4LSNA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 131
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lsnA05
1UA0A 3ZT0A 1RILA 3MFHA 4NLXA 2Z1JA 3GYNA 3F73A 5F8LA 4E0DA 1S1UB 1FK9B 2W9BA 2YNIB 1HPZB 1K6YA 3AVBA 4KI4A 4TY8A 1IKVB 1LW0B 3MEDB 2W9CA 3SI6A 4KB7A 2FBTA 1S48A 1WAJA 2IMWP 2AJQA 3FSIA 3UIQA 3NDKA 1Q8IA 3EPGA 3RR8A 3PJWA 3RWUA 2DFHA 3NMAA 3AO1A 1QHTA 5F9NA 1TKZB 5F8HA 5KG7A 2KFNA 4NRUA 3L2WA 2I1RA 3UQSA 4J9QA 4EBDA 1BGXT 4BWJA 4WFZA 4OPJA 4E7KA 3QZ8A 1T94A 3OVNA 4DU1A 5KFWA 1VSDA 3TAFA 3I0RA 1S0NA 3O4QA 4J9RA 5CYQB 3MTKA 4DQSA 1NK8A 4OKEA 2WONB 4RW6B 5KFSA 1C0UA 4TSXA 1C0MA 3HO1A 1QE1A 1O1WA 4LSLB 3MEGB 3A2FA 3NF7A 3WNEA 1B9FA 2W8LA 1RDCA 5HROB 1C2PA 4ELVA 4KREA 4CGFA 4NCGB 4CFDA 2X6SA 3M8QA 3JSMB 1MMLA 3AVJA 4CEFA 4BE2A 4GMJB 1ZBLA 3NH2A 1L5UA 3C6TB 4M3RA 5KI6A 4DTJA 4IR9A 4F50A 4YFUA 1RT5B 4J2AA 2JEFA 3TAEA 3RB4A 3K5MA 4NLVA 4J9LA 4M3TA 3KIOA 1D9DA 1UA1A 1IKWA 5DMRA 5C42A 1VSJA 3ZSRA 4K4XA 3AA5X 1D9FA 4NYFA 4XPEA 4OLBA 4IH5A 2OPQB 1QUVA 1L3SA 4CJWA 4O44A 2O4IA 3O4NA 3RAQA 3DLGB 2RN2A 2HMIA 1RT7A 3L3VA 3N6MA 1SKRA 4R8UA 4ZP6A 4CEQA 4J9MA 3PHEA 3VN5A 4M42A 2HNYA 3DDKA 2B4JA 5CYQA 4O4GA 3G6XA 3HVAA 1C1CB 1HJRA 1S9FA 3P5JA 2AX1A 1U04A 4PWDB 1ZTTA 4B8CA 1NJXA 2XY6A 1WSHA 4CJ5A 1MU2B 2FJXA 2ZE2A 3V9SA 4HKQA 2XC9A 3L2VA 2XY7A 4Q0BA 4QWCA 3B6OA 1T8EA 1K1SA 1U48A 1UWBB 2I5JB 5CZ1A 5J2MB 2WHOA 1JLAB 3NGYA 4E1MA 3IGNA 5SZTA 4K50A 2ILZA 4HYKA 1UOCA 5J2QA 4CJSA 3RAXA 2VG5B 3PR5B 3BQ1A 3ULDA 3QYYA 3PX6A 4J9PA 3KK2B 1TKXA 5KT3A 2O5DA 1HMVB 4ELUA 4CK2A 4E7HA 1ASUA 3T1AA 5KG4A 2XCPA 4CK3A 2YNGB 3LPUA 4DQQA 4CHYA 3SJJA 1FKOA 1T03A 3C6UB 5KFXA 3N6NA 3LP1A 3NH1A 2WK4A 3VQSA 4F4KA 1S1XB 1RT2A 2WOMB 3Q8SB 4O55A 1NJZA 4H4MA 4DF8A 4W5NA 1LW2A 3GIMA 3ZSZA 4CF1A 1NK6A 4FJMA 2V9WA 3D45A 1RT6B 1TL1B 3ZCMA 3QGIA 4RW9B 4KV8B 5CY4A 5KG2A 1IG9A 4FCYA 4EP5A 3OL6A 1C1AA 5KFQA 3HVTB 3HYFA 4TYBA 1VSLA 2IC3A 4QWAA 4FLZA 1HQEB 1S97A 4O3PA 1K1QA 1N48A 1BQMB 4BDPA 2C28A 1FXXA 4ECSA 3AO4A 4QAGA 1T7PA 3OSPA 3OYGA 4ICLA 4QWBA 4CHQA 3AVAA 4IOBA 3QERA 1R0AB 4EEYA 2E6MA 3VQ4A 4HCBA 5KFGA 4MKBA 3V1RA 2R2SA 4ZP8A 4C8KA 4M3WA 3G86A 3OLAA 1S9GA 3FFIB 3OLBA 3T5LA 1U09A 1DTQB 4DL4A 2FC0A 3SUNA 2JLEA 2BR0A 1RT4B 2UVRA 1KLNA 3NFAA 4QWDA 3ZT4A 4KE5A 1YVUA 1HQUB 4K4UA 2FJVA 2R2UA 5J2NA 3ZSQA 3HK2A 4CEAA 3T19A 3ZT3A 4CJTA 4HHTA 4M3YA 2J6UA 4FLUA 3DLRA 4M3ZA 5KT4A 1RTJA 4CF8A 2YKMA 4CGGA 1JLEA 5HBMA 3NGZA 3HJFA 3LPTA 4GW6A 4YR0A 3HVRA 3IG1B 1TAUA 1IKXA 3VQPA 1RNHA 2BANA 3QNOA 4ZHRA 1RT3A 2Z1HA 4DS4A 1ZETA 5JS2A 2W42A 1HYZA 4RUCA 3V81A 4CGJA 1NK7A 1JLGB 2VG7B 3DOLB 3IGVA 3RB0A 1TK0A 2OA8A 1ZYQA 1SKWA 1I39A 2ATQA 4HUGA 4FLVA 2GIRA 1KHWA 1SUQA 3ITHB 1RBUA 3OYJA 4KKOB 1REVB 5DQGA 1Q9XA 4TYAA 1BI4B 3DMJB 2VA2A 2P1JA 3AO3A 2R2TA 4DL7A 2A1SA 3HVWA 4RW7B 5KFEA 5KT7A 3DRRB 4DSJA 2RDIA 1TQLA 3K5NA 4HCCA 2D3ZA 4MK9A 4QWEA 4B9TA 4J2BA 3TI0A 3VQBA 2EHGA 4F4XA 2IM3A 1NHVA 4RW8B 4DTMA 4YMEA 4RZRA 3D5MA 1JLCA 1LWFA 3MXIA 4KPYA 4CFCA 2JEIA 1WN7A 1RTHA 3Q8RB 5T14A 3SQ4A 1W9HA 3RMDA 4KFBA 4ECTA 3SUOA 4FJLA 5I42A 4EO8A 4N76A 3HL8A 3BGRB 1N6QA 2IA6A 4DQRA 2O4GA 3GV8B 2HNZA 3NBPB 1LWEB 3SQ1A 5CZ2A 5J2PA 3AVGA 2A1RA 3KLFA 3DRSB 3ZT1A 3DLKA 4FJXA 4I2PA 3MFIA 3TR8A 3V4IB 2IOCA 4AHSA 4C8MA 3M9MB 1SL1A 4CJKA 4KTZA 4OGEA 4NLSA 2OPSA 3ALYA 3QGGA 1BL3A 3HT3A 4RW4A 2VWKA 4MQ3A 1IM4A 4B08A 3OYBA 4RUAA 3EZ5A 2G8FA 1DTTA 2QV6A 5FDLB 5T7BA 1LWCB 3PZPA 2XRIA 4CFBA 1JKHA 3V6DB 3DLBA 1QTMA 4GC7A 4F8RA 2XO7A 1U45A 1WAFA 3V1OA 2OYQA 4ED2A 4DTSA 5CYMA 4KB0A 1FKPA 3HSTB 1SV5A 3MXMA 2FBVA 1VSKA 4KHQA 2EX3A 3DI6A 3I0SA 3DLEA 3TANA 1CSJA 4CHPA 4HUFA 4BACA 3KK1B 3D28A 1SH3A 1N56A 1BIUA 2UVVA 1JLFA 3LP2A 3BSOA 4DTRA 2QKKA 3CJ3A 4CF0A 2ZD1A 1B92A 3QIPB 4QPXA 3CFPA 4XO0A 2XCAA 3DM2B 1ASWA 4CEDA 2P5GA 4IG3A 1RBRA 4E7IA 2G8UA 4N41A 3TAMB 5EUHA 2YKNA 3KK3A 2KQ2A 2D0BA 4RNMA 3H2LA 4YR2A 2V4QA 2JEJA 1YTAA 1SL2A 3VA0A 3VQ9A 4XPCA 1RA7A 5KFKA 4E89A 4FJJA 3H4DA 4ID1A 1LAVA 2OH2A 3SCXA 1XC9A 2IDOA 3ZSOA 1WNEA 2RKIA 5DK5A 4DEZA 4CESA 4JS5A 4DL2A 1ZTWA 1RT1B 1J5OB 3LZIA 4I2QA 2HHSA 3KHHA 1S9EA 4HTUA 5KFCA 4O4RA 1EETB 3JYTB 3MEEA 4ECUA 5KFZA 1QAJA 2HNDA 5J1EA 1KFSA 1C0TA 2FJWA 4FZZA 3KJVA 2R8JA 5KT2A 1HARA 3E01A 2D3UA 4F2SA 3B6PA 1RTDB 3UPFA 1S6PB 4AHCA 3DOKA 4KHYA 5C24B 4Y34A 1Q9YA 4DG1A 2FBXA 2HVIA 5HP1A 4IG0B 2IJNA 4EO6A 3QGHA 4KO0B 1KTQA 4DSEA 1KVAA 3LP3A 4DMNA 4FJIA 1JL1A 4DS5A 1D1UA 1XR6A 2R8GA 2JEGA 3TVKA 2XGPA 1NK5A 4DTNA 4DU4A 2VG6A 3QO9B 1J54A 1TV6A 1VRUA 4Z4HA 3NGIA 1JXEA 1HYSB 3KLHB 4DL5A 1VSMA 1N5YB 4ZVHA 4DSFA 2XY8A 2W8KA 2X78A 2GBZA 3KTQA 4ZPDA 3CDEA 2J6TA 2B5JB 3OYDA 4DQIA 1HNIA 3HPOA 4CHZA 4WZQA 3K5LA 1TP7A 4ECRA 5C25B 4H54A 2OPRB 2YNHB 4CK1A 1TVRB 3BSCA 1ITGA 3QLHB 3H59A 5KG0A 4GVMA 1S1UA 1FK9A 1T05B 4EYIB 3QEPA 2YNIA 1HRHA 1HPZA 1RDRA 5KFUA 4Y3CA 1S6QB 1IKVA 1LAWA 4KHSA 1LW0A 3MEDA 5KRTA 1WSEA 4LQ9A 3TAPA 2GUIA 3OL7A 2HHUA 2BQ3A 4FK0A 3M8SA 5FRMA 4NYZA 1DLOB 1B9DA 3SPYA 1C1BB 1Y97A 4CIEA 1JXLA 1QQCA 4W5TA 3LALA 3VQ8A 5FROA 4DTPA 2HVHA 