4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
3CDEA 4DF4A 1T3NA 2PYJA 1C1AA 4KO0A 3H5UA 4Y1DA 1C1CB 1NKCA 3KLIA 5HLFA 3NF9A 3OYCA 2ATLA 2D0CA 1KLNA 2ETJA 4RUCA 5KFLA 4CGDA 4NLRA 1SL0A 4IDKB 4R8UA 2HWIA 1ITGA 3PY8A 4CHOA 1RTJB 5C42B 3OSNA 5KTQA 3B6PA 3OY9A 4DSKA 4CIGA 2ILZA 1WSGA 5F8MA 3G0ZA 4LSNB 1JXEA 3KLGB 1ZBUA 3KLFB 3T5KA 3QIPB 1QUVA 1LV5A 4IH5A 3S3NA 4TY8A 1Y97A 2BQUA 4G1QB 1RTHB 1U48A 4CCHA 1T03A 4WFYA 3OYIA 4E89A 2HHQA 2WONA 3K59A 1TVRA 1ZETA 1TK5A 3L2RA 4EO8A 3DYAB 3LANA 1BIUA 3QZ7A 3EYZA 1VRUB 3K5OA 4MH8A 4M3YA 4QWDA 1CSJA 2VG6B 1YT3A 5DGAA 3CFPA 3JYTB 2YNFB 1KHWA 3ITHA 3I0SB 1HPZB 1UOCA 3G86A 4XIUA 3VQ4A 1F21A 3DLKB 1GX6A 3HP6A 2W42A 1G15A 3L8BA 3SUNA 4I9QA 3I0RB 2X6NA 4DMNA 5DG8A 3BDPA 4C8MA 1S49A 4CEZA 1WSFA 3AO4A 3IG1A 3D28A 1DLOA 1B9FA 1NNDA 1YTAA 4DTPA 4DSEA 1S1UB 4FJIA 1ZBIA 4N47A 2ZKUA 2IOCA 4KB0A 2XGPA 2E9ZA 2VG7B 1TP7A 1VSLA 4RUAA 3DLGA 4OKKA 3L2VA 1RT4A 4YNQA 2QK9A 4FM0A 4ZP8A 1S0NA 4B8CA 1NJWA 3HVTB 1EP4B 2C2EA 2UVVA 2PY5A 4FZZA 5KG4A 1SV5A 1NK0A 3VQ5A 4F2SA 2E9TA 4M3RA 2XY7A 5DQHA 3GV5B 3NAHA 4O3NA 3MEEA 3TQ1A 3CFOA 3QEXA 4FK2A 3V4IB 2XRIA 1KVBA 3DMJA 1NKBA 4WXOA 2FVCA 4KV8A 4YMEA 4QPXA 1OS5A 1RT5A 4DSJA 3LWLA 1QSYA 1REVB 2KZMA 5I3UB 4OJRA 3TAPA 5F8JA 4TN2A 4B9SA 4LD0A 4O4GB 3HVAA 2W9BA 5CYMA 4KHYA 4QWBA 5HP1A 3RMAA 3G6YA 4E7KA 4DFPA 2VG5A 4BE1A 4QWCA 4C8LA 4I7FB 4ED2A 1U47A 4CEEA 2RN2A 4CJPA 3L2UA 3PR5B 1D5AA 4KAZA 1RT1A 3RRGA 2EHGA 1LWFB 3GIMA 2O4GA 4U6PA 1UA1A 3DLHA 3DOKA 1RT3B 1X9SA 1S5JA 3OYJA 1S10A 1WSEA 1JKHB 2R8IA 2D3ZA 1D9DA 1FKPA 2C2DA 4B8AB 1TV6A 1TKXA 1L3SA 4E7LA 2ALZA 3KIOA 4ZVGA 5HROB 1WSHA 4Z4EA 1SUQA 1KHVA 4JLHA 3KHHA 4ZVEA 3KKRA 1CLQA 3HXMA 4IH6A 5DQGA 1S1WB 2ITGA 5SZTA 4ZVHA 4B9LA 1WSIA 4J9QA 4NCAA 1RTDA 2IAJB 2HMIA 3KK2A 4DS5A 4DS4A 3NAEA 2R8GA 2O5DA 2P5OA 4FJ5A 4EYHB 1J5OB 1QHTA 3EPGA 3QINA 3OYHA 3TAMA 2DY4A 1C1CA 2BQRA 1RCHA 1QE1B 2D0AA 2XGQA 3PUFA 3CDUA 4ECVA 2UVRA 2R2SA 2ASDA 3AO2A 3SFUA 2PZSA 5KFAA 1SH2A 3NH0A 4B9UA 1TAQA 3KK3B 4ZP6A 2DFHA 2GUIA 3SQ0A 5SWMA 1BHLA 3DI6A 2JEFA 4O5BA 3LZIA 3AVGA 4RW7B 3QO9A 5KFFA 3H4BA 2A1RA 4B3OB 4Q5VA 2Y1JA 4YR0A 1A5VA 3H2LA 1RBTA 4ECQA 4M94A 2AGQA 3BSAA 3SPYA 3DRRA 3TI0A 1QTMA 4KTWA 2AGPA 4QW9A 4R5PB 4HTUA 2HHSA 4CGGA 3V9ZA 4FJLA 5KFVA 3CJ0A 4IG3A 4AHTA 3K58A 4EBCA 1JLEA 1S6QA 1JX4A 2OH2A 2B6AA 5KFNA 1XR5A 3PZPA 4NYZA 4MIBA 2RF2A 4JV2A 3OYAA 1S9GA 3AA4A 4W5QA 4NLSA 2JEJA 4NCGA 1R0AA 2QXFA 4IKFA 2G8UA 3KLIB 3QIDA 1RBVA 5HLFB 2DFFA 4ELUA 3VQCA 2QE5A 4CK2A 1C6VA 1N56A 1JIHA 2GIQA 1S97A 3AVNA 3D45A 1RDRA 2D41A 3NAIA 2R8HA 4X2BA 5CY4A 1QSLA 3V6KA 1TK0A 4IG0A 4CJQA 1ZBFA 3DLEA 3HVRA 2PYLA 4DTSA 2Q3SA 4QWAA 4FM2A 2HHWA 4LQ9A 3H08A 3LWMA 5KG5A 4NLWA 4TY8B 4F4ZA 2AX1A 2YHBA 3HVTA 1T03B 4ELVA 4AILC 3V6JA 2WONB 1CZ9A 1TVRB 5KI6A 1S4FA 5F8HA 3V6DA 1W25A 5FROA 4EO6A 4DQQA 3OLBA 4DTOA 1VSFA 2JC0A 4CJFA 3L3UA 1WNSA 2P51A 4O3RA 1CXUA 3QNNA 4FW1A 2KW4A 5KFDA 4CEFA 1TKTA 4EYIB 4MFBA 4CJKA 3AA2A 3EZ5A 3QLHA 4F4KA 5KFGA 2W8LA 1REVA 2XWYA 2UVWA 4DTMA 1WLJA 4O4GA 2LSNA 1HNIA 2OPSA 3VQ8A 4CGFA 3SYZA 2YKMA 1KSPA 5HRNA 5J2NA 2QV6A 1Q9XA 3KLVA 3IG1B 1C1BA 2WHOA 1DLOB 4TYAA 1HNVA 1ZTWA 5KFRA 3C95A 3CWJA 3Q8PB 5C25A 1N5YA 3MECA 4KAIA 4CEAA 3THVA 5L1LA 3SFGA 2O4IA 1CXQA 1RDCA 3K57A 3DLGB 3QERA 1TKZA 4DL5A 5DLFA 1RT4B 4BDPA 4Z4CA 1X9WA 1ZBHA 2J6TA 2QKBA 1LAVA 3P1GA 5C24A 4ED0A 4CJ4A 3JSMA 3FRZA 5J2QA 4DU4A 4BWJA 4CFDA 5KFMA 4E19A 3F9KA 4W5TA 1NK4A 1C0MA 3V1OA 1LWEA 1Z25A 4TY9A 5KG2A 3MEEB 3MFHA 1NK9A 4FJKA 3OYGA 5HRPA 3DMJB 4ZHRA 4QWEA 4KHMA 3LZJA 1BI4A 2BRLA 2GC8A 4KV8B 4CJ3A 1RDBA 1K1SA 2DFEA 3HO1A 4N76A 4FXDA 2D0BA 3HP9A 1RT5B 3KLEB 3HYFA 3SNNA 2HHUA 3AVKA 1BL3A 2HNYA 4F3TA 2FVRA 4Q43A 1O1WA 3WNHA 4HCCA 2W9BB 1RILA 4JV0A 5CYMB 1TKDA 2YV0X 5HP1B 1UWBA 4FJHA 2FJVA 1SH0A 2GV9A 4DG1B 4FLTA 4FLYA 1S1TA 1VSEA 1RT1B 4PQUA 3TANA 1EETA 3V9XA 3DOKB 3NCIA 1W0HA 5F8NA 3O3FA 3SJJA 1I3AA 1RBUA 3G6VA 2OZMA 4ECTA 1FKPB 3C6TA 1TV6B 2G8KA 1QAJA 1TKXB 2IM2A 4ECYA 3AO5A 2HWHA 2IC3A 3BQ0A 1SUQB 2YKNA 3DLRA 3HKWA 3D5MA 3B6OA 4NLXA 1RT6A 4CESA 1HYSA 1RTDB 5KT3A 2HMIB 3KK2B 3FQKA 4OGCA 3GV7B 2HHVA 4FYDA 4Z4FA 4RW6A 4YP3A 4HKQA 3RB0A 4TSXA 5FRMA 3AA5X 1C0TA 4Q45A 3PX4A 3IS9A 2P5GA 3FDSA 2F8SA 3LP1A 3TAMB 1NHVA 3D0PA 2FLLA 3DRSA 3OYFA 4O44A 1IKXA 3S9HA 3NF6A 2XY6A 5KFCA 2IDOA 3NF8A 4CEQA 1HJRA 1SKSA 2VA3A 4DL6A 3N6LA 3GILA 4O55A 1L5UA 3AV9A 4DQRA 3MAQA 5L1IA 2X74A 4RG8A 3DI6B 3HPHA 3BREA 4M41A 2KQ2A 3QO9B 1BCMA 3RMCA 1RT7A 2V4RA 4CJTA 1RYSA 4FZYA 2F96A 4KHNA 4TQSA 4K4XA 2IJNA 2ATQA 1NJYA 1I6JA 4Y1CA 4BE0A 4FJMA 3HJFA 3DRRB 3TAQA 1S48A 1LAWA 4IG3B 4L8RB 3PHEA 2B5JA 4H4MA 4DL3A 1DTQA 1JLEB 1S6QB 3HK2A 4ECRA 2KTQA 2B6AB 4MK8A 1FK9A 2AJQA 2FLPA 2RF2B 4OPKA 4M3ZA 2HAIA 4FBTA 1L3VA 3ZSYA 3I5CA 1S9GB 3OVNA 1IKYA 4XPCA 4URGA 4NCGB 1R0AB 4EP4A 1CZBA 1U4BA 1LWCA 3K2PA 4CJRA 3OJSA 3OL9A 4FLWA 2V9WA 4J9RA 5KFBA 5EU7A 3MEGA 3T3FA 3ISNC 3K5MA 2HW3A 2E4LA 4MK9A 4IG0B 4Z4GA 3I5BA 3DLEB 5DMRA 4CIFA 3U6FA 4ED8A 4WFXA 3DDKA 1NJZA 1JLGA 