3IG1A

Hiv-1 reverse transcriptase with the inhibitor beta-thujaplicinol bound at the rnase h active site
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
552
structure length
552
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAISQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase p66 subunit
publication title Structure of HIV-1 reverse transcriptase with the inhibitor beta-Thujaplicinol bound at the RNase H active site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase
total genus 132
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3ig1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ig1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ig1A05
1KHVA 1BI4A 4QOZB 1S6QA 1WNSA 3TAMA 1RT1B 2HVIA 1DTQA 3GIIA 3MF5A 5C5JA 3V9XA 1L3SA 4FJXA 3DRRB 2KZZA 1CXUA 4DQSA 4DTNA 1TKXB 4KB0A 1WSJA 2HHVA 3MEEB 1C1BB 4IH6A 3LPTA 5KFNA 5KFJA 2YNIA 2XY8A 4CESA 1REVA 4TN2A 2F8TA 4G1QB 4DFPA 4PQUA 5JS1A 2AGQA 4BWMA 4CEQA 2FBXA 4M3WA 1GOCA 1BISA 1S1XA 1L5UA 4DG1B 1ASWA 1FXXA 3S3OA 4O3NA 2ILYA 1VRUB 1Y97A 3TVKA 3N6MA 2WHOA 5C24A 1BGXT 3DYAB 4K4ZA 3FFIB 3NH2A 4K4WA 4KHMA 5J2MB 1RA6A 4FLVA 3KLIB 2R7YA 4IG0A 3OL6A 1EKEA 2HMIB 4CJWA 1TAUA 3PZPA 3KNAA 5I42A 3IS9B 1TK0A 2XGPA 2B43A 4Q43A 2DPJA 1NK9A 1YT3A 1QE1A 2C2RA 3H08A 3MR3A 3AVFA 4YR3A 3L2VA 1SL0A 3IRXA 2BGGA 4O3QA 4B9TA 1IKXA 1JX4A 1UA1A 5F8JA 4ED7A 4ECXA 4DFMA 4ZPDA 5C42A 1S1WB 1VSKA 3RRHA 1TKTB 1ZBHA 4MK8A 2D0CA 4KREA 1XC9A 4FJLA 4FZXC 4KHRA 1TL1B 2C22A 3NKYA 4O44A 2OPQA 3OJSA 3C6UA 4EP4A 1LV5A 3QLHB 4F4WA 2O5DA 1S0OA 5SWMA 3H5SA 1WAFA 3IN5A 3QEIA 3MEGA 4RNNA 2GIRA 1VRTB 3CDEA 2UUWA 3V6DB 2VA3A 2D7SA 5CZ2A 1RT4A 5F8NA 4WYWA 3DLKB 4I2PB 2DFFA 2IC3B 3KLGA 3DMJB 4KI6A 2A1RA 3HL8A 2D0AA 3QEVA 4E7IA 3QERA 3KK3B 1IKYA 3VQ7A 3HT3A 2ATLA 3NGYA 3LP3A 1JLEA 3QEPA 3KLVA 2OYQA 3V6JA 1RTJB 1TAQA 3RR7A 3BREA 1WLJA 5J2QA 4IBNA 1R0AB 3VA0A 4H54A 4KTQA 4CGJA 3ISND 4NLTA 3SFGA 3F9KA 2D3UA 1NKEA 3GIJA 3GILA 4K4UA 1U04A 2BRLA 3V81A 4KV8B 4WXWA 2XY7A 2YKMB 4RU9A 2YNGA 2VG7B 1LWEA 4DSFA 3ZT1A 3PW0A 4ELUA 4KHSA 2IS3A 4MK7A 3V1QA 4J2AA 3MECB 4F3TA 3RMAA 5F8LA 4Q8EA 4OGEA 3FQKA 3MXMA 5K14B 3C94A 4RUCA 4ZMMA 3EY1A 4O55A 1B92A 1JKHB 4RW4B 4F50A 5KFMA 1T05A 4CJVA 3DRPA 2HW3A 3KOAA 4E7JA 5KFKA 3NGIA 3PX0A 3AO1A 1LW2A 3PV8A 5KFCA 2PYLA 4F2RA 4I7FB 1G15A 1J53A 1LWFA 4ECQA 4KPYA 3KJVA 1RT6B 3TANA 4O4GB 4IDKB 4OJRA 4FJGA 1KCFA 3JSMA 4FK4A 1RDDA 4TLRA 3BQ1A 2WRMA 4U6PA 1YVFA 2KW4A 1N56A 3MAQA 3K57A 4IFYA 5EWGA 3BQ2A 5KFOA 1RBSA 4ZVFA 5HROB 3OLAA 5HRRA 4DS5A 3M8QB 4K4TA 2RPIA 3VQ5A 5L1KA 1DLOA 4F8RA 2FVPA 4ED8A 2E9TA 4NLRA 4E1NA 2RN2A 3IG1A 3ZSYA 1RBVA 3LDSA 2R8HA 5KT3A 2HHXA 4QCLA 5KFWA 2JEGA 4IKAA 3NF8A 2D41A 4KBIA 1TVRA 5KT7A 2V9WA 3PY8A 4R8UB 4EYIB 1F21A 4M42A 3NF6A 4CF2A 3H4BA 1BIUA 1HQEB 5KFPA 5EWFA 1BQNB 1HNIB 3MEDB 1RCHA 3G6XA 1LW0A 4NLSA 4PUOA 2R2SA 4DTUA 4JV2A 4J2DA 4X2BA 4C8LA 3BDPA 3DI6A 3AO3A 2Y1JA 3PHEA 1S1UB 2HNDA 2BQ3A 4J2EA 4RG8A 1S9GB 3TR8A 2OZMA 2G8HA 1HNVA 4HKQA 3HYFA 1ZBLA 4K50A 3PR4A 3LP2B 2ZE2B 4URSA 2HNZA 1RBTA 3SV4A 2DPIA 3KK2B 3AVBA 4TY8A 2IAJB 4NLQA 5FROA 1RDBA 2KFNA 3TABA 1QSSA 4FZYA 2X6SA 1FKOB 4CF1A 4LSNB 2YNHA 2YKNA 1RA7A 1NK4A 4EZ9A 4M3YA 3QIPB 3HVWA 3OVNA 3DM2A 2PYJA 1ZTTA 1TV6A 1TL3A 3V4IB 3LPUA 2BE2A 1JLBA 3G0ZA 4F2SA 4EP5A 1IO2A 3CJ4A 1VSMA 3ZT2A 2RKIB 2B6AA 2W9CB 3EYZA 1SH3A 1TKZB 4WFYA 1C0UB 3QEXA 3T5LA 4TSXA 5CYMB 2F8SA 1RBRA 1HMVA 4CFCA 3H59A 4U7CA 4Z4FA 3OYEA 1GX6A 3LWLA 3SYZA 1LWCA 1S4FA 5L9XA 2FLPA 2V0NA 5J2PA 4LH4A 1S6PB 3T5JA 5KG3A 3ZT3A 3QETA 4JV0A 4CECA 3LP1A 5KFXA 1RTIB 2R2RA 1RT5A 2IM1A 4CJLA 4N56A 4NRTA 3TAEA 2B5JB 3EPIA 2JLEA 4ZP8A 4ZP9A 3NCIA 3VN5A 4KO0B 4RUAA 1GX5A 5D3GB 3NBPA 4J9RA 1RT1A 4ZHRB 1RT2B 3SUOA 3H5YA 4W5RA 1KHWA 5J2NA 3RB6A 4EBCA 1W9HA 3SV3A 1ZYQA 4N76A 3DRRA 1J54A 2ITGA 4CE9A 3HO1A 4MIAA 4N5SA 1XHXA 1S9EA 1TKXA 1S9FA 1NJXA 3HP9A 4HTUA 4FZZA 3EZ5A 3MEEA 3L2RA 1C1BA 3SNNA 4OPKA 5KFDA 3CJ0A 1QUVA 1JLGB 4G1QA 3V6KA 3I8DA 3RR8A 4Z4HA 4DLGA 4DG1A 2QKKA 5EWEA 1MU2A 4YNQA 2G8FA 1VRUA 4DSIA 4OKEA 4WXOA 3Q8PB 3RAXA 4B9NA 4JLHA 3CDUA 3FFIA 3VQCA 1L3UA 1U4BA 1NNDA 1T8EA 4CGFA 1N4LA 2XO7A 5J2MA 4M3XA 5HLFB 3THVA 4FS1A 3KLIA 3EZUA 1SKSA 3A2FA 3UR0A 1HYVA 1N6QB 2HMIA 3IS9A 3H98A 1S48A 4RNFA 3VQ9A 3I0RA 2VG6B 4DTOA 4DTRA 2J6TA 3E01B 4Z4GA 4H4MA 2FLNA 2B4JA 1JLAB 3HPGA 4E7HA 3CIZA 1RT3B 4FBTA 1WSFA 4K4YA 3KMSA 3T1AA 3RB0A 1CZ9A 4OKJA 1TKTA 4B9UA 1EETB 4MK9A 4BACA 1S1VA 3QGHA 3CDWA 3PX6A 1JXEA 3KHHA 3QLHA 2FBTA 3BSAA 4E19A 2JEIA 4QWEA 1X9MA 1VRTA 4J9NA 3OYAA 3NAHA 1NJWA 3V6DA 3KKSA 2XY6A 4CGDA 2W8LA 4Y34A 3DLKA 4I2PA 4NLPA 4ED2A 3DMJA 3I0SB 1KSPA 1OS5A 3NAEA 3BQ0A 1NK6A 1QS4A 3SJJA 4DSEA 2XRIA 3O3HA 4E89A 4FBUA 3HVTB 3KK3A 5T7BA 1WSGA 4FM1A 3S3NA 4ZP7A 4DSJA 4ECWA 3DOKB 3L3VA 1LAVA 3AVKA 4QWBA 4FJNA 3ZSVA 2F8EX 1TGOA 1SKRA 4CHZA 5DLFA 1RTJA 3AA4A 3HVAA 5HRNA 1R0AA 3DDKA 4CEAA 2UVVA 1NK8A 3V1OA 2CKWA 5HBMB 4KV8A 1FK9B 4JUZA 4BE0A 3QNNA 3T3FA 1BIZA 4OVLA 1D8YA 1JLQB 5HP1B 3OYIA 2FVSA 4B3OA 4KKOB 2HWHA 2RDIA 1WSIA 4F4XA 4ZPBA 4FJIA 4M41A 1RT7B 5C25A 5CY4A 4ELTA 