1TKZA 3CFOA 4G3IA 1S1TB 1JIHA 3FQLA 4O3NA 2XY5A 1EP4B 4B8AB 1SH0A 3M8PB 4K8ZA 4ECYA 4WZMA 3NH0A 4H4OB 3RB6A 4CEOA 3QEVA 5KG3A 3QETA 4Q8FA 5KFOA 4KTWA 2UVUA 4F4ZA 4NYNA 5KFNA 1S1WB 4DLGA 3SZ2A 4ELTA 1KFDA 4ED1A 4EZ6A 1TKTB 1OS5A 4RNOA 2WONA 4RW6A 4BWMA 1RTIB 3KLIB 1GX5A 5DQIA 3ASMA 1Z26A 3BJYA 1D0EA 3VQ6A 4LSLA 3BQ2A 3MEGA 4EP4A 2FLLA 4G1QB 4WE1B 2B6AB 1CXUA 3RTVA 1S1VB 5HROA 2B43A 4NCGA 3GILA 4GC6A 1RCHA 1C6VA 3JSMA 1KLMB 3ZT2A 4JRPA 5HRNA 1QSLA 3QINA 3OYNA 1ZBFA 2QE5A 4J9OA 1JLBB 3C6TA 3KD1E 2IM0A 1RT5A 3U3YA 3VQQA 4YR3A 4PY5A 4ZTJA 3KMQA 4CJRA 3NCIA 1BCOA 4B9MA 4TQSA 3SQ2A 3CM5A 1HNVB 4MFBB 4O3RA 2PYJA 1NKCA 4DFMA 2YNFB 4M41A 2HHWA 2OPQA 4B9VA 1IKYB 5KG1A 1JL2A 4J2DA 4NCAA 4FJ8A 3OYCA 3SV3A 2KW4A 2ITGA 3DLGA 4CE9A 3DRPB 2BRLA 2HHQA 3DYAB 3OYFA 3H5UA 1TKDA 3QNNA 4PUOB 1D8YA 3V6HA 2KFZA 1C1CA 4ZPAA 2XGQA 3BQ0A 4LH4A 4OJRA 4CJQA 4URSA 3LAMA 4PWDA 3IS9B 3M8RA 2BE2B 1MU2A 4KB1A 1XHZA 1JLQB 1A5WA 4RNFA 4ECVA 4OKKA 5E41A 5DG9A 4B9SA 3FRZA 2D0AA 3OYLA 2PY5A 4IQXA 1ZBHA 4ECWA 1UWBA 4U7CA 1BIZA 2I5JA 2RF2B 2GC8A 5I3UB 5DLGA 5J2MA 3OY9A 4ID5B 1JLAA 4CJUA 4I7FB 3ZSVA 4R0EA 3KNAA 1BQNB 3PX4A 5KFYA 4ZMMA 3HPHA 3HHKA 3KLEB 3RRGA 4ZPCA 4CEEA 4MK8A 4KHUA 2VG5A 3HP9A 1BISA 1WSFA 1UAXA 2FVSA 4TY9A 2GV9A 2HHXA 3KK2A 1W25A 4M95A 1HMVA 4IRDA 5K14B 3NF9A 4KHRA 4AHVA 5EU7A 3IN5A 3G10A 2PZSA 1JX4A 2HB5A 3NE6A 4LSNB 1S0MA 2YNGA 5KGWA 3NF6A 2ASLA 3C6UA 4CJEA 3MR2A 5FRNA 3MAQA 4MK7A 2C2EA 5L9XA 1XR5A 3BREA 4OL8A 4O3OA 3ZSWA 3KOAA 4B3OB 3CIZA 1S1XA 3OYMA 2WOMA 1S4FA 2W7PA 4K4WA 3S3OA 3VA3A 1VSHA 3I8DA 4NLOA 4YP3A 4NLTA 3ZSYA 2WTFA 3RBEA 3L8BA 5DLFA 1RT6A 3FQKA 4WXOA 2J6SA 1TL1A 4B9UA 4NRTA 2Z1IA 4RW9A 4KV8A 3K58A 4WYWA 3IRXB 3D0PA 4M3XA 4FJ7A 4DL3A 2F8TA 4YQWA 4H8KA 3HVTA 4FJGA 4F3OA 4MIBA 4ED8A 5KG6A 3OL8A 2BQUA 4RG8A 4FM2A 1HQEA 1VSEA 4L8RB 4K4ZA 1XI1A 1SL0A 3I5CA 1KRPA 1BQMA 4Z4IA 5F8IA 3S9HA 1L3UA 2FVRA 4FJ5A 5KFLA 2DPJA 4IFVB 3LWLA 4C8NA 5HLFB 1R0AA 4FM1A 4CGDA 3HXMA 1L3VA 3FFIA 4B9NA 4FS2A 4LH5A 4CJVA 1DTQA 4R5PB 3KKRA 3SYZA 2DFEA 3RMAA 1RT4A 3NL0A 3ISNC 1VRTB 2F8EX 4EYHB 3CJ5A 1HQUA 2HAIA 4EZ9A 4ECZA 2R8HA 5D3GB 1NOZA 1RBVA 1VSFA 3L2RA 4PQUB 2E4LA 3ICLA 1EKEA 3IG1A 1N4LA 4PA1A 3QZ7A 4CJ3A 3V6KA 1JXBA 4E7LA 5KFIA 2KZMA 4BE0A 3RRHA 4IFYB 4IDKB 1IO2A 5L1IA 3BSAA 2LSNA 1JLGA 2VG7A 3DOLA 2OPPB 1U49A 3KLGB 2AGQA 2IAJB 4FVMA 1TL3B 3VQEA 3MECB 4IRCA 4E7JA 3ITHA 4WYLA 3GIKA 4KKOA 1REVA 1VK0A 3EZUA 1BI4A 3DMJA 3G0ZA 3V6JA 3AVIA 4CJLA 4CJPA 3KLVA 3M9NB 3NHGA 2PYLA 2IM1A 4RW7A 1QSYA 4FS1A 4FJNA 3DRRA 4KHNA 1XR7A 1ASVA 2BDPA 3T5HA 1WSIA 2E9RX 1QSSA 4RNNA 2W9AA 3QEXA 3PW4A 2XHBA 4JRQA 5DGBA 2W9BB 3HPGA 3TABA 3K59A 5SWMA 4RW8A 4WFYA 4ZPBA 4TY8B 5EWEA 2W9CB 3U3GA 4XIUA 2AQ4A 2HHVA 2QXFA 4MH8A 5KT6A 1YTUA 4NLWA 3F9KA 3BR9A 5KFJA 3AO5A 4K4TA 4CF2A 3UDLA 3BGRA 4M94A 2KTQA 3RR7A 3V9WA 4KHMA 5F8JA 2YHAA 1EXQA 1GOAA 3NBPA 1LWEA 3SUQA 2DPIA 1Z25A 2C22A 1WLJA 2ZQBA 3DRSA 4DU3A 2JC1A 3K2PA 3V4IA 4OKJA 3QESA 3I0RB 3BSNA 3SQ0A 1GX6A 2AU0A 4Y2CA 1X9MA 3CJ2A 2ALZA 1EX4A 3OSNA 3WNHA 1C0UB 1NK4A 1QE1B 2Q3SA 3CDWA 2D0CA 3PY8A 4KTQA 1GOBA 3BDPA 5FDLA 4LQ3A 2D5RA 4DSKA 1LWCA 3H98A 4JV0A 2XWYA 4ZVGA 3T5JA 3V6DA 5KG5A 4Y1DA 4ECXA 1NK0A 3CYMA 4JLHA 4ED3A 4FZYA 3OL9A 4KBIA 3M8QB 4CERA 1QAIA 1NKBA 3H5SA 1KHVA 1SKSA 3KK1A 4CJFA 4DTXA 4NLPA 4CHOA 5L1JA 4W5RA 2FVCA 2P5OA 4FBUA 3MR5A 1TGOA 3QIPA 1RBTA 4Q43A 4E19A 3DM2A 3RMBA 2AWZA 4MIAA 4FW1A 2UVWA 2OZMA 4J2EA 1S49A 3TAMA 1IKWB 4OGCA 1SH2A 3E51A 1ZBIA 3C94A 3PO5A 5C42B 3CFRA 3N6LA 4O5BA 4TQRA 3IAYA 2Z1GA 3U6FA 3VQDA 3QIOA 2G8IA 4ZVFA 4O44B 5HRSA 2HMIB 1RT7B 3PR4A 4R8UB 2G8KA 1A5VA 2HWHA 5KFVA 5EWFA 4NLQA 4CEBA 3KKSA 5KT5A 4Z4GA 2HNYB 4LD0A 4DQPA 3CQ8A 3H5YA 3L3UA 4O4GB 2G8VA 3OYKA 3HKWA 2BRKA 3P1GA 1RT1A 1J5OA 3HM9A 4IR1A 4KRFA 4Q5VA 2CJQA 3AO2A 1EETA 3OYEA 1G15A 3JYTA 2ZE2B 4M45A 3PW7A 1KSPA 4Z0UA 1A5XA 4TLRA 3SV4A 4KAZA 4Q0BB 2RDJA 4E3SA 2VA3A 1RTDA 1S6PA 5C24A 3AA3A 2HWIA 2FBYA 1X9WA 3PV8A 1RBSA 3KHLA 5HRPA 4Y2AA 4IG0A 4JV1A 2ETJA 3O3HA 4KO0A 2ILYA 3NGDA 4QW9A 1J9AA 3AA4A 2C2DA 1S10A 3SUPA 5J2QB 3SI8A 4CF9A 4NLRA 2RPIA 2IJFA 3AA2A 3C95A 2CKWA 3QO9A 4FLTA 3QEIA 1TKXB 4CCHA 4TXSA 4W5OA 1NJWA 1HYSA 5KFFA 4BE1A 4ZTFA 2FVPA 3KLHA 1RYRA 4NLYA 4AHRA 1VSIA 4O0IA 3NKYA 4UQGA 1N5YA 3EYZA 4CGHA 1TK5A 1FKOB 1T03B 3TQ1A 2WRMA 2AGOA 1S0OA 2B5JA 3LP1B 4JS4A 1KCFA 4N5SA 4NZ0A 5EDWA 2AGPA 4IKAA 1RT2B 2GIQA 5C25A 3GV7B 4Q8EA 2OPRA 5KFPA 2YNHA 3GQCA 4Z4EA 1TVRA 2IBKA 4DFKA 3QLHA 2FLNA 3VQCA 5F8GA 4F4YA 4H4MB 3AVNA 1LW2B 1T05A 4C8OA 3OS2A 3CJ4A 2F96A 3LZJA 1CZBA 1S6QA 3Q8PB 4ZVEA 2BQRA 3OYHA 2P51A 3QEWA 2WB4A 1QS4A 2VWJA 4DFPA 2E9ZA 1J53A 1DLOA 1NKEA 4U6PA 2IC3B 4KHWA 1C1BA 3VQAA 1WSGA 2F8SA 3RBDA 4ICLB 4KI6A 5KGXA 1S1TA 3LWMA 1TAQA 4Z4CA 1EP4A 3KHGA 2UUWA 3M8PA 4KAIA 2QKBA 4FBTA 3CO9A 3Q8QB 4H4OA 1S9GB 3OS1A 1RA6A 3VQ7A 2DTUA 4QW8A 4Z4FA 2BGGA 1WNSA 3H40A 1S1WA 1CXQA 2IGIA 4NLGA 5L1KA 1KVCA 5KTQA 1TKTA 4URGA 1YT3A 3O3GA 1RTIA 3KLIA 2W7OA 5J2NB 4ECQA 2OZSA 3CDUA 2R8KA 3S3MA 1F21A 5HRRA 1RTJB 