4KKOA

Crystal structure of hiv-1 reverse transcriptase in complex with 4-((4-methoxy-6-(2-morpholinoethoxy)-1,3,5-triazin-2-yl)amino)-2-((3-methylbut-2-en-1-yl)oxy)benzonitrile (jlj513), a non-nucleoside inhibitor
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 reverse transcriptase, p66 subunit
publication title Extension into the entrance channel of HIV-1 reverse transcriptase-Crystallography and enhanced solubility.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Hydrolase/hydrolase inhibitor
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4kkoA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4kkoA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4kkoA05
4OLAA 4FW1A 3CJ0A 2W8KA 1JIHA 5SZTA 4FJNA 4OJRA 3LZIA 4DS5A 1TKZA 4RU9A 1D9FA 4J2BA 1T7PA 3C6UA 4Y34A 5T14A 2JEJA 3N6MA 1C1CB 1JLBB 4MKAA 3CFPA 1SL2A 3NF7A 4KHYA 3FQLA 3UDLA 3AVMA 3V4IA 3LAKA 3CVKA 4RW8B 3NGDA 3VQBA 4B8AB 4KV8A 3LDSA 4ECQA 3MXMA 1RTIB 1SUQA 2YNIB 5CY4A 1S0MA 4FM1A 2P5GA 4J9OA 2XY7A 2ASJA 4DSJA 3T3FA 3HVTA 2ASDA 3KNAA 1ZETA 3FFIA 3SNNA 2QE5A 1BIZA 4IRCA 1IKVB 1QHTA 4DFKA 4ED6A 3V9SA 4ZPDA 1D5AA 4ED8A 2J6TA 2OPRA 5F8HA 4TXSA 3BQ1A 4KKOA 2VG7B 1ZBIA 1HMVB 3EZ5A 4JLHA 4RUCA 4AH9A 3JYTA 4TLRA 2IS3A 3OYDA 3B6PA 3OS1A 4AHCA 4O3RA 4BDZA 2G8UA 4CK1A 2FLNA 1LW0B 4EO6A 4IDKB 1LWEB 3DRSA 4GMJB 2FBYA 4XPEA 1FKOA 2YHBA 3M9OB 1VSIA 1L3TA 5J2NB 2Z1GA 3Q8QB 2ITGA 4F2RA 4IG3B 5KG1A 4ECXA 3VQEA 3NH1A 4GC6A 4Q43A 2F96A 4NCGA 1SV5B 4KB7A 1JX4A 3CM5A 1TKXA 3JSMB 3I5CA 3ZSZA 2FJWA 1S10A 1YTAA 4F4XA 1JLAA 4ZHRA 4G1QA 3MFIA 2V0NA 4NYZA 2VWJA 2D3UA 1VSLA 4NLWA 4IFYA 4OKKA 2WK4A 4IBNA 4KHQA 3UIQA 3QGIA 3VN5A 4Z4EA 3DOKB 1RBVA 5KFPA 3QNNA 1VSFA 1CLQA 1SKSA 3NF8A 2KZMA 1KFSA 3TVKA 4ICLB 2ASLA 3OLBA 1OS5A 3H5UA 4Q8FA 4FJ7A 1JLCA 1K1QA 4DTOA 4AHUA 3C94A 4FCYA 3MEGB 1NK5A 2FBXA 3DYAA 4DQIA 3QEPA 3H4BA 5C25B 3T5KA 1EETB 1IKWB 4NLTA 3QZ8A 5EDWA 4TN2A 2GIRA 4K4VA 2HNDA 2W8LA 5HP1A 2OZSA 4Q5VA 4WZQA 2JEIA 2OPSA 4O5BA 3DRRB 2OZMA 2WOMB 2FVSA 4FZXC 3OYNA 1BQNA 4ZMMA 2R8KA 4CEEA 4W5TA 1IM4A 3PX4A 4HTUA 3K5OA 1S6PA 1VSMA 3KHRA 4KFBB 3BR9A 1RDDA 2A1SA 3B6OA 2BANB 4FLXA 2C2EA 3V1QA 1S9GA 3BDPA 2R8IA 5J2PA 3ZSVA 3PX6A 2PY5A 4M3UA 1BCMA 4HUEA 4OVLA 2XHBA 1XC9A 2OPQB 1WSHA 3KJVB 3KLGA 1N48A 3CFOA 4J9NA 1TKZB 1S48A 4Q8EA 3PO5A 2J6UA 4ELTA 5KG4A 3MR2A 5KG3A 3C6UB 3Q8PB 4CHNA 3QERA 3SCXA 4DG1B 1TVRA 3H5YA 4GW6A 4N56A 2IC3B 4MH8A 1HQEA 4BWMA 4IRDA 5I42A 1JLGB 2JEGA 2UVRA 1TL3A 1TGOA 1SUQB 4NLSA 5EUHA 4CJSA 4KHWA 1T94A 1U4BA 4RZRA 3HVTB 3VQDA 3U3YA 2XY8A 2IJFA 5KT5A 3FFIB 2O4IA 5KFUA 4QPXA 1WSJA 3ZSOA 1EP4B 1YVUA 4TSXA 4FM0A 3L2RA 1NJWA 4QAGA 4PY5A 3EY1A 4NCAA 1EXQA 1VRTA 3SUQA 2FVRA 2ATQA 3SFGA 2YNGA 2IA6A 4I7FA 3D28A 3JYTB 2UUTA 3HYFA 1KHWA 4K4ZA 3H98A 3QEIA 4F50A 4ED2A 4Y3CA 4CIEA 2HHXA 1RT5A 5C42A 4QWDA 4IRKA 3DRSB 3NAEA 4FLUA 1LW2A 1FKOB 1S9EB 1FKPB 1S6QA 4NLRA 1R0AB 2GV9A 2ZKUA 1HRHA 4DS4A 5KFLA 4EBDA 4NLGA 1VK0A 4NCGB 4CF0A 4WFZA 3EYZA 1TKXB 4N47A 1SH2A 3RB6A 3K5LA 1S1VB 5DGAA 1JLAB 3TAEA 3RBEA 4G1QB 2VG5A 2E9ZA 4DQPA 3DLEA 3L2UA 3I5AA 1A5VA 1TKDA 3ISNC 3OL8A 2O4GA 3L2VA 5KFOA 5CYQA 3SQ0A 1LAVA 1S49A 5KFZA 2FJXA 4CJVA 1WSGA 4BWJA 3NMAA 1ZBFA 1RT4A 4E7LA 1HARA 4KHNA 4KHRA 3HM9A 3PX0A 3OYFA 3HJFA 3AO1A 4F4KA 4G3IA 1G15A 1UWBA 3CJ5A 4IH5A 1RDCA 1GX6A 2D0CA 5KFIA 3DYAB 1IKXB 4TYAA 1BISA 2OPPB 4ID5A 3M8PB 5KFHA 4O3NA 1HYZA 1ZTWA 3BREA 1WSFA 4RNFA 3I0SA 4LSNA 4BE2A 1RT1A 4JV0A 4JV2A 1T3NA 3LP1A 2HNDB 3T5JA 5HP1B 1S1WA 3L2WA 2PZSA 2WB4A 3MTKA 5EWFA 2BDPA 4TQRA 3MF5A 1N56A 2OPSB 3K2PA 1RT7B 4K8ZA 5CZ2A 2HHQA 3G6XA 3N6LA 3MEEB 4YNQA 2RF2A 1QSSA 4B3OB 1BQNB 4DQSA 2BQRA 3GIMA 4B9NA 3TAMA 1ZBLA 1UA1A 4O44A 3GV7B 3HPHA 3H59A 2JEFA 1WSIA 5FROA 3L3UA 5J2PB 3QIPA 4JUZA 3AVLA 4B8CA 3SPZA 3DRPA 1NHUA 5KFDA 3KMQA 1GOAA 3V9UA 4MKBA 2X6SA 3K59A 2HAIA 2JLEA 1NKCA 3MR5A 4CK2A 3DLBA 2ZQBA 3V6DA 2WCXA 3SPYA 3KLIA 2UVUA 3AVHA 1HQEB 4DSKA 1KVAA 1VSDA 4L8RB 3KKRA 3EPIA 2KTQA 5HRNA 5I3UA 3QYYA 1S5JA 3PR4A 4CHOA 4CGGA 3K5MA 5J1EA 3G6VA 3H4DA 3KK1A 2R8HA 4CK3A 3NH0A 2C2RA 3I0RB 4H4MA 4ED7A 4E19A 3RMCA 3T19A 3RAQA 2BE2B 3AVGA 4CGFA 4K4TA 4E7HA 3PJWA 1U47A 2GUIA 4BE0A 4FJ9A 3IS9A 3SI8A 5E41A 1KFDA 5KFCA 4ZP8A 2YNGB 4HHTA 1ZYQA 4DLGA 4R5PA 4IQXA 1HNVB 2QK9A 3T5HA 4NYFA 4DU4A 2W9BA 1NHVA 3OHBA 5D3GB 4LH4A 5C42B 3CDEA 3LP0B 4PWDB 4CEZA 3TI0A 1SKRA 4OPJA 2W42A 3HXMA 1LV5A 4CJLA 4URGA 3U6FA 1Q8IA 4NLOA 4FLZA 1ZBHA 2E6LA 1JLQA 4YQWA 4ELUA 4DSIA 5FDLA 5KFKA 4ECYA 3VQ8A 2UVWA 4CECA 1ASWA 3G10A 3GV8B 3ALYA 2VG5B 3DLEB 3G6YA 1I3AA 4J9MA 4U7CA 4O3QA 4I2PB 4QW9A 3IAYA 5KG2A 4J9QA 1RT2A 2RPIA 3OJUA 3RMAA 2FLLA 1J5OA 1RT4B 3NDKA 2DFEA 4Z4CA 4CF2A 5DG8A 2QV6A 4J9KA 4CERA 1KRPA 4J9PA 4DL3A 4Q44A 4KSEB 3LALA 4CJUA 4FK2A 2DPJA 4IKAA 3RBDA 1B9DA 3MFHA 1XR6A 1S4FA 3HHKA 3VQ4A 5EU7A 4CFCA 1BHLA 4ELVA 4I9QA 1O1WA 3PZPA 4IH7A 3EZUA 3I0SB 1ASVA 3KLEA 5KT4A 5KRTA 4FLWA 4NLQA 4RW6A 3LP1B 4WZMA 1S1WB 3E01A 2QKBA 5CYMA 2HMIA 3RR7A 4Q45A 3OYIA 1T03A 3S3NA 1KVCA 3F73A 3HPOA 2RF2B 2E6MA 4DL6A 3QIOA 1WN7A 4LSLA 3KHHA 3TAFA 2HVIA 3TAMB 3D0PA 3ZT4A 