1B9DA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
143
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 51
structure length 143
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9dA00
3P5JA 3V1RA 2OPPA 3NCIA 4DSJA 3NAEA 4IBNA 1TK5A 1RT7A 2ZQBA 3EYZA 3RR7A 1SL0A 4KTQA 4CESA 3K5MA 4ID1A 2DTUA 4CJ3A 3M8QA 2PZSA 1JLBA 2XY8A 3LP3A 3RMBA 4NCGA 2AJQA 4DU3A 3HO1A 5CZ2A 4CJWA 2B4JA 4E0DA 4FVMA 1I39A 1BI4B 4CJFA 1K6YA 1TGOA 4OPJA 3VQQA 3OYDA 4ZTFA 2RKIA 4I9QA 1JLCA 4F2SA 3T19A 5SZTA 3TR8A 3ZT1A 3K5OA 3NGYA 5JS1A 4DQQA 2HHVA 2KFZA 2VWKA 4I2QA 2D0BA 3U6FA 3BDPA 2IOCA 4CEEA 4Z4EA 2HHXA 3HP9A 4IDKA 4FLYA 1T7PA 4N56A 1UA0A 3DRSA 3NF6A 1VSMA 1RILA 1D8YA 3K5LA 4DS4A 5C25A 1FKOA 3ITHA 1NKCA 2B6AA 2YKMA 3HYFA 2OA8A 5C24A 4DSLA 1RBSA 2F96A 5KRTA 3V6DA 2Z1IA 2O4GA 1EP4A 4ELTA 2FBYA 1QSSA 1VK0A 2YNHA 4CK2A 1WSEA 1WSHA 5HP1A 3TI0A 3MXMA 1XHZA 1LAVA 4DS5A 4MQ3A 4RW6A 4CJPA 1ASWA 4CFDA 3PX4A 4I2PA 1NK9A 1KVAA 1TV6A 5FRNA 2YKNA 4CHQA 4KV8A 4DF4A 4BDZA 4M41A 4CJTA 3HPHA 3V9UA 4DQRA 4OJRA 1U45A 3QLHA 5C42A 3SJJA 3TAEA 4JRQA 4CCHA 1ASUA 2IS3A 1S1UA 1RDCA 3NE6A 1NJZA 1ZBLA 4KHQA 1BGXT 1C1AA 2BANA 3PX0A 3VA3A 4O0JA 4M3YA 4PQUA 1S6PA 2IC3A 1JLGA 4AHSA 4W5OA 3I0SA 3TARA 4FZZA 3ZSYA 4CHOA 3OYMA 1YVUA 5E41A 3OYIA 4E7KA 3V9SA 4FLWA 5CZ1A 3OS0A 4DFKA 3LZJA 4FK0A 5KI6A 3KJVA 4DTSA 3ZSRA 1B9FA 1HPZA 4OGCA 4CEFA 3RWUA 4KHUA 3P83D 1EXQA 4CFAA 1KRPA 4OVLA 4CHNA 3QNOA 3ZSZA 2DFEA 3NF8A 4FJXA 1S5JA 4FW2A 3E01A 1QTMA 3PO5A 2HW3A 4CJQA 3NH1A 3SV3A 1YTAA 4CIGA 1N5YA 3DLHA 4HHTA 1B9DA 1T8EA 3OYGA 2Y1JA 3S3OA 4FYDA 4B8AB 3T3FA 2HHUA 4GW6A 3SI6A 4FLZA 2I5JA 4KAZA 4FCYA 2BE2A 2Q3SA 3DYAA 3DLRA 1B92A 5SWMA 1Y97A 5HBMA 4KO0A 2XHBA 4B9LA 2ZD1A 4W5QA 1TAUA 1WAJA 4OKEA 1LWCA 3M8SA 1RDDA 1REVA 3QEXA 3MXIA 1U47A 4BWMA 1U48A 3OYKA 1TK0A 3TAGA 5HRPA 3K58A 4NCAA 3TAQA 4CFCA 4FJGA 4H4MA 4M42A 4B9MA 3L2VA 3HSTB 1UOCA 2RPIA 2IAJA 1KLNA 3KLIA 2A1SA 1RT4A 1VRTA 3C95A 4JRPA 4F4KA 1Z26A 1S9GA 3WNHA 4Z4HA 1WNSA 3TAPA 4CF9A 4EZ6A 4E3SA 3VQ8A 3RRGA 4Z4IA 3NF7A 1W9HA 3OYFA 1XI1A 1TL3A 1GOCA 4CE9A 2KTQA 3MAQA 2Z1HA 3LAMA 3CQ8A 4NCBA 2KZMA 1RT2A 3VQAA 1QHTA 4DLEA 1HYSA 1HNIA 3LPTA 3B6OA 3CG7A 4LD0A 1LWFA 4CGJA 4CHYA 3C94A 3EY1A 3SNNA 2VWJA 4EP5A 4FLTA 1NK0A 4PUOA 2PYLA 3IRXA 4FJNA 2Z1JA 4KPYA 4FJ9A 2HHSA 4Q0BA 2VG6A 1YTUA 1XWLA 3KKSA 3NH2A 2P51A 4FK4A 2IGIA 4CF2A 4FM0A 3VQ7A 3TANA 4OLBA 3AA5X 5CYMA 4E7JA 1S9EA 3AVGA 3L2UA 2WONA 1VRUA 1NOZA 3OJUA 1L3TA 4PA1A 4AH9A 3DOLA 3V9XA 4J2AA 3PV8A 1QQCA 5HROA 5I3UA 1SKRA 4HCBA 2HVHA 3JSMA 3SUQA 3K2PA 4W5RA 4ELUA 2BDPA 4KB1A 4FXDA 4JLHA 5KGXA 4FJLA 1HNVA 3V9WA 1A5WA 4GMJB 1NK7A 3KTQA 4CERA 3S3MA 4F2RA 3V81A 3PY8A 3LWLA 4CGIA 2Y1IA 1BCMA 3H08A 5I42A 2W42A 4B9NA 3SQ1A 1Z25A 3V1QA 4DG1A 1KFSA 4C8KA 2KQ2A 2GBZA 1ITGA 3HVTA 3JYTA 1NKBA 3VQBA 1CZBA 2HB5A 1VSDA 4LH4A 4B9SA 4M3ZA 1BQMA 2PY5A 3OYAA 4DU4A 4F8RA 1UWBA 3SUPA 3O4QA 4KHSA 4CJ4A 4N47A 1JLEA 4FZYA 3OY9A 2X78A 4DLGA 3LALA 2OPQA 3UIQA 4LY7A 4FLUA 1J5OA 3RMAA 1WN7A 4AHUA 2R7YA 3THVA 2D5RA 1EKEA 3LAKA 4OGEA 4Y1CA 3S9HA 4HTUA 1IH7A 3VQ5A 1L5UA 4OLAA 2KZZA 4DQIA 2P5GA 2XO7A 4C8NA 1QS4A 2HVIA 3G0ZA 2X6SA 2VG5A 5KGWA 4B8CA 4JS4A 3IAYA 4LSLA 1WSGA 5FDLA 1VSLA 5KRSA 4Y1DA 3U3YA 4BE0A 2D0AA 4Z4CA 4KFBA 1JXEA 2YNGA 3DM2A 4O5BA 3U3GA 3MECA 4MFBA 5K14A 4CJ5A 3F9KA 5HRNA 5J1EA 3ULDA 1KFDA 1X1PA 2DFFA 4IFYA 1ZBHA 4B9UA 3VQEA 4EZ9A 1HJRA 3KLGA 3QEVA 1RT3A 4DTPA 3AO3A 3SV4A 3CM6A 1L3UA 4NYFA 1LW2A 4C8MA 2QKKA 4FZXC 2XY5A 1GOAA 3TWHA 4KB0A 4DTUA 2F8SA 4CHZA 4ZTJA 4GVMA 1KVCA 3CFPA 1RBVA 5HRSA 3VQDA 3MEEA 2KFNA 1KCFA 2G8IA 3DI6A 1JLAA 1SL1A 4RW8A 3WNEA 4LSNA 1BCOA 1J9AA 3O3FA 4DF8A 3SQ2A 4DTXA 1SKWA 3M8PA 4M3TA 4Z0UA 1BHLA 1Q8IA 1JL1A 3LZIA 1HYVA 1KVBA 4CGFA 4E89A 4FLVA 4ZHRA 1TKTA 1L3VA 1S1XA 3LP2A 3QIOA 1SV5A 1ZYQA 3K5NA 1RCHA 4BDPA 1Q9YA 1KTQA 3VQPA 3OS1A 2HHTA 5CYQA 1WAFA 3NBPA 3ZSWA 2FBVA 1VSIA 4DFJA 2FBTA 4FM2A 3HJFA 4M3RA 3VQCA 3M8RA 1BL3A 2WOMA 3S3NA 2OYQA 1U04A 3LWMA 2HNYA 4BE2A 1NOYA 4UQGA 3LDSA 3HVRA 3D45A 3PUFA 1DTTA 4DTJA 3TAFA 4OPKA 4DTRA 3ZT2A 4DTOA 5KTQA 1WSIA 2QKBA 1BI4A 3OVNA 4CJVA 4CF0A 3F73A 1Q9XA 5CY4A 1WSJA 1RTJA 4O4GA 1RNHA 2P1JA 1SUQA 3L2QA 1X9SA 3L2WA 4FJHA 4M3UA 1EETA 3D0PA 5EU7A 2G8VA 4DFPA 3AVKA 1KLMA 4M3XA 1S1TA 3G10A 3NHGA 4H8KA 3ZSOA 3LP0A 4DSKA 1D5AA 4B3OA 4HUGA 3VA0A 5FROA 3AVCA 4KKOA 2X74A 4M3WA 2ZE2A 3DLEA 1RT1A 3KK1A 2DY4A 2X6NA 2P5OA 3K59A 3AO1A 5J2PA 3PO4A 2HNZA 1DTQA 4B08A 2XY6A 1O1WA 1BQNA 1IKVA 3C6UA 4DWIA 3ZSVA 1NK4A 3NFAA 4KHNA 1ZBIA 3QINA 4IKFA 3O4NA 4B9TA 3VQ4A 2HHWA 1BISA 2FBXA 1RTHA 1JLFA 4HUEA 1T03A 1IKXA 2E4LA 2YV0X 5J2MA 5D3GA 1S6QA 3NH0A 3L3VA 4J2DA 1ZBUA 1RBRA 4CJLA 1UA1A 3AVBA 4CECA 4RG8A 1FK9A 2OZMA 5J2NA 3QERA 4K8XA 2QK9A 3AVHA 3OS2A 3OYJA 3TABA 1VSJA 3KKRA 4CJEA 2RF2A 3VN5A 1DLOA 3OYHA 1RT5A 2B5JA 3B6PA 3O3GA 3RTVA 3ZT3A 4DQPA 2ETJA 3KLFA 1U49A 1D9FA 4DSIA 3SZ2A 2A1RA 3AA4A 1C1BA 1LAWA 4PY5A 4CIEA 4CEDA 3NF9A 4OKJA 4NYNA 1R0AA 1S1WA 4L8RB 4BDYA 1S1VA 3L3UA 4PWDA 4FW1A 1W0HA 4K8ZA 4DMNA 4FJIA 1HQEA 3NGZA 3ZCMA 1D9DA 4QAGA 1IKWA 5J2QA 3HT3A 4CIFA 3CFRA 4JS5A 4J2EA 3BGRA 1L3SA 4KI4A 4AHVA 3CYMA 3AVMA 4KRFA 4HVJA 4XIUA 4BWJA 3RMDA 3SUNA 4CGDA 3FFIA 4EP4A 1VSKA 5DK5A 1SKSA 4E1NA 3AVNA 3KK2A 4OKKA 3VQ9A 1KSPA 2G8KA 4ELVA 4RW4A 3HP6A 4W5TA 2DFHA 1LW0A 5HLFA 4G1QA 4IFVA 1VSFA 3KD1E 1WLJA 4FJ5A 4CGHA 1JLQA 1QSLA 1EX4A 3KLEA 4Z4GA 4CEQA 4FM1A 4M45A 3IS9A 3T1AA 4Q5VA 3AVLA 2YNFA 1A5VA 4RW7A 3P1GA 2HNDA 4CEBA 1VSEA 1CXUA 1JKHA 1RBTA 4BACA 2OZSA 1ZBFA 2HMIA 1NJXA 2NUBA 3MEGA 3AA3A 4F3TA 2OPRA 4HUFA 3SUOA 1NJYA 5FRMA 3ZSXA 2XY7A 2HHQA 3PX6A 2YHAA 2YHBA 4CHPA 4N76A 4YNQA 4FJKA 2Z1GA 4CFBA 3QIPA 3DRRA 5T7BA 4E7HA 4KHYA 3I8DA 4KTZA 1MU2A 1UAXA 3ALYA 3L8BA 4C8OA 2G8FA 2EX3A 3AVFA 1CLQA 2LSNA 1LV5A 3QEIA 2O4IA 4E7LA 1TAQA 4R5PA 4FJMA 3DOKA 4HCCA 4FJJA 2G8HA 4DTMA 1QSYA 4ID5A 2JGUA 3OYLA 5JS2A 4B9VA 2YNIA 4ICLA 1ASVA 3LANA 3MXJA 3AVAA 1NJWA 1TL1A 3QETA 1N6QA 4RW9A 3SQ4A 1G15A 2QXFA 3HK2A 3AO4A 4LH5A 3QNNA 1RBUA 4IG0A 4CJKA 4O0IA 1C0TA 4DSFA 1FKPA 1IKYA 4Z4FA 1C0MA 1YT3A 4WE1A 1JL2A 3KLHA 3AA2A 4CEOA 4DU1A 2EHGA 3AVJA 1LWEA 2RN2A 3I0RA 1SL2A 4CEZA 3O3HA 3K57A 4FLXA 4I7FA 3V9ZA 1BIZA 5HRRA 3LPUA 4CJUA 3V1OA 3SPYA 4FK2A 2GV9A 3IG1A 1NKEA 1A5XA 1TKZA 4O44A 2ATQA 1NK5A 3SQ0A 5DMRA 3CFOA 1X9WA 4FJ7A 3WNGA 4YFUA 3KIOA 3HM9A 4CJSA 1TKXA 1F21A 1RT6A 4H4OA 3HXMA 2F8TA 4CK3A 3DLKA 4CEAA 3OYNA 4DSEA 1TK8A 4F3OA 4KREA 1WSFA 4CGGA 2OPSA 3DMJA 4J2BA 4IG3A 3NDKA 3V4IA 3A2FA 3OJSA 4N41A 4AILC 2VG7A 4CF1A 4KTWA 1XHXA 3EZ5A 2BGGA 1RTDA 3SCXA 3AO5A 3VQ6A 3QESA 3HPOA 3CM5A 4E19A 1C1CA 3HL8A 2GUIA 4QCLA 1VSHA 3ZT0A 4DTNA 1J53A 1RTIA 1HRHA 2JLEA 3L2RA 1XC9A 3MEDA 1HMVA 1GOBA 3QEPA 1FXXA 1TKDA 3OYCA 4DQSA 1HQUA 2G8UA 3KK3A 3DRPA 3QO9A 4TSXA 3HPGA 4AHRA 3NGIA 2E6MA 3RR8A 3ISNC 3ZSQA 3KD5E 2ITGA 2XRIA 3LP1A 4I9LA 4CJRA 4DFMA 4O55A 3TAMA 1X9MA 1JXBA 1C0UA 1TVRA 2E6LA 3ZT4A 3RMCA 1IG9A 3OYBA 1RDAA 3RRHA 1NK8A 3AVIA 4AHCA 1CZ9A 4CF8A 3SPZA 1U4BA 1I3AA 3SYZA 3WNFA 4E7IA 4KI6A 3QEWA 1J54A 1QE1A 4FJ8A 4KHWA 3C6TA 4BE1A 4E1MA 1HYZA 3AV9A 4N5SA 1C6VA 3ASMA 3DLGA 4CK1A 4QOZB 2G8WA 3AO2A 1IO2A 3OYEA 4C8LA 2D0CA 1CXQA 2KW4A 1T05A 1RDBA 1NK6A 2PYJA 4W5NA 2FC0A 2IDOA 3DLBA 4AHTA 1BIUA
chains in the Genus database with same CATH superfamily
4DSJA 3V1RA 4IBNA 1RT7A 2NNWA 3EYZA 4JI8K 4CESA 2DTUA 4BRNA 4ILGB 3CJ7A 3TPQA 3CPWM 4GV9A 4CJWA 1G99A 2B4JA 4FVMA 1K6YA 3C65A 3C6HA 4ZTFA 2RKIA 4LC9B 3K5OA 2HHVA 5AQRA 3CQXA 2KFZA 4I2QA 3BDPA 4Z4EA 3CETA 2HHXA 3H3NO 4CZGA 5BRDA 3DRSA 3NF6A 1VSMA 4WQ4A 1D8YA 5CR4A 2NRXA 3IDHA 4DV3K 3ITHA 2OA8A 5C24A 1RBSA 2F96A 4JD2B 5KRTA 1EP4A 2P9IA 4ELTA 1DGKN 2FBYA 4CK2A 2HBLA 1ATNA 3EKSA 5AQXA 3TI0A 2BH1A 3OA9A 3QFUA 4RW6A 4BVOA 3TU5A 4CJPA 5TKWA 4CFDA 4DR7K 3D2FB 3H46O 4I2PA 5AQTA 4BDZA 4FWQA 2H3GX 3TSUA 1S1UA 1NJZA 1BGXT 1C1AA 4CI6A 2BANA 3NMUA 3AAQA 1LCUA 3VMFB 3I0SA 4FZZA 1GLAG 5E41A 1ATRA 3VESA 3DXMB 1OH5A 2QEXN 3VERA 4KHUA 4OGCA 3P83D 1EXQA 4CZKA 1KRPA 2F7TA 4BQLA 5AZJB 4FJXA 1S5JA 3E01A 1HPMA 1YTAA 1N5YA 1V4SA 1VAZA 2HSTA 2UYTA 3LM2A 3O1BA 4KAZA 4C23A 3DYAA 4YY3K 3DLRA 5HBMA 3SAHA 2ZD1A 1TAUA 1T6DA 3CC4N 4OKEA 1LWCA 3MXIA 4BR9A 3WXJA 1VQ4N 3K58A 4NCAA 3SLCA 1Z05A 2RPIA 2IAJA 2A1SA 3A5OC 4JRPA 4Z4HA 3FGUA 1WNSA 3SMPA 3TAPA 1W9HA 3OYFA 1TL3A 2AA4A 3W0LA 4PKHA 4CE9A 2KTQA 3LAMA 3THXB 1QHTA 5AQGA 4A59A 3B6OA 4LD0A 4IO9L 4CGJA 3EY1A 3SNNA 4DUYK 2VWJA 1NK0A 3L6QA 2VGNA 2HHSA 1XWLA 3KK7A 3M6GA 4CF2A 3GDQA 2D4WA 3L2UA 2O8CB 2WONA 4H5WA 2UUAK 1XMOK 1L3TA 3HI0A 3OJUA 4DR3K 5AQQA 4J2AA 2UU9K 1C0GA 3PSIA 3SUQA 3K2PA 4W5RA 4KB1A 4FJLA 4WYBA 1HNVA 1WUAA 3CCSN 3V9WA 3KTQA 1YF5L 2W42A 3E9PA 2YCHA 2GBZA 3VENA 1NKBA 4DU4A 3MN5A 3SUPA 3LL3A 4PKIA 1R59O 1JLEA 4IOCL 3UIQA 4LY7A 1WN7A 3P31A 3LAKA 4IOAL 3O5BA 4OLAA 3EKUA 1QS4A 3SBGA 3G0ZA 5FDLA 5KRSA 1VSLA 3ATVA 5AQKA 3HBTA 5AJ3K 4MLEA 3U3GA 3F9KA 