1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
3OYJA 3TANA 1Z26A 3LP0A 3OYIA 4C8MA 3DLHA 4NRUA 4FJ9A 3KMQA 3AVMA 4FZXC 3V6HA 3JSMA 4Q43A 2X78A 5KFVA 5EDWA 1WAJA 3NGDA 2OZSA 1VRUA 1GX5A 1GOBA 3VQ9A 4J2EA 1KFSA 5HP1B 4CF0A 3BJYA 1RA7A 3SQ1A 3V4IA 3DDKA 2O4IA 3K5OA 2OPQA 4IG0A 2XC9A 1JXLA 5KFAA 1JLCA 5KFLA 3KK3A 4J9MA 3D45A 3PX4A 2V9WA 4G3IA 1B9FA 3KJVA 1EP4B 1VSFA 3EPIA 1NJYA 4OL8A 4F4KA 1QSYA 3BR9A 3OVNA 3WNEA 2IC3B 4CHZA 3ASMA 3NH1A 4LSNB 3M9MB 4CIGA 4M95A 1LWFA 1S9GA 1HQUA 5C42B 2O5DA 5KFJA 3G6VA 2R8IA 1CZ9A 1HNVA 1TAUA 4DEZA 3AA4A 1VSKA 2HNZA 1C1BB 3FDSA 3PZPA 2W9BA 4DQIA 5C25B 1KFDA 2ILZA 3PO4A 1JLQA 3PR5B 4M41A 4BE1A 2IMWP 1JXBA 2HNYB 3AA5X 3WNGA 2IJNA 4NCAA 3NCIA 1N4LA 3PUFA 2E9ZA 1Q8IA 3QIPB 3HKWA 1RT1A 1C0TA 3OLAA 4JRQA 3EYZA 3KD5E 4CHYA 5FDLB 3ITHA 2FVRA 2UVWA 5HROB 1REVA 3OYFA 4KTQA 5KFBA 3GIMA 2XWYA 1U09A 4I9LA 2W8LA 1VSIA 2HHVA 2HHUA 3KKRA 1TGOA 1TL3B 4I7FA 4N41A 4QW9A 2HAIA 4LSLB 3BGRA 1SKWA 4HUGA 1N48A 1A5XA 4FJIA 3NL0A 2YNHB 4O3QA 2WB4A 1CXQA 3MEEB 4YR3A 1ASWA 3KLEB 3PVXA 5F8IA 3RAXA 3VQBA 4CJPA 2JC0A 3NAIA 1SV5A 4KAIA 5DK5A 3H5UA 2HHWA 4DFMA 2WONA 3DRPB 2D5RA 2HVHA 1S48A 1N6QB 3TAFA 3O3HA 4H4MB 1X9SA 3I5AA 4EYHB 1KVCA 4PWDA 4GW6A 3JYTB 1O1WA 3DRSB 4KSEB 3V9UA 1SH0A 4Y3CA 4RUCA 4GMJB 2QXFA 1BIUA 2NUBA 4Q44A 4I2QA 5HLFB 3D5MA 1S1UA 4FLZA 3RWUA 4LQ3A 4DFKA 4B9MA 3DM2A 4F3TA 1C0MA 1HQEA 4O0IA 3BQ0A 2FBXA 4Q8EA 4W5RA 5SZTA 2R2UA 4K4XA 2R8HA 1RDRA 1W0HA 4N56A 3CJ5A 4CJ3A 3TI0A 3N6LA 2KW4A 1QS4A 4K4UA 4LD0A 4M3TA 2IA6A 4KKOA 5KGWA 3MAQA 4RNOA 1X9MA 3QNNA 3KMSA 3SPYA 4ID5A 2RKIB 3HYFA 3GILA 4Y2CA 1T03A 1QE1A 2JEIA 3TR8A 3RBEA 2JGUA 4CHQA 4FJ8A 1LAWA 4NCGA 1HMVA 3VQ8A 4AH9A 2BE2B 1RTDB 1TKTB 4TY9A 4TN2A 1YVUA 1XHXA 2FBTA 2IM3A 4E1NA 4M3ZA 3LWMA 3HVRA 1ASVA 1SKRA 3LAKA 1NOYA 5KFDA 3KLGA 2E9RX 1TL1A 2HNDA 1R0AB 4DS5A 1U04A 2DFFA 3KK3B 5DGBA 3OL8A 3HVWA 2R7YA 1NKEA 1HPZA 2HMIA 4EZ9A 3TWHA 4C8KA 3LDSA 4CFBA 3U3GA 1KHWA 4BE0A 1S0MA 1I39A 1ZYQA 4H4OA 2RF2A 2FVQA 4F4XA 3HVTB 3OYHA 1FXXA 4DTPA 2DFEA 4C8OA 4BWMA 3NAEA 4H8KA 4Q8FA 5DQHA 2R8KA 4KAZA 4NCBA 2R2TA 4J9QA 3HK2A 1JLFB 1C6VA 1BIZA 4CJ4A 2C22A 4U7CA 3UR0A 3VQCA 1RNHA 4K4TA 5F8JA 3E51A 1JLQB 3OL9A 2A1SA 4CGJA 4KHUA 3OYMA 1C0UB 4ZVEA 3T5KA 5KG7A 5EU7A 4AHVA 1RTIA 1S6PB 3MTKA 2IGIA 4W5OA 3KD1E 3MECA 2OH2A 5KGXA 1TVRB 1N5YA 3SV3A 4FZZA 1UA1A 4DU1A 1XWLA 5SWMA 4KFBA 3DI6A 1NJWA 3IRXB 2ZKUA 4ELUA 1JLAB 4B9UA 4YP3A 4IFVB 4JV0A 3BSNA 2P51A 4O3RA 4I7FB 1RT3A 3MXIA 4NLRA 4WFZA 1SUQB 2HHQA 1Q9YA 4RW4A 5HRRA 1S9EA 2JEFA 3QESA 3QYYA 1S5JA 3QNOA 3H5XA 1DLOB 4RW6B 3LP1B 5CYQA 3CJ2A 4CEAA 3AVBA 3M8PA 2OPPA 4N47A 4XIUA 3TAMA 3OYEA 5DQIA 3NDKA 4B3OB 3P5JA 3MR6A 1SV5B 2AWZA 4O44B 3I0RA 4IH7A 1LV5A 3KLFA 4EP4A 1LWCB 2VA2A 2XY8A 1RCHA 4ICLB 4IDKB 3M9OB 3HSTB 1TV6B 4CIEA 2IAJA 1RT2B 1JLGB 1IO2A 3CJ4A 4CJFA 4NLOA 4F4ZA 4KHWA 1S49A 4IKAA 5T7BA 2W42A 4ZVFA 2JC1A 3AO1A 1TKXB 2JEGA 2ALZA 1BCOA 4CJKA 2B5JA 2QKBA 1DTQB 1NK9A 4HVJA 4EBEA 1IKWB 3SUNA 3NKYA 4MKBA 3CJ0A 3EPGA 2KFNA 4CJSA 1Y97A 1HJRA 3T5LA 4FM2A 2R8GA 4WXOA 2GIQA 1T94A 4DTNA 1RTJB 4F4YA 3ALYA 2YNGB 4Y1CA 3G10A 5KG2A 3RRGA 2FBYA 3SUPA 3PW7A 2X74A 2BGGA 2DFHA 4HCCA 4ELTA 1JLBB 3AVFA 3VN5A 4KREA 4WE1A 