1B9DA

Mobility of an hiv-1 integrase active site loop is correlated with catalytic activity
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
154
structure length
143
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGYSAGERIVDIIATDIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mobility of an HIV-1 integrase active site loop is correlated with catalytic activity.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords PROTEIN (INTEGRASE)
total genus 51
structure length 143
sequence length 154
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1b9dA00
3DRRA 4N47A 4C8MA 1KFDA 4E7LA 4E3SA 2IDOA 3OYLA 3E01A 4CK1A 2AJQA 1QSYA 3VA3A 3NF7A 1C6VA 4ZHRA 1RBRA 1I39A 4MQ3A 2HNZA 3HO1A 3L3UA 4FJHA 2KFZA 3V9ZA 4FLVA 4H4OA 3SUQA 5I42A 1WSHA 1RBTA 1BQMA 2OPPA 1CLQA 4M3TA 1LAVA 4W5TA 3AA2A 4M3ZA 2YNGA 4CF8A 3U3YA 4W5OA 4CJEA 2P1JA 4CJWA 4CIGA 3L2WA 3AVHA 4CHPA 4DFMA 3V6DA 3SJJA 2A1RA 4F3TA 1YTAA 1KTQA 3AA3A 3PX4A 1FKOA 2RN2A 4FJLA 1VSIA 4CEAA 2HW3A 4C8LA 1B9DA 4I9QA 1ASWA 3V1RA 5D3GA 3LZJA 1X9WA 2OA8A 5HLFA 1TK8A 1QSLA 2HHSA 1S1WA 4Z4FA 3NF6A 1J9AA 1BCOA 4CF0A 2IS3A 3NCIA 4OLBA 4AH9A 3S3MA 1EX4A 3ZSWA 1VSJA 2F8TA 4HHTA 5CZ1A 1WSEA 2R7YA 3OJSA 4FLUA 1C1CA 3KKRA 2OPRA 3QLHA 3KK1A 2FBYA 4DTUA 1KLNA 1TKXA 4KO0A 2G8KA 3M8SA 1XC9A 2PYLA 1RT2A 4CF2A 3MEGA 3KLEA 1RDDA 4EZ9A 1F21A 4KKOA 4YNQA 3HPGA 4N56A 3V4IA 1NK7A 1KCFA 1RTHA 3U3GA 3NAEA 3VQ5A 3ZCMA 3LALA 3HVRA 1RBUA 3AO4A 3K5NA 4FK4A 1EKEA 1QS4A 4UQGA 3PX0A 2A1SA 5FROA 3O4NA 3HP9A 2Z1HA 1GOCA 3AVMA 2KFNA 3JYTA 3OYAA 2IGIA 1U4BA 4CIFA 5J2QA 4ID1A 1TL3A 2E4LA 4QAGA 5C42A 4W5QA 4CFAA 1LV5A 1J5OA 4IG0A 4DSJA 1HNVA 4DFPA 3ZSOA 3CM6A 3NE6A 3AVGA 4FLWA 1NJZA 4IKFA 4KPYA 1ZBLA 4M3YA 3PO4A 1EETA 2X6NA 4FW2A 1CZ9A 4QCLA 4BE0A 4CK3A 3OY9A 1QQCA 1XHXA 4BWJA 3DOKA 3ZT1A 3ZSQA 4DU4A 3T3FA 1QSSA 1X9MA 2BGGA 5HP1A 1A5XA 3K2PA 3C6UA 1HPZA 3OYHA 3HK2A 2DY4A 2QKKA 4M3WA 3KLHA 1TK0A 4M3RA 2OZMA 2E6MA 3LZIA 3VQAA 2FBTA 4CFDA 4IG3A 4DTSA 3SPZA 3VQ7A 4CERA 4CGFA 2HHVA 1JL1A 3FFIA 4LY7A 4FJKA 4E1NA 4N41A 2X6SA 1N6QA 5J2MA 3TAMA 1XHZA 4OJRA 3O3FA 4YFUA 4J2EA 3TR8A 4RW9A 4AHUA 3ZSXA 5E41A 3OS2A 3OYFA 2VG6A 4CJQA 4W5NA 1CXQA 3AO5A 3RRGA 3DLKA 4O44A 4L8RB 3OYBA 3AA4A 1SV5A 4B8CA 5HRNA 4DU3A 4NYNA 3T19A 3QIOA 1U47A 1IG9A 5FDLA 4CJ4A 4M41A 4E0DA 4LD0A 3V81A 2EX3A 2HHUA 4GW6A 5C24A 4DWIA 1IKYA 3NH0A 5KI6A 4CEEA 3TAFA 1RTDA 2PY5A 4Z4EA 2Z1GA 1HJRA 2ZE2A 3L3VA 3F73A 3QIPA 4NCBA 4CHYA 1NJYA 2D0AA 3ZSVA 4PWDA 3AVAA 1RT6A 4DQRA 1NJXA 2X74A 4W5RA 2P5GA 4M3XA 1VSKA 1L3UA 3I0RA 3VQ6A 4CGGA 4B9TA 4ELTA 1WN7A 4XIUA 2G8VA 1K6YA 3ZT3A 2XHBA 2G8UA 4CGJA 4JS5A 3K5LA 4FLXA 4FJMA 1S1XA 4DS5A 3HM9A 1REVA 3VQBA 4OGCA 4FM0A 4HCCA 3HSTB 4CGDA 4DF8A 2JLEA 4DTMA 1I3AA 3HT3A 3KD5E 4FCYA 1YT3A 4B9VA 2YV0X 1WSFA 1LW2A 4EP4A 3S3NA 4DSIA 4KHQA 3LP0A 2Y1IA 1D8YA 3V9SA 1TGOA 3QEWA 3TAEA 1C0MA 4FLTA 4ELVA 4RW6A 2HNYA 3NH1A 3O3GA 5CYMA 3OS1A 3TAPA 2YNIA 1WSGA 4Z4HA 2O4GA 4PY5A 3A2FA 3OYDA 4Z4CA 1DTQA 3HL8A 4RW4A 4QOZB 3KLGA 1TL1A 2P51A 3LPTA 5HRPA 4ZTFA 3VQCA 1SL0A 3OYNA 4J2BA 1W0HA 3TAQA 2KTQA 4HVJA 1WAFA 1TKTA 4KTZA 5KGWA 1NKBA 2G8FA 3S9HA 4M3UA 4TSXA 3HJFA 3K59A 1BCMA 1JLGA 2BDPA 3TANA 4OVLA 1NK0A 1U45A 4CECA 3PV8A 3KTQA 4FJNA 5SZTA 1VSFA 1HMVA 1RDBA 4NYFA 2DFEA 4RW7A 3TAGA 4DTPA 3RWUA 1FK9A 4I2QA 3SNNA 3KJVA 5FRMA 2YKNA 2ITGA 3WNGA 3HXMA 4BDPA 1N5YA 2BE2A 3DI6A 1ZBHA 3HPOA 2HVHA 5T7BA 1WSIA 4B3OA 5C25A 2HHXA 4JS4A 4DS4A 2HMIA 3DYAA 3NF8A 3C94A 2HB5A 2YKMA 5J1EA 3KKSA 1A5WA 1G15A 2RF2A 4I7FA 4B9NA 2O4IA 1R0AA 4E19A 1RNHA 3EY1A 4DFJA 3SV3A 4E7HA 4KHSA 3OYEA 2XY7A 4Q0BA 4BDZA 1T7PA 2KZMA 3ALYA 4CJ3A 2XY6A 1C0TA 1HQEA 2IOCA 3AO3A 3V9XA 4C8NA 1UWBA 1MU2A 4FYDA 1T05A 1D9DA 1SL2A 1Y97A 3MAQA 4C8KA 4B9MA 3RMCA 4FJIA 1JXEA 3OYJA 4LSNA 1KSPA 4H8KA 4CK2A 1JL2A 3QEPA 1ITGA 3L2QA 3WNHA 2GV9A 1J54A 3KK2A 3V9WA 3M8QA 4DTNA 1Z25A 1QHTA 3S3OA 4FJ7A 1BQNA 2KQ2A 3C95A 3KD1E 4FJGA 3RTVA 1T8EA 3OS0A 1VRUA 1RBSA 2PYJA 1QE1A 2X78A 3O4QA 4ZTJA 4FJ8A 4CJFA 4NCAA 3D0PA 3TI0A 1JXBA 2FC0A 1WAJA 3DLGA 1TAQA 3EZ5A 3CQ8A 4FM1A 3DLHA 4IFYA 3AO2A 3IG1A 3LANA 2WOMA 2D0CA 2E6LA 1RTIA 4CJ5A 3SUOA 1D9FA 5EU7A 1IKXA 4R5PA 4B9SA 4FK2A 4B08A 4H4MA 4F2RA 3CFRA 1HNIA 1TK5A 3NHGA 3M8RA 4C8OA 3L2UA 3NGYA 3OYMA 4KREA 4O0IA 1HRHA 3IS9A 3IAYA 4FK0A 3I0SA 4FZXC 1FXXA 3NGIA 3AVJA 3SUNA 1C1AA 3ZSZA 3MECA 4IBNA 1VSLA 3L2VA 3SPYA 1YTUA 1U04A 3DRSA 3THVA 1ZBIA 4MFBA 3ZT0A 3V9UA 4DF4A 4KHWA 1VSDA 4O4GA 4CJTA 1SKRA 4FM2A 1A5VA 1L5UA 1S5JA 5HRSA 2B6AA 1BL3A 2F96A 4HUEA 3SYZA 5J2NA 1S9EA 3NBPA 4DMNA 4OLAA 2P5OA 3HYFA 1BIUA 4CJSA 4LH5A 4BDYA 3D45A 3KIOA 4K8XA 2RKIA 3IRXA 1SUQA 4FVMA 4CFCA 1GOBA 3JSMA 3DLEA 3QEXA 1ZBFA 5JS1A 4NCGA 3I8DA 3BDPA 2W42A 1O1WA 2EHGA 1BHLA 2WONA 3OYIA 1SKWA 3L2RA 5FRNA 3AVIA 4KI6A 4CHOA 4KHUA 3SZ2A 4CE9A 4FXDA 2B4JA 3DM2A 4E7IA 3HPHA 4F8RA 1SKSA 4KB0A 3O3HA 1WNSA 1C1BA 4E7JA 5KRTA 3LWMA 4JRPA 1S9GA 4CJUA 4DQQA 1NK8A 4DQPA 3BGRA 4B8AB 1JKHA 4WE1A 1BI4A 1ASUA 3AV9A 2XRIA 5CYQA 4DTXA 3OJUA 2B5JA 1J53A 3QERA 4DG1A 2XY8A 3TABA 4CGHA 3CM5A 1RT4A 3VA0A 1VK0A 4J2DA 3RMAA 1Z26A 4CHZA 4ICLA 4CIEA 4EP5A 4FLZA 3ZSYA 3ITHA 3C6TA 2GUIA 1VRTA 4M45A 1QTMA 2RPIA 1RCHA 1EP4A 2ATQA 4OKEA 4CEDA 3MXIA 3V1OA 1ZYQA 1NJWA 3DLBA 1EXQA 1S1UA 4O0JA 4CFBA 3WNFA 1Q9YA 2HNDA 1DLOA 1JLFA 3VQ4A 1W9HA 3SQ0A 3PX6A 1RT3A 3VQPA 1RBVA 4E1MA 1TKZA 3SQ1A 3P83D 3H08A 1RT1A 2Y1JA 1BI4B 1NK9A 1HYSA 2HHTA 4RG8A 3OYKA 3NF9A 3ASMA 3K58A 3RRHA 3DMJA 3ISNC 4BACA 2G8IA 2HHQA 3QNNA 4DSLA 4DTOA 3QESA 2BANA 4AHSA 4KV8A 4DU1A 4KFBA 3MEDA 4CCHA 2YNHA 4KRFA 3TARA 1LWEA 1GOAA 2Z1JA 4DTRA 2OZSA 2DTUA 1NOZA 3M8PA 4I9LA 1T03A 2YNFA 3DLRA 3KLIA 1KRPA 3V1QA 4BWMA 4HUFA 3KK3A 4B9UA 3VN5A 3OYGA 2DFFA 4FJ5A 2Q3SA 4FJXA 1S1VA 4CHQA 1NK5A 3RR7A 2VWJA 5HROA 4Y1DA 1S6PA 4Z0UA 3RR8A 3P5JA 3OVNA 4E7KA 3PO5A 4B9LA 4FZYA 5SWMA 3ZSRA 2D0BA 4LH4A 4AILC 4KB1A 4KAZA 4CJRA 3RMDA 3AVKA 5DK5A 4KI4A 1XI1A 1IH7A 4CHNA 4HTUA 1VSHA 3VQDA 3UIQA 1NKEA 1BGXT 1L3TA 5CZ2A 3L8BA 1U48A 4KHYA 1B92A 3PY8A 3K5OA 4IDKA 1VSMA 3LAKA 4Q5VA 4CJVA 4JRQA 3G10A 3T1AA 1TAUA 1DTTA 3G0ZA 4O55A 4E89A 4FJ9A 2ETJA 2OPQA 4OPKA 3OYCA 3AA5X 1NKCA 4DSEA 1S1TA 2YHAA 5HBMA 1Q8IA 3TWHA 3WNEA 1RT5A 1LWFA 1NOYA 3QINA 3P1GA 3PUFA 3DRPA 3SI6A 3QEIA 4DLEA 1WSJA 1RTJA 4GVMA 4RW8A 5KTQA 3LWLA 4KHNA 1BISA 1TKDA 4Z4GA 1U49A 4HCBA 1HYVA 3NDKA 1UA1A 1NK6A 3ULDA 2Z1IA 4OKJA 3CG7A 3NGZA 3QETA 3RMBA 4OKKA 4G1QA 4F4KA 2DFHA 4PQUA 3VQ9A 4CEBA 2XO7A 2KZZA 4F2SA 3CYMA 4FJJA 1JLAA 4JLHA 3ZT4A 2XY5A 3LAMA 1WLJA 1D5AA 4CJKA 5CY4A 3QO9A 3HVTA 2QK9A 4PA1A 4AHVA 3MXMA 2G8WA 3F9KA 1XWLA 4AHCA 3SQ4A 4OPJA 2IC3A 4O5BA 4Y1CA 1FKPA 4DFKA 4FW1A 4FLYA 1VSEA 4CJLA 3SQ2A 4N76A 2VG7A 3EYZA 1JLBA 3B6OA 3MXJA 3LP3A 3AVFA 4K8ZA 4I2PA 2QKBA 1HQUA 3DOLA 5KGXA 1KVCA 2YHBA 4CF9A 1RDCA 1TVRA 3CFPA 4DLGA 2VWKA 2HVIA 1KLMA 1KVAA 2D5RA 4DQSA 4OGEA 3MEEA 2GBZA 5K14A 1L3VA 4PUOA 4GMJB 1UOCA 3KLFA 5DMRA 4DQIA 3K57A 4BE2A 4DTJA 4IFVA 4Z4IA 4AHTA 2FBXA 3SCXA 4DSFA 1IO2A 4FZZA 2I5JA 4CGIA 2LSNA 5JS2A 1X9SA 4HUGA 4ELUA 4M42A 2HHWA 3CFOA 2IAJA 4N5SA 4KTQA 1SL1A 3AVNA 1C0UA 3QEVA 1HYZA 2PZSA 1IKVA 4J2AA 2NUBA 3LP1A 4DSKA 4ID5A 2ZD1A 3NFAA 4CESA 1B9FA 1Q9XA 2VG5A 3AVBA 2OPSA 3AO1A 3VQ8A 2OYQA 1RILA 1LAWA 1JLEA 3VQEA 1KVBA 4CJPA 4BE1A 1S6QA 1TV6A 2ZQBA 1LWCA 1RT7A 5HRRA 3ZT2A 4CEFA 4CEQA 3NH2A 1ASVA 1JLQA 3VQQA 1RDAA 2G8HA 1UA0A 1JLCA 1X1PA 4AHRA 2KW4A 3LDSA 3SV4A 1LW0A 1CXUA 3LPUA 1NK4A 2JGUA 5I3UA 1KFSA 4EZ6A 5KRSA 3QNOA 2FBVA 4F3OA 3AVLA 1CZBA 1UAXA 1ZBUA 2QXFA 1YVUA 4CEZA 3HP6A 3K5MA 4KTWA 2F8SA 3SUPA 3AVCA 3LP2A 1IKWA 4CF1A 1BIZA 1L3SA 4LSLA 4CEOA 5J2PA 3U6FA 3B6PA
chains in the Genus database with same CATH superfamily
