3IG1A

Hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase p66 subunit
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 132
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ig1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ig1A05
4ECYA 1J53A 3ZSYA 3TAEA 4O55A 1RT3B 3RAXA 4KB7A 1KLMB 3BDPA 2XC9A 1U4BA 2OPQB 2ZE2B 1J5OB 3UPFA 5KFEA 4ECWA 3V9XA 1D8YA 3H4DA 3MECA 4FJ7A 1JKHA 1TK0A 3ZT2A 4BDPA 4ICLA 2KFNA 4DTMA 5HROB 4CCHA 5EWFA 1RTDA 5KFMA 3A2FA 3CVKA 3QINA 4B8AB 3C6UA 2Y1IA 1S1WA 1SL1A 2HHWA 5DG8A 1NK6A 4CJUA 1FK9B 4DU1A 4DU3A 3MECB 3KHLA 5L1KA 2BANA 4M42A 4ICLB 4IBNA 1R0AA 1RTDB 3AVCA 5DG7A 4W5TA 3VQSA 5EU7A 1WAFA 2FC0A 3C6UB 5F8MA 1D9FA 4O3PA 4MQ3A 1NHVA 4CJQA 3AO4A 1RT5B 5KFIA 1DTTA 4R0EA 3ULDA 1RT7A 4ZP9A 5FDLA 1TAQA 2O4IA 4I7FA 2BANB 4I2PB 5KFGA 3SYZA 3OHAA 4ZVEA 5KG0A 3GYNA 4CESA 1G15A 4FJJA 3V9ZA 2WRMA 5JS2A 1XR7A 3RBDA 1GOCA 1S1XA 4ED3A 3ZSXA 4CJFA 3L2QA 3OHBA 4KHRA 1BHLA 1JLEA 1T94A 1RT7B 1TL3A 4I7FB 4NLPA 1RT2B 2X6SA 1VRTA 4E1NA 5KFLA 3CJ3A 1YVFA 2QK9A 2AJQA 1EX4A 3AVBA 4FJGA 4AH9A 4ZP8A 4OLBA 3BSOA 3THVA 1HQUA 4NLXA 4CJKA 2UUTA 2IJNA 3S3OA 4KHMA 1BL3A 1BQMA 1QE1A 4LH5A 4OPJA 4FM0A 2JGUA 1GOBA 4RW7A 1TL3B 2J6UA 3ZT4A 4Q8EA 3ZT1A 4FLZA 4WXWA 2ASDA 3OL6A 1RTJB 4KAIA 5KTQA 4CGHA 4CHNA 1MU2B 5I3UA 3I0RA 4B9LA 4Y1DA 4Z0UA 4KBIA 1VK0A 3I0SA 3SV3A 3HL8A 4ECSA 5C42B 4YP3A 2XO7A 4KB0A 3ZSWA 1LW2B 4Y34A 3V1RA 2Z1HA 1QE1B 4KHNA 2X6NA 1KFSA 1RCHA 4QPXA 1S9FA 4I9LA 1S6QB 4QAGA 4OKJA 4RW7B 3L3UA 4E7IA 1TKDA 3NCIA 3BR9A 2JEGA 3DM2B 4JV0A 4O3RA 2FJXA 4W5NA 2B4JA 3RB4A 4DL7A 4N41A 2DPJA 2BRLA 3CDEA 3K59A 2EC0A 4HUFA 2E4LA 4FZXC 3I0SB 1QSYA 2AQ4A 1SKSA 3M8QA 2HVIA 2FVRA 4KFBB 1XHXA 3CDWA 3HHKA 2KQ2A 3DLGB 1TV6B 4CJPA 5KFJA 3DLRA 3CJ4A 4PWDA 1RTIB 3F9KA 1RT4B 1I39A 2IC3A 4IR9A 5EWEA 2R7YA 2WONA 4FXDA 2YNGA 1RYRA 2X74A 3DLBA 3LANA 4I2QA 3M8QB 2X78A 4CJ3A 4FZZA 5KFAA 4Q0BB 3QZ8A 4EZ6A 3H08A 4LD0A 1UA0A 4CEEA 4F4YA 2IM3A 4PWDB 3OL9A 2GC8A 1J9AA 3I5CA 3SUNA 3MTKA 4MFBA 4FBUA 3CFPA 4KRFA 2HNDB 1QTMA 1L3VA 3AO2A 4RW4A 5KGWA 3V81A 1NNDA 2B43A 4HVJA 4I2QB 4RW8B 2P5OA 3KLEA 5KG4A 5DQIA 4TY8A 1NK0A 3AVHA 3CJ2A 2JC1A 2XGQA 2QXFA 3LP3A 1GX6A 3BSAA 1HJRA 3PO5A 4O3NA 4CEAA 2D3ZA 3M9OB 4DTPA 1HNIA 5EUHA 1VSFA 1BIZA 4JS5A 4F3OA 3G10A 2A1SA 2XI3A 4CFBA 4C8LA 3AVKA 1N5YA 2XCPA 4MFBB 3RB0A 1LW0A 1JLGB 4RNHA 2BQRA 2IA6A 4CF1A 4RW4B 1A5XA 4MK9A 2J6SA 4DFJA 4CJ4A 3DLKB 4CF0A 3Q8PB 2XI2A 4TY8B 4KV8A 4QW8A 4ZVHA 3QIOA 3PX4A 2BRKA 3TAFA 4AHSA 4WYWA 4WZMA 3DLEA 1LAWA 1U09A 3TAPA 3N6MA 1J54A 3I5BA 5KRTA 3IG1A 3I8DA 1ZBLA 1EP4A 4CGIA 4FYDA 1K1SA 3ZSRA 4DU4A 3P1GA 4EZ9A 1RDCA 2O5DA 3L3VA 4B9SA 4EBCA 1CZBA 4FJXA 1QHTA 3H5UA 5CY4A 3SQ4A 4EO6A 4ZVFA 4J9SA 3MR3A 3BSNA 1RYSA 3DLEB 1Z25A 4TQSA 4IFVA 4FCYA 4NLGA 4N76A 5C24A 3OYKA 1EP4B 4FM1A 3ITHB 2XY5A 4ZVGA 3T19A 2ILZA 3P83D 2JC0A 2VG5A 4M3RA 3CO9A 4ECZA 4KKOA 1L3TA 2XY8A 3OL8A 2G8WA 5KFZA 4URGA 3HXMA 1IH7A 4CHYA 3OY9A 3VQPA 4IDKB 4J2EA 1W9HA 1O1WA 3FQLA 3LDSA 3EY1A 3OYFA 3L2UA 1TL1A 2OA8A 2HHUA 1HPZA 4URQU 2WHOA 4FLUA 1VSKA 4Q8FA 4NLOA 1GX5A 4KKOB 4BE1A 3S3NA 4O44A 1VSIA 2J6TA 1KTQA 1ZBHA 3JYTB 3VA0A 3Q8SB 1RA6A 1RDBA 1T05B 3M9MB 5HP1A 3LP2A 4IRCA 3H2LA 2DY4A 1LAVA 4FW1A 1WSHA 5HLFA 5KRSA 1NKEA 2CJQA 4N5SA 1TL1B 2RPIA 3V6KA 1ASUA 3V6DB 1HPZB 4MK8A 3RMDA 4H54A 5KG2A 1SH2A 2G8UA 1WNSA 4DLEA 4PUOA 4Q43A 3NBPB 3QNNA 4KE5A 4BE0A 3VN5A 4O44B 1JXEA 3NL0A 4FVMA 5KFYA 4CIFA 3QEIA 4CIEA 3K5NA 4EO8A 4DQIA 3LP2B 5J2NA 4RW6A 2OH2A 4IOBA 2ILYA 5DQHA 5HLFB 3OYLA 4M3YA 3O3GA 4KAZA 2IM2A 3DRSB 1Q9YA 1JLBA 3N6NA 4N47A 1RBUA 1RT1A 4E7HA 1T03A 1JL2A 3T5JA 1NKBA 4PUOB 4NLVA 3DMJA 3M8PA 1S9GB 1EETA 5DLFA 2UVUA 1NK7A 4QOZB 3HVWA 1TVRB 4CJLA 3KTQA 4IG3A 3NAIA 3CQ8A 1SKRA 5J2NB 4RW6B 3ICLA 1S1TA 3ZSQA 4Z4CA 3VQ9A 1TKZA 4YR2A 3PX6A 1EXQA 1NK9A 2OYQA 4NLDA 2AWZA 3IS9A 4ZPBA 4ELUA 1RT6B 3MEDA 1LV5A 4NRUA 1DLOA 2WCXA 2JEJA 3KHHA 1QAJA 5J2QA 3PJXA 1LWCA 3DMJB 4FM2A 1S9EA 4E7JA 3AVMA 3QERA 1EETB 2YV0X 4CJRA 5SZTA 2HNZB 2C22A 4TY9A 4C8MA 3QLHA 4IG3B 1D9DA 3D0PA 4RUAA 1IKYA 3G86A 4LQ9A 1KSPA 3QO9A 4GVMA 3HPHA 1S1TB 1QSSA 3HVAA 2WOMA 3RMAA 2IOCA 2R8KA 1TKZB 4NYZA 1KVCA 4KTWA 3HPOA 5KFBA 4Q44A 4FK0A 3IS9B 3MEDB 2FBTA 4ZP6A 1DLOB 2HHXA 3FFIA 3OLAA 4WXOA 4J9OA 5J2QB 1S1UA 4FJIA 1S9EB 3HKWA 1ZTTA 4KREA 3BQ0A 1KHVA 5L1JA 5KG3A 4DTSA 3QLHB 3PVXA 3LZJA 3QO9B 4MIBA 1B92A 3G6VA 5DGAA 3PV8A 5J2PA 3B6PA 4B9TA 4IRDA 4ZHRA 3OYGA 1RBVA 5FRMA 1ZBIA 3VQCA 3LZIA 3E01A 1S1UB 5T14A 3OJUA 4OGCA 3OSNA 3RMCA 4IFYA 2OPSB 2JEFA 1KVBA 1WSEA 3AVGA 1X9SA 1WSGA 1N4LA 2GV9A 3AO5A 4YFUA 3MEEA 3HK2A 1C0UA 3VQ4A 1JKHB 5KFNA 3SQ1A 4FJ5A 3EPIA 1IKWA 3RRHA 2C2DA 4XPCA 4FLVA 1X9WA 1UWBA 3E01B 4IR1A 3SI8A 3OS0A 2RDIA 2YKMA 2ATQA 4B3OA 5KFUA 4IFYB 1S1WB 3KLGA 4B08A 3KMSA 3ISND 4FLWA 4M3UA 1HQEA 1ZTWA 4O0IA 5HBMA 4Z4GA 3MEEB 4OVLA 3Q8QB 4KHWA 4B9MA 3N6LA 2RDJA 1Z26A 3H5XA 1IKWB 2BDPA 5KT7A 1F21A 3I5AA 2I5JA 2P51A 1R0AB 2FJVA 4CK2A 1W0HA 3KHRA 4N56A 2P5GA 3KLIA 2FBXA 2YKMB 4FJLA 4B3OB 1KFDA 2FJWA 3PW2A 1IKXA 3KLGB 1YTUA 2IGIA 