3MECA 1C1CB 1FKPB 4ID1A 1I39A 1D9FA 3H2LA 2JEJA 3L3UA 4Y1CA 5K14A 4MKBA 2D0BA 4LY7A 4AHUA 1JKHA 1A5VA 4RW4A 4CHOA 4CIFA 3VQ6A 3OS1A 5KT4A 2E9RX 3WNGA 2E6MA 3KLFB 4AHCA 4WE1B 5KG5A 1IKWA 1UA0A 2G8UA 1WSHA 4KTWA 4NLOA 4CCHA 4I7FA 1SL2A 3OSPA 2OPPB 4E7KA 5KG7A 2YNFB 1TP7A 3VQ4A 1RT6A 4IDKA 2BRKA 3PUFA 3H4DA 3NF7A 3BR9A 4PWDA 3LAMA 4DU1A 4J9QA 2HWIA 3G86A 3F73A 3ZSXA 1NOYA 2IDOA 4DS4A 4CIGA 3QO9A 3U3YA 5KG1A 3K5MA 3O3GA 4GMJB 3HM9A 3HXMA 3QGIA 2AU0A 3M8QA 2ALZA 3GV8B 2QE5A 4G3IA 3CM5A 1XI1A 3QGGA 4W5OA 1VSHA 2XC9A 2WTFA 4LQ9A 3RMBA 1L3VA 3I5CA 3MFHA 5J1EB 3OYHA 1IKVA 4CF8A 3HSTB 4NLGA 4MFBB 3UPFA 1C2PA 1BHLA 2HVHA 2HHTA 2XWYA 3KHGA 4HUEA 1HYSB 5KG6A 2E6LA 2OA8A 1N5YB 1TK5A 5KT2A 3MFIA 1I6JA 1O1WA 3AVAA 1HQEA 1HNIA 4URGA 5L1LA 1D0EA 4O5BA 3L2WA 3TWHA 3AO4A 4CEEA 1X1PA 4CJTA 4ECSA 5EU7A 3PW7A 5DGAA 1SH2A 5KFFA 4FJ7A 3VA3A 1VSEA 3WNHA 1JLCA 1HARA 1DTQB 1S1UA 4Q8FA 4BWJA 3G6VA 3ISNC 4IRKA 4LSLB 3GYNA 4JS5A 3CFOA 1S9GA 3DLRA 3TAPA 3OLBA 2LSNA 4IQXA 3GIKA 3M8PB 4EZ6A 4Z0UA 3JYTB 3LP2A 4EBEA 4CK1A 4NLYA 1RNHA 5HRSA 1UWBB 4CEZA 2IAJA 4NCGB 3AVHA 2AGOA 3NAIA 3SQ2A 2X74A 1ZBIA 1BQMB 2XCPA 3ULDA 3O4NA 1TQLA 1SH0A 5JS2A 1FKOA 4Y3CA 4J9SA 1S10A 4HCCA 4LSNA 2QKBA 3QIPA 4YQWA 2UUTA 3GV7B 2XI3A 4E0DA 4ID5B 4AHTA 2KTQA 4IG0B 3AA5X 5I3UA 3TAFA 4CGHA 2ZQBA 1KTQA 2RKIA 4NLVA 3RRGA 1QE1B 1QSYA 4Q0BB 2R8KA 4Y2AA 1TKZA 4Y2CA 4FVMA 1U48A 1U09A 3OS2A 3I5BA 1C0UA 2RDJA 3T5HA 4OKKA 4QW8A 4RZRA 4NLUA 5CYMA 4IH5A 1KFDA 1JXLA 3TAQA 4NCBA 3SQ0A 3KLEB 2ETJA 4ED6A 5DQGA 4FJ5A 4M3UA 4IOBA 3KIOA 4LQ3A 2R8GA 2C2DA 4HHTA 3DLGB 3ZT0A 1ZTWA 3VQPA 4IG3B 5E41A 3ZSRA 3PR5B 4OPJA 4XPCA 3V9UA 1HJRA 4DWIA 5KFRA 2B5JA 2FBYA 3ASMA 2ILZA 3BGRA 4KO0A 2W9AA 3CQ8A 3MEGB 3VQDA 5D3GA 3LANA 4DMNA 4IR1A 1RT2A 3V6HA 4CHNA 4IFVB 4CJEA 2IOCA 3VQ8A 4DL4A 4CJRA 3KD5E 4RW8A 1BCMA 4CJQA 4RW7B 4ZPAA 1IKYB 1CZBA 3SUNA 4J2BA 2UVWA 2KZMA 1JLGA 3S9HA 3CO9A 1RTHB 4YR0A 2KFZA 3QYYA 1Z4UA 4I9QA 4FLWA 2GBZA 4DQRA 4WZMA 5J2QB 2V4QA 2YV0X 3N6NA 4C8KA 2E9ZA 3HK2A 4K4VA 3P1GA 4DTJA 5HLFA 4ECYA 4H4OA 5KT5A 1C6VA 3SUQA 4M3ZA 3D28A 4NRUA 4YP3A 3KLHA 1WN7A 5KGXA 3O3FA 5EDWA 3KMQA 3D45A 2VG6A 3DOLB 3S3MA 3ZSOA 2HNYB 3PJWA 3CJ2A 3B6PA 2KQ2A 4F4YA 2OPRA 1JLAA 2JC1A 3B6OA 3DRSA 5CYQA 3OL9A 2R2TA 1RTDB 4FXDA 1RT3A 3AVMA 5KG2A 4O0JA 4MH8A 4RNHA 5F9LA 1EETA 1IH7A 4C8OA 2XCAA 1T05B 3RWUA 1KRPA 3DRPB 3FDSA 2UVRA 4ECTA 3QZ8A 3O4QA 1KLMB 2W9BA 3QEWA 2EX3A 3CFRA 4I9LA 3OYFA 3CYMA 4TYBA 4XIUA 4CEBA 2IM2A 1ASVA 4E3SA 1LWFB 1CXQA 3OYNA 2Y1IA 3KJVB 4B9MA 3MXIA 1EP4A 1QQCA 4CHYA 3OYGA 5KFQA 3DLEA 3KKRA 4AHSA 3QESA 4RNMA 2RF2A 3ITHB 3SUPA 3L2UA 2O4IA 1GOBA 4NYZA 3HVTA 4DU3A 3KD1E 3M8RA 4M3TA 4DF4A 5FRNA 4IFYB 2ZD1A 1SV5B 1B9FA 3DOKA 1CLQA 3AV9A 4ZPCA 4R5PB 4FJMA 3TI0A 4M95A 3AVLA 3TARA 3QNOA 3M9OB 4ED3A 4AHVA 4F4KA 3OYBA 5DLGA 1DTTB 2QV6A 4B9VA 4DF8A 3BSCA 3ZSWA 3T19A 3AVGA 1C1AA 4KFBB 2Z1HA 1RDCA 1RDRA 4HVJA 5HBMA 4HUFA 3M9MB 1FK9A 3ZCMA 4FLYA 1TK8A 4YMEA 2WB4A 4CJ5A 4I2QB 3CG7A 3VQBA 1JLQA 5HP1A 4RW9B 4EYHB 2AX0A 3G6YA 4KI4A 3DYAA 2CJQA 4GW6A 1RT7A 4TXSA 4FJJA 5JXSA 2WK4A 2WOMB 3LWMA 4AH9A 3DI6B 4CK2A 1C1CA 1FKPA 3H40A 5KTQA 1MMLA 1J9AA 2ATQA 2DFEA 4DL6A 2PZSA 2W8KA 3IGNA 4ZVEA 3CWJA 5KFHA 3SQ4A 1HNVB 4HUGA 3ZSQA 2OH2A 4Z4IA 4NYFA 4WE1A 2HNZB 1KLNA 5KFZA 3OYCA 4J9PA 4YFUA 1KVAA 4BDPA 3FSIA 5SZTA 3RTVA 1S1WA 5DMRA 1K1SA 4B8AB 3P83D 2IJFA 4KAZA 4BE2A 1TL1A 2FJWA 1QAIA 1Z26A 5DQHA 4ED1A 1WAJA 4DL7A 5DG8A 4WYLA 4OL8A 3RBDA 4KHYA 1NJZA 4YR2A 2BE2B 2NUBA 1YTAA 1IG9A 3SCXA 4B9LA 4PA1A 4TY9A 3MR2A 4O4RA 1Q8IA 3D0PA 3LP0B 1JXBA 1WSEA 2IC3A 1BL3A 2R8IA 2BANB 4TQRA 1S1TB 5J1EA 5KFVA 3HKWA 4MFBA 4CJ3A 1Z25A 1VSDA 4URQU 1HMVB 4ICLB 2A1SA 1NK0A 3LAKA 1N5YA 3OHAA 1Q9XA 3K5NA 1HYZA 1C0TB 4BDYA 2AX1A 3RMDA 3PW5A 2P5GA 1CSJA 4UQGA 4KAIA 1D9DA 4K4XA 1QSLA 3MTKA 3OL8A 1RT5B 2G8IA 5KG0A 4DTXA 3KK1B 5KFIA 4DU4A 2JEFA 3NBPB 1U45A 3E51A 2W7OA 4KRFA 2YKMA 5J2NB 2X78A 4LSLA 5CZ1A 3OSNA 4CJPA 1S9EB 2E4LA 2VG7A 3KHLA 1RYRA 3M8PA 4LH5A 5DK5A 3JYTA 3VQSA 1SKWA 4K8ZA 1NJYA 1HPZB 4W5TA 3C6TB 1UWBA 4CIEA 1NK7A 4NCGA 4RW6B 3ZT4A 2I1RA 1T94A 2DTUA 3SI8A 4QAGA 3ZSZA 4HCBA 4CK3A 1MU2B 4NLDA 1BQMA 3AVJA 2J6UA 1XR6A 2IM0A 4M3RA 2ASLA 3UDLA 4CEOA 3H5UA 1S5JA 4DL3A 1VSFA 3TQ1A 3HPOA 3NMAA 4ID5A 5F8IA 2G8KA 2IBKA 1SUQB 4DQIA 5FRMA 3L8BA 4FLXA 3QINA 1J5OB 2OPSB 3I0RB 4O4GA 3AVNA 3GIMA 4Q0BA 1IM4A 2G8VA 3SZ2A 4O3PA 1HQUB 4H4MB 4CJUA 2XY5A 3G10A 2WONB 1QTMA 1KVBA 4CHQA 3KLEA 3CM6A 3AA2A 1JLFB 5HROA 4CFBA 1T03B 2HAIA 3MR6A 1X9WA 2AWZA 4F3OA 1S1VB 3DLGA 4IG3A 1RILA 2ASDA 2IGIA 4MKAA 3RAQA 2EHGA 5KFTA 4DL5A 1YVUA 4C8NA 2BDPA 2VG5B 3LALA 1C0MA 3NE6A 5FDLB 3K58A 2XHBA 2I5JB 1ASUA 4R8UA 1KFSA 4IFVA 3P5JA 2HHSA 4H8KA 1A5XA 4Z4EA 4ECVA 2DFHA 4ELVA 4ECZA 1BQNA 1N48A 3MEDA 4M94A 2WCXA 1ITGA 1U49A 1XR5A 4RW7A 4CGIA 3SFUA 4N41A 3OYKA 4ZTFA 1T7PA 1BI4B 1JL1A 3OYJA 3M8SA 1S6QB 1RTHA 3TAMB 3CJ3A 4DLEA 2VWKA 4ZTJA 3I5AA 4FM0A 3OYLA 4XPEA 3Q8QB 5HRPA 3NDKA 4FLZA 5T14A 4R0EA 1XHZA 2ZE2A 3H5XA 2BQUA 2YNIB 3OJUA 3KK2A 5KFAA 4GC6A 1REVB 3NGDA 3HVRA 4PQUB 4DL2A 4EEYA 3RMCA 3HHKA 2HHWA 1S1XB 2XI2A 