4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
4CESA 1T05B 2ZE2A 4RUCA 1ASWA 4K4XA 1S6PB 4J9NA 5CZ2A 4F3TA 1Q9XA 2ZE2B 2I1RA 3AVLA 1XR7A 3CM6A 3TVKA 4O3NA 2YNHA 5KRSA 4RU9A 2FBTA 3CFRA 2YNHB 4ECWA 4FJ7A 4QWAA 4ECXA 4DS4A 1YVUA 4NRUA 2KZZA 1S1XA 5KFFA 1GOBA 4CFAA 4DTJA 2BGGA 5F8IA 1NK4A 1S1XB 3BQ2A 5KG7A 4KTWA 3QO9A 4EBEA 1TKDA 4NYFA 4QWEA 4CJQA 4DTOA 4Y34A 3ITHA 4B3OA 1FKOA 3GYNA 5KFYA 3VA0A 1S1UB 3ITHB 4B3OB 1FKOB 4RW8A 2GBZA 3NH1A 3KD5E 1HQUA 4E1MA 1IG9A 1U09A 4RW8B 4WFZA 1N5YA 1IKXA 1HQUB 4IKAA 3PZPA 4DMNA 2AGQA 3QGHA 3VQ8A 1N5YB 5F8GA 4IRKA 1IKXB 4QWBA 4WFXA 5KFMA 1WNSA 3PR5B 3NH0A 3T19A 2V4QA 3VQPA 3GV7B 3T5JA 3AO2A 3ZSWA 3LAKA 3CJ3A 3OYAA 4KHQA 2AU0A 4BWMA 4JV1A 3AO5A 3PO4A 3DLEA 3ZSOA 2W9BA 4LD0A 3AVHA 2G8KA 4IFVA 5EU7A 4Z0UA 4NYZA 3DLEB 1KVCA 2W9BB 3NF8A 4TQRA 2KTQA 4IFVB 3CDUA 3G6XA 1U04A 1RT6A 2RF2A 4YR0A 3OYFA 4FLWA 4MIBA 4J9RA 1X9WA 4HKQA 3K58A 4FLYA 3UR0A 2F8SA 1RT6B 2RF2B 4FS2A 4TLRA 4J9LA 4DQQA 3HKWA 3EPIA 1WLJA 1SL1A 4B9VA 2HNYA 2XGQA 4KHMA 5HBMA 3NAEA 1RTHA 1ASVA 3U3GA 4DTMA 2HNYB 3M8RA 4FZZA 3HYFA 4Y1DA 5HBMB 3OYMA 1HRHA 2P51A 4HUGA 1VRTA 1RTHB 1EP4A 2WCXA 2XY6A 4C8OA 3DLBA 3KKRA 3DI6A 4MK8A 3L3UA 1VRTB 1EP4B 3OL8A 4GMJB 1T8EA 4N41A 1HQEB 3V1RA 4CEZA 3DI6B 2UVWA 3KHGA 4Q5VA 3I8DA 3AO3A 4MK9A 4M41A 2FC0A 3LP3A 4CFCA 3LAMA 1IKWB 4DFMA 1J54A 3RB0A 4ZVFA 2ASDA 1BHLA 4JS5A 2HHWA 1GX6A 2D3UA 2OYQA 2E4LA 3SUPA 2A1SA 2D0AA 5EWGA 1HJRA 1S5JA 2FVQA 3HK2A 4FCYA 4HTUA 2HHSA 3LP1A 2F96A 2BQUA 2UUTA 4NLDA 3LP1B 4BDYA 4HUFA 5FRNA 1VSHA 3OYIA 2QKKA 1JLFA 4I2PA 4FBTA 4ECVA 4K4TA 1JLFB 4I2PB 4FM2A 5KFBA 3QEWA 3OL6A 2J6UA 4HHTA 4NLGA 5F8NA 4EP5A 4K4ZA 4CGHA 3EZ5A 3K5OA 5T14A 1SL0A 4ED0A 2KQ2A 3GV8B 4RG8A 4WFYA 3V4IA 4CEFA 4UQGA 1ZTTA 1B9FA 5FROA 1TVRA 2FBXA 5E41A 3PJWA 1N56A 3QEXA 2IJNA 1RT7A 1TVRB 2WHOA 3QIPA 3K59A 1RNHA 1TKTA 3PUFA 4NLPA 2YNIA 4DL3A 1RT7B 5FDLA 3WNEA 4KTQA 1JLGA 1TKTB 4M3UA 2YNIB 3TWHA 5FDLB 4FJHA 5KG1A 1DLOA 1JLGB 1C2PA 3K5LA 5KFHA 4EO6A 2R8IA 4IKFA 5KFCA 1NJXA 1DLOB 3I0SA 2HB5A 4C8LA 4KI6A 1KLMA 1JXBA 5KTQA 3HM9A 3LDSA 4DTPA 3I0SB 5KFLA 3ZSQA 4FZXC 2JGUA 1KLMB 2F8EX 3V6KA 4OPJA 4RW7A 2IC3A 4HCCA 2IBKA 5KFIA 2IGIA 2DTUA 4DQRA 2EC0A 3KJVA 4RW7B 3FFIA 2E6LA 3AVNA 2IC3B 4NLTA 3PX4A 2A1RA 4GVMA 3OL7A 1NJYA 4E7HA 1JL1A 4TSXA 4O4RA 3RMDA 3KJVB 3V1QA 3FFIB 4OVLA 5J2NA 4F50A 1OS5A 5KFWA 4DEZA 5I42A 3SCXA 2AWZA 5J2NB 3NKYA 1C0MA 4DS5A 4CJLA 1RT4A 4WYLA 1XHZA 5I42B 3BR9A 4NLRA 1RDRA 3CYMA 1RT4B 4FYDA 2QK9A 5KFTA 2EX3A 1WSHA 2VG7A 1YVFA 1CXUA 3V9XA 1BCOA 4O0JA 3SZ2A 2VG7B 4QCLA 1D0EA 2E9TA 4ZVHA 4J9QA 2YV0X 3T5HA 2R8GA 5FRMA 4O44A 4KBIA 2BR0A 3CFPA 2ZQBA 3QNNA 3ZSRA 2Y1JA 2W9CA 4M42A 4O44B 3G6YA 1NK7A 2IM2A 2W7PA 4CF8A 4K4YA 2XY7A 4I2QA 3KTQA 2W9CB 4QWCA 3JYTA 4Y2CA 4I2QB 1U48A 4ICLA 5KT5A 3JYTB 1TAUA 4O3QA 4ICLB 2JC0A 2WRMA 3GIKA 3IS9A 2B5JA 1DTTA 4Q44A 1WN7A 4RNNA 2BE2A 5L9XA 3U3YA 4FM1A 3IS9B 4CEOA 4CHYA 2B5JB 1DTTB 3RB6A 3L2UA 2RPIA 2IJFA 3TI0A 3THVA 3CO9A 2FVSA 4KB0A 3EPGA 3H5SA 4N47A 1C0TA 1NKCA 4CHPA 4B9MA 4FBUA 4KREA 1J9AA 1RBVA 4W5QA 3OYNA 1YTUA 1U4BA 3RB3A 1XI1A 4WXOA 3QETA 1BQNA 3SJJA 3HVWA 3HVTA 1A5XA 1N4LA 3HPHA 4Y1CA 1Y97A 1XR5A 4B9LA 1I39A 5DLGA 4K4SA 1BQNB 4E0DA 3HVTB 4FW1A 4E7LA 1NK6A 3TR8A 3PX6A 2E9RX 5KRTA 3VQ7A 4Q43A 3ZCMA 2OPQA 4EZ6A 3NH2A 1C1CB 1G15A 4NCGA 2OPQB 3TAPA 4H8KA 1ZBHA 4JV2A 3TAFA 5KFZA 4NCGB 3VN5A 3LZJA 4ZTFA 1U47A 4IRCA 3S3NA 2KFZA 4CCHA 1FKPA 1TKXA 3SQ0A 4E7IA 4C8MA 3RMAA 4YP3A 1FKPB 1TKXB 4URSA 1GX5A 5JS2A 3OLAA 4IH5A 4BDZA 4NLVA 4IDKA 3OYCA 5KFNA 1RTIA 3CJ2A 2O5DA 4IQXA 3KD1E 3M8SA 1KVAA 4IDKB 1RTIB 2B43A 1CLQA 3VQCA 4GC6A 2AJQA 3PW2A 3VQBA 3BQ0A 3OHBA 1QHTA 1L3VA 4QWDA 3PW4A 1NK5A 2HMIA 4AHCA 5J1EA 3AVMA 4TY9A 5J1EB 2YNGA 3V9ZA 2AX1A 3QIDA 1K1QA 3GIJA 2W8KA 3ASMA 4KHRA 4ED3A 2HWHA 1IKVB 2YNGB 1NJWA 3RB4A 4DF8A 1UAXA 1RILA 5KT3A 3TAMA 4O0IA 1KLNA 1KRPA 2BANA 3OJUA 1ASUA 4AH9A 4O5BA 3NFAA 3HJFA 3TAMB 4ECUA 1T05A 2BANB 4PWDA 3PR4A 4KTZA 4YFUA 4PWDB 1HARA 1WNEA 4IH7A 1K1SA 5KG2A 1S1TA 2V9WA 5KI6A 2G8HA 1S1TB 1TL1A 3PX0A 4DSIA 4EZ9A 4ZP6A 1HNVB 1JLCA 3S9HA 3CWJA 4EBCA 4BACA 1TL1B 5KT6A 1RT2A 3AVGA 4ED2A 2YHAA 4CHOA 1JLCB 3RAXA 5L1IA 1RT2B 4CF2A 4DTUA 4U6PA 5KFAA 4AHRA 5J2MA 4CF0A 4CJUA 3TAEA 2JLEA 3NAHA 3M8PA 1IH7A 3NAIA 1BGXT 3L2VA 3L2QA 5CYQA 4TY8A 2GC8A 5F8LA 5J2MB 1C0UA 4OKJA 2BQ3A 3M8PB 1S1UA 5CYQB 1BIUA 4TY8B 4B9NA 3ZT1A 1C0UB 3H4DA 3AVAA 5DQIA 4DF4A 3EY1A 4DSFA 3H5UA 5KG4A 1LWCA 1XWLA 4IG3A 3OYBA 1UA1A 5SZTA 5C42A 3MXIA 1LWCB 4IG3B 4NLYA 4NCBA 4DQPA 1QAIA 1D8YA 5C42B 2FJVA 1NKEA 1LWFB 3OJSA 3VQSA 2B6AA 1RDBA 1XC9A 2HHTA 1WSGA 4M3YA 3OYHA 3L2RA 2B6AB 5K14A 1QAJA 3LANA 1NKBA 1QS4A 3K5NA 2X6SA 1N6QA 1SKSA 4ED7A 2Z1JA 5K14B 3IAYA 2C2DA 4KKOA 4CGFA 1N6QB 4CEDA 5KFPA 4FJGA 1RDAA 2G8VA 4JLHA 4IRDA 4CJWA 2C28A 1S0OA 1RAJA 5L1JA 2J6TA 4KKOB 3IRXA 3V6JA 3L3VA 3RWUA 2GIRA 2D3ZA 4F3OA 3NHGA 4CIEA 2ASJA 3IRXB 3KK3A 2DY4A 1LW2A 3UQSA 4OGCA 4LH5A 1TK0A 2FVRA 2DFFA 3KK3B 3KLEA 1SV5A 1QUVA 1NHUA 1LW2B 3NF6A 2UVVA 