4J2BA 3C94A 3G6YA 3LWMA 1RDDA 1NJXA 1EKEA 1KCFA 1DTTB 1HQEB 2AGOA 5HBMB 5FRNA 4E7LA 5FDLB 1CXQA 2E6MA 1XI1A 4L8RB 4DL4A 4BWMA 3DI6A 2JLEA 3FSIA 2W9CA 1QAIA 1SH3A 1BIUA 3NMAA 2ZD1A 2W8LA 4QWAA 3ZCMA 3PHEA 2G8KA 2HHSA 1XR5A 4KI6A 3KIOA 4BDYA 3AA2A 4TSXA 3B6OA 3GIMA 1S1XB 2W9AA 3HT3A 3CFRA 4O3OA 4FBTA 1SV5A 4M94A 2BR0A 4ECTA 1JLEB 4BWJA 1VRUA 3LP1A 3TABA 1BCOA 4KHYA 1FXXA 3DI6B 5F9LA 1VRTB 4CF9A 3RMBA 3H4BA 4FJHA 3NE6A 4Z4EA 2W9CB 2ZD1B 4Y1CA 4Q5VA 4CJSA 4CEOA 1BISA 2V4QA 1HQUB 4JV2A 4RZRA 3PO4A 3EZUA 4DSIA 3OYMA 1BQMB 3TI0A 1U45A 2AGPA 3UQSA 1NK8A 2UVWA 3NH0A 4IH6A 2FVPA 3SI6A 1VRUB 3LP1B 2YNHA 1KHWA 3HP9A 2XWYA 2AX0A 4MIAA 2LSNA 3M8SA 2KTQA 2BGGA 4K8ZA 1RNHA 3VQ7A 4PY5A 1ASWA 4CJ5A 1TK8A 2FLPA 4H4MA 5I3UB 3HJFA 3I0RB 4CJWA 3RR8A 4IG0A 3ISNC 2B5JA 1TGOA 4AHRA 4RNNA 3MFIA 3KKSA 4FS2A 3QIPA 2HAIA 1L3SA 1YT3A 3QESA 4TYBA 3LP0A 3MXIA 5F8IA 2YNHB 1X1PA 2VG7A 3TAMA 4F50A 3DRRA 4LSLA 2AU0A 4G3IA 3ZSOA 4Z4IA 4FW2A 4IQXA 1CXUA 1HRHA 2YNFA 4ED2A 1BQNA 3UDLA 1UA1A 1S1VA 2FVSA 2HVHA 3NF8A 3K5MA 3KNAA 4CEFA 4XIUA 3QIPB 2YNIA 4ZPCA 2FVQA 3HPGA 2XRIA 3HSTB 3RTVA 3KK1A 3IGNA 1S49A 4MH8A 3TAMB 2IC3B 3QEPA 1C1BA 2R8IA 1VSMA 3H98A 3LAKA 3AO1A 1NK4A 2WONB 2YNGB 1IO2A 3IRXA 3SV4A 2YNFB 1NKCA 1W25A 1IG9A 4K4TA 5CZ1A 4KB1A 2AX1A 3NDKA 4F2SA 4KO0A 4H4OA 2P1JA 1QUVA 3OVNA 3OS2A 1N48A 1L3UA 2YNIB 3KD1E 2XHBA 4HYKA 4NLWA 4FK2A 2KZZA 5KG7A 4ELTA 4CGDA 1C6VA 2QKBA 4EBDA 2XGPA 3AO3A 3EYZA 4DL5A 3C6TA 4M3TA 1SKWA 3V81B 4JUZA 3TARA 1S0NA 3KLEB 4KO0B 4KTZA 4H4OB 5C5JA 5KFKA 2EX3A 5K14A 4DWIA 4K4SA 4K50A 3H59A 5HRNA 2HW3A 3GQCA 4K4YA 1HNIB 1JIHA 1T7PA 4DTOA 3MEGA 3O3HA 2VA3A 3NHGA 1N5YB 3SUPA 5F8JA 4OGEA 1LW0B 2UUWA 2FBVA 3C6TB 5KFOA 4ZTFA 3SUOA 2DFEA 4F2RA 2Z1JA 4KV8B 3KJVA 1VSEA 4AHVA 4Q45A 5K14B 3QGGA 3TQ1A 5T7BA 2ZKUA 2VA2A 1ASVA 4NRTA 4ED0A 5KFQA 3CM6A 1I3AA 1YVUA 3IG1B 4J9NA 4IH5A 3MEGB 2Z1IA 3QNOA 3CWJA 2W42A 5J2MA 4F4KA 3NAHA 3L2WA 4F8RA 3DLHA 1C1AA 4QWBA 3DOKA 3GILA 5L1LA 2IJFA 2E9RX 2D41A 1JX4A 2R2UA 1CLQA 1RBTA 2HWIA 2F96A 4HKQA 2OPRA 3NF6A 4CHQA 1VSHA 3OYIA 1IKVA 3L8BA 4IFVB 3NH2A 4MKAA 3U3YA 4NCGA 1SL0A 4CGJA 4KHUA 5C24B 4E1MA 4YMEA 3KLHA 2G8IA 4DS4A 1NOYA 3LAMA 2DFHA 3AVJA 2VG5B 4ZP7A 4CGFA 3S9HA 1KLNA 3QEWA 3DOKB 1S10A 4JLHA 5HRRA 4KHQA 3AVFA 2ZQBA 3WNEA 4TXSA 4DQRA 4J9PA 1U47A 1S5JA 4FLYA 5KFPA 4CEZA 1JLCA 1RTHA 3DRPA 2D5RA 3QYYA 3AA4A 1IKVB 5F8NA 1S0MA 3ZSVA 4EBEA 3KLHB 4EP5A 1KRPA 1D0EA 3HVTA 1JXLA 3VQAA 4DQPA 1T3NA 3MR2A 3D45A 2IBKA 4GMJB 4XO0A 3L2VA 3OYBA 3NKYA 4ED6A 2R2SA 3H40A 3H5SA 4DMNA 4O4GA 1BI4A 1JLCB 5HP1B 3DRPB 3ZT0A 1RAJA 3PX0A 4CJEA 4DTXA 4GC7A 1FKOA 1U04A 3U3GA 3AA5X 1HMVA 5F8HA 3VA3A 4ID1A 2ALZA 4TLRA 3QETA 3HM9A 4CGGA 4I9QA 4R8UA 1BCMA 1TAUA 4O4GB 3GIJA 5F8GA 5KFXA 1BI4B 4CF2A 5KT4A 2Z1GA 5C25A 3GV8B 4DEZA 2HHQA 3TWHA 2W8KA 5DQGA 3OL7A 4CJVA 3QEXA 1CSJA 1JLBB 1Y97A 3K5OA 5KFTA 2XY6A 3SUQA 3FRZA 3DOLA 1FKOB 1RT1B 4B8CA 3DYAA 1T03B 3SFUA 4CHOA 4DTUA 3PJWA 3T5KA 3T1AA 4B9NA 3M8PB 4JRPA 1GOAA 3LALA 4E89A 2G8FA 1CZ9A 2C2RA 4OLAA 4WFZA 5JXSA 5C25B 3OYCA 5SWMA 3SPZA 5CYMA 2O4GA 4DG1A 3QGIA 1X9MA 4ID5A 4OPKA 4ECQA 3DOLB 3RB3A 2AGQA 4K8XA 4DFMA 4NLTA 4M41A 4TYAA 2V9WA 2GIRA 4Y2CA 3IN5A 2BQUA 4KTQA 1LWCB 2R2TA 4RUCA 2OPQA 2ZE2A 4KI4A 1XWLA 2B6AA 3HP6A 3RBEA 1IKYB 1ZBUA 1I6JA 2WTFA 4K4WA 4FJKA 3PW0A 5KG1A 1ZBFA 4J9RA 2E9ZA 2WOMB 2ITGA 3O4NA 4E19A 3V6JA 4HCBA 4ID5B 4M95A 4W5OA 3BJYA 4DTJA 1B9DA 4NCBA 1SUQA 4FJ9A 4C8NA 4WFXA 3FFIB 3K57A 4O4RA 1S6PA 3HO1A 3MR5A 1FK9A 2QE5A 1C2PA 5KFRA 3M8RA 2B6AB 4IRKA 4F3TA 4UQGA 3E51A 2CKWA 3GV5B 5F9NA 1XC9A 4XPEA 4RW9A 2E6LA 5J2PB 3BGRA 5JUMA 4ECXA 4NLYA 4ZHRB 4ECUA 3V6HA 3LPUA 1QS4A 2ASJA 1WN7A 4JRQA 2DTUA 4ELVA 1C1CA 1QSLA 1Q9XA 1RA7A 4EYHB 3TAQA 1SUQB 2ETJA 2F8EX 2XCAA 1RT5A 4E3SA 4AHTA 1S6PB 1WAJA 3BREA 3G6XA 4U6PA 3AV9A 4I2PA 1K1QA 2WB4A 2PYJA 2DPIA 4RW9B 3BGRB 1C0UB 3CDUA 2GIQA 4FLXA 1C1CB 4OKKA 1JL1A 2GUIA 1C0MA 1UWBB 1TKTA 3OS1A 2VG6A 2IDOA 5KT3A 4IH7A 1RT2A 4TN2A 3TAGA 4DF4A 4QWDA 1T8EA 1BGXT 3GV7B 3CG7A 4OKEA 4ECRA 3OYHA 5KFFA 3MAQA 3VQ5A 3V9UA 3NGYA 3SPYA 4ECVA 4CEDA 2I5JB 4RU9A 1TKTB 1B9FA 3CM5A 4DSKA 4CFAA 3AVAA 2VG6B 3KLIB 3KK2A 1IKXB 3QGHA 4J2DA 4URSA 3RRGA 4CK1A 4NLUA 2IM0A 1RTJA 3MXJA 4NYNA 1MU2A 3V9SA 2RF2A 2G8VA 4MKBA 4CIGA 5KT5A 1A5WA 3SNNA 5C42A 1IM4A 1KVAA 1LW2A 4LQ3A 3CIZA 4DL6A 1S6QA 2Q3SA 3KK2B 4CEQA 3T5LA 2D0BA 4M3WA 3DM2A 3V9WA 1SV5B 4O3SA 4QWEA 1L5UA 3AA3A 3VQ8A 5E41A 2RF2B 4F4XA 2D0AA 4CHZA 3BSCA 4ED1A 1HYVA 1D1UA 4LY7A 4KFBA 3SCXA 5DLGA 3MXMA 2NUBA 1REVA 3DLGA 1TV6A 3NGDA 4DTNA 3OLBA 3AVIA 1VSDA 1RTIA 3JSMA 4ZPAA 4O5BA 4DFPA 1RT4A 1UAXA 2R8GA 5J1EA 1WSIA 4ZTJA 2UVRA 3H5YA 2UVVA 1DTQA 2F8TA 2HHTA 1LWFA 3M9NB 3WNHA 5DG9A 3NFAA 4WE1A 1S97A 4CERA 4M3ZA 3PR5B 3P5JA 4Q0BA 1REVB 4H4MB 4RNFA 4CHPA 3SJJA 3MFHA 3V1OA 3BQ1A 4IG0B 4PA1A 1TP7A 2B5JB 4M3XA 3JSMB 1N6QA 4K4XA 1HNVA 2W9BA 2PY5A 4CJTA 5J1EB 4YR0A 5F8LA 5EWGA 3C95A 3LP0B 1DTQB 2HNDA 4CFDA 1LWFB 3OYJA 3Q8RB 4YNQA 1NK5A 4WE1B 5CYQA 2VG7B 2HMIA 3D28A 4CF8A 3DRRB 4RW8A 4O3QA 4LSLB 