4KB0A

Crystal structure of rnase t in complex with a bluge dna (two nucleotide insertion cc )
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
207
structure length
207
Chain Sequence
LTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title Structural insights into DNA repair by RNase T--an exonuclease processing 3' end of structured DNA in repair pathways.
pubmed doi rcsb
source organism Escherichia coli
total genus 61
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kb0A00
3B6PA 1D9DA 4OGCA 1BHLA 1JXBA 1RBUA 3SQ0A 5DK5A 4PWDA 3V9UA 1D5AA 4DQRA 1RTHA 1SL1A 3AVNA 3QEWA 1ZYQA 2E6MA 3NBPA 3O3GA 1T8EA 3SQ2A 1NK4A 3QIPA 1RDDA 3ISNC 1GOCA 4AHVA 4W5QA 2FBYA 1Y97A 4FJKA 3I8DA 3MEEA 2AJQA 3AVAA 3QIOA 3OYLA 3T3FA 4CECA 3QINA 1RDAA 1BIUA 1HQEA 3WNFA 3DM2A 3LWMA 3DLBA 2YNIA 1CZ9A 4CEAA 1SL2A 1JLGA 4FJXA 4CGIA 3RMCA 2HHSA 1K6YA 4CJVA 3ZSOA 4DF8A 4KO0A 3VN5A 3VQQA 2YKMA 4Z4GA 1WAFA 4CJKA 1NK7A 1TK5A 2HHQA 5HRNA 4CJ3A 1NJZA 2XRIA 3VQBA 1X9SA 1BIZA 3V4IA 2FBXA 4FJMA 1VSEA 1BQMA 5EU7A 3AO3A 2P51A 3D45A 1S5JA 1YTAA 3LALA 4E3SA 3RR8A 4FK0A 1UWBA 4FJJA 3DLGA 1TKZA 1T03A 4M41A 4CHNA 4OKEA 4M3UA 2YNHA 3KK2A 1R0AA 3S9HA 3DLRA 1RDBA 4HUGA 2JGUA 3E01A 3OYIA 1VRUA 4LSNA 4KHUA 1BL3A 3AVCA 4N47A 2Z1JA 2QKKA 3PO5A 3TWHA 4C8MA 2KZZA 2IS3A 4CE9A 3TAEA 2VWJA 3P5JA 3HK2A 1FKPA 3PX6A 1RBSA 2Z1GA 4G1QA 3U3GA 5FROA 3VQ8A 4CFCA 4CEOA 1CLQA 1JLAA 4DTMA 1UA0A 3OYAA 4N5SA 1C1BA 3RMAA 4F8RA 3NCIA 4O0IA 3TI0A 4HCCA 5J2QA 3NH1A 1RT6A 3IS9A 2FBVA 4FLUA 2G8FA 3ZSRA 4DFPA 4GMJB 4FJHA 3NGZA 4N56A 3OYNA 4Z0UA 4CEFA 4KREA 2XHBA 1WSJA 1Z25A 3C94A 3NFAA 3SV3A 2XY8A 3V9ZA 5CYMA 4M3YA 4DQSA 3HO1A 1UA1A 3VQEA 3QNOA 2OYQA 4W5RA 4EZ6A 2VG6A 1DTTA 3LPUA 3KLEA 2IGIA 3LP2A 4OGEA 4BE1A 4ICLA 1S1UA 1W9HA 5HRRA 4CJSA 3KD1E 4I2QA 3ZSYA 4CJ4A 1KSPA 4PUOA 1FKOA 1A5VA 1BI4A 2WONA 4I9LA 1VK0A 1IG9A 1LWCA 4B8AB 4F3OA 1NK0A 4K8ZA 4W5NA 3O3FA 2HNDA 1L3TA 4K8XA 3TAMA 2XY6A 4CHOA 1UOCA 2HB5A 4FZXC 1ASUA 3ZT0A 4B9NA 2IAJA 4FLZA 2PY5A 4CFDA 4KB0A 4FJ7A 3HM9A 3RWUA 1NKBA 2D0BA 4IG3A 4FLYA 4AHSA 3SUPA 2P5GA 1KVCA 3G0ZA 2O4IA 3NHGA 3LPTA 3F73A 4DFJA 4EZ9A 3V9WA 3UIQA 3S3MA 4AHUA 4LY7A 1HYZA 1VSHA 4CJLA 4Z4HA 3QESA 4FLWA 4C8LA 4Y1CA 4Q5VA 3V1QA 1ITGA 3AVLA 4B08A 3I0SA 4KHQA 4O0JA 3AVMA 1J5OA 3BDPA 1BQNA 4IDKA 1WN7A 1JLQA 2OA8A 4F4KA 4CIFA 4MQ3A 4FJ5A 3CFPA 1LWEA 2BANA 4CESA 3LZIA 1C1AA 4KHYA 1RTIA 2HHUA 2KFNA 1D8YA 3HYFA 1SUQA 4ZTJA 3OYDA 2QKBA 1SL0A 4B9LA 1ZBUA 4B8CA 1X1PA 3EZ5A 3ULDA 2R7YA 4ZTFA 1QSSA 3NAEA 3HP9A 1LAVA 3DLKA 4WE1A 1IH7A 3MXIA 3K58A 3V81A 3QEPA 1QS4A 4B9VA 4KB1A 4KPYA 3O4QA 3M8PA 4JLHA 5CYQA 5J2MA 3L2WA 2BGGA 4BE2A 2X6NA 3HL8A 1NKCA 3HP6A 3L2VA 4KTQA 2RKIA 3MECA 3NDKA 1Q8IA 1GOBA 1J54A 3AVBA 3OYGA 4CHPA 4J2BA 2DY4A 3ZT2A 4M3ZA 4CF2A 4DTXA 4KFBA 3K5MA 2NUBA 1ZBIA 4OLAA 1WLJA 3OS1A 4DU4A 3OVNA 4CK3A 1QSYA 1XHZA 5CZ1A 3OYFA 1Z26A 2RPIA 1LWFA 1S6PA 3NF9A 4CEZA 3L2UA 2OZMA 3OYCA 3QETA 1W0HA 3CQ8A 3DI6A 4F2RA 5I3UA 1RILA 5C25A 2D0AA 2GBZA 3P83D 2HVIA 1TAUA 3OYKA 3LWLA 1NJXA 3DLEA 4C8KA 4PQUA 3AO5A 2RF2A 2ATQA 3ZT4A 1HJRA 1Q9YA 1FXXA 1B9FA 4AHTA 4DTUA 3NH0A 2OPSA 2YKNA 2JLEA 1D9FA 3AA4A 4Z4IA 3HPGA 4AHRA 3SJJA 3NF7A 4KHWA 4DQIA 3S3OA 2G8IA 1TAQA 2ITGA 3SZ2A 4DG1A 3SNNA 2KW4A 3RR7A 4B9UA 4M3RA 2ZD1A 3SQ1A 4NCAA 1IKVA 1WSIA 1REVA 3ZCMA 1XHXA 1I3AA 3DRPA 4DLGA 1NK9A 1X9MA 5J2NA 2HNYA 2FC0A 3WNHA 4KI6A 1A5WA 3AO4A 5FRNA 3HJFA 4H4MA 2KZMA 5HP1A 5JS2A 2KFZA 1HYVA 3EY1A 4DSKA 2ETJA 3SUOA 4OJRA 2ZQBA 2Z1HA 1KCFA 4CJPA 1RT4A 1QHTA 3L3UA 2G8UA 3QEIA 4DS4A 2HNZA 3MXMA 3KD5E 3AVKA 3AVFA 4KAZA 4Z4FA 3AO2A 3SCXA 4IFYA 4DU3A 1NK5A 4RW6A 3U6FA 2YHBA 1X9WA 4RW8A 1KLMA 1B9DA 3HXMA 3IG1A 3RMBA 2BDPA 4CFAA 2KQ2A 3NGIA 4FVMA 4FJLA 3KTQA 1WAJA 3LP0A 1KTQA 1TKTA 3SPZA 4FM0A 4N41A 5FRMA 3KLGA 1RDCA 4E7JA 2A1RA 3M8QA 2VG5A 3AVIA 3ZSXA 4CJFA 1BCOA 2X74A 5E41A 1TL1A 4BWJA 5HRPA 4J2DA 1C1CA 3DOLA 2G8WA 2HMIA 3VQ7A 3PV8A 5D3GA 3OS2A 4O44A 4TSXA 1T7PA 1BISA 1QSLA 2DFFA 4O55A 1QQCA 2B4JA 4LD0A 1TGOA 1VSLA 2Z1IA 2G8VA 1YT3A 3PX0A 4NYFA 1S1XA 4OKJA 3K5LA 1RCHA 3NGYA 1NJWA 2BE2A 3V6DA 5HLFA 3ZSQA 3KKSA 3VQ5A 4JRPA 4CCHA 4IBNA 3V9XA 1ASWA 4M3WA 3AVHA 3L8BA 2IDOA 1VSIA 4NYNA 3V1OA 1XC9A 4DQPA 2KTQA 1WSEA 4CHZA 2I5JA 4NCBA 3RMDA 2RN2A 4BE0A 2HHVA 3AO1A 3QERA 3SQ4A 3O3HA 4FLVA 4BDYA 3VQ9A 2G8HA 1RT2A 3PUFA 4E7IA 1HYSA 1KRPA 1WSGA 4CJQA 3T19A 1CZBA 4KHSA 1G15A 2HW3A 4JS5A 4CEDA 4HUEA 3THVA 4CFBA 3OYEA 4O4GA 3D0PA 4XIUA 5J1EA 5CY4A 4LH5A 1HRHA 4OVLA 3LP3A 3K59A 4HVJA 4OKKA 2E6LA 4OLBA 1S1VA 3CYMA 3EYZA 3QNNA 2YNFA 4RW7A 3CG7A 1QE1A 5KRSA 3KK1A 4FW2A 2VWKA 4KTWA 4FZZA 2PZSA 4F3TA 2XY7A 4OPKA 4AHCA 4Z4CA 1TL3A 2YV0X 4CERA 2QK9A 3K5OA 5DMRA 4FK2A 4FJ9A 4FZYA 2X78A 1EKEA 4DFKA 2OPRA 3OS0A 4I9QA 3OYBA 1JL1A 4EP4A 1WNSA 5SZTA 1TK0A 4BDZA 4B9MA 3TR8A 2HHWA 4CEEA 3SUQA 4F2SA 4FXDA 4ELTA 4DTRA 3PY8A 5JS1A 1RTJA 3JSMA 4B3OA 4AH9A 3C95A 1LV5A 1VSMA 3DRSA 2Y1JA 4L8RB 3NF8A 3VQAA 1IKWA 4ID1A 5I42A 4BDPA 2DFEA 4ZHRA 1J53A 1MU2A 5KGWA 3TABA 1RTDA 1NOZA 3BGRA 4DWIA 4QCLA 3DYAA 3M8RA 4FLXA 1KVAA 3B6OA 4W5OA 2X6SA 4KKOA 1L3UA 1C0UA 1YVUA 4E0DA 4FJNA 2E4LA 4QAGA 3HVRA 3OY9A 1S9GA 4ELUA 1JKHA 2HHTA 3MEGA 4FJ8A 3AA3A 1I39A 1HPZA 4GVMA 3PO4A 4DSJA 3SUNA 4DFMA 4DSEA 1BI4B 1L3SA 4H8KA 2P5OA 2HHXA 1S1TA 3IRXA 4DSIA 3AA5X 4KV8A 5KGXA 3K57A 4CK2A 3KIOA 1S6QA 4JRQA 4CF8A 3KJVA 1BGXT 1RBVA 2Q3SA 4I7FA 3CFRA 4CF9A 2A1SA 4RW4A 1VSJA 1VSKA 3FFIA 1SKRA 4ELVA 3SV4A 2F8TA 3AV9A 4CEBA 3VA0A 5C42A 1VRTA 2GUIA 2QXFA 3LANA 3SYZA 4FJIA 2B6AA 3ZSVA 5KTQA 1FK9A 3MXJA 4HTUA 2XY5A 1ZBLA 1C0MA 1JLBA 2LSNA 3LAMA 4CJUA 3CM5A 3V1RA 4FM1A 1HMVA 3RTVA 4QOZB 1RT5A 4IG0A 1LW2A 4LSLA 1RT3A 3V9SA 1JLCA 3QEVA 1BCMA 4YNQA 1CXUA 4E19A 1XWLA 1C0TA 4E89A 1KFSA 4C8OA 4CIEA 2EHGA 4IFVA 1DTQA 4FK4A 1SV5A 3CM6A 3T1AA 4CGHA 5SWMA 2OZSA 4IKFA 4E7LA 3VA3A 1EETA 3QO9A 4NCGA 1HNVA 4CGJA 1ASVA 1RBTA 2DTUA 4CJEA 4CJWA 4AILC 1RT7A 3OYHA 3TAGA 4MFBA 4ID5A 3TAQA 3WNGA 4OPJA 4DF4A 1U4BA 4KHNA 1EP4A 4PA1A 1ZBHA 3AA2A 4Z4EA 4CHQA 3A2FA 1O1WA 4CGFA 4B9SA 4Q0BA 3RRGA 3KLIA 3MAQA 4CGDA 4GW6A 1U49A 3TARA 1LAWA 3AVJA 3SPYA 4DLEA 3I0RA 1TV6A 5HROA 1SKSA 1NK6A 2G8KA 3IAYA 2PYJA 3H08A 1A5XA 1NJYA 1IKYA 3C6UA 4UQGA 2IC3A 1IO2A 4E1MA 3K5NA 4DU1A 1U45A 2ZE2A 3TANA 4B9TA 2FBTA 4DSLA 4KRFA 3RRHA 4CF0A 1QTMA 5HBMA 4YFUA 3CFOA 1U47A 1U04A 2O4GA 1XI1A 1Q9XA 2F8SA 4PY5A 1TKDA 1GOAA 3G10A 1WSFA 4HUFA 2VG7A 4RW9A 3ZT3A 4CK1A 3ALYA 4M45A 1ZBFA 4O5BA 4M3XA 2F96A 4FLTA 3KLFA 4DS5A 1EXQA 3WNEA 3S3NA 4FYDA 4DTPA 3LP1A 2GV9A 4J2AA 3C6TA 3ZSZA 1C6VA 1EX4A 1S1WA 4DTNA 4I2PA 4RG8A 1JLFA 1RT1A 5C24A 4Y1DA 1UAXA 3OYMA 3O4NA 4JS4A 5HRSA 1LW0A 4DTJA 1CXQA 3ZSWA 1F21A 3U3YA 4CJRA 1JXEA 3HVTA 4CHYA 2DFHA 1TVRA 3ASMA 1TK8A 1U48A 5CZ2A 3VQCA 4KTZA 1YTUA 4M3TA 1JL2A 3LAKA 4E7KA 3SI6A 3TAPA 1L5UA 5J2PA 3PX4A 4CGGA 3VQDA 3NE6A 3MEDA 4J2EA 3ZT1A 4CJTA 3NH2A 4DQQA 1T05A 3OJSA 2PYLA 3ITHA 3HPHA 2OPQA 3DOKA 3TAFA 1SKWA 1KVBA 1HNIA 4DTSA 1S9EA 4KI4A 4DMNA 3VQPA 3AVGA 5K14A 2YNGA 3QLHA 1HQUA 3DMJA 4CEQA 2B5JA 3HPOA 3L2RA 2Y1IA 2W42A 3K2PA 3HT3A 2XO7A 2EX3A 3L3VA 4FW1A 4CF1A 3VQ4A 4E1NA 4EP5A 3OYJA 3M8SA 4HHTA 1NK8A 1L3VA 4FJGA 2HVHA 4FCYA 1VSFA 4BWMA 3VQ6A 1RBRA 2WOMA 4FM2A 4C8NA 1TKXA 3HSTB 5KRTA 4HCBA 1KLNA 3F9KA 3P1GA 4H4OA 4M42A 1N5YA 3DLHA 1IKXA 1B92A 4LH4A 1VSDA 3KKRA 1J9AA 2OPPA 4E7HA 1NOYA 4CIGA 3NF6A 1DLOA 1WSHA 5KI6A 2D0CA 4CJ5A 2P1JA 2IOCA 3JYTA 4R5PA 3LDSA 4DTOA 5T7BA 4BACA 3QEXA 3OJUA 3KK3A 3L2QA 1JLEA 1KFDA 5FDLA 3LZJA 1RNHA 2D5RA 3KLHA 1NKEA 1N6QA 4W5TA 3DRRA 4N76A 4DSFA 2YHAA
chains in the Genus database with same CATH superfamily
