3IG1A

Hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
molecule keywords HIV-1 Reverse Transcriptase p66 subunit
total genus 132
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ig1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ig1A05
4O44A 5DG9A 2BQ3A 5FROA 3RBEA 4H4MA 1T05B 2VA2A 2KFNA 4MK8A 4CF2A 3VQ5A 3T5HA 5K14B 3BQ0A 5KT6A 3VA3A 5KFBA 1WNSA 2IAJB 1EX4A 2YNIB 3DRSA 3EPGA 4DL4A 3LZIA 2ZE2A 3PX0A 4F2SA 2IGIA 1RTDA 3CM5A 3H5UA 4ECZA 5KT7A 3EYZA 3DRSB 1ZYQA 5J2NB 3K58A 1IKWA 4HVJA 3Q8PB 3O4QA 3AVJA 2Y1IA 4YMEA 4RW4B 3Q8RB 4AH9A 2D0CA 3T19A 4CJTA 2F8TA 3S9HA 1N6QA 4B9LA 4TY8A 3BSOA 1SH2A 2W9AA 4W5OA 5KG0A 3U3YA 3G10A 3TABA 4R5PB 3G6VA 1HMVA 4IOBA 1S48A 1LW0B 4TYBA 1HARA 3FQLA 3H08A 3LP3A 1NKCA 4ECUA 2WOMB 1YTUA 3N6MA 4IG3B 4E7LA 1TKXA 1J5OB 3V9UA 5I3UA 5EDWA 2G8FA 5KFWA 3H98A 2DY4A 4CEDA 2X74A 4M95A 4QCLA 2RPIA 3DMJA 4XPEA 5HLFA 2R8IA 2ATQA 4CHYA 3LWLA 3F73A 4Z4HA 1SL0A 3OL8A 2CJQA 4DLEA 2XC9A 3KKRA 3ZSYA 3K59A 3C95A 1C0UA 1JLCB 4FJ7A 4DTUA 2D3ZA 2IJFA 4HUEA 1N48A 4DL5A 1HQEA 2B43A 3PO5A 1RBTA 3BGRB 4TQSA 3DLRA 1C0MA 3BQ2A 4CGHA 2ASDA 4KB1A 1D0EA 3BGRA 2FC0A 4CEZA 1WSGA 3QEPA 3NBPA 3MECA 3RMCA 4O44B 3VQ9A 2D5RA 3AO5A 3VQCA 1NK5A 3KLFB 2LSNA 2VG6A 4AHVA 3T5JA 3I0SA 3MR3A 5DQIA 3SUPA 2FBTA 3BREA 3RRGA 2AWZA 1ZBLA 2IJNA 1NOZA 3NL0A 3OYMA 2QKKA 4B9TA 4BDPA 3N6LA 3GIKA 2ASJA 2IM1A 5C42A 2WHOA 2R8HA 4X2BA 1QS4A 1ZETA 4DTPA 4CJ4A 4RW7A 3DLEB 4JLHA 5KFJA 1FXXA 4Q0BB 4J2DA 1KRPA 1KVAA 2P51A 4EBEA 3ICLA 4Z4EA 3QIPA 1U04A 3DRPA 1S9EB 3VN5A 4FM0A 2BQUA 1RTHA 1VSMA 3I5AA 4RW6B 4DQSA 1TV6A 5KFVA 3CFPA 1FKPB 3KK3B 2YKNA 1X9SA 2OPPA 4CF8A 1A5VA 1VSFA 5DK5A 1S9GB 1Z25A 2X6SA 4RW6A 3HP6A 1RTDB 3KHRA 5FDLB 4CGFA 4E89A 5CY4A 3VQ7A 4FXDA 2FVQA 2FVCA 1A5XA 4WYLA 1Q9YA 4J9NA 4ED8A 3OS2A 4RG8A 5FRMA 3DOKB 4WE1A 3GYNA 4O4GA 3CJ5A 4K4VA 2IA6A 3M9MB 2ETJA 4IH5A 4RUCA 3OHBA 4FLTA 4C8KA 5F9NA 3KMQA 1IKVB 2I5JA 4ID5B 3AO1A 3TQ1A 1GOCA 5F8MA 2J6SA 2W9CB 1KVCA 4Z4IA 3PVXA 3KOAA 4KKOA 3WNFA 4E7JA 2W9BA 3PW5A 1ZBFA 4HYKA 2IDOA 3PJWA 4KHQA 1FKPA 1XHZA 4K4ZA 1TVRA 1NKEA 3SUNA 4W5NA 1LWFA 4B9VA 4KTWA 3TAMA 3NE6A 1HYSA 4YNQA 3VQ8A 3OL6A 2WTFA 3HVRA 4KTZA 1NK9A 3AA2A 2AU0A 3OSNA 1TL3A 4Y2CA 4CK1A 2HVIA 1S1WA 2HHVA 4F8RA 4MIAA 4JRPA 2DFFA 1IM4A 3KK2B 3K5MA 2B4JA 1S1TA 3SFGA 4H4MB 2F8EX 1SUQB 4H54A 5KFUA 1I6JA 1IKYB 4DQIA 2E4LA 5F9LA 3CFOA 3KLIB 3KHHA 4NYZA 4URSA 2FLNA 3S3MA 5F8JA 4NRUA 4M3XA 4FJGA 3QO9B 1HYZA 2V4QA 4M45A 3IS9B 2G8HA 3NF7A 1NK0A 5F8NA 3VQEA 5F8HA 4F4ZA 4Y3CA 1EXQA 3QNNA 5KT3A 2UUTA 3DLKB 4PWDB 1HNVB 3BQ1A 1HPZA 3AVIA 5K14A 2XCPA 1HQEB 4JS5A 1C2PA 4F3OA 3KLEA 3GIIA 3NH0A 4DTMA 1UAXA 3D45A 1RT6B 3O3FA 1WNEA 3HPGA 3MEGA 2HHUA 4LH5A 3RB4A 3DRRA 3QERA 2AGPA 5HBMB 4EO6A 1C0UB 1JLCA 3NDKA 3CVKA 3MTKA 1WSFA 3IS9A 3OYJA 1KLMB 5DGBA 1RTIA 2B6AA 1EETA 4NLGA 3ZT1A 4OGCA 3OY9A 5EWEA 2JEIA 1CXUA 3JSMB 1SKWA 4CJEA 4CJKA 1DTTA 2RF2A 1U09A 4KO0A 3GIJA 1QSLA 1NJZA 2YHAA 2HHSA 4PWDA 5KG2A 4KTQA 4FS2A 4MK9A 3Q8QB 3PO4A 5KFKA 4J9SA 1TP7A 4J9OA 5KFGA 3MR2A 4O4RA 3KLHA 1T8EA 4CHNA 1NK8A 5HLFB 3OYIA 5DQHA 4FZZA 3AVMA 3B6PA 4ED1A 4I2QB 4RU9A 2W7PA 4DU3A 4NLXA 3NGZA 4R8UB 1QE1A 1WAFA 4CF1A 4DLGA 2BGGA 4W5TA 1JKHA 1BQNA 3AVBA 1S9GA 3DLGB 4J2AA 4LQ3A 4IBNA 1HYSB 4B8CA 3PW4A 2DPIA 1RBUA 3PW7A 4B9NA 1QSYA 1C0TA 4NZ0A 1VSIA 3RB0A 2XO7A 4I7FA 1SUQA 2EHGA 4FJMA 1KCFA 4KREA 3G0ZA 3ISND 4FJ5A 1FKOA 1QAJA 1IKXB 2D3UA 4ZVHA 4XIUA 4ED2A 1LAWA 4KHMA 3UDLA 1HNIA 1S49A 1B92A 1S9FA 1K1SA 5T7BA 1QUVA 4ED0A 3PZPA 3KK3A 3V9WA 5I42B 3CDWA 4RNOA 3RR8A 2W42A 1WSIA 5SWMA 2UVUA 4LH4A 5L1LA 4OKEA 4DTSA 1RT4A 1XI1A 4C8OA 2OPQA 4E0DA 1FK9B 4ECVA 1TQLA 3AV9A 3HYFA 3DLHA 1VSEA 3OYNA 5KGWA 1T03A 3DLGA 4ZP8A 2BE2B 4CGGA 3P83D 2ATLA 4R0EA 4CJUA 3QETA 4LSLB 3KJVB 1MMLA 4LY7A 1RT1B 5HRPA 4RW4A 3AVAA 3MXIA 2CKWA 3QIPB 3QGIA 3OYGA 5HROA 2ZQBA 1RTHB 3UIQA 1NJWA 2Y1JA 2KW4A 4Y1CA 3RMDA 2HNDB 2HHTA 4BE0A 1VRUA 4G3IA 2GV9A 3T3FA 2ILYA 1NOYA 2OPRA 2HNYB 3LAKA 4CFBA 1DTQB 4GC7A 3V1OA 3NHGA 3E01B 3CJ3A 1JXEA 4IQXA 3L2RA 4ECXA 4Z4GA 3O3HA 2I5JB 4WFZA 3K5OA 4FLVA 1Q9XA 2JC0A 5DG7A 4IKFA 4HUFA 3LP0B 3K2PA 4KHRA 4DU1A 1CZ9A 2J6TA 2D7SA 5SZTA 2R2UA 3ZSWA 2OPQB 4Q45A 3VA0A 4AHUA 2GIRA 4Q8FA 4CGJA 4FJ9A 1RDRA 3M8PB 3I0RB 1YVFA 1HYVA 2ZE2B 1NK7A 5D3GB 4IH6A 5KFSA 4KPYA 3RRHA 1CLQA 5J1EB 3HO1A 3KJVA 4FJIA 4FLYA 4CEQA 1SKRA 4CJQA 4JV2A 4RZRA 4OLBA 2E9RX 2JGUA 5CYMA 4O3NA 1NKBA 2O5DA 4IFYB 1IO2A 4FZYA 4IR1A 4B9MA 5KFAA 1HPZB 4CGIA 1LW2A 4MIBA 2XWYA 4ECTA 3AO2A 4N56A 1HMVB 1JLGB 3M8QB 4CEOA 3V6JA 3MXJA 4CJLA 3CDUA 3C6UB 4FJKA 1KFDA 2UVWA 5T14A 3U6FA 4I2PB 4KRFA 5KG3A 4OPJA 2IC3A 1NJYA 5HP1A 4ZVFA 4J2EA 4MK7A 4ZPBA 1LWEB 4ECQA 4ZVEA 1TAQA 2UVVA 2ZD1B 2D0AA 2YV0X 1RCHA 1N5YA 3LP2A 1XR5A 4CECA 4F2RA 1RT3B 2BANA 3ZSOA 1LW0A 1EP4B 1S1WB 4IFVB 3VQ6A 1RT4B 3TAFA 3OL9A 1WSJA 3VQPA 4RNHA 2C22A 3GV8B 4CHOA 2XY6A 2IM0A 1YT3A 4RNNA 2OA8A 4EO8A 4O5BA 3ZCMA 5KFIA 4FK4A 1TKXB 1K6YA 4EZ9A 3OYAA 4L8RB 2ZKUA 4OL8A 1BISA 2HHXA 3LALA 3SFUA 3S3OA 2IBKA 1FK9A 1BHLA 1U47A 3OYEA 3MXMA 