4KB0A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion cc )
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb0A00
2FBYA 2VG6A 4N41A 3AA5X 1HRHA 2FBVA 2JLEA 1X9MA 4MFBA 3VQPA 1EETA 3ZSZA 3VQ6A 2XY6A 5HLFA 3TAMA 1IKWA 1RNHA 4W5QA 1KRPA 3KLHA 2ZD1A 1UOCA 5I3UA 5HBMA 1FKPA 3DLGA 5E41A 4F2RA 1QQCA 2FBTA 4LD0A 4BDZA 1NJYA 4HVJA 1HYSA 4I2PA 1NOZA 4RW7A 4CGIA 3KK2A 1NJZA 2Y1JA 3RRGA 4Z4GA 4FYDA 5C24A 5FRNA 3QESA 4DF4A 4OLBA 4DQIA 3IS9A 5FROA 3LP1A 4XIUA 2VG5A 3KD1E 1RILA 3LZJA 1XC9A 3NAEA 3HT3A 1Z26A 3VQ4A 2G8HA 1RTIA 4KKOA 4KV8A 3LWLA 2HHWA 3P5JA 4CJ5A 4CJ4A 3OY9A 3OYEA 3KD5E 4BACA 3T19A 4CFAA 3NF9A 4NYFA 1ITGA 4AILC 2D0AA 1RDAA 4DSLA 3HVTA 4M3RA 1HQUA 1Q9XA 1C0MA 4CESA 1NJXA 3SNNA 3SUPA 5CYQA 1T03A 3I0RA 4CIFA 4CJKA 5T7BA 1LWFA 4CHYA 3F9KA 1BHLA 3PUFA 3OYKA 3ASMA 3KLIA 4CJWA 1TK8A 3VQ8A 1S1WA 1Q9YA 4O44A 1JL2A 4CFCA 1JLGA 4M3WA 2NUBA 1Y97A 5J1EA 1RBVA 1GOBA 3HSTB 5EU7A 3T3FA 3QIOA 4O55A 4CK3A 4CEBA 1RBTA 4KI6A 1KLNA 4FJLA 4K8XA 3SV3A 4HUEA 4C8LA 4CJRA 3OYAA 5C25A 3ULDA 4E7JA 1NOYA 3AA2A 4KREA 4CGJA 4M3XA 2EHGA 5J2MA 3DOLA 1JLBA 1WSHA 3TARA 3IAYA 4OPKA 1O1WA 2OPSA 4ZHRA 4OKEA 2RPIA 4CEDA 4CJVA 4CCHA 4KTWA 5JS1A 2KZMA 3T1AA 1RTHA 3NH2A 1TKXA 3LAKA 1VSDA 2OZMA 4YNQA 4W5TA 4FZZA 3OYIA 2HNZA 3QO9A 4CF0A 3V9SA 4DU4A 1WSIA 1XI1A 1L3SA 3CM6A 3AO4A 3TAQA 3AA3A 2XY5A 3LAMA 4Z4FA 3WNFA 1EP4A 4FLYA 3U3YA 3O4QA 3VQQA 2B6AA 5J2PA 1CXQA 1I39A 2F8TA 2KZZA 3EY1A 5HRNA 1BGXT 5KRSA 1U45A 3DLRA 1N5YA 5CZ2A 4BDPA 3U6FA 3U3GA 2X78A 1KVCA 1BI4B 2FBXA 2DFEA 1JLQA 3DRRA 1GOAA 1U4BA 3EZ5A 5J2NA 5DMRA 3LP2A 3UIQA 4CJ3A 4CJPA 1B92A 4PQUA 3CG7A 3VQ5A 4H4MA 1SL0A 3DI6A 4CJEA 5HROA 4PA1A 1DTTA 1HPZA 3JYTA 1TAQA 1IKXA 3IG1A 1NK4A 4AHVA 1IO2A 1GOCA 2EX3A 3D0PA 4DTUA 4RG8A 1ZBUA 2IOCA 3K2PA 2XY7A 2PZSA 1QTMA 2Z1JA 3DRPA 2VWKA 1K6YA 3KK1A 1QE1A 3ZSVA 1UAXA 3AVIA 1RBSA 3PO5A 1QSSA 3PY8A 4CEQA 1C1CA 1HYVA 2XY8A 4CJFA 1BIUA 2OPQA 3DLEA 2DTUA 3MEDA 4HTUA 4OPJA 1C0TA 3C94A 3ITHA 4B9VA 2PYLA 4DSIA 4DTXA 3I8DA 3HO1A 1TGOA 2YNHA 4KHNA 4CJLA 2G8WA 2FC0A 3ZT4A 1IKYA 4CIGA 3JSMA 3TWHA 4DLGA 4RW8A 4CIEA 4E7KA 1WNSA 3TI0A 1S1TA 3K57A 1NKCA 2BDPA 4B8AB 2HVIA 4FLWA 4DTPA 3NH0A 4DMNA 3LDSA 3M8RA 3TABA 1EX4A 3VQDA 4CF2A 4ELTA 4I9QA 4E3SA 4M42A 4Y1CA 3KK3A 1X1PA 3CYMA 3ZCMA 3SUQA 3HM9A 2HVHA 4LY7A 1J54A 1RDCA 3BGRA 4CGDA 3PV8A 2X6NA 4DF8A 3S3MA 3AVKA 2O4GA 1UWBA 1ZYQA 3RTVA 4FLVA 1VK0A 2YHAA 3AVGA 3OS0A 1SL1A 3KLFA 1TL3A 1WSGA 4B9UA 1DTQA 2KTQA 3NCIA 4EZ9A 4OLAA 3SPYA 4DLEA 1BCOA 3QEWA 1RBRA 4JRPA 4DU3A 3SUNA 4TSXA 4ELUA 4FK2A 4DTOA 1YT3A 2YNIA 1X9WA 3NDKA 4CJUA 1SUQA 3DLBA 1CXUA 4CE9A 4HCCA 1B9DA 4H8KA 5FDLA 4B9SA 4AHRA 3D45A 3O4NA 4HHTA 1NK5A 3HP6A 4BE0A 1SL2A 4WE1A 3WNHA 4IKFA 3MEGA 3ZT2A 1S9EA 4CEOA 4KTQA 4J2AA 1D9DA 1CLQA 4OGCA 2PY5A 4ID5A 2JGUA 4IG3A 2QKKA 4QCLA 3WNEA 3QINA 1TVRA 1LWEA 3V1RA 4E1MA 5KGXA 4FJGA 1F21A 4CEZA 2KQ2A 1WAJA 3OS1A 4DFMA 1LAVA 3QEPA 3M8SA 3ISNC 4FVMA 4O4GA 3CQ8A 1RTDA 4B3OA 5KTQA 3K5NA 2RF2A 1B9FA 4CHQA 2O4IA 3ZT1A 3NFAA 1NK9A 1FXXA 2ATQA 3ZSRA 1EKEA 1S1VA 3C95A 3QERA 4N47A 1Z25A 1KVAA 3AVBA 3VQ9A 3M8PA 3H08A 4BE1A 4FJMA 4CJQA 3SQ1A 4FZYA 2P5GA 1XHXA 4E7HA 4R5PA 4OJRA 4F8RA 3G0ZA 1D5AA 3AO3A 1N6QA 4CGGA 3NGZA 4CHNA 1NKEA 3PX4A 1U49A 2ETJA 1HMVA 1VRUA 1T8EA 1HNVA 1JXBA 3TAGA 1BQNA 1G15A 3DMJA 4PUOA 4CEFA 3QETA 4L8RB 4LH4A 4JS4A 1BIZA 3BDPA 5DK5A 1S1UA 2Y1IA 3S9HA 1C1AA 3IRXA 4M3ZA 4NCGA 4BWMA 4CEEA 2YHBA 4E1NA 3F73A 4FLUA 4FM0A 4FJHA 2OZSA 4NCAA 3AVFA 4DFKA 3V81A 3SJJA 4ZTJA 1NKBA 4CK1A 4B9TA 4Z0UA 1TV6A 4FJ7A 3ZSXA 5FRMA 1JLCA 1WN7A 2E4LA 3QLHA 4E89A 3HVRA 4DTJA 3QEVA 5CY4A 1WAFA 3RR7A 4KHUA 4FK4A 4B9LA 4CK2A 1R0AA 3B6OA 2IC3A 4FM2A 4C8OA 4EP4A 3L8BA 1VSHA 2OPRA 4PY5A 3SYZA 1XWLA 3AVAA 1KLMA 1TK5A 3AA4A 3HP9A 2G8VA 3LP0A 3O3HA 1A5XA 3HL8A 1QS4A 4CHOA 4FLZA 4JRQA 1U47A 2YV0X 4DG1A 3C6UA 4C8NA 2OPPA 2G8KA 4IG0A 4BWJA 3C6TA 5KRTA 1S5JA 4DFPA 4G1QA 3L2RA 2HHXA 4LH5A 4K8ZA 3NF6A 3PX0A 4CGFA 1NK8A 1HJRA 1LW2A 4KB0A 4FXDA 3S3OA 4E19A 4CF8A 1Q8IA 1SKRA 3MEEA 1KFSA 1WSFA 2B5JA 3S3NA 3CM5A 1I3AA 4AHCA 1MU2A 1BQMA 3MXIA 2X6SA 4JLHA 4CHZA 3OYDA 4Z4HA 3OYFA 1ASVA 4GW6A 4DFJA 4I7FA 1A5VA 1RT4A 4CJSA 4KTZA 4FW1A 3OYHA 3SQ0A 1VRTA 4OGEA 2LSNA 2P51A 3LZIA 5I42A 2XRIA 1C0UA 1CZ9A 1LW0A 4ICLA 4YFUA 1HQEA 4O5BA 3NE6A 5JS2A 3NGIA 3V4IA 3PO4A 2KFNA 4KHWA 4RW6A 2R7YA 3L2WA 4W5RA 3VQAA 3AVCA 2HHTA 3HPHA 2DFFA 1J5OA 1J9AA 4CFBA 3ZSOA 4ELVA 4F3OA 1ZBHA 4CGHA 3RWUA 3I0SA 3LWMA 3RMAA 3PX6A 3ZSYA 3SV4A 3L3UA 4Q5VA 3LPTA 1JL1A 2ZE2A 3ALYA 3G10A 3VQCA 3DOKA 3L2UA 1WSEA 3P83D 4AHTA 1L3TA 3SPZA 3VA0A 1VSIA 4DQRA 1T7PA 3K59A 1NK7A 2P5OA 5HRSA 3RMDA 1JXEA 3KJVA 4OKJA 4FJ9A 3V1OA 5CZ1A 4FM1A 4QOZB 3M8QA 1TL1A 2Z1IA 1XHZA 4AH9A 1QSYA 2GBZA 1ZBLA 4FJKA 3P1GA 4LSLA 3KTQA 3V1QA 3SQ4A 3SI6A 2QK9A 1IH7A 1ZBFA 3NHGA 3OJSA 4DS4A 1U04A 5CYMA 3QEXA 2A1RA 4DQPA 1X9SA 4FJXA 3K58A 3DLKA 2G8IA 4DTNA 2HHUA 3TR8A 3QNNA 5HRPA 1UA1A 4DSFA 1L5UA 3AV9A 4KHQA 1FKOA 4M45A 1RDDA 5K14A 5C42A 2GUIA 2IDOA 4Z4EA 3SCXA 4FJIA 4KB1A 3AO5A 4JS5A 4OKKA 5KI6A 1D8YA 3AO1A 5SWMA 3V6DA 1LAWA 4LSNA 4CF9A 1YTUA 1TAUA 1CZBA 4CECA 3HPGA 2HMIA 3VQEA 4N56A 1RT7A 4EP5A 3OYGA 3V9UA 4H4OA 3SZ2A 4C8MA 1RCHA 2D0CA 3RMCA 4UQGA 4DTRA 1D9FA 2ITGA 4Q0BA 1TK0A 1NK6A 3SUOA 1NJWA 3L2QA 3MXJA 2OA8A 4QAGA 3K5LA 3ZSQA 3TAFA 1VSFA 3RMBA 4B9MA 3TANA 3E01A 4BE2A 1VSMA 3NF7A 1C1BA 2VG7A 4O0IA 2BGGA 4FLTA 3OYJA 3NGYA 3VQ7A 2W42A 1WSJA 4DQSA 4NCBA 1T05A 4GVMA 3CFRA 1RT6A 1DLOA 1UA0A 5KGWA 3NF8A 3DRSA 4KI4A 2ZQBA 2IS3A 3OYMA 2WOMA 1ASWA 2YKMA 3LP3A 3V9WA 2A1SA 2QKBA 2HHQA 3SQ2A 4KPYA 2HB5A 4BDYA 1YVUA 3MECA 4FJJA 4RW9A 2PYJA 3CFOA 3L3VA 3RRHA 1TKZA 4M3UA 4CHPA 1S6PA 2KFZA 3L2VA 4M41A 3DLHA 4CFDA 3AVNA 2YNGA 3V9ZA 4ZTFA 4E7LA 4HCBA 1RBUA 5J2QA 3OYCA 1RTJA 2E6MA 2QXFA 4KAZA 4J2DA 1A5WA 1BISA 4MQ3A 1LV5A 3RR8A 4EZ6A 3OS2A 1RT3A 1RT1A 3K5MA 4W5OA 4NYNA 3ZSWA 3OYLA 1ZBIA 3KIOA 4CF1A 1S9GA 2IGIA 1U48A 4N76A 3HYFA 2D0BA 2WONA 4FJ5A 2BE2A 1JLAA 2AJQA 1RDBA 4N5SA 2RN2A 2Q3SA 4KHSA 1IG9A 2HW3A 3EYZA 3OVNA 1W0HA 4M3YA 1C6VA 4DU1A 3CFPA 4O0JA 1SKSA 4KHYA 2Z1HA 3AVLA 1BI4A 4F3TA 2VWJA 1VSJA 3VA3A 1BL3A 5HRRA 2HNDA 2IAJA 1VSKA 1SKWA 4FW2A 1QHTA 3V9XA 3FFIA 3MXMA 3QEIA 1KFDA 2XHBA 3O3GA 4C8KA 2YNFA 1KTQA 3WNGA 1QSLA 2HHSA 2DY4A 4FLXA 4OVLA 3OYNA 3QIPA 3THVA 3ZT3A 2XO7A 4J2EA 4DSEA 4B8CA 4DQQA 1L3UA 4DTMA 1KCFA 1ASUA 5SZTA 4KRFA 3A2FA 1IKVA 2X74A 2B4JA 4FJ8A 2G8UA 1JLEA 1SV5A 1HNIA 4W5NA 3LANA 2BANA 2P1JA 4HUFA 4Z4CA 1RT2A 1W9HA 5HP1A 4E0DA 4B08A 3OYBA 4HUGA 3AVMA 3HPOA 3VQBA 4F4KA 1LWCA 4CEAA 3TAPA 2G8FA 4PWDA 1S1XA 4IFVA 4Y1DA 1KVBA 4GMJB 3MAQA 3B6PA 4ID1A 4F2SA 1REVA 4IBNA 3HK2A 4DS5A 3QNOA 2HNYA 1S6QA 4I9LA 3NBPA 4M3TA 1JLFA 4IDKA 3KLGA 4FK0A 2Z1GA 4Z4IA 2I5JA 3OJUA 2F8SA 1VSLA 2OYQA 1TKTA 4I2QA 1L3VA 4IFYA 3DM2A 4E7IA 4DTSA 2F96A 3AVJA 3HXMA 4AHSA 4DWIA 5D3GA 3AVHA 2RKIA 3TAEA 2GV9A 4CERA 1NK0A 4B9NA 1VSEA 3K5OA 1RT5A 3HJFA 3KKRA 3O3FA 3ZT0A 1KSPA 3DYAA 2E6LA 4CJTA 2KW4A 1FK9A 3NH1A 2D5RA 1YTAA 3LPUA 4RW4A 3VN5A 4FZXC 1J53A 1TKDA 1EXQA 1WLJA 3AO2A 4KO0A 2YKNA 4DSJA 2HHVA 3KLEA 3LALA 2DFHA 4FCYA 3KKSA 4FJNA 4DSKA 4AHUA 1HYZA 4J2BA 1JKHA 4KFBA 1BCMA
chains in the Genus database with same CATH superfamily
1X9MA 1GLJO 1QQMA 3QBWA 1KRPA 3KLHA 3K0SA 3CJ7A 4LD0A 3MX2A 4BDZA 4X65K 2Y1JA 4Z4GA 1TUUA 1BOTO 5C24A 4JI4K 2ZF5O 1NM1A 3Q7BA 4DV6K 4XIUA 2VG5A 4MDBA 3ID6A 4KKOA 4KV8A 4YY3K 4CJ4A 1YVNA 3OYEA 4CVNE 3NF9A 1ITGA 3HVTA 1GLAG 4M3RA 4B1VA 2YJEA 1C0MA 1NJXA 4CZHA 4CZGA 4CJKA 5T7BA 1LWFA 1KD1O 1BUPA 3E9LA 3VGLA 3KLIA 4DV1K 3SBTA 5GIOA 3TSQA 3L4IA 1JLGA 4M3WA 5AQSA 3VF6A 3OTOK 1GOBA 3NVKA 4O55A 5E26A 1RBTA 1KLNA 4E7JA 5C25A 4KREA 5J2MA 3CJ9A 2OPSA 3CCLN 4OKEA 4OPAA 4KTWA 4PKIA 3T1AA 4X62K 4YNQA 4W5TA 1X3MA 3QO9A 3BUZB 4CF0A 3MN7A 4JD2A 2XY5A 4Z4FA 3E1YA 1CXQA 3QMLA 1I39A 3ULEB 1Q86O 3EY1A 5HRNA 4WQ4A 4B3SK 3H46O 2A40A 2ZM6K 3CCMN 3CCUN 3OBWA 5AQPA 3THYA 2QWLA 1BI4B 3CF5L 1GOAA 1U4BA 5DMRA 3UIQA 3BF1A 1SL0A 5JLHA 3FLCO 1NGDA 3M3ZA 3CCQN 2EX3A 4RG8A 2PZSA 3K2PA 3VTHA 1QTMA 3ENOA 3ZSVA 4FO0A 3PO5A 4CJFA 1VQPN 2OPQA 3DLEA 4JKCA 4FWRA 4DR1K 3ITHA 2A42A 4CJLA 3ZT4A 1IKYA 4A61A 2PAVA 1VQ8N 4WQ4C 4DV0K 1G99A 1BA1A 3K57A 4FLWA 1DKGD 3TSPA 2ZGZA 3CD6N 2UXBK 4ELTA 4BROA 2FLOA 3VEZA 5FPNA 4LY7A 4PL8A 4IZ9A 3AVKA 1UWBA 1I94K 3RTVA 4FLVA 1SL1A 3F9MA 1TL3A 1LCUA 4FPAA 3M1FA 1NMDA 4DLEA 4JRPA 2HBMA 1YT3A 2YNIA 3NDKA 4F9OA 1SUQA 4B1UB 1B9DA 5CE3A 1HNWK 4B9SA 2WUSA 5KPTA 1WB9A 4YORA 4WE1A 1N34K 2KHOA 2A3ZA 4OGCA 2QKKA 4QCLA 2UUAK 5KGXA 4LFBK 3EE8A 3ZX2A 2KQ2A 3ISNC 1RTDA 4AF1A 3K5NA 2O4IA 3ZT1A 3P4IA 2ATQA 3ZSRA 4N47A 3M8PA 3AO3A 2E5LK 1YIJN 5AQWA 4DQ8A 1U49A 1NKEA 5AQQA 3L0QA 1HMVA 4K43A 1HNVA 4M7YA 4PUOA 3DMJA 3QETA 3BDPA 1JJ2M 4NCGA 2YHBA 3J7AP 4NCAA 3THXB 5TKWA 2VQFK 4B9TA 1YJNN 1TV6A 2P9NA 5FRMA 2E2OA 3KZBA 5IWAK 5AZJA 2E4LA 3A5LC 4DTJA 4FK4A 1NU0A 5C10A 