4KB0A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion cc )
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb0A00
5KGXA 5D3GA 2Q3SA 3CG7A 4DF4A 1I39A 1KCFA 1C1BA 4IG3A 4JLHA 4KV8A 1F21A 3AVLA 3VQPA 3SUQA 5J2MA 3QETA 4CEDA 3S3NA 2OZSA 3KLFA 4M42A 2FC0A 4Q0BA 3L2WA 1QS4A 1A5WA 3AVAA 3KIOA 1RT4A 1IKVA 3IAYA 5HLFA 1T03A 1KSPA 2DFFA 4FJ9A 3OYNA 2RN2A 3T19A 4HCBA 4CJ5A 4F4KA 3OYGA 5J2QA 3MXIA 2DTUA 4FZYA 4GVMA 5C42A 1NJXA 3P1GA 4IFYA 4M45A 5HROA 3IG1A 2JGUA 3NDKA 4CJTA 1IH7A 3AO5A 3HPGA 4CHNA 4CERA 5FDLA 1NKEA 4FJGA 1HYZA 3OYKA 4CF8A 3AVHA 1C0UA 2XY8A 3ZT2A 2BGGA 1JL2A 1BIUA 3IRXA 1TKZA 3OYMA 1SL0A 1HNIA 4CK2A 2X6SA 1QSLA 4DTXA 3SV4A 1SV5A 1QQCA 1BI4A 1O1WA 4HTUA 3I8DA 4CEEA 2QKBA 1S1VA 1HRHA 4FJNA 3OJSA 4BWJA 2D5RA 3DRSA 4ZHRA 3EZ5A 4N41A 4Z4HA 3LDSA 3DI6A 1RT3A 1JKHA 3ISNC 4FLXA 2HMIA 1RDDA 4CGGA 3E01A 4LD0A 2ATQA 1BIZA 1RT5A 3QEXA 1G15A 3CM5A 3O3HA 3OYHA 4CEFA 4B3OA 3AVFA 4BE2A 3U6FA 3MEGA 2Y1JA 4OPKA 1J5OA 2QK9A 1U45A 3A2FA 3VQAA 2IC3A 4FM0A 4B9VA 1A5VA 5KRTA 1Q8IA 2X6NA 4QAGA 4DSEA 2Z1HA 5CYMA 4B9TA 4KI6A 3SJJA 1RT2A 1GOBA 2XHBA 4DTPA 4OKJA 1T05A 4CGJA 1KVAA 3SNNA 1KRPA 5SZTA 2QKKA 3ZSVA 4PQUA 5EU7A 1KLNA 2AJQA 3KLIA 1XI1A 1B9FA 3HVRA 5KTQA 3PY8A 2KTQA 3IS9A 2HVHA 3LAKA 4RW8A 1EX4A 4O44A 3TANA 3DOLA 3MEEA 3L2QA 3VQ9A 1HNVA 3V9SA 4LH5A 1NOYA 2RF2A 1RBTA 3NH0A 4ZTFA 2P5OA 2VWJA 3RRHA 2OPSA 2I5JA 4OVLA 4IBNA 1S6PA 4O0IA 5J2PA 2A1RA 1YT3A 3OS2A 4PY5A 1IKYA 3NF6A 4PA1A 3UIQA 3RMCA 3C95A 3ZSQA 4FCYA 4B9NA 1S1WA 1WSIA 3ZT4A 1U49A 1GOAA 3OYAA 3QNOA 1REVA 4E7HA 4ZTJA 4W5OA 3AVJA 3M8SA 1RILA 3SYZA 3OS0A 2VG7A 1JLEA 3ZT0A 1VSJA 2OPPA 5SWMA 4DU3A 4FM2A 1NJWA 2KZZA 4Z4IA 3WNFA 2EX3A 1HYVA 4I2PA 4AHVA 1LAVA 3LP0A 1UOCA 4LSNA 4DF8A 3K58A 1WSFA 1A5XA 4MQ3A 4HCCA 4Z4FA 3L2VA 3LP1A 3HSTB 3AVNA 1CXUA 5CY4A 1NK9A 2O4IA 3OYJA 3I0SA 4B9UA 3LWLA 1S1UA 3DMJA 3OS1A 2HVIA 1UAXA 3TAFA 1RNHA 3LALA 1UWBA 3NGZA 4B9SA 5JS1A 2HHXA 1RTHA 1RDAA 1ASUA 5CZ2A 3VQ7A 3WNHA 3QEVA 1SL1A 1QTMA 2YNGA 2F96A 1FKPA 3QLHA 4CGIA 3OYBA 1S5JA 1TGOA 3SI6A 3FFIA 3AA2A 4RW9A 4RW7A 4HUGA 3QIOA 3MEDA 2EHGA 4CESA 3OVNA 3VN5A 1YTUA 2ETJA 4J2EA 4CJRA 2BE2A 4N56A 1SKSA 2PZSA 4KTQA 2VG6A 3AVBA 1XC9A 4KFBA 3QEPA 3PO5A 4B08A 2R7YA 3RMAA 1ZBLA 1UA0A 3RR7A 4EZ9A 4BE0A 1NKBA 1MU2A 5E41A 2WONA 1S9EA 1SKRA 1D9FA 3DM2A 2F8TA 1ITGA 4NYFA 2OPRA 2Z1IA 4O5BA 3SPYA 4K8ZA 1QHTA 4CJEA 3TAPA 1XHXA 3RR8A 1LWCA 4KTZA 2BDPA 4M3XA 3LAMA 4CFDA 2P5GA 3C94A 3VQ8A 3LPTA 1IKWA 4CGFA 3O4NA 4DU1A 4J2BA 4O0JA 4CK1A 4AHUA 3ZT1A 1KLMA 1RCHA 1YVUA 4EP5A 3EY1A 3SCXA 1KFDA 1IG9A 3HPOA 4M3YA 4AHCA 3V1OA 3SPZA 1KVBA 4I9QA 4NYNA 4FLWA 2P1JA 2RKIA 1WSHA 5DMRA 3OYEA 4E3SA 1EKEA 3ALYA 4CF1A 2HHQA 3KLGA 4Q5VA 2HHSA 2D0BA 2O4GA 2E6LA 4OGCA 4GMJB 3KK2A 4Z4GA 1IKXA 1C1AA 3O4QA 4KHSA 1S1XA 2LSNA 3B6OA 3LANA 4C8MA 1JLAA 4CJLA 3TI0A 4KRFA 1JLQA 3AO1A 4OKKA 1VSMA 3AVMA 4M41A 1LV5A 3PO4A 1WLJA 2BANA 1RTJA 2E6MA 4ID5A 3ZSZA 3NH2A 2YHAA 4CHOA 1JL1A 4CJPA 3OYFA 1K6YA 4FVMA 1SL2A 4BDYA 4CF9A 3TAEA 3QNNA 4B9MA 4NCAA 3HXMA 4FJIA 4MFBA 3ITHA 3WNEA 2G8VA 4DQPA 4WE1A 1B92A 3KKRA 5HP1A 2KFNA 2GBZA 3BGRA 3QIPA 4NCGA 3TR8A 4BACA 3SUOA 4ELUA 3VQCA 3JYTA 4CFAA 3TAGA 5I42A 1WNSA 1DTQA 4DS4A 1KVCA 1FK9A 3AO3A 5HRPA 3KLHA 4E7KA 2ZD1A 4DTMA 4BE1A 2DFHA 3PV8A 4KAZA 2HHTA 3NGIA 1IO2A 2IAJA 1NK4A 1X1PA 3TAMA 3JSMA 4BDPA 3DRRA 3V1QA 1CZBA 1NK0A 1WSGA 1J54A 4CECA 5I3UA 4C8NA 1WN7A 3NF8A 3PX4A 4DTNA 1LWEA 3QEWA 3SUNA 2HHUA 4Z4CA 5T7BA 4EP4A 1ZBIA 3K5MA 3AO2A 3NF7A 3KJVA 2YNHA 3AA4A 5JS2A 2X78A 4CF0A 1U48A 1L3TA 1RDCA 3HT3A 4KO0A 4W5TA 4CJVA 3TWHA 3VQQA 4J2AA 3TABA 2X74A 5K14A 4M3ZA 3C6TA 1LWFA 4FYDA 2QXFA 1L3VA 4KPYA 4PWDA 3DOKA 2B5JA 4DTRA 4M3UA 4B9LA 2D0AA 4OJRA 4CJFA 1Q9XA 4O55A 4FLYA 4DSKA 4J2DA 2Y1IA 3SQ0A 1VRUA 3HYFA 4I7FA 1NOZA 4DTSA 1VSHA 4KB1A 2OA8A 3KK3A 1QSSA 4FZXC 4IG0A 1NJYA 3DRPA 1UA1A 3SQ1A 4W5RA 2A1SA 3H08A 3K5OA 1QE1A 4CHZA 2G8UA 4EZ6A 4FK2A 1SUQA 4FXDA 4KTWA 1RBUA 1EETA 2XY6A 3B6PA 4AILC 4FJKA 5C24A 4YFUA 3MXMA 1ZBHA 2KZMA 4KB0A 2HHVA 4CIEA 2PYJA 4UQGA 1RBSA 1RT1A 1NK6A 1BQNA 4H4MA 4CJKA 1KFSA 2FBVA 2HNDA 4TSXA 4HUFA 2NUBA 1CXQA 1S9GA 1ZBFA 1Z26A 4I2QA 4OGEA 3ZSWA 4CGHA 3S9HA 1NK7A 3NAEA 1TAUA 2B4JA 3F9KA 4DLEA 4KHUA 4O4GA 4N76A 4IDKA 1D9DA 3DLHA 1L3SA 4CJSA 4Y1DA 3AVIA 2D0CA 1R0AA 4CJ3A 3OYIA 3LP2A 3KK1A 1D8YA 3KD1E 3NH1A 2DY4A 5FRMA 3SUPA 2HW3A 1FXXA 4CJWA 1HPZA 2YKMA 1Z25A 2KQ2A 3ZCMA 4DQRA 2GV9A 1W0HA 3NF9A 4FLVA 1JLBA 2VWKA 5FROA 4I9LA 1VK0A 4FJ7A 1RT7A 1SKWA 1ZBUA 2VG5A 1TAQA 2JLEA 1KTQA 3CYMA 1C0MA 1W9HA 3U3GA 4OKEA 4CEOA 4CIGA 3LZJA 3K2PA 4JRQA 1X9SA 4F8RA 4JS4A 3S3OA 1RT6A 3HO1A 3EYZA 3SV3A 3NFAA 3L2RA 4DQSA 2OPQA 4KKOA 4FK4A 3D45A 4W5QA 1C1CA 4E0DA 3VA0A 4CK3A 2ITGA 3KKSA 3WNGA 4N5SA 3DLRA 4IFVA 3AVGA 3O3GA 1BGXT 2IOCA 3VQ5A 3HP6A 1TV6A 4HUEA 1HQUA 3LPUA 1RTDA 5DK5A 3RTVA 1CLQA 1DTTA 3ZSRA 4CHQA 5KRSA 4E7LA 4CHYA 3RRGA 4C8LA 4DWIA 2YKNA 3C6UA 2PY5A 2W42A 1BISA 4N47A 4CF2A 2B6AA 3RMBA 2F8SA 4FJLA 4KHWA 2Z1GA 3KLEA 5J2NA 3LWMA 3HJFA 1HMVA 3NCIA 4L8RB 4M3WA 4DTUA 1L3UA 5HBMA 4DLGA 2HHWA 1VSFA 1S6QA 1VSIA 3T1AA 1NJZA 1EXQA 3AVKA 4FM1A 2FBXA 1U4BA 2XRIA 4YNQA 3OYDA 1YTAA 2E4LA 3HM9A 3L3UA 2OYQA 1TKTA 1BQMA 3ZT3A 3K5LA 3DLGA 3G0ZA 4IKFA 5CYQA 3VQ6A 3AV9A 2HNYA 3P5JA 3ZSXA 4CJUA 3NBPA 1NK5A 1QSYA 3VQDA 3L2UA 4FLUA 2HNZA 1LW2A 2ZE2A 3F73A 1GOCA 3AO4A 1WSJA 4AHRA 4DFPA 4AHSA 5KGWA 1ASVA 1T7PA 4B8AB 3K57A 1ZYQA 3DLKA 4H4OA 2DFEA 4KHYA 1Q9YA 1U04A 4NCBA 3ZSOA 3QINA 4CJ4A 4HHTA 4RG8A 4FLTA 3QERA 1HQEA 3RMDA 4ICLA 4ELVA 3AA5X 3PUFA 4CEAA 1L5UA 3ASMA 4JRPA 2YNFA 1TK0A 4KI4A 4FZZA 4F3TA 3V4IA 1C6VA 4OLBA 3KD5E 1BCMA 2Z1JA 4DFKA 1JLCA 4CE9A 4F2RA 3CQ8A 4DSJA 3DLBA 3V9WA 3K59A 4FJHA 4DU4A 3AVCA 4CGDA 5FRNA 1EP4A 4ID1A 3NE6A 1JLFA 1U47A 1S1TA 1T8EA 4OPJA 1N5YA 3T3FA 4E7JA 3HL8A 4FLZA 3SQ2A 4AH9A 4CJQA 1BHLA 4Y1CA 1VSKA 1C0TA 3V9ZA 4F2SA 3HK2A 3HVTA 1TKDA 5HRNA 3HP9A 4DTJA 1XHZA 2KW4A 3DLEA 2FBTA 4RW4A 1BL3A 3OY9A 4FJ8A 4DG1A 3M8PA 3HPHA 2ZQBA 3M8QA 1XWLA 4BDZA 1HJRA 1JLGA 4CEZA 4E7IA 3PX6A 4CIFA 3QESA 3THVA 1FKOA 3P83D 2XY7A 4CCHA 1LAWA 3VQBA 1NK8A 3LZIA 1J53A 1CZ9A 2IGIA 4CFBA 4HVJA 1JXBA 4BWMA 3RWUA 4AHTA 3NGYA 4FJJA 1WAFA 1D5AA 3CFOA 3OYLA 4CHPA 4KREA 4Z4EA 4W5NA 1B9DA 4H8KA 1TK5A 1BCOA 3VQEA 3M8RA 4LSLA 1TVRA 4FJMA 4DS5A 5HRSA 1RDBA 4K8XA 3QEIA 2XY5A 2GUIA 2P51A 3QO9A 2FBYA 4R5PA 3NHGA 4DFJA 1NKCA 3LP3A 3MAQA 1I3AA 3S3MA 3BDPA 3CM6A 1DLOA 2G8IA 5J1EA 5KI6A 1RBRA 1Y97A 5CZ1A 3O3FA 1HYSA 4E1NA 4DSIA 2G8WA 3TARA 4CEBA 1TL3A 3OJUA 1BI4B 3TAQA 4RW6A 1X9WA 4LY7A 5HRRA 2G8FA 4B8CA 3D0PA 2OZMA 3V9UA 1TK8A 3V81A 4DFMA 5C25A 4G1QA 3SQ4A 2XO7A 3MXJA 1X9MA 4Z0UA 1VSLA 3L8BA 2G8KA 4ELTA 1WSEA 4CFCA 1N6QA 4DSLA 4KHQA 4QCLA 2KFZA 2YHBA 4FW2A 1ASWA 4DQQA 1VSEA 4F3OA 1RBVA 1RTIA 4DSFA 3DYAA 2WOMA 2IS3A 1VRTA 3K5NA 3PX0A 1JXEA 4C8OA 4E1MA 3VQ4A 4DTOA 4PUOA 4DQIA 1LW0A 2HB5A 2RPIA 4XIUA 4QOZB 4JS5A 3V1RA 3MECA 2G8HA 2IDOA 2YV0X 3L3VA 4GW6A 3VA3A 3U3YA 1J9AA 3SZ2A 3G10A 3AA3A 4FJ5A 3ZSYA 3V6DA 4M3TA 1WAJA 4KHNA 3ULDA 4DMNA 4LH4A 4FK0A 4C8KA 3V9XA 1VSDA 1TL1A 3CFRA 2PYLA 2YNIA 1TKXA 4M3RA 3CFPA 4FW1A 3KTQA 4FJXA 4E19A 4CEQA 4OLAA 4E89A 3OYCA 3I0RA
chains in the Genus database with same CATH superfamily
5KGXA 3T69A 2P9PA 1C1BA 4IG3A 2ASPA 4B3SK 3S3NA 1SAZA 3VQPA 4U67L 3EE8A 5H1SQ 1A5WA 2YHXA 4KH5A 1IKVA 3UE5A 3HRGA 3WEEA 3DLLL 4F4KA 2DTUA 3C7NB 4GVMA 5C42A 3QB0A 4IFYA 3UB5A 5M1FA 4CJTA 4CHNA 4B1XB 3EKSA 4FJGA 4CF8A 4RWTA 2BGGA 1JL2A 1SV5A 2YCHA 3I8DA 3AY9A 3G71N 4FJNA 1RT3A 4FLXA 1RDDA 3E01A 3Q7CA 3GE1A 1G15A 3THWA 5AFUA 4BE2A 1KAYA 2Y1JA 1QQMA 4JHDB 2IC3A 4JI7K 2X6NA 4DSEA 4B9TA 2XHBA 1KRPA 4FWMA 3SNNA 2QKKA 5SZTA 3ZSVA 3O9SA 3KLIA 3EO3A 2KKZA 4JEPA 5KQDA 3RSEA 3LAKA 4RW8A 1WBDA 4A2BA 2NRVA 1NOYA 4EIAA 2QWPA 4DR6K 3RRHA 3L6QA 2I5JA 4OVLA 4IBNA 1YT3A 3RMCA 3C95A 4FCYA 4B3TK 1MWMA 3KHYA 3AVJA 3M8SA 3SYZA 4CZEA 3CCMN 4DB3A 3M3ZA 1NU0A 4AHVA 3R9PA 1UOCA 4DF8A 3K58A 1IV0A 1A5XA 4JI4K 1FW6A 1HUXA 3FR0A 2PBDA 3OYJA 3I0SA 3PLAA 3OS1A 1UAXA 5JS1A 3EZWA 5C2FA 3WXLA 3VQ7A 4PKGA 1SL1A 3H3OB 1QTMA 3K9KA 3LDOA 3OYBA 1E4FT 2A41A 2QTDA 4RW9A 4JKBA 4HUGA 4CESA 3VN5A 1YTUA 2ETJA 4BG8A 4KFBA 3PO5A 1MU2A 4BRQA 2WONA 3CF5L 3DM2A 2F8TA 1ITGA 4NYFA 4JKGB 2Z1IA 1HR0K 3SPYA 4BG9A 4K8ZA 5GAGP 1J5EK 4CJEA 1LWCA 2BDPA 4M3XA 3VERA 3D7EO 3J81O 2P5GA 1BO5O 1IKWA 2QW9A 4CK1A 1KLMA 1KFDA 3HPOA 1NLVA 4AHCA 5AQLA 3DAWA 3V1OA 3H1QA 3A5OC 2P1JA 3OYEA 5DMRA 1JJ2M 4L3QA 1EKEA 1XNRK 4CF1A 4QS8A 4Q5VA 3P38A 2AP1A 1HJOA 4OGCA 4GMJB 4Z4GA 1C1AA 4KHSA 2W40A 2LSNA 3LANA 4C8MA 1OKJA 4M41A 1BOTO 1WLJA 1YHQN 4ID5A 2E6MA 3CXCM 2YHAA 4JKAA 4CHOA 4CJPA 3OYFA 1K6YA 1SL2A 1LCUA 3TAEA 3EKUA 1R59O 4JI6K 4NCAA 5C10A 3ITHA 1B92A 4CZGA 2GBZA 4BACA 3SUOA 3VQCA 1K73O 2HBLA 5HRPA 1FK9A 4KAZA 3PV8A 2DFHA 2O8CB 5KPRA 2IAJA 1X1PA 3TAMA 4BY9C 3V1QA 5AQUA 1VQON 5I3UA 4CBUA 1LWEA 4Z4CA 1ZBIA 3VF4A 