3IG1A

Hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 Reverse Transcriptase p66 subunit
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 132
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ig1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ig1A05
3LPUA 4CJEA 3AVMA 1ZYQA 1RYSA 2HHSA 3GIKA 4W5TA 3HP6A 3HK2A 4F8RA 1O1WA 5KFYA 2GC8A 2ITGA 4XO0A 1W9HA 4EBDA 2O4IA 1RTJA 2IJNA 1NK5A 5HP1B 4HVJA 2YKNA 3QZ7A 3KK1B 2BR0A 4I2PA 3EPGA 2AGOA 2C2DA 1TK5A 2G8KA 4JV0A 4ZMMA 4CJFA 4E0DA 2V4RA 4WYLA 3KLIA 4TY9A 4M3ZA 3CDEA 1NNDA 4AHSA 3NMAA 4HCCA 1RBSA 1BI4B 3ZSRA 4U7CA 2D0AA 3O4NA 3BQ1A 3AVAA 1L3TA 4BDPA 2XGPA 2AGQA 4O3QA 2FVCA 4M45A 4CHPA 3AVFA 1NJWA 2AWZA 3VQSA 4EYHB 4K50A 1SV5A 3BDPA 2I5JA 3JSMB 3V81A 1SKSA 1Q8IA 4CIGA 3H59A 4NLSA 4URQU 2W7OA 4FZZA 4J2AA 2OPPB 1LAWA 4B3OB 4AHTA 1LWFB 4WZMA 4URGA 1S1TB 4KO0B 2IM1A 1NK8A 3DLHA 4W5NA 3FSIA 2R7YA 1KFSA 3DOKB 4ECYA 1QSYA 3CDUA 2OA8A 4FBTA 2GIQA 4CGFA 2FLLA 4LH5A 1C0UB 4HUEA 1ZBIA 4WFXA 3NF6A 1GX6A 3CM6A 5KT4A 4OKEA 3TAGA 2HW3A 4QWAA 3AVIA 3OYIA 4DTOA 4DQPA 2B5JA 5EWGA 4DQQA 3F73A 3I0SA 1JLAB 3GQCA 2OPSA 2IBKA 4KB1A 3JYTA 3THVA 3BR9A 1ITGA 1N4LA 3SQ2A 3DMJB 3MR2A 3C6UB 2FVRA 1S1WA 4CGIA 4L8RB 3KK2B 5DLGA 1L5UA 4ZTFA 2YNHA 1HRHA 2BQRA 3ZT0A 1S9GB 3ZSVA 2UVUA 4URSA 1S1VA 4B9SA 4DU4A 3DRRB 3S9HA 4RW9B 3Q8RB 1WAJA 1VK0A 1XHZA 4OVLA 4IRCA 5F8IA 4KPYA 3DLKB 3OYBA 1RTIA 3OYNA 3MEDA 1CLQA 3VQQA 4M3WA 4RNHA 2KW4A 1X9MA 1S1XA 4FJ7A 4NCGB 4H4MB 3NGYA 2KFZA 4J9KA 3VQ8A 1LW0A 3RRHA 3ZT4A 1GX5A 3OY9A 4RNMA 1HJRA 4FLUA 5F8HA 1UA0A 4RZRA 3KMQA 4GW6A 4NLVA 1ZBLA 5KTQA 4DSJA 5DQIA 1D1UA 3HVTA 1TKXA 2VG5A 3V1OA 4KRFA 4K4WA 5F8MA 3MXJA 3IG1B 3T1AA 4BDZA 2PZSA 1KVBA 2D0CA 3V4IA 3IS9A 4O3OA 2DFEA 4LSNA 3U6FA 1X9SA 1HQUA 1YVFA 1N6QA 4E19A 5KFPA 4CIEA 2FBYA 1TK0A 4IQXA 3NGIA 3TAQA 3OS2A 4M3YA 3MXMA 5DQHA 4HUGA 3H5SA 4B8AB 4RNNA 2W9CA 3HPHA 3EPIA 4QW9A 4B9TA 2KZMA 2XRIA 3SV3A 3T5KA 3NGZA 2C2RA 1S9EB 3E51A 5DG8A 2VG7B 3M8PA 1BGXT 3NH1A 4Y3CA 2WONA 1GOBA 3I5BA 3OYDA 4HTUA 2Z1JA 4ED8A 3H5XA 3CDWA 3DLGB 3HP9A 4DLGA 3ITHA 2J6TA 1Q9YA 4ZVFA 2A1RA 1BQNA 3RAXA 3OJUA 1ZBUA 1RDBA 2RF2A 3NBPB 4PWDB 5DG7A 1B9FA 4ZP6A 1U09A 3L2VA 3V9ZA 1HYVA 3PX4A 4YNQA 3SUPA 1TAQA 1VRUB 2IMWP 2J6UA 1KLMB 3TAMB 1JXLA 4LQ9A 3V9UA 3K59A 1VRTA 1JLBB 5J2MB 2W42A 4G1QA 2RPIA 4NCBA 3PR5B 1UOCA 3QIPA 3QO9A 1DLOB 4WFYA 3UQSA 4TSXA 4J2DA 4OKKA 3OYJA 4PA1A 3LWMA 4RW6A 1J53A 3V9SA 5FDLB 2R2UA 5CY4A 4DFPA 2PY5A 4YMEA 4DTRA 3QNOA 4IOBA 3VQCA 2FLNA 3OYCA 5KFVA 5KFKA 3NAEA 2XI3A 1NK6A 2ZE2B 1TV6A 2X74A 3KLVA 2AX1A 1UWBB 2UUTA 3TVKA 1I3AA 1KRPA 1HPZA 4FJ5A 4RW7A 3OHBA 2P5GA 2DY4A 4ICLB 2Q3SA 4CFAA 4CJKA 2HHQA 4CK2A 2HNYB 2DPIA 1L3SA 5KG4A 1TKTB 2AGPA 1HYSB 2HNZB 4NRUA 5KFXA 5KFRA 1RILA 1RDRA 3B6OA 1TKZB 1JKHB 1YVUA 4GC7A 3BSOA 5C25B 4KB7A 4NRTA 4F4YA 4W5OA 4Z4GA 4CJTA 4E7LA 2QV6A 2BGGA 4YP3A 1VSLA 2HWHA 1RT6B 1QS4A 3PZPA 4JV1A 5SWMA 1ZBFA 3NCIA 4EO8A 3HPOA 1HYZA 3MECB 4O0IA 2ATLA 1SH3A 1NJZA 4Z4FA 4F3OA 4LSLA 3ZT1A 2B6AA 4AILC 1RT7A 3H4DA 3MFIA 2D41A 3KMSA 3HM9A 3CQ8A 3D0PA 1TK8A 4Z4CA 3FDSA 3AVKA 2D3UA 3L3VA 2XY7A 2ATQA 1RDAA 3U3GA 1DTQB 3NAIA 1MU2B 2KTQA 3IRXB 2QK9A 4YQWA 4O3PA 4FW2A 4IG3B 1VSFA 3MTKA 2IJFA 2ILZA 1TL1B 4MFBB 4O4GB 4O55A 5HP1A 1BCMA 3OYMA 4LQ3A 1ZTWA 3SQ1A 3KK3A 3UDLA 4M42A 1D9FA 1REVB 4F4XA 2G8VA 1IKVB 4CJLA 3DLEB 3OYFA 5KFBA 2E9TA 3NAHA 1QAJA 5J2QB 1S0MA 5DLFA 3QZ8A 4K4SA 1FKPB 3NH2A 5CYQA 4B9LA 1C2PA 1BI4A 4YR3A 2FC0A 2XI2A 4DTUA 3HSTB 4F4KA 4I2QA 1NOZA 4CHZA 4Q44A 2FLPA 4N5SA 1EXQA 4M95A 4NZ0A 5J2PB 3CJ5A 4CGGA 4FJIA 4C8OA 3MEGB 4DSKA 3VQBA 3PW7A 3JSMA 4O3SA 4KHUA 3L2WA 4J9LA 2XWYA 1SL0A 2IM3A 3OL8A 5CZ1A 1NOYA 3KTQA 3LAMA 4GC6A 2OPPA 3HJFA 4B3OA 3K57A 3CJ0A 4CF1A 1LWFA 4CF2A 4HCBA 4RW4A 3CIZA 4DL2A 4FVMA 4PUOB 4KO0A 1LWEB 1J54A 2AJQA 4FYDA 1S10A 1XWLA 2JEFA 3P83D 3M8SA 4ECWA 3I0RB 3DOKA 4K4UA 3K58A 3T5HA 4FM0A 4ED2A 4FJNA 4CFCA 4FK4A 1CXUA 1C0UA 4Q45A 4CJRA 4OPKA 2HHTA 3GV8B 4DL7A 1FK9B 4CGJA 3MEEB 4KHQA 4KHWA 3VQ7A 1JLAA 3AO5A 1ZETA 3RRGA 2BE2B 4O3NA 1J9AA 4ZTJA 2D7SA 4CGHA 4FLZA 2W9BB 5KFDA 2FVSA 3DMJA 1I39A 3C6UA 4Y2CA 4NLDA 2RDJA 4FZYA 2P1JA 3KK2A 2FJXA 2B4JA 1TVRB 4M41A 5HRRA 1OS5A 1S9GA 4IFVB 2ZKUA 2ALZA 4KHYA 4UQGA 3DRRA 1C1CB 4RW9A 2OZMA 4DFMA 2BQ3A 1B92A 4CJ5A 3DLKA 5DGAA 2F96A 1JIHA 4FLXA 5F8LA 4ZVEA 4NCGA 4H4MA 1C0TA 1DTTB 3V9XA 3K5NA 1JLQA 2IC3B 4DQSA 2D5RA 3KLHB 4DTXA 5I42A 3L2UA 2ETJA 4K4ZA 2RKIB 3KOAA 5KFFA 3PW4A 4CF0A 2Y1JA 3FFIA 5HRSA 4QPXA 3IG1A 1EP4B 4M3UA 4JV2A 3KJVA 4W5RA 5KI6A 4E7IA 4RU9A 1XC9A 5K14A 2VA3A 4JRPA 4ZVHA 1JXEA 3DRPA 3O3GA 2HVHA 4IFYB 3PW2A 3RBEA 3LP3A 5EU7A 2D3ZA 2GUIA 3SI6A 5KG5A 2E9RX 5JS1A 3IGVA 3SPYA 4DEZA 1S9EA 3KD1E 3RMDA 3TAPA 4CEQA 4IH6A 1Z25A 1WNSA 1TGOA 3AV9A 4PY5A 1KFDA 3PY8A 3SV4A 3DLGA 4B08A 3IN5A 2GV9A 5JS2A 5F9NA 4OJRA 3ZSWA 3NBPA 4PWDA 4DSIA 3NF7A 1BQMB 1BIZA 1VRUA 1UAXA 4KB0A 1RT2B 1KLMA 3TAMA 3CFPA 3RMBA 1HMVA 1YTAA 4IG0A 1JLBA 5J2MA 4FJGA 4H4OB 4QWDA 3DLBA 3M8RA 4I7FB 1TAUA 2WTFA 4O44B 3SCXA 1ASUA 3AA5X 2OZSA 3I5CA 3OL7A 