1B9DA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 51
structure length 143
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9dA00
3QESA 1WLJA 1Q8IA 1BQNA 3VQ6A 3DLBA 2BGGA 3NCIA 1JXBA 3LAMA 1T8EA 1S1TA 4ELTA 4DSIA 2E6LA 3DRRA 4DFKA 2ITGA 4CHPA 1TKXA 2E4LA 3K5OA 4GVMA 3ZT3A 1KFSA 4ELVA 2O4IA 5HRSA 3CQ8A 3THVA 3QNOA 1ASWA 1YTAA 2FBYA 1XHXA 4PQUA 4LSLA 1RDDA 1LW2A 3L3UA 4AH9A 4CHZA 3D45A 1ZBFA 4M3YA 4FJMA 3P1GA 4LH4A 3UIQA 3EY1A 4N41A 1NK6A 4FLTA 3DLGA 1C0TA 5DMRA 3VQ9A 3LWMA 1RT6A 4I7FA 4FJ9A 1JLFA 3NFAA 1NKEA 3SYZA 4FK4A 4KTZA 3LANA 3T3FA 4AHRA 1JLGA 4CEOA 4DU4A 4B9VA 1GOBA 2O4GA 4CIFA 2FC0A 1D9FA 4B9UA 3PUFA 1CZ9A 3TAQA 2OZMA 5JS1A 1ZBIA 4O44A 4CJ4A 4CJQA 2P51A 2JGUA 4KKOA 3V9ZA 4E7LA 1XWLA 1WSJA 3ISNC 3O3FA 3L3VA 2X6NA 3OY9A 2OPQA 3TAEA 4NYFA 4DTOA 1IKXA 3SV3A 4CJRA 3VQBA 1HMVA 1KSPA 3ZSOA 4QAGA 1DTTA 4E7IA 2Z1GA 3PX0A 1L3TA 3WNGA 4C8OA 3DLRA 1WSGA 4E3SA 3CFOA 4CEEA 1W0HA 2HHXA 4PA1A 1UA0A 2G8IA 5HRRA 4FZYA 3ZT2A 3HP6A 2DFFA 4FJIA 2IOCA 1D8YA 1HYVA 4HCCA 3PO4A 3BDPA 1QS4A 2KW4A 3SI6A 1WAJA 4LY7A 1TL1A 3M8PA 4OJRA 3SUPA 4RW6A 4F8RA 1ZBLA 3O4QA 1RTIA 2XY6A 1QE1A 3QEIA 1HQUA 3AO3A 3ALYA 4IBNA 3SV4A 5J2MA 1BIUA 3V4IA 3OS0A 2P5GA 1BQMA 3NHGA 3AO5A 4FJ5A 2KFZA 4CEFA 1J9AA 3SQ0A 2D0AA 1N5YA 4KTWA 1HNVA 4H4MA 4KB0A 4J2AA 4CGJA 3OYGA 4K8ZA 1QSLA 3VQCA 3C6UA 1RBSA 4RW4A 5FDLA 1YVUA 4IFYA 1RBTA 1WSEA 3ZSWA 4B9NA 4B9SA 3V6DA 4DQSA 1L3UA 2QK9A 4FJGA 4E7KA 1HPZA 4JRPA 5J2QA 2BANA 3LP2A 4CGIA 2HW3A 3NF9A 4AHSA 1RT1A 2ATQA 4CJTA 3QEPA 1KLNA 4OKJA 1VSHA 4OKKA 4OVLA 1SL1A 4CJSA 1RNHA 4DTXA 3C95A 1VRTA 3C94A 1IKVA 2YNFA 4BDPA 3AVCA 1T7PA 3MXJA 2XY7A 3CM5A 3L2QA 3KTQA 2FBTA 4CJ5A 4CIEA 1NJXA 3V1RA 1C1AA 4I9LA 3VQ4A 3CFRA 4CFCA 2R7YA 1KVAA 1NKCA 1ASUA 4DSJA 3NGIA 1KFDA 1N6QA 4ELUA 1TAUA 1HYSA 4FM0A 2GBZA 4WE1A 4Z4GA 1YTUA 4Z0UA 2IGIA 3LAKA 3WNFA 3K58A 3ZSXA 4CHOA 1X9WA 4BE1A 3PY8A 3OYHA 4DQPA 4FZZA 1KRPA 4M3WA 4FJKA 1B9FA 2AJQA 4DF8A 3IG1A 4QOZB 3CFPA 1XI1A 1RDAA 1RBRA 1Y97A 3C6TA 3DLEA 1VSIA 3VQ7A 1C1BA 4CK2A 4ZHRA 1NK7A 2KFNA 1S1UA 1RT5A 3LP0A 4FW2A 4HHTA 4FM2A 2YHBA 3SPZA 4H8KA 2YNGA 4CEQA 4JRQA 3P5JA 4DU1A 4CJWA 3DM2A 1TKDA 4JS4A 2KZZA 2RN2A 1C0UA 2XRIA 3QO9A 4DTNA 2YHAA 3NF7A 1JLAA 3SUNA 2YNHA 4DTSA 4AHCA 3EZ5A 4LH5A 3QEWA 1VRUA 4F2RA 1S1VA 2JLEA 4E19A 3HVTA 1LW0A 1BIZA 1RILA 4FLWA 2B5JA 3H08A 3E01A 5EU7A 3HXMA 2A1RA 3OS2A 2G8WA 4CF0A 2P1JA 3V9XA 1QQCA 1JXEA 1WSIA 4W5TA 3HJFA 2X6SA 3RTVA 2PZSA 2HVHA 4H4OA 3L2UA 1NOYA 2G8FA 1LWEA 3RMAA 4KHWA 5SZTA 3ASMA 4MQ3A 3HL8A 4CF9A 3OYKA 1ASVA 3MEGA 1NK0A 4RW8A 5C25A 1I3AA 3F73A 1TK0A 5I42A 4B8AB 1TVRA 4HTUA 3MXMA 3KLIA 1QTMA 1I39A 4AHTA 3VN5A 1Q9XA 3QLHA 3ZSZA 1JLEA 3VQ5A 3EYZA 1ZYQA 2G8KA 1S9GA 1J54A 3ZSVA 4CGHA 4M42A 1UA1A 1SKRA 1WSFA 4B9MA 4CFDA 1RT3A 1MU2A 4YFUA 3AVLA 4N76A 2HHQA 3SUOA 4CJUA 3LZIA 4FLXA 1ITGA 4DFPA 1FK9A 1EKEA 1RTJA 3RRGA 1KVBA 2HHWA 2DTUA 4IG0A 2BE2A 1IKYA 1JL2A 1U48A 4M45A 5J2NA 4EZ6A 1NK8A 4KHUA 3OYLA 4EP4A 2P5OA 1RT4A 2Z1IA 4KB1A 4BWMA 4KPYA 2F8TA 2RPIA 4O4GA 2ZQBA 3ZSYA 4Q0BA 1FXXA 5KTQA 4KREA 5HBMA 5CYMA 1SL0A 1J53A 3MECA 4NCGA 3VA3A 3PO5A 3WNEA 3NDKA 4E7HA 4CEZA 4BE2A 4B08A 3LPTA 4C8NA 5KGWA 3D0PA 1S6QA 2ZD1A 3G0ZA 3KKSA 4HUGA 1RTDA 4EP5A 1NK9A 3K2PA 4KAZA 3QNNA 1BI4A 1YT3A 2XY5A 1IH7A 3MAQA 4M41A 4DSFA 2IS3A 3AA3A 2Y1JA 4C8KA 5JS2A 4F3OA 4KRFA 1ZBHA 1QSSA 2E6MA 1JLCA 4K8XA 3SQ1A 1SUQA 5CZ1A 3ZT0A 4OGEA 1U4BA 1EXQA 3OS1A 3KK1A 3OJSA 3TWHA 1K6YA 1CXQA 3TAFA 1RBVA 3ZT1A 5HP1A 4M3TA 5C24A 5CYQA 2VG7A 4M3UA 2PYJA 4F4KA 1VSMA 4FLVA 4DLEA 4AHUA 3DOKA 3CYMA 4W5QA 2G8HA 3NH0A 4NYNA 2B4JA 2KQ2A 4KO0A 4DFJA 3LP3A 2ETJA 3ITHA 4RW7A 1C6VA 4DS4A 1T03A 4Y1CA 1BCMA 1Z25A 4OGCA 4NCAA 1DLOA 3TANA 4CHNA 4FK0A 3SPYA 4DTRA 3KD1E 1IKWA 1VSDA 3SJJA 2GV9A 1B9DA 4Z4CA 3SNNA 2KTQA 3BGRA 2EHGA 2D5RA 4CHQA 4KHYA 1TK8A 1TKZA 2F8SA 3RWUA 4OKEA 2KZMA 2LSNA 2OPSA 4CJVA 5T7BA 4CJPA 1NJYA 3K5NA 4ICLA 3VA0A 1LWCA 1WSHA 3AVAA 1BGXT 1Q9YA 4CGGA 4IG3A 5CY4A 3T19A 4NCBA 2D0CA 4G1QA 1F21A 4E0DA 2ZE2A 4FLZA 1SV5A 2VG6A 3M8SA 3OYEA 4PY5A 4FJJA 4DU3A 1VK0A 1KCFA 3DI6A 1D5AA 4CF1A 1X9MA 2OZSA 5KRTA 4QCLA 2DY4A 2QXFA 4FJHA 3A2FA 1VSLA 5KI6A 3DRPA 3TAMA 3DRSA 4FK2A 3NF8A 3SZ2A 4DQIA 3IRXA 1LWFA 3VQDA 3I0SA 4DLGA 3OYFA 3RMCA 4DSKA 3L8BA 1NK4A 4PUOA 4CESA 3B6PA 4FYDA 2Q3SA 3HPGA 4UQGA 3OYMA 3OYAA 3AVGA 4ID5A 5HRPA 3NH1A 1NJZA 3PX6A 1U45A 2G8UA 3AVIA 5FRNA 1C0MA 1HNIA 1VSJA 3AVNA 5E41A 4OLBA 1XC9A 1VSEA 4CGFA 2D0BA 2HNDA 2Z1JA 3NH2A 4MFBA 4O0JA 2OPPA 4L8RB 4M3XA 3AO1A 3HSTB 4FZXC 1UAXA 5HRNA 4FW1A 4DSLA 3AA2A 3VQQA 1NKBA 4AHVA 4BE0A 3OYBA 1BCOA 4DQRA 1FKOA 3VQEA 3FFIA 2B6AA 2FBVA 1W9HA 5FROA 3M8RA 3L2VA 2HMIA 1HRHA 3AVKA 4IKFA 4HUFA 2OYQA 3HT3A 3S3MA 3HYFA 3KKRA 4DF4A 4OPKA 3S9HA 3IAYA 4Z4EA 1IO2A 1TL3A 5KGXA 3HP9A 4GW6A 3K5MA 5D3GA 3KJVA 4JS5A 5I3UA 1RTHA 2YKMA 3AVJA 5C42A 4HCBA 1BHLA 1RBUA 1VSFA 3AVMA 4DQQA 3F9KA 3LPUA 2QKKA 4FJ8A 3WNHA 4CEAA 3DLKA 4DWIA 1CZBA 3S3OA 1LAWA 1RDBA 1HQEA 2OPRA 3TR8A 3HPOA 3I8DA 1TK5A 3PX4A 4CECA 1TAQA 2HHTA 2YNIA 1REVA 4FVMA 4O55A 4LD0A 5KRSA 4DG1A 1TV6A 3DLHA 4YNQA 3AA4A 3AO2A 1RCHA 4DTPA 4DSEA 4FJNA 1UWBA 2EX3A 1NOZA 1A5WA 3O3GA 3O3HA 4DTUA 3PV8A 3AV9A 3QERA 2VWKA 3OJUA 4KHSA 1S9EA 1U47A 1GOCA 3NAEA 4DTJA 3NE6A 3AVBA 1VSKA 1LAVA 1S6PA 3IS9A 4CJEA 1L3SA 2GUIA 4J2BA 4O0IA 1EETA 4E7JA 4CERA 3LALA 4CF8A 3LZJA 1LV5A 4DMNA 4CK3A 3TAPA 2DFEA 5HROA 4CK1A 3V81A 1C1CA 4I2QA 1UOCA 4BDYA 4KV8A 3HPHA 1JLBA 1FKPA 3O4NA 3V9WA 3JSMA 3TARA 4ZTJA 3VQAA 4KI6A 1X1PA 4CF2A 4R5PA 1BI4B 2YKNA 2XHBA 1BISA 3KD5E 4HVJA 4CJLA 1U04A 3NF6A 3OYCA 4FJ7A 3NBPA 4FLYA 3KLFA 1SKSA 4Z4FA 1HYZA 3DYAA 4IFVA 4I2PA 3ULDA 3TAGA 1T05A 1IG9A 4PWDA 4CFAA 2QKBA 4FXDA 4KFBA 1RDCA 4B9TA 3TI0A 4DFMA 1HJRA 4KTQA 4O5BA 3DMJA 3U3GA 4FCYA 1B92A 3B6OA 1SKWA 4KHNA 1DTQA 3RMBA 4F3TA 2F96A 1JL1A 1JLQA 2I5JA 2WONA 1WAFA 2X78A 4CJKA 1G15A 1D9DA 2HHUA 1KTQA 4BDZA 2HVIA 1Z26A 5CZ2A 1GOAA 2DFHA 3QIOA 3OVNA 3ZSQA 2HNZA 3LP1A 2OA8A 3OYNA 3KK3A 3RMDA 4J2EA 1KLMA 3MXIA 3NGZA 2A1SA 5SWMA 3K5LA 4W5OA 1R0AA 1RT7A 4CIGA 4EZ9A 1QHTA 4E1MA 3RRHA 3CM6A 3S3NA 2FBXA 4B8CA 1BL3A 1ZBUA 3OYDA 1CXUA 2IAJA 4HUEA 4C8LA 4W5NA 3ZSRA 3HM9A 3V9UA 3HO1A 4BACA 4M3RA 2Y1IA 2HNYA 4CJ3A 4Q5VA 3V1OA 3MEDA 4ID1A 4CGDA 3KLHA 3HVRA 3SCXA 4ZTFA 1J5OA 1EP4A 1S5JA 3KLGA 3LWLA 3JYTA 4CEDA 1A5VA 1S1XA 2VWJA 5DK5A 4J2DA 4BWJA 3QINA 2RKIA 1NJWA 2VG5A 4N47A 3SQ2A 2WOMA 2X74A 5J1EA 1WN7A 4F2SA 3CG7A 3V1QA 2XY8A 4FLUA 3KK2A 1QSYA 4FJLA 1EX4A 3SQ4A 1XHZA 3U3YA 2HHSA 2G8VA 4XIUA 2PY5A 2RF2A 4IDKA 4LSNA 4N5SA 2XO7A 3RR7A 3T1AA 1O1WA 2HB5A 3ZT4A 4B9LA 4DS5A 3AO4A 2HHVA 1L3VA 1U49A 1WNSA 3DOLA 4Y1DA 4C8MA 3MEEA 3OYJA 3L2WA 2NUBA 2Z1HA 1TKTA 1KVCA 4GMJB 3VQ8A 4M3ZA 3G10A 4OLAA 3ZCMA 1A5XA 4N56A 3KLEA 1RT2A 4JLHA 3SUQA 1L5UA 1X9SA 3AVHA 2W42A 3QEVA 2IDOA 3P83D 3U6FA 5HLFA 4I9QA 5K14A 4KHQA 3K57A 4RG8A 3AVFA 4DTMA 3TABA 1SL2A 2IC3A 3VQPA 1TGOA 4KI4A 3I0RA 2YV0X 4E1NA 5J2PA 2BDPA 4CHYA 3OYIA 4Z4IA 4W5RA 3M8QA 3QETA 3QEXA 4CE9A 4CJFA 5FRMA 4CFBA 3QIPA 3KIOA 3HK2A 1S1WA 4TSXA 3L2RA 3RR8A 4AILC 4RW9A 4CEBA 3V9SA 3K59A 4CCHA 1CLQA 1NK5A 4FJXA 1JKHA 4OPJA 3LDSA 2PYLA 4Z4HA 4E89A 4FM1A 4B3OA 3NGYA 3AA5X
chains in the Genus database with same CATH superfamily
3CJCA 1BQNA 3DLBA 3P39A 2ITGA 4CHPA 1TKXA 3KWIA 5HRSA 2Q0UA 3QNOA 4JKHA 1LW2A 3L3UA 4CZIA 5ELZA 4FJMA 4JD2B 3FZKA 3H45C 4EHTA 1RT6A 2P9LB 3CCUN 4BC4A 2IVOA 1VQ9N 3G4SN 4FK4A 1N33K 4LFBK 2UUBK 4AHRA 1JLGA 4CEOA 3N4PA 1GOBA 4CIFA 1D9FA 1CZ9A 4O44A 3OY9A 4NYFA 4DTOA 3EZWA 4B3TK 3BZCA 4DQ8A 3VQBA 1HMVA 4WYBA 2GTDA 4E7IA 2Z1GA 1L3TA 3D7EO 3QBWA 1WSGA 5CHIA 1W0HA 4PA1A 1UA0A 1KD1O 3ZT2A 4BY9C 2DFFA 2IOCA 1D8YA 3U4LA 3BDPA 5BR8K 1QS4A 2KW4A 2YX6A 2QW9A 1RDWX 3O4QA 4BR4A 1VQ4N 5AQWA 4B9QA 3SV4A 3WXKA 3OS0A 2P5GA 3NHGA 3AO5A 4CZKA 4X62K 1J9AA 4JKDA 1HNVA 4KB0A 3OYGA 3VQCA 5FDLA 3M3ZA 3KHYA 1WSEA 4EHUA 4B9NA 1ATRA 2BANA 2HW3A 4PKIA 2ATQA 1KLNA 3G25A 1SL1A 1RNHA 4DTXA 3KWGA 1VQPN 3GE1A 4WQ4C 4FOEA 1T7PA 3CXCM 1YAGA 3THWB 4CJ5A 1NJXA 3VQ4A 1Z6RA 1M1KO 5AQMA 1ASUA 3GG4A 1KFDA 4GNIA 3NGIA 2GBZA 4Z4GA 2UUCK 1N8RO 3G71N 1VQNN 4BR5A 5BRHA 3OYHA 4DQPA 2BTFA 1Q7YO 5C10A 4FJKA 2AJQA 3ULEA 1XI1A 3BY5A 3C6TA 1RBRA 4MO4A 3UE5A 1NK7A 4GVEA 3LP0A 2YHBA 2CGJA 5LMUK 5AQPA 2XRIA 4DTSA 4AHCA 1HPMA 2RE2A 4H0PA 3PSIA 4FLWA 2B5JA 2A1RA 2P1JA 3V9XA 4K42A 1QQCA 1VQON 3S41A 4H4OA 2KLAA 4KHWA 4MQ3A 4BR2A 3TPQA 3F73A 1I3AA 2P9UA 5I42A 3MDQA 5F1XA 1BU6O 4HTUA 3PLAA 1K8AO 1Q9XA 3JXUA 2F8TA 3MN6A 3VF6A 3WXIA 1WSFA 4H0OA 1RT3A 1K8KA 4CJUA 3M5RA 1ITGA 4DFPA 1RTJA 4C1NI 1OH6A 3FE1A 2BE2A 1NK8A 4B1YB 2FSJA 2P5OA 4KPYA 1RT4A 4BWMA 2RPIA 2ZQBA 4OO1J 5HBMA 1SL0A 1J53A 4DR3K 4LF7K 4BE2A 5AQRA 4HUGA 1NGEA 2FSKA 5BRFA 3QNNA 1YT3A 2XY5A 3O4WA 5GINA 4M41A 4DSFA 1GLAG 3AA3A 4C8KA 1NGCA 3LM2A 1TYQB 1QSSA 3A5MC 1SUQA 1U4BA 4I6MA 4F4KA 4FLVA 3VTHA 4CBXA 3CYMA 4W5QA 2G8HA 3NH0A 