4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
5KGXA 4DF8A 2A1SA 4F2SA 4JUZA 4LQ3A 4H54A 4YR0A 2JC1A 2ATQA 4E7LA 4EYHB 1RDBA 4IQXA 3DM2B 2HHTA 3NF6A 5DLGA 1S6QA 1HQUB 1EETB 1T3NA 4DEZA 3NGZA 5F8LA 2OPPB 2IA6A 1HYSA 3PO5A 1SL2A 4KI4A 2B6AA 1RT4B 4OPKA 5J2MB 4ED1A 1QAIA 3HPOA 3VQPA 2W42A 1IO2A 1VSFA 4ECTA 4Q5VA 1JX4A 4DWIA 1B9DA 4CHPA 4IFVA 1QS4A 4DS4A 4DFMA 1JLCA 4CF1A 5EU7A 2YHBA 2JGUA 4BWJA 5E41A 5JUMA 3L2UA 4CJWA 3BGRB 2AGQA 4KAZA 1FXXA 1WNSA 2RF2A 1VK0A 3KHRA 3KHLA 1U48A 2ZE2B 3DLKB 4NLDA 2HB5A 4CHNA 1C1CB 1S1WA 4ZHRA 4B9LA 4O4RA 2QKKA 5KFXA 3MEDA 4Q43A 2JC0A 3H5SA 2DFFA 4DQQA 3CVKA 4B9VA 3AO4A 1YVFA 2BR0A 3C94A 3HL8A 3V81B 4M3WA 1HNIA 2QXFA 4IRDA 2IAJB 3H5YA 5EWFA 1ZBIA 1WLJA 1X9SA 2W8LA 1ASUA 3THVA 1BISA 3FSIA 3CJ2A 4KV8B 4CJ4A 2DTUA 3OYMA 3OS1A 1BQMB 5I42A 4KO0B 1A5VA 4FCYA 4IH7A 4HHTA 4ECVA 4OGCA 4E0DA 3RAXA 3RMCA 1A5WA 3E01B 4OLBA 1LW0A 3QGIA 4ELUA 4HUFA 3O3FA 2FVRA 3TAPA 4F8RA 4IH6A 2BRLA 3AVIA 2W9CB 2OPRB 5KFEA 4NLVA 4CEQA 4KB0A 3NHGA 3ZSXA 2O4GA 2B43A 1QE1B 4CIGA 3T5HA 3NMAA 4WFXA 5KG6A 2JLEA 4DTSA 2XY8A 3QIPB 4EEYA 3HKWA 2F8EX 3DRSA 3RBEA 1LW2A 4J9RA 3Q8QB 1QHTA 4R5PA 2YKNA 3SJJA 4O3OA 3OYCA 4FJHA 2ZD1A 3BR9A 1A5XA 2D41A 5HP1A 2Y1JA 2XY6A 4RW6A 1TKXB 5KG4A 3QEVA 4ZP7A 4DTRA 3MFIA 1NK0A 1MU2B 3AVHA 4B08A 4Y3CA 3M9NB 4EBCA 4CF9A 2BE2B 4GW6A 3T5LA 3CFOA 5CZ2A 2AX1A 1RAJA 3FFIA 4C8KA 4OPJA 3MEGA 4JV1A 1JLQA 4BE1A 4E1NA 4FJKA 1HNVB 3B6OA 3E51A 4H8KA 3T19A 3V9XA 1RTHA 1UA1A 4K8ZA 4W5NA 4YR2A 3HYFA 1HMVA 1BQNB 3OYHA 4U7CA 1ZBFA 4DSKA 1IKYB 3S3MA 1RCHA 2GIQA 4CIFA 1T03A 3LP2A 3RB3A 4ZVFA 2J6SA 4CHQA 2W9BA 4OLAA 3RR8A 3AVCA 1Q9YA 2AGOA 1RT5A 3FDSA 3OHBA 1NK4A 3HJFA 4XPCA 2AJQA 1W0HA 1ZETA 3L2RA 3UQSA 4URGA 1KVCA 4DFKA 3G6YA 3NDKA 4PWDB 2IDOA 4N47A 1W25A 3PUFA 2WONB 5J2QB 4DL3A 3CO9A 3CG7A 3S3OA 3CFPA 4AILC 3RMBA 4ZP6A 4JLHA 2XGQA 3MEEB 2IM0A 1KCFA 4CIEA 5FRNA 3H5UA 1LAWA 3VQ8A 4ZPCA 4PUOA 4FK2A 1RBTA 4H4MA 2IC3B 4KTZA 2X6SA 4O3RA 3LZJA 1NK9A 1RTDA 3H40A 1G15A 3CIZA 2XCAA 2BDPA 2O4IA 3AVMA 1CSJA 4TY9A 4CJEA 1BI4A 2AGPA 3LP0A 1YTUA 4ID5A 5KFBA 3MR5A 4IG3A 4DSIA 4DL2A 2W7OA 4F4WA 4IFYB 2XGPA 2EC0A 2UUTA 1RA6A 3K5NA 3VQ6A 3NGYA 1VRTB 3MXIA 3RB6A 1R0AB 3V9WA 1TK5A 4J9QA 2D7SA 2CJQA 2G8VA 2W9AA 1JLGB 5C24B 3OYJA 1S1TA 3DMJB 1IKXA 1TK8A 4O44B 1NJXA 3ZT2A 1VSLA 1JKHA 5J2QA 2WTFA 2R2UA 1NNDA 2YNIA 3OLBA 3O3GA 3G6XA 3DRPA 4CK3A 3M8QA 1XR6A 3K5LA 4ID1A 1CZBA 3KLGB 4NLPA 4Z4FA 1LWEA 5F8HA 4TYAA 3NF8A 3V6JA 1ZTWA 4MH8A 3NL0A 4B3OA 3KK3A 3QIOA 3P5JA 1RYRA 3F9KA 4J2DA 2ILYA 5CYQB 3NF7A 2B5JA 4IKFA 1YVUA 2I5JB 2XY5A 3HPHA 3BSOA 3NAEA 3PW5A 4PQUB 2HNYA 3PZPA 3AVNA 4CJSA 2XC9A 1NOZA 3OYNA 3KLIB 3A2FA 2KTQA 3SUQA 5KRTA 1S9GB 3C6TB 4RW8A 2RDIA 3AO1A 5KFSA 4CJKA 1EXQA 2UVUA 1RILA 4Y2AA 1DTQA 3BQ1A 5HRSA 4DQRA 1TL1A 1WSHA 2AU0A 3G0ZA 2UUWA 1BCMA 4RW9B 1N5YB 4J9MA 3LPUA 3KIOA 3DI6A 3MTKA 3OL9A 2KFNA 5KFUA 4ECSA 3CJ4A 4BWMA 5KG7A 4PY5A 4ZP9A 1N48A 4IDKB 5KFHA 4DFJA 2P5OA 2DY4A 3SI8A 4C8OA 4JV2A 3RMDA 3CFRA 4LD0A 4H4OA 1C1BB 3RR7A 4RUAA 1GX6A 4X2BA 3AVLA 3BSAA 1NJZA 2Y1IA 3AA2A 4KBIA 3K57A 3MECB 4EBDA 4ED0A 1S0OA 4WZMA 4CFBA 3PVXA 1RT7B 5HBMA 4E7KA 2YNGA 1RT6A 1S49A 3CDWA 4MIBA 4BE0A 5DQGA 3EZ5A 3PR4A 1U09A 4WZQA 3M9OB 4J2EA 5D3GA 4M3UA 5HLFB 2IMWP 4N56A 3CDUA 2FBXA 4RW7A 1VSIA 1SL0A 4FW1A 3WNFA 4YMEA 4NLXA 3U3GA 2F8TA 4KHYA 3IGVA 4QPXA 3H08A 4L8RB 4FJJA 4F3TA 5KT2A 5KFZA 3H4BA 4IG0A 2ZQBA 1U04A 4DU3A 4MKAA 1S1XA 4UQGA 4IBNA 5CZ1A 3F73A 4FVMA 1KLNA 1S48A 3EYZA 1L3SA 4IH5A 4CJFA 3RRGA 3IS9A 4O3QA 3CDEA 1QSLA 1Z25A 4M3ZA 1NK6A 3PV8A 1KLMB 2ZKUA 4DTMA 5KT3A 2KZZA 4YR3A 3LP1B 1DTTB 4Y34A 1NK8A 2QKBA 4F4ZA 4CERA 3ZT4A 4ECYA 5L1IA 3I0SA 3AO2A 3LWMA 2R2TA 3ZT1A 1GOAA 3OL7A 4EBEA 2YNFB 3H2LA 2IGIA 1S1VA 1N6QB 3V6DA 2WB4A 4ICLB 2PZSA 1TV6A 3KKSA 3L2WA 1IKWA 3DRRB 1RT3A 4I9QA 4CEZA 1RT1B 4DS5A 3KLFA 3D28A 2HWIA 4KREA 2R7YA 3HVRA 1S9EB 1LWFA 3RBDA 3SUOA 2BANA 2V9WA 5HROA 2E9ZA 5SZTA 3WNHA 1ASVA 3O4NA 4FJ5A 2LSNA 1KFDA 4AH9A 3SZ2A 4Z4IA 3QNNA 1S6QB 4CHOA 2HHWA 2HHVA 3LWLA 1HYSB 4I2QA 2B6AB 4J9KA 1TP7A 4NLSA 5EUHA 3AA5X 1XC9A 1L3TA 1S6PA 1KHVA 3CM5A 4CGJA 4IFVB 5DK5A 3Q8RB 1JLCB 4Z4CA 1WN7A 2R2SA 4DG1A 3ITHA 4RU9A 2RF2B 4YP3A 5F8MA 1S9EA 3CWJA 3NBPA 1D9DA 4GMJB 1S1WB 4ZHRB 4DSJA 2IM2A 4J9LA 4QCLA 4CJLA 3MEDB 3DLRA 3UPFA 4CE9A 5DG9A 4NRTA 1RBRA 2E6MA 5CYMA 3L2VA 4ED2A 1J5OA 1HNIB 1JLBA 3P83D 1BIZA 1LAVA 2G8KA 2WOMA 4QOZB 3PW2A 4RNMA 3H59A 3WNGA 4URSA 4ZVEA 3RWUA 4FXDA 3I8DA 4XO0A 1REVA 4HKQA 2WHOA 2X78A 3T3FA 3MXMA 2DPIA 1X1PA 3PX4A 4FM2A 2BQ3A 1S4FA 1ASWA 5I42B 3DYAA 4NZ0A 2BQRA 1LW0B 2OPSA 5C5JA 3NKYA 2E6LA 4DLGA 5JXSA 1S5JA 3QO9A 4CECA 3I5AA 3S3NA 1NHUA 5KFVA 4J9NA 3QNOA 3ISNC 1TK0A 5K14A 1D0EA 3TABA 3KTQA 2V0NA 3DRSB 3VQ7A 1LW2B 2Z1HA 1KSPA 3SPYA 1BHLA 3DLEA 5DQIA 4CEFA 2ATLA 4R5PB 2YKNB 5J2NA 1NHVA 2ZD1B 1JXLA 2G8FA 5HP1B 4RW6B 2FLPA 1VSMA 2D0CA 4KTWA 4EP4A 4F2RA 2VG7A 1VRUA 4BACA 4KHSA 4KI6A 4TN2A 2G8HA 4FZZA 2HHUA 4DTUA 4NLUA 3PW0A 2GV9A 1SKSA 3M8PA 5J1EA 3SPZA 4DL4A 4FK4A 