4B9LA 3L8BA 3SYZA 2OANA 3HP9A 1QQOA 2QEXN 1U47A 4DG1A 4IG0A 4JD2B 2HSTA 2F9WA 4EFHA 5KRTA 1KC8O 3PSIA 4DFPA 3L2RA 1K8KB 4CZEA 3PX0A 4I6MA 4CGFA 3HTVA 4QS8A 1VQKN 4E19A 1Q8IA 3QBXA 1SKRA 1WSFA 2QWPA 5B8HA 3S3NA 1MU2A 2X6SA 4BC3A 4I7FA 2FSNA 3SQ0A 3OYHA 1YITN 1VRTA 2UU9K 4KBOA 3O80A 4A62A 4ICLA 1OH5A 3VQAA 2NRHA 3A5NC 1NGGA 4CGHA 3RWUA 3WXIA 3LWMA 2UYTA 3LPTA 3VQCA 1WSEA 3P83D 4DR3K 4DQRA 1VSIA 4CBXA 1JXEA 2QW9A 4FJ9A 4FM1A 4ISGA 5C2FA 1XHZA 1QSYA 5JVGL 4WYBA 3O9QA 3P1GA 5JICA 4GY2B 3OJSA 2UUCK 3DWLA 4DR2K 3J8AA 5AFUH 4DTNA 3TR8A 5HRPA 4KHQA 4M45A 2GUIA 4Z4EA 3SCXA 4KB1A 4OKKA 5SWMA 3C7NA 4LSNA 3CIPA 1CZBA 1QQNA 4DKWA 1XNRK 2P9UB 4H4OA 4C8MA 2PBDA 4UQGA 4Q0BA 5AR0A 3HRGA 3MN6A 1NK6A 3SUOA 4NO7A 4QAGA 1DT9A 3ZSQA 3TAFA 1K9MO 4JI5K 1C0FA 1C1BA 1C0GA 2VG7A 3MN9A 3B8AX 3NGYA 3VQ7A 4NCBA 4GV6A 3UKRB 1T05A 3TSUA 1DLOA 1T6CA 3BEXA 2IS3A 2WOMA 3E9PA 3V9WA 4B1WB 4KPYA 2PYJA 1VQLN 1TKZA 5FPEA 4CHPA 2KFZA 4A2AA 4OO1J 4M41A 4MDAA 4C1NK 4HCBA 4E7LA 1RBUA 1W97L 3BP8A 2E6MA 1LV5A 4MQ3A 4BRCA 1RT1A 4W5OA 3OYLA 3ZSWA 1ZBIA 3CC7N 3KIOA 1U48A 4CD1A 4JKDA 1JLAA 2AJQA 1RDBA 3EYZA 3OVNA 4DU1A 2VWJA 2WC9A 3Q7CA 2HNDA 3V9XA 1KFDA 4C8KA 1VQNN 4DR6K 2HHSA 5GAEP 3ZT3A 2Q2RA 4DTMA 1KCFA 2X74A 4FJ8A 1JLEA 1E4FT 2P1JA 2KKZA 3JXUA 1W9HA 3VEXA 4E0DA 4B08A 3HPOA 4CEAA 2O8DB 3TPQA 4IFVA 4Y1DA 4BRMA 1VQ9N 3SMPA 3B6PA 3J81O 3FZLA 3HK2A 4BQZA 1S6QA 4I9LA 3CERA 3NBPA 4DCHA 1JLFA 4FK0A 2HF3A 2F8SA 3EKUA 3D7EO 3O08A 3N4QA 4IWVA 1L3VA 4IFYA 2P9PA 3DXKA 4DTSA 4FWMA 5A2QO 4HTLA 4L3QA 2UUBK 4EAHD 3K5OA 3HJFA 1RT5A 1QZ6A 4CJTA 4K41A 4M63C 3VN5A 4JN4A 3FZKA 1HJOA 2HHVA 2E8AA 5BPMA 3H1VX 4JK9A 3KKSA 5LJWA 4M7XA 4J2BA 2YCHA 4BRGA 4KFBA 2O8EA 5AZIB 5EY4A 1HRHA 2FBVA 2Q36A 4MFBA 3VQ6A 2XY6A 5HLFA 2VCPA 3ZETA 2RE2A 4W5QA 1UOCA 5E41A 5BN8A 4H5WA 5M1KA 5AQZA 4DB3A 4OLBA 3I33A 3LP1A 5FROA 3KD1E 3VETA 5BRFA 1HNZK 1XC9A 3HT3A 4BGBA 2UXCK 3O9SA 4NB4A 2G8HA 1KAYA 3P5JA 4CJ5A 3KD5E 4BACA 3H3NO 4AILC 4XEIA 2NRRA 1RDAA 3WEEB 2ZGYA 3WUHA 2KLAA 3WXLA 1HQUA 4AM7A 4B3MK 1GLBG 2W6KA 4CESA 3SNNA 3P38A 5CYQA 3I0RA 3FZFA 4CHYA 3F9KA 1BHLA 3PUFA 4JI1K 4FOEA 4JEPA 1TK8A 3VQ8A 4O44A 4CFCA 5BR8K 1YF5L 2NUBA 5BPNA 2A41A 4FWPA 4CI6A 3THXA 4LF8K 4KI6A 4KH6A 1EWRA 5F1XA 3VEOA 3SV3A 3ZX0A 3ZEUA 3OYAA 1NOYA 4KHPK 4CGJA 3EO3A 5GAGP 1NGIA 4CW7B 2KZMA 3NH2A 1TKXA 1VSDA 2OZMA 2F9TA 3O9TA 2HNZA 4U67L 2AA4A 4R79A 3AO4A 3LAMA 2V7ZA 3WNFA 4FLYA 3TU5A 3VQQA 2B6AA 3EE9A 3DLRA 4BDPA 5CZ2A 3SMSA 3U6FA 1KVCA 1SS6A 4YHHK 2DFEA 3DRRA 3P31A 4XH1A 4CJ3A 4CJPA 2QM1A 5LJVA 4PQUA 4BRIA 3CG7A 3VQ5A 3SAFA 4PA1A 1HPZA 3JYTA 1IKXA 3IG1A 4H5VA 4CZKA 1GOCA 4BRHA 3D0PA 2XY7A 3THWA 2Z1JA 3DRPA 1QSSA 3CCVN 2DTUA 3H6EA 1C0TA 4JAXA 4V19S 3I8DA 2G8WA 2FC0A 3GL1A 3JSMA 4BQLA 5AZJB 3TI0A 1S1TA 2Q1NA 3F5TA 5FLXO 4DTPA 3LDSA 3M8RA 3TABA 4I9QA 4CF2A 5C0YA 3AAQA 4Y1CA 3C65A 3CJ1A 4YDUA 1GLDG 4NXNK 3KVGA 3CYMA 3NVMA 5M1PA 3SUQA 1J54A 3BGRA 4CGDA 3PV8A 1MWMA 4DF8A 3S3MA 3KWGA 1VQ6N 3VF2A 4FWNA 4I6MB 1WSGA 1DTQA 2KTQA 3SPYA 2E2QA 2OTJN 2O8CB 3R8EA 4CE9A 4HCCA 4H8KA 3D45A 4HHTA 4BE0A 2OTLN 1EQYA 3MEGA 4J2AA 4IG3A 5AQYA 3QINA 4FJGA 3ID8A 3V1RA 5KQ8A 1QVFM 1WAJA 4H0PA 1K8AO 1IBMK 3QEPA 2H3GX 3CQ8A 4B3OA 3NFAA 1NK9A 1EKEA 1S1VA 3QERA 5EVZA 1QHAA 3UKUA 3WT0A 2ASPA 3AVBA 3VQ9A 4BE1A 4FJMA 3CI5A 1XHXA 3T1HK 3THWB 3D2EB 2GEMA 3QFPA 4OJRA 4F8RA 3G0ZA 1D5AA 1N6QA 4JKGA 4CHNA 3PX4A 1VRUA 3MN5A 1JXBA 1BQNA 4NLCA 1U2VB 4L8RB 1S1UA 2QTDA 2Y1IA 1C1AA 3S9HA 4M3ZA 3FFKB 4KHSA 4FM0A 4DFKA 3V81A 4ZTJA 1NKBA 1BG3A 2QWMA 4MLEA 1WN7A 3F2KA 4IFEA 4FSVA 4KHUA 4JYAK 4GKJK 1R0AA 4WFNL 4FM2A 2IC3A 4EP4A 4BR5A 3SAGA 4PY5A 1XWLA 1KLMA 1TK5A 1A5XA 4RCHA 3HL8A 3C7NB 4FLZA 1GLFO 1S22A 2YV0X 4WF9L 5JLFA 2HHXA 4LH5A 3AGRA 1XMQK 3NF6A 2ZJRL 1LW2A 3S3OA 3IUCA 1YUWA 1KFSA 2YJFA 3CM5A 4WQ5A 2P9LB 1ZXOA 5CHIA 4CHZA 4Z4HA 3OYFA 1ASVA 1A5VA 5C12A 1LOTB 4CJSA 1OH6A 4FW1A 3EL2A 3LZIA 4MO4A 5GINA 1C0UA 4Z94A 3NGIA 3V4IA 4O5BA 4A59A 1TYQB 4RW6A 3WXKA 2I7PA 2HHTA 1J5OA 1J9AA 4WFBL 4CFBA 4ELVA 4FWKA 1XNQK 3L3UA 2ZE2A 3G10A 2DPNA 3DOKA 1L3TA 1S72N 3VA0A 1VQMN 3U4LA 3RMDA 5EXWA 4FWOA 3KJVA 4OKJA 4HWIA 3V1OA 5CZ1A 4H0XB 4ILJA 1HX1A 4QOZB 3M8QA 4AH9A 5ADXH 2IVOA 1ZBLA 3KTQA 4LSLA 3V1QA 1ZBFA 1MDUB 3PIOL 3NHGA 2Q31A 2QI2A 4DQPA 1X9SA 3K58A 3DLKA 2ASOA 2G8IA 2WFBA 4LC9B 4DR4K 1R59O 2A6AA 1ESVA 3AV9A 3RSEB 3MCAB 5K14A 2IDOA 4FJIA 4A2BA 3AO5A 4JS5A 2P9UA 4O8UA 2CGKA 4A5AA 5AQJA 4U7BA 2HMIA 4LF5K 1RT7A 4EP5A 3VEVA 3RMCA 3C0BA 4XH4A 1T44A 4DTRA 2ITGA 1YHQN 1D9FA 2A5XA 2OA8A 3U8XA 4BRLA 3K5LA 2YX6A 1VSFA 4BRQA 3RMBA 4BVOA 3E01A 3WXJA 1VSMA 2BGGA 3OYJA 4DV3K 1IBLK 4JI7K 3CC4N 3HBTA 4GVMA 3CFRA 1UA0A 2ITMA 2ZQBA 4QS7A 2QKBA 1IJJA 5LMUK 4RW9A 3CFOA 4CZJA 2CH5A 3L3VA 3L2VA 1VQ4N 3O8MA 4CFDA 5DM6L 3BY5A 4ZTFA 1RTJA 4J2DA 2P9SA 5GAHP 1ATRA 4CF1A 1S9GA 2IGIA 4JK7A 2E88A 1WBBA 2BE2A 2O8EB 1OVQA 1ILYA 1IG9A 2AP1A 4RTFD 1W0HA 4M3YA 1C6VA 4O0JA 2P9KA 3AVLA 1VSJA 5HRRA 1SKWA 1ZBSA 3BZKA 1SZ2A 3C6HA 3O9UA 3FFIA 3QEIA 4H03B 4BRAA 3O3GA 1QSLA 4CJ7A 4FLXA 5AQMA 4ILGB 1D4XA 4B8CA 3A2FA 2B4JA 2G8UA 1FW6A 1SV5A 1HNIA 4W5NA 2E1ZA 2BANA 3O4WA 3IFRA 4Z4CA 4K0KK 3OYBA 3SAHA 5ADXA 3A8YA 5M1QA 4PWDA 2VYPA 4GMJB 2Q0UA 5LY3A 2FF6A 4DS5A 4OX9K 1IG8A 5FPDA 4M3TA 1O13A 4Z4IA 2NLXA 1VSLA 4B9QA 1RDWX 1TKTA 2O8FB 3FZMA 3DM2A 5FPMA 4E7IA 2F96A 3HXMA 3U9ZA 2YHYA 4IOXA 5D3GA 3AVHA 2GV9A 3LDOA 5AQXA 3HZ6A 2O8BB 4PHTX 2E6LA 1FK9A 4CBWA 3NH1A 3KHYA 1P90A 2VWBA 1YTAA 3LPUA 5AZIA 1J53A 3PSFA 4DSJA 1BWFO 4FWSA 4AHUA 4DSKA 2FBYA 3AA5X 3LDLA 3MCPA 1NGAA 2JLEA 1BA0A 3OA9A 1Z05A 4J8FA 3TAMA 1IKWA 2ZD1A 5I3UA 1FKPA 1VAZA 3DLGA 5AQTA 2FBTA 1ZC6A 1NJYA 3RSEA 2QA4N 3WQTA 4RW7A 4CGIA 3KK2A 4DUYK 1NJZA 3GG4A 3ATUA 3I55N 5FRNA 4DQIA 3IS9A 1RILA 3LZJA 3MWTA 4CZIA 3NAEA 1Z26A 4JV5K 4IXCA 3CPWM 5JVHL 3LWLA 2HHWA 3OY9A 3FE1A 2UXDK 2O8DA 4NYFA 2V52B 4DSLA 4CZMA 3K9JA 1Q9XA 3ENHA 5AQIA 2W40A 1SQKA 3AAPA 3ASMA 3OYKA 3VENA 4WCEL 1S1WA 3NMUA 5F2RA 4DV2K 1JL2A 4IDHA 3ZEUB 3W3DA 3HSTB 5EU7A 3T3FA 2Q97A 3QIOA 3A5OC 4FJLA 4K8XA 4LF9K 5AQGA 1BO5O 4A5BA 4M3XA 4CZLA 4DHYA 3TARA 1JLBA 1WSHA 3IAYA 2EWSA 3AY9A 4ZHRA 2RPIA 4BR9A 4CJVA 2E2NA 1J6ZA 3LAKA 4FZZA 3OYIA 1L3SA 1WSIA 3CM6A 3TAQA 4NXMK 3U3YA 5J2PA 3FZHA 2F8TA 4B1XB 1BGXT 5KRSA 1N5YA 4GVEA 2V7YA 2X78A 3EZ5A 3H3OB 3AGKA 1VQ5N 3LP2A 3FR0A 1B92A 3PLAA 4PL7A 5HROA 1DTTA 1NK4A 4AHVA 1IO2A 4GV9A 1ZBUA 2IOCA 4GKKK 1QE1A 4CEQA 1HYVA 2XY8A 3OHRA 1BIUA 3GOIA 4H0OA 4OPJA 4B9VA 2PYLA 4DSIA 4KHNA 3TWHA 3TTDA 4E7KA 1WNSA 1NKCA 4B8AB 4A57A 5E84A 2HVIA 3SK3A 1VQ7N 4DMNA 1OVYA 1X9JA 3VQDA 4M42A 2ZJQL 1QZ5A 1X1PA 1KAXA 1RDCA 1ZYQA 1VK0A 3AVGA 3VMFB 3KLFA 4B9UA 3NCIA 4EZ9A 4OLAA 4KH4A 3IKMA 3QEWA 1RBRA 4DU3A 3SUNA 4FK2A 5C15A 2D0PA 1X9WA 2GUPA 3DLBA 1NGJA 5FDLA 4AHRA 1NK5A 1SL2A 4BRKA 4DV4K 3WNHA 1S9EA 1YJWN 4BR7A 1D9DA 1CLQA 4ID5A 2JGUA 2P9IA 4E1MA 3I56N 3OS1A 1LAVA 3R1XA 3M8SA 4FVMA 2NRVA 3J80O 1B9FA 2BH1A 3D2EA 1Z25A 1M1KO 3H08A 5BRDA 3SQ1A 4FZYA 2P5GA 1JCFA 1H1VA 4CGGA 3DXMA 3EEQA 2ETJA 2NRZA 4JKHA 1VQON 1BDGA 3CCSN 1T8EA 3TAGA 3VGKA 4JKGB 4CEFA 1FJGK 4LH4A 4JS4A 1XC3A 4E1JA 1YJ9N 5DK5A 5KPRA 4BWMA 4CZFA 2W41A 3SJJA 1HKGA 4CK1A 1U6ZA 3ZSXA 1RFQA 1JLCA 4IEEA 3ZLJA 4E89A 5CY4A 4IJAA 1HKCA 1NLVA 1VSHA 3AA4A 2GWJA 3BZCA 1BU6O 2CH6A 1QS4A 3VOVA 4C8NA 2G8KA 2D4WA 2D0OA 4BWJA 3C6TA 3M5RA 1S5JA 3ATVA 4K8ZA 1NK8A 3UKRA 1HJRA 4KB0A 4OPHA 3WXMB 1HKBA 3D2FA 4CF8A 3MEEA 4G9ZA 3K9KA 5BREA 2B5JA 1I3AA 3LDNA 3MWPA 1BQMA 3MXIA 3LL3A 2WBNA 4EIAA 4GW6A 5BRHA 5C2DA 4DFJA 4DUZK 1RT4A 2OCEA 4C1NI 1NMNA 4OGEA 2LSNA 2P51A 5I42A 2XRIA 2QWOA 1CZ9A 1LW0A 4YFUA 1HQEA 3CETA 4KHWA 5EOYA 2R7YA 3L2WA 4W5RA 2P9IB 2DFFA 3CQXA 2ZJPL 3EKSA 4BY9C 4BGAA 3I0SA 3RMAA 4YOYA 3SV4A 3CJCA 4Q5VA 1JL1A 3ALYA 4C23A 3L2UA 4AHTA 3E66A 3SPZA 2FSKA 4CBUA 4MLHA 5HRSA 4BR0A 1TL1A 2Z1IA 1Z6RA 4FJKA 1RDUA 2YI1A 2A1RA 1U04A 5CYMA 4YOXA 1XMOK 2HHUA 1KXPA 3QNNA 4DSFA 1FKOA 3MMVA 5C42A 5GADP 2HHHK 1D8YA 5KI6A 4YDUC 3AO1A 3V6DA 3CQYA 1LAWA 1Q81O 1TAUA 2JWLA 1YTUA 3HPGA 3VQEA 3OYGA 3V9UA 3SZ2A 1RCHA 3VF4A 1Y64A 4JI3K 3MXJA 3D2FB 5KPZA 4BE2A 1WUAA 4O0IA 3MDQA 4FLTA 1NWKA 4JKAA 2W42A 3QICA 1WSJA 4DQSA 1HNXK 1HPMA 5KGWA 3CJAA 4KI4A 3OYMA 4BRNA 2P9LA 3LP3A 2O8FA 1N32K 3G4SN 4X66K 4BDYA 1YVUA 5AJ3K 3H1QA 3RRHA 5BR9A 4FWLA 3AVNA 2YNGA 3V9ZA 1TYQA 5J2QA 3OYCA 2QXFA 4AM6A 3VEYA 4KAZA 4DR5K 4BR4A 3CCRN 4EZ6A 3DXMB 4NYNA 1GLCG 5F0XA 4N76A 3HYFA 2D0BA 2QWQA 2D1KA 2P9KB 2JWKA 2RN2A 2HW3A 1SKSA 3CFPA 2Z1HA 5M1OA 4F3TA 3RVCA 2IAJA 4FW2A 4JNEA 3MXMA 4JI0K 4EHTA 2F4VK 1KTQA 3TTFA 3WNGA 2DY4A 2BUPA 3OYNA 3QIPA 4J2EA 4DQQA 3CPEA 1L3UA 4KRFA 1ASUA 1IKVA 3IDHA 4UY8O 3LANA 4DR7K 4HUGA 4LFAK 3VQBA 1LWCA 2GTDA 3TAPA 1IBKK 5AQVA 3HOSA 2VQEK 2HF4A 1SAZA 4F2SA 4IBNA 3QNOA 3LM2A 1S3XA 2HNYA 4YOWA 3M6GA 3R3LA 3DXKB 4IDKA 3KLGA 4XH5A 2I5JA 4H5TA 1NGHA 3J7ZO 4ILHA 1NBWA 3AVJA 4DV7K 2Q0RA 5AFUA 4DWIA 