4KB0A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion cc )
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
b'LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb0A00
2OPRA 4M3RA 1WSIA 1HYSA 1CLQA 5J2PA 4C8KA 3DMJA 1TGOA 3AO2A 3VQDA 4CEQA 4E7JA 4CEOA 3HP9A 3OS2A 3ZSQA 3QIOA 1WSFA 1RDAA 3KLGA 1N6QA 3T3FA 3QEVA 3NH2A 2EX3A 1WSHA 4CGHA 2LSNA 3SQ2A 1RTIA 4KTZA 1B9DA 2WONA 2YKMA 3ITHA 3MEEA 3VQ5A 4Z4HA 4F2SA 4GVMA 1KVCA 3LZJA 1SL1A 3I8DA 3SV4A 3L8BA 4OKKA 4CHOA 3EZ5A 1VRUA 1YTUA 3QETA 3OYFA 4FLZA 4IDKA 2YNIA 1W9HA 2ETJA 4CE9A 4CJPA 2O4IA 3P5JA 4Z4GA 1TKTA 4FW2A 4CIFA 4BWMA 4E7HA 2XY5A 1KLNA 2X74A 4FM1A 5CYQA 1JLEA 2IS3A 3QERA 2HB5A 3I0RA 1JLGA 4FCYA 1QSSA 2FBYA 2F96A 3DOLA 3F9KA 4MFBA 3U3GA 4CJ3A 4CJSA 4FJXA 1HQUA 5HROA 2OPPA 2BANA 3HPOA 4DTOA 4G1QA 4N5SA 3PX6A 2G8WA 4FLXA 2BGGA 3OYAA 4ZTFA 3OJUA 1IO2A 5CY4A 4KO0A 3QEXA 3DRRA 2JGUA 4GW6A 3QEWA 5JS2A 2IGIA 4M45A 3KJVA 4B9UA 3OVNA 5KRSA 4CHNA 2HW3A 1D9FA 1U47A 3L2RA 4M3WA 2IOCA 1NJZA 3RTVA 4E89A 1LWFA 2HMIA 1KFSA 4AHSA 4DQQA 4DWIA 2YNGA 1TV6A 3ZSZA 1RTHA 4FLWA 1T05A 3NBPA 3TAEA 4F4KA 1BISA 4FLYA 4M3YA 3CM5A 3NGYA 3QNOA 1BHLA 4H4OA 4WE1A 4CJRA 3KD5E 4FJKA 3JYTA 1YVUA 3AA2A 5K14A 3C95A 3G0ZA 1NK5A 2YHBA 3O3HA 4OPJA 1NK7A 4FLVA 4DG1A 4AH9A 4Z4FA 3OYLA 3TABA 4RW6A 1WLJA 3ZSXA 1EX4A 1GOBA 4HHTA 1N5YA 4KHWA 1C1CA 4CJEA 4BWJA 1T03A 4FJGA 5CZ1A 3T19A 3HP6A 1ASWA 1C0UA 4CEEA 3OY9A 3P83D 2XY7A 3M8RA 2A1SA 4RW7A 4J2AA 1JLCA 4CK1A 3SPYA 4HVJA 1RTDA 2P51A 3SZ2A 5HLFA 4BACA 1HJRA 1QE1A 4LSNA 1A5WA 3DYAA 4HCCA 4I2QA 3MAQA 3VQAA 1C1BA 1L3VA 3LWLA 3K5NA 1NJYA 3C6UA 5KRTA 1I39A 3AO3A 1VSKA 3RMDA 1WAJA 4OGEA 3HPHA 4DLGA 1RT1A 4DFMA 4CFDA 4DF4A 1JL2A 1L3SA 1ZBUA 2VWKA 2G8HA 1IH7A 4DFKA 1ZBFA 1LW2A 4M3ZA 3QINA 4DTSA 3F73A 2FC0A 3WNEA 4KV8A 4N47A 4JRPA 2OA8A 5HRPA 2PY5A 1QS4A 5FDLA 3NDKA 2KTQA 2KW4A 3OS0A 2YNFA 4AHUA 4KRFA 2HHSA 4K8XA 3K57A 1VSMA 4CGJA 4OPKA 3NGIA 4AILC 3QNNA 4LH4A 3OYHA 4NCGA 2BE2A 4EZ9A 4NYNA 3FFIA 4DSKA 1EKEA 1SUQA 1VSLA 3M8PA 3ZSRA 1EP4A 3NAEA 3HO1A 1O1WA 4CFCA 2XY6A 2F8SA 2ATQA 2KZZA 3V1RA 4DQSA 1WSGA 4KB0A 4Z4CA 1FKPA 1TK5A 4N56A 1UOCA 4HUEA 4CEZA 2D0BA 3AVMA 5FRMA 3ZCMA 1BI4A 3NF6A 3AVBA 3KD1E 1I3AA 3OYMA 1KRPA 5KGXA 3WNGA 1JLFA 4OKJA 4DQIA 3S3MA 1NK0A 1C0TA 4PWDA 4C8OA 3E01A 1BI4B 4E7KA 5FRNA 3TWHA 2XO7A 3RRHA 4JS4A 3VQEA 4HUGA 3LPUA 4RW8A 4FJ7A 1LWCA 3QLHA 3V9UA 5J2MA 1D5AA 3LANA 2OPSA 3V6DA 4FK2A 1WSEA 3SQ1A 3DRSA 1DTTA 3ZSVA 3SYZA 1BGXT 4QAGA 3T1AA 3OJSA 3V4IA 3DM2A 2HHXA 1IKYA 3AVCA 2QK9A 3QEPA 1FXXA 1ZBIA 4NYFA 1T8EA 1RILA 2DFHA 1Y97A 3IS9A 3KKSA 2FBVA 3V9SA 3AVLA 4B3OA 3PY8A 4FZYA 4B8CA 4E7LA 2YHAA 1NJWA 5I42A 3SUOA 4E19A 1BIZA 2IAJA 3I0SA 4N76A 3MEGA 4CIGA 4C8NA 1KFDA 1WN7A 4RG8A 2VG6A 4DU1A 5D3GA 1W0HA 5J2QA 4Y1CA 3CFOA 4DU4A 4O0JA 1VSIA 3KIOA 3AVJA 4OVLA 4W5OA 3V9XA 4CK3A 1NK9A 3QO9A 2GV9A 2QKKA 3TAQA 4FYDA 4IG3A 1S9EA 1X9SA 3AVIA 1LAWA 3VQ7A 1NOYA 1HNIA 1HYVA 1WSJA 2Z1HA 4CEBA 3LDSA 2DY4A 2HVIA 1YTAA 3IG1A 2X6NA 5KI6A 3NH0A 3HM9A 2G8KA 3A2FA 3NFAA 3SI6A 4PA1A 3MXJA 1SKRA 1S1UA 3L2QA 3B6PA 4B9VA 1JXBA 1XC9A 2HHWA 4CEFA 3DLBA 1T7PA 3KTQA 3JSMA 3LP2A 4CERA 4CF9A 2D0AA 3KK2A 1VSJA 3AA4A 3TAFA 3CQ8A 1NK4A 1ZBLA 1L3TA 1JLQA 1S6QA 3KLFA 3G10A 3PUFA 2FBXA 1TKZA 4AHRA 1JLBA 5I3UA 1SL0A 1YT3A 3NHGA 1HNVA 3DLGA 5CYMA 5SWMA 4DTMA 4DTJA 4DTPA 3TARA 3AA3A 3K59A 1SKSA 3CM6A 4H4MA 4B8AB 1TL3A 1A5VA 1FK9A 2AJQA 3LPTA 3MECA 4H8KA 4AHVA 4IFVA 4DSFA 4CHPA 4CJKA 4DSLA 4YNQA 2FBTA 1RT6A 4W5TA 4DLEA 1VK0A 3AVHA 1QQCA 3VQBA 1U49A 3SQ0A 1RBRA 4FJHA 2PYLA 4BDYA 4O44A 4MQ3A 2E4LA 2HVHA 1XHXA 4BDZA 3AVAA 4PUOA 2IC3A 4O55A 1Q9XA 2HNDA 1BL3A 2P5GA 4CJ4A 1RT4A 2OZSA 1BQMA 1RT7A 3TI0A 4F8RA 4ID5A 3O3GA 3LP0A 2G8VA 4B9TA 4KTQA 4IFYA 4E0DA 3QIPA 3S9HA 3VQCA 1X9WA 2I5JA 1VSHA 4KREA 1FKOA 2O4GA 1VSEA 3SV3A 4KI4A 4KKOA 4AHCA 4KI6A 2HNYA 3RR7A 3PO5A 2P5OA 2D0CA 3AVGA 3AO5A 3KKRA 1XHZA 1ZYQA 1J9AA 1UA1A 3HSTB 3MEDA 3VQQA 1RT5A 4FXDA 3EY1A 4E1NA 1IKVA 3AVFA 3TAPA 3HJFA 1SV5A 3HXMA 4FJ5A 4IBNA 1BIUA 4AHTA 4ZTJA 2GBZA 4OGCA 4YFUA 1TVRA 2ITGA 3IAYA 4FJIA 3V1QA 1RDDA 1S1TA 5EU7A 1IKXA 4C8LA 4ELVA 2ZE2A 4EZ6A 3OYEA 4CHZA 1UAXA 1B92A 3L3UA 1RDCA 1UWBA 2Z1GA 3CFPA 1TKDA 4CCHA 3NF8A 1JKHA 4Z0UA 2YV0X 2GUIA 3QEIA 2B4JA 3ULDA 1C6VA 1IG9A 3BDPA 2P1JA 4ZHRA 2OPQA 3VQPA 2PZSA 3VN5A 3CYMA 3AVNA 2KFZA 4ICLA 3HVRA 4HUFA 4KHYA 4CJVA 2DTUA 1LW0A 3HVTA 3OYBA 3WNHA 1G15A 1NKBA 4NCBA 1WAFA 3NE6A 4O0IA 2D5RA 4FJNA 1KTQA 1UA0A 2XY8A 3LALA 4E7IA 4FVMA 4JS5A 1RDBA 4CJ5A 4EP4A 4E1MA 4DF8A 1U48A 1X1PA 4FK0A 1C0MA 1IKWA 2Y1IA 5HP1A 1JLAA 3LP1A 3K5MA 3U3YA 2QXFA 3SUNA 3NF9A 3H08A 4CESA 4B9SA 1CZBA 4CFAA 4KHUA 4DQPA 4DTRA 1VRTA 4I7FA 3MXMA 1TK8A 1EETA 4CJWA 3TAGA 4GMJB 4M42A 2E6LA 1S1XA 2RPIA 1X9MA 3KLHA 4TSXA 4O4GA 4BE0A 1L5UA 4ID1A 4BE1A 1U4BA 4B08A 4BE2A 1S9GA 4PY5A 1U04A 1XWLA 3WNFA 4EP5A 1A5XA 3THVA 1J54A 1RBUA 3IRXA 3VQ9A 3K5OA 3VA0A 3SUQA 2QKBA 3RR8A 1REVA 3SNNA 1LWEA 1S5JA 4OLBA 1VSDA 4Q5VA 1QSLA 1TK0A 1U45A 1RTJA 2YKNA 3VA3A 1QSYA 1SKWA 2ZD1A 3L2VA 1RNHA 3RMCA 2XHBA 4PQUA 2VG7A 4IG0A 4DTUA 3C94A 1QHTA 1KCFA 4CGGA 3ZSYA 4DQRA 3VQ8A 1D8YA 3DOKA 4FK4A 5KTQA 3KK1A 4I2PA 4Z4IA 4CIEA 2HHUA 3O4NA 4LY7A 4CF1A 1DTQA 1K6YA 2ZQBA 3LAMA 1BQNA 3DLKA 4KB1A 4W5RA 4J2EA 3V9WA 4IKFA 4KPYA 1RCHA 1HMVA 4KAZA 4FZXC 2DFEA 3PX4A 4OKEA 1RT3A 3OYDA 3DI6A 5HRRA 4F3OA 4FLTA 2VG5A 2G8UA 4CJFA 3BGRA 4Z4EA 3HL8A 4KFBA 4CEAA 1LV5A 4HTUA 4F2RA 3OYNA 4DSEA 1NK6A 3OYCA 3OYIA 4K8ZA 1ASUA 5J2NA 3KLIA 4Y1DA 1NOZA 1Q9YA 2Q3SA 2W42A 1EXQA 3TR8A 3M8SA 1B9FA 4FLUA 4M3UA 3DRPA 3L3VA 4LD0A 3TAMA 4FJ9A 1CZ9A 3EYZA 2XRIA 3D45A 4CGIA 4B9NA 4KHNA 3DLHA 4ELUA 1RBVA 1LAVA 3ZT0A 3OYKA 4DTXA 3ZT4A 3SUPA 4DMNA 3KLEA 2HHQA 4CGFA 4Q0BA 1RT2A 1HRHA 1MU2A 1HQEA 3V1OA 4OJRA 3VQ6A 2A1RA 4I9QA 3S3NA 3SPZA 5JS1A 1BCMA 3ZT2A 2KFNA 4DFJA 4CHYA 2HHVA 3VQ4A 5SZTA 2WOMA 5KGWA 1S1VA 3OYJA 3L2UA 3K5LA 4FJMA 4W5QA 3PX0A 3NF7A 3D0PA 4DU3A 1RBTA 5HRNA 3L2WA 5J1EA 4CJQA 3NH1A 5FROA 4M3XA 1GOAA 3TANA 3LZIA 3U6FA 5C42A 4FM2A 4QOZB 2X78A 3DLEA 4CK2A 2VWJA 2PYJA 3V9ZA 2G8IA 3LWMA 1F21A 4E3SA 2R7YA 4UQGA 2NUBA 3OYGA 3PV8A 3ZT1A 3SCXA 4DS4A 2Y1JA 4RW9A 4BDPA 4J2BA 1SL2A 4ELTA 2IDOA 1Z25A 4FM0A 3QESA 3RMAA 2OZMA 1J5OA 3K58A 3B6OA 4KHSA 1KVAA 3PO4A 3DLRA 1ASVA 1TL1A 4DS5A 3OS1A 4CF0A 1TAQA 4HCBA 3KK3A 4CHQA 4OLAA 1J53A 1TAUA 5E41A 2B5JA 5T7BA 3SQ4A 4JLHA 4KHQA 1CXQA 2EHGA 1NK8A 2Z1JA 2E6MA 4F3TA 1ZBHA 2KZMA 4DSJA 3ZSOA 3C6TA 1JL1A 4FZZA 4M41A 2RKIA 4LH5A 5C24A 3LAKA 4KTWA 4L8RB 3MXIA 1Q8IA 2YNHA 4C8MA 5C25A 4M3TA 4B9LA 4J2DA 4CGDA 2HNZA 4CFBA 3K2PA 3HPGA 4W5NA 4DTNA 4CF8A 4QCLA 1DLOA 1CXUA 1S1WA 5CZ2A 3NGZA 2BDPA 3HK2A 5DMRA 3CG7A 1HPZA 4FJ8A 3M8QA 5DK5A 3ISNC 3RWUA 3SJJA 1KVBA 1WNSA 4LSLA 4O5BA 3ZT3A 1R0AA 4FW1A 1RBSA 4CF2A 1C1AA 2KQ2A 1KLMA 3HT3A 3AO1A 4R5PA 4DFPA 4CEDA 4RW4A 1L3UA 3NCIA 4XIUA 4DSIA 1ITGA 1TKXA 2F8TA 2B6AA 1Z26A 2Z1IA 3V81A 4N41A 1XI1A 1D9DA 4FJJA 1GOCA 4NCAA 3AO4A 3RRGA 2HHTA 2OYQA 3RMBA 3P1GA 4JRQA 2G8FA 4I9LA 1NJXA 1S6PA 2DFFA 1KSPA 1JXEA 1QTMA 1NKEA 3O4QA 4CJLA 3AV9A 5HRSA 2RN2A 3UIQA 3LP3A 4B9MA 1HYZA 3ALYA 4CJTA 2X6SA 1BCOA 3O3FA 2RF2A 5HBMA 4FJLA 4CECA 3ASMA 2JLEA 4CJUA 3ZSWA 3S3OA 1NKCA 3AVKA 3HYFA 1VSFA 3AA5X 3CFRA
chains in the Genus database with same CATH superfamily
2OPRA 5M1PA 5J2PA 4C8KA 1TGOA 4CEOA 3OS2A 1JJ2M 1RDAA 3KLGA 1DT9A 3QEVA 1H1VA 2WUSA 2ZJQL 5FPMA 3FZHA 1P90A 3LZJA 1KD1O 4OKKA 4QS9A 2FSKA 1YTUA 4IDKA 2ETJA 1BA1A 3P5JA 4Z4GA 4CIFA 2A6AA 2X74A 2E5LK 4PKIA 3HOSA 3U3GA 3DOLA 3F9KA 3VEZA 3CXCM 5HROA 3CCJN 4B1WB 3EKSA 4LF7K 3HPOA 4ZTFA 3F9MA 4BY9C 1MWMA 4FWMA 1NJIO 3QEWA 1EQYA 3L2RA 2IOCA 2GWKA 4E89A 1KFSA 5AQUA 3J8AA 2YI1A 5BR9A 4JKEA 3WXIA 3UB5A 3KD5E 1JCGA 1K8AO 3JYTA 1X3MA 2O8FA 5K14A 5JLFA 1BA0A 2P9LB 4AH9A 4Z4FA 3TABA 2O8FB 3ZSXA 1GOBA 5AR0A 1VQ6N 4YOTA 3I56N 1U2VB 1YJ9N 3T19A 3HP6A 2PAVA 4J2AA 5E84A 3THYB 4FOEA 4LSNA 2VCPA 4I2QA 2ASPA 2QEXN 4DV2K 3LWLA 3K5NA 4GV6A 1WBBA 3AO3A 4DHYA 4OGEA 1RT1A 4CFDA 2ZJRL 2G8HA 3VESA 4DTSA 2P9NA 3FR0A 3GOIA 3G71N 1QS4A 5FDLA 2P9NB 4WQ5A 3K57A 4H5RA 2ITMA 1IJJA 4EZ9A 3FFIA 1SUQA 1JCFA 3ZSRA 4GKKK 3N4QA 1HNZK 4C1NI 1UOCA 3SBTA 4CEZA 2D0BA 5FRMA 3WNGA 1JLFA 4OKJA 4BRAA 3R9PA 3BY5A 4CW7B 2UXCK 1C0TA 2ZWHA 4WQ5C 1NGAA 3LDPA 3RRHA 4WQ4A 3QLHA 2OPSA 4DV4K 3A5MC 1EWRA 4JI2K 3ZSVA 1BGXT 4QAGA 3T1AA 1IKYA 2P9IA 3QEPA 3CPEA 1RILA 3IS9A 2FBVA 4B3OA 4E7LA 1QVFM 3VEOA 3FE1A 3SUOA 4BGBA 4E19A 2IAJA 4N76A 3E9PA 4C8NA 1KFDA 5DM7L 4O0JA 4JKCA 1VSIA 1GLBG 5F0XA 1WUAA 3AAPA 2GV9A 3TAQA 3GE1A 1X9SA 3UE5A 4PL8A 4CEBA 3LDSA 3O6WA 5AQZA 3EEQA 1QQOA 3IG1A 5KI6A 1OKJA 2G8KA 3NFAA 5DM6L 5CE3A 2OTJN 1XC9A 3G6EN 2GX9A 3LDNA 4CERA 3TAFA 1NK4A 3U8XA 2HSTA 3PUFA 1XMOK 1TKZA 3DWLA 4BRFA 4DTMA 4DTJA 3TARA 3K59A 1M90O 1A5VA 1FK9A 2JWLA 3MECA 2YHXA 3MX5A 4DSFA 4DSLA 3O9SA 2FBTA 4JNEA 1XQSC 2NRVA 4W5TA 1KAZA 4DLEA 4BRLA 1RFQA 3H46O 3SQ0A 