4LSNA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 131
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lsnA05
4LQ9A 3AVBA 5FDLB 3SUQA 3NF8A 2B6AB 4B9UA 3RAQA 4AHTA 4FLUA 3DYAA 4IH5A 1L3VA 4CFAA 4KB1A 3NF6A 5DGAA 2D0BA 1NK5A 1C1CB 3BSNA 3L2QA 3NCIA 4DFMA 3MXIA 2OPRA 3QEVA 3K2PA 4B8AB 1SV5B 4EBCA 2FVSA 1I3AA 1REVB 4OKJA 3FRZA 5HRNA 1JXLA 1TK5A 3EZUA 4IOBA 4W5RA 3O3GA 4FM0A 5KFDA 2ZD1B 3SQ4A 4F2RA 1HNVA 3HT3A 3AVNA 4JV1A 4ECRA 3TAMB 3BQ0A 4KV8A 3G6XA 2E6MA 1C2PA 1CZBA 3OL9A 1CXQA 4F4KA 5KFXA 3G6YA 3PV8A 4KB0A 4W5NA 4DTUA 4ZP7A 2I5JA 4M42A 3ICLA 3LP2A 3DM2B 3H98A 2W9BB 2F8EX 3SUPA 1N5YB 4XO0A 4Q45A 4H8KA 2OPSA 5HRRA 4O0IA 2DPJA 4URQU 4DU1A 4E1NA 3V6JA 3LWLA 4DSFA 3PY8A 4CJPA 3MECB 2RDIA 4OPKA 3B6PA 4DLGA 5DK5A 3AVKA 1RAJA 4K4YA 4MKAA 4IDKB 3MXJA 5KFVA 4E0DA 2FJXA 5KT5A 4FVMA 3DLGA 4IH6A 3HKWA 4IBNA 4E7JA 3MR3A 5KRSA 1LAWA 1VSJA 5KFFA 4B9LA 4K4VA 2ILYA 1QUVA 3OL6A 3RMBA 2KTQA 4FLVA 1IKXB 2AGPA 5KT4A 3NGDA 4CF1A 4JRPA 1ZYQA 4ECXA 1TVRB 4O4GB 2IM0A 1DLOA 3U3GA 4N41A 5HROA 3ISNC 2HWHA 3KJVA 3QIOA 4N56A 3SCXA 1HQEB 4ECZA 3JYTA 4I2QB 3SQ1A 3HVTB 3KK3A 2EC0A 3NGZA 1IG9A 2EX3A 4DTJA 4TY9A 2DPIA 2HHTA 1VSHA 2XI2A 4F4ZA 4ICLA 4TLRA 1WNEA 1LAVA 3OSNA 2Z1IA 4B9MA 5KGXA 1B9FA 5C42A 1TKTB 5J2PB 3DLBA 1GOBA 3DMJA 3V81A 4FM2A 1N4LA 4FBTA 2W7OA 4MIBA 2YNHB 1DTQB 1XR5A 3L8BA 5CYMB 1CLQA 4Z4HA 2YNGB 3O4NA 3CO9A 3LP3A 2YNFA 1O1WA 4F2SA 4KFBB 4J9MA 3DLKA 3QEPA 1X9MA 3ZCMA 1LW2A 3FDSA 5KFLA 2OYQA 4MK9A 2X6SA 3QIDA 3P83D 4O5BA 4CEAA 1IKYB 3N6NA 4KI6A 4KV8B 4Z4GA 1K1SA 3LAMA 4J2EA 3CJ3A 1JXEA 3H5SA 3VQ8A 1NK6A 4CECA 4ZVEA 3V9UA 1B9DA 4NLRA 1JX4A 3S3NA 5L9XA 5F8IA 1ZBHA 5KFEA 1RT6A 3DRSA 3OYCA 3BGRA 4BDZA 1HYSA 2OPRB 5KG1A 5J2MA 3AVJA 4DG1A 4RZRA 1GX5A 1T05A 4CJUA 1QS4A 3L3UA 5KFPA 3E01B 1S6QA 3HP9A 4BWJA 3D5MA 1RNHA 4CJEA 3TAPA 4FJHA 3N6MA 4Y1DA 4ECTA 5FDLA 2XC9A 1WAFA 5KFRA 5J2QB 4CHOA 1C1AA 3HHKA 2DFFA 2BANA 2X78A 4WFZA 3LALA 2VWKA 4PQUA 4CHZA 1NJZA 1NK0A 1S9EB 4NLQA 2I5JB 4ZMMA 3L2WA 5C25A 1SL2A 4CFCA 3KK2B 4JUZA 1KCFA 4FJ5A 3AA5X 2UVWA 1UA1A 1VSDA 5F8NA 3TAQA 3Q8PB 3TAMA 3WNEA 3PX6A 3CM5A 4F50A 1ASVA 3TARA 4ZHRB 1EKEA 2W8LA 3T5LA 1YTAA 3PR5B 1JLAA 4I9LA 2HWIA 2HNZB 3T19A 4B8CA 3TVKA 4ZPDA 1S1VB 1BCMA 5EDWA 4CJSA 3QNNA 4TY8B 4KO0B 5KFYA 2RKIA 3OY9A 4E7KA 4LSLB 3SV3A 3E51A 1CXUA 1U4BA 2P5OA 5KG7A 1QAIA 1KRPA 3KLVA 1TKXB 4J9KA 4MFBB 2IDOA 4AH9A 3DI6B 1FKPA 4TYBA 5EWFA 1QAJA 4CFDA 3AVIA 3LZJA 2E9ZA 3LPTA 1L5UA 1KLNA 2RN2A 2R7YA 1YVFA 4RW9B 3SFGA 1S10A 3TR8A 1RDRA 2ZQBA 5JUMA 1N48A 3RR7A 1FXXA 3SQ2A 3MAQA 1J5OB 4LD0A 2FJVA 4RNOA 4CHYA 4DWIA 4CIGA 4Q44A 1HMVA 1FKPB 3M8RA 3QNOA 3KMQA 4CJ3A 4ED7A 2WTFA 3IRXB 1Q9XA 3CM6A 4ZPAA 2E4LA 3E01A 5EUHA 4N76A 2V0NA 3AVFA 2R8JA 2JEGA 4IR1A 4NLYA 3HVAA 4FW2A 1UWBB 2QKKA 4TSXA 2GV9A 1J53A 4RU9A 3A2FA 3RBEA 4AHCA 4O3PA 4FJGA 4F4XA 4CEDA 4M95A 3PO5A 4FM1A 1NKEA 1LWFA 4JV2A 3NH1A 1VSMA 3RAXA 1NK7A 4H4OA 3SI6A 3QYYA 3BJYA 3OYJA 3MEEB 4M3UA 5KFWA 3VQEA 3QEWA 3OYGA 1HPZB 4NCGB 3MFIA 3KKRA 5CYQA 3I5AA 2B5JB 2BQUA 1RTDB 4QAGA 4DSEA 1LW2B 1UA0A 5KFAA 1D8YA 1RDBA 4AHSA 3G0ZA 1X9SA 2YNFB 4YQWA 2ALZA 4FJNA 5HRPA 2YNGA 5F8JA 2E6LA 1N6QA 3DLEB 4ZP9A 4NLXA 4C8NA 5KFSA 2JGUA 3FQLA 3DMJB 3DOKB 4L8RB 4Q0BB 3V4IB 1TKTA 5KG4A 4YR0A 3T5JA 1DTTA 4E7HA 3OYKA 2F96A 5HLFB 5K14A 1RBSA 4IG3A 1HYSB 3C94A 1BGXT 4M3YA 4WE1B 3NH0A 1I6JA 4IRCA 1D1UA 3HYFA 2OPQB 3HVTA 3KK3B 3M9MB 2UVRA 4EP4A 4B9TA 1LWCA 1GOCA 4FW1A 5KG3A 2BQRA 1T03B 1RT5A 1IKYA 2XY6A 2VG5A 1S49A 1ZETA 2O4GA 4R5PA 4DL3A 1LWCB 2RDJA 3RB6A 1Q8IA 4QWBA 4M3XA 3NAIA 4RNMA 1S0MA 4E1MA 5F8HA 3KHHA 1RT4B 3BQ1A 4B3OA 2C2RA 4IFYB 4CEBA 3KLIA 2YV0X 4IG3B 3V81B 1WSFA 2IAJA 4MQ3A 3CDUA 1JLBA 3I0RA 4DL6A 4ICLB 1UAXA 5F9NA 4CGJA 3DLEA 3IAYA 5D3GB 4HCBA 3ITHB 5HBMA 2V4RA 1RILA 4PWDB 3O4QA 1G15A 4CGGA 5I42A 3KK1B 3HJFA 1RTDA 3K57A 4URGA 3QEIA 2C2EA 4LH5A 1IH7A 5HROB 4ID5A 3I5CA 4WFXA 3OVNA 4FZYA 4HYKA 1S1WA 3AO3A 3MEEA 4Y2AA 2QV6A 1CSJA 3SNNA 4ZVFA 1LWFB 3Q8QB 4QWAA 4G3IA 1LV5A 4DFKA 4CEZA 5DMRA 4DSJA 2GC8A 4FJJA 3EYZA 3QO9A 3ZT3A 3AA2A 3GIKA 3VN5A 1A5VA 3AVGA 5KFUA 4RUCA 3H2LA 4PY5A 3LANA 4RW4A 1GX6A 3ZSQA 4DS5A 1D0EA 3TWHA 1BIZA 2XCAA 3QETA 3LWMA 1TGOA 5C24B 4EP5A 4E89A 3PW2A 4CJRA 3NMAA 1W0HA 5JS2A 4NLSA 5DG8A 4M3ZA 1BI4B 3ULDA 1NK8A 5KFZA 1NHUA 3GYNA 3DM2A 4JS5A 4RW7B 4GMJB 1SKSA 2KFZA 2D0CA 3QESA 2A1RA 4NYFA 2WRMA 4CJWA 4KB7A 3P5JA 1RA6A 3M8QA 5KFOA 4HCCA 3VQ7A 4EZ6A 4QW8A 4CGDA 1NJWA 1ZBIA 4FJ7A 4DQIA 3DOLA 2AX1A 4EEYA 3KHRA 2IBKA 1ASUA 4RG8A 2GIRA 4KBIA 3ZSVA 4ECUA 4OJRA 4FZZA 2EHGA 4RUAA 1J9AA 4I2PB 2JEIA 4IG0B 2ASDA 1KFSA 4EO8A 4HHTA 3SPZA 5DLFA 4BACA 3TAEA 1JLAB 3FQKA 4LH4A 2F8SA 3RMCA 4NLTA 4M45A 4CK3A 2E9TA 4C8MA 3H4DA 2FC0A 4ZHRA 1U09A 3PJWA 4B9NA 2B6AA 2UVUA 4DSKA 3IGVA 1TV6B 3ZT1A 3LP0A 5C25B 2VA3A 4ZVGA 2W8KA 2Y1IA 3VQ4A 3BSOA 4XPEA 4MIAA 1KLMB 4IQXA 4KHRA 1NHVA 3S3MA 3EY1A 1LWEA 3NDKA 1EETB 2WHOA 1XHZA 4IFVB 4XPCA 2BRLA 3CDWA 3PX4A 4FYDA 1S9FA 3VQAA 1KVBA 1S6QB 3LAKA 4ZP6A 1TL3A 4Y34A 1F21A 1T05B 4Y3CA 3UR0A 