4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
4NLPA 3DM2A 3TQ1A 3N6MA 3MXMA 1BI4B 2W8KA 4MFBA 5C25A 5DQGA 3DLKA 4ED1A 4QWDA 2W7OA 1JLFA 3G10A 5FRMA 4ECXA 4CFCA 3T3FA 3AA4A 2QK9A 3BQ1A 4DQQA 3OYAA 3S3MA 1NJWA 3KKRA 1SV5A 4FJ9A 1U47A 4ZP9A 2WONA 1NOYA 3O4NA 4M3YA 3UR0A 5HLFB 3F73A 3RMAA 3OYEA 4CFDA 4HUGA 4ZHRB 2BQ3A 2AU0A 1S1XB 4RW9B 1TKXA 4RW6B 1NHVA 3UPFA 4OVLA 1ZTTA 4W5OA 1VRTA 3RTVA 1S9GA 3K57A 4TY8A 2YKMB 2CKWA 1U49A 3CDUA 2YNHB 3HL8A 1S1UA 3DYAB 2VA3A 1SH3A 2R8IA 1NK9A 5EWEA 5HP1A 3M8QB 1JX4A 2DPIA 4IR9A 2FLNA 4ED6A 4E3SA 3BJYA 5T7BA 4DTRA 1RT3B 4RNNA 1SL0A 1HNIA 4K8ZA 4MK7A 3ZT1A 5KFHA 1JXEA 1RT2A 3S3NA 5HROA 2YNIB 3P1GA 4DTOA 3CWJA 2B5JB 4FW2A 3NGYA 4I2QB 3H5YA 2FLLA 3QLHB 4OKJA 4E7KA 2HHXA 1VSDA 4KREA 4KV8B 3QZ7A 4EP5A 1BISA 5KFGA 4CFBA 3TAQA 4F4XA 4DSFA 5KI6A 2FJVA 4C8LA 4K4YA 3L2QA 4AHVA 3LP1B 4RUAA 4FM2A 1UAXA 5KFXA 4KTQA 3SUQA 1ZBHA 3P83D 5SWMA 3CFPA 1CZ9A 4KRFA 3CJ4A 4HYKA 1TKZB 4DF8A 4B9LA 4TQRA 4NCGB 2D0AA 2X74A 4CGIA 3V4IB 4CE9A 1N4LA 3KLEB 4UQGA 3CG7A 2FJXA 1TKXB 3AA2A 3A2FA 4DL3A 3V1OA 2HW3A 3DLBA 4DG1A 3K58A 1S9GB 2FLPA 2JEFA 1HQUA 3HVRA 2HNDB 4B9NA 2PY5A 3VQSA 3OYJA 1RYSA 1TK0A 4O0JA 3FDSA 3LZIA 1RT7A 2HHVA 3ZSOA 1JL1A 5KRSA 1NJYA 1UWBA 4FK2A 5J2NB 1IKXB 5HRPA 2FBYA 1F21A 1DLOB 1L3TA 2BR0A 3BSOA 4DTNA 3OL7A 4O0IA 2XCAA 1S1WA 3MFHA 1IKVA 1RT3A 5KFOA 3V9SA 4B08A 1REVA 3TANA 1W25A 1RTHB 1T8EA 2PYJA 3RRGA 3NAIA 2IM0A 2E6MA 1RAJA 3O3GA 4NLXA 1N6QB 2W8LA 4I9QA 1S48A 1JKHA 2RKIB 3SV3A 3BSCA 4FM0A 4Z4HA 3QIPA 3N6NA 4WXOA 3HO1A 5J1EB 1LAVA 1WSHA 1C1AA 3V81B 1FK9B 5KFJA 1W9HA 3S9HA 3D5MA 1UOCA 4DL6A 3T5LA 4K4XA 2IDOA 1QTMA 4FJNA 4ZVEA 3ISNC 4DTSA 4MK8A 5KRTA 1RYRA 4X2BA 4DTPA 5KT2A 1C0UA 1QSLA 4NLVA 3IS9A 4KO0B 4WFXA 5KFVA 4CHNA 4WE1B 1LWFB 5KFAA 4O4GB 3TVKA 1VSMA 4M45A 5JS1A 1SH2A 4DFPA 5I3UB 1S1XA 2OPPB 5J2PB 5E41A 2D0CA 1RA7A 2UVVA 4DU4A 2ILYA 4FW1A 4KFBA 2GV9A 1MMLA 2XRIA 4CJ5A 1SKWA 4TY8B 3L3UA 3WNEA 5D3GB 3HP6A 2HNDA 2IM3A 1WNSA 3DLHA 1ZETA 4CJPA 3CM5A 3H5SA 2GIRA 4AILC 3NBPB 4O44B 4Y34A 4EO8A 4EBDA 1CLQA 2DFHA 2ASDA 4LH5A 2KFZA 1S0OA 4MFBB 2HHSA 1I3AA 5KG2A 4M3RA 2JGUA 4FJXA 3M8SA 4PQUA 4JS5A 3FSIA 4KHRA 2G8HA 1KLMA 4URSA 4M3WA 4DQIA 3QZ8A 2W42A 1SV5B 4HUFA 4FCYA 2RKIA 3SV4A 3QESA 5KFFA 3BSNA 2AX0A 3ZSYA 2XC9A 3G6VA 3HP9A 3M9OB 4R5PA 2BANA 1BGXT 3ZSZA 3ZSQA 4RW6A 3DMJB 4FZXC 1RT1B 4FLYA 2PZSA 1IM4A 3GQCA 3PZPA 2YKMA 4OL8A 4KB7A 2E6LA 4YR0A 4DWIA 1OS5A 4DS4A 3EPIA 2Z1HA 4TYAA 4IH7A 4CGJA 2ALZA 4LQ3A 4B3OB 1LW0B 4KO0A 4TN2A 3SI6A 1RDAA 2FBXA 3TI0A 1LWFA 1RT5A 2G8FA 2AQ4A 4CK1A 5F8LA 3V4IA 4JRPA 3TWHA 4N41A 3KK3B 3KLGA 5DMRA 3RRHA 4Y1DA 1EX4A 5CYQA 1RT2B 2HNZB 1NOZA 5HROB 2YNIA 4KFBB 1T3NA 2HNYB 4E0DA 1YTUA 2B5JA 3SUPA 2BE2B 5C5JA 3AO3A 4CIFA 4FJKA 1S6QB 1RTJA 1XR6A 4CJRA 4OGEA 4HCCA 1HYVA 1LW2A 4KV8A 1TVRB 1MU2A 4LD0A 1KSPA 3DRRB 4F2SA 1NKCA 4DS5A 1WSJA 3UIQA 3H98A 3SPYA 1HNVB 4Q0BA 4ZMMA 2GBZA 1S1WB 4NLQA 3Q8RB 4O3RA 4W5NA 2B4JA 4XPEA 1IKVB 5EWFA 3M8PA 3WNGA 1X9WA 1GX6A 2UVRA 4H4MA 3TAFA 3KK1A 1U4BA 4KE5A 5F8HA 3E01B 4J2EA 3I8DA 3I5AA 4TLRA 2R2SA 1T03B 2HWIA 4Q5VA 1RTDA 3AA5X 4I7FB 3U6FA 2FVPA 4KHQA 4Q44A 5J1EA 1VSHA 3V6HA 1FK9A 3AVMA 4XPCA 4RZRA 1HRHA 5KTQA 5KFTA 4TQSA 3TR8A 4C8MA 5KT7A 1RT1A 3DI6A 3PR4A 3CJ5A 4J9LA 2OPQB 4CJKA 5CZ1A 4J9QA 1ITGA 1JLGA 2XCPA 1RT7B 3OYGA 3QEXA 2XHBA 4O3QA 5L9XA 3OHAA 3VQAA 5HRSA 5DQIA 4OPJA 1LW0A 1IKXA 4AHTA 4CESA 1YVFA 1LV5A 1CXUA 1RT5B 1S9EB 4K4ZA 4JV1A 3SFUA 1JLQB 2ASLA 2OPPA 3AVKA 3ZSXA 3KJVB 3PX6A 3SQ2A 3V6JA 3H5UA 1S6PA 1S5JA 2YHAA 1EETB 2HNYA 4EZ6A 2HVHA 2HAIA 1SL2A 5D3GA 2OH2A 3V9UA 4JV2A 1KHWA 3I5BA 2I5JA 1S6QA 4DL5A 4IFVB 1LWCB 1IG9A 4NLSA 5F8GA 3V81A 3CDWA 1LW2B 1MU2B 3HYFA 5KG1A 3DRRA 3KNAA 4F4YA 4QOZB 1KCFA 2P1JA 2R8KA 4EP4A 3NBPA 4O44A 4DSJA 4TSXA 4EZ9A 3LPTA 4Q0BB 3NH1A 4B9TA 2OPRB 1FKPA 3HHKA 4CCHA 4CERA 1RBVA 4CGGA 2GIQA 3T1AA 3T5KA 1S97A 1R0AB 4OLAA 2W9AA 4Y1CA 2UVWA 2IM1A 3PW2A 3TAEA 4MH8A 3G6XA 4I7FA 5KFZA 4CEZA 3VQ8A 1TKDA 1YVUA 4CJEA 2AGPA 4DF4A 3MEEB 3MFIA 3DMJA 3ZT0A 2FVRA 2Y1JA 4ECTA 3DI6B 4ZPDA 5DQHA 4F50A 2ITGA 3KK2A 3NAHA 3OS1A 5KGWA 1ZBIA 4CGDA 3PO4A 3OYBA 4MIBA 4M3TA 3Q8PB 4FJ5A 4CHZA 4F8RA 1HYSA 4ZVGA 3V1QA 1D5AA 3FFIA 2KTQA 1C1BB 4QAGA 4F4ZA 3KK3A 4JV0A 5J2MA 5T14A 4ED7A 5CYQB 4B8CA 4RW4B 2HNZA 1X9MA 1S6PB 4LY7A 3OJSA 1EETA 1IKWB 5KG6A 3OHBA 4M3UA 5L1LA 2KZMA 2HB5A 2HMIB 2I5JB 4QWAA 4KHWA 3CJ2A 2IC3A 1U45A 4E19A 1Q9XA 3GILA 4CIGA 2KW4A 4DMNA 3BR9A 3NKYA 5KG4A 1RBSA 1JLAB 4CJSA 4KB0A 3BQ0A 4B9VA 1X1PA 4HUEA 4DFJA 4ECYA 4CF2A 3M8PB 2IMWP 4H4MB 2AGOA 4RNFA 1J53A 4FBUA 2UUWA 2J6UA 2IBKA 4IBNA 3V9XA 5HRNA 3OL9A 1JLEB 3TAGA 4B3OA 4EYHB 2R8JA 3NGDA 1UA0A 1QUVA 3C95A 2G8WA 3QGHA 4QWBA 3OLAA 2DFFA 3LP2B 3EY1A 4ICLA 4AHSA 1BIUA 1U04A 4Z0UA 4QW9A 3U3YA 2V4RA 1Z26A 2OYQA 4WZQA 1A5WA 3KLVA 2BE2A 3QNOA 3KLIB 1BHLA 4F4KA 3OS0A 3KK2B 2BQRA 5CYMA 3MTKA 4ED8A 1TAQA 3KLFA 2WHOA 4K8XA 4FJMA 3NF9A 3D28A 5L1JA 1HYSB 1S9FA 3IAYA 1QSSA 1HNVA 1JLQA 4Y2AA 2IM2A 4DTMA 3ASMA 1KTQA 3L8BA 3KK1B 