4NYNA 5F2RA 1GLBG 4DS4A 1W7AA 4FPBA 5FPNA 4IEIA 3QBXA 2GV9A 3E9PA 3BGRA 4KHYA 4CHQA 1TK8A 1ZC6A 4K0KK 2OPSA 5T7BA 1NJYA 2BUPA 3K5NA 1NGHA 4EAHD 3VA0A 2GWKA 2QXLA 3AVAA 4CGGA 4NCBA 3T19A 2D0CA 4JI0K 1F21A 4H03B 4E0DA 3L6QA 3CCMN 3F9MA 3L4QA 4C1NK 4GV9A 4CF1A 2P9IA 4FO0A 3A2FA 3DRSA 4YOYA 4IEEA 4DQIA 1VHXA 3ZX2A 2PFUA 4DLGA 3I0SA 3RMCA 1NGAA 3OYFA 4DSKA 3H3OB 3L8BA 4CESA 4FOIA 4UQGA 2HF3A 3ULEB 1CZAN 3NH1A 2VCPA 3VEXA 3PX6A 1U45A 2G8UA 5FRNA 5DM6L 4OLBA 3KZBA 4H0TB 1VSEA 5IWAK 1VQ8N 4CGFA 4MFBA 2HHHK 4M3XA 3OA9A 4FZXC 2P9SB 3CJBA 3VETA 3R8EA 3JAMO 3CPWM 2WC9A 5FROA 3L2VA 1W9HA 2HMIA 1NLVA 3KK7A 3AVKA 1V4SA 1SZ2A 3CC2N 3S3MA 1HUXA 4Z4EA 2HBJA 3WXMB 3K5MA 1OKJA 5D3GA 2HF4A 4GW6A 3O9UA 1RTHA 3C6HA 1YJWN 3F9KA 3LPUA 3H1VX 2P9UB 3WNHA 2HSTA 3DLKA 4FWKA 4MDAA 4FWPA 4KH5A 4IOCL 3PX4A 3P31A 2YHXA 1REVA 3JS6A 5FPDA 1K73O 1K8KB 3TTDA 5BPNA 4FJNA 4BR9A 3O3GA 3TU5A 1HNWK 3QERA 4DUZK 3BEXA 4DTJA 3QMLA 3HBTA 4A62A 4BRMA 1VSKA 1S6PA 3FZFA 4ISEA 3NE6A 4O0IA 1EETA 4K41A 4CERA 5HROA 2VQFK 4CJ7A 1UOCA 2OZSA 1JLBA 4R5PA 2GEMA 3KD5E 4HVJA 4CJLA 3CF5L 1U04A 1XMOK 1NBWA 5A2QO 4Z4FA 4CBUA 3DYAA 4IFVA 1IG9A 1SQKA 1HR0K 1W2BM 1RDCA 4I6MB 3BP8A 3FFKB 3THXA 3U3GA 4BRQA 1DTQA 3RMBA 4PHTX 4FWQA 1WAFA 2X78A 4KHPK 1G15A 4G9ZA 4BRFA 1E4FT 3LDLA 4H5TA 3KK3A 1ATNA 3RMDA 3NGZA 3WXLA 1VQMN 1HLUA 4BG9A 4CIGA 4E1MA 3HI0A 1KAXA 4IO8A 3ZEUA 2IAJA 3UB5A 4C8LA 3ZSRA 4BACA 4M3RA 2HNYA 4CJ3A 3HVRA 3V1OA 4LF4K 1EP4A 1S5JA 2VWJA 1NMNA 1S1XA 4J2DA 2ZJPL 4YDUA 2F9WA 3V1QA 4FLUA 3MN5A 3KK2A 2P9IB 3SQ4A 2HHSA 4FJHA 4XIUA 1RGIA 4IDKA 4LSNA 4RWTA 4XH1A 3QB0A 2HB5A 1QVGM 2VWBA 5AJ3K 2NUBA 2Z1HA 1TKTA 3G10A 1A5XA 4JLHA 1X9SA 3AVHA 3QEVA 3U6FA 3ZLJA 3E9OA 3VF4A 3ATVA 4MLEA 2IC3A 4B1XB 1TGOA 3QICA 2BDPA 3ENOA 4Z4IA 4H5VA 5TKWA 4CFBA 4JAXA 4B1UB 3HTVA 3RR8A 2WTUA 4RW9A 3MMVA 1NK5A 5BR9A 3LDSA 4FM1A 2QWNA 3NGYA 3H46O 1K9MO 2NRWA 5BPMA 3J81O 2VGNA 3NCIA 2UXDK 3UKRA 1JXBA 2EWSA 2WBNA 3LAMA 2E6LA 3DRRA 4DFKA 5M1PA 2W6LA 3K5OA 4GVMA 3ZT3A 4NO7A 2FBYA 1XNQK 4U67L 4LSLA 4CHZA 1T6CA 1YI2N 2E20A 3T69A 4N41A 4FLTA 2NRXA 3DLGA 4JK8A 4B1WB 3FR0A 3NFAA 1NKEA 3SYZA 1QVFM 3LANA 2NRVA 4DU4A 4B9VA 3CCVN 5JS1A 4BRGA 3AGKA 4CJ4A 4JI6K 3DXKA 3V9ZA 2X6NA 2A5XA 1S72N 1GLCG 4J8FA 4BQZA 1DTTA 4YOTA 3PX0A 4C8OA 4YOWA 3CD6N 4B1VA 3CFOA 3MN7A 4CEEA 2HHXA 3D6RA 3D2FA 5HRRA 4FZYA 1T44A 3HP6A 4H5NA 1TUYA 1O13A 3SUPA 4OJRA 2YJEA 3MX5A 3THXB 1RTIA 3AO3A 4IBNA 5J2MA 4FJ5A 3SQ0A 1N5YA 3SJHA 5MLCQ 4NXNK 4K8ZA 4RW4A 1YVUA 1RBTA 4B9SA 3EEQA 3V6DA 4DQSA 2Q2RA 1L3UA 4E7KA 5FPEA 4JRPA 4CGIA 3LP2A 2CH6A 2QWLA 4CJTA 4IOAL 3ZEUB 3CMEN 4OKJA 1VSHA 4OKKA 4CJSA 4KH4A 2ZGZA 3C95A 1MDUB 1IKVA 4BDPA 3AVCA 3HOTA 3CM5A 2FLOA 2UUAK 4YOUA 4DR6K 4I9LA 3O08A 3CFRA 2A3ZA 3GBTA 3C6AA 1TAUA 4DV4K 4FM0A 3FLCO 4Z0UA 2D0OA 1XMQK 3CERA 3WNFA 1E3MA 4FZZA 3VGKA 3A8YA 4JI1K 2A41A 3F2KA 4CZJA 5C12A 3BF3A 3NVKA 3SPZA 4FM2A 2E1ZA 4JRQA 3P5JA 4DU1A 1TKDA 2KZZA 1VQ5N 2RN2A 3QO9A 4DTNA 4B3MK 2YHAA 3SUNA 4R79A 1S1VA 5ADXH 1BIZA 3H08A 3WEEA 2G8WA 3OS2A 4A57A 4YOXA 4JI5K 1JXEA 3EO3A 1WSIA 3GDQA 4XH4A 3RTVA 2PZSA 2HVHA 4Y0WA 1KAZA 1NOYA 3IUCA 5SZTA 3ASMA 4CZMA 5KQ8A 3HL8A 3OYKA 3KVGA 3MEGA 1TK0A 3O8MA 1NGFA 1TVRA 3MXMA 2QWMA 4M42A 1S9GA 3QFPA 4CGHA 2CGKA 5AZIA 1MU2A 3AVLA 4N76A 5M1KA 3SUOA 4FLXA 4C23A 3I8BA 1YVNA 2DTUA 3VESA 4IG0A 4JNEA 2WUSA 3CPEA 1U48A 4M45A 3ID6A 4KHUA 2Z1IA 1J5EK 4X65K 5AFUH 1N32K 3ZSYA 1FXXA 5KTQA 3DAWA 4H0VB 1GLJO 4V19S 3WNEA 3NDKA 1YHQN 4CEZA 5KGWA 3DXKB 3D0PA 2ZD1A 3G0ZA 1NK9A 1VQKN 4KRFA 2IS3A 2Y1JA 2E6MA 1LOTB 2GUPA 1X3MA 5EOYA 3OS1A 4WFBL 3OJSA 3TWHA 1K6YA 4DV3K 3TAFA 3ZT1A 5HP1A 1OH5A 5CYQA 2VG7A 3QDKA 4M3UA 2PYJA 2HBLA 4BC5A 4OPAA 4AHUA 4BROA 2B4JA 2CGLA 3CJAA 1Z25A 3CHWA 4CHNA 4QS8A 1IKWA 1VSDA 1B9DA 5TKYA 3J7YP 2NNWA 4MDBA 4DV2K 2KZMA 2LSNA 1XQSC 2O8FA 4CJVA 4ICLA 1LWCA 2V51B 4LF5K 1IG8A 2ZE2A 4FLZA 2CH5A 4PY5A 3VENA 3OBWA 1KCFA 2Q36A 5KI6A 3TAMA 5E26A 1IV0A 4PUOA 3B6PA 4A2AA 1M90O 1IBKK 3OYAA 3AVGA 3AVIA 3VTIA 1H1VA 3NH2A 4L8RB 3W0LA 3HSTB 2FF3B 4O8UA 1NKBA 4WF9L 3OYBA 2Q1NA 2UXBK 5E84A 3WEEB 2B6AA 3M8RA 4BR0A 3HT3A 3KKRA 3S9HA 4JKGA 1IO2A 2NRRA 1TL3A 1YJNN 3KJVA 3MCAB 4PKGA 4JS5A 2YKMA 5C42A 4HCBA 1VSFA 4WQ5C 3ZYYX 2QKKA 5LY3A 2ZWHA 4A61A 5AQSA 2FF6A 3SMPA 4CEAA 1CZBA 3TR8A 1XC3A 1TK5A 5C0YA 2Q97A 4YHHK 3OHRA 2HHTA 4QS9A 4DG1A 4DV1K 1TV6A 2FXUA 4BC2A 3AA4A 1R59O 4IXCA 2QI2A 2PAVA 4BRKA 1G99A 1UWBA 3N4QA 1GLDG 4IOXA 4DB3A 4DKWA 3O3HA 3PV8A 1JJ2M 3AV9A 5EXWA 2VWKA 5EY4A 3NAEA 1U47A 3AVBA 1LAVA 1L3SA 1C0GA 4HTLA 2GELA 2F4VK 3O9QA 4CF8A 3U9ZA 3V81A 3V9WA 4BDYA 4IFEA 4KI6A 2P9KA 4ZTJA 3JSMA 3LL3A 3VQAA 2YKNA 3OYCA 4JI7K 3GOIA 4NLBA 1HYZA 4BRPA 4BVPA 3E1YA 4PWDA 4K43A 4JV5K 2QKBA 4KFBA 5FLXO 4DFMA 1BUPA 4F9OA 4O5BA 2IVNA 1B92A 1QZ5A 3UKUA 4F3TA 2F96A 3SBTA 5CE3A 4DR5K 3FZHA 1JL1A 1JLQA 2WONA 1OH8A 5GIOA 1D9DA 4GV3A 2O8BA 1BWFO 1Z26A 2HNZA 3LP1A 4J2EA 3CM6A 3S3NA 4BREA 1ZBUA 2YCHA 3OYDA 4HUEA 2O8FB 3ID8A 2Y1IA 1OVQA 2RHKA 3KLHA 3MEDA 4ZTFA 1J5OA 2G8VA 3LWLA 3CJ9A 3SLCA 2UYTA 3B8AX 4OX9K 4N47A 1P90A 2QWQA 4LF8K 4BGAA 4FJLA 5LJVA 5AZJA 3LDNA 5JICA 3OBYA 2RF2A 3VMFB 4N5SA 3O80A 2WFBA 4DV6K 3MEEA 3OYJA 4WFAL 4GMJB 1KVCA 3VQ8A 1WOQA 4M3ZA 5AQJA 4N56A 3KLEA 4RTFD 1GLLO 5HLFA 4KHQA 4RG8A 2PBDA 3AVFA 1KXPA 4DTMA 3VQPA 3I0RA 4E1NA 5J2PA 2O8EA 4W5RA 4BVOA 3QEXA 4CE9A 4CJFA 1QQOA 3PIPL 1S1WA 4TSXA 4AILC 4GKJK 3K59A 4CCHA 1HX1A 1U6ZA 3DJCA 4OPJA 4DV0K 2PYLA 2W41A 3AA5X 4MLHA 1VQLN 2A6AA 1GLEG 3SK3A 1T8EA 4DSIA 2O4IA 4ELVA 3CQ8A 1XHXA 4PQUA 3VEOA 1LCUA 1RDDA 4AH9A 3ZX3A 4HWIA 3D45A 1ZBFA 1HKCA 1T3VA 4M3YA 3CJ7A 3UIQA 3U9DA 1NGDA 5DMRA 3VQ9A 4FJ9A 4KTZA 3T3FA 2FSNA 4B9UA 2OZMA 3OW2M 3MWPA 3TAQA 1ZBIA 4JKFA 4JYAK 2P51A 1S22A 5AQGA 4E7LA 1WSJA 1EWRA 3TAEA 4L3QA 3SV3A 4IO9L 5KPZA 3I55N 3ZSOA 4QAGA 1DGKN 1Q18A 1Y64A 4E3SA 5M1OA 3ENBA 4B1ZA 1S3XA 2A42A 4WCEL 3CCLN 4FJIA 1HYVA 1WBDA 3PO4A 3IFRA 4HCCA 2O8DA 3SI6A 4LY7A 3I56N 1TL1A 3M8PA 1YITN 4F8RA 1ZBLA 2XY6A 3ALYA 4B3RK 3V4IA 3A5NC 3VEVA 4CZEA 2KFZA 4CBWA 3A0IX 3O5BA 1NGJA 4CGJA 4LF9K 3C6UA 3J7ZO 3ZSWA 5KPTA 4PL8A 1D4XA 1YUWA 5J2QA 1ATSA 4AHSA 5B8HA 3QEPA 3HZ6A 4OVLA 1NWKA 1VRTA 5AQNA 3C94A 3T1HK 2YNFA 3MXJA 3L2QA 4K25A 3V1RA 1C1AA 1ESVA 4DSJA 1NKCA 1IBLK 5EX5A 1N6QA 4ELUA 1HYSA 3TTFA 4WE1A 2QWRA 4YOVA 3EKSA 4LFAK 3K58A 3ZSXA 4CHOA 1X9WA 4BE1A 2VGMA 4JHDA 3T1YK 4RCHA 4M3WA 4QOZB 3CFPA 1Y97A 4ZHRA 3VQ7A 2KFNA 1C1BA 4H0YB 1RT5A 4FW2A 3DXMA 4LC9B 2YNGA 4CEQA 2YJFA 4CJWA 4JS4A 2J4RA 5LL6Z 4F2RA 3EZ5A 1NMDA 4LH5A 1VRUA 2JLEA 4E19A 4AM7A 3HVTA 1RILA 3E01A 5EU7A 3HXMA 1U2VA 5KPRA 4FVUA 2V7YA 5AQKA 3L2UA 3U8XA 5GAEP 4RW8A 1HKGA 4M7YA 5AR0A 4B8AB 3VN5A 3ZSZA 1JLEA 3VQ5A 1ZYQA 1J54A 1SKRA 4CI6A 1VAZA 4B9MA 4CFDA 5F0XA 4CZFA 1EO1A 2HHQA 2Q0RA 3EE9A 3LZIA 3VGLA 3LDQA 1FK9A 1KVBA 2E8AA 3IDHA 4EP4A 4IJAA 1ILYA 2NZTA 4FWRA 5CYMA 2OCEA 3MECA 4NCGA 4FWMA 2V52B 3LPTA 4EFHA 1Q86O 3ZETA 3KKSA 1RTDA 1YJ9N 3J80O 4KAZA 1BI4A 1YXQA 4JKEA 3VEWA 3W3DA 3MAQA 4JKCA 4JK9A 1ZBHA 2HMPA 1JLCA 4K8XA 3AGRA 4ISGA 5CZ1A 4OGEA 1EXQA 3KK1A 1CXQA 2AP1A 2O8DB 1JCGA 3DOKA 4DR4K 4JN4A 2KQ2A 3R1XA 3RVCA 5BREA 2ETJA 3ITHA 4RW7A 1C6VA 1T03A 4Y1CA 2NRZA 5AQOA 3O9SA 1DLOA 4CD3A 5AQUA 3SPYA 3CQYA 4DTRA 3SJJA 2KTQA 4XEIA 5C2DA 2HBMA 4WQ4A 4CZGA 4Z94A 3RWUA 4OKEA 4CJPA 1WSHA 1BGXT 4FWOA 4IG3A 5CY4A 2O8CA 4G1QA 1P8ZA 1VQ7N 1SV5A 4FJJA 1BA0A 4DU3A 4BC3A 2DY4A 3DI6A 3THWA 4QCLA 4GKKK 1VSLA 5AQFA 1WBBA 4YDUC 4FK2A 3NF8A 1LWFA 3VQDA 1NK4A 2JWKA 4JHDB 4FYDA 2Q3SA 3HPGA 2D4WA 3QFUA 2OANA 4ID5A 4GV6A 1NJZA 1VSJA 4BQLA 2D0PA 3H3NO 1XC9A 4O0JA 2OPPA 3NVMA 1UAXA 4DSLA 1KAYA 4AHVA 5BPLA 2ITMA 3MCPA 3DLLL 3VQEA 1U2VB 2P9NA 5GAHP 5HOOA 4HUFA 2OYQA 3DWLA 4DF4A 1V4TA 3IAYA 4A59A 2E1YA 5KGXA 3HP9A 3AVJA 3CI5A 3Q7BA 3UKRB 1BHLA 4ILGB 3VEYA 4BR7A 3HPOA 1HQEA 2OPRA 3I8DA 2GX9A 1TAQA 2YNIA 4O55A 2NLXA 3BF1A 3DLHA 4U7BA 3CC4N 2YI1A 4ILJA 4DSEA 4BRNA 3L4IA 2EX3A 3TSQA 1NOZA 1A5WA 3IS9A 4E7JA 3LALA 4CK3A 2DFEA 1GLFO 2W6KA 1C1CA 3ZETB 4KV8A 3HPHA 1FKPA 3TARA 3O4NA 2XHBA 1BI4B 3EL2A 4DR2K 3D2FB 3NF6A 4FJ7A 1SKSA 4I2PA 3ULDA 3TAGA 1T05A 1TYQA 5I9EB 1NG9A 4B9TA 3O1BA 1MWMA 3MK6A 4FCYA 3B6OA 1SAZA 5IT9O 2YHYA 3TSUA 5AQTA 4JK7A 3CCQN 4CJKA 4BDZA 4O8KA 5CZ2A 1GOAA 2DFHA 4CZLA 3OVNA 3SAGA 3MXIA 4CVNE 4A5BA 2A1SA 4W5OA 1RT7A 5JVGL 1X3NA 3HM8A 3VEZA 1BL3A 1RDUA 2OTJN 3AAPA 1CXUA 3V9UA 3C65A 1NGIA 3CCRN 4NXMK 4Q5VA 4CGDA 3SCXA 3K9JA 3KLGA 4IWVA 1DKGD 2O8CB 3VGMA 2RKIA 2VG5A 1Z05A 2X74A 3M1FA 1YIJN 5J1EA 4F2SA 3CG7A 2XY8A 4QS7A 1C0FA 3E9LA 1XHZA 2E88A 4CZHA 3U3YA 3RR7A 2XO7A 3T1AA 2UXCK 1O1WA 2IIRA 3AO4A 1TUUA 1WNSA 4O5FA 3DOLA 3EKUA 2ZM6K 4C8MA 4LFCK 3SUQA 1RT2A 1L5UA 1QQMA 2W42A 2F9TA 3P83D 4I9QA 5K14A 1NM1A 3EE8A 3R6MA 4CW7B 2ZJQL 1SL2A 4KI4A 2P9SA 4MO5A 4BRLA 4A5AA 1Q81O 3QETA 2P9NB 3L2RA 3P4IA 4PL7A 5BN9A 5JVHL 1CLQA 2JWLA 3SZ2A 3QESA 1WLJA 1Q8IA 3VQ6A 5M1QA 