4EZ9A 1HQUB 4M94A 1RT7A 4MKBA 3MR2A 3T5HA 3D0PA 3K59A 1Q9YA 4BDPA 2RF2B 1XR7A 1WNSA 3DRSB 2ZE2A 3PVXA 4XIUA 5DQIA 2D7SA 3SQ0A 3AVCA 4NLPA 3H5XA 1RDDA 1MU2A 1S9GA 3H40A 3MF5A 1X9WA 2A1SA 4BE0A 4RNNA 4IKAA 4ED0A 4CHNA 2JC0A 4DF4A 2HNYA 4CIEA 2XY7A 1QQCA 2IM2A 2G8IA 2HMIB 2HW3A 2YHAA 1QSYA 4RNFA 1ZBFA 4HKQA 4AHVA 1SL1A 2I1RA 3DDKA 2WONA 3IG1A 1TV6A 5CY4A 1T7PA 3RWUA 4KHUA 1U49A 2P51A 3U3YA 2YNHA 4FZXC 2HHXA 2ATQA 1VK0A 2W9CA 4ED1A 1BQMA 1VRTA 4ECYA 3MFHA 3SPYA 2AGQA 5KFCA 3QIPA 4WYLA 3QZ8A 2VA2A 1SUQB 2WK4A 4QW9A 1XR6A 3NBPA 3PUFA 4ELUA 4NLWA 4J2BA 1S6PA 3I0SA 1QHTA 1JLQB 1S0NA 4IG0A 1EXQA 1NJYA 5JS1A 2BQ3A 2HNDA 2IJNA 4CGHA 3V6KA 1Y97A 3VQDA 3QLHA 4GC6A 4I2QA 1HQEA 1FKOB 3T5KA 2IM1A 2C2DA 4CHQA 1XI1A 5JXSA 3G86A 4LSNA 4K4SA 1BCOA 4FK4A 5FRMA 1RT2A 3L3VA 2V9WA 3UPFA 5KT2A 4YFUA 4RW6B 4TQSA 1C0MA 3V9XA 5DG7A 4FJXA 3OL7A 3MEDB 1S1XB 4O4RA 2FVQA 1IKVA 3PX0A 4Y2CA 4DTRA 4CGIA 3WNGA 4Z4FA 1SKWA 5KFIA 5KFHA 4DEZA 3M9OB 3M8SA 3RRGA 5KRTA 4FJ9A 4FJIA 4E19A 1C0UA 3MEGA 4ELVA 5CZ2A 1TKZA 3OSPA 2IC3A 1NKCA 3OYAA 4TXSA 1WSEA 4OKKA 2HHQA 3Q8SB 3NH2A 4U6PA 3RTVA 3SUOA 3RRHA 3CJ2A 3SV4A 1ZBLA 1TQLA 2OZSA 2R8IA 3BREA 4DF8A 1D5AA 3PZPA 1RTHB 1WSHA 4KHNA 5KT7A 3OS1A 3NF9A 4R8UB 1KHWA 2OPPB 2WB4A 3ZSRA 2PZSA 1KSPA 3NAHA 4CF8A 3BDPA 3VQ6A 3HXMA 1S1XA 4CHPA 1U04A 1JL1A 3TAFA 3CJ0A 2VG7A 2HHWA 2XY8A 4OLAA 4AHUA 1S1WB 2PYJA 3V6DB 3KLGA 3ZSYA 5F8GA 2BE2A 4LQ3A 3H4BA 5KFKA 2Q3SA 1B92A 4Z4CA 3JSMB 1A5XA 4CCHA 4Y1CA 4KTZA 5I3UA 4NRUA 3O3FA 4ELTA 1JLQA 3KKSA 4K50A 3VQQA 1C1CA 4OGEA 3OYHA 3KIOA 3P1GA 2DFHA 4CEFA 1VSEA 4KHSA 3KTQA 4U7CA 2FBTA 3OYMA 4DU4A 1K6YA 1TKDA 1RTIA 1BQMB 4B3OB 3H59A 1JLFA 4CF9A 5EWGA 2AWZA 2B43A 4C8OA 2OZMA 5KI6A 5KFTA 4DTPA 3DRPA 2QXFA 3AVAA 3D45A 4OGCA 4DL2A 3KLFA 3CYMA 2R8GA 3KLHB 4CJ5A 4LSNB 2AQ4A 4CEOA 3OYFA 4FJLA 4NZ0A 2G8KA 1KFDA 3QLHB 2OPQA 3DRRA 5F8LA 2IM3A 5DGBA 2JEJA 1R0AB 3MR6A 4C8LA 4DMNA 3C6TB 4JRQA 3NBPB 3SI8A 3LZIA 5K14B 3I8DA 5EU7A 1QSSA 3EPGA 2HVHA 1RT7B 4CJLA 3V4IA 4Q0BA 3VQPA 4J2AA 4NLOA 4FJMA 1S1UA 4Q5VA 1TL3B 3K58A 2Y1JA 4M3WA 2E9RX 3AO1A 5KFGA 4CJQA 3IG1B 1Z25A 2R2SA 2HVIA 4H4MB 1VSKA 3OJUA 4QWDA 4O3NA 4DS4A 5L1KA 3ZT4A 5DLGA 4ED8A 3OHAA 3PO4A 4NCGA 4CERA 4ZPCA 4IRDA 3VQCA 2HNYB 5J1EA 4IH7A 3QGGA 1IKWA 3RB3A 1NOYA 5HP1A 2HHUA 4K8ZA 1LW0A 3M9NB 2ZE2B 3GQCA 4J9RA 4J9QA 1BHLA 1S1UB 4CJTA 4IR9A 4QCLA 3CFRA 4Z4EA 1UWBA 3AO2A 3HSTB 4WZMA 4DQRA 4Q43A 1SH0A 3F73A 4MK7A 4IFVA 2CKWA 4FK2A 1JLGA 4KE5A 2C22A 4KHQA 3RBDA 4DFJA 4F4YA 1RBTA 3KLHA 4JLHA 4ECWA 4F4WA 2PY5A 3ASMA 5HP1B 4K4XA 1BQNB 3KHGA 4B08A 2D5RA 4NRTA 3KLEB 5J1EB 2HHVA 2HHSA 4KSEB 1C1BB 3LP0B 2WOMA 3RR8A 4EBEA 1JLFB 1KVCA 2ASLA 4W5OA 3BR9A 3NGIA 4DSLA 4C8KA 1TAUA 1ASWA 1UOCA 3NE6A 4DL5A 4HUFA 4K4WA 4OKEA 4M3TA 4MFBA 4F3OA 4AILC 3NL0A 2YNIB 1A5WA 4IKFA 3CVKA 1VSIA 3IS9A 2BRKA 3RB0A 1HYZA 1SH2A 2FBYA 3ISND 1S1VA 4KRFA 3G10A 1HJRA 4HUGA 2BE2B 3KLGB 2P1JA 3VQ9A 4FJ8A 3GIJA 4J9OA 1Z26A 2AU0A 2VG7B 3M8QB 1WAJA 3UQSA 3HVWA 3LP1B 3VQ5A 4M3RA 1D9FA 4KAZA 4ECVA 3ZSOA 3HL8A 3GIMA 1HNIA 4E7IA 3TAGA 3HPGA 1JXBA 1S1TB 4EBDA 2FJWA 2OPPA 2J6TA 1FK9B 3K5OA 2AX0A 3PW5A 1RTHA 2IOCA 4ID5B 3CDEA 1BI4A 4J9LA 4YNQA 3M8PB 2BGGA 3NAEA 4O44B 4RW8A 4BE1A 3KD5E 2UUWA 3HP6A 2D3UA 2J6UA 4FS1A 1QSLA 4PWDA 4CK2A 3N6LA 4GVMA 3V9ZA 3VA3A 4WXWA 4K8XA 3C6UB 4KAIA 4CJVA 3FFIB 1W25A 3UIQA 4KKOA 2YKNB 3C6UA 2GBZA 4CGFA 1YVUA 3BSAA 4DG1B 2KFNA 1RA7A 4IFYA 4W5QA 4H54A 3PR4A 1RT6B 3JSMA 3KOAA 4RW8B 2R2TA 4Z4IA 4O44A 1IKVB 1JLEB 3QEXA 4G1QB 2RPIA 3NKYA 4X2BA 4R5PB 3V6DA 4PA1A 3KNAA 4DTSA 1QTMA 4I7FB 2HAIA 3OYIA 4HTUA 1RCHA 1RT5B 3GILA 1HNIB 3WNFA 4F3TA 4CK1A 3GV5B 2VG6B 2KW4A 1HYVA 4KFBA 4YR3A 3G6VA 4KREA 2BDPA 4WE1A 1DTQA 4DQPA 1L3SA 3OHBA 2XWYA 1BL3A 5HLFA 4DTXA 4DFPA 4KKOB 2FVCA 3FFIA 5C42B 1Z4UA 3ZSWA 2ATLA 1VRTB 3SYZA 2W9CB 3KLIB 3IS9B 4N5SA 1RDAA 3NGYA 4UQGA 1TKZB 2ILZA 2YNIA 3SFUA 3ALYA 4CF0A 2QK9A 3OJSA 5C5JA 3M8PA 3U6FA 3MEGB 4NLGA 2Z1JA 4E7LA 1IO2A 3V9SA 3MTKA 4DQSA 3MXMA 1NJXA 4CESA 3KJVB 3H08A 1S1TA 3V6HA 1X1PA 1U45A 5KFJA 2ZKUA 3SZ2A 1C1BA 2KZZA 3K5MA 4H4OB 3MEDA 3HO1A 2AGOA 2Z1HA 4Q8FA 2G8HA 1RT3B 1TVRA 4MK8A 5KFNA 4KHMA 3IN5A 1ZTWA 1MU2B 1S9GB 2FVRA 5KG0A 1NNDA 3OYLA 4CIFA 2FVPA 1MMLA 4WYWA 4LY7A 3QZ7A 3V9WA 4K4ZA 3IGNA 4FK0A 3LDSA 4IRKA 2R2RA 5HRSA 4O3OA 1FKOA 3OYEA 1WSJA 4MH8A 2OA8A 1HQUA 3AO5A 4QPXA 3ZT0A 3VA0A 4EYHB 4B9VA 2R8KA 3UDLA 1QE1B 1RBRA 4BDYA 4IDKA 1VRUA 4ZTJA 2QKBA 2YHBA 3QIPB 3CG7A 3CJ5A 1LWEB 3GV8B 1ZTTA 5KFBA 5KFQA 5KG2A 4ED3A 4CE9A 3LPUA 2G8VA 3BQ2A 4O3SA 2FLNA 2KQ2A 4DTNA 5KG5A 4FCYA 1J5OA 1N5YA 2HB5A 2XI3A 1IKWB 3KLEA 3PJXA 4DLEA 3KMSA 5T7BA 4QWCA 2VWJA 3HK2A 1BQNA 3L2VA 3TI0A 4KHYA 3L2UA 2FLPA 3F9KA 1WSGA 1S5JA 3AO4A 4NYZA 2FBXA 3OYNA 4JS4A 1JLGB 4FS2A 1VRUB 4CF2A 3B6OA 4OVLA 1QE1A 2ASJA 4NCAA 2RKIB 4KO0A 3IRXA 4TY8A 2JLEA 3CWJA 1T8EA 3CFOA 4CJKA 2HNZA 4WFYA 4DSIA 3NF7A 3HVRA 4FLTA 4RNHA 3PW7A 3QERA 3T1AA 3RB4A 1R0AA 4AHRA 3QGHA 3DRRB 2FBVA 1RT3A 2XHBA 1EETA 4KPYA 4QWEA 5FROA 3KK2A 3KD1E 2XCPA 3AVHA 1XC9A 