1RBRA 5EVZA 3FLCO 2GUPA 3EO3A 3AVAA 2IC3A 1Q9XA 4CJ4A 1RT4A 1BQMA 1RT7A 4ID5A 3O08A 3QIPA 3S9HA 3MMVA 2O4GA 1VSEA 3ZETA 3SV3A 3TTCA 3IUCA 2HNYA 1OH7A 2D0CA 1ZYQA 2E20A 5H1SQ 1HKCA 1RT5A 4BG9A 2E2PA 4GV3A 1SS6A 1NGIA 4OGCA 3IAYA 3K9KA 1RDDA 4BR5A 4WYBA 4C8LA 4BQLA 4ISFA 4ELVA 2ZE2A 2BTFA 3M1FA 4CCHA 3QEIA 3E66A 3CC4N 3BDPA 4ZHRA 3VQPA 3CQYA 3A8YA 3R3LA 4KHPK 2D1KA 1XNRK 3HVTA 3TPQA 4FJNA 4IOXA 3ZX2A 1Q86O 1UA0A 4BRHA 4CBWA 4E1MA 1X1PA 4FK0A 5JVGL 5M1FA 3MN6A 1JLAA 3O9UA 5HP1A 3NF9A 2YJFA 5GADP 1WOQA 5AQFA 2W6KA 1VRTA 3MXMA 1EETA 4CJWA 4M42A 3GDQA 2ZJPL 1L5UA 4MLHA 4BE0A 4UY8O 4ID1A 1S9GA 5LMNK 4DUYK 3CCSN 2QM1A 1A5XA 1NMDA 4YOWA 3THVA 1RBUA 3FZFA 4LFBK 3VQ9A 1K73O 2O8CA 3D2EA 4EIAA 1U45A 3FZKA 1XUPO 2YKNA 3CCQN 3L2VA 3D2EB 4DR7K 4B3MK 1D8YA 3VQ8A 4FK4A 2E8AA 4LF8K 5LJVA 4LY7A 4CF1A 4KB1A 3DLKA 3V9WA 1RCHA 3CJBA 4KAZA 3DI6A 2UUCK 2NRZA 4Z4EA 4HTUA 2VGMA 1NK6A 5F1XA 4Y1DA 1NOZA 4BC4A 3C0BA 2Q3SA 4JEPA 2W42A 3TR8A 4BRMA 3L3VA 3TAMA 3EYZA 4KHNA 2XRIA 3D45A 4IXCA 4CGIA 3DLHA 3OYKA 4DTXA 3JAMO 3VETA 1BG3A 3KLEA 4Q0BA 3TTFA 1HRHA 4IJAA 3ZT2A 4CZKA 4BR9A 5KGWA 3JS6A 4W5QA 4DU3A 1HKBA 5J1EA 4O5FA 2Q97A 4H5VA 3TANA 1E4GT 3LZIA 3U6FA 2OANA 1GLEG 4QOZB 3LWMA 4MO4A 4E3SA 4QS7A 4UQGA 3CQXA 3SJHA 3OYGA 3SCXA 3VF2A 2Y1JA 1SL2A 2IDOA 2OZMA 5BPMA 1KVAA 1SZ2A 3KWGA 2H3GX 5EY4A 1J53A 3SQ4A 4XH5A 4F3TA 1ZBHA 3O1WA 4LH5A 4KTWA 2RE2A 2YNHA 1VQKN 4B9LA 5GIPA 2HNZA 3HPGA 4AQYK 4DTNA 4QCLA 3BF3A 3CCLN 4JYAK 2BDPA 4A2AA 3M8QA 5AQRA 1QZ5A 3QMLA 1R0AA 4FW1A 1RBSA 4JK8A 4DFPA 3UKUA 4DSIA 1TKXA 2O8EA 1Z26A 2YCHA 1GLLO 1XI1A 1GOCA 3RRGA 3O5BA 2G8FA 4JRQA 5AQTA 4BR7A 2DFFA 3O4QA 4MDAA 4CJLA 1GLFO 3LP3A 2X6SA 1BCOA 3O3FA 3O4WA 4CECA 4BR2A 5I9EB 5ADXH 3J80O 3U9DA 1VAZA 3CFRA 1HYSA 1O13A 1CLQA 1T3VA 3VQDA 3AO2A 1HNXK 1R59O 3ZSQA 4BRQA 2EX3A 2UXBK 3BP8A 4CGHA 4G9ZA 2WONA 2FXUA 2YKMA 3MEEA 3O80A 3VQ5A 4Z4HA 4F2SA 4GVMA 1KVCA 1SL1A 3SV4A 3L8BA 3EZ5A 3D2FB 3MN5A 5LY3A 3S41A 2YNIA 1SAZA 2QI2A 1G99A 4KH4A 1N36K 2XY5A 5CYQA 2HB5A 3I0RA 5BRDA 4JI8K 4A2BA 3DLLL 2F96A 4CJ3A 4CJSA 4MFBA 5AFUH 3PX6A 4FL9A 4FLXA 3NVKA 3OYAA 3I33A 4KO0A 3QFPA 4ISEA 3M3ZA 3CMAN 1YI2N 3UKRB 2IGIA 2QWOA 4B9UA 1TYQA 3OVNA 1WB9A 4CHNA 4FPBA 1IBMK 4BVOA 1NJZA 3AGKA 3VEVA 1LWFA 1TYQB 4AHSA 1KAYA 3SAFA 3KWIA 3IFRA 4C1NK 2NRTA 3NBPA 1RGIA 3TAEA 4M3YA 1BHLA 1YVUA 5M1QA 3CC7N 1ZC6A 4RW6A 2A41A 4KHWA 1N5YA 1C1CA 1T03A 5CZ1A 4IJNA 1C0UA 5AZJB 3M8RA 4RW7A 1K8KA 1HJRA 4MDBA 3DYAA 4HCCA 1K8KB 1U6ZA 2ASOA 3HRGA 3A5OC 3U4LA 1VSKA 3RMDA 1WAJA 3HPHA 4DLGA 1L3SA 1JL2A 4A5BA 2VWKA 1IH7A 2PFUA 4M3ZA 2Q36A 3WNEA 4KV8A 3Q7CA 2E2NA 2KW4A 1MWKA 1QQNA 3RSEA 3H1QA 4CD3A 2HHSA 4LF9K 5LJWA 5C10A 3NGIA 4AILC 3QNNA 4F9OA 3AAQA 2VQFK 3RSEB 1V4SA 4NCGA 4IEEA 4DSKA 1EKEA 3QDKA 4CFCA 3V1RA 4Z4CA 4N56A 1HLUA 3ZYYX 1SQKA 4HUEA 2P9PB 2Q0RA 3OTOK 4JI6K 1DKGD 1I3AA 1KRPA 3KD1E 1NK0A 4PWDA 1YHQN 2EWSA 4JS4A 2HBMA 1LWCA 3V9UA 3IMXA 1VQ5N 2QXLA 1VQPN 3SQ1A 3NVMA 1KAXA 2UU9K 1FXXA 1I94K 3AVLA 1FW6A 4B8CA 4LFAK 3CC2N 1NJWA 5I42A 1BIZA 2E2OA 3I0SA 3A5LC 4RG8A 2E1ZA 4ILJA 1VQ9N 4DU4A 3THWA 4H5TA 3V9XA 3QO9A 1TUYA 2UUBK 2QKKA 4IG3A 3THWB 1LAWA 1NOYA 1HNIA 3VEYA 1HYVA 1WSJA 2Z1HA 4IO9L 3H1VX 2HVIA 3A2FA 3SI6A 4PA1A 3WXLA 1S1UA 5GIOA 1IV0A 4B9VA 1JXBA 1NGBA 4CD1A 3KK2A 1VSJA 1JLQA 3KLFA 3AA3A 3CCUN 1SKSA 1NM1A 2W41A 4H4MA 4B8AB 1TL3A 2AJQA 4H8KA 1HPMA 4YNQA 5JVHL 4DR2K 1VK0A 1IBLK 3SMSA 1QQCA 3VQBA 1U49A 4X66K 4O44A 4MQ3A 2E4LA 2HVHA 1DEJA 3KK7A 4BDZA 4PUOA 3LDLA 2HNDA 3CJ7A 2P5GA 1NLVA 3TI0A 4BC3A 3LP0A 2G8VA 4B9TA 4OX9K 2I5JA 4KREA 3KHYA 1FKOA 2QWMA 4KI6A 4WFBL 1C0FA 2P9SA 2P5OA 1XHZA 3MWPA 5FPDA 3MEDA 3MN9A 3PSFA 3VQQA 3HZ6A 2P9SB 4H5WA 3TAPA 3AVFA 3HJFA 3HXMA 2CGLA 4ZTJA 2GBZA 4B3SK 2ITGA 3LDOA 4FJIA 1VHXA 1S1TA 4H0OA 4CZIA 3P31A 2HHXA 1UAXA 1B92A 3CJ9A 4GY2B 1LOTB 2YJEA 2NRWA 1W2BM 3NF8A 3ENOA 2A3ZA 2YV0X 2GUIA 5AQXA 4Z0UA 5MLCQ 4LF6K 3DXMA 4CVNE 2OPQA 1S3XA 3CYMA 3DXMB 4NB4A 4B1VA 4EHTA 4JI7K 4KHYA 2DTUA 3WNHA 4NCBA 3VTHA 3NE6A 2D5RA 3EZWA 4CZLA 2XY8A 4FVMA 5AQWA 1U48A 4DF8A 5F2RA 5M1KA 2NZTA 3LP1A 3K5MA 3SUNA 4B9SA 2QXFA 4KHUA 3B8AX 4CFAA 3VGLA 2HBKA 3MCAB 3H3OB 3TAGA 1S1XA 5E26A 3KLHA 3Q7BA 3N4PA 1U4BA 4B08A 2FF3B 2QWRA 3IRXA 2P9IB 3IDHA 2QKBA 3HSCA 1REVA 1S5JA 4OLBA 1VSDA 1RNHA 2XHBA 2VG7A 4IG0A 3L4IA 1QHTA 4CGGA 4NXNK 3DOKA 1TUUA 4FWLA 1W7AA 2HHUA 5JICA 3LAMA 3QICA 4H0YB 4K43A 3O9QA 2W6LA 4KPYA 2NRXA 4OKEA 2KKZA 1RT3A 1DGKN 4CJFA 1LV5A 3OYCA 3A0IX 3OYIA 3DAWA 1Q9YA 2QWLA 3TSUA 1QQMA 1B9FA 3ENHA 3OW2M 4K0KK 1CZ9A 4B9NA 4BRIA 1RBVA 3ZT4A 4K25A 2D0PA 4OJRA 1LCUA 5JS1A 1BCMA 3VQ4A 5JLHA 2UUAK 2D0OA 1M1KO 5C15A 3HI0A 4CBXA 5FROA 3A5NC 2ZGZA 4NXMK 4FM2A 2X78A 2VWJA 3BEXA 2G8IA 3ZETB 2R7YA 3PV8A 2NNWA 3WT0A 4DS4A 3CI5A 4BDPA 5LL6Z 5BPLA 4IOAL 3T1YK 3RMAA 3K58A 1OVQA 3DLRA 1Q81O 4HCBA 4XEIA 3ZEUA 4AM7A 5T7BA 4JLHA 2Z1JA 1YVNA 4CZJA 3ZSOA 2RKIA 5GAGP 2CGJA 4BRCA 4ILGB 4NO7A 3P39A 4J2DA 4H5NA 5BPNA 1YITN 4J8FA 1GLAG 1CXUA 5CZ2A 5AQHA 3CG7A 1HPZA 4FJ8A 3E9LA 5DK5A 3ISNC 4U67L 4O5BA 3TSPA 2I7NA 1C1AA 1KLMA 4R5PA 1L3UA 4DCHA 1ITGA 2F8TA 3AO4A 2HHTA 2KLAA 4FO0A 3RMBA 1VQMN 4I9LA 1Y64A 2RN2A 3UIQA 1HYZA 3ALYA 2RF2A 2JLEA 4YOYA 5C0YA 5LMUK 3J81O 1WSIA 1NGGA 2O8CB 3DMJA 3T69A 3MDQA 4CEQA 2Q1NA 4LF4K 5ELZA 3ULEA 1WSFA 5AZIA 3NH2A 1WSHA 3SQ2A 4M63C 3AY9A 1RTIA 3HBTA 4KTZA 3ULEB 3ITHA 3H6EA 5AZIB 2IVNA 5A2QO 1V4TA 2E88A 3OYFA 4CI6A 1QZ6A 1W9HA 4CE9A 1EO1A 4CJPA 2O4IA 1TKTA 4BWMA 4E7HA 3R1XA 1KLNA 2UXDK 4FM1A 1JLEA 3HTVA 2UYTA 4FCYA 4FJXA 2FBYA 5KPZA 4DUZK 1S72N 1HQUA 3HOTA 2BANA 4G1QA 4PKHA 2G8WA 4GVEA 5M1OA 1HR0K 2JGUA 4GW6A 3F5TA 1N32K 1YUWA 3KJVA 4BC2A 2HW3A 3K0SA 1D9FA 1U47A 3RTVA 4L3QA 2HMIA 4B1YB 2YNGA 1TV6A 1RTHA 3J7ZO 4FLWA 3C65A 3CM5A 3NGYA 4PHTX 3EN9A 4H4OA 4WE1A 4JKGA 4CJRA 4ILHA 3C7NA 3R6MA 3FFKB 3AA2A 3C95A 4A57A 3G0ZA 1NK5A 3LM2A 4JKGB 5KPTA 3O3HA 1NK7A 4FLVA 1BDGA 4JI0K 1IBKK 1WLJA 3BUZB 1EX4A 4HHTA 4CJEA 4FVUA 4FJGA 3WXMB 3OY9A 3P83D 2PBDA 3CERA 2HBJA 4HVJA 3SZ2A 3P4IA 1A5WA 4BR0A 1C1BA 1L3VA 1NJYA 3C6UA 5KRTA 1I39A 3SBGA 3CHWA 2V7ZA 1ATRA 4DFMA 1ZBUA 4DFKA 1LW2A 2DPNA 3P38A 5AJ3K 3EL2A 3F73A 4N47A 2P9KA 4JRPA 2OA8A 5HRPA 2PY5A 3NDKA 3OS0A 4AHUA 4KRFA 4YDUA 4Z94A 4AF1A 4XH1A 3OYHA 1T6CA 2BE2A 3CJ1A 4NYNA 4JK9A 3SK3A 3VENA 3CJAA 3M8PA 5AQVA 3NAEA 4B3TK 3HO1A 4DR6K 3UKUB 1O1WA 4Y0WA 2F8SA 1RDWX 2O8EB 2KZZA 4FWNA 5BR8K 1TK5A 3C6HA 3L0QA 3AVMA 4BC5A 1JCEA 3AVBA 3PLAA 3OYMA 4DQIA 1BO5O 5BRFA 2FSJA 4E7KA 4C8OA 4FWSA 4YDUC 5FRNA 3TWHA 1X3NA 2XO7A 3WEEA 4FJ7A 4RW8A 4BRPA 1WSEA 5C2FA 1DTTA 4DV6K 2JWKA 3SYZA 3DM2A 3AVCA 2QK9A 1ZBIA 4EFHA 4NYFA 2WC9A 1Y97A 2Q31A 3IKMA 2YHAA 4DR3K 5FPEA 5D3GA 3MEGA 1YF5L 4CIGA 2O8DA 2VG6A 5AQPA 4LF5K 2V51B 4DR1K 1ZBSA 3AVJA 4CK3A 1OH8A 2D4WA 3VQ7A 1OH6A 3HM8A 2F4VK 1NBWA 4DV7K 3H3NO 1YTAA 5AQOA 3WXKA 3HM9A 3MXJA 3L2QA 4KH5A 4CEFA 3DLBA 3KTQA 4CF9A 2D0AA 3AA4A 3CQ8A 3BZCA 1S6QA 3G10A 4RTFD 2FBXA 3L4QA 5M1NA 1JLBA 1SL0A 5BN8A 1EWQA 3DLGA 5CYMA 5SWMA 4DTPA 4EHUA 1YJNN 5FPNA 3LPTA 4IFVA 4CJKA 1RT6A 3VGKA 4LFCK 4WF9L 3AVHA 4FJHA 2PYLA 4BDYA 1XHXA 4IWVA 4O55A 5TKYA 3CCVN 5B8HA 5C2DA 4F8RA 3O3GA 4KTQA 4GV9A 4IFYA 3ZLJA 4E0DA 1X9WA 1VSHA 5AQLA 4DB3A 4IOCL 4A5AA 4YOUA 4IDHA 3PO5A 2Q2RA 4FWOA 3AO5A 1J9AA 1UA1A 5AQMA 4I6MA 3HSTB 3PIOL 3QBXA 4I6MB 1BIUA 4AHTA 2F9WA 4YFUA 1TVRA 1ILYA 3O1BA 5TKWA 1IKXA 3L3UA 3CFPA 1UWBA 2Z1GA 4PL7A 1C6VA 2P1JA 1HX1A 4JI4K 4DR5K 2PZSA 2WFBA 4B1XB 4NLBA 1GLDG 2GELA 2OCEA 3AVNA 3SAHA 3VGMA 4ICLA 3HVRA 4HUFA 4CJVA 2FF6A 4JKFA 4FWRA 5GAEP 4EP4A 1C0MA 1NU0A 1IKWA 3QFUA 3U3YA 3H08A 4CESA 3FGUA 4I7FA 4YOVA 1TK8A 4X64K 4GMJB 5GINA 2RPIA 3LL3A 1X9MA 4TSXA 3C6AA 3FZLA 2A42A 4BE2A 1U04A 1XWLA 3VPZA 3WNFA 1W97L 4OPHA 5ADXA 1J54A 4H0XB 4HWIA 4CZEA 3VA0A 3SUQA 3RR8A 4Q5VA 4A59A 2BUPA 1N33K 5EXWA 3RMCA 4PQUA 4H03B 2GWJA 2ZM6K 3C94A 5BRHA 2AA4A 1D4XA 3ENBA 5KTQA 3KK1A 1C0GA 4I2PA 4Z4IA 4OO1J 4B1ZA 1DTQA 1K6YA 2HBLA 4A61A 4W5RA 4FWQA 1CZAN 1YAGA 2AP1A 1HMVA 3OA9A 2DFEA 3AGRA 3PX4A 3OYDA 5KQ8A 4F3OA 1OVYA 4OPAA 2G8UA 3BGRA 5AFUA 4KFBA 4DKWA 4DSEA 4EAHD 1E3MA 1BWFO 3KLIA 4BRKA 3GBTA 2A40A 3M8SA 4FLUA 4JN4A 4JI1K 4ELUA 1LAVA 3ZT0A 3SUPA 4DMNA 2HHQA 4CGFA 2A5XA 4H0PA 1MU2A 3V1OA 3VTIA 4I9QA 3S3NA 3SPZA 2KFNA 4FJMA 5SZTA 1S1VA 3L2UA 3K5LA 4BQZA 3PX0A 3NF7A 3L2WA 4M3XA 4CJQA 3VEXA 1GOAA 1QVGM 2P9LA 4QS8A 5C42A 4IEIA 4WFAL 3SMPA 5C12A 1F21A 2NUBA 1U2VA 3ZT1A 5IWAK 4J2BA 2F7TA 3THYA 3CCMN 3QESA 3B6OA 2YX6A 4BR4A 1ASVA 3AARA 5AQGA 4DS5A 1TAUA 3KK3A 5E41A 2B5JA 4JAXA 4JI5K 1NK8A 2E6MA 3C6TA 1JL1A 5HL7L 2BH1A 3MXIA 4M3TA 4CFBA 3K2PA 1VQON 1DLOA 3HK2A 1S1WA 3R8EA 2QWNA 4DV5K 4JD2A 3RWUA 3CD6N 1KVBA 1MDUB 4LSLA 3GL1A 4CF2A 4JD2B 3HT3A 4CEDA 3NCIA 4XIUA 2B6AA 4N41A 4FJJA 4NCAA 3VOVA 2OYQA 3P1GA 1JXEA 1QTMA 1NKEA 3E1YA 1HJOA 4BGAA 5HRSA 3AV9A 3I55N 2YHWA 4B9MA 3G4SN 4JI3K 4FJLA 5HBMA 4CJUA 3ZSWA 2ZF5O 3S3OA 2IVOA 