 2WVDA 1YZ6A 3NCQA 3DI6B 1RTDA 2EWHA 3NGTA 4X66J 3CUNA 3ZSRA 3JSYA 2A42A 1WEXA 3IM9A 4FF3A 3ENWA 4LF6K 1V6HA 3CYMA 2UXBF 4KI4A 5I3UB 3VA3A 1VQMS 1S1XA 2D4WA 3VQ9A 4DV1K 5HP1A 4I68A 3M2UA 2ADCA 5LT5A 1S0NA 4QIEA 2VQFF 4NWBA 3TUPA 2ZVSA 1C6VA 2FSKA 4BWJA 4YR3A 4I6WA 4DR4J 4DV3K 1VI7A 4URQU 4X4RA 4FYXB 3OQ2A 3FZHA 4WK3A 5AJ3F 2QN6B 1TP7A 3I6PA 3CXCR 2DFFA 1JL1A 3E8OA 2POKA 2NXCA 4DX8H 2P6TA 1KAYA 1S1WB 4PWDA 3HM9A 4XEIA 4J9VA 3ILLA 4IH7A 3X1LB 2DGUA 1DTQA 5KFCA 4ELTA 4P2FA 2LXFA 4WE1A 5BR8J 3IBWA 3W62A 1DQ9A 5JS1A 4NLCA 2FBXA 4CJRA 3A8IA 4ICLA 2IVFB 3P49B 3T1AA 2A10A 4CECA 3BQ2A 2KKZA 1OPZA 2BTFA 1NO8A 1OQ3A 2K06A 2QSFA 1JLEB 4HVJA 2BKOA 2V4QA 3I32A 3H3NO 3SUQA 4W92B 2GC8A 2EBGA 4FVUA 2F8HA 2I9SA 1VQ8N 4CI0B 3VCDA 3FMBA 2FBVA 2OELA 4JRPA 2JC1A 2GO8A 3ZT3A 1EX4A 1NHKL 3LPTA 1VBYA 1IR1A 3EJMA 3HD1A 1VBXA 3KIOA 4I2PB 4HUGA 2K8GA 4WE1B 4X66F 4WYBA 3OFHA 3R2CJ 2GJ2A 1X8DA 5M1KA 3A5LC 3THWB 2HNZA 5A0YB 4DTMA 3U1NA 4BRMA 3MMBB 2YNFB 2F4VF 1SC1B 1EX8A 5HVHA 1RP5A 3JB9k 1U49A 2KLAA 5AQPA 4DX5A 3DMJB 2XY8A 3DCAA 4DR7K 2RRBA 4B9SA 2DGXA 2W9AA 3CCES 3BKUA 2VBZA 5SUHA 3M8WA 2FJEB 3A5MC 3ZT0A 1FKOA 3CDAA 4X84A 3A8JA 4TVAB 4NCBA 4WQ5C 3THXB 3DLEA 1RILA 2CDQA 1HKGA 4MYUA 3MWTA 2XLKA 2O4IA 4KH1B 2VU5A 2IM2A 5A8KA 1QUVA 2YPYA 4NXMF 2ZJRL 2DTJA 1BLUA 3R5JB 3WXJA 4J90A 1XR6A 4UY85 3ZSYA 3K8WA 3W9JA 3Q83A 2FUG9 3LZIA 1HNIB 1A9NB 1LW0A 3AGKA 3OT9A 2WOMA 3ILOA 1TYQA 3HZEA 3ATVA 2LEBA 5EX5A 4E7JA 3UCZP 2IFXA 3UDLA 2ACMA 5DM7L 4CO4A 5C24B 5B09A 2HQCA 3E01B 1BWVA 3OUYA 4FJ7A 2IS3A 1H2UX 1U24A 1FERA 1UZDA 1X7VA 1C1CA 1FJEB 1KNZA 4TSXA 5M1PA 3P31A 1ZPVA 3CG7A 2PGCA 4KE5A 3GE9A 5M1QA 4ERDA 2MZQA 4M3RA 3RBEA 2VODA 2DHHA 2KFNA 1I3AA 5A8RB 1LXNA 5KOXA 1TR0A 2E66A 3PO5A 3O1BA 3L2QA 3WNGA 3TARA 5D4PA 4DTXA 1RDUA 3C0BA 4JLHA 4Q0BB 1RT5A 2K7JA 5JS2A 3MMBA 2HWIA 2J7WA 1KONA 1AUSL 2RD5C 4IG0B 3S3MA 4Y6IA 2HHHF 4X66K 1MN9A 2J7KA 2B8QA 3KYLA 4YY3J 1VQOS 2C3YA 5KFKA 2ZH9A 4IH6A 1FE4A 3MFIA 1E6VA 1UPPA 4ZCLA 2BA9A 2XBPA 2QL5B 4X4NA 2HHUA 4XDDA 5K20B 5AQQA 1U2RA 3DU6A 2DXDA 1NGBA 1BIZA 3PJ9A 4NXNF 5KFPA 4DR7F 5BJRA 3OYIA 1NDLA 5ETVA 2AZ1A 3QFPA 4BC2A 1IG9A 2Z1HA 4Q7AA 3LDNA 4NXMJ 2YX1A 5AQVA 2J9DE 4ECSA 3I56S 3NBPA 4FWQA 3DU5A 4ES2A 3RB3A 3DLRA 2VC0A 2P6SA 2H5EA 1RGIA 5E26A 4I9QA 5ADXA 2BEFA 2CQ0A 2ZD1B 4NLUA 4DX6A 2F9WA 4DR2J 1QSYA 1UW4A 2W2MP 3MAHA 2X1FA 1WLJA 4CEQA 2MGZB 1BA0A 4ZPWR 1XMQK 1YJTA 4ZJOA 5KFEA 2P5OA 1UWAA 3OSPA 1U2FA 4PG5A 1NRKA 1IR2A 3DRPB 1RA6A 2K7KA 2PAVA 1NNDA 5BN9A 1BQMB 5HP1B 4O3SA 3T69A 4PR6A 3CULA 2Z4PA 3MAAA 5C25A 2FC9A 1WSIA 2P9KA 5CYQB 1RWVB 2FC0A 2E9ZA 4HWIA 4YUDA 1S1XB 3NLCA 2VIHA 2VDIA 4O3QA 5CAAA 3PR5B 4P75A 3MTKA 3M7VA 5IT9O 3PDNA 3ZT4A 3ASMA 2KHDA 4DX7A 3BB5A 1DTTB 5I3QA 3TVKA 4JI5K 4N56A 4M63A 2G8KA 2XI2A 3V5RA 3HX9A 2EC2A 1URNA 1BMQB 3OL9A 2X78A 4UUWA 3OYFA 1VISA 4YB6A 3KWMA 5BPNA 3HXMA 1RU2A 4B3TF 4KREA 3SV4A 1WACA 2CQ2A 1NSPA 3VQEA 4ISFA 1RK8A 4NXNJ 2RF2A 3TX0A 3I55N 1ZBIA 2M52A 4H4KA 4A4JA 5LMNK 2UUAJ 2H54B 3QGIA 2DHGA 1BY9A 1BXNA 1T8EA 4WU2A 3OXGA 1XMOK 4K4UA 3HSTB 4V19J 3WC2A 1UETA 3QDKA 3T9ZA 5J1EA 1IBLJ 2OD4A 4CLSA 1WC5A 2FVCA 1TFWA 3CD6S 1H0HB 3L9ZA 3DYAB 3G82A 2DO0A 2V6AA 2XNRA 4NE9C 4ZCMA 2YQ0A 2HLUA 1K0VA 4DBQA 3A2FA 2Y8WA 4KHPF 3DOMB 5D8HB 5U47A 4X62J 4FNIA 4BGAA 2KB2A 1QD1A 4FOEA 4ZK7M 1QAYA 3L4QA 2APOA 3WEEB 2RRNA 2F40A 1YQHA 2CPYA 3CCMN 1WG1A 1JXLA 1VGYA 2P9GA 2P9NA 4LR8A 