2BGGA 4IDHA 5FPMA 2NRTA 3HRGA 1S1TA 4ELTA 2E4LA 1KFSA 3H6EA 5AZIB 2HOEA 3THVA 1ASWA 2E2OA 1YTAA 4KH6A 2ZJRL 1FW6A 2Q31A 1BO5O 3P1GA 4LH4A 1NGBA 3A5OC 1XUPO 3EY1A 1NK6A 1JCFA 1C0TA 3LWMA 4I7FA 4NLCA 1DT9A 1JLFA 4FWLA 3WUHA 4DCHA 3TTCA 2O4GA 2FC0A 3PUFA 5AQVA 4CJQA 2JGUA 3F5TA 4KKOA 1XWLA 3ISNC 3O3FA 3L3VA 2OPQA 3O9TA 1IKXA 4DV5K 4CJRA 1KSPA 1NU0A 2W40A 2E2PA 3WNGA 3NMUA 3DLRA 3I33A 4JI4K 2I7PA 2VYPA 2G8IA 4EIAA 1WAJA 4RW6A 1QE1A 3CC7N 3QEIA 1HQUA 1BIUA 2UU9K 1BQMA 4CEFA 2IVPA 2D0AA 4KTWA 3Q7CA 4H4MA 4J2AA 3R9PA 1FJGK 1QSLA 1RBSA 3H1QA 4IFYA 5AQXA 1BDGA 5LMNK 2P9PA 4OPHA 2QK9A 4FJGA 1HPZA 3PIOL 3NF9A 1RT1A 3WQTA 1J6ZA 3RSEA 3TSPA 3ZX0A 4IJNA 3VERA 3WQUA 2XY7A 3THYA 3KTQA 2FBTA 4YY3K 4CIEA 4DHYA 4CFCA 2R7YA 1KVAA 1YTUA 2QWPA 2IGIA 3LAKA 1IBMK 1Q82O 3PY8A 4BGBA 1KRPA 1B9FA 4UY8O 4DF8A 3IG1A 1RDAA 4DV7K 1MWKA 3DLEA 4CK2A 1VSIA 1S1UA 4HHTA 4H8KA 3DM2A 3E66A 1C0UA 3NF7A 1JLAA 2YNHA 3QEWA 4H0XB 5M1NA 1LW0A 3D2EA 1NJIO 4H5WA 4B3SK 4CF0A 3C0BA 5H1SQ 1N36K 4W5TA 4AF1A 4JKGB 3HJFA 2X6SA 2OTLN 4FL9A 5JMVA 3CCJN 4M63C 2G8FA 1LWEA 3RMAA 2QM1A 3O1WA 4CF9A 1ASVA 1NK0A 3WXJA 5C25A 3LM9A 1XNRK 3A5LC 3FZLA 3SBGA 3KLIA 5AQYA 1I39A 2BH1A 4AHTA 5GAGP 1QTMA 3QLHA 3EYZA 2G8KA 1IJJA 3ZSVA 1UA1A 4M7XA 4X66K 3LDOA 5EVZA 4YFUA 2KHOA 3RRGA 1EKEA 2QWOA 2HHWA 4KBOA 1IKYA 1JL2A 4AQYK 5BRDA 5J2NA 2ASPA 4EZ6A 3OYLA 1ZXOA 3CETA 4KB1A 1VQ6N 1SS6A 4O4GA 5AQZA 4Q0BA 4KREA 3VA3A 2F7TA 3PO5A 4E7HA 5ADXA 2P9KB 4B08A 4C8NA 5GIPA 1KC8O 1S6QA 4EP5A 3K2PA 4CD1A 1IH7A 5C15A 5JS2A 4F3OA 2VQEK 4JI3K 3SQ1A 3ZT0A 3M6GA 4DUYK 1RBVA 3UKUB 4M3TA 5C24A 2DPNA 3VPZA 3P38A 1VSMA 4DLEA 4ISFA 4DR7K 3L0QA 5AQIA 2O8BB 3IMXA 4BRAA 5DM7L 4E1JA 4KO0A 4DFJA 3LP3A 2ZF5O 4DR1K 1BCMA 4FSVA 4NB4A 4OGCA 4BRHA 4NCAA 3TANA 1EWQA 4FK0A 3KD1E 2P9PB 4Z4CA 3SNNA 2EHGA 2D5RA 1TKZA 2F8SA 5AFUA 5KQDA 5CR4A 3RSEB 2GWJA 4XH5A 5AQLA 1Q9YA 3K9KA 4JI2K 1JCEA 4JKBA 3VOVA 5AQQA 3AAQA 2VG6A 3M8SA 2HBKA 3OYEA 3THYB 4JI8K 4AM6A 2QTDA 1VK0A 3J7AP 1D5AA 5AZJB 1X9MA 3OTOK 5KRTA 1WB9A 2QXFA 1I94K 5LJWA 3DRPA 3CCEN 1DEJA 3IRXA 4JKAA 4H5RA 3VF2A 3ATUA 3C7NA 3OYMA 3T7ZA 1BG3A 5HRPA 3MX2A 1KQSM 1C0MA 1HNIA 5E41A 3AVNA 2I7NA 2D0BA 2HNDA 2Z1JA 3AO1A 4YORA 5HRNA 2O8EB 4FW1A 1QHAA 3AA2A 3BZKA 3VQQA 4BE0A 1HKBA 2ASOA 3MN9A 3SAFA 1BCOA 4DQRA 3D2EB 4X64K 1FKOA 1OVYA 3FFIA 2FBVA 1HRHA 4IKFA 3FZMA 3CCSN 3HYFA 4OPKA 3CJ1A 2NRHA 5I3UA 1T6DA 3CMAN 1RBUA 3AVMA 4DQQA 4FJ8A 4JEPA 4DWIA 3S3OA 2YHWA 5BN8A 1LAWA 1RDBA 1OH7A 4CECA 5GADP 4FVMA 4LD0A 3O9RA 5KRSA 1QZ6A 4JD2A 4YNQA 3GL1A 3AO2A 1RCHA 4DTPA 2P9LA 4DTUA 2E2NA 3WT0A 3OJUA 2QA4N 4KHSA 1S9EA 1BA1A 1GOCA 3J8AA 4CJEA 3R3LA 4J2BA 2GUIA 4GY2B 1QQNA 3LZJA 1LV5A 4IZ9A 4DMNA 3TAPA 4CK1A 4I2QA 1X1PA 4CF2A 1BISA 1BOTO 3NBPA 4FLYA 4ILHA 3KLFA 2AA4A 2E5LK 4FPAA 4CFAA 4FXDA 1ZBSA 1MA9B 3CQXA 3TI0A 1HJRA 4KTQA 3DMJA 1YF5L 3FGUA 2A40A 5M1FA 1SKWA 1W97L 3LDPA 4KHNA 1NNEA 3AY9A 2I5JA 2HHUA 1KTQA 2HVIA 2V7ZA 3QIOA 3AARA 3ZSQA 2OA8A 1HNZK 3OYNA 3SMSA 4LF6K 1KLMA 4PKHA 5SWMA 3K5LA 3ENHA 1R0AA 4EZ9A 1EQYA 1QHTA 3RRHA 4WFNL 2FBXA 4B8CA 1HNXK 4W5NA 3HM9A 2D1KA 3HO1A 2QEXN 4FWSA 1HJOA 4ID1A 3G6EN 3JYTA 3HSCA 1RFQA 1A5VA 4CEDA 4BRCA 5DK5A 4BG8A 5HL7L 4BWJA 3QINA 5AQHA 1NJWA 3SQ2A 2WOMA 5C2FA 3PSFA 1WN7A 1NGGA 3CIPA 3MWTA 1QSYA 4FWNA 1EX4A 5JLFA 3O6WA 4BRIA 2PY5A 3ZT4A 4B9LA 4DS5A 2KKZA 3C7NB 3DXMB 5JLHA 1U49A 1L3VA 2HHVA 4Y1DA 3L2WA 4A2BA 3BUZB 3HOSA 4OLAA 1E4GT 3ZCMA 2E2QA 2IDOA 3K57A 3TABA 1WUAA 2YV0X 1X9JA 4CHYA 3OYIA 2ZGYA 3M8QA 4BRDA 3K0SA 3EN9A 5FRMA 3QIPA 3IKMA 4WQ5A 3KIOA 3HK2A 4CEBA 3V9SA 2H3GX 4FJXA 1N34K 1JKHA 4Z4HA 4E89A 4B3OA 3SAHA 2ASMA
chains in the Genus database with same CATH topology
3QESA 1WLJA 1Q8IA 1BQNA 3VQ6A 3DLBA 2BGGA 3NCIA 1JXBA 3LAMA 1T8EA 1S1TA 4ELTA 4DSIA 2E6LA 3DRRA 4DFKA 2ITGA 4CHPA 1TKXA 2E4LA 3K5OA 4GVMA 3ZT3A 1KFSA 4ELVA 2O4IA 5HRSA 3CQ8A 3THVA 3QNOA 1ASWA 1YTAA 2FBYA 1XHXA 4PQUA 4LSLA 1RDDA 1LW2A 3L3UA 4AH9A 4CHZA 3D45A 1ZBFA 4M3YA 4FJMA 3P1GA 4LH4A 3UIQA 3EY1A 4N41A 1NK6A 4FLTA 3DLGA 1C0TA 5DMRA 3VQ9A 3LWMA 1RT6A 4I7FA 4FJ9A 1JLFA 3NFAA 1NKEA 3SYZA 4FK4A 4KTZA 3LANA 3T3FA 4AHRA 1JLGA 4CEOA 4DU4A 4B9VA 1GOBA 2O4GA 4CIFA 2FC0A 1D9FA 4B9UA 3PUFA 1CZ9A 3TAQA 2OZMA 5JS1A 1ZBIA 4O44A 4CJ4A 4CJQA 2P51A 2JGUA 4KKOA 3V9ZA 4E7LA 1XWLA 1WSJA 3ISNC 3O3FA 3L3VA 2X6NA 3OY9A 2OPQA 3TAEA 4NYFA 4DTOA 1IKXA 3SV3A 4CJRA 3VQBA 1HMVA 1KSPA 3ZSOA 4QAGA 1DTTA 4E7IA 2Z1GA 3PX0A 1L3TA 3WNGA 4C8OA 3DLRA 1WSGA 4E3SA 3CFOA 4CEEA 1W0HA 2HHXA 4PA1A 1UA0A 2G8IA 5HRRA 4FZYA 3ZT2A 3HP6A 2DFFA 4FJIA 2IOCA 1D8YA 1HYVA 4HCCA 3PO4A 3BDPA 1QS4A 2KW4A 3SI6A 1WAJA 4LY7A 1TL1A 3M8PA 4OJRA 3SUPA 4RW6A 4F8RA 1ZBLA 3O4QA 1RTIA 2XY6A 1QE1A 3QEIA 1HQUA 3AO3A 3ALYA 4IBNA 3SV4A 5J2MA 1BIUA 3V4IA 3OS0A 2P5GA 1BQMA 3NHGA 3AO5A 4FJ5A 2KFZA 4CEFA 1J9AA 3SQ0A 2D0AA 1N5YA 4KTWA 1HNVA 4H4MA 4KB0A 4J2AA 4CGJA 3OYGA 4K8ZA 1QSLA 3VQCA 3C6UA 1RBSA 4RW4A 5FDLA 1YVUA 4IFYA 1RBTA 1WSEA 3ZSWA 4B9NA 4B9SA 3V6DA 4DQSA 1L3UA 2QK9A 4FJGA 4E7KA 1HPZA 4JRPA 5J2QA 2BANA 3LP2A 4CGIA 2HW3A 3NF9A 4AHSA 1RT1A 2ATQA 4CJTA 3QEPA 1KLNA 4OKJA 1VSHA 4OKKA 4OVLA 1SL1A 4CJSA 1RNHA 4DTXA 3C95A 1VRTA 3C94A 1IKVA 2YNFA 4BDPA 3AVCA 1T7PA 3MXJA 2XY7A 3CM5A 3L2QA 3KTQA 2FBTA 4CJ5A 4CIEA 1NJXA 3V1RA 1C1AA 4I9LA 3VQ4A 3CFRA 4CFCA 2R7YA 1KVAA 1NKCA 1ASUA 4DSJA 3NGIA 1KFDA 1N6QA 4ELUA 1TAUA 1HYSA 4FM0A 2GBZA 4WE1A 4Z4GA 1YTUA 4Z0UA 2IGIA 3LAKA 3WNFA 3K58A 3ZSXA 4CHOA 1X9WA 4BE1A 3PY8A 3OYHA 4DQPA 4FZZA 1KRPA 4M3WA 4FJKA 1B9FA 2AJQA 4DF8A 3IG1A 4QOZB 3CFPA 1XI1A 1RDAA 1RBRA 1Y97A 3C6TA 3DLEA 1VSIA 3VQ7A 1C1BA 4CK2A 4ZHRA 1NK7A 2KFNA 1S1UA 1RT5A 3LP0A 4FW2A 4HHTA 4FM2A 2YHBA 3SPZA 4H8KA 2YNGA 4CEQA 4JRQA 3P5JA 4DU1A 4CJWA 3DM2A 1TKDA 4JS4A 2KZZA 2RN2A 1C0UA 2XRIA 3QO9A 4DTNA 2YHAA 3NF7A 1JLAA 3SUNA 2YNHA 4DTSA 4AHCA 3EZ5A 4LH5A 3QEWA 1VRUA 4F2RA 1S1VA 2JLEA 4E19A 3HVTA 1LW0A 1BIZA 1RILA 4FLWA 2B5JA 3H08A 3E01A 5EU7A 3HXMA 2A1RA 3OS2A 2G8WA 4CF0A 2P1JA 3V9XA 1QQCA 1JXEA 1WSIA 4W5TA 3HJFA 2X6SA 3RTVA 2PZSA 2HVHA 4H4OA 3L2UA 1NOYA 2G8FA 1LWEA 3RMAA 4KHWA 5SZTA 3ASMA 4MQ3A 3HL8A 4CF9A 3OYKA 1ASVA 3MEGA 1NK0A 4RW8A 5C25A 1I3AA 3F73A 1TK0A 5I42A 4B8AB 1TVRA 4HTUA 3MXMA 3KLIA 1QTMA 1I39A 4AHTA 3VN5A 1Q9XA 3QLHA 3ZSZA 1JLEA 3VQ5A 3EYZA 1ZYQA 2G8KA 1S9GA 1J54A 3ZSVA 4CGHA 4M42A 1UA1A 1SKRA 1WSFA 4B9MA 4CFDA 1RT3A 1MU2A 4YFUA 3AVLA 4N76A 2HHQA 3SUOA 4CJUA 3LZIA 4FLXA 1ITGA 4DFPA 1FK9A 1EKEA 1RTJA 3RRGA 1KVBA 2HHWA 2DTUA 4IG0A 2BE2A 1IKYA 1JL2A 1U48A 4M45A 5J2NA 4EZ6A 1NK8A 4KHUA 3OYLA 4EP4A 2P5OA 1RT4A 2Z1IA 4KB1A 4BWMA 4KPYA 2F8TA 2RPIA 4O4GA 2ZQBA 3ZSYA 4Q0BA 1FXXA 5KTQA 4KREA 5HBMA 5CYMA 1SL0A 1J53A 3MECA 4NCGA 3VA3A 3PO5A 3WNEA 3NDKA 4E7HA 4CEZA 4BE2A 4B08A 3LPTA 4C8NA 5KGWA 3D0PA 1S6QA 2ZD1A 3G0ZA 3KKSA 4HUGA 1RTDA 4EP5A 1NK9A 3K2PA 4KAZA 3QNNA 1BI4A 1YT3A 2XY5A 1IH7A 3MAQA 4M41A 4DSFA 2IS3A 3AA3A 2Y1JA 4C8KA 5JS2A 4F3OA 4KRFA 1ZBHA 1QSSA 2E6MA 1JLCA 4K8XA 3SQ1A 1SUQA 5CZ1A 3ZT0A 4OGEA 1U4BA 1EXQA 3OS1A 3KK1A 3OJSA 3TWHA 1K6YA 1CXQA 3TAFA 1RBVA 3ZT1A 5HP1A 4M3TA 5C24A 5CYQA 2VG7A 4M3UA 2PYJA 4F4KA 1VSMA 4FLVA 4DLEA 4AHUA 3DOKA 3CYMA 4W5QA 2G8HA 3NH0A 4NYNA 2B4JA 2KQ2A 4KO0A 4DFJA 3LP3A 2ETJA 3ITHA 4RW7A 1C6VA 4DS4A 1T03A 4Y1CA 1BCMA 1Z25A 4OGCA 4NCAA 1DLOA 3TANA 4CHNA 4FK0A 3SPYA 4DTRA 3KD1E 1IKWA 1VSDA 3SJJA 2GV9A 1B9DA 4Z4CA 3SNNA 2KTQA 3BGRA 2EHGA 2D5RA 4CHQA 4KHYA 1TK8A 1TKZA 2F8SA 3RWUA 4OKEA 2KZMA 2LSNA 2OPSA 4CJVA 5T7BA 4CJPA 1NJYA 3K5NA 4ICLA 3VA0A 1LWCA 1WSHA 3AVAA 1BGXT 1Q9YA 4CGGA 4IG3A 5CY4A 3T19A 4NCBA 2D0CA 4G1QA 1F21A 4E0DA 2ZE2A 4FLZA 1SV5A 2VG6A 3M8SA 3OYEA 4PY5A 4FJJA 4DU3A 1VK0A 1KCFA 3DI6A 1D5AA 4CF1A 1X9MA 2OZSA 5KRTA 4QCLA 2DY4A 2QXFA 4FJHA 3A2FA 1VSLA 5KI6A 3DRPA 3TAMA 3DRSA 4FK2A 3NF8A 3SZ2A 4DQIA 3IRXA 1LWFA 3VQDA 3I0SA 4DLGA 3OYFA 3RMCA 4DSKA 3L8BA 1NK4A 4PUOA 4CESA 3B6PA 4FYDA 2Q3SA 3HPGA 4UQGA 3OYMA 3OYAA 3AVGA 4ID5A 5HRPA 3NH1A 1NJZA 3PX6A 1U45A 2G8UA 3AVIA 5FRNA 1C0MA 1HNIA 1VSJA 3AVNA 5E41A 4OLBA 1XC9A 1VSEA 4CGFA 2D0BA 2HNDA 2Z1JA 3NH2A 4MFBA 4O0JA 2OPPA 4L8RB 4M3XA 3AO1A 3HSTB 4FZXC 1UAXA 5HRNA 4FW1A 4DSLA 3AA2A 3VQQA 1NKBA 4AHVA 4BE0A 3OYBA 1BCOA 4DQRA 1FKOA 3VQEA 3FFIA 2B6AA 2FBVA 1W9HA 5FROA 3M8RA 3L2VA 2HMIA 1HRHA 3AVKA 4IKFA 4HUFA 2OYQA 3HT3A 3S3MA 3HYFA 3KKRA 4DF4A 4OPKA 3S9HA 3IAYA 4Z4EA 1IO2A 1TL3A 5KGXA 3HP9A 4GW6A 3K5MA 5D3GA 3KJVA 4JS5A 5I3UA 1RTHA 2YKMA 3AVJA 5C42A 4HCBA 1BHLA 1RBUA 1VSFA 3AVMA 4DQQA 3F9KA 3LPUA 2QKKA 4FJ8A 3WNHA 4CEAA 3DLKA 4DWIA 1CZBA 3S3OA 1LAWA 1RDBA 1HQEA 2OPRA 3TR8A 3HPOA 3I8DA 1TK5A 3PX4A 4CECA 1TAQA 2HHTA 2YNIA 1REVA 4FVMA 4O55A 4LD0A 5KRSA 4DG1A 1TV6A 3DLHA 4YNQA 3AA4A 3AO2A 1RCHA 4DTPA 4DSEA 4FJNA 1UWBA 2EX3A 1NOZA 1A5WA 3O3GA 3O3HA 4DTUA 3PV8A 3AV9A 3QERA 2VWKA 3OJUA 4KHSA 1S9EA 1U47A 1GOCA 3NAEA 4DTJA 3NE6A 3AVBA 1VSKA 1LAVA 1S6PA 3IS9A 4CJEA 1L3SA 2GUIA 4J2BA 4O0IA 1EETA 4E7JA 