3IG1A

Hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords HIV-1 Reverse Transcriptase p66 subunit
total genus 132
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ig1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ig1A05
4MKAA 4QWDA 1WAFA 1I39A 3PJWA 2VG7B 1GOCA 5F8HA 2RKIB 4DLGA 4AHVA 1D5AA 4O44A 5KFZA 1VSHA 4CJPA 1HQEB 3JSMA 1RDBA 4J9PA 4JRQA 5KFQA 3IG1A 4J9RA 2BDPA 1CXUA 3KHHA 1RT1B 3KLFB 4HUGA 1TL1A 3V9XA 4IQXA 2VG5A 3SUQA 2V4RA 1VK0A 4CF1A 4FJ5A 3EZUA 3PHEA 4CE9A 4OL8A 3MEEB 2D0CA 1IKXB 4YMEA 4FS2A 1ZTWA 3EPIA 4FW1A 1LWFB 5FRMA 1BGXT 4MFBB 4E89A 3BQ1A 4DEZA 1N48A 3QNNA 1IM4A 4TSXA 3IRXA 3V6HA 4I2PB 4CEQA 2AWZA 4OLAA 2HMIB 4CEEA 3LAMA 3CDEA 3NF8A 4IRKA 3KLEA 4CJEA 4JRPA 1FKPA 5KT6A 5DG9A 2FBXA 1HYSB 4ZVFA 5DMRA 4B9NA 1NOZA 1I3AA 1A5WA 4DTMA 3ZT0A 1KLMB 5EUHA 3I5CA 3DLHA 1S9FA 3VQ4A 3L2QA 1IKWA 4DL7A 3QIOA 3K5LA 4NLUA 3U3GA 3KHRA 1L5UA 1W25A 1ZBUA 3N6NA 5JUMA 1WLJA 1JLAA 2G8HA 2O4IA 4CIGA 3OS0A 4N5SA 1U4BA 1HJRA 1TK8A 3C94A 4I9LA 2ZKUA 1XI1A 3OLAA 3TAPA 1BCMA 1UAXA 3HO1A 4N47A 2DPJA 4ECRA 2P1JA 2FBYA 3PX6A 1EP4A 3KTQA 1RBUA 2P51A 4NCGA 4ED8A 3P83D 4TN2A 1HRHA 3KOAA 4KAZA 4RNHA 5EDWA 3NH2A 3KLEB 3KHLA 3ISND 5C24B 3RTVA 5C42A 3L2VA 4F4XA 4CK3A 1S6QB 3RB6A 1J5OA 4MK9A 1EP4B 4C8LA 2X6SA 2B43A 2W9AA 3AA5X 4PUOB 3VN5A 4O4RA 3SPZA 3M8PB 3OL6A 3T5JA 4Q44A 4KTQA 1IKWB 4FZZA 4ID1A 4KI4A 2VG6B 3KLHB 1A5XA 2DPIA 3M8RA 1BIZA 5HRSA 1IH7A 3DLGB 4CHOA 4MH8A 3TANA 2CJQA 1QE1B 2OYQA 4O3SA 2Y1IA 1DLOA 3H40A 3SPYA 1RDAA 2QV6A 2PYJA 1S1VB 2D41A 2BRLA 4NLPA 4DL6A 5DLFA 4O3RA 1LW0A 4K8XA 5KG6A 4DL4A 3RRGA 4ECQA 4FJNA 4I2QA 1MMLA 4O0IA 1NJZA 4KHYA 4H4MB 1X9WA 2Z1HA 4G3IA 1XHXA 4ICLA 1VSDA 3EY1A 4ZTJA 1T05A 4FLYA 4URGA 4O3QA 4DTSA 3OJSA 3PR4A 3NGYA 1LWEB 1XWLA 1Q9YA 1LW0B 1TP7A 5JXSA 3M8PA 2C22A 3DRSB 5HRRA 2IGIA 3OYBA 3VQEA 1QUVA 1HPZA 1KHVA 4NYZA 3LPTA 4ICLB 4DTJA 2VG6A 4CHPA 4WE1B 5FDLA 4DF4A 4GW6A 1RT2B 3LZJA 4DFMA 2ATLA 1Q9XA 5SZTA 1QHTA 4NCAA 3RWUA 1K6YA 3M8QA 3PX4A 3ZSXA 4QWEA 4AHCA 4ELVA 2XY5A 1RDDA 5CZ2A 4RW7A 1S1UB 3TWHA 3IAYA 3AV9A 5J2MA 4EZ9A 2HNZB 4QW9A 1RCHA 4BE1A 1BI4A 1DTQB 4RW8B 4FJXA 1JL1A 1BQNB 4ZVGA 2W7PA 5C5JA 3PJXA 1NKBA 3N6MA 4NRUA 4L8RB 2WRMA 4QOZB 2XC9A 3V1QA 3A2FA 4K4VA 3L3VA 4ZPBA 3AVGA 4Z4CA 1TVRB 2IJNA 3QERA 4FJGA 3KK3B 1C1CA 3CYMA 4MQ3A 1ZBHA 4MIBA 5I42B 2HWIA 1KTQA 1WSJA 4E1MA 3MXIA 4CJ5A 1JIHA 1C1BB 5HP1B 4O5BA 2FVCA 5KT7A 4KKOA 3DM2B 2JEFA 3F9KA 1S0MA 2UUTA 5HROB 2WK4A 1QAIA 3V81A 4IFYA 4N56A 4AILC 3CJ2A 3UDLA 3K5NA 3OSNA 4ZP8A 2JLEA 4FLTA 2FLLA 2V4QA 2NUBA 2XRIA 3OSPA 2HNYB 3AVAA 4FJ9A 2GBZA 1LW2A 4XPCA 4XPEA 3HVWA 1J9AA 4FLZA 3PVXA 5HROA 4F8RA 1U04A 3T5KA 3P5JA 4GVMA 2W9CA 3SI6A 3ZSQA 3PY8A 3OS1A 3DRRA 3FFIB 4NLYA 4MK8A 1VRTA 4O3OA 4WYWA 4QWAA 1RTJB 4CK2A 5KFMA 4AHTA 2XHBA 3K59A 1TQLA 1SKWA 1ZBIA 4ECSA 3PZPA 1TL1B 4FYDA 2CKWA 2P5OA 3V6JA 1KSPA 2KFZA 3FSIA 3HPGA 3ZT2A 5CYMB 1CZBA 4Z4EA 2HHUA 2RPIA 4KREA 2XO7A 2RKIA 2KQ2A 3OYKA 5I42A 3QGHA 4RZRA 3K58A 1W9HA 4NRTA 3OL8A 3QEIA 1IKVA 4ECTA 4NLSA 4OKEA 3ALYA 3I8DA 2VG7A 1LWFA 3SQ2A 2ASLA 3QIPA 3M9MB 3CIZA 2OPSA 1RILA 2YHBA 2FVRA 2D0BA 5K14A 1NK5A 1EKEA 3RR7A 4I9QA 4TQRA 1KLMA 2HWHA 3LP1B 3DMJA 3FQLA 1RDRA 3C6TA 4DQSA 1N5YB 2WB4A 1K1SA 4TQSA 3DRRB 3H59A 3SUNA 4TY9A 1VRTB 2KFNA 2O4GA 1JLAB 2R8KA 3MF5A 3CWJA 2XI2A 3G6YA 3OLBA 4I2PA 3ITHB 4CJ3A 2YKNB 1CZ9A 3AVFA 3QINA 3PO4A 1EETB 3BSOA 4J2AA 3K5OA 4J9MA 4PQUB 3LWLA 2PYLA 4HVJA 3IS9A 2AQ4A 2ZE2B 4W5TA 4DSLA 2HW3A 4J2DA 4KTWA 4ZMMA 3KD1E 4CF0A 1I6JA 3E51A 1VSFA 4DF8A 4CEZA 3H5XA 4DLEA 3NGZA 4IOBA 4MK7A 1S0OA 4FJ7A 3DOLA 3NF7A 2BRKA 2ZD1B 4KE5A 1NOYA 1RTIA 1EETA 3K5MA 4IG0B 4MKBA 3H5YA 1WSHA 4M3TA 1TGOA 2YKMA 1HQUA 2VA2A 2EX3A 2AU0A 3NBPB 1RTHA 4IDKB 4LH4A 3MECA 5KG4A 4EP5A 2OH2A 3ZT4A 3S9HA 4OKJA 3QEWA 4BE2A 4F2RA 2WONA 1YVUA 2E6LA 2RDIA 2OPQB 3NF9A 1U45A 3OVNA 4ELUA 4Q43A 3BQ2A 2GC8A 4DSIA 1CSJA 2E9TA 2PY5A 2HNDB 4J9LA 3NGIA 2XGPA 3CG7A 2VWKA 3LPUA 3GIIA 4CF2A 3EPGA 3I0SB 3KLHA 2C2DA 4QWCA 3NGDA 2G8IA 2R2RA 5SWMA 3VQ7A 5T7BA 3I0RB 1JLCA 4RNOA 2WTFA 1EX4A 4OGCA 3LALA 3BSCA 4ED0A 5J2PA 1RA7A 4BWMA 4FM0A 3QLHB 4DTUA 2B4JA 1RYSA 4CIFA 3T5LA 2OZSA 3NHGA 3CFPA 4DTRA 4KI6A 3RMAA 3RBEA 3RMCA 4ELTA 2HAIA 5KFPA 4J2BA 3SFGA 5KT2A 2BANA 1JLEA 4EO6A 5KT3A 1NKCA 1N6QA 1C2PA 3PX0A 2UVVA 4EO8A 3TQ1A 1IKYB 1D1UA 2YNIB 3AO4A 4FBTA 4DU3A 4B9SA 3G10A 5DQGA 2IBKA 2G8FA 2BQ3A 4KRFA 1DLOB 4M3WA 4OPKA 3ZCMA 3RB0A 4W5NA 4I7FB 4FZXC 1CLQA 1S9GB 1IKYA 3HK2A 3D28A 3ZT3A 2YNHB 4HKQA 4PWDA 5F9NA 3OY9A 1JX4A 3MAQA 1VSJA 1DTTA 1U49A 1S5JA 3RBDA 4Y2AA 4HUEA 3HHKA 3V9ZA 3TAQA 2IM3A 3MEEA 1SV5B 3OJUA 4YR3A 3KK1A 4DS4A 3UR0A 5F8LA 3AO2A 4CHZA 4CF9A 2O5DA 1T05B 1FK9B 3MR2A 1DTQA 4RW8A 1QAJA 1D9FA 1LWEA 4XO0A 4CEOA 1YT3A 3T19A 4YP3A 2Q3SA 4ED2A 4ZVHA 4N41A 4DG1A 4NYFA 2R7YA 3L8BA 2D5RA 4CFAA 4WXWA 3SQ4A 4IG3A 3O3GA 1SUQB 3S3NA 3H98A 1KVAA 4E7HA 4B9LA 3KHGA 2W7OA 3TAMA 2QXFA 1BQNA 1S1TA 3WNFA 1T03A 1FXXA 2D3UA 3B6PA 3LZIA 3OYFA 3GIMA 3M8SA 4DFKA 4B9VA 3AVHA 4U7CA 4R8UB 5FROA 4LSNA 1JLGB 5D3GB 