1B9DA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 51
structure length 143
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9dA00
3OYLA 2ZQBA 2G8IA 3ITHA 3ZSQA 4CJPA 1EKEA 3AVCA 3NGYA 4UQGA 1KCFA 3ZT1A 4XIUA 1B92A 5T7BA 4E1MA 1NJYA 3MEGA 1A5VA 1SUQA 2P5GA 4HCBA 1WN7A 1RBVA 4LY7A 5C42A 3SJJA 2VG5A 3QESA 2YKNA 3QEWA 1C0TA 1GOAA 3SUNA 5KGWA 4W5OA 1VSKA 2VWJA 4W5TA 4B9TA 3IAYA 1UA1A 1SL1A 3AVNA 4DG1A 4CEFA 4H8KA 3VN5A 1VSFA 1ASUA 1RDDA 1IH7A 4Y1CA 4FJHA 4FLTA 2O4GA 4KV8A 3LDSA 2PYLA 1S1TA 3SV3A 4BDPA 2IDOA 4ZTFA 4FJXA 1J53A 4Q5VA 4DU3A 1ZBUA 1WNSA 3PX6A 4Z4GA 3KLFA 1SL0A 1NOYA 3S3NA 1JLBA 2P1JA 3V9WA 1NJXA 4F3OA 4C8MA 1HMVA 3NAEA 3L2WA 4FLYA 1JL2A 4CFCA 3LPTA 4FM0A 4FZZA 4RW6A 4KHUA 1O1WA 2HVIA 3D0PA 1Z25A 1WLJA 3NH2A 2XHBA 4B8CA 4M3XA 1RDAA 3OYBA 1U4BA 4N41A 3L2UA 4EP4A 3HM9A 4Z4CA 1D5AA 2JLEA 4OPJA 1TK0A 4HUFA 1SKRA 3LP1A 4DSIA 1JKHA 3F73A 1VRTA 4FW1A 1C6VA 4WE1A 3TAPA 4FVMA 4DF4A 2Z1IA 5HLFA 3KLEA 3UIQA 4CHOA 3NCIA 4CECA 4W5RA 2KW4A 1HJRA 3A2FA 1LWCA 4I7FA 1UA0A 3G0ZA 4FK2A 4CJKA 3DMJA 4FLWA 3DRSA 3WNEA 3V9SA 3HJFA 3HPOA 4W5NA 3WNFA 3RWUA 2FBTA 2RKIA 1QSYA 4CEZA 3RMBA 1ZBHA 1NOZA 1SKWA 2IGIA 4KRFA 1KSPA 4AHRA 3V1QA 3B6PA 2ETJA 3VQAA 3ZSRA 4W5QA 1T05A 2XRIA 3NH1A 1C0UA 3VQQA 3SCXA 4BE0A 1BGXT 1HRHA 1LWEA 4AHSA 1S1VA 3LANA 4KTZA 5K14A 4DMNA 3QEIA 4MQ3A 4ZTJA 1G15A 1GOCA 2YKMA 2XY7A 4E3SA 2P5OA 2KFZA 1ZYQA 1SV5A 4QAGA 3HPHA 1HYVA 4DQSA 4DFKA 2YNIA 4O5BA 4FJNA 1EETA 3LZJA 4FLZA 1XWLA 5CYQA 5FROA 3OYEA 4CJSA 3I8DA 5DK5A 3RRHA 4CFBA 3V4IA 1NJZA 4FJ7A 3ZT0A 4CEBA 1IG9A 5C24A 4M3WA 4NCAA 4QOZB 4EP5A 4K8ZA 3NF7A 1RT4A 2OZMA 2HHTA 1NKCA 3VQ6A 4DSFA 1U49A 4CHNA 3SI6A 3OY9A 4PA1A 3ZT4A 3EYZA 2OPPA 3KD1E 1HPZA 4JS4A 2VG6A 4CE9A 1JLQA 3QETA 1S1UA 4C8LA 3KKRA 1KLNA 4Y1DA 1GOBA 3SNNA 1IO2A 1DLOA 4K8XA 4Z4FA 1TV6A 4HUGA 3TAQA 1Q8IA 5HP1A 1JLGA 4BDYA 4FJ9A 2KZMA 1LAWA 2A1SA 2OA8A 1RBSA 2FBVA 3LP0A 4CJFA 4CIFA 2GV9A 4FM1A 4CESA 1JLAA 3AA2A 3H08A 4FJGA 4YNQA 4JS5A 3SQ0A 5CYMA 2G8WA 2I5JA 2X6SA 1REVA 3AO3A 4BE2A 1RTIA 3V9XA 3SPYA 4IFYA 4CERA 4FJJA 1X1PA 1NJWA 3PO4A 2FC0A 4NCGA 2DFHA 4CIEA 1XHXA 4BDZA 1FKPA 4DSEA 3L2QA 4DTXA 3NF9A 2EX3A 4CHPA 2PZSA 1J5OA 4FJKA 4CJUA 2GBZA 1S6PA 3K5MA 1CZ9A 2G8HA 3DRRA 3VQ4A 4DFMA 4DQRA 4IG0A 1IKWA 1WSGA 1TKXA 4OJRA 1RBTA 3RR7A 3VQ5A 1YVUA 1CZBA 2OPSA 3V9UA 4M41A 4AH9A 1BCOA 4E7JA 2A1RA 1BIUA 4CHYA 4I9QA 4RW9A 3VQ8A 4DWIA 3DM2A 4CGFA 1T03A 1T8EA 1ZBFA 5FRNA 4CK3A 3C94A 4M3TA 4JRQA 3AV9A 3P5JA 3MAQA 5I3UA 3TR8A 1S1WA 3ULDA 1BI4A 3WNHA 4CK1A 3OYMA 4CJEA 4RG8A 4DSJA 1LW2A 2B4JA 4CJVA 4N56A 3TAFA 3OYJA 3QINA 1TGOA 2XY5A 1RBUA 3IRXA 1X9SA 3CM5A 2YHAA 1NK8A 4OLAA 1D9DA 1S1XA 1RT1A 2RN2A 4E1NA 1NK6A 5HROA 3CG7A 1RT3A 1ASVA 3BDPA 3AVJA 2G8KA 2RF2A 3CYMA 3VQCA 3OYIA 5EU7A 4DTSA 2BANA 5J2NA 4AILC 4B9LA 4Z4HA 4B8AB 3KLHA 3QIOA 1WSHA 3E01A 3VQ9A 3PX4A 1FK9A 4CGHA 2G8VA 5FDLA 2YV0X 4CHQA 1LW0A 1WSEA 4C8KA 3PO5A 4CJLA 4KHSA 4DTRA 4KTWA 1KVAA 1JLFA 3JYTA 4B3OA 3FFIA 3DLGA 4FJMA 3VA3A 3AO1A 2OPQA 4DS5A 2HMIA 1HQEA 3HPGA 5KI6A 4AHUA 5HRPA 3LAKA 4KB1A 3L8BA 4B9VA 3OYHA 3K5LA 2B5JA 2FBXA 4H4MA 3NGIA 1CXQA 3HP6A 3V81A 4DQIA 2YNHA 4CJQA 4KPYA 4FLUA 2HHVA 3CFOA 2ATQA 4AHCA 4CEAA 1RT5A 3PV8A 4FJLA 3JSMA 4J2AA 3HYFA 3ZT3A 4CGIA 1VSLA 3SQ4A 2IOCA 4M45A 3L2VA 4KFBA 5HBMA 1QTMA 3VQEA 5E41A 4DQQA 4PWDA 2Z1GA 3AA5X 4NYNA 1K6YA 4NCBA 4KO0A 4LSLA 1DTTA 1RT6A 1KFDA 2HNZA 4ID1A 3OYAA 3KJVA 3HK2A 1W0HA 3AVGA 5J1EA 1ZBLA 4F4KA 5SZTA 4LD0A 1QS4A 3NFAA 1QE1A 1I39A 3IS9A 1SKSA 2AJQA 1HNIA 3VA0A 5C25A 1D9FA 4OLBA 4BWMA 1B9DA 1HNVA 2ZD1A 1BHLA 2BE2A 4G1QA 3ZSWA 4E7LA 1VSEA 1D8YA 4DQPA 5CZ2A 4Q0BA 1J54A 3ZSYA 3OYKA 3K57A 2HNYA 2F8SA 1N5YA 3SUOA 4M42A 2HHUA 4ELUA 1LWFA 3RMCA 3AVAA 4DSLA 3OYFA 4CEEA 4HVJA 3SV4A 1X9MA 3LP3A 3K5OA 5SWMA 1Z26A 5HRSA 5I42A 3OS1A 3F9KA 2BDPA 1DTQA 1JLCA 2QXFA 3C6TA 3SYZA 3LWMA 3U3YA 3QO9A 3RR8A 1BL3A 1RTJA 3ALYA 5KGXA 4DSKA 4KTQA 4FK0A 4ELTA 4PQUA 4FW2A 1UAXA 3TAGA 4KKOA 1UWBA 2IAJA 2RPIA 3AO4A 3MXJA 4CGDA 3V9ZA 4O0JA 3TI0A 3K58A 2WOMA 4IDKA 3NGZA 1TKDA 1L3UA 4EZ9A 1I3AA 4F3TA 3QIPA 4DFJA 3NF8A 3MXIA 2Q3SA 3AO2A 4CEOA 3NHGA 3TANA 4C8NA 3CQ8A 3L3VA 3VQBA 2D0CA 2X78A 3NH0A 1NK9A 4FJ8A 1YT3A 3SPZA 2HHSA 2DY4A 3K5NA 2X74A 3L2RA 2XY6A 1C1CA 1WSIA 3THVA 4CF1A 2NUBA 4AHVA 4FZXC 3S3OA 5KTQA 3AVHA 2QKBA 1TAUA 4KHNA 3QNOA 1CXUA 3AA4A 2KZZA 2HHWA 4OGCA 4CJWA 1BQNA 4YFUA 5D3GA 3OJUA 4QCLA 4HUEA 3PUFA 2PYJA 4PUOA 3OJSA 1VRUA 3K2PA 2QKKA 4PY5A 2FBYA 3WNGA 3MEEA 1IKYA 3V6DA 1Q9XA 1C1AA 2WONA 3SUPA 3HVRA 1KLMA 4M3RA 4OVLA 4J2DA 1S9EA 4CJTA 3HSTB 1C1BA 3CFPA 3ZSOA 3SZ2A 3AO5A 3DI6A 4E19A 4FK4A 1S5JA 1WAFA 3KIOA 1NK0A 3HXMA 5FRMA 1Y97A 2HHQA 1MU2A 4E7IA 3PX0A 3ZT2A 1L3TA 4KHQA 1RCHA 3HVTA 1QQCA 4E7HA 4DTPA 1IKXA 1SL2A 1TKTA 3M8PA 3U3GA 3RRGA 1ASWA 1TAQA 4BACA 4CCHA 1XC9A 1VSDA 4FCYA 5J2MA 1QSLA 2O4IA 3OVNA 3LALA 3O3GA 4H4OA 1VSHA 3KLIA 4OPKA 2YHBA 2HNDA 3DLKA 3DLEA 3LAMA 4OKKA 4BWJA 3ZSXA 3LZIA 3KLGA 4E7KA 1U48A 1KVBA 3LP2A 4KHYA 3PY8A 4CGGA 3VQ7A 3OS2A 3QEXA 1RDBA 3ISNC 4TSXA 4KREA 3I0RA 3RMDA 1YTAA 4C8OA 4O0IA 4AHTA 1VSMA 4R5PA 3P83D 4IBNA 1R0AA 4B9UA 4M3UA 3ZSZA 3CFRA 4F8RA 1BQMA 4DTOA 3AVBA 4DTMA 3SUQA 1NK4A 5JS1A 4CJ3A 4N5SA 3HT3A 1NKEA 4J2BA 4LH4A 1VSJA 4B9MA 3KTQA 3ZCMA 3CM6A 4ID5A 1NKBA 2HB5A 1CLQA 5JS2A 4E0DA 3T1AA 1RTDA 4IFVA 1U04A 5HRNA 4OKEA 2OYQA 2KTQA 4GMJB 4IG3A 3V1RA 3T19A 1TL1A 4GVMA 3TAMA 1RILA 4KB0A 1RT7A 4RW8A 1LAVA 2D0AA 1FXXA 3DOKA 3LPUA 3VQDA 4CIGA 3BGRA 4DLGA 1J9AA 2JGUA 3U6FA 1U47A 1VSIA 1BCMA 4O44A 3QERA 3ZSVA 2XO7A 3KK1A 1RTHA 1JL1A 1A5XA 1C0MA 1VK0A 4KI6A 5CZ1A 4EZ6A 4JRPA 3KD5E 4E89A 4FYDA 4ZHRA 3QNNA 2DFFA 3HL8A 2VWKA 4HHTA 2F8TA 5DMRA 4HTUA 4HCCA 1KFSA 4DTJA 3TAEA 3QEVA 4KAZA 4FJIA 4J2EA 2YNGA 3C95A 3OYGA 5J2QA 3SQ1A 1BIZA 3OS0A 2VG7A 2G8UA 4B9SA 3DOLA 4ELVA 1X9WA 4CK2A 2E4LA 1L3SA 4ICLA 4RW7A 2B6AA 1EP4A 4DF8A 3O4NA 3OYNA 4DFPA 4JLHA 4RW4A 3SQ2A 3OYDA 4FM2A 3O4QA 2ZE2A 3T3FA 4LH5A 4GW6A 1TKZA 3ASMA 3MEDA 3OYCA 1HYSA 3P1GA 1XI1A 5HRRA 2HVHA 4OGEA 3RTVA 1TK8A 3EZ5A 1ZBIA 1KTQA 4DU1A 2IC3A 3AVLA 4FLXA 2G8FA 2QK9A 3NBPA 2DFEA 2GUIA 1L5UA 3MECA 4FZYA 3DLHA 3O3FA 2D5RA 1RBRA 1UOCA 2LSNA 4CFDA 3QEPA 4DTNA 1L3VA 1JXEA 3QLHA 4DS4A 1S6QA 3TABA 1N6QA 2Z1HA 3DLBA 3DYAA 4CJ5A 4M3YA 4N47A 3KK3A 3NDKA 3M8QA 1RT2A 1EXQA 1BISA 2W42A 3DLRA 3C6UA 4MFBA 4I2QA 1T7PA 3L3UA 4Z4EA 1JXBA 1F21A 3KKSA 4B08A 2P51A 1JLEA 1Q9YA 4O55A 1ITGA 2Y1IA 2KQ2A 3IG1A 4BE1A 2HHXA 1TVRA 1EX4A 4OKJA 2KFNA 4CHZA 2HW3A 4FXDA 1IKVA 5CY4A 2ITGA 3M8SA 4Z4IA 4KHWA 1TL3A 4I9LA 3AA3A 4CJRA 4CF2A 2Z1JA 3D45A 1RDCA 1XHZA 3TWHA 2R7YA 3AVIA 1HQUA 4CF0A 3KK2A 2BGGA 5J2PA 2OPRA 4KI4A 3LWLA 4IKFA 1QHTA 1WAJA 4Z0UA 3VQPA 4CF8A 4CGJA 3AVMA 1WSFA 4CJ4A 3K59A 4DU4A 4CEQA 3AVFA 2E6LA 3HO1A 3B6OA 4FJ5A 1NK7A 3S9HA 2IS3A 1U45A 4LSNA 1WSJA 3S3MA 1B9FA 2F96A 4DLEA 4M3ZA 4DTUA 2YNFA 3G10A 3NE6A 2E6MA 4CFAA 2Y1JA 1NK5A 1HYZA 5KRTA 3M8RA 2X6NA 2DTUA 1W9HA 1TK5A 1S9GA 2EHGA 1QSSA 3EY1A 5KRSA 4F2RA 3I0SA 3DRPA 4N76A 1YTUA 1LV5A 1A5WA 1KVCA 4FLVA 2D0BA 4I2PA 1KRPA 1BI4B 3O3HA 3TARA 4L8RB 4O4GA 3MXMA 4B9NA 4NYFA 2OZSA 4F2SA 3NF6A 4CEDA 3HP9A 3RMAA 2PY5A 1FKOA 3AVKA 4CF9A 1RNHA 3V1OA 2XY8A
chains in the Genus database with same CATH superfamily
3FZHA 4JKCA 3K9JA 4WQ4C 3I8BA 4A5BA 1EKEA 1XNRK 1NJYA 1YHQN 4E1MA 1SUQA 2O8EB 2QWLA 5BN9A 3VEVA 3WXLA 2VG5A 5TKWA 2YKNA 3UKRA 5KGWA 4W5OA 2VWJA 1UA1A 4H5TA 1VSFA 1RDDA 4FJHA 4JKHA 1N36K 2F9TA 2O4GA 2QTDA 4KV8A 4XH5A 3LDSA 4FLTA 1W2BM 4BDPA 2IDOA 1P8ZA 4FJXA 1J53A 4Q5VA 4DU3A 4H0PA 1WNSA 3PX6A 4Z4GA 3BF3A 3QFUA 3E9LA 4FOIA 1HMVA 4FLYA 4CFCA 4EIAA 4KHUA 1IBKK 1O1WA 1RDAA 3L2UA 3HM9A 4FWPA 4C23A 4CD3A 4HUFA 5HLFA 4FW1A 5AQHA 1RDUA 2Z1IA 3A5MC 3KLEA 1LOTB 3NCIA 2VQFK 4FWOA 2KW4A 1HJRA 3A2FA 5F2RA 4CJKA 1EWQA 3V9SA 4XH1A 3TTCA 3VPZA 3AARA 5AQYA 4B1XB 3B6PA 2AP1A 1NGDA 4BRMA 4QOZB 4F9OA 2P5OA 2WFBA 4QAGA 3HPHA 2YNIA 4O5BA 3SAHA 1EETA 4X66K 3LZJA 4FLZA 2IIRA 3I8DA 3A5NC 5DK5A 3V4IA 4FJ7A 3DJCA 2ITMA 3TSQA 1E4FT 2GX9A 1QQOA 3L6QA 5M1QA 3VQ6A 3SI6A 1EQYA 4PA1A 2QI2A 3KD1E 1HPZA 3CMAN 1KLNA 1IO2A 1DLOA 1TV6A 4HUGA 5HP1A 1JLGA 4FJ9A 5GIOA 3TU5A 2GV9A 4JV5K 2VCPA 1JLAA 1Q82O 4JS5A 2O8BA 2G8WA 4K25A 4DUYK 1REVA 2FSJA 2HBJA 4BDZA 1FKPA 4DKWA 4DTXA 1NNEA 4O5FA 3F5TA 3LDNA 4CJUA 3K5MA 1CZ9A 3DRRA 3VQ4A 4IG0A 1RBTA 1KXPA 1CZBA 4M41A 4AH9A 1BCOA 3QDKA 4E7JA 2A1RA 2ZGYA 3VQ8A 4DWIA 4CGFA 4BVOA 3OYMA 2UXDK 2ZGZA 4CJEA 1YJ9N 4DR4K 2H3GX 3TAFA 5DM7L 2XY5A 3H45C 3CM5A 3THYB 3S41A 1NK8A 3PIPL 2NZTA 4NB4A 3ULEA 1RT1A 2RN2A 4E1NA 1RT3A 1ASVA 1VQKN 3VQCA 3K9KA 1ATSA 4AILC 4B9LA 3CCSN 3FZMA 3ID8A 1FK9A 4A57A 4A62A 4JKEA 4EFHA 3DXMB 3A5OC 4CZEA 1WSEA 4KTWA 1JLFA 3JYTA 4B3OA 3VA3A 5KI6A 3HPGA 3C7NA 3OYHA 1CXQA 3O9UA 2YNHA 3U9DA 2RHKA 4H0OA 4KPYA 3CFOA 3PV8A 1RT5A 4J2AA 1IJJA 3ZT3A 1VSLA 2IOCA 2F7TA 3L2VA 4PWDA 5E41A 2V52B 4FPAA 3ZX0A 4NYNA 4JKFA 1K6YA 