4LSNA

Crystal structure of hiv-1 reverse transcriptase in complex with (e)-3-(3-bromo-5-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy)phenoxy)phenyl)acrylonitrile (jlj518), a non-nucleoside inhibitor
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
549
structure length
549
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Structure-Based Evaluation of C5 Derivatives in the Catechol Diether Series Targeting HIV-1 Reverse Transcriptase.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 131
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4lsnA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lsnA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4lsnA05
2ASJA 4I7FA 3LP1A 5KG6A 2WONB 4KHMA 4PA1A 2KTQA 1WNSA 4DU4A 1NK5A 1TK5A 3K2PA 2QKBA 2YNFA 3C6TA 1XHZA 2HAIA 2D41A 1XHXA 1WSJA 2O5DA 2B4JA 4E19A 3OYIA 3HJFA 1C0TA 2HHWA 2DFHA 3H5SA 4Q8EA 4KV8A 4YMEA 1NK8A 4IG0A 1S9EA 4IKAA 3BGRA 4W5QA 1RT1B 2VG7B 4MKAA 5CZ1A 5KFCA 5KFOA 4EYHB 3ZSQA 2HMIA 3DRRA 3EZ5A 1Y97A 3QERA 2XCAA 4AHCA 4E7KA 3CG7A 3MF5A 3VQ7A 3VQQA 1S0OA 2KFZA 1HJRA 3LAKA 1EP4B 1TV6A 4O3OA 2ATQA 3HPHA 4CJ3A 5DLGA 3BSNA 3AVKA 3QIOA 5I3UA 2BANB 3SQ2A 4MKBA 1A5XA 1U45A 2LSNA 3IRXA 1NOZA 2OYQA 1QS4A 1SH2A 3DM2B 1RBTA 2DY4A 5KFBA 4FXDA 4MH8A 4BE0A 3HSTB 3QZ7A 3UR0A 4DQQA 4B3OA 4YNQA 3NDKA 3OYGA 1B9DA 2E4LA 3HPGA 4KHUA 4AHRA 4F3OA 4XPCA 1RTIA 1FXXA 4M3TA 1BIUA 2YNHA 3BDPA 1IKXB 3Q8SB 1N56A 2V4RA 3VQSA 5DG7A 4CF2A 4CEOA 4DTRA 2I1RA 4O0IA 1QE1A 3DMJA 3BSOA 3OY9A 2JC1A 4DS4A 3NBPB 3IS9B 3WNGA 2WTFA 1U04A 1RT5B 5KFZA 4O0JA 1BI4B 1RCHA 2BR0A 2V4QA 3QIPB 3CO9A 5KG3A 4C8NA 2KFNA 2FBTA 1HYSA 1J5OA 2BE2A 3M9MB 2B5JB 3L3VA 3IGNA 5KT5A 1XR7A 3AVAA 1U09A 4M45A 1HNIB 3E01B 3IGVA 3LDSA 3B6OA 4NLQA 3LWLA 5HLFA 1T03B 3RAQA 4DWIA 2YKNB 5JS2A 3V4IA 4EBEA 3CM5A 1BQMB 3HKWA 2GUIA 4FS2A 5CYQA 4CJ4A 4O3SA 1D5AA 4CEDA 4CF9A 5EDWA 5DG8A 1T3NA 1S10A 3AVFA 3DRSB 4NLRA 2X78A 3C94A 1D8YA 2D0BA 2C2DA 5FROA 1RNHA 5KFFA 1RDAA 1JXLA 1R0AB 3VQ5A 4FYDA 4O5BA 4ZTJA 5SZTA 1BHLA 2OPQB 3TI0A 1DTTB 5KFWA 1IKVB 1ZBLA 3LALA 2IGIA 4FVMA 4KHRA 3KKRA 3KHGA 2YNGA 3H59A 3MXJA 4DSLA 2BQ3A 3L2UA 5I42B 3V6JA 4OPJA 4FZYA 3HXMA 2XO7A 3NAEA 2KZZA 3CJ5A 3SUNA 1N6QA 1REVB 1S1UA 2RKIA 1S49A 1RTHA 2JLEA 3QZ8A 2O4IA 2GC8A 1BL3A 2E9TA 3AO5A 4DTNA 3LZJA 3DOKA 4J2EA 2IA6A 3DLGB 2OPRB 4OKJA 3PHEA 3G10A 1TKTB 3FFIB 4DL4A 5DGAA 3ZCMA 5CYMA 1JLCB 3PY8A 4YR0A 4KTQA 1N6QB 3Q8PB 3DYAB 1K1QA 2PY5A 3P83D 1VSFA 3N6LA 1TVRB 3SUOA 2HB5A 4ICLB 4IG3A 2JGUA 4KHWA 2AX0A 2FBYA 4CK1A 4KHQA 3CWJA 4IH5A 5HP1B 3VQPA 5T7BA 1L3TA 1JX4A 4KRFA 3JSMA 3MXIA 4ED7A 4WFYA 3SPYA 4GMJB 3QEXA 3V6DA 3NE6A 1QSSA 3DRPA 4KAIA 3NF6A 3K5NA 3S3NA 3OSNA 1ZBUA 4FLTA 3H08A 4RNFA 2X74A 3SI6A 3T5JA 3RRHA 3C6UB 1ITGA 5DQGA 1KLNA 4ZP8A 4NZ0A 3LPTA 2GV9A 3HK2A 3DLEA 3CJ3A 4KPYA 2IMWP 4BACA 3I5BA 3QGIA 4NRTA 3ITHB 2R8JA 1C0UA 4FLVA 4LSNA 3DLBA 3V1QA 1RTJA 4DL2A 1K1SA 4F3TA 3H2LA 4N56A 3MEGB 1HNVB 3MEEA 3I0RA 2W7PA 1A5WA 1S6QA 4EBCA 3OL7A 4OVLA 3VQAA 4IH7A 3NH1A 4KI4A 4H4MA 4CHNA 4CJTA 3QEVA 4CJPA 1D0EA 4DF8A 2D0AA 4WZMA 1MU2A 2XI3A 3NMAA 4JS5A 4ECSA 4C8LA 1X9WA 4RW9A 1RT7B 2VG5A 4TQRA 4B9LA 1S6PA 4QWDA 2IAJA 4LSNB 2G8HA 3T5HA 4ZHRB 3DOLB 4DSIA 3QO9B 4M3XA 3VA0A 5KT6A 4CEAA 4MFBB 1S9GA 5KRTA 2OPPB 4UQGA 4NCGA 4KO0B 4EBDA 3S3MA 3ZSXA 3PV8A 1DLOB 3VQEA 3IAYA 2ASDA 1ZBHA 1C6VA 4O4GA 3KK2B 1TL1A 4R5PA 5HRPA 5L1JA 1LWFB 4YFUA 4HCCA 4EEYA 1ZYQA 2FLPA 3AVGA 3FQLA 4FZXC 1BGXT 1RBUA 4CJSA 1LAWA 3LPUA 4KKOA 4NLXA 4N47A 4FCYA 3AO3A 4J9NA 5HROB 4ZP6A 4URQU 4DU1A 4CJUA 3RBEA 2V9WA 3LP0A 2OPSA 2YNIB 1I6JA 1Z26A 3V9ZA 1SL2A 2W7OA 2QV6A 5F8LA 2NUBA 1KVAA 3PJXA 2D3UA 2C28A 3GIIA 3OS2A 4R8UB 5J2MA 3SV3A 4MIBA 2UUWA 2C2EA 4KSEB 4F4YA 4PQUA 2PYJA 1UOCA 1JLEA 2FBXA 3AVNA 2OPSB 1C1CB 1J9AA 5CY4A 4JRQA 1F21A 2IDOA 1SL0A 3THVA 4CHZA 3SUQA 3WNFA 3KOAA 4DTOA 5KT3A 4K4YA 1LW0A 3KD5E 4KHNA 4RZRA 2R8HA 2XY7A 2KW4A 3RRGA 4EZ9A 1S5JA 1JLAB 2BQRA 1ASVA 2FVRA 4M3WA 3NAIA 4KE5A 3B6PA 2E6MA 4N41A 1TGOA 3SZ2A 4PQUB 2G8UA 4DQSA 3T5LA 3V81A 4NYFA 4DG1B 3OYCA 4HUGA 2DFEA 2ITGA 4CFAA 2G8FA 4DL7A 3NKYA 2ZD1B 4M3RA 2OZSA 2F8SA 5KFXA 4GVMA 4B8CA 3KKSA 4IRDA 1RBVA 3KLIA 5C25B 4E1MA 4L8RB 1DTQA 3OVNA 3T19A 3TABA 2B6AA 3HYFA 3SI8A 2IM0A 4B9SA 2XY5A 1ZETA 1SL1A 1S1WB 1N4LA 3KK3A 1SKWA 3MR5A 4YQWA 3BJYA 1U48A 2JC0A 4CJQA 3OYMA 4ECXA 1KCFA 3ZSWA 3OL9A 4URGA 3BR9A 4LY7A 4TQSA 2GIRA 1X9SA 3Q8QB 4B08A 3MFIA 5K14B 4RW6A 1TKZB 4LH5A 4B9VA 3KLFB 1EETB 1JLGB 2WONA 5DQIA 4ECVA 3OYBA 2B6AB 5HBMB 1L3UA 2VG6A 4ED6A 1VSKA 1L5UA 2Z1GA 3EPIA 1KRPA 3OJSA 3QLHB 3OL6A 3PO4A 3JYTB 5EUHA 4LH4A 4DL3A 1IH7A 4HKQA 3PR5B 2A1SA 1RT1A 1XR6A 1CLQA 4LD0A 2FVSA 3ZSOA 2VG7A 2ILYA 5C24B 5KT4A 2ATLA 4FJLA 3NHGA 4HCBA 3KTQA 1FKPA 4BDZA 2PZSA 1WSGA 4DTPA 5JS1A 1QAIA 2VG6B 3AV9A 3V9XA 1EP4A 4FJ5A 3OS0A 1IG9A 3HP9A 4EYIB 3RMDA 4ZTFA 1B92A 4RNNA 3K5MA 2BANA 1W0HA 1WLJA 3RB4A 5C42B 2XRIA 4DFKA 4FZZA 3RMAA 4F2SA 3DM2A 4ED3A 1BCMA 4TY8B 4XO0A 3PO5A 3QGHA 2HVIA 1FKPB 4FJ9A 2FVCA 3UQSA 4GC7A 1S1TA 1TK0A 4O44B 1TKXB 3HHKA 3MR6A 1VSEA 3AA5X 4CHPA 4Q45A 