3CPWM 3AA4A 1L3TA 1RDCA 4W5TA 2QEXN 5K14A 4DR4K 1X9JA 2QXFA 1YF5L 4KPYA 4JYAK 2B5JA 4WQ4A 1ATRA 3BEXA 4OJRA 2H3GX 1Q9XA 3SQ0A 4GKKK 3ENOA 5FPMA 3KK3A 1HLUA 4IG0A 1NJYA 1UA1A 3SQ1A 2A1SA 4H0PA 4LC9B 3K5OA 2G8UA 4EZ6A 4GV6A 4FXDA 3DXMB 4KTWA 1EETA 2BTFA 3IMXA 1VAZA 4FJKA 3ZX0A 2KZMA 4O8KA 4KB0A 2YJEA 1RT1A 4B1WB 1YJNN 3CCRN 3O5BA 3UKUA 1ZBFA 4I2QA 4FVUA 3W3DA 4JK8A 4GY2B 4A61A 1MWKA 1R0AA 1GLLO 2CGLA 1NM1A 3KD1E 5BN9A 1FXXA 4CJWA 3ZCMA 2VQEK 4MLEA 3OBYA 4FJ7A 3OHRA 1ZBUA 5AQXA 1GLCG 4ISGA 3SAHA 1KTQA 1TYQB 2P9KA 1C0MA 3TWHA 2GWKA 4JRQA 4BGAA 1X9SA 5AQJA 4MLHA 3HO1A 2A42A 1N8RO 5FPDA 3E9OA 3SV3A 4DQSA 1C1CA 3VA0A 4CK3A 1RDUA 3KKSA 4N5SA 1VQNN 1TV6A 3MX2A 1HKGA 3RRGA 2YKNA 3D2EA 2PY5A 4LFCK 4DR1K 4EFHA 4YOTA 4LF8K 4CF2A 1OH8A 4DHYA 5HBMA 4DLGA 1VSFA 3T1AA 4FM1A 4O8UA 1U4BA 3OYDA 3DXKB 3SK3A 1VQMN 2E4LA 2OYQA 5KPTA 3AV9A 3ZSXA 2ZJRL 3VTHA 1GOCA 4AHSA 3QFPA 4YOVA 1EWQA 3J7ZO 3QERA 1HQEA 3PIOL 4MO4A 4BRLA 3AA5X 3PUFA 4BREA 3CJAA 2YNFA 5M1KA 4FZZA 2EWSA 4OLBA 2Z1JA 4JAXA 4CE9A 3KWIA 4F2RA 3TTDA 3VENA 4DSJA 2VGNA 2P9LB 4ID1A 3T1HK 3CQXA 4A59A 5F2RA 4FLZA 1EQYA 3HK2A 3TTFA 1TKDA 4JD2B 4AM6A 1Q86O 4B9QA 4DTJA 4RW4A 2GTDA 4DG1A 3M8PA 2ZQBA 2KHOA 5JLHA 4E7IA 4CIFA 4CVNE 3THVA 1FKOA 4CZFA 4CCHA 5I9EB 1J53A 2IGIA 3RWUA 1KAXA 3NGYA 4FOEA 3OYLA 3HM8A 4DV2K 1EWRA 3W0LA 4CHPA 4Z4EA 1BCOA 1VHXA 1T6CA 3I56N 3M8RA 1TVRA 1YITN 1RDBA 4WQ5C 1HNZK 2GUIA 4DFJA 3NHGA 1NKCA 3MAQA 3H45C 2G8IA 1DLOA 3SBGA 5J1EA 1NG9A 1RBRA 4BRCA 3WT0A 1TL3A 1X9WA 4LF5K 5HRRA 2G8FA 3D0PA 3V81A 4G1QA 2V7ZA 2XO7A 3SQ4A 2BUPA 1K9MO 3I55N 2WBNA 1N36K 4DQQA 1K8KA 1NGJA 1RBVA 1VRTA 3K5NA 1JXEA 4E1MA 2RPIA 4BC2A 4YY3K 5HL7L 4GVEA 2IDOA 2YV0X 3L3VA 4I6MB 1J9AA 4BRMA 4DR2K 4KHNA 3ULDA 1C0FA 2O8FB 4C8KA 1YI2N 3O8MA 3CFRA 2YI1A 4FJXA 1M1KO 2VYPA 1JCGA 4CEQA 4EAHD 4OLAA 4E89A 4JN4A 3H46O 4BRHA 2E1YA 2CGJA 4JLHA 3SUQA 3QETA 2NRHA 5HLFA 1T03A 2O8BB 4FJ9A 2RN2A 4DV7K 1NWKA 5E84A 4WF9L 5J2QA 2D0PA 5EX5A 1OH5A 3THXB 3KWGA 5HROA 4FWRA 1G99A 2UXCK 4CERA 2XY8A 3ZT2A 3SMSA 5AZJA 1TKZA 4FPAA 1YXQA 1QSLA 1QQCA 1BI4A 3O1BA 1ILYA 4ISEA 1S3XA 4DV1K 1SS6A 1HRHA 1KAZA 2D5RA 4GNIA 1O13A 3EZ5A 3LDSA 4JI5K 4BRFA 3ISNC 1JKHA 2WFBA 3CJBA 4MO5A 2HMIA 4LD0A 1D4XA 1JCEA 1RT5A 3QEXA 3CM5A 2DY4A 3O3HA 3AVFA 2IVPA 3MEGA 5JICA 4OPKA 4B9VA 5KRTA 2CGKA 4QAGA 4H03B 4DTPA 4OKJA 1KVAA 5KTQA 2IVOA 3CERA 4DKWA 2QWQA 3MEEA 1RBTA 4ZTFA 4H0YB 5J2PA 1NMDA 3NF6A 2ASOA 4K25A 3OYAA 3QNOA 3CMEN 3ENHA 4E7HA 3OS0A 2NRWA 1JLEA 3NMUA 1VSJA 3O1WA 2KZZA 4Z4IA 2W41A 3MDQA 3MN7A 5HOOA 3LP0A 4DV5K 3QFUA 1ATNA 1WSFA 4HCCA 4KHPK 3LP1A 3HSTB 3C7NA 3JXUA 3TSQA 1HKBA 3WXIA 4H5VA 3LWLA 1S1UA 1RNHA 3LALA 4B9SA 4CI6A 2HHXA 2IIRA 5CZ2A 3WNHA 3QEVA 3CETA 3AGKA 1FKPA 4CGIA 1NGCA 3FGUA 3SI6A 3FFIA 3AA2A 3MEDA 5LJWA 4MDAA 1P90A 4KTQA 2F9TA 2WUSA 1VQ8N 3QEPA 4EZ9A 1ZBLA 1UA0A 1D9FA 1SKRA 2YJFA 5BN8A 1W7AA 3CJCA 3AGRA 4O5BA 4JHDA 3VEOA 4PL8A 3TAPA 4K41A 4CBXA 4H5WA 3MWPA 3C94A 3FZLA 4WFAL 3LPTA 2ZF5O 4CGFA 3O4NA 4J2BA 1U6ZA 3ZT1A 3T7ZA 5AQZA 4EP5A 3LL3A 3PSIA 5AQGA 5AQHA 5EOYA 4NYNA 1NGIA 2RKIA 4E3SA 2HHQA 2HHSA 2O4GA 2E6LA 3KK2A 1IKXA 3TI0A 3PSFA 3I8BA 2Q0UA 1JLQA 4OKKA 3LDLA 2BANA 4BDYA 3MCPA 4DV0K 4B9MA 4MFBA 4EHTA 1VQKN 3O9TA 5HP1A 2KFNA 3QIPA 4WFBL 4WFNL 4YOYA 3TAGA 4KH4A 1KVCA 4DQPA 3AO3A 4BE1A 2HHTA 3SBTA 1VQ4N 4BQLA 3LM9A 3P39A 2Q1NA 3A0IX 3DRRA 1FJGK 4KBOA 1WSGA 1J54A 3O6WA 1RGIA 3QEWA 3SUNA 1HNXK 2HHUA 3CJ9A 5T7BA 2A6AA 3AO2A 1BDGA 4CF0A 3LM2A 3C6TA 1LWFA 2E5LK 4DTRA 3WXMB 4CJFA 4JI2K 4O55A 4JKGA 4I7FA 5AQTA 3O9QA 4JK7A 4AQYK 2P9PB 2D4WA 3O9RA 2GWJA 4W5RA 4AM7A 3THYB 2CH6A 5AQQA 3B6PA 3VGMA 5JVHL 4YFUA 2FF3B 2PFUA 5C12A 2PYJA 1RBSA 2VGMA 1BQNA 4TSXA 1Z26A 4CGHA 3NAEA 1OVYA 3F9KA 4DLEA 4LF7K 1NGAA 3AVIA 4V19S 3OYIA 3LP2A 1D8YA 4CD1A 4LF4K 3SUPA 4J8FA 5F0XA 1Z25A 3CCEN 2UXDK 5FROA 4I9LA 3SAFA 5LMUK 2VG5A 5EXWA 2O8CA 1M90O 3U3GA 4CIGA 4CEOA 4OKEA 4F8RA 3ZETA 2P9UB 4JS4A 1RT6A 3OW2M 1V4SA 3BZCA 3NFAA 4U7BA 1QHAA 2FLOA 2OPQA 2HF4A 3L2RA 4E0DA 3AVGA 4BRPA 3O3GA 2IOCA 2P9SB 3VQ5A 1C0GA 1RTDA 3LPUA 4BRNA 4E7LA 4BR9A 3C0BA 4BGBA 2W42A 3LDPA 2WC9A 1Y64A 2Z1GA 3KLEA 3LWMA 1HMVA 1QQNA 3NCIA 4L8RB 1S6QA 3SLCA 3AVKA 2FBXA 2P9NB 2XRIA 3R3LA 1YTAA 3L3UA 1BWFO 1BQMA 3ZT3A 3O9UA 3G0ZA 2HBMA 4H0OA 4IKFA 3DXMA 3VQ6A 2HNYA 4CJUA 3CMAN 4FL9A 1NK5A 3L2UA 1LW2A 1QVGM 5BREA 3AO4A 1WSJA 3FZHA 5A2QO 4HTLA 1ASVA 1XC3A 2HMPA 3KZBA 4B8AB 1WB9A 1ZYQA 2DFEA 4JI0K 3H3NO 3ZSOA 4CJ4A 4HHTA 4RG8A 1ZXOA 1GLAG 1L5UA 3ASMA 4DV3K 5AR0A 4F3TA 3V4IA 3WXJA 3KD5E 4DFKA 3AARA 3IFRA 4G9ZA 1Z6RA 3F9MA 3MN9A 3V9WA 3K59A 3DLBA 4FJHA 4CGDA 4BR5A 1GLEG 1EP4A 3NE6A 1JLFA 1T8EA 2NNWA 3HOSA 4OPJA 1N5YA 3IDHA 3HL8A 3EN9A 4F2SA 1C0TA 3V9ZA 1TYQA 3HVTA 4B3MK 2ZGYA 5FPNA 4FJ8A 3HPHA 4UY8O 5BPMA 1XWLA 4BDZA 1RDWX 4ILJA 4PHTX 3QESA 4QS9A 4C1NK 1DGKN 1HX1A 1JXBA 5AZIB 4BWMA 4PKHA 4BR0A 4YDUA 4JKDA 3CHWA 4LSLA 1BA1A 1KXPA 4BRKA 4K8XA 2P51A 2V7YA 4R5PA 3LP3A 3DXKA 5KI6A 2UUAK 5CZ1A 2JWKA 3O3FA 4K42A 5JVGL 2E88A 4IO8A 4DSIA 1Q81O 2GUPA 1BG3A 4Y0WA 4LY7A 4IOCL 2ZWHA 1SZ2A 4IEEA 5C25A 3D2FB 3MMVA 1ZBSA 5CE3A 1X9MA 1WSEA 4CFCA 2NRRA 3O80A 4FW2A 1ASWA 1Z05A 4F3OA 3ATVA 1RTIA 3UKRB 2IS3A 4C8OA 3PX0A 3VQ4A 4PUOA 2VCPA 3E9LA 2NRXA 2HB5A 2JWLA 3M5RA 1LOTB 4QOZB 3V1RA 2GEMA 3ZYYX 2G8HA 1HNWK 4OO1J 1NGEA 4IXCA 3FZKA 3G10A 4M3TA 2P9LA 4DMNA 4LH4A 2O8EB 1VSDA 1TL1A 2PYLA 3CFPA 3VOVA 4FW1A 2ZJPL 3OYCA 5D3GA 3CG7A 3ULEB 4DF4A 1KCFA 1EO1A 4KV8A 3FLCO 1F21A 3AVLA 3CD6N 4CEDA 5BRHA 1QS4A 4LFBK 3KIOA 5ADXH 2DFFA 3OYNA 2NRTA 4CJ5A 3OYGA 4LF6K 3H6EA 4FZYA 2E1ZA 1GLJO 3P1GA 2Q2RA 4M45A 2VQFK 1BA0A 2RHKA 3HPGA 2UUBK 4B1ZA 1NKEA 2W6LA 1HYZA 3OYKA 1NGBA 3CCQN 1C0UA 2CH5A 4A62A 1BIUA 4NXNK 4CK2A 4DTXA 2YX6A 4HTUA 4CEEA 2QKBA 3OJSA 1OH7A 4X66K 4Z4HA 5CR4A 5AQMA 4EHUA 4CGGA 2HOEA 2ATQA 1BIZA 4NXMK 4NB4A 1WUAA 1VQLN 3OYHA 3U6FA 5FPEA 1J5OA 2QK9A 5AQVA 1U45A 3BY5A 1DT9A 3VTIA 3VQAA 4FM0A 1A5VA 5LL6Z 4KI6A 1Q8IA 5BRFA 2Z1HA 5CYMA 2ZGZA 1RT2A 3SJJA 1GOBA 1KC8O 3FZFA 5GAEP 1KLNA 2KTQA 3PY8A 1VQ7N 2HVHA 4O44A 5M1QA 4I6MA 3L2QA 3VF6A 1HNVA 1T3VA 2DPNA 2GX9A 4LH5A 3VQ9A 4E1JA 2RF2A 4X65K 3NH0A 2P5OA 2O8FA 3WQTA 4CW7B 4PY5A 4B9NA 1WSIA 1GOAA 1REVA 3AAQA 4ZTJA 3A8YA 4W5OA 5E26A 2VG7A 3QBWA 1N33K 2FSKA 3ZT0A 5SWMA 4DU3A 4FO0A 1NJWA 3WUHA 1ATSA 3WNFA 1HYVA 4JK9A 3J7AP 4LSNA 4B1UB 4MQ3A 4Z4FA 3L2VA 1CXUA 2E2PA 5CY4A 1NK9A 4RTFD 1E3MA 3Q7BA 2HVIA 1DKGD 3DMJA 2ZM6K 4NO7A 1RDAA 1ASUA 2W6KA 4BR4A 3ENBA 4DUYK 3SAGA 1XMOK 2OTLN 3QLHA 1S5JA 3C65A 1ZC6A 1K8AO 4JI1K 1QQOA 4CJRA 2BE2A 1SKSA 4WQ4C 3MWTA 3L0QA 2PZSA 2I7NA 3RMAA 3RR7A 5E41A 1S9EA 3G4SN 2OPRA 3LAMA 2FSJA 3VEYA 4NLBA 1W2BM 3JAMO 3VQ8A 4YDUC 4QS7A 4CD3A 4O0JA 4DR5K 1NMNA 1RCHA 3SCXA 1IG9A 2GELA 4KH6A 2QM1A 1KVBA 4FLWA 1WSHA 5M1PA 3KLGA 4JI8K 2D0BA 1H1VA 3CQYA 1S1XA 3B6OA 1JLAA 4CJLA 1GLDG 1MA9B 3AO1A 1VSMA 3AVMA 2ITMA 3PO4A 3NH2A 1U48A 4CF9A 3QNNA 3I33A 4FWSA 3HXMA 4FJIA 2Q36A 3WNEA 2G8VA 1YVNA 3ZX3A 3KKRA 3CCUN 4ELUA 4A2AA 3JS6A 4CFAA 3R1XA 5I42A 1YJWN 2QWRA 1DTQA 4DS4A 1NJZA 3KLHA 4DTMA 2ZD1A 3VGKA 4BVOA 3VPZA 3NGIA 1IO2A 1NGFA 4IJNA 1NK4A 1T44A 1S22A 4H5NA 1NK0A 1XNQK 4CECA 1GLBG 4C8NA 2E2QA 3NF8A 3PX4A 3HTVA 2NZTA 3NF7A 2YNHA 4JKFA 1KQSM 2X78A 4JV5K 4KO0A 4CJVA 4J2AA 2X74A 4FYDA 3P4IA 3O08A 1IG8A 3ZLJA 1L3VA 4PWDA 3DOKA 4M3UA 4DSKA 1VRUA 4DTSA 1NOZA 3RVCA 1VSHA 4KB1A 3MN5A 2OA8A 4YOXA 3PIPL 3H08A 2QWLA 4FK2A 1SUQA 1RBUA 2XY6A 4AILC 4M63C 5C24A 4CJ7A 2HHVA 2QXLA 4H4MA 3ATUA 2FBVA 2HBJA 5FLXO 2HNDA 2NUBA 4OGEA 3F2KA 3ZSWA 1NK7A 3BP8A 2B4JA 4KHUA 3C6AA 1D9DA 3DLHA 1L3SA 4CJSA 2V51B 2OTJN 4LFAK 3KK1A 2HW3A 1QZ6A 1HPZA 2KQ2A 4CZMA 2GV9A 3NF9A 1U2VB 4FLVA 3WXKA 4IO9L 1SKWA 4JKHA 3E66A 2HSTA 3CYMA 1W9HA 5AQNA 1TK8A 3LZJA 1YIJN 3K9JA 3EYZA 5MLCQ 2IVNA 1T6DA 5AQRA 4FK4A 4KKOA 3D45A 4W5QA 3DJCA 4B3RK 3DLRA 3F5TA 3HP6A 1BGXT 5BPLA 3G25A 2QWNA 5DK5A 3RTVA 1DTTA 2V52B 4CHQA 4CHYA 4C8LA 3MX5A 3SMPA 4DWIA 3C6UA 2O8DB 4BR7A 4FJLA 3HJFA 2P9IB 4IEIA 4DTUA 2UYTA 1VSIA 3GL1A 2UUCK 1J6ZA 4FWQA 3VEVA 3WQUA 3VGLA 4BC3A 4PKIA 1TKTA 3K5LA 1VQPN 3DWLA 3THYA 3DLGA 5CYQA 3P5JA 1XMQK 4FLUA 2YHWA 2HNZA 2ZE2A 3F73A 4CZLA 1T7PA 3FZMA 3K57A 4H4OA 1Q9YA 1U04A 4NCBA 3ZEUB 1SQKA 4FLTA 4ELVA 4CEAA 5C2DA 4H0XB 4JRPA 1TK0A 4KI4A 1VQ5N 1BCMA 1JLCA 4DUZK 4DU4A 5FRNA 2E2NA 1IJJA 1U47A 2OCEA 4E7JA 3P31A 1BHLA 4Y1CA 1VSKA 3HOTA 5HRNA 3HP9A 1XHZA 2P9UA 1TUYA 3DLEA 2FBTA 1BL3A 2Q31A 4JKEA 4DR3K 4ILGB 1HJRA 4CEZA 3J7YP 3TSUA 2P9SA 4A5BA 1WBBA 1NK8A 1NGHA 4CFBA 4AHTA 3WEEB 1D5AA 3CFOA 2UU9K 4KREA 3GG4A 3VQEA 3A5NC 4FJMA 2PAVA 1RFQA 4DS5A 5HRSA 3R6MA 3QEIA 1HKCA 3D6RA 3QO9A 2FBYA 5TKYA 2P9NA 1I3AA 3BDPA 5M1NA 1Y97A 1NGDA 1HYSA 3TARA 4CEBA 3OJUA 1Q82O 3TAQA 3J8AA 4GKJK 2QWMA 1XUPO 3A5LC 3MXJA 4Z0UA 1VSLA 3THWB 4BRAA 4DSLA 4KHQA 4QCLA 2KFZA 2YHBA 4IZ9A 5AQKA 2I7PA 4FWNA 1V4TA 4OPHA 4X64K 3VETA 4DQIA 1BUPA 3CCSN 1QVFM 