3UKUB 5DK5A 3V9UA 1SL1A 3QEWA 2E6MA 1OH7A 3SQ2A 2GEMA 1RDDA 2D1KA 3AVAA 2YI1A 3QIOA 3CCJN 3T3FA 3QINA 5C10A 5JLHA 3VEWA 4BRFA 3CHWA 4K42A 3EL2A 2HHSA 3ENBA 4ILHA 1XNRK 4KO0A 2YKMA 1WAFA 3EN9A 2HHQA 1DGKN 4KHPK 4CJ3A 1NJZA 2XRIA 1X9SA 1BIZA 3V4IA 1VSEA 5EU7A 5KPRA 5LMUK 1YTAA 2KHOA 3THWA 3W3DA 5EY4A 1UWBA 4M3UA 3KK2A 1KAYA 3EEQA 3DLRA 4H5NA 5AQXA 2JGUA 3OYIA 2QWRA 4A59A 4C8MA 2IS3A 3PX6A 3U3GA 4CFCA 1CLQA 3C0BA 1JLAA 2H3GX 2HF3A 4PKGA 4N5SA 4U67L 3RMAA 3ID8A 4F8RA 3NCIA 3TI0A 2QXLA 4FOEA 4DFPA 1VQKN 2O8DA 3CCQN 4B3SK 3OYNA 4Z0UA 1N32K 4KREA 2XHBA 1WSJA 4WFAL 2XY8A 4CD1A 4DQSA 3A5LC 4JI0K 3QBXA 3LPUA 2IGIA 4OGEA 1W9HA 5HRRA 3KD1E 4I2QA 3ZSYA 3W0LA 3GOIA 4PUOA 4JI1K 3NVMA 2WONA 4I9LA 1IG9A 1NK0A 3O3FA 2HNDA 1K8KB 3TAMA 4IDHA 2XY6A 2UUBK 4CHOA 2UXDK 2YHYA 4YHHK 4B9NA 4RWTA 2PY5A 4KB0A 2GWKA 3RWUA 4IG3A 2E8AA 3VF2A 2O8FB 4BRLA 4YOYA 4DFJA 1EWRA 2ZGYA 4MO5A 4CJLA 3K0SA 4FLWA 4Y1CA 2HSTA 1ITGA 4H5WA 3BDPA 2CGLA 2ZWHA 4IZ9A 4MQ3A 4FJ5A 3DLLL 3OW2M 4CESA 3WUHA 4GVEA 4BRGA 2QKBA 4FPAA 3ULDA 1E4GT 2GELA 3D7EO 3RSEA 4JHDA 3MXIA 4PHTX 3V81A 1QS4A 4KB1A 2ITMA 3A5NC 5J2MA 1EWQA 4BE2A 3HL8A 3AGKA 3HP6A 4KTQA 4CHPA 4WQ5A 4M3ZA 4DTXA 1WLJA 4DU4A 3CJ7A 3OVNA 1QSYA 4YORA 1Z26A 3I33A 1LWFA 1P90A 2W41A 2GX9A 3OYCA 1W0HA 3LDOA 1RILA 5C25A 5KPTA 1GLJO 1V4SA 4HTLA 4CD3A 3OYKA 1NGHA 5JVHL 3DLEA 4PQUA 3ZT4A 3MDQA 1HJRA 1Q9YA 5HOOA 4IO9L 4MDBA 4Z4IA 4DR1K 3HPGA 1VQ5N 2ITGA 3SZ2A 4DG1A 3RR7A 2KW4A 5EVZA 2ZD1A 3ZCMA 1ZBSA 5ELZA 1I3AA 2P9NA 5J2NA 4KI6A 1A5WA 2NRZA 3C65A 1SAZA 3F2KA 1HYVA 3EY1A 4DSKA 2ETJA 2WBNA 4CJPA 4CZJA 1TYQB 3AVKA 3SMSA 4LF9K 3H3OB 3SCXA 4RW6A 3KZBA 3VERA 1Q81O 2O8EA 1KLMA 4CFAA 2QEXN 3NGIA 4FVMA 4DV3K 3WT0A 1WAJA 3LP0A 4B3TK 4QS7A 1H1VA 4CJFA 1JCFA 4BWJA 2HMIA 4H0PA 3PV8A 1T44A 2B4JA 2UU9K 2JWKA 3FGUA 4GKJK 1S1XA 5AQMA 4OKJA 5EX5A 4CBUA 2NRTA 3ZSQA 2Q2RA 4IBNA 3AVHA 3H1VX 4IJNA 1SQKA 4J8FA 2I5JA 2QWLA 4FWLA 2A42A 3H46O 3EZWA 3QERA 3SQ4A 1N36K 3VQ9A 1RT2A 2QWQA 1HYSA 3O9UA 4EIAA 4WFBL 3T69A 4XH5A 4O4GA 3D0PA 5J1EA 5CY4A 4LH5A 1HRHA 5AJ3K 3K59A 4HVJA 1S1VA 5BR9A 3VESA 3CYMA 3QNNA 4FW2A 4F3TA 2QK9A 1TL3A 4CERA 5DMRA 1HKBA 1FW6A 5JLFA 4FZYA 2GTDA 3OYBA 3BEXA 1TK0A 4B9MA 1Z6RA 4CEEA 3SUQA 3QFPA 3CCSN 5JS1A 1RTJA 3JSMA 3MWPA 5BRDA 3DRSA 2Y1JA 3DXMA 3FLCO 1J53A 5KGWA 3TABA 3BGRA 4BRQA 1C0UA 4E0DA 4FJNA 3T7ZA 4QAGA 3HVRA 4BVPA 4NB4A 1JKHA 4JI4K 4BR5A 2NRHA 4B3RK 4DSEA 1WBDA 1L3SA 4H8KA 4CZMA 3BP8A 3BF3A 3CCVN 1U2VA 1NNEA 1YF5L 3IRXA 4KV8A 3K57A 1S6QA 1S72N 2Q3SA 5AFUA 1BDGA 2HBLA 4RW4A 4XEIA 3SV4A 1LCUA 4CEBA 4A5AA 5C42A 4IOCL 1VRTA 4JK9A 2QXFA 3LANA 3HOSA 3SYZA 4FJXA 3MXJA 1C0MA 2LSNA 1IJJA 4CJUA 3V1RA 1BG3A 4LSLA 3V9SA 3HBTA 1CXUA 4C8OA 4JEPA 1SV5A 2IIRA 4IEEA 4E7LA 1XC3A 3CIPA 3QO9A 4NCGA 1HNVA 1QZ5A 2P9IB 4CBWA 4DF4A 1EP4A 1ZBHA 2O8CB 3RRGA 3KLIA 3CPWM 2FLOA 4B1XB 3VEYA 3E66A 1U49A 4BROA 3ULEB 1LAWA 1HUXA 3AVJA 3SPYA 5HROA 3I0RA 2D4WA 3AARA 4YOTA 1NK6A 3H08A 1A5XA 3J81O 1IKYA 1NJYA 4DU1A 1IO2A 4LFCK 2FBTA 1Q9XA 4PY5A 4JKFA 4A57A 3G10A 4RW9A 1K9MO 5M1FA 3ZX3A 4DS5A 1EXQA 4DTPA 3FZLA 3ZSZA 2KLAA 4DTNA 1GLCG 4I2PA 3H1QA 1X3MA 4H0OA 4Y1DA 1YAGA 4H03B 4JS4A 1CXQA 4CJRA 3HVTA 4CHYA 2DFHA 3ASMA 3I55N 3VQCA 4M3TA 1KXPA 1V4TA 4JD2A 1VQLN 1NJIO 3PIPL 3ENHA 4RCHA 4DQQA 4EFHA 1T05A 1ESVA 1SKWA 1KVBA 4DTSA 5K14A 4FWSA 3QLHA 4JNEA 1HQUA 3C7NA 3EKSA 2YJEA 5FRNA 4MLHA 3L3VA 2F9TA 4CF1A 4KHSA 2HW3A 1L3VA 5LL6Z 4FCYA 1KQSM 1VSFA 3QDKA 5KRTA 5AZIA 1KLNA 3THXB 2P9PA 4IXCA 4F9OA 4BRPA 4CIGA 2VGMA 2YJFA 1RDWX 2D0CA 4CJ5A 2P9SA 2P1JA 2IOCA 4R5PA 4DTOA 5T7BA 3T1HK 1M1KO 4DQ8A 2HBKA 3LZJA 2D5RA 3P31A 5GAGP 2FSKA 4OGCA 1YITN 3SQ0A 4DR7K 1D5AA 4DQRA 3BZCA 4BC2A 2V7YA 3O3GA 5IWAK 1NK4A 3U9ZA 3WXMB 2FBYA 3CQXA 2EWSA 3I8DA 3MEEA 3G71N 2AJQA 1EQYA 2P9UB 5FPMA 1ILYA 1RDAA 1T6DA 3WNFA 3DLBA 5BRFA 4CEAA 1SL2A 4M7YA 1JLGA 1M90O 4CGIA 3VF4A 2VWBA 3VN5A 1NK7A 1TK5A 3ZEUA 5HRNA 3VQBA 4L3QA 2FBXA 1ZC6A 3D45A 3D2FA 3DLGA 5GAHP 3G4SN 4OKEA 4M7XA 1R0AA 4HUGA 5HL7L 4KHUA 4N47A 2QKKA 5GIOA 2A5XA 4CZKA 3TAEA 3P5JA 4RTFD 4LF5K 2Z1GA 3VGMA 4CEOA 4BY9C 3O4WA 4K25A 4LF4K 4O0IA 5AZJB 4DV4K 4YOXA 3J7ZO 3VF6A 3NGZA 4CEFA 1GLDG 1Z25A 2ZGZA 3V9ZA 4M3YA 3E9OA 3HO1A 1UA1A 3CCEN 5EXWA 4CZGA 2D0PA 3M5RA 1CZAN 3LP2A 3SAHA 3O9TA 4QS9A 3UKRB 4ISEA 4CJ4A 1FKOA 4F3OA 1QZ6A 4K8ZA 3FE1A 1C0GA 4K8XA 4LF8K 1UOCA 3ZT0A 4H0YB 4FJ7A 3HM9A 5KQDA 3SUPA 3LPTA 2RHKA 3CETA 3V9WA 4AHUA 4E1JA 1MA9B 1VSHA 4Z4HA 1N8RO 3J7AP 3AVLA 1YUWA 4O0JA 4IDKA 1JLQA 5BPMA 2OA8A 2YHWA 3CFPA 4KHYA 3LZIA 2HHUA 3THWB 5AQNA 3MWTA 1D8YA 3HYFA 4CZIA 3OYDA 1W2BM 4B9LA 1ZBUA 4B8CA 1X1PA 3EZ5A 4ZTFA 5AQPA 2R7YA 1QSSA 3NAEA 4WE1A 3K58A 4KPYA 3J8AA 3L2WA 2X6NA 2GWJA 1NKCA 3NDKA 1J54A 3AVBA 1RFQA 4AQYK 3EO3A 1GLFO 3J7YP 4M63C 1S6PA 5M1OA 4BC5A 4CEZA 4B1UB 3L2UA 3HRGA 4X62K 3QETA 2OZMA 3DI6A 5I3UA 2O8DB 2O8BA 2D0AA 2HVIA 3LWLA 1Q82O 4C8KA 3SAGA 4K0KK 2RF2A 2ATQA 2QW9A 3KWIA 3WXJA 5AFUH 3WEEA 2KKZA 2BUPA 1FXXA 4DTUA 1N34K 3TTDA 4O5FA 3SJJA 2G8IA 1TAQA 3SNNA 3SBTA 4AM7A 3AGRA 1WSIA 2ASMA 1NK9A 1X9MA 3HM8A 3R1XA 1ATSA 4B3MK 2NRVA 3QEIA 4KAZA 4Z4FA 3AO2A 1NK5A 1LOTB 1Y64A 2VQFK 2YHBA 1X9WA 1RDUA 4FJLA 3A5MC 4X64K 1TKTA 4N41A 3KLGA 1RDCA 2FF3B 4E7JA 2A1RA 4YOUA 3RSEB 4JHDB 3ZSXA 1VQMN 5E41A 3DOLA 5D3GA 4OPHA 4O44A 1BISA 3MCAB 4O55A 1QQCA 3IDHA 1TGOA 1YT3A 1QVFM 4NYFA 5ADXA 3NGYA 1HKCA 1NJWA 1YI2N 4A5BA 3IKMA 5HLFA 2QWOA 3UKUA 3VQ5A 4CCHA 1VAZA 3V9XA 4NYNA 3SAFA 1YIJN 3ATVA 3S41A 5TKWA 1NLVA 4ILJA 4NCBA 4XH4A 3AO1A 3O3HA 4FLVA 4BDYA 5LMNK 1KD1O 4E7IA 4AM6A 4DV5K 1WSGA 2A41A 3LL3A 3SK3A 3CQYA 4JN4A 3O5BA 1CZBA 3T19A 1G15A 4GY2B 3RVCA 4JS5A 4CEDA 3THVA 4NXMK 4CFBA 4OVLA 3THYA 2E6LA 4OLBA 4B1VA 2P9NB 2IVOA 2YNFA 3CG7A 2VWKA 2OANA 4CW7B 2XY7A 4Z4CA 2OTLN 4CVNE 4JYAK 1EKEA 2OPRA 1OVQA 3OS0A 4I9QA 4EP4A 5SZTA 1XUPO 4BDZA 3TR8A 2ASOA 3TSPA 2E2PA 4F2SA 4FXDA 2O8EB 4UY8O 3PY8A 1DKGD 1VSMA 4BQLA 2ZJQL 5IT9O 4CZFA 1T3VA 2VQEK 3SMPA 3DYAA 4KKOA 3SLCA 1YVUA 2E4LA 4FJ8A 2FXUA 3AA3A 3NVKA 3A0IX 1I39A 1YVNA 4GVMA 2W6KA 2ZM6K 4PL8A 4BRMA 3O9RA 4YDUC 1BI4B 1NM1A 1S1TA 4FPBA 5KGXA 3KIOA 4JRQA 3GE1A 1J5EK 2ZJRL 5AQJA 3C6AA 4I7FA 4CF9A 4I6MB 1VSJA 1VSKA 3FZMA 2F8TA 3AV9A 2GUIA 2B6AA 3IFRA 2XY5A 1JLBA 1T7PA 3LAMA 5BN8A 2E1ZA 3RTVA 1WB9A 1NMNA 1LW2A 3QEVA 1RT3A 1JLCA 1KFSA 4CIEA 2EHGA 2ZF5O 4FK4A 4IKFA 4FL9A 1WBBA 2OZSA 3VA3A 1EETA 4CGJA 5C12A 4YOVA 3OYHA 3TAGA 3WNGA 1OH5A 1U4BA 5M1PA 4DCHA 5BREA 5MLCQ 4DLEA 2PBDA 3IAYA 2PYJA 4A2BA 4IOAL 4UQGA 1GLEG 3K5NA 4Y0WA 1U45A 2ZE2A 4B9TA 1NU0A 3DXMB 2WC9A 4CF0A 1QTMA 4YFUA 3CFOA 1U47A 1I94K 2D0OA 2J4RA 3ALYA 4H0XB 3P4IA 2V52B 4O5BA 3KLFA 4FYDA 4KH5A 3JAMO 3LP1A 3O8MA 1EX4A 4RG8A 4OX9K 4B1ZA 1UAXA 3O4NA 3CCLN 1LW0A 4DTJA 4DV1K 1BWFO 1U2VB 3OBYA 1EO1A 4CI6A 4HWIA 5CZ2A 3AAQA 3LAKA 4E7KA 3TAPA 4H0VB 1L5UA 1R59O 5F1XA 3E9LA 3ZT1A 4BGAA 2PYLA 3ITHA 4PKHA 3MK6A 4KI4A 4DMNA 3O6WA 1BO5O 1W97L 3HT3A 2XO7A 2EX3A 3VOVA 3OYJA 4FK0A 4NLBA 4Z94A 4BR2A 4BWMA 2PFUA 2WOMA 4JKGA 2UYTA 1VQPN 3CC2N 2A40A 4E7HA 3VETA 3NF6A 1WSHA 2Q1NA 2QTDA 4JKBA 4CZEA 4BACA 3QEXA 3OJUA 3KK3A 3L2QA 5FDLA 1J6ZA 3OTOK 4K41A 4MDAA 3O80A 1HNXK 2YHAA 1BHLA 3IMXA 2BH1A 1HKGA 3ISNC 1G99A 1Y97A 4FJKA 2GUPA 4DKWA 3OYLA 4CECA 1HQEA 3DM2A 4GKKK 1CZ9A 5AQHA 3OHRA 1K6YA 4CJVA 3ZSOA 2AA4A 3WXIA 4H0TB 3VQQA 4CJKA 1HNZK 3LDNA 3GG4A 3AO3A 2P51A 3P39A 3LALA 1IBMK 3L0QA 3RR8A 1TKZA 4M41A 4CHNA 1Q18A 2YNHA 3S9HA 3I8BA 1RDBA 3CJBA 1OVYA 5EOYA 1NWKA 3KHYA 4LSNA 5GIPA 1BL3A 3ZETA 4IJAA 3TWHA 2KZZA 3C7NB 5CHIA 4CE9A 2VWJA 4EAHD 5AQWA 3HK2A 1VQNN 1FKPA 2P9LA 4G1QA 1XQSC 1MWMA 1UA0A 3OYAA 1ZXOA 1C1BA 5AZIB 4C1NK 1QQMA 4BR4A 4WCEL 5ADXH 5J2QA 1VQ4N 1NGCA 2P9PB 1NGDA 2FBVA 4FLUA 3F9MA 3ZSRA 3JXUA 3H3NO 5AQQA 1NGEA 2P9SB 4JKHA 3C94A 4BR9A 5CYMA 1VQ8N 3E1YA 3VQEA 2OYQA 1JCGA 4W5RA 4EZ6A 3ZLJA 1NGBA 1YJ9N 3HZ6A 4JKDA 1S1UA 2E2OA 4CJSA 3MN6A 4OPAA 1QQOA 1LWCA 4B8AB 5JVGL 4W5NA 1L3TA 3BUZB 3AY9A 3CJ9A 2HB5A 4FZXC 2IAJA 4FLZA 2W40A 3FZHA 4FLYA 4AHSA 2P5GA 2QWMA 1QVGM 2O4IA 3NHGA 2Q97A 1FJGK 3LDPA 5FPNA 3UIQA 5GADP 3MN7A 1HYZA 3QESA 4C8LA 3Q7BA 4Q5VA 3V1QA 4B08A 4KHQA 1IV0A 3AVMA 1BQNA 4ISFA 1WUAA 2JWLA 4F4KA 1LWEA 2BANA 3D2FB 1SZ2A 1C1AA 4FWRA 1RTIA 1BUPA 2YX6A 1SL0A 3VGLA 2P9IA 2P9KA 3DLKA 1XNQK 1K73O 4B9VA 3O4QA 4JLHA 3QBWA 3L2VA 2RKIA 4DV7K 2E5LK 1Q8IA 1GOBA 3NMUA 3OYGA 2DY4A 3ZT2A 4CF2A 1X9JA 1ZBIA 4OLAA 1TUYA 4KH6A 5CZ1A 3OYFA 3NF9A 4F2RA 3M3ZA 3ID6A 1D4XA 3P83D 1NJXA 5DM7L 4C1NI 4X66K 3M6GA 3ZX0A 4DR5K 3QICA 5BPLA 3NH0A 2OPSA 3TPQA 3AA4A 1RGIA 4AHRA 5BN9A 4B9UA 4M3RA 1IKVA 3EE8A 4FWPA 4BC3A 4DLGA 3P38A 2Q0RA 2HNYA 2FC0A 1NBWA 3WNHA 5LJWA 3GDQA 3AO4A 4H4MA 2KZMA 1NGIA 5JS2A 5BR8K 1ATRA 3DXKA 4KH4A 4BR0A 1KCFA 1RT4A 1QHTA 2G8UA 4DS4A 4CZLA 4A2AA 3KD5E 1MDUB 3AVFA 3ENOA 3KK7A 2ZJPL 1NGJA 4FSVA 3WQTA 1QQNA 4IFYA 3CERA 4BRCA 4RW8A 1B9DA 3HXMA 3TTCA 2KQ2A 4U7BA 4XH1A 3KTQA 1KTQA 5FRMA 4JV5K 4FM0A 3AVIA 1TL1A 4J2DA 2QI2A 4TSXA 4LD0A 2YCHA 5F0XA 3PX0A 3BF1A 4DR2K 1X3NA 4JK7A 4X65K 2BE2A 3D2EB 2AP1A 3HSCA 5AR0A 3SBGA 3KKSA 4JRPA 4B1WB 3L8BA 3V1OA 1VSIA 2PAVA 2E1YA 1WSEA 4CHZA 3MN5A 1NGAA 1XMOK 1DEJA 4BE0A 2HHVA 4OO1J 3CI5A 1KRPA 3WXLA 1YJWN 2Q0UA 4CJQA 1YHQN 3K9JA 4FOIA 3CC4N 3CCMN 1HLUA 5CR4A 5CE3A 1VQ7N 4XIUA 3U8XA 1WOQA 2RE2A 2E88A 3EYZA 1QE1A 4KTWA 4AHCA 2YV0X 4FK2A 4FJ9A 5AQKA 5JICA 2CH5A 1KC8O 4LF7K 1HPMA 1NGGA 4ELTA 2UUAK 4AH9A 3C95A 2CGKA 4L8RB 3O9SA 4BDPA 4ID1A 1Z05A 4DWIA 1RTDA 1NOZA 4WFNL 4JI7K 4QCLA 3M8RA 4FLXA 3B6OA 4W5OA 4YY3K 4JAXA 3OY9A 4ELUA 2V51B 3MEGA 4BRKA 3PO4A 4YDUA 5AQZA 4DV2K 5E84A 2P5OA 2HHXA 3OBWA 3DJCA 1Q86O 3H45C 4DR3K 1SKRA 1C0FA 4DUZK 3G6EN 4BVOA 1VHXA 4FJIA 5KTQA 1ZBLA 4FM1A 3CM5A 1RT5A 4O8UA 4IG0A 1BCMA 4YNQA 4E19A 3THYB 1C0TA 1XWLA 4E89A 3A5OC 3LDQA 3QFUA 4IFVA 1DTQA 3CM6A 3T1AA 4CGHA 5SWMA 4WYBA 1QHAA 1ASVA 1RBTA 1BOTO 4CJEA 3HOTA 4CZHA 5B8HA 4ID5A 4WQ4C 1HNWK 3AA2A 4Z4EA 3D6RA 1HR0K 3A2FA 4CGFA 5C2FA 4A61A 3CCRN 3TARA 4FWQA 1BU6O 1TV6A 4H5VA 1SKSA 2G8KA 4GV9A 4BRNA 4JKCA 2OCEA 2IC3A 2NRRA 5FPEA 3RRHA 3LM9A 2O4GA 2F8SA 4GNIA 1TKDA 2FF6A 4HUFA 2VG7A 3ATUA 4H5RA 4M3XA 2F96A 4GV3A 3C6TA 1C6VA 1S1WA 1JLFA 3VEVA 5TKYA 5HRSA 5AQFA 1BA0A 1F21A 3ZSWA 3U3YA 1JXEA 3TU5A 5FLXO 3R6MA 1TK8A 4KTZA 2FSNA 1JL2A 3SI6A 5J2PA 