2VGNA 5HOOA 2RHKA 3HYFA 1VSFA 3AA5X 4M3RA 5IT9O 3O8MA 4JKBA 4E7JA 3LM9A 3HP9A 1KQSM 5BREA 3CCEN 3QBWA 3QIOA 1N6QA 4IZ9A 4DV3K 3T3FA 1S22A 1VQ7N 2LSNA 4O8UA 1B9DA 1N34K 2VWBA 3WQUA 2QWPA 3I8DA 4CHOA 1VRUA 4JV5K 3WQTA 3QETA 4FLZA 1J6ZA 5AQQA 3GG4A 4JK7A 4JHDA 2FLOA 2E1YA 3KZBA 4A62A 4FW2A 4WQ4C 4JHDB 2IS3A 3QERA 1JLGA 1QSSA 2OPPA 4DTOA 2BGGA 4N5SA 1Z05A 4DV1K 3OJUA 1IO2A 5CY4A 5AQKA 3QEXA 3DRRA 4BRDA 5JS2A 3EE8A 4M45A 4FWPA 3TTDA 5KRSA 2HF4A 2F9TA 1BOTO 3NMUA 4M3WA 4LC9B 4BRGA 2GTDA 4MLEA 2QA4N 2GEMA 2IIRA 4DQQA 4BREA 4DWIA 5AQNA 3ZSZA 1T05A 4F4KA 1BISA 4H0VB 4B9QA 4FLYA 3QNOA 1NMNA 2VYPA 2QTDA 5EOYA 1GLCG 2YHBA 3T7ZA 4DQ8A 4OPJA 4DG1A 3OYLA 3BZKA 1NGHA 4BWJA 3CMEN 1ASWA 4CEEA 2XY7A 2A1SA 3D6RA 1JLCA 3PSIA 4CK1A 3SPYA 1RTDA 2P51A 2NRRA 5HLFA 3D7EO 3CETA 1QE1A 4BACA 1NGEA 3M6GA 1VQ8N 3MAQA 3VQAA 3ZEUB 3CCRN 1NGCA 3F2KA 4WFNL 4YY3K 4BVPA 5JMVA 4DF4A 1FJGK 1IG8A 1ZBFA 2V7YA 3DXKA 3QINA 2FC0A 3DXKB 1RDUA 4XH4A 2KTQA 2YNFA 2CH6A 2YHYA 3W3DA 1ATSA 4JKAA 4K8XA 1VSMA 4CGJA 4OPKA 2J4RA 4LH4A 5AQIA 4X62K 1VSLA 1NGJA 1EP4A 2XY6A 2WTUA 2ATQA 4DQSA 3SAGA 1WSGA 4KB0A 1FKPA 4CJ7A 1VQLN 3ZCMA 1BI4A 3NF6A 4IO8A 5KGXA 4FSVA 4U7BA 3S3MA 3E01A 1BI4B 3TU5A 5EX5A 3VQEA 4K42A 3LPUA 4HUGA 2NRHA 3CIPA 5J2MA 4FK2A 1D5AA 3LANA 3V6DA 4FOIA 4FPAA 3DRSA 4JKHA 3OJSA 3V4IA 1T8EA 2DFHA 2QWQA 3KKSA 3V9SA 4K41A 3PY8A 4FZYA 4B1UB 4KI4A 4DU1A 3QB0A 1WN7A 1W0HA 5J2QA 4Y1CA 4HTLA 3CFOA 4CBUA 3KIOA 3OHRA 4OVLA 2HMPA 4W5OA 1NK9A 2P9UA 3RVCA 4ISGA 4V19S 2Q0UA 4FYDA 1S9EA 3AVIA 4YORA 2P9UB 2DY4A 1QHAA 2OTLN 2X6NA 1XNQK 3NH0A 3VEWA 1XC3A 3H45C 1SKRA 3B6PA 3JXUA 2HHWA 3EE9A 1T7PA 3JSMA 3LP2A 1T44A 4KHSA 1L3TA 1ZBLA 4CZGA 4AHRA 1K9MO 5I3UA 1YT3A 3VMFB 1HNVA 3NHGA 3VF4A 2HHHK 3CM6A 1NNEA 1KC8O 1YIJN 4AHVA 3KVGA 4CHPA 4PKGA 5CR4A 2ZGYA 1VQNN 3T1HK 4M7YA 3C7NB 3PIPL 1BL3A 4NLCA 3EKUA 2OZSA 4FWKA 3MX2A 3DJCA 3VQCA 4C23A 4KKOA 5AQYA 4AHCA 4H0TB 3RR7A 3AVGA 3KKRA 4RWTA 2HOEA 4FXDA 2IVPA 4E1NA 1IKVA 3EY1A 1SV5A 4FJ5A 4IBNA 1BUPA 4WCEL 1E4FT 4BROA 1WBDA 3V1QA 5EU7A 4EZ6A 3OYEA 4CHZA 1TKDA 4FJKA 1RDCA 1YJWN 3ZX3A 2P9KB 3M5RA 1JKHA 1ZXOA 2B4JA 3O9TA 3ULDA 1IG9A 3MN7A 4E1JA 1T6DA 3VN5A 2KFZA 3W0LA 1XMQK 1BU6O 3ATUA 1LW0A 3OYBA 3J7YP 1NKBA 1G15A 4BRNA 1WAFA 1NGFA 4O0IA 4JKDA 1KTQA 3ATVA 3LDQA 3LALA 4E7IA 4JS5A 1RDBA 4DR4K 2Y1IA 4RCHA 2ASMA 1CZBA 3BF1A 5GAHP 2E2QA 4DQPA 4DTRA 5FLXO 2WBNA 3WEEB 2E6LA 2QW9A 1N8RO 3J7AP 4IFEA 4O4GA 3SLCA 4BE1A 4PY5A 4EP5A 1Q18A 1P8ZA 1NGDA 3K5OA 3SNNA 1LWEA 2CGKA 3ID8A 1QSLA 3U9ZA 1TK0A 1RTJA 3OBWA 4O8KA 3VA3A 1QSYA 1SKWA 2ZD1A 2O8DB 4DTUA 4B3RK 1KCFA 1X9JA 3ZSYA 4DQRA 3CJCA 5CHIA 4CIEA 5AQSA 3O4NA 4CZFA 1KXPA 3OBYA 1ESVA 2ZQBA 3D2FA 1BQNA 4J2EA 4IKFA 4FZXC 1YXQA 4M7XA 5HRRA 3WXJA 4FLTA 2VG5A 3HL8A 4CEAA 4F2RA 3OYNA 3MCPA 2CH5A 4K8ZA 2O8BA 1ASUA 5J2NA 1Q82O 1EXQA 3UKRA 2KHOA 2O8BB 4M3UA 1NWKA 3DRPA 4LD0A 4FJ9A 1ATNA 1RT2A 3CF5L 1HQEA 3G25A 3VQ6A 4AM6A 2A1RA 3O9RA 1MA9B 4DFJA 4CHYA 2HHVA 4KBOA 2WOMA 3OYJA 3ZX0A 4KH6A 1Q7YO 3D0PA 3TSQA 1RBTA 5HRNA 3NH1A 3E9OA 3L6QA 5KPRA 1J5EK 3CPWM 3DLEA 4CK2A 2PYJA 3V9ZA 2V52B 4R79A 4CZHA 3MK6A 4RW9A 5AZJA 4ELTA 1Z25A 4X65K 4FM0A 1HUXA 4YOXA 1J5OA 3PO4A 2NLXA 1OH5A 1TL1A 3OS1A 4CF0A 1TAQA 2HF3A 3VERA 4CHQA 4OLAA 4KHQA 1CXQA 2EHGA 2I7PA 2KZMA 4DSJA 4FZZA 4M41A 4DV0K 5C24A 3LAKA 4L8RB 1Q8IA 4C8MA 5C25A 4CGDA 4W5NA 5AQJA 4CF8A 4GKJK 3NGZA 1VQ4N 5DMRA 1HKGA 1HNWK 3FZMA 3SJJA 1WNSA 3ZT3A 3VF6A 4YHHK 2KQ2A 3AO1A 3ID6A 4GNIA 4RW4A 3K9JA 1GLJO 2Z1IA 3V81A 3WUHA 4MO5A 4BG8A 1D9DA 2P9PA 1NJXA 1S6PA 1KSPA 5BN9A 2W40A 1NG9A 1Z6RA 2FSNA 4CJTA 4CZMA 3THXA 3ASMA 2VQEK 3I8BA 1NKCA 5KQDA 3THXB 3MWTA 3AVKA 4CJ5A
chains in the Genus database with same CATH topology
2OPRA 4M3RA 1WSIA 1HYSA 1CLQA 5J2PA 4C8KA 3DMJA 1TGOA 3AO2A 3VQDA 4CEQA 4E7JA 4CEOA 3HP9A 3OS2A 3ZSQA 3QIOA 1WSFA 1RDAA 3KLGA 1N6QA 3T3FA 3QEVA 3NH2A 2EX3A 1WSHA 4CGHA 2LSNA 3SQ2A 1RTIA 4KTZA 1B9DA 2WONA 2YKMA 3ITHA 3MEEA 3VQ5A 4Z4HA 4F2SA 4GVMA 1KVCA 3LZJA 1SL1A 3I8DA 3SV4A 3L8BA 4OKKA 4CHOA 3EZ5A 1VRUA 1YTUA 3QETA 3OYFA 4FLZA 4IDKA 2YNIA 1W9HA 2ETJA 4CE9A 4CJPA 2O4IA 3P5JA 4Z4GA 1TKTA 4FW2A 4CIFA 4BWMA 4E7HA 2XY5A 1KLNA 2X74A 4FM1A 5CYQA 1JLEA 2IS3A 3QERA 2HB5A 3I0RA 1JLGA 4FCYA 1QSSA 2FBYA 2F96A 3DOLA 3F9KA 4MFBA 3U3GA 4CJ3A 4CJSA 4FJXA 1HQUA 5HROA 2OPPA 2BANA 3HPOA 4DTOA 4G1QA 4N5SA 3PX6A 2G8WA 4FLXA 2BGGA 3OYAA 4ZTFA 3OJUA 1IO2A 5CY4A 4KO0A 3QEXA 3DRRA 2JGUA 4GW6A 3QEWA 5JS2A 2IGIA 4M45A 3KJVA 4B9UA 3OVNA 5KRSA 4CHNA 2HW3A 1D9FA 1U47A 3L2RA 4M3WA 2IOCA 1NJZA 3RTVA 4E89A 1LWFA 2HMIA 1KFSA 4AHSA 4DQQA 4DWIA 2YNGA 1TV6A 3ZSZA 1RTHA 4FLWA 1T05A 3NBPA 3TAEA 4F4KA 1BISA 4FLYA 4M3YA 3CM5A 3NGYA 3QNOA 1BHLA 4H4OA 4WE1A 4CJRA 3KD5E 4FJKA 3JYTA 1YVUA 3AA2A 5K14A 3C95A 3G0ZA 1NK5A 2YHBA 3O3HA 4OPJA 1NK7A 4FLVA 4DG1A 4AH9A 4Z4FA 3OYLA 3TABA 4RW6A 1WLJA 3ZSXA 1EX4A 1GOBA 4HHTA 1N5YA 4KHWA 1C1CA 4CJEA 4BWJA 1T03A 4FJGA 5CZ1A 3T19A 3HP6A 1ASWA 1C0UA 4CEEA 3OY9A 3P83D 2XY7A 3M8RA 2A1SA 4RW7A 4J2AA 1JLCA 4CK1A 3SPYA 4HVJA 1RTDA 2P51A 3SZ2A 5HLFA 4BACA 1HJRA 1QE1A 4LSNA 1A5WA 3DYAA 4HCCA 4I2QA 3MAQA 3VQAA 1C1BA 1L3VA 3LWLA 3K5NA 1NJYA 3C6UA 5KRTA 1I39A 3AO3A 1VSKA 3RMDA 1WAJA 4OGEA 3HPHA 4DLGA 1RT1A 4DFMA 4CFDA 4DF4A 1JL2A 1L3SA 1ZBUA 2VWKA 2G8HA 1IH7A 4DFKA 1ZBFA 1LW2A 4M3ZA 3QINA 4DTSA 3F73A 2FC0A 3WNEA 4KV8A 4N47A 4JRPA 2OA8A 5HRPA 2PY5A 1QS4A 5FDLA 3NDKA 2KTQA 2KW4A 3OS0A 2YNFA 4AHUA 4KRFA 2HHSA 4K8XA 3K57A 1VSMA 4CGJA 4OPKA 3NGIA 4AILC 3QNNA 4LH4A 3OYHA 4NCGA 2BE2A 4EZ9A 4NYNA 3FFIA 4DSKA 1EKEA 1SUQA 1VSLA 3M8PA 3ZSRA 1EP4A 3NAEA 3HO1A 1O1WA 4CFCA 2XY6A 2F8SA 2ATQA 2KZZA 3V1RA 4DQSA 1WSGA 4KB0A 4Z4CA 1FKPA 1TK5A 4N56A 1UOCA 4HUEA 4CEZA 2D0BA 3AVMA 5FRMA 3ZCMA 1BI4A 3NF6A 3AVBA 3KD1E 1I3AA 3OYMA 1KRPA 5KGXA 3WNGA 1JLFA 4OKJA 4DQIA 3S3MA 1NK0A 1C0TA 4PWDA 4C8OA 3E01A 1BI4B 4E7KA 5FRNA 3TWHA 2XO7A 3RRHA 4JS4A 3VQEA 4HUGA 3LPUA 4RW8A 4FJ7A 1LWCA 3QLHA 3V9UA 5J2MA 1D5AA 3LANA 2OPSA 3V6DA 4FK2A 1WSEA 3SQ1A 3DRSA 1DTTA 3ZSVA 3SYZA 1BGXT 4QAGA 3T1AA 3OJSA 3V4IA 3DM2A 2HHXA 1IKYA 3AVCA 2QK9A 3QEPA 1FXXA 1ZBIA 4NYFA 1T8EA 1RILA 2DFHA 1Y97A 3IS9A 3KKSA 2FBVA 3V9SA 3AVLA 4B3OA 3PY8A 4FZYA 4B8CA 4E7LA 2YHAA 1NJWA 5I42A 3SUOA 4E19A 1BIZA 2IAJA 3I0SA 4N76A 3MEGA 4CIGA 4C8NA 1KFDA 1WN7A 4RG8A 2VG6A 4DU1A 5D3GA 1W0HA 5J2QA 4Y1CA 3CFOA 4DU4A 4O0JA 1VSIA 3KIOA 3AVJA 4OVLA 4W5OA 3V9XA 4CK3A 1NK9A 3QO9A 2GV9A 2QKKA 3TAQA 4FYDA 4IG3A 1S9EA 1X9SA 3AVIA 1LAWA 3VQ7A 1NOYA 1HNIA 1HYVA 1WSJA 2Z1HA 4CEBA 3LDSA 2DY4A 2HVIA 1YTAA 3IG1A 2X6NA 5KI6A 3NH0A 3HM9A 2G8KA 3A2FA 3NFAA 3SI6A 4PA1A 3MXJA 1SKRA 1S1UA 3L2QA 3B6PA 4B9VA 1JXBA 1XC9A 2HHWA 4CEFA 3DLBA 1T7PA 3KTQA 3JSMA 3LP2A 4CERA 4CF9A 2D0AA 3KK2A 1VSJA 3AA4A 3TAFA 3CQ8A 1NK4A 1ZBLA 1L3TA 1JLQA 1S6QA 3KLFA 3G10A 3PUFA 2FBXA 1TKZA 4AHRA 1JLBA 5I3UA 1SL0A 1YT3A 3NHGA 1HNVA 3DLGA 5CYMA 5SWMA 4DTMA 4DTJA 4DTPA 3TARA 3AA3A 3K59A 1SKSA 3CM6A 4H4MA 4B8AB 1TL3A 1A5VA 1FK9A 2AJQA 3LPTA 3MECA 4H8KA 4AHVA 4IFVA 4DSFA 4CHPA 4CJKA 4DSLA 4YNQA 2FBTA 1RT6A 4W5TA 4DLEA 1VK0A 3AVHA 1QQCA 3VQBA 1U49A 3SQ0A 1RBRA 4FJHA 2PYLA 4BDYA 4O44A 4MQ3A 2E4LA 2HVHA 1XHXA 4BDZA 3AVAA 4PUOA 2IC3A 4O55A 1Q9XA 2HNDA 1BL3A 2P5GA 4CJ4A 1RT4A 2OZSA 1BQMA 1RT7A 3TI0A 4F8RA 4ID5A 3O3GA 3LP0A 2G8VA 4B9TA 4KTQA 4IFYA 4E0DA 3QIPA 3S9HA 3VQCA 1X9WA 2I5JA 1VSHA 4KREA 1FKOA 2O4GA 1VSEA 3SV3A 4KI4A 4KKOA 4AHCA 4KI6A 2HNYA 3RR7A 3PO5A 2P5OA 2D0CA 3AVGA 3AO5A 3KKRA 1XHZA 1ZYQA 1J9AA 1UA1A 3HSTB 3MEDA 3VQQA 1RT5A 4FXDA 3EY1A 4E1NA 1IKVA 3AVFA 3TAPA 3HJFA 1SV5A 3HXMA 4FJ5A 4IBNA 1BIUA 4AHTA 4ZTJA 2GBZA 4OGCA 4YFUA 1TVRA 2ITGA 3IAYA 4FJIA 3V1QA 1RDDA 1S1TA 5EU7A 1IKXA 4C8LA 4ELVA 2ZE2A 4EZ6A 3OYEA 4CHZA 1UAXA 1B92A 3L3UA 1RDCA 1UWBA 2Z1GA 3CFPA 1TKDA 4CCHA 3NF8A 1JKHA 4Z0UA 2YV0X 2GUIA 3QEIA 2B4JA 3ULDA 1C6VA 1IG9A 3BDPA 2P1JA 4ZHRA 2OPQA 3VQPA 2PZSA 3VN5A 3CYMA 3AVNA 2KFZA 4ICLA 3HVRA 4HUFA 4KHYA 4CJVA 2DTUA 1LW0A 3HVTA 3OYBA 3WNHA 1G15A 1NKBA 4NCBA 1WAFA 3NE6A 4O0IA 2D5RA 4FJNA 1KTQA 1UA0A 2XY8A 3LALA 4E7IA 4FVMA 4JS5A 1RDBA 4CJ5A 4EP4A 4E1MA 4DF8A 1U48A 1X1PA 4FK0A 1C0MA 1IKWA 2Y1IA 5HP1A 1JLAA 3LP1A 3K5MA 3U3YA 2QXFA 3SUNA 3NF9A 3H08A 4CESA 4B9SA 1CZBA 4CFAA 4KHUA 4DQPA 4DTRA 1VRTA 4I7FA 3MXMA 1TK8A 1EETA 4CJWA 3TAGA 4GMJB 4M42A 2E6LA 1S1XA 2RPIA 1X9MA 3KLHA 4TSXA 4O4GA 4BE0A 1L5UA 4ID1A 4BE1A 1U4BA 4B08A 4BE2A 1S9GA 4PY5A 1U04A 1XWLA 3WNFA 4EP5A 1A5XA 3THVA 1J54A 1RBUA 3IRXA 3VQ9A 3K5OA 3VA0A 3SUQA 2QKBA 3RR8A 1REVA 3SNNA 1LWEA 1S5JA 4OLBA 1VSDA 4Q5VA 1QSLA 1TK0A 1U45A 1RTJA 2YKNA 3VA3A 1QSYA 1SKWA 2ZD1A 3L2VA 1RNHA 3RMCA 2XHBA 4PQUA 2VG7A 4IG0A 4DTUA 3C94A 1QHTA 1KCFA 4CGGA 3ZSYA 4DQRA 3VQ8A 1D8YA 3DOKA 4FK4A 5KTQA 3KK1A 4I2PA 4Z4IA 4CIEA 2HHUA 3O4NA 4LY7A 4CF1A 1DTQA 1K6YA 2ZQBA 3LAMA 1BQNA 3DLKA 4KB1A 4W5RA 4J2EA 3V9WA 4IKFA 4KPYA 1RCHA 1HMVA 4KAZA 4FZXC 2DFEA 3PX4A 4OKEA 1RT3A 3OYDA 3DI6A 5HRRA 