4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HIV-1 reverse transcriptase, p66 subunit
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
4W5QA 3VQDA 4Q0BA 4ZVHA 3MTKA 3B6PA 5HBMA 4FZXC 5DGAA 3Q8SB 4ECVA 3G10A 3DYAA 1EKEA 4O4GA 5DQGA 5HROA 3KHGA 4O55A 2IAJB 4Y34A 4DG1A 2BRKA 3DI6A 5I42B 3EPIA 1F21A 3O4QA 4AHTA 5KFIA 4K4ZA 2W9CA 4O0IA 3S3NA 3RWUA 3GV5B 4DF8A 1VSMA 3VQ8A 4FCYA 1U4BA 3ISNC 2F8EX 1T3NA 2XY7A 2E9TA 1JXLA 4I9LA 2VG5A 4NLDA 3BGRA 2JEJA 4LQ9A 5KFHA 1NK9A 4MK8A 4MIBA 3T5KA 2BE2A 4J9NA 2Z1HA 1JLQB 3HP9A 3AA5X 1MMLA 3G6XA 3HJFA 2DPIA 4CCHA 2WONA 4KHQA 3K5LA 5KT6A 2KZMA 2GIQA 5K14B 3LPTA 1S10A 4CIFA 2G8FA 3BREA 4LQ3A 4CECA 2A1RA 2W7PA 1JKHB 1VSLA 3CQ8A 4RG8A 5KT2A 3ZT2A 3VQEA 4ELUA 2HAIA 4I2PA 1IM4A 1KHVA 1HQEA 4CJKA 5KG0A 3BDPA 2HNYA 3KLVA 3AVNA 3V4IA 3M8PB 3OY9A 1RT1B 1TVRB 4ZPDA 4CGDA 1KHWA 3CDUA 4W5OA 3MR3A 3HVAA 1REVB 3QIPB 2J6TA 2FJWA 3NE6A 3KLIA 3LP0A 5FRNA 3DI6B 4M3XA 4KKOA 4DFJA 1S6PB 2FVCA 3M8QB 1RTIB 4TY9A 1VK0A 3RMDA 2UUTA 4Z4HA 3HYFA 4DFMA 4Q45A 3UIQA 1CLQA 2OPSA 3NAEA 4DTSA 2QKKA 1VSDA 1TKXB 4HHTA 4WZQA 5KFMA 4CIGA 5KGWA 4ED8A 1NOZA 3SQ2A 1RTIA 4CFDA 5J2MA 4EEYA 1TV6A 4NCAA 5HLFB 2OPSB 1O1WA 1JLBA 3RB4A 3AVIA 1JLCA 3OL6A 4J2BA 1RA6A 4BWJA 4ECWA 5DG8A 3L2QA 2VG6A 4CEOA 2B5JB 4KV8A 4CJWA 1ZTWA 3H2LA 1IO2A 3BQ2A 4FYDA 1FKOB 4AHVA 1Z4UA 2C28A 3O3FA 3VN5A 3HK2A 4NLSA 5T7BA 2I5JA 4F3OA 4ECSA 3PY8A 2KZZA 1HPZB 1J5OA 5KG3A 4WFXA 5KFLA 4CGGA 3QESA 5C25B 1Q9XA 1REVA 4CJRA 2E9RX 2D5RA 4DEZA 3C6TB 3DM2A 4DU1A 2OPQA 3M8QA 4CIEA 3KD1E 4K8ZA 2BE2B 4RNHA 1YVUA 1C0UB 3O3HA 2HNZB 1HPZA 2G8WA 1VRTA 3LAMA 1HNIB 4FJLA 3LZJA 4O3NA 3CO9A 2FVRA 3QGIA 5F8GA 4K4YA 3ZSOA 4CJPA 3OSNA 3IS9B 5F9NA 3UR0A 3BSNA 5JS2A 2HHUA 1TL3A 4K4XA 1KTQA 4B9LA 1UAXA 3OYFA 3HPHA 2XI2A 3LZIA 3OYJA 3AO5A 1ZETA 4FJKA 4IDKB 4NLQA 1S9GB 5KFNA 1JLFA 4J9PA 4GC6A 4QW8A 3KLFA 3DRRA 1SH3A 3CJ2A 4CFCA 4DTOA 4QPXA 1S49A 2ASJA 1FXXA 2CKWA 3MEDA 4M94A 4NCBA 3PZPA 3KLIB 2QXFA 4DTXA 1BIUA 4FK4A 4DL6A 1J5OB 3PVXA 2YNHA 3AVFA 3KLFB 1IKVA 4B9NA 3HKWA 1QS4A 3DM2B 2FLNA 3GIMA 4IR1A 4FZZA 4L8RB 3AA4A 5J2QB 3OYAA 5JUMA 5KRSA 1ZYQA 1JXBA 3V6KA 2HHVA 4TXSA 4DQPA 4BE2A 5J2MB 1RDBA 3P83D 1IKVB 1J53A 1ZBFA 2YNIA 2R8IA 1IKXA 4LH4A 2D41A 4FLVA 3I0RB 3Q8PB 5K14A 3QIOA 3HO1A 3MFIA 1IKWA 3F9KA 5KG7A 5KFOA 5CZ1A 3QGGA 3OSPA 4QCLA 1JKHA 4AHCA 3TAMA 1GOCA 3CJ5A 3V9ZA 1Z26A 4RU9A 2FBXA 3PHEA 1RT4A 2OPPB 3MEEB 5C25A 4HKQA 1RT2A 4DWIA 3C95A 3OS1A 4O3OA 3PW4A 2FLPA 2Z1IA 3QIPA 3M8SA 2R2SA 2D0AA 1EETB 1RCHA 4NCGA 2IMWP 5L1JA 2VA2A 4FK0A 1I3AA 4IFVA 5KT4A 4G3IA 3JSMA 4ICLA 3DRPB 4NLPA 4Y2CA 2WHOA 4FLXA 2HVIA 4FJNA 2IM0A 5KG6A 2DFHA 4OGEA 4OKJA 3QLHA 5L1LA 1SH2A 4RW8A 2C2RA 1S1WB 4CHYA 4FJ9A 3VQSA 1XWLA 3QZ7A 1S6QB 4EBEA 4JV0A 2BR0A 4I7FA 3RRHA 2RKIB 1NK8A 4TN2A 1TV6B 4ZVFA 3EZ5A 3BSCA 5HLFA 1QE1A 1S1XB 3A2FA 2ZE2A 4K4WA 4CF2A 3ZCMA 4EBDA 3TABA 3OYIA 4FJMA 4Z4FA 4TLRA 4CEAA 4W5TA 3H40A 4NLTA 1HYZA 1W0HA 2RPIA 2VWJA 2IM3A 2B5JA 3UPFA 4CERA 1Q9YA 4IRDA 4H8KA 3SNNA 4IRCA 4DL4A 3TAEA 4M3ZA 1XHXA 3QEWA 3GV7B 3KK1A 1T05B 2FVPA 2IA6A 4C8KA 1S1VB 4C8LA 4Q0BB 2C2EA 3CFRA 1WSJA 1EP4B 3ULDA 4H54A 4O4GB 1QQCA 5KG2A 4Y2AA 1XR7A 4URQU 3RAXA 1WNEA 2HHXA 3L2VA 3L2RA 2ILYA 2R7YA 2F8SA 2IGIA 1SKRA 2X6NA 4FBUA 3SV4A 1QUVA 5F8JA 3DLEB 4CGIA 3CDEA 1EP4A 2W9AA 4QAGA 2JEGA 1L3TA 3NDKA 1S4FA 4XPEA 4DTNA 3DRSB 3MXMA 3DLGA 4TYAA 4KREA 2IM2A 1UWBA 4LSLA 5KT3A 5KGXA 2R8HA 2G8IA 3ZT4A 1FKPA 1BQNA 1LAWA 1K1QA 1BL3A 3ZT0A 4ECUA 2OPPA 1RYRA 3MEEA 4ZHRB 1NHUA 4RZRA 4K8XA 3G6VA 3OYCA 4HTUA 4H4MA 3DYAB 4BE1A 3MEDB 4HYKA 3QIDA 1JLAA 4ZMMA 4NYZA 3VQ4A 1D9DA 1VSEA 4JRQA 3M9NB 4CF9A 2VG6B 4E7KA 1RT1A 1TVRA 4W5RA 4B9SA 3AVMA 5KFQA 4F4ZA 2WK4A 4MIAA 3L3UA 2BRLA 1K6YA 3NF9A 2E9ZA 1BHLA 1C0MA 4DS5A 5J2QA 4KB1A 2JEFA 5FRMA 4B3OB 4K4VA 1BCMA 1SKSA 1S6QA 3U3YA 3KMSA 2KTQA 4R5PA 2YHAA 5I3UA 1Z25A 5KFZA 2V9WA 1TK5A 4OVLA 3VQ7A 5EWFA 4ZP9A 1B9FA 4OJRA 5KFGA 4CEBA 2J6SA 2EHGA 3PJXA 4CK3A 3K59A 2OZMA 3DOLA 4FVMA 4M3RA 4KHSA 4J9OA 1UWBB 3ZSYA 1S48A 3M8RA 4YMEA 1VRTB 1HNIA 3V6JA 3NF7A 4NLOA 3SPZA 4EBCA 1TP7A 5DLFA 2J6UA 2AX1A 3ZT1A 4IH6A 3PW2A 4RW7B 4RUAA 4RNOA 3H59A 1XR5A 3KHRA 4IRKA 3PX0A 3QO9B 2UVRA 4H4MB 1SH0A 1TL3B 4ID1A 2YNFA 3QEVA 5C42B 3AO1A 2DTUA 2WOMB 4OL8A 1ZBUA 1X1PA 3IGNA 1TKZA 4N41A 2F8TA 4OGCA 1EETA 4YNQA 2VA3A 2D7SA 3OVNA 1HNVA 3DRPA 4NLUA 4CHNA 4OKKA 3AVHA 2ASDA 1ITGA 3N6NA 3FQKA 1GX5A 2R8GA 4KFBB 1NKBA 4E7JA 2XCAA 1NK0A 4H4OA 2P51A 2G8VA 1YVFA 5C5JA 1WSGA 4AHSA 1A5WA 4FJIA 5KFRA 3SUOA 2YNHB 4OLBA 5KFFA 3H5SA 3NCIA 3LP1A 3AO3A 3SQ4A 5KFDA 5DQHA 1JLCB 1S1XA 3RBEA 4CGHA 4EYIB 3AVAA 5DG7A 3SUNA 3DDKA 4JV1A 4PA1A 1RDDA 1C2PA 3VQCA 4DTMA 3IS9A 3QINA 4WE1B 4Y1CA 2V0NA 1NK7A 1UOCA 4J2AA 1KVCA 3LP1B 3QNOA 4QWEA 4J9LA 4ELVA 4BDPA 1TKDA 4IDKA 4O3RA 2YKMA 3ZSXA 3V1QA 4CJSA 2YNFB 4FW1A 2D0CA 2QK9A 2W42A 1RT6B 4CJ3A 4M95A 5EDWA 4RNMA 3OHBA 3T5JA 4Z4CA 4CF1A 4DTUA 2OPQB 2JLEA 1BIZA 3E01B 2ZD1A 1C0UA 2YNGA 2KW4A 4Z4EA 2ZQBA 2XHBA 4YFUA 3EY1A 3H5XA 2KFZA 1LWFB 3SFUA 1K1SA 