1SKSA 4NLOA 3PR4A 2G8VA 1IKXA 3FSIA 3F9KA 4Q43A 4LSLB 4B9NA 2RDIA 4NLVA 4RNOA 5KFGA 4CCHA 3GYNA 2GIQA 4CJVA 2BRLA 2IOCA 1S97A 4JV0A 4EP4A 3G6YA 4K4SA 3NBPA 3IS9A 5F8MA 4M41A 1S1TB 4CFCA 3OYKA 1RT5A 2R2UA 2Y1IA 3Q8RB 3BQ2A 1BI4A 4DSJA 3QIPA 4FM1A 3U3YA 2VA3A 1NK7A 2Q3SA 3T1AA 2IM2A 4Y1DA 3TAMB 1WNEA 4CIGA 5KG5A 3VQ4A 2B5JA 3RAXA 1JLBB 2HNYB 1TP7A 4Y1CA 4FM0A 1RT6B 4URSA 5D3GA 4WYLA 3OYJA 1HNIA 2HHXA 2D0CA 3E01A 3AVCA 4NLTA 4ZPCA 4TSXA 1T03A 1A5VA 1TK8A 3PUFA 2YKNA 1BQMA 5KT2A 4OGCA 3GIJA 4BDYA 3CDWA 5KGXA 1LV5A 3PW4A 2HNZB 4RUCA 5CZ2A 4DLEA 1BIZA 1C2PA 4M94A 2AGPA 3DRSA 1N5YA 2HW3A 5E41A 2WCXA 3EYZA 3KLVA 3M8QA 5D3GB 3QETA 1R0AA 1SV5A 2OPQA 1DTTA 4K4TA 4DL6A 5KI6A 3SQ1A 1IKVA 4HUEA 4QCLA 5DQHA 4C8OA 5KFTA 2XY8A 4FW2A 2OA8A 2BRKA 1NK4A 3HVAA 2G8WA 3CQ8A 3OYLA 3H5UA 5F8GA 3BQ0A 5I42A 4E7IA 3KLHB 4QWEA 1HYVA 5KG1A 3OL8A 5KG4A 4BWJA 3KHLA 2HHSA 1N5YB 3TAFA 5DMRA 1REVA 2EHGA 3M8QB 5KFLA 4TYBA 4YR3A 4NLGA 1YTUA 3CVKA 3VQCA 5KG0A 5HRRA 1SV5B 4IFYB 5KTQA 4W5NA 1XI1A 3KMQA 2IC3B 3P1GA 1T05B 1G15A 1T7PA 4K50A 1T94A 1YT3A 4ECWA 3SUPA 3DLGA 2OPRA 5KFDA 1NJXA 1VSMA 2JEGA 1TKTA 3FFIA 4B9UA 2R2RA 3RB3A 1T8EA 3NL0A 4DFJA 3KJVB 3MECB 1QHTA 1WN7A 1JLCA 3CFOA 3DYAA 2PYLA 5J2QB 3ZSYA 3OYEA 2HHVA 4FLZA 2VWKA 1Q9XA 3QYYA 4CHQA 3ISND 1TVRA 3T3FA 3CIZA 1RDRA 1YVUA 4ICLA 2R7YA 3EPGA 2XCPA 3MR2A 3RWUA 3UPFA 3TANA 3SFGA 5HP1A 4ZVGA 3KLEB 3G6VA 3NH0A 3ZT4A 4ZVEA 2CJQA 5FRMA 4ZP9A 4QWBA 3V6KA 2R8IA 4E7HA 1JIHA 3HM9A 2O4GA 3NAHA 3QNOA 4KFBB 4NLSA 5KFAA 2R2TA 3U6FA 4BE1A 4NCAA 4Z0UA 1GOBA 3C6UA 4CJLA 1FKOB 4ID5B 3IG1B 5J1EB 2KQ2A 4QAGA 1NOYA 1NHUA 3NF7A 3HO1A 3ITHA 4RW4B 1ZTWA 1JXBA 4E89A 3MEGA 2FVPA 3V6HA 1HNVA 3HL8A 4M3ZA 3KLGB 1KLMB 4H4OB 4DTSA 3GIKA 2RN2A 4M3UA 3A2FA 4E0DA 4XIUA 4CEBA 4Q0BA 1BQNA 2FJWA 4JRPA 1HQUB 3LAMA 3PVXA 3V9UA 4K8ZA 1NK0A 1RT7A 4Y2CA 1EKEA 1WAFA 1S4FA 3P5JA 1TAQA 3NH2A 4BDPA 4JLHA 3QINA 1CSJA 4ZHRA 1EX4A 3DOLA 5KRSA 3QO9A 4J9KA 3NGYA 4CFBA 4MFBA 1HQEA 1J54A 5JXSA 2OPPA 3OYFA 4FS1A 3LANA 3RBDA 4ED1A 1CZ9A 4KO0A 3RB6A 3WNEA 5KG2A 4Q0BB 1BQNB 5F8NA 4CK2A 4FLXA 1DLOA 4DQPA 5KGWA 5L1LA 3M8PB 3UIQA 3KK2A 4YP3A 3TARA 3EY1A 4BWMA 4I2QB 1LWFA 1JLFB 2ETJA 4DQIA 4TYAA 4FW1A 1L3SA 5KFVA 4J2BA 1SUQB 4J9LA 1VSDA 4RW7B 1HQEB 3O3HA 2G8IA 4DSFA 2R8KA 1LWEB 4Q8FA 1WSHA 1RT4B 5HROA 4RUAA 4XPEA 1NJWA 2YNIA 1NKCA 3N6NA 2HVHA 3ZT0A 2D5RA 1L3VA 1N48A 2F8TA 1S48A 3SJJA 4PUOB 4ELVA 2DTUA 2FVQA 2W42A 1YTAA 3BSAA 3OYNA 4R8UA 1S0NA 3ULDA 2OZMA 4Y2AA 4GW6A 4FK2A 1RT3B 1RILA 4QWCA 4ECQA 1UA0A 4ED8A 4CHYA 1C1CA 1D1UA 2QK9A 4CE9A 2UVWA 4CGFA 4Z4CA 3LZIA 4F4WA 4IRCA 4ED0A 4RW8B 4WE1B 4O3QA 5KFKA 4DSKA 4OLAA 4KREA 5EWGA 4DSEA 1J53A 4ZVHA 2FLNA 5J2NB 1CXQA 5F9LA 4MK9A 3DLKA 2AU0A 4NLDA 4KBIA 3V1OA 1JLAA 2B43A 3QESA 3TAGA 2W9BA 1W25A 1WAJA 3ISNC 3PW2A 4DG1A 4PWDB 3BQ1A 3G86A 3AO2A 1S1VB 2XI2A 4HYKA 3O4NA 5KFUA 4CGHA 4CJKA 3FQKA 2ZD1A 3CM6A 3OS1A 4O4RA 4CJWA 5C25A 4EO6A 2XC9A 3F73A 4GC6A 3RB0A 4J9RA 2WOMA 3DLKB 4QW8A 1IKYB 3VQDA 4Z4IA 4NLWA 1S1WA 3QEIA 2W9BB 1HARA 1KHWA 5KFQA 4E3SA 3CJ4A 1TKDA 3VQ6A 3SNNA 2Z1JA 2YV0X 3CJ2A 4ZMMA 1KTQA 3D5MA 3N6MA 4J9MA 5K14A 1XR5A 2DPIA 1TKZA 4OL8A 1D9DA 4CJ5A 3KLFA 1RDBA 2OH2A 1QQCA 1EETA 1JLGA 3KIOA 5HBMA 2WOMB 3NGDA 4CF8A 3E51A 3AA2A 3AVBA 4K4VA 2RDJA 4DU3A 5KFMA 3QLHA 1RA7A 4ECZA 3JYTA 3HVWA 1HMVA 1WSFA 2GBZA 4NYNA 5F8JA 4CGDA 4MK7A 4CHOA 1LWCB 3KK1A 4TLRA 1S0MA 5F8HA 1FK9A 4FM2A 3HVTB 2Y1JA 1KVCA 4CERA 4KHSA 4NLPA 3CFPA 1O1WA 3QEPA 5C24A 3TWHA 3VA3A 4B8AB 2UVRA 4IKFA 5L1KA 3M9OB 2G8KA 4DFMA 1LW2B 4IRKA 4F4XA 2ASLA 3RR7A 2CKWA 1HMVB 4FJNA 1C1BA 2ZE2B 4J9QA 2WK4A 3KK1B 3QGGA 3CYMA 4G1QB 2HWHA 3RMBA 1FK9B 1S1XB 5C42A 3U3GA 4TY8A 4IQXA 4MK8A 4Y34A 4YR2A 4QW9A 2AWZA 4EP5A 2IM3A 3K57A 4PY5A 1YVFA 1UWBA 1Z25A 2FJVA 1RT2B 3AA4A 4RU9A 3I8DA 4O44A 4W5OA 1TKXA 4CJEA 1JLQB 4ELTA 5FDLB 2WHOA 2F8EX 4IDKB 1K6YA 2JEJA 1C1BB 1WSIA 1QAJA 4LSLA 4IOBA 3L2QA 2C22A 3KHHA 2ALZA 2RF2B 4H8KA 4E7JA 5JUMA 3NGZA 2XWYA 2YHBA 2I5JB 2IS3A 3AVMA 4OKKA 4W5RA 5L1IA 5J2PB 4K4ZA 3DI6B 4Q5VA 1UWBB 3LP2B 4OKEA 4O3RA 1NJZA 4DTXA 1QSYA 4Z4GA 2XHBA 1VK0A 5DG9A 2W9CB 2A1RA 1RTDA 1IKWA 4FK4A 5EU7A 2JEFA 3TAMA 4I7FB 3LP1B 3GV7B 4B9MA 4FK0A 1JLBA 2HNYA 1TAUA 2QXFA 1C1AA 4I9LA 1JL1A 4F8RA 2YNFB 3C6TB 5EWEA 3TR8A 1RT6A 4WFZA 2AGQA 1C0TB 3GILA 3VN5A 4KV8B 1HRHA 4IG0B 3SV4A 1S9EB 4N76A 2QKKA 3BGRB 1Q9YA 4W5TA 3OLBA 4IR9A 2BDPA 1RTDB 1IKWB 3SPZA 2HNZA 3I5CA 2HNDA 3SQ0A 3BREA 3O3FA 2HMIB 3IN5A 3DRRB 4KI6A 1QTMA 3AVJA 4Y3CA 1RYSA 1KVBA 1TV6B 1KHVA 3D0PA 4U6PA 4J9OA 2R2SA 2FC0A 5I3UB 2RPIA 5F8IA 4K8XA 4AHVA 3OSPA 3IRXB 4FBUA 1MMLA 1NNDA 4JS4A 3H5XA 2HNDB 1RBRA 1SH3A 3FDSA 4QOZB 2HHTA 1BCOA 3KLHA 4B3OB 3GV8B 3H40A 3PJWA 2EX3A 5DGBA 1D9FA 1JL2A 4M42A 4WXWA 4ED2A 4DTUA 1RTIB 2UVVA 1IO2A 1HPZA 4IFYA 3AO1A 1Q8IA 2YNHB 4MQ3A 4KB0A 2IC3A 4WFXA 1T05A 2VWJA 4M95A 4FJHA 4AHUA 4F50A 2P5GA 4HTUA 2HHQA 3ZSVA 5KFJA 3T5KA 3RMCA 1I3AA 4FLUA 1QE1B 1SKRA 3DMJB 2VA2A 4KAZA 3AVIA 3OHBA 3KJVA 1UAXA 3MECA 1EXQA 3CDEA 2QE5A 3VQBA 3MXMA 1JXEA 5J2QA 3TAQA 4C8KA 5KFEA 1KFDA 2FLLA 3I5AA 1HPZB 4DS5A 4FJGA 4HVJA 1HYSB 