4CERA 3LALA 4CF8A 3LZJA 1LV5A 4DMNA 4CK3A 3TAPA 2DFEA 5HROA 4CK1A 3V81A 1C1CA 4I2QA 1UOCA 4BDYA 4KV8A 3HPHA 1JLBA 1FKPA 3O4NA 3V9WA 3JSMA 3TARA 4ZTJA 3VQAA 4KI6A 1X1PA 4CF2A 4R5PA 1BI4B 2YKNA 2XHBA 1BISA 3KD5E 4HVJA 4CJLA 1U04A 3NF6A 3OYCA 4FJ7A 3NBPA 4FLYA 3KLFA 1SKSA 4Z4FA 1HYZA 3DYAA 4IFVA 4I2PA 3ULDA 3TAGA 1T05A 1IG9A 4PWDA 4CFAA 2QKBA 4FXDA 4KFBA 1RDCA 4B9TA 3TI0A 4DFMA 1HJRA 4KTQA 4O5BA 3DMJA 3U3GA 4FCYA 1B92A 3B6OA 1SKWA 4KHNA 1DTQA 3RMBA 4F3TA 2F96A 1JL1A 1JLQA 2I5JA 2WONA 1WAFA 2X78A 4CJKA 1G15A 1D9DA 2HHUA 1KTQA 4BDZA 2HVIA 1Z26A 5CZ2A 1GOAA 2DFHA 3QIOA 3OVNA 3ZSQA 2HNZA 3LP1A 2OA8A 3OYNA 3KK3A 3RMDA 4J2EA 1KLMA 3MXIA 3NGZA 2A1SA 5SWMA 3K5LA 4W5OA 1R0AA 1RT7A 4CIGA 4EZ9A 1QHTA 4E1MA 3RRHA 3CM6A 3S3NA 2FBXA 4B8CA 1BL3A 1ZBUA 3OYDA 1CXUA 2IAJA 4HUEA 4C8LA 4W5NA 3ZSRA 3HM9A 3V9UA 3HO1A 4BACA 4M3RA 2Y1IA 2HNYA 4CJ3A 4Q5VA 3V1OA 3MEDA 4ID1A 4CGDA 3KLHA 3HVRA 3SCXA 4ZTFA 1J5OA 1EP4A 1S5JA 3KLGA 3LWLA 3JYTA 4CEDA 1A5VA 1S1XA 2VWJA 5DK5A 4J2DA 4BWJA 3QINA 2RKIA 1NJWA 2VG5A 4N47A 3SQ2A 2WOMA 2X74A 5J1EA 1WN7A 4F2SA 3CG7A 3V1QA 2XY8A 4FLUA 3KK2A 1QSYA 4FJLA 1EX4A 3SQ4A 1XHZA 3U3YA 2HHSA 2G8VA 4XIUA 2PY5A 2RF2A 4IDKA 4LSNA 4N5SA 2XO7A 3RR7A 3T1AA 1O1WA 2HB5A 3ZT4A 4B9LA 4DS5A 3AO4A 2HHVA 1L3VA 1U49A 1WNSA 3DOLA 4Y1DA 4C8MA 3MEEA 3OYJA 3L2WA 2NUBA 2Z1HA 1TKTA 1KVCA 4GMJB 3VQ8A 4M3ZA 3G10A 4OLAA 3ZCMA 1A5XA 4N56A 3KLEA 1RT2A 4JLHA 3SUQA 1L5UA 1X9SA 3AVHA 2W42A 3QEVA 2IDOA 3P83D 3U6FA 5HLFA 4I9QA 5K14A 4KHQA 3K57A 4RG8A 3AVFA 4DTMA 3TABA 1SL2A 2IC3A 3VQPA 1TGOA 4KI4A 3I0RA 2YV0X 4E1NA 5J2PA 2BDPA 4CHYA 3OYIA 4Z4IA 4W5RA 3M8QA 3QETA 3QEXA 4CE9A 4CJFA 5FRMA 4CFBA 3QIPA 3KIOA 3HK2A 1S1WA 4TSXA 3L2RA 3RR8A 4AILC 4RW9A 4CEBA 3V9SA 3K59A 4CCHA 1CLQA 1NK5A 4FJXA 1JKHA 4OPJA 3LDSA 2PYLA 4Z4HA 4E89A 4FM1A 4B3OA 3NGYA 3AA5X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QES A;  1WLJ A;  1Q8I A;  1BQN A;  3VQ6 A;  3DLB A;  2BGG A;  3NCI A;  1JXB A;  3LAM A;  1T8E A;  1S1T A;  4ELT A;  4DSI A;  2E6L A;  3DRR A;  4DFK A;  2ITG A;  4CHP A;  1TKX A;  2E4L A;  3K5O A;  4GVM A;  3ZT3 A;  1KFS A;  4ELV A;  2O4I A;  5HRS A;  3CQ8 A;  3THV A;  3QNO A;  1ASW A;  1YTA A;  2FBY A;  1XHX A;  4PQU A;  4LSL A;  1RDD A;  1LW2 A;  3L3U A;  4AH9 A;  4CHZ A;  3D45 A;  1ZBF A;  4M3Y A;  4FJM A;  3P1G A;  4LH4 A;  3UIQ A;  3EY1 A;  4N41 A;  1NK6 A;  4FLT A;  3DLG A;  1C0T A;  5DMR A;  3VQ9 A;  3LWM A;  1RT6 A;  4I7F A;  4FJ9 A;  1JLF A;  3NFA A;  1NKE A;  3SYZ A;  4FK4 A;  4KTZ A;  3LAN A;  3T3F A;  4AHR A;  1JLG A;  4CEO A;  4DU4 A;  4B9V A;  1GOB A;  2O4G A;  4CIF A;  2FC0 A;  1D9F A;  4B9U A;  3PUF A;  1CZ9 A;  3TAQ A;  2OZM A;  5JS1 A;  1ZBI A;  4O44 A;  4CJ4 A;  4CJQ A;  2P51 A;  2JGU A;  4KKO A;  3V9Z A;  4E7L A;  1XWL A;  1WSJ A;  3ISN C;  3O3F A;  3L3V A;  2X6N A;  3OY9 A;  2OPQ A;  3TAE A;  4NYF A;  4DTO A;  1IKX A;  3SV3 A;  4CJR A;  3VQB A;  1HMV A;  1KSP A;  3ZSO A;  4QAG A;  1DTT A;  4E7I A;  2Z1G A;  3PX0 A;  1L3T A;  3WNG A;  4C8O A;  3DLR A;  1WSG A;  4E3S A;  3CFO A;  4CEE A;  1W0H A;  2HHX A;  4PA1 A;  1UA0 A;  2G8I A;  5HRR A;  4FZY A;  3ZT2 A;  3HP6 A;  2DFF A;  4FJI A;  2IOC A;  1D8Y A;  1HYV A;  4HCC A;  3PO4 A;  3BDP A;  1QS4 A;  2KW4 A;  3SI6 A;  1WAJ A;  4LY7 A;  1TL1 A;  3M8P A;  4OJR A;  3SUP A;  4RW6 A;  4F8R A;  1ZBL A;  3O4Q A;  1RTI A;  2XY6 A;  1QE1 A;  3QEI A;  1HQU A;  3AO3 A;  3ALY A;  4IBN A;  3SV4 A;  5J2M A;  1BIU A;  3V4I A;  3OS0 A;  2P5G A;  1BQM A;  3NHG A;  3AO5 A;  4FJ5 A;  2KFZ A;  4CEF A;  1J9A A;  3SQ0 A;  2D0A A;  1N5Y A;  4KTW A;  1HNV A;  4H4M A;  4KB0 A;  4J2A A;  4CGJ A;  3OYG A;  4K8Z A;  1QSL A;  3VQC A;  3C6U A;  1RBS A;  4RW4 A;  5FDL A;  1YVU A;  4IFY A;  1RBT A;  1WSE A;  3ZSW A;  4B9N A;  4B9S A;  3V6D A;  4DQS A;  1L3U A;  2QK9 A;  4FJG A;  4E7K A;  1HPZ A;  4JRP A;  5J2Q A;  2BAN A;  3LP2 A;  4CGI A;  2HW3 A;  3NF9 A;  4AHS A;  1RT1 A;  2ATQ A;  4CJT A;  3QEP A;  1KLN A;  4OKJ A;  1VSH A;  4OKK A;  4OVL A;  1SL1 A;  4CJS A;  1RNH A;  4DTX A;  3C95 A;  1VRT A;  3C94 A;  1IKV A;  2YNF A;  4BDP A;  3AVC A;  1T7P A;  3MXJ A;  2XY7 A;  3CM5 A;  3L2Q A;  3KTQ A;  2FBT A;  4CJ5 A;  4CIE A;  1NJX A;  3V1R A;  1C1A A;  4I9L A;  3VQ4 A;  3CFR A;  4CFC A;  2R7Y A;  1KVA A;  1NKC A;  1ASU A;  4DSJ A;  3NGI A;  1KFD A;  1N6Q A;  4ELU A;  1TAU A;  1HYS A;  4FM0 A;  2GBZ A;  4WE1 A;  4Z4G A;  1YTU A;  4Z0U A;  2IGI A;  3LAK A;  3WNF A;  3K58 A;  3ZSX A;  4CHO A;  1X9W A;  4BE1 A;  3PY8 A;  3OYH A;  4DQP A;  4FZZ A;  1KRP A;  4M3W A;  4FJK A;  1B9F A;  2AJQ A;  4DF8 A;  3IG1 A;  4QOZ B;  3CFP A;  1XI1 A;  1RDA A;  1RBR A;  1Y97 A;  3C6T A;  3DLE A;  1VSI A;  3VQ7 A;  1C1B A;  4CK2 A;  4ZHR A;  1NK7 A;  2KFN A;  1S1U A;  1RT5 A;  3LP0 A;  4FW2 A;  4HHT A;  4FM2 A;  2YHB A;  3SPZ A;  4H8K A;  2YNG A;  4CEQ A;  4JRQ A;  3P5J A;  4DU1 A;  4CJW A;  3DM2 A;  1TKD A;  4JS4 A;  2KZZ A;  2RN2 A;  1C0U A;  2XRI A;  3QO9 A;  4DTN A;  2YHA A;  3NF7 A;  1JLA A;  3SUN A;  2YNH A;  4DTS A;  4AHC A;  3EZ5 A;  4LH5 A;  3QEW A;  1VRU A;  4F2R A;  1S1V A;  2JLE A;  4E19 A;  3HVT A;  1LW0 A;  1BIZ A;  1RIL A;  4FLW A;  2B5J A;  3H08 A;  3E01 A;  5EU7 A;  3HXM A;  2A1R A;  3OS2 A;  2G8W A;  4CF0 A;  2P1J A;  3V9X A;  1QQC A;  1JXE A;  1WSI A;  4W5T A;  3HJF A;  2X6S A;  3RTV A;  2PZS A;  2HVH A;  4H4O A;  3L2U A;  1NOY A;  2G8F A;  1LWE A;  3RMA A;  4KHW A;  5SZT A;  3ASM A;  4MQ3 A;  3HL8 A;  4CF9 A;  3OYK A;  1ASV A;  3MEG A;  1NK0 A;  4RW8 A;  5C25 A;  1I3A A;  3F73 A;  1TK0 A;  5I42 A;  4B8A B;  1TVR A;  4HTU A;  3MXM A;  3KLI A;  1QTM A;  1I39 A;  4AHT A;  3VN5 A;  1Q9X A;  3QLH A;  3ZSZ A;  1JLE A;  3VQ5 A;  3EYZ A;  1ZYQ A;  2G8K A;  1S9G A;  1J54 A;  3ZSV A;  4CGH A;  4M42 A;  1UA1 A;  1SKR A;  1WSF A;  4B9M A;  4CFD A;  1RT3 A;  1MU2 A;  4YFU A;  3AVL A;  4N76 A;  2HHQ A;  3SUO A;  4CJU A;  3LZI A;  4FLX A;  1ITG A;  4DFP A;  1FK9 A;  1EKE A;  1RTJ A;  3RRG A;  1KVB A;  2HHW A;  2DTU A;  4IG0 A;  2BE2 A;  1IKY A;  1JL2 A;  1U48 A;  4M45 A;  5J2N A;  4EZ6 A;  1NK8 A;  4KHU A;  3OYL A;  4EP4 A;  2P5O A;  1RT4 A;  2Z1I A;  4KB1 A;  4BWM A;  4KPY A;  2F8T A;  2RPI A;  4O4G A;  2ZQB A;  3ZSY A;  4Q0B A;  1FXX A;  5KTQ A;  4KRE A;  5HBM A;  5CYM A;  1SL0 A;  1J53 A;  3MEC A;  4NCG A;  3VA3 A;  3PO5 A;  3WNE A;  3NDK A;  4E7H A;  4CEZ A;  4BE2 A;  4B08 A;  3LPT A;  4C8N A;  5KGW A;  3D0P A;  1S6Q A;  2ZD1 A;  3G0Z A;  3KKS A;  4HUG A;  1RTD A;  4EP5 A;  1NK9 A;  3K2P A;  4KAZ A;  3QNN A;  1BI4 A;  1YT3 A;  2XY5 A;  1IH7 A;  3MAQ A;  4M41 A;  4DSF A;  2IS3 A;  3AA3 A;  2Y1J A;  4C8K A;  5JS2 A;  4F3O A;  4KRF A;  1ZBH A;  1QSS A;  2E6M A;  1JLC A;  4K8X A;  3SQ1 A;  1SUQ A;  5CZ1 A;  3ZT0 A;  4OGE A;  1U4B A;  1EXQ A;  3OS1 A;  3KK1 A;  3OJS A;  3TWH A;  1K6Y A;  1CXQ A;  3TAF A;  1RBV A;  3ZT1 A;  5HP1 A;  4M3T A;  5C24 A;  5CYQ A;  2VG7 A;  4M3U A;  2PYJ A;  4F4K A;  1VSM A;  4FLV A;  4DLE A;  4AHU A;  3DOK A;  3CYM A;  4W5Q A;  2G8H A;  3NH0 A;  4NYN A;  2B4J A;  2KQ2 A;  4KO0 A;  4DFJ A;  3LP3 A;  2ETJ A;  3ITH A;  4RW7 A;  1C6V A;  4DS4 A;  1T03 A;  4Y1C A;  1BCM A;  1Z25 A;  4OGC A;  4NCA A;  1DLO A;  3TAN A;  4CHN A;  4FK0 A;  3SPY A;  4DTR A;  3KD1 E;  1IKW A;  1VSD A;  3SJJ A;  2GV9 A;  1B9D A;  4Z4C A;  3SNN A;  2KTQ A;  3BGR A;  2EHG A;  2D5R A;  4CHQ A;  4KHY A;  1TK8 A;  1TKZ A;  2F8S A;  3RWU A;  4OKE A;  2KZM A;  2LSN A;  2OPS A;  4CJV A;  5T7B A;  4CJP A;  1NJY A;  3K5N A;  4ICL A;  3VA0 A;  1LWC A;  1WSH A;  3AVA A;  1BGX T;  1Q9Y A;  4CGG A;  4IG3 A;  5CY4 A;  3T19 A;  4NCB A;  2D0C A;  4G1Q A;  1F21 A;  4E0D A;  2ZE2 A;  4FLZ A;  1SV5 A;  2VG6 A;  3M8S A;  3OYE A;  4PY5 A;  4FJJ A;  4DU3 A;  1VK0 A;  1KCF A;  3DI6 A;  1D5A A;  4CF1 A;  1X9M A;  2OZS A;  5KRT A;  4QCL A;  2DY4 A;  2QXF A;  4FJH A;  3A2F A;  1VSL A;  5KI6 A;  3DRP A;  3TAM A;  3DRS A;  4FK2 A;  3NF8 A;  3SZ2 A;  4DQI A;  3IRX A;  1LWF A;  3VQD A;  3I0S A;  4DLG A;  3OYF A;  3RMC A;  4DSK A;  3L8B A;  1NK4 A;  4PUO A;  4CES A;  3B6P A;  4FYD A;  2Q3S A;  3HPG A;  4UQG A;  3OYM A;  3OYA A;  3AVG A;  4ID5 A;  5HRP A;  3NH1 A;  1NJZ A;  3PX6 A;  1U45 A;  2G8U A;  3AVI A;  5FRN A;  1C0M A;  1HNI A;  1VSJ A;  3AVN A;  5E41 A;  4OLB A;  1XC9 A;  1VSE A;  4CGF A;  2D0B A;  2HND A;  2Z1J A;  3NH2 A;  4MFB A;  4O0J A;  2OPP A;  4L8R B;  4M3X A;  3AO1 A;  3HST B;  4FZX C;  1UAX A;  5HRN A;  4FW1 A;  4DSL A;  3AA2 A;  3VQQ A;  1NKB A;  4AHV A;  4BE0 A;  3OYB A;  1BCO A;  4DQR A;  1FKO A;  3VQE A;  3FFI A;  2B6A A;  2FBV A;  1W9H A;  5FRO A;  3M8R A;  3L2V A;  2HMI A;  1HRH A;  3AVK A;  4IKF A;  4HUF A;  2OYQ A;  3HT3 A;  3S3M A;  3HYF A;  3KKR A;  4DF4 A;  4OPK A;  3S9H A;  3IAY A;  4Z4E A;  1IO2 A;  1TL3 A;  5KGX A;  3HP9 A;  4GW6 A;  3K5M A;  