3TAEA 4B9NA 5AQOA 3KKRA 1KSPA 3AARA 3DYAA 2HOEA 4RW4A 2O8BA 1TKDA 1WLJA 3AO2A 2NZTA 4K42A 2IVNA 1J5EK 2QWRA 4FCYA 4FJNA 4BRDA 3DJCA 2VG6A 4N41A 5AQNA 3GBTA 3VQPA 1EETA 3ZSZA 2P9SB 2YHWA 1RNHA 5M1NA 4O8KA 2J4RA 5HBMA 3CMEN 4F2RA 1QQCA 2V51B 4HVJA 3SBGA 1HYSA 4I2PA 1NOZA 5AQRA 3R9PA 3RRGA 4FYDA 3QESA 4DF4A 1M90O 2F7TA 5CR4A 3VTIA 3VQ4A 4CD3A 1RTIA 2E20A 4KH5A 2ZWHA 3QFUA 4WFAL 1VHXA 3T7ZA 3T19A 4CFAA 4JI8K 2WTUA 2D0AA 3CCEN 5HL7L 4Y0WA 4BR2A 1HR0K 3SUPA 1T03A 3BF3A 4CIFA 3WEEA 2HMPA 4CJWA 1Q9YA 4H0TB 4JHDB 3SJHA 3VESA 1HLUA 5J1EA 1Y97A 4JKEA 1RBVA 1X3NA 4CK3A 1MWKA 4CEBA 4B3RK 4HUEA 4C8LA 4CJRA 5HOOA 3ULDA 1W7AA 1NGBA 3AA2A 1OH8A 2EHGA 2P9PB 3DOLA 3MK6A 4OPKA 1O1WA 5JS1A 4CEDA 4CCHA 1RTHA 3HOTA 4H5RA 5H1SQ 4FPBA 5LL6Z 3V9SA 4DU4A 1XI1A 5AQKA 3AA3A 2GELA 1EP4A 4BC5A 3O4QA 1K8KA 2BTFA 2KZZA 1U45A 4IO8A 3U3GA 1N8RO 3HI0A 4BG8A 3N4PA 2FBXA 1XUPO 1JLQA 5J2NA 3TTCA 3T1YK 1T6DA 5I9EB 2ASMA 3CJBA 1NGEA 4H4MA 3DI6A 4CJEA 3ZX3A 1TAQA 4YOUA 1Q7YO 2NRXA 4PKGA 4DTUA 2VWKA 4JK8A 1K6YA 3KK1A 4EHUA 1ATNA 1UAXA 3AVIA 1RBSA 4K25A 1EWQA 3PY8A 4JI6K 1C1CA 3MEDA 4H5NA 4HTUA 3C94A 4FOIA 1YXQA 4DTXA 3HO1A 1TGOA 2YNHA 5BPLA 3GDQA 4CIGA 4DLGA 4RW8A 4CIEA 3O1WA 4WQ5C 2BDPA 3OBYA 2RHKA 2FSJA 3NH0A 5TKYA 1EX4A 4E3SA 3KK3A 3ZCMA 2IIRA 3HM9A 2HVHA 4BC2A 2X6NA 2O4GA 1KQSM 4LF7K 2YHAA 3OS0A 2NNWA 3VEWA 5BN9A 1BCOA 1EO1A 3KK7A 3DLLL 4TSXA 4ELUA 4DTOA 2W6LA 3THYB 4ISEA 3ZETB 4AQYK 4NLBA 4CJUA 1CXUA 2IVPA 3VPZA 1E3MA 1GLLO 3O4NA 3HP6A 4IKFA 3ZT2A 4CEOA 4KTQA 2PY5A 1HUXA 3O1BA 3WNEA 1TVRA 1LWEA 5AQFA 3L4QA 1F21A 4H0YB 4ISFA 4CEZA 4DFMA 4FVUA 4O4GA 3U9DA 5KTQA 2RF2A 3UKUB 4DV5K 4CHQA 1FXXA 4MO5A 2NRWA 3C95A 1KVAA 3ENBA 1WBDA 4CJQA 4E7HA 4R5PA 3LDQA 4JKBA 3NGZA 4BG9A 1G15A 5AQLA 5AQUA 1BIZA 2FXUA 3IRXA 4BREA 5IT9O 3LM9A 4QS9A 3F73A 4CEEA 2E2PA 5AQHA 4E1NA 4FLUA 4FJHA 3DAWA 4JI2K 2OZSA 3AVFA 4FJ7A 4B3TK 3H45C 4Z0UA 3O9RA 3L6QA 4B1ZA 3CCJN 4GV3A 2VGNA 3QLHA 3HVRA 3QEVA 3RR7A 1WAFA 3JS6A 1GLEG 4CK2A 3B6OA 4C8OA 1K73O 2OPRA 4BRPA 3AVAA 2G8VA 3LP0A 3O3HA 2HBJA 4CHOA 4JRQA 3C6UA 2OPPA 3G6EN 3A5MC 4G1QA 5GIPA 3ULEA 4FXDA 1CZAN 4AHCA 4BRFA 3I8BA 4JLHA 3OYDA 1NGFA 4KTZA 2O8CA 1YI2N 3NE6A 3PO4A 4LF4K 5JS2A 2KFNA 1MA9B 3AVCA 3G25A 3HPHA 4FWQA 3ZSOA 4F3OA 1ZBHA 5DM7L 1IV0A 3IMXA 3O6WA 3PX6A 3ZSYA 3WQUA 2PFUA 1T7PA 3K59A 1NK7A 2FF3B 2P5OA 3HM8A 3VGMA 3HSCA 4IOAL 2GBZA 2QK9A 1V4TA 3SQ4A 4X64K 3SI6A 1JCEA 1IH7A 3C6AA 4DS4A 3QEXA 4FJXA 3UB5A 2GWKA 3CMAN 3O5BA 1DGKN 3G71N 1UA1A 1L5UA 1W2BM 1RDDA 3D6RA 2I7NA 4GNIA 1NG9A 4CF9A 1KAZA 4IO9L 4CECA 4N56A 3W0LA 2D0CA 3T69A 1TK0A 2YHXA 3R6MA 1NJWA 3L2QA 4B9MA 3TANA 1ATSA 3NF7A 1OH7A 3P39A 1NJIO 2QXLA 1T3VA 1YAGA 3SLCA 1RT6A 3FGUA 4O5FA 3E9OA 3NF8A 3DRSA 1RGIA 3CC2N 2VGMA 1ASWA 4LFCK 2YKMA 2A1SA 5ELZA 2HHQA 3SQ2A 2HB5A 4YOVA 3MECA 4FJJA 2NRTA 4IEIA 4M3UA 1S6PA 1TUYA 2CGJA 3DLHA 1V4SA 4PKHA 3LDPA 2HBKA 1A5WA 1BISA 3RR8A 3OS2A 1RT3A 3MX5A 3K5MA 5M1FA 2WONA 4FJ5A 1U2VA 4N5SA 1E4GT 1Q82O 2Q3SA 4KHYA 1QVGM 2GX9A 4FL9A 1BI4A 3VA3A 1BL3A 1VSKA 2P9NB 1QHTA 2CGLA 3JAMO 2XHBA 4IOCL 2YNFA 1N36K 4OVLA 4RWTA 3THVA 2XO7A 4DSEA 3OW2M 5SZTA 3A0IX 5MLCQ 4BC4A 3S41A 1XQSC 3KWIA 4HUFA 1RT2A 1NGCA 2HBLA 4IJNA 5HP1A 1N33K 3AVMA 4F4KA 3ZYYX 3EZWA 4JHDA 2G8FA 1WOQA 3CXCM 1S1XA 3QDKA 5LMNK 1KVBA 3MAQA 4ID1A 1REVA 4JKFA 1JCGA 2Z1GA 3UE5A 3VERA 2E1YA 3OJUA 2OYQA 4I2QA 2QWNA 5KQDA 4H0VB 4YOTA 1OKJA 5EX5A 4AHSA 2RKIA 4CERA 1NK0A 1VSEA 1DEJA 3EN9A 5JMVA 3O3FA 3ZT0A 4LF6K 3QB0A 2KW4A 3J7YP 2D5RA 1P8ZA 4FZXC 1Q18A 1EXQA 4KO0A 2YKNA 3CHWA 3GE1A 3KLEA 3LALA 3PIPL 2DFHA 1NNEA 1HYZA 4BVPA 1JKHA 4B1YB 1BCMA
chains in the Genus database with same CATH topology
2FBYA 2VG6A 4N41A 3AA5X 1HRHA 2FBVA 2JLEA 1X9MA 4MFBA 3VQPA 1EETA 3ZSZA 3VQ6A 2XY6A 5HLFA 3TAMA 1IKWA 1RNHA 4W5QA 1KRPA 3KLHA 2ZD1A 1UOCA 5I3UA 5HBMA 1FKPA 3DLGA 5E41A 4F2RA 1QQCA 2FBTA 4LD0A 4BDZA 1NJYA 4HVJA 1HYSA 4I2PA 1NOZA 4RW7A 4CGIA 3KK2A 1NJZA 2Y1JA 3RRGA 4Z4GA 4FYDA 5C24A 5FRNA 3QESA 4DF4A 4OLBA 4DQIA 3IS9A 5FROA 3LP1A 4XIUA 2VG5A 3KD1E 1RILA 3LZJA 1XC9A 3NAEA 3HT3A 1Z26A 3VQ4A 2G8HA 1RTIA 4KKOA 4KV8A 3LWLA 2HHWA 3P5JA 4CJ5A 4CJ4A 3OY9A 3OYEA 3KD5E 4BACA 3T19A 4CFAA 3NF9A 4NYFA 1ITGA 4AILC 2D0AA 1RDAA 4DSLA 3HVTA 4M3RA 1HQUA 1Q9XA 1C0MA 4CESA 1NJXA 3SNNA 3SUPA 5CYQA 1T03A 3I0RA 4CIFA 4CJKA 5T7BA 1LWFA 4CHYA 3F9KA 1BHLA 3PUFA 3OYKA 3ASMA 3KLIA 4CJWA 1TK8A 3VQ8A 1S1WA 1Q9YA 4O44A 1JL2A 4CFCA 1JLGA 4M3WA 2NUBA 1Y97A 5J1EA 1RBVA 1GOBA 3HSTB 5EU7A 3T3FA 3QIOA 4O55A 4CK3A 4CEBA 1RBTA 4KI6A 1KLNA 4FJLA 4K8XA 3SV3A 4HUEA 4C8LA 4CJRA 3OYAA 5C25A 3ULDA 4E7JA 1NOYA 3AA2A 4KREA 4CGJA 4M3XA 2EHGA 5J2MA 3DOLA 1JLBA 1WSHA 3TARA 3IAYA 4OPKA 1O1WA 2OPSA 4ZHRA 4OKEA 2RPIA 4CEDA 4CJVA 4CCHA 4KTWA 5JS1A 2KZMA 3T1AA 1RTHA 3NH2A 1TKXA 3LAKA 1VSDA 2OZMA 4YNQA 4W5TA 4FZZA 3OYIA 2HNZA 3QO9A 4CF0A 3V9SA 4DU4A 1WSIA 1XI1A 1L3SA 3CM6A 3AO4A 3TAQA 3AA3A 2XY5A 3LAMA 4Z4FA 3WNFA 1EP4A 4FLYA 3U3YA 3O4QA 3VQQA 2B6AA 5J2PA 1CXQA 1I39A 2F8TA 2KZZA 3EY1A 5HRNA 1BGXT 5KRSA 1U45A 3DLRA 1N5YA 5CZ2A 4BDPA 3U6FA 3U3GA 2X78A 1KVCA 1BI4B 2FBXA 2DFEA 1JLQA 3DRRA 1GOAA 1U4BA 3EZ5A 5J2NA 5DMRA 3LP2A 3UIQA 4CJ3A 4CJPA 1B92A 4PQUA 3CG7A 3VQ5A 4H4MA 1SL0A 3DI6A 4CJEA 5HROA 4PA1A 1DTTA 1HPZA 3JYTA 1TAQA 1IKXA 3IG1A 1NK4A 4AHVA 1IO2A 1GOCA 2EX3A 3D0PA 4DTUA 4RG8A 1ZBUA 2IOCA 3K2PA 2XY7A 2PZSA 1QTMA 2Z1JA 3DRPA 2VWKA 1K6YA 3KK1A 1QE1A 3ZSVA 1UAXA 3AVIA 1RBSA 3PO5A 1QSSA 3PY8A 4CEQA 1C1CA 1HYVA 2XY8A 4CJFA 1BIUA 2OPQA 3DLEA 2DTUA 3MEDA 4HTUA 4OPJA 1C0TA 3C94A 3ITHA 4B9VA 2PYLA 4DSIA 4DTXA 3I8DA 3HO1A 1TGOA 2YNHA 4KHNA 4CJLA 2G8WA 2FC0A 3ZT4A 1IKYA 4CIGA 3JSMA 3TWHA 4DLGA 4RW8A 4CIEA 4E7KA 1WNSA 3TI0A 1S1TA 3K57A 1NKCA 2BDPA 4B8AB 2HVIA 4FLWA 4DTPA 3NH0A 4DMNA 3LDSA 3M8RA 3TABA 1EX4A 3VQDA 4CF2A 4ELTA 4I9QA 4E3SA 4M42A 4Y1CA 3KK3A 1X1PA 3CYMA 3ZCMA 3SUQA 3HM9A 2HVHA 4LY7A 1J54A 1RDCA 3BGRA 4CGDA 3PV8A 2X6NA 4DF8A 3S3MA 3AVKA 2O4GA 1UWBA 1ZYQA 3RTVA 4FLVA 1VK0A 2YHAA 3AVGA 3OS0A 1SL1A 3KLFA 1TL3A 1WSGA 4B9UA 1DTQA 2KTQA 3NCIA 4EZ9A 4OLAA 3SPYA 4DLEA 1BCOA 3QEWA 1RBRA 4JRPA 4DU3A 3SUNA 4TSXA 4ELUA 4FK2A 4DTOA 1YT3A 2YNIA 1X9WA 3NDKA 4CJUA 1SUQA 3DLBA 1CXUA 4CE9A 4HCCA 1B9DA 4H8KA 5FDLA 4B9SA 4AHRA 3D45A 3O4NA 4HHTA 1NK5A 3HP6A 4BE0A 1SL2A 4WE1A 3WNHA 4IKFA 3MEGA 3ZT2A 1S9EA 4CEOA 4KTQA 4J2AA 1D9DA 1CLQA 4OGCA 2PY5A 4ID5A 2JGUA 4IG3A 2QKKA 4QCLA 3WNEA 3QINA 1TVRA 1LWEA 3V1RA 4E1MA 5KGXA 4FJGA 1F21A 4CEZA 2KQ2A 1WAJA 3OS1A 4DFMA 1LAVA 3QEPA 3M8SA 3ISNC 4FVMA 4O4GA 3CQ8A 1RTDA 4B3OA 5KTQA 3K5NA 2RF2A 1B9FA 4CHQA 2O4IA 3ZT1A 3NFAA 1NK9A 1FXXA 2ATQA 3ZSRA 1EKEA 1S1VA 3C95A 3QERA 4N47A 1Z25A 1KVAA 3AVBA 3VQ9A 3M8PA 3H08A 4BE1A 4FJMA 4CJQA 3SQ1A 4FZYA 2P5GA 1XHXA 4E7HA 4R5PA 4OJRA 4F8RA 3G0ZA 1D5AA 3AO3A 1N6QA 4CGGA 3NGZA 4CHNA 1NKEA 3PX4A 1U49A 2ETJA 1HMVA 1VRUA 1T8EA 1HNVA 1JXBA 3TAGA 1BQNA 1G15A 3DMJA 4PUOA 4CEFA 3QETA 4L8RB 4LH4A 4JS4A 1BIZA 3BDPA 5DK5A 1S1UA 2Y1IA 3S9HA 1C1AA 3IRXA 4M3ZA 4NCGA 4BWMA 4CEEA 2YHBA 4E1NA 3F73A 4FLUA 4FM0A 4FJHA 2OZSA 4NCAA 3AVFA 4DFKA 3V81A 3SJJA 4ZTJA 1NKBA 4CK1A 4B9TA 4Z0UA 1TV6A 4FJ7A 3ZSXA 5FRMA 1JLCA 1WN7A 2E4LA 3QLHA 4E89A 3HVRA 4DTJA 3QEVA 5CY4A 1WAFA 3RR7A 4KHUA 4FK4A 4B9LA 4CK2A 1R0AA 3B6OA 2IC3A 4FM2A 4C8OA 4EP4A 3L8BA 1VSHA 2OPRA 4PY5A 3SYZA 1XWLA 3AVAA 1KLMA 1TK5A 3AA4A 3HP9A 2G8VA 3LP0A 3O3HA 1A5XA 3HL8A 1QS4A 4CHOA 4FLZA 4JRQA 1U47A 2YV0X 4DG1A 3C6UA 4C8NA 2OPPA 2G8KA 4IG0A 4BWJA 3C6TA 5KRTA 1S5JA 4DFPA 4G1QA 3L2RA 2HHXA 4LH5A 4K8ZA 3NF6A 3PX0A 4CGFA 1NK8A 1HJRA 1LW2A 4KB0A 4FXDA 3S3OA 4E19A 4CF8A 1Q8IA 1SKRA 3MEEA 1KFSA 1WSFA 2B5JA 3S3NA 3CM5A 1I3AA 4AHCA 1MU2A 1BQMA 3MXIA 2X6SA 4JLHA 4CHZA 3OYDA 4Z4HA 3OYFA 1ASVA 4GW6A 4DFJA 4I7FA 1A5VA 1RT4A 4CJSA 4KTZA 4FW1A 3OYHA 3SQ0A 1VRTA 4OGEA 2LSNA 2P51A 3LZIA 5I42A 2XRIA 1C0UA 1CZ9A 1LW0A 4ICLA 4YFUA 1HQEA 4O5BA 3NE6A 5JS2A 3NGIA 3V4IA 3PO4A 2KFNA 4KHWA 4RW6A 2R7YA 3L2WA 4W5RA 3VQAA 3AVCA 2HHTA 3HPHA 2DFFA 1J5OA 1J9AA 4CFBA 3ZSOA 4ELVA 4F3OA 1ZBHA 4CGHA 3RWUA 3I0SA 3LWMA 3RMAA 3PX6A 3ZSYA 3SV4A 3L3UA 4Q5VA 3LPTA 1JL1A 2ZE2A 3ALYA 3G10A 3VQCA 3DOKA 3L2UA 1WSEA 3P83D 4AHTA 1L3TA 3SPZA 3VA0A 1VSIA 4DQRA 1T7PA 3K59A 1NK7A 2P5OA 5HRSA 3RMDA 1JXEA 3KJVA 4OKJA 4FJ9A 3V1OA 5CZ1A 4FM1A 4QOZB 3M8QA 1TL1A 2Z1IA 1XHZA 4AH9A 1QSYA 2GBZA 1ZBLA 4FJKA 3P1GA 4LSLA 3KTQA 3V1QA 3SQ4A 3SI6A 2QK9A 1IH7A 1ZBFA 3NHGA 3OJSA 4DS4A 1U04A 5CYMA 3QEXA 2A1RA 4DQPA 1X9SA 4FJXA 3K58A 3DLKA 2G8IA 4DTNA 2HHUA 3TR8A 3QNNA 5HRPA 1UA1A 4DSFA 1L5UA 3AV9A 4KHQA 1FKOA 4M45A 1RDDA 5K14A 5C42A 2GUIA 2IDOA 4Z4EA 3SCXA 4FJIA 4KB1A 3AO5A 4JS5A 4OKKA 5KI6A 1D8YA 3AO1A 5SWMA 3V6DA 1LAWA 4LSNA 4CF9A 1YTUA 1TAUA 1CZBA 4CECA 3HPGA 2HMIA 3VQEA 4N56A 1RT7A 4EP5A 3OYGA 3V9UA 4H4OA 3SZ2A 4C8MA 1RCHA 2D0CA 3RMCA 4UQGA 4DTRA 1D9FA 2ITGA 4Q0BA 1TK0A 1NK6A 3SUOA 1NJWA 3L2QA 3MXJA 2OA8A 4QAGA 3K5LA 3ZSQA 3TAFA 1VSFA 3RMBA 