1B9DA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (INTEGRASE)
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 51
structure length 143
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9dA00
4LH5A 1S1XA 4JS5A 2Z1HA 2G8WA 4KTQA 1S9EA 2Y1JA 1QSSA 3HPOA 3PY8A 1RT1A 4GMJB 2YV0X 4KI6A 1VRTA 2YNGA 4MQ3A 2PY5A 1SKRA 3TI0A 4DTUA 1T8EA 4KB1A 2HHQA 1RBSA 4FZYA 4NYNA 2A1RA 4CHYA 3HSTB 2QKBA 4YFUA 2OZSA 2F96A 2HVIA 3A2FA 3QLHA 4KHNA 2GV9A 3O3GA 4HTUA 1FK9A 2YHAA 2YKNA 2BE2A 4AHSA 3MAQA 4PQUA 4CJRA 3V1OA 2FBYA 3DLGA 4PY5A 3BGRA 3V9WA 1KRPA 4DF8A 3JYTA 1S5JA 3AVMA 1BQNA 4CJ4A 4OPKA 3KLGA 2G8HA 4B9SA 1TAQA 3CQ8A 1LAWA 2G8VA 4IDKA 1VSIA 3SQ1A 1ZBLA 3ZSRA 3OS1A 4PUOA 1X9WA 4CF0A 1RBRA 3K5OA 1S1WA 4OLAA 4CEOA 5JS1A 4B8AB 4B9UA 4M3TA 4FCYA 1ZBFA 2VG7A 4O55A 2VWJA 3TANA 3RRHA 3AA3A 4O44A 2E6MA 4H8KA 3KTQA 3SUPA 3U3GA 3WNEA 1TK8A 4KFBA 2HHTA 3D0PA 3OY9A 3OYGA 4CJPA 3K5NA 1XHZA 2HVHA 4EZ6A 1L3SA 1F21A 2EHGA 1X9SA 3RWUA 4DFKA 4E19A 4G1QA 2HMIA 3CYMA 4PA1A 1KFSA 1U49A 4CEAA 4I2PA 1RDCA 3AVKA 4CJQA 2HHVA 4BWMA 3C94A 2R7YA 4JRQA 1HRHA 2X6NA 1WSJA 2D0AA 2OA8A 2VG5A 5KGXA 4BE2A 4CJKA 1KVAA 3CG7A 1G15A 5HRPA 2B5JA 4J2EA 1EETA 3H08A 4J2DA 3OYEA 1B9FA 3WNHA 4BE0A 1JXBA 3RR7A 1S1UA 3AO2A 1WSHA 4FLVA 3TAMA 3SQ0A 5EU7A 2FBVA 4CF1A 3CM6A 4M3UA 2ZE2A 1HYZA 1LW0A 1RNHA 4W5OA 4CECA 3IRXA 4DS4A 2GBZA 1HNIA 4QCLA 3RMBA 1RDBA 4DTRA 2P51A 1SL2A 1TKDA 3EYZA 1VSEA 2XY8A 1SUQA 5KRSA 3ASMA 1IKVA 3HYFA 3K2PA 4W5TA 4E7HA 1CZ9A 3MEDA 4FLWA 3AVAA 4HUEA 3EY1A 4HCBA 2XRIA 3O4NA 1N5YA 3HXMA 4YNQA 3T1AA 3V9UA 4DTOA 3ZT4A 5CYMA 3M8SA 4CHPA 3AVGA 3ULDA 1DTQA 4M3RA 3SPZA 1BI4B 1QSLA 3NAEA 4E7IA 4CJFA 2DTUA 3V9XA 4DS5A 4ZTFA 1T05A 1U47A 3HVTA 4CIEA 1UWBA 3F73A 4ELVA 2IOCA 1VSFA 3O3HA 3U6FA 3QEIA 1Q9YA 4DTJA 3VQ5A 3KLHA 1KVBA 3TAPA 4KHSA 2HHUA 4OKKA 1JLEA 3MXJA 3OYDA 4MFBA 2XY5A 2RKIA 4FLUA 3VN5A 4CEFA 1S1VA 4F3TA 3QO9A 3SUQA 1GOBA 4M3ZA 3M8PA 3AV9A 2ZQBA 4CJ3A 3ALYA 4O0JA 2IDOA 3C95A 2HHWA 1TKZA 1UAXA 4RW6A 1L3VA 1X9MA 1QS4A 3FFIA 3DOLA 3LAMA 3SUNA 4CGIA 1Y97A 3LWLA 1K6YA 2XHBA 3SZ2A 3V1RA 4DU3A 1WAFA 2X6SA 4DTXA 1NK6A 2ZD1A 2FBTA 3TAEA 3ZSVA 4Z4GA 3L2RA 4FJGA 1BCOA 4ID5A 3VA3A 3TARA 1NK9A 2G8FA 4Z4EA 3KKSA 2G8KA 1C6VA 3IS9A 4Q5VA 5FROA 4CEZA 3HT3A 1JXEA 1ASWA 3DLRA 5FDLA 5J2QA 4CGGA 1BIZA 3E01A 2YHBA 4I7FA 4KB0A 4BDPA 1NKCA 2B4JA 1WAJA 4CJWA 1D9DA 4I9LA 3KLFA 4CF9A 4NCBA 2OYQA 3V9ZA 2KFNA 4RW7A 1KSPA 4B08A 4H4OA 3AA5X 4E89A 4M3WA 4K8XA 3HPHA 3AVBA 3KLIA 1SKWA 1FKPA 1B92A 3VQ4A 1JKHA 3OYHA 4DSFA 3NH1A 1RTIA 1CXUA 4H4MA 1C1CA 1NOYA 3PX6A 4HCCA 1EX4A 1S6QA 4FVMA 2GUIA 3NFAA 4DSKA 3F9KA 4KTZA 1TVRA 1TKXA 3DMJA 4GW6A 4LD0A 3KK2A 1SL1A 4CK2A 1XHXA 3HPGA 2YNHA 4FJKA 1FXXA 1J53A 1TL1A 3ITHA 2D0BA 1WSFA 5DK5A 1D8YA 4FJJA 4FZZA 1HJRA 2OPQA 2VG6A 3VQQA 3VQEA 4IG0A 4W5NA 1RT7A 4E3SA 4ZTJA 1DLOA 1YTAA 4M3XA 1T7PA 1CZBA 4B9VA 1RTDA 3S3MA 4CHOA 3DLHA 3AVIA 4J2AA 1A5VA 1I39A 3DRRA 3MEEA 3ZSQA 4E1NA 4DU1A 1UA1A 3BDPA 2P1JA 4FJMA 1LWCA 1TGOA 4CJTA 1N6QA 4Z4IA 2IC3A 4HUFA 2WONA 3OS0A 4IKFA 2Z1GA 2OZMA 4RW8A 1RT3A 3M8QA 4DF4A 2DFEA 1LV5A 4FJLA 3OYFA 4F2SA 4I9QA 3C6UA 4AHVA 3L2QA 5HRRA 3RMAA 3LZIA 4O5BA 3WNFA 1EP4A 1JLAA 1Z25A 4DU4A 3MXMA 3NF6A 1UA0A 1QE1A 4BACA 4CGHA 1MU2A 4E7LA 1QSYA 4CF2A 1D5AA 1CXQA 2XY7A 4CGDA 3LALA 4DFPA 2E4LA 4JRPA 1LW2A 4DQRA 1RBUA 4K8ZA 4KPYA 2Z1IA 3K59A 4IFVA 3QEWA 4FJ8A 1R0AA 2F8SA 1KVCA 2D0CA 1RBTA 3NF9A 4CJUA 1RTJA 4KV8A 4DTMA 1NK8A 4GVMA 4CJLA 4KHQA 5J1EA 3NGIA 1XWLA 3T3FA 3KIOA 4M45A 2KW4A 1L5UA 3S3NA 3C6TA 1LAVA 1SKSA 4JLHA 4FJHA 4DSJA 1REVA 1A5WA 3LANA 2HHXA 2KZMA 1BI4A 1BHLA 4CCHA 4F2RA 3KLEA 3PV8A 4B3OA 3L3VA 3OJSA 4AHUA 4BDZA 3AVLA 4F3OA 4N76A 4Q0BA 3G0ZA 2KZZA 5KI6A 2Q3SA 3D45A 4FXDA 1TK0A 1JL1A 4CHQA 3ZSXA 3K57A 3ZSYA 4Z4CA 4XIUA 4M42A 2YNIA 2IAJA 3B6PA 4OPJA 1IKYA 4OLBA 4DSIA 2ETJA 3DLKA 1HYVA 3LAKA 3MEGA 1IKXA 3VQCA 4DFJA 4CESA 3OYKA 2P5OA 3NHGA 2WOMA 4LH4A 1D9FA 3OYNA 3KJVA 3DOKA 4FK2A 4CERA 4M41A 4CGFA 4DSLA 4CIFA 3O3FA 3NGZA 1JLQA 1TL3A 1HPZA 4DFMA 1BGXT 1Z26A 3DRSA 5I42A 3MXIA 3LPUA 4B9MA 4FZXC 4BWJA 3NH0A 3L8BA 1NJWA 3OYLA 3SCXA 1GOAA 1KTQA 3VQ8A 4N56A 3VQBA 2I5JA 3NBPA 4E7KA 3KK1A 2BGGA 4CFBA 1HYSA 1TKTA 3TABA 4DG1A 5KGWA 3NCIA 4NCGA 3SYZA 2W42A 2BDPA 4DWIA 2KQ2A 3M8RA 4B9TA 5FRNA 5CZ2A 1RBVA 1VSLA 4FYDA 4EZ9A 4KAZA 5J2PA 4KHUA 3L2WA 4E0DA 2YKMA 2QK9A 4FJNA 1IKWA 1WSEA 4Y1DA 5C24A 4EP4A 4PWDA 2QXFA 3CFPA 3G10A 4NCAA 4W5QA 4FJ7A 4N5SA 1W9HA 5HROA 4LSNA 5E41A 3PX4A 3PUFA 4M3YA 2HB5A 3DLEA 4TSXA 3B6OA 1X1PA 4C8NA 3OJUA 1NJXA 1VSHA 1NK5A 4CFAA 4KTWA 3NF7A 4CEDA 4FJ5A 2PZSA 3K5LA 3NGYA 2HHSA 3SV3A 3RTVA 4FK4A 2OPRA 3VQPA 4Y1CA 3ZT1A 3I8DA 1C0MA 4DTNA 3VQ6A 4DQPA 3L3UA 2RF2A 3K58A 1WSGA 1BL3A 5JS2A 5J2NA 3HJFA 3SUOA 4FJIA 1KFDA 1JLCA 4JS4A 1Q9XA 1B9DA 1BQMA 2HNYA 4O0IA 3SNNA 1NJZA 5HRNA 4C8OA 4DQIA 4BDYA 3HK2A 4OKJA 1U04A 4FJXA 4E1MA 3OYMA 1EKEA 4DMNA 4DLEA 2E6LA 3TAFA 1HNVA 3IAYA 3LPTA 4DTPA 2DFHA 2JLEA 3DRPA 4DLGA 3HM9A 3V6DA 3VA0A 1NK7A 1VSMA 5CZ1A 5HBMA 4CGJA 3QERA 2XY6A 2KFZA 3TR8A 3ISNC 1IO2A 1XI1A 4OKEA 5HRSA 1ZBIA 4I2QA 5SWMA 3VQAA 1NKBA 3UIQA 1VSKA 3OYBA 4DTSA 1ZBHA 4CJ5A 1BCMA 3ZCMA 3VQ9A 3AVFA 2YNFA 1UOCA 2Z1JA 3HP9A 4LY7A 4HHTA 4C8LA 1Q8IA 1VSJA 2A1SA 1O1WA 1ZBUA 3SI6A 1HMVA 4CF8A 3I0RA 3HP6A 4UQGA 5T7BA 4OJRA 3ZT0A 1TAUA 4AILC 2O4IA 1J5OA 4CFCA 3AA4A 1LWEA 3LP3A 1JLGA 1C0TA 2RPIA 5CY4A 4E7JA 3QEVA 3CFOA 1QQCA 2KTQA 4B8CA 1C0UA 4FLXA 4CJSA 2HNZA 1ASUA 1KCFA 2ITGA 2F8TA 3QEPA 2FBXA 4EP5A 4Z4HA 4CHZA 1RT4A 2NUBA 4DQSA 1CLQA 1GOCA 3VQDA 4DSEA 4ZHRA 5FRMA 1RDAA 1JL2A 4IBNA 2X78A 3OYJA 3PX0A 1WN7A 3LZJA 3AO5A 1NOZA 3SPYA 2P5GA 4AHCA 5D3GA 3TWHA 3T19A 4CK3A 3TAGA 1TV6A 1WLJA 3OVNA 1J54A 3P1GA 4CIGA 3OYCA 3P5JA 3V9SA 3U3YA 3V4IA 4KI4A 4FLYA 2D5RA 4FM2A 4FM1A 2OPSA 1VRUA 5K14A 3SJJA 3SV4A 1ZYQA 4KHYA 1DTTA 4BE1A 4L8RB 1YT3A 4CFDA 4CE9A 1EXQA 1IG9A 1IH7A 2O4GA 3LP0A 5HLFA 1T03A 3HO1A 1W0HA 3QIOA 2EX3A 4ID1A 5I3UA 3KK3A 3V81A 5KRTA 3PO4A 1RT2A 3LP1A 3DM2A 1FKOA 5SZTA 1U48A 4C8KA 2Y1IA 1NJYA 1L3UA 4CEBA 5C25A 4CK1A 3L2UA 3DI6A 4HUGA 3SQ4A 2PYJA 3AO4A 3MECA 4WE1A 3NH2A 3OS2A 4J2BA 1WNSA 4FK0A 1WSIA 1C1BA 1RT6A 4RG8A 3K5MA 3ZSOA 3NE6A 2LSNA 4B9NA 1KLMA 1NKEA 3SQ2A 5C42A 3QNOA 4CEEA 4AH9A 3V1QA 1NK4A 4ELUA 2G8UA 3RMCA 4IG3A 4CEQA 4ELTA 1VK0A 3P83D 3S9HA 4RW4A 4N41A 2AJQA 1C1AA 4Z0UA 3KD1E 2RN2A 4NYFA 3QNNA 2IS3A 4CJVA 2X74A 4KHWA 1RCHA 1RT5A 2HNDA 3OYIA 4FW1A 2OPPA 4ICLA 4FLZA 1SL0A 4KREA 3AO3A 1VSDA 2B6AA 3DYAA 4KO0A 4W5RA 3QESA 4CHNA 2PYLA 1SV5A 1ASVA 4FW2A 3ZSWA 3I0SA 3DLBA 4C8MA 3NF8A 2DY4A 3ZSZA 4QOZB 3QINA 1A5XA 4CJEA 3WNGA 3AVHA 3CFRA 3O4QA 1KLNA 3RRGA 5CYQA 1XC9A 3RR8A 4OVLA 1BISA 3LP2A 3LWMA 4FLTA 3LDSA 4KRFA 4N47A 1L3TA 4AHRA 3EZ5A 1ITGA 1QTMA 4B9LA 3NDKA 4FJ9A 1JLFA 3IG1A 1U45A 1HQUA 4HVJA 1HQEA 3ZT2A 3OYAA 2HW3A 1S9GA 2DFFA 1NK0A 2ATQA 2JGUA 3S3OA 3L2VA 3HVRA 3PO5A 1S1TA 1JLBA 3AVNA 3QEXA 2G8IA 3TAQA 3AA2A 3THVA 2XO7A 1BIUA 1QHTA 4LSLA 3RMDA 4Z4FA 1RILA 3AO1A 4AHTA 4F8RA 1RDDA 3AVJA 4FM0A 3KKRA 1J9AA 1TK5A 4KKOA 4F4KA 3AVCA 1YVUA 1LWFA 2FC0A 3KD5E 4O4GA 1U4BA 1I3AA 4DQQA 2QKKA 3HL8A 4OGEA 5KTQA 2BANA 3CM5A 2VWKA 4RW9A 3JSMA 5HP1A 4R5PA 1RTHA 3QIPA 4IFYA 1YTUA 4OGCA 5DMRA 3VQ7A 1S6PA 4QAGA 2IGIA 3ZT3A 3QETA 5J2MA
chains in the Genus database with same CATH superfamily
4LH5A 2O8BA 4JS5A 2Z1HA 1DGKN 4KI6A 4H0TB 3TI0A 1HR0K 4KB1A 5E26A 4NYNA 4YOTA 3QLHA 2NRVA 4KHNA 2GV9A 2YHAA 2YCHA 3MAQA 4PQUA 3D2FA 3T1HK 4DF8A 3D2EA 5ADXA 3KLGA 2G8HA 1TAQA 1LAWA 4IDKA 4K41A 3K5OA 4H0VB 4C23A 4OLAA 4H5WA 4B9UA 4FCYA 3MK6A 4O44A 3I33A 3K5NA 1XHZA 3M1FA 3LDLA 2P9SA 3RWUA 4DFKA 3CMEN 3U9DA 4CZFA 4MDBA 4CEAA 4WQ5A 3VF4A 2VGMA 3C94A 3O80A 1HRHA 4CJKA 1KVAA 3C0BA 2HBJA 3R9PA 1B9FA 2ZF5O 3WNHA 4Z94A 5DM7L 4FLVA 1HJOA 3CPEA 1HYZA 2GUPA 3IRXA 4BRGA 3RMBA 4DTRA 2P51A 4QS9A 5KRSA 3ASMA 1S3XA 1HNXK 2XRIA 3V9UA 3SBTA 4JNEA 3SPZA 3MDQA 1BI4B 3NAEA 2Q2RA 4CJFA 1S22A 4BROA 1NM1A 2VCPA 3F73A 1Q9YA 3U6FA 3QEIA 3VQ5A 4QS8A 4OKKA 3FZLA 4FLUA 3VN5A 5AQIA 4CZKA 2D4WA 3ALYA 4O0JA 4C1NK 1UAXA 1L3VA 1QS4A 3SBGA 3SZ2A 1Y97A 3FGUA 4DU3A 2UXCK 2ZD1A 5AQOA 3ZSVA 5AQGA 4Z4GA 4XH4A 1BCOA 4ID5A 3VA3A 3TARA 1NK9A 2G8FA 4JD2A 4PKIA 3P4IA 3DLRA 5CHIA 1NKCA 4YOXA 1WAJA 4I9LA 3KLFA 1P8ZA 4CF9A 2VQFK 3V9ZA 2KFNA 1QVGM 4A62A 4H4OA 5A2QO 3HPHA 3AVBA 3KLIA 4B3MK 1SKWA 1FKPA 5C2DA 3VQ4A 3OYHA 1ILYA 1RTIA 4XH1A 4HCCA 2O8EA 4FOEA 4KTZA 3EE8A 4GW6A 4LD0A 3KK2A 4CK2A 5I9EB 4B9QA 1XHXA 3ENBA 1TL1A 4FZZA 5GIPA 2OPQA 2VG6A 1HNZK 2UXBK 1KC8O 4KBOA 1RT7A 4CJ7A 4E3SA 4JKGB 4ZTJA 1RTDA 3S3MA 1U6ZA 3AVIA 1VQMN 1A5VA 1I39A 3DRRA 5AFUH 4E1NA 5KQ8A 1UA1A 4Z4IA 1LWCA 4BRPA 1LCUA 2WONA 2OZMA 1X9JA 3M8QA 4FPAA 3OYFA 4AHVA 3RMAA 4YY3K 2W41A 2YI1A 1Z25A 1MU2A 1QSYA 4YDUC 1CXQA 2FSJA 3MWTA 4JRPA 4KPYA 3A0IX 2F8SA 4IFVA 2D0CA 4JI1K 1QHAA 2YJFA 4CJLA 5AQFA 2KW4A 1L5UA 1NLVA 2GWJA 1SKSA 5FPNA 4DSJA 2P9UA 1BHLA 