3PX4A 4CGGA 3VQDA 3NE6A 3MEDA 4BQZA 1BA1A 4CJTA 3NH2A 3OJSA 3HPHA 2OPQA 3TAFA 1HNIA 1S9EA 3CC7N 3VQPA 5M1NA 1VQON 4K43A 3DMJA 2Y1IA 2A3ZA 3K2PA 3M8SA 2HVHA 2V7ZA 3VQ6A 4FM2A 1XMQK 1TKXA 3HSTB 3F9KA 3P1GA 3MX5A 1IKXA 1B92A 2OPPA 3WXKA 1NOYA 2CGJA 1DLOA 5AQYA 2IVNA 3JYTA 2QWNA 3TSUA 1KFDA 3KLHA 1NKEA 3CJCA 4G9ZA 1SS6A 3B6PA 5JMVA 1D9DA 1JXBA 1RBUA 4PWDA 4EHTA 3C6HA 3TSQA 1RTHA 3AVNA 5GINA 3NBPA 1T8EA 3VGKA 1K8KA 3QIPA 1KAZA 1GOCA 1TUUA 4AHVA 3B8AX 5KPZA 4W5QA 4FVUA 5AQSA 3H6EA 3CMEN 1BIUA 2O8FA 3LWMA 2YNIA 3WQUA 3RMCA 4JI2K 2F9WA 4DF8A 4Z4GA 1NGFA 3CMAN 1YJNN 4A62A 4FJMA 1BQMA 3I56N 2BTFA 1S5JA 4JKAA 4E3SA 4PL7A 3GL1A 3F5TA 3TTFA 3QMLA 4FJJA 3UB5A 1T03A 2UUCK 1T6CA 3E01A 1VRUA 3AVCA 2Z1JA 3HTVA 3PO5A 4BRDA 3M1FA 4BRHA 1RBSA 3LDLA 5FROA 3VQ8A 4BRIA 4V19S 4AF1A 4DTMA 3OA9A 4JKGB 4HCCA 2HF4A 3NH1A 1RT6A 3IS9A 4CBXA 2G8FA 3L6QA 4GMJB 4FJHA 4ILGB 4N56A 1HJOA 3PSFA 3NFAA 3SV3A 1KAXA 3QNOA 3O1WA 2VG6A 1W7AA 1DTTA 3FR0A 3KLEA 2ASPA 4BE1A 4ICLA 5AQVA 3VMFB 1KSPA 2F7TA 1A5VA 1BI4A 2WFBA 1VK0A 3R3LA 1N33K 4BR7A 1ASUA 4MO4A 5A2QO 4CFDA 4I6MA 1NKBA 2D0BA 1KVCA 2I7NA 3G0ZA 1JJ2M 3FZKA 4BG8A 3F73A 4EZ9A 3VTHA 4FWMA 3S3MA 4LY7A 5AQRA 1OKJA 1TYQA 3I0SA 1J5OA 1WN7A 4CIFA 4QS8A 4JI3K 2KFNA 2NRXA 4ZTJA 1SUQA 1S22A 2QA4N 5AQLA 2E2NA 3HP9A 1LAVA 4YOWA 1IH7A 1O13A 3QEPA 4C23A 4H5TA 4DB3A 3ZETB 3M8PA 3VEZA 5CYQA 3ZX2A 2BGGA 4MLEA 2P9LB 3MECA 4J2BA 3N4QA 4DV0K 4NXNK 4DR4K 4KFBA 3K5MA 1MWKA 2NUBA 2NNWA 4WQ5C 4KBOA 2HBJA 3OS1A 4CK3A 1XHZA 3CJAA 2RPIA 3CQ8A 2E2QA 2GBZA 5M1QA 1TAUA 3VEOA 4WF9L 3AO5A 5KQ8A 3FFKB 3O08A 1B9FA 4AHTA 3T1YK 3PLAA 2YKNA 2JLEA 1D9FA 1E3MA 4KHWA 3NF7A 4DQIA 3S3OA 4JK8A 4NCAA 3SQ1A 2VYPA 2QM1A 2WUSA 4O8KA 1REVA 4EHUA 1XHXA 3DAWA 5LJVA 3DRPA 4BC4A 4JD2B 3PIOL 2NZTA 1HX1A 3CPEA 2IVPA 3HJFA 3MMVA 5HP1A 2KFZA 4DHYA 3JS6A 3GBTA 3MCPA 4OJRA 3SUOA 2ZQBA 2Z1HA 3L3UA 4IWVA 5DM6L 2HNZA 5C2DA 3MXMA 2HOEA 3KVGA 4DU3A 5M1KA 3U6FA 3RMBA 3IG1A 2BDPA 5LY3A 5C0YA 4ISGA 3SPZA 1GLAG 4DUYK 2UXBK 3M8QA 2P9KB 2VG5A 1BCOA 2X74A 5HRPA 1C1CA 2G8WA 3VQ7A 1NG9A 4LF6K 3OS2A 1QSLA 2DFFA 1VSLA 2Z1IA 5BPNA 3J80O 3CXCM 2G8VA 3L4QA 1IG8A 2HBMA 3K5LA 1RCHA 3V6DA 4B9QA 3CF5L 4FWNA 3SJHA 1ASWA 4M3WA 2IDOA 4DQPA 1XC9A 4IEIA 2KTQA 1GLBG 3N4PA 3G25A 3RMDA 2RN2A 4IOXA 4LFAK 4B1YB 1IBKK 3R9PA 2UXCK 2G8HA 3PUFA 3O1BA 1YXQA 3IUCA 2NLXA 5BRHA 2DPNA 5AQIA 4HUEA 5F2RA 3OYEA 3BZKA 3ZEUB 3LP3A 4IO8A 4DV6K 4OKKA 4RW7A 5KRSA 2YHXA 3VEXA 3KK1A 5AQTA 4FZZA 2PZSA 2NRWA 4OPKA 3K5OA 3DXKB 3DWLA 2X78A 4DFKA 4FO0A 2O8CA 1JL1A 1WNSA 3VENA 5GAEP 2HHWA 3QB0A 3ULEA 5C15A 4DTRA 4DR6K 3U4LA 4B3OA 1LV5A 2WTUA 1Q7YO 3NF8A 3VQAA 3Q7CA 1IKWA 4NO7A 5I42A 2I7PA 4LC9B 2DFEA 4JI8K 4ZHRA 4IFEA 1MU2A 5AQUA 2Q31A 1KVAA 1DT9A 1L3UA 2X6SA 3CJ1A 2VCPA 1S9GA 4CJ7A 2HHTA 1HPZA 4DSJA 3SUNA 4LFBK 2FSJA 4DFMA 3PSIA 3LM2A 1GLLO 2HMPA 1P8ZA 1JCEA 4DSIA 3AA5X 4CK2A 3L4IA 4CF8A 3KJVA 1BGXT 1RBVA 3CFRA 2A1SA 3FFIA 4ELVA 3R8EA 3VA0A 1VQ9N 3A8YA 2A6AA 3ZSVA 1FK9A 4HTUA 4QOZB 4NLCA 1HMVA 3EKUA 4JKEA 3VPZA 1U6ZA 3UE5A 1NMDA 3HI0A 4BREA 2DTUA 4CJWA 4AILC 3THXA 5AQOA 1RT7A 4WQ4A 4MFBA 3TAQA 4OPJA 4KHNA 4PA1A 4CHQA 1O1WA 4B9SA 4Q0BA 3MAQA 4CGDA 1VQ6N 4GW6A 2CH6A 4GV6A 4FWOA 3C6UA 4E1MA 4DSLA 4KRFA 3TANA 5HBMA 2F4VK 1U04A 1XI1A 2O8BB 3O9QA 3BY5A 1GOAA 1OH6A 1WSFA 3ZT3A 4CK1A 4M45A 1ZBFA 3CD6N 3WEEB 3VTIA 4FLTA 3S3NA 3WNEA 2P9UA 5AQGA 2GV9A 3CCUN 3FZFA 4J2AA 3AAPA 3MX2A 1RT1A 5C24A 3OYMA 5I9EB 5FPDA 1ATNA 2OTJN 4JI6K 1TVRA 3MN9A 2Q36A 1U48A 1YTUA 2VGNA 4PKIA 3ZYYX 4J2EA 4JI5K 4BRAA 4R79A 1IBLK 3DOKA 2W6LA 4BGBA 3AVGA 4FWKA 2YNGA 3HPOA 4CEQA 3L2RA 2B5JA 2W42A 2HHHK 1ZYQA 1S3XA 4FW1A 4EP5A 4HHTA 3VQ4A 4E1NA 1NK8A 4FJGA 1E4FT 2E20A 1RBRA 3E9PA 4C8NA 4HCBA 4H4OA 4M42A 1N5YA 3DLHA 5AZJA 4LH4A 1VSDA 3KKRA 3KWGA 1J9AA 5KI6A 3U9DA 3EE9A 3LDSA 2QWPA 3K9KA 4BG9A 1OH8A 1JLEA 1RNHA 5E26A 5H1SQ 1N6QA 4W5TA 3DRRA 1K8AO 3UKRA 4N76A 4DSFA 3D2EA
chains in the Genus database with same CATH topology
3B6PA 1D9DA 4OGCA 1BHLA 1JXBA 1RBUA 3SQ0A 5DK5A 4PWDA 3V9UA 1D5AA 4DQRA 1RTHA 1SL1A 3AVNA 3QEWA 1ZYQA 2E6MA 3NBPA 3O3GA 1T8EA 3SQ2A 1NK4A 3QIPA 1RDDA 3ISNC 1GOCA 4AHVA 4W5QA 2FBYA 1Y97A 4FJKA 3I8DA 3MEEA 2AJQA 3AVAA 3QIOA 3OYLA 3T3FA 4CECA 3QINA 1RDAA 1BIUA 1HQEA 3WNFA 3DM2A 3LWMA 3DLBA 2YNIA 1CZ9A 4CEAA 1SL2A 1JLGA 4FJXA 4CGIA 3RMCA 2HHSA 1K6YA 4CJVA 3ZSOA 4DF8A 4KO0A 3VN5A 3VQQA 2YKMA 4Z4GA 1WAFA 4CJKA 1NK7A 1TK5A 2HHQA 5HRNA 4CJ3A 1NJZA 2XRIA 3VQBA 1X9SA 1BIZA 3V4IA 2FBXA 4FJMA 1VSEA 1BQMA 5EU7A 3AO3A 2P51A 3D45A 1S5JA 1YTAA 3LALA 4E3SA 3RR8A 4FK0A 1UWBA 4FJJA 3DLGA 1TKZA 1T03A 4M41A 4CHNA 4OKEA 4M3UA 2YNHA 3KK2A 1R0AA 3S9HA 3DLRA 1RDBA 4HUGA 2JGUA 3E01A 3OYIA 1VRUA 4LSNA 4KHUA 1BL3A 3AVCA 4N47A 2Z1JA 2QKKA 3PO5A 3TWHA 4C8MA 2KZZA 2IS3A 4CE9A 3TAEA 2VWJA 3P5JA 3HK2A 1FKPA 3PX6A 1RBSA 2Z1GA 4G1QA 3U3GA 5FROA 3VQ8A 4CFCA 4CEOA 1CLQA 1JLAA 4DTMA 1UA0A 3OYAA 4N5SA 1C1BA 3RMAA 4F8RA 3NCIA 4O0IA 3TI0A 4HCCA 5J2QA 3NH1A 1RT6A 3IS9A 2FBVA 4FLUA 2G8FA 3ZSRA 4DFPA 4GMJB 4FJHA 3NGZA 4N56A 3OYNA 4Z0UA 4CEFA 4KREA 2XHBA 1WSJA 1Z25A 3C94A 3NFAA 3SV3A 2XY8A 3V9ZA 5CYMA 4M3YA 4DQSA 3HO1A 1UA1A 3VQEA 3QNOA 2OYQA 4W5RA 4EZ6A 2VG6A 1DTTA 3LPUA 3KLEA 2IGIA 3LP2A 4OGEA 4BE1A 4ICLA 1S1UA 1W9HA 5HRRA 4CJSA 3KD1E 4I2QA 3ZSYA 4CJ4A 1KSPA 4PUOA 1FKOA 1A5VA 1BI4A 2WONA 4I9LA 1VK0A 1IG9A 1LWCA 4B8AB 4F3OA 1NK0A 4K8ZA 4W5NA 3O3FA 2HNDA 1L3TA 4K8XA 3TAMA 2XY6A 4CHOA 1UOCA 2HB5A 4FZXC 1ASUA 3ZT0A 4B9NA 2IAJA 4FLZA 2PY5A 4CFDA 4KB0A 4FJ7A 3HM9A 3RWUA 1NKBA 2D0BA 4IG3A 4FLYA 4AHSA 3SUPA 2P5GA 1KVCA 3G0ZA 2O4IA 3NHGA 3LPTA 3F73A 4DFJA 4EZ9A 3V9WA 3UIQA 3S3MA 4AHUA 4LY7A 1HYZA 1VSHA 4CJLA 4Z4HA 3QESA 4FLWA 4C8LA 4Y1CA 4Q5VA 3V1QA 1ITGA 3AVLA 4B08A 3I0SA 4KHQA 4O0JA 3AVMA 1J5OA 3BDPA 1BQNA 4IDKA 1WN7A 1JLQA 2OA8A 4F4KA 4CIFA 4MQ3A 4FJ5A 3CFPA 1LWEA 2BANA 4CESA 3LZIA 1C1AA 4KHYA 1RTIA 2HHUA 2KFNA 1D8YA 3HYFA 1SUQA 4ZTJA 3OYDA 2QKBA 1SL0A 4B9LA 1ZBUA 4B8CA 1X1PA 3EZ5A 3ULDA 2R7YA 4ZTFA 1QSSA 3NAEA 3HP9A 1LAVA 3DLKA 4WE1A 1IH7A 3MXIA 3K58A 3V81A 3QEPA 1QS4A 4B9VA 4KB1A 4KPYA 3O4QA 3M8PA 4JLHA 5CYQA 5J2MA 3L2WA 2BGGA 4BE2A 2X6NA 3HL8A 1NKCA 3HP6A 3L2VA 4KTQA 2RKIA 3MECA 3NDKA 1Q8IA 1GOBA 1J54A 3AVBA 3OYGA 4CHPA 4J2BA 2DY4A 3ZT2A 4M3ZA 4CF2A 4DTXA 4KFBA 3K5MA 2NUBA 1ZBIA 4OLAA 1WLJA 3OS1A 4DU4A 3OVNA 4CK3A 1QSYA 1XHZA 5CZ1A 3OYFA 1Z26A 2RPIA 1LWFA 1S6PA 3NF9A 4CEZA 3L2UA 2OZMA 3OYCA 3QETA 1W0HA 3CQ8A 3DI6A 4F2RA 5I3UA 1RILA 5C25A 2D0AA 2GBZA 3P83D 2HVIA 1TAUA 3OYKA 3LWLA 1NJXA 3DLEA 4C8KA 4PQUA 3AO5A 2RF2A 2ATQA 3ZT4A 1HJRA 1Q9YA 1FXXA 1B9FA 4AHTA 4DTUA 3NH0A 2OPSA 2YKNA 2JLEA 1D9FA 3AA4A 4Z4IA 3HPGA 4AHRA 3SJJA 3NF7A 4KHWA 4DQIA 3S3OA 2G8IA 1TAQA 2ITGA 3SZ2A 4DG1A 3SNNA 2KW4A 3RR7A 4B9UA 4M3RA 2ZD1A 3SQ1A 4NCAA 1IKVA 1WSIA 1REVA 3ZCMA 1XHXA 1I3AA 3DRPA 4DLGA 1NK9A 1X9MA 5J2NA 2HNYA 2FC0A 3WNHA 4KI6A 1A5WA 3AO4A 5FRNA 3HJFA 4H4MA 2KZMA 5HP1A 5JS2A 2KFZA 1HYVA 3EY1A 4DSKA 2ETJA 3SUOA 4OJRA 2ZQBA 2Z1HA 1KCFA 4CJPA 1RT4A 1QHTA 3L3UA 2G8UA 3QEIA 4DS4A 2HNZA 3MXMA 3KD5E 3AVKA 3AVFA 4KAZA 4Z4FA 3AO2A 3SCXA 4IFYA 4DU3A 1NK5A 4RW6A 3U6FA 2YHBA 1X9WA 4RW8A 1KLMA 1B9DA 3HXMA 3IG1A 3RMBA 2BDPA 4CFAA 2KQ2A 3NGIA 4FVMA 4FJLA 3KTQA 1WAJA 3LP0A 1KTQA 1TKTA 3SPZA 4FM0A 4N41A 5FRMA 3KLGA 1RDCA 4E7JA 2A1RA 3M8QA 2VG5A 3AVIA 3ZSXA 4CJFA 1BCOA 2X74A 5E41A 1TL1A 4BWJA 5HRPA 4J2DA 1C1CA 3DOLA 2G8WA 2HMIA 3VQ7A 3PV8A 5D3GA 3OS2A 4O44A 4TSXA 1T7PA 1BISA 1QSLA 2DFFA 4O55A 1QQCA 2B4JA 4LD0A 1TGOA 1VSLA 2Z1IA 2G8VA 1YT3A 3PX0A 4NYFA 1S1XA 4OKJA 3K5LA 1RCHA 3NGYA 1NJWA 2BE2A 3V6DA 5HLFA 3ZSQA 3KKSA 3VQ5A 4JRPA 4CCHA 4IBNA 3V9XA 1ASWA 4M3WA 3AVHA 3L8BA 2IDOA 1VSIA 4NYNA 3V1OA 1XC9A 4DQPA 2KTQA 1WSEA 4CHZA 2I5JA 4NCBA 3RMDA 2RN2A 4BE0A 2HHVA 3AO1A 3QERA 3SQ4A 3O3HA 4FLVA 4BDYA 3VQ9A 2G8HA 1RT2A 3PUFA 4E7IA 1HYSA 1KRPA 1WSGA 4CJQA 3T19A 1CZBA 4KHSA 1G15A 2HW3A 4JS5A 4CEDA 4HUEA 3THVA 4CFBA 3OYEA 4O4GA 3D0PA 4XIUA 5J1EA 5CY4A 4LH5A 1HRHA 4OVLA 3LP3A 3K59A 4HVJA 4OKKA 2E6LA 4OLBA 1S1VA 3CYMA 3EYZA 3QNNA 2YNFA 4RW7A 3CG7A 1QE1A 5KRSA 3KK1A 4FW2A 2VWKA 4KTWA 4FZZA 2PZSA 4F3TA 2XY7A 4OPKA 4AHCA 4Z4CA 1TL3A 2YV0X 4CERA 2QK9A 3K5OA 5DMRA 4FK2A 4FJ9A 4FZYA 2X78A 1EKEA 4DFKA 2OPRA 3OS0A 4I9QA 3OYBA 1JL1A 4EP4A 1WNSA 5SZTA 1TK0A 4BDZA 4B9MA 3TR8A 2HHWA 4CEEA 3SUQA 4F2SA 4FXDA 4ELTA 4DTRA 3PY8A 5JS1A 1RTJA 3JSMA 4B3OA 4AH9A 3C95A 1LV5A 1VSMA 3DRSA 2Y1JA 4L8RB 3NF8A 3VQAA 1IKWA 4ID1A 5I42A 4BDPA 2DFEA 4ZHRA 1J53A 1MU2A 5KGWA 3TABA 1RTDA 1NOZA 3BGRA 4DWIA 4QCLA 3DYAA 3M8RA 4FLXA 1KVAA 3B6OA 4W5OA 2X6SA 4KKOA 1L3UA 1C0UA 1YVUA 4E0DA 4FJNA 2E4LA 4QAGA 3HVRA 3OY9A 1S9GA 4ELUA 1JKHA 2HHTA 3MEGA 4FJ8A 3AA3A 1I39A 1HPZA 4GVMA 3PO4A 4DSJA 3SUNA 4DFMA 4DSEA 1BI4B 1L3SA 4H8KA 2P5OA 2HHXA 1S1TA 3IRXA 4DSIA 3AA5X 4KV8A 5KGXA 3K57A 4CK2A 3KIOA 1S6QA 4JRQA 4CF8A 3KJVA 1BGXT 1RBVA 2Q3SA 4I7FA 3CFRA 4CF9A 2A1SA 4RW4A 1VSJA 1VSKA 3FFIA 1SKRA 4ELVA 3SV4A 2F8TA 3AV9A 4CEBA 