2HNDA 2XI2A 4FZYA 3FFIB 3MFHA 3N6LA 1B92A 2OZMA 4DLEA 3MEGB 1JLQB 2W7PA 4AHVA 2D0BA 4CEBA 4NYZA 1I3AA 2JEIA 3QEXA 3QETA 3IG1A 3CJ3A 3IRXA 1ZBLA 1RTHB 2QK9A 3EPGA 3OL8A 3HVAA 1HMVB 3KLVA 5KFPA 2A1RA 4R0EA 4M45A 3QZ7A 3OYBA 3T5JA 1T03B 2ITGA 3LP2B 3VN5A 1HRHA 4F3OA 2W9BB 4IRCA 3LDSA 4DTOA 1BGXT 4JS4A 4CJ3A 5T7BA 3KJVA 2Q3SA 1RT5B 4CJTA 2V4RA 4ED3A 2C28A 3I5BA 4WXOA 2IOCA 5DLFA 2OPQA 4LH4A 4Q8FA 3V1QA 3QGHA 3GYNA 1O1WA 3PHEA 3GILA 4JRPA 4ZVHA 3OS2A 4GC7A 3RB4A 4I7FA 4ED7A 1KRPA 4I2PA 3OJSA 1GX5A 5FROA 1S1UA 4YFUA 3QESA 1RDRA 1XR5A 3G6VA 4DL5A 4WE1A 4PUOB 4H4MB 2WRMA 5J2PA 4EYIB 1J9AA 1RTDB 2Z1GA 3EZUA 4M41A 5F8NA 1JLAA 1BI4B 3LP0B 4ID5B 1RTIA 1Q8IA 1RDCA 4DTXA 4IG3B 4DTPA 4KHUA 4J2BA 1VSKA 4O4GA 1B9FA 2RDJA 3PW4A 3PR5B 3V9UA 3OSPA 2YHAA 4JS5A 1KTQA 1D5AA 2WK4A 1S1TB 2JEJA 2VG6A 1IKXB 1L3VA 1RBSA 3NH0A 1JKHB 3GQCA 4WXWA 4FLZA 2YNIB 2UVWA 3OY9A 1TVRA 1SKWA 3TAMA 3DRPB 3M8QB 4Y1DA 4KKOA 1Q9XA 4MK7A 5KG1A 2IJNA 4ELTA 1SH3A 1LWEB 3KK2A 1QTMA 4B3OB 3KK3B 3L8BA 1UAXA 3PY8A 3LAKA 3KD1E 3OS0A 1C0MA 2B5JB 5C25A 1EX4A 3CM6A 3RTVA 2HHXA 3OL6A 1SL1A 3QGGA 4ECRA 3AA3A 2HNYB 2R8HA 4EZ6A 4E7IA 3WNEA 4JRQA 1C0TA 4HYKA 2DFEA 2D3ZA 4DQPA 4RW8B 1XHXA 4ELVA 3QIDA 4DL7A 1DTQB 4HTUA 1TL1B 3LANA 4MK8A 4Z4GA 1BCOA 2G8UA 1N4LA 4B9SA 1HYZA 3DI6B 2HMIA 1TL3A 1D8YA 4LSLA 1ZBUA 1CXUA 3JYTA 1Z4UA 3V6HA 5HRRA 4ZVGA 4CJ5A 3KHHA 4CJPA 4J9SA 1JL2A 1C1AA 4H4OB 1DLOA 4CGHA 3G10A 4G1QA 4QW9A 3KKRA 4W5QA 4GC6A 3HXMA 3C6UA 4CFDA 1GOBA 4K4VA 4CGDA 3V9ZA 4FJ7A 3TR8A 1NJYA 3OYKA 3ZT0A 5DG8A 3SV4A 1FKPA 3L2QA 3HSTB 2VG5A 5HBMB 1VSHA 2YNGB 1RT6B 4CHZA 2OYQA 4FLYA 2R8IA 2C2RA 4W5TA 3MF5A 1HYVA 1RYSA 4B9TA 3GV5B 3TVKA 2PY5A 4QW8A 5D3GB 1ITGA 3NGIA 3HO1A 3TARA 4CF2A 3HVTA 1Z26A 4RW7B 2GC8A 5KFGA 4KE5A 5SWMA 5KG2A 2KQ2A 2RN2A 3HP6A 2OA8A 4NYFA 4DL6A 2FLNA 4AHTA 4LSNA 5EDWA 4FLXA 1UWBA 2FLLA 4FS1A 1SKRA 2W8KA 3V9SA 2OH2A 1EP4A 4FS2A 3GIIA 2X74A 4RG8A 3ZSQA 3BREA 2G8WA 3MR6A 4CJRA 4IG0B 3V1RA 4Y2CA 5F8IA 5L1JA 4CGGA 4RNOA 1S1XB 3DLBA 5DGAA 3KNAA 5FDLA 3FQKA 4NYNA 5C42A 2IM1A 1QUVA 3IS9B 3NAHA 1SUQA 1KVBA 3BSCA 3MR2A 3KLHA 1S10A 4Q0BA 1U45A 2E4LA 2P51A 3CJ5A 4WYWA 1IKVA 3C95A 3O4QA 3VQDA 3TAEA 2ETJA 3ALYA 4B9UA 2BGGA 3I0SB 3H5XA 5KG0A 2XCPA 4B8CA 4GVMA 3O3HA 5KT6A 5KFOA 4CGIA 1UA0A 4EO6A 3PW7A 3QEWA 5L9XA 1S1VB 4MFBA 4AHUA 3V6DB 1C2PA 4TY8A 4AHSA 2IM3A 3SQ0A 4OGEA 1TV6B 4WFZA 2OZSA 4Z4HA 1IKWB 2XHBA 1RT3B 4ZPBA 3KLFB 3DOLA 3I5CA 4BDYA 1TKZA 3DLGA 4ECUA 1LWFB 4FYDA 3K58A 2BANB 2P5GA 3ULDA 1NKBA 3PJXA 4CGFA 3ZCMA 5HROB 2HHQA 4RW4A 2ASDA 3KMSA 2E9RX 4W5RA 1HJRA 4TQRA 1NJWA 2RKIA 3GIJA 4IOBA 2AQ4A 4FJXA 4TQSA 4W5OA 1WSJA 1T05A 3BQ0A 2GUIA 4I2QB 1Y97A 1HPZA 2J6TA 1XHZA 5CY4A 1RT2A 1SV5A 3T5KA 1WAJA 1FKOA 1S6PB 4C8NA 4RNFA 1HQEA 2ASLA 3CQ8A 4DQSA 1WNEA 4E89A 1NK5A 3BQ2A 4DG1B 3VQQA 3ITHB 5EWEA 3MXJA 4LY7A 2HAIA 4MKBA 3JSMA 3NBPB 2FJVA 1KHWA 2JEGA 3KLEA 2XWYA 4FLTA 3AO3A 5KI6A 3ASMA 3TANA 4WFYA 3DOKA 2VA3A 2HWHA 3V4IA 5KFLA 3QEPA 3QLHB 3OYAA 5KFCA 1XI1A 3HPGA 1CXQA 3SQ4A 5CYMB 2FVCA 4OVLA 1J5OB 4MQ3A 2PYLA 1JLBB 1K1QA 1WSFA 4KFBA 2EHGA 4FK0A 2YKMA 4O5BA 4DU1A 4EZ9A 2WOMB 1WSEA 4J9PA 1QSSA 3PX6A 1JLEA 1D9FA 1TKTA 1U4BA 4YNQA 3OYFA 5KFMA 4NCGA 3IGNA 1REVB 4TXSA 4RZRA 5JS2A 3SV3A 2IJFA 2KW4A 1S9FA 3DYAB 5F9NA 4NLGA 4R8UA 4CK1A 2OPSB 3LAMA 2XY7A 2FVQA 4KB7A 4YQWA 5KFKA 4IRKA 2G8IA 1YT3A 3QO9B 3TWHA 1RTJA 4DSFA 3Q8SB 4K4UA 4CFCA 3K5MA 2DPJA 2R8GA 1J54A 5DMRA 3VA0A 1IG9A 4MIAA 3HM9A 3QLHA 3B6PA 4FW2A 2I1RA 2QE5A 5I3UA 4F4XA 5K14B 2Z1JA 2HNZA 4TLRA 4KHWA 1C0UA 3NAIA 1BL3A 3NFAA 3SQ1A 3DLEB 4QWDA 1JLFA 5J2NB 5KFIA 3K2PA 3DDKA 3BSNA 2VG7B 1FK9A 1VRUB 3K59A 2EX3A 4E19A 2YNHA 4CK2A 4PA1A 4TYBA 3I0RA 4Z0UA 2FJWA 3M8PB 1LWCA 5J1EB 4Z4EA 2HNDB 4EP5A 3ZSRA 3M8RA 3NH2A 1IM4A 4CEOA 3IG1B 3IRXB 4IR1A 3AVAA 4FZXC 2R8KA 3VA3A 1JL1A 4N41A 4CFAA 5KFYA 2FJXA 3IAYA 3NF9A 1JIHA 1EKEA 4IR9A 4K50A 3TAGA 1T8EA 4FJ8A 3LP3A 3DM2A 1WSIA 4NCBA 3KJVB 1TAUA 3MR3A 1RA7A 2C2DA 1HQUA 2FVSA 3BJYA 1EETA 3OLAA 4I9LA 4O3NA 3OSNA 2OPPA 4KHMA 4NLRA 1RT4A 4DMNA 4O3SA 2OPQB 5J2MA 4NLTA 5HRNA 1NK7A 2ALZA 2B4JA 4BE2A 4BDZA 4Y1CA 4I7FB 4I2PB 3KHGA 1S1UB 4FJIA 3BGRA 4RNHA 2VA2A 4E7JA 2VWJA 5T14A 4NLOA 4WE1B 2ZE2A 3DLKA 5J2PB 4NRUA 4O0JA 1L3UA 1NOYA 1C1CA 2BRKA 4K4XA 5HRPA 3TAFA 1JLAB 2C2EA 1RTIB 1I6JA 4E1MA 1RDDA 2YV0X 2PYJA 3OYGA 3SUNA 1S0MA 4NLQA 1X9MA 4O4GB 3VQBA 3V81A 3U6FA 2IAJA 4F50A 5KFJA 3ZSOA 4CF8A 2VG6B 3IN5A 5L1LA 4K4SA 4DQIA 4FM1A 1QQCA 4N76A 1YTAA 3S9HA 3AVJA 1QSYA 1TVRB 1UOCA 4KV8A 3TAMB 4JV0A 4FBUA 4FM0A 3GIMA 2UVVA 3P1GA 2F8SA 4KKOB 1BQMA 4CEAA 3KK1B 4KO0A 3M8SA 4CJQA 3KK2B 3TAQA 2R8JA 3Q8PB 3E01A 4AHRA 5KT7A 4K4ZA 4M94A 3QINA 2ILZA 2FC0A 2O5DA 4C8LA 5C25B 4MK9A 2FBYA 2W9CA 2OPRA 3FRZA 3RB0A 5KG3A 1ZTTA 3M9MB 2RPIA 3LZIA 2HVHA 4F4YA 1QE1A 4DSLA 1C0TB 2KZMA 3VQEA 1ZYQA 4OJRA 2XI3A 5KFRA 1CZ9A 1S97A 2NUBA 3QIPA 4KB1A 4J2AA 4KRFA 4NCAA 2D3UA 4K4TA 4CF0A 2HMIB 2AX0A 3AVGA 1TL3B 4LSLB 5EWGA 3JYTB 1TKXA 3TI0A 1MMLA 3OYEA 1DLOB 1MU2A 3KK1A 3GIKA 4G1QB 