1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
1TV6A 2HB5A 3QO9B 1WSHA 1LAVA 4I7FB 4K4UA 4DSEA 1B9FA 3NMAA 1HNVB 2X6NA 2D41A 5KFMA 4Q44A 4HUFA 4CGIA 3HL8A 2QXFA 1KTQA 3CFOA 4IRKA 4ZP8A 1ASUA 1LV5A 3C6UA 5CZ1A 1TV6B 3S3NA 4O3OA 1YTUA 2C28A 1U48A 2YKNA 3PJWA 3OYJA 3HM9A 1L3UA 1NK9A 4W5OA 1TL3A 3CJ5A 4K4XA 4M95A 4LH4A 1EXQA 4G1QA 5I42A 3HO1A 3DOKB 5KT2A 4RNMA 3EPGA 1BHLA 3PX0A 3VQEA 3TANA 2ATLA 1JIHA 1RTJA 3C6UB 3NGIA 1HNIA 5KGWA 3KNAA 3G0ZA 4FZXC 2YKNB 1ZTWA 1KVCA 4NLTA 4HKQA 1TL3B 4I2QA 3DLRA 4OL8A 1JLCA 4G1QB 5I42B 3OYFA 5F9LA 2VWKA 3ZT0A 2WHOA 2VG5A 4CK3A 4CF1A 4JUZA 1RT7A 1N48A 4DSLA 4WXWA 1RTJB 4OGCA 4IRDA 1HNIB 4Y2AA 5HRPA 3V9UA 1ZYQA 3V1OA 5CYQA 4I2QB 4MFBA 2ILZA 5DK5A 1JLCB 4MIAA 2F8TA 5DG9A 3PZPA 2VG5B 1D9DA 2XC9A 2VA3A 1RT7B 4TQSA 3U3GA 4EBEA 3DLBA 3OYHA 4IH7A 3AO2A 1UOCA 3H08A 2A1SA 4FW2A 1LWFA 3QERA 5CYQB 4ED8A 4ED2A 4MFBB 1Y97A 1RT4A 4F4KA 3ZSRA 3QIOA 4B8AB 3I5BA 1XR5A 1ZBHA 2ZE2A 2B6AA 4DTOA 1Q9YA 1R0AA 1K1SA 1RT2A 4W5QA 3KLIA 4R0EA 5HBMA 1QE1A 1CSJA 3CO9A 1LWFB 4E1MA 1S9FA 3T5HA 3HPOA 4LSNA 2PYJA 4KPYA 3AA4A 4ZVEA 2RKIA 2IOCA 3MR5A 1RT4B 2ILYA 4KHSA 4Z4IA 1HPZA 1XHXA 3DRSA 3K5OA 4DQQA 4CJWA 3ZSXA 3OSPA 2ZE2B 4F3TA 4J9NA 2B6AB 3C95A 2GV9A 2V0NA 2VG6A 2W9BA 5K14A 4TY9A 2W9CA 3V4IA 4O3RA 1R0AB 1RT2B 2ATQA 3KLIB 1BI4A 5HBMB 4NLVA 2FBYA 4M3YA 1QE1B 1C1BA 4LSNB 4CFAA 3PV8A 1SL0A 2RKIB 4J9MA 1GOBA 1BQNA 3SPYA 5KFJA 1HPZB 4Y1DA 3DRSB 4F4WA 3T5KA 3HP6A 4U6PA 3H5XA 3ITHA 3VQQA 3M8SA 1NKBA 4B3OA 1S9GB 3NKYA 4FBTA 3EY1A 2VG6B 2W9BB 5K14B 3V4IB 3RB0A 1G15A 3CDUA 4ID1A 1BIUA 1EETA 4E7IA 4RNHA 5L1LA 3LP1B 1C1BB 4ECQA 4FJNA 4FJHA 2AU0A 3NF8A 1T05A 4JRPA 1BQNB 3BSCA 3IRXA 3GIMA 2HW3A 3RMBA 3CYMA 1U04A 4QW9A 2FC0A 4OJRA 3ITHB 1KFDA 3B6PA 3AVLA 3PJXA 4B3OB 4K4TA 1GOAA 4QOZB 4Q0BA 3M8PA 3ZSQA 1EETB 1TQLA 5KFIA 5KG6A 2R2UA 4FK0A 3PX6A 3AO4A 3IRXB 1A5VA 4O0IA 4RU9A 2YHBA 1IKWA 4CF9A 5KFRA 2B43A 3QGGA 4JS4A 4CF0A 2QKBA 4Q0BB 4RW7A 4M45A 3AVHA 4XPCA 2YHAA 3M8PB 2WRMA 2ASJA 3MXMA 4KHRA 3BQ0A 3JYTA 1LAWA 1TKZA 2F8EX 4DTPA 1S6PA 5KFQA 2WOMA 4QCLA 4H8KA 1IKWB 5KFXA 1NJWA 4ELTA 4TYBA 1VSFA 3DRRA 3WNFA 4ED1A 1FXXA 4FJKA 4FZZA 4RW7B 4DSKA 3N6NA 4H54A 4IFVA 3N6MA 2IC3A 3RTVA 3MEEA 3KIOA 1QTMA 3JYTB 1TKZB 2FBVA 4B9UA 3GV5B 1S6PB 2WOMB 2HAIA 4WZQA 1TAUA 2W8LA 3DRRB 3UR0A 3KKRA 2UVWA 2XGQA 2J6SA 3ZSOA 1BGXT 1S5JA 4CCHA 3OHBA 4EZ9A 2IC3B 4U7CA 1RT6B 4EP5A 4F4ZA 3MEEB 1DTQA 4K4ZA 4KHUA 5L1KA 3KMSA 5KFUA 4WXOA 3V81A 2BRLA 2GIRA 3PVXA 4M3TA 4PUOA 3L2UA 2W42A 3MFIA 1RAJA 3N6LA 5CYMA 1ZBLA 2Z1HA 2G8IA 1TL1B 2C22A 3SPZA 4FCYA 3FQKA 3AA2A 2AX0A 3VQ5A 3OYNA 1DTQB 2FLLA 2R8HA 2OPQA 3L2VA 2OPSA 4MIBA 5KT4A 3V81B 3UPFA 2AWZA 4KHMA 4EBCA 4PUOB 3OLBA 3DRPA 5CYMB 4YR3A 4BDYA 3UQSA 4HVJA 4RW6A 3FRZA 3HK2A 3SJJA 4ZPDA 4AHRA 5HRNA 3EYZA 4PWDA 3E01A 1WNEA 1C0MA 1X1PA 2OPQB 2OPSB 4FJ7A 4FJ8A 4TQRA 1NK0A 3ISNC 5KFFA 5KI6A 2HMIA 3DRPB 1S1VA 2WK4A 4CJQA 4DWIA 3AVBA 4JLHA 5JXSA 1J54A 4N5SA 2JEGA 2DFHA 1S1XA 1JLBA 4RW6B 3NAIA 4F4YA 3MR3A 3SV4A 3AVAA 4PWDB 1TK0A 3E01B 5HP1A 2FLNA 3AVGA 3LDSA 1NK8A 3RB4A 2IA6A 3OVNA 5F9NA 4KKOA 4CHPA 1VRTB 1D8YA 2HMIB 1B92A 1S1VB 3HVAA 4ZHRA 2WB4A 3GQCA 1S1XB 1JLBB 5EU7A 1WSIA 2IDOA 3L2QA 4CHNA 1NK4A 4Q45A 1RDCA 3WNHA 2XY6A 2ALZA 5HP1B 3VQPA 3WNGA 3G86A 4TY8A 1SKWA 5CZ2A 3OYCA 3OL9A 3L2WA 4KKOB 3KHHA 4FLWA 4DTRA 2BANA 4FJJA 4DU1A 2FBTA 4ZHRB 4B9NA 2IM3A 4HUEA 3DOLA 4ED7A 1REVA 4O44A 4EYHB 4TY8B 5L1JA 4CEFA 4DS5A 4NCGA 3V9ZA 2YNFA 4CJUA 2BANB 2JLEA 3D0PA 4IOBA 2D7SA 5FDLA 4DQPA 4FM1A 5EWGA 3DOLB 1N5YA 4DF4A 3LANA 1REVB 4O44B 3Q8RB 3SQ0A 3HKWA 5KG2A 2EC0A 4OKKA 4NCGB 2YNFB 1S0NA 4E7JA 4XO0A 4BE1A 3H5UA 5FDLB 4ZPBA 4E89A 3D5MA 4DTUA 3RRHA 3QEXA 1IO2A 1N5YB 1VSMA 4NCAA 4N47A 3RMAA 2OPRA 1JXLA 3L3UA 4M3UA 3SNNA 3NF7A 1UA0A 1NJYA 5L9XA 4G3IA 4URSA 3GIJA 1RBTA 1NJZA 3AVMA 3RBDA 4Q5VA 2G8FA 2OPRB 2R8GA 4ECXA 3SYZA 1T3NA 5JS1A 5J2PA 1RTDA 5F8MA 1F21A 1S48A 5DLFA 4MKBA 4C8OA 4WYWA 4JV1A 4JV2A 4DMNA 2RF2A 2JEIA 1JL1A 3GV8B 3CM6A 1Z4UA 1RYRA 3TVKA 4W5TA 1TKTA 2WTFA 2FVQA 3PUFA 4YP3A 3DI6A 4PY5A 2ZKUA 3GILA 4AHUA 4DL3A 4NLOA 4F3OA 3NGYA 3BQ2A 5J2PB 1HRHA 1RTDB 5HLFA 4KREA 5C5JA 3KK2A 3RMCA 3CQ8A 3DYAA 5KG4A 4DFKA 2RF2B 1LW2A 4QWEA 1BCMA 1TKTB 3NF9A 1RT1A 3QEVA 2YNIA 4OVLA 1RTHA 3RWUA 3DI6B 3KK1A 4BDPA 2OZSA 1KCFA 3ZSZA 1MMLA 5HLFB 3IGNA 1JXBA 4QPXA 3KK2B 3DYAB 3QGHA 1T03A 1LW2B 3HVTA 3H5SA 5KRSA 1RT1B 1VK0A 2YNIB 5KFZA 1RTHB 4YFUA 3HPHA 1NNDA 2YV0X 2C2DA 3KK1B 4W5RA 3RBEA 3I5AA 3M9OB 4O3SA 4F2RA 2R8IA 4TXSA 3TARA 2IAJA 2VG7A 4OPJA 1T03B 2UUWA 3V6HA 3AVIA 3DM2A 3HVTB 4FW1A 3PR5B 1BQMA 3KMQA 4NZ0A 3K2PA 4CFCA 3LALA 2IAJB 2HHUA 2VG7B 5C25A 2W7OA 4RW8A 1L3VA 4FYDA 2FLPA 3BSOA 3VQDA 3DM2B 4CF8A 1QS4A 4M3ZA 1T8EA 3OYDA 4CEAA 1J53A 1BQMB 3Q8PB 3PW0A 4CECA 3C6TA 3T5LA 5C25B 1QSSA 1JLQA 1SH0A 4K8XA 4NLXA 4Y1CA 4RW8B 3VQCA 3P83D 2C2EA 3V9WA 4B9TA 4J2BA 4J2EA 4DTNA 5DGAA 5KFVA 3C6TB 1GX6A 2DY4A 3AVKA 4B9MA 1JLQB 5KFDA 4KTZA 4O55A 4K4YA 3ULDA 1KLMA 3AV9A 4CESA 4DTXA 2DPJA 4CFBA 1KHWA 