4E1NA 3V6DB 4QWDA 1N4LA 3V1OA 3GV8B 2QV6A 4NCGB 3ZSZA 4B9UA 3TAPA 4ICLB 1NK5A 4KHMA 4EO8A 2DY4A 3HPGA 4CHZA 4CGFA 1WSFA 3SQ0A 2FBYA 3MR2A 3CG7A 1SUQB 4NYNA 3QLHB 1JX4A 5HRSA 1L3VA 2YNIB 3NL0A 1BQNB 3IAYA 3CM6A 3H4DA 2FBVA 1TKTB 3I5BA 1GOBA 2X6SA 1IKWB 3LAKA 3NKYA 4ED2A 1SV5B 2BANA 1MU2B 2WOMA 3BSOA 1RTJB 2YKMB 5EUHA 3HP6A 2W8LA 4DQSA 1KFSA 1HQUB 1D1UA 4NRUA 4F4XA 4IOBA 4OKEA 3D0PA 5KFUA 1RT4B 4E3SA 3THVA 3H08A 4I9QA 4KHRA 3RBDA 4AH9A 1XC9A 2IM1A 3NAHA 3NGYA 3AVBA 4GC7A 2GV9A 4DSIA 4O3SA 3CM5A 4AHRA 4B3OA 4KRFA 1RT3B 2WTFA 3JSMB 4ECXA 1VSJA 4CJUA 1GX6A 4ECYA 4Q44A 1RT5A 3SFGA 4CJEA 1HMVA 4CHPA 4IG0A 1WSEA 2FBTA 4DSLA 1XR6A 5F8HA 2HHSA 2B6AA 2BDPA 3RR7A 4O3QA 2UVVA 4F4WA 4CF0A 2JEIA 4WYLA 1DTQB 4FM1A 5HRNA 4J2EA 3TAMB 3OYKA 3EYZA 1RBVA 1L3SA 3DLEA 4FS1A 1ASVA 5CYQB 5HRRA 1RBSA 1HMVB 3OYMA 1C0TA 5J1EB 3ZSQA 2ZE2B 1NK6A 4CJ5A 2AGOA 4JUZA 1TK0A 3ZSVA 1RILA 1NJZA 3FFIA 2HNDA 4DFKA 5C24A 1U09A 1RT2B 5DLGA 3N6MA 4CESA 3HHKA 3ITHB 3ZSWA 2C22A 1RDRA 1QTMA 3PW5A 3FDSA 2AGPA 1LWCA 1RTDA 3MFHA 1C0TB 3V4IB 4DLGA 3P5JA 5KG4A 1S1VA 4FW2A 1VSFA 1VSIA 3OL8A 4E19A 3CJ4A 4LD0A 4M3YA 4KFBA 4PWDA 2E4LA 5D3GB 1JLAB 3KLEA 3K5NA 1DTTB 4KKOB 3NGZA 1SL2A 3V9UA 1BQMA 5DGBA 4I7FB 2BQRA 1LAVA 1RT5B 4URGA 3TAQA 1N6QA 2YHBA 1SKWA 4IFYA 4URSA 3GQCA 1QE1B 4CFAA 3QEXA 2VWKA 3KLHA 3TI0A 5FDLB 2B6AB 2P5GA 1KCFA 3KK2B 3CJ3A 4EP5A 4RNNA 2W9BA 1NNDA 1TKXA 3N6LA 2KFNA 1N48A 3H4BA 3I5AA 5F8LA 1BQMB 5F8MA 1NJWA 5E41A 3CWJA 4LSLB 2XI3A 1MU2A 4NLYA 5CYQA 5FROA 4IFYB 4TQRA 1KVBA 1HRHA 5DK5A 1S0NA 4PUOA 4CEFA 4B9MA 5KG5A 1FKPB 4MH8A 3KK1B 1WLJA 4IR9A 3QZ8A 1KFDA 4FXDA 3RTVA 3OYNA 4O3PA 3PX6A 1TL1A 4CJ4A 3P1GA 4KV8B 3OJUA 4FJ8A 3MF5A 1Q8IA 2V4QA 4NLXA 1WAFA 4WXOA 4QWCA 4DU4A 3NFAA 1RT3A 1RDAA 3G0ZA 2I5JB 2JGUA 3V9XA 1J9AA 4E7HA 3VA0A 4KAIA 2IDOA 4LSNA 3U6FA 1DTTA 2IS3A 3DRSA 4B8CA 3KIOA 5KFWA 3DLGB 2QKBA 1HNVB 3NH0A 1N6QB 3SJJA 1IKYB 4Q8EA 3MR5A 1ZTTA 3TWHA 3CIZA 4FM0A 2RF2B 2YKNA 1T8EA 3V81A 3L2WA 1TKTA 1VSKA 3PW7A 2O4GA 4UQGA 1U45A 5L1KA 3MXJA 4B8AB 2XCPA 2QE5A 3M9MB 4RW9B 2ALZA 3VQ6A 1D5AA 1BI4A 3PO5A 4CEZA 1RTDB 4FBTA 2IBKA 4JS4A 4F8RA 2O4IA 1YTUA 5KRTA 4KHYA 2BQUA 4OLAA 1XI1A 1NHVA 4M3UA 3SPYA 1T7PA 3KLEB 4AHUA 4YP3A 4YQWA 4R5PB 3OYHA 5HBMB 5I3UB 2E6LA 1RDCA 1GOAA 4ECRA 3VQPA 4ED6A 4KB0A 3NHGA 3KLHB 5J2NB 3OHAA 5FDLA 2PY5A 2XWYA 4FLYA 3DOLB 3S9HA 1S97A 1JXEA 4H4OB 2WCXA 1WN7A 5SWMA 3TQ1A 4FM2A 3I8DA 3SUPA 4IBNA 5JXSA 3NF6A 4KTWA 3NAIA 4TY8A 2BQ3A 2X78A 3EPGA 3KK3A 3I0SB 4DSFA 3NGIA 1ASUA 4QWAA 3H5UA 1Y97A 3I0RA 3RB6A 4XPCA 1G15A 2I1RA 2HNDB 5C42A 5C24B 3BSAA 3OYLA 4IQXA 2XY8A 1HYSA 4KBIA 4C8NA 2IJNA 1D9FA 1TKZB 3KK3B 2D0BA 3ITHA 1TK8A 5F9LA 1TAUA 1VSHA 2W8KA 3EZUA 1RTHB 1R0AA 3LWLA 3T1AA 4KB7A 1HQEB 4CGJA 3D28A 2HNYB 3OS0A 2WRMA 3M9OB 2HWIA 2AGQA 4E7LA 4F2RA 4F4KA 3PO4A 2E6MA 4ED0A 2R2TA 1QAIA 4QOZB 1R0AB 3NMAA 4B9VA 2Y1IA 1DLOB 3RB3A 1S1TB 2OZSA 4GMJB 3B6OA 3OYGA 1FK9B 3SYZA 3UQSA 3O4NA 1S6PA 4HUFA 1RBRA 3OYDA 1IG9A 4JV2A 3DLHA 2ILZA 5L1IA 4FJGA 2ATQA 1RT7A 4O44B 4ECQA 1TGOA 4R0EA 5KFAA 4HCBA 3I0SA 3L3VA 4ZVEA 4NLRA 1BI4B 4YR2A 4BDZA 4PUOB 4ID5B 5KFBA 3RMCA 3NBPB 2FVSA 3HXMA 3OLAA 3D5MA 4EO6A 3T19A 1HYSB 2Z1JA 4OPJA 3QERA 4CE9A 1SV5A 2BANB 1NJYA 2G8HA 1RTJA 2HWHA 1BISA 1I39A 3NH1A 5DG9A 2ZD1B 4FK2A 1RBTA 5KFEA 1B92A 1CSJA 2R2RA 1SL0A 2ZKUA 2XY5A 4ZP6A 3OL9A 5KI6A 3AVJA 1FKOA 3T5HA 4XO0A 2HMIB 4J9MA 1C1AA 5EWEA 4DQQA 1KSPA 4JRPA 1NK4A 1WSIA 2AWZA 3AVKA 5DQIA 3NGDA 4ELTA 2HB5A 3QGHA 2IJFA 1J54A 4HUEA 1QHTA 4FLUA 3PV8A 3HSTB 4ZP8A 3ISND 4N56A 4QWBA 2IC3B 4NZ0A 4FLTA 3TANA 2X74A 1RA7A 4MKAA 1S5JA 2HNZA 4DLEA 4HCCA 5D3GA 1LW0B 4KI4A 2Z1GA 3E51A 4J9KA 1DTQA 1I6JA 3LWMA 3S3OA 3HVWA 4NLVA 4RW9A 4W5NA 1LWEA 1BCOA 1N5YB 3SZ2A 3KK2A 3NBPA 1JLEA 3HPOA 2XGPA 3SCXA 3AVGA 4CJTA 4WYWA 4AILC 3HVRA 3DOKB 3OS2A 4ZHRA 4PQUA 3FRZA 3DLBA 4O0JA 3V6HA 2XC9A 4FJXA 2CJQA 4X2BA 3D45A 5HP1A 1ZBIA 3BR9A 1X9MA 1N5YA 4N76A 3WNFA 4ED7A 4Z4GA 2GIRA 3AA2A 1U47A 1UA0A 4FLWA 3SI6A 4U7CA 2ETJA 4RW6A 4IG0B 4FJJA 4Y1DA 1C1BB 2C2DA 1UA1A 3WNEA 4O5BA 1KLMA 4DSJA 2HHQA 3AO2A 5CYMB 3RRGA 1XHZA 2P1JA 2LSNA 3VQAA 5KFVA 5JS1A 2HVHA 4WFYA 1JL1A 1CZBA 5HROB 2D3ZA 5KFJA 4TY8B 4DTJA 3GILA 4O4RA 3DLRA 3LP3A 2VG7A 4M42A 4LSNB 4KHWA 4ID5A 3PW0A 4DU3A 1HJRA 5I42A 4E89A 5KT5A 2W9BB 2OH2A 3FFIB 4F3TA 1KLMB 4DMNA 1RAJA 4DQRA 1IKXB 2D3UA 1T03B 1EXQA 4K4SA 3CYMA 1CXQA 3CJ0A 4QW9A 4KHNA 4OPKA 3KJVB 4KI6A 1LV5A 4C8MA 4FS2A 4KPYA 4ED1A 4N5SA 3DOKA 1NKCA 4RW7A 3ASMA 3QO9A 3TARA 5L9XA 3DLKB 4E7IA 4DSKA 1A5VA 3OJSA 4EP4A 3LANA 1KLNA 1ZBLA 3L2UA 4CFBA 3TAGA 4J9QA 5KFCA 4EYHB 4K4UA 4E1MA 4EZ6A 3S3MA 3G86A 4I2PB 3KKRA 2OPRB 2DPJA 3PR5B 2IC3A 1CZ9A 4GW6A 4Z4IA 4CEQA 1NJXA 4E0DA 2V4RA 1D0EA 4YR3A 3KTQA 4Z0UA 3LP2B 4DL3A 5CZ2A 1LW0A 2DFFA 1RYSA 4EZ9A 4CHOA 4TQSA 3BGRB 4RW8B 1S1WA 2OPRA 4ECTA 4IG3A 3AO4A 3ZSRA 5J2NA 3NF8A 4CJLA 4IH5A 3VQQA 4F50A 3L8BA 4F2SA 1JLGB 4DL5A 2RF2A 2YKNB 3AV9A 3SUQA 4BDYA 4WE1A 4DS4A 4C8OA 1OS5A 4ZPAA 3MEGB 3TVKA 1S9EA 4CJFA 4J2DA 4NYFA 3GYNA 2HW3A 