3VQQA 3KLEB 1SV5B 4M95A 3C6UA 1TQLA 3KLHA 3QGIA 1RTDA 3CJ4A 1WSFA 1VSFA 3LALA 2PZSA 2HHQA 1SH2A 3C6UB 4O55A 4ZTJA 2EHGA 3DDKA 3KLHB 1RTDB 3BGRA 3FQLA 3V9WA 3AO1A 3PW5A 2DFEA 5KT2A 4DSLA 3OHAA 3BGRB 3TARA 3E51A 1HQEA 4ZPAA 3DLKA 5I3UB 3HXMA 2E6MA 4CE9A 1RT3B 3NGDA 1IKWA 4LQ9A 4FVMA 1UOCA 3DLKB 1LAWA 3AVCA 4XIUA 2VWJA 4CGIA 3PHEA 3HT3A 5F9LA 4ECTA 4FJ8A 1RT1A 3SQ1A 4YR3A 2WB4A 4IH6A 2D0CA 4FJXA 4N56A 1RT1B 4ZVEA 3RMBA 2QKBA 3UDLA 2J6SA 1W0HA 3F73A 2R2TA 3TQ1A 3MXMA 2IS3A 2BRLA 4CF1A 4W5OA 2P5GA 4OGEA 2D41A 4E3SA 1RYSA 2O4IA 1I3AA 4WYWA 4CJ4A 3OYKA 1VSIA 4O3OA 4CEQA 2W42A 4FLXA 4DU3A 4NYNA 3MR3A 3P1GA 4JS4A 1BCMA 4CGGA 2FJXA 4OLBA 2D5RA 4CHZA 1SL2A 5F9NA 5DGBA 1ZETA 4PQUA 5HP1A 4TN2A 2PYJA 2OPPB 4HYKA 2FLPA 3P5JA 1S97A 4PQUB 2B4JA 5HP1B 4YMEA 4ZPBA 5F8JA 3ULDA 1L3SA 1ZBUA 4KE5A 3UPFA 4F4YA 3HO1A 1SKRA 1ZBIA 4DLGA 4BE2A 4CJKA 4Z4GA 2OA8A 5KFQA 4CIFA 3KK1A 3NGIA 4XPCA 4W5TA 4CIGA 4EBDA 3NE6A 3KK1B 2KW4A 1BI4A 4B9UA 1TV6A 1D5AA 3OYEA 5JXSA 2DPJA 2RDIA 1JIHA 1BI4B 4FJ9A 1TV6B 4X2BA 3VQ4A 1S9GA 2FLNA 1UA0A 4R5PA 4URQU 1SH0A 4CJSA 5EWEA 1S9GB 2Z1IA 3CM5A 2HW3A 1JXEA 4R5PB 1VSKA 3QEIA 3CIZA 3MR5A 3GIIA 3RTVA 3DLRA 1TK5A 4CECA 4ELUA 3HL8A 1JKHB 2ILZA 1WAJA 4ELTA 4ZVGA 4HCBA 3MECA 1QQCA 1HYVA 4DL5A 4O4GB 3MECB 4Q8EA 3O3FA 2XRIA 2RN2A 3NF7A 3M8QA 4AHUA 3OL9A 2ILYA 4KPYA 3M8QB 5KFEA 3HVAA 3ICLA 3V9UA 3DYAA 5KFVA 4M94A 1KFDA 1XHXA 3T5LA 4ECZA 4AHVA 3MEGA 3B6PA 4N5SA 4FM0A 3DYAB 4F2SA 4QW9A 1S49A 2WONA 3MEGB 4E19A 4DL4A 2R8KA 4JV0A 4FJ5A 2WONB 1I6JA 5HRNA 3O3GA 4Z4IA 3BSNA 4O3SA 3KLFA 1NJZA 3VQ6A 4H4MA 4LSNA 1GOAA 3ZT4A 4DL6A 4KB7A 2FVPA 3RBDA 3KLFB 4H4MB 3M9NB 4LSNB 4AILC 4XO0A 3SFUA 3KHRA 1X1PA 1R0AB 4ZP7A 3PJXA 4I9LA 4OJRA 4FJKA 3V1OA 4OPKA 3T5KA 4TYAA 3BQ1A 1U45A 3O4QA 4FLVA 3I5CA 2CJQA 3CQ8A 4CJ3A 3DRRB 1RTJA 3OS0A 3KHHA 4CFDA 1C1BA 4JRQA 4R0EA 3CVKA 4EEYA 2HVHA 2ZD1A 4MKBA 1RTJB 3MF5A 1VSDA 3PV8A 2G8WA 4ZHRB 3T3FA 4Z4FA 1C1BB 4I7FB 2ZD1B 3E01A 3CJ0A 1JLEA 2IAJA 1RT5A 4G1QA 3KMSA 4ZP8A 5DMRA 4G3IA 3E01B 2OZSA 1O1WA 1JLEB 4OL8A 2IAJB 1RT5B 4G1QB 2DPIA 3A2FA 3CG7A 1LAVA 4F2RA 3OVNA 4ECSA 4QAGA 1EXQA 1GOCA 1BISA 3G0ZA 3OYJA 3TANA 2R2UA 2PY5A 4J2AA 3IG1A 5KG0A 2FJWA 3ZT3A 2QXFA 3VA3A 4LQ3A 3I5AA 1C1CA 3ISNC 3IG1B 4J9PA 1Q8IA 2WTFA 2ATLA 1IO2A 2NUBA 5JS1A 5EUHA 4JRPA 2YHBA 3V9SA 2RKIA 1Z26A 1L3UA 4CHQA 3OLBA 1HMVA 4B9TA 2RKIB 4DFKA 3PVXA 3GV5B 1JLBA 1LW0A 1HMVB 4M3RA 3LZIA 5DGAA 4F4KA 1JLBB 1LW0B 1BQMA 1S9FA 1TK8A 3RR8A 4ZP9A 4DL7A 5DG9A 4J2BA 3JSMA 4QW8A 4ID1A 1BQMB 3IGNA 2C2EA 3JSMB 2W8LA 3MFIA 3AVBA 5T7BA 4CHNA 1X9MA 1IM4A 2OPSA 3H2LA 2Y1IA 4IBNA 3DMJA 4KO0A 1NHVA 4DFJA 2OPSB 3S3OA 3L8BA 3AV9A 1HNIA 3QINA 3KOAA 4CFBA 3QZ7A 4ZPCA 3DMJB 4KO0B 2YNFA 4Q0BB 3LWLA 1HNIB 3SYZA 1KSPA 5KFKA 3M9OB 3ISND 1IKVA 2YNFB 1LV5A 1WSEA 3HPGA 5KFDA 3V6DB 2CKWA 3V6HA 1YTAA 1HPZB 4M3WA 4FZYA 2XI3A 3SPYA 3HP6A 3PW0A 4DTRA 3D5MA 4CEBA 3FQKA 4B08A 4CK3A 4Z4CA 4C8NA 4KHWA 3LP0A 5DQGA 1FK9A 3AA3A 2C22A 2R8HA 2HHVA 5KFJA 3KKSA 3O4NA 1RBSA 4CF9A 3HVRA 3LP0B 1FK9B 4K8ZA 1NK8A 1JLAA 2XO7A 5KFSA 4EYHB 4FJIA 1REVA 4DTNA 2P1JA 4J9KA 1S0MA 3Q8QB 1BIZA 3MTKA 1JLAB 5C25A 1N48A 4O3RA 3LWMA 1QSLA 1S1WA 3H08A 4M3XA 1IKYA 4WXWA 1REVB 1HNVA 3C6TA 5C25B 2AGPA 2GUIA 1S1WB 2HHUA 1IKYB 2IOCA 1T7PA 3FRZA 2AX0A 3C6TB 2JEJA 1EKEA 1RDDA 3TAGA 5J2PA 4ID5A 4WE1A 4FJJA 3P83D 1D1UA 3OY9A 1TP7A 3PW7A 5J2PB 4RNHA 1CZ9A 4ID5B 4WE1B 2V0NA 5CYMA 3BSAA 2XC9A 4ECQA 4EO8A 1SKWA 5CYMB 5HRSA 2QE5A 5J2QA 4IR9A 4EP4A 1RA6A 1WSJA 4KHSA 5EDWA 1B9DA 4HVJA 4Z4HA 4PY5A 5HRPA 1XR6A 5J2QB 4MKAA 1NK9A 3CJ5A 3DRPA 1QSSA 1RDCA 4NLQA 4N76A 3AA5X 3OYDA 1RA7A 2DFHA 3FDSA 2HNZA 3DRPB 3QO9B 3TABA 3DLGA 1LWFA 4IOBA 5SWMA 5CZ1A 2HNZB 4CGDA 1J5OA 5KG3A 4QOZB 2JEIA 4IR1A 3DLGB 3DRSA 1EETA 2UVRA 3SI6A 4DTSA 2FVCA 3CFOA 3NGYA 2X6NA 3TAQA 1J5OB 5D3GA 3DRSB 1EETB 1FXXA 1VSLA 3MR2A 4RZRA 3SFGA 5D3GB 1S48A 3I5BA 4Q8FA 4F8RA 1S4FA 3HSTB 5DLFA 4ED1A 1QSYA 2JEFA 4DSEA 3SI8A 3LPUA 4KRFA 4CGJA 3D45A 4CJ5A 3DOLA 2Z1GA 1D9DA 1BL3A 5KGWA 3G10A 3DOLB 1JX4A 3OSNA 4FK0A 4W5NA 2VG5A 3D28A 3PO5A 3VQAA 1NOZA 2HNDA 2VG5B 2GIQA 2XHBA 4I9QA 5DG8A 4K50A 4RUAA 3LP2A 1UWBA 2HNDB 4KSEB 2YKMA 4CERA 1U49A 5DQHA 3LP2B 1UWBB 4NLSA 3MFHA 5F8HA 4YNQA 4DSKA 2YKMB 1ZBFA 4MH8A 1C1AA 2R2RA 4H54A 1KHWA 3V81A 2ALZA 4H4OA 1NK0A 3V81B 5I3UA 3IGVA 4NLUA 1RT3A 2GV9A 2I5JA 4H4OB 2HAIA 4DWIA 5EWFA 2X74A 3M9MB 3DLHA 2I5JB 3SUQA 3RRHA 3DM2A 4CJTA 2XWYA 4L8RB 1JL2A 1VSMA 2WK4A 4MIAA 2OZMA 3VQ9A 4ZPDA 3DM2B 3OS2A 3C95A 3GILA 4F4ZA 3H5XA 1KTQA 1NOYA 4FLUA 3NGZA 3G86A 3ZT2A 3QIOA 3QEVA 1A5WA 3Q8PB 4F4WA 3I0RA 1S1VA 4FLTA 3HP9A 2D7SA 3ZT0A 3I0RB 1S1VB 2IM0A 3MEDA 4QPXA 5F8MA 1X9SA 4LSLA 3HPOA 1T03A 3BSCA 4J9OA 3MEDB 2LSNA 5C24A 4KFBA 4FK2A 3Q8SB 4LSLB 4O3PA 4AHSA 1T03B 1CSJA 1KFSA 3KNAA 4RNFA 5CY4A 4M3ZA 5C24B 4KFBB 1JLQA 1RCHA 2BQRA 2OPPA 4DFPA 3WNFA 2XCPA 1CZBA 1JLQB 4CK2A 2XCAA 4K8XA 5KFXA 2R8JA 1CXQA 3GIMA 2R2SA 3F9KA 1MU2A 4IFYA 2XI2A 3SQ2A 3OYGA 2O4GA 3PY8A 1MU2B 4IFYB 4ECYA 4ED8A 2W7OA 4TXSA 