4YDUA

Crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
336
structure length
336
Chain Sequence
MRVLGIETSCDETGIAIYDDEKGLLANQLYSQVKLHADYGGVVPELASRDHVRKTVPLIQAALKESGLTAKDIDAVAYTAGPGLVGALLVGATVGRSLAFAWDVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQYELLGESIDDAAGEAFDKTAKLLGLDYPGGPLLSKMAAQGTAGRFVFPRPMTDRPGLDFSFSGLKTFAANTIRDNGTDDQTRADIARAFEDAVVDTLMIKCKRALDQTGFKRLVMAGGVSANRTLRAKLAEMMKKRRGEVFYARPEFCTDNGAMIAYAGMVRFKAGATADLGVSVRPRWPLAELPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA N6-adenosine threonylcarbamoyltransferase
publication title The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 122
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 2.3.1.234: N(6)-L-threonylcarbamoyladenine synthase.
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4yduA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4yduA01
5AQJA 1MA9B 3VEXA 2ITMA 2FF3B 4XH5A 1JCGA 1HLUA 3MDQA 4FSVA 4FWOA 4I6MA 4CZKA 1QZ5A 1TYQA 3BF1A 5AFUH 1GLCG 1XUPO 5AQXA 5AQZA 2Q1NA 2ASOA 4BRIA 2QWNA 4B1YB 3RSEA 5AZIA 2IVPA 4CJ7A 2KHOA 3KVGA 4CBWA 1NMDA 2I7NA 4CZLA 2YHXA 2ZGZA 4JAXA 3GBTA 4BRLA 3LDQA 3CJAA 3DXKB 1QQNA 1V4SA 2CH5A 4BC2A 3BUZB 5AQMA 2Q36A 2P9PB 1ZBSA 4EAHD 5ADXH 3HM8A 3J8AA 3VOVA 5BPMA 5AQVA 2FSKA 4BVOA 1HKGA 2GWJA 3U4LA 1YVNA 4AM6A 4YDUC 2CH6A 4H0PA 1NWKA 2BTFA 5AQFA 3O08A 3G25A 3H1VX 3WXLA 4HTLA 3JS6A 4BRMA 1R59O 2A42A 4PKHA 4WQ5C 3WQUA 4DHYA 3AY9A 3ZX0A 4K25A 4B1ZA 4PKIA 2E2QA 3A5LC 2Q31A 5AZIB 2E88A 1T6DA 2D0OA 3QFUA 3AAPA 3GG4A 3CJCA 3JXUA 3MMVA 4WQ4C 3WEEB 1KAXA 2YHWA 4BC3A 4BQZA 2D0PA 1GLJO 4BRAA 2ZF5O 1C0FA 4XH1A 5AQRA 3ZEUA 3BF3A 4B1UB 2P9NA 3FZMA 1U6ZA 5LJWA 2GWKA 1ESVA 1LCUA 4BQLA 5AQKA 3WXIA 4A61A 3LDOA 3HBTA 3CQXA 3L6QA 2NLXA 1NBWA 5JLHA 3HZ6A 3D2FB 3H46O 3MK6A 2E2PA 4H03B 1NGIA 4F9OA 2H3GX 3A5NC 3VENA 3UKRB 2ASMA 5FPDA 3DXMA 2VWBA 3A0IX 3ENOA 2HF4A 3HI0A 4BRFA 1GLDG 2IVOA 1C0GA 4BRQA 3U8XA 1X9JA 3GOIA 1NGDA 2P9SA 2A3ZA 2P9IB 3O1BA 5LJVA 1NGGA 1NGJA 4K41A 4FWSA 1H1VA 4BC4A 1BA1A 5ELZA 1BA0A 5AQNA 1ATRA 1BU6O 5AR0A 1U2VB 1SAZA 1HPMA 3ZEUB 3CJ1A 3VETA 4FOIA 4QS7A 2AP1A 3SK3A 3GE1A 3CJ7A 5KQ8A 5BN9A 4BR9A 3HTVA 2QWMA 4BRGA 4FOEA 4HWIA 4JHDA 4H0OA 1EQYA 4CI6A 3O6WA 2P9KA 4H5RA 4PL7A 4B1WB 3LDPA 4O5FA 4JN4A 2GUPA 3M1FA 3DXMB 5KPRA 4CZIA 3ATUA 5AQUA 1QQMA 1KAYA 3DJCA 3S41A 5F2RA 4H5TA 3O4WA 3WXJA 5I9EB 2QXLA 2Q97A 1ATNA 2A40A 2P9UA 2VYPA 5AQOA 3BEXA 1JCEA 2E2OA 4FWKA 4RCHA 4EHTA 5KPZA 3IMXA 2V7ZA 2V51B 3D2EB 1K8KB 2QWQA 1NGCA 1NGEA 1BUPA 2WUSA 3FZKA 2YHYA 4H5NA 4CZFA 3VEYA 1YXQA 4MLHA 4BG9A 4ISGA 3EKUA 2Q0UA 4QS9A 3UB5A 5F0XA 5FPEA 2GEMA 2F9WA 3QBWA 4EHUA 3B8AX 4A2BA 3D7EO 1GLLO 5FPMA 2FXUA 4H0YB 1HJOA 4I6MB 3ZETA 2E1ZA 2I7PA 1TYQB 1GLEG 3QMLA 1E4GT 2YCHA 4CZGA 3KHYA 2FLOA 4FWNA 4NO7A 4BR2A 4CBXA 3A5MC 4JD2A 3VF2A 1MWMA 3W3DA 1DGKN 3RSEB 1SQKA 3UKUA 1MWKA 3GL1A 1SZ2A 3LDLA 1HX1A 5E26A 1QZ6A 2PBDA 4C23A 2P9UB 3ULEA 3FFKB 3VEWA 3ZX3A 3FGUA 5AQIA 3WQTA 1BG3A 4FWMA 3VGLA 3VEOA 2QM1A 3MN9A 2E8AA 5AFUA 3H3OB 2ZWHA 4FO0A 1IG8A 1D4XA 4BR0A 4CZEA 5AQGA 1S22A 1ZXOA 5AQPA 1IJJA 5AQTA 2OANA 2W40A 4FPBA 1NGAA 5BRDA 2A41A 2YJEA 2FSJA 1T6CA 1XC3A 3AARA 2HMPA 4H5VA 2DPNA 4CBUA 1J6ZA 2NRHA 4BR7A 4LC9B 2GTDA 2QW9A 5JMVA 3IDHA 3FR0A 2IIRA 3U9ZA 3MCPA 3EN9A 3VGMA 4RWTA 1GLFO 3VEVA 3GDQA 3CI5A 5ADXA 1TUUA 1S3XA 3R8EA 4KBOA 3ULEB 3ATVA 3HSCA 4YDUA 4MLEA 1TUYA 1HKCA 3CJBA 1KXPA 2AA4A 1GLBG 3H6EA 5AQWA 2P9LA 2D1KA 2P9NB 4AM7A 4MO4A 3TPQA 4ISFA 3FZHA 2GELA 2YJFA 1Q18A 1T44A 3H45C 3EO3A 4H0VB 1Z6RA 5B8HA 1DKGD 4WQ4A 3CERA 3CJ9A 5BREA 4IO8A 5JLFA 2A5XA 3SMSA 3DXKA 3FZLA 4BR4A 1NM1A 3QDKA 5BPLA 4DCHA 1YAGA 4H0XB 3WXKA 2F9TA 3L0QA 3DAWA 1RGIA 4A2AA 4BVPA 4BROA 4FWPA 5EXWA 1X3NA 4IJNA 4DB3A 3O80A 2P9PA 3VF4A 3H1QA 5AQQA 5BRHA 5JICA 5AZJA 5TKYA 5BR9A 2P9SB 4FL9A 5E84A 3CHWA 5F1XA 4CD1A 4IJAA 4E1JA 3W0LA 1BDGA 2E20A 3QFPA 4IZ9A 1GLAG 4FWQA 5BN8A 3FZFA 4NB4A 2BUPA 2P9LB 2VCPA 4BRHA 2CGKA 3SJHA 3ZX2A 1Y64A 1NGBA 1P8ZA 2FSNA 2E2NA 5EY4A 3O1WA 4BRPA 1LOTB 1NLVA 4BRKA 1ATSA 1OKJA 1XQSC 4K43A 2Q0RA 2FF6A 3WEEA 3LDNA 3MN7A 4JHDB 3VESA 2CGJA 2YI1A 4WYBA 4CZHA 2P9KB 3MN6A 4BGAA 3I8BA 3O8MA 4DQ8A 4M7XA 4RTFD 3AAQA 1BOTO 3LM9A 3MN5A 5AZJB 3LM2A 1G99A 5AQYA 1V4TA 4FWRA 4XH4A 2E1YA 2PAVA 3QB0A 4BR5A 1WOQA 4J8FA 3EL2A 1Z05A 4BRDA 1CZAN 3M3ZA 5AQLA 3KZBA 2CGLA 4BGBA 3D2FA 4Y0WA 4M63C 5KQDA 3WT0A 3VERA 1RDWX 3O5BA 4O8KA 1WUAA 1DEJA 3A5OC 4BRCA 2EWSA 3CIPA 2NZTA 3R6MA 4H0TB 3UKRA 2ASPA 3IUCA 4JNEA 4A62A 5LY3A 4MO5A 4GY2B 3A8YA 3F9MA 3M6GA 3R9PA 4BREA 1MDUB 3ID8A 1QHAA 2P9IA 3CQYA 4EFHA 4QS8A 2HF3A 2Q2RA 2ZGYA 1RFQA 3WUHA 3BP8A 3ZETB 1E4FT 4PL8A 2V7YA 3C7NA 4PKGA 3L4IA 1U2VA 3VGKA 1QQOA 3QBXA 4B1XB 2W41A 3UE5A 5EX5A 4JD2B 1HUXA 4XEIA 3P4IA 3UKUB 2A6AA 3C0BA 4IWVA 5AQHA 2V52B 2QWOA 3SMPA 5EOYA 4K42A 3I33A 3QICA 1KAZA 2QWLA 4FWLA 3ENHA 1YUWA 4M7YA 3OHRA 4WQ5A 3TU5A 1X3MA 2IVNA 1HKBA 3EKSA 4BC5A 4Z94A 3H3NO 3VF6A 3DWLA 1NGFA 4BRNA 3EZWA 5AQSA 3LL3A 3SLCA 2QWRA 1ZC6A 1BO5O 4EIAA 3C7NB 5BPNA 3D2EA 5CE3A 4CZJA 1BWFO 1K8KA 2UYTA 5FPNA 3FE1A 2J4RA 5BRFA 3VEZA 3CETA 2HOEA 5EVZA 2QWPA 4B9QA 5KPTA 2D4WA 3VPZA 1NGHA 4L3QA 3FLCO 4H5WA 4B1VA 4BG8A 3IFRA 4CD3A 4ISEA 4FPAA 4GNIA 3U9DA 1JCFA 4IXCA 4CZMA
chains in the Genus database with same CATH superfamily
2FF3B 3DRPA 4CJEA 3MDQA 1YJNN 1VQON 2HHUA 1WSIA 1Y97A 3BF1A 4CJQA 1GLCG 1XUPO 5AQXA 4FLUA 2FC0A 4BRIA 2JWLA 3NF9A 4B1YB 3RSEA 4KHQA 4CJ7A 1JLAA 3PX6A 3O3GA 2ITGA 2HSTA 4CBWA 3WNEA 4R5PA 3SQ0A 2VG7A 1OH8A 2YHXA 1VHXA 1QE1A 3LDQA 2CH5A 3P38A 1CLQA 4M3TA 5JS2A 1U49A 1GOAA 2P9PB 1ZBUA 5ADXH 3HM8A 1YTAA 1D5AA 3CCUN 1WAJA 3AVJA 5BPMA 1TVRA 4BVOA 1HKGA 1Q9XA 3U4LA 2DFEA 3AO1A 5BR8K 2CH6A 3K9JA 2BTFA 3TR8A 4LF4K 1WBDA 3O08A 4PKHA 2IC3A 3OYKA 1JLBA 4DR6K 4OPKA 1T6DA 3DMJA 3TTFA 4DLGA 3GG4A 3CJCA 2G8KA 1Z25A 1JKHA 2O8EB 2HHWA 3PSIA 3AVIA 2D0PA 4B9NA 3AGRA 2HVIA 3HPHA 1C0FA 3L3UA 5AQRA 3THYB 3ZEUA 1VQPN 3BF3A 4CK1A 3NCIA 4Z4IA 4W5TA 4E0DA 1LCUA 4A61A 3CQXA 2NLXA 4FJ8A 1OH6A 1QQCA 4MDAA 2E2PA 2QA4N 1NGIA 3CCQN 1YF5L 3UKRB 5FPDA 1T3VA 3DXMA 3ZT0A 1BCMA 1GLDG 2IVOA 4CGFA 1C0GA 3GOIA 1EO1A 4OKEA 4DTSA 4CJRA 1XNQK 1NGJA 1RTDA 4K41A 1D8YA 1BA1A 3T1HK 4Z4CA 5AQNA 4DSKA 5AR0A 1SAZA 4FOIA 1S5JA 1C1CA 3VQ5A 1VQ4N 1RBVA 5KRSA 2NRRA 1EP4A 5KQ8A 5DMRA 4E19A 4ZTFA 3LANA 2DY4A 1KTQA 1NOZA 3O6WA 4IEEA 4CI6A 3HO1A 3KLEA 4H5RA 4KI4A 2F8TA 3NH2A 3M8PA 3M1FA 3LWLA 4YOYA 2PYJA 3ATUA 3LDSA 4IBNA 2DFHA 4M3YA 3WNGA 5KRTA 3WXJA 2PZSA 3J7ZO 2A40A 2P9UA 2VYPA 3BEXA 4H4OA 2E2OA 2V7ZA 3LZIA 4Y1DA 4B8AB 4KKOA 1NGCA 4CVNE 1HNIA 1NGEA 4FVMA 1KCFA 1RBTA 4H5NA 4DR7K 5GIOA 4NCGA 3KD1E 3LP0A 2Q0UA 3IS9A 3CCSN 5GAGP 3ULDA 4EHUA 4A59A 4I2QA 3HVRA 1QVFM 2ZQBA 1HJOA 4I6MB 3CXCM 2I7PA 1TYQB 5GINA 1E4GT 4CF1A 1C0MA 2FLOA 4FWNA 1L3UA 1Q81O 3K59A 4JD2A 3HOSA 4CJPA 4C8KA 1ZBHA 1SZ2A 1HX1A 4IOAL 2KZMA 2WTUA 4FJMA 1QZ6A 2PBDA 4O5BA 3O9TA 3VEWA 3ZX3A 2E6LA 1VSLA 3FGUA 4N76A 5AQIA 2VWJA 3ZT3A 4FWMA 4Z4EA 4CEBA 2E5LK 1SKWA 1RBUA 4FO0A 3G6EN 1IG8A 5M1PA 1D4XA 4BR0A 4CFBA 4KHSA 3OBYA 1RCHA 2HHVA 3BZCA 2W40A 4DQSA 4JI3K 1NGAA 3VQAA 2YJEA 3AARA 2VWKA 4CBUA 3OYCA 3IDHA 3L8BA 3QEWA 3VQPA 4V19S 4A5BA 3AO3A 3TARA 3OS2A 3MCPA 3EE9A 3HP6A 4WCEL 2OZMA 1S3XA 4GVEA 3R8EA 1JJ2M 4EZ9A 4NXMK 4DV2K 2PFUA 5CZ2A 1NKCA 2HHQA 2XY6A 1N34K 1VAZA 3Q7BA 1TK0A 3ULEB 4KPYA 3B6OA 1HKCA 4DTRA 3EYZA 1KXPA 2P9LA 1WSJA 5DM7L 4CJWA 1FJGK 2YJFA 1WLJA 4IFYA 1HYSA 3ZSRA 2P5OA 4B08A 3OS0A 5B8HA 1DKGD 3CERA 4DTXA 3OYJA 4IFVA 3SMSA 3DXKA 1NM1A 2IOCA 1DTTA 4H0XB 2QKKA 4TSXA 1I39A 4IKFA 5EXWA 3T1YK 5BRHA 3OBWA 4GKKK 3KLFA 4KH5A 4H4MA 4LFAK 1HMVA 4G1QA 3G4SN 3QEIA 4CD1A 1RILA 1N32K 4E1JA 1KVAA 4PUOA 2XRIA 4B9TA 2KQ2A 1GLAG 2BUPA 5KI6A 2VCPA 2E6MA 3CMEN 2DTUA 2P1JA 1O1WA 3O1WA 1LOTB 4F4KA 4L8RB 1B92A 4YY3K 1VQ9N 3OYAA 4JI1K 4BRKA 1OKJA 1XQSC 3AVBA 2O8BA 5C2DA 3OYIA 4JHDB 1S72N 