5KFNA 2Y1JA 3TAPA 1C2PA 1N5YB 3ZSYA 1JLFB 4DL5A 2YKNB 4DFJA 4ECZA 4RNHA 3V9ZA 4KB0A 5KT6A 3DRPB 3DI6A 4WXOA 1RTDA 4ZVFA 4W5NA 1WLJA 1VSHA 2AX0A 1TAQA 2W9AA 2C28A 4W5OA 4E7JA 1WNSA 3O4QA 1S1UA 4OKJA 4KAIA 1YT3A 1RTHA 4DL4A 1U04A 3KLIB 2XCPA 4MFBA 1IKYA 5HROA 3OLAA 5I3UB 3ASMA 1RBSA 4DQQA 1ZBUA 2R8JA 3KK1B 3G0ZA 3DMJA 2IM3A 4M41A 2PYLA 4H4MB 4B9TA 3LANA 4F2SA 4W5QA 4F4WA 4I9LA 1RNHA 5KFQA 1Z26A 1U48A 1Q9YA 4N41A 1Y97A 3SZ2A 4MK9A 3MR6A 2IJNA 3IS9B 1C1AA 1X9SA 4DTRA 3ITHB 4DTJA 5J2QA 4GVMA 4RW9A 5DG9A 2XY6A 3SI6A 1VSJA 4MK8A 4FZZA 1QS4A 3VQPA 1DTTB 1I6JA 1REVA 2W9BB 3FDSA 2R8GA 1QAIA 3QESA 3CIZA 3TANA 2IMWP 2BR0A 2AX1A 1HQUB 4Q0BB 2B6AB 3KLVA 3D5MA 2AJQA 3RWUA 3WNFA 1TKTA 4TY8B 1TV6B 3ZT2A 3QGHA 2DFFA 2X78A 1JLQB 5FDLB 1NK4A 4QWAA 3V81A 3U3GA 4CGIA 4CCHA 3NAHA 2Z1JA 4FS2A 4M95A 3PVXA 2ZD1A 4CHYA 5KG7A 4IG0A 2RKIA 3I8DA 2P1JA 3O3HA 2IM2A 3OYAA 4KBIA 4F3TA 3NFAA 1UAXA 4J9LA 1EKEA 1C6VA 2LSNA 4FJXA 1C1BB 5DQHA 2V4RA 2YV0X 3M8QB 3SQ2A 5DQIA 4NLUA 1HPZB 2XC9A 1N6QA 2FJVA 1D9DA 3TAGA 3LP2A 2R2RA 2DPIA 3KK3B 3O4NA 3ZSRA 4OGCA 2G8KA 4M94A 2HHWA 5KFRA 2AGQA 3HT3A 1NK7A 2CKWA 2WONA 4EP5A 2XWYA 1LWCA 4M3YA 2F8EX 4EYHB 4HCCA 4WFYA 4W5RA 4RW7A 3VA0A 3KLEB 1J9AA 3NKYA 2AQ4A 3C6TA 4RW4A 3RMBA 3L2QA 4GC7A 3E01B 5HBMA 4TY9A 3NE6A 4KTQA 5CYMB 2HMIB 4DF4A 4NLYA 5CZ1A 1T03B 1JL2A 3V4IB 5KFTA 4CE9A 4QWEA 4ZTFA 1KTQA 4CF1A 3QGGA 2YKMA 4KV8B 4FLTA 3HVAA 5DLFA 3TABA 4DTUA 4OLBA 3N6NA 5C24A 2KW4A 4CGJA 1JKHA 3H5XA 2IAJA 2HHTA 1CZ9A 3RTVA 4IOBA 3SYZA 4IH6A 1C0MA 4J2DA 4EO8A 1XWLA 4OPKA 3DLRA 3NF9A 2OPRB 2ATLA 2VG6A 1BQMA 3KK2A 5HRPA 4DTSA 4KKOB 1XR7A 3SQ4A 2HNYA 5HLFA 3AVNA 1S9FA 3FRZA 2UVVA 4CEQA 2RDJA 1LAWA 3CJ4A 4Z4FA 4HKQA 4DEZA 4RNNA 2PYJA 3DLKA 4Z4IA 4B9SA 1C0UA 1TQLA 3PW5A 1CZBA 4FJKA 3QIDA 3ZT0A 1S1UB 3MEDA 3BGRA 3AVFA 2DY4A 2V9WA 4K50A 1XHXA 1X1PA 4WE1A 2W9CA 3NGZA 1KSPA 3MECA 3PW7A 3D45A 2AU0A 4MFBB 4YP3A 4TQSA 4ZPAA 3NHGA 3OYHA 1K1SA 3SFUA 2KFZA 1RBUA 3DMJB 2HWIA 3RR8A 1CXUA 2Q3SA 2G8VA 4ZHRB 4CJEA 3H2LA 5KFGA 3QEWA 3HPGA 1JLEA 3KLFA 4JS5A 3DOLA 4YMEA 3PV8A 4QCLA 3SV3A 2ZE2A 1VRUA 3SQ1A 3A2FA 4K4UA 3UR0A 1A5XA 4IFYB 1S1XA 3ZSWA 2B43A 2D0BA 1GOCA 1U09A 4DTPA 1BL3A 2I5JA 4RW9B 3ISND 2HHSA 4K8XA 4I2QA 3AV9A 2XY5A 5F9NA 1TAUA 1BI4A 2EHGA 1JLCB 4O4GA 4E7IA 1NOZA 2R2UA 1RBRA 1KLNA 4YFUA 4ZVHA 4ED3A 3V6KA 2F8TA 2VWKA 3GQCA 4K4WA 4IR9A 3LAMA 3NBPA 4AILC 4WYLA 1JL1A 2HW3A 3V81B 3PHEA 2FVCA 5KG5A 3OL9A 4CJWA 2QXFA 4IG0B 1S1TA 2RKIB 3QLHA 4KAZA 3LZJA 4EP4A 1RAJA 3LP3A 4ED1A 4NLDA 5JXSA 4ZPBA 3FSIA 3P1GA 2X74A 4KHSA 3KTQA 4J9RA 5FRNA 5KGWA 4FYDA 1RA7A 1S6PB 4E0DA 2D5RA 4DU1A 1T05A 3O3FA 4BE1A 1S9GB 1Q9XA 4Y1DA 3VQCA 4DFPA 3KLGB 3F9KA 3HO1A 2IM0A 1LWCB 3OL7A 4F3OA 1QE1A 2BRLA 3RRGA 2EX3A 1S97A 1NK8A 4ZVGA 4RNOA 3C6TB 4RW4B 2HHUA 1MMLA 4CJKA 1TVRB 2QKKA 1QUVA 3AVJA 3CJ3A 4OKEA 2X6NA 3M9NB 2VG7A 4FJMA 3S3MA 1SL1A 1HMVA 3QETA 1WAFA 5I42B 2G8WA 2R2SA 1TL3B 4KPYA 4KHUA 4DWIA 1Z4UA 4KO0A 1I39A 1JKHB 3MXIA 1JXBA 4DLEA 2IAJB 3SUPA 4M45A 4KI4A 3T5LA 4IDKA 1LWEA 2W7OA 4M3ZA 4C8LA 3VA3A 1TL1A 3PR5B 4F8RA 5J2NA 2CJQA 3CDUA 4MIAA 4IG3A 5L1KA 3IGNA 2E9RX 5JUMA 3FQKA 3GILA 4HUGA 2YNHA 2VG6B 1BQMB 3KK2B 4K4XA 4BDYA 5HLFB 1VRTB 4KRFA 1RDRA 4FJGA 4XPCA 4WFXA 3GV5B 4CIFA 4I7FB 5KRSA 3QO9A 3TARA 3Q8RB 5KFJA 4NRTA 3KOAA 4TYBA 5L9XA 1RT5B 3MEDB 4ZPCA 2R2TA 4B08A 3OY9A 2P51A 1LW2B 2B5JA 4ZP9A 3MECB 1S6QB 1NJXA 3K57A 4Y1CA 4CJRA 4R8UA 5DGBA 4ICLA 4NCBA 3M8SA 2P5OA 3ULDA 3VQ5A 4CEOA 3M9MB 4NRUA 3KLFB 1XR5A 4K4YA 3DOLB 5FRMA 4PUOA 2E4LA 4B9VA 5CYQB 2GC8A 4WXWA 1S1XB 1J53A 3C95A 4KI6A 4CF8A 3HP9A 2YNFA 4FJLA 3OYEA 1B92A 1EETA 1XHZA 2HHVA 1W0HA 1BI4B 3NAIA 4PA1A 3TWHA 5SWMA 5KFYA 5C5JA 4CHPA 3KD5E 1D1UA 3ZT3A 3HVRA 2AGOA 4CESA 3DRRA 4O4GB 1L3VA 1KLMA 2WOMA 4KB1A 1UWBB 3DLHA 4DL7A 1W25A 5DQGA 1XI1A 5KFWA 2KZZA 4DSFA 4KREA 4ID5B 1UA0A 1D8YA 3G86A 3KD1E 2OYQA 2IOCA 4LSNB 4PQUA 1ITGA 1B9FA 3KHGA 3DM2A 1RT1B 4RNMA 3AVBA 4EZ6A 4CJQA 3QEVA 1S1TB 3QLHB 3QINA 2OPQA 4HVJA 3KJVA 1VSEA 3TAQA 1HNIA 1NKBA 3RB3A 3V9WA 2C22A 2ILYA 4URQU 1SL0A 4FJHA 3PW4A 4F4YA 4N5SA 3KIOA 3PO4A 2WHOA 3RB0A 4J2AA 1JXEA 3GIJA 3P5JA 3CFRA 4DG1A 1T05B 2IC3A 4O44B 2ILZA 3HK2A 3UQSA 3OYGA 2Z1IA 3GIIA 4CEBA 5KG0A 3OYBA 3BSCA 1RTJA 1JLGA 3QIPB 1RT3A 4CFAA 3V6HA 3LPTA 3BSAA 4KE5A 4YR0A 4EBCA 3NF6A 4NYNA 3BSOA 5JS2A 4FLVA 3OL6A 1QE1B 4CEFA 4ECWA 1NOYA 1MU2A 4B9UA 4NLXA 5KT2A 1EP4A 2JC0A 4LD0A 4DFMA 3AA5X 2G8FA 3CYMA 4FW2A 3DLGA 3V6DB 3KKSA 4UQGA 3TR8A 4OGEA 3OJSA 3HVWA 2XGQA 3V1RA 3CG7A 3SUOA 1ASUA 3GYNA 4DSEA 3PW2A 5J1EB 2JGUA 5F8GA 4KO0B 2NUBA 4FJJA 1U45A 3I5BA 4FVMA 4C8MA 2HVHA 1S9EA 4C8OA 3OYJA 3UPFA 2D7SA 1FKPA 1TL1B 1YTUA 3OYCA 1R0AA 1C0TA 3VQSA 4M3TA 1RCHA 2YNHB 1BGXT 4K4SA 3RMDA 3PW0A 4RUAA 2BQUA 4FS1A 3THVA 1S1VA 4CJ4A 3RAXA 4R5PB 5F8IA 3AO3A 3QO9B 1K6YA 4E1MA 5KT7A 4Y2AA 4E1NA 4FZYA 2VA3A 4IFVA 3VQ7A 2B4JA 3V1OA 2B5JB 4X2BA 3K5NA 3OSPA 4ZP7A 5KFVA 4O55A 2YHAA 2XRIA 1Z25A 4R8UB 2IGIA 1W9HA 3MR3A 1U49A 4F4ZA 2KFNA 2GIQA 4J9SA 4ECVA 4DMNA 1RT6A 3M8RA 3T1AA 4FJIA 2DFHA 3BSNA 1FK9A 1HYVA 3WNGA 4FJ5A 2HB5A 1S0NA 4CGHA 4Z4HA 