4TQRA 2IOCA 3SQ4A 4DS4A 4N41A 1YTAA 4CJVA 1RT7B 3QGHA 3WNGA 1L5UA 4R5PA 4CJWA 1JXBA 4K4WA 4IKAA 5EWFA 4URQU 3O3GA 4YQWA 4WE1B 2PY5A 3H2LA 5J2QA 4IG0B 4G1QB 1D1UA 3PX6A 5C42B 1NHVA 4NLRA 1S4FA 3OJSA 5KFNA 4R8UA 3LAMA 4FVMA 4N47A 3KLFA 1RYRA 4DS5A 3NF9A 5KT4A 4BWJA 3KK1A 4MH8A 3L3UA 1S6PA 2BRKA 2DFEA 3GIMA 3K5LA 3NGIA 2PYJA 4MKBA 3QEIA 1DTTB 2RF2B 4CHPA 3H40A 4CHZA 4NYNA 5C5JA 1EP4A 4CCHA 2O4IA 3VQBA 3TR8A 4DSKA 4PQUA 5KG7A 3RBDA 3PX4A 3NGYA 3EZUA 4O3RA 1REVA 3FDSA 5KFLA 1RDBA 5JUMA 3JSMA 2E9ZA 5KFTA 1VSJA 3FQKA 4EP5A 4FBTA 2OYQA 2W7OA 5JS2A 2QK9A 1VSHA 4N76A 2DPJA 1ZTTA 3C6UA 2QE5A 1U4BA 1IKVA 4CIEA 5DG8A 3MAQA 1GX6A 4CERA 3PUFA 3HXMA 2EX3A 1WAJA 4CJ3A 5F8LA 3OL7A 4RW8B 3DM2B 3JYTB 1Z26A 4EEYA 4E1NA 4DSEA 5J2PB 1WLJA 4DQRA 4IDKB 3HHKA 3NGDA 1HNIB 5DMRA 1C1CA 1S5JA 1S1VA 4PQUB 3OLAA 1BI4B 4QAGA 4DF4A 4JS4A 3V6DA 3NKYA 1BIUA 4CFDA 1RTJA 1KHVA 3THVA 4PUOB 3TI0A 1QQCA 4FW2A 2P1JA 3BSAA 4DFPA 3OYCA 2VG6B 1VRTA 2RKIA 1Y97A 2J6UA 3TAMB 4FJJA 2KFZA 3CJ4A 3Q8SB 4ZPCA 3CQ8A 4H4OB 4DSIA 4ED6A 4WFYA 1X9MA 1I3AA 4RNMA 3MEEA 4MFBA 4RNFA 4TY8B 4F4WA 3NCIA 2FBYA 3U3GA 4ZTFA 3L2QA 4FLZA 4OGEA 2X6NA 1JLQA 3KMSA 3GQCA 3IRXB 4C8LA 3AVHA 4CEAA 5KFHA 3OSPA 2ZD1A 3DOLA 4DG1B 3AA4A 1CZBA 4YP3A 4KI4A 2HHWA 1RBSA 4E7KA 4DSFA 2VWJA 1BL3A 3KTQA 2B5JB 5KFMA 4M3ZA 1W0HA 3OHAA 4J9RA 1JLBA 2FBVA 5KI6A 4O4GB 4CK3A 4U7CA 1JIHA 5KT5A 4ECWA 3ASMA 1KLNA 1S1TB 2Q3SA 3KD1E 1UA0A 3HP9A 4FK0A 4KKOB 3ZSZA 4CJPA 4EBCA 2OPPB 4QWCA 1W25A 2Z1HA 3V6HA 1RT5A 3HPHA 3IGVA 4QWDA 2D0BA 1N6QB 4ZMMA 3IAYA 4IG0A 4NLUA 2RKIB 1TAUA 3OS0A 4ED7A 5HP1B 4C8NA 3HJFA 5CZ2A 4Y34A 5C24B 2I1RA 3IN5A 3E01A 3MEEB 4MFBB 5KFYA 1T94A 2AX1A 3CIZA 4TSXA 3ISNC 2XGPA 1RTJB 3L3VA 2HNYA 3HKWA 3TWHA 4M3WA 5L9XA 4KFBB 1JLAA 1UOCA 4ID1A 1TK5A 3SUOA 4ID5A 1HQUA 4WXWA 1EETB 2PYLA 2UVRA 4IFYA 2IC3B 1BQNB 3SCXA 3HL8A 2FVPA 3S3NA 3NAHA 4FJXA 5I3UB 4N5SA 5D3GA 4FM2A 2W8KA 2VG5B 3G6YA 4M3YA 1JLFA 3F9KA 4ZPDA 2Z1GA 4AHSA 3DI6A 2O4GA 4TLRA 5KFPA 4JV0A 4M3TA 2AX0A 3MECB 2R8JA 2Z1JA 4UQGA 3QEWA 1JLFB 1S10A 3PJXA 4FLUA 4KHNA 3OYDA 4NLVA 2YNFA 3C6TA 1EKEA 4QWAA 4OVLA 4KHSA 1NNDA 2GC8A 1S0NA 4I9QA 5HRNA 4XPCA 4Y2AA 1TGOA 2XGQA 4I2QA 3NFAA 3MFHA 4GC6A 3N6NA 4FJLA 3KK1B 1LW2B 5FRNA 2KTQA 3I0RA 3C94A 3HK2A 1I39A 4CEFA 2W9BB 1F21A 1TKTB 3QYYA 4FK2A 4WYWA 3V9XA 2OPSB 3WNHA 1SKSA 2BDPA 4ELVA 2BRLA 3ZSQA 5HRSA 4M3RA 3UQSA 2BR0A 3IG1A 1B9DA 2AGOA 5KRTA 4LSLA 2FVSA 2X78A 1TL3B 4ICLA 1RBRA 3KHLA 3SQ0A 2YNGB 3GV5B 1JXLA 3L2WA 1VSDA 3V6KA 4HKQA 3TAPA 4H8KA 1XR6A 3OYFA 2E6MA 2R2RA 1B9FA 3V81A 5CYQA 1J53A 3CJ2A 3H4BA 2FJWA 4HCCA 1LV5A 2XRIA 3NF6A 3V1RA 3QGGA 5HRRA 4O0IA 4J2BA 3AA3A 1S6QB 2FJVA 4B9UA 3DYAA 4TYAA 3AO3A 2YNFB 3PHEA 5JXSA 1BIZA 4CFCA 4G1QA 4Z4FA 4DFMA 1KSPA 3ZT2A 3V81B 5DLFA 2B5JA 4ZP9A 3LPUA 4ZPAA 3NF8A 4KB7A 3ULDA 1WSHA 2NUBA 3RMBA 3G86A 4OKJA 4JUZA 4E3SA 3KKSA 3H5SA 1LWFB 5HROB 4YR0A 2YNGA 4B8AB 4KO0B 4CIFA 1QTMA 4ICLB 1ITGA 1YVUA 4OJRA 3RMAA 3PW2A 2PZSA 3I8DA 2HAIA 2OH2A 1S97A 1D5AA 3K57A 1KVBA 2ILZA 4DTNA 4O3SA 3HPOA 2HWIA 1BCOA 3KK2A 3FSIA 2YNHB 4KV8A 2KQ2A 4KI6A 4O3OA 3G6XA 3I0SB 2HMIA 1TL1B 2JEJA 3DM2A 4F4YA 3AA5X 4IRCA 3H59A 4E7HA 2JEGA 4QOZB 3I5CA 2GUIA 3GILA 4FM1A 4ED3A 4DL3A 1NJXA 5KG6A 1BQMA 3MF5A 1RT2B 1C1BB 4DQPA 4DG1A 2YNIA 4O0JA 1NK4A 4ZP7A 5J2MB 1RILA 3V9ZA 4ZVGA 1T7PA 1RT1A 4K4XA 5EU7A 1Z4UA 4PUOA 5F8GA 2W9CA 1RT6A 3T5LA 3TAQA 5J2NA 3RR7A 3P1GA 4PA1A 1T03B 1N4LA 5L1IA 5L1JA 3H5YA 4OKKA 2HB5A 1T05A 4J9MA 4FYDA 4AILC 5KFDA 5DQGA 4XO0A 4Q43A 1QSSA 1S6PB 1KLMA 3KNAA 2G8KA 3PR4A 1U49A 4JV1A 5EWGA 1L3TA 3D5MA 4DMNA 4HTUA 2WRMA 4ECYA 1D8YA 4J9PA 3EZ5A 4DL6A 3QZ7A 3NAIA 4M94A 4K4YA 3V1QA 2EC0A 5FDLA 3WNEA 3OS1A 3M8RA 4BDYA 2RDIA 4FBUA 3V4IB 2BE2A 1TL1A 4EYHB 1O1WA 5KT2A 4K8XA 3CDEA 2WOMA 2E6LA 2RN2A 1RAJA 3PW0A 1S0MA 3KLEB 4KFBA 4ECSA 4FS1A 3H5XA 5CZ1A 4DTXA 2DTUA 3RWUA 1TV6B 1K1QA 1J9AA 3RAXA 4DSLA 3HSTB 1LWCA 3T1AA 4KSEB 4K4UA 3AVCA 4E19A 3BR9A 3M8QA 5C24A 3FFIA 4EZ6A 2OPRB 4CK2A 1UWBB 4IFVA 4ELTA 1LWCB 3NMAA 4F4XA 4ZHRA 3KD5E 2FBXA 1RNHA 2G8IA 1SL2A 2YKMA 2QXFA 1SV5B 3DLEA 5E41A 1CSJA 1RBVA 2QKBA 4MQ3A 2ITGA 3LP2B 4TN2A 4AHCA 2HWHA 3SI8A 3T5KA 3IGNA 1TKDA 4DTJA 4J9LA 1S9EA 1ASVA 1RT7A 4I2PA 3SV4A 5DLGA 4CJSA 2XHBA 4C8MA 4O55A 4FCYA 2R2TA 3OVNA 2GBZA 2C2RA 4DTRA 3IRXA 4DSJA 3EPIA 3L2VA 3FRZA 3ZT4A 2OZSA 1WN7A 1X1PA 1RTIB 5KG5A 4M42A 4FLWA 1TK0A 3SPYA 4B3OB 1UWBA 1A5WA 4BWMA 2XCAA 4LSNB 2FLLA 2KZMA 1GOAA 1JL2A 1HRHA 2AGQA 3PV8A 3ALYA 4F50A 1IKYA 2D41A 1TK8A 2YNHA 4KV8B 1Q8IA 1IH7A 3M8SA 4IRKA 3RTVA 1VSKA 4NLSA 4LSNA 4B9SA 4EBDA 5I42A 4Q5VA 2VG5A 2WB4A 3VQDA 1IG9A 5KFXA 3KHGA 3KLGB 3DYAB 3A2FA 3OYKA 4ZP6A 4IR9A 1JLQB 2R8KA 3JYTA 4OLAA 4J9QA 2XY8A 3AO4A 3H4DA 3E51A 1KTQA 5KGXA 2DFHA 4Z0UA 3HVWA 4K4TA 3L8BA 3LDSA 3VQAA 4Q0BA 5KFCA 4DL2A 1N5YB 2G8VA 4JRQA 1KFSA 1HJRA 2W8LA 5KFEA 4NLPA 4LD0A 2A1SA 4CESA 4DU4A 3BDPA 1ZBUA 2IMWP 4GMJB 3I5BA 1C1CB 4LQ9A 3PY8A 3GV7B 2C2EA 4FJHA 3V6DB 4NYFA 2GIQA 3OYHA 1DTQA 1S1UB 1J5OA 3CJ0A 3FFIB 3KLVA 3SQ2A 2B6AB 3RAQA 1J54A 1D9FA 4QWEA 3BSNA 1XC9A 2HNZB 3LP1B 1R0AB 1C1AA 4CHQA 4BE2A 4WZMA 1DLOB 2QV6A 4FJNA 1NHUA 2F8SA 3KLIA 1QAIA 3BSCA 4Z4CA 3TAGA 1N56A 1JLEA 4AHTA 2HNZA 2A1RA 4NCGA 3LANA 4RW7B 1D9DA 2YKNB 3RB3A 3KIOA 4DFKA 3SJJA 1SL1A 4I9LA 3DLKA 4U6PA 1ZTWA 4KAIA 3L2UA 2G8UA 4YFUA 4CFAA 4KHUA 1SH0A 1RA7A 3LPTA 3TAEA 2OZMA 3MR5A 4W5RA 1MU2B 3HT3A 1RDAA 1S1XB 4HHTA 4BE1A 5J2PA 4NLYA 2FLPA 1WSEA 3P5JA 3DOKA 1VRTB 3MFIA 2XI2A 3QIDA 4CJFA 1DLOA 2HVHA 4EP4A 3QO9A 3D28A 2WONB 1W9HA 2G8WA 1JX4A 3BJYA 2KZZA 3QESA 3LP0A 3DDKA 4F3TA 4RW9B 1RDDA 4NCAA 4CF9A 4DWIA 3C6TB 2WONA 3EY1A 3SYZA 3DOLB 4HUGA 4IG3A 4RW9A 3QEVA 3AVKA 4I7FB 4BACA 1ASWA 4DFJA 5J1EA 3HVTA 2HW3A 1SH3A 1KHWA 3CFRA 1MU2A 3MR6A 4BDZA 3CM6A 3HM9A 3TANA 2RDJA 1L3VA 5J2MA 4YR3A 4KHYA 2WK4A 4EYIB 1ZBHA 1S1UA 3O4NA 4KAZA 4Q8EA 2WCXA 4DL7A 3PR5B 4CE9A 3QNOA 5C25B 1TKZA 2F96A 2XI3A 2FVRA 2VG7A 2UUWA 5F8IA 1IKXA 3HVAA 1VK0A 1XR7A 1T3NA 1TKZB 4KHWA 3SI6A 4CEBA 4K4SA 2HHQA 4GW6A 1HQUB 1VRUB 4NCGB 3ZT3A 5KG1A 1L3UA 3TARA 1JLBB 4DTOA 4O3PA 2YKMB 3SNNA 3NH2A 2VA3A 2VWKA 4M3UA 2IM2A 4DEZA 1RT2A 4QW9A 2R2SA 3CWJA 5KFFA 1ZBIA 3DLBA 2V0NA 4KBIA 4K50A 1C6VA 1RT5B 4ZTJA 4GVMA 3DRRB 3OJUA 3M9NB 3AVGA 4FW1A 2JEFA 3IG1B 2VG7B 1XHXA 4RUAA 3ZT0A 4NCBA 2IM3A 3SZ2A 4IDKA 2ALZA 1QE1B 3OYLA 3LZJA 4H4OA 1TKTA 1LWEA 4ELUA 3KLHB 4F4KA 3AVNA 3QZ8A 4QW8A 3SQ1A 4ZHRB 3RB6A 1OS5A 5HBMA 1BGXT 3TVKA 3UPFA 3CO9A 4M41A 2C28A 4OPKA 3B6OA 4WZQA 2IAJA 3NH1A 3OYBA 3ITHA 5CYMB 4B3OA 3KLGA 2R8GA 3AVFA 1VSLA 4E7IA 4TY9A 3CYMA 3QLHB 5KFOA 4E1MA 4W5QA 2JC1A 1RYSA 4CF0A 4CEEA 5JS1A 2IS3A 1JKHB 3QIOA 1S6QA 2YHBA 3OLBA 3QINA 4MKAA 3QLHA 1JLEB 4NLOA 3ZSXA 1C0TB 4WFXA 1LAVA 3VQSA 1S0OA 4KE5A 1GX5A 3M9OB 4NLWA 1ASUA 4K8ZA 2E9TA 3DI6B 2P5GA 2BQRA 3MEDA 4Y1DA 1GOBA 1XWLA 3M8PA 5KFZA 2Z1IA 4ECRA 4NRTA 4FZXC 1S1XA 1QHTA 1TVRB 4PY5A 4NLDA 4URGA 3ZSVA 2JLEA 3VQQA 5KG4A 5DGAA 2V9WA 5EUHA 4HCBA 4QWBA 2C2DA 3SV3A 1JL1A 3LP1A 1R0AA 3K5NA 4CIGA 4FLXA 2OPSA 4DQQA 1CXQA 3D0PA 3SUQA 3ZSRA 1L3SA 5KTQA 3MEGB 5CYQB 2XY5A 1JLGA 1C1BA 5KFRA 4CGDA 1UA1A 2HNDA 2V4RA 4CJ5A 4J9KA 1X9WA 3DMJB 1RT3A 2BANB 3LWMA 3HVTB 4NLTA 3CG7A 2XY7A 4TXSA 1SV5A 5KRSA 1G15A 3AVLA 1REVB 4DF8A 1S1VB 3NBPB 1RA6A 4Q44A 4YR2A 3UR0A 1U45A 5KFQA 1FKOB 4QPXA 2AQ4A 2R7YA 3SPZA 2FJXA 1BI4A 3NAEA 1JLAB 1IKWB 1BCMA 5L1KA 4NLQA 3V4IA 3ITHB 3QEXA 4O3QA 4KB0A 2AJQA 3V9SA 5C25A 4FJ8A 2P5OA 3MEDB 1U48A 1HNVA 1NK6A 1RDCA 5J2QB 4IH7A 4RW8A 3DRPB 2ASLA 4CJRA 4AHRA 4WXOA 1BQMB 2HMIB 3VQ4A 4IRDA 4B08A
chains in the Genus database with same CATH superfamily
4O44A 4B3RK 1NH8A 3TEGA 3SDEA 4B3TF 3RBEA 5F0WA 3L0QA 2QLBB 3IR7B 2KFNA 2HIQA 1LCUA 1E3MA 1KOHA 3A8KA 3J80O 4OHXA 5K14B 3MCNA 4LRFA 4JKCA 3GMGA 2QMUB 1EX4A 2QLFB 3DRSA 2PD1A 3IA0A 3EPGA 1U6BA 2EVZA 4CLWA 1BU6O 3DHXA 2VYPA 2ZE2A 4F2SA 1DQ8A 3KHYA 2J8SA 5DM7L 1P90A 2HVEA 1RTDA 4G1PA 3CM5A 3H5UA 1ZYQA 5J2NB 1HBMB 4OFZA 2MZRA 2VQEF 1XK8A 4RW4B 4AH9A 3T19A 1J5EK 1H7XA 3QJLA 2E88A 2GUPA 3LPYA 1J6ZA 3F41A 3RG6A 3PXGa 1HLUA 3AARA 3UNGC 4PL8A 1S48A 1H2VZ 4KIAA 3MD1A 2B4PA 1R0CB 3FQLA 3DXMB 1HPMA 3LP3A 3PHTA 3FGUA 5DJBA 4ECUA 3MI7X 2RU9A 1VRQC 5GIOA 2CQ4A 4ZVTB 3P8BB 2A40A 3ZTRA 1VQ4N 2DIUA 1CJTA 2RMLA 5I3UA 5EDWA 3M2UA 3GG1A 2G8FA 4LFAF 4YOTA 4CEDA 3CCEN 4BY9C 2FY8A 5JVGL 4H0PA 1WHWA 2PI4A 2RPIA 5LSRA 5AJ3K 2UXBK 4CHYA 2R8IA 4Z4HA 3W63A 4A5BA 2BJEA 1C0UA 2FUG9 4ZN3A 1CZAN 1YKWA 4PWWA 2B43A 4H4KA 1RBTA 4TQSA 2FJDB 3DLRA 2BOAA 1FJGF 3R9PA 1D0EA 4U9RA 2R7TA 4M5JA 4JKDA 2DBBA 2H9ZA 3O1BA 3NBPA 4W4MA 1RADB 1URRA 2CQ3A 3QJPA 5F0XA 2YWKA 3VQCA 1Q81O 2LSNA 2XZWA 3T5JA 3I0SA 4PR6A 2IJNA 1NOZA 4HR2A 2WBRA 3OYMA 4BDPA 2MGZB 2UU9J 1QS4A 2PC6A 4C98A 4CH1A 4CJ4A 2IBOA 2HHHK 1CS4A 1VCTA 2W24A 3W8PA 1FXXA 5B0AA 4K7QA 1RXOB 4K59A 3R5CA 4GVBA 1KRPA 1HBUB 5GAEU 2CVIA 3CCES 4NZ6A 3ULEB 2A42A 3QIPA 2MY8A 1S9EB 5AQRA 2FIUA 3FZKA 1HNWF 2N4DA 2BQUA 3WIUA 2C3OA 3O08A 3I5AA 4CWBA 1Q7LB 1TV6A 1PSDA 1U2VA 1FKPB 2DHGA 5HANA 3AAPA 5ETKA 1S22A 1X4DA 3CCQS 1WG4A 1A5VA 1VSFA 1VQMN 2K1RB 2D74B 4BRFA 4JI4F 4F25A 1RTDB 5FDLB 2LQBA 4C8ZA 4FXDA 2FVCA 3G71S 4FPAA 1Q9YA 2QWRA 4ED8A 3QNWB 2VFUA 1GH8A 4RG8A 1HWUA 4WE1A 2Y1RI 3CJ5A 3MK6A 3IC1A 2ETJA 2ZVIA 4FLTA 2HBZB 2ITMA 3WUHA 4FWSA 1KQGB 4LC9B 1IKVB 4I6AA 4F3MA 3PNIA 1KOOA 2J6SA 2W9CB 4KKOA 4E7JA 3G8TA 4BG8A 2W9BA 1ZM2A 2NPFA 1FKPA 2C3MA 2OI2A 1XHZA 2PMHA 4K4ZA 1TVRA 4MYUA 4USKA 2CYYA 1LWFA 3QWPA 4B9VA 2P8IA 2B8QA 3OL6A 5IXUA 3AA2A 1NGHA 2AU0A 1BQXA 4F8RA 3K9JA 1Y5LB 2DFFA 2UXCF 2N7CA 3MOJB 3K5MA 1JB0C 2EK6A 1S1TA 2VWBA 2RUGA 2OTJN 5AXLA 1IKYB 2P9UA 4QPTA 1D3WA 2V8GA 2R3VA 2E2PA 2FXUA 2F4VF 1S99A 4NYZA 4URSA 1LEOA 2IVNA 2NYIA 2V4QA 2DNPA 3A13A 3HSJA 3F2KA 4M45A 2GMLA 1NK0A 3PCOB 5F8HA 2HBMA 4Y3CA 2RH3A 4NASA 1EXQA 5KT3A 3DLKB 2QA4G 4PWDB 1TZ0A 1HPZA 3RAMA 4X65F 3AVIA 2EI5A 1P1LA 1Y00A 3KLEA 3GIIA 3NH0A 2AV5A 4DTMA 1OJ4A 3TP2A 3JQKA 2YWEA 2EWHA 1ZXOA 1HL6A 2Q31A 1WI6A 3MM8B 3RB4A 1H74A 3VV2B 2K7JA 2AGPA 3QRRA 1EWRA 1JLCA 3NDKA 3CVKA 3MTKA 3IS9A 2MSTA 4WTYA 3OYJA 4DV7K 1X4FA 1IBLK 1JCEA 4A8OA 1PJ5A 1GMUA 3U9DA 3SJHA 