3VESA 1WSFA 2YI1A 3KWIA 3ID6A 2G8UA 5SWMA 4FZXC 2OTJN 3RMCA 3AAQA 1BOTO 4FJNA 2O4GA 3MN5A 1T7PA 5AZJB 3LM2A 1G99A 3JYTA 3V1QA 4ELTA 1NKEA 3K2PA 2PAVA 3TSUA 3QB0A 1UA0A 1SL1A 1Z05A 4BRDA 1CZAN 2CGLA 4BGBA 1S9GA 3D2FA 4Y0WA 1OVYA 5T7BA 3OJUA 5JVHL 3U3YA 2OPSA 3CMAN 2EWSA 2NZTA 4CGJA 4W5OA 1OH5A 4YHHK 3IUCA 3I8DA 4A62A 1W0HA 4GY2B 2DFFA 5AJ3K 3M8SA 3ID8A 1HNXK 1QHAA 1NK5A 3QINA 2HF3A 2Q2RA 4CFCA 3BP8A 3ZETB 4PL8A 1KC8O 3THWA 2Q3SA 3C7NA 4PKGA 3FFIA 3R3LA 3QBXA 1NK0A 4LF9K 3KJVA 3JAMO 4JI2K 3P4IA 4DR1K 3CPEA 3IRXA 1ILYA 3C0BA 4IWVA 3VTIA 1WSHA 3E9PA 4K42A 3I33A 4GMJB 3ENHA 4FZZA 1NU0A 4NLCA 1YUWA 1N6QA 3QERA 3NF6A 1VSHA 3QIOA 3P1GA 4FM0A 4DV4K 4BC5A 4OVLA 2KFNA 4Z94A 2OCEA 3CFRA 1VK0A 4BRNA 1WN7A 3NGYA 3LL3A 3TAEA 1LV5A 4DV3K 2QWRA 1FW6A 3QNOA 3KLGA 4LSNA 3D2EA 5CE3A 4CZJA 1K8KA 4FK0A 4CEFA 2HOEA 1IKVA 3CCEN 1TKTA 2D4WA 4M41A 4BG8A 2UUAK 1HRHA 3QLHA 5HROA 4FPAA 4GNIA 1RDDA 1DTQA 4MQ3A 1XNRK 1BQMA 2YKNA 5JS1A 3U3GA 4XH5A 4FWOA 1A5XA 4CZKA 1QZ5A 5AFUH 3ASMA 4HCBA 1KFSA 4LF5K 1BGXT 2D5RA 3HL8A 5AZIA 2IVPA 5J2PA 1T8EA 2E4LA 3RRGA 2BANA 2HMIA 2HHTA 4JAXA 4AHUA 4BRLA 3CJAA 4JKEA 4BC2A 3NH0A 3OY9A 4DU4A 4FXDA 2VGNA 1JLQA 1C0TA 2Q36A 4IFEA 2Y1IA 1S1VA 4X62K 1X9MA 5M1FA 1BISA 4JKFA 4BWJA 3VOVA 3OYEA 2FBYA 3MXIA 2FSKA 2GWJA 2B4JA 3O3HA 3MX5A 3TWHA 1YVNA 1NWKA 4JRQA 4LD0A 1S1UA 4BDZA 3H1VX 3WXLA 3K5MA 4E7IA 3JS6A 4BRMA 4YOTA 3NMUA 3WQUA 4DHYA 4Z4HA 2O8DB 3AY9A 2D0CA 3ZX0A 4K25A 1VQ7N 3A5LC 1WSGA 2E88A 4CJUA 1C0UA 4DR5K 4BDPA 3DRSA 3QFUA 4KH4A 3AVNA 3MMVA 1KAXA 2P5GA 4CGIA 3DOKA 1TV6A 2OPPA 4MFBA 3S3NA 1FK9A 2RF2A 4JI8K 4I2PA 4ILHA 4DV5K 4PQUA 3CCMN 5LJWA 1RT6A 3FZMA 3LALA 1NK8A 4DG1A 1LWFA 5AQKA 1RT5A 3LDOA 1J53A 5HRRA 1CXQA 3D6RA 2OPRA 4HCCA 1W9HA 3MK6A 3A5NC 3VENA 2ASMA 5HRSA 3TAPA 3ITHA 3A0IX 3ENOA 3HI0A 4BRFA 3VN5A 1GOCA 3U8XA 2YHAA 5K14A 2P9SA 4KHPK 2P9IB 3NBPA 5LJVA 2XY7A 1SKSA 2FBVA 1W7AA 1H1VA 4K8XA 4Z0UA 3DLRA 4FJKA 1J9AA 4RW9A 1YJWN 1YHQN 3KTQA 3PUFA 1BU6O 1U2VB 1SL2A 2FBXA 3ZEUB 3VETA 1FXXA 4QS7A 3SK3A 3SCXA 3CC2N 2XY8A 5CYQA 2XHBA 2QTDA 2GUIA 4BRGA 3TAQA 4IO9L 4F8RA 3AVAA 4FYDA 4HWIA 3I0SA 4DWIA 3DLKA 3L2RA 3DM2A 2KKZA 4B1WB 3CM6A 4O5FA 4W5RA 1ZYQA 4JN4A 2GUPA 4DU3A 3DXMB 3HM9A 4JK7A 4WFAL 5AQUA 4CIFA 1EX4A 1KAYA 1QQMA 3DLLL 3HK2A 5CR4A 4NLBA 5LMNK 3KK7A 4BE1A 3EZ5A 3CM5A 3VQDA 3NAEA 2V51B 4KO0A 4FLWA 2QWQA 1RDAA 4FJ5A 4CZFA 2BE2A 2YHYA 1BL3A 4M3WA 3VEYA 1YXQA 1RT7A 3WXMB 1DLOA 3HVTA 4JKDA 2GEMA 3QBWA 2NRTA 3B8AX 4A2BA 4H0YB 1IKYA 4OLAA 1GLEG 4CJKA 4N41A 3KHYA 4I7FA 4JI6K 4JI0K 4NO7A 4BR2A 3SBGA 3RMBA 1MWMA 3W3DA 1SQKA 3GL1A 4H8KA 3K57A 5CHIA 3ZT4A 1HR0K 3SAHA 2VQEK 1RT3A 2P9UB 3ZSQA 3FFKB 3CYMA 1IG9A 4CHPA 3WQTA 1BG3A 4DR4K 1RDCA 4O0JA 1HQEA 4CJSA 2QM1A 4CHYA 4KAZA 1HPZA 2ZWHA 5FLXO 1BQNA 3O4QA 3RVCA 5AQPA 4CEDA 1NK6A 1IJJA 5AQTA 3DLBA 1BI4B 4KI6A 4JI7K 1T6CA 1XC3A 4JS5A 4H5VA 3O9QA 4J2AA 3SV4A 1J6ZA 1RT1A 4LC9B 2YV0X 3P5JA 1FKOA 1BCOA 3U9ZA 3EN9A 3VGMA 1L3SA 1S1WA 3PSFA 1JL1A 4FLVA 5ADXA 1TUUA 2Z1JA 4FJLA 1SKRA 2JLEA 1YITN 3ATVA 2F7TA 3HSCA 3SAGA 4KHNA 1TUYA 2PY5A 3PLAA 4AHVA 5HBMA 3SBTA 4YOWA 2AA4A 1GLBG 1U48A 2P9NB 1ZBIA 4MO4A 3AA2A 4ISFA 3FZHA 4B9LA 1T44A 3N4QA 4DKWA 4RW6A 3DOLA 2FBTA 4X65K 1Z6RA 3CJ9A 2ZJQL 3OTOK 2A5XA 3FZLA 5BPLA 1XMOK 2F9TA 3DAWA 4A2AA 2HW3A 4FWPA 2P9PA 1MU2A 3NFAA 4JKGB 1EETA 2WC9A 3J81O 1S1TA 2F4VK 4IDHA 3V9XA 5F1XA 2RPIA 1BDGA 1S6QA 3QFPA 3E66A 2GV9A 2P51A 4FM2A 2KFZA 4NB4A 2IS3A 2P9LB 2UUCK 1RDUA 2HBLA 2QEXN 3OYGA 1IBMK 5EY4A 2E2NA 3RR7A 3O9SA 2VG6A 1RBRA 3CCRN 4FLXA 5C15A 4AILC 4K43A 2AJQA 3LDNA 3J7AP 2O8EA 1Q86O 1ASUA 4CZHA 3O9UA 3LPTA 4CK2A 2P9KB 4JS4A 3SAFA 4RW7A 3THYA 4B8CA 5FDLA 1RDBA 4M7XA 4FZYA 4Q5VA 2HHHK 2X6SA 2IDOA 4DLEA 2YNIA 4FWRA 4PA1A 1L3VA 4XH4A 3ZLJA 4GW6A 4GVMA 2UUBK 1BHLA 3KZBA 4M63C 4DF4A 5DM6L 4FCYA 3B6PA 3O5BA 4O8KA 1WUAA 4BRCA 3E9OA 3UKRA 1VRTA 3F2KA 3OVNA 5LY3A 1L3TA 4MO5A 4DUYK 4ILJA 3F9MA 1MDUB 1LW2A 2O8BB 1KLNA 2UXBK 1U04A 3CQYA 4EFHA 3SUPA 3BY5A 3OYBA 4BE2A 3AA5X 4JKBA 2NRXA 3L4IA 3NVKA 3BGRA 2W41A 3J80O 5EX5A 3AVFA 3H08A 1HYZA 3UKUB 5HLFA 4LY7A 5AQHA 4B9SA 2V52B 2QWOA 1W97L 3SMPA 3KK3A 1KRPA 1CXUA 4FWLA 1KQSM 3AVCA 4M7YA 1KFDA 4WQ5A 1X3MA 3VQ6A 3THXB 2IVNA 4DU1A 3PO5A 3MX2A 5KTQA 3TSPA 3NF7A 4F3TA 3LP2A 1HNVA 2XO7A 4IOXA 2VQFK 5AQSA 4Z4GA 2G8IA 1ZC6A 3RMDA 1BO5O 2Z1HA 3C7NB 3TAGA 1IBLK 4B3SK 2A1SA 5FPNA 5M1QA 2J4RA 4UY8O 4LFBK 4DSIA 1NK4A 5KPTA 4F3OA 1NGHA 3HSTB 4L3QA 5FROA 2NRZA 4B1VA 3IFRA 2HB5A 5HOOA 4IXCA 1RTHA 1XWLA 2Z1GA 4CZMA 5AQJA 3VQ4A 2ITMA 3SUNA 1RNHA 1JCGA 3RWUA 4I6MA 4DFKA 1TYQA 1A5WA 3OYNA 2YX6A 4OGCA 5AQZA 4YNQA 3EY1A 4OLBA 3ZCMA 2ASOA 3TABA 2QWNA 1YI2N 4FVUA 4JKHA 3KVGA 1DT9A 3I55N 1NMDA 3K0SA 2I7NA 2ZGZA 2F96A 3VQQA 3T69A 2QK9A 3GBTA 4LH4A 1V4SA 3Q7CA 4U7BA 1B9DA 5AQMA 2NRWA 2KZZA 1S1XA 4EAHD 1TAQA 1ZBLA 3J8AA 1TKXA 3KK2A 1TK8A 4IG0A 3HOTA 4AM6A 3S3OA 4YDUC 4UQGA 4KRFA 1Q7YO 1WB9A 3G25A 1R59O 1RTJA 4JK8A 1NNEA 3F9KA 3L3VA 5AZIB 2Q31A 3CD6N 4OPAA 2D0OA 3AAPA 3AVMA 4WQ4C 3WEEB 1N33K 4JEPA 3V4IA 4BC3A 4BQZA 1VSDA 1GLJO 3HXMA 1QVGM 1K6YA 2OYQA 4B3MK 2ZF5O 3K5OA 3KK1A 4B1UB 1T03A 3OYMA 2UXCK 1IV0A 2GWKA 1ESVA 4GKJK 2W42A 4JRPA 3WXIA 3SUOA 3AO5A 2G8HA 2YHBA 1I3AA 3L6QA 1NBWA 4JI4K 5JLHA 4DUZK 3KKSA 2G8VA 3HZ6A 3AVGA 1E3MA 3H46O 1KVCA 4BY9C 3I56N 2ZJRL 2D0BA 4ILGB 4NXNK 1BIUA 3G71N 1NK9A 1VSKA 2VWBA 2IGIA 4BRQA 1NGDA 3T7ZA 2A3ZA 3QEVA 3O1BA 4OX9K 1NGGA 4CESA 1BIZA 3L2UA 2ATQA 4CGHA 3KLHA 3CFOA 1ATRA 4A57A 4FLTA 4HUFA 4DQPA 3CJ1A 2AP1A 3GE1A 3SPZA 3CJ7A 3HTVA 3K5NA 4C1NI 1W2BM 3TSQA 4FW1A 1HJRA 1SL0A 1YVUA 4JHDA 4KHYA 1LW0A 3LP1A 4CIEA 1EQYA 3IG1A 3LPUA 3J7YP 3CFPA 3WNHA 2W6KA 4M3UA 2O8FB 3BDPA 1R0AA 5KPRA 4DFPA 3C6HA 4DS4A 4KTZA 4CFDA 1VSFA 5F2RA 4H5TA 3O4WA 4LF8K 2QXLA 1ATNA 5AQOA 4RCHA 4W5NA 4EHTA 5KPZA 3P83D 4HHTA 4QAGA 1BUPA 3DRRA 1SS6A 2WUSA 3M8QA 4WF9L 4IDKA 3ZSOA 2G8FA 4O55A 4DQIA 4BG9A 4MLHA 3RTVA 1FKPA 3TAMA 4DSLA 3UB5A 5F0XA 5FPEA 2RHKA 4AHTA 3KLIA 5J1EA 1C6VA 3ZETA 2E1ZA 4CZGA 2YCHA 3BZKA 3E9LA 3DYAA 4CBXA 4ICLA 4CFAA 1DGKN 3RSEB 3LWMA 2EHGA 1MWKA 3LDLA 3CCVN 4YOUA 3P39A 5J2MA 5E26A 4CHOA 4FLYA 4B9UA 2VG5A 1YTUA 3VEOA 1I94K 3MN9A 1IH7A 2E8AA 5AFUA 1X9WA 4GV3A 3L2VA 4F2SA 2LSNA 1S22A 3F5TA 1S9EA 2X78A 3KD5E 4JK9A 2OANA 1ITGA 5BRDA 2A41A 1GOBA 1CZBA 4LH5A 4EZ6A 2HMPA 5M1OA 2DPNA 5DK5A 4BR7A 3QO9A 5JVGL 2GTDA 2QW9A 5JMVA 3FR0A 2IIRA 4RG8A 3PY8A 3D0PA 4RWTA 1GLFO 4B9MA 5A2QO 4ZHRA 1J54A 1HQUA 5C24A 4PHTX 4KBOA 1D9FA 4RW4A 3KKRA 4MLEA 2ETJA 3SV3A 3OS1A 1RT2A 3CJBA 4J2EA 1SUQA 3ZSVA 4AM7A 4DQQA 1CZ9A 2GELA 1Q18A 1P90A 4H0VB 4KHUA 4OPJA 5BREA 3WNFA 4CF9A 4BR4A 1RTIA 1YAGA 1XHZA 3L0QA 3NF8A 3CF5L 3HT3A 4BVPA 3NDKA 4KFBA 5C10A 4YOXA 3O80A 4CJ5A 4O44A 3H1QA 5AQQA 1Q9YA 5TKYA 3ENBA 4Y1CA 4FL9A 3CHWA 3S9HA 2NNWA 4G9ZA 4IJAA 4CEOA 4QOZB 2HVHA 1JLCA 2E20A 4FW2A 4IZ9A 2I5JA 5BN8A 4BRHA 3CG7A 4B9VA 4LSLA 2CGKA 2O8DA 4X66K 4EP4A 4DR2K 3ALYA 1P8ZA 1QSLA 2Y1JA 2QI2A 3LZJA 3MXMA 1T05A 3SYZA 1VQ5N 2F8SA 1NJXA 2EX3A 3PIPL 2Q0RA 2FF6A 4HVJA 5M1NA 5MLCQ 2ZM6K 2CGJA 3ZYYX 1N5YA 4WYBA 5I42A 1XHXA 4DTJA 4AQYK 4Z4FA 3ZSZA 3V6DA 3QETA 3I8BA 3MWPA 4DQ8A 1VSEA 1NJWA 3HPOA 4LFCK 3LM9A 1QS4A 3T19A 1HYVA 4CHZA 3SI6A 5GAHP 1TK5A 4J8FA 3OA9A 2UXDK 1QSYA 1IO2A 4M45A 3M3ZA 5KQDA 4E7KA 1Q82O 4KREA 1RDWX 1KVBA 2O8CA 1Z26A 1DEJA 1U47A 4H0TB 4DTOA 3AO2A 3C6UA 2ASPA 3EEQA 4JNEA 4E3SA 1C1BA 2ZJPL 4KB0A 4BREA 3OYLA 3O4NA 3TI0A 1KD1O 2P9IA 3V1OA 3ZSYA 1D9DA 2HBKA 3TTCA 4CJ4A 4QS8A 1QHTA 1E4FT 2OZSA 2V7YA 3I0RA 3TANA 4CF8A 4KB1A 1U2VA 3VGKA 4BDYA 1KLMA 4DV6K 4JD2B 3L2WA 4M3RA 3TTDA 1O13A 3SPYA 1NKBA 4OGEA 2WONA 1VQMN 4CECA 4U67L 3NGZA 3KWGA 2HNDA 5CYMA 4OKKA 2NRVA 3MECA 3DLEA 3V9UA 3QEXA 5HL7L 3TAFA 4K8ZA 3EKSA 3C6TA 4WFNL 3RRHA 3PX0A 3K9KA 4HUGA 5LMUK 1K73O 3H3NO 3DLHA 3VF6A 3DWLA 3C6AA 3EZWA 4NYNA 4DSEA 4M42A 4OO1J 3SLCA 1IBKK 5BPNA 