3UKUB 4NCBA 3OYAA 2HNZA 4B3RK 5M1NA 4F4KA 4LD0A 3NFAA 1SKSA 3O1BA 1V4TA 2AJQA 1Q7YO 4A61A 3CHWA 3ZSWA 1BHLA 2BE2A 4IOAL 4E7LA 4DQPA 4Q0BA 5H1SQ 3OYKA 3IMXA 1KAZA 1HX1A 2HHUA 1BDGA 4HVJA 3SV4A 1DTQA 1JLCA 2P9LA 4EAHD 2P9NA 4B9QA 1BL3A 4DSKA 3ALYA 1DKGD 4FW2A 1XNQK 4QS9A 2CGLA 2RPIA 3MXJA 4CGDA 4GY2B 4O0JA 3K58A 1TKDA 2E20A 4DFJA 1LCUA 3U8XA 4LF8K 1YUWA 3NHGA 3TANA 3L3VA 5AZJA 2X78A 3M6GA 3K5NA 3BZKA 2XY6A 3CJ9A 3THVA 4FZXC 2QKBA 4KHNA 3SAFA 4OGCA 4CJWA 3L4IA 2W6KA 2NRHA 3HM8A 4JHDB 4PUOA 2FBYA 3WNGA 4IOXA 2VGMA 3SUPA 3HVRA 4CJTA 1VQNN 1C1BA 1U2VA 4JNEA 5C0YA 2Q2RA 1S5JA 4H0VB 1ZXOA 5AQZA 4KHQA 2ZM6K 3HVTA 1QQCA 5GADP 2QWRA 4DV7K 4H0XB 3WXMB 3OVNA 3KLIA 2HNDA 4OKKA 3LAMA 4CZIA 3CPWM 4JI8K 2UYTA 4C8OA 3O9TA 4M3UA 1I94K 1BQMA 3BZCA 4BGBA 4DTMA 4GV3A 1NK4A 4CJ3A 1NKEA 4LH4A 1VSJA 3N4QA 4E0DA 3FGUA 1X3MA 1U04A 3L0QA 4OKEA 5HRNA 2ASOA 4GMJB 2FSKA 1TL1A 2RE2A 4EHUA 4CIGA 3UE5A 4BRKA 1U47A 1VSIA 3C6AA 1C0MA 4HWIA 1NWKA 3AAPA 4BREA 4JRPA 4C1NK 1K8KA 3HL8A 4HHTA 2HBKA 4HTUA 1KFSA 4YORA 3TAEA 3QEVA 4KAZA 4FJIA 3H3NO 2HMPA 5J2QA 3CC2N 3SQ1A 1SQKA 3OS0A 2VG7A 4B9SA 3O80A 2AA4A 2HSTA 3BEXA 4PKGA 1BA1A 1KQSM 4FM2A 3IUCA 3ZX2A 1TKZA 2OANA 3OYCA 1XI1A 1DGKN 1QQMA 4FLXA 3NBPA 4GNIA 3NVMA 3KVGA 4FZYA 1RBRA 3J80O 1BWFO 4DS4A 5JLHA 3WUHA 2P9PA 3DYAA 3NDKA 1HKGA 1OKJA 1T7PA 3L3UA 1JXBA 1JLEA 1Q9YA 4O55A 2KHOA 4XEIA 2Y1IA 4LF9K 4JK8A 3IG1A 2E1ZA 1TVRA 2HW3A 4Z4IA 4KHWA 3D7EO 1X9JA 4CJRA 1T6CA 2UUAK 1RDCA 5AQUA 3TWHA 5J2PA 2OPRA 4RWTA 3KZBA 4FWNA 4KH4A 3SBTA 3AVMA 4CEQA 2E6LA 3B6OA 4FJ5A 4BG9A 2IS3A 1WSJA 4LFCK 1B9FA 4M3ZA 4CI6A 2E6MA 4CFAA 1NK5A 3HBTA 2DTUA 2CGJA 1ESVA 2ASMA 2EHGA 3TPQA 1A5WA 4BC4A 4FO0A 2NRZA 4YDUC 5LL6Z 4JI0K 2OZSA 1VQ6N 3HP9A 1WUAA 3CCUN 2ZQBA 1Q81O 4DV4K 3ZSQA 1KCFA 3ZT1A 1B92A 2P5GA 4FWMA 1DT9A 1RBVA 3CJCA 3WEEA 3SJJA 1C0TA 1GOAA 4PL7A 3SUNA 4ILGB 4B9TA 4JK9A 4CZHA 3VGLA 4CEFA 4H8KA 1ASUA 4Y1CA 3SV3A 3T1YK 4ZTFA 1WB9A 2GWJA 1SL0A 1YJWN 2P1JA 1NJXA 4JI6K 5KPRA 2EWSA 3LPTA 3O4WA 1Z25A 5E26A 1KD1O 3NH2A 2FF6A 3ATVA 5M1KA 3VEWA 3LP1A 3MN6A 4FWQA 1JKHA 1T8EA 1VRTA 3TAPA 3DXKA 2FF3B 3D2FA 3CF5L 3UIQA 2BH1A 4FK2A 2KLAA 2VYPA 4W5NA 2RKIA 2KKZA 4IJNA 4WQ4A 1YI2N 3QBXA 3ATUA 4BRPA 4CEZA 3J81O 1MA9B 5FPMA 3OBWA 1SKWA 1W7AA 4AHRA 3NVKA 3ZSRA 4W5QA 3CD6N 3VQQA 4BE0A 1BGXT 4AHSA 3J8AA 1S1VA 5K14A 5AQSA 1G15A 2XY7A 5TKYA 1ZYQA 4FJNA 3R8EA 1XWLA 5CYQA 3RRHA 3QICA 4CFBA 1NJZA 4DV6K 5M1OA 4DR1K 3ZT0A 4CEBA 4WFBL 3FFKB 5BREA 4EP5A 2E2NA 3NF7A 1RT4A 2HHTA 2F4VK 1U49A 4DSFA 4LF7K 4CHNA 2QWPA 2PAVA 3R6MA 4LF5K 4Y1DA 3T1HK 2JWKA 3TAQA 4BDYA 5CHIA 1LAWA 2E5LK 4FM1A 4CESA 1Q86O 3O6WA 5CYMA 4HTLA 1IG8A 5AQVA 1RTIA 4CERA 5AFUH 1NJWA 3PLAA 2DFHA 1NGIA 4BC5A 3L2QA 2PZSA 4CHPA 4NO7A 3GL1A 1S6PA 1S3XA 4YHHK 1YVUA 2OPSA 4LF4K 3SAGA 2YJFA 2E8AA 2HBLA 1K73O 4BR2A 3CERA 4M3TA 3MDQA 3RSEA 3VTHA 3MX2A 1K8AO 2NNWA 3HRGA 3ZETB 3WNHA 4CK1A 4RG8A 2I7NA 3OYJA 1X9SA 2O8DB 4OLAA 4NLCA 4JKAA 3CG7A 4BR7A 3BDPA 3CYMA 5J2NA 4JI4K 4Z4HA 4B8AB 3LDPA 3KLHA 4CBXA 2O8EA 3VQ9A 5HL7L 4CGHA 2GWKA 5FDLA 3VF2A 1LW0A 3THXB 5JVGL 2A42A 3FE1A 1T6DA 3GG4A 4FJMA 5FLXO 2OPQA 3J7AP 4FL9A 3K5LA 2FBXA 3HP6A 2E1YA 3P39A 2HHVA 1XQSC 4FLUA 5A2QO 4CEAA 5IWAK 1GLDG 2QWNA 4U67L 5LY3A 3EEQA 1QTMA 1VQ7N 1NU0A 4LSLA 3GDQA 1RT6A 4ID1A 3AVGA 1ZBLA 5J1EA 5EY4A 4M7YA 1QE1A 4KBOA 1D9FA 5CE3A 4OLBA 4BWMA 1B9DA 4M63C 4K0KK 4G1QA 1VSEA 5AQGA 2P9KB 1J54A 3ZSYA 3K57A 2F8SA 4M42A 3IDHA 3MMVA 5ADXH 5SWMA 3F9KA 2QXFA 3LWMA 4FK0A 4B3SK 4KTQA 3TAGA 5B8HA 4KKOA 2IAJA 3CCQN 2HF4A 4BRHA 4U7BA 4IDKA 1L3UA 1GLFO 1VQON 4DV1K 3EL2A 4FJ8A 3WXKA 3SPZA 4CZJA 4CZFA 1NGHA 2P9IB 1S72N 1WSIA 2NUBA 3ZYYX 3S3OA 3QNOA 2KZZA 1NGAA 5D3GA 2HHHK 4A5AA 4QCLA 4HUEA 2PYJA 1VQ5N 5AFUA 4PY5A 3O9RA 4DR6K 5JMVA 4J2DA 1S9EA 3CFPA 3ZSOA 1ZBSA 3SZ2A 3AO5A 3DI6A 3HXMA 4JI3K 2QM1A 3ZT2A 5GINA 1RCHA 3ZX3A 3EE9A 1SL2A 3M8PA 3RRGA 3H46O 3FR0A 2O8CA 1OVQA 1TAQA 3G6EN 3CC4N 4H4OA 5CR4A 3LZIA 3ZSXA 3LP2A 4KHYA 4CGGA 5LMNK 3VQ7A 3A8YA 4TSXA 4KREA 3H1QA 3I0RA 1YTAA 3TTDA 1VSMA 1YAGA 2GELA 1R0AA 5JLFA 5KQ8A 3AVBA 3SUQA 4H5RA 4B9MA 3KTQA 4WF9L 3CM6A 3M3ZA 3SJHA 1CLQA 4H0TB 4IFVA 4CW7B 4JN4A 3THYA 3V1RA 2E2OA 3D2EB 3T19A 3TAMA 5GAHP 4K43A 4WFNL 1M1KO 3HI0A 2D0AA 1FXXA 4BVPA 3BGRA 2NRRA 5HOOA 4FPBA 2V7ZA 4YOYA 2XO7A 3KK1A 4WQ5C 1RTHA 1JL1A 5C15A 3ZEUA 1OH7A 4EZ6A 4GKKK 3KD5E 3DXMA 4FYDA 3JAMO 4ZHRA 5DMRA 4DTJA 2YNGA 5AQRA 5AQLA 4BRDA 2G8UA 3DOLA 4ELVA 1HNZK 4CD1A 1Q18A 2A6AA 4RW7A 4DF8A 3OYNA 1NMDA 3L4QA 4RW4A 3ENOA 3O4QA 2ZE2A 3MEDA 1HYSA 3FZKA 3O9SA 5ADXA 4OGEA 3RTVA 1TK8A 1ZBIA 1KTQA 3UKUA 4DU1A 1IBMK 2G8FA 2QK9A 2DFEA 1L5UA 2LSNA 1UOCA 3QFPA 5AQJA 3QLHA 1S6QA 2O8FB 1BU6O 3TABA 4BRFA 2E88A 1D4XA 2Z1HA 1N6QA 4N47A 3J7ZO 1JCGA 4BG8A 2W42A 3C6UA 4Z4EA 3LDQA 1F21A 4B3TK 3BF1A 1KAYA 4OPAA 2I7PA 1EX4A 4A59A 3AY9A 2KFNA 4CHZA 4FXDA 1IKVA 5CY4A 2ITGA 2P9UB 2YJEA 3E1YA 2Z1JA 2P9SB 4BRNA 1NGCA 4NXNK 2R7YA 3LWLA 4IKFA 1VHXA 4Z0UA 4IJAA 4CF8A 4CGJA 3MX5A 3IKMA 5BR8K 1ATRA 3MN5A 3K59A 4XH4A 4DU4A 4LSNA 3G71N 2F96A 4DR2K 2Y1JA 1IV0A 4DR3K 1DEJA 1HYZA 3M8RA 1W9HA 2ASPA 2NRTA 3O08A 1QSSA 5KRSA 4F2RA 2OTJN 3CC7N 1YTUA 1KVCA 2VGNA 4JHDA 4B3MK 4I2PA 1KRPA 1BI4B 4LFBK 3TARA 1HNXK 2UUBK 4O4GA 4IWVA 2UXCK 3NF6A 5JICA 2PY5A 3AVKA 3WXIA 1RNHA 1TUYA 2G8IA 3ITHA 4CJPA 4UQGA 4XIUA 2UU9K 3MCPA 2UXBK 4H03B 3E66A 5C42A 5BR9A 3QESA 4AM7A 3QEWA 3DWLA 1VSKA 2GEMA 4CZMA 3CJBA 2WUSA 1Z6RA 1BUPA 1S1TA 3SMPA 4BRIA 4JD2B 3I55N 3DAWA 3VEOA 5AQTA 2W40A 3KLFA 3VF4A 3QMLA 4AQYK 1NOYA 4C8MA 2YHWA 4DUZK 3L2WA 4FM0A 4FZZA 4G9ZA 2DPNA 1N8RO 2HVIA 2Q0UA 1WLJA 2XHBA 2GTDA 4M3XA 1KAXA 4YOTA 3OYBA 1U4BA 4N41A 4FSVA 4FVUA 4Z4CA 1D5AA 2JLEA 1SKRA 4DSIA 3F73A 5BPLA 4WE1A 4DF4A 4CECA 4FWSA 4YDUA 4I7FA 5JVHL 3G0ZA 1CZAN 4FLWA 3WNEA 3HJFA 3HPOA 1W97L 4IZ9A 3MK6A 3WNFA 1N32K 1QSYA 3THWB 3RMBA 1ZBHA 3GOIA 3HOSA 4KRFA 5BPNA 1KSPA 3V1QA 2ETJA 3CJ7A 3PSFA 1C0UA 3SCXA 1HRHA 5AZIA 3W0LA 3LDOA 3LANA 3QEIA 4ZTJA 3WQTA 3SMSA 1ATNA 2YKMA 4CZGA 4E3SA 1MWMA 1SV5A 1HYVA 2D0PA 4DQSA 4DFKA 2Q97A 3SLCA 4DB3A 3OYEA 2FXUA 4CJSA 3I56N 3CCRN 2V51B 2W6LA 4PKIA 1IG9A 3TSUA 4NCAA 3C0BA 3VMFB 3E9OA 2OZMA 1RFQA 3K0SA 4MLEA 3OY9A 3ZT4A 4MDAA 1JLQA 3QETA 1S1UA 4C8LA 3SNNA 4Z4FA 1XC3A 1Q8IA 2A1SA 2OA8A 1WBBA 5F0XA 2FBVA 2NRVA 4CJFA 4CIFA 3W3DA 4DQ8A 4YNQA 3SQ0A 4B1YB 1YVNA 2I5JA 2X6SA 1H1VA 4BRQA 4DR7K 1SS6A 3O1WA 4WCEL 3PO4A 2FC0A 4NCGA 3I33A 4DSEA 1XHXA 3PX4A 3NF9A 2EX3A 4OPHA 3KK7A 5F1XA 2GBZA 2D0OA 4DFMA 1IKWA 1WSGA 1BO5O 3D6RA 4OJRA 4JKGB 3V9UA 4A2BA 3WQUA 1BIUA 4CHYA 3ZLJA 1YJNN 3DM2A 1TYQB 1KC8O 1XUPO 4CK3A 4JRQA 3AV9A 3TR8A 1S1WA 3ULDA 4DSJA 1LW2A 2B4JA 4DV3K 3VERA 3QINA 1TGOA 4JI7K 1QVFM 4DCHA 5GAEP 1RBUA 3IRXA 1EO1A 2CH6A 1S1XA 1NK6A 3AVJA 2BUPA 2YHXA 3OYIA 5AQPA 2BANA 1U6ZA 4YY3K 3QIOA 3E01A 3KHYA 1BG3A 2G8VA 4CHQA 4KHPK 3PO5A 2YHYA 4CJLA 4KHSA 1KVAA 3R1XA 3FFIA 3AGRA 3DLGA 1GLLO 2GUPA 3VGKA 4DS5A 1QZ5A 2HMIA 4KB1A 3L8BA 2A40A 4CJ7A 2B5JA 3NGIA 3V81A 4BRLA 4I6MB 2ATQA 4AHCA 4FJLA 3JSMA 3HYFA 4CGIA 1J5EK 3GE1A 2Q36A 4KFBA 3VQEA 4DQQA 2Z1GA 3AA5X 1HR0K 4WFAL 3U9ZA 3HK2A 1W0HA 4X65K 5LJVA 3IS9A 1I39A 1HNIA 5C25A 3MWPA 1HNVA 1D8YA 4QS8A 5CZ2A 2HNYA 3VEYA 4ELUA 1LWFA 3HZ6A 3OYFA 4CEEA 1X9MA 1N34K 3LP3A 3K5OA 1Z26A 2BDPA 3C6TA 3SYZA 3U3YA 3QO9A 2HBMA 5KGXA 5JS1A 4RCHA 1NLVA 4ELTA 1UAXA 3HSCA 4DV2K 4EZ9A 1I3AA 4F3TA 3QIPA 4JEPA 3AO2A 3CQ8A 3VQBA 1E4GT 2D0CA 3GBTA 3NH0A 1YT3A 2V7YA 4X64K 2X74A 3L2RA 3G25A 3C6HA 1YXQA 1HJOA 5KTQA 1TAUA 1IBLK 1CXUA 4JI5K 1T3VA 3OJUA 3PUFA 3OJSA 1VRUA 3HTVA 3MEEA 3V6DA 1C1AA 2WONA 2ZJRL 3HSTB 4E19A 4B1ZA 4FK4A 3KIOA 1NK0A 5FRMA 1GLJO 2HHQA 4E7IA 3PX0A 4E7HA 4DTPA 3MN9A 1IKXA 1TKTA 3U3GA 4YOXA 1XC9A 4FCYA 5J2MA 1QSLA 2QXLA 2O4IA 1VSHA 3WT0A 3UKRB 4LF6K 1GLBG 3DLKA 3DLEA 2QA4N 3KLGA 1MDUB 1KVBA 3VEXA 4IFEA 5C10A 1RDBA 2A41A 4IOCL 3RMDA 4MDBA 4O0IA 4AHTA 4R5PA 4IBNA 4B9UA 4A2AA 3ZSZA 3CFRA 4DTOA 1VQ4N 1NGGA 5EVZA 5AQIA 4N5SA 3TTFA 3G4SN 3ZCMA 3PSIA 3ZETA 2HB5A 4IO9L 4GV6A 3T1AA 1RTDA 2O8DA 1NM1A 4V19S 4IG3A 2NRWA 4PHTX 5IT9O 1RT7A 4MO4A 2Q0RA 1LAVA 3LPUA 1WBDA 3U6FA 4KH5A 1BCMA 3SK3A 3OBYA 4O44A 3T7ZA 3ZSVA 1NGJA 1A5XA 1VQPN 3QNNA 4NXMK 2DFFA 2YCHA 3THXA 2VWKA 2QWMA 2F8TA 5M1FA 2QWQA 4UY8O 4J2EA 3OYGA 1FJGK 2UUCK 2QW9A 3VGMA 1X9WA 1L3SA 3KWIA 4ICLA 3M5RA 1EP4A 3FZLA 3O4NA 4YOUA 4JLHA 3TSPA 3QB0A 4BRGA 3SQ2A 4C1NI 1S22A 2ZWHA 2HVHA 1YITN 3EZ5A 5C12A 2IC3A 2YX6A 2VWBA 3AVLA 3CI5A 3MWTA 3MECA 3O3FA 2D5RA 3QEPA 4DTNA 1T44A 1JXEA 5E84A 3LM2A 3DLBA 1JCFA 4ISGA 1RT2A 2P9KA 1XMQK 3CETA 3DLRA 4MFBA 4I2QA 3KKSA 4B08A 2KQ2A 3VTIA 4JYAK 4BE1A 2HHXA 4RTFD 3CCEN 4OKJA 4BQLA 3M8SA 1QVGM 1TL3A 4WQ5A 5FPDA 1QQNA 3AA3A 4L3QA 5AQFA 3D45A 1OH6A 3VEZA 4BRAA 3KK2A 4CF0A 2O8BB 4BRCA 2BTFA 1WAJA 1NJIO 4DR5K 1VQMN 1WSFA 2E2QA 3CJAA 4EHTA 2P9IA 1U45A 4B1WB 3EKSA 4GV9A 3G10A 3ID6A 1GLEG 5KRTA 2X6NA 1TK5A 1S9GA 4DV0K 