3N6LA 2QKKA 1LWEA 3K5OA 3SFGA 4IG0B 4KAIA 2WTFA 4ID5A 2D7SA 1T03A 2F96A 1LAWA 4DU1A 2P5GA 2HMIA 2HWHA 3CFOA 4DSLA 5JXSA 4NRTA 2JEGA 4DSKA 3VQ6A 1C2PA 4KHUA 2GC8A 3NGZA 4N5SA 3NAEA 4AH9A 2BRLA 3QGGA 1WAJA 3AO1A 4ED3A 3LAMA 3EYZA 2JC1A 5SZTA 3KHHA 2HHTA 2VG5B 1FKPB 2OPQA 1B9DA 1NJZA 1VK0A 5J2QA 4Z4EA 3VQBA 3JYTA 3RB6A 5F8JA 2B6AB 2R2RA 4WFYA 5I42B 2B43A 3WNFA 4ICLB 4RUCA 2V0NA 3HVAA 3PX4A 4E7IA 4DG1B 1NKBA 2XGPA 3KLIA 1C1CA 2KFNA 3OL8A 3G86A 4IRKA 1N48A 4IFVA 1LWCA 5L1IA 3K2PA 3QINA 4Z4GA 3NCIA 4ECUA 4BDZA 4RW7B 4FVMA 2WOMA 4ELUA 2UVUA 4FK4A 3KOAA 4J9RA 1BQNB 2IJNA 4ECRA 4ECVA 2A1SA 2OPRA 3CYMA 2CJQA 3CJ3A 1WNEA 5FDLB 4RW4A 4BE1A 3HK2A 3I5CA 4K4SA 1N6QA 1R0AA 3AVHA 2IS3A 4IOBA 3RMDA 1RCHA 4NLTA 2P51A 3QO9A 3HVTA 3QIPB 4CFAA 4NLWA 1TK5A 3QETA 3QERA 2A1RA 3VA0A 4AHRA 1JLAA 5KG3A 4KHNA 3SNNA 4B8AB 1RBUA 5EDWA 1EP4A 4OPKA 3VQQA 4NCAA 1NNDA 3TABA 4URQU 3KKSA 3GV8B 2JLEA 3VQDA 3VQ7A 1D9FA 4FLWA 2JC0A 4MKAA 1JXLA 3RMBA 1C0UB 1RDCA 2XI3A 3AA3A 4DTJA 1QQCA 1I39A 2VWKA 1WN7A 3KTQA 4WE1A 4J9KA 3LP0B 2KQ2A 5FRNA 3SQ4A 3PHEA 1C1BA 2J6SA 4E1NA 2ZQBA 4CHQA 4B9MA 3GIMA 3MXJA 4AHUA 1WSIA 2JEIA 3DRSB 2LSNA 1IKWA 4FJHA 2DFEA 1ASVA 3TARA 3IG1B 5FROA 4CF0A 4FS2A 4K4WA 3GIJA 1JIHA 5DGAA 4K4VA 3OLBA 4IFYB 1ZTWA 3LWLA 3PR5B 4RW7A 2W9CB 3DDKA 2WOMB 4F3OA 4YQWA 3MR2A 4E89A 1S1VA 3PW0A 4O3PA 3PW5A 1L5UA 3TAMA 4Q8EA 1TKTA 5FDLA 3DLGB 1T05B 3HPHA 1S10A 4PQUB 4CEDA 1JLEA 1WSFA 4JRQA 4EEYA 3RB4A 3GV5B 1BQMA 3HM9A 2DY4A 3BREA 1HJRA 4YFUA 3AO5A 3QO9B 4O3SA 4RG8A 1D8YA 3K59A 4NRUA 3AVBA 3AVLA 4GC6A 4R5PB 4C8KA 1HYZA 3OYMA 5F9NA 2XY5A 2R2TA 2XI2A 1SUQB 1B9FA 4J9SA 1RT6A 3V1RA 3RR8A 4FLTA 3GIKA 1A5XA 3HPGA 5KFSA 4LSLA 3EPGA 4FM1A 1XHZA 3KMSA 1JLBB 2HHWA 4CJ4A 4BDPA 4YR3A 5EU7A 4XIUA 2B6AA 3OS2A 3C6UA 4CF1A 3ICLA 3LP0A 3DLEB 3GIIA 3G0ZA 5I42A 5KFBA 3ZT2A 3D45A 3MR6A 4ZP8A 2XY7A 3MXIA 1RT4B 4OKEA 3VQEA 2EC0A 1N5YB 3DRSA 4IG0A 4DL2A 1XC9A 4QWCA 4ID5B 4E7JA 4FJLA 3OVNA 4LQ9A 1C1CB 2X78A 3IG1A 3FQKA 2OPSB 3VN5A 2V9WA 1QSYA 4TY9A 3RBDA 4EBEA 1G15A 4U7CA 4E1MA 3QNNA 1TVRA 4JUZA 3LWMA 3KD1E 3RBEA 4WYLA 4IH5A 1HPZA 3PV8A 4M3ZA 4KSEB 5JS2A 1VSLA 3T5HA 4HCBA 2QE5A 1RTIB 2VG5A 1VRUA 1JLCB 3DLGA 3CQ8A 1KFDA 4ED0A 4B9SA 5J2QB 1KLNA 1FXXA 1XR5A 1EXQA 2D0BA 4ZPCA 3V9ZA 3E01A 4HHTA 1L3VA 1Q9YA 1W0HA 3L2UA 2V4QA 4BDYA 1NK5A 3B6PA 4NLOA 4CJ3A 4CK2A 3HVTB 5JUMA 3I0SA 5DLGA 3O4QA 4CJVA 3NF6A 4AHCA 1HMVB 3F9KA 4CHOA 1RDDA 4QW8A 3MEGB 4U6PA 1J5OB 1SUQA 3SUNA 2C2RA 1UA1A 4KBIA 2BDPA 5KFDA 1O1WA 4H54A 4CJQA 2DTUA 1XWLA 4FJGA 3CDEA 3OYIA 2IAJB 1D0EA 4QPXA 3THVA 1WSEA 5DG8A 4OLBA 4FYDA 5DLFA 4FBTA 2YKNB 4IKFA 1KVAA 5F8MA 1TQLA 4IKAA 3LP3A 1C0MA 4CJUA 3OSNA 4G1QA 4CJLA 4L8RB 1A5VA 4ZP7A 5KT3A 2QXFA 2RF2B 1N5YA 2R2UA 5KFIA 3UDLA 4Y3CA 5DGBA 5KFCA 2HVIA 3HJFA 4RNHA 4URGA 2OPSA 3UQSA 4KAZA 3V6DB 4KKOB 3MEDB 2D3UA 3H4BA 3OYLA 1S0MA 3T5JA 3PJWA 4CJFA 4W5RA 4KPYA 1BCOA 4KI4A 4MQ3A 4Z4FA 1S1VB 3U3GA 3HSTB 3CVKA 2IA6A 5HRRA 1YT3A 2E4LA 1GOBA 3TAMB 3L3VA 2YNGA 3DOLA 4IG3B 1JLCA 3Q8QB 3KHLA 4CHYA 3BGRB 1RBTA 3NHGA 4NCBA 1S0NA 4CK3A 1X9SA 1K1SA 2E9RX 4CF9A 4HKQA 3SJJA 4NLDA 4ECSA 3DLKB 4CEFA 3PW7A 4FLXA 4PY5A 4FLZA 4DFMA 4EO6A 3O3HA 3MEEA 2Z1GA 5DG9A 4CECA 1TGOA 2FVSA 1KVBA 2XGQA 1VSJA 4KTWA 5KFYA 2WONB 3RAQA 1XHXA 3K5NA 1VSIA 3MF5A 4QWEA 4O4RA 4Z4CA 5EUHA 4RW9A 3AVNA 1GOAA 3SI8A 4EYIB 2X6NA 1NKEA 1VRTB 5KFEA 1IH7A 4FK0A 2W9CA 2BRKA 2ZD1A 3C6UB 1IKYA 3FFIB 4FLVA 1NK8A 1KHVA 2VG6A 3ITHB 5J2MB 2ATLA 1CXQA 2R7YA 1TKTB 2W7PA 4FJ7A 4DL7A 4WXWA 4G1QB 4O3NA 1T05A 5KFKA 4J9PA 2ILZA 3OJUA 4IQXA 3AVFA 3E51A 2HHQA 4PUOB 4MIAA 3BQ2A 4RNOA 4BACA 2ETJA 3AV9A 2QV6A 1ASWA 2XY8A 3QIDA 2Z1IA 4O55A 1HNIB 3P5JA 4IRDA 1L3UA 3V6DA 3CFRA 2Z1JA 4B9UA 4R8UA 3NGIA 2IC3B 4ECWA 3QEIA 1SKSA 2XWYA 4WZMA 3IGVA 4OGCA 4E7HA 1RT6B 1VRUB 3BSAA 1XR7A 1TL1B 4FXDA 2G8VA 1C0TA 3DOLB 4CJTA 2VA2A 3BGRA 2KZZA 3MAQA 3SUOA 4NLYA 2OA8A 3DOKB 4FZYA 1KFSA 5KT4A 3LP1A 4I2PB 4DL4A 3O3FA 3I0SB 4LH4A 5F8IA 4W5QA 2PYLA 2BQUA 2HHUA 1HMVA 3LP2A 3PUFA 3VQ4A 3KIOA 3PY8A 3LAKA 4RW8A 1RT4A 3JSMB 4FJIA 1VSFA 1NK6A 4H8KA 4ZTJA 1WLJA 4NCGA 1JL2A 1S49A 1VSKA 3L2RA 4FJ8A 3ZCMA 3KLEA 1K1QA 4CGHA 4PWDA 3OYCA 5CYMB 5KT5A 3KLFB 1SH0A 3IN5A 1HPZB 5C42A 3ZSWA 1JXBA 3OYFA 5K14B 1IKYB 3AVAA 4CHPA 1RTIA 1Z4UA 4KI6A 4ZVHA 1UWBB 3KHGA 3OL6A 3ULDA 4FJJA 4N76A 2RDJA 2JEJA 1LWEB 4DQSA 1TP7A 1QE1B 3OYNA 2AWZA 2AJQA 4M3XA 3OYDA 4JS4A 3IRXA 4IH6A 4W5TA 4DSEA 4KKOA 4TXSA 3V9WA 2Y1IA 2RPIA 4GC7A 3SCXA 4CEBA 4DTUA 3MEGA 1SL1A 4LSNB 2FBVA 2ZE2A 3T19A 3VQ9A 3M8RA 1FKOB 4ELTA 1S1TB 2F8EX 3B6OA 2YNGB 3CO9A 3MECB 4XO0A 3PX0A 4IG3A 2YNFB 3H4DA 3M9MB 4NYNA 2IAJA 4MKBA 1DTTB 3KD5E 3JYTB 1J9AA 5CZ2A 1RA6A 3DOKA 2WRMA 3C6TB 4I2PA 3I0RB 2G8UA 5DG7A 2BGGA 3D0PA 4DQPA 3H08A 2AGQA 2OZMA 3AVIA 3QEPA 1TV6A 3IS9B 3NDKA 3CIZA 4E7LA 2C22A 2RF2A 1BIZA 4EBCA 1L3SA 5HBMA 2OZSA 4KHMA 3VQPA 2RN2A 3HT3A 4F3TA 2D5RA 3FQLA 2J6TA 2D41A 2ZKUA 3PVXA 4C8OA 5L1KA 4PWDB 1KRPA 5KFWA 3MEDA 4WYWA 4Q8FA 3NMAA 3QEWA 1CSJA 5KFUA 3H5XA 4J9OA 4IR1A 