4KB0A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion cc )
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb0A00
1BL3A 3BDPA 1Z26A 3WNHA 3HXMA 2OA8A 4W5NA 1SKRA 1IG9A 2DFFA 2P5GA 1RNHA 1QSSA 1RT5A 4DTOA 1S9EA 4E0DA 4E1MA 4FLVA 3NH2A 3VQ5A 3V9SA 1NKEA 1L3VA 2HNDA 4OPJA 1U48A 4CEFA 2Z1JA 3HSTB 4FJIA 1MU2A 4F2SA 4FJ5A 1EX4A 1FK9A 1RT7A 1A5WA 5FROA 3KK1A 1IKYA 1WLJA 4DQQA 2DFHA 3AVJA 3F9KA 4BWJA 4DTUA 4ELUA 4DFMA 1Q9XA 1CLQA 3CFOA 3C94A 2KFZA 2D5RA 3PY8A 4KHNA 5I42A 3LALA 4DU4A 4FYDA 1C0MA 1RBSA 4OGCA 4B9LA 3VQ7A 5HRSA 2GBZA 4BE0A 2IOCA 2HHQA 3WNGA 2YKMA 3CM6A 4M45A 1X1PA 4FLWA 4KHSA 4PWDA 2FBVA 1RTIA 3ZT3A 4DF4A 3L2UA 3SI6A 5E41A 1T7PA 5D3GA 4Z4FA 1C0UA 1LWCA 4FJKA 1UA0A 4AILC 4CJ4A 1EKEA 2GUIA 3ZT4A 1BISA 2D0BA 3NE6A 2QKKA 2FBXA 3AVHA 5CY4A 5I3UA 5JS2A 1C1AA 1HYVA 4CF2A 5KGXA 3NGZA 2BGGA 4KI6A 3A2FA 1QTMA 3AA5X 2ITGA 4KTQA 5HRPA 4QAGA 4DTRA 3AVKA 3C95A 4KTWA 4RW4A 2YNFA 1B9FA 4KKOA 2KW4A 1WSIA 1SL0A 1R0AA 4DSLA 4FW2A 3WNFA 3O3HA 2F96A 3K5OA 1VK0A 3P5JA 4DWIA 4OGEA 4CJRA 3SUQA 1NK0A 1ZBHA 2HHSA 3SJJA 3SQ0A 2IDOA 3QEPA 4Z4IA 3PX4A 1REVA 1QSYA 4CJWA 4KB1A 4Z0UA 3ZSRA 4RW6A 2OPRA 3K2PA 1EP4A 4I2PA 4I9QA 4YNQA 3ULDA 1TK0A 4E3SA 3O4NA 4QCLA 3LPTA 3KIOA 1LAWA 3V1QA 1KVBA 4DSKA 1JLAA 3IS9A 1TL3A 2BE2A 1DTQA 4N5SA 4PUOA 1WAJA 4LSNA 1TL1A 4ID1A 2VG6A 3VQAA 3HPOA 4DLEA 3V9ZA 4CHPA 1O1WA 1N6QA 4K8XA 3KD1E 2YNHA 4AHSA 3TR8A 4CGHA 4FJLA 3LP3A 4HTUA 4HCCA 1KLMA 4M42A 4I2QA 2PY5A 4CJVA 1S1VA 1BIZA 5HLFA 4EZ9A 1RTHA 2Z1HA 3TAQA 4FK0A 4M3TA 4PA1A 4DQRA 2HW3A 3NF9A 3VQ8A 4EP4A 1VRTA 1KRPA 4CEZA 1J53A 3OS0A 2GV9A 3C6UA 3G10A 3LZJA 1WSHA 3K5NA 4FM1A 2PZSA 4FJXA 4NCBA 1D8YA 2F8SA 3LZIA 4DLGA 3T1AA 1S1WA 3LPUA 3VQ4A 4DQSA 1S9GA 4DU3A 1Q9YA 3O4QA 4KFBA 2YV0X 3RWUA 4CHQA 3QIOA 4E7KA 4CF0A 2WOMA 3HO1A 5CYQA 3AVFA 1C6VA 3AO2A 3AVGA 2OYQA 3OYHA 4B9VA 1WSJA 4WE1A 3L3UA 4CFAA 2XY7A 1SL1A 4CGGA 4CGJA 4B08A 1WNSA 3RR7A 4CIGA 3MAQA 1BIUA 1DLOA 2HHWA 4I7FA 1S1UA 3KLIA 4O4GA 3OS1A 5DK5A 4CJFA 3I0RA 4Y1CA 3QO9A 1LV5A 2OPPA 3CYMA 3M8QA 4FVMA 3T19A 4OLBA 1BCOA 3VQQA 4CFBA 1D9DA 3OYJA 3RMCA 4KHUA 3ASMA 3DRPA 3DLRA 3SPZA 4HUGA 3T3FA 4YFUA 1EXQA 3LWMA 2XY5A 4CEAA 1KLNA 1UAXA 3HVRA 1X9WA 2HMIA 4R5PA 1TV6A 3V6DA 4PY5A 3MXMA 3AVLA 1U45A 1HPZA 1JLEA 2IAJA 4H4MA 4CECA 4Z4HA 2XO7A 4BDZA 4FK4A 2HVIA 3AVBA 4LD0A 4CGDA 1SKSA 4EP5A 3SZ2A 1QS4A 4DQPA 3LP1A 2BANA 3EYZA 3TABA 4E19A 4N56A 2P1JA 1XHZA 1CXUA 3L3VA 3V9UA 4CJUA 3OYGA 2X74A 1ASVA 4GVMA 2DTUA 3SUNA 1FKOA 4E1NA 4CEDA 3TANA 2X78A 4OKJA 4N47A 4J2BA 5FRNA 3LWLA 1C1CA 4OKEA 4JRQA 4KREA 4FZXC 1XHXA 3ZSQA 4CK2A 4IG3A 1RCHA 3PUFA 4DS5A 1D5AA 1KFDA 1S1XA 3L2WA 4Z4CA 3TAMA 3TAEA 3LAKA 3AO1A 3ZSWA 2VWKA 5EU7A 3U3YA 3HVTA 1NJXA 4CEBA 4CHYA 3IRXA 3QINA 3AO3A 3P1GA 2Y1JA 1SV5A 2ETJA 4M41A 2XY6A 5JS1A 4H8KA 3ZT1A 3K58A 3AVAA 2VWJA 3TWHA 4LH4A 3VQCA 3HP9A 3ZT2A 5C24A 1GOAA 4JS4A 1ZBLA 1NK8A 4NYFA 1VSJA 2HB5A 3ZSZA 3B6PA 3ZSVA 4RW9A 3QERA 1ZBIA 4KB0A 5KTQA 4BDPA 4HCBA 1CXQA 3QNNA 3SQ2A 4QOZB 1VRUA 1KCFA 3SQ4A 3O3FA 3ZSXA 3AVCA 1JLCA 4Q5VA 3LANA 2NUBA 4CF8A 1A5XA 2RPIA 1QHTA 1YTUA 1L5UA 3H08A 2G8KA 4M3ZA 3VA0A 2G8FA 1BI4A 4FJJA 3LP0A 2HNYA 5KRTA 2AJQA 4E7JA 1VSFA 1B92A 4DFPA 1ZBUA 3SCXA 3DMJA 2IGIA 2KFNA 3M8SA 1WN7A 4M3XA 3VQPA 1WSFA 4FJ9A 4RW8A 5SWMA 4CEEA 3V9WA 4IFYA 4GMJB 3O3GA 4W5RA 4CJPA 3QEWA 1L3TA 3K5MA 3NF7A 3MXIA 1YT3A 5C25A 3V1OA 3OYNA 3EY1A 1VSHA 1RBTA 1BHLA 3K5LA 3G0ZA 4CF1A 4FM0A 4KRFA 4TSXA 4FLXA 2YKNA 1JLFA 3QIPA 2G8VA 4DSEA 3RRHA 1T03A 1S5JA 2VG7A 2YNGA 3AA4A 4IG0A 3K57A 4F2RA 3HL8A 3UIQA 3TAGA 1ZBFA 4JRPA 3V4IA 2ZE2A 3V81A 3CM5A 2LSNA 4CK3A 3DM2A 3K59A 3DI6A 4KHQA 5SZTA 2KZMA 1JL1A 2KQ2A 4M3RA 4LY7A 1BQMA 1I39A 4O44A 3L8BA 3HYFA 1Z25A 4CCHA 1HYSA 1LW0A 4H4OA 3SNNA 1HQUA 3KKSA 2F8TA 3OYKA 4O0JA 4FCYA 4DQIA 3OYCA 3MEGA 1NOZA 3PV8A 1L3UA 1YTAA 1BCMA 1VSDA 4FW1A 3NBPA 1U47A 3ZT0A 3V9XA 2D0AA 2QXFA 1RT3A 4C8NA 2FC0A 1XI1A 2A1SA 1TKTA 4M3WA 2E6MA 3MEDA 4Z4GA 4DG1A 1BI4B 3TI0A 1NK5A 4B3OA 1X9SA 1SKWA 1IH7A 3QEVA 3NGYA 1RTJA 1WSEA 3DLBA 1IKXA 3ZSOA 3VN5A 2PYLA 2YNIA 1TGOA 1IKVA 3KK3A 4F8RA 4IKFA 3VQDA 1VSMA 4C8KA 3SYZA 4B9NA 3LAMA 2ZQBA 4CFCA 1TAQA 4AHVA 3OYBA 4IDKA 1CZBA 4IBNA 2RKIA 3QLHA 3OS2A 1NJZA 4Z4EA 2O4GA 1RDAA 3OY9A 2KTQA 1JXBA 3DOKA 1FKPA 3QEIA 1VSLA 1S6PA 4MFBA 4W5QA 1X9MA 1Q8IA 4OVLA 1RBVA 4FLYA 4BE1A 3OVNA 4CERA 4DF8A 4N41A 4W5OA 5HRRA 5T7BA 4AHCA 3KLEA 3RMDA 4F3TA 3V1RA 4FK2A 1C1BA 1SUQA 3LP2A 3SUPA 4B9SA 2G8WA 4DTJA 4KO0A 1W9HA 3PX0A 2VG5A 2KZZA 4FLUA 3DYAA 3P83D 4CEQA 2OZMA 4Q0BA 1NK9A 1BGXT 4CJ5A 3D45A 2ZD1A 3LDSA 4B9UA 1KVCA 1JLGA 1TKXA 1HJRA 2QK9A 1VSEA 1HRHA 3HK2A 3OYDA 3AO4A 5KRSA 4K8ZA 4O55A 3AVMA 4JLHA 4KHYA 2HVHA 2RN2A 3CQ8A 3PO5A 3QNOA 4M3UA 5K14A 1HYZA 1GOCA 1WAFA 3E01A 1J54A 3NAEA 3NCIA 3DRSA 5J1EA 1TK8A 1RTDA 1QE1A 3MXJA 4B8AB 4KTZA 4DSFA 4CF9A 3KTQA 1HMVA 1TKZA 3HPHA 4CIFA 4ZTFA 1JLBA 2XRIA 3SPYA 4CIEA 3QESA 4CESA 2BDPA 3VQBA 4DSIA 1RT1A 1FXXA 4LH5A 2D0CA 3TAPA 2HHUA 2X6NA 4L8RB 1UOCA 4DTXA 1TAUA 3OJSA 4FJGA 3SV4A 2E6LA 1UWBA 4CHNA 3NHGA 3L2QA 3KLFA 1NJYA 4KI4A 4PQUA 1N5YA 4KV8A 3HPGA 4CJLA 4CJQA 3WNEA 2EHGA 2OZSA 1HNIA 3AA3A 1RT6A 3DLKA 5CZ1A 5C42A 3SV3A 4CJEA 1KVAA 1TVRA 2X6SA 3AVNA 5HRNA 1T05A 3D0PA 4C8LA 4DSJA 4BDYA 4GW6A 5J2MA 5HBMA 4Y1DA 3NGIA 3BGRA 4CEOA 2DFEA 4FM2A 3KJVA 3KLHA 2XHBA 4DTNA 1S6QA 1SL2A 4G1QA 3AA2A 4B9MA 1RILA 1W0HA 3AV9A 3U3GA 3NF8A 3IAYA 4JS5A 1U4BA 5CYMA 1JKHA 1HNVA 2YHAA 1G15A 1D9FA 3VA3A 3RRGA 1LAVA 1RT4A 1NK6A 3RMAA 2I5JA 3F73A 2QKBA 4NYNA 4IFVA 4ICLA 2A1RA 2OPSA 4OKKA 2JLEA 3NF6A 4O5BA 3AO5A 4OPKA 1GOBA 1JLQA 2Z1GA 3MECA 3OYAA 1RDCA 4DS4A 2P51A 4N76A 3S3OA 1U49A 5J2QA 1TKDA 5FRMA 4KAZA 4KPYA 1T8EA 3JYTA 4AHRA 4HVJA 4DFJA 4W5TA 3CG7A 4XIUA 3JSMA 3B6OA 3TAFA 3ZSYA 1A5VA 3OYEA 4FJNA 3FFIA 3OYLA 4FXDA 4DU1A 2W42A 4MQ3A 3KK2A 2HHXA 2JGUA 3I8DA 1EETA 1VSKA 4KHWA 1U04A 4C8MA 1LW2A 1ITGA 3SUOA 1IO2A 3IG1A 1KFSA 4AHTA 4AH9A 3RTVA 1QQCA 1RT2A 3DLGA 4B8CA 4CE9A 1WSGA 3DRRA 3HJFA 3NFAA 2R7YA 1ASWA 3CFRA 4FZZA 1J5OA 1LWFA 4FJ7A 3M8PA 2OPQA 4BWMA 4CFDA 4ELTA 4F3OA 1NJWA 4BACA 1RDDA 2IS3A 4CJ3A 3ITHA 4CJKA 2PYJA 4FJMA 4DFKA 4NCAA 3VQ6A 4DTSA 5HROA 5J2PA 4HUFA 4E7LA 4F4KA 3AVIA 4CJTA 4B9TA 1CZ9A 3DOLA 3ZCMA 2XY8A 4AHUA 4HUEA 5KGWA 1LWEA 4FLZA 5HP1A 3OYFA 1XWLA 3S3NA 4HHTA 4FLTA 1QSLA 1NKCA 4I9LA 3L2VA 4CGIA 1DTTA 3DLHA 2P5OA 4ZTJA 4DTPA 2G8HA 2RF2A 3QETA 4E7IA 4RW7A 3DLEA 2B4JA 3HT3A 4M3YA 1JL2A 3RR8A 3L2RA 4NCGA 3PX6A 3ISNC 3MEEA 3NH1A 2WONA 4DMNA 1NOYA 5CZ2A 3QEXA 1RBRA 4ID5A 4UQGA 4J2EA 2HHVA 3ALYA 3C6TA 2E4LA 3VQ9A 1UA1A 4RG8A 4FZYA 1J9AA 1ASUA 4CHZA 2B5JA 3NH0A 2Z1IA 1TK5A 2G8UA 4FJHA 3PO4A 2HNZA 3KD5E 1NK7A 4C8OA 1Y97A 2B6AA 2FBYA 4E7HA 3SQ1A 1C0TA 2EX3A 1YVUA 4ZHRA 1ZYQA 1S1TA 1NKBA 5DMRA 3HP6A 3S9HA 3OJUA 1VSIA 4OJRA 4BE2A 3HM9A 3I0SA 3S3MA 4O0IA 4J2AA 2O4IA 1RDBA 4DTMA 1HQEA 2DY4A 3KLGA 5J2NA 2YHBA 3VQEA 4J2DA 4OLAA 3NDKA 4CJSA 4ELVA 5KI6A 1BQNA 4CHOA 1IKWA 4EZ6A 1RBUA 3OYMA 3U6FA 2HHTA 1KSPA 2FBTA 4CGFA 1NK4A 1XC9A 3THVA 1B9DA 2G8IA 5FDLA 1L3SA 2Q3SA 3M8RA 2Y1IA 3RMBA 2IC3A 1F21A 3KKRA 4FJ8A 4E89A 1JXEA 1I3AA 3OYIA 3TARA 1K6YA 3EZ5A 4LSLA 1KTQA 4CK1A 2ATQA 3CFPA
chains in the Genus database with same CATH superfamily
1BL3A 2OA8A 2P5GA 4JI3K 4BQZA 4E1MA 3V9SA 3VQ5A 3ULEB 3HSTB 4JI6K 1MU2A 4FJ5A 4YDUA 3I8BA 2JWKA 2YJEA 1CLQA 3EE9A 4DFMA 2GX9A 1Q9XA 2D5RA 4BR0A 3LALA 4DV2K 1NGBA 1X9JA 2AA4A 3BZKA 5HRSA 1S22A 4CZIA 4B1VA 2HHQA 3CD6N 4M45A 2FBVA 4EAHD 4DF4A 3SI6A 4FSVA 1LWCA 2UXCK 3SLCA 3NE6A 3ZETB 3N4QA 4LF4K 2P9PB 4EIAA 4JKEA 4KTQA 4PKGA 3SAHA 1OVQA 4DSLA 3FZLA 4FWOA 3K5OA 3GE1A 4CJRA 1VQON 4KB1A 2OPRA 2E1ZA 3K2PA 1EO1A 2VWBA 5I9EB 3O4NA 4RWTA 1J6ZA 3MWPA 1TL3A 1DTQA 1WAJA 2A3ZA 2VG6A 1P8ZA 5LL6Z 1N6QA 4K8XA 2W41A 3ID6A 2GUPA 4AHSA 2W40A 4FJLA 3RSEA 4G9ZA 4MLHA 5AQYA 4CJVA 1S1VA 5HLFA 4EZ9A 2Z1HA 3TAQA 2HW3A 1NLVA 3JXUA 4X64K 3NF9A 3VQ8A 1KRPA 4CEZA 1J53A 2GV9A 3C6UA 3CQXA 4UY8O 3O9SA 3VF2A 2F8SA 4NCBA 2YX6A 1N34K 4DLGA 4GV3A 3LPUA 3C7NB 3VQ4A 4DU3A 1HKBA 4KFBA 2YV0X 3QIOA 5M1OA 2WOMA 5CYQA 3AVFA 3AO2A 3L3UA 1M90O 4CZMA 3FZKA 3ZX2A 3MAQA 2HHWA 1Y64A 4KHPK 5DK5A 4Y1CA 3QO9A 2OPPA 4OLBA 3CCSN 3H6EA 3O1BA 5ELZA 4KHUA 4CBUA 1Q7YO 3T3FA 3BF3A 4YFUA 3HVRA 4PY5A 2PFUA 1JLEA 4H4MA 5LMNK 4FK4A 3AVBA 4LD0A 3UB5A 1W2BM 4IXCA 4HWIA 4BR4A 4I6MB 3S41A 3EYZA 2RHKA 3TABA 1E4FT 4N56A 2P1JA 3OYGA 3H3OB 4CEDA 4BG8A 4N47A 1C1CA 3CMEN 3D2EB 4KREA 4FZXC 4IWVA 4CK2A 3PUFA 4DS5A 1KFDA 3TAMA 4DR6K 4H0VB 1WBBA 1T3VA 1NJXA 4WQ4C 2YHYA 1NU0A 5AQKA 4M41A 3BP8A 4B3MK 4JI8K 4LH4A 1NGJA 4JK8A 1ZBLA 1V4SA 1ZBIA 4BGAA 5KTQA 1CXQA 3QNNA 3MX2A 1KCFA 5LMUK 4Q5VA 2CGJA 1A5XA 2F9WA 1YTUA 3VA0A 3LP0A 4BVPA 2HNYA 3SJHA 1ZBUA 2QXLA 3EL2A 4DFPA 5AQJA 4M3XA 3NVKA 3O3GA 3QEWA 3WT0A 3HOSA 3MXIA 1YT3A 4FM0A 4TSXA 4FLXA 4H0PA 4C1NK 1YIJN 1S5JA 1RGIA 1N32K 4IG0A 3K57A 4H0XB 2P9SA 5HL7L 3TAGA 2ZE2A 