4F3OA 4FLTA 2VG5A 2G8UA 4CJFA 3BGRA 4Z4EA 3HL8A 4KFBA 4CEAA 1LV5A 4HTUA 4F2RA 3OYNA 4DSEA 1NK6A 3OYCA 3OYIA 4K8ZA 1ASUA 5J2NA 3KLIA 4Y1DA 1NOZA 1Q9YA 2Q3SA 2W42A 1EXQA 3TR8A 3M8SA 1B9FA 4FLUA 4M3UA 3DRPA 3L3VA 4LD0A 3TAMA 4FJ9A 1CZ9A 3EYZA 2XRIA 3D45A 4CGIA 4B9NA 4KHNA 3DLHA 4ELUA 1RBVA 1LAVA 3ZT0A 3OYKA 4DTXA 3ZT4A 3SUPA 4DMNA 3KLEA 2HHQA 4CGFA 4Q0BA 1RT2A 1HRHA 1MU2A 1HQEA 3V1OA 4OJRA 3VQ6A 2A1RA 4I9QA 3S3NA 3SPZA 5JS1A 1BCMA 3ZT2A 2KFNA 4DFJA 4CHYA 2HHVA 3VQ4A 5SZTA 2WOMA 5KGWA 1S1VA 3OYJA 3L2UA 3K5LA 4FJMA 4W5QA 3PX0A 3NF7A 3D0PA 4DU3A 1RBTA 5HRNA 3L2WA 5J1EA 4CJQA 3NH1A 5FROA 4M3XA 1GOAA 3TANA 3LZIA 3U6FA 5C42A 4FM2A 4QOZB 2X78A 3DLEA 4CK2A 2VWJA 2PYJA 3V9ZA 2G8IA 3LWMA 1F21A 4E3SA 2R7YA 4UQGA 2NUBA 3OYGA 3PV8A 3ZT1A 3SCXA 4DS4A 2Y1JA 4RW9A 4BDPA 4J2BA 1SL2A 4ELTA 2IDOA 1Z25A 4FM0A 3QESA 3RMAA 2OZMA 1J5OA 3K58A 3B6OA 4KHSA 1KVAA 3PO4A 3DLRA 1ASVA 1TL1A 4DS5A 3OS1A 4CF0A 1TAQA 4HCBA 3KK3A 4CHQA 4OLAA 1J53A 1TAUA 5E41A 2B5JA 5T7BA 3SQ4A 4JLHA 4KHQA 1CXQA 2EHGA 1NK8A 2Z1JA 2E6MA 4F3TA 1ZBHA 2KZMA 4DSJA 3ZSOA 3C6TA 1JL1A 4FZZA 4M41A 2RKIA 4LH5A 5C24A 3LAKA 4KTWA 4L8RB 3MXIA 1Q8IA 2YNHA 4C8MA 5C25A 4M3TA 4B9LA 4J2DA 4CGDA 2HNZA 4CFBA 3K2PA 3HPGA 4W5NA 4DTNA 4CF8A 4QCLA 1DLOA 1CXUA 1S1WA 5CZ2A 3NGZA 2BDPA 3HK2A 5DMRA 3CG7A 1HPZA 4FJ8A 3M8QA 5DK5A 3ISNC 3RWUA 3SJJA 1KVBA 1WNSA 4LSLA 4O5BA 3ZT3A 1R0AA 4FW1A 1RBSA 4CF2A 1C1AA 2KQ2A 1KLMA 3HT3A 3AO1A 4R5PA 4DFPA 4CEDA 4RW4A 1L3UA 3NCIA 4XIUA 4DSIA 1ITGA 1TKXA 2F8TA 2B6AA 1Z26A 2Z1IA 3V81A 4N41A 1XI1A 1D9DA 4FJJA 1GOCA 4NCAA 3AO4A 3RRGA 2HHTA 2OYQA 3RMBA 3P1GA 4JRQA 2G8FA 4I9LA 1NJXA 1S6PA 2DFFA 1KSPA 1JXEA 1QTMA 1NKEA 3O4QA 4CJLA 3AV9A 5HRSA 2RN2A 3UIQA 3LP3A 4B9MA 1HYZA 3ALYA 4CJTA 2X6SA 1BCOA 3O3FA 2RF2A 5HBMA 4FJLA 4CECA 3ASMA 2JLEA 4CJUA 3ZSWA 3S3OA 1NKCA 3AVKA 3HYFA 1VSFA 3AA5X 3CFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPR A;  4M3R A;  1WSI A;  1HYS A;  1CLQ A;  5J2P A;  4C8K A;  3DMJ A;  1TGO A;  3AO2 A;  3VQD A;  4CEQ A;  4E7J A;  4CEO A;  3HP9 A;  3OS2 A;  3ZSQ A;  3QIO A;  1WSF A;  1RDA A;  3KLG A;  1N6Q A;  3T3F A;  3QEV A;  3NH2 A;  2EX3 A;  1WSH A;  4CGH A;  2LSN A;  3SQ2 A;  1RTI A;  4KTZ A;  1B9D A;  2WON A;  2YKM A;  3ITH A;  3MEE A;  3VQ5 A;  4Z4H A;  4F2S A;  4GVM A;  1KVC A;  3LZJ A;  1SL1 A;  3I8D A;  3SV4 A;  3L8B A;  4OKK A;  4CHO A;  3EZ5 A;  1VRU A;  1YTU A;  3QET A;  3OYF A;  4FLZ A;  4IDK A;  2YNI A;  1W9H A;  2ETJ A;  4CE9 A;  4CJP A;  2O4I A;  3P5J A;  4Z4G A;  1TKT A;  4FW2 A;  4CIF A;  4BWM A;  4E7H A;  2XY5 A;  1KLN A;  2X74 A;  4FM1 A;  5CYQ A;  1JLE A;  2IS3 A;  3QER A;  2HB5 A;  3I0R A;  1JLG A;  4FCY A;  1QSS A;  2FBY A;  2F96 A;  3DOL A;  3F9K A;  4MFB A;  3U3G A;  4CJ3 A;  4CJS A;  4FJX A;  1HQU A;  5HRO A;  2OPP A;  2BAN A;  3HPO A;  4DTO A;  4G1Q A;  4N5S A;  3PX6 A;  2G8W A;  4FLX A;  2BGG A;  3OYA A;  4ZTF A;  3OJU A;  1IO2 A;  5CY4 A;  4KO0 A;  3QEX A;  3DRR A;  2JGU A;  4GW6 A;  3QEW A;  5JS2 A;  2IGI A;  4M45 A;  3KJV A;  4B9U A;  3OVN A;  5KRS A;  4CHN A;  2HW3 A;  1D9F A;  1U47 A;  3L2R A;  4M3W A;  2IOC A;  1NJZ A;  3RTV A;  4E89 A;  1LWF A;  2HMI A;  1KFS A;  4AHS A;  4DQQ A;  4DWI A;  2YNG A;  1TV6 A;  3ZSZ A;  1RTH A;  4FLW A;  1T05 A;  3NBP A;  3TAE A;  4F4K A;  1BIS A;  4FLY A;  4M3Y A;  3CM5 A;  3NGY A;  3QNO A;  1BHL A;  4H4O A;  4WE1 A;  4CJR A;  3KD5 E;  4FJK A;  3JYT A;  1YVU A;  3AA2 A;  5K14 A;  3C95 A;  3G0Z A;  1NK5 A;  2YHB A;  3O3H A;  4OPJ A;  1NK7 A;  4FLV A;  4DG1 A;  4AH9 A;  4Z4F A;  3OYL A;  3TAB A;  4RW6 A;  1WLJ A;  3ZSX A;  1EX4 A;  1GOB A;  4HHT A;  1N5Y A;  4KHW A;  1C1C A;  4CJE A;  4BWJ A;  1T03 A;  4FJG A;  5CZ1 A;  3T19 A;  3HP6 A;  1ASW A;  1C0U A;  4CEE A;  3OY9 A;  3P83 D;  2XY7 A;  3M8R A;  2A1S A;  4RW7 A;  4J2A A;  1JLC A;  4CK1 A;  3SPY A;  4HVJ A;  1RTD A;  2P51 A;  3SZ2 A;  5HLF A;  4BAC A;  1HJR A;  1QE1 A;  4LSN A;  1A5W A;  3DYA A;  4HCC A;  4I2Q A;  3MAQ A;  3VQA A;  1C1B A;  1L3V A;  3LWL A;  3K5N A;  1NJY A;  3C6U A;  5KRT A;  1I39 A;  3AO3 A;  1VSK A;  3RMD A;  1WAJ A;  4OGE A;  3HPH A;  4DLG A;  1RT1 A;  4DFM A;  4CFD A;  4DF4 A;  1JL2 A;  1L3S A;  1ZBU A;  2VWK A;  2G8H A;  1IH7 A;  4DFK A;  1ZBF A;  1LW2 A;  4M3Z A;  3QIN A;  4DTS A;  3F73 A;  2FC0 A;  3WNE A;  4KV8 A;  4N47 A;  4JRP A;  2OA8 A;  5HRP A;  2PY5 A;  1QS4 A;  5FDL A;  3NDK A;  2KTQ A;  2KW4 A;  3OS0 A;  2YNF A;  4AHU A;  4KRF A;  2HHS A;  4K8X A;  3K57 A;  1VSM A;  4CGJ A;  4OPK A;  3NGI A;  4AIL C;  3QNN A;  4LH4 A;  3OYH A;  4NCG A;  2BE2 A;  4EZ9 A;  4NYN A;  3FFI A;  4DSK A;  1EKE A;  1SUQ A;  1VSL A;  3M8P A;  3ZSR A;  1EP4 A;  3NAE A;  3HO1 A;  1O1W A;  4CFC A;  2XY6 A;  2F8S A;  2ATQ A;  2KZZ A;  3V1R A;  4DQS A;  1WSG A;  4KB0 A;  4Z4C A;  1FKP A;  1TK5 A;  4N56 A;  1UOC A;  4HUE A;  4CEZ A;  2D0B A;  3AVM A;  5FRM A;  3ZCM A;  1BI4 A;  3NF6 A;  3AVB A;  3KD1 E;  1I3A A;  3OYM A;  1KRP A;  5KGX A;  3WNG A;  1JLF A;  4OKJ A;  4DQI A;  3S3M A;  1NK0 A;  1C0T A;  4PWD A;  4C8O A;  3E01 A;  1BI4 B;  4E7K A;  5FRN A;  3TWH A;  2XO7 A;  3RRH A;  4JS4 A;  3VQE A;  4HUG A;  3LPU A;  4RW8 A;  4FJ7 A;  1LWC A;  3QLH A;  3V9U A;  5J2M A;  1D5A A;  3LAN A;  2OPS A;  3V6D A;  4FK2 A;  1WSE A;  3SQ1 A;  3DRS A;  1DTT A;  3ZSV A;  3SYZ A;  1BGX T;  4QAG A;  3T1A A;  3OJS A;  3V4I A;  3DM2 A;  2HHX A;  1IKY A;  3AVC A;  2QK9 A;  3QEP A;  1FXX A;  1ZBI A;  4NYF A;  1T8E A;  1RIL A;  2DFH A;  1Y97 A;  3IS9 A;  3KKS A;  2FBV A;  3V9S A;  3AVL A;  4B3O A;  3PY8 A;  4FZY A;  4B8C A;  4E7L A;  2YHA A;  1NJW A;  5I42 A;  3SUO A;  4E19 A;  1BIZ A;  2IAJ A;  3I0S A;  4N76 A;  3MEG A;  4CIG A;  4C8N A;  1KFD A;  1WN7 A;  4RG8 A;  2VG6 A;  4DU1 A;  5D3G A;  1W0H A;  5J2Q A;  4Y1C A;  3CFO A;  4DU4 A;  4O0J A;  1VSI A;  3KIO A;  3AVJ A;  4OVL A;  4W5O A;  3V9X A;  4CK3 A;  1NK9 A;  3QO9 A;  2GV9 A;  2QKK A;  3TAQ A;  4FYD A;  4IG3 A;  1S9E A;  1X9S A;  3AVI A;  1LAW A;  3VQ7 A;  1NOY A;  1HNI A;  1HYV A;  1WSJ A;  2Z1H A;  4CEB A;  3LDS A;  2DY4 A;  2HVI A;  1YTA A;  3IG1 A;  2X6N A;  5KI6 A;  3NH0 A;  3HM9 A;  2G8K A;  3A2F A;  3NFA A;  3SI6 A;  4PA1 A;  3MXJ A;  1SKR A;  1S1U A;  3L2Q A;  3B6P A;  4B9V A;  1JXB A;  1XC9 A;  2HHW A;  4CEF A;  3DLB A;  1T7P A;  3KTQ A;  3JSM A;  3LP2 A;  4CER A;  4CF9 A;  2D0A A;  3KK2 A;  1VSJ A;  3AA4 A;  3TAF A;  3CQ8 A;  1NK4 A;  1ZBL A;  1L3T A;  1JLQ A;  1S6Q A;  3KLF A;  3G10 A;  3PUF A;  2FBX A;  1TKZ A;  4AHR A;  1JLB A;  5I3U A;  1SL0 A;  1YT3 A;  3NHG A;  1HNV A;  3DLG A;  5CYM A;  5SWM A;  4DTM A;  4DTJ A;  4DTP A;  3TAR A;  3AA3 A;  3K59 A;  1SKS A;  3CM6 A;  4H4M A;  4B8A B;  1TL3 A;  1A5V A;  1FK9 A;  2AJQ A;  3LPT A;  3MEC A;  4H8K A;  4AHV A;  4IFV A;  4DSF A;  4CHP A;  4CJK A;  4DSL A;  4YNQ A;  2FBT A;  1RT6 A;  4W5T A;  4DLE A;  1VK0 A;  3AVH A;  1QQC A;  3VQB A;  1U49 A;  3SQ0 A;  1RBR A;  4FJH A;  2PYL A;  4BDY A;  4O44 A;  4MQ3 A;  2E4L A;  2HVH A;  1XHX A;  4BDZ A;  3AVA A;  4PUO A;  2IC3 A;  4O55 A;  1Q9X A;  2HND A;  1BL3 A;  2P5G A;  4CJ4 A;  1RT4 A;  2OZS A;  1BQM A;  1RT7 A;  3TI0 A;  4F8R A;  4ID5 A;  3O3G A;  3LP0 A;  2G8V A;  4B9T A;  4KTQ A;  4IFY A;  4E0D A;  3QIP A;  3S9H A;  3VQC A;  1X9W A;  2I5J A;  1VSH A;  4KRE A;  1FKO A;  2O4G A;  1VSE A;  3SV3 A;  4KI4 A;  4KKO A;  4AHC A;  4KI6 A;  2HNY A;  3RR7 A;  3PO5 A;  2P5O A;  2D0C A;  3AVG A;  3AO5 A;  3KKR A;  1XHZ A;  1ZYQ A;  1J9A A;  1UA1 A;  3HST B;  3MED A;  3VQQ A;  1RT5 A;  4FXD A;  3EY1 A;  4E1N A;  1IKV A;  3AVF A;  3TAP A;  3HJF A;  1SV5 A;  3HXM A;  4FJ5 A;  4IBN A;  1BIU A;  4AHT A;  4ZTJ A;  2GBZ A;  4OGC A;  4YFU A;  1TVR A;  2ITG A;  3IAY A;  4FJI A;  3V1Q A;  1RDD A;  1S1T A;  5EU7 A;  1IKX A;  4C8L A;  4ELV A;  2ZE2 A;  4EZ6 A;  3OYE A;  4CHZ A;  1UAX A;  1B92 A;  3L3U A;  1RDC A;  1UWB A;  2Z1G A;  3CFP A;  1TKD A;  4CCH A;  3NF8 A;  1JKH A;  4Z0U A;  2YV0 X;  2GUI A;  3QEI A;  2B4J A;  3ULD A;  1C6V A;  1IG9 A;  3BDP A;  2P1J A;  4ZHR A;  2OPQ A;  3VQP A;  2PZS A;  3VN5 A;  3CYM A;  3AVN A;  2KFZ A;  4ICL A;  3HVR A;  4HUF A;  4KHY A;  4CJV A;  2DTU A;  1LW0 A;  3HVT A;  3OYB A;  3WNH A;  1G15 A;  1NKB A;  4NCB A;  1WAF A;  3NE6 A;  4O0I A;  2D5R A;  4FJN A;  1KTQ A;  1UA0 A;  2XY8 A;  3LAL A;  4E7I A;  4FVM A;  4JS5 A;  1RDB A;  4CJ5 A;  4EP4 A;  4E1M A;  4DF8 A;  1U48 A;  1X1P A;  4FK0 A;  1C0M A;  1IKW A;  2Y1I A;  5HP1 A;  1JLA A;  3LP1 A;  3K5M A;  3U3Y A;  2QXF A;  3SUN A;  3NF9 A;  3H08 A;  4CES A;  4B9S A;  1CZB A;  4CFA A;  4KHU A;  4DQP A;  4DTR A;  1VRT A;  4I7F A;  3MXM A;  1TK8 A;  1EET A;  4CJW A;  3TAG A;  4GMJ B;  4M42 A;  2E6L A;  1S1X A;  2RPI A;  1X9M A;  3KLH A;  4TSX A;  4O4G A;  4BE0 A;  1L5U A;  4ID1 A;  4BE1 A;  1U4B A;  4B08 A;  4BE2 A;  1S9G A;  4PY5 