3HT3A 1RAJA 2DPIA 4OKJA 4OPKA 3OS2A 1QE1B 3DLGB 1IKYB 2BANB 3F73A 4ECTA 3MXJA 4CGHA 1A5VA 4YR2A 3ZT1A 3DLEA 4NCGB 2GC8A 4NLSA 4BDYA 4J9SA 2F8EX 3LALA 3MEGB 1L3UA 2W9CB 5D3GA 3RMCA 4TY8A 1S1WB 4IFYB 3G0ZA 1HYSB 4NRTA 3AVGA 4ZTJA 4B9NA 3NH2A 4FJ5A 3NBPA 3PW4A 4E19A 5J2NB 2KFZA 1UOCA 4FXDA 4KV8A 5JS1A 1RT4B 4ELVA 3AA2A 1RT6B 3PJWA 4DL4A 3NF6A 1FKOB 4DSIA 3L3UA 1J53A 1NHVA 4ZHRB 1Z4UA 1WSEA 3MR3A 3CWJA 2FVPA 4ZPBA 4HKQA 2VG6B 3AO3A 4FM1A 2VWKA 3PW2A 4YNQA 1DTTA 1TK5A 1VK0A 4R0EA 2XCAA 3DOLB 5KI6A 4J9LA 3K2PA 1YTUA 3MR5A 4JV2A 4DQRA 1NK6A 2AJQA 3DRRB 4PUOB 4CFAA 5J2QA 1RDBA 3KLHA 3CDUA 3DLBA 1S1VB 4B9LA 1MU2B 4CF2A 2UVVA 1BI4B 2XY7A 3VQSA 2WK4A 4EEYA 2PYLA 4E0DA 4ID1A 3V81A 3L2WA 3LZIA 3CJ3A 4DTMA 1U49A 2CJQA 4CGDA 1TP7A 3SYZA 1IKVA 1TKZB 5KFMA 2V4RA 3NH0A 4FK4A 4J9KA 4G1QA 4KB7A 4ZVHA 3QEPA 2ZD1A 4DL5A 4DG1A 2XO7A 1K1SA 5DGAA 3S3NA 4QPXA 2FC0A 3KK1A 4O3SA 4RW7B 3N6NA 4RUAA 1I6JA 3CG7A 3OYCA 1UWBA 2E6MA 1RT7B 2VG5A 2WCXA 5J2PB 1S97A 4NZ0A 3K57A 4URSA 1BCMA 3LZJA 1RT5A 1RTHA 3I0RB 2W7OA 1LW0A 2PYJA 4IG3A 3AO2A 4I2PB 4KO0A 5J2MB 5L9XA 4NLDA 1T7PA 1KLMA 4F50A 2YNIA 3V6JA 4Z4CA 2OPRB 1C1CA 3BQ2A 3QETA 3PX0A 3AVKA 4FJXA 3RR8A 3SJJA 3QIDA 3DYAB 4CFCA 5FRMA 4PQUA 1IKXB 1QAIA 3CO9A 3OL7A 4AHRA 3LPTA 1ZBIA 4CESA 2I5JA 1LW2B 3A2FA 4R8UB 4M3YA 2YNFB 3BREA 4DL7A 4IR1A 3I0SA 1ZTWA 3RB3A 1OS5A 5CYMA 3VQAA 4Y34A 5I42B 1CXUA 4FLVA 2X6SA 2YKNB 4URGA 5CZ1A 2FJVA 2FJWA 3PW0A 4CEEA 1RBSA 1RYSA 4K4VA 5DLFA 4CFDA 3QGHA 3V6DB 1I3AA 4DF4A 3VQ4A 4NLXA 4ZMMA 1D1UA 4M3WA 4KB0A 5HBMA 4LH5A 3M9NB 1T05B 3DLRA 3S9HA 4KB1A 3HVAA 4QOZB 1IH7A 3NF9A 3CIZA 2OYQA 3DMJA 3RMAA 3HPHA 3S3OA 2C2DA 3KK2A 5F9NA 4TQRA 3PV8A 4ZPAA 3QEXA 4Q5VA 4DQQA 4YFUA 2G8HA 1JKHB 1QSLA 4Z4IA 1X1PA 2ASLA 4FW2A 4Z4HA 4E3SA 1KLNA 3NMAA 1WSJA 1G15A 3B6PA 3V1OA 5C24A 4WYWA 4RU9A 1LWEA 4IRCA 4BACA 4IBNA 5K14A 3LPUA 4PA1A 4ZP8A 3BDPA 2BQ3A 2V0NA 3T1AA 4CJVA 1QUVA 4CJEA 4ECWA 2WTFA 2ZE2A 3SQ0A 3VQQA 4XPEA 3Q8PB 2RDIA 4Q0BB 4CK2A 1JLEB 4MIBA 4EBCA 4O3OA 4ED3A 3OJUA 2YKMB 4K50A 3DLKA 4DLEA 4E7KA 3KLIA 3E01A 4IH5A 1ZETA 3I8DA 2D0CA 4RG8A 4ZPDA 1IM4A 4CHPA 3ISNC 4O4GA 4FK0A 1NK5A 4WYLA 4DU4A 2EHGA 3HJFA 2XI2A 4IOBA 1S6QB 3G6YA 1QHTA 4K4WA 4FZYA 4JRPA 1BQNB 4RW9A 4JV1A 4RW8A 4KHQA 4ECRA 3V1RA 2FVCA 5KFHA 3KHHA 3IGNA 3H98A 4CF9A 2J6SA 1VSJA 5KFUA 3DOKA 4LH4A 5J1EA 2B6AB 2AX0A 3PHEA 2HHXA 3THVA 5JUMA 3LP3A 3LP0B 3RB6A 2D3UA 4KHRA 4BDPA 3NGIA 2I1RA 1XR5A 4DF8A 3QEIA 2KZMA 5KT5A 5DG7A 2F8SA 3K5LA 4ECQA 2B4JA 3JSMB 4FK2A 4YR0A 2XGQA 3RR7A 4TSXA 1VRUB 4KPYA 4JS5A 5KG1A 4H54A 3V4IB 5EWFA 1QAJA 1J5OA 2OPQB 4NLTA 4IG0B 4U6PA 3D0PA 2CKWA 1JLCB 3H4BA 1SKSA 3ULDA 2XCPA 4QWBA 3KTQA 3FFIA 3KJVB 2O4GA 4W5QA 2W8KA 5I3UA 4EZ6A 2WOMA 1RDAA 4KTZA 4CEFA 5L1LA 2LSNA 4Z4EA 2E4LA 3H2LA 3H5SA 3GIJA 1VSDA 1LWFB 2OPSA 1S9GB 1HQUB 4QWDA 1YTAA 2QE5A 3QO9A 1L3TA 1JL2A 4AHCA 2UVRA 1HNVB 5E41A 1FKPA 3C6UA 3I0SB 2KQ2A 2HNZB 3OHAA 4ECZA 3IS9A 4B9SA 1ZBFA 2W9BB 5KFEA 3O3FA 3CFRA 3SFUA 3RB4A 1JXEA 2IM0A 1FK9A 2FLPA 1K1QA 3T19A 1RT1B 1C0TB 3M8QA 3TARA 3KIOA 1EETA 4TXSA 3IG1A 3RRHA 2ZQBA 3PR4A 4RNHA 3V9ZA 4NYNA 3ITHB 1MMLA 4Y1DA 4CECA 1TAQA 4DSFA 2QK9A 1HNIA 4NLQA 1NHUA 1REVB 3RMDA 4NLVA 3L2UA 1D5AA 3SFGA 4CK3A 