1I6JA 3ZT1A 4FJXA 3KHGA 5F8NA 4BE0A 3MEDA 5KFHA 3QZ8A 3HSTB 3L2RA 1RDBA 4MH8A 1WAFA 3CJ2A 4ZP7A 3FFIA 3EZUA 4WFYA 2JC1A 2P1JA 1K1QA 4CK1A 3QETA 4KB0A 1S0OA 2IM2A 4ZPAA 4C8KA 1KLMB 2I1RA 1SV5A 3P5JA 5KFOA 4RUCA 2YNHA 3MEDB 4KI4A 4H4OA 4KAZA 3PO5A 3VQAA 4ICLA 2R2SA 5F8LA 4UQGA 4KHYA 2JC0A 2JGUA 3FFIB 4ED6A 1RBUA 2DPIA 1RT5A 2Z1JA 2CJQA 2HNYA 4J9KA 4WYLA 2JEFA 4DSJA 4IR9A 1SV5B 1A5XA 5DQHA 3S3MA 2YNHB 4CJLA 4H4OB 3VQBA 4ICLB 1HQEA 4DL2A 2DFFA 4MK8A 2IJNA 1EP4A 2W9CB 2WONA 1A5WA 4DU4A 3OJSA 5J2NA 5KFTA 3KLHA 3KKSA 1BI4B 1RT5B 3S9HA 4J9LA 2HNYB 2HVHA 3DLGA 4RG8A 2FVSA 3PX4A 2BGGA 3VQ8A 4B9LA 4OKEA 5F8GA 2KFNA 3OSNA 4DU3A 3E51A 3GIKA 2R8JA 1HQEB 3OYKA 4OPKA 3SI6A 3QIPA 4XIUA 1EP4B 2WONB 1S1UA 3IG1A 4IH6A 1JLFA 5J2NB 3KLHB 2JEJA 1T94A 4IKFA 2IM1A 4B08A 3NF6A 2OPPA 2Q3SA 3DLGB 1HJRA 1TGOA 4GC6A 1T05B 1XR7A 4ZVFA 3SI8A 2HHQA 3H98A 4LY7A 3MEGA 3O4QA 3FSIA 2E6LA 3QIPB 5KFYA 4IDKA 1S1UB 2FVPA 3HYFA 3IG1B 4NYNA 1MU2A 3H5YA 1JLFB 3MR2A 3IS9A 4Y2CA 4NLGA 5KTQA 1FKPA 4CFDA 3M9MB 3HT3A 4M42A 2OPPB 2GC8A 5KFNA 2UVUA 5SWMA 3EZ5A 1RTIA 3KLFA 3SQ2A 2FJWA 3MEGB 4FJIA 4O4RA 4IDKB 3ALYA 3K5NA 3RR8A 1I39A 1MU2B 4M3XA 3H4DA 3IS9B 2V4RA 3NH1A 3KJVA 1FKPB 1QQCA 3OYEA 1J9AA 3K58A 1D5AA 3HP9A 2QKKA 1RTIB 3KLFB 3SUNA 1IKVA 3OL8A 4E1NA 3FDSA 5KT3A 2W9AA 4EBDA 4DFMA 3MFHA 3KK3A 3GIIA 1RILA 4IFVB 1SKRA 3KJVB 4KFBA 4F8RA 1WSGA 5EWEA 4CJKA 3O4NA 3QNOA 1IKVB 2IMWP 5KG1A 2AGQA 4QAGA 1QSLA 2OZMA 5DGBA 1NHUA 3KK3B 1HYSA 4AH9A 4F50A 4ECVA 1RNHA 4CHQA 5KFCA 4EO6A 4FVMA 4KFBB 4CK2A 2D5RA 2CKWA 3IN5A 5KT7A 4QW8A 4BE2A 4URGA 3HHKA 4EO8A 3DLEA 2O5DA 4KHWA 3OS2A 4GC7A 4CJSA 3QESA 3MXJA 4EP4A 1HYSB 2O4IA 4O5BA 1ZBIA 1SL2A 3RAXA 4WFXA 2P5OA 4QWDA 3BJYA 1WLJA 2OH2A 2KZMA 1KHVA 5DQGA 5J1EA 4HYKA 3UIQA 4ECYA 1WAJA 3DMJA 3K59A 5KFSA 4E7LA 1TKXA 3KLEA 2F96A 2XY7A 4DQRA 2UUTA 4Z0UA 4CJFA 4NLWA 2LSNA 5EUHA 2BQRA 1LWEA 4ED0A 4RNNA 3OY9A 4HTUA 4CEBA 2D0CA 2D3ZA 5J1EB 2ZQBA 3T19A 3DMJB 1RBVA 1ZBFA 3KLGA 1HARA 4OKJA 4ECSA 1LWCA 1TKXB 1IG9A 4RW9A 3CFRA 4YNQA 3D28A 3CWJA 2YNGA 4RNFA 1UWBA 4HCBA 1UAXA 3OYLA 2F8SA 5FRNA 3CDEA 1LWEB 4AILC 4IRCA 1YVFA 1C0UA 3AO5A 2PZSA 2HHTA 3NFAA 2BR0A 1TK5A 3KLGB 3OLAA 1CZBA 1LWCB 3LZIA 4FJ5A 2X78A 4CEZA 5JUMA 4RW9B 4K4VA 3VQ4A 4IG0A 3TAEA 3H40A 3S3OA 3EPIA 2YNGB 2G8WA 3G6YA 1UWBB 4KTWA 4KBIA 4FZYA 1C0UB 3SQ4A 1C1CA 4AHCA 5DG7A 4ECWA 3SV3A 3OL6A 3NGZA 3SFUA 2G8KA 2J6TA 2X6SA 3WNEA 4IG0B 4URQU 3VA0A 4KB1A 3OL7A 4CIFA 1ITGA 4O3NA 2ITGA 4Q8FA 4OGEA 4DQSA 4FBUA 2W7PA 3G6XA 4ECRA 5KG3A 1W9HA 3KD1E 2G8VA 4IG3A 3MXIA 4E19A 1Q8IA 1C1CB 3QEWA 4E0DA 1RYSA 1IH7A 4RW4A 3SZ2A 1OS5A 4FLYA 5C24A 1SL1A 3MF5A 1ZBUA 2KQ2A 3NGDA 3SFGA 2HHWA 1S1TA 3TAFA 2HVIA 1D1UA 1U45A 1VSJA 3QGIA 4IG3B 5KT6A 4B9VA 4DLGA 4DF8A 2J6UA 4Y3CA 3KTQA 4TLRA 2P51A 2OA8A 1YT3A 4RW4B 4KV8A 1WSEA 2G8UA 5L1IA 4ECZA 2HHXA 4N56A 2IGIA 3CJ0A 2FJVA 5C24B 5EDWA 4WZMA 3NAHA 4JS5A 4OLAA 1S1TB 4FLVA 2A1RA 1QHTA 1N6QA 1K6YA 1Z25A 3GV7B 3OS0A 1VSIA 4KV8B 4DTMA 1W0HA 1RA6A 4BWMA 1YTAA 4O4GA 1JXEA 4NLPA 2X74A 4BDZA 3AVJA 3VQ7A 2RDIA 1TK8A 1TAQA 3IAYA 1IKXA 1N6QB 2B4JA 1SH3A 4I9LA 3PY8A 4NYFA 1KLNA 4NLQA 3QIDA 4JV0A 3K5MA 4ZP6A 3CVKA 4O4GB 4KHQA 3HPGA 2UVRA 2RPIA 4BWJA 4DL6A 3RB6A 3NAEA 3ZT4A 1X9SA 1HYZA 1KRPA 1IKXB 3H2LA 4E7KA 4W5NA 5FROA 3QLHA 1HYVA 2KFZA 1BISA 2QE5A 4WFZA 1LW0A 4Z4CA 3AO1A 4PA1A 3Q8QB 1S10A 3FQLA 3CM5A 4KE5A 5C42A 3KLVA 3V9XA 3QEIA 2QK9A 5F8HA 3K57A 4CHZA 4H4MA 1NJXA 3QEPA 4FJ9A 1VSEA 1BCOA 5DMRA 3QLHB 1B9DA 1RDDA 4Y34A 4J9OA 4ELUA 1BIZA 3QNNA 3DOKA 3I0RA 3V1QA 1LW0B 5E41A 3B6OA 4KB7A 2HWIA 2Y1IA 5KGXA 4X2BA 5FRMA 3HVWA 3T1AA 4LQ3A 5C42B 3TAQA 2RDJA 4H4MB 4MKAA 4IBNA 2R7YA 1DLOA 5SZTA 4C8LA 1BL3A 2RN2A 1S4FA 4K4WA 3I0RB 1S1WA 4LQ9A 4J2AA 3MECA 3MR6A 3DLHA 1W25A 3BSNA 3LAKA 1S97A 2IM0A 1VSHA 3DDKA 4DEZA 2BRKA 3AVFA 1U47A 1DLOB 4IR1A 4YR2A 2VWJA 1NOYA 4DSFA 4NRTA 3TQ1A 1FKOA 2XWYA 3V1RA 1S1WB 2GIQA 3MECB 5I3UA 2XI3A 4DQIA 2XGPA 1YVUA 3ICLA 1CXUA 1VSLA 4WE1A 3OHAA 4LD0A 3NBPA 4KI6A 1KVAA 2XRIA 5D3GA 2V4QA 1NHVA 1FKOB 3MTKA 3MAQA 4OLBA 2XCPA 5I3UB 4ECUA 3I8DA 4I9QA 4ECTA 4FXDA 3CDWA 4M3WA 4WE1B 3LP3A 1NKEA 3NBPB 2E6MA 4B8CA 2R2TA 5DQIA 2XCAA 5D3GB 2R8KA 3VQ6A 2PYLA 4YQWA 5KG5A 2W8KA 5KFLA 5KRTA 4FJGA 4L8RB 3O3HA 2OYQA 2XHBA 2XY8A 5HRSA 5KG0A 4NLDA 2Z1IA 5KFKA 4AHVA 4DTSA 2I5JA 1RDAA 4Q43A 2ASLA 4J2DA 3TR8A 2ZD1A 1S9GA 1VSKA 3GYNA 4ZVHA 4ZP9A 4FLUA 3U3YA 4IH5A 3LP1A 4NLSA 3PO4A 4B9SA 2EHGA 1JX4A 4RUAA 2I5JB 1RBRA 3VQSA 2NUBA 1N56A 4CJVA 5HROA 3P1GA 1ASVA 4CEEA 2ASDA 2ZD1B 4DL4A 4CJ4A 2IBKA 2PY5A 3RR7A 1S0MA 3PR4A 3TABA 4DLEA 3RRGA 4FJLA 3TAPA 1JLEA 5F8JA 2C2RA 5T7BA 4N41A 1CLQA 3DLKA 1C0TA 5KFBA 4AHTA 1XHZA 4IFYA 1C6VA 5HROB 3CIZA 2D0AA 3PW4A 4CJPA 4Z4GA 4M41A 2AGPA 4KO0A 1EX4A 4HCCA 3SQ1A 5KFEA 3KHLA 5KFAA 3RMDA 4RZRA 4NCBA 4EYIB 1JLEB 3Q8SB 1Q9XA 2DFEA 1L3TA 3DLKB 1C0TB 4DS4A 2P5GA 4IFYB 4CHYA 3BR9A 1WN7A 2AGOA 4CF2A 1HMVA 3AVNA 4IQXA 4FK2A 2BE2A 2Z1GA 1UA1A 4KO0B 3K5LA 2HNDA 4DG1A 1KSPA 4DTJA 4CGHA 1N4LA 2HNZA 4Z4HA 4FM0A 