4B9MA 3TANA 3E01A 4BE2A 1VSMA 3NF7A 1C1BA 2VG7A 4O0IA 2BGGA 4FLTA 3OYJA 3NGYA 3VQ7A 2W42A 1WSJA 4DQSA 4NCBA 1T05A 4GVMA 3CFRA 1RT6A 1DLOA 1UA0A 5KGWA 3NF8A 3DRSA 4KI4A 2ZQBA 2IS3A 3OYMA 2WOMA 1ASWA 2YKMA 3LP3A 3V9WA 2A1SA 2QKBA 2HHQA 3SQ2A 4KPYA 2HB5A 4BDYA 1YVUA 3MECA 4FJJA 4RW9A 2PYJA 3CFOA 3L3VA 3RRHA 1TKZA 4M3UA 4CHPA 1S6PA 2KFZA 3L2VA 4M41A 3DLHA 4CFDA 3AVNA 2YNGA 3V9ZA 4ZTFA 4E7LA 4HCBA 1RBUA 5J2QA 3OYCA 1RTJA 2E6MA 2QXFA 4KAZA 4J2DA 1A5WA 1BISA 4MQ3A 1LV5A 3RR8A 4EZ6A 3OS2A 1RT3A 1RT1A 3K5MA 4W5OA 4NYNA 3ZSWA 3OYLA 1ZBIA 3KIOA 4CF1A 1S9GA 2IGIA 1U48A 4N76A 3HYFA 2D0BA 2WONA 4FJ5A 2BE2A 1JLAA 2AJQA 1RDBA 4N5SA 2RN2A 2Q3SA 4KHSA 1IG9A 2HW3A 3EYZA 3OVNA 1W0HA 4M3YA 1C6VA 4DU1A 3CFPA 4O0JA 1SKSA 4KHYA 2Z1HA 3AVLA 1BI4A 4F3TA 2VWJA 1VSJA 3VA3A 1BL3A 5HRRA 2HNDA 2IAJA 1VSKA 1SKWA 4FW2A 1QHTA 3V9XA 3FFIA 3MXMA 3QEIA 1KFDA 2XHBA 3O3GA 4C8KA 2YNFA 1KTQA 3WNGA 1QSLA 2HHSA 2DY4A 4FLXA 4OVLA 3OYNA 3QIPA 3THVA 3ZT3A 2XO7A 4J2EA 4DSEA 4B8CA 4DQQA 1L3UA 4DTMA 1KCFA 1ASUA 5SZTA 4KRFA 3A2FA 1IKVA 2X74A 2B4JA 4FJ8A 2G8UA 1JLEA 1SV5A 1HNIA 4W5NA 3LANA 2BANA 2P1JA 4HUFA 4Z4CA 1RT2A 1W9HA 5HP1A 4E0DA 4B08A 3OYBA 4HUGA 3AVMA 3HPOA 3VQBA 4F4KA 1LWCA 4CEAA 3TAPA 2G8FA 4PWDA 1S1XA 4IFVA 4Y1DA 1KVBA 4GMJB 3MAQA 3B6PA 4ID1A 4F2SA 1REVA 4IBNA 3HK2A 4DS5A 3QNOA 2HNYA 1S6QA 4I9LA 3NBPA 4M3TA 1JLFA 4IDKA 3KLGA 4FK0A 2Z1GA 4Z4IA 2I5JA 3OJUA 2F8SA 1VSLA 2OYQA 1TKTA 4I2QA 1L3VA 4IFYA 3DM2A 4E7IA 4DTSA 2F96A 3AVJA 3HXMA 4AHSA 4DWIA 5D3GA 3AVHA 2RKIA 3TAEA 2GV9A 4CERA 1NK0A 4B9NA 1VSEA 3K5OA 1RT5A 3HJFA 3KKRA 3O3FA 3ZT0A 1KSPA 3DYAA 2E6LA 4CJTA 2KW4A 1FK9A 3NH1A 2D5RA 1YTAA 3LPUA 4RW4A 3VN5A 4FZXC 1J53A 1TKDA 1EXQA 1WLJA 3AO2A 4KO0A 2YKNA 4DSJA 2HHVA 3KLEA 3LALA 2DFHA 4FCYA 3KKSA 4FJNA 4DSKA 4AHUA 1HYZA 4J2BA 1JKHA 4KFBA 1BCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBY A;  2VG6 A;  4N41 A;  3AA5 X;  1HRH A;  2FBV A;  2JLE A;  1X9M A;  4MFB A;  3VQP A;  1EET A;  3ZSZ A;  3VQ6 A;  2XY6 A;  5HLF A;  3TAM A;  1IKW A;  1RNH A;  4W5Q A;  1KRP A;  3KLH A;  2ZD1 A;  1UOC A;  5I3U A;  5HBM A;  1FKP A;  3DLG A;  5E41 A;  4F2R A;  1QQC A;  2FBT A;  4LD0 A;  4BDZ A;  1NJY A;  4HVJ A;  1HYS A;  4I2P A;  1NOZ A;  4RW7 A;  4CGI A;  3KK2 A;  1NJZ A;  2Y1J A;  3RRG A;  4Z4G A;  4FYD A;  5C24 A;  5FRN A;  3QES A;  4DF4 A;  4OLB A;  4DQI A;  3IS9 A;  5FRO A;  3LP1 A;  4XIU A;  2VG5 A;  3KD1 E;  1RIL A;  3LZJ A;  1XC9 A;  3NAE A;  3HT3 A;  1Z26 A;  3VQ4 A;  2G8H A;  1RTI A;  4KKO A;  4KV8 A;  3LWL A;  2HHW A;  3P5J A;  4CJ5 A;  4CJ4 A;  3OY9 A;  3OYE A;  3KD5 E;  4BAC A;  3T19 A;  4CFA A;  3NF9 A;  4NYF A;  1ITG A;  4AIL C;  2D0A A;  1RDA A;  4DSL A;  3HVT A;  4M3R A;  1HQU A;  1Q9X A;  1C0M A;  4CES A;  1NJX A;  3SNN A;  3SUP A;  5CYQ A;  1T03 A;  3I0R A;  4CIF A;  4CJK A;  5T7B A;  1LWF A;  4CHY A;  3F9K A;  1BHL A;  3PUF A;  3OYK A;  3ASM A;  3KLI A;  4CJW A;  1TK8 A;  3VQ8 A;  1S1W A;  1Q9Y A;  4O44 A;  1JL2 A;  4CFC A;  1JLG A;  4M3W A;  2NUB A;  1Y97 A;  5J1E A;  1RBV A;  1GOB A;  3HST B;  5EU7 A;  3T3F A;  3QIO A;  4O55 A;  4CK3 A;  4CEB A;  1RBT A;  4KI6 A;  1KLN A;  4FJL A;  4K8X A;  3SV3 A;  4HUE A;  4C8L A;  4CJR A;  3OYA A;  5C25 A;  3ULD A;  4E7J A;  1NOY A;  3AA2 A;  4KRE A;  4CGJ A;  4M3X A;  2EHG A;  5J2M A;  3DOL A;  1JLB A;  1WSH A;  3TAR A;  3IAY A;  4OPK A;  1O1W A;  2OPS A;  4ZHR A;  4OKE A;  2RPI A;  4CED A;  4CJV A;  4CCH A;  4KTW A;  5JS1 A;  2KZM A;  3T1A A;  1RTH A;  3NH2 A;  1TKX A;  3LAK A;  1VSD A;  2OZM A;  4YNQ A;  4W5T A;  4FZZ A;  3OYI A;  2HNZ A;  3QO9 A;  4CF0 A;  3V9S A;  4DU4 A;  1WSI A;  1XI1 A;  1L3S A;  3CM6 A;  3AO4 A;  3TAQ A;  3AA3 A;  2XY5 A;  3LAM A;  4Z4F A;  3WNF A;  1EP4 A;  4FLY A;  3U3Y A;  3O4Q A;  3VQQ A;  2B6A A;  5J2P A;  1CXQ A;  1I39 A;  2F8T A;  2KZZ A;  3EY1 A;  5HRN A;  1BGX T;  5KRS A;  1U45 A;  3DLR A;  1N5Y A;  5CZ2 A;  4BDP A;  3U6F A;  3U3G A;  2X78 A;  1KVC A;  1BI4 B;  2FBX A;  2DFE A;  1JLQ A;  3DRR A;  1GOA A;  1U4B A;  3EZ5 A;  5J2N A;  5DMR A;  3LP2 A;  3UIQ A;  4CJ3 A;  4CJP A;  1B92 A;  4PQU A;  3CG7 A;  3VQ5 A;  4H4M A;  1SL0 A;  3DI6 A;  4CJE A;  5HRO A;  4PA1 A;  1DTT A;  1HPZ A;  3JYT A;  1TAQ A;  1IKX A;  3IG1 A;  1NK4 A;  4AHV A;  1IO2 A;  1GOC A;  2EX3 A;  3D0P A;  4DTU A;  4RG8 A;  1ZBU A;  2IOC A;  3K2P A;  2XY7 A;  2PZS A;  1QTM A;  2Z1J A;  3DRP A;  2VWK A;  1K6Y A;  3KK1 A;  1QE1 A;  3ZSV A;  1UAX A;  3AVI A;  1RBS A;  3PO5 A;  1QSS A;  3PY8 A;  4CEQ A;  1C1C A;  1HYV A;  2XY8 A;  4CJF A;  1BIU A;  2OPQ A;  3DLE A;  2DTU A;  3MED A;  4HTU A;  4OPJ A;  1C0T A;  3C94 A;  3ITH A;  4B9V A;  2PYL A;  4DSI A;  4DTX A;  3I8D A;  3HO1 A;  1TGO A;  2YNH A;  4KHN A;  4CJL A;  2G8W A;  2FC0 A;  3ZT4 A;  1IKY A;  4CIG A;  3JSM A;  3TWH A;  4DLG A;  4RW8 A;  4CIE A;  4E7K A;  1WNS A;  3TI0 A;  1S1T A;  3K57 A;  1NKC A;  2BDP A;  4B8A B;  2HVI A;  4FLW A;  4DTP A;  3NH0 A;  4DMN A;  3LDS A;  3M8R A;  3TAB A;  1EX4 A;  3VQD A;  4CF2 A;  4ELT A;  4I9Q A;  4E3S A;  4M42 A;  4Y1C A;  3KK3 A;  1X1P A;  3CYM A;  3ZCM A;  3SUQ A;  3HM9 A;  2HVH A;  4LY7 A;  1J54 A;  1RDC A;  3BGR A;  4CGD A;  3PV8 A;  2X6N A;  4DF8 A;  3S3M A;  3AVK A;  2O4G A;  1UWB A;  1ZYQ A;  3RTV A;  4FLV A;  1VK0 A;  2YHA A;  3AVG A;  3OS0 A;  1SL1 A;  3KLF A;  1TL3 A;  1WSG A;  4B9U A;  1DTQ A;  2KTQ A;  3NCI A;  4EZ9 A;  4OLA A;  3SPY A;  4DLE A;  1BCO A;  3QEW A;  1RBR A;  4JRP A;  4DU3 A;  3SUN A;  4TSX A;  4ELU A;  4FK2 A;  4DTO A;  1YT3 A;  2YNI A;  1X9W A;  3NDK A;  4CJU A;  1SUQ A;  3DLB A;  1CXU A;  4CE9 A;  4HCC A;  1B9D A;  4H8K A;  5FDL A;  4B9S A;  4AHR A;  3D45 A;  3O4N A;  4HHT A;  1NK5 A;  3HP6 A;  4BE0 A;  1SL2 A;  4WE1 A;  3WNH A;  4IKF A;  3MEG A;  3ZT2 A;  1S9E A;  4CEO A;  4KTQ A;  4J2A A;  1D9D A;  1CLQ A;  4OGC A;  2PY5 A;  4ID5 A;  2JGU A;  4IG3 A;  2QKK A;  4QCL A;  3WNE A;  3QIN A;  1TVR A;  1LWE A;  3V1R A;  4E1M A;  5KGX A;  4FJG A;  1F21 A;  4CEZ A;  2KQ2 A;  1WAJ A;  3OS1 A;  4DFM A;  1LAV A;  3QEP A;  3M8S A;  3ISN C;  4FVM A;  4O4G A;  3CQ8 A;  1RTD A;  4B3O A;  5KTQ A;  3K5N A;  2RF2 A;  1B9F A;  4CHQ A;  2O4I A;  3ZT1 A;  3NFA A;  1NK9 A;  1FXX A;  2ATQ A;  3ZSR A;  1EKE A;  1S1V A;  3C95 A;  3QER A;  4N47 A;  1Z25 A;  1KVA A;  3AVB A;  3VQ9 A;  3M8P A;  3H08 A;  4BE1 A;  4FJM A;  4CJQ A;  3SQ1 A;  4FZY A;  2P5G A;  1XHX A;  4E7H A;  4R5P A;  4OJR A;  4F8R A;  3G0Z A;  1D5A A;  3AO3 A;  1N6Q A;  4CGG A;  3NGZ A;  4CHN A;  1NKE A;  3PX4 A;  1U49 A;  2ETJ A;  1HMV A;  1VRU A;  1T8E A;  1HNV A;  1JXB A;  3TAG A;  1BQN A;  1G15 A;  3DMJ A;  4PUO A;  4CEF A;  3QET A;  4L8R B;  4LH4 A;  4JS4 A;  1BIZ A;  3BDP A;  5DK5 A;  1S1U A;  2Y1I A;  3S9H A;  1C1A A;  3IRX A;  4M3Z A;  4NCG A;  4BWM A;  4CEE A;  2YHB A;  4E1N A;  3F73 A;  4FLU A;  4FM0 A;  4FJH A;  2OZS A;  4NCA A;  3AVF A;  4DFK A;  3V81 A;  3SJJ A;  4ZTJ A;  1NKB A;  4CK1 A;  4B9T A;  4Z0U A;  1TV6 A;  4FJ7 A;  3ZSX A;  5FRM A;  1JLC A;  1WN7 A;  2E4L A;  3QLH A;  4E89 A;  3HVR A;  4DTJ A;  3QEV A;  5CY4 A;  1WAF A;  3RR7 A;  4KHU A;  4FK4 A;  4B9L A;  4CK2 A;  1R0A A;  3B6O A;  2IC3 A;  4FM2 A;  4C8O A;  4EP4 A;  3L8B A;  1VSH A;  2OPR A;  4PY5 A;  3SYZ A;  1XWL A;  3AVA A;  1KLM A;  1TK5 A;  3AA4 A;  3HP9 A;  2G8V A;  3LP0 A;  3O3H A;  1A5X A;  3HL8 A;  1QS4 A;  4CHO A;  4FLZ A;  4JRQ A;  1U47 A;  2YV0 X;  4DG1 A;  3C6U A;  4C8N A;  2OPP A;  2G8K A;  4IG0 A;  4BWJ A;  3C6T A;  5KRT A;  1S5J A;  4DFP A;  4G1Q A;  3L2R A;  2HHX A;  4LH5 A;  4K8Z A;  3NF6 A;  3PX0 A;  4CGF A;  1NK8 A;  1HJR A;  1LW2 A;  4KB0 A;  4FXD A;  3S3O A;  4E19 A;  4CF8 A;  1Q8I A;  1SKR A;  3MEE A;  1KFS A;  1WSF A;  2B5J A;  3S3N A;  3CM5 A;  1I3A A;  4AHC A;  1MU2 A;  1BQM A;  3MXI A;  2X6S A;  4JLH A;  4CHZ A;  3OYD A;  4Z4H A;  3OYF A;  1ASV A;  4GW6 A;  4DFJ A;  4I7F A;  1A5V A;  1RT4 A;  4CJS A;  4KTZ A;  4FW1 A;  3OYH A;  3SQ0 A;  1VRT A;  4OGE A;  2LSN A;  2P51 A;  3LZI A;  5I42 A;  2XRI A;  1C0U A;  1CZ9 A;  1LW0 A;  4ICL A;  4YFU A;  1HQE A;  4O5B A;  3NE6 A;  5JS2 A;  3NGI A;  3V4I A;  3PO4 A;  2KFN A;  4KHW A;  4RW6 A;  2R7Y A;  3L2W A;  4W5R A;  3VQA A;  3AVC A;  2HHT A;  3HPH A;  2DFF A;  1J5O A;  1J9A A;  4CFB A;  3ZSO A;  4ELV A;  4F3O A;  1ZBH A;  4CGH A;  3RWU A;  3I0S A;  3LWM A;  3RMA A;  3PX6 A;  3ZSY A;  3SV4 A;  3L3U A;  4Q5V A;  3LPT A;  1JL1 A;  2ZE2 A;  3ALY A;  3G10 A;  3VQC A;  3DOK A;  3L2U A;  1WSE A;  3P83 D;  4AHT A;  1L3T A;  3SPZ A;  3VA0 A;  1VSI A;  4DQR A;  1T7P A;  3K59 A;  1NK7 A;  2P5O A;  5HRS A;  3RMD A;  1JXE A;  3KJV A;  4OKJ A;  4FJ9 A;  3V1O A;  5CZ1 A;  4FM1 A;  4QOZ B;  3M8Q A;  1TL1 A;  2Z1I A;  1XHZ A;  4AH9 A;  1QSY A;  2GBZ A;  1ZBL A;  4FJK A;  3P1G A;  4LSL A;  3KTQ A;  3V1Q A;  3SQ4 A;  3SI6 A;  