3VA0A 5C42A 1VRTA 2GUIA 2QXFA 3LANA 3SYZA 4FJIA 2B6AA 3ZSVA 5KTQA 1FK9A 3MXJA 4HTUA 2XY5A 1ZBLA 1C0MA 1JLBA 2LSNA 3LAMA 4CJUA 3CM5A 3V1RA 4FM1A 1HMVA 3RTVA 4QOZB 1RT5A 4IG0A 1LW2A 4LSLA 1RT3A 3V9SA 1JLCA 3QEVA 1BCMA 4YNQA 1CXUA 4E19A 1XWLA 1C0TA 4E89A 1KFSA 4C8OA 4CIEA 2EHGA 4IFVA 1DTQA 4FK4A 1SV5A 3CM6A 3T1AA 4CGHA 5SWMA 2OZSA 4IKFA 4E7LA 3VA3A 1EETA 3QO9A 4NCGA 1HNVA 4CGJA 1ASVA 1RBTA 2DTUA 4CJEA 4CJWA 4AILC 1RT7A 3OYHA 3TAGA 4MFBA 4ID5A 3TAQA 3WNGA 4OPJA 4DF4A 1U4BA 4KHNA 1EP4A 4PA1A 1ZBHA 3AA2A 4Z4EA 4CHQA 3A2FA 1O1WA 4CGFA 4B9SA 4Q0BA 3RRGA 3KLIA 3MAQA 4CGDA 4GW6A 1U49A 3TARA 1LAWA 3AVJA 3SPYA 4DLEA 3I0RA 1TV6A 5HROA 1SKSA 1NK6A 2G8KA 3IAYA 2PYJA 3H08A 1A5XA 1NJYA 1IKYA 3C6UA 4UQGA 2IC3A 1IO2A 4E1MA 3K5NA 4DU1A 1U45A 2ZE2A 3TANA 4B9TA 2FBTA 4DSLA 4KRFA 3RRHA 4CF0A 1QTMA 5HBMA 4YFUA 3CFOA 1U47A 1U04A 2O4GA 1XI1A 1Q9XA 2F8SA 4PY5A 1TKDA 1GOAA 3G10A 1WSFA 4HUFA 2VG7A 4RW9A 3ZT3A 4CK1A 3ALYA 4M45A 1ZBFA 4O5BA 4M3XA 2F96A 4FLTA 3KLFA 4DS5A 1EXQA 3WNEA 3S3NA 4FYDA 4DTPA 3LP1A 2GV9A 4J2AA 3C6TA 3ZSZA 1C6VA 1EX4A 1S1WA 4DTNA 4I2PA 4RG8A 1JLFA 1RT1A 5C24A 4Y1DA 1UAXA 3OYMA 3O4NA 4JS4A 5HRSA 1LW0A 4DTJA 1CXQA 3ZSWA 1F21A 3U3YA 4CJRA 1JXEA 3HVTA 4CHYA 2DFHA 1TVRA 3ASMA 1TK8A 1U48A 5CZ2A 3VQCA 4KTZA 1YTUA 4M3TA 1JL2A 3LAKA 4E7KA 3SI6A 3TAPA 1L5UA 5J2PA 3PX4A 4CGGA 3VQDA 3NE6A 3MEDA 4J2EA 3ZT1A 4CJTA 3NH2A 4DQQA 1T05A 3OJSA 2PYLA 3ITHA 3HPHA 2OPQA 3DOKA 3TAFA 1SKWA 1KVBA 1HNIA 4DTSA 1S9EA 4KI4A 4DMNA 3VQPA 3AVGA 5K14A 2YNGA 3QLHA 1HQUA 3DMJA 4CEQA 2B5JA 3HPOA 3L2RA 2Y1IA 2W42A 3K2PA 3HT3A 2XO7A 2EX3A 3L3VA 4FW1A 4CF1A 3VQ4A 4E1NA 4EP5A 3OYJA 3M8SA 4HHTA 1NK8A 1L3VA 4FJGA 2HVHA 4FCYA 1VSFA 4BWMA 3VQ6A 1RBRA 2WOMA 4FM2A 4C8NA 1TKXA 3HSTB 5KRTA 4HCBA 1KLNA 3F9KA 3P1GA 4H4OA 4M42A 1N5YA 3DLHA 1IKXA 1B92A 4LH4A 1VSDA 3KKRA 1J9AA 2OPPA 4E7HA 1NOYA 4CIGA 3NF6A 1DLOA 1WSHA 5KI6A 2D0CA 4CJ5A 2P1JA 2IOCA 3JYTA 4R5PA 3LDSA 4DTOA 5T7BA 4BACA 3QEXA 3OJUA 3KK3A 3L2QA 1JLEA 1KFDA 5FDLA 3LZJA 1RNHA 2D5RA 3KLHA 1NKEA 1N6QA 4W5TA 3DRRA 4N76A 4DSFA 2YHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6P A;  1D9D A;  4OGC A;  1BHL A;  1JXB A;  1RBU A;  3SQ0 A;  5DK5 A;  4PWD A;  3V9U A;  1D5A A;  4DQR A;  1RTH A;  1SL1 A;  3AVN A;  3QEW A;  1ZYQ A;  2E6M A;  3NBP A;  3O3G A;  1T8E A;  3SQ2 A;  1NK4 A;  3QIP A;  1RDD A;  3ISN C;  1GOC A;  4AHV A;  4W5Q A;  2FBY A;  1Y97 A;  4FJK A;  3I8D A;  3MEE A;  2AJQ A;  3AVA A;  3QIO A;  3OYL A;  3T3F A;  4CEC A;  3QIN A;  1RDA A;  1BIU A;  1HQE A;  3WNF A;  3DM2 A;  3LWM A;  3DLB A;  2YNI A;  1CZ9 A;  4CEA A;  1SL2 A;  1JLG A;  4FJX A;  4CGI A;  3RMC A;  2HHS A;  1K6Y A;  4CJV A;  3ZSO A;  4DF8 A;  4KO0 A;  3VN5 A;  3VQQ A;  2YKM A;  4Z4G A;  1WAF A;  4CJK A;  1NK7 A;  1TK5 A;  2HHQ A;  5HRN A;  4CJ3 A;  1NJZ A;  2XRI A;  3VQB A;  1X9S A;  1BIZ A;  3V4I A;  2FBX A;  4FJM A;  1VSE A;  1BQM A;  5EU7 A;  3AO3 A;  2P51 A;  3D45 A;  1S5J A;  1YTA A;  3LAL A;  4E3S A;  3RR8 A;  4FK0 A;  1UWB A;  4FJJ A;  3DLG A;  1TKZ A;  1T03 A;  4M41 A;  4CHN A;  4OKE A;  4M3U A;  2YNH A;  3KK2 A;  1R0A A;  3S9H A;  3DLR A;  1RDB A;  4HUG A;  2JGU A;  3E01 A;  3OYI A;  1VRU A;  4LSN A;  4KHU A;  1BL3 A;  3AVC A;  4N47 A;  2Z1J A;  2QKK A;  3PO5 A;  3TWH A;  4C8M A;  2KZZ A;  2IS3 A;  4CE9 A;  3TAE A;  2VWJ A;  3P5J A;  3HK2 A;  1FKP A;  3PX6 A;  1RBS A;  2Z1G A;  4G1Q A;  3U3G A;  5FRO A;  3VQ8 A;  4CFC A;  4CEO A;  1CLQ A;  1JLA A;  4DTM A;  1UA0 A;  3OYA A;  4N5S A;  1C1B A;  3RMA A;  4F8R A;  3NCI A;  4O0I A;  3TI0 A;  4HCC A;  5J2Q A;  3NH1 A;  1RT6 A;  3IS9 A;  2FBV A;  4FLU A;  2G8F A;  3ZSR A;  4DFP A;  4GMJ B;  4FJH A;  3NGZ A;  4N56 A;  3OYN A;  4Z0U A;  4CEF A;  4KRE A;  2XHB A;  1WSJ A;  1Z25 A;  3C94 A;  3NFA A;  3SV3 A;  2XY8 A;  3V9Z A;  5CYM A;  4M3Y A;  4DQS A;  3HO1 A;  1UA1 A;  3VQE A;  3QNO A;  2OYQ A;  4W5R A;  4EZ6 A;  2VG6 A;  1DTT A;  3LPU A;  3KLE A;  2IGI A;  3LP2 A;  4OGE A;  4BE1 A;  4ICL A;  1S1U A;  1W9H A;  5HRR A;  4CJS A;  3KD1 E;  4I2Q A;  3ZSY A;  4CJ4 A;  1KSP A;  4PUO A;  1FKO A;  1A5V A;  1BI4 A;  2WON A;  4I9L A;  1VK0 A;  1IG9 A;  1LWC A;  4B8A B;  4F3O A;  1NK0 A;  4K8Z A;  4W5N A;  3O3F A;  2HND A;  1L3T A;  4K8X A;  3TAM A;  2XY6 A;  4CHO A;  1UOC A;  2HB5 A;  4FZX C;  1ASU A;  3ZT0 A;  4B9N A;  2IAJ A;  4FLZ A;  2PY5 A;  4CFD A;  4KB0 A;  4FJ7 A;  3HM9 A;  3RWU A;  1NKB A;  2D0B A;  4IG3 A;  4FLY A;  4AHS A;  3SUP A;  2P5G A;  1KVC A;  3G0Z A;  2O4I A;  3NHG A;  3LPT A;  3F73 A;  4DFJ A;  4EZ9 A;  3V9W A;  3UIQ A;  3S3M A;  4AHU A;  4LY7 A;  1HYZ A;  1VSH A;  4CJL A;  4Z4H A;  3QES A;  4FLW A;  4C8L A;  4Y1C A;  4Q5V A;  3V1Q A;  1ITG A;  3AVL A;  4B08 A;  3I0S A;  4KHQ A;  4O0J A;  3AVM A;  1J5O A;  3BDP A;  1BQN A;  4IDK A;  1WN7 A;  1JLQ A;  2OA8 A;  4F4K A;  4CIF A;  4MQ3 A;  4FJ5 A;  3CFP A;  1LWE A;  2BAN A;  4CES A;  3LZI A;  1C1A A;  4KHY A;  1RTI A;  2HHU A;  2KFN A;  1D8Y A;  3HYF A;  1SUQ A;  4ZTJ A;  3OYD A;  2QKB A;  1SL0 A;  4B9L A;  1ZBU A;  4B8C A;  1X1P A;  3EZ5 A;  3ULD A;  2R7Y A;  4ZTF A;  1QSS A;  3NAE A;  3HP9 A;  1LAV A;  3DLK A;  4WE1 A;  1IH7 A;  3MXI A;  3K58 A;  3V81 A;  3QEP A;  1QS4 A;  4B9V A;  4KB1 A;  4KPY A;  3O4Q A;  3M8P A;  4JLH A;  5CYQ A;  5J2M A;  3L2W A;  2BGG A;  4BE2 A;  2X6N A;  3HL8 A;  1NKC A;  3HP6 A;  3L2V A;  4KTQ A;  2RKI A;  3MEC A;  3NDK A;  1Q8I A;  1GOB A;  1J54 A;  3AVB A;  3OYG A;  4CHP A;  4J2B A;  2DY4 A;  3ZT2 A;  4M3Z A;  4CF2 A;  4DTX A;  4KFB A;  3K5M A;  2NUB A;  1ZBI A;  4OLA A;  1WLJ A;  3OS1 A;  4DU4 A;  3OVN A;  4CK3 A;  1QSY A;  1XHZ A;  5CZ1 A;  3OYF A;  1Z26 A;  2RPI A;  1LWF A;  1S6P A;  3NF9 A;  4CEZ A;  3L2U A;  2OZM A;  3OYC A;  3QET A;  1W0H A;  3CQ8 A;  3DI6 A;  4F2R A;  5I3U A;  1RIL A;  5C25 A;  2D0A A;  2GBZ A;  3P83 D;  2HVI A;  1TAU A;  3OYK A;  3LWL A;  1NJX A;  3DLE A;  4C8K A;  4PQU A;  3AO5 A;  2RF2 A;  2ATQ A;  3ZT4 A;  1HJR A;  1Q9Y A;  1FXX A;  1B9F A;  4AHT A;  4DTU A;  3NH0 A;  2OPS A;  2YKN A;  2JLE A;  1D9F A;  3AA4 A;  4Z4I A;  3HPG A;  4AHR A;  3SJJ A;  3NF7 A;  4KHW A;  4DQI A;  3S3O A;  2G8I A;  1TAQ A;  2ITG A;  3SZ2 A;  4DG1 A;  3SNN A;  2KW4 A;  3RR7 A;  4B9U A;  4M3R A;  2ZD1 A;  3SQ1 A;  4NCA A;  1IKV A;  1WSI A;  1REV A;  3ZCM A;  1XHX A;  1I3A A;  3DRP A;  4DLG A;  1NK9 A;  1X9M A;  5J2N A;  2HNY A;  2FC0 A;  3WNH A;  4KI6 A;  1A5W A;  3AO4 A;  5FRN A;  3HJF A;  4H4M A;  2KZM A;  5HP1 A;  5JS2 A;  2KFZ A;  1HYV A;  3EY1 A;  4DSK A;  2ETJ A;  3SUO A;  4OJR A;  2ZQB A;  2Z1H A;  1KCF A;  4CJP A;  1RT4 A;  1QHT A;  3L3U A;  2G8U A;  3QEI A;  4DS4 A;  2HNZ A;  3MXM A;  3KD5 E;  3AVK A;  3AVF A;  4KAZ A;  4Z4F A;  3AO2 A;  3SCX A;  4IFY A;  4DU3 A;  1NK5 A;  4RW6 A;  3U6F A;  2YHB A;  1X9W A;  4RW8 A;  1KLM A;  1B9D A;  3HXM A;  3IG1 A;  3RMB A;  2BDP A;  4CFA A;  2KQ2 A;  3NGI A;  4FVM A;  4FJL A;  3KTQ A;  1WAJ A;  3LP0 A;  1KTQ A;  1TKT A;  3SPZ A;  4FM0 A;  4N41 A;  5FRM A;  3KLG A;  1RDC A;  4E7J A;  2A1R A;  3M8Q A;  2VG5 A;  3AVI A;  3ZSX A;  4CJF A;  1BCO A;  2X74 A;  5E41 A;  1TL1 A;  4BWJ A;  5HRP A;  4J2D A;  1C1C A;  3DOL A;  2G8W A;  2HMI A;  3VQ7 A;  3PV8 A;  5D3G A;  3OS2 A;  4O44 A;  4TSX A;  1T7P A;  1BIS A;  1QSL A;  2DFF A;  4O55 A;  1QQC A;  2B4J A;  4LD0 A;  1TGO A;  1VSL A;  2Z1I A;  2G8V A;  1YT3 A;  3PX0 A;  4NYF A;  1S1X A;  4OKJ A;  3K5L A;  1RCH A;  3NGY A;  1NJW A;  2BE2 A;  3V6D A;  5HLF A;  3ZSQ A;  3KKS A;  3VQ5 A;  4JRP A;  4CCH A;  4IBN A;  3V9X A;  1ASW A;  4M3W A;  3AVH A;  3L8B A;  2IDO A;  1VSI A;  4NYN A;  3V1O A;  1XC9 A;  4DQP A;  2KTQ A;  1WSE A;  4CHZ A;  2I5J A;  4NCB A;  3RMD A;  2RN2 A;  4BE0 A;  2HHV A;  3AO1 A;  3QER A;  3SQ4 A;  3O3H A;  4FLV A;  4BDY A;  3VQ9 A;  2G8H A;  1RT2 A;  3PUF A;  4E7I A;  1HYS A;  1KRP A;  1WSG A;  4CJQ A;  3T19 A;  1CZB A;  4KHS A;  1G15 A;  2HW3 A;  4JS5 A;  4CED A;  4HUE A;  3THV A;  4CFB A;  3OYE A;  4O4G A;  3D0P A;  4XIU A;  5J1E A;  5CY4 A;  4LH5 A;  1HRH A;  4OVL A;  3LP3 A;  3K59 A;  4HVJ A;  4OKK A;  2E6L A;  4OLB A;  1S1V A;  3CYM A;  3EYZ A;  3QNN A;  2YNF A;  4RW7 A;  3CG7 A;  1QE1 A;  5KRS A;  3KK1 A;  4FW2 A;  2VWK A;  4KTW A;  4FZZ A;  2PZS A;  4F3T A;  2XY7 A;  4OPK A;  4AHC A;  4Z4C A;  1TL3 A;  2YV0 X;  4CER A;  2QK9 A;  3K5O A;  5DMR A;  4FK2 A;  4FJ9 A;  4FZY A;  2X78 A;  1EKE A;  4DFK A;  2OPR A;  3OS0 A;  4I9Q A;  3OYB A;  1JL1 A;  4EP4 A;  1WNS A;  5SZT A;  1TK0 A;  4BDZ A;  4B9M A;  3TR8 A;  2HHW A;  4CEE A;  3SUQ A;  4F2S A;  4FXD A;  4ELT A;  4DTR A;  3PY8 A;  5JS1 A;  1RTJ A;  3JSM A;  4B3O A;  4AH9 A;  3C95 A;  1LV5 A;  1VSM A;  3DRS A;  2Y1J A;  4L8R B;  3NF8 A;  3VQA A;  1IKW A;  4ID1 A;  5I42 A;  4BDP A;  2DFE A;  4ZHR A;  1J53 A;  1MU2 A;  5KGW A;  3TAB A;  1RTD A;  1NOZ A;  3BGR A;  4DWI A;  4QCL A;  3DYA A;  3M8R