2ITMA 4IFYA 3K0SA 4BRLA 4NYFA 2QKKA 2XY5A 1GOAA 2F8SA 4CHZA 4H0TB 2O8BA 1KVCA 3VQDA 3LM9A 3MEEA 2KFNA 4RW8A 1OVYA 1J9AA 1BCOA 2ASMA 1Q8IA 4I9QA 1TKTA 1QVGM 2QWLA 4BDPA 2HHTA 4FPBA 3ZSWA 1SQKA 1VSIA 2FBTA 4JKHA 3HJFA 1VQPN 1NGHA 1BU6O 4A5BA 3J8AA 1QZ6A 3S3NA 1YJ9N 3LWMA 2IVPA 4JKGB 3PUFA 4DTRA 3D2EA 4JI5K 3OVNA 5CY4A 1WSJA 3Q7CA 1RNHA 2FF3B 2P1JA 2Q0UA 4M3UA 1IG8A 2G8VA 4IDHA 4DFPA 3ZEUA 3QICA 1N36K 3G10A 4H8KA 3LP0A 4B3OA 5FROA 3AVCA 1RT1A 3KK1A 1GLFO 3AO1A 4FWNA 4B08A 3S41A 1O1WA 3C6UA 5EXWA 3CPEA 4NO7A 3QINA 2FBXA 3BZKA 1JLFA 4H0OA 3UKUB 1S6QA 3L3VA 4LF8K 1HUXA 1RBRA 1UA1A 3AVBA 3SMSA 4BC4A 4B3RK 3E1YA 1HKCA 4QS7A 3WEEB 3U4LA 3OS2A 1VSJA 2PAVA 3VN5A 2B5JA 3B6PA 1MWMA 2O8EA 3EN9A 3NF9A 2E2QA 4KH5A 1S1WA 3VEOA 4L8RB 3A5NC 3L3UA 4OO1J 4FW1A 2A5XA 1W0HA 2E20A 4JK7A 4Z94A 1HQEA 4QAGA 4JS5A 2VQFK 3BGRA 3QB0A 3OTOK 3RMDA 3SUNA 1JCEA 1VSKA 4E1NA 3AVNA 4U67L 4OKKA 3A5MC 4FWMA 2O8FB 3CQYA 2G8KA 3FE1A 4W5TA 1LW0A 4IFVA 1VSFA 3TTDA 4CEQA 5AZIB 4FL9A 4PHTX 4IO8A 4Q5VA 3AVLA 4A2BA 2UXCK 2HNDA 1VSEA 2Q1NA 4RCHA 4FOIA 3CC2N 4MO5A 3MEGA 1YAGA 3PX6A 2YHAA 2YHBA 2YHYA 1U2VB 3DRRA 5T7BA 4KHYA 4JK9A 4HWIA 2G8FA 2LSNA 4B1XB 3VPZA 3P4IA 2G8HA 4DTMA 1QSYA 4ID5A 2JGUA 3I8BA 5C0YA 5C2FA 1HNWK 3FZMA 1QQMA 2E1ZA 1N6QA 4RW9A 5M1NA 1G15A 2CGKA 2GWJA 1C0TA 1FKPA 5CE3A 4BC2A 1NLVA 4CEOA 1VQKN 4DR5K 5JVGL 3O3HA 1BIZA 2E2PA 1VQNN 5AQYA 3TTFA 2GV9A 3QBWA 3PIPL 3E9OA 2QA4N 4FJ7A 2CGJA 3CFOA 4YFUA 4YOVA 4JI6K 1F21A 1RT6A 2F8TA 3SAGA 1TK8A 2FSKA 3OBWA 3DMJA 1XHXA 1T3VA 1RTDA 3M5RA 2CH6A 3HPOA 2WC9A 3CM5A 4B3MK 3WXIA 3DXKA 1J53A 1RTIA 3N4PA 3MEDA 1HMVA 2JWLA 1GOBA 3FZKA 1HQUA 1FJGK 3ISNC 2XRIA 3LP1A 4I9LA 4DFMA 2E6LA 3RMCA 3OYBA 1RDAA 1NGCA 4KI6A 1KD1O 4KH4A 1CZAN 3VGMA 3AV9A 4N5SA 1C6VA 3DLGA 2G8WA 4MO4A 2D0CA 1MA9B 4W5NA 1VSDA 2CGLA 2IDOA 3DLBA 1BIUA 1IBMK 4AF1A 1TK5A 4ID1A 3M8QA 4FWRA 5JICA 1JLBA 3LP3A 4NCGA 3JXUA 3HO1A 1NMDA 1K8KA 3IKMA 2ZGZA 1I39A 5ELZA 2A42A 3OYDA 1ZBSA 3WXLA 4CBUA 3I55N 1JLCA 2V52B 2ZJQL 5SZTA 5FPMA 5JS1A 3RSEB 2UUCK 2D0BA 1HNXK 4CEEA 4IDKA 1MDUB 5JVHL 1QHAA 1NJIO 1FKOA 2YKMA 5AQNA 4CZLA 3HYFA 3J7AP 5BN8A 1YHQN 1YITN 4KHPK 4DCHA 4DSLA 4H0VB 2O4GA 3ZX3A 1QSSA 1BG3A 1VK0A 1WSEA 3THWA 4CBWA 1LAVA 3VGLA 1ASWA 1TV6A 4DV4K 4KV8A 4CJTA 2RE2A 2ASOA 3V9UA 4DQRA 3DAWA 3HSCA 1RDCA 3NE6A 1OVQA 4LF9K 2KLAA 4PQUA 1JLGA 4AHSA 1BUPA 2GWKA 3TARA 3ZSYA 4DR2K 1YVUA 3V9SA 1TUUA 5CZ1A 3KJVA 1KC8O 3RWUA 1B9FA 1HPZA 4CEFA 4J8FA 4CFAA 4OVLA 5AFUA 5BPLA 4CHNA 3QNOA 3QMLA 1VQ5N 3NF8A 4H5NA 1BWFO 1WBBA 3PO5A 1DEJA 5AQSA 4JKEA 4CJQA 4YHHK 3NH1A 3DLHA 1B9DA 3T3FA 3SJHA 2HHUA 4GW6A 4BRFA 4CZIA 3VEXA 4FLZA 3WT0A 3L0QA 5DM6L 4EAHD 2BE2A 2BTFA 2Q3SA 3TTCA 1Y97A 5SWMA 4DV7K 4BR0A 1WAJA 2V7ZA 1RDDA 1U47A 3G71N 1U48A 4H0XB 3OYKA 3TAQA 3EO3A 4BRQA 4H4MA 4YOWA 3T1HK 4LF5K 2YJFA 2FF6A 4M7XA 2P9LA 3KLIA 1VRTA 4F4KA 1Z26A 3WNHA 3P39A 2ZF5O 4E3SA 4YORA 4Z4IA 1RDUA 4DV5K 1XI1A 2KZMA 4NCBA 4FWSA 1RT2A 2P9UB 3VQAA 2GEMA 4C1NK 4DLEA 5LMUK 3LPTA 3BZCA 3CG7A 3C94A 3LDNA 4PUOA 4FLTA 4FWOA 3IRXA 4FJNA 2Z1JA 3O9RA 4Q0BA 2VG6A 1GLJO 4BR4A 1C0FA 4DHYA 3AA5X 4E7JA 1IBLK 1S9EA 5IWAK 2W6KA 3T69A 1W7AA 4PA1A 2E5LK 4DV6K 3CIPA 3PV8A 3GE1A 4DV0K 4HCBA 3WUHA 2BDPA 1NGGA 1SAZA 1NK7A 4F2RA 4CERA 4B9NA 4CGIA 1BCMA 1NM1A 3H08A 3V1QA 4DG1A 4C8KA 3F9MA 2KQ2A 3HVTA 4H5VA 3JYTA 3VQBA 4WQ5A 1BQMA 3R9PA 3VEZA 4LFCK 3O9TA 1X3NA 3O4QA 1HNZK 4KHSA 1Q18A 4XEIA 1NGBA 4FWLA 4FZYA 2YX6A 2X78A 1J5OA 3RMAA 4O8UA 1E4FT 3THVA 5F1XA 2D5RA 4OGEA 4HTUA 2P9SB 2KZZA 2XO7A 2X6SA 1J6ZA 5KGWA 4B8CA 3BY5A 4Y0WA 3UB5A 3IAYA 4Y1DA 2OCEA 4KFBA 1JXEA 3DM2A 4O5BA 5GADP 4FK0A 3OBYA 3ULDA 1KFDA 2DFFA 4B9UA 3QEVA 1RT3A 1W97L 4JYAK 3AO3A 3CM6A 4WFNL 4FZXC 5AQPA 1HX1A 1N33K 1QZ5A 3CERA 4ZTJA 3CFPA 3WNEA 3SQ2A 1SKWA 4Z0UA 1BHLA 1JJ2M 1JL1A 1KVBA 4E89A 4MDAA 4ZHRA 4JEPA 3CCJN 2OTJN 1ZYQA 3OS1A 1WAFA 4FM2A 2ASPA 2FXUA 3EE9A 4GVEA 3M8RA 3G4SN 3CCRN 3I33A 2OYQA 3KWGA 4B3TK 4BRGA 3D7EO 4DTJA 3TAFA 3BF3A 5KTQA 1WSIA 4X66K 4M7YA 2IVNA 1Q9XA 2HF3A 1IBKK 1TYQB 3L2WA 3D0PA 1YJNN 3AVKA 4M3XA 3GBTA 3ZSOA 4DSKA 3VA0A 2Q36A 1E4GT 4WCEL 2QWQA 2ZE2A 3DLEA 2DY4A 4JKBA 1ZC6A 3PO4A 2Q97A 3HOTA 1DTQA 3T7ZA 1BQNA 4DWIA 1NK4A 4JI4K 4B9QA 4K43A 4WF9L 2HHWA 4BR7A 4BRCA 1IKXA 4JD2A 2VYPA 5D3GA 3NH0A 4J2DA 2P9NB 2O8BB 4YOXA 4CJLA 3A5LC 3THYB 4CECA 1DKGD 4ILJA 2QK9A 2QTDA 2VWBA 4O8KA 3O3GA 3IUCA 3ZT3A 4DQPA 2ETJA 3KLFA 4DSIA 1D9FA 4KH6A 2A1RA 2P9PB 4OKJA 4NYNA 4JI3K 3MN7A 1S1VA 5HL7L 4K8ZA 2HBKA 4RTFD 4DMNA 3NGZA 1U6ZA 1D9DA 5J2QA 3G6EN 3DXMA 3HT3A 3CFRA 4KRFA 3HM8A 4AHVA 3AVMA 4NLBA 2F4VK 5AZJA 5DK5A 4FVUA 5GIPA 1H1VA 4ISGA 4ELVA 3ZEUB 2NRRA 3F5TA 1LOTB 4G1QA 1VQON 5I9EB 1WLJA 4FJ5A 4MLHA 1KAXA 1QSLA 1IV0A 4Z4GA 4M45A 3IS9A 4LF4K 3GG4A 5E84A 1RBTA 3FZLA 2HMIA 1NJXA 4BRPA 5FRMA 3CI5A 4YNQA 3QIPA 3L8BA 3ALYA 4JKCA 2EX3A 1CLQA 1TAQA 2A40A 4FJJA 5GIOA 3MN9A 2J4RA 3LANA 3MXJA 3AVAA 5BREA 1TL1A 2RHKA 3QETA 3SQ4A 3BP8A 3AO4A 3QNNA 2A41A 4O0IA 4DSFA 1IKYA 1C0MA 1YT3A 1Q86O 3H1VX 3ZETB 4NXNK 5B8HA 1SL2A 3K57A 3V9ZA 3GOIA 4CJUA 4JN4A 3C0BA 2ATQA 5DMRA 1X9WA 3WNGA 4LF6K 4L3QA 3KIOA 3HM9A 3DLKA 4BR2A 2VQEK 4DKWA 3FR0A 1WSFA 2NRWA 4J2BA 4IG3A 3V4IA 4BROA 4N41A 4CF1A 4ILHA 4KTWA 4BG8A 4A61A 5LY3A 2HMPA 3EZ5A 3QESA 2UUBK 1C1CA 4QCLA 2GUIA 1VSHA 4JKAA 3ZT0A 1HRHA 1FXXA 2QM1A 3MX2A 2FSJA 4DQSA 3KK3A 3HPGA 4AHRA 2UXDK 4B1UB 3ZSQA 3TAMA 1X9MA 1JXBA 3ZLJA 5KPZA 3VOVA 2ZJPL 1CZ9A 1U4BA 3SYZA 4E7IA 2NRVA 4KHWA 5GAEP 4E1MA 1HYZA 3OYEA 4OPHA 2PBDA 3Q7BA 3PIOL 1YXQA 3O4WA 4AHTA 3NCIA 2OPPA 4OX9K 3GL1A 2ZQBA 3O8MA 4F9OA 3I56N 1VQLN 1SL0A 3K5MA 5BRFA 2XY8A 3RMBA 4CZEA 4DU3A 4E0DA 5EY4A 1BI4B 3J7ZO 1TGOA 1T6CA 4OPJA 1VQ9N 5BRHA 4E1JA 5AFUH 3T19A 3ZT1A 3MCAB 3AAPA 3ULEB 1EO1A 4AM7A 3CC7N 3VETA 3VF6A 3N4QA 4FLYA 1T7PA 1UA0A 1XMQK 1RILA 3K5LA 4DS4A 5C25A 2PFUA 1NKCA 2B6AA 2YHWA 3O1WA 3VEYA 1DT9A 2Z1IA 3BUZB 2YNHA 5HP1A 1XHZA 4BGBA 1NK9A 1KVAA 5FRNA 2YKNA 4DF4A 3E9LA 4IJAA 3CJBA 4OJRA 1U45A 3QLHA 4I6MB 1ASUA 3WQUA 4KHQA 3VA3A 4H0YB 4JNEA 4O0JA 3UKUA 4M3YA 4CW7B 5EVZA 2E2OA 4K42A 3OYMA 4CHOA 2OANA 4E7KA 4FLWA 1Q82O 4BRAA 3TSPA 3LZJA 3WEEA 5GAHP 3ZSRA 4DTSA 2O8DB 3A0IX 4A2AA 3ZSZA 2DFEA 4DUZK 2QWOA 1YJWN 4FW2A 3KWIA 1QTMA 4CZHA 3SV3A 4YOUA 3QFPA 4CIGA 2Y1JA 1WOQA 2I5JA 4FCYA 1W2BM 1B92A 2QWPA 4W5QA 3CCQN 3M8SA 3QEXA 4BWMA 5LL6Z 3TAGA 5HRPA 5BPNA 1BA0A 4CFCA 4FJGA 4B9MA 3HSTB 2O8FA 1UOCA 1GLBG 1KLNA 3PSFA 1RT4A 3H3OB 4IOXA 1WBDA 2P9KB 4CF9A 4EZ6A 4XH1A 3NF7A 4LF7K 3VEWA 4YOYA 3L4QA 3SK3A 3MAQA 4X64K 3CJCA 3TSQA 3P38A 1XUPO 1HNIA 4BC5A 3ZX2A 4CHYA 1U2VA 4KPYA 4A57A 3KKSA 2P51A 3AGKA 4FM0A 4BR5A 5EX5A 3TANA 4PL7A 2NRTA 1VRUA 3U9DA 2UXBK 5AQWA 1HJOA 3DOLA 3V9XA 5HROA 1QQCA 2HVHA 4FXDA 5KGXA 4H5RA 1A5WA 5AQMA 3LWLA 2Y1IA 5I42A 3SQ1A 1KFSA 1KQSM 2F9TA 1CZBA 2HB5A 1QQOA 3CCLN 4B9SA 4CBXA 4XH5A 3OYAA 1YVNA 1M90O 4CJ4A 5AQFA 3H45C 5C12A 1EWQA 4DLGA 4GV6A 2OPQA 1L5UA 4Y1CA 4BRMA 4DQIA 1VHXA 2E2NA 4H03B 4LSLA 4Z4CA 5HRNA 3MECA 4MFBA 5K14A 5J1EA 2KHOA 3LDQA 1S3XA 4BY9C 1ZBHA 1NBWA 4EZ9A 3DLLL 3KLGA 3SV4A 2FSNA 2Q2RA 4C8MA 1FW6A 4IXCA 3TWHA 4KB0A 4GVMA 5HRSA 4BRDA 1KXPA 4EHTA 3U8XA 1KCFA 2G8IA 4QS9A 1SL1A 4LSNA 3O3FA 4DF8A 4DTXA 4M3TA 3LZIA 1HYVA 3C6AA 4CGFA 3O9SA 1L3VA 4K0KK 5GAGP 4BREA 1S1XA 1SV5A 1Q9YA 1KTQA 2E88A 3NBPA 1VQ6N 4U7BA 4M3RA 3VQCA 2WOMA 4YDUC 4BE2A 1M1KO 3HVRA 1DTTA 4JHDA 3ZT2A 4B1VA 4NLCA 5BPMA 4CF0A 1RTJA 4IEIA 1SUQA 3L2QA 1EETA 5EU7A 1KLMA 1S1TA 5EOYA 4CVNE 5KQDA 3NHGA 1XQSC 2P9IB 4HUGA 4JAXA 3C7NA 3RSEA 4JI0K 3R1XA 3MCPA 3M3ZA 2X6NA 3L4IA 4NXMK 4H0PA 5M1KA 1NGEA 4G9ZA 3K9KA 1ZXOA 1IKVA 2ZM6K 3NFAA 4KHNA 4BRIA 3O4NA 4B9TA 3VQ4A 4WFAL 1BISA 1RTHA 2E4LA 5GINA 3R3LA 2QXLA 4WQ4C 3IMXA 2OZMA 4RG8A 2D1KA 5J2NA 3QERA 1JCGA 3AVHA 3OYJA 3KHYA 3O6WA 4CJEA 2RF2A 1X9JA 4MDBA 4O5FA 3MMVA 3RTVA 4BVPA 5AQVA 1BOTO 1NG9A 3SZ2A 3AA4A 2YI1A 3O80A 2IIRA 4JKFA 1XC3A 4H5TA 3ZCMA 4CIFA 1L3SA 3CYMA 3EZWA 4HVJA 4XIUA 4GV3A 3FFIA 3KK2A 5LJWA 4RW4A 3HP6A 3J80O 1EX4A 3KLEA 3MN6A 3T1AA 3UKRA 4JV5K 3K9JA 3G25A 3O08A 2W6LA 2JWKA 1JKHA 3PLAA 2I7PA 1ZBFA 1RGIA 3VF2A 2NUBA 3AA3A 4F3TA 2OPRA 4HUFA 3SUOA 1NJYA 2HBJA 1OH6A 5LJVA 4CHPA 5BN9A 2BUPA 4CFBA 4E7HA 1MU2A 1UAXA 4YOTA 5AQHA 4CD1A 1LV5A 3R8EA 4R5PA 3DOKA 3AY9A 3OYLA 3H1QA 4B9VA 5JS2A 1ASVA 1QVFM 4JK8A 2ZWHA 3QDKA 3WXKA 1NJWA 2P9UA 5ADXA 4LH5A 1RBUA 4IG0A 4CJKA 1E3MA 1XNQK 3JS6A 1JL2A 3KLHA 2IVOA 4DU1A 1RFQA 2RN2A 4BRKA 4FLXA 5HRRA 3LPUA 4EIAA 3SPYA 3MX5A 3IG1A 4FK2A 4O44A 1TKZA 1S72N 1NK5A 3SQ0A 2QWRA 3J7YP 3RVCA 4FWKA 4BG9A 3HXMA 3D6RA 4GNIA 3OYNA 4F3OA 4JI7K 1SZ2A 4CGGA 2OPSA 5HOOA 2F9WA 3NDKA 3OJSA 4AILC 3ATUA 2BGGA 3AO5A 5IT9O 3W3DA 4E19A 1Q81O 3HL8A 4DTNA 1NGIA 3QEPA 3OYCA 3CD6N 1K8AO 2G8UA 1ATSA 1GLLO 3OW2M 4ISFA 4FO0A 1S22A 1VQMN 3NGIA 2E6MA 4UY8O 3RR8A 4RWTA 2ITGA 2VGMA 4NB4A 3MWPA 4CJRA 2P9SA 4O55A 4DR6K 1C0UA 3ZT4A 1YIJN 3AVIA 4AHCA 4CF8A 1I3AA 3MWTA 