4O3PA 4KSEB 3LPTA 4J9QA 3ISND 1JL2A 4I2PA 1L3SA 1QSYA 1XR6A 4ELVA 2AQ4A 1HMVB 5KFGA 2KTQA 1ASWA 4CGFA 2UVVA 2BE2B 4CGJA 3O3GA 3OYAA 3ZSYA 3V6KA 2HNDB 1RT6A 4DG1B 3A2FA 1QAJA 3VA3A 1JKHA 1WNSA 1VSDA 3PW7A 4FJMA 2HNZB 4XPEA 5J2MA 3H59A 3LWMA 4HUGA 4I2PB 4ZPCA 2BQ3A 2E9TA 1O1WA 4E7HA 2HHSA 5F8IA 4J9SA 2GUIA 4TN2A 2E9RX 1TL1A 2E9ZA 3LAMA 1IM4A 3NDKA 4RNOA 5EWFA 1JKHB 1ZTTA 3BGRA 3RAQA 4FS2A 4DFJA 2DTUA 3F73A 5J2MB 4LSLA 4CGDA 1D9FA 1J5OA 2G8HA 2V9WA 1CZ9A 1C2PA 4HHTA 4Z4FA 3ZCMA 1EKEA 3AVCA 5KFWA 1TVRA 2Y1JA 4R5PA 4ZTJA 3LP0A 3M9NB 2O4GA 3SUOA 4QWAA 3HXMA 1TKDA 3LPUA 3OS1A 3NCIA 1RT3A 3BGRB 3HJFA 4TSXA 1WSJA 4LSLB 1J5OB 1I3AA 3ZSVA 4CHOA 4CJEA 4DL5A 4DL7A 1IKYA 1L5UA 1FK9A 3CFPA 3DLEB 3PW5A 3PW2A 3L3VA 3T3FA 4CJ3A 1TVRB 4R5PB 1JLGA 3LP0B 1SKSA 2XO7A 2KZZA 4NLRA 2IJFA 3ZSWA 1RT3B 2HWHA 2QV6A 3QYYA 4KHNA 3M8QA 4FM2A 3JSMA 3AA3A 4F2SA 4CERA 1DTTA 2VA2A 3V6JA 2HHVA 3UDLA 1T7PA 1VRTA 1IKYB 2GBZA 4CJRA 1FK9B 2BDPA 3CJ4A 2XI2A 4IKAA 2D3UA 3BREA 3U6FA 4ZVGA 3KHRA 2ETJA 2BQUA 1JLGB 3KLEB 1KFSA 1QUVA 4EEYA 5T14A 3NHGA 3M8QB 1RCHA 1U49A 3JSMB 3H4BA 4M94A 3TI0A 1S9EA 4PQUA 4MK9A 4FK4A 1SH2A 3OJUA 1DTTB 4JRQA 3D45A 3V6DA 4C8MA 3ASMA 4NLUA 4FLXA 4QWBA 3QZ7A 4MQ3A 3I5CA 5KFPA 1S49A 1U4BA 5J2QA 1S6QA 4GMJB 1CXQA 2EX3A 2FVCA 4K4SA 2IS3A 4CIEA 2FJXA 1RDRA 1S9EB 4PQUB 3LZJA 3KD5E 4GVMA 1XI1A 3V6DB 4YMEA 4K8ZA 5KG7A 1U09A 4LH5A 3SUQA 2KW4A 4O3QA 3L8BA 4NYZA 3AA5X 5J2QB 1S6QB 3M8RA 3ZT3A 4CEQA 1JLAA 2E4LA 2XY5A 4E3SA 1X9MA 1HQUA 3TAMA 4CE9A 1NKCA 2R2RA 3ZT2A 1Z26A 3G10A 4C8NA 1TP7A 4ID5A 3G6VA 1NK5A 1SUQA 4CEOA 5KT5A 1RBSA 3QINA 5DG8A 2B5JA 4R8UA 1NK7A 1RA7A 4FLZA 3CJ3A 1JLAB 1VRUA 3BDPA 1NOZA 1HQUB 3TAMB 3T5JA 5JS2A 2FVRA 3AO3A 4ZMMA 1C1AA 3F9KA 4NLYA 1KVBA 4FLTA 3RB3A 4CEDA 4KRFA 4ID5B 1SUQB 5HRRA 3OYMA 2B5JB 4R8UB 3NL0A 4M3RA 3LWLA 3OYBA 3CG7A 4O0JA 4AHSA 2AJQA 1XC9A 1WSFA 3BSAA 1VRUB 1D0EA 3V9SA 3C94A 1ZETA 4KAIA 3THVA 5DLGA 4FS1A 4J9RA 4Z4EA 3OYGA 3NE6A 1XWLA 4ZTFA 3OYIA 4K50A 3I0SA 4YR0A 1GOCA 3VN5A 4CGGA 4TYAA 3SUPA 3VQ9A 4F4XA 2WCXA 4Q8EA 3O3FA 4CIGA 3PHEA 4CJTA 4J9PA 5CY4A 1X9WA 3LP2A 2FBXA 4ED3A 4KTQA 4MK7A 3TAGA 3I0SB 2YKMA 3IGVA 4GW6A 1QAIA 4DFPA 4DSIA 3TWHA 4CJ5A 4EZ6A 3QO9A 4NRUA 4I7FA 3NH0A 4BACA 3NH2A 3LP2B 1GX5A 1NK6A 1HNVA 3KOAA 2AX1A 3SCXA 2D0BA 4QWCA 3BQ1A 2YKMB 4N76A 3HVRA
chains in the Genus database with same CATH superfamily
4OZ1A 1RE1B 4FSVA 1TV6A 2HB5A 3QO9B 1OPIA 3GJRB 1EKSA 3UVJB 4K4UA 1NZAA 2RVJA 2IRXA 1KAZA 1HNVB 1FJCA 1CJTA 2WVEA 1DGKN 2VD3A 2HVZA 4CGIA 2QXFA 3SQOP 1ASUA 3J7YU 1T11A 2VFTA 5CZ1A 2D9PA 4O3OA 1W2BR 1OWXA 3OYJA 4DR7K 3HM9A 1L3UA 1FJGF 3C7NA 4DV0F 3CIMA 1FFWB 2CZ9A 1I1GA 1YDLA 5AQPA 4CM2A 3HO1A 3PEHA 1UJ6A 4RNMA 3PX0A 1BHLA 1R8HA 2ATLA 2ATCB 1B0PA 1VQLS 1VQPN 1RTJA 4CQ1A 1Y9OA 1HNIA 4USMA 5KGWA 3KNAA 4DV1K 3FMWA 2V4JB 1TL3B 4I2QA 1KAYA 2FXUA 3DLRA 4DV5K 2B7CB 4G1QB 1M5KC 5I42B 5F9LA 4A48A 1AA1B 2HFZA 2F4VJ 1DJ0A 4WXWA 4A5BA 4Y2AA 4JKGB 4F9OA 4A8YA 2ILZA 1NB2A 1RWXB 1XTZA 4MIAA 1B99A 3BPSP 1NU4A 4I67A 3U3GA 2Q1NA 3G8TA 2LCWA 3H1QA 3H08A 4ED8A 1RT4A 2VJVA 4B8AB 2GJIA 3U4LA 3VEOA 3MTJA 3TZZA 4MMOA 1RT2A 4LF6F 3LH2S 2C1EB 5GAEI 4KPYA 5HI7A 3AA4A 2RKIA 2ILYA 1HPZA 2ZNYA 4KYZA 3DRSA 3K5OA 2ZE2B 3C95A 2V0NA 2E2QA 2W9BA 2C42A 3PSFA 3JSRA 3CJQA 5CYJA 1NMDA 3I56N 3KLIB 4EGLA 1BI4A 3G4SN 5HBMB 3G8QA 2J0QD 2Q1LA 1S7IA 5ETOA 3MM9A 1B0VA 1X0PA 4CFAA 2WBNA 2QG9B 3QT7A 4BG8A 1R8AA 3WEEA 1F1BB 2H1YA 4F4WA 3H20A 4TU8A 3J7YP 1R8CA 2B8QA 4TNOA 1APSA 1S9GB 2VG6B 1U1NA 2V2ZA 1E6YB 3RB0A 1B0TA 3CDUA 1N32F 4E7IA 4DV3J 3CF5L 5D4OA 2DNOA 1C1BB 4FJNA 4PXCA 4LF5F 4CLWA 4JRPA 1IV0A 2G2ZA 5A2QY 2F4VK 1T3VA 1EQ0A 3O8MA 4XTTA 4QW9A 4FF1A 2FC0A 3ITHB 2VICA 3K8WA 3PJXA 4X4PA 2E1MC 3I4HX 4H5TA 4P10A 2CNNB 1EETB 4OMFG 3SAFA 1MA9B 4M63C 2A3ZA 2R2UA 3MM7A 1YITN 2PMZD 3QT6A 5AQGA 2V2QA 3AO4A 2K3IA 3JAMU 4OV1A 2YHYA 4RU9A 5F0UA 2LLZA 3M8ZA 2HQIA 1T0TV 5E33A 2B43A 4JS4A 1XEZA 4Q0BB 4RW7A 4M45A 3TUPA 4DR1K 1N0VC 3HX9A 2WRMA 3MXMA 4JI5K 3R5GA 2EKYA 1LAWA 4DTPA 3ZLJA 3US5A 3C0BA 4H8KA 5A0YB 4ELTA 4TYBA 1VSFA 3R8YA 3H90A 4DR3K 1FXXA 4FJKA 4IFVA 1OYDA 5LMUF 3MEEA 3EVMA 1MWQA 1TKZB 2FBVA 4JD2B 1M1KO 1AUDA 4TU9A 4H0PA 1S6PB 4NE9C 4UTGA 4BQZA 1N33F 1XMBA 4X4UA 4U67Q 1NRKA 3R2CJ 2H9ZA 4WJBA 4BR2A 1IUJA 2Q0UA 1IJEB 2HF4A 2XGQA 4DV7J 2IDLA 1R31A 3R5BA 3J81O 2JX2A 5AQYA 1DTQA 2NXEA 5LM7E 2YJFA 4WXOA 2BRLA 1VRQC 4PPZA 3JQMA 4WF9Q 3OA9A 4PUOA 5I3QA 2FY1A 3MFIA 1ZBLA 3MMAA 4AD6A 2G8IA 1TL1B 2C22A 1GLFO 4DV3K 2QGFB 2AIRB 4C98A 5BPMA 2EBEA 2ZVSA 4PPDA 4A8MP 2X1FA 1RWPB 1WBDA 3L2VA 3VEXA 3CCVN 3LDQA 2I8EA 3HSZA 4EBCA 3KJNB 2AHOB 1HR0J 4BDYA 3EE8A 3W0LA 2PMWA 3P3DA 3W2WB 3FRZA 2YWGA 3SJJA 4ZPDA 4KQZA 4JP8A 3TX8A 1WNEA 1C0MA 2ZC4A 2MSTA 4ZCIA 2DNRA 4CWBA 4FJ8A 1FNMA 5KFFA 4QJVA 2OTJN 4ILJA 4JLHA 3MXHP 2WTUA 4KBOA 4N5SA 2JEGA 2DFHA 2F9TA 2L9NA 4I6WA 1E6VA 3L7PA 2MKHA 2RDDA 3AVAA 1U0HB 1TK0A 1YBAA 3IP0A 3AVGA 3UDCA 1NK8A 1N36F 3VAGA 2IA6A 4KKOA 4CHPA 5D77A 2KJWA 1ZC6A 2HMIB 1W7WA 4ZHRA 1CQMA 2B4PA 