A;  1U04 A;  1XWL A;  3WNF A;  4EP5 A;  1A5X A;  3THV A;  1J54 A;  1RBU A;  3IRX A;  3VQ9 A;  3K5O A;  3VA0 A;  3SUQ A;  2QKB A;  3RR8 A;  1REV A;  3SNN A;  1LWE A;  1S5J A;  4OLB A;  1VSD A;  4Q5V A;  1QSL A;  1TK0 A;  1U45 A;  1RTJ A;  2YKN A;  3VA3 A;  1QSY A;  1SKW A;  2ZD1 A;  3L2V A;  1RNH A;  3RMC A;  2XHB A;  4PQU A;  2VG7 A;  4IG0 A;  4DTU A;  3C94 A;  1QHT A;  1KCF A;  4CGG A;  3ZSY A;  4DQR A;  3VQ8 A;  1D8Y A;  3DOK A;  4FK4 A;  5KTQ A;  3KK1 A;  4I2P A;  4Z4I A;  4CIE A;  2HHU A;  3O4N A;  4LY7 A;  4CF1 A;  1DTQ A;  1K6Y A;  2ZQB A;  3LAM A;  1BQN A;  3DLK A;  4KB1 A;  4W5R A;  4J2E A;  3V9W A;  4IKF A;  4KPY A;  1RCH A;  1HMV A;  4KAZ A;  4FZX C;  2DFE A;  3PX4 A;  4OKE A;  1RT3 A;  3OYD A;  3DI6 A;  5HRR A;  4F3O A;  4FLT A;  2VG5 A;  2G8U A;  4CJF A;  3BGR A;  4Z4E A;  3HL8 A;  4KFB A;  4CEA A;  1LV5 A;  4HTU A;  4F2R A;  3OYN A;  4DSE A;  1NK6 A;  3OYC A;  3OYI A;  4K8Z A;  1ASU A;  5J2N A;  3KLI A;  4Y1D A;  1NOZ A;  1Q9Y A;  2Q3S A;  2W42 A;  1EXQ A;  3TR8 A;  3M8S A;  1B9F A;  4FLU A;  4M3U A;  3DRP A;  3L3V A;  4LD0 A;  3TAM A;  4FJ9 A;  1CZ9 A;  3EYZ A;  2XRI A;  3D45 A;  4CGI A;  4B9N A;  4KHN A;  3DLH A;  4ELU A;  1RBV A;  1LAV A;  3ZT0 A;  3OYK A;  4DTX A;  3ZT4 A;  3SUP A;  4DMN A;  3KLE A;  2HHQ A;  4CGF A;  4Q0B A;  1RT2 A;  1HRH A;  1MU2 A;  1HQE A;  3V1O A;  4OJR A;  3VQ6 A;  2A1R A;  4I9Q A;  3S3N A;  3SPZ A;  5JS1 A;  1BCM A;  3ZT2 A;  2KFN A;  4DFJ A;  4CHY A;  2HHV A;  3VQ4 A;  5SZT A;  2WOM A;  5KGW A;  1S1V A;  3OYJ A;  3L2U A;  3K5L A;  4FJM A;  4W5Q A;  3PX0 A;  3NF7 A;  3D0P A;  4DU3 A;  1RBT A;  5HRN A;  3L2W A;  5J1E A;  4CJQ A;  3NH1 A;  5FRO A;  4M3X A;  1GOA A;  3TAN A;  3LZI A;  3U6F A;  5C42 A;  4FM2 A;  4QOZ B;  2X78 A;  3DLE A;  4CK2 A;  2VWJ A;  2PYJ A;  3V9Z A;  2G8I A;  3LWM A;  1F21 A;  4E3S A;  2R7Y A;  4UQG A;  2NUB A;  3OYG A;  3PV8 A;  3ZT1 A;  3SCX A;  4DS4 A;  2Y1J A;  4RW9 A;  4BDP A;  4J2B A;  1SL2 A;  4ELT A;  2IDO A;  1Z25 A;  4FM0 A;  3QES A;  3RMA A;  2OZM A;  1J5O A;  3K58 A;  3B6O A;  4KHS A;  1KVA A;  3PO4 A;  3DLR A;  1ASV A;  1TL1 A;  4DS5 A;  3OS1 A;  4CF0 A;  1TAQ A;  4HCB A;  3KK3 A;  4CHQ A;  4OLA A;  1J53 A;  1TAU A;  5E41 A;  2B5J A;  5T7B A;  3SQ4 A;  4JLH A;  4KHQ A;  1CXQ A;  2EHG A;  1NK8 A;  2Z1J A;  2E6M A;  4F3T A;  1ZBH A;  2KZM A;  4DSJ A;  3ZSO A;  3C6T A;  1JL1 A;  4FZZ A;  4M41 A;  2RKI A;  4LH5 A;  5C24 A;  3LAK A;  4KTW A;  4L8R B;  3MXI A;  1Q8I A;  2YNH A;  4C8M A;  5C25 A;  4M3T A;  4B9L A;  4J2D A;  4CGD A;  2HNZ A;  4CFB A;  3K2P A;  3HPG A;  4W5N A;  4DTN A;  4CF8 A;  4QCL A;  1DLO A;  1CXU A;  1S1W A;  5CZ2 A;  3NGZ A;  2BDP A;  3HK2 A;  5DMR A;  3CG7 A;  1HPZ A;  4FJ8 A;  3M8Q A;  5DK5 A;  3ISN C;  3RWU A;  3SJJ A;  1KVB A;  1WNS A;  4LSL A;  4O5B A;  3ZT3 A;  1R0A A;  4FW1 A;  1RBS A;  4CF2 A;  1C1A A;  2KQ2 A;  1KLM A;  3HT3 A;  3AO1 A;  4R5P A;  4DFP A;  4CED A;  4RW4 A;  1L3U A;  3NCI A;  4XIU A;  4DSI A;  1ITG A;  1TKX A;  2F8T A;  2B6A A;  1Z26 A;  2Z1I A;  3V81 A;  4N41 A;  1XI1 A;  1D9D A;  4FJJ A;  1GOC A;  4NCA A;  3AO4 A;  3RRG A;  2HHT A;  2OYQ A;  3RMB A;  3P1G A;  4JRQ A;  2G8F A;  4I9L A;  1NJX A;  1S6P A;  2DFF A;  1KSP A;  1JXE A;  1QTM A;  1NKE A;  3O4Q A;  4CJL A;  3AV9 A;  5HRS A;  2RN2 A;  3UIQ A;  3LP3 A;  4B9M A;  1HYZ A;  3ALY A;  4CJT A;  2X6S A;  1BCO A;  3O3F A;  2RF2 A;  5HBM A;  4FJL A;  4CEC A;  3ASM A;  2JLE A;  4CJU A;  3ZSW A;  3S3O A;  1NKC A;  3AVK A;  3HYF A;  1VSF A;  3AA5 X;  3CFR A; 
#chains in the Genus database with same CATH topology
 2OPR A;  5M1P A;  5J2P A;  4C8K A;  1TGO A;  4CEO A;  3OS2 A;  1JJ2 M;  1RDA A;  3KLG A;  1DT9 A;  3QEV A;  1H1V A;  2WUS A;  2ZJQ L;  5FPM A;  3FZH A;  1P90 A;  3LZJ A;  1KD1 O;  4OKK A;  4QS9 A;  2FSK A;  1YTU A;  4IDK A;  2ETJ A;  1BA1 A;  3P5J A;  4Z4G A;  4CIF A;  2A6A A;  2X74 A;  2E5L K;  4PKI A;  3HOS A;  3U3G A;  3DOL A;  3F9K A;  3VEZ A;  3CXC M;  5HRO A;  3CCJ N;  4B1W B;  3EKS A;  4LF7 K;  3HPO A;  4ZTF A;  3F9M A;  4BY9 C;  1MWM A;  4FWM A;  1NJI O;  3QEW A;  1EQY A;  3L2R A;  2IOC A;  2GWK A;  4E89 A;  1KFS A;  5AQU A;  3J8A A;  2YI1 A;  5BR9 A;  4JKE A;  3WXI A;  3UB5 A;  3KD5 E;  1JCG A;  1K8A O;  3JYT A;  1X3M A;  2O8F A;  5K14 A;  5JLF A;  1BA0 A;  2P9L B;  4AH9 A;  4Z4F A;  3TAB A;  2O8F B;  3ZSX A;  1GOB A;  5AR0 A;  1VQ6 N;  4YOT A;  3I56 N;  1U2V B;  1YJ9 N;  3T19 A;  3HP6 A;  2PAV A;  4J2A A;  5E84 A;  3THY B;  4FOE A;  4LSN A;  2VCP A;  4I2Q A;  2ASP A;  2QEX N;  4DV2 K;  3LWL A;  3K5N A;  4GV6 A;  1WBB A;  3AO3 A;  4DHY A;  4OGE A;  1RT1 A;  4CFD A;  2ZJR L;  2G8H A;  3VES A;  4DTS A;  2P9N A;  3FR0 A;  3GOI A;  3G71 N;  1QS4 A;  5FDL A;  2P9N B;  4WQ5 A;  3K57 A;  4H5R A;  2ITM A;  1IJJ A;  4EZ9 A;  3FFI A;  1SUQ A;  1JCF A;  3ZSR A;  4GKK K;  3N4Q A;  1HNZ K;  4C1N I;  1UOC A;  3SBT A;  4CEZ A;  2D0B A;  5FRM A;  3WNG A;  1JLF A;  4OKJ A;  4BRA A;  3R9P A;  3BY5 A;  4CW7 B;  2UXC K;  1C0T A;  2ZWH A;  4WQ5 C;  1NGA A;  3LDP A;  3RRH A;  4WQ4 A;  3QLH A;  2OPS A;  4DV4 K;  3A5M C;  1EWR A;  4JI2 K;  3ZSV A;  1BGX T;  4QAG A;  3T1A A;  1IKY A;  2P9I A;  3QEP A;  3CPE A;  1RIL A;  3IS9 A;  2FBV A;  4B3O A;  4E7L A;  1QVF M;  3VEO A;  3FE1 A;  3SUO A;  4BGB A;  4E19 A;  2IAJ A;  4N76 A;  3E9P A;  4C8N A;  1KFD A;  5DM7 L;  4O0J A;  4JKC A;  1VSI A;  1GLB G;  5F0X A;  1WUA A;  3AAP A;  2GV9 A;  3TAQ A;  3GE1 A;  1X9S A;  3UE5 A;  4PL8 A;  4CEB A;  3LDS A;  3O6W A;  5AQZ A;  3EEQ A;  1QQO A;  3IG1 A;  5KI6 A;  1OKJ A;  2G8K A;  3NFA A;  5DM6 L;  5CE3 A;  2OTJ N;  1XC9 A;  3G6E N;  2GX9 A;  3LDN A;  4CER A;  3TAF A;  1NK4 A;  3U8X A;  2HST A;  3PUF A;  1XMO K;  1TKZ A;  3DWL A;  4BRF A;  4DTM A;  4DTJ A;  3TAR A;  3K59 A;  1M90 O;  1A5V A;  1FK9 A;  2JWL A;  3MEC A;  2YHX A;  3MX5 A;  4DSF A;  4DSL A;  3O9S A;  2FBT A;  4JNE A;  1XQS C;  2NRV A;  4W5T A;  1KAZ A;  4DLE A;  4BRL A;  1RFQ A;  3H46 O;  3SQ0 A;  1RBR A;  5EVZ A;  3FLC O;  2GUP A;  3EO3 A;  3AVA A;  2IC3 A;  1Q9X A;  4CJ4 A;  1RT4 A;  1BQM A;  1RT7 A;  4ID5 A;  3O08 A;  3QIP A;  3S9H A;  3MMV A;  2O4G A;  1VSE A;  3ZET A;  3SV3 A;  3TTC A;  3IUC A;  2HNY A;  1OH7 A;  2D0C A;  1ZYQ A;  2E20 A;  5H1S Q;  1HKC A;  1RT5 A;  4BG9 A;  2E2P A;  4GV3 A;  1SS6 A;  1NGI A;  4OGC A;  3IAY A;  3K9K A;  1RDD A;  4BR5 A;  4WYB A;  4C8L A;  4BQL A;  4ISF A;  4ELV A;  2ZE2 A;  2BTF A;  3M1F A;  4CCH A;  3QEI A;  3E66 A;  3CC4 N;  3BDP A;  4ZHR A;  3VQP A;  3CQY A;  3A8Y A;  3R3L A;  4KHP K;  2D1K A;  1XNR K;  3HVT A;  3TPQ A;  4FJN A;  4IOX A;  3ZX2 A;  1Q86 O;  1UA0 A;  4BRH A;  4CBW A;  4E1M A;  1X1P A;  4FK0 A;  5JVG L;  5M1F A;  3MN6 A;  1JLA A;  3O9U A;  5HP1 A;  3NF9 A;  2YJF A;  5GAD P;  1WOQ A;  5AQF A;  2W6K A;  1VRT A;  3MXM A;  1EET A;  4CJW A;  4M42 A;  3GDQ A;  2ZJP L;  1L5U A;  4MLH A;  4BE0 A;  4UY8 O;  4ID1 A;  1S9G A;  5LMN K;  4DUY K;  3CCS N;  2QM1 A;  1A5X A;  1NMD A;  4YOW A;  3THV A;  1RBU A;  3FZF A;  4LFB K;  3VQ9 A;  1K73 O;  2O8C A;  3D2E A;  4EIA A;  1U45 A;  3FZK A;  1XUP O;  2YKN A;  3CCQ N;  3L2V A;  3D2E B;  4DR7 K;  4B3M K;  1D8Y A;  3VQ8 A;  4FK4 A;  2E8A A;  4LF8 K;  5LJV A;  4LY7 A;  4CF1 A;  4KB1 A;  3DLK A;  3V9W A;  1RCH A;  3CJB A;  4KAZ A;  3DI6 A;  2UUC K;  2NRZ A;  4Z4E A;  4HTU A;  2VGM A;  1NK6 A;  5F1X A;  4Y1D A;  1NOZ A;  4BC4 A;  3C0B A;  2Q3S A;  4JEP A;  2W42 A;  3TR8 A;  4BRM A;  3L3V A;  3TAM A;  3EYZ A;  4KHN A;  2XRI A;  3D45 A;  4IXC A;  4CGI A;  3DLH A;  3OYK A;  4DTX A;  3JAM O;  3VET A;  1BG3 A;  3KLE A;  4Q0B A;  3TTF A;  1HRH A;  4IJA A;  3ZT2 A;  4CZK A;  4BR9 A;  5KGW A;  3JS6 A;  4W5Q A;  4DU3 A;  1HKB A;  5J1E A;  4O5F A;  2Q97 A;  4H5V A;  3TAN A;  1E4G T;  3LZI A;  3U6F A;  2OAN A;  1GLE G;  4QOZ B;  3LWM A;  4MO4 A;  4E3S A;  4QS7 A;  4UQG A;  3CQX A;  3SJH A;  3OYG A;  3SCX A;  3VF2 A;  2Y1J A;  1SL2 A;  2IDO A;  2OZM A;  5BPM A;  1KVA A;  1SZ2 A;  3KWG A;  2H3G X;  5EY4 A;  1J53 A;  3SQ4 A;  4XH5 A;  4F3T A;  1ZBH A;  3O1W A;  4LH5 A;  4KTW A;  2RE2 A;  2YNH A;  1VQK N;  4B9L A;  5GIP A;  2HNZ A;  3HPG A;  4AQY K;  4DTN A;  4QCL A;  3BF3 A;  3CCL N;  4JYA K;  2BDP A;  4A2A A;  3M8Q A;  5AQR A;  1QZ5 A;  3QML A;  1R0A A;  4FW1 A;  1RBS A;  4JK8 A;  4DFP A;  3UKU A;  4DSI A;  1TKX A;  2O8E A;  1Z26 A;  2YCH A;  1GLL O;  1XI1 A;  1GOC A;  3RRG A;  3O5B A;  2G8F A;  4JRQ A;  5AQT A;  4BR7 A;  2DFF A;  3O4Q A;  4MDA A;  4CJL A;  1GLF O;  3LP3 A;  2X6S A;  1BCO A;  3O3F A;  3O4W A;  4CEC A;  4BR2 A;  5I9E B;  5ADX H;  3J80 O;  3U9D A;  1VAZ A;  3CFR A;  1HYS A;  1O13 A;  1CLQ A;  1T3V A;  3VQD A;  3AO2 A;  1HNX K;  1R59 O;  3ZSQ A;  4BRQ A;  2EX3 A;  2UXB K;  3BP8 A;  4CGH A;  4G9Z A;  2WON A;  2FXU A;  2YKM A;  3MEE A;  