4PQUA 1SH0A 3KLVA 2OZMA 4DQSA 3T3FA 4RG8A 2D3UA 1ZETA 2HB5A 2BE2A 4ZPDA 2GBZA 3T5HA 5KFHA 3PW7A 5KI6A 2WK4A 4Y3CA 1BQNB 2IS3A 4C8KA 4JV1A 1S1VB 4MK7A 1TK5A 1N6QB 2OPPA 5I42A 1HNVB 2R8JA 3UIQA 2W9BB 1WSFA 1NJYA 3KLFA 1A5VA 1WLJA 5DGBA 3CFOA 1QQCA 3SQ0A 4BE2A 1JLGA 4YQWA 3KK1B 3PUFA 5FROA 5CYQB 2HMIB 4WZQA 1S0OA 3DLKA 4PQUB 1C1BB 4B9UA 3TVKA 4QWCA 2QKKA 4WFYA 2V4RA 2BE2B 4FJ8A 3TR8A 3IRXB 3F73A 5L9XA 4LH4A 4HTUA 1UOCA 2ATLA 4EEYA 5HRPA 3V4IA 1HYSA 2I1RA 2PYLA 2OPPB 5I42B 4NZ0A 1RILA 4EYIB 2RKIA 3KLFB 4O0JA 2FBYA 3QEVA 4DLGA 2YHAA 2R8HA 4F4WA 3G0ZA 3TANA 5KT2A 4Y2AA 2PZSA 3VQDA 4FLTA 4G1QA 2VWJA 3SQ2A 4E0DA 4HUGA 4KPYA 3V4IB 1HYSB 1RBRA 4Z4FA 3PW4A 3RR7A 3OYNA 3U6FA 2FLLA 3V1QA 4NLRA 4CE9A 3ITHA 1YTAA 2RKIB 4HUEA 2QV6A 4HHTA 1OS5A 4TQRA 3NF9A 4OJRA 1U48A 2IAJA 1S4FA 1D5AA 4HCCA 3UR0A 2DFFA 1RDAA 4FJMA 3VQQA 2C28A 4GW6A 3QIDA 3CYMA 1HARA 1LWEA 5KFCA 1JLFA 3ZT3A 4G1QB 4F4ZA 5KGXA 5JS1A 5KFSA 4DQQA 4IDKA 3KJVB 1WNEA 3WNFA 4K4ZA 1MMLA 5KG6A 3NF7A 4ED8A 4J9QA 3EZ5A 4DSJA 4FS1A 3GIKA 3NGIA 3AVLA 2YHBA 3RWUA 3ALYA 3O3FA 4J2AA 3AVNA 2IAJB 1NJWA 4DL3A 3MR6A 1NJZA 4NLSA 2Y1JA 2IM1A 2IMWP 3PZPA 2W7PA 5J2MB 1LWEB 3EPGA 3WNGA 3VQ6A 3JYTA 1JLFB 3SZ2A 1T05A 1NHUA 2RN2A 4CFCA 4FZYA 5D3GA 3RAQA 4ZMMA 2EHGA 4AILC 4R5PA 3IAYA 4NLQA 2V0NA 3CJ5A 1JLQA 2D0CA 3V6DA 3QZ7A 4J9MA 3HVRA 1VSJA 4U7CA 2OPRB 4W5RA 4DSEA 3MF5A 4NYFA 2JEIA 4NCGB 1ZYQA 3NBPA 3KD5E 3PR4A 3KMQA 2D7SA 3RB6A 3K5LA 1RDRA 1Q8IA 5KFVA 4DS5A 3VQBA 4H8KA 4EP4A 1XR6A 3GIIA 2R2RA 5CZ2A 5DK5A 5KG5A 5D3GB 4R5PB 2W7OA 3L2RA 3DRSA 3PY8A 4DFKA 1JLQB 4JS4A 4WYLA 4KSEB 1RTHB 3IGVA 4J9KA 4RNOA 4AHUA 5KFDA 2KZMA 4BDZA 4K4VA 4QW9A 4LSNA 4M45A 3KKRA 3HVTB 1S9GA 1S48A 3DDKA 2VWKA 1TVRA 3S3MA 4CK3A 3HYFA 3OJSA 4B9VA 1C0TA 1RBSA 2HHVA 1JLAA 4KHSA 4C8OA 3O4QA 3OYAA 4IKAA 1N56A 2YKNA 2XY7A 1RT6A 3KOAA 4DTRA 4DL2A 4CEBA 3KHGA 4LSNB 3VQEA 1U49A 2HNZA 2KW4A 1TQLA 3CJ0A 4IKFA 1HMVB 4DF8A 3BQ2A 3FQKA 5KT6A 1TKXA 3OSPA 3LPTA 2KFZA 1C0TB 5DMRA 1JLAB 2HWHA 4R8UB 1HYZA 4FK4A 3KK3A 2OZSA 4K4UA 1K6YA 4OL8A 3NGZA 4W5QA 4BACA 2HNYA 3NH1A 1FKPA 4J9LA 5HRSA 5KFWA 2FLNA 2YKNB 1WSJA 4RNMA 4GC6A 2F8SA 3NAEA 2BQ3A 3D5MA 5EDWA 3FDSA 1VSLA 3DYAB 4AHCA 3SFGA 4ED7A 1XHZA 2G8HA 4DSLA 1TKXB 5L1IA 1NOZA 1RT3A 2FVCA 1KLMA 3K58A 1J5OA 3KK3B 1SL2A 2E9TA 1Z4UA 4Z4HA 3K2PA 4CECA 2HNYB 1FKPB 4X2BA 3ASMA 2C2EA 5HROA 5CYMB 3PW5A 4DSFA 2A1RA 3OYEA 4DG1B 4NCAA 2ASLA 3OYDA 4QCLA 3LWLA 4E7KA 1JXBA 4FJNA 4YR3A 2OPSA 1ITGA 3ZSZA
chains in the Genus database with same CATH superfamily
2O8CB 3L09A 3ZSYA 1NGFA 2BXJA 3JQKA 1PJ7A 3RAXA 4KB7A 2WBRA 3ZT2A 2OKQA 4YB1P 3A4TA 1HHTP 3OA9A 1X4HA 1RTDA 1F0XA 4WU3A 4CH1A 4CVNE 3A2FA 4CZCA 5M2PA 2IPOB 1S1WA 3SCLE 5D4PA 2NXCA 3CF5Q 4CJUA 4L73A 4H0OA 1TL7B 1TUYA 5L1KA 2YWEA 4PQAA 4F26A 2FJBB 1I5OB 4IBNA 4ANDA 2GVDB 1FO1A 1RTDB 5DG7A 4IFEA 1CULB 4ID8A 4WIQA 1WAFA 2VBYA 2FC0A 5ADXA 1X0FA 2XTJP 2LU2A 4IWVA 4ILHA 4NASA 4BRMA 4QIVA 3U02A 3DXMA 2NLXA 3EVMA 3OHAA 2PE8A 2W2MP 3ZO7A 4ZVEA 2FHJD 1RBLA 4FJJA 5DS7A 1UWAA 5JVHL 4PG5A 2HRUA 3DDNA 2VQEK 1WG1A 3VALA 1XTZA 1S1XA 4DV7F 3ZSXA 4CJFA 3P45B 4P6QA 3L2QA 3TZXA 3D1HA 1BHLA 3M4XA 4M5MA 3DXMB 3R7BB 1TL3A 4UOCA 4K2JA 1RT2B 4JK7A 3CJ3A 5K8OA 4OI6A 3CT9A 1N88A 3KHYA 4LC9B 3AVBA 4B1UB 4I67A 3R6GB 3THVA 4AYBD 2D3OR 1HQUA 4OYWA 4CJKA 2UUTA 4ZOSA 3S3OA 4HEA9 1BL3A 4ISEA 1QE1A 2VQFF 4FM0A 2JGUA 5J1PA 1HLUA 1QZ6A 4RW7A 1TL3B 2U2FA 2XMKA 2J6UA 1YBTA 4FLZA 2DISA 3KKFA 3OL6A 4KAIA 5KTQA 4O8UA 5L38A 4CGHA 1MU2B 5I3UA 4ER8A 1B99A 4Y1DA 4CZLA 3FVYA 3HL8A 4ECSA 3P49B 2XO7A 1DARA 1FWPA 3RU0A 3ZSWA 1LW2B 4Y34A 3G87A 1QE1B 4KHNA 1B0PA 1KFSA 2X6NA 3LDPA 2AA4A 4MLEA 1S9FA 4I9LA 3K0JA 1S6QB 1IBCB 4FYXB 4QAGA 1NSKL 4RW7B 3L3UA 1Z1ZA 4LR9A 1NEEA 1KDNA 3NCIA 3TJ9A 5EVZA 5BREA 4C23A 4W5NA 3RB4A 3K0SA 2P6SA 2MZSA 5E7OB 2FHOB 2E4LA 4FZXC 3KG1A 2HVIA 4CLWA 4Y2KA 1XHXA 2CGLA 3PEJA 2KQ2A 3DLGB 1W7WA 1ZC6A 1PGZA 3SBTA 3O1BA 3F9KA 2CDRB 2KM8B 3BGOP 1BXNA 2OSQA 1U6BA 1G2EA 1IR0A 4IR9A 5EWEA 3HBTA 4BROA 4FXDA 3MDQA 1XBWA 5ETNA 2E5JA 4I2QA 4CLKA 2BH1A 2FZCB 3LF0A 3DN9A 4CJ3A 2RE2A 3W9IA 3V2UC 3H08A 2PFFB 1UA0A 1NU0A 4CEEA 3S1TA 2M5YA 4GO5X 2DXEA 2XYHB 3OL9A 4FWQA 4JB8B 2VQFK 1FXLA 4OYMA 3G4SN 2W40A 2L41A 3E9PA 3O8MA 1HX1A 4KRFA 4MKVA 3AO2A 4RW4A 3V81A 2LXIA 1NNDA 3OBYA 4I2QB 3ETMA 4RW8B 3QSIA 5CCLA 3H2VE 1NK0A 4LBPA 4BS2A 3VETA 5GAHI 3THXA 4ZN1A 1TYQA 4WFAL 1OH8A 4MO5A 3CCZA 3H3OB 1HNIA 1VSFA 1GTEA 1JMTA 1YAGA 1NGHA 2UXBJ 4PAAA 2DGOA 1LW0A 1VIXA 1FVSA 4RW4B 1A5XA 2ZH8A 1WORA 4KR0B 3Q8PB 5LJWA 1R89A 2LECA 4KV8A 5FJ4A 3TSUA 3IC1A 4AHSA 1TYQB 4B3TJ 4IO1A 2OTJS 3N6MA 3QFPA 2DNZA 3IG1A 3I8DA 2WAQD 2ZF5O 2MEWA 3LM2A 2VPWB 2F4VJ 2NYHA 1RDCA 3KDNA 4QZVB 5C2CA 2WVBA 3D9BA 2ZDPA 4NB4A 2PDAA 3BKUA 3GFYA 3SQ4A 4PKHA 3MR3A 4PXBA 4KH6A 3A3OB 1EHWA 4IFVA 3BZQA 4FCYA 4JAXA 3P83D 2VG5A 2CPXA 3CO9A 4ECZA 1R6VA 3U4LA 1QQOA 3CERA 1WUUA 4JKDA 1ZPVA 4P7VA 2XY8A 4OQJA 2F3JA 3AQPA 2MXYA 3AJ1A 1SJ4P 3QBCA 3HXMA 3UI3A 2AIRB 4B1YB 5CR4A 3FNNA 3FQLA 4X4QA 3LDSA 2HHUA 5LJ5Y 2NQPA 1HPZA 