5EU7A 1P1TA 4KHPJ 1NK4A 4DX8H 4P2XA 3WNHA 4BG9A 2ALZA 5HP1B 3VQPA 2MGZA 1VHIA 3OL9A 2QTWA 3TJ8A 1CULB 2CPZA 4DV7K 5LSRA 1UFWA 1HBOA 4DU1A 1BU6O 5H1SV 2CVEA 3CB4A 2YHXA 3A5LC 3Q8VA 4PEOA 4NYOA 5E3AA 3KK7A 2VKRA 4NLCA 4EYHB 4X4TA 2MKKA 4DS5A 3NY0A 4P7VA 4CLSA 4NCGA 4HHJA 2YNFA 4CJUA 2BANB 1R3NA 3P6YC 3W9JA 2UXDK 4WTYA 1Q4RA 3DOLB 4DF4A 3LANA 3SQ0A 2W2QP 4C11A 3FBFA 3RUBL 2FGOA 2ZM6F 2V6AA 3CJAA 1H0HB 2EC0A 2XTJP 3H5UA 2N4DA 4JI0K 3QB0A 3E2EA 3D5MA 4DTUA 1VSMA 4W90B 5EX0A 2JRSA 4LF9F 1MSWD 2NXJA 3D6TB 1UA0A 3VCDA 4C8ZA 5M1NA 4URSA 1AZSA 3VZIA 1RBTA 1O0PA 2QWPA 4HDHA 2ABYA 3EKUA 3TEGA 4S0MA 4Q5VA 1VHXA 3BEXA 2OPRB 3SYZA 4B3SK 5H1SQ 5JS1A 2OJ3A 3LOUA 3T1YJ 3H7HB 2QLJB 1S48A 4MKBA 4Y6IA 4WYWA 2M0GB 3JS9A 3SBGA 3B54A 4DMNA 2RF2A 2JEIA 4A57A 3GV8B 3TJ9A 1RYRA 1XMQK 4U67L 3CJBA 3ENVA 4OX9F 4YP3A 4PY5A 1SPBP 2ZKUA 4DL3A 4NLOA 1FE4A 4F3OA 1V9OA 1F0XA 5HVGA 4A46A 1RTDB 1R0BG 2CYYA 1EO1A 5KG4A 2CFXA 2NS1B 2RJZA 1HI8A 3ID8A 3KWGA 3NF9A 1RT1A 3QEVA 2YNIA 2PO4A 3OTEA 2MLYA 3C19A 3MN5A 3R3LA 4BDPA 2OZSA 3ZSZA 2Z8QA 5HLFB 4OZ0A 2DHSA 3QGHA 2EK1A 4FOEA 3H3NO 2B9WA 3CQXA 3AAPA 4DCJB 5FPMA 5KFZA 4DV0K 3KK1B 5L9NA 5DDQC 2VBWA 3I5AA 2OKQA 5IC6B 3HULA 4F2RA 2GHPA 2HIQA 2HWTA 2GGPB 1T03B 3P8BB 3V6HA 3I8BA 4M7YA 2DNQA 3IM8A 3AOBA 3AVIA 3DM2A 1P9QC 1HBMA 4H03B 3WXIA 3C16B 3KMQA 3CC7S 2XULA 1Q1KA 2CRLA 3C15A 3EX7B 5B0FA 2VG7B 2P9IB 3QSYB 3LF0A 3DNCA 1VQ6S 1QS4A 2CDQA 4M3ZA 4LRAA 3DHXA 3TQEA 2W4DA 1LQ9A 4CEAA 3FZHA 3N9UC 5KOWA 3Q8PB 1R8BA 3CETA 1YVNA 4CECA 3C6TA 1WSVA 3GJSB 1JLQA 1DBDA 1FESA 4K8XA 2XZDB 3P83D 5KPTA 2C2EA 4YDUC 1J5EF 4B9TA 3G6EN 2AEFA 3KUHA 4EU0A 4EIAA 4DJBA 1JCEA 3Q89A 4CLZA 5GAEP 1TUWA 2OFGX 5KFDA 3OBYA 3BYRA 1KLMA 3BKUA 5LMNF 3AV9A 2ADBA 2DPJA 1I6JA 1TL7B 1NBEB 3KHGA 2CH6A 3C6AA 4EFHA 5KFHA 3S1TA 5IWAJ 4GRSA 2PFDA 2IVYA 1K8KB 4WFYA 2P1JA 4XDDA 2BV3A 1K1QA 2CNOB 2O66A 1CJUB 5D78A 4C8KA 1SV5A 1UL3A 3IDHA 1NGCA 4BRMA 2E5JA 3MEDB 4KI4A 4H4OA 4KAZA 1OVYA 3VQAA 4K2XA 3MM5B 4K41A 5F8LA 4KHYA 2JC0A 2JGUA 1KONA 4CM0A 1RT5A 4BC7A 4YOXA 3VF2A 1K0TA 2HNYA 1RKIA 4IR9A 5ADXA 1N32K 1VIXA 2HQDA 4CBWA 5BYRA 3UDVA 5DQHA 5LSLA 1VI7A 3SBMA 2UYTA 1FI4A 3VZHA 4G65A 2DFFA 1U6BA 4PAAA 2W9CB 4IO9Q 3H46O 3KLHA 4OX7A 1JWWA 3S9HA 3HFKA 1TFYA 2B9YA 3EZWA 1KQGB 2H4YB 4RG8A 4J5OA 4JI8F 5EHHA 1JNRB 2VDHA 2ACMA 4B9LA 3OXFA 2K3KA 4LFAJ 4OZ2A 4DU3A 3E51A 2VPWB 4ZCMA 3OTOK 3CJRA 2UXCF 4A59A 3NF6A 5AQWA 2X1GA 5F3ZA 4GC6A 4OYAA 1GEHA 1XR7A 2F1FA 2I38A 3NOCA 4NX9A 2BM0A 3DXMB 1A7GE 3FSIA 2E6LA 3QIPB 3W60A 3H5YA 3MR2A 4Y2CA 5AQTA 2OPPB 5KFNA 2UVUA 5SWMA 1C4AA 4UF4A 3KNGA 3WXMB 1CC7A 3J81j 5A8WA 4E8UA 2CPEA 4OI0A 3SMPA 4IDKB 3FCHA 1NG9A 1MU2B 4M3XA 4DUZJ 2A41A 3VF4A 1FKPB 1OMSA 1J9AA 1D5AA 1RTIB 5C7PA 3FVYA 2QA4S 3ZXWA 2J9CA 3SJHA 4DFMA 3KK3A 1UP1A 1RILA 4FYWB 4GMKA 2ALYB 1MMDA 4OYWA 1FKAF 4CO3A 2UUAK 3CNQP 3QRPA 3DDIA 5EWEA 5HK4A 3C14A 1QSLA 1Q0NA 1D8ZA 1HYSA 3O8WA 3SCLE 1RNHA 4CHQA 5KFCA 4FVMA 4KFBB 2CKWA 1IBLJ 5KT7A 4C4WA 2EFNA 1VQ5S 3HHKA 4EO8A 4ZVTB 2O5DA 4CJSA 1Y5IB 5CABA 1EKRA 4O5BA 5BRDA 1KR4A 4TLQA 4WFXA 5FJ4A 3Q23A 1F60B 1NMNA 2CPIA 3R1HA 5K5MA 5AXKA 4ZITA 4KIAA 2KZMA 5J1EA 2HZCA 4C3LA 4HYKA 2V68A 4RWTA 5KFSA 1TKXA 1O8BA 2FTRA 3NCQA 3TU5A 3QJPA 4U95A 1D4XA 4CJFA 3W63A 3PTWA 1RUSA 3EZOA 1K73O 1LWEA 1RAOA 4ED0A 4HTUA 2RSQA 2D3ZA 2XZTB 3U1NA 3DMJB 2CIMA 4OKJA 4DV2F 4ECSA 4RW9A 4YNQA 3J7ZO 2F8SA 5FRNA 1G2EA 3BH6B 4AILC 2PZSA 2DEIA 2XM3A 2BR0A 4BCAA 3LZIA 1LWCB 4BRNA 5JUMA 4QS9A 4CH7A 2GVZB 3S3OA 4ZOSA 2YNGB 4KY3A 1UWBB 3JTOA 1H2TZ 2F5GA 4IO9L 3AAQA 3KYLA 3IWNC 2Y8YA 4AHCA 5DG7A 3SV3A 1QJHA 1AFJA 3SFUA 3CJ1A 5AQVA 2J6TA 3WNEA 1K47A 2DY1A 3VA0A 4FPIA 4CIFA 4OGEA 2M2BA 3G6XA 4X64F 5LJ5Y 3KD1E 2HFNA 4HHUA 3UKRB 4IG3A 1Q8IA 4E0DA 5TKWA 3TVZA 1IH7A 3GB0A 3I9V9 2GZOA 4RW4A 3SZ2A 1OS5A 2HYIB 1LK7A 5DZ6A 4OQJA 4CZFA 3MF5A 3CCRS 1HR0F 1S1TA 5HMWA 3TAFA 3NCRA 3QGIA 1XMOJ 3I82A 2PGCA 3MM8B 1K73T 2E1PA 2NPIA 2AJ0A 2OA8A 2VJUA 2P6TA 2UUBJ 2HHXA 2IGIA 4AF1A 3CJ0A 5C24B 4O5FA 5EDWA 4WZMA 4JS5A 4X62K 3EXYA 1VQSA 3J7ZT 1VQNS 1BA0A 3DWLA 4M1KA 1K6YA 1Z25A 3Q0AA 1RACB 2DVIA 5EN1A 4KV8B 2FYXA 1FXDA 3MUMP 4O4GA 4BDZA 2C2NA 2XB2D 3CEDA 3IAYA 3DXKB 2R7SA 3M2RA 5DETA 1SH3A 4DV4J 3PY8A 4NYFA 2HQFA 4NLQA 5H9EK 4FVCA 2X1AA 3ONQA 1XBWA 3CVKA 4A2BA 2RPIA 1Y3KA 2XHWA 3CQYA 3ZX2A 5B09A 5D0EA 3NAEA 2PI5A 1X9SA 4KH4A 4BGAA 1OJ4A 1IKXB 5ETRA 3D3BJ 5IT9O 2KFZA 1BISA 3PXGa 1JCFA 2XYGB 2RIJA 3LTOA 4KGKA 3FZLA 1RAHB 1U25A 3EE9A 3FQLA 3CM5A 1Y4ZB 5C42A 4JI2K 4H4MA 3CCJN 3NVKA 2VU5A 1Q81O 4LF8F 1VSEA 2J9DA 4CZKA 3QLHB 2HBMA 2UUCJ 3OPKA 4ELUA 1BIZA 2N7YA 3QNNA 1LW0B 4UY8O 4X2BA 1W2IA 3HVWA 2ZH1A 3AODA 2ROGA 1EQMA 3D2FA 2LEAA 3NMRA 5SZTA 3M8YA 2KO1A 3IR6B 5G4DA 1L3KA 2B56A 1X3NA 2RN2A 5FLXU 4K4WA 3I0RB 3THWB 4LQ9A 4J2AA 3MECA 2J8SA 3UWTA 3BSNA 5K8PA 4JI4K 1ELOA 3DDKA 4DEZA 1SKUB 2BRKA 4L74A 3W9HA 1EZZB 4IR1A 4AFFA 5IS2A 2VWJA 2JL9A 2GVDA 3TQ1A 3T1YF 1S1WB 5AZJB 4ISGA 1XNRK 4DQIA 2AV5A 1NEEA 2H3GX 3VAJA 2CQBA 3ICLA 4BR4A 4WE1A 2XSJB 4XH4A 