4FS2A 3N6MA 2AU0A 4Y2AA 1DLOA 3SUNA 4NYFA 1JLEB 3V6JA 2ZD1A 5FROA 5CZ2A 4JS4A 4ED1A 3CJ2A 3PHEA 3L8BA 5FDLA 4Z0UA 4OLBA 3T3FA 5C42B 4FJJA 2F8SA 3KHHA 4ECSA 1S6PA 1TKDA 3HT3A 2W9AA 1LWCB 1JX4A 1VSJA 4QW8A 4CFBA 1HNIB 1QSLA 4K8XA 2ZE2A 2XY6A 1U45A 3RMAA 2IGIA 1RTHB 1QHTA 1UWBA 4ZPCA 4F4ZA 2JLEA 2HB5A 4KHMA 3L2RA 4DSEA 4ED0A 4ICLA 4MKAA 4J9QA 3WNGA 3QYYA 1KVCA 2HNYA 3QGHA 4ZP7A 1XR6A 1X1PA 4AHRA 4NLOA 3SFGA 1TKTA 1HYSA 2HNZA 1LV5A 2UVVA 1JLCB 1YT3A 3ZSXA 4QCLA 2WRMA 3VQ4A 1TKZA 1JKHA 3HYFA 1ASWA 4J9MA 3V1RA 4TY8B 5C25A 1C0MA 1IO2A 3Q8QB 3LAKA 3BSNA 3OSNA 4F2SA 1CZ9A 5HLFB 4DF8A 1RTDB 2WHOA 2FBVA 1SL2A 3OYKA 4IR9A 3CFRA 2FVQA 1RT6A 3MXIA 4JS5A 3E01B 1RA6A 3D28A 3RMCA 3WNFA 5CYMB 4XPEA 4F50A 3A2FA 3MECA 3HO1A 4LD0A 4ED7A 2HAIA 4DWIA 4B9MA 2Z1GA 2G8WA 1NHUA 4HHTA 4KHNA 3DM2A 5KFOA 3PUFA 4DS5A 4NLUA 4NLYA 2EHGA 4F4WA 4CEOA 3NGDA 4KI6A 1JLGB 1L3UA 1WSHA 1RTJB 4CJPA 5KFCA 4CF9A 4ZVGA 1IKYA 2YNGA 4OPJA 1QUVA 1QE1B 1DTQA 2YKNB 4NLTA 4ELUA 4MK9A 3AO2A 1XHXA 1MU2A 3IRXA 3QESA 4BACA 3BQ0A 1EX4A 3H40A 5EWEA 4IG3A 4M3XA 1J5OB 4BE1A 4DQIA 1TL3B 2OYQA 1TL1A 5I3UB 3QEXA 1S0OA 4KBIA 4KHRA 5KGWA 4KV8B 1B9DA 1HQEB 2HVIA 4Y34A 1REVA 2XCAA 3DRSB 3AO3A 3UR0A 4TQRA 2JEIA 4DS4A 1MMLA 1IKVA 1S6QB 4CJUA 2HNDA 3SPZA 3DLEA 4MK7A 1F21A 3PX6A 5J2QA 3HKWA 4JUZA 3GILA 3DYAB 4BE2A 1KHWA 3H5UA 4E3SA 4CEAA 3LP1B 5DG9A 3ZSYA 1X9WA 1SV5B 5L1LA 3V81B 1U47A 3RBDA 4TN2A 1RAJA 2G8UA 4KSEB 1SUQA 4Y1DA 1XI1A 3PW5A 4BE0A 5J2PA 1TQLA 4TQSA 3OYGA 4ZHRB 4Q8EA 1IH7A 3MEGA 4FJMA 1W0HA 1L3VA 4CFDA 2HMIB 4N56A 1EETB 2E9ZA 3LWLA 5KFUA 3SQ0A 1RT3B 2E4LA 1C6VA 3DDKA 1LWEA 1HARA 3BQ2A 1IG9A 2FVPA 4CHOA 4MIBA 3GYNA 3AVNA 4CEBA 1K1QA 4KFBB 1KHVA 3BREA 5DQGA 2FJWA 1S1WB 3S3NA 4FJXA 5HROB 1FK9A 1WSEA 2HHWA 1BISA 4LY7A 3MEEA 4CGDA 2GBZA 5KFZA 1CXQA 3QIOA 3VN5A 2P5OA 2BE2A 2W9BA 1N56A 4K4XA 3GV7B 2XCPA 4WE1B 4DL3A 1S0NA 3PO5A 3LZJA 1JLFB 1WSIA 3AA3A 1RTIB 3V6DB 3GIIA 2XC9A 3MEDB 4M3RA 1TVRA 4AH9A 4B9VA 2VG6B 3ZT2A 2IM0A 1FKOB 4IFVA 5KFAA 5F9LA 1C1CA 2X78A 3M8QB 2UVRA 3NKYA 1U4BA 1VSIA 4R0EA 4BDYA 4K8ZA 5KT3A 4EYIB 2G8HA 2BQUA 4IBNA 3ALYA 1U04A 3HVTB 1TKXB 5HBMA 4NYNA 4EBCA 4ECZA 4K4VA 2VG5B 4EO6A 1D5AA 1DTTA 1D8YA 4R5PB 4TYAA 4FJ8A 2IC3A 3LP2B 3HXMA 3C6TB 3F9KA 3KLHA 3IS9B 3I8DA 3KHLA 2YV0X 1CZBA 4DTPA 1HQUB 4YR0A 2UUWA 5JUMA 4FJHA 1W25A 4ECVA 1I6JA 4Y1CA 3VQPA 4Z4HA 3SFUA 3AVHA 3KK1A 2W9CB 4B9UA 1R0AB 2QXFA 1EP4A 4KTZA 4KHSA 2XY5A 4CJWA 3M9MB 1S1UB 3LDSA 4IH7A 1Z4UA 4H54A 1LW2B 1RT5B 4OLAA 4ID1A 4IFYA 4IDKB 3ITHB 3PV8A 3VA0A 3MF5A 4ELTA 5KG1A 3TWHA 4DU1A 1VSKA 3H08A 3DI6B 1NKEA 3QGGA 1IKXB 3M9OB 5KT6A 2R8GA 5KG7A 5FRMA 4O0JA 4CJQA 4OGEA 2B43A 2V4QA 4FK2A 3QO9B 1RBTA 4FLYA 1SL1A 3NF9A 4OKJA 2XGQA 4NLRA 4J2BA 1BQMA 2CKWA 4QWBA 1RT2A 3TI0A 2IS3A 4U6PA 1S1TA 2WOMB 3U3YA 1JXBA 1S5JA 2VWKA 4H4OA 2Y1IA 2HHVA 4AHVA 2OPQB 2OPRB 3SI8A 4M3TA 4K4TA 4DMNA 2DFFA 1VSHA 3AO1A 1YTUA 4XIUA 1C1BB 3SNNA 3O3HA 2YKMB 1JLEA 4KKOB 2YNFB 3AVGA 4RNOA 1S97A 4DFJA 2JEJA 1NK7A 3KLFB 3OL9A 5C42A 3CO9A 4O3RA 1S4FA 4X2BA 2IA6A 5KG6A 4E7KA 4QAGA 3TABA 3ZT3A 3AA4A 3EZ5A 2O5DA 4KE5A 1U49A 4TLRA 3V6HA 1HNIA 3G10A 2BANB 4ID5B 3KHGA 3OSPA 3N6LA 1RTHA 4E1NA 2BDPA 3D45A 3LPTA 4TXSA 3QLHB 1HNVB 4E1MA 4HUFA 1XR7A 5F8JA 3HHKA 1BIUA 5KG0A 5EDWA 2Z1HA 3FRZA 4Q5VA 5KFJA 3VQEA 2R2TA 4CHQA 4CJ4A 5DK5A 4MH8A 1JL2A 1JLCA 4KAZA 2ILYA 2IM2A 3MR6A 5KG2A 3BGRB 3OHAA 3GIJA 5DGBA 4J9NA 3P5JA 2ASDA 2X6NA 2KZZA 4MIAA 4TY8A 3AVJA 4W5QA 1T05B 5L1IA 4Z4IA 4KTWA 5HLFA 1RTDA 2EC0A 4FK0A 3H5YA 3QIDA 4FLTA 3OL6A 3E01A 4EBEA 2ASJA 1FXXA 3K5LA 4CJSA 5CYMA 1RT1B 3O4QA 1WSJA 3GV5B 5KRSA 2HHUA 3QEIA 2NUBA 2R8JA 5J1EB 3OVNA 3MAQA 4ZPBA 4N41A 5F8NA 4WYWA 1NK9A 1JLGA 2YHAA 2PYLA 4HKQA 1QE1A 3DOLB 1T3NA 3RB6A 3HVRA 3KK3B 5L1KA 1ASVA 4DG1B 2VG7A 3IGNA 2C28A 4N47A 3OJSA 3FQLA 2F8TA 5KFTA 3TR8A 1J5OA 3L3UA 5D3GB 3H2LA 1TL3A 5HRNA 5I3UA 5C24B 4I9QA 4MK8A 4WXWA 4DL6A 4RUCA 4KV8A 4RNFA 5CYQB 1EKEA 3KKRA 4C8NA 1HQEA 3DRSA 4DTJA 4CERA 3S3MA 5KFGA 1S6QA 1A5VA 2UVWA 5KFIA 1VSMA 2PYJA 3KNAA 3RR7A 4I2QB 3VQ5A 3DYAA 1D9DA 3RB0A 3O3FA 3VQ6A 3LP1A 4FJKA 2FBTA 2IOCA 1T03B 3CYMA 3ZCMA 1QAIA 1KTQA 4EP5A 5KT7A 5KFWA 5EUHA 4RW8B 3QGIA 4CJ3A 3QEPA 4RW4B 4NLXA 4YR2A 4E7HA 4ZP8A 3MR5A 3AVCA 4ZHRA 4IKAA 4FS1A 1NJXA 2G8IA 3LP0B 2IAJB 2HMIA 4CEFA 3QEWA 5EWFA 1IKWB 1EETA 4F2RA 3LALA 3SZ2A 3QEVA 3K5MA 4K4YA 1RT3A 2QE5A 3Q8PB 4DQRA 3KLGB 1A5XA 3G6VA 5L9XA 2D0BA 1N5YB 4J9RA 3HVWA 5E41A 4R8UB 4ECQA 4KFBA 1WSGA 3GIMA 2BRKA 5F8GA 1RNHA 4CEEA 1G15A 2HWIA 3SUQA 1Q9XA 1SKRA 1C1AA 5HROA 2C22A 4IKFA 4E7JA 5KG3A 3H4BA 3G6YA 3VQDA 1RT4B 2O4GA 4HYKA 1LAVA 3HVAA 5C5JA 4B9NA 4PQUB 3T5LA 4EZ9A 5J2NB 1U48A 4NLPA 4WE1A 5KFQA 1JLFA 2YNIB 4J9SA 4Q0BB 3V6DA 2R8KA 4M94A 3CFOA 2VG6A 5L1JA 1FKOA 4ZP9A 3OYAA 3KLEB 1C0TB 2R2SA 1KCFA 1RBVA 4CCHA 3OS1A 1JLQB 2DPJA 4IH5A 2R8HA 3M8QA 4FJ9A 2C2EA 4KI4A 4DSFA 3KHRA 4IRDA 3VQAA 5KFHA 5I42B 3PJXA 2W8KA 4CEDA 3MFHA 3FFIB 1S49A 4I2PB 3WNEA 4R5PA 4FLWA 3LP2A 1UA1A 3C6TA 2E6MA 1BCOA 4CHYA 3KJVB 2R2RA 4NCAA 5K14B 4DTNA 3KLIB 