2VWKA 3KNAA 2Z1HA 3PW4A 4QW8A 3MTKA 1SKWA 2WTFA 3QEWA 4GC7A 2XCPA 4JS5A 5KFPA 4O3QA 2WRMA 3G6XA 3FFIA 3ZSWA 3V6DB 3GIIA 3HVWA 3KOAA 4XO0A 3M9OB 2YNGA 5JS2A 4HUGA 1WSJA 4HYKA 4IFVA 4LH4A 3DLBA 4FJJA 4M45A 4PA1A 1TKTB 2HNZA 2EC0A 4MFBB 2WK4A 4Y34A 3KLEA 4ZPCA 3QLHB 3LP3A 2WOMA 4DQSA 1S9EA 1B9DA 1RAJA 4I2PA 1GOAA 2UUTA 4N5SA 3SI6A 3RAXA 2G8VA 1NK8A 5EUHA 4MIAA 1HNIB 2OPSB 1XR7A 2YKMB 1JL1A 3AVMA 5J2NB 4CGHA 3V9SA 4RW8A 1KVAA 2CKWA 4J2DA 3FSIA 5EDWA 4DG1A 1C1BB 4Z4HA 3RMDA 1HNVB 3ICLA 2ILYA 3LP0A 4FM1A 3RAQA 3M9MB 5I42A 1NHUA 3PX0A 4LH5A 4FK0A 4IR1A 4O0IA 4YFUA 5C25B 3P5JA 1N5YB 3MECB 3H5XA 4ZVFA 2D3UA 3KD1E 5DG7A 4EZ9A 1X9MA 3VQSA 1TKZB 1VSJA 3M8RA 4CK1A 4AHUA 4KPYA 5DLGA 4RNHA 3OYLA 1VSMA 5K14A 3AVJA 3VA3A 3ZSXA 5C24B 3CJ4A 3JSMB 2FLNA 5KFZA 5J2QB 2V4QA 4I9LA 3NDKA 4FJNA 4CF8A 2VWJA 1RYRA 2IJFA 5KFHA 1LWEB 1JLAA 3MXIA 3BQ1A 1MU2B 3MR2A 4ZHRB 2I5JA 1BI4B 3VQAA 5KFJA 3LPUA 4JS4A 3HPGA 5KT4A 4OGEA 1IH7A 3T5JA 1KRPA 4KHQA 1VSKA 2HNYB 4KHRA 2FVQA 3NGYA 3BSNA 1UA0A 4LSLA 1UWBB 1HQEA 4Y2CA 3OL8A 3VQ6A 2DPIA 2GIRA 4DU3A 3EZUA 4QOZB 2FBXA 1BQNA 1S1TB 3IGVA 2WCXA 3KLHA 4PQUB 3MR6A 1EETB 3OSPA 4QCLA 3MR3A 4O0JA 2B4JA 2IBKA 4Y2AA 4QAGA 5FDLA 4RNNA 2OPQA 2ASJA 4ZP7A 4NYFA 3VQ9A 4RNFA 4HUEA 4J9SA 2D7SA 4JRQA 3C6TB 4DTNA 5KFQA 2XC9A 1XC9A 2XHBA 2IC3B 1A5XA 2YKNB 4CJLA 4CGJA 4YQWA 1U09A 2R2RA 4TXSA 4K4VA 1ZYQA 4CEDA 1RT6B 2FVSA 1HYSB 4C8KA 4ID1A 1JXLA 4DFJA 3CVKA 4NLOA 4RW6B 3RR8A 4M3UA 1WNEA 4Y3CA 1C0TB 2OPPA 3IS9B 3M8PA 3UQSA 4H4OA 3LP1B 4IQXA 4DQIA 1BIZA 4K4WA 3DRSB 4N56A 2WB4A 3IRXB 3NKYA 4O44B 1IKXB 3O4NA 5L9XA 3QETA 4AH9A 4OPJA 4KHWA 4BACA 2FBTA 2FVPA 2AWZA 1S0OA 1FKOA 4JRPA 4R0EA 2AGOA 3ZT1A 4CERA 5F9NA 2DTUA 3SUOA 3IAYA 3RB4A 1RT7B 1NK6A 3PJXA 3RB3A 4K4ZA 1Q9YA 4KI4A 1KCFA 3M9NB 2GBZA 3V81A 1N48A 4AHRA 4DL2A 4Z0UA 3SZ2A 2W9AA 1EX4A 5KFIA 3OS0A 3CJ5A 4J9PA 1S6PA 3U3GA 5KRTA 2FBVA 2ZD1A 5JXSA 5F8GA 4CJSA 2Z1IA 2B5JB 5JUMA 4H4MB 1NOZA 1DTQB 3WNFA 2IM1A 3SI8A 1FK9B 4CEOA 1XR6A 4HUFA 1RDAA 4ECUA 5KFTA 2W7OA 3KMSA 5CZ2A 3IN5A 4IRDA 3N6MA 4OKJA 2XO7A 3RR7A 4G3IA 3ZSQA 3QYYA 1IKYB 3LAMA 2XY5A 3OL6A 3DRPA 4RU9A 1LWCB 1L3UA 4B9NA 4B9VA 4O3PA 1HYZA 3T19A 4I2QA 3V6HA 2J6SA 3O3HA 3AVBA 3BSCA 3TVKA 2I1RA 2KZZA 4PWDA 3MEGB 4ECWA 2HNDA 4F4XA 1J54A 4FLXA 4MQ3A 4FK4A 2F8TA 2ASLA 2Z1JA 4PUOA 4NLGA 3KK1A 3PO4A 4CFCA 1HARA 5J2PA 1D1UA 3IGNA 3SV3A 4FJGA 3E01A 2FC0A 1JLGB 2IS3A 1RA7A 4W5OA 4ID5A 4F2RA 1QSSA 1YTUA 4B9MA 2ZE2A 3QNOA 4CF0A 4ECZA 1U45A 4J9LA 1JLQA 5KFYA 3AA3A 4KBIA 4Q0BA 2P1JA 4J9OA 1U49A 1TGOA 3FFIB 3CM5A 5KFXA 2YNGB 3SCXA 3WNGA 4BDZA 5EWFA 4IFVB 4FS1A 1NK5A 4UQGA 1MU2A 4ELTA 4YR2A 1Q8IA 4DFKA 3ZT0A 4ICLA 4GC6A 2HNZB 3PW5A 3VN5A 2R8KA 4FLUA 2G8HA 2G8IA 4CEBA 2FBYA 2WOMB 1S9EB 4M3TA 2YNHB 4H54A 4I2PB 4ED7A 1KLMA 5DK5A 3VQQA 2HHXA 2IMWP 2OPRA 2FJXA 1NOYA 2E9RX 4KREA 4RW8B 4K4YA 3WNEA 2E6LA 2RDIA 1T8EA 1ZTTA 5CYQA 5KFOA 4WE1A 3KJVA 3LP0B 5I42B 4ECSA 3O3GA 1ASVA 4OVLA 5EWEA 3UPFA 1IM4A 2E6MA 4KFBA 4DWIA 3SUQA 2X78A 4EP5A 2ZQBA 3NBPA 5T7BA 1RTIA 3OHAA 4GMJB 3BQ2A 2BR0A 3QGGA 4WXWA 1JLBA 5K14B 1S0MA 4KE5A 3LP2A 5C5JA 1KFSA 2OZSA 4W5NA 5KT2A 3TARA 1N6QA 1BQMA 5E41A 1TL3B 4AHSA 4NLUA 4CE9A 1JLAB 4FJ7A 3EY1A 4NLQA 4CJ5A 2NUBA 2I5JB 4WZMA 3UIQA 3UR0A 4K50A 4K8XA 3AO3A 3IRXA 3M8QA 4M95A 3K5NA 3C94A 3VA0A 1L3TA 3NE6A 4CF9A 3ULDA 3NGZA 3QGHA 4LSLB 5KFKA 3OYMA 1VRTA 3RB6A 1HQEB 1HYVA 1BISA 4JV1A 4E3SA 3MR5A 2YHAA 3QGIA 1BQNB 4F4WA 4JUZA 5KGXA 4URQU 3AVAA 5HBMA 3KLHB 2IM3A 1RT2A 3AVLA 4XPEA 3OYDA 1T05B 4URSA 2G8WA 4ECXA 2KFZA 4KKOA 2JEGA 5L1JA 1BCOA 2AX0A 5FDLB 1N4LA 3ZSVA 4KB1A 4FJ9A 2OPQB 3TWHA 4CF2A 1MMLA 4ZTFA 3H5YA 3TR8A 4RNMA 3L3VA 3RBDA 2QKKA 3ASMA 1TK8A 4K4UA 5KFUA 4ZPBA 2HHTA 1SH3A 5J1EA 2KFNA 5KT7A 3ISND 4CK3A 1GOCA 1LW2A 3ZT3A 3ZT4A 3TAEA 2HB5A 4DL7A 2BGGA 1B92A 2CJQA 1KTQA 4IR9A 1YVFA 1GX5A 3P83D 4FJ8A 2OPPB 3M8PB 2W9CB 4CHQA 5KFWA 4H4OB 3H40A 3MXJA 3VQDA 5KG6A 1K6YA 3RMBA 4CJVA 3CM6A 1WAFA 1NJXA 3OHBA 4Z4IA 4ZMMA 1A5WA 5KFSA 4FW2A 3H59A 1SKRA 1XHZA 2RKIA 4RW9A 4WZQA 2BDPA 4H8KA 3V9UA 4Q8FA 4K4TA 4GVMA 4CJUA 4CIEA 3TAFA 2IGIA 4E0DA 1FKOB 3CIZA 3KHRA 4IFYA 4F50A 3AVFA 1NKEA 4CFBA 3ZT2A 4J2EA 5KT5A 4M3WA 3GIJA 3A2FA 5HRRA 1BGXT 1D9FA 3V81B 5FRNA 2BE2A 4CHNA 3QIOA 2JLEA 2R8JA 1EXQA 4F4YA 1YVUA 3VQEA 2V0NA 3OYKA 1S6PB 4CJEA 4E7HA 4E7JA 1RDDA 1S1XA 2XI2A 2ZD1B 3QESA 4J2AA 4O3OA 4WYLA 4DFMA 4M42A 3C6UA 3Q8SB 4ED6A 2IA6A 4IRKA 3NMAA 2XCAA 4RW4A 2JC1A 3TABA 1RNHA 4B9TA 4RNOA 4IOBA 4ZPAA 3HL8A 2YNHA 4DF8A 2D5RA 3CJ2A 5J2MB 1EKEA 3SUPA 4CECA 1SL1A 3OYNA 2G8FA 3DRPB 1K1QA 3MF5A 4NLTA 3K5LA 4KTZA 4I2QB 3H5SA 3NGIA 3H4DA 4PWDB 4NLVA 1Z26A 2HNDB 2YNIB 4PUOB 3HM9A 1TAUA 3KK1B 5EWGA 1RBRA 2UVUA 4KHUA 5J2PB 4AHCA 1S1VA 1J53A 3E01B 4OL8A 4ID5B 1C2PA 2ZE2B 1HMVA 1HQUA 1DTTA 1TL1A 3MEDA 4DSFA 1JLQB 1W9HA 3HHKA 2FJWA 4K8ZA 1JLFA 4Q0BB 2BRKA 3ZCMA 3DM2A 1IKWA 2F8EX 2XI3A 3RWUA 4IBNA 1TL3A 1X1PA 3KHLA 1JLCA 3RRHA 2EX3A 4KI6A 4ICLB 1C0UA 3I5AA 1LW0A 3QEIA 3DOLA 4BDYA 3GQCA 3KHGA 1VK0A 2OYQA 4NRTA 