4H4OA 4DTMA 4PUOB 1HYSA 2XGPA 4CEAA 4M42A 2IDOA 1IKXA 4CHZA 2OPPA 3M8PA 2G8HA 3VQQA 4CJ5A 1LWFA 1RT2B 2YNFB 1J5OB 4HCBA 3NCIA 3IRXA 4O3SA 3CO9A 1QSLA 1L3SA 2G8IA 4J2EA 5JS1A 3VQ9A 1J54A 1RT7A 4ED0A 1KLMB 5T7BA 4CJ3A 4XO0A 5KTQA 3MEEA 1WNEA 4B9MA 1YVFA 4B3OA 4JV1A 2HWHA 4DSLA 4ECUA 3AA2A 3S9HA 3OYMA 3PY8A 4NZ0A 2WTFA 4CHQA 4E89A 4PQUB 2BGGA 3V9XA 5F8NA 3DM2B 4RW6B 1JXLA 5J2MA 1BIUA 1TK5A 1NNDA 1HNIB 4LH5A 1QTMA 3ZCMA 5DG7A 4HUFA 3OVNA 3CWJA 3NH2A 2IBKA 4LSLB 3AVAA 2DTUA 4E3SA 4M3XA 5DMRA 3Q8SB 3SV4A 1RTJB 3HSTB 3LWMA 3ICLA 1T8EA 1RT3B 2J6SA 3BQ0A 3DI6B 3CM6A 4AHVA 1ZTTA 1RTDB 5L1LA 4CJPA 3I0RA 4EYIB 4CJTA 4DQRA 4BACA 1CSJA 4ZVEA 4M3WA 2FVPA 1KHVA 1RILA 1MU2B 2BE2A 2AWZA 4LY7A 3O3GA 3NGYA 2Z1HA 2A1RA 3GIKA 4CFBA 1RTHB 3DLGB 3PJXA 3MAQA 3KLHA 2WRMA 2HNZA 3AVCA 4AHTA 3BJYA 1IKYB 5HROB 5DLGA 4E7KA 1L3UA 1WSEA 2D41A 4CFDA 4QW8A 1HNVA 5KFFA 1IO2A 1DLOA 2FLPA 5D3GA 1FXXA 3LP0A 3RRHA 4PWDA 5KFMA 2ETJA 1NJZA 1F21A 3QZ7A 5KFXA 1C0TB 3ZSXA 2OH2A 1DTQA 3AO5A 1A5WA 1VSKA 3TQ1A 4U6PA 5F9LA 4ZTJA 4FBUA 2UUWA 5J2QB 1RDAA 5F8MA 4HYKA 3CJ2A 4CEDA 1REVB 3OS0A 4URSA 4DU3A 4I2PA 4IFVB 1BCOA 2VA2A 5KFSA 1NKEA 3EPGA 5L1IA 1RYRA 4KTWA 3IG1A 4KHMA 5K14A 1WAJA 4CF9A 2V4QA 1TKTB 1NK6A 3H40A 3MXJA 4C8KA 1X9MA 2D3ZA 4WYWA 1RT6B 2FVQA 2XI3A 1RDBA 3KMSA 1FK9B 4LQ9A 1KVBA 2ZD1B 4KTZA 4H8KA 4MQ3A 4H4OB 2BRKA 1HYSB 4FK0A 3LPUA 3OYLA 4FM2A 5KFEA 4Z0UA 1RBTA 1LWFB 5HRRA 1C1CA 1N6QB 3IRXB 1JLBA 5F8LA 1IH7A 3LP2B 3L8BA 3P83D 3BQ2A 1NK0A 4C8NA 4RW8A 1KCFA 2KQ2A 4EZ9A 3OHAA 5F8JA 4O3PA 1RTIA 2YNIA 3OS2A 2D0AA 1D0EA 4QOZB 2WONB 4H54A 2ALZA 4FBTA 3LWLA 4M3RA 1N5YA 2FC0A 4YR3A 4RW7B 2AGPA 1JLFA 4IKFA 2YKNA 2JC1A 1IKVA 5KGXA 1SH0A 2E9TA 5J2MB 5HBMB 1X9WA 1TK0A 4R0EA 5KI6A 4FJ8A 3RB4A 1QAJA 4ECSA 3QNOA 2YKMB 1GX5A 4CGDA 2F8SA 4NLVA 5C24B 5DK5A 3AVKA 3DDKA 2FBVA 5KFBA 1LW0A 3AVIA 3QEXA 4B9LA 3HKWA 3S3OA 1EX4A 4FXDA 2O5DA 5EWEA 2Y1IA 4AHRA 2XO7A 4O0IA 1SV5A 3K58A 4QWBA 4Y2CA 4ID1A 3JSMA 2HNYB 1UOCA 2GBZA 1QSYA 4OL8A 3H5SA 1SH3A 4N76A 3H08A 4QWCA 3DLKB 1TK8A 1C0UB 4XIUA 4MIBA 2RDIA 2XCAA 3ZSQA 2BQ3A 1S0OA 3BGRB 3V6JA 4ZP6A 4CJFA 4JRQA 4WE1B 2W9CB 4YR2A 3L3VA 3KLHB 1CXQA 4DTXA 2HNZB 3OSNA 3DOKA 3AO4A 3ITHA 2EC0A 3IN5A 1N4LA 3ZT1A 4ECRA 3PUFA 2RN2A 1DTTA 1DLOB 2FBTA 1QQCA 4CIGA 3WNHA 3AO2A 4DF8A 4FLYA 1JLEB 1HQUA 4Q0BA 2B6AA 3KHLA 3OYKA 3HP6A 3HL8A 4LQ3A 4Z4GA 3CDWA 1RA6A 3MEGA 4MK7A 4JS4A 2ZE2B 4NLPA 1VRUB 4TY8A 4DL2A 1DTQB 4EBEA 1TV6A 1HJRA 5L1JA 1TP7A 2W7PA 5C25A 4AHSA 3NGIA 5HRSA 2I5JB 1NJYA 4EEYA 3AA4A 1IKWA 4I2QB 5KT3A 3E51A 2I1RA 5KG6A 3NL0A 4JRPA 1RYSA 1SKWA 3AA3A 3WNEA 4BDPA 2C2DA 3CQ8A 2R7YA 4FK4A 3IG1B 4ECTA 1GOBA 5K14B 1C1BA 3VQ6A 3VQAA 3M8QA 3SJJA 5EWGA 1HPZA 2XI2A 4IR1A 4RG8A 3SUNA 2IM1A 1L5UA 1IG9A 3NBPB 2OA8A 4KFBA 4DTNA 3IGVA 2BANA 1NK9A 3KK3A 4O3OA 4O4RA 5KFAA 4O0JA
chains in the Genus database with same CATH superfamily
4FW1A 2H4WB 2N7YA 4LSZB 2HSEB 3OR1A 2XMJA 4FJNA 4RU9A 4LF4K 3IAM9 4J2BA 4QIFA 4Y34A 2JEJA 1U02A 1S72N 5ETSA 1CJKA 2CFXA 3C16A 1HWJA 4KHYA 3BPSP 3CEDA 3TZXA 2RRAA 3V4IA 3LAKA 3CVKA 4RW8B 4DXLA 3MN7A 1RCOB 2R7VA 3LDSA 4JI0K 1KWMA 4RJVA 4C4WA 2ASJA 2WBMA 1YSJA 4DV3F 1SC4B 2OTLS 3EDQB 4CLZA 1WEYA 1BIZA 1QHTA 4DFKA 3K89A 1D5AA 2J6TA 4TXSA 3ULHA 1U1KA 2VG7B 3F56A 3AJ2A 1RWWB 5B8HA 2VQFK 1X4GA 3VGTA 1PAUB 3IXQA 4AH9A 4ES1A 4TLRA 2IS3A 5M1FA 3OYDA 3CETA 3RGIA 3ZEUB 3OS1A 4O3RA 2G8UA 1Q8KA 1FVSA 5ETPA 3M9OB 1OO0B 1QAYA 1YJVA 1UVIA 4NI2A 3H6EA 1TKXA 4OHXA 2XO6A 5M1KA 2QWNA 3D2FA 2YQ1A 4V19J 1SQKA 4NYZA 3FK4A 1NH8A 3NVMA 5ADXH 3HX9A 4ZVPB 1ZAXA 3QT7A 1BG3A 3OT9A 5AXLA 5E84A 5AFUA 1NPRA 4Z4EA 2NRTA 2MJNA 2D1KA 3QNNA 4CZJA 1SCJB 3TVKA 5M1QA 3TSQA 3CD7A 2ASLA 2MZ1A 3H5UA 3ENQA 1UVKA 2HHHJ 4X4OA 3HHNB 3C94A 1WI8A 4M5GA 2DO0A 3DYAA 4DQIA 2ASMA 3CCTA 3UDVA 2HS4A 2YHYA 3T6BA 4O8UA 1EETB 5LMUJ 1IKWB 1CEZA 3GFYA 5EDWA 4TN2A 4WQ5C 2YQ3A 1HNZF 2OPSA 2ZM6J 1Z1ZA 3DRRB 3UD5A 2OZMA 2FVSA 3O4WA 1OPZA 1WSRA 1C0GA 3OYNA 2NZCA 2R8KA 3HDSA 3UN2A 5EGYA 1UL3A 2G0IA 1RDDA 3B6OA 4H0TB 4CZKA 2QLFB 4CM2A 3IWXA 3EZOA 3BDPA 1JWWA 2R8IA 5H9EK 5J2PA 3ZSVA 2BABA 4DUYK 3KJVB 3KLGA 1VRQC 1N48A 1ATRA 3SQOP 2CPZA 4FOIA 3PO5A 4HI1A 2J6UA 4ELTA 3JSYA 3MMBB 3I56N 1G4CA 1WTFA 3WEEB 5KG3A 3C6UB 2WFBA 3BEGB 3SK3A 4CHNA 1FI4A 5FD1A 2J9CA 4DG1B 1TVRA 3H5YA 4N56A 4I56A 4USIA 4ZVSB 5IFMA 2FJBB 3BO4A 3T9ZA 2ZH8A 2JEGA 3O9TA 2U1AA 2CQ2A 4YY3F 4U8YA 1E3MA 2N7CA 1GK8A 1U4BA 3JSBA 3TRGA 3HVTB 3FSXA 2FHOB 2DNMA 2IJFA 3FFIB 3C7NB 1EP4B 1SKUB 5C15A 2MQLA 4OV1A 4NCAA 4X66K 3GJSB 1VRTA 1MLAA 1WOPA 3VAMA 4DV0F 4I7FA 3D28A 3JYTB 1N34J 4OMFG 1KHWA 3OV7A 3Q7CA 1Q5VA 2BJ8A 3MM7B 1SZ2A 2UUBF 5C42A 2NXUA 4LF6K 3DRSB 1LW2A 1S9EB 3WQTA 4ISFA 2ZF5O 4BC3A 1S6QA 1R0AB 1ZM2A 1FFWB 2ZKUA 2NRZA 1QM9A 3ZTQA 3BUZB 1HQ2A 2AJFE 1RE1B 1A7GE 1TUWA 4N47A 1SH2A 1IBKK 3P3DA 4LVOP 4N77A 4DV7K 1N32J 5DGAA 2QMXA 3RBEA 1NWKA 4G1QB 2E9ZA 3L4QA 3L2UA 2YKPA 4FF3A 3PTWA 3GFXA 1EX8A 3L2VA 1ACMB 5CYQA 2FF3B 2CGLA 3DXKA 5KFZA 3WQPA 2FJXA 3CF5L 3K7RA 2MZTA 2VBYA 4CJVA 5BPMA 4N8OA 4BWJA 4JV5J 4A48A 4KHRA 5IZHA 2W4PA 5BYRA 1XNQJ 3OTCA 3KXDA 1UZHA 