2Z1GA 4IG3B 2UVRA 1ASVA 3AO1A 2FVSA 1U09A 3H5UA 2ASDA 4HTUA 1FKOA 3TAGA 1SL2A 1C1CB 3RMBA 5HBMA 4TLRA 1S1TB 1DTTB 1C0UB 2BE2B 4FLUA 3LANA 4ECVA 1L3VA 1QS4A 1BQMB 3AO3A 4TXSA 4WXOA 5J2NA 4DMNA 3DM2A 3DDKA 3CJ3A 4EBEA 3PW7A 3RMDA 1HYVA 2W9CB 1LV5A 3DLKA 1FKOB 4DQQA 4FJIA 1HNVB 3D45A 1S1WB 1SH2A 1Q8IA 2JEGA 4KPYA 5HBMB 4NCGB 3S3OA 1TAUA 4CGDA 4CHQA 2FJVA 4H4OB 1C1BA 2Y1JA 5DG8A 2Z1IA 4HYKA 4NLDA 4NLRA 1GX5A 2WHOA 5KFVA 3G6VA 3FRZA 4FCYA 1C0MA 2BQUA 5C42B 2KZZA 3VQ5A 3DLKB 1ITGA 4AHUA 2BR0A 4DSKA 2D3ZA 3CM5A 1RT1A 2RN2A 3NKYA 1RTJA 2IOCA 1Y97A 1LW2B 2B5JB 3RB4A 1RTDA 3UIQA 4R8UA 4DL3A 3SUPA 3HXMA 4ZVEA 1BL3A 1KCFA 3MEGA 3T3FA 4TY8B 3QIPB 2E9RX 5KFSA 5K14B 4W5QA 3PV8A 4U6PA 2X78A 1LAWA 3CO9A 3Q8RB 5KRSA 1JL2A 4CECA 3GIJA 3VQ6A 3HP9A 2ILYA 3GIKA 3AVNA 4M3RA 4J9SA 2IS3A 2OPSB 1Z4UA 1S10A 1L3TA 1IG9A 5L1IA 4KB0A 5CYQA 1LWCA 3QGIA 3OYEA 3H4DA 2HHTA 3S3MA 4QAGA 1D0EA 3HPOA 1IKVB 3BGRA 5KG3A 1WSIA 4FLWA 3LP1A 1S97A 4CGJA 1SL1A 3C6TB 4FJMA 4CEBA 4YFUA 1WSEA 1JLFA 1TK5A 3JYTA 5J2QA 4W5OA 2OZMA 4CERA 1B9DA 4CJUA 2WCXA 3DOKB 2XCAA 3L2WA 2FVQA 1LWCB 4URQU 1SH3A 4DTOA 3DOLB 1RT5A 5I3UB 1T7PA 3M9NB 4X2BA 1BISA 4WFXA 2GV9A 2FLPA 4IG0A 1IKXA 4K4WA 4PQUA 3AVMA 4O3NA 3RAQA 3VQQA 3JYTB 5J2QB 2F8SA 4EYHB 1ZYQA 4ECZA 3VQ8A 4F4ZA 1JLQA 5KFTA 2C2EA 3C6UA 5KFUA 4Z4GA 3IRXB 4IRDA 1UWBA 3LP0B 3V6KA 3QNOA 3D0PA 4M95A 1NK0A 4KFBA 2OPQA 2ZD1A 1TKZA 1WNSA 2BGGA 4N76A 3TVKA 2C28A 1BIUA 3ULDA 2IM2A 4O4GA 3TAFA 1RT4B 4F3TA 3KLIB 3KMSA 4WYLA 5DG7A 4KO0B 1BCOA 4IRCA 1REVA 1UWBB 4ZP6A 4XIUA 3NAHA 1QE1A 4CJLA 2WONB 1RBTA 1RT7B 3PW0A 5KG7A 4NLOA 1VSEA 3SJJA 3BR9A 4B08A 4B8AB 4FS1A 3TAEA 4KO0A 3SV3A 3CFRA 3SNNA 1JLBA 3I0RA 4CEFA 3MEDA 3OYGA 2E6MA 1NJXA 4M3XA 4DFJA 4JV2A 3D5MA 2PZSA 4GMJB 4JV0A 4FK0A 4LQ3A 3ICLA 4KSEB 4K50A 4NLGA 1HQEA 1JXLA 3CJ0A 3C6UB 1XR6A 2HNYA 3KKSA 4C8NA 2ATQA 4RUAA 3DRPB 2HHWA 1JLCB 3H08A 1WNEA 4K4XA 5EWFA 4MFBA 5KG2A 4ED7A 1U47A 4KTZA 4B9UA 4FJHA 2KW4A 3E01A 4H8KA 5KFBA 4AH9A 4KV8B 3OYCA 1GX6A 2R2TA 4FVMA 1REVB 5KFIA 3U6FA 3KD5E 4WFYA 5KRTA 4DQPA 3THVA 2W42A 2OPRB 3NH1A 4RW7B 3I5AA 2RDJA 2XWYA 2HHVA 3B6OA 2X6NA 1N6QB 4JLHA 4FK2A 2DY4A 3U3YA 3DYAA 3GQCA 3G86A 5E41A 4YQWA 4CJ4A 1ASUA 2R8GA 5F8NA 2IM1A 1FK9A 4Q0BA 4CESA 3IGNA 1G15A 3PR5B 2HB5A 4TYAA 5KFEA 1JLBB 1NK6A 3NF6A 5KFXA 4URSA 5HLFA 1NNDA 5KFFA 4K4UA 4K4ZA 3DLRA 3I5BA 3KK1B 1YTAA 1HNIB 3LP2B 4J9QA 4KHUA 3MR3A 3WNEA 5KFCA 4WZMA 2YNHA 4PWDB 2GIQA 3VQBA 4OLBA 1JXBA 4CF8A 3QO9B 1F21A 1XR5A 4Z4FA 3DI6A 2UVWA 2DTUA 4IFYB 3BSAA 3SYZA 4O55A 2YHAA 4J9KA 3CM6A 5KI6A 4Y3CA 3CJ4A 4NYNA 3Q8SB 1TKTA 4DS5A 2FBVA 1RAJA 4Q8FA 4EZ6A 5DGAA 4OKKA 1RBVA 4M3ZA 3RRHA 3QESA 2RF2B 4O0JA 5F8JA 4LSNB 2GUIA 4C8OA 5KFGA 5D3GA 3NCIA 4ED1A 4QWBA 3DYAB 3VQCA 1ZTTA 1NK8A 3RR8A 2YNGB 2W8LA 3AVIA 3QETA 1J5OB 3KLGB 1T03B 3CQ8A 4YR0A 4KHWA 3QYYA 4PUOA 2BE2A 2D0AA 2YNFB 2E4LA 1TK0A 4NCBA 4DSEA 3O4QA 1JLGA 3HVTB 1A5VA 3QEXA 1NJYA 5J2MB 4FJKA 1TKXB 2IJFA 4ID5A 4FJJA 3NBPA 3LP2A 4IH5A 2IAJA 4JV1A 5F8MA 4EEYA 3Q8QB 3ZSRA 4E19A 3UPFA 1RYRA 3VQSA 1B92A 5KFAA 1KFDA 1C0TA 3NMAA 4E7LA 1R0AA 3NAIA 2YV0X 4F3OA 1NK9A 1RTDB 3HP6A 4QCLA 3OYAA 5J2NB 2R8JA 5JS1A 1QSLA 2OPPB 3SUOA 1OS5A 1JKHA 3VA3A 1RT3B 2IAJB 5KFRA 4TY8A 2AGPA 1MU2B 1S1WA 1NHUA 4G1QA 3ZSVA 5L1JA 3L3UA 2IC3A 1J53A 3OS2A 4H4OA 4R5PA 4DL2A 3F73A 3H2LA 2B5JA 3AA3A 4FBUA 3KIOA 3NDKA 3DMJB 1D8YA 1UA1A 3V9UA 4CGHA 4OPJA 3MEGB 3BQ0A 2HHQA 1VSLA 4CFBA 5EWGA 1MU2A 1RA6A 2V9WA 3T5HA 3IN5A 2KZMA 3MR5A 3OYDA 3OHAA 4B3OA 1TV6A 3NL0A 3V6DB 2R8IA 2R2SA 4HUFA 3ASMA 4FK4A 4F50A 1ASWA 3C95A 4QW8A 4DQIA 4OGEA 4CHNA 2G8WA 2V0NA 4JS5A 3MTKA 2E9ZA 1S6QA 1VRUA 5KG0A 1KHWA 3RB3A 5KGXA 2I5JA 4M3UA 1WAJA 5KTQA 2UUWA 1QQCA 1RDCA 4B3OB 2AJQA 1NKEA 3HL8A 4M42A 1R0AB 3CVKA 4IBNA 5DGBA 2W8KA 2G8VA 2F8EX 3ISNC 1SKRA 2HMIA 2J6TA 4FLXA 3L2UA 1HQUB 3PUFA 1RT3A 3DLBA 1BI4B 5FRNA 3SI8A 4KB7A 4G1QB 1NHVA 1JLQB 5CYQB 2B6AA 4R5PB 2ITGA 1KLNA 1LAVA 4ZPDA 4DU4A 4IFVB 3LP0A 1X9MA 3BGRB 2VWJA 1RT5B 2AGOA 2KTQA 1ZBFA 4TYBA 1TVRA 3K2PA 4KHQA 1JLFB 4ECXA 4W5RA 3HYFA 4KHMA 2ASJA 5KT4A 3V1OA 2VA3A 2XGQA 1QTMA 3DOKA 3SQ0A 3SZ2A 4CCHA 3SV4A 1TV6B 4M94A 1XHZA 4DG1B 4AHRA 4DTNA 3KJVA 4EBCA 3HKWA 4O3PA 4KKOB 3O4NA 3DLEA 4EBDA 4WFZA 4Z0UA 1TKZB 2HVIA 4BACA 5L1KA 3QLHA 2XY8A 4J2EA 2OA8A 4RW4A 4ZP7A 1N5YA 4O4GB 4RG8A 3MXJA 3VQAA 4R0EA 2FVPA 3GYNA 1TL3A 3VA0A 3PO5A 2YKNA 4M41A 3WNHA 2XY6A 3MR6A 5F9LA 4DQRA 2QKBA 1TAQA 5KFJA 5DQHA 4K4TA 2ALZA 1S9EB 5T14A 4RW4B 3FFIA 4FJLA 1SH0A 3G0ZA 2J6UA 5KFYA 3QGGA 4IFVA 2ZQBA 4CEDA 3SCXA 1S1UA 3V1RA 4DTPA 3V9WA 2HNZA 1S1XB 3M9OB 3VQ9A 2XCPA 2DFEA 4CJTA 1S6PA 1HNVA 5KFOA 4CIEA 3HM9A 1RNHA 4Y1DA 3G6XA 3K57A 2HHXA 4HCBA 4RW6A 4CJVA 3KJVB 4ZTFA 2ETJA 4ZHRA 4EP4A 4NLTA 4CK1A 1UOCA 3QEVA 4ED6A 4E7KA 2A1RA 2R2UA 2P5GA 4ZPCA 4RW9B 4BDPA 4KV8A 4KBIA 4OJRA 5HP1A 5KG1A 4DWIA 3HJFA 4CFCA 4ZHRB 3FDSA 1SUQA 4CJFA 1SKSA 4Y2CA 2QK9A 3E01B 3TAMB 4RW9A 4B9MA 3IG1B 3ITHA 3LP3A 3LAKA 1KVBA 2OPRA 3CDWA 4F2SA 2Z1JA 4CJKA 4FM2A 1S1XA 3MXMA 3DI6B 1HPZB 5F8IA 3HT3A 4Z4HA 5KFNA 