A;  4FLX A;  1KVA A;  3B6O A;  4W5O A;  2X6S A;  4KKO A;  1L3U A;  1C0U A;  1YVU A;  4E0D A;  4FJN A;  2E4L A;  4QAG A;  3HVR A;  3OY9 A;  1S9G A;  4ELU A;  1JKH A;  2HHT A;  3MEG A;  4FJ8 A;  3AA3 A;  1I39 A;  1HPZ A;  4GVM A;  3PO4 A;  4DSJ A;  3SUN A;  4DFM A;  4DSE A;  1BI4 B;  1L3S A;  4H8K A;  2P5O A;  2HHX A;  1S1T A;  3IRX A;  4DSI A;  3AA5 X;  4KV8 A;  5KGX A;  3K57 A;  4CK2 A;  3KIO A;  1S6Q A;  4JRQ A;  4CF8 A;  3KJV A;  1BGX T;  1RBV A;  2Q3S A;  4I7F A;  3CFR A;  4CF9 A;  2A1S A;  4RW4 A;  1VSJ A;  1VSK A;  3FFI A;  1SKR A;  4ELV A;  3SV4 A;  2F8T A;  3AV9 A;  4CEB A;  3VA0 A;  5C42 A;  1VRT A;  2GUI A;  2QXF A;  3LAN A;  3SYZ A;  4FJI A;  2B6A A;  3ZSV A;  5KTQ A;  1FK9 A;  3MXJ A;  4HTU A;  2XY5 A;  1ZBL A;  1C0M A;  1JLB A;  2LSN A;  3LAM A;  4CJU A;  3CM5 A;  3V1R A;  4FM1 A;  1HMV A;  3RTV A;  4QOZ B;  1RT5 A;  4IG0 A;  1LW2 A;  4LSL A;  1RT3 A;  3V9S A;  1JLC A;  3QEV A;  1BCM A;  4YNQ A;  1CXU A;  4E19 A;  1XWL A;  1C0T A;  4E89 A;  1KFS A;  4C8O A;  4CIE A;  2EHG A;  4IFV A;  1DTQ A;  4FK4 A;  1SV5 A;  3CM6 A;  3T1A A;  4CGH A;  5SWM A;  2OZS A;  4IKF A;  4E7L A;  3VA3 A;  1EET A;  3QO9 A;  4NCG A;  1HNV A;  4CGJ A;  1ASV A;  1RBT A;  2DTU A;  4CJE A;  4CJW A;  4AIL C;  1RT7 A;  3OYH A;  3TAG A;  4MFB A;  4ID5 A;  3TAQ A;  3WNG A;  4OPJ A;  4DF4 A;  1U4B A;  4KHN A;  1EP4 A;  4PA1 A;  1ZBH A;  3AA2 A;  4Z4E A;  4CHQ A;  3A2F A;  1O1W A;  4CGF A;  4B9S A;  4Q0B A;  3RRG A;  3KLI A;  3MAQ A;  4CGD A;  4GW6 A;  1U49 A;  3TAR A;  1LAW A;  3AVJ A;  3SPY A;  4DLE A;  3I0R A;  1TV6 A;  5HRO A;  1SKS A;  1NK6 A;  2G8K A;  3IAY A;  2PYJ A;  3H08 A;  1A5X A;  1NJY A;  1IKY A;  3C6U A;  4UQG A;  2IC3 A;  1IO2 A;  4E1M A;  3K5N A;  4DU1 A;  1U45 A;  2ZE2 A;  3TAN A;  4B9T A;  2FBT A;  4DSL A;  4KRF A;  3RRH A;  4CF0 A;  1QTM A;  5HBM A;  4YFU A;  3CFO A;  1U47 A;  1U04 A;  2O4G A;  1XI1 A;  1Q9X A;  2F8S A;  4PY5 A;  1TKD A;  1GOA A;  3G10 A;  1WSF A;  4HUF A;  2VG7 A;  4RW9 A;  3ZT3 A;  4CK1 A;  3ALY A;  4M45 A;  1ZBF A;  4O5B A;  4M3X A;  2F96 A;  4FLT A;  3KLF A;  4DS5 A;  1EXQ A;  3WNE A;  3S3N A;  4FYD A;  4DTP A;  3LP1 A;  2GV9 A;  4J2A A;  3C6T A;  3ZSZ A;  1C6V A;  1EX4 A;  1S1W A;  4DTN A;  4I2P A;  4RG8 A;  1JLF A;  1RT1 A;  5C24 A;  4Y1D A;  1UAX A;  3OYM A;  3O4N A;  4JS4 A;  5HRS A;  1LW0 A;  4DTJ A;  1CXQ A;  3ZSW A;  1F21 A;  3U3Y A;  4CJR A;  1JXE A;  3HVT A;  4CHY A;  2DFH A;  1TVR A;  3ASM A;  1TK8 A;  1U48 A;  5CZ2 A;  3VQC A;  4KTZ A;  1YTU A;  4M3T A;  1JL2 A;  3LAK A;  4E7K A;  3SI6 A;  3TAP A;  1L5U A;  5J2P A;  3PX4 A;  4CGG A;  3VQD A;  3NE6 A;  3MED A;  4J2E A;  3ZT1 A;  4CJT A;  3NH2 A;  4DQQ A;  1T05 A;  3OJS A;  2PYL A;  3ITH A;  3HPH A;  2OPQ A;  3DOK A;  3TAF A;  1SKW A;  1KVB A;  1HNI A;  4DTS A;  1S9E A;  4KI4 A;  4DMN A;  3VQP A;  3AVG A;  5K14 A;  2YNG A;  3QLH A;  1HQU A;  3DMJ A;  4CEQ A;  2B5J A;  3HPO A;  3L2R A;  2Y1I A;  2W42 A;  3K2P A;  3HT3 A;  2XO7 A;  2EX3 A;  3L3V A;  4FW1 A;  4CF1 A;  3VQ4 A;  4E1N A;  4EP5 A;  3OYJ A;  3M8S A;  4HHT A;  1NK8 A;  1L3V A;  4FJG A;  2HVH A;  4FCY A;  1VSF A;  4BWM A;  3VQ6 A;  1RBR A;  2WOM A;  4FM2 A;  4C8N A;  1TKX A;  3HST B;  5KRT A;  4HCB A;  1KLN A;  3F9K A;  3P1G A;  4H4O A;  4M42 A;  1N5Y A;  3DLH A;  1IKX A;  1B92 A;  4LH4 A;  1VSD A;  3KKR A;  1J9A A;  2OPP A;  4E7H A;  1NOY A;  4CIG A;  3NF6 A;  1DLO A;  1WSH A;  5KI6 A;  2D0C A;  4CJ5 A;  2P1J A;  2IOC A;  3JYT A;  4R5P A;  3LDS A;  4DTO A;  5T7B A;  4BAC A;  3QEX A;  3OJU A;  3KK3 A;  3L2Q A;  1JLE A;  1KFD A;  5FDL A;  3LZJ A;  1RNH A;  2D5R A;  3KLH A;  1NKE A;  1N6Q A;  4W5T A;  3DRR A;  4N76 A;  4DSF A;  2YHA A; 
#chains in the Genus database with same CATH topology
 3UKU B;  5DK5 A;  3V9U A;  1SL1 A;  3QEW A;  2E6M A;  1OH7 A;  3SQ2 A;  2GEM A;  1RDD A;  2D1K A;  3AVA A;  2YI1 A;  3QIO A;  3CCJ N;  3T3F A;  3QIN A;  5C10 A;  5JLH A;  3VEW A;  4BRF A;  3CHW A;  4K42 A;  3EL2 A;  2HHS A;  3ENB A;  4ILH A;  1XNR K;  4KO0 A;  2YKM A;  1WAF A;  3EN9 A;  2HHQ A;  1DGK N;  4KHP K;  4CJ3 A;  1NJZ A;  2XRI A;  1X9S A;  1BIZ A;  3V4I A;  1VSE A;  5EU7 A;  5KPR A;  5LMU K;  1YTA A;  2KHO A;  3THW A;  3W3D A;  5EY4 A;  1UWB A;  4M3U A;  3KK2 A;  1KAY A;  3EEQ A;  3DLR A;  4H5N A;  5AQX A;  2JGU A;  3OYI A;  2QWR A;  4A59 A;  4C8M A;  2IS3 A;  3PX6 A;  3U3G A;  4CFC A;  1CLQ A;  3C0B A;  1JLA A;  2H3G X;  2HF3 A;  4PKG A;  4N5S A;  4U67 L;  3RMA A;  3ID8 A;  4F8R A;  3NCI A;  3TI0 A;  2QXL A;  4FOE A;  4DFP A;  1VQK N;  2O8D A;  3CCQ N;  4B3S K;  3OYN A;  4Z0U A;  1N32 K;  4KRE A;  2XHB A;  1WSJ A;  4WFA L;  2XY8 A;  4CD1 A;  4DQS A;  3A5L C;  4JI0 K;  3QBX A;  3LPU A;  2IGI A;  4OGE A;  1W9H A;  5HRR A;  3KD1 E;  4I2Q A;  3ZSY A;  3W0L A;  3GOI A;  4PUO A;  4JI1 K;  3NVM A;  2WON A;  4I9L A;  1IG9 A;  1NK0 A;  3O3F A;  2HND A;  1K8K B;  3TAM A;  4IDH A;  2XY6 A;  2UUB K;  4CHO A;  2UXD K;  2YHY A;  4YHH K;  4B9N A;  4RWT A;  2PY5 A;  4KB0 A;  2GWK A;  3RWU A;  4IG3 A;  2E8A A;  3VF2 A;  2O8F B;  4BRL A;  4YOY A;  4DFJ A;  1EWR A;  2ZGY A;  4MO5 A;  4CJL A;  3K0S A;  4FLW A;  4Y1C A;  2HST A;  1ITG A;  4H5W A;  3BDP A;  2CGL A;  2ZWH A;  4IZ9 A;  4MQ3 A;  4FJ5 A;  3DLL L;  3OW2 M;  4CES A;  3WUH A;  4GVE A;  4BRG A;  2QKB A;  4FPA A;  3ULD A;  1E4G T;  2GEL A;  3D7E O;  3RSE A;  4JHD A;  3MXI A;  4PHT X;  3V81 A;  1QS4 A;  4KB1 A;  2ITM A;  3A5N C;  5J2M A;  1EWQ A;  4BE2 A;  3HL8 A;  3AGK A;  3HP6 A;  4KTQ A;  4CHP A;  4WQ5 A;  4M3Z A;  4DTX A;  1WLJ A;  4DU4 A;  3CJ7 A;  3OVN A;  1QSY A;  4YOR A;  1Z26 A;  3I33 A;  1LWF A;  1P90 A;  2W41 A;  2GX9 A;  3OYC A;  1W0H A;  3LDO A;  1RIL A;  5C25 A;  5KPT A;  1GLJ O;  1V4S A;  4HTL A;  4CD3 A;  3OYK A;  1NGH A;  5JVH L;  3DLE A;  4PQU A;  3ZT4 A;  3MDQ A;  1HJR A;  1Q9Y A;  5HOO A;  4IO9 L;  4MDB A;  4Z4I A;  4DR1 K;  3HPG A;  1VQ5 N;  2ITG A;  3SZ2 A;  4DG1 A;  3RR7 A;  2KW4 A;  5EVZ A;  2ZD1 A;  3ZCM A;  1ZBS A;  5ELZ A;  1I3A A;  2P9N A;  5J2N A;  4KI6 A;  1A5W A;  2NRZ A;  3C65 A;  1SAZ A;  3F2K A;  1HYV A;  3EY1 A;  4DSK A;  2ETJ A;  2WBN A;  4CJP A;  4CZJ A;  1TYQ B;  3AVK A;  3SMS A;  4LF9 K;  3H3O B;  3SCX A;  4RW6 A;  3KZB A;  3VER A;  1Q81 O;  2O8E A;  1KLM A;  4CFA A;  2QEX N;  3NGI A;  4FVM A;  4DV3 K;  3WT0 A;  1WAJ A;  3LP0 A;  4B3T K;  4QS7 A;  1H1V A;  4CJF A;  1JCF A;  4BWJ A;  2HMI A;  4H0P A;  3PV8 A;  1T44 A;  2B4J A;  2UU9 K;  2JWK A;  3FGU A;  4GKJ K;  1S1X A;  5AQM A;  4OKJ A;  5EX5 A;  4CBU A;  2NRT A;  3ZSQ A;  2Q2R A;  4IBN A;  3AVH A;  3H1V X;  4IJN A;  1SQK A;  4J8F A;  2I5J A;  2QWL A;  4FWL A;  2A42 A;  3H46 O;  3EZW A;  3QER A;  3SQ4 A;  1N36 K;  3VQ9 A;  1RT2 A;  2QWQ A;  1HYS A;  3O9U A;  4EIA A;  4WFB L;  3T69 A;  4XH5 A;  4O4G A;  3D0P A;  5J1E A;  5CY4 A;  4LH5 A;  1HRH A;  5AJ3 K;  3K59 A;  4HVJ A;  1S1V A;  5BR9 A;  3VES A;  3CYM A;  3QNN A;  4FW2 A;  4F3T A;  2QK9 A;  1TL3 A;  4CER A;  5DMR A;  1HKB A;  1FW6 A;  5JLF A;  4FZY A;  2GTD A;  3OYB A;  3BEX A;  1TK0 A;  4B9M A;  1Z6R A;  4CEE A;  3SUQ A;  3QFP A;  3CCS N;  5JS1 A;  1RTJ A;  3JSM A;  3MWP A;  5BRD A;  3DRS A;  2Y1J A;  3DXM A;  3FLC O;  1J53 A;  5KGW A;  3TAB A;  3BGR A;  4BRQ A;  1C0U A;  4E0D A;  4FJN A;  3T7Z A;  4QAG A;  3HVR A;  4BVP A;  4NB4 A;  1JKH A;  4JI4 K;  4BR5 A;  2NRH A;  4B3R K;  4DSE A;  1WBD A;  1L3S A;  4H8K A;  4CZM A;  3BP8 A;  3BF3 A;  3CCV N;  1U2V A;  1NNE A;  1YF5 L;  3IRX A;  4KV8 A;  3K57 A;  1S6Q A;  1S72 N;  2Q3S A;  5AFU A;  1BDG A;  2HBL A;  4RW4 A;  4XEI A;  3SV4 A;  1LCU A;  4CEB A;  4A5A A;  5C42 A;  4IOC L;  1VRT A;  4JK9 A;  2QXF A;  3LAN A;  3HOS A;  3SYZ A;  4FJX A;  3MXJ A;  1C0M A;  2LSN A;  1IJJ A;  4CJU A;  3V1R A;  1BG3 A;  4LSL A;  3V9S A;  3HBT A;  1CXU A;  4C8O A;  4JEP A;  1SV5 A;  2IIR A;  4IEE A;  4E7L A;  1XC3 A;  3CIP A;  3QO9 A;  4NCG A;  1HNV A;  1QZ5 A;  2P9I B;  4CBW A;  4DF4 A;  1EP4 A;  1ZBH A;  2O8C B;  3RRG A;  3KLI A;  3CPW M;  2FLO A;  4B1X B;  3VEY A;  3E66 A;  1U49 A;  4BRO A;  3ULE B;  1LAW A;  1HUX A;  3AVJ A;  3SPY A;  5HRO A;  3I0R A;  2D4W A;  3AAR A;  4YOT A;  1NK6 A;  3H08 A;  1A5X A;  3J81 O;  1IKY A;  1NJY A;  4DU1 A;  1IO2 A;  4LFC K;  2FBT A;  1Q9X A;  4PY5 A;  4JKF A;  4A57 A;  3G10 A;  4RW9 A;  1K9M O;  5M1F A;  3ZX3 A;  4DS5 A;  1EXQ A;  4DTP A;  3FZL A;  3ZSZ A;  2KLA A;  4DTN A;  1GLC G;  4I2P A;  3H1Q A;  1X3M A;  4H0O A;  4Y1D A;  1YAG A;  4H03 B;  4JS4 A;  1CXQ A;  4CJR A;  3HVT A;  4CHY A;  2DFH A;  3ASM A;  3I55 N;  3VQC A;  4M3T A;  1KXP A;  1V4T A;  4JD2 A;  1VQL N;  1NJI O;  3PIP L;  3ENH A;  4RCH A;  4DQQ A;  4EFH A;  1T05 A;  1ESV A;  1SKW A;  1KVB A;  4DTS A;  5K14 A;  4FWS A;  3QLH A;  4JNE A;  1HQU A;  3C7N A;  3EKS A;  2YJE A;  5FRN A;  4MLH A;  3L3V A;  2F9T A;  4CF1 A;  