3H98A 3KNAA 4KTQA 4I2QB 1JLBB 3C6UA 2G8KA 4BACA 4CK2A 4ECZA 1JL2A 3KOAA 2DFEA 3VQBA 2XO7A 1C1BA 1KRPA 4XIUA 4CJVA 1TAQA 2ITGA 1S9EB 3KHLA 2UVUA 2YNGB 1W25A 3LP0B 4R8UA 1T94A 3AVLA 4DFPA 4CF8A 1C6VA 2R8JA 5SZTA 3RMBA 3U3GA 2PZSA 2VG7B 1U04A 3V9WA 3V6DA 3HT3A 1NKEA 2EC0A 2B43A 4LY7A 3RMAA 3QETA 5J2PA 4WFZA 4GVMA 1ZBHA 3K5OA 2FJVA 4G1QB 4ZPBA 3PX4A 1IH7A 3LDSA 4LH5A 4KHUA 4B08A 3QYYA 4FJ7A 1KVAA 1S0OA 2R8KA 4YR0A 3PJWA 1RT7B 4O44A 3RAQA 2AJQA 4F4YA 5CY4A 3LALA 1LW2A 3IG1A 3T3FA 4PQUB 3MECA 4FLZA 4WXWA 4KO0A 3OYBA 3M8PA 3IGVA 4B9TA 4PY5A 3OYEA 2KQ2A 4FJHA 3AA3A 4CEEA 3GIIA 4KSEB 1RTHA 2FJXA 4Q43A 4IH7A 1RBUA 4CEDA 1S9GA 2AX0A 5KFPA 2UVWA 3MECB 1W9HA 5HRPA 2JC1A 2P5OA 4BE0A 3V1RA 3DRRB 2R2UA 1U49A 1HYVA 2BGGA 2F96A 4BWMA 3CDWA 3C6TA 1U48A 1WSHA 2GBZA 3MR6A 3HL8A 2AQ4A 3K57A 1FK9A 4KE5A 2W9CB 3F73A 1C1CB 5F8IA 4NRTA 2PYJA 5KFSA 4RNFA 2W7OA 3KHHA 1B9DA 3K2PA 1T03A 5KFTA 4Q8FA 3O3GA 3MEGA 4WZMA 3DMJB 3HVTB 4K50A 1JLQA 3MAQA 1C1CA 5J1EA 3KJVA 4NLGA 4DF4A 2WONB 2EX3A 3HM9A 2AU0A 1L5UA 4CJQA 1NOYA 5KFKA 2FLLA 4KO0B 3JYTB 1YT3A 2A1SA 4KTZA 4MKBA 5T14A 5DMRA 1LWEB 2UUWA 4RUCA 3PUFA 3K58A 4U6PA 5KFYA 1JLEB 1LWCB 4N47A 5F8NA 1DLOA 2ATLA 3QEPA 3Q8QB 1QSYA 1S1TA 3V9SA 4R8UB 2B4JA 4RW4B 1HARA 3KLGB 2RN2A 4CK1A 2XY6A 1D8YA 2RDJA 1TQLA 4PWDB 4ED3A 2PYLA 5KG1A 3SI8A 2HHWA 4ZP7A 4ZVGA 4ZTJA 5EWGA 3IRXA 2FVQA 5KTQA 3KD5E 3VA3A 4JS5A 3KLGA 4MK7A 4IG3B 1RNHA 2OYQA 3K5MA 3BJYA 4IKFA 3GIKA 1N56A 4K4TA 1JIHA 3QNNA 3CFPA 2Y1JA 2ASLA 1JLGA 4Q5VA 3IN5A 4DSEA 3OL7A 4M3TA 3KMQA 1WAJA 3RR8A 3DMJA 3HVTA 2YV0X 4ZPCA 4M41A 3WNGA 1S1UA 3NH2A 2OA8A 3KKSA 4MFBB 2HMIA 2O5DA 3BQ1A 1X9SA 5EU7A 4I2QA 4MQ3A 3Q8RB 2GC8A 1TL1B 3C6UB 4KAZA 3PR4A 3UDLA 4M45A 5HP1B 4ZTFA 4MK9A 3G6YA 4DL7A 1RT6A 2WB4A 3AVCA 4FZYA 4DQIA 4TYBA 2XGQA 2RDIA 1S9FA 4RW4A 2G8UA 3ICLA 4HUGA 1QAJA 1CXUA 2NUBA 1EX4A 4J9RA 4JLHA 3E01A 3H5YA 3QEIA 2FC0A 3TR8A 1A5XA 4DG1B 2HHTA 4CHQA 3TAFA 1BGXT 2GUIA 3SQ1A 1T05A 1LWFA 1WNSA 1SL1A 4FJ5A 1QSSA 1S0MA 3IRXB 5CYMA 4M3WA 5J2PB 2XRIA 3FSIA 1QSLA 1IKYA 1VRUA 3ZT3A 3FQLA 2VG5B 3WNHA 1X9WA 3CFOA 2IOCA 5KT7A 4DL2A 4IKAA 3LPUA 4G1QA 2RKIA 3LP2A 3I5CA 3C94A 2JC0A 3RB0A 1SUQA 3V81B 3SV3A 5KFXA 3OLBA 3BQ0A 4DTPA 1YTAA 3VQ5A 3VQ9A 3ALYA 4NLWA 3CVKA 3JYTA 1LW2B 3IG1B 1ASWA 1VRUB 4Y3CA 1S1UB 4TSXA 1L3UA 4MFBA 3T5LA 3MXIA 3GIJA 1JLFB 4J9SA 2IAJA 4HVJA 4RW6B 3DLKA 2Q3SA 4IFVB 4DTRA 1HQUA
chains in the Genus database with same CATH superfamily
3SQGA 4PPZA 3D1HA 3B6PA 2VC1A 3FSXA 2K06A 5HBMA 1W26A 3OHRA 3BS9A 5B0BA 4O4GA 2CG8A 4PXBA 4Y34A 2BRKA 1H0HB 2BABA 5HK4A 2YVSA 3O8MA 5KFIA 4K4ZA 4L73A 5E3PA 1U4BA 1Q95G 2XY7A 4NASA 1VQKS 2VG5A 4NLDA 3BGRA 2B56A 1F2GA 2YBVA 1JJ2M 3LDNA 5JVHL 3DFEA 3HJFA 1WSVA 4KHQA 3AXMA 3K5LA 2OHDA 5K14B 4BRIA 1DFDA 2OTJN 4DR6F 3TTDA 2W7PA 1VBXA 1VSLA 3H1VX 4ELUA 2HAIA 2XZDB 1IM4A 4GMKA 2FHJD 2OFGX 2MB0B 3GWCA 5KG0A 3AVNA 4OLOA 1X3NA 2Q36A 4ZPDA 1KHWA 2VGNA 3FGUA 3SK3A 5GADP 3E8OA 2J6TA 2LXIA 3QJPA 5FRNA 3DI6B 4U95A 4M3XA 2FVCA 2D3OR 1NWKA 3EKSA 3RMDA 2NPFA 2MKKA 3HYFA 1VQLN 2KRRA 2W4PA 4DFMA 4Q45A 3D2EB 1J2VA 3EUNA 4DTSA 2QKKA 3O44A 3SXLA 2VZ9A 2CPZA 1WB9A 1TKXB 4HHTA 4HI1A 1S6OA 5KFMA 1EQMA 1O8BA 2H48B 4CIGA 2YQ0A 1NOZA 4K0KK 2VOPA 1M0SA 4KGMA 2RRBA 3M30B 3AVIA 4CZFA 1JLCA 1HR0K 1HUXA 4J2BA 1YXQA 1NLVA 4BWJA 2QA4N 3BN4A 2VG6A 4RU2A 4KGKA 1OY8A 1K0VA 4CEOA 5GAHP 3Q2SC 4KV8A 4X4SA 1GLLO 4JI5K 2Z57B 2OMLA 4DR1J 1FKOB 3HDSA 5HMXA 3LH2S 2I5JA 3PSFA 2P6TA 3GE1A 1Q9XA 2N7YA 4EWTA 4FWOA 4BRGA 1PJ5A 4CJRA 4FYVB 1R59O 4DEZA 3G6EN 3C6TB 4U7UK 3R6GB 2IIHA 1VQMN 2AMCB 1RABB 1YVUA 1C0UB 3K9KA 3O3HA 4KT0C 1VRTA 1MDUB 2BOPA 1H2VZ 1UJ4A 4DPYA 4A5AA 4PL8A 4FOIA 4O3NA 3M6VA 4CBUA 3B8HA 1UCNA 5F8GA 3A1YG 3IS9B 2R42A 2P9IA 2BJ3A 2KYZA 1UAXA 3US5A 2RRAA 2DD8S 3AO5A 1ZETA 4FJKA 1NDKA 1EKRA 3U8XA 5IT9U 2HZVA 2P9GA 4QIFA 3T1YF 1AW0A 4H0PA 1WC4A 2V5HG 5CHIA 2RUSA 3SAFA 1SH3A 2ASJA 1RKIA 3W65A 1FXXA 2DRBA 4CD3A 2YY3A 3SDEB 4ILRA 1X4HA 4UF4A 2B3TB 1HI0P 4FK4A 3UDCA 5HVGA 2DRAA 1WEYA 1EAYC 3PDNA 3EMTA 1IKVA 2XS7A 5A8WA 3HKWA 2FLNA 4BGBA 3OYAA 2GHPA 4HEA9 2ZJPL 2L41A 2JDJA 2CWXA 3VGKA 5J2MB 1NU0A 4L3KA 1GLEG 1J53A 4A4JA 2ZGZA 3C6AA 1H3DA 5TKWA 2WAQD 5K14A 3HO1A 4FF4A 3IA0A 2B9YA 4DUZK 4QS8A 3OTCA 3TAMA 5GMEA 1FRXA 1Z26A 3C15A 3GTYX 4TU8A 3UDEA 1IBKF 1TU0B 4XK8C 5C25A 3SAHA 2Z2YB 1XQIA 3ZETA 4O3OA 3H2VE 3EN9A 4LIRA 3PW4A 1FNXH 4MMOA 2FLPA 2XS5A 3MWTA 1EETB 4NCGA 2VA2A 3DGPA 4IFVA 5KT4A 2DGVA 5EVZA 1BUXA 2KXNB 4NLPA 1KWMA 2HVIA 3FFKB 1YZ7A 2IM0A 2QA4S 2HFSA 4PL7A 2ZUAA 4U67L 1IJEB 4OKJA 2ASMA 1SH2A 3OVBA 5GAGP 1S1WB 4CHYA 1U24A 1S6QB 1EZZB 1TFWA 5L46A 4JYAF 1NK8A 4ZLJA 3BSCA 1NGEA 5AFUA 1IBMF 2I2YA 4EBDA 3OYIA 4TLRA 3H40A 3LDQA 3DRYA 1HYZA 5ETPA 1W0HA 1RCXB 2VWJA 2IM3A 3D68A 2I6WA 3H3NO 4IRDA 3T9NA 2E5IA 2A18A 3R7NB 4DL4A 3TAEA 1XHXA 2OKQA 2MKIA 2QWPA 3GV7B 2AHOB 1CC8A 3N79A 4JYAJ 1T05B 3I9V9 2IA6A 2H9ZA 4Y28C 4Q0BB 2ZDPA 5LJWA 5IC6B 2LDYA 2ZC3A 4LF9J 4V19X 2IPOB 1XR7A 3BH7B 2UUBK 3RAXA 1WNEA 3L2RA 2KO1A 2HF4A 3SV4A 4OYWA 