3G10A 2AQ4A 4HVJA 5D3GA 3V1QA 2BANA 1KLMB 1IKVA 3BJYA 1D8YA 3VQPA 2OPRB 3BGRA 4DEZA 3AVHA 3SPZA 4NCBA 3HT3A 4MKBA 4CHYA 4HHTA 4KSEB 4O4RA 2R2TA 5CYQB 2JGUA 4WE1B 3H98A 1U04A 4RZRA 3KJVB 3Q8QB 4DSLA 4KFBB 1T05A 2RPIA 4IDKA 1J9AA 1RTJA 5C42A 3RBEA 4W5RA 3NBPB 3MFIA 4DTJA 1RTIB 3PV8A 4OLAA 4LSNA 3KLGA 2B43A 4DQPA 1UAXA 3KLFA 4DTRA 3LAKA 3QIPA 4FLVA 1JLBB 4FJXA 4DLGA 4YR3A 5HRSA 2C28A 3LP2B 2Z1GA 1Z4UA 2C22A 1WN7A 4G1QA 1RTHA 4EZ6A 3NGDA 4DU1A 3OS2A 1N6QB 1BQMB 3DYAA 1KFDA 5KG1A 3FQLA 5L1KA 1VRUA 4J2BA 4MKAA 3S3MA 2W9CA 2VG6A 2RDJA 3JYTA 3CDWA 4PY5A 2YNFA 3NL0A 3M8QB 3I0SA 1HPZA 4NLYA 3SQ4A 3E51A 1RBSA 3DLKA 1QQCA 3Q8RB 5KFEA 3OYBA 1QS4A 3I0RA 1VRTB 3LDSA 1IO2A 4KO0B 3PW2A 2JEIA 3HPOA 3SV4A 5KG3A 3PJWA 5DG9A 2UUWA 5HBMB 1XWLA 1RT2B 3KKSA 3CJ3A 1WAJA 2A1SA 4KKOB 4R8UB 1T7PA 3N6NA 1S1UA 4ZPDA 4CF1A 4NLDA 2W7PA 4OKEA 3BSOA 3GYNA 4DSIA 5T14A 4J9MA 2VG7A 2IM0A 3PW0A 2BQ3A 1KVCA 3OL7A 1SL2A 3T1AA 4EEYA 3TAGA 3I8DA 3VQBA 3NF7A 1NK7A 3QEPA 3PO5A 3T5HA 4MK7A 4E7IA 4B08A 1JL2A 5J1EB 3SQ2A 1EP4A 1LW2B 3KTQA 4FS2A 3LALA 3NH2A 3ZSOA 4LY7A 4Q44A 3RTVA 4ZTJA 3GV8B 5J2MA 4CJWA 4HCBA 1VSDA 4WFZA 4E1MA 4TYBA 3QZ8A 4F8RA 3M8SA 3V4IA 4IRCA 4C8OA 2J6UA 3ITHB 4KB7A 1HRHA 4LQ3A 3OLAA 1VSHA 1FXXA 4E1NA 3NFAA 2OA8A 5F9LA 3ZSZA 2RKIB 4RW9B 4IKAA 5I3UA 3OYEA 2W8KA 3BR9A 2YNIA 1S9FA 3S3OA 2HVIA 4FLZA 2C2RA 4IFYB 4Q8EA 4NRUA 4CGIA 3UDLA 3QEVA 3HSTB 4I7FA 1VSIA 4NLPA 1I39A 4CHPA 3ZSRA 3EPIA 5F8IA 3SQ1A 5KT6A 3CYMA 3PR4A 2BE2B 3F73A 2XY8A 1LWFA 5KGWA 2Y1IA 1RT3A 4C8NA 1D0EA 3L2QA 3PW7A 3OS1A 3ALYA 4CFAA 2DPJA 1IG9A 1JKHA 1S1XB 4KHSA 5DQIA 5F8LA 3AVCA 3C6UB 4KTQA 2X6SA 5HROA 4RW4B 3PX6A 1QAIA 1XI1A 1SV5B 4KRFA 1S1WA 3CG7A 3V1RA 2IAJA 5KG7A 1ZBLA 1T94A 4OLBA 3T5LA 1ASWA 1J5OA 3CFRA 4N41A 3MXMA 1TQLA 4NZ0A 1QE1A 3O4QA 4ED1A 3KMQA 3NHGA 1RA6A 3AVIA 4EBDA 3KK3A 5DGBA 5JS1A 3GIKA 4FVMA 4J9NA 1S1VB 2VG5B 1JXBA 4J9KA 4RW7A 4K4SA 1GOBA 2R7YA 3CO9A 4DL4A 1HMVB 1HQUB 4M3XA 1DTTB 4B3OA 1TL1B 3MEDB 1ASUA 1JLFB 4TQRA 4EBEA 2AU0A 3NH1A 4AHVA 3DM2B 1IKWB 3AO1A 4BWMA 4FCYA 3U3YA 4FZXC 5KG0A 5CZ1A 3CQ8A 1JLCB 4CHZA 3LPTA 2R2UA 4ZP9A 4R5PA 4O3SA 4F3OA 4WYWA 4GW6A 3VQ7A 1C0UB 4DTUA 4DTXA 4IH7A 1LW0B 4NYNA 3DOLB 2VA2A 4BE2A 5KRSA 3KD5E 4TLRA 3L2WA 4U7CA 2HVHA 5D3GB 2BANB 3OJUA 3PVXA 4DLEA 1IKVB 4ED3A 3BGRB 3V9WA 4FBUA 1XHXA
chains in the Genus database with same CATH superfamily
3CJSA 4PL8A 1PJ5A 4YOXA 4KO0A 2LDIA 3UVJA 1NKCA 2DNGA 4TU7A 2ZH5A 2HURA 3RGIA 2O66A 4PHTX 2QJ3A 1KLNA 2ETJA 4R8UA 3LW5C 2HWIA 2O8CB 1RTJB 2GUPA 2Y1RI 5KTQA 3B6PA 4CIGA 3CCQS 4LSNB 4P72A 1ATRA 2VGMA 1ILYA 4F02A 3S3NA 4TY8A 2BQUA 4JI3F 4CCHA 3HMJG 2VV5A 1T03A 4DB3A 1TK5A 3DYAB 3K5OA 3AA9A 3PRDA 4KPCA 2DNNA 3Q86A 1AFIA 2VG6B 1RCOB 5DGAA 4X65K 3JYTB 1ATNA 4IOAL 2YNFB 2DR9A 3UKRA 3A8YA 2VF3A 4XIUA 1F21A 3DLKB 1CJUB 1KP6A 2CQBA 3D1HA 3SUNA 4LFAK 1NEEA 2UV8G 3BDPA 2VFSA 2BKNA 1R8CA 4K0KK 1WHVA 1DLOA 2OELA 4DTPA 3WBZA 3CC7S 1S1UB 1ZBIA 3C6HA 1NSQA 1MG7A 4JI4J 1TP7A 2B51A 2XYGB 1DJ0A 3DHWC 4KGMA 2VQFF 2PMWA 4DMZA 3IP0A 3W3DA 3HOSA 2NXUA 3SSRA 1SPBP 3OVAA 5CA5A 1A9NB 2UVVA 4FZZA 5KG4A 2XMKA 4I6YA 4F2SA 2E9TA 2BJ3A 2XY7A 3NS7B 3AGRA 4NA3A 3GV5B 3UKUA 3F56A 3NAHA 4D3HA 3ZETA 1WI8A 3V4IB 1Q95G 2XRIA 1NKBA 2DNYA 1YITS 2FVCA 4KV8A 1HI1A 1OS5A 2HWTA 3OFGA 5CXTA 3GYGA 4NEYA 4DSJA 1QSYA 4HI2A 1CQMA 3LUYA 4USTA 4WQ4A 2KZMA 4OJRA 2E1RA 4JD2A 2CGLA 5ELZA 3KK7A 3R3LA 1WDDA 1NGEA 2WC9A 3LDNA 2HVDA 1R27B 1OY6A 3KUGA 2F5GA 2VG5A 4CTAA 2AT1B 3C16A 2BABA 2A40A 4CEEA 1GLDG 3PR5B 1LWFB 1LWXA 2NZ4A 3GIMA 4U6PA 3MMCA 1JQGA 1F5BA 1S10A 1JKHB 2R8IA 3I9V9 4PWWA 1VQ8N 1Q8BA 1L3SA 2LU1A 2ASYA 2ALZA 4MJKA 4ZVGA 1WSHA 4JKCA 3THTA 1SUQA 3JTPA 4ZVEA 3O9SA 2P5VA 3HXMA 4IH6A 2AF6A 3H25A 3CC4S 2XLKA 4Z94A 4B9LA 1WSIA 2I8EA 2N3LA 2HMIA 2RAQA 3NLCA 1GLBG 3NAEA 2O5DA 4AQYK 1VBKA 2DNRA 4EYHB 1J5OB 3QINA 1JK9B 1EARA 3NS5A 2D0AA 3CDUA 4FYWB 1VYAA 3PDNA 2UVRA 4K7QA 2PZSA 4B9UA 1TAQA 4ZP6A 3POTB 5TKYA 1NBEB 4K0KJ 2YH0A 3G4SS 5SWMA 2J7UA 2M7SA 2QFIA 2PN6A 3TVYA 4NX9A 4O5BA 2A18A 4RW7B 5KFFA 3H4BA 1H2UX 2NXEA 3QNWB 4DBQA 1FXDA 4Q5VA 2V34A 2I2YA 1NLVA 3C19A 1GMWD 1A5VA 3VGVA 3R6MA 1FHTA 2ATCB 4H0YB 1F9FA 1AA1B 1RBTA 3ZZRA 3Q8YA 1MA9B 4M94A 1VOMA 3SPYA 3A3NB 1YLXA 4QW9A 2ZZMA 2R7XA 3V9ZA 3CJ0A 3D2WA 4EBCA 1JX4A 5AZJB 1SJFA 2OH2A 5KFNA 5LT5A 3D7SB 4E2FB 1IBMK 1NDPA 5K8NA 2ZBIA 2OEKA 2EFPA 2VD3A 1VCTA 4JI5F 2V68A 3ENHA 1IBLJ 4PXDA 1TZ0A 3KLIB 2DCLA 3QIDA 3ZZOA 4EIAA 3FMWA 3VQCA 4B3SF 1HD0A 3HSZA 2IFXA 1KAYA 2DT9A 1I94F 3FEYB 1MROA 3NCRA 1S97A 1U25A 3IUCA 4UZCA 4B3MJ 1C0FA 4CRJA 2GVZB 2M3DA 2NLXA 1YJ9N 4IG0A 3DRXA 3HVRA 4DTSA 5M1PA 2HHWA 3LWMA 1VQNN 4YB1P 4ZITA 2AX1A 2WONB 1S4FA 4OHXA 2CH5A 2FPHX 3V6DA 5FROA 4EO6A 4DQQA 1TMMA 1V9OA 5FPMA 1VC0A 3OLBA 2Q43A 5M2RA 4USHA 2F8MA 2CWXA 2JC0A 4CJFA 1L3KA 2GVDA 3PTWA 3BZCA 5KFDA 1HWKA 3QBWA 4EYIB 2DRBA 4A59A 4LF6K 1PAUB 3QLHA 4GVEA 4K2JA 1HNXK 3WQPA 4WPAA 2OPSA 4LF5J 4CGFA 3TNVA 4C3KA 2HBRB 4IO9Q 1EWQA 1FFWB 4TYAA 5CHCB 4IJNA 3Q8VA 1R31A 4B3TF 4KAIA 