1J5OB 2BE2B 3V9SA 4FJXA 2BGGA 3KLEA 1ZBIA 2BQUA 2C2RA 3OJUA 4ZPDA 5KFIA 4ECRA 3PW0A 2E9RX 5C5JA 3SCXA 4KFBA 4DLGA 5HRSA 5HLFB 4O3NA 3SFUA 4QWAA 3FRZA 3V4IB 5DLFA 4OJRA 4AHSA 4CFDA 4NLYA 4N5SA 5CYQB 3ZSZA 3L2VA 1FKOA 4ID5A 3IG1A 3MAQA 5J1EA 1VSHA 3RTVA 3ZT3A 1U4BA 2J6UA 1NHVA 4RW4A 1NJYA 5HRNA 3S9HA 3WNHA 3PW5A 1I39A 3NF9A 3O4QA 4IFVA 5KG7A 2ZQBA 3CDUA 4K4UA 3KLGA 1KLMA 3TVKA 3L3UA 1SH0A 3GQCA 1X9MA 4H4OA 2IJNA 4M3YA 3M9NB 4LQ3A 4ZVFA 4AILC 1W9HA 2EC0A 4OGEA 1HQUA 2YNGB 3LP3A 4J9PA 2Z1HA 1CZBA 1NK6A 4WYWA 1OS5A 3HT3A 4K4XA 1VSLA 1VSIA 4FJ7A 1S1UB 2RKIB 4IFVB 4TY9A 1RTHB 1KSPA 2D7SA 4NLUA 1B9FA 2J6SA 4O3PA 4QPXA 1RAJA 4ID1A 3DOKB 3QEWA 4CJRA 5KFRA 5SWMA 3M8SA 3K5OA 3M8PA 3DLHA 1RYRA 5CYMB 4F2RA 3KHRA 3SYZA 4TN2A 5F9NA 4I2QA 3OYDA 1JLFA 3HP6A 2ILZA 4FJ8A 4G3IA 4DQRA 1SUQA 5KT7A 4RW7A 4IG3B 3K5LA 3PX4A 3NF8A 3C95A 4ZPBA 1LWEA 3OYHA 3V9WA 1RT4A 2E6LA 2R8GA 3I0SA 3KMSA 4K4WA 3AVLA 3TAPA 4EO8A 3JSMB 2J6TA 4KTWA 4FJIA 1TQLA 5FRNA 2XY6A 3V6DB 3MFHA 2P1JA 3DRPB 4CK3A 2HHUA 4CGJA 1VRTA 2DPJA 4PUOA 2FJXA 3D45A 3MR3A 3NCIA 4FLWA 2FBVA 3L2RA 4ZP7A 4WXOA 3K59A 1XWLA 3DLEB 3M8RA 4DFPA 1CXUA 4CIEA 4TXSA 2V0NA 4BE2A 3PX6A 4B9TA 4CEQA 3SQ4A 1RT3A 4CIFA 1Z4UA 1C0UB 1RDCA 3I0SB 4X2BA 1RTJB 3ALYA 4JV1A 4RNHA 2JEIA 3MEEB 3I0RB 2P51A 2IM1A 1VRTB 1S6QB 4RW8A 4WE1A 4ECTA 4DTJA 3AA3A 1ZBFA 4H4MB 4ZPAA 4F4KA 3CJ0A 4JUZA 5J2NA 5EWFA 3S3OA 3QIDA 3V1RA 2Z1IA 1MU2B 2F96A 3RR8A 2KZMA 3EZUA 2DFFA 1HYZA 3G6XA 1ASUA 4CEEA 4RW9B 2VG5B 4Z4HA 3KD1E 2AGOA 1S6PB 5KFHA 3VQ9A 2IAJB 1QUVA 1GOCA 4ELUA 4E1NA 2HWIA 4PWDA 1U47A 1S9FA 3H4BA 3K58A 1S1VA 1X1PA 1ZTTA 3BSCA 2WB4A 4J9SA 4Z4EA 4U7CA 1U49A 2AJQA 1QSLA 4AH9A 1KFSA 1S9GB 4WZQA 4CECA 3DDKA 4NCGB 2XGQA 3ASMA 3DLRA 3PX0A 2UUTA 4FJJA 3ICLA 1IKYA 4OPKA 1JKHA 3QNNA 4HHTA 1ASWA 1NKBA 3ZT2A 5KFSA 2W9AA 4O4GB 4F4ZA 3VQ8A 3L2WA 1TL1B 4JV2A 4R5PB 1TL3A 3ZSRA 3AO4A 4DMNA 1C0MA 3KNAA 3CFRA 1RBSA 3UDLA 4KKOB 1BISA 1VSJA 4RG8A 2YHAA 4RNMA 2UVUA 3LP0B 4FJKA 3NFAA 4FBTA 4CEZA 3NGIA 1LAVA 1JKHB 3H4DA 4IBNA 3AVHA 1NKEA 1LWCA 4Z4FA 2IJFA 1XC9A 3HVTA 2W8KA 5L9XA 3H5YA 3D28A 3TQ1A 1TL3B 3HPOA 5J2MB 4Q44A 5KFNA 4I2PA 4MIAA 1VRUA 3TAEA 2X6NA 3OHAA 1JLEB 4DEZA 3O3GA 3L8BA 3MEDA 1LW2A 1UA1A 4HUFA 1RA6A 4J2DA 1NK9A 4LQ9A 5KFPA 4I9QA 1GX6A 2ZE2A 5T14A 1LW0B 3G0ZA 4G1QA 5DK5A 4AHTA 4FLYA 1S1XA 4CF0A 3PW7A 4C8MA 2P5OA 4KTZA 4I2PB 1VRUB 1RDDA 2YKMA 4IR1A 3V81B 4ECUA 2WRMA 4ECYA 1RT2A 1GOAA 4IH6A 4KB1A 4KHYA 1JLQA 4NYZA 3OLAA 3MEDB 5FDLA 4CGGA 3MTKA 3H98A 4DL5A 4IDKA 4CF1A 4CJFA 4KB7A 3KLIB 2X6SA 2ZKUA 4NRUA 2AX1A 4DF4A 1DTQB 2RF2A 2W8LA 5KFYA 4EZ6A 4CGIA 2I5JA 4E7LA 4NCBA 4CESA 2YKMB 4FJMA 4O55A 3GIMA 5J2PA 1GX5A 3KK3B 1WSEA 3ZT1A 3LWMA 3DI6A 2D3ZA 2XGPA 3GV5B 3LP2A 4R0EA 4DTMA 3HVRA 4CEFA 3PZPA 4OLBA 2W9CA 4H54A 2E9ZA 4RW6B 1IM4A 4J2AA 2IBKA 2AQ4A 3OYAA
chains in the Genus database with same CATH superfamily
1VQON 2WONB 4PA1A 4ZCLA 2DHGA 2PDAA 2EBGA 4LR8A 1WNSA 4G1PA 3R9LA 1NK5A 4DB3A 3CXCM 4Y65A 4WFAQ 2HQFA 4WFNQ 1XHXA 1KAYA 1FFGB 1Q82O 2QW9A 3Q7CA 2HQCA 4KIAA 2V8GA 4E19A 1C0TA 1IJJA 4Q8EA 4KV8A 4YMEA 1F5CA 1JCGA 2N3LA 3BGRA 1VC6A 4W5QA 2QA1A 3K9KA 5A8RB 4GKJF 4WTOB 4EYHB 1MN7A 3M8YA 1UVKA 2ZM6K 3H6EA 4AHCA 1ILYA 1GEHA 2DRDA 2XQCA 3SK3A 1OJ4A 4CD1A 1EP4B 5DDQC 2DGWA 2C2OB 3UVJA 5A8KA 3EXYA 5DLGA 3UO0A 5KAKA 3CPWR 3QIOA 2UU9K 5I3UA 3SQ2A 2OYQA 1HBNA 2XSFA 2A3ZA 2U1AA 2QSWA 2P9CA 5EGYA 5KFBA 5HMZA 3EKUA 3EDQB 1EJ7L 3UR0A 3MHYA 3HHLC 4DQQA 1RAAB 4LF7J 1WKLA 2RRNA 1VQ5S 2POKA 1RTIA 4NXNK 1FXXA 2XSJB 1C0FA 1NG9A 1NNEA 2F4VK 3AODA 5AFUH 1IKXB 2KO1A 2BUNA 2K7JA 3M1FA 2DEJA 1XMQK 4OFZA 3ZO7A 3R7NB 2ZBCA 3CNQP 5A2QY 4NYPA 4MAKA 2JC1A 5FPEA 1R7IA 3WNGA 2OAUA 1RT5B 2VZ9A 4ETXA 5HSPA 1BI4B 2BR0A 3RW6A 1H6KX 1VLOA 3M8ZA 2KFNA 4IQMA 2FBTA 1HYSA 4OX9K 3D6MB 2CDRB 4YOWA 2DH9A 4B1YB 3IGNA 4ZVRB 2OANA 1EX8A 2IY5B 1LOUA 1D4XA 4FN5A 5FIIA 1YBAA 3LDSA 1T03B 5B09A 2G2OA 3NOCA 3RAQA 4DWIA 3Q8YA 2C3UA 2UXBJ 4BR9A 1BQMB 1MWMA 5AR0A 2L3MA 1NAQA 4CLLA 1UFLA 4DCJB 1FFSB 4B3RK 3VEWA 1HBOA 1SBRA 4B3TK 2P6TA 2X78A 1RWOB 2D0BA 3K8WA 5FROA 4U8YA 5KFFA 1RNHA 1JXLA 4ZTJA 4IO8A 2P5VA 5KFWA 2ZUAA 3MDQA 4QYZJ 3TZWA 3FZKA 2YNGA 2W6KA 3MXJA 1ZAVA 3SCJE 2V63A 2WFBA 4OPJA 4FZYA 3HXMA 2ROPA 1CBKA 3NAEA 2KZZA 4OMFG 2RUGA 4X65K 2B4PA 2XMWA 1HNWJ 1S1UA 1S49A 1RTHA 4AFFA 3NNCA 4OI6A 2LP4A 3BGFA 4PPZA 2EBEA 3FFIB 1VQKS 4CVNE 1AA1B 5DGAA 5KQ8A 1JLCB 1U6FA 1OY6A 4KTQA 1N6QB 3DYAB 1IJFB 3X3UA 3D0GE 2BJ3A 1YWXA 2UXCF 2LQ9A 3N6LA 2O8DB 3IP0A 2JGUA 2DISA 3IC1A 4CK1A 4USMA 4A2BA 2GZOA 2AV5A 1L3TA 2V2VA 1YJWS 1T02A 3V6DA 2O8BB 3NE6A 2FYXA 1QSSA 1RHUB 2QGFB 3LOUA 1E6YA 3K5NA 3OSNA 1NLVA 2JH3A 5E3RA 1OYEA 4M5MA 2X3GA 1V9OA 5DQGA 3AARA 3S7RA 4ZP8A 4NZ0A 2B8QA 5LM7E 2IMWP 3I5BA 3DHXA 4EHTA 2E2QA 3SQGA 3MOZA 1XNRF 2F4FA 2C42A 1G3OA 1K1SA 7FDRA 3ILIA 4N56A 3LH2S 3G4SS 5T41A 5GADU 1A5WA 2DY9A 2WVCA 4EBCA 2GEMA 4OVLA 3VQAA 2KT5A 4BBYA 1D0EA 2D0AA 3Q8UA 4WZMA 1HPMA 2EFOA 3CETA 4ECSA 2W4CA 2RSQA 2M7SA 2HF3A 4LSNB 2G8HA 1TMJA 5RUBA 3MM6B 2HSEB 3W2VA 1IQZA 3E1YA 4P52A 3QO9B 5MAOA 3SJHA 4WU3A 5HO4A 2YI1A 5F0WA 4UQGA 