4LSNA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
549
structure length
549
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lsnA05
3M8SA 2UVWA 2GIRA 1K1QA 2IM0A 3BQ2A 4HYKA 1EX4A 3RWUA 1TL1B 3OYJA 3HL8A 5EWEA 1UWBA 1S1UA 5KG7A 5EWFA 4CERA 1XR5A 1MMLA 2YKNB 2HWHA 4DTNA 4KAIA 4I2QB 3F73A 3KK2B 3HO1A 2HMIA 4FZZA 4QWAA 2HNZB 4EYIB 5KFAA 1TKZB 3A2FA 1O1WA 5DGAA 3IAYA 5KFWA 1TV6A 4NLXA 2AX1A 2CKWA 4WZMA 3MEDB 3PV8A 1ASVA 2HW3A 2JGUA 1WSJA 3RB4A 4NYFA 3G86A 1X1PA 4FJJA 4IR1A 4CIEA 3DM2A 3NAHA 1U48A 3V9ZA 1TKTA 1Y97A 1UWBB 4RW4A 4CEZA 3PX0A 3M8PA 3NBPB 2WK4A 3QIPB 4O4RA 3NGYA 3PX6A 3T5JA 2HMIB 3BSOA 1HPZB 3HP6A 4NLQA 4O0JA 4TQRA 3CJ2A 4FM2A 4KB1A 4O55A 1NK9A 1TV6B 4ZVFA 5F8LA 4KHWA 1CZBA 1S48A 1REVA 2E9TA 4U7CA 4R5PA 1CZ9A 4KO0B 3GV8B 4B9MA 4ECSA 3DM2B 4FW2A 3VQSA 1TVRB 1SH2A 3KLHA 3M8PB 4O3NA 3ZSOA 1BCMA 3P5JA 3ISNC 1JLAA 1T05A 4OGCA 1S1VB 4W5NA 3H98A 4Y2AA 3HT3A 2R7YA 1RT3B 1JXEA 5FRNA 1RT4A 1REVB 3T19A 5DMRA 1EXQA 1TAQA 3SZ2A 4QAGA 2W9CB 4CEDA 2E6LA 1BQNA 3MR3A 4N41A 2QKBA 3OHAA 4MH8A 3WNGA 4Y34A 3KLHB 2PY5A 3LALA 3PR5B 2DFEA 4R8UA 1T05B 4IRDA 4AHTA 4RW8A 3VQDA 5CZ2A 5KT5A 1T03A 2HVIA 4Z4GA 1NHVA 3PX4A 1IO2A 3RMAA 1WNEA 1TL3B 3D5MA 3N6NA 3NH2A 1JL2A 4OLAA 1KFSA 3AVNA 4XPCA 2ITGA 4KFBB 3OYMA 3AVMA 5KFTA 4Z4CA 1WSFA 2UUWA 3CO9A 3AVAA 2BANB 4QWBA 2D3ZA 4CF9A 3QIOA 3PJXA 1UA0A 1Q9XA 4KHSA 1RTJA 4NYZA 3OJSA 3RRGA 4M3YA 1T03B 1S5JA 4RW7B 3S3MA 1XHXA 3ZT4A 1U04A 3MEGA 1C0TA 3DOLB 1BIZA 3LP0B 4ED6A 3L2WA 3K5NA 1JL1A 4CESA 3AVFA 1D5AA 4IDKB 2Y1JA 4HHTA 4TXSA 4KREA 5JS1A 2YKMA 1XHZA 5DK5A 3NL0A 3K58A 1HQEB 3PW7A 1N4LA 4ZPCA 1RTJB 2OPPB 2AJQA 3NF9A 4NLVA 2P5GA 4DSKA 3AVIA 3H40A 3MEGB 1C0TB 5HROA 3TAQA 3OL7A 4FW1A 3NAIA 4K50A 3SV3A 3M8QA 5DQIA 2ASDA 3BDPA 2CJQA 4ID1A 5C25A 4QOZB 4HUFA 4TN2A 2YKMB 4W5OA 1RBSA 2VWKA 4JRQA 3QGIA 4FJMA 5L1KA 1JXBA 4E89A 3SCXA 3L2QA 4B3OB 3AVHA 3CQ8A 1LW0A 3QEXA 4KPYA 2WHOA 1N6QA 3JSMA 1RT6A 4FLTA 4J9SA 3CDEA 3VQPA 3KMQA 4CJLA 4JLHA 4CECA 3SYZA 3LP1B 1Z25A 2IBKA 5HROB 4MIAA 4K4SA 4FJNA 4ECYA 4ECWA 2BE2A 3P1GA 4WXOA 5DG8A 4CGHA 2DPIA 3V9SA 3KHLA 3M8QB 2FVRA 1FK9B 3HXMA 5K14A 3NCIA 2JEJA 2IA6A 3QLHA 3KHGA 1K6YA 3KTQA 1ZETA 3QNNA 2WOMA 2HHXA 1C0MA 1ZTTA 4AHSA 1IKYB 4EBDA 3OS0A 3L2VA 1A5VA 3H5UA 4WFZA 1RYRA 1N6QB 3KHRA 1NJZA 4O3OA 1VSLA 2KQ2A 4W5TA 1Q9YA 2BDPA 2FLLA 2R8KA 1T94A 3GIIA 3HPOA 4KTQA 2JEGA 2IAJB 3M9NB 5K14B 1VSHA 2HHTA 2BRLA 2FBTA 2ASJA 3RAQA 3AA3A 3ZCMA 4IRCA 3PY8A 5F8NA 2FJVA 2HHSA 3NE6A 2GC8A 2WOMB 4FK2A 1SL0A 1SH3A 3OSPA 3I5CA 4DSFA 3KLFA 4H4OB 4RUCA 1ZBHA 1NKEA 3KHHA 4CHOA 4AH9A 4O5BA 3D28A 2D0CA 4FBUA 1VSFA 2HHQA 5KFJA 3KLIA 4CJSA 3VQ8A 4Z0UA 1MU2A 1GX5A 3PVXA 1QSLA 2YNHB 1RT5A 3ZSWA 5C5JA 3S3OA 2KFNA 4ZPDA 4TLRA 3BQ0A 3I0RA 4NLSA 4ZTFA 1TGOA 3UIQA 4E1MA 3DLKA 1HYSB 4F3OA 4KI4A 1HJRA 4FK4A 5C24B 4FJXA 3MFHA 4DTUA 3TABA 4B9TA 2YNGB 5CYMA 4QCLA 2UVRA 4EYHB 1J5OA 3VQAA 1S0NA 3KLIB 2JEFA 3V6KA 4AILC 2BQ3A 3PW4A 3NF6A 3TAPA 5KFQA 4WFXA 5T14A 1RT5B 4C8OA 4IFYB 4F4ZA 1S0MA 4ECVA 2W9BA 4IFVA 3I0RB 4JV2A 1QE1A 4RNHA 2GUIA 4RW9A 1JXLA 1FKOA 5DQGA 3MXMA 4FM0A 1J5OB 5DG9A 3HPGA 4CEOA 3U3YA 4DFMA 4YQWA 2DTUA 3AVGA 3IS9B 4YFUA 1YTUA 1RDCA 2P5OA 5DLGA 4OKJA 4CJ4A 4OPKA 4IFVB 3VQEA 4RZRA 3HSTB 1ASWA 3AVKA 2YV0X 1FKOB 1JLBA 4PWDA 3PO5A 5F8HA 4M3TA 4CFBA 3OYCA 5HBMB 5HLFA 4MQ3A 4RW6A 2E6MA 1U47A 1D1UA 5EUHA 3NGZA 5KGWA 3RR7A 2FVQA 4WZQA 3CDUA 3UQSA 1C0UA 1RILA 4O3QA 1RT7A 2R2RA 4Z4HA 5KFYA 4CJWA 3CWJA 2FJWA 3OYFA 2Z1GA 2UUTA 1KLNA 3DLEA 4KKOA 4NCBA 4Y3CA 1TQLA 4RNMA 4EBEA 2KFZA 5EDWA 1VSJA 3ZT1A 4E3SA 3E01A 1ZBUA 3PW0A 1JKHA 2XO7A 2VWJA 4RU9A 3IG1A 3LANA 5HRPA 1WAJA 3RMCA 4IRKA 1T8EA 4FJIA 3HVRA 2O4GA 4B8CA 4QW8A 3I8DA 4URGA 1LAWA 1Z4UA 2IDOA 1EETA 3H2LA 1C0UB 1LW2A 3EPGA 1RT7B 1RTIB 4IR9A 3V9UA 1F21A 4KKOB 1VSDA 2OZMA 1W0HA 2C2RA 2YNIB 3QEWA 2HAIA 4J9RA 2RF2B 3OL8A 4IBNA 2VG7A 4DF4A 4LSLA 1N5YA 2JC1A 2BQUA 3IG1B 4NLRA 2KZZA 1EETB 4ED2A 4H4MA 2ILZA 5DQHA 4IG0B 3SQ1A 1LW2B 3NDKA 2Q3SA 4Y1CA 3B6OA 2P1JA 3HK2A 3H59A 4FS2A 3VQBA 1I3AA 3G6VA 4MK8A 4DTPA 1BISA 4KHYA 4Z4IA 3L3UA 2VG7B 4F4KA 4LSLB 1N5YB 4DSIA 4J9OA 2W42A 4CHQA 2C2EA 4CJVA 4M45A 1RAJA 4WE1A 4BWMA 2XCPA 1HQUA 4MKBA 1S1WB 3AO3A 4H4MB 3FQKA 5J2MA 3KJVA 3OS1A 2XHBA 2PYJA 3SPZA 4CF8A 2LSNA 2IMWP 3ASMA 4PQUA 4CGGA 2JLEA 3DLBA 3T3FA 3OL6A 3LP2A 1KVBA 1ZBIA 2WB4A 1DTTA 4IG3A 1S1UB 1S10A 5KFGA 3GILA 4YNQA 4FJHA 1RBVA 3IN5A 4ZMMA 3QINA 4WE1B 3RRHA 4LH5A 5J2QA 2EC0A 5J2MB 2XC9A 4B08A 3KJVB 4E7HA 1J54A 2G8VA 4FXDA 4C8KA 3V9WA 2W8KA 3SUNA 2RKIA 5I3UA 4O44A 1TK5A 4CJFA 1JLEA 4K8XA 3K59A 3RAXA 2FVPA 4IH7A 4CJRA 5KG1A 3TAEA 2OPRA 5KT4A 3S9HA 4XO0A 3LP2B 4DEZA 3OY9A 2NUBA 1DTTB 1TKTB 4IG3B 2HVHA 4RW4B 2KTQA 2X78A 4DL5A 1XWLA 4LQ3A 1GX6A 3UDLA 4KI6A 1QTMA 1S0OA 5J2QB 3DRRA 1QAJA 5F9NA 2RKIB 2JEIA 5FDLA 3NF8A 2WONA 2IM1A 2JC0A 2D0BA 1NK7A 2OA8A 2QXFA 4GVMA 2XY7A 4R5PB 4FJ5A 4DWIA 3TI0A 2OPRB 4NCGA 1HRHA 3BJYA 3BGRA 2YHBA 3KLEA 3QNOA 2XI3A 3SQ2A 1JLAB 3G6XA 1DLOA 1LWCA 2GBZA 1RTHA 3DRRB 3FRZA 5JUMA 2RDJA 