3RB0A 1IO2A 4CEEA 1BQNA 2Q3SA 3ITHA 2EX3A 2R8GA 3CM6A 4KHSA 3GV7B 1RDBA 2G8KA 2WCXA 4BWMA 3RAXA 4M41A 1BCMA 4TYBA 1CZBA 2O4GA 2VG7B 4YNQA 4NLGA 1QS4A 4DQRA 1NK7A 2YHBA 1QHTA 4DFKA 3IRXB 3C94A 3OYKA 4ECZA 2AX1A 4R8UB 1ZBUA 4M95A 3QEVA 2UUTA 1KLMB 3ZSRA 1N56A 4QCLA 3AVCA 3RR7A 3MR5A 1EP4B 4BE2A 1TL1A 4O3OA 4CF8A 4N56A 3PJXA 1C0TB 2BANB 4J9NA 1Y97A 1XI1A 2YNFA 4I9LA 4Y2CA 1WAFA 2IGIA 3IGNA 5KFNA 4OJRA 4RNMA 4CEAA 4FZZA 1J54A 4BWJA 3HXMA 5KFPA 2ZD1B 3HPOA 3VA3A 2FC0A 3KLHB 3C6TA 3HKWA 2VG6B 2FBTA 1TV6B 4RW8B 1S4FA 3K5LA 2WB4A 1B92A 4Q45A 3NH2A 1T94A 4YR2A 5HBMB 4PUOA 4K4TA 4ZHRA 3KLGB 3SYZA 3LDSA 4ID1A 5KFQA 1HQEB 4KTZA 5C24B 5CY4A 5KT6A 5KG7A 3KHRA 1GX5A 4IFYA 2XY6A 3VQCA 3L2VA 4NYZA 4IDKB 4KHYA 1C6VA 4FS1A 5F8NA 5C42B 5DK5A 4J2BA 3DRPB 5K14A 1RTJB 5KFLA 4Z4IA 4J9MA 1S1UB 3DYAA 3EZUA 4ZP6A 3SQ1A 2DPJA 2X6SA 5HP1B 1TL3B 3LALA 4ZPBA 3Q8SB 3DM2B 1RDRA 1D1UA 2R8HA 1BI4A 1Q8IA 1BQMB 5C25B 2E9ZA 3OSPA 4HVJA 2FVCA 2D3ZA 2WK4A 4GMJB 1SKRA 3ISND 4M42A 1NK0A 4R0EA 2XO7A 3JSMA 3CJ0A 4I2QA 1RTDB 4LSNA 4ZVFA 1DTQB 1WSGA 1I6JA 3QLHA 4M94A 3MECA 3PW4A 3LANA 3NH0A 2W9BB 4LSLB 3L2WA 1RBRA 3BDPA 1JLBA 2RDIA 3QYYA 4IRCA 3AVJA 4J2DA 4OKKA 3MR3A 4N47A 2ATQA 4F4WA 3KLHA 4J2AA 1JLGB 3NE6A 3I0RA 3DLEA 3S3OA 3GYNA 3HVWA 4G3IA 1ASUA 3EZ5A 3K5MA 3AO4A 1NHUA 1EKEA 3ZT3A 1S9EA 1QE1A 3PO5A 3ZT4A 4DTXA 1NJXA 5F9LA 4GVMA 3H40A 3V6KA 4F2RA 3LPUA 1HARA 1HQEA 5KG0A 3KJVA 2IJFA 4NZ0A 3LZJA 4GW6A 4FLUA 4YP3A 3AO2A 4H4OA 2VWJA 5EWGA 1ZBLA 3DLRA 3NFAA 1K6YA 4NLUA 2IOCA 3DRPA 5KGXA 4ED2A 2ASJA 4CEOA 2ZE2B 1FKOA 4K4UA 1S1TA 3SQ0A 3NL0A 2C2DA 1GOCA 2GUIA 2NUBA 5J2NA 3QGIA 4RU9A 1TL3A 3NF7A 4JLHA 3NF8A 3H2LA 3QIOA 4NYFA 1DTTA 2O4IA 2C28A 3VQ5A 1VSEA 1JLFB 1BL3A 4CIEA 1Z25A 1D9DA 1TAUA 1U48A 5KG5A 2FJWA 3SPZA 4CGFA 3H59A 1TKZA 1NK4A 4KB1A 5KFMA 4Q43A 4ECQA 1J5OA 5HLFA 1DTQA 4CJWA 2QKBA 1YTAA 1KVCA 2EHGA 3FRZA 2W9BA 4DSIA 2FVQA 3RB3A 4MK9A 2YKNA 1HQUB 1ZBFA 3M9NB 4BE0A 3SZ2A 3AVGA 4ZPAA 2YNHA 3KMQA 3OY9A 4WFZA 3OYHA 1QAJA 4HTUA 5KFRA 1T7PA 1RILA 3M8QA 4CEQA 1ZYQA 2G8IA 1DLOA 4PA1A 4NLRA 3ALYA 2F8TA 2E9TA 4O4GA 3ZSVA 2VG7A 4K50A 5I3UA 1QAIA 1U09A 2P5OA 3RMCA 4DU3A 3TAPA 1TK8A 5J2PA 2O5DA 2C2EA 4ELVA 5C24A 2I1RA 3G6YA 1REVB 4C8NA 1RTHA 2F8SA 4H4OB 4YMEA 3WNHA 4DEZA 4IDKA 4O5BA 2YV0X 3RWUA 1JKHB 4DLEA 4DLGA 4ZTFA 1RNHA
chains in the Genus database with same CATH superfamily
1KN6A 4FP9A 1R0BG 3MXMA 2AV5A 1UP1A 1BI4B 4KH4A 1VQ8N 3I9ZA 5D4OA 4ED1A 2HRUA 5CCLA 1N88A 1HNWF 1WACA 2CG8A 2VC1A 3VEWA 4JHDA 1NOYA 4M3YA 3UR0A 5HLFB 6FD1A 1S77D 2B3TB 4HUGA 2BQ3A 2AU0A 1S6OA 4Z2XA 4RW6B 5RUBA 4ED5A 1VRTA 3BKFA 5AQPA 3FBEA 2CPDA 3HHEA 4LFCJ 3CDUA 3GFXA 2VA3A 5M1QA 5AR0A 4J9UE 3W2VA 2DPIA 2MSSA 1HKGA 4ED6A 2WBMA 1L3KA 1AROP 4HHJA 5T7BA 2XB2D 2LP4A 3W62A 3ZT1A 4CT8A 5KFHA 3EXYA 4JK8A 3S3NA 1JNRB 2F40A 2CNLB 4M7YA 3CWJA 4MAKA 1CZAN 1H1VA 1I5OB 3J80U 3DU6A 5A0YB 1VSDA 1YITN 3QZ7A 5M2UA 4HTLA 4WTOB 2MGZB 5AE2A 3SMPA 4F4XA 4EHUA 4ID8A 4A8OA 2PE8A 2FZKB 2ZVIA 1NJIO 3GWCA 4RUAA 4KTQA 2XS7A 1ZBHA 1CZ9A 3CJ4A 3ZNUA 3T9NA 3TZXA 4B9LA 3E9OA 2OGUA 1C0GA 2I6WA 4NCGB 4CE9A 1Q82O 1ZM9A 1JB0C 4UQGA 2CXEA 3AA2A 4DL3A 3HULA 2W2PP 3R5DA 4PWWA 4X84A 4ENOA 3OYJA 1TK0A 4WTYA 1HPMA 2EEYA 4ISGA 5KRSA 1FE4A 2HLUA 4ILJA 1GAOA 2ZH1A 2FBYA 1DLOB 3G71S 1V3ZA 1P9QC 4DTNA 3OL7A 4NEYA 1UVJA 3WQUA 1ZC6A 1IKVA 5GAGI 2P9NA 5KFOA 3BF1A 3V9SA 4B08A 1REVA 3TANA 1RTHB 1TL5A 5HVFA 3O3GA 1VHFA 1B7YB 1IN0A 4I9QA 1K8AO 4G1IA 2VDIA 3BSCA 1Q81O 3A8JA 4Z4HA 1RBLA 2CRLA 5L38A 1AA1B 1IM6A 1WWHA 2FZCB 4IZ9A 3S9HA 5LJ3Y 5B7WA 1XMOF 3D5MA 3OTEA 4N8OA 1NPKA 2IDOA 1QTMA 1X3NA 4J91A 4ZVEA 3H6EA 4C4WA 1TMMA 2RHKA 1HKAA 1NDPA 5B0BA 3AQPA 4WFXA 5ETKA 3M3ZA 4CLPA 4M45A 1VSMA 1SH2A 1HNWK 5I3UB 2NRVA 1V3SA 2DRDA 1S1XA 1PYOB 5I3QA 5E41A 3THXB 3SCJE 1I1GA 4QS9A 2V2QA 2Y0SD 2GV9A 1ATSA 4B1VA 5A8KA 1MMLA 4JP8A 5ETTA 3WNEA 5D3GB 3HP6A 1EARA 2IM3A 2JFDA 2IVOA 4BGBA 4BRNA 4WF9L 5JVHQ 1PYSB 2VIHA 2CJ9A 3W9IA 4P2XA 1PJ6A 4C11A 2DRAA 1H2VZ 4EO8A 1X4BA 3QBWA 1CLQA 2BMBA 2DFHA 5HMXA 1SIWB 3AA8A 3M30A 4MFBB 1B64A 1I3AA 2P9KB 5KG2A 5A2QY 2RU3A 4KJIA 2P9IB 4FWSA 4U8VA 4PQUA 2G8HA 2MY8A 1VCTA 4KYZA 2WTUA 2M0GB 4FCYA 2CQ1A 2RKIA 5EGYA 3QAEA 3KDOA 4A8XA 4O8KA 3BSNA 4WFAQ 4HHUA 2LQ5A 3G6VA 3M9OB 1NPPA 1BGXT 2HZCA 4DV0J 3ZSQA 2VJVA 2YTCA 3EGNA 4HEA9 5SUHA 4F3QA 2PZSA 2GUPA 3NNCA 3PZPA 2YKMA 1OSCA 1YI2S 3IP0A 1OS5A 4M5IA 2HWTA 1T95A 4B1YB 2HAFA 3FFKB 1RWMB 2OD6A 3LOUA 3P96A 2HZAA 4A59A 2H51B 4TN2A 3D6TB 1HKBA 3B8HA 3KJQB 2P9LB 3KUHA 2ZWOA 1TUGB 4RWXA 1N32J 4NPOA 3O8WA 2CQ2A 2RRAA 5DMRA 4Y1DA 1EX4A 4QIEA 4W98A 2HNZB 1NOZA 5HROB 3CJ9A 1J5EJ 1T3NA 3PM9A 4E0DA 1BC6A 1YTUA 2B5JA 3BKUA 4CIFA 3GYXB 3OTBA 2U2FA 2G0JA 4FL9A 2HFSA 2PEHA 3MM8A 1HYVA 4Z7YA 3CJRA 4HL9A 3IDHA 3VZIA 1UMJA 3J7YI 3H98A 4X65F 1T9UA 4WBFA 4UOFA 1HNVB 4Q0BA 2QWRA 2GBZA 1S79A 4XPEA 3D3BJ 1N5QA 3TAFA 3KK1A 3CJ8A 2V6AA 5F8HA 3R2CJ 3K2YA 2MKYA 4J2EA 3I5AA 1MN7A 4KHQA 1FJGJ 3V6HA 1FK9A 1HHTP 4XPCA 4C0HA 4TQSA 5EN1A 4ZPWR 4RUHA 2XS2A 1RT1A 