5AQFA 5LT5A 3HJFA 5IWAJ 3AO1A 5D78A 2MZQA 4HH1A 4IH5A 3CJ5A 3CCVN 5D6GA 4WF9L 3W7BA 4BQLA 3M6XA 4M5LA 4TYAA 2Z30B 3VPZA 2P5VA 1HYZA 4PXCA 1WSFA 5JJBA 4BE2A 2KU7A 4OV6A 2WB4A 3CJCA 3MTKA 2BDPA 3BN7A 3PEHA 1N56A 1E6YA 3SAGA 4K8ZA 2IBOA 2DHAA 2BJDA 4L74A 5E3AA 2RF2A 9ATCB 4B3OB 3E9PA 4M5NA 3HFVA 3GIMA 4B9NA 1HW8A 5DZ7A 2F3JA 1WF2A 2UUAK 2G2YA 5HO4A 2O8BB 3KDNA 2JEFA 4LFCF 2DHGA 2CPEA 4B8CA 3AOCA 4FOEA 4CI0B 1M5PC 1HBMB 4MKBA 5A0YA 4NXNF 2QA2A 2HVEA 4MLEA 1GLLO 2XM3A 3BZCA 1NZ8A 2VQEK 3R6MA 1IJJA 1KQSM 4CK2A 2Q36A 1X0FA 2IPOB 2GQQA 3PSIA 4J90A 2WCXA 3KLIA 1EIYB 4DSKA 3LL3A 1R8BA 2CG4A 3EPIA 3TPQA 5I3UA 3QSIA 3QYYA 3G6EN 1S5JA 5E33A 5J1EA 4BR2A 4CK3A 1FXRA 3UB5A 3KYLA 4LBHA 4ENOA 4E19A 3RMCA 4DI6A 3T19A 3W5XA 5LL6Z 2CVIA 3QBCA 4CGFA 1PSDA 1U47A 2GUIA 5HI7A 2V63A 1JJCB 4YHHK 1RLCL 2GMLA 3CCZA 5GAGI 4IQXA 3VEXA 5AQZA 3J80Y 3T5HA 4NYFA 1H1VA 3ISZA 2W9BA 5D3GB 4MKYA 4W98A 4GRSA 4QYRA 3CDEA 3LP0B 1VQ6N 1CULA 3OTOF 1DARA 2B9WA 3GZ7A 2A10A 1ZBHA 3JTPA 1JLQA 3UCUP 3CIPA 2LEAA 2UVWA 2RUGA 1ASWA 4CECA 1NMDA 3SQGA 3OFHA 1N33J 2VG5B 5SUHA 3Q83A 5B0AA 3WXKA 2Z2YB 4RBVA 4RUHA 2MQMA 1I3AA 2LP4A 4U7CA 4DPUA 3R7NB 1RAEB 3DRXA 2E5JA 2OD6A 1T0TV 1BD6A 5AXNA 4U8VA 2VL1A 3MAHA 4LBIA 1BWFO 2DFEA 5DG8A 2CQ1A 1T9UA 4CJUA 4DUTA 4LF9J 3R1LA 3RBDA 2F5GA 5FIIA 1XR6A 3HHKA 3VQ4A 2ZZMA 4ELVA 2YHWA 1O1WA 4JI1F 2KI2A 4KGKA 2W4DA 1ASVA 2YX4A 5KT4A 1RI7A 4KGZB 2B0GA 5GADI 5L46A 1RKJA 1R0BG 2QKBA 1S3XA 4C98A 3PYGA 3QPIA 3HSCA 1T03A 3MDFA 1SQGA 3AQPA 3WC0A 2RD5C 4QR1A 2E6MA 4X4NA 3QIOA 2G1DA 1WN7A 5C2DA 2HVIA 2FJDB 3NG8A 3TAMB 2Y1JA 1AUSL 1O6XA 3IO1A 2YKNB 4RNHA 4ERDA 3DRPB 1FWPA 2HBKA 2RRNA 3PJ9A 4PG8A 2BJEA 1RTDA 4K43A 1WLJA 2AX0A 1PYOB 3Q8YA 2E7XA 2XS2A 2W9AA 2C28A 1V5IB 1H2VZ 2MDAA 1WNSA 4CVNE 4KAIA 4DR4K 2V2KA 2XCPA 4DX8H 1X4CA 4XH5A 4WKYA 3GCXP 2EFPA 7FDRA 2FHJA 4P9SA 3DMJA 2DGOA 2UXCK 3SDEA 3LANA 4W4MA 2K1RB 3WX4A 1KQGB 2KYXA 2MLXA 2M70A 5M2PA 2E29A 1UCNA 3KFWX 3MR6A 3O1WA 1X9SA 2CVEA 2HS3A 3W60A 4DHVA 1YITN 2DYAA 2JH3A 4OHZA 3SMZA 2CQDA 5I9EB 4ZITA 2R8GA 1QAIA 4DR2K 1Y9OA 2NR0A 2Y0SD 2B8PA 4Q2LA 1J5EJ 1YJTA 3CC2N 4Q0BB 1NSAA 2VFRA 1NSPA 4YS2A 4JEPA 4L3QA 3L4BC 2VJVA 4XTTA 3ID8A 4B3TK 3QGHA 3RRKA 3K0JA 2DFFA 5A8RA 1NK4A 4QWAA 2H65B 3M1FA 3U3GA 3BF1A 3EO3A 3NAHA 2P9UB 4PL7A 2ZD1A 3HFZB 3C14A 3AFGA 3U1LA 4FF2A 2IM2A 3OYAA 2VZ9A 1M5KC 5DDRC 4KBIA 2PA8D 2IJRA 2J7WA 2DXDA 2V4RA 3VALA 3SQ2A 5DQIA 5AJ3K 1HPZB 3OXGA 3UDCA 3PACA 3ENOA 3G9CA 4OI4A 3SBTA 3DC2A 2R2RA 3O4NA 4ILGB 1JQGA 3LQVA 3W1YC 3M32B 4BR4A 1REGX 3CJAA 1NK7A 4AE5A 2WONA 2NS1B 3SIPB 5LXYA 2XWYA 4ZA1A 3O3LA 3M3ZA 2YWHA 1WC4A 3C19A 2F8EX 5IT9Y 1FNOA 4W5RA 4RW7A 3VA0A 1J9AA 1ZOTA 3NKYA 2QWMA 4ANDA 5LJWA 3L2QA 1KOHA 4LF7F 2Q0UA 1CJKB 4GC7A 4ANEA 1HKBA 1WJ9A 4DF4A 4NLYA 4EGLA 3CMAN 5KFTA 3V4IB 4CE9A 4QWEA 4FNIA 5CCMA 1H72C 1T6DA 3QFPA 4DHYA 4C7QA 1PGZA 4DTUA 4OLBA 1JJ2M 5C24A 4CGJA 4GKKK 2IAJA 1CZ9A 3CCRS 3MXHP 2MKYA 1XWLA 4HT7A 4DV6J 4GY2B 1BQMA 3KK2A 5HRPA 1VLYA 4IUFA 4RKUC 2O8FA 2HNYA 5MLCV 4GKJF 1YRTA 3FRZA 2RDJA 1T9VA 2EG1A 3GR1A 4DB3A 4Z4FA 1BDGA 2FZKB 2HPUA 3DLKA 4Z4IA 1TQLA 1CZBA 1BHNA 4IDHA 1OSCA 3QIDA 1VBKA 3MEDA 3FE1A 2DY4A 2V9WA 5FJ4A 4K50A 2W9CA 2NRVA 3NGZA 4WFNL 3D45A 2AU0A 4B1WB 3OTBA 4ZPAA 5H1SQ 1HNWF 3NHGA 1RACB 3CPWR 4I64A 5F3TA 4DQ8A 1RBUA 2HWIA 3GOIA 2B7BB 3G8SA 2Q3SA 4CJEA 2ZOFA 3QEWA 3R97A 3KLFA 3T1HJ 4JS5A 3DOLA 2P9LA 2HZVA 3SV3A 3SMPA 2HIQA 1VRUA 1QVFM 3A2FA 3UR0A 4HWIA 1H7WA 1T6CA 2V5HG 3A8JA 4QIEA 1S1XA 2D0BA 3TTFA 3WBZA 3B82A 3W8GA 1BL3A 3OFEA 2VF3A 5HANA 2KB2A 4IYQA 2EHGA 3FGUA 3ATVA 3BN4A 1DFDA 4A8FA 2ATCB 1RAGB 1NOZA 3ULEA 4LFBK 1RBRA 4ZVHA 1F5AA 3V6KA 5IQ6A 4K4WA 4AILC 1U7LA 2CQ3A 1RBAA 2XG8A 4WYLA 1NU0A 2O8EA 2FVCA 5KG5A 3J81Y 3TX8A 2P9GA 4DR7K 1K9MT 2OJ3A 3LZJA 4ED4A 4EP4A 6AT1B 4PWWA 3QWPA 2ZBRA 3FSIA 3P1GA 4J8FA 2X74A 2KM8C 4J9RA 3GMGA 1QZ6A 3O9QA 1GLEG 1KVJA 5BR8F 4E0DA 1B0PA 2FJAB 5KOWA 3P8BB 3EZWA 2ACYA 2ZH7A 1BUPA 4HLBA 3KLGB 3G2XA 4OZJA 2QL7B 3UDEA 4BC4A 2IM0A 1ZBTA 1QE1A 2HKEA 3CERA 2G0JA 5ITHA 2EX3A 2GWKA 2A6OA 3MUTP 4OLOA 4ZDNA 4AUKA 2YCHA 3GFHA 2N3OA 4ZVGA 4CYUA 4RNOA 1X5SA 5BYSA 1HI0P 2HHUA 2W25A 4OHVA 4CJKA 1TVRB 2QKKA 2NUHA 1M5SA 2X6NA 2YWWA 4FJMA 4L3NA 3QETA 2YPZA 3VZIA 1YBAA 5K5MA 2G8WA 2I8EA 4KPYA 1NZAA 2YKOA 4KO0A 2I2YA 2MPUA 1W2BR 4IDKA 4M3ZA 4C8LA 5DJBA 1FRXA 5CHIA 5J2NA 3HT0A 1HHTP 3FQKA 3GILA 4K5RA 2AEJA 4P2SA 4BDYA 4JI7J 3L09A 2BW2A 4MDBA 5GINA 2JLGA 5HLFB 1VRTB 1XN9A 4KRFA 4WFXA 3GV5B 4CIFA 1A0OB 1DJ0A 4I7FB 2EXUA 3J81j 2PIIA 4LR9A 5KFJA 2Y0BB 3N5BA 3NOGA 4HHJA 2HRYA 3D0GE 3R5GA 4ZPCA 3H3NO 1LW2B 5B09A 3MECB 1MWMA 2G1HA 4LFAF 1ZAVA 1S6QB 3JQKA 4P2XA 4CJRA 4A8WA 2MLZA 4B3RJ 2DH9A 4CNZA 3F41A 3ULDA 5M1NA 4AM6A 3QT8A 1XR5A 4K4YA 1EARA 1D4XA 1MWZA 2AZ3A 2E4LA 3RG6A 5CYQB 2GC8A 2E7WA 1S59A 3DXKB 4HDGA 4IO1A 3D66A 3CCEN 1CJUA 1X4EA 4KI6A 4UY8O 1WUUA 1PYSB 4FJLA 2JX2A 4OZ2A 1B92A 1NBWA 1XHZA 4PAAA 1RAAB 3A5MC 1WOOA 3OFGA 5C5JA 3KD5E 4YN3B 1D1UA 1B0VA 1FT8A 4WKRA 1HWKA 2LVWA 4USKA 5IOLA 1KLMA 2WOMA 5B0EA 1T9WA 2MY8A 1UA0A 1Q7YT 3FFKB 3G86A 4ILHA 2OYQA 4WIQA 1ITGA 