2VA2A 2A1RA 1N48A 3AO1A 3V1OA 4F3TA 4BWJA 5I42A 3CJ0A 2XY5A 4KRFA 5FDLB 4HVJA 2WONB 5KG0A 1NKBA 1RT4B 1QHTA 2F8SA 4NCGB 1RBUA 1YVFA 4BDZA 3BGRB 1BQNB 2RPIA 4JUZA 4N5SA 4EO8A 4JRPA 3AVBA 3CFRA 4TQSA 1FKPA 3L2UA 3K2PA 4R8UB 4ZP9A 5F8JA 1LWCB 4RW8B 4O0IA 1RTHB 3S3NA 4TY9A 2QV6A 4R0EA 4TYBA 3MEEA 2UVVA 2E9ZA 2Z1JA 1LWFA 4GC7A 3GV5B 4CJTA 3WNFA 4J2EA 1BI4A 4AHCA 2IC3A 3NGIA 4C8MA 3KKRA 1SKRA 4QWCA 5DG7A 4E7KA 4O3RA 2YHAA 1RBTA 2B5JA 2AQ4A 1KLMA 3Q8PB 3LWLA 3SUOA 4K4WA 4J9LA 1ZBFA 1JLCA 1G15A 4CGJA 1DTQA 1RYSA 3LWMA 4EEYA 2ILYA 2ALZA 4M3WA 1BIUA 1W25A 5KG5A 2W9AA 3NKYA 2FLNA 4XPEA 1FXXA 2F8TA 4K4XA 4EP4A 2A1SA 4FZYA 2C28A 1KHWA 1ZYQA 5KFOA 3DLRA 2IC3B 3AA2A 3OVNA 3PW5A 2WCXA 1S9EA 4CJ5A 1LWEA 4ELTA 2B5JB 1VSMA 2PYLA 1KLMB 3K5LA 3VQ9A 3WNEA 2R8HA 4B9SA 3FSIA 1NK8A 4CJUA 1ASUA 5KG3A 5KFHA 4URQU 3SNNA 5CZ1A 1NK6A 3CDWA 1T3NA 4KBIA 3CG7A 1C1BA 4CEBA 4OVLA 4M42A 2J6UA 4OGEA 1D9FA 1VK0A 2HNDA 5HRNA 3I5AA 4JV0A 2OH2A 1CLQA 2ZD1A 3Q8SB 4Q0BA 2FC0A 1XC9A 4DSEA 1S9EB 1B9DA 4GMJB 2R2UA 3OYGA 5C25B 1Q8IA 4MIBA 1LWEB 4I2PA 3UR0A 4I9QA 5F9LA 2J6SA 1VSIA 3ULDA 1BL3A 4N76A 1KRPA 3QETA 1N56A 1LW0B 3V6HA 2B6AA 1RT6B 3JSMB 3I5BA 3GIJA 1C1BB 3DYAA 4MK7A 4DQRA 2KZMA 4LQ9A 1LV5A 2HNDB 3SJJA 2ZKUA 2BE2B 2ZD1B 5F8IA 4ED0A 2X74A 3RBEA 1NK4A 4TY8A 4ZTJA 5EU7A 5KGXA 3SQ0A 2D3UA 3NH1A 1SL1A 2BRKA 4DSJA 1B9FA 3QLHB 3DOKA 4F4XA 4LD0A 3KLGA 1YVUA 4ELVA 4AHRA 1S6PA 3Q8QB 3OLAA 3PUFA 4NLPA 2XY8A 1IKWA 1IM4A 4BDPA 3C6UA 4CJKA 3TAMA 4LH4A 4CHPA 1A5XA 4E19A 4NLOA 4CGIA 2D7SA 3PZPA 4TY8B 2OPQA 4ECTA 4HCBA 4CGFA 3DMJA 5F8GA 4QW9A 1R0AA 3LPTA 4DQQA 3THVA 1VRTA 1S1TA 4CEFA 3KLGB 1L3SA 4HUEA 3V81A 2XRIA 3V1RA 1S9GA 4OL8A 4NLUA 4DU1A 3KLFB 2E9RX 2G8IA 3SFUA 4DTXA 1NK5A 1IKWB 4RG8A 4ZP6A 3DRPA 4CK3A 4ID5A 5KFVA 3NF7A 3OYHA 4DFPA 3T5LA 5HRSA 2IJFA 4FJLA 1CXQA 4EBCA 4Z4EA 2HHUA 2RDIA 4ICLA 3N6MA 1MU2B 5KFBA 3RMDA 4ZVEA 4C8LA 4J2AA 4B9VA 1R0AB 4B9UA 4CF1A 1VRTB 4MFBA 3KOAA 3T5HA 1S9GB 4W5RA 3DLKB 5L1IA 2IOCA 4N47A 3LP3A 4OPJA 2XWYA 4K4TA 1L5UA 1S1XA 4E0DA 3ICLA 4O3PA 3QEPA 5CYMB 3SFGA 1HMVA 4ID5B 1NOZA 3O4QA 3QZ7A 5E41A 1RT1A 1S49A 4E1NA 4GW6A 4OKKA 3DRSA 1A5WA 4ICLB 1KFDA 4CHNA 3CM6A 1C1CA 5HP1A 1QAIA 1QSYA 4MFBB 1JLFA 2W9BB 3AO2A 3MECA 1JLQA 4PUOA 4EP5A 1QE1B 3RB6A 4RW9B 3B6PA 1U49A 4M41A 4BDYA 3FFIA 3T5KA 5JS2A 1S1XB 1D8YA 1HMVB 2Z1HA 4CIFA 4M3UA 1BQMA 5KFIA 4FLVA 1GOAA 2BGGA 1RT1B 5F8MA 2ASLA 3MXIA 3DRSB 5FROA 2O5DA 3QZ8A 4Y1DA 2Y1IA 3SQ4A 1C1CB 5DLFA 1U4BA 4K4UA 2HWIA 3AO4A 5KG4A 4RUAA 3K57A 1RNHA 2HHVA 1JLFB 3KMSA 1D9DA 4LY7A 1TKXA 1JLQB 3I0SA 2HHWA 4KB0A 4PUOB 1KHVA 2DFFA 4NLWA 1NNDA 3SI6A 3TWHA 1HARA 1Z26A 3QIDA 4PWDB 1JLBB 3CFOA 3D45A 4HCCA 1BQMB 4PY5A 4JS5A 5KT6A 2DFHA 3AA4A 4NCAA 3HJFA 1IKXA 4ZP7A 3G6YA 1GOBA 3FDSA 3OYAA 1S97A 3CM5A 2I5JA 5HLFB 4CJQA 4RW6B 5J1EA 1XR6A 4K4ZA 3OLBA 4K4YA 3OHBA 3H5YA 3KIOA 4PA1A 3CIZA 5KFUA 2XGQA 1X9SA 1TKXB 3I0SB 4NRUA 4DMNA 4BACA 3KK3A 5L1JA 1KCFA 3OYIA 4Q8EA 1L3TA 3DLEB 3SV4A 3C6TA 1S6QA 4DL2A 1KSPA 3OYEA 2D41A 1TK8A 4NRTA 4Q45A 3LZIA 2G8UA 5KFRA 2VA3A 3E01B 5CYQA 4DG1A 2IM2A 3RB3A 3LZJA 1W9HA 4KV8A 2I5JB 3PJWA 1WSGA 4KHUA 1JKHB 4Q43A 2BQRA 1YT3A 3IRXA 4HUGA 1C2PA 4LSNA 3SI8A 1IKVA 2ZE2A 2EHGA 3M9OB 4J2BA 4EO6A 3KK3B 3LDSA 3VQ5A 4XIUA 3OS2A 3ZSVA 3KD1E 3C6TB 1S6QB 4IKAA 3QO9A 3MAQA 4QPXA 2QKKA 4KB7A 4J9PA 4DG1B 2AU0A 1RDBA 2W7PA 3BSAA 5C42A 3KLVA 4CFAA 1NK0A 3H4DA 3QESA 1TKZA 2FLPA 3IRXB 4YR3A 1B92A 5D3GA 4LSNB 3PHEA 4DS5A 4ZPAA 4IQXA 1IKVB 2ZE2B 2XCAA 1WLJA 4F50A 4U6PA 3MEDA 4F8RA 4IH5A 1KVCA 1KTQA 3OYBA 5KG6A 3N6LA 3QO9B 4I7FA 5DGBA 1NHUA 3V1QA 3OYNA 3NBPA 3MFIA 1UAXA 2R8IA 5SZTA 3QIPA 1UA1A 2IM3A 4DSLA 4M3XA 1HPZA 4DLGA 5C42B 3OYKA 2WTFA 3EYZA 4Z4FA 2R2TA 2EX3A 5D3GB 4CJPA 1HQUB 3KK1A 3BR9A 4H54A 3O4NA 2ATQA 3NHGA 2FBVA 1RCHA 4QWEA 3HM9A 5KI6A 4KO0A 2C2DA 4ED7A 1KVAA 2DY4A 3FQLA 1EKEA 3EY1A 3RBDA 3ZSXA 2C22A 4CK1A 1TVRA 4URSA 4PQUB 4I7FB 1SUQA 3TVKA 4DQIA 3CJ3A 3LPUA 4J9NA 5KT3A 2AWZA 1S1VA 3BSNA 5KFEA 2IGIA 3V4IA 2X6SA 4MKAA 1RT3A 5JXSA 4YR0A 3QGGA 3EPIA 2PZSA 1BGXT 4H8KA 3K5MA 4WFYA 3KK1B 4CFDA 1IH7A 4CHYA 4EZ9A 2W9CA 2B4JA 1K1SA 5I3UB 4O44B 4KHNA 1D0EA 1JLEB 3HPHA 1SUQB 4AHVA 4OLBA 3H5SA 4X2BA 5EWGA 3V4IB 1J53A 4FYDA 4Q44A 3LAKA 3EZ5A 2V0NA 4Q8FA 4J2DA 3VN5A 2AGPA 5J2PA 4JV1A 4KTWA 1TL3A 4ECQA 1RBRA 1OS5A 3M9MB 4KTZA 2FVSA 4KFBA 4KAZA 1QQCA 3H08A 1HNVA 4NLDA 1ZBLA 4JS4A 3TARA 3EZUA 3L3VA 2BANA 2WRMA 4DFJA 2OZSA 5T7BA 2W8LA 3KLEB 1L3VA 4RNFA 3MR6A 3UPFA 4ED3A 3VQ7A 4RW7A 4ECZA 3F9KA 3AVLA 5KFFA 2KW4A 3DOLA 2FJXA 1TAUA 5J2PB 1DLOB 4B9LA 2I1RA 3LP0A 3HVTA 4CF2A 4E7IA 4M3RA 4IDKA 5I42B 3MXJA 5KFXA 2D5RA 2OPSA 2F8EX 1HNVB 4M94A 3VQ4A 3RMBA 3OYLA 4IH6A 3V6JA 1RDDA 3JYTA 1ITGA 1HQEA 4CE9A 3HKWA 3V6DA 5KFMA 2OPPA 3Q8RB 5KFNA 4IKFA 2RN2A 3ISND 4MK9A 4N56A 5J2NA 1TKDA 4DL6A 1RDRA 4WXWA 3VQ6A 3U6FA 4DU4A 1FKPB 4O3SA 4FCYA 4KE5A 3HVTB 3AVJA 3MEEB 1LWFB 4FJ9A 2OPSB 4C8NA 3NGDA 3ZT2A 2GIQA 4FBTA 1BI4B 4M95A 1HYVA 4FM1A 3JYTB 1RA6A 4FJ8A 4Y2CA 3V6DB 4B3OA 1GOCA 4DS4A 3TR8A 3K5OA 