3LP3A 1BWFO 4N56A 4ID1A 4N5SA 3FE1A 5FRMA 5BRFA 1UAXA 2HBMA 1M90O 5EVZA 1ZBFA 4H5WA 3IAYA 1UOCA 4CD3A 3MXJA 3U9DA 3T3FA 2X74A 4A5AA 4DTMA 5HRPA 1MA9B 1TKZA 1NOYA 3VEXA 4ELUA 2D0AA 4JI5K 1HLUA 1SV5A 4FSVA 3RR8A 1WNSA 2YKMA 1VQ6N 4XIUA 2W6LA 5EU7A 4O0IA 1OVQA 2Q1NA 3SUQA 3AV9A 2ZD1A 4CHQA 4PWDA 2KHOA 4NCBA 1NJZA 3M8RA 2XY5A 2B5JA 4CZLA 4AH9A 1UA1A 3NH1A 3DXKB 1QQNA 5IWAK 3BUZB 1A5VA 1VQLN 2HNYA 1ZBSA 2GX9A 4AF1A 4CF0A 3QEPA 3SQ2A 2NUBA 3IKMA 4YORA 5AQVA 2OTLN 3ZSXA 4MDBA 3VQEA 1BI4A 4H0PA 3VQBA 3ISNC 3MEEA 3O9RA 5AQFA 2JGUA 4FK2A 3L4QA 4HTLA 2OPQA 3OYFA 2A42A 4WQ5C 4DF8A 5GAEP 4E7LA 1M1KO 1J5EK 4B1ZA 4PKIA 2E2QA 5J2NA 1K8AO 4QCLA 2QXFA 2JWKA 1RBSA 4K0KK 1TKDA 4I9QA 3AGKA 4CJVA 1IKWA 3LAKA 3JXUA 4O8UA 2YHWA 4CE9A 3C95A 4BRAA 4JKCA 4XH1A 5HP1A 4KHWA 2R7YA 2P9NA 1U6ZA 4CEQA 4B3TK 4BQLA 4E7HA 3HBTA 1NG9A 1WAFA 3CPWM 3CC4N 3A2FA 3K5LA 4CERA 2BGGA 3D2FB 4H03B 3E1YA 4F9OA 2H3GX 4CCHA 4GV6A 4CJ3A 3V81A 2X6NA 4IG3A 4FJGA 4JKGA 2HF4A 4AHSA 3AVHA 1EWRA 3EE8A 1X9JA 4PY5A 4C8MA 3R1XA 3SNNA 1IKXA 1TAUA 4FWSA 4BC4A 1U45A 5ELZA 1BA0A 2RE2A 3AA4A 3THWB 4ELVA 3VA3A 5J2QA 1HPMA 5CY4A 4YOVA 3CC7N 5C12A 3ZT2A 1EWQA 1Q8IA 5BN9A 2QKBA 4BR9A 3U6FA 2QWMA 4KH6A 3HJFA 4M3XA 4FOEA 1JXEA 1QTMA 1UWBA 3AO4A 4OJRA 5D3GA 4CJTA 1EXQA 1NMNA 4H0OA 4DV1K 1XC9A 3VA0A 4FLZA 4DTPA 1L5UA 4JLHA 2YNFA 4J2DA 2P9KA 3MCAB 1RT4A 1JL2A 4PL7A 4C8LA 4C8OA 3LDPA 1JLGA 3CCJN 4CZIA 4OKJA 3PO4A 3UIQA 3DJCA 1LWCA 3C65A 3S41A 4X64K 5I9EB 2HHSA 4FM1A 2Q97A 3O3FA 1K9MO 1JCEA 4FWKA 4RW8A 4BE0A 3IMXA 4KTWA 3D2EB 4FJXA 1K8KB 5KGXA 5H1SQ 4DR3K 3D45A 4E7JA 5M1KA 3FZKA 2G8WA 4N47A 3PIOL 3CQ8A 1VQKN 4ISGA 4LF7K 3EKUA 3HYFA 4NCAA 4JKAA 4QS9A 5E41A 2F9WA 3D7EO 1GLLO 2GBZA 4GV9A 5FPMA 1YT3A 2FXUA 4DMNA 2HBJA 3QMLA 1VRUA 2YNHA 4FK4A 4E1MA 3A5MC 3MAQA 5GADP 3VF2A 1LWEA 4IOCL 3UKUA 3OJSA 3DLGA 3HRGA 2BH1A 4F2RA 1LAWA 4E89A 3RMAA 4C23A 3ZSWA 3ULEA 2HNZA 1B9FA 1ASVA 3VGLA 1TGOA 3S3MA 1YJ9N 3NGIA 3AVLA 2UU9K 4CF2A 1VSIA 3H3OB 1OH7A 3THXA 4IEIA 2B6AA 4CZEA 4DSJA 5AQGA 1ZXOA 3V1RA 3DI6A 4O4GA 3KIOA 4FPBA 3VQCA 3AA3A 2FSJA 2A1RA 4NYFA 3THVA 2NRHA 3VQ9A 2WOMA 5HRNA 1VQ8N 5C2FA 4DFMA 4DS5A 4B3OA 4I9LA 3VQ7A 3CCLN 3MEDA 1XMQK 1U4BA 2O4IA 3VQ8A 1G15A 4CEAA 3JSMA 3F73A 1WBBA 3VEVA 3GDQA 3LAMA 3CI5A 4CEZA 3QIPA 4CHNA 4YDUA 2KW4A 4C1NK 4JYAK 2VGMA 3K58A 3H6EA 5AQWA 1VSJA 4HUEA 2D1KA 1JLFA 3HPGA 2YNGA 3TPQA 3H45C 4E1NA 4CGDA 3EO3A 1JLEA 1TL1A 3QESA 4ID5A 4LF6K 4WQ4A 4CGGA 5JLFA 4IO8A 4J2BA 2OA8A 3QDKA 1VQNN 4DCHA 1HNZK 3WXKA 3OW2M 4FJJA 1RGIA 3V9SA 4BROA 5TKWA 1X3NA 4IJNA 4DB3A 3V9ZA 3VF4A 5JICA 5AZJA 3P31A 5BR9A 3T1AA 2P9SB 5E84A 3VMFB 3M5RA 3W0LA 1ASWA 3NE6A 3NVMA 4CJFA 4W5QA 3N4PA 4DFJA 1X1PA 5I3UA 4FWQA 3FZFA 4FJ7A 5IT9O 2KLAA 3SJHA 3ZX2A 1Y64A 1NJIO 1NGBA 2FSNA 4BRPA 1NLVA 4BWMA 3G0ZA 3QNNA 1QSSA 4EP5A 5C42A 5GIPA 1ATSA 4M3ZA 1VSMA 3WEEA 3SQ1A 3MN7A 4YFUA 3SZ2A 4CW7B 3ZT1A 3MN6A 4BGAA 2PYLA 1YIJN 3PX4A 3O8MA 3OYDA 4FJ9A 3MWTA 5C0YA 1WSEA 3HP9A 4RTFD 3MEGA 3OYHA 3PV8A 2WBNA 5AQYA 4DV0K 1V4TA 4R79A 2E1YA 4AHRA 1KSPA 4BR5A 1WOQA 4CJLA 3EL2A 1N8RO 4FJHA 4WFBL 5AQLA 3WT0A 3VERA 5KGWA 4AHCA 2BDPA 1XI1A 3A5OC 3CIPA 3R6MA 3VTHA 2IAJA 3A8YA 2KTQA 3M6GA 3R9PA 3G10A 4WE1A 1JXBA 2ZGYA 1RFQA 5LL6Z 3WUHA 4C8NA 4CIGA 1REVA 1QQOA 4B1XB 1J5OA 3UE5A 4FJIA 1F21A 3C94A 1LAVA 1HUXA 4XEIA 1NK7A 2A6AA 4B3RK 5SZTA 4Q0BA 5FRNA 5EOYA 4DTNA 3QICA 3L2QA 1KAZA 2QWLA 3SJJA 1N36K 5C25A 2O8FA 4CEEA 2O8CB 3OHRA 2WFBA 1TL3A 3TU5A 1X9SA 3V9WA 4HTUA 1HKBA 1S6PA 4CK3A 3AVKA 4BACA 2Z1IA 5CZ1A 4DV7K 4DTUA 1NGFA 4KTQA 2ZE2A 4ZTJA 2HHXA 4EIAA 2UYTA 4DQRA 1NJYA 3VEZA 3CETA 2QWPA 4B9QA 3VPZA 3FLCO 4DSFA 3SQ4A 1C1AA 3E01A 4ISEA 1EKEA 4KV8A 4JV5K 4OPHA 1JCFA 2RKIA 2RN2A 3NHGA 1HNWK
chains in the Genus database with same CATH topology
5AQJA 1MA9B 3VEXA 2ITMA 2FF3B 4XH5A 1JCGA 1HLUA 3MDQA 4FSVA 4FWOA 1YJNN 1VQON 4I6MA 4CZKA 1QZ5A 1TYQA 3BF1A 1VQ6N 5AFUH 2YX6A 1GLCG 1XUPO 5AQXA 5AQZA 2Q1NA 2ASOA 4BRIA 2JWLA 2QWNA 4B1YB 1YI2N 3RSEA 4FVUA 5AZIA 2IVPA 4CJ7A 4JKHA 2KHOA 3KVGA 2HSTA 4CBWA 1DT9A 3I55N 1NMDA 2I7NA 4CZLA 2YHXA 2ZGZA 4JAXA 3T69A 3GBTA 4BRLA 3LDQA 3CJAA 3DXKB 1QQNA 1V4SA 4JKEA 2CH5A 4BC2A 3BUZB 3Q7CA 3P38A 4U7BA 1VQLN 2VGNA 5AQMA 2NRWA 2Q36A 2P9PB 1ZBSA 4IFEA 2GX9A 4AF1A 4EAHD 5ADXH 3HM8A 5M1FA 3J8AA 4JKFA 3CCUN 3VOVA 5BPMA 3IKMA 4YORA 2FSKA 5AQVA 1HKGA 4BVOA 2OTLN 2GWJA 3U4LA 4MDBA 3MX5A 3HOTA 1YVNA 4AM6A 4YDUC 2CH6A 4H0PA 3K9JA 1NWKA 2BTFA 1Q7YO 3O9RA 5AQFA 3O08A 3L4QA 3G25A 3H1VX 3WXLA 4HTLA 3JS6A 4BRMA 1R59O 2A42A 4PKHA 4YOTA 4WQ5C 3WQUA 3NMUA 5GAEP 4DHYA 4JK8A 3AY9A 3ZX0A 1M1KO 4K25A 4B1ZA 1VQ7N 4PKIA 2E2QA 3A5LC 2Q31A 5AZIB 2E88A 1K8AO 1T6DA 2JWKA 4OPAA 3CD6N 2D0OA 3TTFA 3QFUA 3AAPA 4KH4A 3GG4A 3AGKA 3CJCA 3JXUA 3MMVA 4O8UA 4WQ4C 1KAXA 4JEPA 3WEEB 2YHWA 4BC3A 4BQZA 2D0PA 1GLJO 1QVGM 4BRAA 3AGRA 2ZF5O 1C0FA 4JKCA 4ILHA 4XH1A 5AQRA 3ZEUA 1VQPN 3BF3A 4B1UB 3CCMN 2P9NA 3FZMA 1U6ZA 5LJWA 2GWKA 1ESVA 1LCUA 4BQLA 5AQKA 3WXIA 4A61A 3LDOA 3HBTA 3CQXA 3L6QA 2NLXA 1NBWA 3CPWM 5JLHA 3CC4N 3D6RA 3HZ6A 4MDAA 3D2FB 3H46O 3MK6A 2E2PA 4H03B 3E1YA 4BY9C 2QA4N 3I56N 1NGIA 4F9OA 2ZJRL 2H3GX 3A5NC 4ILGB 3CCQN 1YF5L 3VENA 3UKRB 4GV6A 2ASMA 5FPDA 3G71N 1T3VA 3DXMA 2VWBA 3A0IX 3ENOA 4JKGA 2HF4A 3HI0A 4BRFA 1GLDG 2IVOA 1C0GA 4BRQA 3EE8A 1X9JA 3U8XA 3GOIA 1NGDA 2P9SA 3T7ZA 2A3ZA 2P9IB 3O1BA 1EO1A 5LJVA 1NGGA 3R1XA 1NGJA 4K41A 4FWSA 1H1VA 4BC4A 1BA1A 5ELZA 1YJWN 1BA0A 1YHQN 2RE2A 5AQNA 1ATRA 1BU6O 4A57A 5AR0A 1U2VB 1SAZA 1HPMA 3ZEUB 3CJ1A 3VETA 4FOIA 4QS7A 2AP1A 3SK3A 4YOVA 3CC2N 1VQ4N 3CC7N 3GE1A 5C12A 2NRRA 3CJ7A 5KQ8A 5BN9A 4BR9A 3HTVA 2QTDA 2QWMA 4KH6A 4C1NI 4BRGA 4IO9L 1W2BM 3TSQA 4FOEA 4HWIA 4JHDA 4H0OA 1EQYA 4CI6A 3O6WA 4IEEA 2P9KA 3MCAB 4H5RA 4PL7A 2KKZA 4B1WB 3LDPA 4O5FA 4JN4A 2GUPA 3M1FA 3DXMB 5KPRA 4YOYA 4JK7A 3CCJN 4CZIA 3ATUA 3C6HA 4WFAL 5AQUA 1QQMA 1KAYA 3DLLL 3DJCA 3C65A 3S41A 5CR4A 5F2RA 4H5TA 3O4WA 3WXJA 5I9EB 4NLBA 2QXLA 2Q97A 1ATNA 3KK7A 3J7ZO 2A40A 2P9UA 2VYPA 5AQOA 3BEXA 1K9MO 1JCEA 2E2OA 4FWKA 4RCHA 4EHTA 5KPZA 3IMXA 2V7ZA 2V51B 3D2EB 1K8KB 5H1SQ 2QWQA 1NGCA 1NGEA 1BUPA 1SS6A 2WUSA 3FZKA 2YHYA 4H5NA 4CZFA 5M1KA 5GIOA 4WF9L 3VEYA 1YXQA 4MLHA 4BG9A 3PIOL 3WXMB 4ISGA 1VQKN 3EKUA 2Q0UA 4JKAA 4QS9A 3UB5A 5F0XA 4JKDA 2GEMA 5FPEA 3CCSN 2F9WA 5GAGP 3QBWA 2NRTA 4EHUA 2RHKA 3B8AX 4A2BA 4A59A 3D7EO 1GLLO 4GV9A 5FPMA 2FXUA 1QVFM 4H0YB 1HJOA 4I6MB 3ZETA 2E1ZA 2I7PA 2HBJA 3CXCM 1TYQB 1GLEG 3QMLA 1E4GT 2YCHA 4CZGA 5GINA 3KHYA 2FLOA 3E9LA 4FWNA 4NO7A 4BR2A 4CBXA 3SBGA 3A5MC 1Q81O 5GADP 4JD2A 3VF2A 3HOSA 1MWMA 3W3DA 1DGKN 3RSEB 1SQKA 4IOCL 3UKUA 1MWKA 3GL1A 1SZ2A 3LDLA 5CHIA 3CCVN 4YOUA 3P39A 3SAHA 1HX1A 3HRGA 2BH1A 4IOAL 5E26A 1QZ6A 2PBDA 4C23A 2P9UB 3O9TA 3ULEA 3FFKB 3VEWA 3ZX3A 3FGUA 5AQIA 3WQTA 1BG3A 4FWMA 3VGLA 1YJ9N 3VEOA 2QM1A 3MN9A 2E8AA 5AFUA 3H3OB 4GV3A 2ZWHA 4FO0A 3G6EN 1IG8A 5M1PA 1D4XA 4BR0A 4IEIA 4CZEA 5AQGA 1S22A 3OBYA 1ZXOA 3F5TA 3RVCA 5AQPA 1IJJA 5AQTA 4JK9A 2OANA 2W40A 4FPBA 1NGAA 5BRDA 2A41A 2YJEA 2FSJA 1T6CA 1XC3A 3AARA 2HMPA 4H5VA 2DPNA 3O9QA 5M1OA 1J6ZA 2NRHA 4BR7A 4CBUA 4LC9B 5JVGL 2GTDA 2QW9A 5JMVA 3IDHA 5C2FA 1VQ8N 3FR0A 4A5BA 2IIRA 3CCLN 3U9ZA 3MCPA 3EN9A 3VGMA 3EE9A 4RWTA 1GLFO 3VEVA 3GDQA 4WCEL 3CI5A 5ADXA 1TUUA 1S3XA 4GVEA 3R8EA 1JJ2M 1YITN 4PHTX 2PFUA 4KBOA 1VAZA 3Q7BA 3ULEB 3ATVA 2F7TA 3HSCA 4MLEA 4YDUA 3SAGA 1TUYA 3PLAA 4C1NK 1HKCA 3CJBA 2VGMA 3SBTA 1KXPA 2AA4A 4YOWA 1GLBG 3H6EA 5AQWA 2P9LA 2D1KA 5DM7L 2P9NB 4AM7A 4MO4A 3TPQA 4ISFA 3FZHA 2GELA 2YJFA 1Q18A 1T44A 3H45C 1P90A 3N4QA 3EO3A 4DKWA 4H0VB 1Z6RA 5B8HA 1DKGD 4WQ4A 3CERA 3CJ9A 5BREA 4IO8A 5JLFA 2ZJQL 2A5XA 3SMSA 3DXKA 3FZLA 4BR4A 1NM1A 3QDKA 5BPLA 1VQNN 4DCHA 1YAGA 4H0XB 3WXKA 2F9TA 3L0QA 3DAWA 1RGIA 4A2AA 3CF5L 3OW2M 4BVPA 4BROA 4FWPA 5TKWA 5EXWA 1X3NA 4IJNA 4DB3A 5C10A 4YOXA 3O80A 2P9PA 3VF4A 3H1QA 5AQQA 4JKGB 