5F2RA 4K41A 3WNFA 4FJ8A 3D2FA 3C6TA 3ZX0A 4BE1A 3ASMA 1SS6A 1IO2A 1CXQA 2KW4A 3CJAA 4QS8A 3P5JA 3NAEA 4JI2K 3RR7A 3IFRA 3CCMN 3VTHA 4KTQA 4CJ3A 2PZSA 1OH7A 5AR0A 1OH8A 2AJQA 4JI1K 3D2EB 5CZ2A 3NVMA 5M1PA 4CJFA 3VQQA 4F2SA 3TR8A 3NGYA 1RDWX 4DQQA 3A8YA 4OPAA 1NMNA 2VWKA 2QWNA 3KZBA 5DM7L 3U6FA 2IOCA 5M1QA 3HP9A 4N56A 1KAZA 1TYQA 3V6DA 1NGDA 3CJ9A 1GLCG 1GLDG 1WSHA 3MXMA 4DS5A 3H6EA 4MQ3A 5FPNA 3PX4A 4CJ7A 4CHQA 3THXA 1T44A 4M41A 3HPHA 1TUYA 1Y64A 5C42A 3SJJA 3TAEA 4JRQA 2O8EB 4CCHA 2IS3A 1ZBLA 1XNRK 3M1FA 3PX0A 3HTVA 1S6PA 2IC3A 4W5OA 3U9ZA 2P9NA 1N8RO 1N32K 3THYA 3OYIA 4C1NI 2ZGYA 3BEXA 3OS0A 4DFKA 2O8CA 5KI6A 4M42A 4WFBL 1YUWA 4FSVA 1BO5O 4KBOA 3EL2A 2HW3A 3R6MA 4HTLA 4IWVA 4HHTA 2P9PA 3OYGA 1T8EA 3S3OA 4FYDA 4B8AB 3F2KA 3MK6A 3SI6A 2E1YA 4FOEA 4DV2K 4KO0A 2XHBA 4B9LA 1REVA 3WQTA 2WFBA 1TK0A 2D0OA 2QI2A 2NRZA 3L2VA 2CH5A 3DJCA 3VTIA 5KPRA 3FZFA 4GKKK 4AQYK 3C95A 5CHIA 1S9GA 3CCUN 3LDOA 3VQ8A 3T1YK 2GELA 3ZYYX 1D4XA 3RRGA 4LFAK 3ID8A 1GOCA 2Z1HA 3CQ8A 3CF5L 3CMAN 1HYSA 1LWFA 5C2DA 2Q31A 5JMVA 4EP5A 2PYLA 1Q7YO 4FJ9A 3J81O 3HRGA 1YTUA 3NH2A 4FK4A 2IGIA 3VQ7A 2HOEA 5AQOA 5CYMA 4OLBA 3AVGA 4BQZA 1NOZA 3CCVN 5H1SQ 4AH9A 3EEQA 1SKRA 5I3UA 3JSMA 4ELUA 5KPTA 5M1FA 4JLHA 3ENBA 4GMJB 4PL8A 3S3MA 3SBTA 3V81A 4EFHA 3PY8A 3ZETA 3B8AX 1Z25A 2GTDA 4LFBK 1ITGA 2Q0RA 4JKGA 4LH4A 2A3ZA 4M3ZA 3DXKB 2PY5A 4F8RA 4BC3A 1UWBA 4DV1K 1ESVA 2EWSA 4N47A 3VEVA 3OY9A 3LALA 1HKBA 3ID6A 4FLUA 4PKGA 2I7NA 3AGRA 4AHUA 2R7YA 1EKEA 3S9HA 1HR0K 1IH7A 3VQ5A 2P5GA 2HVIA 4C8NA 2VG5A 4JS4A 3O9UA 1WSGA 3LDLA 1P8ZA 3ENHA 3U3YA 4DB3A 4BE0A 2D0AA 1MWKA 2YNGA 4CJ5A 4IJNA 1X1PA 3CMEN 3VQEA 1HJRA 4JKDA 4DTPA 1L3UA 1LW2A 3HOSA 4DTUA 5FPDA 2DPNA 3VF4A 4B1ZA 1RBVA 4B3SK 4CZMA 3DI6A 1JLAA 2W40A 2WTUA 3M8PA 1K8KB 4CD3A 1BDGA 4FLVA 3HZ6A 3QIOA 2YHXA 3LP2A 1EWRA 3K5NA 1RCHA 2HHHK 3VQPA 5CYQA 2FBVA 4DFJA 3CCEN 4EHUA 1BL3A 1NU0A 1U04A 2HNYA 1NOYA 4UQGA 3LDSA 3ENOA 3D45A 4OPKA 1ILYA 4CZFA 4DTOA 2QKBA 1BI4A 4CJVA 3F73A 1KAYA 4O4GA 4IEEA 1X9SA 4FJHA 3CJ1A 3O9QA 1I94K 3OHRA 2A6AA 1D5AA 4KKOA 2X74A 3ULEA 4M3WA 3AARA 5FPEA 3THWB 5AZIA 1X3MA 2P5OA 3K59A 5J2PA 5A2QO 3E66A 3FFKB 5AQUA 2HNZA 2XY6A 1O13A 3ZSVA 1ZBIA 4IKFA 4B1WB 1IJJA 4HUEA 1T03A 5J2MA 2YV0X 1J5EK 2W41A 4K25A 1ZBUA 1GLEG 5AQZA 2OTLN 4IFEA 2NLXA 1FK9A 3LDPA 5BR8K 1N34K 1QQNA 4K8XA 3TABA 3KKRA 2D0PA 1DLOA 4IZ9A 1RT5A 3OYHA 2VCPA 4I6MA 1U49A 1C1BA 1LAWA 2YJEA 2FLOA 4PY5A 4CIEA 5AQLA 3WXMB 4CEDA 1R0AA 1EQYA 4BDYA 5E26A 4PWDA 5ADXH 4FJIA 1IKWA 2E8AA 5F0XA 4J2EA 4KI4A 4JHDB 2O8DA 4BWJA 5M1OA 1VQ8N 4CZJA 4CGDA 4EP4A 1HLUA 1SKSA 3CHWA 3VQ9A 2HF4A 1KSPA 3CXCM 2DFHA 5HLFA 2P9LB 2QW9A 1NNEA 3KD1E 4B1YB 4R79A 4CGHA 1JLQA 2NRHA 3C7NB 4FM1A 5TKYA 2YNFA 1A5VA 4ISEA 1NGJA 4RW7A 3EE8A 3P1GA 4CEBA 5C10A 1CXUA 3FLCO 2OZSA 4BACA 2WBNA 4DR1K 1K73O 5BR9A 1NWKA 3ZSXA 2XY7A 2HHQA 5FLXO 4N76A 2V7YA 4FJKA 2Z1GA 5KQ8A 2ZJRL 1VQ7N 3I8DA 4KTZA 4C8OA 2P9KA 3AVFA 2O4IA 5JLFA 3QEIA 4E7LA 4FJMA 4HCCA 3NVKA 4A62A 3UE5A 2YNIA 4ICLA 4V19S 2QXFA 3HK2A 3SAFA 2NZTA 4Z4FA 4WE1A 4GY2B 5LMNK 3AA2A 2AP1A 2EHGA 3AVJA 1LWEA 3I0RA 3JAMO 4CEZA 4I7FA 2V51B 3MDQA 3V1OA 1Z6RA 4A5AA 1K9MO 1NKEA 1A5XA 1HKGA 4DQ8A 4CJSA 1TKXA 4H4OA 5AQIA 4CK3A 3DWLA 4CEAA 4GKJK 5AQJA 4DSEA 3VGKA 2WUSA 4KREA 2KKZA 3A2FA 2VG7A 4DR4K 3KVGA 3SCXA 3VQ6A 1V4TA 3UKRB 2QWMA 1JCFA 4X65K 2JLEA 5JLHA 3L2RA 4M63C 1XC9A 1TKDA 3QBXA 3DRPA 3BF1A 3QO9A 4TSXA 1WB9A 4AM6A 3KD5E 4WQ5C 4BRHA 3FZHA 1TVRA 1IG9A 2HBMA 4XH4A 3RRHA 1P90A 1NK8A 3SPZA 1NGAA 4BGAA 1J54A 1QE1A 3QEWA 1NGFA 5C15A 2GUPA 2GX9A 4CK1A 1YI2N 4QOZB 4FPAA 4YDUA 3AO2A 4C8LA 4FWPA 5MLCQ 1OKJA 1T05A 1RDBA 1NK6A 2PYJA 1BA1A 2FC0A 4X62K
chains in the Genus database with same CATH topology
3P5JA 3V1RA 2OPPA 3NCIA 4DSJA 3NAEA 4IBNA 1TK5A 1RT7A 2ZQBA 3EYZA 3RR7A 1SL0A 4KTQA 4CESA 3K5MA 4ID1A 2DTUA 4CJ3A 3M8QA 2PZSA 1JLBA 2XY8A 3LP3A 3RMBA 4NCGA 2AJQA 4DU3A 3HO1A 5CZ2A 4CJWA 2B4JA 4E0DA 4FVMA 1I39A 1BI4B 4CJFA 1K6YA 1TGOA 4OPJA 3VQQA 3OYDA 4ZTFA 2RKIA 4I9QA 1JLCA 4F2SA 3T19A 5SZTA 3TR8A 3ZT1A 3K5OA 3NGYA 5JS1A 4DQQA 2HHVA 2KFZA 2VWKA 4I2QA 2D0BA 3U6FA 3BDPA 2IOCA 4CEEA 4Z4EA 2HHXA 3HP9A 4IDKA 4FLYA 1T7PA 4N56A 1UA0A 3DRSA 3NF6A 1VSMA 1RILA 1D8YA 3K5LA 4DS4A 5C25A 1FKOA 3ITHA 1NKCA 2B6AA 2YKMA 3HYFA 2OA8A 5C24A 4DSLA 1RBSA 2F96A 5KRTA 3V6DA 2Z1IA 2O4GA 1EP4A 4ELTA 2FBYA 1QSSA 1VK0A 2YNHA 4CK2A 1WSEA 1WSHA 5HP1A 3TI0A 3MXMA 1XHZA 1LAVA 4DS5A 4MQ3A 4RW6A 4CJPA 1ASWA 4CFDA 3PX4A 4I2PA 1NK9A 1KVAA 1TV6A 5FRNA 2YKNA 4CHQA 4KV8A 4DF4A 4BDZA 4M41A 4CJTA 3HPHA 3V9UA 4DQRA 4OJRA 1U45A 3QLHA 5C42A 3SJJA 3TAEA 4JRQA 4CCHA 1ASUA 2IS3A 1S1UA 1RDCA 3NE6A 1NJZA 1ZBLA 4KHQA 1BGXT 1C1AA 2BANA 3PX0A 3VA3A 4O0JA 4M3YA 4PQUA 1S6PA 2IC3A 1JLGA 4AHSA 4W5OA 3I0SA 3TARA 4FZZA 3ZSYA 4CHOA 3OYMA 1YVUA 5E41A 3OYIA 4E7KA 3V9SA 4FLWA 5CZ1A 3OS0A 4DFKA 3LZJA 4FK0A 5KI6A 3KJVA 4DTSA 3ZSRA 1B9FA 1HPZA 4OGCA 4CEFA 3RWUA 4KHUA 3P83D 1EXQA 4CFAA 1KRPA 4OVLA 4CHNA 3QNOA 3ZSZA 2DFEA 3NF8A 4FJXA 1S5JA 4FW2A 3E01A 1QTMA 3PO5A 2HW3A 4CJQA 3NH1A 3SV3A 1YTAA 4CIGA 1N5YA 3DLHA 4HHTA 1B9DA 1T8EA 3OYGA 2Y1JA 3S3OA 4FYDA 4B8AB 3T3FA 2HHUA 4GW6A 3SI6A 4FLZA 2I5JA 4KAZA 4FCYA 2BE2A 2Q3SA 3DYAA 3DLRA 1B92A 5SWMA 1Y97A 5HBMA 4KO0A 2XHBA 4B9LA 2ZD1A 4W5QA 1TAUA 1WAJA 4OKEA 1LWCA 3M8SA 1RDDA 1REVA 3QEXA 3MXIA 1U47A 4BWMA 1U48A 3OYKA 1TK0A 3TAGA 5HRPA 3K58A 4NCAA 3TAQA 4CFCA 4FJGA 4H4MA 4M42A 4B9MA 3L2VA 3HSTB 1UOCA 2RPIA 2IAJA 1KLNA 3KLIA 2A1SA 1RT4A 1VRTA 3C95A 4JRPA 4F4KA 1Z26A 1S9GA 3WNHA 4Z4HA 1WNSA 3TAPA 4CF9A 4EZ6A 4E3SA 3VQ8A 3RRGA 4Z4IA 3NF7A 1W9HA 3OYFA 1XI1A 1TL3A 1GOCA 4CE9A 2KTQA 3MAQA 2Z1HA 3LAMA 3CQ8A 4NCBA 2KZMA 1RT2A 3VQAA 1QHTA 4DLEA 1HYSA 1HNIA 3LPTA 3B6OA 3CG7A 4LD0A 1LWFA 4CGJA 4CHYA 3C94A 3EY1A 3SNNA 2VWJA 4EP5A 4FLTA 1NK0A 4PUOA 2PYLA 3IRXA 4FJNA 2Z1JA 4KPYA 4FJ9A 2HHSA 4Q0BA 2VG6A 1YTUA 1XWLA 3KKSA 3NH2A 2P51A 4FK4A 2IGIA 4CF2A 4FM0A 3VQ7A 3TANA 4OLBA 3AA5X 5CYMA 4E7JA 1S9EA 3AVGA 3L2UA 2WONA 1VRUA 1NOZA 3OJUA 1L3TA 4PA1A 4AH9A 3DOLA 3V9XA 4J2AA 3PV8A 1QQCA 5HROA 5I3UA 1SKRA 4HCBA 2HVHA 3JSMA 3SUQA 3K2PA 4W5RA 4ELUA 2BDPA 4KB1A 4FXDA 4JLHA 5KGXA 4FJLA 1HNVA 3V9WA 1A5WA 4GMJB 1NK7A 3KTQA 4CERA 3S3MA 4F2RA 3V81A 3PY8A 3LWLA 4CGIA 2Y1IA 1BCMA 3H08A 5I42A 2W42A 4B9NA 3SQ1A 1Z25A 3V1QA 4DG1A 1KFSA 4C8KA 2KQ2A 2GBZA 1ITGA 3HVTA 3JYTA 1NKBA 3VQBA 1CZBA 2HB5A 1VSDA 4LH4A 4B9SA 4M3ZA 1BQMA 2PY5A 3OYAA 4DU4A 4F8RA 1UWBA 3SUPA 3O4QA 4KHSA 4CJ4A 4N47A 1JLEA 4FZYA 3OY9A 2X78A 4DLGA 3LALA 2OPQA 3UIQA 4LY7A 4FLUA 1J5OA 3RMAA 1WN7A 4AHUA 2R7YA 3THVA 2D5RA 1EKEA 3LAKA 4OGEA 4Y1CA 3S9HA 4HTUA 1IH7A 3VQ5A 1L5UA 4OLAA 2KZZA 4DQIA 2P5GA 2XO7A 4C8NA 1QS4A 2HVIA 3G0ZA 2X6SA 2VG5A 5KGWA 4B8CA 4JS4A 3IAYA 4LSLA 1WSGA 5FDLA 1VSLA 5KRSA 4Y1DA 3U3YA 4BE0A 2D0AA 4Z4CA 4KFBA 1JXEA 2YNGA 3DM2A 4O5BA 3U3GA 3MECA 4MFBA 5K14A 4CJ5A 3F9KA 5HRNA 5J1EA 3ULDA 1KFDA 1X1PA 2DFFA 4IFYA 1ZBHA 4B9UA 3VQEA 4EZ9A 1HJRA 3KLGA 3QEVA 1RT3A 4DTPA 3AO3A 3SV4A 3CM6A 1L3UA 4NYFA 1LW2A 4C8MA 2QKKA 4FZXC 2XY5A 1GOAA 3TWHA 4KB0A 4DTUA 2F8SA 4CHZA 4ZTJA 4GVMA 1KVCA 3CFPA 1RBVA 5HRSA 3VQDA 3MEEA 2KFNA 1KCFA 2G8IA 3DI6A 1JLAA 1SL1A 4RW8A 3WNEA 4LSNA 1BCOA 1J9AA 3O3FA 4DF8A 3SQ2A 4DTXA 1SKWA 3M8PA 4M3TA 4Z0UA 1BHLA 1Q8IA 1JL1A 3LZIA 1HYVA 1KVBA 4CGFA 4E89A 4FLVA 4ZHRA 1TKTA 1L3VA 1S1XA 3LP2A 3QIOA 1SV5A 1ZYQA 3K5NA 1RCHA 4BDPA 1Q9YA 1KTQA 3VQPA 3OS1A 2HHTA 5CYQA 1WAFA 3NBPA 3ZSWA 2FBVA 1VSIA 4DFJA 2FBTA 4FM2A 3HJFA 4M3RA 3VQCA 3M8RA 1BL3A 2WOMA 3S3NA 2OYQA 1U04A 3LWMA 2HNYA 4BE2A 1NOYA 4UQGA 3LDSA 3HVRA 3D45A 3PUFA 1DTTA 4DTJA 3TAFA 4OPKA 4DTRA 3ZT2A 4DTOA 5KTQA 1WSIA 2QKBA 1BI4A 3OVNA 4CJVA 4CF0A 3F73A 1Q9XA 5CY4A 1WSJA 1RTJA 4O4GA 1RNHA 2P1JA 1SUQA 3L2QA 1X9SA 3L2WA 4FJHA 4M3UA 1EETA 3D0PA 5EU7A 2G8VA 4DFPA 3AVKA 1KLMA 4M3XA 1S1TA 3G10A 3NHGA 4H8KA 3ZSOA 3LP0A 4DSKA 1D5AA 4B3OA 4HUGA 3VA0A 5FROA 3AVCA 4KKOA 2X74A 4M3WA 2ZE2A 3DLEA 1RT1A 3KK1A 2DY4A 2X6NA 2P5OA 3K59A 3AO1A 5J2PA 3PO4A 2HNZA 1DTQA 4B08A 2XY6A 1O1WA 1BQNA 1IKVA 3C6UA 4DWIA 3ZSVA 1NK4A 3NFAA 4KHNA 1ZBIA 3QINA 4IKFA 3O4NA 4B9TA 3VQ4A 2HHWA 1BISA 2FBXA 1RTHA 1JLFA 4HUEA 1T03A 1IKXA 2E4LA 2YV0X 5J2MA 5D3GA 1S6QA 3NH0A 3L3VA 4J2DA 1ZBUA 1RBRA 4CJLA 1UA1A 3AVBA 4CECA 4RG8A 1FK9A 2OZMA 5J2NA 3QERA 4K8XA 2QK9A 3AVHA 3OS2A 3OYJA 3TABA 1VSJA 3KKRA 4CJEA 2RF2A 3VN5A 1DLOA 3OYHA 1RT5A 2B5JA 3B6PA 3O3GA 3RTVA 3ZT3A 4DQPA 2ETJA 3KLFA 1U49A 1D9FA 4DSIA 3SZ2A 2A1RA 3AA4A 1C1BA 1LAWA 4PY5A 4CIEA 4CEDA 3NF9A 4OKJA 4NYNA 1R0AA 1S1WA 4L8RB 4BDYA 1S1VA 3L3UA 4PWDA 4FW1A 1W0HA 4K8ZA 4DMNA 4FJIA 1HQEA 3NGZA 3ZCMA 1D9DA 4QAGA 1IKWA 5J2QA 3HT3A 4CIFA 3CFRA 4JS5A 4J2EA 3BGRA 1L3SA 4KI4A 4AHVA 3CYMA 3AVMA 4KRFA 4HVJA 4XIUA 4BWJA 3RMDA 3SUNA 4CGDA 3FFIA 4EP4A 1VSKA 5DK5A 1SKSA 4E1NA 3AVNA 3KK2A 4OKKA 3VQ9A 1KSPA 2G8KA 4ELVA 4RW4A 3HP6A 4W5TA 2DFHA 1LW0A 5HLFA 4G1QA 4IFVA 1VSFA 3KD1E 1WLJA 4FJ5A 