3UN5A 3SFGA 1IN0A 4NA1A 2MSTA 2ZDPA 1LOUA 7FD1A 1CJVB 5A2QY 5BYSA 1TKZA 2ZNZA 1MLAA 4DL5A 1RHUB 1CEZA 2ZZTA 3DXBA 2HBLA 1VHXA 4M7YA 4B1ZA 2QKBA 1YXQA 1P1LA 1RWUA 4DCPB 2CQ4A 4E19A 1FWLA 4WWSA 1Z25A 4TY9A 1YKWA 5KG2A 4OZLA 3C14A 4KH0B 2ZJPQ 3OYGA 3LZJA 2FF6A 1IBMJ 3B82A 2UV8A 1T11A 1RT5B 2DHXA 3HYFA 3CCWA 5A8WB 1RGVA 4DZDA 4OPAA 1RXOB 4K2XA 2C3OA 5DO2A 4Q43A 3TJAA 4BCAA 1TKDA 1CS4B 2YV0X 3EMTA 5JVGL 3M2RB 4CLSA 4HDHA 3DFEA 4FLTA 2ZH7A 1S1TA 3DOKB 2QMXA 4WIIA 3NCIA 3D3BJ 5F8NA 2F7VA 2M8DB 2UUCF 4JI7K 4ECTA 2P9EA 3M30A 2BJEA 4IUFA 2G8KA 1QAJA 3UN3A 3B8HA 2HWHA 2C2MB 2OCEA 3CI5A 3V4MA 1EZZB 3P4UB 3LPEA 1QVGM 2HZVA 1WC0A 4FWKA 1XMOK 2YX4A 5BRFA 5KQ8A 3GV7B 2QLFB 2HHVA 1H38A 4YP3A 4HKQA 4F0KA 4TSXA 2PI4A 4KGVB 3C15B 3VGUA 4IQMA 4DCOB 5HJYA 3LP1A 1NGDA 3OD2A 3D0PA 2MQPA 2FLLA 3DRSA 3ADAC 1HNXJ 3OYFA 1M1KO 1IKXA 3ZZ0A 3MR7A 4CLKA 3PYGA 3NF8A 3GB0A 4LRAA 3N28A 1SKSA 2VA3A 4BY9C 1Q5VA 2GAGC 5CH7B 1A7GE 2QWRA 2GV1A 3BZQA 3MAQA 5L1IA 2X74A 1Y0HA 3DI6B 4H5TA 1CPZA 1YJNN 1BCMA 1RWMB 2AMCB 2OD6A 4ZLJA 4CJTA 4HL9A 3RBXA 4DR2F 3CJQA 3DXKA 4KHNA 4TQSA 3WC0A 4K4XA 2ATQA 4UUWA 3MOZA 2J0SD 4EUVA 4ZPTR 3H6EA 5AJ3F 3A8EA 1X4HA 4L8RB 4W92B 4DL3A 1WSRA 1Y3KA 1S6QB 1N32K 4ECRA 2YWHA 1HBUB 1HNWK 3DLJA 3W62A 2FLPA 1HWLA 3TZXA 4ANEA 5DDOC 1S9GB 3B6BA 2IDEA 5D4OA 4NCGB 1F60B 4OPHA 1ZA2B 3VGTA 1LWCA 4CJRA 4FLWA 3SAFA 2NR0A 1IR1A 3QAEA 1UPMB 4DU7A 2GNKA 1R59O 5KFBA 5EU7A 3DCAA 1S22A 2RS8A 1NH7A 1RZMA 3I8BA 2COLA 5MLCV 5AQMA 2Z58B 4P7VA 2EK1A 1HBOB 3G82A 2CQ2A 3DLEB 2CZ9A 3QRQA 4CIFA 3DDKA 1NJZA 2MKCA 1N88A 1YHQN 3O5TB 4XH5A 3P3DA 4QYZK 3QAUA 1U1NA 4GKKK 4O3QA 3G6XA 3EE3A 1OY8A 4JAXA 4RBTA 4QIVA 3NS6A 2MQQA 4XO0A 3M9OB 1FCAA 1WSJA 2VBYA 4ENOA 2GQCA 3I6PA 1YTYA 1XMOJ 4AUKA 4QR1A 2HNZA 2HFZA 2CJAA 5ETTA 3G6ES 3HHLB 2WK4A 2ZKTA 4LT6A 1YI2N 2WOMA 5DDQC 5CCLA 1RAJA 4I2PA 2WBMA 5IXUA 3MM7B 1HNIB 4WYBA 5J2NB 3V9SA 3FSIA 1QHAA 3FZBA 3VGKA 1C1BB 1DQ8A 4Z4HA 2P9PA 3LP0A 3W64A 2Q1NA 2D9OA 5F0UA 4FK0A 3UD5A 1S76D 1IR0A 3O9QA 1WBBA 2O8FB 2PO4A 2C2KB 4D3GA 4OHZA 2DGXA 3UCGA 3VQSA 3GYXB 4KPYA 3N01A 1X4FA 4RNHA 2GWJA 3VA3A 3ZSXA 3GOIA 2E5LF 5J2QB 3CPWR 4I9LA 2XZWA 4W90B 3CD6N 3CCVN 2IJFA 1B0TA 4LMZA 3MXIA 1N5TA 3FNNA 3BQ1A 2FJAB 1MU2B 2ITMA 3I33A 2B56A 1HNWJ 4ZHRB 1Q86O 5HI7A 2M4MA 4YORA 5KFJA 4CO1A 2A6OA 5A6PA 1G7CB 4DQ8A 2FVQA 4ILGB 3FCHA 4LF4K 1UWBB 1KQFB 1HQEA 4Y2CA 4X4VA 4HLBA 1Q4RA 1FNOA 3PEJA 4DU3A 2FBXA 2K1RA 4JKHA 1M1GA 4N8NA 3VZIA 2QWMA 2HQ3A 2XMUA 2B4JA 1F3VA 3P8BB 1VQMN 4Y2AA 4QAGA 1VQON 5FDLA 2Z2MA 2PIIA 4OV1A 3VQ9A 4HUEA 4X65F 3AOBA 2VQEK 2J0QD 4OZJA 2XC9A 4GKKJ 3E66A 2YKNB 3TTCA 4RO0A 2FY8A 4DUYK 1U09A 4TXSA 2FZKB 1GLEG 1ZYQA 1ZH5A 1RT6B 4LFAF 4C8KA 2ZHOA 2EXUA 2WSEC 4RW6B 3RR8A 2UUBJ 1IBKK 2PFUA 3PEHA 4H4OA 4IQXA 4FOEA 1UWAA 4K4WA 2KKZA 1SKUB 4XAKA 3NKYA 3O4NA 5E0OA 4AH9A 1RHMB 3QJJA 4BACA 2FBTA 2RQKA 4ZDNA 3Q8UA 3QDKA 4OI2A 3QWPA 2NPIA 3G8TA 2LMIA 3AXMA 5SUHA 3CERA 4JRPA 3MD3A 2EC2A 4OZNA 3NVMA 3ZT1A 3IR6B 4K25A 5ETNA 1Q9YA 1RWPB 2V4JB 1KCFA 3HZ6A 4ZVQB 3M05A 1Q1KA 2DGQA 1N48A 2ZH6A 4TU8A 4DL2A 1P6TA 5KFIA 5BPLA 4J9PA 4JI6K 5IT9U 1AB8A 1RACB 4ILRA 2FBVA 1CJTB 2ZD1A 4ZN3A 2HHHK 5I3PA 5JXSA 3D2EB 4A8SA 1C0GA 4CZHA 5DM6L 2U2FA 4CEOA 1VBZA 1RDAA 4ECUA 5EXWA 3KMSA 3N6MA 2ZJRL 1VQLS 4J9VA 3RAMA 1XJWB 2EFOA 3QYYA 1FD2A 3PKMA 2AYBA 3P96A 3J80Y 4AF1A 2QMWA 3GFZA 3UR3C 4QR0A 1RAEB 5HN0A 1U1LA 1FXRA 1BLUA 3BGOP 8RUCA 1HBNB 3HZEA 3TVKA 3KNGA 2KZZA 3MEGB 1LXNA 2HNDA 1J54A 2DNQA 4MQ3A 2EG1A 2LXUA 2YPZA 2F8TA 4P6QA 4X4SA 1VQ5N 2L9DA 3PO4A 3FGVA 4RWWA 3IGNA 4CLLA 4FJGA 1HA1A 5GMEA 2FC0A 3F41A 4ID5A 1YTUA 3OBIA 4CF0A 4JI0F 4ECZA 2DCUB 2E1MC 3MCMA 4KH4A 4Q0BA 4AQYF 1U49A 5IV3A 3FFIB 1EAYC 5IQQA 5KFXA 2YNGB 1Y00A 3H8YA 3WNGA 4BDZA 2W4PA 5EWFA 3CCLN 4DUYJ 1WI6A 5FPEA 5KOXA 3RVCA 3AGKA 2QO3A 5T41A 1MU2A 4ELTA 2ZZNA 4ICLA 3PW5A 5LSLA 3M8YA 3TUJC 2OTLN 3ILLA 1W2BR 4H54A 1ZS6A 4ED7A 5DK5A 3VQQA 4RR5A 3GONA 2IMWP 2OPRA 1B70B 1MN9A 3N0VA 5D0HA 4KREA 1G4CA 1I1GA 2BOAA 2RDIA 1T8EA 4NZ6A 2CIMA 2RHKA 3FJ2A 5I42B 3MM5B 2GHPA 2CG4A 4ZLPA 3TSQA 4KFBA 3L7PA 3ZEUA 2XMVA 1OVQA 4C3LA 3B78A 5ETPA 3SUQA 1Z05A 2VBZA 2FHMA 3NBPA 3MN6A 1GK8A 2RQCA 2J8AA 5IFMA 3QGGA 1NU0A 2LFVA 1JLBA 5K14B 4KE5A 1RBAA 4X4TA 3IM9A 3TARA 2WSFC 2HHHJ 3HX9A 5E41A 2MB0B 4NLUA 4CE9A 2R9LA 3EY1A 4GO7X 4NLQA 2YWEA 4H5RA 3O9TA 2DNPA 3KUHA 2NUBA 2I5JB 3IR7B 3FVYA 2BE7D 4WTOB 4C0OC 5L39A 3CO0P 4DR5K 3WX8A 1U1OA 4K50A 1X60A 1AW0A 2GTDA 1XNQK 3K5NA 5B0GA 4JKGA 3ONQA 3C94A 4I69A 2ZDOA 2WVEA 2YX7A 2ADCA 3MCSA 1N0VC 1J6ZA 3GTYX 2OP5A 5KFKA 3R8YA 3OYMA 4E3SA 3ULHA 1RU1A 4QQBA 3AQPA 3QGIA 1BQNB 4F4WA 1DGKN 4URQU 3AVAA 2XLJA 4WFAL 2V4JA 1RT2A 4DOZA 3PFEA 4EHTA 3OYDA 2JWKA 5IM0B 4KKOA 2JEGA 5L1JA 1UEUA 3SQGA 2RQMA 5BYQA 1N4LA 2CNNB 2OPQB 2GJIA 4C7QA 3ZNJ1 2E5IA 4NA2A 3MXHP 4DZ6A 3OXGA 3TR8A 5KOWA 4RNMA 4LF6F 1X4EA 3ASMA 1TK8A 2B4PA 4ZPBA 5J1EA 2KFNA 3H7HB 3LDOA 3DXMA 1LW2A 1VQKN 4PKDB 2NRVA 1E6YB 3GDQA 3LTOA 3SQOP 4F67A 4UQTA 4DX5A 5GADI 3P83D 4FJ8A 3RW7A 1XMQK 