4J9MA 4CJEA 4ECRA 3NBPA 4KHYA 3Q8RB 5DK5A 2VA2A 1ITGA 4Z4EA 3ZSYA 4NLXA 3NBPB 3SUNA 3MEEA 5KG6A 3VQ5A 3V4IB 2UVUA 2HWIA 3H40A 3CDWA 3MEEB 4FS1A 3AVIA 2VA3A 1D9FA 3IN5A 1QTMA 3ALYA 5HROA 1KVBA 2X78A 4K4UA 4DLEA 3QIPB 3EZUA 1JKHA 4YQWA 1LWEA 5HROB 3CDEA 3N6LA 4OKKA 4RW6A 4IG0A 1LWEB 4NLOA 3HHKA 4Y2AA 4R8UA 1QE1A 4O4GA 5L1KA 3K5MA 3AVJA 4RW6B 2VWKA 4IG0B 1DTQA 2ASLA 4J9SA 4R8UB 1QE1B 4YR2A 4DG1A 1B92A 2JC1A 2BRKA 1TAQA 1DTQB 4B9SA 4DG1B 2E9ZA 4DSJA 3AA2A 3SUOA 1S9EA 2FBYA 3NF9A 3AA4A 3RRGA 2RDJA 1A5VA 3AO4A 3K2PA 4BE0A 4HUEA 4ED6A 1Z4UA 4B8AB 1NNDA 1RBTA 1WAFA 2G8FA 3AVFA 3SPZA 1S9EB 2IM1A 2XY5A 2IM3A 3SV4A 2P5OA 4TQSA 4E7JA 4CEEA 4RW4A 1TL3A 3L2WA 5KG5A 2FLLA 5JUMA 1KCFA 1L5UA 2UUWA 4DQIA 4TYBA 2AQ4A 4U7CA 4RW4B 1TL3B 3KHLA 3QERA 2C2RA 1WSIA 1W25A 4NZ0A 4RW9A 5DG7A 4E89A 3QLHA 4W5RA 4RW9B 3G6VA 5KT4A 1T3NA 2Z1HA 3KLIA 1Z25A 2R7YA 3QLHB 4ELVA 1R0AA 1VRUA 3KLIB 4NLWA 5KFGA 2JEGA 1EX4A 1VRUB 4BWJA 3NMAA 1RBUA 4BE1A 4CJVA 3QEPA 5L1LA 3OS1A 3D0PA 2QV6A 2PYLA 3O3HA 3FSIA 3DRRA 2OPRA 1RBRA 4WZMA 4CEAA 4GW6A 3KK2A 4KAZA 1VK0A 4DU4A 4DL2A 2OPRB 4ZHRA 3KK2B 2ITGA 3B6OA 4E7KA 2BDPA 4I7FA 4J2DA 4FK4A 4RNOA 4BDPA 4Y3CA 4KV8A 4EYIB 3RBEA 4ZMMA 3WNHA 1L3TA 1ZYQA 3NDKA 3WNGA 4KV8B 3T1AA 5KFOA 2YKNA 3N6MA 4KAIA 4CJPA 3SV3A 5HLFA 4LY7A 1ZBLA 2G8IA 2BE2B 5C5JA 1S10A 3QNOA 4M45A 2YKNB 4PUOA 2ZKUA 3C94A 3H59A 4KHNA 5HLFB 4Q45A 4PUOB 3S3MA 1C0TB 4E1NA 3DOKA 4B8CA 3BSOA 4KB1A 3OSPA 1F21A 3QYYA 1W9HA 3DOKB 1MMLA 2IA6A 1VSJA 1JXLA 3K57A 3GQCA 2W9AA 5HRRA 2HVIA 4DTXA 2OH2A 1K6YA 1KHVA 3EYZA 2AGOA 1ZTWA 3H5YA 4NCAA 4CK1A 2HHXA 2F8TA 2Q3SA 3SQ4A 4LH4A 4J2EA 3MR6A 4OKEA 3VQDA 3MAQA 4C8KA 3H4BA 4JUZA 3AVKA 3ZSXA 4FJNA 1HYZA 3RR7A 1S6QA 4FW2A 2XGPA 3OYLA 1TGOA 4CJRA 1TKZA 1T94A 4FXDA 1S6QB 2ATQA 2D0BA 4XPEA 3LPTA 1TKZB 5KGXA 4RNMA 4K4WA 4M3TA 3BREA 3QZ8A 4PA1A 1YT3A 3RAQA 4FJLA 2FBVA 4Q0BA 4KHUA 4WZQA 4GC7A 5KFUA 4K4VA 1C6VA 1HYSA 3VQEA 5KFRA 3V6DA 1J53A 2VG6A 4NRTA 4URGA 2V4RA 1SH3A 1HYSB 1HPZA 3ZSVA 5KT7A 1RYRA 3QESA 2VG6B 2ETJA 3UIQA 2G8UA 3N6NA 1SUQA 3KLGA 3NL0A 4CJFA 2HMIB 3QGGA 4KI4A 1SUQB 4FLZA 3KLGB 2WOMA 1S0NA 4DQSA 3RMCA 4DU1A 2KZMA 4MK7A 4FJMA 3KLVA 3U6FA 2WOMB 3MXJA 3BDPA 2KFNA 4OLAA 3SNNA 3KMQA 1Q9YA 2IDOA 4F4XA 4MQ3A 2IMWP 3H98A 3ZSZA 3NCIA 2XY8A 4MFBA 3BJYA 1VSEA 3KIOA 4MFBB 1S6PA 4AHTA
chains in the Genus database with same CATH superfamily
4RUCA 4K4XA 4J9NA 3D0HE 4PXEA 4F3TA 1RFQA 4OYZA 4NZ7A 2LLZA 3CMES 2NZCA 5L9NA 2F9DA 2KXNB 4JI4J 4RU9A 2FBTA 3ENQA 2NZTA 2YNHB 4ECWA 4FJ7A 4ZVSB 2HPUA 2NSCA 2MGZA 1KKHA 5F8IA 1NK4A 3IR6B 4LF5F 3RBXA 3D6FB 2EFVA 4CZHA 3QO9A 3KUHA 1IQZA 1TKDA 2EK1A 4NYFA 3VETA 4B3TF 5HL7L 4B3OA 3Q0AA 5D8HB 5GAEU 5CZVA 1Q79A 3ITHB 2HHHK 4U8VA 3NH1A 4GNIA 4E1MA 2COLA 4OV1A 5ETSA 3G8QA 1HQUB 2I6WA 2A3ZA 2Z30B 2B8QA 4DMNA 2AGQA 3VQ8A 5F8GA 1IKXB 1YITN 2M7SA 4ERDA 3W1YC 5KFMA 4RU2A 3VQPA 3V4MA 3JB9k 3P31A 4M5IA 3ZSWA 3MPDA 3LAKA 2HIYA 3CJ3A 3QT6A 3M6XA 3OYAA 2GQQA 2FB0A 2E5LK 3AXMA 4A61A 1NDCA 2Q1NA 3AO5A 1FDBA 3DLEA 3DFEA 2W9BA 2DHGA 3AVHA 3BKUA 4C9DA 5DDRC 5EU7A 2IYGA 4KGMA 1X0PA 4UOFA 1KVCA 4DR6J 5DO2A 1ZM3A 2KTQA 3CDUA 1U04A 4YR0A 3OYFA 2ZH2A 4J9RA 1BLUA 3HD2A 2B3TB 3UR0A 2F8SA 4P2MA 2CQ3A 1KQFB 3CCSS 1Q95G 2X1FA 1WLJA 5H9FK 2HS3A 3BEXA 1YRTA 1SC3B 3CXCM 1I51B 3TYTA 2ZH4A 3K7RA 3JQKA 1WSRA 4DR3J 1ZS6A 3KKRA 3DI6A 4GRSA 4GMJB 3TJ8A 1KQSR 1T8EA 2XWXA 3K2YA 3V1RA 4DJBA 4M5LA 4PL7A 2OEJA 2LQBA 2HK3A 1IKWB 4DFMA 3VAJA 3HI9A 4DV4J 2E4LA 5F3ZA 4HI2A 2A1SA 4HACA 4OZ3A 2D0AA 2ZUAA 1HJRA 3HK2A 4FCYA 1WHYA 3W62A 3POTA 1TMMA 2BQUA 2UUTA 2ZC3A 2GFFA 2QX0A 3FGUA 4DR6K 5B0DA 4WCEQ 5B0GA 5GAEP 1VSHA 4MJKA 4ISFA 4I2PA 1UEUA 2A42A 3BP8A 4K4TA 2M70A 4N7TA 3AJ2A 5KFBA 3QEWA 3OL6A 2ZKTA 4NA3A 4FF3A 5F8NA 3F41A 5A0YB 1XNRJ 3D3CJ 2VDIA 3V4IA 1NU0A 4CEFA 4UQGA 2FHJD 1NDKA 1TVRA 2QMUB 2LEPA 3IKMA 1N56A 3MN6A 1YDLA 2MXYA 2WHOA 2KXFA 3CPEA 3ULHA 1OSDA 2YNIA 3MM7A 5GADI 2HBJA 2J0XA 1JLGA 5DDPC 4LF4J 2MY7A 3TWHA 3TA0A 5KG1A 4NLCA 3K5LA 3PYFA 4DV4K 4EO6A 1JWWA 4IKFA 2DB1A 2XSFA 1R0CB 4BRMA 2F8MA 4KI6A 4IOXA 1JXBA 3HM9A 5B09A 4DTPA 3H42A 5KFLA 3ZSQA 4JAXA 4FZXC 4CZCA 2E2OA 4R25A 4TVAB 5M1NA 4ZS6A 4RW7A 3AAWB 3VGLA 5HO4A 2IGIA 5CHIA 1VAZA 2WW4A 3KJVA 4NLTA 3CCQS 4E7HA 3FFIB 3O6WA 1M0SA 3PACA 1CVJA 2IVNA 2OTJS 5KFWA 5I42A 3SCXA 2AWZA 4X84A 4DS5A 4CJLA 1WUUA 2FZGB 2NXNA 4WYLA 2OHDA 1O6XA 4FYDA 3CC7N 2V69A 1UJ5A 2MKJA 3V9XA 4JP8A 2HHPA 3SZ2A 1J2VA 4J9QA 3VEXA 4USVA 2R8GA 4A5AA 1S7HA 1S7IA 4TLQA 1GMUA 2Q0UA 2BR0A 1UL3A 2ZQBA 3QNNA 3DXSX 2W9CA 4FWOA 1S57A 2IM2A 3EGWB 4Y2MA 4CJ7A 4K4YA 4DV3F 1F5AA 4X65F 4GMKA 4DV6K 4QWCA 3CDBA 4P6QA 2DNLA 4ICLA 3VEWA 3SLCA 3PIPL 3P8BB 3P96A 4U7UD 5DETA 2E1CA 2NQPA 4HI1A 4RNNA 4IDHA 1VQYA 4PAAA 3D66A 3IS9B 2Q0RA 2B5JB 1DTTB 1YHQS 2HKEA 1K8AO 2CNOB 4KB0A 3H5SA 1C0TA 4B9MA 4CHPA 1RLCL 1SJFA 1YTUA 1B64A 4DUZJ 1FD8A 3CQXA 4BLGA 1U4BA 1XI1A 4QIGA 4HH1A 1VBZA 2BM0A 4ID8A 3HPHA 3GSDA 1XR5A 2YWGA 1FNMA 1XTZA 4K42A 1BQNB 3HVTB 1MG7A 4AQYJ 3MWBA 1E4FT 4E7LA 1NK6A 3PX6A 