2APOA 5F8JA 3CDEA 4BREA 1IG8A 4DV6F 3L7PA 3DRSB 3GZ7A 2BKNA 4TYAA 3LGNA 5LXYA 5KT3A 1PBUA 4B1UB 3D1QA 2G8IA 1UFLA 2CZVC 1FKPA 1K1QA 3HULA 3BKTA 4NWBA 1BC6A 2QN6B 2OPPA 3MEEA 4ZHRB 4J91A 4RZRA 4H4MA 3DYAB 4K5SA 2ATCB 2RE2A 1N34J 1XC3A 4Z37A 3CCTA 1BO5O 3VQ4A 3ZTOA 7FD1A 4JRQA 4CF9A 4E7KA 1RT1A 1WOPA 4B9SA 1NU4A 4HVZA 3NF9A 2E9ZA 1UVMA 2GQCA 3M3ZA 5IFMA 5FRMA 1EWQA 3W5ZA 2CAJA 4NEYA 1Z25A 5KFZA 3IAM9 3H0PA 3NP5A 4AT1B 1B9FA 4U96A 4OJRA 1OSDA 3QSIA 2UUAJ 5A6WA 4CK3A 4M5HA 2OZMA 5IT9O 2MQLA 2WBRA 3IC1A 2PI4A 1Q0NA 1S48A 5JVGL 1WDDA 4ZLNA 1E3MA 3W7BA 2CPJA 3SPZA 4NLOA 2EWHA 1K44A 4EBCA 1TP7A 5DLFA 2AX1A 3BKFA 4YB6A 1NZ8A 3HKZD 5G0RB 4IH6A 4ZCLA 2UUAK 4RW7B 1N5SA 3UD5A 1HL6A 2CJYB 3PX0A 3QO9B 2W4DA 2UVRA 1SH0A 3E9PA 2YNFA 2Q0UA 5C42B 1LXNA 4DV6J 4OL8A 1X1PA 3IGNA 2H65B 4N41A 2F8TA 1OKJA 1EETA 2N7CA 2VA3A 1U2VB 1Y9OA 1HNVA 1JCGA 4CO5A 4NLUA 3BR8A 4CHNA 1S57A 4JI6K 1XMQK 1HWIA 2ZFHA 3VTIA 4J37A 4YUDA 2RU9A 3VETA 1H7WA 3PTWA 1FJCA 2P51A 5C5JA 1U25A 3P4UB 3DC2A 5KFFA 3H5SA 2OTJS 3R5DA 4M5GA 4JKHA 5B0EA 3SQ4A 2Y9HA 1QVGM 1U2CA 4K0KF 4DPTA 3HHLD 3L4IA 5F0WA 3RBEA 4CGHA 1CS4B 5DG7A 4I56A 2DPNA 4PA1A 5LSRA 3QINA 1YRXA 4J2AA 1YJRA 1R7IA 1TZ0A 1X0FA 3D67A 4QWEA 4ELVA 4BDPA 1TKDA 1V9OA 4IDKA 4NXMK 2YKMA 3ET6A 4Y2KA 3V1QA 2HGMA 5JMVA 4FW1A 2QK9A 2EVZA 4CW7B 1SQFA 2CJKA 2O8FA 3BYRA 2KL8A 4IJAA 4DV0J 4JI6F 1XMQF 4DTUA 3VERA 2OPQB 1IBMK 4YOXA 2K1RB 2XMTA 2AP6A 5AQJA 3R1HA 4UUWA 2KW4A 2ZHBA 3GSIA 2UUCK 2E7WA 2NYIA 3VF4A 4YFUA 3H5XA 4JKDA 4LC9B 5AQYA 1IM6A 1FNOA 3SFUA 1K1SA 4I6WA 1N4LA 3MN7A 5AQIA 2RNEA 4B9UA 3LGMA 1NK5A 2NRVA 4IO9L 2GMHA 4GKJK 1JB0C 4CHZA 2KHDA 4BC3A 1WSFA 3CG7A 5A6PA 2P9KA 4FWKA 4W4MA 1PAEX 3CM6A 3H4DA 2IVMA 1F0XA 1TKTB 3OTOJ 1VQNS 1GOBA 1Q79A 4CVNE 4B3SF 4R0JA 2BV3A 1SV5B 3BEGB 3TR5A 3BSOA 4X64K 1RQ0A 2W8LA 1K8KA 4DQSA 1KFSA 4DCHA 4NRUA 3PYDA 1U7LA 5KFUA 1RT4B 2UXDF 5B09A 5D78A 4I9QA 4KHRA 4ILMA 4M5IA 1UFWA 3NAHA 4H5NA 3EGVA 3OXLA 3J7ZO 4JBCA 2H54B 3QGPA 4KRFA 1RT3B 2WTFA 1VC6A 3JSMB 4U7UD 3O80A 3BGFA 1VSJA 4CJUA 3PJ9A 3SFGA 2ADBA 3CCSN 1XMQJ 4JI6J 1HD0A 1XR6A 5F8HA 2BDPA 4NE9C 4O3QA 4CF0A 4F4WA 1UWAA 3HZ6A 3QT5A 3MMAA 4KBOA 4DJBA 4JI3J 3DXMB 1DTQB 4J2EA 5HRNA 4KIAA 1WKLA 1HHTP 3M4XA 4FS1A 1ASVA 1U6FA 2YWEA 4ZDNA 2BBEA 3MK6A 2P6SA 3PEJA 1NK6A 4Y00A 3ZSQA 2AGOA 5H9EJ 3CCRS 2MTLA 3FFIA 4GVBB 5E3CA 1ZAWA 5C24A 2XM3A 4DV2F 4JN4A 4L3NA 1FDBA 4OYOA 2XLIA 1VYAA 1N36J 3J7A1 3ITHB 2Z4PA 1RDRA 3V2UC 4EI2A 2AIRB 3PW5A 3FDSA 1LWCA 2JNJA 1C0TB 2B0GA 2GMLA 2X1AA 5KG4A 3EEQA 3TW0A 1QLNA 3D7SB 3A3NB 2DNKA 3M2VB 1MROA 4LD0A 4PWDA 2OD6A 1JLAB 3KLEA 3M6UA 1O6XA 2FZGB 5IM0B 4XH4A 4D3GA 1SL2A 4UY8T 3V9UA 4WQ5A 1LAVA 1VR6A 4YOUA 1PYTA 2V94A 1N6QA 1FWKA 4NL5A 2YHBA 2QSWA 1SKWA 4CFAA 4HHUA 3QEXA 4BRPA 2VWKA 3KLHA 2NXEA 2O1PA 2P5GA 3KK2B 4EP5A 2E44A 1TKXA 5F2RA 1U0HB 1CS4A 2EW9A 4FNHA 1KEKA 1BQMB 3DN9A 1NJWA 4CJ7A 2UUCF 4LSLB 3VAGA 1MU2A 4IFYB 4WU2A 4TQRA 4DV3J 1KVBA 4PUOA 3TYTA 1MG7A 1G3OA 2FLOA 3KK1B 3MM5A 1WLJA 1HWKA 1BU6O 4FXDA 3KG4A 2GV1A 3ZTSA 3P1GA 4KV8B 4BROA 3MAAA 4FJ8A 2XBPA 3MF5A 1Q8IA 2V4QA 4WXOA 2FD2A 4QWCA 3BF4A 2MHEA 1VQ8S 3NFAA 3V9XA 3G0ZA 2I5JB 4RR5A 1VHFA 2X1FA 3GYXB 3ZFVA 1LKZA 4DV3F 2E2NA 2EFGA 2NRHA 3O9TA 3UVJB 3KIOA 5KFWA 1KQSM 1RAHB 3JQMA 3VWSA 3IBFB 4USIA 3NH0A 3CCUN 3SJJA 1IKYB 3K9JA 5M1FA 4Q8EA 1ICEB 1ZTTA 4CIOA 3CCVS 1CJTA 4NOHA 2UU9J 3VGMA 3TWHA 5CQGA 4ENOA 5T41A 3V81A 3L2WA 1TKTA 3D6TB 2EFNA 5L1KA 3THWB 2ZH8A 4WJBA 3M9MB 4ZIVA 2ALZA 2VFSA 3AODA 1RTDB 4AQYJ 3BF1A 1YHQN 4JS4A 4F8RA 4DUTA 1UVKA 5AE2A 1YTUA 2QWRA 2GMJA 4W90B 5TKYA 4KHYA 3D3BJ 3SDEA 3SPYA 4AHUA 2LQJA 2G2ZA 4IOAL 3LA0A 1GXLA 2IVPA 1U8SA 4ED6A 3NHGA 1ZC6A 3OHAA 1HI8A 2XWYA 4DX7A 4LFAK 4FLYA 3KZBA 2DISA 3DOLB 1NJIO 1AZSB 2O01C 1NAQA 2N3OA 1YITS 4A48A 4QYZJ 3TQ1A 2O8CB 4DR3J 3FRYA 2BQ3A 1HNZJ 1AUSL 4R25A 2DNPA 4DSFA 1U1PA 2IVFB 4X4PA 1ASUA 4QWAA 3JS6A 3W8GA 1WHWA 3O6WA 3S6EA 2VCPA 5GADI 1EHWA 4HTIA 1M5OC 3BV8A 3POTB 4GVBA 5C24B 5FIIA 3W2WA 1HYSA 4KBIA 2EC2A 3KK3B 3ITHA 1ROFA 3TX8A 4ID8A 1MWZA 3M32A 3T1AA 3AH6A 4CGJA 3NGRA 2YWHA 3FZHA 1UVNA 3H6EA 2LCWA 2OFHX 3M9OB 3NNHA 4WQ5C 5D0RA 3D0GE 3PO4A 1T6CA 3KG1A 2R2TA 4QOZB 1R0AB 4JKAA 2Y1IA 1DLOB 1XERA 3RB3A 2VFRA 3NVKA 2DVIA 3SYZA 4L76A 1YIJS 4AL7A 2BJ9A 2E8AA 4O23A 1HBNA 1RBRA 3DLHA 2ILZA 1D8ZA 3B82A 1V5VA 1HR0F 2ATQA 4FJGA 1FXLA 4O44B 4ECQA 3AQPA 4P2SA 4CZEA 1FRIA 4F0KA 3L3VA 4NB4A 1BI4B 4B3RJ 4PUOB 2XMWA 3CCEN 2DR6A 3D5MA 4EO6A 2DB1A 2QMUB 4FO0A 4MYUA 2YXLA 5F0UA 5E2QA 4CE9A 2BANB 1BISA 1I39A 1CSJA 4WF9Q 2R2RA 2DNYA 2HOEA 5KPTA 2XY5A 1WC0A 1VHIA 3GR1A 3EVOA 4USHA 3T5HA 1XUPO 1C1AA 4DQQA 1KSPA 3THXA 3QJLA 2CGJA 5H9FK 4BRAA 3AAPA 3AVKA 2Z2LA 4V19J 3CCLN 1U8WA 3VEYA 1J54A 2JOQA 2VODA 2ZNZA 3PV8A 2FGOA 3ISND 2IC3B 1WC1A 2ZJPQ 4FLTA 3G8QA 1RA7A 4MKAA 2HNZA 1CJTB 4NA2A 1OVQA 2CZ4A 2Z1GA 2MPUA 3R1XA 3THWA 1PO6A 1LWEA 1BCOA 2IIRA 1R27B 5C15A 4FVUA 1F3FA 4WWSA 2XGPA 3QRRA 3AVGA 3PKYA 3KJNB 1S0VA 1HBMA 1SIZA 1ZH5A 4ZHRA 3DLBA 4O0JA 1Q82T 4FJXA 3B4DA 1X9MA 2B7BB 4N76A 