3EY1A 2O8CB 3DRPA 4N76A 1J6ZA 1LV5A 3VF6A 3P38A 5AQOA 5KPTA 3O3HA 4NYFA 3BP8A 2JWLA 4CEDA 3RMAA 1TUUA 3ULEB 1MWKA 3V1OA 5AQMA 3OYLA 3AVCA 3NGYA 1GLAG 5T7BA 4HCBA 3MEGA 1A5VA 1WN7A 4LY7A 4Y0WA 3CCLN 3M1FA 3IAYA 4W5TA 4GKJK 1SL1A 3AVNA 4IDHA 4DG1A 3VN5A 4M7XA 1IH7A 2PYLA 3C7NB 1ZBUA 4H5WA 3S3NA 3CMEN 1JLBA 4F3OA 3V9WA 3EN9A 3ZEUB 1C0FA 3NAEA 5AQQA 1JL2A 2NRXA 4RW6A 3D0PA 2FLOA 4JK7A 4B8CA 3D2EA 4EP4A 1OH8A 4OPJA 1TK0A 4YOVA 1YIJN 3OHRA 2WC9A 1C6VA 4BROA 4FVMA 4DHYA 2ZJPL 4CHOA 1SZ2A 4W5RA 1LWCA 1UA0A 3DMJA 3DRSA 4X62K 1X3NA 3RWUA 2FBTA 3SBGA 3VESA 1QZ6A 5GAGP 2P9LB 3AGKA 2P9NB 1NOZA 2IGIA 4AF1A 4ISEA 4OO1J 3VQAA 1T05A 5AJ3K 1WOQA 2XRIA 3NH1A 4B9VA 1LWEA 4DMNA 1XMOK 4H5VA 4KTZA 4MQ3A 1GOCA 2KFZA 1R59O 4YOWA 3F9MA 4O8UA 4BC3A 3VETA 5EOYA 5AZJB 1V4SA 5FROA 3E9PA 5C24A 5EX5A 4M3WA 1HKCA 5GIPA 4K8ZA 1NKCA 2O8FA 1NBWA 3EYZA 4CZKA 4E1JA 2OPPA 1JJ2M 4JS4A 3AAQA 2VG6A 4CE9A 1Z05A 3KKRA 1GOBA 4K8XA 1JCEA 2KZMA 1U2VB 3Q7CA 1RBSA 4J8FA 3KWGA 3VENA 2P9UA 3LP0A 4MLHA 4Z94A 2P9SA 3AA2A 3H08A 4FJGA 2Q31A 2IVNA 4ILHA 3AO3A 4BE2A 3V9XA 3RVCA 3SPYA 4IFYA 1E3MA 4FJJA 1NGBA 1X1PA 4CIEA 5DM6L 4FJKA 1J5OA 4IEEA 2G8HA 4DQRA 3RR7A 1HUXA 1TKXA 1HKBA 1RDWX 3VQ5A 4PL8A 5M1PA 3OA9A 3BUZB 4I9QA 1P90A 4RW9A 1T03A 4WYBA 1ZBFA 5FRNA 3C94A 3P5JA 3MAQA 5I3UA 1NG9A 1BI4A 2IVOA 4N56A 4CJVA 3MN7A 2J4RA 4NLBA 2YHAA 1D9DA 3QBWA 5HROA 2G8KA 2RF2A 5EU7A 4DTSA 3IFRA 5AQNA 1OVYA 3LL3A 1WSHA 2WBNA 2YV0X 3CCMN 1ILYA 4C8KA 1K8KB 4DTRA 4BGAA 1VQ8N 3AO1A 2ZJQL 1HQEA 5C2FA 1BOTO 4AHUA 3LAKA 4JD2A 5HRPA 3A5LC 4LC9B 1ZC6A 4H4MA 3F2KA 3CQXA 4DQIA 3LDLA 3BY5A 5MLCQ 4CJQA 1RGIA 5FPNA 3T69A 3SQ4A 4M45A 2VQEK 5HBMA 3J7YP 2D1KA 4FWRA 3R9PA 3O5BA 4KO0A 1VAZA 1DTTA 2A5XA 1KFDA 3KJVA 4CBUA 4OX9K 5SZTA 1QS4A 5AZIB 4JAXA 3VA0A 2P9PB 2ZD1A 3R3LA 1HLUA 3C65A 4H5NA 4BR4A 3SUOA 1N5YA 3EZWA 3RMCA 3WXJA 5BN8A 3AVAA 4DSLA 1C0GA 5I42A 4BQZA 5HRSA 3OS1A 3THWA 2ZF5O 3B8AX 1RTJA 3RR8A 4PQUA 3Q7BA 3HOTA 1UWBA 3AO4A 3V9ZA 3TI0A 3CQYA 2WOMA 3NGZA 4KH6A 3H6EA 3NF8A 1O13A 3MXIA 2Q3SA 3NMUA 4CEOA 4GVEA 4C8NA 2HHSA 3MCAB 1NK9A 4BY9C 2DY4A 3OTOK 3ENBA 1YF5L 1C1CA 3CJ1A 4CF1A 4AHVA 3AVHA 3H1VX 3LM9A 3AA4A 2F9WA 2HHWA 1BQNA 4YFUA 3U4LA 4K41A 5KPZA 3K2PA 4JI2K 2QKKA 1IKYA 1Q9XA 3EE8A 3VOVA 1KLMA 4M3RA 4FOEA 4OVLA 3CIPA 1NGEA 3H3OB 1WAFA 4JKDA 1Y97A 1MU2A 1L3TA 3PIOL 4B1UB 2YI1A 1ASWA 4BACA 4CCHA 3O8MA 1VSDA 3WEEB 3LALA 3O3GA 4OPKA 3JXUA 2YHBA 4K42A 4BWJA 2QEXN 3P31A 4E7KA 1U48A 1EWRA 3ENHA 3PY8A 3OS2A 3QEXA 3ISNC 1GLCG 4JKGA 2QWOA 5BRFA 5FPEA 3P83D 4AM6A 4F8RA 2CGKA 3A0IX 3EO3A 3P4IA 4FWLA 3HT3A 4J2BA 1TYQA 1VQ9N 4ID5A 1NKBA 5JS2A 2CH5A 3OW2M 4IO8A 5LMUK 2OYQA 2KTQA 4GVMA 2WTUA 1NGFA 1RILA 4CZLA 4KB0A 4RW8A 2W41A 3DOKA 3VQDA 2IVPA 3DXKB 4DLGA 1J9AA 2JGUA 3D2FB 1K9MO 3QERA 1VK0A 5BRDA 4KI6A 5CZ1A 1NMNA 3FZFA 2OTLN 1HPMA 3CCJN 4LFAK 4E89A 3N4PA 1VQLN 4HCCA 1BA0A 4JI1K 3C95A 1BIZA 2E2PA 2HOEA 4CK2A 2E4LA 4CVNE 2B6AA 1M90O 4DFPA 2A3ZA 5ELZA 4I6MA 2OCEA 5BRHA 3OYDA 3T3FA 4LH5A 4GW6A 1HNWK 3ASMA 3FLCO 3P1GA 5HRRA 5I9EB 4H0YB 4QS7A 2PFUA 5BPMA 1Y64A 2GUIA 4FWKA 3DLHA 3DLLL 4CFDA 4IEIA 1L3VA 5LJWA 4M3YA 2Q1NA 4BC2A 4CJ5A 3KK3A 5KQDA 3JS6A 3M8QA 1EXQA 1BISA 4IXCA 2P51A 1ITGA 2HF3A 4PKHA 4O8KA 1N33K 4ILJA 1SAZA 4MO5A 4I9LA 4CF2A 4B1VA 1XHZA 3AVIA 1HQUA 2BGGA 5C2DA 2NLXA 3UB5A 4KI4A 1G99A 1QHTA 3VQPA 3EKUA 2PBDA 5AR0A 4CJ4A 4R79A 2D4WA 4CBWA 3AVFA 3HO1A 1NK7A 3S9HA 3S3MA 4BR5A 4DLEA 4JKBA 2FSNA 4ISFA 5AQXA 4DTUA 2YNFA 5AQWA 3NE6A 4DV5K 5AQKA 1QHAA 3I0SA 4BR9A 3RSEB 4BR0A 4FLVA 2D0BA 4L8RB 3CXCM 5EXWA 3MXMA 4B9NA 1OH5A 3O9QA 4F2SA 1FW6A 3CPEA 1FKOA 4CF9A 3CCVN 2XY8A
chains in the Genus database with same CATH topology
3OYLA 2ZQBA 2G8IA 3ITHA 3ZSQA 4CJPA 1EKEA 3AVCA 3NGYA 4UQGA 1KCFA 3ZT1A 4XIUA 1B92A 5T7BA 4E1MA 1NJYA 3MEGA 1A5VA 1SUQA 2P5GA 4HCBA 1WN7A 1RBVA 4LY7A 5C42A 3SJJA 2VG5A 3QESA 2YKNA 3QEWA 1C0TA 1GOAA 3SUNA 5KGWA 4W5OA 1VSKA 2VWJA 4W5TA 4B9TA 3IAYA 1UA1A 1SL1A 3AVNA 4DG1A 4CEFA 4H8KA 3VN5A 1VSFA 1ASUA 1RDDA 1IH7A 4Y1CA 4FJHA 4FLTA 2O4GA 4KV8A 3LDSA 2PYLA 1S1TA 3SV3A 4BDPA 2IDOA 4ZTFA 4FJXA 1J53A 4Q5VA 4DU3A 1ZBUA 1WNSA 3PX6A 4Z4GA 3KLFA 1SL0A 1NOYA 3S3NA 1JLBA 2P1JA 3V9WA 1NJXA 4F3OA 4C8MA 1HMVA 3NAEA 3L2WA 4FLYA 1JL2A 4CFCA 3LPTA 4FM0A 4FZZA 4RW6A 4KHUA 1O1WA 2HVIA 3D0PA 1Z25A 1WLJA 3NH2A 2XHBA 4B8CA 4M3XA 1RDAA 3OYBA 1U4BA 4N41A 3L2UA 4EP4A 3HM9A 4Z4CA 1D5AA 2JLEA 4OPJA 1TK0A 4HUFA 1SKRA 3LP1A 4DSIA 1JKHA 3F73A 1VRTA 4FW1A 1C6VA 4WE1A 3TAPA 4FVMA 4DF4A 2Z1IA 5HLFA 3KLEA 3UIQA 4CHOA 3NCIA 4CECA 4W5RA 2KW4A 1HJRA 3A2FA 1LWCA 4I7FA 1UA0A 3G0ZA 4FK2A 4CJKA 3DMJA 4FLWA 3DRSA 3WNEA 3V9SA 3HJFA 3HPOA 4W5NA 3WNFA 3RWUA 2FBTA 2RKIA 1QSYA 4CEZA 3RMBA 1ZBHA 1NOZA 1SKWA 2IGIA 4KRFA 1KSPA 4AHRA 3V1QA 3B6PA 2ETJA 3VQAA 3ZSRA 4W5QA 1T05A 2XRIA 3NH1A 1C0UA 3VQQA 3SCXA 4BE0A 1BGXT 1HRHA 1LWEA 4AHSA 1S1VA 3LANA 4KTZA 5K14A 4DMNA 3QEIA 4MQ3A 4ZTJA 1G15A 1GOCA 2YKMA 2XY7A 4E3SA 2P5OA 2KFZA 1ZYQA 1SV5A 4QAGA 3HPHA 1HYVA 4DQSA 4DFKA 2YNIA 4O5BA 4FJNA 1EETA 3LZJA 4FLZA 1XWLA 5CYQA 5FROA 3OYEA 4CJSA 3I8DA 5DK5A 3RRHA 4CFBA 3V4IA 1NJZA 4FJ7A 3ZT0A 4CEBA 1IG9A 5C24A 4M3WA 4NCAA 4QOZB 4EP5A 4K8ZA 3NF7A 1RT4A 2OZMA 2HHTA 1NKCA 3VQ6A 4DSFA 1U49A 4CHNA 3SI6A 3OY9A 4PA1A 3ZT4A 3EYZA 2OPPA 3KD1E 1HPZA 4JS4A 2VG6A 4CE9A 1JLQA 3QETA 1S1UA 4C8LA 3KKRA 1KLNA 4Y1DA 1GOBA 3SNNA 1IO2A 1DLOA 4K8XA 4Z4FA 1TV6A 4HUGA 3TAQA 1Q8IA 5HP1A 1JLGA 4BDYA 4FJ9A 2KZMA 1LAWA 2A1SA 2OA8A 1RBSA 2FBVA 3LP0A 4CJFA 4CIFA 2GV9A 4FM1A 4CESA 1JLAA 3AA2A 3H08A 4FJGA 4YNQA 4JS5A 3SQ0A 5CYMA 2G8WA 2I5JA 2X6SA 1REVA 3AO3A 4BE2A 1RTIA 3V9XA 3SPYA 4IFYA 4CERA 4FJJA 1X1PA 1NJWA 3PO4A 2FC0A 4NCGA 2DFHA 4CIEA 1XHXA 4BDZA 1FKPA 4DSEA 3L2QA 4DTXA 3NF9A 2EX3A 4CHPA 2PZSA 1J5OA 4FJKA 4CJUA 2GBZA 1S6PA 3K5MA 1CZ9A 2G8HA 3DRRA 3VQ4A 4DFMA 4DQRA 4IG0A 1IKWA 1WSGA 1TKXA 4OJRA 1RBTA 3RR7A 3VQ5A 1YVUA 1CZBA 2OPSA 3V9UA 4M41A 4AH9A 1BCOA 4E7JA 2A1RA 1BIUA 4CHYA 4I9QA 4RW9A 3VQ8A 4DWIA 3DM2A 4CGFA 1T03A 1T8EA 1ZBFA 5FRNA 4CK3A 3C94A 4M3TA 4JRQA 3AV9A 3P5JA 3MAQA 5I3UA 3TR8A 1S1WA 3ULDA 1BI4A 3WNHA 4CK1A 3OYMA 4CJEA 4RG8A 4DSJA 1LW2A 2B4JA 4CJVA 4N56A 3TAFA 3OYJA 3QINA 1TGOA 2XY5A 1RBUA 3IRXA 1X9SA 3CM5A 2YHAA 1NK8A 4OLAA 1D9DA 1S1XA 1RT1A 2RN2A 4E1NA 1NK6A 5HROA 3CG7A 1RT3A 1ASVA 3BDPA 3AVJA 2G8KA 2RF2A 3CYMA 3VQCA 3OYIA 5EU7A 4DTSA 2BANA 5J2NA 4AILC 4B9LA 4Z4HA 4B8AB 3KLHA 3QIOA 1WSHA 3E01A 3VQ9A 3PX4A 1FK9A 4CGHA 2G8VA 5FDLA 2YV0X 4CHQA 1LW0A 1WSEA 4C8KA 3PO5A 4CJLA 4KHSA 4DTRA 4KTWA 1KVAA 1JLFA 3JYTA 4B3OA 3FFIA 3DLGA 4FJMA 3VA3A 3AO1A 2OPQA 4DS5A 2HMIA 1HQEA 3HPGA 5KI6A 4AHUA 5HRPA 3LAKA 4KB1A 3L8BA 4B9VA 3OYHA 3K5LA 2B5JA 2FBXA 4H4MA 3NGIA 1CXQA 3HP6A 3V81A 4DQIA 2YNHA 4CJQA 4KPYA 4FLUA 2HHVA 3CFOA 2ATQA 4AHCA 4CEAA 1RT5A 3PV8A 4FJLA 3JSMA 4J2AA 3HYFA 3ZT3A 4CGIA 1VSLA 3SQ4A 2IOCA 4M45A 3L2VA 4KFBA 5HBMA 1QTMA 3VQEA 5E41A 4DQQA 4PWDA 2Z1GA 3AA5X 4NYNA 1K6YA 4NCBA 4KO0A 4LSLA 1DTTA 1RT6A 1KFDA 2HNZA 4ID1A 3OYAA 3KJVA 3HK2A 1W0HA 3AVGA 5J1EA 1ZBLA 4F4KA 5SZTA 4LD0A 1QS4A 3NFAA 1QE1A 1I39A 3IS9A 1SKSA 2AJQA 1HNIA 3VA0A 5C25A 1D9FA 4OLBA 4BWMA 1B9DA 1HNVA 2ZD1A 1BHLA 2BE2A 4G1QA 3ZSWA 4E7LA 1VSEA 1D8YA 4DQPA 5CZ2A 4Q0BA 1J54A 3ZSYA 3OYKA 3K57A 2HNYA 2F8SA 1N5YA 3SUOA 4M42A 2HHUA 4ELUA 1LWFA 3RMCA 3AVAA 4DSLA 3OYFA 4CEEA 4HVJA 3SV4A 1X9MA 3LP3A 3K5OA 5SWMA 1Z26A 5HRSA 5I42A 3OS1A 3F9KA 2BDPA 1DTQA 1JLCA 2QXFA 3C6TA 3SYZA 3LWMA 3U3YA 3QO9A 3RR8A 1BL3A 1RTJA 3ALYA 5KGXA 4DSKA 4KTQA 4FK0A 4ELTA 4PQUA 4FW2A 1UAXA 3TAGA 4KKOA 1UWBA 2IAJA 2RPIA 3AO4A 3MXJA 4CGDA 3V9ZA 4O0JA 3TI0A 3K58A 2WOMA 4IDKA 3NGZA 1TKDA 1L3UA 4EZ9A 1I3AA 4F3TA 3QIPA 4DFJA 3NF8A 3MXIA 2Q3SA 3AO2A 4CEOA 3NHGA 3TANA 4C8NA 3CQ8A 3L3VA 3VQBA 2D0CA 2X78A 3NH0A 1NK9A 4FJ8A 1YT3A 3SPZA 2HHSA 2DY4A 3K5NA 2X74A 3L2RA 2XY6A 1C1CA 1WSIA 3THVA 4CF1A 2NUBA 4AHVA 4FZXC 3S3OA 5KTQA 3AVHA 2QKBA 1TAUA 4KHNA 3QNOA 1CXUA 3AA4A 2KZZA 2HHWA 4OGCA 4CJWA 1BQNA 4YFUA 5D3GA 3OJUA 4QCLA 4HUEA 3PUFA 2PYJA 4PUOA 3OJSA 1VRUA 3K2PA 2QKKA 4PY5A 2FBYA 3WNGA 3MEEA 1IKYA 3V6DA 1Q9XA 1C1AA 2WONA 3SUPA 3HVRA 1KLMA 4M3RA 4OVLA 4J2DA 1S9EA 4CJTA 3HSTB 1C1BA 3CFPA 3ZSOA 3SZ2A 3AO5A 3DI6A 4E19A 4FK4A 1S5JA 1WAFA 3KIOA 1NK0A 3HXMA 5FRMA 1Y97A 2HHQA 1MU2A 4E7IA 3PX0A 3ZT2A 1L3TA 4KHQA 1RCHA 3HVTA 1QQCA 4E7HA 4DTPA 1IKXA 1SL2A 1TKTA 3M8PA 3U3GA 3RRGA 1ASWA 1TAQA 4BACA 4CCHA 1XC9A 1VSDA 4FCYA 5J2MA 1QSLA 2O4IA 3OVNA 3LALA 3O3GA 4H4OA 1VSHA 3KLIA 4OPKA 2YHBA 2HNDA 3DLKA 3DLEA 3LAMA 4OKKA 4BWJA 3ZSXA 3LZIA 3KLGA 4E7KA 1U48A 1KVBA 3LP2A 4KHYA 3PY8A 4CGGA 3VQ7A 3OS2A 3QEXA 1RDBA 3ISNC 4TSXA 4KREA 3I0RA 3RMDA 1YTAA 4C8OA 4O0IA 4AHTA 1VSMA 4R5PA 3P83D 4IBNA 1R0AA 4B9UA 4M3UA 3ZSZA 3CFRA 4F8RA 1BQMA 4DTOA 3AVBA 4DTMA 3SUQA 1NK4A 5JS1A 4CJ3A 4N5SA 3HT3A 1NKEA 4J2BA 4LH4A 1VSJA 4B9MA 3KTQA 3ZCMA 3CM6A 4ID5A 1NKBA 2HB5A 1CLQA 5JS2A 4E0DA 3T1AA 1RTDA 4IFVA 1U04A 