1JKHB 3HM8A 4CWBA 2F8TA 3BKFA 4HDGA 4DR1J 2ZBRA 1Q0NA 1DQAA 4BC3A 2E6MA 3AO1A 1APSA 1F60B 3U9ZA 1YBAA 5KG0A 5CR4A 1R31A 4A47A 5B0CA 2EFGA 3VEWA 4O44B 2EW9A 2JZ5A 1HBOB 3WDOA 3P6YC 4WYLA 1N32F 5KFXA 1NPPA 3FCHA 4F2SA 1LWFB 1NPRA 2GVDA 2DPJA 4YOUA 3L4IA 4HH1A 4P7TA 1WHWA 2ZGYA 5B0EA 4JI4J 4DV1F 1TKDA 4O4RA 1SC6A 4CERA 2O8EB 5AXMA 4DFKA 4FJJA 4GW6A 4YN3B 4B8AB 2AA4A 3C19A 5E2QA 1NGCA 1XMQF 4QOZB 5HATA 5ETQA 1SPBP 3GLJA 2PYJA 3J7YU 2VL1A 1UVMA 4OZ3A 3I55S 4XO0A 5DG9A 1FTRA 1PJ7A 3JAMU 3THVA 3DYAA 4LFCK 4RL1A 1BGXT 2FSJA 5GIOA 3HHKA 2ROGA 3DI6A 1RTDB 3H5SA 3F5TA 3OV7A 1RISA 2ZNZA 2E7WA 4NLWA 1JX4A 2CFXA 2V63A 1TKXB 4ZCIA 4G6VB 1FWPA 4DUZJ 1LAVA 4OZLA 3SBMA 4CJQA 4X62F 2K1RB 1S9EB 4CLWA 2IDLA 5EWGA 3GYNA 4NRUA 1QAIA 2V5HG 1P27B 2YNGA 3QZ7A 4ZLLA 4O0IA 1Q81T 4B3MJ 2F3JA 3ALYA 2VFUA 3QBWA 4DR1F 3ICLA 4M7YA 4LIRA 4J9RA 3VAKA 2GX8A 3C7NB 9ATCB 1B9FA 4BCAA 1TGOA 3W3SA 2ZWPA 1LW2B 2OKQA 3H20A 2QI2A 2UUCK 1NKBA 3H1QA 2ALZA 3A8KA 1XJWB 3CJAA 4YR0A 1FXLA 4I7FA 2HS3A 4O8KA 3BGLA 4I9LA 3V6KA 5HROA 1HNWF 2FZKB 1DEJA 1X5TA 2XMWA 3ET6B 4CBUA 2WSFC 1I94F 2ITMA 3GSIA 4OZJA 2EFOA 3JSMA 1SJ1A 1CLFA 4M3WA 3M32A 3ZZOA 2F7VA 3UD3P 1Y5NB 1G6BA 3JYTB 2XI3A 5EX0A 4CEDA 2G0IA 3BYPA 1YDLA 2DJWA 2C1EB 4C7QA 4EFAC 4QOTA 5IV4A 2NRTA 4HLBA 2NSCA 4H0TB 3DHWC 4DTRA 3MCSA 4WFNQ 4JYAK 4MQ3A 1KVJA 3OPKA 3M32B 4OI6A 2C2ZB 1Q78A 1OYDA 2IVPA 4J9MA 3W8GA 4R5PB 1S9GA 1ATRA 2OANA 4I6YA 4OPJA 2HQ3A 4NB4A 2QLXA 3IA0A 1SJ3P 2YWGA 4H5TA 1RT7B 2M5YA 5GADI 1WBBA 5H1SQ 2P9PB 1IQTA 1OKJA 1EWRA 5LMNJ 3TOQA 4XH4A 4ZCKA 2CPEA 1VQON 5LXRA 2FLLA 3AO3A 4Y28C 2UXBJ 1TK8A 1NJWA 3N6LA 1FHTA 4H5WA 3MN6A 1FD8A 3MR7A 2MZSA 3UD4P 3DJCA 1IBMF 4EK2A 1IXKA 2AT1B 1ZH5A 2IAJA 3GV8B 1MROA 1VQKN 1JCEA 2QA4N 3EWGA 5KFSA 3TEGA 5GMKa 1HWKA 2MZTA 3V4IA 3MD1A 3WQTA 1RTHB 1EWQA 2DPIA 1Q8IA 4RX6A 1JLCA 2UUWA 4NA2A 4FLZA 3SI6A 1OH8A 2M2BA 2ZOFA 1R89A 5BRFA 3I87A 2B4PA 5HJXA 1KQSR 4XDCA 1RXOB 4PQUA 4PCQA 3ZX2A 3QEVA 1OSCA 1BHNA 3AVHA 3D7SB 4CLTA 1RTIA 2V8PA 1YJ7A 4IRCA 2V67A 3CMAS 1CEZA 3AVGA 5AQWA 1H74A 4C0BA 3OTOF 4K4TA 5C25B 3THTA 5CD4H 3FCVA 5G0RB 3B8HA 2YWFA 4FXDA 5BR8F 2Q43A 2LMIA 1YVFA 3TNVA 4L3QA 3P1GA 3O8MA 4K2JA 4EIAA 3MCOA 4EGLA 2EFVA 3VEOA 1Y11A 2RU9A 4WYWA 1ZOTA 2XHWA 3J80Y 1Q86T 1X0PA 4YEAA 4CJ7A 1U1NA 2XTJP 3W66A 3CJKB 3MXIA 2G1HA 3J80U 3UW1A 4R8UB 3D1OA 1RWPB 3GB0A 1CJUA 3CTRA 1LNQA 1AUDA 4QWAA 2ASDA 4Z7CA 3B78A 4IG3B 3I5CA 4A5BA 2EK1A 2UUAK 3A3NB 4CIEA 3M5RA 4ILGB 1NK7A 2NZ4A 2U1AA 1ELOA 5CCLA 1RDWX 1NXIA 3LGMA 4KBIA 4MFBB 4CGGA 1UP1A 1L3VA 3D2EB 4CBWA 1R3NA 5IT9Y 5GAEP 2ZJQQ 4DV4F 2QC3A 1TMJA 2BUNA 4HDHA 4B3TK 2CQDA 2P1JA 1E6VB 2G9OA 1FT8A 3QAEA 3UVJA 4CK3A 1KTQA 3P8BB 1BCOA 2O8DB 4ES1A 3KZBA 1RLCL 3ETMA 2LYVA 5FRMA 1T11A 4O0NA 1GK8A 1YVUA 2GMHA 4PYDA 4M7XA 1T94A 2QA4S 4F4ZA 2IVYA 3FQKA 3V6DA 3L6QA 3MCMA 4H4OA 1Z1ZA 4JI6K 2YKQA 2BM1A 3FRYA 1WNEA 1M1GA 4XPCA 1KHVA 2F8MA 2J7UA 1U47A 3OTDA 1E6YB 3O1LA 4B3RK 2YKNB 2E5LF 4IR1A 5A6WA 1C0UB 1OY6A 2FLPA 2A6OA 3D4JA 4WU3A 2EKNA 5KFQA 3CDWA 3OYDA 3G0ZA 3P83D 2HGLA 3D6MB 4QCLA 1GLEG 2WBNA 5DDOC 2D5RA 3IN5A 4C9DA 3HZGA 1OSDA 4OQJA 3FVYA 3C2PA 4KHSA 3WQPA 3AVCA 2GW8A 3KD1E 3SQOP 3OVSA 3VEZA 1OJ4A 5CZ1A 2G8WA 3AAPA 4CLFA 2DD8S 1KVAA 4GKJJ 3TUIC 2I5JA 2P9SB 3CSKA 4KH4A 2Z0GA 3FZ2A 2BOPA 4B9LA 3DLKB 4CZLA 3DMJA 3HPOA 1WSEA 4RBVA 2G8VA 2MKSA 2M7SA 3MEDB 4U6PA 2E9TA 4FBTA 4EI2A 3L2WA 3TAQA 1DRZA 1N56A 4C8OA 2X1BA 