3SJJA 2J6SA 3HPOA 4NCBA 1BIUA 1KHVA 1EX4A 2QE5A 2XRIA 1S9EA 3NHGA 3DRPB 3GIIA 1TL1B 4DTMA 5F8MA 1RBUA 4NYNA 3DI6A 2XGQA 1CZ9A 1TKXA 2OH2A 2O4IA 3QINA 2XY5A 1HRHA 4LSLA 3CQ8A 1SKRA 4EYIB 4J2DA 2P5GA 4N47A 2F8TA 4HUEA 4O3QA 1VSLA 4CEEA 2DY4A 3OLAA 4O0JA 2W42A 3RMAA 4J9PA 4RW4B 2IMWP 3C6TA 4ED2A 5I3UB 4I2PA 1C6VA 4YR2A 3BGRB 5L1IA 2O5DA 2VG6A 4OL8A 1NK4A 2Z1GA 5DQGA 3OS2A 1RBVA 5EWEA 3AA3A 4K4TA 3SUNA 4I7FA 1U48A 4PQUB 4FBUA 1SH3A 2X6NA 4ECSA 3I5BA 1L3UA 4G1QA 4KTWA 3NFAA 1JLEA 2D3ZA 5J2QA 5KG6A 2IGIA 4FLYA 4TYAA 3DLKB 4RW7A 3KK1A 2W9AA 5I42B 4TN2A 5L1LA 5SWMA 3H5YA 1TAQA 3V1RA 3OLBA 3VQBA 3Q8RB 2NUBA 3ITHA 1RTIB 5HBMB 2XGPA 5CYMA 1EP4B 1KTQA 2YKNA 4EO6A 1W9HA 4DL7A 2KZMA 4ED6A 1TP7A 1S4FA 2IAJB 4OPJA 5J2MB 2C28A 5C24A 4O3RA 1ITGA 3ZSXA 4ZPBA 1RTJA 4I9QA 1RDCA 1C0UB 3K5NA 3K5LA 3GV7B 2IS3A 2X74A 3DLHA 1YTUA 4CJ4A 5CZ1A 3QO9B 1FK9A 2VG5B 2CJQA 3H5UA 3CIZA 1T03A 3AV9A 1WN7A 2G8FA 1JIHA 3AA4A 5SZTA 3PW0A 5J2NB 4DU3A 3LP1A 5KGWA 4CEQA 5DG9A 2WCXA 4R8UA 4J9SA 2R2UA 1RT1B 4RW6A 2JC1A 4WXOA 3C95A 5KT6A 5J2PA 5L1JA 3DLRA 3WNHA 1DTTB 1C0TA 1JLCA 1S97A 2GIQA 2ETJA 3DOKA 3PW4A 3T3FA 2FLLA 2IC3B 1JKHA 2W7PA 3MR5A 1N6QB 3DLGB 5D3GA 3HPHA 1JKHB 3D28A 1HARA 1IM4A 3L2RA 3I0RB 1JLBB 1JLCB 3JYTB 1C0TB 2LSNA 3RMDA 4GW6A 4DTOA 5CYQB 3AVLA 3MECA 4TQRA 1HPZA 1RT4A 5KTQA 2DTUA 1ZBUA 2OPSB 1RT1A 3O3HA 1NOZA 4KHWA 2WOMB 4E3SA 1DLOB 4CFBA 4FJKA 1WSIA 1XHXA 3LP2B 4J9NA 1N56A 4O4GA 2WONB 3CFPA 5J2NA 3HM9A 4WZQA 1BISA 4Z0UA 1IKXA 4ID1A 1RT2B 4M41A 3EPIA 4KTQA 2HMIA 1VSFA 4FXDA 4O55A 2IA6A 1NKBA 2ZD1A 4Q8EA 1S48A 4ZP8A 1WLJA 1TK8A 3TANA 2HNDB 1REVA 1RTJB 4BWMA 2D0AA 4QOZB 4NLVA 3TQ1A 4B9SA 2UVVA 3I0SB 1SV5A 1S6PB 5KFMA 2BR0A 1SL0A 3S3OA 4YMEA 1SUQA 3FSIA 5DQHA 3OL8A 1RYSA 3ZSZA 2ITGA 3S9HA 3THVA 2IJFA 4ZVHA 4DL4A 1EP4A 4URSA 1GOAA 1LW0B 3DYAB 2W9BA 2JEFA 1U47A 3V1OA 2B5JA 5E41A 4RW9A 4PUOA 3CJ4A 4FLZA 4FLWA 4FLXA 4W5TA 3OYBA 1K1QA 1HNVB 1YT3A 4YP3A 2AJQA 2R8HA 4H4MA 1NK9A 2DFEA 3TABA 2PYLA 4OLBA 1XWLA 4F8RA 3OYDA 5KT3A 2RF2A 2G8UA 5FRNA 4K4UA 3V1QA 1I39A 3QGIA 4ZTFA 3VQSA 1TK0A 3AVMA 1JL2A 5T14A 2D41A 3ZT2A 4DQQA 4JV0A 2B4JA 3EZ5A 4HVJA 2XO7A 2GUIA 1RYRA 4GC7A 3BSCA 1T94A 4CJFA 2V4QA 3OS0A 3KHLA 4ECQA 2G8WA 1KLMA 1HMVB 1OS5A 4R0EA 5F9LA 4KI4A 1S0OA 1J54A 2YKMB 3KLFB 1TL1A 4NLDA 3DOLB 4BE2A 1L3TA 4NLUA 2UUTA 1D9DA 3PHEA 2YKMA 2BANB 4PUOB 1KVAA 1T3NA
chains in the Genus database with same CATH superfamily
1VQ7N 3UB5A 1G3OA 2WVCA 5FDLB 3J7ZT 3NF8A 4FPIA 1T0TV 3MHYA 3D6FB 1KQKA 4FLUA 3DYAA 4FPRA 4EFHA 4IH5A 1L3VA 5G0RB 1HW9A 3EGWB 1C1CB 3A13A 2RQCA 3BSNA 3O3LA 2E20A 5IV4A 4CVNE 3NCIA 2KDOA 4DFMA 2YHYA 2OPRA 3QEVA 4ZCIA 2XLJA 2QLXA 1E3MA 4IO1A 4DV3K 5HRNA 1CULA 1S5ZA 4IOBA 4NO7A 5EOYA 4W5RA 3J7ZO 2WSEC 2ZD1B 2GHWA 1HNVA 3HT3A 1XMQJ 1VFJA 3AVNA 3G6XA 1KC8T 3MMAB 2E6MA 1CZBA 2PDAA 3OL9A 4HH1A 4LR8A 2KLAA 3T41A 3VPZA 3LDLA 3PV8A 4W5NA 3ICLA 3SUPA 2F8EX 4Q45A 2OPSA 4URQU 3EE3A 4E1NA 4LF5F 3V6JA 4DSFA 1HHSA 3PY8A 3SSRA 2RU3A 2O8CA 3AVKA 4K4YA 3MXJA 2Z57B 1G99A 2E1CA 1X4DA 4E7JA 1NNEA 1LAWA 4DR1K 1NEEA 4U7UK 1VC0A 5KFFA 3R5BA 4B9LA 2B3TB 1KD1O 1QUVA 2E7XA 1O13A 4FLVA 5CH7B 2LEAA 1IKXB 2KYXA 1AZSB 1WJ9A 5KT4A 1FDDA 4ECXA 1RU1A 4O4GB 2LEPA 1AFJA 2DRAA 3J7AN 1VHFA 1E6VA 4DR6J 4N41A 2FDNA 3SCXA 2Y8YA 1I94K 4A59A 3ZYYX 1FFGB 2J8AA 5TKWA 2MHEA 3JYTA 2OP5A 3KDNA 5H9EK 3SQ1A 3HVTB 1IR1A 1UFKA 2DO4A 3D68A 3EVMA 3R5DA 3O9SA 1VSHA 3HDSA 4ES1A 3B54A 1QQNA 3IRWP 4X65J 1LAVA 1TYQB 2ZM6J 3TWZA 1B9FA 2EKYA 4WFNL 5C42A 2KU7A 3VVUA 1GOBA 3CCMN 2W7OA 5A8RB 5HO4A 5GMKa 5GAGI 1UVNA 3L8BA 2BE7D 2RB7A 2YNFA 4KH6A 4UY8T 3G96A 3QEPA 5LMUJ 3ZCMA 1LW2A 3SK3A 5KFLA 3P83D 1QY7A 4O5BA 5KPRA 1IKYB 3N6NA 4KI6A 3HHLA 3PIPL 2C3MA 4ZLPA 5M1QA 1JXEA 3H5SA 3N9UC 2ZITA 3EKSA 1B9DA 1R8CA 2MKHA 1JX4A 5L9XA 1YVNA 1WC1A 1S76D 4P2SA 2HBYB 3VZHA 1HYSA 2RMLA 5KG1A 4LF9J 1M1GA 4DG1A 3GU0A 2BA9A 3EDQB 2XBPA 3OQ2A 1N0VC 2YX4A 4B1UB 5KFPA 4JKFA 2IJRA 2RJZA 3THYA 4L3QA 1NHKL 1RNHA 3BGFA 4CJEA 2RHKA 4I6MB 1WAFA 2OO4A 4Q7AA 3FFKB 4GV6A 5J2QB 1Q8KA 3HHKA 2DFFA 4B1WB 1VQON 2X78A 4WFZA 4AD6A 2L9NA 2O3DA 3O9RA 5CCMA 5IT9O 4CFCA 2CDRB 3NGKA 4JUZA 2FQQB 4CWBA 4BS2A 3I9V9 3CM5A 3SMZA 4F50A 2Q3PA 1ASVA 4QZVB 3QT8A 1GXTA 3H6EA 2A1BA 2DR9A 5FPNA 3O6WA 3PR5B 4I9LA 1CC7A 3DN9A 1UMJA 4CBUA 5A2QO 1HR0K 3GE9A 1S1VB 1Q81O 4LF9F 3OY9A 3RRKA 4E7KA 1MA9B 3SV3A 1X0FA 1X4CA 3U9ZA 5KG7A 4O0NA 4ZCLA 3CD7A 5CQGA 1SJRA 4LRDA 1KNZA 2JFDA 4WK1A 1T9YA 3LPTA 4DV4K 5LMNF 2QL9B 3JS9A 2RN2A 1DEJA 4DR2K 4CT9A 1A7GE 5IC4B 5A8KA 1UJ5A 4NEZA 3FEZA 3SQ2A 5AZJB 2VBWA 2P9CA 3H45C 4X64F 1WHVA 4CHYA 1FTCA 3B8HA 1FKPB 4FWLA 4H5RA 3QNOA 3KMQA 3LGHA 4LF2A 4BRIA 4QS8A 2LMIA 2K3IA 4CJ3A 1QLNA 2W6LA 3G2XA 2AJFE 1YITN 3EGNA 5AQPA 4FW2A 1UWBB 2C3OA 2F4VJ 2QKKA 5AQXA 4KQZA 4B3RJ 3W0LA 4A8FA 2ZM6F 1QD1A 4CYUB 3EGZA 3HFVA 1APSA 3RBEA 2YWGA 2ZH5A 2PD1A 4F4XA 2AA4A 4M95A 1XMOF 3AXKA 2W7AA 4FM1A 4OI2A 2E5LF 5HVFA 3BGOP 3RAXA 4MKYA 3BKUA 4H4OA 3HHLD 3QYYA 4M3UA 3IM8A 5KFWA 4V19X 3VQEA 1YJRA 3KKRA 4FO0A 4CH1A 