4CGHA 1JLQA 1QSLA 1EX4A 3KLEA 4Z4GA 4CEQA 4FM1A 4M45A 3IS9A 3T1AA 4Q5VA 3AVLA 2YNFA 1A5VA 4RW7A 3P1GA 2HNDA 4CEBA 1VSEA 1CXUA 1JKHA 1RBTA 4BACA 2OZSA 1ZBFA 2HMIA 1NJXA 2NUBA 3MEGA 3AA3A 4F3TA 2OPRA 4HUFA 3SUOA 1NJYA 5FRMA 3ZSXA 2XY7A 2HHQA 3PX6A 2YHAA 2YHBA 4CHPA 4N76A 4YNQA 4FJKA 2Z1GA 4CFBA 3QIPA 3DRRA 5T7BA 4E7HA 4KHYA 3I8DA 4KTZA 1MU2A 1UAXA 3ALYA 3L8BA 4C8OA 2G8FA 2EX3A 3AVFA 1CLQA 2LSNA 1LV5A 3QEIA 2O4IA 4E7LA 1TAQA 4R5PA 4FJMA 3DOKA 4HCCA 4FJJA 2G8HA 4DTMA 1QSYA 4ID5A 2JGUA 3OYLA 5JS2A 4B9VA 2YNIA 4ICLA 1ASVA 3LANA 3MXJA 3AVAA 1NJWA 1TL1A 3QETA 1N6QA 4RW9A 3SQ4A 1G15A 2QXFA 3HK2A 3AO4A 4LH5A 3QNNA 1RBUA 4IG0A 4CJKA 4O0IA 1C0TA 4DSFA 1FKPA 1IKYA 4Z4FA 1C0MA 1YT3A 4WE1A 1JL2A 3KLHA 3AA2A 4CEOA 4DU1A 2EHGA 3AVJA 1LWEA 2RN2A 3I0RA 1SL2A 4CEZA 3O3HA 3K57A 4FLXA 4I7FA 3V9ZA 1BIZA 5HRRA 3LPUA 4CJUA 3V1OA 3SPYA 4FK2A 2GV9A 3IG1A 1NKEA 1A5XA 1TKZA 4O44A 2ATQA 1NK5A 3SQ0A 5DMRA 3CFOA 1X9WA 4FJ7A 3WNGA 4YFUA 3KIOA 3HM9A 4CJSA 1TKXA 1F21A 1RT6A 4H4OA 3HXMA 2F8TA 4CK3A 3DLKA 4CEAA 3OYNA 4DSEA 1TK8A 4F3OA 4KREA 1WSFA 4CGGA 2OPSA 3DMJA 4J2BA 4IG3A 3NDKA 3V4IA 3A2FA 3OJSA 4N41A 4AILC 2VG7A 4CF1A 4KTWA 1XHXA 3EZ5A 2BGGA 1RTDA 3SCXA 3AO5A 3VQ6A 3QESA 3HPOA 3CM5A 4E19A 1C1CA 3HL8A 2GUIA 4QCLA 1VSHA 3ZT0A 4DTNA 1J53A 1RTIA 1HRHA 2JLEA 3L2RA 1XC9A 3MEDA 1HMVA 1GOBA 3QEPA 1FXXA 1TKDA 3OYCA 4DQSA 1HQUA 2G8UA 3KK3A 3DRPA 3QO9A 4TSXA 3HPGA 4AHRA 3NGIA 2E6MA 3RR8A 3ISNC 3ZSQA 3KD5E 2ITGA 2XRIA 3LP1A 4I9LA 4CJRA 4DFMA 4O55A 3TAMA 1X9MA 1JXBA 1C0UA 1TVRA 2E6LA 3ZT4A 3RMCA 1IG9A 3OYBA 1RDAA 3RRHA 1NK8A 3AVIA 4AHCA 1CZ9A 4CF8A 3SPZA 1U4BA 1I3AA 3SYZA 3WNFA 4E7IA 4KI6A 3QEWA 1J54A 1QE1A 4FJ8A 4KHWA 3C6TA 4BE1A 4E1MA 1HYZA 3AV9A 4N5SA 1C6VA 3ASMA 3DLGA 4CK1A 4QOZB 2G8WA 3AO2A 1IO2A 3OYEA 4C8LA 2D0CA 1CXQA 2KW4A 1T05A 1RDBA 1NK6A 2PYJA 4W5NA 2FC0A 2IDOA 3DLBA 4AHTA 1BIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5J A;  3V1R A;  2OPP A;  3NCI A;  4DSJ A;  3NAE A;  4IBN A;  1TK5 A;  1RT7 A;  2ZQB A;  3EYZ A;  3RR7 A;  1SL0 A;  4KTQ A;  4CES A;  3K5M A;  4ID1 A;  2DTU A;  4CJ3 A;  3M8Q A;  2PZS A;  1JLB A;  2XY8 A;  3LP3 A;  3RMB A;  4NCG A;  2AJQ A;  4DU3 A;  3HO1 A;  5CZ2 A;  4CJW A;  2B4J A;  4E0D A;  4FVM A;  1I39 A;  1BI4 B;  4CJF A;  1K6Y A;  1TGO A;  4OPJ A;  3VQQ A;  3OYD A;  4ZTF A;  2RKI A;  4I9Q A;  1JLC A;  4F2S A;  3T19 A;  5SZT A;  3TR8 A;  3ZT1 A;  3K5O A;  3NGY A;  5JS1 A;  4DQQ A;  2HHV A;  2KFZ A;  2VWK A;  4I2Q A;  2D0B A;  3U6F A;  3BDP A;  2IOC A;  4CEE A;  4Z4E A;  2HHX A;  3HP9 A;  4IDK A;  4FLY A;  1T7P A;  4N56 A;  1UA0 A;  3DRS A;  3NF6 A;  1VSM A;  1RIL A;  1D8Y A;  3K5L A;  4DS4 A;  5C25 A;  1FKO A;  3ITH A;  1NKC A;  2B6A A;  2YKM A;  3HYF A;  2OA8 A;  5C24 A;  4DSL A;  1RBS A;  2F96 A;  5KRT A;  3V6D A;  2Z1I A;  2O4G A;  1EP4 A;  4ELT A;  2FBY A;  1QSS A;  1VK0 A;  2YNH A;  4CK2 A;  1WSE A;  1WSH A;  5HP1 A;  3TI0 A;  3MXM A;  1XHZ A;  1LAV A;  4DS5 A;  4MQ3 A;  4RW6 A;  4CJP A;  1ASW A;  4CFD A;  3PX4 A;  4I2P A;  1NK9 A;  1KVA A;  1TV6 A;  5FRN A;  2YKN A;  4CHQ A;  4KV8 A;  4DF4 A;  4BDZ A;  4M41 A;  4CJT A;  3HPH A;  3V9U A;  4DQR A;  4OJR A;  1U45 A;  3QLH A;  5C42 A;  3SJJ A;  3TAE A;  4JRQ A;  4CCH A;  1ASU A;  2IS3 A;  1S1U A;  1RDC A;  3NE6 A;  1NJZ A;  1ZBL A;  4KHQ A;  1BGX T;  1C1A A;  2BAN A;  3PX0 A;  3VA3 A;  4O0J A;  4M3Y A;  4PQU A;  1S6P A;  2IC3 A;  1JLG A;  4AHS A;  4W5O A;  3I0S A;  3TAR A;  4FZZ A;  3ZSY A;  4CHO A;  3OYM A;  1YVU A;  5E41 A;  3OYI A;  4E7K A;  3V9S A;  4FLW A;  5CZ1 A;  3OS0 A;  4DFK A;  3LZJ A;  4FK0 A;  5KI6 A;  3KJV A;  4DTS A;  3ZSR A;  1B9F A;  1HPZ A;  4OGC A;  4CEF A;  3RWU A;  4KHU A;  3P83 D;  1EXQ A;  4CFA A;  1KRP A;  4OVL A;  4CHN A;  3QNO A;  3ZSZ A;  2DFE A;  3NF8 A;  4FJX A;  1S5J A;  4FW2 A;  3E01 A;  1QTM A;  3PO5 A;  2HW3 A;  4CJQ A;  3NH1 A;  3SV3 A;  1YTA A;  4CIG A;  1N5Y A;  3DLH A;  4HHT A;  1B9D A;  1T8E A;  3OYG A;  2Y1J A;  3S3O A;  4FYD A;  4B8A B;  3T3F A;  2HHU A;  4GW6 A;  3SI6 A;  4FLZ A;  2I5J A;  4KAZ A;  4FCY A;  2BE2 A;  2Q3S A;  3DYA A;  3DLR A;  1B92 A;  5SWM A;  1Y97 A;  5HBM A;  4KO0 A;  2XHB A;  4B9L A;  2ZD1 A;  4W5Q A;  1TAU A;  1WAJ A;  4OKE A;  1LWC A;  3M8S A;  1RDD A;  1REV A;  3QEX A;  3MXI A;  1U47 A;  4BWM A;  1U48 A;  3OYK A;  1TK0 A;  3TAG A;  5HRP A;  3K58 A;  4NCA A;  3TAQ A;  4CFC A;  4FJG A;  4H4M A;  4M42 A;  4B9M A;  3L2V A;  3HST B;  1UOC A;  2RPI A;  2IAJ A;  1KLN A;  3KLI A;  2A1S A;  1RT4 A;  1VRT A;  3C95 A;  4JRP A;  4F4K A;  1Z26 A;  1S9G A;  3WNH A;  4Z4H A;  1WNS A;  3TAP A;  4CF9 A;  4EZ6 A;  4E3S A;  3VQ8 A;  3RRG A;  4Z4I A;  3NF7 A;  1W9H A;  3OYF A;  1XI1 A;  1TL3 A;  1GOC A;  4CE9 A;  2KTQ A;  3MAQ A;  2Z1H A;  3LAM A;  3CQ8 A;  4NCB A;  2KZM A;  1RT2 A;  3VQA A;  1QHT A;  4DLE A;  1HYS A;  1HNI A;  3LPT A;  3B6O A;  3CG7 A;  4LD0 A;  1LWF A;  4CGJ A;  4CHY A;  3C94 A;  3EY1 A;  3SNN A;  2VWJ A;  4EP5 A;  4FLT A;  1NK0 A;  4PUO A;  2PYL A;  3IRX A;  4FJN A;  2Z1J A;  4KPY A;  4FJ9 A;  2HHS A;  4Q0B A;  2VG6 A;  1YTU A;  1XWL A;  3KKS A;  3NH2 A;  2P51 A;  4FK4 A;  2IGI A;  4CF2 A;  4FM0 A;  3VQ7 A;  3TAN A;  4OLB A;  3AA5 X;  5CYM A;  4E7J A;  1S9E A;  3AVG A;  3L2U A;  2WON A;  1VRU A;  1NOZ A;  3OJU A;  1L3T A;  4PA1 A;  4AH9 A;  3DOL A;  3V9X A;  4J2A A;  3PV8 A;  1QQC A;  5HRO A;  5I3U A;  1SKR A;  4HCB A;  2HVH A;  3JSM A;  3SUQ A;  3K2P A;  4W5R A;  4ELU A;  2BDP A;  4KB1 A;  4FXD A;  4JLH A;  5KGX A;  4FJL A;  1HNV A;  3V9W A;  1A5W A;  4GMJ B;  1NK7 A;  3KTQ A;  4CER A;  3S3M A;  4F2R A;  3V81 A;  3PY8 A;  3LWL A;  4CGI A;  2Y1I A;  1BCM A;  3H08 A;  5I42 A;  2W42 A;  4B9N A;  3SQ1 A;  1Z25 A;  3V1Q A;  4DG1 A;  1KFS A;  4C8K A;  2KQ2 A;  2GBZ A;  1ITG A;  3HVT A;  3JYT A;  1NKB A;  3VQB A;  1CZB A;  2HB5 A;  1VSD A;  4LH4 A;  4B9S A;  4M3Z A;  1BQM A;  2PY5 A;  3OYA A;  4DU4 A;  4F8R A;  1UWB A;  3SUP A;  3O4Q A;  4KHS A;  4CJ4 A;  4N47 A;  1JLE A;  4FZY A;  3OY9 A;  2X78 A;  4DLG A;  3LAL A;  2OPQ A;  3UIQ A;  4LY7 A;  4FLU A;  1J5O A;  3RMA A;  1WN7 A;  4AHU A;  2R7Y A;  3THV A;  2D5R A;  1EKE A;  3LAK A;  4OGE A;  4Y1C A;  3S9H A;  4HTU A;  1IH7 A;  3VQ5 A;  1L5U A;  4OLA A;  2KZZ A;  4DQI A;  2P5G A;  2XO7 A;  4C8N A;  1QS4 A;  2HVI A;  3G0Z A;  2X6S A;  2VG5 A;  5KGW A;  4B8C A;  4JS4 A;  3IAY A;  4LSL A;  1WSG A;  5FDL A;  1VSL A;  5KRS A;  4Y1D A;  3U3Y A;  4BE0 A;  2D0A A;  4Z4C A;  4KFB A;  1JXE A;  2YNG A;  3DM2 A;  4O5B A;  3U3G A;  3MEC A;  4MFB A;  5K14 A;  4CJ5 A;  3F9K A;  5HRN A;  5J1E A;  3ULD A;  1KFD A;  1X1P A;  2DFF A;  4IFY A;  1ZBH A;  4B9U A;  3VQE A;  4EZ9 A;  1HJR A;  3KLG A;  3QEV A;  1RT3 A;  4DTP A;  3AO3 A;  3SV4 A;  3CM6 A;  1L3U A;  4NYF A;  1LW2 A;  4C8M A;  2QKK A;  4FZX C;  2XY5 A;  1GOA A;  3TWH A;  4KB0 A;  4DTU A;  2F8S A;  4CHZ A;  4ZTJ A;  4GVM A;  1KVC A;  3CFP A;  1RBV A;  5HRS A;  3VQD A;  3MEE A;  2KFN A;  1KCF A;  2G8I A;  3DI6 A;  1JLA A;  1SL1 A;  4RW8 A;  3WNE A;  4LSN A;  1BCO A;  1J9A A;  3O3F A;  4DF8 A;  3SQ2 A;  4DTX A;  1SKW A;  3M8P A;  4M3T A;  4Z0U A;  1BHL A;  1Q8I A;  1JL1 A;  3LZI A;  1HYV A;  1KVB A;  4CGF A;  4E89 A;  4FLV A;  4ZHR A;  1TKT A;  1L3V A;  1S1X A;  3LP2 A;  3QIO A;  1SV5 A;  1ZYQ A;  3K5N A;  1RCH A;  4BDP A;  1Q9Y A;  1KTQ A;  3VQP A;  3OS1 A;  2HHT A;  5CYQ A;  1WAF A;  3NBP A;  3ZSW A;  2FBV A;  1VSI A;  4DFJ A;  2FBT A;  4FM2 A;  3HJF A;  4M3R A;  3VQC A;  3M8R A;  1BL3 A;  2WOM A;  3S3N A;  2OYQ A;  1U04 A;  3LWM A;  2HNY A;  4BE2 A;  1NOY A;  4UQG A;  3LDS A;  3HVR A;  3D45 A;  3PUF A;  1DTT A;  4DTJ A;  3TAF A;  4OPK A;  4DTR A;  3ZT2 A;  4DTO A;  5KTQ A;  1WSI A;  2QKB A;  1BI4 A;  3OVN A;  4CJV A;  4CF0 A;  3F73 A;  1Q9X A;  5CY4 A;  1WSJ A;  1RTJ A;  4O4G A;  1RNH A;  2P1J A;  1SUQ A;  3L2Q A;  1X9S A;  3L2W A;  4FJH A;  4M3U A;  1EET A;  3D0P A;  5EU7 A;  2G8V A;  4DFP A;  3AVK A;  1KLM A;  4M3X A;  1S1T A;  3G10 A;  3NHG A;  4H8K A;  3ZSO A;  3LP0 A;  4DSK A;  1D5A A;  4B3O A;  4HUG A;  3VA0 A;  5FRO A;  3AVC A;  4KKO A;  2X74 A;  4M3W A;  2ZE2 A;  3DLE A;  1RT1 A;  3KK1 A;  2DY4 A;  2X6N A;  2P5O A;  3K59 A;  3AO1 A;  5J2P A;  3PO4 A;  2HNZ A;  1DTQ A;  4B08 A;  2XY6 A;  1O1W A;  1BQN A;  1IKV A;  3C6U A;  4DWI A;  3ZSV A;  1NK4 A;  3NFA A;  4KHN A;  1ZBI A;  3QIN A;  4IKF A;  3O4N A;  4B9T A;  3VQ4 A;  2HHW A;  1BIS A;  2FBX A;  1RTH A;  1JLF A;  4HUE A;  1T03 A;  1IKX A;  2E4L A;  2YV0 X;  5J2M A;  5D3G A;  1S6Q A;  3NH0 A;  3L3V A;  4J2D A;  1ZBU A;  1RBR A;  4CJL A;  1UA1 A;  3AVB A;  4CEC A;  4RG8 A;  1FK9 A;  2OZM A;  5J2N A;  3QER A;  4K8X A;  2QK9 A;  3AVH A;  3OS2 A;  3OYJ A;  3TAB A;  1VSJ A;  3KKR A;  4CJE A;  2RF2 A;  3VN5 A;  1DLO A;  3OYH A;  1RT5 A;  2B5J A;  3B6P A;  3O3G A;  3RTV