4KHS A;  2HW3 A;  1L3V A;  5LL6 Z;  4FCY A;  1KQS M;  1VSF A;  3QDK A;  5KRT A;  5AZI A;  1KLN A;  3THX B;  2P9P A;  4IXC A;  4F9O A;  4BRP A;  4CIG A;  2VGM A;  2YJF A;  1RDW X;  2D0C A;  4CJ5 A;  2P9S A;  2P1J A;  2IOC A;  4R5P A;  4DTO A;  5T7B A;  3T1H K;  1M1K O;  4DQ8 A;  2HBK A;  3LZJ A;  2D5R A;  3P31 A;  5GAG P;  2FSK A;  4OGC A;  1YIT N;  3SQ0 A;  4DR7 K;  1D5A A;  4DQR A;  3BZC A;  4BC2 A;  2V7Y A;  3O3G A;  5IWA K;  1NK4 A;  3U9Z A;  3WXM B;  2FBY A;  3CQX A;  2EWS A;  3I8D A;  3MEE A;  3G71 N;  2AJQ A;  1EQY A;  2P9U B;  5FPM A;  1ILY A;  1RDA A;  1T6D A;  3WNF A;  3DLB A;  5BRF A;  4CEA A;  1SL2 A;  4M7Y A;  1JLG A;  1M90 O;  4CGI A;  3VF4 A;  2VWB A;  3VN5 A;  1NK7 A;  1TK5 A;  3ZEU A;  5HRN A;  3VQB A;  4L3Q A;  2FBX A;  1ZC6 A;  3D45 A;  3D2F A;  3DLG A;  5GAH P;  3G4S N;  4OKE A;  4M7X A;  1R0A A;  4HUG A;  5HL7 L;  4KHU A;  4N47 A;  2QKK A;  5GIO A;  2A5X A;  4CZK A;  3TAE A;  3P5J A;  4RTF D;  4LF5 K;  2Z1G A;  3VGM A;  4CEO A;  4BY9 C;  3O4W A;  4K25 A;  4LF4 K;  4O0I A;  5AZJ B;  4DV4 K;  4YOX A;  3J7Z O;  3VF6 A;  3NGZ A;  4CEF A;  1GLD G;  1Z25 A;  2ZGZ A;  3V9Z A;  4M3Y A;  3E9O A;  3HO1 A;  1UA1 A;  3CCE N;  5EXW A;  4CZG A;  2D0P A;  3M5R A;  1CZA N;  3LP2 A;  3SAH A;  3O9T A;  4QS9 A;  3UKR B;  4ISE A;  4CJ4 A;  1FKO A;  4F3O A;  1QZ6 A;  4K8Z A;  3FE1 A;  1C0G A;  4K8X A;  4LF8 K;  1UOC A;  3ZT0 A;  4H0Y B;  4FJ7 A;  3HM9 A;  5KQD A;  3SUP A;  3LPT A;  2RHK A;  3CET A;  3V9W A;  4AHU A;  4E1J A;  1MA9 B;  1VSH A;  4Z4H A;  1N8R O;  3J7A P;  3AVL A;  1YUW A;  4O0J A;  4IDK A;  1JLQ A;  5BPM A;  2OA8 A;  2YHW A;  3CFP A;  4KHY A;  3LZI A;  2HHU A;  3THW B;  5AQN A;  3MWT A;  1D8Y A;  3HYF A;  4CZI A;  3OYD A;  1W2B M;  4B9L A;  1ZBU A;  4B8C A;  1X1P A;  3EZ5 A;  4ZTF A;  5AQP A;  2R7Y A;  1QSS A;  3NAE A;  4WE1 A;  3K58 A;  4KPY A;  3J8A A;  3L2W A;  2X6N A;  2GWJ A;  1NKC A;  3NDK A;  1J54 A;  3AVB A;  1RFQ A;  4AQY K;  3EO3 A;  1GLF O;  3J7Y P;  4M63 C;  1S6P A;  5M1O A;  4BC5 A;  4CEZ A;  4B1U B;  3L2U A;  3HRG A;  4X62 K;  3QET A;  2OZM A;  3DI6 A;  5I3U A;  2O8D B;  2O8B A;  2D0A A;  2HVI A;  3LWL A;  1Q82 O;  4C8K A;  3SAG A;  4K0K K;  2RF2 A;  2ATQ A;  2QW9 A;  3KWI A;  3WXJ A;  5AFU H;  3WEE A;  2KKZ A;  2BUP A;  1FXX A;  4DTU A;  1N34 K;  3TTD A;  4O5F A;  3SJJ A;  2G8I A;  1TAQ A;  3SNN A;  3SBT A;  4AM7 A;  3AGR A;  1WSI A;  2ASM A;  1NK9 A;  1X9M A;  3HM8 A;  3R1X A;  1ATS A;  4B3M K;  2NRV A;  3QEI A;  4KAZ A;  4Z4F A;  3AO2 A;  1NK5 A;  1LOT B;  1Y64 A;  2VQF K;  2YHB A;  1X9W A;  1RDU A;  4FJL A;  3A5M C;  4X64 K;  1TKT A;  4N41 A;  3KLG A;  1RDC A;  2FF3 B;  4E7J A;  2A1R A;  4YOU A;  3RSE B;  4JHD B;  3ZSX A;  1VQM N;  5E41 A;  3DOL A;  5D3G A;  4OPH A;  4O44 A;  1BIS A;  3MCA B;  4O55 A;  1QQC A;  3IDH A;  1TGO A;  1YT3 A;  1QVF M;  4NYF A;  5ADX A;  3NGY A;  1HKC A;  1NJW A;  1YI2 N;  4A5B A;  3IKM A;  5HLF A;  2QWO A;  3UKU A;  3VQ5 A;  4CCH A;  1VAZ A;  3V9X A;  4NYN A;  3SAF A;  1YIJ N;  3ATV A;  3S41 A;  5TKW A;  1NLV A;  4ILJ A;  4NCB A;  4XH4 A;  3AO1 A;  3O3H A;  4FLV A;  4BDY A;  5LMN K;  1KD1 O;  4E7I A;  4AM6 A;  4DV5 K;  1WSG A;  2A41 A;  3LL3 A;  3SK3 A;  3CQY A;  4JN4 A;  3O5B A;  1CZB A;  3T19 A;  1G15 A;  4GY2 B;  3RVC A;  4JS5 A;  4CED A;  3THV A;  4NXM K;  4CFB A;  4OVL A;  3THY A;  2E6L A;  4OLB A;  4B1V A;  2P9N B;  2IVO A;  2YNF A;  3CG7 A;  2VWK A;  2OAN A;  4CW7 B;  2XY7 A;  4Z4C A;  2OTL N;  4CVN E;  4JYA K;  1EKE A;  2OPR A;  1OVQ A;  3OS0 A;  4I9Q A;  4EP4 A;  5SZT A;  1XUP O;  4BDZ A;  3TR8 A;  2ASO A;  3TSP A;  2E2P A;  4F2S A;  4FXD A;  2O8E B;  4UY8 O;  3PY8 A;  1DKG D;  1VSM A;  4BQL A;  2ZJQ L;  5IT9 O;  4CZF A;  1T3V A;  2VQE K;  3SMP A;  3DYA A;  4KKO A;  3SLC A;  1YVU A;  2E4L A;  4FJ8 A;  2FXU A;  3AA3 A;  3NVK A;  3A0I X;  1I39 A;  1YVN A;  4GVM A;  2W6K A;  2ZM6 K;  4PL8 A;  4BRM A;  3O9R A;  4YDU C;  1BI4 B;  1NM1 A;  1S1T A;  4FPB A;  5KGX A;  3KIO A;  4JRQ A;  3GE1 A;  1J5E K;  2ZJR L;  5AQJ A;  3C6A A;  4I7F A;  4CF9 A;  4I6M B;  1VSJ A;  1VSK A;  3FZM A;  2F8T A;  3AV9 A;  2GUI A;  2B6A A;  3IFR A;  2XY5 A;  1JLB A;  1T7P A;  3LAM A;  5BN8 A;  2E1Z A;  3RTV A;  1WB9 A;  1NMN A;  1LW2 A;  3QEV A;  1RT3 A;  1JLC A;  1KFS A;  4CIE A;  2EHG A;  2ZF5 O;  4FK4 A;  4IKF A;  4FL9 A;  1WBB A;  2OZS A;  3VA3 A;  1EET A;  4CGJ A;  5C12 A;  4YOV A;  3OYH A;  3TAG A;  3WNG A;  1OH5 A;  1U4B A;  5M1P A;  4DCH A;  5BRE A;  5MLC Q;  4DLE A;  2PBD A;  3IAY A;  2PYJ A;  4A2B A;  4IOA L;  4UQG A;  1GLE G;  3K5N A;  4Y0W A;  1U45 A;  2ZE2 A;  4B9T A;  1NU0 A;  3DXM B;  2WC9 A;  4CF0 A;  1QTM A;  4YFU A;  3CFO A;  1U47 A;  1I94 K;  2D0O A;  2J4R A;  3ALY A;  4H0X B;  3P4I A;  2V52 B;  4O5B A;  3KLF A;  4FYD A;  4KH5 A;  3JAM O;  3LP1 A;  3O8M A;  1EX4 A;  4RG8 A;  4OX9 K;  4B1Z A;  1UAX A;  3O4N A;  3CCL N;  1LW0 A;  4DTJ A;  4DV1 K;  1BWF O;  1U2V B;  3OBY A;  1EO1 A;  4CI6 A;  4HWI A;  5CZ2 A;  3AAQ A;  3LAK A;  4E7K A;  3TAP A;  4H0V B;  1L5U A;  1R59 O;  5F1X A;  3E9L A;  3ZT1 A;  4BGA A;  2PYL A;  3ITH A;  4PKH A;  3MK6 A;  4KI4 A;  4DMN A;  3O6W A;  1BO5 O;  1W97 L;  3HT3 A;  2XO7 A;  2EX3 A;  3VOV A;  3OYJ A;  4FK0 A;  4NLB A;  4Z94 A;  4BR2 A;  4BWM A;  2PFU A;  2WOM A;  4JKG A;  2UYT A;  1VQP N;  3CC2 N;  2A40 A;  4E7H A;  3VET A;  3NF6 A;  1WSH A;  2Q1N A;  2QTD A;  4JKB A;  4CZE A;  4BAC A;  3QEX A;  3OJU A;  3KK3 A;  3L2Q A;  5FDL A;  1J6Z A;  3OTO K;  4K41 A;  4MDA A;  3O80 A;  1HNX K;  2YHA A;  1BHL A;  3IMX A;  2BH1 A;  1HKG A;  3ISN C;  1G99 A;  1Y97 A;  4FJK A;  2GUP A;  4DKW A;  3OYL A;  4CEC A;  1HQE A;  3DM2 A;  4GKK K;  1CZ9 A;  5AQH A;  3OHR A;  1K6Y A;  4CJV A;  3ZSO A;  2AA4 A;  3WXI A;  4H0T B;  3VQQ A;  4CJK A;  1HNZ K;  3LDN A;  3GG4 A;  3AO3 A;  2P51 A;  3P39 A;  3LAL A;  1IBM K;  3L0Q A;  3RR8 A;  1TKZ A;  4M41 A;  4CHN A;  1Q18 A;  2YNH A;  3S9H A;  3I8B A;  1RDB A;  3CJB A;  1OVY A;  5EOY A;  1NWK A;  3KHY A;  4LSN A;  5GIP A;  1BL3 A;  3ZET A;  4IJA A;  3TWH A;  2KZZ A;  3C7N B;  5CHI A;  4CE9 A;  2VWJ A;  4EAH D;  5AQW A;  3HK2 A;  1VQN N;  1FKP A;  2P9L A;  4G1Q A;  1XQS C;  1MWM A;  1UA0 A;  3OYA A;  1ZXO A;  1C1B A;  5AZI B;  4C1N K;  1QQM A;  4BR4 A;  4WCE L;  5ADX H;  5J2Q A;  1VQ4 N;  1NGC A;  2P9P B;  1NGD A;  2FBV A;  4FLU A;  3F9M A;  3ZSR A;  3JXU A;  3H3N O;  5AQQ A;  1NGE A;  2P9S B;  4JKH A;  3C94 A;  4BR9 A;  5CYM A;  1VQ8 N;  3E1Y A;  3VQE A;  2OYQ A;  1JCG A;  4W5R A;  4EZ6 A;  3ZLJ A;  1NGB A;  1YJ9 N;  3HZ6 A;  4JKD A;  1S1U A;  2E2O A;  4CJS A;  3MN6 A;  4OPA A;  1QQO A;  1LWC A;  4B8A B;  5JVG L;  4W5N A;  1L3T A;  3BUZ B;  3AY9 A;  3CJ9 A;  2HB5 A;  4FZX C;  2IAJ A;  4FLZ A;  2W40 A;  3FZH A;  4FLY A;  4AHS A;  2P5G A;  2QWM A;  1QVG M;  2O4I A;  3NHG A;  2Q97 A;  1FJG K;  3LDP A;  5FPN A;  3UIQ A;  5GAD P;  3MN7 A;  1HYZ A;  3QES A;  4C8L A;  3Q7B A;  4Q5V A;  3V1Q A;  4B08 A;  4KHQ A;  1IV0 A;  3AVM A;  1BQN A;  4ISF A;  1WUA A;  2JWL A;  4F4K A;  1LWE A;  2BAN A;  3D2F B;  1SZ2 A;  1C1A A;  4FWR A;  1RTI A;  1BUP A;  2YX6 A;  1SL0 A;  3VGL A;  2P9I A;  2P9K A;  3DLK A;  1XNQ K;  1K73 O;  4B9V A;  3O4Q A;  4JLH A;  3QBW A;  3L2V A;  2RKI A;  4DV7 K;  2E5L K;  1Q8I A;  1GOB A;  3NMU A;  3OYG A;  2DY4 A;  3ZT2 A;  4CF2 A;  1X9J A;  1ZBI A;  4OLA A;  1TUY A;  4KH6 A;  5CZ1 A;  3OYF A;  3NF9 A;  4F2R A;  3M3Z A;  3ID6 A;  1D4X A;  3P83 D;  1NJX A;  5DM7 L;  4C1N I;  4X66 K;  3M6G A;  3ZX0 A;  4DR5 K;  3QIC A;  5BPL A;  3NH0 A;  2OPS A;  3TPQ A;  3AA4 A;  1RGI A;  4AHR A;  5BN9 A;  4B9U A;  4M3R A;  1IKV A;  3EE8 A;  4FWP A;  4BC3 A;  4DLG A;  3P38 A;  2Q0R A;  2HNY A;  2FC0 A;  1NBW A;  3WNH A;  5LJW A;  3GDQ A;  3AO4 A;  4H4M A;  2KZM A;  1NGI A;  5JS2 A;  5BR8 K;  1ATR A;  3DXK A;  4KH4 A;  4BR0 A;  1KCF A;  1RT4 A;  1QHT A;  2G8U A;  4DS4 A;  4CZL A;  4A2A A;  3KD5 E;  1MDU B;  3AVF A;  3ENO A;  3KK7 A;  2ZJP L;  1NGJ A;  4FSV A;  3WQT A;  1QQN A;  4IFY A;  3CER A;  4BRC A;  4RW8 A;  1B9D A;  3HXM A;  3TTC A;  2KQ2 A;  4U7B A;  4XH1 A;  3KTQ A;  1KTQ A;  5FRM A;  4JV5 K;  4FM0 A;  3AVI A;  1TL1 A;  4J2D A;  2QI2 A;  4TSX A;  4LD0 A;  2YCH A;  5F0X A;  3PX0 A;  3BF1 A;  4DR2 K;  1X3N A;  4JK7 A;  4X65 K;  2BE2 A;  3D2E B;  2AP1 A;  3HSC A;  5AR0 A;  3SBG A;  3KKS A;  4JRP A;  4B1W B;  3L8B A;  3V1O A;  1VSI A;  2PAV A;  2E1Y A;  1WSE A;  4CHZ A;  3MN5 A;  1NGA A;  1XMO K;  1DEJ A;  4BE0 A;  2HHV A;  4OO1 J;  3CI5 A;  1KRP A;  3WXL A;  1YJW N;  2Q0U A;  4CJQ A;  1YHQ N;  3K9J A;  4FOI A;  3CC4 N;  3CCM N;  1HLU A;  5CR4 A;  5CE3 A;  1VQ7 N;  4XIU A;  3U8X A;  1WOQ A;  2RE2 A;  2E88 A;  3EYZ A;  1QE1 A;  4KTW A;  4AHC A;  2YV0 X;  4FK2 A;  4FJ9 A;  5AQK A;  5JIC A;  2CH5 A;  1KC8 O;  4LF7 K;  1HPM A;  1NGG A;  4ELT A;  2UUA K;  4AH9 