2I1RA 4IRKA 2EX3A 4KAIA 1D0EA 3SQ4A 3DRPB 1QSSA 4MFBA 4O4GA 4FW1A 3TAFA 4J9PA 1R0AA 3ISND 3C94A 1SKWA 4YFUA 3RAQA 5DMRA 4O4RA 3VA3A 1S1UA 2HHXA 4EEYA 4QWCA 1RDCA 3Q8SB 1SH0A 4FBUA 2Z1IA 1LW2A 1RT5A 4CE9A 1KLNA 2WCXA 1FKPA 4CECA 3CJ4A 3TARA 4N76A 4IDKA 1RCHA 3IAYA 2W8LA 4QOZB 2DTUA 3AO4A 2I5JB 3CM5A 2G8FA 4ELVA 1RBUA 4BWJA 3LZIA 4DF4A 3DI6A 3RB4A 3G0ZA 3FQKA 1IKXA 1HMVB 4JLHA 4IG0B 3L2QA 4CK3A 3C95A 3OYLA 1SH2A 3G86A 4KREA 3T19A 4Q43A 2ZD1B 2ZQBA 4JRQA 4FXDA 2WB4A 4PUOA 2WOMA 4XPCA 3ASMA 1S6PB 2B5JB 4DTMA 2OPQA 2OPRA 1RA7A 3RB3A 4LH4A 3I0RA 3I0SB 4C8MA 3SUOA 3P1GA 2A1SA 3HL8A 2JC0A 1C1BA 4ZPDA 3B6PA 2OPSB 2YKMA 3JYTB 4CHNA 4KKOA 4ECTA 1QQCA 2YNFA 3ULDA 3KLFA 4I9LA 5T14A 2V9WA 1WAFA 2AQ4A 3EY1A 1VSEA 2YNHB 3H98A 1NHVA 5JXSA 1JL1A 3PR4A 2XO7A 1S1VB 1VSDA 3UPFA 3EYZA 3ICLA 2BANA 4ID5A 3AA2A 1WSFA 1RYRA 4DL4A 3G6XA 3ZSOA 4DTSA 4DL5A 1S9FA 3QLHA 4CEZA 1HNVA 1WLJA 3BJYA 3UIQA 5SZTA 1S1XB 4ECXA 3PJWA 3NF8A 2J6SA 3S3OA 3PO4A 4FJLA 3CJ3A 3RR8A 4CIFA 1LW0B 1ZBHA 4NLWA 4ED6A 2IDOA 3BGRA 4CK1A 5T7BA 4DU3A 3CG7A 4EZ6A 2VWJA 2P51A 3SYZA 3PVXA 1CSJA 2DFHA 3QERA 3NE6A 4F3TA 1T05A 4NLQA 4MQ3A 1BL3A 4FM1A 3DM2B 3V4IB 4LSNB 2F8EX 4EP4A 1T7PA 1N6QB 2RKIA 3OLAA 3V6KA 4C8KA 1RT1A 3V9WA 4Q8FA 4KTQA 1IKYB 2YNGB 1QTMA 1NK0A 3OYEA 2BRLA 3I5AA 3K5OA 4J9OA 1Z26A 5J1EA 4MKBA 5KT2A 3M8PB 3NDKA 3KD5E 2WONB 4BWMA 3K2PA 1BHLA 3ZSQA 1NKBA 4ZPAA 3DOLA 3KIOA 3BSAA 1K6YA 2RN2A 2VA2A 3T5JA 4CJVA 3RWUA 1BQNB 4DG1A 4DFKA 1NKCA 3V1QA 2RF2B 3TAEA 2HNDB 2QKKA 2GIRA 3MR3A 3ZSZA 4C8LA 1WN7A 2XHBA 5D3GA 4WZQA 1XR5A 5C24A 3WNHA 3NH0A 4FCYA 5KFEA 1VRTB 1RDDA 2LSNA 4ED3A 3TANA 4B8CA 1Y97A 4DLEA 4G1QB 4FZXC 4WXOA 1RBRA 2KFNA 4H8KA 3QIPB 2RDIA 3ISNC 1A5WA 4FM2A 3SJJA 4RW6B 1SUQB 3DLRA 4ECRA 5KGXA 4CF8A 3CWJA 4E89A 4RUAA 3KKSA 1T94A 4I7FA 2AX0A 2FBXA 3BSCA 1T03A 4TYBA 4O44A 4IR1A 5HRPA 3EZUA 3NL0A 2W7PA 4DSLA 4ECUA 4AHUA 4WFZA 1N48A 3OYHA 3AVLA 4RW8A 1TV6B 3QETA 3PW0A 2JEGA 2V0NA 4CESA 4Z4EA 1HPZB 3AVBA 2JC1A 3NFAA 3PX0A 4RW7B 3LP0A 5KT5A 2IAJA 4RG8A 1IKWA 4G3IA 2QKBA 1LWCA 3D5MA 3VQ9A 3KLGA 4O5BA 1T8EA 1KVAA 4AHCA 4J2EA 1N5YA 2R8IA 4GMJB 4QWEA 5KFSA 3RTVA 5FRNA 4R8UA 1ZTTA 2OH2A 4NYZA 5KFLA 3QINA 2WK4A 5KRTA 2YHBA 5KFNA 5KFMA 4OL8A 1NK4A 2E6LA 3CVKA 1IM4A 4OGCA 3M9NB 1WNEA 1RT4A 3OS0A 3TQ1A 4PQUA 4LSLB 5J2NA 2X6SA 2B6AB 1NJYA 1RT7B 1GOAA 2JGUA 1KSPA 3NHGA 2ASLA 1S48A 1GOCA 2CJQA 3QNNA 2YNIA 3LANA 4Q0BA 4FLVA 1K1SA 2FJVA 3N6NA 4NLGA 3OLBA 4GVMA 2XY8A 5HBMB 2KQ2A 1TP7A 3HPGA 3KLEA
chains in the Genus database with same CATH superfamily
2EI5A 2XHCA 2YKAA 2KVIA 1HPMA 2HHSA 5IT4A 3GIKA 3D2EB 2EW9A 2NXCA 4P72A 3HK2A 4DV7F 4F8RA 1O1WA 1QZ6A 2QLXA 1W9HA 1RJJA 3OTOF 4EBDA 1PSDA 2ZJQL 4ANCA 3O3LA 1NK5A 4NI2A 1D3WA 4ES1A 2QMUB 2BR0A 3L9ZA 1V4SA 5IM0B 2IPOB 5LL6Z 3W2WA 1QD1A 4AXJA 4GKKK 2V4RA 1RXOB 5F2RA 1Y3KA 3O4WA 2FF6A 4OJHA 3R6MA 2E5GA 1UZHA 4AHSA 4FWOA 2LU2A 4OO1J 2V67A 1KQKA 2D0AA 5I4MA 3BKFA 2NZ4A 1HNWK 1LOTB 3TU5A 3CJQA 4WFBQ 3SCIE 2CQ0A 2GGPA 5B0EA 2RS8A 3H6EA 2NRXA 1NJWA 5IQ6A 2OELA 1H2UX 4EYHB 4K50A 2I5JA 3JSMB 5H9FK 3H59A 1NMEB 2W7OA 2GJ2A 4J2AA 1C4AA 1OH6A 4B3OB 4YOYA 4URGA 1S1TB 4OYMA 2DR8A 4B02A 1GH8A 3OXFA 2FHJA 2DRBA 4LF4J 4ECYA 1QSYA 1P90A 4FBTA 1CC7A 4QOTA 4GRSA 4CGFA 4LH5A 4HUEA 4WFXA 5B8HA 3CM6A 4OKEA 3GE9A 3TAGA 4QWAA 3OYIA 3TWZA 5EWGA 4DQQA 3P38A 3GYGA 4O8UA 2IBKA 3THVA 1LFPA 3K8WA 3SQ2A 5BR8K 3I55S 4HH0A 3DMJB 1Q82T 2OMOA 4GKJF 1K0VA 2YX1A 1L5UA 1ACMB 1IBMF 3ZT0A 2ROEA 3HHLC 1ZOTA 1S1VA 3FVYA 5HK4A 3WHIA 3DRRB 1QZ5A 2GVDB 4JI2F 3NNAA 3OYBA 1RTIA 4X4TA 3OYNA 2MEWA 3SAHA 1URNA 4CT8A 2Z57B 2KW4A 4B1XB 1OH5A 4DXLA 4J9KA 4LFCF 5C0YA 2R7WA 2BKOA 4OYOA 1LW0A 3ZT4A 3BEXA 3B78A 3OY9A 1HR0J 4FLUA 2OFHX 5E26A 4RZRA 4NLVA 4RX6A 3CW2C 1TKXA 5D15A 3V1OA 4KRFA 4HHUA 4DX7A 2Z56B 2PZSA 4JD2B 4O3OA 2DFEA 3U6FA 4ZVUB 1YHQN 4E19A 2AP1A 4LRBA 3NEKA 3IR5B 3H5SA 3D4JA 2KB2A 4KGZB 3J7Z5 2HGNA 3C19A 4RNNA 4M63C 3EPIA 4QW9A 2DHHA 1PCAA 2H48B 4KH6A 1J27A 3P8BB 3AQOA 5B0DA 3DGVA 4WF9L 2ZFHA 2J9CA 3M8PA 1BGXT 4PKIA 4CBUA 4DL0C 4CO2A 1PYOB 1DKGD 4TVAB 3SMZA 1RTZA 2LVWA 3ID8A 4UOGA 2XS2A 3CC2N 2C3PA 1ZBUA 4USJC 2NREA 5DG7A 4ZP6A 2YWEA 3VCDA 1U09A 1HYVA 1YJ7A 2IMWP 3CF5L 1KLMB 4AT1B 3O9QA 3R9PA 1JXLA 1YAGA 4BG8A 5C2DA 3K59A 3FEYB 1SPBP 4BRLA 1VRTA 5J2MB 2Q43A 1UFKA 1XC3A 4WJBA 2RPIA 3PR5B 5GAHI 1CJKA 5KAKA 3VAFA 4WFYA 3UQSA 4J2DA 4RCHA 4JI7J 1RQ0A 2R2UA 2DNQA 3TJ9A 2PY5A 1ZS6A 2QI2A 4DTRA 4YB5A 1JCFA 3VQCA 2FLNA 3OYCA 1TV6A 4XTTA 2CVEA 2BEFA 4LF1A 4JNEA 2UUTA 1O13A 3TVKA 3BM7A 2P5GA 4ICLB 2Q3SA 1N5VA 4CK2A 5EN1A 2DPIA 1L3SA 1GLBG 2M70A 3HSGA 2DY1A 4NRUA 4DV4F 5KFRA 4KGXB 1RILA 3B6OA 2CA9A 1GXTA 3MM9B 5LL6d 3SQGA 1QQMA 4W5OA 2BGGA 2O1PA 1HNXJ 3SAFA 2C42A 3NRBA 1VSLA 3JTNA 2HWHA 2VV5A 3PZPA 1OYDA 4ER8A 3NCIA 1SH3A 1NJZA 2F4FA 5DS7A 1RT7A 3H4DA 1FO1A 4YB7A 2HS4A 1U6ZA 3EO3A 2VH7A 1CPZA 4RL1A 3HM9A 3ZZYA 5DM6Q 5GVQA 3LGHA 5B09A 1TK8A 1P8GA 3FDSA 4J8FA 2B51A 3AVKA 1R8BA 1JB0C 1Q82O 3PKMA 1M90T 1MU2B 1HHSA 3IRXB 1YK9A 2BKPA 4YQWA 4O3PA 3R2CJ 3KWGA 4IG3B 2RQ4A 