2VBXA 4YDDB 2OPQB 3R1LA 5CZ1A 4J9QA 3W5ZA 3SCKE 1GXLA 2NZTA 1WG5A 3QEXA 5L9XA 2H9ZA 3JQJA 3MM9B 1PBAA 1YVFA 1LV5A 3CC2S 2KXFA 4JV1A 3SFUA 2AEFA 3AVKA 3W9JA 5AQXA 3V6JA 4I0WA 4Z7CA 4I4BA 2HAIA 1H74A 3CCQN 2OH2A 4XAKA 3ENHA 4JV2A 4QS7A 3I5BA 3WC2A 2I5JA 5CA5A 4DL5A 4LBIA 4IFVB 4NLSA 5F8GA 1O51A 3I87A 4OHYA 3HYFA 2CJYB 1KBRA 2DGUA 3D68A 1Y00A 3VHQA 4DV6K 3NH1A 3G71N 2OPRB 1FKPA 3ZZZA 4A8KA 1RBVA 1TFWA 2PA3A 1IBKF 1Q79A 2NCKL 2UZAA 4DV4F 3T5KA 2P9EA 1R0AB 2J7UA 4BC9A 2HK3A 4V1Ak 3G6XA 5AQTA 4LRBA 2E7XA 3E9LA 2KXHA 3VQ8A 3JSBA 1TKDA 4B02A 1YVUA 4DV5K 4CJEA 3H3OB 4DF4A 3MEEB 4WQ5C 3ZETA 4IOCQ 3M8ZA 4PKIA 3DI6B 4ZPDA 2EI5A 5ETQA 1AUDA 4F50A 4NXNF 1NRKA 4F9OA 4BRIA 3OR2B 3CMQA 3NAHA 5KGWA 4CGDA 3ILOA 1GLFO 4M7XA 4BRCA 1FRLA 4OYBA 1HYSA 1VQ6N 2KTQA 1C1BB 1U0HA 2BJ3A 2GNKA 4F4ZA 3M30B 4J37A 1DAXA 4RW4B 2FHOB 2P9PA 2LEAA 2UV8A 2B9EA 1YRXA 2F5GA 1O13A 5KG6A 2XLJA 4H5NA 3OHBA 3OTOK 5L1LA 2CDRB 2KZMA 1V5VA 1H98A 2O8DB 2HB5A 3R7NB 4E19A 2OO4A 4ZVQB 1ROFA 3GILA 1KEKA 4CIGA 4DMNA 1WD6A 3NKYA 1RBSA 4H5TA 2V94A 4K8RA 2BM0A 2W7AA 4CJSA 4KB0A 3BQ0A 3A5LC 4IEEA 1FXRA 3CCMN 4JI4J 3M8PB 2DRBA 3CCUN 2VQEJ 4IOXA 1HNXF 3VZHA 2AGOA 1J53A 1CPZA 2UUWA 3OL9A 3PIPL 4ZLNA 1NZ8A 4CD3A 2DNNA 4DR3F 3MDFA 3NGDA 1OJ4A 1UA0A 5M1OA 3UKUA 3P39A 3BUZB 4CYUB 2KT2A 4ICLA 2ZJQQ 1WHXA 4DX5A 1B0PA 1X3MA 3M2UA 2BE2A 4LMZA 2V2ZA 4EWTA 5BYRA 5IC6B 4CT9A 3LPYA 3A8YA 3DRYA 3KLFA 4YHHF 5L1JA 2MHEA 3RVCA 1QSSA 1YJ7A 2BUPA 2WW4A 4NA2A 4Y2AA 1R8PA 3SIPB 2F4VJ 3G9CA 2IM2A 1S12A 1KTQA 3R8EA 2WVBA 3N6LA 3P3DA 2ZHOA 4KAIA 2BACA 2D7SA 1T03A 4DUZJ 2F96A 1LAWA 2P5GA 2HMIA 2GCFA 3TUJC 1H6KX 3OT9A 3HOSA 1JJ2R 4USKA 2GC8A 3ULEA 4N5SA 3NAEA 2BRLA 3R1XA 1FNOA 5DM7L 4OLOA 3LAMA 2JC1A 3KZBA 4KC5A 2HHTA 1FKPB 2F9WA 5I3PA 5AQNA 2OPQA 1FTCA 3SAHA 1B9DA 3QGPA 2AJ1A 2J4RA 3SSQA 3G96A 1RACB 1BWFO 2DK2A 3VQBA 4HT5A 3JYTA 3KJFB 3VAJA 2UUAJ 1FT8A 3QT5A 4DR7F 3GBTA 4WFYA 2NRHA 5I42B 3BBFA 2B43A 2ZM6K 3T1HJ 5IV4A 4HWIA 3UDCA 3WNFA 3M5RA 4JI1J 2XULA 1UFKA 3EZWA 3MHYA 3VGKA 1W7WA 1RAFB 3KLIA 4A5AA 5FPMA 2WFBA 4FF4A 4OYZA 4IFVA 5L1IA 4UUWA 4Z4GA 3ILIA 4ECUA 4BDZA 2WOMA 4ELUA 3KOAA 3T1YJ 4J9RA 5KOWA 4FYVB 1X5OA 2V50A 3CD5A 2QSFA 2ZOMA 3ZZYA 2DHAA 2XTJP 1UPMB 4C8ZA 1WNEA 2FJDB 4IOCL 2QA4G 4ED4A 4BHQA 2G2YA 3I5CA 4K4SA 1RHRB 4ZIVA 2IS3A 1K0TA 4L72B 4NLTA 2HIQA 3BZCA 2O8EA 3KYLA 4J7CA 1YGYA 1KOHA 1BUPA 3QO9A 2HKEA 4MLHA 1UTAA 2A1RA 4JI4F 2CPJA 3EGWB 5IWAK 1JLAA 4IO8A 4KHNA 1OO0B 2AKWB 1S7IA 1NNDA 3VR1A 3KKSA 2UXCJ 3GV8B 3VQDA 1D9FA 3BZQA 3RMBA 1R8BA 2UXBJ 1QQCA 2J9CA 1WN7A 4WE1A 3DFEA 4UT4A 1VHXA 2E5LK 2DNZA 4F3MA 2ZQBA 4BROA 2DGVA 1X4FA 4CHQA 1RB0A 3OUYA 1WSIA 3DRSB 4YOWA 4FJHA 1ASVA 3EE9A 1WDTA 3E2EA 3P49B 2Q31A 4LC9B 2RH3A 3TO8A 4NMLA 1JIHA 3BBBA 2MZJA 3OLBA 4FWMA 3PR5B 1LQ9A 4RW7A 3NVMA 2W9CB 4FWQA 2P8IA 3RW7A 4F3OA 5D4PA 3ULHA 3PW0A 3N5FA 5F0WA 2HHHJ 2QIFA 4JEPA 4O3PA 3PW5A 1CBKA 4Q8EA 1B7FA 4KHPJ 1WF1A 1UCNA 3TEGA 1REGX 5AZIB 4EEYA 2G1DA 1BQMA 3HM9A 3JS9A 1IBKJ 3N4QA 3P38A 4NRUA 3ZX0A 2VL1A 2DHGA 1OQ6A 2KG0A 3A5OC 2R2TA 2XI2A 3A5MC 3DNCA 2LLZA 4BRPA 4FLTA 3M2UB 3HHNB 1VQ8S 4F26A 3HPGA 2ACMA 2YWKA 4FM1A 1XHZA 1F9HA 4FO0A 4CJ4A 2WSFC 5EU7A 3ICLA 2X1AA 4JI7K 4JKBA 4BG8A 3C16B 5KFBA 2P9UB 3ZT2A 3MR6A 4DR5J 2VOOA 4WQ4A 3MAAA 4BS2A 1WOOA 3V2UC 3DRSA 3CQYA 2POKA 1NMNA 4DL2A 4ZVTB 2AYGA 1M5PC 4U7UK 1C1CB 1PJ7A 1WHWA 1GLLO 1CG2A 2V9WA 1QM9A 1GTEA 3QNNA 2COLA 5HL7Q 5FJ4A 2LQBA 5CD4H 3NLCA 1HPZA 3IBWA 1BMQB 2GHPA 4JI0F 3UNYA 5JS2A 2ZH8A 1AYEA 4FNHA 3W2WA 4MT1A 2QXLA 1JLCB 2DR7A 2QWMA 1UETA 5J2QB 1C4AA 1Q9YA 1W0HA 4E98A 1B70B 1YJVA 1NK5A 3B6PA 4NLOA 3CJBA 3NF6A 3RSEB 3AOAA 5A76A 3C46A 4QW8A 2YX6A 1RJJA 4TKTA 2CZ4A 2C2RA 2AMCB 4X64K 1UA1A 2BDPA 5KFDA 1O1WA 3OTDA 4DI6A 1IJFB 2DTUA 4FJGA 2GQCA 2BE7D 1XC3A 5DG8A 4LF6F 4UZCA 3AGRA 3AY9A 3NEKA 4WF9Q 5LJ5Y 4JI8J 3MMAA 1KVAA 3C0BA 1TQLA 1MW7A 4DB3A 4IKAA 2LEBA 2YHYA 1N32F 2PDAA 2IDLA 3OSNA 4G1QA 2CAJA 5FLXO 2APOA 4C98A 2OEJA 2MKHA 5IV3A 2RF2B 3QATA 1N5YA 1WORA 3ZX3A 1NLKL 2R2UA 5KFIA 5DGBA 5KFCA 3W1YC 3L7UA 1YBAA 3CULA 2QW9A 3V6DB 4YOYA 3MEDB 3H4BA 4RCHA 1AT1B 5DS7A 3U3GA 4DOZA 1XJWB 4X64J 1BQXA 2Y8YA 2E4LA 1GOBA 2DEJA 3MN5A 1H72C 2LYVA 5HQMA 3TAMB 4PG6A 4GVLA 3PFEA 2Z30B 1JLCA 4X66J 2MLYA 4CHYA 4CK3A 1X9SA 1S72N 1F9FA 3X3UA 5B0AA 3SJJA 4ECSA 3DLKB 1CULB 3PW7A 4EFAC 4PY5A 5DG9A 5DDPC 1Q53A 1TGOA 1VSJA 1SIZA 1FXDA 1F9EB 1WC6A 2WONB 3GIRA 5AQSA 2J7KA 1XHXA 3GR1A 4L76A 1VSIA 4U96A 5EUHA 1TU0B 1VLOA 3CF5Q 3D67A 4NB4A 5KFEA 3J7YU 2HSTA 4FK0A 2OP5A 2ZD1A 5HOOA 4JI2J 4FLVA 1NK8A 1G1XA 2P9UA 3U1LA 5GADP 2W7PA 4WXWA 3KKFA 1T05A 1WKLA 3CNQP 5KFKA 4J9PA 1V3RA 3AVFA 1X4EA 2HHQA 3VF2A 4RNOA 2ETJA 2QV6A 3L4BC 5IM0A 4PRFA 2Z1IA 4AF1A 3JTNA 4CO3A 3ZEUA 3CJSA 3GG0A 1P9YA 1L3UA 3CFRA 4B9UA 4F0KA 1VS3A 2PMZD 3T1HF 3FEZA 1SKSA 4GKKK 1VJWA 3O9TA 1RDUA 4OGCA 4E7HA 3BSAA 1LOUA 1LKZA 1TL1B 3DOLB 4CJTA 4GKJK 3OPKA 3BGRA 3O80A 3I31A 3AB4B 2GQQA 3AJ1A 4Y00A 5B0EA 3UKUB 1YJNS 2BQUA 3LTOA 3L09A 3NGRA 3LAKA 1WG1A 2MZQA 4OX9K 4ZTJA 