3H40A 1SQFA 4A5AA 1TL5A 4CJVA 1X0FA 4LR8A 1RHJB 1FTRA 2E1AA 4Z4IA 2J9DE 4Q2LA 4ZMMA 4EHUA 3H3NO 4GV9A 5KFSA 4FW2A 2RKIA 4OI0A 2AJ4A 4E0DA 3D0GE 3CDAA 4IFYA 3JB9k 2G1HA 2GWKA 3U9DA 3WIVA 2WB1D 4M3WA 3GIJA 2UYTA 4H0VB 3EN9A 4E1JA 1BGXT 3V81B 4CHNA 4C1NK 2JLEA 2Z0GA 3HFZB 2X51A 4N8OA 1LQ9A 1NNEA 1S6PB 3TX8A 2R3VA 2H48B 3MN7A 1FERA 1UCNA 2MPUA 3OHRA 2HQDA 4J2AA 1J2VA 4O3OA 4DFMA 2I9SA 5JVHQ 2IA6A 2XCAA 2JC1A 4BRHA 4WU3A 2HQCA 4RNOA 3SAHA 2P9UA 2D5RA 2EKNA 2N4DA 4OQJA 4G9ZA 2D9PA 4DR5J 2OIHA 4CECA 3T69A 4FPRA 1XNQJ 2G8FA 4QU7A 3DRPB 3SDEB 2IVMA 5A8RB 3MF5A 4CO5A 4KTZA 3ZLJA 1U2CA 2NLWA 1SI9A 3H4DA 2AIRB 4JKFA 2OTJS 1RWXB 4JI7F 2ZBCA 2YNIB 4PUOB 2W6LA 4IWVA 4DV5F 5GIOA 1RBRA 2MGZA 1B4SA 4N7TA 4KHUA 3ILOA 4AHCA 3PSIA 3WQTA 5BRHA 4O5FA 3WXJA 3D3CJ 1N34J 1HQUA 1TL1A 5AE2A 2V2ZA 2V52B 3VEOA 3UD4P 4X4UA 3OFHA 4ILMA 3E8OA 3MUMP 3W2VA 1SS6A 2CDQA 2WW8A 1X1PA 3KHLA 4JKBA 3RRHA 1VQ7N 4KI6A 2MQMA 4BGBA 1NPRA 5B0EA 4C23A 3I5AA 3MEKA 3D6TB 1VK0A 3KHGA 2QIFA 2UU9J 2P9SB 2OYQA 1OQ6A 3FCWA 3H0PA 4P2FA 2BANA 1KLMB 1XMQJ 1U8WA 2RVJA 1D8YA 3LQVA 3VQPA 3AVHA 2CNOB 2UZAA 2IDLA 5U47A 4O4RA 5CYQB 2JGUA 4WE1B 3H98A 1ULRA 4RZRA 4IOAQ 3N79A 4WP3A 3RYLA 2MYFA 1R43A 1Q81T 3VAHA 1G2EA 5C42A 4BG9A 3RBEA 5DS7A 5ETLA 1EKSA 5B0AA 4W5RA 3O44A 4DR7K 3MFIA 1RTIB 3PV8A 1QZ5A 1N32F 3KG0A 3M3ZA 4H03B 4OLAA 2W2MP 1HW8A 2B43A 4DQPA 3QSYB 1UAXA 4DTRA 1A6LA 5D6GA 3LAKA 1TU0B 3THYB 1MMDA 2IIHA 1XK8A 3T1HK 4FJXA 4DLGA 1YRUA 1WF0A 3LP2B 1Z4UA 3I87A 4G1QA 3AJ1A 3OS2A 1RAOA 1RSCA 1N6QB 1BQMB 5KG1A 3VMFB 4U8VA 4KH5A 2HBJA 4YDXA 5GINA 4J2BA 3RRKA 4IXCA 3I0SA 3C6AA 1F2HA 1RBSA 4LSZB 5LMNF 5KAKA 1QQCA 1PC5A 3OYBA 1QS4A 3T1YK 1VRTB 3LDSA 3HF5A 3ZFVA 3PW2A 1SJ4P 4PCQA 3HPOA 4C11B 1D4XA 4PL7A 4A47A 2UUWA 3EZOA 4ERDA 4DV4F 3W3SA 3THXA 3CJ3A 3OUYB 3JAMU 1VBXA 5FLXY 5ETKA 1T7PA 2GX8A 3N6NA 4ZPDA 4BRKA 3GMGA 4DSIA 5T14A 4KIAA 2VG7A 3IWXA 4EEYA 4DUZF 2W7AA 2JLFA 3W61A 4A8FA 2X7IA 3SQ2A 1ZZFA 3HKZD 3ILIA 2PT0A 2JZ5A 2WVCA 4A61A 5H9EK 4HACB 2X1AA 4LY7A 4Q44A 4ZIWA 3GV8B 3HHLD 2HS3A 4WFZA 2QG9B 1LEOA 3TTDA 4TYBA 3M8SA 3KJNB 4C8OA 4IRCA 2DGWA 5LL6Z 4WCEL 4ZOSA 1DARA 3EXCX 3ITHB 2E7WA 3G87A 4KB7A 3OLAA 1FWKA 4GKJJ 3NFAA 4X66F 3ET6B 4F9OA 1GTEA 2YNIA 2BTFA 1B3TA 4FLZA 2C2RA 1S72N 1EHWA 1MN7A 3HHLC 4NLPA 4AM7A 3MWPA 5E84A 3O8MA 3FLCO 2N82B 2GAHC 3KXDA 3EPIA 5KT6A 2FSJA 2DEIA 4USJC 4DPXA 4WK1A 1OO0B 4DR7J 2KLAA 4FYYB 1X3MA 1D0EA 2YHWA 5B0DA 3T1HJ 5M1QA 3B8AX 2Y9HA 4PKGA 3VAIA 4KTQA 1FEEA 2CJ9A 4NMLA 2D4WA 1RUSA 2HIYA 1WORA 1K9MO 4KRFA 4YEAA 1FX2A 1IR2A 1S1WA 2HIQA 2KM8B 4LF4F 5C2GA 2HK3A 4OLBA 1KAXA 4NASA 4JHDA 1YQHA 2HGLA 3MXMA 3MAHA 2QWNA 3LDPA 2VONA 4CO3A 2XG8A 1WOOA 3M32B 2G0JA 1RA6A 2IMOA 2KYXA 5ETQA 5HK4A 4BR0A 2VQEF 3FUYA 3EE8A 1JJ2R 4FVMA 2A6MA 5K20B 1JXBA 4J9KA 2F7TA 2MKSA 4DR1K 3G96A 4V19X 3N4QA 4LRFA 2OJ3A 4B3OA 1NJIT 1ASUA 4TQRA 3IO1A 3DM2B 2XMTA 4BWMA 1IBKF 3P6YC 4FZXC 5CZ1A 4FPIA 1YJNS 4ZP9A 4CI0B 2HF4A 1GNKA 1NAQA 4YDUC 2BKPA 1C0UB 4AM6A 3D7EO 5A2QU 1RK8A 1REGX 4IH7A 4OJ1A 5H9EJ 3DOLB 3IDHA 1Z6RA 5KRSA 3CCJN 4DJBA 4CZIA 3E3XA 3PVXA 1IKVB 1SVDA 3J7AP 3J7YU 3AD9C 4C4WA 4F0MA 2VB6A 1T9YA 2PYJA 1ZAWA 3CCRN 3J7A1 1C1AA 2DY9A 3H5UA 4F26A 3DWLA 2AJFE 4GVBA 5HLFA 1X4DA 3OYCA 2D0CA 3GFXA 2U1AA 4JI6F 4P9SA 2KVQE 3CCES 1SL0A 2BW7A 2R7TA 4IDKB 1ITGA 3PY8A 1BWVA 3CMAS 4DSKA 3OY9A 1WSGA 4PG5A 3QIPB 1QUVA 1TTHB 2GS8A 1Y97A 3A5NC 4PPZA 1U48A 4WFYA 3OYIA 3CCUN 3PIOQ 3K59A 2HVZA 1TVRA 4OLPA 1Y5NB 2XMMA 3LANA 1BIUA 3QZ7A 3ZX2A 1R8PA 4WFBL 4M3YA 1H6KX 1YHQS 1YT3A 3VAFA 4YY3K 1KHWA 2PAVA 3MM8B 2BH1A 5M2UA 3ITHA 1HPZB 1UOCA 3G86A 5BR8F 1GX6A 4ES1A 1X8DA 4DPWA 1G15A 3D2FA 3L8BA 1GLCG 3RUBL 3NNHA 1RHKB 3EZWA 1WSFA 3AO4A 1IJFB 4OX9F 4OHYA 3QJLA 2NRTA 2KJWA 3FMBA 1GXUA 3D28A 3TWZA 1ITPA 1NNDA 2QW9A 2HAFA 4A8KA 2YJEA 3OR1B 2HFUA 4N47A 4A8WA 2IOCA 3BH7B 2Z2LA 4CP5A 2M2BA 3DLGA 1Y3JA 2XLIA 1K8KB 2MDAA 5JVGQ 2FHJA 1FXLA 1RT4A 2LDYA 3DOMB 3R5JB 2XB2D 5DDPC 3CCZA 1NJWA 5JMVA 3HVTB 2C2EA 5HL7L 4A2AA 2G1DA 4M5KA 3VQ5A 3H2VE 4M3RA 2FGOA 4Y0FA 1MSWD 4G65A 2I6WA 3CPWM 3MEEA 3TQ1A 3CFOA 1UEVA 1GMUA 3L6QA 3QEXA 4CBUA 1RBOB 1AT1B 1T9UA 4OJ3A 3CCVS 2F9TA 1IWGA 4I6WA 2EFVA 1WDTA 5F8JA 4TN2A 2OMLA 2W9BA 3EKUA 4E7KA 4BE1A 1JB0C 4A57A 1S5ZA 4I7FB 3C7NB 5AQHA 2YQ0A 4C0BA 4WP8A 3L2UA 4KAZA 4BRAA 1RT1A 2EHGA 3VETA 3OW2M 5AQGA 4LRDA 2IVPA 1UA1A 3OYJA 3EM1A 1YRTA 3OR2A 1D9DA 1FKPA 1WF1A 1HWUA 2NRZA 3R9PA 1TKXA 5CQGA 1BE4A 2Y0BB 4FWQA 5HROB 1F0XA 4Z4EA 1KHVA 4JLHA 3CSKA 4ZPVR 5K5MA 3KKRA 3MPYA 2J76E 2BW2A 2UXDJ 4ZVHA 3MK6A 2MY8A 1RTDA 2IAJB 3KK2A 4DS5A 4DS4A 2ZH3A 2R8GA 4YHHF 2E29A 2WBNA 2QLXA 1M90T 3O3LA 2Q1LA 3TEGA 4FWRA 4H5NA 1M5SA 4NXNF 3SFUA 1SH2A 4DV2K 1NG9A 2UP1A 2KKHA 3P38A 2JEFA 3LZIA 3QO9A 1FVSA 3VWSA 3QSIA 2XO6A 3HHNB 4A62A 4YR0A 4DPYA 3PM9A 3CXCM 1OVYA 1S7HA 4CZCA 4DV0K 4QPTA 1F9HA 4R5PB 2B9WA 1FDDA 4GNIA 4AHTA 3SBTA 2IPOB 5J1PA 1JLEA 4HH0A 3M7VA 1ZC6A 3J7Z5 3MM8A 1Y5LB 1PO6A 4NYZA 1KQKA 2BV3A 2MKKA 4P7TA 2LKZA 2RF2A 4JV2A 2CQDA 2F8HA 1FA0A 4W5QA 