3AVMA 4G1QA 3THVA 2YKMB 4WE1A 2B6AA 1JLEB 5HBMB 3V1QA 3NAEA 1KVBA 5JXSA 4DWIA 1S1VA 1IKXB 2X74A 2BANB 5EWGA 4IRKA 3LAKA 4ZHRB 3EPIA 4J9KA 5DG7A 4NLUA 1RT3B 3PUFA 1NHUA 4QOZB 1BHLA 1GOCA 1KLMA 3PW2A 4X2BA 4RU9A 3V81B 3OHBA 3NAHA 4YNQA 4CHNA 2V4RA 3S3NA 3K5OA 4AHTA 4FW2A 4DTUA 3PVXA 1JLBA 3V9ZA 3WNFA 1SUQB 3MR6A 3NF8A 4DTOA 3AVLA 4OPKA 2G8HA 4DL6A 4WXWA 1RDDA 3KMSA 1HNVA 4MFBA 3T3FA 5JS1A 4ED6A 1I6JA 3CJ0A 2UUTA 4FK2A 2YNFA 2G8WA 1NNDA 3SFGA 1IKYA 1NOYA 5C5JA 2AX0A 4CEZA 2R7YA 4OLAA 3DRPA 2V0NA 4DSLA 3L2UA 3DYAA 2WCXA 1LV5A 4PUOA 4FLYA 2ASDA 3AVHA 4AH9A 3T5KA 2Y1JA 4URQU 4IBNA 1YVFA 1JLCB 1LWFB 5KRSA 3K57A 4FJKA 3IS9A 3P83D 2Y1IA 1X9SA 2BE2A 2R8IA 3PO4A 1RTHB 4O3QA 4TN2A 3AV9A 1I3AA 4KFBB 4HVJA 4M3UA 1JLQA 4NCBA 3ZSXA 5I42B 4F2RA 1RYSA 4Y1CA 1X1PA 4OVLA 1N6QB 3L2QA 5DGAA 3PJXA 1RDBA 2HNZB 2FVQA 2RF2A 5I3UA 4N47A 5DQHA 3RMCA 4ID5A 2QK9A 3LP0B 5J2PB 4I7FA 3H5XA 4DLEA 1BQNA 3KLFB 1W0HA 4F4WA 3DLKB 3KLEA 4I2PB 4K4VA 4MKAA 3G6YA 3CWJA 1U4BA 3TAGA 2E6LA 2ATLA 1CZ9A 4IKFA 4J9NA 3SNNA 2OPSB 4FLXA 4O0JA 4RW4B 3I5AA 5KFHA 4ZP7A 4HUEA 3TAQA 4ZP9A 2YHBA 1BCMA 3PX0A 1S5JA 5K14A 3TWHA 2NUBA 5KFBA 4DF4A 1DTTB 3V9UA 3FDSA 5KFMA 1TK8A 1JKHB 4LSNA 2FLPA 3OYIA 5L1LA 2D41A 4N56A 3G6VA 3KHRA 2ASJA 4I9QA 3CG7A 4QCLA 4KSEB 5JUMA 5CYMB 3GIJA 1FKPB 4NLDA 4FM0A 3RB3A 1U47A 1ZBUA 4DFJA 4W5QA 1SV5B 4B3OA 3H08A 1T3NA 3MXJA 3KD5E 3I5BA 3DI6B 3I0SB 3DLEB 4Q44A 2XI3A 1WSJA 4CIGA 1JLFB 3LP2B 2EC0A 4FYDA 4B9LA 3CM6A 1L3TA 3UR0A 3GV5B 3H4BA 2ZD1B 2ZKUA 4BDZA 4IH7A 5F8MA 3O3FA 3WNGA 1XWLA 3PW0A 5KFAA 4FXDA 4IG3B 3IRXA 3PW5A 3AVFA 4ED7A 2YKNB 2IM2A 3KK3B 2YV0X 2IS3A 2DFFA 4EBCA 3LP0A 4IH6A 3OJSA 4AHUA 3OS0A 4C8LA 3DLHA 1D5AA 1CLQA 5F8NA 2KZZA 4IFVA 1IH7A 5HLFA 4Q45A 4K4YA 3OJUA 1NK9A 1NJYA 4I9LA 3NAIA 4FLWA 4RNHA 3OHAA 2RKIB 3M9OB 4K4SA 4FJ9A 1XHXA 1RAJA 4R5PA 3VQ5A 4I2QB 2XI2A 3MF5A 5KFRA 1S9EB 1RDAA 1Z4UA 3TARA 2X6NA 1VRTA 2C2RA 3GIIA 3LDSA 3MEEB 2HW3A 3AVKA 3HP6A 2HNDB 4JV2A 4CIFA 5J1EB 1C0TB 4WFXA 3KJVB 5D3GA 3E01B 4AILC 4F3TA 4PQUA 5DG8A 3DOKB 4FJHA 4CGIA 4DG1B 4EBEA 2JC0A 5HP1B 3CVKA 2JGUA 3MR3A 4FK4A 3SFUA 2D7SA 3QIDA 2E9TA 5KFDA 5F9LA 3V9XA 4IFYA 4IDKA 1HYVA 4J9SA 4DSIA 4BDYA 2OPPA 3ISND 3KLGA 2IAJA 4JUZA 4E1NA 2HHTA 4O3SA 1TL3A 2VG6B 3SPZA 3MECA 1TV6B 1VRUB 4FZXC 3OYAA 5KFTA 4LY7A 2R2RA 4CECA 3AVCA 4ED0A 4K8XA 2DY4A 3LANA 1HNIB 4CJ4A 3EY1A 4CFAA
chains in the Genus database with same CATH superfamily
3ZT0A 5C2CA 2Z1JA 5JMNA 2CXEA 2B9XA 3BB5A 2YNIB 3W9IA 1K6YA 2AA4A 5M1OA 4ZVTB 3K2YA 2ZC4A 3OTEA 2IY5B 3MEDB 2HZVA 3VAMA 3SI6A 1S48A 2IMWP 1GLBG 1RHMB 2GMJA 2V4JA 2J0SD 5GAEI 5A2QY 4GO7X 2XB2D 3SCLE 5M1QA 1BGXT 4FPBA 2MQLA 4A8OA 3PM9A 1T94A 3QZ8A 1D8ZA 1RGIA 4ES2A 5KFWA 4DU1A 3I0RA 3O4QA 5DM6L 4LF2A 2VF3A 4JI1K 5LY3A 1LQ9A 1UP1A 3DXMB 5BN8A 2VBYA 5CYQB 1X0PA 2E66A 4CJ7A 3HHLC 4DQSA 1M90T 1NK8A 2WONB 2CGLA 1C0UA 4EGLA 2VUGA 2P9KA 4CIOA 2E20A 4ZIWA 1RB0A 4Y2IA 1LFWA 3VWSA 2GCFA 2IDLA 3O3LA 2QO3A 4KREA 1Y5NB 2Z4PA 2QM1A 2QL7B 1HHQA 3JSMB 3BYRA 1PC4A 3N4PA 1H38A 1VR6A 2E5LK 4MT1A 2ROPA 4DU7A 1XQIA 4JKHA 4M3RA 4GKKF 4F50A 4YFUA 1RT5B 5JVGL 2JEFA 1K73O 1VQPS 1QVFM 3KIOA 3KUEA 1TL4A 4B3SF 3J81U 1UA1A 1KN6A 1PILA 4OI2A 5D78A 1FERA 5EX5A 3CUNA 4M8LA 1D9FA 4IOAQ 4HI2A 4CD1A 4XPEA 2OPQB 1QUVA 4DR7J 1TTHB 1L3SA 2VPZB 4CJWA 3O4NA 2FD2A 2CPJA 1RT7A 1SJRA 3N6MA 4PXBA 2Q0RA 3PHEA 3VN5A 3DDKA 5CYQA 4O4GA 3HVAA 4OYPA 3WC0A 2YX4A 3G82B 4ZA1A 2CJAA 4CJ5A 2FJXA 1M1GA 4OZ3A 1RWKB 5AZJB 5I9EB 5E3CA 1XNQK 2MHNA 3R6GB 1UPMB 3PHTA 4Q0BA 4KH4A 3B6OA 2OKQA 1WEZA 4KGVB 2VH7A 4KR0B 2MY7A 5J2MB 2WHOA 2OCEA 2MLYA 2XHCA 2G4BA 1JB0C 2G1HA 4BR9A 5DM7L 1UOCA 1EX8A 1IBKK 3D1OA 3J7AP 4OZ0A 3E66A 3PR5B 1JMTA 4B1WB 2WSCC 4GV3A 1F2HA 3ULDA 3QYYA 2XS7A 3UDVA 3T6JA 2OUGA 3KK2B 3VEZA 3OFGA 2O5DA 1X4AA 4ELUA 4M63C 4DV7K 3FC9A 4E7HA 1YAGA 1M5OC 1ASUA 2LYVA 4BRDA 4HACA 4FWPA 2YNGB 2DNHA 3LPUA 4FOEA 4PR6A 5KFXA 2QL9B 3I96A 4PKIA 1M90O 2C2NA 3VGUA 5AQGA 2WK4A 4AM7A 1S1XB 1RT2A 5BPMA 3PYGA 3QQCD 2MMYA 5B0AA 4W5NA 3CD6S 3ZSZA 1DHMA 5AR0A 4RW9B 5CY4A 2YI1A 2IJRA 1YITN 4XEIA 1OY6A 4NI2A 4EP5A 3HYFA 5EX0A 4FXWA 4FLZA 1HQEB 1Z1ZA 4UW2A 1K1QA 4BDPA 1U8WA 2C28A 1FXXA 4ECSA 2V2KA 2R7SA 3AO4A 1T7PA 4QAGA 3OSPA 5DM6Q 1NXIA 2FTRA 2OEMA 3MCAB 1R0AB 1GXUA 4U8YA 2ADCA 2DY9A 3VQ4A 3UDEA 1BE4A 1AFJA 4DUYK 1Z2ZA 2P9LA 3C2PA 2ZBPA 4J7CA 2R2SA 4YUDA 2ZZMA 4H0PA 3OLAA 5LMNK 5M1PA 3DU6A 2EG2A 1S9GA 2OHDA 4B3TK 5I4MA 1IV0A 1UKUA 1UETA 4LFBF 2CWKA 3SUNA 1GK8A 3NFAA 4TU9A 2ZH6A 4K4UA 2Y0BB 2FJVA 2YH1A 3HK2A 4DR5F 2APOA 1QVGR 4M3ZA 5KT4A 3A5LC 2YKMA 1YQHA 5HBMA 4GW6A 3VQPA 1VQNS 2O3DA 3DKDA 1IBMF 3QJLA 2KDOA 3OR1B 4ZHRA 3M30B 3DFEA 4DV6J 1U02A 4DS4A 3PJ9A 5JVGQ 1OYDA 5JS2A 4LF6J 1HYZA 3LGNA 2KT3A 3M8YA 2M8HA 1YHQS 4CGJA 2H3EB 2A1BA 2EEYA 4YN3B 4YB1P 1WI8A 1QY7A 4LR9A 1SKWA 2ATQA 2GIRA 3J7ZO 2Y8WA 3B4MA 3FJ2A 1H1VA 2VC0A 1AZSA 1RBUA 3FGUA 1X4HA 3BDEA 4KKOB 3D0GE 4TYAA 1BI4B 2A2CA 2VA2A 2CPFA 4BR5A 5ETKA 4JD2B 2Q43A 5KT7A 4DSJA 2RDIA 3N5BA 4LRCA 4PXCA 4KH1B 3OV7A 1OH6A 