5K8PA 4BS2A 2ILZA 1YJ9S 2VJVA 2MKHA 4PWUA 2DNOA 1D9FA 4BC5A 4F4XA 1FTCA 2VC0A 3H42A 1S0MA 2VHGA 3Q83A 2QWQA 3QZ8A 5AQVA 1C0FA 4B9LA 3OPKA 4FYVB 3NMRA 3L4IA 2QA2A 4WP8A 2AF6A 3T69A 4HWIA 4EWTA 4JK7A 4CHZA 4DR4K 4NZ0A 1VJQA 1WTBA 2V6AA 3CJ5A 3OFGA 4L76A 4CGGA 4C8OA 2P2CB 4ZN1A 3DXBA 4J9LA 3L2WA 4WQ5C 3V4MA 1NOYA 3GWCA 3LAMA 3NGSA 3K57A 3U4LA 3BPSP 4HEA9 3QT7A 4GNIA 4DR1K 4FYDA 2JEFA 2E29A 1H98A 3LA0A 4P6QA 1Q95G 4K4UA 4V19J 3IDHA 2CQPA 5E0OA 1VQNN 1OIAA 4FJNA 3C7NA 4CFCA 5GINA 2N82B 4Q45A 4OPKA 2HBQB 3FBCA 3O2IA 1KOOA 2HHTA 5L46A 3GFZA 2LA6A 1VQ9S 1HNZK 2BZ2A 4JK8A 1F3VA 2E66A 4KHWA 3THWA 4YDUA 1J9AA 1U2RA 4DMZA 2W9BB 4QYZK 1YJNS 4OZLA 3C6UA 3OBIA 1HLUA 3R27A 3KK2A 2ZZNA 5C2FA 1TVRB 1Q7LB 1PKUA 2LMIA 1S9GA 3J80Y 2ZKUA 4E1JA 2HIQA 3D2FB 5HOOA 4RW9A 1OSCA 2OZMA 3C6AA 4DFMA 1GXLA 4OYWA 1B92A 2N7CA 5E3RA 2A18A 3GJTB 4WTOB 3CB4A 3N79A 4OHZA 3MEKA 2A6MA 2F96A 4ZVEA 4NCGA 1C0TA 4FZVA 1DY3A 1VDHA 5B0GA 4ISFA 1UJ6A 4DPYA 4LR9A 2RUGA 2W25A 1WB9A 4QIVA 1A7GE 4DCOB 2NXEA 3EXYA 3CCEN 2WBRA 2RKIB 3KOAA 2MKSA 3PW4A 3CIMA 4YOEA 2BH1A 2Y8YA 3G82B 2CG4A 4JV2A 1RHQB 2QL5B 2ZM6K 4XH1A 2OAUA 4B1YB 3KJVA 4W5RA 3AXKA 4M7YA 4RU9A 1T95A 4IOCL 5KPTA 2A5XA 4OPAA 4IO9Q 2NXJA 3SIPB 1XJWB 3N4WA 2HVHA 3PW2A 5ADXH 3KVGA 4YORA 2E1RA 5KG5A 3SPYA 3RMDA 4C0HA 5EY4A 4C11A 1TGOA 3S1TA 2P9LB 1K0TA 4QU6A 3VV2B 5JS2A 3CD7A 4NXMJ 4OJRA 3SCLE 5F0XA 4FF1A 1HBUA 3NF7A 3G9CA 4KB0A 3TAMA 1SJ1A 5E33A 3RMBA 5C15A 1M90O 1JLBA 5EOYA 3OR2B 4MMOA 4QWDA 1S22A 5TKYA 2G4BA 3DXKB 2CAJA 1UEKA 1TAUA 3MPVA 4O44B 3AA5X 3I5CA 2GWJA 3OUYA 1RACB 2GQQA 4ZIVA 3N6MA 2AU0A 2W6LA 3SUNA 3PFEA 4NYFA 2ZD1A 3VZIA 2QWLA 1VBXA 3PHEA 4Z0UA 2W2MP 1RSCA 2F8SA 4IJAA 4ECSA 3Q8UA 4ALZA 3H1QA 2W9AA 1VQ4S 2XY6A 3EZOA 1F3FA 4ZPCA 2O3DA 4ATNA 3HFKA 2CDQA 4DSEA 4ED0A 4FOIA 3R6GB 4ZA1A 2DR9A 3QYYA 4C97A 4A5BA 3M6XA 3OHRA 2LQ5A 1HYSA 1LV5A 2UVVA 1JLCB 1YT3A 3IXQA 7FDRA 3VQ4A 3A4TA 3HYFA 4J9MA 3AD7C 3GCXP 4CM0A 3PTWA 4LMZA 1IO2A 3Q8QB 3LAKA 3OSNA 1HD1A 4DF8A 5AQNA 1RTDB 4KH5A 1SL2A 4IR9A 3WIUA 1FDNA 3T1HF 2Z8QA 2L41A 1AZSA 1NGJA 3MXIA 1LFWA 3VVUA 1RAGB 5KOWA 1AA1B 2XYPB 3CCJN 3RMCA 1PJ7A 3WNFA 2IHR1 4F50A 4ETXA 3A2FA 1U2CA 2CPYA 2GW8A 2XYGB 3BGFA 3NGKA 4LD0A 3VEYA 2ASPA 5IWAJ 2R9LA 1EHWA 4PZVA 4B9MA 1TMJA 4JB8B 1V5IB 2Z1GA 1XMOK 1NHUA 1S12A 4ZLJA 4NLYA 2V2VA 3CCSS 4F4WA 3NGDA 4KI6A 5H1SQ 2BACA 5EX3A 4CF9A 3VEXA 4B3MF 1Q8LA 4MT1A 4OPJA 5SUHA 1QVGM 1W2IA 4NLTA 4OI3A 4ELUA 1D4XA 4MK9A 4B3RF 1XHXA 1VS3A 3ONQA 4CZHA 3QESA 3H40A 4KYZA 3DFEA 3IFEA 1TL1A 3TTFA 3FGUA 1S0OA 4KBIA 5KGWA 4KHPJ 4RWXA 2MKIA 1B9DA 4Y34A 5B7WA 1ZH5A 1X5OA 4UY8T 4GO5X 1V3ZA 4IDHA 3IMQJ 1S6QB 2X1FA 2J76E 2AW0A 3PX6A 4I6WA 5D6GA 1FRKA 2E7VA 1QDUB 3G8QA 2GGPB 2YHWA 1WOOA 3H5UA 4OZJA 4DV5F 1VRQC 4PXDA 3LP1B 5I3QA 2J7UA 3ZSYA 2H51B 2GWKA 2O8FB 2G8UA 2VDIA 2A3JA 1XI1A 2FZCB 3HD1A 4XAKA 5J2PA 4BLGA 3PIPQ 3OYGA 4BRGA 1RAFB 4DPUA 3ZNJ1 4ZCLA 4RR5A 3LWLA 2E9ZA 3FZHA 2F8HA 3B6BA 2E2OA 2E4LA 1C6VA 2UXDJ 4LVOP 1T9UA 1WC5A 3TA1A 4BRQA 1HARA 1S6UA 1IG9A 2G2ZA 4H0XB 5AQPA 4BR0A 3QFPA 3GYNA 3AVNA 5A2QO 4CEBA 4K0KJ 4JI8F 3GL1A 3GBTA 3NGUA 3QRPA 3LGNA 3DU5A 1KQSM 1FK9A 3CEDA 5T7LB 5ETQA 2VWBA 1BWVA 1BISA 4N77A 3MEEA 3E9LA 2GTDA 5GADU 3VN5A 4A47A 2DNZA 4USIA 2HZCA 1IJJA 2XCPA 1S0NA 3SSSA 4QR2A 3LZJA 3AOBA 2JFDA 1RTIB 5G0RB 3JAMO 4AM7A 2IM0A 2ALYB 1BMQB 3HHLA 4LFAF 5F9LA 3EDRB 3NS7B 3M8QB 5GAGU 2V8DA 1NNEA 1R59O 1IR1A 3JQKA 1VSIA 2DGVA 5LMUF 3THXA 2XTJP 4ZVQB 4EYIB 2BXJA 1EJ7L 3HZEA 1TFYA 1TKXB 4NYNA 3EKUA 4K4VA 4EO6A 1UJ4A 4FJ8A 4F7VA 2MZQA 3I8DA 3KHLA 4X4OA 4DTPA 4J91A 2CADA 3MMBA 4FJHA 3C16A 4RTFD 2GVZA 4Y1CA 3OVSA 1C4CA 2YHYA 4P52A 2XY5A 5CABA 1Y3JA 3BGUA 3VEOA 5AQSA 4Y2MA 3TEGA 1BC6A 3I4PA 2HBZB 4LF9J 5AQZA 2GV1A 4PG5A 3OR1A 4DV7K 4M63A 2M3DA 3MF5A 1FA0A 3TWHA 4P71A 3OTBA 5AQRA 4KPCA 3DI6B 4QBUA 3KG1A 2FB0A 3TTCA 2F7TA 5KG7A 1BUPA 2EWHA 1R3NA 2V4QA 2KHOA 3ZZOA 4PPZA 1JCGA 3NF9A 3T9NA 4OKJA 3IA0A 1BQMA 2CKWA 4QWBA 2ZWHA 5AXKA 2RILA 4U6PA 3TI0A 2IS3A 3VQTA 4DV3J 4BRNA 4K4TA 2DFFA 1VSHA 1YTUA 4XIUA 3CXCR 1C1BB 3SNNA 4CO4A 1BY9A 2YKMB 4JYAF 1LXJA 2HHHJ 5HMWA 2DY9A 4B3SK 2MZ1A 1YJ9N 4DR3F 4ZN3A 4UY8O 2R7OA 2IA6A 2JWNA 1YI2S 2GCFA 3KKFA 3ZT3A 4IOXA 5JLHA 1OPZA 1VC6A 2GX8A 3MM5A 4TLRA 4YHHJ 1U1OA 4TU8A 1F5CA 1RTHA 1Q7YO 2PBDA 5E3AA 3LPTA 3M1VB 2JL9A 4HUFA 3SQGB 2Y8WA 3BZQA 4TU7A 4Q5VA 3Q2TC 2R2TA 1JMTA 2ILYA 5D77A 3MR6A 1VBYA 1VCTA 3JS6A 2ASDA 4FNHA 2EFNA 2C2OB 4TY8A 3GJRB 3W60A 3K7RA 5M1NA 3AVJA 1T05B 4Z4IA 2KHDA 2GQ2A 1AFIA 4FK0A 5CQGA 4WFAQ 1REGX 4GVBA 3QIDA 3OBYA 1FXXA 5ITHA 3SLCA 1BHNA 4CJSA 1RT1B 3O4QA 2MHNA 4UZBA 3E1YA 1OH7A 3MPWA 3AT1B 1HNXK 3FZLA 4WKYA 2MKYA 3TA2A 3QEIA 2A6OA 2NUBA 3MR7A 3DOMA 1JJCB 3VF6A 1VQ9N 4ZPBA 3H3OB 3BO3A 1UMJA 3IBFB 1VC5A 4NXNJ 5CAAA 2PYLA 2XEXA 2B4VA 2VCPA 5HMXA 1YJWS 4RPFA 3RB6A 1VQKS 2GA7A 1QVFM 1YJNN 4N47A 2UUCK 3VALA 2F8TA 5KFTA 2HEKA 2YX6A 5I3UA 5C24B 4I9QA 1VFJA 4WXWA 3EVMA 3CSKA 4RNFA 2X7IA 2CGJA 3MN7A 1TFWA 4YB6A 4CP5A 1OPIA 2E7XA 2A3ZA 2UUAK 5KFIA 1VSMA 4LREA 5D4LA 1HWLA 2BJ8A 