3L2RA 5JS2A 3QZ8A 4Q0BB 1FKPB 2JGUA 3JSMB 1X9SA 1RT2A 1RT6B 3ZSZA 4RW6B 1BHLA 4C8KA 1HYSA 3V9SA 3QIDA 3O3HA 1XR7A 2VG5B 3ZSWA 3KK2A 3AVLA 5KFKA 3MFIA 5F8GA 4KHSA 2YKMB 5CYMA 4ZP9A 4I7FA 1RBSA 3P1GA 4CEAA 3CFOA 3MECB 2YNGA 3O3FA 1TKDA 1J54A 3KLGA 1GOAA 4B9TA 3TI0A 1RT6A 1JXEA 1QSYA 2GIRA 3LDSA 3KMQA 3NAEA 3EZ5A 1SV5A 2FJWA 4DFPA 1ZBLA 4DL5A 1KFSA 3CJ5A 2IA6A 4WZQA 4CJSA 3EYZA 3I0SA 2AX1A 4DSFA 4KB1A 1TKTB 3HPHA 3KNAA 5KFHA 4F4WA 3KKRA 1ZETA 5EU7A 2RF2A 5J2PB 3HVAA 4JUZA 2IDOA 4RNFA 4CGFA 2IMWP 4K4SA 1TKXA 4ID5B 3GV8B 1RT4A 3PW5A 3KLIA 3VQPA 3NE6A 1CXQA 1T8EA 3TABA 2J6SA 1W0HA 4NLQA 3OHBA 2FJXA 1D9DA 3BSNA 3NH0A 2YNFA 3OYIA 4CJRA 3KK2B 3AA2A 1RT7A 4Q8EA 3SQ1A 5C24A 1S0NA 2ZE2A 4RNMA 4E0DA 2FBTA 5L1LA 1VSIA 1HMVA 4BDZA 5HRPA 3WNGA 3T1AA 1SL0A 2DFHA 4FW2A 2EC0A 1C0TB 2D7SA 3OYJA 1NJWA 2JEJA 3DLGA 2UVUA 5C25A 1N56A 4JS4A 2WOMB 3NFAA 1S49A 4IKAA 4E1NA 3GV5B 2ILZA 1BQMA 1L3UA 4NLXA 3OL9A 4QPXA 4Y34A 1S9GA 4CJQA 1S1VA 3PW2A 5J1EA 4E7JA 4RUCA 1HMVB 2I1RA 3TR8A 2I5JB 4LSLB 4B8CA 3HVRA 1EXQA 2AGQA 1C6VA 2BQRA 1T3NA 4CFDA 3V6DA 5KT5A 2WOMA 2FLNA 4AHSA 4H4MA 4ECWA 4NZ0A 4YR2A 2HNDA 4F4YA 4KAIA 2A1SA 4IR1A 2QE5A 4RU9A 2IM0A 3AVCA 1VRUB 4ECUA 2DFFA 4Q5VA 4IKFA 5DK5A 2G8KA 4DSJA 2R8HA 4DU1A 1O1WA 1VSKA 4I2QB 3OL7A 3QZ7A 2C2RA 3DRSA 4BE0A 5KFDA 3AVJA 2X74A 3GILA 4K4YA 4C8MA 3FQKA 1S48A 1YVFA 4H54A 3AVBA 4BWJA 4NLVA 4IH7A 3TARA 1NK4A 3UQSA 5L9XA 4J9OA 4GC6A 3BDPA 2HHSA 4HHTA 5HRNA 4CGIA 2G8UA 3M8QB 5C25B 5HLFB 2BANB 4IR9A 1JLEB 1C1AA 4FLVA 4M3YA 4LD0A 5DLGA 1RBRA 4HCCA 2F96A 4KHNA 3IS9B 2YNIA 4WE1A 5FDLB 5J1EB 1KRPA 4EYIB 4LY7A 3AA4A 4LSLA 3OYLA 3AO5A 3PW4A 2B6AB 4ZPAA 2W9BA 3RAXA 1HARA 3BJYA 3H5SA 5CY4A 2F8TA 3QO9A 3MEDB 1RTIB 4M45A 1WSFA 1Z26A 4Y1CA 1K1QA 3V4IA 4GC7A 1RTHB 4IDKA 1N4LA 4RNNA 3KK3A 3Q8PB 4MIAA 1Z25A 3CDUA 4E3SA 1WN7A 2JEIA 3ZSYA 1X1PA 1UA0A 2JC0A 1S4FA 1IO2A 3MFHA 4FM1A 1TL3B 5KFWA 4BDYA 3DRPA 3QEPA 4UQGA 1B9FA 3DLEB 1KVCA 5I3UA 4KHRA 2HVHA 1GOBA 2AX0A 2XY7A 1S9EA 5KFLA 3ZSOA 4E7IA 4FZYA 3V4IB 2LSNA 1S6PB 4ED3A 1T94A 4O44B 2QKKA 4DTXA 3SFUA 1YTUA 1L3SA 5KG5A 4Z4IA 4F4KA 4PY5A 2EHGA 1WSGA 1NK7A 2JC1A 5CZ1A 5KGWA 3GV7B 4PA1A 4KFBB 3HVTA 4LQ9A 4CJWA 4OVLA 2FC0A 3OYNA 3KLVA 2W9BB 4Q45A 3ZT1A 3BREA 4IH6A 4CHYA 4YNQA 4K8ZA 3IGVA 4FXDA 3N6LA 2XI3A 4ECYA 1U48A 3OYMA 1VSMA 3V81B 2OPPA 4FJ8A 1JKHB 3HSTB 1HNIA 5DQIA 1XC9A 3H4BA 3AVKA 3VQDA 3LWMA 3OYHA 2IC3B 4NLWA 5EWEA 4CGGA 1C0UA 1HYZA 4J9NA 1QSSA 4LH5A 3KLFA
chains in the Genus database with same CATH superfamily
3THXA 1WC3A 2PN6A 4X65J 3PKMA 4QWDA 1MWMA 1I39A 3P38A 2DGUA 3N4QA 4ZCMA 3PJWA 3MZIA 1ACMB 4A47A 2FDNA 5C2DA 5F8HA 4DLGA 3PFOA 1YWXA 3J81O 5KFZA 4JRQA 3IG1A 4ZIVA 2W01A 2BDPA 1TL1A 3VVTA 2VG5A 4CF1A 2IDEA 3EZUA 4OL8A 3HZGA 2ZF5O 4BRNA 2D0CA 4YMEA 4FS2A 4EIAA 1LWFB 3MPDA 4MFBB 1U2CA 4H5RA 3NS7B 1N5VA 4BGBA 4OZNA 2CPZA 3W5YA 4CEQA 3UD3P 2E7XA 3RW6A 4CJEA 1A0OB 2HIQA 5KT6A 2ZWPA 2HBZB 2R3VA 5CABA 2FBXA 5GAHI 3BY5A 3O5TB 4A8QA 4DTMA 3ZT0A 1KLMB 4DV7F 3GB0A 2CVEA 4OYOA 1KOOA 3DLHA 5LL6Z 2EFVA 5FPMA 4I6AA 4NLUA 3U3GA 1L5UA 4B1XB 1VQ5N 2V4JA 1WLJA 2G8HA 4N5SA 1FW6A 1WOOA 5J1PA 3C94A 3EXCX 4ZS6A 2XMKA 4DV5F 1XI1A 3OLAA 1HI1A 4N47A 5K8PA 2KYXA 4ECRA 1S6UA 3PX6A 5KOXA 2XEXA 4DR2J 3KTQA 1RBUA 1YIJS 4K2XA 1EQYA 4NCGA 2YQ0A 3VAJA 4JEPA 1HKBA 4TN2A 4C0BA 5H9FJ 1MDUB 1PAUB 5HVFA 2DGVA 1M1HA 3ETOA 3KHLA 1F5CA 3ISND 2E5HA 1WTFA 3L2VA 1NMEB 5J1NA 1NDCA 3FZHA 3RB6A 1EP4B 1WG4A 2B43A 3AA5X 3C7NA 4BR4A 4O4RA 3M8PB 1F1BB 1OPIA 3FSYA 2OTJS 4OO1J 4Q44A 4KTQA 2Y0SD 2D0OA 4ZK7M 2E2NA 4DL0C 2XG8A 1TUYA 3ZTOA 3PACA 3M30A 3EMTA 2M8HA 2RIJA 4ZVUB 2A0FB 1A9NB 2UUBK 1BIZA 3M32A 5HRSA 3DLGB 4L76A 1XN9A 2LCWA 2OYQA 4B1ZA 1IJJA 2R4FA 1DLOA 3H7HB 2X51A 1SBRA 1S1VB 2D41A 2J8AA 4DL6A 1X8DA 1LW0A 3C3LA 2LQ9A 5KG6A 4DL4A 1HBNB 1NJZA 4H4MB 2FHJA 2CJBA 4AUKA 2V34A 1XHXA 1VBXA 1LEOA 4YHHJ 2BOPA 1KP6A 1T05A 1B3TA 4O3QA 3BV8A 3OJSA 2PFDA 1YBTA 1XWLA 1Q9YA 1TP7A 3M8PA 4AL5A 1IN0A 2O8FB 2UUAJ 1M5HA 1QD1A 1KHVA 1K44A 5CZVA 4ICLB 2HLTA 3RSEA 3D6TB 4WE1B 2ZVSA 4DV1J 4DFMA 3LZJA 3SSRA 2QT7A 3M8QA 3ZSXA 4QWEA 4AHCA 1K0TA 5CZ2A 2HEKA 1S22A 3AV9A 5J2MA 2JRSA 1TMJA 2CZVC 2JWLA 2MHEA 4O23A 1UVIA 1VQ7N 2J5AA 3O9RA 1WUAA 1WBBA 4ZPVR 3QICA 2I0XA 1BOTO 1L3KA 1HBNA 1YDLA 2ZHOA 4L8RB 1N33K 4DV7J 4B02A 2QA4N 1JQGA 3V1QA 4C0HA 3R5AA 2CQ4A 2XMWA 4YY3K 4MQ3A 4XH5A 2HWIA 4TVAB 4E1MA 1WSJA 3M8YA 3TZXA 1U6BA 3HF5A 1JIHA 4WK1A 2CNOB 2I2YA 2CQ1A 4KKOA 3DM2B 3F9KA 2UUTA 1Z1ZA 1U1QA 2G1DA 4OYAA 3UDLA 2KKHA 2ZM6F 3WQPA 3PIOQ 3BDEA 3A5MC 3OSPA 2RJZA 1FFGB 4XPEA 3HVWA 1RBAA 2QYGA 3PVXA 3Q23A 2VFVA 1X5OA 2GUPA 5GAHP 2KM8B 3AA8A 2NUHA 1FJEB 2CGKA 4O3OA 2W4DA 2GX8A 4CK2A 2XHBA 1ZBIA 5IWAK 2Q6CA 3PZPA 1N0VC 1E6YA 2CKWA 2P5OA 3MHYA 3S6EA 2FZKB 2B51A 4AF1A 4CBWA 3EX7B 3FBFA 4R0JA 4CBXA 2HKEA 3QGHA 2GQCA 3K58A 1W9HA 2BXJA 4NRTA 3CUNA 2A40A 2Q79A 3QEIA 1RWVB 5RUBA 2QEXS 1IKVA 1X60A 4NLSA 3TWZA 2QWNA 3LDQA 4OKEA 4EAHD 2P9SA 2UUCJ 1GT8A 4JD2A 4ZVOB 3VEWA 1LWFA 3T6BA 3M9MB 2DIVA 2ZH9A 1VQ7S 1F5BA 2W1BA 4CQ1A 