4OGCA 3DOLA 4B3OB 2HNYA 5C24B 4KHNA 3AO5A 3NF9A 3OY9A 1RAJA 4CGGA 5C25B 2HHQA 1JIHA 3GQCA 1RTDA 2FJVA 4M45A 4FLTA 3IGVA 4FM2A 1NOZA 3V4IA 1GOAA 3NHGA 1TKDA 2VA2A 5I42B 1Q9YA 5F9NA 2W9CA 4FS2A 4QW9A 4Z4CA 5L1JA 2W42A 4J9OA 1VSLA 2FVRA 1ZBFA 4WZQA 1KLMA 2D5RA 4QWCA 3IRXB 1IKWB 1HRHA 3SI6A 4OLBA 1IKXB 4DSLA 1JL2A 5C42B 4FJ9A 4CJFA 4MQ3A 4K4SA 4PWDB 1S6PA 2C2EA 4O44B 1QAJA 1S97A 2OPQB 4JS4A 4EO6A 5DGBA 1W0HA 3C6UB 3ITHA 1RTIA 3LZIA 3QO9B 4CJ4A 3RBEA 3OS0A 4J9MA 1SV5A 4DTPA 4QWAA 4DFJA 1QHTA 5KI6A 2D3ZA 1D5AA 4NCAA 2JGUA 2EC0A 3PJXA 4IRDA 4ZVHA 4R5PA 1RT4B 4ZHRA 3NGZA 4RNOA 3U6FA 1D1UA 3KLGB 1T3NA 4O3OA 1XR7A 3NL0A 1DTTA 1IKVB 4KHQA 1VSIA 3FRZA 3TAGA 2ZKUA 1S49A 1B9DA 2FVCA 4KFBA 2IMWP 4JV1A 4Y1DA 2P5OA 4FJHA 3QIDA 5F8MA 4IR9A 5KFBA 3CVKA 3T5KA 1JLEB 1NKBA 3BJYA 3BSOA 4CERA 3ALYA 4JRPA 1WNEA 4I2QA 3UQSA 3L2QA 4AILC 3DLHA 4RW9A 4FK2A 2F96A 2ASJA 4O3RA 5KFSA 2QXFA 1NHVA 1SL1A 1ZETA 3C95A 2WOMA 4FK0A 5KFYA 3PVXA 4DQQA 1JLCB 4KB7A 4CHPA 3WNEA 3V81B 4EO8A 2FBVA 2BQRA 1N6QA 2JC0A 4FJKA 3PW4A 2YNGB 4E7LA 4GVMA 4FJ8A 1LWEB 3E01A 3Q8SB 4NYNA 4FCYA 4ECUA 5KGWA 2YHBA 1EX4A 3D5MA 2P1JA 3U3GA 1NHUA 3RB4A 3EPGA 1UAXA 2C28A 4KHWA 2R8JA 4B08A 1I3AA 3BSNA 4O0IA 1EXQA 2FLLA 4O3SA 4B8CA 1LW2B 5I3UB 2P51A 4TQSA 1RBUA 4DQPA 3RB3A 4BDZA 4CEDA 5F8GA 3MR5A 3LP0A 2GV9A 5KRTA 4IRCA 4LD0A 3KTQA 3JSMB 3I0SA 4CF0A 4PY5A 2BANA 1S1TA 3N6LA 2FVQA 2AQ4A 3QZ7A 3LZJA 3HPHA 4CJKA 4DSKA 4Q5VA 2YHAA 4ZP6A 3SPYA 5KFGA 5KFLA 2Z1IA 4ICLA 3M9NB 4KB1A 2W7PA 4WFXA 5KFEA 4NLXA 2VWJA 2V4RA 4C8MA 1C0TA 1DLOB 4E1MA 4CJSA 4FLUA 4IKFA 4KHUA 3K5OA 2O4GA 4WFZA 4JRQA 3V9ZA 4XO0A 4Q45A 3IG1B 1X9SA 3BGRB 3PX4A 3KK1A 3OYMA 2IM3A 4F4ZA 2DY4A 1VK0A 4B9SA 4AHRA 1TVRB 3V1RA 3AVCA 3NFAA 5JUMA 4DFKA 3SPZA 2FJXA 3AVIA 2GUIA 3SQ1A 5DQIA 4W5QA 4RW8B 4CFAA 4K8XA 3WNFA 2G8WA 4KKOA 1LW0B 2FC0A 4PUOB 4DTSA 2GC8A 3GV5B 5KRSA 1HPZA 3VQQA 3C6TA 2PY5A 1K6YA 4KTZA 4OLAA 5KFUA 4J9LA 4RW6A 4N47A 1BCOA 4IH7A 5F8HA 3Q8RB 2HNDB 1A5WA 3MXJA 4EBDA 4GC7A 3K5LA 1NKCA 3HJFA 2GIQA 1K1QA 2OZSA 4FYDA 4W5NA 2IA6A 3NH0A 3UIQA 2QK9A 3DLBA 4FW1A 3OHBA 3KLFA 2Z1GA 4H4OB 4FW2A 2AJQA 1SUQA 5L1IA 4TY8B 4ED0A 2Z1JA 3AA3A 2OPPA 4NLWA 3KLHB 4KE5A 2YNFA 1NK5A 1J5OA 4DEZA 1U47A 2OPSA 4KSEB 3V9SA 5DG7A 1RYSA 2X6NA 4CFDA 4BE1A 4Q44A 1RDAA 1L3TA 3OL7A 3ICLA 1HQUA 4NZ0A 4QPXA 3K2PA 2OPRB 2YNHB 2YKNB 2BR0A 3KHRA 3DRSB 5CYQB 4TYAA 2Q3SA 3DM2B 2WONA 2HB5A 3CJ5A 4DTMA 4CEFA 1TV6B 1TL3B 1JLFA 1JLBB 2XGQA 4L8RB 1S0MA 1T03A 3FQLA 4J9KA 3HP6A 3CFPA 5KT6A 1S0NA 3OYDA 3PO5A 2B6AB 4ZVGA 4HYKA 1XWLA 4MIBA 3VQAA 2J6SA 3VQEA 2W9BB 3PW2A 3K59A 1YTUA 3NH1A 2VG5A 2R2UA 3PO4A 5FDLA 3QIOA 2I5JA 3AO2A 1ZBUA 1HYSA 1EP4B 2HHUA 5DG9A 1KVCA 3IAYA 1LWCB 5KG4A 1VSJA 2IJNA 1W25A 3DLEB 5J2PB 4ECRA 1UOCA 5EUHA 2RF2B 2UVUA 3LP1B 2AGPA 3V9WA 1LAWA 4QWDA 2ZD1B 4CF9A
chains in the Genus database with same CATH superfamily
4KT0C 1H2VZ 2AA4A 2GMHA 5BR8F 1R43A 1RACB 1IR0A 2DRAA 4GO7X 3MF5A 3V9XA 4FJXA 2P9PA 4DTNA 1TKXB 1B0VA 1GLBG 3CULA 4I64A 3LPTA 2YNIA 2H1YA 2F8TA 1REVA 1GMWA 1V9OA 3KJQB 2ASOA 3BPDA 5JS1A 3P5TL 2AGQA 4M3WA 3X3UA 1H7WA 4FF2A 3OBYA 2DGVA 3S3OA 2FD2A 4JYAF 3TVKA 2Z8QA 4IOAQ 3D4JA 2E88A 3DYAB 2MZQA 5I9EB 4DU8A 3ZZPA 3PFOA 2KRBA 4K4WA 1VHIA 1RA6A 3BO2A 4LRFA 3TZWA 4FLVA 3KLIB 4A5AA 4JI1K 4CJWA 3IR7B 3PZPA 3KNAA 3CJBA 5I42A 1FE4A 4Q43A 1DURA 2XNQA 1UL3A 1QE1A 5L38A 3H08A 3WC2A 2X7IA 1SL0A 3L2VA 4S0MA 3NMUA 5U47A 4O3QA 4BRKA 2IVPA 1IKXA 2QYCA 4W4MA 2YPYA 4ED7A 4ZPDA 5C42A 1NH7A 3R1LA 1F6TA 3ZFVA 3RAMA 3ENQA 2JVRA 1TL1B 3K0SA 3R5JB 3DGPB 3OJSA 3ENWA 3CCMN 1LV5A 1YQHA 4ZJQA 1OKJA 3RVCA 1TYQB 1FEHA 2D3O1 5SWMA 1FXDA 1HWKA 3TJ8A 5F3ZA 3LTOA 5IT4A 1VRTB 3AAQA 2CG4A 2VA3A 4X62J 1RT4A 2MMYA 2QL7B 3DLKB 5F8NA 1R27B 3SIPB 2PFFB 1SIWB 5HO4A 2B4OA 4USJC 4CNZA 4WKRA 3VEOA 3MTJA 3EXYA 4B3SF 4UOCA 5AQFA 4JK7A 3QERA 1IKYA 1VQ7S 2OFHX 3N01A 5GMDA 4CH1A 3NGYA 3QT7A 5KQDA 2HBMA 1JLEA 2XS5A 3CD6S 2IRYA 1A0OB 1TAQA 4P7VA 3BREA 1WLJA 3N5FA 1PYOB 4CGJA 3F9KA 3FZLA 3JS6A 2LEPA 1BXNA 1NJIO 4ISFA 4BRIA 2BRLA 3M8YA 2VPYB 4RU9A 5IV4A 1SI9A 3RU0A 4FWOA 3LO3A 1VQYA 2ZC4A 2P9LB 1LWEA 1ZA2B 2A3ZA 4DSFA 2RRBA 3PW0A 5CZXA 5LMNF 3BBFA 4KHPK 5LSRA 3P49B 4F3TA 5KOXA 3FFKB 2BTFA 4RKUC 2I0XA 3MXMA 2DEIA 2LEAA 4BVPA 5K14B 3R5BA 2DIUA 2L9NA 7FDRA 5IC6B 1YSJA 5KFMA 2CQ0A 4M8LA 5L8RC 2AJ1A 5LM7E 4E7JA 5KFKA 1RZMA 1ILYA 1KQSR 3CCEN 4GV9A 1LWFA 2BKPA 2W2QP 3QMQA 3DRYA 2VOOA 3DXKA 3CF5L 4DX5A 4OZLA 4OJRA 4FJGA 1KCFA 4U6PA 1NDLA 3I9V9 1W7WA 4J5OA 3TTDA 2VPXB 2HFUA 1OH5A 4ZVFA 4K0KF 1VISA 3IWNC 5L9NA 2JZ5A 4W92B 4K4TA 4A59A 1N36F 1IVZA 4H0PA 4F8RA 3L09A 2HBJA 2FVPA 2ZF5O 4KH0B 3HT0A 2VGMA 2VJVA 2RN2A 3QBCA 4LRCA 1PCAA 4ZVRB 5KT3A 1CC8A 4CYUA 4DV6F 2YKPA 1EKRA 4QCLA 2JEGA 1J6ZA 4DPXA 3EVOA 4AQYF 3NWRA 4EYIB 4M42A 3J81U 3H4BA 4CF2A 1W2BM 3EKUA 1RCHA 2QC3A 4XAKA 4G1PA 3MMCB 2AEJA 2GX9A 3DI6A 2CUYA 3AO3A 5LMUF 4JKCA 2B51A 4J2EA 4RG8A 5A8RA 2A5XA 4PR6A 3TR8A 2HHPA 2OZMA 4BS2A 1VCTA 3BS9A 2P9NB 3HYFA 4CLYA 3WT0A 3DJCA 1WC0A 3LP2B 1M5SA 2ZE2B 4LF7F 3SV4A 3AVBA 1NRKA 3IR5B 4DR4F 2HFVA 4UOFA 2IAJB 2D9PA 2RQ4A 1U0SA 