3OBWA 5BRHA 2WC9A 5JICA 4KH5A 5AZJA 5TKYA 3ENBA 3P31A 5BR9A 2P9SB 4IDHA 4FL9A 5E84A 3CHWA 3G4SN 2NNWA 5F1XA 4CD1A 4G9ZA 4IJAA 3VMFB 4E1JA 3M5RA 3W0LA 1BDGA 2E20A 3NVMA 3QFPA 3N4PA 4IZ9A 3E66A 1GLAG 4FWQA 5BN8A 3FZFA 4NB4A 2BUPA 2P9LB 2VCPA 4BRHA 1RDUA 3CMEN 2HBLA 2KLAA 2QEXN 2CGKA 3SJHA 3ZX2A 1Y64A 1NJIO 1NGBA 1P8ZA 2FSNA 2E2NA 5EY4A 2QI2A 3O1WA 1LOTB 4BRPA 1NLVA 3O9SA 1VQ9N 1VQ5N 4BRKA 5GIPA 3CCRN 1ATSA 1OKJA 1XQSC 5C15A 3PIPL 4K43A 5C2DA 2Q0RA 2FF6A 3WEEA 5M1NA 3LDNA 5MLCQ 3MN7A 4JHDB 1S72N 3VESA 1Q86O 2CGJA 2YI1A 3ZYYX 4WYBA 4CZHA 3KWIA 3O9UA 3ID6A 2P9KB 2OTJN 3SAFA 3MN6A 4BGAA 1YIJN 3I8BA 3MWPA 3O8MA 4DQ8A 5C0YA 3MWTA 4M7XA 4RTFD 3AAQA 1BOTO 2WBNA 3LM9A 3MN5A 5AZJB 3LM2A 1G99A 5AQYA 1V4TA 4FWRA 4XH4A 2E1YA 2PAVA 4R79A 3TSUA 3QB0A 4BR5A 5GAHP 1WOQA 4J8FA 3EL2A 3OA9A 1N8RO 1Z05A 4BRDA 4WFBL 1CZAN 3M3ZA 5AQLA 3KZBA 2CGLA 4BGBA 3D2FA 5JVHL 4Y0WA 1OVYA 4M63C 5KQDA 3WT0A 3VERA 1Q82O 5DM6L 1RDWX 3O5BA 4O8KA 3CMAN 1WUAA 1DEJA 3A5OC 4BRCA 2EWSA 3CIPA 2NZTA 3E9OA 3R6MA 4H0TB 3UKRA 2ASPA 3F2KA 3IUCA 4JNEA 3VTHA 4A62A 4MO5A 5LY3A 4GY2B 3A8YA 2ZJPL 4ILJA 3F9MA 3M6GA 3R9PA 4BREA 1MDUB 3ID8A 1QHAA 1KD1O 2P9IA 2HBKA 3CQYA 3TTCA 4EFHA 4QS8A 2HF3A 2Q2RA 2ZGYA 1RFQA 3WUHA 3BP8A 3ZETB 1E4FT 4PL8A 1KC8O 4JKBA 2NRXA 2V7YA 3C7NA 4PKGA 3L4IA 1U2VA 3VGKA 3R3LA 1QQOA 3NVKA 3QBXA 4B1XB 2W41A 3UE5A 5EX5A 4JD2B 1HUXA 4XEIA 3P4IA 3UKUB 3CPEA 2A6AA 3TTDA 1ILYA 3C0BA 4IWVA 5AQHA 3VTIA 1O13A 2V52B 2QWOA 1W97L 3SMPA 5EOYA 3E9PA 4K42A 3I33A 3QICA 1KAZA 1VQMN 2QWLA 4FWLA 3ENHA 4U67L 3KWGA 1KQSM 2NRVA 4NLCA 1YUWA 4M7YA 3OHRA 2WFBA 4WQ5A 5HL7L 3TU5A 1X3MA 2IVNA 1HKBA 3EKSA 4WFNL 3MX2A 3K9KA 4BC5A 3TSPA 4Z94A 1K73O 3H3NO 3VF6A 3DWLA 1NGFA 4BRNA 3C6AA 4IOXA 3EZWA 5AQSA 3LL3A 4OO1J 3SLCA 2QWRA 1ZC6A 1BO5O 4EIAA 3C7NB 5BPNA 3D2EA 5CE3A 4CZJA 1BWFO 2UYTA 1K8KA 5FPNA 3FE1A 5M1QA 2J4RA 5BRFA 4UY8O 2HBMA 3VEZA 3CETA 2HOEA 5EVZA 1M90O 2QWPA 3CCEN 4B9QA 5KPTA 2D4WA 3VPZA 1NGHA 4L3QA 3FLCO 4H5WA 2NRZA 4B1VA 4BG8A 3IFRA 4CD3A 4ISEA 4FPAA 4GNIA 4OPHA 3U9DA 1JCFA 5HOOA 4IXCA 4A5AA 4CZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQJ A;  1MA9 B;  3VEX A;  2ITM A;  2FF3 B;  4XH5 A;  1JCG A;  1HLU A;  3MDQ A;  4FSV A;  4FWO A;  4I6M A;  4CZK A;  1QZ5 A;  1TYQ A;  3BF1 A;  5AFU H;  1GLC G;  1XUP O;  5AQX A;  5AQZ A;  2Q1N A;  2ASO A;  4BRI A;  2QWN A;  4B1Y B;  3RSE A;  5AZI A;  2IVP A;  4CJ7 A;  2KHO A;  3KVG A;  4CBW A;  1NMD A;  2I7N A;  4CZL A;  2YHX A;  2ZGZ A;  4JAX A;  3GBT A;  4BRL A;  3LDQ A;  3CJA A;  3DXK B;  1QQN A;  1V4S A;  2CH5 A;  4BC2 A;  3BUZ B;  5AQM A;  2Q36 A;  2P9P B;  1ZBS A;  4EAH D;  5ADX H;  3HM8 A;  3J8A A;  3VOV A;  5BPM A;  5AQV A;  2FSK A;  4BVO A;  1HKG A;  2GWJ A;  3U4L A;  1YVN A;  4AM6 A;  4YDU C;  2CH6 A;  4H0P A;  1NWK A;  2BTF A;  5AQF A;  3O08 A;  3G25 A;  3H1V X;  3WXL A;  4HTL A;  3JS6 A;  4BRM A;  1R59 O;  2A42 A;  4PKH A;  4WQ5 C;  3WQU A;  4DHY A;  3AY9 A;  3ZX0 A;  4K25 A;  4B1Z A;  4PKI A;  2E2Q A;  3A5L C;  2Q31 A;  5AZI B;  2E88 A;  1T6D A;  2D0O A;  3QFU A;  3AAP A;  3GG4 A;  3CJC A;  3JXU A;  3MMV A;  4WQ4 C;  3WEE B;  1KAX A;  2YHW A;  4BC3 A;  4BQZ A;  2D0P A;  1GLJ O;  4BRA A;  2ZF5 O;  1C0F A;  4XH1 A;  5AQR A;  3ZEU A;  3BF3 A;  4B1U B;  2P9N A;  3FZM A;  1U6Z A;  5LJW A;  2GWK A;  1ESV A;  1LCU A;  4BQL A;  5AQK A;  3WXI A;  4A61 A;  3LDO A;  3HBT A;  3CQX A;  3L6Q A;  2NLX A;  1NBW A;  5JLH A;  3HZ6 A;  3D2F B;  3H46 O;  3MK6 A;  2E2P A;  4H03 B;  1NGI A;  4F9O A;  2H3G X;  3A5N C;  3VEN A;  3UKR B;  2ASM A;  5FPD A;  3DXM A;  2VWB A;  3A0I X;  3ENO A;  2HF4 A;  3HI0 A;  4BRF A;  1GLD G;  2IVO A;  1C0G A;  4BRQ A;  3U8X A;  1X9J A;  3GOI A;  1NGD A;  2P9S A;  2A3Z A;  2P9I B;  3O1B A;  5LJV A;  1NGG A;  1NGJ A;  4K41 A;  4FWS A;  1H1V A;  4BC4 A;  1BA1 A;  5ELZ A;  1BA0 A;  5AQN A;  1ATR A;  1BU6 O;  5AR0 A;  1U2V B;  1SAZ A;  1HPM A;  3ZEU B;  3CJ1 A;  3VET A;  4FOI A;  4QS7 A;  2AP1 A;  3SK3 A;  3GE1 A;  3CJ7 A;  5KQ8 A;  5BN9 A;  4BR9 A;  3HTV A;  2QWM A;  4BRG A;  4FOE A;  4HWI A;  4JHD A;  4H0O A;  1EQY A;  4CI6 A;  3O6W A;  2P9K A;  4H5R A;  4PL7 A;  4B1W B;  3LDP A;  4O5F A;  4JN4 A;  2GUP A;  3M1F A;  3DXM B;  5KPR A;  4CZI A;  3ATU A;  5AQU A;  1QQM A;  1KAY A;  3DJC A;  3S41 A;  5F2R A;  4H5T A;  3O4W A;  3WXJ A;  5I9E B;  2QXL A;  2Q97 A;  1ATN A;  2A40 A;  2P9U A;  2VYP A;  5AQO A;  3BEX A;  1JCE A;  2E2O A;  4FWK A;  4RCH A;  4EHT A;  5KPZ A;  3IMX A;  2V7Z A;  2V51 B;  3D2E B;  1K8K B;  2QWQ A;  1NGC A;  1NGE A;  1BUP A;  2WUS A;  3FZK A;  2YHY A;  4H5N A;  4CZF A;  3VEY A;  1YXQ A;  4MLH A;  4BG9 A;  4ISG A;  3EKU A;  2Q0U A;  4QS9 A;  3UB5 A;  5F0X A;  5FPE A;  2GEM A;  2F9W A;  3QBW A;  4EHU A;  3B8A X;  4A2B A;  3D7E O;  1GLL O;  5FPM A;  2FXU A;  4H0Y B;  1HJO A;  4I6M B;  3ZET A;  2E1Z A;  2I7P A;  1TYQ B;  1GLE G;  3QML A;  1E4G T;  2YCH A;  4CZG A;  3KHY A;  2FLO A;  4FWN A;  4NO7 A;  4BR2 A;  4CBX A;  3A5M C;  4JD2 A;  3VF2 A;  1MWM A;  3W3D A;  1DGK N;  3RSE B;  1SQK A;  3UKU A;  1MWK A;  3GL1 A;  1SZ2 A;  3LDL A;  1HX1 A;  5E26 A;  1QZ6 A;  2PBD A;  4C23 A;  2P9U B;  3ULE A;  3FFK B;  3VEW A;  3ZX3 A;  3FGU A;  5AQI A;  3WQT A;  1BG3 A;  4FWM A;  3VGL A;  3VEO A;  2QM1 A;  3MN9 A;  2E8A A;  5AFU A;  3H3O B;  2ZWH A;  4FO0 A;  1IG8 A;  1D4X A;  4BR0 A;  4CZE A;  5AQG A;  1S22 A;  1ZXO A;  5AQP A;  1IJJ A;  5AQT A;  2OAN A;  2W40 A;  4FPB A;  1NGA A;  5BRD A;  2A41 A;  2YJE A;  2FSJ A;  1T6C A;  1XC3 A;  3AAR A;  2HMP A;  4H5V A;  2DPN A;  4CBU A;  1J6Z A;  2NRH A;  4BR7 A;  4LC9 B;  2GTD A;  2QW9 A;  5JMV A;  3IDH A;  3FR0 A;  2IIR A;  3U9Z A;  3MCP A;  3EN9 A;  3VGM A;  4RWT A;  1GLF O;  3VEV A;  3GDQ A;  3CI5 A;  5ADX A;  1TUU A;  1S3X A;  3R8E A;  4KBO A;  3ULE B;  3ATV A;  3HSC A;  4YDU A;  4MLE A;  1TUY A;  1HKC A;  3CJB A;  1KXP A;  2AA4 A;  1GLB G;  3H6E A;  5AQW A;  2P9L A;  2D1K A;  2P9N B;  4AM7 A;  4MO4 A;  3TPQ A;  4ISF A;  3FZH A;  2GEL A;  2YJF A;  1Q18 A;  1T44 A;  3H45 C;  3EO3 A;  4H0V B;  1Z6R A;  5B8H A;  1DKG D;  4WQ4 A;  3CER A;  3CJ9 A;  5BRE A;  4IO8 A;  5JLF A;  2A5X A;  3SMS A;  3DXK A;  3FZL A;  4BR4 A;  1NM1 A;  3QDK A;  5BPL A;  4DCH A;  1YAG A;  4H0X B;  3WXK A;  2F9T A;  3L0Q A;  3DAW A;  1RGI A;  4A2A A;  4BVP A;  4BRO A;  4FWP A;  5EXW A;  1X3N A;  4IJN A;  4DB3 A;  3O80 A;  2P9P A;  3VF4 A;  3H1Q A;  5AQQ A;  5BRH A;  5JIC A;  5AZJ A;  5TKY A;  5BR9 A;  2P9S B;  4FL9 A;  5E84 A;  3CHW A;  5F1X A;  4CD1 A;  4IJA A;  4E1J A;  3W0L A;  1BDG A;  2E20 A;  3QFP A;  4IZ9 A;  1GLA G;  4FWQ A;  5BN8 A;  3FZF A;  4NB4 A;  2BUP A;  2P9L B;  2VCP A;  4BRH A;  2CGK A;  3SJH A;  3ZX2 A;  1Y64 A;  1NGB A;  1P8Z A;  2FSN A;  2E2N A;  5EY4 A;  3O1W A;  4BRP A;  1LOT B;  1NLV A;  4BRK A;  1ATS A;  1OKJ A;  1XQS C;  4K43 A;  2Q0R A;  2FF6 A;  3WEE A;  3LDN A;  3MN7 A;  4JHD B;  3VES A;  2CGJ A;  2YI1 A;  4WYB A;  4CZH A;  2P9K B;  3MN6 A;  4BGA A;  3I8B A;  3O8M A;  4DQ8 A;  4M7X A;  4RTF D;  3AAQ A;  1BOT O;  3LM9 A;  3MN5 A;  5AZJ B;  3LM2 A;  1G99 A;  5AQY A;  1V4T A;  4FWR A;  4XH4 A;  2E1Y A;  2PAV A;  3QB0 A;  4BR5 A;  1WOQ A;  4J8F A;  3EL2 A;  1Z05 A;  4BRD A;  1CZA N;  3M3Z A;  5AQL A;  3KZB A;  2CGL A;  4BGB A;  3D2F A;  4Y0W A;  4M63 C;  5KQD A;  3WT0 A;  3VER A;  1RDW X;  3O5B A;  4O8K A;  1WUA A;  1DEJ A;  3A5O C;  4BRC A;  2EWS A;  3CIP A;  2NZT A;  3R6M A;  4H0T B;  3UKR A;  2ASP A;  3IUC A;  4JNE A;  4A62 A;  5LY3 A;  4MO5 A;  4GY2 B;  3A8Y A;  3F9M A;  3M6G A;  3R9P A;  4BRE A;  1MDU B;  3ID8 A;  1QHA A;  2P9I A;  3CQY A;  4EFH A;  4QS8 A;  2HF3 A;  2Q2R A;  2ZGY A;  1RFQ A;  3WUH A;  3BP8 A;  3ZET B;  1E4F T;  4PL8 A;  2V7Y A;  3C7N A;  4PKG A;  3L4I A;  1U2V A;  3VGK A;  1QQO A;  3QBX A;  4B1X B;  2W41 A;  3UE5 A;  5EX5 A;  4JD2 B;  1HUX A;  4XEI A;  3P4I A;  3UKU B;  2A6A A;  3C0B A;  4IWV A;  5AQH A;  2V52 B;  2QWO A;  3SMP A;  5EOY A;  4K42 A;  3I33 A;  3QIC A;  1KAZ A;  2QWL A;  4FWL A;  3ENH A;  1YUW A;  4M7Y A;  3OHR A;  4WQ5 A;  3TU5 A;  1X3M A;  2IVN A;  1HKB A;  3EKS A;  4BC5 A;  4Z94 A;  3H3N O;  3VF6 A;  3DWL A;  1NGF A;  4BRN A;  3EZW A;  5AQS A;  3LL3 A;  3SLC A;  2QWR A;  1ZC6 A;  1BO5 O;  4EIA A;  3C7N B;  5BPN A;  3D2E A;  5CE3 A;  4CZJ A;  1BWF O;  1K8K A;  2UYT A;  5FPN A;  3FE1 A;  2J4R A;  5BRF A;  3VEZ A;  3CET A;  2HOE A;  5EVZ A;  2QWP A;  4B9Q A;  5KPT A;  2D4W A;  3VPZ A;  1NGH A;  4L3Q A;  3FLC O;  4H5W A;  4B1V A;  4BG8 A;  3IFR A;  4CD3 A;  4ISE A;  4FPA A;  4GNI A;  3U9D A;  1JCF A;  4IXC A;  4CZM A; 