3VQ7A 3DLJA 4X66K 4NCGA 3WXIA 2CQ2A 1F3VA 5H9EJ 1XNQF 2IIHA 4P7VA 3LZJA 1ZH5A 4CCHA 2B4OA 1HBUA 1TKXB 2OO4A 4N77A 3BF4A 1EX8A 4QJVA 4IDKA 4DUTA 2F4FA 3OYCA 1N5VA 3U1MA 3DXMA 5B7WA 3D1QA 2F8HA 2DEIA 3VQCA 4GC6A 3PW2A 3BQ0A 4DUZK 4UOGA 1NPKA 2E2NA 2IY5B 1XMQJ 4QWDA 1MA9B 3MM8A 2KI2A 3OTOJ 2HMIA 3DRYA 2WC9A 3K5PA 4AHCA 2ATCB 1YIJS 5J1EA 1V3SA 2Z8QA 4NL5A 3B82A 4AQYK 4TY9A 5IWAF 3F0NA 4A48A 4GKKK 4DL0C 4UY8T 1SQEA 2P9IB 1NJWA 3SXLA 3RB4A 2FF6A 2JWKA 3KZBA 2CQPA 4JD2B 3M30B 4ILMA 1WG5A 1NAQA 4F3MA 1H38A 4X62F 2KVQE 3CUNA 5H9EK 1VC6A 4JN4A 4O0IA 1YI2N 1RHKB 3OJUA 3D1OA 4OI6A 5RUBA 3TAMB 4ECUA 4C3LA 4PWDA 3IUCA 3AFGA 2ABYA 3WT0A 4CH0S 4QBUA 4YFUA 4J5OA 1RWXB 4B3SF 4M5GA 1RCOB 1AA1B 4TKTA 1S1TA 5GMDA 3N5FA 3NY0A 2G8HA 4EUVA 4FL9A 2F4VJ 1JLCA 4C11B 4FWSA 4BACA 1TL1B 5KT6A 1RT2A 2CPJA 3AOAA 3C7NA 1XMQK 4OLPA 3MM5B 5L1IA 3D2EB 2AZ1A 5J2MA 4CJUA 3VGTA 5FLXY 1IH7A 1HD0A 3NS6A 1KOHA 5F8LA 2PIIA 2M52A 2W4PA 2E7XA 3CPWR 5CYQB 1M5KC 2FJDB 1AUDA 3BPDA 2XO6A 4DF4A 3CCJS 4FN5A 2H3EB 1LWCA 3HZGA 4IG3A 1UA1A 3MXIA 3Q8UA 3UE2A 2AZ3A 4LF6F 3VQSA 1IWAA 4WP8A 2APOA 2CPHA 3OYHA 3GJQB 3MMAA 1Y3JA 3EE9A 1QAJA 2RUSA 1NKBA 2VZ9A 1ZBTA 2ASYA 5K14B 4PR6A 2PMWA 3VCDA 1N6QB 3M32B 1RDAA 2G8VA 4BRFA 4CJWA 5LXYA 2C28A 1QTNB 1RAJA 2J6TA 4KKOB 3L3VA 2DGWA 2D3ZA 3NHGA 4B1XB 2ZBPA 3UQSA 1WEZA 3QRPA 4FOIA 3BUZB 2F40A 1WG4A 4J9UE 1SV5A 1F9HA 2BJ9A 3NF6A 2XS7A 3QT5A 4M5JA 3S8SA 4AL6A 3C6UA 4DUYK 1TQLA 2O8EB 1RTDA 4RX6A 3A8IA 4ZTJA 3AO1A 2DFEA 3MM6A 1SBRA 3BGRB 3O08A 2YPZA 3VAHA 1OPZA 5AQSA 2CIMA 3DLKA 2FJBB 2E6MA 1DKGD 4CE9A 2W1BA 1AROP 2WBNA 2BW2A 2QWRA 3AVCA 2KH9A 1IQTA 2VWJA 3PHEA 3HT3A 1IBMK 2HFZA 1KQKA 5F9LA 3DLLQ 4ECTA 2NRWA 2MQ8A 4YR3A 2RQKA 2WB4A 3O9TA 2JJ4D 4IH6A 1Y7PA 5D0EA 1RT1B 4ZVEA 2BVZA 2CYYA 4KIAA 1V6HA 1W0HA 4CLLA 4GVEA 3AB2B 3ENAA 3F73A 4X4QA 4B3RF 2CPXA 3MXMA 1ICEB 3VV2B 2ZH1A 4QS7A 5K5MA 4OGEA 3L4IA 4IOCQ 1QY7A 2P9LA 1Y11A 2GMHA 1I3AA 4H0TB 4CJ4A 3C14B 1DARA 1FJ7A 3ZTQA 5I9EB 4BC2A 3K9KA 3R5DA 4NXMK 1PC5A 4CGGA 4LBHA 2FJXA 4QU6A 5HP1A 5K8OA 1BY9A 2XMMA 2B4JA 2QXLA 1OQ6A 3T1HJ 2A1BA 5IC4B 3W0LA 1RWNB 1ZBUA 2CDQA 1SC1B 2GHVC 4EWTA 4BE2A 4DV0K 2OA8A 1U1LA 3NGIA 1S99A 2ZH3A 3EVWA 3OW2M 3R8YA 2VV5A 4UTGA 4X4RA 3CJ7A 3DLLL 1TV6A 2ZZNA 5ADZA 3DXKB 2NYIA 3OYEA 4FWMA 4FJ9A 3VQ4A 2FLNA 1JJCB 3MPWA 4OZJA 4EIAA 4MT1A 4R5PA 1SH0A 3EGZA 5A8KA 3GTYX 4NYPA 5A2QY 2Z1IA 4IO8A 1JXEA 2QWOA 3OR2A 3MR5A 4OFZA 3GIIA 2V4JA 5AQWA 2JL9A 4CECA 3VVTA 1YRUA 4ELUA 1B4SA 2NSBA 4RTFD 2ZHBA 3VAKA 4ZVGA 1JJHA 2KG1A 1QQCA 1HYVA 3CW2C 4DL5A 1IR2A 5C15A 3H1VX 2KDOA 3MECB 3HHEA 1R0BG 4H0OA 1TL7B 3EO3A 4JI2J 2XRIA 1U02A 2PO4A 1GTHA 4NA2A 4B3MK 3KG1A 2I7PA 2DR6A 3M8QB 1NPRA 3VGMA 3J7ZT 1RKJA 3BO4A 3DYAA 5KFVA 2FLOA 4M94A 2X7IA 1XHXA 4I6YA 1WF0A 2YQ1A 2AEJA 1I94J 2WONA 3SCKE 2D1KA 2A6MA 3MEGB 4DL4A 3OTCA 5HRNA 5LMUK 2V51B 1XMOJ 4Z4IA 3VQ6A 1GOAA 4DL6A 1ELOA 4KB7A 4X4VA 1K9MO 2ASPA 2NRRA 3ULEB 4XO0A 4JI7J 3KHRA 2ADBA 4FWQA 4LR7A 3M2RB 1R0AB 1YJ9N 3WX8A 4I9LA 4FJKA 3FVYA 5AZIB 1O8BA 4C0OC 4TYAA 3CTRA 3O4QA 3I5CA 4U95A 3HLUA 2CJQA 3HBTA 5E3PA 3J7AN 4R0EA 5LMNF 2XSJB 2HVHA 3MF5A 4IYQA 1VSDA 3ENWA 3T3FA 1OSCA 1C1BB 3H3NO 4YUDA 3TTFA 1RHRB 3IAM9 1JLEA 1NMEB 4ZP8A 3E01B 4LR8A 4OL8A 1RT5B 2NR0A 3GZ7A 1HWLA 3OD2A 2DPIA 3R27A 3A2FA 3CG7A 2OUGA 4K7QA 4ECSA 1GOCA 5ETQA 4DV7J 1I94K 3G0ZA 2NRXA 3OYJA 2Q97A 3TANA 4ZVOB 1P9QC 4O8UA 4NMXA 1WOPA 1NZ8A 3ISNC 3EDQB 3L3CA 1KVKA 2FDNA 3R7NB 4QIVA 3K89A 4MYUA 4TNOA 2ROEA 3MCOA 4XDDA 1NCLA 1HNZF 2QW9A 3V9SA 1L3UA 3K17A 1WC1A 1R27B 5FPEA 3ISZA 1HMVA 5I3PA 4DR1J 4TU7A 1JLBA 2Y1RI 2YX1A 4LIRA 4U96A 4F4KA 8ATCB 3RR8A 3U27A 2KO1A 3JSMA 1VQ8S 3BN4A 3G4SS 1Q86O 4EHTA 1OYEA 4P72A 2BKPA 1NMNA 4ZPWR 3PRDA 5T7BA 2DXEA 1X9MA 2P9NB 4AFFA 1U6FA 4IBNA 5AE2A 1IJEB 3DMJA 4KO0A 2J9EA 4FXVA 4JI5F 1HNIA 3WZ0A 3QZ7A 4DV7K 4ZVQB 1QHAA 4AD6A 1FXDA 3HX9A 4A4JA 3M9OB 2AP1A 2DNNA 1HLUA 1N33F 1WOSA 3S01A 3AD7C 3AQPA 4H0YB 4DV5K 5KOXA 3MMVA 4FZYA 1QLNA 2RE2A 3SPYA 3PW0A 2FY8A 3D5MA 1VISA 2AJFE 1FX2A 4B08A 4OI0A 4PG6A 4C8NA 5ETVA 1FK9A 3VOVA 1DQ9A 1QZ6A 2CH6A 2QLFB 4CF9A 4DR1K 2BACA 3LP0B 4DCOB 4K8ZA 3W5ZA 4PCQA 3CIMA 5KFSA 4EK2A 2CQHA 1REVA 1VJQA 4J9KA 1H2TZ 1RWOB 3FKBA 3W2VB 3MTKA 2B9XA 2ADCA 3O9RA 4O3RA 1S1WA 1SXLA 4F9OA 1T3VA 4JI3F 2DBBA 3KVGA 4M1KA 3O44A 2KKHA 4L3KA 4HWIA 3MPVA 5J2PA 4S0MA 4ID5A 1HKAA 2J7WA 2LVWA 1D1UA 3S6EA 1XQIA 4P73A 2ZGYA 2V0NA 3BO2A 1XMBA 5IFMA 3UCGA 3JTOA 2QWMA 5F0WA 4QR0A 4Y2KA 3BGLA 1X3MA 1VIOA 4IR9A 2HLUA 1RA6A 3NLCA 4KHSA 2HBLA 4HVJA 4PY5A 4C3MA 2MGZB 3K9JA 3DRPA 5GINA 1S22A 4NLQA 3NMUA 3OYDA 3QO9B 2WTUA 3DLGA 1HR0K 1LWFA 4IOBA 2HNZB 1SJRA 3IRWP 3CCLN 4DOZA 2YPYA 4QOZB 4DTSA 2KXHA 3NGYA 1NJIT 4KHPF 3TAQA 3SCIE 1J5OB 3VWSA 3DRSB 3HJVA 2G9OA 1IUJA 2OKQA 1VSLA 2WAQD 3R1HA 4JEPA 2F9WA 2UXBJ 1UWAA 4HDGA 2I7NA 2DEJA 1S4FA 2YHWA 3B8HA 3HSTB 2EG2A 1BUPA 3HZEA 2FJAB 3W65A 4ES3A 4DSEA 2QA1A 1LNQA 4A8KA 2UUBK 4USTA 3DOLA 3BB5A 2MZ1A 1D9DA 2Z1GA 2BJ8A 1BL3A 3FCHA 5KGWA 1ZAWA 1JX4A 1ESVA 2K1RB 2GA7A 