2KFNA 1RDBA 4JI0F 3CHWA 3RBXA 4FZYA 5G0RB 1FKOB 3EZWA 2YKNA 2CPZA 4U7BA 3JAMY 2DB1A 2R3VA 1WTBA 1UVNA 3MAAA 2PYJA 2OFGX 1ZTTA 5LSLA 1TL3A 2Y8WA 2BE2A 3EDQB 4J90A 3IM8A 4LF4J 1IO2A 4YB1P 3CJ4A 1T9UA 2WBRA 3R9PA 1U1QA 2E2QA 1VK3A 4DCPB 4WFYA 1BOTO 2FPHX 2Z58B 4B3MJ 3T5LA 3G4SN 1RBRA 2RNEA 4U7CA 3OYEA 1GX6A 1R7IA 1Y00A 1SCJB 1YG0A 2H5IB 2CIMA 2GQ2A 3R6LB 2OTJN 4BCAA 2IRXA 2V0NA 2CQPA 5ADZA 4CBUA 1S6PB 4WPAA 4JV0A 4CECA 4FN5A 3EXCX 4NRTA 3P31A 3BM7A 3UKUB 2RT3A 4DV4F 1V4SA 1WOOA 3AGRA 4C7QA 4J9RA 1HI8A 3SUOA 3OV7A 5J2NA 2VPWB 1HKAA 4CE9A 3HO1A 1YHQN 1ZAWA 4MIAA 1YBTA 2MLYA 1HWLA 1TFYA 1S9EA 5J1NA 2FGCA 3J7YP 1Z2LA 1CULB 1TKXA 1WC4A 1S9FA 1NJXA 1A6LA 3HOSA 2RHQB 1TUWA 5MLCQ 1XNQK 1WOPA 4E2FB 1TL5A 3A1YG 4YY3J 3ZEUB 3V6KA 3RR8A 3HHLB 2DNRA 2EI5A 4DLGA 3U9ZA 2CQ3A 4YNQA 1F2GA 4Z2XA 3CJSA 4CZEA 1XNRF 3R8YA 2QWNA 2EVZA 4TU9A 3J81j 2EFOA 3KLIA 2XZTB 3EZUA 2VIHA 3A2FA 3UR0A 1HYVA 2R7SA 2F4VJ 1R8BA 5CR4A 4RNFA 3R3LA 2FY1A 9RUBA 2ZHOA 4AXJA 2HMPA 3Q7BA 3VPZA 2BW2A 3CIZA 4WBFA 1RT3B 2NZTA 4K4YA 3KMSA 4FKXA 2P9CA 3O9UA 3OQ2A 4DV3J 1FJGK 2DBBA 3DGPA 3CDWA 4NXNJ 4L3QA 3KHHA 5BYQA 1TYQA 4CI6A 3SBMA 1VRTA 2VQEF 3OYAA 3NAHA 1UTAA 1U8SA 4Y34A 2KHOA 3DLKA 3HHLD 1BC6A 4NLPA 4ED2A 1DFDA 1KSPA 3QB0A 1K44A 3NAEA 3O1LA 1I5OB 3HHLC 1HBOB 4E89A 1F9FA 4OHWA 5T7BA 3S3NA 1SXLA 2RU9A 4V19X 1QUPA 5GAEU 3L3VA 4QWBA 2V2VA 4FJNA 4U8VA 4KJIA 1IJEB 1PC4A 1KD1T 2B3TB 1SKRA 1GLEG 1HKCA 1VFJA 1XTZA 2E1PA 1N33F 2ALYB 1RE1B 1SPBP 4EGLA 2QFIA 3AJDA 3M7VA 1C0FA 1FDDA 4UZCA 3ZZZA 2P9LA 2RDIA 2GHWA 2XHCA 4QIEA 1G4CA 1OPIA 5A2QU 1C1CB 1FKPB 2K7JA 4DV0F 2NPIA 3G8QA 1N5QA 2DGOA 4PKDB 3WQTA 2JEJA 3L3UA 4Y1CA 5K14A 1VQOS 4MKBA 1PIEA 1CS4B 1A5VA 4F3MA 4AL7A 2LKZA 4CHOA 4CIFA 1IM6A 3I56S 3O08A 2J9DE 3WNGA 2VBXA 4RX6A 4C1NK 1UA0A 3CIPA 4MKVA 1WSHA 1KQGB 3LM2A 2XLJA 2IPOB 4NLOA 4ZKAA 5FLXY 2DHAA 4JI5K 4E7KA 1TP7A 2HFNA 1Q7LB 1NAQA 1HHSA 4ZLNA 1HNXK 4PWDA 2VQFF 2E5LK 4LFBK 2ZC3A 4ZN3A 1XMOK 2IDOA 2AKWB 1FWPA 3DN9A 3OVSA 3O3GA 3HM9A 4GMJB 1QQOA 3HXMA 1XI1A 2NSCA 1JWWA 4HEA9 1WEZA 3SK3A 4CM2A 5K8MA 1VQPN 1P8GA 5JLHA 2V68A 3U4LA 3N4QA 5C2FA 1IKVA 4A2BA 2GZOA 4CF8A 4PG6A 2LEBA 2G4BA 2XWYA 4LF6F 3KHGA 4LF8K 2F40A 3EM1A 1HYSB 4Y0WA 1LK5A 1N5YB 3BYRA 1N8RO 1O1WA 3AVAA 1RWMB 5MLCV 1Y0HA 2ADCA 2GWJA 4O5BA 2XS2A 3PJ9A 3AO4A 1KDNA 1O51A 4YHHF 5EU7A 1U25A 4UY8O 3VA3A 1FX4A 1JLCA 1DTQB 2RUGA 3AQPA 3L95X 2QWOA 4I69A 3ISNC 4IRKA 4HL9A 3GYNA 4ILGB 2IRUA 3TZYA 3TAPA 4XH1A 1U0HA 1QVGR 3I87A 4LC9B 1DAXA 1S72S 4F26A 2P9NA 4KHPJ 1K73O 3KWGA 3JYTB 1OY8A 3LP2A 1E4FT 4D3HA 2W6KA 4DR2K 2IAJA 3VAJA 4U67L 3OXGA 4JD2A 3AVHA 3SQ2A 3W1YC 2JL9A 1ZBIA 2KYXA 2XCPA 1HBMB 3FLCO 5AZIB 1TQLA 3S01A 5G0RA 3J7ZO 1FKOA 4J9SA 1Q81T 1O8BA 1S10A 4P9SA 1AUDA 2NLWA 2QKBA 3ENVA 1U1NA 4PPDA 2UUTA 5AZJB 3GV7B 2QG9B 4AHTA 4P73A 2DYAA 2KTQA 5TKYA 2CXEA 2W2OP 3TAFA 1VQ8S 2WB1D 3L3CA 3NGUA 1FXLA 4Q0BB 2R8KA 4Y65A 4J8FA 2ZFHA 5DM6Q 1RBAA 1NMDA 2MTLA 4X4SA 2CQIA 3K89A 3BZKA 5EGYA 2UU9K 2ETJA 2A6AA 3X1LB 4I1TA 3KIOA 2R8GA 4R25A 2HBZB 4BRGA 2QMWA 4RO0A 4KGMA 3V9UA 4CZHA 4DWIA 2FBYA 1I51B 1FFGB 2W9AA 3UKUA 2Z2YB 3GMGA 4OZJA 2JWKA 3CQ8A 2VC1A 4LFCF 4DMNA 2IIRA 5AR0A 3D0IE 3RSEB 3OVAA 5E3RA 5HMXA 1CJUB 1CULA 3QT8A 4QR2A 2M7SA 1NGGA 3JQKA 5I4MA 3SUNA 4J2BA 1YAGA 3ZEUA 3HHLA 3CO9A 2CH6A 4FWRA 2MQPA 1RU1A 4I9QA 4FLWA 4A4JA 5J2QB 2QSWA 3QT6A 4C3MA 4FDFA 3B8HA 1R0CB 3S7RA 3P1GA 1YZ6A 3HHNB 4CLKA 4CZFA 2HQGA 1C6VA 3SUQA 4M3ZA 1UVLA 2CFXA 5AQLA 4BLGA 4FNHA 5EDWA 1MN7A 4JV5F 4ISEA 2CPXA 3B6PA 2EW9A 2OPRA 3BF3A 2DHSA 5E2QA 3DXSX 1RAGB 5AQRA 2JC1A 1IJFB 3DRSA 2R2TA 4B3TJ 1RTDB 4FXDA 2BJDA 1RT3A 5RUBA 3CCTA 4RNHA 4A8XA 5CAAA 5F9LA 2MQ8A 3IWLA 4I4BA 4WFBQ 3CETA 1KRPA 3DRPB 1JJ4A 4ECTA 3AJ1A 1NSAA 1QM9A 4FL9A 3CFRA 2LQBA 4JI7F 5ETNA 4OZ5A 2VOPA 4CEBA 5LOQA 1V5IB 2Y1IA 2MKHA 3T41A 2XMWA 2ZZTA 4WFNL 1IBCB 1VOMA 1WTFA 2C3UA 2CPJA 3JQJA 3L2UA 1GOBA 1GTHA 3KD1E 3M8RA 4DF4A 1X4BA 4FF1A 2MB0B 2QL9B 1Q7YO 2LU2A 2IVMA 4ZPCA 4H0YB 1KWMA 3CCUS 4M95A 3D2EA 1H73A 4DR6J 1ZC6A 3QNOA 3AOBA 4RJVA 3R27A 2IVOA 4ED3A 3MN6A 2L48A 4DX8H 4C23A 1YWXA 1NU4A 3ZSWA 1XNQJ 4XEIA 1HQ2A 4OHYA 1YI2S 2XSFA 1RDCA 4DR3F 1YGYA 3D0GE 2B7CB 1Y5IB 2XLKA 4J91A 3ZCMA 3WXLA 5C12A 2F3JA 2WB4A 3VQBA 2BH1A 4RW9B 3UO0A 3A3NB 4EYHB 4OYZA 4FJJA 5JXSA 2WK4A 2WOMB 1DT9A 4CK2A 1C1CA 1FKPA 4WJBA 5KTQA 1Q86T 4IZ9A 3DLLL 2DGSA 4FKYA 4ZVEA 3UI3A 3TSUA 3CWJA 1KVIA 5J1PA 2G2OA 3O9TA 4MJKA 2GX8A 4HUGA 1SJQA 1QZ6A 3TUJC 4HH1A 2HNZB 2NXUA 5LL6Z 1RHMB 4YFUA 2IVYA 1HA1A 1X5OA 3M6GA 5DDOC 2IJFA 1YRXA 2CZVC 1FJGJ 2RAQA 4KH4A 4KAZA 1K9MT 4MYTA 1U1KA 3FJ2A 2Z30B 5DQHA 3N79A 1J5EK 1FW6A 1XEZA 3CE8A 4ED1A 4DL7A 1DARA 4WYLA 2FF3B 1UVJA 5FIIA 1VQ4N 3CPEA 3IBFB 4YR2A 1IG9A 4B9LA 3SCXA 4PA1A 3MR2A 4O4RA 3D0PA 1NPKA 1PJ5A 2KHCA 3FGVA 3GBTA 1JXVA 1S1TB 2E1RA 3JTNA 3I82A 2DXEA 2VODA 3SCKE 3FZ2A 4CJ3A 1Z25A 3VEXA 1HMVB 5AQKA 3H8YA 3D6HB 1N5YA 3OHAA 2B9YA 4JI3F 3PW5A 4LRDA 5E33A 2IVFB 1CSJA 2QIFA 1YJRA 4X4OA 4DTXA 3BF4A 1VQ6S 2BJ3A 1SQEA 5KFIA 3E51A 8AT1B 2Z0GA 2UUBK 3WUHA 5CQGA 4KRFA 2DR8A 4FOEA 2Q6BA 3KHLA 5T41A 5DK5A 4BR2A 1S6OA 