#chains in the Genus database with same CATH topology
 2FF3 B;  3DRP A;  4CJE A;  3MDQ A;  1YJN N;  1VQO N;  2HHU A;  1WSI A;  1Y97 A;  3BF1 A;  4CJQ A;  1GLC G;  1XUP O;  5AQX A;  4FLU A;  2FC0 A;  4BRI A;  2JWL A;  3NF9 A;  4B1Y B;  3RSE A;  4KHQ A;  4CJ7 A;  1JLA A;  3PX6 A;  3O3G A;  2ITG A;  2HST A;  4CBW A;  3WNE A;  4R5P A;  3SQ0 A;  2VG7 A;  1OH8 A;  2YHX A;  1VHX A;  1QE1 A;  3LDQ A;  2CH5 A;  3P38 A;  1CLQ A;  4M3T A;  5JS2 A;  1U49 A;  1GOA A;  2P9P B;  1ZBU A;  5ADX H;  3HM8 A;  1YTA A;  1D5A A;  3CCU N;  1WAJ A;  3AVJ A;  5BPM A;  1TVR A;  4BVO A;  1HKG A;  1Q9X A;  3U4L A;  2DFE A;  3AO1 A;  5BR8 K;  2CH6 A;  3K9J A;  2BTF A;  3TR8 A;  4LF4 K;  1WBD A;  3O08 A;  4PKH A;  2IC3 A;  3OYK A;  1JLB A;  4DR6 K;  4OPK A;  1T6D A;  3DMJ A;  3TTF A;  4DLG A;  3GG4 A;  3CJC A;  2G8K A;  1Z25 A;  1JKH A;  2O8E B;  2HHW A;  3PSI A;  3AVI A;  2D0P A;  4B9N A;  3AGR A;  2HVI A;  3HPH A;  1C0F A;  3L3U A;  5AQR A;  3THY B;  3ZEU A;  1VQP N;  3BF3 A;  4CK1 A;  3NCI A;  4Z4I A;  4W5T A;  4E0D A;  1LCU A;  4A61 A;  3CQX A;  2NLX A;  4FJ8 A;  1OH6 A;  1QQC A;  4MDA A;  2E2P A;  2QA4 N;  1NGI A;  3CCQ N;  1YF5 L;  3UKR B;  5FPD A;  1T3V A;  3DXM A;  3ZT0 A;  1BCM A;  1GLD G;  2IVO A;  4CGF A;  1C0G A;  3GOI A;  1EO1 A;  4OKE A;  4DTS A;  4CJR A;  1XNQ K;  1NGJ A;  1RTD A;  4K41 A;  1D8Y A;  1BA1 A;  3T1H K;  4Z4C A;  5AQN A;  4DSK A;  5AR0 A;  1SAZ A;  4FOI A;  1S5J A;  1C1C A;  3VQ5 A;  1VQ4 N;  1RBV A;  5KRS A;  2NRR A;  1EP4 A;  5KQ8 A;  5DMR A;  4E19 A;  4ZTF A;  3LAN A;  2DY4 A;  1KTQ A;  1NOZ A;  3O6W A;  4IEE A;  4CI6 A;  3HO1 A;  3KLE A;  4H5R A;  4KI4 A;  2F8T A;  3NH2 A;  3M8P A;  3M1F A;  3LWL A;  4YOY A;  2PYJ A;  3ATU A;  3LDS A;  4IBN A;  2DFH A;  4M3Y A;  3WNG A;  5KRT A;  3WXJ A;  2PZS A;  3J7Z O;  2A40 A;  2P9U A;  2VYP A;  3BEX A;  4H4O A;  2E2O A;  2V7Z A;  3LZI A;  4Y1D A;  4B8A B;  4KKO A;  1NGC A;  4CVN E;  1HNI A;  1NGE A;  4FVM A;  1KCF A;  1RBT A;  4H5N A;  4DR7 K;  5GIO A;  4NCG A;  3KD1 E;  3LP0 A;  2Q0U A;  3IS9 A;  3CCS N;  5GAG P;  3ULD A;  4EHU A;  4A59 A;  4I2Q A;  3HVR A;  1QVF M;  2ZQB A;  1HJO A;  4I6M B;  3CXC M;  2I7P A;  1TYQ B;  5GIN A;  1E4G T;  4CF1 A;  1C0M A;  2FLO A;  4FWN A;  1L3U A;  1Q81 O;  3K59 A;  4JD2 A;  3HOS A;  4CJP A;  4C8K A;  1ZBH A;  1SZ2 A;  1HX1 A;  4IOA L;  2KZM A;  2WTU A;  4FJM A;  1QZ6 A;  2PBD A;  4O5B A;  3O9T A;  3VEW A;  3ZX3 A;  2E6L A;  1VSL A;  3FGU A;  4N76 A;  5AQI A;  2VWJ A;  3ZT3 A;  4FWM A;  4Z4E A;  4CEB A;  2E5L K;  1SKW A;  1RBU A;  4FO0 A;  3G6E N;  1IG8 A;  5M1P A;  1D4X A;  4BR0 A;  4CFB A;  4KHS A;  3OBY A;  1RCH A;  2HHV A;  3BZC A;  2W40 A;  4DQS A;  4JI3 K;  1NGA A;  3VQA A;  2YJE A;  3AAR A;  2VWK A;  4CBU A;  3OYC A;  3IDH A;  3L8B A;  3QEW A;  3VQP A;  4V19 S;  4A5B A;  3AO3 A;  3TAR A;  3OS2 A;  3MCP A;  3EE9 A;  3HP6 A;  4WCE L;  2OZM A;  1S3X A;  4GVE A;  3R8E A;  1JJ2 M;  4EZ9 A;  4NXM K;  4DV2 K;  2PFU A;  5CZ2 A;  1NKC A;  2HHQ A;  2XY6 A;  1N34 K;  1VAZ A;  3Q7B A;  1TK0 A;  3ULE B;  4KPY A;  3B6O A;  1HKC A;  4DTR A;  3EYZ A;  1KXP A;  2P9L A;  1WSJ A;  5DM7 L;  4CJW A;  1FJG K;  2YJF A;  1WLJ A;  4IFY A;  1HYS A;  3ZSR A;  2P5O A;  4B08 A;  3OS0 A;  5B8H A;  1DKG D;  3CER A;  4DTX A;  3OYJ A;  4IFV A;  3SMS A;  3DXK A;  1NM1 A;  2IOC A;  1DTT A;  4H0X B;  2QKK A;  4TSX A;  1I39 A;  4IKF A;  5EXW A;  3T1Y K;  5BRH A;  3OBW A;  4GKK K;  3KLF A;  4KH5 A;  4H4M A;  4LFA K;  1HMV A;  4G1Q A;  3G4S N;  3QEI A;  4CD1 A;  1RIL A;  1N32 K;  4E1J A;  1KVA A;  4PUO A;  2XRI A;  4B9T A;  2KQ2 A;  1GLA G;  2BUP A;  5KI6 A;  2VCP A;  2E6M A;  3CME N;  2DTU A;  2P1J A;  1O1W A;  3O1W A;  1LOT B;  4F4K A;  4L8R B;  1B92 A;  4YY3 K;  1VQ9 N;  3OYA A;  4JI1 K;  4BRK A;  1OKJ A;  1XQS C;  3AVB A;  2O8B A;  5C2D A;  3OYI A;  4JHD B;  1S72 N;  3VES A;  1WSF A;  2YI1 A;  3KWI A;  3ID6 A;  2G8U A;  5SWM A;  4FZX C;  2OTJ N;  3RMC A;  3AAQ A;  1BOT O;  4FJN A;  2O4G A;  3MN5 A;  1T7P A;  5AZJ B;  3LM2 A;  1G99 A;  3JYT A;  3V1Q A;  4ELT A;  1NKE A;  3K2P A;  2PAV A;  3TSU A;  3QB0 A;  1UA0 A;  1SL1 A;  1Z05 A;  4BRD A;  1CZA N;  2CGL A;  4BGB A;  1S9G A;  3D2F A;  4Y0W A;  1OVY A;  5T7B A;  3OJU A;  5JVH L;  3U3Y A;  2OPS A;  3CMA N;  2EWS A;  2NZT A;  4CGJ A;  4W5O A;  1OH5 A;  4YHH K;  3IUC A;  3I8D A;  4A62 A;  1W0H A;  4GY2 B;  2DFF A;  5AJ3 K;  3M8S A;  3ID8 A;  1HNX K;  1QHA A;  1NK5 A;  3QIN A;  2HF3 A;  2Q2R A;  4CFC A;  3BP8 A;  3ZET B;  4PL8 A;  1KC8 O;  3THW A;  2Q3S A;  3C7N A;  4PKG A;  3FFI A;  3R3L A;  3QBX A;  1NK0 A;  4LF9 K;  3KJV A;  3JAM O;  4JI2 K;  3P4I A;  4DR1 K;  3CPE A;  3IRX A;  1ILY A;  3C0B A;  4IWV A;  3VTI A;  1WSH A;  3E9P A;  4K42 A;  3I33 A;  4GMJ B;  3ENH A;  4FZZ A;  1NU0 A;  4NLC A;  1YUW A;  1N6Q A;  3QER A;  3NF6 A;  1VSH A;  3QIO A;  3P1G A;  4FM0 A;  4DV4 K;  4BC5 A;  4OVL A;  2KFN A;  4Z94 A;  2OCE A;  3CFR A;  1VK0 A;  4BRN A;  1WN7 A;  3NGY A;  3LL3 A;  3TAE A;  1LV5 A;  4DV3 K;  2QWR A;  1FW6 A;  3QNO A;  3KLG A;  4LSN A;  3D2E A;  5CE3 A;  4CZJ A;  1K8K A;  4FK0 A;  4CEF A;  2HOE A;  1IKV A;  3CCE N;  1TKT A;  2D4W A;  4M41 A;  4BG8 A;  2UUA K;  1HRH A;  3QLH A;  5HRO A;  4FPA A;  4GNI A;  1RDD A;  1DTQ A;  4MQ3 A;  1XNR K;  1BQM A;  2YKN A;  5JS1 A;  3U3G A;  4XH5 A;  4FWO A;  1A5X A;  4CZK A;  1QZ5 A;  5AFU H;  3ASM A;  4HCB A;  1KFS A;  4LF5 K;  1BGX T;  2D5R A;  3HL8 A;  5AZI A;  2IVP A;  5J2P A;  1T8E A;  2E4L A;  3RRG A;  2BAN A;  2HMI A;  2HHT A;  4JAX A;  4AHU A;  4BRL A;  3CJA A;  4JKE A;  4BC2 A;  3NH0 A;  3OY9 A;  4DU4 A;  4FXD A;  2VGN A;  1JLQ A;  1C0T A;  2Q36 A;  4IFE A;  2Y1I A;  1S1V A;  4X62 K;  1X9M A;  5M1F A;  1BIS A;  4JKF A;  4BWJ A;  3VOV A;  3OYE A;  2FBY A;  3MXI A;  2FSK A;  2GWJ A;  2B4J A;  3O3H A;  3MX5 A;  3TWH A;  1YVN A;  1NWK A;  4JRQ A;  4LD0 A;  1S1U A;  4BDZ A;  3H1V X;  3WXL A;  3K5M A;  4E7I A;  3JS6 A;  4BRM A;  4YOT A;  3NMU A;  3WQU A;  4DHY A;  4Z4H A;  2O8D B;  3AY9 A;  2D0C A;  3ZX0 A;  4K25 A;  1VQ7 N;  3A5L C;  1WSG A;  2E88 A;  4CJU A;  1C0U A;  4DR5 K;  4BDP A;  3DRS A;  3QFU A;  4KH4 A;  3AVN A;  3MMV A;  1KAX A;  2P5G A;  4CGI A;  3DOK A;  1TV6 A;  2OPP A;  4MFB A;  3S3N A;  1FK9 A;  2RF2 A;  4JI8 K;  4I2P A;  4ILH A;  4DV5 K;  4PQU A;  3CCM N;  5LJW A;  1RT6 A;  3FZM A;  3LAL A;  1NK8 A;  4DG1 A;  1LWF A;  5AQK A;  1RT5 A;  3LDO A;  1J53 A;  5HRR A;  1CXQ A;  3D6R A;  2OPR A;  4HCC A;  1W9H A;  3MK6 A;  3A5N C;  3VEN A;  2ASM A;  5HRS A;  3TAP A;  3ITH A;  3A0I X;  3ENO A;  3HI0 A;  4BRF A;  3VN5 A;  1GOC A;  3U8X A;  2YHA A;  5K14 A;  2P9S A;  4KHP K;  2P9I B;  3NBP A;  5LJV A;  2XY7 A;  1SKS A;  2FBV A;  1W7A A;  1H1V A;  4K8X A;  4Z0U A;  3DLR A;  4FJK A;  1J9A A;  4RW9 A;  1YJW N;  1YHQ N;  3KTQ A;  3PUF A;  1BU6 O;  1U2V B;  1SL2 A;  2FBX A;  3ZEU B;  3VET A;  1FXX A;  4QS7 A;  3SK3 A;  3SCX A;  3CC2 N;  2XY8 A;  5CYQ A;  2XHB A;  2QTD A;  2GUI A;  4BRG A;  3TAQ A;  