4XIUA 3KK7A 4JS5A 3MECA 4IDHA 3RSEB 2ZJQL 3U3YA 3SZ2A 3OTOK 5AQWA 2HBKA 4LF9K 3ZSYA 3V6DA 3CI5A 1IBMK 3OBWA 3V9XA 2E8AA 4M3RA 3KTQA 2FXUA 3LZIA 5LY3A 3I0RA 2Q3SA 1I39A 3FFKB 2FF6A 3L4QA 5J2MA 2J4RA 2OZSA 3KLFA 4M42A 2FC0A 4Q0BA 3L2WA 3QICA 3AVAA 1RT4A 3B8AX 5LMNK 5AZIA 3TU5A 4FSVA 1KSPA 3IAYA 5BRDA 3TSPA 3BF3A 1XQSC 3T19A 4HCBA 4DV4K 4X62K 1NJIO 1Q18A 1GLFO 3MXIA 3NVKA 1NJXA 4DCHA 5LJVA 3IG1A 2JGUA 3NDKA 1IH7A 3AO5A 4O5FA 5F1XA 4WYBA 3QBXA 3VESA 4WQ5A 5FDLA 3AVHA 4OX9K 3OYMA 3IRXA 1SL0A 1HNIA 2YHYA 2X6SA 3HBTA 4JNEA 3SV4A 1O1WA 1S1VA 2A5XA 4BWJA 3DRSA 4ZHRA 1I94K 4H5RA 3GDQA 3VEZA 4N41A 3DI6A 1X3NA 4H0VB 2ASMA 3VEWA 4CZHA 5DM7L 5C0YA 3D2FA 4A5AA 4DQ8A 1W97L 3GBTA 1KD1O 4YOUA 4CEFA 4B3OA 5GADP 3ZETB 3U9ZA 3A2FA 3UKRA 1T05A 4CGJA 2AJQA 3QMLA 4XH4A 4PQUA 5EU7A 1XI1A 1B9FA 3HVRA 3IS9A 4MDBA 1EX4A 3TANA 3DOLA 4JKCA 3V9SA 4OPAA 2VWJA 4C1NI 2OPSA 2A1RA 1S6PA 4O0IA 2O8EA 3OS2A 1IKYA 2F9WA 4PA1A 3UIQA 3ZSQA 1S1WA 1U49A 3ZT4A 4CZIA 4BRGA 3ULEA 1RILA 3VEXA 2OPPA 5AJ3K 4FM2A 1ESVA 2EX3A 4I2PA 1LAVA 4FWOA 4FPBA 1YUWA 4CZJA 3AVNA 2QWOA 2O4IA 4IWVA 5AQPA 3LDNA 4B9UA 1IBKK 3CIPA 3TAFA 4IFEA 1UWBA 3NGZA 3QDKA 1RTHA 3EL2A 2YNGA 2F96A 4M7XA 1TGOA 5EY4A 1E4GT 4DV6K 4RW7A 3QIOA 2EHGA 3OVNA 3E9PA 4J2EA 4ISFA 1N34K 3T1YK 4N56A 2E2OA 2NRZA 2AA4A 3OA9A 2VG6A 3AVBA 1XC9A 3AAPA 4B08A 2R7YA 1IBLK 4BE0A 1NKBA 4WCEL 4C23A 4JD2A 2D1KA 1QHTA 1XHXA 3RR8A 4KTZA 2Q0RA 4CBWA 4CFDA 4DR7K 5DM6L 4FWPA 4F9OA 2VWBA 4DU1A 4AHUA 1YVUA 4XH1A 3EY1A 4M3YA 3SPZA 4I9QA 3J80O 3ALYA 3M1FA 3O4QA 3UKUB 5KQ8A 1X3MA 3BUZB 5KPZA 4KRFA 1LV5A 1RTJA 2Y1IA 3ZSZA 1P8ZA 5JMVA 1JL1A 2FSNA 4FVMA 3ID8A 3IUCA 1CZAN 4WE1A 4IOAL 3BGRA 4NCGA 3TR8A 3CC7N 5TKWA 3JYTA 3CCJN 1WNSA 4E7KA 2P9KB 1YJ9N 3CJ7A 3JSMA 5AQOA 4BDPA 1CZBA 1WN7A 4H0TB 5B8HA 4NLCA 4DTNA 4EP4A 3K5MA 3KJVA 3C6HA 5JS2A 3HT3A 2BH1A 3VQQA 5IT9O 3TABA 3EE9A 4M3ZA 4GV9A 3D2EB 3MCAB 3CCVN 4B9LA 2D0AA 4J2DA 4FLYA 2E20A 3HYFA 4YORA 1QSSA 4FZXC 1MDUB 3DRPA 4R79A 1QE1A 4CHZA 5JLFA 2OANA 4PL7A 3BF1A 3CC2N 2O8BA 5ADXA 3G6EN 3MXMA 1S72N 1ZBHA 4CIEA 3HI0A 4UQGA 1NK6A 4CJKA 1KFSA 4HUFA 3THXA 5AQIA 5GIPA 1CXQA 2RE2A 1S9GA 3S9HA 1TAUA 3TPQA 4BR2A 4O4GA 4N76A 4IDKA 4Y1DA 2D0CA 4CJ3A 3NH1A 5FRMA 5AQSA 3HSCA 2YKMA 4DQRA 1W0HA 2HHHK 4YHHK 5AQYA 1JLBA 2VWKA 1VK0A 1RT7A 1TAQA 2JLEA 4FWKA 4H5TA 4BRDA 4M7YA 3K2PA 3S3OA 1QZ5A 3MK6A 3S41A 3GOIA 2ITGA 1TUUA 3WNGA 4IFVA 3KVGA 3N4QA 4HUEA 1HQUA 1CLQA 1NBWA 3ZX2A 3VF2A 3ZSRA 5KRSA 1NGGA 3CCLN 3NVMA 4HWIA 1VQ6N 1BISA 4N47A 3MN6A 2B6AA 3IKMA 3RMBA 2F8SA 4KHWA 5J2NA 1DEJA 4M3WA 4XEIA 1L3UA 2HHWA 1NNEA 1EXQA 4YNQA 5CHIA 3HM9A 3TTCA 1BU6O 4FWLA 5EVZA 3U4LA 4BQZA 3NBPA 3R8EA 1QSYA 3VQDA 4ILHA 4AHRA 4DFPA 2QI2A 5GAHP 5KGWA 4CZKA 1N32K 3H1VX 3A5MC 3DLKA 3E1YA 4KHYA 1K8KB 3QINA 4Z94A 3CC4N 3RMDA 4ICLA 5GINA 3LDQA 4B1YB 2KLAA 4BC4A 1C6VA 2QA4N 3U8XA 3VMFB 3SJHA 2WTUA 3CQ8A 5BR8K 1U2VA 2F4VK 3AVCA 4K43A 4YOWA 4AF1A 4K0KK 5AQFA 1S1TA 3T3FA 1HPMA 3SQ2A 3HZ6A 2A40A 3L4IA 4AH9A 4CJQA 1VQ9N 5GIOA 3CJ1A 1OVQA 2KW4A 4GV3A 3K0SA 2UXBK 3OY9A 5BPNA 3M8QA 3N4PA 1JLGA 3PX6A 3P83D 2XY7A 1LAWA 3VQBA 1CZ9A 4HVJA 5C15A 4FJJA 3M6GA 1WAFA 4W5NA 1B9DA 4H8KA 1TK5A 2O8DA 2HF3A 2P9IA 4FOIA 2XY5A 3O4WA 5M1OA 3S3MA 4IJAA 3CM6A 3BZKA 5ELZA 5AZJB 4E1NA 3ID6A 2G8WA 1WOQA 1BI4B 4RW6A 4BROA 3U9DA 2F7TA 2NLXA 4B8CA 2OZMA 2D0OA 3V9UA 1Q7YO 4DFMA 3L8BA 2G8KA 5AFUH 4ELTA 1OH6A 1N6QA 2A3ZA 1YAGA 1JCFA 1VSEA 4BC5A 3CPEA 3ZEUA 4DSFA 4A57A 3DYAA 2WOMA 4BVPA 5IWAK 4DTOA 3EEQA 1LW0A 4RCHA 5BR9A 4GW6A 3VA3A 3AA3A 4FJ5A 1WAJA 2Q97A 4FK0A 4JI3K 4BRIA 4IOXA 4B1VA 2YNIA 1TKXA 3FE1A 4XH5A 4E19A
chains in the Genus database with same CATH topology
5KGXA 5D3GA 2Q3SA 3CG7A 4DF4A 1I39A 1KCFA 1C1BA 4IG3A 4JLHA 4KV8A 1F21A 3AVLA 3VQPA 3SUQA 5J2MA 3QETA 4CEDA 3S3NA 2OZSA 3KLFA 4M42A 2FC0A 4Q0BA 3L2WA 1QS4A 1A5WA 3AVAA 3KIOA 1RT4A 1IKVA 3IAYA 5HLFA 1T03A 1KSPA 2DFFA 4FJ9A 3OYNA 2RN2A 3T19A 4HCBA 4CJ5A 4F4KA 3OYGA 5J2QA 3MXIA 2DTUA 4FZYA 4GVMA 5C42A 1NJXA 3P1GA 4IFYA 4M45A 5HROA 3IG1A 2JGUA 3NDKA 4CJTA 1IH7A 3AO5A 3HPGA 4CHNA 4CERA 5FDLA 1NKEA 4FJGA 1HYZA 3OYKA 4CF8A 3AVHA 1C0UA 2XY8A 3ZT2A 2BGGA 1JL2A 1BIUA 3IRXA 1TKZA 3OYMA 1SL0A 1HNIA 4CK2A 2X6SA 1QSLA 4DTXA 3SV4A 1SV5A 1QQCA 1BI4A 1O1WA 4HTUA 3I8DA 4CEEA 2QKBA 1S1VA 1HRHA 4FJNA 3OJSA 4BWJA 2D5RA 3DRSA 4ZHRA 3EZ5A 4N41A 4Z4HA 3LDSA 3DI6A 1RT3A 1JKHA 3ISNC 4FLXA 2HMIA 1RDDA 4CGGA 3E01A 4LD0A 2ATQA 1BIZA 1RT5A 3QEXA 1G15A 3CM5A 3O3HA 3OYHA 4CEFA 4B3OA 3AVFA 4BE2A 3U6FA 3MEGA 2Y1JA 4OPKA 1J5OA 2QK9A 1U45A 3A2FA 3VQAA 2IC3A 4FM0A 4B9VA 1A5VA 5KRTA 1Q8IA 2X6NA 4QAGA 4DSEA 2Z1HA 5CYMA 4B9TA 4KI6A 3SJJA 1RT2A 1GOBA 2XHBA 4DTPA 4OKJA 1T05A 4CGJA 1KVAA 3SNNA 1KRPA 5SZTA 2QKKA 3ZSVA 4PQUA 5EU7A 1KLNA 2AJQA 3KLIA 1XI1A 1B9FA 3HVRA 5KTQA 3PY8A 2KTQA 3IS9A 2HVHA 3LAKA 4RW8A 1EX4A 4O44A 3TANA 3DOLA 3MEEA 3L2QA 3VQ9A 1HNVA 3V9SA 4LH5A 1NOYA 2RF2A 1RBTA 3NH0A 4ZTFA 2P5OA 2VWJA 3RRHA 2OPSA 2I5JA 4OVLA 4IBNA 1S6PA 4O0IA 5J2PA 2A1RA 1YT3A 3OS2A 4PY5A 1IKYA 3NF6A 4PA1A 3UIQA 3RMCA 3C95A 3ZSQA 4FCYA 4B9NA 1S1WA 1WSIA 3ZT4A 1U49A 1GOAA 3OYAA 3QNOA 1REVA 4E7HA 4ZTJA 4W5OA 3AVJA 3M8SA 1RILA 3SYZA 3OS0A 2VG7A 1JLEA 3ZT0A 1VSJA 2OPPA 5SWMA 4DU3A 4FM2A 1NJWA 2KZZA 4Z4IA 3WNFA 2EX3A 1HYVA 4I2PA 4AHVA 1LAVA 3LP0A 1UOCA 4LSNA 4DF8A 3K58A 1WSFA 1A5XA 4MQ3A 4HCCA 4Z4FA 3L2VA 3LP1A 3HSTB 3AVNA 1CXUA 5CY4A 1NK9A 2O4IA 3OYJA 3I0SA 4B9UA 3LWLA 1S1UA 3DMJA 3OS1A 2HVIA 1UAXA 3TAFA 1RNHA 3LALA 1UWBA 3NGZA 4B9SA 5JS1A 2HHXA 1RTHA 1RDAA 1ASUA 5CZ2A 3VQ7A 3WNHA 3QEVA 1SL1A 1QTMA 2YNGA 2F96A 1FKPA 3QLHA 4CGIA 3OYBA 1S5JA 1TGOA 3SI6A 3FFIA 3AA2A 4RW9A 4RW7A 4HUGA 3QIOA 3MEDA 2EHGA 4CESA 3OVNA 3VN5A 1YTUA 2ETJA 4J2EA 4CJRA 2BE2A 4N56A 1SKSA 2PZSA 4KTQA 2VG6A 3AVBA 1XC9A 4KFBA 3QEPA 3PO5A 4B08A 2R7YA 3RMAA 1ZBLA 1UA0A 3RR7A 4EZ9A 4BE0A 1NKBA 1MU2A 5E41A 2WONA 1S9EA 1SKRA 1D9FA 3DM2A 2F8TA 1ITGA 4NYFA 2OPRA 2Z1IA 4O5BA 3SPYA 4K8ZA 1QHTA 4CJEA 3TAPA 1XHXA 3RR8A 1LWCA 4KTZA 2BDPA 4M3XA 3LAMA 4CFDA 2P5GA 3C94A 3VQ8A 3LPTA 1IKWA 4CGFA 3O4NA 4DU1A 4J2BA 4O0JA 4CK1A 4AHUA 3ZT1A 1KLMA 1RCHA 1YVUA 4EP5A 3EY1A 3SCXA 1KFDA 1IG9A 3HPOA 4M3YA 4AHCA 3V1OA 3SPZA 1KVBA 4I9QA 4NYNA 4FLWA 2P1JA 2RKIA 1WSHA 5DMRA 3OYEA 4E3SA 1EKEA 3ALYA 4CF1A 2HHQA 3KLGA 4Q5VA 2HHSA 2D0BA 2O4GA 2E6LA 4OGCA 4GMJB 3KK2A 4Z4GA 1IKXA 1C1AA 3O4QA 4KHSA 1S1XA 2LSNA 3B6OA 3LANA 4C8MA 1JLAA 4CJLA 3TI0A 4KRFA 1JLQA 3AO1A 4OKKA 1VSMA 3AVMA 4M41A 1LV5A 3PO4A 1WLJA 2BANA 1RTJA 2E6MA 4ID5A 3ZSZA 3NH2A 2YHAA 4CHOA 1JL1A 4CJPA 3OYFA 1K6YA 4FVMA 1SL2A 4BDYA 4CF9A 3TAEA 3QNNA 4B9MA 4NCAA 3HXMA 4FJIA 4MFBA 3ITHA 3WNEA 2G8VA 4DQPA 4WE1A 1B92A 3KKRA 5HP1A 2KFNA 2GBZA 3BGRA 3QIPA 4NCGA 3TR8A 4BACA 3SUOA 4ELUA 3VQCA 3JYTA 4CFAA 3TAGA 5I42A 1WNSA 1DTQA 4DS4A 1KVCA 1FK9A 3AO3A 5HRPA 3KLHA 4E7KA 2ZD1A 4DTMA 4BE1A 2DFHA 3PV8A 4KAZA 2HHTA 3NGIA 1IO2A 2IAJA 1NK4A 1X1PA 3TAMA 3JSMA 4BDPA 3DRRA 3V1QA 1CZBA 1NK0A 1WSGA 1J54A 4CECA 5I3UA 4C8NA 1WN7A 3NF8A 3PX4A 4DTNA 1LWEA 3QEWA 3SUNA 2HHUA 4Z4CA 5T7BA 4EP4A 1ZBIA 3K5MA 3AO2A 3NF7A 3KJVA 2YNHA 3AA4A 5JS2A 2X78A 4CF0A 1U48A 1L3TA 1RDCA 3HT3A 4KO0A 4W5TA 4CJVA 3TWHA 3VQQA 4J2AA 3TABA 2X74A 5K14A 4M3ZA 3C6TA 1LWFA 4FYDA 2QXFA 1L3VA 4KPYA 4PWDA 3DOKA 2B5JA 4DTRA 4M3UA 4B9LA 2D0AA 4OJRA 4CJFA 1Q9XA 4O55A 4FLYA 4DSKA 4J2DA 2Y1IA 3SQ0A 1VRUA 3HYFA 4I7FA 1NOZA 4DTSA 1VSHA 4KB1A 2OA8A 3KK3A 1QSSA 4FZXC 4IG0A 1NJYA 3DRPA 1UA1A 3SQ1A 4W5RA 2A1SA 3H08A 3K5OA 1QE1A 4CHZA 2G8UA 4EZ6A 4FK2A 1SUQA 4FXDA 4KTWA 1RBUA 1EETA 2XY6A 3B6PA 4AILC 4FJKA 5C24A 4YFUA 3MXMA 1ZBHA 2KZMA 4KB0A 2HHVA 4CIEA 2PYJA 4UQGA 1RBSA 1RT1A 1NK6A 1BQNA 4H4MA 4CJKA 1KFSA 2FBVA 2HNDA 4TSXA 4HUFA 2NUBA 1CXQA 1S9GA 1ZBFA 1Z26A 4I2QA 4OGEA 3ZSWA 4CGHA 3S9HA 1NK7A 3NAEA 1TAUA 2B4JA 3F9KA 4DLEA 4KHUA 4O4GA 4N76A 4IDKA 1D9DA 3DLHA 1L3SA 4CJSA 4Y1DA 3AVIA 2D0CA 1R0AA 4CJ3A 3OYIA 3LP2A 3KK1A 1D8YA 3KD1E 3NH1A 2DY4A 5FRMA 3SUPA 2HW3A 1FXXA 4CJWA 1HPZA 2YKMA 1Z25A 2KQ2A 3ZCMA 4DQRA 2GV9A 1W0HA 3NF9A 4FLVA 1JLBA 2VWKA 5FROA 4I9LA 1VK0A 4FJ7A 1RT7A 1SKWA 1ZBUA 2VG5A 1TAQA 2JLEA 1KTQA 3CYMA 1C0MA 1W9HA 3U3GA 4OKEA 4CEOA 4CIGA 3LZJA 3K2PA 4JRQA 1X9SA 4F8RA 4JS4A 3S3OA 1RT6A 3HO1A 3EYZA 3SV3A 3NFAA 3L2RA 4DQSA 2OPQA 4KKOA 4FK4A 3D45A 4W5QA 1C1CA 4E0DA 3VA0A 4CK3A 2ITGA 3KKSA 3WNGA 4N5SA 3DLRA 4IFVA 3AVGA 3O3GA 1BGXT 2IOCA 3VQ5A 3HP6A 1TV6A 4HUEA 1HQUA 3LPUA 1RTDA 5DK5A 3RTVA 1CLQA 1DTTA 3ZSRA 4CHQA 5KRSA 4E7LA 4CHYA 3RRGA 4C8LA 4DWIA 2YKNA 3C6UA 2PY5A 2W42A 1BISA 4N47A 4CF2A 2B6AA 3RMBA 2F8SA 4FJLA 4KHWA 2Z1GA 3KLEA 5J2NA 3LWMA 3HJFA 1HMVA 3NCIA 4L8RB 4M3WA 4DTUA 1L3UA 5HBMA 4DLGA 2HHWA 1VSFA 1S6QA 1VSIA 3T1AA 1NJZA 1EXQA 3AVKA 4FM1A 2FBXA 1U4BA 2XRIA 4YNQA 3OYDA 1YTAA 2E4LA 3HM9A 3L3UA 2OYQA 1TKTA 1BQMA 3ZT3A 3K5LA 3DLGA 3G0ZA 4IKFA 5CYQA 3VQ6A 3AV9A 2HNYA 3P5JA 3ZSXA 4CJUA 3NBPA 1NK5A 1QSYA 3VQDA 3L2UA 4FLUA 2HNZA 1LW2A 