3RZAA 4TQRA 3T69A 3M2UB 4KH0B 4DQSA 1WTBA 2Q2RA 3ZTQA 2YJFA 2CH5A 4TQSA 2DNYA 1GLBG 2V50A 3MMBA 4JI1F 2P9KB 2GAHC 3CIPA 2VDIA 1HWJA 3MF5A 2HURA 5HVGA 2VQFF 2XI2A 1HBMA 2WBRA 1VQ5S 3GE1A 4CJ3A 1YJNS 3AOBA 3KG0A 3VESA 3GBTA 3PO4A 2VJUA 2AIRB 4MLHA 2DR8A 2V7ZA 5CAAA 4HVJA 3VEOA 4W5TA 2V5HG 1DHMA 1U6ZA 4DSLA 1UZDA 3KD1E 2LFVA 2P6TA 4LF9F 3D7EO 3NGZA 3MAHA 2QA4S 4JNEA 1HA1A 2QLWA 2HBMA 2ZD1B 4KE5A 4PR6A 5CXTA 3MCAB 1W2IA 4IG0B 4M3TA 2Z2LA 1HQUA 3O9SA 2AU0A 2RDDA 4JYAK 4NLCA 3P4IA 4LH4A 4K8RA 1U25A 1UVJA 3D68A 3ZTSA 1QM9A 4F2RA 2E6LA 4DPXA 1U45A 2YWKA 3UE5A 2IVNA 3OVNA 2ZDOA 2GC8A 1CSJA 3UKRB 1N5QA 1CULA 2FF6A 3THWB 3GIIA 3EPGA 4JI8K 3HD1A 4QWCA 3OXLA 4BC3A 3BSCA 2E1AA 3CCES 4FM0A 5A6PA 5LJWA 4LF6F 2ZDPA 3L7OA 1RZMA 4BR2A 3T5LA 2W2NP 2QTDA 1I51B 3NHGA 4LF1A 2J9CA 1P6TA 1HHSA 3RMAA 4ELTA 2KXNB 5KFPA 3HDSA 2IRXA 4Z94A 4DR5F 4KYZA 1YHQS 3KG4A 1N6QA 2UVVA 4EO8A 4PHTX 4X64K 3AO4A 2CJKA 4FBTA 4L75A 2GGPA 3VAKA 4DU3A 2G0IA 1KQKA 2HZVA 1RHRB 2FJEB 4P2FA 4B9SA 2RB7A 3I96A 1KVJA 2IBKA 2BQ3A 4KRFA 3HFVA 4P2SA 1E4FT 2VYPA 4M3WA 2DTJA 3ZCMA 4W5NA 2IVYA 4I7FB 1TUGB 4WFNL 5AXMA 3VZHA 3EDQB 2IDLA 3BZCA 3HK2A 4K0KF 3MAQA 3MN9A 2PFUA 3RBDA 8RUCA 1T44A 3HHKA 2XQCA 2IM3A 3M7VA 3PM9A 2A2CA 1SV5B 3TUZC 4YR3A 4ZVTB 3MMAA 1IR2A 4NPOA 4P75A 2ZBIA 3R6GB 3MMCA 3BM7A 3MR2A 2PMWA 1QAJA 4WFNQ 1D9FA 1LWEA 3D67A 4XO0A 4CEOA 4ZIWA 1FERA 4ZVHA 3ET6A 4N41A 4DG1A 4KBOA 2Z2YB 1M90O 4NYFA 3L8BA 4CFAA 1HR0J 3C46A 2LEAA 4IG3A 2NZCA 4B3MJ 3SCLE 2K7KA 4K0KK 3CJ1A 1PCAA 1W26A 2GGPB 1PO6A 4OX6A 4K59A 1FXXA 1KQFB 1A6LA 2V2ZA 4YDUC 1VQLS 3W63A 3ELHA 1NPKA 4DFKA 4B9VA 3AVHA 4R8UB 4DZ6A 1JLGB 2GVZB 4A8SA 3KYLA 1AXQA 3GG0A 1EZZB 4KGVB 2ASDA 4EHUA 4HTUA 3GPAA 5HBMA 3LA0A 1S1TB 1M5KC 1SVDA 1FKAF 2DEJA 5IC4B 2HZAA 4K5RA 1DY3A 1Q7YT 3DM2A 2J7WA 2ZJRL 3PW7A 3NGKA 1RWUA 2LLZA 4UOFA 1DURA 2KG0A 2HHHK 1ATSA 5AJ3K 1FKOB 4DQQA 1HNVB 3OTOK 1SH2A 4KPYA 5C2CA 2XBPA 1ZC6A 3A5OC 1FF2A 2ZFHA 3M3ZA 2VL1A 2Z1IA 4HYKA 4DPTA 1F3VA 1GX5A 5KFVA 2VGMA 1C0MA 1FTCA 5C42B 2BQUA 2KZZA 4ZLNA 5B0CA 4AHUA 1U1NA 1EQMA 2D3ZA 4OI2A 3MUTP 1MW7A 3CM5A 3MCOA 1BD6A 5AR0A 4R8UA 2CNNB 3SUPA 3HXMA 3VETA 1TU0B 4ZVEA 2YJEA 4DV0J 3B82A 3T3FA 3EVWA 2PAVA 2E9RX 1QZ5A 2GA7A 5KFSA 1NSQA 4ZVSB 3NGUA 3D3CJ 3Q8RB 5KRSA 3GSIA 1HKCA 2IYGA 3GIJA 4DR3K 1Q1KA 4GO5X 4DU7A 3VQ6A 2RMLA 1S76D 4PXBA 2P9SB 4UUXA 3W9HA 3TEGA 2VICA 5GADI 3GIKA 1E4GT 3AVNA 3I31A 3CJKB 1Z4UA 3TU5A 1L3TA 3MURP 3P45B 5EOYA 4KB0A 2HBRB 1ITPA 3W64A 3CJRA 3T1HJ 1D0EA 1WACA 1BUPA 2F8MA 2BJDA 2P5VA 2XYGB 1VAZA 4GV6A 1S79A 3MN5A 4MAKA 5HQ8A 1S97A 1M1KT 4CEBA 5B0AA 2C1EB 4BRAA 1JLFA 3Q89A 2WCXA 2JSXA 2BABA 1SH3A 3H25A 4TKTA 1HNWF 2G9OA 3DOLB 3W65A 4P74A 3M9NB 2L9NA 4WFXA 2B4UA 4K4WA 4O8UA 4X84A 3SLCA 4O3NA 2Q0UA 3EJMA 1SC1B 1YTYA 3JYTB 5J2QB 3ZZRA 1WOSA 1U0SA 3AODA 3C6UA 5FIIA 3IRXB 1TTHB 3BGOP 1SIZA 1HPMA 2ZD1A 5LXYA 2R7OA 1T3VA 3CD6S 3A5NC 3I9ZA 5DDQC 3ULDA 2IM2A 2ZGZA 1RT4B 4EMDA 2E44A 3LTOA 4LRFA 4JKGB 1BCOA 2GX9A 4IRCA 3PRBA 1UWBB 3NAHA 2FC8A 1JCFA 1MMDA 4TU8A 1RBTA 4DZDA 2OSQA 5H9EK 1MWKA 3LDLA 4B3TJ 3BR9A 3DN9A 4BVPA 4B08A 3KWIA 1X4HA 3TAEA 1V5IB 4I67A 2SXLA 1RJJA 4DV2K 4KO0A 9ATCB 2OD6A 1JLBA 4C3LA 4ERDA 6FD1A 4U67Q 2E6MA 3LPYA 2PZSA 4OHXA 4F02A 4JV0A 3AGRA 2D3O1 4LQ3A 1JXLA 3CJ0A 3C6UB 3R6LB 2HNYA 2H5EA 4LFCF 2NXCA 3DRPB 4ZLPA 3MX2A 1ZBSA 4CO0A 3FZKA 2QLXA 5DRKA 5EWFA 4MFBA 1FWLA 2OCEA 1IJEB 1TUVA 2MLYA 4B9UA 3EO3A 5KFBA 1GX6A 3CJBA 4I68A 2MY7A 4DQPA 3THVA 4RW7B 3I5AA 2QA4G 2XWYA 4DJBA 4YS2A 3U3YA 4DV6K 3GQCA 4YQWA 4CO5A 2GWKA 3ATUA 2R8GA 5LMNF 2IM1A 4Q0BA 1WJ9A 4GKJJ 4GY2B 1WEZA 3Q83A 2QMWA 1JLBB 3I8BA 3CNQP 5HLFA 1YJVA 3TZYA 2ZZTA 4ANDA 1D4XA 4K4ZA 3KWMA 1HNIB 3WNEA 3THYA 4PL7A 5KFCA 4PWDB 1WDDA 1ILYA 5G0RA 4A8FA 2POKA 2N7YA 1HLUA 3HRGA 2F4VF 1SB6A 3ET6B 4WFBQ 4X4PA 3TRGA 1XR5A 3DI6A 3IBWA 2DNZA 2J9DA 4IFYB 3BSAA 4H0YB 3IMXA 3W8GA 3CM6A 2HYIB 2HGLA 1Q8LA 4KPCA 1RAJA 5FPEA 4Q8FA 4M3ZA 3QESA 2BUPA 2GUIA 1N5SA 5IC6B 2W8LA 3IM8A 4LT6A 3C2PA 4TU9A 2M8DB 1UL3A 2GVDA 2Z58B 2C2ZB 2MGZA 1Z2ZA 5BR8K 2Y1RI 2D0AA 5ADXA 1WC0A 3QFPA 3SJHA 1EIYB 2KO1A 2JWNA 3MM6A 4ZVQB 4NO7A 3QEXA 2IJFA 4OYWA 3NBPA 3MWTA 5HMYA 3THPA 4JV1A 5F8MA 3C6AA 3KKFA 3R27A 4XDCA 1B92A 5KFAA 1IBLF 4E7LA 2NLXA 5HO4A 4ZPTR 1N32F 4QCLA 3OYAA 3VF4A 4YHHK 2EPIA 3CMEN 1N52B 4JI2J 3UD5A 1FVQA 1LXNA 2MJNA 3W2WB 4DCJB 2AGPA 3K8WA 4CT8A 1S1WA 1K9MO 4G1QA 3GR0A 1VYAA 3ZSVA 5L1JA 3L3UA 3DJCA 4YB5A 4A2BA 5EY4A 1XMOF 1VJQA 3CD7A 4HHHA 4X4UA 3AA3A 1V9OA 2VFSA 3TA1A 3DMJB 1RHKB 1D8YA 5TKYA 3J7YI 4DPWA 2VZ9A 1U2FA 4OPJA 2LXIA 1KBRA 2J0QD 4GKKK 3L4BC 3P3DA 1R8PA 2IJRA 2LA6A 3J81U 3ASMA 1XNQK 3HHLA 1Y7PA 3MEKA 4OGEA 2EKNA 3GYGA 4DUYF 5I9EB 2V0NA 4JS5A 4LRBA 1S6QA 2GEMA 2HZCA 1T6CA 1BLUA 2EFQA 1RISA 5KTQA 2YWEA 5B0FA 1CJUB 3GFYA 2LEBA 1NKEA 1ZA2B 7FD1A 4DR6J 1EX8A 2F8EX 2HMIA 2UXBJ 4OZ0A 2NPFA 1I94K 3L2UA 5FRNA 3SI8A 4DX7A 4G1QB 1H2UX 3CJSA 1JLQB 5CYQB 2B6AA 1GFWB 1LAVA 3GG4A 5KQ8A 4M5HA 3LP0A 1XMOJ 3NG8A 1NHKL 2AGOA 1KC8T 2G0JA 2FQQB 2ZBRA 2VBXA 3HYFA 4KHMA 3M1FA 3ENAA 