4IO9 L;  4F8R A;  3AVA A;  4FYD A;  4HWI A;  3I0S A;  4DWI A;  3DLK A;  3L2R A;  3DM2 A;  2KKZ A;  4B1W B;  3CM6 A;  4O5F A;  4W5R A;  1ZYQ A;  4JN4 A;  2GUP A;  4DU3 A;  3DXM B;  3HM9 A;  4JK7 A;  4WFA L;  5AQU A;  4CIF A;  1EX4 A;  1KAY A;  1QQM A;  3DLL L;  3HK2 A;  5CR4 A;  4NLB A;  5LMN K;  3KK7 A;  4BE1 A;  3EZ5 A;  3CM5 A;  3VQD A;  3NAE A;  2V51 B;  4KO0 A;  4FLW A;  2QWQ A;  1RDA A;  4FJ5 A;  4CZF A;  2BE2 A;  2YHY A;  1BL3 A;  4M3W A;  3VEY A;  1YXQ A;  1RT7 A;  3WXM B;  1DLO A;  3HVT A;  4JKD A;  2GEM A;  3QBW A;  2NRT A;  3B8A X;  4A2B A;  4H0Y B;  1IKY A;  4OLA A;  1GLE G;  4CJK A;  4N41 A;  3KHY A;  4I7F A;  4JI6 K;  4JI0 K;  4NO7 A;  4BR2 A;  3SBG A;  3RMB A;  1MWM A;  3W3D A;  1SQK A;  3GL1 A;  4H8K A;  3K57 A;  5CHI A;  3ZT4 A;  1HR0 K;  3SAH A;  2VQE K;  1RT3 A;  2P9U B;  3ZSQ A;  3FFK B;  3CYM A;  1IG9 A;  4CHP A;  3WQT A;  1BG3 A;  4DR4 K;  1RDC A;  4O0J A;  1HQE A;  4CJS A;  2QM1 A;  4CHY A;  4KAZ A;  1HPZ A;  2ZWH A;  5FLX O;  1BQN A;  3O4Q A;  3RVC A;  5AQP A;  4CED A;  1NK6 A;  1IJJ A;  5AQT A;  3DLB A;  1BI4 B;  4KI6 A;  4JI7 K;  1T6C A;  1XC3 A;  4JS5 A;  4H5V A;  3O9Q A;  4J2A A;  3SV4 A;  1J6Z A;  1RT1 A;  4LC9 B;  2YV0 X;  3P5J A;  1FKO A;  1BCO A;  3U9Z A;  3EN9 A;  3VGM A;  1L3S A;  1S1W A;  3PSF A;  1JL1 A;  4FLV A;  5ADX A;  1TUU A;  2Z1J A;  4FJL A;  1SKR A;  2JLE A;  1YIT N;  3ATV A;  2F7T A;  3HSC A;  3SAG A;  4KHN A;  1TUY A;  2PY5 A;  3PLA A;  4AHV A;  5HBM A;  3SBT A;  4YOW A;  2AA4 A;  1GLB G;  1U48 A;  2P9N B;  1ZBI A;  4MO4 A;  3AA2 A;  4ISF A;  3FZH A;  4B9L A;  1T44 A;  3N4Q A;  4DKW A;  4RW6 A;  3DOL A;  2FBT A;  4X65 K;  1Z6R A;  3CJ9 A;  2ZJQ L;  3OTO K;  2A5X A;  3FZL A;  5BPL A;  1XMO K;  2F9T A;  3DAW A;  4A2A A;  2HW3 A;  4FWP A;  2P9P A;  1MU2 A;  3NFA A;  4JKG B;  1EET A;  2WC9 A;  3J81 O;  1S1T A;  2F4V K;  4IDH A;  3V9X A;  5F1X A;  2RPI A;  1BDG A;  1S6Q A;  3QFP A;  3E66 A;  2GV9 A;  2P51 A;  4FM2 A;  2KFZ A;  4NB4 A;  2IS3 A;  2P9L B;  2UUC K;  1RDU A;  2HBL A;  2QEX N;  3OYG A;  1IBM K;  5EY4 A;  2E2N A;  3RR7 A;  3O9S A;  2VG6 A;  1RBR A;  3CCR N;  4FLX A;  5C15 A;  4AIL C;  4K43 A;  2AJQ A;  3LDN A;  3J7A P;  2O8E A;  1Q86 O;  1ASU A;  4CZH A;  3O9U A;  3LPT A;  4CK2 A;  2P9K B;  4JS4 A;  3SAF A;  4RW7 A;  3THY A;  4B8C A;  5FDL A;  1RDB A;  4M7X A;  4FZY A;  4Q5V A;  2HHH K;  2X6S A;  2IDO A;  4DLE A;  2YNI A;  4FWR A;  4PA1 A;  1L3V A;  4XH4 A;  3ZLJ A;  4GW6 A;  4GVM A;  2UUB K;  1BHL A;  3KZB A;  4M63 C;  4DF4 A;  5DM6 L;  4FCY A;  3B6P A;  3O5B A;  4O8K A;  1WUA A;  4BRC A;  3E9O A;  3UKR A;  1VRT A;  3F2K A;  3OVN A;  5LY3 A;  1L3T A;  4MO5 A;  4DUY K;  4ILJ A;  3F9M A;  1MDU B;  1LW2 A;  2O8B B;  1KLN A;  2UXB K;  1U04 A;  3CQY A;  4EFH A;  3SUP A;  3BY5 A;  3OYB A;  4BE2 A;  3AA5 X;  4JKB A;  2NRX A;  3L4I A;  3NVK A;  3BGR A;  2W41 A;  3J80 O;  5EX5 A;  3AVF A;  3H08 A;  1HYZ A;  3UKU B;  5HLF A;  4LY7 A;  5AQH A;  4B9S A;  2V52 B;  2QWO A;  1W97 L;  3SMP A;  3KK3 A;  1KRP A;  1CXU A;  4FWL A;  1KQS M;  3AVC A;  4M7Y A;  1KFD A;  4WQ5 A;  1X3M A;  3VQ6 A;  3THX B;  2IVN A;  4DU1 A;  3PO5 A;  3MX2 A;  5KTQ A;  3TSP A;  3NF7 A;  4F3T A;  3LP2 A;  1HNV A;  2XO7 A;  4IOX A;  2VQF K;  5AQS A;  4Z4G A;  2G8I A;  1ZC6 A;  3RMD A;  1BO5 O;  2Z1H A;  3C7N B;  3TAG A;  1IBL K;  4B3S K;  2A1S A;  5FPN A;  5M1Q A;  2J4R A;  4UY8 O;  4LFB K;  4DSI A;  1NK4 A;  5KPT A;  4F3O A;  1NGH A;  3HST B;  4L3Q A;  5FRO A;  2NRZ A;  4B1V A;  3IFR A;  2HB5 A;  5HOO A;  4IXC A;  1RTH A;  1XWL A;  2Z1G A;  4CZM A;  5AQJ A;  3VQ4 A;  2ITM A;  3SUN A;  1RNH A;  1JCG A;  3RWU A;  4I6M A;  4DFK A;  1TYQ A;  1A5W A;  3OYN A;  2YX6 A;  4OGC A;  5AQZ A;  4YNQ A;  3EY1 A;  4OLB A;  3ZCM A;  2ASO A;  3TAB A;  2QWN A;  1YI2 N;  4FVU A;  4JKH A;  3KVG A;  1DT9 A;  3I55 N;  1NMD A;  3K0S A;  2I7N A;  2ZGZ A;  2F96 A;  3VQQ A;  3T69 A;  2QK9 A;  3GBT A;  4LH4 A;  1V4S A;  3Q7C A;  4U7B A;  1B9D A;  5AQM A;  2NRW A;  2KZZ A;  1S1X A;  4EAH D;  1TAQ A;  1ZBL A;  3J8A A;  1TKX A;  3KK2 A;  1TK8 A;  4IG0 A;  3HOT A;  4AM6 A;  3S3O A;  4YDU C;  4UQG A;  4KRF A;  1Q7Y O;  1WB9 A;  3G25 A;  1R59 O;  1RTJ A;  4JK8 A;  1NNE A;  3F9K A;  3L3V A;  5AZI B;  2Q31 A;  3CD6 N;  4OPA A;  2D0O A;  3AAP A;  3AVM A;  4WQ4 C;  3WEE B;  1N33 K;  4JEP A;  3V4I A;  4BC3 A;  4BQZ A;  1VSD A;  1GLJ O;  3HXM A;  1QVG M;  1K6Y A;  2OYQ A;  4B3M K;  2ZF5 O;  3K5O A;  3KK1 A;  4B1U B;  1T03 A;  3OYM A;  2UXC K;  1IV0 A;  2GWK A;  1ESV A;  4GKJ K;  2W42 A;  4JRP A;  3WXI A;  3SUO A;  3AO5 A;  2G8H A;  2YHB A;  1I3A A;  3L6Q A;  1NBW A;  4JI4 K;  5JLH A;  4DUZ K;  3KKS A;  2G8V A;  3HZ6 A;  3AVG A;  1E3M A;  3H46 O;  1KVC A;  4BY9 C;  3I56 N;  2ZJR L;  2D0B A;  4ILG B;  4NXN K;  1BIU A;  3G71 N;  1NK9 A;  1VSK A;  2VWB A;  2IGI A;  4BRQ A;  1NGD A;  3T7Z A;  2A3Z A;  3QEV A;  3O1B A;  4OX9 K;  1NGG A;  4CES A;  1BIZ A;  3L2U A;  2ATQ A;  4CGH A;  3KLH A;  3CFO A;  1ATR A;  4A57 A;  4FLT A;  4HUF A;  4DQP A;  3CJ1 A;  2AP1 A;  3GE1 A;  3SPZ A;  3CJ7 A;  3HTV A;  3K5N A;  4C1N I;  1W2B M;  3TSQ A;  4FW1 A;  1HJR A;  1SL0 A;  1YVU A;  4JHD A;  4KHY A;  1LW0 A;  3LP1 A;  4CIE A;  1EQY A;  3IG1 A;  3LPU A;  3J7Y P;  3CFP A;  3WNH A;  2W6K A;  4M3U A;  2O8F B;  3BDP A;  1R0A A;  5KPR A;  4DFP A;  3C6H A;  4DS4 A;  4KTZ A;  4CFD A;  1VSF A;  5F2R A;  4H5T A;  3O4W A;  4LF8 K;  2QXL A;  1ATN A;  5AQO A;  4RCH A;  4W5N A;  4EHT A;  5KPZ A;  3P83 D;  4HHT A;  4QAG A;  1BUP A;  3DRR A;  1SS6 A;  2WUS A;  3M8Q A;  4WF9 L;  4IDK A;  3ZSO A;  2G8F A;  4O55 A;  4DQI A;  4BG9 A;  4MLH A;  3RTV A;  1FKP A;  3TAM A;  4DSL A;  3UB5 A;  5F0X A;  5FPE A;  2RHK A;  4AHT A;  3KLI A;  5J1E A;  1C6V A;  3ZET A;  2E1Z A;  4CZG A;  2YCH A;  3BZK A;  3E9L A;  3DYA A;  4CBX A;  4ICL A;  4CFA A;  1DGK N;  3RSE B;  3LWM A;  2EHG A;  1MWK A;  3LDL A;  3CCV N;  4YOU A;  3P39 A;  5J2M A;  5E26 A;  4CHO A;  4FLY A;  4B9U A;  2VG5 A;  1YTU A;  3VEO A;  1I94 K;  3MN9 A;  1IH7 A;  2E8A A;  5AFU A;  1X9W A;  4GV3 A;  3L2V A;  4F2S A;  2LSN A;  1S22 A;  3F5T A;  1S9E A;  2X78 A;  3KD5 E;  4JK9 A;  2OAN A;  1ITG A;  5BRD A;  2A41 A;  1GOB A;  1CZB A;  4LH5 A;  4EZ6 A;  2HMP A;  5M1O A;  2DPN A;  5DK5 A;  4BR7 A;  3QO9 A;  5JVG L;  2GTD A;  2QW9 A;  5JMV A;  3FR0 A;  2IIR A;  4RG8 A;  3PY8 A;  3D0P A;  4RWT A;  1GLF O;  4B9M A;  5A2Q O;  4ZHR A;  1J54 A;  1HQU A;  5C24 A;  4PHT X;  4KBO A;  1D9F A;  4RW4 A;  3KKR A;  4MLE A;  2ETJ A;  3SV3 A;  3OS1 A;  1RT2 A;  3CJB A;  4J2E A;  1SUQ A;  3ZSV A;  4AM7 A;  4DQQ A;  1CZ9 A;  2GEL A;  1Q18 A;  1P90 A;  4H0V B;  4KHU A;  4OPJ A;  5BRE A;  3WNF A;  4CF9 A;  4BR4 A;  1RTI A;  1YAG A;  1XHZ A;  3L0Q A;  3NF8 A;  3CF5 L;  3HT3 A;  4BVP A;  3NDK A;  4KFB A;  5C10 A;  4YOX A;  3O80 A;  4CJ5 A;  4O44 A;  3H1Q A;  5AQQ A;  1Q9Y A;  5TKY A;  3ENB A;  4Y1C A;  4FL9 A;  3CHW A;  3S9H A;  2NNW A;  4G9Z A;  4IJA A;  4CEO A;  4QOZ B;  2HVH A;  1JLC A;  2E20 A;  4FW2 A;  4IZ9 A;  2I5J A;  5BN8 A;  4BRH A;  3CG7 A;  4B9V A;  4LSL A;  2CGK A;  2O8D A;  4X66 K;  4EP4 A;  4DR2 K;  3ALY A;  1P8Z A;  1QSL A;  2Y1J A;  2QI2 A;  3LZJ A;  3MXM A;  1T05 A;  3SYZ A;  1VQ5 N;  2F8S A;  1NJX A;  2EX3 A;  3PIP L;  2Q0R A;  2FF6 A;  4HVJ A;  5M1N A;  5MLC Q;  2ZM6 K;  2CGJ A;  3ZYY X;  1N5Y A;  4WYB A;  5I42 A;  1XHX A;  4DTJ A;  4AQY K;  4Z4F A;  3ZSZ A;  3V6D A;  3QET A;  3I8B A;  3MWP A;  4DQ8 A;  1VSE A;  1NJW A;  3HPO A;  4LFC K;  3LM9 A;  1QS4 A;  3T19 A;  1HYV A;  4CHZ A;  3SI6 A;  5GAH P;  1TK5 A;  4J8F A;  3OA9 A;  2UXD K;  1QSY A;  1IO2 A;  4M45 A;  3M3Z A;  5KQD A;  4E7K A;  1Q82 O;  4KRE A;  1RDW X;  1KVB A;  2O8C A;  1Z26 A;  1DEJ A;  1U47 A;  4H0T B;  4DTO A;  3AO2 A;  3C6U A;  