2UXCK 3KG0A 3TTCA 3VPZA 1NOZA 4WP3A 2ZEJA 4TU8A 4BC5A 2CQDA 3ZZ0A 1HJOA 2LDIA 4ZITA 2NS1B 4JI6J 1SQKA 5HOOA 4NLSA 5F8HA 4U7UK 3IM8A 1RHMB 1C1AA 3QB0A 4YY3J 4H54A 3V81A 2WVBA 1LXNA 2XBPA 2VFTA 1X0FA 4LFAK 3NGUA 5I3UA 3IGVA 1RT3A 3KWMA 3VHQA 4H4OB 2HAIA 2W2MP 5D0HA 3RRHA 2J0QD 2YCHA 3O9QA 4FF4A 2CVIA 2OZMA 3OS2A 3GILA 4F4ZA 5KQ8A 1Y00A 2DKOB 3G86A 3NGZA 3AY0A 3LF0A 3ZT2A 1A5WA 3KUGA 1SJQA 2HQDA 3ZC4A 2UUCJ 5A76A 1S1VB 5E33A 5F8MA 3ETMA 5K8MA 5MLCV 5BREA 3LW5C 2VQEK 1T03A 4DQ8A 4X4NA 2LECA 4KFBA 4FK2A 4LSLB 1HLWA 5B0CA 1CSJA 5CY4A 3HI0A 1Z1ZA 3KWGA 1JLQA 3SDEB 4DFPA 2FGOA 2QN6B 3TJAA 3POTB 3UDEA 2XCPA 1EQ0A 4K8XA 2HGNA 1CXQA 6FDRA 2Q2RA 1GMWD 1LK7A 3IBWA 2FHOB 2XI2A 3FJ2A 1F9EB 3OYGA 1MWKA 1N0VC 1MU2B 4IFYB 3MMJA 3ZZZA 3NBPA 3Q8RB 5DK5A 5IZHA 2VA2A 1ITGA 1KWMA 2VC1A 4CQ1A 3ZSYA 2XQCA 4FZVA 3MEEA 2E44A 2MMYA 2JLGA 2UZAA 3V4IB 3MXHP 4MDAA 2YY3A 4CWBA 1ZZFA 3CDWA 4JV5J 3W60A 3H0PA 2J9DA 5AQIA 1IM6A 4BQLA 1AFIA 5HROA 2X78A 4E1JA 3FZFA 4K2JA 4DLEA 4E98A 2CJAA 2ZZMA 3CT9A 1JKHA 4DPOA 3MM7B 4UQTA 1S76D 1NSKL 2CPZA 4M5MA 1FFSB 2HFOA 3WBZA 5AQGA 4RW6B 2VWKA 2JX2A 4M5DA 5G4DA 3UFCX 3T7ZA 4LUBA 1TAQA 4ZOSA 4EMDA 3QDKA 5AQKA 4DG1B 4DSJA 3SUOA 4KGZB 3IWNC 2FBYA 5AXKA 3NF9A 2KFYA 3AA4A 2GVZB 3RRGA 4JI4F 3J7YI 1A5VA 4BE0A 3W8PA 4B8AB 1RBTA 1RDUA 1IJJA 1JJ2M 3CCMS 2XY5A 2IYIA 3SV4A 3SJHA 3PTWA 2MLZA 3SK3A 4OMFG 3QPIA 4E7JA 4CEEA 1VK3A 4RW4A 4MLHA 3HSCA 3L2WA 4DQIA 2D69A 2UUWA 1KCFA 3D7SB 4B02A 1A0OB 2CAJA 1ZA2B 3T9ZA 5BPMA 3A8YA 2WBMA 1HWUA 4FPBA 3U1NA 4RW9B 1WB9A 3G6VA 3CMEN 5IM0B 4H5VA 3I55N 4EU0A 3HFVA 1G4CA 1VRUA 2ROPA 4BWJA 3H1QA 1RBUA 4A8FA 2HURA 3NGTA 1HNXF 4CJVA 2M9KA 2MEWA 2QV6A 3O3HA 2KKZA 1FWLA 4WZMA 1T44A 3KK2A 4KAZA 1Q8LA 1VK0A 3ADAC 2M5YA 2BW7A 2ITGA 4E7KA 3WUHA 4I7FA 2MHNA 1VQPS 4FK4A 2EFPA 4Y3CA 5CCMA 4ZMMA 1G7CB 1NBEB 4KV8B 3T1AA 3I4PA 1URNA 4FDFA 3TTDA 2CQBA 2MZJA 3MHYA 2YKNA 1E6VA 5AQHA 4RBVA 2V8DA 3QNOA 1UVIA 4DR6F 3H59A 4KHNA 5HLFB 3Q24A 1W97L 4Q45A 2H54B 2QLBB 4ZVPB 2RMLA 4H5RA 2DTJA 1C0TB 4GKJK 3H90A 1IBKK 3R97A 4PKHA 5A8RB 2ZWOA 3HHLC 2UV8A 1VQ7S 1NBWA 1W9HA 4G1PA 1JXLA 1KHVA 2PE8A 2HK2A 3TU5A 1RAIB 1ZTWA 5K8NA 5FPMA 2HHXA 4O8KA 2Q3SA 4DR3F 3MR6A 3VQDA 1QAYA 1VOMA 2LQ9A 4BY9C 2EFQA 3H4BA 1KAXA 4FPAA 3ZSXA 3HF5A 3ID6A 4YOTA 3MUVP 2J9DE 1EJ7L 1VI7A 3PRBA 4YDUA 3RR7A 5AZJA 1H2UX 1NZAA 4M8LA 2XGPA 1DQ8A 2YKQA 4QYZK 2XMUA 3GPAA 1U25A 3C6HA 1S6QB 4XPEA 2CQCA 4JHDA 3CCSN 1MLAA 1R8PA 4P2XA 5KGXA 2YH0A 4RNMA 4K4WA 4GVBA 5JMVA 2BKOA 3BREA 3QZ8A 3G71S 3OXFA 3CJ1A 3LPYA 4FJLA 4CNYA 3P38A 2FBVA 3AD8C 3T1YJ 4GC7A 3TRGA 3IWLA 4ETZA 1FCAA 2RRBA 3VQEA 2RB7A 5KFRA 2XMKA 1GLFO 1NXIA 1DJ0A 2VG6A 4NRTA 2XMTA 2MKKA 1HYSB 1HPZA 3ZSVA 5KT7A 3QESA 5TKYA 4CJFA 2WB1D 2HMIB 1SUQB 3KLGB 3QWPA 1XNRF 4I6WA 2WOMA 4DQSA 3OBWA 4QOTA 3CCVS 1Q18A 4BCAA 3BDPA 3SNNA 1TMJA 3KMQA 4F4XA 2VGNA 1BHNA 1GLCG 1U1KA 3MUTP 2VDHA 2IMWP 3ZSZA 1HHTP 2UXDJ 1TYQB 2OFHX 5LSOA 3K0JA 5M1PA 3NCIA 5DRKA 4LF4F 5EGYA 3BJYA 3ENOA 4MFBB 2E2QA 2Z2LA 2PMZD 3WC0A 2DNGA 3LDOA 4FPIA 2D3O1 2R3VA 2VBZA 2ZE2B 3AVLA 3TVKA 2YNHA 3O8MA 5F0UA 5ADXA 2MZRA 3B6BA 1P1TA 2CUYA 1QQNA 1F60B 3RW6A 4QWAA 1R31A 2DT9A 1NDPA 1RWKB 3MX2A 2FHKA 5KFFA 3VEVA 1GOBA 4CFAA 3CMQA 4CLUA 3MD1A 1WHVA 5KG7A 3C7NB 4KTWA 1EQYA 1VQ5S 3TZWA 3O3LA 5FIIA 4OI3A 2HF3A 2BUPA 3ITHA 3GYNA 1PJ6A 3SSRA 2WVEA 2WFBA 4DHVA 3VGSA 4LRFA 1B99A 1CJTB 3CPWM 2GBZA 1HQUA 1SI9A 3VMFB 5FJ4A 2HFSA 2QM1A 4RW8B 1HNWJ 1IKXA 4IKAA 1JCEA 1Q8BA 1N5YB 3NNAA 3PSFA 4KH5A 3AOCA 2O67A 3PR5B 4ZN3A 3AO2A 4OQJA 2N3OA 3VGKA 4OZLA 3TUPA 2BJEA 2OIHA 1IBLK 1RTZA 9ATCB 1KVIA 4F0KA 1IJFB 4CLKA 1X5OA 3RW7A 3ZSOA 4ZJQA 4WFNQ 3JS6A 5D15A 2QL7B 2R42A 2AJ0A 4CZEA 4DX7A 5AQOA 1OH5A 4MIBA 1WHXA 1X9WA 4HKQA 4WTYA 1RT6B 2RF2B 3JQMA 4FO0A 4ZA1A 4DUZF 3HKWA 3EPIA 3FR0A 1SL1A 5M2PA 3BV8A 1U1RA 5M2RA 2BJ1A 4DX8H 1ASVA 3U3GA 3QFHA 4BG9A 4DTMA 1SAZA 4Y1DA 4IO9Q 5HBMB 3OYMA 4AQYF 2P51A 1RTHB 3MPYA 3R8EA 4G1IA 4J8FA 4MK8A 5LJWA 3L3UA 1VRTB 1MROB 1EP4B 3OL8A 2EG1A 3TR5A 3CQYA 4N41A 5FLXO 1YHQN 3CCWA 4YB1P 4Q5VA 4JI8K 3I8DA 3AO3A 2CQ4A 2DITA 3A5NC 4ZVRB 2FC0A 4CFCA 4ES1A 3RB0A 2BEFA 3EZOA 8AT1B 2ASDA 4JS5A 2HHWA 4LFCJ 2D3UA 2QMWA 3J81j 3UNGC 4JYAJ 3AT1B 3SMZA 1HI0P 5EWGA 2FVQA 4PYDA 3E8OA 4WFNL 1S4EA 2GELA 4ETXA 4NLDA 3LP1B 5FRNA 3HSJA 3TEHB 1NSPA 2BX6A 1RE1B 2RSQA 1U6BA 4FM2A 2A6AA 4KBOA 2J6UA 3M8ZA 2ZJRQ 1XMQF 1K73O 5A0YA 2HFVA 3OTOF 1RGIA 3KNGA 1U26A 2UU9K 2KQ2A 4IO9L 2QYCA 3DN9A 4RBUA 2LFVA 1Q86T 5HVGA 5E41A 2MZTA 3THYB 2DGQA 2HRTA 1Y5LB 2RE1A 3QIPA 3PYDA 5F1XA 2FSJA 1RNHA 5L46A 3PUFA 4NLPA 4DL3A 3LM9A 2ALYB 5HATA 1BMQB 1TKTB 3X3UA 1QQMA 4LREA 5FDLB 4GO7X 5MLCQ 2W6LA 2OEMA 1C2PA 2XS2A 2MLYA 4LFCK 1DZ5A 5KOWA 4JYAK 1DLOB 1GH8A 3OBYA 1YIJN 3GFXA 4C8LA 2Z0GA 2A18A 3Q23A 5E5NA 2JGUA 1KLMB 1Y10A 3V6KA 4OPJA 1UEVA 4OJGA 2FD2A 3UD4P 3IBFB 4DR4K 4HCCA 3MDQA 1Z2LA 1KAYA 2DTUA 2DR5A 2F4VF 1SZ2A 2QI2A 3FFIA 2E6LA 4P2SA 2IC3B 5AE1A 4GVMA 1RP5A 2ZJRL 4ED5A 4O4RA 3RMDA 1ZM4A 4CD3A 1J27A 1TZ0A 5EVZA 4OVLA 2XNRA 1UEKA 