3OJSA 3M8RA 4ZP7A 3SV4A 1CLQA 1BQMA 4J9PA 3AVJA 4DL2A 1HRHA 4DSJA 1NKBA 4M45A 4J2AA 4MIAA 4KHYA 4BE2A 1GOAA 3MEDA 3BGRB 4WFYA 5KFCA 2AGQA 2Z1GA 3NF8A 4C8LA 4RNMA 3EZUA 3ZT3A 4WZQA 2YHAA 2HVIA 1S1TA 5C5JA 4ECSA 1B92A 3FQKA 3TABA 5KG4A 3G86A 4CJQA 2WONB 5HP1A 2B43A 3H40A 2XHBA 4ZTFA 4ED0A 4EO6A 4CEZA 3VQEA 3ICLA 1SH2A 2XRIA 1WSGA 4PWDB 3G6XA 2C2EA 2JLEA 3QZ7A 3L2VA 3E01B 3OL6A 4F2SA 4CHNA 4I2QB 3V9WA 3NGYA 1S1UB 4HYKA 2IOCA 4K4YA 4FJGA 4FS2A 1RA6A 3SQ4A 3DM2B 3GV8B 2QKKA 1SL2A 1HQEB 2GUIA 4EO8A 3LWLA 3K5MA 2VG7A 4E7LA 4F4WA 2IC3A 4LSNA 5KFTA 4K4ZA 3LP2A 4DS4A 4KI6A 5C42A 4DSKA 2G8WA 3K5NA 3AO4A 4HUEA 1CZBA 1HYZA 2Z1JA 4KKOB 4OKEA 4Z4FA 4CIFA 2R2SA 5FROA 1VSEA 4ZP6A 4ID5B 3L3VA 4FJJA 3NF7A 1C1BA 5C25A 3GIIA 1XHZA 1KCFA 3EZ5A 3GV7B 4DTSA 1T3NA 2F8TA 1T03B 4B8AB 2HNYA 4KBIA 1HMVB 3QEWA 3QIPA 2AQ4A 1N56A 4CJ5A 3QERA 2KZZA 4C8NA 1SL0A 3HXMA 3L2RA 5KFQA 4RZRA 4MK7A 1BHLA 5FDLA 5JXSA 2PZSA 5HROA 4CJLA 3KLGB 4ED6A 2C2RA 1TL1B 2HNDB 2Y1IA 4F3OA 4ED7A 4WZMA 2PY5A 2WRMA 4M3RA 3KKSA 4J9NA 1HPZB 1S0NA 2HMIB 3KOAA 3CFPA 3EY1A 1TL3A 5KFSA 3PJXA 4LSLA 1ASUA 2BRKA 2DTUA 4DU3A 4NLGA 4O55A 1U45A 3H4DA 3O3GA 2P5OA 2YNHA 3SPZA 4MH8A 3RMBA 2OPSB 4H4OB 1NJXA 2RF2B 4E7HA 3MEEA 3KLEA 3KHRA 4OVLA 5KFFA 1WSHA 4ED8A 4E89A 1XI1A 5HRSA 4FJLA 3BQ1A 4EP5A 4FLWA 4N76A 3WNFA 4R5PA 3DRPA 5F8NA 1N6QA 3SNNA 2ATLA 2KTQA 3TAQA 4IRKA 4H4MA 4O5BA 4ZPCA 1KRPA 3TAGA 3JYTA 3DRSA 2VA3A 4EYIB 4FBTA 2D0BA 1XR6A 5HLFA 1RTIB 3AVAA 3M8QB 2AU0A 3MECB 5KFIA 3IG1B 1N5YB 1WSFA 3V6KA 4FJNA 4RNNA 4FLXA 5KT6A 4KFBB 4QWEA 2D0AA 4BWJA 3DI6B 3U6FA 3PX6A 4DWIA 1EXQA 5KFKA 2GBZA 4CGGA 2RN2A 3OYDA 4CHOA 3CYMA 1NK0A 2DPJA 1S0OA 1RT3B 1BL3A 2XGPA 1S4FA 4RW4B 1S9EB 4MK9A 3VQ5A 2C28A 1WNEA 3QINA 2RKIA 5CYQB 4IH6A 1S1TB 3M8PB 2OPPB 2IS3A 4FJMA 1RBUA 5CY4A 3TAMB 2BE2A 1RTDA 1EKEA 1TKTA 4ZVGA 5KT3A 2RDJA 4Q45A 3KLFB 2ILYA 3K59A 1W9HA 4E1MA 1D0EA 2IAJB 3MF5A 4KI4A 5KFZA 5DQGA 1R0AA 4DFPA 4ECUA 1SH3A 3CVKA 3HHKA 2V4QA 1WAFA 3MFHA 4O0JA 4Z4GA 4MFBA 1RILA 2B5JB 4CERA 4W5NA 3ZSRA 4IQXA 2E6LA 2VG7B 5F8HA 2YV0X 3OLBA 3LP2B 4TQSA 5FRNA 2OZMA 2XI3A 2XY5A 5KG0A 3OHBA 1TQLA 4K4SA 4J2BA 3HVTA 1WN7A 3UIQA 4NYFA 4K8ZA 4MK8A 4W5TA 3CDWA 2FLNA 1Z25A 1VSMA 2IM1A 1S10A 3VQPA 3OS0A 4FLUA 3BSCA 1JLFA 4AHSA 4DTXA 2F96A 5EWEA 3B6OA 4DQPA 4I9QA 4CK1A 4WE1B 4TYAA 4DSEA 4XO0A 1C0UA 4ECXA 4L8RB 1GX6A 3DLEB 4DTUA 4B8CA 1S6PA 3VQ7A 1CSJA 3ZSZA 4CF1A 4FVMA 1TVRA 5D3GB 4TY8B 3IN5A 3NBPB 4FYDA 3Q8SB 1ITGA 3IRXA 3CM5A 4LY7A 1JLAA 2D3ZA 4TYBA 1J54A 1F21A 4IFVA 3T5HA 3PY8A 2AX1A 4KV8B 5KG6A 3P1GA 1RDDA 3RAQA 3ZSQA 4NLUA 1GOCA 1SUQA 4CJRA 4FJ7A 4HHTA 4PY5A 4Y2AA 1DLOA 4RW6A 3LP1A 3OYLA 3PW5A 1L3VA 1TKDA 4Z0UA 4BDZA 3I5BA 3VA3A 3OSNA 3AVCA 5KFYA 4IRDA 3S3MA 1DTTB 2W9AA 3ZSYA 4GC6A 2WHOA 4B3OA 1K6YA 1KHVA 4NLWA 2J6UA 4CEOA 1JIHA 4O44A 4R5PB 3GQCA 3HM9A 1XR7A 3ZSVA 1LWCA 1J9AA 4ICLA 4IDKA 1TV6A 2Z1HA 3AVLA 3KLVA 1RT2A 1JLGA 3FQLA 3IGVA 1S1XA 5J2QB 1X9WA 2BDPA 3KLHB 1VRTA 5F8GA 1TKXA 3SQ2A 2XY6A 4URQU 4ED2A 3VA0A 3ISND 3BSOA 3NAHA 1DTQA 2IJFA 3V81B 3MR2A 1IKWA 2UUWA 1LAVA 3CFOA 5DMRA 1IKVB 4QWCA 1VSLA 3Q8QB 3K58A 1XC9A 4CGFA 3LANA 3QEVA 5F9LA 1IG9A 2RPIA 4G1QB 2ATQA 2JEJA 3HP9A 2ZD1B 1RTJA 4ECYA 4DG1B 2YNGA 