5HRNA 4OKEA 2OYQA 2KTQA 4GMJB 4IG3A 3V1RA 3T19A 1TL1A 4GVMA 3TAMA 1RILA 4KB0A 1RT7A 4RW8A 1LAVA 2D0AA 1FXXA 3DOKA 3LPUA 3VQDA 4CIGA 3BGRA 4DLGA 1J9AA 2JGUA 3U6FA 1U47A 1VSIA 1BCMA 4O44A 3QERA 3ZSVA 2XO7A 3KK1A 1RTHA 1JL1A 1A5XA 1C0MA 1VK0A 4KI6A 5CZ1A 4EZ6A 4JRPA 3KD5E 4E89A 4FYDA 4ZHRA 3QNNA 2DFFA 3HL8A 2VWKA 4HHTA 2F8TA 5DMRA 4HTUA 4HCCA 1KFSA 4DTJA 3TAEA 3QEVA 4KAZA 4FJIA 4J2EA 2YNGA 3C95A 3OYGA 5J2QA 3SQ1A 1BIZA 3OS0A 2VG7A 2G8UA 4B9SA 3DOLA 4ELVA 1X9WA 4CK2A 2E4LA 1L3SA 4ICLA 4RW7A 2B6AA 1EP4A 4DF8A 3O4NA 3OYNA 4DFPA 4JLHA 4RW4A 3SQ2A 3OYDA 4FM2A 3O4QA 2ZE2A 3T3FA 4LH5A 4GW6A 1TKZA 3ASMA 3MEDA 3OYCA 1HYSA 3P1GA 1XI1A 5HRRA 2HVHA 4OGEA 3RTVA 1TK8A 3EZ5A 1ZBIA 1KTQA 4DU1A 2IC3A 3AVLA 4FLXA 2G8FA 2QK9A 3NBPA 2DFEA 2GUIA 1L5UA 3MECA 4FZYA 3DLHA 3O3FA 2D5RA 1RBRA 1UOCA 2LSNA 4CFDA 3QEPA 4DTNA 1L3VA 1JXEA 3QLHA 4DS4A 1S6QA 3TABA 1N6QA 2Z1HA 3DLBA 3DYAA 4CJ5A 4M3YA 4N47A 3KK3A 3NDKA 3M8QA 1RT2A 1EXQA 1BISA 2W42A 3DLRA 3C6UA 4MFBA 4I2QA 1T7PA 3L3UA 4Z4EA 1JXBA 1F21A 3KKSA 4B08A 2P51A 1JLEA 1Q9YA 4O55A 1ITGA 2Y1IA 2KQ2A 3IG1A 4BE1A 2HHXA 1TVRA 1EX4A 4OKJA 2KFNA 4CHZA 2HW3A 4FXDA 1IKVA 5CY4A 2ITGA 3M8SA 4Z4IA 4KHWA 1TL3A 4I9LA 3AA3A 4CJRA 4CF2A 2Z1JA 3D45A 1RDCA 1XHZA 3TWHA 2R7YA 3AVIA 1HQUA 4CF0A 3KK2A 2BGGA 5J2PA 2OPRA 4KI4A 3LWLA 4IKFA 1QHTA 1WAJA 4Z0UA 3VQPA 4CF8A 4CGJA 3AVMA 1WSFA 4CJ4A 3K59A 4DU4A 4CEQA 3AVFA 2E6LA 3HO1A 3B6OA 4FJ5A 1NK7A 3S9HA 2IS3A 1U45A 4LSNA 1WSJA 3S3MA 1B9FA 2F96A 4DLEA 4M3ZA 4DTUA 2YNFA 3G10A 3NE6A 2E6MA 4CFAA 2Y1JA 1NK5A 1HYZA 5KRTA 3M8RA 2X6NA 2DTUA 1W9HA 1TK5A 1S9GA 2EHGA 1QSSA 3EY1A 5KRSA 4F2RA 3I0SA 3DRPA 4N76A 1YTUA 1LV5A 1A5WA 1KVCA 4FLVA 2D0BA 4I2PA 1KRPA 1BI4B 3O3HA 3TARA 4L8RB 4O4GA 3MXMA 4B9NA 4NYFA 2OZSA 4F2SA 3NF6A 4CEDA 3HP9A 3RMAA 2PY5A 1FKOA 3AVKA 4CF9A 1RNHA 3V1OA 2XY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYL A;  2ZQB A;  2G8I A;  3ITH A;  3ZSQ A;  4CJP A;  1EKE A;  3AVC A;  3NGY A;  4UQG A;  1KCF A;  3ZT1 A;  4XIU A;  1B92 A;  5T7B A;  4E1M A;  1NJY A;  3MEG A;  1A5V A;  1SUQ A;  2P5G A;  4HCB A;  1WN7 A;  1RBV A;  4LY7 A;  5C42 A;  3SJJ A;  2VG5 A;  3QES A;  2YKN A;  3QEW A;  1C0T A;  1GOA A;  3SUN A;  5KGW A;  4W5O A;  1VSK A;  2VWJ A;  4W5T A;  4B9T A;  3IAY A;  1UA1 A;  1SL1 A;  3AVN A;  4DG1 A;  4CEF A;  4H8K A;  3VN5 A;  1VSF A;  1ASU A;  1RDD A;  1IH7 A;  4Y1C A;  4FJH A;  4FLT A;  2O4G A;  4KV8 A;  3LDS A;  2PYL A;  1S1T A;  3SV3 A;  4BDP A;  2IDO A;  4ZTF A;  4FJX A;  1J53 A;  4Q5V A;  4DU3 A;  1ZBU A;  1WNS A;  3PX6 A;  4Z4G A;  3KLF A;  1SL0 A;  1NOY A;  3S3N A;  1JLB A;  2P1J A;  3V9W A;  1NJX A;  4F3O A;  4C8M A;  1HMV A;  3NAE A;  3L2W A;  4FLY A;  1JL2 A;  4CFC A;  3LPT A;  4FM0 A;  4FZZ A;  4RW6 A;  4KHU A;  1O1W A;  2HVI A;  3D0P A;  1Z25 A;  1WLJ A;  3NH2 A;  2XHB A;  4B8C A;  4M3X A;  1RDA A;  3OYB A;  1U4B A;  4N41 A;  3L2U A;  4EP4 A;  3HM9 A;  4Z4C A;  1D5A A;  2JLE A;  4OPJ A;  1TK0 A;  4HUF A;  1SKR A;  3LP1 A;  4DSI A;  1JKH A;  3F73 A;  1VRT A;  4FW1 A;  1C6V A;  4WE1 A;  3TAP A;  4FVM A;  4DF4 A;  2Z1I A;  5HLF A;  3KLE A;  3UIQ A;  4CHO A;  3NCI A;  4CEC A;  4W5R A;  2KW4 A;  1HJR A;  3A2F A;  1LWC A;  4I7F A;  1UA0 A;  3G0Z A;  4FK2 A;  4CJK A;  3DMJ A;  4FLW A;  3DRS A;  3WNE A;  3V9S A;  3HJF A;  3HPO A;  4W5N A;  3WNF A;  3RWU A;  2FBT A;  2RKI A;  1QSY A;  4CEZ A;  3RMB A;  1ZBH A;  1NOZ A;  1SKW A;  2IGI A;  4KRF A;  1KSP A;  4AHR A;  3V1Q A;  3B6P A;  2ETJ A;  3VQA A;  3ZSR A;  4W5Q A;  1T05 A;  2XRI A;  3NH1 A;  1C0U A;  3VQQ A;  3SCX A;  4BE0 A;  1BGX T;  1HRH A;  1LWE A;  4AHS A;  1S1V A;  3LAN A;  4KTZ A;  5K14 A;  4DMN A;  3QEI A;  4MQ3 A;  4ZTJ A;  1G15 A;  1GOC A;  2YKM A;  2XY7 A;  4E3S A;  2P5O A;  2KFZ A;  1ZYQ A;  1SV5 A;  4QAG A;  3HPH A;  1HYV A;  4DQS A;  4DFK A;  2YNI A;  4O5B A;  4FJN A;  1EET A;  3LZJ A;  4FLZ A;  1XWL A;  5CYQ A;  5FRO A;  3OYE A;  4CJS A;  3I8D A;  5DK5 A;  3RRH A;  4CFB A;  3V4I A;  1NJZ A;  4FJ7 A;  3ZT0 A;  4CEB A;  1IG9 A;  5C24 A;  4M3W A;  4NCA A;  4QOZ B;  4EP5 A;  4K8Z A;  3NF7 A;  1RT4 A;  2OZM A;  2HHT A;  1NKC A;  3VQ6 A;  4DSF A;  1U49 A;  4CHN A;  3SI6 A;  3OY9 A;  4PA1 A;  3ZT4 A;  3EYZ A;  2OPP A;  3KD1 E;  1HPZ A;  4JS4 A;  2VG6 A;  4CE9 A;  1JLQ A;  3QET A;  1S1U A;  4C8L A;  3KKR A;  1KLN A;  4Y1D A;  1GOB A;  3SNN A;  1IO2 A;  1DLO A;  4K8X A;  4Z4F A;  1TV6 A;  4HUG A;  3TAQ A;  1Q8I A;  5HP1 A;  1JLG A;  4BDY A;  4FJ9 A;  2KZM A;  1LAW A;  2A1S A;  2OA8 A;  1RBS A;  2FBV A;  3LP0 A;  4CJF A;  4CIF A;  2GV9 A;  4FM1 A;  4CES A;  1JLA A;  3AA2 A;  3H08 A;  4FJG A;  4YNQ A;  4JS5 A;  3SQ0 A;  5CYM A;  2G8W A;  2I5J A;  2X6S A;  1REV A;  3AO3 A;  4BE2 A;  1RTI A;  3V9X A;  3SPY A;  4IFY A;  4CER A;  4FJJ A;  1X1P A;  1NJW A;  3PO4 A;  2FC0 A;  4NCG A;  2DFH A;  4CIE A;  1XHX A;  4BDZ A;  1FKP A;  4DSE A;  3L2Q A;  4DTX A;  3NF9 A;  2EX3 A;  4CHP A;  2PZS A;  1J5O A;  4FJK A;  4CJU A;  2GBZ A;  1S6P A;  3K5M A;  1CZ9 A;  2G8H A;  3DRR A;  3VQ4 A;  4DFM A;  4DQR A;  4IG0 A;  1IKW A;  1WSG A;  1TKX A;  4OJR A;  1RBT A;  3RR7 A;  3VQ5 A;  1YVU A;  1CZB A;  2OPS A;  3V9U A;  4M41 A;  4AH9 A;  1BCO A;  4E7J A;  2A1R A;  1BIU A;  4CHY A;  4I9Q A;  4RW9 A;  3VQ8 A;  4DWI A;  3DM2 A;  4CGF A;  1T03 A;  1T8E A;  1ZBF A;  5FRN A;  4CK3 A;  3C94 A;  4M3T A;  4JRQ A;  3AV9 A;  3P5J A;  3MAQ A;  5I3U A;  3TR8 A;  1S1W A;  3ULD A;  1BI4 A;  3WNH A;  4CK1 A;  3OYM A;  4CJE A;  4RG8 A;  4DSJ A;  1LW2 A;  2B4J A;  4CJV A;  4N56 A;  3TAF A;  3OYJ A;  3QIN A;  1TGO A;  2XY5 A;  1RBU A;  3IRX A;  1X9S A;  3CM5 A;  2YHA A;  1NK8 A;  4OLA A;  1D9D A;  1S1X A;  1RT1 A;  2RN2 A;  4E1N A;  1NK6 A;  5HRO A;  3CG7 A;  1RT3 A;  1ASV A;  3BDP A;  3AVJ A;  2G8K A;  2RF2 A;  3CYM A;  3VQC A;  3OYI A;  5EU7 A;  4DTS A;  2BAN A;  5J2N A;  4AIL C;  4B9L A;  4Z4H A;  4B8A B;  3KLH A;  3QIO A;  1WSH A;  3E01 A;  3VQ9 A;  3PX4 A;  1FK9 A;  4CGH A;  2G8V A;  5FDL A;  2YV0 X;  4CHQ A;  1LW0 A;  1WSE A;  4C8K A;  3PO5 A;  4CJL A;  4KHS A;  4DTR A;  4KTW A;  1KVA A;  1JLF A;  3JYT A;  4B3O A;  3FFI A;  3DLG A;  4FJM A;  3VA3 A;  3AO1 A;  2OPQ A;  4DS5 A;  2HMI A;  1HQE A;  3HPG A;  5KI6 A;  4AHU A;  5HRP A;  3LAK A;  4KB1 A;  3L8B A;  4B9V A;  3OYH A;  3K5L A;  2B5J A;  2FBX A;  4H4M A;  3NGI A;  1CXQ A;  3HP6 A;  3V81 A;  4DQI A;  2YNH A;  4CJQ A;  4KPY A;  4FLU A;  2HHV A;  3CFO A;  2ATQ A;  4AHC A;  4CEA A;  1RT5 A;  3PV8 A;  4FJL A;  3JSM A;  4J2A A;  3HYF A;  3ZT3 A;  4CGI A;  1VSL A;  3SQ4 A;  2IOC A;  4M45 A;  3L2V A;  4KFB A;  5HBM A;  1QTM A;  3VQE A;  5E41 A;  4DQQ A;  4PWD A;  2Z1G A;  3AA5 X;  4NYN A;  1K6Y A;  4NCB A;  4KO0 A;  4LSL A;  1DTT A;  1RT6 A;  1KFD A;  2HNZ A;  4ID1 A;  3OYA A;  3KJV A;  3HK2 A;  1W0H A;  3AVG A;  5J1E A;  1ZBL A;  4F4K A;  5SZT A;  4LD0 A;  1QS4 A;  3NFA A;  1QE1 A;  1I39 A;  3IS9 A;  1SKS A;  2AJQ A;  1HNI A;  3VA0 A;  5C25 A;  1D9F A;  4OLB A;  4BWM A;  1B9D A;  1HNV A;  2ZD1 A;  1BHL A;  2BE2 A;  4G1Q A;  3ZSW A;  4E7L A;  1VSE A;  1D8Y A;  4DQP A;  5CZ2 A;  4Q0B A;  1J54 A;  3ZSY A;  3OYK A;  3K57 A;  2HNY A;  2F8S A;  1N5Y A;  3SUO A;  4M42 A;  2HHU A;  4ELU A;  1LWF A;  3RMC A;  3AVA A;  4DSL A;  3OYF A;  4CEE A;  4HVJ A;  3SV4 A;  1X9M A;  3LP3 A;  3K5O A;  5SWM A;  1Z26 A;  5HRS A;  5I42 A;  3OS1 A;  3F9K A;  2BDP A;  1DTQ A;  1JLC A;  2QXF A;  3C6T A;  3SYZ A;  3LWM A;  3U3Y A;  3QO9 A;  3RR8 A;  1BL3 A;  1RTJ A;  3ALY A;  5KGX A;  4DSK A;  4KTQ A;  4FK0 A;  4ELT A;  4PQU A;  4FW2 A;  1UAX A;  3TAG A;  4KKO A;  1UWB A;  2IAJ A;  2RPI A;  3AO4 A;  3MXJ A;  4CGD A;  3V9Z A;  4O0J A;  3TI0 A;  3K58 A;  2WOM A;  4IDK A;  3NGZ A;  1TKD A;  1L3U A;  4EZ9 A;  1I3A A;  4F3T A;  3QIP A;  4DFJ A;  3NF8 A;  3MXI A;  2Q3S A;  3AO2 A;  4CEO A;  3NHG A;  3TAN A;  4C8N A;  3CQ8 A;  3L3V A;  3VQB A;  2D0C A;  2X78 A;  3NH0 A;  1NK9 A;  4FJ8 A;  1YT3 A;  3SPZ A;  2HHS A;  2DY4 A;  3K5N A;  2X74 A;  3L2R A;  2XY6 A;  1C1C A;  1WSI A;  3THV A;  4CF1 A;  2NUB A;  4AHV A;  4FZX C;  3S3O A;  5KTQ A;  3AVH A;  2QKB A;  1TAU A;  4KHN A;  3QNO A;  1CXU A;  3AA4 A;  2KZZ A;  2HHW A;  4OGC A;  4CJW A;  1BQN A;  4YFU A;  5D3G A;  3OJU A;  4QCL A;  4HUE A;  3PUF A;  2PYJ A;  4PUO A;  3OJS A;  1VRU A;  3K2P A;  2QKK A;  4PY5 A;  2FBY A;  3WNG A;  3MEE A;  1IKY A;  3V6D A;  1Q9X A;  1C1A A;  2WON A;  3SUP A;  3HVR A;  1KLM A;  4M3R A;  4OVL A;  4J2D A;  1S9E A;  4CJT A;  3HST B;  1C1B A;  3CFP A;  3ZSO A;  3SZ2 A;  3AO5 A;  3DI6 A;  4E19 A;  4FK4 A;  1S5J A;  1WAF A;  3KIO A;  1NK0 A;  3HXM A;  5FRM A;  1Y97 A;  2HHQ A;  1MU2 A;  4E7I A;  3PX0 A;  3ZT2 A;  1L3T A;  4KHQ A;  1RCH A;  3HVT A;  1QQC A;  4E7H A;  4DTP A;  1IKX A;  1SL2 A;  1TKT A;  3M8P A;  3U3G A;  3RRG A;  1ASW A;  1TAQ A;  