2B7BB 3JYTA 3MWPA 2MDAA 4R0JA 4X4UA 3C6TB 4PWUA 4CIEA 2E1AA 4IOCL 1UKUA 2M3DA 5E7OB 3RRKA 3IUCA 4QAGA 2LA6A 4HCBA 4NLDA 1HBMA 5AZIA 3FUYA 2ASLA 2CJBA 4CEOA 4JI8K 3H5UA 3MMAB 3BV8A 5BYSA 1H2UX 1VSFA 5B0AA 3HPOA 2IBKA 5BJRA 3CCVN 3W63A 4FLXA 2NZCA 2U1AA 5HMZA 5B7WA 1M90T 3C6HA 2HWTA 4Q0BA 4DMZA 1RP5A 4ZVOB 3RYLA 1XMOJ 1HQUB 4DHYA 3HFKA 4ANDA 3B6BA 2FJAB 3OBWA 2DR5A 5HOOA 2Q66A 2XY5A 4OX6A 2WONB 2JWLA 2XULA 3SXLA 1QTMA 1KVBA 2AV5A 4H0TB 2F65A 2H65B 4OI0A 3UDEA 5HROA 1BLUA 3DFEA 3MR6A 4XDDA 1FKAF 1VQKS 2AWZA 4L3KA 2IGIA 3DXMB 3P45B 1KP6A 4DL5A 3JS9A 2NYHA 2BDPA 4LF8J 1JJ2R 2LMIA 3B82A 2HFSA 4MYUA 4BR7A 3P4IA 3BGUA 4YOVA 4R8UA 2HAFA 3RSEA 3O1BA 2DFHA 5DZ7A 1RCXB 4ECZA 4M94A 1CJUA 1ITGA 3TTCA 3PYGA 2AJ2A 1KNZA 3AH6A 3O9SA 4XH4A 3SFUA 2R7VA 5D0EA 1HLWA 3OYKA 1NNEA 1D4XA 1W7AA 3AT1B 2MZTA 3MPDA 1XHZA 1UEUA 2YQ1A 3TQEA 4BBYA 4DR2J 4PG5A 3BKFA 2W4DA 4PQUB 4DL2A 3LDLA 1SVDA 4B3MF 3ELHA 4KHNA 3AO5A 2R4FA 4GKJK 2M70A 5C25B 1JIHA 1B64A 1V6HA 4C2MA 1RTDA 4M45A 3CCSS 3QBXA 4FLTA 2KL8A 5IXUA 1GOAA 4OJHA 2XEXA 3M1VB 4IEEA 3L6QA 2CVEA 2PI4A 5F9NA 2W9CA 3LW5C 4KGVB 3MX5A 3EKSA 5B09A 4J9OA 4GMKA 1ZBFA 3THXB 2UXCK 3TVZA 3VETA 3CERA 4P74A 2D5RA 3IRXB 2HQCA 4MDBA 4I0WA 1HRHA 3WEEB 4ZDNA 2UU9J 4FJ9A 2M88A 3CCJN 5H9EK 3LGMA 1FERA 4EO6A 3IBCB 5DGBA 1W0HA 3C6UB 4AD6A 1JJCB 2HK2A 4WP9A 4YY3F 3NP5A 4Y28C 4DTPA 4F25A 1QHTA 2FSJA 4JAXA 4A8SA 1I94K 2LQ8A 4ZVHA 2MY7A 4ZHRA 1WKJA 4WQ5C 1ZS6A 2VFRA 4JI2K 3L7UA 2C3OA 2GAGC 3UDVA 1YJVA 2WUSA 5IT9Y 2ZJRL 1FCAA 1PJ6A 2Q2RA 1B9DA 5BPMA 2BUNA 2FVCA 2IMWP 4Y1DA 5LJ5Y 5HI7A 1NKBA 5M2PA 3SBGA 2QL5B 1SQKA 4AILC 4RW9A 2F96A 2ASJA 4NYOA 4LR9A 2O01C 1CC7A 4IUFA 4N8NA 3C95A 2WOMA 2GS8A 2QX0A 5KFYA 4NOHA 3PVXA 4KB7A 2CJXB 4O8UA 3R2CJ 4EO8A 1IBKF 1N6QA 4MT1A 3D0HE 2JC0A 4QZVB 5TKWA 4E7LA 4TKTA 4FJ8A 3A8KA 4B02A 4H0VB 4LR8A 1Q82T 3SQOP 4LF5K 4FCYA 1WC5A 1WEXA 1RLCL 1KONA 1EX4A 3D5MA 1IBMK 3SSQA 4M5LA 3TOQA 4DKWA 4IDHA 1E3MA 4KHWA 1YRTA 2XSJB 5GAGP 2XYHB 1I3AA 2QTDA 3BSNA 1EXQA 3FMBA 3VQTA 3UN3A 4O3SA 4NEZA 1LW2B 2WSCC 4DN0A 4IOAL 3BBCA 5I3UB 2VKZG 2P51A 4DQPA 4CEDA 2GV9A 4IRCA 3JSMB 3SSSA 3BGFA 4PY5A 3VAIA 1S1TA 4I6MB 5E0OA 3QZ7A 3HPHA 4CJKA 1WSRA 4A8MP 4P2MA 5IQ6A 2W7PA 4DV5K 2F5GA 3FR0A 5E5NA 1DLOB 1S0VA 4KHUA 1WHYA 5GVQA 3P5BP 4JI1F 2VASA 4IWVA 2IM3A 1NDKA 4ISGA 2DY4A 3AA9A 1VK0A 5G4DA 5IWAK 2AJ4A 1R6YA 2HFZA 1TVRB 3G9CA 3CTRA 4WF9Q 3AVCA 2E7XA 4C3KA 3O6QA 1VQ7N 2FJXA 3U8XA 5DQIA 4K8XA 1BA1A 3WNFA 4B1YB 1WI8A 2FC0A 4PUOB 2EKYA 4NX9A 3C6TA 3GOIA 2ITMA 1PKUA 3FZHA 4ZIWA 3M4XA 4KTZA 2F7VA 4J9LA 2BE7D 4OZNA 4N47A 4ZVUB 3Q8RB 3HJFA 2RQKA 1LK7A 2GIQA 1GMUA 4K0KK 1K1QA 2YWKA 2UP1A 4BC7A 4A46A 3NY0A 2IA6A 5C2GA 3RGIA 2VICA 3MMAA 3DLBA 4FW1A 4HHJA 2GNKA 3OHBA 3LQVA 3KLFA 2L3MA 4H4OB 4ED0A 3AA3A 3KLHB 4KE5A 4I6YA 4HWIA 1U47A 4DEZA 3GFZA 2OD6A 4KSEB 3V9SA 4JNEA 2X6NA 4CFDA 1HQUA 2NRWA 3M6UA 2FJBB 1U2FA 3TA0A 2R7RA 3T6JA 4ZN1A 2WONA 3AQOA 3CJ5A 1JLBB 2XGQA 5L46A 1PC5A 1S0MA 3FQLA 4NZ7A 5KT6A 3OYDA 1PYTA 2VH7A 3PO5A 4HYKA 1HLUA 1RSCA 3TUPA 1KQKA 1YITS 3DXMA 2J0QD 2JFKA 3VQEA 5K9FA 2NPFA 2MJUA 4F4AA 2KXHA 2R2UA 1OQ3A 1KOOA 3Q0AA 1NGHA 3DLEB 3G25A 2HZCA 5GADI 4FWPA 4ECRA 3J7AP 3PIPQ 2MPUA 4AYBD 2UVUA 1RABB 3NGRA 3QRRA 1FF2A 2EFNA 2AGPA 1LAWA 4QWDA 3QWUA 4CF9A 5GIOA 1X4DA 2VFVA 3MUMP 1KHVA 4QIGA 3BR8A 1U8WA 4QOZB 2CDQA 4O0NA 5K20B 2KZZA 4BQLA 2JRSA 5DETA 4DQSA 2JWNA 2Q36A 4WQ5A 4BC4A 1QDUB 1C1BB 2XMMA 1U26A 2X3GA 1UJ5A 3HCXA 1X4HA 2RJZA 1Q18A 2ZDPA 3CCLS 4DFPA 4PQUA 3VGLA 4BWMA 2NRTA 3OFGA 2DCLA 3PM9A 1U2VB 2DGQA 2U2FA 3FFIB 3T9ZA 3T9NA 2QWRA 1KS2A 2MKSA 2PFUA 2V8HA 3HZGA 4JI4J 1FTCA 2R7YA 3VGMA 1EKEA 3IFEA 1TAUA 3M1VA 2CQGA 1TK0A 3SMSA 2B43A 1NK9A 5AQGA 1TL4A 3EX7B 3MCAB 1U1LA 1S57A 3MK6A 3AVFA 3DLJA 3WIUA 3THXA 2EC2A 4QIWD 3IRXA 3US5A 4WQ4C 2MKKA 1DQ8A 1SB6A 2CPDA 4B9TA 3THTA 1UA1A 1JX4A 2PFDA 1HD1A 1SC1B 4ECXA 1S76D 1S1WB 1VSKA 1NSKL 2O8FB 1TKTB 4H0XB 1ZBHA 5F0XA 4FJLA 3QNWB 4FZXC 4GVBB 3ATUA 4CZGA 3C6UA 2NRRA 4ZCKA 3MM8B 5CHCB 5H9FK 3QLHB 2OO4A 1S0OA 4OHZA 3EVWA 3R6GB 2RILA 2D7SA 3PYDA 3NWGA 2NXNA 2CQBA 4KI6A 2VPZB 2A1RA 2LP4A 2W01A 4BR5A 4E7IA 4Y0FA 3KK3B 4LFAK 3W3DA 4CP5A 3VQ7A 3FZBA 1I1GA 1VQNN 4YB7A 3QEPA 4CH7A 4GRSA 3H3NO 3THYB 2LDIA 1U2CA 3F44A 3SCJE 4K43A 5CE3A 4OZ0A 4KTQA 3D6RA 1EO1A 1M1GA 5DJBA 2RVJA 3T1HJ 2Q97A 3GIJA 3GILA 1KC8O 4M63C 3HTVA 3PDNA 1LFWA 3KYLA 5F41A 2VG7B 5EHHA 1OH8A 3ZTRA 1HR0J 2QYGA 2IS3A 4MK7A 3MECB 4EFHA 5F8LA 1HHQA 1FA0A 3CJCA 4IFEA 2CRLA 5BR8J 1AFIA 3C94A 2V8GA 4DJBA 4FWSA 1B92A 2XSJA 5CABA 4F50A 1T05A 4CJVA 5HSPA 3CPWM 1NDCA 3ZTPA 1NGEA 1LW2A 1EWRA 1DZ5A 1RK8A 4CLFA 5KFCA 4F2RA 4I7FB 1RWKB 1RADB 2ZH8A 1GH8A 4DV7F 4KPYA 3KJVA 4O4GB 2LQ5A 4USMA 1GXTA 2I7PA 3JSMA 4DXLA 4I6MA 3ZX0A 3BQ1A 2WRMA 1Q4RA 1XNQF 4JYAJ 3TRGA 3M8WA 1R3NA 1N56A 3WXMB 3K57A 4IFYA 1RBSA 2N4CA 4HHHA 3GG4A 2AZ1A 2DHHA 1P8ZA 4DS5A 5HRRA 5JLFA 4HTJA 1QHAA 1FJ7A 4JI2J 1DLOA 3VAHA 1M0SA 1U02A 5ELZA 1MWMA 2YQ3A 4BR0A 2M2BA 3D54A 1NGFA 1Y10A 4USTA 5KFWA 4IKAA 3NF8A 4KBIA 1TVRA 1R0BG 3PY8A 2GJIA 1X4CA 3NF6A 3R8EA 3CC2S 2IJRA 3CDBA 1ATNA 2V2QA 5EWFA 1BQNB 