3PJWA 3UIQA 3SNNA 4CESA 2BE2A 3C6UB 2CKWA 4Q44A 2QV6A 1JXBA 3ZSWA 3UR0A 2D5RA 2GIRA 1I39A 4HVJA 4K4YA 4FJNA 1FKPB 3SFUA 1HNVA 3OYDA 2VG5B 2R2RA 4FLWA 3HVWA 4F4KA 4BDPA 4HCBA 1BQNA 4WYLA 3QERA 3OJUA 1IKYA 5KFTA 5KFFA 2FVPA 3EY1A 4ZP8A 4M95A 2HHSA 4DTJA 2FBTA 2HW3A 3HVTB 5F8JA 5L1KA 4OKJA 3KMQA 4LSNB 3AA4A 1UWBB 2F96A 4FJLA 2E9TA 4B8AB 3L3UA 4LQ9A 1K6YA 1EP4B 4PWDA 5DGBA 4CCHA 4KPYA 1J53A 2P1JA 2WONA 1SH2A 3HHKA 2AWZA 5F8GA 2DFHA 2Z1IA 1IH7A 5FDLB 5C42B 3AVBA 1SUQB 3MEEA 3SI6A 3KLHB 1WAFA 4Q0BB 4G3IA 2IC3A 2VWKA 4IKAA 4KAIA 3PO4A 1IKVB 3LALA 4KTQA 1T7PA 3SQ2A 3SFGA 1XR7A 1KFSA 4RUCA 3NE6A 1F21A 4QWEA 3RRHA 4FJGA 4IFYA 3N6MA 2HVIA 4KSEB 4MFBB 1VRTA 3UDLA 4KHQA 1R0AA 4TY8B 1VSJA 4HCCA 1KVAA 1JLGA 4XIUA 3MAQA 5C24A 3SYZA 3DMJA 1CLQA 3DOLB 2IBKA 4O44A 1TKZB 3DLGB 3ZSYA 4CEDA 4K8XA 4ECQA 4RW4B 1RDAA 4LH5A 4ZPDA 3OVNA 3KLGA 4CJUA 5DQHA 3V6KA 4RNNA 2RKIB 4B9MA 3RAQA 4FBTA 4C8MA 3NCIA 5CYQA 4ZMMA 3DLHA 3D5MA 4NLYA 2I5JA 1T05B 2XRIA 2KFZA 1HPZB 3ZSZA 4PQUA 3VQ4A 4DU4A 1RT2B 3EPIA 4DSEA 2J6UA 4ECXA 4FLVA 1SV5B 3KLIA 1D1UA 4M3TA 1FKOB 1S9GA 3C6TA 5KT5A 1HQEB 3L3VA 3ISND 4HUGA 1X9WA 4FLUA 1T94A 3KOAA 4RW9A 1N5YA 1S0NA 2FBVA 3JSMB 4IDKA 3K5OA 5KGWA 3KLEB 4N5SA 1NKEA 2D0AA 3SUPA 3QZ8A 3ICLA 4QWAA 1C1BA 4ECWA 5FRMA 4AHCA 3DOKB 4QWBA 3OYIA 3CJ0A 4O3PA 3V4IB 1TQLA 2BQUA 4HUEA 3OYLA 1VSDA 3PX0A 2JEFA 4K4WA 3MECA 1GOCA 5KFNA 4KFBB 5KFQA 4E3SA 5KFDA 2YKMB 1ZBHA 3QEIA 1RT7A 4M42A 1JLEB 1NKCA 4ZTFA 2XO7A 5KG5A 3SCXA 1TKTB 2ASJA 3HK2A 4NLWA 3T1AA 4NCGB 4Q8EA 4DF4A 5KFAA 3RMAA 3ZSVA 3AVKA 3VQSA 1C6VA 4QAGA 3NH1A 5HLFA 4TSXA 1LV5A 4KHNA 4Q45A 2C22A 1RBUA 1U47A 4R8UB 1K1SA 1U49A 5F9LA 3N6NA 3FQLA 5DG7A 3H98A 1W9HA 4QWCA 3U3YA 4U6PA 1RBVA 1RNHA 1RTJB 4EO8A 4CEEA 4FJ9A 4ZPAA 5KTQA 1N56A 1JXEA 3D0PA 5KRSA 4KHRA 2UVRA 5KT4A 3TQ1A 4E7HA 1SH0A 5I3UB 4XPEA 4CHYA 1OS5A 3AVFA 4DFPA 3VQ5A 3NGDA 1TKDA 4ECZA 4B9NA 2HNZB 3QYYA 2GBZA 4OL8A 1C0UB 4ZTJA 1HARA 2X6NA 3AO5A 1KLMA 4OKKA 4ED6A 3GV8B 4O55A 3H4DA 1JLFB 2IS3A 3LP1A 1WSGA 1DTTA 3CYMA 4CJVA 2WCXA 3VQAA 5KFWA 1FK9B 3VQCA 3HP9A 3KD5E 3VQ9A 1BIUA 2YNHB 1VSEA 1L5UA 1TAQA 3GV7B 5JS1A 4OKEA 3I0RB 3BDPA 2YNFA 4M3RA 1LWCB 4FJMA 3LPTA 3D45A 2V4QA 1XWLA 3ZT3A 4M3YA 4J9OA 1N6QA 3G86A 4ICLA 3V1OA 1QAJA 3AV9A 4O0IA 3HT3A 3DRRA 4URQU 4ED8A 1RT1A 4M3XA 3OHAA 1TGOA 4DTNA
chains in the Genus database with same CATH superfamily
1ZA1B 1RAHB 3W8PA 4X4RA 2L9DA 2GEMA 2GQ2A 4DR7J 2JC1A 2KXHA 3EZOA 4BY9C 4E7LA 5HK4A 2HHTA 4ILRA 3NF6A 4I4BA 1U0HA 1DEJA 1V9OA 1Q5YA 4L76A 3ZC4A 1PJ6A 2W25A 1ITPA 1QAXA 1FXDA 4ES3A 2KG1A 5EX0A 2B6AA 4OPKA 4YY3J 1MWYA 1WC3A 5EOYA 4DWIA 1GLCG 4AUKA 4JI8F 3A12A 5K8PA 4DS4A 4M5NA 3GFXA 5EU7A 1KOOA 2JGUA 2I7NA 2R7UA 1YLXA 4DV7F 4YORA 5BR8J 3KHRA 3WHIA 2ZE2B 4DV4F 3I82A 4CHNA 1C1CB 4ZHRA 2NUHA 4LSZB 4O4RA 5KFXA 3MEDA 4Q43A 2JC0A 4OI2A 2ZHBA 2CH6A 3CVKA 3FR0A 3VV2B 3BP8A 3HL8A 2M0GB 1HBMA 2Q1NA 1HNIA 2QXFA 3P96A 1B4SA 2J8SA 2YX1A 1OVYA 4JI1F 1QZ6A 2KT3A 3D7SB 5AQZA 4IZ9A 2EG2A 2N4DA 3DXMA 1ASUA 4B9QA 1BISA 2QW9A 1ZM2A 2QC3A 5E3RA 4K8RA 4WFBL 3OS1A 3VEWA 5I42A 4KO0B 4ECVA 4FVUA 5GIPA 1LW0A 4JV5K 4HACA 2ZM6K 1BA0A 4HUFA 3O3FA 2FVRA 4J9UE 3EE9A 2PEHA 1JJHA 3AVIA 5ETPA 2NYIA 4X65K 3CSKA 1YJWN 3T5HA 3NY0A 1SJ3P 2JLEA 3HBTA 4DTSA 4LFBJ 1YVNA 3HKWA 2BE9B 2JNJA 4U7BA 3TZYA 1VQ5S 1U02A 1QHTA 3NGKA 4K0KK 2AYMA 3SJJA 2QXLA 4M5MA 2O8CB 2HIQA 5ADZA 1FWPA 3DGPA 1TKXB 2ITMA 5A0YB 4ZP7A 3TVZA 2V67A 3MFIA 1NK0A 1Q7YO 4Y3CA 3M9NB 4IEEA 3M30A 4BHQA 1M5KC 4GW6A 1Z05A 4MDAA 3CFOA 5CZ2A 2KN4A 2AX1A 2H3EB 4B3SJ 1JNRB 3TA1A 1J2VA 4USUA 4OPJA 2QWMA 2AYGA 1KQSM 3W9IA 3ENBA 1AZSA 4L3NA 4FJKA 4Q7AA 3VEOA 3E51A 3UKUB 2LECA 2G0JA 1H98A 1UA1A 3HKZD 1N34F 1BQNB 1W7AA 4L3KA 1CVJA 3MN6A 3OYHA 3UVJA 1IKYB 1IBKJ 3ETOA 1F9FA 1RCHA 5HO4A 1VQ9N 3LP2A 4OLOA 3AA9A 4JAXA 1MWKA 1Q9YA 2AGOA 2BXJA 2CQPA 3FDSA 4UZCA 4C8YA 2HFOA 4YHHF 1IJEB 1A9NB 2AJQA 4N8OA 3UDCA 4MKYA 1H7WA 2BKPA 5LSLA 3MM8B 2P9GA 4PWDB 4KHPK 5I3PA 1FW6A 1UVIA 4FWRA 2WONB 3U8XA 4A61A 4DL3A 1CZAN 3CG7A 2OTJS 2OAUA 4OQJA 4LVNP 2IM0A 2VQFF 3C46A 3H5UA 4HTLA 1RBTA 4CZKA 2PI5A 1CJUA 1UP1A 1RBOB 4RWWA 2DHHA 4CJEA 2BM1A 2CAJA 3BPDA 1BI4A 4ID5A 5KFBA 4G9ZA 4PKGA 2IVPA 2W7OA 4F4WA 4IFYB 4JI4J 2EC0A 1RU2A 1X7VA 1HW8A 4P9SA 3BKFA 3MXIA 1R0AB 1OPIA 2HRTA 3QBCA 4DX5A 4KIAA 2G8VA 1YG0A 2FHOB 1WBDA 2BEFA 1RWVB 3WBZA 3ZT2A 4UY8O 3O9QA 3ISZA 3PCOB 3O3GA 4NXNF 4ZVSB 3ZZYA 2ZH1A 1ZAVA 1XR6A 3K2YA 4ID1A 1CZBA 3T1YF 2DBBA 5FPDA 3F41A 3V6JA 3NMRA 4MH8A 3DWLA 3KK3A 5GADI 3A8JA 4ED4A 1RYRA 2AF6A 2ILYA 5CYQB 2QGFB 2CPHA 5GADP 3WIUA 1YVUA 2E7VA 4OZ2A 5TKWA 3BH6B 3GWCA 2P9PA 4CJSA 1T11A 1RU1A 3A2FA 4ZCIA 4RW8A 1EXQA 2UVUA 1NGIA 1RILA 3GG4A 4DQRA 3QJJA 2AU0A 4KYZA 4OZJA 1Q16B 1BCMA 3LPUA 1VIXA 3DI6A 3MTKA 5KFUA 1LKZA 4PR6A 4ZP9A 2EK1A 4LFCJ 3TP2A 2EKNA 4NA1A 4C8OA 2ZH8A 1UKUA 3CFRA 4AM7A 4H4OA 1SC6A 5D4NA 2PBDA 5F3TA 4RUAA 3U4LA 2CPJA 1GX6A 3OVSA 4X2BA 3BSAA 2Y1IA 2KH9A 3CC4N 3AA2A 1X4GA 3K57A 1YWXA 2JDJA 1Q5VA 4ED0A 2PFDA 5AQXA 4NXMK 2CPFA 3WIVA 