4DDFA 2RHKA 3S3MA 1GLDG 4DV2K 3PV8A 4QR1A 1A0OB 3ZZRA 3HZ6A 5ETKA 4U67L 1M90T 1YJRA 4LRDA 1ZBHA 4C4WA 3VCDA 5AQYA 3GTYX 3D6TB 2ERRA 5L1JA 4JV5J 3HMJG 4DV3J 3Q24A 4EEYA 1ACMB 2FLPA 1D9AA 5B08A 4FZXC 1BGXT 1RBUA 1LAWA 5FPDA 3ISZA 4B1UB 4NLXA 4N47A 2DB1A 4J9NA 4ZP6A 4DU1A 1U1QA 4CJUA 3EGVA 4GMKA 3LP0A 2WVDA 4QS9A 2Q1NA 1Z26A 2OEMA 1SL2A 4C11A 5TKWA 1Q1KA 2O01C 4FOIA 1NGGA 2QV6A 1HI1A 2DGOA 5ETSA 3O5TB 2CQ4A 4RR5A 3DXBA 2CJAA 2QFIA 2JZ5A 4CP5A 2HBQB 3S41A 4WFBQ 4CLZA 4C8YA 4KSEB 2JVOA 3A1YG 2HVZA 2YWEA 2PD1A 2VDIA 3VAGA 1YJNN 1C4CA 1M5PC 3AVNA 2OPSB 1C1CB 5LY3A 5CY4A 1R31A 3HOTA 4OJ1A 3SUQA 1AT1B 2ZVIA 1YJTA 2KJWA 5KT3A 1U1OA 2VFUA 1FDNA 3K0SA 3KD5E 4CBXA 4B3MK 4EZ9A 2KW4A 1HR0J 3D1OA 1ASVA 2WTUA 1ZPWX 4B1ZA 1LEOA 3NAIA 3O8WA 4KE5A 4N41A 1RAEB 1YIJN 4NYFA 4U8VA 4W98A 4HUGA 3OYCA 2VBWA 2DFEA 2ITGA 1BWFO 2FY8A 2V52B 2OD4A 1KD1T 4OJGA 3ELHA 3SMSA 2F8SA 1HLUA 1WOSA 2ZZTA 3GL1A 2A3JA 4U7BA 3OVNA 3T19A 2RU3A 3HYFA 4A57A 2JDJA 3CD5A 1SL1A 1CLFA 4DXLA 5DDPC 4PKIA 4YQWA 3OUYA 4A8YA 5AXKA 3PYEA 1FJEB 4CJQA 2PMZD 3OR1A 4ECXA 1K9MT 1KCFA 3D2EB 3OL9A 4LY7A 1RWWB 1TKZB 2PO4A 5AE2A 4E2FB 1QQMA 2VGNA 1YAGA 2V50A 1DURA 2PBDA 1EETB 1JLGB 4ECVA 2WONA 2L9WA 2L9DA 4IJNA 3PSIA 2A2CA 3OYBA 1ZH5A 2B6AB 3HBTA 1PKUA 4XAKA 5CD4H 1KRPA 3QBCA 3ZX2A 2NZTA 1Q81O 3PO4A 1OKJA 5D77A 3MD1A 5EUHA 4LH4A 5D4OA 1IH7A 1M1GA 3R3LA 3ATVA 3J7A1 1XR6A 3ZSOA 5A8RA 2QM1A 5AFUA 5C24B 3BDEA 4FJLA 4DR5F 4OHWA 2QWLA 5KPTA 1FKPA 4DTPA 5IT4A 5M2PA 3V9XA 1N32J 3AD8C 1EP4A 4JI2J 4ERDA 1IG9A 3FMBA 4EYIB 2MZJA 2ZWOA 5CH7B 3K5MA 1WLJA 2QYCA 2YWKA 3RB4A 5C42B 2OTJS 1J5EJ 3RMAA 2MKHA 1RAGB 4TY8B 4XO0A 1WC0A 3D0IE 3T1YF 1BU6O 4QS8A 3M3ZA 2FVCA 3U4LA 1S1TA 1IBLF 1TKXB 4WJBA 3AA5X 2QTWA 2XSJA 3B54A 4Q45A 1B4SA 4JI6K 1M90O 1IKXA 4Q43A 4B9NA 1TYQB 1FT8A 2NUHA 2I7NA 2FC8A 2YKOA 2AD9A 2MLXA 1FRJA 5F8MA 4GV6A 1RT5A 4K0KJ 2Y1IA 3BQ2A 3RGIA 1BI4A 2VA3A 4X64J 3GLJA 3IFEA 2KN4A 3EL2A 2IM2A 2IRXA 4YOUA 2XO6A 1WNEA 4WCEL 1QM9A 5JVHQ 2NRVA 1TP7A 4KJIA 4DZ6A 1X5OA 3DRYA 1CQNA 2R7UA 2D0CA 5GMEA 4ES2A 3KWMA 4K43A 2VPYB 1T03A 3QFUA 1BQMA 3VF6A 2LA4A 4K41A 3CDWA 5KGXA 1VQ7N 1QLNA 2HNZB 3H20A 3QB0A 2DCUB 2PI5A 2CPFA 2VASA 2QL9B 2HZCA 3B8AX 1C2PA 3RYLA 4M94A 4EAHD 4FYVB 1SXLA 3HFZB 2OUGA 2WCXA 4CNZA 2E2OA 2JJ4D 5D3GB 3QETA 1S5ZA 2HBJA 1FJGJ 1RDWX 1GNKA 1SV5A 2CZVC 4IJAA 2GELA 5KI6A 1WHWA 4R0JA 3LPYA 2JLGA 3ZNUA 2QMWA 2FGCA 2BRKA 3P5TL 4USVA 4BRDA 1KS2A 3SCKE 5CA5A 4JK9A 2XMUA 2XS2A 4E7IA 4LF5K 4C8ZA 1VQ4S 4QWEA 2DJWA 2FHJD 2AW0A 4FPIA 3KHLA 1QTNB 3TAFA 2DR6A 3IMXA 4MO5A 2H1YA 1QHAA 2BJDA 3M8QB 5KFLA 3O44A 4DUZJ 2KYZA 3VQCA 5KG0A 5HRRA 2V34A 4DL0C 2IC3B 1M5KC 2QC3A 1G15A 1XMQF 1WD6A 3U1LA 2GMHA 5KFDA 1OY8A 1VSMA 4DR2K 3FFIA 3D7EO 5FD1A 2D0OA 1H2UX 3VVTA 3J81U 1JLCA 2YH0A 3DYAA 5J2QB 3OYEA 2HHVA 1FEEA 1L3KA 5BR8J 5ETNA 1GLBG 1NSKL 3UNYA 5A0YB 3QYYA 1BD6A 2O8DA 2O3DA 3KKFA 1YVUA 1R0BG 1QJHA 4OX9F 3EPGA 2OCEA 3FRYA 1TR0A 5GADP 3M30B 3SFGA 3TANA 2E1PA 4V19J 3KLEB 3NGKA 3V6KA 1X4DA 3UDVA 1JIHA 3ENWA 2H4WB 2O4GA 3GWCA 4CD3A 3QNOA 3H25A 3K7RA 5ETQA 3CC4S 2CG4A 4BE1A 2NLWA 4PG5A 2G0CA 4Z0UA 1GOBA 3GPAA 1VQPS 4ID5B 4DI6A 4MYTA 2IPOB 2QRRA 3OVBA 1LXNA 1ZM2A 1Q7YT 3NF7A 4UT4A 2CZ4A 1T0TV 2H3EB 3BR8A 2OTLN 1ZTWA 4B3TF 2CPHA 1RHMB 2M9KA 2NSBA 2OO4A 1LQ9A 3HL8A 3HSCA 3BZQA 4M3ZA 3CJ1A 5H9EJ 4DTSA 3GIKA 2XLKA 1JB0C 3HZGA 1YXQA 1H7XA 3A2FA 3AJ2A 4BCAA 1BQNA 2GO9A 3VALA 3UCUP 2HK2A 1NK0A 3FBBA 1W7WA 4E98A 3P5JA 4WCEQ 1FE0A 4ZITA 4JLHA 1OPZA 4YB7A 2A10A 3VAMA 3QO9A 5KPRA 2D4WA 4NYOA 3DXMB 3DGPA 2PAVA 2PEBA 4FOEA 4H0TB 2VC0A 4C48A 4FS1A 3ONQA 1FTCA 1F9HA 1CZ9A 1F3VA 3WNEA 4ISFA 4CK2A 5BR9A 4FLXA 1EAYC 3GZ7A 5IOLA 5C15A 3M6XA 4JOUA 1FEHA 1JLFB 2AF6A 4TYAA 3MPVA 3Q2SC 1Y9OA 1VSDA 2LFVA 1DT9A 1J27A 3ZX3A 4QQBA 4Q8FA 1R6YA 2Y3YA 2JFDA 4RUAA 2WZ1A 1NKCA 1E6VB 1X4HA 3B6BA 1VIXA 3OW2R 1K0TA 4ELVA 2FVQA 1RP5A 3BSAA 3CIMA 4CO0A 5BJRA 1MW7A 3GSIA 4DV7K 3ULDA 1OSCA 1NGIA 1GMVA 4GW6A 3MN9A 1PGZA 4ECQA 5LMUK 4CHYA 1C1CA 3KDNA 4A61A 2UV8A 1FX2A 4IRCA 1S3XA 4WE1B 5KFKA 5DDOC 5EWGA 3C19A 2Z2LA 3MD3A 4DSEA 2FLNA 5J2NB 3DLKA 3GDQA 4OJHA 4NLDA 2UUCK 2BM0A 3O08A 1OVYA 2W9BA 2BKNA 3HTVA 2XMTA 1IBKK 5CD4A 1HD0A 3AO2A 2ZUGA 4MLHA 4HYKA 3FQKA 1WG5A 2KXFA 4RCHA 3DXSX 1I3OB 2DGXA 5D0EA 4D3GA 1HL6A 5MLCQ 3R5BA 2SXLA 4M63A 1KONA 2PFDA 3SSQA 3A3OB 4J9RA 3RB0A 2DPNA 2QG9B 4QW8A 3QEIA 5KOWA 2MPUA 1KHWA 3MMJA 1RWMB 3D2EA 3CJ2A 3VF2A 2H5JB 1NSQA 1EQMA 3VENA 4DV1K 4AQYJ 1XR5A 3GP9A 1TKZA 3ILLA 3SDEB 1D9DA 5E5NA 5JLHA 3J8AA 1EETA 1JLGA 2RHQB 2W6LA 3CJBA 2WOMB 4CF8A 3AA2A 4FWQA 3BKUA 2RMLA 4BC2A 1DGKN 2NSCA 1NWKA 3TSUA 4ECZA 1OVQA 3HVWA 1Q7YO 4LFCK 4JKAA 2VFSA 1FRMA 4FPBA 4TLRA 1VC0A 5SUHA 2CJBA 4CERA 1F0XA 1CJVB 2VODA 1YI2S 2WUSA 3CCTA 1O1WA 3QEPA 5C24A 2Z56B 1FHTA 4B8AB 3MCPA 1ZA1B 5L1KA 1UZHA 5ELZA 2VHGA 4KH4A 4F02A 3MCNA 4B3SK 5F3TA 5G4DA 4DV4K 1P8GA 4DFMA 2DTJA 2YTCA 4NASA 5LJVA 2O8FB 1Q8LA 1KEKA 2M52A 4IOAL 2V9KA 1TFYA 4G1QB 4B3MF 5C42A 3CMAS 2IVMA 3BN4A 4KHPJ 3TOQA 4JKHA 4JKFA 4TY8A 4Y34A 1FDDA 2K1RB 2IM3A 2CQ3A 3QJJA 2Y8WA 2LECA 3J80Y 2P9PB 2Y8YA 2PMWA 3I8DA 