4ILGB 4FYWB 2DD8S 2QLXA 4B9TA 1PYSB 5LOQA 1NHVA 2MZTA 4ANCA 1T9VA 1WG5A 4DBQA 3TZZA 3MXIA 1KAXA 4X62K 2G0IA 2CAJA 4CFCA 1GLAG 3SQ4A 1W9HA 3P31A 3CCMS 4M5LA 1PCAA 5I42A 2R7UA 5DM7Q 3BGRB 3EXYA 4XH5A 3MR7A 2NZ4A 5GMDA 1LWEB 3U9ZA 2DHHA 3SQ1A 5CZ2A 4OFZA 3DAWA 3FE1A 5ADXA 4I4BA 1JJ2R 3MDQA 3DRSB 3FK4A 3CMQA 1X3NA 3UCGA 3KVGA 1FFSB 4FJXA 3MFIA 3THXA 2HOEA 1KQKA 3OVAA 3OA9A 3M9MB 1SL1A 2LU1A 1P90A 1KWMA 1BL3A 3HT3A 2YWHA 2VWKA 3R7NB 4JI1F 1IM4A 5H1SQ 1W97L 1PGZA 3EZ5A 1DT9A 1DTTA 3WT0A 3DLBA 2OTLN 2N82B 4F8RA 2JVOA 5B0GA 1WAFA 1IR1A 2E2PA 2X1AA 2EK1A 4KGMA 3ZZZA 2OI2A 3TWZA 4A8FA 4GKKJ 2LFVA 3HSTB 4I6YA 1VMBA 3I0SA 3TANA 4CHPA 4B3SJ 3KK1B 1S77D 3GONA 3LP2A 2QFJA 2QIFA 4MIWA 2CPHA 2E5LF 2I38A 3NXZA 4CF0A 2ZD1A 3QIPB 3CFPA 1FRIA 4QS8A 4XO0A 2XCAA 1UVNA 2MQPA 4CEDA 2PSZA 2G8UA 3TAMB 3HT0A 3KK3A 4USTA 4CVNE 4Z2XA 1VHIA 2D0BA 4YR2A 3MURP 2DO0A 4XPCA 4J91A 1VQ5S 4FJJA 2V8HA 2L9NA 2UUBK 4P10A 2D1KA 1XC9A 3D0HE 5CXTA 2XYGB 5GAHP 3H2VE 3CJ7A 2RKIA 1Y3JA 2A18A 4I2QA 5BPNA 4BRQA 1RADB 3KHHA 1S9EA 5KFCA 2B9YA 2DHXA 1ESVA 1EETB 1NEEA 4ECUA 2MB0B 5KFZA 4GVEA 3I87A 2FJWA 2JLGA 4ZK7M 3KJVA 2R8JA 3C3LA 1WSVA 2D3UA 4UY8T 3FZKA 3B6PA 1XNQF 4KHYA 1JCGA 5HJYA 3VF6A 3H6EA 2FBXA 3ETMA 5HP1A 5A6PA 1F60B 2PC6A 2IJNA 2B4OA 3TX0A 4KO0B 1QQMA 4ZJOA 4DSEA 3W5ZA 3JTPA 2VGNA 3Q8UA 3M32A 1U2RA 4YDUA 1NK5A 1TL5A 3IXQA 1IBKF 4IJAA 4DU4A 1FWKA 3QO9B 2Q79A 2FDNA 1BD6A 1TV6A 3P96A 2HIYA 2P9CA 1N5YB 1BU6O 3W5XA 3P38A 4DV7F 4DSFA 2W8KA 2DHSA 2GQCA 3K9JA 2IRYA 1YJTA 2Z2LA 4FWSA 4JI8K 1ZXOA 3U8XA 1OSCA 3BN7A 3CULA 2Q66A 2OPRB 2YNHB 4LREA 4ZN3A 3BSCA 2KRBA 1MWZA 4GVMA 1FK9A 3H90A 1T05B 5ETPA 1HRHA 1HPZA 1NMEB 1QD1A 4Y3CA 2MY8A 3HX9A 1IKVA 5KRTA 5A76A 2MQMA 2XSJA 4LQ9A 1FDBA 3CDBA 3OL7A 1V3SA 3HCXA 4FK0A 2GIFA 1DLOB 1HBUA 1B9DA 3SPYA 1C1BB 3QFHA 5BREA 4CIEA 4W5TA 3LALA 3VQ8A 2XMTA 3BZKA 1N88A 3M1VA 4LFBJ 4O3NA 1R6YA 4RBVA 2LXIA 4B8AB 1XJWB 1U1LA 4Y2KA 4PRFA 4K8ZA 3N28A 1TL7A 4ECYA 3RB6A 3ENWA 3M6WA 4CI0B 4KTWA 4DR5J 1I94K 4F4ZA 4B3TF 5ETTA 4EZ6A 3J80O 3PFEA 3DDIA 4G6VB 4RNOA 4BWMA 1GX5A 2OP5A 5IS2A 5DQIA 1GLFO 1IBMJ 5HMWA 2EVZA 2BJEA 4AQYK 3K7RA 3HM8A 4RBTA 1XUPO 1IVZA 5BRDA 2H3GX 1RLCL 2B43A 3MMAB 4I1TA 4GC6A 1C0GA 2P9IB 2X1FA 3U1LA 3ET6B 3OYNA 2YWWA 1NPRA 1JLBB 3NVKA 2Q31A 1H2VZ 2VBWA 3G9CA 2CJYB 3U3YA 4CM0A 2GJIA 4ZTJA 2W01A 4CZJA 8ATCB 4B9MA 5KAKA 3CT9A 4QU7A 4OLOA 2O8EA 1KOOA 5K8OA 2EBGA 1X5PA 1PYOB 5KG1A 1JL2A 4WCEL 2V69A 5CYJA 1RABB 1KR4A 3A5MC 2KW4A 4ANDA 3DRPB 1J27A 4E8UA 3W63A 1FO1A 1TKDA 3QNNA 3FCVA 4GY2B 3BQ0A 4LH4A 4CJQA 3LAMA 4PWDA 4CNYA 5D0GA 2R4FA 2BE2B 2XMUA 4CT8A 1MU2A 5AFUA 4DDFA 4X62F 5BR9A 1NGFA 3AOAA 4XK8C 4Q7AA 4ECVA 5E41A 2VQEK 4ZCLA 4H5NA 1N34J 4IQXA 1ZBHA 1VQMN 4U7CA 2I5JA 2GC8A 3AD8C 4LF7J 2CZ4A 4ID5B 1JLAA 4NZ7A 4NA1A 3ZNUA 5GADU 3KNAA 1ELOA 3HPHA 2ZOMA 3KLEB 4JI1J 4JHDB 2ZUAA 3RRGA 3G25A 4CEEA 3EMTA 1Q79A 2VG5A 2IVPA 4LT6A 1FTRA 1UVMA 2GV9A 4CLPA 3ZZYA 3JAMU 2WVEA 4KHRA 2DGTA 2ZHAA 3NE6A 4AT1B 5DO2A 3HHNB 4IQMA 4KQZA 1NPKA 2GGPA 3LA0A 5LMUF 3KDOA 3BEGB 2C2EA 3ILJA 2E5LJ 4O3OA 4CYUA 3CXCR 2WOMA 2FUG9 1WUUA 2WBRA 4NLTA 3ZSYA 4CBWA 3NS6A 4LF1A 3FBEA 6FD1A 1RT6A 1BWFO 4KV8A 2ZNZA 4RWXA 4M3XA 2ZEJA 3DU5A 4FM2A 3OL8A 2BUPA 2R7TA 1VSEA 1KRPA 1FTCA 2QWMA 3KHYA 3UCUP 2LDYA 5KFLA 2DPJA 1NBWA 4CLTA 3EN9A 4Y0WA 1L3VA 4B9NA 4FS2A 3NGSA 2UUBF 3CSKA 1HNXK 2RDDA 3O08A 4GV6A 1UEUA 1DTQA 2QLBB 4R5PB 3GZ7A 3RMAA 1KQSR 5KQ8A 3S6EA 4WKYA 4WK1A 5RUBA 1Y5IB 2OMOA 4IYQA 1VRTB 5F0XA 2NXJA 1XNQJ 3CJ5A 1HQUA 3GSDA 4EZ9A 1SJFA 1Q18A 3HHLA 4ECZA 4M5MA 3WZ0A 4BC2A 2NRRA 2FY1A 3OFFA 3L2RA 4PQUB 2E4LA 1O5JA 1HWIA 1EKEA 1S76D 4PA1A 3QZ7A 4CNZA 2MKSA 1WWHA 2XMJA 2MKHA 1IBKJ 4C98A 5KFIA 2KZMA 3H3NO 4C0BA 3RRHA 4K5SA 2VG7A 3U1NA 3K8WA 1FI4A 3MM9B 3BH6B 3R3TA 4DV7J 4IRCA 1PJ6A 5KPRA 3CIMA 4CZGA 1NG9A 3GIKA 4WK3A 2AJ4A 2QL5B 1LOTB 3R9LA 4U7BA 3G0ZA 4CJLA 3KLVA 3M9NB 3NHGA 1P6TA 4NB4A 2LQ8A 4FJNA 4OLPA 4KHNA 1FNMA 1D9AA 1WB9A 2BDPA 2EW9A 1Y9OA 4LIRA 4KGKA 2E9RX 2LQ5A 2ZJQL 4JI8F 5L38A 3MM6A 2W9AA 3ZFVA 3OVBA 2GAGC 2BZ2A 3QEXA 2XHBA 2HBYB 1Q95G 4RW8A 1K44A 3A13A 4WU3A 3WX4A 4TY8B 1XMBA 3CJRA 5EWEA 2W9CB 2OD6A 3OVSA 1UPPA 2FHKA 4MH8A 5KT6A 3SXLA 1YTUA 3TJAA 5CAAA 3HF5A 2C3UA 2AIRB 4QQBA 4PG4A 1HHSA 1EXQA 1AB8A 4P73A 1GOAA 3FEZA 1DARA 2HVDA 4PKGA 3THYB 4JI4F 1W2BM 2EFOA 4B3TJ 5EOYA 4K0KK 4ZVPB 3FZBA 2ZQBA 3PKYA 2NR0A 2OTLS 2JC1A 4K41A 3WQPA 2V2VA 3SQ0A 1GX6A 1X9MA 2VV5A 2JL9A 2DR8A 2YWKA 4FF3A 2D0CA 4KTQA 1RBOB 1RAOA 5B08A 2VJVA 3BDPA 2D5RA 1NCLA 5IT9U 3H98A 3MX5A 3V6DA 3ZX0A 4AQYF 2HRUA 2EXUA 1PBUA 3CJQA 3S1TA 4ECXA 1NK0A 1VIXA 2CPXA 3NVMA 4XH1A 1YSJA 3ATUA 5JMVA 2E5JA 4CERA 1RAIB 5JVHL 1QAYA 4ZVOB 3GFHA 1RCOB 4NYPA 3PNIA 3M6GA 1FJGK 1KHVA 1TMJA 4NLPA 5IXUA 2X1GA 3C15B 1IXKA 4AYBD 1UEKA 2D3O1 2P5OA 2O8DA 3OR2A 4X64K 3AD9C 3UE5A 2VB6A 4NA2A 3DM2A 2E7VA 2AWZA 2MKYA 4MIAA 2UVWA 3MM7B 4OGCA 3A1YG 1U0HA 4M1KA 2QFIA 5C42B 1ATRA 3CFRA 3RYLA 2IYIA 2ASMA 3W9JA 5FLXU 2DJWA 1I1GA 3IAYA 1DFDA 3B54A 2XM3A 4OX6A 3VQDA 4O44B 1NSKL 