5D3G A;  3KJV A;  4JS5 A;  5I3U A;  1RTH A;  2YKM A;  3AVJ A;  5C42 A;  4HCB A;  1BHL A;  1RBU A;  1VSF A;  3AVM A;  4DQQ A;  3F9K A;  3LPU A;  2QKK A;  4FJ8 A;  3WNH A;  4CEA A;  3DLK A;  4DWI A;  1CZB A;  3S3O A;  1LAW A;  1RDB A;  1HQE A;  2OPR A;  3TR8 A;  3HPO A;  3I8D A;  1TK5 A;  3PX4 A;  4CEC A;  1TAQ A;  2HHT A;  2YNI A;  1REV A;  4FVM A;  4O55 A;  4LD0 A;  5KRS A;  4DG1 A;  1TV6 A;  3DLH A;  4YNQ A;  3AA4 A;  3AO2 A;  1RCH A;  4DTP A;  4DSE A;  4FJN A;  1UWB A;  2EX3 A;  1NOZ A;  1A5W A;  3O3G A;  3O3H A;  4DTU A;  3PV8 A;  3AV9 A;  3QER A;  2VWK A;  3OJU A;  4KHS A;  1S9E A;  1U47 A;  1GOC A;  3NAE A;  4DTJ A;  3NE6 A;  3AVB A;  1VSK A;  1LAV A;  1S6P A;  3IS9 A;  4CJE A;  1L3S A;  2GUI A;  4J2B A;  4O0I A;  1EET A;  4E7J A;  4CER A;  3LAL A;  4CF8 A;  3LZJ A;  1LV5 A;  4DMN A;  4CK3 A;  3TAP A;  2DFE A;  5HRO A;  4CK1 A;  3V81 A;  1C1C A;  4I2Q A;  1UOC A;  4BDY A;  4KV8 A;  3HPH A;  1JLB A;  1FKP A;  3O4N A;  3V9W A;  3JSM A;  3TAR A;  4ZTJ A;  3VQA A;  4KI6 A;  1X1P A;  4CF2 A;  4R5P A;  1BI4 B;  2YKN A;  2XHB A;  1BIS A;  3KD5 E;  4HVJ A;  4CJL A;  1U04 A;  3NF6 A;  3OYC A;  4FJ7 A;  3NBP A;  4FLY A;  3KLF A;  1SKS A;  4Z4F A;  1HYZ A;  3DYA A;  4IFV A;  4I2P A;  3ULD A;  3TAG A;  1T05 A;  1IG9 A;  4PWD A;  4CFA A;  2QKB A;  4FXD A;  4KFB A;  1RDC A;  4B9T A;  3TI0 A;  4DFM A;  1HJR A;  4KTQ A;  4O5B A;  3DMJ A;  3U3G A;  4FCY A;  1B92 A;  3B6O A;  1SKW A;  4KHN A;  1DTQ A;  3RMB A;  4F3T A;  2F96 A;  1JL1 A;  1JLQ A;  2I5J A;  2WON A;  1WAF A;  2X78 A;  4CJK A;  1G15 A;  1D9D A;  2HHU A;  1KTQ A;  4BDZ A;  2HVI A;  1Z26 A;  5CZ2 A;  1GOA A;  2DFH A;  3QIO A;  3OVN A;  3ZSQ A;  2HNZ A;  3LP1 A;  2OA8 A;  3OYN A;  3KK3 A;  3RMD A;  4J2E A;  1KLM A;  3MXI A;  3NGZ A;  2A1S A;  5SWM A;  3K5L A;  4W5O A;  1R0A A;  1RT7 A;  4CIG A;  4EZ9 A;  1QHT A;  4E1M A;  3RRH A;  3CM6 A;  3S3N A;  2FBX A;  4B8C A;  1BL3 A;  1ZBU A;  3OYD A;  1CXU A;  2IAJ A;  4HUE A;  4C8L A;  4W5N A;  3ZSR A;  3HM9 A;  3V9U A;  3HO1 A;  4BAC A;  4M3R A;  2Y1I A;  2HNY A;  4CJ3 A;  4Q5V A;  3V1O A;  3MED A;  4ID1 A;  4CGD A;  3KLH A;  3HVR A;  3SCX A;  4ZTF A;  1J5O A;  1EP4 A;  1S5J A;  3KLG A;  3LWL A;  3JYT A;  4CED A;  1A5V A;  1S1X A;  2VWJ A;  5DK5 A;  4J2D A;  4BWJ A;  3QIN A;  2RKI A;  1NJW A;  2VG5 A;  4N47 A;  3SQ2 A;  2WOM A;  2X74 A;  5J1E A;  1WN7 A;  4F2S A;  3CG7 A;  3V1Q A;  2XY8 A;  4FLU A;  3KK2 A;  1QSY A;  4FJL A;  1EX4 A;  3SQ4 A;  1XHZ A;  3U3Y A;  2HHS A;  2G8V A;  4XIU A;  2PY5 A;  2RF2 A;  4IDK A;  4LSN A;  4N5S A;  2XO7 A;  3RR7 A;  3T1A A;  1O1W A;  2HB5 A;  3ZT4 A;  4B9L A;  4DS5 A;  3AO4 A;  2HHV A;  1L3V A;  1U49 A;  1WNS A;  3DOL A;  4Y1D A;  4C8M A;  3MEE A;  3OYJ A;  3L2W A;  2NUB A;  2Z1H A;  1TKT A;  1KVC A;  4GMJ B;  3VQ8 A;  4M3Z A;  3G10 A;  4OLA A;  3ZCM A;  1A5X A;  4N56 A;  3KLE A;  1RT2 A;  4JLH A;  3SUQ A;  1L5U A;  1X9S A;  3AVH A;  2W42 A;  3QEV A;  2IDO A;  3P83 D;  3U6F A;  5HLF A;  4I9Q A;  5K14 A;  4KHQ A;  3K57 A;  4RG8 A;  3AVF A;  4DTM A;  3TAB A;  1SL2 A;  2IC3 A;  3VQP A;  1TGO A;  4KI4 A;  3I0R A;  2YV0 X;  4E1N A;  5J2P A;  2BDP A;  4CHY A;  3OYI A;  4Z4I A;  4W5R A;  3M8Q A;  3QET A;  3QEX A;  4CE9 A;  4CJF A;  5FRM A;  4CFB A;  3QIP A;  3KIO A;  3HK2 A;  1S1W A;  4TSX A;  3L2R A;  3RR8 A;  4AIL C;  4RW9 A;  4CEB A;  3V9S A;  3K59 A;  4CCH A;  1CLQ A;  1NK5 A;  4FJX A;  1JKH A;  4OPJ A;  3LDS A;  2PYL A;  4Z4H A;  4E89 A;  4FM1 A;  4B3O A;  3NGY A;  3AA5 X; 
#chains in the Genus database with same CATH topology
 3CJC A;  1BQN A;  3DLB A;  3P39 A;  2ITG A;  4CHP A;  1TKX A;  3KWI A;  5HRS A;  2Q0U A;  3QNO A;  4JKH A;  1LW2 A;  3L3U A;  4CZI A;  5ELZ A;  4FJM A;  4JD2 B;  3FZK A;  3H45 C;  4EHT A;  1RT6 A;  2P9L B;  3CCU N;  4BC4 A;  2IVO A;  1VQ9 N;  3G4S N;  4FK4 A;  1N33 K;  4LFB K;  2UUB K;  4AHR A;  1JLG A;  4CEO A;  3N4P A;  1GOB A;  4CIF A;  1D9F A;  1CZ9 A;  4O44 A;  3OY9 A;  4NYF A;  4DTO A;  3EZW A;  4B3T K;  3BZC A;  4DQ8 A;  3VQB A;  1HMV A;  4WYB A;  2GTD A;  4E7I A;  2Z1G A;  1L3T A;  3D7E O;  3QBW A;  1WSG A;  5CHI A;  1W0H A;  4PA1 A;  1UA0 A;  1KD1 O;  3ZT2 A;  4BY9 C;  2DFF A;  2IOC A;  1D8Y A;  3U4L A;  3BDP A;  5BR8 K;  1QS4 A;  2KW4 A;  2YX6 A;  2QW9 A;  1RDW X;  3O4Q A;  4BR4 A;  1VQ4 N;  5AQW A;  4B9Q A;  3SV4 A;  3WXK A;  3OS0 A;  2P5G A;  3NHG A;  3AO5 A;  4CZK A;  4X62 K;  1J9A A;  4JKD A;  1HNV A;  4KB0 A;  3OYG A;  3VQC A;  5FDL A;  3M3Z A;  3KHY A;  1WSE A;  4EHU A;  4B9N A;  1ATR A;  2BAN A;  2HW3 A;  4PKI A;  2ATQ A;  1KLN A;  3G25 A;  1SL1 A;  1RNH A;  4DTX A;  3KWG A;  1VQP N;  3GE1 A;  4WQ4 C;  4FOE A;  1T7P A;  3CXC M;  1YAG A;  3THW B;  4CJ5 A;  1NJX A;  3VQ4 A;  1Z6R A;  1M1K O;  5AQM A;  1ASU A;  3GG4 A;  1KFD A;  4GNI A;  3NGI A;  2GBZ A;  4Z4G A;  2UUC K;  1N8R O;  3G71 N;  1VQN N;  4BR5 A;  5BRH A;  3OYH A;  4DQP A;  2BTF A;  1Q7Y O;  5C10 A;  4FJK A;  2AJQ A;  3ULE A;  1XI1 A;  3BY5 A;  3C6T A;  1RBR A;  4MO4 A;  3UE5 A;  1NK7 A;  4GVE A;  3LP0 A;  2YHB A;  2CGJ A;  5LMU K;  5AQP A;  2XRI A;  4DTS A;  4AHC A;  1HPM A;  2RE2 A;  4H0P A;  3PSI A;  4FLW A;  2B5J A;  2A1R A;  2P1J A;  3V9X A;  4K42 A;  1QQC A;  1VQO N;  3S41 A;  4H4O A;  2KLA A;  4KHW A;  4MQ3 A;  4BR2 A;  3TPQ A;  3F73 A;  1I3A A;  2P9U A;  5I42 A;  3MDQ A;  5F1X A;  1BU6 O;  4HTU A;  3PLA A;  1K8A O;  1Q9X A;  3JXU A;  2F8T A;  3MN6 A;  3VF6 A;  3WXI A;  1WSF A;  4H0O A;  1RT3 A;  1K8K A;  4CJU A;  3M5R A;  1ITG A;  4DFP A;  1RTJ A;  4C1N I;  1OH6 A;  3FE1 A;  2BE2 A;  1NK8 A;  4B1Y B;  2FSJ A;  2P5O A;  4KPY A;  1RT4 A;  4BWM A;  2RPI A;  2ZQB A;  4OO1 J;  5HBM A;  1SL0 A;  1J53 A;  4DR3 K;  4LF7 K;  4BE2 A;  5AQR A;  4HUG A;  1NGE A;  2FSK A;  5BRF A;  3QNN A;  1YT3 A;  2XY5 A;  3O4W A;  5GIN A;  4M41 A;  4DSF A;  1GLA G;  3AA3 A;  4C8K A;  1NGC A;  3LM2 A;  1TYQ B;  1QSS A;  3A5M C;  1SUQ A;  1U4B A;  4I6M A;  4F4K A;  4FLV A;  3VTH A;  4CBX A;  3CYM A;  4W5Q A;  2G8H A;  3NH0 A;  4NYN A;  5F2R A;  1GLB G;  4DS4 A;  1W7A A;  4FPB A;  5FPN A;  4IEI A;  3QBX A;  2GV9 A;  3E9P A;  3BGR A;  4KHY A;  4CHQ A;  1TK8 A;  1ZC6 A;  4K0K K;  2OPS A;  5T7B A;  1NJY A;  2BUP A;  3K5N A;  1NGH A;  4EAH D;  3VA0 A;  2GWK A;  2QXL A;  3AVA A;  4CGG A;  4NCB A;  3T19 A;  2D0C A;  4JI0 K;  1F21 A;  4H03 B;  4E0D A;  3L6Q A;  3CCM N;  3F9M A;  3L4Q A;  4C1N K;  4GV9 A;  4CF1 A;  2P9I A;  4FO0 A;  3A2F A;  3DRS A;  4YOY A;  4IEE A;  4DQI A;  1VHX A;  3ZX2 A;  2PFU A;  4DLG A;  3I0S A;  3RMC A;  1NGA A;  3OYF A;  4DSK A;  3H3O B;  3L8B A;  4CES A;  4FOI A;  4UQG A;  2HF3 A;  3ULE B;  1CZA N;  3NH1 A;  2VCP A;  3VEX A;  3PX6 A;  1U45 A;  2G8U A;  5FRN A;  5DM6 L;  4OLB A;  3KZB A;  4H0T B;  1VSE A;  5IWA K;  1VQ8 N;  4CGF A;  4MFB A;  2HHH K;  4M3X A;  3OA9 A;  4FZX C;  2P9S B;  3CJB A;  3VET A;  3R8E A;  3JAM O;  3CPW M;  2WC9 A;  5FRO A;  3L2V A;  1W9H A;  2HMI A;  1NLV A;  3KK7 A;  3AVK A;  1V4S A;  1SZ2 A;  3CC2 N;  3S3M A;  1HUX A;  4Z4E A;  2HBJ A;  3WXM B;  3K5M A;  1OKJ A;  5D3G A;  2HF4 A;  4GW6 A;  3O9U A;  1RTH A;  3C6H A;  1YJW N;  3F9K A;  3LPU A;  3H1V X;  2P9U B;  3WNH A;  2HST A;  3DLK A;  4FWK A;  4MDA A;  4FWP A;  4KH5 A;  4IOC L;  3PX4 A;  3P31 A;  2YHX A;  1REV A;  3JS6 A;  5FPD A;  1K73 O;  1K8K B;  3TTD A;  5BPN A;  4FJN A;  4BR9 A;  3O3G A;  3TU5 A;  1HNW K;  3QER A;  4DUZ K;  3BEX A;  4DTJ A;  3QML A;  3HBT A;  4A62 A;  4BRM A;  1VSK A;  1S6P A;  3FZF A;  4ISE A;  3NE6 A;  4O0I A;  1EET A;  4K41 A;  4CER A;  5HRO A;  2VQF K;  4CJ7 A;  1UOC A;  2OZS A;  1JLB A;  4R5P A;  2GEM A;  3KD5 E;  4HVJ A;  4CJL A;  3CF5 L;  1U04 A;  1XMO K;  1NBW A;  5A2Q O;  4Z4F A;  4CBU A;  3DYA A;  4IFV A;  1IG9 A;  1SQK A;  1HR0 K;  1W2B M;  1RDC A;  4I6M B;  3BP8 A;  3FFK B;  3THX A;  3U3G A;  4BRQ A;  1DTQ A;  3RMB A;  4PHT X;  4FWQ A;  1WAF A;  2X78 A;  4KHP K;  1G15 A;  4G9Z A;  4BRF A;  1E4F T;  3LDL A;  4H5T A;  3KK3 A;  1ATN A;  3RMD A;  3NGZ A;  3WXL A;  1VQM N;  1HLU A;  4BG9 A;  4CIG A;  4E1M A;  3HI0 A;  1KAX A;  4IO8 A;  3ZEU A;  2IAJ A;  3UB5 A;  4C8L A;  3ZSR A;  4BAC A;  4M3R A;  2HNY A;  4CJ3 A;  3HVR A;  3V1O A;  4LF4 K;  1EP4 A;  1S5J A;  2VWJ A;  1NMN A;  1S1X A;  4J2D A;  2ZJP L;  4YDU A;  2F9W A;  3V1Q A;  4FLU A;  3MN5 A;  3KK2 A;  2P9I B;  3SQ4 A;  2HHS A;  4FJH A;  4XIU A;  1RGI A;  4IDK A;  4LSN A;  4RWT A;  4XH1 A;  3QB0 A;  2HB5 A;  1QVG M;  2VWB A;  5AJ3 K;  2NUB A;  2Z1H A;  1TKT A;  3G10 A;  1A5X A;  4JLH A;  1X9S A;  3AVH A;  3QEV A;  3U6F A;  3ZLJ A;  3E9O A;  3VF4 A;  3ATV A;  4MLE A;  2IC3 A;  4B1X B;  1TGO A;  3QIC A;  2BDP A;  3ENO A;  4Z4I A;  4H5V A;  5TKW A;  4CFB A;  4JAX A;  4B1U B;  3HTV A;  3RR8 A;  2WTU A;  4RW9 A;  3MMV A;  1NK5 A;  5BR9 