1KVAA 3N6MA 4CEQA 5KG3A 3KK1B 3AV9A 3HP6A 3ZT4A 4FLTA 1ZTTA 3V1QA 1UWBB 1JLBA 5L1KA 3H5YA 1VSHA 2VG5B 3T5JA 3DLGA 1IKYA 2BANA 4UQGA 3OY9A 1NKCA 1WLJA 5EWGA 3L8BA 2D41A 3SZ2A 4J2DA 1RT5B 1RTHB 5L1JA 1UA0A 2J6TA 4HCBA 3MEGA 1LW0B 2W9CA 4IG3B 4CF8A 1S1WA 4IFYA 3GV5B 1HYSA 1WSIA 4KO0B 4FS1A 1ZBUA 1KTQA 1KLMB 3NFAA 2YNIB 3OYGA 4CJUA 4DTRA 1C1CB 3CM6A 4JUZA 4CGIA 2ETJA 3TVKA 5J2NA 4NLPA 4MQ3A 3RTVA 3FRZA 3C6TA 4MFBB 1RT4A 3V9XA 1Q9XA 2BQRA 3CQ8A 4PQUB 1L3SA 1D9FA 1RT6A 2I5JB 3QLHA 1FKOA 4QWAA 3AVNA 4ZHRA 1RBVA 1B9DA 3HL8A 5KRTA 1EX4A 5KFOA 4OGEA 4HUFA 5F8LA 4QCLA 5CYMB 3AVIA 3P83D 3LAMA 3H08A 4EBDA 3ZSOA 2VG6A 3KNAA 4KE5A 3AO5A 4KTWA 4DTOA 4F8RA 3OS1A 3OYBA 5KG5A 4QAGA 3C94A 3DOLA 2BRLA 2OA8A 2FBVA 3NHGA 2AGOA 4WFXA 1TK8A 2ASJA 5HBMB 4OLAA 1JX4A 2UVUA 3DRRA 4PUOA 4DMNA 4OGCA 4DQSA 5F8MA 3DMJB 1QSSA 4OLBA 3U3YA 3KK2B 1RDCA 1S1VA 3SUQA 3CDEA 1MU2A 4DL3A 3T3FA 1BI4A 3SCXA 4TLRA 4NYZA 3OYNA 1RYRA 4B9TA 3NGZA 5KFGA 2GV9A 1TKZA 3L2QA 4WXWA 4OKKA 4FJHA 1YT3A 4M94A 5C24B 3OSPA 1LWEB 1JL1A 5K14B 2G8KA 5L1IA 4B08A 2A1RA 4F2RA 2E9TA 4RW7A 3TAPA 2IM2A 2ZE2B 3O4QA 3FSIA 3SUOA 1RT7A 4CJWA 2G8VA 2EX3A 4M42A 5J2PA 2Q3SA 4HTUA 4KHNA 3DLKB 3VQDA 3O4NA 3KLIB 3HPGA 1C2PA 5DG9A 4CCHA 4O4GB 3UPFA 4KRFA 1UAXA 1EP4A 4FJKA 1L5UA 4I2PA 2QV6A 5J2MA 4DTJA 1S1XB 4E7IA 2OPRA 2AGPA 3ZT2A 4NLYA 4CEBA 1VRTB 5KFPA 2EC0A 4RW9B 4RW8B 3QIOA 3V9SA 5KFWA 3HO1A 4CEDA 3DYAA 3M8SA 4DL6A 4LQ9A 4IR9A 4ECVA 1IKXA 5KFNA 4J9OA 3GYNA 3GIKA 2HWHA 3UDLA 3MXMA 1LW2A 4R8UA 2YNFA 2IDOA 3C95A 2R2RA 4YMEA 5KFRA 3OYKA 4DFJA 3DOKB 3RB0A 5J1EB 5I42A 3ZSXA 2YKNA 3SI6A 2HWIA 1A5WA 4QW8A 4N5SA 1QQCA 3OYAA 4MKAA 4JS4A 3V6DA 2Y1JA 1RBTA 4DLGA 4M3XA 3RBDA 1U4BA 4B9VA 4ZP9A 3F9KA 3H59A 4X2BA 3QGIA 3KHLA 3I5CA 1QTMA 1T05A 3AA3A 4OPJA 1ZBHA 4O4RA 1J5OB 2W7PA 5CZ2A 1NJZA 3TAEA 2DY4A 1KSPA 4E7JA 3FFIB 1T8EA 1D9DA 1W25A 3HPOA 1JKHA 5I3UB 1C1AA 2P5GA 2ASDA 4FCYA 1TK0A 2WOMB 4KHSA 1D8YA 3ZSWA 1HYVA 4GVMA 1WNSA 1YVFA 2HHTA 2G8UA 3QZ8A 3MFIA 4AHTA 3C6TB 2FLLA 1NK8A 1U48A 3QO9B 1U47A 3VQ6A 1BGXT 4GC7A 2FVSA 4FLYA 4AHUA 2Z1IA 4FW1A 2HB5A 3BSAA 1FKPB 3C6UB 2IBKA 3D28A 3QLHB 5DG8A 5KTQA 2G8FA 1NK4A 1NK7A 3IS9B 4RNFA 1KVBA 4Q0BA 1JLEA 1HARA 5KT2A 5KT4A 3PO5A 2D7SA 5KT7A 2YKMA 2BQUA 4KHMA 4FM0A 1FK9B 4DSLA 4CJTA 2HW3A 1SL1A 2HHSA 4M3UA 4IKFA 4O3NA 4FBUA 1EETB 5HRNA 3KHGA 1NOZA 5EUHA 5DLGA 5JS2A 4ED1A 4AILC 4XPCA 3AVHA 3SI8A 1HNIB 4JLHA 2G8IA 4CE9A 1S6QA 4OJRA 2R8JA 2UUTA 4YQWA 1BQNA 1NNDA 3QGGA 2FJXA 5KRSA 2VWJA 5T14A 1BQMB 4O3PA 3IAYA 5HRPA 5KFXA 4K8XA 3Q8RB 1BISA 3MEDB 2ITGA 1RBRA 2X6NA 2YHBA 3ZCMA 3UQSA 3ZT0A 4J9RA 3NE6A 2GIRA 3WNHA 2P1JA 1S9FA 1ZBLA 2BR0A 3TQ1A 2B6AA
chains in the Genus database with same CATH superfamily
2C2OB 3LP0A 3M5RA 3KZBA 2C3UA 4C8MA 2ZH3A 3DLHA 3HDSA 2B51A 1YI2N 2E1RA 3EMTA 4GMKA 3AVMA 2EW9A 3V6HA 4JKAA 1KNZA 3JSMA 1WHYA 5E3CA 2PI4A 2XHWA 2VOPA 4B3RF 4CF0A 2MLXA 2JNJA 1RA7A 3BJYA 3FCVA 4ZOSA 3DDKA 1Y10A 2BJ9A 4ERDA 2Q1NA 5FIIA 2OPQA 4IG0A 2XC9A 3CMES 2PBDA 4J9MA 5CD4A 3O5TB 3PX4A 2FPHX 3DXKA 2V9WA 3UR3C 4G3IA 1X8DA 4B9QA 1VSFA 3NNCA 1HI8A 2NXUA 1S3XA 4X4NA 4F4KA 4IXCA 5CR4A 3BR9A 3NH1A 4BRFA 1S9GA 5CAAA 2O8EB 4F67A 4NOHA 5KFJA 3DJCA 3G6VA 1B3TA 6FDRA 