4DUZK 4PUOA 4IYQA 3R5CA 4BRQA 1U7LA 4JV2A 4J2DA 1NWKA 4X2BA 1VC0A 3BDPA 3HFVA 2CQCA 2IA0A 1YUWA 4H0OA 3EL2A 4FXWA 2HS0A 3HD1A 1FJGF 5BN9A 5CHIA 1S1UB 3CMAS 4Z7CA 4NYPA 5HK4A 5EXWA 2D3OR 4LUBA 2ZZMA 1SKUB 1HNVA 4H4KA 4HKQA 4LF5J 1ZBLA 4V1Ak 2PN6A 4B3SJ 1EAYC 4URSA 3KK2B 3AHPA 1UEVA 4NLQA 1CQMA 3CJRA 1WACA 3KZBA 2EG2A 2F8HA 1QSSA 2EEYA 3OTEA 4EMDA 3ZX3A 3PSIA 4CF1A 4LSNB 5DDQC 4DPWA 4EZ9A 3QIPB 4V19S 2G9OA 3OVNA 2YTCA 3V4IB 3LPUA 1JLBA 4DL0C 3G0ZA 2W24A 3IFRA 4Q7AA 3ENOA 3PHTA 1M5PC 4LT6A 4NLCA 4BRNA 3U9DA 4TSXA 1HBNB 2M4MA 3W8PA 3JTOA 5LMNJ 2PEHA 3PEHA 4B1UB 3H59A 4CLWA 4Z4FA 4WQ4A 1S4FA 2OD4A 4GVLA 3S41A 2ZNZA 3A5NC 4LH4A 3MDQA 5HL7L 1RTIB 2O8EB 3VESA 1RT5A 2IM1A 3GR1A 3TAEA 3EPIA 4ZP8A 2HYIB 4KO0B 2C3MA 1GX5A 2K7KA 1BA0A 5D3GB 2GHVC 1KHWA 1W9HA 1ZYQA 1WHXA 5LSOA 5AQIA 2ITGA 1J54A 1P9QC 2RMLA 3GFHA 2BJ1A 4KPCA 2QLBB 3POTB 4LVNP 1RWNB 4IEIA 4HTUA 5D4OA 2ZEJA 4JI5F 3M2VB 3LUYA 1U1RA 1C1BA 4OPKA 5KFDA 2QTWA 3PRDA 1HNXF 1M5KC 3HKZD 2L41A 4LFBF 2E5LF 5AE3A 3U1NA 4K0KJ 2WVBA 2QM1A 1XMOF 1U2VA 4CZJA 3O9RA 4OKEA 2KXFA 4WXOA 3Q8PB 1EB0A 1ZPWX 3C15B 3CDUA 3FFIA 3LH2S 1NNDA 4CGFA 1N4LA 3TP2A 3E1YA 1MNEA 3KDOA 1MG7A 2ZZNA 3THVA 4FS1A 4DV6J 1ZZNA 1HBUA 2DNPA 3KG4A 3H98A 4I56A 2XTJP 3I0RA 3CCQS 4DTOA 4A8OA 4DTRA 5HANA 3E01B 4H4MA 4M63A 3A8YA 4LF8F 2GHPA 3OFFA 3HPGA 3ILOA 3PXGa 4BRAA 2GVDB 5LMUJ 3RB0A 4OKJA 1TKTA 1AA1B 4MK9A 4GVBA 3O8WA 3A12A 3KJFB 3QGHA 1SZ2A 2MLZA 3MD1A 3UCZP 3MM8A 2HZAA 3QLHA 1WBDA 1Y11A 3BSAA 4E19A 1VQ8N 2LCWA 2NQPA 4IO8A 4K5SA 3UVJA 3W61A 2DNGA 4LF7J 2P9UB 1X60A 2BX6A 2QWPA 4H03B 3CMQA 4JI0J 1OS5A 4DR2F 4DSEA 1AYEA 1OY6A 3O3HA 4FBUA 3HVTB 3KK3A 1WSGA 2ZH1A 4ZP7A 5DO2A 3IMXA 3F5TA 1N5SA 4FF3A 3AVKA 3VV2B 5DM6L 3V4MA 3ZSVA 2L9DA 5THWA 3THYA 5E3AA 3ET6A 3CC4N 3UN5A 1QQNA 4M5DB 1NU0A 2FF6A 1RCOB 5D0RA 3D1OA 3C65A 2DRDA 1WF0A 1Y64A 2HQIA 4Q2MA 4ES2A 4USVA 2CAJA 4CEAA 2UVVA 3V1OA 3H90A 2A40A 5HBMB 1H74A 5FPDA 4L3NA 2YH1A 4P2FA 3QNNA 2XB2D 4OVLA 1D8YA 3ZETB 2A6OA 2FVSA 3LPYA 4KKOB 4ES3A 2E1ZA 4ZPBA 4RL1A 1U24A 5AQOA 2UU9F 5CY4A 1RBLA 1B4SA 1UCNA 2RIJA 3MECA 3ZZYA 1B99A 1CJKB 2BKNA 4DV4J 1DJ0A 4M7XA 3H2LA 3VVTA 2HGLA 5FLXO 1H1VA 3G71N 1KOHA 4AHUA 5JVGQ 4TNOA 4E8UA 3J80U 3VQ6A 1LFPA 4BRCA 5KT4A 2E9RX 3VHQA 2ZBRA 1ZXOA 1IKWA 3OW2M 5B0DA 4DV1K 4I7FA 1SL2A 2OPPB 4GY2B 1KVJA 3P8BB 2YNFB 3CO0P 5AQXA 5DS7A 4DR3K 2BRKA 2EBGA 3NF7A 3LAMA 3UNYA 1FNMA 5H9FJ 4ED5A 1K47A 2HWIA 3IAM9 3F73A 4Y2KA 3QO9A 5KG1A 4RUBA 2ALZA 4G3IA 3CM5A 1RB0A 3FVYA 2JOQA 2YHYA 3SCLE 3BGOP 1OWXA 2JLFA 4F36A 1L3VA 3L0QA 2MQNA 3I5CA 3MFHA 5J1EB 3WBZA 2BACA 3GIRA 4LFAJ 1ZAXA 4NLGA 3QRQA 2HKEA 1BHLA 5IM0B 1RAIB 3ILLA 4BRFA 3TUZC 2E2NA 4WFBL 2J7KA 3CJ7A 3FBFA 2OA8A 2HRUA 3DOMB 3TWHA 1Y3KA 1X1PA 2BE9B 4P10A 4LBHA 3CCUN 1X4FA 3PW7A 2CGKA 5DGAA 3NS7B 1SH2A 1P1TA 1VSEA 2UUCK 2I9SA 4ANCA 2PDAA 1S1UA 2QWLA 2VQEJ 4Q8FA 4BWJA 3G6VA 4LSLB 4JS5A 3VGKA 1YI2N 3MN9A 3N9UC 1FESA 3OLBA 2P9PB 4NMLA 3I55S 3GIKA 4N8OA 3LOUA 3AY9A 4EZ6A 4EBEA 1PBAA 2D74B 5GINA 4WP3A 1PAEX 2H3EB 2N7YA 3NAIA 1ZPVA 2X74A 3TSPA 3A13A 1UVKA 2DNNA 1BQMB 3O4NA 2EWSA 5AFUH 2RQCA 4Y3CA 4PCQA 3KWIA 4D3GA 3J7YI 4ZCMA 4HCCA 4LSNA 2CQ1A 1M1KT 3QIPA 4YQWA 1N33J 2ZH4A 3D6TB 2BBEA 5HN0A 5M1QA 4NA3A 2EPIA 1NGCA 3QGPA 4CGHA 1MWQA 2EBEA 1NGJA 4YN3B 3D9BA 1QE1B 4LRBA 3EGZA 2H4YB 4FVMA 2PO4A 2QLWA 2RDJA 3WQUA 1UFKA 1G6BA 2PIIA 3H25A 3G82B 2O8DB 1JXLA 2HVEA 4ED6A 5DQGA 2HG4A 4LQ3A 3UE5A 1ZTWA 1FDBA 3ZSRA 3GR0A 2O8EA 3ASMA 2ILZA 3BGRA 1VBXA 4KO0A 2GO9A 1GMWD 4A57A 5D3GA 4B1ZA 3LANA 3FE1A 3JSBA 2BM0A 1Y5NB 2XZWA 4CJEA 2IOCA 3VQ8A 5E3PA 4DUZJ 4HI1A 2W41A 3KD5E 4RW8A 1BCMA 2MKJA 2VQFJ 1NMNA 3M2VA 4OZ3A 1RHUB 4P2XA 1IKYB 1S4EA 1CZBA 2KZMA 4K42A 2O3DA 2KFZA 3QYYA 2YXLA 1J5EF 1VQ6N 1EX8A 3KWMA 1NPPA 4DI6A 2YV0X 2OP5A 2ZWOA 3C15A 4DCOB 1NGAA 1SJRA 4C8KA 3HK2A 4BR9A 1KAYA 4BC5A 4ECYA 5KT5A 4OO1J 1WEYA 1XIQA 3K17A 1XUPO 4CLUA 5ADXA 4X65K 3PJWA 4MKYA 2ZM6K 3CJ2A 1YDLA 2KQ2A 3W9IA 1RWOB 1NB2A 5CYQA 4YHHJ 2HRYA 4ZA1A 2HBRB 4M5MA 4MH8A 2V50A 3BEXA 3C14B 1D3WA 1IH7A 2YWWA 1V5VA 2P2CB 2IYIA 4C8OA 2XCAA 1AB8A 1KLMB 2W9BA 4ZPTR 2UUBF 4I9LA 3OYFA 3CYMA 3A4TA 1SJ4P 2O8CA 1LWFB 1Y5LB 3OYNA 2P9UA 1VLYA 3DXKB 3KG0A 1EP4A 3C66A 4PG7A 1QQCA 4CHYA 4DUYF 3SMPA 3KKRA 3JAMU 2DR9A 3QESA 4RNMA 2RF2A 3EUNA 3DHWC 3ITHB 4LIWA 2O4IA 3HVTA 2ZD1A 3MCSA 1FWLA 4U7UD 2QW9A 1WUUA 3C16B 4JI8F 3F56A 4ZOSA 4NXMK 5LXRA 3M9OB 2ROGA 2VD3A 4M5DA 3IA0A 1SAZA 3C3LA 1V3RA 1DTTB 2RE2A 2QV6A 2GA7A 2HLUA 3BSCA 3R5GA 2HF3A 2Z1HA 4HVJA 5HBMA 4HUFA 4QJVA 2F4FA 5D0GA 4RWTA 1TK8A 4ATNA 4YMEA 4CJ5A 3TA1A 3ZETA 3HI9A 1FRIA 3ETMA 1MN9A 4V19J 4PL8A 4NMXA 4GKKK 3GG1A 3G6EN 3LWMA 3DI6B 4L74A 2MKYA 1KD1O 2D4WA 1CJKA 3EGVA 2W8KA 3IGNA 2HOEA 2AEFA 2JHEA 4LFCJ 2A0FB 5ETTA 2RS2A 1ACMB 2R7OA 5A8RB 4K59A 5KFHA 3K9JA 3ZSQA 2OH2A 4QR0A 1MWKA 4B3RK 4NYFA 1IV0A 2UYTA 3ISZA 3OYCA 4J9PA 4BDPA 5KAKA 5SZTA 3K0JA 1YJNS 2XZDB 5ETPA 3P83D 4B1VA 5B0CA 2VBWA 3K8VA 4UF4A 1QAIA 4BG8A 2HHHK 3Q22A 3QAUA 5DG8A 2D1KA 1VQ9N 3RBDA 3MAAB 4M5HA 4P72A 2BE2B 3VGUA 1WSEA 2IC3A 1BL3A 4EAHD 1DQAA 3GTYX 5J1EA 4JV5J 1GK8A 1RAEB 