A;  3ZT3 A;  4DQP A;  2ETJ A;  3KLF A;  1U49 A;  1D9F A;  4DSI A;  3SZ2 A;  2A1R A;  3AA4 A;  1C1B A;  1LAW A;  4PY5 A;  4CIE A;  4CED A;  3NF9 A;  4OKJ A;  4NYN A;  1R0A A;  1S1W A;  4L8R B;  4BDY A;  1S1V A;  3L3U A;  4PWD A;  4FW1 A;  1W0H A;  4K8Z A;  4DMN A;  4FJI A;  1HQE A;  3NGZ A;  3ZCM A;  1D9D A;  4QAG A;  1IKW A;  5J2Q A;  3HT3 A;  4CIF A;  3CFR A;  4JS5 A;  4J2E A;  3BGR A;  1L3S A;  4KI4 A;  4AHV A;  3CYM A;  3AVM A;  4KRF A;  4HVJ A;  4XIU A;  4BWJ A;  3RMD A;  3SUN A;  4CGD A;  3FFI A;  4EP4 A;  1VSK A;  5DK5 A;  1SKS A;  4E1N A;  3AVN A;  3KK2 A;  4OKK A;  3VQ9 A;  1KSP A;  2G8K A;  4ELV A;  4RW4 A;  3HP6 A;  4W5T A;  2DFH A;  1LW0 A;  5HLF A;  4G1Q A;  4IFV A;  1VSF A;  3KD1 E;  1WLJ A;  4FJ5 A;  4CGH A;  1JLQ A;  1QSL A;  1EX4 A;  3KLE A;  4Z4G A;  4CEQ A;  4FM1 A;  4M45 A;  3IS9 A;  3T1A A;  4Q5V A;  3AVL A;  2YNF A;  1A5V A;  4RW7 A;  3P1G A;  2HND A;  4CEB A;  1VSE A;  1CXU A;  1JKH A;  1RBT A;  4BAC A;  2OZS A;  1ZBF A;  2HMI A;  1NJX A;  2NUB A;  3MEG A;  3AA3 A;  4F3T A;  2OPR A;  4HUF A;  3SUO A;  1NJY A;  5FRM A;  3ZSX A;  2XY7 A;  2HHQ A;  3PX6 A;  2YHA A;  2YHB A;  4CHP A;  4N76 A;  4YNQ A;  4FJK A;  2Z1G A;  4CFB A;  3QIP A;  3DRR A;  5T7B A;  4E7H A;  4KHY A;  3I8D A;  4KTZ A;  1MU2 A;  1UAX A;  3ALY A;  3L8B A;  4C8O A;  2G8F A;  2EX3 A;  3AVF A;  1CLQ A;  2LSN A;  1LV5 A;  3QEI A;  2O4I A;  4E7L A;  1TAQ A;  4R5P A;  4FJM A;  3DOK A;  4HCC A;  4FJJ A;  2G8H A;  4DTM A;  1QSY A;  4ID5 A;  2JGU A;  3OYL A;  5JS2 A;  4B9V A;  2YNI A;  4ICL A;  1ASV A;  3LAN A;  3MXJ A;  3AVA A;  1NJW A;  1TL1 A;  3QET A;  1N6Q A;  4RW9 A;  3SQ4 A;  1G15 A;  2QXF A;  3HK2 A;  3AO4 A;  4LH5 A;  3QNN A;  1RBU A;  4IG0 A;  4CJK A;  4O0I A;  1C0T A;  4DSF A;  1FKP A;  1IKY A;  4Z4F A;  1C0M A;  1YT3 A;  4WE1 A;  1JL2 A;  3KLH A;  3AA2 A;  4CEO A;  4DU1 A;  2EHG A;  3AVJ A;  1LWE A;  2RN2 A;  3I0R A;  1SL2 A;  4CEZ A;  3O3H A;  3K57 A;  4FLX A;  4I7F A;  3V9Z A;  1BIZ A;  5HRR A;  3LPU A;  4CJU A;  3V1O A;  3SPY A;  4FK2 A;  2GV9 A;  3IG1 A;  1NKE A;  1A5X A;  1TKZ A;  4O44 A;  2ATQ A;  1NK5 A;  3SQ0 A;  5DMR A;  3CFO A;  1X9W A;  4FJ7 A;  3WNG A;  4YFU A;  3KIO A;  3HM9 A;  4CJS A;  1TKX A;  1F21 A;  1RT6 A;  4H4O A;  3HXM A;  2F8T A;  4CK3 A;  3DLK A;  4CEA A;  3OYN A;  4DSE A;  1TK8 A;  4F3O A;  4KRE A;  1WSF A;  4CGG A;  2OPS A;  3DMJ A;  4J2B A;  4IG3 A;  3NDK A;  3V4I A;  3A2F A;  3OJS A;  4N41 A;  4AIL C;  2VG7 A;  4CF1 A;  4KTW A;  1XHX A;  3EZ5 A;  2BGG A;  1RTD A;  3SCX A;  3AO5 A;  3VQ6 A;  3QES A;  3HPO A;  3CM5 A;  4E19 A;  1C1C A;  3HL8 A;  2GUI A;  4QCL A;  1VSH A;  3ZT0 A;  4DTN A;  1J53 A;  1RTI A;  1HRH A;  2JLE A;  3L2R A;  1XC9 A;  3MED A;  1HMV A;  1GOB A;  3QEP A;  1FXX A;  1TKD A;  3OYC A;  4DQS A;  1HQU A;  2G8U A;  3KK3 A;  3DRP A;  3QO9 A;  4TSX A;  3HPG A;  4AHR A;  3NGI A;  2E6M A;  3RR8 A;  3ISN C;  3ZSQ A;  3KD5 E;  2ITG A;  2XRI A;  3LP1 A;  4I9L A;  4CJR A;  4DFM A;  4O55 A;  3TAM A;  1X9M A;  1JXB A;  1C0U A;  1TVR A;  2E6L A;  3ZT4 A;  3RMC A;  1IG9 A;  3OYB A;  1RDA A;  3RRH A;  1NK8 A;  3AVI A;  4AHC A;  1CZ9 A;  4CF8 A;  3SPZ A;  1U4B A;  1I3A A;  3SYZ A;  3WNF A;  4E7I A;  4KI6 A;  3QEW A;  1J54 A;  1QE1 A;  4FJ8 A;  4KHW A;  3C6T A;  4BE1 A;  4E1M A;  1HYZ A;  3AV9 A;  4N5S A;  1C6V A;  3ASM A;  3DLG A;  4CK1 A;  4QOZ B;  2G8W A;  3AO2 A;  1IO2 A;  3OYE A;  4C8L A;  2D0C A;  1CXQ A;  2KW4 A;  1T05 A;  1RDB A;  1NK6 A;  2PYJ A;  4W5N A;  2FC0 A;  2IDO A;  3DLB A;  4AHT A;  1BIU A; 
#chains in the Genus database with same CATH topology
 4DSJ A;  3V1R A;  4IBN A;  1RT7 A;  2NNW A;  3EYZ A;  4JI8 K;  4CES A;  2DTU A;  4BRN A;  4ILG B;  3CJ7 A;  3TPQ A;  3CPW M;  4GV9 A;  4CJW A;  1G99 A;  2B4J A;  4FVM A;  1K6Y A;  3C65 A;  3C6H A;  4ZTF A;  2RKI A;  4LC9 B;  3K5O A;  2HHV A;  5AQR A;  3CQX A;  2KFZ A;  4I2Q A;  3BDP A;  4Z4E A;  3CET A;  2HHX A;  3H3N O;  4CZG A;  5BRD A;  3DRS A;  3NF6 A;  1VSM A;  4WQ4 A;  1D8Y A;  5CR4 A;  2NRX A;  3IDH A;  4DV3 K;  3ITH A;  2OA8 A;  5C24 A;  1RBS A;  2F96 A;  4JD2 B;  5KRT A;  1EP4 A;  2P9I A;  4ELT A;  1DGK N;  2FBY A;  4CK2 A;  2HBL A;  1ATN A;  3EKS A;  5AQX A;  3TI0 A;  2BH1 A;  3OA9 A;  3QFU A;  4RW6 A;  4BVO A;  3TU5 A;  4CJP A;  5TKW A;  4CFD A;  4DR7 K;  3D2F B;  3H46 O;  4I2P A;  5AQT A;  4BDZ A;  4FWQ A;  2H3G X;  3TSU A;  1S1U A;  1NJZ A;  1BGX T;  1C1A A;  4CI6 A;  2BAN A;  3NMU A;  3AAQ A;  1LCU A;  3VMF B;  3I0S A;  4FZZ A;  1GLA G;  5E41 A;  1ATR A;  3VES A;  3DXM B;  1OH5 A;  2QEX N;  3VER A;  4KHU A;  4OGC A;  3P83 D;  1EXQ A;  4CZK A;  1KRP A;  2F7T A;  4BQL A;  5AZJ B;  4FJX A;  1S5J A;  3E01 A;  1HPM A;  1YTA A;  1N5Y A;  1V4S A;  1VAZ A;  2HST A;  2UYT A;  3LM2 A;  3O1B A;  4KAZ A;  4C23 A;  3DYA A;  4YY3 K;  3DLR A;  5HBM A;  3SAH A;  2ZD1 A;  1TAU A;  1T6D A;  3CC4 N;  4OKE A;  1LWC A;  3MXI A;  4BR9 A;  3WXJ A;  1VQ4 N;  3K58 A;  4NCA A;  3SLC A;  1Z05 A;  2RPI A;  2IAJ A;  2A1S A;  3A5O C;  4JRP A;  4Z4H A;  3FGU A;  1WNS A;  3SMP A;  3TAP A;  1W9H A;  3OYF A;  1TL3 A;  2AA4 A;  3W0L A;  4PKH A;  4CE9 A;  2KTQ A;  3LAM A;  3THX B;  1QHT A;  5AQG A;  4A59 A;  3B6O A;  4LD0 A;  4IO9 L;  4CGJ A;  3EY1 A;  3SNN A;  4DUY K;  2VWJ A;  1NK0 A;  3L6Q A;  2VGN A;  2HHS A;  1XWL A;  3KK7 A;  3M6G A;  4CF2 A;  3GDQ A;  2D4W A;  3L2U A;  2O8C B;  2WON A;  4H5W A;  2UUA K;  1XMO K;  1L3T A;  3HI0 A;  3OJU A;  4DR3 K;  5AQQ A;  4J2A A;  2UU9 K;  1C0G A;  3PSI A;  3SUQ A;  3K2P A;  4W5R A;  4KB1 A;  4FJL A;  4WYB A;  1HNV A;  1WUA A;  3CCS N;  3V9W A;  3KTQ A;  1YF5 L;  2W42 A;  3E9P A;  2YCH A;  2GBZ A;  3VEN A;  1NKB A;  4DU4 A;  3MN5 A;  3SUP A;  3LL3 A;  4PKI A;  1R59 O;  1JLE A;  4IOC L;  3UIQ A;  4LY7 A;  1WN7 A;  3P31 A;  3LAK A;  4IOA L;  3O5B A;  4OLA A;  3EKU A;  1QS4 A;  3SBG A;  3G0Z A;  5FDL A;  5KRS A;  1VSL A;  3ATV A;  5AQK A;  3HBT A;  5AJ3 K;  4MLE A;  3U3G A;  3F9K A;  2ITM A;  4IFY A;  3K0S A;  4BRL A;  4NYF A;  2QKK A;  2XY5 A;  1GOA A;  2F8S A;  4CHZ A;  4H0T B;  2O8B A;  1KVC A;  3VQD A;  3LM9 A;  3MEE A;  2KFN A;  4RW8 A;  1OVY A;  1J9A A;  1BCO A;  2ASM A;  1Q8I A;  4I9Q A;  1TKT A;  1QVG M;  2QWL A;  4BDP A;  2HHT A;  4FPB A;  3ZSW A;  1SQK A;  1VSI A;  2FBT A;  4JKH A;  3HJF A;  1VQP N;  1NGH A;  1BU6 O;  4A5B A;  3J8A A;  1QZ6 A;  3S3N A;  1YJ9 N;  3LWM A;  2IVP A;  4JKG B;  3PUF A;  4DTR A;  3D2E A;  4JI5 K;  3OVN A;  5CY4 A;  1WSJ A;  3Q7C A;  1RNH A;  2FF3 B;  2P1J A;  2Q0U A;  4M3U A;  1IG8 A;  2G8V A;  4IDH A;  4DFP A;  3ZEU A;  3QIC A;  1N36 K;  3G10 A;  4H8K A;  3LP0 A;  4B3O A;  5FRO A;  3AVC A;  1RT1 A;  3KK1 A;  1GLF O;  3AO1 A;  4FWN A;  4B08 A;  3S41 A;  1O1W A;  3C6U A;  5EXW A;  3CPE A;  4NO7 A;  3QIN A;  2FBX A;  3BZK A;  1JLF A;  4H0O A;  3UKU B;  1S6Q A;  3L3V A;  4LF8 K;  1HUX A;  1RBR A;  1UA1 A;  3AVB A;  3SMS A;  4BC4 A;  4B3R K;  3E1Y A;  1HKC A;  4QS7 A;  3WEE B;  3U4L A;  3OS2 A;  1VSJ A;  2PAV A;  3VN5 A;  2B5J A;  3B6P A;  1MWM A;  2O8E A;  3EN9 A;  3NF9 A;  2E2Q A;  4KH5 A;  1S1W A;  3VEO A;  4L8R B;  3A5N C;  3L3U A;  4OO1 J;  4FW1 A;  2A5X A;  1W0H A;  2E20 A;  4JK7 A;  4Z94 A;  1HQE A;  4QAG A;  4JS5 A;  2VQF K;  3BGR A;  3QB0 A;  3OTO K;  3RMD A;  3SUN A;  1JCE A;  1VSK A;  4E1N A;  3AVN A;  4U67 L;  4OKK A;  3A5M C;  4FWM A;  2O8F B;  3CQY A;  2G8K A;  3FE1 A;  4W5T A;  1LW0 A;  4IFV A;  1VSF A;  3TTD A;  4CEQ A;  5AZI B;  4FL9 A;  4PHT X;  4IO8 A;  4Q5V A;  3AVL A;  4A2B A;  2UXC K;  2HND A;  1VSE A;  2Q1N A;  4RCH A;  4FOI A;  3CC2 N;  4MO5 A;  3MEG A;  1YAG A;  3PX6 A;  2YHA A;  2YHB A;  2YHY A;  1U2V B;  3DRR A;  5T7B A;  4KHY A;  4JK9 A;  4HWI A;  2G8F A;  2LSN A;  4B1X B;  3VPZ A;  3P4I A;  2G8H A;  4DTM A;  1QSY A;  4ID5 A;  2JGU A;  3I8B A;  5C0Y A;  5C2F A;  1HNW K;  3FZM A;  1QQM A;  2E1Z A;  1N6Q A;  4RW9 A;  5M1N A;  1G15 A;  2CGK A;  2GWJ A;  1C0T A;  1FKP A;  5CE3 A;  4BC2 A;  1NLV A;  4CEO A;  1VQK N;  4DR5 K;  5JVG L;  3O3H A;  1BIZ A;  2E2P A;  1VQN N;  5AQY A;  3TTF A;  2GV9 A;  3QBW A;  3PIP L;  3E9O A;  2QA4 N;  4FJ7 A;  2CGJ A;  3CFO A;  4YFU A;  4YOV A;  4JI6 K;  1F21 A;  1RT6 A;  2F8T A;  3SAG A;  1TK8 A;  2FSK A;  3OBW A;  3DMJ A;  1XHX A;  1T3V A;  1RTD A;  3M5R A;  2CH6 A;  3HPO A;  2WC9 A;  3CM5 A;  4B3M K;  3WXI A;  3DXK A;  1J53 A;  1RTI A;  3N4P A;  3MED A;  1HMV A;  2JWL A;  1GOB A;  3FZK A;  1HQU A;  1FJG K;  3ISN C;  2XRI A;  3LP1 A;  4I9L A;  4DFM A;  2E6L A;  3RMC A;  3OYB A;  1RDA A;  1NGC A;  4KI6 A;  1KD1 O;  4KH4 A;  1CZA N;  3VGM A;  3AV9 A;  4N5S A;  1C6V A;  3DLG A;  2G8W A;  4MO4 A;  2D0C A;  1MA9 B;  4W5N A;  1VSD A;  2CGL A;  2IDO A;  3DLB A;  1BIU A;  1IBM K;  4AF1 A;  1TK5 A;  4ID1 A;  3M8Q A;  4FWR A;  5JIC A;  1JLB A;  