4F9OA 4CCHA 4IZ9A 4B3OA 3L3VA 4R79A 4M63C 4BDZA 4F3OA 4H0YB 3IDHA 4FXDA 4CHQA 3ZSXA 4XIUA 2YNIA 1VQPN 4OPJA 3LDQA 1IKYA 1XNRK 2ETJA 3DLKA 1HYVA 5FPEA 4DHYA 3VQCA 4DFJA 4CESA 1N33K 2P5OA 1VQLN 4IDHA 3GBTA 3K0SA 3KJVA 3DOKA 4CERA 4CGFA 1QZ5A 3T69A 1TL3A 4DFMA 5AZJA 1BGXT 4LFBK 3L8BA 2PBDA 3VQ8A 3NBPA 4JI5K 2NZTA 3L6QA 3M5RA 4DR6K 4DG1A 1C0FA 3KWGA 3EKUA 3L4IA 2E5LK 3JAMO 3WEEB 4EZ9A 4IOAL 4KHUA 2QK9A 3IFRA 1WSEA 4Y1DA 1VQ4N 5C24A 1QQOA 1S72N 4B1ZA 4FJ7A 4JI7K 1W9HA 5HROA 4LSNA 4M3YA 4TSXA 5BR9A 1I94K 4YHHK 4CFAA 4CEDA 4G9ZA 3RTVA 2OPRA 4H5TA 2O8CB 1C0MA 3HJFA 3L3UA 4ILJA 5J2NA 4JS4A 4O0IA 3SNNA 4C8OA 4BDYA 4EFHA 4DQ8A 1MA9B 1NGGA 4E1MA 3OYMA 1YITN 4B1UB 5DM6L 3DRPA 4DLGA 3QMLA 3HM9A 4FWRA 3V6DA 2FSKA 3VA0A 1ZBSA 5HBMA 4MLEA 3QERA 2XY6A 1NU0A 1Q82O 4FL9A 1IO2A 1XI1A 1ZBIA 3MX5A 3J81O 4CJ5A 1BCMA 2YNFA 1UOCA 3VEOA 2A1SA 2ZGZA 3TSQA 1DT9A 3VEXA 1J5OA 2NRHA 1BO5O 1DEJA 5CY4A 4BRQA 4GY2B 1C0UA 2F8TA 2P9PA 2FBXA 2GELA 4EP5A 2NUBA 3D2FB 1GOCA 5IWAK 3CCQN 3D2EB 4DSEA 3GOIA 3VF6A 4X64K 3LZJA 3SPYA 3M6GA 5D3GA 1XNQK 4AHCA 3CD6N 3T19A 1SS6A 3DXKA 1WLJA 3OVNA 4CIGA 5AQMA 3OYCA 3V4IA 2UYTA 2D5RA 3UKUA 2E2NA 4A59A 2P9KB 1DTTA 5EVZA 2E2QA 2F9WA 4FWLA 1NGAA 2O4GA 3LP0A 1YJNN 3RSEA 4X62K 5KRTA 3PO4A 3P31A 5HOOA 1L3UA 4CEBA 4CK1A 4HUGA 3SQ4A 3NH2A 4FK0A 1WSIA 1ZC6A 4RG8A 5FPMA 5KQDA 3SQ2A 2QEXN 4AH9A 4A2BA 1VQKN 4ELUA 4IG3A 5TKYA 3CC2N 2AJQA 1VQ5N 4Z0UA 3GE1A 4JKDA 2HNDA 3OYIA 2OPPA 4JI4K 3QDKA 4FLZA 1T3VA 4KREA 3AO3A 2B6AA 4KO0A 4M7YA 3I55N 3QESA 3ZLJA 3MN7A 5KPTA 3I0SA 3O1WA 1E4GT 4IEEA 3AGKA 3QINA 1KLNA 3MN5A 1X3NA 3N4PA 5CYQA 4LF5K 4OVLA 3LP2A 3LWMA 4FLTA 4KRFA 4WFNL 3NDKA 4H5RA 3IG1A 2EWSA 3CHWA 4CD1A 3WQUA 2ATQA 1K9MO 3L2VA 1NGFA 3HVRA 3A5OC 1OVYA 1S1TA 4JKEA 1YJWN 1N8RO 3THVA 2OTLN 1N32K 4Z4FA 1RILA 4DV7K 3EL2A 2ZGYA 2FC0A 3H1QA 4IWVA 1I3AA 5KTQA 1T44A 2BANA 3CM5A 1RTHA 2HMPA 4IFYA 4QAGA 2ZJQL 1S1XA 2G8WA 4KTQA 5JVHL 1P90A 3PY8A 2YV0X 2YNGA 3S41A 5GIOA 4BRHA 2HHQA 4FZYA 2KHOA 3HSTB 4GVEA 3CJ7A 1NGDA 4IOXA 1XMQK 3SAHA 3OW2M 4NLBA 4AM6A 4J8FA 4HTUA 1FK9A 2O8FA 3HM8A 2W6LA 3DLGA 3V9WA 1KRPA 3MX2A 2A41A 3JYTA 1S5JA 5TKWA 4CJ4A 4B9SA 3CQ8A 1OKJA 3TSUA 5AQWA 4IOCL 2G8VA 3VEWA 3ZSRA 1RBRA 3CF5L 1S1WA 2QWMA 3P38A 2VG7A 3ATVA 2VWJA 5AQHA 2HHTA 3WNEA 2V7YA 5KPRA 1TK8A 1GLFO 2O8DB 3OYGA 2HVHA 4EZ6A 1L3SA 4E19A 3O1BA 3LM2A 3VOVA 3J7YP 4M7XA 1KFSA 5M1NA 1TUUA 1RDCA 4CJQA 1U2VA 4BRCA 2X6NA 4HWIA 1WSJA 2OA8A 3CCRN 4CZIA 1BU6O 2CH6A 2B5JA 3OYEA 5AQTA 1JXBA 1S1UA 3AO2A 3SQ0A 5EU7A 2FBVA 3OHRA 4CF1A 4M3UA 2ZE2A 4L3QA 1RDUA 3QBXA 4W5OA 4DS4A 1TKDA 3U9ZA 3EYZA 3HYFA 4B1XB 1CZ9A 4FLWA 4B3RK 4GKJK 3DWLA 1YXQA 3T1AA 2P9LA 3ZT4A 4CHPA 3AVGA 2BH1A 1DTQA 4M3RA 5LJVA 4WF9L 5BRDA 1U47A 5AR0A 1Q86O 5ELZA 3KLHA 1KD1O 1HLUA 2HHUA 4MFBA 2XY5A 2RKIA 3QO9A 3SUQA 3M8PA 1GLEG 4CJ3A 2WC9A 2KKZA 1X9MA 3ID8A 3FFIA 4CGIA 2XHBA 2YJEA 3VENA 1BG3A 3TAEA 3C7NA 4BQLA 1K73O 5AZJB 1C6VA 1NGCA 4YOWA 3HT3A 1JXEA 3CJCA 5FDLA 5J2QA 4CGGA 1BIZA 3AAPA 3E01A 5AQJA 5EOYA 4BDPA 1OH7A 1D9DA 4JK8A 2IVOA 2YHWA 3U4LA 3UB5A 3CC7N 3BZKA 4DV1K 4M3WA 3MCPA 1B92A 3HOSA 3CCVN 4BR5A 1CXUA 4H4MA 1WBDA 3PX6A 1S6QA 4FVMA 2GUIA 3NFAA 1SL1A 2HBMA 3DMJA 1TYQB 4ILGB 3ITHA 3MN6A 1D8YA 5DK5A 1JCFA 3VQQA 3VQEA 3I56N 1T7PA 3THWA 4J2AA 1RFQA 4DU1A 4FJMA 4CJTA 3ZETA 2IC3A 3VTIA 2Z1GA 3LM9A 3VERA 4RW8A 1RT3A 2DFEA 4FJLA 4F2SA 3HRGA 1GLLO 3WNFA 1EP4A 4DU4A 4LC9B 3VEZA 4CGHA 4E7LA 4MDAA 5BPMA 3AAQA 5AQNA 2NRRA 4CGDA 2D1KA 2XY7A 4DFPA 1RBUA 2Z1IA 1Q7YO 3QEWA 4FWKA 4DTMA 4KV8A 2P9NB 3NGIA 3KIOA 1HX1A 1SAZA 3A5NC 3VF2A 4BG8A 4JI2K 4JLHA 2HHXA 1REVA 2I7NA 4F2RA 3KLEA 3G0ZA 2P9PB 3G71N 1Q81O 1HUXA 2Q3SA 4LF8K 3RVCA 3EEQA 4QS7A 1EWRA 2IAJA 3B6PA 1K8KB 2YX6A 3DXKB 3THXB 1IKXA 4JHDB 4RCHA 3OYKA 4DV4K 4BVPA 1KXPA 2WOMA 4EHUA 4FK2A 3D7EO 4M41A 2ASPA 4CIFA 3O3FA 1HPZA 3RSEB 3K9KA 1Z26A 1XQSC 5I42A 3MXIA 1QVFM 3LPUA 5F2RA 3SCXA 3OTOK 2I5JA 2NRXA 2P9IA 1OH5A 5C10A 1TKTA 4FOIA 3SYZA 5KGWA 4E0DA 4NCGA 5FRNA 4DWIA 3SMPA 5CZ2A 1RBVA 1V4TA 4KAZA 4BC2A 2YKMA 1FW6A 4N5SA 3DXMB 3PX4A 2HB5A 3DLEA 3B6OA 3NGYA 2CGJA 2ITMA 3CCLN 3I8DA 4JKAA 4DTNA 4IJNA 2F7TA 5JS2A 4FJIA 1KFDA 1NJZA 4DQIA 3MCAB 3AGRA 3L4QA 1EKEA 4DMNA 4IO9L 2E6LA 3TAFA 1TUYA 3IAYA 1VQ7N 4DTPA 4FWSA 2AP1A 5LL6Z 4DUYK 3THYA 4UY8O 4YOVA 5BR8K 3ISNC 2KFZA 1NWKA 5HRSA 4JI0K 1Z6RA 3IKMA 3ZYYX 3OYBA 2Q0UA 3ZCMA 3VQ9A 4HHTA 1VSJA 1O1WA 2Q1NA 4UQGA 1TAUA 1OH6A 4YOUA 1HNWK 3LP3A 3QFUA 1JLGA 2RPIA 4E7JA 3QEVA 2KTQA 4K25A 5LY3A 3E9OA 2D0PA 5FLXO 2O8FB 4Z4HA 5BPLA 5AQXA 3TU5A 4I6MB 4JKBA 1JL2A 2X78A 3OYJA 2P5GA 3TWHA 3TAGA 3V9SA 3P5JA 4FM1A 4KHYA 3H3OB 3CJBA 2IIRA 4BC5A 1YT3A 4CFDA 1EXQA 2UUAK 3FZMA 1W0HA 3QIOA 4DR4K 3HSCA 1RT2A 1CZAN 1FKOA 4C8KA 2Y1IA 2Q97A 3T1YK 3E9LA 3DI6A 3SMSA 3AO4A 4WE1A 5AQPA 3OS2A 1IBKK 1C1BA 3ZSOA 2LSNA 4JAXA 1KLMA 1NKEA 3QNOA 1NK4A 4CZMA 2G8UA 3A5MC 4ELTA 1VK0A 3P83D 5IT9O 5HL7L 4WYBA 1C1AA 3QNNA 4IO8A 2X74A 4CZJA 4BR9A 1VSDA 4FW2A 1ASVA 2A42A 1IBLK 3DLBA 3ZSZA 1RGIA 3WNGA 3AVHA 3CFRA 5LJWA 4GKKK 1BISA 2HHHK 5GAHP 3T7ZA 1NGHA 1L3TA 2CGKA 1NGIA 2WBNA 4H5NA 1U45A 1HQUA 4ILHA 1K8AO 3CMAN 1S9GA 2DFFA 1NK0A 2JGUA 3S3OA 4H03B 1IG8A 3PO5A 4JEPA 5BN9A 3TAQA 5JLHA 1BIUA 1QHTA 4B1VA 5CE3A 4F8RA 1J9AA 4F4KA 1YJ9N 3AVCA 4O4GA 3HL8A 4OGEA 2VWKA 3JSMA 1BOTO 4K43A 3QIPA 5AQVA 5DMRA 3O9UA 1S6PA 2QWNA 5AFUA 2QW9A 1S9EA 1QSSA 1BUPA 4IFEA 4GMJB 3ATUA 1VRTA 2PY5A 1SKRA 1T8EA 4AF1A 1T6DA 1RBSA 2QKBA 2HVIA 4EIAA 3UKRB 2YKNA 1YAGA 2BE2A 4AHSA 3BGRA 3DLLL 2O8BB 4KH6A 4OPKA 3ZEUA 4BRKA 1MWKA 2FSNA 4OPAA 3OS1A 4PUOA 1BDGA 1X9WA 4CF0A 1FJGK 3WQTA 4CEOA 4B8AB 4B3SK 2KLAA 4O55A 1IV0A 3BUZB 3TANA 3AA3A 3WUHA 2E6MA 4H8KA 3KTQA 3VEVA 3SUPA 3U3GA 3O5BA 4KFBA 2QI2A 3D0PA 3GDQA 4NB4A 1WBBA 3PSIA 1SZ2A 4GV3A 2EHGA 1X9SA 3MWPA 4GV6A 2HMIA 3VETA 3CYMA 4PA1A 4I2PA 1EO1A 2WFBA 3AVKA 3WXIA 3EE9A 2HHVA 4BWMA 4PL8A 4YOYA 2D0AA 2VG5A 4BE2A 3CCJN 2P9SB 3C65A 1G15A 3I8BA 1EETA 3H08A 4J2DA 3RR7A 3SJHA 3CM6A 3R1XA 1RNHA 1LW0A 4CECA 1HNIA 4QCLA 4CW7B 1RDBA 2A5XA 2BUPA 1SL2A 1VSEA 2XY8A 3DJCA 3O4WA 1IKVA 5LMUK 4E7HA 4HUEA 4HCBA 1N5YA 3HXMA 5E84A 1ATNA 3ULDA 2IVNA 4E7IA 3V9XA 4DS5A 1T05A 3J7ZO 3EKSA 4DCHA 4OPHA 1UWBA 5GINA 3BEXA 4ELVA 1MDUB 3D6RA 1GLAG 4CZHA 4CI6A 2CH5A 1JLEA 3OYDA 3KHYA 4BRIA 2GWKA 4CEFA 1GOBA 4M3ZA 3AV9A 1NNEA 2HHWA 1M90O 1TKZA 3E66A 4RW6A 5FPDA 4GV9A 4DR1K 2QWQA 3DOLA 5AZIA 1K6YA 1YIJN 3V1RA 3O8MA 1WAFA 2X6SA 3VMFB 1NK6A 2FBTA 1QQMA 4FWMA 3L2RA 1VQON 1OH8A 3KKSA 2G8KA 5KPZA 3IS9A 5FROA 2OTJN 1T6CA 1ASWA 3FR0A 4KB0A 2B4JA 4NCBA 2OYQA 3VEYA 1NGBA 4JKGA 1N36K 1JKHA 4JD2B 4DSFA 3NH1A 2Q36A 1NOYA 4EAHD 3KK7A 4DSKA 3F9KA 1TKXA 3HPGA 3IMXA 2D0BA 1WOQA 1WSFA 3J7AP 1HJRA 4W5NA 5C2FA 1YTAA 4M3XA 3G6EN 3R3LA 5F0XA 3DLHA 3ENOA 4BGAA 4BRNA 4ISEA 3ZSQA 4FSVA 3BDPA 3WXLA 4FVUA 3HBTA 2O8EB 3O9RA 1TGOA 3SK3A 1BA0A 2ASMA 3F5TA 4RWTA 3TTFA 2CGLA 4C1NI 2Q31A 4DF4A 1LV5A 3C6UA 3L2QA 4O5BA 1JLAA 4BRFA 3MXMA 1NMDA 2D0OA 4JI8K 3THYB 4U7BA 5ADXH 4CF2A 2QTDA 1LW2A 4K8ZA 4FJ8A 1R0AA 4BC4A 1RBTA 5AQYA 4KHQA 1R59O 3C6AA 5J1EA 1NBWA 1XWLA 4M45A 1KAXA 3FZKA 3S3NA 4FJHA 2KZMA 2NRWA 3J8AA 5AQSA 1Z05A 3PV8A 3NMUA 3K9JA 3H6EA 4NXNK 4JKCA 4Q0BA 1LOTB 3H3NO 2KZZA 5KI6A 3D45A 3AARA 2VWBA 3ZSYA 4Z4CA 4M42A 4BR0A 2P9UB 4OLBA 1XC3A 3LAKA 3MEGA 1C0GA 3CJ1A 3BZCA 2NRTA 4LH4A 4O8KA 4AM7A 1GLBG 3Q7CA 4DV3K 5GAEP 5M1PA 4FZXC 4BWJA 1IBMK 4PHTX 4N56A 4E7KA 2QWPA 3KK1A 4CFBA 1HYSA 3R8EA 3CC4N 2KQ2A 3M8RA 4B9TA 4FYDA 1M1KO 5BN8A 5J2PA 1VAZA 1E3MA 3L2WA 4FJNA 2O8CA 1IKWA 2QXLA 3F2KA 4EP4A 4PWDA 2QXFA 3CCMN 2AA4A 3DAWA 4DR5K 1GLDG 4BC3A 5E41A 3OJUA 3LDPA 1VSHA 2YHYA 1NK5A 2GX9A 4KTWA 3OBWA 1KAYA 2PZSA 3K5LA 3A5LC 3IUCA 4FWNA 4FK4A 3VQPA 4Y1CA 3ZT1A 4JV5K 4DQPA 2RF2A 1WSGA 1BL3A 4BREA 3SUOA 1JLCA 3TTDA 4MO5A 3HK2A 4RTFD 1N34K 4OKJA 4CD3A 3FLCO 4BRAA 4FJXA 4PKHA 1HNVA 3LPTA 4CBXA 4X65K 1W7AA 4JKHA 1QQNA 1YF5L 1VSMA 5CZ1A 3CJ9A 3TR8A 2E1ZA 3CQYA 4OKEA 3WXMB 1G99A 1NKBA 3UIQA 4WQ4A 4C8LA 3HP9A 4LY7A 3JXUA 1Q8IA 2QA4N 3SI6A 3QFPA 3HP6A 3ZT0A 4AILC 2O4IA 3QBWA 3PIPL 3QB0A 1C0TA 1GLCG 5C15A 3CFOA 1QQCA 4B8CA 4FLXA 2P9KA 4CJSA 3CQXA 1ASUA 2ITGA 2UUBK 4CHZA 1ATSA 1RT4A 4CBUA 1CLQA 5JICA 2YHXA 3VQDA 4BRLA 4ZHRA 1RDAA 4IBNA 3ZEUB 4BR4A 1WN7A 3O9QA 4CK3A 3B8AX 4HTLA 1TV6A 3P1GA 3U3YA 4FLYA 4FM2A 3L0QA 5K14A 1ZYQA 4CZLA 3CCEN 2HOEA 3N4QA 2F4VK 3HO1A 2GTDA 5I3UA 3KK3A 3LP1A 4JK7A 3DM2A 3CCSN 1NJYA 4I9QA 5C25A 3L2UA 2PYJA 3MECA 3CI5A 1WNSA 3UKUB 3NE6A 5BREA 5C42A 2E2OA 3WT0A 3MMVA 4OX9K 2Q0RA 4WCEL 3RMCA 3S9HA 4RW4A 4N41A 2UXDK 2RN2A 4NYFA 4KHWA 1RCHA 1RT5A 2OANA 4FW1A 1SL0A 3DYAA 4CHNA 5JVGL 3ZSWA 3ULEA 4C8MA 3NF8A 1ESVA 3SLCA 4DB3A 2DY4A 1Q18A 4LF9K 4QOZB 4LFAK 3R6MA 3O4QA 1W2BM 3BF3A 1XC9A 3LDSA 3CIPA 1QTMA 3EZ5A 4B9LA 4MO4A 4BR7A 5M1OA 4DV5K 1JLBA 4H5VA 3QEXA 3AA2A 3PSFA 3KVGA 3U8XA 2XO7A 4LSLA 3RMDA 2F9TA 3AO1A 4AHTA 1RDDA 4FM0A 1LWFA 1U4BA 2V51B 