4BAC A;  4CCH A;  1XC9 A;  1VSD A;  4FCY A;  5J2M A;  1QSL A;  2O4I A;  3OVN A;  3LAL A;  3O3G A;  4H4O A;  1VSH A;  3KLI A;  4OPK A;  2YHB A;  2HND A;  3DLK A;  3DLE A;  3LAM A;  4OKK A;  4BWJ A;  3ZSX A;  3LZI A;  3KLG A;  4E7K A;  1U48 A;  1KVB A;  3LP2 A;  4KHY A;  3PY8 A;  4CGG A;  3VQ7 A;  3OS2 A;  3QEX A;  1RDB A;  3ISN C;  4TSX A;  4KRE A;  3I0R A;  3RMD A;  1YTA A;  4C8O A;  4O0I A;  4AHT A;  1VSM A;  4R5P A;  3P83 D;  4IBN A;  1R0A A;  4B9U A;  4M3U A;  3ZSZ A;  3CFR A;  4F8R A;  1BQM A;  4DTO A;  3AVB A;  4DTM A;  3SUQ A;  1NK4 A;  5JS1 A;  4CJ3 A;  4N5S A;  3HT3 A;  1NKE A;  4J2B A;  4LH4 A;  1VSJ A;  4B9M A;  3KTQ A;  3ZCM A;  3CM6 A;  4ID5 A;  1NKB A;  2HB5 A;  1CLQ A;  5JS2 A;  4E0D A;  3T1A A;  1RTD A;  4IFV A;  1U04 A;  5HRN A;  4OKE A;  2OYQ A;  2KTQ A;  4GMJ B;  4IG3 A;  3V1R A;  3T19 A;  1TL1 A;  4GVM A;  3TAM A;  1RIL A;  4KB0 A;  1RT7 A;  4RW8 A;  1LAV A;  2D0A A;  1FXX A;  3DOK A;  3LPU A;  3VQD A;  4CIG A;  3BGR A;  4DLG A;  1J9A A;  2JGU A;  3U6F A;  1U47 A;  1VSI A;  1BCM A;  4O44 A;  3QER A;  3ZSV A;  2XO7 A;  3KK1 A;  1RTH A;  1JL1 A;  1A5X A;  1C0M A;  1VK0 A;  4KI6 A;  5CZ1 A;  4EZ6 A;  4JRP A;  3KD5 E;  4E89 A;  4FYD A;  4ZHR A;  3QNN A;  2DFF A;  3HL8 A;  2VWK A;  4HHT A;  2F8T A;  5DMR A;  4HTU A;  4HCC A;  1KFS A;  4DTJ A;  3TAE A;  3QEV A;  4KAZ A;  4FJI A;  4J2E A;  2YNG A;  3C95 A;  3OYG A;  5J2Q A;  3SQ1 A;  1BIZ A;  3OS0 A;  2VG7 A;  2G8U A;  4B9S A;  3DOL A;  4ELV A;  1X9W A;  4CK2 A;  2E4L A;  1L3S A;  4ICL A;  4RW7 A;  2B6A A;  1EP4 A;  4DF8 A;  3O4N A;  3OYN A;  4DFP A;  4JLH A;  4RW4 A;  3SQ2 A;  3OYD A;  4FM2 A;  3O4Q A;  2ZE2 A;  3T3F A;  4LH5 A;  4GW6 A;  1TKZ A;  3ASM A;  3MED A;  3OYC A;  1HYS A;  3P1G A;  1XI1 A;  5HRR A;  2HVH A;  4OGE A;  3RTV A;  1TK8 A;  3EZ5 A;  1ZBI A;  1KTQ A;  4DU1 A;  2IC3 A;  3AVL A;  4FLX A;  2G8F A;  2QK9 A;  3NBP A;  2DFE A;  2GUI A;  1L5U A;  3MEC A;  4FZY A;  3DLH A;  3O3F A;  2D5R A;  1RBR A;  1UOC A;  2LSN A;  4CFD A;  3QEP A;  4DTN A;  1L3V A;  1JXE A;  3QLH A;  4DS4 A;  1S6Q A;  3TAB A;  1N6Q A;  2Z1H A;  3DLB A;  3DYA A;  4CJ5 A;  4M3Y A;  4N47 A;  3KK3 A;  3NDK A;  3M8Q A;  1RT2 A;  1EXQ A;  1BIS A;  2W42 A;  3DLR A;  3C6U A;  4MFB A;  4I2Q A;  1T7P A;  3L3U A;  4Z4E A;  1JXB A;  1F21 A;  3KKS A;  4B08 A;  2P51 A;  1JLE A;  1Q9Y A;  4O55 A;  1ITG A;  2Y1I A;  2KQ2 A;  3IG1 A;  4BE1 A;  2HHX A;  1TVR A;  1EX4 A;  4OKJ A;  2KFN A;  4CHZ A;  2HW3 A;  4FXD A;  1IKV A;  5CY4 A;  2ITG A;  3M8S A;  4Z4I A;  4KHW A;  1TL3 A;  4I9L A;  3AA3 A;  4CJR A;  4CF2 A;  2Z1J A;  3D45 A;  1RDC A;  1XHZ A;  3TWH A;  2R7Y A;  3AVI A;  1HQU A;  4CF0 A;  3KK2 A;  2BGG A;  5J2P A;  2OPR A;  4KI4 A;  3LWL A;  4IKF A;  1QHT A;  1WAJ A;  4Z0U A;  3VQP A;  4CF8 A;  4CGJ A;  3AVM A;  1WSF A;  4CJ4 A;  3K59 A;  4DU4 A;  4CEQ A;  3AVF A;  2E6L A;  3HO1 A;  3B6O A;  4FJ5 A;  1NK7 A;  3S9H A;  2IS3 A;  1U45 A;  4LSN A;  1WSJ A;  3S3M A;  1B9F A;  2F96 A;  4DLE A;  4M3Z A;  4DTU A;  2YNF A;  3G10 A;  3NE6 A;  2E6M A;  4CFA A;  2Y1J A;  1NK5 A;  1HYZ A;  5KRT A;  3M8R A;  2X6N A;  2DTU A;  1W9H A;  1TK5 A;  1S9G A;  2EHG A;  1QSS A;  3EY1 A;  5KRS A;  4F2R A;  3I0S A;  3DRP A;  4N76 A;  1YTU A;  1LV5 A;  1A5W A;  1KVC A;  4FLV A;  2D0B A;  4I2P A;  1KRP A;  1BI4 B;  3O3H A;  3TAR A;  4L8R B;  4O4G A;  3MXM A;  4B9N A;  4NYF A;  2OZS A;  4F2S A;  3NF6 A;  4CED A;  3HP9 A;  3RMA A;  2PY5 A;  1FKO A;  3AVK A;  4CF9 A;  1RNH A;  3V1O A;  2XY8 A; 
#chains in the Genus database with same CATH topology
 3FZH A;  4JKC A;  3K9J A;  4WQ4 C;  3I8B A;  4A5B A;  1EKE A;  1XNR K;  1NJY A;  1YHQ N;  4E1M A;  1SUQ A;  2O8E B;  2QWL A;  5BN9 A;  3VEV A;  3WXL A;  2VG5 A;  5TKW A;  2YKN A;  3UKR A;  5KGW A;  4W5O A;  2VWJ A;  1UA1 A;  4H5T A;  1VSF A;  1RDD A;  4FJH A;  4JKH A;  1N36 K;  2F9T A;  2O4G A;  2QTD A;  4KV8 A;  4XH5 A;  3LDS A;  4FLT A;  1W2B M;  4BDP A;  2IDO A;  1P8Z A;  4FJX A;  1J53 A;  4Q5V A;  4DU3 A;  4H0P A;  1WNS A;  3PX6 A;  4Z4G A;  3BF3 A;  3QFU A;  3E9L A;  4FOI A;  1HMV A;  4FLY A;  4CFC A;  4EIA A;  4KHU A;  1IBK K;  1O1W A;  1RDA A;  3L2U A;  3HM9 A;  4FWP A;  4C23 A;  4CD3 A;  4HUF A;  5HLF A;  4FW1 A;  5AQH A;  1RDU A;  2Z1I A;  3A5M C;  3KLE A;  1LOT B;  3NCI A;  2VQF K;  4FWO A;  2KW4 A;  1HJR A;  3A2F A;  5F2R A;  4CJK A;  1EWQ A;  3V9S A;  4XH1 A;  3TTC A;  3VPZ A;  3AAR A;  5AQY A;  4B1X B;  3B6P A;  2AP1 A;  1NGD A;  4BRM A;  4QOZ B;  4F9O A;  2P5O A;  2WFB A;  4QAG A;  3HPH A;  2YNI A;  4O5B A;  3SAH A;  1EET A;  4X66 K;  3LZJ A;  4FLZ A;  2IIR A;  3I8D A;  3A5N C;  5DK5 A;  3V4I A;  4FJ7 A;  3DJC A;  2ITM A;  3TSQ A;  1E4F T;  2GX9 A;  1QQO A;  3L6Q A;  5M1Q A;  3VQ6 A;  3SI6 A;  1EQY A;  4PA1 A;  2QI2 A;  3KD1 E;  1HPZ A;  3CMA N;  1KLN A;  1IO2 A;  1DLO A;  1TV6 A;  4HUG A;  5HP1 A;  1JLG A;  4FJ9 A;  5GIO A;  3TU5 A;  2GV9 A;  4JV5 K;  2VCP A;  1JLA A;  1Q82 O;  4JS5 A;  2O8B A;  2G8W A;  4K25 A;  4DUY K;  1REV A;  2FSJ A;  2HBJ A;  4BDZ A;  1FKP A;  4DKW A;  4DTX A;  1NNE A;  4O5F A;  3F5T A;  3LDN A;  4CJU A;  3K5M A;  1CZ9 A;  3DRR A;  3VQ4 A;  4IG0 A;  1RBT A;  1KXP A;  1CZB A;  4M41 A;  4AH9 A;  1BCO A;  3QDK A;  4E7J A;  2A1R A;  2ZGY A;  3VQ8 A;  4DWI A;  4CGF A;  4BVO A;  3OYM A;  2UXD K;  2ZGZ A;  4CJE A;  1YJ9 N;  4DR4 K;  2H3G X;  3TAF A;  5DM7 L;  2XY5 A;  3H45 C;  3CM5 A;  3THY B;  3S41 A;  1NK8 A;  3PIP L;  2NZT A;  4NB4 A;  3ULE A;  1RT1 A;  2RN2 A;  4E1N A;  1RT3 A;  1ASV A;  1VQK N;  3VQC A;  3K9K A;  1ATS A;  4AIL C;  4B9L A;  3CCS N;  3FZM A;  3ID8 A;  1FK9 A;  4A57 A;  4A62 A;  4JKE A;  4EFH A;  3DXM B;  3A5O C;  4CZE A;  1WSE A;  4KTW A;  1JLF A;  3JYT A;  4B3O A;  3VA3 A;  5KI6 A;  3HPG A;  3C7N A;  3OYH A;  1CXQ A;  3O9U A;  2YNH A;  3U9D A;  2RHK A;  4H0O A;  4KPY A;  3CFO A;  3PV8 A;  1RT5 A;  4J2A A;  1IJJ A;  3ZT3 A;  1VSL A;  2IOC A;  2F7T A;  3L2V A;  4PWD A;  5E41 A;  2V52 B;  4FPA A;  3ZX0 A;  4NYN A;  4JKF A;  1K6Y A;  3UKU B;  4NCB A;  3OYA A;  2HNZ A;  4B3R K;  5M1N A;  4F4K A;  4LD0 A;  3NFA A;  1SKS A;  3O1B A;  1V4T A;  2AJQ A;  1Q7Y O;  4A61 A;  3CHW A;  3ZSW A;  1BHL A;  2BE2 A;  4IOA L;  4E7L A;  4DQP A;  4Q0B A;  5H1S Q;  3OYK A;  3IMX A;  1KAZ A;  1HX1 A;  2HHU A;  1BDG A;  4HVJ A;  3SV4 A;  1DTQ A;  1JLC A;  2P9L A;  4EAH D;  2P9N A;  4B9Q A;  1BL3 A;  4DSK A;  3ALY A;  1DKG D;  4FW2 A;  1XNQ K;  4QS9 A;  2CGL A;  2RPI A;  3MXJ A;  4CGD A;  4GY2 B;  4O0J A;  3K58 A;  1TKD A;  2E20 A;  4DFJ A;  1LCU A;  3U8X A;  4LF8 K;  1YUW A;  3NHG A;  3TAN A;  3L3V A;  5AZJ A;  2X78 A;  3M6G A;  3K5N A;  3BZK A;  2XY6 A;  3CJ9 A;  3THV A;  4FZX C;  2QKB A;  4KHN A;  3SAF A;  4OGC A;  4CJW A;  3L4I A;  2W6K A;  2NRH A;  3HM8 A;  4JHD B;  4PUO A;  2FBY A;  3WNG A;  4IOX A;  2VGM A;  3SUP A;  3HVR A;  4CJT A;  1VQN N;  1C1B A;  1U2V A;  4JNE A;  5C0Y A;  2Q2R A;  1S5J A;  4H0V B;  1ZXO A;  5AQZ A;  4KHQ A;  2ZM6 K;  3HVT A;  1QQC A;  5GAD P;  2QWR A;  4DV7 K;  4H0X B;  3WXM B;  3OVN A;  3KLI A;  2HND A;  4OKK A;  3LAM A;  4CZI A;  3CPW M;  4JI8 K;  2UYT A;  4C8O A;  3O9T A;  4M3U A;  1I94 K;  1BQM A;  3BZC A;  4BGB A;  4DTM A;  4GV3 A;  1NK4 A;  4CJ3 A;  1NKE A;  4LH4 A;  1VSJ A;  3N4Q A;  4E0D A;  3FGU A;  1X3M A;  1U04 A;  3L0Q A;  4OKE A;  5HRN A;  2ASO A;  4GMJ B;  2FSK A;  1TL1 A;  2RE2 A;  4EHU A;  4CIG A;  3UE5 A;  4BRK A;  1U47 A;  1VSI A;  3C6A A;  1C0M A;  4HWI A;  1NWK A;  3AAP A;  4BRE A;  4JRP A;  4C1N K;  1K8K A;  3HL8 A;  4HHT A;  2HBK A;  4HTU A;  1KFS A;  4YOR A;  3TAE A;  3QEV A;  4KAZ A;  4FJI A;  3H3N O;  2HMP A;  5J2Q A;  3CC2 N;  3SQ1 A;  1SQK A;  3OS0 A;  2VG7 A;  4B9S A;  3O80 A;  2AA4 A;  2HST A;  3BEX A;  4PKG A;  1BA1 A;  1KQS M;  4FM2 A;  3IUC A;  3ZX2 A;  1TKZ A;  2OAN A;  3OYC A;  1XI1 A;  1DGK N;  1QQM A;  4FLX A;  3NBP A;  4GNI A;  3NVM A;  3KVG A;  4FZY A;  1RBR A;  3J80 O;  1BWF O;  4DS4 A;  5JLH A;  3WUH A;  2P9P A;  3DYA A;  3NDK A;  1HKG A;  1OKJ A;  1T7P A;  3L3U A;  1JXB A;  1JLE A;  1Q9Y A;  4O55 A;  2KHO A;  4XEI A;  2Y1I A;  4LF9 K;  4JK8 A;  3IG1 A;  2E1Z A;  1TVR A;  2HW3 A;  4Z4I A;  4KHW A;  3D7E O;  1X9J A;  4CJR A;  1T6C A;  2UUA K;  1RDC A;  5AQU A;  3TWH A;  5J2P A;  2OPR A;  4RWT A;  3KZB A;  4FWN A;  4KH4 A;  3SBT A;  3AVM A;  4CEQ A;  2E6L A;  3B6O A;  4FJ5 A;  4BG9 A;  2IS3 A;  1WSJ A;  4LFC K;  1B9F A;  4M3Z A;  4CI6 A;  2E6M A;  4CFA A;  1NK5 A;  3HBT A;  2DTU A;  2CGJ A;  1ESV A;  2ASM A;  2EHG A;  3TPQ A;  1A5W A;  4BC4 A;  4FO0 A;  2NRZ A;  4YDU C;  5LL6 Z;  4JI0 K;  2OZS A;  1VQ6 N;  3HP9 A;  1WUA A;  3CCU N;  2ZQB A;  1Q81 O;  4DV4 K;  3ZSQ A;  1KCF A;  3ZT1 A;  1B92 A;  2P5G A;  4FWM A;  1DT9 A;  1RBV A;  3CJC A;  3WEE A;  3SJJ A;  1C0T A;  1GOA