4UT4A 1TAUA 1UETA 4DR3J 2BBEA 3D1HA 5B0BA 4MAKA 3BO4A 2LQ8A 3LL3A 1MROB 3CIPA 1M90O 1ZZFA 4ZN3A 2HFZA 2W9BA 2ILZA 1UFLA 3W66A 1JLQA 3PR5B 3FBCA 3MM9B 2ROGA 2IMWP 3R1LA 3AA5X 3WNGA 5IC4B 4HACB 4NCAA 1N4LA 3PUFA 3CCZA 2K8GA 2HQCA 3HKWA 1RT1A 3OLAA 4LF5F 4CHYA 4OPAA 5AJ3F 3GL1A 5HROB 2QA2A 4WK1A 2G1DA 3OYFA 5HMYA 3OA9A 2BJEA 5KFBA 3GIMA 1LOUA 4LF9F 3E2EA 2HHVA 1OPZA 1TL3B 4N41A 4H5VA 1QQNA 4LSLB 1S76D 1N48A 5EVZA 3C8YA 2YNHB 2WB4A 4X64F 4AM7A 3L09A 3RAXA 3VQBA 4LRDA 2JC0A 3L4BC 3GJTB 2A1BA 3GSIA 1SV5A 4CO0A 2HVHA 4K0KJ 3KWMA 4JV5K 4H4MB 1R8AA 3FZMA 2KB2A 3MM8B 1SH0A 4Y3CA 2MKYA 4RUCA 3ONQA 2QXFA 4JI4J 1NH8A 2NUBA 3RWUA 4LQ3A 5FLXO 2QA4S 4BVPA 3P39A 2X3GA 1HQEA 4O0IA 3SQGB 3BQ0A 2F9TA 4K4XA 5F1XA 3L95X 2DR8A 3T9NA 2IRUA 2G0JA 4N56A 2IBOA 4M63A 2KW4A 4JK9A 4LD0A 4M3TA 4B3MK 4KKOA 1UVNA 1H74A 1X9MA 2QZ8A 1UPPA 2CA9A 2IRYA 3RAMA 5K9FA 2RKIB 1U8WA 4QYRA 4Y2CA 5AQFA 3BKTA 2JEIA 3TR8A 3M05A 1MMDA 4QIEA 2L9NA 1LAWA 4FJ8A 4NCGA 1TKTB 3O8MA 4CI6A 3DWLA 1XHXA 2HVZA 2JWLA 2JLGA 4UOHA 5AQTA 3ENVA 3HVRA 3LAKA 1ZM9A 1DZ5A 3UN3A 4JI0F 2VC1A 5KFDA 4KC5A 3TA2A 2DFFA 2E7XA 3KK3B 1RKIA 1X60A 2FZGB 3HVWA 4HH1A 5LMUF 1JCFA 1NKEA 1KD1T 1HKAA 4YDXA 2JFDA 4C8KA 2H5EA 4CBUA 2UUAF 5GAEU 1ZYQA 1RAAB 3HVTB 1UJ6A 5HO4A 2PMZD 2BUNA 5ETQA 3M2UB 4BWMA 4H8KA 2E7VA 1W97L 4Q8FA 5DQHA 1MWZA 2M7SA 4CM2A 4J9QA 3CPWM 3HK2A 2AJ2A 4C98A 3LM2A 2ZBQA 5F8JA 3OL9A 4CGJA 1C0UB 1WDTA 2DTJA 3MCOA 3PFOA 3UDCA 4PKIA 3U8XA 3T5KA 1YIJS 1IR2A 2ZBCA 1S6PB 1QVGR 2CG4A 3D3CJ 1UA1A 5M1OA 4KFBA 1NJWA 2R7RA 3IRXB 2HFNA 4BGBA 4OIXA 3C3LA 3HZEA 4JV0A 1SUQB 1Q9YA 2JEFA 4PZVA 1NGJA 4CBWA 2XS7A 3QYYA 5IWAJ 3QNOA 3ILOA 5LMNF 4RW6B 3LP1B 1WI6A 3PSIA 5AQJA 3WEEB 3M8PA 2P5VA 1OWXA 2OPPA 4N47A 1AB8A 3PIOL 1ULRA 3NDKA 4B3OB 4ZDNA 3D2EA 2VKZG 1ROFA 4JN4A 4CTAB 3KLFA 2PD1A 4ISFA 2XY8A 2A2DA 4IDKB 1FXRA 4CIEA 3VEVA 3AY0A 4DL0C 4QBUA 1S49A 4U8YA 3VZIA 1YTYA 1F3FA 2ZH1A 5HSPA 3W3DA 2ALZA 2GMJA 2QKBA 2J5AA 2MKIA 2W4DA 3A3OB 3PIOQ 3NKYA 1TZ0A 3MMBB 4LFCJ 2RHSB 2V8HA 1HJRA 1Y4ZB 3OR2A 4WXOA 1T94A 3K2YA 3ALYA 4DTNA 4RKUC 2YNGB 2PI5A 2QXLA 2L9DA 1YF5L 3PW7A 1IQZA 1ZA2B 2KH9A 4M5DB 2XS2A 2X74A 5F3TA 4HCCA 2E44A 3PYDA 1IBMF 3W63A 4WE1A 1O51A 5BPLA 3OS2A 1QE1B 1IKYB 2BANB 1TL5A 3UD3P 4NXMF 4XK8C 2VPXB 3KJNB 2FJAB 1IN0A 2UP1A 4ZLJA 2PIIA 5D3GA 3RMCA 4TY8A 5BYRA 4IFYB 1P1LA 4ZTJA 3NH2A 3HHEA 4TNOA 3NBPA 4P71A 4DJBA 3P6YC 3TSPA 4C11A 4CZCA 4E19A 4B3TK 3CMEN 3TJ8A 2R3VA 1VJWA 2O66A 4DKWA 3K9KA 1CJUA 5J2NB 4A46A 2KFZA 4W98A 1UOCA 4FXDA 2QL9B 4QZVB 3AA2A 3K8VA 1MW7A 4NYOA 1Z4UA 2E2NA 1WSEA 2M2BA 3CJ1A 2Q0RA 1DQAA 2AYMA 2EC2A 2VU5A 2VWKA 2F8MA 1XMQF 4R0EA 5KI6A 2CGJA 2WTUA 4JI7K 1XNQF 4OZLA 3PYEA 3VGLA 1YTUA 3MR5A 4USMA 1EQ0A 1B70B 1NK6A 2UXBJ 3DRRB 4PUOB 5LY3A 3MPVA 3KG4A 3CDUA 2BM1A 5FD1A 1KAZA 1S1VB 4LFBF 4ENOA 2UVVA 2XY7A 4A8KA 5L46A 5AQGA 3VESA 3SSSA 1U49A 2CJQA 5D0EA 2LXFA 1TP7A 2HBKA 1APSA 4CLYA 3SYZA 4NMXA 4Y0WA 2RRAA 2V4RA 3T1HF 3OBWA 3LGHA 4P9SA 5GAEI 4FK4A 2I8EA 2ZEJA 2V2QA 2P9UB 1TUUA 1NAQA 5AXNA 1N5SA 1OVYA 4DV5J 3SQOP 4LF6J 3CG7A 2DISA 4ETZA 2IVPA 2VG5A 3MMAA 4PAAA 4P7VA 2C3OA 2B9WA 2JH3A 4OI1A 1FE0A 4DR1K 3LZJA 1RTHA 5MLCQ 1EX8A 4KH5A 1XMOF 4ZKAA 1R59O 2YNIA 2AEMA 3R8EA 3VAKA 