2HZAA 5GIPA 4H4KC 3J81j 3QB0A 2IVYA 1T3VA 1N0VC 3AAWB 1VOMA 2KXFA 3IO1A 3FKBA 1X4HA 1ZAWA 4EP5A 2EVZA 3T6JA 2Y1RI 3GPAA 3NGTA 5EUHA 4CJ3A 2D3O1 5A8KA 1OYEA 4ZP8A 3AVCA 3M05A 4WFNL 4DR2F 4ZHRA 2JHEA 2G8IA 3MTJA 2IAJB 1HI8A 2HMIA 4CW7B 1EETA 3I32A 4F2RA 1RT3A 1R89A 4WQ5A 4DQRA 1NPRA 4DR5J 1RUSA 1OWXA 1U0HB 2B8QA 1B99A 4J9RA 5A8WB 3GCWP 2PAVA 5AQQA 5E41A 3GIMA 4NEZA 4I1TA 2HWIA 1Q9XA 4DX8H 5HROA 1FKAF 5KG3A 1RT4B 2O4GA 2ADBA 3HVAA 5C5JA 1NM1A 4Y0WA 4PQUB 3BYRA 4EZ9A 1U48A 4NLPA 2PEBA 1M1GA 3BR8A 3GE1A 1JLFA 2VDHA 4Q0BB 3V6DA 4LF8F 4FKYA 5D4OA 2QFJA 3C65A 3PLAA 4ILLA 2VG6A 1FKOA 1C0TB 2CQ3A 3OS1A 1S7HA 3DHWC 2C2EA 3W2VB 2QLBB 5KFHA 3OTOJ 4DV1F 1OVYA 2KRRA 1SIWB 2M8HA 2ZBPA 3EGVA 1FJEB 1KEKA 4OX9K 4DV6J 3MFHA 4ZVSB 2D1CA 3ZYYX 1IQZA 3UNGC 4ILJA 3R5BA 3I96A 3K9KA 4FLWA 3MOJB 1UA1A 1MWMA 3KJVB 2R2RA 1XMBA 4NCAA 2ZBQA 3M1FA 4DBQA 4DTNA 3LF0A 3KLIB 1N0UA 2I1RA 1D0EA 1P8ZA 1QSSA 4ILMA 4FW1A 5T41A 2IA0A 1UPMB 3SXLA 2ASOA 3UR3C 1YWXA 4X64J 3M32A 1YIJS 1S1UA 4EEYA 3L3CA 1FWPA 2BX6A 1NAQA 4QWCA 4C11B 4YOTA 4FBUA 2Z1IA 1VQ6S 4ZLNA 1KLNA 3M30A 2DVIA 3B8AX 2ZBIA 4IDKA 3M6WA 2C3YA 2W8LA 2PE8A 2HBLA 4X4PA 3CM5A 3EEQA 1MROA 2R7RA 1K8KA 3BH7B 4DF4A 4LF5F 3SBGA 1HBUB 3H3NO 2WSFC 1IKXA 4PG4A 4NWBA 3L2QA 1NGHA 2OEMA 3G86A 3T19A 3BKUA 4Q43A 4FPIA 1KQSR 1LOUA 1GT8A 1NZAA 2ZD1B 4CO5A 2GHWA 2CQ2A 1DARA 5JICA 2E2NA 4PUOA 4JI6K 3US5A 4DTMA 3CD6S 1CULA 3KWMA 3RB3A 1RISA 4NXMK 3I0SB 1VHFA 4FWNA 2J0XA 3P1GA 2A1SA 4ZPDA 2EFPA 2OPSB 4QZVB 1PGZA 4KKOA 1Z1ZA 3PIOL 3CJBA 5DM6L 4GKJJ 3ULDA 1H74A 3KLFA 1FNOA 5T14A 4JV5J 4M5GA 4WP3A 2AQ4A 4GV6A 1HBMA 1IBMJ 2P9KA 2EK6A 1JL1A 4M5HA 2AZ3A 4ZCIA 3AA2A 2R4FA 4JI2J 4BRPA 1RYRA 5C2GA 4H5VA 3G6XA 3SSQA 4DL5A 1U1NA 3P4UB 4A62A 1S9FA 1OSDA 4CEZA 3M8YA 3VAIA 1HNVA 3ETOA 5LJVA 2KT2A 3UIQA 3PJWA 1T9TA 4LFCJ 3ILIA 3PO4A 3CJ3A 4CIFA 5F41A 4BQLA 4H0TB 4NLWA 2O8DB 3I33A 1KC8T 1IWGA 4ZIWA 5T7BA 5EXWA 4EZ6A 2JWLA 1OMSA 3CCUS 2LDIA 4OZ0A 3UKUB 2RB7A 1Y7PA 3M3ZA 5BXIA 3AJDA 4C9DA 2CRLA 3V4IB 4EP4A 1UFWA 3OLAA 4C8KA 3Q24A 5MAOA 2ZHAA 4FPAA 3PM9A 3QGPA 4HI2A 1WC0A 2ROGA 4HTJA 1FCAA 5KT2A 4JN4A 1OY6A 3NDKA 4BWMA 2HK3A 3R5JB 3PYGA 5ETNA 3CJ1A 3ZSQA 2JH3A 4HACA 4N8NA 3U1MA 2VA2A 3T5JA 4CJVA 2AJ4A 2BM0A 2GIRA 4JI1F 3PXGa 1G3OA 5D3GA 3MUTP 3JSRA 1FWLA 3HSJA 1I94J 1KAYA 2LSNA 3TANA 4DLEA 2E5IA 4WXOA 2KFNA 3QIPB 2C3MA 4O8KA 3ISNC 3WEEA 1XUPO 1Y64A 2LXUA 4IYQA 2AYGA 4RW6B 1PILA 1VI7A 5GAEI 1R0BG 4ERDA 1BOTO 4CH7A 2IVOA 3KKSA 1T94A 3BSCA 1VBZA 3KJQB 1W2BM 3ET6B 3IP0A 1CBKA 1F1BB 3C3LA 4QIEA 3AVLA 3EJMA 3MUVP 2WB1D 1BE4A 2JC1A 2FSJA 5KT5A 2Q1NA 4GO7X 1G7CB 3R6LB 4DV4J 4O5BA 2ZGYA 4CIOA 1KVAA 1U24A 3QJPA 2YCHA 3I82A 4FN5A 4GMJB 4CTAA 2WAQD 5KFSA 4QWEA 1HWIA 1ZTTA 4DUYJ 2GEMA 2XZTB 5KRTA 3HHNB 3ENWA 1OY9A 3SJHA 4CZGA 1O51A 3AAPA 4W90B 1E6YA 2YHBA 2HIYA 4OL8A 3L7UA 1VQLS 4BCAA 3VHQA 2E6LA 2K7JA 5ELZA 4X4RA 2DHAA 5GIOA 4K0KK 4PXBA 5J2NA 3MMAA 2X1AA 4EU0A 1KWMA 3NS6A 1S48A 4F0MA 3QNNA 3QAUA 3C14B 3C15A 4P9SA 3GFHA 2JWKA 1W97L 2A42A 3LPUA 3VAHA 1E6VA 2VQEK 1ITPA 2VPXB 3HP6A 4WIIA 3MMBB 5KFYA 2GC8A 3C16B 4BC2A 2VPYB 2O4IA 4LF7K 5DM7Q 4A61A 1SJ4P 2YKNA 5L9NA 2G1DA 2AGOA 1WI6A 2OP5A 3U7JA 4LF6J 3D1HA 4ZMMA 3CPWM 1NMNA 4M3ZA 2V68A 1AW0A 2I8EA 3T1YF 3N9UC 1M1KT 2FQQB 1XN9A 3H46O 5M1QA 4P2XA 2ZWPA 2PA8D 5AQXA 1KC8O 4P7VA 2CQ4A 1BI4B 3EL2A 4U7CA 1KN6A 3BQ1A 4KH0B 1FEHA 2B7CB 2EBGA 3V2UC 1L3TA 1KKHA 1U1QA 2DXEA 2FGOA 5F3TA 4CHPA 3DHXA 4BBYA 2AWZA 3D3BJ 3ZTOA 1SV5A 3BDPA 1SKSA 3MM8B 3NP5A 4X62K 1ZPWX 3PRDA 4AHTA 1G6BA 4LFBF 1BWEA 1Q79A 2IM1A 1KFSA 2PMHA 2ZJQQ 2FSNA 3HSCA 1HWKA 1WG5A 5GAHU 1NUEA 2K06A 4YOVA 3W63A 1XNQF 2H3EB 2IMOA 3CJAA 3AVIA 4JI3J 2KYXA 4DTOA 4DQPA 1X4FA 1NGBA 1DQAA 1YBUA 1NXIA 1YJWN 2B5JA 4OI0A 3F73A 2VFRA 4IUFA 4KB1A 1X4CA 3BR9A 1ITGA 5EX0A 4FSVA 1YBAA 3MR2A 2FLOA 1IR2A 4CGIA 4JI0F 3I6PA 1CS4B 3N28A 1FEEA 2ZUAA 3H2VE 2YNHA 1HRHA 1CVJA 3A8IA 1NHKL 2QWOA 1VC0A 3Q23A 3Q8RB 4NO7A 5F8IA 4KPYA 3DLKB 1EWQA 2U2FA 3QBCA 3HJVA 3BGLA 4RNHA 5AQLA 4Y0FA 1S1XA 2FSKA 3UFCX 4H4MB 3NGYA 1J5EK 2J0WA 5K8MA 1DAXA 2O8CB 3RRHA 4F36A 1GX5A 2CPIA 1HJRA 4KC5A 1HI1A 4GKKF 5DQIA 1D1UA 3UVJB 1RAOA 3HF5A 3IG1B 1T0TV 1TUWA 1WEZA 3CMES 2D0CA 2V8VA 2GZOA 4N8OA 1HQUA 2C1EB 1FD2A 2FBYA 1TK0A 2EK1A 3TAQA 4IQXA 3PIPL 1HNWF 3OS2A 4OFZA 4FO0A 2DNNA 2JLGA 2DCLA 4X65J 3QMQA 1RGIA 5IZHA 2XRIA 4RJVA 3T5KA 2C2RA 3E51A 5DG8A 3RW7A 1N36J 4I4BA 4OX7A 1VJWA 2YH1A 2P9SB 2WONA 1GOBA 3I5BA 4HTUA 2C3OA 2KM8B 2Z1JA 5AZJA 3H5XA 2LEBA 5E7OB 4DLGA 3HP9A 2J6TA 3RVCA 3KYLA 1Q9YA 3M2UB 4ZVFA 1BQNA 2XSJB 2VOOA 1PYSB 1N32J 1YZ7A 3NBPB 3UN5A 2UXCF 2X1GA 3L2VA 3PX4A 4CBXA 4YNQA 1BQXA 2DITA 4A8MP 3W0LA 4LQ9A 3TX0A 2LU1A 3L6QA 2W42A 4G1QA 4DN0A 1UOCA 3GOIA 3VEWA 4RUHA 1X8DA 2DH8A 4CZJA 3HOTA 4PA1A 3LWMA 6FD1A 4OLPA 3HMJG 1J53A 4YUDA 1SC4B 2POKA 1CJUB 5CY4A 4DFPA 4DPOA 1YBTA 4H4KA 3A3PB 3JQJA 1S79A 3QNOA 3M6UA 2P9CA 1ZBSA 3PSIA 2FGCA 1FXRA 2DPNA 5KFVA 1M1KO 1AROP 1NK6A 2G9OA 2I7NA 5GAGP 2XYHB 2AX1A 3UCGA 1UWBB 1RKIA 1JK9B 3A5MC 3OHBA 1PO6A 2DY4A 4CJKA 4CFAA 1PJ6A 