1RUSA 3BJYA 3J7ZT 4FCYA 1VC6A 2MQNA 3LGNA 1RWXB 3B4MA 2IMWP 2L08A 1B70B 1MG7A 2QIFA 3J8AA 1VQ6S 5L8RC 5ETKA 3RYLA 2LECA 3E2EA 4OHZA 3GFXA 5D0RA 5TKYA 2M8HA 4JUZA 4YY3F 5DK5A 1S1TB 3GSDA 3C6TB 4DQSA 1X4BA 1N5VA 4DR1K 3QEPA 3HHNB 1S7HA 2E5JA 4JI7K 4FVCA 4LT6A 1EAYC 2YBVA 1HW9A 3VF2A 4DV0F 5AE1A 4M8LA 2JSXA 5G4DA 3OJSA 3BR9A 2BUPA 3H90A 3MM8B 5A2QY 4QIFA 4B1UB 2J0QD 4ECRA 2R4FA 3TU5A 5KG1A 4K8XA 2F8SA 2ZWHA 4J9KA 2RS8A 1SXLA 1FD2A 2OO4A 3DDKA 3CCSN 1YX2A 2ZC4A 4AE5A 3B6OA 1IJFB 3MF5A 4BE0A 4BWMA 3CCTA 3QQCD 3SPYA 4L73A 2M70A 3ULHA 4DV5J 1NHVA 2OI2A 2QMWA 3C94A 3PKYA 4XAKA 2CRLA 4C1NK 3TWZA 5CHCB 1NM1A 4FLUA 1N36F 3L2UA 4GMJB 3VETA 4JHDB 1D09B 1S72N 1NK6A 3B4DA 4DV4K 1Q8BA 4AILC 3ZC4A 3I5AA 4JD2A 3PCOB 3EO3A 3MTJA 4F3TA 1RDAA 1JLEA 2RHQB 2DK2A 4RW8A 3JYTA 2YHAA 1HR0J 2ZH7A 1JXEA 2V69A 4WXWA 2OFGX 3SAHA 1VQ6N 1NKEA 5JXSA 4NLRA 3QRPA 4ECZA 1S22A 2VA3A 4AHUA 4PWDB 2R8KA 2UUTA 4OJ3A 3M1VA 1U0SA 1U6BA 4IKAA 4X4QA 3CPWM 1TKXA 4DTPA 5T7LA 2HK3A 3UN5A 2CDRB 4WFAL 1VYAA 3ULEA 3T1HK 5CYJA 4MO5A 5KG7A 1GOAA 4CT9A 2V4RA 2X74A 5EOYA 2DTUA 4JKHA 4AQYK 5HL7Q 1ESVA 4ZA1A 2O5DA 4M5DB 5AJ3J 4DMZA 2G8IA 3E01A 1D8ZA 4OHYA 3PNIA 1LAWA 4G65A 4LVNP 4HR2A 2KFYA 4HHUA 1R7IA 1I5OB 2OPSA 4DLGA 5KPRA 3LPUA 2HRYA 3MMVA 5KFRA 3SAGA 4AT1B 4DWIA 1S99A 4ECXA 4G3IA 2NYHA 4DPXA 4FJ5A 4M95A 5KT6A 2FHMA 4EAHD 4GVLA 3N9UC 4U95A 3HSGA 2MKCA 1SH2A 4AYBD 3NY0A 2YKMA 1ZA1B 1YJWS 1CZBA 5MAOA 5HN0A 1UEKA 5A8KB 3F9KA 4ZVPB 1UCNA 1GEHA 3LOUA 1ZM4A 4ED8A 4W5QA 4E2FB 4KHPJ 2C2KB 1ZAXA 4CO0A 3DLBA 3EZUA 2K3IA 4DR3F 1RHMB 3D1HA 1FTCA 1VSIA 4F8RA 3DOLB 1SIWB 2GMLA 4DV3F 2IJNA 3DHXA 3EE3A 4RUCA 3PY8A 4BRIA 1TL3A 4CLZA 1UA1A 1NM2A 2YV0X 3TWHA 1GNKA 4FS1A 4Q8EA 2P8IA 1WG5A 4ICLB 1U1PA 4USHA 2QTWA 5A76A 3MM6A 1NHUA 2XMMA 3QWUA 4HKQA 1GMUA 2Z1JA 4YB1P 2YQ3A 2XLIA 2E1ZA 2P9PA 2DIVA 2GV9A 5C15A 4P9SA 1MWQA 4E0DA 4NYPA 1GTHA 4AXJA 2BJDA 4O55A 3NGRA 2L48A 4A61A 4Y00A 1WUUA 3KK2B 1ZAVA 4JHDA 4R8UA 3W1YC 5E7OB 2Z30B 1RTZA 1HYSB 5LL6d 3CJKA 2HS4A 1G3OA 2XMUA 5C7PA 1Q18A 1S1TA 4L76A 2ETJA 5T14A 5ETSA 4K25A 2OSQA 4KHUA 3NG8A 4ZPBA 3SQ4A 5C2DA 1QLNA 1T95A 4EBEA 1V3ZA 1S4EA 3K9JA 2MLZA 2DNKA 3O3LA 3US5A 4BE1A 4KY3A 3Q89A 1RDCA 1Q82O 4WCEQ 2VOPA 1V3SA 1S76D 4EO8A 4DTNA 3GFHA 1TKTB 3PIOL 3AVJA 2V7ZA 5L9XA 4FZYA 1S7IA 4B3RJ 3NVKA 5E3PA 1YI2S 1TUUA 4CF8A 2E9RX 3GIIA 3NOGA 1NGEA 3DXSX 5B0BA 4OKEA 4MKBA 3NGDA 4BR5A 3CM5A 3PR4A 2BJ3A 1X4FA 4FF1A 2OD6A 4LJMA 3CCLS 2OMLA 2ROEA 1SAZA 3CJ8A 3VQ5A 3J81U 3EX7B 3OY9A 2NRXA 1RA7A 2C3PA 2HGNA 2AX0A 3OD2A 4M5LA 3OW2R 4PG6A 3DRPA 4FXWA 1VSMA 2D1CA 4C8ZA 5AFUA 1VQKS 1OQ6A 3PX6A 2Q3SA 1HNXJ 1S48A 3VQ7A 4CJ3A 4RPFA 3WT0A 1LFPA 5AJ3K 4J2DA 3TTFA 4DUTA 5KFUA 4BR9A 2I2YA 3W63A 3C46A 2HHQA 4P2MA 1HR0K 2OYQA 2YWWA 2CQHA 1F21A 3T41A 1TUGB 3DGPA 3A8EA 4K41A 1WD6A 1GLFO 1KQGB 4N8NA 1OH6A 3BKTA 2IJFA 2YI1A 2OP5A 2Z1IA 4BACA 5BPMA 4RR5A 3KLGB 3I0RB 1VK3A 4K2XA 4B02A 4FWLA 2KYZA 1T03A 3A8YA 2E1PA 1D9FA 3K58A 2MLYA 5AQHA 2VWBA 2MHNA 4MK7A 3ZNJ1 4HL9A 4GVBB 3C14A 2ZKTA 3ZXWA 1VRTA 5T7BA 1HW8A 1WSJA 1Q79A 2DGWA 5CABA 3EL2A 5B0FA 3U02A 2VG5A 1UKUA 4DQRA 1WKJA 3PIPL 3F73A 1HWIA 1KOHA 4NASA 1BL3A 4NOHA 2YX7A 3IWLA 3VWSA 5IXUA 4NMXA 4NXMK 3HOTA 1BWEA 1YIJN 1JLGB 3IRXA 4RW7B 1E4FT 2Q3PA 1IBMJ 2AJ2A 3I0RA 3G8SA 2FHJD 3AA9A 1JCGA 1CULA 3QFUA 2GWJA 1EIYB 3BGOP 1B4SA 2HIYA 2HBYB 4FBUA 4PWUA 3O80A 5C2FA 1S57A 2FZCB 3K2PA 1SBRA 5AQXA 4DPWA 