3LP3 A;  4NCG A;  3JXU A;  3HO1 A;  1NMD A;  1K8K A;  3IKM A;  2ZGZ A;  1I39 A;  5ELZ A;  2A42 A;  3OYD A;  1ZBS A;  3WXL A;  4CBU A;  3I55 N;  1JLC A;  2V52 B;  2ZJQ L;  5SZT A;  5FPM A;  5JS1 A;  3RSE B;  2UUC K;  2D0B A;  1HNX K;  4CEE A;  4IDK A;  1MDU B;  5JVH L;  1QHA A;  1NJI O;  1FKO A;  2YKM A;  5AQN A;  4CZL A;  3HYF A;  3J7A P;  5BN8 A;  1YHQ N;  1YIT N;  4KHP K;  4DCH A;  4DSL A;  4H0V B;  2O4G A;  3ZX3 A;  1QSS A;  1BG3 A;  1VK0 A;  1WSE A;  3THW A;  4CBW A;  1LAV A;  3VGL A;  1ASW A;  1TV6 A;  4DV4 K;  4KV8 A;  4CJT A;  2RE2 A;  2ASO A;  3V9U A;  4DQR A;  3DAW A;  3HSC A;  1RDC A;  3NE6 A;  1OVQ A;  4LF9 K;  2KLA A;  4PQU A;  1JLG A;  4AHS A;  1BUP A;  2GWK A;  3TAR A;  3ZSY A;  4DR2 K;  1YVU A;  3V9S A;  1TUU A;  5CZ1 A;  3KJV A;  1KC8 O;  3RWU A;  1B9F A;  1HPZ A;  4CEF A;  4J8F A;  4CFA A;  4OVL A;  5AFU A;  5BPL A;  4CHN A;  3QNO A;  3QML A;  1VQ5 N;  3NF8 A;  4H5N A;  1BWF O;  1WBB A;  3PO5 A;  1DEJ A;  5AQS A;  4JKE A;  4CJQ A;  4YHH K;  3NH1 A;  3DLH A;  1B9D A;  3T3F A;  3SJH A;  2HHU A;  4GW6 A;  4BRF A;  4CZI A;  3VEX A;  4FLZ A;  3WT0 A;  3L0Q A;  5DM6 L;  4EAH D;  2BE2 A;  2BTF A;  2Q3S A;  3TTC A;  1Y97 A;  5SWM A;  4DV7 K;  4BR0 A;  1WAJ A;  2V7Z A;  1RDD A;  1U47 A;  3G71 N;  1U48 A;  4H0X B;  3OYK A;  3TAQ A;  3EO3 A;  4BRQ A;  4H4M A;  4YOW A;  3T1H K;  4LF5 K;  2YJF A;  2FF6 A;  4M7X A;  2P9L A;  3KLI A;  1VRT A;  4F4K A;  1Z26 A;  3WNH A;  3P39 A;  2ZF5 O;  4E3S A;  4YOR A;  4Z4I A;  1RDU A;  4DV5 K;  1XI1 A;  2KZM A;  4NCB A;  4FWS A;  1RT2 A;  2P9U B;  3VQA A;  2GEM A;  4C1N K;  4DLE A;  5LMU K;  3LPT A;  3BZC A;  3CG7 A;  3C94 A;  3LDN A;  4PUO A;  4FLT A;  4FWO A;  3IRX A;  4FJN A;  2Z1J A;  3O9R A;  4Q0B A;  2VG6 A;  1GLJ O;  4BR4 A;  1C0F A;  4DHY A;  3AA5 X;  4E7J A;  1IBL K;  1S9E A;  5IWA K;  2W6K A;  3T69 A;  1W7A A;  4PA1 A;  2E5L K;  4DV6 K;  3CIP A;  3PV8 A;  3GE1 A;  4DV0 K;  4HCB A;  3WUH A;  2BDP A;  1NGG A;  1SAZ A;  1NK7 A;  4F2R A;  4CER A;  4B9N A;  4CGI A;  1BCM A;  1NM1 A;  3H08 A;  3V1Q A;  4DG1 A;  4C8K A;  3F9M A;  2KQ2 A;  3HVT A;  4H5V A;  3JYT A;  3VQB A;  4WQ5 A;  1BQM A;  3R9P A;  3VEZ A;  4LFC K;  3O9T A;  1X3N A;  3O4Q A;  1HNZ K;  4KHS A;  1Q18 A;  4XEI A;  1NGB A;  4FWL A;  4FZY A;  2YX6 A;  2X78 A;  1J5O A;  3RMA A;  4O8U A;  1E4F T;  3THV A;  5F1X A;  2D5R A;  4OGE A;  4HTU A;  2P9S B;  2KZZ A;  2XO7 A;  2X6S A;  1J6Z A;  5KGW A;  4B8C A;  3BY5 A;  4Y0W A;  3UB5 A;  3IAY A;  4Y1D A;  2OCE A;  4KFB A;  1JXE A;  3DM2 A;  4O5B A;  5GAD P;  4FK0 A;  3OBY A;  3ULD A;  1KFD A;  2DFF A;  4B9U A;  3QEV A;  1RT3 A;  1W97 L;  4JYA K;  3AO3 A;  3CM6 A;  4WFN L;  4FZX C;  5AQP A;  1HX1 A;  1N33 K;  1QZ5 A;  3CER A;  4ZTJ A;  3CFP A;  3WNE A;  3SQ2 A;  1SKW A;  4Z0U A;  1BHL A;  1JJ2 M;  1JL1 A;  1KVB A;  4E89 A;  4MDA A;  4ZHR A;  4JEP A;  3CCJ N;  2OTJ N;  1ZYQ A;  3OS1 A;  1WAF A;  4FM2 A;  2ASP A;  2FXU A;  3EE9 A;  4GVE A;  3M8R A;  3G4S N;  3CCR N;  3I33 A;  2OYQ A;  3KWG A;  4B3T K;  4BRG A;  3D7E O;  4DTJ A;  3TAF A;  3BF3 A;  5KTQ A;  1WSI A;  4X66 K;  4M7Y A;  2IVN A;  1Q9X A;  2HF3 A;  1IBK K;  1TYQ B;  3L2W A;  3D0P A;  1YJN N;  3AVK A;  4M3X A;  3GBT A;  3ZSO A;  4DSK A;  3VA0 A;  2Q36 A;  1E4G T;  4WCE L;  2QWQ A;  2ZE2 A;  3DLE A;  2DY4 A;  4JKB A;  1ZC6 A;  3PO4 A;  2Q97 A;  3HOT A;  1DTQ A;  3T7Z A;  1BQN A;  4DWI A;  1NK4 A;  4JI4 K;  4B9Q A;  4K43 A;  4WF9 L;  2HHW A;  4BR7 A;  4BRC A;  1IKX A;  4JD2 A;  2VYP A;  5D3G A;  3NH0 A;  4J2D A;  2P9N B;  2O8B B;  4YOX A;  4CJL A;  3A5L C;  3THY B;  4CEC A;  1DKG D;  4ILJ A;  2QK9 A;  2QTD A;  2VWB A;  4O8K A;  3O3G A;  3IUC A;  3ZT3 A;  4DQP A;  2ETJ A;  3KLF A;  4DSI A;  1D9F A;  4KH6 A;  2A1R A;  2P9P B;  4OKJ A;  4NYN A;  4JI3 K;  3MN7 A;  1S1V A;  5HL7 L;  4K8Z A;  2HBK A;  4RTF D;  4DMN A;  3NGZ A;  1U6Z A;  1D9D A;  5J2Q A;  3G6E N;  3DXM A;  3HT3 A;  3CFR A;  4KRF A;  3HM8 A;  4AHV A;  3AVM A;  4NLB A;  2F4V K;  5AZJ A;  5DK5 A;  4FVU A;  5GIP A;  1H1V A;  4ISG A;  4ELV A;  3ZEU B;  2NRR A;  3F5T A;  1LOT B;  4G1Q A;  1VQO N;  5I9E B;  1WLJ A;  4FJ5 A;  4MLH A;  1KAX A;  1QSL A;  1IV0 A;  4Z4G A;  4M45 A;  3IS9 A;  4LF4 K;  3GG4 A;  5E84 A;  1RBT A;  3FZL A;  2HMI A;  1NJX A;  4BRP A;  5FRM A;  3CI5 A;  4YNQ A;  3QIP A;  3L8B A;  3ALY A;  4JKC A;  2EX3 A;  1CLQ A;  1TAQ A;  2A40 A;  4FJJ A;  5GIO A;  3MN9 A;  2J4R A;  3LAN A;  3MXJ A;  3AVA A;  5BRE A;  1TL1 A;  2RHK A;  3QET A;  3SQ4 A;  3BP8 A;  3AO4 A;  3QNN A;  2A41 A;  4O0I A;  4DSF A;  1IKY A;  1C0M A;  1YT3 A;  1Q86 O;  3H1V X;  3ZET B;  4NXN K;  5B8H A;  1SL2 A;  3K57 A;  3V9Z A;  3GOI A;  4CJU A;  4JN4 A;  3C0B A;  2ATQ A;  5DMR A;  1X9W A;  3WNG A;  4LF6 K;  4L3Q A;  3KIO A;  3HM9 A;  3DLK A;  4BR2 A;  2VQE K;  4DKW A;  3FR0 A;  1WSF A;  2NRW A;  4J2B A;  4IG3 A;  3V4I A;  4BRO A;  4N41 A;  4CF1 A;  4ILH A;  4KTW A;  4BG8 A;  4A61 A;  5LY3 A;  2HMP A;  3EZ5 A;  3QES A;  2UUB K;  1C1C A;  4QCL A;  2GUI A;  1VSH A;  4JKA A;  3ZT0 A;  1HRH A;  1FXX A;  2QM1 A;  3MX2 A;  2FSJ A;  4DQS A;  3KK3 A;  3HPG A;  4AHR A;  2UXD K;  4B1U B;  3ZSQ A;  3TAM A;  1X9M A;  1JXB A;  3ZLJ A;  5KPZ A;  3VOV A;  2ZJP L;  1CZ9 A;  1U4B A;  3SYZ A;  4E7I A;  2NRV A;  4KHW A;  5GAE P;  4E1M A;  1HYZ A;  3OYE A;  4OPH A;  2PBD A;  3Q7B A;  3PIO L;  1YXQ A;  3O4W A;  4AHT A;  3NCI A;  2OPP A;  4OX9 K;  3GL1 A;  2ZQB A;  3O8M A;  4F9O A;  3I56 N;  1VQL N;  1SL0 A;  3K5M A;  5BRF A;  2XY8 A;  3RMB A;  4CZE A;  4DU3 A;  4E0D A;  5EY4 A;  1BI4 B;  3J7Z O;  1TGO A;  1T6C A;  4OPJ A;  1VQ9 N;  5BRH A;  4E1J A;  5AFU H;  3T19 A;  3ZT1 A;  3MCA B;  3AAP A;  3ULE B;  1EO1 A;  4AM7 A;  3CC7 N;  3VET A;  3VF6 A;  3N4Q A;  4FLY A;  1T7P A;  1UA0 A;  1XMQ K;  1RIL A;  3K5L A;  4DS4 A;  5C25 A;  2PFU A;  1NKC A;  2B6A A;  2YHW A;  3O1W A;  3VEY A;  1DT9 A;  2Z1I A;  3BUZ B;  2YNH A;  5HP1 A;  1XHZ A;  4BGB A;  1NK9 A;  1KVA A;  5FRN A;  2YKN A;  4DF4 A;  3E9L A;  4IJA A;  3CJB A;  4OJR A;  1U45 A;  3QLH A;  4I6M B;  1ASU A;  3WQU A;  4KHQ A;  3VA3 A;  4H0Y B;  4JNE A;  4O0J A;  3UKU A;  4M3Y A;  4CW7 B;  5EVZ A;  2E2O A;  4K42 A;  3OYM A;  4CHO A;  2OAN A;  4E7K A;  4FLW A;  1Q82 O;  4BRA A;  3TSP A;  3LZJ A;  3WEE A;  5GAH P;  3ZSR A;  4DTS A;  2O8D B;  3A0I X;  4A2A A;  3ZSZ A;  2DFE A;  4DUZ K;  2QWO A;  1YJW N;  4FW2 A;  3KWI A;  1QTM A;  4CZH A;  3SV3 A;  4YOU A;  3QFP A;  4CIG A;  2Y1J A;  1WOQ A;  2I5J A;  4FCY A;  1W2B M;  1B92 A;  2QWP A;  4W5Q A;  3CCQ N;  3M8S A;  3QEX A;  4BWM A;  5LL6 Z;  3TAG A;  5HRP A;  5BPN A;  1BA0 A;  4CFC A;  4FJG A;  4B9M A;  3HST B;  2O8F A;  1UOC A;  1GLB G;  1KLN A;  3PSF A;  1RT4 A;  3H3O B;  4IOX A;  1WBD A;  2P9K B;  4CF9 A;  4EZ6 A;  4XH1 A;  3NF7 A;  4LF7 K;  3VEW A;  4YOY A;  3L4Q A;  3SK3 A;  3MAQ A;  4X64 K;  3CJC A;  3TSQ A;  3P38 A;  1XUP O;  1HNI A;  4BC5 A;  3ZX2 A;  4CHY A;  1U2V A;  4KPY A;  4A57 A;  3KKS A;  2P51 A;  3AGK A;  4FM0 A;  4BR5 A;  5EX5 A;  3TAN A;  4PL7 A;  2NRT A;  1VRU A;  3U9D A;  2UXB K;  5AQW A;  1HJO A;  3DOL A;  3V9X A;  5HRO A;  1QQC A;  2HVH A;  4FXD A;  5KGX A;  4H5R A;  1A5W A;  5AQM A;  3LWL A;  2Y1I A;  5I42 A;  3SQ1 A;  1KFS A;  1KQS M;  2F9T A;  1CZB A;  2HB5 A;  1QQO A;  3CCL N;  4B9S A;  4CBX A;  4XH5 A;  3OYA A;  1YVN A;  1M90 O;  4CJ4 A;  5AQF A;  3H45 C;  5C12 A;  1EWQ A;  4DLG A;  4GV6 A;  2OPQ A;  1L5U A;  4Y1C A;  4BRM A;  4DQI A;  1VHX A;  2E2N A;  4H03 B;  4LSL A;  4Z4C A;  5HRN A;  3MEC A;  4MFB A;  5K14 A;  5J1E A;  2KHO A;  3LDQ A;  1S3X A;  4BY9 C;  1ZBH A;  1NBW A;  4EZ9 A;  3DLL L;  3KLG A;  3SV4 A;  2FSN A;  2Q2R A;  4C8M A;  1FW6 A;  4IXC A;  3TWH A;  4KB0 A;  4GVM A;  5HRS A;  4BRD A;  1KXP A;  4EHT A;  3U8X A;  1KCF A;  2G8I A;  4QS9 A;  1SL1 A;  4LSN A;  3O3F A;  4DF8 A;  4DTX A;  4M3T A;  3LZI A;  1HYV A;  3C6A A;  4CGF A;  3O9S A;  1L3V A;  4K0K K;  5GAG P;  4BRE A;  1S1X A;  1SV5 A;  1Q9Y A;  1KTQ A;  2E88 A;  3NBP A;  1VQ6 N;  4U7B A;  4M3R A;  3VQC A;  2WOM A;  4YDU C;  4BE2 A;  1M1K O;  3HVR A;  1DTT A;  4JHD A;  3ZT2 A;  4B1V A;  4NLC A;  5BPM A;  4CF0 A;  1RTJ A;  4IEI A;  1SUQ A;  3L2Q A;  1EET A;  5EU7 A;  1KLM A;  1S1T A;  5EOY A;  4CVN E;  5KQD A;  3NHG A;  1XQS C;  2P9I B;  4HUG A;  4JAX A;  3C7N A;  3RSE A;  4JI0 K;  3R1X A;  3MCP A;  3M3Z A;  2X6N A;  3L4I A;  4NXM K;  4H0P A;  5M1K A;  1NGE A;  4G9Z A;  3K9K A;  1ZXO A;  1IKV A;  2ZM6 K;  3NFA A;  4KHN A;  4BRI A;  3O4N A;  4B9T A;  3VQ4 A;  4WFA L;  1BIS A;  1RTH A;  2E4L A;  5GIN A;  3R3L A;  2QXL A;  4WQ4 C;  3IMX A;  2OZM A;  4RG8 A;  2D1K A;  5J2N A;  3QER A;  1JCG A;  3AVH A;  3OYJ A;  3KHY A;  3O6W A;  4CJE A;  2RF2 A;  1X9J A;  4MDB A;  4O5F A;  3MMV A;  3RTV A;  4BVP A;  5AQV A;  1BOT O;  1NG9 