2QK9 A;  1IH7 A;  1ZBF A;  3NHG A;  3OJS A;  4DS4 A;  1U04 A;  5CYM A;  3QEX A;  2A1R A;  4DQP A;  1X9S A;  4FJX A;  3K58 A;  3DLK A;  2G8I A;  4DTN A;  2HHU A;  3TR8 A;  3QNN A;  5HRP A;  1UA1 A;  4DSF A;  1L5U A;  3AV9 A;  4KHQ A;  1FKO A;  4M45 A;  1RDD A;  5K14 A;  5C42 A;  2GUI A;  2IDO A;  4Z4E A;  3SCX A;  4FJI A;  4KB1 A;  3AO5 A;  4JS5 A;  4OKK A;  5KI6 A;  1D8Y A;  3AO1 A;  5SWM A;  3V6D A;  1LAW A;  4LSN A;  4CF9 A;  1YTU A;  1TAU A;  1CZB A;  4CEC A;  3HPG A;  2HMI A;  3VQE A;  4N56 A;  1RT7 A;  4EP5 A;  3OYG A;  3V9U A;  4H4O A;  3SZ2 A;  4C8M A;  1RCH A;  2D0C A;  3RMC A;  4UQG A;  4DTR A;  1D9F A;  2ITG A;  4Q0B A;  1TK0 A;  1NK6 A;  3SUO A;  1NJW A;  3L2Q A;  3MXJ A;  2OA8 A;  4QAG A;  3K5L A;  3ZSQ A;  3TAF A;  1VSF A;  3RMB A;  4B9M A;  3TAN A;  3E01 A;  4BE2 A;  1VSM A;  3NF7 A;  1C1B A;  2VG7 A;  4O0I A;  2BGG A;  4FLT A;  3OYJ A;  3NGY A;  3VQ7 A;  2W42 A;  1WSJ A;  4DQS A;  4NCB A;  1T05 A;  4GVM A;  3CFR A;  1RT6 A;  1DLO A;  1UA0 A;  5KGW A;  3NF8 A;  3DRS A;  4KI4 A;  2ZQB A;  2IS3 A;  3OYM A;  2WOM A;  1ASW A;  2YKM A;  3LP3 A;  3V9W A;  2A1S A;  2QKB A;  2HHQ A;  3SQ2 A;  4KPY A;  2HB5 A;  4BDY A;  1YVU A;  3MEC A;  4FJJ A;  4RW9 A;  2PYJ A;  3CFO A;  3L3V A;  3RRH A;  1TKZ A;  4M3U A;  4CHP A;  1S6P A;  2KFZ A;  3L2V A;  4M41 A;  3DLH A;  4CFD A;  3AVN A;  2YNG A;  3V9Z A;  4ZTF A;  4E7L A;  4HCB A;  1RBU A;  5J2Q A;  3OYC A;  1RTJ A;  2E6M A;  2QXF A;  4KAZ A;  4J2D A;  1A5W A;  1BIS A;  4MQ3 A;  1LV5 A;  3RR8 A;  4EZ6 A;  3OS2 A;  1RT3 A;  1RT1 A;  3K5M A;  4W5O A;  4NYN A;  3ZSW A;  3OYL A;  1ZBI A;  3KIO A;  4CF1 A;  1S9G A;  2IGI A;  1U48 A;  4N76 A;  3HYF A;  2D0B A;  2WON A;  4FJ5 A;  2BE2 A;  1JLA A;  2AJQ A;  1RDB A;  4N5S A;  2RN2 A;  2Q3S A;  4KHS A;  1IG9 A;  2HW3 A;  3EYZ A;  3OVN A;  1W0H A;  4M3Y A;  1C6V A;  4DU1 A;  3CFP A;  4O0J A;  1SKS A;  4KHY A;  2Z1H A;  3AVL A;  1BI4 A;  4F3T A;  2VWJ A;  1VSJ A;  3VA3 A;  1BL3 A;  5HRR A;  2HND A;  2IAJ A;  1VSK A;  1SKW A;  4FW2 A;  1QHT A;  3V9X A;  3FFI A;  3MXM A;  3QEI A;  1KFD A;  2XHB A;  3O3G A;  4C8K A;  2YNF A;  1KTQ A;  3WNG A;  1QSL A;  2HHS A;  2DY4 A;  4FLX A;  4OVL A;  3OYN A;  3QIP A;  3THV A;  3ZT3 A;  2XO7 A;  4J2E A;  4DSE A;  4B8C A;  4DQQ A;  1L3U A;  4DTM A;  1KCF A;  1ASU A;  5SZT A;  4KRF A;  3A2F A;  1IKV A;  2X74 A;  2B4J A;  4FJ8 A;  2G8U A;  1JLE A;  1SV5 A;  1HNI A;  4W5N A;  3LAN A;  2BAN A;  2P1J A;  4HUF A;  4Z4C A;  1RT2 A;  1W9H A;  5HP1 A;  4E0D A;  4B08 A;  3OYB A;  4HUG A;  3AVM A;  3HPO A;  3VQB A;  4F4K A;  1LWC A;  4CEA A;  3TAP A;  2G8F A;  4PWD A;  1S1X A;  4IFV A;  4Y1D A;  1KVB A;  4GMJ B;  3MAQ A;  3B6P A;  4ID1 A;  4F2S A;  1REV A;  4IBN A;  3HK2 A;  4DS5 A;  3QNO A;  2HNY A;  1S6Q A;  4I9L A;  3NBP A;  4M3T A;  1JLF A;  4IDK A;  3KLG A;  4FK0 A;  2Z1G A;  4Z4I A;  2I5J A;  3OJU A;  2F8S A;  1VSL A;  2OYQ A;  1TKT A;  4I2Q A;  1L3V A;  4IFY A;  3DM2 A;  4E7I A;  4DTS A;  2F96 A;  3AVJ A;  3HXM A;  4AHS A;  4DWI A;  5D3G A;  3AVH A;  2RKI A;  3TAE A;  2GV9 A;  4CER A;  1NK0 A;  4B9N A;  1VSE A;  3K5O A;  1RT5 A;  3HJF A;  3KKR A;  3O3F A;  3ZT0 A;  1KSP A;  3DYA A;  2E6L A;  4CJT A;  2KW4 A;  1FK9 A;  3NH1 A;  2D5R A;  1YTA A;  3LPU A;  4RW4 A;  3VN5 A;  4FZX C;  1J53 A;  1TKD A;  1EXQ A;  1WLJ A;  3AO2 A;  4KO0 A;  2YKN A;  4DSJ A;  2HHV A;  3KLE A;  3LAL A;  2DFH A;  4FCY A;  3KKS A;  4FJN A;  4DSK A;  4AHU A;  1HYZ A;  4J2B A;  1JKH A;  4KFB A;  1BCM A; 
#chains in the Genus database with same CATH topology
 1X9M A;  1GLJ O;  1QQM A;  3QBW A;  1KRP A;  3KLH A;  3K0S A;  3CJ7 A;  4LD0 A;  3MX2 A;  4BDZ A;  4X65 K;  2Y1J A;  4Z4G A;  1TUU A;  1BOT O;  5C24 A;  4JI4 K;  2ZF5 O;  1NM1 A;  3Q7B A;  4DV6 K;  4XIU A;  2VG5 A;  4MDB A;  3ID6 A;  4KKO A;  4KV8 A;  4YY3 K;  4CJ4 A;  1YVN A;  3OYE A;  4CVN E;  3NF9 A;  1ITG A;  3HVT A;  1GLA G;  4M3R A;  4B1V A;  2YJE A;  1C0M A;  1NJX A;  4CZH A;  4CZG A;  4CJK A;  5T7B A;  1LWF A;  1KD1 O;  1BUP A;  3E9L A;  3VGL A;  3KLI A;  4DV1 K;  3SBT A;  5GIO A;  3TSQ A;  3L4I A;  1JLG A;  4M3W A;  5AQS A;  3VF6 A;  3OTO K;  1GOB A;  3NVK A;  4O55 A;  5E26 A;  1RBT A;  1KLN A;  4E7J A;  5C25 A;  4KRE A;  5J2M A;  3CJ9 A;  2OPS A;  3CCL N;  4OKE A;  4OPA A;  4KTW A;  4PKI A;  3T1A A;  4X62 K;  4YNQ A;  4W5T A;  1X3M A;  3QO9 A;  3BUZ B;  4CF0 A;  3MN7 A;  4JD2 A;  2XY5 A;  4Z4F A;  3E1Y A;  1CXQ A;  3QML A;  1I39 A;  3ULE B;  1Q86 O;  3EY1 A;  5HRN A;  4WQ4 A;  4B3S K;  3H46 O;  2A40 A;  2ZM6 K;  3CCM N;  3CCU N;  3OBW A;  5AQP A;  3THY A;  2QWL A;  1BI4 B;  3CF5 L;  1GOA A;  1U4B A;  5DMR A;  3UIQ A;  3BF1 A;  1SL0 A;  5JLH A;  3FLC O;  1NGD A;  3M3Z A;  3CCQ N;  2EX3 A;  4RG8 A;  2PZS A;  3K2P A;  3VTH A;  1QTM A;  3ENO A;  3ZSV A;  4FO0 A;  3PO5 A;  4CJF A;  1VQP N;  2OPQ A;  3DLE A;  4JKC A;  4FWR A;  4DR1 K;  3ITH A;  2A42 A;  4CJL A;  3ZT4 A;  1IKY A;  4A61 A;  2PAV A;  1VQ8 N;  4WQ4 C;  4DV0 K;  1G99 A;  1BA1 A;  3K57 A;  4FLW A;  1DKG D;  3TSP A;  2ZGZ A;  3CD6 N;  2UXB K;  4ELT A;  4BRO A;  2FLO A;  3VEZ A;  5FPN A;  4LY7 A;  4PL8 A;  4IZ9 A;  3AVK A;  1UWB A;  1I94 K;  3RTV A;  4FLV A;  1SL1 A;  3F9M A;  1TL3 A;  1LCU A;  4FPA A;  3M1F A;  1NMD A;  4DLE A;  4JRP A;  2HBM A;  1YT3 A;  2YNI A;  3NDK A;  4F9O A;  1SUQ A;  4B1U B;  1B9D A;  5CE3 A;  1HNW K;  4B9S A;  2WUS A;  5KPT A;  1WB9 A;  4YOR A;  4WE1 A;  1N34 K;  2KHO A;  2A3Z A;  4OGC A;  2QKK A;  4QCL A;  2UUA K;  5KGX A;  4LFB K;  3EE8 A;  3ZX2 A;  2KQ2 A;  3ISN C;  1RTD A;  4AF1 A;  3K5N A;  2O4I A;  3ZT1 A;  3P4I A;  2ATQ A;  3ZSR A;  4N47 A;  3M8P A;  3AO3 A;  2E5L K;  1YIJ N;  5AQW A;  4DQ8 A;  1U49 A;  1NKE A;  5AQQ A;  3L0Q A;  1HMV A;  4K43 A;  1HNV A;  4M7Y A;  4PUO A;  3DMJ A;  3QET A;  3BDP A;  1JJ2 M;  4NCG A;  2YHB A;  3J7A P;  4NCA A;  3THX B;  5TKW A;  2VQF K;  4B9T A;  1YJN N;  1TV6 A;  2P9N A;  5FRM A;  2E2O A;  3KZB A;  5IWA K;  5AZJ A;  2E4L A;  3A5L C;  4DTJ A;  4FK4 A;  1NU0 A;  5C10 A;  4B9L A;  3L8B A;  3SYZ A;  2OAN A;  3HP9 A;  1QQO A;  2QEX N;  1U47 A;  4DG1 A;  4IG0 A;  4JD2 B;  2HST A;  2F9W A;  4EFH A;  5KRT A;  1KC8 O;  3PSI A;  4DFP A;  3L2R A;  1K8K B;  4CZE A;  3PX0 A;  4I6M A;  4CGF A;  3HTV A;  4QS8 A;  1VQK N;  4E19 A;  1Q8I A;  3QBX A;  1SKR A;  1WSF A;  2QWP A;  5B8H A;  3S3N A;  1MU2 A;  2X6S A;  4BC3 A;  4I7F A;  2FSN A;  3SQ0 A;  3OYH A;  1YIT N;  1VRT A;  2UU9 K;  4KBO A;  3O80 A;  4A62 A;  4ICL A;  1OH5 A;  3VQA A;  2NRH A;  3A5N C;  1NGG A;  4CGH A;  3RWU A;  3WXI A;  3LWM A;  2UYT A;  3LPT A;  3VQC A;  1WSE A;  3P83 D;  4DR3 K;  4DQR A;  1VSI A;  4CBX A;  1JXE A;  2QW9 A;  4FJ9 A;  4FM1 A;  4ISG A;  5C2F A;  1XHZ A;  1QSY A;  5JVG L;  4WYB A;  3O9Q A;  3P1G A;  5JIC A;  4GY2 B;  3OJS A;  2UUC K;  3DWL A;  4DR2 K;  3J8A A;  5AFU H;  4DTN A;  3TR8 A;  5HRP A;  4KHQ A;  4M45 A;  2GUI A;  4Z4E A;  3SCX A;  4KB1 A;  4OKK A;  5SWM A;  3C7N A;  4LSN A;  3CIP A;  1CZB A;  1QQN A;  4DKW A;  1XNR K;  2P9U B;  4H4O A;  4C8M A;  2PBD A;  4UQG A;  4Q0B A;  5AR0 A;  3HRG A;  3MN6 A;  1NK6 A;  3SUO A;  4NO7 A;  4QAG A;  1DT9 A;  3ZSQ A;  3TAF A;  1K9M O;  4JI5 K;  1C0F A;  1C1B A;  1C0G A;  2VG7 A;  3MN9 A;  3B8A X;  3NGY A;  3VQ7 A;  4NCB A;  4GV6 A;  3UKR B;  1T05 A;  3TSU A;  1DLO A;  1T6C A;  3BEX A;  2IS3 A;  2WOM A;  3E9P A;  3V9W A;  4B1W B;  4KPY A;  2PYJ A;  1VQL N;  1TKZ A;  5FPE A;  4CHP A;  2KFZ A;  4A2A A;  4OO1 J;  4M41 A;  4MDA A;  4C1N K;  4HCB A;  4E7L A;  1RBU A;  1W97 L;  3BP8 A;  2E6M A;  1LV5 A;  4MQ3 A;  4BRC A;  1RT1 A;  4W5O A;  3OYL A;  3ZSW A;  1ZBI A;  3CC7 N;  3KIO A;  1U48 A;  4CD1 A;  4JKD A;  1JLA A;  2AJQ A;  1RDB A;  3EYZ A;  3OVN A;  4DU1 A;  2VWJ A;  2WC9 A;  3Q7C A;  2HND A;  3V9X A;  1KFD A;  4C8K A;  1VQN N;  4DR6 K;  2HHS A;  5GAE P;  3ZT3 A;  2Q2R A;  4DTM A;  1KCF A;  2X74 A;  4FJ8 A;  1JLE A;  1E4F T;  2P1J A;  2KKZ A;  3JXU A;  1W9H A;  3VEX A;  4E0D A;  4B08 A;  3HPO A;  4CEA A;  2O8D B;  3TPQ A;  4IFV A;  4Y1D A;  4BRM A;  1VQ9 N;  3SMP A;  3B6P A;  3J81 O;  3FZL A;  3HK2 A;  4BQZ A;  1S6Q A;  4I9L A;  3CER A;  3NBP A;  4DCH A;  1JLF A;  4FK0 A;  2HF3 A;  2F8S A;  3EKU A;  3D7E O;  3O08 A;  3N4Q A;  4IWV A;  1L3V A;  4IFY A;  2P9P A;  3DXK A;  4DTS A;  4FWM A;  5A2Q O;  4HTL A;  4L3Q A;  2UUB K;  4EAH D;  3K5O A;  3HJF A;  1RT5 A;  1QZ6 A;  4CJT A;  4K41 A;  4M63 C;  3VN5 A;  4JN4 A;  3FZK A;  1HJO A;  2HHV A;  2E8A A;  5BPM A;  3H1V X;  4JK9 A;  3KKS A;  5LJW A;  4M7X A;  4J2B A;  2YCH A;  4BRG A;  4KFB A;  2O8E A;  5AZI B;  5EY4 A;  1HRH A;  2FBV A;  2Q36 A;  4MFB A;  3VQ6 A;  2XY6 A;  5HLF A;  2VCP A;  3ZET A;  2RE2 A;  4W5Q A;  1UOC A;  5E41 A;  5BN8 A;  4H5W A;  5M1K A;  5AQZ A;  4DB3 A;  4OLB A;  