1GLEG 4Z4CA 3QETA 1AW0A 3RR8A 1YBTA 3QIDA 5HOOA 4OYBA 2QA4N 3DYAB 4CH7A 2QG9B 2J76E 1QAIA 1A7GE 3CO9A 3OL7A 3LPTA 1X7VA 3GE1A 1U02A 4DL7A 4FVCA 4O23A 1ZTWA 3C6HA 3DDNA 3D6RA 1GLCG 3EE9A 5CYMA 2QA4G 2QM1A 4EMDA 4URGA 4LRBA 2CWKA 1V9OA 3M8YA 1U1RA 4JAXA 3QBWA 4FWNA 4GV9A 4ZCKA 3L9ZA 2ABYA 1I3AA 2LQ9A 3PHTA 3ZNJ1 1U2RA 3A5OC 2YX4A 1YJNS 3DXMB 2EG2A 1T05B 3NGUA 3DLRA 3Q0AA 3S9HA 2D1KA 1WBDA 3ULHA 2OYQA 1RTZA 2V2KA 1U0HB 4LVNP 5AXMA 1NJIO 3RMAA 1SKUB 2OTLS 3PV8A 1DQ8A 4YN3B 3EVWA 1GLFO 3J80O 4M5LA 4DQQA 4OHVA 4OZNA 4YFUA 2G8HA 2JWKA 2HBYB 3MCMA 1Q82T 4K43A 2HIYA 4E3SA 2CQ1A 1WSJA 1J5EK 1G15A 3KJQB 4WYWA 3VEWA 4RU9A 1LWEA 4IRCA 5M2PA 4BACA 3EDQB 4IBNA 5K14A 3LPUA 2QFJA 4DV1J 2BQ3A 3G82A 4C3MA 3B8HA 2AIRB 4CJVA 2ZITA 4DPXA 1NGIA 4DR3F 2WTFA 3NVKA 4Q0BB 4DR6F 2Z30B 5DO2A 3IKMA 2YKMB 4K50A 4DV6K 4U7UD 3FKBA 4TU7A 2LQJA 3E01A 1RAIB 2CZ4A 4RG8A 1S57A 3EGNA 4ZPDA 1IM4A 4BRLA 3ISNC 3D66A 4FK0A 4DBQA 4ANDA 2G0IA 4WYLA 2EHGA 5LJ3Y 3V4MA 4IOBA 1YIJN 1TTHB 2DH9A 2AYEA 2LCWA 1W2IA 2C3MA 3TNVA 3V1RA 4F7VA 2NCKL 3M3ZA 3VEYA 2CIMA 3H98A 2J6SA 5AQWA 2MQNA 1V3SA 2VWBA 3G4SS 1W7WA 4LH4A 3S6EA 4CI0B 4CZJA 5CXTA 3PHEA 2HHXA 4ZVQB 3LP0B 1A0OB 1XR5A 3QEIA 1X4BA 1RWPB 2XZWA 4ECQA 3JSMB 4FK2A 2XGQA 3RR7A 1D4XA 1QVFM 1EZZB 4C6AA 4TSXA 5AZJA 3SBMA 2MJNA 4H54A 2X1GA 1VQYA 2MPUA 2RE2A 2QLJB 2OPQB 1QLNA 4IG0B 4BRDA 4NA2A 2ZJRL 3RSEA 3NG8A 4H5RA 3DXKB 2E66A 2XZDB 3ULDA 3E8OA 4QWBA 4CDIA 4M5IA 3D6TB 5E3AA 3GZ7A 4WIQA 3WUHA 1IJFB 4JI4F 4H4KA 4W5QA 3B4MA 2R7SA 5AQZA 4UOGA 1RDAA 1FVSA 4IO8A 1ZZNA 2YX6A 1OQ6A 3KUGA 1S9GB 3UNYA 2MLZA 4I4BA 5DETA 2AW0A 2CJKA 1WSRA 1FKPA 5KOWA 3C6UA 1RHJB 2XSJA 2ZJRQ 5E7OB 3S8SA 3IFRA 1HNWJ 2KQ2A 4ECZA 2OKQA 3IS9A 4B9SA 5B08A 2W9BB 1R89A 2Z4PA 4CD1A 1UWAA 3GYXB 3UE5A 5E3RA 1LNQA 1NPRA 2FLPA 1K8AO 1RT1B 4X62K 3W60A 1T95A 3M8QA 5IQQA 3KIOA 2GO8A 3IG1A 2ZQBA 4BRNA 4IDHA 1U26A 4MLHA 3LOUA 2CG8A 5BRHA 5DRKA 1IVZA 1NHKL 1S12A 1NM2A 3SV4A 4A61A 4ZJOA 1CLQA 3HHLA 4FWOA 1HRHA 3B78A 4DSJA 4BRQA 1G4CA 3IMXA 1NKBA 1UVLA 3QAUA 2FB0A 1OH7A 2QWQA 4BC3A 4ZVRB 4C8LA 2JFKA 2HVIA 2FSJA 3L7PA 1B92A 5B7WA 3AD7C 5A8KB 1ZAWA 4RR5A 3TABA 5KG4A 4TLQA 4X84A 3SBTA 3G86A 5GMDA 3M1FA 1RCXB 2DY9A 2XB2D 3I33A 4ZTFA 2R7TA 2AT1B 1KN6A 3VQEA 2MZ1A 1WSGA 3MDQA 1LWXA 2JLEA 3Q7BA 4F2SA 2VFUA 1P27B 5D4OA 4DR2J 3V9WA 4U8VA 3GV8B 1RAOA 2XO6A 3IUCA 1HQEB 2HRTA 4BRIA 3A8IA 2CAJA 4E7LA 4F4WA 3O8WA 2IC3A 4K4ZA 4DUYK 2GHWA 2HOEA 3LP2A 1YWXA 3WXLA 1MNEA 1Q95G 1FNMA 2O8CB 2XMJA 1N8RT 2Z1JA 4KKOB 1H7XA 4OKEA 1UVJA 3MAAA 4CO3A 2OI2A 4FJJA 4IFEA 5C25A 3GBTA 4AQYJ 3EE3A 2F8TA 4JD2A 4B8AB 2HNYA 2P9GA 4PQAA 2YWEA 5FLXY 3CQYA 3QIPA 4MJKA 4A8WA 5IV4A 2VD3A 4MTPA 3G96A 1N56A 3OTOJ 4C8NA 1SL0A 1HNZF 3VF0B 1RWKB 2PZSA 1I94K 5E3QA 4L75A 2N3OA 3W62A 3EVMA 2WBNA 2DHSA 4F0KA 3U4LA 4ED7A 4P72A 4QIGA 4M3RA 2AF6A 3CJSA 3F2KA 3VEXA 1G99A 3NS7B 4BRGA 4EHUA 2DTUA 1RAEB 3A13A 4R79A 5B09A 3RMBA 4ALZA 2H51B 4E7HA 4A57A 3NGSA 3KUHA 5K20B 3GG1A 3D2FB 1PBAA 2LDIA 1CJKA 3O1BA 3WNFA 5F8NA 2UYTA 4KRWA 1N6QA 2OCEA 2ATLA 3SNNA 3TAQA 3UDEA 3OUYB 1KRPA 3M6WA 3TAGA 1QZ6A 3DRSA 4ZK7M 2BYCA 4EYIB 4BBYA 4P7TA 1XR6A 5HLFA 1K8AT 1RWOB 3AVAA 1OH8A 5KFIA 1YJNN 2KVQE 2NYHA 3THTA 3TSQA 4KFBB 