5E3PA 1CG2A 2ZJPQ 2D1KA 4BGBA 3VVUA 4UUXA 4WIIA 1QZ5A 4NLOA 2CH6A 4HACA 3S3NA 1RHMB 1KTQA 1ZBHA 3MM9A 3D4JA 1T05B 3FZHA 4I1TA 2DY4A 1WSHA 2FGOA 4N5SA 2AJ2A 2RPIA 3V6KA 1ASUA 1HPZB 3M6WA 2DHSA 5GMDA 3C16A 3ID6A 1WNSA 5DETA 4PUOA 3HSZA 4JI3J 2HKEA 4HACB 1HWJA 1YJVA 1HBNA 3R27A 4FVMA 5KFYA 3KZBA 2Y8WA 2N7YA 1RWNB 3HHDA 2P9GA 3ZNUA 1R8AA 3D54A 2OH2A 3HRGA 3O5BA 2MKCA 5B0DA 3CMEN 3NGKA 3O3GA 3OVSA 2XYPB 2QWPA 1JLBA 5MAOA 4N47A 2QX0A 2OANA 3PFEA 3EJMA 2E7XA 1T03A 3DXSX 1JL2A 4ES2A 2YCHA 3MAHA 4PUOB 5KAKA 1U1KA 1YJTA 1EETA 2RDDA 4U67L 4JOUA 3ZYYX 4QOZB 1TVRB 1FVQA 1SKRA 3G8SA 4G6VB 4CZKA 3CQXA 3BZKA 5HI7A 4Z4CA 3N0VA 2CQCA 3VQ9A 1TKZA 3KJQB 4Y28C 1EXQA 3IBCB 2B4VA 2WBMA 4DR1F 1HWLA 2FB0A 2VFSA 1LV5A 1YKWA 1Q82O 2JEJA 1LWCA 1S9EA 1M1KT 4BRKA 3AVMA 1EETB 2YV0X 1YJ9S 3SIPB 2Q6BA 4I64A 4DZ6A 4C8MA 1APSA 1VJQA 2E7VA 3QLHA 2AYMA 1UVLA 1IKYA 3G86A 4LQ9A 1RHQB 3HPHA 3W66A 1QSSA 3WDOA 2HBKA 2PIIA 1TKZB 2W2OP 4NYZA 1N8RT 3HSCA 1E4FT 1GEHA 2CQGA 2WVEA 4Q44A 3GPAA 1YG0A 4FK0A 1VK3A 8AT1B 4OX9J 1U1RA 2HHXA 5GIPA 4WXOA 5AQUA 2JVRA 1WHVA 5M1KA 1S9EB 3HKWA 4GKJF 4JI6J 3MN7A 3QDKA 5BYRA 3QLHB 2E5HA 4OX8A 2DHXA 2ZBRA 2MZJA 5J2PA 2YWHA 3B6PA 4ZHRA 3E1YA 3GJQB 4Q2LA 3KK7A 3A5NC 1BHNA 1F9HA 3DAWA 2QEXN 5ETRA 3I55N 4IOAQ 5T14A 3RMCA 5HJXA 3PRVA 4V19X 1Y0HA 1NJIO 4NXNJ 3PLAA 2QL7B 3BGUA 2AT1B 3MEEA 3JQMA 4DV6F 1RWWB 3BDEA 4X66F 4FJ5A 4WCEL 2R3VA 2C2DA 2MZ1A 2V50A 5IXUA 1VR6A 4DR1K 4B3OA 1HNZK 1Y3KA 3Q83A 1BE4A 1ZM9A 3PYFA 5AQJA 2JLGA 5IV3A 4Z4GA 3MEEB 2KXNB 3Q8QB 5HO4A 4B9MA 2ZWPA 4JEPA 2AJ0A 3HHLA 2CQ2A 1Z26A 1PG5B 3A3NB 4F67A 3MCMA 2I5JA 2P51A 2FJVA 3M6XA 3MCNA 1U25A 4B3OB 1V9OA 2IGIA 3CCVN 2CQDA 3G6YA 2MB0B 1KCFA 2MLYA 1DTTB 2NREA 5FRNA 3CCWA 5HMWA 1UKUA 3HHLB 3FSIA 1YJNS 4P2XA 4DBQA 1SH3A 2UU9F 2W8LA 2G8KA 1YWXA 2HHSA 1XR5A 1CEZA 4RTFD 3R5BA 4X4OA 3CPWM 4XDCA 4O3OA 4USJC 2HVEA 1T3OA 5C7PA 4BWJA 1BOTO 2N4CA 1CJUA 1VRUA 1GQEA 1BCOA 4KHYA 2DXDA 1FXXA 5F9LA 3QGPA 4FWPA 5BRHA 4FJHA 4EMDA 3NE6A 2CPYA 1UFWA 1YRTA 4A8MP 4CZEA 4Y1CA 1UP1A 4Q5VA 1VS3A 2CPDA 1VHFA 3ENQA 1BISA 4ENOA 4X66K 1FJGF 5FLXY 2C2KB 4LFCF 4BQZA 1Z05A 3PO4A 3EZUA 1OVQA 4ISGA 3MGJA 2EKYA 1U45A 2AGPA 5HQMA 2UVWA 3W9HA 4PRFA 1CJUB 4ALZA 1VRUB 3SI6A 1MNEA 2YNHA 2HRYA 2PMHA 3HP9A 2XWYA 2Q3PA 2KTQA 1G6BA 1RNHA 3S01A 1TK8A 1U02A 2FLPA 2Q31A 2FLOA 4A2BA 5BR9A 2E1YA 2P9PB 3PTWA 4IG0A 2UXCJ 2F4FA 2ZVIA 1FRIA 3A8IA 3R8YA 2FD2A 3B78A 1L3SA 3QESA 2IBOA 1LK5A 3OV7A 2L08A 2YNHB 4G9ZA 4OYIA 4BR2A 4F50A 3AODA 3EXYA 3TJAA 3A13A 3ZSOA 3QPIA 2ZH3A 2UUBF 1CJVA 5AQZA 1BQNA 3D3CJ 2FVSA 5AQXA 4JI0F 3CCLN 4XIUA 3WXIA 1FRJA 1I3OB 3DKDA 2XRIA 3HSTB 3KNGA 4OZNA 2IC3B 5LSOA 2Y9HA 1HKCA 3CC4S 1EQYA 2HURA 3QEPA 1C1BA 2R8IA 4Y6IA 2VJVA 4JN4A 1UW4A 1CJVB 1HI0P 2MYFA 1NKCA 5CZ1A 2AKWB 4OI4A 2AX1A 1MW7A 2P1JA 3OS2A 2XLIA 1L3UA 4FK2A 1FJGK 5D4OA 3B8HA 4LIWA 4LFCK 4CGDA 3AOCA 4QQBA 4FKYA 1VQ5S 2KM8C 2XGPA 2Z2LA 3MN9A 4DL5A 1IR2A 3L4BC 1VC0A 3ZX2A 4OI1A 4JUZA 3Q89A 3KLEB 4CYUA 2DITA 2X51A 2W1BA 4BRNA 4K50A 2HW3A 4WJBA 2CG4A 2O67A 1P90A 3CJQA 2H65B 4NMXA 1T7PA 2VHGA 1HBOA 2VA3A 1MWQA 1N5YB 3SUPA 4OGEA 2UUCF 3LOUA 5KFOA 4ZTFA 2ZZTA 2F5GA 4PWUA 4WTOB 4F2RA 1P9YA 4CYUB 1NB7A 4PWWA 3FMWA 4BCAA 3RRKA 2UUBK 3TQ1A 5T7BA 4OYPA 5ETLA 5KFQA 1PILA 1YVUA 3MM8A 3T7ZA 4JI2K 1IJJA 1JJ2M 3CWJA 1TELA 2HGLA 5J2MA 4F4KA 3L2WA 5ETPA 3SMPA 2ROGA 4JYAJ 5L1LA 3D0GE 2E1ZA 4W98A 4QS9A 5F0WA 1CLQA 3H0PA 3DLLL 4M5NA 4DV1F 4DV2F 2L48A 4MKAA 3U3YA 3LDNA 4I68A 2W6KA 3MM8B 4UY85 2ZOFA 4KHUA 3VF0B 4E1MA 2G8IA 1NOYA 3LAMA 1YI2N 1NU4A 1UVJA 2YQ3A 2XG8A 4DX6A 3IAS9 4CGFA 3QEWA 3G6ES 2QN6B 3THYA 2ZITA 4BRFA 1YJ9N 4YB5A 4TXSA 1EO1A 3IM9A 1S5JA 3VOVA 4ZVOB 4FLYA 5KFPA 3O1WA 4CEZA 1Q0NA 1JLCA 3IA0A 5HOOA 4I0WA 5F8NA 1FFSB 3VQTA 3ZSVA 5A8WA 4B3SF 3NXZA 3HVTA 3PKYA 3VQAA 5F0XA 1N36F 3D45A 2IBKA 2HQIA 4GMJB 2R7SA 2JOQA 3THYB 4ED6A 5IT0A 3GFXA 3B8AX 4WP9A 2QL9B 3NVMA 2EG2A 1H38A 2IFXA 2W6LA 4Y0WA 2UUCK 1JLCB 3D0HE 3F9MA 5ETOA 1HWIA 1ITPA 3J80U 5FD1A 3TA0A 4DTXA 4GC7A 3GG4A 2CJYB 1U04A 5F8HA 3VA3A 3TP2A 1RHKB 1NGBA 3FK4A 1DBDA 4R8UA 2QLJB 2V67A 1RI7A 2G4BA 5HMXA 4K25A 4WKYA 5F8GA 1N32F 4KH5A 3VF2A 4CF2A 5A8RB 2M9KA 4AM7A 5MLCV 3OR1A 1GNKA 2UP1A 3IP0A 1WHWA 1XMBA 4DEZA 1ZOTA 3TWHA 1EB0A 3UE5A 1H74A 1R8BA 1RHUB 5KFTA 4PEOA 2XY6A 1R7IA 4DV1K 4YB6A 3C0BA 3NCPA 4ZCLA 4DV2K 1S0VA 1RAFB 4FWRA 3SFUA 4DTUA 4TU7A 4B9NA 4JRPA 3LO3A 4HH1A 1GOAA 2OFHX 1L3KA 2WTUA 2C2RA 3PIOL 4Z2XA 4OLAA 4EAHD 3NNHA 2E5GA 4MDAA 3ULHA 3OR1B 5JXSA 1C0FA 3QGIA 4DU7A 1Q81T 1X9MA 1XQIA 3ZFVA 2D9OA 3AD9C 2AGQA 4DFMA 2P9LA 3AHPA 2GIRA 3WQTA 1GXUA 4B3SK 4OZ1A 1NB2A 2MSSA 4P2FA 3W9JA 1IWGA 1N36K 2DHGA 4CO1A 4X64F 4JI4J 4ETZA 5ETKA 3PW0A 4J9RA 5C2FA 3O4NA 4E19A 3M2RA 3NCQA 3T41A 4D3HA 4W5OA 2GHVC 4NCBA 2P9LB 5C2DA 4FJ9A 4F9OA 4WFXA 3K57A 4O4RA 4WFBL 4JKFA 4KRWA 1XEZA 4C3MA 2QWQA 3VR1A 3HO1A 3HSDA 3WX8A 4GMKA 2CADA 1FK9A 3D1QA 2QYCA 3M8RA 1FDNA 5F9NA 1K9MT 2EI5A 4RW9A 3NWRA 4N7TA 2QFJA 1N32K 3M2RB 3V6HA 3LPUA 1ZH5A 2H48B 3NS6A 2ASJA 1C1CA 1Q9XA 5E3CA 4EYHB 3CJBA 