3I33 A;  3LP1 A;  5FRO A;  3KD1 E;  3VET A;  5BRF A;  1HNZ K;  1XC9 A;  3HT3 A;  4BGB A;  2UXC K;  3O9S A;  4NB4 A;  2G8H A;  1KAY A;  3P5J A;  4CJ5 A;  3KD5 E;  4BAC A;  3H3N O;  4AIL C;  4XEI A;  2NRR A;  1RDA A;  3WEE B;  2ZGY A;  3WUH A;  2KLA A;  3WXL A;  1HQU A;  4AM7 A;  4B3M K;  1GLB G;  2W6K A;  4CES A;  3SNN A;  3P38 A;  5CYQ A;  3I0R A;  3FZF A;  4CHY A;  3F9K A;  1BHL A;  3PUF A;  4JI1 K;  4FOE A;  4JEP A;  1TK8 A;  3VQ8 A;  4O44 A;  4CFC A;  5BR8 K;  1YF5 L;  2NUB A;  5BPN A;  2A41 A;  4FWP A;  4CI6 A;  3THX A;  4LF8 K;  4KI6 A;  4KH6 A;  1EWR A;  5F1X A;  3VEO A;  3SV3 A;  3ZX0 A;  3ZEU A;  3OYA A;  1NOY A;  4KHP K;  4CGJ A;  3EO3 A;  5GAG P;  1NGI A;  4CW7 B;  2KZM A;  3NH2 A;  1TKX A;  1VSD A;  2OZM A;  2F9T A;  3O9T A;  2HNZ A;  4U67 L;  2AA4 A;  4R79 A;  3AO4 A;  3LAM A;  2V7Z A;  3WNF A;  4FLY A;  3TU5 A;  3VQQ A;  2B6A A;  3EE9 A;  3DLR A;  4BDP A;  5CZ2 A;  3SMS A;  3U6F A;  1KVC A;  1SS6 A;  4YHH K;  2DFE A;  3DRR A;  3P31 A;  4XH1 A;  4CJ3 A;  4CJP A;  2QM1 A;  5LJV A;  4PQU A;  4BRI A;  3CG7 A;  3VQ5 A;  3SAF A;  4PA1 A;  1HPZ A;  3JYT A;  1IKX A;  3IG1 A;  4H5V A;  4CZK A;  1GOC A;  4BRH A;  3D0P A;  2XY7 A;  3THW A;  2Z1J A;  3DRP A;  1QSS A;  3CCV N;  2DTU A;  3H6E A;  1C0T A;  4JAX A;  4V19 S;  3I8D A;  2G8W A;  2FC0 A;  3GL1 A;  3JSM A;  4BQL A;  5AZJ B;  3TI0 A;  1S1T A;  2Q1N A;  3F5T A;  5FLX O;  4DTP A;  3LDS A;  3M8R A;  3TAB A;  4I9Q A;  4CF2 A;  5C0Y A;  3AAQ A;  4Y1C A;  3C65 A;  3CJ1 A;  4YDU A;  1GLD G;  4NXN K;  3KVG A;  3CYM A;  3NVM A;  5M1P A;  3SUQ A;  1J54 A;  3BGR A;  4CGD A;  3PV8 A;  1MWM A;  4DF8 A;  3S3M A;  3KWG A;  1VQ6 N;  3VF2 A;  4FWN A;  4I6M B;  1WSG A;  1DTQ A;  2KTQ A;  3SPY A;  2E2Q A;  2OTJ N;  2O8C B;  3R8E A;  4CE9 A;  4HCC A;  4H8K A;  3D45 A;  4HHT A;  4BE0 A;  2OTL N;  1EQY A;  3MEG A;  4J2A A;  4IG3 A;  5AQY A;  3QIN A;  4FJG A;  3ID8 A;  3V1R A;  5KQ8 A;  1QVF M;  1WAJ A;  4H0P A;  1K8A O;  1IBM K;  3QEP A;  2H3G X;  3CQ8 A;  4B3O A;  3NFA A;  1NK9 A;  1EKE A;  1S1V A;  3QER A;  5EVZ A;  1QHA A;  3UKU A;  3WT0 A;  2ASP A;  3AVB A;  3VQ9 A;  4BE1 A;  4FJM A;  3CI5 A;  1XHX A;  3T1H K;  3THW B;  3D2E B;  2GEM A;  3QFP A;  4OJR A;  4F8R A;  3G0Z A;  1D5A A;  1N6Q A;  4JKG A;  4CHN A;  3PX4 A;  1VRU A;  3MN5 A;  1JXB A;  1BQN A;  4NLC A;  1U2V B;  4L8R B;  1S1U A;  2QTD A;  2Y1I A;  1C1A A;  3S9H A;  4M3Z A;  3FFK B;  4KHS A;  4FM0 A;  4DFK A;  3V81 A;  4ZTJ A;  1NKB A;  1BG3 A;  2QWM A;  4MLE A;  1WN7 A;  3F2K A;  4IFE A;  4FSV A;  4KHU A;  4JYA K;  4GKJ K;  1R0A A;  4WFN L;  4FM2 A;  2IC3 A;  4EP4 A;  4BR5 A;  3SAG A;  4PY5 A;  1XWL A;  1KLM A;  1TK5 A;  1A5X A;  4RCH A;  3HL8 A;  3C7N B;  4FLZ A;  1GLF O;  1S22 A;  2YV0 X;  4WF9 L;  5JLF A;  2HHX A;  4LH5 A;  3AGR A;  1XMQ K;  3NF6 A;  2ZJR L;  1LW2 A;  3S3O A;  3IUC A;  1YUW A;  1KFS A;  2YJF A;  3CM5 A;  4WQ5 A;  2P9L B;  1ZXO A;  5CHI A;  4CHZ A;  4Z4H A;  3OYF A;  1ASV A;  1A5V A;  5C12 A;  1LOT B;  4CJS A;  1OH6 A;  4FW1 A;  3EL2 A;  3LZI A;  4MO4 A;  5GIN A;  1C0U A;  4Z94 A;  3NGI A;  3V4I A;  4O5B A;  4A59 A;  1TYQ B;  4RW6 A;  3WXK A;  2I7P A;  2HHT A;  1J5O A;  1J9A A;  4WFB L;  4CFB A;  4ELV A;  4FWK A;  1XNQ K;  3L3U A;  2ZE2 A;  3G10 A;  2DPN A;  3DOK A;  1L3T A;  1S72 N;  3VA0 A;  1VQM N;  3U4L A;  3RMD A;  5EXW A;  4FWO A;  3KJV A;  4OKJ A;  4HWI A;  3V1O A;  5CZ1 A;  4H0X B;  4ILJ A;  1HX1 A;  4QOZ B;  3M8Q A;  4AH9 A;  5ADX H;  2IVO A;  1ZBL A;  3KTQ A;  4LSL A;  3V1Q A;  1ZBF A;  1MDU B;  3PIO L;  3NHG A;  2Q31 A;  2QI2 A;  4DQP A;  1X9S A;  3K58 A;  3DLK A;  2ASO A;  2G8I A;  2WFB A;  4LC9 B;  4DR4 K;  1R59 O;  2A6A A;  1ESV A;  3AV9 A;  3RSE B;  3MCA B;  5K14 A;  2IDO A;  4FJI A;  4A2B A;  3AO5 A;  4JS5 A;  2P9U A;  4O8U A;  2CGK A;  4A5A A;  5AQJ A;  4U7B A;  2HMI A;  4LF5 K;  1RT7 A;  4EP5 A;  3VEV A;  3RMC A;  3C0B A;  4XH4 A;  1T44 A;  4DTR A;  2ITG A;  1YHQ N;  1D9F A;  2A5X A;  2OA8 A;  3U8X A;  4BRL A;  3K5L A;  2YX6 A;  1VSF A;  4BRQ A;  3RMB A;  4BVO A;  3E01 A;  3WXJ A;  1VSM A;  2BGG A;  3OYJ A;  4DV3 K;  1IBL K;  4JI7 K;  3CC4 N;  3HBT A;  4GVM A;  3CFR A;  1UA0 A;  2ITM A;  2ZQB A;  4QS7 A;  2QKB A;  1IJJ A;  5LMU K;  4RW9 A;  3CFO A;  4CZJ A;  2CH5 A;  3L3V A;  3L2V A;  1VQ4 N;  3O8M A;  4CFD A;  5DM6 L;  3BY5 A;  4ZTF A;  1RTJ A;  4J2D A;  2P9S A;  5GAH P;  1ATR A;  4CF1 A;  1S9G A;  2IGI A;  4JK7 A;  2E88 A;  1WBB A;  2BE2 A;  2O8E B;  1OVQ A;  1ILY A;  1IG9 A;  2AP1 A;  4RTF D;  1W0H A;  4M3Y A;  1C6V A;  4O0J A;  2P9K A;  3AVL A;  1VSJ A;  5HRR A;  1SKW A;  1ZBS A;  3BZK A;  1SZ2 A;  3C6H A;  3O9U A;  3FFI A;  3QEI A;  4H03 B;  4BRA A;  3O3G A;  1QSL A;  4CJ7 A;  4FLX A;  5AQM A;  4ILG B;  1D4X A;  4B8C A;  3A2F A;  2B4J A;  2G8U A;  1FW6 A;  1SV5 A;  1HNI A;  4W5N A;  2E1Z A;  2BAN A;  3O4W A;  3IFR A;  4Z4C A;  4K0K K;  3OYB A;  3SAH A;  5ADX A;  3A8Y A;  5M1Q A;  4PWD A;  2VYP A;  4GMJ B;  2Q0U A;  5LY3 A;  2FF6 A;  4DS5 A;  4OX9 K;  1IG8 A;  5FPD A;  4M3T A;  1O13 A;  4Z4I A;  2NLX A;  1VSL A;  4B9Q A;  1RDW X;  1TKT A;  2O8F B;  3FZM A;  3DM2 A;  5FPM A;  4E7I A;  2F96 A;  3HXM A;  3U9Z A;  2YHY A;  4IOX A;  5D3G A;  3AVH A;  2GV9 A;  3LDO A;  5AQX A;  3HZ6 A;  2O8B B;  4PHT X;  2E6L A;  1FK9 A;  4CBW A;  3NH1 A;  3KHY A;  1P90 A;  2VWB A;  1YTA A;  3LPU A;  5AZI A;  1J53 A;  3PSF A;  4DSJ A;  1BWF O;  4FWS A;  4AHU A;  4DSK A;  2FBY A;  3AA5 X;  3LDL A;  3MCP A;  1NGA A;  2JLE A;  1BA0 A;  3OA9 A;  1Z05 A;  4J8F A;  3TAM A;  1IKW A;  2ZD1 A;  5I3U A;  1FKP A;  1VAZ A;  3DLG A;  5AQT A;  2FBT A;  1ZC6 A;  1NJY A;  3RSE A;  2QA4 N;  3WQT A;  4RW7 A;  4CGI A;  3KK2 A;  4DUY K;  1NJZ A;  3GG4 A;  3ATU A;  3I55 N;  5FRN A;  4DQI A;  3IS9 A;  1RIL A;  3LZJ A;  3MWT A;  4CZI A;  3NAE A;  1Z26 A;  4JV5 K;  4IXC A;  3CPW M;  5JVH L;  3LWL A;  2HHW A;  3OY9 A;  3FE1 A;  2UXD K;  2O8D A;  4NYF A;  2V52 B;  4DSL A;  4CZM A;  3K9J A;  1Q9X A;  3ENH A;  5AQI A;  2W40 A;  1SQK A;  3AAP A;  3ASM A;  3OYK A;  3VEN A;  4WCE L;  1S1W A;  3NMU A;  5F2R A;  4DV2 K;  1JL2 A;  4IDH A;  3ZEU B;  3W3D A;  3HST B;  5EU7 A;  3T3F A;  2Q97 A;  3QIO A;  3A5O C;  4FJL A;  4K8X A;  4LF9 K;  5AQG A;  1BO5 O;  4A5B A;  4M3X A;  4CZL A;  4DHY A;  3TAR A;  1JLB A;  1WSH A;  3IAY A;  2EWS A;  3AY9 A;  4ZHR A;  2RPI A;  4BR9 A;  4CJV A;  2E2N A;  1J6Z A;  3LAK A;  4FZZ A;  3OYI A;  1L3S A;  1WSI A;  3CM6 A;  3TAQ A;  4NXM K;  3U3Y A;  5J2P A;  3FZH A;  2F8T A;  4B1X B;  1BGX T;  5KRS A;  1N5Y A;  4GVE A;  2V7Y A;  2X78 A;  3EZ5 A;  3H3O B;  3AGK A;  1VQ5 N;  3LP2 A;  3FR0 A;  1B92 A;  3PLA A;  4PL7 A;  5HRO A;  1DTT A;  1NK4 A;  4AHV A;  1IO2 A;  4GV9 A;  1ZBU A;  2IOC A;  4GKK K;  1QE1 A;  4CEQ A;  1HYV A;  2XY8 A;  3OHR A;  1BIU A;  3GOI A;  4H0O A;  4OPJ A;  4B9V A;  2PYL A;  4DSI A;  4KHN A;  3TWH A;  3TTD A;  4E7K A;  1WNS A;  1NKC A;  4B8A B;  4A57 A;  5E84 A;  2HVI A;  3SK3 A;  1VQ7 N;  4DMN A;  1OVY A;  1X9J A;  3VQD A;  4M42 A;  2ZJQ L;  1QZ5 A;  1X1P A;  1KAX A;  1RDC A;  1ZYQ A;  1VK0 A;  3AVG A;  3VMF B;  3KLF A;  4B9U A;  3NCI A;  4EZ9 A;  4OLA A;  4KH4 A;  3IKM A;  3QEW A;  1RBR A;  4DU3 A;  3SUN A;  4FK2 A;  5C15 A;  2D0P A;  1X9W A;  2GUP A;  3DLB A;  1NGJ A;  5FDL A;  4AHR A;  1NK5 A;  1SL2 A;  4BRK A;  4DV4 K;  3WNH A;  1S9E A;  1YJW N;  4BR7 A;  1D9D A;  1CLQ A;  4ID5 A;  2JGU A;  2P9I A;  4E1M A;  3I56 N;  3OS1 A;  1LAV A;  3R1X A;  3M8S A;  4FVM A;  2NRV A;  3J80 O;  1B9F A;  2BH1 A;  3D2E A;  1Z25 A;  1M1K O;  3H08 A;  5BRD A;  3SQ1 A;  4FZY A;  2P5G A;  1JCF A;  1H1V A;  4CGG A;  3DXM A;  3EEQ A;  2ETJ A;  2NRZ A;  4JKH A;  1VQO N;  1BDG A;  3CCS N;  1T8E A;  3TAG A;  3VGK A;  4JKG B;  4CEF A;  1FJG K;  4LH4 A;  4JS4 A;  1XC3 A;  4E1J A;  1YJ9 N;  5DK5 A;  5KPR A;  4BWM A;  4CZF A;  2W41 A;  3SJJ A;  1HKG A;  4CK1 A;  1U6Z A;  3ZSX A;  1RFQ A;  1JLC A;  4IEE A;  3ZLJ A;  4E89 A;  5CY4 A;  4IJA A;  1HKC A;  1NLV A;  1VSH A;  3AA4 A;  2GWJ A;  3BZC A;  1BU6 O;  2CH6 A;  1QS4 A;  3VOV A;  4C8N A;  2G8K A;  2D4W A;  2D0O A;  4BWJ A;  3C6T A;  3M5R A;  1S5J A;  3ATV A;  4K8Z A;  1NK8 A;  3UKR A;  1HJR A;  4KB0 A;  4OPH A;  3WXM B;  1HKB A;  3D2F A;  4CF8 A;  3MEE A;  4G9Z A;  3K9K A;  5BRE A;  2B5J A;  1I3A A;  3LDN A;  3MWP A;  1BQM A;  3MXI A;  3LL3 A;  2WBN A;  4EIA A;  4GW6 A;  5BRH A;  5C2D A;  4DFJ A;  4DUZ K;  1RT4 A;  2OCE A;  4C1N I;  1NMN A;  4OGE A;  2LSN A;  2P51 A;  5I42 A;  2XRI A;  2QWO A;  1CZ9 A;  1LW0 A;  4YFU A;  1HQE A;  3CET A;  4KHW A;  5EOY A;  2R7Y A;  3L2W A;  4W5R A;  2P9I B;  2DFF A;  3CQX A;  2ZJP L;  3EKS A;  4BY9 C;  4BGA A;  3I0S A;  3RMA A;  4YOY A;  3SV4 A;  3CJC A;  4Q5V A;  1JL1 A;  3ALY A;  4C23 A;  3L2U A;  4AHT A;  3E66 A;  3SPZ A;  2FSK A;  4CBU A;  4MLH A;  5HRS A;  4BR0 A;  1TL1 A;  2Z1I A;  1Z6R A;  4FJK A;  1RDU A;  2YI1 A;  2A1R A;  1U04 A;  5CYM A;  4YOX A;  1XMO K;  2HHU A;  1KXP A;  3QNN A;  4DSF A;  1FKO A;  3MMV A;  5C42 A;  5GAD P;  2HHH K;  1D8Y A;  5KI6 A;  4YDU C;  3AO1 A;  3V6D A;  3CQY A;  1LAW A;  1Q81 O;  1TAU A;  2JWL A;  1YTU A;  3HPG A;  3VQE A;  3OYG A;  3V9U A;  3SZ2 A;  1RCH A;  3VF4 A;  1Y64 A;  4JI3 K;  3MXJ A;  3D2F B;  5KPZ A;  4BE2 A;  1WUA A;  4O0I A;  3MDQ A;  4FLT A;  1NWK A;  4JKA A;  2W42 A;  3QIC A;  1WSJ A;  4DQS A;  1HNX K;  1HPM A;  5KGW A;  3CJA A;  4KI4 A;  3OYM A;  4BRN A;  2P9L A;  3LP3 A;  2O8F A;  1N32 K;  3G4S N;  4X66 K;  4BDY A;  1YVU A;  5AJ3 K;  3H1Q A;  3RRH A;  5BR9 A;  4FWL A;  3AVN A;  2YNG A;  3V9Z A;  1TYQ A;  5J2Q A;  3OYC A;  2QXF A;  4AM6 A;  3VEY A;  4KAZ A;  4DR5 K;  4BR4 A;  3CCR N;  4EZ6 A;  3DXM B;  4NYN A;  1GLC G;  5F0X A;  4N76 A;  3HYF A;  2D0B A;  2QWQ A;  2D1K A;  2P9K B;  2JWK A;  2RN2 A;  2HW3 A;  1SKS A;  3CFP A;  2Z1H A;  5M1O A;  4F3T A;  3RVC A;  2IAJ A;  4FW2 A;  4JNE A;  3MXM A;  4JI0 K;  4EHT A;  2F4V K;  1KTQ A;  3TTF A;  3WNG A;  2DY4 A;  2BUP A;  3OYN A;  3QIP A;  4J2E A;  4DQQ A;  3CPE A;  1L3U A;  4KRF A;  1ASU A;  1IKV A;  3IDH A;  4UY8 O;  3LAN A;  4DR7 K;  4HUG A;  4LFA K;  3VQB A;  1LWC A;  2GTD A;  3TAP A;  1IBK K;  5AQV A;  3HOS A;  2VQE K;  2HF4 A;  1SAZ A;  4F2S A;  4IBN A;  3QNO A;  3LM2 A;  1S3X A;  2HNY A;  4YOW A;  3M6G A;  3R3L A;  3DXK B;  4IDK A;  3KLG A;  4XH5 A;  2I5J A;  4H5T A;  1NGH A;  3J7Z O;  4ILH A;  1NBW A;  3AVJ A;  4DV7 K;  2Q0R A;  5AFU A;  4DWI A;  3TAE A;  4B9N A;  5AQO A;  3KKR A;  1KSP A;  3AAR A;  3DYA A;  2HOE A;  4RW4 A;  2O8B A;  1TKD A;  1WLJ A;  3AO2 A;  2NZT A;  4K42 A;  2IVN A;  1J5E K;  2QWR A;  4FCY A;  4FJN A;  4BRD A;  3DJC A;  2VG6 A;  4N41 A;  5AQN A;  3GBT A;  3VQP A;  1EET A;  3ZSZ A;  2P9S B;  2YHW A;  1RNH A;  5M1N A;  4O8K A;  2J4R A;  5HBM A;  3CME N;  4F2R A;  1QQC A;  2V51 B;  4HVJ A;  3SBG A;  1HYS A;  4I2P A;  1NOZ A;  5AQR A;  3R9P A;  3RRG A;  4FYD A;  3QES A;  4DF4 A;  1M90 O;  2F7T A;  5CR4 A;  3VTI A;  3VQ4 A;  4CD3 A;  1RTI A;  2E20 A;  4KH5 A;  2ZWH A;  3QFU A;  4WFA L;  1VHX A;  3T7Z A;  3T19 A;  4CFA A;  4JI8 K;  2WTU A;  2D0A A;  3CCE N;  5HL7 L;  4Y0W A;  4BR2 A;  1HR0 K;  3SUP A;  1T03 A;  3BF3 A;  4CIF A;  3WEE A;  2HMP A;  4CJW A;  1Q9Y A;  4H0T B;  4JHD B;  3SJH A;  3VES A;  1HLU A;  5J1E A;  1Y97 A;  4JKE A;  1RBV A;  1X3N A;  4CK3 A;  1MWK A;  4CEB A;  4B3R K;  4HUE A;  4C8L A;  4CJR A;  5HOO A;  3ULD A;  1W7A A;  1NGB A;  3AA2 A;  1OH8 A;  2EHG A;  2P9P B;  3DOL A;  3MK6 A;  4OPK A;  1O1W A;  5JS1 A;  4CED A;  4CCH A;  1RTH A;  3HOT A;  4H5R A;  5H1S Q;  4FPB A;  5LL6 Z;  3V9S A;  4DU4 A;  1XI1 A;  5AQK A;  3AA3 A;  2GEL A;  1EP4 A;  4BC5 A;  3O4Q A;  1K8K A;  2BTF A;  2KZZ A;  1U45 A;  4IO8 A;  3U3G A;  1N8R O;  3HI0 A;  4BG8 A;  3N4P A;  2FBX A;  1XUP O;  1JLQ A;  5J2N A;  3TTC A;  3T1Y K;  1T6D A;  5I9E B;  2ASM A;  3CJB A;  1NGE A;  4H4M A;  3DI6 A;  4CJE A;  3ZX3 A;  1TAQ A;  4YOU A;  1Q7Y O;  2NRX A;  4PKG A;  4DTU A;  2VWK A;  4JK8 A;  1K6Y A;  3KK1 A;  4EHU A;  1ATN A;  1UAX A;  3AVI A;  1RBS A;  4K25 A;  1EWQ A;  3PY8 A;  4JI6 K;  1C1C A;  3MED A;  4H5N A;  4HTU A;  3C94 A;  4FOI A;  1YXQ A;  4DTX A;  3HO1 A;  1TGO A;  2YNH A;  5BPL A;  3GDQ A;  4CIG A;  4DLG A;  4RW8 A;  4CIE A;  3O1W A;  4WQ5 C;  2BDP A;  3OBY A;  2RHK A;  2FSJ A;  3NH0 A;  5TKY A;  1EX4 A;  4E3S A;  3KK3 A;  3ZCM A;  2IIR A;  3HM9 A;  2HVH A;  4BC2 A;  2X6N A;  2O4G A;  1KQS M;  4LF7 K;  2YHA A;  3OS0 A;  2NNW A;  3VEW A;  5BN9 A;  1BCO A;  1EO1 A;  3KK7 A;  3DLL L;  4TSX A;  4ELU A;  4DTO A;  2W6L A;  3THY B;  4ISE A;  3ZET B;  4AQY K;  4NLB A;  4CJU A;  1CXU A;  2IVP A;  3VPZ A;  1E3M A;  1GLL O;  3O4N A;  3HP6 A;  4IKF A;  3ZT2 A;  4CEO A;  4KTQ A;  2PY5 A;  1HUX A;  3O1B A;  3WNE A;  1TVR A;  1LWE A;  5AQF A;  3L4Q A;  1F21 A;  4H0Y B;  4ISF A;  4CEZ A;  4DFM A;  4FVU A;  4O4G A;  3U9D A;  5KTQ A;  2RF2 A;  3UKU B;  4DV5 K;  4CHQ A;  1FXX A;  4MO5 A;  2NRW A;  3C95 A;  1KVA A;  3ENB A;  1WBD A;  4CJQ A;  4E7H A;  4R5P A;  3LDQ A;  4JKB A;  3NGZ A;  4BG9 A;  1G15 A;  5AQL A;  5AQU A;  1BIZ A;  2FXU A;  3IRX A;  4BRE A;  5IT9 O;  3LM9 A;  4QS9 A;  3F73 A;  4CEE A;  2E2P A;  5AQH A;  4E1N A;  4FLU A;  4FJH A;  3DAW A;  4JI2 K;  2OZS A;  3AVF A;  4FJ7 A;  4B3T K;  3H45 C;  4Z0U A;  3O9R A;  3L6Q A;  4B1Z A;  3CCJ N;  4GV3 A;  2VGN A;  3QLH A;  3HVR A;  3QEV A;  3RR7 A;  1WAF A;  3JS6 A;  1GLE G;  4CK2 A;  3B6O A;  4C8O A;  1K73 O;  2OPR A;  4BRP A;  3AVA A;  2G8V A;  3LP0 A;  3O3H A;  2HBJ A;  4CHO A;  4JRQ A;  3C6U A;  2OPP A;  3G6E N;  3A5M C;  4G1Q A;  5GIP A;  3ULE A;  4FXD A;  1CZA N;  4AHC A;  4BRF A;  3I8B A;  4JLH A;  3OYD A;  1NGF A;  4KTZ A;  2O8C A;  1YI2 N;  3NE6 A;  3PO4 A;  4LF4 K;  5JS2 A;  2KFN A;  1MA9 B;  3AVC A;  3G25 A;  3HPH A;  4FWQ A;  3ZSO A;  4F3O A;  1ZBH A;  5DM7 L;  1IV0 A;  3IMX A;  3O6W A;  3PX6 A;  3ZSY A;  3WQU A;  2PFU A;  1T7P A;  3K59 A;  1NK7 A;  2FF3 B;  2P5O A;  3HM8 A;  3VGM A;  3HSC A;  4IOA L;  2GBZ A;  2QK9 A;  1V4T A;  3SQ4 A;  4X64 K;  3SI6 A;  1JCE A;  1IH7 A;  3C6A A;  4DS4 A;  3QEX A;  4FJX A;  3UB5 A;  2GWK A;  3CMA N;  3O5B A;  1DGK N;  3G71 N;  1UA1 A;  1L5U A;  1W2B M;  1RDD A;  3D6R A;  2I7N A;  4GNI A;  1NG9 A;  4CF9 A;  1KAZ A;  4IO9 L;  4CEC A;  4N56 A;  3W0L A;  2D0C A;  3T69 A;  1TK0 A;  2YHX A;  3R6M A;  1NJW A;  3L2Q A;  4B9M A;  3TAN A;  1ATS A;  3NF7 A;  1OH7 A;  3P39 A;  1NJI O;  2QXL A;  1T3V A;  1YAG A;  3SLC A;  1RT6 A;  3FGU A;  4O5F A;  3E9O A;  3NF8 A;  3DRS A;  1RGI A;  3CC2 N;  2VGM A;  1ASW A;  4LFC K;  2YKM A;  2A1S A;  5ELZ A;  2HHQ A;  3SQ2 A;  2HB5 A;  4YOV A;  3MEC A;  4FJJ A;  2NRT A;  4IEI A;  4M3U A;  1S6P A;  1TUY A;  2CGJ A;  3DLH A;  1V4S A;  4PKH A;  3LDP A;  2HBK A;  1A5W A;  1BIS A;  3RR8 A;  3OS2 A;  1RT3 A;  3MX5 A;  3K5M A;  5M1F A;  2WON A;  4FJ5 A;  1U2V A;  4N5S A;  1E4G T;  1Q82 O;  2Q3S A;  4KHY A;  1QVG M;  2GX9 A;  4FL9 A;  1BI4 A;  3VA3 A;  1BL3 A;  1VSK A;  2P9N B;  1QHT A;  2CGL A;  3JAM O;  2XHB A;  4IOC L;  2YNF A;  1N36 K;  4OVL A;  4RWT A;  3THV A;  2XO7 A;  4DSE A;  3OW2 M;  5SZT A;  3A0I X;  5MLC Q;  4BC4 A;  3S41 A;  1XQS C;  3KWI A;  4HUF A;  1RT2 A;  1NGC A;  2HBL A;  4IJN A;  5HP1 A;  1N33 K;  3AVM A;  4F4K A;  3ZYY X;  3EZW A;  4JHD A;  2G8F A;  1WOQ A;  3CXC M;  1S1X A;  3QDK A;  5LMN K;  1KVB A;  3MAQ A;  4ID1 A;  1REV A;  4JKF A;  1JCG A;  2Z1G A;  3UE5 A;  3VER A;  2E1Y A;  3OJU A;  2OYQ A;  4I2Q A;  2QWN A;  5KQD A;  4H0V B;  4YOT A;  1OKJ A;  5EX5 A;  4AHS A;  2RKI A;  4CER A;  1NK0 A;  1VSE A;  1DEJ A;  3EN9 A;  5JMV A;  3O3F A;  3ZT0 A;  4LF6 K;  3QB0 A;  2KW4 A;  3J7Y P;  2D5R A;  1P8Z A;  4FZX C;  1Q18 A;  1EXQ A;  4KO0 A;  2YKN A;  3CHW A;  3GE1 A;  3KLE A;  3LAL A;  3PIP L;  2DFH A;  1NNE A;  1HYZ A;  4BVP A;  1JKH A;  4B1Y B;  1BCM A; 
#chains in the Genus database with same CATH homology
 2FBY A;  2VG6 A;  4N41 A;  3AA5 X;  1HRH A;  2FBV A;  2JLE A;  1X9M A;  4MFB A;  3VQP A;  1EET A;  3ZSZ A;  3VQ6 A;  2XY6 A;  5HLF A;  3TAM A;  1IKW A;  1RNH A;  4W5Q A;  1KRP A;  3KLH A;  2ZD1 A;  1UOC A;  5I3U A;  5HBM A;  1FKP A;  3DLG A;  5E41 A;  4F2R A;  1QQC A;  2FBT A;  4LD0 A;  4BDZ A;  1NJY A;  4HVJ A;  1HYS A;  4I2P A;  1NOZ A;  4RW7 A;  4CGI A;  3KK2 A;  1NJZ A;  2Y1J A;  3RRG A;  4Z4G A;  4FYD A;  5C24 A;  5FRN A;  3QES A;  4DF4 A;  4OLB A;  4DQI A;  3IS9 A;  5FRO A;  3LP1 A;  4XIU A;  2VG5 A;  3KD1 E;  1RIL A;  3LZJ A;  1XC9 A;  3NAE A;  3HT3 A;  1Z26 A;  3VQ4 A;  2G8H A;  1RTI A;  4KKO A;  4KV8 A;  3LWL A;  2HHW A;  3P5J A;  4CJ5 A;  4CJ4 A;  3OY9 A;  3OYE A;  3KD5 E;  4BAC A;  3T19 A;  4CFA A;  3NF9 A;  4NYF A;  1ITG A;  4AIL C;  2D0A A;  1RDA A;  4DSL A;  3HVT A;  4M3R A;  1HQU A;  1Q9X A;  1C0M A;  4CES A;  1NJX A;  3SNN A;  3SUP A;  5CYQ A;  1T03 A;  3I0R A;  4CIF A;  4CJK A;  5T7B A;  1LWF A;  4CHY A;  3F9K A;  1BHL A;  3PUF A;  3OYK A;  3ASM A;  3KLI A;  4CJW A;  1TK8 A;  3VQ8 A;  1S1W A;  1Q9Y A;  4O44 A;  1JL2 A;  4CFC A;  1JLG A;  4M3W A;  2NUB A;  1Y97 A;  5J1E A;  1RBV A;  1GOB A;  3HST B;  5EU7 A;  3T3F A;  3QIO A;  4O55 A;  4CK3 A;  4CEB A;  1RBT A;  4KI6 A;  1KLN A;  4FJL A;  4K8X A;  3SV3 A;  4HUE A;  4C8L A;  4CJR A;  3OYA A;  5C25 A;  3ULD A;  4E7J A;  1NOY A;  3AA2 A;  4KRE A;  4CGJ A;  4M3X A;  2EHG A;  5J2M A;  3DOL A;  1JLB A;  1WSH A;  3TAR A;  3IAY A;  4OPK A;  1O1W A;  2OPS A;  4ZHR A;  4OKE A;  2RPI A;  4CED A;  4CJV A;  4CCH A;  4KTW A;  5JS1 A;  2KZM A;  3T1A A;  1RTH A;  3NH2 A;  1TKX A;  3LAK A;  1VSD A;  2OZM A;  4YNQ A;  4W5T A;  4FZZ A;  3OYI A;  