3ZT0A 5J2NB 1RT2A 4O4GA 3LP1A 4DTOA 1JLCB 2X6NA 5KFZA 1DTQB 1UOCA 4NLYA 2HB5A 3VQQA 3KD5E 3ZSYA 1SL2A 2B43A 1FK9A 4NLTA 1WSIA 4ZVGA 3GIMA 1S9FA 4DTSA 4IOBA 4ECUA 2VG5A 2QE5A 1IKYA 4F4YA 4M3ZA 1ZTWA 4FZXC 1QS4A 3PR4A 4FVMA 5KFPA 1RT2B 3OSNA 3MR5A 4O4GB 2IS3A 1RTDA 3VA0A 3CJ4A 2BR0A 5KT7A 3G0ZA 4E7LA 1SKWA 2AX0A 4HTUA 1WAFA 1I6JA 4CJ3A 1TK0A 3GQCA 2IAJA 3OJUA 4EZ6A 3C94A 3NH0A 3QYYA 4K4VA 3DLGA 4F2SA 4Q0BB 3PW2A 3NMAA 2VG5B 3ALYA 2QK9A 1NJWA 1NKCA 1L3UA 4BE2A 3OYDA 3TAGA 4G1QA 2W7OA 4H4OA 2ATLA 1WSEA 4I9LA 4I2PB 1RTDB 3HVWA 5KFKA 4FLYA 4J9QA 3TQ1A 3HP9A 4FLXA 4WYWA 2B6AB 4KSEB 5HRRA 4OKEA 3DYAB 3TANA 1S4FA 4TSXA 3HVAA 4CEAA 3IGVA 2YNHA 3DLGB 4DTMA 1NJYA 1LAVA 4CEEA 1J9AA 4G1QB 4CJEA 3O3GA 1HYSA 3DI6A 2FBYA 2XGPA 4J9MA 2AGQA 3CVKA 3DOKB 5C24A 3NAEA 2YNGA 3KKSA 2G8FA 4FLUA 4HKQA 2R2SA 4L8RB 3IGNA 4ED1A 1C1AA 1C6VA 4DL4A 1S6PB 4CFCA 1HNIA 1XI1A 3CYMA 3C6UB 3QERA 1VSKA 2G8WA 2V9WA 3TAMB 3HHKA 4DL3A 1I39A 4IFYA 1RA7A 4CF0A 5L1LA 3CFPA 2G8HA 1U09A 3LAMA 2OPQB 2V4QA 2OYQA 4GC6A 3NFAA 5KT2A 3DMJB 1X9MA 3DI6B 4OJRA 5KRSA 4B9NA 4FLZA 1S1TB 4ECRA 2AGOA 3SPYA 4DTRA 3V81B 4BE0A 3H4BA 4DLEA 4Q5VA 1HNIB 2D0AA 3IS9A 3DDKA 4F2RA 3DRPB 4DTJA 3HYFA 4CHZA 3M8RA 2ZQBA 4CCHA 3O3HA 3C95A 5CY4A 3RTVA 3WNHA 1XR7A 4FS1A 1NJXA 4RNNA 3RB0A 4F4WA 5L9XA 4BE1A 3ZSZA 3SUQA 3DLHA 3O3FA 3G10A 2YNFA 2R8GA 4DQPA 3QEIA 1WSHA 3PO4A 1TP7A 4UQGA 4FLWA 5HBMA 5KFLA 2Z1IA 3BSCA 3GYNA 3SUPA 4TYAA 4ZVHA 3H5XA 1T7PA 2FBXA 2XI2A 4CK2A 3T1AA 2O4IA 1EP4A 4KHQA 4KHRA 2J6TA 3TAFA 2P51A 1SV5A 5KFCA 3OL9A 1JX4A 2VG6A 5KRTA 5HP1B 5SWMA 1JIHA 4ECXA 2YNFB 5KTQA 3MECB 4CGDA 1NOYA 4YMEA 3D0PA 4FJGA 3FFIB 4WYLA 3GV7B 4CEQA 1QSSA 3RR8A 3MR2A 2HNYA 1WNSA 4NYNA 1EP4B 3BQ1A 3ZSRA 3V9XA 3MF5A 1SV5B 4DQSA 1RTIA 3BREA 3VQCA 2VG6B 4E7JA 2GV9A 3P83D 4DU3A 4YP3A 4QWDA 4J9KA 4NZ0A 2E4LA 2F96A 2YNIA 4ED8A 1VRUA 3ITHA 2RF2A 3QEVA 1JLGA 4ZP8A 4FK0A 4NLGA 2FVCA 1CSJA 4AHUA 2IJNA 1QUVA 3L2RA 1WN7A 1VSEA 1IKXB 2HNYB 5FRMA 4IG0A 1SH0A 3E51A 2G8KA 1CXUA 2R8JA 5J1EB 4YR2A 1HYZA 4FJKA 3MTKA 3AVCA 4ZHRA 4DF8A 3L8BA 4CIGA 3GIKA 3VA3A 4DL7A 3ZT3A 3AO5A 4W5QA 4RNOA 4DFKA 4G3IA 1TL1A 1VRUB 3ITHB 1RDAA 3KNAA 1JLGB 2YKNA 1X9WA 2V4RA 3QGHA 3U3GA 2ETJA 5KFSA 4I2QA 4ELUA 2XY6A 4B8AB 5KFDA 3AV9A 4ZPBA 5CYQB 1S1WA 3KK2A 1BHLA 4KV8B 2DPJA 4KHMA 1U45A 5KG2A 4K8ZA 2HNZA 3ZSQA 2UVUA 1BCOA 1IG9A 4ZHRB 1YTAA 3CJ5A 4FJ7A 1SKSA 3AA5X
chains in the Genus database with same CATH superfamily
3QRQA 3G82B 3EGNA 3K5PA 3I55N 1E4FT 2IM0A 1EX4A 1PJ6A 1TL1B 2QLBB 4LF4J 3CCWA 3MCMA 4ER8A 5EWEA 1XR5A 1MMLA 2YKNB 2B7CB 1EZZB 3TUZC 4FYWB 2NRZA 3F73A 3VF2A 4JKAA 3KK2B 3L4BC 2LECA 1X4EA 2CXEA 5M2RA 1O1WA 3C0BA 4DUZJ 5DGAA 5KFWA 1SS6A 4KGXB 1FJ7A 4F0KA 3SLCA 3VALA 2HW3A 4NYFA 1BDGA 3PSIA 1Y97A 3OTDA 1UWBB 4JI7J 4KH5A 3NGTA 1Z2ZA 3H0PA 2E1YA 2QWRA 2CQGA 3G6ES 3QIPB 2P8IA 4O4RA 4AQYK 1HNWF 1LCUA 2HMIB 4C1NI 2YWGA 3SK3A 1Y4ZB 4FM2A 3HBTA 2K8GA 4ZVFA 3TZXA 2RMLA 4C0HA 1CZBA 2E9TA 1RU1A 3BF3A 4LF1A 1S7IA 3BZCA 3DM2B 3VQSA 4NXNK 4NEZA 4M1KA 4G6VB 3KLHA 1WC4A 4YDUC 3O6WA 2JZ5A 4OGCA 4Y2AA 1WC6A 1QQOA 3J8AA 3N9UC 2E5IA 5HOOA 4OHXA 4DU7A 4ZLPA 1REVB 3T19A 1QLNA 2ZGYA 1EXQA 3SZ2A 3MN9A 1P6TA 3EGVA 2VD3A 5BR8J 1K73O 1NBEB 2UUCK 3OHAA 1PSDA 3MM5B 2VV5A 2RHQB 2PY5A 3LALA 4B3SF 4ZJOA 2DFEA 1MG7A 4JBCA 2IY5B 2O3DA 4USTA 2W7AA 1ELOA 2HVIA 2HIQA 1IO2A 2ZC4A 3D5MA 5IV4A 3PG9A 3C3LA 1FXRA 3N6NA 1Z05A 3PIPQ 4CZGA 4KFBB 4I6YA 2YQ1A 3AVMA 4NEYA 3S01A 4CF9A 4CZHA 3PJXA 2LXIA 1ZAWA 1Q9XA 2RB7A 3W5XA 3FNNA 4A47A 4NYZA 3CCSS 5LMNJ 3RRGA 4JHDB 4M3YA 3S3MA 2MKSA 3OFEA 3J7YI 1U04A 3DOLB 2R9LA 3AVFA 5DRKA 2Y1JA 2HS0A 3P31A 3IBWA 1N36K 4KGVB 3DU5A 8ATCB 4PEOA 1OVQA 2HVDA 4ZPCA 4DR7K 3P4IA 2AJQA 2A6OA 8AT1B 2P5GA 3AQPA 3QICA 3AVIA 1IWGA 2ERRA 3HZGA 3W9HA 2OAUA 3FJ2A 3EMTA 3GE9A 1YGYA 3H40A 2W41A 1C0TB 3OL7A 3BKUA 1B3TA 2MKJA 4K50A 3FEYB 3TVZA 1GXUA 4PQAA 3TEGA 3BPSP 4JI3J 1SJ1A 2GMLA 2F9WA 1NGAA 2SXLA 3EICA 2YKMB 1WHWA 5IS2A 4W5OA 2IDEA 1I94K 3CNQP 3OHRA 3QGIA 1Z6RA 2ZH4A 4UUXA 2DR9A 4FJMA 1NJIT 4ZK7M 4CLLA 1OY6A 3DGPB 2WHOA 1N6QA 3JSMA 3ZZOA 5AZIB 3VQPA 2O8BA 2GWJA 4JLHA 1U1QA 2KI2A 4X65J 4FWOA 4I6AA 5HROB 4MIAA 4ES3A 4K4SA 2VQEK 2K7KA 3OBIA 2ZOMA 3D7EO 5DG8A 1GMWD 1G99A 1FD2A 5K14A 5LMUJ 2LDIA 1CJVA 2H4YB 3H1QA 3HSDA 4B3MF 3DHXA 1ZETA 4WJBA 1VQ5S 2HHXA 1E6VB 4AHSA 1IKYB 4EBDA 3OS0A 4DZ6A 2Q1NA 3H5UA 1NJZA 4O3OA 4H0YB 1U1KA 2FLLA 1TZ0A 3P49B 5IXUA 1MSWD 3MPWA 4X62F 5D0HA 1XC3A 1KAYA 4X4TA 3HPOA 3I56N 4FPRA 3ID6A 5JVHL 4QR0A 2IAJB 3M9NB 2HHTA 4UQTA 2ASJA 3ZCMA 3DN9A 2V50A 4IRCA 2CUYA 3PY8A 5AQLA 5F8NA 5AE3A 3NEKA 1IBCB 4FK2A 3H3OB 2HKEA 1ZBHA 1VQLN 2XHWA 4CO5A 3C16B 3UCUP 4CHOA 5LY3A 3T7ZA 1NDKA 5D0RA 4FBUA 1VSFA 5JMVA 4RPFA 2CYYA 5KFJA 1X5PA 4K41A 2MHNA 4I68A 2FTRA 2JFKA 4RBTA 3HJVA 1WTBA 3S3OA 1RAFB 2KFNA 2A2DA 1NXIA 3AGKA 4TLRA 4JI4F 1NMEB 1TGOA 3UIQA 4ES2A 3DLKA 4PHTX 1Y5NB 1HNXK 2AF6A 4IYQA 2VIHA 1AFIA 2HGNA 1HJRA 1NWKA 1IV0A 1RHQB 3MFHA 3DCAA 1XNQJ 1XQSC 3UCGA 2HF4A 1NGDA 3T1HF 1J5OA 2AA4A 2GS8A 4OQJA 3VQAA 