1TKXA 4CJEA 1JLQB 3L4QA 4JD2B 1IBMJ 3TYTA 3EXCX 5AQNA 2CPZA 4IDKB 1SC3B 4HTJA 3HD1A 1QAJA 3VGMA 4IOBA 3E3XA 2RF2B 3UDEA 3NGZA 1VOMA 1M1KT 4OKKA 5L1IA 3DI6B 4C3KA 5E33A 3G8QA 1QSYA 3P4IA 1VK0A 5DG9A 3CCUN 1UMJA 1Q5VA 3DFEA 5AQFA 5B0AA 5EU7A 2I9SA 2LVWA 3UD4P 3LP1B 1VQ9S 3GV7B 2J7KA 3J7AP 2LCWA 3C6TB 3T9NA 3GYGA 1WC6A 1HWJA 2GV1A 2MHEA 3VN5A 3C14B 1HRHA 1HBMB 2HFZA 4N76A 3VGTA 2IDEA 2AYEA 3TEGA 2BDPA 1VBKA 3CCQN 1VBZA 1IKWB 2CYYA 2HNZA 2NR0A 4WQ4A 4BRFA 4LF8K 3SQ0A 5IWAK 1FWPA 5EVZA 3BREA 3O3FA 1VJWA 2CQGA 4KI6A 3BF4A 1GLCG 4DUTA 3CB4A 4EWTA 2DGUA 2ZOFA 2XNRA 1NGEA 3TA2A 4CH1A 1W2BR 5BYSA 5AJ3K 1JJ4A 4J9OA 2R2SA 4AXIA 2RPIA 4AF1A 4K8XA 2WBRA 4AHVA 2L08A 1T9WA 2BM1A 2M70A 3FDSA 4QOZB 1ZC6A 2Z58B 3H40A 4PG4A 5CR4A 2EX3A 2J7UA 1VQOS 5IT9Y 3DLJA 1VQMN 4RUHA 2RRAA 4JI6F 5LJ3Y 1I94K 1HPZA 2EK1A 2IC3A 1F9FA 3VEYA 1NGHA 3H1VX 3KUEA 3H3NO 1WB9A 2VWJA 4I64A 3T69A 2HHQA 1CEZA 1LXJA 3RMCA 3D68A 1QE1B 4KAZA 3DMJB 1N33K 3G87A 3VQBA 3MXMA 2GO8A 4A47A 2GJIA 5J2QA 4C8KA 3F9MA 3C6AA 2UUBK 2MYFA 4G1IA 2FLLA 3ZTQA 5A0YA 3I5AA 1MWZA 4JP8A 1NB2A 2WW8A 3TVYA 4DS5A 2VGMA 4ZVQB 2BE2B 4FJXA 2DGQA 4CZEA 3KLEA 4QIEA 3JSRA 3PCOB 4NEZA 2BQUA 2D9PA 4Z7YA 2H54B 3OJUA 3I55N 3PLAA 4ZPDA 2E9RX 5C5JA 3D54A 5HRSA 1OQ3A 1KAZA 4KH0B 3SFUA 2RHSB 3FRZA 3CCLN 3NLCA 3V4IB 1Y5IB 4NLYA 5CYQB 4ID5A 1IBCB 1MN9A 1F6TA 1G1XA 2ZF5O 4CLFA 4BC7A 5L39A 2XYPB 3WQUA 2MMYA 2BA9A 3BYPA 3O4QA 2BKPA 2OEKA 2IRUA 4IFVA 3MZIA 2ZQBA 4ILHA 4TKTA 3WBZA 3TVKA 3L3UA 5LMNK 4WK3A 5IM0B 1HIYA 1W9HA 1X4AA 3VGSA 3QRQA 3CF5L 1MDUB 5BRHA 2BEFA 4LF5F 4MKVA 4J9PA 2OELA 4CT8A 2VQFJ 2Z1HA 1NK6A 2QYGA 1QZ6A 3JQJA 1YBUA 1M1KO 1VSIA 4FJ7A 2VJUA 1HFEL 3DXMA 5EHHA 1KSPA 2G0JA 2D7SA 4NLUA 2J9EA 3LDNA 4QPXA 4P2MA 1X4CA 4GVBB 3R8YA 4E8UA 3G2XA 3C7NA 4DR2F 2E29A 3MPUB 2BACA 1FF2A 1K8AO 4JI8F 1P8ZA 4KY3A 5IV3A 2AMCB 5CYMB 1RYRA 4F2RA 3SYZA 4USKA 4QZVB 3KHRA 5F9NA 3OYDA 1JLFA 3HP6A 1WKKA 3D6HB 2U2FA 4G3IA 2J76E 2I38A 4JYAK 3PX4A 4HHJA 2JFKA 2NXUA 3DOMB 5B7WA 2COLA 4C97A 4QS7A 4C98A 3TAPA 3JSMB 1E6VA 1NDLA 1TQLA 2XY6A 2VQEJ 1P9YA 2P1JA 3TTCA 4CK3A 1H74A 2QWOA 1PYSB 3J80O 3ENQA 5ETPA 3L2RA 2RIJA 3FEZA 5K9FA 3VEVA 4DV5J 3DLEB 3M8RA 1WC3A 1RAOA 3KJQB 2V0NA 4NL5A 3I82A 1RDCA 3I0SB 2KH9A 4ILGB 3K9JA 1RTJB 3IAM9 4BRKA 1CG2A 1XNQK 4B17A 3W7BA 4DOZA 2W41A 3OBWA 5EY4A 3D6RA 3I0RB 5D4LA 3RBXA 4WE1A 4ECTA 1ZBFA 3PYGA 5J2NA 2AA4A 3QIDA 1X4GA 3RR8A 2KZMA 3EZUA 2FHJA 1NMEB 5AQOA 4XH4A 1PAUB 1S6PB 4Y00A 2MQNA 5GADI 3VPZA 4LBPA 3DNCA 2UP1A 1NGDA 1QUVA 4ELUA 2XZTB 3ENHA 1X1PA 1ZTTA 2ZH6A 3NP5A 1U49A 2QWRA 3JB9k 3CT9A 3H0PA 1BUPA 1QSLA 1KFSA 4WZQA 4NCGB 4CLSA 2KXNB 2EK6A 1LOTB 1E3MA 2MB0B 3ASMA 2KXHA 1Q8BA 3PX0A 3EVWA 3FBFA 3O2IA 3BGUA 2HPUA 3QNNA 4BS2A 5ETLA 2W9AA 4F4ZA 1TL1B 4JV2A 2DNLA 3JQKA 3ZSRA 3AO4A 4DMNA 1HW9A 1IWGA 5H1SQ 2EG1A 1FFWB 1OPIA 1Q95G 1BISA 2V67A 3WEEB 3DCAA 3I87A 2YHAA 1H38A 4ED5A 3M2VA 2ZWPA 4HACB 4FJKA 4CEZA 1JKHB 1KDNA 1J6ZA 4FO0A 4CM2A 1NM2A 1RGIA 4QPTA 3AGKA 4Z4FA 1XC9A 3H5YA 3TQ1A 3D1HA 1CJVA 4DV7F 1CJUB 4OI1A 3DAWA 3TTFA 4I2PA 2X6NA 1JJCB 2ZJPQ 5LMUF 3THWB 2ZBRA 1IR2A 4KT0C 2QX0A 1QQOA 1SC4B 1GX6A 3BPDA 3ZLJA 4G1QA 5DK5A 5D0GA 2VKZG 3PW7A 2UUCF 2VIHA 3IXQA 3MMAB 2K1RA 2P9PA 1VQ8N 4KHYA 1X8DA 2O8CB 2KLAA 1JLQA 4JD2A 3MK6A 2HHHJ 2J4RA 3THYB 3VHQA 3H98A 4DL5A 4IDKA 4CF1A 3SAGA 1UETA 2ZKUA 4NRUA 4V19X 1DTQB 2RF2A 2UUAF 5KFYA 3CCEN 4CGIA 3R7BB 4E7LA 1DHMA 3EO3A 3PRDA 2YKMB 4FJMA 2GMLA 3DGVA 3ZT1A 3KK3B 3DI6A 3ZZUA 2ZHBA 4TU7A 3HVRA 5AXMA 4OLBA 4DV1F 1YJNS 2E9ZA 1KOHA 4B1WB 2A0FB 4JI5K 2AQ4A 3OYAA 1B64A 2BABA 1NPRA 2CPIA 3LP1A 4KHMA 2KTQA 2RB7A 1DY3A 2N7CA 3C6TA 1TTHB 1XHZA 2HAIA 4LC9B 3OFFA 2O5DA 4FYXB 2B4JA 2ZBQA 4LFCF 3OYIA 4LF9J 1HWUA 2DFHA 3C14A 1WOQA 3H5SA 1HBMA 1IV0A 5ETVA 4IKAA 4IZ9A 4X4QA 1YIJS 2BXJA 2OFHX 1RT1B 3GFHA 1KC8T 2VG7B 1NMNA 5KFCA 5KFOA 3PYDA 3FUYA 3ZSQA 2VICA 3EZ5A 5DZ7A 4B3SF 1SB6A 4DV4F 3LDOA 2ZJRL 2FJBB 3LAKA 1RTZA 3HPHA 4YB1P 5BPMA 3OXGA 4ES1A 1YLXA 4JI0K 3BSNA 2IIHA 4WK1A 1S72N 4MKBA 1A5XA 1U45A 2LSNA 4LMZA 2E7XA 3DM2B 2HS0A 4HI2A 4YOEA 4MH8A 4BE0A 4HR2A 4JI4J 4X62F 4A62A 4YY3K 4XPCA 5AQQA 4FF4A 1JNRB 3D6FB 3V2UC 3J81j 2AZ1A 3GR0A 2UXDJ 2BJ1A 1WOPA 4NZ6A 5DG7A 2DNPA 1TUWA 1HHQA 1Z2LA 5CAAA 1QE1A 3DMJA 3OY9A 1N34K 4DS4A 3PTWA 3THXB 2V4QA 4DV0K 4C8NA 1IG8A 2KVIA 2BE2A 3M9MB 1V4TA 2B5JB 3L3VA 5KT5A 3UN3A 1Q86O 2NRWA 1XR7A 1M5VC 3AVAA 1U09A 4I6MB 4L76A 4DHVA 1HNIB 4KH1B 5CHIA 4I69A 4NLQA 2IYIA 2MKSA 2NNWA 3LWLA 3OTOK 5JLFA 5GAHI 3V4IA 3HKWA 1GLLO 4FS2A 4N8OA 5CYQA 4CJ4A 2MZRA 4DMZA 4LF8F 4RO0A 3O9RA 5IWAF 4CEDA 3CD6N 5DG8A 5LSRA 3PXGa 4BR5A 3DRSB 4NLRA 3C94A 2XMMA 3ZTSA 3I9V9 2AT1B 1R0AB 4FYDA 3VQ5A 3UW1A 1BHLA 4AE5A 3CCSN 2E5LF 3LALA 3UKUB 5IM0A 2HEKA 4FVMA 3KKRA 3KHGA 2ZNYA 3H59A 2AKWB 5A8WB 3QFPA 1TZ0A 2BQ3A 2GCFA 5I42B 3MMBB 3V6JA 2LEAA 3I9ZA 1NDPA 4QBUA 3VAFA 4DV6K 3CPEA 5M1OA 3GE9A 3HJVA 2ZBIA 1I94F 1XN9A 2BW2A 1RHJB 2JLEA 3QZ8A 2O4IA 2DNOA 2KU7A 5IZHA 4FWOA 1ATRA 3O9QA 3F2KA 4J2EA 4GVBA 2IA6A 2QZ8A 1KQSM 4KQZA 2VV5A 2NPFA 4DL4A 1DZ5A 1VQ7S 2CPYA 5CYMA 5HL7Q 4X66K 4FNHA 2UUBF 2R7RA 2DO0A 2PY5A 