A;  3SZ2 A;  3AA4 A;  2YI1 A;  3O80 A;  2IIR A;  4JKF A;  1XC3 A;  4H5T A;  3ZCM A;  4CIF A;  1L3S A;  3CYM A;  3EZW A;  4HVJ A;  4XIU A;  4GV3 A;  3FFI A;  3KK2 A;  5LJW A;  4RW4 A;  3HP6 A;  3J80 O;  1EX4 A;  3KLE A;  3MN6 A;  3T1A A;  3UKR A;  4JV5 K;  3K9J A;  3G25 A;  3O08 A;  2W6L A;  2JWK A;  1JKH A;  3PLA A;  2I7P A;  1ZBF A;  1RGI A;  3VF2 A;  2NUB A;  3AA3 A;  4F3T A;  2OPR A;  4HUF A;  3SUO A;  1NJY A;  2HBJ A;  1OH6 A;  5LJV A;  4CHP A;  5BN9 A;  2BUP A;  4CFB A;  4E7H A;  1MU2 A;  1UAX A;  4YOT A;  5AQH A;  4CD1 A;  1LV5 A;  3R8E A;  4R5P A;  3DOK A;  3AY9 A;  3OYL A;  3H1Q A;  4B9V A;  5JS2 A;  1ASV A;  1QVF M;  4JK8 A;  2ZWH A;  3QDK A;  3WXK A;  1NJW A;  2P9U A;  5ADX A;  4LH5 A;  1RBU A;  4IG0 A;  4CJK A;  1E3M A;  1XNQ K;  3JS6 A;  1JL2 A;  3KLH A;  2IVO A;  4DU1 A;  1RFQ A;  2RN2 A;  4BRK A;  4FLX A;  5HRR A;  3LPU A;  4EIA A;  3SPY A;  3MX5 A;  3IG1 A;  4FK2 A;  4O44 A;  1TKZ A;  1S72 N;  1NK5 A;  3SQ0 A;  2QWR A;  3J7Y P;  3RVC A;  4FWK A;  4BG9 A;  3HXM A;  3D6R A;  4GNI A;  3OYN A;  4F3O A;  4JI7 K;  1SZ2 A;  4CGG A;  2OPS A;  5HOO A;  2F9W A;  3NDK A;  3OJS A;  4AIL C;  3ATU A;  2BGG A;  3AO5 A;  5IT9 O;  3W3D A;  4E19 A;  1Q81 O;  3HL8 A;  4DTN A;  1NGI A;  3QEP A;  3OYC A;  3CD6 N;  1K8A O;  2G8U A;  1ATS A;  1GLL O;  3OW2 M;  4ISF A;  4FO0 A;  1S22 A;  1VQM N;  3NGI A;  2E6M A;  4UY8 O;  3RR8 A;  4RWT A;  2ITG A;  2VGM A;  4NB4 A;  3MWP A;  4CJR A;  2P9S A;  4O55 A;  4DR6 K;  1C0U A;  3ZT4 A;  1YIJ N;  3AVI A;  4AHC A;  4CF8 A;  1I3A A;  3MWT A;  5F2R A;  4K41 A;  3WNF A;  4FJ8 A;  3D2F A;  3C6T A;  3ZX0 A;  4BE1 A;  3ASM A;  1SS6 A;  1IO2 A;  1CXQ A;  2KW4 A;  3CJA A;  4QS8 A;  3P5J A;  3NAE A;  4JI2 K;  3RR7 A;  3IFR A;  3CCM N;  3VTH A;  4KTQ A;  4CJ3 A;  2PZS A;  1OH7 A;  5AR0 A;  1OH8 A;  2AJQ A;  4JI1 K;  3D2E B;  5CZ2 A;  3NVM A;  5M1P A;  4CJF A;  3VQQ A;  4F2S A;  3TR8 A;  3NGY A;  1RDW X;  4DQQ A;  3A8Y A;  4OPA A;  1NMN A;  2VWK A;  2QWN A;  3KZB A;  5DM7 L;  3U6F A;  2IOC A;  5M1Q A;  3HP9 A;  4N56 A;  1KAZ A;  1TYQ A;  3V6D A;  1NGD A;  3CJ9 A;  1GLC G;  1GLD G;  1WSH A;  3MXM A;  4DS5 A;  3H6E A;  4MQ3 A;  5FPN A;  3PX4 A;  4CJ7 A;  4CHQ A;  3THX A;  1T44 A;  4M41 A;  3HPH A;  1TUY A;  1Y64 A;  5C42 A;  3SJJ A;  3TAE A;  4JRQ A;  2O8E B;  4CCH A;  2IS3 A;  1ZBL A;  1XNR K;  3M1F A;  3PX0 A;  3HTV A;  1S6P A;  2IC3 A;  4W5O A;  3U9Z A;  2P9N A;  1N8R O;  1N32 K;  3THY A;  3OYI A;  4C1N I;  2ZGY A;  3BEX A;  3OS0 A;  4DFK A;  2O8C A;  5KI6 A;  4M42 A;  4WFB L;  1YUW A;  4FSV A;  1BO5 O;  4KBO A;  3EL2 A;  2HW3 A;  3R6M A;  4HTL A;  4IWV A;  4HHT A;  2P9P A;  3OYG A;  1T8E A;  3S3O A;  4FYD A;  4B8A B;  3F2K A;  3MK6 A;  3SI6 A;  2E1Y A;  4FOE A;  4DV2 K;  4KO0 A;  2XHB A;  4B9L A;  1REV A;  3WQT A;  2WFB A;  1TK0 A;  2D0O A;  2QI2 A;  2NRZ A;  3L2V A;  2CH5 A;  3DJC A;  3VTI A;  5KPR A;  3FZF A;  4GKK K;  4AQY K;  3C95 A;  5CHI A;  1S9G A;  3CCU N;  3LDO A;  3VQ8 A;  3T1Y K;  2GEL A;  3ZYY X;  1D4X A;  3RRG A;  4LFA K;  3ID8 A;  1GOC A;  2Z1H A;  3CQ8 A;  3CF5 L;  3CMA N;  1HYS A;  1LWF A;  5C2D A;  2Q31 A;  5JMV A;  4EP5 A;  2PYL A;  1Q7Y O;  4FJ9 A;  3J81 O;  3HRG A;  1YTU A;  3NH2 A;  4FK4 A;  2IGI A;  3VQ7 A;  2HOE A;  5AQO A;  5CYM A;  4OLB A;  3AVG A;  4BQZ A;  1NOZ A;  3CCV N;  5H1S Q;  4AH9 A;  3EEQ A;  1SKR A;  5I3U A;  3JSM A;  4ELU A;  5KPT A;  5M1F A;  4JLH A;  3ENB A;  4GMJ B;  4PL8 A;  3S3M A;  3SBT A;  3V81 A;  4EFH A;  3PY8 A;  3ZET A;  3B8A X;  1Z25 A;  2GTD A;  4LFB K;  1ITG A;  2Q0R A;  4JKG A;  4LH4 A;  2A3Z A;  4M3Z A;  3DXK B;  2PY5 A;  4F8R A;  4BC3 A;  1UWB A;  4DV1 K;  1ESV A;  2EWS A;  4N47 A;  3VEV A;  3OY9 A;  3LAL A;  1HKB A;  3ID6 A;  4FLU A;  4PKG A;  2I7N A;  3AGR A;  4AHU A;  2R7Y A;  1EKE A;  3S9H A;  1HR0 K;  1IH7 A;  3VQ5 A;  2P5G A;  2HVI A;  4C8N A;  2VG5 A;  4JS4 A;  3O9U A;  1WSG A;  3LDL A;  1P8Z A;  3ENH A;  3U3Y A;  4DB3 A;  4BE0 A;  2D0A A;  1MWK A;  2YNG A;  4CJ5 A;  4IJN A;  1X1P A;  3CME N;  3VQE A;  1HJR A;  4JKD A;  4DTP A;  1L3U A;  1LW2 A;  3HOS A;  4DTU A;  5FPD A;  2DPN A;  3VF4 A;  4B1Z A;  1RBV A;  4B3S K;  4CZM A;  3DI6 A;  1JLA A;  2W40 A;  2WTU A;  3M8P A;  1K8K B;  4CD3 A;  1BDG A;  4FLV A;  3HZ6 A;  3QIO A;  2YHX A;  3LP2 A;  1EWR A;  3K5N A;  1RCH A;  2HHH K;  3VQP A;  5CYQ A;  2FBV A;  4DFJ A;  3CCE N;  4EHU A;  1BL3 A;  1NU0 A;  1U04 A;  2HNY A;  1NOY A;  4UQG A;  3LDS A;  3ENO A;  3D45 A;  4OPK A;  1ILY A;  4CZF A;  4DTO A;  2QKB A;  1BI4 A;  4CJV A;  3F73 A;  1KAY A;  4O4G A;  4IEE A;  1X9S A;  4FJH A;  3CJ1 A;  3O9Q A;  1I94 K;  3OHR A;  2A6A A;  1D5A A;  4KKO A;  2X74 A;  3ULE A;  4M3W A;  3AAR A;  5FPE A;  3THW B;  5AZI A;  1X3M A;  2P5O A;  3K59 A;  5J2P A;  5A2Q O;  3E66 A;  3FFK B;  5AQU A;  2HNZ A;  2XY6 A;  1O13 A;  3ZSV A;  1ZBI A;  4IKF A;  4B1W B;  1IJJ A;  4HUE A;  1T03 A;  5J2M A;  2YV0 X;  1J5E K;  2W41 A;  4K25 A;  1ZBU A;  1GLE G;  5AQZ A;  2OTL N;  4IFE A;  2NLX A;  1FK9 A;  3LDP A;  5BR8 K;  1N34 K;  1QQN A;  4K8X A;  3TAB A;  3KKR A;  2D0P A;  1DLO A;  4IZ9 A;  1RT5 A;  3OYH A;  2VCP A;  4I6M A;  1U49 A;  1C1B A;  1LAW A;  2YJE A;  2FLO A;  4PY5 A;  4CIE A;  5AQL A;  3WXM B;  4CED A;  1R0A A;  1EQY A;  4BDY A;  5E26 A;  4PWD A;  5ADX H;  4FJI A;  1IKW A;  2E8A A;  5F0X A;  4J2E A;  4KI4 A;  4JHD B;  2O8D A;  4BWJ A;  5M1O A;  1VQ8 N;  4CZJ A;  4CGD A;  4EP4 A;  1HLU A;  1SKS A;  3CHW A;  3VQ9 A;  2HF4 A;  1KSP A;  3CXC M;  2DFH A;  5HLF A;  2P9L B;  2QW9 A;  1NNE A;  3KD1 E;  4B1Y B;  4R79 A;  4CGH A;  1JLQ A;  2NRH A;  3C7N B;  4FM1 A;  5TKY A;  2YNF A;  1A5V A;  4ISE A;  1NGJ A;  4RW7 A;  3EE8 A;  3P1G A;  4CEB A;  5C10 A;  1CXU A;  3FLC O;  2OZS A;  4BAC A;  2WBN A;  4DR1 K;  1K73 O;  5BR9 A;  1NWK A;  3ZSX A;  2XY7 A;  2HHQ A;  5FLX O;  4N76 A;  2V7Y A;  4FJK A;  2Z1G A;  5KQ8 A;  2ZJR L;  1VQ7 N;  3I8D A;  4KTZ A;  4C8O A;  2P9K A;  3AVF A;  2O4I A;  5JLF A;  3QEI A;  4E7L A;  4FJM A;  4HCC A;  3NVK A;  4A62 A;  3UE5 A;  2YNI A;  4ICL A;  4V19 S;  2QXF A;  3HK2 A;  3SAF A;  2NZT A;  4Z4F A;  4WE1 A;  4GY2 B;  5LMN K;  3AA2 A;  2AP1 A;  2EHG A;  3AVJ A;  1LWE A;  3I0R A;  3JAM O;  4CEZ A;  4I7F A;  2V51 B;  3MDQ A;  3V1O A;  1Z6R A;  4A5A A;  1K9M O;  1NKE A;  1A5X A;  1HKG A;  4DQ8 A;  4CJS A;  1TKX A;  4H4O A;  5AQI A;  4CK3 A;  3DWL A;  4CEA A;  4GKJ K;  5AQJ A;  4DSE A;  3VGK A;  2WUS A;  4KRE A;  2KKZ A;  3A2F A;  2VG7 A;  4DR4 K;  3KVG A;  3SCX A;  3VQ6 A;  1V4T A;  3UKR B;  2QWM A;  1JCF A;  4X65 K;  2JLE A;  5JLH A;  3L2R A;  4M63 C;  1XC9 A;  1TKD A;  3QBX A;  3DRP A;  3BF1 A;  3QO9 A;  4TSX A;  1WB9 A;  4AM6 A;  3KD5 E;  4WQ5 C;  4BRH A;  3FZH A;  1TVR A;  1IG9 A;  2HBM A;  4XH4 A;  3RRH A;  1P90 A;  1NK8 A;  3SPZ A;  1NGA A;  4BGA A;  1J54 A;  1QE1 A;  3QEW A;  1NGF A;  5C15 A;  2GUP A;  2GX9 A;  4CK1 A;  1YI2 N;  4QOZ B;  4FPA A;  4YDU A;  3AO2 A;  4C8L A;  4FWP A;  5MLC Q;  1OKJ A;  1T05 A;  1RDB A;  1NK6 A;  2PYJ A;  1BA1 A;  2FC0 A;  4X62 K; 
#chains in the Genus database with same CATH homology
 3P5J A;  3V1R A;  2OPP A;  3NCI A;  4DSJ A;  3NAE A;  4IBN A;  1TK5 A;  1RT7 A;  2ZQB A;  3EYZ A;  3RR7 A;  1SL0 A;  4KTQ A;  4CES A;  3K5M A;  4ID1 A;  2DTU A;  4CJ3 A;  3M8Q A;  2PZS A;  1JLB A;  2XY8 A;  3LP3 A;  3RMB A;  4NCG A;  2AJQ A;  4DU3 A;  3HO1 A;  5CZ2 A;  4CJW A;  2B4J A;  4E0D A;  4FVM A;  1I39 A;  1BI4 B;  4CJF A;  1K6Y A;  1TGO A;  4OPJ A;  3VQQ A;  3OYD A;  4ZTF A;  2RKI A;  4I9Q A;  1JLC A;  4F2S A;  3T19 A;  5SZT A;  3TR8 A;  3ZT1 A;  3K5O A;  3NGY A;  5JS1 A;  4DQQ A;  2HHV A;  2KFZ A;  2VWK A;  4I2Q A;  2D0B A;  3U6F A;  3BDP A;  2IOC A;  4CEE A;  4Z4E A;  2HHX A;  3HP9 A;  4IDK A;  4FLY A;  1T7P A;  4N56 A;  1UA0 A;  3DRS A;  3NF6 A;  1VSM A;  1RIL A;  1D8Y A;  3K5L A;  4DS4 A;  5C25 A;  1FKO A;  3ITH A;  1NKC A;  2B6A A;  2YKM A;  3HYF A;  2OA8 A;  5C24 A;  4DSL A;  1RBS A;  2F96 A;  5KRT A;  3V6D A;  2Z1I A;  2O4G A;  1EP4 A;  4ELT A;  2FBY A;  1QSS A;  1VK0 A;  2YNH A;  4CK2 A;  1WSE A;  1WSH A;  5HP1 A;  3TI0 A;  3MXM A;  1XHZ A;  1LAV A;  4DS5 A;  4MQ3 A;  4RW6 A;  4CJP A;  1ASW A;  4CFD A;  3PX4 A;  4I2P A;  1NK9 A;  1KVA A;  1TV6 A;  5FRN A;  2YKN A;  4CHQ A;  4KV8 A;  4DF4 A;  4BDZ A;  4M41 A;  4CJT A;  3HPH A;  3V9U A;  4DQR A;  4OJR A;  1U45 A;  3QLH A;  5C42 A;  3SJJ A;  3TAE A;  4JRQ A;  4CCH A;  1ASU A;  2IS3 A;  1S1U A;  1RDC A;  3NE6 A;  1NJZ A;  1ZBL A;  4KHQ A;  1BGX T;  1C1A A;  2BAN A;  3PX0 A;  3VA3 A;  4O0J A;  4M3Y A;  4PQU A;  1S6P A;  2IC3 A;  1JLG A;  4AHS A;  4W5O A;  3I0S A;  3TAR A;  4FZZ A;  3ZSY A;  4CHO A;  3OYM A;  1YVU A;  5E41 A;  3OYI A;  4E7K A;  3V9S A;  4FLW A;  5CZ1 A;  3OS0 A;  4DFK A;  3LZJ A;  4FK0 A;  5KI6 A;  3KJV A;  