4PKHA 3AGKA 4JI0K 4CK1A 3ENHA 3NF7A 3CXCM 1C6VA 1RBRA 5BPLA 4IEEA 1BQMA 1RDUA 1LAVA 4W5TA 1KXPA 4W5OA 4HWIA 2P1JA 3QFUA 2A1RA 3AA3A 3AY9A 4CZIA 3CQYA 1B9DA 2VYPA 2IVPA 2YX6A 4OO1J 1S1WA 4DCHA 5LY3A 4CF0A 2P9UA 4JKHA 3NCIA 1EX4A 3ZSWA 1VSJA 3WXMB 2F8TA 2QWPA 4H0TB 2R7YA 2AA4A 3OJSA 3KK1A 3H1VX 1G99A 4BRKA 3M8SA 5ELZA 4YOUA 1NGJA 3CCMN 1RT2A 1RDWX 5IT9O 3VEVA 3E9PA 4YOYA 3U3GA 4I6MA 3VQ5A 3HVRA 4EAHD 1RBUA 3AO4A 3K5NA 4FK4A 2HF4A 4EFHA 3WXLA 4JN4A 3SBTA 3JYTA 3WQUA 2PBDA 4BR7A 5J2QA 3VGMA 5C42A 1U4BA 2D0OA 2E4LA 4QS9A 1LV5A 4IG0A 4DSJA 4DFPA 1NJZA 4IKFA 3NE6A 4KPYA 1ZBLA 3O6WA 4FW2A 1CZ9A 4BE0A 4NB4A 4JNEA 3ZT1A 3ZSQA 3T3FA 4A2BA 4FO0A 1X9MA 4MO5A 3UB5A 1W97L 4HTLA 3KLHA 4M3RA 3G4SN 3VQAA 3SPZA 4CGFA 2HHVA 3TSUA 4C23A 4N41A 4JAXA 4CBXA 5J2MA 2O8DA 4B3TK 5E41A 3BF3A 3OYFA 4JK8A 1J5EK 5LMUK 5HL7L 4O44A 4L8RB 3AA4A 1SV5A 4DU3A 4CJ4A 4LD0A 2EX3A 1NU0A 3EZWA 3TAFA 1RTDA 4GVEA 2ZE2A 3L3VA 3F73A 5JMVA 3ZSVA 4JKDA 2A3ZA 1RT6A 3KK7A 2P9LA 2X74A 2ITMA 4W5RA 4FL9A 3I0RA 1SS6A 1WN7A 3IUCA 3MN5A 3ZEUA 3BY5A 4JS5A 2D0PA 3K5LA 4FJMA 1NGBA 3RSEA 5JLHA 3HM9A 4Z94A 4DR5K 4CGDA 3S41A 2JLEA 5BR8K 4B9VA 2BTFA 4B3SK 4DSIA 2ZGYA 4DV6K 1TGOA 3IDHA 1C0MA 4FLTA 2HNYA 3NH1A 3I55N 1J6ZA 4JKBA 4Z4HA 1WSGA 1XC3A 3OYDA 1DTQA 3HL8A 1SL0A 4EIAA 3G25A 1W0HA 4LFAK 1WAFA 3DXKB 3G71N 2G8FA 4M3UA 1Z6RA 3HJFA 1BCMA 1JLGA 3TANA 3OHRA 4CECA 3PV8A 3D6RA 4V19S 1NGEA 5KPTA 1VQ4N 1HMVA 3IFRA 2QM1A 4I2QA 5B8HA 1N5YA 1ZBHA 4X64K 1DEJA 2OCEA 2O8DB 1VQMN 3NF8A 4GKJK 2I7NA 2O4IA 1R0AA 1RNHA 4DFJA 3C65A 3GG4A 2XY7A 3ALYA 4CJ3A 5AJ3K 5FPDA 2XY6A 1C0TA 1HKGA 3V9XA 2OTLN 1T05A 1D9DA 3FE1A 3CD6N 4XH4A 1JXEA 5LMNK 4LSNA 5M1OA 1HKCA 1HUXA 2O8BB 5A2QO 3I56N 4DTNA 1S3XA 1BQNA 2HOEA 5C2FA 3HOSA 3I33A 3RTVA 3OS0A 2YHWA 2GUPA 1RBSA 1QE1A 2X78A 3O4QA 3TI0A 3DLGA 4CBWA 3EZ5A 4JKCA 1D9FA 2E6LA 4QOZB 3ULEB 4R5PA 4FK2A 1NMNA 2O8FA 3NHGA 4C8OA 3K0SA 3L2UA 3F9MA 3OYMA 1HRHA 3DJCA 5GINA 1FXXA 1C1AA 4IBNA 5FPEA 3THVA 4BRNA 4CJTA 3M5RA 3E9OA 4K43A 1L5UA 5HRSA 5AQYA 1U2VA 3CJ7A 1JJ2M 4H5WA 3D45A 1TUUA 2RKIA 5C0YA 3KVGA 4JKAA 4DQ8A 4NCGA 3BDPA 2W42A 3L4IA 2E8AA 1SKWA 4KH6A 3OYIA 2QWMA 4CHOA 4KHUA 1GLDG 5AQHA 5KRTA 2P9NA 4A57A 1NK8A 4EZ9A 1DKGD 1V4SA 4B8AB 2FXUA 5LJWA 2E88A 2XRIA 1NGGA 2IVNA 2B5JA 1J53A 4JI6K 3QERA 3TABA 3CM5A 1VAZA 4CHZA 4FLZA 3C6TA 1VRTA 3THWA 1QTMA 4BRIA 3C7NA 1NJWA 2QWOA 3KWGA 3V1OA 1ZYQA 3WNFA 2HNDA 3L0QA 2UYTA 2ZJPL 4FVUA 4E1MA 3T1YK 1NK9A 2NRRA 3O9UA 1HYSA 4RG8A 1VQKN 3DMJA 2G8IA 3QESA 3ULEA 4AHSA 4K25A 4KFBA 5AQOA 4CCHA 2RHKA 2Z1JA 5AQTA 3TPQA 1T03A 4BWMA 4B9UA 3VN5A 1YJ9N 4FJXA 4CHQA 5AQRA 1NK5A 3H3NO 2QTDA 5HROA 4CVNE 4Z0UA 3RR8A 3OVNA 3LM2A 4AILC 4KB1A 1S72N 4FOEA 5DK5A 1IH7A 2UXDK 3A8YA 3UKUA 1VSHA 3UIQA 4C1NK 4FWRA 4H0XB 3L8BA 5BN8A 1B92A 1VQ6N 3LDQA 3K5OA 1VSMA 4Q5VA 1TAUA 3G0ZA 4FJ9A 4E89A 3PIPL 3AA5X 2YHAA 4DV5K 3TWHA 1NOYA 1LWFA 4DHYA 3QINA 4WQ4A 5KTQA 4KHNA 1BISA 1S22A 4CJ7A 4HCBA 4WQ5A 2QI2A 3R6MA 3NDKA 4BROA 3OTOK 3U9DA 3NGZA 5AQGA 1ATNA 2E5LK 3C7NB 3VQ9A 4CEBA 2P9IB 3CYMA 1JLAA 2A40A 2NNWA 1D5AA 3ZX2A 3CCQN 4WFAL 3Q7BA 3UE5A 3MXMA 4A59A 2G8WA 3SQ4A 3H46O 4FW1A 2VG7A 3B6OA 4I2PA 3DOLA 5KGXA 2YHBA 1TUYA 1RDCA 1TVRA 4CF9A 2VWKA 2HVIA 3HM8A 2NZTA 1NM1A 5AQVA 5M1QA 4PUOA 1L3VA 5DMRA 3K57A 2A5XA 2UXBK 2I5JA 4ELUA 1JCEA 5JS2A 4M42A 1IJJA 3ID6A 2HHWA 4CZJA 1GLEG 3AVNA 1SL1A 2NUBA 3O9TA 3LL3A 4ID5A 4BR5A 2ZD1A 1Q9XA 3AVBA 4M7XA 2OPSA 5AZIB 3VEZA 4JI2K 2OYQA 1RILA 1KVBA 4NXMK 2E20A 1S6QA 4CEQA 3M6GA 3UKUB 4BQZA 1ASVA 3VQQA 2KW4A 1P8ZA 1CXUA 2F7TA 4JKGA 5I3UA 4EZ6A 1NGFA 1UAXA 1ZBUA 1YVUA 2YHYA 1T6DA 4CBUA 5C10A 1BIZA 3GL1A 3DRRA 4E3SA 2GTDA 4JKEA 2IDOA 3OYLA 2AJQA 1K8KA 4DB3A 4ILJA 4KHPK 4MQ3A 3HO1A 4FJHA 3R1XA 4FLVA 1WBDA 4H4OA 5I42A 5C2DA 1CLQA 3J80O 4M3ZA 2YNGA 3U3YA 4CJWA 3SJJA 3L2WA 2P9IA 3AVHA 5TKYA 1KTQA 1VSIA 4CEAA 1YI2N 4CI6A 4I9QA 1ASWA 5D3GA 5M1KA 2KLAA 2WFBA 1QSLA 2HHSA 1J9AA 4X62K 3CCUN 1OVYA 4E1JA 4CD3A 4CZMA 3AAQA 4HHTA 3KKRA 2O8FB 5CE3A 4R79A 2OPRA 3CJ1A 4DTUA 1TKXA 2G8KA 2Q0UA 3CMAN 3R8EA 4BC2A 2PYLA 2HBJA 4CF2A 4H03B 1KQSM 1I94K 2GELA 4N56A 3EE8A 3V4IA 2V7ZA 3NAEA 2UUAK 4GV6A 1MWMA 1QS4A 4UQGA 2A1SA 5AZIA 2F9WA 1GOCA 2E1YA 3L6QA 4MO4A 4ID1A 4CFAA 1J5OA 1HNVA 5I9EB 3CM6A 3AVGA 4FLWA 3MDQA 3PO4A 2KHOA 2I7PA 4JKGB 4CK3A 4C1NI 1QQCA 3OY9A 4DU4A 4NXNK 3CC7N 4PHTX 3AGRA 1QVFM 4JKFA 1TK0A 3U4LA 4RTFD 1HLUA 3LZIA 1WB9A 4BRCA 4IOAL 1NGHA 3FFIA 3ID8A 3U9ZA 4DR7K 3THWB 4YFUA 3TR8A 4X66K 4AHUA 3OS2A 4B3RK 3AO5A 4IEIA 1NGCA 3AAPA 5HRNA 1D4XA 3PIOL 3KZBA 1U47A 4M41A 5AQXA 3V81A 4GW6A 5C24A 5CR4A 1IKYA 5GAHP 3NH0A 2W6LA 3D2EA 4PKIA 2Z1GA 1E4FT 3QIPA 4NCBA 2D0AA 2V51B 4PWDA 4DQRA 3VTHA 3R3LA 2FSJA 2Q31A 4M3XA 1VSKA 2GWKA 4ISEA 2HHHK 4B9TA 3QDKA 2G8UA 4KH5A 4OGCA 1EO1A 1I3AA 1VQNN 1YT3A 2YV0X 1WSFA 3S3NA 1D8YA 3F2KA 3VF4A 3TAEA 5GAGP 1C0FA 3WXJA 5CYMA 3BZKA 3A2FA 3TTDA 1ZXOA 3QBXA 1TL1A 4JD2B 2P51A 3LPTA 4ZTFA 3VQCA 2NRHA 1XMQK 3TAQA 3T69A 2KTQA 3FZHA 2YHXA 1TKTA 4KTZA 3VPZA 3E9LA 4TSXA 1NK0A 1U45A 4MLHA 2CH5A 1QQMA 3QBWA 3VTIA 1T6CA 2UUCK 2DFEA 4BC4A 2VGMA 4JI8K 3WNGA 2ITGA 3O9RA 3HXMA 5T7BA 1WSIA 5C25A 2UU9K 4JS4A 4DS4A 3C94A 2YKMA 5J1EA 3HOTA 3A5MC 2RF2A 1G15A 3CQXA 4E7HA 4KHSA 3OYEA 3HTVA 4Q0BA 4BDZA 1T7PA 4WF9L 1HQEA 1YF5L 3AO3A 4C8NA 1JCFA 1SL2A 3D2EB 3PSFA 4WFNL 2ZJRL 3OYJA 2FSNA 3TU5A 4H8KA 4CK2A 1JL2A 3QEPA 1ITGA 3L2QA 3M8QA 2PFUA 4IWVA 3WUHA 4LF6K 5AQFA 3KD1E 4QS7A 1T8EA 3N4PA 3DXMA 3VMFB 2PYJA 1BUPA 1U2VB 5KQ8A 2WUSA 1JXBA 1HNWK 3ZLJA 1TAQA 3LANA 3SUOA 3MWTA 4B08A 4F2RA 1VQ7N 3CFRA 1BO5O 1TK5A 4O8KA 2QA4N 3VENA 4KREA 4FK0A 4FZXC 1H1VA 5AZJB 3MECA 5E84A 4JD2A 1ZBIA 3ZT0A 2NRTA 4KHWA 1VSDA 2Q97A 1S5JA 3SYZA 2CGKA 4BVPA 5JVHL 3VEXA 2P5OA 4CJSA 1SUQA 4CFCA 4FVMA 1GOBA 1ZBFA 4G9ZA 1LCUA 1HNZK 3SZ2A 4FXDA 3CCEN 2B4JA 4F8RA 3SBGA 1EWRA 2HBLA 2P9LB 3D2FB 5AQSA 1SKSA 3O3HA 3MN9A 1WNSA 1C1BA 3HRGA 4CZEA 3LWMA 4DQPA 3BGRA 4WE1A 3QFPA 1HPMA 2HSTA 2VWBA 3OJUA 5BRHA 3J7AP 1RT4A 3VA0A 1VK0A 4J2DA 3RMAA 3TSPA 4ICLA 4OPHA 4EP5A 3ITHA 3QICA 4XEIA 1K9MO 4FWQA 2ATQA 3B8AX 1EXQA 4O0JA 1Q9YA 1JLFA 1W9HA 3M3ZA 3J81O 3DXMB 1RFQA 3OYKA 2NRWA 3NF9A 4YDUC 3ASMA 3THYA 4BACA 4DSLA 4DU1A 2YNHA 2OZSA 4DTRA 1GOAA 2VGNA 2DTUA 3M8PA 4I9LA 4B9QA 2YNFA 3DLRA 5BREA 4AQYK 1M1KO 3O9SA 1KRPA 4NO7A 1T44A 2VQEK 3KK3A 4YOTA 1NNEA 1BDGA 3RR7A 2VWJA 1ZC6A 3P5JA 1QVGM 4B9LA 4FZYA 4LH4A 3C6AA 4KAZA 4CJRA 3AVKA 4KI4A 2KKZA 4HTUA 3VQDA 1BGXT 5CZ2A 1U48A 1OH6A 3GDQA 3PY8A 1WBBA 4PL8A 4O8UA 1EQYA 4BRMA 2O8BA 4O55A 2OPQA 4OPKA 1NKCA 1S1TA 2P9PB 3VGKA 5IWAK 1Q8IA 1RT5A 3P1GA 3DRPA 3J7YP 3SI6A 1N33K 1HR0K 1RTJA 1ESVA 3CJAA 4GVMA 3BZCA 4CZGA 2QWRA 5BPNA 3ULDA 2Z1IA 4BGAA 3RMBA 2YCHA 4F4KA 2F4VK 4F2SA 3ATUA 3ZT4A 3PLAA 3HVTA 4AHVA 4DUYK 4AHCA 4OPJA 4O5BA 1FKPA 1JLBA 3LP3A 2QKBA 5AQNA 1HQUA 3JXUA 2D5RA 2YI1A 4DR6K 2QWLA 1UOCA 2Q0RA 3SAFA 1DGKN 4Z4IA 3BEXA 5EX5A 2FBXA 1K73O 3SCXA 4DSFA 4B1WB 1IO2A 4H5RA 4FZZA 4CGIA 1X9SA 3SMSA 2IAJA 1NBWA 2PAVA 3QEVA 2PZSA 1IKVA 4CZHA 5DM6L 1E3MA 2VG5A 1Q81O 3VQ8A 4MDAA 1JLEA 2Q1NA 4BE1A 4CEFA 1TV6A 3BP8A 5HRRA 3FGUA 2QEXN 1JLCA 1FW6A 3FFKB 3P38A 3LPUA 3CI5A 1YJWN 1KFSA 5KRSA 5JVGL 4F3OA 3AVLA 4CEZA 4FOIA 3AVCA 3LP2A 1IKWA 1L3SA 4CEOA 2AP1A 5F0XA 3U6FA 2CGJA 4C8MA 4N47A 1KFDA 3MN7A 3E01A 3HI0A 1QSYA 2VCPA 1O13A 3VA3A 2E2PA 5FPMA 4ZHRA 1I39A 2HNZA 3L3UA 4EHTA 3V9ZA 3TTCA 3WXIA 4BR4A 4IXCA 1WSHA 2OPPA 3AA2A 4CF8A 4CJEA 1VQ9N 3F5TA 3PX4A 4K0KK 4C8LA 3HSCA 1TYQA 3V1RA 1X9WA 1OVQA 5HLFA 1TK8A 3FZKA 1BCOA 4IDHA 4AH9A 2ASOA 1KD1O 5AQMA 4UY8O 3VETA 4FLUA 5EXWA 1KLNA 1GLLO 2E2QA 5EY4A 4DKWA 5AZJA 4IO8A 1HKBA 3KLEA 1RDDA 1W2BM 3HPGA 1NK7A 1KCFA 4XH1A 4BVOA 3ZCMA 3L4QA 3A5OC 1EKEA 3PX0A 5FROA 1U6ZA 3O4NA 3HP9A 5KQDA 4GKKK 2Z1HA 3AVMA 3OYAA 3EEQA 3H3OB 3BUZB 1TL3A 2BH1A 5AQLA 1XUPO 4A2AA 3CCLN 5AQIA 3K9JA 1EETA 4QCLA 1XHXA 4BWJA 3DOKA 5HP1A 3C6UA 1HPZA 1T3VA 3OYHA 3N4QA 3HK2A 4OX9K 3LDPA 4BQLA 2FSKA 1ILYA 1ZBSA 3LDLA 2OZMA 2E6MA 1BU6O 5JICA 2FBTA 1GLCG 4IG3A 4DTSA 3VQ7A 4CERA 3O9QA 1JL1A 4FJKA 5BN9A 2X6SA 1N6QA 2WTUA 3O3FA 4J2EA 1QQOA 1JCGA 2A41A 4CJQA 1SQKA 3WT0A 4W5NA 1CXQA 1RGIA 4AF1A 3RRGA 3DLKA 3OYBA 4BREA 3J7ZO 4NYNA 2H3GX 3QIOA 1IG9A 4E0DA 3C0BA 4FWSA 3THYB 2QXLA 4DWIA 2FF6A 4OPAA 5KI6A 4CEEA 2PY5A 4Z4EA 2O8EB 1HJRA 4M7YA 3CJCA 1HJOA 3VERA 4ELTA 3VQ6A 4CGGA 2G8VA 4RCHA 2XHBA 1KAZA 4YOWA 3MCPA 1S1XA 4DS5A 1REVA 3VQBA 4FM0A 3CERA 1K8KB 2P9KA 2NRXA 3HT3A 1YIJN 4BRAA 1LW2A 3C6HA 4KHQA 2Y1IA 3ZYYX 2WC9A 3V9SA 1GLAG 4AM7A 4JEPA 4JI4K 4BRHA 4YY3K 3OS1A 4ISGA 2YNIA 4PY5A 2O4GA 1SZ2A 4Z4CA 3KLGA 5HRPA 4ISFA 3OYNA 4J2BA 4HVJA 1QQNA 3SK3A 1NKBA 1KAYA 1ATSA 3K59A 4LFCK 5AFUA 1CZAN 2J4RA 3FZLA 4FJNA 3O08A 1RDBA 4NYFA 2W40A 4LF4K 5AQPA 1FK9A 3SNNA 3RWUA 3KJVA 4BDPA 2ZF5O 3DI6A 4B3OA 4IOXA 1BWFO 2ASPA 2HMIA 2HB5A 3KKSA 4B1YB 2CGLA 4I7FA 3JAMO 3EY1A 3SV3A 1V4TA 2KZMA 4L3QA 3MX2A 1XNQK 2HBMA 3UKRB 2IOCA 2ZM6K 1MU2A 4FYDA 4J8FA 3MAQA 4C8KA 3A0IX 3H45C 4B9MA 3RMCA 1KSPA 1Q7YO 2E1ZA 4AM6A 3WNHA 3ZETA 1J54A 3KK2A 1Z25A 1QHTA 1NGIA 3C95A 3OBWA 4JYAK 4ZTJA 4FJ8A 3D0PA 2FC0A 1HNXK 3CQ8A 4FM1A 3DLHA 4IFYA 3AO2A 3IG1A 4KBOA 1RTIA 1IKXA 4BRLA 5ADXA 4H4MA 1HNIA 5CHIA 3TSQA 3NGYA 4O0IA 4B1UB 3NGIA 3SUNA 3SPYA 1VSLA 3D2FA 1YVNA 1YTUA 1U04A 3DRSA 4MFBA 3SJHA 4DF4A 1YAGA 1SKRA 1VHXA 4FM2A 5FLXO 2B6AA 4HUEA 1GLFO 1WUAA 2F96A 4WQ5C 4DMNA 4OLAA 4LH5A 3KIOA 3OA9A 3IRXA 2O8CA 3JSMA 2W6KA 4IFEA 4B1ZA 3DLEA 1N34K 3I8DA 2EHGA 3EO3A 5FRNA 3L2RA 3AVIA 4KI6A 3CCSN 3SAGA 5EOYA 4CE9A 4E7IA 4H5TA 4KB0A 2QWNA 1TYQB 4E7JA 4JRPA 1S9GA 4CJUA 4DQQA 1N36K 1ASUA 1IBKK 5CYQA 2HF3A 4DTXA 3MWPA 1NWKA 3ATVA 4CGHA 4JV5K 4IJNA 3P4IA 3ZSYA 4BG8A 2RPIA 1EP4A 4CEDA 3ZETB 4CFBA 3VQ4A 3SQ0A 4NLBA 1NLVA 1RBVA 3P83D 3H08A 5EVZA 1BI4B 4LC9B 3VESA 2ZGZA 3RRHA 4LF5K 4H0VB 3ISNC 2HHQA 3QNNA 5H1SQ 4DTOA 1EWQA 3MEDA 3SLCA 3W3DA 1NOZA 4YORA 2A6AA 4JK7A 4HUFA 4JK9A 2Q3SA 1S1VA 1C0GA 4Y1DA 1S6PA 4E7KA 3PO5A 4FWLA 5SWMA 1OKJA 3RMDA 1XI1A 1BG3A 2O8CB 3EKSA 1X3MA 1KAXA 1QZ6A 4LF7K 4JRQA 3G10A 3EE9A 3OYCA 4IJAA 2IIRA 4QS8A 4DSEA 5HBMA 1Q18A 4H0PA 1BA0A 4BR9A 3QEIA 1WSJA 3GE1A 5JLFA 1TKDA 4Z4GA 3CJ9A 4ILHA 3GOIA 3G6EN 3RVCA 4GV9A 3QETA 5M1NA 4PQUA 