4WK3A 2KRBA 4Z7YA 1RTIA 2LQJA 1EETA 1FVQA 2NSCA 2Y0SD 4DN9A 3JSBA 1SJ3P 2ZBPA 3HTVA 2UUAJ 4CJKA 1DTTA 4OX8A 1VC5A 1U09A 1QSLA 1QZ6A 4AQYF 4JI2J 4PWDA 2UUBK 3Q8QB 4M5MA 5KFKA 3M1VB 4J9OA 3FVYA 5EX3A 3MR2A 4U7BA 1UVKA 1F60B 4OPHA 1Q79A 5HLFB 5M1FA 2W4DA 3ZTSA 2K3IA 4A46A 4QS7A 4DU3A 2RNEA 2HBKA 1RTZA 1YBTA 2N7YA 4NA3A 2LMIA 6FDRA 2IIRA 4J2AA 3IR5B 2JVRA 4MDAA 2DPIA 4M8LA 1RBUA 2IYIA 4BVOA 3HFVA 5KOXA 2VC0A 1S72N 3W2VB 4CJ7A 4J9VA 4NZ0A 2ASOA 1UL3A 3KXDA 1HBNB 3ZZPA 3C7NB 1KCFA 4KREA 5LJ3Y 4FWNA 3FMWA 4I6WA 2D3UA 1IKXB 5H9EK 1JCGA 4V19S 5C2FA 4O8UA 3AB4B 1RCXB 4ED0A 3PZPA 2BUNA 4CVNE 2DCLA 2DCUB 3CDWA 3AOBA 3MMBB 2ZEJA 3WZ0A 3RR8A 2R42A 3CJRA 1SZ2A 5SWMA 3MUTP 4I68A 4DV0J 1V4SA 1LQ9A 5GINA 4E0DA 1WTFA 1X31C 3AV9A 3J81Y 4QYZJ 4ZP8A 3NNHA 1W26A 4CGGA 5LMNJ 2IHR1 2ATLA 1Q5VA 4R0EA 1EX8A 5H1SQ 3QETA 2NR0A 2HSEB 1UAWA 3QSIA 3MXIA 3FC9A 3L4BC 2CKWA 2GGPB 2ZBRA 2E2OA 1T11A 3G82B 3OYGA 5HROA 2R7XA 2D69A 3AQOA 2Y1JA 4CLLA 2KW4A 3RMDA 1YJ9N 1HI1A 2V94A 1VQON 4U7UK 4P73A 4MDBA 2C42A 1DTQB 3HJVA 4KT0C 3PTWA 4GC7A 2VONA 4A8MP 3NHGA 3D1OA 4JI1J 3L2RA 3KVGA 4ECXA 1H98A 4CLPA 1OWXA 2DHSA 3RGIA 3CCWA 3DNCA 3CO0P 2I5JB 1IBKJ 1VIOA 3N4QA 1Q9XA 1SJ1A 4IKFA 4KHRA 4DR1F 2J6TA 1CZ9A 1N32F 3ZSWA 2OPQB 4JI4J 3M2RA 5AQWA 4AHUA 2JWKA 2LP4A 4CGJA 3CCLS 3H45C 1FHTA 5AQZA 4UUXA 3I0RB 1YVFA 2EBGA 2RRAA 2ZE2B 5D3GB 2DXEA 4C11B 3DC2A 3Q8UA 2RJZA 4FLYA 4JI8J 1VS3A 1UKUA 5HMXA 3WBZA 4DR2J 2DRAA 2DISA 4OLBA 2E9RX 1VGYA 1M0SA 1NKBA 2XO6A 3FEZA 1HPZB 2CDRB 3IWXA 3OFEA 4DR1K 5E3CA 2YWWA 2DNOA 1LW2A 4ZPWR 1EZZB 3R5GA 4ECTA 2RRNA 4N56A 1HMVB 1Q95G 3M8QB 2VC1A 3ILIA 3V6JA 3D68A 2HQFA 3MDFA 3OA9A 3EJMA 5HP1A 4YOYA 1TAQA 3HHEA 2YPZA 4DR3F 5ELZA 1ACMB 3VF0B 1T9XA 4JI8K 3QAUA 1U26A 7FDRA 4CECA 1GT8A 1RT3B 4P7VA 1LW0A 4IFVB 4JKFA 3EE8A 2VKRA 2EW9A 3BO2A 3VQPA 3GWCA 3CJ9A 4KH1B 4CHOA 2XY6A 2IM0A 4JI4K 3I55S 1Y3KA 1M5PC 4JYAF 4ISFA 4O5BA 3ZCMA 3G4SS 1QAYA 1K6YA 4LRDA 2ACYA 1IBKK 4USTA 4ANCA 2HHXA 1BISA 4LF4K 3KDNA 2IBKA 3OYEA 5B08A 4UY85 3Q7CA 4PG7A 3SQ4A 4E1JA 1YTAA 2IVFB 2ZDOA 4WYBA 5HATA 4K4WA 1M5VC 4IKAA 3O3GA 3HF5A 4WE1B 1FI4A 2XBPA 1V9OA 5ADXH 3C6HA 1VQLS 4L3KA 1BA0A 1N32J 3D2EA 4NLRA 1IBKF 3BBFA 2LVWA 3SCKE 2MXYA 5CZXA 4WQ5C 2MKJA 1T44A 3FSXA 1RYRA 3UO0A 4DS5A 2O8CA 5KT4A 4BWJA 3KK1A 2XS7A 1N33F 4JNEA 2UP1A 2BRKA 2DFEA 3MDQA 3K5LA 3NGIA 1O13A 4PZVA 3QEIA 4X65J 4Y0FA 1PYTA 2G1DA 4FYVB 3W7BA 1KVIA 2P9IA 1TFWA 4PCQA 5KG7A 2B51A 4OZNA 4PKGA 3WXLA 2BXJA 3Q24A 1ZS6A 5JUMA 1RDBA 2L9DA 2V8DA 3VGTA 1NXIA 2QK9A 4N76A 3C6UA 3AGKA 5DG8A 2D1KA 1GX6A 2EX3A 3D3CJ 1F2GA 4OO1J 3BF3A 2HBJA 1Z26A 4DSEA 5J2PB 4KHPJ 1WLJA 3TJ8A 4IDKB 1ZAWA 3H2UB 3NGDA 4M1KA 3N01A 5DMRA 4OYXA 5FIIA 1S1VA 4PQUB 4QAGA 3J80Y 4PKHA 1RTJA 2QSFA 1FTRA 1IM6A 2KM8C 2RILA 4KGZB 2IMOA 1VLOA 4BR7A 2N3OA 3RSEA 4WU3A 2C2OB 1VRTA 1Y97A 4NPOA 1U8WA 3CJ4A 3EVOA 4DSIA 1X8DA 2E5IA 4OYPA 3GTYX 3KMSA 3GQCA 4BRHA 3IRXB 3CD0A 1DEJA 1NU4A 3P6YC 4LF5K 2HFNA 2QEXN 2DJWA 3B8HA 4IQMA 2FB0A 2VWJA 1OYDA 1BL3A 1VAZA 4U96A 2MKIA 3CCVN 3E8OA 4J9RA 4WCEQ 1JLBA 2ZJQQ 4CK3A 1DJ0A 4ECWA 1KQFB 3ASMA 1KLNA 1WWHA 2GX8A 2ZJPL 5E3QA 4KKOB 2Z1HA 1W25A 4WIQA 4QWDA 1YWXA 4ITSA 4ZMMA 3AA9A 1HD0A 3CPEA 4NLUA 1TAUA 3VESA 1RBAA 1Y9OA 1T3VA 2P9LA 5CZ2A 4Y34A 5C24B 4WP9A 5FPEA 1R6YA 5KFYA 5BR9A 4JI7F 4UOHA 3MD3A 3MMJA 2B4VA 4ED5A 3TWHA 4ES3A 4M3WA 4USWA 5GADU 1JLAA 2CVEA 4PKDB 2E8AA 2NXJA 4KH4A 1VHIA 1BQNB 5HI7A 3HL8A 4IO9L 2FVPA 3KUEA 3U1NA 5D3GA 4HL9A 2VG5B 1BWVA 3G6YA 1BUPA 1PCAA 3SAFA 3DI6A 2O4GA 1F5AA 3QBWA 5KFPA 4JOUA 1AA1B 4M3TA 3P31A 1FFGB 3KUHA 4YOUA 3QWUA 4F02A 2PFFB 3CCSN 4RBUA 2NSBA 1R31A 4NLVA 3C6TA 2OTLS 3M8WA 4DV6F 4OVLA 3VALA 1NNDA 3NNCA 4LF8K 5IV4A 2P9IB 1S0NA 1RU1A 3C46A 5FLXU 4XPCA 2BBEA 4HHHA 4I2QA 2GVDA 2CGLA 1QJHA 4P2SA 3N6NA 1XIQA 2VBZA 1B7YB 2QL9B 4EFAC 3K7RA 2FGCA 2DHHA 2KTQA 4KBOA 3VMFB 3M8ZA 4AM6A 2GHVC 3F5TA 4BRLA 3MURP 3QYYA 4WYWA 2AJFE 2OPSB 3O9QA 4FZVA 4DKWA 4TU7A 2FYXA 2DNLA 4DCHA 1CS4B 1B9DA 2QLXA 2AGOA 4BGBA 5K8OA 2V2VA 4ICLA 2QA4S 1FDAA 1RGVA 3M05A 3GV5B 1QVGM 3L2WA 3CCJN 1WUUA 2E6MA 5AZIA 2GTDA 4NWBA 3V81A 2NRHA 2VB6A 4BC7A 5HVGA 1Y5NB 3O6WA 5CYQA 2EKYA 4LBHA 2JWLA 1ZAXA 3W64A 4NO7A 3KZBA 1ITPA 3VAIA 3NVMA 2XRIA 1U25A 3NF6A 3V1RA 3BS9A 2GO9A 3BO4A 2GHPA 4LFCF 2HHHJ 3AA3A 1SQGA 4B9UA 1RHQB 5A2QU 1NEEA 5KAKA 1WHYA 4OPAA 3NF8A 4KB7A 2GAGC 1WSHA 2HF4A 4NZ7A 1FJCA 4FYYB 4JUZA 3E1YA 4YR0A 2YNGA 4EAHD 4FXWA 5GAEP 4CIFA 3OPKA 2ZFHA 1ITGA 3PW2A 3I8DA 3CCTA 2QWQA 3K57A 2EK1A 4DTNA 4O3SA 1BD6A 2XMUA 2YBVA 2HWIA 3UCZP 2P9KA 4IOAQ 2KLAA 3MMCA 3FSIA 1WG5A 4KV8A 4LVNP 1HNWJ 3H59A 2MZ1A 2JEGA 1IBCB 2GUIA 1BXNA 3GFYA 4DL3A 1NJXA 2F40A 1BQMA 2F4FA 2LDIA 3MF5A 3CJCA 4O0JA 4CT9A 5J2MB 3V9ZA 3PRVA 4ZVGA 2XLKA 3LPEA 1RT1A 3UN5A 4FL9A 2DH7A 5CABA 3BBCA 2I7NA 1RT6A 3T5LA 2XNQA 4Y2KA 1VQOS 1A0OB 3H5YA 4OKKA 5F3TA 3SQOP 4AT1B 4DUZJ 4AILC 3DKDA 2YX1A 2HYIB 1KLMA 2ZC4A 1G7CB 2VPYB 4DV3K 1ZH5A 1RHMB 2R7QA 5EWGA 3D5MA 2WRMA 4WP8A 1AZSB 4J9PA 4DL6A 1R8CA 2H3EB 2HF3A 3DLLL 1D09B 2EC0A 1V3SA 4FBUA 4UY8T 