A;  4PL7 A;  3SUN A;  4ILG B;  4B9T A;  4JK9 A;  4CZH A;  3VGL A;  4CEF A;  4H8K A;  1ASU A;  4Y1C A;  3SV3 A;  3T1Y K;  4ZTF A;  1WB9 A;  2GWJ A;  1SL0 A;  1YJW N;  2P1J A;  1NJX A;  4JI6 K;  5KPR A;  2EWS A;  3LPT A;  3O4W A;  1Z25 A;  5E26 A;  1KD1 O;  3NH2 A;  2FF6 A;  3ATV A;  5M1K A;  3VEW A;  3LP1 A;  3MN6 A;  4FWQ A;  1JKH A;  1T8E A;  1VRT A;  3TAP A;  3DXK A;  2FF3 B;  3D2F A;  3CF5 L;  3UIQ A;  2BH1 A;  4FK2 A;  2KLA A;  2VYP A;  4W5N A;  2RKI A;  2KKZ A;  4IJN A;  4WQ4 A;  1YI2 N;  3QBX A;  3ATU A;  4BRP A;  4CEZ A;  3J81 O;  1MA9 B;  5FPM A;  3OBW A;  1SKW A;  1W7A A;  4AHR A;  3NVK A;  3ZSR A;  4W5Q A;  3CD6 N;  3VQQ A;  4BE0 A;  1BGX T;  4AHS A;  3J8A A;  1S1V A;  5K14 A;  5AQS A;  1G15 A;  2XY7 A;  5TKY A;  1ZYQ A;  4FJN A;  3R8E A;  1XWL A;  5CYQ A;  3RRH A;  3QIC A;  4CFB A;  1NJZ A;  4DV6 K;  5M1O A;  4DR1 K;  3ZT0 A;  4CEB A;  4WFB L;  3FFK B;  5BRE A;  4EP5 A;  2E2N A;  3NF7 A;  1RT4 A;  2HHT A;  2F4V K;  1U49 A;  4DSF A;  4LF7 K;  4CHN A;  2QWP A;  2PAV A;  3R6M A;  4LF5 K;  4Y1D A;  3T1H K;  2JWK A;  3TAQ A;  4BDY A;  5CHI A;  1LAW A;  2E5L K;  4FM1 A;  4CES A;  1Q86 O;  3O6W A;  5CYM A;  4HTL A;  1IG8 A;  5AQV A;  1RTI A;  4CER A;  5AFU H;  1NJW A;  3PLA A;  2DFH A;  1NGI A;  4BC5 A;  3L2Q A;  2PZS A;  4CHP A;  4NO7 A;  3GL1 A;  1S6P A;  1S3X A;  4YHH K;  1YVU A;  2OPS A;  4LF4 K;  3SAG A;  2YJF A;  2E8A A;  2HBL A;  1K73 O;  4BR2 A;  3CER A;  4M3T A;  3MDQ A;  3RSE A;  3VTH A;  3MX2 A;  1K8A O;  2NNW A;  3HRG A;  3ZET B;  3WNH A;  4CK1 A;  4RG8 A;  2I7N A;  3OYJ A;  1X9S A;  2O8D B;  4OLA A;  4NLC A;  4JKA A;  3CG7 A;  4BR7 A;  3BDP A;  3CYM A;  5J2N A;  4JI4 K;  4Z4H A;  4B8A B;  3LDP A;  3KLH A;  4CBX A;  2O8E A;  3VQ9 A;  5HL7 L;  4CGH A;  2GWK A;  5FDL A;  3VF2 A;  1LW0 A;  3THX B;  5JVG L;  2A42 A;  3FE1 A;  1T6D A;  3GG4 A;  4FJM A;  5FLX O;  2OPQ A;  3J7A P;  4FL9 A;  3K5L A;  2FBX A;  3HP6 A;  2E1Y A;  3P39 A;  2HHV A;  1XQS C;  4FLU A;  5A2Q O;  4CEA A;  5IWA K;  1GLD G;  2QWN A;  4U67 L;  5LY3 A;  3EEQ A;  1QTM A;  1VQ7 N;  1NU0 A;  4LSL A;  3GDQ A;  1RT6 A;  4ID1 A;  3AVG A;  1ZBL A;  5J1E A;  5EY4 A;  4M7Y A;  1QE1 A;  4KBO A;  1D9F A;  5CE3 A;  4OLB A;  4BWM A;  1B9D A;  4M63 C;  4K0K K;  4G1Q A;  1VSE A;  5AQG A;  2P9K B;  1J54 A;  3ZSY A;  3K57 A;  2F8S A;  4M42 A;  3IDH A;  3MMV A;  5ADX H;  5SWM A;  3F9K A;  2QXF A;  3LWM A;  4FK0 A;  4B3S K;  4KTQ A;  3TAG A;  5B8H A;  4KKO A;  2IAJ A;  3CCQ N;  2HF4 A;  4BRH A;  4U7B A;  4IDK A;  1L3U A;  1GLF O;  1VQO N;  4DV1 K;  3EL2 A;  4FJ8 A;  3WXK A;  3SPZ A;  4CZJ A;  4CZF A;  1NGH A;  2P9I B;  1S72 N;  1WSI A;  2NUB A;  3ZYY X;  3S3O A;  3QNO A;  2KZZ A;  1NGA A;  5D3G A;  2HHH K;  4A5A A;  4QCL A;  4HUE A;  2PYJ A;  1VQ5 N;  5AFU A;  4PY5 A;  3O9R A;  4DR6 K;  5JMV A;  4J2D A;  1S9E A;  3CFP A;  3ZSO A;  1ZBS A;  3SZ2 A;  3AO5 A;  3DI6 A;  3HXM A;  4JI3 K;  2QM1 A;  3ZT2 A;  5GIN A;  1RCH A;  3ZX3 A;  3EE9 A;  1SL2 A;  3M8P A;  3RRG A;  3H46 O;  3FR0 A;  2O8C A;  1OVQ A;  1TAQ A;  3G6E N;  3CC4 N;  4H4O A;  5CR4 A;  3LZI A;  3ZSX A;  3LP2 A;  4KHY A;  4CGG A;  5LMN K;  3VQ7 A;  3A8Y A;  4TSX A;  4KRE A;  3H1Q A;  3I0R A;  1YTA A;  3TTD A;  1VSM A;  1YAG A;  2GEL A;  1R0A A;  5JLF A;  5KQ8 A;  3AVB A;  3SUQ A;  4H5R A;  4B9M A;  3KTQ A;  4WF9 L;  3CM6 A;  3M3Z A;  3SJH A;  1CLQ A;  4H0T B;  4IFV A;  4CW7 B;  4JN4 A;  3THY A;  3V1R A;  2E2O A;  3D2E B;  3T19 A;  3TAM A;  5GAH P;  4K43 A;  4WFN L;  1M1K O;  3HI0 A;  2D0A A;  1FXX A;  4BVP A;  3BGR A;  2NRR A;  5HOO A;  4FPB A;  2V7Z A;  4YOY A;  2XO7 A;  3KK1 A;  4WQ5 C;  1RTH A;  1JL1 A;  5C15 A;  3ZEU A;  1OH7 A;  4EZ6 A;  4GKK K;  3KD5 E;  3DXM A;  4FYD A;  3JAM O;  4ZHR A;  5DMR A;  4DTJ A;  2YNG A;  5AQR A;  5AQL A;  4BRD A;  2G8U A;  3DOL A;  4ELV A;  1HNZ K;  4CD1 A;  1Q18 A;  2A6A A;  4RW7 A;  4DF8 A;  3OYN A;  1NMD A;  3L4Q A;  4RW4 A;  3ENO A;  3O4Q A;  2ZE2 A;  3MED A;  1HYS A;  3FZK A;  3O9S A;  5ADX A;  4OGE A;  3RTV A;  1TK8 A;  1ZBI A;  1KTQ A;  3UKU A;  4DU1 A;  1IBM K;  2G8F A;  2QK9 A;  2DFE A;  1L5U A;  2LSN A;  1UOC A;  3QFP A;  5AQJ A;  3QLH A;  1S6Q A;  2O8F B;  1BU6 O;  3TAB A;  4BRF A;  2E88 A;  1D4X A;  2Z1H A;  1N6Q A;  4N47 A;  3J7Z O;  1JCG A;  4BG8 A;  2W42 A;  3C6U A;  4Z4E A;  3LDQ A;  1F21 A;  4B3T K;  3BF1 A;  1KAY A;  4OPA A;  2I7P A;  1EX4 A;  4A59 A;  3AY9 A;  2KFN A;  4CHZ A;  4FXD A;  1IKV A;  5CY4 A;  2ITG A;  2P9U B;  2YJE A;  3E1Y A;  2Z1J A;  2P9S B;  4BRN A;  1NGC A;  4NXN K;  2R7Y A;  3LWL A;  4IKF A;  1VHX A;  4Z0U A;  4IJA A;  4CF8 A;  4CGJ A;  3MX5 A;  3IKM A;  5BR8 K;  1ATR A;  3MN5 A;  3K59 A;  4XH4 A;  4DU4 A;  4LSN A;  3G71 N;  2F96 A;  4DR2 K;  2Y1J A;  1IV0 A;  4DR3 K;  1DEJ A;  1HYZ A;  3M8R A;  1W9H A;  2ASP A;  2NRT A;  3O08 A;  1QSS A;  5KRS A;  4F2R A;  2OTJ N;  3CC7 N;  1YTU A;  1KVC A;  2VGN A;  4JHD A;  4B3M K;  4I2P A;  1KRP A;  1BI4 B;  4LFB K;  3TAR A;  1HNX K;  2UUB K;  4O4G A;  4IWV A;  2UXC K;  3NF6 A;  5JIC A;  2PY5 A;  3AVK A;  3WXI A;  1RNH A;  1TUY A;  2G8I A;  3ITH A;  4CJP A;  4UQG A;  4XIU A;  2UU9 K;  3MCP A;  2UXB K;  4H03 B;  3E66 A;  5C42 A;  5BR9 A;  3QES A;  4AM7 A;  3QEW A;  3DWL A;  1VSK A;  2GEM A;  4CZM A;  3CJB A;  2WUS A;  1Z6R A;  1BUP A;  1S1T A;  3SMP A;  4BRI A;  4JD2 B;  3I55 N;  3DAW A;  3VEO A;  5AQT A;  2W40 A;  3KLF A;  3VF4 A;  3QML A;  4AQY K;  1NOY A;  4C8M A;  2YHW A;  4DUZ K;  3L2W A;  4FM0 A;  4FZZ A;  4G9Z A;  2DPN A;  1N8R O;  2HVI A;  2Q0U A;  1WLJ A;  2XHB A;  2GTD A;  4M3X A;  1KAX A;  4YOT A;  3OYB A;  1U4B A;  4N41 A;  4FSV A;  4FVU A;  4Z4C A;  1D5A A;  2JLE A;  1SKR A;  4DSI A;  3F73 A;  5BPL A;  4WE1 A;  4DF4 A;  4CEC A;  4FWS A;  4YDU A;  4I7F A;  5JVH L;  3G0Z A;  1CZA N;  4FLW A;  3WNE A;  3HJF A;  3HPO A;  1W97 L;  4IZ9 A;  3MK6 A;  3WNF A;  1N32 K;  1QSY A;  3THW B;  3RMB A;  1ZBH A;  3GOI A;  3HOS A;  4KRF A;  5BPN A;  1KSP A;  3V1Q A;  2ETJ A;  3CJ7 A;  3PSF A;  1C0U A;  3SCX A;  1HRH A;  5AZI A;  3W0L A;  3LDO A;  3LAN A;  3QEI A;  4ZTJ A;  3WQT A;  3SMS A;  1ATN A;  2YKM A;  4CZG A;  4E3S A;  1MWM A;  1SV5 A;  1HYV A;  2D0P A;  4DQS A;  4DFK A;  2Q97 A;  3SLC A;  4DB3 A;  3OYE A;  2FXU A;  4CJS A;  3I56 N;  3CCR N;  2V51 B;  2W6L A;  4PKI A;  1IG9 A;  3TSU A;  4NCA A;  3C0B A;  3VMF B;  3E9O A;  2OZM A;  1RFQ A;  3K0S A;  4MLE A;  3OY9 A;  3ZT4 A;  4MDA A;  1JLQ A;  3QET A;  1S1U A;  4C8L A;  3SNN A;  4Z4F A;  1XC3 A;  1Q8I A;  2A1S A;  2OA8 A;  1WBB A;  5F0X A;  2FBV A;  2NRV A;  4CJF A;  4CIF A;  3W3D A;  4DQ8 A;  4YNQ A;  3SQ0 A;  4B1Y B;  1YVN A;  2I5J A;  2X6S A;  1H1V A;  4BRQ A;  4DR7 K;  1SS6 A;  3O1W A;  4WCE L;  3PO4 A;  2FC0 A;  4NCG A;  3I33 A;  4DSE A;  1XHX A;  3PX4 A;  3NF9 A;  2EX3 A;  4OPH A;  3KK7 A;  5F1X A;  2GBZ A;  2D0O A;  4DFM A;  1IKW A;  1WSG A;  1BO5 O;  3D6R A;  4OJR A;  4JKG B;  3V9U A;  4A2B A;  3WQU A;  1BIU A;  4CHY A;  3ZLJ A;  1YJN N;  3DM2 A;  1TYQ B;  1KC8 O;  1XUP O;  4CK3 A;  4JRQ A;  3AV9 A;  3TR8 A;  1S1W A;  3ULD A;  4DSJ A;  1LW2 A;  2B4J A;  4DV3 K;  3VER A;  3QIN A;  1TGO A;  4JI7 K;  1QVF M;  4DCH A;  5GAE P;  1RBU A;  3IRX A;  1EO1 A;  2CH6 A;  1S1X A;  1NK6 A;  3AVJ A;  2BUP A;  2YHX A;  3OYI A;  5AQP A;  2BAN A;  1U6Z A;  4YY3 K;  3QIO A;  3E01 A;  3KHY A;  1BG3 A;  2G8V A;  4CHQ A;  4KHP K;  3PO5 A;  2YHY A;  4CJL A;  4KHS A;  1KVA A;  3R1X A;  3FFI A;  3AGR A;  3DLG A;  1GLL O;  2GUP A;  3VGK A;  4DS5 A;  1QZ5 A;  2HMI A;  4KB1 A;  3L8B A;  2A40 A;  4CJ7 A;  2B5J A;  3NGI A;  3V81 A;  4BRL A;  4I6M B;  2ATQ A;  4AHC A;  4FJL A;  3JSM A;  3HYF A;  4CGI A;  1J5E K;  3GE1 A;  2Q36 A;  4KFB A;  3VQE A;  4DQQ A;  2Z1G A;  3AA5 X;  1HR0 K;  4WFA L;  3U9Z A;  3HK2 A;  1W0H A;  4X65 K;  5LJV A;  3IS9 A;  1I39 A;  1HNI A;  5C25 A;  3MWP A;  1HNV A;  1D8Y A;  4QS8 A;  5CZ2 A;  2HNY A;  3VEY A;  4ELU A;  1LWF A;  3HZ6 A;  3OYF A;  4CEE A;  1X9M A;  1N34 K;  3LP3 A;  3K5O A;  1Z26 A;  2BDP A;  3C6T A;  3SYZ A;  3U3Y A;  3QO9 A;  2HBM A;  5KGX A;  5JS1 A;  4RCH A;  1NLV A;  4ELT A;  1UAX A;  3HSC A;  4DV2 K;  4EZ9 A;  1I3A A;  4F3T A;  3QIP A;  4JEP A;  3AO2 A;  3CQ8 A;  3VQB A;  1E4G T;  2D0C A;  3GBT A;  3NH0 A;  1YT3 A;  2V7Y A;  4X64 K;  2X74 A;  3L2R A;  3G25 A;  3C6H A;  1YXQ A;  1HJO A;  5KTQ A;  1TAU A;  1IBL K;  1CXU A;  4JI5 K;  1T3V A;  3OJU A;  3PUF A;  3OJS A;  1VRU A;  3HTV A;  3MEE A;  3V6D A;  1C1A A;  2WON A;  2ZJR L;  3HST B;  4E19 A;  4B1Z A;  4FK4 A;  3KIO A;  1NK0 A;  5FRM A;  1GLJ O;  2HHQ A;  4E7I A;  3PX0 A;  4E7H A;  4DTP A;  3MN9 A;  1IKX A;  1TKT A;  3U3G A;  4YOX A;  1XC9 A;  4FCY A;  5J2M A;  1QSL A;  2QXL A;  2O4I A;  1VSH A;  3WT0 A;  3UKR B;  4LF6 K;  1GLB G;  3DLK A;  3DLE A;  2QA4 N;  