2ZE2A 3F73A 1GOCA 3AO4A 1WSJA 4AHRA 4DFPA 4AHSA 5KGWA 1ASVA 1T7PA 4B8AB 3K57A 1ZYQA 3DLKA 4H4OA 2DFEA 4KHYA 1Q9YA 1U04A 4NCBA 3ZSOA 3QINA 4CJ4A 4HHTA 4RG8A 4FLTA 3QERA 1HQEA 3RMDA 4ICLA 4ELVA 3AA5X 3PUFA 4CEAA 1L5UA 3ASMA 4JRPA 2YNFA 1TK0A 4KI4A 4FZZA 4F3TA 3V4IA 1C6VA 4OLBA 3KD5E 1BCMA 2Z1JA 4DFKA 1JLCA 4CE9A 4F2RA 3CQ8A 4DSJA 3DLBA 3V9WA 3K59A 4FJHA 4DU4A 3AVCA 4CGDA 5FRNA 1EP4A 4ID1A 3NE6A 1JLFA 1U47A 1S1TA 1T8EA 4OPJA 1N5YA 3T3FA 4E7JA 3HL8A 4FLZA 3SQ2A 4AH9A 4CJQA 1BHLA 4Y1CA 1VSKA 1C0TA 3V9ZA 4F2SA 3HK2A 3HVTA 1TKDA 5HRNA 3HP9A 4DTJA 1XHZA 2KW4A 3DLEA 2FBTA 4RW4A 1BL3A 3OY9A 4FJ8A 4DG1A 3M8PA 3HPHA 2ZQBA 3M8QA 1XWLA 4BDZA 1HJRA 1JLGA 4CEZA 4E7IA 3PX6A 4CIFA 3QESA 3THVA 1FKOA 3P83D 2XY7A 4CCHA 1LAWA 3VQBA 1NK8A 3LZIA 1J53A 1CZ9A 2IGIA 4CFBA 4HVJA 1JXBA 4BWMA 3RWUA 4AHTA 3NGYA 4FJJA 1WAFA 1D5AA 3CFOA 3OYLA 4CHPA 4KREA 4Z4EA 4W5NA 1B9DA 4H8KA 1TK5A 1BCOA 3VQEA 3M8RA 4LSLA 1TVRA 4FJMA 4DS5A 5HRSA 1RDBA 4K8XA 3QEIA 2XY5A 2GUIA 2P51A 3QO9A 2FBYA 4R5PA 3NHGA 4DFJA 1NKCA 3LP3A 3MAQA 1I3AA 3S3MA 3BDPA 3CM6A 1DLOA 2G8IA 5J1EA 5KI6A 1RBRA 1Y97A 5CZ1A 3O3FA 1HYSA 4E1NA 4DSIA 2G8WA 3TARA 4CEBA 1TL3A 3OJUA 1BI4B 3TAQA 4RW6A 1X9WA 4LY7A 5HRRA 2G8FA 4B8CA 3D0PA 2OZMA 3V9UA 1TK8A 3V81A 4DFMA 5C25A 4G1QA 3SQ4A 2XO7A 3MXJA 1X9MA 4Z0UA 1VSLA 3L8BA 2G8KA 4ELTA 1WSEA 4CFCA 1N6QA 4DSLA 4KHQA 4QCLA 2KFZA 2YHBA 4FW2A 1ASWA 4DQQA 1VSEA 4F3OA 1RBVA 1RTIA 4DSFA 3DYAA 2WOMA 2IS3A 1VRTA 3K5NA 3PX0A 1JXEA 4C8OA 4E1MA 3VQ4A 4DTOA 4PUOA 4DQIA 1LW0A 2HB5A 2RPIA 4XIUA 4QOZB 4JS5A 3V1RA 3MECA 2G8HA 2IDOA 2YV0X 3L3VA 4GW6A 3VA3A 3U3YA 1J9AA 3SZ2A 3G10A 3AA3A 4FJ5A 3ZSYA 3V6DA 4M3TA 1WAJA 4KHNA 3ULDA 4DMNA 4LH4A 4FK0A 4C8KA 3V9XA 1VSDA 1TL1A 3CFRA 2PYLA 2YNIA 1TKXA 4M3RA 3CFPA 4FW1A 3KTQA 4FJXA 4E19A 4CEQA 4OLAA 4E89A 3OYCA 3I0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KGX A;  5D3G A;  2Q3S A;  3CG7 A;  4DF4 A;  1I39 A;  1KCF A;  1C1B A;  4IG3 A;  4JLH A;  4KV8 A;  1F21 A;  3AVL A;  3VQP A;  3SUQ A;  5J2M A;  3QET A;  4CED A;  3S3N A;  2OZS A;  3KLF A;  4M42 A;  2FC0 A;  4Q0B A;  3L2W A;  1QS4 A;  1A5W A;  3AVA A;  3KIO A;  1RT4 A;  1IKV A;  3IAY A;  5HLF A;  1T03 A;  1KSP A;  2DFF A;  4FJ9 A;  3OYN A;  2RN2 A;  3T19 A;  4HCB A;  4CJ5 A;  4F4K A;  3OYG A;  5J2Q A;  3MXI A;  2DTU A;  4FZY A;  4GVM A;  5C42 A;  1NJX A;  3P1G A;  4IFY A;  4M45 A;  5HRO A;  3IG1 A;  2JGU A;  3NDK A;  4CJT A;  1IH7 A;  3AO5 A;  3HPG A;  4CHN A;  4CER A;  5FDL A;  1NKE A;  4FJG A;  1HYZ A;  3OYK A;  4CF8 A;  3AVH A;  1C0U A;  2XY8 A;  3ZT2 A;  2BGG A;  1JL2 A;  1BIU A;  3IRX A;  1TKZ A;  3OYM A;  1SL0 A;  1HNI A;  4CK2 A;  2X6S A;  1QSL A;  4DTX A;  3SV4 A;  1SV5 A;  1QQC A;  1BI4 A;  1O1W A;  4HTU A;  3I8D A;  4CEE A;  2QKB A;  1S1V A;  1HRH A;  4FJN A;  3OJS A;  4BWJ A;  2D5R A;  3DRS A;  4ZHR A;  3EZ5 A;  4N41 A;  4Z4H A;  3LDS A;  3DI6 A;  1RT3 A;  1JKH A;  3ISN C;  4FLX A;  2HMI A;  1RDD A;  4CGG A;  3E01 A;  4LD0 A;  2ATQ A;  1BIZ A;  1RT5 A;  3QEX A;  1G15 A;  3CM5 A;  3O3H A;  3OYH A;  4CEF A;  4B3O A;  3AVF A;  4BE2 A;  3U6F A;  3MEG A;  2Y1J A;  4OPK A;  1J5O A;  2QK9 A;  1U45 A;  3A2F A;  3VQA A;  2IC3 A;  4FM0 A;  4B9V A;  1A5V A;  5KRT A;  1Q8I A;  2X6N A;  4QAG A;  4DSE A;  2Z1H A;  5CYM A;  4B9T A;  4KI6 A;  3SJJ A;  1RT2 A;  1GOB A;  2XHB A;  4DTP A;  4OKJ A;  1T05 A;  4CGJ A;  1KVA A;  3SNN A;  1KRP A;  5SZT A;  2QKK A;  3ZSV A;  4PQU A;  5EU7 A;  1KLN A;  2AJQ A;  3KLI A;  1XI1 A;  1B9F A;  3HVR A;  5KTQ A;  3PY8 A;  2KTQ A;  3IS9 A;  2HVH A;  3LAK A;  4RW8 A;  1EX4 A;  4O44 A;  3TAN A;  3DOL A;  3MEE A;  3L2Q A;  3VQ9 A;  1HNV A;  3V9S A;  4LH5 A;  1NOY A;  2RF2 A;  1RBT A;  3NH0 A;  4ZTF A;  2P5O A;  2VWJ A;  3RRH A;  2OPS A;  2I5J A;  4OVL A;  4IBN A;  1S6P A;  4O0I A;  5J2P A;  2A1R A;  1YT3 A;  3OS2 A;  4PY5 A;  1IKY A;  3NF6 A;  4PA1 A;  3UIQ A;  3RMC A;  3C95 A;  3ZSQ A;  4FCY A;  4B9N A;  1S1W A;  1WSI A;  3ZT4 A;  1U49 A;  1GOA A;  3OYA A;  3QNO A;  1REV A;  4E7H A;  4ZTJ A;  4W5O A;  3AVJ A;  3M8S A;  1RIL A;  3SYZ A;  3OS0 A;  2VG7 A;  1JLE A;  3ZT0 A;  1VSJ A;  2OPP A;  5SWM A;  4DU3 A;  4FM2 A;  1NJW A;  2KZZ A;  4Z4I A;  3WNF A;  2EX3 A;  1HYV A;  4I2P A;  4AHV A;  1LAV A;  3LP0 A;  1UOC A;  4LSN A;  4DF8 A;  3K58 A;  1WSF A;  1A5X A;  4MQ3 A;  4HCC A;  4Z4F A;  3L2V A;  3LP1 A;  3HST B;  3AVN A;  1CXU A;  5CY4 A;  1NK9 A;  2O4I A;  3OYJ A;  3I0S A;  4B9U A;  3LWL A;  1S1U A;  3DMJ A;  3OS1 A;  2HVI A;  1UAX A;  3TAF A;  1RNH A;  3LAL A;  1UWB A;  3NGZ A;  4B9S A;  5JS1 A;  2HHX A;  1RTH A;  1RDA A;  1ASU A;  5CZ2 A;  3VQ7 A;  3WNH A;  3QEV A;  1SL1 A;  1QTM A;  2YNG A;  2F96 A;  1FKP A;  3QLH A;  4CGI A;  3OYB A;  1S5J A;  1TGO A;  3SI6 A;  3FFI A;  3AA2 A;  4RW9 A;  4RW7 A;  4HUG A;  3QIO A;  3MED A;  2EHG A;  4CES A;  3OVN A;  3VN5 A;  1YTU A;  2ETJ A;  4J2E A;  4CJR A;  2BE2 A;  4N56 A;  1SKS A;  2PZS A;  4KTQ A;  2VG6 A;  3AVB A;  1XC9 A;  4KFB A;  3QEP A;  3PO5 A;  4B08 A;  2R7Y A;  3RMA A;  1ZBL A;  1UA0 A;  3RR7 A;  4EZ9 A;  4BE0 A;  1NKB A;  1MU2 A;  5E41 A;  2WON A;  1S9E A;  1SKR A;  1D9F A;  3DM2 A;  2F8T A;  1ITG A;  4NYF A;  2OPR A;  2Z1I A;  4O5B A;  3SPY A;  4K8Z A;  1QHT A;  4CJE A;  3TAP A;  1XHX A;  3RR8 A;  1LWC A;  4KTZ A;  2BDP A;  4M3X A;  3LAM A;  4CFD A;  2P5G A;  3C94 A;  3VQ8 A;  3LPT A;  1IKW A;  4CGF A;  3O4N A;  4DU1 A;  4J2B A;  4O0J A;  4CK1 A;  4AHU A;  3ZT1 A;  1KLM A;  1RCH A;  1YVU A;  4EP5 A;  3EY1 A;  3SCX A;  1KFD A;  1IG9 A;  3HPO A;  4M3Y A;  4AHC A;  3V1O A;  3SPZ A;  1KVB A;  4I9Q A;  4NYN A;  4FLW A;  2P1J A;  2RKI A;  1WSH A;  5DMR A;  3OYE A;  4E3S A;  1EKE A;  3ALY A;  4CF1 A;  2HHQ A;  3KLG A;  4Q5V A;  2HHS A;  2D0B A;  2O4G A;  2E6L A;  4OGC A;  4GMJ B;  3KK2 A;  4Z4G A;  1IKX A;  1C1A A;  3O4Q A;  4KHS A;  1S1X A;  2LSN A;  3B6O A;  3LAN A;  4C8M A;  1JLA A;  4CJL A;  3TI0 A;  4KRF A;  1JLQ A;  3AO1 A;  4OKK A;  1VSM A;  3AVM A;  4M41 A;  1LV5 A;  3PO4 A;  1WLJ A;  2BAN A;  1RTJ A;  2E6M A;  4ID5 A;  3ZSZ A;  3NH2 A;  2YHA A;  4CHO A;  1JL1 A;  4CJP A;  3OYF A;  1K6Y A;  4FVM A;  1SL2 A;  4BDY A;  4CF9 A;  3TAE A;  3QNN A;  4B9M A;  4NCA A;  3HXM A;  4FJI A;  4MFB A;  3ITH A;  3WNE A;  2G8V A;  4DQP A;  4WE1 A;  1B92 A;  3KKR A;  5HP1 A;  2KFN A;  2GBZ A;  3BGR A;  3QIP A;  4NCG A;  3TR8 A;  4BAC A;  3SUO A;  4ELU A;  3VQC A;  3JYT A;  4CFA A;  3TAG A;  5I42 A;  1WNS A;  1DTQ A;  4DS4 A;  1KVC A;  1FK9 A;  3AO3 A;  5HRP A;  3KLH A;  4E7K A;  2ZD1 A;  4DTM A;  4BE1 A;  2DFH A;  3PV8 A;  4KAZ A;  2HHT A;  3NGI A;  1IO2 A;  2IAJ A;  1NK4 A;  1X1P A;  3TAM A;  3JSM A;  4BDP A;  3DRR A;  3V1Q A;  1CZB A;  1NK0 A;  1WSG A;  1J54 A;  4CEC A;  5I3U A;  4C8N A;  1WN7 A;  3NF8 A;  3PX4 A;  4DTN A;  1LWE A;  3QEW A;  3SUN A;  2HHU A;  4Z4C A;  5T7B A;  4EP4 A;  1ZBI A;  3K5M A;  3AO2 A;  3NF7 A;  3KJV A;  2YNH A;  3AA4 A;  5JS2 A;  2X78 A;  4CF0 A;  1U48 A;  1L3T A;  1RDC A;  3HT3 A;  4KO0 A;  4W5T A;  4CJV A;  3TWH A;  3VQQ A;  4J2A A;  3TAB A;  2X74 A;  5K14 A;  4M3Z A;  3C6T A;  1LWF A;  4FYD A;  2QXF A;  1L3V A;  4KPY A;  4PWD A;  3DOK A;  2B5J A;  4DTR A;  4M3U A;  4B9L A;  2D0A A;  4OJR A;  4CJF A;  1Q9X A;  4O55 A;  4FLY A;  4DSK A;  4J2D A;  2Y1I A;  3SQ0 A;  1VRU A;  3HYF A;  4I7F A;  1NOZ A;  4DTS A;  1VSH A;  4KB1 A;  2OA8 A;  3KK3 A;  1QSS A;  4FZX C;  4IG0 A;  1NJY A;  3DRP A;  1UA1 A;  3SQ1 A;  4W5R A;  2A1S A;  3H08 A;  3K5O A;  1QE1 A;  4CHZ A;  2G8U A;  4EZ6 A;  4FK2 A;  1SUQ A;  4FXD A;  4KTW A;  1RBU A;  1EET A;  2XY6 A;  3B6P A;  4AIL C;  4FJK A;  5C24 A;  4YFU A;  3MXM A;  1ZBH A;  2KZM A;  4KB0 A;  2HHV A;  4CIE A;  2PYJ A;  4UQG A;  1RBS A;  1RT1 A;  1NK6 A;  1BQN A;  4H4M A;  4CJK A;  1KFS A;  2FBV A;  2HND A;  4TSX A;  4HUF A;  2NUB A;  1CXQ A;  1S9G A;  1ZBF A;  1Z26 A;  4I2Q A;  4OGE A;  3ZSW A;  4CGH A;  3S9H A;  1NK7 A;  3NAE A;  1TAU A;  2B4J A;  3F9K A;  4DLE A;  4KHU A;  4O4G A;  4N76 A;  4IDK A;  1D9D A;  3DLH A;  1L3S A;  4CJS A;  4Y1D A;  3AVI A;  2D0C A;  1R0A A;  4CJ3 A;  3OYI A;  3LP2 A;  3KK1 A;  1D8Y A;  3KD1 E;  3NH1 A;  2DY4 A;  5FRM A;  3SUP A;  2HW3 A;  1FXX A;  4CJW A;  1HPZ A;  2YKM A;  1Z25 A;  2KQ2 A;  3ZCM A;  4DQR A;  2GV9 A;  1W0H A;  3NF9 A;  4FLV A;  1JLB A;  2VWK A;  5FRO A;  4I9L A;  1VK0 A;  4FJ7 A;  1RT7 A;  1SKW A;  1ZBU A;  2VG5 A;  1TAQ A;  2JLE A;  1KTQ A;  3CYM A;  1C0M A;  1W9H A;  3U3G A;  4OKE A;  4CEO A;  4CIG A;  3LZJ A;  3K2P A;  4JRQ A;  1X9S A;  4F8R A;  4JS4 A;  3S3O A;  1RT6 A;  3HO1 A;  3EYZ A;  3SV3 A;  3NFA A;  3L2R A;  4DQS A;  2OPQ A;  4KKO A;  4FK4 A;  3D45 A;  4W5Q A;  1C1C A;  4E0D A;  3VA0 A;  4CK3 A;  2ITG A;  3KKS A;  3WNG A;  4N5S A;  3DLR A;  4IFV A;  3AVG A;  3O3G A;  1BGX T;  2IOC A;  3VQ5 