3O5BA 3MN6A 3MX5A 4JLHA 2XY5A 2UXCK 3LAMA 1WLJA 4CJKA 3QO9A 3WXKA 4PA1A 5E26A 5BPMA 1XWLA 4EHUA 3FZMA 5AQKA 4Y1CA 4DFKA 3SQ2A 3CCRN 4FLYA 1SAZA 4N76A 3EYZA 5M1PA 3MMVA 2P9KB 2CH6A 3MXJA 4K8ZA 4A5BA 3NVMA 1KVCA 5C15A 4DQSA 5K14A 2GBZA 4DTJA 4BR2A 4DR2K 5AFUH 2LSNA 3U8XA 4HUGA 1KC8O 4N5SA 3O1WA 3DLLL 1C0UA 1HYZA 1NGDA 1P90A 4PKGA 4DSKA 3NFAA 4CD1A 1YITN 1X3NA 4DV4K 4CJPA 1LAWA 3CC4N 3VF2A 3NH2A 3ZT2A 1OH8A 2NRZA 3FR0A 1UA0A 4AHRA 3DWLA 4K41A 3LDSA 1LW0A 1NK4A 2RE2A 2JGUA 3QNOA 2FBVA 2QXFA 2F8SA 3K5MA 4KTWA 3SUPA 4CF1A 3ZEUB 4BY9C 4E7LA 3EKUA 4DV2K 1M90O 5KPRA 5AQUA 2IVOA 2UUBK 2KFZA 2FLOA 3SUQA 1RBTA 4M3TA 5DM7L 4CIGA 2BUPA 4CHPA 4DFMA 3V6DA 4F3TA 1YTAA 1FKOA 2RN2A 4FJLA 1YXQA 2HW3A 3DXKA 3LZJA 2OA8A 5BR9A 3VOVA 3JS6A 2GX9A 4Z4FA 3NF6A 4OLBA 2IS3A 1VQLN 3S3MA 3IMXA 5CZ1A 1WSEA 1C1CA 2JWKA 3QLHA 2FBYA 4KO0A 3FZFA 1XC9A 5GIOA 1IV0A 3MEGA 1F21A 4KKOA 4YNQA 2A42A 3SAHA 1RTHA 2P9PA 3WEEA 3LALA 4O5FA 3GBTA 4BC3A 1IBLK 3CCVN 2KFNA 3A5NC 5F1XA 4WCEL 4DR4K 4YHHK 4IZ9A 2IGIA 4DUZK 4CIFA 4W5QA 4QAGA 4MDBA 3KWIA 3ZSOA 4M3YA 4BRPA 4IOCL 2X6NA 3VEYA 1QSSA 3SMPA 3P31A 2BGGA 1A5XA 3K2PA 2DY4A 2QKKA 2QWQA 3TTFA 4M3WA 2DPNA 3Q7CA 3NMUA 4GNIA 4CZLA 4CFDA 2W41A 4XH5A 1VQ8N 4LY7A 4RWTA 4E1NA 4LF9K 3TAMA 1XHZA 4OJRA 3QB0A 2YJEA 3IKMA 4RW9A 2F9TA 3ZSXA 2VG6A 4FSVA 4DV0K 4B8CA 3T19A 4CZKA 5FDLA 2HHUA 2ASMA 4MLEA 4PL7A 3VGLA 2ZWHA 3MCAB 4CHYA 1NJYA 5F2RA 2FF3B 3AVAA 1NJXA 2P5GA 5BRDA 1FJGK 1L3UA 5HOOA 4XIUA 4DV1K 3WEEB 1K6YA 3ZT3A 4CGJA 4FLXA 1N32K 4HCCA 3T1HK 3CPEA 3HSTB 5LJVA 4DF8A 2JWLA 3LM9A 4DTMA 3KD5E 3HBTA 4FCYA 4EP4A 3LP0A 3QEWA 4ELVA 4RW6A 2GEMA 3O3GA 1GLJO 3TAPA 2NLXA 1MDUB 4RW4A 3CETA 3CPWM 1XMOK 5KGWA 4BRQA 3S9HA 3RSEB 2BDPA 3BF1A 3OW2M 4OVLA 3KTQA 5AQZA 3UKRA 2NRVA 5SZTA 1VSFA 3P39A 4BC5A 3CF5L 4FWMA 4RW7A 5LL6Z 3TAGA 1OH7A 1K8AO 4DTPA 5FRMA 2YKNA 2BE2A 4B1XB 3CHWA 3HPOA 2HVHA 4B3MK 4DR1K 2HHXA 4GY2B 3DYAA 1ATRA 3VEWA 1A5WA 4B9NA 2YJFA 3O80A 4E19A 3CIPA 3H1QA 5AQQA 3KHYA 4CW7B 1UWBA 1R59O 2QW9A 1MWKA 3CMEN 1Y97A 4FJIA 3H6EA 4YOXA 1XQSC 1VQON 2GV9A 3V9WA 4FWOA 3S3OA 4FJ7A 2OTJN 2KQ2A 4FJGA 3QMLA 2ZJQL 1VRUA 5AQWA 5FPNA 2Q36A 4A5AA 4CJFA 2OANA 5C12A 4NCAA 1QZ5A 1WAJA 2P9SB 4YDUA 1NGAA 1QHAA 2WOMA 2D0CA 4CJ5A 5EU7A 4B9SA 4JHDA 3CC2N 3ZX0A 5ADXH 3M8RA 2D4WA 3IS9A 3IAYA 3I0SA 3AVJA 4Y0WA 3ZSZA 3L2VA 4JI7K 5AQJA 4LF8K 3V9UA 4O4GA 4IO9L 4I6MB 1YJNN 1A5VA 2Q2RA 5J2NA 1BL3A 1S9EA 3NBPA 3HYFA 4GV3A 3AARA 1BIUA 4K42A 4BDYA 4K8XA 1GLBG 5JS1A 3QEXA 3OBYA 1O1WA 3A5LC 1MA9B 1BHLA 2WONA 4FPAA 2O8EA 5M1FA 3M1FA 4BGBA 4U7BA 5BRFA 3DM2A 3HPHA 3THXB 1NMDA 4A61A 4F9OA 4WQ4C 1JKHA 1BI4A 3PSIA 1LOTB 4JI3K 3AV9A 3ENOA 1Y64A 3WQTA 4DG1A 2XY8A 1IBMK 3O4WA 1BA1A 1YUWA 1Z26A 4CIEA 3HZ6A 1Q82O 4JI5K 2GUIA 2HMPA 4M45A 1RCHA 4KH4A 4OKEA 3MXIA 3DLBA 1S1UA 4X65K 1DLOA 3PX6A 1RT3A 3VQPA 1TKZA 2P9NB 4WFBL 3SQ1A 1X9JA 2Y1JA 1RT1A 3I8BA 2HHTA 4WYBA 3D7EO 1YHQN 2P9SA 3LDNA 3K58A 4BRFA 1Q86O 5KPZA 2BANA 4KV8A 4JHDB 3T7ZA 4KRFA 3TARA 1LWEA 4FPBA 1OH5A 1WOQA 3KLIA 3ZX3A 3V1QA 1VQ5N 1Z05A 2HBKA 3OYGA 2DFFA 4FJ5A 4ILGB 4LFBK 4BRDA 5GADP 1IG8A 3ZSRA 2D0BA 5GIPA 3E66A 3LDOA 4CZFA 3O8MA 3W0LA 5AR0A 4CHNA 3EN9A 1NKEA 1L3TA 4KHYA 5GAEP 4IDKA 3LAKA 4CJVA 3EL2A 3ENBA 3T1AA 1NG9A 1DTTA 2V52B 2ETJA 4H5NA 3VF6A 4B1VA 4H0YB 4JI1K 5TKWA 3THXA 3O1BA 3WNEA 4U67L 3PUFA 1VQPN 4FWPA 4DLEA 4RW8A 3LWLA 1N8RO 2E2NA 4H0OA 1U49A 1HYVA 3DAWA 1UA1A 3MK6A 4NLCA 1NK6A 3CJBA 4OKJA 3CG7A 4OKKA 4BR0A 3J8AA 4G1QA 2DFHA 4H5VA 2XO7A 3E1YA 1XNRK 2KZZA 4FJJA 1NJIO 5CY4A 2QK9A 2D1KA 3F9KA 3FLCO 2IC3A 1VSEA 4BG9A 4CJLA 3K9KA 5MLCQ 2P9UB 1DT9A 3AVFA 4DV3K 4DLGA 4BRGA 3CFPA 1KLMA 1KVAA 4YOVA 4OGEA 3MEEA 4GMJB 1HX1A 3VEOA 3KLFA 4DQIA 1BOTO 4BE2A 3NVKA 4IFVA 2VQFK 4AHTA 3R9PA 3CFOA 4KTQA 2EWSA 4J2AA 3LP1A 4CESA 1B9FA 2V7YA 4A62A 4DV7K 3AO1A 2E2OA 4FWNA 3VQEA 4M63C 2ZQBA 1LWCA 1RT7A 3CCJN 1JLQA 1RDAA 2G8HA 1X1PA 3SV4A 2GWJA 1CZBA 3HP6A 4DR3K 2WBNA 4LSLA 1W7AA 4FWKA 1E4GT 5J2PA 3B6PA
chains in the Genus database with same CATH topology
3DRRA 4N47A 4C8MA 1KFDA 4E7LA 4E3SA 2IDOA 3OYLA 3E01A 4CK1A 2AJQA 1QSYA 3VA3A 3NF7A 1C6VA 4ZHRA 1RBRA 1I39A 4MQ3A 2HNZA 3HO1A 3L3UA 4FJHA 2KFZA 3V9ZA 4FLVA 4H4OA 3SUQA 5I42A 1WSHA 1RBTA 1BQMA 2OPPA 1CLQA 4M3TA 1LAVA 4W5TA 3AA2A 4M3ZA 2YNGA 4CF8A 3U3YA 4W5OA 4CJEA 2P1JA 4CJWA 4CIGA 3L2WA 3AVHA 4CHPA 4DFMA 3V6DA 3SJJA 2A1RA 4F3TA 1YTAA 1KTQA 3AA3A 3PX4A 1FKOA 2RN2A 4FJLA 1VSIA 4CEAA 2HW3A 4C8LA 1B9DA 4I9QA 1ASWA 3V1RA 5D3GA 3LZJA 1X9WA 2OA8A 5HLFA 1TK8A 1QSLA 2HHSA 1S1WA 4Z4FA 3NF6A 1J9AA 1BCOA 4CF0A 2IS3A 3NCIA 4OLBA 4AH9A 3S3MA 1EX4A 3ZSWA 1VSJA 2F8TA 4HHTA 5CZ1A 1WSEA 2R7YA 3OJSA 4FLUA 1C1CA 3KKRA 2OPRA 3QLHA 3KK1A 2FBYA 4DTUA 1KLNA 1TKXA 4KO0A 2G8KA 3M8SA 1XC9A 2PYLA 1RT2A 4CF2A 3MEGA 3KLEA 1RDDA 4EZ9A 1F21A 4KKOA 4YNQA 3HPGA 4N56A 3V4IA 1NK7A 1KCFA 1RTHA 3U3GA 3NAEA 3VQ5A 3ZCMA 3LALA 3HVRA 1RBUA 3AO4A 3K5NA 4FK4A 1EKEA 1QS4A 4UQGA 3PX0A 2A1SA 5FROA 3O4NA 3HP9A 2Z1HA 1GOCA 3AVMA 2KFNA 3JYTA 3OYAA 2IGIA 1U4BA 4CIFA 5J2QA 4ID1A 1TL3A 2E4LA 4QAGA 5C42A 4W5QA 4CFAA 1LV5A 1J5OA 4IG0A 4DSJA 1HNVA 4DFPA 3ZSOA 3CM6A 3NE6A 3AVGA 4FLWA 1NJZA 4IKFA 4KPYA 1ZBLA 4M3YA 3PO4A 1EETA 2X6NA 4FW2A 1CZ9A 4QCLA 4BE0A 4CK3A 3OY9A 1QQCA 1XHXA 4BWJA 3DOKA 3ZT1A 3ZSQA 4DU4A 3T3FA 1QSSA 1X9MA 2BGGA 5HP1A 1A5XA 3K2PA 3C6UA 1HPZA 3OYHA 3HK2A 2DY4A 2QKKA 4M3WA 3KLHA 1TK0A 4M3RA 2OZMA 2E6MA 3LZIA 3VQAA 2FBTA 4CFDA 4IG3A 4DTSA 3SPZA 3VQ7A 4CERA 4CGFA 2HHVA 1JL1A 3FFIA 4LY7A 4FJKA 4E1NA 4N41A 2X6SA 1N6QA 5J2MA 3TAMA 1XHZA 4OJRA 3O3FA 4YFUA 4J2EA 3TR8A 4RW9A 4AHUA 3ZSXA 5E41A 3OS2A 3OYFA 2VG6A 4CJQA 4W5NA 1CXQA 3AO5A 3RRGA 3DLKA 4O44A 4L8RB 3OYBA 3AA4A 1SV5A 4B8CA 5HRNA 4DU3A 4NYNA 3T19A 3QIOA 1U47A 1IG9A 5FDLA 4CJ4A 4M41A 4E0DA 4LD0A 3V81A 2EX3A 2HHUA 4GW6A 5C24A 4DWIA 1IKYA 3NH0A 5KI6A 4CEEA 3TAFA 1RTDA 2PY5A 4Z4EA 2Z1GA 1HJRA 2ZE2A 3L3VA 3F73A 3QIPA 4NCBA 4CHYA 1NJYA 2D0AA 3ZSVA 4PWDA 3AVAA 1RT6A 4DQRA 1NJXA 2X74A 4W5RA 2P5GA 4M3XA 1VSKA 1L3UA 3I0RA 3VQ6A 4CGGA 4B9TA 4ELTA 1WN7A 4XIUA 2G8VA 1K6YA 3ZT3A 2XHBA 2G8UA 4CGJA 4JS5A 3K5LA 4FLXA 4FJMA 1S1XA 4DS5A 3HM9A 1REVA 3VQBA 4OGCA 4FM0A 4HCCA 3HSTB 4CGDA 4DF8A 2JLEA 4DTMA 1I3AA 3HT3A 3KD5E 4FCYA 1YT3A 4B9VA 2YV0X 1WSFA 1LW2A 4EP4A 3S3NA 4DSIA 4KHQA 3LP0A 2Y1IA 1D8YA 3V9SA 1TGOA 3QEWA 3TAEA 1C0MA 4FLTA 4ELVA 4RW6A 2HNYA 3NH1A 3O3GA 5CYMA 3OS1A 3TAPA 2YNIA 1WSGA 4Z4HA 2O4GA 4PY5A 3A2FA 3OYDA 4Z4CA 1DTQA 3HL8A 4RW4A 4QOZB 3KLGA 1TL1A 2P51A 3LPTA 5HRPA 4ZTFA 3VQCA 1SL0A 3OYNA 4J2BA 1W0HA 3TAQA 2KTQA 4HVJA 1WAFA 1TKTA 4KTZA 5KGWA 1NKBA 2G8FA 3S9HA 4M3UA 4TSXA 3HJFA 3K59A 1BCMA 1JLGA 2BDPA 3TANA 4OVLA 1NK0A 1U45A 4CECA 3PV8A 3KTQA 4FJNA 5SZTA 1VSFA 1HMVA 1RDBA 4NYFA 2DFEA 4RW7A 3TAGA 4DTPA 3RWUA 1FK9A 4I2QA 3SNNA 3KJVA 5FRMA 2YKNA 2ITGA 3WNGA 3HXMA 4BDPA 1N5YA 2BE2A 3DI6A 1ZBHA 3HPOA 2HVHA 5T7BA 1WSIA 4B3OA 5C25A 2HHXA 4JS4A 4DS4A 2HMIA 3DYAA 3NF8A 3C94A 2HB5A 2YKMA 5J1EA 3KKSA 1A5WA 1G15A 2RF2A 4I7FA 4B9NA 2O4IA 1R0AA 4E19A 1RNHA 3EY1A 4DFJA 3SV3A 4E7HA 4KHSA 3OYEA 2XY7A 4Q0BA 4BDZA 1T7PA 2KZMA 3ALYA 4CJ3A 2XY6A 1C0TA 1HQEA 2IOCA 3AO3A 3V9XA 4C8NA 1UWBA 1MU2A 4FYDA 1T05A 1D9DA 1SL2A 1Y97A 3MAQA 4C8KA 4B9MA 3RMCA 4FJIA 1JXEA 3OYJA 4LSNA 1KSPA 4H8KA 4CK2A 1JL2A 3QEPA 1ITGA 3L2QA 3WNHA 2GV9A 1J54A 3KK2A 3V9WA 3M8QA 4DTNA 1Z25A 1QHTA 3S3OA 4FJ7A 1BQNA 2KQ2A 3C95A 3KD1E 4FJGA 3RTVA 1T8EA 3OS0A 1VRUA 1RBSA 2PYJA 1QE1A 2X78A 3O4QA 4ZTJA 4FJ8A 4CJFA 4NCAA 3D0PA 3TI0A 1JXBA 2FC0A 1WAJA 3DLGA 1TAQA 3EZ5A 3CQ8A 4FM1A 3DLHA 4IFYA 3AO2A 3IG1A 3LANA 2WOMA 2D0CA 2E6LA 1RTIA 4CJ5A 3SUOA 1D9FA 5EU7A 1IKXA 4R5PA 4B9SA 4FK2A 4B08A 4H4MA 4F2RA 3CFRA 1HNIA 1TK5A 3NHGA 3M8RA 4C8OA 3L2UA 3NGYA 3OYMA 4KREA 4O0IA 1HRHA 3IS9A 3IAYA 4FK0A 3I0SA 4FZXC 1FXXA 3NGIA 3AVJA 3SUNA 1C1AA 3ZSZA 3MECA 4IBNA 1VSLA 3L2VA 3SPYA 1YTUA 1U04A 3DRSA 3THVA 1ZBIA 4MFBA 3ZT0A 3V9UA 4DF4A 4KHWA 1VSDA 4O4GA 4CJTA 1SKRA 4FM2A 1A5VA 1L5UA 1S5JA 5HRSA 2B6AA 1BL3A 2F96A 4HUEA 3SYZA 5J2NA 1S9EA 3NBPA 4DMNA 4OLAA 2P5OA 3HYFA 1BIUA 4CJSA 4LH5A 4BDYA 3D45A 3KIOA 4K8XA 2RKIA 3IRXA 1SUQA 4FVMA 4CFCA 1GOBA 3JSMA 3DLEA 3QEXA 1ZBFA 5JS1A 4NCGA 3I8DA 3BDPA 2W42A 1O1WA 2EHGA 1BHLA 2WONA 3OYIA 1SKWA 3L2RA 5FRNA 3AVIA 4KI6A 4CHOA 4KHUA 3SZ2A 4CE9A 4FXDA 2B4JA 3DM2A 4E7IA 3HPHA 4F8RA 1SKSA 4KB0A 3O3HA 1WNSA 1C1BA 4E7JA 5KRTA 3LWMA 4JRPA 1S9GA 4CJUA 4DQQA 1NK8A 4DQPA 3BGRA 4B8AB 1JKHA 4WE1A 1BI4A 1ASUA 3AV9A 2XRIA 5CYQA 4DTXA 3OJUA 2B5JA 1J53A 3QERA 4DG1A 2XY8A 3TABA 4CGHA 3CM5A 1RT4A 3VA0A 1VK0A 4J2DA 3RMAA 1Z26A 4CHZA 4ICLA 4CIEA 4EP5A 4FLZA 3ZSYA 3ITHA 3C6TA 2GUIA 1VRTA 4M45A 1QTMA 2RPIA 1RCHA 1EP4A 2ATQA 4OKEA 4CEDA 3MXIA 3V1OA 1ZYQA 1NJWA 3DLBA 1EXQA 1S1UA 4O0JA 4CFBA 3WNFA 1Q9YA 2HNDA 1DLOA 1JLFA 3VQ4A 1W9HA 3SQ0A 3PX6A 1RT3A 3VQPA 1RBVA 4E1MA 1TKZA 3SQ1A 3P83D 3H08A 1RT1A 2Y1JA 1BI4B 1NK9A 1HYSA 2HHTA 4RG8A 3OYKA 3NF9A 3ASMA 3K58A 3RRHA 3DMJA 3ISNC 4BACA 2G8IA 2HHQA 3QNNA 