2DR7A 4DEZA 1UVJA 2IVOA 5CD4A 2ZWHA 4JI1K 3HOSA 1S6UA 3VEOA 4U67Q 4K2XA 1RDRA 3CYMA 3A3OB 2NRTA 4C6AA 2MQNA 3E2EA 3H46O 3S1TA 2G1HA 1BCOA 5ADXH 3SIPB 5D0GA 3M2UA 2EFGA 1B7FA 4YOUA 3UN3A 2YKPA 1U2VB 1VRQC 2CPFA 4P74A 5E2QA 1C4AA 2KYXA 1WJ9A 4M42A 4O44B 3D67A 3Q7CA 2W7PA 3M6VA 4CF8A 2XY7A 1T95A 1Y64A 1U2CA 3R7SB 5IT4A 4Y2CA 5K20B 2MDAA 1TAUA 2Z58B 4O3QA 1NGIA 3SCJE 1M5VC 3IS9A 2B5JA 1DTTA 3R5CA 1U8SA 1X4FA 4ZLPA 1FD2A 3DDIA 4OHXA 4P7TA 1BO5O 2C3PA 1WF2A 3RB6A 2IJFA 3TI0A 3BGUA 4NE9C 4X4UA 2Q3PA 4KREA 3BBCA 5A2QO 3QETA 1BQNA 1N4LA 3HVTA 1A5XA 4Y1CA 5DLGA 4I1TA 1X4DA 4FW1A 2HMPA 5IC6B 4BR5A 3FGVA 4AYBD 2HVEA 1EIYB 4H8KA 2U2FA 4JV2A 5KFZA 3VN5A 2BTFA 2P6SA 4Y65A 1U47A 4IRCA 1Q53A 2KFZA 1TKXA 4KH4A 2HGLA 4E7IA 3R1XA 5AQJA 4J91A 5CQGA 5JS2A 3CJKB 1YG0A 4IH5A 1G99A 2XHWA 4DV2J 1QAXA 3RVCA 1V5VA 3TA1A 3CJ2A 2O5DA 2EW9A 3PIOQ 1WELA 3TWZA 5AQLA 4LSZB 4RL1A 2E1AA 3KJNB 2F7VA 3OHBA 1KXPA 5BYQA 4A8WA 3CD7A 3AAQA 2VBYA 2OLWA 3VAGA 5LJ5Y 4U7BA 4W92B 3V9ZA 2MQQA 2AX1A 3QIDA 1K1QA 2WVFA 3ASMA 3T1HF 4JD2A 3M30A 2R7SA 3H2UB 3HRGA 1FO1A 4F0MA 4DF8A 1RILA 1YZ7A 3TAMA 3M5RA 2C3UA 4BC7A 5A8WB 4X64K 4KTZA 2QSWA 4DR7J 1YJWN 4ZN1A 4LVOP 4C7QA 3IM9A 3NS5A 2XMAA 2G2YA 3HT0A 1HARA 2DK2A 4ILRA 3Q22A 5KG2A 1BDGA 2WUSA 3PIOL 4PPDA 3P49B 2PAVA 4C11A 3FRYA 2IJRA 1TL1A 3UD5A 3O9UA 3PX0A 4EZ9A 2H5JB 3TZYA 3CWJA 4EBCA 3MM5A 2KT5A 2YWKA 3AVGA 4ED2A 2YHAA 3AAPA 1WUAA 4K0KJ 3Q2SC 2XTJP 3BBBA 2DGOA 3GONA 5DM6Q 4DTUA 4AHRA 3R9LA 2KJWA 4F0HA 2DO0A 2OELA 3TAEA 3W5YA 4JI2F 3NAHA 1U7LA 4UY85 3CETA 3NAIA 3L2QA 5CYQA 3KDNA 2V94A 3M8PB 1S1UA 5BJRA 1BIUA 4TY8B 4B9NA 2OMOA 3AVAA 3H4DA 4Y6IA 5DQIA 2ZBQA 5IV3A 1GQEA 4OYWA 2E5HA 2HLTA 3WXLA 4PABA 2IIRA 1I94F 2D1CA 2IVPA 2C42A 1VLOA 4NCBA 3ENVA 5C42B 3CC4S 1XMOF 2X1GA 4RWXA 2G13A 1LWFB 3ET6B 1RDBA 3AARA 1RHJB 1YLXA 1PKUA 1WC5A 2VKZG 2B6AB 5C0YA 5K14A 2I0XA 4JI7F 2Y8WA 3LANA 1NGCA 1QS4A 2X6SA 3ZZTA 1N6QA 4ILHA 3M32A 4OYMA 1AZSB 3IAYA 2LEAA 4KKOA 2PC6A 5J1NA 4JLHA 5CH7B 2QEXS 2Q79A 3BY5A 3BN7A 1S0OA 3LGNA 4CVNE 5DM6L 2DYAA 3CD0A 1T6CA 2E8AA 4CIEA 4BRGA 1J5EJ 2ASJA 5IT9O 1S77D 2ZH9A 4OGCA 1TK0A 2NRVA 2PFDA 4YOVA 3KK3B 3LO3A 1QUVA 3TSPA 1OY6A 2BE9B 2O8EA 2ZVSA 1M5HA 2EWHA 2UVVA 1D3WA 2DHXA 1CG2A 4JI0J 3QGIA 1SJ1A 3CJ4A 1WSFA 3UD3P 4BVOA 3G82B 4O55A 3BGOP 3KLHB 3BGRA 2VIHA 5KT2A 4DV7F 4DSLA 3OHAA 4QS8A 2KL8A 3TARA 3L7PA 4DR2J 1S59A 4BR2A 5BR8J 3E51A 1HQEA 3MN7A 5KPTA 1HL6A 5I3UB 2V8PA 2QWPA 5AQNA 3J7AP 1RT3B 3AQOA 3NGDA 5HN0A 4USJC 4LQ9A 3MN5A 1CC8A 1LAWA 3BO3A 2O1PA 4USIA 4FJ8A 1RT1A 1VQ9N 1F9FA 1W7WA 3J80O 4N56A 3KFWX 4B1WB 3D6HB 4DR1F 2J6SA 1Q5VA 2R2TA 3TQ1A 2BRLA 4CF1A 4W5OA 3CJQA 3PLAA 2DRDA 3C14A 4ZJOA 3MAAB 4E3SA 1KQGB 2O4IA 4NXNF 2OJ3A 2Y1LB 2UUAJ 4XDCA 1U1OA 1BQXA 3NEKA 3EE3A 4JS4A 1BCMA 3CHWA 4CHZA 1ZPVA 2K8GA 5DGBA 1ZETA 4TN2A 2PYJA 4HYKA 1S97A 2ZM6J 4YMEA 1BG3A 3ULDA 4G65A 1T11A 2KM8C 4KE5A 4LRBA 1VIXA 2YJEA 1S79A 1VQ8N 3G4SN 1FJEB 2ZBCA 3MN9A 4Y0FA 3D6RA 4M5KA 3P5BP 3DXKA 3NE6A 2V6AA 5E0OA 2KW4A 1VFJA 3LQVA 3VERA 3JS9A 1FJGJ 2DPJA 3FZBA 1UA0A 1X7VA 3CIPA 1IN0A 3M2VB 3QAEA 4HTJA 2VFRA 1S9GB 3BZKA 2U1AA 1VSKA 3GFHA 2W7AA 3CIZA 3RTVA 1QUPA 3DLRA 1JKHB 3V2UC 4JBCA 4H5TA 2O8BB 3MECA 1B0TA 1N8RO 1MMDA 1FRKA 1J6ZA 1HIYA 1V4TA 2RN2A 3HOTA 3NF7A 4LRDA 3M8QA 4AHUA 4B3TJ 1RAFB 1RAOA 1WD6A 3VTIA 3OVBA 4DZDA 4Z37A 1GT8A 5M2UA 3HDSA 3A8KA 2IDEA 3T5LA 1UVNA 4AHVA 3MEGA 3B6PA 4FM0A 4F2SA 3NGKA 3CULA 1S49A 2IHR1 3A5OC 3ZZUA 4FJ5A 4XH4A 4ENOA 1I6JA 4Q2LA 2DNKA 3O3GA 4OYPA 4YS2A 1FJGK 3BSNA 5G0RB 1SIZA 5AQVA 1U1MA 1P9YA 3RBDA 2BOPA 3KLFB 3KUEA 2LQ8A 4H4MB 4LSNB 3QSYB 3M2RA 3UKRB 5BRHA 4IEEA 3HULA 3G96A 2F7TA 5AZIA 2DY1A 2UXBF 3ZZYA 4CO1A 2WBRA 1MMNA 3BQ1A 4FLVA 5SUHA 1FEHA 4KQZA 2XSJA 4PL8A 1MSWD 4CFDA 1C1BA 4LF5K 1S72N 3CD5A 3MR7A 1X5SA 3PV8A 2JWLA 1LFPA 4Z4FA 3J7Z5 4I7FB 3H45C 1BD6A 2ZD1B 2DNRA 4LF7J 3E01A 2D0PA 3CJ0A 4B3TK 1RT5A 3QSIA 3M05A 5DMRA 4G3IA 3CCES 2IAJB 2C2NA 4G1QB 1PYSB 4JI6F 1N34J 1LAVA 4F2RA 1N36J 4WF9Q 3OVNA 4QAGA 4RO0A 4WQ4C 1BISA 2FZKB 2MJUA 2PY5A 4OI4A 4I56A 2P5VA 4YY3F 2FJWA 2QXFA 1MNEA 1MWQA 3VA3A 3SAHA 1ZAXA 1Z6RA 2Y8YA 3ETOA 3WX4A 1Q8IA 4LF9J 5AJ3J 1H3DA 4TU9A 4JK7A 2R7XA 3SMSA 5EUHA 4DV1J 4JRPA 3F44A 1A9NB 1KEKA 1DQAA 4B9TA 2RKIB 1EKSA 3BDEA 5D4PA 5D6GA 4DFKA 3IAS9 4Y28C 1P1LA 2YX7A 3LZIA 4F25A 3I6PA 4Z2XA 2OCEA 5CABA 4ZP9A 1WI6A 1CJUB 4DL7A 5DG9A 2ZGZA 2GO8A 4ZJLA 4C1NI 2OGUA 1ITPA 2ITMA 1BQMB 2UUCF 2J4RA 4ZVUB 2JVOA 4CZIA 2AYMA 2P9NA 4H4KA 4Y2IA 2W8LA 4LF7K 2LXUA 4CHNA 3VTHA 1IM4A 3RSEB 2H5IB 2Y1IA 3RUBL 2ZF5O 3GDQA 2GTDA 2G0JA 4DFJA 4WF9L 2OPSB 4GVBB 2DH9A 3L8BA 3AV9A 3BKFA 3KOAA 4ZPCA 4KYZA 2DHAA 2OAUA 4CH7A 3A3NB 1SJ3P 3OT9A 1WSEA 1RK8A 3HPGA 5KFDA 2AMCB 2CKWA 2ZNZA 3V6HA 3HD1A 4FNIA 1HPZB 4M3WA 1NGEA 1WC6A 4BRNA 2XI3A 2NZ4A 2FJEB 2W01A 3GBTA 4DV1K 3TP2A 3U02A 1HW9A 3FMWA 3LP0A 5GMKa 4P2FA 2HHVA 3AA3A 4L72B 1ZBSA 3KKSA 1F5CA 2HHHJ 1TL5A 3O4NA 1RBSA 3HVRA 3JTNA 4A8MP 4ER8A 3W2VA 2C2MB 1NK8A 4JV5F 3BM7A 2XO7A 2FUG9 4EAHD 1S0MA 3LWMA 1QSLA 