3O80 A;  3VQ5 A;  4Z4H A;  4F2S A;  4GVM A;  1KVC A;  1SL1 A;  3SV4 A;  3L8B A;  3EZ5 A;  3D2F B;  3MN5 A;  5LY3 A;  3S41 A;  2YNI A;  1SAZ A;  2QI2 A;  1G99 A;  4KH4 A;  1N36 K;  2XY5 A;  5CYQ A;  2HB5 A;  3I0R A;  5BRD A;  4JI8 K;  4A2B A;  3DLL L;  2F96 A;  4CJ3 A;  4CJS A;  4MFB A;  5AFU H;  3PX6 A;  4FL9 A;  4FLX A;  3NVK A;  3OYA A;  3I33 A;  4KO0 A;  3QFP A;  4ISE A;  3M3Z A;  3CMA N;  1YI2 N;  3UKR B;  2IGI A;  2QWO A;  4B9U A;  1TYQ A;  3OVN A;  1WB9 A;  4CHN A;  4FPB A;  1IBM K;  4BVO A;  1NJZ A;  3AGK A;  3VEV A;  1LWF A;  1TYQ B;  4AHS A;  1KAY A;  3SAF A;  3KWI A;  3IFR A;  4C1N K;  2NRT A;  3NBP A;  1RGI A;  3TAE A;  4M3Y A;  1BHL A;  1YVU A;  5M1Q A;  3CC7 N;  1ZC6 A;  4RW6 A;  2A41 A;  4KHW A;  1N5Y A;  1C1C A;  1T03 A;  5CZ1 A;  4IJN A;  1C0U A;  5AZJ B;  3M8R A;  4RW7 A;  1K8K A;  1HJR A;  4MDB A;  3DYA A;  4HCC A;  1K8K B;  1U6Z A;  2ASO A;  3HRG A;  3A5O C;  3U4L A;  1VSK A;  3RMD A;  1WAJ A;  3HPH A;  4DLG A;  1L3S A;  1JL2 A;  4A5B A;  2VWK A;  1IH7 A;  2PFU A;  4M3Z A;  2Q36 A;  3WNE A;  4KV8 A;  3Q7C A;  2E2N A;  2KW4 A;  1MWK A;  1QQN A;  3RSE A;  3H1Q A;  4CD3 A;  2HHS A;  4LF9 K;  5LJW A;  5C10 A;  3NGI A;  4AIL C;  3QNN A;  4F9O A;  3AAQ A;  2VQF K;  3RSE B;  1V4S A;  4NCG A;  4IEE A;  4DSK A;  1EKE A;  3QDK A;  4CFC A;  3V1R A;  4Z4C A;  4N56 A;  1HLU A;  3ZYY X;  1SQK A;  4HUE A;  2P9P B;  2Q0R A;  3OTO K;  4JI6 K;  1DKG D;  1I3A A;  1KRP A;  3KD1 E;  1NK0 A;  4PWD A;  1YHQ N;  2EWS A;  4JS4 A;  2HBM A;  1LWC A;  3V9U A;  3IMX A;  1VQ5 N;  2QXL A;  1VQP N;  3SQ1 A;  3NVM A;  1KAX A;  2UU9 K;  1FXX A;  1I94 K;  3AVL A;  1FW6 A;  4B8C A;  4LFA K;  3CC2 N;  1NJW A;  5I42 A;  1BIZ A;  2E2O A;  3I0S A;  3A5L C;  4RG8 A;  2E1Z A;  4ILJ A;  1VQ9 N;  4DU4 A;  3THW A;  4H5T A;  3V9X A;  3QO9 A;  1TUY A;  2UUB K;  2QKK A;  4IG3 A;  3THW B;  1LAW A;  1NOY A;  1HNI A;  3VEY A;  1HYV A;  1WSJ A;  2Z1H A;  4IO9 L;  3H1V X;  2HVI A;  3A2F A;  3SI6 A;  4PA1 A;  3WXL A;  1S1U A;  5GIO A;  1IV0 A;  4B9V A;  1JXB A;  1NGB A;  4CD1 A;  3KK2 A;  1VSJ A;  1JLQ A;  3KLF A;  3AA3 A;  3CCU N;  1SKS A;  1NM1 A;  2W41 A;  4H4M A;  4B8A B;  1TL3 A;  2AJQ A;  4H8K A;  1HPM A;  4YNQ A;  5JVH L;  4DR2 K;  1VK0 A;  1IBL K;  3SMS A;  1QQC A;  3VQB A;  1U49 A;  4X66 K;  4O44 A;  4MQ3 A;  2E4L A;  2HVH A;  1DEJ A;  3KK7 A;  4BDZ A;  4PUO A;  3LDL A;  2HND A;  3CJ7 A;  2P5G A;  1NLV A;  3TI0 A;  4BC3 A;  3LP0 A;  2G8V A;  4B9T A;  4OX9 K;  2I5J A;  4KRE A;  3KHY A;  1FKO A;  2QWM A;  4KI6 A;  4WFB L;  1C0F A;  2P9S A;  2P5O A;  1XHZ A;  3MWP A;  5FPD A;  3MED A;  3MN9 A;  3PSF A;  3VQQ A;  3HZ6 A;  2P9S B;  4H5W A;  3TAP A;  3AVF A;  3HJF A;  3HXM A;  2CGL A;  4ZTJ A;  2GBZ A;  4B3S K;  2ITG A;  3LDO A;  4FJI A;  1VHX A;  1S1T A;  4H0O A;  4CZI A;  3P31 A;  2HHX A;  1UAX A;  1B92 A;  3CJ9 A;  4GY2 B;  1LOT B;  2YJE A;  2NRW A;  1W2B M;  3NF8 A;  3ENO A;  2A3Z A;  2YV0 X;  2GUI A;  5AQX A;  4Z0U A;  5MLC Q;  4LF6 K;  3DXM A;  4CVN E;  2OPQ A;  1S3X A;  3CYM A;  3DXM B;  4NB4 A;  4B1V A;  4EHT A;  4JI7 K;  4KHY A;  2DTU A;  3WNH A;  4NCB A;  3VTH A;  3NE6 A;  2D5R A;  3EZW A;  4CZL A;  2XY8 A;  4FVM A;  5AQW A;  1U48 A;  4DF8 A;  5F2R A;  5M1K A;  2NZT A;  3LP1 A;  3K5M A;  3SUN A;  4B9S A;  2QXF A;  4KHU A;  3B8A X;  4CFA A;  3VGL A;  2HBK A;  3MCA B;  3H3O B;  3TAG A;  1S1X A;  5E26 A;  3KLH A;  3Q7B A;  3N4P A;  1U4B A;  4B08 A;  2FF3 B;  2QWR A;  3IRX A;  2P9I B;  3IDH A;  2QKB A;  3HSC A;  1REV A;  1S5J A;  4OLB A;  1VSD A;  1RNH A;  2XHB A;  2VG7 A;  4IG0 A;  3L4I A;  1QHT A;  4CGG A;  4NXN K;  3DOK A;  1TUU A;  4FWL A;  1W7A A;  2HHU A;  5JIC A;  3LAM A;  3QIC A;  4H0Y B;  4K43 A;  3O9Q A;  2W6L A;  4KPY A;  2NRX A;  4OKE A;  2KKZ A;  1RT3 A;  1DGK N;  4CJF A;  1LV5 A;  3OYC A;  3A0I X;  3OYI A;  3DAW A;  1Q9Y A;  2QWL A;  3TSU A;  1QQM A;  1B9F A;  3ENH A;  3OW2 M;  4K0K K;  1CZ9 A;  4B9N A;  4BRI A;  1RBV A;  3ZT4 A;  4K25 A;  2D0P A;  4OJR A;  1LCU A;  5JS1 A;  1BCM A;  3VQ4 A;  5JLH A;  2UUA K;  2D0O A;  1M1K O;  5C15 A;  3HI0 A;  4CBX A;  5FRO A;  3A5N C;  2ZGZ A;  4NXM K;  4FM2 A;  2X78 A;  2VWJ A;  3BEX A;  2G8I A;  3ZET B;  2R7Y A;  3PV8 A;  2NNW A;  3WT0 A;  4DS4 A;  3CI5 A;  4BDP A;  5LL6 Z;  5BPL A;  4IOA L;  3T1Y K;  3RMA A;  3K58 A;  1OVQ A;  3DLR A;  1Q81 O;  4HCB A;  4XEI A;  3ZEU A;  4AM7 A;  5T7B A;  4JLH A;  2Z1J A;  1YVN A;  4CZJ A;  3ZSO A;  2RKI A;  5GAG P;  2CGJ A;  4BRC A;  4ILG B;  4NO7 A;  3P39 A;  4J2D A;  4H5N A;  5BPN A;  1YIT N;  4J8F A;  1GLA G;  1CXU A;  5CZ2 A;  5AQH A;  3CG7 A;  1HPZ A;  4FJ8 A;  3E9L A;  5DK5 A;  3ISN C;  4U67 L;  4O5B A;  3TSP A;  2I7N A;  1C1A A;  1KLM A;  4R5P A;  1L3U A;  4DCH A;  1ITG A;  2F8T A;  3AO4 A;  2HHT A;  2KLA A;  4FO0 A;  3RMB A;  1VQM N;  4I9L A;  1Y64 A;  2RN2 A;  3UIQ A;  1HYZ A;  3ALY A;  2RF2 A;  2JLE A;  4YOY A;  5C0Y A;  5LMU K;  3J81 O;  1WSI A;  1NGG A;  2O8C B;  3DMJ A;  3T69 A;  3MDQ A;  4CEQ A;  2Q1N A;  4LF4 K;  5ELZ A;  3ULE A;  1WSF A;  5AZI A;  3NH2 A;  1WSH A;  3SQ2 A;  4M63 C;  3AY9 A;  1RTI A;  3HBT A;  4KTZ A;  3ULE B;  3ITH A;  3H6E A;  5AZI B;  2IVN A;  5A2Q O;  1V4T A;  2E88 A;  3OYF A;  4CI6 A;  1QZ6 A;  1W9H A;  4CE9 A;  1EO1 A;  4CJP A;  2O4I A;  1TKT A;  4BWM A;  4E7H A;  3R1X A;  1KLN A;  2UXD K;  4FM1 A;  1JLE A;  3HTV A;  2UYT A;  4FCY A;  4FJX A;  2FBY A;  5KPZ A;  4DUZ K;  1S72 N;  1HQU A;  3HOT A;  2BAN A;  4G1Q A;  4PKH A;  2G8W A;  4GVE A;  5M1O A;  1HR0 K;  2JGU A;  4GW6 A;  3F5T A;  1N32 K;  1YUW A;  3KJV A;  4BC2 A;  2HW3 A;  3K0S A;  1D9F A;  1U47 A;  3RTV A;  4L3Q A;  2HMI A;  4B1Y B;  2YNG A;  1TV6 A;  1RTH A;  3J7Z O;  4FLW A;  3C65 A;  3CM5 A;  3NGY A;  4PHT X;  3EN9 A;  4H4O A;  4WE1 A;  4JKG A;  4CJR A;  4ILH A;  3C7N A;  3R6M A;  3FFK B;  3AA2 A;  3C95 A;  4A57 A;  3G0Z A;  1NK5 A;  3LM2 A;  4JKG B;  5KPT A;  3O3H A;  1NK7 A;  4FLV A;  1BDG A;  4JI0 K;  1IBK K;  1WLJ A;  3BUZ B;  1EX4 A;  4HHT A;  4CJE A;  4FVU A;  4FJG A;  3WXM B;  3OY9 A;  3P83 D;  2PBD A;  3CER A;  2HBJ A;  4HVJ A;  3SZ2 A;  3P4I A;  1A5W A;  4BR0 A;  1C1B A;  1L3V A;  1NJY A;  3C6U A;  5KRT A;  1I39 A;  3SBG A;  3CHW A;  2V7Z A;  1ATR A;  4DFM A;  1ZBU A;  4DFK A;  1LW2 A;  2DPN A;  3P38 A;  5AJ3 K;  3EL2 A;  3F73 A;  4N47 A;  2P9K A;  4JRP A;  2OA8 A;  5HRP A;  2PY5 A;  3NDK A;  3OS0 A;  4AHU A;  4KRF A;  4YDU A;  4Z94 A;  4AF1 A;  4XH1 A;  3OYH A;  1T6C A;  2BE2 A;  3CJ1 A;  4NYN A;  4JK9 A;  3SK3 A;  3VEN A;  3CJA A;  3M8P A;  5AQV A;  3NAE A;  4B3T K;  3HO1 A;  4DR6 K;  3UKU B;  1O1W A;  4Y0W A;  2F8S A;  1RDW X;  2O8E B;  2KZZ A;  4FWN A;  5BR8 K;  1TK5 A;  3C6H A;  3L0Q A;  3AVM A;  4BC5 A;  1JCE A;  3AVB A;  3PLA A;  3OYM A;  4DQI A;  1BO5 O;  5BRF A;  2FSJ A;  4E7K A;  4C8O A;  4FWS A;  4YDU C;  5FRN A;  3TWH A;  1X3N A;  2XO7 A;  3WEE A;  4FJ7 A;  4RW8 A;  4BRP A;  1WSE A;  5C2F A;  1DTT A;  4DV6 K;  2JWK A;  3SYZ A;  3DM2 A;  3AVC A;  2QK9 A;  1ZBI A;  4EFH A;  4NYF A;  2WC9 A;  1Y97 A;  2Q31 A;  3IKM A;  2YHA A;  4DR3 K;  5FPE A;  5D3G A;  3MEG A;  1YF5 L;  4CIG A;  2O8D A;  2VG6 A;  5AQP A;  4LF5 K;  2V51 B;  4DR1 K;  1ZBS A;  3AVJ A;  4CK3 A;  1OH8 A;  2D4W A;  3VQ7 A;  1OH6 A;  3HM8 A;  2F4V K;  1NBW A;  4DV7 K;  3H3N O;  1YTA A;  5AQO A;  3WXK A;  3HM9 A;  3MXJ A;  3L2Q A;  4KH5 A;  4CEF A;  3DLB A;  3KTQ A;  4CF9 A;  2D0A A;  3AA4 A;  3CQ8 A;  3BZC A;  1S6Q A;  3G10 A;  4RTF D;  2FBX A;  3L4Q A;  5M1N A;  1JLB A;  1SL0 A;  5BN8 A;  1EWQ A;  3DLG A;  5CYM A;  5SWM A;  4DTP A;  4EHU A;  1YJN N;  5FPN A;  3LPT A;  4IFV A;  4CJK A;  1RT6 A;  3VGK A;  4LFC K;  4WF9 L;  3AVH A;  4FJH A;  2PYL A;  4BDY A;  1XHX A;  4IWV A;  4O55 A;  5TKY A;  3CCV N;  5B8H A;  5C2D A;  4F8R A;  3O3G A;  4KTQ A;  4GV9 A;  4IFY A;  3ZLJ A;  4E0D A;  1X9W A;  1VSH A;  5AQL A;  4DB3 A;  4IOC L;  4A5A A;  4YOU A;  4IDH A;  3PO5 A;  2Q2R A;  4FWO A;  3AO5 A;  1J9A A;  1UA1 A;  5AQM A;  4I6M A;  3HST B;  3PIO L;  3QBX A;  4I6M B;  1BIU A;  4AHT A;  2F9W A;  4YFU A;  1TVR A;  1ILY A;  3O1B A;  5TKW A;  1IKX A;  3L3U A;  3CFP A;  1UWB A;  2Z1G A;  4PL7 A;  1C6V A;  2P1J A;  1HX1 A;  4JI4 K;  4DR5 K;  2PZS A;  2WFB A;  4B1X B;  4NLB A;  1GLD G;  2GEL A;  2OCE A;  3AVN A;  3SAH A;  3VGM A;  4ICL A;  3HVR A;  4HUF A;  4CJV A;  2FF6 A;  4JKF A;  4FWR A;  5GAE P;  4EP4 A;  1C0M A;  1NU0 A;  1IKW A;  3QFU A;  3U3Y A;  3H08 A;  4CES A;  3FGU A;  4I7F A;  4YOV A;  1TK8 A;  4X64 K;  4GMJ B;  5GIN A;  2RPI A;  3LL3 A;  1X9M A;  4TSX A;  3C6A A;  3FZL A;  2A42 A;  4BE2 A;  1U04 A;  1XWL A;  3VPZ A;  3WNF A;  1W97 L;  4OPH A;  5ADX A;  1J54 A;  4H0X B;  4HWI A;  4CZE A;  3VA0 A;  3SUQ A;  3RR8 A;  4Q5V A;  4A59 A;  2BUP A;  1N33 K;  5EXW A;  3RMC A;  4PQU A;  