1FA0A 2A42A 2XCAA 4YS2A 3QMQA 2BM0A 3OXGA 3G6XA 4I2PA 1IBKF 4FOEA 1DEJA 2DPIA 1JNZB 4RW9B 4U7UD 1TU0B 4K0KF 1VQ9N 1K47A 1C1CB 4OKKA 1JL1A 2XBPA 2NR0A 1HNWK 3C6AA 2IDOA 5KT3A 4KH0B 1ZA2B 1YJ7A 2AV5A 2QM1A 3O6QA 2VU5A 1LQ9A 3ISZA 4K5SA 1LEOA 3QT8A 2FIUA 1S7HA 4CZGA 1BGXT 4J5OA 4BVOA 4UZBA 2C2MB 3H46O 4YDXA 4OKEA 1VIOA 4PL8A 4X64K 5HN0A 5AQRA 2C2NA 2X3GA 4LVNP 4F0HA 1P1TA 2LQ9A 4UOGA 2OUGA 3GOIA 2YWWA 1OWXA 3I6PA 1X7VA 4BLGA 3LL3A 2CGKA 1Q79A 5HL7L 3OXLA 4CFAA 5L8RC 3KK2A 1WACA 1HIYA 1QAYA 3TRGA 5A8KA 2XMUA 1SQKA 1ZM2A 1EJ7L 4GV6A 2C2ZB 2IM0A 1P8GA 2V4JB 3MXJA 2C2OB 4CLFA 5B0GA 1I1GA 3V9SA 1QDUB 4MKBA 4BRAA 1A5WA 3SNNA 5C42A 3IWNC 1VISA 2FPHX 2MHNA 3JB9k 3ZEUB 1OIAA 1UETA 4ZLPA 1NH8A 2QL5B 3A8EA 3CIZA 4CEQA 3KK2B 2YKQA 3ZZRA 1SIWB 5A8KB 4JD2A 4M3WA 3W7BA 2CQ0A 3JS9A 3MWBA 4K59A 3DM2A 3V9WA 2IVMA 4DR2J 3HI9A 1SVDA 2AEMA 1GH8A 5AR0A 4F4XA 4N77A 4LFAJ 4CHZA 1IBKK 1HYVA 4IXCA 3HHLC 3SCXA 2WW4A 3LGHA 5AQWA 3J81Y 2MPUA 2F9WA 2B9EA 2C3PA 2HQDA 2XMAA 3JSMA 3C7NA 4O5BA 4B02A 1UAXA 2WVDA 1M5VC 1WI8A 3CCRN 5LY3A 2F8TA 4NA3A 1Q78A 4ZCKA 5DG9A 4OO1J 4WE1A 1S97A 2FDNA 1O13A 4CERA 2XNQA 4ATNA 1EIYB 3SJHA 1M5PC 5AE3A 1MLAA 2FC9A 2D0OA 2B9YA 3MFHA 4O8KA 1LXNA 2NCKL 3JSMB 4DXLA 3C7NB 1OQ6A 4JI5F 4K4XA 1HNVA 1NHKL 2PFUA 1XMQK 5F8LA 2JVOA 2VKRA 3LP0B 4CFDA 4YNQA 4WE1B 5BXIA 4KGKA 4CF8A 1WC0A 1D9AA 4O3QA 3PDNA 3KLVA 1V4SA 3PXGa 3NOGA 3T3FA 4RG8A 2Z2MA 2HB5A 4ZPDA 4H5TA 3GB0A 4RLEA 4X4SA 1PBAA 5KI6A 4Y3CA 1N33J 5AZJA 2IS3A 4H0XB 2OAUA 3FBBA 3EUNA 2KJWA 5E3RA 5I42A 1HNVB 4CH0S 1A6LA 2V7YA 3VENA 3VGVA 1N0UA 3FCVA 1A5VA 5BPMA 3S41A 2QC3A 1X5SA 2ASPA 2A5XA 2GW8A 1W7AA 4OI0A 2VFVA 3R5GA 1HKAA 4YHHJ 2YY3A 2HQGA 4WFYA 2EWHA 3G6EN 5FPMA 2HIQA 2K7JA 3MMCB 5L9XA 4IO9Q 1UOCA 5I3PA 3L9ZA 1TMJA 1HYSA 4LF8J 2PFDA 5I42B 3RSEA 4QR1A 3P3DA 2FF6A 2RKIA 1FX2A 1H73A 4M5DA 4ZIWA 3BO2A 2FBYA 1PBUA 1SC4B 3QJJA 4DLGA 4JK8A 3H3NO 2F8MA 1WC6A 3G0ZA 4Y2AA 2PZSA 4UF4A 1SB6A 5KPRA 2HPUA 2IRUA 4Q7AA 2H5JB 1G99A 1EKSA 4D3GA 1HYSB 4X4TA 4H0TB 4CE9A 2C3UA 2JWNA 1WC1A 2RKIB 2QV6A 4NO7A 4DR5J 1U48A 4OJRA 4X4RA 4JI5K 5H9EK 4EHTA 4DUYJ 4GW6A 1UVNA 5G4DA 3QIDA 4PG4A 5KFCA 3TUJC 3W8GA 3ZT3A 5AQPA 5KGXA 5JS1A 2GWKA 4DQQA 5IT9U 1HKBA 3KJVB 1MMLA 3DXKB 3VWSA 4ED8A 3QB0A 4ERDA 4BRGA 3AVLA 2YHBA 3RWUA 3O3FA 3MOJB 3PFOA 1Y00A 4DL3A 3AJ2A 2QA4S 3P4UB 4I6AA 2Q6CA 3EPGA 5DDPC 3JYTA 3SZ2A 4CZMA 2A3JA 3IO1A 4ZMMA 2JLFA 2FSJA 4PYDA 2V0NA 2ZHBA 3R5DA 1GLEG 1JLQA 2AEJA 2HQ3A 4U7CA 4G65A 5GAGI 4DSEA 2XSFA 4HHJA 2WVCA 1R0CB 4RJVA 4NCGB 3VMFB 3NBPA 2RVJA 3UDEA 2D7SA 4PPZA 3VQBA 3BBCA 3Q7BA 5CZ2A 4K8RA 3OTEA 5KG5A 2W7OA 2ADCA 1LFPA 1RWPB 4NYOA 3PY8A 1NBEB 1JLQB 1T11A 2HHHF 1NWKA 4X4VA 2F7VA 4RNOA 1XNQK 4CO0A 2KZMA 4K4VA 4QW9A 4M45A 1K73O 1S9GA 2VWKA 4J91A 3S3MA 2MKYA 4OYXA 5AQIA 3JAMO 3MEKA 2HHVA 1JLAA 2IVOA 4CTAA 1X3NA 1VQOS 4F0MA 3OYAA 2H54B 1RT6A 4CQ1A 3KHGA 3W0LA 2IIRA 3VQEA 1YBAA 2KW4A 1TQLA 3CJ0A 5HQLA 1HMVB 1A0OB 2ZZMA 3FQKA 1TKXA 3GE1A 1M1KO 1LOTB 2RRNA 1JLAB 4XEIA 4FK4A 1FWKA 4H5NA 3R5AA 4CTAB 2VOOA 4L3QA 2B3TB 3CHWA 4BACA 3NH1A 5HRSA 4OLPA 2DRBA 2F8SA 1N8RO 3NAEA 2B51A 3SXLA 3TYTA 1Y5NB 4C98A 4YB7A 2BE9B 1TKXB 1U1LA 4BR4A 2YJEA 1NOZA 1RT3A 1KLMA 3DOMA 2HIYA 1SL2A 3AH6A 2EFQA 2AJFE 3QAEA 4X2BA 2QGFB 3W5YA 5CYMB 4DSFA 4DG1B 2LFVA 2ASLA 3ENBA 4WPAA 2F9DA 2VPZB 1JXBA 4CBXA 2FJDB 3PSIA 2DHAA 3IMQJ 3ZSZA 4LUBA 3CXCR 3VTIA 1YDLA 4XK8C 1RT3B 4C4WA 1KLMB 2OPQB 2ZE2B 5KFEA 4ECWA 3H4DA 3MECA 3CCJS 1KN6A 1JKHA 4JI1F 4YDUA 4RO0A 4BDPA 4DR7J 2GHWA 2K8GA 1NAQA 4B1XB 4DR3K 3QINA 4B8AB 2Y1IA 4CO4A 1SL1A 4AUKA 4OPAA 1SJ3P 5F2RA 3HHLD 2ZZNA 4DU1A 4DU3A 5LXRA 3MECB 3KHLA 1X4CA 4WP3A 1JK9B 2Z56B 3CC2N 1PC4A 1R0AA 3AVCA 4W5TA 5EU7A 5HMYA 1HKGA 1Q7YO 2NZCA 1R43A 3AO4A 2ZJQQ 1X5OA 1M90O 3M5RA 4LF5K 2KG0A 2V51B 1ZAVA 1UMJA 2MQLA 4MKYA 3G9CA 2DD8S 3THWB 1VQLS 4KH4A 4BC5A 1H7WA 1S3XA 4CD1A 3UKUA 1XR7A 3R6LB 4C97A 3CETA 2XZWA 4ED3A 3OTOK 3OHBA 4CNZA 4KHRA 1HL6A 4USTA 1S77D 2HFNA 3FFKB 2BEFA 4NLPA 1VRTA 4E1NA 5KFLA 3IRWP 3CD5A 2FHKA 4M7YA 1NBWA 1YVFA 2CH5A 1HR0J 2AJQA 1WD6A 3W65A 1EX4A 4NOHA 3UKUB 4OLBA 1T0TV 2MKJA 1VQMS 2DB1A 1ZM4A 3R5CA 4K5RA 2PEHA 1GOBA 2CNNB 2FC8A 1R6YA 5CD4H 3ZT1A 2I7NA 4MO4A 2EW9A 2HBZB 2ASDA 3A5MC 3EL2A 2J7WA 5CZXA 1DFDA 1P9QC 1PJ6A 4Y0FA 3D2EA 3I0RA 4ZCMA 4KBIA 3I0SA 2BKNA 1AFJA 3TTFA 3WQPA 4ZN3A 1DZ5A 1RQ0A 3A1YG 3GCXP 2UV8A 1EX8A 3TX8A 4E7IA 1TKDA 3DCAA 3BR9A 2F9TA 3ATVA 5AE1A 3CI5A 4KBOA 4DL7A 1SJ1A 3T6BA 2DPJA 2BRLA 2E2NA 3CDEA 4HUFA 2EC0A 1LFWA 4DHYA 3I0SB 1QSYA 1SKSA 3M8QA 2DIVA 4YY3J 1IBLF 2F1FA 2FVRA 3W3SA 2H1YA 2DH9A 2GJIA 3CEDA 3EZOA 1TV6B 1ZBTA 4JI8J 5DJBA 3CJ4A 2YWFA 2DNKA 2YH0A 3G71S 1BA0A 4BRIA 3CCSS 1EWRA 1WEZA 2R7YA 2WONA 1P8ZA 5EHHA 4WYBA 3M8QB 2WSFC 1DQAA 5GAEI 2N4DA 5KFAA 3E66A 2GELA 4Y2IA 4QYZK 1N5SA 3KWMA 4LRBA 2QG9B 2QZ8A 3MUMP 1J9AA 3C15A 3I5CA 1BD6A 5T41A 3SUNA 3VGUA 2FJAB 3MTKA 1YTYA 3FJ2A 3CFPA 3QT6A 2HNDB 2UV8G 1L3VA 1U1QA 5FPEA 1W2BM 2B43A 1QAXA 2QA4N 3E2EA 5KG4A 4DV3F 5DQIA 2V63A 2JC1A 2QXFA 2BE7D 2WSCC 1GX6A 1HW8A 4O3NA 3PO5A 