A;  3HP6 A;  1TV6 A;  4HUE A;  1HQU A;  3LPU A;  1RTD A;  5DK5 A;  3RTV A;  1CLQ A;  1DTT A;  3ZSR A;  4CHQ A;  5KRS A;  4E7L A;  4CHY A;  3RRG A;  4C8L A;  4DWI A;  2YKN A;  3C6U A;  2PY5 A;  2W42 A;  1BIS A;  4N47 A;  4CF2 A;  2B6A A;  3RMB A;  2F8S A;  4FJL A;  4KHW A;  2Z1G A;  3KLE A;  5J2N A;  3LWM A;  3HJF A;  1HMV A;  3NCI A;  4L8R B;  4M3W A;  4DTU A;  1L3U A;  5HBM A;  4DLG A;  2HHW A;  1VSF A;  1S6Q A;  1VSI A;  3T1A A;  1NJZ A;  1EXQ A;  3AVK A;  4FM1 A;  2FBX A;  1U4B A;  2XRI A;  4YNQ A;  3OYD A;  1YTA A;  2E4L A;  3HM9 A;  3L3U A;  2OYQ A;  1TKT A;  1BQM A;  3ZT3 A;  3K5L A;  3DLG A;  3G0Z A;  4IKF A;  5CYQ A;  3VQ6 A;  3AV9 A;  2HNY A;  3P5J A;  3ZSX A;  4CJU A;  3NBP A;  1NK5 A;  1QSY A;  3VQD A;  3L2U A;  4FLU A;  2HNZ A;  1LW2 A;  2ZE2 A;  3F73 A;  1GOC A;  3AO4 A;  1WSJ A;  4AHR A;  4DFP A;  4AHS A;  5KGW A;  1ASV A;  1T7P A;  4B8A B;  3K57 A;  1ZYQ A;  3DLK A;  4H4O A;  2DFE A;  4KHY A;  1Q9Y A;  1U04 A;  4NCB A;  3ZSO A;  3QIN A;  4CJ4 A;  4HHT A;  4RG8 A;  4FLT A;  3QER A;  1HQE A;  3RMD A;  4ICL A;  4ELV A;  3AA5 X;  3PUF A;  4CEA A;  1L5U A;  3ASM A;  4JRP A;  2YNF A;  1TK0 A;  4KI4 A;  4FZZ A;  4F3T A;  3V4I A;  1C6V A;  4OLB A;  3KD5 E;  1BCM A;  2Z1J A;  4DFK A;  1JLC A;  4CE9 A;  4F2R A;  3CQ8 A;  4DSJ A;  3DLB A;  3V9W A;  3K59 A;  4FJH A;  4DU4 A;  3AVC A;  4CGD A;  5FRN A;  1EP4 A;  4ID1 A;  3NE6 A;  1JLF A;  1U47 A;  1S1T A;  1T8E A;  4OPJ A;  1N5Y A;  3T3F A;  4E7J A;  3HL8 A;  4FLZ A;  3SQ2 A;  4AH9 A;  4CJQ A;  1BHL A;  4Y1C A;  1VSK A;  1C0T A;  3V9Z A;  4F2S A;  3HK2 A;  3HVT A;  1TKD A;  5HRN A;  3HP9 A;  4DTJ A;  1XHZ A;  2KW4 A;  3DLE A;  2FBT A;  4RW4 A;  1BL3 A;  3OY9 A;  4FJ8 A;  4DG1 A;  3M8P A;  3HPH A;  2ZQB A;  3M8Q A;  1XWL A;  4BDZ A;  1HJR A;  1JLG A;  4CEZ A;  4E7I A;  3PX6 A;  4CIF A;  3QES A;  3THV A;  1FKO A;  3P83 D;  2XY7 A;  4CCH A;  1LAW A;  3VQB A;  1NK8 A;  3LZI A;  1J53 A;  1CZ9 A;  2IGI A;  4CFB A;  4HVJ A;  1JXB A;  4BWM A;  3RWU A;  4AHT A;  3NGY A;  4FJJ A;  1WAF A;  1D5A A;  3CFO A;  3OYL A;  4CHP A;  4KRE A;  4Z4E A;  4W5N A;  1B9D A;  4H8K A;  1TK5 A;  1BCO A;  3VQE A;  3M8R A;  4LSL A;  1TVR A;  4FJM A;  4DS5 A;  5HRS A;  1RDB A;  4K8X A;  3QEI A;  2XY5 A;  2GUI A;  2P51 A;  3QO9 A;  2FBY A;  4R5P A;  3NHG A;  4DFJ A;  1NKC A;  3LP3 A;  3MAQ A;  1I3A A;  3S3M A;  3BDP A;  3CM6 A;  1DLO A;  2G8I A;  5J1E A;  5KI6 A;  1RBR A;  1Y97 A;  5CZ1 A;  3O3F A;  1HYS A;  4E1N A;  4DSI A;  2G8W A;  3TAR A;  4CEB A;  1TL3 A;  3OJU A;  1BI4 B;  3TAQ A;  4RW6 A;  1X9W A;  4LY7 A;  5HRR A;  2G8F A;  4B8C A;  3D0P A;  2OZM A;  3V9U A;  1TK8 A;  3V81 A;  4DFM A;  5C25 A;  4G1Q A;  3SQ4 A;  2XO7 A;  3MXJ A;  1X9M A;  4Z0U A;  1VSL A;  3L8B A;  2G8K A;  4ELT A;  1WSE A;  4CFC A;  1N6Q A;  4DSL A;  4KHQ A;  4QCL A;  2KFZ A;  2YHB A;  4FW2 A;  1ASW A;  4DQQ A;  1VSE A;  4F3O A;  1RBV A;  1RTI A;  4DSF A;  3DYA A;  2WOM A;  2IS3 A;  1VRT A;  3K5N A;  3PX0 A;  1JXE A;  4C8O A;  4E1M A;  3VQ4 A;  4DTO A;  4PUO A;  4DQI A;  1LW0 A;  2HB5 A;  2RPI A;  4XIU A;  4QOZ B;  4JS5 A;  3V1R A;  3MEC A;  2G8H A;  2IDO A;  2YV0 X;  3L3V A;  4GW6 A;  3VA3 A;  3U3Y A;  1J9A A;  3SZ2 A;  3G10 A;  3AA3 A;  4FJ5 A;  3ZSY A;  3V6D A;  4M3T A;  1WAJ A;  4KHN A;  3ULD A;  4DMN A;  4LH4 A;  4FK0 A;  4C8K A;  3V9X A;  1VSD A;  1TL1 A;  3CFR A;  2PYL A;  2YNI A;  1TKX A;  4M3R A;  3CFP A;  4FW1 A;  3KTQ A;  4FJX A;  4E19 A;  4CEQ A;  4OLA A;  4E89 A;  3OYC A;  3I0R A; 
#chains in the Genus database with same CATH topology
 5KGX A;  3T69 A;  2P9P A;  1C1B A;  4IG3 A;  2ASP A;  4B3S K;  3S3N A;  1SAZ A;  3VQP A;  4U67 L;  3EE8 A;  5H1S Q;  1A5W A;  2YHX A;  4KH5 A;  1IKV A;  3UE5 A;  3HRG A;  3WEE A;  3DLL L;  4F4K A;  2DTU A;  3C7N B;  4GVM A;  5C42 A;  3QB0 A;  4IFY A;  3UB5 A;  5M1F A;  4CJT A;  4CHN A;  4B1X B;  3EKS A;  4FJG A;  4CF8 A;  4RWT A;  2BGG A;  1JL2 A;  1SV5 A;  2YCH A;  3I8D A;  3AY9 A;  3G71 N;  4FJN A;  1RT3 A;  4FLX A;  1RDD A;  3E01 A;  3Q7C A;  3GE1 A;  1G15 A;  3THW A;  5AFU A;  4BE2 A;  1KAY A;  2Y1J A;  1QQM A;  4JHD B;  2IC3 A;  4JI7 K;  2X6N A;  4DSE A;  4B9T A;  2XHB A;  1KRP A;  4FWM A;  3SNN A;  2QKK A;  5SZT A;  3ZSV A;  3O9S A;  3KLI A;  3EO3 A;  2KKZ A;  4JEP A;  5KQD A;  3RSE A;  3LAK A;  4RW8 A;  1WBD A;  4A2B A;  2NRV A;  1NOY A;  4EIA A;  2QWP A;  4DR6 K;  3RRH A;  3L6Q A;  2I5J A;  4OVL A;  4IBN A;  1YT3 A;  3RMC A;  3C95 A;  4FCY A;  4B3T K;  1MWM A;  3KHY A;  3AVJ A;  3M8S A;  3SYZ A;  4CZE A;  3CCM N;  4DB3 A;  3M3Z A;  1NU0 A;  4AHV A;  3R9P A;  1UOC A;  4DF8 A;  3K58 A;  1IV0 A;  1A5X A;  4JI4 K;  1FW6 A;  1HUX A;  3FR0 A;  2PBD A;  3OYJ A;  3I0S A;  3PLA A;  3OS1 A;  1UAX A;  5JS1 A;  3EZW A;  5C2F A;  3WXL A;  3VQ7 A;  4PKG A;  1SL1 A;  3H3O B;  1QTM A;  3K9K A;  3LDO A;  3OYB A;  1E4F T;  2A41 A;  2QTD A;  4RW9 A;  4JKB A;  4HUG A;  4CES A;  3VN5 A;  1YTU A;  2ETJ A;  4BG8 A;  4KFB A;  3PO5 A;  1MU2 A;  4BRQ A;  2WON A;  3CF5 L;  3DM2 A;  2F8T A;  1ITG A;  4NYF A;  4JKG B;  2Z1I A;  1HR0 K;  3SPY A;  4BG9 A;  4K8Z A;  5GAG P;  1J5E K;  4CJE A;  1LWC A;  2BDP A;  4M3X A;  3VER A;  3D7E O;  3J81 O;  2P5G A;  1BO5 O;  1IKW A;  2QW9 A;  4CK1 A;  1KLM A;  1KFD A;  3HPO A;  1NLV A;  4AHC A;  5AQL A;  3DAW A;  3V1O A;  3H1Q A;  3A5O C;  2P1J A;  3OYE A;  5DMR A;  1JJ2 M;  4L3Q A;  1EKE A;  1XNR K;  4CF1 A;  4QS8 A;  4Q5V A;  3P38 A;  2AP1 A;  1HJO A;  4OGC A;  4GMJ B;  4Z4G A;  1C1A A;  4KHS A;  2W40 A;  2LSN A;  3LAN A;  4C8M A;  1OKJ A;  4M41 A;  1BOT O;  1WLJ A;  1YHQ N;  4ID5 A;  2E6M A;  3CXC M;  2YHA A;  4JKA A;  4CHO A;  4CJP A;  3OYF A;  1K6Y A;  1SL2 A;  1LCU A;  3TAE A;  3EKU A;  1R59 O;  4JI6 K;  4NCA A;  5C10 A;  3ITH A;  1B92 A;  4CZG A;  2GBZ A;  4BAC A;  3SUO A;  3VQC A;  1K73 O;  2HBL A;  5HRP A;  1FK9 A;  4KAZ A;  3PV8 A;  2DFH A;  2O8C B;  5KPR A;  2IAJ A;  1X1P A;  3TAM A;  4BY9 C;  3V1Q A;  5AQU A;  1VQO N;  5I3U A;  4CBU A;  1LWE A;  4Z4C A;  1ZBI A;  3VF4 A;  3CPW M;  3AA4 A;  1L3T A;  1RDC A;  4W5T A;  2QEX N;  5K14 A;  4DR4 K;  1X9J A;  2QXF A;  1YF5 L;  4KPY A;  4JYA K;  2B5J A;  4WQ4 A;  1ATR A;  3BEX A;  4OJR A;  2H3G X;  1Q9X A;  3SQ0 A;  4GKK K;  3ENO A;  5FPM A;  3KK3 A;  1HLU A;  4IG0 A;  1NJY A;  1UA1 A;  3SQ1 A;  2A1S A;  4H0P A;  4LC9 B;  3K5O A;  2G8U A;  4EZ6 A;  4GV6 A;  4FXD A;  3DXM B;  4KTW A;  1EET A;  2BTF A;  3IMX A;  1VAZ A;  4FJK A;  3ZX0 A;  2KZM A;  4O8K A;  4KB0 A;  2YJE A;  1RT1 A;  4B1W B;  1YJN N;  3CCR N;  3O5B A;  3UKU A;  1ZBF A;  4I2Q A;  4FVU A;  3W3D A;  4JK8 A;  4GY2 B;  4A61 A;  1MWK A;  1R0A A;  1GLL O;  2CGL A;  1NM1 A;  3KD1 E;  5BN9 A;  1FXX A;  4CJW A;  3ZCM A;  2VQE K;  4MLE A;  3OBY A;  4FJ7 A;  3OHR A;  1ZBU A;  5AQX A;  1GLC G;  4ISG A;  3SAH A;  1KTQ A;  1TYQ B;  2P9K A;  1C0M A;  3TWH A;  2GWK A;  4JRQ A;  4BGA A;  1X9S A;  5AQJ A;  4MLH A;  3HO1 A;  2A42 A;  1N8R O;  5FPD A;  3E9O A;  3SV3 A;  4DQS A;  1C1C A;  3VA0 A;  4CK3 A;  1RDU A;  3KKS A;  4N5S A;  1VQN N;  1TV6 A;  3MX2 A;  1HKG A;  3RRG A;  2YKN A;  3D2E A;  2PY5 A;  4LFC K;  4DR1 K;  4EFH A;  4YOT A;  4LF8 K;  4CF2 A;  1OH8 A;  4DHY A;  5HBM A;  4DLG A;  1VSF A;  3T1A A;  4FM1 A;  4O8U A;  1U4B A;  3OYD A;  3DXK B;  3SK3 A;  1VQM N;  2E4L A;  2OYQ A;  5KPT A;  3AV9 A;  3ZSX A;  2ZJR L;  3VTH A;  1GOC A;  4AHS A;  3QFP A;  4YOV A;  1EWQ A;  3J7Z O;  3QER A;  1HQE A;  3PIO L;  4MO4 A;  4BRL A;  3AA5 X;  3PUF A;  4BRE A;  3CJA A;  2YNF A;  5M1K A;  4FZZ A;  2EWS A;  4OLB A;  2Z1J A;  4JAX A;  4CE9 A;  3KWI A;  4F2R A;  3TTD A;  3VEN A;  4DSJ A;  2VGN A;  2P9L B;  4ID1 A;  3T1H K;  3CQX A;  4A59 A;  5F2R A;  4FLZ A;  1EQY A;  3HK2 A;  3TTF A;  1TKD A;  4JD2 B;  4AM6 A;  1Q86 O;  4B9Q A;  4DTJ A;  4RW4 A;  2GTD A;  4DG1 A;  3M8P A;  2ZQB A;  2KHO A;  5JLH A;  4E7I A;  4CIF A;  4CVN E;  3THV A;  1FKO A;  4CZF A;  4CCH A;  5I9E B;  1J53 A;  2IGI A;  3RWU A;  1KAX A;  3NGY A;  4FOE A;  3OYL A;  3HM8 A;  4DV2 K;  1EWR A;  3W0L A;  4CHP A;  4Z4E A;  1BCO A;  1VHX A;  1T6C A;  3I56 N;  3M8R A;  1TVR A;  1YIT N;  1RDB A;  4WQ5 C;  1HNZ K;  2GUI A;  4DFJ A;  3NHG A;  1NKC A;  3MAQ A;  3H45 C;  2G8I A;  1DLO A;  3SBG A;  5J1E A;  1NG9 A;  1RBR A;  4BRC A;  3WT0 A;  1TL3 A;  1X9W A;  4LF5 K;  5HRR A;  2G8F A;  3D0P A;  3V81 A;  4G1Q A;  2V7Z A;  2XO7 A;  3SQ4 A;  2BUP A;  1K9M O;  3I55 N;  2WBN A;  1N36 K;  4DQQ A;  1K8K A;  1NGJ A;  1RBV A;  1VRT A;  3K5N A;  1JXE A;  4E1M A;  2RPI A;  4BC2 A;  4YY3 K;  5HL7 L;  4GVE A;  2IDO A;  2YV0 X;  3L3V A;  4I6M B;  1J9A A;  4BRM A;  4DR2 K;  4KHN A;  3ULD A;  1C0F A;  2O8F B;  4C8K A;  1YI2 N;  3O8M A;  3CFR A;  2YI1 A;  4FJX A;  1M1K O;  2VYP A;  1JCG A;  4CEQ A;  4EAH D;  4OLA A;  4E89 A;  