1C0FA 4DV7K 1NSKL 4I1TA 1VQNN 4CI6A 2ETJA 4GKKF 1ESVA 2VQEF 4FJJA 2Z2ZA 3SQGB 1KLMA 1KR4A 3N01A 3NWGA 1ZM9A 1XHZA 1UL3A 3KHYA 3VQAA 4K25A 5KFVA 1UZHA 2WVDA 2A42A 3MTJA 1LFPA 5CR4A 5DM7L 5CZVA 4M63C 4B1ZA 1XMBA 3PW0A 5DDPC 2BJ7A 5KT5A 2W9BB 4Z2XA 3CCQS 2AW0A 5AR0A 1VQSA 4KHPJ 3CMAN 4LFCF 2HAFA 3IBCB 1IKXB 3GL1A 2MQ8A 3AFGA 2IY5B 4LSZB 5IC4B 3CYMA 2P9LB 4KI6A 1Y5NB 1AROP 1B7FA 4JKGB 4FS2A 2PT0A 3DOKA 4RW7A 4C1NK 3OTEA 2MGZB 3ASMA 3QO9A 3W9IA 4ANDA 3DLKB 3AJDA 4Z7CA 2NCKL 2EWSA 2KB2A 3T41A 1OH7A 4DCJB 1CQNA 1LK5A 3L2UA 4J9QA 4DR5J 4EYHB 4AYBD 4E1MA 4FPBA 2CQ4A 3S3MA 3G86A 4NI2B 4C97A 1YGYA 4B3SJ 3BBFA 3SSQA 4B3SK 1Q86T 3ETMA 4DR6J 1R8CA 4DUZJ 3A13A 3TRGA 3CC4N 1RISA 1QVGR 3KTQA 4Z0UA 3LP2B 1F60B 1NEEA 5CZ2A 2DFFA 3CCMN 2HLTA 2CJXB 1VJWA 4JI0F 4RW8B 3QICA 4ECTA 3MM8B 5J2NA 4BRCA 2CQPA 3ENWA 2AF6A 2CH5A 2FC9A 4IH5A 4F50A 4LF5K 5LSOA 3L8BA 4F2SA 2YKNB 1H74A 4C3LA 1YLXA 3DDNA 4CZHA 2KT2A 4BDYA 4PZVA 2QSFA 1ZBTA 1OS5A 3IMXA 2CVEA 3D54A 4ZPAA 1OY9A 2ZKTA 5DZ7A 4J2DA 3B4MA 5HQLA 5AQGA 3MD3A 3AB4B 3DOMA 3KNAA 3MX5A 2ZJRQ 2J4RA 1JL2A 3VQBA 3BP8A 1C1BA 2L08A 4L6V3 1SI9A 4NXNK 4OI4A 4MDAA 3D0IE 5LJ5Y 2UVUA 5FD1A 1Q18A 1V4SA 5M2RA 2MKHA 3UKUB 3D4JA 4CF8A 1C6VA 5SZTA 1G99A 3U3GA 2PZSA 2HVEA 2OD4A 3OT9A 3ZTQA 1U04A 2GX9A 1NKEA 2B43A 4GVMA 1ZBHA 4A61A 3PEHA 4BRHA 2E7XA 1H1VA 1P8ZA 2FJVA 2QIFA 2P9KB 4LH5A 3I6PA 4B08A 3QYYA 3A5NC 4FJ7A 3RSEA 5RUBA 2E5JA 2DTJA 3ZTRA 1AT1B 1LW2A 3MECA 1RBOB 3K0JA 4FLZA 4JK7A 4B9TA 3P38A 2J9DE 1NPRA 4PY5A 4QYRA 4CEEA 1EQ0A 3DDIA 3GJQB 1DARA 2QLJB 1RTHA 3WQPA 3ETOA 1RBUA 3E66A 2G0JA 3PYFA 4DR6K 5HRPA 2PFUA 4B3MJ 2P5OA 2ZH4A 3GFZA 3L9ZA 2R2UA 1HYVA 2BGGA 1RHMB 3CDWA 2KJWA 4IOCL 2DJWA 2AQ4A 1YI2N 1FK9A 2W9CB 3F73A 2MLZA 3N4WA 1IR2A 2V52B 4YY3J 2PYJA 2W7OA 1M5KC 5KFTA 2ROPA 3MEGA 3C65A 3DMJB 2VFTA 4K50A 2M2BA 3QB0A 1C1CA 1FE4A 4CO3A 3FEZA 2EX3A 3HM9A 1L5UA 2R7SA 1X5PA 2XMJA 5F1XA 3N4QA 3PIOQ 3JYTB 1YT3A 4MKBA 5T14A 1NB2A 1FEEA 4U6PA 1JLEB 1LWCB 2BM0A 4DV2J 1WJ9A 1PCAA 4R8UB 3JS9A 4RW4B 1HARA 2MQMA 3CI5A 4NO7A 1BUPA 4OI6A 2WSEC 1TQLA 4PWDB 1XNRK 2PYLA 4WIIA 1YKWA 1X5SA 3RRKA 3VMFB 1NGFA 1WHVA 4ZTJA 2IBOA 1VAZA 2BKPA 4P2MA 3VA3A 4JS5A 3MM9B 3KLGA 4CLSA 3MM8A 2QWLA 3J7YP 2G2YA 4K4TA 1JIHA 2CJBA 2KG1A 1KBRA 2CQBA 4OYZA 3A5LC 2GEMA 3G71S 3NNCA 2QL9B 2YWWA 3GB0A 1V4TA 4WU3A 2AZ3A 2FY8A 2OA8A 5AQXA 1NGDA 2HBMA 5HL7L 3IR6B 3E9LA 1I51B 4MFBB 3BGLA 1X9SA 3ENVA 4MQ3A 1KOHA 3PR4A 4MYTA 1RI7A 5HP1B 4HL9A 4ZVUB 4NX9A 4O0NA 2WB4A 2F9TA 2BJEA 1SQEA 2RMLA 4H5VA 4JAXA 1EX4A 4J9RA 3ZZZA 2FC0A 1A5XA 4DG1B 4H5TA 2IVYA 2V9KA 2VQFK 4N8NA 1T05A 2KYXA 3CIMA 1WNSA 1XMOK 1S0MA 1S79A 3THTA 5CYMA 5AFUH 4QR0A 2MZJA 1VHXA 1QSLA 1IKYA 1VRUA 4WTOB 2ADCA 2O8DB 2H51B 2VICA 3LPUA 3TP2A 5BPMA 2ZITA 3EE9A 1M5HA 5CZXA 1HKBA 4CO0A 3ULEB 4GKJJ 1T95A 3EGZA 4OPAA 3V81B 4E2FB 3OLBA 4DTPA 1YTAA 1HNWJ 4GV6A 2F3JA 4DPUA 1RE1B 1LW2B 1ASWA 3LUYA 3QWUA 3TUJC 2K3IA 3T9ZA 1L3UA 1FRMA 3BGUA 2IDLA 4JV5F 1VQON 4UOCA 2KM8C 1NMEB 2FSNA 1FDDA 2NRTA 3ZZPA 2CQGA 4F67A 2Q3SA 4IFVB 4DTRA 1ZXOA 3LM9A 3NOGA 2JHEA 3W8PA 1HA1A 3VQDA 2P9UB 1LNQA 3R5BA 3NWRA 4OV1A 1WHYA 5DGAA 4ECVA 3DYAA 3RVCA 3AAQA 1EKEA 1YUWA 5DQGA 4ES1A 2XLKA 3DU6A 5I4MA 5HATA 1RHJB 5I42B 1F21A 3S3NA 4O0IA 2W9CA 4A2BA 4NLBA 4DF8A 3FBBA 4FCYA 3CD0A 2ZC4A 1T3NA 4LF4K 2YKQA 4I9LA 4K7QA 2JEJA 4RUBA 2P9PA 1UW9A 5KFHA 3FJ2A 1FTCA 2HBRB 4J9NA 3MM7A 1VQMS 1MMDA 4CCHA 2V8PA 5C2GA 1MW7A 3S01A 3ZZUA 3LPTA 2HFZA 2QL5B 2POKA 1F6TA 3O08A 3UN2A 4CECA 2Q2RA 2JVRA 3LOUA 2FSJA 3CCSS 5GVQA 4F4AA 4OZ3A 4QJVA 5M1PA 5KT2A 3CJ1A 4PKIA 3ZT2A 3VQEA 1E4GT 5IZHA 1KHVA 4MIWA 4CJKA 3OFGA 4RTFD 3TJAA 3K8VA 3ZXWA 3V4IA 4KHPK 2Y1RI 2DNOA 2UXCJ 2OEMA 4JK8A 1TVRB 4J9VA 2ZBRA 4DUYK 5LMUF 4ZN1A 3HVAA 1REVB 2H4WB 2RRNA 3KLIA 2DO4A 5LOQA 3LP0A 3KJFB 3RGIA 1Q82O 3TTCA 4WP9A 5L39A 5LJ3Y 1RTIB 4TY9A 3I82A 1X31C 1VK0A 1K8AO 4AUKA 4AXIA 5FLXY 1B7YB 4Z4HA 2XMMA 3M8ZA 3QMQA 1OQ6A 4MTPA 1VSDA 4WZQA 1Q53A 2W4CA 3Q7CA 2FTRA 1HI1A 9ATCB 3D2EA 1O1WA 1JLBA 4HT5A 2E2PA 3PYEA 3RB4A 3H3OB 4X62J 3OL6A 2LLZA 4IO1A 1RP5A 5DG8A 3CXCR 5KQDA 4OV6A 3J7AN 5ELZA 2QM1A 2CDQA 4DV1K 4CJWA 5C12A 1HBOA 4WF9L 3PRBA 4FYDA 3C7NB 1JJ4A 3L0QA 3O3FA 3PY8A 3NOCA 3RBZA 4WFXA 2BACA 3QESA 3SBGA 4I6AA 4ITSA 3D6RA 3DM2A 4DU1A 2OPQA 3M8QA 2HBLA 4NEZA 3KD1E 4K8ZA 2HS4A 1R31A 1MWYA 2HNZB 4JI4K 3Q86A 2G8WA 1RUSA 2XYPB 4KJIA 4FJLA 3LZJA 4BVPA 3IWLA 1F9FA 2FVRA 4CJPA 2MLXA 3UR0A 3BSNA 2R7OA 2GA7A 4DPWA 2KN4A 3OYFA 2XI2A 3D3CJ 3J81O 2V7YA 3OYJA 3C8YA 2E1ZA 4HACA 4DR3F 1S9GB 5KFNA 2O8EB 2BJ8A 1R8BA 2VBYA 4DTOA 4NMXA 4PAAA 4WKRA 3MEDA 2DEIA 4NCBA 2PC6A 2QYCA 5EX5A 4LF8F 2QWMA 3CCUS 1BIUA 3LPYA 4DL6A 2I38A 1J5OB 3PVXA 3CCZA 4B3MK 4X84A 1OPIA 1WG1A 1VGYA 2R7VA 4WCEQ 4YN3B 1M1HA 4LR7A 3MXHP 4FZZA 1HNZF 4A62A 1JXBA 3V6KA 3TA0A 3MOZA 3OTOF 4LVOP 4ILHA 1IKVB 3SCIE 1FFGB 1VK3A 4X4QA 1ZBFA 1Y11A 2R8IA 1IKXA 4LH4A 4FLVA 2DCUB 1ZM4A 2YQ3A 3MMAB 1QZ5A 5KG7A 1SC1B 4U9RA 3OSPA 3ADAC 1FJGF 2A6OA 3VOVA 1GOCA 4DU8A 1ZAVA 1KTVA 2D1CA 2DIUA 1Q4RA 3MX2A 4GNIA 