4H03 B;  2GWJ A;  2ZM6 K;  3C94 A;  5BRH A;  2AA4 A;  1D4X A;  3ENB A;  5KTQ A;  3KK1 A;  1C0G A;  4I2P A;  4Z4I A;  4OO1 J;  4B1Z A;  1DTQ A;  1K6Y A;  2HBL A;  4A61 A;  4W5R A;  4FWQ A;  1CZA N;  1YAG A;  2AP1 A;  1HMV A;  3OA9 A;  2DFE A;  3AGR A;  3PX4 A;  3OYD A;  5KQ8 A;  4F3O A;  1OVY A;  4OPA A;  2G8U A;  3BGR A;  5AFU A;  4KFB A;  4DKW A;  4DSE A;  4EAH D;  1E3M A;  1BWF O;  3KLI A;  4BRK A;  3GBT A;  2A40 A;  3M8S A;  4FLU A;  4JN4 A;  4JI1 K;  4ELU A;  1LAV A;  3ZT0 A;  3SUP A;  4DMN A;  2HHQ A;  4CGF A;  2A5X A;  4H0P A;  1MU2 A;  3V1O A;  3VTI A;  4I9Q A;  3S3N A;  3SPZ A;  2KFN A;  4FJM A;  5SZT A;  1S1V A;  3L2U A;  3K5L A;  4BQZ A;  3PX0 A;  3NF7 A;  3L2W A;  4M3X A;  4CJQ A;  3VEX A;  1GOA A;  1QVG M;  2P9L A;  4QS8 A;  5C42 A;  4IEI A;  4WFA L;  3SMP A;  5C12 A;  1F21 A;  2NUB A;  1U2V A;  3ZT1 A;  5IWA K;  4J2B A;  2F7T A;  3THY A;  3CCM N;  3QES A;  3B6O A;  2YX6 A;  4BR4 A;  1ASV A;  3AAR A;  5AQG A;  4DS5 A;  1TAU A;  3KK3 A;  5E41 A;  2B5J A;  4JAX A;  4JI5 K;  1NK8 A;  2E6M A;  3C6T A;  1JL1 A;  5HL7 L;  2BH1 A;  3MXI A;  4M3T A;  4CFB A;  3K2P A;  1VQO N;  1DLO A;  3HK2 A;  1S1W A;  3R8E A;  2QWN A;  4DV5 K;  4JD2 A;  3RWU A;  3CD6 N;  1KVB A;  1MDU B;  4LSL A;  3GL1 A;  4CF2 A;  4JD2 B;  3HT3 A;  4CED A;  3NCI A;  4XIU A;  2B6A A;  4N41 A;  4FJJ A;  4NCA A;  3VOV A;  2OYQ A;  3P1G A;  1JXE A;  1QTM A;  1NKE A;  3E1Y A;  1HJO A;  4BGA A;  5HRS A;  3AV9 A;  3I55 N;  2YHW A;  4B9M A;  3G4S N;  4JI3 K;  4FJL A;  5HBM A;  4CJU A;  3ZSW A;  2ZF5 O;  3S3O A;  2IVO A;  2VGN A;  5HOO A;  2RHK A;  3HYF A;  1VSF A;  3AA5 X;  4M3R A;  5IT9 O;  3O8M A;  4JKB A;  4E7J A;  3LM9 A;  3HP9 A;  1KQS M;  5BRE A;  3CCE N;  3QBW A;  3QIO A;  1N6Q A;  4IZ9 A;  4DV3 K;  3T3F A;  1S22 A;  1VQ7 N;  2LSN A;  4O8U A;  1B9D A;  1N34 K;  2VWB A;  3WQU A;  2QWP A;  3I8D A;  4CHO A;  1VRU A;  4JV5 K;  3WQT A;  3QET A;  4FLZ A;  1J6Z A;  5AQQ A;  3GG4 A;  4JK7 A;  4JHD A;  2FLO A;  2E1Y A;  3KZB A;  4A62 A;  4FW2 A;  4WQ4 C;  4JHD B;  2IS3 A;  3QER A;  1JLG A;  1QSS A;  2OPP A;  4DTO A;  2BGG A;  4N5S A;  1Z05 A;  4DV1 K;  3OJU A;  1IO2 A;  5CY4 A;  5AQK A;  3QEX A;  3DRR A;  4BRD A;  5JS2 A;  3EE8 A;  4M45 A;  4FWP A;  3TTD A;  5KRS A;  2HF4 A;  2F9T A;  1BOT O;  3NMU A;  4M3W A;  4LC9 B;  4BRG A;  2GTD A;  4MLE A;  2QA4 N;  2GEM A;  2IIR A;  4DQQ A;  4BRE A;  4DWI A;  5AQN A;  3ZSZ A;  1T05 A;  4F4K A;  1BIS A;  4H0V B;  4B9Q A;  4FLY A;  3QNO A;  1NMN A;  2VYP A;  2QTD A;  5EOY A;  1GLC G;  2YHB A;  3T7Z A;  4DQ8 A;  4OPJ A;  4DG1 A;  3OYL A;  3BZK A;  1NGH A;  4BWJ A;  3CME N;  1ASW A;  4CEE A;  2XY7 A;  2A1S A;  3D6R A;  1JLC A;  3PSI A;  4CK1 A;  3SPY A;  1RTD A;  2P51 A;  2NRR A;  5HLF A;  3D7E O;  3CET A;  1QE1 A;  4BAC A;  1NGE A;  3M6G A;  1VQ8 N;  3MAQ A;  3VQA A;  3ZEU B;  3CCR N;  1NGC A;  3F2K A;  4WFN L;  4YY3 K;  4BVP A;  5JMV A;  4DF4 A;  1FJG K;  1IG8 A;  1ZBF A;  2V7Y A;  3DXK A;  3QIN A;  2FC0 A;  3DXK B;  1RDU A;  4XH4 A;  2KTQ A;  2YNF A;  2CH6 A;  2YHY A;  3W3D A;  1ATS A;  4JKA A;  4K8X A;  1VSM A;  4CGJ A;  4OPK A;  2J4R A;  4LH4 A;  5AQI A;  4X62 K;  1VSL A;  1NGJ A;  1EP4 A;  2XY6 A;  2WTU A;  2ATQ A;  4DQS A;  3SAG A;  1WSG A;  4KB0 A;  1FKP A;  4CJ7 A;  1VQL N;  3ZCM A;  1BI4 A;  3NF6 A;  4IO8 A;  5KGX A;  4FSV A;  4U7B A;  3S3M A;  3E01 A;  1BI4 B;  3TU5 A;  5EX5 A;  3VQE A;  4K42 A;  3LPU A;  4HUG A;  2NRH A;  3CIP A;  5J2M A;  4FK2 A;  1D5A A;  3LAN A;  3V6D A;  4FOI A;  4FPA A;  3DRS A;  4JKH A;  3OJS A;  3V4I A;  1T8E A;  2DFH A;  2QWQ A;  3KKS A;  3V9S A;  4K41 A;  3PY8 A;  4FZY A;  4B1U B;  4KI4 A;  4DU1 A;  3QB0 A;  1WN7 A;  1W0H A;  5J2Q A;  4Y1C A;  4HTL A;  3CFO A;  4CBU A;  3KIO A;  3OHR A;  4OVL A;  2HMP A;  4W5O A;  1NK9 A;  2P9U A;  3RVC A;  4ISG A;  4V19 S;  2Q0U A;  4FYD A;  1S9E A;  3AVI A;  4YOR A;  2P9U B;  2DY4 A;  1QHA A;  2OTL N;  2X6N A;  1XNQ K;  3NH0 A;  3VEW A;  1XC3 A;  3H45 C;  1SKR A;  3B6P A;  3JXU A;  2HHW A;  3EE9 A;  1T7P A;  3JSM A;  3LP2 A;  1T44 A;  4KHS A;  1L3T A;  1ZBL A;  4CZG A;  4AHR A;  1K9M O;  5I3U A;  1YT3 A;  3VMF B;  1HNV A;  3NHG A;  3VF4 A;  2HHH K;  3CM6 A;  1NNE A;  1KC8 O;  1YIJ N;  4AHV A;  3KVG A;  4CHP A;  4PKG A;  5CR4 A;  2ZGY A;  1VQN N;  3T1H K;  4M7Y A;  3C7N B;  3PIP L;  1BL3 A;  4NLC A;  3EKU A;  2OZS A;  4FWK A;  3MX2 A;  3DJC A;  3VQC A;  4C23 A;  4KKO A;  5AQY A;  4AHC A;  4H0T B;  3RR7 A;  3AVG A;  3KKR A;  4RWT A;  2HOE A;  4FXD A;  2IVP A;  4E1N A;  1IKV A;  3EY1 A;  1SV5 A;  4FJ5 A;  4IBN A;  1BUP A;  4WCE L;  1E4F T;  4BRO A;  1WBD A;  3V1Q A;  5EU7 A;  4EZ6 A;  3OYE A;  4CHZ A;  1TKD A;  4FJK A;  1RDC A;  1YJW N;  3ZX3 A;  2P9K B;  3M5R A;  1JKH A;  1ZXO A;  2B4J A;  3O9T A;  3ULD A;  1IG9 A;  3MN7 A;  4E1J A;  1T6D A;  3VN5 A;  2KFZ A;  3W0L A;  1XMQ K;  1BU6 O;  3ATU A;  1LW0 A;  3OYB A;  3J7Y P;  1NKB A;  1G15 A;  4BRN A;  1WAF A;  1NGF A;  4O0I A;  4JKD A;  1KTQ A;  3ATV A;  3LDQ A;  3LAL A;  4E7I A;  4JS5 A;  1RDB A;  4DR4 K;  2Y1I A;  4RCH A;  2ASM A;  1CZB A;  3BF1 A;  5GAH P;  2E2Q A;  4DQP A;  4DTR A;  5FLX O;  2WBN A;  3WEE B;  2E6L A;  2QW9 A;  1N8R O;  3J7A P;  4IFE A;  4O4G A;  3SLC A;  4BE1 A;  4PY5 A;  4EP5 A;  1Q18 A;  1P8Z A;  1NGD A;  3K5O A;  3SNN A;  1LWE A;  2CGK A;  3ID8 A;  1QSL A;  3U9Z A;  1TK0 A;  1RTJ A;  3OBW A;  4O8K A;  3VA3 A;  1QSY A;  1SKW A;  2ZD1 A;  2O8D B;  4DTU A;  4B3R K;  1KCF A;  1X9J A;  3ZSY A;  4DQR A;  3CJC A;  5CHI A;  4CIE A;  5AQS A;  3O4N A;  4CZF A;  1KXP A;  3OBY A;  1ESV A;  2ZQB A;  3D2F A;  1BQN A;  4J2E A;  4IKF A;  4FZX C;  1YXQ A;  4M7X A;  5HRR A;  3WXJ A;  4FLT A;  2VG5 A;  3HL8 A;  4CEA A;  4F2R A;  3OYN A;  3MCP A;  2CH5 A;  4K8Z A;  2O8B A;  1ASU A;  5J2N A;  1Q82 O;  1EXQ A;  3UKR A;  2KHO A;  2O8B B;  4M3U A;  1NWK A;  3DRP A;  4LD0 A;  4FJ9 A;  1ATN A;  1RT2 A;  3CF5 L;  1HQE A;  3G25 A;  3VQ6 A;  4AM6 A;  2A1R A;  3O9R A;  1MA9 B;  4DFJ A;  4CHY A;  2HHV A;  4KBO A;  2WOM A;  3OYJ A;  3ZX0 A;  4KH6 A;  1Q7Y O;  3D0P A;  3TSQ A;  1RBT A;  5HRN A;  3NH1 A;  3E9O A;  3L6Q A;  5KPR A;  1J5E K;  3CPW M;  3DLE A;  4CK2 A;  2PYJ A;  3V9Z A;  2V52 B;  4R79 A;  4CZH A;  3MK6 A;  4RW9 A;  5AZJ A;  4ELT A;  1Z25 A;  4X65 K;  4FM0 A;  1HUX A;  4YOX A;  1J5O A;  3PO4 A;  2NLX A;  1OH5 A;  1TL1 A;  3OS1 A;  4CF0 A;  1TAQ A;  2HF3 A;  3VER A;  4CHQ A;  4OLA A;  4KHQ A;  1CXQ A;  2EHG A;  2I7P A;  2KZM A;  4DSJ A;  4FZZ A;  4M41 A;  4DV0 K;  5C24 A;  3LAK A;  4L8R B;  1Q8I A;  4C8M A;  5C25 A;  4CGD A;  4W5N A;  5AQJ A;  4CF8 A;  4GKJ K;  3NGZ A;  1VQ4 N;  5DMR A;  1HKG A;  1HNW K;  3FZM A;  3SJJ A;  1WNS A;  3ZT3 A;  3VF6 A;  4YHH K;  2KQ2 A;  3AO1 A;  3ID6 A;  4GNI A;  4RW4 A;  3K9J A;  1GLJ O;  2Z1I A;  3V81 A;  3WUH A;  4MO5 A;  4BG8 A;  1D9D A;  2P9P A;  1NJX A;  1S6P A;  1KSP A;  5BN9 A;  2W40 A;  1NG9 A;  1Z6R A;  2FSN A;  4CJT A;  4CZM A;  3THX A;  3ASM A;  2VQE K;  3I8B A;  1NKC A;  5KQD A;  3THX B;  3MWT A;  3AVK A;  4CJ5 A; 
#chains in the Genus database with same CATH homology
 2OPR A;  4M3R A;  1WSI A;  1HYS A;  1CLQ A;  5J2P A;  4C8K A;  3DMJ A;  1TGO A;  3AO2 A;  3VQD A;  4CEQ A;  4E7J A;  4CEO A;  3HP9 A;  3OS2 A;  3ZSQ A;  3QIO A;  1WSF A;  1RDA A;  3KLG A;  1N6Q A;  3T3F A;  3QEV A;  3NH2 A;  2EX3 A;  1WSH A;  4CGH A;  2LSN A;  3SQ2 A;  1RTI A;  4KTZ A;  1B9D A;  2WON A;  2YKM A;  3ITH A;  3MEE A;  3VQ5 A;  4Z4H A;  4F2S A;  4GVM A;  1KVC A;  3LZJ A;  1SL1 A;  3I8D A;  3SV4 A;  3L8B A;  4OKK A;  4CHO A;  3EZ5 A;  1VRU A;  1YTU A;  3QET A;  3OYF A;  4FLZ A;  4IDK A;  2YNI A;  1W9H A;  2ETJ A;  4CE9 A;  4CJP A;  2O4I A;  3P5J A;  4Z4G A;  1TKT A;  4FW2 A;  4CIF A;  4BWM A;  4E7H A;  2XY5 A;  1KLN A;  2X74 A;  4FM1 A;  5CYQ A;  1JLE A;  2IS3 A;  3QER A;  2HB5 A;  3I0R A;  1JLG A;  4FCY A;  1QSS A;  2FBY A;  2F96 A;  3DOL A;  3F9K A;  4MFB A;  3U3G A;  4CJ3 A;  4CJS A;  4FJX A;  1HQU A;  5HRO A;  2OPP A;  2BAN A;  3HPO A;  4DTO A;  4G1Q A;  4N5S A;  3PX6 A;  2G8W A;  4FLX A;  2BGG A;  3OYA A;  4ZTF A;  3OJU A;  1IO2 A;  5CY4 A;  4KO0 A;  3QEX A;  3DRR A;  2JGU A;  4GW6 A;  3QEW A;  5JS2 A;  2IGI A;  4M45 A;  3KJV A;  4B9U A;  3OVN A;  5KRS A;  4CHN A;  2HW3 A;  1D9F A;  1U47 A;  3L2R A;  4M3W A;  2IOC A;  1NJZ A;  3RTV A;  4E89 A;  1LWF A;  2HMI A;  1KFS A;  4AHS A;  4DQQ A;  4DWI A;  2YNG A;  1TV6 A;  3ZSZ A;  1RTH A;  4FLW A;  1T05 A;  3NBP A;  3TAE A;  4F4K A;  1BIS A;  4FLY A;  4M3Y A;  3CM5 A;  3NGY A;  3QNO A;  1BHL A;  4H4O A;  4WE1 A;  4CJR A;  3KD5 E;  4FJK A;  3JYT A;  1YVU A;  3AA2 A;  5K14 A;  3C95 A;  3G0Z A;  1NK5 A;  2YHB A;  3O3H A;  4OPJ A;  1NK7 A;  4FLV A;  4DG1 A;  4AH9 A;  4Z4F A;  3OYL A;  3TAB A;  4RW6 A;  1WLJ A;  3ZSX A;  1EX4 A;  