1GMVA 3F56A 1S72N 3W1YC 3GR1A 2FSJA 4F02A 2PMHA 1NHVA 3A8EA 2HMPA 2NRWA 1IBMK 2XCPA 5I3UB 1ATNA 3I8DA 4I9QA 3FCVA 4JK9A 3CDWA 5CHCB 3LP3A 2VH7A 3NBPB 2E6MA 3T9ZA 4EHUA 3PLAA 1BWVA 2P9SB 1SC3B 3CO0P 4CBXA 4DXLA 1QZ5A 1TMMA 4FJGA 1B70B 4ZIWA 2ASMA 3R7SB 4U9RA 2RRAA 2XY8A 2APOA 2Z1IA 2HQ3A 4PXBA 4BHQA 5HQMA 3BN7A 2NXUA 2UU9J 3GIRA 2YWEA 1B64A 3S01A 3ULEB 1S79A 3BBBA 4IJNA 3KWIA 2DJWA 1HNXJ 1YHQS 1S9GA 2L9DA 3IC1A 3VVUA 1NGAA 4WTOB 4F67A 4ZVHA 3DLJA 1KVIA 3P5TL 4BC4A 3OXLA 2I5JB 1YJ9S 3VF0B 5DS7A 5E3CA 3VQSA 2HZAA 5HROA 3P1GA 2UXCK 2P6SA 2ZD1B 4DL4A 4USWA 2PY5A 3CMES 3RR7A 3VVTA 5BRFA 2L41A 3PR4A 4Q7AA 4YB6A 2RQ4A 4DN9A 4FJLA 1JLEA 4N41A 5BREA 5GAGI 2QO3A 5DJBA 6FDRA 3AOAA 4WQ5A 1V3RA 1RHRB 3AD8C 2D3O1 2D0AA 4BROA 4I6YA 5LSOA 1EX4A 4FKYA 5KFEA 5KOXA 3DLLQ 1NWKA 3RMDA 2XS7A 3JAMY 4EYIB 4CZMA 3Q8SB 2DFEA 1RGVA 1C0TB 1FDDA 2RILA 2P9CA 8RUCA 3MWTA 1GLDG 1WN7A 3TA0A 3EEQA 2LA4A 1HLUA 4IQXA 3UKUB 1YUWA 4JKBA 2Z1GA 4NASA 1UA1A 3M7VA 3AOCA 2J0SD 3DHWC 5IWAF 3AA8A 4IOAL 1BG3A 3EVWA 1CBKA 3THYA 1QSYA 4EAHD 2AW0A 2POKA 3H2UB 5KFGA 4FNHA 1ASWA 4CGFA 2UVVA 2BE2B 3ZTQA 3OYAA 4X4QA 3V6KA 1QAJA 3I6PA 2ZFHA 2FF6A 1JKHA 1WNSA 1VSDA 2UP1A 3DJCA 4K7QA 4XPEA 1M90O 3BKTA 4HUGA 2E9TA 2Z2YB 2GX8A 1RHJB 4DR6J 4J9SA 3TZYA 1WSRA 3DDNA 2E2PA 1TL1A 2V7ZA 2DNPA 1RWVB 3NVMA 4LFBJ 3BGRA 1Y10A 3RAQA 3CD6S 4K0KJ 2DTUA 3A5MC 3W2VA 1P6TA 5J2MB 1D9FA 3LUYA 2E2OA 2DR6A 3T69A 4Z4FA 1EKEA 4L72B 1RI7A 2FB0A 3DFEA 2Y1JA 3UD5A 4R5PA 1SC4B 4MIWA 3LP0A 3FR0A 3R5DA 4V19X 4LFAF 3GJQB 2WW4A 3J8AA 1M0SA 5E3PA 1I3AA 3VEYA 1TUVA 2GMLA 1UTAA 2QWOA 3GE1A 3HOSA 2ZNZA 4C97A 4CJ3A 1UPPA 3M2UB 4B3TJ 3L9ZA 4NLRA 2QV6A 4KHNA 3M8QA 4C1NI 4DV2K 3GCWP 3AA3A 4JV5J 1XNQF 3S41A 2DGUA 1YRXA 5ETQA 3V6JA 2HHVA 3UDLA 4PZVA 1T7PA 4TKTA 1WI8A 1XQIA 2RQCA 3CJ4A 3NEKA 3MGJA 2A40A 4IKAA 4BRKA 3NS7B 2R4FA 3NS6A 3KHRA 3BH7B 1KD1T 1JLGB 3CC7N 3KLEB 4K43A 1QUVA 4EEYA 5T14A 1UETA 2LQBA 2HSTA 1X4EA 2R7TA 3JSMB 1CVJA 5I4MA 3D6HB 4FK4A 4OHZA 2P9UA 2XO6A 5DM7L 1DTTB 4V1Ak 4ED5A 4DUZF 3VAKA 2IVFB 3TTDA 1M90T 3I5CA 3A0IX 4CYUB 1UPMB 2J7WA 5J2QA 3VHQA 2EX3A 1IXKA 3DN9A 2VYPA 3CERA 2X3GA 2IS3A 2V52B 4F4AA 2F7TA 3PHTA 3OTDA 2QW9A 1ZPWX 4JI6J 3WXKA 4YMEA 4A61A 4X64K 1U09A 3U27A 3FE1A 3GZ7A 3O6WA 4KH6A 4I6MB 2J8AA 2JVOA 3L8BA 4NYZA 4ZLPA 4ATNA 4A2AA 1JLAA 1V3SA 2IVOA 1PC5A 1Y7PA 3M3ZA 4HR2A 3MMCA 1X9MA 3TAMA 3G87A 1WF0A 4CE9A 2R2RA 1YXQA 3MK6A 1IBLF 3G10A 3PRBA 1RBSA 3S8SA 4ZKAA 1F9FA 1YJWS 2AYBA 1SAZA 3VGSA 3OBWA 1FE0A 3L7UA 1R6YA 1NOZA 1HQUB 3DLLL 3T5JA 2QIFA 2FVRA 4ZMMA 3F9KA 1PCAA 2CPHA 3AY9A 3QRRA 3OYMA 1UEKA 4R8UB 3M32B 2Q97A 3JSYA 4O0JA 4YOYA 4PABA 3W9IA 1XC9A 1QQNA 1OH5A 1VRUB 4HACA 1RHQB 4XEIA 1CS4B 4B3RJ 4ZTFA 4LC9B 3IA0A 2NYHA 4K50A 1WDDA 3I4PA 4CGGA 1RK8A 1S6UA 2C2OB 3SCJE 2WCXA 3FKBA 4CJTA 2PEBA 3CCSN 1X9WA 1NGFA 5B7WA 3LP2A 1X0FA 2FBXA 4KTQA 3TAGA 2DY9A 3FMBA 1ZS6A 2CUYA 3IGVA 1HWLA 4GW6A 4DFPA 2GJ2A 4DSIA 1FW6A 3ZTPA 3BUZB 1ZAVA 5AXNA 4M5JA 2KFYA 5HJYA 1YJNS 1ZZFA 1MN9A 2EFVA 3HD2A 3HHLD 4ZN1A 1Z2ZA 1Q5YA 1GX5A 4I4BA 2P8IA 3KOAA 2AX1A 3SCXA 4LF8K 1T95A 1YIJN 3BQ1A 4N76A 2YKMB 4OHWA 4CO5A 1OQ3A 4UOCA 4CI0B 1AFIA 4BREA 1WUUA 5IM0B 3VGUA 1RABB 1NH7A 2D41A 3TSPA 1RXOB 3NLCA 1A6LA 1WC1A 2DITA 4GKJF 4K25A 3CFOA 1WDTA 3EL2A 4IRKA 1LV5A 3C6UA 4CLFA 1TV6B 2LXFA 3S3NA 5HQ8A 4NA1A 3BGLA 4M95A 5EXWA 3AQOA 1XMOF 4WKRA 1RP5A 1CJTB 3EPGA 2DGVA 3TANA 1JIHA 2UUBF 3NGIA 4FPAA 3MMJA 3G0ZA 4FZXC 3C7NB 4FWOA 5E26A 3PYEA 4LRCA 1JLCA 3NWGA 2HVDA 3PRVA 4MKVA 2QA4G 3GPAA 3ZT0A 2VG5A 4H0YB 4CF1A 1RT7A 3ILLA 1RTJB 4OGCA 4AT1B 5K9FA 1HNIB 1Y11A 3V9UA 2DRDA 5LL6d 3V1OA 1SQEA 5CYQA 4I2QB 4JK7A 4LF1A 2DCLA 2WSEC 2PFUA 5DG9A 3BPDA 4DV4F 8ATCB 3T1HK 2GO9A 4EBEA 2EK6A 3OYHA 4DU8A 5T7LA 1UOCA 3QBCA 2RRBA 4XAKA 5F1XA 2DHHA 4NA2A 1KWMA 2XMVA 1YI2N 4ED2A 4F4KA 3ZSRA 1C0GA 4HVZA 3K89A 1VQ8S 3TSQA 3B82A 3W65A 3SMSA 1XR5A 1REGX 4CLPA 2CQPA 4DTOA 3NGRA 2W4CA 1DAXA 1R0AA 4W5QA 1U6ZA 5G0RA 3HPOA 3T5HA 4XK8C 3O9QA 4ZVEA 2IOCA 3VR1A 1RT4B 2KYXA 4F3QA 4KHSA 5FPNA 2AEMA 3BO4A 3VWSA 1UJ4A 1GT8A 3OSPA 4F3TA 4J9NA 3CPEA 2UUCF 4J8FA 2W9CA 1Q82O 3HHLA 4O3RA 1RT2B 2XHCA 4DUYJ 4O8UA 2FJDB 1LXNA 5GAGP 3PV8A 5A6PA 2RKIB 2FGCA 1BQNA 1HPZB 3QMQA 4Y1DA 3DRSB 4CRJA 4U6PA 3AQPA 2G0CA 3CW2C 4WP8A 3LGHA 4FDFA 4FBTA 3EY1A 1P8GA 1CJVA 1P9YA 2W9BB 3ENWA 1BIUA 2JWNA 3NS5A 1F3VA 4RNHA 1QVGR 2V67A 1HJOA 3UNYA 3MM9B 4FOIA 4ECQA 3R5AA 1VQMS 2E44A 3IRXA 3GIMA 3RMBA 2MB0B 1U04A 2OHDA 3J7AP 4L73A 3THTA 1HX1A 1KFDA 3B6PA 2J4RA 5IV4A 2VASA 2BUNA 3W62A 3M8PA 5KFIA 3C46A 2XMAA 4O8KA 1RHUB 1LCUA 1NAQA 5ETMA 1A5VA 1QTNB 4O0IA 2A18A 1JK9B 3CCRN 1PAEX 3R7BB 3TUIC 2PI4A 2QLBB 3AVHA 4XPCA 3POTA 4ZDNA 2QTDA 2ASJA 2J9DE 1WOQA 3SDEA 3MM7B 1M1GA 3JYTA 2CQ0A 5CQGA 2M8DB 1PJ7A 4CIOA 3DOMA 1VK3A 1JMTA 1NJWA 3W8PA 2NSCA 3GMGA 4DUTA 4FZZA 4RW7B 1HHTP 4H54A 2IC3A 1NLKL 4O0NA 1Q82T 2ZH8A 3NMUA 4B9UA 4C23A 1C0FA 2FC8A 4PWWA 2CQ3A 1YTYA 4WZQA 2DISA 2V5HG 3RU0A 4A8QA 2W8LA 4JN4A 2UU9F 2UVWA 1KXPA 3P49B 5B0DA 4HI1A 4EZ9A 2KKZA 