A;  3C95 A;  2CGK A;  4L8R B;  3O9S A;  4BDP A;  4ID1 A;  1Z05 A;  4DWI A;  1RTD A;  1NOZ A;  4WFN L;  4JI7 K;  4QCL A;  3M8R A;  4FLX A;  3B6O A;  4W5O A;  4YY3 K;  4JAX A;  3OY9 A;  4ELU A;  2V51 B;  3MEG A;  4BRK A;  3PO4 A;  4YDU A;  5AQZ A;  4DV2 K;  5E84 A;  2P5O A;  2HHX A;  3OBW A;  3DJC A;  1Q86 O;  3H45 C;  4DR3 K;  1SKR A;  1C0F A;  4DUZ K;  3G6E N;  4BVO A;  1VHX A;  4FJI A;  5KTQ A;  1ZBL A;  4FM1 A;  3CM5 A;  1RT5 A;  4O8U A;  4IG0 A;  1BCM A;  4YNQ A;  4E19 A;  3THY B;  1C0T A;  1XWL A;  4E89 A;  3A5O C;  3LDQ A;  3QFU A;  4IFV A;  1DTQ A;  3CM6 A;  3T1A A;  4CGH A;  5SWM A;  4WYB A;  1QHA A;  1ASV A;  1RBT A;  1BOT O;  4CJE A;  3HOT A;  4CZH A;  5B8H A;  4ID5 A;  4WQ4 C;  1HNW K;  3AA2 A;  4Z4E A;  3D6R A;  1HR0 K;  3A2F A;  4CGF A;  5C2F A;  4A61 A;  3CCR N;  3TAR A;  4FWQ A;  1BU6 O;  1TV6 A;  4H5V A;  1SKS A;  2G8K A;  4GV9 A;  4BRN A;  4JKC A;  2OCE A;  2IC3 A;  2NRR A;  5FPE A;  3RRH A;  3LM9 A;  2O4G A;  2F8S A;  4GNI A;  1TKD A;  2FF6 A;  4HUF A;  2VG7 A;  3ATU A;  4H5R A;  4M3X A;  2F96 A;  4GV3 A;  3C6T A;  1C6V A;  1S1W A;  1JLF A;  3VEV A;  5TKY A;  5HRS A;  5AQF A;  1BA0 A;  1F21 A;  3ZSW A;  3U3Y A;  1JXE A;  3TU5 A;  5FLX O;  3R6M A;  1TK8 A;  4KTZ A;  2FSN A;  1JL2 A;  3SI6 A;  5J2P A;  3PX4 A;  4CGG A;  3VQD A;  3NE6 A;  3MED A;  4BQZ A;  1BA1 A;  4CJT A;  3NH2 A;  3OJS A;  3HPH A;  2OPQ A;  3TAF A;  1HNI A;  1S9E A;  3CC7 N;  3VQP A;  5M1N A;  1VQO N;  4K43 A;  3DMJ A;  2Y1I A;  2A3Z A;  3K2P A;  3M8S A;  2HVH A;  2V7Z A;  3VQ6 A;  4FM2 A;  1XMQ K;  1TKX A;  3HST B;  3F9K A;  3P1G A;  3MX5 A;  1IKX A;  1B92 A;  2OPP A;  3WXK A;  1NOY A;  2CGJ A;  1DLO A;  5AQY A;  2IVN A;  3JYT A;  2QWN A;  3TSU A;  1KFD A;  3KLH A;  1NKE A;  3CJC A;  4G9Z A;  1SS6 A;  3B6P A;  5JMV A;  1D9D A;  1JXB A;  1RBU A;  4PWD A;  4EHT A;  3C6H A;  3TSQ A;  1RTH A;  3AVN A;  5GIN A;  3NBP A;  1T8E A;  3VGK A;  1K8K A;  3QIP A;  1KAZ A;  1GOC A;  1TUU A;  4AHV A;  3B8A X;  5KPZ A;  4W5Q A;  4FVU A;  5AQS A;  3H6E A;  3CME N;  1BIU A;  2O8F A;  3LWM A;  2YNI A;  3WQU A;  3RMC A;  4JI2 K;  2F9W A;  4DF8 A;  4Z4G A;  1NGF A;  3CMA N;  1YJN N;  4A62 A;  4FJM A;  1BQM A;  3I56 N;  2BTF A;  1S5J A;  4JKA A;  4E3S A;  4PL7 A;  3GL1 A;  3F5T A;  3TTF A;  3QML A;  4FJJ A;  3UB5 A;  1T03 A;  2UUC K;  1T6C A;  3E01 A;  1VRU A;  3AVC A;  2Z1J A;  3HTV A;  3PO5 A;  4BRD A;  3M1F A;  4BRH A;  1RBS A;  3LDL A;  5FRO A;  3VQ8 A;  4BRI A;  4V19 S;  4AF1 A;  4DTM A;  3OA9 A;  4JKG B;  4HCC A;  2HF4 A;  3NH1 A;  1RT6 A;  3IS9 A;  4CBX A;  2G8F A;  3L6Q A;  4GMJ B;  4FJH A;  4ILG B;  4N56 A;  1HJO A;  3PSF A;  3NFA A;  3SV3 A;  1KAX A;  3QNO A;  3O1W A;  2VG6 A;  1W7A A;  1DTT A;  3FR0 A;  3KLE A;  2ASP A;  4BE1 A;  4ICL A;  5AQV A;  3VMF B;  1KSP A;  2F7T A;  1A5V A;  1BI4 A;  2WFB A;  1VK0 A;  3R3L A;  1N33 K;  4BR7 A;  1ASU A;  4MO4 A;  5A2Q O;  4CFD A;  4I6M A;  1NKB A;  2D0B A;  1KVC A;  2I7N A;  3G0Z A;  1JJ2 M;  3FZK A;  4BG8 A;  3F73 A;  4EZ9 A;  3VTH A;  4FWM A;  3S3M A;  4LY7 A;  5AQR A;  1OKJ A;  1TYQ A;  3I0S A;  1J5O A;  1WN7 A;  4CIF A;  4QS8 A;  4JI3 K;  2KFN A;  2NRX A;  4ZTJ A;  1SUQ A;  1S22 A;  2QA4 N;  5AQL A;  2E2N A;  3HP9 A;  1LAV A;  4YOW A;  1IH7 A;  1O13 A;  3QEP A;  4C23 A;  4H5T A;  4DB3 A;  3ZET B;  3M8P A;  3VEZ A;  5CYQ A;  3ZX2 A;  2BGG A;  4MLE A;  2P9L B;  3MEC A;  4J2B A;  3N4Q A;  4DV0 K;  4NXN K;  4DR4 K;  4KFB A;  3K5M A;  1MWK A;  2NUB A;  2NNW A;  4WQ5 C;  4KBO A;  2HBJ A;  3OS1 A;  4CK3 A;  1XHZ A;  3CJA A;  2RPI A;  3CQ8 A;  2E2Q A;  2GBZ A;  5M1Q A;  1TAU A;  3VEO A;  4WF9 L;  3AO5 A;  5KQ8 A;  3FFK B;  3O08 A;  1B9F A;  4AHT A;  3T1Y K;  3PLA A;  2YKN A;  2JLE A;  1D9F A;  1E3M A;  4KHW A;  3NF7 A;  4DQI A;  3S3O A;  4JK8 A;  4NCA A;  3SQ1 A;  2VYP A;  2QM1 A;  2WUS A;  4O8K A;  1REV A;  4EHU A;  1XHX A;  3DAW A;  5LJV A;  3DRP A;  4BC4 A;  4JD2 B;  3PIO L;  2NZT A;  1HX1 A;  3CPE A;  2IVP A;  3HJF A;  3MMV A;  5HP1 A;  2KFZ A;  4DHY A;  3JS6 A;  3GBT A;  3MCP A;  4OJR A;  3SUO A;  2ZQB A;  2Z1H A;  3L3U A;  4IWV A;  5DM6 L;  2HNZ A;  5C2D A;  3MXM A;  2HOE A;  3KVG A;  4DU3 A;  5M1K A;  3U6F A;  3RMB A;  3IG1 A;  2BDP A;  5LY3 A;  5C0Y A;  4ISG A;  3SPZ A;  1GLA G;  4DUY K;  2UXB K;  3M8Q A;  2P9K B;  2VG5 A;  1BCO A;  2X74 A;  5HRP A;  1C1C A;  2G8W A;  3VQ7 A;  1NG9 A;  4LF6 K;  3OS2 A;  1QSL A;  2DFF A;  1VSL A;  2Z1I A;  5BPN A;  3J80 O;  3CXC M;  2G8V A;  3L4Q A;  1IG8 A;  2HBM A;  3K5L A;  1RCH A;  3V6D A;  4B9Q A;  3CF5 L;  4FWN A;  3SJH A;  1ASW A;  4M3W A;  2IDO A;  4DQP A;  1XC9 A;  4IEI A;  2KTQ A;  1GLB G;  3N4P A;  3G25 A;  3RMD A;  2RN2 A;  4IOX A;  4LFA K;  4B1Y B;  1IBK K;  3R9P A;  2UXC K;  2G8H A;  3PUF A;  3O1B A;  1YXQ A;  3IUC A;  2NLX A;  5BRH A;  2DPN A;  5AQI A;  4HUE A;  5F2R A;  3OYE A;  3BZK A;  3ZEU B;  3LP3 A;  4IO8 A;  4DV6 K;  4OKK A;  4RW7 A;  5KRS A;  2YHX A;  3VEX A;  3KK1 A;  5AQT A;  4FZZ A;  2PZS A;  2NRW A;  4OPK A;  3K5O A;  3DXK B;  3DWL A;  2X78 A;  4DFK A;  4FO0 A;  2O8C A;  1JL1 A;  1WNS A;  3VEN A;  5GAE P;  2HHW A;  3QB0 A;  3ULE A;  5C15 A;  4DTR A;  4DR6 K;  3U4L A;  4B3O A;  1LV5 A;  2WTU A;  1Q7Y O;  3NF8 A;  3VQA A;  3Q7C A;  1IKW A;  4NO7 A;  5I42 A;  2I7P A;  4LC9 B;  2DFE A;  4JI8 K;  4ZHR A;  4IFE A;  1MU2 A;  5AQU A;  2Q31 A;  1KVA A;  1DT9 A;  1L3U A;  2X6S A;  3CJ1 A;  2VCP A;  1S9G A;  4CJ7 A;  2HHT A;  1HPZ A;  4DSJ A;  3SUN A;  4LFB K;  2FSJ A;  4DFM A;  3PSI A;  3LM2 A;  1GLL O;  2HMP A;  1P8Z A;  1JCE A;  4DSI A;  3AA5 X;  4CK2 A;  3L4I A;  4CF8 A;  3KJV A;  1BGX T;  1RBV A;  3CFR A;  2A1S A;  3FFI A;  4ELV A;  3R8E A;  3VA0 A;  1VQ9 N;  3A8Y A;  2A6A A;  3ZSV A;  1FK9 A;  4HTU A;  4QOZ B;  4NLC A;  1HMV A;  3EKU A;  4JKE A;  3VPZ A;  1U6Z A;  3UE5 A;  1NMD A;  3HI0 A;  4BRE A;  2DTU A;  4CJW A;  4AIL C;  3THX A;  5AQO A;  1RT7 A;  4WQ4 A;  4MFB A;  3TAQ A;  4OPJ A;  4KHN A;  4PA1 A;  4CHQ A;  1O1W A;  4B9S A;  4Q0B A;  3MAQ A;  4CGD A;  1VQ6 N;  4GW6 A;  2CH6 A;  4GV6 A;  4FWO A;  3C6U A;  4E1M A;  4DSL A;  4KRF A;  3TAN A;  5HBM A;  2F4V K;  1U04 A;  1XI1 A;  2O8B B;  3O9Q A;  3BY5 A;  1GOA A;  1OH6 A;  1WSF A;  3ZT3 A;  4CK1 A;  4M45 A;  1ZBF A;  3CD6 N;  3WEE B;  3VTI A;  4FLT A;  3S3N A;  3WNE A;  2P9U A;  5AQG A;  2GV9 A;  3CCU N;  3FZF A;  4J2A A;  3AAP A;  3MX2 A;  1RT1 A;  5C24 A;  3OYM A;  5I9E B;  5FPD A;  1ATN A;  2OTJ N;  4JI6 K;  1TVR A;  3MN9 A;  2Q36 A;  1U48 A;  1YTU A;  2VGN A;  4PKI A;  3ZYY X;  4J2E A;  4JI5 K;  4BRA A;  4R79 A;  1IBL K;  3DOK A;  2W6L A;  4BGB A;  3AVG A;  4FWK A;  2YNG A;  3HPO A;  4CEQ A;  3L2R A;  2B5J A;  2W42 A;  2HHH K;  1ZYQ A;  1S3X A;  4FW1 A;  4EP5 A;  4HHT A;  3VQ4 A;  4E1N A;  1NK8 A;  4FJG A;  1E4F T;  2E20 A;  1RBR A;  3E9P A;  4C8N A;  4HCB A;  4H4O A;  4M42 A;  1N5Y A;  3DLH A;  5AZJ A;  4LH4 A;  1VSD A;  3KKR A;  3KWG A;  1J9A A;  5KI6 A;  3U9D A;  3EE9 A;  3LDS A;  2QWP A;  3K9K A;  4BG9 A;  1OH8 A;  1JLE A;  1RNH A;  5E26 A;  5H1S Q;  1N6Q A;  4W5T A;  3DRR A;  1K8A O;  3UKR A;  4N76 A;  4DSF A;  3D2E A; 
#chains in the Genus database with same CATH homology
 3B6P A;  1D9D A;  4OGC A;  1BHL A;  1JXB A;  1RBU A;  3SQ0 A;  5DK5 A;  4PWD A;  3V9U A;  1D5A A;  4DQR A;  1RTH A;  1SL1 A;  3AVN A;  3QEW A;  1ZYQ A;  2E6M A;  3NBP A;  3O3G A;  1T8E A;  3SQ2 A;  1NK4 A;  3QIP A;  1RDD A;  3ISN C;  1GOC A;  4AHV A;  4W5Q A;  2FBY A;  1Y97 A;  4FJK A;  3I8D A;  3MEE A;  2AJQ A;  3AVA A;  3QIO A;  3OYL A;  3T3F A;  4CEC A;  3QIN A;  1RDA A;  1BIU A;  1HQE A;  3WNF A;  3DM2 A;  3LWM A;  3DLB A;  2YNI A;  1CZ9 A;  4CEA A;  1SL2 A;  1JLG A;  4FJX A;  4CGI A;  3RMC A;  2HHS A;  1K6Y A;  4CJV A;  3ZSO A;  4DF8 A;  4KO0 A;  3VN5 A;  3VQQ A;  2YKM A;  4Z4G A;  1WAF A;  4CJK A;  1NK7 A;  1TK5 A;  2HHQ A;  5HRN A;  4CJ3 A;  1NJZ A;  2XRI A;  3VQB A;  1X9S A;  1BIZ A;  3V4I A;  2FBX A;  4FJM A;  1VSE A;  1BQM A;  5EU7 A;  3AO3 A;  2P51 A;  3D45 A;  1S5J A;  1YTA A;  3LAL A;  4E3S A;  3RR8 A;  4FK0 A;  1UWB A;  4FJJ A;  3DLG A;  1TKZ A;  1T03 A;  4M41 A;  4CHN A;  4OKE A;  4M3U A;  2YNH A;  3KK2 A;  1R0A A;  3S9H A;  3DLR A;  1RDB A;  4HUG A;  2JGU A;  3E01 A;  3OYI A;  1VRU A;  4LSN A;  4KHU A;  1BL3 A;  3AVC A;  4N47 A;  2Z1J A;  2QKK A;  3PO5 A;  3TWH A;  4C8M A;  2KZZ A;  2IS3 A;  4CE9 A;  3TAE A;  2VWJ A;  3P5J A;  3HK2 A;  1FKP A;  3PX6 A;  1RBS A;  2Z1G A;  4G1Q A;  3U3G A;  5FRO A;  3VQ8 A;  4CFC A;  4CEO A;  1CLQ A;  1JLA A;  4DTM A;  1UA0 A;  3OYA A;  4N5S A;  1C1B A;  3RMA A;  4F8R A;  3NCI A;  4O0I A;  3TI0 A;  4HCC A;  5J2Q A;  3NH1 A;  1RT6 A;  3IS9 A;  2FBV A;  4FLU A;  2G8F A;  3ZSR A;  4DFP A;  4GMJ B;  4FJH A;  3NGZ A;  4N56 A;  3OYN A;  4Z0U A;  4CEF A;  4KRE A;  2XHB A;  1WSJ A;  1Z25 A;  3C94 A;  3NFA A;  