4A62A 2VA3A 1PYTA 2O3DA 4K0KJ 3SV4A 1IBLJ 3M8WA 4M94A 4AHRA 4JI3K 4EBCA 3BBCA 4KKOB 3DU6A 3WIVA 2MZJA 4BQZA 1VQ4S 5L1KA 2N4CA 4ZCLA 3GE9A 2OA8A 1FNOA 1N5YA 3AHPA 3ILOA 1ZOTA 4WWSA 2FVPA 2MY8A 1TL3A 3VA0A 3PO5A 2N4DA 4WK3A 3SQGA 2LVWA 4HDHA 4M41A 2XY6A 1RHUB 3IR6B 4FXVA 3MR6A 2ALZA 4UZCA 3ENQA 1X4FA 2C2MB 1MA9B 3QGGA 2GELA 3SCXA 2NSCA 1JCEA 3V1RA 5CHCB 3FCVA 4DTPA 3V9WA 3M9OB 3VQ9A 4KY3A 2CQGA 3RYLA 2DFEA 3LDOA 2O8CA 4CIEA 4X62J 4Y1DA 4A59A 1DQ8A 2NRRA 3ZYYX 2O67A 4RW6A 2ETJA 2E1RA 3T1YF 1HX1A 4JD2B 4ED6A 3CGIA 2A1RA 3HI0A 2DCLA 2NRVA 1NWKA 2V8GA 1NSPA 4C7QA 5HJYA 4ZPCA 2FHKA 4BDPA 1UZHA 3CE8A 4JI6F 4KBIA 1PYOB 2GMHA 2WBNA 5HP1A 1VISA 5KG1A 3H46O 4B1VA 1F9FA 2UU9J 3G82B 3ZFVA 3ILLA 1HKAA 4ENOA 2PDAA 1VQLN 3THXB 1V5VA 3LAKA 1KVBA 2OPRA 3CDWA 1AZSA 4F2SA 4FM2A 3MXMA 1DEJA 3HT3A 5KFNA 4ILMA 1SJ1A 2YHWA 1FKPB 4FP9A 1RT2A 2ZC3A 1QDUB 2DJWA 1JJ2M 1SJFA 1Y11A 4RW6B 3ZSZA 3CCTA 1NZ8A 1XR7A 2VG5B 4I6WA 3I4HX 2YQ1A 4ZKAA 2HBJA 5KFKA 3MFIA 2FXUA 2OKQA 2NUUG 2B0GA 1HBUB 2C3PA 4B9TA 2H4WB 3TI0A 2KXFA 2FHMA 4U8VA 4B3SJ 2UUAF 1GMWA 1WKLA 4LF5K 1QSYA 2PEHA 1SQKA 3EZ5A 5BREA 2BEFA 4HDGA 1ZBLA 5BN8A 3R5DA 4QIVA 1FRJA 1V3RA 3HLUA 1S72S 3G6EN 1WHVA 3CD5A 3MUVP 2AX1A 4JKEA 1TKTB 4AYBD 1EB0A 3K2YA 3D3BJ 3IR7B 2QG9B 5E3PA 3AA9A 4OZJA 2B3TB 2VGNA 4KGXB 1T8EA 1W0HA 1R0BG 1JB0C 3CCQN 1D9DA 4K43A 4U96A 1NGIA 2KL8A 4DV2J 3VF6A 1RT7A 3SQ1A 5C24A 2V68A 5IQQA 4CO3A 3TQEA 2ZE2A 1HBUA 4TLQA 2LMIA 3T6JA 5MLCQ 4FZVA 4BDZA 1LOTB 4HI1A 5IT9U 2DFHA 1KWMA 3UR3C 4MO5A 4OJHA 1C0TB 3P6YC 1NJWA 4YB6A 4YY3F 3NFAA 4IKAA 2FLOA 1Q82T 4LVNP 1L3UA 4KHPK 5A8RB 3POTA 3IA0A 2AHOB 2V2QA 4P9SA 2I1RA 3WC2A 3TR8A 2I5JB 2V2KA 4LSLB 3GSDA 2AYGA 3CIMA 4IDHA 1AA1B 1EXQA 2ZBPA 1VLYA 2PMZD 2AGQA 1IXKA 4IEEA 3K0SA 5AQTA 2R7WA 4CFDA 1YJWS 3UN3A 3TZZA 1OH5A 4IO9Q 4OI4A 2JWKA 3Q22A 2BKNA 1F60B 3R8EA 2QN6B 2HNDA 3X1LB 4F4YA 2V8DA 4M63C 4IR1A 1SKUB 1A7GE 5JLHA 4Q5VA 1HJOA 3HHLC 2R8HA 1WI8A 4DU1A 5DDRC 4FWPA 3L4QA 3QNWB 3DRSA 4C8MA 2GHVC 3TARA 2J9EA 1NK4A 3I32A 4J9OA 5G4DA 4PG6A 2L48A 2GJ2A 2G8UA 2WB1D 1PSDA 3TTFA 1ZZFA 1TL5A 3NNCA 1NBEB 4FLVA 4LD0A 2GVZA 1K8KA 5AZJB 2F96A 4KHNA 2A42A 1K0VA 4QIFA 3IS9B 1F2GA 3L9ZA 1KRPA 2VFTA 3NXZA 4LSLA 3PW4A 3J8AA 4P7TA 4GKJF 1FRMA 2YQ3A 4QYZJ 2F8TA 4USTA 3IKMA 3KJFB 3MEDB 1RTIB 2XYHB 4YY3J 3AD9C 4AXIA 5BJRA 1GAOA 4GC7A 3GP9A 4RNNA 3Q8PB 1K47A 1Q4RA 4MIAA 4MLEA 3DXKA 5GADP 2E20A 2JEIA 1X1PA 1RE1B 3DDIA 3Q86A 1TL3B 5HAOA 1PGZA 2ZH6A 1B9FA 1W2BR 4J91A 4M5DA 1KVCA 4A8XA 2CGJA 3ATVA 2AX0A 2XY7A 1RK8A 2KJVA 3ZSOA 4E7IA 1OY6A 1C0GA 2LSNA 3ZEUB 1TL7A 1S6PB 4FYVB 4C0OC 1FRIA 4LF8J 2R9LA 4Z4IA 4F4KA 1BMQB 2EHGA 3VGVA 1NJIO 1NK7A 1WSGA 2NQPA 4CJWA 4OVLA 2AJ0A 2FC0A 1EARA 1ZAXA 2H3EB 2YVSA 4NZ7A 2V9KA 2UXCJ 3IGVA 4FXDA 2HBKA 4NI2A 4ISGA 4P2XA 1QVFM 5F0WA 1U48A 2DRAA 4CH7A 4FJ8A 1CJKA 2OP5A 3HSTB 3CJ7A 3H4BA 3VQDA 1X3MA 3QJLA 3OYHA 3SMSA 5IXUA 2WSCC 2Q31A 5M1KA 4LH5A 3KLFA 2ZNYA 3HZEA 1RWKB 4WQ5A 4G65A 3TSUA 2JNJA 2CQ0A 2IBOA 1FFWB 4JI4J 1PJ7A 2VG7B 1T0TV 4AHVA 4RJVA 3G82A 4CJPA 4LF6K 4X4VA 3JSMA 1RDBA 4E2FB 4X4RA 5KFQA 3RRKA 2X1BA 4JV5F 4HUGA 4IO8A 3ZTRA 3A8IA 1FTRA 3SUQA 2V4RA 1VK0A 4FJ5A 3SAFA 5A2QO 4CE9A 1WBDA 3MEEB 3EPIA 5AQZA 5ADXH 5FRMA 2ZJPL 1OVQA 3OQ2A 3KG1A 4E89A 3E66A 3BQ1A 4DEZA 3MWBA 3QNNA 2W41A 3IRXA 2B4OA 3HSDA 4PCQA 5E0OA 2J7UA 4OLAA 4CEEA 3CDEA 5AQVA 4S0MA 4LJMA 1V6HA 1IQZA 3KLEA 2RT3A 4C8YA 4I56A 5A8KA 3QFHA 3MPVA 1SAZA 5AQOA 1NGDA 3QWPA 1VQOS 1HYSB 5DMRA 3OUYB 4DV3K 1A5WA 3D1OA 3I5CA 2MQNA 4KIAA 1S9FA 1UFWA 3DGPB 3D54A 1IKWA 2FJDB 1YXQA 2G2YA 1YVNA 2QWOA 3MMBB 1W25A 2P9KA 4JI5F 5JUMA 3L6QA 1DJ0A 3PRDA 2ZVIA 1U4BA 3O1WA 1HJRA 1BCMA 2FHOB 4WFAQ 1YBUA 3O44A 4LFBF 1U24A 2FBYA 5EX3A 3QSYB 3GYXB 4A8YA 1WG1A 2N7CA 4ED8A 3DCAA 4QYRA 2OTLS 4ILHA 4LF9J 1HRHA 1VHFA 2PA8D 4RNHA 4F7VA 5EDWA 4H0OA 3KLEB 4CLPA 5C24B 5AJ3F 3C16A 4USWA 4F4XA 4PKIA 1TYQA 2VUGA 2DNRA 3VN5A 1LOUA 1U2RA 4C4WA 1RAOA 3RU0A 1KS2A 1FJGK 1IKWB 5AZIB 3O5BA 4OLOA 3LOUA 1ZAVA 2QLJB 2C2KB 5FLXY 1HD0A 3RVCA 2Q1NA 1JJCB 1SJRA 4QPTA 2DPIA 2EVZA 1NGGA 5I3PA 3VCDA 1IH7A 4CHOA 4MH8A 1C4AA 1QE1B 4LF8K 1N36F 2Y1IA 4CP5A 3J7AN 3SPYA 1X0FA 3QT6A 3U4LA 1RDAA 3GDQA 2AV5A 2AZ3A 2PYJA 4UOGA 4RX6A 2VF3A 4ES1A 1Y0HA 4OFZA 1RTZA 1WF0A 3TSQA 4FYWB 4O3RA 3FVYA 3CQXA 2CH6A 2BKPA 5K20B 1RB0A 3RRGA 1KQGB 3US5A 2R7TA 3ZO7A 4O0IA 5C7PA 2Z1HA 2ALYB 4B3TK 4OHZA 2A10A 1NGEA 4ZTJA 4DN9A 3NGYA 1LW0B 3SBGA 2MB0B 2EFPA 2C22A 4M8LA 2EEYA 3OYBA 2I7PA 1B99A 1UETA 1HPZA 3U1MA 2M3DA 2DD8S 4A46A 1J6ZA 1OH6A 3C8YA 1SS6A 4GW6A 4NYOA 3ZX0A 4LSZB 1QHTA 4NCAA 3UDVA 3RWUA 4ETZA 3SK3A 2XY5A 2HQDA 5A8WA 1RDDA 3OR2A 2ATCB 3TWHA 1RLCL 2MSTA 3G87A 4LUBA 1XUPO 2BZ2A 4B3TF 1FFSB 2BYCA 2VDHA 4EZ9A 2HNZB 4BRIA 5M1OA 1RCHA 5F0UA 3W5ZA 3WXMB 3FCHA 4WCEQ 1VQ6S 3N6MA 1P8ZA 1PC4A 4WFAL 2AJFE 3OD2A 4K4VA 3A2FA 1WDTA 2GZOA 1RABB 4Z4CA 3SQOP 4W92B 3KK3B 1HBOB 3OBIA 3CYMA 1ZBHA 2MDAA 5I42B 3ULEA 1JJ4A 2A41A 1U1KA 1VQNN 1FO1A 1Q78A 5KT7A 4USUA 2HVZA 1S0MA 2MQ8A 5HROB 2FY1A 4PG8A 4AILC 3PDNA 3K5NA 4MMOA 5GMDA 4ZP8A 