2B9YA 2E1YA 1LXJA 1RAFB 2OTLN 2IYGA 3PX6A 5KFKA 2XEXA 2DK2A 3RUBL 1WEZA 2GHPA 2HZVA 3A8JA 2A6MA 1BL3A 1K73T 7FDRA 1QJHA 3NCPA 4Y28C 3VQ5A 4WU3A 2MSSA 2WW8A 1WSVA 1S1TB 2E7WA 3M8PB 5F0WA 3ZEUA 2OPPB 3WX8A 2BE2A 1RTDA 3NGTA 1FXLA 3D2EB 1FESA 3TZWA 3A5LC 3KLFB 2JJ4D 1FF2A 3K59A 2VPYB 2VJUA 2PFDA 3M1VA 5DQGA 1R0AA 1IG8A 4ECUA 2UXBF 3JQJA 2B3TB 3EDRB 1NGGA 2PN6A 3WC2A 2K1RA 2ASPA 4W5NA 1DBDA 2G2OA 3PKYA 1V3ZA 2E6LA 2VG7B 5F8HA 1PYOB 3M6GA 4PG7A 3AD9C 3MHYA 3OLBA 1A9NB 4FWMA 2OZMA 1TR0A 2AEJA 4KY3A 2Q36A 5DZ6A 3OR2B 2CWXA 3CDWA 4NA1A 1VSMA 2NYIA 2IM1A 3HHNB 7FD1A 5ETTA 3EEQA 3G4SN 4DTXA 1E6YA 2BXJA 3GLJA 2BUPA 1Y64A 1RHUB 2NRHA 3B6OA 1ZBTA 4CK1A 4WE1B 1PJ6A 1NGHA 4ER8A 1VRQC 4XO0A 1EIYB 4L8RB 5LJVA 5KOXA 2BJ7A 1VQ9N 4A48A 4FNHA 4CF1A 4DV0K 4ZA1A 1N0UA 1TVRA 5D3GB 2CVIA 4TY8B 2NRVA 3NBPB 1HI1A 5D77A 4FYDA 4C11B 3WC0A 4A5BA 2QLWA 3M2VA 4CNZA 1DEJA 1JLAA 4TYBA 1CJUB 5AZIA 1J54A 2U2FA 5J1NA 3PY8A 2AX1A 3P1GA 5EXWA 3RAQA 4OHYA 2UUCJ 4NLUA 3VF4A 4WK3A 3BGLA 4CZLA 5E3PA 5DM7L 4GNIA 1YZ6A 1WEXA 5HVHA 1TKDA 4PKHA 5AQKA 5EOYA 2WZ1A 4B3SK 4CJ7A 1HWUA 3S3MA 3ZSYA 2GZOA 2W9AA 3WBZA 3SSQA 1K6YA 3D4JA 4NLWA 2J6UA 1EKSA 1JIHA 4O44A 4R5PB 3CPWR 1J9AA 2MKHA 1TV6A 2DXFA 1VBXA 1ZXOA 2BDPA 3CJTA 2OMLA 2V51B 4HTJA 5DM7Q 3ZTQA 5LL6d 1KVIA 1L3KA 2QLFB 1Q0NA 3ISND 3NAHA 3DRYA 2IJFA 3FCWA 1IKWA 2OP5A 3CFOA 1WTBA 1VSLA 3K58A 2CDQA 3QSYB 2Y3YA 3DDIA 1VISA 3T9ZA 2Q1LA 1X4GA 2C3PA 2JEJA 2A41A 1KEKA 3KJFB 4X64K 5KG3A 1TELA 5JICA 4B1UB 3CJ8A 1ZTTA 2Q2RA 1IXKA 2VG5B 3V5RA 4DPYA 3MMAB 3DLGA 4UQGA 3OY9A 1Z2LA 1NKCA 3GJSB 4DCPB 1UAWA 3SZ2A 4V19S 1RTHB 5L1JA 2QWPA 1BXNA 2W9CA 4H4KC 1S1WA 1EQYA 1WSIA 1F2HA 1ZBUA 2Z56B 4FYWB 4MKVA 2YNIB 4CJUA 2HRYA 4MYTA 2XULA 2ETJA 4RL1A 4MQ3A 3ENAA 3QAEA 3DFEA 2QSFA 3C66A 3CQ8A 1V3RA 4WTOB 1GLAG 1C0FA 5DM6L 4GY2B 4PYDA 4ZHRA 4OYXA 1EX4A 4HUFA 5CYMB 3P83D 2BJDA 1E4FT 4B17A 4HI1A 5M1FA 4ETXA 4DPTA 2DGTA 4KTWA 4CLFA 2D3O1 2KLAA 1RWUA 4QAGA 3MN7A 1VAZA 3LDLA 1OKJA 2G0CA 1R0BG 4X66J 3ZZ0A 2BOAA 4OGCA 2VBYA 2J9DE 4GRSA 4OX7A 3ENHA 3CE8A 2LMIA 1T02A 2DHAA 3HHLC 2VONA 2W2PP 3SCXA 1NGAA 3CCSS 4TLRA 4OI0A 2MTLA 1YRXA 2GV9A 1TKZA 4OQJA 2VH7A 5T7LA 1U8SA 1BHNA 3CO0P 3C2PA 1LWEB 1JL1A 4PWUA 4DR7J 5K14B 4LVOP 5L1IA 2DHGA 3P38A 1YQHA 3ZX2A 3G82B 5A6WA 4F2RA 2E2OA 2E9TA 3TAPA 3X1LB 2BJ3A 4LR7A 5LSRA 1HNWF 1RT7A 1KP6A 3F0NA 2G8VA 2EX3A 1FWPA 5J2PA 1B0TA 4DR5K 4KHNA 2E5GA 4QIFA 1WACA 3PSFA 4M5MA 1FERA 1CVJA 5DG9A 1WTFA 2H4WB 1EP4A 2PAVA 3IBWA 1ATRA 3SK3A 4DTJA 2OPRA 2AGPA 1KXPA 4A59A 4ZVOB 4NLYA 4CEBA 2ZWPA 3GTYX 2XMWA 3QIOA 3TUZC 4ECVA 2YWGA 3VAFA 2VBZA 1Q86T 1PBUA 3GYNA 3GIKA 3CDBA 1IBLK 4R8UA 3OYKA 3BBBA 2QMUB 2ZBIA 3FFKB 4YB5A 2JVRA 4JI5K 4FWLA 3VGUA 3T69A 1B7FA 3RW7A 5CCMA 1U4BA 2NRZA 4KJIA 5AZJB 4W90B 4HL9A 3QGIA 3KHLA 2Z58B 3MD3A 3HCXA 1HL6A 3WIVA 2XMUA 2ACMA 3KUEA 2LQ5A 3R3TA 2W7PA 1NJZA 5CZ2A 4DV3K 3D7SB 5K8NA 2KXHA 4H5WA 2EBGA 4E7JA 1D9DA 3I87A 1W25A 4A8YA 3HPOA 4DR2F 2CGLA 3I9V9 1C1AA 4FCYA 1WUAA 4LRAA 3AAPA 2COLA 3N9UC 3QZ8A 3IAS9 3MFIA 1VQ5S 4AE5A 1NK8A 3SBGA 4USWA 1BGXT 4IJAA 1X4EA 3VF2A 4AHUA 1FKPB 3MWPA 3O9UA 4FDFA 3C6UB 2XSJB 5DG8A 1NK4A 1Q8LA 3H8YA 3IS9B 3FK4A 1JLEA 5BN9A 3PFEA 2VB6A 4MMOA 5KT4A 3VF6A 2D7SA 