1N48A 5LY3A 5EY4A 3H08A 1KC8O 4DX5A 1PC4A 3CC7S 4AM7A 1K73T 4KGVB 3I82A 5C25B 4WQ5A 2GUIA 1IKYB 3Q8VA 1GXTA 2VJVA 3C6TB 5CE3A 1R6VA 3GJSB 1M1HA 2MQMA 4Z94A 4UOCA 4W90B 3BGFA 4E8UA 7AT1B 3PW7A 4RNHA 4LFBJ 2E5LJ 2GNKA 3BSAA 2NXJA 4FWRA 4BR4A 4EO8A 5CYMB 5HRSA 3W8GA 3TUZC 1RISA 4EP4A 1WSJA 5EDWA 1B9DA 3WQTA 4F7VA 5HRPA 1XR6A 2B4UA 2O8CB 1X4HA 3FBBA 4QPTA 1RDCA 1MWMA 3AA5X 3FDSA 2HNZA 3R1LA 4NLBA 1M5PC 5SWMA 4O5FA 1FHTA 1J5OA 3AHPA 5KG3A 3DRSA 3SI6A 1AT1B 1ACMB 5H9FJ 3A8JA 3CFOA 1H0HB 1OIAA 1EETB 1HI1A 2JDJA 4X65J 1FXXA 4LBPA 3NCPA 5D3GB 3D6TB 1NGAA 5AQTA 3GFZA 3I5BA 4Q8FA 5GAHU 5DLFA 3CCMN 3LGMA 2JEFA 3O5BA 3QWUA 2A6OA 3LPUA 3HHLB 4CJ5A 2ACYA 1JNZB 2K1RA 3G10A 1YJVA 2F63A 4LFBK 2E1ZA 1CEZA 2ASMA 3D28A 4CZJA 3R6GB 3PO5A 2A5XA 1UAWA 3BEGB 5IQQA 4C3KA 3OV7A 1FRXA 2VG5B 2GIQA 4OZ5A 3AA9A 1N0UA 5AFUA 2HNDB 5TKWA 4CERA 2R7RA 5DQHA 1QVGM 3LP2B 4FNHA 3CXCR 3MFHA 1HKGA 4YNQA 3PFOA 2YKMB 1ZBFA 4QQBA 1NH8A 1KHWA 1NEEA 4CYUB 4H4OA 3QFPA 2F5GA 3VR1A 3MZIA 2AIRB 4KH0B 3QNWB 2RQMA 4WPAA 2I5JB 1VQPN 4DV3K 2Z2YB 2XHCA 4X65K 5HI7A 3UKUB 3C16A 4CJTA 2WK4A 1V9OA 1UW9A 4ZPDA 3HM8A 3DM2B 2V8GA 3I4HX 3C95A 2KU7A 4P75A 1KTQA 2LA4A 5JICA 3WEEB 1QM9A 2MSSA 3QIOA 3Q8PB 1T9VA 4OIXA 1S1VA 1CC7A 4FLTA 5THWA 3ZT0A 1DBDA 5M1OA 1LEOA 5DZ7A 1F2HA 4LSLA 1HQ2A 5LL6d 1YI2S 2LSNA 4CLZA 1TFYA 4U9RA 1M1KO 1FI4A 3SDEA 4AHSA 5D77A 1KFSA 4RNFA 5C24B 1DY3A 1WOOA 3M8YA 2BQRA 3JAMO 3Q89A 3T1YF 3GIMA 3F9KA 2AT1B 1BA1A 1PBUA 1HBOB 1MU2A 2RIJA 4IFYA 3WDOA 3C15B 3Q83A 3FBFA 4CNZA 2IRYA 4ED8A 1HKBA 4TXSA 5GAHP 1WSVA 3SEOA 4CJEA 4ECRA 4FKYA 4JNEA 1XNQK 1R8AA 3CMAN 3GG4A 2L9WA 3W5XA 3VQ5A 2UVUA 2HWIA 4RPFA 3SQGA 2H4WB 1NM1A 4CDIA 4FS1A 1UVLA 1D9FA 4RKUC 3IN5A 1QTMA 2QC3A 1KVBA 2ZHAA 3QIPB 1BU6O 3LUYA 4YQWA 1FWPA 3CDEA 1GLLO 2UXDF 1K0VA 3CCUN 4OKKA 4RW6A 1LWEB 4CTAA 3UNYA 4Y2AA 2X1AA 2C3MA 1UKUA 3ENBA 3MCMA 2H9ZA 4FF1A 4J9SA 5HQ8A 3FC9A 4DG1A 2B56A 4CO0A 4DV6J 4WCEL 1DTQB 2GVZA 2VONA 5IWAK 5EOYA 3G9CA 5IT0A 1E6YB 1PAEX 3CCVN 1W7AA 1NJIO 2RDJA 2VJUA 3ZNJ1 3GIRA 2OTLN 3I56S 1FVSA 5ETKA 2XM3A 2WSEC 4X62K 2KB2A 1Y0HA 3LGHA 2E29A 5AXLA 5KG5A 1FDAA 4U7CA 2LQ5A 2VICA 2PDAA 1W25A 4RW9A 3UWTA 5IM0A 2WW8A 2OP5A 3K8WA 2GMLA 4M5NA 2E5GA 2VU5A 3AA8A 1T3NA 1Z25A 3FEXB 3QLHB 3ILIA 4B3SK 2MKHA 4CM0A 3J7YU 3KLIB 4NLWA 1HNWF 4ANEA 2DCUB 2B9EA 3M2UB 3AGRA 3NMAA 2VFUA 3V5RA 4BE1A 1CJVB 1SQFA 2RNEA 1PJ7A 4X66J 3HFKA 3OS1A 2LU2A 2Y3YA 3DRRA 2N7YA 3EGNA 4DL2A 2VHGA 3OFEA 3QJPA 4B9QA 2NNWA 4LRAA 4PPZA 2AP6A 5AQZA 3RBEA 4KV8A 1FE0A 3WNHA 1ZYQA 5EN1A 2XZWA 4OX7A 2P9PB 1EHWA 5KFOA 1NGFA 2DPNA 3N6MA 4CJPA 4OX9J 1GMVA 3SV3A 1RAAB 5HLFA 2LU1A 1ZBLA 5C10A 3C94A 4QS9A 4JKHA 3FCVA 5A8RA 4LF6K 1Q82O 4DR5J 4AM6A 3QYYA 3IFEA 3DOKB 1MMLA 2IA6A 2P9KB 2IPOB 2HVIA 5HRRA 4DTXA 2J0SD 3EYZA 2MKSA 2AGOA 2V67A 4GKKJ 2ASOA 2CDRB 4CK1A 3MGJA 2F8TA 3SQ4A 2K2PA 5AFUH 4OKEA 1BXNA 3KWIA 5LL6Z 1DAXA 4JUZA 4LF2A 3FFKB 4MTPA 1U0HB 1S6QA 3A1YG 4FW2A 2DNOA 3OYLA 1TGOA 1GLAG 2ATQA 4YDDB 3PG9A 1TKZB 3G8TA 2PGCA 4LFCF 4BGBA 2JH3A 4JYAF 3D3BJ 5AT1B 1E4GT 3CD6N 3TO8A 5T7LB 3C0BA 3TUJC 1A6LA 1LQ9A 3BYRA 4OX9K 4Q0BA 2J8AA 1G2EA 4WZQA 5E3AA 4K4VA 1HYSA 1BUXA 4CO4A 1HBMB 2P2CB 3ZO7A 1J53A 1FE4A 1OY8A 4V19S 3J7YP 4DR5K 1RYRA 2BJ3A 2P9CA 1RJJA 3N6NA 1SUQA 3KLGA 3NS7B 3DU6A 3NL0A 4BQZA 3QGGA 2DGVA 4KI4A 4FLZA 3H3OB 3GYGA 3CC2N 3CO0P 4V19X 2KZMA 3VAIA 1NGDA 1N5SA 3U6FA 2I2YA 2X1BA 4B3RK 1Q9YA 2DXDA 1TYQA 3DGVA 3FZKA 4MQ3A 3DAWA 2XY8A 4MFBA 3SSQA 2NXEA 2FPHX 1F2GA 1AW0A 3R3LA 2E20A 3D6MB 4H0XB 4CESA 4K59A 2ZE2A 5EX5A 1ASWA 2ZWPA 4YORA 5CZ2A 2POKA 2I1RA 4PWUA 1TL4A 1YBTA 3OVSA 3L9ZA 3GFYA 4O3NA 4QZVB 5H1SQ 5KRSA 1FTCA 3CFRA 3HCXA 5M1QA 1YJNN 2CADA 3CB4A 2KZZA 4USMA 4DTJA 2XZTB 3PEJA 1VQOS 1S1XB 1OH6A 4UZCA 4IWVA 3ONQA 4QWEA 4CJQA 4XH5A 4DTOA 1LOUA 4Y34A 4MKYA 4FP9A 2DGSA 3UR3C 1CJTA 4DUYJ 3VA0A 3CJRA 4NO7A 1S1UB 1FKOB 4RW8A 2LEBA 2M2BA 2D9OA 3KD5E 1U09A 5KQDA 2B9WA 1YRXA 4WFZA 1N5YA 2RAQA 2VGMA 4OYBA 1N8RT 2H3GX 1WDTA 3QGHA 4IRKA 2FZCB 4KGXB 4BRCA 3W63A 3T19A 2BE7D 2QA2A 4J37A 2DR9A 5L38A 2VQFJ 1Y9OA 1Q78A 3R2CJ 1FW6A 3FBCA 2EC2A 1IBMJ 5F2RA 3QQCD 3AJDA 4O0NA 2GEMA 2QWQA 4BWMA 4JV1A 3PO4A 5D4OA 4WIIA 2G8KA 5AQFA 2AEFA 4A62A 3M1VB 3NF8A 3CJ8A 2KT2A 4TQRA 4IFVB 3G6XA 4IO1A 2Q6CA 1RT6A 2RF2A 1VQ6S 2G0CA 4FLWA 2D3OR 3K58A 4FLYA 3UB5A 2RS8A 1AYEA 4BRKA 3HTVA 4NXMJ 4J9LA 4OHYA 1R59O 4A8SA 2XGQA 2EFOA 1RWPB 5HBMA 4NEZA 3A13A 1RTHA 2R7QA 2EXUA 3ELHA 2HNYB 1P6TA 2HS4A 4FZZA 3HYFA 3ZX2A 5E3RA 4HUGA 1VRTA 4P9SA 1MROA 1EP4A 1K0TA 3IR7B 2WCXA 2XY6A 4GV3A 4C8OA 3DLBA 1B3TA 4I69A 4DV0J 2RVJA 4ILGB 3R5BA 1HQEB 5LXRA 4YOWA 1CULB 1VQMN 1ULRA 1RXOB 3KHGA 2VQFK 3E9OA 1UJ6A 3OTEA 5LJ3Y 4M41A 5LMNK 2PN6A 3MD3A 4ZVFA 1BHLA 1GX6A 3TX0A 2OYQA 3SUPA 1MN7A 1ZM2A 3AODA 5BYSA 1ILYA 1UP1A 3LP1A 3TW0A 2F96A 1UETA 3AXKA 4DV2F 1UFLA 1W26A 2AJ2A 3CJTA 3PEHA 2HRUA 4BDYA 5U47A 3OYIA 2QKKA 2H65B 2DNZA 3BF3A 4ECVA 3I33A 2P9UB 1JLFB 3BPSP 1WF1A 2YQ3A 3OW2R 3B8AX 2MYFA 2JZ5A 4EP5A 3EZ5A 4CGHA 2YX6A 3K5OA 3LTOA 1SL0A 4B3MJ 