1GOB A;  4HHT A;  1N5Y A;  4KHW A;  1C1C A;  4CJE A;  4BWJ A;  1T03 A;  4FJG A;  5CZ1 A;  3T19 A;  3HP6 A;  1ASW A;  1C0U A;  4CEE A;  3OY9 A;  3P83 D;  2XY7 A;  3M8R A;  2A1S A;  4RW7 A;  4J2A A;  1JLC A;  4CK1 A;  3SPY A;  4HVJ A;  1RTD A;  2P51 A;  3SZ2 A;  5HLF A;  4BAC A;  1HJR A;  1QE1 A;  4LSN A;  1A5W A;  3DYA A;  4HCC A;  4I2Q A;  3MAQ A;  3VQA A;  1C1B A;  1L3V A;  3LWL A;  3K5N A;  1NJY A;  3C6U A;  5KRT A;  1I39 A;  3AO3 A;  1VSK A;  3RMD A;  1WAJ A;  4OGE A;  3HPH A;  4DLG A;  1RT1 A;  4DFM A;  4CFD A;  4DF4 A;  1JL2 A;  1L3S A;  1ZBU A;  2VWK A;  2G8H A;  1IH7 A;  4DFK A;  1ZBF A;  1LW2 A;  4M3Z A;  3QIN A;  4DTS A;  3F73 A;  2FC0 A;  3WNE A;  4KV8 A;  4N47 A;  4JRP A;  2OA8 A;  5HRP A;  2PY5 A;  1QS4 A;  5FDL A;  3NDK A;  2KTQ A;  2KW4 A;  3OS0 A;  2YNF A;  4AHU A;  4KRF A;  2HHS A;  4K8X A;  3K57 A;  1VSM A;  4CGJ A;  4OPK A;  3NGI A;  4AIL C;  3QNN A;  4LH4 A;  3OYH A;  4NCG A;  2BE2 A;  4EZ9 A;  4NYN A;  3FFI A;  4DSK A;  1EKE A;  1SUQ A;  1VSL A;  3M8P A;  3ZSR A;  1EP4 A;  3NAE A;  3HO1 A;  1O1W A;  4CFC A;  2XY6 A;  2F8S A;  2ATQ A;  2KZZ A;  3V1R A;  4DQS A;  1WSG A;  4KB0 A;  4Z4C A;  1FKP A;  1TK5 A;  4N56 A;  1UOC A;  4HUE A;  4CEZ A;  2D0B A;  3AVM A;  5FRM A;  3ZCM A;  1BI4 A;  3NF6 A;  3AVB A;  3KD1 E;  1I3A A;  3OYM A;  1KRP A;  5KGX A;  3WNG A;  1JLF A;  4OKJ A;  4DQI A;  3S3M A;  1NK0 A;  1C0T A;  4PWD A;  4C8O A;  3E01 A;  1BI4 B;  4E7K A;  5FRN A;  3TWH A;  2XO7 A;  3RRH A;  4JS4 A;  3VQE A;  4HUG A;  3LPU A;  4RW8 A;  4FJ7 A;  1LWC A;  3QLH A;  3V9U A;  5J2M A;  1D5A A;  3LAN A;  2OPS A;  3V6D A;  4FK2 A;  1WSE A;  3SQ1 A;  3DRS A;  1DTT A;  3ZSV A;  3SYZ A;  1BGX T;  4QAG A;  3T1A A;  3OJS A;  3V4I A;  3DM2 A;  2HHX A;  1IKY A;  3AVC A;  2QK9 A;  3QEP A;  1FXX A;  1ZBI A;  4NYF A;  1T8E A;  1RIL A;  2DFH A;  1Y97 A;  3IS9 A;  3KKS A;  2FBV A;  3V9S A;  3AVL A;  4B3O A;  3PY8 A;  4FZY A;  4B8C A;  4E7L A;  2YHA A;  1NJW A;  5I42 A;  3SUO A;  4E19 A;  1BIZ A;  2IAJ A;  3I0S A;  4N76 A;  3MEG A;  4CIG A;  4C8N A;  1KFD A;  1WN7 A;  4RG8 A;  2VG6 A;  4DU1 A;  5D3G A;  1W0H A;  5J2Q A;  4Y1C A;  3CFO A;  4DU4 A;  4O0J A;  1VSI A;  3KIO A;  3AVJ A;  4OVL A;  4W5O A;  3V9X A;  4CK3 A;  1NK9 A;  3QO9 A;  2GV9 A;  2QKK A;  3TAQ A;  4FYD A;  4IG3 A;  1S9E A;  1X9S A;  3AVI A;  1LAW A;  3VQ7 A;  1NOY A;  1HNI A;  1HYV A;  1WSJ A;  2Z1H A;  4CEB A;  3LDS A;  2DY4 A;  2HVI A;  1YTA A;  3IG1 A;  2X6N A;  5KI6 A;  3NH0 A;  3HM9 A;  2G8K A;  3A2F A;  3NFA A;  3SI6 A;  4PA1 A;  3MXJ A;  1SKR A;  1S1U A;  3L2Q A;  3B6P A;  4B9V A;  1JXB A;  1XC9 A;  2HHW A;  4CEF A;  3DLB A;  1T7P A;  3KTQ A;  3JSM A;  3LP2 A;  4CER A;  4CF9 A;  2D0A A;  3KK2 A;  1VSJ A;  3AA4 A;  3TAF A;  3CQ8 A;  1NK4 A;  1ZBL A;  1L3T A;  1JLQ A;  1S6Q A;  3KLF A;  3G10 A;  3PUF A;  2FBX A;  1TKZ A;  4AHR A;  1JLB A;  5I3U A;  1SL0 A;  1YT3 A;  3NHG A;  1HNV A;  3DLG A;  5CYM A;  5SWM A;  4DTM A;  4DTJ A;  4DTP A;  3TAR A;  3AA3 A;  3K59 A;  1SKS A;  3CM6 A;  4H4M A;  4B8A B;  1TL3 A;  1A5V A;  1FK9 A;  2AJQ A;  3LPT A;  3MEC A;  4H8K A;  4AHV A;  4IFV A;  4DSF A;  4CHP A;  4CJK A;  4DSL A;  4YNQ A;  2FBT A;  1RT6 A;  4W5T A;  4DLE A;  1VK0 A;  3AVH A;  1QQC A;  3VQB A;  1U49 A;  3SQ0 A;  1RBR A;  4FJH A;  2PYL A;  4BDY A;  4O44 A;  4MQ3 A;  2E4L A;  2HVH A;  1XHX A;  4BDZ A;  3AVA A;  4PUO A;  2IC3 A;  4O55 A;  1Q9X A;  2HND A;  1BL3 A;  2P5G A;  4CJ4 A;  1RT4 A;  2OZS A;  1BQM A;  1RT7 A;  3TI0 A;  4F8R A;  4ID5 A;  3O3G A;  3LP0 A;  2G8V A;  4B9T A;  4KTQ A;  4IFY A;  4E0D A;  3QIP A;  3S9H A;  3VQC A;  1X9W A;  2I5J A;  1VSH A;  4KRE A;  1FKO A;  2O4G A;  1VSE A;  3SV3 A;  4KI4 A;  4KKO A;  4AHC A;  4KI6 A;  2HNY A;  3RR7 A;  3PO5 A;  2P5O A;  2D0C A;  3AVG A;  3AO5 A;  3KKR A;  1XHZ A;  1ZYQ A;  1J9A A;  1UA1 A;  3HST B;  3MED A;  3VQQ A;  1RT5 A;  4FXD A;  3EY1 A;  4E1N A;  1IKV A;  3AVF A;  3TAP A;  3HJF A;  1SV5 A;  3HXM A;  4FJ5 A;  4IBN A;  1BIU A;  4AHT A;  4ZTJ A;  2GBZ A;  4OGC A;  4YFU A;  1TVR A;  2ITG A;  3IAY A;  4FJI A;  3V1Q A;  1RDD A;  1S1T A;  5EU7 A;  1IKX A;  4C8L A;  4ELV A;  2ZE2 A;  4EZ6 A;  3OYE A;  4CHZ A;  1UAX A;  1B92 A;  3L3U A;  1RDC A;  1UWB A;  2Z1G A;  3CFP A;  1TKD A;  4CCH A;  3NF8 A;  1JKH A;  4Z0U A;  2YV0 X;  2GUI A;  3QEI A;  2B4J A;  3ULD A;  1C6V A;  1IG9 A;  3BDP A;  2P1J A;  4ZHR A;  2OPQ A;  3VQP A;  2PZS A;  3VN5 A;  3CYM A;  3AVN A;  2KFZ A;  4ICL A;  3HVR A;  4HUF A;  4KHY A;  4CJV A;  2DTU A;  1LW0 A;  3HVT A;  3OYB A;  3WNH A;  1G15 A;  1NKB A;  4NCB A;  1WAF A;  3NE6 A;  4O0I A;  2D5R A;  4FJN A;  1KTQ A;  1UA0 A;  2XY8 A;  3LAL A;  4E7I A;  4FVM A;  4JS5 A;  1RDB A;  4CJ5 A;  4EP4 A;  4E1M A;  4DF8 A;  1U48 A;  1X1P A;  4FK0 A;  1C0M A;  1IKW A;  2Y1I A;  5HP1 A;  1JLA A;  3LP1 A;  3K5M A;  3U3Y A;  2QXF A;  3SUN A;  3NF9 A;  3H08 A;  4CES A;  4B9S A;  1CZB A;  4CFA A;  4KHU A;  4DQP A;  4DTR A;  1VRT A;  4I7F A;  3MXM A;  1TK8 A;  1EET A;  4CJW A;  3TAG A;  4GMJ B;  4M42 A;  2E6L A;  1S1X A;  2RPI A;  1X9M A;  3KLH A;  4TSX A;  4O4G A;  4BE0 A;  1L5U A;  4ID1 A;  4BE1 A;  1U4B A;  4B08 A;  4BE2 A;  1S9G A;  4PY5 A;  1U04 A;  1XWL A;  3WNF A;  4EP5 A;  1A5X A;  3THV A;  1J54 A;  1RBU A;  3IRX A;  3VQ9 A;  3K5O A;  3VA0 A;  3SUQ A;  2QKB A;  3RR8 A;  1REV A;  3SNN A;  1LWE A;  1S5J A;  4OLB A;  1VSD A;  4Q5V A;  1QSL A;  1TK0 A;  1U45 A;  1RTJ A;  2YKN A;  3VA3 A;  1QSY A;  1SKW A;  2ZD1 A;  3L2V A;  1RNH A;  3RMC A;  2XHB A;  4PQU A;  2VG7 A;  4IG0 A;  4DTU A;  3C94 A;  1QHT A;  1KCF A;  4CGG A;  3ZSY A;  4DQR A;  3VQ8 A;  1D8Y A;  3DOK A;  4FK4 A;  5KTQ A;  3KK1 A;  4I2P A;  4Z4I A;  4CIE A;  2HHU A;  3O4N A;  4LY7 A;  4CF1 A;  1DTQ A;  1K6Y A;  2ZQB A;  3LAM A;  1BQN A;  3DLK A;  4KB1 A;  4W5R A;  4J2E A;  3V9W A;  4IKF A;  4KPY A;  1RCH A;  1HMV A;  4KAZ A;  4FZX C;  2DFE A;  3PX4 A;  4OKE A;  1RT3 A;  3OYD A;  3DI6 A;  5HRR A;  4F3O A;  4FLT A;  2VG5 A;  2G8U A;  4CJF A;  3BGR A;  4Z4E A;  3HL8 A;  4KFB A;  4CEA A;  1LV5 A;  4HTU A;  4F2R A;  3OYN A;  4DSE A;  1NK6 A;  3OYC A;  3OYI A;  4K8Z A;  1ASU A;  5J2N A;  3KLI A;  4Y1D A;  1NOZ A;  1Q9Y A;  2Q3S A;  2W42 A;  1EXQ A;  3TR8 A;  3M8S A;  1B9F A;  4FLU A;  4M3U A;  3DRP A;  3L3V A;  4LD0 A;  3TAM A;  4FJ9 A;  1CZ9 A;  3EYZ A;  2XRI A;  3D45 A;  4CGI A;  4B9N A;  4KHN A;  3DLH A;  4ELU A;  1RBV A;  1LAV A;  3ZT0 A;  3OYK A;  4DTX A;  3ZT4 A;  3SUP A;  4DMN A;  3KLE A;  2HHQ A;  4CGF A;  4Q0B A;  1RT2 A;  1HRH A;  1MU2 A;  1HQE A;  3V1O A;  4OJR A;  3VQ6 A;  2A1R A;  4I9Q A;  3S3N A;  3SPZ A;  5JS1 A;  1BCM A;  3ZT2 A;  2KFN A;  4DFJ A;  4CHY A;  2HHV A;  3VQ4 A;  5SZT A;  2WOM A;  5KGW A;  1S1V A;  3OYJ A;  3L2U A;  3K5L A;  4FJM A;  4W5Q A;  3PX0 A;  3NF7 A;  3D0P A;  4DU3 A;  1RBT A;  5HRN A;  3L2W A;  5J1E A;  4CJQ A;  3NH1 A;  5FRO A;  4M3X A;  1GOA A;  3TAN A;  3LZI A;  3U6F A;  5C42 A;  4FM2 A;  4QOZ B;  2X78 A;  3DLE A;  4CK2 A;  2VWJ A;  2PYJ A;  3V9Z A;  2G8I A;  3LWM A;  1F21 A;  4E3S A;  2R7Y A;  4UQG A;  2NUB A;  3OYG A;  3PV8 A;  3ZT1 A;  3SCX A;  4DS4 A;  2Y1J A;  4RW9 A;  4BDP A;  4J2B A;  1SL2 A;  4ELT A;  2IDO A;  1Z25 A;  4FM0 A;  3QES A;  3RMA A;  2OZM A;  1J5O A;  3K58 A;  3B6O A;  4KHS A;  1KVA A;  3PO4 A;  3DLR A;  1ASV A;  1TL1 A;  4DS5 A;  3OS1 A;  4CF0 A;  1TAQ A;  4HCB A;  3KK3 A;  4CHQ A;  4OLA A;  1J53 A;  1TAU A;  5E41 A;  2B5J A;  5T7B A;  3SQ4 A;  4JLH A;  4KHQ A;  1CXQ A;  2EHG A;  1NK8 A;  2Z1J A;  2E6M A;  4F3T A;  1ZBH A;  2KZM A;  4DSJ A;  3ZSO A;  3C6T A;  1JL1 A;  4FZZ A;  4M41 A;  2RKI A;  4LH5 A;  5C24 A;  3LAK A;  4KTW A;  4L8R B;  3MXI A;  1Q8I A;  2YNH A;  4C8M A;  5C25 A;  4M3T A;  4B9L A;  4J2D A;  4CGD A;  2HNZ A;  4CFB A;  3K2P A;  3HPG A;  4W5N A;  4DTN A;  4CF8 A;  4QCL A;  1DLO A;  1CXU A;  1S1W A;  5CZ2 A;  3NGZ A;  2BDP A;  3HK2 A;  5DMR A;  3CG7 A;  1HPZ A;  4FJ8 A;  3M8Q A;  5DK5 A;  3ISN C;  3RWU A;  3SJJ A;  1KVB A;  1WNS A;  4LSL A;  4O5B A;  3ZT3 A;  1R0A A;  4FW1 A;  1RBS A;  4CF2 A;  1C1A A;  2KQ2 A;  1KLM A;  3HT3 A;  3AO1 A;  4R5P A;  4DFP A;  4CED A;  4RW4 A;  1L3U A;  3NCI A;  4XIU A;  4DSI A;  1ITG A;  1TKX A;  2F8T A;  2B6A A;  1Z26 A;  2Z1I A;  3V81 A;  4N41 A;  1XI1 A;  1D9D A;  4FJJ A;  1GOC A;  4NCA A;  3AO4 A;  3RRG A;  2HHT A;  2OYQ A;  3RMB A;  3P1G A;  4JRQ A;  2G8F A;  4I9L A;  1NJX A;  1S6P A;  2DFF A;  1KSP A;  1JXE A;  1QTM A;  1NKE A;  3O4Q A;  4CJL A;  3AV9 A;  5HRS A;  2RN2 A;  3UIQ A;  3LP3 A;  4B9M A;  1HYZ A;  3ALY A;  4CJT A;  2X6S A;  1BCO A;  3O3F A;  2RF2 A;  5HBM A;  4FJL A;  4CEC A;  3ASM A;  2JLE A;  4CJU A;  3ZSW A;  3S3O A;  1NKC A;  3AVK A;  3HYF A;  1VSF A;  3AA5 X;  3CFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...