1S0NA 2R7OA 4HTIA 3LM2A 1NCLA 4X4NA 3NF6A 4HH1A 2H3GX 1NU4A 1RT5B 2CPJA 4IFYB 1WI6A 1S0MA 4ECVA 3TTFA 2VF3A 5DDRC 3MMBA 1PG5B 3GB0A 4GO5X 4LF5K 4IFVA 2QLFB 3BF1A 3TQEA 5C2DA 2AJ0A 3T1YF 5FPDA 5K8NA 4BVPA 5DQGA 4OYXA 4YUDA 2ADBA 2FHMA 2GMHA 3U3YA 1VRQC 1W2IA 4DFMA 1K73T 3Q7CA 2P9SA 3BH7B 1TTHB 3CD6N 4DBQA 3MWPA 1GLJO 3MPUB 4L76A 3GDQA 1YTUA 5KPTA 4OKJA 1FEEA 1S72S 1GMVA 4WTYA 1TYQA 4RZRA 3GSDA 2FC8A 4F04B 1RGIA 2EG1A 1JLBA 1ATSA 2LU2A 2RUSA 3R1LA 1U2VB 5HBMB 2MSSA 3S1TA 2MKCA 1ULRA 3NGSA 2E6MA 1U47A 4WK3A 2P5VA 1HWUA 1R6YA 1C0UA 2R2RA 4ZITA 1NBWA 3AOCA 2UUTA 1U8SA 1KLNA 4NCBA 3FSYA 3CCMS 2KFZA 1R0BG 1KVIA 3CCUN 1VSJA 4YB6A 3RGIA 2QWNA 1ZBUA 3PW0A 2VWJA 3LANA 1YJUA 2AEMA 4IRKA 3HVRA 4B8CA 2BEFA 5IT4A 3AD9C 4U9RA 1EARA 3SSSA 5AQZA 3QWUA 5AQVA 5E3QA 1RTIB 1F21A 1NEEA 2ZJRQ 2OZMA 3E9PA 3MM9B 3NRBA 2C2RA 3W66A 5D15A 3QEWA 3M6GA 1U26A 3QQCD 3M1FA 2HAIA 3MN7A 3DWLA 4OLPA 3OL8A 1F9HA 4LSLA 4OX7A 2JC1A 4X84A 3HLUA 3PYDA 1MNEA 4H5VA 4NLRA 3CC4S 1KVJA 3AXMA 4O0NA 1N0VC 3NDKA 1U1LA 3GIRA 3CXCM 1V5VA 5GAHP 2E1PA 4FS2A 1IQZA 1VIOA 3AY9A 4DTPA 3GR0A 1N34F 3I9V9 3EZWA 2IVFB 4F4KA 2E8AA 3HHEA 1H74A 2B8QA 2DO4A 2OGUA 4USWA 4WE1A 5GADI 4XH4A 1S1WB 3S41A 3FQKA 1OO0B 4A8XA 2N7YA 4BHQA 2LSNA 4FWKA 2IMWP 1TR0A 3UR3C 4B02A 2V2QA 3DLBA 1M0SA 1KVBA 4B9QA 1UAWA 2WB4A 1S1UB 1CJKB 1S10A 5KFGA 3GILA 1FDDA 3TSUA 1RBVA 4ZMMA 1YHQS 4X4QA 4YY3K 3QINA 2PFUA 3HF5A 1KBRA 4LH5A 3MCNA 1J54A 3W8PA 2G8VA 4EU0A 4C8KA 2G1HA 1S99A 2V4JB 3V9WA 2W8KA 3GTYX 3SUNA 3CCJS 4O44A 2HBQB 2Z4PA 1QVGR 4K8XA 3GJQB 1WUAA 2VUGA 3MM6A 3TAEA 4XO0A 3LP2B 4D3HA 4BC3A 1DBDA 1DTTB 4WK1A 3FBBA 1Q81T 2FD2A 5IFMA 1LOUA 3U1LA 2ABYA 4KI6A 1QTMA 1S0OA 5J2QB 3CCRN 5A6WA 3HDSA 4OJGA 1PKUA 2RKIB 1F5CA 1VQKN 5FDLA 2WONA 1ZC6A 3F9MA 1YBTA 2OPRB 2VASA 2F7TA 1HRHA 2C2OB 2YHBA 2ZJPQ 4FF1A 2XI3A 1OYEA 3BO4A 1BWFO 2VHGA 2M88A 1U0HA 4YOWA 1VQ8N 1DLOA 2IBOA 4KQZA 2L9DA 4BWJA 4OYWA 2NSCA 5I42A 2C3MA 5KG0A 1RT4B 2F4FA 1WI8A 2NQPA 2F8SA 1MROA 4BDZA 2R7RA 3BGRB 1BQNB 1S6OA 4CRJA 4YOEA 2NXJA 1OYDA 3TZYA 4U96A 3L2UA 4NXMF 5F8JA 1AZSA 1RTHB 3HSZA 1HWIA 1R27B 3J81U 4YOYA 4TYBA 3MEEA 2E9ZA 1LWFA 3EVMA 4GC7A 4P2XA 1F9EB 4M5IA 4AQYJ 1OQ6A 2KM8C 3NGIA 1SKRA 2QT7A 4QWCA 5DG7A 4OZ0A 1BD6A 1FXLA 1RBTA 2B5JA 2AQ4A 4YN3B 3Q8PB 3SUOA 1ZBFA 1SIWB 3LWMA 4L74A 4M3WA 1V4TA 1T9TA 4NXNJ 3NKYA 1OJ4A 1WBBA 2F8TA 7FD1A 2A1SA 1JJ2R 1ZYQA 3RW6A 3W60A 4LR7A 3E2EA 3PW5A 1S9EA 2R7QA 2QA2A 2D4WA 4ELTA 2AYEA 2FDNA 3QT7A 5KG3A 2OEMA 4DV3J 3MM8B 3MWBA 3QJJA 3CDWA 3CG7A 1X4CA 2UUCJ 4OVLA 4M42A 4XTTA 2KFYA 1CLQA 2ZD1A 4WQ4C 4Q0BA 5MAOA 3RZAA 4M63A 3M05A 4DSEA 4AXJA 5C25B 1Q8IA 4MIBA 1LWEB 3R5CA 3NWGA 2OEJA 1CJTB 2ALYB 5F9LA 3H42A 2J6SA 1QZ5A 4N76A 1DAXA 4LR8A 2ZZNA 4C23A 1LW0B 1XMQJ 4BRGA 4Q7AA 2DXDA 1X5SA 4WTOB 1RLCL 5DM6Q 4OX9K 2KZMA 4LQ9A 1LV5A 5GAEU 2HNDB 3SJJA 3JQKA 2ZKUA 1TUUA 2W2OP 2QA4G 4CZLA 5MLCQ 2YX1A 4TY8A 3BEGB 2PMWA 4DV0K 3VGSA 5AE2A 1FJCA 1F2HA 3QLHB 2FJDB 3FC9A 4LD0A 2HRTA 4BROA 4AL5A 1WC1A 2QJ3A 3PUFA 3Q8QB 4LF8K 4NLPA 3ET6A 3IP0A 1YKWA 2AKWB 1N36J 3TAMA 4YOTA 5JLHA 2P9LA 3C6AA 1WG1A 1VQPS 4NLOA 5ETSA 4ECTA 4HCBA 5ETMA 4U67Q 1UTAA 3LPTA 2DGXA 2VU5A 1S9GA 4OL8A 5JLFA 4DU1A 3KLFB 2UXDK 5BXIA 2G8IA 4DTXA 1M5KC 2B9XA 1NK5A 3ULEB 1IKWB 3N5FA 4ZP6A 4CK3A 4XDCA 2MZRA 2ZHAA 3T5LA 3BUZB 5C2CA 3ENBA 5I9EB 2CQ1A 2HHUA 2RDIA 1MU2B 4ZVEA 1R0AB 3D0HE 4B9UA 2GW8A 1NMDA 3OT9A 1NSAA 2ZWOA 5L1IA 2P9IA 3H90A 3FGVA 2C1EB 4K4TA 1L5UA 4UUWA 4LF9J 2L08A 4FWMA 1S1XA 3ICLA 3TJAA 1HMVA 4ID5B 1NOZA 2DH7A 3SCLE 3QZ7A 4IFEA 4GKKF 2OIHA 2DNLA 5AFUA 2VPZB 3THWA 1KFDA 1R43A 2DRAA 4E1JA 3TJ8A 1QSYA 4WFAL 4EAHD 3M32B 2W9BB 3MECA 3U9DA 2DXFA 1QE1B 2EFGA 1HNWK 4M41A 1N32J 2MZJA 2Z1HA 4CIFA 1CZAN 4M3UA 4Z37A 1RK8A 2YQ0A 2KLAA 5F8MA 5DM7L 3MXIA 3UKUB 1Z2LA 5HMXA 2FXUA 1U4BA 3AO4A 1V9OA 4FWLA 5L39A 4RUAA 4UT4A 3CJ8A 2HHVA 1JLFB 1VJWA 1YVNA 1D9DA 1YJ9S 4EWTA 5K8MA 4KB0A 3LDLA 4PUOB 1KHVA 3FBEA 3K8WA 2GZOA 4CT8A 3SI6A 1MWKA 1RHUB 3JAMY 4OYMA 3CJSA 3TA1A 1WDDA 1C4AA 1VBKA 2DFHA 3ATUA 4NCAA 2VFTA 1IKXA 3G6YA 1GOBA 1KOHA 3LA0A 2I5JA 5HLFB 2NS1B 4CJQA 3DDIA 4PR6A 4K4ZA 2Z30B 5BYRA 1XNRJ 3OHBA 3KIOA 1K0TA 3ZX3A 2RIJA 1RKIA 4JI5F 3CIZA 1F60B 1FJGJ 2XGQA 4NYPA 2FSNA 3UWTA 3KJFB 1QD1A 4BACA 5L1JA 2LXFA 4B3SK 3ENWA 2VL1A 4Q8EA 4A8KA 3D2FA 1U6ZA 3C6TA 1S6QA 4DL2A 4CYUA 1LNQA 3LZIA 2G0CA 2BYCA 5C2FA 3E01B 2IM2A 1V3RA 4PWWA 3AJ1A 4HTJA 1W9HA 4K2XA 1JKHB 3IWNC 3VGMA 2BQRA 2RE1A 2ZH7A 3IRXA 4HUGA 3RVCA 4CM2A 1C2PA 3VEYA 3AD8C 1VQ6S 2EHGA 3KWIA 5JVGL 1WORA 1UEVA 2D1CA 3TPQA 3LDSA 3VQ5A 4XIUA 3ZSVA 4JKHA 2VICA 3KD1E 2HFNA 4IKAA 4FF3A 3QO9A 1OQ3A 4QPXA 2QKKA 2W6KA 5B0FA 4DG1B 3IWLA 1KVKA 2W7PA 3BSAA 1NH7A 3TO8A 2MY7A 2AP1A 2FLPA 5IWAF 2NZTA 4DS5A 2QLJB 4ZPAA 3HD1A 2ZE2B 1CLFA 4F8RA 5ETRA 1AFJA 2VCPA 4FL9A 4IH5A 4F9OA 5A2QY 1KTQA 1UVIA 1CULA 2MDAA 2HOEA 4LRDA 5DGBA 4TU7A 4B17A 1S6UA 2MYFA 3G6EN 1DHMA 3QIPA 3WXJA 2YPYA 3CJBA 2O8FB 5C42B 3OYKA 4NZ6A 4Z4FA 3CCLN 2R2TA 2V8HA 1SQKA 2ATQA 4YDUA 2FBVA 3NHGA 1T9YA 2VFUA 1NGJA 3HM9A 