2M3DA 3ET6B 3VPZA 1TL1A 2JLGA 4HT5A 4EYHB 4OIXA 2NUHA 5KT2A 2UUAF 1VBXA 2MEWA 2ADCA 3DAWA 1S0MA 3UKRB 4WFAQ 2W2NP 5CZ1A 5KQDA 1U1PA 1UVLA 2MHNA 2NXEA 4KH5A 2F63A 4CP5A 4L72B 2FSNA 2HRTA 4K4UA 3MMAB 1QAXA 1GLLO 4OV6A 4EZ6A 3EZOA 4FOIA 3N79A 2JLFA 3HD2A 2OEMA 3NMAA 3OFGA 5MLCQ 1RNHA 1GLCG 2QTDA 2ZBQA 4WFNQ 1WC3A 5FJ4A 4EI2A 1RBVA 4I4BA 5GADP 4MQ3A 1WC1A 1O6XA 4X4RA 3LP2B 3SI8A 4GKJF 3EDRB 2JFDA 3U8XA 3GSDA 3O9RA 4YOWA 4L75A 5RUBA 2XM3A 1TKDA 4J9LA 4DTJA 1ZM9A 2CPYA 1YZ7A 3UKUA 1RT7A 3TSQA 3EEQA 4TNOA 4C8MA 5BRDA 2R2TA 1RISA 1XUPO 3M5RA 1NB2A 3I56N 2VDIA 2ZJQL 4A8YA 3EDQB 1YXQA 4YDUA 1YHQS 3FRZA 1PBUA 2YKAA 5J1PA 1XMOK 1HA1A 2DNRA 3CD7A 1HBNA 5C7PA 2LXUA 1TK0A 1SC4B 5ETTA 3AA8A 1DBDA 4HTJA 4BWMA 2DB1A 5LSLA 4DV3J 1GOAA 3DCAA 1EAYC 1HRHA 4GV9A 3PV8A 3ALYA 4FWPA 1TK8A 3UD4P 1Q8IA 1IH7A 1HNZF 1UVNA 2R7OA 4IRKA 4B9SA 1BA1A 4Q5VA 2VG5A 3BZCA 1IG9A 1NBWA 3KHGA 2FZGB 3HOSA 3DYAB 3CEDA 2DITA 1FEEA 4LF9J 2AHOB 4QS8A 1JLQB 4KGKA 2Z30B 1Y10A 4FPRA 1XBWA 2PO4A 4V19X 1P9QC 2EKNA 5AE1A 4OLPA 1SVDA 3BZKA 1HNXF 1ATNA 3BGLA 1DGKN 3IXQA 3R6LB 3VQAA 2H65B 1JJHA 2G8VA 2F8HA 4BC2A 1HJRA 5AQPA 1NJIT 4IO9Q 1QUPA 4LD0A 4QIEA 2A1SA 4CESA 4GMJB 4XH4A 3M30A 1S12A 4LQ9A 2HBLA 4N7TA 1E6VA 4DV7F 4CDIA 5IT9O 1VR6A 4KHPK 1XNQF 4X4UA 2A5XA 4CBWA 3RAQA 4DV5F 1J54A 5AQLA 1D9FA 2HNZB 1C1AA 2I2YA 4DX7A 1QQNA 1VBYA 1DLOB 4CNZA 4BE2A 2QV6A 2F8SA 3KLIA 2AP1A 4HLBA 3BSCA 3TAGA 4CIOA 2HNZA 2A1RA 3LANA 3H8YA 4DPUA 1RBLA 3AD8C 4PKIA 1K73T 2IRYA 2NPIA 1VQNN 4JI0K 1LOUA 1YX2A 1U7LA 3VGVA 3VEZA 1YJUA 1NGGA 3MR5A 2DR5A 4KGMA 2V51B 1S1XB 3T7ZA 3DOKA 5IC6B 4PPZA 3QIDA 2HS3A 2QJ3A 4IOAL 3KNGA 3TRGA 2HVHA 4ZVOB 2DGXA 2MQPA 3PSFA 3CERA 3QESA 4PXEA 4NCAA 2BW2A 1TTHB 4JAXA 4DWIA 1T95A 4RO0A 2P2CB 3GE9A 3EY1A 2M70A 2MJUA 4HUGA 4RW9A 3QEVA 1NNEA 3DDIA 3HZGA 4I7FB 4BR5A 3TTCA 5ADZA 3OFFA 1SH3A 4DR7F 1C0GA 4ES1A 1KHWA 2DNHA 4DR5J 5DZ6A 2YQ3A 2M8HA 3IP0A 3TANA 2RDJA 5DM6Q 4YR3A 3T1HK 3BYPA 3I32A 1S1UA 4Q8EA 4TKTA 5ADXA 4Y65A 4CH0S 2QIFA 4EK2A 1T3OA 5E33A 2Q0UA 2FVRA 3TZYA 4M7YA 3UDEA 5JMNA 3VZHA 1TKZB 1VQNS 4GVEA 4K4SA 2KYZA 2ZH8A 1JLBB 4OI1A 2CG8A 4A5AA 3QGPA 4K5RA 1F6TA 4QW9A 2R2SA 2AEFA 2A6AA 2W4PA 2V0NA 4K50A 2FHKA 1RWOB 5JVGQ 3OVAA 2YWHA 1V4TA 4NOHA 3OJUA 3UD5A 3GFHA 2CZVC 2JEFA 2Z2YB 2VG7B 4ERDA 2IDEA 4RUAA 2GELA 4NCBA 1QTNB 4OYOA 4DI6A 3TTFA 3KLHB 4DR6J 4DBQA 3AOCA 1VQ6S 2MSSA 1WUAA 2YKQA 3RB6A 3VHQA 2YX7A 1BGXT 1MNEA 1H2TZ 2C28A 4F7VA 3O80A 1WSVA 5E3RA 3ZFVA 3OYBA 4USJC 3ITHA 2G1HA 3ZXWA 1VSLA 4TY9A 3RBZA 2PBDA 2JC1A 1RYSA 4A8SA 3J80U 2NRZA 3GPAA 3TU5A 1S6QA 2YHBA 3OLBA 2A10A 3QINA 1YJWS 4NLOA 4WFXA 3NOGA 3BGUA 3VQSA 2ZH5A 1CC7A 3MGJA 4JI5K 1YIJN 2W6KA 5M1NA 1ASUA 1P9YA 4EGLA 4K8ZA 3DI6B 4Y1DA 2ZH1A 5KFZA 2Z1IA 3M32A 2H5EA 3CD5A 4NRTA 4FWQA 1S1XA 2HAFA 2XG8A 3R2CJ 3CSKA 1VQLN 3ZSVA 2JLEA 3VQQA 3A1YG 5DGAA 2YCHA 5IT0A 1R0AA 4DQQA 4CZIA 3CCQN 1CXQA 5KTQA 3MEGB 4J9UE 2XY5A 3AOAA 2DEIA 1PO6A 1UA1A 4JI8F 2V4RA 4CJ5A 4FWRA 3LWMA 3QATA 4NLTA 3C15A 3ATUA 4CM0A 4DF8A 1LK7A 3QFPA 3KFWX 3PDNA 1U45A 1GFWB 4QPXA 4M5IA 3G4SN 3VAKA 3KJQB 3UD3P 3LM9A 4O3QA 3DXMA 4FJ8A 3MEDB 1U48A 1V3ZA 1M5HA 4U95A 5J2QB 1QDUB 4KH0B 4HTLA 5JLFA 3QRPA 3GP9A 1BQMB 4IRDA 3KKFA 3MHYA 1RU2A 3WXJA 2G0CA 2Y1LB 4Y2IA 3ENVA 4GY2B 1RE1B 4PYDA 3HSZA 5BR8F 3HD1A 4Z7CA 1HWIA 3BQ0A 4DZ6A 3RW7A 1KP6A 1MSWD 1WNSA 4CO1A 4YDDB 2IAJB 2YNIB 4QJVA 3J7YU 2VFRA 1XMOF 3PX0A 5F0UA 4X4NA 2IGIA 4PXCA 1O8BA 2W41A 1Q0NA 3O9TA 1IKWA 4CLUA 2V9KA 3Q8PB 1SI9A 3O4QA 3AVJA 2B9EA 4Y2MA 4YMEA 3CTRA 2L48A 2F8TA 3S9HA 1N6QA 2FD2A 3BSOA 1G99A 2XB2D 1NBEB 2BW7A 3U3YA 3TABA 1FRKA 2DNYA 2J0WA 5HO4A 2W7AA 2PEBA 1V5IB 2OMOA 1UPPA 3H08A 1FD8A 4A8KA 1U02A 2IIHA 1U1LA 1URNA 2HBQB 2WOMB 4GVBB 1YTUA 2V8HA 3N6MA 4IG3B 5AFUH 3FEYB 1IVZA 3TUIC 3V9UA 2J0XA 3I9V9 2ASYA 2Q2RA 1IUJA 3H98A 2QMWA 4CLSA 4QCLA 5C12A 4DX8H 3DMJA 4XPEA 2QL7B 2P5VA 2ATQA 4P2XA 2CJQA 1TUGB 4E8UA 5GADI 2XC9A 4I1TA 3K59A 3THXB 4DR5F 2M0GB 1RHKB 3R7SB 4HUEA 1F9EB 5AQXA 3CULA 4DL5A 2VBWA 1NAQA 3BQ2A 1FRMA 4KB1A 2DRBA 3S6EA 2JH3A 1X0FA 1K44A 2HS0A 3BYRA 3Q2TC 3BGRA 5LMUJ 2AEJA 3QEPA 3U27A 3DRXA 1ZBTA 3RMCA 3N5BA 1U1OA 3ZX2A 4BQZA 1NK5A 4G1IA 1FNMA 1A7GE 3MR3A 2V2ZA 2QA1A 4BRIA 1VDHA 1ZBLA 4LFBJ 1F1BB 3J7A1 2QKKA 3GIKA 3OTBA 5C42A 3Q7BA 3OV7A 3VERA 1WOPA 2KB2A 3TEHB 2XZTB 2UUBF 1GLFO 2YQ0A 4EBEA 5A8KA 1U04A 1OH6A 3C16A 3VN5A 3T1YF 2FHMA 3GBTA 3L7PA 4FM0A 4U67L 1RTHA 2KT2A 1VSMA 5DETA 2MLZA 4DQSA 3F44A 3KK3B 1RFQA 2OPPA 2VH7A 5DK5A 5D0HA 3IR6B 2OD4A 4EUVA 2GCFA 3KHRA 2OEKA 3VQ7A 2FVQA 3H7HB 1A5XA 3MM7B 2V4JA 2F5GA 2E2QA 4ANDA 3OHBA 2CJXB 4K0KJ 5AQJA 4DU7A 1RBOB 3OR2B 1IR0A 2BKOA 2I5JA 2LXFA 2CPDA 5DDQC 3O9SA 3H1VX 4Z4IA 1JJ2R 3KOAA 2YHYA 2DGVA 2XQCA 1YJNN 3PW5A 1T6CA 2J7KA 4LRBA 4X65K 3TUJC 1NKEA 4W5NA 3JTPA 5H9FJ 3TAMA 3NE6A 2CH6A 2WTFA 4KTZA 1NK9A 3OSNA 1TL3A 3BDEA 4BREA 1SJFA 2HVIA 1PAUB 5BREA 1IG8A 1S1WA 3AFGA 4JI1K 2Y8YA 4CO4A 3SFGA 4H4MB 1HI8A 4NB4A 1SUQB 5BYQA 1FCAA 9RUBA 1FDBA 2QN6B 1JWWA 2BM1A 1Q5YA 1YHQN 1CJVA 2E4LA 1HNXJ 1RI7A 3NWGA 1GMWA 4FN5A 