2XZDB 1IO2A 2OPPA 5HL7L 1F2HA 4W90B 4BE2A 3H4BA 4RW4B 3HHLA 4LF8K 4ZPAA 2CH5A 3KNGA 3L2VA 3VAGA 2PE8A 1QZ5A 4GY2B 4ZLPA 3CETA 3NL0A 2I0XA 4KB0A 4O5BA 3ITHB 1Q4RA 3C95A 1FJGJ 5DDPC 1UFLA 1J5OB 6FD1A 3CE8A 4J37A 3OL7A 2FVQA 2XMJA 4J9QA 2XHBA 4YB5A 1MWMA 4TU9A 1HBNB 1D5AA 2ZH1A 4OHXA 3UR0A 3E9OA 2HS0A 4KGKA 3CIMA 4WIIA 1Q53A 4I2QB 2EHGA 2D3ZA 2QT7A 4ED5A 3VQ4A 3CQXA 1R59O 3QT8A 2IM3A 2HZAA 2YJEA 3AD9C 1U1KA 1HBNA 2VFVA 5KT7A 1JQGA 5AE2A 4FK2A 4HTUA 4DV7J 4LBIA 4FLTA 2BQUA 4KHYA 5M2PA 3CC2S 3V9ZA 1RAJA 1XNRF 2WBRA 2W42A 4Q2LA 3D9BA 2VJUA 2SXLA 1VQ5N 1R6YA 1KQFB 1JLCB 5KTQA 3RWUA 1CXUA 4KTZA 1EP4A 4CFDA 2JC0A 1WC3A 3THWA 4NI2B 2R8JA 3AOCA 5ITHA 4CEFA 1I6JA 1DFDA 2EXUA 3NGUA 3IP0A 3FQLA 3HKWA 4NCGB 3FSIA 2JLEA 4CEZA 1S77D 3D3CJ 3AD7C 3CD5A 4CGJA 4KBOA 2NRHA 2AJ1A 3KJVB 2PA3A 3BEXA 4CFBA 3CCMS 1ACMB 5HBMB 4FKXA 4FP9A 3TX8A 1XC3A 4J2AA 1GXLA 4X4TA 5AQKA 4IOBA 1VRQC 1KQSM 1U09A 2NRVA 5AQFA 4USWA 3P4IA 1K73O 1N8RT 1KR4A 1VQ7S 2K3KA 1FJGF 3EEQA 4ZP9A 1O1WA 5EUHA 2J8SA 4TQRA 3FKBA 2ZUAA 4PY5A 2W4DA 4LF8F 2CJBA 3U1MA 1LWEA 4H8KA 4KKOA 1EXQA 3CJRA 3W9HA 3ID6A 3A1YG 2D74B 2EVZA 4GVEA 3WQUA 3DXMB 1XMQJ 4ZLJA 2FF3B 1BO5O 4K42A 4FJMA 1UAXA 1YKWA 2MSSA 2QWQA 4UQTA 4DQ8A 2N3OA 4JI3K 4K0KJ 1Q1KA 3AY9A 2K1RA 1FESA 4EZ6A 3FE1A 1RWUA 3O5BA 2R9LA 2DR8A 2MPUA 4HTJA 3MUTP 3BGUA 1CQNA 1FE0A 4DL2A 3D2FA 4GKJF 5HSPA 5L1JA 5LJWA 3JQKA 4JK7A 1CJVB 1DHMA 2WSEC 1WN7A 4Y0WA 1M5PC 3U6FA 4KAZA 4MO4A 1T9YA 2XY6A 4G1PA 5I42B 1YITS 3QZ8A 1FRKA 3V9XA 5AQIA 4KHRA 5FPEA 2MZRA 1BI4B 3KHYA 2LQ8A 1ZXOA 5DDRC 2ASYA 1MWZA 3I4HX 2DHSA 1UVLA 1WJ9A 4QU7A 1Y64A 2VQFJ 5E3QA 3PSIA 1RJJA 2DGVA 1B7FA 4B3MF 3WXLA 2L41A 2E7XA 2NUUG 3IC1A 2H48B 3MWBA 4ZKAA 5DJBA 3OYJA 4EFHA 1RTJB 5BYQA 4EHTA 4FJLA 4UOHA 4KB7A 5IT9U 5ETLA 1YJWN 4IFYB 5FLXO 3OS1A 1U8WA 1SL2A 4PEOA 4A2BA 2VWJA 4JK9A 1KXPA 3D0PA 3AVLA 4RWTA 4WKRA 3PFOA 1YJNN 4KB1A 5D4OA 1K1QA 5F9LA 4CM2A 3CCJS 2G4BA 3G71N 1YF5L 1C0UA 3VTHA 1I94J 4BRGA 3HDSA 4WZMA 4BC5A 4NMLA 1ZZFA 4Y2AA 3H42A 4R25A 5B0DA 3H4DA 3HP9A 4LF8J 4BR2A 3DC2A 2ZUGA 5DM6L 1JK9B 1B92A 4FK0A 3TVZA 3R8YA 1HI0P 4H5RA 4UOGA 1IBKK 4K4YA 3CFRA 5E3RA 3EPGA 3EXYA 1D4XA 4E7LA 4A8MP 4ED3A 3LQVA 4GKKK 3V6JA 4PRFA 5GVQA 5K14A 3VESA 2ZDPA 2CZVC 2L9WA 4A62A 4CHZA 1IBCB 1JJ2M 1F3VA 3VEXA 1F1BB 3MR3A 2C28A 1NK5A 2PEHA 3AA8A 1C4CA 3SDEB 3SBGA 4LF1A 4OO1J 2CXEA 3OFGA 4YY3K 3KKSA 1HPMA 5DM6Q 1WF1A 2N4CA 3LWMA 2W2QP 2RUSA 4QS9A 2AWZA 1DTQB 3OFEA 2CNKB 3ONQA 2PZSA 3VA0A 2DNZA 1RACB 1EZZB 4QAGA 4Z4FA 1NGGA 3QNWB 4FPRA 3OR2A 2G2ZA 4OX7A 4ZIVA 1FRHA 4LREA 3KOAA 1Q5VA 4PYAA 2G1DA 2X3GA 3EZOA 2UXCK 2RDJA 3NFAA 2BKNA 4Q45A 1V4TA 2P5VA 6AT1B 1RAOA 3I33A 4RJVA 4KH6A 4L8RB 2N4DA 4IOXA 3ENBA 1AFIA 2RUGA 4ILLA 4K59A 3QIOA 1T3OA 3QT5A 3SLCA 3LDPA 4OI0A 2KW4A 5AXNA 4OX9F 1QY7A 1RCHA 1TAQA 1PGZA 3MM6B 1CZAN 3OTOJ 3UI3A 1C1BA 2HSTA 4ECTA 3VERA 3WHIA 1J53A 4MDAA 3CD7A 2W7AA 4LSZB 2B9EA 1IJJA 2YTCA 2V2QA 3GV5B 3QJJA 1R0BG 1YHQN 3MPDA 4CJVA 3ENQA 1FNMA 4N7TA 3R7NB 3CCRS 2CKWA 3JS9A 5FD1A 3MM5B 3M8QA 5J2PB 2CG4A 3UKUB 2UVRA 4UZCA 3QEXA 1UFWA 1GT8A 2B0GA 3OUYB 4AHTA 3ZSOA 3FZBA 3GIKA 3M9NB 5KT4A 3MM9A 2OJ3A 1JL2A 3BGFA 2I38A 2BOAA 4AL7A 2H51B 3CPEA 4A8XA 4L6V3 2V8VA 4XK8C 4QYRA 4KI6A 4K4XA 1K8AT 2V94A 4U7CA 4ID5A 1NB7A 4F2RA 4NPOA 1J5EK 3HPHA 1U02A 4C97A 3D6FB 3CJ1A 2KXNB 5BREA 1CC7A 2DR7A 4H54A 2MEWA 2ZEJA 3OVAA 1XK8A 1KOOA 3PYDA 1VQ4N 2E44A 3CJ3A 2HHHJ 1YJ9N 