3V81A 5E84A 2Q0UA 3DM2A 1VQ8N 2KZMA 1HYSA 1Z25A 4BRIA 1HQUA 3KKSA 5C2DA 3MEGA 1L3UA 4NXMK 4C1NI 4BRGA 4BVOA 2UU9K 3LL3A 1YJNN 3VGKA 3OTOK 5AQVA 4B3SK 2E6MA 4M3WA 4Z4GA 1OH6A 4K43A 4B3OA 3QEVA 2PYLA 3TTDA 5BR9A 3LAMA 1VQ4N 4IBNA 3QLHA 2O4GA 1RDAA 2NLXA 3OY9A 1JXBA 3QEIA 1FKPA 3WXJA 1X9MA 4JI0K 1Q8IA 1RBVA 4FLYA 1BA0A 3EKUA 3RMDA 4AHCA 1KD1O 2NRZA 1NGGA 3HBTA 2EWSA 4FWQA 3QMLA 4KO0A 4WQ5A 3FGUA 3WUHA 5BRHA 4FLUA 4CEQA 2OZMA 2CH6A 4BRPA 5EX5A 3D45A 1JLGA 3OYDA 3F9MA 4K8ZA 2D0PA 3AVMA 4KHYA 2RN2A 3O9QA 3VF4A 1GOCA 3PSFA 3E01A 4H5NA 4DSFA 4CIFA 4KH6A 3VQBA 4LH5A 3TAPA 4BRCA 1TAUA 4L8RB 4DTXA 3L6QA 1LOTB 4CHNA 4JAXA 4PQUA 1HX1A 3E9OA 1MWMA 3WNEA 2OZSA 3AA3A 5CZ1A 3SV3A 5HOOA 1YVNA 4YORA 3VTHA 5AZIA 4C8LA 2QWRA 3NGIA 4CEOA 2DFEA 4WCEL 1SL2A 3AA2A 3AV9A 3U3GA 3IAYA 4CZKA 4M63C 1SAZA 1NK6A 3RMAA 3TSUA 2QKBA 2HMPA 4NYNA 1ESVA 4A5AA 2JLEA 2O8BA 3NF6A 3SNNA 3AO5A 1GOBA 2P51A 4JD2B 5J2QA 4DQ8A 5EXWA 5IT9O 4K25A 2QWNA 3FFIA 5KPTA 3MCAB 5CE3A 1K8KA 2W42A 4MQ3A 1NBWA 3B8AX 4ILJA 4C8MA 1ITGA 4H5WA 1IO2A 3MN6A 4AH9A 3LDLA 5EY4A 1QQCA 4CE9A 3R6MA 3DRRA 3HJFA 3CFRA 1K9MO 5BRFA 2I7PA 4CFDA 2F7TA 3QBWA 4DUYK 2IS3A 1RDUA 3ATUA 4NCAA 2I7NA 1GLLO 4BC4A 3VQ6A 5J2PA 4HUFA 3KVGA 3A0IX 3OYFA 2WUSA 4CGIA 5FPDA 4KH4A 5KPRA 2O8FB 2A6AA 1QZ5A 1Z05A 2B4JA 3RR8A 1V4TA 1NOYA 3MEEA 3NH1A 2HHVA 3C6TA 3VQ9A 5JMVA 4FZYA 3ULEA 1ASUA 3WXKA 4CHZA 3NH0A 2Z1IA 1TK5A 2G8UA 3GL1A 4FJHA 3PSIA 1DT9A 2FBYA 2Q97A 3M6GA 3S9HA 3TU5A 1VSIA 1BG3A 2E1YA 4OJRA 4DV1K 3S3MA 1HQEA 5GADP 3KLGA 5J2NA 3VQEA 3WXMB 4J2DA 3K0SA 2HBLA 5JVHL 4CHOA 3U6FA 2V7YA 1NK4A 1S3XA 2GWJA 5GAEP 1QQNA 3DLLL 3RMBA 3SK3A 4E89A 1I3AA 4JK7A 3EZ5A 3ZETA 4AM7A 1ILYA 4BR9A 2ZGYA 4K42A 1IG9A 1QSSA 4JI4K 1RT5A 2P9UA 3ENOA 3GBTA 5F2RA 4H0YB 1L3VA 4B1WB 4DV6K 1EX4A 3E9LA 1WLJA 4CJ7A 4DTUA 3MN5A 3C94A 2KFZA 4MDBA 5I42A 1C0MA 4QS8A 3VQ7A 1N33K 4B1XB 4BC5A 4BE0A 2IOCA 3WNGA 4FLWA 1X1PA 3E9PA 3ZT3A 5E41A 5TKWA 3SBTA 1C0UA 4FJKA 1UA0A 1VQMN 1BISA 2WBNA 2D0BA 1ZC6A 3THYB 2FBXA 4BC3A 5CY4A 4U67L 4JKFA 5JS2A 3NGZA 3TSQA 3C65A 2BGGA 2UUBK 3AA5X 2ITGA 3AVKA 4BRQA 4RW4A 1YITN 3LDPA 4KKOA 3T69A 2KW4A 1Z6RA 4FW2A 1NGCA 4Z94A 3W3DA 3SAGA 4OGEA 2HHSA 4Z4IA 3O80A 2VQFK 4IO9L 1HNWK 3PIPL 2GTDA 4I9QA 2YHXA 4YNQA 1TK0A 4E3SA 4QCLA 5AQXA 2P9KB 3SMPA 3IS9A 3TPQA 3VEOA 3J7AP 1U6ZA 4PUOA 4LSNA 3V9ZA 4DLEA 4BREA 1O1WA 3WEEB 4CGHA 4IDHA 1KLMA 4DR3K 4FK0A 3GG4A 1Q82O 4BY9C 2E20A 3LZJA 2KKZA 1WSHA 4I6MA 3K5NA 4FM1A 1D8YA 3LZIA 1S1WA 3VERA 1S9GA 2ZJQL 1Q9YA 1P90A 1IJJA 3T1YK 1GLBG 2OYQA 4WE1A 4CFAA 2XY7A 4BGBA 3RR7A 3KK7A 2UXDK 3UKUB 1DLOA 4I7FA 3I0RA 1KAXA 4A62A 5BPLA 3T19A 4FVMA 3EEQA 1VQ9N 3OYJA 3ASMA 4HUGA 1NMNA 5JLHA 1EXQA 3LWMA 2XY5A 2VQEK 1KLNA 3K9KA 1UAXA 3W0LA 3IUCA 3DXKB 1Q81O 4R5PA 3V6DA 2IAJA 4BDZA 1N8RO 3G25A 2HVIA 4BRLA 4LF6K 1BA1A 2O8DB 2BANA 1CXUA 3L3VA 1C0FA 4CJUA 1XQSC 4GVMA 5BPMA 1QZ6A 2NRVA 2WTUA 4V19S 4YOWA 4OO1J 4PL7A 1RCHA 1D5AA 4Z4CA 3LAKA 3F5TA 5EU7A 4CEBA 2P9IB 5DM6L 3IRXA 4YOUA 3AO3A 1ZXOA 2WFBA 1KQSM 4X65K 4X66K 3ZT1A 3CERA 3K58A 3IDHA 3AVAA 2VWJA 2E2NA 3ZT2A 1NK8A 1GOAA 2G8KA 4FYDA 1VSJA 2HB5A 3ZSZA 3B6PA 3QERA 4RW9A 4BDPA 4HCBA 4QOZB 1VRUA 3VEYA 3PLAA 3SQ4A 3AVCA 2VGMA 3LANA 2NUBA 4CF8A 3P38A 4BRMA 3CHWA 4JV5K 3H08A 3O8MA 4O5FA 4A61A 4FOEA 5KRTA 2AJQA 1KXPA 1B92A 3DMJA 2IGIA 4WYBA 1WN7A 4FJ9A 3J7ZO 3V9WA 4IFYA 4BROA 1L3TA 3OYNA 2ZM6K 3U8XA 3DXMB 1RBTA 4PKHA 4LF8K 1E4GT 1IV0A 2V51B 4BRKA 2YNGA 2VG7A 1H1VA 3AA4A 4DV7K 1ZBFA 4IOCL 3V4IA 3C6HA 3N4PA 5SZTA 4A2AA 4CBWA 4H4OA 2F8TA 3OYKA 1NOZA 1YTAA 4BRHA 4FW1A 1YF5L 3NBPA 1U47A 1YJ9N 3D2FA 3V9XA 2QXFA 1TKTA 3VOVA 4M7XA 5KPZA 2BUPA 3ID8A 1SKWA 5GIOA 3NGYA 3DLBA 1IKXA 4MO4A 1IKVA 3KK3A 4F8RA 3VQDA 3CMAN 1TAQA 4AHVA 4H5VA 3OYBA 1NJZA 1CZBA 3OS2A 4Z4EA 4L3QA 3I55N 1VSLA 4ILGB 2E2OA 4BE1A 4CERA 4W5OA 5HRRA 3QB0A 3V1RA 3F2KA 2NRHA 3BY5A 2VG5A 4OPAA 1N36K 2NRWA 1BGXT 4M3ZA 2ZD1A 4CZLA 1TKXA 1HJRA 1VSEA 1HRHA 1WOQA 3THWB 5KRSA 5GINA 4O55A 3CQ8A 3QNOA 4M3UA 5K14A 1HYZA 1WAFA 1J54A 3GOIA 5IWAK 3NAEA 1TK8A 1RTDA 4KTZA 4CF9A 3HPHA 4ZTFA 3SPYA 4MO5A 3QESA 4JD2A 1RT1A 1FXXA 3CC4N 4M7YA 1UOCA 1VQKN 3SV4A 4O8UA 2EHGA 1HNIA 5C42A 1RT6A 2DPNA 2OTLN 4ILHA 1KVAA 3AVNA 4FOIA 3CC7N 4DSJA 3CCRN 4FM2A 4DTNA 1S6QA 2ZGZA 1TUUA 1U4BA 5M1QA 4IOAL 5CYMA 1JKHA 4DR5K 1D9FA 2W6KA 3RRGA 4DR1K 1XMOK 3P4IA 2VCPA 3F73A 4K0KK 4O5BA 4DS4A 2Z1GA 1JLQA 4N76A 4DB3A 1RDCA 3EO3A 4A2BA 3U4LA 1TKDA 1TYQA 1T8EA 4IJAA 3CG7A 3JSMA 2O8FA 3TAFA 1A5VA 3CCVN 3OYEA 3CJAA 2KLAA 5AFUH 4DU1A 1DEJA 2HHXA 3WXLA 2JGUA 3I8DA 1EETA 3M1FA 3O9TA 3IG1A 3MCPA 3RTVA 1RT2A 3DLGA 4B8CA 1WSGA 1YI2N 4FZZA 1J5OA 1LWFA 4J8FA 4LF7K 2QWLA 4BWMA 3T7ZA 3CI5A 4B1YB 4CJKA 4E7LA 4ISGA 3DOLA 2XY8A 4AHUA 4HUEA 5KGWA 4FLZA 3CQYA 1E3MA 5F1XA 4I9LA 3DLHA 4ZTJA 2QEXN 3QETA 4JEPA 4RW7A 3PX6A 1WUAA 4J2EA 1HR0K 1VQNN 5AQLA 2E4LA 1J9AA 1NJIO 3PO4A 2HNZA 4YDUC 2QM1A 2ASPA 3A5MC 4B1UB 1ZYQA 3NMUA 1W7AA 2ASOA 3HP6A 4BE2A 2FSJA 4DTMA 2YHBA 3H1QA 4GKKK 1BQNA 3OYMA 2HHTA 1K73O 1KSPA 5C0YA 4LC9B 1XC9A 3VEWA 3J80O 3H1VX 3M8RA 2Y1IA 3RSEB 1F21A 3TARA 1K6YA 2NZTA 3THYA 4XEIA 4H5RA 2ATQA 1IG8A 1VAZA 3CFPA 3BDPA 1Z26A 3HXMA 3MDQA 5C15A 2Q2RA 1S9EA 4LFAK 4FLVA 1NKEA 2HNDA 1VQPN 3JAMO 1U48A 4CEFA 4A57A 2Z1JA 4F2SA 1RT7A 3DAWA 4CZEA 4NB4A 1A5WA 1IKYA 2DFHA 4FWRA 3F9KA 2D0OA 5M1KA 4NO7A 3CFOA 1SS6A 3SMSA 3VEVA 3EZWA 4BRFA 2P9KA 5AQSA 4PKIA 2FSKA 2YKMA 3CM6A 2HBKA 5AQFA 1RTIA 3L2UA 1T7PA 3WEEA 1HLUA 1LCUA 5LJVA 4Z4FA 1SQKA 4AILC 2UYTA 1EKEA 3WXIA 2E88A 3ZT4A 2KHOA 1J5EK 1FJGK 3CJ9A 4KBOA 4H0OA 3R3LA 3AVHA 5I3UA 1O13A 1JCGA 4CF2A 1HYVA 1EWQA 4KI6A 5HRPA 4HTLA 4QAGA 2YI1A 4DTRA 2O8CB 4KTWA 3Q7CA 4IOXA 2PBDA 1WSIA 1SL0A 1R0AA 1U2VB 3O5BA 2F96A 1VK0A 4A59A 1VQ6N 3P5JA 1GLDG 1ZBHA 3THXB 3OHRA 3SQ0A 3QEPA 2UXBK 4EFHA 5LJWA 3SAFA 4Z0UA 3UKUA 3ZSRA 4CW7B 4RW6A 1EP4A 4I2PA 3ULDA 4FWPA 1KVBA 5AJ3K 2BE2A 5AFUA 3BEXA 3VGMA 3VQAA 4CHPA 3KD1E 5F0XA 1IBMK 2FXUA 3TR8A 3LP3A 1IBKK 3RVCA 3TTCA 4I2QA 2PY5A 1BIZA 4PA1A 3QFUA 2A40A 3OS0A 2O8DA 4WFAL 1ZBSA 2PZSA 4FJXA 5LY3A 1S72N 4PHTX 2FF3B 3RWUA 4CHQA 4E7KA 4CF0A 3HO1A 3ZEUB 1WSJA 1SL1A 4CGJA 4JI7K 3ZLJA 1MWKA 1WNSA 4F9OA 3KLIA 4O4GA 4LF5K 4CJFA 4BRDA 3BZCA 3FZFA 1OH7A 1BCOA 1XNRK 1D9DA 4GKJK 3A5LC 5CHIA 3QBXA 4O8KA 3IFRA 5GIPA 1X9WA 4FWNA 1TV6A 3MXMA 3AVLA 1U45A 4FO0A 4CECA 2XO7A 3H46O 3FR0A 5AQZA 3CCLN 3OW2M 1QS4A 2P9PA 5AQQA 1NGIA 3A5OC 4E19A 3V9UA 4JI5K 2F9TA 2X74A 4C23A 4DR7K 4FWLA 2DTUA 3SUNA 3TANA 4J2BA 3LWLA 4OKEA 1YJWN 4JRQA 1HUXA 3ZSQA 3CF5L 3CJ7A 5M1FA 1S1XA 3L2WA 3DXMA 2QWQA 3C0BA 2HBMA 2VWKA 3U3YA 4H03B 4IEIA 2VGNA 2QA4N 3WQUA 3P1GA 3HSCA 3MN7A 4B1ZA 2XY6A 4H8KA 4FWMA 4FJ7A 3KWIA 3HP9A 5C24A 3TTFA 4JI2K 1MA9B 4JKGB 2IVNA 3SQ2A 4EHUA 3ZSXA 1JLCA 5AQWA 2CGKA 2RPIA 5AQGA 1QHTA 3AY9A 1L5UA 3J7YP 3C7NA 4E7JA 1VSFA 5FPMA 2KFNA 3E1YA 1Q18A 3VMFB 3M8SA 4RW8A 4GMJB 3VESA 5C2FA 4IEEA 3K5MA 4FPAA 1QVFM 3V1OA 3HI0A 4Y0WA 1BHLA 4DUZK 5AQUA 1MDUB 4KRFA 2YKNA 1NWKA 1JLFA 4WQ4A 2G8VA 3RRHA 1QQMA 3CETA 3AARA 4F2RA 4B3RK 2E2QA 4CK3A 4YY3K 3MWTA 4M3RA 4LY7A 4O44A 4WQ5C 3L8BA 1OVYA 1K8AO 4O0JA 4DQIA 3MMVA 3OYCA 1ATRA 4JNEA 1RDWX 3PV8A 1BCMA 1VSDA 1DKGD 1RT3A 2FC0A 1XI1A 2A1SA 4DG1A 1BI4B 3TI0A 1NK5A 3SBGA 1X9SA 1IH7A 1RTJA 3FZMA 1TGOA 4IKFA 5AQMA 3A5NC 1VSMA 4CZFA 3D2EA 2QWMA 3SYZA 4B9NA 1BO5O 4CFCA 3UKRB 3AGRA 3PIOL 4IDKA 2RKIA 4CBXA 4U7BA 3CC2N 2KTQA 3CPWM 1S6PA 2ITMA 3R9PA 4OVLA 4DF8A 3OVNA 4N41A 4F3TA 4FK2A 3MK6A 1C1BA 1SUQA 4NLCA 4XH1A 3QFPA 4DTJA 3M5RA 2AP1A 3Q7BA 3P83D 4Q0BA 1NK9A 4CJ5A 3L4IA 3FZHA 3LDSA 1KVCA 2O8EB 2QWPA 3G6EN 3HZ6A 2V52B 4JLHA 3PO5A 3J81O 5M1NA 1XMQK 3NCIA 3T1HK 4B8AB 3KTQA 2E8AA 1HMVA 2NRXA 3NVMA 2BDPA 1IBLK 3OJSA 4FJGA 3M3ZA 2E6LA 1UWBA 3LM9A 3NHGA 3L2QA 4KI4A 4KV8A 3TSPA 3HPGA 4CJQA 4WFNL 3DLKA 1TVRA 2X6SA 5HRNA 1T05A 5JLFA 4FL9A 3GDQA 4GW6A 5J2MA 3BGRA 3KLHA 2Q0RA 2A42A 2XHBA 4G1QA 3E66A 3NF8A 2P9LB 4R79A 4AQYK 2A5XA 2CH5A 3LDOA 4BR7A 5BR8K 4QS7A 4GY2B 2I5JA 3FFKB 3HOTA 4IFVA 4EHTA 1YUWA 4OKKA 1EWRA 2UUAK 1U49A 4H0TB 5FRMA 1XUPO 4KPYA 3JYTA 4HVJA 4JHDB 3AAPA 4XIUA 3B6OA 3HTVA 4FJNA 3OYLA 1XNQK 2P9UB 3KK2A 3P39A 1VSKA 5AR0A 4KHWA 3G71N 1OH5A 3NFAA 5A2QO 3ZX3A 2OPQA 3ENHA 1RDDA 2PYJA 5KQ8A 4DFKA 4MLEA 4JKCA 4BC2A 4F4KA 4DR4K 5H1SQ 1CZ9A 1HPMA 4B9TA 3ZCMA 4MDAA 3C6AA 1LWEA 4E1JA 5HP1A 3ZYYX 3S3NA 4HHTA 4JYAK 1DTTA 2P5OA 3VF6A 2GEMA 4DTPA 5KQDA 2RF2A 4E7IA 1TUYA 5BREA 3L2RA 4YOVA 3ISNC 4DMNA 3LDNA 4ISEA 4UQGA 5AQRA 3ALYA 1UA1A 4RG8A 2B5JA 2H3GX 3CJBA 3IKMA 1YAGA 1HJOA 3O6WA 5FLXO 2B6AA 4BG9A 1C0TA 2EX3A 1S1TA 3O9RA 5C10A 2D4WA 3FLCO 3HM9A 2QWOA 4J2AA 2O4IA 1RDBA 2YJFA 5AQHA 3KWGA 4OLAA 4K41A 2CGLA 4CJSA 3NDKA 4ELVA 5KI6A 5FPEA 1HKGA 5AZJB 1RBUA 2UUCK 3L0QA 5AQOA 2FBTA 4CGFA 2P9NB 1L3SA 2Q3SA 4AM6A 4CD1A 2ZWHA 1JXEA 3OYIA 4LSLA 1KTQA 3IMXA 4CK1A 1X3MA 3WQTA 4YOYA 2HSTA 3LM2A 3WNHA 4W5NA 4JI1K 3AAQA 1SKRA 