1B9FA 4DR1J 3DM2A 4RNMA 4EZ6A 5AQIA 3SSRA 3RYLA 3VGLA 4PXDA 3QEVA 1S1TB 3J7Z5 5B0FA 4HVJA 2OPQA 3ZO7A 3RB3A 4EIAA 3IDHA 5EX5A 4URQU 4C9DA 1SL0A 3MM5A 3PW4A 4N5SA 3IR5B 5CD4H 4IOCQ 3VV2B 1X4AA 1MWQA 4Q2MA 5GAEI 4RR5A 2WHOA 2KM8B 3EUNA 3GIJA 3P5JA 4B02A 5AQTA 2IC3A 2YHXA 3HOTA 2ILZA 1Q0NA 3QJLA 1H0HB 3GIIA 3KG4A 3H1QA 6FDRA 3BSCA 3NOCA 3R5BA 1FRIA 3BH6B 1RT3A 2VPYB 3EE9A 4CFAA 4KE5A 4EBCA 4NYNA 1RFQA 2B9YA 3OL6A 5A0YB 2WBNA 1RHQB 3I82A 1FHTA 4B9UA 4NLXA 2K06A 5KT2A 2VC0A 2NZ4A 4DFMA 5FPNA 2ITMA 3UI3A 1KR4A 2AMCB 5DM6Q 1ASUA 4DSEA 5J1EB 3UNYA 4FPRA 3LM9A 2JGUA 2BUNA 3R2CJ 2GMHA 2FHJD 1XMQJ 1DHMA 2VICA 4C8OA 1CJVA 3D7EO 1MMDA 2D7SA 3BKFA 1FKPA 4KH6A 3OYCA 2RHQB 4ZCLA 4M3TA 1BGXT 3DNCA 3N4WA 1H7XA 1RADB 2BQUA 5B0CA 4FS1A 2HQFA 2ZVSA 3C6AA 1CPZA 1VFJA 3IA0A 1S1VA 1N54B 3AO3A 3QO9B 2CPIA 3OTDA 2OTLN 2E5HA 1K6YA 3CC4S 5KT7A 4GVEA 2W4CA 2DHHA 1FKAF 2BE9B 2B4JA 1HR0F 4FWQA 4H5NA 1OWXA 3K5NA 3HKZD 2GAHC 2DGXA 1CULB 4ZP7A 4V1Ak 2EKNA 2XRIA 1Q81T 2VBWA 4R8UB 5LSRA 1U49A 4F4ZA 1U1RA 2HF4A 5GMDA 1B3TA 3TTCA 3T1AA 4CLSA 2Z56B 1QD1A 3NS5A 2CJKA 1VQYA 2MTLA 4OX8A 2BM0A 4CGHA 4H4OA 3D67A 4PUOB 3W64A 1V5VA 4BRDA 2MKKA 2OPPA 3MPYA 3T7ZA 2QL5B 3LDLA 3ZYYX 4DU8A 1OYDA 1NJIO 1FWKA 4P7VA 4O3SA 5C7PA 1QSLA 4J2EA 3MD1A 5JS1A 2XSJA 1J54A 1W97L 2LQ9A 1X4HA 1NLKL 5HMZA 2EBEA 2VH7A 4CJ3A 2J8AA 4PG6A 3PXGa 3G82A 1YVFA 2Q79A 1U1MA 4OX9K 4JYAF 2X1GA 3V4MA 1TL4A 4E89A 2IRUA 5F8NA 3TJAA 2DHSA 4BCAA 2ZWHA 2C2OB 4JI8J 2HRTA 1J27A 1GMWA 3HTVA 5HAOA 1J6ZA 4DUZJ 4HTLA 4NZ6A 3Q2TC 2IYGA 1YDLA 3CWJA 3OW2R 1K0VA 2DRBA 1YRUA 3UD3P 3MMCB 4DR6F 2DTUA 2E2NA 3CCJS 3R7BB 3Q8SB 3E9OA 3GP9A 3LWMA 1U24A 2J6SA 3CM6A 1HFEL 4I6YA 4DCPB 4AHVA 5JVGL 1RTDB 4OZ5A 3H2VE 4TU8A 2J5AA 2RT3A 5L1LA 3I0RA 4EYIB 2HBYB 3D7SB 4BACA 1RZMA 5A6PA 2VFTA 2CG8A 5AT1B 4CZIA 1RILA 2BE2A 2Z1HA 3GIKA 4CFBA 4PXEA 4TU7A 5E3PA 2P9CA 2HNZA 3AVCA 3A5OC 1L3UA 1HNVA 2J76E 5KFFA 3PSFA 1X5OA 1K73O 3FC9A 2FLPA 4XDDA 5KFMA 1NJZA 4K42A 3US5A 3L9ZA 1FRHA 1C0TB 1DTQA 3TEHB 1WG5A 3S41A 3NP5A 4U6PA 5KPZA 1U1QA 5AQUA 2XMKA 2UUWA 5F3ZA 1RDAA 2ZH1A 3OVAA 3TNVA 3CD0A 4YB1P 3KUGA 4UZCA 3A4TA 5A2QY 3UKUA 4IOXA 4CLPA 4I2PA 2LLZA 1NDPA 4CD3A 2GELA 2H5IB 5KFSA 4OYWA 5L1IA 5K14A 2LCWA 1WAJA 4BREA 2W7AA 2C3PA 1NK6A 5HATA 5KAKA 4Y6IA 5A8RB 4K0KJ 1RDBA 1NSKL 1FK9B 1MG7A 4LQ9A 5HMYA 2ZD1B 4KTZA 4H8KA 1QJHA 4FWLA 1KQSR 4PKIA 4QJVA 3TVZA 6FD1A 5E3QA 3MOZA 3M1VB 1X5TA 4Z0UA 1RBTA 4CI6A 2M7SA 1FDDA 1FJGJ 1YBUA 4U7UK 2OMLA 1UFWA 3L8BA 1NRKA 4HEA9 3R5AA 4JKGB 1FRMA 2DGWA 5F8JA 4O3PA 1PO6A 4QOTA 1OH6A 3OS2A 3GJTB 3RU0A 2UU9F 2WONB 1GXUA 2V7YA 4ID8A 4H54A 3LWLA 1T3OA 1MWKA 1RHRB 4P73A 4FWMA 4RW7B 1IKVA 5KGXA 9RUBA 4CTAB 5JVHQ 5EY4A 4WFAL 3ZTOA 3K9JA 4R0EA 4KH5A 2F8HA 2Q2RA 5KI6A 1U1NA 2KLAA 4FJ8A 3RB4A 2QWRA 1QAJA 4ECSA 4OZ1A 1Z2ZA 1OVQA 3OTEA 5LM7E 1FFGB 1LK7A 3CW2C 4KRWA 2HZAA 5C24B 5DDPC 3DDIA 5DK5A 1ZAWA 1FDAA 3DLJA 2GVDB 3DDKA 1TELA 5KFBA 3NY0A 3AVIA 3S3OA 2LEPA 3A3PB 1VLOA 5KPRA 3PRBA 1FTRA 4FXDA 1KC8T 2ZNYA 1YI2S 3K58A 2O8FB 3LPYA 2HNYB 1UOCA 3VTIA 2P8IA 3DOMA 4N76A 5D0GA 2E8AA 2F4VF 5KOXA 3DLKB 3GL1A 4XIUA 1X4BA 3Q0AA 1WACA 1S0OA 4ZP6A 4DV2F 2W9CB 4YR2A 3L3VA 4JD2B 3KLHB 2C3UA 4ZCIA 1ZM3A 2EC0A 3Q8UA 4BVPA 3IN5A 2B7CB 2ZUGA 1FXDA 1DLOB 2CPJA 1VK8A 4J7CA 4C2MA 2DNPA 2UYTA 4CIOA 4FLYA 3OYKA 2U2FA 3EE8A 1H74A 3GSDA 4LQ3A 5IV3A 4HDHA 4NLPA 1VRUB 3CD6S 1HJRA 2DNOA 3W9JA 1TTHB 5C25A 4AHSA 2IVYA 2XLJA 4EFHA 2HHHK 2O1PA 4ZPVR 5KT3A 4X64F 2I1RA 3QFWA 1DGKN 4DV4J 1HWIA 4QYZJ 2O8DB 4X62J 3IG1B 1HPMA 1RWKB 4ZPTR 1LK5A 3QWUA 5LMUK 1EKRA 4FWSA 2CJXB 1TL7A 1IG9A 3E8OA 2OA8A 4KFBA 2DH7A 3X3UA 2ZC4A 1YAGA 2Q6CA 2ZM6K 4LRCA 1UFKA 2VFVA 1UMJA 4OLAA 1VHIA 1N0UA 3AT1B 3EMTA 4FZVA 1TKZA 1QVGR 1W26A 4R79A 5FPEA 3M2UB 4BC9A 1XMOJ 2F65A 1C1CB 3NLCA 1JLBB 4W92B 1NBEB 2MGZB 2DH8A 4JN4A 2ZJRL 3AY9A 1JCEA 2JZ5A 1AZSA 1FCAA 1OY9A 3M30A 4KV8A 3AJ1A 5K20B 4ECQA 4FWPA 3W8PA 2YNIB 4C0HA 3CJ8A 4USJC 2P5GA 5MAOA 3J80U 2DY1A 2MQQA 1RGVA 1UJ5A 2QE5A 3NNCA 2LFVA 3CJ7A 4JAXA 2OPRA 2DNKA 3BQ1A 4PPZA 3U4LA 4KKOA 1F2GA 2LDIA 4RUCA 5CZVA 3B6PA 1WC1A 3CJQA 1SJ3P 4H5TA 4BDZA 5IT4A 1LW0B 4IDKB 2CJYB 1FKOA 2YHBA 2VIHA 1VSIA 3W3SA 5J2NB 4F2RA 2ITGA 3FEYB 3VQEA 2Z4PA 2R42A 3BR8A 4NCGA 1IXKA 1SV5B 4KB7A 1N34K 3CM5A 3VHQA 3JSMB 3I5CA 2C2NA 4MLHA 1YTAA 4ZHRA 2ZJQQ 3MFIA 2ADBA 2E1CA 2VWJA 4ETZA 4ZKAA 2D3UA 2PD1A 1GLDG 3QATA 4OFZA 1IWAA 4CZFA 4P74A 4IFYA 4QBUA 3G96A 5F0XA 4CO0A 2WK4A 2MZRA 3QGIA 1RBVA 5KFPA 1ZZNA 2FGCA 1SKSA 3NF8A 1N32K 2I6WA 4EWTA 4FJ7A 2FZGB 1N52B 2RH3A 2ZKTA 4DTOA 3MMJA 4FCYA 5CQGA 4YOXA 3MEGB 1NK5A 4JV5K 5E2QA 2XWXA 3C15A 4I0WA 4ZCKA 3TR5A 4OI0A 1CJUB 2NZTA 1XNQK 1HLUA 3PIOL 1U8SA 4ZIWA 5IWAK 3QZ8A 4ANCA 3R2DJ 3HSJA 3ZFVA 2HBJA 5HP1A 3R9PA 2OSQA 2KHCA 4WZQA 5HVGA 2JEIA 4O5BA 2XMAA 4RCHA 3CT9A 3T1YJ 1WB9A 3O9RA 2WOMB 2RHSB 4HR2A 2C1EB 5HL7L 5JVGQ 1BQNA 4ZMMA 1JXVA 2WAQD 2ROEA 2KG0A 1R43A 1S6PA 3QAUA 2A1SA 1RAOA 4E2FB 1S9GA 5E5NA 3PX6A 2UXBF 1BCMA 1NU4A 3OBYA 1UJ4A 4HUEA 2HMPA 2XHBA 2OPQB 4FKXA 5IT0A 3NGTA 3CMES 3CFOA 1NB2A 2H3GX 3SLCA 2CAJA 3MM5B 1MNEA 2CQHA 3TO8A 1GMWD 2MLYA 