2EXUA 2LEPA 4FLTA 2V8PA 2C42A 2V4QA 4Y0WA 3J80Y 5LSOA 2VPYB 2OEKA 2XRIA 4IOAL 1FT8A 3OR2B 1LW2A 1N8RT 4BRFA 3BB5A 2NPIA 3O3LA 5BR8F 1U04A 3OW2M 3ZSQA 3OS1A 4KHPJ 4M7XA 2OANA 5BYSA 1VRTA 3UKUA 2V67A 3O8WA 4QWAA 1RTJB 4FWMA 3K59A 1TQLA 4U95A 4X66F 3R3TA 4FYDA 2HOEA 5BR9A 3V6JA 2BJ8A 2VV5A 2KFZA 3FSIA 3HPGA 2NYIA 5CYMB 1FDNA 1ZS6A 3QRPA 4Z4EA 5AFUH 2RHSB 2HHUA 2RPIA 3VQTA 1VBKA 2XO7A 3P8BB 4I1TA 1CJVA 2BMBA 1D8ZA 3IDHA 5I42A 1MWZA 2FTRA 2P9CA 3OL8A 4M5KA 3AFGA 3JSYA 1RI7A 2Y8YA 3CQYA 2I9SA 4U8YA 4YOUA 2BACA 2KKZA 2QWQA 3AQOA 2N3OA 3CC2S 3R97A 2F1FA 2KN4A 2DXEA 1Z05A 1VRQC 2VU5A 2FY8A 1BO5O 3TSPA 3B4MA 1WKJA 3A8EA 4EK2A 4IUFA 2EC2A 2K7JA 4RKUC 1OKJA 1RAGB 3MAAA 1QUPA 2HWHA 3NRBA 3OVSA 1S5ZA 2BM1A 1N5YB 3SUNA 2LDIA 4GVBA 3CJKA 1VRTB 1JLAB 1IR0A 3SQGB 4I2PA 2L08A 1EETB 1HR0F 4J2AA 4USVA 4HI2A 1FRXA 3LWLA 2X7IA 1Q86O 2PYLA 3KUHA 2FYXA 1PBAA 3FGVA 2CNKB 4KTWA 1R3NA 2CGLA 3K9KA 2B9WA 1OQ3A 4CEZA 1J27A 1BDGA 1S0OA 4FJ7A 3D9BA 5EGYA 3DOLA 2HBQB 1NOYA 4NXNJ 1NGFA 5IWAJ 3H5YA 2YKMA 2ROEA 1FX2A 1CQMA 2DNGA 1HW8A 4X64J 1RTHA 4IDKB 1Y00A 3JQKA 4BE2A 4AM6A 3NF9A 4JI5J 2PD1A 3PYEA 4DSIA 1NM1A 3VOVA 3NGIA 2XGPA 3CG7A 3LPUA 3D2FA 4ED4A 2OLWA 5F2RA 3BKUA 2OHDA 3MMVA 2HQ3A 2G8IA 3KUGA 5T7BA 4CLWA 1JLCA 1EX4A 4OGCA 3LALA 3MGJA 3U7JA 2F4FA 1RA7A 1CS4B 2BJ1A 4BWMA 2MQQA 3QLHB 3GFHA 4DTUA 4LFAF 3HZ6A 2YHXA 1OIAA 1RYSA 2MKSA 1SQEA 3P96A 3M8ZA 4DR2F 3LDPA 4KI6A 4QQBA 2E1CA 3I33A 3FBCA 4JI3J 4LF4F 3RMCA 3HHDA 4G1IA 3SAHA 3OFEA 4F25A 1AZSB 5KT2A 1RHQB 5KT3A 1SJ3P 4OX8A 3C0BA 2NRWA 4WTOB 1IKYB 4DV0F 4DR7K 1D1UA 2YNIB 4OYBA 3WZ0A 4DR1F 1RCOB 2VCPA 1WUUA 2GHPA 2OIHA 5DQGA 3BEGB 1OVYA 2DB1A 3CC4N 5F3ZA 4HACA 4MKYA 4IEIA 4KGZB 1B4SA 3IR5B 3QAEA 4OPKA 1EO1A 4BRLA 2P8IA 1WG5A 4OX9F 1S9GB 2E2PA 3ZT3A 2IPOB 3HSGA 5F9NA 1JX4A 3FKBA 1DTTA 1U49A 5E3CA 1S5JA 3FSXA 3V9ZA 1XMBA 4J5OA 1IJFB 1Q82O 3OJUA 5F8LA 1N34F 3AO2A 2O5DA 3D4JA 3VVUA 1FNMA 1GLAG 1VBYA 1DTQA 4G1PA 4A61A 4BGAA 3UB5A 1YI2N 2NZTA 4OPAA 1Y3JA 3RAMA 2H54B 1YT3A 3T19A 4QZVB 4YP3A 4CBUA 2YWFA 2E1PA 3I4PA 2IVPA 4RLEA 2H1YA 2NXNA 3O3GA 1KVAA 1P1LA 2CQHA 4B9LA 3KHGA 3THYB 4LF4K 2P2CB 5CYJA 1K8AT 2W7OA 1UPPA 2VIHA 2M0GB 3CMAS 1M1GA 2EK1A 4UY8O 3QT8A 2VD3A 2F40A 3LZIA 1TL4A 3M8SA 1NH7A 3CJCA 5FROA 2Z1GA 2EK6A 4IG3B 3UNYA 1FX4A 4CNZA 3ILJA 3H5UA 4DV5K 4M5IA 1HNXJ 2V6AA 3RMBA 3L7UA 1DTTB 4FLUA 2HRYA 4F3QA 5AE2A 4E98A 4BC9A 4CRJA 4JYAF 5B8HA 1UWAA 3HFKA 5J2NA 4DMNA 3DDKA 3GZ7A 1S6OA 4EBEA 3RMDA 3OFGA 3TVYA 2W9CB 2OO4A 3SIPB 2CRLA 3DLKA 2YWHA 3QFWA 3D45A 3P31A 1WSRA 2JEGA 2UXDK 4M7YA 5HBMB 3U02A 1N54B 3CMQA 5HATA 1TMMA 4H4OB 1C1BA 1OO0B 5BRFA 2HQIA 4BRDA 3W7BA 3K9JA 1N34K 5DG8A 2YX4A 4NLRA 2WHOA 2CA9A 4U7UD 4NEYA 4HVZA 2W7AA 1X4AA 4LF8F 2Q0RA 1AROP 2RQCA 1ITGA 3ZX2A 3CF5Q 4ILJA 5BXIA 1RTJA 2LU2A 2Z0GA 2AW0A 3DRXA 2XLKA 3FBEA 1SC4B 1KCFA 4DV5J 2QMUB 3K89A 3IBCB 5K14B 4W5QA 2X78A 3CO9A 4CT9A 1W7WA 4I0WA 1JJ2R 2UXCK 2P9NB 2HWTA 2LDYA 2WW8A 5AFUA 5DZ6A 2IVMA 2Q66A 3CSKA 2H5IB 5DS7A 2IS3A 3FFKB 2QXLA 3IUCA 1S10A 3HHNB 5ETKA 3C14A 2KVQE 4XTTA 1MROA 2HFNA 2MKJA 3SCKE 4QS8A 4FLWA 2D9PA 3D6RA 5BPMA 2OEMA 4YFUA 1VFJA 1N88A 3KDNA 3R2CJ 4NWBA 5FLXO 3KJQB 2MMYA 4CLSA 3DOKB 3L2WA 2MKIA 2FVQA 2MKKA 1W7AA 2W25A 2JFDA 4M5DB 1T7PA 1MMNA 2W6KA 4JKCA 2FLPA 2IIRA 1U1MA 1IKXA 1RGVA 3WX8A 5AQUA 2W2MP 3AVMA 2QWPA 3VQQA 3BBFA 4IYQA 3R3LA 3VWSA 4WP8A 2LQ5A 1CBKA 1JLQA 5KFTA 3OFFA 2X1GA 3H20A 4IRDA 3LP0B 1S57A 1T9YA 3V6KA 4IOAQ 2HGMA 3EVOA 4QIEA 1QY7A 2OPQA 2ERRA 2G13A 4ZITA 4WKRA 3H8YA 1BIUA 4O4GA 3VF0B 3TAFA 5GAEU 3LW5C 3Q8UA 1RWOB 4WYLA 1WOQA 4H0TB 2NCKL 1RUSA 3BO4A 5AQSA 1REVA 5AQQA 2B4VA 4XIUA 4TU7A 3NOCA 1OJ4A 1IBMJ 1U6FA 2MPUA 5AQMA 4CLZA 2HQFA 3L3CA 5KG7A 4OHWA 2YXLA 4N77A 3R7NB 2HK2A 4FS1A 4PABA 2CZ9A 2CPIA 2P9EA 3SV3A 4OPHA 2XMUA 1YJTA 1VQNS 2UV8A 1X4BA 3VZIA 3R2DJ 4JV2A 1QQOA 4GMJB 5B09A 1MLAA 2XNRA 3ICLA 4KSEB 4AFFA 4K50A 4NLGA 1FI4A 1XR6A 2XO6A 4C8NA 2NXEA 5HSPA 4M5JA 2ATQA 2DNKA 4RUAA 4NLBA 4B3RF 4DXLA 4K4XA 3DRYA 3B6BA 4YORA 1UW4A 4ED7A 3FZLA 2ZH1A 1U47A 1TUUA 3DWLA 1UJ5A 4FJHA 2O8CB 3AARA 4EI2A 4PXCA 1GTEA 3CJTA 2BE9B 4FVMA 1REVB 5KFIA 3MDFA 5D6GA 5KRTA 3NH1A 1NBWA 5AQNA 4B1YB 2HHVA 2B4PA 2XULA 4FK2A 2DY4A 3S41A 1ASUA 4J8FA 1FK9A 1FJGJ 1U0HA 4QIGA 2RILA 3PR5B 2HB5A 3CCQS 3VGMA 1FWKA 3N0VA 4PAAA 3L7PA 4JI6J 1XQSC 3W62A 3DLRA 5FPNA 2KVIA 3LP2B 4J9QA 4KHUA 1MWYA 5KAKA 3JTNA 3VV2B 2YNHA 2CPDA 3DGVA 5AXLA 3R9PA 2GIQA 3O6QA 3F56A 1IBKK 4OLBA 2A6MA 5DM6Q 1UVNA 5AT1B 1J2VA 1C4CA 4RO0A 5IZHA 4G6VB 5F41A 2UVWA 2QTWA 3OTOJ 1TZ0A 3D0HE 2DTUA 1BA1A 2E2QA 5L39A 3SYZA 1BUXA 2MQOA 4J9KA 1O5JA 4GVLA 5KI6A 3HFZB 3BF1A 4Y6IA 4N7TA 4LBPA 3OVAA 4CNYA 4EZ6A 5DGAA 1XQIA 3MR7A 4LMZA 5BYRA 3RRHA 1ATNA 1R59O 3SSQA 5F8JA 2ADBA 1V3SA 4QWBA 3GU0A 2VHGA 1NK8A 2LXUA 4DR2K 3QETA 3WX4A 4USMA 3J80O 1T03B 3D2EB 3QYYA 2YNFB 2FJAB 5AQWA 1H3DA 1R6YA 3UDEA 4UQTA 4DSEA 4U7UK 3BN7A 2VC0A 4FJKA 4ID5A 3LP2A 1RWNB 2IAJA 2E7WA 2MZSA 1N5TA 2RE2A 4E19A 3UPFA 1YI2S 2XLIA 2MGZB 1N33F 1XTZA 3NMAA 2YV0X 1RTDB 1WEYA 4NE9C 2HHPA 