3KLG A;  1MDU B;  1KVB A;  3VEX A;  4IFE A;  5C10 A;  1RDB A;  2A41 A;  4IOC L;  3RMD A;  4MDB A;  4O0I A;  4AHT A;  4R5P A;  4IBN A;  4B9U A;  4A2A A;  3ZSZ A;  3CFR A;  4DTO A;  1VQ4 N;  1NGG A;  5EVZ A;  5AQI A;  4N5S A;  3TTF A;  3G4S N;  3ZCM A;  3PSI A;  3ZET A;  2HB5 A;  4IO9 L;  4GV6 A;  3T1A A;  1RTD A;  2O8D A;  1NM1 A;  4V19 S;  4IG3 A;  2NRW A;  4PHT X;  5IT9 O;  1RT7 A;  4MO4 A;  2Q0R A;  1LAV A;  3LPU A;  1WBD A;  3U6F A;  4KH5 A;  1BCM A;  3SK3 A;  3OBY A;  4O44 A;  3T7Z A;  3ZSV A;  1NGJ A;  1A5X A;  1VQP N;  3QNN A;  4NXM K;  2DFF A;  2YCH A;  3THX A;  2VWK A;  2QWM A;  2F8T A;  5M1F A;  2QWQ A;  4UY8 O;  4J2E A;  3OYG A;  1FJG K;  2UUC K;  2QW9 A;  3VGM A;  1X9W A;  1L3S A;  3KWI A;  4ICL A;  3M5R A;  1EP4 A;  3FZL A;  3O4N A;  4YOU A;  4JLH A;  3TSP A;  3QB0 A;  4BRG A;  3SQ2 A;  4C1N I;  1S22 A;  2ZWH A;  2HVH A;  1YIT N;  3EZ5 A;  5C12 A;  2IC3 A;  2YX6 A;  2VWB A;  3AVL A;  3CI5 A;  3MWT A;  3MEC A;  3O3F A;  2D5R A;  3QEP A;  4DTN A;  1T44 A;  1JXE A;  5E84 A;  3LM2 A;  3DLB A;  1JCF A;  4ISG A;  1RT2 A;  2P9K A;  1XMQ K;  3CET A;  3DLR A;  4MFB A;  4I2Q A;  3KKS A;  4B08 A;  2KQ2 A;  3VTI A;  4JYA K;  4BE1 A;  2HHX A;  4RTF D;  3CCE N;  4OKJ A;  4BQL A;  3M8S A;  1QVG M;  1TL3 A;  4WQ5 A;  5FPD A;  1QQN A;  3AA3 A;  4L3Q A;  5AQF A;  3D45 A;  1OH6 A;  3VEZ A;  4BRA A;  3KK2 A;  4CF0 A;  2O8B B;  4BRC A;  2BTF A;  1WAJ A;  1NJI O;  4DR5 K;  1VQM N;  1WSF A;  2E2Q A;  3CJA A;  4EHT A;  2P9I A;  1U45 A;  4B1W B;  3EKS A;  4GV9 A;  3G10 A;  3ID6 A;  1GLE G;  5KRT A;  2X6N A;  1TK5 A;  1S9G A;  4DV0 K;  3EY1 A;  2O8C B;  3DRP A;  4N76 A;  1J6Z A;  1LV5 A;  3VF6 A;  3P38 A;  5AQO A;  5KPT A;  3O3H A;  4NYF A;  3BP8 A;  2JWL A;  4CED A;  3RMA A;  1TUU A;  3ULE B;  1MWK A;  3V1O A;  5AQM A;  3OYL A;  3AVC A;  3NGY A;  1GLA G;  5T7B A;  4HCB A;  3MEG A;  1A5V A;  1WN7 A;  4LY7 A;  4Y0W A;  3CCL N;  3M1F A;  3IAY A;  4W5T A;  4GKJ K;  1SL1 A;  3AVN A;  4IDH A;  4DG1 A;  3VN5 A;  4M7X A;  1IH7 A;  2PYL A;  3C7N B;  1ZBU A;  4H5W A;  3S3N A;  3CME N;  1JLB A;  4F3O A;  3V9W A;  3EN9 A;  3ZEU B;  1C0F A;  3NAE A;  5AQQ A;  1JL2 A;  2NRX A;  4RW6 A;  3D0P A;  2FLO A;  4JK7 A;  4B8C A;  3D2E A;  4EP4 A;  1OH8 A;  4OPJ A;  1TK0 A;  4YOV A;  1YIJ N;  3OHR A;  2WC9 A;  1C6V A;  4BRO A;  4FVM A;  4DHY A;  2ZJP L;  4CHO A;  1SZ2 A;  4W5R A;  1LWC A;  1UA0 A;  3DMJ A;  3DRS A;  4X62 K;  1X3N A;  3RWU A;  2FBT A;  3SBG A;  3VES A;  1QZ6 A;  5GAG P;  2P9L B;  3AGK A;  2P9N B;  1NOZ A;  2IGI A;  4AF1 A;  4ISE A;  4OO1 J;  3VQA A;  1T05 A;  5AJ3 K;  1WOQ A;  2XRI A;  3NH1 A;  4B9V A;  1LWE A;  4DMN A;  1XMO K;  4H5V A;  4KTZ A;  4MQ3 A;  1GOC A;  2KFZ A;  1R59 O;  4YOW A;  3F9M A;  4O8U A;  4BC3 A;  3VET A;  5EOY A;  5AZJ B;  1V4S A;  5FRO A;  3E9P A;  5C24 A;  5EX5 A;  4M3W A;  1HKC A;  5GIP A;  4K8Z A;  1NKC A;  2O8F A;  1NBW A;  3EYZ A;  4CZK A;  4E1J A;  2OPP A;  1JJ2 M;  4JS4 A;  3AAQ A;  2VG6 A;  4CE9 A;  1Z05 A;  3KKR A;  1GOB A;  4K8X A;  1JCE A;  2KZM A;  1U2V B;  3Q7C A;  1RBS A;  4J8F A;  3KWG A;  3VEN A;  2P9U A;  3LP0 A;  4MLH A;  4Z94 A;  2P9S A;  3AA2 A;  3H08 A;  4FJG A;  2Q31 A;  2IVN A;  4ILH A;  3AO3 A;  4BE2 A;  3V9X A;  3RVC A;  3SPY A;  4IFY A;  1E3M A;  4FJJ A;  1NGB A;  1X1P A;  4CIE A;  5DM6 L;  4FJK A;  1J5O A;  4IEE A;  2G8H A;  4DQR A;  3RR7 A;  1HUX A;  1TKX A;  1HKB A;  1RDW X;  3VQ5 A;  4PL8 A;  5M1P A;  3OA9 A;  3BUZ B;  4I9Q A;  1P90 A;  4RW9 A;  1T03 A;  4WYB A;  1ZBF A;  5FRN A;  3C94 A;  3P5J A;  3MAQ A;  5I3U A;  1NG9 A;  1BI4 A;  2IVO A;  4N56 A;  4CJV A;  3MN7 A;  2J4R A;  4NLB A;  2YHA A;  1D9D A;  3QBW A;  5HRO A;  2G8K A;  2RF2 A;  5EU7 A;  4DTS A;  3IFR A;  5AQN A;  1OVY A;  3LL3 A;  1WSH A;  2WBN A;  2YV0 X;  3CCM N;  1ILY A;  4C8K A;  1K8K B;  4DTR A;  4BGA A;  1VQ8 N;  3AO1 A;  2ZJQ L;  1HQE A;  5C2F A;  1BOT O;  4AHU A;  3LAK A;  4JD2 A;  5HRP A;  3A5L C;  4LC9 B;  1ZC6 A;  4H4M A;  3F2K A;  3CQX A;  4DQI A;  3LDL A;  3BY5 A;  5MLC Q;  4CJQ A;  1RGI A;  5FPN A;  3T69 A;  3SQ4 A;  4M45 A;  2VQE K;  5HBM A;  3J7Y P;  2D1K A;  4FWR A;  3R9P A;  3O5B A;  4KO0 A;  1VAZ A;  1DTT A;  2A5X A;  1KFD A;  3KJV A;  4CBU A;  4OX9 K;  5SZT A;  1QS4 A;  5AZI B;  4JAX A;  3VA0 A;  2P9P B;  2ZD1 A;  3R3L A;  1HLU A;  3C65 A;  4H5N A;  4BR4 A;  3SUO A;  1N5Y A;  3EZW A;  3RMC A;  3WXJ A;  5BN8 A;  3AVA A;  4DSL A;  1C0G A;  5I42 A;  4BQZ A;  5HRS A;  3OS1 A;  3THW A;  2ZF5 O;  3B8A X;  1RTJ A;  3RR8 A;  4PQU A;  3Q7B A;  3HOT A;  1UWB A;  3AO4 A;  3V9Z A;  3TI0 A;  3CQY A;  2WOM A;  3NGZ A;  4KH6 A;  3H6E A;  3NF8 A;  1O13 A;  3MXI A;  2Q3S A;  3NMU A;  4CEO A;  4GVE A;  4C8N A;  2HHS A;  3MCA B;  1NK9 A;  4BY9 C;  2DY4 A;  3OTO K;  3ENB A;  1YF5 L;  1C1C A;  3CJ1 A;  4CF1 A;  4AHV A;  3AVH A;  3H1V X;  3LM9 A;  3AA4 A;  2F9W A;  2HHW A;  1BQN A;  4YFU A;  3U4L A;  4K41 A;  5KPZ A;  3K2P A;  4JI2 K;  2QKK A;  1IKY A;  1Q9X A;  3EE8 A;  3VOV A;  1KLM A;  4M3R A;  4FOE A;  4OVL A;  3CIP A;  1NGE A;  3H3O B;  1WAF A;  4JKD A;  1Y97 A;  1MU2 A;  1L3T A;  3PIO L;  4B1U B;  2YI1 A;  1ASW A;  4BAC A;  4CCH A;  3O8M A;  1VSD A;  3WEE B;  3LAL A;  3O3G A;  4OPK A;  3JXU A;  2YHB A;  4K42 A;  4BWJ A;  2QEX N;  3P31 A;  4E7K A;  1U48 A;  1EWR A;  3ENH A;  3PY8 A;  3OS2 A;  3QEX A;  3ISN C;  1GLC G;  4JKG A;  2QWO A;  5BRF A;  5FPE A;  3P83 D;  4AM6 A;  4F8R A;  2CGK A;  3A0I X;  3EO3 A;  3P4I A;  4FWL A;  3HT3 A;  4J2B A;  1TYQ A;  1VQ9 N;  4ID5 A;  1NKB A;  5JS2 A;  2CH5 A;  3OW2 M;  4IO8 A;  5LMU K;  2OYQ A;  2KTQ A;  4GVM A;  2WTU A;  1NGF A;  1RIL A;  4CZL A;  4KB0 A;  4RW8 A;  2W41 A;  3DOK A;  3VQD A;  2IVP A;  3DXK B;  4DLG A;  1J9A A;  2JGU A;  3D2F B;  1K9M O;  3QER A;  1VK0 A;  5BRD A;  4KI6 A;  5CZ1 A;  1NMN A;  3FZF A;  2OTL N;  1HPM A;  3CCJ N;  4LFA K;  4E89 A;  3N4P A;  1VQL N;  4HCC A;  1BA0 A;  4JI1 K;  3C95 A;  1BIZ A;  2E2P A;  2HOE A;  4CK2 A;  2E4L A;  4CVN E;  2B6A A;  1M90 O;  4DFP A;  2A3Z A;  5ELZ A;  4I6M A;  2OCE A;  5BRH A;  3OYD A;  3T3F A;  4LH5 A;  4GW6 A;  1HNW K;  3ASM A;  3FLC O;  3P1G A;  5HRR A;  5I9E B;  4H0Y B;  4QS7 A;  2PFU A;  5BPM A;  1Y64 A;  2GUI A;  4FWK A;  3DLH A;  3DLL L;  4CFD A;  4IEI A;  1L3V A;  5LJW A;  4M3Y A;  2Q1N A;  4BC2 A;  4CJ5 A;  3KK3 A;  5KQD A;  3JS6 A;  3M8Q A;  1EXQ A;  1BIS A;  4IXC A;  2P51 A;  1ITG A;  2HF3 A;  4PKH A;  4O8K A;  1N33 K;  4ILJ A;  1SAZ A;  4MO5 A;  4I9L A;  4CF2 A;  4B1V A;  1XHZ A;  3AVI A;  1HQU A;  2BGG A;  5C2D A;  2NLX A;  3UB5 A;  4KI4 A;  1G99 A;  1QHT A;  3VQP A;  3EKU A;  2PBD A;  5AR0 A;  4CJ4 A;  4R79 A;  2D4W A;  4CBW A;  3AVF A;  3HO1 A;  1NK7 A;  3S9H A;  3S3M A;  4BR5 A;  4DLE A;  4JKB A;  2FSN A;  4ISF A;  5AQX A;  4DTU A;  2YNF A;  5AQW A;  3NE6 A;  4DV5 K;  5AQK A;  1QHA A;  3I0S A;  4BR9 A;  3RSE B;  4BR0 A;  4FLV A;  2D0B A;  4L8R B;  3CXC M;  5EXW A;  3MXM A;  4B9N A;  1OH5 A;  3O9Q A;  4F2S A;  1FW6 A;  3CPE A;  1FKO A;  4CF9 A;  3CCV N;  2XY8 A; 
#chains in the Genus database with same CATH homology
 3OYL A;  2ZQB A;  2G8I A;  3ITH A;  3ZSQ A;  4CJP A;  1EKE A;  3AVC A;  3NGY A;  4UQG A;  1KCF A;  3ZT1 A;  4XIU A;  1B92 A;  5T7B A;  4E1M A;  1NJY A;  3MEG A;  1A5V A;  1SUQ A;  2P5G A;  4HCB A;  1WN7 A;  1RBV A;  4LY7 A;  5C42 A;  3SJJ A;  2VG5 A;  3QES A;  2YKN A;  3QEW A;  1C0T A;  1GOA A;  3SUN A;  5KGW A;  4W5O A;  1VSK A;  2VWJ A;  4W5T A;  4B9T A;  3IAY A;  1UA1 A;  1SL1 A;  3AVN A;  4DG1 A;  4CEF A;  4H8K A;  3VN5 A;  1VSF A;  1ASU A;  1RDD A;  1IH7 A;  4Y1C A;  4FJH A;  4FLT A;  2O4G A;  4KV8 A;  3LDS A;  2PYL A;  1S1T A;  3SV3 A;  4BDP A;  2IDO A;  4ZTF A;  4FJX A;  1J53 A;  4Q5V A;  4DU3 A;  1ZBU A;  1WNS A;  3PX6 A;  4Z4G A;  3KLF A;  1SL0 A;  1NOY A;  3S3N A;  1JLB A;  2P1J A;  3V9W A;  1NJX A;  4F3O A;  4C8M A;  1HMV A;  3NAE A;  3L2W A;  4FLY A;  1JL2 A;  4CFC A;  3LPT A;  4FM0 A;  4FZZ A;  4RW6 A;  4KHU A;  1O1W A;  2HVI A;  3D0P A;  1Z25 A;  1WLJ A;  3NH2 A;  2XHB A;  4B8C A;  4M3X A;  1RDA A;  3OYB A;  1U4B A;  4N41 A;  3L2U A;  4EP4 A;  3HM9 A;  4Z4C A;  1D5A A;  2JLE A;  4OPJ A;  1TK0 A;  4HUF A;  1SKR A;  3LP1 A;  4DSI A;  1JKH A;  3F73 A;  1VRT A;  4FW1 A;  1C6V A;  4WE1 A;  3TAP A;  4FVM A;  4DF4 A;  2Z1I A;  5HLF A;  3KLE A;  3UIQ A;  4CHO A;  3NCI A;  4CEC A;  4W5R A;  2KW4 A;  1HJR A;  3A2F A;  1LWC A;  4I7F A;  1UA0 A;  3G0Z A;  4FK2 A;  4CJK A;  3DMJ A;  4FLW A;  3DRS A;  3WNE A;  3V9S A;  3HJF A;  3HPO A;  4W5N A;  3WNF A;  3RWU A;  2FBT A;  2RKI A;  1QSY A;  4CEZ A;  3RMB A;  1ZBH A;  1NOZ A;  1SKW A;  2IGI A;  4KRF A;  1KSP A;  4AHR A;  3V1Q A;  3B6P A;  2ETJ A;  3VQA A;  3ZSR A;  4W5Q A;  1T05 A;  2XRI A;  3NH1 A;  1C0U A;  3VQQ A;  3SCX A;  4BE0 A;  1BGX T;  