1UKUA 1UMJA 4HKQA 2QO3A 2W41A 2D0PA 2CQ2A 3KWGA 2ZH9A 1F5BA 2CRLA 4Y2IA 2D0AA 4A8MP 2IMWP 4ANCA 2LA6A 2WHOA 3CJKB 2CQCA 2DFHA 2UU9F 3O5BA 2OSRA 4YDUC 2EFVA 5L1LA 1JXVA 3PFEA 2I7PA 4RW8A 1P9YA 2L9NA 2R7XA 3Q8UA 2KHCA 4JV0A 4DV6K 1K73T 1NH7A 4P74A 2PDAA 3RRHA 2DH7A 2CPHA 4ZVFA 1MMNA 3A2FA 4WKYA 3ZX0A 2ASPA 2ZE2A 5AQTA 3R7SB 1MNEA 1N0VC 4CEAA 4W5TA 1HIYA 4KRWA 4C3MA 2N4CA 3M8YA 2O8BA 1NJIT 1KKHA 5CABA 3UPFA 2ZJQL 4YDDB 3U4LA 4LRCA 4M3ZA 3QEWA 4DV7J 3PXGa 4DB3A 1U2FA 2V4JB 1YVNA 4K42A 3KK1A 1N8RO 4M5JA 5HMWA 5D6GA 4C8LA 1FEHA 2BVZA 4LF6J 2DIVA 1EP4B 3ULDA 4PXDA 1XJWB 3I4PA 1QQCA 2MY8A 5KG2A 5FPEA 2OTLN 1BWFO 5CD4A 4X4UA 4FP9A 2R7YA 4YY3K 3BH6B 4BCAA 1SKRA 2X6NA 4IWVA 2DY1A 4CGIA 1Q78A 3TVZA 2W9AA 3CJ8A 4I64A 1ZAXA 1L3TA 3NDKA 1S4FA 4XPEA 1K47A 2WVCA 5EX0A 1NDLA 4OZLA 4CLPA 2E5GA 1UWBA 2XLJA 5KGXA 2R8HA 5DO2A 2VDHA 4OI2A 2H3EB 1UAWA 4KGVB 2ZBPA 4J8FA 4JHDB 3C15B 2G1DA 1LAWA 1UVIA 4BRDA 1GLCG 4ECUA 1KQGB 2OO4A 1NHUA 2F9JA 5M1QA 3S41A 4K8XA 2PO4A 3THYA 5EN1A 1ZOTA 3MEDB 1I1GA 1HKAA 4KGZB 4OZNA 2PMZD 1JLAA 4ZMMA 4N8OA 4X65K 4BR7A 2CQHA 2XMKA 2D3O1 1YZ6A 4FYWB 4W5RA 1NRKA 3AVMA 3MCMA 4F4ZA 2WK4A 4MIAA 2WW4A 3J7AP 1BHLA 2UXDJ 2QJ3A 3VZHA 4KB1A 1VQOS 4K4VA 2NSCA 2E1AA 1HWLA 1SKSA 1S6QA 3CMAS 2KTQA 4F36A 2Q43A 3NMRA 3VQ7A 1C0GA 4ZP9A 1N34F 3ELHA 1RHKB 5CAAA 1WUUA 2OEKA 2DR8A 2KVIA 2J6SA 3KVGA 2EHGA 3R5JB 3DOLA 4FVMA 1B0PA 4OHXA 2DGUA 1UPMB 2YH1A 3ZSYA 3TVYA 2XB2D 2O8CA 1U26A 4YMEA 4A8SA 4QIEA 3DCAA 1QQMA 2IYGA 3V6JA 2J6UA 3QBCA 3JB9k 2FHOB 3L6QA 2YX1A 2VV5A 4IRKA 1RGIA 2GQ2A 1T3VA 4DV4F 3AGRA 2DTUA 2MDAA 5F0XA 2F4FA 2VGMA 4Y0FA 3GONA 2UP1A 2R7UA 1CJUB 2FDNA 1YJNS 2CQIA 2JSXA 3G6ES 3AVHA 1NLKL 2DNLA 2CQ0A 4DV0F 1GX5A 3HJVA 1V3ZA 3FMBA 4E7JA 1ATSA 1U1OA 2I0XA 1A5WA 3MM9A 3SMPA 4OLBA 5ETSA 3OFEA 3NCIA 2PIIA 2H5EA 2F1FA 2RQCA 2GELA 2HQGA 3AB2B 4EFAC 2EG1A 1BHNA 3IUCA 1P27B 3DLLQ 1P9QC 2N3LA 1C2PA 3KDOA 3CEDA 4WE1B 4XH1A 4DX5A 5AXMA 4O8KA 1KVCA 2MMYA 3MMBB 3QNOA 4PABA 4O3RA 3EZWA 3O2IA 1U1LA 1FWPA 1RAGB 3CCWA 2AEJA 2D0CA 2Q79A 2P9EA 4FYXB 3GCWP 1SQGA 1B0TA 4M95A 3OHBA 3T5JA 4CF1A 3CCRN 3HFVA 2UUBJ 2HFNA 3G4SN 4OI1A 4YDUA 4CLUA 5A8KA 2A3JA 1TELA 3ET6B 4KHPF 2RHKA 2ZQBA 2UXBF 2NPIA 1Q7YT 2KFZA 3HSJA 1W2BM 1VBKA 2DNZA 5JVGQ 3QBXA 3V1OA 2QV6A 4JI8F 2K1RA 3TAPA 2ZH5A 4ICLB 3CULA 2O8DA 4EO8A 3M1FA 4CWBA 1DY3A 4QBUA 3MR2A 2YJFA 3VALA 2YTCA 4NYNA 1JX4A 2OIHA 2YNIB 5ADXH 2MLYA 4WFNL 1CJKA 2FBVA 4O5FA 1VLYA 3THPA 2X6SA 1IKWB 3A8EA 1N34K 3L7OA 2DBBA 2P8IA 2E1RA 3WHIA 5EUHA 4AQYF 3I56S 4JI4J 5BRDA 4BVOA 5LJVA 2VQEK 4MJKA 1H2TZ 4B1XB 1WI6A 2B4VA 4BR5A 4I6YA 1VQ7N 4IOBA 3KG0A 1TUVA 5LSLA 3THVA 4PG7A 5C2FA 4IUFA 1B0VA 2V68A 1XC9A 4USVA 3HTVA 2GV9A 2VOOA 4X64F 1GK8A 1R8HA 4FZVA 1TYQB 4ECYA 4Q44A 2KH9A 1RT5A 2RQ4A 3OTOK 3M2RA 1ILYA 1WSEA 4DSLA 1A0OB 2WVEA 5E5NA 5KOXA 3JQJA 2JEIA 1FD8A 3DLEA 3CC7N 3C6HA 1R6YA 3OA9A 3FK4A 2NRXA 3OYMA 3ZZOA 3D6HB 3WX8A 1RILA 2HNDA 4DFKA 1VQ5S 1RT2B 4ZCKA 3DXMA 1IXKA 1WI8A 4CESA 2QMXA 3HHKA 5ITHA 1FRKA 5BRHA 2WZ1A 1UW4A 2HBYB 2C22A 1FWLA 2DRDA 3AT1B 3CGIA 3MFHA 2AGPA 4QS9A 4QIVA 3V4IB 2CH6A 3P5JA 4ANEA 3CD6S 1NPPA 1S1VA 1NSQA 4FW2A 2MZSA 1VSIA 1DHMA 2O3DA 1XMOJ 1WTFA 3K5NA 1DTTB 4W92B 1RAEB 2KRBA 5DGBA 8RUCA 1DJ0A 2VBZA 3PCOB 3KJQB 4URSA 3WEEB 4FF1A 5FDLB 2B6AB 1KCFA 4LF9F 4RO0A 1NNDA 3R1LA 2LEAA 3N6LA 1PG5B 2Y3YA 3I5AA 2R3VA 3M2UB 2LVWA 1IVZA 1HBMB 5F8MA 3EGWB 3CWJA 4NLYA 5CYQA 3D1OA 5FROA 5AJ3J 1HRHA 5EXWA 3VAJA 4WYBA 2Q97A 4OJGA 5KG5A 4FKYA 4ZVPB 4MH8A 4B1YB 1VQ9N 3OR1B 5C7PA 3QZ8A 3P8BB 3OYNA 2LQBA 5HMZA 3UKRA 2UU9K 3OJUA 2QLBB 1XNRF 2PE8A 2ASOA 3Q89A 4JI7F 4B02A 4DR5K 1HHSA 4DU4A 1F1BB 3MGJA 1RT3A 5A8KB 1RDAA 1HQ2A 3CJCA 1X5OA 1OYDA 3IM8A 2QEXN 1J9AA 5K9FA 4KAIA 4XDCA 2V2ZA 2IDOA 4ILGB 4DR1K 2IS3A 4B8CA 1TL7B 4CYUA 4U8YA 1FERA 3CTRA 3OQ2A 2DHGA 5LXRA 2W2MP 2YX4A 1HFEL 4PG4A 5JLHA 2P9LA 3IM9A 2VF3A 3EGNA 3MHYA 2WSFC 3QQCD 3CIZA 1T8EA 4DR2J 1NO8A 1IR1A 4UQGA 3X1LB 2KG0A 2B9WA 3MZIA 4DL0C 5B0DA 1M90T 3SSSA 3U7JA 1NBEB 4FBTA 3M5RA 3HBTA 3JSYA 4ZKAA 5AQHA 5D0GA 1AUDA 1WF1A 1YF5L 2QL7B 1E4FT 4OX7A 2ZZTA 5KRTA 2IRUA 1XIQA 3CCES 1M5PC 3VEVA 1T7PA 1BY9A 4J7CA 3KLEB 4YP3A 1HJOA 3OYHA 1XBWA 1YQHA 1RDCA 1GQEA 3N4PA 3FCVA 1YJVA 4NZ7A 3FC9A 1TYQA 1VLOA 1OH8A 3KLHB 5J2NB 2CADA 5LL6Z 3TUZC 1KAXA 2W40A 2CPEA 1JXEA 4H4OB 3L3CA 2WCXA 4HDHA 5T7LA 2CPFA 3NCPA 4MO5A 3T1HK 4OJHA 2ZDOA 3SUPA 3OD2A 4IBNA 5JXSA 3D2FA 3NF6A 2GTDA 1Y5IB 3NAIA 4TY8A 1PGZA 1REGX 3I0SB 3HOTA 1VQPS 2GX8A 4Y6IA 3F44A 2QFJA 4MO4A 4BY9C 3CQXA 1Y97A 3WUHA 3K7RA 3VAFA 1IJJA 4A8OA 2I1RA 2HNDB 4JKCA 1W2IA 4IQXA 4C8NA 2HF3A 2IJNA 1FX4A 1D9FA 1TKZB 5F9LA 4EU0A 4CZJA 3LWLA 2ZJRL 3GYGA 2ZJQQ 4K41A 1HQEB 4DBQA 2JL9A 3ZEUB 3OS0A 2HNYB 2WRMA 2MXYA 3CCQN 4P52A 3IR7B 4E7LA 1OH5A 2ZF5O 2FHMA 4PWUA 4K0KJ 2E6MA 5A8RA 5C2DA 4FPIA 2BOAA 2A41A 2OZSA 3CJKA 1CPZA 3B6OA 5A0YA 3J81j 3WEEA 1PSDA 3W3SA 3OYDA 1RHQB 1PBAA 1RCOB 1R0BG 3OW2R 1T3OA 1H98A 2VQEJ 2Z0GA 4ZVEA 2VQFF 3SLCA 3HHLC 4DR1F 2WBNA 3EVWA 4ALZA 4ID5B 5GAGU 5AZJA 3NBPB 3TZZA 3HXMA 