2ASP A;  3EEQ A;  4JNE A;  4E3S A;  1C1B A;  2ZJP L;  4KB0 A;  4BRE A;  3OYL A;  3O4N A;  3TI0 A;  1KD1 O;  2P9I A;  3V1O A;  3ZSY A;  1D9D A;  2HBK A;  3TTC A;  4CJ4 A;  4QS8 A;  1QHT A;  1E4F T;  2OZS A;  2V7Y A;  3I0R A;  3TAN A;  4CF8 A;  4KB1 A;  1U2V A;  3VGK A;  4BDY A;  1KLM A;  4DV6 K;  4JD2 B;  3L2W A;  4M3R A;  3TTD A;  1O13 A;  3SPY A;  1NKB A;  4OGE A;  2WON A;  1VQM N;  4CEC A;  4U67 L;  3NGZ A;  3KWG A;  2HND A;  5CYM A;  4OKK A;  2NRV A;  3MEC A;  3DLE A;  3V9U A;  3QEX A;  5HL7 L;  3TAF A;  4K8Z A;  3EKS A;  3C6T A;  4WFN L;  3RRH A;  3PX0 A;  3K9K A;  4HUG A;  5LMU K;  1K73 O;  3H3N O;  3DLH A;  3VF6 A;  3DWL A;  3C6A A;  3EZW A;  4NYN A;  4DSE A;  4M42 A;  4OO1 J;  3SLC A;  1IBK K;  5BPN A;  3LP3 A;  1BWF O;  4N56 A;  4ID1 A;  4N5S A;  3FE1 A;  5FRM A;  5BRF A;  1UAX A;  2HBM A;  1M90 O;  5EVZ A;  1ZBF A;  4H5W A;  3IAY A;  1UOC A;  4CD3 A;  3MXJ A;  3U9D A;  3T3F A;  2X74 A;  4A5A A;  4DTM A;  5HRP A;  1MA9 B;  1TKZ A;  1NOY A;  3VEX A;  4ELU A;  2D0A A;  4JI5 K;  1HLU A;  1SV5 A;  4FSV A;  3RR8 A;  1WNS A;  2YKM A;  1VQ6 N;  4XIU A;  2W6L A;  5EU7 A;  4O0I A;  1OVQ A;  2Q1N A;  3SUQ A;  3AV9 A;  2ZD1 A;  4CHQ A;  4PWD A;  2KHO A;  4NCB A;  1NJZ A;  3M8R A;  2XY5 A;  2B5J A;  4CZL A;  4AH9 A;  1UA1 A;  3NH1 A;  3DXK B;  1QQN A;  5IWA K;  3BUZ B;  1A5V A;  1VQL N;  2HNY A;  1ZBS A;  2GX9 A;  4AF1 A;  4CF0 A;  3QEP A;  3SQ2 A;  2NUB A;  3IKM A;  4YOR A;  5AQV A;  2OTL N;  3ZSX A;  4MDB A;  3VQE A;  1BI4 A;  4H0P A;  3VQB A;  3ISN C;  3MEE A;  3O9R A;  5AQF A;  2JGU A;  4FK2 A;  3L4Q A;  4HTL A;  2OPQ A;  3OYF A;  2A42 A;  4WQ5 C;  4DF8 A;  5GAE P;  4E7L A;  1M1K O;  1J5E K;  4B1Z A;  4PKI A;  2E2Q A;  5J2N A;  1K8A O;  4QCL A;  2QXF A;  2JWK A;  1RBS A;  4K0K K;  1TKD A;  4I9Q A;  3AGK A;  4CJV A;  1IKW A;  3LAK A;  3JXU A;  4O8U A;  2YHW A;  4CE9 A;  3C95 A;  4BRA A;  4JKC A;  4XH1 A;  5HP1 A;  4KHW A;  2R7Y A;  2P9N A;  1U6Z A;  4CEQ A;  4B3T K;  4BQL A;  4E7H A;  3HBT A;  1NG9 A;  1WAF A;  3CPW M;  3CC4 N;  3A2F A;  3K5L A;  4CER A;  2BGG A;  3D2F B;  4H03 B;  3E1Y A;  4F9O A;  2H3G X;  4CCH A;  4GV6 A;  4CJ3 A;  3V81 A;  2X6N A;  4IG3 A;  4FJG A;  4JKG A;  2HF4 A;  4AHS A;  3AVH A;  1EWR A;  3EE8 A;  1X9J A;  4PY5 A;  4C8M A;  3R1X A;  3SNN A;  1IKX A;  1TAU A;  4FWS A;  4BC4 A;  1U45 A;  5ELZ A;  1BA0 A;  2RE2 A;  3AA4 A;  3THW B;  4ELV A;  3VA3 A;  5J2Q A;  1HPM A;  5CY4 A;  4YOV A;  3CC7 N;  5C12 A;  3ZT2 A;  1EWQ A;  1Q8I A;  5BN9 A;  2QKB A;  4BR9 A;  3U6F A;  2QWM A;  4KH6 A;  3HJF A;  4M3X A;  4FOE A;  1JXE A;  1QTM A;  1UWB A;  3AO4 A;  4OJR A;  5D3G A;  4CJT A;  1EXQ A;  1NMN A;  4H0O A;  4DV1 K;  1XC9 A;  3VA0 A;  4FLZ A;  4DTP A;  1L5U A;  4JLH A;  2YNF A;  4J2D A;  2P9K A;  3MCA B;  1RT4 A;  1JL2 A;  4PL7 A;  4C8L A;  4C8O A;  3LDP A;  1JLG A;  3CCJ N;  4CZI A;  4OKJ A;  3PO4 A;  3UIQ A;  3DJC A;  1LWC A;  3C65 A;  3S41 A;  4X64 K;  5I9E B;  2HHS A;  4FM1 A;  2Q97 A;  3O3F A;  1K9M O;  1JCE A;  4FWK A;  4RW8 A;  4BE0 A;  3IMX A;  4KTW A;  3D2E B;  4FJX A;  1K8K B;  5KGX A;  5H1S Q;  4DR3 K;  3D45 A;  4E7J A;  5M1K A;  3FZK A;  2G8W A;  4N47 A;  3PIO L;  3CQ8 A;  1VQK N;  4ISG A;  4LF7 K;  3EKU A;  3HYF A;  4NCA A;  4JKA A;  4QS9 A;  5E41 A;  2F9W A;  3D7E O;  1GLL O;  2GBZ A;  4GV9 A;  5FPM A;  1YT3 A;  2FXU A;  4DMN A;  2HBJ A;  3QML A;  1VRU A;  2YNH A;  4FK4 A;  4E1M A;  3A5M C;  3MAQ A;  5GAD P;  3VF2 A;  1LWE A;  4IOC L;  3UKU A;  3OJS A;  3DLG A;  3HRG A;  2BH1 A;  4F2R A;  1LAW A;  4E89 A;  3RMA A;  4C23 A;  3ZSW A;  3ULE A;  2HNZ A;  1B9F A;  1ASV A;  3VGL A;  1TGO A;  3S3M A;  1YJ9 N;  3NGI A;  3AVL A;  2UU9 K;  4CF2 A;  1VSI A;  3H3O B;  1OH7 A;  3THX A;  4IEI A;  2B6A A;  4CZE A;  4DSJ A;  5AQG A;  1ZXO A;  3V1R A;  3DI6 A;  4O4G A;  3KIO A;  4FPB A;  3VQC A;  3AA3 A;  2FSJ A;  2A1R A;  4NYF A;  3THV A;  2NRH A;  3VQ9 A;  2WOM A;  5HRN A;  1VQ8 N;  5C2F A;  4DFM A;  4DS5 A;  4B3O A;  4I9L A;  3VQ7 A;  3CCL N;  3MED A;  1XMQ K;  1U4B A;  2O4I A;  3VQ8 A;  1G15 A;  4CEA A;  3JSM A;  3F73 A;  1WBB A;  3VEV A;  3GDQ A;  3LAM A;  3CI5 A;  4CEZ A;  3QIP A;  4CHN A;  4YDU A;  2KW4 A;  4C1N K;  4JYA K;  2VGM A;  3K58 A;  3H6E A;  5AQW A;  1VSJ A;  4HUE A;  2D1K A;  1JLF A;  3HPG A;  2YNG A;  3TPQ A;  3H45 C;  4E1N A;  4CGD A;  3EO3 A;  1JLE A;  1TL1 A;  3QES A;  4ID5 A;  4LF6 K;  4WQ4 A;  4CGG A;  5JLF A;  4IO8 A;  4J2B A;  2OA8 A;  3QDK A;  1VQN N;  4DCH A;  1HNZ K;  3WXK A;  3OW2 M;  4FJJ A;  1RGI A;  3V9S A;  4BRO A;  5TKW A;  1X3N A;  4IJN A;  4DB3 A;  3V9Z A;  3VF4 A;  5JIC A;  5AZJ A;  3P31 A;  5BR9 A;  3T1A A;  2P9S B;  5E84 A;  3VMF B;  3M5R A;  3W0L A;  1ASW A;  3NE6 A;  3NVM A;  4CJF A;  4W5Q A;  3N4P A;  4DFJ A;  1X1P A;  5I3U A;  4FWQ A;  3FZF A;  4FJ7 A;  5IT9 O;  2KLA A;  3SJH A;  3ZX2 A;  1Y64 A;  1NJI O;  1NGB A;  2FSN A;  4BRP A;  1NLV A;  4BWM A;  3G0Z A;  3QNN A;  1QSS A;  4EP5 A;  5C42 A;  5GIP A;  1ATS A;  4M3Z A;  1VSM A;  3WEE A;  3SQ1 A;  3MN7 A;  4YFU A;  3SZ2 A;  4CW7 B;  3ZT1 A;  3MN6 A;  4BGA A;  2PYL A;  1YIJ N;  3PX4 A;  3O8M A;  3OYD A;  4FJ9 A;  3MWT A;  5C0Y A;  1WSE A;  3HP9 A;  4RTF D;  3MEG A;  3OYH A;  3PV8 A;  2WBN A;  5AQY A;  4DV0 K;  1V4T A;  4R79 A;  2E1Y A;  4AHR A;  1KSP A;  4BR5 A;  1WOQ A;  4CJL A;  3EL2 A;  1N8R O;  4FJH A;  4WFB L;  5AQL A;  3WT0 A;  3VER A;  5KGW A;  4AHC A;  2BDP A;  1XI1 A;  3A5O C;  3CIP A;  3R6M A;  3VTH A;  2IAJ A;  3A8Y A;  2KTQ A;  3M6G A;  3R9P A;  3G10 A;  4WE1 A;  1JXB A;  2ZGY A;  1RFQ A;  5LL6 Z;  3WUH A;  4C8N A;  4CIG A;  1REV A;  1QQO A;  4B1X B;  1J5O A;  3UE5 A;  4FJI A;  1F21 A;  3C94 A;  1LAV A;  1HUX A;  4XEI A;  1NK7 A;  2A6A A;  4B3R K;  5SZT A;  4Q0B A;  5FRN A;  5EOY A;  4DTN A;  3QIC A;  3L2Q A;  1KAZ A;  2QWL A;  3SJJ A;  1N36 K;  5C25 A;  2O8F A;  4CEE A;  2O8C B;  3OHR A;  2WFB A;  1TL3 A;  3TU5 A;  1X9S A;  3V9W A;  4HTU A;  1HKB A;  1S6P A;  4CK3 A;  3AVK A;  4BAC A;  2Z1I A;  5CZ1 A;  4DV7 K;  4DTU A;  1NGF A;  4KTQ A;  2ZE2 A;  4ZTJ A;  2HHX A;  4EIA A;  2UYT A;  4DQR A;  1NJY A;  3VEZ A;  3CET A;  2QWP A;  4B9Q A;  3VPZ A;  3FLC O;  4DSF A;  3SQ4 A;  1C1A A;  3E01 A;  4ISE A;  1EKE A;  4KV8 A;  4JV5 K;  4OPH A;  1JCF A;  2RKI A;  2RN2 A;  3NHG A;  1HNW K; 
#chains in the Genus database with same CATH homology
 5AQJ A;  1MA9 B;  3VEX A;  2ITM A;  2FF3 B;  4XH5 A;  1JCG A;  1HLU A;  3MDQ A;  4FSV A;  4FWO A;  1YJN N;  1VQO N;  4I6M A;  4CZK A;  1QZ5 A;  1TYQ A;  3BF1 A;  1VQ6 N;  5AFU H;  2YX6 A;  1GLC G;  1XUP O;  5AQX A;  5AQZ A;  2Q1N A;  2ASO A;  4BRI A;  2JWL A;  2QWN A;  4B1Y B;  1YI2 N;  3RSE A;  4FVU A;  5AZI A;  2IVP A;  4CJ7 A;  4JKH A;  2KHO A;  3KVG A;  2HST A;  4CBW A;  1DT9 A;  3I55 N;  1NMD A;  2I7N A;  4CZL A;  2YHX A;  2ZGZ A;  4JAX A;  3T69 A;  3GBT A;  4BRL A;  3LDQ A;  3CJA A;  3DXK B;  1QQN A;  1V4S A;  4JKE A;  2CH5 A;  4BC2 A;  3BUZ B;  3Q7C A;  3P38 A;  4U7B A;  1VQL N;  2VGN A;  5AQM A;  2NRW A;  2Q36 A;  2P9P B;  1ZBS A;  4IFE A;  2GX9 A;  4AF1 A;  4EAH D;  5ADX H;  3HM8 A;  5M1F A;  3J8A A;  4JKF A;  3CCU N;  3VOV A;  5BPM A;  3IKM A;  4YOR A;  2FSK A;  5AQV A;  1HKG A;  4BVO A;  2OTL N;  2GWJ A;  3U4L A;  4MDB A;  3MX5 A;  3HOT A;  1YVN A;  4AM6 A;  4YDU C;  2CH6 A;  4H0P A;  3K9J A;  1NWK A;  2BTF A;  1Q7Y O;  3O9R A;  5AQF A;  3O08 A;  3L4Q A;  3G25 A;  3H1V X;  3WXL A;  4HTL A;  3JS6 A;  4BRM A;  1R59 O;  2A42 A;  4PKH A;  4YOT A;  4WQ5 C;  3WQU A;  3NMU A;  5GAE P;  4DHY A;  4JK8 A;  3AY9 A;  3ZX0 A;  1M1K O;  4K25 A;  4B1Z A;  1VQ7 N;  4PKI A;  2E2Q A;  3A5L C;  2Q31 A;  5AZI B;  2E88 A;  1K8A O;  1T6D A;  2JWK A;  4OPA A;  3CD6 N;  2D0O A;  3TTF A;  3QFU A;  3AAP A;  4KH4 A;  3GG4 A;  3AGK A;  3CJC