1HRH A;  1LWE A;  4AHS A;  1S1V A;  3LAN A;  4KTZ A;  5K14 A;  4DMN A;  3QEI A;  4MQ3 A;  4ZTJ A;  1G15 A;  1GOC A;  2YKM A;  2XY7 A;  4E3S A;  2P5O A;  2KFZ A;  1ZYQ A;  1SV5 A;  4QAG A;  3HPH A;  1HYV A;  4DQS A;  4DFK A;  2YNI A;  4O5B A;  4FJN A;  1EET A;  3LZJ A;  4FLZ A;  1XWL A;  5CYQ A;  5FRO A;  3OYE A;  4CJS A;  3I8D A;  5DK5 A;  3RRH A;  4CFB A;  3V4I A;  1NJZ A;  4FJ7 A;  3ZT0 A;  4CEB A;  1IG9 A;  5C24 A;  4M3W A;  4NCA A;  4QOZ B;  4EP5 A;  4K8Z A;  3NF7 A;  1RT4 A;  2OZM A;  2HHT A;  1NKC A;  3VQ6 A;  4DSF A;  1U49 A;  4CHN A;  3SI6 A;  3OY9 A;  4PA1 A;  3ZT4 A;  3EYZ A;  2OPP A;  3KD1 E;  1HPZ A;  4JS4 A;  2VG6 A;  4CE9 A;  1JLQ A;  3QET A;  1S1U A;  4C8L A;  3KKR A;  1KLN A;  4Y1D A;  1GOB A;  3SNN A;  1IO2 A;  1DLO A;  4K8X A;  4Z4F A;  1TV6 A;  4HUG A;  3TAQ A;  1Q8I A;  5HP1 A;  1JLG A;  4BDY A;  4FJ9 A;  2KZM A;  1LAW A;  2A1S A;  2OA8 A;  1RBS A;  2FBV A;  3LP0 A;  4CJF A;  4CIF A;  2GV9 A;  4FM1 A;  4CES A;  1JLA A;  3AA2 A;  3H08 A;  4FJG A;  4YNQ A;  4JS5 A;  3SQ0 A;  5CYM A;  2G8W A;  2I5J A;  2X6S A;  1REV A;  3AO3 A;  4BE2 A;  1RTI A;  3V9X A;  3SPY A;  4IFY A;  4CER A;  4FJJ A;  1X1P A;  1NJW A;  3PO4 A;  2FC0 A;  4NCG A;  2DFH A;  4CIE A;  1XHX A;  4BDZ A;  1FKP A;  4DSE A;  3L2Q A;  4DTX A;  3NF9 A;  2EX3 A;  4CHP A;  2PZS A;  1J5O A;  4FJK A;  4CJU A;  2GBZ A;  1S6P A;  3K5M A;  1CZ9 A;  2G8H A;  3DRR A;  3VQ4 A;  4DFM A;  4DQR A;  4IG0 A;  1IKW A;  1WSG A;  1TKX A;  4OJR A;  1RBT A;  3RR7 A;  3VQ5 A;  1YVU A;  1CZB A;  2OPS A;  3V9U A;  4M41 A;  4AH9 A;  1BCO A;  4E7J A;  2A1R A;  1BIU A;  4CHY A;  4I9Q A;  4RW9 A;  3VQ8 A;  4DWI A;  3DM2 A;  4CGF A;  1T03 A;  1T8E A;  1ZBF A;  5FRN A;  4CK3 A;  3C94 A;  4M3T A;  4JRQ A;  3AV9 A;  3P5J A;  3MAQ A;  5I3U A;  3TR8 A;  1S1W A;  3ULD A;  1BI4 A;  3WNH A;  4CK1 A;  3OYM A;  4CJE A;  4RG8 A;  4DSJ A;  1LW2 A;  2B4J A;  4CJV A;  4N56 A;  3TAF A;  3OYJ A;  3QIN A;  1TGO A;  2XY5 A;  1RBU A;  3IRX A;  1X9S A;  3CM5 A;  2YHA A;  1NK8 A;  4OLA A;  1D9D A;  1S1X A;  1RT1 A;  2RN2 A;  4E1N A;  1NK6 A;  5HRO A;  3CG7 A;  1RT3 A;  1ASV A;  3BDP A;  3AVJ A;  2G8K A;  2RF2 A;  3CYM A;  3VQC A;  3OYI A;  5EU7 A;  4DTS A;  2BAN A;  5J2N A;  4AIL C;  4B9L A;  4Z4H A;  4B8A B;  3KLH A;  3QIO A;  1WSH A;  3E01 A;  3VQ9 A;  3PX4 A;  1FK9 A;  4CGH A;  2G8V A;  5FDL A;  2YV0 X;  4CHQ A;  1LW0 A;  1WSE A;  4C8K A;  3PO5 A;  4CJL A;  4KHS A;  4DTR A;  4KTW A;  1KVA A;  1JLF A;  3JYT A;  4B3O A;  3FFI A;  3DLG A;  4FJM A;  3VA3 A;  3AO1 A;  2OPQ A;  4DS5 A;  2HMI A;  1HQE A;  3HPG A;  5KI6 A;  4AHU A;  5HRP A;  3LAK A;  4KB1 A;  3L8B A;  4B9V A;  3OYH A;  3K5L A;  2B5J A;  2FBX A;  4H4M A;  3NGI A;  1CXQ A;  3HP6 A;  3V81 A;  4DQI A;  2YNH A;  4CJQ A;  4KPY A;  4FLU A;  2HHV A;  3CFO A;  2ATQ A;  4AHC A;  4CEA A;  1RT5 A;  3PV8 A;  4FJL A;  3JSM A;  4J2A A;  3HYF A;  3ZT3 A;  4CGI A;  1VSL A;  3SQ4 A;  2IOC A;  4M45 A;  3L2V A;  4KFB A;  5HBM A;  1QTM A;  3VQE A;  5E41 A;  4DQQ A;  4PWD A;  2Z1G A;  3AA5 X;  4NYN A;  1K6Y A;  4NCB A;  4KO0 A;  4LSL A;  1DTT A;  1RT6 A;  1KFD A;  2HNZ A;  4ID1 A;  3OYA A;  3KJV A;  3HK2 A;  1W0H A;  3AVG A;  5J1E A;  1ZBL A;  4F4K A;  5SZT A;  4LD0 A;  1QS4 A;  3NFA A;  1QE1 A;  1I39 A;  3IS9 A;  1SKS A;  2AJQ A;  1HNI A;  3VA0 A;  5C25 A;  1D9F A;  4OLB A;  4BWM A;  1B9D A;  1HNV A;  2ZD1 A;  1BHL A;  2BE2 A;  4G1Q A;  3ZSW A;  4E7L A;  1VSE A;  1D8Y A;  4DQP A;  5CZ2 A;  4Q0B A;  1J54 A;  3ZSY A;  3OYK A;  3K57 A;  2HNY A;  2F8S A;  1N5Y A;  3SUO A;  4M42 A;  2HHU A;  4ELU A;  1LWF A;  3RMC A;  3AVA A;  4DSL A;  3OYF A;  4CEE A;  4HVJ A;  3SV4 A;  1X9M A;  3LP3 A;  3K5O A;  5SWM A;  1Z26 A;  5HRS A;  5I42 A;  3OS1 A;  3F9K A;  2BDP A;  1DTQ A;  1JLC A;  2QXF A;  3C6T A;  3SYZ A;  3LWM A;  3U3Y A;  3QO9 A;  3RR8 A;  1BL3 A;  1RTJ A;  3ALY A;  5KGX A;  4DSK A;  4KTQ A;  4FK0 A;  4ELT A;  4PQU A;  4FW2 A;  1UAX A;  3TAG A;  4KKO A;  1UWB A;  2IAJ A;  2RPI A;  3AO4 A;  3MXJ A;  4CGD A;  3V9Z A;  4O0J A;  3TI0 A;  3K58 A;  2WOM A;  4IDK A;  3NGZ A;  1TKD A;  1L3U A;  4EZ9 A;  1I3A A;  4F3T A;  3QIP A;  4DFJ A;  3NF8 A;  3MXI A;  2Q3S A;  3AO2 A;  4CEO A;  3NHG A;  3TAN A;  4C8N A;  3CQ8 A;  3L3V A;  3VQB A;  2D0C A;  2X78 A;  3NH0 A;  1NK9 A;  4FJ8 A;  1YT3 A;  3SPZ A;  2HHS A;  2DY4 A;  3K5N A;  2X74 A;  3L2R A;  2XY6 A;  1C1C A;  1WSI A;  3THV A;  4CF1 A;  2NUB A;  4AHV A;  4FZX C;  3S3O A;  5KTQ A;  3AVH A;  2QKB A;  1TAU A;  4KHN A;  3QNO A;  1CXU A;  3AA4 A;  2KZZ A;  2HHW A;  4OGC A;  4CJW A;  1BQN A;  4YFU A;  5D3G A;  3OJU A;  4QCL A;  4HUE A;  3PUF A;  2PYJ A;  4PUO A;  3OJS A;  1VRU A;  3K2P A;  2QKK A;  4PY5 A;  2FBY A;  3WNG A;  3MEE A;  1IKY A;  3V6D A;  1Q9X A;  1C1A A;  2WON A;  3SUP A;  3HVR A;  1KLM A;  4M3R A;  4OVL A;  4J2D A;  1S9E A;  4CJT A;  3HST B;  1C1B A;  3CFP A;  3ZSO A;  3SZ2 A;  3AO5 A;  3DI6 A;  4E19 A;  4FK4 A;  1S5J A;  1WAF A;  3KIO A;  1NK0 A;  3HXM A;  5FRM A;  1Y97 A;  2HHQ A;  1MU2 A;  4E7I A;  3PX0 A;  3ZT2 A;  1L3T A;  4KHQ A;  1RCH A;  3HVT A;  1QQC A;  4E7H A;  4DTP A;  1IKX A;  1SL2 A;  1TKT A;  3M8P A;  3U3G A;  3RRG A;  1ASW A;  1TAQ A;  4BAC A;  4CCH A;  1XC9 A;  1VSD A;  4FCY A;  5J2M A;  1QSL A;  2O4I A;  3OVN A;  3LAL A;  3O3G A;  4H4O A;  1VSH A;  3KLI A;  4OPK A;  2YHB A;  2HND A;  3DLK A;  3DLE A;  3LAM A;  4OKK A;  4BWJ A;  3ZSX A;  3LZI A;  3KLG A;  4E7K A;  1U48 A;  1KVB A;  3LP2 A;  4KHY A;  3PY8 A;  4CGG A;  3VQ7 A;  3OS2 A;  3QEX A;  1RDB A;  3ISN C;  4TSX A;  4KRE A;  3I0R A;  3RMD A;  1YTA A;  4C8O A;  4O0I A;  4AHT A;  1VSM A;  4R5P A;  3P83 D;  4IBN A;  1R0A A;  4B9U A;  4M3U A;  3ZSZ A;  3CFR A;  4F8R A;  1BQM A;  4DTO A;  3AVB A;  4DTM A;  3SUQ A;  1NK4 A;  5JS1 A;  4CJ3 A;  4N5S A;  3HT3 A;  1NKE A;  4J2B A;  4LH4 A;  1VSJ A;  4B9M A;  3KTQ A;  3ZCM A;  3CM6 A;  4ID5 A;  1NKB A;  2HB5 A;  1CLQ A;  5JS2 A;  4E0D A;  3T1A A;  1RTD A;  4IFV A;  1U04 A;  5HRN A;  4OKE A;  2OYQ A;  2KTQ A;  4GMJ B;  4IG3 A;  3V1R A;  3T19 A;  1TL1 A;  4GVM A;  3TAM A;  1RIL A;  4KB0 A;  1RT7 A;  4RW8 A;  1LAV A;  2D0A A;  1FXX A;  3DOK A;  3LPU A;  3VQD A;  4CIG A;  3BGR A;  4DLG A;  1J9A A;  2JGU A;  3U6F A;  1U47 A;  1VSI A;  1BCM A;  4O44 A;  3QER A;  3ZSV A;  2XO7 A;  3KK1 A;  1RTH A;  1JL1 A;  1A5X A;  1C0M A;  1VK0 A;  4KI6 A;  5CZ1 A;  4EZ6 A;  4JRP A;  3KD5 E;  4E89 A;  4FYD A;  4ZHR A;  3QNN A;  2DFF A;  3HL8 A;  2VWK A;  4HHT A;  2F8T A;  5DMR A;  4HTU A;  4HCC A;  1KFS A;  4DTJ A;  3TAE A;  3QEV A;  4KAZ A;  4FJI A;  4J2E A;  2YNG A;  3C95 A;  3OYG A;  5J2Q A;  3SQ1 A;  1BIZ A;  3OS0 A;  2VG7 A;  2G8U A;  4B9S A;  3DOL A;  4ELV A;  1X9W A;  4CK2 A;  2E4L A;  1L3S A;  4ICL A;  4RW7 A;  2B6A A;  1EP4 A;  4DF8 A;  3O4N A;  3OYN A;  4DFP A;  4JLH A;  4RW4 A;  3SQ2 A;  3OYD A;  4FM2 A;  3O4Q A;  2ZE2 A;  3T3F A;  4LH5 A;  4GW6 A;  1TKZ A;  3ASM A;  3MED A;  3OYC A;  1HYS A;  3P1G A;  1XI1 A;  5HRR A;  2HVH A;  4OGE A;  3RTV A;  1TK8 A;  3EZ5 A;  1ZBI A;  1KTQ A;  4DU1 A;  2IC3 A;  3AVL A;  4FLX A;  2G8F A;  2QK9 A;  3NBP A;  2DFE A;  2GUI A;  1L5U A;  3MEC A;  4FZY A;  3DLH A;  3O3F A;  2D5R A;  1RBR A;  1UOC A;  2LSN A;  4CFD A;  3QEP A;  4DTN A;  1L3V A;  1JXE A;  3QLH A;  4DS4 A;  1S6Q A;  3TAB A;  1N6Q A;  2Z1H A;  3DLB A;  3DYA A;  4CJ5 A;  4M3Y A;  4N47 A;  3KK3 A;  3NDK A;  3M8Q A;  1RT2 A;  1EXQ A;  1BIS A;  2W42 A;  3DLR A;  3C6U A;  4MFB A;  4I2Q A;  1T7P A;  3L3U A;  4Z4E A;  1JXB A;  1F21 A;  3KKS A;  4B08 A;  2P51 A;  1JLE A;  1Q9Y A;  4O55 A;  1ITG A;  2Y1I A;  2KQ2 A;  3IG1 A;  4BE1 A;  2HHX A;  1TVR A;  1EX4 A;  4OKJ A;  2KFN A;  4CHZ A;  2HW3 A;  4FXD A;  1IKV A;  5CY4 A;  2ITG A;  3M8S A;  4Z4I A;  4KHW A;  1TL3 A;  4I9L A;  3AA3 A;  4CJR A;  4CF2 A;  2Z1J A;  3D45 A;  1RDC A;  1XHZ A;  3TWH A;  2R7Y A;  3AVI A;  1HQU A;  4CF0 A;  3KK2 A;  2BGG A;  5J2P A;  2OPR A;  4KI4 A;  3LWL A;  4IKF A;  1QHT A;  1WAJ A;  4Z0U A;  3VQP A;  4CF8 A;  4CGJ A;  3AVM A;  1WSF A;  4CJ4 A;  3K59 A;  4DU4 A;  4CEQ A;  3AVF A;  2E6L A;  3HO1 A;  3B6O A;  4FJ5 A;  1NK7 A;  3S9H A;  2IS3 A;  1U45 A;  4LSN A;  1WSJ A;  3S3M A;  1B9F A;  2F96 A;  4DLE A;  4M3Z A;  4DTU A;  2YNF A;  3G10 A;  3NE6 A;  2E6M A;  4CFA A;  2Y1J A;  1NK5 A;  1HYZ A;  5KRT A;  3M8R A;  2X6N A;  2DTU A;  1W9H A;  1TK5 A;  1S9G A;  2EHG A;  1QSS A;  3EY1 A;  5KRS A;  4F2R A;  3I0S A;  3DRP A;  4N76 A;  1YTU A;  1LV5 A;  1A5W A;  1KVC A;  4FLV A;  2D0B A;  4I2P A;  1KRP A;  1BI4 B;  3O3H A;  3TAR A;  4L8R B;  4O4G A;  3MXM A;  4B9N A;  4NYF A;  2OZS A;  4F2S A;  3NF6 A;  4CED A;  3HP9 A;  3RMA A;  2PY5 A;  1FKO A;  3AVK A;  4CF9 A;  1RNH A;  3V1O A;  2XY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...