3CJKA 2XMTA 2D3ZA 3M9OB 2LEBA 2DIUA 1GT8A 5DM7Q 3C15B 2FYXA 3D6HB 4X62F 3H2UB 1JLGB 4DR4J 4MK9A 2I2YA 2J6SA 5L46A 4CJ4A 3DLKB 2W2NP 2XI2A 4QW8A 2H3EB 3HD2A 1Q86T 3NEKA 3CPEA 2DYAA 2ZH7A 1IBLK 3CJKB 2D3O1 2FJEB 1AUDA 3TAPA 3I5BA 4UOFA 3GMGA 4FYDA 1K1SA 5B0BA 2J9CA 1IBMF 1QVFM 2O5DA 3L3VA 4IJNA 4GV3A 4EBCA 1CZBA 3BF3A 2V8DA 1D8ZA 1ELOA 1QVGR 4LF6J 1HJOA 1RBOB 4ZVFA 2A6AA 3EN9A 4N76A 1NH7A 3JTNA 3OYKA 4FM1A 3ITHB 4ZVGA 4XH4A 3JTOA 4M3RA 5KOXA 1VGYA 4KKOA 1XMOF 1E3MA 1NXIA 5FPNA 3UKRB 4K42A 2J7KA 5KFZA 3UNGC 4URGA 1IV0A 1RISA 3VQPA 1RB0A 1KP6A 4TU9A 4YOUA 3C65A 4DV3K 3VZIA 4IDKB 2FY8A 1W9HA 3EY1A 3OYFA 3LGMA 3KG0A 2OA8A 2EBGA 4FLUA 3PYEA 2YTCA 4CZFA 1GX5A 4KKOB 3VV2B 5ETSA 1VSIA 4DCHA 2J6TA 3WIVA 1RWMB 4X62K 1P6TA 1SJRA 3VA0A 1RA6A 1RDBA 2NRXA 1NPRA 4IRCA 3VGTA 4FW1A 5KRSA 5HLFA 2BABA 1NKEA 2CJQA 4NI2A 2A6OA 4MK8A 3F41A 2DGUA 2G8UA 2RAQA 1RAEB 4DLEA 1WUAA 2YHXA 3J7ZT 3VN5A 4KQZA 4LBIA 3NL0A 3T9ZA 2NXJA 2BW2A 3I82A 3QEIA 3J7YI 1IBMK 3K5NA 5AQMA 4EO8A 4ILLA 4JNEA 3MWTA 4IOBA 5DQHA 2GA7A 5HLFB 3CCJN 4KAZA 1RZMA 1Q9YA 3N6NA 5LJ3Y 2J0WA 1RT1A 3JTPA 3WIUA 3AB4B 3DMJA 3M8PA 2GNKA 1HBMA 5DLFA 1KQGB 3HM8A 3KTQA 4IG3A 1X8DA 3RBZA 5A2QU 5B0AA 1IM6A 4FF1A 4JI7J 3MCSA 2QWOA 1LK7A 1KD1O 1LXJA 2AWZA 1REGX 4OX6A 2XQCA 3MEDA 4OLOA 1Q81O 1WF0A 1QAJA 4USMA 1JCEA 2Q36A 3DMJB 2YWGA 2GFFA 1HBMB 4X4PA 3EGWB 4RKUC 2HNZB 2C22A 4TY9A 3CUNA 4IG3B 1D9DA 1ZPWX 1Q1KA 1U2RA 2NSCA 2OMOA 2WOMA 4GVBA 4H0YB 1WJ9A 2IOCA 4I4BA 2R8KA 1J6ZA 2R7WA 4KTWA 2HZCA 2HBJA 4C3LA 1VQLN 4RBTA 3MEDB 4ZP6A 4WKRA 2AYEA 3FFIA 4U8VA 3OLAA 1VQ7S 4J9OA 3W1YC 2ROPA 1QLNA 1S1UA 4F3QA 1VBXA 2PEBA 1ZTTA 6AT1B 4KREA 1NMDA 5LMUJ 3BQ0A 4FNIA 5DZ6A 2A0FB 3LZJA 2RMLA 2BOAA 3MUVP 3G6VA 4GVBB 5DGAA 2DGTA 1VHXA 3P96A 2E5IA 1RWVB 4MT1A 3OYGA 1RBVA 2QYGA 1QQMA 5FRMA 1N34J 1ZBIA 4CLYA 3E01A 4DPXA 4OYBA 3I4PA 1S1UB 3KJNB 2HSTA 3D67A 4Q2MA 3W5XA 4C8YA 3VTHA 4IFYA 4KHPK 3IAM9 2OPSB 2FZGB 4LF1A 5K20B 4YFUA 3IFEA 4FN5A 4OPHA 3VQ4A 3TPQA 3OR2B 1VBKA 2CPJA 1EZZB 1UW9A 2CRLA 3DFEA 3UE2A 4GV9A 2IRYA 3RRHA 4USKA 5U47A 5DDRC 4XPCA 1NMNA 1X9WA 1XJWB 3IFRA 3E01B 2ZJRQ 1MWKA 4L75A 3ZZTA 4LBHA 4LF4J 1VQYA 3SQGA 4IFYB 3ISND 2V5HG 4HHUA 4FLWA 3QBXA 3L7OA 1ZTWA 2V69A 3C14A 3CB4A 3D0IE 4QIWD 4WFNL 4WQ5C 2RDJA 5LT5A 3VCDA 3J80Y 2BDPA 3EKUA 1O8BA 1X4BA 3OVBA 3GU0A 4J7CA 1D3WA 4CK2A 4N56A 1XQSC 2FBXA 4A8QA 1YXQA 5M1FA 2FJWA 3PW2A 1IKXA 5IV4A 2V9KA 1RDDA 4GVEA 1EKEA 2PA3A 3UN3A 2AGOA 4E7LA 5FDLB 2E6MA 3G71N 1ZBSA 4BWMA 5AJ3K 4OHXA 1HNZJ 4K43A 2JLEA 3CCSN 1B4SA 4YDUC 2RILA 1QAIA 1PCAA 4CLSA 4CO5A 3ZZOA 3NMAA 2QLWA 2UXBF 5CABA 1V6HA 1U8WA 1T9VA 2UZAA 3BP8A 3KIOA 3AA2A 1V3ZA 3OFEA 4XAKA 4FBTA 2ZFHA 3O2IA 3R9LA 4M94A 2BR0A 1JLEB 4AL6A 4B9QA 4JHDA 3THTA 3DLJA 3TABA 4B3TF 3O80A 3RMBA 1U2VA 2BKOA 2QO3A 4CZHA 1E6YA 2F4VF 2RT3A 2HRTA 2V4QA 3W2VA 2MGZA 1JXVA 4JV2A 4RZRA 3PNIA 3D6FB 1BQMB 4JKGA 3VGKA 2GX8A 4CI6A 2DR8A 1E4GT 1SAZA 2XZDB 3NH0A 2UUAK 4JHDB 2VODA 5ADZA 2EPIA 1KHWA 4MIAA 2B7BB 1U2VB 4K8ZA 2ZC3A 3CCUN 2LKZA 2O8EA 2XMMA 1E6YB 5CA5A 3HJFA 4ZITA 2BJ7A 3VAIA 3CJCA 3SBMA 3W2VB 2DNGA 2B5JA 3GCWP 2ZEJA 3QBWA 2M52A 4O23A 2C3YA 1CPZA 3M1VA 3PG9A 3CDBA 3D3BJ 3L4QA 4JKGB 2HAIA 4YN3B 3ILJA 4NZ6A 3FCHA 4TYBA 3MXIA 4AM6A 1OY8A 4IOCQ 2VG7A 3VAJA 4LSLA 1K0VA 1RK8A 1RBAA 5BN9A 4Z4IA 3HJVA 2YXLA 2QWNA 4FW2A 1CXUA 1HRHA 2GMLA 4RWXA 1YRXA 1BA1A 1NO8A 5LSLA 1X4FA 1UA1A 2DNHA 3K5MA 3M1VB 3KNAA 2UXBK 1FNOA 2DR7A 2KVQE 4ZPCA 4PG8A 1NGAA 3EVWA 3KK1A 3BH7B 3OQ2A 3MN5A 2V34A 3AO1A 1NK4A 2YWKA 2YNGB 4B3TK 3R97A 1W25A 1S57A 2UXDF 3ZTSA 2KKHA 4JI3F 3PRBA 2HF4A 4YEAA 4CT8A 3OVNA 2ZGZA 1NDCA 3N4WA 2F4VK 3R1HA 2XHBA 1CC8A 4AXJA 3PIPL 1QY7A 1BUXA 1SXLA 1NLVA 3L6QA 2LCWA 3FKBA 2VL1A 4EBDA 1Z2LA 3JSYA 4EIAA 4A2AA 3C6TA 3BPDA 4NE9C 3UNYA 3QJLA 1BDGA 3TARA 3OTDA 5KFKA 5K14A 2NZTA 4K4SA 3H59A 1VQKS 3GQCA 2QFIA 1YVNA 5CQGA 2CJ9A 3O3HA 2LQJA 3EVOA 3NHGA 1GTHA 2DCUB 2UUWA 3C6TB 2DGWA 3HZGA 1YIJS 3FZFA 4X65J 2VICA 2Z1JA 4AHVA 1PSDA 5K14B 3M30A 2ZKUA 4P7TA 4NRTA 3CM6A 3EE3A 4I6MA 3GG1A 4OMFG 4JV5K 2YHYA 3NAHA 2MKIA 2VC1A 1RU2A 1GMWA 1C1AA 3C8YA 3K9KA 1SC3B 4OX9F 3GILA 1PC5A 3LDOA 2IJFA 2D41A 2IYGA 3T1HJ 3EX7B 4JI6F 3M30B 5BRDA 2J76E 1I94K 1O0PA 5E3AA 1RAGB 2UXDK 2OPRA 4NL5A 4DUZK 1IKVA 3E3XA 3NH2A 1PAEX 1SL0A 3IDHA 5C24B 3KLHA 1VI7A 4YOXA 3UD4P 4RBUA 3ZZZA 2BV3A 3S9HA 1SIZA 4UY8O 3AA8A 1YZ7A 3VZHA 4KHQA 3AVFA 2ZQBA 4NEZA 1T95A 4JI2J 4QS8A 1RTHA 3QYYA 3AA4A 1K8AT 1DKGD 1IKVB 4NXNF 1Y5LB 1S22A 4EBEA 2DK2A 3KLHB 1KBRA 1KRPA 1JXLA 5A2QO 1KAYA 4M5GA 4XH5A 2KHCA 4JKEA 1F3FA 2W7AA 3SAHA 1YGYA 2A2CA 1VQ6S 3NKYA 4DPYA 4NYPA 2HSEB 5THWA 5F41A 3H5SA 1X4EA 4O4GA 4DMNA 2J9DE 3OPKA 2HFSA 5HP1B 3NVKA 3MCAB 2MDAA 2FXUA 3IKMA 2CQ4A 1RWUA 5LM7E 3PYGA 4ID1A 3PJ9A 2ALZA 4DPUA 3MMBB 2GMHA 4OZ2A 2GV1A 3FGUA 4I9QA 1PO6A 2RHQB 2ITMA 5CXTA 3TZZA 1TAUA 4O4GB 1KOOA 2MQOA 3OT9A 4DCPB 5C25A 2YQ0A 4OX9K 1KVKA 1PYOB 3AFGA 2YQ1A 2EBEA 2W2QP 4C0BA 3FEYB 1WTFA 4B3RK 3QEXA 3BKTA 3M6VA 2XHWA 4FF2A 4JI6K 2EG1A 1VDHA 2AP6A 3N01A 3AA9A 1WHYA 4NWBA 2KT3A 