2HMIB 1UJ6A 2HWHA 4AM6A 1X4EA 4NLQA 3CMAN 5M1FA 4I6MB 2R42A 2DNOA 2G8VA 4X62J 3HKWA 5ITHA 3HFKA 3P1GA 3D3BJ 1R6VA 3N79A 2DGVA 4ZVUB 5GMKa 3HM9A 2ZVIA 1F9HA 1EQYA 1G15A 3EVWA 1F5CA 4PABA 1KSPA 1URRA 4TLRA 3G8TA 1AYEA 3BGLA 3M2UB 4PXEA 1W7WA 4QYZK 2GELA 4QS7A 5AQXA 3AA3A 2VQEF 3Q89A 4O8KA 5A8WB 4Y2AA 3O3HA 1VIOA 2W4DA 3JXUA 5AXLA 1NSAA 4PL8A 2VFTA 2A10A 3K0JA 2RPIA 1VYAA 1I3OB 2CKWA 3BKTA 4FLTA 2KG0A 4KBOA 4JAXA 5LMUJ 3LTOA 4W5OA 4BROA 3VMFB 3CCQN 1HYSA 4ZTFA 2AT1B 1OVQA 5HAOA 2WSEC 1CVJA 4CBXA 2ZJQQ 2E7XA 4CGHA 5C12A 2A6MA 3TQ1A 3DRYA 1HBMB 4YB5A 4C11B 1KCFA 2AGPA 2F7TA 1FD8A 4JI3K 5C25A 4YOXA 5KFPA 2QYGA 1TVRA 4WKRA 4HHHA 1FF2A 3W2WB 5AQIA 3HOSA 1LW2B 4JI0K 4C6AA 3ATVA 3LZJA 1CZBA 1S6QA 1HL6A 4ZVEA 3OYHA 1BC6A 3FMWA 1NMNA 1J53A 1NH8A 5E84A 5IC6B 3OFEA 1WSGA 2UUBJ 5H9FK 4JN4A 2OD4A 1PC5A 1S1TA 3LWMA 2Q36A 1TAQA 4U9RA 2D0PA 3LH2S 3BEXA 4DR1K 2UUWA 1G3OA 3MAAB 3ZZRA 4H4OA 3OS1A 3IR6B 3VQ7A 3PEHA 1PJ7A 5AQTA 2V8VA 4Z4FA 5GINA 1WNSA 3H40A 1AT1B 1HNXF 3FBCA 4B1VA 2YQ3A 3KWMA 3NY0A 3FCHA 5KTQA 2XMWA 5FD1A 1RTIA 2W7OA 3AJ2A 1WBBA 4H0XB 1U2VB 2OZSA 3S3MA 3FZHA 5JVHQ 2J9DA 1CULB 3AVMA 3MMBB 2B6AA 3W2VA 4DX5A 3NAEA 1KVBA 2RQCA 1DEJA 5FPNA 3BKUA 1IKXB 1WKKA 4BRNA 1SKUB 1VDHA 2XNQA 1NHUA 2R7XA 1BHLA 1KLMA 3W8PA 2P9NB 2HAFA 3OHBA 3NAHA 4YNQA 3E9PA 3AB2B 3EGNA 4DTUA 3THTA 2J7WA 3MUTP 3PVXA 1G7CB 4I64A 1BA0A 3VAFA 2ZJRL 2J8AA 3UD4P 2EKNA 3VGMA 4BR2A 4OPKA 4DL6A 1QJHA 5JS1A 3D2WA 4CP5A 1NHKL 3I9V9 4C7QA 3SFGA 4B3MK 4BRLA 2F65A 3MPVA 3H2UB 2QWRA 5C5JA 2ZDPA 2R7YA 3CCUN 2V67A 1I51B 2XYPB 1FNOA 2HPUA 1RCXB 1VBKA 3W3SA 4PUOA 1UVIA 3T5KA 1VQMS 1R8CA 5DDOC 1B3TA 2DISA 2R9LA 2QA4N 2HQFA 1YVFA 1JLCB 5KRSA 2W2MP 1C0FA 4GKJK 4DU8A 1QQOA 3IS9A 1DGKN 1X9SA 2W41A 3NNCA 2HBZB 1RTHB 1JCEA 1O51A 4A8WA 3IA0A 4JI4J 4HVJA 1JLQA 4D3HA 1IUJA 1YBAA 4DX8H 4F2RA 1GLCG 3R2CJ 1N6QB 3L2QA 2B4PA 3PJXA 1RDBA 2HNZB 2FVQA 2LVWA 1B99A 3RMCA 3LO3A 3GL1A 3LP0B 4G9ZA 2RUGA 2HBJA 3H20A 1PIEA 1BQNA 1ZOTA 4F4WA 2BACA 4I2PB 4MKAA 3AGKA 3B6BA 4K0KF 3SNNA 2OPSB 1ZM9A 2KXHA 4OJ3A 4AQYJ 4O0JA 4NYOA 4HUEA 1BCMA 1S5JA 1XMQK 4DF4A 3V9UA 3CCEN 2Y8YA 4G1IA 3UKUA 1TK8A 1RUSA 1JKHB 3UN5A 4LSNA 1H98A 4IO9Q 1HUXA 3IWXA 2V8DA 2L9DA 7AT1B 1X4DA 3KHRA 4MLHA 1WOOA 2EFGA 5CYMB 3GIJA 1GLDG 3VGKA 1OH7A 4FM0A 1HFEL 1U47A 4W5QA 4B3OA 3H08A 3MXJA 1YKWA 3DLEB 2XI3A 3K9KA 2HBRB 4C1NI 3F9MA 3M3ZA 3FFKB 3HSCA 4FYDA 1FJGF 3EDRB 3ZZ0A 6AT1B 3CQXA 5F8MA 5BR8F 3O6QA 3PW0A 4FXDA 3GCXP 2UXDK 3TSQA 3GJTB 3J80Y 3AVFA 4WIIA 3CD7A 2DFFA 2KRRA 5BPLA 3SEOA 3LP0A 5T41A 4C8LA 1CLQA 1D5AA 3A8JA 5F8NA 5LT5A 3MZIA 1X5TA 4GMKA 3THPA 5FJ4A 2Z56B 3GFYA 4NE9C 2C2ZB 5HLFA 4Q45A 4K4YA 1MA9B 2HF4A 3OJUA 1JK9B 1NK9A 2WVBA 4I9LA 3VQTA 4ZLJA 4X4UA 4RNHA 3PDNA 1XBWA 4WP9A 3M9OB 1XHXA 4C8ZA 3SDEB 1IJJA 3MOJB 3THWB 2BJ1A 1Y64A 2VQEJ 4BRKA 1NZ8A 2HNDB 2OAUA 2QSFA 4WFXA 5D3GA 3E01B 1EKSA 2FQQB 3DOKB 3VESA 1SIZA 5CD4H 4PPDA 4CGIA 4DG1B 4C3KA 4H5TA 3J7YU 4FK4A 1H73A 3UKRB 1Q8BA 1FW6A 5E3RA 3P45B 2EI5A 5F9LA 1NRKA 4Z7CA 3V9XA 2ZJRQ 1KD1O 3ZETA 2CFXA 2JRSA 3PRDA 4O3SA 4WTOB 3C19A 4KC5A 2CQ0A 4Y00A 3CCVN 2UXBK 5KFTA 4LY7A 4JI5K 5CZVA 2NRZA 2RE2A 1F9FA 2FIUA 3I82A 2F4VK 2V7YA 3HKZD 4JYAK 3M2RA 4L76A 2YTCA 1ZM2A 3W7BA 5AZIB 2PO4A 4FPIA 4Y28C 4ZDNA 5IOLA 1GMWA 2VBZA 1UEVA 1F5AA 2DR5A 1VC0A 1A0OB 1UVJA 1LW0B 4DR2K 3TX8A 4KB7A 3QMQA 2AJQA 2VZ9A 3RUBL 4DR6K 1YVNA 1VQ9N 3QDKA 1OY9A 3PJWA 1VLOA 2L3MA 3AO1A 4LRFA 5A2QU 2GVZB 2AJFE 4OHXA 4NRUA 3L2WA 2HFZA 2I1RA 4EBDA 5HN0A 2WVFA 4OPJA 1VOMA 2P9SA 2B7CB 4DR1F 3TAFA 1QUPA 3UN2A 3MTKA 3MI7X 3U02A 4OKEA 2M7SA 4TSXA 1NUEA 1QE1A 4CZLA 2HFVA 4M5JA 4LSLB 3MEGB 3M2VA 3LDLA 4BRGA 4RL1A 4KHPK 1FJEB 1HIYA 3J7Z5 2W8LA 4CBUA 1RDCA 3AA9A 5HROB 4L72B 1KVJA 2XZTB 4NCGB 2C1EB 4CFDA 2J8SA 5AQVA 4CW7B 4DPYA 3M8QA 3AH6A 2V2QA 4NLBA 2HFOA 3AVJA 4CEFA 3N0VA 1P8GA 2D9PA 2IA0A 5CQGA 2HLTA 3H0PA 4DTJA 5ETQA 1RKIA 4CRJA 1FVQA 3FNNA 3RB4A 5K20B 3CMAS 1H74A 1GEHA 1D9DA 3R5GA 3MWBA 2GMHA 3A3NB 1EQMA 1P9QC 1VSJA 1D09B 4H5RA 4NYFA 4LF8J 2MQ8A 1X5OA 2O8CB 1NGAA 4OLBA 1U1OA 4GVBB 2DTJA 1TYQA 3O1WA 1M5HA 2O4IA 5E7OB 2RN2A 3HTVA 4B3MF 2AF6A 1HBOB 4CEQA 2WZ1A 4J9MA 2VGMA 5CCLA 2HNYA 4JKAA 1S57A 1C1CB 3UR3C 1HJRA 3RSEA 2HS0A 2NXUA 1GMUA 3D68A 3WQUA 4B8CA 2F9TA 4LF9K 2XY6A 1X4CA 4LFAF 4GKJF 2ZE2A 4H0VB 5CH7B 1SQFA 2MZ1A 1AXQA 3L2VA 1GFWB 2DGQA 4QWCA 4AXIA 5HI7A 1U48A 2UP1A 3IMQJ 2JHEA 4B1YB 4QIWD 3M7VA 3NGYA 3CCQS 4LR7A 3IGNA 4NMLA 5SZTA 3I56N 3JTOA 2HFSA 1R59O 2DGXA 3MMCB 4LR8A 2YKQA 4K43A 1EJ7L 2L41A 4BRMA 1MMDA 1N33K 2GQ2A 5HK4A 5KT3A 3NGTA 2M0GB 3EXCX 4KY3A 1AA1B 5GAGU 1XMQF 5HVFA 3T1AA 2XCPA 2MYFA 2GAHC 4CHYA 1FKOA 1T03A 3C6UB 3LGMA 2GV1A 2MQOA 3N6NA 3LP1A 2CG4A 2GNKA 3PFOA 3WXJA 1GAOA 4EI2A 2F4FA 5BR8J 1R8BA 4H4MA 4DF8A 3O5TB 3GIMA 1C4AA 5GADP 3BGUA 2DIUA 1N32K 5T7LA 3CPWM 4DV3K 3CHWA 2W4PA 4YDDB 1T0TV 1OKJA 5KG2A 3CIPA 4OYMA 1IG9A 2N4CA 1C1AA 5KFQA 4JEPA 2CPYA 3TTFA 3WC2A 1BQMB 3RGIA 2NRWA 2CJXB 3L6QA 3D0IE 1F0XA 2HHHK 4ICLA 3W62A 3QERA 4EEYA 5KFGA 1W2IA 3PKMA 3G86A 4RO0A 