4DSLA 4DTOA 3QESA 2BANA 4AHSA 4KV8A 4DU1A 4KFBA 3MEDA 4CCHA 2YNHA 4KRFA 3TARA 1LWEA 1GOAA 2Z1JA 4DTRA 2OZSA 2DTUA 1NOZA 3M8PA 4I9LA 1T03A 2YNFA 3DLRA 3KLIA 1KRPA 3V1QA 4BWMA 4HUFA 3KK3A 4B9UA 3VN5A 3OYGA 2DFFA 4FJ5A 2Q3SA 4FJXA 1S1VA 4CHQA 1NK5A 3RR7A 2VWJA 5HROA 4Y1DA 1S6PA 4Z0UA 3RR8A 3P5JA 3OVNA 4E7KA 3PO5A 4B9LA 4FZYA 5SWMA 3ZSRA 2D0BA 4LH4A 4AILC 4KB1A 4KAZA 4CJRA 3RMDA 3AVKA 5DK5A 4KI4A 1XI1A 1IH7A 4CHNA 4HTUA 1VSHA 3VQDA 3UIQA 1NKEA 1BGXT 1L3TA 5CZ2A 3L8BA 1U48A 4KHYA 1B92A 3PY8A 3K5OA 4IDKA 1VSMA 3LAKA 4Q5VA 4CJVA 4JRQA 3G10A 3T1AA 1TAUA 1DTTA 3G0ZA 4O55A 4E89A 4FJ9A 2ETJA 2OPQA 4OPKA 3OYCA 3AA5X 1NKCA 4DSEA 1S1TA 2YHAA 5HBMA 1Q8IA 3TWHA 3WNEA 1RT5A 1LWFA 1NOYA 3QINA 3P1GA 3PUFA 3DRPA 3SI6A 3QEIA 4DLEA 1WSJA 1RTJA 4GVMA 4RW8A 5KTQA 3LWLA 4KHNA 1BISA 1TKDA 4Z4GA 1U49A 4HCBA 1HYVA 3NDKA 1UA1A 1NK6A 3ULDA 2Z1IA 4OKJA 3CG7A 3NGZA 3QETA 3RMBA 4OKKA 4G1QA 4F4KA 2DFHA 4PQUA 3VQ9A 4CEBA 2XO7A 2KZZA 4F2SA 3CYMA 4FJJA 1JLAA 4JLHA 3ZT4A 2XY5A 3LAMA 1WLJA 1D5AA 4CJKA 5CY4A 3QO9A 3HVTA 2QK9A 4PA1A 4AHVA 3MXMA 2G8WA 3F9KA 1XWLA 4AHCA 3SQ4A 4OPJA 2IC3A 4O5BA 4Y1CA 1FKPA 4DFKA 4FW1A 4FLYA 1VSEA 4CJLA 3SQ2A 4N76A 2VG7A 3EYZA 1JLBA 3B6OA 3MXJA 3LP3A 3AVFA 4K8ZA 4I2PA 2QKBA 1HQUA 3DOLA 5KGXA 1KVCA 2YHBA 4CF9A 1RDCA 1TVRA 3CFPA 4DLGA 2VWKA 2HVIA 1KLMA 1KVAA 2D5RA 4DQSA 4OGEA 3MEEA 2GBZA 5K14A 1L3VA 4PUOA 4GMJB 1UOCA 3KLFA 5DMRA 4DQIA 3K57A 4BE2A 4DTJA 4IFVA 4Z4IA 4AHTA 2FBXA 3SCXA 4DSFA 1IO2A 4FZZA 2I5JA 4CGIA 2LSNA 5JS2A 1X9SA 4HUGA 4ELUA 4M42A 2HHWA 3CFOA 2IAJA 4N5SA 4KTQA 1SL1A 3AVNA 1C0UA 3QEVA 1HYZA 2PZSA 1IKVA 4J2AA 2NUBA 3LP1A 4DSKA 4ID5A 2ZD1A 3NFAA 4CESA 1B9FA 1Q9XA 2VG5A 3AVBA 2OPSA 3AO1A 3VQ8A 2OYQA 1RILA 1LAWA 1JLEA 3VQEA 1KVBA 4CJPA 4BE1A 1S6QA 1TV6A 2ZQBA 1LWCA 1RT7A 5HRRA 3ZT2A 4CEFA 4CEQA 3NH2A 1ASVA 1JLQA 3VQQA 1RDAA 2G8HA 1UA0A 1JLCA 1X1PA 4AHRA 2KW4A 3LDSA 3SV4A 1LW0A 1CXUA 3LPUA 1NK4A 2JGUA 5I3UA 1KFSA 4EZ6A 5KRSA 3QNOA 2FBVA 4F3OA 3AVLA 1CZBA 1UAXA 1ZBUA 2QXFA 1YVUA 4CEZA 3HP6A 3K5MA 4KTWA 2F8SA 3SUPA 3AVCA 3LP2A 1IKWA 4CF1A 1BIZA 1L3SA 4LSLA 4CEOA 5J2PA 3U6FA 3B6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRR A;  4N47 A;  4C8M A;  1KFD A;  4E7L A;  4E3S A;  2IDO A;  3OYL A;  3E01 A;  4CK1 A;  2AJQ A;  1QSY A;  3VA3 A;  3NF7 A;  1C6V A;  4ZHR A;  1RBR A;  1I39 A;  4MQ3 A;  2HNZ A;  3HO1 A;  3L3U A;  4FJH A;  2KFZ A;  3V9Z A;  4FLV A;  4H4O A;  3SUQ A;  5I42 A;  1WSH A;  1RBT A;  1BQM A;  2OPP A;  1CLQ A;  4M3T A;  1LAV A;  4W5T A;  3AA2 A;  4M3Z A;  2YNG A;  4CF8 A;  3U3Y A;  4W5O A;  4CJE A;  2P1J A;  4CJW A;  4CIG A;  3L2W A;  3AVH A;  4CHP A;  4DFM A;  3V6D A;  3SJJ A;  2A1R A;  4F3T A;  1YTA A;  1KTQ A;  3AA3 A;  3PX4 A;  1FKO A;  2RN2 A;  4FJL A;  1VSI A;  4CEA A;  2HW3 A;  4C8L A;  1B9D A;  4I9Q A;  1ASW A;  3V1R A;  5D3G A;  3LZJ A;  1X9W A;  2OA8 A;  5HLF A;  1TK8 A;  1QSL A;  2HHS A;  1S1W A;  4Z4F A;  3NF6 A;  1J9A A;  1BCO A;  4CF0 A;  2IS3 A;  3NCI A;  4OLB A;  4AH9 A;  3S3M A;  1EX4 A;  3ZSW A;  1VSJ A;  2F8T A;  4HHT A;  5CZ1 A;  1WSE A;  2R7Y A;  3OJS A;  4FLU A;  1C1C A;  3KKR A;  2OPR A;  3QLH A;  3KK1 A;  2FBY A;  4DTU A;  1KLN A;  1TKX A;  4KO0 A;  2G8K A;  3M8S A;  1XC9 A;  2PYL A;  1RT2 A;  4CF2 A;  3MEG A;  3KLE A;  1RDD A;  4EZ9 A;  1F21 A;  4KKO A;  4YNQ A;  3HPG A;  4N56 A;  3V4I A;  1NK7 A;  1KCF A;  1RTH A;  3U3G A;  3NAE A;  3VQ5 A;  3ZCM A;  3LAL A;  3HVR A;  1RBU A;  3AO4 A;  3K5N A;  4FK4 A;  1EKE A;  1QS4 A;  4UQG A;  3PX0 A;  2A1S A;  5FRO A;  3O4N A;  3HP9 A;  2Z1H A;  1GOC A;  3AVM A;  2KFN A;  3JYT A;  3OYA A;  2IGI A;  1U4B A;  4CIF A;  5J2Q A;  4ID1 A;  1TL3 A;  2E4L A;  4QAG A;  5C42 A;  4W5Q A;  4CFA A;  1LV5 A;  1J5O A;  4IG0 A;  4DSJ A;  1HNV A;  4DFP A;  3ZSO A;  3CM6 A;  3NE6 A;  3AVG A;  4FLW A;  1NJZ A;  4IKF A;  4KPY A;  1ZBL A;  4M3Y A;  3PO4 A;  1EET A;  2X6N A;  4FW2 A;  1CZ9 A;  4QCL A;  4BE0 A;  4CK3 A;  3OY9 A;  1QQC A;  1XHX A;  4BWJ A;  3DOK A;  3ZT1 A;  3ZSQ A;  4DU4 A;  3T3F A;  1QSS A;  1X9M A;  2BGG A;  5HP1 A;  1A5X A;  3K2P A;  3C6U A;  1HPZ A;  3OYH A;  3HK2 A;  2DY4 A;  2QKK A;  4M3W A;  3KLH A;  1TK0 A;  4M3R A;  2OZM A;  2E6M A;  3LZI A;  3VQA A;  2FBT A;  4CFD A;  4IG3 A;  4DTS A;  3SPZ A;  3VQ7 A;  4CER A;  4CGF A;  2HHV A;  1JL1 A;  3FFI A;  4LY7 A;  4FJK A;  4E1N A;  4N41 A;  2X6S A;  1N6Q A;  5J2M A;  3TAM A;  1XHZ A;  4OJR A;  3O3F A;  4YFU A;  4J2E A;  3TR8 A;  4RW9 A;  4AHU A;  3ZSX A;  5E41 A;  3OS2 A;  3OYF A;  2VG6 A;  4CJQ A;  4W5N A;  1CXQ A;  3AO5 A;  3RRG A;  3DLK A;  4O44 A;  4L8R B;  3OYB A;  3AA4 A;  1SV5 A;  4B8C A;  5HRN A;  4DU3 A;  4NYN A;  3T19 A;  3QIO A;  1U47 A;  1IG9 A;  5FDL A;  4CJ4 A;  4M41 A;  4E0D A;  4LD0 A;  3V81 A;  2EX3 A;  2HHU A;  4GW6 A;  5C24 A;  4DWI A;  1IKY A;  3NH0 A;  5KI6 A;  4CEE A;  3TAF A;  1RTD A;  2PY5 A;  4Z4E A;  2Z1G A;  1HJR A;  2ZE2 A;  3L3V A;  3F73 A;  3QIP A;  4NCB A;  4CHY A;  1NJY A;  2D0A A;  3ZSV A;  4PWD A;  3AVA A;  1RT6 A;  4DQR A;  1NJX A;  2X74 A;  4W5R A;  2P5G A;  4M3X A;  1VSK A;  1L3U A;  3I0R A;  3VQ6 A;  4CGG A;  4B9T A;  4ELT A;  1WN7 A;  4XIU A;  2G8V A;  1K6Y A;  3ZT3 A;  2XHB A;  2G8U A;  4CGJ A;  4JS5 A;  3K5L A;  4FLX A;  4FJM A;  1S1X A;  4DS5 A;  3HM9 A;  1REV A;  3VQB A;  4OGC A;  4FM0 A;  4HCC A;  3HST B;  4CGD A;  4DF8 A;  2JLE A;  4DTM A;  1I3A A;  3HT3 A;  3KD5 E;  4FCY A;  1YT3 A;  4B9V A;  2YV0 X;  1WSF A;  1LW2 A;  4EP4 A;  3S3N A;  4DSI A;  4KHQ A;  3LP0 A;  2Y1I A;  1D8Y A;  3V9S A;  1TGO A;  3QEW A;  3TAE A;  1C0M A;  4FLT A;  4ELV A;  4RW6 A;  2HNY A;  3NH1 A;  3O3G A;  5CYM A;  3OS1 A;  3TAP A;  2YNI A;  1WSG A;  4Z4H A;  2O4G A;  4PY5 A;  3A2F A;  3OYD A;  4Z4C A;  1DTQ A;  3HL8 A;  4RW4 A;  4QOZ B;  3KLG A;  1TL1 A;  2P51 A;  3LPT A;  5HRP A;  4ZTF A;  3VQC A;  1SL0 A;  3OYN A;  4J2B A;  1W0H A;  3TAQ A;  2KTQ A;  4HVJ A;  1WAF A;  1TKT A;  4KTZ A;  5KGW A;  1NKB A;  2G8F A;  3S9H A;  4M3U A;  4TSX A;  3HJF A;  3K59 A;  1BCM A;  1JLG A;  2BDP A;  3TAN A;  4OVL A;  1NK0 A;  1U45 A;  4CEC A;  3PV8 A;  3KTQ A;  4FJN A;  5SZT A;  1VSF A;  1HMV A;  1RDB A;  4NYF A;  2DFE A;  4RW7 A;  3TAG A;  4DTP A;  3RWU A;  1FK9 A;  4I2Q A;  3SNN A;  3KJV A;  5FRM A;  2YKN A;  2ITG A;  3WNG A;  3HXM A;  4BDP A;  1N5Y A;  2BE2 A;  3DI6 A;  1ZBH A;  3HPO A;  2HVH A;  5T7B A;  1WSI A;  4B3O A;  5C25 A;  2HHX A;  4JS4 A;  4DS4 A;  2HMI A;  3DYA A;  3NF8 A;  3C94 A;  2HB5 A;  2YKM A;  5J1E A;  3KKS A;  1A5W A;  1G15 A;  2RF2 A;  4I7F A;  4B9N A;  2O4I A;  1R0A A;  4E19 A;  1RNH A;  3EY1 A;  4DFJ A;  3SV3 A;  4E7H A;  4KHS A;  3OYE A;  2XY7 A;  4Q0B A;  4BDZ A;  1T7P A;  2KZM A;  3ALY A;  4CJ3 A;  2XY6 A;  1C0T A;  1HQE A;  2IOC A;  3AO3 A;  3V9X A;  4C8N A;  1UWB A;  1MU2 A;  4FYD A;  1T05 A;  1D9D A;  1SL2 A;  1Y97 A;  3MAQ A;  4C8K A;  4B9M A;  3RMC A;  4FJI A;  1JXE A;  3OYJ A;  4LSN A;  1KSP A;  4H8K A;  4CK2 A;  1JL2 A;  3QEP A;  1ITG A;  3L2Q A;  3WNH A;  2GV9 A;  1J54 A;  3KK2 A;  3V9W A;  3M8Q A;  4DTN A;  1Z25 A;  1QHT A;  3S3O A;  4FJ7 A;  1BQN A;  2KQ2 A;  3C95 A;  3KD1 E;  4FJG A;  3RTV A;  1T8E A;  3OS0 A;  1VRU A;  1RBS A;  2PYJ A;  1QE1 A;  2X78 A;  3O4Q A;  4ZTJ A;  4FJ8 A;  4CJF A;  4NCA A;  3D0P A;  3TI0 A;  1JXB A;  2FC0 A;  1WAJ A;  3DLG A;  1TAQ A;  3EZ5 A;  3CQ8 A;  4FM1 A;  3DLH A;  4IFY A;  3AO2 A;  3IG1 A;  3LAN A;  2WOM A;  2D0C A;  2E6L A;  1RTI A;  4CJ5 A;  3SUO A;  1D9F A;  5EU7 A;  1IKX A;  4R5P A;  4B9S A;  4FK2 A;  4B08 A;  4H4M A;  4F2R A;  3CFR A;  1HNI A;  1TK5 A;  3NHG A;  3M8R A;  4C8O A;  3L2U A;  3NGY A;  3OYM A;  4KRE A;  4O0I A;  1HRH A;  3IS9 A;  3IAY A;  4FK0 A;  3I0S A;  4FZX C;  1FXX A;  3NGI A;  3AVJ A;  3SUN A;  1C1A A;  3ZSZ A;  3MEC A;  4IBN A;  1VSL A;  3L2V A;  3SPY A;  1YTU A;  1U04 A;  3DRS A;  3THV A;  1ZBI A;  4MFB A;  3ZT0 A;  3V9U A;  4DF4 A;  4KHW A;  1VSD A;  4O4G A;  4CJT A;  1SKR A;  4FM2 A;  1A5V A;  1L5U A;  1S5J A;  5HRS A;  2B6A A;  1BL3 A;  2F96 A;  4HUE A;  3SYZ A;  5J2N A;  1S9E A;  3NBP A;  4DMN A;  4OLA A;  2P5O A;  3HYF A;  1BIU A;  4CJS A;  4LH5 A;  4BDY A;  3D45 A;  3KIO A;  4K8X A;  2RKI A;  3IRX A;  1SUQ A;  4FVM A;  4CFC A;  1GOB A;  3JSM A;  3DLE A;  3QEX A;  1ZBF A;  5JS1 A;  4NCG A;  3I8D A;  3BDP A;  2W42 A;  1O1W A;  2EHG A;  1BHL A;  2WON A;  3OYI A;  1SKW A;  3L2R A;  5FRN A;  3AVI A;  4KI6 A;  4CHO A;  4KHU A;  3SZ2 A;  4CE9 A;  4FXD A;  2B4J A;  3DM2 A;  4E7I A;  3HPH A;  4F8R A;  1SKS A;  4KB0 A;  3O3H A;  1WNS A;  1C1B A;  4E7J A;  5KRT A;  3LWM A;  4JRP A;  1S9G A;  4CJU A;  4DQQ A;  1NK8 A;  4DQP A;  3BGR A;  4B8A B;  1JKH A;  4WE1 A;  1BI4 A;  1ASU A;  3AV9 A;  2XRI A;  5CYQ A;  4DTX A;  3OJU A;  2B5J A;  1J53 A;  3QER A;  4DG1 A;  2XY8 A;  3TAB A;  4CGH A;  3CM5 A;  1RT4 A;  3VA0 A;  1VK0 A;  4J2D A;  3RMA A;  1Z26 A;  