2DFFA 3OBYA 1RNHA 1OKJA 2ZJPL 4DTOA 4E0DA 2O8CA 4RTFD 3NH2A 1BDGA 4XH4A 1U2VA 4OPJA 4FJIA 1NGFA 1FK9A 1T6CA 5FROA 3KK1A 3THXA 4DQQA 3AVJA 4BWJA 4ELUA 1GLEG 3J8AA 4CVNE 3PY8A 4KHNA 1JCFA 4YOXA 4DU4A 2HF3A 1RBSA 4OGCA 3BF1A 4B9LA 4CZHA 4LF9K 4NXNK 2GBZA 2OTJN 3VEXA 4PWDA 2QW9A 4KHSA 5TKYA 5D3GA 4FVUA 4DV4K 4CJ4A 3MX5A 2GUIA 2PAVA 2QKKA 1D4XA 1GLAG 1C1AA 5KGXA 4PL8A 1HNZK 3A2FA 4ISFA 3U9ZA 4X62K 1QTMA 3C95A 2YNFA 1VQ7N 1B9FA 1JJ2M 3WNFA 3O3HA 3FE1A 3ZEUA 4DWIA 3SUQA 1NK0A 2E5LK 3SJJA 2IDOA 3LDQA 3PX4A 1REVA 1QSYA 4CJWA 3K9JA 1NGAA 4NLBA 3LPTA 1YHQN 5GAHP 3KIOA 1LAWA 3V1QA 1NGDA 4DSKA 1JLAA 3QDKA 4CD3A 4N5SA 1TL1A 4ID1A 3HPOA 2W6LA 2YNHA 4HTUA 2Q1NA 4HCCA 4M42A 1SZ2A 1RTHA 4M3TA 1OH8A 4DQRA 4EP4A 1VRTA 4CZJA 5ADXH 3G10A 3HM8A 4JN4A 5EVZA 3T1AA 5DM7L 4JK9A 3O4QA 4JKAA 4AF1A 1C6VA 3AVGA 4B9VA 3OYHA 1C0GA 4BRNA 4CGGA 4B08A 3O4WA 4CIGA 2FLOA 2IVOA 1BIUA 4QS9A 1S1UA 3OS1A 1YXQA 1JCEA 3DJCA 5CR4A 1LV5A 3CYMA 3M8QA 5AQTA 4FPBA 3ZX0A 1G99A 3VQQA 4CFBA 3RMCA 3VGLA 1NGEA 3DRPA 3DLRA 3SPZA 3OA9A 4BQLA 4CEAA 2IIRA 2HMIA 4CZGA 1BU6O 1HPZA 4JKGA 4Z4HA 3D2FB 4CGDA 1SKSA 4EP5A 3O9UA 3SZ2A 4DQPA 3LP1A 3QICA 1XHZA 1ASVA 1FKOA 4E1NA 2IVPA 2X78A 2HBJA 4OKJA 5FRNA 3A8YA 3DWLA 2HHHK 1I94K 1XHXA 4IG3A 1GLFO 4DV5K 3TAEA 4IFEA 3AO1A 3ZSWA 3HVTA 5BN9A 2F4VK 4LFBK 4CHYA 3CCQN 3QINA 1T44A 3G4SN 2Y1JA 1SV5A 2ETJA 5JS1A 2V7ZA 3VEZA 3TWHA 3VQCA 4JS4A 3L4QA 4NYFA 3ZSVA 1ATNA 4KB0A 2YHWA 4BR2A 3I33A 3O08A 2ZJRL 5EOYA 5BPNA 3O3FA 1XC3A 1NNEA 3H45C 2G8FA 3KZBA 1BI4A 4FJJA 5E26A 2OANA 3SCXA 4LFCK 3VQPA 1WSFA 5SWMA 4CEEA 1NMDA 4W5RA 4CJPA 1NM1A 3NF7A 5C25A 3UKRA 3EY1A 1VSHA 3K5LA 1QVGM 3G0ZA 4CF1A 1WBDA 5MLCQ 3R8EA 3QIPA 4DSEA 1T03A 2WC9A 3U9DA 3HL8A 2Q36A 3UIQA 2HOEA 4JRPA 3CM5A 2LSNA 4KHQA 3K59A 3DI6A 1KC8O 1JL1A 3OBWA 2KQ2A 3MN9A 1BQMA 1I39A 3VPZA 4CCHA 3HYFA 1LW0A 3AGKA 3DXKA 4DHYA 4FCYA 4IO8A 4DV3K 2O8EA 3ZT0A 3CPEA 2D0AA 1BUPA 4C8NA 3CCJN 3MEDA 5C12A 1GLJO 1WSEA 3ZSOA 3VN5A 2YNIA 1R59O 2A41A 3H3NO 2NRTA 5B8HA 3P31A 2BH1A 4C8KA 2ZQBA 1TYQB 4YHHK 3EKSA 1VQ5N 2NNWA 3DOKA 3D7EO 4MFBA 4W5QA 3VENA 1GLCG 1T6DA 2ASMA 2P9IA 3HRGA 4FWKA 5ADXA 4YOTA 3KLEA 5T7BA 2P9SB 3R1XA 3LP2A 3SUPA 4B9SA 5AQNA 1HNXK 2G8WA 3PX0A 1W9HA 2KZZA 4OPHA 3I56N 2D1KA 1ATSA 4CI6A 3DYAA 5GAGP 2HF4A 4B9UA 4JKBA 3HK2A 2QK9A 2P9LA 3AO4A 2HVHA 2FF6A 1W97L 1HKCA 3ENBA 5FPNA 3DRSA 5J1EA 4WFBL 2E2PA 1QE1A 3MXJA 2BTFA 5JICA 1TKZA 3BUZB 1JLBA 2XRIA 4CIEA 3EE8A 4CESA 4DSIA 2D0CA 1VQLN 2HHUA 2X6NA 4JHDA 4JKHA 4GNIA 3CCMN 1QQOA 3JS6A 3KLFA 1NJYA 1N5YA 4CJLA 3D6RA 5AQIA 3VTIA 4CJEA 4JKDA 2OCEA 3D0PA 4GV9A 4BDYA 5HBMA 4Y1DA 3KJVA 3CCEN 2NRRA 4B9MA 1RILA 1W0HA 4DV0K 1X3NA 4JS5A 4OX9K 1HNVA 4DCHA 1G15A 2YHAA 3VA3A 1LAVA 1RT4A 4H5TA 4ICLA 2A1RA 2OPSA 2ZF5O 4OPKA 4DQSA 3MECA 3OYAA 4XH5A 1FW6A 3S3OA 2QTDA 4KAZA 4AHRA 4DFJA 4GVEA 4W5TA 5AQPA 4BRAA 3ZSYA 4FXDA 3CXCM 2GWKA 4IJNA 3CCUN 4B9QA 1DGKN 4DKWA 1U04A 1LW2A 3SUOA 5AZIB 1KFSA 4AHTA 1NGHA 2R7YA 5JVGL 1ASWA 2J4RA 3M8PA 4ELTA 2VYPA 4F3OA 1NJWA 4BACA 4CJ3A 3ITHA 4FJMA 3THWA 5BN8A 4DTSA 5HROA 2Q31A 4GV6A 3AVIA 3CIPA 4CJTA 1RFQA 5AZJA 5M1PA 1XWLA 2P9NA 4FLTA 1QSLA 3CJ1A 2O8BB 1NKCA 4BR5A 3L2VA 2QI2A 1WB9A 1M1KO 1EQYA 2G8HA 1BOTO 3DLEA 3HT3A 4M3YA 1JL2A 1Q86O 5BRDA 4NCGA 2WONA 5CZ2A 3QEXA 1QHAA 1RBRA 1K8KB 4ID5A 3VETA 2GELA 4KH5A 3KD5E 1BWFO 1NK7A 4C8OA 1Y97A 3KHYA 4E7HA 3SQ1A 4ZHRA 1YVUA 2RE2A 4FWSA 4WF9L 1KAZA 3EN9A 1NKBA 5DMRA 3ATVA 3OJUA 1VHXA 3I0SA 3CJCA 4O0IA 2DY4A 1CZAN 2FSNA 2JWLA 4DR2K 3O1WA 4RCHA 1IKWA 3UE5A 4EZ6A 1NG9A 2YCHA 4IZ9A 4B3TK 1KAYA 3THVA 1B9DA 4A5BA 2G8IA 5FDLA 2IC3A 3KKRA 4FJ8A
chains in the Genus database with same CATH topology
1BL3A 3BDPA 1Z26A 3WNHA 3HXMA 2OA8A 4W5NA 1SKRA 1IG9A 2DFFA 2P5GA 1RNHA 1QSSA 1RT5A 4DTOA 1S9EA 4E0DA 4E1MA 4FLVA 3NH2A 3VQ5A 3V9SA 1NKEA 1L3VA 2HNDA 4OPJA 1U48A 4CEFA 2Z1JA 3HSTB 4FJIA 1MU2A 4F2SA 4FJ5A 1EX4A 1FK9A 1RT7A 1A5WA 5FROA 3KK1A 1IKYA 1WLJA 4DQQA 2DFHA 3AVJA 3F9KA 4BWJA 4DTUA 4ELUA 4DFMA 1Q9XA 1CLQA 3CFOA 3C94A 2KFZA 2D5RA 3PY8A 4KHNA 5I42A 3LALA 4DU4A 4FYDA 1C0MA 1RBSA 4OGCA 4B9LA 3VQ7A 5HRSA 2GBZA 4BE0A 2IOCA 2HHQA 3WNGA 2YKMA 3CM6A 4M45A 1X1PA 4FLWA 4KHSA 4PWDA 2FBVA 1RTIA 3ZT3A 4DF4A 3L2UA 3SI6A 5E41A 1T7PA 5D3GA 4Z4FA 1C0UA 1LWCA 4FJKA 1UA0A 4AILC 4CJ4A 1EKEA 2GUIA 3ZT4A 1BISA 2D0BA 3NE6A 2QKKA 2FBXA 3AVHA 5CY4A 5I3UA 5JS2A 1C1AA 1HYVA 4CF2A 5KGXA 3NGZA 2BGGA 4KI6A 3A2FA 1QTMA 3AA5X 2ITGA 4KTQA 5HRPA 4QAGA 4DTRA 3AVKA 3C95A 4KTWA 4RW4A 2YNFA 1B9FA 4KKOA 2KW4A 1WSIA 1SL0A 1R0AA 4DSLA 4FW2A 3WNFA 3O3HA 2F96A 3K5OA 1VK0A 3P5JA 4DWIA 4OGEA 4CJRA 3SUQA 1NK0A 1ZBHA 2HHSA 3SJJA 3SQ0A 2IDOA 3QEPA 4Z4IA 3PX4A 1REVA 1QSYA 4CJWA 4KB1A 4Z0UA 3ZSRA 4RW6A 2OPRA 3K2PA 1EP4A 4I2PA 4I9QA 4YNQA 3ULDA 1TK0A 4E3SA 3O4NA 4QCLA 3LPTA 3KIOA 1LAWA 3V1QA 1KVBA 4DSKA 1JLAA 3IS9A 1TL3A 2BE2A 1DTQA 4N5SA 4PUOA 1WAJA 4LSNA 1TL1A 4ID1A 2VG6A 3VQAA 3HPOA 4DLEA 3V9ZA 4CHPA 1O1WA 1N6QA 4K8XA 3KD1E 2YNHA 4AHSA 3TR8A 4CGHA 4FJLA 3LP3A 4HTUA 4HCCA 1KLMA 4M42A 4I2QA 2PY5A 4CJVA 1S1VA 1BIZA 5HLFA 4EZ9A 1RTHA 2Z1HA 3TAQA 4FK0A 4M3TA 4PA1A 4DQRA 2HW3A 3NF9A 3VQ8A 4EP4A 1VRTA 1KRPA 4CEZA 1J53A 3OS0A 2GV9A 3C6UA 3G10A 3LZJA 1WSHA 3K5NA 4FM1A 2PZSA 4FJXA 4NCBA 1D8YA 2F8SA 3LZIA 4DLGA 3T1AA 1S1WA 3LPUA 3VQ4A 4DQSA 1S9GA 4DU3A 1Q9YA 3O4QA 4KFBA 2YV0X 3RWUA 4CHQA 3QIOA 4E7KA 4CF0A 2WOMA 3HO1A 5CYQA 3AVFA 1C6VA 3AO2A 3AVGA 2OYQA 3OYHA 4B9VA 1WSJA 4WE1A 3L3UA 4CFAA 2XY7A 1SL1A 4CGGA 4CGJA 4B08A 1WNSA 3RR7A 4CIGA 3MAQA 1BIUA 1DLOA 2HHWA 4I7FA 1S1UA 3KLIA 4O4GA 3OS1A 5DK5A 4CJFA 3I0RA 4Y1CA 3QO9A 1LV5A 2OPPA 3CYMA 3M8QA 4FVMA 3T19A 4OLBA 1BCOA 3VQQA 4CFBA 1D9DA 3OYJA 3RMCA 4KHUA 3ASMA 3DRPA 3DLRA 3SPZA 4HUGA 3T3FA 4YFUA 1EXQA 3LWMA 2XY5A 4CEAA 1KLNA 1UAXA 3HVRA 1X9WA 2HMIA 4R5PA 1TV6A 3V6DA 4PY5A 3MXMA 3AVLA 1U45A 1HPZA 1JLEA 2IAJA 4H4MA 4CECA 4Z4HA 2XO7A 4BDZA 4FK4A 2HVIA 3AVBA 4LD0A 4CGDA 1SKSA 4EP5A 3SZ2A 1QS4A 4DQPA 3LP1A 2BANA 3EYZA 3TABA 4E19A 4N56A 2P1JA 1XHZA 1CXUA 3L3VA 3V9UA 4CJUA 3OYGA 2X74A 1ASVA 4GVMA 2DTUA 3SUNA 1FKOA 4E1NA 4CEDA 3TANA 2X78A 4OKJA 4N47A 4J2BA 5FRNA 3LWLA 1C1CA 4OKEA 4JRQA 4KREA 4FZXC 1XHXA 3ZSQA 4CK2A 4IG3A 1RCHA 3PUFA 4DS5A 1D5AA 1KFDA 1S1XA 3L2WA 4Z4CA 3TAMA 3TAEA 3LAKA 3AO1A 3ZSWA 2VWKA 5EU7A 3U3YA 3HVTA 1NJXA 4CEBA 4CHYA 3IRXA 3QINA 3AO3A 3P1GA 2Y1JA 1SV5A 2ETJA 4M41A 2XY6A 5JS1A 4H8KA 3ZT1A 3K58A 3AVAA 2VWJA 3TWHA 4LH4A 3VQCA 3HP9A 3ZT2A 5C24A 1GOAA 4JS4A 1ZBLA 1NK8A 4NYFA 1VSJA 2HB5A 3ZSZA 3B6PA 3ZSVA 4RW9A 3QERA 1ZBIA 4KB0A 5KTQA 4BDPA 4HCBA 1CXQA 3QNNA 3SQ2A 4QOZB 1VRUA 1KCFA 3SQ4A 3O3FA 3ZSXA 3AVCA 1JLCA 4Q5VA 3LANA 2NUBA 4CF8A 1A5XA 2RPIA 1QHTA 1YTUA 1L5UA 3H08A 2G8KA 4M3ZA 3VA0A 2G8FA 1BI4A 4FJJA 3LP0A 2HNYA 5KRTA 2AJQA 4E7JA 1VSFA 1B92A 4DFPA 1ZBUA 3SCXA 3DMJA 2IGIA 2KFNA 3M8SA 1WN7A 4M3XA 3VQPA 1WSFA 4FJ9A 4RW8A 5SWMA 4CEEA 3V9WA 4IFYA 4GMJB 3O3GA 4W5RA 4CJPA 3QEWA 1L3TA 3K5MA 3NF7A 3MXIA 1YT3A 5C25A 3V1OA 3OYNA 3EY1A 1VSHA 1RBTA 1BHLA 3K5LA 3G0ZA 4CF1A 4FM0A 4KRFA 4TSXA 4FLXA 2YKNA 1JLFA 3QIPA 2G8VA 4DSEA 3RRHA 1T03A 1S5JA 2VG7A 2YNGA 3AA4A 4IG0A 3K57A 4F2RA 3HL8A 3UIQA 3TAGA 1ZBFA 4JRPA 3V4IA 2ZE2A 3V81A 3CM5A 2LSNA 4CK3A 3DM2A 3K59A 3DI6A 4KHQA 5SZTA 2KZMA 1JL1A 2KQ2A 4M3RA 4LY7A 1BQMA 1I39A 4O44A 3L8BA 3HYFA 1Z25A 4CCHA 1HYSA 1LW0A 4H4OA 3SNNA 1HQUA 3KKSA 2F8TA 3OYKA 4O0JA 4FCYA 4DQIA 3OYCA 3MEGA 1NOZA 3PV8A 1L3UA 1YTAA 1BCMA 1VSDA 4FW1A 3NBPA 1U47A 3ZT0A 3V9XA 2D0AA 2QXFA 1RT3A 4C8NA 2FC0A 1XI1A 2A1SA 1TKTA 4M3WA 2E6MA 3MEDA 4Z4GA 4DG1A 1BI4B 3TI0A 1NK5A 4B3OA 1X9SA 1SKWA 1IH7A 3QEVA 3NGYA 1RTJA 1WSEA 3DLBA 1IKXA 3ZSOA 3VN5A 2PYLA 2YNIA 1TGOA 1IKVA 3KK3A 4F8RA 4IKFA 3VQDA 1VSMA 4C8KA 3SYZA 4B9NA 3LAMA 2ZQBA 4CFCA 1TAQA 4AHVA 3OYBA 4IDKA 1CZBA 4IBNA 2RKIA 3QLHA 3OS2A 1NJZA 4Z4EA 2O4GA 1RDAA 3OY9A 2KTQA 1JXBA 3DOKA 1FKPA 3QEIA 1VSLA 1S6PA 4MFBA 4W5QA 1X9MA 1Q8IA 4OVLA 1RBVA 4FLYA 4BE1A 3OVNA 4CERA 4DF8A 4N41A 4W5OA 5HRRA 5T7BA 4AHCA 3KLEA 3RMDA 4F3TA 3V1RA 4FK2A 1C1BA 1SUQA 3LP2A 3SUPA 4B9SA 2G8WA 4DTJA 4KO0A 1W9HA 3PX0A 2VG5A 2KZZA 4FLUA 3DYAA 3P83D 4CEQA 2OZMA 4Q0BA 1NK9A 1BGXT 4CJ5A 3D45A 2ZD1A 3LDSA 4B9UA 1KVCA 1JLGA 1TKXA 1HJRA 2QK9A 1VSEA 1HRHA 3HK2A 3OYDA 3AO4A 5KRSA 4K8ZA 4O55A 3AVMA 4JLHA 4KHYA 2HVHA 2RN2A 3CQ8A 3PO5A 3QNOA 4M3UA 5K14A 1HYZA 1GOCA 1WAFA 3E01A 1J54A 3NAEA 3NCIA 3DRSA 5J1EA 1TK8A 1RTDA 1QE1A 3MXJA 4B8AB 4KTZA 4DSFA 4CF9A 3KTQA 1HMVA 1TKZA 3HPHA 4CIFA 4ZTFA 1JLBA 2XRIA 3SPYA 4CIEA 3QESA 4CESA 2BDPA 3VQBA 4DSIA 1RT1A 1FXXA 4LH5A 2D0CA 3TAPA 2HHUA 2X6NA 4L8RB 1UOCA 4DTXA 1TAUA 3OJSA 4FJGA 3SV4A 2E6LA 1UWBA 4CHNA 3NHGA 3L2QA 3KLFA 1NJYA 4KI4A 4PQUA 1N5YA 4KV8A 3HPGA 4CJLA 4CJQA 3WNEA 2EHGA 2OZSA 1HNIA 3AA3A 1RT6A 3DLKA 5CZ1A 5C42A 3SV3A 4CJEA 1KVAA 1TVRA 2X6SA 3AVNA 5HRNA 1T05A 3D0PA 4C8LA 4DSJA 4BDYA 4GW6A 5J2MA 5HBMA 4Y1DA 3NGIA 3BGRA 4CEOA 2DFEA 4FM2A 3KJVA 3KLHA 2XHBA 