3SUOA 2MZ1A 4KR0B 3VA3A 3GJTB 1F3FA 4DV1F 2WAQD 1RHJB 4M1KA 2V4JB 3QJPA 2RRBA 3GFXA 1J53A 2G2ZA 3LQVA 3OS2A 4DL2A 3P49B 4GKJK 4NA2A 3C6HA 3CCRN 1NLKL 4FF1A 3H2UB 4BRCA 3V9UA 4JKFA 2Z2ZA 4CGHA 2UXCF 3CCWA 2OFGX 2RAQA 2O8EB 4OYZA 3MR5A 1JNRB 2MEWA 4JV5J 5HOOA 4B3OA 2OFHX 3NL0A 4ZDNA 3V6DB 4H0XB 1UFKA 3C95A 3K0JA 4DQIA 5C15A 5LL6d 3TX0A 5KG0A 3RB3A 5CQGA 5KGXA 2I5JA 3AD7C 4M3UA 1XNRJ 3CCLN 2HVEA 4HTJA 4JHDA 1QQCA 1RDCA 1MROB 3CVKA 1GMUA 5D4LA 4IOCQ 3CCLS 2G8VA 1YLXA 3NS6A 1Q86T 3Q0AA 2ZM6K 4PXDA 4FLXA 2DHGA 4WJBA 1BC6A 3MCPA 1OH8A 4QYZK 2ITGA 4DX6A 3F9MA 4NXMJ 5IM0B 1SPBP 2ZOFA 1CJUA 3BGRB 2VWJA 3NLCA 3G8SA 1NB2A 3QT5A 2CQPA 3E9OA 3CI5A 3A12A 4JKDA 4EFAC 2XGQA 1EWQA 2FHJD 4M5NA 2JOQA 1S99A 1X4EA 4CCHA 1N33J 3IRWP 4DTNA 4X4TA 2UU9F 5D4PA 5DM6L 3DLEA 2HVIA 1FE0A 4BACA 4J2EA 4O4GB 4RG8A 2DR5A 2K3KA 2P9IA 2V7YA 3KDOA 1MG7A 4JHDB 5D0EA 4OIXA 2V94A 4QOTA 3GYNA 2H48B 2DRBA 1T11A 5I3QA 1GLEG 3R6MA 4NB4A 4WKYA 1WORA 4DQRA 4CZJA 2QL5B 4K4TA 1VQKN 4H5NA 5KOWA 4DV4K 4LRDA 2MLZA 3G0ZA 2K1RB 2ZQBA 4CEDA 3B8HA 1VDHA 2AEFA 2A6AA 2ZZMA 1R31A 2AA4A 4CJTA 4DPOA 4OJGA 2NR0A 1S6PA 4NXNK 5KFOA 2HS3A 5H9EJ 2YKAA 1YJ7A 4DX5A 3FRYA 2GTDA 4CJVA 1HLWA 2BTFA 5CA5A 4BRGA 3E9PA 4YOXA 4DV3F 4WQ5C 4ZHRA 1APSA 2JFKA 4CK1A 4AD6A 2VBYA 3M6UA 2QM1A 2R2UA 5AE1A 1I94J 3WEEB 3E8OA 3DAWA 2NREA 5H9FK 1K8AO 4DWIA 2MYFA 4IFEA 3HJFA 1YJNN 4JK9A 4CFCA 1CJKB 4X4QA 4EFHA 4DOZA 1SUQA 1F0XA 2FSNA 4CJFA 1VK3A 3IXQA 3UVJA 2QK9A 3MM8B 2GWJA 3E01B 4Y28C 1YJ9N 4BR5A 2ASOA 3TAMB 3H42A 2K1RA 2CJ9A 1U8SA 5C2GA 3S8SA 1ZXOA 2H3GX 3LP3A 4LR8A 5BPNA 2O8FA 4Z7CA 3CTRA 3HHEA 3UD4P 4UY8T 3C19A 2IIHA 4K41A 4JN4A 3JSMB 1X9SA 1U26A 1BHLA 2M5YA 3UE2A 3V9SA 3QIDA 1EAYC 3BP8A 1NDLA 2HRTA 3KK2A 4KHSA 3AXKA 1H38A 3M2VB 2YKMB 4ILGB 4ZP9A 2GFFA 2HGNA 3F5TA 3P1GA 3VEXA 4CEAA 1KAYA 5IWAF 2HHHF 3SMZA 4FWKA 2M88A 2DY9A 4OYPA 2XMAA 1N0UA 3AD8C 1UKUA 3G71S 1J5EK 1JXEA 4UF4A 4BC7A 3A3PB 3KMQA 4CI6A 2XSFA 3Q8YA 2FJWA 2YI1A 2RD5C 4DL5A 1KFSA 5EX5A 1GXTA 3M4XA 4F0HA 5E3QA 3BN4A 1DGKN 2VKZG 3OUYA 3BGLA 5LSRA 3PG9A 4F4WA 3KKRA 4XH4A 1ZETA 2BOAA 4FL9A 3OTCA 2RF2A 4JUZA 2IDOA 2VODA 2IMWP 2QLFB 4ID5B 2Q1LA 3PW5A 3KLIA 3FC9A 3UCZP 3EZWA 3TABA 2DR9A 2CUYA 4NLQA 5IOLA 1IQTA 3OHBA 2V2VA 1N34J 3PXGa 2LA4A 2PIIA 3OYIA 3KK2B 5BR8J 1KAZA 4ISEA 2DHAA 2KT3A 1S0NA 1RWPB 4YOVA 4CH1A 5L1LA 1VSIA 4A48A 3M30B 5HRPA 3WNGA 3T1AA 3MXHP 4BRHA 3ZLJA 4LBIA 3HHLD 2LU1A 1FRHA 2BVZA 3DLGA 5C25A 3A1YG 2WOMB 3IWXA 4JB8B 4E1NA 1BQMA 3NNAA 4K2JA 4QPXA 3B78A 3TNVA 1S9GA 5D77A 1S1VA 2CNLB 3PW2A 5J1EA 4E7JA 1DQ9A 2R7QA 4B8CA 3G4SS 1M0SA 3V6DA 5FJ4A 2FLNA 3ZNJ1 1Q5VA 2FZCB 1P9YA 4H4MA 2AP1A 4BS2A 3POTB 4KAIA 2QE5A 3W8PA 3TR5A 3AVCA 2DFFA 5DK5A 3ETMA 4DSJA 2G8KA 1X4GA 8ATCB 1Q81O 4I2QB 3VPZA 3VGTA 3QZ7A 1J5EF 5KFDA 1WHXA 4KJIA 1UAWA 4K4YA 1QTNB 2VJVA 1YVFA 1QJHA 3W5XA 1OY9A 4IH7A 1Q95G 2HF4A 2HHSA 3VEZA 4CGIA 2IYIA 3PJ9A 4F04B 3M8QB 5C25B 1HBMB 2VOOA 1UVKA 1IBKJ 1T9XA 1C1AA 3WXKA 4M3YA 1OH7A 2QGFB 4A8MP 1RBRA 4FXWA 4HCCA 1KC8O 2WVDA 2QRRA 5J1EB 2IRYA 4ZOSA 3NY0A 2AJ1A 2F9DA 1X0PA 2MZQA 3K5PA 4DV2F 1HARA 4QR0A 2CFXA 2X3GA 4PKDB 3QO9A 4QBUA 3CDAA 4HHJA 1WD6A 2OMLA 1WSFA 1Z26A 4Y1CA 5CD4A 1K1QA 1N4LA 4FVCA 3O08A 3CCZA 1Z25A 4ID8A 3CDUA 2OUGA 3ZSYA 2RQKA 5A8WB 3CC4S 4FM1A 4BDYA 3QEPA 4OQJA 3NVMA 2FSKA 1YF5L 5I3UA 4DR6F 3G6ES 2KU7A 4CYUB 3CCVS 4W90B 5LM7E 5KFLA 4FOEA 4O44B 3SFUA 1K9MT 5KG5A 4OV1A 4ANEA 1X7VA 5KGWA 5CZ1A 3N5BA 4PA1A 3HVTA 5JMNA 3W61A 4QIWD 5DDOC 2E5LF 2KFYA 2UUCK 3GWCA 4RR5A 1TL7B 2KG1A 3KLVA 1HNWK 1NGJA 3OTDA 1T9WA 4K5SA 2BJEA 4GV9A 3N6LA 2XI3A 3EEQA 4ECYA 1E6YB 3OYMA 1H2TZ 1VSMA 2OPPA 2O8BA 3BKFA 1JKHB 1FNXH 1KEKA 5CH7B 4FPIA 5GINA 2IC3B 1QSSA 4J9NA 1HYZA 4CLLA 4CWBA 1RT1A 4UW2A 3BGUA 2XM3A 3CC7S 1VQPN 4FF2A 1GOCA 4O44A 2JX2A 3E1YA 2E88A 4J9PA 1CXUA 3KHHA 5F1XA 3KLFB 4CO2A 1NB7A 4Y65A 1H2VZ 5ETTA 2WTUA 1CQNA 3ENVA 1IKXB 2DNQA 4FW1A 4JI7J 1AFJA 2XSJA 5K5MA 4HTLA 5CCMA 3OBWA 1W97L 5LXRA 1IM4A 3CXCM 1XNQJ 3V6HA 3NWRA 4BBYA 1SIWB 3J7YP 4WPAA 3EGZA 4LR7A 3WQUA 3EL2A 1NJIT 5DG9A 3N9UC 1R8CA 5GAGU 2DH7A 4B9NA 4P7VA 3NGRA 2CPXA 1RFQA 4BY9C 4DUZK 3UWTA 3L2QA 4DL7A 3K5LA 3L95X 3GJQB 3KHRA 4WP3A 1ZBUA 3N6NA 1JLAA 5A8KB 3IM9A 3OS0A 2ZH7A 3O80A 1H1VA 2KT5A 1VQ9N 2ZKUA 1P8GA 4RU2A 2DIUA 1NM2A 2EKYA 3HO1A 1UAXA 5C0YA 1PJ6A 3DGPA 1EQ0A 3KXDA 4M63A 2B9YA 4MTPA 4ES2A 2VKRA 3THWA 2MQMA 4B17A 4O5FA 1GLFO 3CCMS 4H03B 2QSWA 1PAEX 5AE3A 3QPIA 4LIWA 4UUWA 3KOAA 4KAZA 2Z4PA 3BUZB 5C42A 3D6HB 2D69A 2IVFB 4IJNA 4JI4K 4CK3A 4PG4A 4MK9A 2ZBCA 2WSEC 2F4VJ 1UPMB 2DISA 4C8LA 1S72N 2KLAA 2UUBJ 3OTEA 3OL6A 1U2VB 3T5JA 1WHYA 2ACMA 3CXCR 2G1HA 1P27B 2BW7A 4JK7A 4ID1A 3VGKA 5DM7L 4KI4A 3HULA 5F3TA 1TYQB 5EXWA 4YDXA 4OMFG 4H0PA 3TEHB 2F7VA 5ETRA 4I4BA 3W9JA 4O3SA 4HL9A 3J7ZO 1GXLA 3QJJA 2GQ2A 2YY3A 3H40A 1REGX 2CADA 1BWEA 4ZVPB 5DLFA 3H1VX 1PBUA 1ZM9A 4H5WA 3J81Y 4ECQA 1GH8A 4I2QA 1MMLA 1RLDA 2XHCA 4KQZA 3TJAA 3F41A 4KHYA 2OAUA 2CJAA 2YKQA 3JAMU 4JI1K 4G3IA 4DR7J 3EY1A 4C23A 1VR6A 3M05A 3MMCB 3G25A 4BRMA 4URGA 4DTSA 2F9TA 