1WLJA 3JQKA 4V19J 1Q82T 2I2YA 2KYZA 5L39A 4DR1K 3CEDA 3F2KA 4CGHA 1QVFM 1T0TV 1EX8A 1E6VA 2BTFA 3AQOA 3ZTOA 2LXIA 2KDOA 1RLCL 3R27A 5C42A 5E5NA 1IKYB 4ZVHA 2E66A 1RBOB 3OL6A 3ZTQA 2NXNA 1YAGA 1P27B 4FJJA 1ZA1B 4JN4A 1WUAA 4M3XA 5IQ6A 4XH5A 4JS4A 3IRXA 4KKOA 4TXSA 2Y1IA 4DXLA 1WTFA 4DHVA 3EN9A 3SCXA 3FVYA 3TJ8A 4LRDA 1SL1A 4BG9A 3PKMA 2W1BA 3GPAA 4ELTA 3B6OA 3CO9A 3MECB 1ZS6A 1OY9A 1CLFA 4IG3A 3M9MB 1CJVA 3T9ZA 1XNRF 4MKBA 5A8RA 5M1PA 3WX8A 3EVMA 3EVOA 3JYTB 4DUYK 3DOKA 1E6YA 3I0RB 5DG7A 2E1PA 4OZJA 4ILRA 3QEPA 5KPTA 3IS9B 4L73A 4I67A 1WF0A 2RF2A 4EBCA 2OZSA 4CZKA 1DJ0A 2MTLA 5IT0A 1Y11A 3PVXA 2Z2YB 2OANA 4WYWA 3O8MA 4Q8FA 3PKYA 1BWEA 3UI3A 5KFUA 2B4PA 4CTAB 3CERA 3RU0A 1VQLS 3C14B 2M9KA 3RB0A 4CEEA 3HDSA 3PEHA 2RHSB 2Q3SA 2XSFA 4A8SA 2AJFE 3GV7B 2G8KA 3LL3A 5FD1A 3RAXA 1CZBA 2ZGYA 2GJFA 3WBZA 3CXCR 2YHBA 3C94A 1SJFA 2AX1A 3ETMA 3TRGA 1HNZJ 4M95A 3VF6A 2UUTA 3ZSRA 4A48A 2ASMA 1VQPS 4FZVA 4CZLA 2ASYA 3MPVA 4N56A 2QX0A 4J9NA 2HGMA 4Y2CA 5KOXA 3KK7A 2OMLA 4ALZA 4F67A 1J54A 4OHXA 1R31A 2GO8A 2FC0A 2KFYA 4NI2B 3HSGA 3UN5A 3W3SA 2YKQA 4JHDB 2WB4A 3NH2A 4NXNK 1UL3A 1T9TA 3BM7A 2QL9B 1VFJA 4ETZA 1SQEA 3WEEB 4X62K 2W2MP 2BKPA 1RFQA 5CY4A 2AYBA 3H2UB 1QQMA 3MMCA 2BJ8A 4IFYA 4LF9K 3K5PA 2ROEA 4BRGA 1C6VA 4KHYA 5C42B 2VC0A 2VKZG 3CT9A 4PWUA 4FF1A 2UUBJ 1RTJB 5KFLA 1K9MT 1T3OA 3RUBL 5JVGQ 3J7AP 2GEMA 5HP1B 4ZPBA 2ZJRL 3D54A 2MJNA 4KBOA 3VOVA 1PSDA 2KKZA 3BO3A 2BJ7A 1B4SA 2M4MA 5EX0A 2WK4A 3ISND 1NK0A 3M6VA 4WKRA 3JSMA 2NPIA 2B4UA 1DTQB 1I6JA 4P72A 2CDQA 7FDRA 3B4DA 4IO1A 1NHKL 5LJVA 2Z57B 4C3LA 1SJRA 2OSQA 1JLBA 2RDIA 3QYYA 3CCSS 2CNNB 3W65A 3AVJA 4J2DA 2NQPA 1KKHA 4OKKA 1DQAA 4JKAA 4Y2IA 4AUKA 4RUBA 3HSJA 3FMWA 2ZWPA 3S3OA 5GMEA 1UZHA 1ASUA 5AJ3F 1UVNA 5JMVA 2XYGB 1YKWA 4Q7AA 4D3GA 4FYWB 5D6GA 1S9EA 2Z2MA 4X4RA 1NJXA 1XNQK 5F9LA 3O1BA 3H40A 3V6KA 4YEAA 3LPUA 3HHLB 2BOPA 4DU7A 4RU2A 1U2FA 4NZ0A 3LZJA 2UUCJ 3AO2A 4NYPA 4I6MB 5GAHP 5EWGA 1ZBLA 3DLRA 2VOPA 1K6YA 2IOCA 4B3RJ 4X66F 4CEOA 4UOHA 1YWXA 4JYAK 5B8HA 4K4UA 3SQ0A 1LFWA 3CCLN 5AFUH 3EXCX 5J2NA 4RU9A 4ILLA 4OV1A 2ZZMA 1URNA 2O4IA 3NGKA 3CCWA 2QN6B 1BL3A 1Z25A 1TAUA 4CRJA 1TKZA 3MMBB 4RTFD 5KFMA 1DTQA 1U1NA 2JNJA 2ZVSA 2HBJA 1RWVB 1G99A 1BG3A 2J7WA 4F0MA 1N5SA 2ZBIA 1HLWA 1T02A 5L46A 2HGLA 2YKNA 1NB2A 2LA6A 4ZPAA 2H65B 4ISEA 4ZA1A 5AE3A 4LFAK 4HTUA 5KFRA 1T7PA 4BC2A 1P6TA 3M8QA 1VMBA 1NLVA 1ZA2B 1DLOA 1HWIA 2AYEA 4NLRA 3UN3A 3FZBA 3ALYA 2F8TA 1VQNN 4PYAA 3KG1A 1QAIA 1U09A 3LGMA 1PKUA 1TK8A 2C2EA 4ELVA 4BRLA 2I1RA 3CMEN 4PG5A 2DVIA 1REVB 1RKJA 1FTRA 3GYGA 2MKKA 2ZH2A 3R1HA 1YJRA 3WNHA 1CQMA 1AFIA 3MX5A 2HYIB 1IR2A 1J27A 3A8EA 4USUA 2KJWA 5M1KA 4OI2A 4GVEA 1R89A 2YQ3A 4OO1J 3N6MA 3NOGA 3GDQA 1VBZA 1VHIA 3CJ1A 5C25A 1WKKA 1NXIA 2W7OA 1JLFA 4GNIA 2XMVA 4ECXA 4CFCA 2P9CA 2AP1A 3AA4A 4R79A 4DQQA 2KI2A 4KGXB 1NJWA 4BRAA 3KKRA 1BA1A 1U47A 2WONA 4BREA 2R7WA 5AE1A 2VICA 2DEIA 1HI0P 3POTA 3GE1A 2YWGA 4ZHRB 2ZFHA 2QA1A 1TKXA 2HBZB 2Y3YA 3GU0A 1ZTTA 1U6BA 3WXIA 2HQGA 1IVZA 4TY8A 3LDNA 2OAUA 3NG8A 3N5BA 3HMJG 3JSRA 4K7QA 1S1UA 1T6DA 1XN9A 2R8IA 3HI0A 2QZ8A 3O6QA 2B7BB 1SC4B 5EWEA 2VGNA 4ER8A 5HO4A 2M2BA 5HP1A 3M8QB 1DQ8A 1WEYA 2BOAA 2VBYA 2F4FA 2FLNA 4PABA 4X4OA 4RNNA 4K8ZA 3IA0A 2CQDA 4MK7A 1Q8BA 2K7KA 5HROA 2YNIB 3P1GA 4DTOA 4FW2A 2ITMA 4YHHJ 4C0OC 3H5YA 2CQCA 2NREA 1ELOA 2FLLA 3MM8B 4E7KA 4H03B 4WFNQ 1OYDA 4KREA 1K73O 1BISA 3PJ9A 4ES2A 2OELA 1APSA 2XYHB 5KFGA 4DSFA 2RJZA 3OQ2A 1Q95G 2CJXB 2FJVA 3IM8A 5KI6A 4C8LA 5CAAA 2DGSA 3FZKA 2GAHC 2UU9K 2K3KA 2Q6CA 3SUQA 5SWMA 2WB1D 2ZH5A 4HYKA 2GMJA 2N82B 4DV3K 1I94F 2D0AA 1DZ5A 1FRXA 3CCJN 1N4LA 3ENAA 3KLEB 4K0KJ 4OYMA 2KN4A 4ZDNA 3GCXP 4ZJOA 1LWXA 2ZBQA 2V67A 3OXGA 2FLPA 3HVRA 3CIPA 2HHHK 2MKSA 4B9NA 2XMMA 5GAEU 5LMNJ 4O0JA 3PIOQ 4A46A 5AQRA 4QU7A 1NJYA 3WC0A 4FK2A 1EHWA 2JL9A 1IKXB 1HL6A 1L3TA 3FGVA 3W61A 4QIGA 2GVZB 3BSOA 1CC8A 3T7ZA 2EKNA 1ULRA 5ADXA 2P9KA 3M1VB 4JI0K 4DV3J 1W2BR 1VI7A 1N6QB 2W8LA 4OMFG 4WCEQ 4YOEA 1S48A 1SJ4P 2RKIB 2G4BA 3EUNA 1IBLJ 1FI4A 3D0HE 3V81B 5H9FJ 2BKOA 2M7SA 1IR1A 1FWLA 3HM8A 2WAQD 2L9WA 4H4KC 3E9PA 1V5IB 1U2RA 2PBDA 4IJNA 4FXVA 2EWSA 3UD5A 4FJNA 5KRTA 5D0EA 5KT2A 1YG0A 1C0UA 3GCWP 4KO0B 3JS6A 4FPIA 1R8HA 2UV8G 2P9LA 2PAVA 2ZDPA 1BD6A 2I8EA 1LWFB 2QFIA 4E2FB 3IWXA 1HBOA 2CIMA 1T44A 5J2PB 3EVWA 2Q0UA 3G82B 1RA7A 1UJ5A 4FW1A 2X7IA 4KFBA 4K42A 1JJHA 2BM1A 2FHKA 1SKWA 2XRIA 4CJ5A 2PN6A 4RLEA 1RWPB 3EEQA 3EGZA 2HNDA 5HQLA 1WNSA 3DLHA 4B1UB 2HFUA 4IOAL 4OZ0A 1FNMA 3MPDA 2A3JA 3O5BA 2VFRA 3CCMS 4EBDA 4QR2A 3MM7B 5J1NA 2D0OA 3NS7B 3GMGA 2ASDA 4LH5A 1XNRK 1HBNB 2P9NB 4JI6J 3T6BA 2QLJB 3NP5A 4URSA 2YWEA 4M3WA 4NO7A 2CJAA 4HUFA 2DR8A 3D2EB 3SV4A 2E5JA 2AX0A 3ZSYA 2F4VF 4WPAA 3ENBA 2O8FB 7FD1A 3F41A 3ZETB 3ZSZA 5AQQA 3DMJB 4FZXC 3WHIA 3KWMA 3EWGA 3U1MA 4YR0A 1YI2N 1VK8A 1K47A 4DS4A 4X4QA 3EPIA 1X8DA 8ATCB 1B0TA 4IH7A 2O66A 2RIJA 3MUVP 4B3OB 3SI6A 2JZ5A 5DO2A 5E3QA 5F8LA 4JRPA 3ILLA 2XMUA 4OI3A 2VBZA 3W8GA 4BLGA 2HNYB 3SSSA 3Q24A 3S8SA 1PILA 2EFOA 3B4MA 4LF7F 5C5JA 