5B8HA 4DQQA 2QKKA 4RW9A 5HP1A 4R5PA 2V52B 1YTUA 3UE5A 4JI3K 2IVPA 4XEIA 3ZT3A 3QETA 1OVQA 3BY5A 5AZIB 3W3DA 2E88A 2Y1JA 3HPOA 1RT1A 2ZM6K 4MQ3A 4DV6K 2RE2A 4DTUA 5AQKA 4YORA 4FPBA 2A1RA 4CHYA 2WUSA 4YFUA 2F96A 2OZSA 4LFCK 3A2FA 2PFUA 5H1SQ 3O3GA 4CJRA 3V1OA 2FBYA 4PY5A 4PL7A 3AVMA 1BQNA 2O8DA 1HKBA 1VSIA 3SQ1A 1ZBLA 3HI0A 4FWOA 5JS1A 4M3TA 1ATRA 1ZBFA 2HSTA 3RRHA 4IXCA 1YVNA 1ZXOA 3OY9A 4CJPA 4JYAK 1F21A 3EZWA 3O9TA 4G1QA 4DKWA 2UU9K 1DKGD 3O6WA 1SQKA 1U49A 4XH5A 4DV2K 2R7YA 3QICA 4JRQA 4E1JA 3A8YA 5KGXA 3CG7A 2HBKA 5HRPA 4J2EA 4BE0A 1WSHA 3TAMA 4CBWA 4LF7K 2ZWHA 1U2VB 2VGNA 4DR3K 2GBZA 1JCGA 3H45C 3M3ZA 1SUQA 3CCUN 4W5TA 3K2PA 5C12A 3MEDA 3O08A 3AVAA 3EY1A 3O4NA 4YNQA 4DR2K 4DTOA 5CYMA 3M8SA 1QSLA 1E4FT 3JS6A 2RHKA 2QWOA 4CZGA 1WUAA 2DTUA 4ZTFA 3SAGA 3HVTA 4CIEA 1VQ6N 2IOCA 1VSFA 3O3HA 4DTJA 4MLHA 1KVBA 5M1KA 3TAPA 4KHSA 3MXJA 2P9LB 1S1VA 4F3TA 3HOTA 4B1YB 5MLCQ 1XMOK 2ZQBA 2IDOA 2QWRA 3C95A 4CZEA 5EX5A 3LAMA 3SUNA 3CJAA 3LWLA 3VTHA 5GAGP 4DTXA 4A57A 4JK9A 3LL3A 4FJGA 1KAZA 3EN9A 4Z4EA 3ZX0A 1VHXA 4Q5VA 4CEZA 4I7FA 2YHBA 3FZHA 3VGKA 4CJWA 4A61A 1TYQA 4RW7A 1KSPA 4B08A 3FZFA 4X66K 3AA5X 1MWMA 4E89A 3C7NB 4K8XA 4H0PA 2V7ZA 1YI2N 1C1CA 1BWFO 5EY4A 1EX4A 3OBYA 1TVRA 1JCEA 1HKCA 2NNWA 4FJKA 2YNHA 3ZX2A 1FXXA 1J53A 1BA1A 4FJJA 3WXKA 5AQLA 4IG0A 1DLOA 1CZBA 4B9VA 4CHOA 3MEEA 4K0KK 2P1JA 1N6QA 4HUFA 2FXUA 3OS0A 2WTUA 5BRFA 4IKFA 2DPNA 3TSPA 3P39A 2P9NA 5HRRA 2A40A 3LZIA 1IJJA 3CXCM 4Y0WA 3CPWM 3THWB 3NF6A 1UA0A 1QE1A 1KQSM 4BACA 4JN4A 4V19S 3ZETB 1D5AA 5BRHA 3LALA 2E4LA 4BRDA 4DQRA 1H1VA 3K59A 1KVCA 3NF9A 4CJUA 1RTJA 1NK8A 4GVMA 4ISGA 3T3FA 2OCEA 2E2PA 2NRZA 3C6TA 2W40A 1LAVA 1K8KA 5AJ3K 3LANA 1A5WA 4A5AA 1BI4A 3ID6A 3THXA 3CERA 3OJSA 4JHDA 4AHUA 3AVLA 4N76A 1Y64A 5JLFA 3OA9A 1VQNN 2QM1A 2W6KA 1TK0A 1JL1A 3K57A 3Q7BA 3BF1A 3KZBA 4DSIA 2VYPA 4KH4A 4NXMK 3NVMA 3NHGA 4B1WB 1D9FA 2A6AA 3OYNA 1O13A 4WQ4C 4DSLA 3C6HA 3NGZA 4BVOA 1JLQA 2NLXA 1VQ8N 3DRSA 2A3ZA 4FWPA 4B9MA 3NH0A 1NJWA 3OYLA 1GOAA 1KTQA 2BGGA 3VQBA 3DXMA 3EO3A 3O9SA 2GEMA 3TABA 4BG9A 2BDPA 3NCIA 2W42A 1VSLA 4BRMA 2FLOA 3AY9A 4NO7A 4YDUA 3TPQA 3CFPA 3G10A 4NCAA 2E20A 4W5QA 4LF6K 4O8UA 3SAFA 2P9IB 3ULEB 4KH5A 3PUFA 1NJIO 1W97L 1X1PA 4C8NA 1NJXA 3NF7A 4WQ5C 4FJ5A 2HHSA 4WFAL 3SV3A 4K42A 4U67L 5M1QA 2HBLA 3VQ6A 1V4SA 3K58A 5AQQA 3HZ6A 1Q9XA 1B9DA 1BQMA 2HNYA 3BP8A 5HRNA 5BPNA 5AQUA 1U04A 4DV0K 2FF3B 5GADP 2E1YA 2ZJRL 1YHQN 4DLEA 3G4SN 1EQYA 1NMNA 2DFHA 2H3GX 2JLEA 3G25A 4NLCA 1X3MA 5F1XA 3VGLA 1NK7A 3MN9A 2JWKA 4CGJA 4O5FA 2HF4A 2E8AA 4I2QA 5SWMA 3VQAA 4BQZA 4OO1J 1VSKA 4DTSA 4GNIA 1ZBHA 3AVFA 2Z1JA 4I6MA 3H46O 1ZBUA 1HMVA 4CF8A 4BY9C 3I0RA 1HKGA 5T7BA 4OJRA 2VQEK 4CFCA 3AA4A 1LWEA 2J4RA 4H0OA 2HNZA 1KCFA 4PKGA 3QEPA 4DQSA 1RDWX 2QWLA 5FRMA 1YUWA 4IEIA 3PX0A 3AO5A 1NOZA 3E9PA 4A5BA 3FFKB 1XUPO 1J54A 4KI4A 5LMNK 4DUZK 2OPSA 1VRUA 3SJJA 3SV4A 4BE1A 4JI6K 4L8RB 4A2AA 4CE9A 4BR2A 1IG9A 3PIOL 1IH7A 5HLFA 1T03A 4H0XB 5AQRA 3LDNA 4ID1A 5AQZA 2EX3A 3TTCA 4FO0A 3V81A 2FF6A 4FWQA 5SZTA 2BTFA 1U48A 3WXJA 3VGMA 4J2BA 1RT6A 3K5MA 4B9NA 1VQ9N 4CVNE 3VPZA 4CEEA 3V1QA 4WFBL 1J5EK 3KWIA 1NGEA 3HTVA 3WEEA 4CEQA 3KD1E 3NVKA 2IS3A 4CJVA 3J80O 1J6ZA 1EWQA 4ISFA 4ICLA 1JJ2M 2UUCK 4W5RA 2PYLA 1SV5A 5M1FA 4IJAA 5EXWA 2ZJPL 4CJEA 1A5XA 3PLAA 1NG9A 3RRGA 3RR8A 3F9MA 3CETA 5CR4A 3ZX3A 4N47A 2HF3A 4AHRA 1ITGA 3ENHA 4FJ9A 1JLFA 2JWLA 4LF4K 3W0LA 2ASOA 4HVJA 1HQEA 3ZT2A 3GL1A 4EHTA 3OYAA 2HW3A 3LDOA 3VESA 4BGBA 1D4XA 4JKFA 3AVNA 2PAVA 4B3TK 2G8IA 4DR7K 1GLJO 1QZ6A 3AVJA 1WB9A 3KKRA 1TK5A 4KKOA 4AQYK 4KHPK 1YVUA 3KD5E 3GG4A 3E1YA 1HPMA 3H1VX 2I7PA 5C0YA 3FE1A 1NGJA 3UKRA 3VQ7A 4OGCA 5JMVA 2IGIA 5J2MA
chains in the Genus database with same CATH topology
4LH5A 1S1XA 4JS5A 2Z1HA 2G8WA 4KTQA 1S9EA 2Y1JA 1QSSA 3HPOA 3PY8A 1RT1A 4GMJB 2YV0X 4KI6A 1VRTA 2YNGA 4MQ3A 2PY5A 1SKRA 3TI0A 4DTUA 1T8EA 4KB1A 2HHQA 1RBSA 4FZYA 4NYNA 2A1RA 4CHYA 3HSTB 2QKBA 4YFUA 2OZSA 2F96A 2HVIA 3A2FA 3QLHA 4KHNA 2GV9A 3O3GA 4HTUA 1FK9A 2YHAA 2YKNA 2BE2A 4AHSA 3MAQA 4PQUA 4CJRA 3V1OA 2FBYA 3DLGA 4PY5A 3BGRA 3V9WA 1KRPA 4DF8A 3JYTA 1S5JA 3AVMA 1BQNA 4CJ4A 4OPKA 3KLGA 2G8HA 4B9SA 1TAQA 3CQ8A 1LAWA 2G8VA 4IDKA 1VSIA 3SQ1A 1ZBLA 3ZSRA 3OS1A 4PUOA 1X9WA 4CF0A 1RBRA 3K5OA 1S1WA 4OLAA 4CEOA 5JS1A 4B8AB 4B9UA 4M3TA 4FCYA 1ZBFA 2VG7A 4O55A 2VWJA 3TANA 3RRHA 3AA3A 4O44A 2E6MA 4H8KA 3KTQA 3SUPA 3U3GA 3WNEA 1TK8A 4KFBA 2HHTA 3D0PA 3OY9A 3OYGA 4CJPA 3K5NA 1XHZA 2HVHA 4EZ6A 1L3SA 1F21A 2EHGA 1X9SA 3RWUA 4DFKA 4E19A 4G1QA 2HMIA 3CYMA 4PA1A 1KFSA 1U49A 4CEAA 4I2PA 1RDCA 3AVKA 4CJQA 2HHVA 4BWMA 3C94A 2R7YA 4JRQA 1HRHA 2X6NA 1WSJA 2D0AA 2OA8A 2VG5A 5KGXA 4BE2A 4CJKA 1KVAA 3CG7A 1G15A 5HRPA 2B5JA 4J2EA 1EETA 3H08A 4J2DA 3OYEA 1B9FA 3WNHA 4BE0A 1JXBA 3RR7A 1S1UA 3AO2A 1WSHA 4FLVA 3TAMA 3SQ0A 5EU7A 2FBVA 4CF1A 3CM6A 4M3UA 2ZE2A 1HYZA 1LW0A 1RNHA 4W5OA 4CECA 3IRXA 4DS4A 2GBZA 1HNIA 4QCLA 3RMBA 1RDBA 4DTRA 2P51A 1SL2A 1TKDA 3EYZA 1VSEA 2XY8A 1SUQA 5KRSA 3ASMA 1IKVA 3HYFA 3K2PA 4W5TA 4E7HA 1CZ9A 3MEDA 4FLWA 3AVAA 4HUEA 3EY1A 4HCBA 2XRIA 3O4NA 1N5YA 3HXMA 4YNQA 3T1AA 3V9UA 4DTOA 3ZT4A 5CYMA 3M8SA 4CHPA 3AVGA 3ULDA 1DTQA 4M3RA 3SPZA 1BI4B 1QSLA 3NAEA 4E7IA 4CJFA 2DTUA 3V9XA 4DS5A 4ZTFA 1T05A 1U47A 3HVTA 4CIEA 1UWBA 3F73A 4ELVA 2IOCA 1VSFA 3O3HA 3U6FA 3QEIA 1Q9YA 4DTJA 3VQ5A 3KLHA 1KVBA 3TAPA 4KHSA 2HHUA 4OKKA 1JLEA 3MXJA 3OYDA 4MFBA 2XY5A 2RKIA 4FLUA 3VN5A 4CEFA 1S1VA 4F3TA 3QO9A 3SUQA 1GOBA 4M3ZA 3M8PA 3AV9A 2ZQBA 4CJ3A 3ALYA 4O0JA 2IDOA 3C95A 2HHWA 1TKZA 1UAXA 4RW6A 1L3VA 1X9MA 1QS4A 3FFIA 3DOLA 3LAMA 3SUNA 4CGIA 1Y97A 3LWLA 1K6YA 2XHBA 3SZ2A 3V1RA 4DU3A 1WAFA 2X6SA 4DTXA 1NK6A 2ZD1A 2FBTA 3TAEA 3ZSVA 4Z4GA 3L2RA 4FJGA 1BCOA 4ID5A 3VA3A 3TARA 1NK9A 2G8FA 4Z4EA 3KKSA 2G8KA 1C6VA 3IS9A 4Q5VA 5FROA 4CEZA 3HT3A 1JXEA 1ASWA 3DLRA 5FDLA 5J2QA 4CGGA 1BIZA 3E01A 2YHBA 4I7FA 4KB0A 4BDPA 1NKCA 2B4JA 1WAJA 4CJWA 1D9DA 4I9LA 3KLFA 4CF9A 4NCBA 2OYQA 3V9ZA 2KFNA 4RW7A 1KSPA 4B08A 4H4OA 3AA5X 4E89A 4M3WA 4K8XA 3HPHA 3AVBA 3KLIA 1SKWA 1FKPA 1B92A 3VQ4A 1JKHA 3OYHA 4DSFA 3NH1A 1RTIA 1CXUA 4H4MA 1C1CA 1NOYA 3PX6A 4HCCA 1EX4A 1S6QA 4FVMA 2GUIA 3NFAA 4DSKA 3F9KA 4KTZA 1TVRA 1TKXA 3DMJA 4GW6A 4LD0A 3KK2A 1SL1A 4CK2A 1XHXA 3HPGA 2YNHA 4FJKA 1FXXA 1J53A 1TL1A 3ITHA 2D0BA 1WSFA 5DK5A 1D8YA 4FJJA 4FZZA 1HJRA 2OPQA 2VG6A 3VQQA 3VQEA 4IG0A 4W5NA 1RT7A 4E3SA 4ZTJA 1DLOA 1YTAA 4M3XA 1T7PA 1CZBA 4B9VA 1RTDA 3S3MA 4CHOA 3DLHA 3AVIA 4J2AA 1A5VA 1I39A 3DRRA 3MEEA 3ZSQA 4E1NA 4DU1A 1UA1A 3BDPA 2P1JA 4FJMA 1LWCA 1TGOA 4CJTA 1N6QA 4Z4IA 2IC3A 4HUFA 2WONA 3OS0A 4IKFA 2Z1GA 2OZMA 4RW8A 1RT3A 3M8QA 4DF4A 2DFEA 1LV5A 4FJLA 3OYFA 4F2SA 4I9QA 3C6UA 4AHVA 3L2QA 5HRRA 3RMAA 3LZIA 4O5BA 3WNFA 1EP4A 1JLAA 1Z25A 4DU4A 3MXMA 3NF6A 1UA0A 1QE1A 4BACA 4CGHA 1MU2A 4E7LA 1QSYA 4CF2A 1D5AA 1CXQA 2XY7A 4CGDA 3LALA 4DFPA 2E4LA 4JRPA 1LW2A 4DQRA 1RBUA 4K8ZA 4KPYA 2Z1IA 3K59A 4IFVA 3QEWA 4FJ8A 1R0AA 2F8SA 1KVCA 2D0CA 1RBTA 3NF9A 4CJUA 1RTJA 4KV8A 4DTMA 1NK8A 4GVMA 4CJLA 4KHQA 5J1EA 3NGIA 1XWLA 3T3FA 3KIOA 4M45A 2KW4A 1L5UA 3S3NA 3C6TA 1LAVA 1SKSA 4JLHA 4FJHA 4DSJA 1REVA 1A5WA 3LANA 2HHXA 2KZMA 1BI4A 1BHLA 4CCHA 4F2RA 3KLEA 3PV8A 4B3OA 3L3VA 3OJSA 4AHUA 4BDZA 3AVLA 4F3OA 4N76A 4Q0BA 3G0ZA 2KZZA 5KI6A 2Q3SA 3D45A 4FXDA 1TK0A 1JL1A 4CHQA 3ZSXA 3K57A 3ZSYA 4Z4CA 4XIUA 4M42A 2YNIA 2IAJA 3B6PA 4OPJA 1IKYA 4OLBA 4DSIA 2ETJA 3DLKA 1HYVA 3LAKA 3MEGA 1IKXA 3VQCA 4DFJA 4CESA 3OYKA 2P5OA 3NHGA 2WOMA 4LH4A 1D9FA 3OYNA 3KJVA 3DOKA 4FK2A 4CERA 4M41A 4CGFA 4DSLA 4CIFA 3O3FA 3NGZA 1JLQA 1TL3A 1HPZA 4DFMA 1BGXT 1Z26A 3DRSA 5I42A 3MXIA 3LPUA 4B9MA 4FZXC 4BWJA 3NH0A 3L8BA 1NJWA 3OYLA 3SCXA 1GOAA 1KTQA 3VQ8A 4N56A 3VQBA 2I5JA 3NBPA 4E7KA 3KK1A 2BGGA 4CFBA 1HYSA 1TKTA 3TABA 4DG1A 5KGWA 3NCIA 4NCGA 3SYZA 2W42A 2BDPA 4DWIA 2KQ2A 3M8RA 4B9TA 5FRNA 5CZ2A 1RBVA 1VSLA 4FYDA 4EZ9A 4KAZA 5J2PA 4KHUA 3L2WA 4E0DA 2YKMA 2QK9A 4FJNA 1IKWA 1WSEA 4Y1DA 5C24A 4EP4A 4PWDA 2QXFA 3CFPA 3G10A 4NCAA 4W5QA 4FJ7A 4N5SA 1W9HA 5HROA 4LSNA 5E41A 3PX4A 3PUFA 4M3YA 2HB5A 3DLEA 4TSXA 3B6OA 1X1PA 4C8NA 3OJUA 1NJXA 1VSHA 1NK5A 4CFAA 4KTWA 3NF7A 4CEDA 4FJ5A 2PZSA 3K5LA 3NGYA 2HHSA 3SV3A 3RTVA 4FK4A 2OPRA 3VQPA 4Y1CA 3ZT1A 3I8DA 1C0MA 4DTNA 3VQ6A 4DQPA 3L3UA 2RF2A 3K58A 1WSGA 1BL3A 5JS2A 5J2NA 3HJFA 3SUOA 4FJIA 1KFDA 1JLCA 4JS4A 1Q9XA 1B9DA 1BQMA 2HNYA 4O0IA 3SNNA 1NJZA 5HRNA 4C8OA 4DQIA 4BDYA 3HK2A 4OKJA 1U04A 4FJXA 4E1MA 3OYMA 1EKEA 4DMNA 4DLEA 2E6LA 3TAFA 1HNVA 3IAYA 3LPTA 4DTPA 2DFHA 2JLEA 3DRPA 4DLGA 3HM9A 3V6DA 3VA0A 1NK7A 1VSMA 5CZ1A 5HBMA 4CGJA 3QERA 2XY6A 2KFZA 3TR8A 3ISNC 1IO2A 1XI1A 4OKEA 5HRSA 1ZBIA 4I2QA 5SWMA 3VQAA 1NKBA 3UIQA 1VSKA 3OYBA 4DTSA 1ZBHA 4CJ5A 1BCMA 3ZCMA 3VQ9A 3AVFA 2YNFA 1UOCA 2Z1JA 3HP9A 4LY7A 4HHTA 4C8LA 1Q8IA 1VSJA 2A1SA 1O1WA 1ZBUA 3SI6A 1HMVA 4CF8A 3I0RA 3HP6A 4UQGA 5T7BA 4OJRA 3ZT0A 1TAUA 4AILC 2O4IA 1J5OA 4CFCA 3AA4A 1LWEA 3LP3A 