4AXJA 5CD4H 5DJBA 4E7KA 2Q79A 3UI3A 1RT6A 1NDLA 5HOOA 5AQJA 5DQGA 3G96A 3FJ2A 4KH0B 3ENWA 5AQYA 3PR4A 2V34A 5EX3A 4K5RA 4RW7A 3W66A 2P9UA 4NLXA 4CLLA 4F4AA 4TU9A 5C2CA 1HNWK 4FL9A 5KT2A 2UXCJ 3QQCD 4AF1A 4IG0A 2ZQBA 1IBMF 1U04A 3WZ0A 5JICA 3VPZA 1NM2A 4MKAA 5CZ1A 1MG7A 4U96A 4KC5A 1RHRB 4O3QA 1UFKA 2PMHA 4U9RA 1Z25A 1L3KA 4M3ZA 4ILGB 3DJCA 5L39A 2KZZA 2QKBA 3W2VA 4F4ZA 1KKHA 5AQUA 3SDEB 3I0SA 4I56A 2K7KA 5IWAK 2LLZA 2F9TA 2W7AA 1GOAA 3G4SN 5CCMA 4HI1A 2XYGB 3E66A 2QLWA 3H2LA 3AOBA 2HBKA 3CCVN 1ULRA 2ZWPA 2HK3A 4RBUA 3HHLD 1AYEA 3L2WA 4KJIA 1RT3A 2D69A 4GKKJ 1SZ2A 4KREA 4CD1A 3OW2M 1C4AA 3HVRA 2DGSA 2JL9A 4EHUA 3RBDA 2BANA 1J5EJ 2P9SA 3PSIA 2UUCK 5JVGL 3R5BA 2V9WA 5A8WB 1IBLJ 5F41A 4ZCKA 4USHA 1AUSL 3P31A 4AH9A 3GR0A 1U1LA 3MAHA 3TTFA 3R8EA 2FGOA 2FF3B 1S6QB 2J7UA 4JP8A 4A59A 2ADCA 1VQLN 4NLSA 1WOPA 4ZS6A 3A5MC 4IXCA 4C0BA 1YRXA 2E1RA 4MLEA 4BR7A 4CGJA 2OI2A 2Z4PA 1AW0A 3RSEA 4H5RA 1NJIO 2HGLA 3QB0A 4A57A 2HQDA 1Y11A 4RU9A 2DHAA 2R7QA 2RF2B 1NGAA 1A7GE 1QQNA 2PN6A 1WKLA 1FDNA 1RISA 3HRGA 3W60A 3CCLN 4CJLA 4LF5J 5A76A 1Q7LB 2ZVIA 5DG9A 1HD1A 1WI8A 1BIZA 2GWJA 3Q22A 2YWGA 2VBZA 4DX7A 4RNMA 3WNGA 3FE1A 3AH6A 3A5OC 3CC2S 3T3FA 4HKQA 2WHOA 4M5LA 1X1PA 5EXWA 1OY6A 1MSWD 1S57A 1CG2A 2OPSA 2E6LA 1KAYA 2NLXA 1SKUB 3V4MA 3NWRA 3JXUA 5KFVA 4A47A 1U6FA 1TK0A 4RU2A 1T44A 3AJ2A 4GVLA 3VQ7A 2Z1HA 3GP9A 3DGVA 4NI2B 2D4WA 4R5PB 2YKNB 1KC8T 2X1GA 6FDRA 4PQAA 1VHFA 5HP1B 5LM7E 2FLPA 1VSMA 1XBWA 4J91A 4BACA 1ATSA 2GAGC 4TN2A 2DH9A 5ETTA 3AB2B 2F8MA 3IR7B 3OUYB 3PW0A 2P9CA 2HNDA 2WVEA 3TUPA 4FZYA 1V3ZA 3NCPA 5LSOA 2CIMA 3MEGB 2RJZA 3N9UC 2JEIA 4DR5F 2HGMA 2VH7A 2L3MA 3R5DA 5ETLA 3C16A 1HMVB 1FRXA 3EL2A 3KLVA 2A1RA 4R0EA 4M45A 3QZ7A 3T5JA 1OPZA 3LL3A 2CPIA 4CJ3A 2J8AA 3C7NA 2P8IA 1AFIA 2V4RA 1NHKL 1NMEB 1VI7A 4ED3A 3LDNA 5AQFA 4OX9F 1VISA 2OPQA 1DARA 3V1QA 4V1Ak 1UPPA 2XHCA 3P8BB 2LU1A 4UUWA 3MAAB 3D1HA 5CXTA 3RB4A 4ED7A 3BGUA 5FROA 2QJ3A 1QLNA 4B3MK 3QESA 1RDRA 1XR5A 3THWA 4Q2MA 4H4MB 5J2PA 1J9AA 4CH7A 1SI9A 1X4BA 4DR4F 4DTXA 4IG3B 2FC9A 4DTPA 2DGTA 4CZLA 3UCZP 5KAKA 1UFWA 2Q3PA 4LFAF 3PW4A 3V9UA 3U1LA 4BRAA 4IQMA 1FDDA 4NE9C 2WK4A 1IKXB 3CJ7A 1RBSA 3KFWX 2ZC4A 1BWEA 1YI2N 3GQCA 3BV8A 2YNIB 2UVWA 3SQGA 1SKWA 3J80U 4Y1DA 4KKOA 1NPPA 2HBYB 4BR9A 4FVCA 1HWLA 5IT9U 2WW4A 4B3OB 4CZEA 1UFLA 1FT8A 3CJKB 3TJ9A 3RTVA 1EX4A 1RWPB 3OL6A 4ECRA 5M1PA 4IO9L 5G0RA 2XSJA 2HNYB 1RTZA 4EZ6A 1VQ6N 4JV5J 3GE1A 4JRQA 4OYBA 1C0TA 2AP6A 4HYKA 2F7TA 1OSDA 4LF8K 3PRDA 4FF4A 4X65J 4WQ4C 1GK8A 1TL1B 4YOEA 2E5HA 3VEYA 2G8UA 1N4LA 4ERDA 1TL3A 1D8YA 2F40A 4CJ5A 2X3DA 4CJPA 1C1AA 4K0KJ 5HMZA 2GGPA 4QW9A 3MEKA 3KKRA 4W5QA 4IOCQ 5H1SQ 4DJBA 1BWVA 1LXNA 4K4VA 3V9ZA 1FERA 2ZOMA 4HR2A 3L2QA 3US5A 2VG5A 2VD3A 1OJ4A 2YNGB 2NNWA 4CHZA 3K8WA 4MYTA 3O80A 3T6JA 1HYVA 2PY5A 3UKRB 1VOMA 4QW8A 1ITGA 4C1NI 1VLYA 3CCQN 4B3TF 3I96A 4RL1A 5AXKA 4BROA 4U7UK 3HVTA 1VJWA 3G8SA 1VQ4S 2KQ2A 3HP6A 4NYFA 4ZN3A 2FLNA 4AHTA 3OFHA 1YGYA 5FD1A 2ACYA 5F3ZA 1ZM9A 2CNLB 2LKZA 1EP4A 3GIIA 3EGWB 3DU6A 3SAGA 3MR6A 3ZTRA 1FX4A 3ILLA 2WSEC 1DT9A 4Y2CA 3EGVA 2VODA 4RNOA 1SAZA 1PGZA 3KNAA 2GTDA 3GPAA 2QSFA 4KHPJ 4NYNA 1TUGB 5JLFA 3IS9B 3NAHA 3HOTA 1SUQA 4JKHA 4Q0BA 2P51A 3CJ5A 1VBXA 4WYWA 5CE3A 1PAUB 4DUTA 3C95A 3VQDA 4V19X 3TAEA 4B9UA 4A8YA 2KVQE 5KG0A 2Y0BB 4EO6A 3WQUA 2OSQA 2DB1A 3EICA 3QEWA 4MFBA 2BA9A 3V6DB 1C2PA 1S72N 4AHSA 2IM3A 3M2VB 1E3MA 2OZSA 3QT7A 2ROPA 2DNQA 1RBLA 2HZCA 3W8GA 1H1VA 4JHDB 3DLGA 4ECUA 1LWFB 3EX7B 3K58A 2DVIA 2BYCA 2HHQA 2AJ2A 4RW4A 2E5LK 4TQRA 1NJWA 2ZJRL 4TQSA 3QRRA 3BQ0A 2GUIA 4C9DA 3BF3A 3ONQA 1K8KA 1P9YA 3FRYA 1E6YA 2VQEK 2MQMA 4EMDA 4FWKA 5HN0A 1SV5A 1BY9A 1FKOA 3ZNUA 4DR1F 1S6PB 4DQSA 1DZ5A 4E89A 4Q2LA 2BJ1A 4LF1A 4JKAA 4DV2F 3R27A 5EY4A 4LY7A 2E88A 2FJVA 1KHWA 2HBMA 2F4VF 4JKFA 1U25A 1RLCL 5KOWA 4AL5A 3TANA 4CH0S 3DOKA 3V4IA 5IM0B 4JD2B 3IMXA 3QLHB 3QEPA 5E5NA 2KYZA 3QFPA 3W3DA 4C7QA 4K59A 2LVWA 3LA0A 3FZLA 2BE7D 3VGVA 4OVLA 1J5OB 1YITN 4MQ3A 1JLBB 1K1QA 1BHNA 3C15A 1NM1A 2OO4A 1OWXA 1QUPA 2EHGA 2YKMA 1LFWA 4EZ9A 1QSSA 2O8DB 2AT1B 1XUPO 4NXMJ 1D9FA 3GFYA 2IIRA 5KFMA 3IGNA 1F2HA 4TXSA 4RZRA 3SV3A 3MPVA 4CZMA 1S77D 1FTCA 1S9FA 5F9NA 3UB5A 3OBIA 2D3O1 2E7XA 3LAMA 5DRKA 4YQWA 5KFKA 4DCPB 3QAEA 1RTJA 3PTWA 4DSFA 4K4UA 4CFCA 1HWKA 4CT9A 4LR7A 4JKEA 2F63A 3NLCA 3GFHA 1VQPN 1FRHA 4DR6F 1RUSA 1HNWJ 4B02A 2QE5A 5I3UA 3M32B 2GQCA 2Z1JA 3DXKB 5AQHA 4MO5A 2X1FA 2OP5A 3ULHA 1BL3A 2A5XA 3DLEB 2BV3A 1FF2A 4FWLA 4QWDA 1UCNA 4FWQA 2PA3A 1APSA 4DV5K 1JWWA 1TYQA 3ATVA 5IT0A 1FJEB 4OZNA 4E19A 3M1VA 2UU9F 2RS2A 4EP5A 3TX0A 4LF7K 1MWQA 5IWAJ 1PJ5A 1IM4A 5AQPA 1S6UA 2ZNZA 4P6QA 3E8OA 1NPRA 1YRUA 5BXIA 1HBNB 1S7IA 2J9DA 1HR0K 3R97A 3CPWM 4TLQA 2ATCB 1E4FT 1EKEA 4FWMA 4FPAA 4JB8B 5T7LA 5HI7A 2UUCJ 2V2KA 3KJVB 3T6BA 5DDPC 1NGDA 2C2DA 2FVSA 3BEXA 4BRHA 1GLLO 4MIWA 4I9LA 2OPPA 3D9BA 1RABB 1RT4A 3AOCA 4DMNA 2MY7A 5J2MA 3LM2A 1NH8A 4RJVA 4IJAA 2V68A 3CERA 5CA5A 3NG8A 3HHLB 4NA3A 1WEZA 3LW5C 2QWNA 4MAKA 2CGJA 1S1UB 1OMSA 4ISGA 4NLOA 4OMFG 