2OI2A 4CHOA 2GAHC 3EICA 2F7TA 4E89A 3AAPA 4PPDA 3I96A 2VIHA 3ENWA 5C25B 1UAWA 5AQHA 3SPZA 5AQNA 3FBFA 1S59A 3QT7A 1OH7A 2KU7A 2ZDOA 3C6HA 4M41A 4NXNK 2ASYA 3SMZA 2BQUA 4JKBA 4KTQA 2R2TA 4HTLA 4BRPA 1WBBA 1NM1A 3A8KA 3GG0A 3HP6A 1ZBUA 5IT9Y 2WTFA 4FJKA 1WHXA 2RB7A 5KG1A 2COLA 4M95A 4NPOA 5JJBA 4V19S 1SUQA 1D4XA 1WSRA 1VCTA 2Z2YB 4DPOA 4R79A 3MR5A 2QE5A 1N52B 1QHAA 1C2PA 5KFRA 1TL7A 5LJVA 2UXCF 2PI5A 4M7XA 1WC3A 2APOA 3GV5B 1EWQA 5A6WA 3E9OA 2GVDA 5JUMA 1OH5A 1CULA 4NLYA 4LT6A 4OHVA 1VAZA 1QS4A 4ZJQA 1U24A 1TFYA 4A48A 3TAQA 1SUQB 4DV0J 4FWSA 5GADI 2R7VA 2IDEA 1OPIA 1RHJB 3TTDA 1X3MA 2PBDA 4IJAA 4OZ0A 2HS3A 4R25A 2HMPA 5HANA 5ELZA 5EOYA 3Q2SC 2PYJA 2B9XA 2HWTA 3A0IX 1C0UB 1DT9A 3A3PB 2IIHA 3MK6A 1CJTB 2GUPA 2GIQA 1C0MA 5HAOA 1UWBB 2EKNA 2VG6A 2ZNYA 2DXFA 2EFGA 4A8WA 1RT2A 3MTJA 4TN2A 1AYEA 5DM6L 4A8KA 4A8FA 1T8EA 2G9OA 3CG7A 4ECRA 3ZZUA 2OD6A 4ECVA 3K8VA 4BRLA 3H8YA 3I8BA 3CM5A 2VG6B 2I7PA 3KLIB 3NGTA 1G1XA 2KYXA 3EEQA 2DTJA 4CK1A 1VLOA 1HNWJ 1MU2A 1FTCA 2G8VA 1WF2A 1RAOA 2E8AA 5KT5A 1KVAA 5D77A 1LW2A 2VUGA 4WFAQ 2VASA 3DC2A 2X1BA 4DL6A 1S6QA 3RVCA 4JKAA 3F5TA 4H5RA 1SV5B 4CBWA 3CCMS 3M6UA 1HA1A 3AA3A 3T9NA 3NP5A 4W4MA 2D0AA 3GP9A 4ED1A 2RUGA 3AQOA 3EGZA 3SSQA 3DLGA 1R59O 4M63A 1JJCB 1OH6A 4DTNA 2AF6A 9RUBA 4JYAF 2YKOA 1D09B 3LDQA 1OJ4A 3U7JA 2KHOA 4E2FB 1VQKN 1YITN 4ZVUB 4ZTJA 2ZHAA 2UVRA 1MWZA 3LPYA 3M9NB 4UTGA 2MLZA 4M3ZA 2CJKA 4Z94A 3EDQB 3ID8A 2K3IA 5D4NA 4H4MB 5BYSA 2H5IB 4BQLA 1RAHB 3SJJA 1U2CA 5CAAA 5E5NA 4PA1A 1TP7A 1AT1B 4C9DA 2BJ3A 2CPFA 4M3XA 3R8EA 4DV7K 2XLJA 3FE1A 2PY5A 1NMEB 5EWGA 2VBZA 3C95A 5A6PA 5B0EA 3FMBA 5CYQA 1RGIA 3DRRB 4RW8A 1IJEB 4PQUA 2NPIA 1Q5YA 1BLUA 2D3UA 1ZETA 2N7CA 2CFXA 2GBZA 3PW7A 4ZCIA 1RABB 3OTCA 1B0VA 4JV1A 1S1VB 3HT0A 4A61A 4MK7A 3UIQA 2R8JA 2FY1A 1WSFA 5GVQA 1W2IA 3KLFA 3CNQP 1U1OA 1QQCA 4BE2A 3PUFA 1YJWS 2FTRA 4QU6A 5CYQB 1X9JA 1DURA 1S0OA 4PQUB 5LMNJ 4B9UA 1OYEA 4QWCA 1XMQJ 3C3LA 4FJ8A 3IRXB 2VYPA 4LH4A 2K1RB 4HTUA 1S7IA 4EEYA 4HR2A 2I1RA 1FE4A 1SQEA 2GTDA 1X4DA 4FWMA 3CC7S 4I6WA 2ZM6J 4EYIB 1RFQA 3KLFB 4O0JA 2OJ3A 3ZZ0A 1URRA 2LMIA 2OMLA 2FZKB 3FGVA 3IR5B 4CBUA 4JYAK 5KQDA 2VWBA 5B8HA 3QSYB 1VJWA 3QEVA 2DY9A 3BPSP 2XS7A 1T9XA 2HK3A 2YHAA 4XTTA 3EMTA 4E0DA 4HUGA 4L3KA 2DRAA 3PW4A 2V94A 3OYNA 2DGSA 3ZETA 1FESA 1OS5A 3U1LA 4TQRA 2IAJA 3M8WA 1S4FA 4ZLJA 4HCCA 1RDAA 3RW6A 3HZ6A 4U67Q 2EFPA 1HARA 2JNJA 1RKJA 1LWEA 1EAYC 1JLFA 5IWAJ 3H6EA 5AFUH 3TSQA 4H4KA 4F4ZA 3WUHA 2JWLA 2RQ4A 1NZ8A 3EZ5A 4DSJA 3ZETB 4A4JA 1FJEB 4JI4F 3AVNA 2IAJB 2VBWA 3G8TA 4NLSA 2Y1JA 2IMWP 1LWEB 3VQ6A 3SQOP 1JLFB 3M2UA 4YDDB 4A8XA 1T05A 1YLXA 1FRXA 4FZYA 5D3GA 3RAQA 2EHGA 4AILC 5H9EJ 1HI1A 4Y00A 2HLUA 2RQKA 3QZ7A 3HVRA 1WOOA 3MF5A 2JEIA 2F63A 2KKZA 2V8HA 1Q95G 3KD5E 1U1NA 1U6ZA 2Q0UA 3O9TA 4FWLA 2ZBCA 3SK3A 3RB6A 6FDRA 3AT1B 3M2UB 1ZA1B 1UVIA 1XR6A 5I4MA 4U9RA 2EFOA 5BPLA 5D3GB 1BWEA 1J5EJ 1WG4A 3BEXA 4DFKA 2IRXA 4JS4A 4KSEB 3CGIA 3EGNA 2VDIA 1WC4A 2DJWA 2YJFA 4AHUA 4H5VA 3O44A 4BDZA 2PAVA 3HMJG 1VFJA 4BREA 2LEPA 1TVRA 4S0MA 1MN9A 3HYFA 2J0XA 3OJSA 5ADXH 1RBSA 4ZVQB 2DNRA 2C3OA 2I8EA 2D74B 5CYJA 4C8OA 2AW0A 1U0HB 2CQ1A 4WCEQ 2QLBB 4FXWA 2YKNA 5TKWA 4JK9A 3M2VB 4DL2A 4CEBA 4HTJA 2EK6A 2W41A 3ULEA 4IEEA 1AFIA 1R0BG 2QWLA 4CM2A 2MQMA 2D9PA 3KWIA 5JVGQ 1XNQJ 5DMRA 3UN5A 3HSJA 1IN0A 2OZSA 3ZLJA 1K6YA 3NGZA 2A40A 3VGLA 3D68A 1FKPA 5AQGA 4CO2A 2YKNB 3WBZA 2J0SD 1WSJA 4RNMA 1FDAA 2HGMA 3K7RA 1Q82T 2Q43A 4YUDA 3HCXA 3ULEB 3FDSA 3CJ8A 2LP4A 3DYAB 4LFBJ 5FLXU 3SFGA 4ED7A 4GKKJ 1O5JA 4ZKAA 2IMOA 3NNAA 1NLKL 4DHVA 2E9TA 1R8CA 1Z4UA 4Z4HA 2HS0A 1FKPB 2P9CA 3ASMA 3PW5A 4YOEA 2BJ1A 4DR2F 2ZBQA 4NCAA 2E5LJ 3AXMA 4QCLA 3U8XA 3LA0A 4LFAF 4O5FA 1ITGA 4ECYA 1J53A 1UJ4A 1NGEA 3TAEA 4O55A 4F0KA 1U4BA 1N5VA 3KJFB 3O6WA 4FJ7A 2Z8QA 4WF9L 3L4IA 1NRKA 2KFNA 4DTMA 1F5AA 3RW7A 2DO0A 2LU1A 4DOZA 5EWFA 3MMAA 3A5OC 3VEVA 5KFMA 3HFKA 3CVKA 2R42A 1CBKA 3C6UA 4L72B 2NLWA 3DXBA 2HHWA 2OTLS 4JKHA 4PXCA 1NJIT 1FNMA 1NK6A 3T69A 5B09A 3CCMN 3B4MA 3JXUA 4QBUA 3MMAB 1UZHA 4PG7A 3VQSA 2CQ3A 1HNXJ 3C6UB 5F8MA 3FUYA 4O3PA 1ICEB 5KQ8A 4MQ3A 3ZXWA 1KC8O 1NHVA 1RT5B 2V6AA 5JVGL 3SAFA 5KFIA 1DTTA 4R0EA 3ULDA 1WB9A 1RT7A 5HMZA 2O4IA 3TA2A 1N33F 2WB1D 4DR3J 3SYZA 2ZWHA 4A8OA 4OHYA 3KUGA 3GYNA 5F3ZA 1G15A 2ZH9A 1K8KB 1UEVA 2VKZG 4CLZA 5TKYA 1FD2A 4NZ7A 1WDTA 1F5BA 3WC0A 5IC4B 4DR2K 3P6YC 3C66A 4YHHF 1YZ6A 2RQCA 4GKJK 1RT7B 4LFAK 5A2QY 1ZM3A 1KTVA 3NY0A 1TTHB 3VF6A 2ASOA 4LF8F 1Q16B 2Y1LB 2M0GB 4USWA 4LJMA 2OEKA 1S4EA 3AAWB 4LF5J 4AH9A 4ZP8A 1UCNA 4FPAA 4NLXA 4OHWA 3SCIE 2MKHA 3H45C 1H3DA 4KHMA 4F7VA 4BY9C 3CIPA 5CHIA 4OPJA 3TO8A 2IDLA 4I69A 3VHQA 3HOTA 3ZT4A 4Q8EA 1R8HA 2R7QA 4WXWA 5BJRA 1RTJB 3OTOJ 4CHNA 2NXUA 3ZZPA 5E0OA 2KFYA 4DV6K 4Z0UA 2P9PA 4U8YA 4DR5F 3SV3A 4YP3A 4DUYF 3WX4A 4KB0A 2VV5A 2Z1HA 2YX6A 1MMDA 1G3OA 4OKJA 4C1NK 5IQ6A 2AJ1A 3F0NA 5C0YA 3QQCD 2ZOMA 4JV0A 4O3RA 2FJXA 2B4JA 2HHPA 2O01C 4N41A 1HI8A 1RSCA 3VEOA 2AQ4A 5HATA 4KFBB 3CDWA 4PKIA 4PR6A 1J2VA 4CJPA 4BRDA 4K41A 3DLRA 1WKKA 3BBFA 2OTJN 2O66A 1URNA 4C2MA 1RTIB 