2LXFA 3MR2A 2EEYA 2A3JA 4LF5J 2IC3B 4N8NA 3WX8A 5LY3A 3THYA 2MKHA 3I6PA 1SJRA 1HQEA 4IOAL 4IRDA 2GWJA 2MXYA 1SUQB 1C0FA 5JMNA 5M1OA 4CJSA 4DPWA 4OZLA 1OJ4A 1T94A 4JP8A 2HWTA 4G1PA 1RWNB 2UV8G 2Z8QA 1VIXA 3VQDA 5KT5A 2O4IA 1E4FT 3M6UA 1WSJA 1WI6A 1PCAA 1YVUA 4TSXA 2V51B 1NJWA 2DEIA 3SUQA 4GO5X 5LL6d 3SFGA 3A3NB 5AE3A 2NYIA 1Y10A 4B3MJ 3H98A 1N36F 1S7HA 2JHEA 4F50A 4Y3CA 4DV1J 4ZJLA 2UUCF 4IRKA 1MN7A 4ATNA 1FKPB 5LMNF 4NLRA 2GV9A 2QA1A 5EX0A 5THWA 4BR0A 4ES2A 4NLGA 1VK0A 3K5LA 4XK8C 4DR5F 1S1VB 1JLAB 5CH7B 3TAEA 2JL9A 4DQPA 1NXIA 2CA9A 1A5VA 2Y8YA 2E20A 1S57A 3ISNC 3KHYA 1YZ7A 2HVZA 2O4GA 2UXDF 3U1MA 1S76D 1V9OA 3CCRN 3PYFA 1B70B 1S49A 3M7VA 5CR4A 3EXCX 4CO3A 4A2BA 3NMAA 1RT4A 5IT9U 2HAFA 4WP9A 4KHPJ 3QQCD 1N33K 2FSJA 3PG9A 3PX0A 1BLUA 3WXLA 1U2FA 3HI9A 1WHWA 5ETOA 4G3IA 5EOYA 2O8CB 1HNXJ 1G15A 4A8KA 1UWBA 3EXYA 4F0KA 1S4EA 2OPPB 2E88A 1ZTWA 5AQRA 3N4PA 2GHWA 5HVFA 3VCDA 2IRYA 2HNDB 3T5JA 1S1WA 3L2WA 4LF9K 5EWFA 2XSJB 3MF5A 3DJCA 2ZUAA 3R3TA 3LDNA 4F26A 3N6LA 3JS6A 1W7WA 4JI5F 3G82B 1QSSA 2QN6B 1M1KT 2XYPB 4FPIA 4UOGA 2X1FA 4PG7A 4DV5F 1WHXA 2CXEA 1UA1A 1P1TA 3MPUB 3ZZ0A 2NLXA 3L3UA 1U25A 4YOYA 2CQGA 1PILA 1DZ5A 4M5JA 1VQPS 3KMQA 4BHQA 3DGVA 3TOQA 1RKIA 1N5TA 3V9UA 3M4XA 1IWGA 2XB2D 1U0SA 1YHQS 1HBOA 2X6SA 4JI2F 1YJNS 2P6TA 2JLEA 3AAQA 4S0MA 1NKCA 2QLXA 3JAMO 1WC0A 3DLBA 4JI4J 2QXLA 2ZQBA 3V6DA 2A40A 2H5JB 5F0UA 3SPYA 3GYGA 1RISA 1VSDA 4L8RB 5K8OA 5HRNA 2QWLA 3MCSA 3ZZTA 3KK1A 3PLAA 1XMBA 3I0RB 4H4MA 2NNWA 5DDOC 3MDQA 4ZLNA 2EK6A 2BE2B 2YJEA 3AVGA 4WFBQ 1HWLA 1B99A 1S22A 1Q7LB 2A6MA 3IS9A 4ZP8A 2YNGB 1P9QC 4WTOB 3S01A 4EFAC 1HNVB 1P27B 2QK9A 1LFWA 3ONQA 4C3KA 4WU3A 4DU4A 1S5ZA 3J81U 4LH4A 3CGIA 2ZHAA 4OPJA 4AQYK 3QJPA 1VJWA 3HXMA 4ILRA 2XMVA 4CJLA 4ELUA 3VF6A 3P39A 4DSIA 5KFKA 4ECYA 2J0XA 2AYBA 1AW0A 2HGMA 1EQYA 4NXMF 1VQ8N 3DLEB 4FF1A 1SJ1A 3G6YA 1J5EK 2OI2A 3UKUB 3ZLJA 1I94J 4O3QA 4I2PB 3D1OA 4B1UB 3QRRA 3IAYA 5T7LA 2RPIA 3RMAA 1J5OA 3L7UA 4BR9A 2OAUA 4Z4CA 1LXNA 2QV6A 2KVQE 2RRBA 4CERA 3TW0A 3LALA 4FK2A 2CUYA 5CHCB 4XH4A 3MFHA 1S7IA 1NGJA 4X65J 1S4FA 4CFCA 1BHLA 4YDXA 3PHTA 1URRA 4IH7A 3I0SB 4B3SF 5GAHP 2CQIA 4CT9A 3M8ZA 4NLQA 4RW6A 3LP1B 2OEKA 1BA1A 5B0DA 4K25A 2BX6A 5CYMA 1ULRA 2F9TA 2E1AA 2ZFHA 1KVCA 3O8MA 1UKUA 3MN9A 3J7AN 2GS8A 4F7VA 3G8TA 2GVZA 4DL6A 4LSLA 3KHHA 5KFNA 3THXB 5G0RB 1N88A 1C2PA 1NGEA 4JI6J 1QLNA 4ECZA 3FBCA 2ACMA 4JKDA 4WP8A 4WXOA 3M6WA 2EBGA 4W5NA 3UCGA 4ZN3A 3CJBA 3ZNJ1 1VBYA 1M0SA 4E7JA 3O4QA 1PC4A 4OKJA 1YT3A 5BR9A 1U04A 5AFUH 4E1JA 4DV6K 4MFBA 3RSEA 1YQHA 3OLAA 2MQOA 4BRHA 1RBSA 4DQQA 2ZWOA 1CJTA 4I1TA 2R8JA 1R6VA 1YLXA 5HMXA 2BKNA 2QG9B 4F2SA 2IIHA 2VOPA 1PJ6A 3P49B 4CZMA 4BRAA 1FE0A 4RL1A 4DV3J 1RNHA 1MROB 3MZIA 4YOTA 1GQEA 1U48A 4KGVB 2CJ9A 2RNEA 1F9FA 1C1AA 3CI5A 4DTRA 3QAEA 4DTJA 2G9OA 4NA1A 4RW9A 2OKQA 5DG9A 1FTCA 1F6TA 4X4PA 1QS4A 2AJ2A 3T1HK 1QAXA 4Z2XA 3FZKA 3EJMA 2Q3PA 2IMWP 3CTRA 4GNIA 2AJ4A 3U02A 3RWUA 4ILJA 2UV8A 2GW8A 4UY85 3FRYA 2VBZA 2ZGYA 2XLIA 5FDLB 1OMSA 3DXMA 5D0EA 4FS2A 1UAWA 1SJFA 3PVXA 4CHYA 2OEMA 1RUSA 4IG0A 2RKIA 1HIYA 4KH4A 3I8DA 5D0HA 3A3OB 2JVOA 1UAXA 4J9LA 3TU5A 1C6VA 1U2RA 3VGMA 1KNZA 4RWTA 1Q78A 2QMUB 4PCQA 1HBUA 4E8UA 1OQ6A 1UVJA 3PIPQ 3J7A1 2XC9A 1OKJA 4CO5A 1M1HA 2FJVA 1D9DA 1CC8A 3LP2A 1TL7B 3A8IA 3W2VA 2L41A 3ZSRA 4WTYA 4M94A 5IM0A 3CC4N 3FZLA 2GO9A 1NPKA 3HT3A 4PKDB 2GX9A 1LWCA 4NEZA 4KGXB 1ATSA 3KLEB 4M5IA 3MCAB 1TL5A 3C6TA 4RW4A 1K47A 3RMBA 3VGUA 3AARA 3TA0A 3E01B 2QA4G 2ADCA 2HMIB 4ZTFA 3H20A 3M30B 4CF1A 1N5QA 2YH1A 4KV8B 1HNZJ 3UE5A 1JKHA 3H5XA 4YOWA 3ETMA 4C8ZA 3OR2B 3FZ2A 1IBLF 1ELOA 2HHTA 3RTVA 1G7CB 1C0MA 3BGOP 4J2DA 3DLRA 3NF9A 2OPRB 3VEWA 1VHFA 4DTSA 5F41A 4KKOB 3SQ4A 4P75A 1WDDA 3CJ4A 4HKQA 4F04B 4RNNA 4TNOA 2PYJA 2R7RA 1C0UA 4FJKA 3D54A 2NQPA 3DAWA 1TR0A 1S1UB 3TJ9A 3BGRA 1XHXA 1X1PA 4LR7A 3SBMA 1P9YA 4JI7K 4BRNA 4IJAA 3EN9A 2RVJA 2Q1NA 3S6EA 1K1SA 3SFUA 4U96A 2KFZA 1QZ5A 4Z7CA 4QZVB 2D74B 5AQGA 3RR8A 3B4MA 3OBIA 3MX2A 2G8VA 4ZHRB 5C2CA 4YY3J 3M05A 4L76A 4IWVA 4YMEA 1Q8LA 2I7NA 1OH5A 2XHWA 3QB0A 4FPAA 3CCJN 3SQ1A 3LDQA 1RWXB 4IFYB 4OI3A 4B3RK 1Q16B 1U09A 4DTPA 3H8YA 2R7UA 3AV9A 4YB7A 4CNYA 5F9NA 3CSKA 5B0GA 2FD2A 2XMUA 3U1NA 1FRJA 4DV0J 1YUWA 2JDJA 4U7UD 1RWVB 4OI6A 2DHXA 1KLNA 4YFUA 2UUBJ 3ATUA 3ZC4A 2VWKA 3C15B 1R7IA 4AFFA 1RSCA 3I32A 2W24A 2DRDA 1JL1A 3V81B 1VAZA 1V6HA 2QXFA 3TZWA 4KAZA 1WKKA 4WQ4A 2ZH2A 4B1ZA 1K8KA 3IFEA 3IC1A 4NLDA 5BPNA 2E7VA 3KTQA 2HK2A 3EM1A 1V3RA 5KGWA 5CXTA 4FYWB 1NCLA 1VK3A 4DR1K 3IBCB 1S6PB 5HQMA 5EXWA 4BE1A 1S6UA 4WK1A 1S9GB 2F4FA 4OYIA 1Q9XA 2AF6A 3VAIA 3D9BA 3J7YP 3NEKA 2RAQA 3I55S 4DMZA 1KAXA 1T95A 3HO1A 2HBMA 4X4QA 7AT1B 3U8XA 1S97A 4ES3A 2CPDA 2DVIA 2GHPA 4O0NA 2BM1A 3AVJA 4NYPA 1NSQA 3M9NB 3S3MA 1HMVA 4RBTA 1YTYA 1RHMB 2OFGX 1EWQA 5GMEA 4KHUA 3P6YC 1JJ4A 4CBXA 2B8QA 3NMRA 2HBLA 1JXBA 4DLEA 3Q7BA 3LOUA 4M45A 2LQ5A 3KJFB 5A2QU 1Y5IB 1LWEA 2W7OA 3HHLA 1PAEX 4XAKA 3PR5B 1XC3A 2ZH9A 4XDCA 3IGNA 5L1KA 3AXMA 4HUGA 2VG6B 1YRXA 3HFKA 1KD1O 4LFCJ 2BJ9A 4A2AA 4XPCA 4M8LA 5KRSA 5F0WA 1ESVA 1XMQK 2IA0A 4CZGA 4NXNJ 2YBVA 3FBBA 2XLKA 