5AQIA 5HVHA 2ZEJA 5D0HA 2BEFA 3OVAA 2XO6A 4HCCA 1SJ3P 4JK7A 4OX8A 4F2SA 1NGEA 2BZ2A 1VQ5N 1U02A 2WVFA 4NLQA 1KC8O 5GAHU 2QM1A 4OLPA 4I56A 1X9WA 1H73A 3ZYYX 1GX6A 2UVRA 3Q0AA 3OW2R 1O8BA 3M32A 4Y65A 1U4BA 4KH6A 4KE5A 5BJRA 1GLEG 2R2SA 1T03B 1YIJN 4Q5VA 2DXFA 1RTDA 3U6FA 2FVPA 3D2EA 4Q44A 4OPHA 3DGPB 4RZRA 1HRHA 2AEJA 4F02A 5KTQA 5C2DA 3HHDA 3DN9A 5DETA 2VD3A 1NDCA 2AW0A 1IBMF 4DX8H 3PR4A 2DYAA 3H25A 2ZH6A 2XCPA 2CFXA 5H1SV 3H1VX 3ET6A 1GH8A 3OYGA 2XHBA 4O3QA 4OZ1A 3QNWB 3IBCB 4AQYK 2UUCF 2CPEA 1S9EB 3LDQA 1Z2ZA 2B9XA 2DISA 2ZF5O 2VODA 2IRXA 2P9PB 3TZZA 2VHGA 2YHAA 1EETB 4H0TB 3CI5A 2DBBA 1WHYA 1SL2A 5D3GA 1R27B 3V9UA 3BY5A 1KHWA 1S6QA 1IG9A 3V81A 1MU2B 3DRRA 2GQ2A 3KNAA 5I9EB 4F4YA 4UQTA 3JAMO 5B0GA 2R8KA 4O44A 4TSXA 4M5KA 4YOVA 4B9TA 2JWKA 4CCHA 3OFGA 4CERA 4CGGA 1SS6A 2LQJA 4WIQA 1S97A 2A6AA 4OLAA 2UVWA 3TAEA 4PXDA 3DXKB 4MH8A 4HI2A 2J5AA 4I7FA 1MROB 5KFZA 1HWKA 4CEZA 1CJTB 3MI7X 1WDDA 2ROGA 5D0GA 2QL7B 3T6JA 1Q1KA 3SBGA 1U1QA 3ZT0A 2AIRB 5U47A 2EBGA 4BR5A 1R3NA 1FDAA 4QYZJ 2QWNA 3QFPA 4ZPTR 2AZ3A 2UUAF 1NSQA 3QDKA 1URRA 4MDBA 4C7QA 1RAGB 4MIBA 3VGMA 4M3TA 1N33K 4ZVRB 4FJ5A 4A57A 4RO0A 1CC7A 1NMEB 3G6EN 3I9V9 3KK3A 5J2MA 3US5A 3F44A 3I55S 3PSIA 1DFDA 1GK8A 5CYQB 5BXIA 1X9MA 5EY4A 3OUYB 2H48B 1S6PB 4LY7A 3CC2N 1EETA 1IKWB 4GO5X 2CH5A 3C66A 3MOZA 4HDHA 1OH8A 5CE3A 4DUZF 2I5JB 3VGUA 4LF6K 1K0VA 4KHWA 3WT0A 2OEKA 2CZVC 2CYYA 3BR9A 4X65J 1JLAB 4DR4F 1EWQA 3ZZPA 4BQLA 5H9EJ 1F2HA 4CF2A 3E1YA 1MWYA 2KVIA 3IKMA 2I9SA 2LMIA 4XEIA 3RRKA 4RNFA 4FBUA 3D1QA 3M7VA 2RDDA 2CPYA 1VC0A 1UVMA 5HRNA 5LMUF 3TAGA 5CZXA 2E5LJ 3DXKA 1NGHA 2YHXA 2HGNA 4ANDA 1QUVA 5AQVA 2KVQE 2E5IA 3DGPA 4BR0A 3OLAA 3EY1A 4Z94A 1BIUA 1U04A 2KB2A 2B4OA 2H5JB 3U3YA 3O44A 2DNHA 1XK8A 4MDAA 4LSZB 3UR3C 5ETOA 1BHLA 4F4KA 4DR3J 2CQPA 5D0RA 3KK2B 2A41A 2BA9A 1E6VB 3CGIA 3CD6S 1NBEB 4DV3F 1FCAA 3PYGA 1TAQA 4K8XA 2RT3A 2OLWA 3D28A 3NF9A 1HYSB 4PXEA 3K89A 2ZJRQ 3CE8A 2VQEF 4K41A 1JNZB 2ZJPQ 4DHYA 4ETXA 1M1KT 4CH0S 5EHHA 4DTMA 2FXUA 2DIUA 1WI6A 4DCJB 3QFUA 2XHCA 4Y6IA 3MN6A 2QKKA 4IG0B 5AQWA 2WTFA 2HFOA 3WXMB 1NGGA 1X4GA 1GTHA 2J9DE 1LXNA 2HWHA 2LDIA 4DSLA 4P2MA 1GMWD 3Q8YA 2L48A 4AH9A 1WAJA 3QGGA 1RGIA 4USVA 5A8WB 3MCOA 4ED3A 4NXMK 3UFCX 2BV3A 1H2UX 5ETNA 3KHHA 1CEZA 1XMBA 1N8RT 5HK4A 3BV8A 2J0WA 1HD1A 1NJZA 1VBYA 3TU5A 2MEWA 5ETRA 5J2QA 2GZOA 4JV5K 5A6PA 2FY8A 4WU2A 5AXKA 2CQ3A 5GAHI 3TUPA 3AT1B 2H4WB 4A8QA 4CZFA 4RUCA 3I4HX 2K2PA 3HVAA 1HWJA 1MMDA 2W2NP 1TUVA 1NKBA 2DNQA 2DH8A 5AFUA 1C1CA 4Q2MA 3SCIE 3G86A 2VCPA 2J0XA 2UXDK 1LWCA 4CO4A 3VGTA 2JFKA 3W5XA 1YUWA 1NWKA 1GLAG 1HW8A 1I3OB 4B3TF 4LVNP 2IJNA 2A1SA 1RWNB 3CC4S 1HIYA 3FCWA 4BE1A 1N34J 3BZKA 2EBEA 1N6QA 4BQZA 3AVHA 1SQGA 4RBVA 3RG6A 5LMUJ 3NNHA 1RCHA 2O1PA 3PTWA 2P51A 3AAQA 3HVTA 4CFAA 2IJRA 4NLWA 3QETA 1R8AA 4CWBA 3SBTA 2IVMA 2FDNA 4A2BA 5KG3A 3K0JA 3DXMB 3MZIA 3SNNA 1RBUA 5EDWA 3VQQA 2W2QP 4LVOP 1BE4A 3D7SB 4URQU 4OYAA 4YDUA 5G0RB 3PYEA 3Q22A 5LSOA 4IWVA 2HFNA 4MKAA 2M70A 1C0UB 3PFOA 3AA3A 2RNEA 2OKQA 4DTJA 1M5HA 3KTQA 2VWKA 2YY3A 2HBKA 2FSKA 1YBTA 5A6WA 3MXJA 4BRFA 3G87A 3B54A 1QD1A 4OI4A 2JEIA 3CQXA 1RTZA 1N5VA 1NH7A 4YB1P 2MZRA 4FS2A 1ZTWA 4ZN3A 2YVSA 4YQWA 3DC2A 1HWLA 1S1VA 1HI8A 1CJKB 4PAAA 3CTRA 3FZHA 2Z56B 3AAPA 3DLGB 4OYWA 2RQCA 6AT1B 4FVCA 4PQUB 4CEDA 3FZ2A 3GB0A 2ZHAA 4JRQA 1HNXJ 3JQMA 5GAEP 1H7XA 1Q78A 2DGXA 3AO5A 3QO9B 3H90A 3UD4P 2AHOB 1J5EF 4R5PB 3OYMA 5F9NA 5LSLA 3KUGA 2D4WA 4DCPB 3RR8A 1A5XA 5GINA 5D4LA 4LSLA 4UOGA 2N7CA 4QIFA 2X3GA 4X64F 4YY3K 4YR3A 4XIUA 4YORA 4RPFA 2B8QA 3C6UA 4GKJF 1PC5A 3LGNA 2PFUA 2VZ9A 3D45A 3BH6B 3MK6A 4QR0A 2N4DA 2EC0A 4P75A 5T7LA 2QYCA 2K8GA 2IRYA 4PEOA 3VEOA 4NXNJ 4ID5B 3EMTA 3OVNA 4EU0A 3VN5A 4X4NA 4PG4A 3RBDA 1XERA 4U7CA 2YI1A 1ZPWX 1IBMJ 2LXUA 2AJ2A 3LWMA 3KD1E 2ZGZA 3RBEA 3QT8A 4CNYA 2I7NA 1TYQB 4M3ZA 3FJ2A 5AQKA 1ZM3A 4GKJJ 1HBUB 3W64A 3T5HA 1NJIT 2QE5A 1RTIB 4ZLLA 2MB0B 4OI6A 5DZ6A 4GKKF 3DLGA 4OX7A 4B9SA 4H4KA 2XZTB 1FXXA 1XR5A 1EXQA 2WW8A 3TTFA 2RQKA 1BLUA 3P31A 4F25A 5IT9U 1QY7A 1CULA 4CJ3A 4CK2A 3HVTB 3TOQA 3AD7C 2D0PA 3O4QA 2LECA 2P9SB 1UVKA 3DOMB 3QBCA 1XEZA 3F9KA 4CIOA 4AQYF 1F3FA 5B08A 4AFFA 1RDDA 2YKOA 4WP8A 4WQ4C 3IMQJ 4CM2A 3PSFA 1J5OB 1SUQA 3SUNA 2G13A 4FWNA 5G4DA 2R7TA 4B3TK 4H54A 1CJUA 3WQPA 2G0IA 1HHSA 3VV2B 4C1NK 1IBMK 4RWTA 3OYIA 1D0EA 3ET6B 4QPXA 3OHRA 1WSEA 5H1SQ 2E1MC 2V8PA 4ZVOB 5DLFA 4FBTA 4KR0B 2YKNB 5CD4A 4IKFA 5E0OA 3I8BA 3CD0A 2FSJA 3OTOF 4USHA 1OYEA 3CJTA 3BN7A 1QQNA 1Q7YO 1XMOJ 1RCXB 4DV1F 3TVYA 4YY3F 1C0MA 3Q2SC 4CJUA 2XMKA 4P73A 4HDGA 4L8RB 4ZP7A 1MG7A 4JBCA 3V5RA 3S7RA 1T9XA 3UDLA 4BRMA 4CO0A 4LBHA 2NXJA 2OIHA 4V19X 4URGA 3UQSA 2M52A 3ELHA 4B3SF 2IVNA 1X4HA 5BR9A 2ZITA 3T5JA 4W5RA 2H3EB 2YXLA 4LBPA 4CTAA 1S1VB 2MQQA 3U7JA 2IA6A 3VWSA 2JWNA 4O5FA 1Y10A 3L3VA 2K7JA 3KHLA 3NHGA 4PG8A 2W4DA 4DV7F 1RCOB 4M1KA 4CF9A 3BBCA 2RB7A 4AL7A 2O8CA 3HFVA 4CEFA 2AP6A 2V8HA 1U1OA 4OYXA 2F7VA 1SQKA 2E2NA 2R7OA 3D7EO 2K06A 2HIYA 4Y0FA 2XGQA 1DY3A 4KTWA 5KFYA 2Q79A 5IWAJ 4CH7A 3K5NA 