1JLGA 1C0TA 2RPIA 5CY4A 4E7JA 3QEVA 3CFOA 1QQCA 2KTQA 4B8CA 1C0UA 4FLXA 4CJSA 2HNZA 1ASUA 1KCFA 2ITGA 2F8TA 3QEPA 2FBXA 4EP5A 4Z4HA 4CHZA 1RT4A 2NUBA 4DQSA 1CLQA 1GOCA 3VQDA 4DSEA 4ZHRA 5FRMA 1RDAA 1JL2A 4IBNA 2X78A 3OYJA 3PX0A 1WN7A 3LZJA 3AO5A 1NOZA 3SPYA 2P5GA 4AHCA 5D3GA 3TWHA 3T19A 4CK3A 3TAGA 1TV6A 1WLJA 3OVNA 1J54A 3P1GA 4CIGA 3OYCA 3P5JA 3V9SA 3U3YA 3V4IA 4KI4A 4FLYA 2D5RA 4FM2A 4FM1A 2OPSA 1VRUA 5K14A 3SJJA 3SV4A 1ZYQA 4KHYA 1DTTA 4BE1A 4L8RB 1YT3A 4CFDA 4CE9A 1EXQA 1IG9A 1IH7A 2O4GA 3LP0A 5HLFA 1T03A 3HO1A 1W0HA 3QIOA 2EX3A 4ID1A 5I3UA 3KK3A 3V81A 5KRTA 3PO4A 1RT2A 3LP1A 3DM2A 1FKOA 5SZTA 1U48A 4C8KA 2Y1IA 1NJYA 1L3UA 4CEBA 5C25A 4CK1A 3L2UA 3DI6A 4HUGA 3SQ4A 2PYJA 3AO4A 3MECA 4WE1A 3NH2A 3OS2A 4J2BA 1WNSA 4FK0A 1WSIA 1C1BA 1RT6A 4RG8A 3K5MA 3ZSOA 3NE6A 2LSNA 4B9NA 1KLMA 1NKEA 3SQ2A 5C42A 3QNOA 4CEEA 4AH9A 3V1QA 1NK4A 4ELUA 2G8UA 3RMCA 4IG3A 4CEQA 4ELTA 1VK0A 3P83D 3S9HA 4RW4A 4N41A 2AJQA 1C1AA 4Z0UA 3KD1E 2RN2A 4NYFA 3QNNA 2IS3A 4CJVA 2X74A 4KHWA 1RCHA 1RT5A 2HNDA 3OYIA 4FW1A 2OPPA 4ICLA 4FLZA 1SL0A 4KREA 3AO3A 1VSDA 2B6AA 3DYAA 4KO0A 4W5RA 3QESA 4CHNA 2PYLA 1SV5A 1ASVA 4FW2A 3ZSWA 3I0SA 3DLBA 4C8MA 3NF8A 2DY4A 3ZSZA 4QOZB 3QINA 1A5XA 4CJEA 3WNGA 3AVHA 3CFRA 3O4QA 1KLNA 3RRGA 5CYQA 1XC9A 3RR8A 4OVLA 1BISA 3LP2A 3LWMA 4FLTA 3LDSA 4KRFA 4N47A 1L3TA 4AHRA 3EZ5A 1ITGA 1QTMA 4B9LA 3NDKA 4FJ9A 1JLFA 3IG1A 1U45A 1HQUA 4HVJA 1HQEA 3ZT2A 3OYAA 2HW3A 1S9GA 2DFFA 1NK0A 2ATQA 2JGUA 3S3OA 3L2VA 3HVRA 3PO5A 1S1TA 1JLBA 3AVNA 3QEXA 2G8IA 3TAQA 3AA2A 3THVA 2XO7A 1BIUA 1QHTA 4LSLA 3RMDA 4Z4FA 1RILA 3AO1A 4AHTA 4F8RA 1RDDA 3AVJA 4FM0A 3KKRA 1J9AA 1TK5A 4KKOA 4F4KA 3AVCA 1YVUA 1LWFA 2FC0A 3KD5E 4O4GA 1U4BA 1I3AA 4DQQA 2QKKA 3HL8A 4OGEA 5KTQA 2BANA 3CM5A 2VWKA 4RW9A 3JSMA 5HP1A 4R5PA 1RTHA 3QIPA 4IFYA 1YTUA 4OGCA 5DMRA 3VQ7A 1S6PA 4QAGA 2IGIA 3ZT3A 3QETA 5J2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LH5 A;  1S1X A;  4JS5 A;  2Z1H A;  2G8W A;  4KTQ A;  1S9E A;  2Y1J A;  1QSS A;  3HPO A;  3PY8 A;  1RT1 A;  4GMJ B;  2YV0 X;  4KI6 A;  1VRT A;  2YNG A;  4MQ3 A;  2PY5 A;  1SKR A;  3TI0 A;  4DTU A;  1T8E A;  4KB1 A;  2HHQ A;  1RBS A;  4FZY A;  4NYN A;  2A1R A;  4CHY A;  3HST B;  2QKB A;  4YFU A;  2OZS A;  2F96 A;  2HVI A;  3A2F A;  3QLH A;  4KHN A;  2GV9 A;  3O3G A;  4HTU A;  1FK9 A;  2YHA A;  2YKN A;  2BE2 A;  4AHS A;  3MAQ A;  4PQU A;  4CJR A;  3V1O A;  2FBY A;  3DLG A;  4PY5 A;  3BGR A;  3V9W A;  1KRP A;  4DF8 A;  3JYT A;  1S5J A;  3AVM A;  1BQN A;  4CJ4 A;  4OPK A;  3KLG A;  2G8H A;  4B9S A;  1TAQ A;  3CQ8 A;  1LAW A;  2G8V A;  4IDK A;  1VSI A;  3SQ1 A;  1ZBL A;  3ZSR A;  3OS1 A;  4PUO A;  1X9W A;  4CF0 A;  1RBR A;  3K5O A;  1S1W A;  4OLA A;  4CEO A;  5JS1 A;  4B8A B;  4B9U A;  4M3T A;  4FCY A;  1ZBF A;  2VG7 A;  4O55 A;  2VWJ A;  3TAN A;  3RRH A;  3AA3 A;  4O44 A;  2E6M A;  4H8K A;  3KTQ A;  3SUP A;  3U3G A;  3WNE A;  1TK8 A;  4KFB A;  2HHT A;  3D0P A;  3OY9 A;  3OYG A;  4CJP A;  3K5N A;  1XHZ A;  2HVH A;  4EZ6 A;  1L3S A;  1F21 A;  2EHG A;  1X9S A;  3RWU A;  4DFK A;  4E19 A;  4G1Q A;  2HMI A;  3CYM A;  4PA1 A;  1KFS A;  1U49 A;  4CEA A;  4I2P A;  1RDC A;  3AVK A;  4CJQ A;  2HHV A;  4BWM A;  3C94 A;  2R7Y A;  4JRQ A;  1HRH A;  2X6N A;  1WSJ A;  2D0A A;  2OA8 A;  2VG5 A;  5KGX A;  4BE2 A;  4CJK A;  1KVA A;  3CG7 A;  1G15 A;  5HRP A;  2B5J A;  4J2E A;  1EET A;  3H08 A;  4J2D A;  3OYE A;  1B9F A;  3WNH A;  4BE0 A;  1JXB A;  3RR7 A;  1S1U A;  3AO2 A;  1WSH A;  4FLV A;  3TAM A;  3SQ0 A;  5EU7 A;  2FBV A;  4CF1 A;  3CM6 A;  4M3U A;  2ZE2 A;  1HYZ A;  1LW0 A;  1RNH A;  4W5O A;  4CEC A;  3IRX A;  4DS4 A;  2GBZ A;  1HNI A;  4QCL A;  3RMB A;  1RDB A;  4DTR A;  2P51 A;  1SL2 A;  1TKD A;  3EYZ A;  1VSE A;  2XY8 A;  1SUQ A;  5KRS A;  3ASM A;  1IKV A;  3HYF A;  3K2P A;  4W5T A;  4E7H A;  1CZ9 A;  3MED A;  4FLW A;  3AVA A;  4HUE A;  3EY1 A;  4HCB A;  2XRI A;  3O4N A;  1N5Y A;  3HXM A;  4YNQ A;  3T1A A;  3V9U A;  4DTO A;  3ZT4 A;  5CYM A;  3M8S A;  4CHP A;  3AVG A;  3ULD A;  1DTQ A;  4M3R A;  3SPZ A;  1BI4 B;  1QSL A;  3NAE A;  4E7I A;  4CJF A;  2DTU A;  3V9X A;  4DS5 A;  4ZTF A;  1T05 A;  1U47 A;  3HVT A;  4CIE A;  1UWB A;  3F73 A;  4ELV A;  2IOC A;  1VSF A;  3O3H A;  3U6F A;  3QEI A;  1Q9Y A;  4DTJ A;  3VQ5 A;  3KLH A;  1KVB A;  3TAP A;  4KHS A;  2HHU A;  4OKK A;  1JLE A;  3MXJ A;  3OYD A;  4MFB A;  2XY5 A;  2RKI A;  4FLU A;  3VN5 A;  4CEF A;  1S1V A;  4F3T A;  3QO9 A;  3SUQ A;  1GOB A;  4M3Z A;  3M8P A;  3AV9 A;  2ZQB A;  4CJ3 A;  3ALY A;  4O0J A;  2IDO A;  3C95 A;  2HHW A;  1TKZ A;  1UAX A;  4RW6 A;  1L3V A;  1X9M A;  1QS4 A;  3FFI A;  3DOL A;  3LAM A;  3SUN A;  4CGI A;  1Y97 A;  3LWL A;  1K6Y A;  2XHB A;  3SZ2 A;  3V1R A;  4DU3 A;  1WAF A;  2X6S A;  4DTX A;  1NK6 A;  2ZD1 A;  2FBT A;  3TAE A;  3ZSV A;  4Z4G A;  3L2R A;  4FJG A;  1BCO A;  4ID5 A;  3VA3 A;  3TAR A;  1NK9 A;  2G8F A;  4Z4E A;  3KKS A;  2G8K A;  1C6V A;  3IS9 A;  4Q5V A;  5FRO A;  4CEZ A;  3HT3 A;  1JXE A;  1ASW A;  3DLR A;  5FDL A;  5J2Q A;  4CGG A;  1BIZ A;  3E01 A;  2YHB A;  4I7F A;  4KB0 A;  4BDP A;  1NKC A;  2B4J A;  1WAJ A;  4CJW A;  1D9D A;  4I9L A;  3KLF A;  4CF9 A;  4NCB A;  2OYQ A;  3V9Z A;  2KFN A;  4RW7 A;  1KSP A;  4B08 A;  4H4O A;  3AA5 X;  4E89 A;  4M3W A;  4K8X A;  3HPH A;  3AVB A;  3KLI A;  1SKW A;  1FKP A;  1B92 A;  3VQ4 A;  1JKH A;  3OYH A;  4DSF A;  3NH1 A;  1RTI A;  1CXU A;  4H4M A;  1C1C A;  1NOY A;  3PX6 A;  4HCC A;  1EX4 A;  1S6Q A;  4FVM A;  2GUI A;  3NFA A;  4DSK A;  3F9K A;  4KTZ A;  1TVR A;  1TKX A;  3DMJ A;  4GW6 A;  4LD0 A;  3KK2 A;  1SL1 A;  4CK2 A;  1XHX A;  3HPG A;  2YNH A;  4FJK A;  1FXX A;  1J53 A;  1TL1 A;  3ITH A;  2D0B A;  1WSF A;  5DK5 A;  1D8Y A;  4FJJ A;  4FZZ A;  1HJR A;  2OPQ A;  2VG6 A;  3VQQ A;  3VQE A;  4IG0 A;  4W5N A;  1RT7 A;  4E3S A;  4ZTJ A;  1DLO A;  1YTA A;  4M3X A;  1T7P A;  1CZB A;  4B9V A;  1RTD A;  3S3M A;  4CHO A;  3DLH A;  3AVI A;  4J2A A;  1A5V A;  1I39 A;  3DRR A;  3MEE A;  3ZSQ A;  4E1N A;  4DU1 A;  1UA1 A;  3BDP A;  2P1J A;  4FJM A;  1LWC A;  1TGO A;  4CJT A;  1N6Q A;  4Z4I A;  2IC3 A;  4HUF A;  2WON A;  3OS0 A;  4IKF A;  2Z1G A;  2OZM A;  4RW8 A;  1RT3 A;  3M8Q A;  4DF4 A;  2DFE A;  1LV5 A;  4FJL A;  3OYF A;  4F2S A;  4I9Q A;  3C6U A;  4AHV A;  3L2Q A;  5HRR A;  3RMA A;  3LZI A;  4O5B A;  3WNF A;  1EP4 A;  1JLA A;  1Z25 A;  4DU4 A;  3MXM A;  3NF6 A;  1UA0 A;  1QE1 A;  4BAC A;  4CGH A;  1MU2 A;  4E7L A;  1QSY A;  4CF2 A;  1D5A A;  1CXQ A;  2XY7 A;  4CGD A;  3LAL A;  4DFP A;  2E4L A;  4JRP A;  1LW2 A;  4DQR A;  1RBU A;  4K8Z A;  4KPY A;  2Z1I A;  3K59 A;  4IFV A;  3QEW A;  4FJ8 A;  1R0A A;  2F8S A;  1KVC A;  2D0C A;  1RBT A;  3NF9 A;  4CJU A;  1RTJ A;  4KV8 A;  4DTM A;  1NK8 A;  4GVM A;  4CJL A;  4KHQ A;  5J1E A;  3NGI A;  1XWL A;  3T3F A;  3KIO A;  4M45 A;  2KW4 A;  1L5U A;  3S3N A;  3C6T A;  1LAV A;  1SKS A;  4JLH A;  4FJH A;  4DSJ A;  1REV A;  1A5W A;  3LAN A;  2HHX A;  2KZM A;  1BI4 A;  1BHL A;  4CCH A;  4F2R A;  3KLE A;  3PV8 A;  4B3O A;  3L3V A;  3OJS A;  4AHU A;  4BDZ A;  3AVL A;  4F3O A;  4N76 A;  4Q0B A;  3G0Z A;  2KZZ A;  5KI6 A;  2Q3S A;  3D45 A;  4FXD A;  1TK0 A;  1JL1 A;  4CHQ A;  3ZSX A;  3K57 A;  3ZSY A;  4Z4C A;  4XIU A;  4M42 A;  2YNI A;  2IAJ A;  3B6P A;  4OPJ A;  1IKY A;  4OLB A;  4DSI A;  2ETJ A;  3DLK A;  1HYV A;  3LAK A;  3MEG A;  1IKX A;  3VQC A;  4DFJ A;  4CES A;  3OYK A;  2P5O A;  3NHG A;  2WOM A;  4LH4 A;  1D9F A;  3OYN A;  3KJV A;  3DOK A;  4FK2 A;  4CER A;  4M41 A;  4CGF A;  4DSL A;  4CIF A;  3O3F A;  3NGZ A;  1JLQ A;  1TL3 A;  1HPZ A;  4DFM A;  1BGX T;  1Z26 A;  3DRS A;  5I42 A;  3MXI A;  3LPU A;  4B9M A;  4FZX C;  4BWJ A;  3NH0 A;  3L8B A;  1NJW A;  3OYL A;  3SCX A;  1GOA A;  1KTQ A;  3VQ8 A;  4N56 A;  3VQB A;  2I5J A;  3NBP A;  4E7K A;  3KK1 A;  2BGG A;  4CFB A;  1HYS A;  1TKT A;  3TAB A;  4DG1 A;  5KGW A;  3NCI A;  4NCG A;  3SYZ A;  2W42 A;  2BDP A;  4DWI A;  2KQ2 A;  3M8R A;  4B9T A;  5FRN A;  5CZ2 A;  1RBV A;  1VSL A;  4FYD A;  4EZ9 A;  4KAZ A;  5J2P A;  4KHU A;  3L2W A;  4E0D A;  2YKM A;  2QK9 A;  4FJN A;  1IKW A;  1WSE A;  4Y1D A;  5C24 A;  4EP4 A;  4PWD A;  2QXF A;  3CFP A;  3G10 A;  4NCA A;  4W5Q A;  4FJ7 A;  4N5S A;  1W9H A;  5HRO A;  4LSN A;  5E41 A;  3PX4 A;  3PUF A;  4M3Y A;  2HB5 A;  3DLE A;  4TSX A;  3B6O A;  1X1P A;  4C8N A;  3OJU A;  1NJX A;  1VSH A;  1NK5 A;  4CFA A;  4KTW A;  3NF7 A;  4CED A;  4FJ5 A;  2PZS A;  3K5L A;  3NGY A;  2HHS A;  3SV3 A;  3RTV A;  4FK4 A;  2OPR A;  3VQP A;  4Y1C A;  3ZT1 A;  3I8D A;  1C0M A;  4DTN A;  3VQ6 A;  4DQP A;  3L3U A;  2RF2 A;  3K58 A;  1WSG A;  1BL3 A;  5JS2 A;  5J2N A;  3HJF A;  3SUO A;  4FJI A;  1KFD A;  1JLC A;  4JS4 A;  1Q9X A;  1B9D A;  1BQM A;  2HNY A;  4O0I A;  3SNN A;  1NJZ A;  5HRN A;  4C8O A;  4DQI A;  4BDY A;  