2IA0A 2B5JB 1VBZA 2W41A 4DSEA 4BGAA 5KFAA 4AHSA 3J7YI 5HMYA 3DJCA 1HBMA 2VJVA 3E1YA 2MZSA 4Y6IA 2YNGA 2ZFHA 1NUEA 5JMVA 1KTVA 1FFWB 4NLXA 1VC5A 3US5A 2RS2A 1U0HA 4Q0BB 2CA9A 2DHXA 2YX6A 4ZOSA 3W66A 3S41A 2F96A 5HLFB 5K14A 1RBSA 4ZPVR 4M3YA 4WE1B 4C23A 3CT9A 3OT9A 1BUXA 3M9MB 4EP4A 3W2WA 2HPUA 3HLUA 1RHQB 1MWYA 4UF4A 2VG5A 3W5YA 3GIRA 2DGXA 3VF4A 4C1NI 4OYMA 4R5PA 1B0TA 3OXLA 3W2WB 1Y3JA 1Q8IA 2PA3A 3M30B 1Y00A 2R7XA 5F8HA 3KHHA 2ASYA 2VKRA 2PO4A 1ZM4A 1YDLA 1PBAA 4J91A 3Q0AA 3CDUA 5LJ5Y 1Q18A 4LMZA 3PFOA 4DL6A 2HSTA 4M5DB 4ICLB 1UAXA 5F9NA 3D1HA 2I7PA 3DOMB 4BVOA 1DGKN 3IAYA 1IBMJ 5HBMA 1M1KO 3EL2A 2LQBA 4NA1A 1HNZJ 5I42A 2VC0A 4USHA 3HJFA 1ZA1B 2KXNB 1UJ4A 2V2ZA 4PEOA 2C2EA 3I9ZA 3QAEA 1IH7A 4LH5A 3MAAA 3OVNA 4KIAA 1XNQJ 4FYWB 3CPWM 2HKEA 3VGSA 4RCHA 2CNOB 1U1KA 1PAUB 3UKUB 3SQGA 1IBKK 3PLAA 2VV5A 3K9KA 1UEKA 4CZGA 4DFKA 4DSJA 2FHJA 2GC8A 4L72B 3CXCM 4FJJA 3ZT3A 2ASMA 2QA1A 4QR1A 3VN5A 4A46A 1A5VA 2HSEB 3RW7A 2B7BB 1WG4A 4QS9A 1GX6A 1AUSL 2XS7A 3TWHA 3VAIA 2HVZA 3ZTQA 4LF4F 4OYAA 3QETA 5AFUA 4B3TJ 2PGCA 4JYAJ 3PW2A 1KR4A 4CJRA 4WFAQ 3J7YU 4HDHA 4CLTA 1NK8A 5KFZA 4NB4A 2L48A 1QTNB 3DM2A 5D8HB 4JS5A 4EFAC 3P4IA 4RW7B 1FWKA 2LU1A 2GVDA 3MM6B 3JSBA 5BYQA 1PC4A 3QESA 2A1RA 4KB7A 4C9DA 2UXDF 2Q0RA 1I5OB 4HCCA 2WW4A 4EZ6A 4QW8A 1CQNA 1K73O 3F56A 3K5PA 4FJ7A 4EEYA 1J5EK 5BREA 3P39A 4YB6A 4KHPJ 3AODA 3EXYA 3ILIA 2QX0A 3DXMA 3MOZA 3ZSVA 4OJRA 4U8YA 2IVNA 2GEMA 1YF5L 3UW1A 3ZX3A 1J9AA 2XZDB 4JI0F 2JEIA 2FC9A 2XSFA 4CLPA 4EO8A 5LL6d 5DLFA 3TAEA 1JLAB 2EK6A 1VQSA 2KYZA 2VQEF 4CK3A 4C8MA 1B70B 3PJWA 3RJMB 3CHWA 3VF2A 3C16A 3CO0P 3ID6A 3IGVA 2MSSA 5K9FA 4CD1A 1WBBA 1SQGA 5HQLA 2NRZA 4H0VB 2ZH1A 2UXBF 2W8KA 2HGMA 4LFCF 1RCOB 1NHVA 2XYHB 3ENWA 1XNRK 3LDOA 3NDKA 2VZ9A 3I31A 1NLVA 1XHZA 3HHDA 3UDVA 1HNZF 4IFVB 3CDWA 2Y0BB 2LLZA 4LFAF 4FYDA 2R3VA 1S9FA 3THYB 4U96A 3DU6A 2DJWA 1NJIT 2YBVA 2UU9K 2MYFA 1F21A 1CS4B 1XJWB 3UR0A 1ZZNA 3T5HA 4M5KA 4OX9F 3NOCA 4JV5K 1H2VZ 5G4DA 1VQYA 1WNSA 2ZE2A 1YUWA 3O9UA 3VEVA 2D7SA 3SQ0A 1RDDA 1S9GA 3SCKE 2HF4A 4DF4A 3TP2A 3WIUA 3NLCA 2IM2A 2G8IA 4F67A 1DJ0A 3MPWA 3A5LC 1SL1A 2A2CA 2I1RA 2KT5A 2WONA 2P2CB 4X66K 1DQ9A 4U7UD 3IG1A 5IQ6A 1U1NA 4FZXC 2ATQA 4UW2A 4CJ7A 4ED1A 1BQMA 1VRTA 2CWKA 2AGQA 5KFCA 1PG5B 4ELUA 4J2BA 3I0SA 1I94F 3HJVA 2UZAA 4IG0A 5IT9Y 2BZ2A 1YBTA 4PAAA 2CQBA 1Y97A 3KG0A 4P9SA 3VQDA 3QLHA 4GC6A 2E66A 3IBWA 2C2DA 1XI1A 3OR2A 1VK8A 1VIXA 3ONQA 1BCOA 1RT2A 1PSDA 3VGUA 1LEOA 3GCXP 3ZETB 4GKJK 2ZH4A 3IA0A 3OTBA 5DG7A 2W2QP 3TR5A 3IDHA 3HSGA 3OL7A 3MEDB 1S1XB 2KT2A 5C2GA 3C3LA 4O4RA 1PIEA 1IKVA 3GFYA 3W64A 1M5KC 1SKWA 1Q4RA 5KFHA 2OEJA 3M9OB 2QSWA 3CQXA 3OBYA 3AH6A 3L4BC 2A5XA 3VEZA 1CEZA 4E19A 1C0UA 3MEGA 4LJMA 5AQHA 5CZ2A 2W4DA 3BR8A 2DT9A 4AYBD 1NKCA 1T44A 3G82A 3FZKA 1WSEA 3GOIA 2VL1A 4LVNP 4OKKA 2RD5C 5HSPA 3NH2A 2VQFK 2ERRA 3F41A 4FWRA 3SUOA 3SV4A 1ZBLA 2FHKA 4PXBA 2OZSA 3BREA 3FNNA 4J8FA 1V3RA 1RTHB 1WSHA 4L76A 1CQMA 4DV0F 2OPPB 1Q78A 2PZSA 3IWLA 4P73A 2CPJA 3H90A 3BDPA 4Y0WA 4DUZF 1RWPB 4ISFA 4OPAA 3TAFA 1EWRA 2R7SA 4CM2A 4DCJB 3E8OA 2DB1A 1S1WB 1P9YA 3O1LA 4GV9A 3KLGA 5F8GA 3HD2A 2BE2A 3H4BA 1CJUA 1UWAA 4AQYF 1G7CB 4PZVA 4CLYA 4N8NA 4FKXA 4CO3A 4CCHA 3O80A 2M52A 2V7YA 2ZH8A 3SBMA 2XB2D 1PJ7A 1C1CA 1N33F 3CD6N 3OYHA 4WKRA 2DFHA 4CEFA 3OYMA 4DU4A 4DU8A 5G0RA 4RBTA 3MPUB 1RTIA 4BRQA 4MT1A 4B3OB 1KEKA 5EWGA 3D66A 5JLFA 5HQ8A 4H03B 5KFTA 4GVLA 4DTPA 4MJKA 2CQDA 4OGCA 3A5MC 5F3TA 2CQPA 4USMA 3KLHB 3CCWA 4YDXA 3ZTRA 3CCVN 4USKA 2DRDA 2OPQA 2Y1RI 5F8LA 3PSIA 2E1MC 2MQLA 2POKA 5ETKA 1HD1A 3C6TB 2GQQA 2YKQA 3NBPB 2QMUB 1HBNA 3EN9A 2XZWA 1N88A 1PO6A 3H2UB 5K8PA 4RBUA 2Z0GA 2CFXA 1NGJA 2J7KA 1PBUA 4RWXA 3IG1B 3TSQA 4C11B 1VOMA 3KWIA 4O3NA 5IZHA 3VGKA 5L1KA 5DLGA 1H1VA 3FKBA 2JWLA 3R6MA 1XTZA 4ZPCA 2Q2RA 2M2BA 4IRDA 4ILLA 1N32J 1V6HA 1IKWA 3T1HJ 1HI0P 4USVA 4AQYK 5IWAF 4A8YA 2HHUA 1LW0A 4YHHF 1BHLA 2DY1A 2Q1NA 1Y0HA 2DGWA 3GONA 5FLXO 4Q43A 1DKGD 5A8WA 1SH0A 4AL5A 4IFVA 3EE9A 4FL9A 5AZIB 2CKWA 2RQ4A 3SBGA 3ZNJ1 1HX1A 4KE5A 3RBDA 2RT3A 4AXJA 4OX6A 1NGIA 4IXCA 4JLHA 1TUWA 5K5MA 3HHEA 2PY5A 2X7IA 3KHGA 2B8PA 1ZOTA 4NA2A 2D5RA 4NRTA 2NRRA 3PEHA 2MLZA 1C1BB 3AY9A 2BUPA 3L6QA 2CQCA 2PA8D 1KVCA 3FE1A 4LRAA 2CAJA 2ASLA 4IJNA 2AYMA 4WTOB 4X64K 2HS0A 3OFFA 3BR9A 2KHOA 3R9LA 4DSLA 2AEMA 1ASWA 1UOCA 1VCTA 5ETRA 2ZGYA 3BYRA 2RH3A 3NL0A 4AILC 2VC1A 3QGPA 3RB0A 1WTFA 3PKYA 1YGYA 1VQ6S 4FWSA 2YPZA 3G10A 5LXRA 1HJRA 3L7OA 3VEXA 3KLGB 1EJ7L 4QYZJ 1IWGA 4FJ8A 5E84A 2XYGB 1B3TA 4LUBA 4RO0A 3DRYA 2QYGA 1RWNB 1Q86O 1WAJA 3VQ5A 1D9FA 5E26A 3HL8A 3O6QA 1YJNS 4JB8B 3SEOA 2FJWA 4EBDA 1V4TA 3GFXA 2AJ4A 1F1BB 1RDWX 1VYAA 1XMQF 2GX8A 4ID5B 3CDEA 2LECA 4J9LA 2KXHA 4YNQA 1E6YB 2BGGA 1BD6A 2H5IB 3KD5E 1JK9B 2UUWA 2J6UA 5HMZA 4PWDA 1P9QC 4P2MA 1C0FA 1AA1B 3FFIB 3PTWA 3UIQA 2FHOB 5K8NA 2MKKA 4NXMF 2V8HA 3DDNA 3C6UA 2GBZA 5F1XA 2QEXN 2KFNA 2RRAA 4FVCA 3WQTA 2NUHA 1RT6B 2ZH2A 3KOAA 4Z4IA 4O44A 2ZF5O 3CXCR 1JLEB 4JP8A 1ATSA 2QWQA 4G1QB 2RPIA 1GLFO 4X2BA 3H1VX 4KGMA 3RAMA 1QTMA 