4I68A 1AW0A 3J80O 1HI1A 4DZ6A 4WYBA 1VRTB 1RXOB 1IH7A 3IC1A 2IVFB 2FJBB 1IKYA 1SQFA 1P8GA 2R7YA 4FJ7A 3UVJA 4O3NA 3H42A 3E66A 4MIAA 3BQ2A 2J9DA 2XY8A 3K9JA 2B9WA 2KLAA 2O8DA 1HNIB 4IRDA 2QT7A 1RUSA 3V6DA 3Q8UA 2CH6A 1YBUA 1N0UA 1BO5O 3TA1A 4CO2A 1FFGB 4I64A 5BRHA 1NUEA 3CDAA 5E3CA 1VRUB 4PL7A 4JI7F 2N7YA 3THWA 2U1AA 3R97A 4DQ8A 1MDUB 3THTA 4NLYA 3SEOA 4J8FA 1K8KB 3DOKB 1RBAA 2DNMA 2VONA 4DL4A 4I2PB 3M2RB 3I0SB 1HJOA 5F8IA 2PYLA 3J7YP 1HMVA 2I7PA 4NOHA 4DV2F 1KP6A 1T11A 2BUNA 3JSMB 1R7IA 2VF3A 1HR0F 3CCRS 3BO2A 1S49A 2DHXA 1K1QA 4CLWA 4AD6A 2RILA 4ILHA 4XH1A 2N3LA 1FVQA 4CBUA 1RSCA 3QPIA 2XLIA 3MMAB 5LT5A 1FDBA 3AVAA 2MMYA 3ZO7A 1Z4UA 4CO1A 4KI6A 3W2WB 5GIOA 2G2OA 2DNOA 2ZC3A 3KHGA 4N76A 1FFSB 1FX2A 1I94J 1LWEB 2M8HA 2AWZA 2D69A 3GOIA 3IR7B 4HACA 5F1XA 3OYDA 2B51A 5BR8K 4IH6A 4DSEA 3LUYA 5GIPA 1XMQF 3JSYA 2RPIA 4GC7A 3EGVA 2M3DA 3QSIA 1Y64A 4BCAA 3L7PA 4X4UA 5A8WA 2XM3A 3MPYA 2ZE2A 4FVUA 4A4JA 2D9PA 2CQBA 5E3AA 3H4DA 1VAZA 4L3KA 4B3MF 2C1EB 3M2VA 5JLFA 3KD5E 1KAYA 4PPZA 5CZ2A 5DJBA 4NLCA 3M6GA 1ZBSA 3D0PA 3BO4A 2OZMA 3MD3A 4USJC 2RRBA 3AVIA 2F1FA 5LOQA 4ZCIA 3CIZA 2QLBB 1L3SA 2DNYA 1MNEA 5AQHA 2UUCK 3A0IX 4PKHA 5L1KA 3VGLA 3R5BA 4ZITA 3MEDA 4I6YA 1RHKB 4AL6A 2AT1B 3ENVA 4R0JA 2FSNA 2MPUA 5BN9A 3H5XA 1YVNA 1AZSB 1BQNA 2XSJA 3ITHA 2EX3A 4BC5A 2R8GA 3CM6A 4KHSA 1RDBA 4BWMA 4MKVA 4WIIA 2QSWA 3MM7A 4NZ7A 4EK2A 4YNQA 4KGVB 4NLGA 1QS4A 1V6HA 3CCQS 1NK7A 2M5YA 1Q86O 4ECZA 5JMNA 4ERDA 2QEXN 2E20A 3VEZA 2GVDB 2RS8A 4C3KA 2HHPA 3O9SA 2E29A 3SJHA 1N56A 5IC4B 3MR5A 2I38A 1PAEX 2GIFA 3NGUA 3PIOL 1C0TB 1WI8A 3TX8A 1Y97A 2EK6A 3UW1A 3CJAA 1UKUA 4I9LA 3N79A 3IGNA 4RNMA 4CEAA 4BWJA 3UE2A 3R6MA 1K8KA 5KFPA 4LFAJ 1EQ0A 3HBTA 1M0SA 3AA9A 4HTJA 3HKWA 2VG6B 4JI3J 4WFBL 2PSZA 2NSCA 3H0PA 1TV6B 4RW8B 3K5LA 4KRWA 2F63A 5HBMB 4PUOA 2HPUA 1JWWA 2OUGA 1YRUA 2EFQA 1HQEB 4KTZA 3O9UA 3D4JA 5C24B 4C3MA 5KT6A 5KG7A 3KHRA 2Q1NA 2IMOA 3FEXB 2XY6A 2R7SA 4HR2A 4P74A 3L2VA 3DRPB 4Z4IA 4ZP6A 4A8YA 1NMDA 3BH7B 2X6SA 1TL3B 1SAZA 2MHNA 1RDRA 2P5VA 1XMQK 1D1UA 2R8HA 3MTJA 1BI4A 2VKRA 3CCEN 3OFHA 4PPDA 3KNGA 2E9ZA 3JB9k 2XYPB 2FJAB 1SKRA 4GMJB 2OJ3A 5JJBA 1JMTA 4ZVFA 4LSNA 3R6GB 4USWA 2ZJQL 4AL5A 4DV4J 3QLHA 5HMWA 4M94A 2W9BB 3F56A 2DT9A 2OSRA 3BDPA 4IRCA 4JI3F 2OEMA 4JOUA 2C2MB 5ITHA 2KHDA 2ATQA 2LA4A 2NLWA 5F0UA 4J2AA 3NE6A 3I0RA 3DLEA 2R42A 4RBUA 4XDDA 3HVWA 1E4GT 3AO4A 4KH1B 1RK8A 1FO1A 3D2FB 4CLUA 2MY7A 3L4QA 1HQEA 2NUUG 5KG0A 1MWQA 1EWRA 1G6BA 4WP3A 4PL8A 2VWJA 1DBDA 2X1GA 3GJTB 4DV7J 2VQFK 4NLUA 3DRPA 2V5HG 1H38A 1S22A 1FKOA 2D1CA 1S1TA 3NL0A 2Z2ZA 1J2VA 2NUBA 3NCPA 1OY6A 3QGIA 2NRRA 3NWGA 5BN8A 2MGZA 3R7SB 2DKOB 3KVGA 3GJSB 1DTTA 3CJ7A 2PGCA 2XLKA 1AUSL 4C6AA 1RWWB 4CGFA 2YX1A 3H59A 2B0GA 4KB1A 1YJ9N 1VJQA 3N28A 3NGTA 4ECQA 3B8AX 4ISFA 2BVZA 1YTAA 2BE9B 2ZUAA 2VWBA 3MM5A 3TA0A 2UUBF 3OTOJ 1ESVA 2V8DA 2W41A 1VQ4N 3SSRA 2IY5B 1FX4A 1LK7A 3AVGA 4TVAB 3FGUA 3O4WA 3MMVA 3KMQA 1BWVA 1HA1A 2E5GA 2XSJB 4DPOA 4DPXA 1M90T 3OYHA 2KXNB 4N8NA 1RILA 4CEQA 2G8IA 2VU5A 2HBLA 4N77A 2OFGX 2HQDA 1ZOTA 3VAMA 4AQYJ 1T9YA 2P5OA 3IUCA 3TAPA 4DU3A 1NGCA 5J2PA 2E1YA 4V19S 5C24A 4B1ZA 1GEHA 2F8SA 3QRPA 3IAM9 4YMEA 1IBLK 4LF8K 4IDKA 1NO8A 4QZVB 1TELA 3L9ZA 4GKKJ 4DLGA 1RNHA 1FE0A 4A8FA 1D9AA 4RWWA 3TQ1A 3CCRN 1VYAA 1KD1T 3WXKA 3UCZP 3U02A 3DLKA 4PCQA 4QWDA 5K9FA 4DZDA 3G10A 2FIUA 2UXBF 3FZFA 3T3FA 2X1BA 3H46O 2QK9A 2F9JA 4FJ9A 4ZP9A 2DY9A 3RJMB 3F73A 1VQPN 5GADU 3OYEA 4RW9B 2RUSA 5HMYA 2O8FA 4B1WB 2ZNYA 1NGJA 3L4IA 4DV2J 1NHVA 3HF5A 3UPFA 3RTVA 2VH7A 2CPXA 1S9GA 3K57A 2YKMB 1V4SA 4EGLA 3CIMA 2OTJN 2VQFF 3C15A 3DYAB 4PQAA 4USMA 1SH3A 3CO0P 3J80Y 2NRZA 2GGPB 4CQ1A 1JX4A 4IR9A 2QMUB 5JICA 4DTRA 4LUBA 1M5SA 1RT3B 4DU8A 1HNIA 3HTVA 3DHWC 3HT0A 4OZ3A 2MZSA 2YWHA 4BVPA 5D15A 4OX9J 3TEHB 3TWZA 2ZM6J 1N33F 4BR9A 3QLHB 4OKJA 3FUYA 1S57A 3DAWA 4KV8B 4EP5A 1RHQB 2XMJA 3K9KA 1GLBG 4K2JA 3TAQA 3LGHA 2Q97A 3ATVA 3BGFA 3FCHA 5ETSA 3MCSA 3GZ7A 4K4YA 5DRKA 3L2QA 4JNEA 1YHQN 4AHVA 1UEUA 3J7ZT 3U9ZA 1WC4A 5KFXA 3D0GE 5KPRA 4KRFA 4OFZA 1ZM4A 2HF4A 1TKZB 3DCAA 3D6FB 4TQRA 5IOLA 4W90B 1PCAA 2RE2A 1ITPA 2X74A 4CGIA 3J7Z5 5CXTA 1NU4A 2FJXA 4PXCA 3HHLA 1TKXB 2F7TA 3V1OA 2HW3A 4YB5A 4DG1A 2LEPA 4F4AA 1S9GB 2JEFA 1HQUA 4KGMA 2E1CA 3CCZA 2HNDB 3ADAC 5BPMA 3MCPA 2BH1A 3VQSA 2PY5A 3FDSA 4M5MA 3LZIA 1RT7A 4LIRA 5CYJA 4BR7A 1TZ0A 3O1LA 2ATCB 5J2NB 1U2CA 5HRPA 1UVIA 1F21A 3CJQA 5E3RA 3T41A 3UN2A 4O0IA 1HNXK 3MFHA 3BEXA 4I6AA 3C7NB 1RT3A 4G65A 3MPWA 4FYXB 2PYJA 1W25A 2GA7A 3RRGA 5F3ZA 2E6MA 2IM0A 4MTPA 4DR6K 1RAJA 4WFNL 2VFTA 4HH1A 4U67Q 2LCWA 3HO1A 5J1EB 2GHVC 1C1AA 1FK9B 4QPTA 1KVJA 2DXDA 1W9HA 3OA9A 2LU2A 1KXPA 3M6UA 4DL6A 3T5LA 2ZZNA 4K4XA 2CJKA 3MWTA 3CCLS 3ISNC 3FKBA 1FA0A 2QA2A 4H5WA 1HW9A 3MM9A 4WE1B 4O4GB 3TVKA 5JS1A 4XH4A 5ADXH 5KAKA 5AZJA 3GJQB 1LXJA 4JI2F 4A47A 4DU4A 2ILYA 5F0XA 1YJTA 3THYA 2RQ4A 3H3NO 1R43A 3FCVA 3CSKA 3B78A 3L3UA 1FRJA 1J5EK 1RQ0A 1YJWS 4ZKAA 1UAWA 4CJPA 2GGPA 3CM5A 2GIRA 4AILC 3NBPB 4Y34A 2CADA 2KFZA 5FIIA 2JGUA 3TJ9A 1WC3A 