A;  3LDS A;  4FM1 A;  2QWN A;  3NGY A;  3H46 O;  1K9M O;  2NRW A;  5BPM A;  3J81 O;  2VGN A;  3NCI A;  2UXD K;  3UKR A;  1JXB A;  2EWS A;  2WBN A;  3LAM A;  2E6L A;  3DRR A;  4DFK A;  5M1P A;  2W6L A;  3K5O A;  4GVM A;  3ZT3 A;  4NO7 A;  2FBY A;  1XNQ K;  4U67 L;  4LSL A;  4CHZ A;  1T6C A;  1YI2 N;  2E20 A;  3T69 A;  4N41 A;  4FLT A;  2NRX A;  3DLG A;  4JK8 A;  4B1W B;  3FR0 A;  3NFA A;  1NKE A;  3SYZ A;  1QVF M;  3LAN A;  2NRV A;  4DU4 A;  4B9V A;  3CCV N;  5JS1 A;  4BRG A;  3AGK A;  4CJ4 A;  4JI6 K;  3DXK A;  3V9Z A;  2X6N A;  2A5X A;  1S72 N;  1GLC G;  4J8F A;  4BQZ A;  1DTT A;  4YOT A;  3PX0 A;  4C8O A;  4YOW A;  3CD6 N;  4B1V A;  3CFO A;  3MN7 A;  4CEE A;  2HHX A;  3D6R A;  3D2F A;  5HRR A;  4FZY A;  1T44 A;  3HP6 A;  4H5N A;  1TUY A;  1O13 A;  3SUP A;  4OJR A;  2YJE A;  3MX5 A;  3THX B;  1RTI A;  3AO3 A;  4IBN A;  5J2M A;  4FJ5 A;  3SQ0 A;  1N5Y A;  3SJH A;  5MLC Q;  4NXN K;  4K8Z A;  4RW4 A;  1YVU A;  1RBT A;  4B9S A;  3EEQ A;  3V6D A;  4DQS A;  2Q2R A;  1L3U A;  4E7K A;  5FPE A;  4JRP A;  4CGI A;  3LP2 A;  2CH6 A;  2QWL A;  4CJT A;  4IOA L;  3ZEU B;  3CME N;  4OKJ A;  1VSH A;  4OKK A;  4CJS A;  4KH4 A;  2ZGZ A;  3C95 A;  1MDU B;  1IKV A;  4BDP A;  3AVC A;  3HOT A;  3CM5 A;  2FLO A;  2UUA K;  4YOU A;  4DR6 K;  4I9L A;  3O08 A;  3CFR A;  2A3Z A;  3GBT A;  3C6A A;  1TAU A;  4DV4 K;  4FM0 A;  3FLC O;  4Z0U A;  2D0O A;  1XMQ K;  3CER A;  3WNF A;  1E3M A;  4FZZ A;  3VGK A;  3A8Y A;  4JI1 K;  2A41 A;  3F2K A;  4CZJ A;  5C12 A;  3BF3 A;  3NVK A;  3SPZ A;  4FM2 A;  2E1Z A;  4JRQ A;  3P5J A;  4DU1 A;  1TKD A;  2KZZ A;  1VQ5 N;  2RN2 A;  3QO9 A;  4DTN A;  4B3M K;  2YHA A;  3SUN A;  4R79 A;  1S1V A;  5ADX H;  1BIZ A;  3H08 A;  3WEE A;  2G8W A;  3OS2 A;  4A57 A;  4YOX A;  4JI5 K;  1JXE A;  3EO3 A;  1WSI A;  3GDQ A;  4XH4 A;  3RTV A;  2PZS A;  2HVH A;  4Y0W A;  1KAZ A;  1NOY A;  3IUC A;  5SZT A;  3ASM A;  4CZM A;  5KQ8 A;  3HL8 A;  3OYK A;  3KVG A;  3MEG A;  1TK0 A;  3O8M A;  1NGF A;  1TVR A;  3MXM A;  2QWM A;  4M42 A;  1S9G A;  3QFP A;  4CGH A;  2CGK A;  5AZI A;  1MU2 A;  3AVL A;  4N76 A;  5M1K A;  3SUO A;  4FLX A;  4C23 A;  3I8B A;  1YVN A;  2DTU A;  3VES A;  4IG0 A;  4JNE A;  2WUS A;  3CPE A;  1U48 A;  4M45 A;  3ID6 A;  4KHU A;  2Z1I A;  1J5E K;  4X65 K;  5AFU H;  1N32 K;  3ZSY A;  1FXX A;  5KTQ A;  3DAW A;  4H0V B;  1GLJ O;  4V19 S;  3WNE A;  3NDK A;  1YHQ N;  4CEZ A;  5KGW A;  3DXK B;  3D0P A;  2ZD1 A;  3G0Z A;  1NK9 A;  1VQK N;  4KRF A;  2IS3 A;  2Y1J A;  2E6M A;  1LOT B;  2GUP A;  1X3M A;  5EOY A;  3OS1 A;  4WFB L;  3OJS A;  3TWH A;  1K6Y A;  4DV3 K;  3TAF A;  3ZT1 A;  5HP1 A;  1OH5 A;  5CYQ A;  2VG7 A;  3QDK A;  4M3U A;  2PYJ A;  2HBL A;  4BC5 A;  4OPA A;  4AHU A;  4BRO A;  2B4J A;  2CGL A;  3CJA A;  1Z25 A;  3CHW A;  4CHN A;  4QS8 A;  1IKW A;  1VSD A;  1B9D A;  5TKY A;  3J7Y P;  2NNW A;  4MDB A;  4DV2 K;  2KZM A;  2LSN A;  1XQS C;  2O8F A;  4CJV A;  4ICL A;  1LWC A;  2V51 B;  4LF5 K;  1IG8 A;  2ZE2 A;  4FLZ A;  2CH5 A;  4PY5 A;  3VEN A;  3OBW A;  1KCF A;  2Q36 A;  5KI6 A;  3TAM A;  5E26 A;  1IV0 A;  4PUO A;  3B6P A;  4A2A A;  1M90 O;  1IBK K;  3OYA A;  3AVG A;  3AVI A;  3VTI A;  1H1V A;  3NH2 A;  4L8R B;  3W0L A;  3HST B;  2FF3 B;  4O8U A;  1NKB A;  4WF9 L;  3OYB A;  2Q1N A;  2UXB K;  5E84 A;  3WEE B;  2B6A A;  3M8R A;  4BR0 A;  3HT3 A;  3KKR A;  3S9H A;  4JKG A;  1IO2 A;  2NRR A;  1TL3 A;  1YJN N;  3KJV A;  3MCA B;  4PKG A;  4JS5 A;  2YKM A;  5C42 A;  4HCB A;  1VSF A;  4WQ5 C;  3ZYY X;  2QKK A;  5LY3 A;  2ZWH A;  4A61 A;  5AQS A;  2FF6 A;  3SMP A;  4CEA A;  1CZB A;  3TR8 A;  1XC3 A;  1TK5 A;  5C0Y A;  2Q97 A;  4YHH K;  3OHR A;  2HHT A;  4QS9 A;  4DG1 A;  4DV1 K;  1TV6 A;  2FXU A;  4BC2 A;  3AA4 A;  1R59 O;  4IXC A;  2QI2 A;  2PAV A;  4BRK A;  1G99 A;  1UWB A;  3N4Q A;  1GLD G;  4IOX A;  4DB3 A;  4DKW A;  3O3H A;  3PV8 A;  1JJ2 M;  3AV9 A;  5EXW A;  2VWK A;  5EY4 A;  3NAE A;  1U47 A;  3AVB A;  1LAV A;  1L3S A;  1C0G A;  4HTL A;  2GEL A;  2F4V K;  3O9Q A;  4CF8 A;  3U9Z A;  3V81 A;  3V9W A;  4BDY A;  4IFE A;  4KI6 A;  2P9K A;  4ZTJ A;  3JSM A;  3LL3 A;  3VQA A;  2YKN A;  3OYC A;  4JI7 K;  3GOI A;  4NLB A;  1HYZ A;  4BRP A;  4BVP A;  3E1Y A;  4PWD A;  4K43 A;  4JV5 K;  2QKB A;  4KFB A;  5FLX O;  4DFM A;  1BUP A;  4F9O A;  4O5B A;  2IVN A;  1B92 A;  1QZ5 A;  3UKU A;  4F3T A;  2F96 A;  3SBT A;  5CE3 A;  4DR5 K;  3FZH A;  1JL1 A;  1JLQ A;  2WON A;  1OH8 A;  5GIO A;  1D9D A;  4GV3 A;  2O8B A;  1BWF O;  1Z26 A;  2HNZ A;  3LP1 A;  4J2E A;  3CM6 A;  3S3N A;  4BRE A;  1ZBU A;  2YCH A;  3OYD A;  4HUE A;  2O8F B;  3ID8 A;  2Y1I A;  1OVQ A;  2RHK A;  3KLH A;  3MED A;  4ZTF A;  1J5O A;  2G8V A;  3LWL A;  3CJ9 A;  3SLC A;  2UYT A;  3B8A X;  4OX9 K;  4N47 A;  1P90 A;  2QWQ A;  4LF8 K;  4BGA A;  4FJL A;  5LJV A;  5AZJ A;  3LDN A;  5JIC A;  3OBY A;  2RF2 A;  3VMF B;  4N5S A;  3O80 A;  2WFB A;  4DV6 K;  3MEE A;  3OYJ A;  4WFA L;  4GMJ B;  1KVC A;  3VQ8 A;  1WOQ A;  4M3Z A;  5AQJ A;  4N56 A;  3KLE A;  4RTF D;  1GLL O;  5HLF A;  4KHQ A;  4RG8 A;  2PBD A;  3AVF A;  1KXP A;  4DTM A;  3VQP A;  3I0R A;  4E1N A;  5J2P A;  2O8E A;  4W5R A;  4BVO A;  3QEX A;  4CE9 A;  4CJF A;  1QQO A;  3PIP L;  1S1W A;  4TSX A;  4AIL C;  4GKJ K;  3K59 A;  4CCH A;  1HX1 A;  1U6Z A;  3DJC A;  4OPJ A;  4DV0 K;  2PYL A;  2W41 A;  3AA5 X;  4MLH A;  1VQL N;  2A6A A;  1GLE G;  3SK3 A;  1T8E A;  4DSI A;  2O4I A;  4ELV A;  3CQ8 A;  1XHX A;  4PQU A;  3VEO A;  1LCU A;  1RDD A;  4AH9 A;  3ZX3 A;  4HWI A;  3D45 A;  1ZBF A;  1HKC A;  1T3V A;  4M3Y A;  3CJ7 A;  3UIQ A;  3U9D A;  1NGD A;  5DMR A;  3VQ9 A;  4FJ9 A;  4KTZ A;  3T3F A;  2FSN A;  4B9U A;  2OZM A;  3OW2 M;  3MWP A;  3TAQ A;  1ZBI A;  4JKF A;  4JYA K;  2P51 A;  1S22 A;  5AQG A;  4E7L A;  1WSJ A;  1EWR A;  3TAE A;  4L3Q A;  3SV3 A;  4IO9 L;  5KPZ A;  3I55 N;  3ZSO A;  4QAG A;  1DGK N;  1Q18 A;  1Y64 A;  4E3S A;  5M1O A;  3ENB A;  4B1Z A;  1S3X A;  2A42 A;  4WCE L;  3CCL N;  4FJI A;  1HYV A;  1WBD A;  3PO4 A;  3IFR A;  4HCC A;  2O8D A;  3SI6 A;  4LY7 A;  3I56 N;  1TL1 A;  3M8P A;  1YIT N;  4F8R A;  1ZBL A;  2XY6 A;  3ALY A;  4B3R K;  3V4I A;  3A5N C;  3VEV A;  4CZE A;  2KFZ A;  4CBW A;  3A0I X;  3O5B A;  1NGJ A;  4CGJ A;  4LF9 K;  3C6U A;  3J7Z O;  3ZSW A;  5KPT A;  4PL8 A;  1D4X A;  1YUW A;  5J2Q A;  1ATS A;  4AHS A;  5B8H A;  3QEP A;  3HZ6 A;  4OVL A;  1NWK A;  1VRT A;  5AQN A;  3C94 A;  3T1H K;  2YNF A;  3MXJ A;  3L2Q A;  4K25 A;  3V1R A;  1C1A A;  1ESV A;  4DSJ A;  1NKC A;  1IBL K;  5EX5 A;  1N6Q A;  4ELU A;  1HYS A;  3TTF A;  4WE1 A;  2QWR A;  4YOV A;  3EKS A;  4LFA K;  3K58 A;  3ZSX A;  4CHO A;  1X9W A;  4BE1 A;  2VGM A;  4JHD A;  3T1Y K;  4RCH A;  4M3W A;  4QOZ B;  3CFP A;  1Y97 A;  4ZHR A;  3VQ7 A;  2KFN A;  1C1B A;  4H0Y B;  1RT5 A;  4FW2 A;  3DXM A;  4LC9 B;  2YNG A;  4CEQ A;  2YJF A;  4CJW A;  4JS4 A;  2J4R A;  5LL6 Z;  4F2R A;  3EZ5 A;  1NMD A;  4LH5 A;  1VRU A;  2JLE A;  4E19 A;  4AM7 A;  3HVT A;  1RIL A;  3E01 A;  5EU7 A;  3HXM A;  1U2V A;  5KPR A;  4FVU A;  2V7Y A;  5AQK A;  3L2U A;  3U8X A;  5GAE P;  4RW8 A;  1HKG A;  4M7Y A;  5AR0 A;  4B8A B;  3VN5 A;  3ZSZ A;  1JLE A;  3VQ5 A;  1ZYQ A;  1J54 A;  1SKR A;  4CI6 A;  1VAZ A;  4B9M A;  4CFD A;  5F0X A;  4CZF A;  1EO1 A;  2HHQ A;  2Q0R A;  3EE9 A;  3LZI A;  3VGL A;  3LDQ A;  1FK9 A;  1KVB A;  2E8A A;  3IDH A;  4EP4 A;  4IJA A;  1ILY A;  2NZT A;  4FWR A;  5CYM A;  2OCE A;  3MEC A;  4NCG A;  4FWM A;  2V52 B;  3LPT A;  4EFH A;  1Q86 O;  3ZET A;  3KKS A;  1RTD A;  1YJ9 N;  3J80 O;  4KAZ A;  1BI4 A;  1YXQ A;  4JKE A;  3VEW A;  3W3D A;  3MAQ A;  4JKC A;  4JK9 A;  1ZBH A;  2HMP A;  1JLC A;  4K8X A;  3AGR A;  4ISG A;  5CZ1 A;  4OGE A;  1EXQ A;  3KK1 A;  1CXQ A;  2AP1 A;  2O8D B;  1JCG A;  3DOK A;  4DR4 K;  4JN4 A;  2KQ2 A;  3R1X A;  3RVC A;  5BRE A;  2ETJ A;  3ITH A;  4RW7 A;  1C6V A;  1T03 A;  4Y1C A;  2NRZ A;  5AQO A;  3O9S A;  1DLO A;  4CD3 A;  5AQU A;  3SPY A;  3CQY A;  4DTR A;  3SJJ A;  2KTQ A;  4XEI A;  5C2D A;  2HBM A;  4WQ4 A;  4CZG A;  4Z94 A;  3RWU A;  4OKE A;  4CJP A;  1WSH A;  1BGX T;  4FWO A;  4IG3 A;  5CY4 A;  2O8C A;  4G1Q A;  1P8Z A;  1VQ7 N;  1SV5 A;  4FJJ A;  1BA0 A;  4DU3 A;  4BC3 A;  2DY4 A;  3DI6 A;  3THW A;  4QCL A;  4GKK K;  1VSL A;  5AQF A;  1WBB A;  4YDU C;  4FK2 A;  3NF8 A;  1LWF A;  3VQD A;  1NK4 A;  2JWK A;  4JHD B;  4FYD A;  2Q3S A;  3HPG A;  2D4W A;  3QFU A;  2OAN A;  4ID5 A;  4GV6 A;  1NJZ A;  1VSJ A;  4BQL A;  2D0P A;  3H3N O;  1XC9 A;  4O0J A;  2OPP A;  3NVM A;  1UAX A;  4DSL A;  1KAY A;  4AHV A;  5BPL A;  2ITM A;  3MCP A;  3DLL L;  3VQE A;  1U2V B;  2P9N A;  5GAH P;  5HOO A;  4HUF A;  2OYQ A;  3DWL A;  4DF4 A;  1V4T A;  3IAY A;  4A59 A;  2E1Y A;  5KGX A;  3HP9 A;  3AVJ A;  3CI5 A;  3Q7B A;  3UKR B;  1BHL A;  4ILG B;  3VEY