3S3MA 1ICEB 4ZPVR 1HYZA 3UVJB 2G8HA 5HK4A 3HHLA 5F8NA 3MWTA 2LQ9A 2HMPA 3QNNA 4WBFA 1HNVB 4C97A 1Q82T 2CQDA 5K14A 3T69A 2XCPA 3CD6S 4JS5A 2EFQA 3EVWA 3LTOA 2DR9A 1FDDA 2DNQA 5IZHA 2XZDB 2GVZA 3MEGA 1RP5A 2X1FA 4ZCKA 4LH5A 3MM6B 3DRRA 3QERA 3Q8VA 3QFHA 4FWOA 4K43A 2R9LA 3NXZA 4YB1P 3R5JB 2AYMA 2YKOA 3K9KA 1IQZA 1KLMB 3JAMU 5IWAK 3QT7A 5DGBA 3D6TB 2D9PA 1H38A 4NLGA 3ZT1A 3FZFA 3I9ZA 3C14A 1DQ9A 4HH0A 3JSMB 2ZGYA 3GB0A 2D1CA 3D7SB 3CMAS 3EO3A 5KPRA 4DZDA 4FF3A 2Y3YA 4C2MA 1NJZA 2HHSA 5KG2A 4KTQA 2VKZG 2QGFB 5M1OA 4ED4A 3IRWP 3OR1B 4AL6A 3ATVA 5KFGA 3KLHA 2BM0A 5ETRA 1NK8A 3CQXA 3NCRA 2PFUA 5KOWA 1E4GT 4FZZA 4ED1A 2M9KA 4I2QB 2GVDB 2E5HA 4NLXA 4R8UB 3FZLA 2APOA 1WAFA 4CF1A 2BGGA 1JKHA 2KKZA 1BQNA 3AVBA 4DHVA 2MB0B 1NPKA 2E1PA 1HYSB 2ZBIA 3PW4A 4CZLA 1U6FA 1QQOA 4OX9K 2MLYA 3C7NA 3CMQA 4CLZA 1QSYA 4P2FA 3W9HA 2XO7A 3RB0A 1YJRA 5A2QY 1G4CA 4I7FA 4FJMA 3PACA 1NDCA 3T6BA 1HKBA 4QBUA 1QAJA 4HACA 2P9CA 5EOYA 1HWLA 4XIUA 1LAWA 1HNIA 3GZ7A 2YVSA 1B92A 4OZ2A 5T7BA 4GKKJ 2ZH9A 1BO5O 3UE5A 3KK3A 3V9WA 2LA4A 3A3OB 2W42A 1CJKB 1WSIA 1KVKA 4LFCJ 1R27B 3GSIA 4LH4A 1PILA 5L1LA 2QWNA 2YJEA 4OKEA 4DTSA 1EIYB 2V50A 1FK9B 2D3OR 2M7SA 1LXJA 5KGWA 1BG3A 5C0YA 3D6MB 1HKGA 3H3NO 1VQ6N 3M30B 1MMLA 1IJFB 4LY7A 4DUZF 2JWNA 4RW4A 1DT9A 3KJFB 1VK3A 5CCMA 3L09A 3I8BA 3SMZA 4WU2A 1KAZA 3R2DJ 5AZJA 4WJBA 2PMZD 2R7VA 2GV9A 2RHSB 1U6ZA 3RU0A 2H1YA 3LAKA 1HNZJ 4CFBA 1WELA 3V1OA 3CJ3A 4C4WA 4IQXA 4Z4GA 3O3HA 3FNNA 5J1NA 3C19A 4K5SA 2H54B 1MROB 3K5OA 2RS8A 4DX6A 1X4EA 2MYFA 5DG7A 4WP3A 3K2PA 3GDQA 4RUHA 1Q16B 5SZTA 4XH5A 1EKSA 5T7LA 1TUVA 1VYAA 3W3SA 2P9GA 2GIRA 4FJ9A 1HWKA 2H4YB 1HYVA 1NK7A 4IH6A 5KFSA 2XSFA 5AQFA 3HO1A 4FJIA 1Q18A 4LF7F 1NSQA 3D1HA 2VGMA 4CJQA 4JV2A 2DNNA 2YWGA 5CYMA 4LR8A 2J9CA 4IFYB 2L08A 4L74A 1LFPA 3JB9k 4B9MA 2QG9B 2F8MA 5KFAA 3OTDA 4CGIA 1NSKL 2V68A 5B0DA 1N5VA 3BF1A 2QLWA 1JLGB 4CW7B 2ZOFA 4CEOA 2PEHA 1YRUA 3DU5A 3MCMA 4LF4F 3CDUA 3C6UB 3CXCR 1KFDA 2IC3A 1NJYA 2HQ3A 5DDOC 1S72S 4ZVEA 2EPIA 2ZD1B 1QVGR 3OBYA 1T6DA 2YV0X 2YX6A 5FD1A 3N28A 1N5YA 3LP2A 4KPCA 3TYTA 1WSRA 4FWMA 2BANA 5AQNA 4H5NA 2EBEA 3MM5B 2VQFK 1S1WB 1RT4B 1REGX 2PA8D 3UKUB 4RNHA 2O8BB 3QB0A 3GV8B 1SJRA 4J90A 4F0HA 2UXDF 4CLKA 3VVUA 1WF0A 5MLCV 4ALZA 5E7OB 4BQLA 5K20B 5IFMA 3H0PA 4EZ9A 5L8RC 4QU7A 3CCJS 2ZKUA 3LALA 3SFUA 4IEIA 5DRKA 3S3OA 2L9WA 1FK9A 4OMFG 3AODA 1TMMA 2V69A 2HFUA 4N41A 4NYPA 3QGHA 2RE2A 1DFDA 4RCHA 3WNGA 3E66A 4CJWA 4YB7A 4KYZA 2ZJRQ 4P75A 3KG1A 3UDCA 4URQU 2DT9A 4YQWA 4X4TA 2CGKA 4G1QB 1D1UA 4JV5K 1FRXA 2FF3B 1HBUA 3AHPA 3PX6A 1HNXK 2NRXA 1UEVA 1OYEA 2BE9B 2UZAA 1S4FA 4FF2A 2WB1D 1RCOB 3UFCX 4FVMA 3PFEA 3E9LA 2MKSA 5AXKA 4N47A 2O01C 2G2OA 2O66A 2EFOA 2CUYA 1XN9A 3FZHA 4YORA 4UOCA 4JI1F 1X7VA 4LBIA 3VTIA 3DU6A 2CRLA 1Q7YO 4CHPA 3H40A 4CHZA 2KT5A 2NXCA 1EP4A 1KS2A 2HK3A 3QJJA 3LGNA 2EC2A 1NB7A 3MUMP 4K25A 2PSZA 3FDSA 3EGNA 1VSJA 1VC0A 4JI6J 5HAOA 2OKQA 5JS2A 3N4PA 3TO8A 4B3MJ 4IFEA 1S79A 1I1GA 1ZTTA 1IKVA 4CIEA 2M52A 4CERA 4XDCA 1JJ2M 5JLHA 5F8LA 4OV1A 3DM2B 3JYTB 3SCJE 4EEYA 1XNQJ 1RABB 1IBLF 2V8PA 2KYXA 4OJHA 1S5JA 1NU0A 4CZCA 1ROFA 3WEEB 4CTAA 3OLAA 1S0VA 3PJ9A 4DF4A 1N0UA 4PXBA 3V4MA 3NKYA 5L9NA 1APSA 1KHVA 2W1BA 3TI0A 3IMQJ 2WVFA 1Z2ZA 3BSAA 4AUKA 4DPXA 2WW4A 1KDNA 1HHQA 3N0VA 3GOIA 2J6UA 5I3QA 4GV6A 4H4OB 3P39A 2HHPA 4ED6A 1X9MA 1I3AA 4RNMA 4TY8B 3EGWB 4F4WA 3HFZB 4LF9K 3MX5A 1CPZA 3W66A 4FLZA 3DLLQ 4DR2K 1VLYA 2ZD1A 1MWQA 3AA4A 4DJBA 1RBSA 4E7KA 2D9OA 4DSFA 2AJ0A 4CRJA 3MUVP 2UUCF 3AD7C 3ENOA 1YITN 4O4GB 4U7CA 2YH0A 2IVMA 2RQMA 3TX8A 1JIHA 1UEKA 4M63A 3KD1E 3KG4A 1SQKA 2EFNA 4FK0A 1R8HA 4AD6A 4DPYA 4YY3K 5ETOA 5LL6Z 2Q97A 1HUXA 2ALYB 1WC0A 1SBRA 2A6OA 1RT5A 1XMQF 2D0BA 1N6QB 1T9WA 1CVJA 1CQNA 1SIWB 4UZCA 3IAYA 1ZBSA 5HP1B 3HJFA 3D2WA 2LEBA 4HTIA 1C0FA 3P4IA 3O8WA 4V19J 2Z0GA 4TSXA 2XGPA 3H25A 2HNYA 2HG4A 5L9XA 2CQ0A 4NX9A 1UOCA 1A6LA 4ID1A 1B0VA 3IBFB 1TK5A 1S59A 3DHWC 5M2RA 3HZ6A 4ZOSA 4CQ1A 1EETB 1NM1A 2UVRA 5B09A 1BDGA 1YAGA 1SC6A 4HH1A 5AQMA 2J5AA 2FF6A 4FJXA 1KQSM 4N5SA 2P6TA 3CW2C 2NCKL 2W8KA 4Y6IA 3VGUA 1FTCA 4ZPDA 2RVJA 5F2RA 4JV0A 3R5DA 5A6PA 3VQTA 3QEWA 3MMBA 4R79A 2O8EB 1SS6A 3PJXA 3MCPA 4KHNA 1EKEA 3GFXA 1LFWA 2ZM6J 3ET6A 4XK8C 4GO7X 3ETMA 2GC8A 4NXMJ 1JJ4A 4OX6A 4KC5A 2QRRA 2OGUA 4ETXA 4OLOA 5GAGI 2XMJA 1VQPN 3VCDA 3CUNA 2XGQA 2W2OP 2UU9K 4GC6A 1ULRA 3HCXA 3QT5A 2QL5B 2Q66A 1VC6A 2Q1NA 2HHHF 1TKTB 2E1RA 4WCEL 2J7WA 2KN4A 5GMEA 2BDPA 5M1KA 2NXNA 1A9NB 3ZSQA 1B4SA 3CI5A 4M3RA 4ILMA 3UQSA 3TSUA 1DHMA 3IG1A 3PG9A 2U2FA 2FVSA 4P52A 2X78A 4R25A 2ZNZA 3SQ0A 3AAWB 1WI8A 1UZDA 2MKCA 3VETA 2DK2A 3TAPA 4H8KA 1XR6A 2R2RA 4USMA 1K9MO 5LJVA 4QZVB 2C3YA 1FJ7A 2E5GA 3OVBA 3D2FA 3WQTA 2QFIA 2DH9A 1TFYA 3LDPA 2XYHB 2PE8A 2DGOA 2MJNA 2CQIA 4JK8A 5BYSA 4NXMK 3W65A 4CZGA 2ZM6K 1AFJA 1S6QB 4YY3J 4TYAA 1NO8A 2YNFB 3DWLA 1VQYA 1ZM3A 4G1QA 1WBDA 1KSPA 3V81B 5DLFA 2B5JA 4ZP9A 3IKMA 1WEYA 4ZPAA 1Q8BA 3ULDA 3S8SA 4FWKA 2BZ2A 5ITHA 4E3SA 3H5SA 1LWFB 3J7YP 4ICLB 3ZTQA 1YVUA 4OJRA 3RMAA 1RGIA 3TOQA 2OH2A 3P38A 2F65A 1X4CA 