2HNZ A;  3QO9 A;  4CF0 A;  3V9S A;  4DU4 A;  1WSI A;  1XI1 A;  1L3S A;  3CM6 A;  3AO4 A;  3TAQ A;  3AA3 A;  2XY5 A;  3LAM A;  4Z4F A;  3WNF A;  1EP4 A;  4FLY A;  3U3Y A;  3O4Q A;  3VQQ A;  2B6A A;  5J2P A;  1CXQ A;  1I39 A;  2F8T A;  2KZZ A;  3EY1 A;  5HRN A;  1BGX T;  5KRS A;  1U45 A;  3DLR A;  1N5Y A;  5CZ2 A;  4BDP A;  3U6F A;  3U3G A;  2X78 A;  1KVC A;  1BI4 B;  2FBX A;  2DFE A;  1JLQ A;  3DRR A;  1GOA A;  1U4B A;  3EZ5 A;  5J2N A;  5DMR A;  3LP2 A;  3UIQ A;  4CJ3 A;  4CJP A;  1B92 A;  4PQU A;  3CG7 A;  3VQ5 A;  4H4M A;  1SL0 A;  3DI6 A;  4CJE A;  5HRO A;  4PA1 A;  1DTT A;  1HPZ A;  3JYT A;  1TAQ A;  1IKX A;  3IG1 A;  1NK4 A;  4AHV A;  1IO2 A;  1GOC A;  2EX3 A;  3D0P A;  4DTU A;  4RG8 A;  1ZBU A;  2IOC A;  3K2P A;  2XY7 A;  2PZS A;  1QTM A;  2Z1J A;  3DRP A;  2VWK A;  1K6Y A;  3KK1 A;  1QE1 A;  3ZSV A;  1UAX A;  3AVI A;  1RBS A;  3PO5 A;  1QSS A;  3PY8 A;  4CEQ A;  1C1C A;  1HYV A;  2XY8 A;  4CJF A;  1BIU A;  2OPQ A;  3DLE A;  2DTU A;  3MED A;  4HTU A;  4OPJ A;  1C0T A;  3C94 A;  3ITH A;  4B9V A;  2PYL A;  4DSI A;  4DTX A;  3I8D A;  3HO1 A;  1TGO A;  2YNH A;  4KHN A;  4CJL A;  2G8W A;  2FC0 A;  3ZT4 A;  1IKY A;  4CIG A;  3JSM A;  3TWH A;  4DLG A;  4RW8 A;  4CIE A;  4E7K A;  1WNS A;  3TI0 A;  1S1T A;  3K57 A;  1NKC A;  2BDP A;  4B8A B;  2HVI A;  4FLW A;  4DTP A;  3NH0 A;  4DMN A;  3LDS A;  3M8R A;  3TAB A;  1EX4 A;  3VQD A;  4CF2 A;  4ELT A;  4I9Q A;  4E3S A;  4M42 A;  4Y1C A;  3KK3 A;  1X1P A;  3CYM A;  3ZCM A;  3SUQ A;  3HM9 A;  2HVH A;  4LY7 A;  1J54 A;  1RDC A;  3BGR A;  4CGD A;  3PV8 A;  2X6N A;  4DF8 A;  3S3M A;  3AVK A;  2O4G A;  1UWB A;  1ZYQ A;  3RTV A;  4FLV A;  1VK0 A;  2YHA A;  3AVG A;  3OS0 A;  1SL1 A;  3KLF A;  1TL3 A;  1WSG A;  4B9U A;  1DTQ A;  2KTQ A;  3NCI A;  4EZ9 A;  4OLA A;  3SPY A;  4DLE A;  1BCO A;  3QEW A;  1RBR A;  4JRP A;  4DU3 A;  3SUN A;  4TSX A;  4ELU A;  4FK2 A;  4DTO A;  1YT3 A;  2YNI A;  1X9W A;  3NDK A;  4CJU A;  1SUQ A;  3DLB A;  1CXU A;  4CE9 A;  4HCC A;  1B9D A;  4H8K A;  5FDL A;  4B9S A;  4AHR A;  3D45 A;  3O4N A;  4HHT A;  1NK5 A;  3HP6 A;  4BE0 A;  1SL2 A;  4WE1 A;  3WNH A;  4IKF A;  3MEG A;  3ZT2 A;  1S9E A;  4CEO A;  4KTQ A;  4J2A A;  1D9D A;  1CLQ A;  4OGC A;  2PY5 A;  4ID5 A;  2JGU A;  4IG3 A;  2QKK A;  4QCL A;  3WNE A;  3QIN A;  1TVR A;  1LWE A;  3V1R A;  4E1M A;  5KGX A;  4FJG A;  1F21 A;  4CEZ A;  2KQ2 A;  1WAJ A;  3OS1 A;  4DFM A;  1LAV A;  3QEP A;  3M8S A;  3ISN C;  4FVM A;  4O4G A;  3CQ8 A;  1RTD A;  4B3O A;  5KTQ A;  3K5N A;  2RF2 A;  1B9F A;  4CHQ A;  2O4I A;  3ZT1 A;  3NFA A;  1NK9 A;  1FXX A;  2ATQ A;  3ZSR A;  1EKE A;  1S1V A;  3C95 A;  3QER A;  4N47 A;  1Z25 A;  1KVA A;  3AVB A;  3VQ9 A;  3M8P A;  3H08 A;  4BE1 A;  4FJM A;  4CJQ A;  3SQ1 A;  4FZY A;  2P5G A;  1XHX A;  4E7H A;  4R5P A;  4OJR A;  4F8R A;  3G0Z A;  1D5A A;  3AO3 A;  1N6Q A;  4CGG A;  3NGZ A;  4CHN A;  1NKE A;  3PX4 A;  1U49 A;  2ETJ A;  1HMV A;  1VRU A;  1T8E A;  1HNV A;  1JXB A;  3TAG A;  1BQN A;  1G15 A;  3DMJ A;  4PUO A;  4CEF A;  3QET A;  4L8R B;  4LH4 A;  4JS4 A;  1BIZ A;  3BDP A;  5DK5 A;  1S1U A;  2Y1I A;  3S9H A;  1C1A A;  3IRX A;  4M3Z A;  4NCG A;  4BWM A;  4CEE A;  2YHB A;  4E1N A;  3F73 A;  4FLU A;  4FM0 A;  4FJH A;  2OZS A;  4NCA A;  3AVF A;  4DFK A;  3V81 A;  3SJJ A;  4ZTJ A;  1NKB A;  4CK1 A;  4B9T A;  4Z0U A;  1TV6 A;  4FJ7 A;  3ZSX A;  5FRM A;  1JLC A;  1WN7 A;  2E4L A;  3QLH A;  4E89 A;  3HVR A;  4DTJ A;  3QEV A;  5CY4 A;  1WAF A;  3RR7 A;  4KHU A;  4FK4 A;  4B9L A;  4CK2 A;  1R0A A;  3B6O A;  2IC3 A;  4FM2 A;  4C8O A;  4EP4 A;  3L8B A;  1VSH A;  2OPR A;  4PY5 A;  3SYZ A;  1XWL A;  3AVA A;  1KLM A;  1TK5 A;  3AA4 A;  3HP9 A;  2G8V A;  3LP0 A;  3O3H A;  1A5X A;  3HL8 A;  1QS4 A;  4CHO A;  4FLZ A;  4JRQ A;  1U47 A;  2YV0 X;  4DG1 A;  3C6U A;  4C8N A;  2OPP A;  2G8K A;  4IG0 A;  4BWJ A;  3C6T A;  5KRT A;  1S5J A;  4DFP A;  4G1Q A;  3L2R A;  2HHX A;  4LH5 A;  4K8Z A;  3NF6 A;  3PX0 A;  4CGF A;  1NK8 A;  1HJR A;  1LW2 A;  4KB0 A;  4FXD A;  3S3O A;  4E19 A;  4CF8 A;  1Q8I A;  1SKR A;  3MEE A;  1KFS A;  1WSF A;  2B5J A;  3S3N A;  3CM5 A;  1I3A A;  4AHC A;  1MU2 A;  1BQM A;  3MXI A;  2X6S A;  4JLH A;  4CHZ A;  3OYD A;  4Z4H A;  3OYF A;  1ASV A;  4GW6 A;  4DFJ A;  4I7F A;  1A5V A;  1RT4 A;  4CJS A;  4KTZ A;  4FW1 A;  3OYH A;  3SQ0 A;  1VRT A;  4OGE A;  2LSN A;  2P51 A;  3LZI A;  5I42 A;  2XRI A;  1C0U A;  1CZ9 A;  1LW0 A;  4ICL A;  4YFU A;  1HQE A;  4O5B A;  3NE6 A;  5JS2 A;  3NGI A;  3V4I A;  3PO4 A;  2KFN A;  4KHW A;  4RW6 A;  2R7Y A;  3L2W A;  4W5R A;  3VQA A;  3AVC A;  2HHT A;  3HPH A;  2DFF A;  1J5O A;  1J9A A;  4CFB A;  3ZSO A;  4ELV A;  4F3O A;  1ZBH A;  4CGH A;  3RWU A;  3I0S A;  3LWM A;  3RMA A;  3PX6 A;  3ZSY A;  3SV4 A;  3L3U A;  4Q5V A;  3LPT A;  1JL1 A;  2ZE2 A;  3ALY A;  3G10 A;  3VQC A;  3DOK A;  3L2U A;  1WSE A;  3P83 D;  4AHT A;  1L3T A;  3SPZ A;  3VA0 A;  1VSI A;  4DQR A;  1T7P A;  3K59 A;  1NK7 A;  2P5O A;  5HRS A;  3RMD A;  1JXE A;  3KJV A;  4OKJ A;  4FJ9 A;  3V1O A;  5CZ1 A;  4FM1 A;  4QOZ B;  3M8Q A;  1TL1 A;  2Z1I A;  1XHZ A;  4AH9 A;  1QSY A;  2GBZ A;  1ZBL A;  4FJK A;  3P1G A;  4LSL A;  3KTQ A;  3V1Q A;  3SQ4 A;  3SI6 A;  2QK9 A;  1IH7 A;  1ZBF A;  3NHG A;  3OJS A;  4DS4 A;  1U04 A;  5CYM A;  3QEX A;  2A1R A;  4DQP A;  1X9S A;  4FJX A;  3K58 A;  3DLK A;  2G8I A;  4DTN A;  2HHU A;  3TR8 A;  3QNN A;  5HRP A;  1UA1 A;  4DSF A;  1L5U A;  3AV9 A;  4KHQ A;  1FKO A;  4M45 A;  1RDD A;  5K14 A;  5C42 A;  2GUI A;  2IDO A;  4Z4E A;  3SCX A;  4FJI A;  4KB1 A;  3AO5 A;  4JS5 A;  4OKK A;  5KI6 A;  1D8Y A;  3AO1 A;  5SWM A;  3V6D A;  1LAW A;  4LSN A;  4CF9 A;  1YTU A;  1TAU A;  1CZB A;  4CEC A;  3HPG A;  2HMI A;  3VQE A;  4N56 A;  1RT7 A;  4EP5 A;  3OYG A;  3V9U A;  4H4O A;  3SZ2 A;  4C8M A;  1RCH A;  2D0C A;  3RMC A;  4UQG A;  4DTR A;  1D9F A;  2ITG A;  4Q0B A;  1TK0 A;  1NK6 A;  3SUO A;  1NJW A;  3L2Q A;  3MXJ A;  2OA8 A;  4QAG A;  3K5L A;  3ZSQ A;  3TAF A;  1VSF A;  3RMB A;  4B9M A;  3TAN A;  3E01 A;  4BE2 A;  1VSM A;  3NF7 A;  1C1B A;  2VG7 A;  4O0I A;  2BGG A;  4FLT A;  3OYJ A;  3NGY A;  3VQ7 A;  2W42 A;  1WSJ A;  4DQS A;  4NCB A;  1T05 A;  4GVM A;  3CFR A;  1RT6 A;  1DLO A;  1UA0 A;  5KGW A;  3NF8 A;  3DRS A;  4KI4 A;  2ZQB A;  2IS3 A;  3OYM A;  2WOM A;  1ASW A;  2YKM A;  3LP3 A;  3V9W A;  2A1S A;  2QKB A;  2HHQ A;  3SQ2 A;  4KPY A;  2HB5 A;  4BDY A;  1YVU A;  3MEC A;  4FJJ A;  4RW9 A;  2PYJ A;  3CFO A;  3L3V A;  3RRH A;  1TKZ A;  4M3U A;  4CHP A;  1S6P A;  2KFZ A;  3L2V A;  4M41 A;  3DLH A;  4CFD A;  3AVN A;  2YNG A;  3V9Z A;  4ZTF A;  4E7L A;  4HCB A;  1RBU A;  5J2Q A;  3OYC A;  1RTJ A;  2E6M A;  2QXF A;  4KAZ A;  4J2D A;  1A5W A;  1BIS A;  4MQ3 A;  1LV5 A;  3RR8 A;  4EZ6 A;  3OS2 A;  1RT3 A;  1RT1 A;  3K5M A;  4W5O A;  4NYN A;  3ZSW A;  3OYL A;  1ZBI A;  3KIO A;  4CF1 A;  1S9G A;  2IGI A;  1U48 A;  4N76 A;  3HYF A;  2D0B A;  2WON A;  4FJ5 A;  2BE2 A;  1JLA A;  2AJQ A;  1RDB A;  4N5S A;  2RN2 A;  2Q3S A;  4KHS A;  1IG9 A;  2HW3 A;  3EYZ A;  3OVN A;  1W0H A;  4M3Y A;  1C6V A;  4DU1 A;  3CFP A;  4O0J A;  1SKS A;  4KHY A;  2Z1H A;  3AVL A;  1BI4 A;  4F3T A;  2VWJ A;  1VSJ A;  3VA3 A;  1BL3 A;  5HRR A;  2HND A;  2IAJ A;  1VSK A;  1SKW A;  4FW2 A;  1QHT A;  3V9X A;  3FFI A;  3MXM A;  3QEI A;  1KFD A;  2XHB A;  3O3G A;  4C8K A;  2YNF A;  1KTQ A;  3WNG A;  1QSL A;  2HHS A;  2DY4 A;  4FLX A;  4OVL A;  3OYN A;  3QIP A;  3THV A;  3ZT3 A;  2XO7 A;  4J2E A;  4DSE A;  4B8C A;  4DQQ A;  1L3U A;  4DTM A;  1KCF A;  1ASU A;  5SZT A;  4KRF A;  3A2F A;  1IKV A;  2X74 A;  2B4J A;  4FJ8 A;  2G8U A;  1JLE A;  1SV5 A;  1HNI A;  4W5N A;  3LAN A;  2BAN A;  2P1J A;  4HUF A;  4Z4C A;  1RT2 A;  1W9H A;  5HP1 A;  4E0D A;  4B08 A;  3OYB A;  4HUG A;  3AVM A;  3HPO A;  3VQB A;  4F4K A;  1LWC A;  4CEA A;  3TAP A;  2G8F A;  4PWD A;  1S1X A;  4IFV A;  4Y1D A;  1KVB A;  4GMJ B;  3MAQ A;  3B6P A;  4ID1 A;  4F2S A;  1REV A;  4IBN A;  3HK2 A;  4DS5 A;  3QNO A;  2HNY A;  1S6Q A;  4I9L A;  3NBP A;  4M3T A;  1JLF A;  4IDK A;  3KLG A;  4FK0 A;  2Z1G A;  4Z4I A;  2I5J A;  3OJU A;  2F8S A;  1VSL A;  2OYQ A;  1TKT A;  4I2Q A;  1L3V A;  4IFY A;  3DM2 A;  4E7I A;  4DTS A;  2F96 A;  3AVJ A;  3HXM A;  4AHS A;  4DWI A;  5D3G A;  3AVH A;  2RKI A;  3TAE A;  2GV9 A;  4CER A;  1NK0 A;  4B9N A;  1VSE A;  3K5O A;  1RT5 A;  3HJF A;  3KKR A;  3O3F A;  3ZT0 A;  1KSP A;  3DYA A;  2E6L A;  4CJT A;  2KW4 A;  1FK9 A;  3NH1 A;  2D5R A;  1YTA A;  3LPU A;  4RW4 A;  3VN5 A;  4FZX C;  1J53 A;  1TKD A;  1EXQ A;  1WLJ A;  3AO2 A;  4KO0 A;  2YKN A;  4DSJ A;  2HHV A;  3KLE A;  3LAL A;  2DFH A;  4FCY A;  3KKS A;  4FJN A;  4DSK A;  4AHU A;  1HYZ A;  4J2B A;  1JKH A;  4KFB A;  1BCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...