4JN4 A;  3H46 O;  4BRH A;  2E1Y A;  2CGJ A;  4JLH A;  3SUQ A;  3QET A;  2NRH A;  5HLF A;  1T03 A;  2O8B B;  4FJ9 A;  2RN2 A;  4DV7 K;  1NWK A;  5E84 A;  4WF9 L;  5J2Q A;  2D0P A;  5EX5 A;  1OH5 A;  3THX B;  3KWG A;  5HRO A;  4FWR A;  1G99 A;  2UXC K;  4CER A;  2XY8 A;  3ZT2 A;  3SMS A;  5AZJ A;  1TKZ A;  4FPA A;  1YXQ A;  1QSL A;  1QQC A;  1BI4 A;  3O1B A;  1ILY A;  4ISE A;  1S3X A;  4DV1 K;  1SS6 A;  1HRH A;  1KAZ A;  2D5R A;  4GNI A;  1O13 A;  3EZ5 A;  3LDS A;  4JI5 K;  4BRF A;  3ISN C;  1JKH A;  2WFB A;  3CJB A;  4MO5 A;  2HMI A;  4LD0 A;  1D4X A;  1JCE A;  1RT5 A;  3QEX A;  3CM5 A;  2DY4 A;  3O3H A;  3AVF A;  2IVP A;  3MEG A;  5JIC A;  4OPK A;  4B9V A;  5KRT A;  2CGK A;  4QAG A;  4H03 B;  4DTP A;  4OKJ A;  1KVA A;  5KTQ A;  2IVO A;  3CER A;  4DKW A;  2QWQ A;  3MEE A;  1RBT A;  4ZTF A;  4H0Y B;  5J2P A;  1NMD A;  3NF6 A;  2ASO A;  4K25 A;  3OYA A;  3QNO A;  3CME N;  3ENH A;  4E7H A;  3OS0 A;  2NRW A;  1JLE A;  3NMU A;  1VSJ A;  3O1W A;  2KZZ A;  4Z4I A;  2W41 A;  3MDQ A;  3MN7 A;  5HOO A;  3LP0 A;  4DV5 K;  3QFU A;  1ATN A;  1WSF A;  4HCC A;  4KHP K;  3LP1 A;  3HST B;  3C7N A;  3JXU A;  3TSQ A;  1HKB A;  3WXI A;  4H5V A;  3LWL A;  1S1U A;  1RNH A;  3LAL A;  4B9S A;  4CI6 A;  2HHX A;  2IIR A;  5CZ2 A;  3WNH A;  3QEV A;  3CET A;  3AGK A;  1FKP A;  4CGI A;  1NGC A;  3FGU A;  3SI6 A;  3FFI A;  3AA2 A;  3MED A;  5LJW A;  4MDA A;  1P90 A;  4KTQ A;  2F9T A;  2WUS A;  1VQ8 N;  3QEP A;  4EZ9 A;  1ZBL A;  1UA0 A;  1D9F A;  1SKR A;  2YJF A;  5BN8 A;  1W7A A;  3CJC A;  3AGR A;  4O5B A;  4JHD A;  3VEO A;  4PL8 A;  3TAP A;  4K41 A;  4CBX A;  4H5W A;  3MWP A;  3C94 A;  3FZL A;  4WFA L;  3LPT A;  2ZF5 O;  4CGF A;  3O4N A;  4J2B A;  1U6Z A;  3ZT1 A;  3T7Z A;  5AQZ A;  4EP5 A;  3LL3 A;  3PSI A;  5AQG A;  5AQH A;  5EOY A;  4NYN A;  1NGI A;  2RKI A;  4E3S A;  2HHQ A;  2HHS A;  2O4G A;  2E6L A;  3KK2 A;  1IKX A;  3TI0 A;  3PSF A;  3I8B A;  2Q0U A;  1JLQ A;  4OKK A;  3LDL A;  2BAN A;  4BDY A;  3MCP A;  4DV0 K;  4B9M A;  4MFB A;  4EHT A;  1VQK N;  3O9T A;  5HP1 A;  2KFN A;  3QIP A;  4WFB L;  4WFN L;  4YOY A;  3TAG A;  4KH4 A;  1KVC A;  4DQP A;  3AO3 A;  4BE1 A;  2HHT A;  3SBT A;  1VQ4 N;  4BQL A;  3LM9 A;  3P39 A;  2Q1N A;  3A0I X;  3DRR A;  1FJG K;  4KBO A;  1WSG A;  1J54 A;  3O6W A;  1RGI A;  3QEW A;  3SUN A;  1HNX K;  2HHU A;  3CJ9 A;  5T7B A;  2A6A A;  3AO2 A;  1BDG A;  4CF0 A;  3LM2 A;  3C6T A;  1LWF A;  2E5L K;  4DTR A;  3WXM B;  4CJF A;  4JI2 K;  4O55 A;  4JKG A;  4I7F A;  5AQT A;  3O9Q A;  4JK7 A;  4AQY K;  2P9P B;  2D4W A;  3O9R A;  2GWJ A;  4W5R A;  4AM7 A;  3THY B;  2CH6 A;  5AQQ A;  3B6P A;  3VGM A;  5JVH L;  4YFU A;  2FF3 B;  2PFU A;  5C12 A;  2PYJ A;  1RBS A;  2VGM A;  1BQN A;  4TSX A;  1Z26 A;  4CGH A;  3NAE A;  1OVY A;  3F9K A;  4DLE A;  4LF7 K;  1NGA A;  3AVI A;  4V19 S;  3OYI A;  3LP2 A;  1D8Y A;  4CD1 A;  4LF4 K;  3SUP A;  4J8F A;  5F0X A;  1Z25 A;  3CCE N;  2UXD K;  5FRO A;  4I9L A;  3SAF A;  5LMU K;  2VG5 A;  5EXW A;  2O8C A;  1M90 O;  3U3G A;  4CIG A;  4CEO A;  4OKE A;  4F8R A;  3ZET A;  2P9U B;  4JS4 A;  1RT6 A;  3OW2 M;  1V4S A;  3BZC A;  3NFA A;  4U7B A;  1QHA A;  2FLO A;  2OPQ A;  2HF4 A;  3L2R A;  4E0D A;  3AVG A;  4BRP A;  3O3G A;  2IOC A;  2P9S B;  3VQ5 A;  1C0G A;  1RTD A;  3LPU A;  4BRN A;  4E7L A;  4BR9 A;  3C0B A;  4BGB A;  2W42 A;  3LDP A;  2WC9 A;  1Y64 A;  2Z1G A;  3KLE A;  3LWM A;  1HMV A;  1QQN A;  3NCI A;  4L8R B;  1S6Q A;  3SLC A;  3AVK A;  2FBX A;  2P9N B;  2XRI A;  3R3L A;  1YTA A;  3L3U A;  1BWF O;  1BQM A;  3ZT3 A;  3O9U A;  3G0Z A;  2HBM A;  4H0O A;  4IKF A;  3DXM A;  3VQ6 A;  2HNY A;  4CJU A;  3CMA N;  4FL9 A;  1NK5 A;  3L2U A;  1LW2 A;  1QVG M;  5BRE A;  3AO4 A;  1WSJ A;  3FZH A;  5A2Q O;  4HTL A;  1ASV A;  1XC3 A;  2HMP A;  3KZB A;  4B8A B;  1WB9 A;  1ZYQ A;  2DFE A;  4JI0 K;  3H3N O;  3ZSO A;  4CJ4 A;  4HHT A;  4RG8 A;  1ZXO A;  1GLA G;  1L5U A;  3ASM A;  4DV3 K;  5AR0 A;  4F3T A;  3V4I A;  3WXJ A;  3KD5 E;  4DFK A;  3AAR A;  3IFR A;  4G9Z A;  1Z6R A;  3F9M A;  3MN9 A;  3V9W A;  3K59 A;  3DLB A;  4FJH A;  4CGD A;  4BR5 A;  1GLE G;  1EP4 A;  3NE6 A;  1JLF A;  1T8E A;  2NNW A;  3HOS A;  4OPJ A;  1N5Y A;  3IDH A;  3HL8 A;  3EN9 A;  4F2S A;  1C0T A;  3V9Z A;  1TYQ A;  3HVT A;  4B3M K;  2ZGY A;  5FPN A;  4FJ8 A;  3HPH A;  4UY8 O;  5BPM A;  1XWL A;  4BDZ A;  1RDW X;  4ILJ A;  4PHT X;  3QES A;  4QS9 A;  4C1N K;  1DGK N;  1HX1 A;  1JXB A;  5AZI B;  4BWM A;  4PKH A;  4BR0 A;  4YDU A;  4JKD A;  3CHW A;  4LSL A;  1BA1 A;  1KXP A;  4BRK A;  4K8X A;  2P51 A;  2V7Y A;  4R5P A;  3LP3 A;  3DXK A;  5KI6 A;  2UUA K;  5CZ1 A;  2JWK A;  3O3F A;  4K42 A;  5JVG L;  2E88 A;  4IO8 A;  4DSI A;  1Q81 O;  2GUP A;  1BG3 A;  4Y0W A;  4LY7 A;  4IOC L;  2ZWH A;  1SZ2 A;  4IEE A;  5C25 A;  3D2F B;  3MMV A;  1ZBS A;  5CE3 A;  1X9M A;  1WSE A;  4CFC A;  2NRR A;  3O80 A;  4FW2 A;  1ASW A;  1Z05 A;  4F3O A;  3ATV A;  1RTI A;  3UKR B;  2IS3 A;  4C8O A;  3PX0 A;  3VQ4 A;  4PUO A;  2VCP A;  3E9L A;  2NRX A;  2HB5 A;  2JWL A;  3M5R A;  1LOT B;  4QOZ B;  3V1R A;  2GEM A;  3ZYY X;  2G8H A;  1HNW K;  4OO1 J;  1NGE A;  4IXC A;  3FZK A;  3G10 A;  4M3T A;  2P9L A;  4DMN A;  4LH4 A;  2O8E B;  1VSD A;  1TL1 A;  2PYL A;  3CFP A;  3VOV A;  4FW1 A;  2ZJP L;  3OYC A;  5D3G A;  3CG7 A;  3ULE B;  4DF4 A;  1KCF A;  1EO1 A;  4KV8 A;  3FLC O;  1F21 A;  3AVL A;  3CD6 N;  4CED A;  5BRH A;  1QS4 A;  4LFB K;  3KIO A;  5ADX H;  2DFF A;  3OYN A;  2NRT A;  4CJ5 A;  3OYG A;  4LF6 K;  3H6E A;  4FZY A;  2E1Z A;  1GLJ O;  3P1G A;  2Q2R A;  4M45 A;  2VQF K;  1BA0 A;  2RHK A;  3HPG A;  2UUB K;  4B1Z A;  1NKE A;  2W6L A;  1HYZ A;  3OYK A;  1NGB A;  3CCQ N;  1C0U A;  2CH5 A;  4A62 A;  1BIU A;  4NXN K;  4CK2 A;  4DTX A;  2YX6 A;  4HTU A;  4CEE A;  2QKB A;  3OJS A;  1OH7 A;  4X66 K;  4Z4H A;  5CR4 A;  5AQM A;  4EHU A;  4CGG A;  2HOE A;  2ATQ A;  1BIZ A;  4NXM K;  4NB4 A;  1WUA A;  1VQL N;  3OYH A;  3U6F A;  5FPE A;  1J5O A;  2QK9 A;  5AQV A;  1U45 A;  3BY5 A;  1DT9 A;  3VTI A;  3VQA A;  4FM0 A;  1A5V A;  5LL6 Z;  4KI6 A;  1Q8I A;  5BRF A;  2Z1H A;  5CYM A;  2ZGZ A;  1RT2 A;  3SJJ A;  1GOB A;  1KC8 O;  3FZF A;  5GAE P;  1KLN A;  2KTQ A;  3PY8 A;  1VQ7 N;  2HVH A;  4O44 A;  5M1Q A;  4I6M A;  3L2Q A;  3VF6 A;  1HNV A;  1T3V A;  2DPN A;  2GX9 A;  4LH5 A;  3VQ9 A;  4E1J A;  2RF2 A;  4X65 K;  3NH0 A;  2P5O A;  2O8F A;  3WQT A;  4CW7 B;  4PY5 A;  4B9N A;  1WSI A;  1GOA A;  1REV A;  3AAQ A;  4ZTJ A;  3A8Y A;  4W5O A;  5E26 A;  2VG7 A;  3QBW A;  1N33 K;  2FSK A;  3ZT0 A;  5SWM A;  4DU3 A;  4FO0 A;  1NJW A;  3WUH A;  1ATS A;  3WNF A;  1HYV A;  4JK9 A;  3J7A P;  4LSN A;  4B1U B;  4MQ3 A;  4Z4F A;  3L2V A;  1CXU A;  2E2P A;  5CY4 A;  1NK9 A;  4RTF D;  1E3M A;  3Q7B A;  2HVI A;  1DKG D;  3DMJ A;  2ZM6 K;  4NO7 A;  1RDA A;  1ASU A;  2W6K A;  4BR4 A;  3ENB A;  4DUY K;  3SAG A;  1XMO K;  2OTL N;  3QLH A;  1S5J A;  3C65 A;  1ZC6 A;  1K8A O;  4JI1 K;  1QQO A;  4CJR A;  2BE2 A;  1SKS A;  4WQ4 C;  3MWT A;  3L0Q A;  2PZS A;  2I7N A;  3RMA A;  3RR7 A;  5E41 A;  1S9E A;  3G4S N;  2OPR A;  3LAM A;  2FSJ A;  3VEY A;  4NLB A;  1W2B M;  3JAM O;  3VQ8 A;  4YDU C;  4QS7 A;  4CD3 A;  4O0J A;  4DR5 K;  1NMN A;  1RCH A;  3SCX A;  1IG9 A;  2GEL A;  4KH6 A;  2QM1 A;  1KVB A;  4FLW A;  1WSH A;  5M1P A;  3KLG A;  4JI8 K;  2D0B A;  1H1V A;  3CQY A;  1S1X A;  3B6O A;  1JLA A;  4CJL A;  1GLD G;  1MA9 B;  3AO1 A;  1VSM A;  3AVM A;  2ITM A;  3PO4 A;  3NH2 A;  1U48 A;  4CF9 A;  3QNN A;  3I33 A;  4FWS A;  3HXM A;  4FJI A;  2Q36 A;  3WNE A;  2G8V A;  1YVN A;  3ZX3 A;  3KKR A;  3CCU N;  4ELU A;  4A2A A;  3JS6 A;  4CFA A;  3R1X A;  5I42 A;  1YJW N;  2QWR A;  1DTQ A;  4DS4 A;  1NJZ A;  3KLH A;  4DTM A;  2ZD1 A;  3VGK A;  4BVO A;  3VPZ A;  3NGI A;  1IO2 A;  1NGF A;  4IJN A;  1NK4 A;  1T44 A;  1S22 A;  4H5N A;  1NK0 A;  1XNQ K;  4CEC A;  1GLB G;  4C8N A;  2E2Q A;  3NF8 A;  3PX4 A;  3HTV A;  2NZT A;  3NF7 A;  2YNH A;  4JKF A;  1KQS M;  2X78 A;  4JV5 K;  4KO0 A;  4CJV A;  4J2A A;  2X74 A;  4FYD A;  3P4I A;  3O08 A;  1IG8 A;  3ZLJ A;  1L3V A;  4PWD A;  3DOK A;  4M3U A;  4DSK A;  1VRU A;  4DTS A;  1NOZ A;  3RVC A;  1VSH A;  4KB1 A;  3MN5 A;  2OA8 A;  4YOX A;  3PIP L;  3H08 A;  2QWL A;  4FK2 A;  1SUQ A;  1RBU A;  2XY6 A;  4AIL C;  4M63 C;  5C24 A;  4CJ7 A;  2HHV A;  2QXL A;  4H4M A;  3ATU A;  2FBV A;  2HBJ A;  5FLX O;  2HND A;  2NUB A;  4OGE A;  3F2K A;  3ZSW A;  1NK7 A;  3BP8 A;  2B4J A;  4KHU A;  3C6A A;  1D9D A;  3DLH A;  1L3S A;  4CJS A;  2V51 B;  2OTJ N;  4LFA K;  3KK1 A;  2HW3 A;  1QZ6 A;  1HPZ A;  2KQ2 A;  4CZM A;  2GV9 A;  3NF9 A;  1U2V B;  4FLV A;  3WXK A;  4IO9 L;  1SKW A;  4JKH A;  3E66 A;  2HST A;  3CYM A;  1W9H A;  5AQN A;  1TK8 A;  3LZJ A;  1YIJ N;  3K9J A;  3EYZ A;  5MLC Q;  2IVN A;  1T6D