3GBTA 2LQ9A 4XAKA 1SCJB 3FFIB 1V3ZA 2O8BA 1H3DA 4DL4A 3R5BA 4J90A 3CCJN 2JLEA 2GTDA 1RT4B 2M4MA 4QWDA 4IXCA 4QU6A 3E8OA 4KE5A 5ETOA 3E2EA 2R2UA 5J2NA 4OPAA 3DGPB 4QYZJ 2XZWA 4CEAA 4IFEA 2LEPA 4CJTA 3ZT3A 4HHTA 4FLUA 5LJ5Y 4WFNQ 4CF8A 1TUWA 3HJFA 1R0CB 3I55N 3QNOA 3ENHA 1FXDA 1ZETA 1R0BG 2W42A 3AAQA 2KB2A 1K9MO 1OPZA 3V81A 5KQDA 3PG9A 4YOUA 1ATSA 3C16A 1Y11A 2GJFA 3DOLB 1TK0A 1H2TZ 1JJHA 2OA8A 1ZYQA 2F8MA 2W25A 4DZDA 1FNXH 4FLVA 1KHWA 5B0BA 3ITHB 3C6HA 3CCUS 1S59A 3QBWA 1RWNB 4WIQA 5DQGA 5GIPA 5DETA 4DKWA 1WKLA 3Q2SC 1BDGA 2PI5A 2P1JA 3AO3A 3GG4A 3T1YK 1ZM3A 5KFEA 1TQLA 1Q81T 3TSPA 4HDHA 2BV3A 3CEDA 2F4VF 3WEEA 3FEXB 2CA9A 2CZVC 2CQHA 1DY3A 3BF3A 3G6EN 1DQAA 4F4XA 2IM3A 2NUUG 4LVOP 1KEKA 2HRTA 4J5OA 3HOTA 2LMIA 3BBFA 3GCWP 3JS6A 3T7ZA 1LWFA 2EFNA 3O2IA 2ZH7A 2K1RB 2ZGZA 3Q8RB 5F1XA 4DR2F 3RMDA 2J0XA 2NLWA 2VFRA 4ECTA 5LJ3Y 2NPIA 3A8EA 2DCUB 5H9FJ 4N76A 4DR6F 3HL8A 4FF2A 4DR1J 2O4GA 3GV8B 3QAEA 5J2PA 2MTLA 3CCES 3AVGA 2O1PA 1QM9A 4PEOA 3SAHA 2A1RA 3ZT1A 4UZBA 3DLKA 1DRZA 4CT9A 3ZC4A 3SSSA 5D0HA 4QPTA 4C8MA 4X4PA 4OIXA 4RUHA 3TZYA 3ALYA 5A0YA 3WQTA 1MSWD 2I7NA 2QA2A 4B08A 3GPAA 2UV8G 1Q7YT 4LIWA 4PQAA 2QT7A 5L9NA 1E4FT 5FDLB 1U25A 3PZPA 1RWXB 2F5GA 1WG4A 3EEQA 3ZTQA 2XO7A 2MQNA 3V1OA 4KHPF 4DTSA 5A8KA 3GB0A 3TA0A 1FKPA 1HD0A 4E1JA 3TNVA 1VHFA 3MXMA 4NEYA 3O4WA 2MSSA 1N56A 1BIUA 2UVVA 1JLFA 3R5AA 1Z2LA 1X31C 1A9NB 2DH9A 2E1CA 2QKKA 2JFDA 2IIRA 1GLLO 1P9YA 4IG3A 4N41A 4UTGA 4DV5J 2YKNA 3ULEB 2MZSA 4P74A 3J7A1 1H2UX 2KQ2A 1RAHB 3K17A 1SL2A 3MM5A 3VA0A 3VQ9A 3O9QA 3ZEUA 4WFAQ 3H4DA 4F9OA 1N36K 1S6OA 2W6KA 5E3QA 1XC3A 4LFAJ 3ZSOA 3JB9k 3CD0A 1WNEA 4GKJJ 3TJ9A 4DEZA 4DL2A 5D77A 5A8RB 3HD1A 2FHMA 3KXDA 2HHSA 4GRSA 3C7NA 1X9JA 2ZWHA 1R89A 3ZZUA 2W40A 2N4DA 5J1EA 4LF9F 1C0TA 3CCZA 2ZH8A 1HARA 1PJ5A 5GAEU 1RWMB 1RTDB 3DXKB 4AHCA 4CZFA 5C24B 4F0KA 4Y34A 1VQ8S 2HLUA 1VJQA 4IG0B 1W26A 4EO6A 1KTQA 3QGHA 2E1AA 1A7GE 1NDPA 4FJIA 2KM8C 2CQCA 3H25A 2XWXA 1D1UA 1BXNA 4WU2A 4BREA 2JEGA 2Y0SD 2CJ9A 2VDHA 1J54A 3CJKB 2CQ2A 3PRVA 2YWEA 1JNRB 4JI6K 1N33F 1WOQA 4U96A 4DL5A 1VSMA 4ALZA 4ZVHA 4IZ9A 2CQGA 2NPFA 2XY8A 2GX9A 2GBZA 5AQJA 3AJDA 2FSJA 4ZPDA 1VQPN 4WF9L 2B5JB 2ACYA 1FRXA 4DQIA 5IWAK 1XNRF 1HNIA 3OYDA 1YWXA 4WZQA 1WKJA 3K5LA 1VQ6N 1VQ9S 2AYBA 1TP7A 4ECRA 2RIJA 3QWUA 2VD3A 4CK1A 1ITGA 2QA4G 4JKGA 2W1BA 3H59A 1S1UA 3O1BA 1YIJN 2DITA 2DXDA 1G6BA 5JJBA 3NMUA 1FDAA 1LAWA 4KHSA 4DI6A 1Y0HA 2EBEA 3TAPA 1N32F 2HHUA 4OYXA 4DV3F 3M8SA 1D3WA 2LEAA 1Y97A 2BOAA 2GA7A 2XG8A 1JXLA 5FROA 3OFHA 2HVHA 5DRKA 2QXLA 1TKZA 2WC9A 3GE9A 1EP4B 2HHHF 3HDSA 1SH0A 3OTCA 2OANA 2QWQA 4IWVA 4PYDA 2MKJA 1E6YA 2X51A 2XMVA 3QETA 1KAYA 4CLZA 4LRAA 4NYNA 4RUBA 5KFNA 4DLGA 4F26A 3KJNB 1KFDA 1PAEX 1OS5A 4RW6A 4USJC 3ASMA 3W61A 4DUZF 1D0EA 3FUYA 2FPHX 3SBGA 1TUVA 3L95X 3ENAA 3RTVA 5GVQA 3IAM9 1V4TA 2RS8A 1C6VA 2CADA 3W5YA 1NGIA 2BEFA 1CJTA 2RVJA 1NNEA 2FJBB 5HRNA 1ULRA 2ASYA 4ILMA 2HQDA 1WHWA 1WF2A 3HHDA 3IUCA 2KXNB 4ZPWR 1KP6A 3C6TA 2Y3YA 3SQOP 1KC8T 3JSYA 2DXFA 3VAGA 4YR3A 4CJRA 1SJ4P 3NCIA 3UNYA 3BM7A 2DVIA 1D4XA 1HKGA 1QAXA 1BCOA 4F36A 2BM0A 4TQSA 2MJNA 3CM5A 2F4VJ 4EAHD 3DWLA 2GVDB 4C0HA 3CD6N 4O3RA 2PYJA 4KJIA 1RBLA 3C66A 2YNFB 4B9VA 2AEFA 3T1YF 1IKYB 1FRLA 1MROB 4J2DA 4FJ8A 3KUGA 3OYCA 2GWJA 3DLGA 2QX0A 1VQ7S 2BRLA 4CO2A 2ADBA 1S6UA 3H5UA 1EZZB 1D8YA 2KFZA 4DR2J 2GWKA 4A62A 3D2EB 3F56A 3E9OA 4DR6J 1ZPWX 3UWTA 2D3OR 3HZGA 3I56S 1VK3A 5CABA 1XHZA 2LXUA 3LM2A 2BXJA 1VS3A 3P5TL 3FRZA 3SSQA 4OI0A 2D0AA 3P4UB 2X7IA 4ECWA 1UWBA 1BIZA 2RF2B 3VAJA 2DRAA 1JCFA 3A3OB 2NYIA 4I7FB 2FC8A 4CLLA 3PX4A 3EZWA 3BGOP 4HI1A 4TVAB 4ZPCA 5C10A 5EXWA 1K8KA 2EK6A 2VDIA 4KHUA 3HP9A 4DB3A 4TY9A 5C0YA 3B8AX 1RQ0A 1ZBSA 4WF9Q 1HMVA 4CI6A 5K14B 2Q6BA 4KHPJ 4X65K 2E5IA 1JX4A 2HB5A 5BYSA 4ITSA 4BHQA 4P7TA 1S0MA 4N8OA 4DPXA 2WTUA 4CJEA 3MR2A 4KGZB 3N4QA 5M1NA 5IZHA 4ES3A 3SBTA 1XR5A 4I69A 4UOFA 3KOAA 1S4FA 2YX1A 4LJMA 4K4WA 3Q8YA 3IC1A 1VSHA 2N3LA 5DDPC 2G1DA 1S0VA 3RG6A 3RBEA 3MCOA 2C3PA 3L8BA 3FQKA 2J6SA 1TL1A 2FGCA 4YOWA 3K58A 4WYWA 2CH6A 2M3DA 1UW4A 3POTA 1RK8A 2F8TA 3HVTA 2DNYA 2OFGX 4ED8A 1R8HA 3CCJS 4GVLA 4M5DB 5CCMA 3I5CA 4HLBA 3S9HA 1E6VA 2XTJP 2FVRA 1L3UA 4FJ5A 2ZWPA 1SJQA 4EIAA 4C8NA 5I3PA 2NUHA 1QVGM 4CGDA 3EM1A 3CDAA 1OYEA 1GXTA 3I55S 4CJVA 4LF9J 3SYZA 2CUYA 1YJWN 4JKFA 2M9KA 1CS4A 2L48A 1WBDA 1F3FA 1U1PA 3OUYA 2R8HA 4H0YB 3D4JA 1TR0A 2QMUB 4CM2A 2ZFHA 3O8WA 2PD1A 3IG1A 4M5NA 5JLHA 1N4LA 4RBUA 2HGMA 3BUZB 1YK9A 4RJVA 5M2UA 1UFKA 4BE0A 2P9PB 4IFYB 4IDKB 5HQLA 5L1IA 3AAWB 1HJOA 3SQGA 1JLGA 1APSA 3CC2N 1WG1A 5IFMA 1U49A 4K42A 2IAJB 3LDOA 1HNWK 2CGJA 4FVMA 3D6HB 4DCPB 3MECB 1LK5A 4HTJA 2P2CB 4E7JA 3IAS9 1REVA 1XNRJ 2B7BB 1VK0A 3EZUA 3DMJA 1Y00A 3P5BP 2CNNB 4JI6F 2PYLA 4IJNA 3TA2A 4RW7A 4MYUA 4FS1A 1YXQA 3DRRA 4Q2LA 1XR7A 1ASVA 3FVYA 3JTNA 4IDHA 3T5HA 3LDQA 2UYTA 5IWAF 2C3YA 4RNNA 1U26A 1N32J 4MMOA 2MQQA 4DV3J 5DGBA 4DPOA 3D2FA 4FWOA 4WFYA 2HVZA 1U1KA 3GOIA 2QEXN 1S22A 5TKYA 1NGGA 3S01A 3P4IA 4NPOA 2AQ4A 1JJ2M 3L4QA 3Q23A 2I2YA 4NLWA 3IR7B 