4F4ZA 3MOZA 3MEEB 4K4ZA 4R25A 2N4CA 2CJ9A 1VQPS 1QAYA 3RZAA 3G9CA 3MUTP 2VF3A 2GIRA 3PVXA 1WORA 1Y3JA 5C12A 3GWCA 1WACA 4L6V3 3O1BA 3N6LA 4FVUA 1IBKK 2V2KA 2Z1HA 3SPZA 4FCYA 1YLXA 1BO5O 3OYNA 1DTQB 2CNKB 1NGJA 1IR0A 2VFRA 2OPQA 4CP5A 2FJAB 3C2PA 2D4WA 4JKDA 1DKGD 2Z2MA 2VWBA 4PUOB 2KI2A 1O51A 3DRPA 4OJHA 1XNQK 3MMAB 1IJJA 4ZVUB 3W64A 4X65F 3HK2A 2XG8A 1IQZA 4GVBA 1BUPA 4AHRA 5HMZA 5B0CA 1RCXB 1VBYA 2O8FA 4X4RA 4D3HA 3R9LA 1NK0A 2H5JB 2GA7A 2OGUA 4OHXA 3R27A 4CJQA 2WK4A 3AVBA 4JKEA 4DHYA 5CH7B 2VBZA 1S1XA 3MCNA 4NXNK 2JHEA 2OEKA 2FLNA 3LDSA 2V94A 3RB4A 1HNZJ 3OVNA 2NRVA 1VRTB 3G25A 2RU3A 1B92A 2OP5A 2VKZG 3HVAA 5D0HA 1WOPA 5HAOA 3CIPA 1E6VB 2QSWA 1WSIA 1RDCA 3GONA 4DR5F 5C2GA 1NDCA 3I56S 3FRYA 3G4SS 3L2WA 5BJRA 4KKOB 3KHHA 4FLWA 2LQ8A 4JI7J 1YQHA 3QT5A 1S12A 4ZHRB 1UVNA 1GLBG 4CZHA 3RBXA 2A0FB 3NNAA 3I9ZA 4DR6F 3OR2A 1S7HA 4RWXA 5L1JA 1TUUA 4CEFA 3ADAC 2MGZB 3V9ZA 4LFBF 2HGMA 4JI3K 1HBOB 2DCUB 3P31A 4JK8A 4KRWA 5EWGA 3H1VX 4LF4K 3S7RA 4WWSA 1RAAB 1Z2LA 3Q8RB 3PCOB 4MDBA 2MQ8A 2B9EA 2RHKA 4YHHK 4PKGA 4OKKA 2CPFA 3NNCA 1M5OC 4NCGB 2YNFB 5LJVA 1YITS 1S0NA 3CCQN 4BE1A 2LDIA 4CH0S 1LOUA 4E1JA 4FP9A 4CZGA 5H9FK 4UOGA 5BR8K 1HW9A 1JB0C 3HSJA 3RMAA 1YGYA 4C11B 4BVPA 3DGPB 5AQKA 4JYAK 2VB6A 2BYCA 3SAHA 1YHQN 3FGUA 5EY4A 2C3YA 4JV5F 2JJ4D 3HSGA 3W3DA 2QT7A 1UFLA 1LWXA 2R8GA 4ECXA 5HJXA 3HHNB 4UT4A 2GEMA 2DIVA 2MKCA 1X8DA 1FXRA 3B8HA 2W40A 1AZSB 1FFSB 3CMEN 3CM6A 3IMXA 4EI2A 1Z4UA 1SJ3P 3TVKA 2XNQA 1TKTA 2OTLN 4C0BA 3KWMA 3PUFA 3GDQA 1ZOTA 3UR3C 1S6OA 4KREA 2XBPA 3CQ8A 1F3FA 2NXNA 2RF2B 5BYQA 4QWEA 3I31A 4JI6F 1D09B 3L3CA 2KH9A 4ALZA 1KCFA 1MMLA 1TYQA 3IGNA 1JXBA 4QPXA 4GKJK 3ENAA 4FYXB 2M70A 4B1WB 3Q86A 4U7UD 5ADZA 1RDWX 5KRSA 1RT1B 2RAQA 2YNIB 4YFUA 3HPHA 2YV0X 1BY9A 1H3DA 2CG8A 5BYSA 2NRZA 1Z05A 3RBEA 4BRPA 3M9OB 1Q18A 2R8IA 5E5NA 2VBYA 3TARA 3T6JA 4OPJA 2UUWA 3ATUA 1U26A 1WI6A 2HIYA 2M52A 2OTJS 3PR5B 2DR5A 3BM7A 1DQAA 3W66A 1BQMA 4LF7F 4NZ0A 3CULA 3K2PA 4ERDA 3GR0A 2HBQB 4USIA 3H45C 3KG1A 3LALA 4DR2F 2HHUA 5FLXY 2AD9A 4RW8A 1L3VA 3AAWB 3VQDA 4G9ZA 1MG7A 3DM2B 1HBMB 4NWBA 1NGDA 4CF8A 3CCUN 1OO0B 1KOOA 3CD6N 1J53A 4YOTA 4P74A 3WHIA 3C15B 3DRXA 2XQCA 4QIVA 4XH1A 1RLDA 3MD1A 4U7BA 4CD3A 3V9WA 1VAZA 3VAFA 4M5GA 3RAMA 3HSCA 4G1IA 4J2BA 2JH3A 4USKA 4J2EA 4UUWA 4DTNA 5KFVA 5LJWA 2AEJA 2U1AA 4BVOA 3C6TB 1NDPA 1X31C 4HTJA 2DY4A 4FWQA 4IQMA 4B9MA 1JLQB 5JMNA 4KTZA 4O55A 3TP2A 1KHWA 4OYIA 4FJXA 3WQUA 2NUUG 1VC0A 3QZ8A 4NXMJ 2K7KA 2E5LJ 3HSTB 3L2RA 4DHVA 3I55N 3L7OA 3CJ2A 3BZQA 3BF3A 4ZP7A 3FFIA 2JC1A 2RT3A 1DZ5A 3QETA 1W97L 4OYZA 4ZPAA 4WQ5C 1KLMB 2DRAA 3VGKA 5KFOA 2N7CA 3ULHA 1NJIO 3PO5A 4DPOA 2HOEA 2VDIA 2DPIA 4DSJA 1SV5B 2DNLA 2FLOA 3S3MA 1BD6A 4CJLA 3S6EA 4H4OB 1HQEA 1FRMA 2IJNA 1EP4A 3MPWA 4DU4A 4U8VA 5J2NA 4ISFA 1RT5B 3ENHA 4K8RA 2HNYB 5KPRA 1Q86O 3MCPA 4N77A 3PRDA 4CH1A 2PIIA 3AH6A 3GTYX 2BGGA 4ER8A 5F8GA 5MAOA 3W5YA 4OPKA 3SMZA 1NNEA 3PACA 1S1UA 5K8MA 1JLFA 3KLHB 3U9DA 1PO6A 2RHQB 4BGBA 1WD6A 3B78A 2VQEJ 2HBLA 3UO0A 5IOLA 3SI8A 4LY7A 3Q2TC 1H2UX 3NP5A 3R6GB 2VFUA 2VOOA 1BMQB 2IVNA 1P27B 5KTQA 2ZBIA 4CFDA 3HT3A 3M9MB 4WIIA 2FY8A 4PG7A 1H98A 2DNYA 2ZBPA 3HCXA 3KLFA 2K1RA 2FJWA 2ZJPQ 3M05A 4FJIA 1S0VA 3TYTA 4M5DA 3ALYA 3RR8A 2GCFA 2MHEA 3D0GE 1TL5A 4QYRA 3OL8A 2Q31A 5A8WB 4P72A 4RWWA 4MTPA 5KT3A 2ITMA 4EBDA 2N3LA 1PIEA 2NUHA 4DCOB 2NCKL 2MZJA 3CJ9A 4RBUA 4Y0FA 1VQYA 3KFWX 2WC9A 3QNOA 1Q86T 2AGQA 5ETNA 4CNYA 3GFHA 3KK3B 2RS2A 4ECVA 1J6ZA 2J7UA 3NRBA 1YF5L 2D5RA 3GG1A 4A8OA 2ZC3A 4X65K 4QW8A 1X3MA 4BE2A 4URGA 2HBJA 4KHWA 3OS2A 3C14B 4GC7A 2G1DA 4AQYJ 4PXEA 2LDYA 1HYSB 5F2RA 2VQFF 3Q7BA 2P5OA 3G6ES 5GAHU 4X66F 2PDAA 4RBTA 1H6KX 4QWDA 3T7ZA 3G96A 5C15A 1G1XA 1KHVA 3K17A 5DQGA 2P9LA 2Y0SD 1I94F 5HN0A 3K59A 3TTFA 1N8RO 1QVFR 4H5VA 3KLEA 2XMWA 3BP8A 4Y0WA 2XY7A 3KJFB 4DQRA 1E3MA 4GV9A 2JWLA 4NLWA 2DEJA 3NXZA 4HDGA 2F7VA 5EUHA 4I56A 5IXUA 2C3OA 3FBCA 2GQCA 4KH1B 3OBIA 5J1EB 4TVAB 3T19A 1ZBFA 3KLGA 4DR5K 2BACA 3KKFA 1HI1A 1TKXB 3CFRA 3D3CJ 4F3MA 3Q2SC 2I2YA 1OH7A 3IAM9 1LWEB 4L75A 1YVFA 2MJUA 2FSKA 3PKYA 3AO5A 2MDAA 2HHTA 4DL0C 3MWPA 3D67A 3GYXB 3AA9A 1FEEA 3W3SA 5AXLA 4IWVA 2X78A 4EHTA 4RW9B 4AL7A 3H40A 3EPIA 2XS5A 1HNWJ 4LRDA 3CSKA 4NEZA 1NGGA 4KTWA 2CAJA 1MNEA 1C1CA 1MROA 1Q5VA 1U1PA 2DO4A 2G8KA 4DV6J 2YPYA 1VOMA 4URQU 4KB1A 2C2MB 3ENOA 4DQSA 1VHFA 2PAVA 2EFPA 4ECRA 2K8GA 4BR5A 1UVMA 4CLLA 1K9MO 1RYSA 4CLYA 4DKWA 2NRHA 2KDOA 3JS6A 3SLCA 2MY8A 4YDDB 1V6HA 1VQOS 3P39A 1UEUA 1SL1A 1N8RT 4DI6A 1ZBUA 2DR8A 3NGDA 3SFGA 1BWEA 4DN0A 1U45A 1SJFA 2ZBCA 4IG3B 1WC5A 5AFUH 1M5PC 3ELHA 4DF8A 3KTQA 4Y3CA 1FRIA 4TLRA 1MMNA 5HVHA 4DR7J 2P51A 4RW4B 1IWGA 2G8UA 5L1IA 2J76E 1S22A 4N56A 2ZJPL 2FJVA 3LPYA 4UUXA 3CJCA 1R59O 4OHVA 1S1TB 3CCEN 4FLVA 1T9UA 4MAKA 4Q2MA 2HBYB 4E2FB 4DV1J 4BLGA 2ZDOA 2A10A 4DV5J 1RA6A 1YTAA 1VQKN 2B0GA 2B4UA 2XSFA 1V3ZA 4KT0C 2H65B 5AE2A 3AVJA 3VQ7A 1TAQA 1WKJA 1SXLA 2NRTA 4OYMA 3FK4A 4I9LA 1FRKA 2YKPA 4JV0A 3RW6A 1DHMA 1XIQA 1XN9A 3PG9A 1GNKA 3CCWA 2Z2ZA 2HBRB 1X5PA 