A;  3JXU A;  3MMV A;  4O8U A;  4WQ4 C;  1KAX A;  4JEP A;  3WEE B;  2YHW A;  4BC3 A;  4BQZ A;  2D0P A;  1GLJ O;  1QVG M;  4BRA A;  3AGR A;  2ZF5 O;  1C0F A;  4JKC A;  4ILH A;  4XH1 A;  5AQR A;  3ZEU A;  1VQP N;  3BF3 A;  4B1U B;  3CCM N;  2P9N A;  3FZM A;  1U6Z A;  5LJW A;  2GWK A;  1ESV A;  1LCU A;  4BQL A;  5AQK A;  3WXI A;  4A61 A;  3LDO A;  3HBT A;  3CQX A;  3L6Q A;  2NLX A;  1NBW A;  3CPW M;  5JLH A;  3CC4 N;  3D6R A;  3HZ6 A;  4MDA A;  3D2F B;  3H46 O;  3MK6 A;  2E2P A;  4H03 B;  3E1Y A;  4BY9 C;  2QA4 N;  3I56 N;  1NGI A;  4F9O A;  2ZJR L;  2H3G X;  3A5N C;  4ILG B;  3CCQ N;  1YF5 L;  3VEN A;  3UKR B;  4GV6 A;  2ASM A;  5FPD A;  3G71 N;  1T3V A;  3DXM A;  2VWB A;  3A0I X;  3ENO A;  4JKG A;  2HF4 A;  3HI0 A;  4BRF A;  1GLD G;  2IVO A;  1C0G A;  4BRQ A;  3EE8 A;  1X9J A;  3U8X A;  3GOI A;  1NGD A;  2P9S A;  3T7Z A;  2A3Z A;  2P9I B;  3O1B A;  1EO1 A;  5LJV A;  1NGG A;  3R1X A;  1NGJ A;  4K41 A;  4FWS A;  1H1V A;  4BC4 A;  1BA1 A;  5ELZ A;  1YJW N;  1BA0 A;  1YHQ N;  2RE2 A;  5AQN A;  1ATR A;  1BU6 O;  4A57 A;  5AR0 A;  1U2V B;  1SAZ A;  1HPM A;  3ZEU B;  3CJ1 A;  3VET A;  4FOI A;  4QS7 A;  2AP1 A;  3SK3 A;  4YOV A;  3CC2 N;  1VQ4 N;  3CC7 N;  3GE1 A;  5C12 A;  2NRR A;  3CJ7 A;  5KQ8 A;  5BN9 A;  4BR9 A;  3HTV A;  2QTD A;  2QWM A;  4KH6 A;  4C1N I;  4BRG A;  4IO9 L;  1W2B M;  3TSQ A;  4FOE A;  4HWI A;  4JHD A;  4H0O A;  1EQY A;  4CI6 A;  3O6W A;  4IEE A;  2P9K A;  3MCA B;  4H5R A;  4PL7 A;  2KKZ A;  4B1W B;  3LDP A;  4O5F A;  4JN4 A;  2GUP A;  3M1F A;  3DXM B;  5KPR A;  4YOY A;  4JK7 A;  3CCJ N;  4CZI A;  3ATU A;  3C6H A;  4WFA L;  5AQU A;  1QQM A;  1KAY A;  3DLL L;  3DJC A;  3C65 A;  3S41 A;  5CR4 A;  5F2R A;  4H5T A;  3O4W A;  3WXJ A;  5I9E B;  4NLB A;  2QXL A;  2Q97 A;  1ATN A;  3KK7 A;  3J7Z O;  2A40 A;  2P9U A;  2VYP A;  5AQO A;  3BEX A;  1K9M O;  1JCE A;  2E2O A;  4FWK A;  4RCH A;  4EHT A;  5KPZ A;  3IMX A;  2V7Z A;  2V51 B;  3D2E B;  1K8K B;  5H1S Q;  2QWQ A;  1NGC A;  1NGE A;  1BUP A;  1SS6 A;  2WUS A;  3FZK A;  2YHY A;  4H5N A;  4CZF A;  5M1K A;  5GIO A;  4WF9 L;  3VEY A;  1YXQ A;  4MLH A;  4BG9 A;  3PIO L;  3WXM B;  4ISG A;  1VQK N;  3EKU A;  2Q0U A;  4JKA A;  4QS9 A;  3UB5 A;  5F0X A;  4JKD A;  2GEM A;  5FPE A;  3CCS N;  2F9W A;  5GAG P;  3QBW A;  2NRT A;  4EHU A;  2RHK A;  3B8A X;  4A2B A;  4A59 A;  3D7E O;  1GLL O;  4GV9 A;  5FPM A;  2FXU A;  1QVF M;  4H0Y B;  1HJO A;  4I6M B;  3ZET A;  2E1Z A;  2I7P A;  2HBJ A;  3CXC M;  1TYQ B;  1GLE G;  3QML A;  1E4G T;  2YCH A;  4CZG A;  5GIN A;  3KHY A;  2FLO A;  3E9L A;  4FWN A;  4NO7 A;  4BR2 A;  4CBX A;  3SBG A;  3A5M C;  1Q81 O;  5GAD P;  4JD2 A;  3VF2 A;  3HOS A;  1MWM A;  3W3D A;  1DGK N;  3RSE B;  1SQK A;  4IOC L;  3UKU A;  1MWK A;  3GL1 A;  1SZ2 A;  3LDL A;  5CHI A;  3CCV N;  4YOU A;  3P39 A;  3SAH A;  1HX1 A;  3HRG A;  2BH1 A;  4IOA L;  5E26 A;  1QZ6 A;  2PBD A;  4C23 A;  2P9U B;  3O9T A;  3ULE A;  3FFK B;  3VEW A;  3ZX3 A;  3FGU A;  5AQI A;  3WQT A;  1BG3 A;  4FWM A;  3VGL A;  1YJ9 N;  3VEO A;  2QM1 A;  3MN9 A;  2E8A A;  5AFU A;  3H3O B;  4GV3 A;  2ZWH A;  4FO0 A;  3G6E N;  1IG8 A;  5M1P A;  1D4X A;  4BR0 A;  4IEI A;  4CZE A;  5AQG A;  1S22 A;  3OBY A;  1ZXO A;  3F5T A;  3RVC A;  5AQP A;  1IJJ A;  5AQT A;  4JK9 A;  2OAN A;  2W40 A;  4FPB A;  1NGA A;  5BRD A;  2A41 A;  2YJE A;  2FSJ A;  1T6C A;  1XC3 A;  3AAR A;  2HMP A;  4H5V A;  2DPN A;  3O9Q A;  5M1O A;  1J6Z A;  2NRH A;  4BR7 A;  4CBU A;  4LC9 B;  5JVG L;  2GTD A;  2QW9 A;  5JMV A;  3IDH A;  5C2F A;  1VQ8 N;  3FR0 A;  4A5B A;  2IIR A;  3CCL N;  3U9Z A;  3MCP A;  3EN9 A;  3VGM A;  3EE9 A;  4RWT A;  1GLF O;  3VEV A;  3GDQ A;  4WCE L;  3CI5 A;  5ADX A;  1TUU A;  1S3X A;  4GVE A;  3R8E A;  1JJ2 M;  1YIT N;  4PHT X;  2PFU A;  4KBO A;  1VAZ A;  3Q7B A;  3ULE B;  3ATV A;  2F7T A;  3HSC A;  4MLE A;  4YDU A;  3SAG A;  1TUY A;  3PLA A;  4C1N K;  1HKC A;  3CJB A;  2VGM A;  3SBT A;  1KXP A;  2AA4 A;  4YOW A;  1GLB G;  3H6E A;  5AQW A;  2P9L A;  2D1K A;  5DM7 L;  2P9N B;  4AM7 A;  4MO4 A;  3TPQ A;  4ISF A;  3FZH A;  2GEL A;  2YJF A;  1Q18 A;  1T44 A;  3H45 C;  1P90 A;  3N4Q A;  3EO3 A;  4DKW A;  4H0V B;  1Z6R A;  5B8H A;  1DKG D;  4WQ4 A;  3CER A;  3CJ9 A;  5BRE A;  4IO8 A;  5JLF A;  2ZJQ L;  2A5X A;  3SMS A;  3DXK A;  3FZL A;  4BR4 A;  1NM1 A;  3QDK A;  5BPL A;  1VQN N;  4DCH A;  1YAG A;  4H0X B;  3WXK A;  2F9T A;  3L0Q A;  3DAW A;  1RGI A;  4A2A A;  3CF5 L;  3OW2 M;  4BVP A;  4BRO A;  4FWP A;  5TKW A;  5EXW A;  1X3N A;  4IJN A;  4DB3 A;  5C10 A;  4YOX A;  3O80 A;  2P9P A;  3VF4 A;  3H1Q A;  5AQQ A;  4JKG B;  3OBW A;  5BRH A;  2WC9 A;  5JIC A;  4KH5 A;  5AZJ A;  5TKY A;  3ENB A;  3P31 A;  5BR9 A;  2P9S B;  4IDH A;  4FL9 A;  5E84 A;  3CHW A;  3G4S N;  2NNW A;  5F1X A;  4CD1 A;  4G9Z A;  4IJA A;  3VMF B;  4E1J A;  3M5R A;  3W0L A;  1BDG A;  2E20 A;  3NVM A;  3QFP A;  3N4P A;  4IZ9 A;  3E66 A;  1GLA G;  4FWQ A;  5BN8 A;  3FZF A;  4NB4 A;  2BUP A;  2P9L B;  2VCP A;  4BRH A;  1RDU A;  3CME N;  2HBL A;  2KLA A;  2QEX N;  2CGK A;  3SJH A;  3ZX2 A;  1Y64 A;  1NJI O;  1NGB A;  1P8Z A;  2FSN A;  2E2N A;  5EY4 A;  2QI2 A;  3O1W A;  1LOT B;  4BRP A;  1NLV A;  3O9S A;  1VQ9 N;  1VQ5 N;  4BRK A;  5GIP A;  3CCR N;  1ATS A;  1OKJ A;  1XQS C;  5C15 A;  3PIP L;  4K43 A;  5C2D A;  2Q0R A;  2FF6 A;  3WEE A;  5M1N A;  3LDN A;  5MLC Q;  3MN7 A;  4JHD B;  1S72 N;  3VES A;  1Q86 O;  2CGJ A;  2YI1 A;  3ZYY X;  4WYB A;  4CZH A;  3KWI A;  3O9U A;  3ID6 A;  2P9K B;  2OTJ N;  3SAF A;  3MN6 A;  4BGA A;  1YIJ N;  3I8B A;  3MWP A;  3O8M A;  4DQ8 A;  5C0Y A;  3MWT A;  4M7X A;  4RTF D;  3AAQ A;  1BOT O;  2WBN A;  3LM9 A;  3MN5 A;  5AZJ B;  3LM2 A;  1G99 A;  5AQY A;  1V4T A;  4FWR A;  4XH4 A;  2E1Y A;  2PAV A;  4R79 A;  3TSU A;  3QB0 A;  4BR5 A;  5GAH P;  1WOQ A;  4J8F A;  3EL2 A;  3OA9 A;  1N8R O;  1Z05 A;  4BRD A;  4WFB L;  1CZA N;  3M3Z A;  5AQL A;  3KZB A;  2CGL A;  4BGB A;  3D2F A;  5JVH L;  4Y0W A;  1OVY A;  4M63 C;  5KQD A;  3WT0 A;  3VER A;  1Q82 O;  5DM6 L;  1RDW X;  3O5B A;  4O8K A;  3CMA N;  1WUA A;  1DEJ A;  3A5O C;  4BRC A;  2EWS A;  3CIP A;  2NZT A;  3E9O A;  3R6M A;  4H0T B;  3UKR A;  2ASP A;  3F2K A;  3IUC A;  4JNE A;  3VTH A;  4A62 A;  4MO5 A;  5LY3 A;  4GY2 B;  3A8Y A;  2ZJP L;  4ILJ A;  3F9M A;  3M6G A;  3R9P A;  4BRE A;  1MDU B;  3ID8 A;  1QHA A;  1KD1 O;  2P9I A;  2HBK A;  3CQY A;  3TTC A;  4EFH A;  4QS8 A;  2HF3 A;  2Q2R A;  2ZGY A;  1RFQ A;  3WUH A;  3BP8 A;  3ZET B;  1E4F T;  4PL8 A;  1KC8 O;  4JKB A;  2NRX A;  2V7Y A;  3C7N A;  4PKG A;  3L4I A;  1U2V A;  3VGK A;  3R3L A;  1QQO A;  3NVK A;  3QBX A;  4B1X B;  2W41 A;  3UE5 A;  5EX5 A;  4JD2 B;  1HUX A;  4XEI A;  3P4I A;  3UKU B;  3CPE A;  2A6A A;  3TTD A;  1ILY A;  3C0B A;  4IWV A;  5AQH A;  3VTI A;  1O13 A;  2V52 B;  2QWO A;  1W97 L;  3SMP A;  5EOY A;  3E9P A;  4K42 A;  3I33 A;  3QIC A;  1KAZ A;  1VQM N;  2QWL A;  4FWL A;  3ENH A;  4U67 L;  3KWG A;  1KQS M;  2NRV A;  4NLC A;  1YUW A;  4M7Y A;  3OHR A;  2WFB A;  4WQ5 A;  5HL7 L;  3TU5 A;  1X3M A;  2IVN A;  1HKB A;  3EKS A;  4WFN L;  3MX2 A;  3K9K A;  4BC5 A;  3TSP A;  4Z94 A;  1K73 O;  3H3N O;  3VF6 A;  3DWL A;  1NGF A;  4BRN A;  3C6A A;  4IOX A;  3EZW A;  5AQS A;  3LL3 A;  4OO1 J;  3SLC A;  2QWR A;  1ZC6 A;  1BO5 O;  4EIA A;  3C7N B;  5BPN A;  3D2E A;  5CE3 A;  4CZJ A;  1BWF O;  2UYT A;  1K8K A;  5FPN A;  3FE1 A;  5M1Q A;  2J4R A;  5BRF A;  4UY8 O;  2HBM A;  3VEZ A;  3CET A;  2HOE A;  5EVZ A;  1M90 O;  2QWP A;  3CCE N;  4B9Q A;  5KPT A;  2D4W A;  3VPZ A;  1NGH A;  4L3Q A;  3FLC O;  4H5W A;  2NRZ A;  4B1V A;  4BG8 A;  3IFR A;  4CD3 A;  4ISE A;  4FPA A;  4GNI A;  4OPH A;  3U9D A;  1JCF A;  5HOO A;  4IXC A;  4A5A A;  4CZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...