2ZE2B 2KN4A 1GLLO 4TYBA 3C6UB 3GPAA 3U8XA 2XYGB 3QIDA 3U1LA 2WVFA 4F9OA 5KFDA 4UY8T 4WF9L 2F4FA 4DJBA 1N5TA 2XG8A 4WP3A 2NYIA 4O5FA 2D41A 2LP4A 4TLQA 4WP9A 3PHEA 3PKMA 2PBDA 3JSRA 1P8ZA 4B1XB 3RU0A 2F8EX 3OBIA 3HYFA 2R7QA 1VLYA 2V52B 3MPVA 4A8FA 2QW9A 1YTYA 3KXDA 2PO4A 2ZDOA 4GRSA 3R27A 5CZXA 3AVAA 1QQMA 2ZBPA 1N4LA 5H9EK 4OX9J 1S4FA 1NJYA 4R0JA 4L3NA 2E5LJ 2RHKA 3W60A 3PX0A 4A8QA 2B3TB 3NAIA 2HZCA 3NNCA 4YB7A 1ZC6A 2KT5A 3W7BA 4ALZA 2Q66A 4BG9A 1WAJA 3V1OA 2GELA 1VQNS 3JAMO 2GIRA 4IZ9A 3SSRA 4I7FB 5GADP 3HD2A 1HYSA 4K8ZA 4CNZA 2OEKA 2GHPA 4OGCA 4F36A 4JI6J 2ZH5A 3OR2B 2GZOA 1F5CA 3MK6A 1DBDA 2IPOB 3HVAA 3K7RA 5DZ6A 1O0PA 3T5KA 4HI2A 2YKOA 4F4WA 1N33K 3QINA 1IN0A 3ZZTA 3M2RB 4WFYA 4A57A 4JAXA 3B82A 1OS5A 3H0PA 5LJ5Y 1HNXF 2HBKA 2RVJA 5EN1A 2IC3A 2CZ4A 4DV2F 1ZBFA 3U3YA 1X9JA 4JI0K 3FBBA 4Z4CA 5LMUJ 1IBMK 4LF6F 1GX6A 3Q2TC 4OPHA 2HRTA 3S3NA 5LSOA 4JS4A 2CYYA 2R42A 5D0EA 3MEDA 2Q79A 4IFVA 3SUNA 3THXA 1C2PA 1Y4ZB 4IOAQ 2NQPA 2VQFK 4CK2A 2CGLA 3HBTA 4PHTX 1DLOB 3SJHA 4WJBA 2V51B 2NXEA 3KG0A 1PC4A 3HFZB 3PJXA 1EQYA 2HFOA 1RWKB 1UMJA 4R79A 1Y5IB 2LCWA 3EYZA 2FB0A 4EWTA 3LL3A 1XBWA 2LSNA 1MWYA 1BQNB 3KLEA 4CW7B 2ZOGA 3S6EA 4ZHRA 4BRHA 3P96A 4CF1A 3O9RA 1GFWB 2M88A 2KTQA 1S9FA 4EP5A 4C11B 2A18A 1SCJB 2YNHB 3MECA 1BWFO 4HEA9 5B0GA 1MA9B 2W2NP 3PRBA 3KLHB 1P90A 1G1XA 1VSEA 2UXDF 1NK9A 3LP2A 2BKPA 1UL3A 3ZTQA 5KQDA 4YOYA 3W64A 4EBCA 3U7JA 3VAHA 3IS9B 4KHMA 3R1LA 4AHRA 1Y0HA 4QWDA 2WCXA 1ITGA 3NGKA 1SB6A 3K5NA 1HI8A 1OH7A 1NZAA 1FWKA 2MKHA 1U1LA 3WX8A 4OYPA 1HBMB 1HD1A 1ASVA 1B7YB 3GE1A 2C2RA 3KUEA 4FF4A 3QICA 3BSOA 1N32J 2CQPA 5SWMA 3PW5A 5LMUF 2HSEB 2FJXA 3CCQS 4KTQA 4RW4A 3PW4A 4LF6J 3NCRA 2DRDA 3MMAB 3OR1A 4DSJA 4JI4F 2MHEA 4PUOA 2D0CA 4DV1J 1HJRA 3J7A1 3J81j 2O4GA 5H9EJ 4U8YA 4IO8A 2ADBA 1UTAA 2FD2A 4LY7A 4M3XA 5KFIA 3MEGA 2HVHA 1XTZA 3BDPA 4DTOA 3EGWB 4IJNA 2MLXA 2R2UA 1N36K 1RT4A 4B1VA 4WTYA 3O6QA 4LF9F 5MLCQ 4RUBA 4CYUA 3VGMA 1VMBA 3TA2A 1K9MO 3K5LA 1A6LA 1MMDA 2DO4A 3QESA 5F41A 1GLCG 4OV1A 3W2VA 3V81A 4DTSA 4A8WA 4DU1A 1KN6A 1VSDA 5J1PA 2KZZA 4DV7F 3K9KA 2UZAA 1WSFA 1FDBA 3SYZA 3OTOK 4Y1DA 4CZMA 4DUZF 4FW1A 4CIGA 4E1NA 4CHYA 2HWTA 3DKDA 2ATLA 3GTYX 2EG1A 3QERA 2LEAA 1M90O 3JXOA 4IYQA 2Q36A 4K0KK 4F67A 3W5YA 3QATA 3KLFA 5C42B 2W41A 2O66A 1YITN 2VD3A 3SPZA 3IAM9 4UF4A 2VOOA 3LA0A 2G2YA 2ZBIA 3LM9A 3HT3A 3I4PA 1C1BB 5I3UA 4B3OA 3VF0B 1BU6O 4P52A 4M5NA 2UVUA 3ZNUA 4YOEA 1LWCA 3VPZA 5GAHI 4YQWA 3ZTSA 4EU0A 2XY7A 1RU1A 4FYDA 1HNWJ 3FEZA 2BE7D 2XSJA 4BG8A 4CJ5A 4RTFD 2HVZA 3LANA 4ZVEA 3CQ8A 3SCLE 1ZYQA 2PA8D 4I2QA 1B9DA 5AQLA 1JWWA 3H5XA 5KFZA 4A8OA 1MWKA 5KFBA 5CD4A 3IGVA 4J9OA 3IR6B 3KJVA 2BR0A 4CJ4A 4JI8K 1JLBB 5K8OA 5KFTA 1AFJA 3HCXA 2COLA 4RUAA 4KT0C 1GMWD 3IS9A 3FBCA 3SQ0A 2R7SA 2HW3A 2FXUA 3CJCA 4BR4A 3G6EN 2FY8A 1WC4A 5FPMA 3QETA 5IWAF 1MMNA 3UN2A 3PEHA 1HJOA 1WF0A 3ZZYA 4CZFA 3TRGA 2E29A 3LW5C 3NHGA 4HUFA 1VDHA 4RBUA 2JWKA 1RLDA 2EFQA 5HROB 4Q0BA 1YBUA 1Y5LB 2KO1A 1GLBG 2PT0A 3KWIA 4BHQA 2MZ1A 3SI8A 4UOFA 3EGVA 3Q86A 4QPTA 3T3FA 5AQNA 1TQLA 2ACYA 4CI6A 5AXLA 4JI7J 2FHKA 2W2PP 1V3RA 2G13A 2QLFB 2GVZB 1W9HA 2Y9HA 3JSMB 4FSVA 2QL7B 2XZTB 1ITPA 3NE6A 1U6FA 4M5JA 3VQDA 3MR5A 2F65A 2Z1GA 4CHOA 1RT6A 2IA0A 4CF9A 1MLAA 3AVNA 1SJRA 3NVMA 2RIJA 4LFAK 4IG3A 3FEYB 3T5LA 3G4SS 4P7VA 1CSJA 2BANA 3DNCA 1IM4A 3TZYA 3SFGA 2JVOA 5DQHA 3D2WA 5M2UA 1X5SA 2FZGB 4P74A 1Q95G 4D3HA 1T03B 2KT2A 2N7YA 