4AFFA 1YIJN 2XULA 2HNYB 2B9YA 4P7TA 1TKTB 1SIZA 2AGPA 2HNZB 1ELOA 1VQ6N 3MAHA 1RDRA 2YWFA 3MN5A 4GC7A 3EN9A 3J7YP 3CF5Q 3UKRB 3BSOA 2ABYA 4F4YA 3W3DA 1RZMA 1QTNB 4CJTA 2ZNZA 4Z4GA 4E7LA 2QV6A 3T1HJ 4YP3A 4DR3K 1R8HA 2A2CA 1YQHA 1RT6B 1QS4A 3O9TA 4JV1A 1ZBFA 3HPOA 1GQEA 2ZH8A 2WVCA 3MECB 2B4PA 4O0IA 2U1AA 1NPKA 3W8GA 4LSLA 1ZPVA 4H5NA 5EGYA 4BRKA 2B6AA 1R6YA 5CZVA 1UETA 3MFIA 3QRRA 2J0QD 2DNHA 4FWMA 4L72B 4JAXA 2UXBK 2MJUA 3D0PA 2MGZB 4F02A 4U7BA 2XY7A 4B3RJ 1RDAA 3U3GA 1DTQB 2MXYA 1RHMB 1RADB 1PAUB 3HCXA 3DCAA 3FSXA 3KUHA 4CM2A 2OTJS 1FJGF 1U8SA 1RP5A 4ZPVR 2IJFA 5LSLA 2XNQA 1HD0A 4CZMA 4O55A 4LQ3A 3UDLA 3MM6B 1H73A 5IM0A 1HUXA 3SMPA 4KRWA 1IKVB 3OYFA 2LA4A 1GTHA 5J2QB 2E44A 4DV5J 2CPFA 4K4SA 4AQYK 2GHVC 4TKTA 5CYQA 1C2PA 1QAXA 2VKZG 1RLDA 3O5BA 3S7RA 1U7LA 1XTZA 4OI4A 1YJVA 2FC0A 4BRDA 1K8KB 4DTUA 1WC4A 3EM1A 4C8ZA 3W5XA 1NOZA 3BV8A 2VGNA 1P9QC 3CCUN 2WSCC 1YITS 1VQ8S 3NS5A 4OPHA 4X64K 3JSMA 4JI5J 1SC6A 3KTQA 1KOHA 4GC6A 1YLXA 2RQMA 2P9PB 5CD4H 1M5KC 4B3OA 1N34K 3CJ0A 5LXRA 4CF1A 4CF2A 4HCBA 4RW4A 3CIZA 4PUOB 1J54A 2GJFA 5BRDA 1R0CB 5ETMA 1RFQA 3M8SA 3K58A 4FM0A 4JI8J 4DR6F 3BBFA 4K5RA 4I68A 4DL7A 1S76D 4HHJA 2IBOA 2HG4A 1VIOA 2QLJB 2EKNA 2XBPA 2F65A 2J8SA 3VQ7A 3RRGA 4NA1A 2BE2B 3UE5A 3UDCA 4ZLLA 2D7SA 2ZH2A 2IVNA 5KFDA 1LXNA 2FVSA 3DMJA 1SQGA 4FZYA 2YWGA 3ETMA 1X3MA 2FJXA 4JI4J 2K3KA 5H9EK 2RRBA 4LFAJ 3L0QA 5ETVA 4AF1A 4KHYA 4PHTX 2QTWA 4NA3A 3DRRA 1VLOA 1C1CB 1VQ5S 3H8YA 2GVDA 5LMUJ 2E5LK 2RJZA 4FYXB 4P2MA 5HANA 4FLXA 5F8LA 2V7YA 4K25A 2MSTA 2MYFA 1DTTB 3V9XA 3K5NA 3D1QA 2W41A 1JLQA 2IC3B 2D5RA 3MWTA 1M5OC 2X3GA 1N5TA 4M5NA 3HI0A 3ILOA 2Y1JA 3CQXA 3UN3A 1QUPA 1RHJB 2VQFJ 4JD2A 2W1BA 2D74B 1HA1A 2PDAA 2HAFA 3E9PA 4E7IA 2XZWA 1PG5B 2PO4A 4ZVHA 2BM1A 5FLXY 1JXEA 3DRPA 1PBUA 4HACB 5M2PA 4BR5A 3QFUA 3LP3A 4DR4F 2GUIA 3AY9A 2E9RX 5JS1A 2F4VF 3KD1E 3HRGA 1VQLN 1HI0P 3FE1A 3W5YA 3H90A 1WNSA 4YOWA 2BKNA 2Y9HA 1UVJA 4C0BA 2NPIA 4DR1F 2PC6A 1R8AA 1KLMA 3ZFVA 1RWNB 3EVWA 1HMVA 3EZWA 1YTAA 3O1LA 2Z2MA 5J2MA 4FJGA 1UEVA 2M4MA 1NSKL 3M8RA 1HNZF 1WHWA 2VF3A 3PFOA 2WTFA 2VZ9A 1VBKA 4JYAJ 3ZX3A 4JKHA 1JLEB 4DX5A 4FWSA 3I31A 5FROA 4ED1A 3GFYA 1I94K 3MHYA 5E2QA 3BN7A 4I6YA 3R1XA 4FJJA 3KHHA 3SSRA 1XMQK 2KJVA 4IJNA 6FDRA 2NRWA 3B4MA 5AFUH 1JX4A 2IVMA 3ENHA 1VSJA 2E1ZA 4QW8A 1JQGA 2MDAA 5LT5A 4USTA 5LMNK 4IFEA 2GMLA 2VU5A 2JLEA 3ZZUA 2HB5A 2E1AA 4K8RA 3DAWA 4B3TF 4ICLA 3C8YA 3WNGA 1KVCA 4C98A 1F5BA 3WX4A 5LM7E 1NSQA 1XR6A 3SFGA 1E6YB 5M1PA 3ZSXA 1T9YA 4OJ1A 4A8WA 3TRGA 1HHTP 3MM9A 1ASWA 2FUG9 4OZ3A 1JJHA 3AHPA 3IKMA 3THYB 3CULA 2H54B 3UDEA 2WHOA 1KTVA 4ZJLA 5C7PA 4ZVOB 3E01B 2E2PA 3C15B 3D28A 5CYMB 2IRYA 2MQMA 2V34A 4QU7A 3FCVA 1TL4A 1E6VB 2G8WA 3GDQA 1WSRA 4HHTA 1TUUA 3G2XA 3DC2A 2ASMA 3DM2A 4BC9A 3PRBA 4NLUA 4CEOA 3VOVA 5FPEA 1L3UA 5H1SV 1WSHA 4CJPA 5KFCA 4ZVGA 1MW7A 1IKYA 2YNGA 1QE1B 2YKNB 1NDKA 2ZWOA 1MU2A 3IRXA 2IIHA 4M7XA 4BACA 2F63A 4DDFA 1NH7A 1T9WA 2DH9A 2P9EA 4IG3A 4M3XA 1J5OB 2FHJD 4BE1A 4DQIA 1TL3B 2CPHA 1FRJA 2C2NA 4KV8B 1HQEB 4PG7A 3CCTA 2KDOA 3R5GA 3UR0A 4TQRA 1S57A 4W4MA 1SC3B 4MK7A 3KXDA 4O0NA 4JUZA 4PQAA 3GILA 4DPWA 2R7SA 1XNRJ 4E98A 4BE2A 2UP1A 1NGIA 4CEAA 3PHTA 1Q4RA 1XK8A 1SV5B 4K2XA 4QIWD 4YY3K 2PA3A 2WBMA 3RBDA 1HWUA 1FRLA 1SQFA 2L9DA 3VERA 2NXNA 1CEZA 4BR2A 3VAMA 2CPJA 4DR2J 3PW5A 1K47A 4G65A 4OYZA 2QZ8A 2L9NA 4MIWA 2RHQB 4Q8EA 4CFDA 3CMEN 3ENQA 4N56A 4LR7A 2R7VA 2K8GA 2JSXA 3DDKA 3CPEA 4YOXA 1NM2A 2FVPA 3LPEA 5AQMA 4F0HA 4OMFG 1X3NA 3ZETB 4C1NI 4X66F 2J8AA 1RU2A 3BREA 3TSPA 3CCRS 1EKRA 1PJ5A 1APSA 3LOUA 3GU0A 2GBZA 3BEGB 5L39A 3O8WA 1RABB 3LDOA 2W9BA 3AAQA 4K4XA 4AE5A 3VPZA 4WE1B 3S01A 1OQ3A 4NMLA 1Q8BA 3DNCA 2D9PA 3GIIA 2IRUA 2QLFB 4M3RA 2FY1A 1TVRA 3KFWX 3A8JA 3M6VA 1EARA 1IUJA 3D2FA 4MLHA 2X78A 4CWBA 3WIVA 1U26A 4DV1J 2KLAA 4R0EA 4K8ZA 1IJFB 1RHUB 3AGKA 4A8XA 2CJYB 3G71N 3FCWA 3ALYA 3AQPA 1UFLA 5HBMA 2HBYB 3FZKA 4ECZA 2HBMA 1D8YA 4R5PB 4EI2A 5FJ4A 4DN9A 2Y0BB 2OJ3A 1CZBA 2QX0A 1HQUB 2BV3A 4YR0A 5EVZA 4CLWA 3MPYA 4PWWA 1QJHA 1B7FA 1Q86T 2NRHA 3SFUA 2UU9K 1IN0A 3G82A 1I5OB 1V3RA 1R0AB 2QXFA 3EVOA 4CJWA 1VQPS 3QICA 2FJDB 1M0SA 4IH7A 3D7EO 4H0VB 2RD5C 1LW2B 4ID1A 2KXHA 1VK8A 2AYBA 3VA0A 2M5YA 1FF2A 4ELTA 1OH8A 5KG1A 4LF5J 1NKEA 1EQ0A 3QGGA 2P9LA 3IFRA 4LF2A 3BO2A 4JKEA 4XDDA 2W4PA 2W40A 1Z05A 1QQNA 1MWZA 1DT9A 4ZK7M 2RNEA 3POTA 2HBRB 5K9FA 2NRVA 4CJQA 3O44A 3OBWA 3CCMS 1SL1A 4C6AA 1F60B 1JCEA 1U2VB 1K9MT 2XGQA 1G4CA 4NLRA 4WU3A 4J2BA 4F9OA 2UV8A 4IXCA 1S5JA 3OR2A 2Y1IA 1NU4A 2OPQB 2OPRB 4M5DB 3DXKA 1WC6A 3T9ZA 4ED4A 2NQPA 4G9ZA 1RI7A 2OTJN 3IM8A 3AVGA 5CD4A 4DFJA 5HQ8A 1NK7A 4F4AA 1S4FA 4QAGA 4OV1A 3EZ5A 4BQZA 4UUXA 3V6HA 2NLXA 3GTYX 3G10A 3KHGA 3OSPA 4NYPA 5CH7B 1D09B 3IMXA 1JNZB 3DU6A 2D0PA 4A57A 1VHXA 1NDLA 2AMCB 4TXSA 3LM9A 3CE8A 1B0VA 3CO0P 4Z94A 3HHKA 5EDWA 4BRFA 3FRZA 3D2WA 3VQEA 3EGNA 4CDIA 4CJ4A 1JLCA 2IM2A 3AA9A 4N7TA 2V7ZA 5DGBA 4DV2J 5D0GA 3CQYA 4ED5A 1YITN 2X6NA 3VGSA 2P8IA 2MLXA 1UAWA 2ZUGA 2HFVA 4W5QA 5L1IA 4KTWA 4JI0K 1RTDA 2EC0A 3TW0A 2W7AA 3H5YA 3OL6A 4JP8A 