4CHZ A;  4ICL A;  4CIE A;  4EP5 A;  4FLZ A;  3ZSY A;  3ITH A;  3C6T A;  2GUI A;  1VRT A;  4M45 A;  1QTM A;  2RPI A;  1RCH A;  1EP4 A;  2ATQ A;  4OKE A;  4CED A;  3MXI A;  3V1O A;  1ZYQ A;  1NJW A;  3DLB A;  1EXQ A;  1S1U A;  4O0J A;  4CFB A;  3WNF A;  1Q9Y A;  2HND A;  1DLO A;  1JLF A;  3VQ4 A;  1W9H A;  3SQ0 A;  3PX6 A;  1RT3 A;  3VQP A;  1RBV A;  4E1M A;  1TKZ A;  3SQ1 A;  3P83 D;  3H08 A;  1RT1 A;  2Y1J A;  1BI4 B;  1NK9 A;  1HYS A;  2HHT A;  4RG8 A;  3OYK A;  3NF9 A;  3ASM A;  3K58 A;  3RRH A;  3DMJ A;  3ISN C;  4BAC A;  2G8I A;  2HHQ A;  3QNN A;  4DSL A;  4DTO A;  3QES A;  2BAN A;  4AHS A;  4KV8 A;  4DU1 A;  4KFB A;  3MED A;  4CCH A;  2YNH A;  4KRF A;  3TAR A;  1LWE A;  1GOA A;  2Z1J A;  4DTR A;  2OZS A;  2DTU A;  1NOZ A;  3M8P A;  4I9L A;  1T03 A;  2YNF A;  3DLR A;  3KLI A;  1KRP A;  3V1Q A;  4BWM A;  4HUF A;  3KK3 A;  4B9U A;  3VN5 A;  3OYG A;  2DFF A;  4FJ5 A;  2Q3S A;  4FJX A;  1S1V A;  4CHQ A;  1NK5 A;  3RR7 A;  2VWJ A;  5HRO A;  4Y1D A;  1S6P A;  4Z0U A;  3RR8 A;  3P5J A;  3OVN A;  4E7K A;  3PO5 A;  4B9L A;  4FZY A;  5SWM A;  3ZSR A;  2D0B A;  4LH4 A;  4AIL C;  4KB1 A;  4KAZ A;  4CJR A;  3RMD A;  3AVK A;  5DK5 A;  4KI4 A;  1XI1 A;  1IH7 A;  4CHN A;  4HTU A;  1VSH A;  3VQD A;  3UIQ A;  1NKE A;  1BGX T;  1L3T A;  5CZ2 A;  3L8B A;  1U48 A;  4KHY A;  1B92 A;  3PY8 A;  3K5O A;  4IDK A;  1VSM A;  3LAK A;  4Q5V A;  4CJV A;  4JRQ A;  3G10 A;  3T1A A;  1TAU A;  1DTT A;  3G0Z A;  4O55 A;  4E89 A;  4FJ9 A;  2ETJ A;  2OPQ A;  4OPK A;  3OYC A;  3AA5 X;  1NKC A;  4DSE A;  1S1T A;  2YHA A;  5HBM A;  1Q8I A;  3TWH A;  3WNE A;  1RT5 A;  1LWF A;  1NOY A;  3QIN A;  3P1G A;  3PUF A;  3DRP A;  3SI6 A;  3QEI A;  4DLE A;  1WSJ A;  1RTJ A;  4GVM A;  4RW8 A;  5KTQ A;  3LWL A;  4KHN A;  1BIS A;  1TKD A;  4Z4G A;  1U49 A;  4HCB A;  1HYV A;  3NDK A;  1UA1 A;  1NK6 A;  3ULD A;  2Z1I A;  4OKJ A;  3CG7 A;  3NGZ A;  3QET A;  3RMB A;  4OKK A;  4G1Q A;  4F4K A;  2DFH A;  4PQU A;  3VQ9 A;  4CEB A;  2XO7 A;  2KZZ A;  4F2S A;  3CYM A;  4FJJ A;  1JLA A;  4JLH A;  3ZT4 A;  2XY5 A;  3LAM A;  1WLJ A;  1D5A A;  4CJK A;  5CY4 A;  3QO9 A;  3HVT A;  2QK9 A;  4PA1 A;  4AHV A;  3MXM A;  2G8W A;  3F9K A;  1XWL A;  4AHC A;  3SQ4 A;  4OPJ A;  2IC3 A;  4O5B A;  4Y1C A;  1FKP A;  4DFK A;  4FW1 A;  4FLY A;  1VSE A;  4CJL A;  3SQ2 A;  4N76 A;  2VG7 A;  3EYZ A;  1JLB A;  3B6O A;  3MXJ A;  3LP3 A;  3AVF A;  4K8Z A;  4I2P A;  2QKB A;  1HQU A;  3DOL A;  5KGX A;  1KVC A;  2YHB A;  4CF9 A;  1RDC A;  1TVR A;  3CFP A;  4DLG A;  2VWK A;  2HVI A;  1KLM A;  1KVA A;  2D5R A;  4DQS A;  4OGE A;  3MEE A;  2GBZ A;  5K14 A;  1L3V A;  4PUO A;  4GMJ B;  1UOC A;  3KLF A;  5DMR A;  4DQI A;  3K57 A;  4BE2 A;  4DTJ A;  4IFV A;  4Z4I A;  4AHT A;  2FBX A;  3SCX A;  4DSF A;  1IO2 A;  4FZZ A;  2I5J A;  4CGI A;  2LSN A;  5JS2 A;  1X9S A;  4HUG A;  4ELU A;  4M42 A;  2HHW A;  3CFO A;  2IAJ A;  4N5S A;  4KTQ A;  1SL1 A;  3AVN A;  1C0U A;  3QEV A;  1HYZ A;  2PZS A;  1IKV A;  4J2A A;  2NUB A;  3LP1 A;  4DSK A;  4ID5 A;  2ZD1 A;  3NFA A;  4CES A;  1B9F A;  1Q9X A;  2VG5 A;  3AVB A;  2OPS A;  3AO1 A;  3VQ8 A;  2OYQ A;  1RIL A;  1LAW A;  1JLE A;  3VQE A;  1KVB A;  4CJP A;  4BE1 A;  1S6Q A;  1TV6 A;  2ZQB A;  1LWC A;  1RT7 A;  5HRR A;  3ZT2 A;  4CEF A;  4CEQ A;  3NH2 A;  1ASV A;  1JLQ A;  3VQQ A;  1RDA A;  2G8H A;  1UA0 A;  1JLC A;  1X1P A;  4AHR A;  2KW4 A;  3LDS A;  3SV4 A;  1LW0 A;  1CXU A;  3LPU A;  1NK4 A;  2JGU A;  5I3U A;  1KFS A;  4EZ6 A;  5KRS A;  3QNO A;  2FBV A;  4F3O A;  3AVL A;  1CZB A;  1UAX A;  1ZBU A;  2QXF A;  1YVU A;  4CEZ A;  3HP6 A;  3K5M A;  4KTW A;  2F8S A;  3SUP A;  3AVC A;  3LP2 A;  1IKW A;  4CF1 A;  1BIZ A;  1L3S A;  4LSL A;  4CEO A;  5J2P A;  3U6F A;  3B6P A; 
#chains in the Genus database with same CATH topology
 4PKH A;  3AGK A;  4JI0 K;  4CK1 A;  3ENH A;  3NF7 A;  3CXC M;  1C6V A;  1RBR A;  5BPL A;  4IEE A;  1BQM A;  1RDU A;  1LAV A;  4W5T A;  1KXP A;  4W5O A;  4HWI A;  2P1J A;  3QFU A;  2A1R A;  3AA3 A;  3AY9 A;  4CZI A;  3CQY A;  1B9D A;  2VYP A;  2IVP A;  2YX6 A;  4OO1 J;  1S1W A;  4DCH A;  5LY3 A;  4CF0 A;  2P9U A;  4JKH A;  3NCI A;  1EX4 A;  3ZSW A;  1VSJ A;  3WXM B;  2F8T A;  2QWP A;  4H0T B;  2R7Y A;  2AA4 A;  3OJS A;  3KK1 A;  3H1V X;  1G99 A;  4BRK A;  3M8S A;  5ELZ A;  4YOU A;  1NGJ A;  3CCM N;  1RT2 A;  1RDW X;  5IT9 O;  3VEV A;  3E9P A;  4YOY A;  3U3G A;  4I6M A;  3VQ5 A;  3HVR A;  4EAH D;  1RBU A;  3AO4 A;  3K5N A;  4FK4 A;  2HF4 A;  4EFH A;  3WXL A;  4JN4 A;  3SBT A;  3JYT A;  3WQU A;  2PBD A;  4BR7 A;  5J2Q A;  3VGM A;  5C42 A;  1U4B A;  2D0O A;  2E4L A;  4QS9 A;  1LV5 A;  4IG0 A;  4DSJ A;  4DFP A;  1NJZ A;  4IKF A;  3NE6 A;  4KPY A;  1ZBL A;  3O6W A;  4FW2 A;  1CZ9 A;  4BE0 A;  4NB4 A;  4JNE A;  3ZT1 A;  3ZSQ A;  3T3F A;  4A2B A;  4FO0 A;  1X9M A;  4MO5 A;  3UB5 A;  1W97 L;  4HTL A;  3KLH A;  4M3R A;  3G4S N;  3VQA A;  3SPZ A;  4CGF A;  2HHV A;  3TSU A;  4C23 A;  4N41 A;  4JAX A;  4CBX A;  5J2M A;  2O8D A;  4B3T K;  5E41 A;  3BF3 A;  3OYF A;  4JK8 A;  1J5E K;  5LMU K;  5HL7 L;  4O44 A;  4L8R B;  3AA4 A;  1SV5 A;  4DU3 A;  4CJ4 A;  4LD0 A;  2EX3 A;  1NU0 A;  3EZW A;  3TAF A;  1RTD A;  4GVE A;  2ZE2 A;  3L3V A;  3F73 A;  5JMV A;  3ZSV A;  4JKD A;  2A3Z A;  1RT6 A;  3KK7 A;  2P9L A;  2X74 A;  2ITM A;  4W5R A;  4FL9 A;  3I0R A;  1SS6 A;  1WN7 A;  3IUC A;  3MN5 A;  3ZEU A;  3BY5 A;  4JS5 A;  2D0P A;  3K5L A;  4FJM A;  1NGB A;  3RSE A;  5JLH A;  3HM9 A;  4Z94 A;  4DR5 K;  4CGD A;  3S41 A;  2JLE A;  5BR8 K;  4B9V A;  2BTF A;  4B3S K;  4DSI A;  2ZGY A;  4DV6 K;  1TGO A;  3IDH A;  1C0M A;  4FLT A;  2HNY A;  3NH1 A;  3I55 N;  1J6Z A;  4JKB A;  4Z4H A;  1WSG A;  1XC3 A;  3OYD A;  1DTQ A;  3HL8 A;  1SL0 A;  4EIA A;  3G25 A;  1W0H A;  4LFA K;  1WAF A;  3DXK B;  3G71 N;  2G8F A;  4M3U A;  1Z6R A;  3HJF A;  1BCM A;  1JLG A;  3TAN A;  3OHR A;  4CEC A;  3PV8 A;  3D6R A;  4V19 S;  1NGE A;  5KPT A;  1VQ4 N;  1HMV A;  3IFR A;  2QM1 A;  4I2Q A;  5B8H A;  1N5Y A;  1ZBH A;  4X64 K;  1DEJ A;  2OCE A;  2O8D B;  1VQM N;  3NF8 A;  4GKJ K;  2I7N A;  2O4I A;  1R0A A;  1RNH A;  4DFJ A;  3C65 A;  3GG4 A;  2XY7 A;  3ALY A;  4CJ3 A;  5AJ3 K;  5FPD A;  2XY6 A;  1C0T A;  1HKG A;  3V9X A;  2OTL N;  1T05 A;  1D9D A;  3FE1 A;  3CD6 N;  4XH4 A;  1JXE A;  5LMN K;  4LSN A;  5M1O A;  1HKC A;  1HUX A;  2O8B B;  5A2Q O;  3I56 N;  4DTN A;  1S3X A;  1BQN A;  2HOE A;  5C2F A;  3HOS A;  3I33 A;  3RTV A;  3OS0 A;  2YHW A;  2GUP A;  1RBS A;  1QE1 A;  2X78 A;  3O4Q A;  3TI0 A;  3DLG A;  4CBW A;  3EZ5 A;  4JKC A;  1D9F A;  2E6L A;  4QOZ B;  3ULE B;  4R5P A;  4FK2 A;  1NMN A;  2O8F A;  3NHG A;  4C8O A;  3K0S A;  3L2U A;  3F9M A;  3OYM A;  1HRH A;  3DJC A;  5GIN A;  1FXX A;  1C1A A;  4IBN A;  5FPE A;  3THV A;  4BRN A;  4CJT A;  3M5R A;  3E9O A;  4K43 A;  1L5U A;  5HRS A;  5AQY A;  1U2V A;  3CJ7 A;  1JJ2 M;  4H5W A;  3D45 A;  1TUU A;  2RKI A;  5C0Y A;  3KVG A;  4JKA A;  4DQ8 A;  4NCG A;  3BDP A;  2W42 A;  3L4I A;  2E8A A;  1SKW A;  4KH6 A;  3OYI A;  2QWM A;  4CHO A;  4KHU A;  1GLD G;  5AQH A;  5KRT A;  2P9N A;  4A57 A;  1NK8 A;  4EZ9 A;  1DKG D;  1V4S A;  4B8A B;  2FXU A;  5LJW A;  2E88 A;  2XRI A;  1NGG A;  2IVN A;  2B5J A;  1J53 A;  4JI6 K;  3QER A;  3TAB A;  3CM5 A;  1VAZ A;  4CHZ A;  4FLZ A;  3C6T A;  1VRT A;  3THW A;  1QTM A;  4BRI A;  3C7N A;  1NJW A;  2QWO A;  3KWG A;  3V1O A;  1ZYQ A;  3WNF A;  2HND A;  3L0Q A;  2UYT A;  2ZJP L;  4FVU A;  4E1M A;  3T1Y K;  1NK9 A;  2NRR A;  3O9U A;  1HYS A;  4RG8 A;  1VQK N;  3DMJ A;  2G8I A;  3QES A;  3ULE A;  4AHS A;  4K25 A;  4KFB A;  5AQO A;  4CCH A;  2RHK A;  2Z1J A;  5AQT A;  3TPQ A;  1T03 A;  4BWM A;  4B9U A;  3VN5 A;  1YJ9 N;  4FJX A;  4CHQ A;  5AQR A;  1NK5 A;  3H3N O;  2QTD A;  5HRO A;  4CVN E;  4Z0U A;  3RR8 A;  3OVN A;  3LM2 A;  4AIL C;  4KB1 A;  1S72 N;  4FOE A;  5DK5 A;  1IH7 A;  2UXD K;  3A8Y A;  3UKU A;  1VSH A;  3UIQ A;  4C1N K;  4FWR A;  4H0X B;  3L8B A;  5BN8 A;  1B92 A;  1VQ6 N;  3LDQ A;  3K5O A;  1VSM A;  4Q5V A;  1TAU A;  3G0Z A;  4FJ9 A;  4E89 A;  3PIP L;  3AA5 X;  2YHA A;  4DV5 K;  3TWH A;  1NOY A;  1LWF A;  4DHY A;  3QIN A;  4WQ4 A;  5KTQ A;  4KHN A;  1BIS A;  1S22 A;  4CJ7 A;  4HCB A;  4WQ5 A;  2QI2 A;  3R6M A;  3NDK A;  4BRO A;  3OTO K;  3U9D A;  3NGZ A;  5AQG A;  1ATN A;  2E5L K;  3C7N B;  3VQ9 A;  4CEB A;  2P9I B;  3CYM A;  1JLA A;  2A40 A;  2NNW A;  1D5A A;  3ZX2 A;  3CCQ N;  4WFA L;  3Q7B A;  3UE5 A;  3MXM A;  4A59 A;  2G8W A;  3SQ4 A;  3H46 O;  4FW1 A;  2VG7 A;  3B6O A;  4I2P A;  3DOL A;  5KGX A;  2YHB A;  1TUY A;  1RDC A;  1TVR A;  4CF9 A;  2VWK A;  2HVI A;  3HM8 A;  2NZT A;  1NM1 A;  5AQV A;  5M1Q A;  4PUO A;  1L3V A;  5DMR A;  3K57 A;  2A5X A;  2UXB K;  2I5J A;  4ELU A;  1JCE A;  5JS2 A;  4M42 A;  1IJJ A;  3ID6 A;  2HHW A;  4CZJ A;  1GLE G;  3AVN A;  1SL1 A;  2NUB A;  3O9T A;  3LL3 A;  4ID5 A;  4BR5 A;  2ZD1 A;  1Q9X A;  3AVB A;  4M7X A;  2OPS A;  5AZI B;  3VEZ A;  4JI2 K;  2OYQ A;  1RIL A;  1KVB A;  4NXM K;  2E20 A;  1S6Q A;  4CEQ A;  3M6G A;  3UKU B;  4BQZ A;  1ASV A;  3VQQ A;  2KW4 A;  1P8Z A;  1CXU A;  2F7T A;  4JKG A;  5I3U A;  4EZ6 A;  1NGF A;  1UAX A;  1ZBU A;  1YVU A;  2YHY A;  1T6D A;  4CBU A;  5C10 A;  1BIZ A;  3GL1 A;  3DRR A;  4E3S A;  2GTD A;  4JKE A;  2IDO A;  3OYL A;  2AJQ A;  1K8K A;  4DB3 A;  4ILJ A;  4KHP K;  4MQ3 A;  3HO1 A;  4FJH A;  3R1X A;  4FLV A;  1WBD A;  4H4O A;  5I42 A;  5C2D A;  1CLQ A;  3J80 O;  4M3Z A;  2YNG A;  3U3Y A;  4CJW A;  3SJJ A;  3L2W A;  2P9I A;  3AVH A;  5TKY A;  1KTQ A;  1VSI A;  4CEA A;  1YI2 N;  4CI6 A;  4I9Q A;  1ASW A;  5D3G A;  5M1K A;  2KLA A;  2WFB A;  1QSL A;  2HHS A;  1J9A A;  4X62 K;  3CCU N;  1OVY A;  4E1J A;  4CD3 A;  4CZM A;  3AAQ A;  4HHT A;  3KKR A;  2O8F B;  5CE3 A;  4R79 A;  2OPR A;  3CJ1 A;  4DTU A;  1TKX A;  2G8K A;  2Q0U A;  3CMA N;  3R8E A;  4BC2 A;  2PYL A;  2HBJ A;  4CF2 A;  4H03 B;  1KQS M;  1I94 K;  2GEL A;  4N56 A;  3EE8 A;  3V4I A;  2V7Z A;  3NAE A;  2UUA K;  4GV6 A;  1MWM A;  1QS4 A;  4UQG A;  2A1S A;  5AZI A;  2F9W A;  1GOC A;  2E1Y A;  3L6Q A;  4MO4 A;  4ID1 A;  4CFA A;  1J5O A;  1HNV A;  5I9E B;  3CM6 A;  3AVG A;  4FLW A;  3MDQ A;  3PO4 A;  2KHO A;  2I7P A;  4JKG B;  4CK3 A;  4C1N I;  1QQC A;  3OY9 A;  4DU4 A;  4NXN K;  3CC7 N;  4PHT X;  3AGR A;  1QVF M;  4JKF A;  1TK0 A;  3U4L A;  4RTF D;  1HLU A;  3LZI A;  1WB9 A;  4BRC A;  4IOA L;  1NGH A;  3FFI A;  3ID8 A;  3U9Z A;  4DR7 K;  3THW B;  4YFU A;  3TR8 A;  4X66 K;  4AHU A;  3OS2 A;  4B3R K;  3AO5 A;  4IEI A;  1NGC A;  3AAP A;  5HRN A;  1D4X A;  3PIO L;  3KZB A;  1U47 A;  4M41 A;  5AQX A;  3V81 A;  4GW6 A;  5C24 A;  5CR4 A;  1IKY A;  5GAH P;  3NH0 A;  2W6L A;  3D2E A;  4PKI A;  2Z1G A;  1E4F T;  3QIP A;  4NCB A;  2D0A A;  2V51 B;  4PWD A;  4DQR A;  3VTH A;  3R3L A;  2FSJ A;  2Q31 A;  4M3X A;  1VSK A;  2GWK A;  4ISE A;  2HHH K;  4B9T A;  3QDK A;  2G8U A;  4KH5 A;  4OGC A;  1EO1 A;  1I3A A;  1VQN N;  1YT3 A;  2YV0 X;  1WSF A;  3S3N A;  1D8Y A;  3F2K A;  3VF4 A;  3TAE A;  5GAG P;  1C0F A;  3WXJ A;  5CYM A;  3BZK A;  3A2F A;  3TTD A;  1ZXO A;  3QBX A;  1TL1 A;  4JD2 B;  2P51 A;  3LPT A;  4ZTF A;  3VQC A;  2NRH A;  1XMQ K;  3TAQ A;  3T69 A;  2KTQ A;  3FZH A;  2YHX A;  1TKT A;  4KTZ A;  3VPZ A;  3E9L A;  4TSX A;  1NK0 A;  1U45 A;  4MLH A;  2CH5 A;  1QQM A;  3QBW A;  3VTI A;  1T6C A;  2UUC K;  2DFE A;  4BC4 A;  2VGM A;  4JI8 K;  3WNG A;  2ITG A;  3O9R A;  3HXM A;  5T7B A;  1WSI A;  5C25 A;  2UU9 K;  4JS4 A;  4DS4 A;  3C94 A;  2YKM A;  5J1E A;  3HOT A;  3A5M C;  2RF2 A;  1G15 A;  3CQX A;  4E7H A;  4KHS A;  3OYE A;  3HTV A;  4Q0B A;  4BDZ A;  1T7P A;  4WF9 L;  1HQE A;  1YF5 L;  3AO3 A;  4C8N A;  1JCF A;  1SL2 A;  3D2E B;  3PSF A;  4WFN L;  2ZJR L;  3OYJ A;  2FSN A;  3TU5 A;  4H8K A;  4CK2 A;  1JL2 A;  3QEP A;  1ITG A;  3L2Q A;  3M8Q A;  2PFU A;  4IWV A;  3WUH A;  4LF6 K;  5AQF A;  3KD1 E;  4QS7 A;  1T8E A;  3N4P A;  3DXM A;  3VMF B;  2PYJ A;  1BUP A;  1U2V B;  5KQ8 A;  2WUS A;  1JXB A;  1HNW K;  3ZLJ A;  1TAQ A;  3LAN A;  3SUO A;  3MWT A;  4B08 A;  4F2R A;  1VQ7 N;  3CFR A;  1BO5 O;  1TK5 A;  4O8K A;  2QA4 N;  3VEN A;  4KRE A;  4FK0 A;  4FZX C;  1H1V A;  5AZJ B;  3MEC A;  5E84 A;  4JD2 A;  1ZBI A;  3ZT0 A;  2NRT A;  4KHW A;  1VSD A;  2Q97 A;  1S5J A;  3SYZ A;  2CGK A;  4BVP A;  5JVH L;  3VEX A;  2P5O A;  4CJS A;  1SUQ A;  4CFC A;  4FVM A;  1GOB A;  1ZBF A;  4G9Z A;  1LCU A;  1HNZ K;  3SZ2 A;  4FXD A;  3CCE N;  2B4J A;  4F8R A;  3SBG A;  1EWR A;  2HBL A;  2P9L B;  3D2F B;  5AQS A;  1SKS A;  3O3H A;  3MN9 A;  1WNS A;  1C1B A;  3HRG A;  4CZE A;  3LWM A;  4DQP A;  3BGR A;  4WE1 A;  3QFP A;  1HPM A;  2HST A;  2VWB A;  3OJU A;  5BRH A;  3J7A P;  1RT4 A;  3VA0 A;  1VK0 A;  4J2D A;  3RMA A;  3TSP A;  4ICL A;  4OPH A;  4EP5 A;  3ITH A;  3QIC A;  4XEI A;  1K9M O;  4FWQ A;  2ATQ A;  3B8A X;  1EXQ A;  4O0J A;  1Q9Y A;  1JLF A;  1W9H A;  3M3Z A;  3J81 O;  3DXM B;  1RFQ A;  3OYK A;  2NRW A;  3NF9 A;  4YDU C;  3ASM A;  3THY A;  4BAC A;  4DSL A;  4DU1 A;  2YNH A;  2OZS A;  4DTR A;  1GOA A;  2VGN A;  2DTU A;  3M8P A;  4I9L A;  4B9Q A;  2YNF A;  3DLR A;  5BRE A;  4AQY K;  1M1K O;  3O9S A;  1KRP A;  4NO7 A;  1T44 A;  2VQE K;  3KK3 A;  4YOT A;  1NNE A;  1BDG A;  3RR7 A;  2VWJ A;  1ZC6 A;  3P5J A;  1QVG M;  4B9L A;  4FZY A;  4LH4 A;  3C6A A;  4KAZ A;  4CJR A;  3AVK A;  4KI4 A;  2KKZ A;  4HTU A;  3VQD A;  1BGX T;  5CZ2 A;  1U48 A;  1OH6 A;  3GDQ A;  3PY8 A;  1WBB A;  4PL8 A;  4O8U A;  1EQY A;  4BRM A;  2O8B A;  4O55 A;  2OPQ A;  4OPK A;  1NKC A;  1S1T A;  2P9P B;  3VGK A;  5IWA K;  1Q8I A;  1RT5 A;  3P1G A;  3DRP A;  3J7Y P;  3SI6 A;  1N33 K;  1HR0 K;  1RTJ A;  1ESV A;  3CJA A;  4GVM A;  3BZC A;  4CZG A;  2QWR A;  5BPN A;  3ULD A;  2Z1I A;  4BGA A;  3RMB A;  2YCH A;  4F4K A;  2F4V K;  4F2S A;  3ATU A;  3ZT4 A;  3PLA A;  3HVT A;  4AHV A;  4DUY K;  4AHC A;  4OPJ A;  4O5B A;  1FKP A;  1JLB A;  3LP3 A;  2QKB A;  5AQN A;  1HQU A;  3JXU A;  2D5R A;  2YI1 A;  4DR6 K;  2QWL A;  1UOC A;  2Q0R A;  3SAF A;  1DGK N;  4Z4I A;  3BEX A;  5EX5 A;  2FBX A;  1K73 O;  3SCX A;  4DSF A;  4B1W B;  1IO2 A;  4H5R A;  4FZZ A;  4CGI A;  1X9S A;  3SMS A;  2IAJ A;  1NBW A;  2PAV A;  3QEV A;  2PZS A;  1IKV A;  4CZH A;  5DM6 L;  1E3M A;  2VG5 A;  1Q81 O;  3VQ8 A;  4MDA A;  1JLE A;  2Q1N A;  4BE1 A;  4CEF A;  1TV6 A;  3BP8 A;  5HRR A;  3FGU A;  2QEX N;  1JLC A;  1FW6 A;  3FFK B;  3P38 A;  3LPU A;  3CI5 A;  1YJW N;  1KFS A;  5KRS A;  5JVG L;  4F3O A;  3AVL A;  4CEZ A;  4FOI A;  3AVC A;  3LP2 A;  1IKW A;  1L3S A;  4CEO A;  2AP1 A;  5F0X A;  3U6F A;  2CGJ A;  4C8M A;  4N47 A;  1KFD A;  3MN7 A;  3E01 A;  3HI0 A;  1QSY A;  2VCP A;  1O13 A;  3VA3 A;  2E2P A;  5FPM A;  4ZHR A;  1I39 A;  2HNZ A;  3L3U A;  4EHT A;  3V9Z A;  3TTC A;  3WXI A;  4BR4 A;  4IXC A;  1WSH A;  2OPP A;  3AA2 A;  4CF8 A;  4CJE A;  1VQ9 N;  3F5T A;  3PX4 A;  4K0K K;  4C8L A;  3HSC A;  1TYQ A;  3V1R A;  1X9W A;  1OVQ A;  5HLF A;  1TK8 A;  3FZK A;  1BCO A;  4IDH A;  4AH9 A;  2ASO A;  1KD1 O;  5AQM A;  4UY8 O;  3VET A;  4FLU A;  5EXW A;  1KLN A;  1GLL O;  2E2Q A;  5EY4 A;  4DKW A;  5AZJ A;  4IO8 A;  1HKB A;  3KLE A;  1RDD A;  1W2B M;  3HPG A;  1NK7 A;  1KCF A;  4XH1 A;  4BVO A;  3ZCM A;  3L4Q A;  3A5O C;  1EKE A;  3PX0 A;  5FRO A;  1U6Z A;  3O4N A;  3HP9 A;  5KQD A;  4GKK K;  2Z1H A;  3AVM A;  3OYA A;  3EEQ A;  3H3O B;  3BUZ B;  1TL3 A;  2BH1 A;  5AQL A;  1XUP O;  4A2A A;  3CCL N;  5AQI A;  3K9J A;  1EET A;  4QCL A;  1XHX A;  4BWJ A;  3DOK A;  5HP1 A;  3C6U A;  1HPZ A;  1T3V A;  3OYH A;  3N4Q A;  3HK2 A;  4OX9 K;  3LDP A;  4BQL A;  2FSK A;  1ILY A;  1ZBS A;  3LDL A;  2OZM A;  2E6M A;  1BU6 O;  5JIC A;  2FBT A;  1GLC G;  4IG3 A;  4DTS A;  3VQ7 A;  4CER A;  3O9Q A;  1JL1 A;  4FJK A;  5BN9 A;  2X6S A;  1N6Q A;  2WTU A;  3O3F A;  4J2E A;  1QQO A;  1JCG A;  2A41 A;  4CJQ A;  1SQK A;  3WT0 A;  4W5N A;  1CXQ A;  1RGI A;  4AF1 A;  3RRG A;  3DLK A;  3OYB A;  4BRE A;  3J7Z O;  4NYN A;  2H3G X;  3QIO A;  1IG9 A;  4E0D A;  3C0B A;  4FWS A;  3THY B;  2QXL A;  4DWI A;  2FF6 A;  4OPA A;  5KI6 A;  4CEE A;  2PY5 A;  4Z4E A;  2O8E B;  1HJR A;  4M7Y A;  3CJC A;  1HJO A;  3VER A;  4ELT A;  3VQ6 A;  4CGG A;  2G8V A;  4RCH A;  2XHB A;  1KAZ A;  4YOW A;  3MCP A;  1S1X A;  4DS5 A;  1REV A;  3VQB A;  4FM0 A;  3CER A;  1K8K B;  2P9K A;  2NRX A;  3HT3 A;  1YIJ N;  4BRA A;  1LW2 A;  3C6H A;  4KHQ A;  2Y1I A;  3ZYY X;  2WC9 A;  3V9S A;  1GLA G;  4AM7 A;  4JEP A;  4JI4 K;  4BRH A;  4YY3 K;  3OS1 A;  4ISG A;  2YNI A;  4PY5 A;  2O4G A;  1SZ2 A;  4Z4C A;  3KLG A;  5HRP A;  4ISF A;  3OYN A;  4J2B A;  4HVJ A;  1QQN A;  3SK3 A;  1NKB A;  1KAY A;  1ATS A;  3K59 A;  4LFC K;  5AFU A;  1CZA N;  2J4R A;  3FZL A;  4FJN A;  3O08 A;  1RDB A;  4NYF A;  2W40 A;  4LF4 K;  5AQP A;  1FK9 A;  3SNN A;  3RWU A;  3KJV A;  4BDP A;  2ZF5 O;  3DI6 A;  4B3O A;  4IOX A;  1BWF O;  2ASP A;  2HMI A;  2HB5 A;  3KKS A;  4B1Y B;  2CGL A;  4I7F A;  3JAM O;  3EY1 A;  3SV3 A;  1V4T A;  2KZM A;  4L3Q A;  3MX2 A;  1XNQ K;  2HBM A;  3UKR B;  2IOC A;  2ZM6 K;  1MU2 A;  4FYD A;  4J8F A;  3MAQ A;  4C8K A;  3A0I X;  3H45 C;  4B9M A;  3RMC A;  1KSP A;  1Q7Y O;  2E1Z A;  4AM6 A;  3WNH A;  3ZET A;  1J54 A;  3KK2 A;  1Z25 A;  1QHT A;  1NGI A;  3C95 A;  3OBW A;  4JYA K;  4ZTJ A;  4FJ8 A;  3D0P A;  2FC0 A;  1HNX K;  3CQ8 A;  4FM1 A;  3DLH A;  4IFY A;  3AO2 A;  3IG1 A;  4KBO A;  1RTI A;  1IKX A;  4BRL A;  5ADX A;  4H4M A;  1HNI A;  5CHI A;  3TSQ A;  3NGY A;  4O0I A;  4B1U B;  3NGI A;  3SUN A;  3SPY A;  1VSL A;  3D2F A;  1YVN A;  1YTU A;  1U04 A;  3DRS A;  4MFB A;  3SJH A;  4DF4 A;  1YAG A;  1SKR A;  1VHX A;  4FM2 A;  5FLX O;  2B6A A;  4HUE A;  1GLF O;  1WUA A;  2F96 A;  4WQ5 C;  4DMN A;  