3EE9A 2UV8G 4M63C 2CFXA 4ZCIA 2ROPA 1H0HB 5DS7A 2YNHB 4KI6A 1I94J 4O3OA 3G6XA 2P9SA 4CZEA 3LO3A 1Y4ZB 4F4YA 3AA5X 2O1PA 3I5CA 1XEZA 4I6MB 4FM1A 4ETZA 2OHDA 2QW9A 3ELHA 1X4AA 3EUNA 1AFIA 1C1BB 2YNIA 3JS9A 1RILA 1AYEA 4PUOA 5F8GA 4C8YA 2W9CA 5J2NA 3RR7A 3P1GA 2RE1A 1T03B 2Q79A 1EHWA 3J7YI 2FZKB 1WF1A 4JI2F 1T05A 4J9MA 1FO1A 5KFDA 2CADA 1NGDA 4L73A 3U4LA 4JB8B 2MY7A 2FHJD 2M88A 4HTUA 3TSPA 1NCLA 3CJKB 2VPZB 3EZ5A 4P2MA 3DGPA 3NAIA 2OFGX 4M94A 4OHVA 4LF5J 5FDLA 4BDYA 3J7AN 2PI5A 3MCSA 2RDIA 2KJWA 3IWLA 4WTOB 5BR8J 3V4IB 4K8XA 2WOMA 4C0BA 1RAJA 3PW0A 4OI2A 4ECSA 2GJIA 4WF9Q 3RAXA 2D3O1 1PC5A 2V5HG 3BKTA 2ZZTA 3HSTB 3DXBA 3G9CA 3SEOA 3T1AA 2CPJA 2QYCA 4QIWD 2EWSA 3AVCA 2VF3A 1RAEB 4DDFA 3K0SA 3FFIA 1S7IA 4UZBA 3GJTB 4CK2A 1PC4A 1PAEX 4DR6F 4F4XA 4ZVRB 3HHDA 3WEEA 3CC2S 3ZZZA 2Z57B 3P5BP 5KQ8A 3DLEA 4FVCA 1WOQA 2OCEA 1N36F 4CD1A 4YHHF 1VQ5S 5GAHU 1X5SA 3CNQP 3VEYA 5D0RA 3FCHA 3MPUB 1T9VA 3IGNA 4YN3B 2Y8WA 4NYOA 3CPWR 2QI2A 1BE4A 2XHBA 3UKRA 4DR6K 4FCYA 3OVNA 2GBZA 4DTRA 4OI3A 1HR0F 3L2VA 2U1AA 4NLCA 2XHCA 2UXCK 4H0XB 1YJTA 1RTIB 3M3ZA 4M42A 1V3RA 4FLWA 1H73A 4B3OB 4RL1A 1DKGD 2BOPA 4EWTA 1A5WA 2DXDA 2XCAA 1GMVA 3I56S 4LSNB 5A8KB 1JL2A 2LKZA 3IM8A 1JNZB 1YG0A 4KV8B 1O51A 2CWXA 2CJKA 1VSKA 1K0TA 4NLSA 4LSNA 1OY6A 4MT1A 4KHPF 2FSKA 2WB4A 5AZIB 1HR0K 5EX5A 1U0HB 4LT6A 4JV5J 2LECA 4X64F 4ZDNA 2GQCA 2R8KA 2DKOB 3MOZA 4OLAA 2CZ4A 4J9QA 1YITS 2XY8A 3E51A 2ABYA 3AJDA 1KTQA 1YGYA 4BC4A 3L8BA 2VJVA 4Q0BA 2ASMA 3E3XA 4JRQA 2W8LA 5KFEA 2CPFA 3R1LA 2BJ9A 1B7FA 4DU4A 1VBZA 1ZBUA 3I5BA 3BEXA 3C6AA 1S6OA 4NYFA 2GIQA 4FKXA 1IBMK 1UFWA 4B3SK 1DTQA 3POTA 4K0KF 3CJ0A 1U2VB 1B64A 2F1FA 3HI0A 2NXUA 2B6AB 5CHIA 4UUWA 4OHWA 3BSNA 4CO2A 1XC9A 4X62K 4WZMA 4FJNA 1YSJA 1QAIA 3O3LA 1JLEA 4GVLA 3LH2S 4RW7B 3H90A 1GLAG 3BZQA 4DV4F 3TR5A 5B8HA 2OEJA 2E44A 3RB3A 4LF8F 3SJJA 2W2MP 4KAIA 4LR7A 4YFUA 1CLFA 5CXTA 4H5RA 4KHUA 1RA7A 4DCOB 1AB8A 2CPXA 1MU2B 3CHWA 2KH9A 3NLCA 5J2PA 1VJWA 1WKLA 2FLPA 1J5EF 3MFIA 2XI2A 2UUBJ 2GGPA 4CJFA 4EP4A 2MLXA 1W9HA 2G8WA 5IQQA 3BJYA 3LP0A 1G6BA 4RW9B 3C65A 2XNRA 3C6TB 1TELA 5LXYA 3DOLB 3VVTA 1EWQA 3AVKA 5J1EA 2HW3A 1IQTA 1VHFA 4BDZA 3CM6A 1EJ7L 4F4AA 1FXRA 5AXMA 3O4NA 4KAZA 4BS2A 5A0YA 3W62A 3HULA 5IV3A 3PR5B 2YWFA 3D6RA 3MWBA 5C25B 1TKZA 2E5LK 1BHNA 2XI3A 1F9HA 3H6EA 3M6GA 5AJ3F 1XR7A 1T3NA 2RB7A 4M5KA 2RRBA 2KU7A 4CEBA 4GW6A 3ZNUA 1VRUB 1RACB 4OZ3A 1VQMS 3ILOA 4X66J 3SNNA 1N5TA 2VGNA 3NH2A 2VWKA 2IM2A 5BJRA 2YI1A 4F67A 3J81O 4OX7A 1W2IA 4DEZA 1RT2A 2CNKB 2Y0BB 1NH7A 2VZ9A 4G6VB 5E5NA 3A12A 1C6VA 4ZTJA 1Q8LA 4GVMA 3M9NB 3AVGA 4JK7A 3OFHA 5MAOA 4NA2A 3OYLA 4H4OA 2C2KB 1XQIA 4ELUA 2DR8A 3T9NA 4QW8A 4XH1A 4ZHRB 3VTHA 3UPFA 3CO9A 2W6LA 1YQHA 1NGIA 3NH1A 3KLGA 3AVFA 1KTVA 3QLHB 3CYMA 3CC7N 4W5QA 1BWFO 4H0TB 1HD1A 4CF0A 5JS1A 3IUCA 3EN9A 5GAHP 4MKAA 3QLHA 2VL1A 2JVOA 1GLDG 1LAVA 1C4CA 1MA9B 3NCPA 3SDEB 3MN5A 4JKBA 2J0SD 1GX5A 3M9OB 4H0YB 2E9TA 1GOBA 1XWLA 3M8PA 1T9TA 4ECRA 2HVZA 4KQZA 2VD3A 2R7RA 3CQYA 4B02A 3J7ZT 2IVPA 1GAOA 1HIYA 3KWMA 2DXFA 3ZZTA 2JFKA 2UUAK 1FESA 3GYGA 4BRGA 1OY9A 1JL1A 3LP1A 3CCRS 2UXBF 4LF6F 1XMQJ 3HSCA 1N33K 2OPSA 3D0PA 3SUQA 3ZSRA 3R1XA 1X5TA 3R6MA 2V52B 4L6V3 2O8EA 4OYIA 5JMVA 9ATCB 4F3QA 2BKPA 2CJBA 2E1MC 2NQPA 3DMJB 2XY7A 3CG7A 4TXSA 4XAKA 5KRSA 3Q2SC 1RA6A 4Q44A 2CJYB 2B4OA 2H5IB 2AQ4A 1K8AT 4CTAB 3HLUA 3J8AA 1BCMA 4NLQA 3CDBA 1IBLJ 5C25A 2P5OA 1HNVA 1DY3A 5CR4A 2NYHA 1S76D 1GNKA 4RW8A 3DRPB 2ASLA 1YRXA 4AHRA 4ZPTR 3EXCX 1FNOA 1KBRA 2AP6A 1UW9A 1KNZA 3A0IX 5FROA 3GJQB 3KG0A 1LOTB 4DV2F 1T0TV 2VA2A 4MK8A 3J7AP 2PFDA 4CF2A 3MAHA 4MIWA 2DYAA 1HKCA 1ZPVA 2Z56B 5D4LA 5KT6A 4Z37A 3BKUA 3JSYA 2Q36A 2H3GX 1AZSA 5KFBA 2CPIA 3NS6A 5E0OA 1HI0P 3A5LC 4DL4A 2V63A 3LZIA 3JSRA 3LDQA 3L4IA 1CULB 1Z1ZA 5L46A 3EYZA 3K58A 5D0EA 4HVJA 3BB5A 1KC8T 2NRVA 3TZXA 3SCIE 2HBYB 4IWVA 4CJTA 2OMLA 4B9LA 4TY8A 2XSJA 1SH2A 2E1AA 2Z2LA 2HSTA 3G10A 2AJ2A 4NLBA 3L7UA 5HN0A 3UE2A 3A5OC 3BR8A 4DOZA 2L3MA 2FQQB 2KM8B 4OHZA 2LEAA 3VGKA 4MLEA 4IOBA 3N5FA 4ZLJA 1LW0B 1KWMA 1S77D 1HARA 4ILLA 1TL4A 1NKCA 1U2FA 3WX4A 4CLFA 3JQJA 1N5QA 3I87A 4A57A 4Y0WA 3EGZA 3AAQA 1YI2S 4HWIA 2DHXA 5KFWA 2RU3A 2HRUA 3AGRA 3HMJG 2V6AA 3A4TA 5HLFA 3LWLA 5B0FA 1SL0A 2J9EA 3OL8A 4DLEA 4RUBA 4PPDA 3KKRA 3ZSYA 4DV4J 1JLCB 4QS9A 4DTUA 1WJ9A 2XHWA 2D3ZA 5LMUK 5B7WA 4F36A 1MMNA 1N48A 1HQEA 3PO5A 3BGRB 1C0MA 4CGHA 3I33A 3JTOA 3GG4A 4JI0F 5AQSA 4PG4A 4CEZA 2HZCA 1WSGA 3TVZA 3MECA 2DNKA 1QZ5A 4TU8A 3VQ9A 2D5RA 1XJWB 2BEFA 1WEZA 3AO5A 3NG8A 2M4MA 3M4XA 1EARA 1DURA 1RWXB 4DHYA 5DQIA 3SUPA 2FBTA 3FR0A 1YVNA 2GO8A 2AWZA 2HQDA 4OJGA 1NGFA 4PHTX 1VBKA 4CO0A 4B9TA 3N6LA 1IV0A 1VHXA 2XULA 2IM1A 1GXLA 1KONA 1VI7A 2WHOA 2R8HA 4WKYA 1ZETA 4DTPA 4G65A 3DLEB 5KFJA 2ASPA 3VEWA 4J2DA 3CCZA 4JEPA 1KVAA 1NPPA 2P9PA 4YDXA 2DR6A 2P51A 2M5YA 2Q6CA 2K8GA 3DRPA 4BVPA 1SKUB 3I31A 2HS4A 2KJVA 3OTEA 1HJOA 1X4HA 1OY8A 4RW6B 3CFPA 1UEUA 5TKWA 1MDUB 3W8GA 1X9SA 3NWRA 5LT5A 5E26A 3AXKA 2AF6A 1B70B 2Z58B 1S9GB 2X6SA 4RW6A 3HP6A 1UPMB 3EL2A 1CJUB 2MKKA 3DOMB 3TZZA 