5ETMA 3VALA 3FSIA 4KHRA 2RQMA 4JI7J 1W7AA 2NXEA 3QT7A 2LDYA 3QZ8A 5GADI 3EM1A 3QESA 5AXLA 2XC9A 2CWKA 4B3MK 3POTB 5E33A 2LFVA 4R5PA 4CLFA 4OJGA 3M6XA 2WBRA 5D8HB 3UKRA 4RW6A 1GT8A 4CZEA 1RT1B 4FLYA 2NZ4A 3JAMU 1KWMA 1IM4A 1VQYA 1SCJB 2PT0A 4MMOA 3P45B 1FF2A 1FERA 1VQMN 3CCVN 2D1KA 1EQYA 2F4VK 4JKFA 4LQ3A 1LW0B 2VPWB 4KO0A 2BX6A 4FWOA 1WSRA 1FWPA 3TI0A 4L74A 1C4CA 3SBMA 2ASPA 2AQ4A 3V4IA 1FRIA 4N41A 2H5EA 3KK3B 3QRRA 5AXMA 4YOTA 1Q81T 4C48A 3RRHA 3G82A 1UZDA 3THYB 5T7LB 1U25A 2IDEA 2RS2A 4LF6J 3SUPA 1RU2A 3P6YC 2BE2B 3PRDA 3GJRB 3VQTA 4CJ7A 1S6QB 5A0YA 4OGEA 5BYQA 3FEYB 5J1PA 4X4PA 3ILJA 4KV8A 2PMHA 4LD0A 1KSPA 1VQ9S 4YS2A 1NKCA 3MAHA 2VB6A 3BYRA 2EG1A 2K3IA 1V9OA 3SPYA 1S1WB 3Q8RB 2MYFA 2B4JA 3R5JB 5KQDA 5EWFA 3O1WA 3M8PA 3WNGA 3H8YA 3SLCA 4H4MA 4RJVA 5C2FA 4NE9C 2B9YA 3MWPA 1P90A 4WK3A 2OCEA 1WOPA 1W26A 4Y2MA 1MROA 4I7FB 2CG4A 1YSJA 1X4CA 1QUPA 5J1EA 3B82A 4DKWA 3AVMA 4LRAA 1WJ9A 5B0FA 5KFTA 1TUUA 2HQIA 3M6WA 1TMJA 4PG7A 5M2PA 3CCSN 4AE5A 3DI6A 4B9QA 1UW4A 2DNRA 2VFUA 1TUYA 1ITGA 2A10A 4AXJA 4JI4K 3AH6A 1RT7B 5HRSA 3VQAA 3OHAA 3RZAA 4CLZA 1LW0A 4YY3J 4AHTA 2QA4S 4CESA 1RT5B 2IPOB 1HHQA 2J8SA 1JLQB 2ASLA 4CZMA 2A6OA 4DR2F 2OPPA 3CC4N 2XHWA 3KJVB 3PX6A 3SQ2A 4WJBA 3R9LA 2HLTA 3VCDA 1S6PA 4LT6A 4HHHA 4EZ6A 3BP8A 2AYMA 4U67L 3A1YG 1BXNA 4DUYF 2GTDA 1F6TA 2E7VA 4LRFA 1LWCB 2ERRA 3W0LA 2KKHA 3CDWA 1LW2B 1FJ7A 2G1HA 3SDEB 4H0PA 4NEZA 1N34F 4C11B 2P1JA 2WBNA 3NBPA 2B56A 1MN9A 4DSJA 1D09B 4U95A 3OTCA 1VQ7S 3LPTA 1NM2A 1WOQA 2C3PA 3HHKA 2PI5A 5AQLA 3FNNA 2VQEK 2ZH9A 5AQJA 2IYIA 2H4YB 1E3MA 2EFNA 5ETLA 2RMLA 4ILMA 1RP5A 2GW8A 5K8OA 3NRBA 2O8CB 4ZVSB 1FVSA 2EFPA 4WFBQ 4KHPF 1GQEA 2NXUA 2NRTA 5AZJB 3O3LA 3U9DA 2AGPA 4Y28C 4CNZA 3B6BA 1VQKS 3MURP 2V8VA 1UFLA 4ECTA 3W60A 5DQHA 3NXZA 5L8RC 2ITGA 3UDVA 2HZVA 1H7WA 3PO4A 2RRNA 2VDHA 1U1MA 2NYIA 1FEEA 4ZVGA 4P9SA 3V1QA 1D5AA 1VQNS 4CI0B 3MUMP 4OPAA 2JWLA 4JV0A 2PFDA 4P2FA 5T14A 4ED7A 2HEKA 1XMOK 4L3QA 4B8CA 1EJ7L 1OWXA 3OJSA 2HF3A 1NGBA 2DCLA 5DDOC 1BY9A 4M3UA 2DPNA 1FRKA 2GWJA 1IWGA 2UXCF 3SQOP 1N5TA 3VEXA 3I96A 3CJ2A 5HI7A 3CPWM 3MUTP 2KW4A 5KG4A 4TU9A 5HANA 3W63A 4B9VA 2MLXA 2QEXS 4JI5J 2EC2A 2KO1A 4DFJA 1LFPA 4HUEA 4ECYA 3G25A 2V8GA 3TR5A 3OBWA 4UUXA 1NDKA 7AT1B 2VBWA 4K0KF 4H4MB 2AJ0A 3A8KA 3M32B 2J6UA 2IBKA 3WQTA 5FPDA 5MAOA 1TL7A 4UZBA 1JLEB 3A8IA 2IIHA 3JXUA 2VJUA 4EYHB 1FDNA 2UUAK 2R8JA 4BC7A 1XQIA 4QWBA 1KVIA 3CMES 2DFFA 3LP2B 2EPIA 3AXMA 4AHSA 5CZVA 3T1YF 4QW9A 4FF2A 4USTA 2A3ZA 2V4RA 2O01C 5C2CA 1IBCB 4WZQA 1A5WA 2V9KA 4WP9A 2CPHA 1VIOA 3QNOA 1Y9OA 3EKUA 3OS0A 2ADBA 2BQRA 4M63A 4FWPA 2ZKTA 3S41A 5CYMA 2ZBPA 3VGVA 1PIEA 4ZJLA 4DV6J 3AOCA 2UXCK 4EMDA 1ILYA 1WC5A 1CJKA 3UWTA 2Q2RA 3IAYA 4JI1F 4A8WA 4Q2LA 3AFGA 4CLLA 1NM1A 5JVHL 3ASMA 3L8BA 3KK1B 1OH6A 1ATRA 1LWEA 3K5OA 3FBCA 3KHYA 4ID5A 2O8EB 4DX6A 4DU1A 1NAQA 3L6QA 5JXSA 4NRTA 3EX7B 3VQ6A 1C2PA 1S7HA 2JDJA 3HZGA 3D6HB 4NX9A 5HN0A 3NGZA 3CC7S 3BR8A 1HBMA 4OHVA 1AXQA 1M1KO 3GR0A 5SZTA 1F2GA 2A6MA 1RE1B 1F3VA 2NS1B 5G0RA 1VK0A 1VIXA 3SQGB 4OI0A 5A8RB 4Z4EA 1ZBTA 5F8JA 1KVKA 2ZUGA 6FDRA 2R2RA 1W2BM 3C19A 1S3XA 3QAUA 4WCEL 4DPWA 3C16A 2YKAA 2RD5C 4ICLB 1UJ4A 4DUTA 4EUVA 3MAAB 5AT1B 1X4DA 4DG1B 3K17A 1YX2A 1SVDA 1DARA 2ZJPL 5E2QA 3TNVA 2X51A 2KFNA 3BDEA 3OL8A 4OX9F 4IRKA 1HKCA 4GY2B 3K2PA 3QINA 3MGJA 3NCIA 4RW7B 4FVMA 4JYAF 4M5HA 4FK4A 2QYGA 3ZLJA 1CVJA 4FYYB 2RAQA 1OKJA 1BQNB 4XTTA 4ECRA 1Y3KA 4ECVA 1SPBP 3CJ3A 4WFAL 2KT3A 1OSDA 4ES3A 1XNQF 4RBTA 1RKIA 2C42A 1SC3B 1PG5B 4IOBA 3GONA 2WVCA 3ZTSA 4KT0C 2XZDB 2ZBRA 4F04B 1TK5A 4QU6A 3QERA 2EKYA 4QYRA 4ZN1A 3VA0A 1D8ZA 4AHRA 3L0QA 3LPEA 4LFBF 2DH7A 2PD1A 3G8TA 4NCAA 4QR1A 3NMUA 3TABA 2JLEA 3VQ7A 3M8WA 1D4XA 1NB7A 3G2XA 2XI3A 3DDIA 3Q7BA 4WKYA 4OJ3A 5C0YA 2AEMA 1I39A 2Q43A 1HQ2A 2KQ2A 3HHLD 2ADCA 5FRNA 3R5CA 3SQ4A 3PHEA 3W8PA 1C1BA 1HUXA 3THXA 3NNAA 3BPSP 2MQMA 1K8AT 3GLJA 4GV3A 4B9MA 1T6CA 1RAHB 4OIXA 4AHUA 2LSNA 1IKWA 2DFEA 2PA8D 1X60A 1RISA 5FROA 2JLGA 2ABYA 4CF0A 3PDNA 4K4WA 3GIJA 4X62F 1M1GA 4K4VA 4IFYB 1UFWA 2UXDF 2WSEC 3DDKA 2WOMB 5FLXY 1PYTA 1G2EA 3EL2A 2FPHX 2PIIA 1Y7PA 4JI8F 4OJHA 3AARA 4LF9F 3TAMA 3MMJA 1TKTA 4J5OA 1T05B 1VQ7N 3HSDA 1S10A 2QLXA 1F0XA 4C9DA 1Y5IB 1NGAA 1WSFA 3RB4A 1KNZA 3GV5B 2CZ9A 8AT1B 4NWBA 1TUWA 3T69A 3JTOA 3BREA 2Y9HA 1HJRA 4YFUA 4O3SA 4RG8A 5TKYA 3AVBA 3P4UB 4C8KA 4DDFA 2XY5A 4CZJA 1WC0A 1SUQB 1B9FA 4J9SA 4ZLPA 3NVKA 3V1RA 4C8YA 3UCUP 1J6ZA 1CJUB 2ALYB 3QQCD 4DUYJ 2DGTA 1JXVA 1JLBB 2HHWA 4B3RK 3O6WA 1SXLA 5EX3A 3OS2A 2MQNA 5GAGU 3LP0A 3DLEB 4QBUA 3GIIA 2K1RA 5I42A 3Q23A 2BBEA 3CETA 5CABA 4E1JA 5AQGA 2NLXA 4ZP8A 4DN0A 1RT4B 4OKEA 1KQGB 2HS3A 1N5YB 3NS6A 3A3NB 4QWCA 4E7JA 5H9FK 4LQ9A 2X78A 5KPZA 2JRSA 3IG1A 3FQKA 1S72S 3J7AN 1QSYA 4TY9A 4EBEA 4E1MA 4AM7A 4LF2A 4UW2A 4ZCKA 2BW7A 4WYLA 2YH0A 4IH5A 3PV8A 4JV5J 1NSAA 1U26A 1VSLA 4DPTA 4KIAA 3R3LA 2YHWA 5D78A 1UVLA 2V2VA 3D9BA 1SBRA 1S99A 1LCUA 1KLNA 3LM9A 4ZPCA 3V9ZA 3E01A 2L08A 3L2UA 4A61A 3ZC4A 2YWWA 5JUMA 2J0SD 5DLGA 4AHCA 1HMVB 4CHOA 2WVEA