A;  5AQR A;  4FK4 A;  4KKO A;  3D45 A;  4W5Q A;  3DJC A;  4B3R K;  3DLR A;  3F5T A;  3HP6 A;  1BGX T;  5BPL A;  3G25 A;  2QWN A;  5DK5 A;  3RTV A;  1DTT A;  2V52 B;  4CHQ A;  4CHY A;  4C8L A;  3MX5 A;  3SMP A;  4DWI A;  3C6U A;  2O8D B;  4BR7 A;  4FJL A;  3HJF A;  2P9I B;  4IEI A;  4DTU A;  2UYT A;  1VSI A;  3GL1 A;  2UUC K;  1J6Z A;  4FWQ A;  3VEV A;  3WQU A;  3VGL A;  4BC3 A;  4PKI A;  1TKT A;  3K5L A;  1VQP N;  3DWL A;  3THY A;  3DLG A;  5CYQ A;  3P5J A;  1XMQ K;  4FLU A;  2YHW A;  2HNZ A;  2ZE2 A;  3F73 A;  4CZL A;  1T7P A;  3FZM A;  3K57 A;  4H4O A;  1Q9Y A;  1U04 A;  4NCB A;  3ZEU B;  1SQK A;  4FLT A;  4ELV A;  4CEA A;  5C2D A;  4H0X B;  4JRP A;  1TK0 A;  4KI4 A;  1VQ5 N;  1BCM A;  1JLC A;  4DUZ K;  4DU4 A;  5FRN A;  2E2N A;  1IJJ A;  1U47 A;  2OCE A;  4E7J A;  3P31 A;  1BHL A;  4Y1C A;  1VSK A;  3HOT A;  5HRN A;  3HP9 A;  1XHZ A;  2P9U A;  1TUY A;  3DLE A;  2FBT A;  1BL3 A;  2Q31 A;  4JKE A;  4DR3 K;  4ILG B;  1HJR A;  4CEZ A;  3J7Y P;  3TSU A;  2P9S A;  4A5B A;  1WBB A;  1NK8 A;  1NGH A;  4CFB A;  4AHT A;  3WEE B;  1D5A A;  3CFO A;  2UU9 K;  4KRE A;  3GG4 A;  3VQE A;  3A5N C;  4FJM A;  2PAV A;  1RFQ A;  4DS5 A;  5HRS A;  3R6M A;  3QEI A;  1HKC A;  3D6R A;  3QO9 A;  2FBY A;  5TKY A;  2P9N A;  1I3A A;  3BDP A;  5M1N A;  1Y97 A;  1NGD A;  1HYS A;  3TAR A;  4CEB A;  3OJU A;  1Q82 O;  3TAQ A;  3J8A A;  4GKJ K;  2QWM A;  1XUP O;  3A5L C;  3MXJ A;  4Z0U A;  1VSL A;  3THW B;  4BRA A;  4DSL A;  4KHQ A;  4QCL A;  2KFZ A;  2YHB A;  4IZ9 A;  5AQK A;  2I7P A;  4FWN A;  1V4T A;  4OPH A;  4X64 K;  3VET A;  4DQI A;  1BUP A;  3CCS N;  1QVF M;  4XIU A;  3KK7 A;  4JS5 A;  3MEC A;  4IDH A;  3RSE B;  2ZJQ L;  3U3Y A;  3SZ2 A;  3OTO K;  5AQW A;  2HBK A;  4LF9 K;  3ZSY A;  3V6D A;  3CI5 A;  1IBM K;  3OBW A;  3V9X A;  2E8A A;  4M3R A;  3KTQ A;  2FXU A;  3LZI A;  5LY3 A;  3I0R A;  2Q3S A;  1I39 A;  3FFK B;  2FF6 A;  3L4Q A;  5J2M A;  2J4R A;  2OZS A;  3KLF A;  4M42 A;  2FC0 A;  4Q0B A;  3L2W A;  3QIC A;  3AVA A;  1RT4 A;  3B8A X;  5LMN K;  5AZI A;  3TU5 A;  4FSV A;  1KSP A;  3IAY A;  5BRD A;  3TSP A;  3BF3 A;  1XQS C;  3T19 A;  4HCB A;  4DV4 K;  4X62 K;  1NJI O;  1Q18 A;  1GLF O;  3MXI A;  3NVK A;  1NJX A;  4DCH A;  5LJV A;  3IG1 A;  2JGU A;  3NDK A;  1IH7 A;  3AO5 A;  4O5F A;  5F1X A;  4WYB A;  3QBX A;  3VES A;  4WQ5 A;  5FDL A;  3AVH A;  4OX9 K;  3OYM A;  3IRX A;  1SL0 A;  1HNI A;  2YHY A;  2X6S A;  3HBT A;  4JNE A;  3SV4 A;  1O1W A;  1S1V A;  2A5X A;  4BWJ A;  3DRS A;  4ZHR A;  1I94 K;  4H5R A;  3GDQ A;  3VEZ A;  4N41 A;  3DI6 A;  1X3N A;  4H0V B;  2ASM A;  3VEW A;  4CZH A;  5DM7 L;  5C0Y A;  3D2F A;  4A5A A;  4DQ8 A;  1W97 L;  3GBT A;  1KD1 O;  4YOU A;  4CEF A;  4B3O A;  5GAD P;  3ZET B;  3U9Z A;  3A2F A;  3UKR A;  1T05 A;  4CGJ A;  2AJQ A;  3QML A;  4XH4 A;  4PQU A;  5EU7 A;  1XI1 A;  1B9F A;  3HVR A;  3IS9 A;  4MDB A;  1EX4 A;  3TAN A;  3DOL A;  4JKC A;  3V9S A;  4OPA A;  2VWJ A;  4C1N I;  2OPS A;  2A1R A;  1S6P A;  4O0I A;  2O8E A;  3OS2 A;  1IKY A;  2F9W A;  4PA1 A;  3UIQ A;  3ZSQ A;  1S1W A;  1U49 A;  3ZT4 A;  4CZI A;  4BRG A;  3ULE A;  1RIL A;  3VEX A;  2OPP A;  5AJ3 K;  4FM2 A;  1ESV A;  2EX3 A;  4I2P A;  1LAV A;  4FWO A;  4FPB A;  1YUW A;  4CZJ A;  3AVN A;  2QWO A;  2O4I A;  4IWV A;  5AQP A;  3LDN A;  4B9U A;  1IBK K;  3CIP A;  3TAF A;  4IFE A;  1UWB A;  3NGZ A;  3QDK A;  1RTH A;  3EL2 A;  2YNG A;  2F96 A;  4M7X A;  1TGO A;  5EY4 A;  1E4G T;  4DV6 K;  4RW7 A;  3QIO A;  2EHG A;  3OVN A;  3E9P A;  4J2E A;  4ISF A;  1N34 K;  3T1Y K;  4N56 A;  2E2O A;  2NRZ A;  2AA4 A;  3OA9 A;  2VG6 A;  3AVB A;  1XC9 A;  3AAP A;  4B08 A;  2R7Y A;  1IBL K;  4BE0 A;  1NKB A;  4WCE L;  4C23 A;  4JD2 A;  2D1K A;  1QHT A;  1XHX A;  3RR8 A;  4KTZ A;  2Q0R A;  4CBW A;  4CFD A;  4DR7 K;  5DM6 L;  4FWP A;  4F9O A;  2VWB A;  4DU1 A;  4AHU A;  1YVU A;  4XH1 A;  3EY1 A;  4M3Y A;  3SPZ A;  4I9Q A;  3J80 O;  3ALY A;  3M1F A;  3O4Q A;  3UKU B;  5KQ8 A;  1X3M A;  3BUZ B;  5KPZ A;  4KRF A;  1LV5 A;  1RTJ A;  2Y1I A;  3ZSZ A;  1P8Z A;  5JMV A;  1JL1 A;  2FSN A;  4FVM A;  3ID8 A;  3IUC A;  1CZA N;  4WE1 A;  4IOA L;  3BGR A;  4NCG A;  3TR8 A;  3CC7 N;  5TKW A;  3JYT A;  3CCJ N;  1WNS A;  4E7K A;  2P9K B;  1YJ9 N;  3CJ7 A;  3JSM A;  5AQO A;  4BDP A;  1CZB A;  1WN7 A;  4H0T B;  5B8H A;  4NLC A;  4DTN A;  4EP4 A;  3K5M A;  3KJV A;  3C6H A;  5JS2 A;  3HT3 A;  2BH1 A;  3VQQ A;  5IT9 O;  3TAB A;  3EE9 A;  4M3Z A;  4GV9 A;  3D2E B;  3MCA B;  3CCV N;  4B9L A;  2D0A A;  4J2D A;  4FLY A;  2E20 A;  3HYF A;  4YOR A;  1QSS A;  4FZX C;  1MDU B;  3DRP A;  4R79 A;  1QE1 A;  4CHZ A;  5JLF A;  2OAN A;  4PL7 A;  3BF1 A;  3CC2 N;  2O8B A;  5ADX A;  3G6E N;  3MXM A;  1S72 N;  1ZBH A;  4CIE A;  3HI0 A;  4UQG A;  1NK6 A;  4CJK A;  1KFS A;  4HUF A;  3THX A;  5AQI A;  5GIP A;  1CXQ A;  2RE2 A;  1S9G A;  3S9H A;  1TAU A;  3TPQ A;  4BR2 A;  4O4G A;  4N76 A;  4IDK A;  4Y1D A;  2D0C A;  4CJ3 A;  3NH1 A;  5FRM A;  5AQS A;  3HSC A;  2YKM A;  4DQR A;  1W0H A;  2HHH K;  4YHH K;  5AQY A;  1JLB A;  2VWK A;  1VK0 A;  1RT7 A;  1TAQ A;  2JLE A;  4FWK A;  4H5T A;  4BRD A;  4M7Y A;  3K2P A;  3S3O A;  1QZ5 A;  3MK6 A;  3S41 A;  3GOI A;  2ITG A;  1TUU A;  3WNG A;  4IFV A;  3KVG A;  3N4Q A;  4HUE A;  1HQU A;  1CLQ A;  1NBW A;  3ZX2 A;  3VF2 A;  3ZSR A;  5KRS A;  1NGG A;  3CCL N;  3NVM A;  4HWI A;  1VQ6 N;  1BIS A;  4N47 A;  3MN6 A;  2B6A A;  3IKM A;  3RMB A;  2F8S A;  4KHW A;  5J2N A;  1DEJ A;  4M3W A;  4XEI A;  1L3U A;  2HHW A;  1NNE A;  1EXQ A;  4YNQ A;  5CHI A;  3HM9 A;  3TTC A;  1BU6 O;  4FWL A;  5EVZ A;  3U4L A;  4BQZ A;  3NBP A;  3R8E A;  1QSY A;  3VQD A;  4ILH A;  4AHR A;  4DFP A;  2QI2 A;  5GAH P;  5KGW A;  4CZK A;  1N32 K;  3H1V X;  3A5M C;  3DLK A;  3E1Y A;  4KHY A;  1K8K B;  3QIN A;  4Z94 A;  3CC4 N;  3RMD A;  4ICL A;  5GIN A;  3LDQ A;  4B1Y B;  2KLA A;  4BC4 A;  1C6V A;  2QA4 N;  3U8X A;  3VMF B;  3SJH A;  2WTU A;  3CQ8 A;  5BR8 K;  1U2V A;  2F4V K;  3AVC A;  4K43 A;  4YOW A;  4AF1 A;  4K0K K;  5AQF A;  1S1T A;  3T3F A;  1HPM A;  3SQ2 A;  3HZ6 A;  2A40 A;  3L4I A;  4AH9 A;  4CJQ A;  1VQ9 N;  5GIO A;  3CJ1 A;  1OVQ A;  2KW4 A;  4GV3 A;  3K0S A;  2UXB K;  3OY9 A;  5BPN A;  3M8Q A;  3N4P A;  1JLG A;  3PX6 A;  3P83 D;  2XY7 A;  1LAW A;  3VQB A;  1CZ9 A;  4HVJ A;  5C15 A;  4FJJ A;  3M6G A;  1WAF A;  4W5N A;  1B9D A;  4H8K A;  1TK5 A;  2O8D A;  2HF3 A;  2P9I A;  4FOI A;  2XY5 A;  3O4W A;  5M1O A;  3S3M A;  4IJA A;  3CM6 A;  3BZK A;  5ELZ A;  5AZJ B;  4E1N A;  3ID6 A;  2G8W A;  1WOQ A;  1BI4 B;  4RW6 A;  4BRO A;  3U9D A;  2F7T A;  2NLX A;  4B8C A;  2OZM A;  2D0O A;  3V9U A;  1Q7Y O;  4DFM A;  3L8B A;  2G8K A;  5AFU H;  4ELT A;  1OH6 A;  1N6Q A;  2A3Z A;  1YAG A;  1JCF A;  1VSE A;  4BC5 A;  3CPE A;  3ZEU A;  4DSF A;  4A57 A;  3DYA A;  2WOM A;  4BVP A;  5IWA K;  4DTO A;  3EEQ A;  1LW0 A;  4RCH A;  5BR9 A;  4GW6 A;  3VA3 A;  3AA3 A;  4FJ5 A;  1WAJ A;  2Q97 A;  4FK0 A;  4JI3 K;  4BRI A;  4IOX A;  4B1V A;  2YNI A;  1TKX A;  3FE1 A;  4XH5 A;  4E19 A; 
#chains in the Genus database with same CATH homology
 5KGX A;  5D3G A;  2Q3S A;  3CG7 A;  4DF4 A;  1I39 A;  1KCF A;  1C1B A;  4IG3 A;  4JLH A;  4KV8 A;  1F21 A;  3AVL A;  3VQP A;  3SUQ A;  5J2M A;  3QET A;  4CED A;  3S3N A;  2OZS A;  3KLF A;  4M42 A;  2FC0 A;  4Q0B A;  3L2W A;  1QS4 A;  1A5W A;  3AVA A;  3KIO A;  1RT4 A;  1IKV A;  3IAY A;  5HLF A;  1T03 A;  1KSP A;  2DFF A;  4FJ9 A;  3OYN A;  2RN2 A;  3T19 A;  4HCB A;  4CJ5 A;  4F4K A;  3OYG A;  5J2Q A;  3MXI A;  2DTU A;  4FZY A;  4GVM A;  5C42 A;  1NJX A;  3P1G A;  4IFY A;  4M45 A;  5HRO A;  3IG1 A;  2JGU A;  3NDK A;  4CJT A;  1IH7 A;  3AO5 A;  3HPG A;  4CHN A;  4CER A;  5FDL A;  1NKE A;  4FJG A;  1HYZ A;  3OYK A;  4CF8 A;  3AVH A;  1C0U A;  2XY8 A;  3ZT2 A;  2BGG A;  1JL2 A;  1BIU A;  3IRX A;  1TKZ A;  3OYM A;  1SL0 A;  1HNI A;  4CK2 A;  2X6S A;  1QSL A;  4DTX A;  3SV4 A;  1SV5 A;  1QQC A;  1BI4 A;  1O1W A;  4HTU A;  3I8D A;  4CEE A;  2QKB A;  1S1V A;  1HRH A;  4FJN A;  3OJS A;  4BWJ A;  2D5R A;  3DRS A;  4ZHR A;  3EZ5 A;  4N41 A;  4Z4H A;  3LDS A;  3DI6 A;  1RT3 A;  1JKH A;  3ISN C;  4FLX A;  2HMI A;  1RDD A;  4CGG A;  3E01 A;  4LD0 A;  2ATQ A;  1BIZ A;  1RT5 A;  3QEX A;  1G15 A;  3CM5 A;  3O3H A;  3OYH A;  4CEF A;  4B3O A;  3AVF A;  4BE2 A;  3U6F A;  3MEG A;  2Y1J A;  4OPK A;  1J5O A;  2QK9 A;  1U45 A;  3A2F A;  3VQA A;  2IC3 A;  4FM0 A;  4B9V A;  1A5V A;  5KRT A;  1Q8I A;  2X6N A;  4QAG A;  4DSE A;  2Z1H A;  5CYM A;  4B9T A;  4KI6 A;  3SJJ A;  1RT2 A;  1GOB A;  2XHB A;  4DTP A;  4OKJ A;  1T05 A;  4CGJ A;  1KVA A;  3SNN A;  1KRP A;  5SZT A;  2QKK A;  3ZSV A;  4PQU A;  5EU7 A;  1KLN A;  2AJQ A;  3KLI A;  1XI1 A;  1B9F A;  3HVR A;  5KTQ A;  3PY8 A;  2KTQ A;  3IS9 A;  2HVH A;  3LAK A;  4RW8 A;  