4DTNA 1S6QA 1SL2A 4G1QA 3AA2A 4B9MA 1RILA 1W0HA 3AV9A 3U3GA 3NF8A 3IAYA 4JS5A 1U4BA 5CYMA 1JKHA 1HNVA 2YHAA 1G15A 1D9FA 3VA3A 3RRGA 1LAVA 1RT4A 1NK6A 3RMAA 2I5JA 3F73A 2QKBA 4NYNA 4IFVA 4ICLA 2A1RA 2OPSA 4OKKA 2JLEA 3NF6A 4O5BA 3AO5A 4OPKA 1GOBA 1JLQA 2Z1GA 3MECA 3OYAA 1RDCA 4DS4A 2P51A 4N76A 3S3OA 1U49A 5J2QA 1TKDA 5FRMA 4KAZA 4KPYA 1T8EA 3JYTA 4AHRA 4HVJA 4DFJA 4W5TA 3CG7A 4XIUA 3JSMA 3B6OA 3TAFA 3ZSYA 1A5VA 3OYEA 4FJNA 3FFIA 3OYLA 4FXDA 4DU1A 2W42A 4MQ3A 3KK2A 2HHXA 2JGUA 3I8DA 1EETA 1VSKA 4KHWA 1U04A 4C8MA 1LW2A 1ITGA 3SUOA 1IO2A 3IG1A 1KFSA 4AHTA 4AH9A 3RTVA 1QQCA 1RT2A 3DLGA 4B8CA 4CE9A 1WSGA 3DRRA 3HJFA 3NFAA 2R7YA 1ASWA 3CFRA 4FZZA 1J5OA 1LWFA 4FJ7A 3M8PA 2OPQA 4BWMA 4CFDA 4ELTA 4F3OA 1NJWA 4BACA 1RDDA 2IS3A 4CJ3A 3ITHA 4CJKA 2PYJA 4FJMA 4DFKA 4NCAA 3VQ6A 4DTSA 5HROA 5J2PA 4HUFA 4E7LA 4F4KA 3AVIA 4CJTA 4B9TA 1CZ9A 3DOLA 3ZCMA 2XY8A 4AHUA 4HUEA 5KGWA 1LWEA 4FLZA 5HP1A 3OYFA 1XWLA 3S3NA 4HHTA 4FLTA 1QSLA 1NKCA 4I9LA 3L2VA 4CGIA 1DTTA 3DLHA 2P5OA 4ZTJA 4DTPA 2G8HA 2RF2A 3QETA 4E7IA 4RW7A 3DLEA 2B4JA 3HT3A 4M3YA 1JL2A 3RR8A 3L2RA 4NCGA 3PX6A 3ISNC 3MEEA 3NH1A 2WONA 4DMNA 1NOYA 5CZ2A 3QEXA 1RBRA 4ID5A 4UQGA 4J2EA 2HHVA 3ALYA 3C6TA 2E4LA 3VQ9A 1UA1A 4RG8A 4FZYA 1J9AA 1ASUA 4CHZA 2B5JA 3NH0A 2Z1IA 1TK5A 2G8UA 4FJHA 3PO4A 2HNZA 3KD5E 1NK7A 4C8OA 1Y97A 2B6AA 2FBYA 4E7HA 3SQ1A 1C0TA 2EX3A 1YVUA 4ZHRA 1ZYQA 1S1TA 1NKBA 5DMRA 3HP6A 3S9HA 3OJUA 1VSIA 4OJRA 4BE2A 3HM9A 3I0SA 3S3MA 4O0IA 4J2AA 2O4IA 1RDBA 4DTMA 1HQEA 2DY4A 3KLGA 5J2NA 2YHBA 3VQEA 4J2DA 4OLAA 3NDKA 4CJSA 4ELVA 5KI6A 1BQNA 4CHOA 1IKWA 4EZ6A 1RBUA 3OYMA 3U6FA 2HHTA 1KSPA 2FBTA 4CGFA 1NK4A 1XC9A 3THVA 1B9DA 2G8IA 5FDLA 1L3SA 2Q3SA 3M8RA 2Y1IA 3RMBA 2IC3A 1F21A 3KKRA 4FJ8A 4E89A 1JXEA 1I3AA 3OYIA 3TARA 1K6YA 3EZ5A 4LSLA 1KTQA 4CK1A 2ATQA 3CFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL3 A;  3BDP A;  1Z26 A;  3WNH A;  3HXM A;  2OA8 A;  4W5N A;  1SKR A;  1IG9 A;  2DFF A;  2P5G A;  1RNH A;  1QSS A;  1RT5 A;  4DTO A;  1S9E A;  4E0D A;  4E1M A;  4FLV A;  3NH2 A;  3VQ5 A;  3V9S A;  1NKE A;  1L3V A;  2HND A;  4OPJ A;  1U48 A;  4CEF A;  2Z1J A;  3HST B;  4FJI A;  1MU2 A;  4F2S A;  4FJ5 A;  1EX4 A;  1FK9 A;  1RT7 A;  1A5W A;  5FRO A;  3KK1 A;  1IKY A;  1WLJ A;  4DQQ A;  2DFH A;  3AVJ A;  3F9K A;  4BWJ A;  4DTU A;  4ELU A;  4DFM A;  1Q9X A;  1CLQ A;  3CFO A;  3C94 A;  2KFZ A;  2D5R A;  3PY8 A;  4KHN A;  5I42 A;  3LAL A;  4DU4 A;  4FYD A;  1C0M A;  1RBS A;  4OGC A;  4B9L A;  3VQ7 A;  5HRS A;  2GBZ A;  4BE0 A;  2IOC A;  2HHQ A;  3WNG A;  2YKM A;  3CM6 A;  4M45 A;  1X1P A;  4FLW A;  4KHS A;  4PWD A;  2FBV A;  1RTI A;  3ZT3 A;  4DF4 A;  3L2U A;  3SI6 A;  5E41 A;  1T7P A;  5D3G A;  4Z4F A;  1C0U A;  1LWC A;  4FJK A;  1UA0 A;  4AIL C;  4CJ4 A;  1EKE A;  2GUI A;  3ZT4 A;  1BIS A;  2D0B A;  3NE6 A;  2QKK A;  2FBX A;  3AVH A;  5CY4 A;  5I3U A;  5JS2 A;  1C1A A;  1HYV A;  4CF2 A;  5KGX A;  3NGZ A;  2BGG A;  4KI6 A;  3A2F A;  1QTM A;  3AA5 X;  2ITG A;  4KTQ A;  5HRP A;  4QAG A;  4DTR A;  3AVK A;  3C95 A;  4KTW A;  4RW4 A;  2YNF A;  1B9F A;  4KKO A;  2KW4 A;  1WSI A;  1SL0 A;  1R0A A;  4DSL A;  4FW2 A;  3WNF A;  3O3H A;  2F96 A;  3K5O A;  1VK0 A;  3P5J A;  4DWI A;  4OGE A;  4CJR A;  3SUQ A;  1NK0 A;  1ZBH A;  2HHS A;  3SJJ A;  3SQ0 A;  2IDO A;  3QEP A;  4Z4I A;  3PX4 A;  1REV A;  1QSY A;  4CJW A;  4KB1 A;  4Z0U A;  3ZSR A;  4RW6 A;  2OPR A;  3K2P A;  1EP4 A;  4I2P A;  4I9Q A;  4YNQ A;  3ULD A;  1TK0 A;  4E3S A;  3O4N A;  4QCL A;  3LPT A;  3KIO A;  1LAW A;  3V1Q A;  1KVB A;  4DSK A;  1JLA A;  3IS9 A;  1TL3 A;  2BE2 A;  1DTQ A;  4N5S A;  4PUO A;  1WAJ A;  4LSN A;  1TL1 A;  4ID1 A;  2VG6 A;  3VQA A;  3HPO A;  4DLE A;  3V9Z A;  4CHP A;  1O1W A;  1N6Q A;  4K8X A;  3KD1 E;  2YNH A;  4AHS A;  3TR8 A;  4CGH A;  4FJL A;  3LP3 A;  4HTU A;  4HCC A;  1KLM A;  4M42 A;  4I2Q A;  2PY5 A;  4CJV A;  1S1V A;  1BIZ A;  5HLF A;  4EZ9 A;  1RTH A;  2Z1H A;  3TAQ A;  4FK0 A;  4M3T A;  4PA1 A;  4DQR A;  2HW3 A;  3NF9 A;  3VQ8 A;  4EP4 A;  1VRT A;  1KRP A;  4CEZ A;  1J53 A;  3OS0 A;  2GV9 A;  3C6U A;  3G10 A;  3LZJ A;  1WSH A;  3K5N A;  4FM1 A;  2PZS A;  4FJX A;  4NCB A;  1D8Y A;  2F8S A;  3LZI A;  4DLG A;  3T1A A;  1S1W A;  3LPU A;  3VQ4 A;  4DQS A;  1S9G A;  4DU3 A;  1Q9Y A;  3O4Q A;  4KFB A;  2YV0 X;  3RWU A;  4CHQ A;  3QIO A;  4E7K A;  4CF0 A;  2WOM A;  3HO1 A;  5CYQ A;  3AVF A;  1C6V A;  3AO2 A;  3AVG A;  2OYQ A;  3OYH A;  4B9V A;  1WSJ A;  4WE1 A;  3L3U A;  4CFA A;  2XY7 A;  1SL1 A;  4CGG A;  4CGJ A;  4B08 A;  1WNS A;  3RR7 A;  4CIG A;  3MAQ A;  1BIU A;  1DLO A;  2HHW A;  4I7F A;  1S1U A;  3KLI A;  4O4G A;  3OS1 A;  5DK5 A;  4CJF A;  3I0R A;  4Y1C A;  3QO9 A;  1LV5 A;  2OPP A;  3CYM A;  3M8Q A;  4FVM A;  3T19 A;  4OLB A;  1BCO A;  3VQQ A;  4CFB A;  1D9D A;  3OYJ A;  3RMC A;  4KHU A;  3ASM A;  3DRP A;  3DLR A;  3SPZ A;  4HUG A;  3T3F A;  4YFU A;  1EXQ A;  3LWM A;  2XY5 A;  4CEA A;  1KLN A;  1UAX A;  3HVR A;  1X9W A;  2HMI A;  4R5P A;  1TV6 A;  3V6D A;  4PY5 A;  3MXM A;  3AVL A;  1U45 A;  1HPZ A;  1JLE A;  2IAJ A;  4H4M A;  4CEC A;  4Z4H A;  2XO7 A;  4BDZ A;  4FK4 A;  2HVI A;  3AVB A;  4LD0 A;  4CGD A;  1SKS A;  4EP5 A;  3SZ2 A;  1QS4 A;  4DQP A;  3LP1 A;  2BAN A;  3EYZ A;  3TAB A;  4E19 A;  4N56 A;  2P1J A;  1XHZ A;  1CXU A;  3L3V A;  3V9U A;  4CJU A;  3OYG A;  2X74 A;  1ASV A;  4GVM A;  2DTU A;  3SUN A;  1FKO A;  4E1N A;  4CED A;  3TAN A;  2X78 A;  4OKJ A;  4N47 A;  4J2B A;  5FRN A;  3LWL A;  1C1C A;  4OKE A;  4JRQ A;  4KRE A;  4FZX C;  1XHX A;  3ZSQ A;  4CK2 A;  4IG3 A;  1RCH A;  3PUF A;  4DS5 A;  1D5A A;  1KFD A;  1S1X A;  3L2W A;  4Z4C A;  3TAM A;  3TAE A;  3LAK A;  3AO1 A;  3ZSW A;  2VWK A;  5EU7 A;  3U3Y A;  3HVT A;  1NJX A;  4CEB A;  4CHY A;  3IRX A;  3QIN A;  3AO3 A;  3P1G A;  2Y1J A;  1SV5 A;  2ETJ A;  4M41 A;  2XY6 A;  5JS1 A;  4H8K A;  3ZT1 A;  3K58 A;  3AVA A;  2VWJ A;  3TWH A;  4LH4 A;  3VQC A;  3HP9 A;  3ZT2 A;  5C24 A;  1GOA A;  4JS4 A;  1ZBL A;  1NK8 A;  4NYF A;  1VSJ A;  2HB5 A;  3ZSZ A;  3B6P A;  3ZSV A;  4RW9 A;  3QER A;  1ZBI A;  4KB0 A;  5KTQ A;  4BDP A;  4HCB A;  1CXQ A;  3QNN A;  3SQ2 A;  4QOZ B;  1VRU A;  1KCF A;  3SQ4 A;  3O3F A;  3ZSX A;  3AVC A;  1JLC A;  4Q5V A;  3LAN A;  2NUB A;  4CF8 A;  1A5X A;  2RPI A;  1QHT A;  1YTU A;  1L5U A;  3H08 A;  2G8K A;  4M3Z A;  3VA0 A;  2G8F A;  1BI4 A;  4FJJ A;  3LP0 A;  2HNY A;  5KRT A;  2AJQ A;  4E7J A;  1VSF A;  1B92 A;  4DFP A;  1ZBU A;  3SCX A;  3DMJ A;  2IGI A;  2KFN A;  3M8S A;  1WN7 A;  4M3X A;  3VQP A;  1WSF A;  4FJ9 A;  4RW8 A;  5SWM A;  4CEE A;  3V9W A;  4IFY A;  4GMJ B;  3O3G A;  4W5R A;  4CJP A;  3QEW A;  1L3T A;  3K5M A;  3NF7 A;  3MXI A;  1YT3 A;  5C25 A;  3V1O A;  3OYN A;  3EY1 A;  1VSH A;  1RBT A;  1BHL A;  3K5L A;  3G0Z A;  4CF1 A;  4FM0 A;  4KRF A;  4TSX A;  4FLX A;  2YKN A;  1JLF A;  3QIP A;  2G8V A;  4DSE A;  3RRH A;  1T03 A;  1S5J A;  2VG7 A;  2YNG A;  3AA4 A;  4IG0 A;  3K57 A;  4F2R A;  3HL8 A;  3UIQ A;  3TAG A;  1ZBF A;  4JRP A;  3V4I A;  2ZE2 A;  3V81 A;  3CM5 A;  2LSN A;  4CK3 A;  3DM2 A;  3K59 A;  3DI6 A;  4KHQ A;  5SZT A;  2KZM A;  1JL1 A;  2KQ2 A;  4M3R A;  4LY7 A;  1BQM A;  1I39 A;  4O44 A;  3L8B A;  3HYF A;  1Z25 A;  4CCH A;  1HYS A;  1LW0 A;  4H4O A;  3SNN A;  1HQU A;  3KKS A;  2F8T A;  3OYK A;  4O0J A;  4FCY A;  4DQI A;  3OYC A;  3MEG A;  1NOZ A;  3PV8 A;  1L3U A;  1YTA A;  1BCM A;  1VSD A;  4FW1 A;  3NBP A;  1U47 A;  3ZT0 A;  3V9X A;  2D0A A;  2QXF A;  1RT3 A;  4C8N A;  2FC0 A;  1XI1 A;  2A1S A;  1TKT A;  4M3W A;  2E6M A;  3MED A;  4Z4G A;  4DG1 A;  1BI4 B;  3TI0 A;  1NK5 A;  4B3O A;  1X9S A;  1SKW A;  1IH7 A;  3QEV A;  3NGY A;  1RTJ A;  1WSE A;  3DLB A;  1IKX A;  3ZSO A;  3VN5 A;  2PYL A;  2YNI A;  1TGO A;  1IKV A;  3KK3 A;  4F8R A;  4IKF A;  3VQD A;  1VSM A;  4C8K A;  3SYZ A;  4B9N A;  3LAM A;  2ZQB A;  4CFC A;  1TAQ A;  4AHV A;  3OYB A;  4IDK A;  1CZB A;  4IBN A;  2RKI A;  3QLH A;  3OS2 A;  1NJZ A;  4Z4E A;  2O4G A;  1RDA A;  3OY9 A;  2KTQ A;  1JXB A;  3DOK A;  1FKP A;  3QEI A;  1VSL A;  1S6P A;  4MFB A;  4W5Q A;  1X9M A;  1Q8I A;  4OVL A;  1RBV A;  4FLY A;  4BE1 A;  3OVN A;  4CER A;  4DF8 A;  4N41 A;  4W5O A;  5HRR A;  5T7B A;  4AHC A;  3KLE A;  3RMD A;  4F3T A;  3V1R A;  4FK2 A;  1C1B A;  1SUQ A;  3LP2 A;  3SUP A;  4B9S A;  2G8W A;  4DTJ A;  4KO0 A;  1W9H A;  3PX0 A;  2VG5 A;  2KZZ A;  4FLU A;  3DYA A;  3P83 D;  4CEQ A;  2OZM A;  4Q0B A;  1NK9 A;  1BGX T;  4CJ5 A;  3D45 A;  2ZD1 A;  3LDS A;  4B9U A;  1KVC A;  1JLG A;  1TKX A;  1HJR A;  2QK9 A;  1VSE A;  1HRH A;  3HK2 A;  3OYD A;  3AO4 A;  5KRS A;  4K8Z A;  4O55 A;  3AVM A;  4JLH A;  4KHY A;  2HVH A;  2RN2 A;  3CQ8 A;  3PO5 A;  3QNO A;  4M3U A;  5K14 A;  1HYZ A;  1GOC A;  1WAF A;  3E01 A;  1J54 A;  3NAE A;  3NCI A;  3DRS A;  5J1E A;  