4OLA A;  4LH5 A;  3KIO A;  3OA9 A;  3IRX A;  2O8C A;  3JSM A;  2W6K A;  4IFE A;  4B1Z A;  3DLE A;  1N34 K;  3I8D A;  2EHG A;  3EO3 A;  5FRN A;  3L2R A;  3AVI A;  4KI6 A;  3CCS N;  3SAG A;  5EOY A;  4CE9 A;  4E7I A;  4H5T A;  4KB0 A;  2QWN A;  1TYQ B;  4E7J A;  4JRP A;  1S9G A;  4CJU A;  4DQQ A;  1N36 K;  1ASU A;  1IBK K;  5CYQ A;  2HF3 A;  4DTX A;  3MWP A;  1NWK A;  3ATV A;  4CGH A;  4JV5 K;  4IJN A;  3P4I A;  3ZSY A;  4BG8 A;  2RPI A;  1EP4 A;  4CED A;  3ZET B;  4CFB A;  3VQ4 A;  3SQ0 A;  4NLB A;  1NLV A;  1RBV A;  3P83 D;  3H08 A;  5EVZ A;  1BI4 B;  4LC9 B;  3VES A;  2ZGZ A;  3RRH A;  4LF5 K;  4H0V B;  3ISN C;  2HHQ A;  3QNN A;  5H1S Q;  4DTO A;  1EWQ A;  3MED A;  3SLC A;  3W3D A;  1NOZ A;  4YOR A;  2A6A A;  4JK7 A;  4HUF A;  4JK9 A;  2Q3S A;  1S1V A;  1C0G A;  4Y1D A;  1S6P A;  4E7K A;  3PO5 A;  4FWL A;  5SWM A;  1OKJ A;  3RMD A;  1XI1 A;  1BG3 A;  2O8C B;  3EKS A;  1X3M A;  1KAX A;  1QZ6 A;  4LF7 K;  4JRQ A;  3G10 A;  3EE9 A;  3OYC A;  4IJA A;  2IIR A;  4QS8 A;  4DSE A;  5HBM A;  1Q18 A;  4H0P A;  1BA0 A;  4BR9 A;  3QEI A;  1WSJ A;  3GE1 A;  5JLF A;  1TKD A;  4Z4G A;  3CJ9 A;  4ILH A;  3GOI A;  3G6E N;  3RVC A;  4GV9 A;  3QET A;  5M1N A;  4PQU A;  3O5B A;  3MN6 A;  3MX5 A;  4JLH A;  2XY5 A;  2UXC K;  3LAM A;  1WLJ A;  4CJK A;  3QO9 A;  3WXK A;  4PA1 A;  5E26 A;  5BPM A;  1XWL A;  4EHU A;  3FZM A;  5AQK A;  4Y1C A;  4DFK A;  3SQ2 A;  3CCR N;  4FLY A;  1SAZ A;  4N76 A;  3EYZ A;  5M1P A;  3MMV A;  2P9K B;  2CH6 A;  3MXJ A;  4K8Z A;  4A5B A;  3NVM A;  1KVC A;  5C15 A;  4DQS A;  5K14 A;  2GBZ A;  4DTJ A;  4BR2 A;  4DR2 K;  5AFU H;  2LSN A;  3U8X A;  4HUG A;  1KC8 O;  4N5S A;  3O1W A;  3DLL L;  1C0U A;  1HYZ A;  1NGD A;  1P90 A;  4PKG A;  4DSK A;  3NFA A;  4CD1 A;  1YIT N;  1X3N A;  4DV4 K;  4CJP A;  1LAW A;  3CC4 N;  3VF2 A;  3NH2 A;  3ZT2 A;  1OH8 A;  2NRZ A;  3FR0 A;  1UA0 A;  4AHR A;  3DWL A;  4K41 A;  3LDS A;  1LW0 A;  1NK4 A;  2RE2 A;  2JGU A;  3QNO A;  2FBV A;  2QXF A;  2F8S A;  3K5M A;  4KTW A;  3SUP A;  4CF1 A;  3ZEU B;  4BY9 C;  4E7L A;  3EKU A;  4DV2 K;  1M90 O;  5KPR A;  5AQU A;  2IVO A;  2UUB K;  2KFZ A;  2FLO A;  3SUQ A;  1RBT A;  4M3T A;  5DM7 L;  4CIG A;  2BUP A;  4CHP A;  4DFM A;  3V6D A;  4F3T A;  1YTA A;  1FKO A;  2RN2 A;  4FJL A;  1YXQ A;  2HW3 A;  3DXK A;  3LZJ A;  2OA8 A;  5BR9 A;  3VOV A;  3JS6 A;  2GX9 A;  4Z4F A;  3NF6 A;  4OLB A;  2IS3 A;  1VQL N;  3S3M A;  3IMX A;  5CZ1 A;  1WSE A;  1C1C A;  2JWK A;  3QLH A;  2FBY A;  4KO0 A;  3FZF A;  1XC9 A;  5GIO A;  1IV0 A;  3MEG A;  1F21 A;  4KKO A;  4YNQ A;  2A42 A;  3SAH A;  1RTH A;  2P9P A;  3WEE A;  3LAL A;  4O5F A;  3GBT A;  4BC3 A;  1IBL K;  3CCV N;  2KFN A;  3A5N C;  5F1X A;  4WCE L;  4DR4 K;  4YHH K;  4IZ9 A;  2IGI A;  4DUZ K;  4CIF A;  4W5Q A;  4QAG A;  4MDB A;  3KWI A;  3ZSO A;  4M3Y A;  4BRP A;  4IOC L;  2X6N A;  3VEY A;  1QSS A;  3SMP A;  3P31 A;  2BGG A;  1A5X A;  3K2P A;  2DY4 A;  2QKK A;  2QWQ A;  3TTF A;  4M3W A;  2DPN A;  3Q7C A;  3NMU A;  4GNI A;  4CZL A;  4CFD A;  2W41 A;  4XH5 A;  1VQ8 N;  4LY7 A;  4RWT A;  4E1N A;  4LF9 K;  3TAM A;  1XHZ A;  4OJR A;  3QB0 A;  2YJE A;  3IKM A;  4RW9 A;  2F9T A;  3ZSX A;  2VG6 A;  4FSV A;  4DV0 K;  4B8C A;  3T19 A;  4CZK A;  5FDL A;  2HHU A;  2ASM A;  4MLE A;  4PL7 A;  3VGL A;  2ZWH A;  3MCA B;  4CHY A;  1NJY A;  5F2R A;  2FF3 B;  3AVA A;  1NJX A;  2P5G A;  5BRD A;  1FJG K;  1L3U A;  5HOO A;  4XIU A;  4DV1 K;  3WEE B;  1K6Y A;  3ZT3 A;  4CGJ A;  4FLX A;  1N32 K;  4HCC A;  3T1H K;  3CPE A;  3HST B;  5LJV A;  4DF8 A;  2JWL A;  3LM9 A;  4DTM A;  3KD5 E;  3HBT A;  4FCY A;  4EP4 A;  3LP0 A;  3QEW A;  4ELV A;  4RW6 A;  2GEM A;  3O3G A;  1GLJ O;  3TAP A;  2NLX A;  1MDU B;  4RW4 A;  3CET A;  3CPW M;  1XMO K;  5KGW A;  4BRQ A;  3S9H A;  3RSE B;  2BDP A;  3BF1 A;  3OW2 M;  4OVL A;  3KTQ A;  5AQZ A;  3UKR A;  2NRV A;  5SZT A;  1VSF A;  3P39 A;  4BC5 A;  3CF5 L;  4FWM A;  4RW7 A;  5LL6 Z;  3TAG A;  1OH7 A;  1K8A O;  4DTP A;  5FRM A;  2YKN A;  2BE2 A;  4B1X B;  3CHW A;  3HPO A;  2HVH A;  4B3M K;  4DR1 K;  2HHX A;  4GY2 B;  3DYA A;  1ATR A;  3VEW A;  1A5W A;  4B9N A;  2YJF A;  3O80 A;  4E19 A;  3CIP A;  3H1Q A;  5AQQ A;  3KHY A;  4CW7 B;  1UWB A;  1R59 O;  2QW9 A;  1MWK A;  3CME N;  1Y97 A;  4FJI A;  3H6E A;  4YOX A;  1XQS C;  1VQO N;  2GV9 A;  3V9W A;  4FWO A;  3S3O A;  4FJ7 A;  2OTJ N;  2KQ2 A;  4FJG A;  3QML A;  2ZJQ L;  1VRU A;  5AQW A;  5FPN A;  2Q36 A;  4A5A A;  4CJF A;  2OAN A;  5C12 A;  4NCA A;  1QZ5 A;  1WAJ A;  2P9S B;  4YDU A;  1NGA A;  1QHA A;  2WOM A;  2D0C A;  4CJ5 A;  5EU7 A;  4B9S A;  4JHD A;  3CC2 N;  3ZX0 A;  5ADX H;  3M8R A;  2D4W A;  3IS9 A;  3IAY A;  3I0S A;  3AVJ A;  4Y0W A;  3ZSZ A;  3L2V A;  4JI7 K;  5AQJ A;  4LF8 K;  3V9U A;  4O4G A;  4IO9 L;  4I6M B;  1YJN N;  1A5V A;  2Q2R A;  5J2N A;  1BL3 A;  1S9E A;  3NBP A;  3HYF A;  4GV3 A;  3AAR A;  1BIU A;  4K42 A;  4BDY A;  4K8X A;  1GLB G;  5JS1 A;  3QEX A;  3OBY A;  1O1W A;  3A5L C;  1MA9 B;  1BHL A;  2WON A;  4FPA A;  2O8E A;  5M1F A;  3M1F A;  4BGB A;  4U7B A;  5BRF A;  3DM2 A;  3HPH A;  3THX B;  1NMD A;  4A61 A;  4F9O A;  4WQ4 C;  1JKH A;  1BI4 A;  3PSI A;  1LOT B;  4JI3 K;  3AV9 A;  3ENO A;  1Y64 A;  3WQT A;  4DG1 A;  2XY8 A;  1IBM K;  3O4W A;  1BA1 A;  1YUW A;  1Z26 A;  4CIE A;  3HZ6 A;  1Q82 O;  4JI5 K;  2GUI A;  2HMP A;  4M45 A;  1RCH A;  4KH4 A;  4OKE A;  3MXI A;  3DLB A;  1S1U A;  4X65 K;  1DLO A;  3PX6 A;  1RT3 A;  3VQP A;  1TKZ A;  2P9N B;  4WFB L;  3SQ1 A;  1X9J A;  2Y1J A;  1RT1 A;  3I8B A;  2HHT A;  4WYB A;  3D7E O;  1YHQ N;  2P9S A;  3LDN A;  3K58 A;  4BRF A;  1Q86 O;  5KPZ A;  2BAN A;  4KV8 A;  4JHD B;  3T7Z A;  4KRF A;  3TAR A;  1LWE A;  4FPB A;  1OH5 A;  1WOQ A;  3KLI A;  3ZX3 A;  3V1Q A;  1VQ5 N;  1Z05 A;  2HBK A;  3OYG A;  2DFF A;  4FJ5 A;  4ILG B;  4LFB K;  4BRD A;  5GAD P;  1IG8 A;  3ZSR A;  2D0B A;  5GIP A;  3E66 A;  3LDO A;  4CZF A;  3O8M A;  3W0L A;  5AR0 A;  4CHN A;  3EN9 A;  1NKE A;  1L3T A;  4KHY A;  5GAE P;  4IDK A;  3LAK A;  4CJV A;  3EL2 A;  3ENB A;  3T1A A;  1NG9 A;  1DTT A;  2V52 B;  2ETJ A;  4H5N A;  3VF6 A;  4B1V A;  4H0Y B;  4JI1 K;  5TKW A;  3THX A;  3O1B A;  3WNE A;  4U67 L;  3PUF A;  1VQP N;  4FWP A;  4DLE A;  4RW8 A;  3LWL A;  1N8R O;  2E2N A;  4H0O A;  1U49 A;  1HYV A;  3DAW A;  1UA1 A;  3MK6 A;  4NLC A;  1NK6 A;  3CJB A;  4OKJ A;  3CG7 A;  4OKK A;  4BR0 A;  3J8A A;  4G1Q A;  2DFH A;  4H5V A;  2XO7 A;  3E1Y A;  1XNR K;  2KZZ A;  4FJJ A;  1NJI O;  5CY4 A;  2QK9 A;  2D1K A;  3F9K A;  3FLC O;  2IC3 A;  1VSE A;  4BG9 A;  4CJL A;  3K9K A;  5MLC Q;  2P9U B;  1DT9 A;  3AVF A;  4DV3 K;  4DLG A;  4BRG A;  3CFP A;  1KLM A;  1KVA A;  4YOV A;  4OGE A;  3MEE A;  4GMJ B;  1HX1 A;  3VEO A;  3KLF A;  4DQI A;  1BOT O;  4BE2 A;  3NVK A;  4IFV A;  2VQF K;  4AHT A;  3R9P A;  3CFO A;  4KTQ A;  2EWS A;  4J2A A;  3LP1 A;  4CES A;  1B9F A;  2V7Y A;  4A62 A;  4DV7 K;  3AO1 A;  2E2O A;  4FWN A;  3VQE A;  4M63 C;  2ZQB A;  1LWC A;  1RT7 A;  3CCJ N;  1JLQ A;  1RDA A;  2G8H A;  1X1P A;  3SV4 A;  2GWJ A;  1CZB A;  3HP6 A;  4DR3 K;  2WBN A;  4LSL A;  1W7A A;  4FWK A;  1E4G T;  5J2P A;  3B6P A; 
#chains in the Genus database with same CATH homology
 3DRR A;  4N47 A;  4C8M A;  1KFD A;  4E7L A;  4E3S A;  2IDO A;  3OYL A;  3E01 A;  4CK1 A;  2AJQ A;  1QSY A;  3VA3 A;  3NF7 A;  1C6V A;  4ZHR A;  1RBR A;  1I39 A;  4MQ3 A;  2HNZ A;  3HO1 A;  3L3U A;  4FJH A;  2KFZ A;  3V9Z A;  4FLV A;  4H4O A;  3SUQ A;  5I42 A;  1WSH A;  1RBT A;  1BQM A;  2OPP A;  1CLQ A;  4M3T A;  1LAV A;  4W5T A;  3AA2 A;  4M3Z A;  2YNG A;  4CF8 A;  3U3Y A;  4W5O A;  4CJE A;  2P1J A;  4CJW A;  4CIG A;  3L2W A;  3AVH A;  4CHP A;  4DFM A;  3V6D A;  3SJJ A;  2A1R A;  4F3T A;  1YTA A;  1KTQ A;  3AA3 A;  3PX4 A;  1FKO A;  2RN2 A;  4FJL A;  1VSI A;  4CEA A;  2HW3 A;  4C8L A;  1B9D A;  4I9Q A;  1ASW A;  3V1R A;  5D3G A;  3LZJ A;  1X9W A;  2OA8 A;  5HLF A;  1TK8 A;  1QSL A;  2HHS A;  1S1W A;  4Z4F A;  3NF6 A;  1J9A A;  1BCO A;  4CF0 A;  2IS3 A;  3NCI A;  4OLB A;  4AH9 A;  3S3M A;  1EX4 A;  3ZSW A;  1VSJ A;  2F8T A;  4HHT A;  5CZ1 A;  1WSE A;  2R7Y A;  3OJS A;  4FLU A;  1C1C A;  3KKR A;  2OPR A;  3QLH A;  3KK1 A;  2FBY A;  4DTU A;  1KLN A;  1TKX A;  4KO0 A;  2G8K A;  3M8S A;  1XC9 A;  2PYL A;  1RT2 A;  4CF2 A;  3MEG A;  3KLE A;  1RDD A;  4EZ9 A;  1F21 A;  4KKO A;  4YNQ A;  3HPG A;  4N56 A;  3V4I A;  1NK7 A;  1KCF A;  1RTH A;  3U3G A;  3NAE A;  3VQ5 A;  3ZCM A;  3LAL A;  3HVR A;  1RBU A;  3AO4 A;  3K5N A;  4FK4 A;  1EKE A;  1QS4 A;  4UQG A;  3PX0 A;  2A1S A;  5FRO A;  3O4N A;  3HP9 A;  2Z1H A;  1GOC A;  3AVM A;  2KFN A;  3JYT A;  3OYA A;  2IGI A;  1U4B A;  4CIF A;  5J2Q A;  4ID1 A;  1TL3 A;  2E4L A;  4QAG A;  5C42 A;  4W5Q A;  4CFA A;  1LV5 A;  1J5O A;  4IG0 A;  4DSJ A;  1HNV A;  4DFP A;  3ZSO A;  3CM6 A;  3NE6 A;  3AVG A;  4FLW A;  