3HK2 A;  4OKJ A;  1U04 A;  4FJX A;  4E1M A;  3OYM A;  1EKE A;  4DMN A;  4DLE A;  2E6L A;  3TAF A;  1HNV A;  3IAY A;  3LPT A;  4DTP A;  2DFH A;  2JLE A;  3DRP A;  4DLG A;  3HM9 A;  3V6D A;  3VA0 A;  1NK7 A;  1VSM A;  5CZ1 A;  5HBM A;  4CGJ A;  3QER A;  2XY6 A;  2KFZ A;  3TR8 A;  3ISN C;  1IO2 A;  1XI1 A;  4OKE A;  5HRS A;  1ZBI A;  4I2Q A;  5SWM A;  3VQA A;  1NKB A;  3UIQ A;  1VSK A;  3OYB A;  4DTS A;  1ZBH A;  4CJ5 A;  1BCM A;  3ZCM A;  3VQ9 A;  3AVF A;  2YNF A;  1UOC A;  2Z1J A;  3HP9 A;  4LY7 A;  4HHT A;  4C8L A;  1Q8I A;  1VSJ A;  2A1S A;  1O1W A;  1ZBU A;  3SI6 A;  1HMV A;  4CF8 A;  3I0R A;  3HP6 A;  4UQG A;  5T7B A;  4OJR A;  3ZT0 A;  1TAU A;  4AIL C;  2O4I A;  1J5O A;  4CFC A;  3AA4 A;  1LWE A;  3LP3 A;  1JLG A;  1C0T A;  2RPI A;  5CY4 A;  4E7J A;  3QEV A;  3CFO A;  1QQC A;  2KTQ A;  4B8C A;  1C0U A;  4FLX A;  4CJS A;  2HNZ A;  1ASU A;  1KCF A;  2ITG A;  2F8T A;  3QEP A;  2FBX A;  4EP5 A;  4Z4H A;  4CHZ A;  1RT4 A;  2NUB A;  4DQS A;  1CLQ A;  1GOC A;  3VQD A;  4DSE A;  4ZHR A;  5FRM A;  1RDA A;  1JL2 A;  4IBN A;  2X78 A;  3OYJ A;  3PX0 A;  1WN7 A;  3LZJ A;  3AO5 A;  1NOZ A;  3SPY A;  2P5G A;  4AHC A;  5D3G A;  3TWH A;  3T19 A;  4CK3 A;  3TAG A;  1TV6 A;  1WLJ A;  3OVN A;  1J54 A;  3P1G A;  4CIG A;  3OYC A;  3P5J A;  3V9S A;  3U3Y A;  3V4I A;  4KI4 A;  4FLY A;  2D5R A;  4FM2 A;  4FM1 A;  2OPS A;  1VRU A;  5K14 A;  3SJJ A;  3SV4 A;  1ZYQ A;  4KHY A;  1DTT A;  4BE1 A;  4L8R B;  1YT3 A;  4CFD A;  4CE9 A;  1EXQ A;  1IG9 A;  1IH7 A;  2O4G A;  3LP0 A;  5HLF A;  1T03 A;  3HO1 A;  1W0H A;  3QIO A;  2EX3 A;  4ID1 A;  5I3U A;  3KK3 A;  3V81 A;  5KRT A;  3PO4 A;  1RT2 A;  3LP1 A;  3DM2 A;  1FKO A;  5SZT A;  1U48 A;  4C8K A;  2Y1I A;  1NJY A;  1L3U A;  4CEB A;  5C25 A;  4CK1 A;  3L2U A;  3DI6 A;  4HUG A;  3SQ4 A;  2PYJ A;  3AO4 A;  3MEC A;  4WE1 A;  3NH2 A;  3OS2 A;  4J2B A;  1WNS A;  4FK0 A;  1WSI A;  1C1B A;  1RT6 A;  4RG8 A;  3K5M A;  3ZSO A;  3NE6 A;  2LSN A;  4B9N A;  1KLM A;  1NKE A;  3SQ2 A;  5C42 A;  3QNO A;  4CEE A;  4AH9 A;  3V1Q A;  1NK4 A;  4ELU A;  2G8U A;  3RMC A;  4IG3 A;  4CEQ A;  4ELT A;  1VK0 A;  3P83 D;  3S9H A;  4RW4 A;  4N41 A;  2AJQ A;  1C1A A;  4Z0U A;  3KD1 E;  2RN2 A;  4NYF A;  3QNN A;  2IS3 A;  4CJV A;  2X74 A;  4KHW A;  1RCH A;  1RT5 A;  2HND A;  3OYI A;  4FW1 A;  2OPP A;  4ICL A;  4FLZ A;  1SL0 A;  4KRE A;  3AO3 A;  1VSD A;  2B6A A;  3DYA A;  4KO0 A;  4W5R A;  3QES A;  4CHN A;  2PYL A;  1SV5 A;  1ASV A;  4FW2 A;  3ZSW A;  3I0S A;  3DLB A;  4C8M A;  3NF8 A;  2DY4 A;  3ZSZ A;  4QOZ B;  3QIN A;  1A5X A;  4CJE A;  3WNG A;  3AVH A;  3CFR A;  3O4Q A;  1KLN A;  3RRG A;  5CYQ A;  1XC9 A;  3RR8 A;  4OVL A;  1BIS A;  3LP2 A;  3LWM A;  4FLT A;  3LDS A;  4KRF A;  4N47 A;  1L3T A;  4AHR A;  3EZ5 A;  1ITG A;  1QTM A;  4B9L A;  3NDK A;  4FJ9 A;  1JLF A;  3IG1 A;  1U45 A;  1HQU A;  4HVJ A;  1HQE A;  3ZT2 A;  3OYA A;  2HW3 A;  1S9G A;  2DFF A;  1NK0 A;  2ATQ A;  2JGU A;  3S3O A;  3L2V A;  3HVR A;  3PO5 A;  1S1T A;  1JLB A;  3AVN A;  3QEX A;  2G8I A;  3TAQ A;  3AA2 A;  3THV A;  2XO7 A;  1BIU A;  1QHT A;  4LSL A;  3RMD A;  4Z4F A;  1RIL A;  3AO1 A;  4AHT A;  4F8R A;  1RDD A;  3AVJ A;  4FM0 A;  3KKR A;  1J9A A;  1TK5 A;  4KKO A;  4F4K A;  3AVC A;  1YVU A;  1LWF A;  2FC0 A;  3KD5 E;  4O4G A;  1U4B A;  1I3A A;  4DQQ A;  2QKK A;  3HL8 A;  4OGE A;  5KTQ A;  2BAN A;  3CM5 A;  2VWK A;  4RW9 A;  3JSM A;  5HP1 A;  4R5P A;  1RTH A;  3QIP A;  4IFY A;  1YTU A;  4OGC A;  5DMR A;  3VQ7 A;  1S6P A;  4QAG A;  2IGI A;  3ZT3 A;  3QET A;  5J2M A; 
#chains in the Genus database with same CATH topology
 4LH5 A;  2O8B A;  4JS5 A;  2Z1H A;  1DGK N;  4KI6 A;  4H0T B;  3TI0 A;  1HR0 K;  4KB1 A;  5E26 A;  4NYN A;  4YOT A;  3QLH A;  2NRV A;  4KHN A;  2GV9 A;  2YHA A;  2YCH A;  3MAQ A;  4PQU A;  3D2F A;  3T1H K;  4DF8 A;  3D2E A;  5ADX A;  3KLG A;  2G8H A;  1TAQ A;  1LAW A;  4IDK A;  4K41 A;  3K5O A;  4H0V B;  4C23 A;  4OLA A;  4H5W A;  4B9U A;  4FCY A;  3MK6 A;  4O44 A;  3I33 A;  3K5N A;  1XHZ A;  3M1F A;  3LDL A;  2P9S A;  3RWU A;  4DFK A;  3CME N;  3U9D A;  4CZF A;  4MDB A;  4CEA A;  4WQ5 A;  3VF4 A;  2VGM A;  3C94 A;  3O80 A;  1HRH A;  4CJK A;  1KVA A;  3C0B A;  2HBJ A;  3R9P A;  1B9F A;  2ZF5 O;  3WNH A;  4Z94 A;  5DM7 L;  4FLV A;  1HJO A;  3CPE A;  1HYZ A;  2GUP A;  3IRX A;  4BRG A;  3RMB A;  4DTR A;  2P51 A;  4QS9 A;  5KRS A;  3ASM A;  1S3X A;  1HNX K;  2XRI A;  3V9U A;  3SBT A;  4JNE A;  3SPZ A;  3MDQ A;  1BI4 B;  3NAE A;  2Q2R A;  4CJF A;  1S22 A;  4BRO A;  1NM1 A;  2VCP A;  3F73 A;  1Q9Y A;  3U6F A;  3QEI A;  3VQ5 A;  4QS8 A;  4OKK A;  3FZL A;  4FLU A;  3VN5 A;  5AQI A;  4CZK A;  2D4W A;  3ALY A;  4O0J A;  4C1N K;  1UAX A;  1L3V A;  1QS4 A;  3SBG A;  3SZ2 A;  1Y97 A;  3FGU A;  4DU3 A;  2UXC K;  2ZD1 A;  5AQO A;  3ZSV A;  5AQG A;  4Z4G A;  4XH4 A;  1BCO A;  4ID5 A;  3VA3 A;  3TAR A;  1NK9 A;  2G8F A;  4JD2 A;  4PKI A;  3P4I A;  3DLR A;  5CHI A;  1NKC A;  4YOX A;  1WAJ A;  4I9L A;  3KLF A;  1P8Z A;  4CF9 A;  2VQF K;  3V9Z A;  2KFN A;  1QVG M;  4A62 A;  4H4O A;  5A2Q O;  3HPH A;  3AVB A;  3KLI A;  4B3M K;  1SKW A;  1FKP A;  5C2D A;  3VQ4 A;  3OYH A;  1ILY A;  1RTI A;  4XH1 A;  4HCC A;  2O8E A;  4FOE A;  4KTZ A;  3EE8 A;  4GW6 A;  4LD0 A;  3KK2 A;  4CK2 A;  5I9E B;  4B9Q A;  1XHX A;  3ENB A;  1TL1 A;  4FZZ A;  5GIP A;  2OPQ A;  2VG6 A;  1HNZ K;  2UXB K;  1KC8 O;  4KBO A;  1RT7 A;  4CJ7 A;  4E3S A;  4JKG B;  4ZTJ A;  1RTD A;  3S3M A;  1U6Z A;  3AVI A;  1VQM N;  1A5V A;  1I39 A;  3DRR A;  5AFU H;  4E1N A;  5KQ8 A;  1UA1 A;  4Z4I A;  1LWC A;  4BRP A;  1LCU A;  2WON A;  2OZM A;  1X9J A;  3M8Q A;  4FPA A;  3OYF A;  4AHV A;  3RMA A;  4YY3 K;  2W41 A;  2YI1 A;  1Z25 A;  1MU2 A;  1QSY A;  4YDU C;  1CXQ A;  2FSJ A;  3MWT A;  4JRP A;  4KPY A;  3A0I X;  2F8S A;  4IFV A;  2D0C A;  4JI1 K;  1QHA A;  2YJF A;  4CJL A;  5AQF A;  2KW4 A;  1L5U A;  1NLV A;  2GWJ A;  1SKS A;  5FPN A;  4DSJ A;  2P9U A;  1BHL A;  4F9O A;  4CCH A;  4IZ9 A;  4B3O A;  3L3V A;  4R79 A;  4M63 C;  4BDZ A;  4F3O A;  4H0Y B;  3IDH A;  4FXD A;  4CHQ A;  3ZSX A;  4XIU A;  2YNI A;  1VQP N;  4OPJ A;  3LDQ A;  1IKY A;  1XNR K;  2ETJ A;  3DLK A;  1HYV A;  5FPE A;  4DHY A;  3VQC A;  4DFJ A;  4CES A;  1N33 K;  2P5O A;  1VQL N;  4IDH A;  3GBT A;  3K0S A;  3KJV A;  3DOK A;  4CER A;  4CGF A;  1QZ5 A;  3T69 A;  1TL3 A;  4DFM A;  5AZJ A;  1BGX T;  4LFB K;  3L8B A;  2PBD A;  3VQ8 A;  3NBP A;  4JI5 K;  2NZT A;  3L6Q A;  3M5R A;  4DR6 K;  4DG1 A;  1C0F A;  3KWG A;  3EKU A;  3L4I A;  2E5L K;  3JAM O;  3WEE B;  4EZ9 A;  4IOA L;  4KHU A;  2QK9 A;  3IFR A;  1WSE A;  4Y1D A;  1VQ4 N;  5C24 A;  1QQO A;  1S72 N;  4B1Z A;  4FJ7 A;  4JI7 K;  1W9H A;  5HRO A;  4LSN A;  4M3Y A;  4TSX A;  5BR9 A;  1I94 K;  4YHH K;  4CFA A;  4CED A;  4G9Z A;  3RTV A;  2OPR A;  4H5T A;  2O8C B;  1C0M A;  3HJF A;  3L3U A;  4ILJ A;  5J2N A;  4JS4 A;  4O0I A;  3SNN A;  4C8O A;  4BDY A;  4EFH A;  4DQ8 A;  1MA9 B;  1NGG A;  4E1M A;  3OYM A;  1YIT N;  4B1U B;  5DM6 L;  3DRP A;  4DLG A;  3QML A;  3HM9 A;  4FWR A;  3V6D A;  2FSK A;  3VA0 A;  1ZBS A;  5HBM A;  4MLE A;  3QER A;  2XY6 A;  1NU0 A;  1Q82 O;  4FL9 A;  1IO2 A;  1XI1 A;  1ZBI A;  3MX5 A;  3J81 O;  4CJ5 A;  1BCM A;  2YNF A;  1UOC A;  3VEO A;  2A1S A;  2ZGZ A;  3TSQ A;  1DT9 A;  3VEX A;  1J5O A;  2NRH A;  1BO5 O;  1DEJ A;  5CY4 A;  4BRQ A;  4GY2 B;  1C0U A;  2F8T A;  2P9P A;  2FBX A;  2GEL A;  4EP5 A;  2NUB A;  3D2F B;  1GOC A;  5IWA K;  3CCQ N;  3D2E B;  4DSE A;  3GOI A;  3VF6 A;  4X64 K;  3LZJ A;  3SPY A;  3M6G A;  5D3G A;  1XNQ K;  4AHC A;  3CD6 N;  3T19 A;  1SS6 A;  3DXK A;  1WLJ A;  3OVN A;  4CIG A;  5AQM A;  3OYC A;  3V4I A;  2UYT A;  2D5R A;  3UKU A;  2E2N A;  4A59 A;  2P9K B;  1DTT A;  5EVZ A;  2E2Q A;  2F9W A;  4FWL A;  1NGA A;  2O4G A;  3LP0 A;  1YJN N;  3RSE A;  4X62 K;  5KRT A;  3PO4 A;  3P31 A;  5HOO A;  1L3U A;  4CEB A;  4CK1 A;  4HUG A;  3SQ4 A;  3NH2 A;  4FK0 A;  1WSI A;  1ZC6 A;  4RG8 A;  5FPM A;  5KQD A;  3SQ2 A;  2QEX N;  4AH9 A;  4A2B A;  1VQK N;  4ELU A;  4IG3 A;  5TKY A;  3CC2 N;  2AJQ A;  1VQ5 N;  4Z0U A;  3GE1 A;  4JKD A;  2HND A;  3OYI A;  2OPP A;  4JI4 K;  3QDK A;  4FLZ A;  1T3V A;  4KRE A;  3AO3 A;  2B6A A;  4KO0 A;  4M7Y A;  3I55 N;  3QES A;  3ZLJ A;  3MN7 A;  5KPT A;  3I0S A;  3O1W A;  1E4G T;  4IEE A;  3AGK A;  3QIN A;  1KLN A;  3MN5 A;  1X3N A;  3N4P A;  5CYQ A;  4LF5 K;  4OVL A;  3LP2 A;  3LWM A;  4FLT A;  4KRF A;  4WFN L;  3NDK A;  4H5R A;  3IG1 A;  2EWS A;  3CHW A;  4CD1 A;  3WQU A;  2ATQ A;  1K9M O;  3L2V A;  1NGF A;  3HVR A;  3A5O C;  1OVY A;  1S1T A;  4JKE A;  1YJW N;  1N8R O;  3THV A;  2OTL N;  1N32 K;  4Z4F A;  1RIL A;  4DV7 K;  3EL2 A;  2ZGY A;  2FC0 A;  3H1Q A;  4IWV A;  1I3A A;  5KTQ A;  1T44 A;  2BAN A;  3CM5 A;  1RTH A;  2HMP A;  4IFY A;  