4WE1B 1GLEG 2VJUA 3KWIA 4O0JA 4QQBA 1L3UA 4LF9J 5LMNK 1Q81T 2QWLA 3TAFA 1JLAB 4GVBA 2NRTA 3GDQA 4E1MA 1X4AA 2HRUA 2YV0X 2PYJA 2N82B 2OELA 3SUNA 2MQPA 4O4GB 3POTA 1FX2A 3WX4A 5KFJA 5E26A 3J81O 4CF8A 5FLXY 3VTIA 4LBIA 3IN5A 2EXUA 2KDOA 5AJ3F 4G65A 3UNGC 3G71S 1OIAA 4CTAA 1HBUA 4FM1A 3MDFA 4DUYF 4D3GA 1BOTO 1YTAA 5GVQA 1H3DA 3TUJC 1QSYA 1UOCA 4E1JA 4FBUA 2UVVA 2J0XA 4CEAA 3M8SA 3D66A 2SXLA 3KK2B 2R8JA 3Q8PB 2YJEA 2YI1A 2WBRA 5KT7A 1Q18A 1RZMA 7AT1B 3O3LA 2XMTA 4PL7A 4M94A 1XK8A 2V8VA 2O5DA 5C25B 4MK9A 2NRVA 4IJNA 2W9CA 2OPRA 5A2QO 3RB0A 1KC8O 4LIWA 1QE1A 2ZEJA 3LQVA 3J8AA 3VQEA 4BG8A 1CZ9A 4CD3A 2F1FA 5ETNA 1EB0A 2IJRA 2RH3A 5LL6d 4I0WA 4CF0A 4W98A 4KT0C 4LSLB 2G2ZA 2C3UA 5AT1B 2CG8A 2RUSA 4X4OA 2E1MC 1MMLA 3OYEA 2R7VA 1MU2A 4B1VA 2H1YA 1LXJA 2WVBA 4CESA 2G9OA 4D3HA 1AFJA 2R7OA 3VOVA 3VAJA 2GIRA 2W4CA 3ZYYX 2N3OA 2GA7A 4HVJA 3UDVA 1HNZK 2RQKA 2DNMA 3HT0A 1FKPB 4E8UA 2ERRA 3SFUA 3OYDA 1TMMA 5K9FA 4F4KA 3R5GA 1O51A 1GQEA 1NG9A 4C0OC 5KFFA 3JSBA 1CULB 4M5DB 4ZP8A 3TUZC 2HHSA 4H5TA 2CJAA 2H54B 1YIJS 4EK2A 3X3UA 4PEOA 4ZPTR 4LSNB 2KKHA 4JYAK 4B8AB 3DDNA 4P72A 5FPEA 1S4EA 1K6YA 3AXMA 3CB4A 1SBRA 5DGBA 2HHHF 4WQ5C 2H3GX 4A2BA 3D2EB 4C98A 1LNQA 1X4CA 5F8GA 3S6EA 2E20A 4AFFA 5BPMA 4ILHA 4JK9A 4NO7A 1LK5A 1NDCA 3CCES 1KAXA 2KB2A 3QT5A 2VWKA 4IKAA 4B3MJ 4K43A 1KWMA 2ZKTA 1AUDA 4KTQA 1T7PA 4CI0B 1XR7A 3RRHA 1VHXA 3IBFB 1MW7A 1ELOA 1B99A 3U1NA 2HVIA 1RHQB 3N6MA 2OFHX 3AY9A 4HCCA 1T3OA 1KVAA 3J80Y 2B0GA 3CCRN 3UN3A 2KJWA 4ED5A 1YAGA 1TUVA 3GE9A 1KVKA 2HSEB 5IT9Y 4LRAA 4K8XA 4ECQA 4ZLLA 4LH5A 3OVNA 2BH1A 4CJUA 4QR0A 4OHYA 3BN7A 3CJSA 4JBCA 2F9WA 2M4MA 4B9MA 4C8MA 5AQTA 4LFCF 4ZCMA 5HJYA 2E1YA 4NLYA 2I5JA 2PO4A 1NGGA 2VUGA 2CWXA 2KFZA 5GAHI 2PEBA 1HPZB 3ZSZA 4PQUA 5GAHP 3KLIA 1S9GA 1X5TA 1YJNN 1HQEB 3L3VA 2KXFA 3ISND 1U1NA 2NXNA 3QRPA 4FLUA 3I6PA 4PXDA 1TL5A 3EVWA 3KOAA 4LF8J 2FDNA 4CYUB 3THXB 1HJOA 3JSMB 4IDKA 2AZ1A 2DEJA 3K5OA 5D0EA 5AXMA 5KGWA 2BOPA 4QS7A 1PILA 3SUPA 3QZ8A 4QWAA 3O5BA 4O8KA 5AZJA 3CJ0A 2C42A 1RHUB 4EUVA 2P9NB 3G82B 2OGUA 1RHKB 4K4WA 3B8AX 1KDNA 4NMXA 3OT9A 2JWLA 1P6TA 3R1LA 1JJ2R 2NUUG 1JLEB 4TKTA 4GMKA 1KD1O 2DR9A 2ASJA 5AE2A 4NCGB 5KFAA 3ZSVA 3VQSA 4BRLA 1WOSA 3AA8A 5HLFA 3FZFA 3MMVA 4M5IA 3VAKA 4Q45A 3D6FB 1N54B 1YJWS 5F9LA 3MMAA 1OH7A 3U3YA 1RBVA 1RNHA 3R6MA 4DV6K 4CEEA 4ZPAA 3VALA 2K1RB 5HL7L 2M52A 4KY3A 4KRWA 2UVRA 3TQ1A 2GVDA 4CHYA 3OV7A 4QU7A 3AAWB 3NGDA 2BKOA 3CD7A 1WOQA 2GBZA 1GMVA 3GCWP 4K5SA 1C0UB 1I1GA 2X6NA 2X3GA 1EARA 5BYQA 1YHQN 3W65A 4ED6A 1V6HA 1HBOB 1DTTA 3OR2B 1CPZA 3VQAA 4LJMA 3VF4A 2IY5B 2J5AA 1CJVB 4W4MA 5AE1A 1VSEA 2YNHB 5L38A 1TAQA 4A5AA 2YNFA 2E1AA 3LPTA 3D45A 3D0HE 1XWLA 3NVKA 4M3YA 4ICLA 1S12A 2NZ4A 5FLXO 1U26A 1VC6A 1QAJA 3GJRB 3AV9A 4ED8A 3PXGa 3CPEA 1D8ZA 2RSQA 3BKTA 4Y0WA 1VQ9S 3IMQJ 3TSQA 1FRJA 3AAQA 3MCOA 1U2VA 4DF8A 4X64K 3S8SA 2W41A 1YBAA 3HHNB 1BC6A 4LQ3A 5BRFA 5BREA 4CLWA 1D3WA 3DM2B 2NRHA 5DLGA 1HQUB 2DNOA 3ZZ0A 2E5LJ 1EETB 3NGZA 5F8LA 1HYSA 3PO5A 1SL2A 2XZTB 3R6GB 3TA2A 2AYEA 4H03B 4NB4A 3EKSA 2W42A 2ZF5O 1KONA 1JX4A 3THYA 2E29A 1RAEB 3MD3A 1QS4A 2V7YA 4DFMA 1JLCA 2VQEJ 4OJGA 1JXVA 4M63A 4BWJA 5FPMA 3L2UA 3MD1A 4WK3A 2CGKA 3DOMB 2AGQA 4USJC 2B9YA 2HQIA 1DFDA 2DITA 1U48A 1PYSB 2HB5A 1OSCA 1S1WA 2RRBA 2QKKA 4DZ6A 2CJYB 1YTYA 4DXLA 3WT0A 4BBYA 2DFFA 1NDPA 4DQQA 1OY9A 1XEZA 4B9VA 3AO4A 1WB9A 4LF4K 2BR0A 2LQ5A 3SAFA 4IO8A 4IRDA 2IAJB 3ILJA 5JLHA 5EWFA 1ZBIA 3MM9B 1X9SA 4AM6A 3ULEA 2W8LA 2GMHA 3THVA 2MQNA 4WJBA 3ID8A 3ZFVA 3CJ2A 4ANCA 3Q7CA 1IV0A 4KV8B 3OYMA 4A8WA 4OYAA 2DGOA 1JCFA 1BQMB 2VC0A 1FEEA 3I9V9 4IH7A 4OGCA 1RWXB 5LJVA 1A5WA 2BJ9A 3MXHP 1NSPA 3C14B 3MUMP 4H0YB 1CC7A 3TAPA 4F8RA 4IH6A 2DTJA 5HJXA 4KB0A 3NHGA 2LQ9A 2QG9B 2XMMA 1HFEL 3P45B 3GYXB 2HWTA 3NMAA 2FSJA 4JKCA 3CO0P 2B56A 3QIPB 2CNNB 2F8EX 3W2WB 3DRSA 5GAGI 3RBEA 1LW2A 1S22A 3Q8QB 1VQON 3V5RA 4I6AA 4DU8A 2Y8YA 3CCWA 3U02A 1YUWA 3LUYA 4I68A 3ZX2A 3OPKA 2ZD1A 2FHJA 3CJQA 2Y1JA 2XY6A 1T6DA 1JK9B 3QEVA 5D77A 4DTRA 3EGZA 3BN4A 3CC4S 4WKRA 5M1NA 1EJ7L 1UVJA 3AVHA 5HATA 2FXUA 3BO4A 4EBCA 3OTOK 2JVRA 2KT5A 4Y65A 2BE2B 3T5LA 2PE8A 4DV5J 1X9JA 3FMBA 3VF0B 3FFIA 3OFEA 2V8PA 5K5MA 2XLIA 4C8KA 4FPBA 4ISEA 4E1NA 2GELA 3B6OA 3OHRA 4H8KA 1SJ1A 1YJVA 4LF7J 4HH0A 3HZEA 3A5NC 1RTHA 4W5NA 2HFZA 3KG1A 2BW7A 1ZBFA 2QRRA 4WF9L 1UMJA 2DO0A 3H0PA 4ZVFA 1ESVA 2LEBA 4FWOA 2W9BA 1HR0J 4OLAA 4ZVQB 1S7HA 3HI0A 5AZIB 3AVCA 1ZA2B 1RT5A 2W2PP 2Y3YA 3M2UA 3HJFA 2IYIA 1W0HA 3L2RA 2YWWA 3UQSA 4DFKA 4X4UA 1X4EA 1ZM4A 2XMJA 3TNVA 3ZTQA 4AILC 2ZH2A 3RG6A 4JLHA 2XGQA 3I33A 4F02A 3NGSA 3MEEB 1KCFA 2PD1A 4HHHA 2IFXA 3AY0A 2IC3B 4O3RA 1NK9A 1RTDA 1WACA 3G4SS 2BDPA 3AVMA 2AGPA 3LP0A 4LBPA 2YX6A 3CCVS 4LRDA 1WJ9A 4DSIA 1FE0A 4C11B 5LMNJ 4FPRA 1RA6A 2OHDA 3K5NA 1TL7B 1KR4A 4J9QA 2I2YA 4UOCA 2D7SA 2W9AA 2QYGA 1O0PA 1JLGB 5C24B 4OI6A 5CABA 3WEEB 1S1TA 2ZM6F 2P9LA 1FESA 3RYLA 1Y9OA 1TK8A 4O44B 1VSLA 3N79A 1GEHA 4WQ4A 4M1KA 2R2UA 3F0NA 3G6XA 5AXLA 3J7YU 3M8QA 3NOCA 2Q97A 2NRWA 2ZH6A 3FCVA 1LWEA 4Z4FA 