3ULHA 2OTJS 4TU7A 4I7FB 3GBTA 2OKQA 5A2QU 4WFNQ 1HNIB 3SXLA 3FZFA 2FY8A 1HKGA 2GX9A 1WI6A 2H51B 2HQ3A 4CDIA 2E2OA 1R43A 4KFBA 2BACA 4YR3A 1NGCA 5DM7Q 4R79A 4HTJA 1DTQA 3DOMA 4DUYK 2FY1A 2Z2LA 4DTXA 2FVCA 4DR5F 1M5HA 3BZQA 1Z4UA 4WQ4A 1VQ4N 1VRTB 4WPAA 2CPFA 2NNWA 3QDKA 2W9CB 4BC9A 2AMCB 4UQGA 1ILYA 2ZWOA 1EAYC 1BA1A 3U6FA 3MEGB 5LY3A 3GP9A 1IBLK 1B0PA 1RAHB 3IWXA 3V9SA 2K2PA 3MTKA 3UI3A 4MMOA 3J81j 1I3OB 3EZOA 3V6HA 4MO4A 1YBAA 3UKRB 2PMZD 3MEDA 4Q8FA 3BB5A 1TVRA 4MK8A 2FVRA 5KG0A 3OYLA 4EIAA 1MMLA 4WYWA 4LY7A 3V9WA 4OZ1A 2DK2A 2W2NP 3LDSA 2ZH3A 2HHHJ 4CW7B 1XMQK 3JXUA 3W2VA 4FN5A 3OYEA 2OA8A 3AO5A 4IQMA 4U8VA 3ZT0A 1SS6A 2M70A 1N5TA 4B9VA 2HRTA 2R8KA 2R7OA 1N34K 2HYIB 1RBRA 3H42A 4BRNA 3CJBA 3LDQA 4ZTJA 3N79A 1HWJA 2ADBA 1FDNA 2NXCA 4FZVA 3PYEA 4N77A 1PCAA 2FLNA 1F3FA 2QM1A 3D3CJ 5IM0A 2OTJN 3N4PA 4TVAB 3KLEA 3FUYA 3PJXA 4NZ7A 3HK2A 4KHYA 4DR1J 3UDEA 3HHNB 2FLPA 1VQ5S 3F9KA 1WSGA 2K06A 1RISA 1ROFA 3G8TA 4LF8J 2LXUA 1S5JA 4NYZA 4JS4A 1ZPWX 2DNNA 4FS2A 3HBTA 3TTFA 5D4PA 4CF2A 3Q89A 1J6ZA 3B6OA 2P9IB 3OTOJ 4OVLA 4GVEA 3T69A 1OPIA 2ASJA 5F3ZA 1GLAG 2QL5B 3ZO7A 4KO0A 3IRXA 4TY8A 3MR7A 1FJGJ 2JLEA 3PIOQ 1T8EA 2QLJB 3CFOA 3DXMB 2HNZA 1IBLF 4WFYA 3F0NA 4GKJF 2YX7A 5HJXA 3PW7A 3T1AA 2HEKA 5H9EJ 1R0AA 1JCFA 1SC1B 1JJHA 4HT5A 2B56A 3A8JA 2FBVA 1F3VA 3O2IA 2IMOA 4KPYA 4X84A 4QWEA 3RGIA 5A2QY 3SJJA 3HPOA 4NCBA 1EX4A 2XRIA 3L95X 2HIYA 3A3OB 3DRPB 3QT5A 4PR6A 2PMHA 3QJPA 1RBUA 3MN9A 1X3MA 5L8RC 3QINA 2ZHOA 1EQ0A 2VQEJ 3D6RA 4J2DA 1UW9A 4WTYA 4F0HA 2QEXS 2VBXA 4HUEA 3M2UA 4O3QA 4LFBK 2ROEA 1ZAVA 3PJ9A 2W42A 2OI2A 3AOCA 4MO5A 3CJRA 1FRKA 4RW4B 4USTA 4ANEA 4ED2A 2VOPA 3AA8A 5I3UB 5ETNA 2V69A 1SC4B 4YR2A 3BGRB 1R8PA 2O5DA 3MMCB 3EZWA 2EK1A 2V4JB 3M2VA 3PACA 3TW0A 4BCAA 1VI7A 5CHIA 3OS2A 3SSQA 3W9HA 5DDRC 2DPNA 3L4IA 1F2GA 2VPXB 3CETA 2IRYA 4NWBA 1U48A 1F2HA 2GJ2A 4B17A 2FLOA 2AYBA 4G1QA 2E2PA 4V19S 3LOUA 4UOCA 3VTIA 2D3ZA 5J2QA 3HOSA 1IVZA 4TYAA 2ZDPA 4RW7A 5L1LA 5I42B 4TN2A 1TAQA 4NXNJ 4IO9Q 2PSZA 4I64A 5HBMB 4G6VB 2XGPA 3QQCD 5CYMA 3BKFA 2V34A 1W9HA 1WKJA 1M90T 2A0FB 2MZQA 3ET6B 4J37A 4DL7A 2W25A 1QUPA 2CXEA 2MHNA 4FNHA 3CCZA 3CJQA 2AEFA 5B0BA 3D4JA 4PL8A 4Z7YA 4NLCA 8ATCB 5C24A 2N3LA 3ZSXA 4ZPBA 2NRHA 1OH7A 2XS5A 3K5NA 2O8DB 2X74A 2RE2A 3FBCA 5CZ1A 2DGSA 3JB9k 2NYIA 3PW0A 2J9DA 3U9DA 1XNQF 1Q7YO 3C6AA 4M8LA 5DG9A 3U02A 3FR0A 4J9SA 2R2UA 3H8YA 1JCGA 4RW6A 2K1RB 4UOFA 3MAAB 2CNKB 4EAHD 3TSPA 1H7XA 1WORA 3VAJA 3D3BJ 1X3NA 1PYSB 3VQTA 3JQJA 5EXWA 1U0HB 3PW4A 3T3FA 3D2EB 1RAEB 3UE2A 3OVBA 1TL7A 3HPHA 1OY9A 1FT8A 3L2RA 3T9ZA 1JLCB 3JYTB 2R7RA 1C0TB 2XHWA 4DZDA 4DTOA 2VKZG 3MECA 1B0VA 4BR7A 1SQEA 1JQGA 2V2KA 3UVJB 3O3HA 4KHWA 2ZKTA 3E9PA 3LP2B 3TVZA 4O4GA 3CFPA 4IOCQ 3HM9A 2B9XA 4HACA 2DISA 2DTJA 2GO9A 4QPTA 2FGOA 1IKXA 1QVFR 4CYUA 4DOZA 2HMIA 2XMJA 2GQ2A 5AE2A 1NKBA 3FCWA 2KH9A 1CJTA 4Q8EA 1HUXA 1VLOA 1F5AA 1LNQA 5AZIA 1V3SA 4JHDA 3FVYA 4BWMA 2D0AA 1XNRF 1SV5A 1S6PB 4ZN1A 3C66A 1SL0A 3S3OA 4YMEA 4BGBA 1BWVA 3THVA 3BDEA 4ILHA 4BG8A 4ZVHA 4DR3K 1GOAA 1LW0B 1RCXB 2UXCF 3PIPQ 2HBKA 2HBZB 2HRYA 2ROPA 2O8EB 3MUMP 3G71N 4YDUA 2KKHA 5E41A 1FKAF 3M4XA 3R1HA 4PWWA 4OQJA 3EE8A 1RI7A 2IYIA 3NEKA 1HNVB 2FB0A 4JI7F 2YKOA 1CULB 2PYLA 4ZVOB 5BN8A 5KT3A 4K4UA 3KFWX 3KWGA 3UO0A 3VQSA 4JI5J 3KG4A 4LF4J 2W1BA 4C1NK 5T14A 4DQQA 2BH1A 5I9EB 4ZIVA 2B4JA 2YI1A 2ZBRA 1RYRA 3GLJA 2J9EA 4GC7A 3LPEA 4NPOA 2ROGA 3P31A 3OV7A 3OS0A 2CVIA 3VEOA 2YWHA 4ECQA 5T7LA 3BGUA 5ADZA 1OS5A 1EKSA 4KI4A 1T9VA 2W4CA 4DPXA 3FC9A 4BE2A 1L3TA 4NLUA 2UUTA 1XQSC 4NMXA 4PUOB 4JK8A 4DV3F 2GHPA 1IBMK 1HIYA 3DFEA 4P75A 2B6AB 4B9UA 1NWKA 4H5NA 3Q8VA 4AHTA 1N33J 2L9WA 4KB1A 1TR0A 5DGAA 2D0BA 1QZ6A 5I3PA 2YH0A 1X7VA 3TZWA 4B8AB 3FRYA 4EBCA 4B3SK 1OH6A 1U6BA 2UXCK 1REVB 1R31A 3FRZA 4BRKA 2D74B 3EZUA 1X5TA 4FM0A 4F2RA 3LQVA 4YB7A 1RWMB 4JI3K 4JV1A 1N5VA 3MD1A 3TAMB 3GSIA 4ECRA 4KV8A 3ELHA 4GV3A 1WF1A 1C2PA 4CM0A 5KFXA 2FC8A 4JYAK 1DHMA 2I5JA 4M42A 1NGBA 2W9BB 3D67A 3CIPA 4A2AA 1N5YB 3CJCA 3NGUA 4J5OA 2YKPA 5KPZA 3LDNA 4CJPA 1HBOA 2RDIA 4OPKA 1V9OA 4K0KJ 1FDAA 4KPCA 3HSZA 5KFVA 4E0DA 5BPNA 4GKKF 3DLGA 3MR3A 3L4QA 1ZM3A 4QR2A 3TEHB 4JK9A 2XMKA 5AQZA 4FP9A 2VICA 3OL6A 4KHPK 2X1GA 1EIYB 3FGUA 4FVUA 4CF1A 2H4YB 2RSQA 2X1BA 4JRPA 4RX6A 2FZGB 3H2VE 1TVRB 3AD8C 3EVOA 1IV0A 1DLOA 1Q5YA 3WT0A 2BOAA 5HROA 3ISNC 2HWHA 3KJVA 2VJUA 2F5GA 2BKPA 1R0BG 2HAFA 4WCEQ 3NNHA 2QFIA 2EFVA 3NGZA 1ATNA 2EX3A 4TY9A 1GLCG 2XI2A 4TLRA 1WG1A 4B9MA 4ZPTR 3VVTA 1P90A 5J2PB 1UL3A 2V8VA 5AFUH 3V81A 4HT7A 5FJ4A 8AT1B 2PAVA 1XNRJ 4Z4HA 3OVAA 3HOTA 3LP3A 3MDFA 1X9JA 3R7SB 2UUCJ 4KFBB 3DLKA 2B4UA 3HM8A 4AM7A 1YG0A 1WOQA 2OYQA 3MWPA 4CEAA 4LRFA 2VFVA 4PXCA 4KV8B 3C0BA 1WSVA 2NZTA 1AXQA 1N36F 1N8RO 4J2EA 3CJ3A 1WF2A 1GK8A 1NK6A 3VQ8A 2WC9A 3H7HB 2DGOA 4ZVEA 3DKDA 1RT6A 2F63A 4C6AA 4YB5A 3KNGA 3CCLN 2OPRB 3AVJA 3HTVA 4RZRA 1GX5A 1Y5LB 5ETTA 4MYUA 5JVGQ 5GADU 2DVIA 1E4GT 1QS4A 2E88A 4IEEA 3CJKB 3E01B 2MQMA 1S6QA 3CSKA 2MJUA 4BWJA 1D8ZA 4I0WA 4M63A 3VERA 2H9ZA 4DPUA 2MQQA 1TMJA 2AEJA 