1NKCA 1RBUA 3OL8A 1U2VB 1T9XA 1LWXA 3BZQA 4I67A 2YX4A 1L3SA 4PA1A 3IR5B 2CQGA 4DCPB 3CJ9A 3M6VA 3CJ7A 4JKGA 4IUFA 1FKPB 2B7BB 5LJ3Y 2PMWA 3GMGA 3BDEA 2VBYA 4AHVA 3I31A 4DUYK 5DMRA 2MQPA 2D3UA 1BG3A 1W7AA 2VBWA 4B3SF 4QR1A 2FIUA 5BR8K 1BQXA 1TUYA 3UB5A 3I8DA 1Y9OA 5KFGA 1N54B 4F3OA 1RAHB 4QJVA 1WTBA 2BE2A 3GG1A 4OI3A 2B9WA 1VRUB 3EICA 3VAMA 1RSCA 5KGWA 1FJ7A 3T6JA 4IO9Q 1V5IB 2IIHA 4CZIA 4GV9A 5F8HA 4OYIA 2AHOB 2NZCA 4DL6A 1VRTB 1WBDA 1YIJS 1FWLA 3IDHA 2YHYA 4AQYJ 1KRPA 4GVBA 4S0MA 2XMVA 1IH7A 4GVMA 2NSBA 1HNWK 1LWEB 3M6XA 5CXTA 2M8DB 5H9FJ 3GIMA 4KYZA 2KZMA 2UUBK 3OSNA 1XIQA 3EE8A 5DQIA 5J2QA 1N5YA 3M8PB 5HJYA 1T3NA 2KRBA 4DR5J 3RB4A 3DOKA 4UW2A 2G8UA 4WFAQ 5CQGA 4ZDNA 3ZT1A 4JI1J 1UEUA 4CNYA 2Y0SD 4PKGA 2X51A 2D3O1 4YS2A 1D9DA 5IWAK 1H72C 2E88A 1RAEB 4A5AA 3ZETB 4K5SA 1GXTA 5J1EB 2X1GA 2FSNA 2HHVA 1WTFA 1Z2LA 4KH0B 2RPIA 4QYZJ 4LF2A 1W0HA 3CCSS 1TK0A 4JEPA 3K5MA 4JV0A 3MM8A 2DY1A 5D0HA 1MNEA 1R8CA 1S59A 4ISEA 2ZJQL 3N79A 1Y10A 4F3QA 4RNHA 2OEMA 2R8HA 5GAEU 3JAMY 4JP8A 1B64A 3T5HA 3U27A 3P45B 2N3LA 3RBDA 1RT3A 3PUFA 2NLXA 2CUYA 5KFWA 2KJWA 2NRZA 5GADU 3LM2A 3VQ6A 4LFBK 1JJ2R 4IXCA 1N52B 1FFGB 3S1TA 2DRBA 3M8QB 1CZ9A 1K8KA 1XNRJ 1T9VA 4NLSA 1HNXK 3R9PA 5F3ZA 1TL5A 2OLWA 1FF2A 4NLOA 3GR1A 4ZHRB 4F7VA 1F2GA 5DS7A 3S8SA 2WONA 1TL3B 3BSNA 1SUQA 3LP0A 2CQBA 2QWLA 4CZCA 3O08A 2JLFA 3DLLL 1RHKB 3FCWA 2GGPA 5B0AA 4H4MB 3CJSA 3VGUA 1OWXA 5C10A 1T9TA 3K89A 3D66A 3PYGA 4NO7A 2QGFB 3ADAC 3HI0A 3F9MA 3MPWA 2C22A 2GNKA 3TO8A 4X4SA 5IS2A 1T0TV 2P9IB 4JKFA 2D1KA 4WQ4A 2HURA 3KKFA 3VAFA 2OSRA 3H45C 3IFRA 5ETNA 3DM2B 2MKJA 4FM2A 5M2RA 4F26A 4PPZA 1RKJA 4R0EA 3NNAA 2IVMA 3AT1B 2MQ8A 1W7WA 2IC3B 3ZETA 3Q24A 3UE2A 3HK2A 3DLKA 2QA1A 3G87A 3PACA 2P9SA 3M2RA 3AVBA 1FI4A 1XNQJ 4O4GB 2WAQD 4HACB 2UYTA 2NXUA 1ZS6A 2AU0A 4M5MA 4XPEA 5F8JA 3CCEN 2VYPA 3QGHA 4WFNL 1N36J 4JI6F 4FLWA 3ENAA 1HYVA 1SS6A 2DCUB 4CCHA 1RAGB 2ZZNA 4B1WB 2GQ2A 3ULDA 2VHGA 5KRTA 1REGX 2P5GA 3QSYB 3DLJA 4LF7K 2GV1A 4GV3A 4TNOA 4IEEA 4YOXA 4C8MA 2IDOA 2V8HA 1KCFA 2NCKL 1HR0F 1T7PA 1IBLK 1IKVB 3DRRA 4K7QA 4OI1A 4CTAA 1Q86O 3VV2B 4ER8A 4QW9A 2ZJPL 2UUBJ 4BRAA 1NH7A 2BV3A 1F9EB 3EZ5A 1WELA 1F9FA 3AVIA 2Q97A 1W2BM 2VKRA 2HQIA 4PKDB 3ENOA 4CE9A 2DYAA 2V4JA 1TV6A 4FLYA 1XQSC 4I6AA 5A8RA 2PSZA 3GR0A 3W0LA 2XB2D 2IM1A 1WKKA 3RAMA 4WFBQ 4GC7A 3IBFB 1F5BA 3NMUA 3K2YA 3UVJB 2H4YB 3EZWA 1PYTA 4C8YA 3KFWX 3VZIA 4DS4A 4JYAF 2R7XA 1YJVA 2JJ4D 1TZ0A 3ZX3A 4X4PA 2B6AB 3MN9A 3O3HA 1N32K 1IV0A 4E7IA 3VQBA 2AJ0A 3J81Y 2OZSA 1UVNA 2I1RA 5A8WB 1B0PA 3FBFA 3IWNC 3KG4A 1U4BA 1ASUA 4X64F 4PAAA 3KMQA 1KS2A 1WEYA 3M30A 3ZZUA 5AQGA 1SQKA 3WC0A 2F7TA 4AL5A 3O4NA 2AEJA 3O3FA 3HULA 1FEHA 4DV7K 3K0JA 1GOCA 4OZ2A 4J9PA 5GAHP 4HI1A 1UFKA 1U1OA 4DR5K 4PQUB 2CPDA 3KK3B 1S1UA 3H98A 4JV1A 2BE2B 2EKYA 2RDIA 3VAJA 1X60A 4KGVB 3HFVA 3OTBA 1H2VZ 4DR3J 3E9PA 1RT6B 2LXUA 2AP1A 4J5OA 3I56N 2XO7A 4YDUC 2GQQA 3CC2N 4IKFA 4IRDA 4ZN1A 2CJ9A 4YOTA 3MM5A 1SKUB 1RDDA 5D4NA 1HNIA 4KPCA 4X4OA 1LV5A 1HBUB 3AHPA 4OZNA 3R5GA 4X62K 2WTUA 1IUJA 2HQGA 2MMYA 2I8EA 2PY5A 4OZ0A 4JV5K 4H0OA 2DH8A 1R8PA 5F3TA 2BQ3A 2VQEK 3I82A 4FWOA 2DT9A 2HAIA 2J8AA 1NAQA 5HQ8A 3WNEA 3CPWR 1SQEA 3TJ9A 4LVOP 2OUGA 5KFHA 1R27B 2VKZG 4CJLA 4FYWB 2XGQA 2DR9A 4RW8B 1PO6A 3PHTA 4R5PA 5D3GB 2NZTA 2Y1IA 2HOEA 4DQQA 5F2RA 4P73A 3LDOA 2AEMA 1QS4A 3F2KA 3W8PA 4ECUA 4CESA 4DSLA 3J80O 2O8FB 4DF4A 4ELUA 2O8DA 4IJAA 3PW0A 5HOOA 2A3ZA 