3OLAA 3OR1A 4A46A 4YORA 1SJRA 1Z1ZA 4IOAQ 2VIHA 4OPJA 4QOTA 3ULHA 3TZYA 1NJYA 2G8HA 1RTJA 2BE9B 3NH1A 3KWMA 1IBLF 3QT6A 5F3ZA 4FK2A 2H1YA 5KFEA 1B92A 1XNQJ 3OL9A 5KI6A 2F5GA 4AE5A 3NRBA 4OX6A 4JI2J 3I4HX 4DUYF 4JRPA 5DQIA 4ELTA 4OZ5A 1EARA 3LM2A 4NZ6A 3Q0AA 1TL7A 4X62K 5AQSA 4HUEA 3HSCA 3HSTB 4ZP8A 2P5VA 4N56A 5ADXA 3TANA 1J5EJ 2X74A 4N7TA 4I6MB 1L3KA 2GO8A 3EJMA 3MOJB 2D74B 3ENHA 4ZA1A 3W2WB 4NLVA 3DXKB 1JLEA 3AA9A 3TNVA 3TUPA 4DCPB 3SCXA 1SQKA 4CJTA 4WYWA 4AILC 2ROEA 3HVRA 3K17A 2KVQE 2XQCA 2K7KA 4USUA 3V6HA 2FPHX 2XC9A 2W2PP 3BKUA 2DYAA 1ZBIA 3BR9A 1OPZA 2YI1A 4CLWA 4ED7A 2Y8WA 1B70B 1U47A 3AA2A 3ZNUA 2CNNB 1GLBG 4OX8A 4U7CA 4WTYA 3DRXA 3CPWR 4IG0B 5CXTA 3T1YK 4C0BA 1QZ6A 2QC3A 2C2DA 3WNEA 4F04B 3RRGA 2XNRA 2DR9A 1WOQA 4XAKA 1KDNA 5JS1A 4WFYA 1JL1A 1YJWS 2B8QA 4K2JA 3UW1A 1N33F 5KFJA 4TY8B 4DTJA 3DLRA 1HNXJ 1MLAA 4LSNB 4DU3A 1ZZFA 1HJRA 5I42A 5AQOA 3I9ZA 4RWTA 1IN0A 2OH2A 2BX6A 2BZ2A 1KLMB 3CETA 2D3UA 3SBTA 4UY8O 3CJ9A 3U02A 5ETLA 5C2CA 4ZCMA 1HLUA 5M1KA 4HI2A 2DHAA 1LV5A 4C8MA 2ZH2A 5FLXU 4KPYA 1YBUA 5HJXA 3CE8A 3MM7B 3D9BA 4E7IA 4PYAA 4DSKA 1A5VA 3OJSA 2E1YA 4EP4A 4KH1B 5IT9Y 2LXFA 4NXMJ 2DXEA 5L9NA 4LFCJ 5ETKA 3LGHA 5KFCA 2BJ1A 4K4UA 4PHTX 1SCJB 4FWPA 4BR9A 3P6YC 5DS7A 3GJTB 2HVZA 2ZVSA 1HW9A 3VEZA 2MGZA 4FOEA 2IC3A 1CZ9A 4Z4IA 2DR5A 2PMHA 1DT9A 4CEQA 1NJXA 3AY9A 4E0DA 3HHDA 5K8NA 4DL3A 4EZ9A 4CHOA 2HLUA 1SVDA 3BGRB 2KHOA 4ZLLA 1N5QA 4NI2A 4H5WA 3ZSRA 3TTFA 1TUGB 3VQQA 2MZTA 4F3QA 1FF2A 4DL5A 2RF2A 4CM2A 2BXJA 2NZ4A 1WTBA 4WE1A 4X62F 1ZS6A 4DS4A 4CO1A 3R3LA 1PYOB 4CJFA 2OI2A 4OI0A 4NYFA 3DGVA 3PKMA 2JLFA 2GVDA 2WBMA 3JAMO 3H98A 4JD2A 4OZ1A 3UFCX 2PEBA 4KTQA 4M1KA 1JLBB 3C6UA 2HKEA 1NNEA 1T02A 1VDHA 2D69A 3KOAA 2NQPA 3MN9A 1Y10A 2NXNA 4P73A 4NPOA 1KRPA 4XIUA 3OVSA 3PM9A 4CJVA 3CD6N 4X4NA 1FCAA 2QA4G 1T9XA 2P9PB 2HBQB 4LF5F 3RMBA 2KJVA 3MD1A 1J5EF 3VAHA 5D15A 2J7KA 3RMAA 2VYPA 4WFZA 1WC3A 4P2FA 1BQXA 2K7JA 1GLAG 2ZM6F 5GAHI 4LJMA 2Y1LB 2HFOA 2HS0A 2XMAA 3LDSA 3FBFA 2C1EB 5GAEU 5AE1A 1YJTA 3M30A 1RT7B 4DV0K 2AJQA 4F4YA 5CD4H 5CY4A 1KD1O 3T3FA 1JJCB 4JEPA 1P8GA 4WXWA 4P72A 3O5TB 2FB0A 3OYBA 4RWXA 3AA3A 3FSYA 1GLFO 3GIIA 2DNNA 2H4YB 2VH7A 3ZYYX 1FTRA 5D0EA 2FJXA 4Q43A 4IH7A 4CEDA 5HVFA 5ETTA 1K73O 1S9GA 5KFPA 3MECB 4C8YA 3K0SA 2JC1A 3DAWA 1I94J 1IQZA 4RKUC 5BYSA 5LT5A 1RHRB 3N0VA 5A2QO 1U49A 2F96A 3C6TA 1U48A 8ATCB 1WSHA 3UE2A 4AFFA 3HL8A 1HD1A 1X3MA 4FWSA 1H2UX 3WZ0A 5EGYA 3LF0A 4LIWA 4USWA 1AYEA 2KKHA 4NRTA 1S4EA 3AOAA 4HHHA 3DHXA 3CMEN 3TO8A 1GMWD 3TWZA 2KKZA 2ZBCA 2VKZG 5D77A 3F0NA 1T11A 1TMMA 4NLGA 3BO3A 3WXLA 2C3MA 4DF4A 2LYVA 2ZZMA 2E2QA 2AU0A 2L9WA 1NOYA 2DR7A 3EO3A 3PIPL 4KO0B 5HAOA 2LKZA 4KTZA 1HLWA 3SIPB 1N36F 2HYIB 2UUWA 4OZJA 3M6XA 4RUCA 3K58A 4ES3A 3P49B 1T9WA 5DZ6A 1RSCA 4UTGA 3D66A 3QEPA 1S1TA 3V9SA 2B4JA 2XY6A 3VF6A 4JI1J 1DBDA 3BBBA 1NGBA 4LFBK 4NA1A 2G4BA 1Q8KA 1X4EA 2DXDA 5LL6d 2HRTA 4GV3A 3FVYA 4ZP7A 4ZVGA 3IWXA 3KKFA 5EWGA 3IRXA 5KTQA 3KD5E 1NM2A 2QTDA 2HQDA 1NHKL 3K5MA 1ELOA 3BJYA 1NH8A 3GIKA 3NNAA 2Y1JA 2FJDB 2HQFA 5JMNA 2DGTA 3P5BP 3QAUA 3TSQA 5AQMA 1XMOF 3MPUB 3OL7A 3KMQA 3CMES 3HVTA 4M41A 2EI5A 3GMGA 4GY2B 5E0OA 2MKCA 1S1UA 2VC0A 3NH2A 2P9NB 3I33A 2GW8A 1GFWB 4HH1A 2HMIA 2O5DA 1GLJO 2HGLA 3BQ1A 5EU7A 2GC8A 3Q8RB 3C6UB 2VB6A 2IVOA 2VFUA 3AOBA 2H3GX 5K8PA 2J76E 4ZTFA 4MK9A 4DL7A 1MN9A 3A0IX 1RT6A 1UTAA 5IWAJ 2YHXA 1D09B 4DQIA 5F3TA 4DR4K 4TYBA 4I0WA 1S9FA 4JKEA 1FNMA 1EO1A 1QAJA 2NUHA 1CXUA 2FHKA 4ZVRB 5AZIA 1Q5YA 1V5IB 1BG3A 2HHTA 4CHQA 3VTHA 3SQ1A 3LPEA 1SL1A 3FZBA 2Q31A 4FJ5A 1VQ6S 4BR2A 2HQ3A 4JI7J 2RS8A 5E3RA 2E1PA 3ZT3A 3FQLA 2BA9A 2VG5B 3IFRA 3WNHA 3SCJE 3QT8A 4IKAA 2BJDA 2VPWB 3RB0A 3ENOA 1SUQA 3CT9A 4L75A 1E6YB 3BQ0A 1FFSB 3CD5A 3CC7S 3VQ5A 1TL4A 2LFVA 4NLWA 3J81Y 3JYTA 1X4FA 3ZX2A 1VRUB 2CG4A 2DT9A 2GGPA 4NLCA 3D2WA 2YQ1A 2V7ZA 3MXIA 1I5OB 3GIJA 3GOIA 1JLFB 2OELA 1K8AT 2IAJA 3UI3A 2HSTA 1H7XA 3SBMA 1S6UA 3FR0A 3L4BC 1HQUA 3H42A 2V63A 4Q0BA 4BG9A 3B6BA 5LMNK 3Q8SB 1P1TA 2YWFA 3G10A 3THYB 5HROA 3KHGA 2RJZA 1Y00A 2P9SA 2I9SA 2EFQA 3DI6A 2D1KA 4H0TB 1X9JA 3EPIA 3O4QA 4AHTA 2EBGA 3RWUA 3H2UB 5GMDA 3GV5B 1VSMA 2EG2A 2A6AA 2F8EX 1SPBP 2E9TA 1D3WA 2DNMA 3DKDA 4DMZA 4LQ9A 4DHVA 1FX2A 1FKAF 4LFAF 4CZLA 3CMQA 4MIBA 3T5KA 2BE2A 1URNA 4RX6A 2Z1HA 3HP9A 2ZM6K 3AA5X 4C1NI 1O51A 3WQTA 2VU5A 4WQ4A 2DPIA 2CDRB 2R7QA 3H45C 5B7WA 2GIQA 1S10A 4CIFA 3SCKE 4IFEA 4C11A 3BREA 4L3QA 1T9VA 1JKHB 3CQ8A 4RG8A 3ILJA 4I2PA 1HQEA 3IKMA 6FD1A 3CJ7A 3BDPA 2HNYA 3KLVA 5HOOA 3M8PB 1RT1B 2L3MA 3CDUA 4W5OA 2PAVA 3MR3A 4CTAA 1M1GA 4V1Ak 3RYLA 2FJWA 1VQ7S 3NE6A 4C0OC 2X3DA 1MN7A 4J9UE 4DFJA 1Q8BA 1FDNA 2UUTA 4TU9A 2OPSA 3NAEA 4DX6A 1S72S 2NXUA 3SMZA 4ED8A 3SQ2A 1RTIA 1C4CA 4CT9A 4E98A 4NCAA 3O9QA 5I3QA 2V2VA 5HLFB 3O3LA 4WQ4C 4ECWA 2KFYA 4EUVA 2B5JB 4KY3A 1ZTWA 1U6ZA 3M6GA 4DV1F 3CDAA 2B4OA 5CE3A 2C28A 1Y3JA 3VN5A 4NLSA 5T7BA 4F3OA 3MN5A 3VGVA 2F8MA 1HPZB 1FRJA 5KFLA 3FGVA 4CGGA 3QAEA 1H72C 5IQQA 1GT8A 2LDIA 2D5RA 1GAOA 4BRQA 3FE1A 3C7NA 4HLBA 4CIEA 3Q83A 1SS6A 5AXKA 