1TK8 A;  1RTD A;  1QE1 A;  3MXJ A;  4B8A B;  4KTZ A;  4DSF A;  4CF9 A;  3KTQ A;  1HMV A;  1TKZ A;  3HPH A;  4CIF A;  4ZTF A;  1JLB A;  2XRI A;  3SPY A;  4CIE A;  3QES A;  4CES A;  2BDP A;  3VQB A;  4DSI A;  1RT1 A;  1FXX A;  4LH5 A;  2D0C A;  3TAP A;  2HHU A;  2X6N A;  4L8R B;  1UOC A;  4DTX A;  1TAU A;  3OJS A;  4FJG A;  3SV4 A;  2E6L A;  1UWB A;  4CHN A;  3NHG A;  3L2Q A;  3KLF A;  1NJY A;  4KI4 A;  4PQU A;  1N5Y A;  4KV8 A;  3HPG A;  4CJL A;  4CJQ A;  3WNE A;  2EHG A;  2OZS A;  1HNI A;  3AA3 A;  1RT6 A;  3DLK A;  5CZ1 A;  5C42 A;  3SV3 A;  4CJE A;  1KVA A;  1TVR A;  2X6S A;  3AVN A;  5HRN A;  1T05 A;  3D0P A;  4C8L A;  4DSJ A;  4BDY A;  4GW6 A;  5J2M A;  5HBM A;  4Y1D A;  3NGI A;  3BGR A;  4CEO A;  2DFE A;  4FM2 A;  3KJV A;  3KLH A;  2XHB A;  4DTN A;  1S6Q A;  1SL2 A;  4G1Q A;  3AA2 A;  4B9M A;  1RIL A;  1W0H A;  3AV9 A;  3U3G A;  3NF8 A;  3IAY A;  4JS5 A;  1U4B A;  5CYM A;  1JKH A;  1HNV A;  2YHA A;  1G15 A;  1D9F A;  3VA3 A;  3RRG A;  1LAV A;  1RT4 A;  1NK6 A;  3RMA A;  2I5J A;  3F73 A;  2QKB A;  4NYN A;  4IFV A;  4ICL A;  2A1R A;  2OPS A;  4OKK A;  2JLE A;  3NF6 A;  4O5B A;  3AO5 A;  4OPK A;  1GOB A;  1JLQ A;  2Z1G A;  3MEC A;  3OYA A;  1RDC A;  4DS4 A;  2P51 A;  4N76 A;  3S3O A;  1U49 A;  5J2Q A;  1TKD A;  5FRM A;  4KAZ A;  4KPY A;  1T8E A;  3JYT A;  4AHR A;  4HVJ A;  4DFJ A;  4W5T A;  3CG7 A;  4XIU A;  3JSM A;  3B6O A;  3TAF A;  3ZSY A;  1A5V A;  3OYE A;  4FJN A;  3FFI A;  3OYL A;  4FXD A;  4DU1 A;  2W42 A;  4MQ3 A;  3KK2 A;  2HHX A;  2JGU A;  3I8D A;  1EET A;  1VSK A;  4KHW A;  1U04 A;  4C8M A;  1LW2 A;  1ITG A;  3SUO A;  1IO2 A;  3IG1 A;  1KFS A;  4AHT A;  4AH9 A;  3RTV A;  1QQC A;  1RT2 A;  3DLG A;  4B8C A;  4CE9 A;  1WSG A;  3DRR A;  3HJF A;  3NFA A;  2R7Y A;  1ASW A;  3CFR A;  4FZZ A;  1J5O A;  1LWF A;  4FJ7 A;  3M8P A;  2OPQ A;  4BWM A;  4CFD A;  4ELT A;  4F3O A;  1NJW A;  4BAC A;  1RDD A;  2IS3 A;  4CJ3 A;  3ITH A;  4CJK A;  2PYJ A;  4FJM A;  4DFK A;  4NCA A;  3VQ6 A;  4DTS A;  5HRO A;  5J2P A;  4HUF A;  4E7L A;  4F4K A;  3AVI A;  4CJT A;  4B9T A;  1CZ9 A;  3DOL A;  3ZCM A;  2XY8 A;  4AHU A;  4HUE A;  5KGW A;  1LWE A;  4FLZ A;  5HP1 A;  3OYF A;  1XWL A;  3S3N A;  4HHT A;  4FLT A;  1QSL A;  1NKC A;  4I9L A;  3L2V A;  4CGI A;  1DTT A;  3DLH A;  2P5O A;  4ZTJ A;  4DTP A;  2G8H A;  2RF2 A;  3QET A;  4E7I A;  4RW7 A;  3DLE A;  2B4J A;  3HT3 A;  4M3Y A;  1JL2 A;  3RR8 A;  3L2R A;  4NCG A;  3PX6 A;  3ISN C;  3MEE A;  3NH1 A;  2WON A;  4DMN A;  1NOY A;  5CZ2 A;  3QEX A;  1RBR A;  4ID5 A;  4UQG A;  4J2E A;  2HHV A;  3ALY A;  3C6T A;  2E4L A;  3VQ9 A;  1UA1 A;  4RG8 A;  4FZY A;  1J9A A;  1ASU A;  4CHZ A;  2B5J A;  3NH0 A;  2Z1I A;  1TK5 A;  2G8U A;  4FJH A;  3PO4 A;  2HNZ A;  3KD5 E;  1NK7 A;  4C8O A;  1Y97 A;  2B6A A;  2FBY A;  4E7H A;  3SQ1 A;  1C0T A;  2EX3 A;  1YVU A;  4ZHR A;  1ZYQ A;  1S1T A;  1NKB A;  5DMR A;  3HP6 A;  3S9H A;  3OJU A;  1VSI A;  4OJR A;  4BE2 A;  3HM9 A;  3I0S A;  3S3M A;  4O0I A;  4J2A A;  2O4I A;  1RDB A;  4DTM A;  1HQE A;  2DY4 A;  3KLG A;  5J2N A;  2YHB A;  3VQE A;  4J2D A;  4OLA A;  3NDK A;  4CJS A;  4ELV A;  5KI6 A;  1BQN A;  4CHO A;  1IKW A;  4EZ6 A;  1RBU A;  3OYM A;  3U6F A;  2HHT A;  1KSP A;  2FBT A;  4CGF A;  1NK4 A;  1XC9 A;  3THV A;  1B9D A;  2G8I A;  5FDL A;  1L3S A;  2Q3S A;  3M8R A;  2Y1I A;  3RMB A;  2IC3 A;  1F21 A;  3KKR A;  4FJ8 A;  4E89 A;  1JXE A;  1I3A A;  3OYI A;  3TAR A;  1K6Y A;  3EZ5 A;  4LSL A;  1KTQ A;  4CK1 A;  2ATQ A;  3CFP A; 
#chains in the Genus database with same CATH topology
 1BL3 A;  2OA8 A;  2P5G A;  4JI3 K;  4BQZ A;  4E1M A;  3V9S A;  3VQ5 A;  3ULE B;  3HST B;  4JI6 K;  1MU2 A;  4FJ5 A;  4YDU A;  3I8B A;  2JWK A;  2YJE A;  1CLQ A;  3EE9 A;  4DFM A;  2GX9 A;  1Q9X A;  2D5R A;  4BR0 A;  3LAL A;  4DV2 K;  1NGB A;  1X9J A;  2AA4 A;  3BZK A;  5HRS A;  1S22 A;  4CZI A;  4B1V A;  2HHQ A;  3CD6 N;  4M45 A;  2FBV A;  4EAH D;  4DF4 A;  3SI6 A;  4FSV A;  1LWC A;  2UXC K;  3SLC A;  3NE6 A;  3ZET B;  3N4Q A;  4LF4 K;  2P9P B;  4EIA A;  4JKE A;  4KTQ A;  4PKG A;  3SAH A;  1OVQ A;  4DSL A;  3FZL A;  4FWO A;  3K5O A;  3GE1 A;  4CJR A;  1VQO N;  4KB1 A;  2OPR A;  2E1Z A;  3K2P A;  1EO1 A;  2VWB A;  5I9E B;  3O4N A;  4RWT A;  1J6Z A;  3MWP A;  1TL3 A;  1DTQ A;  1WAJ A;  2A3Z A;  2VG6 A;  1P8Z A;  5LL6 Z;  1N6Q A;  4K8X A;  2W41 A;  3ID6 A;  2GUP A;  4AHS A;  2W40 A;  4FJL A;  3RSE A;  4G9Z A;  4MLH A;  5AQY A;  4CJV A;  1S1V A;  5HLF A;  4EZ9 A;  2Z1H A;  3TAQ A;  2HW3 A;  1NLV A;  3JXU A;  4X64 K;  3NF9 A;  3VQ8 A;  1KRP A;  4CEZ A;  1J53 A;  2GV9 A;  3C6U A;  3CQX A;  4UY8 O;  3O9S A;  3VF2 A;  2F8S A;  4NCB A;  2YX6 A;  1N34 K;  4DLG A;  4GV3 A;  3LPU A;  3C7N B;  3VQ4 A;  4DU3 A;  1HKB A;  4KFB A;  2YV0 X;  3QIO A;  5M1O A;  2WOM A;  5CYQ A;  3AVF A;  3AO2 A;  3L3U A;  1M90 O;  4CZM A;  3FZK A;  3ZX2 A;  3MAQ A;  2HHW A;  1Y64 A;  4KHP K;  5DK5 A;  4Y1C A;  3QO9 A;  2OPP A;  4OLB A;  3CCS N;  3H6E A;  3O1B A;  5ELZ A;  4KHU A;  4CBU A;  1Q7Y O;  3T3F A;  3BF3 A;  4YFU A;  3HVR A;  4PY5 A;  2PFU A;  1JLE A;  4H4M A;  5LMN K;  4FK4 A;  3AVB A;  4LD0 A;  3UB5 A;  1W2B M;  4IXC A;  4HWI A;  4BR4 A;  4I6M B;  3S41 A;  3EYZ A;  2RHK A;  3TAB A;  1E4F T;  4N56 A;  2P1J A;  3OYG A;  3H3O B;  4CED A;  4BG8 A;  4N47 A;  1C1C A;  3CME N;  3D2E B;  4KRE A;  4FZX C;  4IWV A;  4CK2 A;  3PUF A;  4DS5 A;  1KFD A;  3TAM A;  4DR6 K;  4H0V B;  1WBB A;  1T3V A;  1NJX A;  4WQ4 C;  2YHY A;  1NU0 A;  5AQK A;  4M41 A;  3BP8 A;  4B3M K;  4JI8 K;  4LH4 A;  1NGJ A;  4JK8 A;  1ZBL A;  1V4S A;  1ZBI A;  4BGA A;  5KTQ A;  1CXQ A;  3QNN A;  3MX2 A;  1KCF A;  5LMU K;  4Q5V A;  2CGJ A;  1A5X A;  2F9W A;  1YTU A;  3VA0 A;  3LP0 A;  4BVP A;  2HNY A;  3SJH A;  1ZBU A;  2QXL A;  3EL2 A;  4DFP A;  5AQJ A;  4M3X A;  3NVK A;  3O3G A;  3QEW A;  3WT0 A;  3HOS A;  3MXI A;  1YT3 A;  4FM0 A;  4TSX A;  4FLX A;  4H0P A;  4C1N K;  1YIJ N;  1S5J A;  1RGI A;  1N32 K;  4IG0 A;  3K57 A;  4H0X B;  2P9S A;  5HL7 L;  3TAG A;  2ZE2 A;  3V81 A;  5E84 A;  2Q0U A;  3DM2 A;  1VQ8 N;  2KZM A;  1HYS A;  1Z25 A;  4BRI A;  1HQU A;  3KKS A;  5C2D A;  3MEG A;  1L3U A;  4NXM K;  4C1N I;  4BRG A;  4BVO A;  2UU9 K;  3LL3 A;  1YJN N;  3VGK A;  3OTO K;  5AQV A;  4B3S K;  2E6M A;  4M3W A;  4Z4G A;  1OH6 A;  4K43 A;  4B3O A;  3QEV A;  2PYL A;  3TTD A;  5BR9 A;  3LAM A;  1VQ4 N;  4IBN A;  3QLH A;  2O4G A;  1RDA A;  2NLX A;  3OY9 A;  1JXB A;  3QEI A;  1FKP A;  3WXJ A;  1X9M A;  4JI0 K;  1Q8I A;  1RBV A;  4FLY A;  1BA0 A;  3EKU A;  3RMD A;  4AHC A;  1KD1 O;  2NRZ A;  1NGG A;  3HBT A;  2EWS A;  4FWQ A;  3QML A;  4KO0 A;  4WQ5 A;  3FGU A;  3WUH A;  5BRH A;  4FLU A;  4CEQ A;  2OZM A;  2CH6 A;  4BRP A;  5EX5 A;  3D45 A;  1JLG A;  3OYD A;  3F9M A;  4K8Z A;  2D0P A;  3AVM A;  4KHY A;  2RN2 A;  3O9Q A;  3VF4 A;  1GOC A;  3PSF A;  3E01 A;  4H5N A;  4DSF A;  4CIF A;  4KH6 A;  3VQB A;  4LH5 A;  3TAP A;  4BRC A;  1TAU A;  4L8R B;  4DTX A;  3L6Q A;  1LOT B;  4CHN A;  4JAX A;  4PQU A;  1HX1 A;  3E9O A;  1MWM A;  3WNE A;  2OZS A;  3AA3 A;  5CZ1 A;  3SV3 A;  5HOO A;  1YVN A;  4YOR A;  3VTH A;  5AZI A;  4C8L A;  2QWR A;  3NGI A;  4CEO A;  2DFE A;  4WCE L;  1SL2 A;  3AA2 A;  3AV9 A;  3U3G A;  3IAY A;  4CZK A;  4M63 C;  1SAZ A;  1NK6 A;  3RMA A;  3TSU A;  2QKB A;  2HMP A;  4NYN A;  1ESV A;  4A5A A;  2JLE A;  2O8B A;  3NF6 A;  3SNN A;  3AO5 A;  1GOB A;  2P51 A;  4JD2 B;  5J2Q A;  4DQ8 A;  5EXW A;  5IT9 O;  4K25 A;  2QWN A;  3FFI A;  5KPT A;  3MCA B;  5CE3 A;  1K8K A;  2W42 A;  4MQ3 A;  1NBW A;  3B8A X;  4ILJ A;  4C8M A;  1ITG A;  4H5W A;  1IO2 A;  3MN6 A;  4AH9 A;  3LDL A;  5EY4 A;  1QQC A;  4CE9 A;  3R6M A;  3DRR A;  3HJF A;  3CFR A;  1K9M O;  5BRF A;  2I7P A;  4CFD A;  2F7T A;  3QBW A;  4DUY K;  2IS3 A;  1RDU A;  3ATU A;  4NCA A;  2I7N A;  1GLL O;  4BC4 A;  3VQ6 A;  5J2P A;  4HUF A;  3KVG A;  3A0I X;  3OYF A;  2WUS A;  4CGI A;  5FPD A;  4KH4 A;  5KPR A;  2O8F B;  2A6A A;  1QZ5 A;  1Z05 A;  2B4J A;  3RR8 A;  1V4T A;  1NOY A;  3MEE A;  3NH1 A;  2HHV A;  3C6T A;  3VQ9 A;  5JMV A;  4FZY A;  3ULE A;  1ASU A;  3WXK A;  4CHZ A;  3NH0 A;  2Z1I A;  1TK5 A;  2G8U A;  3GL1 A;  4FJH A;  3PSI A;  1DT9 A;  2FBY A;  2Q97 A;  3M6G A;  3S9H A;  3TU5 A;  1VSI A;  1BG3 A;  2E1Y A;  4OJR A;  4DV1 K;  3S3M A;  1HQE A;  5GAD P;  3KLG A;  5J2N A;  3VQE A;  3WXM B;  4J2D A;  3K0S A;  2HBL A;  5JVH L;  4CHO A;  3U6F A;  2V7Y A;  1NK4 A;  1S3X A;  2GWJ A;  5GAE P;  1QQN A;  3DLL L;  3RMB A;  3SK3 A;  4E89 A;  1I3A A;  4JK7 A;  3EZ5 A;  3ZET A;  4AM7 A;  1ILY A;  4BR9 A;  2ZGY A;  4K42 A;  1IG9 A;  1QSS A;  4JI4 K;  1RT5 A;  2P9U A;  3ENO A;  3GBT A;  5F2R A;  4H0Y B;  1L3V A;  4B1W B;  4DV6 K;  1EX4 A;  3E9L A;  1WLJ A;  4CJ7 A;  4DTU A;  3MN5 A;  3C94 A;  2KFZ A;  