2HHHJ 4N7TA 1WD6A 1X0FA 3MCNA 1K73T 3C6AA 3AO5A 2V4JB 3UDLA 4M94A 3RR7A 4KHMA 3WHIA 5F8JA 1ZH5A 2F40A 3NBPA 1WC3A 1Z25A 2C22A 1WLJA 3IFEA 4NMXA 2EPIA 3V4IA 3QESA 3I0RB 4DUZJ 2WBNA 4WTYA 1UL3A 1SB6A 3ILLA 2QI2A 5AQMA 1H7WA 4CLSA 3FBBA 3WNHA 2MGZA 3IM9A 1C0UB 1NK4A 2P9KB 3CDWA 3PY8A 2YJFA 1KQFB 5MLCV 1GOBA 2MZJA 2E1PA 1LWCA 3MK6A 4QZVB 3U1MA 5KG5A 2A2DA 4Y1DA 1X7VA 1IBCB 4LRBA 1OPIA 2ATCB 1RTZA 3CYMA 3WIUA 4ED3A 4A48A 1P1LA 4FZYA 3OL9A 2Z2YB 4P2SA 2E1MC 5E0OA 2DYAA 4BC5A 3UDCA 3MWTA 2IBOA 1VFJA 5AQZA 2PMHA 2QTWA 4A59A 3C8YA 4Q43A 3T1YJ 3ID8A 3RMBA 4FW1A 4J2EA 4QYRA 3H7HB 1S49A 4ZPVR 4WFBQ 1KKHA 3MTJA 2KYZA 4WQ5C 1ZBIA 1CJKA 4ZOSA 4MYTA 3M6VA 9RUBA 3N6LA 4O5BA 2Z1GA 3M4XA 3OXGA 1WEXA 4IOCQ 3U6FA 3QIOA 2G8IA 3EICA 4BC9A 4ZVFA 5HRSA 3TW0A 3KWIA 1RT7B 4HVZA 3O1LA 1YBTA 4FPAA 2CNOB 3NOGA 5EWFA 3KKSA 5KT5A 4Z4GA 3Q7BA 5BXIA 1EAYC 2A6AA 3R9PA 2HWTA 4WP3A 3L3UA 3CQ8A 4O4GB 5AQWA 1IWAA 4L6V3 2VPYB 2BRKA 3U7JA 1RT1A 1J5OA 1RU1A 4CLKA 2CJQA 4ZJQA 4TNOA 5K8NA 3EKSA 3JYTA 2W2OP 1RWWB 1FEEA 4LSZB 3HSGA 1A5XA 2R7OA 4Y2MA 3SV4A 4Q0BB 1FD2A 1SVDA 2OTJN 1S6PA 2XO6A 3O9RA 2HWIA 2FBYA 1F6TA 1RBSA 3KHLA 5HRPA 4JV1A 2IVMA 2ILYA 3NGDA 2AMCB 4OZ2A 4QW9A 3I32A 3AA4A 1RGVA 3SUPA 3SI8A 3MM8A 3JQMA 3GG1A 4JV5K 1VQLN 1GT8A 3TP2A 1KTVA 4CO0A 1VQ6S 4W4MA 4CCHA 4TXSA 2H1YA 1NJWA 4CH7A 3KLHA 3O9SA 4BRPA 1YIJS 4HACB 4X65F 2AW0A 4DV1K 3T6BA 1S0OA 4A2BA 4JS4A 4N5SA 4EHTA 4NZ0A 5EDWA 2F3JA 2O8FA 2WBMA 4IKAA 2OIHA 1RT2B 1CJUA 3OTOK 4Z4EA 2VPXB 2IBKA 3QLHA 5CHIA 4F4YA 3J7AN 3AVNA 2KYXA 3GJRB 4C8OA 1UVLA 1Q86O 3CJ4A 3H1VX 3FCWA 3RW7A 4UOGA 2AD9A 3QEWA 2WB4A 4NI2B 2V9KA 3PYDA 2H9ZA 4DFPA 1OWXA 3J7ZT 4TKTA 4CLYA 3VQAA 4Y65A 1NGJA 5GAGP 3NG8A 2CPEA 3SBMA 2P9LB 3M8PA 4KH5A 3CO9A 3Q8QB 1S9GB 4FSVA 3NRBA 3N9UC 4QW8A 3VEYA 4DR4F 3VCDA 2AJ2A 1S1WA 1CXQA 3LQVA 2IGIA 4NLGA 2KT5A 4ISEA 2CPIA 1TKTA 5HOOA 1YT3A 1LKZA 4U67L 1HHTP 3KLIA 3GFXA 2DNNA 4QBUA 3KNGA 3DOMA 4ECQA 4F67A 1TU0B 2PE8A 3GYXB 4G1QA 3THVA 2YKMB 4WE1A 4PYAA 5HBMB 4ISFA 3MMJA 4U95A 4N8NA 4DWIA 1S1VA 4HEA9 5EWGA 4ZHRB 3PUFA 3A3PB 4QOZB 4RLEA 3MMVA 4ISGA 3U4LA 1Y4ZB 3PW2A 1ZPVA 3G71N 1N0VC 3CCLN 4PG8A 4ILLA 4YDXA 1BUXA 1BO5O 4AHTA 5D0RA 2IDEA 4FOIA 3WNFA 4JI6J 3TUIC 2R7WA 2KM8B 1HNWF 3AVLA 1AZSB 5AXKA 3LPEA 2CVEA 1F9EB 1DQ9A 2ITMA 1RDDA 2G0CA 3LOUA 4DCOB 1HNVA 4MFBA 5IWAJ 1WI6A 1I6JA 5ADXH 4HWIA 3CJ0A 2AKWB 3D1QA 2UUTA 1KNZA 1Q78A 3ULHA 3AGRA 1ICEB 1Q53A 1TELA 2V0NA 3V5RA 3DYAA 2GZOA 4FLYA 3ENBA 2ZH2A 4EFHA 1WC1A 2HG4A 4IBNA 2VBXA 2GO9A 2D9OA 3P83D 1ZAVA 2Y1IA 2IVNA 2R8IA 3VF2A 4A8YA 4BRFA 3GDQA 5I42B 2XSFA 1B4SA 3NNAA 3NS7B 1J2VA 3QFUA 1RYSA 1X1PA 4L3NA 4CLUA 4FWMA 1P27B 5I3UA 4BGBA 5DQHA 2BVZA 1T9UA 4X4RA 1WC0A 3H5XA 4JKDA 4RTFD 2AYGA 3GWCA 4K4VA 4DV2K 3THXB 1NDCA 4BBYA 2CNLB 3TAGA 2AEJA 4DR3K 3AD7C 4U8VA 3JXOA 3R7BB 4ZP9A 2YHBA 3CXCM 3TWHA 2NUBA 1DTTB 2E29A 3TYTA 2FSNA 1OH8A 3OYIA 4UOCA 3G6VA 2ASJA 2ZGYA 3SAGA 3CB4A 4KSEB 1O6XA 4V19X 1TFWA 3W8GA 3RB3A 3L4IA 5B8HA 4NXNK 1QDUB 3KD5E 2H5IB 3BO2A 3I0SB 4ATNA 1T11A 3VVUA 3LP2B 4DCHA 4OZJA 4B9LA 3R2DJ 3QRPA 3GV5B 2ZD1B 5J1NA 3HI0A 4BDZA 3S8SA 3RW6A 4JOUA 5KFAA 1EKRA 4DL0C 3IRXA 4V19J 3J80U 3KK3B 3SSRA 1V9OA 3RAMA 2IS3A 1YJWS 5DS7A 1KQSM 3VEVA 3OJSA 3PRBA 3EGWB 2HGNA 3R6LB 4IFVA 1IH7A 2EFVA 5K5MA 4DCJB 1NJYA 3GE1A 4U67Q 5FPDA 3UE2A 2YPZA 2VPWB 1S4EA 3AY0A 5LL6Z 2P6TA 2RKIB 4K4SA 4FJ9A 4DR7K 2E5GA 1CBKA 4A8XA 4BS2A 4I2QB 2XI2A 3MF5A 1ZC6A 1P8ZA 5LSRA 1S9EB 4CZIA 3MCSA 3LDSA 2HW3A 1RAEB 2G2ZA 5BYQA 1SPBP 4QR1A 3R3LA 4CIFA 2ZNYA 1FKAF 2RB7A 3CC2S 3KJVB 3QSIA 2DHGA 4FWRA 4FJHA 4EBEA 5HP1B 1LOUA 1HQ2A 2JGUA 1R7IA 4YOVA 2E9TA 5KFDA 4YEAA 2WVDA 3TRGA 3TQEA 2K7JA 3J7YI 1HYVA 4J9SA 1YJ9N 4BDYA 2OPPA 3ISND 2DY1A 2W2NP 3M32B 4TU8A 3KLGA 4E1NA 4PZVA 2BYCA 4X65J 1TL3A 2HYIB 4JV5F 4F0HA 3TTDA 1TV6B 5HQ8A 4LUBA 2DGOA 4FZXC 1ZBTA 1NB7A 2Z57B 3OYAA 2M2BA 2R2RA 4CECA 2GUPA 5G0RA 3BBBA 1DAXA 4K8XA 1G1XA 2QEXS 3QRRA 2C42A 3CO0P 2NCKL 3LANA 3C0BA 4CJ4A 3EY1A 1MWKA 1RILA 4P71A 4NLXA 3VEXA 3IO1A 3C14A 5GAEP 3AXKA 4F25A 5IM0A 3F73A 5F8LA 3CCRN 1FK9B 2W9BA 3OTOF 2B0GA 1OIAA 1HPZB 1N5QA 3AVBA 3E1YA 3BO3A 3NS5A 1IKVB 2NNWA 2W6LA 2RQKA 1S7IA 2XSJB 2FBTA 3DRXA 4YOTA 3UIQA 1HBUB 1FX4A 2BKNA 1Q8IA 3TZWA 4J37A 3RR8A 3RWUA 4U7UD 4ILRA 3NMAA 1LNQA 2V68A 4DR4J 4I56A 3M1VB 2KFNA 3UQSA 4OO1J 4C0OC 1RHKB 1TL7B 4BWJA 4E7KA 2HIQA 2QRRA 3OVNA 4OYIA 3MN6A 4BGAA 1S0NA 1J5EK 5MAOA 2KL8A 2XS5A 3L7OA 4A8SA 2NLXA 2JNJA 2I6WA 4C9DA 3ZTRA 3QGPA 3HO1A 1ZS6A 2R7QA 1O1WA 1OMSA 3TUZC 2I8EA 4MLEA 3CW2C 4X4QA 2XHWA 1C2PA 4ELVA 2GHVC 2M5YA 1FJ7A 2U1AA 4KH0B 2L9WA 4CTAA 2XULA 2JOQA 1MN9A 4GMJB 1RHUB 2QMXA 3F5TA 5AFUH 3QPIA 3EE3A 1Q5YA 2LDIA 1UTAA 2A42A 4IR9A 1Q8LA 4DN9A 4J2AA 3K5MA 4NLVA 1U6FA 4J9LA 4M3TA 3OT9A 2UU9K 1K47A 1IKWA 2DRDA 5DMRA 1AUDA 2O8EB 2U2FA 3OQ2A 2VU5A 3T1HK 2KXFA 1WDTA 4DUYF 1CJVA 1EQ0A 1FFGB 4UZCA 4FNHA 4R8UA 5AQLA 3ID6A 4ZP6A 4M7XA 2B8PA 5LMNF 2DR6A 1GTEA 1IN0A 2OTJS 3DN9A 2B4JA 3G6XA 4H4KC 5ETNA 1NWKA 1S9FA 3P5JA 4PAAA 1U04A 2Z8QA 2DNLA 