4QAG A;  2ZJQ L;  1S1X A;  2G8W A;  4KTQ A;  5JVH L;  1P90 A;  3PY8 A;  2YV0 X;  2YNG A;  3S41 A;  5GIO A;  4BRH A;  2HHQ A;  4FZY A;  2KHO A;  3HST B;  4GVE A;  3CJ7 A;  1NGD A;  4IOX A;  1XMQ K;  3SAH A;  3OW2 M;  4NLB A;  4AM6 A;  4J8F A;  4HTU A;  1FK9 A;  2O8F A;  3HM8 A;  2W6L A;  3DLG A;  3V9W A;  1KRP A;  3MX2 A;  2A41 A;  3JYT A;  1S5J A;  5TKW A;  4CJ4 A;  4B9S A;  3CQ8 A;  1OKJ A;  3TSU A;  5AQW A;  4IOC L;  2G8V A;  3VEW A;  3ZSR A;  1RBR A;  3CF5 L;  1S1W A;  2QWM A;  3P38 A;  2VG7 A;  3ATV A;  2VWJ A;  5AQH A;  2HHT A;  3WNE A;  2V7Y A;  5KPR A;  1TK8 A;  1GLF O;  2O8D B;  3OYG A;  2HVH A;  4EZ6 A;  1L3S A;  4E19 A;  3O1B A;  3LM2 A;  3VOV A;  3J7Y P;  4M7X A;  1KFS A;  5M1N A;  1TUU A;  1RDC A;  4CJQ A;  1U2V A;  4BRC A;  2X6N A;  4HWI A;  1WSJ A;  2OA8 A;  3CCR N;  4CZI A;  1BU6 O;  2CH6 A;  2B5J A;  3OYE A;  5AQT A;  1JXB A;  1S1U A;  3AO2 A;  3SQ0 A;  5EU7 A;  2FBV A;  3OHR A;  4CF1 A;  4M3U A;  2ZE2 A;  4L3Q A;  1RDU A;  3QBX A;  4W5O A;  4DS4 A;  1TKD A;  3U9Z A;  3EYZ A;  3HYF A;  4B1X B;  1CZ9 A;  4FLW A;  4B3R K;  4GKJ K;  3DWL A;  1YXQ A;  3T1A A;  2P9L A;  3ZT4 A;  4CHP A;  3AVG A;  2BH1 A;  1DTQ A;  4M3R A;  5LJV A;  4WF9 L;  5BRD A;  1U47 A;  5AR0 A;  1Q86 O;  5ELZ A;  3KLH A;  1KD1 O;  1HLU A;  2HHU A;  4MFB A;  2XY5 A;  2RKI A;  3QO9 A;  3SUQ A;  3M8P A;  1GLE G;  4CJ3 A;  2WC9 A;  2KKZ A;  1X9M A;  3ID8 A;  3FFI A;  4CGI A;  2XHB A;  2YJE A;  3VEN A;  1BG3 A;  3TAE A;  3C7N A;  4BQL A;  1K73 O;  5AZJ B;  1C6V A;  1NGC A;  4YOW A;  3HT3 A;  1JXE A;  3CJC A;  5FDL A;  5J2Q A;  4CGG A;  1BIZ A;  3AAP A;  3E01 A;  5AQJ A;  5EOY A;  4BDP A;  1OH7 A;  1D9D A;  4JK8 A;  2IVO A;  2YHW A;  3U4L A;  3UB5 A;  3CC7 N;  3BZK A;  4DV1 K;  4M3W A;  3MCP A;  1B92 A;  3HOS A;  3CCV N;  4BR5 A;  1CXU A;  4H4M A;  1WBD A;  3PX6 A;  1S6Q A;  4FVM A;  2GUI A;  3NFA A;  1SL1 A;  2HBM A;  3DMJ A;  1TYQ B;  4ILG B;  3ITH A;  3MN6 A;  1D8Y A;  5DK5 A;  1JCF A;  3VQQ A;  3VQE A;  3I56 N;  1T7P A;  3THW A;  4J2A A;  1RFQ A;  4DU1 A;  4FJM A;  4CJT A;  3ZET A;  2IC3 A;  3VTI A;  2Z1G A;  3LM9 A;  3VER A;  4RW8 A;  1RT3 A;  2DFE A;  4FJL A;  4F2S A;  3HRG A;  1GLL O;  3WNF A;  1EP4 A;  4DU4 A;  4LC9 B;  3VEZ A;  4CGH A;  4E7L A;  4MDA A;  5BPM A;  3AAQ A;  5AQN A;  2NRR A;  4CGD A;  2D1K A;  2XY7 A;  4DFP A;  1RBU A;  2Z1I A;  1Q7Y O;  3QEW A;  4FWK A;  4DTM A;  4KV8 A;  2P9N B;  3NGI A;  3KIO A;  1HX1 A;  1SAZ A;  3A5N C;  3VF2 A;  4BG8 A;  4JI2 K;  4JLH A;  2HHX A;  1REV A;  2I7N A;  4F2R A;  3KLE A;  3G0Z A;  2P9P B;  3G71 N;  1Q81 O;  1HUX A;  2Q3S A;  4LF8 K;  3RVC A;  3EEQ A;  4QS7 A;  1EWR A;  2IAJ A;  3B6P A;  1K8K B;  2YX6 A;  3DXK B;  3THX B;  1IKX A;  4JHD B;  4RCH A;  3OYK A;  4DV4 K;  4BVP A;  1KXP A;  2WOM A;  4EHU A;  4FK2 A;  3D7E O;  4M41 A;  2ASP A;  4CIF A;  3O3F A;  1HPZ A;  3RSE B;  3K9K A;  1Z26 A;  1XQS C;  5I42 A;  3MXI A;  1QVF M;  3LPU A;  5F2R A;  3SCX A;  3OTO K;  2I5J A;  2NRX A;  2P9I A;  1OH5 A;  5C10 A;  1TKT A;  4FOI A;  3SYZ A;  5KGW A;  4E0D A;  4NCG A;  5FRN A;  4DWI A;  3SMP A;  5CZ2 A;  1RBV A;  1V4T A;  4KAZ A;  4BC2 A;  2YKM A;  1FW6 A;  4N5S A;  3DXM B;  3PX4 A;  2HB5 A;  3DLE A;  3B6O A;  3NGY A;  2CGJ A;  2ITM A;  3CCL N;  3I8D A;  4JKA A;  4DTN A;  4IJN A;  2F7T A;  5JS2 A;  4FJI A;  1KFD A;  1NJZ A;  4DQI A;  3MCA B;  3AGR A;  3L4Q A;  1EKE A;  4DMN A;  4IO9 L;  2E6L A;  3TAF A;  1TUY A;  3IAY A;  1VQ7 N;  4DTP A;  4FWS A;  2AP1 A;  5LL6 Z;  4DUY K;  3THY A;  4UY8 O;  4YOV A;  5BR8 K;  3ISN C;  2KFZ A;  1NWK A;  5HRS A;  4JI0 K;  1Z6R A;  3IKM A;  3ZYY X;  3OYB A;  2Q0U A;  3ZCM A;  3VQ9 A;  4HHT A;  1VSJ A;  1O1W A;  2Q1N A;  4UQG A;  1TAU A;  1OH6 A;  4YOU A;  1HNW K;  3LP3 A;  3QFU A;  1JLG A;  2RPI A;  4E7J A;  3QEV A;  2KTQ A;  4K25 A;  5LY3 A;  3E9O A;  2D0P A;  5FLX O;  2O8F B;  4Z4H A;  5BPL A;  5AQX A;  3TU5 A;  4I6M B;  4JKB A;  1JL2 A;  2X78 A;  3OYJ A;  2P5G A;  3TWH A;  3TAG A;  3V9S A;  3P5J A;  4FM1 A;  4KHY A;  3H3O B;  3CJB A;  2IIR A;  4BC5 A;  1YT3 A;  4CFD A;  1EXQ A;  2UUA K;  3FZM A;  1W0H A;  3QIO A;  4DR4 K;  3HSC A;  1RT2 A;  1CZA N;  1FKO A;  4C8K A;  2Y1I A;  2Q97 A;  3T1Y K;  3E9L A;  3DI6 A;  3SMS A;  3AO4 A;  4WE1 A;  5AQP A;  3OS2 A;  1IBK K;  1C1B A;  3ZSO A;  2LSN A;  4JAX A;  1KLM A;  1NKE A;  3QNO A;  1NK4 A;  4CZM A;  2G8U A;  3A5M C;  4ELT A;  1VK0 A;  3P83 D;  5IT9 O;  5HL7 L;  4WYB A;  1C1A A;  3QNN A;  4IO8 A;  2X74 A;  4CZJ A;  4BR9 A;  1VSD A;  4FW2 A;  1ASV A;  2A42 A;  1IBL K;  3DLB A;  3ZSZ A;  1RGI A;  3WNG A;  3AVH A;  3CFR A;  5LJW A;  4GKK K;  1BIS A;  2HHH K;  5GAH P;  3T7Z A;  1NGH A;  1L3T A;  2CGK A;  1NGI A;  2WBN A;  4H5N A;  1U45 A;  1HQU A;  4ILH A;  1K8A O;  3CMA N;  1S9G A;  2DFF A;  1NK0 A;  2JGU A;  3S3O A;  4H03 B;  1IG8 A;  3PO5 A;  4JEP A;  5BN9 A;  3TAQ A;  5JLH A;  1BIU A;  1QHT A;  4B1V A;  5CE3 A;  4F8R A;  1J9A A;  4F4K A;  1YJ9 N;  3AVC A;  4O4G A;  3HL8 A;  4OGE A;  2VWK A;  3JSM A;  1BOT O;  4K43 A;  3QIP A;  5AQV A;  5DMR A;  3O9U A;  1S6P A;  2QWN A;  5AFU A;  2QW9 A;  1S9E A;  1QSS A;  1BUP A;  4IFE A;  4GMJ B;  3ATU A;  1VRT A;  2PY5 A;  1SKR A;  1T8E A;  4AF1 A;  1T6D A;  1RBS A;  2QKB A;  2HVI A;  4EIA A;  3UKR B;  2YKN A;  1YAG A;  2BE2 A;  4AHS A;  3BGR A;  3DLL L;  2O8B B;  4KH6 A;  4OPK A;  3ZEU A;  4BRK A;  1MWK A;  2FSN A;  4OPA A;  3OS1 A;  4PUO A;  1BDG A;  1X9W A;  4CF0 A;  1FJG K;  3WQT A;  4CEO A;  4B8A B;  4B3S K;  2KLA A;  4O55 A;  1IV0 A;  3BUZ B;  3TAN A;  3AA3 A;  3WUH A;  2E6M A;  4H8K A;  3KTQ A;  3VEV A;  3SUP A;  3U3G A;  3O5B A;  4KFB A;  2QI2 A;  3D0P A;  3GDQ A;  4NB4 A;  1WBB A;  3PSI A;  1SZ2 A;  4GV3 A;  2EHG A;  1X9S A;  3MWP A;  4GV6 A;  2HMI A;  3VET A;  3CYM A;  4PA1 A;  4I2P A;  1EO1 A;  2WFB A;  3AVK A;  3WXI A;  3EE9 A;  2HHV A;  4BWM A;  4PL8 A;  4YOY A;  2D0A A;  2VG5 A;  4BE2 A;  3CCJ N;  2P9S B;  3C65 A;  1G15 A;  3I8B A;  1EET A;  3H08 A;  4J2D A;  3RR7 A;  3SJH A;  3CM6 A;  3R1X A;  1RNH A;  1LW0 A;  4CEC A;  1HNI A;  4QCL A;  4CW7 B;  1RDB A;  2A5X A;  2BUP A;  1SL2 A;  1VSE A;  2XY8 A;  3DJC A;  3O4W A;  1IKV A;  5LMU K;  4E7H A;  4HUE A;  4HCB A;  1N5Y A;  3HXM A;  5E84 A;  1ATN A;  3ULD A;  2IVN A;  4E7I A;  3V9X A;  4DS5 A;  1T05 A;  3J7Z O;  3EKS A;  4DCH A;  4OPH A;  1UWB A;  5GIN A;  3BEX A;  4ELV A;  1MDU B;  3D6R A;  1GLA G;  4CZH A;  4CI6 A;  2CH5 A;  1JLE A;  3OYD A;  3KHY A;  4BRI A;  2GWK A;  4CEF A;  1GOB A;  4M3Z A;  3AV9 A;  1NNE A;  2HHW A;  1M90 O;  1TKZ A;  3E66 A;  4RW6 A;  5FPD A;  4GV9 A;  4DR1 K;  2QWQ A;  3DOL A;  5AZI A;  1K6Y A;  1YIJ N;  3V1R A;  3O8M A;  1WAF A;  2X6S A;  3VMF B;  1NK6 A;  2FBT A;  1QQM A;  4FWM A;  3L2R A;  1VQO N;  1OH8 A;  3KKS A;  2G8K A;  5KPZ A;  3IS9 A;  5FRO A;  2OTJ N;  1T6C A;  1ASW A;  3FR0 A;  4KB0 A;  2B4J A;  4NCB A;  2OYQ A;  3VEY A;  1NGB A;  4JKG A;  1N36 K;  1JKH A;  4JD2 B;  4DSF A;  3NH1 A;  2Q36 A;  1NOY A;  4EAH D;  3KK7 A;  4DSK A;  3F9K A;  1TKX A;  3HPG A;  3IMX A;  2D0B A;  1WOQ A;  1WSF A;  3J7A P;  1HJR A;  4W5N A;  5C2F A;  1YTA A;  4M3X A;  3G6E N;  3R3L A;  5F0X A;  3DLH A;  3ENO A;  4BGA A;  4BRN A;  4ISE A;  3ZSQ A;  4FSV A;  3BDP A;  3WXL A;  4FVU A;  3HBT A;  2O8E B;  3O9R A;  1TGO A;  3SK3 A;  1BA0 A;  2ASM A;  3F5T A;  4RWT A;  3TTF A;  2CGL A;  4C1N I;  2Q31 A;  4DF4 A;  1LV5 A;  3C6U A;  3L2Q A;  4O5B A;  1JLA A;  4BRF A;  3MXM A;  1NMD A;  2D0O A;  4JI8 K;  3THY B;  4U7B A;  5ADX H;  4CF2 A;  2QTD A;  1LW2 A;  4K8Z A;  4FJ8 A;  1R0A A;  4BC4 A;  1RBT A;  5AQY A;  4KHQ A;  1R59 O;  3C6A A;  5J1E A;  1NBW A;  1XWL A;  4M45 A;  1KAX A;  3FZK A;  3S3N A;  4FJH A;  2KZM A;  2NRW A;  3J8A A;  5AQS A;  1Z05 A;  3PV8 A;  3NMU A;  3K9J A;  3H6E A;  4NXN K;  4JKC A;  4Q0B A;  1LOT B;  3H3N O;  2KZZ A;  5KI6 A;  3D45 A;  3AAR A;  2VWB A;  3ZSY A;  4Z4C A;  4M42 A;  4BR0 A;  2P9U B;  4OLB A;  1XC3 A;  3LAK A;  3MEG A;  1C0G A;  3CJ1 A;  3BZC A;  2NRT A;  4LH4 A;  4O8K A;  4AM7 A;  1GLB G;  3Q7C A;  4DV3 K;  5GAE P;  5M1P A;  4FZX C;  4BWJ A;  1IBM K;  4PHT X;  4N56 A;  4E7K A;  2QWP A;  3KK1 A;  4CFB A;  1HYS A;  3R8E A;  3CC4 N;  2KQ2 A;  3M8R A;  4B9T A;  4FYD A;  1M1K O;  5BN8 A;  5J2P A;  1VAZ A;  1E3M A;  3L2W A;  4FJN A;  2O8C A;  1IKW A;  2QXL A;  3F2K A;  4EP4 A;  4PWD A;  2QXF A;  3CCM N;  2AA4 A;  3DAW A;  4DR5 K;  1GLD G;  4BC3 A;  5E41 A;  3OJU A;  3LDP A;  1VSH A;  2YHY A;  1NK5 A;  2GX9 A;  4KTW A;  3OBW A;  1KAY A;  2PZS A;  3K5L A;  3A5L C;  3IUC A;  4FWN A;  4FK4 A;  3VQP A;  4Y1C A;  3ZT1 A;  4JV5 K;  4DQP A;  2RF2 A;  1WSG A;  1BL3 A;  4BRE A;  3SUO A;  1JLC A;  3TTD A;  4MO5 A;  3HK2 A;  4RTF D;  1N34 K;  4OKJ A;  4CD3 A;  3FLC O;  4BRA A;  4FJX A;  4PKH A;  1HNV