4AF1A 2E5GA 1L3KA 5IM0A 2A1SA 1NK0A 3ZTSA 5EX3A 4ETXA 4CD1A 2XMJA 3O3LA 1Q9XA 4GKJF 3K5NA 5FPMA 2G0IA 4KGKA 3BBBA 2B0GA 4UQGA 3AARA 3OPKA 2Z56B 3MTKA 2W40A 5KG0A 4MLEA 3KK1B 3FRYA 4PXDA 1YRUA 4JI7J 2JEFA 1U45A 2CQ2A 1VQSA 2W7OA 5KPRA 3TR5A 2UXCF 2YKMA 5J2NB 1YIJN 4LSLA 4X66K 2RE1A 1S9EB 1Q95G 1N88A 3I8BA 2JH3A 2Z2LA 1RYRA 1Q79A 3FCHA 2FJDB 2VDIA 4I68A 4LH5A 3VQSA 2NUUG 3R7NB 1NJYA 1Q5VA 3TWZA 4W5TA 1MWZA 5HVHA 3ZC4A 4RW6B 2I1RA 3ZNUA 4CK3A 1BQMA 1PSDA 3WX8A 5AE2A 3UD5A 3M2RA 3HSZA 1RXOB 1I94F 1GLCG 4LIRA 4DL3A 1QQMA 4DV1J 3OXLA 3QICA 4JI2F 4DQIA 1HD0A 1DY3A 1FD2A 2Q0UA 4DR3J 2MQQA 3QINA 1J5OB 3FEZA 4M5JA 2OPSB 3TW0A 2GUPA 2QJ3A 3J7AN 3TEGA 3GIMA 1IM4A 5IS2A 4O3PA 2HLTA 2R7XA 4BR4A 2KRRA 3E9LA 4CJUA 2YWHA 1NHKL 4ZPVR 3G82A 4OIXA 2V6AA 2O8DA 2P9GA 3AA2A 4CFBA 2YX7A 4A61A 4KH5A 1Q81O 2QXLA 1RWXB 3HX9A 4Y6IA 1RILA 1CJTA 3QQCD 1BHNA 2OMLA 3RAQA 3S8SA 1CZAN 3GDQA 3RUBL 2GMJA 5FLXU 4NL5A 3LALA 2P9SA 3NE6A 3FGUA 1QAYA 3K58A 4ED4A 2I5JB 2EFVA 1ASUA 4X64K 2V67A 1KFSA 3P5JA 2MHEA 3CI5A 2NXEA 2L08A 1A5XA 4ECVA 4LF5F 4ELVA 3MEDA 1IBMF 1TELA 4HTLA 1S5ZA 5HVGA 4CGIA 3FZMA 2UUCJ 2LU1A 1JL1A 3OYJA 3FSXA 1S6QB 3TAMB 4ID8A 4IQMA 3CJ3A 3I5AA 4USUA 4FM0A 2UUAK 3OYLA 2OLWA 3Q8QB 3TU5A 5HRPA 1IQZA 2W25A 5T14A 3C7NB 4WK3A 1FNOA 2DNYA 5B08A 1CQNA 2DH8A 3HVRA 4EEYA 1WB9A 4OGCA 3AAWB 2FHMA 2YJFA 4JI3J 1VIOA 1JNRB 3IC1A 2ZKTA 1X4GA 2DGUA 4DV5F 1HFEL 2A6MA 2HHQA 4WF9L 2V4JB 3GQCA 3Q89A 1PJ7A 2XM3A 3K7RA 2VA2A 2G0CA 3C14A 3D66A 1Q9YA 3P39A 3AFGA 4A47A 2FJEB 2J8SA 5L1JA 5IWAF 3FNNA 4P7TA 2HF4A 5I3PA 4JKBA 1KLMA 4QWCA 1WF1A 1Z1ZA 3N0VA 3SI6A 2H4WB 3QFHA 4OLBA 2ZOGA 4JI6K 2BJ9A 2YQ0A 3OTOK 3FCWA 5I3QA 4QYZK 4CJFA 4MQ3A 4K4SA 5D78A 4PWDB 2OMOA 2C2EA 4O44B 4JS4A 3ITHA 3SMZA 3BN4A 3LZIA 5IT9O 1F1BB 3O1WA 1VHXA 2KYZA 4A8KA 3HI0A 3FBBA 3K5PA 5HJXA 3C16A 2VJUA 3OBIA 3U6FA 1D1UA 3CQYA 3MDFA 1F9HA 4O3OA 4A5BA 1XR7A 2BA9A 1DTTA 2XHWA 1YJ7A 1IKVB 1OSDA 3NXZA 4LVOP 2HQFA 1VSIA 3FRZA 3WXKA 1V3ZA 1S49A 2A41A 2P5OA 3QIDA 2ZGYA 5LY3A 1WUAA 2QA4S 3BJYA 3BSOA 4CERA 2WSFC 3UQSA 4FK2A 1VYAA 4FWQA 5KFSA 2EFPA 2FQQB 1SJFA 1JLCB 2FIUA 2YX6A 3OD2A 1GTEA 2BQRA 2G2ZA 2W2NP 1KQSM 2OUGA 4X65J 3NVKA 2YNGB 2CNLB 2ZM6J 1U0HB 1T02A 1R59O 2DNOA 3EJMA 5EOYA 3CCLN 4DZ6A 2Y8YA 2B4UA 3CXCR 3Q8SB 4NYNA 2CQDA 5KGWA 2YHBA 1GT8A 2P1JA 4JD2B 3MCPA 3U3GA 5KPTA 2BABA 1RDWX 3HSCA 3S1TA 2C28A 1EQ0A 2OIHA 3VF0B 4DOZA 3HM8A 3MWTA 3L4BC 2RRAA 1Q86O 3E3XA 5B8HA 4USIA 1NG9A 4QS7A 2AD9A 2FLLA 4B8CA 3MXHP 5AXNA 2FHJA 3FBCA 1VQPS 4RU2A 4BDZA 5F0UA 5F8GA 3CNQP 3I0SA 3N6LA 3WIVA 1UPPA 1AT1B 2AQ4A 4OV6A 2Q31A 2DNKA 4DSKA 1FRHA 2YHAA 4ZP6A 4M7YA 2DY1A 3AJ2A 1K9MO 2V4RA 4MIWA 1R8CA 2EK1A 1LXNA 3HF5A 2VBYA 2FHOB 4DDFA 3PNIA 3VTIA 2O4GA 4WFZA 3V9ZA 2DO4A 5AJ3K 2NCKL 3IG1B 4OJ1A 3KK1A 4U96A 4LR7A 3EO3A 2KKZA 5BPLA 2O67A 4X84A 4E1JA 2AYBA 3IDHA 3F41A 1XK8A 3DNCA 3E66A 3AVIA 4DV7K 4CFAA 5T7LB 4GKKJ 1GMVA 1RU2A 2GC8A 1WC1A 2H5EA 1KEKA 3GV5B 1NCLA 2J0WA 3VQQA 2PY5A 3P4UB 2VF3A 3VF2A 3B54A 3QMLA 5M1NA 4RW6A 3DHXA 4JOUA 4USHA 4EK2A 1BCOA 5F8HA 3BUZB 1A5WA 3MXJA 1OVQA 4C0BA 1UZHA 2XO6A 3B4DA 4DU7A 4UUXA 2XMKA 4FYDA 3W65A 4B3RJ 3KNGA 2QK9A 4OLPA 1KKHA 1V4TA 1TZ0A 3QFUA 1HNWK 4FW2A 3UWTA 2E2OA 2E29A 1J5OA 5ETVA 2OPSA 3G8SA 4OX7A 4LFAF 5B0GA 2HHHJ 2V69A 4QPXA 2P9IB 2OPRB 2YNHB 1O0PA 2GQQA 4TYAA 3KHRA 3DRSB 3ENHA 3DM2B 1S79A 4DTMA 1TV6B 5KQ8A 3TX8A 2C1EB 3HP6A 4J9KA 2B9XA 2ZWPA 2XMTA 2J8AA 1RWUA 3CJKA 1IBKJ 2JX2A 1K8AT 3VQAA 2C2NA 2MYFA 3OW2R 3KVGA 4DHVA 2O66A 3EEQA 2JFDA 3SAGA 2CWKA 4I6WA 1YTUA 4CO2A 4OYIA 4QS9A 2DIVA 2UXDK 3I33A 2NXCA 1M90O 2P8IA 2I5JA 3AO2A 3O5BA 3VGTA 5K8NA 5ETMA 5DG9A 1LWCB 3I6PA 4UOGA 4DCHA 3MAHA 4HVZA 5AXKA 2V7ZA 4DV2K 1S6QA 1WNSA 3TAMA 1WDTA 1ZBTA 3D2EB 3BKTA 1L3SA 3DRRB 2AP6A 1CXUA 1FVSA 4A8QA 4DPOA 4KB0A 3C7NA 3TJAA 2HHVA 4HI2A 3GCWP 4IH6A 5KFNA 2QT7A 4CESA 4JKAA 4G1QB 5BR9A 2JDJA 4CEQA 2FBXA 3CC7S 1BISA 1GOCA 4IOXA 4CH0S 1ASWA 1FXXA 3VAMA 2ILYA 1VRUB 1Y97A 3UN2A 2XYPB 1QVFR 3N6MA 5D4LA 2WHOA 5B0EA 3CMAN 3NH2A 2V4JA 3BY5A 3D1QA 2JVOA 2AYGA 4JI1J 3Q2TC 2ATCB 1F9EB 4IG0A 3O44A 1U1MA 2I7NA 1KBRA 3IS9B 2XGPA 1AW0A 1YT3A 3OFEA 4KIAA 4Y2IA 3H2UB 2C2RA 2MZJA 4WTOB 4YR3A 4FSVA 3GPAA 1TUUA 9ATCB 1GNKA 2OJ3A 4Z7YA 2MSTA 4DFMA 1FRXA 4DUZF 2ZJQQ 4X4PA 4MK8A 2D0CA 4KREA 1XC9A 3NKYA 4O44A 1BD6A 4L76A 4ILMA 4ILRA 4EP4A 4F4WA 3A5OC 4OQJA 4LSZB 5GMKa 2FC8A 1X7VA 3IN5A 2J0SD 3QEIA 3UKRA 3CCWA 3MEGA 3V6DB 1T3VA 4OYBA 3OFHA 4WYWA 2YJEA 4I2PB 4OFZA 2CADA 3R97A 4GV3A 3Q7CA 2W2PP 3DMJB 4X62K 3KG1A 1F5AA 1RKJA 3AGKA 3HL8A 5GAGI 4QU7A 3VF4A 2CNNB 2D0AA 2QRRA 1FJEB 5CZVA 3LP3A 2D0OA 3CJQA 3KLVA 3V6JA 2UUAJ 3UFCX 3GJSB 1RTJB 3IM9A 2YVSA 2QLXA 3RR7A 5HQLA 4IBNA 3IWXA 4G1IA 4H54A 3ISND 5ETRA 4NLTA 4LBPA 1REGX 1YJ9S 2XBPA 5BRHA 1VGYA 1NKEA 1QZ5A 2VFSA 3W5XA 4CNYA 4QIVA 4KV8B 2XY7A 1HJOA 1XQIA 3ENAA 2YNGA 2M9KA 4NASA 3ZT1A 1F5CA 4ELUA 3VF6A 1HI1A 4KHSA 3M32A 2ACMA 3LM9A 3V1QA 1AFJA 2PAVA 3IAS9 3RMAA 1HL6A 4Q8EA 5C2CA 3ZZOA 4OGEA 3FQKA 1N0UA 1WF2A 3PG9A 4ZMMA 4O55A 1JKHB 4R79A 4M5IA 3QSIA 1MSWD 4NLBA 4PXEA 3M2UA 3KOAA 4JI6J 3PSFA 3EWGA 3CSKA 