4DTS A;  3ZSR A;  1B9F A;  1HPZ A;  4OGC A;  4CEF A;  3RWU A;  4KHU A;  3P83 D;  1EXQ A;  4CFA A;  1KRP A;  4OVL A;  4CHN A;  3QNO A;  3ZSZ A;  2DFE A;  3NF8 A;  4FJX A;  1S5J A;  4FW2 A;  3E01 A;  1QTM A;  3PO5 A;  2HW3 A;  4CJQ A;  3NH1 A;  3SV3 A;  1YTA A;  4CIG A;  1N5Y A;  3DLH A;  4HHT A;  1B9D A;  1T8E A;  3OYG A;  2Y1J A;  3S3O A;  4FYD A;  4B8A B;  3T3F A;  2HHU A;  4GW6 A;  3SI6 A;  4FLZ A;  2I5J A;  4KAZ A;  4FCY A;  2BE2 A;  2Q3S A;  3DYA A;  3DLR A;  1B92 A;  5SWM A;  1Y97 A;  5HBM A;  4KO0 A;  2XHB A;  4B9L A;  2ZD1 A;  4W5Q A;  1TAU A;  1WAJ A;  4OKE A;  1LWC A;  3M8S A;  1RDD A;  1REV A;  3QEX A;  3MXI A;  1U47 A;  4BWM A;  1U48 A;  3OYK A;  1TK0 A;  3TAG A;  5HRP A;  3K58 A;  4NCA A;  3TAQ A;  4CFC A;  4FJG A;  4H4M A;  4M42 A;  4B9M A;  3L2V A;  3HST B;  1UOC A;  2RPI A;  2IAJ A;  1KLN A;  3KLI A;  2A1S A;  1RT4 A;  1VRT A;  3C95 A;  4JRP A;  4F4K A;  1Z26 A;  1S9G A;  3WNH A;  4Z4H A;  1WNS A;  3TAP A;  4CF9 A;  4EZ6 A;  4E3S A;  3VQ8 A;  3RRG A;  4Z4I A;  3NF7 A;  1W9H A;  3OYF A;  1XI1 A;  1TL3 A;  1GOC A;  4CE9 A;  2KTQ A;  3MAQ A;  2Z1H A;  3LAM A;  3CQ8 A;  4NCB A;  2KZM A;  1RT2 A;  3VQA A;  1QHT A;  4DLE A;  1HYS A;  1HNI A;  3LPT A;  3B6O A;  3CG7 A;  4LD0 A;  1LWF A;  4CGJ A;  4CHY A;  3C94 A;  3EY1 A;  3SNN A;  2VWJ A;  4EP5 A;  4FLT A;  1NK0 A;  4PUO A;  2PYL A;  3IRX A;  4FJN A;  2Z1J A;  4KPY A;  4FJ9 A;  2HHS A;  4Q0B A;  2VG6 A;  1YTU A;  1XWL A;  3KKS A;  3NH2 A;  2P51 A;  4FK4 A;  2IGI A;  4CF2 A;  4FM0 A;  3VQ7 A;  3TAN A;  4OLB A;  3AA5 X;  5CYM A;  4E7J A;  1S9E A;  3AVG A;  3L2U A;  2WON A;  1VRU A;  1NOZ A;  3OJU A;  1L3T A;  4PA1 A;  4AH9 A;  3DOL A;  3V9X A;  4J2A A;  3PV8 A;  1QQC A;  5HRO A;  5I3U A;  1SKR A;  4HCB A;  2HVH A;  3JSM A;  3SUQ A;  3K2P A;  4W5R A;  4ELU A;  2BDP A;  4KB1 A;  4FXD A;  4JLH A;  5KGX A;  4FJL A;  1HNV A;  3V9W A;  1A5W A;  4GMJ B;  1NK7 A;  3KTQ A;  4CER A;  3S3M A;  4F2R A;  3V81 A;  3PY8 A;  3LWL A;  4CGI A;  2Y1I A;  1BCM A;  3H08 A;  5I42 A;  2W42 A;  4B9N A;  3SQ1 A;  1Z25 A;  3V1Q A;  4DG1 A;  1KFS A;  4C8K A;  2KQ2 A;  2GBZ A;  1ITG A;  3HVT A;  3JYT A;  1NKB A;  3VQB A;  1CZB A;  2HB5 A;  1VSD A;  4LH4 A;  4B9S A;  4M3Z A;  1BQM A;  2PY5 A;  3OYA A;  4DU4 A;  4F8R A;  1UWB A;  3SUP A;  3O4Q A;  4KHS A;  4CJ4 A;  4N47 A;  1JLE A;  4FZY A;  3OY9 A;  2X78 A;  4DLG A;  3LAL A;  2OPQ A;  3UIQ A;  4LY7 A;  4FLU A;  1J5O A;  3RMA A;  1WN7 A;  4AHU A;  2R7Y A;  3THV A;  2D5R A;  1EKE A;  3LAK A;  4OGE A;  4Y1C A;  3S9H A;  4HTU A;  1IH7 A;  3VQ5 A;  1L5U A;  4OLA A;  2KZZ A;  4DQI A;  2P5G A;  2XO7 A;  4C8N A;  1QS4 A;  2HVI A;  3G0Z A;  2X6S A;  2VG5 A;  5KGW A;  4B8C A;  4JS4 A;  3IAY A;  4LSL A;  1WSG A;  5FDL A;  1VSL A;  5KRS A;  4Y1D A;  3U3Y A;  4BE0 A;  2D0A A;  4Z4C A;  4KFB A;  1JXE A;  2YNG A;  3DM2 A;  4O5B A;  3U3G A;  3MEC A;  4MFB A;  5K14 A;  4CJ5 A;  3F9K A;  5HRN A;  5J1E A;  3ULD A;  1KFD A;  1X1P A;  2DFF A;  4IFY A;  1ZBH A;  4B9U A;  3VQE A;  4EZ9 A;  1HJR A;  3KLG A;  3QEV A;  1RT3 A;  4DTP A;  3AO3 A;  3SV4 A;  3CM6 A;  1L3U A;  4NYF A;  1LW2 A;  4C8M A;  2QKK A;  4FZX C;  2XY5 A;  1GOA A;  3TWH A;  4KB0 A;  4DTU A;  2F8S A;  4CHZ A;  4ZTJ A;  4GVM A;  1KVC A;  3CFP A;  1RBV A;  5HRS A;  3VQD A;  3MEE A;  2KFN A;  1KCF A;  2G8I A;  3DI6 A;  1JLA A;  1SL1 A;  4RW8 A;  3WNE A;  4LSN A;  1BCO A;  1J9A A;  3O3F A;  4DF8 A;  3SQ2 A;  4DTX A;  1SKW A;  3M8P A;  4M3T A;  4Z0U A;  1BHL A;  1Q8I A;  1JL1 A;  3LZI A;  1HYV A;  1KVB A;  4CGF A;  4E89 A;  4FLV A;  4ZHR A;  1TKT A;  1L3V A;  1S1X A;  3LP2 A;  3QIO A;  1SV5 A;  1ZYQ A;  3K5N A;  1RCH A;  4BDP A;  1Q9Y A;  1KTQ A;  3VQP A;  3OS1 A;  2HHT A;  5CYQ A;  1WAF A;  3NBP A;  3ZSW A;  2FBV A;  1VSI A;  4DFJ A;  2FBT A;  4FM2 A;  3HJF A;  4M3R A;  3VQC A;  3M8R A;  1BL3 A;  2WOM A;  3S3N A;  2OYQ A;  1U04 A;  3LWM A;  2HNY A;  4BE2 A;  1NOY A;  4UQG A;  3LDS A;  3HVR A;  3D45 A;  3PUF A;  1DTT A;  4DTJ A;  3TAF A;  4OPK A;  4DTR A;  3ZT2 A;  4DTO A;  5KTQ A;  1WSI A;  2QKB A;  1BI4 A;  3OVN A;  4CJV A;  4CF0 A;  3F73 A;  1Q9X A;  5CY4 A;  1WSJ A;  1RTJ A;  4O4G A;  1RNH A;  2P1J A;  1SUQ A;  3L2Q A;  1X9S A;  3L2W A;  4FJH A;  4M3U A;  1EET A;  3D0P A;  5EU7 A;  2G8V A;  4DFP A;  3AVK A;  1KLM A;  4M3X A;  1S1T A;  3G10 A;  3NHG A;  4H8K A;  3ZSO A;  3LP0 A;  4DSK A;  1D5A A;  4B3O A;  4HUG A;  3VA0 A;  5FRO A;  3AVC A;  4KKO A;  2X74 A;  4M3W A;  2ZE2 A;  3DLE A;  1RT1 A;  3KK1 A;  2DY4 A;  2X6N A;  2P5O A;  3K59 A;  3AO1 A;  5J2P A;  3PO4 A;  2HNZ A;  1DTQ A;  4B08 A;  2XY6 A;  1O1W A;  1BQN A;  1IKV A;  3C6U A;  4DWI A;  3ZSV A;  1NK4 A;  3NFA A;  4KHN A;  1ZBI A;  3QIN A;  4IKF A;  3O4N A;  4B9T A;  3VQ4 A;  2HHW A;  1BIS A;  2FBX A;  1RTH A;  1JLF A;  4HUE A;  1T03 A;  1IKX A;  2E4L A;  2YV0 X;  5J2M A;  5D3G A;  1S6Q A;  3NH0 A;  3L3V A;  4J2D A;  1ZBU A;  1RBR A;  4CJL A;  1UA1 A;  3AVB A;  4CEC A;  4RG8 A;  1FK9 A;  2OZM A;  5J2N A;  3QER A;  4K8X A;  2QK9 A;  3AVH A;  3OS2 A;  3OYJ A;  3TAB A;  1VSJ A;  3KKR A;  4CJE A;  2RF2 A;  3VN5 A;  1DLO A;  3OYH A;  1RT5 A;  2B5J A;  3B6P A;  3O3G A;  3RTV A;  3ZT3 A;  4DQP A;  2ETJ A;  3KLF A;  1U49 A;  1D9F A;  4DSI A;  3SZ2 A;  2A1R A;  3AA4 A;  1C1B A;  1LAW A;  4PY5 A;  4CIE A;  4CED A;  3NF9 A;  4OKJ A;  4NYN A;  1R0A A;  1S1W A;  4L8R B;  4BDY A;  1S1V A;  3L3U A;  4PWD A;  4FW1 A;  1W0H A;  4K8Z A;  4DMN A;  4FJI A;  1HQE A;  3NGZ A;  3ZCM A;  1D9D A;  4QAG A;  1IKW A;  5J2Q A;  3HT3 A;  4CIF A;  3CFR A;  4JS5 A;  4J2E A;  3BGR A;  1L3S A;  4KI4 A;  4AHV A;  3CYM A;  3AVM A;  4KRF A;  4HVJ A;  4XIU A;  4BWJ A;  3RMD A;  3SUN A;  4CGD A;  3FFI A;  4EP4 A;  1VSK A;  5DK5 A;  1SKS A;  4E1N A;  3AVN A;  3KK2 A;  4OKK A;  3VQ9 A;  1KSP A;  2G8K A;  4ELV A;  4RW4 A;  3HP6 A;  4W5T A;  2DFH A;  1LW0 A;  5HLF A;  4G1Q A;  4IFV A;  1VSF A;  3KD1 E;  1WLJ A;  4FJ5 A;  4CGH A;  1JLQ A;  1QSL A;  1EX4 A;  3KLE A;  4Z4G A;  4CEQ A;  4FM1 A;  4M45 A;  3IS9 A;  3T1A A;  4Q5V A;  3AVL A;  2YNF A;  1A5V A;  4RW7 A;  3P1G A;  2HND A;  4CEB A;  1VSE A;  1CXU A;  1JKH A;  1RBT A;  4BAC A;  2OZS A;  1ZBF A;  2HMI A;  1NJX A;  2NUB A;  3MEG A;  3AA3 A;  4F3T A;  2OPR A;  4HUF A;  3SUO A;  1NJY A;  5FRM A;  3ZSX A;  2XY7 A;  2HHQ A;  3PX6 A;  2YHA A;  2YHB A;  4CHP A;  4N76 A;  4YNQ A;  4FJK A;  2Z1G A;  4CFB A;  3QIP A;  3DRR A;  5T7B A;  4E7H A;  4KHY A;  3I8D A;  4KTZ A;  1MU2 A;  1UAX A;  3ALY A;  3L8B A;  4C8O A;  2G8F A;  2EX3 A;  3AVF A;  1CLQ A;  2LSN A;  1LV5 A;  3QEI A;  2O4I A;  4E7L A;  1TAQ A;  4R5P A;  4FJM A;  3DOK A;  4HCC A;  4FJJ A;  2G8H A;  4DTM A;  1QSY A;  4ID5 A;  2JGU A;  3OYL A;  5JS2 A;  4B9V A;  2YNI A;  4ICL A;  1ASV A;  3LAN A;  3MXJ A;  3AVA A;  1NJW A;  1TL1 A;  3QET A;  1N6Q A;  4RW9 A;  3SQ4 A;  1G15 A;  2QXF A;  3HK2 A;  3AO4 A;  4LH5 A;  3QNN A;  1RBU A;  4IG0 A;  4CJK A;  4O0I A;  1C0T A;  4DSF A;  1FKP A;  1IKY A;  4Z4F A;  1C0M A;  1YT3 A;  4WE1 A;  1JL2 A;  3KLH A;  3AA2 A;  4CEO A;  4DU1 A;  2EHG A;  3AVJ A;  1LWE A;  2RN2 A;  3I0R A;  1SL2 A;  4CEZ A;  3O3H A;  3K57 A;  4FLX A;  4I7F A;  3V9Z A;  1BIZ A;  5HRR A;  3LPU A;  4CJU A;  3V1O A;  3SPY A;  4FK2 A;  2GV9 A;  3IG1 A;  1NKE A;  1A5X A;  1TKZ A;  4O44 A;  2ATQ A;  1NK5 A;  3SQ0 A;  5DMR A;  3CFO A;  1X9W A;  4FJ7 A;  3WNG A;  4YFU A;  3KIO A;  3HM9 A;  4CJS A;  1TKX A;  1F21 A;  1RT6 A;  4H4O A;  3HXM A;  2F8T A;  4CK3 A;  3DLK A;  4CEA A;  3OYN A;  4DSE A;  1TK8 A;  4F3O A;  4KRE A;  1WSF A;  4CGG A;  2OPS A;  3DMJ A;  4J2B A;  4IG3 A;  3NDK A;  3V4I A;  3A2F A;  3OJS A;  4N41 A;  4AIL C;  2VG7 A;  4CF1 A;  4KTW A;  1XHX A;  3EZ5 A;  2BGG A;  1RTD A;  3SCX A;  3AO5 A;  3VQ6 A;  3QES A;  3HPO A;  3CM5 A;  4E19 A;  1C1C A;  3HL8 A;  2GUI A;  4QCL A;  1VSH A;  3ZT0 A;  4DTN A;  1J53 A;  1RTI A;  1HRH A;  2JLE A;  3L2R A;  1XC9 A;  3MED A;  1HMV A;  1GOB A;  3QEP A;  1FXX A;  1TKD A;  3OYC A;  4DQS A;  1HQU A;  2G8U A;  3KK3 A;  3DRP A;  3QO9 A;  4TSX A;  3HPG A;  4AHR A;  3NGI A;  2E6M A;  3RR8 A;  3ISN C;  3ZSQ A;  3KD5 E;  2ITG A;  2XRI A;  3LP1 A;  4I9L A;  4CJR A;  4DFM A;  4O55 A;  3TAM A;  1X9M A;  1JXB A;  1C0U A;  1TVR A;  2E6L A;  3ZT4 A;  3RMC A;  1IG9 A;  3OYB A;  1RDA A;  3RRH A;  1NK8 A;  3AVI A;  4AHC A;  1CZ9 A;  4CF8 A;  3SPZ A;  1U4B A;  1I3A A;  3SYZ A;  3WNF A;  4E7I A;  4KI6 A;  3QEW A;  1J54 A;  1QE1 A;  4FJ8 A;  4KHW A;  3C6T A;  4BE1 A;  4E1M A;  1HYZ A;  3AV9 A;  4N5S A;  1C6V A;  3ASM A;  3DLG A;  4CK1 A;  4QOZ B;  2G8W A;  3AO2 A;  1IO2 A;  3OYE A;  4C8L A;  2D0C A;  1CXQ A;  2KW4 A;  1T05 A;  1RDB A;  1NK6 A;  2PYJ A;  4W5N A;  2FC0 A;  2IDO A;  3DLB A;  4AHT A;  1BIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...