4AF1A 1FDAA 1IBMF 4C48A 1KP6A 3R5DA 3IFEA 3ZSXA 1RB0A 2B3TB 5E7OB 4I7FB 3C15B 2FPHX 2KXNB 4C4WA 1A9NB 1B0TA 1QZ6A 5KT3A 1EKRA 2AWZA 3IMQJ 1Q5YA 3BF4A 3I31A 1N54B 2X6SA 4USJC 3JS6A 3U4LA 3C65A 3QNWB 4HH0A 2NLXA 2J9CA 1P1TA 3EKSA 3HSCA 3CD0A 2JL9A 4PYDA 2PC6A 4BRPA 2P9NA 3W7BA 3UD4P 4GVLA 1WC5A 3V4IB 1J53A 3HI9A 1FNOA 4X62K 1HL6A 2V0NA 3J81O 2P9UB 2A2CA 4Q8FA 2BTFA 2MQMA 5GMKa 1V5IB 2KXHA 2X1AA 1HJOA 1FA0A 2BE7D 4JI7F 2PMHA 4ZJQA 1X0PA 4KFBA 1QQCA 1AYEA 5HMZA 1ZBLA 4JS4A 3JQMA 5AJ3F 4QYZK 1HX1A 3R27A 3L3VA 2WRMA 3N5BA 2DKOB 3CCSN 2W8LA 3KLEB 4RNFA 1VK8A 5LT5A 4JHDA 2YBVA 4ALZA 2A3JA 2A41A 3M1VA 3O1BA 3VQ7A 3DOLA 1TAUA 5J2PB 3UD3P 4XAKA 2XG8A 2M9KA 4TU9A 3HVTA 3MXJA 4JI4K 2WAQD 1VC5A 1HNVB 3D6RA 2O8DA 3VQ4A 4CP5A 3OA9A 3OYLA 4IH6A 2ZITA 1RWMB 3P96A 3JB9k 3L4IA 3V6DA 2VKZG 5KFMA 3Q8RB 4DR6F 3T1HK 5KFNA 2VBWA 4LBHA 1QHAA 3ISND 4EHTA 2E7VA 3IFRA 2HYIB 1FKPB 3K0SA 4KBOA 2D9PA 5BR8F 3AVJA 2QEXS 1KN6A 3HT0A 2Y0SD 2ZM6F 3CULA 2Z0GA 3ZT2A 1MWZA 1UVLA 3T1YK 1VQ4S 4CDIA 1HYVA 2KT2A 2JWLA 1GLEG 3U1MA 3TR8A 2IIHA 5AZIA 2K3IA 1HHTP 5J2NB 3GOIA 1JMTA 1P27B 1U24A 2JWKA 5A8RB 4KHPJ 3ZSYA 4NLTA 2GCFA 2V8PA 4WFNL 1B4SA 4CLYA 3R6GB 1B99A 1VQ5N 1FX4A 2XYGB 2CJ9A 5LMNF 1E6VA 1IKYA 2AYMA 4M3ZA 3THXA 4H0TB 4FZXC 2BX6A 2L3MA 3PR4A 4AM6A 3VZIA 2QMWA 2QC3A 3N4WA 3RSEA 3OSNA 1CQNA 3HHLD 4USIA 4FXWA 3Q8YA 3MD1A 2XS7A 1SKWA 3VHQA 3H2VE 3OR2A 4OPAA 3R5JB 2IAJA 3OJUA 3OTEA 4JB8B 2ROGA 3QYYA 4DV1F 1QVGM 2CQBA 2Z2YB 4QQBA 1L3UA 2UV8A 4G1QA 2UUAJ 2HS4A 3FGUA 4I2PB 1RTDB 5CH7B 5KFKA 1SBRA 2V9KA 2QWLA 3WQTA 3HZEA 4FF2A 1IBKF 2F3JA 2GVZB 3T6BA 4JI3F 3SBTA 2GO9A 4WYWA 1W26A 2G4BA 4OKEA 3DYAB 4ATNA 3VERA 1RHRB 1S4FA 1E6YA 2MQNA 4RTFD 3AXKA 2RVJA 1SXLA 2NRXA 1J9AA 4CJEA 3DI6A 2F9TA 3KWMA 3LH2S 1O8BA 1NU0A 2HIYA 4P71A 1C1AA 5D4PA 2XMJA 3MMAB 2HLUA 5CHCB 5JMNA 3AFGA 2G8WA 4DL3A 4IFYA 3QRPA 3CFPA 2FB0A 2KKZA 1U09A 2OPQB 4GC6A 2HLTA 3HKZD 1RAGB 4J9VA 5KRSA 1N34K 1S1TB 3SPYA 2CPIA 4UW2A 5AQJA 3ZX2A 2MQOA 3N01A 3EXYA 1HNIB 3UDVA 1CC7A 1NPKA 4ZVUB 4DTJA 3HYFA 4I6MB 1FDNA 4CBXA 2VH7A 1S72N 2ZH8A 3RTVA 2D74B 4ZVRB 4FS1A 1S77D 5BRHA 4BC5A 4C11B 2RUGA 1S22A 3VAJA 2DGOA 2JRSA 1NM2A 2O66A 3MMCB 3IM8A 3UNGC 4IOCL 4WF9L 3PO4A 2HBMA 2D1KA 1U2VA 2Z2MA 5HBMA 3MUMP 3BSCA 2XTJP 4TYAA 4NMXA 3M4XA 1JJ2M 3MPYA 5DDPC 4KHQA 2J6TA 3TAFA 5KFCA 2RAQA 1JX4A 4OI1A 2DR7A 3CJKB 5LM7E 5IQQA 3CCMN 5SWMA 3IA0A 5EX0A 2YNFB 3CTRA 3NOGA 5HL7Q 2O8CB 3WXIA 4EGLA 1NOYA 4YMEA 4LRAA 4FJGA 1XMOF 3RR8A 1U2FA 4C3MA 4CIOA 1IQTA 1BA0A 2WVFA 1RTIA 1WELA 4FKXA 3VQCA 2B4UA 4Y00A 3MCPA 4U7UK 5T7LA 3R8YA 3MM9A 2BKNA 4HLBA 4QWDA 3M3ZA 1U6FA 3U9ZA 2ASYA 4FWNA 2CJAA 4H4KA 3W64A 5ETNA 1CSJA 3G9CA 1PBAA 5ETLA 4IO9L 2BJ1A 2BJ3A 2BJ9A 3QSIA 2XHCA 1FFWB 1H0HB 3A8EA 3PYEA 3W65A 1CXUA 2R8JA 2QZ8A 5J1EB 1GLLO 1RHMB 3AVCA 2CGLA 1YG0A 3OW2R 2E1ZA 1K8KB 1RDAA 2YPZA 4NXMK 4NASA 4DHVA 1GNKA 3KG1A 3ULHA 2V4RA 1GLFO 5KFSA 3OXGA 3Q23A 4I2QA 4ELUA 5CYQB 1S1WA 1HBOA 4V19X 4KV8B 4K8ZA 2PGCA 1BC6A 4BR0A 4ZHRB 3IR6B 3ZETB 2GIRA 1J2VA 3TVYA 4CH0S 4EIAA 3OYJA 1VBYA 3HL8A 1KS2A 2VBZA 1S1UA 1S5ZA 1YHQN 4DTNA 4M5KA 2QTWA 2V51B 1H98A 3DXKB 4DZDA 4FZZA 2HNZB 4QU7A 2V4JA 1TKZB 4MT1A 4CO2A 3IAYA 4BRIA 1TV6A 2AX1A 2CKWA 3Q8UA 1PAUB 3EGWB 1ASVA 2ZJQQ 3M8ZA 2JGUA 2HBLA 3MUVP 3OUYA 3RB4A 1WSJA 5L8RC 1SVDA 4CIEA 2DNQA 3F44A 3NAHA 2BKOA 3FKBA 4N77A 4CEZA 3SAHA 2AEJA 1UWAA 3M8PA 3WT0A 3NBPB 3ZEUA 2VJVA 3FUYA 3N28A 2HQFA 1BOTO 3NGYA 5E3AA 4JKBA 1K47A 4TQRA 5I3QA 2NXUA 3CJ2A 5HK4A 5DZ7A 3O3LA 4KHWA 3CMAS 2ITMA 4B9MA 4ECSA 4FW2A 2FF6A 3J7YU 7AT1B 3NOCA 3ZSOA 3P5JA 2B4PA 4B1XB 1T05A 1S1VB 5KPRA 4W5NA 2DR6A 2NUHA 1YUWA 2CQ3A 1XBWA 1GAOA 5F3ZA 2DIUA 2M52A 1RISA 4EMDA 4LF7F 2G13A 3CCZA 4YB7A 1RT4A 5DMRA 4TU8A 2FSKA 2MB0B 2W9CB 4CEDA 2E6LA 1BQNA 2EWSA 3KLHB 4ANDA 1KDNA 3A4TA 3FZFA 5CQGA 3ENVA 1R6VA 3VQDA 5BREA 1YRTA 1JXVA 2X1BA 2PDAA 5KT5A 2DPNA 1T03A 3ISZA 4Z4GA 1BUXA 1RACB 1TL3B 2IYGA 4DI6A 2J76E 1DURA 3NH2A 3L6QA 1JB0C 1UMJA 3D1OA 3F41A 4XPCA 2GHPA 3CETA 4Z4CA 2GX9A 1I51B 3J7A1 2UUWA 3CO9A 4IDHA 2VBYA 2W2QP 4KHSA 1N0UA 3CMES 1VDHA 1RTJA 3OJSA 4QBUA 1VQMS 2LKZA 4ZIWA 2HEKA 2G2YA 3L2WA 1NSQA 2XMVA 4CESA 1D5AA 3KDOA 2BUPA 4KREA 5AQOA 2A3ZA 2PSZA 4L3QA 2XNQA 1HBUA 3K58A 1WG5A 2YQ3A 4B3MJ 3RUBL 3I32A 1Y5IB 1A6LA 3TZWA 4G9ZA 4MDBA 2N4CA 3O5TB 4QIVA 4M7XA 3TAQA 1NZ8A 3VAFA 5E5NA 2UV8G 2FY8A 4FVCA 4ED4A 4X62J 1OH8A 4ID1A 5C25A 5EHHA 4TN2A 2VWKA 2MZ1A 3Q24A 5HQLA 1CJTA 4E89A 3KG4A 1LW0A 3BB5A 4YHHF 3BN4A 2Q31A 3CDEA 3LP1B 1Z25A 5F0UA 4FJNA 3JS9A 1UZHA 3P1GA 3VF4A 2MLXA 2W1BA 2CADA 2ZZTA 2DPIA 4DUYF 2H9ZA 1FK9B 4B3RF 2OANA 3NCIA 4JEPA 2IA6A 4M5DB 2UXCK 1MA9B 3QLHA 3K2YA 2E2OA 1K6YA 3AOAA 5L9NA 2YHWA 2CNKB 2LEAA 2WOMA 1UP1A 1IVZA 3L2VA 2V34A 5GAGU 1ZM4A 5HVFA 4WFZA 4RU2A 4C98A 1RYRA 1N6QB 4UOCA 1MLAA 5MLCV 2H1YA 2BDPA 4W5TA 1VQPN 3TZZA 1GFWB 2CNLB 3GIIA 3B78A 3OVSA 3QGPA 5K14B 3W5YA 4DR3F 3MWTA 2BRLA 2QTDA 2IVYA 3QFUA 3D0GE 3GJRB 4Y28C 3Q83A 2FJVA 2HHSA 4DV3F 2GC8A 5HMYA 1M5OC 3UFCX 1SH3A 3I5CA 3CQXA 3KLFA 2V2KA 