A;  4BR7 A;  3HPO A;  1HQE A;  2OPR A;  3I8D A;  2GX9 A;  1TAQ A;  2YNI A;  4O55 A;  2NLX A;  3BF1 A;  3DLH A;  4U7B A;  3CC4 N;  2YI1 A;  4ILJ A;  4DSE A;  4BRN A;  3L4I A;  2EX3 A;  3TSQ A;  1NOZ A;  1A5W A;  3IS9 A;  4E7J A;  3LAL A;  4CK3 A;  2DFE A;  1GLF O;  2W6K A;  1C1C A;  3ZET B;  4KV8 A;  3HPH A;  1FKP A;  3TAR A;  3O4N A;  2XHB A;  1BI4 B;  3EL2 A;  4DR2 K;  3D2F B;  3NF6 A;  4FJ7 A;  1SKS A;  4I2P A;  3ULD A;  3TAG A;  1T05 A;  1TYQ A;  5I9E B;  1NG9 A;  4B9T A;  3O1B A;  1MWM A;  3MK6 A;  4FCY A;  3B6O A;  1SAZ A;  5IT9 O;  2YHY A;  3TSU A;  5AQT A;  4JK7 A;  3CCQ N;  4CJK A;  4BDZ A;  4O8K A;  5CZ2 A;  1GOA A;  2DFH A;  4CZL A;  3OVN A;  3SAG A;  3MXI A;  4CVN E;  4A5B A;  2A1S A;  4W5O A;  1RT7 A;  5JVG L;  1X3N A;  3HM8 A;  3VEZ A;  1BL3 A;  1RDU A;  2OTJ N;  3AAP A;  1CXU A;  3V9U A;  3C65 A;  1NGI A;  3CCR N;  4NXM K;  4Q5V A;  4CGD A;  3SCX A;  3K9J A;  3KLG A;  4IWV A;  1DKG D;  2O8C B;  3VGM A;  2RKI A;  2VG5 A;  1Z05 A;  2X74 A;  3M1F A;  1YIJ N;  5J1E A;  4F2S A;  3CG7 A;  2XY8 A;  4QS7 A;  1C0F A;  3E9L A;  1XHZ A;  2E88 A;  4CZH A;  3U3Y A;  3RR7 A;  2XO7 A;  3T1A A;  2UXC K;  1O1W A;  2IIR A;  3AO4 A;  1TUU A;  1WNS A;  4O5F A;  3DOL A;  3EKU A;  2ZM6 K;  4C8M A;  4LFC K;  3SUQ A;  1RT2 A;  1L5U A;  1QQM A;  2W42 A;  2F9T A;  3P83 D;  4I9Q A;  5K14 A;  1NM1 A;  3EE8 A;  3R6M A;  4CW7 B;  2ZJQ L;  1SL2 A;  4KI4 A;  2P9S A;  4MO5 A;  4BRL A;  4A5A A;  1Q81 O;  3QET A;  2P9N B;  3L2R A;  3P4I A;  4PL7 A;  5BN9 A;  5JVH L;  1CLQ A;  2JWL A;  3SZ2 A;  3QES A;  1WLJ A;  1Q8I A;  3VQ6 A;  5M1Q A;  2BGG A;  4IDH A;  5FPM A;  2NRT A;  3HRG A;  1S1T A;  4ELT A;  2E4L A;  1KFS A;  3H6E A;  5AZI B;  2HOE A;  3THV A;  1ASW A;  2E2O A;  1YTA A;  4KH6 A;  2ZJR L;  1FW6 A;  2Q31 A;  1BO5 O;  3P1G A;  4LH4 A;  1NGB A;  3A5O C;  1XUP O;  3EY1 A;  1NK6 A;  1JCF A;  1C0T A;  3LWM A;  4I7F A;  4NLC A;  1DT9 A;  1JLF A;  4FWL A;  3WUH A;  4DCH A;  3TTC A;  2O4G A;  2FC0 A;  3PUF A;  5AQV A;  4CJQ A;  2JGU A;  3F5T A;  4KKO A;  1XWL A;  3ISN C;  3O3F A;  3L3V A;  2OPQ A;  3O9T A;  1IKX A;  4DV5 K;  4CJR A;  1KSP A;  1NU0 A;  2W40 A;  2E2P A;  3WNG A;  3NMU A;  3DLR A;  3I33 A;  4JI4 K;  2I7P A;  2VYP A;  2G8I A;  4EIA A;  1WAJ A;  4RW6 A;  1QE1 A;  3CC7 N;  3QEI A;  1HQU A;  1BIU A;  2UU9 K;  1BQM A;  4CEF A;  2IVP A;  2D0A A;  4KTW A;  3Q7C A;  4H4M A;  4J2A A;  3R9P A;  1FJG K;  1QSL A;  1RBS A;  3H1Q A;  4IFY A;  5AQX A;  1BDG A;  5LMN K;  2P9P A;  4OPH A;  2QK9 A;  4FJG A;  1HPZ A;  3PIO L;  3NF9 A;  1RT1 A;  3WQT A;  1J6Z A;  3RSE A;  3TSP A;  3ZX0 A;  4IJN A;  3VER A;  3WQU A;  2XY7 A;  3THY A;  3KTQ A;  2FBT A;  4YY3 K;  4CIE A;  4DHY A;  4CFC A;  2R7Y A;  1KVA A;  1YTU A;  2QWP A;  2IGI A;  3LAK A;  1IBM K;  1Q82 O;  3PY8 A;  4BGB A;  1KRP A;  1B9F A;  4UY8 O;  4DF8 A;  3IG1 A;  1RDA A;  4DV7 K;  1MWK A;  3DLE A;  4CK2 A;  1VSI A;  1S1U A;  4HHT A;  4H8K A;  3DM2 A;  3E66 A;  1C0U A;  3NF7 A;  1JLA A;  2YNH A;  3QEW A;  4H0X B;  5M1N A;  1LW0 A;  3D2E A;  1NJI O;  4H5W A;  4B3S K;  4CF0 A;  3C0B A;  5H1S Q;  1N36 K;  4W5T A;  4AF1 A;  4JKG B;  3HJF A;  2X6S A;  2OTL N;  4FL9 A;  5JMV A;  3CCJ N;  4M63 C;  2G8F A;  1LWE A;  3RMA A;  2QM1 A;  3O1W A;  4CF9 A;  1ASV A;  1NK0 A;  3WXJ A;  5C25 A;  3LM9 A;  1XNR K;  3A5L C;  3FZL A;  3SBG A;  3KLI A;  5AQY A;  1I39 A;  2BH1 A;  4AHT A;  5GAG P;  1QTM A;  3QLH A;  3EYZ A;  2G8K A;  1IJJ A;  3ZSV A;  1UA1 A;  4M7X A;  4X66 K;  3LDO A;  5EVZ A;  4YFU A;  2KHO A;  3RRG A;  1EKE A;  2QWO A;  2HHW A;  4KBO A;  1IKY A;  1JL2 A;  4AQY K;  5BRD A;  5J2N A;  2ASP A;  4EZ6 A;  3OYL A;  1ZXO A;  3CET A;  4KB1 A;  1VQ6 N;  1SS6 A;  4O4G A;  5AQZ A;  4Q0B A;  4KRE A;  3VA3 A;  2F7T A;  3PO5 A;  4E7H A;  5ADX A;  2P9K B;  4B08 A;  4C8N A;  5GIP A;  1KC8 O;  1S6Q A;  4EP5 A;  3K2P A;  4CD1 A;  1IH7 A;  5C15 A;  5JS2 A;  4F3O A;  2VQE K;  4JI3 K;  3SQ1 A;  3ZT0 A;  3M6G A;  4DUY K;  1RBV A;  3UKU B;  4M3T A;  5C24 A;  2DPN A;  3VPZ A;  3P38 A;  1VSM A;  4DLE A;  4ISF A;  4DR7 K;  3L0Q A;  5AQI A;  2O8B B;  3IMX A;  4BRA A;  5DM7 L;  4E1J A;  4KO0 A;  4DFJ A;  3LP3 A;  2ZF5 O;  4DR1 K;  1BCM A;  4FSV A;  4NB4 A;  4OGC A;  4BRH A;  4NCA A;  3TAN A;  1EWQ A;  4FK0 A;  3KD1 E;  2P9P B;  4Z4C A;  3SNN A;  2EHG A;  2D5R A;  1TKZ A;  2F8S A;  5AFU A;  5KQD A;  5CR4 A;  3RSE B;  2GWJ A;  4XH5 A;  5AQL A;  1Q9Y A;  3K9K A;  4JI2 K;  1JCE A;  4JKB A;  3VOV A;  5AQQ A;  3AAQ A;  2VG6 A;  3M8S A;  2HBK A;  3OYE A;  3THY B;  4JI8 K;  4AM6 A;  2QTD A;  1VK0 A;  3J7A P;  1D5A A;  5AZJ B;  1X9M A;  3OTO K;  5KRT A;  1WB9 A;  2QXF A;  1I94 K;  5LJW A;  3DRP A;  3CCE N;  1DEJ A;  3IRX A;  4JKA A;  4H5R A;  3VF2 A;  3ATU A;  3C7N A;  3OYM A;  3T7Z A;  1BG3 A;  5HRP A;  3MX2 A;  1KQS M;  1C0M A;  1HNI A;  5E41 A;  3AVN A;  2I7N A;  2D0B A;  2HND A;  2Z1J A;  3AO1 A;  4YOR A;  5HRN A;  2O8E B;  4FW1 A;  1QHA A;  3AA2 A;  3BZK A;  3VQQ A;  4BE0 A;  1HKB A;  2ASO A;  3MN9 A;  3SAF A;  1BCO A;  4DQR A;  3D2E B;  4X64 K;  1FKO A;  1OVY A;  3FFI A;  2FBV A;  1HRH A;  4IKF A;  3FZM A;  3CCS N;  3HYF A;  4OPK A;  3CJ1 A;  2NRH A;  5I3U A;  1T6D A;  3CMA N;  1RBU A;  3AVM A;  4DQQ A;  4FJ8 A;  4JEP A;  4DWI A;  3S3O A;  2YHW A;  5BN8 A;  1LAW A;  1RDB A;  1OH7 A;  4CEC A;  5GAD P;  4FVM A;  4LD0 A;  3O9R A;  5KRS A;  1QZ6 A;  4JD2 A;  4YNQ A;  3GL1 A;  3AO2 A;  1RCH A;  4DTP A;  2P9L A;  4DTU A;  2E2N A;  3WT0 A;  3OJU A;  2QA4 N;  4KHS A;  1S9E A;  1BA1 A;  1GOC A;  3J8A A;  4CJE A;  3R3L A;  4J2B A;  2GUI A;  4GY2 B;  1QQN A;  3LZJ A;  1LV5 A;  4IZ9 A;  4DMN A;  3TAP A;  4CK1 A;  4I2Q A;  1X1P A;  4CF2 A;  1BIS A;  1BOT O;  3NBP A;  4FLY A;  4ILH A;  3KLF A;  2AA4 A;  2E5L K;  4FPA A;  4CFA A;  4FXD A;  1ZBS A;  1MA9 B;  3CQX A;  3TI0 A;  1HJR A;  4KTQ A;  3DMJ A;  1YF5 L;  3FGU A;  2A40 A;  5M1F A;  1SKW A;  1W97 L;  3LDP A;  4KHN A;  1NNE A;  3AY9 A;  2I5J A;  2HHU A;  1KTQ A;  2HVI A;  2V7Z A;  3QIO A;  3AAR A;  3ZSQ A;  2OA8 A;  1HNZ K;  3OYN A;  3SMS A;  4LF6 K;  1KLM A;  4PKH A;  5SWM A;  3K5L A;  3ENH A;  1R0A A;  4EZ9 A;  1EQY A;  1QHT A;  3RRH A;  4WFN L;  2FBX A;  4B8C A;  1HNX K;  4W5N A;  3HM9 A;  2D1K A;  3HO1 A;  2QEX N;  4FWS A;  1HJO A;  4ID1 A;  3G6E N;  3JYT A;  3HSC A;  1RFQ A;  1A5V A;  4CED A;  4BRC A;  5DK5 A;  4BG8 A;  5HL7 L;  4BWJ A;  3QIN A;  5AQH A;  1NJW A;  3SQ2 A;  2WOM A;  5C2F A;  3PSF A;  1WN7 A;  1NGG A;  3CIP A;  3MWT A;  1QSY A;  4FWN A;  1EX4 A;  5JLF A;  3O6W A;  4BRI A;  2PY5 A;  3ZT4 A;  4B9L A;  4DS5 A;  2KKZ A;  3C7N B;  3DXM B;  5JLH A;  1U49 A;  1L3V A;  2HHV A;  4Y1D A;  3L2W A;  4A2B A;  3BUZ B;  3HOS A;  4OLA A;  1E4G T;  3ZCM A;  2E2Q A;  2IDO A;  3K57 A;  3TAB A;  1WUA A;  2YV0 X;  1X9J A;  4CHY A;  3OYI A;  2ZGY A;  3M8Q A;  4BRD A;  3K0S A;  3EN9 A;  5FRM A;  3QIP A;  3IKM A;  4WQ5 A;  3KIO A;  3HK2 A;  4CEB A;  3V9S A;  2H3G X;  4FJX A;  1N34 K;  1JKH A;  4Z4H A;  4E89 A;  4B3O A;  3SAH A;  2ASM A; 
#chains in the Genus database with same CATH homology
 3QES A;  1WLJ A;  1Q8I A;  1BQN A;  3VQ6 A;  3DLB A;  2BGG A;  3NCI A;  1JXB A;  3LAM A;  1T8E A;  1S1T A;  4ELT A;  4DSI A;  2E6L A;  3DRR A;  4DFK A;  2ITG A;  4CHP A;  1TKX A;  2E4L A;  3K5O A;  4GVM A;  3ZT3 A;  1KFS A;  4ELV A;  2O4I A;  5HRS A;  3CQ8 A;  3THV A;  3QNO A;  1ASW A;  1YTA A;  2FBY A;  1XHX A;  4PQU A;  4LSL A;  1RDD A;  1LW2 A;  3L3U A;  4AH9 A;  4CHZ A;  3D45 A;  1ZBF A;  4M3Y A;  4FJM A;  3P1G A;  4LH4 A;  3UIQ A;  3EY1 A;  4N41 A;  1NK6 A;  4FLT A;  3DLG A;  1C0T A;  5DMR A;  3VQ9 A;  3LWM A;  1RT6 A;  4I7F A;  4FJ9 A;  1JLF A;  3NFA A;  1NKE A;  3SYZ A;  4FK4 A;  4KTZ A;  3LAN A;  3T3F A;  4AHR A;  1JLG A;  4CEO A;  4DU4 A;  4B9V A;  1GOB A;  2O4G A;  4CIF A;  2FC0 A;  1D9F A;  4B9U A;  3PUF A;  1CZ9 A;  3TAQ A;  2OZM A;  5JS1 A;  1ZBI A;  4O44 A;  4CJ4 A;  4CJQ A;  2P51 A;  2JGU A;  4KKO A;  3V9Z A;  4E7L A;  1XWL A;  1WSJ A;  3ISN C;  3O3F A;  3L3V A;  2X6N A;  3OY9 A;  2OPQ A;  3TAE A;  4NYF A;  4DTO A;  1IKX A;  3SV3 A;  4CJR A;  3VQB A;  1HMV A;  1KSP A;  3ZSO A;  4QAG A;  1DTT A;  4E7I A;  2Z1G A;  3PX0 A;  1L3T A;  3WNG A;  4C8O A;  3DLR A;  1WSG A;  4E3S A;  3CFO A;  4CEE A;  1W0H A;  2HHX A;  4PA1 A;  1UA0 A;  2G8I A;  5HRR A;  4FZY A;  3ZT2 A;  3HP6 A;  2DFF A;  4FJI A;  2IOC A;  1D8Y A;  1HYV A;  4HCC A;  3PO4 A;  3BDP A;  1QS4 A;  2KW4 A;  3SI6 A;  1WAJ A;  4LY7 A;  1TL1 A;  3M8P A;  4OJR A;  3SUP A;  4RW6 A;  4F8R A;  1ZBL A;  3O4Q A;  1RTI A;  2XY6 A;  1QE1 A;  3QEI A;  1HQU A;  3AO3 A;  3ALY A;  4IBN A;  3SV4 A;  5J2M A;  1BIU A;  3V4I A;  3OS0 A;  2P5G A;  1BQM A;  3NHG A;  3AO5 A;  4FJ5 A;  2KFZ A;  4CEF A;  1J9A A;  3SQ0 A;  2D0A A;  1N5Y A;  4KTW A;  