2GO8A 2GHVC 1ZTWA 2FUG9 2PMWA 3C0BA 1Y4ZB 3QIOA 3P5JA 1N33K 2RE2A 2H51B 5D4OA 1VQLS 4PL8A 4WFBQ 2Q36A 2W2MP 1FRKA 2XY5A 1HWIA 3NAEA 3W64A 3AVNA 1NOZA 3SUQA 3LF0A 1GLJO 5KRTA 3C6TB 1IR1A 4Y2AA 1Y64A 3KNGA 4PHTX 3EJMA 3G0ZA 2UUWA 4EFHA 3U7JA 4RW9B 3GTYX 1DQ8A 3MX2A 3CCLS 4C97A 2OEJA 2P2CB 2BOAA 1FRLA 4DFJA 2P5OA 3SI8A 4CZJA 5B08A 5B0AA 1GNKA 4AQYK 2XZWA 1C1BB 3RR7A 3AVLA 4OLPA 2CQIA 3A8KA 2KU7A 1VQ7N 3EVOA 5EGYA 2MHNA 3MECB 4EBDA 1Q78A 2RRNA 3KG0A 4WZMA 1SC1B 4CFBA 3PVXA 1RT7B 2NRRA 5HBMA 4OI1A 4B1YB 4XDDA 1HNZJ 5AFUA 3ZZTA 3R7BB 2MSSA 4IOXA 4HDHA 5C10A 4J2EA 1Q95G 5D3GA 1Y3JA 4YOXA 1FJCA 4N56A 2IMWP 2JVOA 3CDUA 3NWGA 3TVYA 1VSIA 2XZDB 4FW1A 3NS7B 3PYDA 3J7A1 1R27B 2ZDOA 4KHYA 3IGVA 4QPXA 4JI8K 3H08A 3DHWC 2ZUAA 4F3QA 1MROB 2RB7A 4CM2A 1PYOB 1UVKA 2GS8A 1EKSA 2ZZNA 1UVMA 5KFZA 2DNRA 4ILLA 4JYAJ 4C23A 4G1PA 4DV7K 3GFZA 3C3LA 2F5GA 3F73A 4FVMA 1YZ7A 3NOGA 4DV4K 1L3SA 4CJFA 3RRGA 4KQZA 4RUHA 3JXOA 2MSTA 3GCXP 1HHTP 2CPDA 3R7SB 2O1PA 2XQCA 3LP1B 4Y34A 1ZC6A 2YKQA 3MPUB 4ECYA 1Q53A 4USWA 3AO2A 2KFYA 7FD1A 1QJHA 4KR0B 4RBTA 3ZNJ1 3OL7A 4JI1K 2M5YA 2IGIA 2QM1A 3I32A 3I55N 3M2RB 2WB4A 2PZSA 4GV3A 1TV6A 3D2WA 2VONA 1IKWA 3C66A 1RT1B 4DS5A 1VLOA 2HWIA 2FD2A 1S9EB 3SUOA 2V8HA 1V3RA 3FCHA 2VGMA 1K8AO 1FRMA 4BR0A 4FN5A 3EO3A 1M1GA 2H4YB 3MCSA 2EFNA 3QNNA 1U0HB 2V7ZA 4CO2A 1B64A 2CQCA 2LQ8A 4I2QA 2B6AB 3BO2A 1XC9A 4JI0J 1CQMA 3RVCA 1OYDA 4GV6A 4P2FA 3W1YC 5MLCV 4PG4A 2R2SA 2W24A 1S99A 2WSCC 4CBXA 3FEYB 3U9ZA 6FD1A 3O1BA 3NBPA 2I9SA 4GMJB 4ZHRB 4J9LA 3H1QA 4PPDA 3MEDB 1VYAA 3A8EA 3CD6N 4RCHA 4CE9A 2CFXA 2DY1A 1Y5IB 4KH1B 1RBRA 5CYMA 5E3AA 1HNIB 1H2TZ 1Y5LB 1YI2S 3M8ZA 1HNXF 1N34K 2RU9A 3G8TA 3DXMB 2B9WA 3PW2A 1HNWF 2EEYA 4FXDA 4XO0A 1CJTA 3GBTA 3MXMA 4FM2A 4H5NA 3H8YA 1VQYA 5I42B 3NGUA 3DYAA 2JFDA 4NZ0A 4YHHK 1H2VZ 2BQRA 3P49B 4QZVB 3FGVA 1LW0B 2CQBA 5C5JA 1FNXH 4HACB 4DLGA 1ZS6A 1VQ6S 3M6GA 2NREA 5JXSA 3QO9A 1RGVA 2OFGX 2CNOB 1UEUA 3M6VA 2N7YA 2VASA 4OZ0A 2VQFK 1A6LA 2VCPA 4DV6J 4X4NA 4EIAA 5K14A 2W40A 2AP1A 3JTOA 2I38A 1KSPA 1ZXOA 1KEKA 3UCGA 3SPYA 3SSQA 5DQIA 4CEFA 4DPYA 1FWKA 1VQSA 4OHXA 1JXLA 2G8FA 3U27A 3DGPB 3CCTA 2FJDB 4EP4A 5EN1A 4EHTA 1FFGB 4KI6A 2HHUA 3Q83A 4DOZA 4CNYA 4NLUA 3M30B 2KHCA 2MLZA 2GV9A 3CJBA 4LRFA 4DR2F 4DL4A 4FK4A 1U6BA 3VGLA 1N8RO 2YKOA 4GKJF 3N6LA 4DLEA 1MN9A 4X4VA 5HVGA 3L4IA 1AZSB 2VF3A 4CEBA 4NXNK 4NYZA 4FWSA 1I3AA 1T6CA 3IG1A 1YQHA 3IRXA 2BW2A 1NUEA 3SQOP 3EPGA 3CCQS 3HVAA 5KFPA 2I7PA 1IN0A 3UVJB 4F67A 3G9CA 1FJGF 3OYBA 3IUCA 1NXIA 3LP2B 1Q79A 2ITGA 5AQQA 4GRSA 3VN5A 4F3OA 2YWFA 5ADXA 3ET6A 4DTOA 4KGVB 5JVGQ 1KBRA 2GQQA 3D2FB 2OUGA 2HSTA 3QRQA 3HHEA 2ZJPL 2U1AA 5DLFA 3H3OB 3KZBA 4LH4A 3PHEA 3GILA 4JRPA 2FF6A 5RUBA 4I2PA 3OJSA 3OTDA 2HS0A 1D9AA 4YFUA 3G6VA 1WORA 1OYEA 2HBRB 2PAVA 3L7OA 5IXUA 4DCOB 2WRMA 4FKXA 4EYIB 1CJUB 5I4MA 2HIYA 2JZ5A 1WHVA 4M41A 4UY8T 1HX1A 2KG0A 5CAAA 1BI4B 4ID5B 1Q8IA 2QX0A 1S72S 5AFUH 3K7RA 3MUTP 3E9OA 4F36A 2Q0UA 2UXDF 4J2BA 2RDJA 2AJ1A 3KVGA 2K2PA 3GB0A 1KTQA 3AB4B 2YCHA 2YH0A 4LF4J 4BC3A 2VG6A 5CYJA 3GONA 3NH0A 2ZH3A 2W2QP 2LFVA 3OY9A 2A3ZA 1TVRA 1RE1B 2FZCB 4BRDA 1FE4A 5KG1A 2E2NA 4NLCA 2DT9A 2B8QA 4Y2MA 5M1OA 3KK3B 2ALYB 3PY8A 3C65A 3KD1E 2HHXA 4QIFA 4RWXA 1WTFA 5EHHA 2P9PB 3OVAA 9ATCB 2DFEA 1XQIA 5L46A 4DQPA 4RW8B 3W61A 1IWAA 5ETSA 1H6KX 4IOAL 1EQYA 4Z4GA 1LOTB 2PFFB 4B9SA 3DI6B 4QIEA 1LOUA 2O3DA 4ZVGA 2OMOA 3NRBA 4CZFA 2OIHA 4H4OB 3CMQA 1YITS 3K0JA 3SCLE 3H90A 3C6UA 4FF1A 4ZJOA 1GOBA 3PRBA 4CVNE 3ENAA 1RSCA 3TPQA 5ITHA 3GSDA 3OTOJ 2L48A 5DG8A 5KPRA 4WQ5A 3SV4A 4PYDA 4OX8A 5SUHA 2QTDA 1VSHA 1RT6B 3J81j 4FLYA 4QIWD 2R8IA 1UZHA 1MA9B 1RYSA 1HI8A 3EE3A 4B9TA 3TVKA 3R7NB 1WBBA 3NGIA 4NYPA 2AKWB 3M6WA 4CW7B 3PJ9A 4U95A 4RW7B 4OYZA 1W2IA 5KFGA 4KE5A 2P9UB 3VEXA 2YX4A 4HT5A 1ICEB 1VQPS 1KNZA 4DL6A 4ZLPA 5EDWA 2YPZA 2ZGZA 5AR0A 4ANDA 2J9CA 2W8KA 3DC2A 4FS2A 1Z6RA 1RFQA 3WXMB 3ZSQA 3W0LA 3BREA 2G8WA 1B70B 4CJRA 4IG0B 4NL5A 1BA1A 5L1JA 1VGYA 4OYXA 1HI1A 2GNKA 3MUVP 5B0CA 1KVBA 3ZEUA 1NNEA 2CNKB 3Q24A 3KLHA 4OIXA 3ELHA 1URNA 3JB9k 1IWGA 3O4QA 3W2VB 2ETJA 4USKA 3I0SB 5AQGA 2P9KA 3HFKA 4U67L 1HL6A 1W26A 4J7CA 1G1XA 4GVMA 1AA1B 3O3HA 4DR3F 1UA0A 4MLHA 2MJNA 3Q8VA 3PW7A 3P4UB 5L9XA 4AHUA 3VGTA 2QI2A 1VQ8N 3OBWA 2VPZB 1KQSR 1RT3B 3BR8A 2JFKA 4CLYA 4FYDA 2BANB 2P9SB 3ULDA 2P5GA 3PJXA 4P75A 5D78A 3ZCMA 4MO4A 3Q8UA 2ASDA 2Z58B 3KMSA 4BRGA 3FSYA 2YH1A 3D3CJ 1UEVA 3AGRA 1R3NA 1NJIT 5DO2A 1UVNA 3GIJA 2CQGA 3QWPA 2CPXA 4HHUA 2LXFA 2ZDPA 1PC4A 2J6TA 2OJ3A 1N33J 1RT2A 8RUCA 1FHTA 2WTUA 4H0OA 1FDBA 3SMSA 2GMLA 1RADB 3KUGA 2MKHA 3CQ8A 1TUYA 3VF6A 4IO9Q 1T9VA 3RBZA 3I31A 3RSEB 2NPFA 2FHKA 1E6VA 4B3RF 5EWEA 3AFGA 4Z7CA 4UQTA 4X4PA 1SCJB 3D6TB 3NMUA 3P4IA 3FKBA 3KLEA 2XWYA 5BN8A 1CEZA 4Y28C 2VA3A 5B7WA 4DI6A 5KFLA 3VMFB 1S5ZA 2UUAF 2FVCA 3CXCR 4DR5K 2LEAA 4AQYJ 2RHQB 1XQSC 4UT4A 3MCAB 4H0VB 4WYBA 5KQ8A 1M90O 1WSEA 4MDBA 2DJWA 3QMQA 4RX6A 3OTCA 2QFJA 1VC5A 3BBBA 4JI6K 2FZGB 3ENVA 1YSJA 2IJFA 4E2FB 2KW4A 1HD0A 2LDYA 3IR6B 2YWEA 4OX9K 4Y2KA 