1EX4 A;  4O44 A;  3TAN A;  3DOL A;  3MEE A;  3L2Q A;  3VQ9 A;  1HNV A;  3V9S A;  4LH5 A;  1NOY A;  2RF2 A;  1RBT A;  3NH0 A;  4ZTF A;  2P5O A;  2VWJ A;  3RRH A;  2OPS A;  2I5J A;  4OVL A;  4IBN A;  1S6P A;  4O0I A;  5J2P A;  2A1R A;  1YT3 A;  3OS2 A;  4PY5 A;  1IKY A;  3NF6 A;  4PA1 A;  3UIQ A;  3RMC A;  3C95 A;  3ZSQ A;  4FCY A;  4B9N A;  1S1W A;  1WSI A;  3ZT4 A;  1U49 A;  1GOA A;  3OYA A;  3QNO A;  1REV A;  4E7H A;  4ZTJ A;  4W5O A;  3AVJ A;  3M8S A;  1RIL A;  3SYZ A;  3OS0 A;  2VG7 A;  1JLE A;  3ZT0 A;  1VSJ A;  2OPP A;  5SWM A;  4DU3 A;  4FM2 A;  1NJW A;  2KZZ A;  4Z4I A;  3WNF A;  2EX3 A;  1HYV A;  4I2P A;  4AHV A;  1LAV A;  3LP0 A;  1UOC A;  4LSN A;  4DF8 A;  3K58 A;  1WSF A;  1A5X A;  4MQ3 A;  4HCC A;  4Z4F A;  3L2V A;  3LP1 A;  3HST B;  3AVN A;  1CXU A;  5CY4 A;  1NK9 A;  2O4I A;  3OYJ A;  3I0S A;  4B9U A;  3LWL A;  1S1U A;  3DMJ A;  3OS1 A;  2HVI A;  1UAX A;  3TAF A;  1RNH A;  3LAL A;  1UWB A;  3NGZ A;  4B9S A;  5JS1 A;  2HHX A;  1RTH A;  1RDA A;  1ASU A;  5CZ2 A;  3VQ7 A;  3WNH A;  3QEV A;  1SL1 A;  1QTM A;  2YNG A;  2F96 A;  1FKP A;  3QLH A;  4CGI A;  3OYB A;  1S5J A;  1TGO A;  3SI6 A;  3FFI A;  3AA2 A;  4RW9 A;  4RW7 A;  4HUG A;  3QIO A;  3MED A;  2EHG A;  4CES A;  3OVN A;  3VN5 A;  1YTU A;  2ETJ A;  4J2E A;  4CJR A;  2BE2 A;  4N56 A;  1SKS A;  2PZS A;  4KTQ A;  2VG6 A;  3AVB A;  1XC9 A;  4KFB A;  3QEP A;  3PO5 A;  4B08 A;  2R7Y A;  3RMA A;  1ZBL A;  1UA0 A;  3RR7 A;  4EZ9 A;  4BE0 A;  1NKB A;  1MU2 A;  5E41 A;  2WON A;  1S9E A;  1SKR A;  1D9F A;  3DM2 A;  2F8T A;  1ITG A;  4NYF A;  2OPR A;  2Z1I A;  4O5B A;  3SPY A;  4K8Z A;  1QHT A;  4CJE A;  3TAP A;  1XHX A;  3RR8 A;  1LWC A;  4KTZ A;  2BDP A;  4M3X A;  3LAM A;  4CFD A;  2P5G A;  3C94 A;  3VQ8 A;  3LPT A;  1IKW A;  4CGF A;  3O4N A;  4DU1 A;  4J2B A;  4O0J A;  4CK1 A;  4AHU A;  3ZT1 A;  1KLM A;  1RCH A;  1YVU A;  4EP5 A;  3EY1 A;  3SCX A;  1KFD A;  1IG9 A;  3HPO A;  4M3Y A;  4AHC A;  3V1O A;  3SPZ A;  1KVB A;  4I9Q A;  4NYN A;  4FLW A;  2P1J A;  2RKI A;  1WSH A;  5DMR A;  3OYE A;  4E3S A;  1EKE A;  3ALY A;  4CF1 A;  2HHQ A;  3KLG A;  4Q5V A;  2HHS A;  2D0B A;  2O4G A;  2E6L A;  4OGC A;  4GMJ B;  3KK2 A;  4Z4G A;  1IKX A;  1C1A A;  3O4Q A;  4KHS A;  1S1X A;  2LSN A;  3B6O A;  3LAN A;  4C8M A;  1JLA A;  4CJL A;  3TI0 A;  4KRF A;  1JLQ A;  3AO1 A;  4OKK A;  1VSM A;  3AVM A;  4M41 A;  1LV5 A;  3PO4 A;  1WLJ A;  2BAN A;  1RTJ A;  2E6M A;  4ID5 A;  3ZSZ A;  3NH2 A;  2YHA A;  4CHO A;  1JL1 A;  4CJP A;  3OYF A;  1K6Y A;  4FVM A;  1SL2 A;  4BDY A;  4CF9 A;  3TAE A;  3QNN A;  4B9M A;  4NCA A;  3HXM A;  4FJI A;  4MFB A;  3ITH A;  3WNE A;  2G8V A;  4DQP A;  4WE1 A;  1B92 A;  3KKR A;  5HP1 A;  2KFN A;  2GBZ A;  3BGR A;  3QIP A;  4NCG A;  3TR8 A;  4BAC A;  3SUO A;  4ELU A;  3VQC A;  3JYT A;  4CFA A;  3TAG A;  5I42 A;  1WNS A;  1DTQ A;  4DS4 A;  1KVC A;  1FK9 A;  3AO3 A;  5HRP A;  3KLH A;  4E7K A;  2ZD1 A;  4DTM A;  4BE1 A;  2DFH A;  3PV8 A;  4KAZ A;  2HHT A;  3NGI A;  1IO2 A;  2IAJ A;  1NK4 A;  1X1P A;  3TAM A;  3JSM A;  4BDP A;  3DRR A;  3V1Q A;  1CZB A;  1NK0 A;  1WSG A;  1J54 A;  4CEC A;  5I3U A;  4C8N A;  1WN7 A;  3NF8 A;  3PX4 A;  4DTN A;  1LWE A;  3QEW A;  3SUN A;  2HHU A;  4Z4C A;  5T7B A;  4EP4 A;  1ZBI A;  3K5M A;  3AO2 A;  3NF7 A;  3KJV A;  2YNH A;  3AA4 A;  5JS2 A;  2X78 A;  4CF0 A;  1U48 A;  1L3T A;  1RDC A;  3HT3 A;  4KO0 A;  4W5T A;  4CJV A;  3TWH A;  3VQQ A;  4J2A A;  3TAB A;  2X74 A;  5K14 A;  4M3Z A;  3C6T A;  1LWF A;  4FYD A;  2QXF A;  1L3V A;  4KPY A;  4PWD A;  3DOK A;  2B5J A;  4DTR A;  4M3U A;  4B9L A;  2D0A A;  4OJR A;  4CJF A;  1Q9X A;  4O55 A;  4FLY A;  4DSK A;  4J2D A;  2Y1I A;  3SQ0 A;  1VRU A;  3HYF A;  4I7F A;  1NOZ A;  4DTS A;  1VSH A;  4KB1 A;  2OA8 A;  3KK3 A;  1QSS A;  4FZX C;  4IG0 A;  1NJY A;  3DRP A;  1UA1 A;  3SQ1 A;  4W5R A;  2A1S A;  3H08 A;  3K5O A;  1QE1 A;  4CHZ A;  2G8U A;  4EZ6 A;  4FK2 A;  1SUQ A;  4FXD A;  4KTW A;  1RBU A;  1EET A;  2XY6 A;  3B6P A;  4AIL C;  4FJK A;  5C24 A;  4YFU A;  3MXM A;  1ZBH A;  2KZM A;  4KB0 A;  2HHV A;  4CIE A;  2PYJ A;  4UQG A;  1RBS A;  1RT1 A;  1NK6 A;  1BQN A;  4H4M A;  4CJK A;  1KFS A;  2FBV A;  2HND A;  4TSX A;  4HUF A;  2NUB A;  1CXQ A;  1S9G A;  1ZBF A;  1Z26 A;  4I2Q A;  4OGE A;  3ZSW A;  4CGH A;  3S9H A;  1NK7 A;  3NAE A;  1TAU A;  2B4J A;  3F9K A;  4DLE A;  4KHU A;  4O4G A;  4N76 A;  4IDK A;  1D9D A;  3DLH A;  1L3S A;  4CJS A;  4Y1D A;  3AVI A;  2D0C A;  1R0A A;  4CJ3 A;  3OYI A;  3LP2 A;  3KK1 A;  1D8Y A;  3KD1 E;  3NH1 A;  2DY4 A;  5FRM A;  3SUP A;  2HW3 A;  1FXX A;  4CJW A;  1HPZ A;  2YKM A;  1Z25 A;  2KQ2 A;  3ZCM A;  4DQR A;  2GV9 A;  1W0H A;  3NF9 A;  4FLV A;  1JLB A;  2VWK A;  5FRO A;  4I9L A;  1VK0 A;  4FJ7 A;  1RT7 A;  1SKW A;  1ZBU A;  2VG5 A;  1TAQ A;  2JLE A;  1KTQ A;  3CYM A;  1C0M A;  1W9H A;  3U3G A;  4OKE A;  4CEO A;  4CIG A;  3LZJ A;  3K2P A;  4JRQ A;  1X9S A;  4F8R A;  4JS4 A;  3S3O A;  1RT6 A;  3HO1 A;  3EYZ A;  3SV3 A;  3NFA A;  3L2R A;  4DQS A;  2OPQ A;  4KKO A;  4FK4 A;  3D45 A;  4W5Q A;  1C1C A;  4E0D A;  3VA0 A;  4CK3 A;  2ITG A;  3KKS A;  3WNG A;  4N5S A;  3DLR A;  4IFV A;  3AVG A;  3O3G A;  1BGX T;  2IOC A;  3VQ5 A;  3HP6 A;  1TV6 A;  4HUE A;  1HQU A;  3LPU A;  1RTD A;  5DK5 A;  3RTV A;  1CLQ A;  1DTT A;  3ZSR A;  4CHQ A;  5KRS A;  4E7L A;  4CHY A;  3RRG A;  4C8L A;  4DWI A;  2YKN A;  3C6U A;  2PY5 A;  2W42 A;  1BIS A;  4N47 A;  4CF2 A;  2B6A A;  3RMB A;  2F8S A;  4FJL A;  4KHW A;  2Z1G A;  3KLE A;  5J2N A;  3LWM A;  3HJF A;  1HMV A;  3NCI A;  4L8R B;  4M3W A;  4DTU A;  1L3U A;  5HBM A;  4DLG A;  2HHW A;  1VSF A;  1S6Q A;  1VSI A;  3T1A A;  1NJZ A;  1EXQ A;  3AVK A;  4FM1 A;  2FBX A;  1U4B A;  2XRI A;  4YNQ A;  3OYD A;  1YTA A;  2E4L A;  3HM9 A;  3L3U A;  2OYQ A;  1TKT A;  1BQM A;  3ZT3 A;  3K5L A;  3DLG A;  3G0Z A;  4IKF A;  5CYQ A;  3VQ6 A;  3AV9 A;  2HNY A;  3P5J A;  3ZSX A;  4CJU A;  3NBP A;  1NK5 A;  1QSY A;  3VQD A;  3L2U A;  4FLU A;  2HNZ A;  1LW2 A;  2ZE2 A;  3F73 A;  1GOC A;  3AO4 A;  1WSJ A;  4AHR A;  4DFP A;  4AHS A;  5KGW A;  1ASV A;  1T7P A;  4B8A B;  3K57 A;  1ZYQ A;  3DLK A;  4H4O A;  2DFE A;  4KHY A;  1Q9Y A;  1U04 A;  4NCB A;  3ZSO A;  3QIN A;  4CJ4 A;  4HHT A;  4RG8 A;  4FLT A;  3QER A;  1HQE A;  3RMD A;  4ICL A;  4ELV A;  3AA5 X;  3PUF A;  4CEA A;  1L5U A;  3ASM A;  4JRP A;  2YNF A;  1TK0 A;  4KI4 A;  4FZZ A;  4F3T A;  3V4I A;  1C6V A;  4OLB A;  3KD5 E;  1BCM A;  2Z1J A;  4DFK A;  1JLC A;  4CE9 A;  4F2R A;  3CQ8 A;  4DSJ A;  3DLB A;  3V9W A;  3K59 A;  4FJH A;  4DU4 A;  3AVC A;  4CGD A;  5FRN A;  1EP4 A;  4ID1 A;  3NE6 A;  1JLF A;  1U47 A;  1S1T A;  1T8E A;  4OPJ A;  1N5Y A;  3T3F A;  4E7J A;  3HL8 A;  4FLZ A;  3SQ2 A;  4AH9 A;  4CJQ A;  1BHL A;  4Y1C A;  1VSK A;  1C0T A;  3V9Z A;  4F2S A;  3HK2 A;  3HVT A;  1TKD A;  5HRN A;  3HP9 A;  4DTJ A;  1XHZ A;  2KW4 A;  3DLE A;  2FBT A;  4RW4 A;  1BL3 A;  3OY9 A;  4FJ8 A;  4DG1 A;  3M8P A;  3HPH A;  2ZQB A;  3M8Q A;  1XWL A;  4BDZ A;  1HJR A;  1JLG A;  4CEZ A;  4E7I A;  3PX6 A;  4CIF A;  3QES A;  3THV A;  1FKO A;  3P83 D;  2XY7 A;  4CCH A;  1LAW A;  3VQB A;  1NK8 A;  3LZI A;  1J53 A;  1CZ9 A;  2IGI A;  4CFB A;  4HVJ A;  1JXB A;  4BWM A;  3RWU A;  4AHT A;  3NGY A;  4FJJ A;  1WAF A;  1D5A A;  3CFO A;  3OYL A;  4CHP A;  4KRE A;  4Z4E A;  4W5N A;  1B9D A;  4H8K A;  1TK5 A;  1BCO A;  3VQE A;  3M8R A;  4LSL A;  1TVR A;  4FJM A;  4DS5 A;  5HRS A;  1RDB A;  4K8X A;  3QEI A;  2XY5 A;  2GUI A;  2P51 A;  3QO9 A;  2FBY A;  4R5P A;  3NHG A;  4DFJ A;  1NKC A;  3LP3 A;  3MAQ A;  1I3A A;  3S3M A;  3BDP A;  3CM6 A;  1DLO A;  2G8I A;  5J1E A;  5KI6 A;  1RBR A;  1Y97 A;  5CZ1 A;  3O3F A;  1HYS A;  4E1N A;  4DSI A;  2G8W A;  3TAR A;  4CEB A;  1TL3 A;  3OJU A;  1BI4 B;  3TAQ A;  4RW6 A;  1X9W A;  4LY7 A;  5HRR A;  2G8F A;  4B8C A;  3D0P A;  2OZM A;  3V9U A;  1TK8 A;  3V81 A;  4DFM A;  5C25 A;  4G1Q A;  3SQ4 A;  2XO7 A;  3MXJ A;  1X9M A;  4Z0U A;  1VSL A;  3L8B A;  2G8K A;  4ELT A;  1WSE A;  4CFC A;  1N6Q A;  4DSL A;  4KHQ A;  4QCL A;  2KFZ A;  2YHB A;  4FW2 A;  1ASW A;  4DQQ A;  1VSE A;  4F3O A;  1RBV A;  1RTI A;  4DSF A;  3DYA A;  2WOM A;  2IS3 A;  1VRT A;  3K5N A;  3PX0 A;  1JXE A;  4C8O A;  4E1M A;  3VQ4 A;  4DTO A;  4PUO A;  4DQI A;  1LW0 A;  2HB5 A;  2RPI A;  4XIU A;  4QOZ B;  4JS5 A;  3V1R A;  3MEC A;  2G8H A;  2IDO A;  2YV0 X;  3L3V A;  4GW6 A;  3VA3 A;  3U3Y A;  1J9A A;  3SZ2 A;  3G10 A;  3AA3 A;  4FJ5 A;  3ZSY A;  3V6D A;  4M3T A;  1WAJ A;  4KHN A;  3ULD A;  4DMN A;  4LH4 A;  4FK0 A;  4C8K A;  3V9X A;  1VSD A;  1TL1 A;  3CFR A;  2PYL A;  2YNI A;  1TKX A;  4M3R A;  3CFP A;  4FW1 A;  3KTQ A;  4FJX A;  4E19 A;  4CEQ A;  4OLA A;  4E89 A;  3OYC A;  3I0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...