4MDB A;  5I42 A;  1C0M A;  4QS8 A;  3VQ7 A;  1N33 K;  4B1X B;  4BC5 A;  4BE0 A;  2IOC A;  3WNG A;  4FLW A;  1X1P A;  3E9P A;  3ZT3 A;  5E41 A;  5TKW A;  3SBT A;  1C0U A;  4FJK A;  1UA0 A;  1VQM N;  1BIS A;  2WBN A;  2D0B A;  1ZC6 A;  3THY B;  2FBX A;  4BC3 A;  5CY4 A;  4U67 L;  4JKF A;  5JS2 A;  3NGZ A;  3TSQ A;  3C65 A;  2BGG A;  2UUB K;  3AA5 X;  2ITG A;  3AVK A;  4BRQ A;  4RW4 A;  1YIT N;  3LDP A;  4KKO A;  3T69 A;  2KW4 A;  1Z6R A;  4FW2 A;  1NGC A;  4Z94 A;  3W3D A;  3SAG A;  4OGE A;  2HHS A;  4Z4I A;  3O80 A;  2VQF K;  4IO9 L;  1HNW K;  3PIP L;  2GTD A;  4I9Q A;  2YHX A;  4YNQ A;  1TK0 A;  4E3S A;  4QCL A;  5AQX A;  2P9K B;  3SMP A;  3IS9 A;  3TPQ A;  3VEO A;  3J7A P;  1U6Z A;  4PUO A;  4LSN A;  3V9Z A;  4DLE A;  4BRE A;  1O1W A;  3WEE B;  4CGH A;  4IDH A;  1KLM A;  4DR3 K;  4FK0 A;  3GG4 A;  1Q82 O;  4BY9 C;  2E20 A;  3LZJ A;  2KKZ A;  1WSH A;  4I6M A;  3K5N A;  4FM1 A;  1D8Y A;  3LZI A;  1S1W A;  3VER A;  1S9G A;  2ZJQ L;  1Q9Y A;  1P90 A;  1IJJ A;  3T1Y K;  1GLB G;  2OYQ A;  4WE1 A;  4CFA A;  2XY7 A;  4BGB A;  3RR7 A;  3KK7 A;  2UXD K;  3UKU B;  1DLO A;  4I7F A;  3I0R A;  1KAX A;  4A62 A;  5BPL A;  3T19 A;  4FVM A;  3EEQ A;  1VQ9 N;  3OYJ A;  3ASM A;  4HUG A;  1NMN A;  5JLH A;  1EXQ A;  3LWM A;  2XY5 A;  2VQE K;  1KLN A;  3K9K A;  1UAX A;  3W0L A;  3IUC A;  3DXK B;  1Q81 O;  4R5P A;  3V6D A;  2IAJ A;  4BDZ A;  1N8R O;  3G25 A;  2HVI A;  4BRL A;  4LF6 K;  1BA1 A;  2O8D B;  2BAN A;  1CXU A;  3L3V A;  1C0F A;  4CJU A;  1XQS C;  4GVM A;  5BPM A;  1QZ6 A;  2NRV A;  2WTU A;  4V19 S;  4YOW A;  4OO1 J;  4PL7 A;  1RCH A;  1D5A A;  4Z4C A;  3LAK A;  3F5T A;  5EU7 A;  4CEB A;  2P9I B;  5DM6 L;  3IRX A;  4YOU A;  3AO3 A;  1ZXO A;  2WFB A;  1KQS M;  4X65 K;  4X66 K;  3ZT1 A;  3CER A;  3K58 A;  3IDH A;  3AVA A;  2VWJ A;  2E2N A;  3ZT2 A;  1NK8 A;  1GOA A;  2G8K A;  4FYD A;  1VSJ A;  2HB5 A;  3ZSZ A;  3B6P A;  3QER A;  4RW9 A;  4BDP A;  4HCB A;  4QOZ B;  1VRU A;  3VEY A;  3PLA A;  3SQ4 A;  3AVC A;  2VGM A;  3LAN A;  2NUB A;  4CF8 A;  3P38 A;  4BRM A;  3CHW A;  4JV5 K;  3H08 A;  3O8M A;  4O5F A;  4A61 A;  4FOE A;  5KRT A;  2AJQ A;  1KXP A;  1B92 A;  3DMJ A;  2IGI A;  4WYB A;  1WN7 A;  4FJ9 A;  3J7Z O;  3V9W A;  4IFY A;  4BRO A;  1L3T A;  3OYN A;  2ZM6 K;  3U8X A;  3DXM B;  1RBT A;  4PKH A;  4LF8 K;  1E4G T;  1IV0 A;  2V51 B;  4BRK A;  2YNG A;  2VG7 A;  1H1V A;  3AA4 A;  4DV7 K;  1ZBF A;  4IOC L;  3V4I A;  3C6H A;  3N4P A;  5SZT A;  4A2A A;  4CBW A;  4H4O A;  2F8T A;  3OYK A;  1NOZ A;  1YTA A;  4BRH A;  4FW1 A;  1YF5 L;  3NBP A;  1U47 A;  1YJ9 N;  3D2F A;  3V9X A;  2QXF A;  1TKT A;  3VOV A;  4M7X A;  5KPZ A;  2BUP A;  3ID8 A;  1SKW A;  5GIO A;  3NGY A;  3DLB A;  1IKX A;  4MO4 A;  1IKV A;  3KK3 A;  4F8R A;  3VQD A;  3CMA N;  1TAQ A;  4AHV A;  4H5V A;  3OYB A;  1NJZ A;  1CZB A;  3OS2 A;  4Z4E A;  4L3Q A;  3I55 N;  1VSL A;  4ILG B;  2E2O A;  4BE1 A;  4CER A;  4W5O A;  5HRR A;  3QB0 A;  3V1R A;  3F2K A;  2NRH A;  3BY5 A;  2VG5 A;  4OPA A;  1N36 K;  2NRW A;  1BGX T;  4M3Z A;  2ZD1 A;  4CZL A;  1TKX A;  1HJR A;  1VSE A;  1HRH A;  1WOQ A;  3THW B;  5KRS A;  5GIN A;  4O55 A;  3CQ8 A;  3QNO A;  4M3U A;  5K14 A;  1HYZ A;  1WAF A;  1J54 A;  3GOI A;  5IWA K;  3NAE A;  1TK8 A;  1RTD A;  4KTZ A;  4CF9 A;  3HPH A;  4ZTF A;  3SPY A;  4MO5 A;  3QES A;  4JD2 A;  1RT1 A;  1FXX A;  3CC4 N;  4M7Y A;  1UOC A;  1VQK N;  3SV4 A;  4O8U A;  2EHG A;  1HNI A;  5C42 A;  1RT6 A;  2DPN A;  2OTL N;  4ILH A;  1KVA A;  3AVN A;  4FOI A;  3CC7 N;  4DSJ A;  3CCR N;  4FM2 A;  4DTN A;  1S6Q A;  2ZGZ A;  1TUU A;  1U4B A;  5M1Q A;  4IOA L;  5CYM A;  1JKH A;  4DR5 K;  1D9F A;  2W6K A;  3RRG A;  4DR1 K;  1XMO K;  3P4I A;  2VCP A;  3F73 A;  4K0K K;  4O5B A;  4DS4 A;  2Z1G A;  1JLQ A;  4N76 A;  4DB3 A;  1RDC A;  3EO3 A;  4A2B A;  3U4L A;  1TKD A;  1TYQ A;  1T8E A;  4IJA A;  3CG7 A;  3JSM A;  2O8F A;  3TAF A;  1A5V A;  3CCV N;  3OYE A;  3CJA A;  2KLA A;  5AFU H;  4DU1 A;  1DEJ A;  2HHX A;  3WXL A;  2JGU A;  3I8D A;  1EET A;  3M1F A;  3O9T A;  3IG1 A;  3MCP A;  3RTV A;  1RT2 A;  3DLG A;  4B8C A;  1WSG A;  1YI2 N;  4FZZ A;  1J5O A;  1LWF A;  4J8F A;  4LF7 K;  2QWL A;  4BWM A;  3T7Z A;  3CI5 A;  4B1Y B;  4CJK A;  4E7L A;  4ISG A;  3DOL A;  2XY8 A;  4AHU A;  4HUE A;  5KGW A;  4FLZ A;  3CQY A;  1E3M A;  5F1X A;  4I9L A;  3DLH A;  4ZTJ A;  2QEX N;  3QET A;  4JEP A;  4RW7 A;  3PX6 A;  1WUA A;  4J2E A;  1HR0 K;  1VQN N;  5AQL A;  2E4L A;  1J9A A;  1NJI O;  3PO4 A;  2HNZ A;  4YDU C;  2QM1 A;  2ASP A;  3A5M C;  4B1U B;  1ZYQ A;  3NMU A;  1W7A A;  2ASO A;  3HP6 A;  4BE2 A;  2FSJ A;  4DTM A;  2YHB A;  3H1Q A;  4GKK K;  1BQN A;  3OYM A;  2HHT A;  1K73 O;  1KSP A;  5C0Y A;  4LC9 B;  1XC9 A;  3VEW A;  3J80 O;  3H1V X;  3M8R A;  2Y1I A;  3RSE B;  1F21 A;  3TAR A;  1K6Y A;  2NZT A;  3THY A;  4XEI A;  4H5R A;  2ATQ A;  1IG8 A;  1VAZ A;  3CFP A;  3BDP A;  1Z26 A;  3HXM A;  3MDQ A;  5C15 A;  2Q2R A;  1S9E A;  4LFA K;  4FLV A;  1NKE A;  2HND A;  1VQP N;  3JAM O;  1U48 A;  4CEF A;  4A57 A;  2Z1J A;  4F2S A;  1RT7 A;  3DAW A;  4CZE A;  4NB4 A;  1A5W A;  1IKY A;  2DFH A;  4FWR A;  3F9K A;  2D0O A;  5M1K A;  4NO7 A;  3CFO A;  1SS6 A;  3SMS A;  3VEV A;  3EZW A;  4BRF A;  2P9K A;  5AQS A;  4PKI A;  2FSK A;  2YKM A;  3CM6 A;  2HBK A;  5AQF A;  1RTI A;  3L2U A;  1T7P A;  3WEE A;  1HLU A;  1LCU A;  5LJV A;  4Z4F A;  1SQK A;  4AIL C;  2UYT A;  1EKE A;  3WXI A;  2E88 A;  3ZT4 A;  2KHO A;  1J5E K;  1FJG K;  3CJ9 A;  4KBO A;  4H0O A;  3R3L A;  3AVH A;  5I3U A;  1O13 A;  1JCG A;  4CF2 A;  1HYV A;  1EWQ A;  4KI6 A;  5HRP A;  4HTL A;  4QAG A;  2YI1 A;  4DTR A;  2O8C B;  4KTW A;  3Q7C A;  4IOX A;  2PBD A;  1WSI A;  1SL0 A;  1R0A A;  1U2V B;  3O5B A;  2F96 A;  1VK0 A;  4A59 A;  1VQ6 N;  3P5J A;  1GLD G;  1ZBH A;  3THX B;  3OHR A;  3SQ0 A;  3QEP A;  2UXB K;  4EFH A;  5LJW A;  3SAF A;  4Z0U A;  3UKU A;  3ZSR A;  4CW7 B;  4RW6 A;  1EP4 A;  4I2P A;  3ULD A;  4FWP A;  1KVB A;  5AJ3 K;  2BE2 A;  5AFU A;  3BEX A;  3VGM A;  3VQA A;  4CHP A;  3KD1 E;  5F0X A;  1IBM K;  2FXU A;  3TR8 A;  3LP3 A;  1IBK K;  3RVC A;  3TTC A;  4I2Q A;  2PY5 A;  1BIZ A;  4PA1 A;  3QFU A;  2A40 A;  3OS0 A;  2O8D A;  4WFA L;  1ZBS A;  2PZS A;  4FJX A;  5LY3 A;  1S72 N;  4PHT X;  2FF3 B;  3RWU A;  4CHQ A;  4E7K A;  4CF0 A;  3HO1 A;  3ZEU B;  1WSJ A;  1SL1 A;  4CGJ A;  4JI7 K;  3ZLJ A;  1MWK A;  1WNS A;  4F9O A;  3KLI A;  4O4G A;  4LF5 K;  4CJF A;  4BRD A;  3BZC A;  3FZF A;  1OH7 A;  1BCO A;  1XNR K;  1D9D A;  4GKJ K;  3A5L C;  5CHI A;  3QBX A;  4O8K A;  3IFR A;  5GIP A;  1X9W A;  4FWN A;  1TV6 A;  3MXM A;  3AVL A;  1U45 A;  4FO0 A;  4CEC A;  2XO7 A;  3H46 O;  3FR0 A;  5AQZ A;  3CCL N;  3OW2 M;  1QS4 A;  2P9P A;  5AQQ A;  1NGI A;  3A5O C;  4E19 A;  3V9U A;  4JI5 K;  2F9T A;  2X74 A;  4C23 A;  4DR7 K;  4FWL A;  2DTU A;  3SUN A;  3TAN A;  4J2B A;  3LWL A;  4OKE A;  1YJW N;  4JRQ A;  1HUX A;  3ZSQ A;  3CF5 L;  3CJ7 A;  5M1F A;  1S1X A;  3L2W A;  3DXM A;  2QWQ A;  3C0B A;  2HBM A;  2VWK A;  3U3Y A;  4H03 B;  4IEI A;  2VGN A;  2QA4 N;  3WQU A;  3P1G A;  3HSC A;  3MN7 A;  4B1Z A;  2XY6 A;  4H8K A;  4FWM A;  4FJ7 A;  3KWI A;  3HP9 A;  5C24 A;  3TTF A;  4JI2 K;  1MA9 B;  4JKG B;  2IVN A;  3SQ2 A;  4EHU A;  3ZSX A;  1JLC A;  5AQW A;  2CGK A;  2RPI A;  5AQG A;  1QHT A;  3AY9 A;  1L5U A;  3J7Y P;  3C7N A;  4E7J A;  1VSF A;  5FPM A;  2KFN A;  3E1Y A;  1Q18 A;  3VMF B;  3M8S A;  4RW8 A;  4GMJ B;  3VES A;  5C2F A;  4IEE A;  3K5M A;  4FPA A;  1QVF M;  3V1O A;  3HI0 A;  4Y0W A;  1BHL A;  4DUZ K;  5AQU A;  1MDU B;  4KRF A;  2YKN A;  1NWK A;  1JLF A;  4WQ4 A;  2G8V A;  3RRH A;  1QQM A;  3CET A;  3AAR A;  4F2R A;  4B3R K;  2E2Q A;  4CK3 A;  4YY3 K;  3MWT A;  4M3R A;  4LY7 A;  4O44 A;  4WQ5 C;  3L8B A;  1OVY A;  1K8A O;  4O0J A;  4DQI A;  3MMV A;  3OYC A;  1ATR A;  4JNE A;  1RDW X;  3PV8 A;  1BCM A;  1VSD A;  1DKG D;  1RT3 A;  2FC0 A;  1XI1 A;  2A1S A;  4DG1 A;  1BI4 B;  3TI0 A;  1NK5 A;  3SBG A;  1X9S A;  1IH7 A;  1RTJ A;  3FZM A;  1TGO A;  4IKF A;  5AQM A;  3A5N C;  1VSM A;  4CZF A;  3D2E A;  2QWM A;  3SYZ A;  4B9N A;  1BO5 O;  4CFC A;  3UKR B;  3AGR A;  3PIO L;  4IDK A;  2RKI A;  4CBX A;  4U7B A;  3CC2 N;  2KTQ A;  3CPW M;  1S6P A;  2ITM A;  3R9P A;  4OVL A;  4DF8 A;  3OVN A;  4N41 A;  4F3T A;  4FK2 A;  3MK6 A;  1C1B A;  1SUQ A;  4NLC A;  4XH1 A;  3QFP A;  4DTJ A;  3M5R A;  2AP1 A;  3Q7B A;  3P83 D;  4Q0B A;  1NK9 A;  4CJ5 A;  3L4I A;  3FZH A;  3LDS A;  1KVC A;  2O8E B;  2QWP A;  3G6E N;  3HZ6 A;  2V52 B;  4JLH A;  3PO5 A;  3J81 O;  5M1N A;  1XMQ K;  3NCI A;  3T1H K;  4B8A B;  3KTQ A;  2E8A A;  1HMV A;  2NRX A;  3NVM A;  2BDP A;  1IBL K;  3OJS A;  4FJG A;  3M3Z A;  2E6L A;  1UWB A;  3LM9 A;  3NHG A;  3L2Q A;  4KI4 A;  4KV8 A;  3TSP A;  3HPG A;  4CJQ A;  4WFN L;  3DLK A;  1TVR A;  2X6S A;  5HRN A;  1T05 A;  5JLF A;  4FL9 A;  3GDQ A;  4GW6 A;  5J2M A;  3BGR A;  3KLH A;  2Q0R A;  2A42 A;  2XHB A;  4G1Q A;  3E66 A;  3NF8 A;  2P9L B;  4R79 A;  4AQY K;  2A5X A;  2CH5 A;  3LDO A;  4BR7 A;  5BR8 K;  4QS7 A;  4GY2 B;  2I5J A;  3FFK B;  3HOT A;  4IFV A;  4EHT A;  1YUW A;  4OKK A;  1EWR A;  2UUA K;  1U49 A;  4H0T B;  5FRM A;  1XUP O;  4KPY A;  3JYT A;  4HVJ A;  4JHD B;  3AAP A;  4XIU A;  3B6O A;  3HTV A;  4FJN A;  3OYL A;  1XNQ K;  2P9U B;  3KK2 A;  3P39 A;  1VSK A;  5AR0 A;  4KHW A;  3G71 N;  1OH5 A;  3NFA A;  5A2Q O;  3ZX3 A;  2OPQ A;  3ENH A;  1RDD A;  2PYJ A;  5KQ8 A;  4DFK A;  4MLE A;  4JKC A;  4BC2 A;  4F4K A;  4DR4 K;  5H1S Q;  1CZ9 A;  1HPM A;  4B9T A;  3ZCM A;  4MDA A;  3C6A A;  1LWE A;  4E1J A;  5HP1 A;  3ZYY X;  3S3N A;  4HHT A;  4JYA K;  1DTT A;  2P5O A;  3VF6 A;  2GEM A;  4DTP A;  5KQD A;  2RF2 A;  4E7I A;  1TUY A;  5BRE A;  3L2R A;  4YOV A;  3ISN C;  4DMN A;  3LDN A;  4ISE A;  4UQG A;  5AQR A;  3ALY A;  1UA1 A;  4RG8 A;  2B5J A;  2H3G X;  3CJB A;  3IKM A;  1YAG A;  1HJO A;  3O6W A;  5FLX O;  2B6A A;  4BG9 A;  1C0T A;  2EX3 A;  1S1T A;  3O9R A;  5C10 A;  2D4W A;  3FLC O;  3HM9 A;  2QWO A;  4J2A A;  2O4I A;  1RDB A;  2YJF A;  5AQH A;  3KWG A;  4OLA A;  4K41 A;  2CGL A;  4CJS A;  3NDK A;  4ELV A;  5KI6 A;  5FPE A;  1HKG A;  5AZJ B;  1RBU A;  2UUC K;  3L0Q A;  5AQO A;  2FBT A;  4CGF A;  2P9N B;  1L3S A;  2Q3S A;  4AM6 A;  4CD1 A;  2ZWH A;  1JXE A;  3OYI A;  4LSL A;  1KTQ A;  3IMX A;  4CK1 A;  1X3M A;  3WQT A;  4YOY A;  2HST A;  3LM2 A;  3WNH A;  4W5N A;  4JI1 K;  3AAQ A;  1SKR A;  2DFF A;  3OBY A;  1RNH A;  1OKJ A;  2ZJP L;  4DTO A;  4E0D A;  2O8C A;  4RTF D;  3NH2 A;  1BDG A;  4XH4 A;  1U2V A;  4OPJ A;  4FJI A;  1NGF A;  1FK9 A;  1T6C A;  5FRO A;  3KK1 A;  3THX A;  4DQQ A;  3AVJ A;  4BWJ A;  4ELU A;  1GLE G;  3J8A A;  4CVN E;  3PY8 A;  4KHN A;  1JCF A;  4YOX A;  4DU4 A;  2HF3 A;  1RBS A;  4OGC A;  3BF1 A;  4B9L A;  4CZH A;  4LF9 K;  4NXN K;  2GBZ A;  2OTJ N;  3VEX A;  4PWD A;  2QW9 A;  4KHS A;  5TKY A;  5D3G A;  4FVU A;  4DV4 K;  4CJ4 A;  3MX5 A;  2GUI A;  2PAV A;  2QKK A;  1D4X A;  1GLA G;  1C1A A;  5KGX A;  4PL8 A;  1HNZ K;  3A2F A;  4ISF A;  3U9Z A;  4X62 K;  1QTM A;  3C95 A;  2YNF A;  1VQ7 N;  1B9F A;  1JJ2 M;  3WNF A;  3O3H A;  3FE1 A;  3ZEU A;  4DWI A;  3SUQ A;  1NK0 A;  2E5L K;  3SJJ A;  2IDO A;  3LDQ A;  3PX4 A;  1REV A;  1QSY A;  4CJW A;  3K9J A;  1NGA A;  4NLB A;  3LPT A;  1YHQ N;  5GAH P;  3KIO A;  1LAW A;  3V1Q A;  1NGD A;  4DSK A;  1JLA A;  3QDK A;  4CD3 A;  4N5S A;  1TL1 A;  4ID1 A;  3HPO A;  2W6L A;  2YNH A;  4HTU A;  2Q1N A;  4HCC A;  4M42 A;  1SZ2 A;  1RTH A;  4M3T A;  1OH8 A;  4DQR A;  4EP4 A;  1VRT A;  4CZJ A;  5ADX H;  3G10 A;  3HM8 A;  4JN4 A;  5EVZ A;  3T1A A;  5DM7 L;  4JK9 A;  3O4Q A;  4JKA A;  4AF1 A;  1C6V A;  3AVG A;  4B9V A;  3OYH A;  1C0G A;  4BRN A;  4CGG A;  4B08 A;  3O4W A;  4CIG A;  2FLO A;  2IVO A;  1BIU A;  4QS9 A;  1S1U A;  3OS1 A;  1YXQ A;  1JCE A;  3DJC A;  5CR4 A;  1LV5 A;  3CYM A;  3M8Q A;  5AQT A;  4FPB A;  3ZX0 A;  1G99 A;  3VQQ A;  4CFB A;  3RMC A;  3VGL A;  1NGE A;  3DRP A;  3DLR A;  3SPZ A;  3OA9 A;  4BQL A;  4CEA A;  2IIR A;  2HMI A;  4CZG A;  1BU6 O;  1HPZ A;  4JKG A;  4Z4H A;  3D2F B;  4CGD A;  1SKS A;  4EP5 A;  3O9U A;  3SZ2 A;  4DQP A;  3LP1 A;  3QIC A;  1XHZ A;  1ASV A;  1FKO A;  4E1N A;  2IVP A;  2X78 A;  2HBJ A;  4OKJ A;  5FRN A;  3A8Y A;  3DWL A;  2HHH K;  1I94 K;  1XHX A;  4IG3 A;  1GLF O;  4DV5 K;  3TAE A;  4IFE A;  3AO1 A;  3ZSW A;  3HVT A;  5BN9 A;  2F4V K;  4LFB K;  4CHY A;  3CCQ N;  3QIN A;  1T44 A;  3G4S N;  2Y1J A;  1SV5 A;  2ETJ A;  5JS1 A;  2V7Z A;  3VEZ A;  3TWH A;  3VQC A;  4JS4 A;  3L4Q A;  4NYF A;  3ZSV A;  1ATN A;  4KB0 A;  2YHW A;  4BR2 A;  3I33 A;  3O08 A;  2ZJR L;  5EOY A;  5BPN A;  3O3F A;  1XC3 A;  1NNE A;  3H45 C;  2G8F A;  3KZB A;  1BI4 A;  4FJJ A;  5E26 A;  2OAN A;  3SCX A;  4LFC K;  3VQP A;  1WSF A;  5SWM A;  4CEE A;  1NMD A;  4W5R A;  4CJP A;  1NM1 A;  3NF7 A;  5C25 A;  3UKR A;  3EY1 A;  1VSH A;  3K5L A;  1QVG M;  3G0Z A;  4CF1 A;  1WBD A;  5MLC Q;  3R8E A;  3QIP A;  4DSE A;  1T03 A;  2WC9 A;  3U9D A;  3HL8 A;  2Q36 A;  3UIQ A;  2HOE A;  4JRP A;  3CM5 A;  2LSN A;  4KHQ A;  3K59 A;  3DI6 A;  1KC8 O;  1JL1 A;  3OBW A;  2KQ2 A;  3MN9 A;  1BQM A;  1I39 A;  3VPZ A;  4CCH A;  3HYF A;  1LW0 A;  3AGK A;  3DXK A;  4DHY A;  4FCY A;  4IO8 A;  4DV3 K;  2O8E A;  3ZT0 A;  3CPE A;  2D0A A;  1BUP A;  4C8N A;  3CCJ N;  3MED A;  5C12 A;  1GLJ O;  1WSE A;  3ZSO A;  3VN5 A;  2YNI A;  1R59 O;  2A41 A;  3H3N O;  2NRT A;  5B8H A;  3P31 A;  2BH1 A;  4C8K A;  2ZQB A;  1TYQ B;  4YHH K;  3EKS A;  1VQ5 N;  2NNW A;  3DOK A;  3D7E O;  4MFB A;  4W5Q A;  3VEN A;  1GLC G;  1T6D A;  2ASM A;  2P9I A;  3HRG A;  4FWK A;  5ADX A;  4YOT A;  3KLE A;  5T7B A;  2P9S B;  3R1X A;  3LP2 A;  3SUP A;  4B9S A;  5AQN A;  1HNX K;  2G8W A;  3PX0 A;  1W9H A;  2KZZ A;  4OPH A;  3I56 N;  2D1K A;  1ATS A;  4CI6 A;  3DYA A;  5GAG P;  2HF4 A;  4B9U A;  4JKB A;  3HK2 A;  2QK9 A;  2P9L A;  3AO4 A;  2HVH A;  2FF6 A;  1W97 L;  1HKC A;  3ENB A;  5FPN A;  3DRS A;  5J1E A;  4WFB L;  2E2P A;  1QE1 A;  3MXJ A;  2BTF A;  5JIC A;  1TKZ A;  3BUZ B;  1JLB A;  2XRI A;  4CIE A;  3EE8 A;  4CES A;  4DSI A;  2D0C A;  1VQL N;  2HHU A;  2X6N A;  4JHD A;  4JKH A;  4GNI A;  3CCM N;  1QQO A;  3JS6 A;  3KLF A;  1NJY A;  1N5Y A;  4CJL A;  3D6R A;  5AQI A;  3VTI A;  4CJE A;  4JKD A;  2OCE A;  3D0P A;  4GV9 A;  4BDY A;  5HBM A;  4Y1D A;  3KJV A;  3CCE N;  2NRR A;  4B9M A;  1RIL A;  1W0H A;  4DV0 K;  1X3N A;  4JS5 A;  4OX9 K;  1HNV A;  4DCH A;  1G15 A;  2YHA A;  3VA3 A;  1LAV A;  1RT4 A;  4H5T A;  4ICL A;  2A1R A;  2OPS A;  2ZF5 O;  4OPK A;  4DQS A;  3MEC A;  3OYA A;  4XH5 A;  1FW6 A;  3S3O A;  2QTD A;  4KAZ A;  4AHR A;  4DFJ A;  4GVE A;  4W5T A;  5AQP A;  4BRA A;  3ZSY A;  4FXD A;  3CXC M;  2GWK A;  4IJN A;  3CCU N;  4B9Q A;  1DGK N;  4DKW A;  1U04 A;  1LW2 A;  3SUO A;  5AZI B;  1KFS A;  4AHT A;  1NGH A;  2R7Y A;  5JVG L;  1ASW A;  2J4R A;  3M8P A;  4ELT A;  2VYP A;  4F3O A;  1NJW A;  4BAC A;  4CJ3 A;  3ITH A;  4FJM A;  3THW A;  5BN8 A;  4DTS A;  5HRO A;  2Q31 A;  4GV6 A;  3AVI A;  3CIP A;  4CJT A;  1RFQ A;  5AZJ A;  5M1P A;  1XWL A;  2P9N A;  4FLT A;  1QSL A;  3CJ1 A;  2O8B B;  1NKC A;  4BR5 A;  3L2V A;  2QI2 A;  1WB9 A;  1M1K O;  1EQY A;  2G8H A;  1BOT O;  3DLE A;  3HT3 A;  4M3Y A;  1JL2 A;  1Q86 O;  5BRD A;  4NCG A;  2WON A;  5CZ2 A;  3QEX A;  1QHA A;  1RBR A;  1K8K B;  4ID5 A;  3VET A;  2GEL A;  4KH5 A;  3KD5 E;  1BWF O;  1NK7 A;  4C8O A;  1Y97 A;  3KHY A;  4E7H A;  3SQ1 A;  4ZHR A;  1YVU A;  2RE2 A;  4FWS A;  4WF9 L;  1KAZ A;  3EN9 A;  1NKB A;  5DMR A;  3ATV A;  3OJU A;  1VHX A;  3I0S A;  3CJC A;  4O0I A;  2DY4 A;  1CZA N;  2FSN A;  2JWL A;  4DR2 K;  3O1W A;  4RCH A;  1IKW A;  3UE5 A;  4EZ6 A;  1NG9 A;  2YCH A;  4IZ9 A;  4B3T K;  1KAY A;  3THV A;  1B9D A;  4A5B A;  2G8I A;  5FDL A;  2IC3 A;  3KKR A;  4FJ8 A; 
#chains in the Genus database with same CATH homology
 1BL3 A;  3BDP A;  1Z26 A;  3WNH A;  3HXM A;  2OA8 A;  4W5N A;  1SKR A;  1IG9 A;  2DFF A;  2P5G A;  1RNH A;  1QSS A;  1RT5 A;  4DTO A;  1S9E A;  4E0D A;  4E1M A;  4FLV A;  3NH2 A;  3VQ5 A;  3V9S A;  1NKE A;  1L3V A;  2HND A;  4OPJ A;  1U48 A;  4CEF A;  2Z1J A;  3HST B;  4FJI A;  1MU2 A;  4F2S A;  4FJ5 A;  1EX4 A;  1FK9 A;  1RT7 A;  1A5W A;  5FRO A;  3KK1 A;  1IKY A;  1WLJ A;  4DQQ A;  2DFH A;  3AVJ A;  3F9K A;  4BWJ A;  4DTU A;  4ELU A;  4DFM A;  1Q9X A;  1CLQ A;  3CFO A;  3C94 A;  2KFZ A;  2D5R A;  3PY8 A;  4KHN A;  5I42 A;  3LAL A;  4DU4 A;  4FYD A;  1C0M A;  1RBS A;  4OGC A;  4B9L A;  3VQ7 A;  5HRS A;  2GBZ A;  4BE0 A;  2IOC A;  2HHQ A;  3WNG A;  2YKM A;  3CM6 A;  4M45 A;  1X1P A;  4FLW A;  4KHS A;  4PWD A;  2FBV A;  1RTI A;  3ZT3 A;  4DF4 A;  3L2U A;  3SI6 A;  5E41 A;  1T7P A;  5D3G A;  4Z4F A;  1C0U A;  1LWC A;  4FJK A;  1UA0 A;  4AIL C;  4CJ4 A;  1EKE A;  2GUI A;  3ZT4 A;  1BIS A;  2D0B A;  3NE6 A;  2QKK A;  2FBX A;  3AVH A;  5CY4 A;  5I3U A;  5JS2 A;  1C1A A;  1HYV A;  4CF2 A;  5KGX A;  3NGZ A;  2BGG A;  4KI6 A;  3A2F A;  1QTM A;  3AA5 X;  2ITG A;  4KTQ A;  5HRP A;  4QAG A;  4DTR A;  3AVK A;  3C95 A;  4KTW A;  4RW4 A;  2YNF A;  1B9F A;  4KKO A;  2KW4 A;  1WSI A;  1SL0 A;  1R0A A;  4DSL A;  4FW2 A;  3WNF A;  3O3H A;  2F96 A;  3K5O A;  1VK0 A;  3P5J A;  4DWI A;  4OGE A;  4CJR A;  3SUQ A;  1NK0 A;  1ZBH A;  2HHS A;  3SJJ A;  3SQ0 A;  2IDO A;  3QEP A;  4Z4I A;  3PX4 A;  1REV A;  1QSY A;  4CJW A;  4KB1 A;  4Z0U A;  3ZSR A;  4RW6 A;  2OPR A;  3K2P A;  1EP4 A;  4I2P A;  4I9Q A;  4YNQ A;  3ULD A;  1TK0 A;  4E3S A;  3O4N A;  4QCL A;  3LPT A;  3KIO A;  1LAW A;  3V1Q A;  1KVB A;  4DSK A;  1JLA A;  