2WSFC 4PWDB 1SI9A 1MU2B 3V9SA 3UVJA 1ZZNA 1W7AA 2J0WA 4HKQA 2XY7A 1VQLS 2HBKA 1N8RO 1K1SA 5E3PA 2I5JB 5CZ1A 1JLAB 5BJRA 2MZRA 4E1MA 1YZ6A 4CH1A 4K50A 5J2QA 3VHQA 1HBNA 1S99A 2VG5B 4DV2F 3BQ1A 4J9PA 4DR3F 3D9BA 2ZF5O 4UUXA 1TKXA 2PFDA 5ETRA 2FZCB 1RWOB 3BS9A 3VAKA 2AP6A 5KG4A 4CK3A 2P9EA 5F0WA 4DQQA 2H4YB 5GAGI 1B0PA 2GGPB 4G1PA 2NRXA 2IVOA 3W64A 4UUWA 2P9UA 4CYUB 4CO4A 2WOMB 1T9YA 2K7KA 3Q8SB 3D3CJ 4CZMA 1UWAA 2LLZA 3T9ZA 4NXNF 4L74A 3TVZA 1HLUA 1UZDA 4CF1A 2KT2A 2V9WA 1RT6B 4MAKA 4OX8A 4A2AA 4PCQA 2KHOA 2YWFA 4KV8B 4LMZA 1YGYA 5C2DA 3CC7N 3MGJA 1V5IB 2J4RA 3MOZA 5K8PA 4A46A 3OL6A 4GV9A 3LPYA 1UCNA 4AE5A 4BR0A 4ZITA 1HPMA 2IC3A 1VSLA 4QWAA 2R7RA 1S97A 4KPCA 1N48A 2ROGA 5HMXA 3BZCA 1Q5VA 1YJ7A 2NXCA 4QWBA 4CHQA 3OW2R 3AVAA 1GMVA 4IOBA 4MKBA 4WJBA 2PFUA 2NZTA 3V1RA 4C8KA 4M3WA 2XYHB 3OLBA 1DTQB 2FC0A 2BW7A 3CQYA 2BR0A 2UVRA 4PXDA 1H7XA 3ENVA 4FKYA 1HQUB 3G71S 2RT3A 2C2MB 3S7RA 3HHLB 3CCLS 5ELZA 3GSIA 1RAFB 1GH8A 1SS6A 1NDKA 3T19A 5HVGA 2FHJD 4M3YA 2J6UA 1SAZA 2V5HG 3I4PA 1RTJA 1M1KO 1JLEA 4L3KA 3NGZA 2X1BA 2ZJPL 4YORA 3HVRA 4YR0A 2XMKA 4NOHA 2BANA 1Q82O 1UVKA 4UT4A 3EX7B 1RT3A 1HLWA 3OBIA 4NWBA 3VALA 2CPZA 3IP0A 4RUCA 4JV5J 4LBPA 2MZQA 2VOOA 2VG7B 3IGVA 3RB0A 4M5HA 2RE1A 3L09A 2Y9HA 1EWQA 2QN6B 1I39A 5THWA 3KG1A 3HRGA 2YKAA 1SUQA 2VQFK 1MLAA 4B02A 2KJVA 1TUGB 4RX6A 3OYJA 5C7PA 3I4HX 5ETMA 1HI0P 3M8WA 2C2KB 2BBEA 2R2TA 4MKYA 4DL7A 3MPYA 3F44A 4IEIA 5SUHA 4WQ5A 4FVUA 3OTOJ 2AP1A 4USHA 4QWEA 3BKFA 3MM6B 3TI0A 5I3QA 3GJSB 4RW8B 2J76E 3F2KA 1UZHA 4YMEA 4RZRA 2OO4A 3AA8A 3MWPA 2JEIA 1GLEG 5T14A 1HWJA 3KK7A 4KFBA 3HZEA 3SUOA 4FJLA 4OX9K 5F41A 2RU9A 5TKWA 4DQRA 4USVA 4JKCA 3GJQB 4I67A 3IBCB 5M2PA 4LF4K 3KLFA 1GTHA 4TLQA 5A6WA 3TR8A 1RISA 2WVCA 2YY3A 4KTZA 4A57A 2BE7D 4EHUA 4NLSA 4USIA 2QWNA 1J5EF 4RW4A 4MQ3A 2XMAA 3H8YA 4PG6A 3OYBA 4RUAA 3EE8A 2QV6A 3AB4B 1XMOK 4LBIA 2XRIA 4JBCA 4Z94A 3V6DB 5HMZA 4GC7A 2NQPA 2JWNA 1U45A 1T9WA 1HR0K 4ED2A 2E2OA 1U6ZA 4DHVA 4KB0A 2ALYB 3OPKA 1SV5A 2FBVA 1KVKA 1VSKA 2BH1A 4KHQA 1B7YB 2EX3A 3DI6A 1CSJA 4HUFA 4BACA 3D28A 1SH3A 5IQQA 2DNKA 4H5VA 3BSOA 3CJ3A 2O8DB 2FF6A 3OR2B 2JWLA 1B92A 4QPXA 2D4WA 3EVOA 2QLFB 1NGHA 3DM2B 2P5GA 2ZBIA 3ZTOA 1S3XA 3JSRA 1F5BA 4JKBA 1U0HB 4DUYJ 3R5CA 1NJIO 1PBAA 4XDDA 3WXLA 2UU9F 5LMNJ 3WX8A 3QJPA 4RNMA 1PSDA 2JEJA 2V4QA 3LGHA 4CO3A 1OO0B 1RA7A 2ZVSA 2GQQA 1HW8A 3KUHA 3T1HF 1LAVA 1K8AO 2OH2A 3SCXA 1O0PA 2NRTA 2IDOA 1FVSA 2MPUA 5DK5A 1I94F 4JS5A 3LZIA 2ABYA 3DHWC 2ZZTA 2Y1LB 2ZJPQ 2E2NA 2CZ9A 1BUPA 3MEEA 1YF5L 4B1XB 1QAJA 1KFSA 1YJ9S 1FRHA 3ONQA 1F3VA 3IMXA 3CNQP 2DT9A 2K2PA 2EG1A 5GAHI 1E4GT 4ZVSB 2HVIA 4DV2J 3K89A 5D4OA 1U1RA 2Z30B 2DHAA 5KOWA 4DR3J 1KVAA 3LP3A 4DMNA 1ZA1B 2DXEA 4DS5A 1N34K 2QLJB 3TUPA 2R8GA 3TVKA 4LF7K 2XGPA 2HF3A 2VG6A 1NU0A 1VRUA 2DBBA 4NASA 1JXEA 2CDRB 1HYSB 3CCRS 2LQJA 1WHXA 3R8YA 1N5SA 4QOTA 3LW5C 2YHXA 2X78A 2J6TA 4NXNJ 3QFPA 2RHQB 4CHZA 5C25B 4L75A 4H54A 3UCZP 1GNKA 4ZS6A 1TVRB 5AQQA 2QWLA 4EYIB 5F0UA 3QEPA 3WXMB 2YNIA 1S6QB 1VAZA 3VENA 3MEDA 2HQCA 2PMZD 1WSEA 1XK8A 4P7VA 2BQ3A 5FRMA 3IM8A 5FPEA 2HHPA 1QQCA 4BR7A 2DNRA 4DTPA 3PCOB 4YB6A 4G3IA 1S1TB 2V8PA 3FQLA 2XY5A 3WDOA 1X4BA 3D6MB 1RAAB 1U1MA 3FZMA 4H4OB 4CEOA 4USKA 3FLCO 1FJCA 2HK3A 5KG3A 1R8PA 2UVUA 3E3XA 4DPTA 4ELTA 3DXMA 4ED1A 2WONA 3WXIA 2C3MA 1RTIB 4BVPA 1MMNA 3GP9A 3G8QA 3VQ6A 3BQ2A 1DQ8A 4F4AA 2PI4A 2GEMA 4YOYA 3RZAA 2FLLA 2NSBA 4HH0A 2IMOA 1WHYA 2B6AB 2RRAA 3W2VB 1T9XA 1TUUA 2RS2A 2MSTA 5JLFA 4IO9L 1WTBA 3D67A 4AFFA 3W9HA 1QQNA 3JSMA 1KLMB 3ZT2A 4JRPA 3AARA 5LL6d 4WP8A 1HI1A 3QINA 3KZBA 3AAPA 5U47A 4J9OA 3CCSN 3KD1E 1RT5A 1G99A 3LL3A 5H1SV 3VQQA 2J7UA 4OYAA 3KMQA 2VQFF 4UF4A 1RWUA 5F3ZA 1U2CA 3DXBA 3SQ2A 2OSRA 1FHTA 3ZZOA 3O5BA 1IQTA 2MKCA 4J9VA 4M41A 2B56A 2OPQA 1UMJA 1TZ0A 2PDAA 3KFWX 1NO8A 3SV3A 5EGYA 2RUSA 1EWRA 3J81j 2HHQA 3SJHA 3OYFA 2H4WB 4PUOB 5CA5A 4KYZA 3D1HA 2XGQA 3SK3A 4YHHK 3IS9B 3M8RA 3G82A 3MPUB 2CQDA 3GMGA 1YBUA 3P39A 1RWVB 4KB1A 5AZJA 3D6FB 1JLQB 2M52A 1A5WA 4MTPA 5AQUA 4OKKA 3OYLA 4OX9F 1UJ4A 1FXLA 5J2MA 2AZ1A 4F0MA 5D6GA 3OY9A 4AF1A 1RHQB 3ZSVA 4R0EA 1J5EJ 1BQNB 4ZMMA 2Q97A 3NWRA 2MKIA 2CVIA 3NCRA 4LF4F 4MK8A 1YI2N 4Q2MA 1WSFA 4ILHA 4FZVA 4NL5A 5FIIA 5KOXA 3KK2A 3BP8A 2I0XA 4M95A 3MD1A 4JI8J 4AHVA 5EU7A 3IN5A 3AOCA 3G10A 2PZSA 4A8KA 5D0EA 3UKUB 4LSNB 2YNGA 4HTIA 1XMOF 1B7FA 2ASLA 1YUWA 3O6WA 3MAQA 4MK7A 1OVYA 5L9XA 5CR4A 3ZZPA 2H51B 3CC7S 2RQ4A 4OL8A 4BRHA 1HR0F 3NOCA 4B3OB 1S1XA 3OYMA 2HVEA 2W7PA 2VIHA 3VA3A 2M70A 4P2FA 3I8DA 4NLOA 1RFQA 5ETLA 3CJ8A 2WTFA 4LVNP 2ZKTA 2DO4A 5DLFA 3BY5A 2UU9J 1KD1T 1VCTA 2PBDA 2PN6A 4RW9A 4S0MA 4PKDB 2HZCA 1IJFB 3D0PA 5AQOA 4YQWA 4JI7K 2FJDB 4FJGA 4F3OA 4MIBA 5KG6A 2BQUA 3CI5A 3T1HJ 1HQEA 3UO0A 1JJ4A 4K4ZA 1XI1A 4J9UE 4ES1A 1I94J 3LWLA 4D3GA 5HLFB 1R0AA 5AQRA 1WDDA 1WF1A 5HL7L 2E44A 2DFEA 2YXLA 5AT1B 3J81O 1U2FA 2D69A 3ISNC 3NMRA 5KPZA 4FYXB 1WSRA 2F8EX 2G0JA 2IPOB 4DJBA 2HAIA 2ZBCA 3GLJA 1MWMA 4FYVB 5D3GB 1NOZA 2BA9A 4CQ1A 4FWNA 1RBVA 4JI2K 2G9OA 3ICLA 2CJBA 5L8RC 3K8VA 3FZFA