3VF0B 2Q3PA 5C10A 1ZOTA 2PFFB 4DPOA 2DH8A 3T1YJ 2IVNA 2CVIA 4PPDA 3FK4A 5A8KA 3KLIA 3PNIA 4DCPB 2CG4A 1Y7PA 1MU2A 2FHKA 4NO7A 2ZH3A 4JI6J 1WHYA 1YX2A 5C5JA 3O9QA 1YWXA 4ZPDA 1IR0A 3FZHA 3I0RA 4DPYA 3T9ZA 3W1YC 2V8GA 2I8EA 2HFVA 4FJXA 4CZEA 4DTUA 3MZIA 4QCLA 2LLZA 5IWAK 4QIGA 1YF5L 1X4DA 1ESVA 4AILC 2DY1A 4IEIA 3PW4A 4J5OA 5KFQA 1M5PC 4WBFA 2IFXA 2A6AA 5GAEI 1F3FA 4IEEA 4JYAJ 2BJEA 2J9DA 2W9BA 4JV2A 1QE1A 4A62A 2CJBA 3OBWA 2VGMA 1JXLA 2B8PA 4JK8A 1FKOA 2MMYA 1VHFA 2P6TA 4FM0A 1J5OB 5DG9A 1DQ8A 4H5RA 2XWXA 2F9DA 3H2UB 2QL9B 2I7NA 3UKUA 4CLUA 1KEKA 2XB2D 1WUUA 1N8RT 3AVGA 4DOZA 3IS9B 4PKDB 2KG0A 4KJIA 3C7NA 1IBMK 3WQUA 4OV6A 2B4OA 1RDCA 2P5OA 3TA0A 1YJ9N 2D3OR 3MMBB 4UY85 4IFVB 4BREA 4BR7A 4UOFA 1ASWA 2YV0X 2QSWA 3H7HB 2YWKA 4LRFA 1GLCG 3E9OA 4CFBA 3HULA 1P1LA 1LFPA 3CPWR 4U8YA 5HLFA 4MQ3A 2P9SB 1BQXA 1FT8A 3GG1A 4PCQA 5A2QU 2GA7A 4CNZA 2FVQA 3RR7A 1WSRA 1XQIA 4ISGA 1RT7A 1TYQB 4Z4HA 3TX0A 4LF9F 2COLA 2QA4S 2Z1GA 2OO4A 3CJTA 4KKOA 2H51B 1SAZA 2BKPA 4EBEA 4H5TA 2BOAA 4JV5F 1H38A 2HAFA 5AQTA 4E3SA 3E01A 2E5LF 4Y0WA 1JKHA 1RUSA 2XO7A 4RU9A 3PDNA 2FY1A 3IG1A 1N34J 1WAJA 1T8EA 3MK6A 4FJIA 1VQ6N 4JI7K 2O4GA 4QW8A 1ZM2A 4URGA 1O13A 4JD2A 1Z4UA 2YTCA 3J7Z5 3A5OC 1KXPA 1ZXOA 1C0UB 1LW2A 3EPGA 1CS4A 4IR9A 3K9JA 2YI1A 1UVJA 1T44A 4ISEA 3VESA 4L75A 1U8WA 1VSDA 2DGVA 3DHWC 2H54B 1W0HA 2KDOA 2V94A 2YNIB 4X66F 4CZJA 2RF2B 2DBBA 3P39A 3WEEB 4IBNA 1GT8A 4QS9A 2VG7A 2X7IA 1N5YA 2BQUA 3SEOA 3AAQA 2CPHA 2P9CA 2KZZA 3H25A 4ED2A 4H4MA 2ILZA 2G1DA 2NXCA 3SQ1A 1NO8A 1S12A 2FHJD 2Q3SA 5DO2A 2ZOGA 5AQSA 4OI4A 2NSBA 3VQBA 2YX6A 1I3AA 4FSVA 4MK8A 2QYGA 3EL2A 2C42A 1BISA 4KHYA 1PJ7A 4WQ5C 3U1NA 1XNRF 4A8FA 2CH5A 2O8FA 4J37A 3OVBA 4LSLB 3VAIA 2OFGX 5BR8K 2W42A 2C2EA 2DRBA 1FJGF 4CJVA 4I0WA 1RAJA 2QW9A 5D0GA 3VEWA 2ZM6K 1AB8A 5J2MA 2CJYB 3OS1A 5GAHU 3SPZA 2W6LA 2MEWA 4CF8A 1U1NA 3LQVA 1H2TZ 2JLEA 5I3PA 4YB1P 3BGFA 4P73A 5CD4A 3GFXA 1ZBIA 1X5OA 4CLSA 4IG3A 4CJ7A 4YNQA 4FJHA 2Q6CA 3IN5A 2XZTB 4I69A 4WE1B 1RU2A 2HBYB 2XC9A 4B1YB 5LMNK 2QI2A 2HK3A 1TK5A 4OI0A 1LKZA 2YWWA 5A0YB 4AM7A 4CJFA 3UN5A 3K59A 3LTOA 4F3QA 2HRYA 3EVOA 3KVGA 5BN9A 4FP9A 4ERDA 3QFPA 1N88A 2P9UA 4DL5A 2RD5C 3SSQA 3IMXA 3ZZTA 3DRRA 1RWNB 2LQ5A 4DV1K 2R3VA 5F9NA 1YITS 2JEIA 4OYPA 2VQFF 2G0IA 2UUBF 2DIVA 2QXFA 2XY7A 4R5PB 3MM6B 4FJ5A 4NCGA 3O9SA 2OUGA 3BJYA 2I0XA 1IBKK 3KLEA 4JI3K 2E20A 3EE3A 1VHXA 1VQYA 4USVA 3G6XA 1LWCA 3FRZA 2RDJA 2VA2A 3HHLA 3ZNJ1 1WKKA 3V1OA 3CJ0A 2XY5A 3Q89A 2YH1A 2YCHA 1TMJA 5FDLB 3UD5A 2WONB 4K0KJ 1NDPA 4X65K 4QZVB 1QAXA 1QHTA 1Y0HA 2GIFA 1RBUA 1IN0A 1YVFA 4OIXA 1GH8A 1TL5A 4FWSA 4JRPA 3THPA 3DXMB 1WOSA 4F25A 4TQSA 1U0HB 1FKPA 4R8UB 4O0IA 4TY9A 2QEXN 2QV6A 3PTWA 1P8GA 2UVVA 3JTPA 1HNZF 2F4VF 4DN0A 3E66A 4CJTA 1VQ4N 2QO3A 4FKYA 1ATNA 4ETZA 2Q97A 2IC3A 2QYCA 1X4AA 4C8MA 3OW2M 5E2QA 2XYHB 2IRYA 1KLMA 4NX9A 3E9LA 2XLIA 4K4WA 4CGJA 3IRWP 1G15A 5A8RA 4EEYA 4PKIA 1AZSB 3R9LA 2ALZA 1QAYA 1BIUA 4B1ZA 3VEVA 1DQAA 2UU9F 3I9ZA 2FLNA 3UDCA 3BGLA 1FXXA 2DT9A 3VQTA 4EP4A 2C28A 2RQMA 4DN9A 3HFVA 2JWNA 3J7ZO 1KC8O 3OVNA 3HRGA 2E1RA 2W4PA 2WCXA 2KL8A 4KH0B 4RWXA 2K2PA 4UOGA 3R1HA 2B5JB 5AXNA 3SQOP 2QMXA 3M2VB 2AZ3A 2LEBA 3WNEA 4OZ5A 4KH6A 4P75A 1ASUA 4NOHA 3BN7A 1Q7YO 4URQU 3SNNA 5ETQA 5CZ1A 4ZDNA 1KWMA 4OI3A 5CYJA 1YQHA 4OGEA 4RKUC 3Q86A 1D9FA 1VK0A 2JLGA 2GFFA 3VPZA 2FC0A 2DITA 5EY4A 1SC1B 1S9EB 4GMJB 3KYLA 4GV9A 1NPRA 5HJYA 5HVGA 3FZKA 4I2PA 3UR0A 1VSIA 3ULDA 1BL3A 4WP9A 3GP9A 1N56A 1NHKL 1NGEA 3HX9A 3TOQA 3DYAA 2HFOA 1WF1A 5EX3A 2BE2B 3CCVS 2ZD1B 5F8IA 4ED0A 3J81Y 2MZSA 1NK4A 4ZTJA 2D3UA 3RJMB 4H0OA 4F4XA 4KHPF 4GV6A 3KLGA 2CPYA 2G9OA 2HGLA 3PCOB 1XERA 3IM9A 2Q1LA 3OPKA 3AAWB 2EI5A 2XY8A 2CZ9A 3LUYA 1FCAA 3ETMA 2ACYA 3OTOF 1HW9A 1T3OA 4CHPA 1A5XA 5D77A 3PZPA 4TY8B 2OPQA 2DCUB 4DR5F 4GKKJ 4AL7A 4DQQA 3THVA 1YBUA 1S1TA 2XRIA 1R8HA 3VAHA 4FYVB 2E1CA 4BLGA 3MR7A 2VBXA 1VR6A 3OV7A 3BP8A 5KFVA 3NF7A 2P9LB 4DB3A 1NLKL 4NLBA 2UUAF 2BV3A 5HRSA 2IJFA 3FRYA 4EBCA 4HTLA 4OZLA 3VR1A 1IBLJ 3L0QA 3ZXWA 4C8LA 1RWOB 4OYBA 3MMJA 2M70A 4OJHA 4MFBA 3T5HA 1ZS6A 1S9GB 4W5RA 2F40A 1X31C 3PIOL 2J7UA 3NVMA 3LP3A 4WFBL 4O3PA 3QEPA 4LF6F 4HDGA 3O4QA 3Q2TC 1RT1A 4E1NA 4PKGA 3TRGA 3DRSA 3LW5C 3I8BA 2PEHA 4ZPWR 1HLWA 1C1CA 3CJKA 2U2FA 1QAIA 2LVWA 4IO8A 3W8GA 4YOXA 2O8CA 4RO0A 3TA2A 1JLQA 4GY2B 4EP5A 4JI5J 1YTYA 2P9IB 2HMPA 3VGTA 4JKEA 3B6PA 1U49A 4BDYA 4C8ZA 5BJRA 1S1XB 5DDOC 1HMVB 3BV8A 4CWBA 1BQMA 2H5IB 4UY8T 3QT8A 2BGGA 1DT9A 2CPEA 2DXEA 5FROA 2XSJA 3THWB 3UN2A 3QZ8A 2ZH1A 4Y1DA 2Y1IA 2QN6B 2VFRA 5DLFA 2HWIA 2MKYA 1U02A 3BGOP 3GWCA 1O51A 4C0OC 4LY7A 4OV1A 1TKXA 3I0SA 2HHWA 4NLWA 3CIPA 1YJVA 1T6CA 4JI0F 1Z26A 3CFOA 4GKJF 1RGVA 1YJWS 1U1RA 3HJFA 2IVOA 4CD1A 4GV3A 4LF7K 3SCJE 3PXGa 4RW6B 5J1EA 2EK1A 4ZJLA 4K4YA 4YDXA 1KD1O 1VQOS 1QUPA 2A5XA 2YHXA 1X9SA 2OD4A 4DMNA 1X3MA 3KK3A 3PKYA 1KCFA 3OYIA 1S59A 3SV4A 5IT0A 1ACMB 3W5ZA 2D41A 3L4QA 3CW2C 1TK8A 3EDQB 5KFRA 3SDEA 1AT1B 5CYQA 1VI7A 3LZJA 4KV8A 2I5JB 2BW7A 4DMZA 1WSGA 5AQPA 4OLOA 2XMKA 2OELA 4LSNA 1IKVA 