3TA0A 3N4QA 1HL6A 2QFIA 3TYTA 2C2DA 3BH7B 1XERA 1BA1A 4Q2MA 4IOCL 4RW6B 4FZZA 3BPDA 2XQCA 1JJHA 3UN3A 2CNNB 1NJZA 3VALA 4FZVA 2HHWA 2A2DA 4YDXA 2ASJA 3U4LA 3R8EA 2CNOB 4C3KA 1QTMA 3BF3A 3Q23A 5FROA 3N0VA 3S7RA 5L1KA 2QXLA 4B3RF 3RMDA 3SQ1A 2XYPB 4H0PA 3ZZRA 1I39A 5KGXA 5FLXU 1X4HA 3C66A 2PC6A 3FFIB 1W25A 1Q81O 3KNAA 4YP3A 5K9FA 1N0VC 1UVIA 4H0VB 1KTVA 3VVTA 4U67Q 1QE1A 3IFEA 4CDIA 4IQMA 3C6TA 3G86A 2EG2A 3RB0A 1Q5YA 3RGIA 2UXCF 4ZP6A 5FIIA 2YQ1A 3UO0A 3W9IA 3HMJG 3KLFB 2QL9B 4YOWA 3AVMA 4HCCA 1TL7B 1DZ5A 2KHOA 2VG7B 2WONB 2AKWB 4CH0S 2WUSA 2ASOA 3BGRA 4CFCA 1FRXA 2MTLA 1WWHA 1RBSA 2JNJA 3P4UB 4B08A 3EDQB 2H1YA 5HI7A 3SZ2A 2BANB 1KC8O 4NA3A 2K2PA 2KL8A 4M5DA 2AQ4A 4N8OA 1YK9A 4DPYA 2PFFB 3E3XA 1MMLA 4A46A 5IQQA 4YHHK 5JVGQ 1HQUA 2DKOB 2RJZA 1U1MA 2E1CA 4GV6A 4P2SA 5DG8A 3HTVA 1NSQA 4FPIA 1HKBA 3PM9A 4AD6A 2ZJRQ 3I5BA 3MURP 4J7CA 2ASMA 1WSVA 4RG8A 2HHHK 4CQ1A 1K73T 3AAWB 3AO4A 1N8RO 3TA1A 2XGPA 3VQPA 3MAQA 1MN7A 1U6ZA 1S6PB 1QDUB 3ZT2A 1S5JA 4LQ3A 4Y34A 5IWAJ 3M30B 2HK2A 1O5JA 2ATQA 3J7AP 3MI7X 3GQCA 2A1RA 3SSSA 3CIZA 5F9NA 2UV8A 2FGCA 3K57A 5DM7Q 1RT1B 2YHWA 1N88A 3ISNC 1NDCA 3CF5Q 1WI6A 2CWKA 2LU1A 2V9KA 1GAOA 2RNEA 4FDFA 4MMOA 3BO2A 3MOZA 1IJEB 1VIXA 1YI2N 5HVFA 4LIWA 2CVEA 3N4WA 1SIZA 5KPZA 2ZKUA 2YPZA 4BBYA 2RKIB 4FXVA 4LRFA 4ID1A 3IRXB 3NH2A 4LSNA 4Z4GA 2V2KA 2EC0A 4DG1A 1NGAA 2UXCJ 3M1FA 3B6PA 4JKBA 2ZBCA 3LTOA 4C4WA 4F4XA 1L3TA 2KJVA 4QU6A 3PYEA 1DARA 1FNOA 3Q8SB 2DFEA 2W1BA 4PPDA 5DQGA 4TY8B 3M8SA 3DOMA 4ITSA 3PTWA 4C48A 4CIOA 2YWHA 3CD0A 3NKYA 4NLGA 1WHVA 1YTAA 3P5TL 4DL3A 4A48A 2WW4A 2B5JB 2HPUA 2XC9A 3UCUP 1NSKL 1H1VA 3L4BC 2RHSB 4JBCA 1X4DA 1FNXH 1ZBHA 3TEHB 3E51A 3CJTA 2RU3A 3J7YP 5C2CA 2CVIA 2HMIA 1RWOB 2V50A 3MMCB 1NLVA 4WZQA 1JLFB 2WTFA 1PAUB 1S0MA 4CZJA 1T3VA 3CMES 1Y3JA 4NYFA 5BYRA 3KHGA 3IKMA 3NGZA 4JI3F 2Q2RA 2Z2LA 3NH0A 1WF2A 3QB0A 4DLEA 3NCIA 3QLHA 4O3OA 3ET6A 5LXYA 2XYHB 1Q9XA 3MR6A 2UP1A 1O13A 1M1HA 5D0GA 4JN4A 4B3SJ 2DISA 4N76A 3R5DA 3CJBA 3P5BP 1RT1A 2JFKA 1A5VA 2A0FB 3A12A 2W9BB 4W5NA 2E6LA 1S1WA 1KAXA 4JI2K 1FVQA 3UKRA 2QWRA 1UWBB 2VG6A 5I4MA 1FXRA 5M1OA 4DV2K 1TVRB 1S1VB 3FJ2A 1WEZA 1QHAA 2YWKA 2DPNA 1RT7A 3IR7B 2P9KB 1AZSB 2P9UA 5JLHA 2UXDJ 1VK0A 3T1YJ 2ZHOA 2ERRA 1NUEA 4HH0A 4QZVB 3O4WA 3TZZA 4W5OA 5E0OA 2OIHA 4B1ZA 2HBZB 5KAKA 5BYSA 3DXMA 1RBAA 1QE1B 2MQOA 1J5OA 1XNRK 5BRDA 4MKVA 4OYMA 3CCWA 1LQ9A 3GYGA 3P5JA 1QVGM 2HF3A 4Z37A 1NK4A 4IWVA 5FDLB 5F8LA 4CZEA 3H7HB 2DNLA 3GJQB 4YMEA 3BN7A 2QKKA 3I0SB 5HMZA 4OZ5A 4DQIA 4XH5A 1UVKA 5BRHA 4ECQA 3PVXA 2RDDA 3QO9B 5CYMB 3JTOA 4F02A 2BW7A 1HMVB 1Y00A 1N5QA 2DB1A 3QRQA 3PZPA 3W2VB 2Z8QA 2NRWA 3IAYA 2LLZA 5FLXY 4KO0B 1GLAG 2HRUA 3AJ2A 1LW2A 5AT1B 3H8YA 4CEBA 1S79A 2MKYA 4LF9J 4KV8B 1X4GA 2QWPA 2HHXA 3L3VA 4DKWA 2QLWA 1L3KA 3MUMP 4JB8B 1JNRB 3D68A 4JKCA 1I3OB 2HFUA 4CEAA 1NJIO 4PXDA 4LF7F 4OYZA 4USJC 1TL1A 1NU0A 4CVNE 3L8BA 1NDPA 1X9WA 1M5KC 4AUKA 3CCRN 3Q22A 3SCJE 1QQOA 1RHQB 2D0OA 4TU8A 3NAHA 2A41A 3TP2A 1G4CA 2QE5A 5CHIA 3BS9A 2J0WA 1R8AA 3TUJC 4BRLA 4B8CA 1LWCB 5L9NA 3ZLJA 5HLFA 1RWMB 4ZVQB 5HQLA 4PL8A 4N47A 3W61A 1RT5B 2CG8A 4M45A 1B3TA 1XN9A 1W97L 4I0WA 3ENVA 3DDIA 4PXBA 3SUPA 1MW7A 3V1RA 3BSCA 3M2VB 4C23A 1TKZB 3MEKA 4DR2K 3GJTB 2O8FA 3J81O 4CO5A 5JLFA 1HQEA 5ADZA 1S9EA 3AVKA 5HRSA 4LRCA 5HMWA 4AHCA 3BV8A 3MD3A 2R7OA 4NLXA 3H5UA 1HRHA 3FRZA 4HTIA 4CJKA 2BRLA 1S6UA 3OVNA 2D69A 3HF5A 4BC9A 4JKAA 4IBNA 