3SV3 A;  2XY8 A;  3V9Z A;  5CYM A;  4M3Y A;  4DQS A;  3HO1 A;  1UA1 A;  3VQE A;  3QNO A;  2OYQ A;  4W5R A;  4EZ6 A;  2VG6 A;  1DTT A;  3LPU A;  3KLE A;  2IGI A;  3LP2 A;  4OGE A;  4BE1 A;  4ICL A;  1S1U A;  1W9H A;  5HRR A;  4CJS A;  3KD1 E;  4I2Q A;  3ZSY A;  4CJ4 A;  1KSP A;  4PUO A;  1FKO A;  1A5V A;  1BI4 A;  2WON A;  4I9L A;  1VK0 A;  1IG9 A;  1LWC A;  4B8A B;  4F3O A;  1NK0 A;  4K8Z A;  4W5N A;  3O3F A;  2HND A;  1L3T A;  4K8X A;  3TAM A;  2XY6 A;  4CHO A;  1UOC A;  2HB5 A;  4FZX C;  1ASU A;  3ZT0 A;  4B9N A;  2IAJ A;  4FLZ A;  2PY5 A;  4CFD A;  4KB0 A;  4FJ7 A;  3HM9 A;  3RWU A;  1NKB A;  2D0B A;  4IG3 A;  4FLY A;  4AHS A;  3SUP A;  2P5G A;  1KVC A;  3G0Z A;  2O4I A;  3NHG A;  3LPT A;  3F73 A;  4DFJ A;  4EZ9 A;  3V9W A;  3UIQ A;  3S3M A;  4AHU A;  4LY7 A;  1HYZ A;  1VSH A;  4CJL A;  4Z4H A;  3QES A;  4FLW A;  4C8L A;  4Y1C A;  4Q5V A;  3V1Q A;  1ITG A;  3AVL A;  4B08 A;  3I0S A;  4KHQ A;  4O0J A;  3AVM A;  1J5O A;  3BDP A;  1BQN A;  4IDK A;  1WN7 A;  1JLQ A;  2OA8 A;  4F4K A;  4CIF A;  4MQ3 A;  4FJ5 A;  3CFP A;  1LWE A;  2BAN A;  4CES A;  3LZI A;  1C1A A;  4KHY A;  1RTI A;  2HHU A;  2KFN A;  1D8Y A;  3HYF A;  1SUQ A;  4ZTJ A;  3OYD A;  2QKB A;  1SL0 A;  4B9L A;  1ZBU A;  4B8C A;  1X1P A;  3EZ5 A;  3ULD A;  2R7Y A;  4ZTF A;  1QSS A;  3NAE A;  3HP9 A;  1LAV A;  3DLK A;  4WE1 A;  1IH7 A;  3MXI A;  3K58 A;  3V81 A;  3QEP A;  1QS4 A;  4B9V A;  4KB1 A;  4KPY A;  3O4Q A;  3M8P A;  4JLH A;  5CYQ A;  5J2M A;  3L2W A;  2BGG A;  4BE2 A;  2X6N A;  3HL8 A;  1NKC A;  3HP6 A;  3L2V A;  4KTQ A;  2RKI A;  3MEC A;  3NDK A;  1Q8I A;  1GOB A;  1J54 A;  3AVB A;  3OYG A;  4CHP A;  4J2B A;  2DY4 A;  3ZT2 A;  4M3Z A;  4CF2 A;  4DTX A;  4KFB A;  3K5M A;  2NUB A;  1ZBI A;  4OLA A;  1WLJ A;  3OS1 A;  4DU4 A;  3OVN A;  4CK3 A;  1QSY A;  1XHZ A;  5CZ1 A;  3OYF A;  1Z26 A;  2RPI A;  1LWF A;  1S6P A;  3NF9 A;  4CEZ A;  3L2U A;  2OZM A;  3OYC A;  3QET A;  1W0H A;  3CQ8 A;  3DI6 A;  4F2R A;  5I3U A;  1RIL A;  5C25 A;  2D0A A;  2GBZ A;  3P83 D;  2HVI A;  1TAU A;  3OYK A;  3LWL A;  1NJX A;  3DLE A;  4C8K A;  4PQU A;  3AO5 A;  2RF2 A;  2ATQ A;  3ZT4 A;  1HJR A;  1Q9Y A;  1FXX A;  1B9F A;  4AHT A;  4DTU A;  3NH0 A;  2OPS A;  2YKN A;  2JLE A;  1D9F A;  3AA4 A;  4Z4I A;  3HPG A;  4AHR A;  3SJJ A;  3NF7 A;  4KHW A;  4DQI A;  3S3O A;  2G8I A;  1TAQ A;  2ITG A;  3SZ2 A;  4DG1 A;  3SNN A;  2KW4 A;  3RR7 A;  4B9U A;  4M3R A;  2ZD1 A;  3SQ1 A;  4NCA A;  1IKV A;  1WSI A;  1REV A;  3ZCM A;  1XHX A;  1I3A A;  3DRP A;  4DLG A;  1NK9 A;  1X9M A;  5J2N A;  2HNY A;  2FC0 A;  3WNH A;  4KI6 A;  1A5W A;  3AO4 A;  5FRN A;  3HJF A;  4H4M A;  2KZM A;  5HP1 A;  5JS2 A;  2KFZ A;  1HYV A;  3EY1 A;  4DSK A;  2ETJ A;  3SUO A;  4OJR A;  2ZQB A;  2Z1H A;  1KCF A;  4CJP A;  1RT4 A;  1QHT A;  3L3U A;  2G8U A;  3QEI A;  4DS4 A;  2HNZ A;  3MXM A;  3KD5 E;  3AVK A;  3AVF A;  4KAZ A;  4Z4F A;  3AO2 A;  3SCX A;  4IFY A;  4DU3 A;  1NK5 A;  4RW6 A;  3U6F A;  2YHB A;  1X9W A;  4RW8 A;  1KLM A;  1B9D A;  3HXM A;  3IG1 A;  3RMB A;  2BDP A;  4CFA A;  2KQ2 A;  3NGI A;  4FVM A;  4FJL A;  3KTQ A;  1WAJ A;  3LP0 A;  1KTQ A;  1TKT A;  3SPZ A;  4FM0 A;  4N41 A;  5FRM A;  3KLG A;  1RDC A;  4E7J A;  2A1R A;  3M8Q A;  2VG5 A;  3AVI A;  3ZSX A;  4CJF A;  1BCO A;  2X74 A;  5E41 A;  1TL1 A;  4BWJ A;  5HRP A;  4J2D A;  1C1C A;  3DOL A;  2G8W A;  2HMI A;  3VQ7 A;  3PV8 A;  5D3G A;  3OS2 A;  4O44 A;  4TSX A;  1T7P A;  1BIS A;  1QSL A;  2DFF A;  4O55 A;  1QQC A;  2B4J A;  4LD0 A;  1TGO A;  1VSL A;  2Z1I A;  2G8V A;  1YT3 A;  3PX0 A;  4NYF A;  1S1X A;  4OKJ A;  3K5L A;  1RCH A;  3NGY A;  1NJW A;  2BE2 A;  3V6D A;  5HLF A;  3ZSQ A;  3KKS A;  3VQ5 A;  4JRP A;  4CCH A;  4IBN A;  3V9X A;  1ASW A;  4M3W A;  3AVH A;  3L8B A;  2IDO A;  1VSI A;  4NYN A;  3V1O A;  1XC9 A;  4DQP A;  2KTQ A;  1WSE A;  4CHZ A;  2I5J A;  4NCB A;  3RMD A;  2RN2 A;  4BE0 A;  2HHV A;  3AO1 A;  3QER A;  3SQ4 A;  3O3H A;  4FLV A;  4BDY A;  3VQ9 A;  2G8H A;  1RT2 A;  3PUF A;  4E7I A;  1HYS A;  1KRP A;  1WSG A;  4CJQ A;  3T19 A;  1CZB A;  4KHS A;  1G15 A;  2HW3 A;  4JS5 A;  4CED A;  4HUE A;  3THV A;  4CFB A;  3OYE A;  4O4G A;  3D0P A;  4XIU A;  5J1E A;  5CY4 A;  4LH5 A;  1HRH A;  4OVL A;  3LP3 A;  3K59 A;  4HVJ A;  4OKK A;  2E6L A;  4OLB A;  1S1V A;  3CYM A;  3EYZ A;  3QNN A;  2YNF A;  4RW7 A;  3CG7 A;  1QE1 A;  5KRS A;  3KK1 A;  4FW2 A;  2VWK A;  4KTW A;  4FZZ A;  2PZS A;  4F3T A;  2XY7 A;  4OPK A;  4AHC A;  4Z4C A;  1TL3 A;  2YV0 X;  4CER A;  2QK9 A;  3K5O A;  5DMR A;  4FK2 A;  4FJ9 A;  4FZY A;  2X78 A;  1EKE A;  4DFK A;  2OPR A;  3OS0 A;  4I9Q A;  3OYB A;  1JL1 A;  4EP4 A;  1WNS A;  5SZT A;  1TK0 A;  4BDZ A;  4B9M A;  3TR8 A;  2HHW A;  4CEE A;  3SUQ A;  4F2S A;  4FXD A;  4ELT A;  4DTR A;  3PY8 A;  5JS1 A;  1RTJ A;  3JSM A;  4B3O A;  4AH9 A;  3C95 A;  1LV5 A;  1VSM A;  3DRS A;  2Y1J A;  4L8R B;  3NF8 A;  3VQA A;  1IKW A;  4ID1 A;  5I42 A;  4BDP A;  2DFE A;  4ZHR A;  1J53 A;  1MU2 A;  5KGW A;  3TAB A;  1RTD A;  1NOZ A;  3BGR A;  4DWI A;  4QCL A;  3DYA A;  3M8R A;  4FLX A;  1KVA A;  3B6O A;  4W5O A;  2X6S A;  4KKO A;  1L3U A;  1C0U A;  1YVU A;  4E0D A;  4FJN A;  2E4L A;  4QAG A;  3HVR A;  3OY9 A;  1S9G A;  4ELU A;  1JKH A;  2HHT A;  3MEG A;  4FJ8 A;  3AA3 A;  1I39 A;  1HPZ A;  4GVM A;  3PO4 A;  4DSJ A;  3SUN A;  4DFM A;  4DSE A;  1BI4 B;  1L3S A;  4H8K A;  2P5O A;  2HHX A;  1S1T A;  3IRX A;  4DSI A;  3AA5 X;  4KV8 A;  5KGX A;  3K57 A;  4CK2 A;  3KIO A;  1S6Q A;  4JRQ A;  4CF8 A;  3KJV A;  1BGX T;  1RBV A;  2Q3S A;  4I7F A;  3CFR A;  4CF9 A;  2A1S A;  4RW4 A;  1VSJ A;  1VSK A;  3FFI A;  1SKR A;  4ELV A;  3SV4 A;  2F8T A;  3AV9 A;  4CEB A;  3VA0 A;  5C42 A;  1VRT A;  2GUI A;  2QXF A;  3LAN A;  3SYZ A;  4FJI A;  2B6A A;  3ZSV A;  5KTQ A;  1FK9 A;  3MXJ A;  4HTU A;  2XY5 A;  1ZBL A;  1C0M A;  1JLB A;  2LSN A;  3LAM A;  4CJU A;  3CM5 A;  3V1R A;  4FM1 A;  1HMV A;  3RTV A;  4QOZ B;  1RT5 A;  4IG0 A;  1LW2 A;  4LSL A;  1RT3 A;  3V9S A;  1JLC A;  3QEV A;  1BCM A;  4YNQ A;  1CXU A;  4E19 A;  1XWL A;  1C0T A;  4E89 A;  1KFS A;  4C8O A;  4CIE A;  2EHG A;  4IFV A;  1DTQ A;  4FK4 A;  1SV5 A;  3CM6 A;  3T1A A;  4CGH A;  5SWM A;  2OZS A;  4IKF A;  4E7L A;  3VA3 A;  1EET A;  3QO9 A;  4NCG A;  1HNV A;  4CGJ A;  1ASV A;  1RBT A;  2DTU A;  4CJE A;  4CJW A;  4AIL C;  1RT7 A;  3OYH A;  3TAG A;  4MFB A;  4ID5 A;  3TAQ A;  3WNG A;  4OPJ A;  4DF4 A;  1U4B A;  4KHN A;  1EP4 A;  4PA1 A;  1ZBH A;  3AA2 A;  4Z4E A;  4CHQ A;  3A2F A;  1O1W A;  4CGF A;  4B9S A;  4Q0B A;  3RRG A;  3KLI A;  3MAQ A;  4CGD A;  4GW6 A;  1U49 A;  3TAR A;  1LAW A;  3AVJ A;  3SPY A;  4DLE A;  3I0R A;  1TV6 A;  5HRO A;  1SKS A;  1NK6 A;  2G8K A;  3IAY A;  2PYJ A;  3H08 A;  1A5X A;  1NJY A;  1IKY A;  3C6U A;  4UQG A;  2IC3 A;  1IO2 A;  4E1M A;  3K5N A;  4DU1 A;  1U45 A;  2ZE2 A;  3TAN A;  4B9T A;  2FBT A;  4DSL A;  4KRF A;  3RRH A;  4CF0 A;  1QTM A;  5HBM A;  4YFU A;  3CFO A;  1U47 A;  1U04 A;  2O4G A;  1XI1 A;  1Q9X A;  2F8S A;  4PY5 A;  1TKD A;  1GOA A;  3G10 A;  1WSF A;  4HUF A;  2VG7 A;  4RW9 A;  3ZT3 A;  4CK1 A;  3ALY A;  4M45 A;  1ZBF A;  4O5B A;  4M3X A;  2F96 A;  4FLT A;  3KLF A;  4DS5 A;  1EXQ A;  3WNE A;  3S3N A;  4FYD A;  4DTP A;  3LP1 A;  2GV9 A;  4J2A A;  3C6T A;  3ZSZ A;  1C6V A;  1EX4 A;  1S1W A;  4DTN A;  4I2P A;  4RG8 A;  1JLF A;  1RT1 A;  5C24 A;  4Y1D A;  1UAX A;  3OYM A;  3O4N A;  4JS4 A;  5HRS A;  1LW0 A;  4DTJ A;  1CXQ A;  3ZSW A;  1F21 A;  3U3Y A;  4CJR A;  1JXE A;  3HVT A;  4CHY A;  2DFH A;  1TVR A;  3ASM A;  1TK8 A;  1U48 A;  5CZ2 A;  3VQC A;  4KTZ A;  1YTU A;  4M3T A;  1JL2 A;  3LAK A;  4E7K A;  3SI6 A;  3TAP A;  1L5U A;  5J2P A;  3PX4 A;  4CGG A;  3VQD A;  3NE6 A;  3MED A;  4J2E A;  3ZT1 A;  4CJT A;  3NH2 A;  4DQQ A;  1T05 A;  3OJS A;  2PYL A;  3ITH A;  3HPH A;  2OPQ A;  3DOK A;  3TAF A;  1SKW A;  1KVB A;  1HNI A;  4DTS A;  1S9E A;  4KI4 A;  4DMN A;  3VQP A;  3AVG A;  5K14 A;  2YNG A;  3QLH A;  1HQU A;  3DMJ A;  4CEQ A;  2B5J A;  3HPO A;  3L2R A;  2Y1I A;  2W42 A;  3K2P A;  3HT3 A;  2XO7 A;  2EX3 A;  3L3V A;  4FW1 A;  4CF1 A;  3VQ4 A;  4E1N A;  4EP5 A;  3OYJ A;  3M8S A;  4HHT A;  1NK8 A;  1L3V A;  4FJG A;  2HVH A;  4FCY A;  1VSF A;  4BWM A;  3VQ6 A;  1RBR A;  2WOM A;  4FM2 A;  4C8N A;  1TKX A;  3HST B;  5KRT A;  4HCB A;  1KLN A;  3F9K A;  3P1G A;  4H4O A;  4M42 A;  1N5Y A;  3DLH A;  1IKX A;  1B92 A;  4LH4 A;  1VSD A;  3KKR A;  1J9A A;  2OPP A;  4E7H A;  1NOY A;  4CIG A;  3NF6 A;  1DLO A;  1WSH A;  5KI6 A;  2D0C A;  4CJ5 A;  2P1J A;  2IOC A;  3JYT A;  4R5P A;  3LDS A;  4DTO A;  5T7B A;  4BAC A;  3QEX A;  3OJU A;  3KK3 A;  3L2Q A;  1JLE A;  1KFD A;  5FDL A;  3LZJ A;  1RNH A;  2D5R A;  3KLH A;  1NKE A;  1N6Q A;  4W5T A;  3DRR A;  4N76 A;  4DSF A;  2YHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...