A;  3LPT A;  4CBX A;  4X65 K;  1W7A A;  4JKH A;  1QQN A;  1YF5 L;  1VSM A;  5CZ1 A;  3CJ9 A;  3TR8 A;  2E1Z A;  3CQY A;  4OKE A;  3WXM B;  1G99 A;  1NKB A;  3UIQ A;  4WQ4 A;  4C8L A;  3HP9 A;  4LY7 A;  3JXU A;  1Q8I A;  2QA4 N;  3SI6 A;  3QFP A;  3HP6 A;  3ZT0 A;  4AIL C;  2O4I A;  3QBW A;  3PIP L;  3QB0 A;  1C0T A;  1GLC G;  5C15 A;  3CFO A;  1QQC A;  4B8C A;  4FLX A;  2P9K A;  4CJS A;  3CQX A;  1ASU A;  2ITG A;  2UUB K;  4CHZ A;  1ATS A;  1RT4 A;  4CBU A;  1CLQ A;  5JIC A;  2YHX A;  3VQD A;  4BRL A;  4ZHR A;  1RDA A;  4IBN A;  3ZEU B;  4BR4 A;  1WN7 A;  3O9Q A;  4CK3 A;  3B8A X;  4HTL A;  1TV6 A;  3P1G A;  3U3Y A;  4FLY A;  4FM2 A;  3L0Q A;  5K14 A;  1ZYQ A;  4CZL A;  3CCE N;  2HOE A;  3N4Q A;  2F4V K;  3HO1 A;  2GTD A;  5I3U A;  3KK3 A;  3LP1 A;  4JK7 A;  3DM2 A;  3CCS N;  1NJY A;  4I9Q A;  5C25 A;  3L2U A;  2PYJ A;  3MEC A;  3CI5 A;  1WNS A;  3UKU B;  3NE6 A;  5BRE A;  5C42 A;  2E2O A;  3WT0 A;  3MMV A;  4OX9 K;  2Q0R A;  4WCE L;  3RMC A;  3S9H A;  4RW4 A;  4N41 A;  2UXD K;  2RN2 A;  4NYF A;  4KHW A;  1RCH A;  1RT5 A;  2OAN A;  4FW1 A;  1SL0 A;  3DYA A;  4CHN A;  5JVG L;  3ZSW A;  3ULE A;  4C8M A;  3NF8 A;  1ESV A;  3SLC A;  4DB3 A;  2DY4 A;  1Q18 A;  4LF9 K;  4QOZ B;  4LFA K;  3R6M A;  3O4Q A;  1W2B M;  3BF3 A;  1XC9 A;  3LDS A;  3CIP A;  1QTM A;  3EZ5 A;  4B9L A;  4MO4 A;  4BR7 A;  5M1O A;  4DV5 K;  1JLB A;  4H5V A;  3QEX A;  3AA2 A;  3PSF A;  3KVG A;  3U8X A;  2XO7 A;  4LSL A;  3RMD A;  2F9T A;  3AO1 A;  4AHT A;  1RDD A;  4FM0 A;  1LWF A;  1U4B A;  2V51 B;  5B8H A;  4DQQ A;  2QKK A;  4RW9 A;  5HP1 A;  4R5P A;  2V52 B;  1YTU A;  3UE5 A;  4JI3 K;  2IVP A;  4XEI A;  3ZT3 A;  3QET A;  1OVQ A;  3BY5 A;  5AZI B;  3W3D A;  2E88 A;  2Y1J A;  3HPO A;  1RT1 A;  2ZM6 K;  4MQ3 A;  4DV6 K;  2RE2 A;  4DTU A;  5AQK A;  4YOR A;  4FPB A;  2A1R A;  4CHY A;  2WUS A;  4YFU A;  2F96 A;  2OZS A;  4LFC K;  3A2F A;  2PFU A;  5H1S Q;  3O3G A;  4CJR A;  3V1O A;  2FBY A;  4PY5 A;  4PL7 A;  3AVM A;  1BQN A;  2O8D A;  1HKB A;  1VSI A;  3SQ1 A;  1ZBL A;  3HI0 A;  4FWO A;  5JS1 A;  4M3T A;  1ATR A;  1ZBF A;  2HST A;  3RRH A;  4IXC A;  1YVN A;  1ZXO A;  3OY9 A;  4CJP A;  4JYA K;  1F21 A;  3EZW A;  3O9T A;  4G1Q A;  4DKW A;  2UU9 K;  1DKG D;  3O6W A;  1SQK A;  1U49 A;  4XH5 A;  4DV2 K;  2R7Y A;  3QIC A;  4JRQ A;  4E1J A;  3A8Y A;  5KGX A;  3CG7 A;  2HBK A;  5HRP A;  4J2E A;  4BE0 A;  1WSH A;  3TAM A;  4CBW A;  4LF7 K;  2ZWH A;  1U2V B;  2VGN A;  4DR3 K;  2GBZ A;  1JCG A;  3H45 C;  3M3Z A;  1SUQ A;  3CCU N;  4W5T A;  3K2P A;  5C12 A;  3MED A;  3O08 A;  3AVA A;  3EY1 A;  3O4N A;  4YNQ A;  4DR2 K;  4DTO A;  5CYM A;  3M8S A;  1QSL A;  1E4F T;  3JS6 A;  2RHK A;  2QWO A;  4CZG A;  1WUA A;  2DTU A;  4ZTF A;  3SAG A;  3HVT A;  4CIE A;  1VQ6 N;  2IOC A;  1VSF A;  3O3H A;  4DTJ A;  4MLH A;  1KVB A;  5M1K A;  3TAP A;  4KHS A;  3MXJ A;  2P9L B;  1S1V A;  4F3T A;  3HOT A;  4B1Y B;  5MLC Q;  1XMO K;  2ZQB A;  2IDO A;  2QWR A;  3C95 A;  4CZE A;  5EX5 A;  3LAM A;  3SUN A;  3CJA A;  3LWL A;  3VTH A;  5GAG P;  4DTX A;  4A57 A;  4JK9 A;  3LL3 A;  4FJG A;  1KAZ A;  3EN9 A;  4Z4E A;  3ZX0 A;  1VHX A;  4Q5V A;  4CEZ A;  4I7F A;  2YHB A;  3FZH A;  3VGK A;  4CJW A;  4A61 A;  1TYQ A;  4RW7 A;  1KSP A;  4B08 A;  3FZF A;  4X66 K;  3AA5 X;  1MWM A;  4E89 A;  3C7N B;  4K8X A;  4H0P A;  2V7Z A;  1YI2 N;  1C1C A;  1BWF O;  5EY4 A;  1EX4 A;  3OBY A;  1TVR A;  1JCE A;  1HKC A;  2NNW A;  4FJK A;  2YNH A;  3ZX2 A;  1FXX A;  1J53 A;  1BA1 A;  4FJJ A;  3WXK A;  5AQL A;  4IG0 A;  1DLO A;  1CZB A;  4B9V A;  4CHO A;  3MEE A;  4K0K K;  2P1J A;  1N6Q A;  4HUF A;  2FXU A;  3OS0 A;  2WTU A;  5BRF A;  4IKF A;  2DPN A;  3TSP A;  3P39 A;  2P9N A;  5HRR A;  2A40 A;  3LZI A;  1IJJ A;  3CXC M;  4Y0W A;  3CPW M;  3THW B;  3NF6 A;  1UA0 A;  1QE1 A;  1KQS M;  4BAC A;  4JN4 A;  4V19 S;  3ZET B;  1D5A A;  5BRH A;  3LAL A;  2E4L A;  4BRD A;  4DQR A;  1H1V A;  3K59 A;  1KVC A;  3NF9 A;  4CJU A;  1RTJ A;  1NK8 A;  4GVM A;  4ISG A;  3T3F A;  2OCE A;  2E2P A;  2NRZ A;  3C6T A;  2W40 A;  1LAV A;  1K8K A;  5AJ3 K;  3LAN A;  1A5W A;  4A5A A;  1BI4 A;  3ID6 A;  3THX A;  3CER A;  3OJS A;  4JHD A;  4AHU A;  3AVL A;  4N76 A;  1Y64 A;  5JLF A;  3OA9 A;  1VQN N;  2QM1 A;  2W6K A;  1TK0 A;  1JL1 A;  3K57 A;  3Q7B A;  3BF1 A;  3KZB A;  4DSI A;  2VYP A;  4KH4 A;  4NXM K;  3NVM A;  3NHG A;  4B1W B;  1D9F A;  2A6A A;  3OYN A;  1O13 A;  4WQ4 C;  4DSL A;  3C6H A;  3NGZ A;  4BVO A;  1JLQ A;  2NLX A;  1VQ8 N;  3DRS A;  2A3Z A;  4FWP A;  4B9M A;  3NH0 A;  1NJW A;  3OYL A;  1GOA A;  1KTQ A;  2BGG A;  3VQB A;  3DXM A;  3EO3 A;  3O9S A;  2GEM A;  3TAB A;  4BG9 A;  2BDP A;  3NCI A;  2W42 A;  1VSL A;  4BRM A;  2FLO A;  3AY9 A;  4NO7 A;  4YDU A;  3TPQ A;  3CFP A;  3G10 A;  4NCA A;  2E20 A;  4W5Q A;  4LF6 K;  4O8U A;  3SAF A;  2P9I B;  3ULE B;  4KH5 A;  3PUF A;  1NJI O;  1W97 L;  1X1P A;  4C8N A;  1NJX A;  3NF7 A;  4WQ5 C;  4FJ5 A;  2HHS A;  4WFA L;  3SV3 A;  4K42 A;  4U67 L;  5M1Q A;  2HBL A;  3VQ6 A;  1V4S A;  3K58 A;  5AQQ A;  3HZ6 A;  1Q9X A;  1B9D A;  1BQM A;  2HNY A;  3BP8 A;  5HRN A;  5BPN A;  5AQU A;  1U04 A;  4DV0 K;  2FF3 B;  5GAD P;  2E1Y A;  2ZJR L;  1YHQ N;  4DLE A;  3G4S N;  1EQY A;  1NMN A;  2DFH A;  2H3G X;  2JLE A;  3G25 A;  4NLC A;  1X3M A;  5F1X A;  3VGL A;  1NK7 A;  3MN9 A;  2JWK A;  4CGJ A;  4O5F A;  2HF4 A;  2E8A A;  4I2Q A;  5SWM A;  3VQA A;  4BQZ A;  4OO1 J;  1VSK A;  4DTS A;  4GNI A;  1ZBH A;  3AVF A;  2Z1J A;  4I6M A;  3H46 O;  1ZBU A;  1HMV A;  4CF8 A;  4BY9 C;  3I0R A;  1HKG A;  5T7B A;  4OJR A;  2VQE K;  4CFC A;  3AA4 A;  1LWE A;  2J4R A;  4H0O A;  2HNZ A;  1KCF A;  4PKG A;  3QEP A;  4DQS A;  1RDW X;  2QWL A;  5FRM A;  1YUW A;  4IEI A;  3PX0 A;  3AO5 A;  1NOZ A;  3E9P A;  4A5B A;  3FFK B;  1XUP O;  1J54 A;  4KI4 A;  5LMN K;  4DUZ K;  2OPS A;  1VRU A;  3SJJ A;  3SV4 A;  4BE1 A;  4JI6 K;  4L8R B;  4A2A A;  4CE9 A;  4BR2 A;  1IG9 A;  3PIO L;  1IH7 A;  5HLF A;  1T03 A;  4H0X B;  5AQR A;  3LDN A;  4ID1 A;  5AQZ A;  2EX3 A;  3TTC A;  4FO0 A;  3V81 A;  2FF6 A;  4FWQ A;  5SZT A;  2BTF A;  1U48 A;  3WXJ A;  3VGM A;  4J2B A;  1RT6 A;  3K5M A;  4B9N A;  1VQ9 N;  4CVN E;  3VPZ A;  4CEE A;  3V1Q A;  4WFB L;  1J5E K;  3KWI A;  1NGE A;  3HTV A;  3WEE A;  4CEQ A;  3KD1 E;  3NVK A;  2IS3 A;  4CJV A;  3J80 O;  1J6Z A;  1EWQ A;  4ISF A;  4ICL A;  1JJ2 M;  2UUC K;  4W5R A;  2PYL A;  1SV5 A;  5M1F A;  4IJA A;  5EXW A;  2ZJP L;  4CJE A;  1A5X A;  3PLA A;  1NG9 A;  3RRG A;  3RR8 A;  3F9M A;  3CET A;  5CR4 A;  3ZX3 A;  4N47 A;  2HF3 A;  4AHR A;  1ITG A;  3ENH A;  4FJ9 A;  1JLF A;  2JWL A;  4LF4 K;  3W0L A;  2ASO A;  4HVJ A;  1HQE A;  3ZT2 A;  3GL1 A;  4EHT A;  3OYA A;  2HW3 A;  3LDO A;  3VES A;  4BGB A;  1D4X A;  4JKF A;  3AVN A;  2PAV A;  4B3T K;  2G8I A;  4DR7 K;  1GLJ O;  1QZ6 A;  3AVJ A;  1WB9 A;  3KKR A;  1TK5 A;  4KKO A;  4AQY K;  4KHP K;  1YVU A;  3KD5 E;  3GG4 A;  3E1Y A;  1HPM A;  3H1V X;  2I7P A;  5C0Y A;  3FE1 A;  1NGJ A;  3UKR A;  3VQ7 A;  4OGC A;  5JMV A;  2IGI A;  5J2M A; 
#chains in the Genus database with same CATH homology
 4LH5 A;  1S1X A;  4JS5 A;  2Z1H A;  2G8W A;  4KTQ A;  1S9E A;  2Y1J A;  1QSS A;  3HPO A;  3PY8 A;  1RT1 A;  4GMJ B;  2YV0 X;  4KI6 A;  1VRT A;  2YNG A;  4MQ3 A;  2PY5 A;  1SKR A;  3TI0 A;  4DTU A;  1T8E A;  4KB1 A;  2HHQ A;  1RBS A;  4FZY A;  4NYN A;  2A1R A;  4CHY A;  3HST B;  2QKB A;  4YFU A;  2OZS A;  2F96 A;  2HVI A;  3A2F A;  3QLH A;  4KHN A;  2GV9 A;  3O3G A;  4HTU A;  1FK9 A;  2YHA A;  2YKN A;  2BE2 A;  4AHS A;  3MAQ A;  4PQU A;  4CJR A;  3V1O A;  2FBY A;  3DLG A;  4PY5 A;  3BGR A;  3V9W A;  1KRP A;  4DF8 A;  3JYT A;  1S5J A;  3AVM A;  1BQN A;  4CJ4 A;  4OPK A;  3KLG A;  2G8H A;  4B9S A;  1TAQ A;  3CQ8 A;  1LAW A;  2G8V A;  4IDK A;  1VSI A;  3SQ1 A;  1ZBL A;  3ZSR A;  3OS1 A;  4PUO A;  1X9W A;  4CF0 A;  1RBR A;  3K5O A;  1S1W A;  4OLA A;  4CEO A;  5JS1 A;  4B8A B;  4B9U A;  4M3T A;  4FCY A;  1ZBF A;  2VG7 A;  4O55 A;  2VWJ A;  3TAN A;  3RRH A;  3AA3 A;  4O44 A;  2E6M A;  4H8K A;  3KTQ A;  3SUP A;  3U3G A;  3WNE A;  1TK8 A;  4KFB A;  2HHT A;  3D0P A;  3OY9 A;  3OYG A;  4CJP A;  3K5N A;  1XHZ A;  2HVH A;  4EZ6 A;  1L3S A;  1F21 A;  2EHG A;  1X9S A;  3RWU A;  4DFK A;  4E19 A;  4G1Q A;  2HMI A;  3CYM A;  4PA1 A;  1KFS A;  1U49 A;  4CEA A;  4I2P A;  1RDC A;  3AVK A;  4CJQ A;  2HHV A;  4BWM A;  3C94 A;  2R7Y A;  4JRQ A;  1HRH A;  2X6N A;  1WSJ A;  2D0A A;  2OA8 A;  2VG5 A;  5KGX A;  4BE2 A;  4CJK A;  1KVA A;  3CG7 A;  1G15 A;  5HRP A;  2B5J A;  4J2E A;  1EET A;  3H08 A;  4J2D A;  3OYE A;  1B9F A;  3WNH A;  4BE0 A;  1JXB A;  3RR7 A;  1S1U A;  3AO2 A;  1WSH A;  4FLV A;  3TAM A;  3SQ0 A;  5EU7 A;  2FBV A;  4CF1 A;  3CM6 A;  4M3U A;  2ZE2 A;  1HYZ A;  1LW0 A;  1RNH A;  4W5O A;  4CEC A;  