4A2BA 4BC3A 2ASJA 2WSEC 1HR0F 9RUBA 2A10A 1UVMA 2F7VA 3VVTA 3QMLA 3OFFA 3W3SA 2C2ZB 2H3GX 2R8JA 1IM6A 3A8YA 1PBAA 1LK5A 2QSFA 2IYIA 3HI9A 3MAQA 4WYWA 4HKQA 3DOLB 3HVRA 3J80U 2LXFA 1UW9A 3SK3A 5IQQA 2W2PP 5D4PA 4CLPA 3PNIA 2C28A 3OJSA 5GAHP 4HTLA 1UEUA 3TR8A 7FD1A 5HRNA 1WKKA 4RUCA 4O5FA 5CYQB 1EKEA 4C8NA 5CA5A 1VQ5N 5KFGA 1S6QA 1RWKB 2PYJA 2NLWA 4BR4A 3RR7A 4I69A 3VQ5A 1D9DA 3VQ6A 1HW9A 3LP1A 4B3SF 2FBTA 4PRFA 1T03B 1EWRA 3ZCMA 3B8HA 2E5JA 2O8FA 3Q7CA 1U1KA 3AOAA 1Q86O 4E2FB 5KFWA 4M5KA 3QEPA 4RW4B 4NLXA 2NZTA 4NPOA 4C0OC 3CCJS 4HTIA 5K8NA 1SJFA 2QA1A 2UXCK 2UZAA 2HFNA 4K2JA 1ZM3A 3SZ2A 3QEVA 3PSFA 3CC7N 2V51B 3MCSA 9ATCB 3KLGB 2XMMA 1A5XA 1URRA 3ENBA 4CZIA 2HBKA 2V2ZA 3HVWA 2HK2A 3NGRA 3ATUA 3P5BP 2GO8A 5AFUA 1X4BA 4NA2A 3LO3A 1TZ0A 2BRKA 4CZKA 3K0JA 5C2CA 5T7LA 3U8XA 3DRXA 2HF4A 3MCOA 2KKZA 2JVOA 3EUNA 1Y5NB 1K9MO 1QM9A 4WQ4C 2OEJA 3T5LA 1WKJA 1FJ7A 3NCRA 3R8YA 3E3XA 3L09A 1HNXF 1FJCA 1S77D 2HQCA 1IQTA 5KFQA 2YNIB 3FCHA 4DV0K 2C3UA 5G0RA 4NL5A 1GK8A 1CC8A 1UJ5A 4WFNQ 3CIPA 1KCFA 4CCHA 1JLQB 2DPJA 2R8HA 3M8QA 4FJ9A 4KI4A 1MN9A 3KHRA 5IFMA 3A3NB 3HULA 2UUCF 4KGVB 4CEDA 2H5IB 1JJ2R 2Z4PA 2QA4G 4I2PB 2CFXA 3GONA 4A5AA 2LQJA 4CLTA 3VGMA 3WXLA 2E6MA 1BCOA 2IVFB 2MQ8A 4OZNA 4JKBA 2BJEA 3T1YJ 2UUAF 4KAIA 3SQ4A 3OV7A 4DR7J 4M1KA 3DRPB 1RAHB 1X5TA 4Z2XA 2NSCA 4I64A 1H2TZ 1MSWD 2Q2RA 2OIHA 3M8WA 4BGBA 3VA3A 1S5ZA 3BBCA 3OVBA 1SH0A 2J9DE 3PEJA 1FKPA 4CECA 3CJ4A 3TARA 4N76A 1WELA 1FTRA 3GB0A 3IAYA 1WC1A 1FJGK 2PEHA 4L74A 4ELVA 5AQOA 2CPZA 3TTDA 3CJKB 4A4JA 1X60A 1N33K 3DI6A 4LFBJ 3RB4A 5CHIA 2BUPA 3FQKA 1HMVB 3UE2A 2FF3B 5EHHA 4CK3A 4C4WA 1SH2A 5ETKA 1WBBA 2V94A 3D54A 1U0SA 1KD1T 2AJ1A 1XNQJ 2LQ8A 5B0CA 2VFSA 2ZDOA 1F2GA 3Q7BA 1CQMA 2R3VA 3E66A 4ZKAA 2NCKL 5GAEU 4XPCA 3OW2R 1FI4A 3FEXB 5IXUA 3VGUA 1RA7A 3I0RA 2GIFA 2OSQA 1T9VA 1VISA 3FUYA 5DDPC 2NRTA 2ZHBA 2JC0A 1C1BA 3B6PA 1FDAA 2YKMA 3JYTB 5AR0A 1QQCA 2J0SD 3KDOA 5KOXA 1NSPA 3IR6B 4C23A 3T7ZA 4FVCA 3A0IX 3A3OB 1EX8A 1SJQA 4I6MB 3PR4A 5HN0A 3VGLA 3D67A 2KJWA 3UPFA 3ICLA 3GJQB 1WSFA 1Q81T 3ENVA 4DL4A 3TSUA 3CD5A 3ZSOA 3D9BA 4DCJB 3CMAS 4DR6K 3M1VA 2FIUA 3BJYA 4DZ6A 4ECXA 1KVKA 2OMLA 8RUCA 4DPTA 4IEEA 3VWSA 2XMJA 4OX9F 2DGOA 1XEZA 1ZBHA 2IDOA 4DU8A 4CK1A 4GKKJ 2PI4A 2IY5B 4OYIA 4LRDA 3R5DA 1V6HA 1BUXA 2O8BB 1YKWA 5K8OA 1WJ9A 4WK1A 5LOQA 3PVXA 3J7AN 1CSJA 3Q2SC 2RRAA 2EC2A 2YKQA 4YDDB 4WYBA 1T05A 4MQ3A 1QHAA 2V50A 2V2KA 4WU2A 2YX4A 3J7ZT 4U8VA 4D3GA 3DM2B 4X4VA 3TO8A 3PIOQ 4LSNB 1AUSL 1T7PA 2HQIA 1N6QB 1HKAA 4S0MA 1RT1A 4Q8FA 1IKYB 2YNGB 3V5RA 2BRLA 3I5AA 2DRAA 3TZYA 3P31A 2AJ0A 1Z26A 1Z6RA 3CCRN 5H9FJ 2MB0B 2HGMA 4B1UB 5CR4A 4C3KA 1LKZA 2MJNA 1BHLA 5BR9A 2KM8C 1NKBA 4USWA 1DFDA 1SZ2A 4OYPA 2PFFB 1K6YA 1YRTA 3ELHA 5GMEA 2HSTA 1H7WA 3AH6A 1HFEL 2RF2B 2QKKA 2W24A 1MWYA 1IBKK 3ZSZA 3J81Y 1F0XA 4C8LA 5AE3A 2BJDA 1YSJA 3DRYA 3PDNA 2F9TA 4K42A 3VTIA 2CQGA 5C24A 3NH0A 4FCYA 1RLCL 2COLA 5KFEA 1B70B 1K44A 1RDDA 4ED3A 3AA8A 4JI6F 2C2KB 1WF1A 3QJJA 2MZRA 2XS7A 4H8KA 2I9SA 4NXMF 2J9EA 3SJJA 1Y9OA 2XG8A 5BR8J 3DLRA 5KGXA 2HFUA 3CJTA 4IEIA 1SI9A 2F4VK 2B8PA 2FBXA 1FVQA 4FNIA 3G6ES 3EZUA 3NL0A 4DUZK 1N48A 1ZM2A 4OV6A 3DDNA 2QGFB 3OYHA 1RB0A 2GNKA 1DZ5A 3PW0A 3ATVA 4AYBD 2JEGA 2V0NA 4HHHA 1HPZB 4RW7B 1W26A 2IAJA 5MLCQ 1M1HA 1VQPN 4G3IA 2E1PA 1HKCA 1NMDA 3A1YG 3VQ9A 4JEPA 2AP6A 3N4PA 1EAYC 1VQYA 4P74A 1U0HA 2FC9A 2P6TA 1DEJA 2K1RB 5A8WA 3TR5A 1YRXA 5IC4B 2OH2A 1UL3A 1ZAXA 3QINA 4FXWA 2HS3A 3D0IE 2H5JB 5KFNA 3CXCM 4J9VA 1NK4A 2XLKA 2DGWA 2PIIA 2M0GB 5AXMA 1KD1O 3B54A 1RT4A 3G8TA 3OS0A 3FZBA 1TYQB 4P75A 4PQUA 2HKEA 3CCMN 1NJYA 2CH5A 2JGUA 1GOCA 4CLFA 2CJQA 1U2FA 4B3TK 3J7YI 2CQDA 1UZDA 3TZZA 4Q0BA 4J7CA 1K1SA 3W62A 1HIYA 3QSIA 3OLBA 5HBMB 4Z37A 2KQ2A 4GMKA 3OFEA 1FD8A 2JVRA 3I8BA 1ZYQA 1RYSA 7AT1B 4L6V3 3AARA 2KO1A 5A6WA 3W2VA 1B7YB 4CLUA 1HX1A 1P9YA 2X51A 2QG9B 4XO0A 2UUBK 1I3OB 1RTJA 3LH2S 5A0YB 2HPUA 1Q81O 5HP1B 2QEXS 4HVJA 2N4DA 2CNOB 3QZ7A 3FC9A 2J7KA 3NCQA 5HSPA 3EPGA 1UP1A 2G8KA 2LP4A 3J7A1 4CZCA 3LDNA 5JVGQ 2KG1A 4CJFA 4E0DA 4WYLA 4MAKA 3KLIA 4TY9A 2DNLA 1NNDA 3CCVS 1NPPA 1WHXA 4AL7A 4ANDA 3VENA 2PN6A 4CLYA 1RBSA 4ZITA 4A8SA 3M5RA 4KHPF 1NEEA 2LDYA 1NLVA 2OD4A 4IQMA 4BDPA 2XGPA 4O3QA 4NLCA 2FVCA 5TKWA 1NGEA 4ZOSA 3SCKE 1X0PA 3J7ZO 2DHGA 3SBMA 3LDQA 2BMBA 3ID6A 3Q8YA 3POTB 3V81A 2JDJA 3F56A 4URQU 2OPPB 1TL5A 2GMHA 1LWFB 3M2VB 4OIXA 5KQ8A 4KO0B 1X4EA 4W5NA 3FSIA 2R7YA 3DOKB 1MWQA 1OQ6A 1RGVA 3D6MB 4U95A 2EBEA 2FLLA 1C0UB 5DJBA 1ZBIA 2ZZMA 3NF6A 5KT4A 2HW3A 4ID8A 5FIIA 5K20B 2QWPA 2I0XA 3I0SA 2YY3A 1JLAB 3GQCA 2DO0A 4L3KA 5C12A 2OPSA 4X4SA 1N4LA 4K0KF 3IR7B 2FVRA 1S1WA 3RAMA 4HH1A 4L8RB 3MXHP 5DLGA 2XLJA 4ZTFA 2P9IA 1RWUA 1ZC6A 2DRDA 2UVUA 4URSA 3NOCA 3PKYA 3S9HA 3NMUA 1WAJA 1P1TA 1XHZA 4OVLA 4IRCA 2HFSA 1X5SA 2ACYA 4PXCA 2VQEF 4CYUB 5DDQC 3MEDA 1MA9B 1SCJB 4X66K 1OJ4A 1TELA 1CLQA 4L3NA 1WHVA 4M3WA 3DXSX 1X9MA 3RBXA 3R1HA 1U1LA 4LF7F 1BA0A 4EFHA 3R9LA 1SJ3P 1IBLK 2O8DA 4CZEA 4RNMA 1UA0A 2D4WA 4GW6A 2QW9A 3IWXA 2BJ9A 3I9ZA 3D7SB 3UKUA 1HQ2A 4BDZA 3UCUP 3NWGA 