2CG4A 2MLYA 4BG9A 4CK1A 2OPSB 4KB7A 4B1WB 4IRKA 1R31A 2MTLA 2GUPA 2Z0GA 2PC6A 4Y2IA 3Q8SB 2Z8QA 2R8GA 1J54A 4A8XA 3MM6A 4MIAA 3QLHA 1WC6A 3DHXA 2IRYA 2V4JA 3G2XA 2BTFA 4JI8J 3K17A 2I1RA 3MM5A 4F4XA 2Q66A 3VENA 1WEXA 3GZ7A 2HNZA 2RIJA 2VDHA 4DV7J 3TA0A 4UF4A 4DR4K 5CD4A 1NWKA 1JLFA 4DV4J 3K2PA 3DDKA 3BSNA 4YB6A 1DAXA 4LFAK 3RU0A 1FK9A 1EIYB 2A3JA 2BJDA 3D3BJ 2DEIA 3EE8A 4TYBA 4PA1A 2R9LA 4Z0UA 2FJWA 1LWCA 2HNDB 2YWKA 3ZSRA 4ETZA 4FWPA 3PLAA 2HVEA 2P6TA 3M1FA 3CQXA 3NH2A 2PFUA 2J76E 4PPZA 4CEOA 1N0VC 4JI1J 4FO0A 5B09A 3I4HX 1WTBA 1QVGM 3OFGA 2RRAA 4HI2A 3NGRA 4X84A 4XEIA 3SAHA 1R6VA 3C16B 3VA3A 4CFAA 1VBZA 2P9IA 5KFYA 2DIVA 5DZ7A 3J7Z5 2KYXA 4IR9A 5THWA 4K50A 3TAGA 1T8EA 4XK8C 2VFRA 1CS4A 1U7LA 2XB2D 4NCBA 1SPBP 2MZSA 3LPYA 4NX9A 1JB0C 3MR3A 2EW9A 3PEJA 2A41A 3SBTA 3BJYA 4P2SA 4O3NA 3OSNA 1R8CA 1F9EB 1NDKA 4KHMA 1EZZB 4A62A 3O1LA 2OPQB 4NLTA 4CLKA 2ZJRQ 2Q43A 4CLPA 4UUXA 1OH5A 1NK7A 2QWQA 4BE2A 3FZBA 2QLJB 4PRFA 3TYTA 3MWPA 3R2CJ 4OPAA 4Y1CA 1XMQF 2NR0A 3TO8A 2Z57B 1XTZA 3BGRA 4BRQA 3THWB 3D0GE 1ZBSA 4MKVA 4AXIA 3DLKA 5J2PB 2BRKA 2FJEB 1Y3KA 5HRPA 1SQEA 4CBWA 2R4FA 4WU3A 1RDDA 4ATNA 4H5VA 4A2AA 3CCRS 3V81A 3CUNA 3AAPA 4F50A 2O8FA 2G4BA 4RLEA 2EG1A 4ENOA 3BS9A 2DCUB 3OW2R 2N3LA 3DAWA 3P39A 4B3TK 1N34J 2GMJA 5LL6Z 3UN2A 3SQGB 2F8SA 4KKOB 1QDUB 1XMOF 1F60B 2UZAA 3TAQA 5L9NA 2J9EA 3E01A 2VV5A 2AMCB 1H0HB 2LCWA 3FVYA 2EPIA 4ZVTB 4YHHJ 2FBYA 3FRZA 1YJNS 1IQTA 3C8YA 5G0RB 2XSJB 1ZTTA 3CIPA 3OD2A 3ZTPA 2BJEA 4DSLA 1C0TB 4DV1F 4OJRA 2FJAB 5KFRA 1S97A 2NUBA 4KB1A 3DU5A 2KI2A 2VQFJ 4DPUA 5GMEA 5H9EK 1TL3B 2DH7A 2RU3A 1SC4B 5F0UA 1RCXB 1NSAA 3MPYA 2Z2YB 3TI0A 2Q6BA 1BWFO 3CJ9A 2E5GA 3GIKA 2GGPB 3UIQA 2NXCA 3SNNA 2FGCA 1IXKA 3DLLL 4Q44A 4C1NK 1WHXA 2QV6A 2DNLA 1W7WA 3KDOA 1ZAWA 4A8KA 2XMAA 4YOWA 4FJNA 2CZVC 3CGIA 4S0MA 4PCQA 1HNVA 1U2FA 2VG5B 3G8QA 4FLWA 2KO1A 1U1MA 1P9QC 4BDPA 4CLSA 4HCBA 1WF0A 4CWBA 4UOGA 2V52B 3OVBA 4NXNJ 3S7RA 2XSFA 3EVMA 4DZDA 3T1YJ 4I6YA 2CXEA 3HVTB 2ASYA 5F8JA 5L1KA 5BJRA 3KMQA 3O2IA 4FJLA 4CO0A 2DO4A 2YY3A 4DR1K 4BGAA 2EKYA 1EP4B 3MHYA 4LBHA 4DV2K 4CCHA 5LJ3Y 2J0QD 5GMDA 1J53A 4RTFD 2P1JA 2AWZA 3I56N 1YHQS 2DFHA 1IH7A 2DNKA 1DRZA 1SUQB 2F4VK 1RHJB 4IUFA 4IEIA 4Q0BB 1XJWB 4G3IA 2GIFA 1VJQA 2DCLA 3R3TA 2MB0B 2MQQA 2U2FA 5FPNA 1NSQA 3NE6A 4QWEA 2QMXA 5C12A 1DY3A 1JQGA 2BUNA 2CZ9A 1WKKA 2DISA 4P2MA 4MFBB 1VRTA 1NGFA 2GV1A 2KM8B 3BPSP 3M8YA 4RUBA 3DMJA 2C2OB 3L09A 3DLGB 3PIOL 3F56A 4RW4B 3KLGA 2RMLA 2NYHA 1X0FA 3JAMO 4C0HA 3KWGA 3DLHA 4X4QA 3BYPA 1UTAA 1P1TA 2XRIA 4WP8A 1K8KB 4B1XB 1E6YB 3VQ4A 4J8FA 3HD1A 4FLVA 1SV5B 2BJ8A 2DGQA 3CCJN 1FKOB 3EWGA 3HCXA 5KT5A 1HWJA 4DN9A 4DB3A 4JI3F 1X9WA 2ASOA 1VS3A 4USIA 2BX6A 2RQMA 1N5YA 5K8NA 2D0PA 2A18A 1RAAB 2A2CA 2FBVA 4OYPA 4HVZA 4OZ3A 4N5SA 3VAMA 3AD7C 2UU9K 1RCOB 4AHCA 3DOKB 2F9DA 1UJ6A 3OYIA 4O3PA 3V4IB 1TQLA 4A48A 2F4FA 2BQUA 3OYLA 2Q0RA 3TTCA 4KH5A 2JEFA 1GMWD 3C15B 4NPOA 2RHKA 5KFQA 3CDAA 2YKMB 1RWNB 1NU4A 3OTBA 4ZTFA 3SCXA 2YXLA 5CH7B 3HK2A 2HZAA 3O9UA 1UL3A 4Q8EA 4OYMA 3NNAA 1C6VA 4Y0FA 4ALZA 1DJ0A 3R1XA 2V8DA 5JVHL 3IRWP 2FHJD 1LV5A 4KHNA 3PYFA 1U47A 3CULA 1NPKA 3LPEA 4LR9A 3M4XA 5DG7A 3H98A 1WKJA 1RTJB 4EO8A 4HTJA 2DNPA 2HYIB 3GL1A 2LU2A 1RDWX 1SH0A 5I3UB 4XPEA 1VQOS 4DFPA 3IAM9 4DX6A 4B9NA 4YEAA 4OL8A 3WXIA 5IV4A 1OO0B 1KLMA 1KQKA 2M3DA 2YBVA 2QYCA 3C19A 2WCXA 5IT4A 3MCNA 2EK6A 1TYQB 2JRSA 3VQ9A 3QNWB 2WB1D 4UZBA 1L5UA 3M1VB 5I9EB 4M3RA 2EFQA 3T1HF 3ZT3A 5AJ3K 1N6QA 4BRNA 3ETMA 3IR5B 1SXLA 4DUYK 5DM6Q 4LF9K 3NS6A 4O0IA 3HT3A 3DRRA 3L9ZA 2RQCA 2UUBF 3W3SA 4V19J 4C4WA 4WFAL 3DCAA 5KGXA 4I1TA 2IHR1 2A1SA 4PZVA 4F2SA 2M8HA 3LH2S 3TEGA 4H54A 4YR0A 4FXWA 5T7LB 3H3NO 3K8VA 1RDBA 3TZWA 2CPZA 4IQXA 3A13A 4Z2XA 2C2MB 4DEZA 5ETMA 2OPPB 4JOUA 2DR8A 4MTPA 1RT4B 2A10A 5J2MB 4ED1A 1QAIA 3AQPA 3HPOA 1W2BM 3VQPA 5A6WA 2CJXB 1IO2A 1VSFA 1ZM3A 4ECTA 1B9DA 4IFVA 1K44A 1WDDA 3PKYA 1TTHB 3VERA 1OVQA 3IDHA 4CJWA 4CM0A 4NEZA 3TQEA 4F0MA 1I94F 1FXXA 3KHLA 2N4CA 2NRXA 1FXRA 4KPCA 4B9LA 2QEXN 2LXUA 1J27A 2Y8WA 4X62K 3M6XA 2G13A 5M2UA 4GVBB 2VIHA 3HZ6A 5M1FA 3CCZA 2D1CA 4BRFA 2AEJA 3POTB 4XH5A 2PDAA 5AQWA 4M3WA 1SQFA 2YQ1A 5B0EA 3SBMA 4DR5J 4YB7A 4FOIA 4CTAB 1HBUB 1MDUB 1O6XA 1S79A 5H1SV 3FSIA 4ID8A 4CJ4A 2VPXB 2DTUA 2IBOA 2CYYA 4KGXB 3CC7N 4OJHA 3O8WA 4TU8A 4FCYA 1N5QA 4E0DA 3RAXA 4JI6J 3RMCA 5T41A 2AV5A 4OLBA 5LMUF 3MM7A 2XLJA 3QGIA 2HHHK 1N36K 2V50A 4DMZA 4OX9J 1UAWA 2BRLA 4AYBD 1LFPA 2W9CB 2OPRB 5KFEA 4NLVA 4BRMA 2O4GA 1PKUA 1QE1B 4WFXA 5KG6A 3E3XA 4PABA 3BH7B 2AA4A 3H2VE 1NGHA 4EEYA 3EXCX 5HL7Q 3OXLA 2MLXA 3CCUN 4J9RA 2Q31A 3KJQB 2KHOA 1DGKN 1A5XA 1OY8A 2D41A 4M7XA 4RW6A 1N32K 4BR4A 3R2DJ 4ZCLA 1VQ7S 3PKMA 1MU2B 4DR4J 3N4WA 5CZXA 4B08A 4PKDB 4X64F 3SLCA 3UR3C 4M5GA 4FDFA 4LFAJ 5G4DA 3T41A 1JLQA 4BE1A 2V63A 4ETXA 1WSRA 3T19A 2OEKA 3V9XA 2GHPA 4YR2A 1M5VC 5ETOA 4NASA 4U7CA 4DSKA 1FCAA 2GIQA 4HT7A 1T03A 3D4JA 8AT1B 2J6SA 4CHQA 3GU0A 3R9LA 1NH7A 4LR8A 2K7JA 4NZ6A 5CZVA 4DPWA 4XH4A 4YB1P 4IFEA 1Y0HA 2DRDA 3CJAA 1QQOA 1Y10A 5HQ8A 