1R0AA 2FC8A 2QXFA 4IKFA 2G8UA 4C97A 1RBVA 1QQOA 3CCMN 4Y65A 3EDQB 2DFFA 2Z2ZA 2H5EA 3SK3A 1IUJA 3VAKA 1TUVA 2QE5A 3JXOA 2GIQA 2AA4A 1RDRA 2GA7A 3NAIA 2C3YA 2R8HA 5AQPA 4NXMK 3Q7BA 5CY4A 2RRAA 1TK0A 5DZ7A 4CJQA 2FSNA 4PZVA 3TA2A 5D0EA 2NUHA 5IT9O 2PYLA 4LQ9A 4NLWA 2FF3B 1VQ5S 3HVTA 2OEMA 4ELVA 3V6JA 1PGZA 1CZ9A 4FNHA 2CVIA 4BG8A 1W25A 2P9NA 3HD2A 2F4VJ 2OHDA 4DTOA 2DNKA 3FE1A 2BKOA 2JFKA 2JVRA 6AT1B 3PRBA 3QNNA 4FW1A 4I6MB 2F40A 1TKTA 4PAAA 4MFBA 2CH6A 2BUNA 3EZ5A 1V3SA 2BXJA 2K7JA 2FD2A 4JI3K 4ZK7M 1S59A 5HO4A 1Q78A 1YIJS 2KH9A 2UVWA 1GFWB 4XH4A 1W2BM 2LSNA 3VQ8A 3SYZA 1KSPA 5HRNA 2FXUA 3AAPA 2QV6A 4J91A 1HBMB 1SC4B 3IG1B 4F25A 3JSYA 2WHOA 4BROA 4DX8H 1ZTWA 4FKYA 5C25A 4J8FA 2QWPA 3MECA 5AQZA 3THVA 1N8RT 3DN9A 2FSKA 5GAGP 1W7WA 1RDCA 3QERA 3R5CA 5IOLA 2OD4A 4JK9A 3CC2N 1T9XA 1ZBHA 3WXKA 4FF3A 1NM1A 4DV0J 3FRZA 4BWJA 1Q8KA 2AJ0A 1ICEB 2QEXS 2VASA 1C0MA 1QY7A 1FRHA 1U2FA 3VVTA 4HHHA 3VEXA 4M63A 1YJTA 1FTCA 2QXLA 4FJKA 5HRPA 3DMJB 1M5OC 1Q82T 4KHMA 4CM2A 4CT9A 2GC8A 5BR9A 3MMBA 3HO1A 1FNXH 1T02A 2VQFK 4MLHA 4MYUA 3KLEB 3SNNA 1UW4A 3CMQA 2HHUA 4Z7CA 2HNYA 3DGPB 1O1WA 3WNHA 4HCCA 3KDOA 4DR3F 4XDDA 5CYMB 2B4OA 5HP1B 3HHDA 3O8WA 3T1HF 3IFRA 1FD8A 4Y00A 2DHHA 1VMBA 3VAGA 3W5ZA 1NGAA 3ZX3A 2QA4G 4PQUA 4YS2A 3D68A 1EETA 3FZFA 3V9XA 1W0HA 2ZF5O 3SJJA 4PWUA 1NDKA 2X3GA 2KFYA 3BS9A 4IO1A 2OANA 3G71N 1TV6B 1U6BA 3MM6B 2KT3A 4H4KC 4X4PA 5HATA 5EX5A 3HKWA 4M8LA 5AR0A 2XSJB 3IMQJ 4NLXA 3T1YF 3OBWA 4P52A 2ERRA 1HYSA 4ES2A 3FQKA 1R6VA 2ZWPA 3FBEA 1SIZA 1AZSA 3RB0A 5FRMA 4MLEA 3IS9A 2P5GA 3FDSA 5GAEP 3TAMB 1NHVA 3GLJA 4JI3J 1VK3A 4F3MA 5DM6Q 1EQ0A 3N6LA 5CYJA 4NLCA 4DQRA 2J0WA 1E6VA 2ZJRQ 4CQ1A 3DC2A 2EI5A 4NE9C 2GO8A 4IO8A 3BREA 1RT7A 4YOVA 1RYSA 4X64K 4M5JA 1U1KA 2MXYA 4CLYA 4FZYA 2C3MA 2F96A 1RKJA 3H1QA 4YOEA 3B54A 2RUSA 4IEIA 2IJNA 1NJYA 4Y1CA 4FJMA 3M2VB 1SQEA 3DRRB 4UTGA 2W4CA 1QQMA 3CF5L 2DNLA 4AFFA 4OZ3A 3LM2A 1QVGR 5LXRA 2E20A 3BBBA 2BJDA 4IG3B 1GLFO 4F7VA 2P9IA 5FPNA 4H4MA 1CULB 3MN5A 2KTQA 2WUSA 2B6AB 2HFNA 2AJQA 1SXLA 3EDRB 4M3ZA 2XQCA 1H7XA 3EGZA 1L3VA 3PSFA 1H72C 1UZHA 4OYWA 3OVNA 4XH1A 4XPCA 4URGA 2XWXA 2MZ1A 2VQFJ 3OQ2A 4EP4A 1CZBA 1U4BA 3OJSA 3K17A 1KWMA 3BO4A 4X62K 4LF2A 1FJEB 2R7WA 2BEFA 1JJHA 4FWOA 3K5MA 2HW3A 2E4LA 4Z4GA 2P9LA 5DMRA 2UXBF 2QL7B 2W1BA 1W7AA 1NDCA 1JLGA 2QLJB 3KNAA 2V50A 4JI5K 2E2NA 2NRWA 3RSEA 3MPDA 3JSBA 4OV6A 4B3SK 3AODA 3ZSWA 2LP4A 3HVWA 3OPKA 3TJ9A 3KOAA 2AW0A 1BMQB 2JWNA 4HYKA 4LIWA 4IFVA 2GELA 3AT1B 3DLBA 3SAGA 4UY85 2EWSA 1J5EF 3FZ2A 3NNAA 2FUG9 3QBCA 2AJ2A 4BS2A 1VQ9N 2ZJQL 3KLEA 1S9EA 1HNZK 5A8KA 2HSEB 4M1KA 4LBHA 4N5SA 3SI6A 3RAXA 1VQ7S 5F41A 2XS2A 4DR1F 5AQJA 3U1MA 4CW7B 5EY4A 2YKMB 2D1CA 1JL1A 2F63A 2Q0UA 3M8WA 3U9ZA 2KHDA 1U0HB 4C0HA 2KM8C 4ILJA 4B17A 3RMDA 5LMUK 1HNVB 1FFGB 4ILLA 3RAQA 3R7NB 2IIRA 4FF2A 1NHUA 4BVOA 3PX0A 2B3TB 3P5JA 1N5YB 4CH7A 3ETOA 3H5XA 1VIOA 3KD1E 5DG7A 1X9MA 3DLLL 2JOQA 1FRIA 1VSJA 4OYOA 1SC6A 3VPZA 2ROEA 5DLGA 1VSMA 2KHOA 2L9NA 3AVJA 5C24B 3QMQA 4A8YA 1SC3B 3JSMB 2FLNA 2JLGA 3NDKA 2KRBA 5IZHA 2V9KA 4JI2F 1LWEB 2DY1A 5LJ5Y 2NRHA 1JLAA 4RTFD 2OUGA 2Y0SD 4UOGA 3B4DA 2GGPA 3HZGA 1KD1T 2LQBA 4K8RA 1BI4B 4FOIA 2HFSA 3HPGA 5KT4A 4OGEA 3OXLA 3CJKA 1IH7A 2V8DA 3CJTA 4A48A 2LECA 3FSYA 3KJQB 2VPWB 2HYIB 2NYIA 3OL8A 2GIRA 5AXKA 1I3OB 3ENAA 4QOZB 2YHXA 1CJKA 4YB5A 3KLHA 3UFCX 2HBYB 3MR6A 2FB0A 4M5DA 3KZBA 1TMJA 3OSPA 4QCLA 3DKDA 1K0TA 2GZOA 2GMLA 4NYFA 4YB7A 4YY3F 4EAHD 4DCHA 3JQJA 4JI5J 3C6TB 2DITA 3IFEA 1GMWA 2G4BA 1XTZA 5KFQA 1X4GA 3WDOA 1WOQA 2IC3B 4B3SJ 4DUTA 2A3JA 1WEXA 1I94J 2R2RA 1HKBA 2H4WB 3N5FA 1BG3A 2MQOA 3QBXA 1UFWA 4ID1A 4HDGA 1AFJA 1ZM3A 3J81Y 2EEYA 2VU5A 1C0TB 1GMVA 3LA0A 2UUCK 2A5XA 1GH8A 4DV7K 5K9FA 1HNZJ 4O44B 3GWCA 4I0WA 5L9XA 3QETA 3NOCA 2K2PA 2NZTA 2HS4A 4OPJA 3BB5A 2LEBA 3GPAA 2N4CA 1QZ6A 1P1TA 1FKOA 4JP8A 4M5NA 2IVNA 4CERA 5A0YB 2KDOA 5F9NA 3SUOA 4KI4A 1FEHA 1RDUA 1T6CA 3SSQA 3SZ2A 1EX4A 4CJ7A 1VC5A 5L38A 1P27B 3CJ5A 4IOXA 4JKEA 3PLAA 2MTLA 3I32A 4U7UK 5KRTA 3LM9A 2ZH2A 3HSGA 5F8GA 1RWVB 3R97A 3W2WB 2B5JB 3MCOA 1FWPA 3UE2A 9ATCB 1DTQB 3WNFA 3DDNA 2IM1A 2CNKB 4O0NA 3S8SA 3SI8A 1EB0A 1FK9B 2RE2A 4HUFA 1NSPA 2ZUAA 4UW2A 4OI1A 2W7OA 4B3TJ 2ZUGA 3IN5A 2CQCA 4PXBA 4CIOA 3ZSQA 1IKYB 4MKVA 3VALA 3LAMA 3CETA 4RU9A 1D8ZA 1L3UA 5AJ3K 4B9NA 2IBOA 5H9FJ 2ASOA 1HYZA 3T19A 3V6HA 3BSCA 4PWDA 3CD7A 1BO5O 4FK4A 2NZCA 4KY3A 4RUBA 3H1VX 2Z1JA 2QMUB 3OTCA 5GAHI 1P9YA 2AHOB 3SMSA 1HARA 5F3TA 1D1UA 1S6OA 1YX2A 2QSWA 3I4PA 2BOPA 2ZFHA 2IS3A 5M1NA 3ZZUA 1QSSA 3MCNA 2CPDA 2VFUA 3QNOA 3MMAB 2ZWOA 1T0TV 2JFDA 3BF3A 1JLQA 2WZ1A 5KFYA 4KBIA 4FVUA 4KGXB 1EX8A 4KGKA 4ZIVA 1KXPA 2A0FB 2HPUA 4FS1A 1V6HA 5EVZA 5T7LA 4UQGA 4DHVA 4YR2A 1Q8IA 2KXFA 3O6WA 4Y28C 1UFLA 4CEBA 3P4IA 2O8DA 2XM3A 4DV2F 1MDUB 1H98A 2DR7A 4FWPA 2OSRA 2CQPA 2YNHB 2Q6CA 1U1PA 2UUCJ 3CEDA 4CWBA 1UJ6A 1QLNA 2PI5A 1FDAA 4RW8B 1IQZA 3WNEA 3D1QA 1ZTTA 5CZXA 1LCUA 5KFOA 5K8PA 3KJVA 4I56A 3WC2A 2MLZA 3HSJA 3W7BA 5EWEA 3UPFA 4C48A 4M63C 3MWBA 1B99A 2DXEA 2VBWA 