4P71A 1HNZK 1NM2A 3R7BB 2GW8A 3D9BA 4WFYA 2HQCA 4RWTA 1HI8A 3THYA 1W2BM 1B9FA 5FROA 4RJVA 3L09A 2CNNB 2FBXA 4A46A 3DOMB 2G1DA 2IJNA 2GZOA 3HSGA 4MO5A 1TKTA 1UZHA 2M3DA 1K8KB 1RT7B 5FDLA 1OMSA 4KTQA 4C1NK 4FJHA 5LMUJ 6FD1A 1DLOA 5HMZA 4DCHA 2NPFA 2RRNA 2YWEA 3EM1A 4M63C 5KFHA 3U4LA 3J81O 4ILLA 2CPIA 4A2AA 4DR7F 3VF6A 1FNXH 1KLMA 5KTQA 3CCLS 4JI5K 4IZ9A 2FIUA 2CQGA 3I0SB 1Y5NB 4IOCL 1PSDA 1X4BA 4C8ZA 3EKUA 5DM7Q 2IC3A 2IBKA 3O5TB 1N33K 1PO6A 3L4QA 4UUWA 3PX4A 3AVNA 2A1RA 3OL7A 1RSCA 4TSXA 5J1PA 5JVHQ 4K0KF 3V1QA 2NLXA 3BKTA 1YZ6A 2HAFA 1RLDA 3OVAA 4K5RA 1OS5A 2ZZTA 2QT7A 3KDOA 5J2NB 3CCRS 1C0MA 2VUGA 3R5AA 4CW7B 3OR1B 1KC8T 1XHZA 3BR9A 1XERA 4WU3A 4YB6A 3LDLA 1RT4B 1R8HA 4L74A 3SBGA 2QK9A 3WXKA 5KFTA 5A6WA 5FD1A 2EX3A 1YVFA 3MTJA 2O8FB 2RD5C 3D68A 1CXUA 1JCFA 3U7JA 4O0JA 1U2VA 1T3OA 2VG7B 3A4TA 1D0EA 1FERA 1RBAA 2CPYA 4JI3K 2E9TA 4ZVHA 4ZKAA 3T5HA 5FRMA 4O44A 4KBIA 4CZFA 1WWHA 4DX6A 5A6PA 2Y1JA 3QJJA 3G6YA 1NK7A 2DXFA 3G2XA 3K0SA 1ZXOA 4FWLA 1U24A 2YI1A 4I2QB 1U48A 4RUHA 3FMBA 2RRAA 1GEHA 3JYTB 5DS7A 2QRRA 4PG4A 2WRMA 3GIKA 5BPLA 1VQSA 4GVLA 3U3YA 4CEOA 2RPIA 1GFWB 2QA4G 2VPWB 3OUYB 3VZHA 2FVSA 3IC1A 1J5EF 4N47A 1HWKA 4A8OA 3ZZPA 3NNHA 3CC4N 1N52B 4FBUA 3US5A 1RBVA 4W5QA 3OYNA 5M1FA 3GWCA 5BYRA 3RB3A 4KHPK 2Y0BB 2E1RA 1KP6A 4JI0F 3HVWA 2XYHB 1RADB 3W2WA 4K4SA 2H51B 1NU4A 2NRHA 4JKGB 2E9RX 5KRTA 4FOEA 3ZCMA 1IXKA 4EZ6A 4DR2F 4DV5J 5BR8F 2VB6A 3EE8A 1G15A 1HPMA 2OPQB 3TAPA 3KXDA 4K8RA 5GIPA 4YN3B 2A40A 3SQ0A 3CJKA 4C8MA 2E7VA 4ALZA 3RMAA 2KM8B 1FKPB 4PKIA 4BDZA 4NLVA 2K3IA 3G6EN 3M7VA 2KT3A 3EDRB 4OZNA 1LKZA 3F2KA 4IQXA 3KD1E 4ILJA 1GLDG 3M8SA 1RTIB 2B43A 1UFKA 4J7CA 1X4GA 1CLQA 1ATNA 3B4MA 3VQBA 2UUAF 1NGJA 4YDXA 2EWSA 3A5MC 2VD3A 5ITHA 2HG4A 2A0FB 2VASA 3HHNB 2HS0A 3B4DA 3VEYA 3PW4A 1NK5A 2BOAA 2C2KB 3ZZRA 3VGUA 5BXIA 3QMLA 3AVMA 1NB7A 1UW4A 3W9JA 2GVDB 3QATA 3N4PA 4RUBA 1T9WA 2ZM6F 1HWIA 2PEBA 3GIJA 2QGFB 2QJ3A 4KHRA 4ED3A 2HWHA 2YNGB 4DN9A 4ZCLA 4W4MA 3I9ZA 1XJWB 1M1KT 4I0WA 2KLAA 5A8WA 5E3CA 2CQIA 1KLNA 1KRPA 4AXJA 1HR0J 4O5BA 2O8DA 3NFAA 1WTBA 5IT9Y 1T05A 2BANB 1FJGF 4YOXA 4PG5A 4JKFA 2GX8A 2MQOA 4JKCA 2QTWA 1VS3A 2AYEA 4IH7A 3RAMA 2JLFA 2V50A 2HQFA 1M90T 1PG5B 1RCXB 3I55S 2GGPB 4ZP6A 3S9HA 3I87A 2UUBJ 4JKEA 5L8RC 3NNCA 4CHOA 4HLBA 3RAXA 2XNQA 3LM2A 2XLIA 4KC5A 2AYBA 1FNOA 5KFAA 3GYXB 4CF0A 2UXCJ 4BRHA 2JLEA 3M8PA 1BGXT 3L2VA 1M5SA 4I6AA 4TY8A 2GC8A 2DR8A 1URRA 4OKJA 2BQ3A 2J0WA 2NPIA 5GAHI 3ZT1A 1SJ4P 2MLXA 1C0UB 4WTOB 3WQPA 1CJKB 3NVMA 3J80Y 2GX9A 3DGPB 4DSFA 2QSFA 3RRKA 4L3QA 3H5UA 3UN5A 1XWLA 3OYBA 1UVMA 5SZTA 2J7KA 5C42A 5FPDA 4LFAJ 4M7XA 4NLYA 3THWA 1HNXJ 4DQPA 3ET6A 2FJVA 3EVMA 1NKEA 1FDNA 2F65A 1BE4A 2P9SB 2B6AA 3VF0B 2HHTA 3L2RA 1RB0A 2E5IA 1AZSA 5ETPA 1CS4A 5K9FA 4ED7A 2Z1JA 4JI4K 4JOUA 2E88A 4FXWA 1GAOA 1VQKS 4CEDA 5KFPA 1VLYA 2DJWA 5L1JA 3V6JA 3I8BA 1X60A 2GIRA 4F3OA 2W4DA 1ZOTA 3VF4A 3IRXB 3KK3A 1NLVA 2DY4A 2VQEJ 4LH5A 4NMLA 4R0JA 2F9TA 2ZOGA 1NHUA 4K43A 1LW2B 4LF7F 4G9ZA 4OYAA 3VQQA 3KLEB 4M95A 3G82A 1BOTO 2RU3A 2A2DA 3KLHA 3OFHA 2Q36A 3U9DA 1S0VA 1WEYA 1VSFA 4PXDA 2PZSA 3MWTA 4V19J 1VDHA 2B4VA 1N34F 1N36F 3FQLA 3V9WA 2L9NA 1BWFO 1OPIA 2BH1A 1PBAA 3G87A 4GO5X 3LA0A 1HNXK 3C3LA 3GG0A 2D74B 1PAUB 4PYAA 4LF9F 2BZ2A 5AJ3F 2NRZA 4H5WA 2PFUA 4CGIA 1FX4A 4WIQA 4DV1F 3Q7BA 1X9JA 3C16B 3CCEN 1BWVA 2D0CA 3MURP 4OO1J 3BBFA 2AA4A 3MAAA 3TNVA 1TTHB 4F4AA 1KQSM 1Q82T 4HHJA 2FQQB 3NGSA 1KDNA 4J90A 3RG6A 1WHWA 3OYKA 1VSIA 4O3OA 1ZC6A 4CEQA 2W42A 3GCXP 5B0FA 2HBZB 2L9DA 4DU3A 4NYNA 1VQ4N 2KHDA 5IOLA 7FDRA 2MQLA 2ZH5A 2P9EA 1SL2A 5F9NA 3PHTA 5ETTA 3K8VA 2FC8A 1F5BA 2VPZB 4PQUB 1IWGA 2QA4S 1VQNS 2PT0A 5F8JA 3QBCA 5HVFA 4DR3K 5EXWA 3UPFA 3ZETA 3HO1A 1SKRA 3NWRA 4DLGA 2EFNA 3VQTA 5KFQA 3QFWA 3G8SA 3MMCB 4XPCA 1N54B 4USUA 2RUGA 4W5TA 3QAUA 4CIGA 4C0HA 1VYAA 4WYBA 2L41A 3KK1B 4ZIWA 4C48A 4B9UA 5HJYA 4H5NA 1D5AA 5JXSA 1JIHA 3FZLA 1BI4B 3M2VA 4X2BA 3AD9C 4Q2MA 4CIOA 1S9GA 3DC2A 2HHHF 4URQU 3SQGB 3CM5A 1RACB 2XULA 4JK8A 2HW3A 5AQRA 5JLHA 2R7OA 2HWTA 3PM9A 1Y3KA 1TK5A 1RI7A 3IA0A 2O8BA 3NMRA 5ETOA 2ILZA 1WAJA 1JJ2R 1YJ7A 4DCJB 3NOCA 4ELTA 3LDNA 1HWJA 3IWXA 4CTAB 3PIPQ 4YB7A 5K8PA 4Q8EA 3JSBA 7FD1A 3W9HA 3BZQA 4KJIA 3M6UA 4LFBF 2E5LF 1XNRK 2C3OA 3OL9A 1RGVA 2ILYA 3UE5A 3DDNA 4KPYA 4P10A 2FYXA 2W6KA 1C4CA 3GR1A 1MDUB 2NCKL 3UW1A 4ECZA 1RWVB 4N5SA 2CZVC 4NYOA 2ZNYA 3GG1A 3BF1A 5AQXA 1QVFR 1BA0A 4F3QA 4CBXA 4BRIA 5G0RA 4GKJJ 3W3SA 2DY9A 4LF4K 3UDCA 1IBKJ 2IMOA 3KLFA 4H4MA 4LSNA 2LYVA 3MEKA 2N3LA 3UKRA 2VC0A 2HOEA 2FVPA 3MK6A 2KYZA 2JSXA 3M9NB 1C0FA 2HYIB 2PMHA 4OV6A 1JCGA 2HFUA 1B7YB 5AE3A 2GJFA 2C2ZB 4OJRA 1QQOA 3AH6A 2JRSA 4F02A 4EHUA 1H2VZ 1MWYA 2VFSA 1AXQA 1U45A 3MWPA 3CQ8A 1OKJA 4CJ3A 5B8HA 3DRRB 3W9IA 3EXCX 1NGBA 4ZPTR 3CVKA 4QYZJ 2ZD1A 4MKBA 1RTJB 1H7WA 4H03B 2G8WA 5GIOA 1GTEA 4BHQA 2IAJA 4G1QA 4Q7AA 3KMSA 4CBWA 3NGRA 2OZSA 1VJWA 1GXUA 4OJ1A 5F41A 2K3KA 3JXUA 1EXQA 4QR1A 2L3MA 2R2UA 3KKFA 4DBQA 2PA3A 4LQ3A 1C1CA 3IG1B 4J9PA 1O0PA 2NXCA 2E1YA 1FVQA 5D0RA 4CO3A