4KPCA 3MCSA 5I3QA 1TVRB 3SUOA 1WBDA 4F0KA 4KHWA 3DOMA 3RBZA 3ZZOA 2ZM6J 4QU7A 1JX4A 4KRFA 3JSMA 4ED7A 4GMJB 1VLYA 3QEXA 4OHYA 2FF6A 1KC8O 2QIFA 4KAIA 6FD1A 3S3NA 1H98A 1XMOJ 4FLTA 5BXIA 2UU9J 3H08A 4RNFA 2X74A 3HOSA 3RRHA 4Y0WA 3C6UB 1KLNA 3CE8A 1EB0A 4GKKK 3DLEA 4KPYA 2QWMA 2ZC3A 2KL8A 5AQVA 4NRTA 2R8JA 1RCOB 2Z0GA 3DLBA 1RTJA 4DL2A 4F3TA 2ZDPA 3MEGB 3GOIA 1HNVB 4NXNJ 3I0RA 3A8KA 2W7PA 1VAZA 2GGPB 1WWHA 2F4VJ 3OL7A 5LMNF 3MOJB 2AJ4A 4CHNA 3SXLA 5TKYA 2FJDB 2G0IA 4DPOA 1I5OB 4X4VA 2DITA 1XMQJ 4CW7B 2XB2D 5D4NA 3JSBA 5LL6Z 1QVFM 1UPPA 4PZVA 2PSZA 1S6PA 4QWDA 3MPDA 3T5HA 3D4JA 4ZHRB 2GHVC 3IAS9 4DSIA 3LF0A 1U1NA 4DR7F 5BYRA 1Y64A 1UJ5A 3HT0A 3L95X 4CEAA 1H72C 2WVEA 4NCGA 4DR1F 5CYJA 4KO0B 4NA3A 1S99A 2GUPA 2NXNA 5L38A 2H4YB 3IAYA 1HWKA 4JI1J 1NLKL 1TL1A 5HRPA 1LWFB 4YDDB 2OTLS 4J5OA 3AVGA 3QJPA 4JYAF 3T9ZA 3RBEA 4B3RJ 4HACA 4B3TJ 1I6JA 3R1XA 4C1NK 2HQ3A 2MZSA 2NYHA 3HX9A 5JMNA 4LF7K 2W7OA 5F8LA 1UVNA 1YJUA 3MCAB 3PJXA 3B82A 2HHPA 4BC3A 1UWAA 3SV3A 1CJUA 4PHTX 5BRDA 2UUWA 3HHLD 3W9JA 1XK8A 1UOCA 4KC5A 1YJ9S 3THWA 2YJEA 1XNQF 1J9AA 2RH3A 2D3O1 4X65J 4JRQA 5DETA 2OSQA 1SL0A 4CHZA 4M63C 3WNFA 4RX6A 2C2KB 1ZZNA 4CZHA 3OTBA 5HVGA 4I56A 4NLBA 2BQRA 4IOXA 3B6PA 3MMAA 4J37A 3SZ2A 1YK9A 4PQUB 2RQ4A 1SS6A 4DG1B 4NXMJ 4C7QA 1BC6A 2F9TA 3ZNJ1 4FWMA 2P9SB 3ZC4A 4MMOA 1KNZA 2P9EA 4CZFA 2O8CA 3SLCA 3CHWA 3N79A 3H46O 4PABA 3TQEA 3THYA 5KFXA 4ZK7M 4B8CA 1SQEA 3KKSA 2CA9A 5C25B 1DTQA 4A48A 1OQ6A 3CJKB 2CPEA 2MZTA 2K7KA 3MM5B 1FTRA 5M2UA 2XY5A 1EQYA 3KK3A 4AM6A 1H3DA 2M88A 3OYMA 3ZSWA 1WEXA 4TQSA 1X9SA 4B08A 5K14B 1X5SA 1RSCA 2XTJP 3IKMA 1O5JA 2NCKL 5ETMA 5DQIA 3C16B 3Q23A 1N8RT 4IOCL 5HBMB 2CNNB 4AD6A 1L3UA 4AUKA 2VG6A 4ED6A 1TUVA 2Z1GA 3K89A 2VUGA 2XMAA 2Y1LB 1Y00A 3BH6B 2OLWA 3M4XA 4IO9L 2QLBB 2QWPA 3FLCO 3RJMB 1HNZJ 1FNMA 2E5HA 3CJ9A 3PR5B 1RT1A 2B9XA 3US5A 4ZVUB 2FVSA 2VG7A 2ILYA 5KT4A 2ATLA 2VOOA 4FXWA 1WSGA 5JS1A 3CCJN 1T9VA 3UE5A 3A4TA 2KDOA 1QVGM 1H0HB 3KNGA 2OFGX 1KAXA 5IXUA 4DFKA 4DV2J 3QMLA 4F2SA 3DM2A 2F9JA 1RHKB 4ED3A 1VHFA 3PO5A 3L0QA 3OTCA 3R1HA 4OI2A 1MROB 1GTHA 4GC7A 2M4MA 2ASMA 1VDHA 3MPYA 4U7UD 1SKSA 4CBUA 3R97A 1X4EA 3BF3A 2DVIA 4NLVA 1R8PA 3TX0A 1T11A 4CWBA 5IFMA 5KFGA 4BGBA 3GYNA 2BRLA 1AZSB 1V6HA 3JTNA 3R2CJ 4EP4A 4NX9A 1JJ2M 2JOQA 1DAXA 4HVZA 4WQ4C 3AGRA 3THXA 2VPZB 3U3YA 1NK7A 4FVUA 1KQGB 4OZ2A 2Q3SA 1R59O 1B7FA 4Y1DA 2JSXA 5F2RA 2B5JA 2E5JA 1JLBB 4Y1CA 3QFWA 3KHYA 4I6MA 3SSSA 4USUA 1NBEB 1RWPB 4WYLA 4CDIA 1HNIA 1GK8A 2HHXA 1MMDA 3OVAA 1N5SA 1A5VA 3PUFA 3HHLB 3U1MA 3LW5C 5KT2A 4OGCA 4DX5A 4BDYA 2MLYA 3PW4A 3BF1A 2RD5C 1ATSA 4ZS6A 4OQJA 3VEZA 1BIZA 1R27B 2AGPA 3DRSA 1N5YA 2HW3A 4Y2IA 4BRLA 3M05A 1R0AA 5C12A 1VMBA 4DL6A 4JI0F 3SCIE 5ITHA 4HUEA 2E1RA 4C8OA 2DHHA 3UKUA 4JV5K 4DV3K 1X60A 3CI5A 3HVAA 3N28A 4M5NA 2G8WA 4HDHA 2YKQA 5A8WA 3OYLA 2W4PA 3H5UA 5F8GA 5I42A 3CCUS 1Y3KA 1HYVA 2W2QP 4F26A 3OL8A 4YY3F 4IOCQ 3PEJA 5DMRA 1YRXA 4CLUA 2EHGA 1PO6A 4YR3A 4IO9Q 4FSVA 1YTUA 2RAQA 2MDAA 1O51A 3KMQA 4KGZB 4NA1A 1YT3A 1BMQB 2HBLA 3VOVA 3I96A 1N34F 5IC4B 1BWVA 3NL0A 3CCQS 2LEBA 3KJVB 3MECB 1N8RO 4DR4F 2PYLA 4FWKA 5GIOA 1R8AA 1FO1A 2MKIA 4X84A 1Q9XA 4CHQA 3ISND 1TVRA 3T3FA 3CIZA 2NXEA 2IMOA 2XCPA 2ZDOA 2F7VA 3MR2A 3RWUA 4I1TA 2EFQA 3G6VA 3IR7B 1XNRK 1VISA 3R5CA 5FRMA 5C0YA 3HM9A 4LSZB 4H5NA 1B0VA 4MJKA 2R2TA 5JJBA 1FJ7A 2QT7A 3MN7A 3W63A 3C6UA 5HATA 4CJLA 5J1EB 1RU2A 4NE9C 2KQ2A 4QAGA 1NOYA 3I8BA 1VQMS 3IO1A 8AT1B 2Q2RA 2YKAA 3JAMU 1UEVA 3EE8A 2M2BA 5KOXA 4CO5A 4YHHJ 1JXBA 3E9LA 3MEGA 2ZJQL 1HNVA 3X1LB 1WHYA 4EFAC 4GV3A 4J9UE 5DDRC 4JI6J 3EKSA 3KLGB 4XDDA 3I56N 1UEKA 2RN2A 1XEZA 4E0DA 1T6CA 3F44A 4K8ZA 1EKEA 1PYOB 1S4FA 4UOGA 2QWNA 2B9EA 1I51B 1SQKA 4DV6F 1TAQA 3NH2A 1CSJA 1S7HA 4ZHRA 4ER8A 3ID8A 3NGYA 4CFBA 5JXSA 3I55S 1HNXF 4KO0A 3RB6A 4Q0BB 5F8NA 3A12A 3W1YC 3CCLS 2APOA 3P49B 1MA9B 3AT1B 1U1PA 4G9ZA 3R3TA 2J8AA 1S59A 1GH8A 4X66F 4YP3A 3IBFB 4BWMA 1JCFA 3J81O 1LWFA 1N32K 4PL8A 5DM7L 3JXOA 4QOTA 4FW1A 5KFVA 4J2BA 4J9LA 1HQEB 2G8IA 4DSFA 2F65A 2R8KA 2ZBPA 3OHRA 3PEHA 1JK9B 2DNNA 3F56A 1J5EK 2VH7A 3ZT0A 1RKJA 1F9EB 1N48A 2OP5A 5BRFA 3RSEB 3B4MA 1S22A 1RBLA 4ANDA 1YTAA 4BQZA 4F0MA 3OYNA 2QA4N 4GKKF 5AE1A 1GMWA 5K20B 3D9BA 4GV9A 3UD5A 4LF5J 3GJQB 4FK2A 2G2YA 3P4UB 3NGTA 2DXDA 4QWCA 1BOTO 2ASYA 4LBIA 2HGLA 1FKAF 4BRQA 4DPWA 4Z4CA 3QJLA 4CI6A 1FNOA 1OIAA 4OX7A 4LT6A 2R4FA 5IS2A 1WELA 4ED0A 4YS2A 2EPIA 4RW8B 2IRYA 4DSKA 4ZVHA 4ZIVA 3ETOA 4K0KK 2KG1A 5F9LA 4MK9A 3VR1A 2AU0A 3ZEUB 4X64K 3TUIC 2BE9B 1W2IA 4F67A 4DG1A 1FXLA 2CQ2A 2P9SA 4PWDB 2IA0A 3BQ1A 2A40A 3ZETB 4PXEA 2Y9HA 2DR9A 3O4NA 2VPXB 2VF3A 4DUYJ 3CM6A 2GX8A 3QT6A 1H1VA 2BYCA 5C25A 1P1TA 1VR6A 3F73A 2KT3A 3CJKA 3MM5A 4M5IA 4NWBA 1HLWA 3EGWB 5HMYA 1S6UA 2LEPA 4Z4IA 3F5TA 3RG6A 4I67A 3CJ4A 4DHYA 3VQ6A 3SNNA 4WKYA 2E44A 1T9UA 3VGLA 2LMIA 2YV0X 2I8EA 3MM7B 3D5MA 5K14A 1OY9A 4OL8A 3J7AN 2MHNA 3C16A 2P8IA 2DNRA 3QT8A 5HBMA 3IDHA 3W5YA 3IUCA 4YOTA 4FKXA 2ZOGA 2CQ0A 4K4VA 3LGMA 4LF7F 4CZCA 1HMVA 1WG4A 4DPUA 5F8JA 3R6GB 3OA9A 4CGDA 1WHVA 4BR2A 4CHOA 1VIOA 2UZAA 3LL3A 2ZHOA 2Y1JA 1KVCA 3CDAA 3MN6A 