3HD1A 3N5BA 4DWIA 3AXKA 2FIUA 4BHQA 4X84A 2ZQBA 4A8XA 2CFXA 1BXNA 3Q89A 2LXFA 2N3OA 2RILA 1S0MA 2FY1A 1BY9A 1ELOA 1X5TA 4DN9A 5C5JA 3CNQP 1KFSA 1NXIA 5AQSA 2W2QP 5A2QO 4PR6A 1JCFA 4FF4A 5DDRC 3EKSA 5C2DA 5AFUH 2M70A 4CJ5A 2I7PA 2G2ZA 3UIQA 2VC0A 3I96A 4DR2J 5HMWA 2CA9A 2HK2A 3M8QA 4DPTA 2BBEA 2DB1A 3U1LA 4NXMF 1Q16B 3UCUP 2CNLB 2ADBA 3NGZA 3PCOB 3PYFA 2UUAF 4LSLB 3GP9A 5AJ3J 3K5PA 1BISA 2O8BB 2HKEA 2YHAA 4WCEQ 2POKA 4DR6F 1YK9A 2G8WA 4ECXA 2KFZA 4QIWD 4CH0S 3EVWA 4DPUA 1M1KT 2EBEA 2GMHA 1DEJA 3ZSVA 4KB1A 2HGNA 3ZYYX 1MWQA 1X4AA 3R1HA 2DEJA 3H5YA 5AQYA 4I1TA 3L3VA 1DBDA 1U2VA 2A10A 5CD4A 2QKKA 3GZ7A 4BR4A 3F44A 3SIPB 5G0RB 2J0XA 3ISND 2E8AA 2HB5A 3QRRA 1V4TA 3L09A 2BGGA 2ZHAA 1D9AA 3LL3A 1YVFA 1GX5A 3IBFB 2OPPB 3M8PB 3HI9A 3GSIA 4KT0C 4I4BA 2B0GA 3C8YA 3R3TA 3VQDA 2RNEA 1K6YA 3FZLA 3DHXA 2CZ4A 4OYMA 4RPFA 3OHBA 3CCQN 3MAAB 1A5WA 3C3LA 4PQAA 1U2RA 1DQAA 3H59A 4RW9A 1K8AO 4Q8FA 1N54B 4FVCA 4GVMA 3BGUA 3NG8A 2Q3PA 1TL7B 1R0BG 1TYQB 2VWBA 1PIEA 1NKEA 1LFWA 3ZZPA 2KB2A 3A0IX 2JSXA 5HRRA 2R8JA 2E66A 2PA3A 4F4YA 3ZXWA 4OHWA 4K59A 1WTBA 3DAWA 4CJEA 4DV3F 3EGNA 5AQKA 1QVFM 2XI2A 4WYLA 2CVEA 4CYUB 3DDIA 1KKHA 5GMKa 3NMAA 3IRWP 4EI2A 4RW4A 3QPIA 5GADP 2YQ3A 1RNHA 4FL9A 2RRNA 2ABYA 1PJ6A 2J4RA 2BM1A 3K0JA 3THWA 1MNEA 4UT4A 2YNHA 4DF8A 3GJSB 1EKEA 1DRZA 3AJ2A 4ZCMA 3CC7N 4NO7A 1YAGA 2M8HA 2YX6A 1K1QA 3A5MC 1U0SA 4I2QB 2N7CA 3NGIA 2HOEA 2E5LJ 4CM0A 4L76A 1WEZA 1UVKA 2VFVA 1WG5A 4H0XB 4G1PA 3PXGa 1RWKB 1TAUA 3KK1B 5EWGA 4CNYA 2UVUA 5J2PB 1S1VA 1WACA 4QIGA 1KVKA 4BR5A 3E01B 1PCAA 2W40A 5HJXA 2PSZA 2E1CA 2Z57B 4OL8A 3VF4A 3CE8A 2V67A 4CT8A 2ZE2B 3TZWA 2VICA 1I51B 2FJWA 2KHCA 1JLFA 2BRKA 2H1YA 3S7RA 2F8EX 4Y2KA 4WF9L 1PAEX 1BU6O 1EIYB 2IJRA 1VHFA 3RWUA 4IBNA 1WG4A 2JH3A 4CZJA 4KHPF 3KVGA 3CCSS 2VIHA 4IO9L 3ISZA 1Y10A 3GSDA 4OJGA 1LW0A 3TZZA 3N4PA 4I6AA 3GQCA 4E98A 4AL5A 3CJAA 4NRTA 4P2MA 4LJMA 5D3GA 4JI0K 5CCMA 3BJYA 4X65J 6FDRA 4IOCL 3QT5A 3CW2C 1NPPA 1RAAB 4X64F 4HWIA 3ATUA 4WFBQ 2AYEA 1FNMA 1NHKL 5I9EB 4KSEB 2B9YA 4FWMA 4UOCA 1OQ3A 1KQGB 1VQSA 1Q86T 4DSLA 4LFAJ 2VFRA 3LF0A 3F9MA 3WZ0A 2O8CA 4BRLA 3CC4N 1RTJA 2KG1A 4QIEA 4CD1A 2JL9A 4LSNA 2WW4A 2DHAA 3UD3P 2Z1GA 4P73A 2QZ8A 2C22A 3PNIA 4BRFA 3I55S 4FYVB 1R8BA 2XYHB 3NGDA 3DYAA 3VAJA 5F2RA 2OFGX 4AYBD 3NMRA 4PG7A 2LYVA 3R7BB 3S3MA 4X62F 2VG6A 2RDJA 5AZIB 1QTNB 3JYTA 4PY5A 4JI1F 2YNFA 3A3PB 3SMPA 3NL0A 3TW0A 1TFWA 3E51A 3DLKA 1CJUA 5HL7Q 5D0RA 4CLWA 4HTJA 1KR4A 4ZJLA 3OVSA 4KRWA 1MWYA 3W66A 1IO2A 5HAOA 2JEIA 3PJWA 5DG9A 2HBMA 4JBCA 5HBMB 1XWLA 3S1TA 3VV2B 5C15A 3KKSA 2A1SA 3RW6A 4MMOA 4PRFA 1UVNA 2E1YA 1S1UA 3R8EA 4CLFA 5B8HA 3BSOA 3KKFA 3M1VB 4J9MA 1NSKL 4OYZA 3OT9A 1SL2A 2CQIA 3I8DA 1YG0A 1RKIA 2A6AA 1NK7A 3QEPA 3IC1A 2GMJA 1RWNB 4GV6A 1HNZF 1CG2A 4C6AA 4JN4A 4PABA 4FS2A 3MM9B 2F9JA 3ZSOA 4BRNA 3AQOA 4ZTJA 1VSDA 1RABB 4E1MA 3K9JA 5ADXH 5LMUF 3D4JA 4AXIA 3V4IA 2AKWB 2ROPA 2C42A 4JI0J 1FJ7A 2VL1A 5J1NA 2H5JB 3D6HB 4AQYJ 3HT0A 1KNZA 2DHGA 5F9LA 4LBPA 5BJRA 3ZSZA 1U26A 4IKAA 2W8KA 1RFQA 3BR9A 2M88A 1EKRA 2ZBPA 2GHVC 3D9BA 2NRRA 1QAXA 2QSFA 1VSIA 1I39A 2ZH8A 1YJ7A 3PR4A 2BE2B 2XY8A 3O2IA 1LWFA 3F0NA 4NEZA 2Y1IA 2LQ9A 3LH2S 3L2QA 3OS1A 2HLTA 3ALYA 2O67A 4CFAA 2DGVA 2DK2A 1JKHA 1S1XB 5DQIA 2YTCA 1BUXA 3GR0A 3C6UB 1S7IA 5FPDA 1HI8A 1QAIA 4AT1B 1N33F 2ASMA 3CG7A 1TUGB 5KG7A 2MHNA 1ZBLA 5JLFA 4DDFA 4MDBA 1J5OA 3CFRA 5CHIA 1WG1A 1WKKA 3MZIA 4N41A 2LLZA 4YB6A 1PC4A 1OYEA 1WC5A 3O4QA 2D0PA 4HR2A 2ZH9A 3AVIA 4DV6K 4YOWA 3POTA 4L73A 5DGBA 5JS1A 3GIKA 2MKIA 5HOOA 4DCJB 5M1KA 2QGFB 4RW7A 1GOBA 2FJBB 2HHPA 4X4RA 3OFEA 3W63A 4DL4A 1HMVB 1DTTB 3MEDB 1T95A 2W6KA 1HR0K 4EBEA 3WEEB 1IKWB 1U1MA 1HKAA 2L3MA 5KG0A 4DV7F 1JLCB 4DV5K 4CHZA 1SJRA 1S57A 1D09B 3UDEA 4O3SA 4PG6A 4WYWA 3NGUA 3BGLA 4NYNA 2AP1A 2YWKA 5AZJA 1UL3A 4BE2A 3KD5E 4U7CA 1R8HA 3O1LA 4ED3A 3BGRB 2EVZA 3QFWA 1XHXA 2P9KB 4LF6J 4Y1DA 3TUIC 3IKMA 3L7UA 3KLIA 1WC6A 1S4EA 3GBTA 4ZS6A 2ATLA 4LF9F 3CMES 4PG4A 4RUCA 5KFLA 4NLRA 4NI2B 3P31A 3QATA 4M5IA 2RD5C 2GVZA 1PKUA 3OSNA 5C0YA 1G3OA 2ILZA 1JXEA 3KLGB 1AYEA 3IAM9 1ZBUA 3KLFB 2NREA 1LV5A 2DNZA 1RTHB 1YF5L 3MN9A 2HHQA 2WONA 4PKHA 3U02A 1ZETA 3L2RA 1T9TA 1VRUB 4MH8A 1NU4A 4A8OA 2VPYB 2DVIA 3R2CJ 3LDLA 5D77A 1VQ4S 1NDLA 5A6WA 4L3QA 3M6WA 4WK3A 3U27A 1XN9A 3VQ4A 2F4FA 2J7KA 1QJHA 3HP6A 1PYTA 1VRQC 4GY2B 2DGUA 4I9QA 1VK8A 1ZPWX 2J9EA 3I0RB 4I64A 3W9JA 4CO4A 5DG8A 1APSA 4CEZA 1BA1A 5DETA 4DV6J 3G25A 2ZM6K 2AZ3A 2R7OA 1RBLA 3THPA 1HLWA 1B9FA 2B8QA 1KQSR 1YTAA 3ZTQA 8AT1B 2JWLA 1SQGA 3K89A 3JS9A 1HX1A 4FJIA 5LMNK 4KB0A 2XGPA 1VSLA 4RUAA 5GADU 4H5WA 4L72B 1CJVA 4GV3A 1JCGA 4OKKA 3L2VA 1XUPO 2CYYA 2MLYA 1NPKA 5B7WA 4YNQA 1T9VA 4FM0A 4BC9A 4ZP8A 4JI7J 4B8CA 4Y0WA 3D0HE 1EP4B 1LK5A 1NK0A 4DV4K 3VESA 3ID6A 4HTLA 4DV5J 4FDFA 1VQYA 2CUYA 4O3NA 3CJBA 5H1SQ 3OTOK 5KPRA 2B9XA 3QT8A 4FK2A 2RUGA 4WXOA 4ZN1A 5AQNA 1U7LA 4DUZK 4QPXA 3M5RA 3VTHA 1RT5A 1IV0A 4CZMA 1AXQA 4DR4F 2E1PA 5A8WA 5I3UB 3L7OA 3TAPA 2J7WA 1WC4A 4ISGA 4B9SA 1CS4A 4QWBA 4QS7A 3M2RA 3RMAA 5BN9A 