4USKA 4NEYA 2VIHA 2W2OP 3V4IA 1CJTB 4PAAA 5M2RA 1X9SA 1YVFA 4CIEA 3HSDA 2H65B 3NGIA 4OYAA 4M3YA 3RSEA 4NLBA 1V5VA 4B8AB 2W9CA 3HPHA 2P9GA 4B9TA 1S9EB 2EFVA 1Y10A 4EMDA 4BR9A 4BRHA 4LUBA 3L7PA 3NH1A 4Y3CA 1NZ8A 5AJ3K 4X62F 5IT0A 4ED8A 2NRZA 1FWKA 3CDWA 5LJ5Y 4DR1J 1WG4A 3DLGB 3ITHA 4FWKA 5JVHL 2MPUA 4PWDB 4AUKA 3V9ZA 2CQHA 1DBDA 1VRUB 2DYAA 2NS1B 3V9UA 1HNZJ 1SC1B 1VAZA 2K3IA 5AQUA 4WK3A 4DHVA 3QIPA 4BGAA 1DLOB 3PG9A 3OYJA 2DNKA 5FD1A 4RW6A 3V9SA 3SCJE 5FDLB 4QYZJ 3MD1A 3QSYB 4MKYA 4YMEA 4AM6A 2RE1A 1S3XA 3TX8A 4JKFA 2OANA 3FSYA 4FPRA 2QJ3A 4IOBA 4AD6A 5IT9U 3BY5A 3E2EA 2GS8A 2XI3A 2ZE2B 3ET6A 4XK8C 3KLVA 1Y11A 1YGYA 2HHHF 2MQQA 3M6GA 2WVFA 2ZVIA 1NG9A 1NBWA 3W66A 5KG4A 1WUAA 2YKOA 1J5EF 4LRAA 5LXYA 2Q6BA 5KFXA 2VYPA 4A8OA 1NB7A 4DCPB 3QFWA 1NCLA 1TKZB 1JKHB 1YVUA 4QPTA 4FWRA 4LF4K 2O67A 1VIXA 1KAZA 5C25B 1RU1A 3U27A 4C3LA 5HQLA 2VPZB 4UOHA 2OGUA 4A8YA 2ZM6J 4XEIA 5HJYA 5ETOA 3VEVA 1O6XA 2DNMA 5SWMA 1VMBA 4EO8A 2ATLA 4WQ4A 2CJKA 4ZCMA 4AILC 3U1LA 2DB1A 2XM3A 3ADAC 3TVYA 2MQNA 3KMSA 3C14A 2P9UB 4CLLA 3O9UA 2E1MC 2VFUA 2D3UA 3R7BB 2SXLA 2ATQA 5A76A 2BOAA 2FHKA 3NAIA 2KTQA 4Y6IA 2WVEA 4MDAA 3HT0A 2QK9A 2E1CA 3W64A 5D78A 3TUZC 1CJVA 3GG1A 3LW5C 3KG4A 2R7TA 2MKKA 1LNQA 3MTKA 1N8RT 3VMFB 2KVQE 4NXNF 4FF3A 1BCMA 3OYMA 1ZTWA 4P2SA 2A1BA 1REVB 2OLWA 3WBZA 1HR0K 2AKWB 4RBVA 3KZBA 3DLEB 3CMAN 1QAJA 2DISA 2HSEB 3OXGA 3ZTSA 1IVZA 1KNZA 1J2VA 1FKPB 3NH2A 1VQMN 1BI4A 2QSWA 4YR3A 5A8RA 1IJEB 2VFVA 4NOHA 4Q2LA 2KHCA 4I2QA 2AIRB 1N52B 2FLPA 4N5SA 1EXQA 4M95A 2ZVSA 2BOPA 3MEGB 4DSKA 2ZOMA 3EGWB 2VL1A 4O3SA 1SL0A 2XWYA 2XQCA 2IM3A 3R1LA 2NUUG 3MM8A 4QR0A 4FVMA 4DL2A 3AGRA 1LWEB 3DGPB 1XWLA 3P83D 3I0RB 1NDCA 4FF2A 2LFVA 2XMTA 1CXUA 4OI1A 1NB2A 1GLAG 4R79A 1GMUA 3NNHA 3AY0A 5HO4A 3GV8B 4HDHA 2DCUB 3CDBA 2QRRA 2JNJA 4KHQA 2R7QA 1ZETA 1UVKA 4O3NA 3OT9A 4CLKA 4JI7K 1V4TA 2B0GA 1XMOJ 1I39A 4Y2CA 3ZC4A 1CS4A 1R7IA 1S7IA 2B4JA 5HRRA 2UXBF 4AL6A 1OS5A 2I7PA 4IFVB 1NGAA 2ALZA 2P9NB 3VR1A 2BQ3A 1CQNA 4EIAA 3DLKA 1SQEA 4QJVA 3TUPA 1V9OA 4KGKA 1F9FA 3VF2A 3R97A 4MYTA 4H4MA 5AQTA 3G6EN 5LJ3Y 2O8CA 5IV4A 3ZZRA 4B17A 4DQSA 3H0PA 3D0HE 2YTCA 3P39A 4BRMA 3KLHB 4DTXA 2ZBCA 5F0WA 4K4ZA 2QLWA 4CVNE 5KFFA 4CF0A 3MMVA 3UVJA 3O6WA 2DGQA 3FFIA 3IAM9 4DV6F 3IG1A 1EP4B 4M3UA 4AQYF 5KI6A 4J5OA 5K14A 3MAAA 3GP9A 1DJ0A 2VA3A 2WBNA 2W2QP 3OXLA 4HI1A 3QPIA 1FX2A 4IFYB 2GELA 3RBEA 5EU7A 3QT5A 4UZCA 1E3MA 3SI6A 3MCNA 3IGVA 4DEZA 5AXNA 2EFQA 2RSQA 4TNOA 4X64F 4CEQA 4IH6A 2MY7A 3UD3P 1Z25A 2P9SA 2VODA 4PY5A 1KFDA 3HHEA 3HSZA 3PY8A 1R8PA 4QQBA 1N34F 4B08A 5ADXA 3IN5A 2GV9A 4M8LA 3M2UA 2Y0SD 5F9NA 4C8YA 3ZLJA 2XSJA 3IBWA 3ZSWA 1FHTA 3NBPA 1XERA 1A9NB 1BIZA 1RT2B 2VBWA 3G8SA 2MKCA 4IG0A 4H4OB 1U1RA 3DLBA 3J80O 3TP2A 1KVIA 4F67A 1ASUA 4DZDA 3OL7A 4PG8A 4PXEA 2CJBA 2MTLA 1YF5L 1N8RO 1X31C 3F5TA 2MMYA 5CZ2A 4JS4A 3K8VA 1ATNA 3CJ2A 1CJUA 2OSRA 4OLBA 5C42B 1VR6A 2QEXN 1S6PA 1F9EB 3D6RA 2MQLA 3UD4P 3RYLA 2ZF5O 1HNIB 1QSLA 4K8XA 1TR0A 2YKPA 3G87A 1Q18A 1U45A 2DHSA 2IGIA 4UTGA 3CCVN 4R0JA 2HRTA 1QHTA 1UWBA 4F4ZA 3SBTA 1PIEA 3A13A 4JV5F 2E5LF 2AV5A 4J9QA 4U7UD 3UB5A 2HNYA 4FWQA 2AYMA 4I6AA 4ZP7A 2R7UA 4AHRA 2QMWA 4PPDA 1TKTA 3A5OC 2HNZA 4RO0A 2W4DA 1V3SA 4QCLA 5D0HA 3N01A 2MZJA 5BPNA 3UKRA 1X7VA 3V1RA 4JKGB 2DTJA 2ZITA 1C0MA 1FXDA 3RG6A 4BROA 1XIQA 3BSNA 4F2SA 5HLFB 2MZSA 2RE2A 5E3QA 3OYKA 1ILYA 4BREA 3CFRA 2PI5A 1RT6A 3F44A 2CDRB 4IWVA 2NPFA 3AD9C 5E3PA 4XPEA 3MECA 3HO1A 3MURP 4ED7A 3AD8C 3A5NC 2RAQA 3O6QA 4DWIA 1H72C 2ZEJA 5A2QY 4DV7J 1JWWA 4ILRA 4KHNA 3PUFA 4DS5A 3LQVA 3U02A 2EHGA 4BR7A 3MMCB 1JLGB 2MGZA 1RTJB 1KQFB 2Q0UA 4CNZA 3OTEA 5KQDA 2WUSA 3I4HX 1DTQA 3ZX0A 1F5AA 3AO2A 1HHQA 1MMDA 3W65A 4WCEL 1WKLA 2HLUA 3H1VX 1NRKA 2HVDA 4J37A 3JAMY 5GAEP 3GG4A 3MM6A 5IT9Y 2XCAA 3AO3A 3DRSB 2AJFE 3LUYA 4AL5A 2JEIA 4F0KA 4DS4A 1MMLA 2Q66A 5FPDA 2I38A 1IKVA 2HNDA 3MCPA 2HQDA 3SPZA 5J2QA 3FJ2A 2EG2A 3MWPA 1YG0A 3DYAB 3HZ6A 4B3SJ 2Z2LA 1I94F 1AFJA 3NCPA 3R2DJ 5L1LA 1XMQF 2RS2A 3V81B 1U47A 4TN2A 1RAJA 1EQYA 2E2QA 2G2OA 2VBXA 1TUYA 4KSEB 1SUQA 1S99A 2A40A 4A8KA 1RDWX 4BE0A 4TQSA 3EMTA 5LMNF 1ESVA 1ATRA 1IH7A 2V5HG 1W0HA 1L3VA 2L3MA 4MLEA 1K73T 1IBCB 2QWMA 3CERA 4DB3A 3O1BA 1Z2LA 2P9PA 3BYPA 3JB9k 5A6PA 1NSAA 5J1PA 4MIBA 2CNLB 5KPRA 4TLQA 1K1QA 4KFBB 5EX5A 3SAGA 5L8RC 4F3MA 1S1WB 5E3CA 1WSEA 2AYEA 4UW2A 3FGVA 3HBTA 2H5EA 1S72N 2I2YA 4LY7A 2P9IB 5KFZA 4DUTA 4MJKA 2ZC4A 3QIOA 2P5OA 2G0CA 4F26A 2BE2A 4DUYF 2Z58B 1T11A 3MPUB 4C7QA 3CMQA 2B9WA 3PO5A 3AA3A 2QN6B 2ZOFA 1GLCG 3MEDB 3H2UB 3U9ZA 4B1WB 3ZT2A 5KFAA 3BZCA 1O5JA 1C1CA 2UVRA 3NKYA 3S41A 1U4BA 1AUDA 5KT3A 2Y1LB 2UUCJ 4M5LA 2D69A 2BQUA 3BB5A 4EBCA 1HKGA 1ATSA 1DTTA 3RGIA 2RQCA 2G0JA 4TYAA 2IC3A 3LP2B 3C6TB 4IOAL 1ROFA 2DR5A 2YV0X 2UUAJ 4CD1A 5HI7A 1H6KX 1Y4ZB 2KI2A 4RUBA 3OA9A 1I6JA 3RSEB 3MOZA 1A0OB 4CD3A 4JHDB 3EWGA 3AVHA 3KK1A 2W9CB 4KTZA 4KHSA 3QBWA 3WC0A 2A6AA 4KT0C 4LF6F 2QT7A 3LDSA 1Z4UA 4H54A 4YY3F 3QDKA 1U25A 4RLEA 1RT5B 2K7KA 5IWAK 3ITHB 3PV8A 4G1PA 3BF3A 3SDEB 4M5IA 2O8EB 3JSYA 3FBFA 4WKRA 1VSKA </