3N6MA 4Y1DA 4BRAA 3ZZPA 4FKYA 4ECTA 3AFGA 1NDPA 1U6ZA 3UCUP 5KFRA 4DV1F 2RS8A 2ZC3A 1S79A 5AQSA 4PL7A 2WFBA 2V5HG 4CRJA 4QIEA 4PQUA 4XK8C 1S9EB 3VHQA 4NLQA 2MQ8A 1RAOA 2JWKA 2KVQE 2I5JB 1TFYA 1SL2A 3KK2B 1KCFA 3AA5X 1RBOB 1Y5IB 2CPYA 3IMXA 3TAMA 3WNEA 3PX6A 4CO0A 4DMZA 2DR8A 4FF2A 2P9KB 4OFZA 3TARA 4ZHRB 4LR7A 3T5LA 1YTAA 5IV3A 1JLAA 5IWAK 1BOTO 1KQSR 4B8CA 2MKYA 3TVKA 4DV5K 4BR0A 3HI9A 4HH0A 5GIPA 2HHHF 1HPMA 2ZZTA 5KFYA 2RKIA 3DDIA 2IDEA 1RXOB 3E51A 2P5OA 4PXEA 9ATCB 4J9KA 4AH9A 3DI6B 1RB0A 4RKUC 2A2DA 2KT3A 1QAJA 4CFDA 4OO1J 5ETSA 4NXNF 3CULA 1L5UA 3IAM9 3ZC4A 3JS6A 5JUMA 3RR7A 2A6OA 1FXXA 3QB0A 3MD3A 5KQDA 4BHQA 4LSZB 4EU0A 1FWPA 1J5OB 4LD0A 2A10A 1MMNA 4RNOA 2EBGA 4LF7F 5AQLA 1ZM9A 1IG8A 3KJFB 1H2TZ 3ZX2A 2WVFA 1VQ7S 4N8OA 1ZC6A 4AL6A 2WTFA 3RBZA 3CM6A 1SCJB 3E01A 5CR4A 1X0PA 2V0NA 3KYLA 1OSDA 2G4BA 4CZLA 1Q81T 2W2PP 1WOPA 4TSXA 2GV9A 4LFCK 5IS2A 2N3OA 3KZBA 4AHCA 2UUAF 4O3PA 4IEIA 4CEDA 3PO5A 2M0GB 2CNLB 3MM5A 4O5FA 1VSMA 3SI6A 3BJYA 3A8EA 4NYPA 3QEWA 2BM0A 3FBFA 2OTLS 3VOVA 4C97A 3RUBL 5CYQA 1RAAB 4Y2KA 3CE8A 4QAGA 1UA0A 1VJQA 1VQPN 1YZ7A 1RDBA 4I6WA 2ALZA 5HRPA 2ZH9A 2CPZA 2E6LA 1TL7B 4ZP9A 3FQLA 2FJBB 4JI7K 4L8RB 3ZZTA 5ETPA 4E7HA 1BGXT 5E3RA 4WP8A 3WXJA 4KRWA 4JHDB 3HYFA 2OPQB 5AXMA 2PFFB 4B9TA 2M5YA 1LWCA 4LF8F 1OMSA 2V67A 2E1YA 2BQRA 4WWSA 2PI4A 4K8RA 4QOTA 5IFMA 2CQ3A 1RT5A 1Y5NB 3ZZ0A 3D1QA 1D09B 4NYOA 4YOTA 3QSIA 2N7CA 4DL3A 2DR7A 3FLCO 3PG9A 4M3XA 3NAIA 4NEYA 3GL1A 4BR2A 3BQ1A 2C2RA 4IFYB 4CEBA 2YQ1A 2Q0UA 1KOOA 4IOCL 1WSFA 1KQSM 3PHTA 2GNKA 1UETA 2F8HA 1JLBA 3K9JA 4JI8F 1S22A 2JL9A 4CGJA 2NRXA 2YTCA 4LC9B 3ITHB 2IPOB 3A3NB 1N32K 3OXGA 2ZH7A 1G15A 1K8KA 4AQYJ 1DY3A 1NZ8A 3MN5A 4PHTX 1RTDA 2HLUA 4HWIA 4OYXA 2DNMA 3K57A 4DR7J 2Q36A 3SBTA 3QEIA 4HYKA 1S1WA 3AO3A 3MEEA 3VGVA 1UZHA 4HHHA 2UUCF 1LWFB 2HZCA 2B0GA 2DEIA 4ZIWA 3LF0A 1HI8A 1WD6A 4QIWD 4WCEL 1Q86T 4QWAA 4G3IA 3J7A1 5DMRA 4A8MP 2LCWA 3EYZA 4A47A 3AGRA 3Q86A 4RUCA 3H25A 4PY5A 4RW4A 2D1CA 4DS5A 1NLKL 1Y64A 2LQ8A 2EFNA 2DR5A 4OI0A 1BLUA 2XCAA 3M5RA 4DV0K 3BS9A 4GRSA 5C24B 3MPDA 3QJLA 3G82B 4EP5A 4QU7A 2XMMA 2PEBA 4KGKA 4CBXA 5JS2A 1HBUA 5DG8A 1KQGB 4X64J 2GWJA 3CCJS 4M3ZA 5C15A 5MAOA 4FWKA 1YJ9N 3H3NO 1NHUA 2XO6A 5CAAA 1SKSA 2KFZA 1MMDA 2BKNA 4CJWA 1GTEA 3M8QA 1Y7PA 2WBMA 3ZLJA 4DR6F 4DQIA 3DOLA 4PQAA 3HFKA 2IBKA 1ASUA 3AHPA 1U8SA 2GIRA 1FJCA 2J5AA 1WUUA 3GR0A 4JOUA 2QWLA 1AFIA 5BR9A 5EX0A 1O0PA 4RUAA 3R9PA 1M0SA 1KFSA 1BDGA 2RHSB 5B08A 2M8HA 4HHTA 2NRTA 4BACA 3C19A 2F8SA 4NLTA 2IYGA 3MX5A 2XHCA 4M45A 3TU5A 2FC0A 1I94J 2KL8A 1U09A 2VPZB 2BXJA 4B9NA 2M7SA 2ZBCA 1AROP 4ILRA 4C8YA 1UFLA 1TV6B 4A5AA 5GVQA 2E8AA 5ADXA 2VA3A 1O51A 2O8BA 4BG9A 4JBCA 4U67L 1YITS 3CEDA 3CC4S 3VGLA 2DH7A 2ZBPA 1KLMB 2DNKA 3P38A 3S3MA 3T6BA 1LWEA 4DV7F 2ZJRL 4WU3A 1HWKA 1HLWA 1SAZA 3LDPA 2GUPA 1AB8A 3GB0A 1KVBA 2FZCB 2PIIA 5B0DA 4ISEA 1TL3A 4Y34A 3IR6B 1YJ7A 1T05B 4M94A 1RT7A 4MKBA 4RTFD 3K59A 3FSXA 4BDPA 1XR7A 3DRSB 1P27B 4NLBA 2IDLA 5JICA 3CCJN 3AVCA 4NLPA 1X9WA 2A1SA 4RNNA 4IKAA 4CHNA 2JC0A 4DR1F 4OYPA 5AQUA 1EB0A 4CIEA 3NVKA 2HMIB 2ZOGA 2YHAA 5L39A 1QSYA 1RSCA 3NS7B 5E3AA 2V63A 4X4SA 1MROA 1IJJA 2O8BB 2WAQD 4YY3K 5F0UA 1TV6A 5CY4A 1IBKF 1QAXA 2Q1LA 1BG3A 3UVJA 2HHXA 3J81O 5GAEI 2W9CA 4ECYA 5TKYA 3QIPA 2KHCA 1X5SA 1SUQB 2LFVA 2XSJB 1VQ9S 1QJHA 5B0EA 1YKWA 4HTLA 3OR1A 1JLQB 1S0NA 1NJYA 5JS1A 2ABYA 2HNDA 2BQ3A 4KJIA 4CGHA 4DPTA 1T9XA 4IWVA 2FSKA 3T5KA 2IM1A 4JI0J 3G86A 1CJKA 2V9KA 3TUZC 2HHHK 4OJ3A 3HULA 4RW6B 1HR0J 2CJ9A 4FJXA 4ILGB 1NGAA 3CF5Q 2BJ3A 2D9PA 2VU5A 2FVQA 2HGNA 3ATUA 1AYEA 5RUBA 3KWMA 2W2MP 4CGIA 2V52B 5KFIA 4DEZA 3M8SA 3RRGA 4AT1B 1JJ2M 1S0VA 1SXLA 4FJ9A 2W4PA 4ID8A 3PKMA 1GXLA 4DR2J 1Q1KA 2IC3A 3G25A 2HZVA 4UQTA 1NG9A 2MTLA 5EX5A 2FYXA 4IUFA 1DURA 1E6YA 3UD3P 3CJ2A 2IVMA 1WOOA 3PZPA 3OS1A 2EEYA 2YY3A 1IXKA 4R8UB 3NOGA 3ZSRA 3M1VB 1KSPA 4ZJQA 3VQ6A 2ZUGA 4LF1A 1FJGK 3CJ0A 2VG7A 2XY8A 1R7IA 2MY8A 2F4VK 3G8SA 2PYJA 3V6DB 2P9UA 3BKTA 1QVFM 4C0HA 4CBWA 3B4MA 3NY0A 4BRLA 1B92A 1K0VA 3JSMB 1BQXA 2ZWPA 4C48A 1A5XA 1VQNN 3FBBA 4L6V3 2D0OA 4KTZA 3DGPA 4NRUA 4ELTA 1UZDA 1JLQA 3CCRN 4ZLJA 4OGEA 4Z94A 3P1GA 5FPEA 2XLKA 4JKHA 3KTQA 3LM2A 4M5NA 3CC2S 1K6YA 2ZDOA 3POTA 1GTHA 4WQ5C 1S12A 2HBMA 1JLFA 4CF9A 1B7FA 2AWZA 4DXLA 2EFGA 3IP0A 3DWLA 2VPYB 5KI6A 4F3QA 4MLEA 1SQKA 3HCXA 2XQCA 2QXFA 2LA6A 3AVAA 3D45A 3OTCA 3M2RA 3ZZYA 1YJWS 5LJ3Y 3KLFA 3CYMA 3S1TA 4CJ5A 4LSNB 2MLYA 4DU7A 4KR0B 3UN3A 4BRGA 1KFDA 2A41A 2IM3A 3WEEB 4JI5F 3FZLA 3LL3A 2OEMA 4OJHA 4JRQA 5BPLA 4XH5A 5D77A 3I8DA 1OYEA 4W90B 3H46O 3EPGA 2HVHA 4BRDA 6FDRA 4Q0BA 1YSJA 4OHYA 4NLOA 5BN9A 1S1UA 4Q5VA 1TL3B 4ZJLA 3K58A 3KXDA 1IJEB 3QAUA 4M3WA 3EVWA 4C3LA 3AO1A 1Q16B 5KFGA 3FZ2A 2R2SA 4H4MB 1KS2A 3OJUA 2UXDJ 3ZT4A 3TQEA 1FW6A 4PKHA 1OH8A 3BBCA 5AQQA 3OHAA 1N32F 1WUAA 2HNYB 1EQMA 1RBAA 1YZ6A 2GW8A 2EFOA 1HNZK 1NOYA 3M9NB 2HIQA 1YAGA 3MUTP 5IT9U 5ELZA 5BR8K 4QCLA 2XTJP 1UCNA 4Z4EA 4NE9C 4WU2A 1UWBA 4NI2A 4QS7A 3AO2A 1KP6A 1S72N 2YWEA 3F73A 2IIHA 1IBKJ 1K47A 3OPKA 4MK7A 