4O4GB 2K06A 3CGIA 3O6QA 2UVRA 4BWJA 4GKKF 4DL6A 1FEHA 4IUFA 3ZT4A 1YK9A 4CI6A 2LP4A 3DCAA 2BE9B 3M2RB 1KRPA 3EN9A 4XDCA 4W5NA 4DOZA 1HYVA 2HVEA 4WFZA 2WSCC 2C2ZB 3IMQJ 1NLVA 2ERRA 1EAYC 3B4MA 3Q8QB 4OPAA 1S10A 3K9KA 4QOTA 4X4VA 1T3OA 3KLVA 1FDAA 3V9XA 2QK9A 5F8HA 3E9OA 3K57A 1RWOB 3QEPA 1BCOA 5DMRA 2HS3A 4GV6A 2JOQA 1B9DA 1RDDA 4LBIA 3CXCM 3R7NB 1VC6A 2HWIA 3J80O 4DR2K 1ZM3A 2H3EB 5THWA 1TUYA 4LQ3A 3CUNA 5C42B 3TAQA 1YBUA 5SUHA 3OVSA 4FNIA 4UOFA 4H4MB 2CGLA 1P8ZA 3HF5A 3ZNJ1 2XNRA 4C8LA 3UN5A 1BL3A 4U8YA 5CCMA 3LGNA 3J81U 4LIWA 3WIUA 3MR6A 1VLYA 4JEPA 1FJ7A 3PYDA 1VSHA 3E9PA 3UCGA 3D2FB 2EPIA 4YR2A 5F0XA 1NOYA 2JLFA 4DSFA 1FKOA 2XWYA 3HHLC 1PAUB 1KEKA 3MECB 1YJ7A 1PILA 4QIFA 5BRHA 5FD1A 2XGPA 2CJAA 2EKNA 1CXUA 5C2DA 2QWLA 4K42A 3F44A 2E1ZA 4HL9A 1HKAA 2R7RA 1KVAA 5CR4A 1NHKL 3HFVA 2V4QA 4UY85 2GVDB 1IQTA 2BMBA 2HKEA 1ROFA 4ES3A 3MTKA 3MAQA 3GE9A 1JJ2R 1FD2A 4I6AA 1SIWB 1ZAXA 4M3WA 1WUAA 2KM8C 4BRHA 4WE1B 1NKEA 3O9UA 3HSDA 4DR1J 4CT8A 5DQIA 4JI5J 2XMKA 3VQ6A 2DKOB 2PYLA 4NA3A 1EQYA 2QZ8A 1NH8A 5KFLA 1X4FA 4L8RB 1HPMA 4DR3J 3O3HA 3A8YA 1LEOA 5KFKA 4DTSA 2M5YA 1UMJA 1RDAA 1H72C 3TR8A 4OJ3A 1VSKA 3W5XA 3DKDA 3VGVA 4BC9A 2MJNA 3CT9A 3ILIA 3A3OB 4IH5A 2E5IA 2EHGA 1WEYA 1WOSA 3SBTA 3VERA 2V34A 1CC8A 3M6GA 2BH1A 4ZPVR 4CJVA 3M6VA 3LA0A 4JI1K 3ISZA 3JB9k 1HWJA 3IR7B 3ZZUA 2BJDA 4H4KA 2W01A 4OX6A 1MW7A 3TAPA 2C2RA 3RSEB 4O23A 4ZS6A 2HK3A 5GIPA 3GYGA 5HROB 4JB8B 2YI1A 3P4IA 3TJAA 2E1CA 3FC9A 1I5OB 5L39A 4Z4GA 4KO0A 3SQ1A 3KHLA 3JXUA 2DXDA 2QMWA 5HMYA 2R9LA 5BPLA 4RZRA 4NCBA 1JLEB 1L3TA 4DS4A 2DH9A 4CF2A 1WELA 1HMVA 2QYGA 4FK2A 1I51B 3UI3A 1DQ8A 4ILGB 2HNDA 4DG1A 2VFSA 1KSPA 4DTJA 1KQSR 3CMAS 4NXMF 1HLWA 2HNZA 4Z4HA 4FM0A 4KSEB 3LPTA 5IQQA 3CCJS 1CQNA 4I2PA 1L3SA 1XR6A 4ELVA 2ZDPA 5DO2A 2HHHF 4CGJA 1FWKA 2GV1A 1GLCG 3LL3A 1CEZA 3A2FA 1OH6A 3CCMN 4DX6A 4IZ9A 2VGNA 5I9EB 1H1VA 3AXKA 3QFWA 5B0EA 2BOPA 4FJMA 3IWLA 3H59A 3D6RA 2ZKTA 3THYB 5DZ7A 2HHSA 4E7HA 5D4PA 1UZHA 3FCWA 3A8IA 5D8HB 3VETA 2OUGA 4ANDA 2E8AA 5KPZA 3LAMA 2YX4A 3CE8A 3J7A1 1JKHB 1ZTTA 3QNWB 1U1MA 4DFJA 1T44A 2R7VA 3ZX0A 2DH7A 4LSLA 4CGDA 2VQFK 2V9WA 2ZITA 1FJEB 3WBZA 2CQHA 2FUG9 2CGKA 4X66K 4P2FA 3FZMA 3HM8A 1WEXA 2QI2A 3M9NB 2N82B 3HXMA 2UXDJ 3LPUA 2DPNA 1RT3A 4OZ5A 1I94K 3BGRB 1ATSA 2I9SA 2VONA 4OPHA 3W2VB 4TSXA 3CDBA 2R7WA 4CJEA 1IKYA 4ANEA 1S72S 1L5UA 1FK9A 3DLEB 3PW5A 2QM1A 1SS6A 2ZWOA 3AB2B 2VQEF 4R5PB 3LP0B 4JI0J 1V5IB 4LFCJ 2KZZA 2IJFA 4HLBA 1NSQA 3GP9A 2JWKA 2QFIA 4F2SA 3A12A 2FPHX 2W2NP 3F5TA 4PL7A 2GWJA 3MCOA 1HFEL 1VRTA 1G4CA 2CGJA 1WEZA 1QVGM 4J37A 2VFVA 1KFSA 1QQOA 3M8QB 1BQXA 3SSSA 3H4BA 1S9EA 4EUVA 4OZ3A 4B3SJ 4FO0A 1A9NB 2E88A 4C8MA 1CLFA 2OANA 5ETLA 3QZ7A 4MQ3A 2HS4A 1S49A 2ZUAA 1U4BA 4M5MA 2GUPA 4GMJB 3DU5A 1CXQA 1XMQJ 4K4SA 4CIEA 5IFMA 2P9UB 3LZJA 1FTCA 4C8YA 1XI1A 3L4IA 3MN6A 3ZC4A 2AP1A 4LH5A 2UXBF 3EVOA 1SCJB 4O3QA 4LJMA 4ZJOA 5J2QB 3RRKA 5A2QO 5K20B 1I3OB 2IFXA 1GXUA 2P9KA 2HFOA 2BUPA 1VYAA 1KQFB 4E3SA 3NGTA 3RYLA 3LO3A 1NKCA 1ZBTA 2JFKA 2LMIA 4ID5A 3QICA 1NK5A 1SUQA 5KT5A 2B5JA 1RA7A 4QBUA 4FLZA 3CJTA 4V19S 1JLAB 3DGPA 3PIPQ 4DV0J 5AJ3K 4RLEA 3MMCB 3TAMB 4B3MK 5JS2A 1W7AA 1C1AA 2J7KA 4KRFA 4LFCK 4NLBA 5HRRA 5KQ8A 2O3DA 3LWLA 1N34F 1RAIB 4ZPTR 3CG7A 2CJXB 2A2DA 1WSFA 3BSAA 5JVHQ 3QATA 3V9SA 3U02A 5E84A 4KAIA 3THVA 4FS1A 1RQ0A 4M5IA 2P9EA 2BXJA 2ADCA 3VTHA 3GFZA 2KHCA 4WP3A 3NE6A 1Z6RA 1XWLA 2VBXA 1Z1ZA 2NREA 3OYIA 3P45B 4L3KA 4PG6A 1YBTA 1AW0A 4HACB 1S57A 5AQNA 4BR9A 3GCXP 4HT5A 2ZOGA 1RGIA 2K2PA 4KJIA 5HVFA 1XERA 4OZJA 2J0XA 4ETXA 4FPBA 5GAEU 4DQ8A 3ILJA 5U47A 4MK7A 1BHNA 2WSFC 4LR8A 1RWNB 4EWTA 1IM6A 2BJ9A 5CA5A 4WCEQ 2MZTA 3KUGA 4RTFD 5I3PA 4CJ5A 1RWKB 2LEPA 4EZ6A 3Q83A 5CD4A 1HNWF 4I7FA 1FTRA 5LXYA 3NH0A 1SBRA 4YS2A 1WB9A 4BACA 1X4DA 3LP2B 1NK6A 5L38A 1NGIA 4WF9L 4DV6F 2L48A 2CQ1A 5C2FA 1X7VA 4YY3F 4P71A 3ID6A 2CWXA 4DSEA 5JVGQ 3NMAA 2C2KB 4MO4A 5GMEA 2X6NA 1FJGK 4Q44A 3K7RA 1KTQA 2KT2A 3TZXA 3W8GA 2LU2A 3VPZA 4DMZA 4ZP8A 4N8OA 2ZGYA 2C28A 1U48A 2YKNA 3PJWA 3H25A 4W5OA 2YJEA 4K4XA 4LH4A 1EXQA 1PYOB 3DOKB 4FWPA 1QY7A 1N32J 5KT2A 4Z7YA 3VQEA 3M4XA 4K5RA 4DR7F 3EDQB 4QPTA 3C6UB 1BXNA 2QEXS 4FF3A 4DR4F 1ZTWA 5D4NA 4F25A 2ACYA 2VWKA 2WHOA 2E2NA 3A1YG 4CK3A 2YQ0A 4DV1F 4BRAA 1N48A 4RX6A 2DNHA 3E9LA 2UZAA 3K8VA 1SJRA 2CQCA 5HRPA 3VEWA 1ZYQA 3OTOJ 4ZCLA 4QYZJ 4MFBA 4F04B 4OJGA 5DK5A 1JLCB 2GNKA 1QAXA 3PZPA 1GAOA 2KG1A 1VC5A 2VG5B 2XC9A 2EXUA 1UVLA 2VA3A 1G99A 1RT7B 4TQSA 4H5WA 3DLBA 2RE1A 2DXFA 3AO2A 2AYEA 4FW2A 1LWFA 3QERA 5HATA 5CYQB 4ZVQB 3L0QA 1Y97A 1JXVA 4LF6K 3QIOA 1LXJA 3I5BA 2V63A 3M8WA 2CWKA 2B6AA 4GO7X 2DXEA 1Q9YA 4R0JA 1K1SA 1A0OB 2DNGA 5T7LB 4R0EA 3ZO7A 4OI3A 1QE1A 3L4BC 1CSJA 4E1MA 2Z58B 2PYJA 4LSNA 1RWWB 1WWHA 4Z4IA 2EFOA 3EUNA 4CJWA 3BV8A 2GV9A 3MM6A 3A5NC 5K14A 4TY9A 3V4IA 1R0AB 4MDAA 1U2RA 2MQLA 2ATQA 5F3TA 4ZJLA 4M3YA 5G0RB 1SL0A 3D1HA 4QZVB 3FZBA 5JVHL 4CDIA 1FHTA 1X5TA 3T5KA 2UUAJ 3HP6A 3M8SA 3VQQA 2IVMA 1X4CA 2VC1A 4LF5K 1RTZA 2I6WA 4B3OA 3LDPA 4MJKA 3HHLB 2AKWB 