2WSEC 1SS6A 4GY2B 1RT4B 3HHNB 3HDSA 3CCQS 3L95X 4QIFA 4GRSA 5CHCB 2IC3A 1I39A 7FD1A 1X31C 2CNLB 4UZCA 3OXFA 1AW0A 2X74A 1FRKA 2Q1LA 4AD6A 3DLBA 3LANA 2MKSA 4LF8K 4Q0BB 2UU9K 3Q22A 4EZ6A 3DLLQ 3QATA 3M3ZA 3O9SA 2IM3A 4GNIA 1DGKN 1N5TA 2GC8A 3FRYA 1OSDA 4WU2A 1ESVA 2XEXA 4MFBA 2CAJA 4FBUA 3D66A 1FX4A 3W62A 3A5LC 1QTMA 5KGWA 1V5VA 3KYLA 4HVJA 2VPXB 1NNEA 2P5OA 4TNOA 3KLEA 4ILJA 4TY8A 3UDVA 3MPUB 4PKDB 2RQMA 2XGQA 4M63C 1YJRA 4DR5K 2W24A 4CEAA 2B56A 4DTPA 4YOVA 4DUYK 4HTIA 1RU1A 5T7LA 4EK2A 1H72C 4JS5A 2V2ZA 4KGXB 4F3OA 3AOAA 2XI3A 1HD1A 4CFBA 2N82B 3AVKA 1N5YA 3GWCA 4QYZJ 2XCPA 1LKZA 4MFBB 5BR8J 3AGRA 3MPDA 4P75A 5EX5A 2BQRA 2IA6A 2C3MA 4CF1A 2KI2A 4CP5A 4CF0A 4TY8B 3MM6A 4C3KA 1U2FA 3PX4A 1H7XA 3QIOA 2BRKA 3TAFA 2E1PA 2CQHA 2N3LA 3J8AA 3GR1A 4ISFA 4WYWA 4WZMA 3DLEA 3CD7A 4BC3A 3MURP 1GMWD 3CMAS 5T7LB 2GAGC 1ZBLA 4CGIA 3UN2A 5AQYA 2FQQB 4DU4A 3PM9A 4EZ9A 2L9DA 2QTDA 4B9SA 3S7RA 3D2WA 1YQHA 2I0XA 3MPWA 4BG9A 3POTA 3CCES 1Y3JA 3MM6B 4EO6A 4LSZB 1WSVA 2EWSA 4J9SA 3Q23A 3BSNA 1MN7A 2IY5B 1RYSA 3DLEB 5E2QA 1Z25A 2G1DA 4QYRA 3MMJA 4TQSA 4NLGA 1C0GA 4BR7A 3JXOA 4JI0K 2XY5A 5G0RA 3G8QA 3T19A 5GADU 2ILZA 2JC0A 1VHIA 3FZKA 2GMJA 1FRHA 2IYIA 4O0NA 4NX9A 2E1RA 3FSYA 2DH8A 1RKIA 3ENVA 2DPNA 4EGLA 3Q2TC 3POTB 2XS2A 2G8WA 3PIOQ 4USIA 2DR9A 3THPA 4M5LA 4CHYA 3OY9A 2BYCA 2E1AA 4DL0C 5E33A 4OJ1A 3L2UA 1TL1A 1UPMB 3NMRA 3KUEA 5G0RB 3GYXB 2BW7A 1T9UA 2HQFA 2Y0BB 4Q8FA 4HT5A 1A9NB 4DR7F 2OEMA 4HI2A 4O44A 1F6TA 2P9SB 3EWGA 3Q8SB 3IM8A 2QA4G 3LP2A 2AYBA 1LAVA 3MOZA 2IVFB 5EXWA 1TL1B 3V6DB 1WG5A 1FRLA 2MQNA 4OJ3A 1F2HA 2HS4A 1KEKA 4ZK7M 3RMDA 5KG2A 1FEHA 1SH2A 3P4IA 4WFBQ 4KPCA 2GEMA 4BE0A 3KDOA 4O44B 1JXEA 2NNWA 2YVSA 2X1GA 4CIEA 1V4TA 2OLWA 5A8RA 4DQIA 3TOQA 3LP2B 2K7KA 3UFCX 4H4KC 4GO7X 2M3DA 2BUNA 3DRSB 2IM2A 3WXKA 4C1NI 2M8HA 4EUVA 5FLXO 1H2TZ 1WEYA 2KYZA 1RBUA 1VLYA 1M5HA 4F36A 4FWOA 4E7HA 2KB2A 2HOEA 3T5JA 1NKBA 4NLVA 3T1YJ 1FFGB 1BC6A 1H98A 3AD7C 2UVUA 3R7NB 4HLBA 2ALYB 3HVWA 3EO3A 1LCUA 1VQ4S 5LL6d 2QW9A 1Q53A 3LDLA 3CQ8A 3NAIA 1CZAN 3WXLA 1ZAXA 3O4WA 3ICLA 2DKOB 1BWVA 3VAHA 3PX6A 3CXCM 1NK9A 3HSGA 2MZQA 4P73A 3IS9A 2UYTA 5A0YB 1DLOA 2WCXA 3KHHA 5J2QA 2E7WA 3PJXA 1ZZFA 1HR0F 1NUEA 4E7JA 4H03B 2CJAA 4MJKA 2AZ1A 4DR7K 3AY0A 5D0RA 4ZPVR 1KSPA 2PN6A 4GVMA 2QWRA 2K06A 3RMAA 5GADP 2RRAA 3P38A 4HDGA 3JAMU 3HPOA 3IS9B 4ZDNA 3HX9A 1DLOB 5HL7Q 5J2QB 4IUFA 4FJIA 1YRUA 4CO3A 4B1ZA 1HD0A 3SBGA 2C42A 1XNRJ 4MIBA 4RR5A 3ONQA 3D7SB 1B92A 2YPZA 3TZWA 3PV8A 4AE5A 2CYYA 2HBYB 3CMES 1FTRA 4B9TA 2G13A 1YJNN 1U1PA 4E98A 3O9RA 1NGGA 3M1FA 2OEJA 2NRHA 4OGCA 3EXCX 4LVOP 2FHMA 2BVZA 3W5ZA 4YY3F 1KKHA 1WSEA 1N0VC 3AVGA 1WSGA 2BACA 1TZ0A 2GV9A 5IOLA 4P2SA 2AMCB 5AZIA 5HQ8A 4JI8F 2HBMA 5KFNA 4YOYA 1QJHA 1GLBG 5GAHU 1UZDA 1IKWA 1KQSR 2H4YB 2RSQA 3I31A 4IR1A 3I4HX 3SI8A 3OS0A 2RDIA 2YKMA 4LRDA 3MM5A 5KFUA 3IUCA 1S1WB 3KLGA 2ATCB 2F9JA 3VAGA 3KMSA 1GLAG 4MTPA 1HR0K 1HQEA 5AZIB 4O0IA 3V5RA 4OVLA 4KHWA 1VBYA 3P39A 1Y5IB 3N6LA 4EHUA 2HBRB 4KHPJ 1IKWB 3GFHA 5DDOC 5KT7A 2NPFA 3I5AA 4FWKA 2W25A 5AXKA 1F9FA 1ROFA 2YKMB 2G1HA 1DRZA 3MM5B 1KOHA 3TU5A 3KLGB 3AJDA 2DGXA 4J2BA 1YTUA 1GMUA 3C94A 1NJXA 2R7OA 2HFOA 1GLLO 4OJHA 1UFLA 2V4JA 1HQEB 2M88A 1NSAA 1XI1A 4DL4A 4QIEA 3CCQN 4UW2A 1NGDA 3K5PA 2O8BA 2W9CA 3TUZC 2QEXS 1BIUA 3ZEUA 2ZD1A 4QWAA 5D0HA 3PHEA 3I55S 2C1EB 2GS8A 4DR4F 4BDYA 3B6OA 3GIMA 1S1XB 3QFHA 3HT3A 2BMBA 4BR9A 1O51A 1HLWA 4B3MJ 4YY3K 3FZ2A 1CQNA 2JWKA 2J4RA 2LQ5A 3H4BA 3CC4N 4LIRA 1IR1A 2NRTA 2O8BB 4Z4EA 2W9CB 4JI8K 2ZD1B 4DV5J 2V52B 1T9YA 4DV4J 4CEOA 3CJAA 4AFFA 1VC6A 3UD5A 5LL6Z 1HQUB 5AJ3J 2DHHA 2OD4A 2BA9A 4LF6F 4DSIA 5ITHA 3TI0A 2EK1A 2IVNA 1NDPA 3UQSA 4A47A 1NK8A 4IH6A 3CF5L 2YPYA 4FO0A 4A5BA 1VQ5N 1FW6A 2LSNA 3M8SA 4PY5A 4CJ5A 1YHQS 2CNOB 5I3UB 4K0KK 3RR8A 4ZLLA 3SLCA 4AHRA 5IS2A 4J9VA 3TW0A 2VJUA 3OW2R 3CCVS 2GVZA 2X7IA 3QAUA 4V19J 4FS2A 5D4LA 1Q18A 3QIPA 4J9UE 1YT3A 3LP0A 2MY8A 5GAHP 3CMAN 5F8IA 1XK8A 1H2UX 4HT7A 1V5IB 3TAMA 4OZ3A 4KGVB 4V1Ak 1RLDA 2AU0A 2Y3YA 4G3IA 4AL5A 2BUPA 2G2ZA 3NOCA 3CJTA 3O3LA 4FF3A 2UUAJ 1U0SA 3UDLA 3CCEN 1PYTA 2HFUA 3ZZYA 2JDJA 1UFKA 2GVZB 3QIPB 2A1BA 2YNIA 3HPGA 4DR4K 2RNEA 4MH8A 3TAMB 1ULRA 1VSMA 3H98A 3LAKA 3SMSA 4ZVRB 3BF1A 3SV4A 1IO2A 3MMCA 4E8UA 1IG9A 2ACYA 2R7RA 3EGVA 3TUPA 3NDKA 1QUVA 9ATCB 3VGSA 1N48A 2YNIB 5F1XA 3KD1E 1CVJA 2JX2A 1UTAA 2MQ8A 5B08A 1QVGM 5KG7A 3T6JA 4ELTA 3R6MA 4LF6K 2R7UA 1C6VA 1HW9A 4NMLA 1FNXH 3AO3A 3EKSA 1F60B 3MR7A 3B6BA 2H51B 4M3TA 2I6WA 4DMZA 3V81B 1XN9A 5H1SV 1S0NA 4ZVSB 3CD0A 1Q8LA 2CIMA 4KTZA 3W64A 3THXB 1ZZNA 2KXFA 4CLUA 1XC3A 2BJ9A 5HRNA 1Y64A 4K4YA 1HNIB 3NRBA 1KXPA 1SC6A 3MEGA 2Q66A 3MD3A 3DNCA 4JI7F 4TU8A 5F8JA 3GTYX 4KYZA 1LW0B 2RJZA 3D6TB 2FBVA 3FLCO 2YBVA 4DN9A 1EARA 3SUOA 4HVZA 2FSKA 4NXMJ 3ET6A 4KV8B 3KJVA 1VSEA 4WP8A 2PGCA 3DXKA 3RYLA 3QGGA 3CCLS 3CTRA 1ASVA 3IG1B 3R7SB 4J9NA 3MEGB 2Z1IA 3QNOA 1Y11A 2KG1A 2W42A 3O1LA 3WEEA 4F8RA 3R2CJ 4QWBA 3DOKA 5FIIA 3G2XA 2VBXA 3W8PA 3TNVA 5AXMA 3ET6B 4KY3A 4J37A 4EFAC 1VQ4N 1JX4A 3WZ0A 3D6RA 5LMUF 2HWIA</