3IS9 A;  1TL3 A;  2BE2 A;  1DTQ A;  4N5S A;  4PUO A;  1WAJ A;  4LSN A;  1TL1 A;  4ID1 A;  2VG6 A;  3VQA A;  3HPO A;  4DLE A;  3V9Z A;  4CHP A;  1O1W A;  1N6Q A;  4K8X A;  3KD1 E;  2YNH A;  4AHS A;  3TR8 A;  4CGH A;  4FJL A;  3LP3 A;  4HTU A;  4HCC A;  1KLM A;  4M42 A;  4I2Q A;  2PY5 A;  4CJV A;  1S1V A;  1BIZ A;  5HLF A;  4EZ9 A;  1RTH A;  2Z1H A;  3TAQ A;  4FK0 A;  4M3T A;  4PA1 A;  4DQR A;  2HW3 A;  3NF9 A;  3VQ8 A;  4EP4 A;  1VRT A;  1KRP A;  4CEZ A;  1J53 A;  3OS0 A;  2GV9 A;  3C6U A;  3G10 A;  3LZJ A;  1WSH A;  3K5N A;  4FM1 A;  2PZS A;  4FJX A;  4NCB A;  1D8Y A;  2F8S A;  3LZI A;  4DLG A;  3T1A A;  1S1W A;  3LPU A;  3VQ4 A;  4DQS A;  1S9G A;  4DU3 A;  1Q9Y A;  3O4Q A;  4KFB A;  2YV0 X;  3RWU A;  4CHQ A;  3QIO A;  4E7K A;  4CF0 A;  2WOM A;  3HO1 A;  5CYQ A;  3AVF A;  1C6V A;  3AO2 A;  3AVG A;  2OYQ A;  3OYH A;  4B9V A;  1WSJ A;  4WE1 A;  3L3U A;  4CFA A;  2XY7 A;  1SL1 A;  4CGG A;  4CGJ A;  4B08 A;  1WNS A;  3RR7 A;  4CIG A;  3MAQ A;  1BIU A;  1DLO A;  2HHW A;  4I7F A;  1S1U A;  3KLI A;  4O4G A;  3OS1 A;  5DK5 A;  4CJF A;  3I0R A;  4Y1C A;  3QO9 A;  1LV5 A;  2OPP A;  3CYM A;  3M8Q A;  4FVM A;  3T19 A;  4OLB A;  1BCO A;  3VQQ A;  4CFB A;  1D9D A;  3OYJ A;  3RMC A;  4KHU A;  3ASM A;  3DRP A;  3DLR A;  3SPZ A;  4HUG A;  3T3F A;  4YFU A;  1EXQ A;  3LWM A;  2XY5 A;  4CEA A;  1KLN A;  1UAX A;  3HVR A;  1X9W A;  2HMI A;  4R5P A;  1TV6 A;  3V6D A;  4PY5 A;  3MXM A;  3AVL A;  1U45 A;  1HPZ A;  1JLE A;  2IAJ A;  4H4M A;  4CEC A;  4Z4H A;  2XO7 A;  4BDZ A;  4FK4 A;  2HVI A;  3AVB A;  4LD0 A;  4CGD A;  1SKS A;  4EP5 A;  3SZ2 A;  1QS4 A;  4DQP A;  3LP1 A;  2BAN A;  3EYZ A;  3TAB A;  4E19 A;  4N56 A;  2P1J A;  1XHZ A;  1CXU A;  3L3V A;  3V9U A;  4CJU A;  3OYG A;  2X74 A;  1ASV A;  4GVM A;  2DTU A;  3SUN A;  1FKO A;  4E1N A;  4CED A;  3TAN A;  2X78 A;  4OKJ A;  4N47 A;  4J2B A;  5FRN A;  3LWL A;  1C1C A;  4OKE A;  4JRQ A;  4KRE A;  4FZX C;  1XHX A;  3ZSQ A;  4CK2 A;  4IG3 A;  1RCH A;  3PUF A;  4DS5 A;  1D5A A;  1KFD A;  1S1X A;  3L2W A;  4Z4C A;  3TAM A;  3TAE A;  3LAK A;  3AO1 A;  3ZSW A;  2VWK A;  5EU7 A;  3U3Y A;  3HVT A;  1NJX A;  4CEB A;  4CHY A;  3IRX A;  3QIN A;  3AO3 A;  3P1G A;  2Y1J A;  1SV5 A;  2ETJ A;  4M41 A;  2XY6 A;  5JS1 A;  4H8K A;  3ZT1 A;  3K58 A;  3AVA A;  2VWJ A;  3TWH A;  4LH4 A;  3VQC A;  3HP9 A;  3ZT2 A;  5C24 A;  1GOA A;  4JS4 A;  1ZBL A;  1NK8 A;  4NYF A;  1VSJ A;  2HB5 A;  3ZSZ A;  3B6P A;  3ZSV A;  4RW9 A;  3QER A;  1ZBI A;  4KB0 A;  5KTQ A;  4BDP A;  4HCB A;  1CXQ A;  3QNN A;  3SQ2 A;  4QOZ B;  1VRU A;  1KCF A;  3SQ4 A;  3O3F A;  3ZSX A;  3AVC A;  1JLC A;  4Q5V A;  3LAN A;  2NUB A;  4CF8 A;  1A5X A;  2RPI A;  1QHT A;  1YTU A;  1L5U A;  3H08 A;  2G8K A;  4M3Z A;  3VA0 A;  2G8F A;  1BI4 A;  4FJJ A;  3LP0 A;  2HNY A;  5KRT A;  2AJQ A;  4E7J A;  1VSF A;  1B92 A;  4DFP A;  1ZBU A;  3SCX A;  3DMJ A;  2IGI A;  2KFN A;  3M8S A;  1WN7 A;  4M3X A;  3VQP A;  1WSF A;  4FJ9 A;  4RW8 A;  5SWM A;  4CEE A;  3V9W A;  4IFY A;  4GMJ B;  3O3G A;  4W5R A;  4CJP A;  3QEW A;  1L3T A;  3K5M A;  3NF7 A;  3MXI A;  1YT3 A;  5C25 A;  3V1O A;  3OYN A;  3EY1 A;  1VSH A;  1RBT A;  1BHL A;  3K5L A;  3G0Z A;  4CF1 A;  4FM0 A;  4KRF A;  4TSX A;  4FLX A;  2YKN A;  1JLF A;  3QIP A;  2G8V A;  4DSE A;  3RRH A;  1T03 A;  1S5J A;  2VG7 A;  2YNG A;  3AA4 A;  4IG0 A;  3K57 A;  4F2R A;  3HL8 A;  3UIQ A;  3TAG A;  1ZBF A;  4JRP A;  3V4I A;  2ZE2 A;  3V81 A;  3CM5 A;  2LSN A;  4CK3 A;  3DM2 A;  3K59 A;  3DI6 A;  4KHQ A;  5SZT A;  2KZM A;  1JL1 A;  2KQ2 A;  4M3R A;  4LY7 A;  1BQM A;  1I39 A;  4O44 A;  3L8B A;  3HYF A;  1Z25 A;  4CCH A;  1HYS A;  1LW0 A;  4H4O A;  3SNN A;  1HQU A;  3KKS A;  2F8T A;  3OYK A;  4O0J A;  4FCY A;  4DQI A;  3OYC A;  3MEG A;  1NOZ A;  3PV8 A;  1L3U A;  1YTA A;  1BCM A;  1VSD A;  4FW1 A;  3NBP A;  1U47 A;  3ZT0 A;  3V9X A;  2D0A A;  2QXF A;  1RT3 A;  4C8N A;  2FC0 A;  1XI1 A;  2A1S A;  1TKT A;  4M3W A;  2E6M A;  3MED A;  4Z4G A;  4DG1 A;  1BI4 B;  3TI0 A;  1NK5 A;  4B3O A;  1X9S A;  1SKW A;  1IH7 A;  3QEV A;  3NGY A;  1RTJ A;  1WSE A;  3DLB A;  1IKX A;  3ZSO A;  3VN5 A;  2PYL A;  2YNI A;  1TGO A;  1IKV A;  3KK3 A;  4F8R A;  4IKF A;  3VQD A;  1VSM A;  4C8K A;  3SYZ A;  4B9N A;  3LAM A;  2ZQB A;  4CFC A;  1TAQ A;  4AHV A;  3OYB A;  4IDK A;  1CZB A;  4IBN A;  2RKI A;  3QLH A;  3OS2 A;  1NJZ A;  4Z4E A;  2O4G A;  1RDA A;  3OY9 A;  2KTQ A;  1JXB A;  3DOK A;  1FKP A;  3QEI A;  1VSL A;  1S6P A;  4MFB A;  4W5Q A;  1X9M A;  1Q8I A;  4OVL A;  1RBV A;  4FLY A;  4BE1 A;  3OVN A;  4CER A;  4DF8 A;  4N41 A;  4W5O A;  5HRR A;  5T7B A;  4AHC A;  3KLE A;  3RMD A;  4F3T A;  3V1R A;  4FK2 A;  1C1B A;  1SUQ A;  3LP2 A;  3SUP A;  4B9S A;  2G8W A;  4DTJ A;  4KO0 A;  1W9H A;  3PX0 A;  2VG5 A;  2KZZ A;  4FLU A;  3DYA A;  3P83 D;  4CEQ A;  2OZM A;  4Q0B A;  1NK9 A;  1BGX T;  4CJ5 A;  3D45 A;  2ZD1 A;  3LDS A;  4B9U A;  1KVC A;  1JLG A;  1TKX A;  1HJR A;  2QK9 A;  1VSE A;  1HRH A;  3HK2 A;  3OYD A;  3AO4 A;  5KRS A;  4K8Z A;  4O55 A;  3AVM A;  4JLH A;  4KHY A;  2HVH A;  2RN2 A;  3CQ8 A;  3PO5 A;  3QNO A;  4M3U A;  5K14 A;  1HYZ A;  1GOC A;  1WAF A;  3E01 A;  1J54 A;  3NAE A;  3NCI A;  3DRS A;  5J1E A;  1TK8 A;  1RTD A;  1QE1 A;  3MXJ A;  4B8A B;  4KTZ A;  4DSF A;  4CF9 A;  3KTQ A;  1HMV A;  1TKZ A;  3HPH A;  4CIF A;  4ZTF A;  1JLB A;  2XRI A;  3SPY A;  4CIE A;  3QES A;  4CES A;  2BDP A;  3VQB A;  4DSI A;  1RT1 A;  1FXX A;  4LH5 A;  2D0C A;  3TAP A;  2HHU A;  2X6N A;  4L8R B;  1UOC A;  4DTX A;  1TAU A;  3OJS A;  4FJG A;  3SV4 A;  2E6L A;  1UWB A;  4CHN A;  3NHG A;  3L2Q A;  3KLF A;  1NJY A;  4KI4 A;  4PQU A;  1N5Y A;  4KV8 A;  3HPG A;  4CJL A;  4CJQ A;  3WNE A;  2EHG A;  2OZS A;  1HNI A;  3AA3 A;  1RT6 A;  3DLK A;  5CZ1 A;  5C42 A;  3SV3 A;  4CJE A;  1KVA A;  1TVR A;  2X6S A;  3AVN A;  5HRN A;  1T05 A;  3D0P A;  4C8L A;  4DSJ A;  4BDY A;  4GW6 A;  5J2M A;  5HBM A;  4Y1D A;  3NGI A;  3BGR A;  4CEO A;  2DFE A;  4FM2 A;  3KJV A;  3KLH A;  2XHB A;  4DTN A;  1S6Q A;  1SL2 A;  4G1Q A;  3AA2 A;  4B9M A;  1RIL A;  1W0H A;  3AV9 A;  3U3G A;  3NF8 A;  3IAY A;  4JS5 A;  1U4B A;  5CYM A;  1JKH A;  1HNV A;  2YHA A;  1G15 A;  1D9F A;  3VA3 A;  3RRG A;  1LAV A;  1RT4 A;  1NK6 A;  3RMA A;  2I5J A;  3F73 A;  2QKB A;  4NYN A;  4IFV A;  4ICL A;  2A1R A;  2OPS A;  4OKK A;  2JLE A;  3NF6 A;  4O5B A;  3AO5 A;  4OPK A;  1GOB A;  1JLQ A;  2Z1G A;  3MEC A;  3OYA A;  1RDC A;  4DS4 A;  2P51 A;  4N76 A;  3S3O A;  1U49 A;  5J2Q A;  1TKD A;  5FRM A;  4KAZ A;  4KPY A;  1T8E A;  3JYT A;  4AHR A;  4HVJ A;  4DFJ A;  4W5T A;  3CG7 A;  4XIU A;  3JSM A;  3B6O A;  3TAF A;  3ZSY A;  1A5V A;  3OYE A;  4FJN A;  3FFI A;  3OYL A;  4FXD A;  4DU1 A;  2W42 A;  4MQ3 A;  3KK2 A;  2HHX A;  2JGU A;  3I8D A;  1EET A;  1VSK A;  4KHW A;  1U04 A;  4C8M A;  1LW2 A;  1ITG A;  3SUO A;  1IO2 A;  3IG1 A;  1KFS A;  4AHT A;  4AH9 A;  3RTV A;  1QQC A;  1RT2 A;  3DLG A;  4B8C A;  4CE9 A;  1WSG A;  3DRR A;  3HJF A;  3NFA A;  2R7Y A;  1ASW A;  3CFR A;  4FZZ A;  1J5O A;  1LWF A;  4FJ7 A;  3M8P A;  2OPQ A;  4BWM A;  4CFD A;  4ELT A;  4F3O A;  1NJW A;  4BAC A;  1RDD A;  2IS3 A;  4CJ3 A;  3ITH A;  4CJK A;  2PYJ A;  4FJM A;  4DFK A;  4NCA A;  3VQ6 A;  4DTS A;  5HRO A;  5J2P A;  4HUF A;  4E7L A;  4F4K A;  3AVI A;  4CJT A;  4B9T A;  1CZ9 A;  3DOL A;  3ZCM A;  2XY8 A;  4AHU A;  4HUE A;  5KGW A;  1LWE A;  4FLZ A;  5HP1 A;  3OYF A;  1XWL A;  3S3N A;  4HHT A;  4FLT A;  1QSL A;  1NKC A;  4I9L A;  3L2V A;  4CGI A;  1DTT A;  3DLH A;  2P5O A;  4ZTJ A;  4DTP A;  2G8H A;  2RF2 A;  3QET A;  4E7I A;  4RW7 A;  3DLE A;  2B4J A;  3HT3 A;  4M3Y A;  1JL2 A;  3RR8 A;  3L2R A;  4NCG A;  3PX6 A;  3ISN C;  3MEE A;  3NH1 A;  2WON A;  4DMN A;  1NOY A;  5CZ2 A;  3QEX A;  1RBR A;  4ID5 A;  4UQG A;  4J2E A;  2HHV A;  3ALY A;  3C6T A;  2E4L A;  3VQ9 A;  1UA1 A;  4RG8 A;  4FZY A;  1J9A A;  1ASU A;  4CHZ A;  2B5J A;  3NH0 A;  2Z1I A;  1TK5 A;  2G8U A;  4FJH A;  3PO4 A;  2HNZ A;  3KD5 E;  1NK7 A;  4C8O A;  1Y97 A;  2B6A A;  2FBY A;  4E7H A;  3SQ1 A;  1C0T A;  2EX3 A;  1YVU A;  4ZHR A;  1ZYQ A;  1S1T A;  1NKB A;  5DMR A;  3HP6 A;  3S9H A;  3OJU A;  1VSI A;  4OJR A;  4BE2 A;  3HM9 A;  3I0S A;  3S3M A;  4O0I A;  4J2A A;  2O4I A;  1RDB A;  4DTM A;  1HQE A;  2DY4 A;  3KLG A;  5J2N A;  2YHB A;  3VQE A;  4J2D A;  4OLA A;  3NDK A;  4CJS A;  4ELV A;  5KI6 A;  1BQN A;  4CHO A;  1IKW A;  4EZ6 A;  1RBU A;  3OYM A;  3U6F A;  2HHT A;  1KSP A;  2FBT A;  4CGF A;  1NK4 A;  1XC9 A;  3THV A;  1B9D A;  2G8I A;  5FDL A;  1L3S A;  2Q3S A;  3M8R A;  2Y1I A;  3RMB A;  2IC3 A;  1F21 A;  3KKR A;  4FJ8 A;  4E89 A;  1JXE A;  1I3A A;  3OYI A;  3TAR A;  1K6Y A;  3EZ5 A;  4LSL A;  1KTQ A;  4CK1 A;  2ATQ A;  3CFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...