1G15A 4ID1A 2LU1A 3HOTA 3N79A 4AE5A 6FD1A 1F5BA 2AU0A 5EOYA 3D7SB 1BQNB 2HW3A 3A8KA 1PSDA 2DT9A 3CCSS 3GFXA 3AVLA 4NEYA 4K4TA 1HBUA 1CJVB 2W41A 4QOZB 2F3JA 3ZEUA 2OSRA 3HZ6A 1VJWA 2DTJA 3ZTSA 1TQLA 2F4VF 1U7LA 4QYZK 2YX7A 4JNEA 2KM8B 4NOHA 5BR9A 5HOOA 2MEWA 3FEXB 3IRXB 2YHBA 1IKWA 1VQON 5KFRA 1BC6A 2F4FA 3QGGA 4CF0A 5GADI 2QKBA 2YHAA 3M8PB 4V19J 3FSYA 1YIJS 1N36J 2HHHK 4FF2A 2OFHX 5BN8A 4KHRA 3BQ0A 3UN2A 2F8EX 5LMUK 2WOMA 4BC3A 4ZCKA 1B4SA 4DR1F 4HEA9 2YKOA 3DRRA 3D2EA 5JVGL 1N33K 1YJTA 4DSKA 3O9RA 2FJEB 3POTB 3N6MA 1G6BA 1WHWA 5C0YA 3SDEB 1QTMA 3KIOA 3QBWA 3JYTB 4ZLNA 1U6FA 3CJKA 3P96A 4NZ6A 3GV5B 4DR3F 2QJ3A 3GSIA 3SK3A 2E66A 3DOMB 3SCIE 1TAUA 5AR0A 1BGXT 3OHBA 1JJCB 2ZZMA 2IC3B 1RT6B 4EP5A 4ZK7M 2MQNA 4RCHA 3KMSA 4L76A 3V81A 3ZTRA 4M3TA 3HHDA 1O6XA 3L2UA 2W42A 5CYMA 2ZM6J 4HHHA 3FQKA 3AA2A 2LFVA 3VQ5A 2AF6A 2CPYA 5IT9U 2R8HA 3VENA 2BTFA 3ATVA 2OPSA 4MIBA 3ET6A 5KT4A 4DV3F 4KHMA 4L3NA 3OLBA 4YR3A 4QR0A 5AE1A 2IJRA 4P2MA 4LSZB 2XMTA 2ASPA 3NWRA 4HVJA 4MYUA 4RW6A 1X5OA 5HRNA 3EYZA 4PWDA 1NGEA 1FVSA 3E01A 1YAGA 1X1PA 2GO8A 2OPQB 2LQJA 4FJ7A 3JSBA 3ISNC 3N5FA 5KI6A 1YI2S 3DRPB 1S1VA 1WOOA 5JXSA 1J54A 1N36K 3O1WA 2CPXA 3IM9A 1JLBA 2O8DA 1RKJA 4ZVSB 3MR3A 3SV4A 4GVBB 3MMVA 2O8BA 2O8FB 2J0WA 3NGUA 4X62J 2ZBQA 2BJ1A 1D8YA 2WVDA 1Y00A 4B17A 2V50A 3GQCA 1S1XB 1XC3A 2Y3YA 4OZLA 4B1XB 3LDLA 3WNGA 4TY8A 2DGTA 3VESA 2RQMA 3OYCA 1TU0B 2VZ9A 4DTRA 1ACMB 2FBTA 3AJDA 4WIQA 4B9NA 1R6VA 2IM3A 5M2RA 5H9EJ 2H5IB 1REVA 4O44A 2EG1A 4WFAQ 4DV7F 2ZM6K 5DM6Q 2JLEA 2EFGA 3D0PA 4IOBA 5FDLA 4C1NK 4CZJA 1N5YA 2FHMA 2I0XA 3OR2B 2M3DA 1SQFA 2UXDF 1KN6A 4JI2J 4CZIA 4LF9K 1N34K 4E7JA 4XO0A 2YY3A 4ZPBA 1UAWA 3O3LA 3FBBA 3RRHA 1EARA 3QEXA 1IO2A 4NCAA 4HTLA 1JXLA 3L4QA 3CDAA 2O1PA 3UE5A 1GMUA 3SNNA 1NJYA 4JI0F 4M7XA 5L9XA 2C3MA 2ZHAA 3N28A 5FPEA 1NGHA 1NJZA 2EI5A 3AVMA 3RBDA 1U02A 3E1YA 3MUVP 2G8FA 3SQGA 3CF5Q 1GMWD 2EVZA 1T3NA 1E4FT 2ZGZA 4JI4J 3QQCD 5J2PA 5F8MA 1R0CB 1AXQA 4OX9K 1F21A 1T9XA 1AUSL 5DLFA 1J5EJ 4C8OA 1Y64A 1UVKA 4JV2A 2WTFA 2FVQA 2O01C 3BN4A 4C2MA 3DI6A 1WKKA 1NDKA 3VAMA 3Q8YA 4LR7A 1XNRJ 2XS2A 4ZVOB 3W5ZA 3E3XA 3NGYA 4PYDA 1HRHA 4KHPF 5C5JA 1QVFM 3KK2A 3RMCA 2WBRA 3DYAA 2XLJA 1LW2A 4D3GA 1RDUA 1X4HA 1BCMA 2RMLA 1U2VA 1TKTB 2GAHC 4RL1A 4OVLA 1RTHA 1IBMJ 2MXYA 2E20A 2FHKA 4OJ1A 3QBXA 2GQQA 2D1CA 5IZHA 3EDRB 1NB7A 4KC5A 2CJBA 3MAAA 2WB1D 3CCLN 3CJ7A 3HVTA 3C66A 2DHXA 3H5SA 3CMAN 1VK0A 3LGMA 1NNDA 2R7XA 2G1HA 1G3OA 4PCQA 1KC8T 2O8EA 1TYQB 4O3SA 5C10A 2IAJA 1T9TA 3EICA 3UFCX 3PFOA 3CD5A 5LT5A 4DR4K 2DGWA 3VGTA 4DZDA 1YG0A 3N4PA 3TR5A 4JI8J 4C9DA 3WQTA 1EWRA 5GADU 3MWBA 3JTNA 5C25A 2CADA 2W7OA 4FYDA 3J81Y 3OUYA 3QFHA 1WTFA 3L95X 4NYPA 2UXCJ 1S77D 3OYDA 2GHWA 1K8AT 3OR1A 1BQMB 1J5EK 3GL1A 3ZX3A 3PW0A 2MPUA 3KG4A 3DRYA 3T5LA 4BRFA 2NR0A 4PYAA 1QSSA 1RLCL 4Y1CA 4RW8B 1N5TA 2G9OA 3JTPA 3VQCA 5KQDA 3D1QA 2YQ1A 5BN9A 1Q7LB 1RAGB 4ZLJA 5LMNK 1ZXOA 4RO0A 4QS8A 2A3JA 4WFAL 4QR2A 2VIHA 1ICEB 1GMWA 4K4YA 3V4MA 4CESA 4DTXA 4CFBA 5AQUA 3ZT1A 3Q24A 4BY9C 5DM6L 4BE0A 4AM7A 4H4KC 1N5SA 3VAIA 1WAFA 3L6QA 2A6MA 5F0WA 3EZUA 3U1LA 2X7IA 2D69A 1FF2A 4NI2A 4WQ4A 3P5JA 3H8YA 1KVJA 2HFUA 2BA9A 4RUCA 3CCQS 5AQOA 2YNHA 1VQ9S 4ICLA 2R2SA 3SIPB 4MYTA 1JJHA 4JHDA 4UQGA 1X4AA 2WBMA 3FFIB 3KXDA 4ED6A 4X84A 2EWHA 2V9KA 4J9KA 2V8DA 4WYLA 2JEFA 2DK2A 1SQKA 3U8XA 3HD1A 4K59A 2MKYA 3VQBA 4DL2A 4JI8K 4A5AA 1VQ4N 3BBFA 3AXMA 2WONA 2OO4A 5KFTA 3KKSA 4J9LA 3RSEA 2HVHA 3DLGA 3J7AN 1HIYA 3QGPA 4FF4A 3OVAA 4ZA1A 2GAGC 4CO1A 4OKEA 2PE8A 3A8JA 1FCAA 1M5VC 3OSNA 5GADP 1HQEB 1ZA2B 2E29A 1EP4B 2ZF5O 3IG1A 4MT1A 4IH6A 5J2NB 1X4BA 3K2YA 2OTLS 2W4PA 1VR6A 4B08A 5CCLA 1HJRA 1T05B 1N54B 2HHQA 3OTOF 3H98A 2DHAA 1GTEA 4F0MA 3MEGA 4AL6A 5LOQA 1W2BM 3KDNA 1S1UB 4NYNA 1JLFB 2ZHOA 1PJ5A 2E7XA 3IS9A 1HHQA 4JKCA 2BJEA 4G6VB 4M42A 3M1VA 2GC8A 3KDOA 2C3PA 5IQ6A 3EZ5A 4CNZA 4DV2J 4AXIA 3ZZTA 1WC0A 2IIHA 4R79A 2JZ5A 1ZPVA 3K5NA 1FWPA 2HLUA 2HFSA 2GTDA 3KJVA 1TZ0A 4HT7A 2QKKA 1CJKA 3HZGA 1NCLA 3QJLA 3KLFB 3N4WA 2K1RB 2B3TB 1KD1O 1IKVA 5F41A 4E1NA 1YRTA 2ZH2A 3FDSA 2W9AA 4M5DB 2QWMA 3MFHA 3GIIA 5E0OA 3HMJG 1SKRA 3TNVA 4W92B 3Q8UA 1JJ2M 1HKBA 4BRGA 2OMOA 4FWMA 2R7QA 5KG1A 4QAGA 2JDJA 1NMEB 4X64J 1WBBA 4AH9A 2UUAF 3CCUS 4A8KA 3HDSA 3O08A 4EO6A 3ZZRA 4CK2A 3IN5A 4ZJQA 1N0UA 1BOTO 4CZCA 1URRA 1RADB 3IO1A 4J9VA 4PXDA 3DLEA 5M1PA 1T6DA 3AGKA 3G82A 1N5QA 2HG4A 3D6MB 1WKLA 3MXJA 1SB6A 3SSRA 4ES2A 2O4IA 1ZBIA 1SL2A 3RAXA 2HEKA 2KRRA 3CD0A 3E8OA 4YN3B 2P9NB 1UCNA 4K5SA 1WLJA 2MTLA 3UIQA 4EFAC 1F9HA 4E7LA 2F96A 2DO0A 9ATCB 1R89A 2UUTA 3I55S 2NZCA 1AB8A 4RNNA 1OY8A 3OY9A 2DYAA 2D0CA 1RHKB 2P9LB 3ZTOA 1M1KT 1RBVA 2KU7A 1HARA 1Q7YO 2QRRA 2QEXN 3TO8A 1WHXA 1FNOA 5AQZA 4HCBA 1UAXA 3OYLA 3BEGB 4LBHA 1C0UA 4J90A 4H5NA 3X1LB 5E2QA 4FN5A 3LQVA 2ZUGA 3KLGB 3CI5A 4FJ5A 4CEZA 2ROPA 4J9UE 4PRFA 4IG0A 4NPOA 3OW2R 1NSPA 3G6YA 4YOUA 2K7JA 4NB4A 2CVIA 4KBIA 4FZYA 1HBNA 3SQ4A 1EJ7L 1WG5A 3N0VA 1KQSM 2X6SA 3AJ2A 1KKHA 4O3NA 5AQLA 1B3TA 4FBUA 3Q22A 4LF8J 5KG3A 2FIUA 3MXIA