3GYGA 2N4DA 1OSCA 4EO6A 4DV4J 2ZHOA 3C6TB 1S6QB 1IBMJ 1U1PA 5C12A 3NCPA 3MAQA 2QA1A 3DXKA 2GX8A 4K8RA 2M8DB 3HM8A 3RRKA 2WUSA 5E3PA 4CFAA 1TKZA 3IRXB 1Y64A 2JLFA 4YR3A 1JK9B 4CM0A 3PHEA 2GO8A 2MJNA 4P2SA 2W2PP 4F50A 4QR1A 4BC4A 3ENQA 3NXZA 2X3GA 1K9MO 3E8OA 1J6ZA 5ADZA 3N6LA 3QO9B 3CF5L 2J7WA 1YSJA 1BLUA 1NHUA 4N8NA 3NBPA 2DR8A 2R8IA 1UA1A 3TUIC 2B9YA 2NXNA 2P2CB 4C3KA 1X4FA 2YWEA 1UW4A 2I2YA 4OO1J 1HKAA 2EX3A 1HQUB 4F7VA 3CMAN 3THYB 2CDRB 4WU3A 2DNZA 5KI6A 2C2DA 2DY4A 1KVAA 3FQLA 3P5TL 4WKRA 2CQIA 2CWXA 2MTLA 4PQUB 1CULB 1M1GA 5E84A 1SUQA 4DQIA 3CJ3A 3LPUA 1S1VA 3CJQA 5AJ3J 1T0TV 3ILJA 2P9GA 3PM9A 2IYIA 2GTDA 4YR0A 4DUYK 3QGGA 2PZSA 3CCLS 3MAAA 4H8KA 2RILA 4CFDA 2XMUA 1T9WA 2J7KA 5FPNA 4CHYA 2C2NA 1FWPA 5AQQA 4JKGA 2W9CA 2B4JA 4L72B 3P5BP 5I3UB 2DY9A 2GQQA 3POTA 3JSYA 3PSFA 4KHNA 1JLEB 3HPHA 1HD0A 4AHVA 2EFOA 4OLBA 1HKBA 4IOXA 4BRNA 3U02A 4ZS6A 5EWGA 3G71S 2E66A 4FYDA 4Q44A 2CJXB 2XMMA 3CPWM 4F67A 4DR6J 2RJZA 4DR3K 3VN5A 2LMIA 4CD3A 1NGGA 2ZEJA 3MMVA 1TL3A 1R31A 2LQJA 4DV3K 4QJVA 3BS9A 3M9MB 4TKTA 4KTZA 3H08A 1RLDA 5M1OA 4NLDA 2ZM6J 2P9NB 3CMEN 4DFJA 1T11A 2VPYB 1L3VA 3MR6A 3UPFA 4ED3A 3IUCA 1VQMN 1IWAA 3CJ7A 4ECZA 2A42A 3F9KA 2KW4A 4LFBJ 2Q2RA 2JDJA 2MKHA 2KVQE 4RJVA 1XMQK 4M3RA 5GMEA 5KFXA 2Y8YA 2D5RA 2W4DA 5CCMA 3TSPA 3ILOA 1AUDA 2XSFA 3RMBA 1T6DA 3V6JA 1RDDA 3VOVA 2XMTA 2HQGA 2MQ8A 3HKWA 2VZ9A 4GRSA 4N56A 2H5EA 3BO2A 1TKDA 4ES1A 2CQCA 3M1VB 4DL6A 2FHOB 1OH6A 3VQ6A 1R8CA 2WW8A 3BEXA 3HVTB 1FD8A 1HBMA 1HQ2A 4ZLLA 2JJ4D 4USHA 2KO1A 1HHSA 3W2VA 2O8DB 3BH6B 1MW7A 4ZPVR 1BI4B 1SJFA 4FM1A 5FIIA 1HBNB 2DNPA 4LVNP 2CQ4A 4DV1J 3I82A 3V6DB 3LL3A 1TMMA 1UPPA 2RHSB 1RT2A 3LP1A 3IAS9 3VWSA 1JLCB 1KAXA 1DTQB 5BR9A 2HB5A 2QXLA 4QPTA 2KJVA 5AXKA 1IBKJ 1FK9A 4M5DA 3PJ9A 2B9EA 3A13A 4ECUA 4WP8A 5ADXA 3GLJA 3VAMA 2OSQA 1CJUB 2C3OA 1MWMA 4UZCA 4H5WA 4FVMA 4FF4A 2A0FB 3VA0A 2EG2A 1M1HA 3G0ZA 3ZTOA 1FNXH 4UZBA 4OPHA 1TK0A 3GQCA 2GGPA 4LF9K 3UDEA 4HHJA 4S0MA 3DLGA 3FZ2A 3B54A 3ALYA 3THXB 4BE2A 2GHVC 4AXIA 2HVEA 4JV5K 4B1UB 3NS6A 4G1PA 3RSEB 4I9LA 3HVWA 4DV2J 4J9QA 2ACMA 5AQWA 2MGZA 4FLXA 1GTEA 3OR2B 2B6AB 2L48A 5ELZA 1M90O 4LVOP 3TANA 1N32K 3IGVA 4DTMA 2FLOA 2IVPA 1NJYA 4MJKA 2DEJA 4G1QB 3IDHA 4X66K 3UN3A 2FBYA 1S7HA 4J9MA 2AGQA 3F5TA 3CVKA 4PPZA 3DOKB 3KKSA 4HKQA 2R2SA 4DV7F 4L8RB 4V19S 4DL4A 4DX6A 1S6PB 5EX5A 3M2UB 1Q82O 3PIPL 1TL7A 3C6UB 2CG8A 3DJCA 5EVZA 3BKTA 1E6YB 2MLZA 4KT0C 1RA7A 4D3GA 2G8HA 2PAVA 4FYYB 3Q22A 3LAMA 3SMZA 2OYQA 3M30B 1X9MA 3DI6B 1GXTA 3X1LB 4KGMA 1WTFA 1JCFA 4OX6A 4FLZA 1FXDA 2MKIA 5F2RA 4MTPA 1XNRK 3PFOA 3V81B 3CERA 4BE0A 1FJGK 3H4BA 4FWPA 1CC8A 2HG4A 5GAGI 3PHTA 2D0AA 5IT9U 3UE2A 3IS9A 4F2RA 3MHYA 3N4PA 4DR7F 2KRBA 1XMOJ 4FXVA 2DHSA 3WNHA 1EWQA 2OI2A 3K0JA 4ZPTR 3CB4A 2L9WA 5L9XA 4BE1A 3ZSZA 2MQQA 1HI1A 1LQ9A 3SUQA 3O3FA 1GEHA 2FHJA 4LBPA 2AT1B 2R8GA 2LXUA 3QEIA 3VGUA 4PG6A 1TP7A 4UQGA 1FRLA 1I94F 4FLWA 5KFLA 4JI6F 3H5XA 2PEBA 2GQ2A 3GL1A 3WXMB 1DZ5A 2IRXA 2DNYA 1JNZB 3T1AA 4LFCF 1FX2A 4FPBA 4BR2A 2CQ2A 2QA4N 1SV5A 1HHQA 3N79A 2VQEF 3D9BA 5KRTA 5HP1B 3GE1A 5KTQA 3ILIA 4X4RA 2NNWA 2POKA 4CGDA 3PYGA 4F3MA 1WG4A 4WYLA 4CLKA 3NG8A 3ZC4A 4L3NA 4JYAF 1C0GA 4DV5J 1UFWA 2VQFK 4NYNA 1WNSA 2UUBK 1F6TA 4ZCIA 3I96A 1F5BA 4DQSA 3WC2A 4R79A 3ZFVA 4FZVA 5DZ6A 4E7JA 2ASPA 2O8EB 3P83D 2XMWA 4YP3A 4FN5A 2KYZA 4LC9B 2E4LA 3PRDA 2YNIA 1FTRA 2MY8A 2VOOA 4RX6A 5L38A 1VRUA 2RF2A 3QEVA 4FK0A 3WEEA 4W90B 2FSJA 2EXUA 4YEAA 4NLGA 4AHUA 2AZ1A 2IJNA 1WN7A 4BR5A 2G2OA 4ZCMA 1VSEA 3BBBA 5CZVA 3E51A 2G8KA 4PG4A 4WQ5A 2GVDB 2NXEA 2M4MA 1HYZA 2BM1A 5AT1B 4IO1A 4DF8A 4JI1J 3VMFB 5T7LB 2RS2A 1VBZA 3GIKA 3VA3A 4A2BA 3ZT3A 1MDUB 1CQMA 1YJRA 2GNKA 3NLCA 3AO5A 3LDPA 3LF0A 4W5QA 1X7VA 4RL1A 4G3IA 3R5AA 4ZLNA 2E7WA 3C14A 2ETJA 3NGRA 3TEHB 2AYGA 4ZPBA 1BHLA 4MKVA 1RBLA 5KG2A 3ZSQA 1H2UX 4M5NA 1IG8A 4FJ7A 3FZBA 1YBAA 1K1QA 2ZUAA 3BQ2A 4HYKA 3JSBA 1YRUA 4OZNA 1VOMA 2W40A 4LIRA 4QIFA 3W9IA 5EWFA 4LF5F 2HWHA 4KAIA 1W2BR 2CQDA 2R42A 1Q86O 2UU9K 4I2QB 5AQIA 1RHKB 1WD6A 1HBOB 3HO1A 2LYVA 2Q79A 4USUA 3RW7A 1FO1A 3JXOA 5GMDA 3HFZB 5A0YA 5B7WA 3IWXA 4F36A 3A8IA 3O8WA 4I64A 4M5HA 3PV8A 1BO5O 2ADCA 3AAPA 2KHCA 4LF7J 3G86A 4FJJA 2CQ0A 1U48A 4LUBA 2F8HA 4WCEQ 3GSIA 3TTCA 1Y10A 2HQCA 2YKAA 3MD3A 3UB5A 3T5JA 1YITN 2BJ8A 3D67A 4NLQA 5AQHA 5L46A 2W25A 1DRZA 2HZAA 1SJ3P 5ETOA 4O55A 1TV6B 5F8LA 3GONA 1S48A 3W9JA 4HL9A 4R5PA 3OUYB 4KO0B 3GV8B 3R2CJ 1TVRB 3THTA 4F0HA 1SH2A 1HKGA 3M8PB 3L95X 4A5AA 3ZEUB 5DDQC 3H98A 1RSCA 3SCIE 3G87A 2EKYA 3HT3A 1OKJA 1JXEA 3PACA 5JICA 4BY9C 5FRNA 4BR9A 1R7IA 1VC6A 1TAQA 4KHPK 3D6FB 4QAGA 1S57A 5GAHI 1FWLA 5B0EA 4N41A 2QKBA 3GCWP 4CZFA 1QVFR 4PXDA 3WNGA 3DXMA 3DXSX 2O1PA 3PR5B 1P90A 4R8UA 1T05B 4IRDA 3AA9A 4DPWA 1QM9A 4HACA 5CZ2A 1MN7A 2FUG9 2KJWA 2L41A 2B9WA 4PZVA 4UF4A 2ZJRL 5AE1A 1NHVA 1GLBG 3OVAA 3EEQA 5H9EK 2BJ7A 1WNEA 3V2UC 2CZ4A 4X64J 2IHR1 4P7TA 3O1LA 4OLAA 1U0SA 3AVNA 3WDOA 3OYMA 2ITGA 3C6HA 5F3TA 5KFTA 1YZ7A 1WSFA 2BANB 4QWBA 2D3ZA 5M1PA 2JFDA 1UA0A 4ANEA 2KM8B 4NWBA 2DISA 2GHWA 