3UFCX 1QTNB 5CCMA 1X3NA 4U96A 1OY8A 3N4PA 1TVRA 2DGQA 1S6PA 2IRXA 3AODA 3GFZA 4M1KA 2H65B 4NZ0A 4MIAA 3FEXB 1FDDA 4B3SK 2XMAA 2VGMA 4C0HA 2OPSB 3D3BJ 4QW8A 4PZVA 3L7UA 3MAAB 5KG4A 2JDJA 1WC0A 3JXUA 1HA1A 1JLFA 1P9QC 4RW9A 1IWGA 3O9SA 5AE3A 5ETPA 3TPQA 4DN9A 1Z4UA 1N33J 1OIAA 1LWFA 2PMZD 3FGUA 3BP8A 3AO5A 4ELVA 1R0AB 2LQBA 2W7OA 1DT9A 4DCHA 3PG9A 2VPXB 4EEYA 3ZSWA 3H40A 2HBJA 4CT8A 4ECVA 3MCAB 3PIPQ 1S9GB 3CI5A 2HBRB 1OYEA 3C16A 1U2CA 2IVNA 4U7UK 4BLGA 5ETTA 1VQ9N 4LBHA 3L09A 4TXSA 1NEEA 2W40A 1IKYB 3B54A 1KC8T 1YJNS 3L2RA 4W98A 2P9NB 4NLBA 3ZZ0A 5E41A 2MKKA 2V2ZA 1CJTB 2JVRA 1VQPN 3AXKA 5KG5A 3DXBA 2AJFE 4OLBA 5AQUA 4ED2A 4EHUA 3EVWA 1K44A 1FJGK 3OHAA 5J2MA 3CD6N 1S6QB 1Y7PA 2O8BA 3QWPA 4FWKA 3KLHA 2D0BA 5L1LA 3CFPA 3G82B 1NGFA 3DGPB 2Z58B 3BZCA 7FDRA 3C15A 5IOLA 2WB4A 4PABA 4TYAA 2XSJB 1H3DA 1UJ4A 3I0SA 3HT0A 1UAWA 2C2EA 3MN7A 5FDLA 4F0KA 2DNGA 4IOAL 4KQZA 4H03B 2B8PA 2Y1LB 2QMXA 4ED0A 4TN2A 3M6WA 4CLKA 3ZYYX 3RVCA 5D78A 1ZM9A 4DHYA 1N6QB 2CAJA 3MXHP 1NK8A 4E7KA 4DZ6A 1SJQA 2XZWA 4CP5A 1NNEA 3G96A 3MDFA 2YJFA 4IG0A 2DY4A 2PD1A 1VQ4S 4ENOA 3MECB 2ZC3A 1CVJA 4OL8A 2FJVA 3VMFB 5E84A 4W5RA 1TYQB 1KLMA 2ZZMA 1YJUA 4QWCA 1AXQA 3C65A 2QSWA 3H2LA 3SIPB 4LFCJ 4AM6A 2CWXA 2VPWB 4DU8A 3ILJA 2NPFA 1YBTA 3G9CA 3G6ES 3PRDA 3OS2A 4AQYF 2YKNA 3IMQJ 1VBZA 1HWLA 4FOIA 5DZ7A 3K0SA 4U67L 4ZMMA 4DOZA 4ZVRB 2V34A 5BN8A 3DWLA 2NXJA 4KHQA 2R3VA 2ZZTA 1EETB 4V19X 3TAEA 3D0HE 4PWWA 2B6AA 4YORA 4K8RA 1FA0A 3CW2C 3NF8A 2DR5A 3I8BA 4JS5A 1KEKA 1XI1A 2LQJA 1VR6A 2ATCB 2KKHA 3MX5A 2IMOA 5HRRA 2W9CB 1MROB 3GFYA 4JI1F 4BRCA 3QPIA 4JI8F 3KWGA 2H5IB 4DV6F 1TL7A 2VH7A 1AT1B 1WSRA 2V9WA 2ZGZA 5H1SV 2GAHC 2DNYA 1E6YA 2ROPA 1CJKA 1ZM3A 4USTA 2GMJA 1D8YA 4BVOA 3UIQA 4A8KA 1FFSB 3SQGA 2EWSA 1HFEL 3SDEA 2Q1NA 1ZM2A 3GJSB 3HVTA 3MCPA 1VC5A 1RDRA 4ZPTR 1TUVA 4EUVA 3CVKA 1VJWA 3PEJA 1Q7LB 3RAXA 2YCHA 3DLGB 4ZVFA 3GDQA 1B99A 1R8BA 3HVTB 4TU7A 2AJ4A 3BF1A 4G1IA 4DSKA 1C0TA 1CJKB 1SJFA 1Q16B 1X4AA 1CC8A 4LRDA 2D9OA 3TVYA 3AO2A 1YJ9S 4DV2J 2WVCA 4CTAB 4LFCF 1H73A 5B08A 4AXIA 1VQPS 3O4QA 3V9WA 2OEJA 1VOMA 1T44A 1S97A 4M42A 3LP1B 4HTLA 1VQ9S 2J9CA 5AQRA 2J4RA 1YAGA 4DR6K 2OPQB 2AGQA 4ZPVR 4F4YA 2PFDA 1NGHA 1QVFR 4OJ1A 4JI0F 1HHSA 3DN9A 1WDTA 2UVVA 3WBZA 3R7BB 4M3UA 3OLBA 5C24A 2MDAA 3CM6A 4F50A 3HSDA 4G9ZA 6FDRA 2CQ3A 3BO4A 1RQ0A 1X0FA 1VQLS 5T7LB 3G71S 3SJJA 1SH0A 3SAFA 5EWFA 4DZDA 2J76E 4YHHF 1RAAB 4GMKA 1RHRB 4JI5F 2RAQA 1SUQB 2BACA 1NBEB 2HNDB 1XNQF 4Y2CA 3NXZA 2R8GA 1WC1A 3FLCO 2IA6A 2R7TA 3T5JA 1S1VA 4RBTA 2EX3A 2XRIA 2BJ9A 4J9LA 4FJ8A 8RUCA 3H6EA 2WZ1A 4B3MK 3UDCA 1PBUA 1XR5A 4J9UE 1KWMA 5CY4A 2C3UA 1H2TZ 2YH1A 4Z4IA 2WVBA 4HCBA 4EP4A 2AX1A 4ZS6A 3VQAA 2IYIA 3ZFVA 1EO1A 1IR0A 1K47A 2H9ZA 2AV5A 2BDPA 4KTWA 3JTPA 2HFSA 4ANEA 2YNFA 4L74A 3T7ZA 3CJQA 1QQCA 2NLWA 4CLLA 2O8EA 3D28A 1RB0A 4TKTA 2CQIA 3QGGA 2XMKA 3T19A 4ETXA 2Z2YB 3D2EA 4H0YB 1VQ8S 1B0VA 1O6XA 4KAIA 1WDDA 1RHJB 4NLTA 3DOKB 3OYHA 4CRJA 3AH6A 3VGLA 4GKJK 3RG6A 1TFYA 1U1QA 1SC4B 2DNOA 4NLVA 3UQSA 2RRAA 3FR0A 3CFOA 4DPUA 4FWPA 3SV3A 4DPTA 2VFTA 4NYZA 2IVOA 2FDNA 1CJUB 5D3GA 3K59A 4JYAJ 1YG0A 2RILA 4X4VA 1WC6A 4KV8A 4ZJQA 3WXMB 3OYLA 4ISGA 1WORA 1EETA 5FRNA 1NMNA 1UOCA 3NH1A 3AJ1A 1XEZA 1VIOA 4Q44A 4RNNA 2V0NA 3J7Z5 1S12A 2YKPA 3FC9A 4FWMA 4DFPA 3EE9A 2A2CA 1A7GE 3O3GA 2W24A 1ATNA 4RU2A 1ZBSA 2J5AA 4MH8A 4GO7X 1HBUA 1PYSB 4MYTA 3M8PA 4LF9K 4LR9A 2V68A 3RR8A 3NWGA 5LL6Z