4L3KA 1IQZA 3TJ8A 3C2PA 4X4OA 4FK2A 1JLGA 2FHMA 2C22A 3MM9B 3BN4A 2EKNA 1TFWA 4FF1A 3KLHA 4ECWA 4F4WA 2F40A 2WVEA 5HP1B 5AQFA 4B08A 4YOYA 4B3TK 2VHGA 2HHSA 2CPXA 4B1ZA 2CQGA 3LP0B 3MPVA 3AB2B 1IM6A 4Y2IA 1TL4A 1BO5O 4W5OA 3ZZOA 3CMEN 2A40A 1QVGM 3BN7A 1FRJA 4NL5A 4BR5A 1YK9A 3DLLL 2E7WA 4DL5A 4HUFA 3PIOL 4M3TA 3C14A 5ETOA 3CQYA 4F3OA 1RLDA 1CZAN 3IS9A 2G0IA 2JHEA 2FBYA 1S1VA 2ZH6A 2Z2MA 5HMXA 4KRFA 3LM9A 1CJUB 2BUNA 4K41A 2BE2B 1M5PC 1KAXA 1V3ZA 3GIJA 1O6XA 1RAFB 2GO8A 4PABA 2F9DA 3LUYA 3HVWA 2V8GA 1B7YB 3I33A 4KAZA 4U9RA 3OD2A 4E7IA 1JXBA 1S1TB 2BV3A 2OPPA 3K5OA 4USJC 2AX0A 2HHPA 1RTHA 4OJ1A 1T9UA 2IVOA 4FOEA 4H0PA 4W98A 4ZVSB 3J7Z5 2UV8A 3M8PB 1OIAA 2EI5A 1R0CB 1BU6O 4O44B 4RW8A 1HI1A 3ILJA 4BE1A 2D3UA 3VEWA 3VA3A 3ZNUA 2DIVA 1W25A 1HW8A 2YKNB 4JKCA 3IO1A 3AXMA 1YVUA 3ZEUA 3I56N 3BSAA 4W5QA 3SSSA 4RW8B 3AT1B 1N54B 3GDQA 2RHQB 5LSOA 1IKVB 2E5JA 4O23A 2C2ZB 4PG7A 5D0GA 1SJQA 3KNAA 4LF4K 3A8YA 1N34F 2HAIA 3OYIA 1RCHA 1MWMA 4OX7A 1RT5B 1X5PA 1U02A 2EFQA 3T1YF 3WNFA 3K8WA 2HBRB 5KAKA 3OW2R 3G6VA 4HDGA 2BDPA 3MN7A 3ZEUB 3C15B 5A8RA 1L3SA 2XWYA 3RVCA 1UVMA 1PILA 4KKOB 3S6EA 5C42B 5LM7E 3HRGA 3SYZA 1S4EA 3IS9B 2E1RA 4X66J 2LU2A 1WC3A 3VAGA 3ALYA 2QK9A 3DAWA 2KVIA 3M8PA 4NLGA 4E7LA 1ZAXA 2LKZA 5CABA 3KJVB 3H08A 1S1TA 2X1FA 5KFJA 2MPUA 4P2XA 3VENA 2KZZA 3K5MA 3QFUA 1VJWA 2B8QA 4B3SJ 3NNAA 3IN5A 1ZTWA 1S9GB 4CIFA 2OD6A 2FD2A 3VAFA 4RUBA 2VF3A 4NXMJ 4M5MA 1DBDA 3PYGA 1NDCA 4MH8A 2QLBB 1TUUA 3OUYB 3VA0A 3MCSA 1RAIB 3T7ZA 3SDEB 2KM8B 5F2RA 1SQFA 1X4HA 4HVZA 4BDYA 1Q82T 3M6GA 1JJCB 2YHBA 4JN4A 1EARA 3CCES 3TZYA 5U47A 5KFBA 3VCDA 4CE9A 5HVHA 3LPUA 2G8VA 4CO5A 5K8OA 4O3SA 3W5ZA 3PM9A 4K0KK 1J5OA 1N5YA 5DZ7A 2CH6A 2XI3A 1IKWB 2BJ7A 1HHTP 1BXNA 2OELA 3BV8A 5T7BA 2YJFA 2CZ9A 4M5GA 4QWCA 3EUNA 3PSFA 3TI0A 3VETA 3MMAA 4CI6A 2VQFJ 1KVKA 3HZGA 3W9IA 3A5OC 2PN6A 2CH5A 2HS3A 4DPYA 4USIA 4I1TA 4C11A 3HI0A 1RHMB 1EHWA 4OX9J 3CC7N 4HL9A 1QE1A 4NCAA 2AP1A 3R8YA 3J80U 4H5VA 1R8BA 4XH4A 2DH8A 4CZEA 3BYPA 3NF7A 3HVRA 2XNQA 1HHQA 4ZS6A 4RNHA 4OZ0A 1WHWA 2QMWA 1GXUA 3N01A 1H2UX 3QGHA 2V51B 3M8WA 2QA4G 1URRA 2R9LA 3CCUN 2XCPA 3MM6A 2N7YA 2J6SA 1BIUA 2QE5A 3KKFA 2J76E 1S9EA 3KUHA 3NHGA 3ENOA 2YXLA 7FD1A 4NYNA 1FE0A 2XGQA 3CNQP 1TKXA 1CLFA 4LSLA 4ZPWR 2YX1A 2Y0SD 4N47A 4JK7A 4CEEA 1VSLA 3OLAA 4O0JA 4UT4A 2D3OR 3RMAA 4B3TF 2HG4A 4K5SA 1R3NA 2IMWP 4IO9L 1IR0A 4DUZK 4CZJA 3DGPB 2DBBA 2E29A 1C6VA 3P5TL 4WKYA 4E1JA 3UKUA 2DGVA 3U4LA 1OH5A 5DQGA 3L7UA 3CD0A 2BW2A 2QIFA 4LF7J 1WBDA 4E98A 1YBUA 3JSRA 4ECSA 1L3UA 1R27B 3PCOB 5KG6A 1FWLA 4FLYA 4C2MA 3E2EA 1WWHA 3KK1A 2OEKA 2OMOA 3V1RA 3C7NB 5LMNJ 3Q8RB 2NUBA 4CTAA 4KGVB 3A4TA 2OSRA 4F04B 4DV7K 4G1PA 2YWKA 4JYAF 1K8AO 4RLEA 1S4FA 2IAJB 5J2MB 2VASA 1R8HA 1NBWA 3E66A 2NLXA 2ZWHA 2KG0A 3TA2A 4I9QA 1NH7A 2RE1A 4JI2K 1UVJA 1C0UB 3GV7B 2IS3A 1WC0A 3DLHA 3GFHA 4P6QA 2GIFA 3AGKA 1FK9A 2VG5B 1NSAA 1ZS6A 2VDHA 4DV1J 1UPPA 1V5IB 4LR9A 2K7JA 3SQGB 2JFKA 3QMLA 4IDHA 4EI2A 2O8FA 2WCXA 1YHQN 4OIXA 1IR2A 2KN4A 2U1AA 2JC1A 5FPMA 1RWOB 4WXOA 3OR2B 2DXDA 2V8DA 5AJ3J 1C0TA 5FLXY 4FPBA 1JLCA 3DOKA 2YWWA 3RZAA 2FLLA 1N6QB 3DLGB 5D3GA 1IM4A 1B99A 4M5DA 2XSJA 3BF3A 1E4FT 3I0RB 4J90A 4UZCA 3HT0A 1NMNA 4E8UA 5C0YA 4GW6A 1VQLN 2BE9B 2AJ0A 2W6KA 2WVDA 1HPZA 3MMBA 4F0MA 1ZBUA 1RT1A 2WOMB 3M30A 4WFAL 2D0PA 3QICA 4IO8A 2AYGA 1QHAA 3HD1A 3PYDA 5F0XA 4WZQA 3Q7BA 2J7WA 5KPTA 5IT4A 5B0CA 1IWAA 4KTQA 1VSFA 4FXDA 1RWKB 1AUDA 3TSUA 1SC6A 1XMBA 1V5VA 2A18A 3CJ1A 4LIWA 5H1SV 3LO3A 2QRRA 2JOQA 2HNDB 1REVA 5BRHA 4QOZB 4NLVA 5C2CA 3K8VA 4OHWA 3O9TA 4Y65A 3ZXWA 4YHHJ 5DQHA 3MI7X 2CQ2A 2EWHA 2V68A 3JSYA 4DR5J 4AL7A 4DL4A 3KDOA 2HQDA 1GEHA 2JEFA 2H5EA 4UTGA 5IT0A 1M1HA 2L3MA 3IAS9 4X4NA 4JI2F 4WQ5A 2B5JA 5B0FA 5LOQA 3CJ4A 4FLWA 4FLXA 3OYBA 2LP4A 1VR6A 1YT3A 3F9MA 2CNNB 4BRHA 4F36A 3WHIA 5T7LB 4H4KC 4OI1A 1RK8A 2F9JA 3MMCA 3C16B 2F4VF 2RF2A 2G8UA 1WB9A 4OI6A 4B9QA 2HQIA 4K0KF 3R3LA 2NXUA 1HL6A 2CADA 4RU2A 4JV0A 3P8BB 3Q22A 2GGPA 4CLSA 2GUIA 2XO7A 3MUVP 2Q6BA 3DXKA 1T94A 1YJVA 4CJFA 1S7IA 5E3CA 2FJEB 3KVGA 1R59O 2KXFA 3NNCA 5F9LA 1S0OA 2YKMB 1TL1A 5J1PA 4BC3A 3DOLB 4EK2A 3W61A 1YJNN 2YKMA 1FF2A 4LQ9A 1NB7A 4Z37A 3AVBA 2O8EA 4NMLA 3JAMU 2MXYA 1BE4A 1IBLJ 2ATCB 4QYRA 2OMLA 2AIRB 4CZIA 1HBUB 1VLYA 4JKAA 2G13A 4XAKA 2UXBK 3L2QA 4CZFA 2ACYA 3K2PA 1X60A 3D0GE 5BJRA 4V19J 3E9OA 3K2YA 4OKJA 3MMVA 1JXLA 4EGLA 4FPAA 2NUUG 5KFDA 3SQ4A 4HHUA 3GG0A 1WDTA 2DNZA 2ZUAA 2FXUA 3BQ0A 3GYGA 1URNA 3IWNC 2E5IA 4A8XA 4DV0J 3FGVA 1U1QA 3CERA 4KB0A 4DTUA 1CJVB 3LP2A 2DPJA 3BP8A 4DPWA 2FPHX 3LWLA 1FNOA 3MECB 5CD4A 3M8ZA 1ZH5A 2IVPA 3B6PA 4CH7A 4I6MA 4CZCA 5DK5A 1YRXA 1RAJA 4MKAA 2X3DA 5KT5A 4JD2A 1NU0A 3HKWA 1P6TA 2CQHA 2FSNA 1YJ9S 5DM6L 2KB2A 3ADAC 1VSJA 2BMBA 2DXFA 1TZ0A 3I6PA 1PJ5A 5HANA 3DXSX 1VQLS 2ILYA 2JLGA 2NRWA 3RMBA 2KTQA 3HZ6A 1WSRA 1BWFO 4X62J 1FXRA 2M8DB 4M7YA 2O8FB 1HNXJ 5BRDA 3IR7B 3UCGA 1H98A 1H72C 2E1AA 1CPZA 3F44A 3QIOA 2NPIA 4FWQA 2O8DA 4CLZA 2R7UA 1HQEB 4ECZA 3EDRB 4I2QB 5H9FJ 1QQOA 3G9CA 3D6MB 1IG9A 1J5EF 