2V7YA 4ETZA 3QWPA 1VQ5N 3T1YK 2XG8A 2XS5A 3FFKB 4DBQA 2G8KA 1IBLK 1A7GE 2YX4A 4F4XA 5DO2A 1U0SA 4FJNA 1GT8A 4BRPA 2ZE2B 2WK4A 3KK1B 2A41A 2HWHA 4DR3J 1FK9B 3DDNA 1LFWA 5DM7Q 2GW8A 2FF3B 3WXJA 3LDLA 3GSDA 1S76D 3I4PA 5CXTA 4UZBA 2AWZA 3W9IA 5C2FA 4QJVA 1MROA 1YVFA 4ENOA 2FJVA 2HOEA 3D1QA 4OI4A 1D8ZA 4W5OA 2DNYA 4PYAA 2WHOA 5B0DA 2DXFA 2F8EX 2KM8B 1K6YA 1C1BB 2YPYA 3L2QA 2ALZA 4D3HA 5JUMA 2V2KA 4LRCA 1LWXA 5AQUA 2XWYA 2I5JB 1JMTA 1AZSA 3Q0AA 2IVPA 5J2PB 5GAEU 1PYTA 3TW0A 1UWBB 3JS6A 4BRCA 4H5WA 4Z4GA 4ZCMA 1YGYA 4FK4A 1U2CA 1SZ2A 2JEFA 4I7FB 5CQGA 4AM7A 1JLBA 1C1AA 3IRWP 2XHWA 1NZ8A 1FERA 2YNFB 5EWEA 4WFZA 2AGQA 3H2UB 1TUGB 3R5DA 3GILA 3OV7A 2G9OA 2YH1A 4E1JA 4IG0B 2M5YA 2QKKA 3VGKA 1Q9YA 5LT5A 1HNWF 3OLBA 3M5RA 2RU9A 4IR9A 4Y28C 3UCGA 2UUCJ 2XMKA 1RTDB 3AB4B 1VQ8S 2HNDA 3IWNC 3OTEA 2RRBA 4DR6K 2HMIB 1V3SA 3DRRB 1AXQA 1OH8A 1IBKJ 1KBRA 4O5FA 3VQTA 3AVJA 4CZGA 2R7XA 2NS1B 3M8WA 1KVBA 3CCES 3D0PA 4WPAA 4H0PA 5HAOA 2EFPA 3OD2A 5F8IA 2MGZB 3U1NA 4FBUA 2WW4A 2XBPA 4JI3J 1SH3A 2D1CA 2HHTA 2WBMA 5E7OB 2R7OA 3PG9A 5M1QA 4LFAK 4C2MA 5DGBA 1D9FA 3CPWM 4JN4A 2MQQA 4WXWA 2PMHA 4DV1J 1U7LA 4HLBA 2D0PA 3AO1A 2FJEB 1PBUA 2MQMA 4AHUA 3H90A 3JSYA 4F50A 2GQQA 2YX1A 4OZNA 1B7YB 3ZSVA 4I6YA 2HFOA 1SKRA 2VA2A 2DNKA 4LFCJ 3K2YA 2V2QA 3KJVA 1X4FA 5AXLA 3MECA 1X31C 3CDEA 2QE5A 4EI2A 1JXEA 4WWSA 4TNOA 2UYTA 4AYBD 5EOYA 3KUHA 1KXPA 5FLXU 1U1MA 2EKNA 1XQSC 3V9SA 3GJSB 5T7LB 2BGGA 1ZBIA 4MT1A 3TA1A 4DV4J 1P90A 4NA2A 4AL7A 3FZLA 1SQGA 5KFIA 3PW0A 5M1NA 4DLGA 5HLFB 4PKDB 3ZSZA 5E84A 3H42A 3L2VA 5J1EA 3ZT3A 1KQFB 3PDNA 4Z37A 2R7SA 3FVYA 2HBYB 2ZITA 5HRNA 3E2EA 3S9HA 4P2XA 3WNHA 4CZLA 1I39A 5K8MA 2E1YA 5KG7A 4WFBL 3B4DA 3CDUA 4A8OA 3ATUA 4K4UA 2LLZA 3KLGA 4K2XA 1SH0A 3GQCA 2IJNA 4HI1A 4M3YA 5D78A 5D4PA 5HMXA 3M9NB 4JV5F 4ZVFA 3W64A 4DV3F 1PJ5A 3AD9C 4UF4A 4A4JA 4LF4K 4CO2A 4FWSA 3UCZP 5ADXA 2NREA 1NEEA 4CLWA 4WYWA 3W61A 2IIRA 2G13A 4K4XA 3A8IA 2KRRA 3AHPA 1FWKA 4CI0B 3E9OA 3SIPB 2J6SA 1GAOA 2HF4A 2PI4A 4ID1A 2X3DA 2YHYA 3CQYA 4LRFA 2F9DA 2DEIA 4K5SA 3M8SA 4CZKA 4WBFA 4IEIA 2HBRB 2J9DE 4ZVTB 4PYDA 5E3PA 2DR7A 1NM1A 4P75A 2Q3PA 3CSKA 3C95A 4JAXA 3V9WA 4JKDA 1HBUB 1HR0F 3CCSS 1YRTA 3KMSA 4EO8A 5C2DA 2J6TA 2WC9A 2E1AA 1O13A 1Y4ZB 3DRPB 2HHUA 1PC5A 3RSEA 1VRTA 2DPJA 2FJXA 4RL1A 5A6WA 5AJ3J 2FBVA 3EGNA 3H2VE 5G0RB 1NZAA 3GBTA 4M8LA 2W40A 2AEMA 3JXUA 4BE2A 4CIFA 5CE3A 1Z4UA 1C0UB 1VQYA 1V3RA 2BUPA 3D3BJ 2QFJA 2FSKA 3LQVA 4TVAB 3ALYA 4JV1A 4O0NA 4RNHA 2CWKA 1WDTA 2JEIA 3MEEB 2FGOA 1I94J 4I4BA 4RW8A 1OMSA 4HH1A 3VGUA 3CJ0A 2EG2A 4JUZA 3S3OA 3ZEUA 2Z1IA 2F96A 1X0FA 3BN7A 1HYZA 3G6XA 2D1KA 4RW9B 4Y2KA 3HM8A 2VG5B 2G1HA 1K47A 1N33J 3VQ9A 2IAJB 4X4RA 2V51B 4E1NA 2XEXA 4UUXA 4PWDA 1U47A 2CQHA 3ZETA 1AYEA 2UUBJ 4J9SA 4Z4EA 4AH9A 1S9GB 1SVDA 5CCMA 3NVKA 1IN0A 2XGQA 1X9JA 2UUTA 4FJJA 4OPKA 1N54B 4Q2MA 3ZXWA 4H0YB 3F0NA 2V8VA 4HHTA 3T6BA 5M1FA 2ADCA 1NKBA 5KFSA 4DKWA 4WP8A 4R5PB 2IBOA 1N32F 3WX4A 4GY2B 3MM7A 1NGBA 1T9TA 2PGCA 1MG7A 1C4AA 5AQZA 4PRFA 3CFRA 3OT9A 1PIEA 1Z1ZA 1OO0B 1J5EF 4RNMA 4HT7A 2WVFA 3NFAA 3TUZC 2HYIB 3J7YU 3O1LA 4L73A 1FRIA 1ZAXA 5LMNJ 5JVHL 1R43A 3CJQA 5L9XA 3D28A 1BXNA 3TTDA 1TL3B 1M5OC 5KFNA 1VRUA 1NJIT 5ADZA 1K73T 3OHAA 4C9DA 1FNXH 3SBTA 1JLEB 4LF6J 1KWMA 3O3GA 3EVOA 1AUDA 3MEDA 2A18A 3LA0A 4J2DA 2MJUA 1NK9A 4LQ9A 4ZJOA 4I9QA 2ZE2A 2FDNA 2J0SD 4K0KF 3TUPA 5GAEP 4FLYA 1JWWA 2GWKA 4C8MA 4X64F 2FHMA 2Q43A 4KTZA 5IT0A 1OH7A 4MTPA 4IR1A 2WSEC 4ECUA 3DC2A 4A5BA 4IO1A 4ECYA 1CVJA 5M2RA 4JI7J 2C3PA 4CGGA 4CJFA 4KB7A 1SC6A 4JYAJ 1FDAA 1GXTA 2AX1A 2G4BA 2YHXA 2I5JA 4DU8A 4NCBA 4CESA 1B3TA 1VHXA 3DU5A 5J2PA 1Y5NB 3NWGA 1WSEA 1HKGA 4Y6IA 4WTYA 2XYHB 1RU1A 4QYRA 3FGUA 2CQPA 2AHOB 4RBTA 1WSVA 3MAAB 1ZBTA 4RW6B 2MZQA 3LGNA 3CJ7A 4J2AA 4ZDNA 3FNNA 2X1BA 4I7FA 3DWLA 1C0GA 3BY5A 1TK5A 3K2PA 2QKBA 2YNFA 4FKYA 4RWWA 2ZH9A 2D41A 1JNZB 3N4WA 5THWA 4Z7CA 3V5RA 4IG0A 2H5IB 3KUGA 4CZJA 4I6WA 4DUZF 2VFVA 3M7VA 2QLWA 3GYXB 4H03B 3UFCX 1SAZA 1ITPA 2HMIA 1FD8A 3DRRA 1Y97A 3QERA 2XCAA 4E7KA 2B0GA 3CG7A 1BA1A 3VQQA 1UW9A 3LTOA 1S0OA 3HRGA 4CJ3A 5JICA 3SBGA 1YDLA 3AVKA 2Q6BA 1UVLA 2MGZA 1ELOA 4LRAA 5BR8F 2NRXA 4OYOA 3VAKA 2AP1A 4FXDA 3HSTB 3QZ7A 4ZIWA 4YNQA 3OYGA 1A9NB 1B9DA 5H9FJ 4P2SA 2LXFA 5B0EA 4BRNA 2B3TB 4F3OA 3UI3A 1YX2A 1WUUA 1WF0A 3UVJB 5HQLA 3V4MA 1BIUA 2ZNZA 1N36J 2HIYA 3GMGA 5GAHU 1N56A 2HRTA 2YX7A 2MQPA 2EFNA 3CJTA 4CF2A 5L8RC 4CEOA 4DTRA 4DV5K 5F1XA 3R6MA 3UB5A 3NWRA 1FVQA 1NDCA 3NBPB 3IS9B 3G8SA 2ACYA 2WTFA 1U04A 1DRZA 1RCHA 3QIPB 3GFYA 3CO9A 2EKYA 4UW2A 4OYIA 5K8NA 3HDSA 3U9ZA 4BRMA 2MSTA 4AL6A 3N01A 2RJZA 2Z2MA 2W4DA 4LREA 2UV8G 1HHSA 4M45A 2NXCA 1NJIO 2DGTA 4DPXA 3E01B 3B6OA 1K73O 2FZCB 5HLFA 3B78A 2EWSA 1IR0A 4EBEA 1X5PA 4OV6A 2GUIA 1ULRA 1KD1O 1D5AA 1FA0A 4CLPA 3AY0A 4CF9A 4DR6F 2CJYB 4H5TA 1T3NA 3M2UB 3E66A 3PNIA 4IFEA 4BY9C 2IVYA 2C2DA 4X4TA 3FEXB 5SZTA 1NGAA 3VV2B 1DTTB 5DM6L 1VQ6S 1IKVB 1ZBLA 1YJVA 1UJ4A 1K9MO 1B70B 1WEYA 3EWGA 1AUSL 3BBCA 4OIXA 3VEOA 4P2FA 1LNQA 1Y3JA 1HW8A 4LFAF 1YSJA 2Q66A 4JI8K 2C2MB 3RRKA 3SUNA 1WC5A 3QICA 1N6QA 2ALYB 2FTRA 3VF0B 4JI5J 3Q8VA 