2UUAK 1AW0A 1T03B 1S5JA 2ZF5O 2MZTA 5H1SQ 2XZDB 4YHHJ 1FVSA 3MEGA 1BIZA 3LP0B 3K5NA 2DO0A 2Y0BB 3FMBA 3GJSB 4QIEA 4TXSA 4FO0A 1I5OB 1SQGA 1BE4A 3D1HA 4DUYJ 5AQGA 5J1PA 4B3RJ 1XHZA 3M2VA 5DK5A 5LSOA 3RAMA 1WF0A 4LF6K 3PW7A 2V6AA 1HR0F 1N4LA 2HVZA 2NZCA 1RTJB 3WZ0A 4NLVA 4K0KF 2JHEA 4DCHA 3MURP 1NAQA 4FW1A 1V4SA 3NAIA 3SV3A 3W3SA 3M8QA 5DQIA 3BDPA 2CJQA 2CH6A 3ZZYA 1FWKA 1RBSA 4JRQA 4DR3J 1HBUB 3ZZ0A 4IUFA 3QT6A 2R4FA 5L1KA 1SJ4P 3SCXA 2J9DE 3AVHA 4JKDA 3CQ8A 3QEXA 1NGFA 4FLTA 4A8MP 4J9SA 2W2MP 4QU6A 3KMQA 3SYZA 1NM1A 3CCVN 2BE2A 4CGHA 3CMQA 2FVRA 4ZVSB 4FVUA 2JEJA 2Y1LB 1NG9A 2EVZA 5C2GA 3KTQA 3QNNA 3O2IA 1C0MA 4JI0K 3HHDA 2CPZA 1EWRA 2ZWHA 1XMBA 2EC2A 4Y0FA 1Q9YA 3LDQA 3H6EA 4PG7A 1U2RA 4KGKA 2FJEB 2F8MA 3KNGA 4M63C 1T94A 9RUBA 3N4QA 2JEGA 1Q8KA 2ZJPL 2FBTA 2I6WA 3RAQA 2YX4A 4BC2A 3FVYA 2WOMB 1PJ5A 2OCEA 2XBPA 3OSPA 3J7AP 1TUWA 4DSFA 1X4GA 4DR2F 5IT9O 4O5BA 3D28A 4Z7YA 2HHQA 3CGIA 4C3LA 1B70B 1B0PA 2XM3A 3HFKA 4Z0UA 1YLXA 3PVXA 1VLYA 2YNHB 3ZSWA 3ZZRA 3SAGA 1C4CA 3W2WA 3EE9A 4XH1A 1RADB 1Z1ZA 3MDFA 4NLSA 2GEMA 1HYSB 4F3OA 4RWTA 1TL4A 5C24B 2QX0A 3DLLQ 2YNGB 5M1QA 3WUHA 2F7VA 2UVRA 1N33F 5A8KB 3PFEA 3KLIB 2JEFA 4YOVA 5AQNA 3TAPA 4WFXA 4C8OA 4F4ZA 2V63A 5IM0B 4FPIA 1CEZA 3I0RB 1DEJA 5GIPA 1E3MA 4R25A 4OFZA 3KZBA 2C2ZB 1G6BA 3TYTA 2FF3B 4PRFA 4GVBA 1IJEB 2HHPA 3FR0A 4CEOA 1CVJA 4O8UA 4YDDB 4JV5J 1N5QA 2DTUA 4C9DA 3ENAA 2E5LJ 5C0YA 1Y5LB 3DC2A 2DNOA 3M6WA 4FPAA 1BMQB 4CJ4A 3A5LC 3VQEA 5AQXA 3HSTB 2YKOA 1FKOB 1VISA 4QYRA 2ZBPA 1YJWN 3PO5A 5F8HA 4M3TA 1IBLF 3OYCA 4IZ9A 2EFQA 5GVQA 4ZVTB 2QLWA 4X66J 2LP4A 4RW6A 1D1UA 3NGZA 2ZH5A 3C7NB 1VQON 2D3O1 4B3TF 4WZQA 3CDUA 3UQSA 1RILA 4OX9F 2HPUA 3ZTPA 3OYFA 3D54A 2A40A 1W7AA 3FZMA 2VFSA 1FHTA 5DM6L 2XYPB 4Y3CA 5LL6Z 4JKCA 2JVOA 3ZT1A 5FPMA 5RUBA 4H0VB 1LXJA 4MO4A 3GFYA 2CWKA 4WIIA 2B56A 4CZKA 3CSKA 3EM1A 3I8DA 1LAWA 2V2VA 3D2EA 1EETA 3H2LA 4PAAA 2HURA 1RBOB 3MCOA 1HLUA 1RT7B 1NJIO 5DJBA 5F0WA 4KKOB 3AD7C 1H3DA 4ZIVA 4K5RA 1RI7A 3ZLJA 4RBUA 2RNEA 4OZJA 1QY7A 3G8SA 3OR1B 4U67L 4DF4A 2OKQA 3IG1B 2DHHA 1ZM3A 2CJKA 2KB2A 5FJ4A 1RWWB 5D4NA 4JD2B 3NNCA 5DQHA 1S79A 1LW2B 4ZA1A 3L7OA 1APSA 1CS4B 2H4WB 4Y1CA 3P45B 2P1JA 3H59A 1VQ7S 1F9FA 2DGUA 4RR5A 3G6VA 5HATA 2GAHC 3L3UA 2VG7B 1N5YB 4DSIA 4CHQA 3Q0AA 4M45A 3QMQA 1WWHA 4IQMA 4BWMA 2XCPA 1HQUA 4MKBA 5G0RA 4H4MB 2P9KA 3I6PA 3KJVA 2GV1A 3THYA 2XHBA 2PYJA 4GMKA 2CIMA 2DNGA 3ASMA 4K5SA 5TKYA 2BXJA 1X9JA 4PQUA 4CGGA 1UJ5A 1DARA 2VQFJ 5TKWA 3OL6A 2UUBJ 2ZVSA 4DU8A 4L73A 2FJBB 3I4HX 1G7CB 3VAKA 2QWQA 4NA2A 3CI5A 3MDQA 3J7YP 4DV4F 3R7SB 5J2MB 4B08A 4E7HA 2AIRB 4FXDA 1WJ9A 4HT5A 4WP3A 5I3UA 3OFFA 1UEUA 1JLEA 2K06A 2FVPA 2Z57B 4IH7A 5KG1A 4FWRA 5HANA 5D0EA 3G71N 3ZZUA 3OY9A 2NUBA 1TKTB 4IG3B 3BKFA 2P9PB 4RW4B 1I3OB 4KRWA 2X78A 4LQ3A 1WKJA 1GX6A 5C7PA 3J80U 5IQ6A 4U7UD 3E1YA 4LIWA 4B3MK 1QAJA 3QAUA 3O4WA 4HEA9 2YXLA 1AROP 3NF8A 4M5LA 1UFLA 2IM1A 1NK7A 1OH5A 4I4BA 2JH3A 1HNZJ 2F4VJ 5B8HA 1UVKA 5JVHQ 1AUSL 2OHDA 5BRDA 2GELA 3F2KA 1QDUB 2APOA 4NLCA 2UZAA 3SQ2A 2PE8A 1JLAB 3CC7S 3AH6A 3DRRB 5JUMA 1N48A 4QS8A 3MCAB 4ILGB 2DNMA 4MMOA 2J8SA 4HVJA 4LJMA 4A8SA 4OHZA 1NKBA 2UU9J 1ATRA 3WX8A 3JXUA 4NCGB 2CRLA 3C8YA 4KY3A 4C8YA 4DV7K 2RPIA 2WC9A 1V3ZA 4N5SA 2KHOA 3CHWA 3FMWA 1NGBA 3ZX0A 1Y11A 3K2PA 2AW0A 4ZP9A 5D78A 1LWCB 4RW8B 2HS3A 3S3NA 3HHLB 1HPMA 4QS7A 4OZ1A 1PYOB 4OYAA 1BI4A 1HBNA 4A4JA 2HHHF 3LPYA 1LEOA 4KR0B 3KKRA 3JQJA 3D4JA 4CO4A 4O3RA 2LQ9A 4ILJA 6AT1B 3AA8A 2QWOA 5H9FJ 3LWLA 4OX8A 1UL3A 2Q0RA 1WKLA 4J9LA 1JLCA 5CXTA 1DTQA 1RYSA 2A6MA 3A1YG 1R0CB 2ILYA 1W25A 3MEKA 4H03B 2DGWA 4XPEA 3TR5A 4NPOA 1SI9A 3A8YA 4YS2A 5KFOA 5B09A 4CLFA 2DNKA 4I67A 3DLRA 2IC3B 2M7SA 2BM0A 1CJUA 1NSPA 3EN9A 3U7JA 4LFBF 1BHNA 2PYLA 1KLMB 4JI6K 3O44A 1WC3A 2R8HA 3FSIA 1NK8A 1W2BM 5KFHA 1NK6A 1J5EF 1T3NA 2ZH6A 4KBIA 4LFCK 1C1BA 1Q1KA 5EOYA 4CEBA 2E2PA 4I6WA 5GAGP 1FESA 4DCJB 3R8EA 3I5AA 2VDIA 4JV0A 2N82B 2OH2A 3OTOJ 2Y9HA 1KONA 3OYGA 2PFDA 5HMWA 2E88A 1NB2A 1PILA 4I9QA 2QFJA 4V1Ak 4DR5J 3KUHA 5H9EJ 1RAOA 2VPWB 1KRPA 3QETA 5K5MA 2ZH2A 4JYAK 2HWTA 3V6HA 2B6AA 1RT6B 3I5BA 3GIJA 3VGKA 4K59A 2W2NP 4MK7A 4DQRA 1MMDA 4PL7A 2XLJA 4EHUA 1WOPA 1TFWA 2X74A 4USMA 5EU7A 2RS8A 5KGXA 4ILRA 2K3KA 3NH1A 1SL1A 2BRKA 4DSJA 3G25A 4PXEA 4BQZA 3SXLA 3CUNA 3DOKA 3SMPA 1D9AA 7FDRA 1YVUA 3M2RA 1T9XA 2GMJA 2B51A 4ISFA 3MM7A 3KFWX 1S6PA 3G8QA 2VONA 3M2UA 1IM4A 4BDPA 3C6UA 3GPAA 2Y3YA 1XIQA 4CJKA 4LH4A 4C6AA 2CVEA 1FE4A 2N3OA 4CGIA 4LF6J 3QMLA 3Q2SC 2NLWA 4CGFA 3M30A 5F8GA 1NMNA 2K1RA 2Q66A 3CC2N 1VRTA 1Q81O 1NGCA 1QVFM 2EPIA 3KLGB 4EFHA 1L3SA 4HUEA 3V81A 4CQ1A 1C0FA 2MJUA 3V1RA 4NLUA 4XEIA 5AQYA 1QTNB 2HBRB 2KH9A 3OYHA 3BBFA 4DFPA 5LJWA 3B8HA 3A3OB 4FJLA 4JI2F 4Z4EA 3N6MA 4ICLA 2JX2A 5KFBA 2VDHA 3S8SA 4DV2F 5K8OA 4CF1A 4OJ1A 1RDWX 4QOTA 2C2KB 4DKWA 3AARA 4RUHA 4N47A 3CCES 4OPJA 1ILYA 3RBZA 3ADAC 4E0DA 5CYMB 3SFGA 4JI0J 3R3LA 4HR2A 4C0BA 1S49A 3IR7B 3O08A 4GKJJ 4GW6A 4OKKA 4ZN1A 1A5WA 3CM6A 3AJDA 5HP1A 3IXQA 4MFBB 3NNAA 3AO2A 4R0JA 3S6EA 3AGRA 1TUGB 2F65A