4WF9L 3MM7B 3OBIA 2BX6A 5LT5A 3UE5A 5M1FA 2HHTA 1YI2N 4F4ZA 1FEEA 4X4UA 2Z1IA 3OHRA 5KGXA 4EWTA 3MPYA 4I69A 3DLBA 3P96A 1O5JA 3ET6A 3IMQJ 4FBTA 4MIBA 2YNHB 3VESA 1DTQB 1XR5A 5CYMB 2HQFA 1C4CA 2YNGB 4FYYB 2A3ZA 2DCLA 2VQEK 1X9MA 4K5RA 3AQOA 3DC2A 3FDSA 5L9NA 1WTBA 4MK9A 2X6SA 4FXVA 5JVHL 4Z4GA 3LAMA 1MDUB 2CGKA 5A0YB 2Q97A 4CECA 3MTJA 4WFBL 3V9UA 3VGTA 1T95A 4NLRA 4JI1F 3M2VB 2CJXB 3S3NA 5F8IA 1ZBHA 3I96A 2QSFA 3OYCA 4BDZA 3BGRA 2CDQA 4ZCKA 4JKGA 4H4KA 5J2MA 2F4FA 3CC2N 2E1PA 5F0WA 1MWZA 4R25A 4CJUA 3L3UA 2VUGA 1EZZB 1I51B 4OLOA 3B8AX 4Y00A 3HP9A 4UY8O 1YJUA 4YY3J 5E5NA 2C42A 3W1YC 2MKIA 5FDLA 3QRPA 3JTNA 4TNOA 4CHOA 1C1AA 1RQ0A 1RGVA 2BANA 3DHWC 3GG4A 2QC3A 1NK0A 4CH0S 3PRDA 4ZMMA 3L2WA 1YLXA 5C25A 3EM1A 2QYCA 2P5VA 5A8KB 2CZ4A 2Z2ZA 1UA1A 5HN0A 2UVWA 3TUIC 4DI6A 5F8NA 5HK4A 1NGEA 2CVEA 3F2KA 2KRRA 4ES3A 4KY3A 2F9TA 1K0TA 1EKEA 2MMYA 4XH1A 4CLUA 2HWIA 5CZXA 2HNZB 2QJ3A 3FJ2A 4OZLA 5CE3A 4ZPDA 3LGMA 1XERA 3M32A 1BCMA 5EDWA 2H54B 4CJSA 3QNNA 5THWA 4KO0B 2GQCA 1N5QA 4LSLB 2VGNA 1CXUA 1WDDA 1KAZA 3OBWA 2IDOA 1T3VA 2RIJA 3P5BP 3AVIA 2E9ZA 1GLBG 1KLNA 1VQ6N 2LYVA 2HBJA 2X3GA 2R7YA 1YVFA 4AFFA 1S10A 3TR8A 4JI1J 2ZQBA 2COLA 2G1HA 3MAQA 1Q0NA 4P72A 1W2IA 1DAXA 3QBWA 3D1OA 2DO0A 2FF6A 4CIGA 4JKBA 3M8RA 1OWXA 4ZVTB 3S01A 1TL5A 3W65A 1QAYA 1XIQA 3WX4A 1KVIA 1FRXA 1FX4A 3Q8UA 3R1LA 4ED7A 1Q9XA 4L3NA 4ZPAA 3SCIE 2E4LA 2M3DA 5EUHA 5A8WB 1FNXH 1UEUA 1UP1A 4NX9A 1KC8O 1RHRB 3CJKA 2DEJA 3MURP 2R8JA 2JEGA 4IR1A 4NLYA 4YOEA 3HVAA 1KN6A 3IKMA 4PG8A 3OA9A 1J53A 4RU9A 1G6BA 5AXNA 2P9KA 1U2CA 3NWRA 4QBUA 3A2FA 2M4MA 3D2FA 2EFPA 1FD8A 2P6SA 1NKEA 2IIRA 4JV2A 3TRGA 4BRMA 1NK7A 4F3MA 4D3GA 4C98A 2P9SB 1VBXA 1U6FA 3I4HX 2BBEA 3TYTA 4NCGB 4G1IA 3MFIA 3CC7S 3I5AA 4OZ5A 1JXVA 1LW2B 3FBEA 3ENQA 1D8YA 4K2JA 1H0HB 3G0ZA 1X9SA 4FJNA 5F8JA 3GCWP 1MN9A 5J1NA 5ETLA 2YQ3A 3DLEB 2CG8A 4FDFA 3N4WA 1UKUA 4C8NA 3PDNA 2JGUA 1EX8A 3V4IB 4H0OA 4YR0A 3T5JA 1DTTA 3WZ0A 3OYKA 4ER8A 1ICEB 4IG3A 2Y9HA 4CLLA 1J27A 3C15A 3QFPA 3O8MA 3NH0A 4IRCA 3FMBA 1HD0A 1JNZB 2CWXA 2ZJQQ 2UVRA 3HVTA 3R6GB 3MWTA 2ASPA 1GOCA 2OANA 4C7QA 3IR5B 4DX7A 4FW1A 5KG3A 5M2UA 4JI5K 1T03B 3G4SS 5LSRA 2XY6A 2Y8WA 2C2NA 3WIVA 2RDJA 2J0XA 3R7BB 2H5JB 4GMKA 2K7KA 4E1MA 4RR5A 4ALZA 2YCHA 4G9ZA 1RT4B 1JMTA 1SIWB 4JI6K 4UOHA 4B3OA 2BABA 3T1YK 3KLIA 2YV0X 4IG3B 4MQ3A 3CDAA 2MZ1A 4OHVA 4UY85 2HGLA 4B02A 2Z2YB 4CD3A 4HCBA 1RWVB 3ZTSA 3MM7A 2YHXA 4DCPB 4CGGA 5CXTA 5AQIA 1N33K 3K0JA 3V5RA 3EMTA 4URGA 4F4AA 5BR8J 5HROB 4ID5A 2OHDA 4WFXA 4AXIA 4FZYA 3BY5A 2QWNA 2QV6A 1CSJA 2KJVA 3SNNA 4TU8A 2HURA 2VBYA 3Q8QB 3UNYA 4CT8A 1LV5A 3R97A 4L75A 4QIVA 3D2FB 4WF9Q 4YOWA 3AA2A 4YOXA 4MTPA 5KFUA 1RACB 3W62A 1D0EA 3AD9C 2FUG9 3LWMA 4E89A 1RWXB 5DDOC 2MKJA 3N5BA 2HFZA 3NMAA 2DCUB 4ZLNA 2OLWA 3O1WA 1BI4B 3I87A 3ATVA 3OFHA 2MKSA 3ULEB 4OHXA 3KHYA 4OYOA 3VZIA 4GMJB 1CJVA 2D0CA 1P8GA 4JI4J 4NYFA 3MXHP 1OVQA 3P5JA 4GO7X 4F9OA 3OW2M 1RA6A 5KFOA 3VQ7A 4CGDA 1FESA 2ZBQA 1J2VA 1LXNA 2AX1A 4Q2LA 3TUPA 3VF0B 3BGLA 3UNGC 4KBIA 3FMWA 4ECUA 1RHUB 3UD4P 2BYCA 3DLLQ 4I2PB 5AQOA 3E9LA 1ESVA 4IG0B 3M32B 4BVPA 1GNKA 4FWNA 4LF6K 3UR3C 1HNWJ 1Q5VA 3S8SA 3SPZA 1OQ3A 5ITHA 3C14B 4LH4A 3THPA 2JWNA 4QJVA 5C2DA 2CZVC 1UPMB 4C0OC 2OJ3A 4OYWA 1LK7A 4MKVA 4DSKA 1UW4A 2AD9A 4YOVA 3ZT1A 5C25B 2WBNA 2B4OA 4EMDA 2ZNYA 4ZVGA 2XMWA 5HOOA 1RBLA 2EXUA 2Y1IA 3QT7A 3BSOA 3MMJA 3AJ2A 4MIAA 3CB4A 1EETB 3MCNA 1H73A 2WHOA 3ILOA 4XPCA 2BRLA 2UUCK 2ACMA 1LXJA 3TA1A 3R5AA 4XDCA 2F8MA 4Y3CA 1HQUB 1FI4A 1NM2A 3MR2A 3PRVA 2XS2A 1Q9YA 2RF2B 1FCAA 3H20A 3LTOA 1VQKS 5DQIA 2AKWB 2EVZA 3GWCA 3H5XA 2GAHC 3H40A 1Z2ZA 3O44A 3G6ES 2ITMA 2UU9F 2Y1LB 1T3OA 2C1EB 3CW2C 2XY7A 2D9OA 2HW3A 5LMUF 3VAMA 3I32A 2R7VA 3ENBA 4IFEA 1TTHB 4RNFA 2Q43A 1ZBFA 3CGIA 1ELOA 2DNRA 4HACB 2I7NA 3DDKA 1L3KA 4BROA 3A1YG 2R7TA 3IM9A 3EXCX 1T7PA 2QXLA 1OQ6A 1U49A 2BTFA 2P51A 4JEPA 2R42A 2PBDA 2QZ8A 1RU2A 3POTB 4DV6F 4B3RF 4BC4A 3SPYA 4IOAL 4WYLA 4PKGA 1S6PA 4RUHA 2AZ1A 2LXFA 1QHTA 2DHGA 2GWKA 3WEEA 1Q95G 4BREA 3M6WA 4DDFA 3OTEA 1FKOB 5JMNA 4TKTA 3Q2TC 4NXMK 1TU0B 4LSNA 2I9SA 5FRMA 2XULA 1N8RT 2V9WA 5HAOA 5E3PA 4YFUA 2AF6A 5IWAJ 2VIHA 2UYTA 4TQSA 1C0MA 3M2RB 2FGCA 2MZRA 4B1XB 3AJDA 4OYZA 4PKDB 1Q7LB 1R8AA 3K89A 3PX0A 4Y2CA 4DTRA 3CCTA 1JJ2R 3WNGA 4A5BA 4KT0C 4Z4FA 1VIOA 1KD1T 3LH2S 4FJIA 1N36K 2P8IA 1SVDA 2G0JA 1TKZA 4NZ6A 4H0XB 3OSPA 4FYVB 2DY9A 1FERA 1YRUA 1GLEG 4TLQA 2HHQA 2HS4A 3BH6B 1MN7A 1RZMA 3Q8SB 4XTTA 2DNLA 3RTVA 3O9QA 3MDQA 4Z7CA 3RRHA 4F0KA 2R8IA 1XEZA 5KT7A 4DV6J 5DS7A 1SPBP 1KHWA 2QTDA 2WB4A 5M2PA 4QQBA 3QSYB 2P6TA 1S1XA 1RABB 3GSDA 4F7VA 4CHPA 1U1MA 2GMJA 2QLWA 2HZAA 4AHUA 3V4MA 5LJWA 1OY6A 1RWWB 3KUEA 1VRQC 1MWQA 2K8GA 4LQ3A 1VQKN 5KFKA 2Q3SA 3CJ8A 3UWTA 2NSCA 5JLHA 4Z4CA 3K17A 4LBIA 5D0RA 3TEGA 5AE3A 4Y1CA 5D0EA 5I3UA 3FZMA 3O3FA 2F65A 3OR1B 4EHTA 1YRTA 2R4FA 3KIOA 4DV2J 2Z56B 1VSEA 4U7CA 2FBTA 4CTAB 3D7EO 4YDUC 1CC8A 1NGGA 1FE4A 4A8KA 3EO3A 2B43A 2RUGA 1OSCA 4C8OA 2OZMA 2XMUA 1P1TA 1WEXA 3DRPA 3SAFA 1PKUA 1XN9A 4OYIA 4YEAA 2R8GA 3ZX0A