2HGNA 2AJFE 3NDKA 2IDOA 4N47A 1W25A 5J2QB 4FOEA 4P52A 3S3OA 3RMBA 2HBZB 1U1PA 4U8YA 3E9LA 1XNQK 3VETA 4CIEA 1IVZA 4CBUA 4JI2F 2O8EA 4PUOA 4FK2A 1KAZA 4KTZA 3KJNB 2X6SA 3LZJA 5E3QA 3H40A 1G7CB 1G15A 3MK6A 2O4IA 1CSJA 3NNHA 1YTUA 3BDEA 3I55S 4DL2A 2UXBF 4H5WA 4WU2A 4JI5F 4OJ3A 5KPZA 3VQ6A 3MWBA 3IKMA 3RB6A 1TK5A 4GY2B 5M1QA 2LXIA 3BEGB 3CDBA 4JI7F 3CT9A 1JKHA 2NZTA 2WTFA 1UPMB 3UD5A 3H42A 3DRPA 3CPWR 4CK3A 3HSDA 3K5LA 1R59O 2UYTA 4NLPA 4B3TJ 1GLFO 3NF8A 2CQ4A 4TYAA 3IXQA 3NL0A 4PKHA 3IO1A 3F9KA 4J2DA 3BZCA 3OR1A 3NF7A 2B5JA 1OH6A 4IKFA 2I5JB 3HPHA 2YWHA 4PQUB 3PZPA 2XC9A 3KLIB 1V3SA 2KTQA 1S9GB 2DR6A 2RDIA 3AO1A 4CJKA 5IQ6A 5E3PA 2KLAA 1DTQA 4F7VA 1AROP 5F0XA 5HRSA 3CMAN 1WSHA 2G2OA 2V2QA 2J7KA 3OL9A 1HUXA 2KFNA 1MN7A 3CJ4A 5KG7A 1GAOA 3CD6S 1N48A 1SS6A 4IDKB 3IFRA 5KFHA 2DY4A 1KD1T 5B0FA 5H9EJ 9RUBA 2F8HA 5E33A 5AZJB 2Z56B 4OI3A 3P5BP 3W62A 3WXJA 2ZOFA 2ABYA 4M5JA 1NCLA 4A4JA 3PEHA 1S0OA 1O13A 4KGZB 1GLAG 3OA9A 3RAMA 3B78A 4B1UB 3MDQA 2VB6A 3UDEA 4BE0A 2H65B 3MI7X 3L3CA 4WZQA 3FBBA 3M9OB 2HZVA 4M3UA 5HLFB 3N0VA 1SC3B 2FB0A 4CQ1A 1NGCA 3U3GA 2WVFA 4WF9Q 3A3PB 3NS5A 1WF1A 3MMAB 4X4SA 3WC2A 3VGSA 4O0NA 4FYVB 3QAUA 4P2XA 2VWBA 4MT1A 3CEDA 4DR1J 2GVDB 2RUGA 4DU3A 3N01A 1S1XA 1U1RA 4IBNA 4JEPA 1S48A 4DV2J 3TUIC 4ZN1A 3UCUP 1QSLA 4PYAA 1NK6A 3BKUA 2B4UA 2ZKUA 4DTMA 5KT3A 2BKNA 3DRXA 1DTTB 1NK8A 2F4VJ 2VU5A 1EWRA 1OQ3A 4CERA 3ZT4A 3VVTA 1R8HA 3LWMA 3BZQA 3ZT1A 1X4HA 4KGMA 2LMIA 3IWXA 1REGX 4EBEA 2J0SD 2YNFB 4DQ8A 4HDGA 1S59A 1S1VA 2XM3A 4ICLB 3KKSA 2OTLN 2W2OP 1GTEA 1N33F 4CEZA 1BD6A 3KLFA 1XNRF 1NMNA 1U2VB 2RE1A 5GAHU 3QSYB 1GMUA 2DKOB 5HROA 5SZTA 4ANEA 3O4NA 2WUSA 2LSNA 1KFDA 3L7PA 3Q0AA 2C2ZB 4G6VB 2W4PA 1WG5A 1TFWA 3GJQB 4LF6F 1C0GA 2HHVA 3QBXA 4L72B 1HYSB 5BRHA 4QR1A 1WUAA 3TRGA 3MMCA 4ZVRB 4ZPVR 3THYB 2WBNA 4N77A 1KHVA 5DK5A 1N0UA 2XS5A 4OJ1A 1JLCB 1HWUA 1PJ7A 4LIRA 1VDHA 4BRKA 4DG1A 1D4XA 4OZ5A 3ITHA 4A8SA 4DV0F 3PRVA 5F8MA 1S9EA 4PXCA 2R3VA 4Y00A 4A8QA 5C2DA 1S1WB 2HMPA 2IM2A 3WQTA 1HHSA 3HFVA 3ILIA 1PBUA 2XMWA 1YRTA 4ZA1A 4NRTA 2UU9J 4ED2A 2M9KA 1HIYA 4X66F 2CVIA 3P83D 2D9OA 3LTOA 1LAVA 2G8KA 3P5TL 2WOMA 2PIIA 3ULEB 4URSA 4ZVEA 3I8DA 4LMZA 2NXEA 1REVA 1RLDA 4M5KA 2CGLA 2X78A 2DPIA 2ZBQA 3PX4A 2C3YA 2BQ3A 1T02A 4DR7F 1SIZA 1S4FA 1ASWA 1QY7A 3MWTA 3VAGA 2BJ3A 5M1KA 3NKYA 2JJ4D 3QICA 5HQMA 4CECA 2JOQA 4XAKA 1M0SA 3S3NA 4YY3F 3CMEN 2QZ8A 1WG4A 1NHUA 3QNOA 4DUZK 3EXYA 5HQLA 3MCMA 4OHWA 1M1KO 3KYLA 2ADBA 3TABA 4U8VA 3DRSB 1LW2B 2HBLA 1QVFM 4WP3A 2WVDA 2DXEA 2ATLA 5B0DA 5BR8F 4ILJA 5J2NA 2ZD1B 4QIVA 3MURP 1HHQA 1Q1KA 2X51A 4L75A 3TW0A 2D0CA 4KTWA 3QDKA 3S01A 4F2RA 2VG7A 1VRUA 4MJKA 4KHSA 1KXPA 1YJRA 4Y6IA 1LQ9A 1VFJA 4DTUA 2RAQA 3CI5A 1WF2A 4YDUC 1SKSA 3M8PA 5J1EA 2LA6A 4CLUA 3FFIB 2VL1A 3MFHA 4JKGA 2OZMA 1SIWB 4AHVA 2O8BA 2D0BA 3KG4A 4HHJA 3QEXA 3QETA 1K73O 5AJ3J 1EX8A 3MOJB 1RTHB 1UW9A 1H7XA 2HBQB 4DUYJ 1SJ4P 1WEYA 2M8DB 5LT5A 2E2QA 1QHAA 3O44A 2W9BB 4IRCA 3LDSA 2QFIA 4LUBA 2Q3SA 2ZBCA 1RT5B 4GO7X 2Y1LB 4LRBA 3AD8C 4CJTA 2GFFA 3M2UB 1IUJA 2AEFA 4FYXB 3ILOA 2IOCA 1BUXA 2E7WA 4Q8FA 3C2PA 3QGHA 4DCHA 3GYNA 2FHMA 2J9DE 1O1WA 1B0VA 4KH6A 2KVIA 2ZH4A 2MKCA 3OS2A 4GC7A 4LFBF 4I7FA 1KRPA 1GX5A 2UV8G 4CNZA 2B4OA 4YDXA 2GAHC 3VAIA 3ENQA 3X1LB 1KOHA 2OCEA 1K0TA 2H48B 5CQGA 1RTDB 4BC2A 2Z1GA 3O08A 3LP0B 3SIPB 1RTIA 1RDCA 3J81U 1VQ8S 1GXTA 3D6RA 2EFOA 1JJ4A 4X62J 3ENHA 1KQFB 1B9FA 3D2FA 4B3SF 3PR5B 5CCLA 1NO8A 5A6PA 3WX8A 1CQNA 1D5AA 2YX7A 1S1TB 2VC1A 2ZBRA 2P9LB 4CI6A 1KTVA 4ZVOB 4FLZA 1NGEA 3FBFA 2COLA 1F3VA 2KL8A 3TAMA 1IBKF 3M8QB 5K8OA 1Q9XA 5A2QU 3MMBA 1LWEB 1QTMA 4OI4A 1AB8A 2OLWA 4BC5A 2ROEA 5GAGU 2ZJQL 4OYWA 3LAKA 2GX8A 3AQOA 1SL1A 4PG6A 5DM7L 5GIOA 5C0YA 2B7BB 4E7IA 1BLUA 2HHHJ 1O8BA 2XYPB 3WNEA 2ACMA 1N36J 5HANA 2NQPA 3CXCM 4ELVA 1XHXA 3QIDA 5IZHA 4DL7A 3CJRA 2XHWA 3R6LB 2CQ0A 1NRKA 4MK8A 2HMIA 1YBTA 2E8AA 1VQMN 1CXUA 4WFNL 3JYTA 1NEEA 3KHHA 1XN9A 1FA0A 3UD3P 2MKIA 1JL2A 1DLOA 3G10A 4G1QA 3UW1A 4GC6A 2FYXA 2IA0A 4J37A 2C2NA 3HXMA 4CFDA 4JI4F 1N32J 4CGDA 3HM8A 1PYTA 3TR8A 1NJYA 5FJ4A 1O5JA 3ZT0A 1R8PA 1V4TA 1X4FA 1DKGD 3PIPL 1RWOB 2DHXA 5LJWA 4USMA 3VVUA 5HBMB 3PSFA 3HMJG 1A0OB 3ENOA 2OYQA 2YQ0A 2C2RA 4W5TA 2CJKA 1ZPVA 3GV5B 4FSVA 5D3GB 1SJQA 3HO1A 3VEZA 1ATNA 3Q2TC 1Z26A 2GC8A 3HI9A 5DM6L 1B3TA 5SWMA 2DK2A 1PBAA 2RN2A 1IBCB 5ETVA 5A8KA 3OXFA 1UWBA 5C7PA 2RVJA 5BYSA 2VFVA 3T69A 3S41A 2O66A 2HQCA 4RG8A 3M8WA 4M7YA 3QWUA 1Q82O 3A8YA 2POKA 5F8IA 5CHIA 2ZJPQ 4FNHA 3DLBA 5AQIA 5FDLA 5C42A 2VFSA 2IM1A 2DGUA 3N4QA 2DGVA 3LDOA 1BUPA 1S10A 1B7FA 3GR1A 1MMDA 2OD6A 1XNQJ 4JI0K 1IKVA 3ALYA 1K9MO 4ZIVA 3H5XA 2GVZA 4B8CA 4AL7A 1HNXK 4F25A 5KT6A 1U1KA 3THTA 5KFOA 1K8AT 3EGNA 2WSFC 4PAAA 3OQ2A 4TY8A 1TV6B 1KP6A 1BMQB 4Z4HA 1IKWB 4PWWA 3BZKA 1DHMA 4ZPBA 2NLWA 3DOLA 2V94A 4BDYA 4I69A 1YBUA 1TKZA 2JHEA 5A8RA 2XLKA 3KJFB 2CPYA 1NKBA 1VQNN 3QPIA 3Q23A 2E9RX 4W5RA 1HJRA 3SCKE 2RKIA 4IOBA 4LF2A 4FJXA 3QGPA 1WSJA 5EX5A 2KJVA 1T05A 3C6HA 4I2QB 4F04B 2HG4A 5CY4A 2UXCF 3W5YA 3T5KA 3QJPA