3IRX A;  4DS4 A;  2GBZ A;  1HNI A;  4QCL A;  3RMB A;  1RDB A;  4DTR A;  2P51 A;  1SL2 A;  1TKD A;  3EYZ A;  1VSE A;  2XY8 A;  1SUQ A;  5KRS A;  3ASM A;  1IKV A;  3HYF A;  3K2P A;  4W5T A;  4E7H A;  1CZ9 A;  3MED A;  4FLW A;  3AVA A;  4HUE A;  3EY1 A;  4HCB A;  2XRI A;  3O4N A;  1N5Y A;  3HXM A;  4YNQ A;  3T1A A;  3V9U A;  4DTO A;  3ZT4 A;  5CYM A;  3M8S A;  4CHP A;  3AVG A;  3ULD A;  1DTQ A;  4M3R A;  3SPZ A;  1BI4 B;  1QSL A;  3NAE A;  4E7I A;  4CJF A;  2DTU A;  3V9X A;  4DS5 A;  4ZTF A;  1T05 A;  1U47 A;  3HVT A;  4CIE A;  1UWB A;  3F73 A;  4ELV A;  2IOC A;  1VSF A;  3O3H A;  3U6F A;  3QEI A;  1Q9Y A;  4DTJ A;  3VQ5 A;  3KLH A;  1KVB A;  3TAP A;  4KHS A;  2HHU A;  4OKK A;  1JLE A;  3MXJ A;  3OYD A;  4MFB A;  2XY5 A;  2RKI A;  4FLU A;  3VN5 A;  4CEF A;  1S1V A;  4F3T A;  3QO9 A;  3SUQ A;  1GOB A;  4M3Z A;  3M8P A;  3AV9 A;  2ZQB A;  4CJ3 A;  3ALY A;  4O0J A;  2IDO A;  3C95 A;  2HHW A;  1TKZ A;  1UAX A;  4RW6 A;  1L3V A;  1X9M A;  1QS4 A;  3FFI A;  3DOL A;  3LAM A;  3SUN A;  4CGI A;  1Y97 A;  3LWL A;  1K6Y A;  2XHB A;  3SZ2 A;  3V1R A;  4DU3 A;  1WAF A;  2X6S A;  4DTX A;  1NK6 A;  2ZD1 A;  2FBT A;  3TAE A;  3ZSV A;  4Z4G A;  3L2R A;  4FJG A;  1BCO A;  4ID5 A;  3VA3 A;  3TAR A;  1NK9 A;  2G8F A;  4Z4E A;  3KKS A;  2G8K A;  1C6V A;  3IS9 A;  4Q5V A;  5FRO A;  4CEZ A;  3HT3 A;  1JXE A;  1ASW A;  3DLR A;  5FDL A;  5J2Q A;  4CGG A;  1BIZ A;  3E01 A;  2YHB A;  4I7F A;  4KB0 A;  4BDP A;  1NKC A;  2B4J A;  1WAJ A;  4CJW A;  1D9D A;  4I9L A;  3KLF A;  4CF9 A;  4NCB A;  2OYQ A;  3V9Z A;  2KFN A;  4RW7 A;  1KSP A;  4B08 A;  4H4O A;  3AA5 X;  4E89 A;  4M3W A;  4K8X A;  3HPH A;  3AVB A;  3KLI A;  1SKW A;  1FKP A;  1B92 A;  3VQ4 A;  1JKH A;  3OYH A;  4DSF A;  3NH1 A;  1RTI A;  1CXU A;  4H4M A;  1C1C A;  1NOY A;  3PX6 A;  4HCC A;  1EX4 A;  1S6Q A;  4FVM A;  2GUI A;  3NFA A;  4DSK A;  3F9K A;  4KTZ A;  1TVR A;  1TKX A;  3DMJ A;  4GW6 A;  4LD0 A;  3KK2 A;  1SL1 A;  4CK2 A;  1XHX A;  3HPG A;  2YNH A;  4FJK A;  1FXX A;  1J53 A;  1TL1 A;  3ITH A;  2D0B A;  1WSF A;  5DK5 A;  1D8Y A;  4FJJ A;  4FZZ A;  1HJR A;  2OPQ A;  2VG6 A;  3VQQ A;  3VQE A;  4IG0 A;  4W5N A;  1RT7 A;  4E3S A;  4ZTJ A;  1DLO A;  1YTA A;  4M3X A;  1T7P A;  1CZB A;  4B9V A;  1RTD A;  3S3M A;  4CHO A;  3DLH A;  3AVI A;  4J2A A;  1A5V A;  1I39 A;  3DRR A;  3MEE A;  3ZSQ A;  4E1N A;  4DU1 A;  1UA1 A;  3BDP A;  2P1J A;  4FJM A;  1LWC A;  1TGO A;  4CJT A;  1N6Q A;  4Z4I A;  2IC3 A;  4HUF A;  2WON A;  3OS0 A;  4IKF A;  2Z1G A;  2OZM A;  4RW8 A;  1RT3 A;  3M8Q A;  4DF4 A;  2DFE A;  1LV5 A;  4FJL A;  3OYF A;  4F2S A;  4I9Q A;  3C6U A;  4AHV A;  3L2Q A;  5HRR A;  3RMA A;  3LZI A;  4O5B A;  3WNF A;  1EP4 A;  1JLA A;  1Z25 A;  4DU4 A;  3MXM A;  3NF6 A;  1UA0 A;  1QE1 A;  4BAC A;  4CGH A;  1MU2 A;  4E7L A;  1QSY A;  4CF2 A;  1D5A A;  1CXQ A;  2XY7 A;  4CGD A;  3LAL A;  4DFP A;  2E4L A;  4JRP A;  1LW2 A;  4DQR A;  1RBU A;  4K8Z A;  4KPY A;  2Z1I A;  3K59 A;  4IFV A;  3QEW A;  4FJ8 A;  1R0A A;  2F8S A;  1KVC A;  2D0C A;  1RBT A;  3NF9 A;  4CJU A;  1RTJ A;  4KV8 A;  4DTM A;  1NK8 A;  4GVM A;  4CJL A;  4KHQ A;  5J1E A;  3NGI A;  1XWL A;  3T3F A;  3KIO A;  4M45 A;  2KW4 A;  1L5U A;  3S3N A;  3C6T A;  1LAV A;  1SKS A;  4JLH A;  4FJH A;  4DSJ A;  1REV A;  1A5W A;  3LAN A;  2HHX A;  2KZM A;  1BI4 A;  1BHL A;  4CCH A;  4F2R A;  3KLE A;  3PV8 A;  4B3O A;  3L3V A;  3OJS A;  4AHU A;  4BDZ A;  3AVL A;  4F3O A;  4N76 A;  4Q0B A;  3G0Z A;  2KZZ A;  5KI6 A;  2Q3S A;  3D45 A;  4FXD A;  1TK0 A;  1JL1 A;  4CHQ A;  3ZSX A;  3K57 A;  3ZSY A;  4Z4C A;  4XIU A;  4M42 A;  2YNI A;  2IAJ A;  3B6P A;  4OPJ A;  1IKY A;  4OLB A;  4DSI A;  2ETJ A;  3DLK A;  1HYV A;  3LAK A;  3MEG A;  1IKX A;  3VQC A;  4DFJ A;  4CES A;  3OYK A;  2P5O A;  3NHG A;  2WOM A;  4LH4 A;  1D9F A;  3OYN A;  3KJV A;  3DOK A;  4FK2 A;  4CER A;  4M41 A;  4CGF A;  4DSL A;  4CIF A;  3O3F A;  3NGZ A;  1JLQ A;  1TL3 A;  1HPZ A;  4DFM A;  1BGX T;  1Z26 A;  3DRS A;  5I42 A;  3MXI A;  3LPU A;  4B9M A;  4FZX C;  4BWJ A;  3NH0 A;  3L8B A;  1NJW A;  3OYL A;  3SCX A;  1GOA A;  1KTQ A;  3VQ8 A;  4N56 A;  3VQB A;  2I5J A;  3NBP A;  4E7K A;  3KK1 A;  2BGG A;  4CFB A;  1HYS A;  1TKT A;  3TAB A;  4DG1 A;  5KGW A;  3NCI A;  4NCG A;  3SYZ A;  2W42 A;  2BDP A;  4DWI A;  2KQ2 A;  3M8R A;  4B9T A;  5FRN A;  5CZ2 A;  1RBV A;  1VSL A;  4FYD A;  4EZ9 A;  4KAZ A;  5J2P A;  4KHU A;  3L2W A;  4E0D A;  2YKM A;  2QK9 A;  4FJN A;  1IKW A;  1WSE A;  4Y1D A;  5C24 A;  4EP4 A;  4PWD A;  2QXF A;  3CFP A;  3G10 A;  4NCA A;  4W5Q A;  4FJ7 A;  4N5S A;  1W9H A;  5HRO A;  4LSN A;  5E41 A;  3PX4 A;  3PUF A;  4M3Y A;  2HB5 A;  3DLE A;  4TSX A;  3B6O A;  1X1P A;  4C8N A;  3OJU A;  1NJX A;  1VSH A;  1NK5 A;  4CFA A;  4KTW A;  3NF7 A;  4CED A;  4FJ5 A;  2PZS A;  3K5L A;  3NGY A;  2HHS A;  3SV3 A;  3RTV A;  4FK4 A;  2OPR A;  3VQP A;  4Y1C A;  3ZT1 A;  3I8D A;  1C0M A;  4DTN A;  3VQ6 A;  4DQP A;  3L3U A;  2RF2 A;  3K58 A;  1WSG A;  1BL3 A;  5JS2 A;  5J2N A;  3HJF A;  3SUO A;  4FJI A;  1KFD A;  1JLC A;  4JS4 A;  1Q9X A;  1B9D A;  1BQM A;  2HNY A;  4O0I A;  3SNN A;  1NJZ A;  5HRN A;  4C8O A;  4DQI A;  4BDY A;  3HK2 A;  4OKJ A;  1U04 A;  4FJX A;  4E1M A;  3OYM A;  1EKE A;  4DMN A;  4DLE A;  2E6L A;  3TAF A;  1HNV A;  3IAY A;  3LPT A;  4DTP A;  2DFH A;  2JLE A;  3DRP A;  4DLG A;  3HM9 A;  3V6D A;  3VA0 A;  1NK7 A;  1VSM A;  5CZ1 A;  5HBM A;  4CGJ A;  3QER A;  2XY6 A;  2KFZ A;  3TR8 A;  3ISN C;  1IO2 A;  1XI1 A;  4OKE A;  5HRS A;  1ZBI A;  4I2Q A;  5SWM A;  3VQA A;  1NKB A;  3UIQ A;  1VSK A;  3OYB A;  4DTS A;  1ZBH A;  4CJ5 A;  1BCM A;  3ZCM A;  3VQ9 A;  3AVF A;  2YNF A;  1UOC A;  2Z1J A;  3HP9 A;  4LY7 A;  4HHT A;  4C8L A;  1Q8I A;  1VSJ A;  2A1S A;  1O1W A;  1ZBU A;  3SI6 A;  1HMV A;  4CF8 A;  3I0R A;  3HP6 A;  4UQG A;  5T7B A;  4OJR A;  3ZT0 A;  1TAU A;  4AIL C;  2O4I A;  1J5O A;  4CFC A;  3AA4 A;  1LWE A;  3LP3 A;  1JLG A;  1C0T A;  2RPI A;  5CY4 A;  4E7J A;  3QEV A;  3CFO A;  1QQC A;  2KTQ A;  4B8C A;  1C0U A;  4FLX A;  4CJS A;  2HNZ A;  1ASU A;  1KCF A;  2ITG A;  2F8T A;  3QEP A;  2FBX A;  4EP5 A;  4Z4H A;  4CHZ A;  1RT4 A;  2NUB A;  4DQS A;  1CLQ A;  1GOC A;  3VQD A;  4DSE A;  4ZHR A;  5FRM A;  1RDA A;  1JL2 A;  4IBN A;  2X78 A;  3OYJ A;  3PX0 A;  1WN7 A;  3LZJ A;  3AO5 A;  1NOZ A;  3SPY A;  2P5G A;  4AHC A;  5D3G A;  3TWH A;  3T19 A;  4CK3 A;  3TAG A;  1TV6 A;  1WLJ A;  3OVN A;  1J54 A;  3P1G A;  4CIG A;  3OYC A;  3P5J A;  3V9S A;  3U3Y A;  3V4I A;  4KI4 A;  4FLY A;  2D5R A;  4FM2 A;  4FM1 A;  2OPS A;  1VRU A;  5K14 A;  3SJJ A;  3SV4 A;  1ZYQ A;  4KHY A;  1DTT A;  4BE1 A;  4L8R B;  1YT3 A;  4CFD A;  4CE9 A;  1EXQ A;  1IG9 A;  1IH7 A;  2O4G A;  3LP0 A;  5HLF A;  1T03 A;  3HO1 A;  1W0H A;  3QIO A;  2EX3 A;  4ID1 A;  5I3U A;  3KK3 A;  3V81 A;  5KRT A;  3PO4 A;  1RT2 A;  3LP1 A;  3DM2 A;  1FKO A;  5SZT A;  1U48 A;  4C8K A;  2Y1I A;  1NJY A;  1L3U A;  4CEB A;  5C25 A;  4CK1 A;  3L2U A;  3DI6 A;  4HUG A;  3SQ4 A;  2PYJ A;  3AO4 A;  3MEC A;  4WE1 A;  3NH2 A;  3OS2 A;  4J2B A;  1WNS A;  4FK0 A;  1WSI A;  1C1B A;  1RT6 A;  4RG8 A;  3K5M A;  3ZSO A;  3NE6 A;  2LSN A;  4B9N A;  1KLM A;  1NKE A;  3SQ2 A;  5C42 A;  3QNO A;  4CEE A;  4AH9 A;  3V1Q A;  1NK4 A;  4ELU A;  2G8U A;  3RMC A;  4IG3 A;  4CEQ A;  4ELT A;  1VK0 A;  3P83 D;  3S9H A;  4RW4 A;  4N41 A;  2AJQ A;  1C1A A;  4Z0U A;  3KD1 E;  2RN2 A;  4NYF A;  3QNN A;  2IS3 A;  4CJV A;  2X74 A;  4KHW A;  1RCH A;  1RT5 A;  2HND A;  3OYI A;  4FW1 A;  2OPP A;  4ICL A;  4FLZ A;  1SL0 A;  4KRE A;  3AO3 A;  1VSD A;  2B6A A;  3DYA A;  4KO0 A;  4W5R A;  3QES A;  4CHN A;  2PYL A;  1SV5 A;  1ASV A;  4FW2 A;  3ZSW A;  3I0S A;  3DLB A;  4C8M A;  3NF8 A;  2DY4 A;  3ZSZ A;  4QOZ B;  3QIN A;  1A5X A;  4CJE A;  3WNG A;  3AVH A;  3CFR A;  3O4Q A;  1KLN A;  3RRG A;  5CYQ A;  1XC9 A;  3RR8 A;  4OVL A;  1BIS A;  3LP2 A;  3LWM A;  4FLT A;  3LDS A;  4KRF A;  4N47 A;  1L3T A;  4AHR A;  3EZ5 A;  1ITG A;  1QTM A;  4B9L A;  3NDK A;  4FJ9 A;  1JLF A;  3IG1 A;  1U45 A;  1HQU A;  4HVJ A;  1HQE A;  3ZT2 A;  3OYA A;  2HW3 A;  1S9G A;  2DFF A;  1NK0 A;  2ATQ A;  2JGU A;  3S3O A;  3L2V A;  3HVR A;  3PO5 A;  1S1T A;  1JLB A;  3AVN A;  3QEX A;  2G8I A;  3TAQ A;  3AA2 A;  3THV A;  2XO7 A;  1BIU A;  1QHT A;  4LSL A;  3RMD A;  4Z4F A;  1RIL A;  3AO1 A;  4AHT A;  4F8R A;  1RDD A;  3AVJ A;  4FM0 A;  3KKR A;  1J9A A;  1TK5 A;  4KKO A;  4F4K A;  3AVC A;  1YVU A;  1LWF A;  2FC0 A;  3KD5 E;  4O4G A;  1U4B A;  1I3A A;  4DQQ A;  2QKK A;  3HL8 A;  4OGE A;  5KTQ A;  2BAN A;  3CM5 A;  2VWK A;  4RW9 A;  3JSM A;  5HP1 A;  4R5P A;  1RTH A;  3QIP A;  4IFY A;  1YTU A;  4OGC A;  5DMR A;  3VQ7 A;  1S6P A;  4QAG A;  2IGI A;  3ZT3 A;  3QET A;  5J2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...