2ZNZA 1LWEB 2UXDF 4TNOA 1WI6A 2NRHA 1HWUA 1B64A 5JXSA 5LMUK 2BKOA 4HACB 2IGIA 2X1AA 3VQEA 3BS9A 1KVKA 1GLJO 4NYZA 4DTJA 2ZKTA 1RAHB 4CHPA 3ULHA 1NDKA 3AQPA 3R5CA 4KRWA 2ATLA 3WXIA 1Q9XA 1VC6A 5SZTA 2RE1A 1K6YA 2DNLA 2DGWA 3PX4A 4ELVA 1OYEA 4RW7A 1S1UB 1YJ9S 3WIUA 1WSVA 5IT9O 4CTAA 4CZLA 4C1NI 3JTOA 4BE1A 1DTQB 4FJXA 1XEZA 1JL1A 1VQ8N 1BQNB 2W7PA 5C5JA 2EBEA 3FEXB 1NKBA 2CPJA 2YTCA 5FLXU 5T41A 3QT7A 1V3ZA 2BM0A 3M2RB 4QOZB 1RACB 3HOSA 3C15A 3L3VA 1K73O 3AVGA 1TVRB 2IJNA 3WDOA 4GKKJ 4LF7K 3QERA 1NCLA 5B08A 1C1CA 2DGTA 3K7RA 1E3MA 1KTQA 1NLVA 4CZEA 5AQLA 2FVCA 2YKOA 2RUGA 2JEFA 2XWXA 1WEXA 1QAIA 3ZZTA 2CG4A 4IFYA 4N56A 2MTLA 3OSNA 4L3KA 2MLXA 2HNYB 4FJ9A 2DRDA 5DZ7A 4XPCA 3P5BP 4P71A 2E1YA 4DI6A 4ZVRB 5HROA 4R25A 4USJC 3T5KA 3P5JA 2W9CA 1VQ6N 4X62F 3DRRA 2J76E 3FFIB 4NLYA 4MK8A 1T9UA 2HLUA 2ZOMA 3SAGA 4RUHA 3B4DA 4Y00A 4W98A 1LQ9A 1VHXA 1NSKL 2ACYA 2GNKA 1KD1T 1NGBA 2M70A 1NXIA 3BPDA 3NCRA 3W2VB 3QMQA 1S12A 2C3UA 4YEAA 4LFAJ 3OYKA 1JMTA 4RZRA 4B3RJ 4YOEA 1VQMS 1YRXA 1AUSL 3QBCA 4ECTA 3ALYA 3I8DA 3CCMN 3CIZA 2OPSA 2YHBA 1U7LA 4KH4A 5K14A 3W60A 4L3QA 3CPWR 2HHHJ 1HNZF 1RU2A 3RR7A 4I9QA 4MO4A 4LF2A 4A8OA 3SBMA 3M6WA 4YB7A 3DMJA 1WELA 2CPFA 2KHOA 1N36K 2QA1A 4QU6A 1QAYA 2N3LA 2WB4A 1K1SA 5C10A 5GIOA 3DRRB 3H59A 4CZHA 2VOPA 2CQDA 4TY9A 2F7TA 2KFNA 2O4GA 4HT7A 2R8KA 3CWJA 3KFWX 4D3GA 3OLBA 1PG5B 3DFEA 1CZ9A 5JMVA 3AVFA 1KVIA 3R5JB 3O9TA 3BSOA 2NXUA 2HQCA 4J9MA 4PQUB 2A1BA 2AQ4A 2HMPA 2YWWA 2HW3A 4J2DA 4CF0A 1I6JA 3E51A 1VSFA 4DF8A 3OVBA 3H5XA 2DNPA 2UXBF 4MDBA 4U67L 3Q8VA 3NF7A 2BRKA 1FVSA 1EETA 1TGOA 2FGOA 2EX3A 3NBPB 1NAQA 2JDJA 1OPZA 1LNQA 2PMHA 5KG4A 2J0SD 2HPUA 4EP5A 4I6MB 2E5LK 3S9HA 2XS5A 3SEOA 4IZ9A 2P9LB 4ED5A 1HL6A 2OPQB 5HQLA 3AJDA 2D1CA 2MSSA 4LFCK 4ELUA 3BQ2A 3CERA 2PY5A 2JJ4D 4J9LA 3O8MA 3I0SB 3KLHA 5AXKA 2C2DA 2VBWA 3CCEN 2E8AA 2R2RA 3I0RB 4RNOA 2WTFA 5A0YA 3NMRA 3O6WA 4ED0A 2NRTA 5J2PA 4DV1K 3EDRB 2B4JA 4P6QA 1FD8A 4PEOA 2OZSA 1DAXA 3GR1A 1Y9OA 4DTRA 2WC9A 4H5TA 4DCHA 3BH7B 3RBEA 3N28A 2HAIA 4AQYF 5MAOA 3SFGA 4BHQA 2O8DA 2BANA 2C3OA 4CI0B 2W4CA 3TP2A 1JLEA 1NKCA 1VQ9S 4OX9J 1C2PA 3WHIA 2WVEA 3TQ1A 3EGVA 5ETVA 1KN6A 4UOHA 1RWMB 2D4WA 3G10A 1HFEL 1V4TA 3N79A 4EUVA 4IOXA 2E29A 4F36A 4PG7A 4PWUA 1YJUA 2ZGYA 1DLOB 4QS7A 3BO2A 5ETQA 3A5LC 1BU6O 1CLQA 5DO2A 2R7RA 3A8YA 2GV1A 4MYTA 1NZAA 1IKYA 3D28A 1ATRA 1H0HB 3U1LA 4PWDA 3OY9A 2LXFA 2ZC4A 2ZBQA 2ZH5A 3CJ9A 3CCUN 5A0YB 1W2BM 3HSJA 5LJ3Y 3TAQA 3M6GA 5LMNJ 5HL7L 3OA9A 2VQEJ 4CHZA 4C3MA 1T05B 4DHYA 2DO4A 4YDUA 1FK9B 1SI9A 4RW8A 5ETLA 1OYDA 4C9DA 2O1PA 1X5SA 3QB0A 5CCLA 5BYQA 2D5RA 2Y8WA 2H51B 2HSTA 3CJAA 3S3NA 3H98A 2CPHA 4E7HA 3RSEB 2I38A 1BQNA 1XK8A 3CB4A 4DR6K 1VBZA 2D3UA 5LOQA 1D9AA 5KQDA 1RCXB 3R7SB 4LSNA 3MM6B 5D3GB 4V19X 2PC6A 2UVRA 3VTHA 2HBYB 1ASVA 2FVSA 4UZBA 3HT0A 2NLWA 4OZ2A 2BE7D 1I5OB 4RPFA 2ZHBA 3VENA 3TAGA 1C1CB 4FPBA 4RBVA 1C0UB 5K8OA 4ILRA 1JWWA 1T95A 1BQMB 4TXSA 1QS4A 2YX6A 2CZ4A 3CJ3A 2FD2A 1LV5A 5D0GA 3IFRA 4BC2A 3JXOA 3H3NO 4Z37A 1HWIA 3I55N 1G7CB 1S1WB 3D2EA 4NCGB 2VQFJ 4CHQA 2FJVA 3T9NA 2VB6A 2Y1JA 1UCNA 2E1ZA 4NLDA 4GO7X 5ITHA 5B7WA 2GO8A 3FRZA 4FCYA 5E5NA 3VQ5A 2ZH3A 1NMDA 2RU3A 2D1KA 3DLKB 2ZH8A 1ZH5A 3DC2A 3EICA 2Y9HA 3UCUP 3C7NB 4LF9K 2F9JA 3NKYA 5HVHA 3F0NA 2B5JB 5HK4A 3RB4A 3GOIA 3LL3A 1RTDA 5IQ6A 4WCEL 2A5XA 3LUYA 3UIQA 4DL3A 1WWHA 1Q53A 2Y3YA 5ETNA 3VGSA 1BL3A 3NGTA 3LF0A 4CM2A 3QIPB 4QR1A 4Z2XA 3HOTA 2GW8A 3CEDA 4C8ZA 3PV8A 4U6PA 1LAWA 3GJSB 3G2XA 4HTIA 1KONA 1RKIA 4FOIA 2C3MA 2QX0A 2CJYB 3T1HK 1BE4A 5HQMA 3ADAC 1IWGA 4BC4A 1O6XA 3C66A 1B0VA 3WC0A 4J9SA 2OPSB 1CJTA 4ZN1A 2HAFA 5L1IA 5CYQA 1LWCA 1F9HA 3CJQA 3OR1A 3H4DA 3OYEA 3S3MA 4QAGA 3AOAA 4DDFA 3R9LA 3HPOA 1IKVB 1HI8A 4P2MA 1WSIA 3FLCO 4CGJA 1SL1A 2QL7B 4JI3F 4FJMA 3ZZUA 1TK5A 2OZMA 4L6V3 5D78A 4CERA 4CD3A 5H1SV 4CJUA 2DXFA 3PLAA 3KNGA 3PEJA 3EE8A 4URQU 4DTOA 3EZOA 2GMJA 4F0MA 1WHWA 1RT5A 5I3UB 3D0IE 4X2BA 2QWMA 5AXNA 1BISA 4PXEA 4PQUA 1DZ5A 1QVGR 2LKZA 3RAQA 4EYHB 3TX8A 2XHWA 4DKWA 2YPYA 1PYSB 2C2EA 2JLGA 4A57A 5KFUA 2YX7A 2EW9A 3QNOA 4KH6A 4M95A 1NK0A 3TOQA 1TKZA 1TELA 2IFXA 3MOZA 2BGGA 4N76A 2Q6BA 3TVKA 1GLDG 3NEKA 2C28A 4B3RK 1UJ4A 5GIPA 1T9VA 5DG7A 3E9LA 3OR1B 3QGPA 3CW2C 1RT7B 2XS2A 5MLCV 3PW0A 2QA2A 1VSEA 3SJJA 5KPRA 2HG4A 2VFUA 2F3JA 2Q97A 3B54A 2KT2A 2KYZA 4CLTA 1R8AA 4XH1A 3SNNA 3I0RA 5HI7A 5AQJA 3MEDA 1OWXA 3OYGA 4OHVA 4BG9A 4DFJA 2ZH2A 2Q3PA 3J7AP 4DU8A 4FK0A 6AT1B 3PYFA 1FXRA 4PPDA 2AP6A 4DV6J 3AH6A 2ZH4A 1ZM2A 3KKSA 3AY0A 1M1KO 3B8AX 1LXJA 4LFAK 1ICEB 1Q8KA 5KG2A 3LM2A 4JI8F 4KTZA 2CQIA 2KW4A 1EHWA 4H8KA 1S7HA 4P72A 5K8NA 4AH9A 3OYCA 2L9DA 3BO3A 4FNIA 3KD5E 1F2HA 2W42A 4MT1A 2OPRB 2KHCA 2OSRA 2MXYA 3B6OA 1N6QB 4J90A 1VJWA 1F6TA 5E41A 4CJ4A 1NGAA 1SJ4P 1EJ7L 4MIWA 3AOCA 1U8WA 3GL1A 3C65A 4BG8A 3IGNA 4TYAA 5KFEA 3G9CA 1NK6A 5KFXA 4URSA 5KFFA 4PKGA 2LECA 4ZA1A 3I5BA 4N8OA 3J80U 3HSCA 1MN7A 3BF3A 1NU4A 3UVJB 5M2PA 3MR3A 4WZMA 3TUPA 5M1NA 5ETMA 2NRZA 2XB2D 1JXBA 5IFMA 4CF8A 3KZBA 3M2UA 1F21A 4Z4FA 2Z56B 5CE3A 4LC9B 4NEZA 4O55A 2YHAA