4QWCA 1F6TA 1LNQA 3T9ZA 4H5VA 1RHRB 4ZJOA 5ADZA 3PFOA 5EGYA 2CGKA 2KL8A 3DOKA 1RT3B 1X9SA 3G6EN 1QDUB 1WSEA 3BN4A 2OMOA 4X66K 2IRUA 2YCHA 2HGMA 2C2DA 1RLDA 4B8AB 3I9ZA 2Z8QA 2C2NA 4E7LA 1Y4ZB 3KIOA 4ZVSB 4ZPWR 1SC1B 1KDNA 3KHHA 4CBWA 1CLQA 5DQGA 4JKDA 4LFCK 5DM7L 4XK8C 3GE1A 5AXNA 2JVOA 1N32J 2P5OA 2HMPA 2J5AA 2P9KA 2VH7A 3C15A 1QHTA 5DJBA 2V8PA 3OYHA 1SJ1A 3BYRA 3MCPA 3WXLA 2BQRA 2VC1A 1N5QA 1QE1B 5F3ZA 1T6DA 2XGQA 3PUFA 2E5HA 2R2SA 2DIVA 2EFNA 2ASDA 2YXLA 3KK3B 2QA1A 2DFHA 3UNGC 4BBYA 3QRPA 4A2BA 4K5SA 1GTHA 3BPSP 4WKRA 3DI6A 2FZCB 3OW2R 2H5IB 3AVGA 4KQZA 3E9LA 2A1RA 4MIWA 4UF4A 1KTVA 5LMNJ 1JNZB 3NEKA 1CLFA 1B7FA 3H2LA 5L8RC 4ECQA 2AGQA 5DZ6A 3BSAA 3TI0A 4QYZJ 4RUHA 1BUPA 1IWAA 3VGSA 2AGPA 4EGLA 3D6RA 2B8PA 2HHSA 1U1QA 3U8XA 3TA1A 4FJLA 5KFVA 4DV4J 1S6QA 1H74A 3N4WA 1YSJA 5HMYA 1HBUA 4JI8K 1XR5A 2C2OB 3SEOA 4MIBA 4MO4A 1ZPVA 3Q23A 2Q97A 3R27A 3FZMA 3OYAA 1S9GA 4NMXA 4DUZJ 4EFAC 2V2VA 4NCGA 1BQXA 5IWAF 2A2CA 4M5MA 5C2CA 2WVFA 2Y1LB 2D74B 1RLCL 1C6VA 1N56A 4DX7A 1JIHA 2ZJQQ 3AVNA 3I31A 4HHUA 2D41A 4AE5A 2G9OA 3A4TA 4X2BA 1HBOA 2KT2A 1FE0A 1QSLA 1ZBFA 3DLEA 2I0XA 1WC3A 4QWAA 3CXCR 5AQWA 4FM2A 3BH6B 4TY8B 5KG5A 1VBYA 3O1WA 2GCFA 4X66J 4MAKA 1T03B 4AILC 3AOAA 1NB7A 5KI6A 1ESVA 2NYHA 4H0PA 1K47A 5CE3A 3L3UA 3DLLQ 4I67A 5I4MA 1CXUA 3HDSA 2KW4A 4DL0C 1PYSB 3W5XA 4CEFA 2NXNA 3HHLA 1OIAA 2RRBA 4ITSA 4F4KA 1N8RO 1WBDA 2HG4A 2QYCA 1YBUA 1WELA 2A2DA 4DTMA 3MM7A 4JV5F 1HNIA 1U02A 3K7RA 5J2NA 3TSUA 2HF3A 1Q9XA 2CQ3A 5C2FA 1C1BA 1DLOB 2MZSA 3J7ZT 4LF4J 1IJEB 5E3AA 1IM6A 2SXLA 3VHQA 2MKHA 5BR8K 2NXCA 3E9OA 2ZEJA 2O8FA 5L1LA 2XS5A 2QX0A 2PMZD 3K57A 3T9NA 3MCAB 3TTFA 1NGGA 5FLXO 4DV1F 4Z4CA 2G0CA 2MHEA 1X9WA 2J6TA 1ZBSA 1LAVA 4J7CA 3HRGA 4CJ4A 2VQEJ 3BBCA 4OX9K 5J2QA 4DU4A 1M0SA 2AP6A 4K43A 4CFDA 3UKUB 3F9KA 2Z56B 4EMDA 2L9WA 1NK4A 3V1OA 1RCXB 3R7SB 3ZETB 2NRXA 4ZHRA 2BRLA 4KV8B 4CJ3A 3CD0A 1K1SA 4FXDA 1RDBA 2DFEA 1YJWS 4LIRA 2D0BA 3HP9A 3FEXB 2XEXA 4TNOA 3ZZYA 1IBKJ 4YUDA 1F3FA 4JD2B 3PACA 1K9MT 1R8AA 4BR2A 3CQXA 3JSRA 1UWBA 4JOUA 4FJHA 4CTAB 3GG4A 3C16B 2GV9A 5JVHL 3JQKA 1VQ6S 1RB0A 1VSEA 4FNIA 1FRMA 4YDUA 3PYDA 4LF7F 3K2YA 3O3FA 3T7ZA 1GLLO 5D0GA 4W98A 1RBUA 2R7VA 2OZMA 3V2UC 3R5AA 2GW8A 2IM2A 1O13A 1OKJA 1SUQB 2YKNA 2CZVC 3AHPA 4BRDA 4JI6J 3US5A 1TR0A 2PA8D 1FESA 1RT6A 4RWXA 2HMIB 1DQ9A 3AH6A 4RW6A 1G99A 3ZZTA 2KVIA 4Q45A 3PX4A 3A8IA 4KYZA 4USUA 4DHYA 2IDOA 1HJRA 2CJKA 4IEEA 6FD1A 4DN0A 4E8UA 3GILA 1L5UA 4O55A 2ACMA 3VAMA 3AV9A 5E26A 1SZ2A 1OH6A 1KAZA 2FGCA 4M41A 4U67L 3J7YP 4YHHK 1UVJA 2V4RA 4WQ5C 1B0VA 1XEZA 2DIUA 1XNRF 3NWGA 5BR8J 1VI7A 3DNCA 3TQEA 1VGYA 2E2PA 3P5BP 4NXNK 4ES3A 2FC9A 4KR0B 3TAQA 2ZC3A 1CJTA 3D2EA 4H0TB 3KUEA 3CTRA 2DD8S 4OX9J 2Q66A 3PHEA 1YZ6A 4F3QA 3HK2A 4Q7AA 3UDCA 5F0WA 4MK8A 5C7PA 4KJIA 4OPKA 1W26A 2QRRA 3CIPA 3OA9A 2WVBA 4FBTA 3IAS9 1M5KC 2CXEA 2OKQA 3R5GA 1S3XA 4LFBF 4GMKA 3TJ8A 3K2PA 4TVAB 1JNRB 1R89A 2Y8YA 2HLUA 1HBNA 3G9CA 4J9RA 4Z37A 4ZCLA 1W97L 3MEGA 1MROB 2LEAA 3T3FA 2DH9A 2WFBA 3G2XA 4LF8K 5D8HB 4LC9B 5HANA 3A8JA 3W60A 2NQPA 1IXKA 4IG0B 1AUDA 5GMDA 2EPIA 3QWUA 4ED8A 2RMLA 4WFXA 4FWNA 1S79A 5JMNA 2VWKA 2E5GA 3PW4A 5B0CA 3TEHB 3MTKA 1SKWA 2WTFA 5AQXA 3QEWA 4GC7A 4OZ1A 2XCPA 1HI0P 3EO3A 2FQQB 4UZBA 2WRMA 3FFIA 3V6DB 1KN6A 3BP8A 3VF2A 2YNGA 1VJWA 2PDAA 5HQLA 4HUGA 1RQ0A 2GVDB 3HHEA 2YQ1A 4FJJA 1BOTO 4DV6F 1N5VA 2CPXA 2EC0A 5CAAA 4Y34A 4ZPCA 3QLHB 3LP3A 1IBLK 2UUTA 1GOAA 1T9WA 2BVZA 1VQ8S 2G8VA 5AQIA 1NK8A 3LGNA 2P9CA 1K73T 3HOTA 2OPSB 1B64A 2MEWA 3AVMA 4B3MK 2FHOB 2CKWA 2FZGB 1HR0F 1BDGA 3H20A 2H9ZA 2XYPB 3ICLA 3TZYA 3EVMA 4JK7A 5I42A 3MM5A 2HSTA 3GFHA 4IR1A 2E5JA 4LVNP 1FJGF 4YHHJ 3O6QA 1KD1O 3TOQA 1BD6A 1TKZB 4ZVPB 1TFYA 3M8RA 4CK1A 2CG8A 3K9KA 3M6VA 3GJRB 4NXNJ 5K14A 2H3EB 4NOHA 3VF6A 3WUHA 2CDRB 4EK2A 3GL1A 3O9UA 4FJNA 1RYRA 2OTJN 4B1WB 1QD1A 3C14B 4HHJA 1HWIA 3FKBA 3QFHA 3MR2A 3AY0A 2V8HA 2I5JA 4LREA 3VQAA 2J8SA 2DGTA 1WOSA 3JAMY 3LPUA 4BVPA 4JS4A 2XULA 4LF5K 1QQNA 3T5JA 5AQRA 1MW7A 3MPWA 1NSAA 4KHQA 2Y3YA 1WTFA 4KHRA 1OWXA 4OLOA 3NGYA 4BQZA 5LY3A 2Z4PA 1RAFB 2CWKA 2DGOA 1M1HA 4UY8T 4NYPA 1MWMA 1BQNA 4LF8J 1S1TB 2WCXA 2QWOA 1FKAF 2W25A 1TUWA 5IM0A 3TUPA 3DXSX 4O0JA 4A46A 1ZAXA 2IBKA 1Y64A 4RNNA 2OPQA 2ASJA 4ISEA 4ZP7A 3ENVA 3M30B 2BUPA 2Q36A 4J9SA 2D7SA 4JRQA 3SMZA 4DR3K 4DTNA 4NZ7A 4UOHA 1XC9A 2XHCA 2XHBA 1A5XA 4OYXA 5IC4B 4CJLA 4CGJA 4YQWA 2H65B 2V7YA 5AQLA 3EICA 4M5HA 4CEDA 1YJ9S 2MZRA 3KJFB 2MY7A 2FVSA 1E6YA 2NCKL 4L6V3 4DFJA 1V3ZA 3CVKA 5E3CA 1JXLA 3MMVA 1OSCA 3W5YA 4NLOA 4M3UA 1WNEA 4Y3CA 1U8SA 2ZM6F 2G0IA 1VQNS 1J27A 3UQSA 2K7KA 3LP1B 4FWSA 2BYCA 1BIZA 3B4MA 3DRSB 4N56A 2WB4A 3IRXB 5HVHA 1IKXB 3MMJA 2L08A 2O3DA 5D78A 4F04B 4KHWA 2QA2A 2P9GA 2CRLA 4MDAA 1Q7YO 3L3CA 1NMDA 1S6UA 5LJ3Y 1SAZA 2QL5B 2QA4N 1S0OA 1DT9A 1H2VZ 2FJEB 3MDFA 1FRLA 2UXCF 4R0EA 4FZVA 3DU6A 2YVSA 2DTUA 2O01C 1OPIA 3RB4A 1NK6A 3NCQA 3RB3A 4K4ZA 3NP5A 4HTIA 3M9NB 3DXKB 3V81A 1OH5A 1KVIA 5GAGI 3OTOF 5CZVA 3GG1A 2MKJA 5D4PA 1RGIA 1S6PA 2E1ZA 3W9IA 4K41A 1GT8A