1UCNA 2E1CA 2QO3A 3PSFA 2E9TA 3M6VA 4DTNA 3LZJA 4C3LA 3DLGB 2WB1D 2OPRB 2ROEA 3GE1A 2A5XA 4OKJA 3PHEA 2O8BA 2MKYA 4EUVA 3QAUA 3MDFA 2A42A 1B0PA 2LDYA 3TJ9A 3P83D 4HL9A 1VSFA 5AE3A 2HB5A 3TZZA 3VAJA 2AX0A 3HSDA 1HBUA 2KHCA 4KHQA 3HKZD 4IH5A 1DKGD 5T7BA 4NO7A 2RS2A 4WFYA 3EICA 4XTTA 4JKGB 4A8XA 3DRPA 2Q0UA 3NF6A 3TJ8A 1X3NA 1ZBUA 4P10A 4KGXB 2CPJA 5G0RA 3K8VA 1ITGA 1T95A 2F1FA 1ZBSA 2CGLA 4OYXA 3LPTA 3HK2A 3CJ3A 2RNEA 2KKHA 1PBAA 1RHRB 3SQOP 4WU2A 3M6UA 3LO3A 1C0UA 3CCRN 2C2ZB 4LSNA 1RKIA 4KGMA 4YY3J 3V1QA 1VQLN 3P3DA 3MM6A 4CNYA 4MDBA 3HD2A 3H2LA 1U1LA 3MEEA 2DGSA 4BC5A 4NLCA 3PRBA 1E6YB 3NH1A 5IT9U 2YVSA 3QEVA 4CJPA 2HSTA 1SJFA 4DF8A 1YVNA 3CULA 4AQYF 3ENOA 3NMAA 3H7HB 5KQDA 4LF4F 1X9WA 4RW9A 2VG5A 4TQRA 4B9LA 3W0LA 2IAJA 2IVOA 2ACMA 3CO0P 3C3LA 4CO3A 3POTB 5HI7A 4PXDA 3L7PA 4DV0J 4M3XA 4LF9K 3VA0A 3TVZA 5KT6A 3CC2N 1S9GA 5CABA 2NYIA 5KRTA 2LQ8A 4XH5A 3J7YP 4IDHA 4CM0A 4EBDA 1EWQA 3FCHA 3AOBA 1DLOB 2QL5B 2HWTA 4P71A 1NXIA 1LK5A 3IWXA 2EWHA 2HQGA 2ASDA 1UVIA 4K7QA 3OTOJ 3KK2B 4R5PA 1U02A 3CJCA 4HCCA 1ZYQA 2HIQA 3FQLA 1URRA 4OPHA 2CAJA 5DM6Q 3LPUA 4BG9A 2VWBA 4FCYA 3AO3A 1YHQN 4A8MP 3I56S 2OPSA 2YNIB 1ZAWA 2F8HA 1TUYA 2Y1RI 4EIAA 3SBMA 2D3UA 4K42A 2YQ3A 2C28A 4DX7A 4ZN1A 4KGKA 3OS2A 2GS8A 4H0VB 1CPZA 2YWGA 4CLTA 4USIA 4YORA 3MX2A 4MIBA 5LJ5Y 4F4YA 3TSPA 5HK4A 3TPQA 1JLEA 3OW2M 1S12A 3A8JA 3G6EN 1H73A 2O67A 5DS7A 1F21A 2IDOA 1BO5O 1P27B 3AOAA 5AQGA 3T1HK 2L41A 2PE8A 4K4YA 4DQ8A 2UUAK 2XY7A 2M8HA 2FVRA 2H65B 4M3WA 1TGOA 3Q7BA 2G8UA 3T5LA 4FWNA 4CFAA 1YG0A 2ADBA 1T9XA 4DL7A 4BREA 1IJEB 2Z2ZA 3GG0A 4M3RA 2OZSA 1G7CB 1VQ9N 4GVMA 2PC6A 2K3IA 2LXIA 5B0BA 4L8RB 1YZ6A 3BUZB 3IR6B 2QMXA 4HHHA 3Q89A 3TABA 2B6AA 3W62A 2K2PA 3SI8A 2IM0A 2LA6A 4B9SA 2MQ8A 3WXMB 2DIVA 1ZETA 2N7YA 1X3MA 1S1WB 1N4LA 2LXUA 3VGVA 4LUBA 1CJKB 2QA4S 5AQMA 3MR5A 3BJYA 1Q78A 1U48A 3N4PA 1P9QC 3WIUA 2PA8D 3TJAA 3CXCR 4ZVOB 3BR9A 4GVLA 2GIRA 3HFKA 2W7AA 3MAAA 2EEYA 4RW6A 3TWZA 4GKKJ 4LH5A 4PG8A 1RWNB 2CQBA 4OJ3A 4NI2B 3KLFB 3D7SB 2NXJA 1ZM4A 3OJSA 3O9SA 3RVCA 3OL6A 3JYTB 2RVJA 4S0MA 1NGFA 4DL3A 2HRYA 3QATA 2GQCA 5M1KA 1HI0P 3WIVA 2A1SA 4BRHA 4W90B 3HSZA 1Q8KA 1CLQA 4LD0A 4WIIA 5DZ6A 1RLDA 3NHGA 4HCBA 2Q31A 3MM9B 3KTQA 4BDZA 2J7WA 4X62K 1QAIA 3AV9A 2ASPA 1LK7A 5GAHP 3O8MA 4UUWA 3EGZA 4FJ5A 2KHOA 2PT0A 1YJ7A 3OS0A 1FCAA 1X0PA 3HP9A 3RMDA 3GG1A 1B92A 3G82B 4RNNA 2CQ1A 1TYQA 4BR4A 1URNA 4JKEA 1P6TA 1W26A 2ROGA 3HHDA 1BCMA 2V6AA 3QGHA 3M6WA 3I6PA 1FKPB 3L4BC 1HI8A 3UQSA 4FVCA 1PJ7A 3HHKA 3R9PA 4ILMA 1VGYA 4NLOA 3PR4A 3F9KA 1H7WA 2EC2A 4LSLB 1XMOK 2GMJA 1EQ0A 4CH0S 4CCHA 2DR8A 2Z57B 1J2VA 1IQTA 3JAMY 1VBYA 4FL9A 2GIQA 4CJVA 3PIPL 4NMLA 3W66A 2GIFA 3MM8B 3BGOP 4BC4A 3G6YA 3GR1A 4K4SA 3NBPA 3IS9A 3BZKA 1S1TB 3TNVA 4CFCA 2R2UA 3OYKA 3Q8RB 4J8FA 3QIPA 4FM1A 1UJ6A 3EX7B 2RS8A 2E8AA 3WQTA 2VL1A 2CPDA 2V8HA 5EXWA 3CUNA 4CIGA 2MSSA 3RAXA 4P74A 2HNYB 5GAEI 2CGJA 2HKEA 1RXOB 3O6QA 4URSA 1S79A 5D3GA 3OYJA 2VQFF 3E01A 3AVCA 3CMEN 1UFWA 4NLTA 4ZPCA 4TSXA 2CJ9A 2E5LK 2OJ3A 1GLFO 1YQHA 3GIJA 4KH5A 1LV5A 2PFFB 4RUCA 1FD2A 2Q97A 4ITSA 4OV1A 3M2UA 4M5KA 1KOOA 3PJ9A 1WJ9A 2K06A 1T44A 5E41A 2VFTA 3I33A 3EYZA 2GVDB 3KLVA 3M8QA 5AXNA 3DU6A 3LM2A 5HVHA 3O80A 4JI1K 1DTTA 4XEIA 1IKVA 1REGX 5DQHA 5KFTA 2XY8A 1CJTB 2Z4PA 4LFBK 2VBYA 4PWUA 5F0XA 2JVRA 3G71N 3CQ8A 2QLJB 5K8OA 4L72B 2CADA 3MUMP 2D9OA 1W2BM 5KG1A 2HHSA 4QR2A 2VQEF 4I68A 3L4IA 2BOAA 3NRBA 4NLGA 5AQRA 3CVKA 4WF9L 1SV5B 2AYGA 5LJWA 3DN9A 4GKJJ 3P1GA 1T05B 5C2CA 3M30A 3FK4A 4K50A 1TL7B 1PCAA 1T94A 4DV5F 2DBBA 4ALZA 3G25A 3SUPA 3MWTA 3DLGA 2OPRA 1NJXA 3VAIA 2CVIA 1RISA 3T6JA 1IVZA 5GINA 2VB6A 4B9UA 5DJBA 3IFRA 2VD3A 4DFJA 2HBZB 5GMDA 3RZAA 2KFYA 4UOHA 1Y0HA 2W24A 4CLYA 4CZIA 3BPSP 3ZSYA 3CCWA 2XMJA 4HEA9 4FLZA 2E7VA 1S0VA 2N82B 2MXYA 4JKBA 3UPFA 3IWLA 2ASOA 4ZP9A 3QT7A 4AL5A 4MO4A 4E7HA 4JKGA 2B4VA 2DNQA 2DHXA 2HGMA 3NAHA 4B9QA 2P9UB 4NXMK 5I3PA 2R9LA 2HBKA 2QLFB 4PXBA 2AIRB 2DNZA 3UE2A 4RJVA 1ZOTA 2J0XA 4J7CA 5CCLA 4CLKA 3N9UC 2HFSA 2AJ0A 4E89A 3NMRA 4JHDB 1RACB 3PIPQ 3CCVN 4DR7K 2P9NB 3FBCA 2XULA 3SSRA 1E4GT 1KLMB 4QIVA 2E1ZA 3ENBA 2QSFA 2ZJPL 1EZZB 1EWRA 4K8RA 4CEBA 4DR1K 1KVIA 3GIRA 4F3MA 1Q81T 3V9UA 3PVXA 1CULB 1ATNA 3M2RB 3VAHA 3A3PB 5AZJB 1KKHA 2XZDB 3POTA 2YY3A 2C3OA 3MAHA 3QINA 3ZTRA 3WX8A 1EX4A 1YTYA 1D09B 2PFUA 3OYFA 1HNZK 3LANA 4ED1A 1GXUA 2ZH2A 4CRJA 5KG2A 3FCVA 1BQNB 2Z30B 4M5JA 1DLOA 3ETMA 3J7Z5 4WYBA 2CJKA 3GB0A 3TA0A 5IQ6A 3KK2A 4H4KA 1BG3A 3EY1A 4QIWD 3BYRA 4I2QB 5E0OA 4YB6A 3P5BP 5BYQA 3DGPB 2D74B 3C65A 1RJJA 2ZH1A 1LWEB 1WSHA 1RT4B 1RDUA 4XPEA 1ZPVA 1NJWA 2YNIA 3N6NA 2HVHA 2D5RA 1NDKA 4H5RA 2IFXA 1S48A 1HKCA 3SJJA 2IJRA 8ATCB 6AT1B 3EDRB 4OI0A 1S4EA 1FRXA 5GMKa 1UL3A 3TP2A 2DTUA 1OWXA 2HHHF 2FHOB 5EX3A 4ED4A 2OZMA 1FRHA 2WSCC 4WF9Q 1VFJA 3PM9A 4Y2AA 1HKBA 1RT3B 2I7PA 2GWJA 4ED8A 3JAMO 2CXEA 1D1UA 1RQ0A 4CGFA 3LZIA 1R89A 4F9OA 4F4WA 5D0RA 2UXCJ 4OLAA 4DN0A 1YKWA 3DLLL 3BKTA 3S01A 1J53A 1M5HA 4OYBA 1IR1A 1RI7A 3V1OA 2RQMA 4DJBA 3QBXA 1YITN 2B43A 1RBAA 2HQDA 3QESA 3TAGA 3M32B 1VQNN 3AJ1A 1W25A 5E3CA 3ISNC 3PW2A 1GTEA 5HQ8A 4PAAA 2ZH5A