3Q23A 4B08A 1NB7A 1WOSA 1G1XA 2B5JA 1AB8A 3MI7X 1YJUA 3K57A 4DPYA 4PG4A 3TSUA 2F8MA 3ET6A 2CWXA 4ICLA 3F5TA 4NCBA 1H73A 2P5OA 2VFUA 5FLXU 4M7XA 3H3OB 4DX7A 4CEOA 3W66A 3M9MB 1K9MO 2VKZG 3LDPA 4NRUA 5A8KA 3O6WA 2C3YA 5FRMA 2AJ0A 3SCKE 4UTGA 4B9VA 4WXWA 1VDHA 1HBNA 3C95A 1N0VC 3HP9A 2YNFA 3J7YU 1YVNA 1YI2N 4YDDB 3GE9A 1W0HA 1BI4B 4A57A 2AGOA 4A8QA 3RVCA 4CESA 4O4GB 4GVLA 5LOQA 2CWKA 4CM0A 1UWBB 3DLHA 2M52A 4D3HA 5DQGA 2ZHOA 2LECA 4BLGA 2KZZA 3THWA 3UKRA 5GADU 3G25A 4JHDA 3KD1E 4LC9B 4NOHA 3OTOJ 2QT7A 3I9V9 3KHGA 2KT5A 3I8BA 4CJQA 4ZS6A 4DX5A 4JI3F 3QLHB 3FEXB 3TAQA 1HNIA 1IR1A 2Q0RA 2DNGA 1HD1A 2EK1A 1N5SA 3CD6N 4YEAA 3RB0A 2VPXB 2GNKA 2L9WA 3CFRA 1LQ9A 1JNZB 2E5LF 1T05B 4F36A 2VDIA 3UQSA 4JI8K 3P45B 3OYGA 2Z1IA 3NGSA 3ZNUA 3P38A 4CEBA 5KG0A 4DR3F 1RTJA 3EVWA 2QIFA 2YPYA 4DUZK 3LA0A 3NGKA 5IC6B 3BSAA 3NS6A 4LF1A 3M2VB 5JS2A 3BSOA 4FLVA 3ZZZA 4FO0A 1K0TA 2MY7A 1HBOB 2CADA 1HHSA 2VB6A 4X4SA 2ZNZA 4GV9A 2JC0A 4JI1J 1RLDA 2H51B 1H38A 3AA5X 3B54A 4FW2A 4C0OC 1BA0A 3DLGA 1RJJA 3V6DB 2AT1B 3OJSA 3HVWA 3V1RA 3ZTRA 4A59A 1WSVA 3GYNA 2Z2ZA 3NRBA 3NXZA 1XNRK 2GJ2A 3W2WA 2H54B 4ZVQB 1U0HB 1U45A 2HVHA 1FEEA 3JTNA 3BY5A 5AZIB 5HSPA 1TL1B 1YTUA 4TLQA 2W6KA 2DNQA 2YNHB 5AR0A 2EFOA 3PW0A 3MN6A 3THVA 1YWXA 3WIVA 2CZVC 2ASOA 3RAXA 3ILIA 2Q31A 3VESA 4E1MA 4Y2AA 4FZYA 1WC6A 5B08A 3VMFB 3VQ7A 4BRFA 1KONA 2PI4A 4LR8A 4LF4F 3OSPA 2EWSA 4BY9C 5KFVA 4O55A 3IBWA 3EDRB 4JB8B 3CQXA 2AKWB 2IGIA 1W9HA 2AYEA 3OHRA 1KKHA 3I56S 4DMNA 4B1VA 2W01A 1VQLS 4FJIA 2P9PA 2P9SA 4R0JA 2APOA 5AXKA 3WNGA 5HQ8A 4FJ5A 3T69A 4JI0F 3FCWA 3RZAA 2OIHA 3CDBA 4M42A 1IKXA 3FZBA 1VQ5S 4CHZA 2G8HA 4CZCA 4CJ5A 2DNNA 5D15A 1LWFA 4HHUA 1J5OB 2HGLA 2GUPA 4K0KK 4YDUA 3BKUA 3DXBA 1SQEA 2BZ2A 5EHHA 3NCIA 3ZX0A 3IRXA 2D4WA 4JKAA 3VQ9A 2B4UA 4PR6A 2VQFF 2KRRA 3VERA 4ED0A 3KG0A 4XO0A 1F9HA 3MEEA 4LT6A 2W2PP 2WC9A 1JMTA 1N8RT 4JV1A 3WC2A 4DSLA 4CT8A 1FJGK 3S9HA 3JSRA 5A8WB 2CGKA 4NZ0A 1WHYA 3QGPA 3GJQB 2DT9A 4EUVA 4PQUB 2ZJPQ 4H4KA 4FVCA 4RW6B 3U7JA 5E26A 2M2BA 5J2MA 1BIUA 3AD9C 4LH5A 1DBDA 3MURP 4GV6A 4C8YA 4JBCA 3WXIA 1GAOA 1RB0A 4BRLA 1FFSB 2IBKA 4LSLB 2CRLA 3S7RA 3IBFB 4CBWA 2POKA 3ILLA 5DMRA 3SV4A 5H9FJ 1NHKL 3ICLA 1TFWA 4PYAA 4OYXA 2RDDA 5DETA 2GEMA 4UW2A 2IYIA 4DQRA 1RWPB 4ZVEA 1KHVA 1MU2B 1F3FA 3JXUA 3KWIA 2A1RA 4X4UA 2VU5A 2HFVA 2LA6A 3VVUA 3H45C 2M9KA 4BBYA 2RS2A 3FEZA 3RSEB 2J7UA 4E7KA 4LF7J 1NGIA 1RAHB 1WSEA 3CMEN 4QW8A 3IR7B 1XEZA 2HS0A 4AL6A 4IJNA 2DGUA 4NA3A 5BJRA 1FXXA 2CQ0A 2EVZA 2EPIA 4UUWA 4DR2J 1ZA1B 5KFXA 3ZSXA 2OH2A 2O3DA 1A5WA 3TQ1A 4HI2A 1SC1B 1X7VA 2SXLA 4NMLA 4WCEQ 2A42A 4HYKA 1YG0A 1WEZA 3MEKA 4DUYF 1C4AA 4GKJJ 4BG9A 4DU3A 4IFVB 2GCFA 1YKWA 4DCJB 2NRWA 3M2RB 4CF9A 1R31A 2V4QA 5BXIA 3AHPA 2PE8A 2RILA 2F9JA 1X9MA 2D3ZA 3UO0A 1RT6B 3DXMB 4DV4K 1HNWJ 1M5OC 4QYZK 3HHEA 1E6VB 3KMSA 3SAHA 3D2EB 3GE1A 4WQ4C 4JKFA 2MJUA 2H48B 3FMBA 2JRSA 3B6BA 4X62K 4JKBA 1RWUA 2V94A 2BRKA 1HYSB 4FK0A 2HFZA 3QT5A 4FM2A 2B4OA 2WVDA 3UVJB 4EU0A 2X1AA 3G4SS 1CBKA 1HBUB 4UY8T 1KAZA 4OYMA 3CUNA 1SI9A 5F8LA 5EN1A 1IH7A 3LP2B 5AQJA 3RW6A 4X66F 3W2VB 3P83D 1NK0A 4C8NA 2Q97A 4RW8A 5TKYA 5BRHA 1KCFA 2KQ2A 3I33A 3OHAA 7FD1A 1IJFB 3K17A 2NLWA 3HF5A 1XMOK 2P9NB 4LF6F 1D8ZA 5T41A 4M3RA 5GVQA 4RX6A 1N5YA 2HQDA 3DLLQ 4CLLA 4YR3A 2FC0A 2AGPA 3SBGA 1EB0A 1R8CA 2PAVA 4WK3A 5F1XA 1SH0A 4LREA 1X9WA 1TK0A 4BR5A 1IBKF 4I4BA 4DV7F 3QNOA 1HI8A 4U67Q 1R8AA 1GX5A 4NLVA 2GQCA 1SJ4P 2E2PA 3DFEA 4BGBA 1HKGA 1Y64A 1HHQA 4B9LA 3FUYA 5JMVA 4A5BA 1T11A 5BR8J 4I6MB 1P6TA 2O5DA 5EWEA 1D09B 1MMNA 4AHRA 1FVQA 2XO7A 4O0IA 3HHLD 4G65A 2MKIA 2AEFA 3J7AP 4ID1A 1HLWA 1QSYA 4DN9A 4OLPA 1SH3A 3H08A 1RWMB 3ILJA 4QWCA 1LWXA 1TK8A 1C0UB 2AJ1A 2YKAA 3PFEA 3BGRB 1Y11A 4CJFA 1W7AA 1CXQA 2PT0A 4DTXA 2WSCC 2E66A 2EKYA 2AW0A 2R4FA 4ECRA 1JCGA 3BZQA 1YHQN 2OP5A 3WNHA 1RU1A 1HQUA 3KHLA 2B6AA 4ZCMA 3CDWA 1RA6A 4C11A 4TY8A 3R7SB 3W65A 4EBEA 3HRGA 3R5JB 2W6LA 3DRYA 2UUAF 2LU1A 4LF2A 2W7PA 4BQZA 1NJYA 3AA4A 3T9NA 4CLKA 1IKWA 1RU2A 4IEEA 1IM6A 3TUZC 2Y1LB 2CYYA 3ZZUA 1BWVA 3WNEA 4J91A 2HBQB 3AQOA 2C2DA 5AQSA 2CZ9A 2VONA 2K2PA 2IMOA 4ZLJA 1C1BA 2VQEF 3M8QA 1BMQB 3QBWA 2QA4S 1L5UA 4LFAJ 2JLFA 1FDBA 3R5CA 4DTNA 3IGVA 1NK9A 3KK3A 1LXJA 2YX6A 4O4RA 5KFAA 4O0JA 3CQYA 2MZSA 3VGKA 1EWRA 2ROPA 3T1YK 3R8YA 2R3VA 1K8KB 2W8KA 1JIHA 5SZTA 3WHIA 4OJRA 3FJ2A 1RAIB 3DGPB 3L7OA 1EQ0A 4F3MA 2Z0GA 1D9FA 4A47A 1SXLA 3AB4B 5I3PA 3WEEA 3C6UA 3KUEA 5T14A 2C3MA 3GB0A 2QM1A 4MKAA 1FESA 4QIGA 1SL2A 4YHHF 3NF7A 3VF4A 1KC8O 3CJRA 2AP1A 3VWSA 3NGDA 3IR6B 3VQBA 2VPWB 1VCTA 3MXMA 1RTIB 4J9OA 2DR6A 2XY7A 4DSJA 2HLUA 2YWKA 3HVTA 4LF5K 2ZZNA 1ZETA 3FFIA 3SNNA 1DQ9A 4IRCA 4ZPDA 1O51A 4NASA 2PEHA 4I6WA 5RUBA 3VGSA 5F8HA 3E2EA 5J1NA 1ZBIA 1HMVB 3OD2A 2D0PA 5CABA 3JYTA 4PKGA 3O5TB 4H5RA 3MM7A 1Q86O 1F3VA 4U7BA 4EO6A 1LWEB 3DRSA 4GMJB 2FBYA 1L3TA 2VGMA 1NGFA 2Z1GA 2KXNB 3FBEA 3CCQS 4ECXA 2V50A 4Q43A 4IOCL 4B3MK 2FJWA 2HQCA 1S10A 3GG4A 1LOUA 5CA5A 4DV1K 4G1QA 2V0NA 1Y4ZB 4M5MA 4LBPA 4IQMA 2RQKA 4BC7A 3K5PA 5FPDA 4A8XA 4OO1J 4C0BA 4OKKA 4KHQA 3CO0P 2HYIB 4IO9Q 3VN5A 2MHNA 3DOKB 3N9UC 2P9EA 1T9TA 