1Y0HA 1I94K 1F9HA 4PKDB 3JAMY 3HSGA 7FDRA 2QXLA 3LAMA 2F4VK 2GAGC 3DLLL 3IFEA 4K4YA 4ZPVR 3ZSOA 3OSNA 2M52A 5F9NA 4JI0J 2CQ1A 5JS2A 3VPZA 2GGPB 5IV4A 4ETZA 3HPHA 3U1NA 3LZIA 4F0HA 4IDKB 2NS1B 4FPRA 1JLFA 4JP8A 2W6LA 1CG2A 2WW8A 2CGKA 4GC6A 1AFJA 1NGGA 3KLFA 1CJKB 1SJQA 4BGAA 4CFCA 1S49A 2M88A 2CKWA 2J8SA 4M94A 3VEXA 3KLIB 4WIQA 3KUEA 1WUAA 5GINA 4PCQA 5GIOA 2VBXA 2NNWA 4NMLA 2QXFA 4DTXA 2O8EA 1YJ9S 1UEVA 3CPWM 2W2OP 2LA4A 3UD3P 4CT8A 1XNRJ 1VISA 1QS4A 4CZGA 3GIMA 4L8RB 3T1YJ 5JUMA 5KRSA 1ZYQA 2ACYA 2HHVA 4DQPA 2E88A 4BE2A 3MDFA 2ZH6A 3EXYA 3ZZTA 1SJ3P 1RDBA 4DI6A 2XG8A 3JQKA 3MMBA 1VQKN 2D41A 3I0RB 2QWQA 3R9PA 4LR8A 3MFIA 4GKKK 1GEHA 3F9KA 5KFOA 5CZ1A 3QGGA 5A2QU 3VF0B 1JKHA 4AHCA 3FBCA 1HBOB 2AD9A 1U1RA 4MLHA 1W7WA 1ZM3A 4DV7F 1RBLA 4U67Q 2JVOA 3V9ZA 3VENA 4RU9A 3PHEA 4LVNP 2ROGA 1RT4A 2RVJA 4KGXB 4PG6A 1RT2A 1OQ3A 3C95A 3OS1A 2W24A 3ZX3A 1QM9A 3M8SA 2A1BA 2R2SA 4FK0A 1RCHA 1I3AA 4CRJA 4CH1A 4G3IA 3JSMA 4ICLA 4ZVOB 1VQ6N 1ZZNA 4C3KA 4F7VA 4FJNA 2CPXA 2PFDA 4OGEA 1D4XA 3I31A 1U02A 2IVNA 2C2RA 3MAHA 3VQSA 3TQEA 3G25A 4OFZA 4EBEA 4CLFA 1GXUA 2GJ2A 2BR0A 2XYHB 3E9OA 2R7RA 5IT4A 2RKIB 4JOUA 4HTJA 2HZCA 3EZ5A 5HLFA 1RU2A 1NUEA 1CJVA 1IR0A 4K4WA 4YB7A 4KYZA 1OSCA 3EZOA 4FJMA 4Z4FA 3PLAA 2RPIA 2B5JA 1Q9YA 2CVIA 3SNNA 1JCFA 3HOSA 1YJUA 3UB5A 3Q22A 3Q2TC 4ATNA 4H0YB 3V5RA 2BEFA 1BLUA 2FVPA 3OBIA 4C48A 4DUYJ 4H54A 4QS7A 3DGPB 4F02A 4O4GB 4Y2AA 9RUBA 1TL5A 4LBPA 4URQU 1H6KX 2HHXA 4WFAQ 3L2VA 3QT7A 2ILYA 4XTTA 2M7SA 4FBUA 4WP3A 1UPPA 1QUVA 1FESA 4IEEA 1Y64A 3H1QA 3DLEB 1WG4A 1EP4A 1UETA 3P31A 3ZZ0A 2JEGA 5MLCV 4C23A 4DTNA 1NMNA 4WFNQ 3K2YA 3MXMA 4FWNA 2IM2A 1KVKA 1YSJA 4LSLA 2AEMA 2A10A 3QDKA 2RAQA 3T1HF 1N88A 1X4GA 2O67A 5I9EB 5BJRA 3GFXA 2KXHA 1A6LA 1BL3A 2EBEA 5AQFA 3ZT0A 2MHNA 1SB6A 1RYRA 2D9PA 1KP6A 3DU5A 4HTUA 2JFDA 2JFKA 4JI3F 2J0SD 2OUGA 1FHTA 4HYKA 4YOWA 2UZAA 4KH5A 2IA0A 3VCDA 1B3TA 4DU7A 1VSEA 3CXCM 4BC5A 1U2VA 3SQOP 1VQ4S 5KFQA 1URRA 2DGSA 4RWWA 3TU5A 3PRDA 2BRLA 1MWMA 2O66A 2Y0BB 5IXUA 5AQKA 2MSTA 1BCMA 5I3PA 2YHAA 2V9WA 4QR2A 4OVLA 2RQMA 4M5KA 1ZA2B 4CEBA 5DDQC 4HR2A 1F2HA 3GFYA 1XNQK 1CULA 4MT1A 4P9SA 4OYBA 2C3UA 2V2KA 1B99A 4M3RA 3BUZB 4KHSA 3F2KA 1WORA 1Q5VA 1CVJA 1HNIA 3M7VA 3NF7A 1T9UA 2HFVA 4GKJF 3PHTA 3I55N 1O13A 5J1PA 4RUAA 2SXLA 4QR1A 4H4MB 1NSAA 1TL3B 4ID1A 2N4DA 3U9DA 4DR2K 3QSYB 1X4CA 4CDIA 1K9MT 1HBUA 2YKOA 2WOMB 1FXDA 1ZBUA 1TKZA 3WT0A 4YNQA 2MQPA 3TA1A 3OVNA 1RXOB 3I56N 1VIXA 4OKKA 3BPSP 2HSEB 4LR9A 4JI5F 3N5BA 3FQKA 2QWNA 3C14B 2XCAA 2QFIA 3MR7A 1YVFA 1WSGA 4AHSA 2AP1A 2M0GB 4FVCA 1U1QA 4PXCA 4FJIA 3UD4P 3SUOA 2YNHB 3VESA 1U2RA 3LP1A 4Y2MA 5KFDA 2ZH1A 1CJVB 2RS2A 1U1KA 3DDKA 4OO1J 4JV1A 2FQQB 3VQCA 3IS9A 2AA4A 5ETRA 1R8AA 3NLCA 4ZCIA 1NK7A 1UOCA 1DEJA 2AJ1A 2VPZB 1HHQA 2C2ZB 4X4TA 2UUCJ 5AJ3K 1VQ4N 2CZ9A 2WB1D 3U1MA 4CJSA 3GG1A 2YNFB 1JK9B 5AXLA 2NLXA 2B4UA 1RT6B 3GCXP 1SC3B 4AD6A 1BIZA 3FEYB 2NRRA 3LO3A 4YHHF 2ZOGA 3ILLA 3R2DJ 4TU7A 3FZ2A 4Z4EA 4PYDA 1X4DA 1LOUA 1RAAB 4E1NA 3FCHA 4A57A 3OR2B 4KPCA 2FJEB 4QWDA 3GV8B 3ZSZA 3MPVA 1RKJA 3A8JA 2W2QP 2DY4A 4CGFA 4S0MA 2CPYA 5IQ6A 2FBYA 4OHWA 2H5JB 1SUQB 2FC8A 2HZAA 3QLHB 3CJSA 3W0LA 2PBDA 5HRSA 1YHQS 1J27A 1N54B 3NL0A 4LT6A 1N33K 3NS7B 3I5BA 1RTZA 2RUGA 5CCLA 3LAKA 2UYTA 2W01A 2F65A 2XSFA 1VQ5N 2BANA 4JB8B 3DXSX 1KVJA 2YKMB 1U0SA 2X1BA 2LQ8A 4U8VA 3TSPA 3P96A 3MUTP 4FPAA 1CJUA 1HQUB 4YS2A 4F4XA 4OKEA 3D0PA 3GU0A 4E3SA 4C6AA 4CNZA 4QIGA 3H08A 4AH9A 3ZETB 3AVBA 4GC7A 4O3SA 3CM5A 4BC7A 3IXQA 4X65J 4ECXA 2LU2A 4RBVA 3PFOA 1HMVA 4CHPA 4IG0A 3C46A 2FBTA 1CZAN 2UVVA 1S22A 4DXLA 3FEXB 4WYLA 2W2NP 3TUIC 5GAEI 4FDFA 3OYKA 4M5MA 2HGNA 3EYZA 3E2EA 2E20A 5HRRA 3NY0A 2FY1A 1X8DA 4I68A 2HBZB 4CJ5A 2MQOA 1NJZA 3UN5A 3QFHA 2K3KA 1U09A 5ETOA 5DLGA 3N6MA 4ISGA 3EKUA 2UXDK 2NUUG 3ZSWA 3G87A 4GV9A 2YHYA 4OYMA 4DPOA 2V8VA 1S72N 2MQQA 2C3OA 3UCGA 1SKUB 3MI7X 1TMJA 3OL8A 2AYGA 3CJ4A 2NZCA 4CTAB 4M3YA 2E4LA 4LUBA 4I6MA 3C14A 3P39A 1Q1KA 4ZVSB 1SJ1A 1QAYA 4I7FB 4OQJA 3DXBA 4F3MA 4URGA 3TAQA 2DXFA 2G9OA 3ZZRA 2QA2A 2DHXA 1FI4A 1V3SA 1QE1B 1N8RT 5AQLA 2NRWA 2Z8QA 4X4OA 4RNNA 1KQKA 2W9BA 1YTYA 3R97A 1N48A 3H4BA 3R5AA 2NXCA 1YRTA 1ATNA 2VD3A 2XI3A 2L9DA 1NXIA 1XEZA 5LMNJ 1FKPB 1DQ8A 1KFDA 4IOCQ 4D3HA 1I3OB 1QQOA 4MKVA 4NLXA 3EX7B 1WAFA 4WFAL 2GAHC 2XHWA 4DV4K 2JGUA 4OYAA 1H38A 4E7HA 3VA0A 2BW2A 4CO2A 1UJ5A 4LSNA 4B17A 3EWGA 1WOOA 3NXZA 3DLGB 2XNQA 2V8DA 3VGTA 1N6QB 3IRWP 1NGIA 1IBKJ 3G96A 3MR5A 2V69A 2J0XA 4GKKJ 2ZH7A 4FM0A 2YKNA 4M5LA 3PW7A 2O4GA 1U45A 2UV8A 2XCPA 2QE5A 3R5CA 3VQ6A 4IXCA 1D5AA 1LXJA 2BM1A 3PO5A 3Q8YA 5AQZA 2IBKA 3HI9A 2EK1A 3NGKA 2ZEJA 4ZJOA 3ZZYA 2BKOA 4HDGA 3W1YC 2UUAF 4M3UA 1R8PA 1FVQA 4LBHA 1TUUA 4R5PB 5I3UB 3ZTPA 2CWKA 2YKPA 3M1VA 1GOAA 4KB0A 1S7IA 3AGKA 2XMUA 4ZIWA 5FDLA 3V4MA 2PY5A 4EFHA 1VCTA 4H5RA 1RWXB 4J90A 5BPNA 2OGUA 2F63A 1WN7A 3I8DA 2ZBIA 4BQZA 3FKBA 3ONQA 2E2OA 3GPAA 1T0TV 2X78A 2CYYA 1WSRA 3NGIA 2E5HA 3H5UA 3CIPA 3I0RA 4DHYA 4XPCA 1G15A 2FHJA 4CNYA 4JD2B 3G9CA 5D0HA 3RAMA 2XY8A 2D0BA 4YOVA 1TK8A