1NJZ A;  4IKF A;  4KPY A;  1ZBL A;  4M3Y A;  3PO4 A;  1EET A;  2X6N A;  4FW2 A;  1CZ9 A;  4QCL A;  4BE0 A;  4CK3 A;  3OY9 A;  1QQC A;  1XHX A;  4BWJ A;  3DOK A;  3ZT1 A;  3ZSQ A;  4DU4 A;  3T3F A;  1QSS A;  1X9M A;  2BGG A;  5HP1 A;  1A5X A;  3K2P A;  3C6U A;  1HPZ A;  3OYH A;  3HK2 A;  2DY4 A;  2QKK A;  4M3W A;  3KLH A;  1TK0 A;  4M3R A;  2OZM A;  2E6M A;  3LZI A;  3VQA A;  2FBT A;  4CFD A;  4IG3 A;  4DTS A;  3SPZ A;  3VQ7 A;  4CER A;  4CGF A;  2HHV A;  1JL1 A;  3FFI A;  4LY7 A;  4FJK A;  4E1N A;  4N41 A;  2X6S A;  1N6Q A;  5J2M A;  3TAM A;  1XHZ A;  4OJR A;  3O3F A;  4YFU A;  4J2E A;  3TR8 A;  4RW9 A;  4AHU A;  3ZSX A;  5E41 A;  3OS2 A;  3OYF A;  2VG6 A;  4CJQ A;  4W5N A;  1CXQ A;  3AO5 A;  3RRG A;  3DLK A;  4O44 A;  4L8R B;  3OYB A;  3AA4 A;  1SV5 A;  4B8C A;  5HRN A;  4DU3 A;  4NYN A;  3T19 A;  3QIO A;  1U47 A;  1IG9 A;  5FDL A;  4CJ4 A;  4M41 A;  4E0D A;  4LD0 A;  3V81 A;  2EX3 A;  2HHU A;  4GW6 A;  5C24 A;  4DWI A;  1IKY A;  3NH0 A;  5KI6 A;  4CEE A;  3TAF A;  1RTD A;  2PY5 A;  4Z4E A;  2Z1G A;  1HJR A;  2ZE2 A;  3L3V A;  3F73 A;  3QIP A;  4NCB A;  4CHY A;  1NJY A;  2D0A A;  3ZSV A;  4PWD A;  3AVA A;  1RT6 A;  4DQR A;  1NJX A;  2X74 A;  4W5R A;  2P5G A;  4M3X A;  1VSK A;  1L3U A;  3I0R A;  3VQ6 A;  4CGG A;  4B9T A;  4ELT A;  1WN7 A;  4XIU A;  2G8V A;  1K6Y A;  3ZT3 A;  2XHB A;  2G8U A;  4CGJ A;  4JS5 A;  3K5L A;  4FLX A;  4FJM A;  1S1X A;  4DS5 A;  3HM9 A;  1REV A;  3VQB A;  4OGC A;  4FM0 A;  4HCC A;  3HST B;  4CGD A;  4DF8 A;  2JLE A;  4DTM A;  1I3A A;  3HT3 A;  3KD5 E;  4FCY A;  1YT3 A;  4B9V A;  2YV0 X;  1WSF A;  1LW2 A;  4EP4 A;  3S3N A;  4DSI A;  4KHQ A;  3LP0 A;  2Y1I A;  1D8Y A;  3V9S A;  1TGO A;  3QEW A;  3TAE A;  1C0M A;  4FLT A;  4ELV A;  4RW6 A;  2HNY A;  3NH1 A;  3O3G A;  5CYM A;  3OS1 A;  3TAP A;  2YNI A;  1WSG A;  4Z4H A;  2O4G A;  4PY5 A;  3A2F A;  3OYD A;  4Z4C A;  1DTQ A;  3HL8 A;  4RW4 A;  4QOZ B;  3KLG A;  1TL1 A;  2P51 A;  3LPT A;  5HRP A;  4ZTF A;  3VQC A;  1SL0 A;  3OYN A;  4J2B A;  1W0H A;  3TAQ A;  2KTQ A;  4HVJ A;  1WAF A;  1TKT A;  4KTZ A;  5KGW A;  1NKB A;  2G8F A;  3S9H A;  4M3U A;  4TSX A;  3HJF A;  3K59 A;  1BCM A;  1JLG A;  2BDP A;  3TAN A;  4OVL A;  1NK0 A;  1U45 A;  4CEC A;  3PV8 A;  3KTQ A;  4FJN A;  5SZT A;  1VSF A;  1HMV A;  1RDB A;  4NYF A;  2DFE A;  4RW7 A;  3TAG A;  4DTP A;  3RWU A;  1FK9 A;  4I2Q A;  3SNN A;  3KJV A;  5FRM A;  2YKN A;  2ITG A;  3WNG A;  3HXM A;  4BDP A;  1N5Y A;  2BE2 A;  3DI6 A;  1ZBH A;  3HPO A;  2HVH A;  5T7B A;  1WSI A;  4B3O A;  5C25 A;  2HHX A;  4JS4 A;  4DS4 A;  2HMI A;  3DYA A;  3NF8 A;  3C94 A;  2HB5 A;  2YKM A;  5J1E A;  3KKS A;  1A5W A;  1G15 A;  2RF2 A;  4I7F A;  4B9N A;  2O4I A;  1R0A A;  4E19 A;  1RNH A;  3EY1 A;  4DFJ A;  3SV3 A;  4E7H A;  4KHS A;  3OYE A;  2XY7 A;  4Q0B A;  4BDZ A;  1T7P A;  2KZM A;  3ALY A;  4CJ3 A;  2XY6 A;  1C0T A;  1HQE A;  2IOC A;  3AO3 A;  3V9X A;  4C8N A;  1UWB A;  1MU2 A;  4FYD A;  1T05 A;  1D9D A;  1SL2 A;  1Y97 A;  3MAQ A;  4C8K A;  4B9M A;  3RMC A;  4FJI A;  1JXE A;  3OYJ A;  4LSN A;  1KSP A;  4H8K A;  4CK2 A;  1JL2 A;  3QEP A;  1ITG A;  3L2Q A;  3WNH A;  2GV9 A;  1J54 A;  3KK2 A;  3V9W A;  3M8Q A;  4DTN A;  1Z25 A;  1QHT A;  3S3O A;  4FJ7 A;  1BQN A;  2KQ2 A;  3C95 A;  3KD1 E;  4FJG A;  3RTV A;  1T8E A;  3OS0 A;  1VRU A;  1RBS A;  2PYJ A;  1QE1 A;  2X78 A;  3O4Q A;  4ZTJ A;  4FJ8 A;  4CJF A;  4NCA A;  3D0P A;  3TI0 A;  1JXB A;  2FC0 A;  1WAJ A;  3DLG A;  1TAQ A;  3EZ5 A;  3CQ8 A;  4FM1 A;  3DLH A;  4IFY A;  3AO2 A;  3IG1 A;  3LAN A;  2WOM A;  2D0C A;  2E6L A;  1RTI A;  4CJ5 A;  3SUO A;  1D9F A;  5EU7 A;  1IKX A;  4R5P A;  4B9S A;  4FK2 A;  4B08 A;  4H4M A;  4F2R A;  3CFR A;  1HNI A;  1TK5 A;  3NHG A;  3M8R A;  4C8O A;  3L2U A;  3NGY A;  3OYM A;  4KRE A;  4O0I A;  1HRH A;  3IS9 A;  3IAY A;  4FK0 A;  3I0S A;  4FZX C;  1FXX A;  3NGI A;  3AVJ A;  3SUN A;  1C1A A;  3ZSZ A;  3MEC A;  4IBN A;  1VSL A;  3L2V A;  3SPY A;  1YTU A;  1U04 A;  3DRS A;  3THV A;  1ZBI A;  4MFB A;  3ZT0 A;  3V9U A;  4DF4 A;  4KHW A;  1VSD A;  4O4G A;  4CJT A;  1SKR A;  4FM2 A;  1A5V A;  1L5U A;  1S5J A;  5HRS A;  2B6A A;  1BL3 A;  2F96 A;  4HUE A;  3SYZ A;  5J2N A;  1S9E A;  3NBP A;  4DMN A;  4OLA A;  2P5O A;  3HYF A;  1BIU A;  4CJS A;  4LH5 A;  4BDY A;  3D45 A;  3KIO A;  4K8X A;  2RKI A;  3IRX A;  1SUQ A;  4FVM A;  4CFC A;  1GOB A;  3JSM A;  3DLE A;  3QEX A;  1ZBF A;  5JS1 A;  4NCG A;  3I8D A;  3BDP A;  2W42 A;  1O1W A;  2EHG A;  1BHL A;  2WON A;  3OYI A;  1SKW A;  3L2R A;  5FRN A;  3AVI A;  4KI6 A;  4CHO A;  4KHU A;  3SZ2 A;  4CE9 A;  4FXD A;  2B4J A;  3DM2 A;  4E7I A;  3HPH A;  4F8R A;  1SKS A;  4KB0 A;  3O3H A;  1WNS A;  1C1B A;  4E7J A;  5KRT A;  3LWM A;  4JRP A;  1S9G A;  4CJU A;  4DQQ A;  1NK8 A;  4DQP A;  3BGR A;  4B8A B;  1JKH A;  4WE1 A;  1BI4 A;  1ASU A;  3AV9 A;  2XRI A;  5CYQ A;  4DTX A;  3OJU A;  2B5J A;  1J53 A;  3QER A;  4DG1 A;  2XY8 A;  3TAB A;  4CGH A;  3CM5 A;  1RT4 A;  3VA0 A;  1VK0 A;  4J2D A;  3RMA A;  1Z26 A;  4CHZ A;  4ICL A;  4CIE A;  4EP5 A;  4FLZ A;  3ZSY A;  3ITH A;  3C6T A;  2GUI A;  1VRT A;  4M45 A;  1QTM A;  2RPI A;  1RCH A;  1EP4 A;  2ATQ A;  4OKE A;  4CED A;  3MXI A;  3V1O A;  1ZYQ A;  1NJW A;  3DLB A;  1EXQ A;  1S1U A;  4O0J A;  4CFB A;  3WNF A;  1Q9Y A;  2HND A;  1DLO A;  1JLF A;  3VQ4 A;  1W9H A;  3SQ0 A;  3PX6 A;  1RT3 A;  3VQP A;  1RBV A;  4E1M A;  1TKZ A;  3SQ1 A;  3P83 D;  3H08 A;  1RT1 A;  2Y1J A;  1BI4 B;  1NK9 A;  1HYS A;  2HHT A;  4RG8 A;  3OYK A;  3NF9 A;  3ASM A;  3K58 A;  3RRH A;  3DMJ A;  3ISN C;  4BAC A;  2G8I A;  2HHQ A;  3QNN A;  4DSL A;  4DTO A;  3QES A;  2BAN A;  4AHS A;  4KV8 A;  4DU1 A;  4KFB A;  3MED A;  4CCH A;  2YNH A;  4KRF A;  3TAR A;  1LWE A;  1GOA A;  2Z1J A;  4DTR A;  2OZS A;  2DTU A;  1NOZ A;  3M8P A;  4I9L A;  1T03 A;  2YNF A;  3DLR A;  3KLI A;  1KRP A;  3V1Q A;  4BWM A;  4HUF A;  3KK3 A;  4B9U A;  3VN5 A;  3OYG A;  2DFF A;  4FJ5 A;  2Q3S A;  4FJX A;  1S1V A;  4CHQ A;  1NK5 A;  3RR7 A;  2VWJ A;  5HRO A;  4Y1D A;  1S6P A;  4Z0U A;  3RR8 A;  3P5J A;  3OVN A;  4E7K A;  3PO5 A;  4B9L A;  4FZY A;  5SWM A;  3ZSR A;  2D0B A;  4LH4 A;  4AIL C;  4KB1 A;  4KAZ A;  4CJR A;  3RMD A;  3AVK A;  5DK5 A;  4KI4 A;  1XI1 A;  1IH7 A;  4CHN A;  4HTU A;  1VSH A;  3VQD A;  3UIQ A;  1NKE A;  1BGX T;  1L3T A;  5CZ2 A;  3L8B A;  1U48 A;  4KHY A;  1B92 A;  3PY8 A;  3K5O A;  4IDK A;  1VSM A;  3LAK A;  4Q5V A;  4CJV A;  4JRQ A;  3G10 A;  3T1A A;  1TAU A;  1DTT A;  3G0Z A;  4O55 A;  4E89 A;  4FJ9 A;  2ETJ A;  2OPQ A;  4OPK A;  3OYC A;  3AA5 X;  1NKC A;  4DSE A;  1S1T A;  2YHA A;  5HBM A;  1Q8I A;  3TWH A;  3WNE A;  1RT5 A;  1LWF A;  1NOY A;  3QIN A;  3P1G A;  3PUF A;  3DRP A;  3SI6 A;  3QEI A;  4DLE A;  1WSJ A;  1RTJ A;  4GVM A;  4RW8 A;  5KTQ A;  3LWL A;  4KHN A;  1BIS A;  1TKD A;  4Z4G A;  1U49 A;  4HCB A;  1HYV A;  3NDK A;  1UA1 A;  1NK6 A;  3ULD A;  2Z1I A;  4OKJ A;  3CG7 A;  3NGZ A;  3QET A;  3RMB A;  4OKK A;  4G1Q A;  4F4K A;  2DFH A;  4PQU A;  3VQ9 A;  4CEB A;  2XO7 A;  2KZZ A;  4F2S A;  3CYM A;  4FJJ A;  1JLA A;  4JLH A;  3ZT4 A;  2XY5 A;  3LAM A;  1WLJ A;  1D5A A;  4CJK A;  5CY4 A;  3QO9 A;  3HVT A;  2QK9 A;  4PA1 A;  4AHV A;  3MXM A;  2G8W A;  3F9K A;  1XWL A;  4AHC A;  3SQ4 A;  4OPJ A;  2IC3 A;  4O5B A;  4Y1C A;  1FKP A;  4DFK A;  4FW1 A;  4FLY A;  1VSE A;  4CJL A;  3SQ2 A;  4N76 A;  2VG7 A;  3EYZ A;  1JLB A;  3B6O A;  3MXJ A;  3LP3 A;  3AVF A;  4K8Z A;  4I2P A;  2QKB A;  1HQU A;  3DOL A;  5KGX A;  1KVC A;  2YHB A;  4CF9 A;  1RDC A;  1TVR A;  3CFP A;  4DLG A;  2VWK A;  2HVI A;  1KLM A;  1KVA A;  2D5R A;  4DQS A;  4OGE A;  3MEE A;  2GBZ A;  5K14 A;  1L3V A;  4PUO A;  4GMJ B;  1UOC A;  3KLF A;  5DMR A;  4DQI A;  3K57 A;  4BE2 A;  4DTJ A;  4IFV A;  4Z4I A;  4AHT A;  2FBX A;  3SCX A;  4DSF A;  1IO2 A;  4FZZ A;  2I5J A;  4CGI A;  2LSN A;  5JS2 A;  1X9S A;  4HUG A;  4ELU A;  4M42 A;  2HHW A;  3CFO A;  2IAJ A;  4N5S A;  4KTQ A;  1SL1 A;  3AVN A;  1C0U A;  3QEV A;  1HYZ A;  2PZS A;  1IKV A;  4J2A A;  2NUB A;  3LP1 A;  4DSK A;  4ID5 A;  2ZD1 A;  3NFA A;  4CES A;  1B9F A;  1Q9X A;  2VG5 A;  3AVB A;  2OPS A;  3AO1 A;  3VQ8 A;  2OYQ A;  1RIL A;  1LAW A;  1JLE A;  3VQE A;  1KVB A;  4CJP A;  4BE1 A;  1S6Q A;  1TV6 A;  2ZQB A;  1LWC A;  1RT7 A;  5HRR A;  3ZT2 A;  4CEF A;  4CEQ A;  3NH2 A;  1ASV A;  1JLQ A;  3VQQ A;  1RDA A;  2G8H A;  1UA0 A;  1JLC A;  1X1P A;  4AHR A;  2KW4 A;  3LDS A;  3SV4 A;  1LW0 A;  1CXU A;  3LPU A;  1NK4 A;  2JGU A;  5I3U A;  1KFS A;  4EZ6 A;  5KRS A;  3QNO A;  2FBV A;  4F3O A;  3AVL A;  1CZB A;  1UAX A;  1ZBU A;  2QXF A;  1YVU A;  4CEZ A;  3HP6 A;  3K5M A;  4KTW A;  2F8S A;  3SUP A;  3AVC A;  3LP2 A;  1IKW A;  4CF1 A;  1BIZ A;  1L3S A;  4LSL A;  4CEO A;  5J2P A;  3U6F A;  3B6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...