1VSFA 1CLQA 1KFSA 3P31A 3TQEA 3ET6B 4ICLB 1OS5A 4Q8FA 1JLCA 1K1QA 5E3CA 4CRJA 4CO4A 3ZETA 4AHUA 2A18A 3QICA 1RAFB 2MKSA 1K73T 2NRXA 3P4IA 2I7PA 2NREA 1ROFA 3CCUN 2E1RA 5DM6L 4KHPK 2QTDA 3QEPA 1OPIA 4YDUC 3T5KA 3DCAA 1OH8A 4BG8A 5K8NA 2VCPA 1IQZA 2GIRA 4K4VA 2W8LA 2YWGA 1RHKB 1HNXK 2OZSA 4PXBA 1M90O 1VQ7S 3TWZA 1XJWB 4PPDA 1X5PA 2VDHA 4DDFA 4FZXC 3AXKA 3HZEA 2YY3A 2K3KA 2LEBA 2FC9A 4CEEA 4W5TA 1IM4A 2DNHA 1HR0J 1U8WA 3K5OA 1WG4A 4DR4F 3GONA 3PKMA 4DPXA 1VSMA 3KHRA 1OQ3A 3AGRA 4H4KC 3BR9A 2BANB 3EX7B 2C2EA 1WTBA 2PY5A 3W3DA 2QWQA 2JWNA 1WSHA 3OR1B 2MKJA 2CPXA 4B17A 3CC7N 2UXCF 5A76A 2KO1A 1Y3KA 3W61A 1H2UX 2B51A 1H3DA 3SXLA 4G6VB 1FNXH 2CH5A 3QERA 3SCXA 4F67A 3C16B 1S6OA 1GLFO 4LIRA 4BWMA 4C1NK 1WKJA 3TUJC 5I42A 2V8DA 1TL3A 5EUHA 1SPBP 4KHWA 4DR2F 3E1YA 1ZPVA 2DGSA 4CH0S 4F02A 3U3YA 2XY8A 4JI4K 2H1YA 4I68A 4QPXA 1FE4A 3UNGC 1GMVA 2NCKL 4B3TF 4JYAJ 4FKYA 3MPWA 5HK4A 3L2RA 2DR5A 5L38A 3EY1A 5IV4A 1EXQA 2V8VA 2V4JA 4H0PA 1WEXA 1BOTO 1KDNA 1UETA 1OY8A 4K4ZA 1EQMA 2EFNA 3W2WB 3QEIA 3W9IA 4CIEA 2FY8A 1RT5A 4QWDA 4P6QA 2G2OA 4FLUA 3GSIA 1RBOB 3VGVA 2G4BA 2CIMA 2B4PA 4RU2A 4NI2B 5AJ3F 4DR6J 1SC6A 4DS4A 2QJ3A 5KFLA 4EBDA 4CF0A 3HSDA 4Y2KA 1R8PA 2HHPA 1TKXB 4F0MA 3GLJA 3D2FB 2VG5A 2B9XA 3I5AA 1TKDA 1Q1KA 5KFOA 3SQ0A 3K2YA 2R9LA 1LAVA 2MHEA 4C3LA 1GLCG 1ZBFA 1SS6A 3MN5A 1YGYA 3MWTA 4E7LA 1HARA 4KHNA 1IG8A 3HCXA 1ZC6A 1KBRA 3A5NC 2QEXN 1T02A 1CQMA 3CXCR 3OYFA 4F4KA 1I94K 1DURA 4BR7A 1HL6A 2HVDA 4GKKF 2D0CA 5KFIA 3L0QA 3DYAB 1IJEB 1IKXB 3MPDA 4O5FA 4O3NA 2YQ0A 3BREA 4LSNA 3WZ0A 4JV0A 3VEOA 3CB4A 1T3NA 3NCPA 2OUGA 3P5TL 1EZZB 4J9UE 3CNQP 1V4SA 4ZVOB 5BRFA 2OPSB 3J7ZO 3HBTA 3K2PA 4X65K 5CZ2A 2HHQA 2XZWA 3MEEB 2R7SA 1Q18A 2BQRA 3W9HA 3CCMN 2IDEA 2PO4A 4LIWA 3TAMA 4IXCA 3QRPA 4NE9C 3GV7B 1WSIA 5FROA 2NPFA 5J2PB 2VOOA 4FL9A 1SAZA 2C42A 3DRPA 2GZOA 4FYYB 1X4FA 1KXPA 1G6BA 5KFDA 2D9PA 1GOAA 2YWFA 3ELHA 2HRUA 3K59A 2DISA 3MR5A 4JI6K 3OUYA 2AYGA 3D3BJ 1VQKS 3D1QA 3ENAA 3SAFA 1XTZA 3QNWB 3M6GA 1FRKA 2UVUA 3CJTA 1KVAA 4BRIA 3CCES 1F1BB 2KTQA 1G3OA 4CGGA 3K5MA 3H4DA 3JB9k 4P71A 1DY3A 4ED7A 1X4DA 2UU9J 3SSQA 4LFBF 3RAQA 1WC5A 2NXJA 4K4TA 3ENBA 3PJWA 1TUYA 4BE0A 3VEZA 3SI8A 5E41A 1KFDA 2VV5A 5KFCA 2C2KB 1ZYQA 4NA2A 4LMZA 3LPEA 4DR7F 1QUPA 2GGPA 4Y2IA 1NHVA 2BKPA 4DV3K 3OHBA 5C42B 2DITA 5JVHL 3TI0A 1SKRA 2W42A 1X31C 1NH7A 1LV5A 4NLCA 1TYQA 4URGA 3U6FA 2PN6A 4NLOA 1PYTA 1CZAN 1MW7A 2XYGB 4YQWA 2V2VA 3G10A 2QWPA 3GV8B 3ALYA 3FLCO 1B7YB 3C2PA 2J7KA 5GMKa 4LJMA 2F7TA 4QW9A 2R7XA 2F4VJ 5B7WA 4J9QA 3OJUA 2XTJP 2N3LA 4G1IA 2VHGA 3EICA 4DV2J 3Q22A 1KRPA 3MX5A 4A46A 2VD3A 1KQFB 4CW7B 4KSEB 3ENHA 1P90A 3MAAA 1I5OB 1WHVA 3A13A 4IKAA 2XS7A 4QU7A 3KG1A 5ETTA 5EU7A 1U1OA 4I9QA 2UZAA 2RE1A 2NRHA 1AUDA 3EZUA 3VF2A 1KAYA 2DGVA 4FLWA 1VR6A 3VAHA 3IM9A 3MTJA 4WZMA 3RR7A 1E6YB 4Q45A 1PG5B 4FDFA 2QLWA 4X64J 3F73A 3EE3A 3EGNA 4AT1B 2RF2B 2OELA 4KIAA 2YJFA 1VQSA 3TAFA 3D0PA 4K2XA 3ZT4A 1N5YB 4DL5A 1VQNS 1PJ5A 4KB0A 4RWWA 4HACA 2MSTA 2K7KA 1DT9A 1F9EB 3DI6A 2NXEA 1FWLA 1HNZK 3Q86A 1YBTA 4MIWA 4NWBA 8ATCB 4FYXB 1TAQA 3BO3A 4W5OA 1LNQA 3ZX2A 1BQXA 1FF2A 5AQOA 2FDNA 1VIOA 3KLIB 5H1SV 1IKYA 3J80O 5I3UB 1F5BA 3IAS9 2E2OA 3IWLA 3ASMA 1ZM4A 1ZBUA 3G0ZA 1WD6A 2DJWA 4HHHA 1X8DA 1IVZA 3FVYA 5BN9A 4A8SA 3S1TA 2XHCA 1LKZA 5AZJA 2KFYA 1Z26A 4QS7A 1Q9YA 3A8KA 4OJ1A 2XZDB 1V3ZA 4H0XB 4GVMA 5AE2A 3SI6A 3QJJA 4YY3K 4MK8A 2DXEA 1J2VA 2W9BB 2HGNA 3KJQB 3TUIC 2RU9A 2CDQA 2M8HA 2AX1A 1HQUB 2B6AB 3D5MA 5GAHI 1O5JA 4C11B 4KBOA 1TKTA 4TY8B 1PC5A 3QMQA 3ZT2A 2X78A 1JLQB 3TP2A 4JKEA 3KZBA 5I3QA 2Z1JA 3SQGB 2PBDA 4M95A 4FYVB 4DV0K 3K0SA 4M5HA 2NRRA 5ETVA 3EKUA 1Y00A 2P1JA 2J9EA 1OSDA 4MJKA 1WELA 2XNQA 2UUBK 3RAMA 4MYTA 1U2VA 5BREA 1QQOA 2BJ3A 3D2WA 4FJXA 1C1BB 4C6AA 2YV0X 3M8QB 3NVKA 4OZ0A 1H2TZ 2ZJQL 3VZHA 3FZHA 3FZFA 3KK3B 4OGCA 4LF8J 4OI2A 2G8KA 2HHWA 3CIMA 2AGQA 2CKWA 4O8KA 2EC2A 4EP5A 5IXUA 3WDOA 2O66A 2LYVA 4EYHB 4WFYA 4O23A 5C0YA 5L39A 2AQ4A 3EWGA 3I31A 1VQLN 5HBMA 2LXUA 1MSWD 1T03B 1RXOB 1JL2A 4EHUA 3OPKA 1KTQA 3QGGA 2YKMA 3HVAA 5DLFA 1VQ5N 3N6NA 4P52A 2BMBA 3AH6A 2Q66A 1IR2A 2COLA 1MN9A 3NWRA 2K3IA 1CQNA 4OZNA 4IOBA 3FZMA 4IH6A 3M8YA 1I3OB 4EO8A 3UD4P 1U1PA 5HLFA 3CJ9A 1VQMS 1S9FA 2UXBJ 1LAWA 4CP5A 4IZ9A 1UP1A 3PW5A 2VODA 2F9WA 3AVFA 4ILLA 3O1LA 2XMTA 4JK7A 3MM8A 4KQZA 2PGCA 4WE1A 1KSPA 3MECA 3PW7A 3HM8A 3OW2M 4LFCK 3HD1A 4DKWA 2JOQA 4TQSA 1GXLA 3DMJB 1YXQA 3SDEB 1CXUA 2ZH3A 1UW4A 4NXNK 4NZ7A 1NG9A 1EO1A 5KFGA 3HPGA 5FPMA 1JLEA 1AFJA 4QCLA 2ZE2A 2XNRA 4OX9F 2DR8A 1TMMA 2E1MC 1T3VA 1R8HA 2B43A 2GJIA 3RJMB 1IBMJ 2R7TA 2I5JA 2IRXA 4FN5A 1TAUA 2N4DA 4AXIA 1JLCB 2Q6BA 1HKAA 1SQFA 2V2ZA 4DCHA 3ZETB 4RO0A 4E7IA 3QDKA 3BZKA 1BXNA 3BEXA 1N36J 4J5OA 2UUCJ 1JCFA 4MKVA 4IR9A 2J0SD 3NBPA 2QGFB 5LMNJ 1FEHA 2QL9B 3OL9A 4CJWA 3AOAA 3AA8A 3C14B 2XMWA 3DXSX 1S1TA 1BC6A 2QWOA 4DR5J 2OSRA 2CJAA 5IT9O 4MYUA 5C12A 3LP3A 5JXSA 2IFXA 8RUCA 4HH0A 3F0NA 4KHSA 2UXDJ 5FRNA 5LJ3Y 3N79A 3R8EA 2Z2LA 3OTOK 1RA7A 1YF5L 4DU1A 2MSSA 3O3FA 4MDAA 1GMUA 1AFIA 1X3MA 2KH9A 4Y1DA 1MA9B 3GTYX 1L3KA 4RLEA 3F9KA 2KN4A 3EVOA 4YOUA 2BRLA 2DNYA 1Y7PA