3VAMA 1K8AO 4WYLA 4OHYA 4J9NA 2HEKA 3KYLA 3PM9A 1VQ9N 3OS2A 3G8SA 2NLXA 4O4GA 4K4VA 1IXKA 2IA6A 3DOMA 3M9MB 1MW7A 1KVJA 4GNIA 2E7VA 1S5ZA 4P10A 2F9WA 5F9NA 2A0FB 2XEXA 3GR1A 4ID5B 3AO1A 2CAJA 1K47A 4JD2B 3BPSP 1VQ7N 2K1RA 3N4WA 2Q6BA 3WNFA 1ZBFA 4HYKA 3X3UA 4BRPA 4KHQA 3BO3A 2QTWA 1N36J 5BPLA 3SUNA 3FK4A 2AYBA 1N33J 2O8FB 3CMES 3AD9C 3NGKA 4BRMA 2COLA 4YNQA 2QWPA 4WQ5A 2UXBJ 2BKNA 4Y2CA 3HT0A 4CK1A 2BTFA 2HHVA 4M5NA 2F7VA 3KK2B 2HFVA 1C4AA 3F0NA 2F8EX 2YX4A 4H54A 1I6JA 1ZA2B 4MJKA 5A6WA 1HKAA 4B3TK 4DQIA 3SSRA 3UNYA 3J81U 3CFOA 3KLIB 1P27B 3WT0A 2FLNA 3Q22A 1H6KX 2IPOB 3KK7A 5F8JA 5LJ5Y 4M3XA 1X4BA 4FJGA 5HQLA 3IS9B 2OSRA 5GAGP 3NF7A 4B1VA 3VQEA 4F4ZA 5D8HB 5D6GA 2ZNYA 1RZMA 3BQ1A 1GLEG 3AB2B 1HQEB 1UCNA 3G96A 5C2DA 1C2PA 4F3OA 3BGFA 5KPZA 2KL8A 4U8YA 3I82A 3U02A 3ZZYA 3D45A 3LM2A 3C8YA 1RT6B 3O3FA 5AQVA 1Y7PA 3HPGA 2HHUA 3QMLA 2KRRA 3M1VA 4DR3J 1UJ5A 4DV3F 2DGQA 5HBMB 4EO6A 3DJCA 1C0UB 1FRHA 1FDNA 5AE2A 3J7ZO 3ID8A 3CMEN 4JI5J 3ZYYX 4D3GA 3UB5A 5A8RB 4OGCA 2ZZNA 2JEIA 1CXUA 1SKWA 4FVUA 3AQPA 1WOSA 1SIZA 1R8PA 3NCQA 4KO0A 1CULA 3TVYA 3PKMA 3TNVA 4FS2A 2E29A 4MK9A 2ZJRL 5DDPC 4J9SA 1Z05A 3H46O 1ELOA 3J7Z5 5AQGA 1R3NA 2KXHA 2ZHBA 4DR3K 2O8CB 3OYIA 3MR7A 3CT9A 5DM7Q 3V5RA 2HOEA 5DQHA 3AVMA 4X4VA 1QE1A 1ZZNA 5BPNA 1UWAA 4W5TA 4UTGA 1S9GA 3DLGB 3QDKA 4LQ3A 1XTZA 3SBMA 3ENAA 1M90T 4B9NA 3SQGB 1RKJA 3CC7S 4ES2A 3SSSA 3CIMA 3FE1A 4OX9J 3BBBA 1KXPA 2EHGA 2E66A 2GW8A 4R0JA 3W5XA 4BC3A 3QT6A 3CJQA 2OSQA 1FKOA 5GMKa 1S49A 2QA2A 1BY9A 3EXYA 1QUVA 1BWEA 4ILRA 3NS7B 3CJ7A 3R27A 4QQBA 4P71A 4C9DA 4RNOA 3NEKA 5CQGA 2DNMA 4RPFA 1WKJA 3AJ2A 4NL5A 1CJUA 4PRFA 3G87A 1U2RA 3HYFA 1GXTA 1VSEA 1IJEB 3OYNA 1T03A 3DLGA 2OUGA 2X1BA 2BE2B 5C2GA 3P83D 1QVFR 2WC9A 4CJUA 3VF4A 3KJVB 2HRYA 5HRPA 4JP8A 3D9BA 1AUSL 2B8PA 2MZSA 3HRGA 1M1KT 3QIPB 3GFZA 2Q43A 4Y1CA 2HURA 1SPBP 2HNDB 2HHTA 3OW2M 3L4QA 4B3MK 2JX2A 2ZZMA 2IRUA 4B3SJ 3EE3A 4O23A 2ERRA 4F04B 1Y64A 2AZ1A 3MM6A 2CJ9A 2DO0A 4RKUC 3IM9A 2IVOA 1X5PA 2VFTA 3FFKB 2R7SA 4DPOA 2OTJS 4WFZA 4FLVA 1QM9A 2XLJA 3NMUA 4OYBA 2E1ZA 3CGIA 3UVJA 4DPWA 4LREA 2R2UA 3VA0A 1L3KA 4CI0B 4CBXA 2KG1A 3M8PB 3FBCA 1CJVB 4X4PA 2CQ2A 4KPYA 3RRHA 4XTTA 2BA9A 2NZCA 1N8RT 2ZH3A 2HFOA 2A18A 3MM9B 2RHQB 2VJUA 3VAFA 1IO2A 4FZYA 2MKHA 1NMNA 5HJYA 4I56A 3FUYA 3CCMS 4IZ9A 2XWYA 4FF4A 5AQUA 2IJRA 1MWYA 1H3DA 2D0PA 5A8WB 4QR1A 4F26A 1N36K 3U1MA 1FFWB 1HX1A 4X64K 3G82A 3FZMA 4I2PB 5C2CA 5KG3A 5F3ZA 4LF4J 4ZVFA 1HBOA 4MK7A 4ZPBA 3HDSA 1LWEB 3D66A 3M2VA 2UVVA 2D0AA 4QOTA 1RJJA 5TKYA 4IO8A 2QEXS 4CI6A 3SAGA 4YDUC 4F2RA 4HDHA 3ZSOA 1EP4B 4U67Q 3VQ6A 4DV6K 4LRCA 3CD6N 3OL9A 2W2QP 2O8DA 2P9LB 1WSJA 3RUBL 5EGYA 2V7YA 2C22A 3CJ8A 4UF4A 3MM8A 2FGOA 4FYXB 3PIOL 2FHOB 1FRJA 1KKHA 1VFJA 4RNNA 2OA8A 4C6AA 3ZETB 5KFIA 2C1EB 5BRHA 1TKXB 5BRFA 1WG1A 3P5TL 3THYB 4OL8A 1RWNB 3BEGB 1RWMB 1BHLA 1Q86T 1J2VA 4TQRA 3CJBA 4DS4A 4N8NA 5FPMA 3NOCA 1JXBA 2I9SA 1Y11A 3U7JA 3M8YA 1WDDA 1F9FA 2PY5A 3M6WA 4IG0B 3C3LA 2BABA 1KR4A 2MKYA 5C42B 1S3XA 4JI5F 2VU5A 3CDAA 4RWXA 3OJSA 5KFNA 2CNNB 3K89A 3D0GE 4JHDB 4ILJA 1NM2A 3KLFA 3NF9A 4HHUA 4MH8A 1NLKL 1RHUB 1F2HA 1FKAF 3R9LA 3MCOA 3GIMA 1SCJB 1F0XA 2RF2B 1IR2A 5C5JA 4CCHA 2DR7A 2G4BA 8RUCA 4PQUA 2A2CA 3RBDA 2BACA 7FD1A 3JAMY 1REVA 5KFLA 3EZWA 4C3KA 3O1LA 4I64A 3CJSA 2KVIA 4FBTA 4CZMA 2W7OA 4KGXB 2DPJA 4DV4K 4NEZA 1U4BA 1X4GA 3MAQA 4F0MA 3PUFA 4CJ3A 1WAJA 3OL7A 3T6JA 2LU2A 2AA4A 3OT9A 2IFXA 1YUWA 3LW5C 2CPHA 4DQRA 4DV2J 3OUYA 2JOQA 3HHKA 5IWAF 3UDVA 3Q83A 1C1CA 4CZHA 1U0HA 3V6DA 3SBGA 1BIUA 4CFDA 3THVA 1FD2A 1RLDA 4OI6A 2FSJA 3W2VA 4DFPA 4HI1A 4HVZA 3TAMB 2KFZA 1XMQK 1OH8A 3KDOA 4RR5A 1FXLA 3Q8SB 3CQ8A 1OVQA 2E2NA 4WFYA 3MEEA 2HFSA 1NZAA 3NCIA 4DUYK 2FBYA 3T9ZA 4ZTFA 3L2QA 2X6NA 4PEOA 1N34J 4I69A 3E9PA 4CEAA 2VIHA 3OSPA 3DOLA 3D4JA 4DG1B 1DQAA 4YP3A 4KI4A 2DRDA 4S0MA 3US5A 4N77A 5LJWA 2B5JB 1W0HA 2N4CA 1BUXA 3FZBA 4PG8A 2DIVA 3S41A 4CZJA 1K9MT 1OPZA 2ZOGA 4C1NI 1PYSB 1TUYA 4TVAB 2RDDA 1VQ8N 4DUYF 1CBKA 2P9EA 1SAZA 4CJPA 1MROA 2OPPB 1BOTO 1N32K 2HKEA 3IGVA 4JYAK 4G9ZA 1AROP 1K8KA 1HBMA 2I1RA 3IAS9 3FBFA 2VBXA 3IN5A 3MEEB 1T94A 4FSVA 3FCWA 4C0OC 4CT8A 1W97L 2I8EA 4ZCLA 5I3PA 4GKJK 3ISNC 1RTJB 2EFPA 5GAHI 2BUPA 1EQ0A 3VF2A 3JXUA 1I94F 4J91A 3MEKA 4GV3A 4KFBB 2V2KA 4HEA9 2PYLA 4IFYA 1W2BR 1MN7A 3UCGA 1UJ4A 1J27A 1KQSR 2HFZA 3S3NA 3NAHA 4HACB 4J37A 4FM2A 2QYGA 4MMOA 1G1XA 4DV1K 4M3YA 1EQYA 2RD5C 1GEHA 4JN4A 2AX0A 2Z1JA 4UQGA 2DGWA 1JLFB 1S10A 4FLUA 4LRAA 3O44A 4GMKA 1EKRA 4QWAA 1AXQA 1TL5A 5M2UA 4KHSA 4A59A 1YLXA 4BRKA 4I9QA 3H42A 1J5EJ 5HRNA 1Q78A 4Y2AA 4XEIA 2RT3A 4DUYJ 2VOPA 3PRDA 2MHEA 1WC5A 4X66F 3MFHA 3U1LA 2AD9A 2K3KA 3KK1B 3HSGA 2KDOA 2JRSA 2O8BA 1LW2B 4A48A 3C94A 1RUSA 1V5VA 3ULEA 2LU1A 2W9BB 2CDQA 5ETNA 2XMTA 1SKSA 5IC4B 5GAGU 4ELVA 2ROGA 2BRLA 2QFJA 2DH8A 5HVHA 5HRSA 4IOCQ 4TU9A 3OXLA 4LSLA 1TL3B 1ESVA 3KHLA 2YTCA 3GIRA 5LXRA 2PMWA 3ZTOA 1JXLA 1VSDA 5F1XA 2WVBA 2ZH2A 3V6KA 4HKQA 3D2FB 3R8EA 1B9FA 2ZUGA 3QFWA 4C7QA 2K2PA 1ATSA 3CJ2A 1VQKS 2YY3A 4JI3J 4M7XA 3CCSS 4CBUA 2FHJA 2GVZB