1HNV A;  4H4M A;  4KB0 A;  4J2A A;  4CGJ A;  3OYG A;  4K8Z A;  1QSL A;  3VQC A;  3C6U A;  1RBS A;  4RW4 A;  5FDL A;  1YVU A;  4IFY A;  1RBT A;  1WSE A;  3ZSW A;  4B9N A;  4B9S A;  3V6D A;  4DQS A;  1L3U A;  2QK9 A;  4FJG A;  4E7K A;  1HPZ A;  4JRP A;  5J2Q A;  2BAN A;  3LP2 A;  4CGI A;  2HW3 A;  3NF9 A;  4AHS A;  1RT1 A;  2ATQ A;  4CJT A;  3QEP A;  1KLN A;  4OKJ A;  1VSH A;  4OKK A;  4OVL A;  1SL1 A;  4CJS A;  1RNH A;  4DTX A;  3C95 A;  1VRT A;  3C94 A;  1IKV A;  2YNF A;  4BDP A;  3AVC A;  1T7P A;  3MXJ A;  2XY7 A;  3CM5 A;  3L2Q A;  3KTQ A;  2FBT A;  4CJ5 A;  4CIE A;  1NJX A;  3V1R A;  1C1A A;  4I9L A;  3VQ4 A;  3CFR A;  4CFC A;  2R7Y A;  1KVA A;  1NKC A;  1ASU A;  4DSJ A;  3NGI A;  1KFD A;  1N6Q A;  4ELU A;  1TAU A;  1HYS A;  4FM0 A;  2GBZ A;  4WE1 A;  4Z4G A;  1YTU A;  4Z0U A;  2IGI A;  3LAK A;  3WNF A;  3K58 A;  3ZSX A;  4CHO A;  1X9W A;  4BE1 A;  3PY8 A;  3OYH A;  4DQP A;  4FZZ A;  1KRP A;  4M3W A;  4FJK A;  1B9F A;  2AJQ A;  4DF8 A;  3IG1 A;  4QOZ B;  3CFP A;  1XI1 A;  1RDA A;  1RBR A;  1Y97 A;  3C6T A;  3DLE A;  1VSI A;  3VQ7 A;  1C1B A;  4CK2 A;  4ZHR A;  1NK7 A;  2KFN A;  1S1U A;  1RT5 A;  3LP0 A;  4FW2 A;  4HHT A;  4FM2 A;  2YHB A;  3SPZ A;  4H8K A;  2YNG A;  4CEQ A;  4JRQ A;  3P5J A;  4DU1 A;  4CJW A;  3DM2 A;  1TKD A;  4JS4 A;  2KZZ A;  2RN2 A;  1C0U A;  2XRI A;  3QO9 A;  4DTN A;  2YHA A;  3NF7 A;  1JLA A;  3SUN A;  2YNH A;  4DTS A;  4AHC A;  3EZ5 A;  4LH5 A;  3QEW A;  1VRU A;  4F2R A;  1S1V A;  2JLE A;  4E19 A;  3HVT A;  1LW0 A;  1BIZ A;  1RIL A;  4FLW A;  2B5J A;  3H08 A;  3E01 A;  5EU7 A;  3HXM A;  2A1R A;  3OS2 A;  2G8W A;  4CF0 A;  2P1J A;  3V9X A;  1QQC A;  1JXE A;  1WSI A;  4W5T A;  3HJF A;  2X6S A;  3RTV A;  2PZS A;  2HVH A;  4H4O A;  3L2U A;  1NOY A;  2G8F A;  1LWE A;  3RMA A;  4KHW A;  5SZT A;  3ASM A;  4MQ3 A;  3HL8 A;  4CF9 A;  3OYK A;  1ASV A;  3MEG A;  1NK0 A;  4RW8 A;  5C25 A;  1I3A A;  3F73 A;  1TK0 A;  5I42 A;  4B8A B;  1TVR A;  4HTU A;  3MXM A;  3KLI A;  1QTM A;  1I39 A;  4AHT A;  3VN5 A;  1Q9X A;  3QLH A;  3ZSZ A;  1JLE A;  3VQ5 A;  3EYZ A;  1ZYQ A;  2G8K A;  1S9G A;  1J54 A;  3ZSV A;  4CGH A;  4M42 A;  1UA1 A;  1SKR A;  1WSF A;  4B9M A;  4CFD A;  1RT3 A;  1MU2 A;  4YFU A;  3AVL A;  4N76 A;  2HHQ A;  3SUO A;  4CJU A;  3LZI A;  4FLX A;  1ITG A;  4DFP A;  1FK9 A;  1EKE A;  1RTJ A;  3RRG A;  1KVB A;  2HHW A;  2DTU A;  4IG0 A;  2BE2 A;  1IKY A;  1JL2 A;  1U48 A;  4M45 A;  5J2N A;  4EZ6 A;  1NK8 A;  4KHU A;  3OYL A;  4EP4 A;  2P5O A;  1RT4 A;  2Z1I A;  4KB1 A;  4BWM A;  4KPY A;  2F8T A;  2RPI A;  4O4G A;  2ZQB A;  3ZSY A;  4Q0B A;  1FXX A;  5KTQ A;  4KRE A;  5HBM A;  5CYM A;  1SL0 A;  1J53 A;  3MEC A;  4NCG A;  3VA3 A;  3PO5 A;  3WNE A;  3NDK A;  4E7H A;  4CEZ A;  4BE2 A;  4B08 A;  3LPT A;  4C8N A;  5KGW A;  3D0P A;  1S6Q A;  2ZD1 A;  3G0Z A;  3KKS A;  4HUG A;  1RTD A;  4EP5 A;  1NK9 A;  3K2P A;  4KAZ A;  3QNN A;  1BI4 A;  1YT3 A;  2XY5 A;  1IH7 A;  3MAQ A;  4M41 A;  4DSF A;  2IS3 A;  3AA3 A;  2Y1J A;  4C8K A;  5JS2 A;  4F3O A;  4KRF A;  1ZBH A;  1QSS A;  2E6M A;  1JLC A;  4K8X A;  3SQ1 A;  1SUQ A;  5CZ1 A;  3ZT0 A;  4OGE A;  1U4B A;  1EXQ A;  3OS1 A;  3KK1 A;  3OJS A;  3TWH A;  1K6Y A;  1CXQ A;  3TAF A;  1RBV A;  3ZT1 A;  5HP1 A;  4M3T A;  5C24 A;  5CYQ A;  2VG7 A;  4M3U A;  2PYJ A;  4F4K A;  1VSM A;  4FLV A;  4DLE A;  4AHU A;  3DOK A;  3CYM A;  4W5Q A;  2G8H A;  3NH0 A;  4NYN A;  2B4J A;  2KQ2 A;  4KO0 A;  4DFJ A;  3LP3 A;  2ETJ A;  3ITH A;  4RW7 A;  1C6V A;  4DS4 A;  1T03 A;  4Y1C A;  1BCM A;  1Z25 A;  4OGC A;  4NCA A;  1DLO A;  3TAN A;  4CHN A;  4FK0 A;  3SPY A;  4DTR A;  3KD1 E;  1IKW A;  1VSD A;  3SJJ A;  2GV9 A;  1B9D A;  4Z4C A;  3SNN A;  2KTQ A;  3BGR A;  2EHG A;  2D5R A;  4CHQ A;  4KHY A;  1TK8 A;  1TKZ A;  2F8S A;  3RWU A;  4OKE A;  2KZM A;  2LSN A;  2OPS A;  4CJV A;  5T7B A;  4CJP A;  1NJY A;  3K5N A;  4ICL A;  3VA0 A;  1LWC A;  1WSH A;  3AVA A;  1BGX T;  1Q9Y A;  4CGG A;  4IG3 A;  5CY4 A;  3T19 A;  4NCB A;  2D0C A;  4G1Q A;  1F21 A;  4E0D A;  2ZE2 A;  4FLZ A;  1SV5 A;  2VG6 A;  3M8S A;  3OYE A;  4PY5 A;  4FJJ A;  4DU3 A;  1VK0 A;  1KCF A;  3DI6 A;  1D5A A;  4CF1 A;  1X9M A;  2OZS A;  5KRT A;  4QCL A;  2DY4 A;  2QXF A;  4FJH A;  3A2F A;  1VSL A;  5KI6 A;  3DRP A;  3TAM A;  3DRS A;  4FK2 A;  3NF8 A;  3SZ2 A;  4DQI A;  3IRX A;  1LWF A;  3VQD A;  3I0S A;  4DLG A;  3OYF A;  3RMC A;  4DSK A;  3L8B A;  1NK4 A;  4PUO A;  4CES A;  3B6P A;  4FYD A;  2Q3S A;  3HPG A;  4UQG A;  3OYM A;  3OYA A;  3AVG A;  4ID5 A;  5HRP A;  3NH1 A;  1NJZ A;  3PX6 A;  1U45 A;  2G8U A;  3AVI A;  5FRN A;  1C0M A;  1HNI A;  1VSJ A;  3AVN A;  5E41 A;  4OLB A;  1XC9 A;  1VSE A;  4CGF A;  2D0B A;  2HND A;  2Z1J A;  3NH2 A;  4MFB A;  4O0J A;  2OPP A;  4L8R B;  4M3X A;  3AO1 A;  3HST B;  4FZX C;  1UAX A;  5HRN A;  4FW1 A;  4DSL A;  3AA2 A;  3VQQ A;  1NKB A;  4AHV A;  4BE0 A;  3OYB A;  1BCO A;  4DQR A;  1FKO A;  3VQE A;  3FFI A;  2B6A A;  2FBV A;  1W9H A;  5FRO A;  3M8R A;  3L2V A;  2HMI A;  1HRH A;  3AVK A;  4IKF A;  4HUF A;  2OYQ A;  3HT3 A;  3S3M A;  3HYF A;  3KKR A;  4DF4 A;  4OPK A;  3S9H A;  3IAY A;  4Z4E A;  1IO2 A;  1TL3 A;  5KGX A;  3HP9 A;  4GW6 A;  3K5M A;  5D3G A;  3KJV A;  4JS5 A;  5I3U A;  1RTH A;  2YKM A;  3AVJ A;  5C42 A;  4HCB A;  1BHL A;  1RBU A;  1VSF A;  3AVM A;  4DQQ A;  3F9K A;  3LPU A;  2QKK A;  4FJ8 A;  3WNH A;  4CEA A;  3DLK A;  4DWI A;  1CZB A;  3S3O A;  1LAW A;  1RDB A;  1HQE A;  2OPR A;  3TR8 A;  3HPO A;  3I8D A;  1TK5 A;  3PX4 A;  4CEC A;  1TAQ A;  2HHT A;  2YNI A;  1REV A;  4FVM A;  4O55 A;  4LD0 A;  5KRS A;  4DG1 A;  1TV6 A;  3DLH A;  4YNQ A;  3AA4 A;  3AO2 A;  1RCH A;  4DTP A;  4DSE A;  4FJN A;  1UWB A;  2EX3 A;  1NOZ A;  1A5W A;  3O3G A;  3O3H A;  4DTU A;  3PV8 A;  3AV9 A;  3QER A;  2VWK A;  3OJU A;  4KHS A;  1S9E A;  1U47 A;  1GOC A;  3NAE A;  4DTJ A;  3NE6 A;  3AVB A;  1VSK A;  1LAV A;  1S6P A;  3IS9 A;  4CJE A;  1L3S A;  2GUI A;  4J2B A;  4O0I A;  1EET A;  4E7J A;  4CER A;  3LAL A;  4CF8 A;  3LZJ A;  1LV5 A;  4DMN A;  4CK3 A;  3TAP A;  2DFE A;  5HRO A;  4CK1 A;  3V81 A;  1C1C A;  4I2Q A;  1UOC A;  4BDY A;  4KV8 A;  3HPH A;  1JLB A;  1FKP A;  3O4N A;  3V9W A;  3JSM A;  3TAR A;  4ZTJ A;  3VQA A;  4KI6 A;  1X1P A;  4CF2 A;  4R5P A;  1BI4 B;  2YKN A;  2XHB A;  1BIS A;  3KD5 E;  4HVJ A;  4CJL A;  1U04 A;  3NF6 A;  3OYC A;  4FJ7 A;  3NBP A;  4FLY A;  3KLF A;  1SKS A;  4Z4F A;  1HYZ A;  3DYA A;  4IFV A;  4I2P A;  3ULD A;  3TAG A;  1T05 A;  1IG9 A;  4PWD A;  4CFA A;  2QKB A;  4FXD A;  4KFB A;  1RDC A;  4B9T A;  3TI0 A;  4DFM A;  1HJR A;  4KTQ A;  4O5B A;  3DMJ A;  3U3G A;  4FCY A;  1B92 A;  3B6O A;  1SKW A;  4KHN A;  1DTQ A;  3RMB A;  4F3T A;  2F96 A;  1JL1 A;  1JLQ A;  2I5J A;  2WON A;  1WAF A;  2X78 A;  4CJK A;  1G15 A;  1D9D A;  2HHU A;  1KTQ A;  4BDZ A;  2HVI A;  1Z26 A;  5CZ2 A;  1GOA A;  2DFH A;  3QIO A;  3OVN A;  3ZSQ A;  2HNZ A;  3LP1 A;  2OA8 A;  3OYN A;  3KK3 A;  3RMD A;  4J2E A;  1KLM A;  3MXI A;  3NGZ A;  2A1S A;  5SWM A;  3K5L A;  4W5O A;  1R0A A;  1RT7 A;  4CIG A;  4EZ9 A;  1QHT A;  4E1M A;  3RRH A;  3CM6 A;  3S3N A;  2FBX A;  4B8C A;  1BL3 A;  1ZBU A;  3OYD A;  1CXU A;  2IAJ A;  4HUE A;  4C8L A;  4W5N A;  3ZSR A;  3HM9 A;  3V9U A;  3HO1 A;  4BAC A;  4M3R A;  2Y1I A;  2HNY A;  4CJ3 A;  4Q5V A;  3V1O A;  3MED A;  4ID1 A;  4CGD A;  3KLH A;  3HVR A;  3SCX A;  4ZTF A;  1J5O A;  1EP4 A;  1S5J A;  3KLG A;  3LWL A;  3JYT A;  4CED A;  1A5V A;  1S1X A;  2VWJ A;  5DK5 A;  4J2D A;  4BWJ A;  3QIN A;  2RKI A;  1NJW A;  2VG5 A;  4N47 A;  3SQ2 A;  2WOM A;  2X74 A;  5J1E A;  1WN7 A;  4F2S A;  3CG7 A;  3V1Q A;  2XY8 A;  4FLU A;  3KK2 A;  1QSY A;  4FJL A;  1EX4 A;  3SQ4 A;  1XHZ A;  3U3Y A;  2HHS A;  2G8V A;  4XIU A;  2PY5 A;  2RF2 A;  4IDK A;  4LSN A;  4N5S A;  2XO7 A;  3RR7 A;  3T1A A;  1O1W A;  2HB5 A;  3ZT4 A;  4B9L A;  4DS5 A;  3AO4 A;  2HHV A;  1L3V A;  1U49 A;  1WNS A;  3DOL A;  4Y1D A;  4C8M A;  3MEE A;  3OYJ A;  3L2W A;  2NUB A;  2Z1H A;  1TKT A;  1KVC A;  4GMJ B;  3VQ8 A;  4M3Z A;  3G10 A;  4OLA A;  3ZCM A;  1A5X A;  4N56 A;  3KLE A;  1RT2 A;  4JLH A;  3SUQ A;  1L5U A;  1X9S A;  3AVH A;  2W42 A;  3QEV A;  2IDO A;  3P83 D;  3U6F A;  5HLF A;  4I9Q A;  5K14 A;  4KHQ A;  3K57 A;  4RG8 A;  3AVF A;  4DTM A;  3TAB A;  1SL2 A;  2IC3 A;  3VQP A;  1TGO A;  4KI4 A;  3I0R A;  2YV0 X;  4E1N A;  5J2P A;  2BDP A;  4CHY A;  3OYI A;  4Z4I A;  4W5R A;  3M8Q A;  3QET A;  3QEX A;  4CE9 A;  4CJF A;  5FRM A;  4CFB A;  3QIP A;  3KIO A;  3HK2 A;  1S1W A;  4TSX A;  3L2R A;  3RR8 A;  4AIL C;  4RW9 A;  4CEB A;  3V9S A;  3K59 A;  4CCH A;  1CLQ A;  1NK5 A;  4FJX A;  1JKH A;  4OPJ A;  3LDS A;  2PYL A;  4Z4H A;  4E89 A;  4FM1 A;  4B3O A;  3NGY A;  3AA5 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...