3CCQN 3PX0A 3AO1A 3J81O 2Y0BB 3PV8A 4QYZJ 1G15A 4NA2A 3QT5A 2GO8A 4IDKB 1GLFO 1Q82O 1HWJA 1RDDA 3D67A 2KU7A 4TLRA 3OT9A 3AB2B 1BY9A 1YVFA 4JB8B 2XG8A 1JCFA 3MAQA 4X4QA 5EWGA 3BQ2A 5KFOA 2XNRA 5HROB 3OLAA 2FDNA 2RPIA 3VQ5A 5L1KA 4KC5A 4H5NA 1EIYB 2CNOB 2E9TA 1UJ6A 2W2MP 4NLRA 2ZDOA 4ITSA 1RWVB 3NLCA 2JSXA 4HT7A 4ENOA 3IG1A 3LDSA 2R8HA 2ZJPQ 4JKFA 3OTCA 2ZBPA 5A0YB 1S7IA 4G65A 3VR1A 1QVGM 5KT7A 4R8UB 2CZ9A 1F21A 4AFFA 4XK8C 5IV3A 1HQEB 5M1KA 4U7UK 4AM7A 5T7LA 3G6XA 4NLSA 2NXJA 3DWLA 4WFAQ 1U1PA 2VWBA 4C8LA 2AHOB 1NXIA 4OJ3A 3PHEA 5HAOA 2Q0RA 2BQ3A 1T11A 5IT9U 1S9GB 2E7WA 1X4AA 3CCVS 4K50A 2ZBIA 3PR4A 4OI3A 4UW2A 5B0BA 4NE9C 4ER8A 1TMMA 1RBTA 3ULHA 3C8YA 4UY85 2RDDA 3N28A 1T6CA 3WXJA 2UXBK 5A8KB 1F60B 3BH6B 2ZVIA 3ZTOA 2X6SA 1NUEA 5LT5A 2P9IA 3HBTA 2YNHA 4W90B 1RA7A 4M3YA 2AIRB 3DM2A 1QTNB 1TV6A 1VHFA 4F2SA 2CGLA 3M30A 2W9CB 3EYZA 4LF4K 4K2JA 3EE8A 3SAHA 1SH3A 3CMEN 1TKZB 1WG4A 1SJ3P 3J7Z5 4RBVA 1VMBA 2AJ0A 5CYMB 2F8SA 3I31A 5JVGL 2DVIA 3E9PA 2OANA 1FX2A 3PEJA 3TJ9A 1LWCA 5L9XA 2FLPA 5KG3A 4KH1B 3MN5A 4Y2MA 2BKOA 3QETA 5DM7Q 1VS3A 3FKBA 5KFXA 3LGNA 3NGTA 4UT4A 2D1CA 4N56A 2B5JB 2JLEA 3VN5A 4EU0A 1FO1A 2J76E 3NBPA 7FD1A 4ZHRB 1X4EA 4DV7J 2F9TA 3DRRA 3AD7C 4N5SA 2HFOA 4DV1F 4JKGB 1N52B 3SNNA 2F9WA 3CJ0A 4G1QA 3VTHA 4F0MA 2KG0A 4Z4HA 4OYOA 1MU2A 3VGVA 2G8FA 1VRUA 2MLXA 1YXQA 3RAXA 4OYMA 3SQGB 4JLHA 4LMZA 4DX6A 1L3UA 2AMCB 1HNWJ 1I3OB 1VRQC 2Y9HA 3ADAC 4M3XA 2A2CA 1SC6A 5HLFB 4DPYA 1SKSA 1X3NA 1N6QB 3M1FA 4PQAA 3IS9A 1S48A 1RHQB 3VQ9A 1C4CA 4L72B 2R7WA 2F4VK 2J6TA 1WSVA 4FNIA 3PYEA 2E1CA 2FLNA 2VONA 4YOYA 4HDGA 5AQJA 3JB9k 3CCJS 1V3SA 2OSRA 1X0FA 4YOWA 4E7HA 3W7BA 4FBTA 1WSFA 4YOEA 1QY7A 3SEOA 4IO9Q 1CZ9A 1EETB 2XMVA 1VQ5S 4BACA 1S1VA 1TTHB 1B0TA 4DV3K 1E6YA 2UUCF 2UXDJ 2FBTA 3HFZB 1FRMA 4NXNK 4QWEA 1X9MA 4C48A 4J9NA 1CLFA 3V6DA 3KKSA 1BWFO 4I2PA 3JSYA 1IBLK 2B4VA 3E2EA 3DMJA 1T95A 3QJPA 4M5NA 2ASMA 2BOPA 5EVZA 5A2QO 2CZ4A 2MGZB 4WIQA 1QS4A 3SJJA 2RB7A 1H3DA 1UW4A 4CT8A 3U1MA 2NRVA 2GTDA 3CCRN 2CVIA 2R7TA 4DV2J 4DSJA 4ECWA 3DOKB 1S99A 1ESVA 3IO1A 4WIIA 1U1OA 2F8EX 4HDHA 1R31A 4CRJA 3CIMA 4CHZA 1RTJA 2DHGA 2XQCA 3AA4A 3HVAA 5HRNA 1B0PA 4DBQA 2FLOA 3J80Y 1RKIA 4E98A 3GJQB 3CJTA 2PT0A 3R5DA 4KV8A 1FK9B 3IKMA 1VQLS 1S59A 5K5MA 2GQCA 3EGNA 4JUZA 2KDOA 1X5TA 1JLQB 2HVDA 1W97L 4K41A 4B3OA 1WSIA 4PZVA 4F4XA 1VBYA 4FJIA 4M41A 3LGHA 4DUYK 1RT7B 1URRA 4LBIA 3FMWA 2IDLA 3MZIA 3D6FB 2HZVA 2HIQA 3QFPA 1AROP 2PBDA 2KFYA 2NRZA 3D2FB 4LY7A 2NRHA 1JKHA 1NMEB 2QA4G 4BGBA 3KLFB 3TNVA 4OJGA 4WK1A 2G8UA 4JI5J 4RWXA 4KTWA 3PLAA 1YF5L 1HNXJ 2DNZA 3E8OA 4C98A 4IDKA 2A18A 2E5LJ 4LFBJ 3H4DA 5A8WA 5HATA 3EE9A 4L6V3 1OH6A 3NCPA 1NOYA 2DNQA 1Z05A 2FZCB 2FB0A 1Q78A 2AU0A 3GJTB 3PRBA 4W5OA 1VSHA 2XC9A 2WTFA 3RMBA 1H2TZ 3MCMA 4ALZA 1DRZA 2J9DA 3OYHA 3HSTB 4MFBB 4MDAA 3UPFA 1XN9A 1C2PA 2HVHA 3LA0A 2HHTA 2GEMA 2O8BA 5A0YA 4CTAA 6FD1A 5IFMA 4NZ6A 1FEEA 5KG6A 4X65F 2E6LA 2ZM6F 3MURP 1TK5A 5KT2A 3MFIA 1I6JA 1ICEB 4MLHA 1HQEA 4BVOA 1B7FA 3H20A 4KH6A 5L1LA 2OEJA 4PYAA 4CEEA 4CJTA 2ZBCA 1PO6A 4ECSA 3H1VX 5GIPA 3O9QA 5KFFA 4WP8A 1RFQA 4FJ7A 3VCDA 3WNHA 2QMXA 4BREA 3VEYA 3U1LA 4RLEA 5ETKA 1NM2A 3ZZ0A 1GQEA 5CYJA 2WVFA 1S9GA 2YWEA 3M8PB 1BQXA 2O1PA 1GLDG 2LQ9A 1E4GT 1WKKA 1RNHA 1W2BR 5HRSA 4BC3A 1UWBB 4CEZA 4NCGB 5AQVA 2GMLA 2AGOA 1SIZA 1EKSA 4YOTA 3H42A 4DR1K 2X3DA 2VZ9A 5A8KA 3ULDA 2DXFA 2V5HG 1SH0A 2F63A 2E7VA 1JB0C 2ZH5A 1HX1A 1G99A 2P9EA 2D0PA 4CLPA 3QRPA 2XI3A 4FYXB 4HH0A 4E0DA 2XYGB 1BO5O 1XMQK 4NXMF 2DITA 4PRFA 4FYYB 3CQXA 1KTQA 1X0PA 2ZH2A 3MM9B 1PBUA 4NLVA 3RRGA 2NLXA 1JJ2M 4DR7K 2E5IA 1QSYA 3R1XA 3TPQA 1TKZA 1YJNN 1U48A 3BB5A 3I5BA 3OS2A 5CA5A 3T5HA 4OKKA 4QW8A 4RZRA 3ETOA 1DKGD 5CYMA 2VFTA 3K9KA 2CPHA 3MWBA 1OO0B 5ITHA 4UOHA 4FJ5A 4M3UA 3BEGB 4TLQA 4G6VB 4LRAA 4GKKF 2C2DA 4HHTA 4IG3B 3H6EA 5E41A 1HHTP 1GLLO 3CJ9A 1HJRA 5KFRA 2B5JA 2QFJA 1S22A 1SQGA 3NS6A 1NGBA 4K25A 1H98A 3VQDA 4IR1A 4CHNA 3M3ZA 4IFVB 4B3RF 4EHTA 3TO8A 4KYZA 1ZM4A 4F7VA 4JKGA 1RJJA 3VOVA 2KHDA 1BWVA 3BZQA 1JCGA 3SDEB 4C11B 3S9HA 3DC2A 1OVYA 4DR5K 3D68A 1Z4UA 2HHHF 4F0KA 3MOJB 1TR0A 4C3LA 4WZMA 1OSCA 3SQGA 2WVDA 1YZ7A 1Y4ZB 2OCEA 3FK4A 3VAFA 5HLFA 1TL7A 1EHWA 3C46A 5AQNA 1IQTA 3LF0A 1BMQB 4WYBA 2UXBJ 3JXUA 4NRUA 1TU0B 1WN7A 3QATA 4HACA 1Y7PA 3D45A 3DOLB 1RWPB 2LECA 4YOXA 3S3MA 1QLNA 2E44A 2YHWA 2YHXA 3UDCA 4DZDA 3B6OA 3GB0A 1LWXA 3SCIE 4M5KA 5F0WA 3OXFA 3AY0A 1PGZA 5KG2A 4O0JA 1VBZA 4B3TK 4M1KA 3VAKA 1EETA 1W26A 5A6WA 3BKUA 1MWYA 4DQ8A 1T05B 3RWUA 2R7UA 3FDSA 2UVRA 1CVJA 4QBUA 3R3TA 3VZIA 3M8ZA 2EX3A 1OQ6A 4TYBA 3CD5A 2KT5A 1MDUB 4A48A 1SS6A 4O5FA 1ASVA 4X66F 1ZA1B 2DGXA 4EWTA 2A2DA 3KJVB 3MPVA 4B9MA 3MXIA 4FWNA 3WQPA 3OYGA 1ROFA 3L4QA 1F0XA 3W3SA 2MGZA 2ZWHA 2KG1A 3SUPA 1ZBSA 4DU3A 1VQNS 5FRNA 4IFYB 2ZVSA 1UJ4A 1B9FA 3DOKA 3Q83A 3AV9A 1NM1A 3P38A 1LOUA 3A5LC 1G7CB 3TI0A 3AVLA 1P1LA 3TARA 3OA9A 2PE8A 4B17A 3OYBA 4DR6K 4KGZB 4DF8A 1YBAA 3T19A 2MQMA 4KFBB 2ZOFA 2R9LA 2KN4A 4L73A 1EARA 1FK9A 4LF1A 1Q53A 4I2QB 3CG7A 2QGFB 1JLQA 4XH5A 2YX4A 4CZKA 4JEPA 3D7EO 3CD6N 2DPNA 2AX0A 1URNA 2JLGA 2W6LA 3DYAA 2PD1A</