5KT7A 2GEMA 3AXMA 4GKKF 1Q79A 3OXLA 4CJTA 3JTNA 1SC4B 2QMWA 4NXMK 1MG7A 5HRNA 2E1ZA 3OTOF 2ZOGA 3ZTSA 3MXHP 4ED1A 4XDCA 3AVHA 1S6QA 5IZHA 4OJRA 3CJ9A 4J90A 2E5LK 3W8GA 5LOQA 3LH2S 4J37A 3QGGA 2FJXA 2R42A 2VWJA 1WKKA 3CUNA 3HHLB 4O3PA 2YJEA 5HRPA 1KQKA 5BR8F 1BISA 2HGNA 3W8PA 2FHJA 2X6NA 1N36J 1S9FA 4AL7A 3US5A 3KNGA 2B6AA 3OTBA 4C0HA 1B7YB 1VMBA 1UZDA 5AFUH 5K8OA 4DX7A 3FBBA 3KMQA 4FZXC 1FX4A 4KGXB 5EX3A 2X78A 4KGVB 3VQ9A 3ZZPA 4J2EA 3HOTA 2UUBF 1XMQK 1JMTA 2ZDOA 1WG4A 1BU6O 4H0VB 1WBBA 1XNQK 1JXLA 6FD1A 1DGKN 1JLCA 5KFLA 3MI7X 4OI2A 4YOYA 4BQZA 3CHWA 2UZAA 2ZVIA 3EPIA 3N4WA 4OL8A 3G6ES 2W2NP 2D0PA 1FA0A 4PWWA 3ID6A 2IC3B 3WZ0A 3M9MB 4CIGA 3H46O 2XYHB 2YKOA 4JI3K 5BPMA 3G2XA 5IV3A 2O5DA 1RWWB 3I6PA 3A8EA 1CZ9A 4K2JA 1HNVA 3ISZA 3CCVN 3ZETA 4DV4K 1VSKA 1WEYA 2RQ4A 1SZ2A 3HI9A 3MAAB 2FJEB 4ZVPB 2NRTA 5IM0A 1I5OB 3FDSA 2KT2A 4DQIA 5C25B 3PO4A 4C1NK 1HR0J 4BE1A 1JXBA 2HNYB 1Q81O 2IJNA 2AJ4A 2OHDA 2P8IA 3QIPB 1F0XA 4MKYA 2C3YA 4JRQA 3CSKA 4KYZA 1H72C 2J4RA 3MN6A 4USUA 1QVFR 2A18A 2OD6A 3CIMA 1TUWA 4OZ5A 2HIQA 1BD6A 1F5BA 1REVA 1S79A 2VASA 4K42A 4I9LA 2A3JA 4CO5A 5BN8A 4ZCLA 2HHUA 3Q86A 1TGOA 4EFHA 3QBCA 2LYVA 3NEKA 4I6YA 4FJIA 1A5XA 1HBOA 1GLBG 4O3QA 1CXQA 4ZVTB 1FRJA 3I55S 3WT0A 1SJ3P 5B0CA 1R27B 2LEBA 2XZTB 3R27A 4QR0A 1CJKB 3TTCA 5DK5A 4OX9F 2HHWA 4DFMA 2WONA 1N6QB 5K8MA 5CD4H 3UN2A 1NEEA 2G1HA 1E6VA 4WF9L 4GW6A 1BE4A 4DV2J 3DRSB 2O8BA 3ZX0A 3V9UA 3GR0A 4GMJB 5HLFB 3D5MA 3M32A 4FLZA 3CXCM 3DM2A 4ZPTR 3MCPA 3BYRA 2R7VA 2W4PA 2VCPA 3CCTA 5SZTA 2R2UA 1HWIA 4DXLA 1HW9A 4U7UK 4NEZA 3KXDA 1Q5YA 1RDRA 3M6UA 4I6WA 1W0HA 1YJWS 3CCSN 3AH6A 4WF9Q 1JXVA 3J7YU 5M1QA 2UUCF 3MCNA 3HYFA 1LXNA 2AZ1A 1JNZB 1XBWA 3GILA 1S72S 5AE1A 3SCKE 3ZEUB 1M5OC 3TZXA 4J9UE 3VQ8A 4AH9A 2BE2B 1RTDB 4TY9A 4TN2A 3TR5A 2IM3A 4FKYA 1T9YA 3TUJC 2EKYA 1SKRA 3CPEA 3L6QA 1NOYA 2GQCA 3M1VB 2E9RX 1R0AB 3CW2C 1S0VA 1OY6A 3WXJA 1H3DA 2GAHC 2R7YA 3T1YJ 2HMIA 2K1RB 2AJFE 2WVEA 3TWHA 3JS6A 2WVCA 1GQEA 1KHWA 3EWGA 1I39A 3QRQA 2FVQA 4F4XA 2M52A 2B9EA 1IWGA 4DTPA 1FNOA 1GXTA 2CPZA 4CYUB 2YKQA 1Z2ZA 3QT5A 3SMSA 4YOTA 3VOVA 2JOQA 4FPIA 2C22A 1FO1A 1RUSA 1CJVA 4U7CA 2M3DA 4WP8A 3VMFB 3OYMA 5KG7A 1J2VA 4AHVA 4W4MA 3HZGA 4W5OA 4K0KK 5JMVA 3TTFA 1TVRB 1N5YA 3SV3A 4FZZA 4A8QA 2QWLA 3EL2A 3RYLA 3DI6A 3U1MA 1S22A 3M2VB 1T3OA 4HT7A 2NQPA 2ZKUA 2DGOA 2O01C 1JLAB 4DU8A 5AZIB 5LT5A 1ICEB 4JI6J 4UZBA 4TVAB 4LF8J 3BSNA 2DGWA 4I7FB 2GO9A 4E2FB 1SJQA 1WD6A 2JX2A 3QESA 1YJUA 1S5JA 1VQ5N 5CYQA 2POKA 4PXCA 4JI2F 2YHYA 2WVFA 4CEAA 3KG0A 3CJAA 3AVBA 3TAMA 2SXLA 3W3SA 3MR6A 3HF5A 3AOCA 4O44B 4Y2MA 4PRFA 4UTGA 1VQLN 4QU7A 3IFEA 1S6UA 2LDYA 3M9OB 1CPZA 1TV6B 2MKJA 1VHFA 1IO2A 4NLOA 2F7TA 3BGOP 4O5FA 5T7BA 2W42A 2ROEA 2JC1A 4OFZA 2JEGA 1BCOA 1GFWB 2N4CA 1NK9A 4HVJA 2KM8C 4EBEA 2NZTA 1IKWB 3SUNA 4C3LA 4C8ZA 1LOTB 5G0RA 4CJSA 1Y97A 1Q16B 1DKGD 2R8GA 4BQLA 2YWFA 5GMEA 3G10A 4L3QA 3HI0A 3RRGA 4H0YB 2HHPA 3D6MB 4LF4F 1QDUB 2BGGA 2DFHA 4ELTA 2R7QA 1IR0A 3AVFA 5C15A 3W1YC 3VN5A 2QWMA 5ADXA 4OPKA 3DLGB 3TJAA 2N82B 4P10A 4YR2A 3DLEA 2GC8A 3OTEA 1W2BM 4YOXA 5KQ8A 2W9CB 1S1WB 2WW4A 4NRTA 4B9NA 2CNOB 4LUBA 2I7PA 1VLOA 2KKZA 5HATA 4UZCA 4PHTX 1PCAA 2RS8A 5JS1A 5EHHA 4U96A 1VQKS 3G6EN 3ZLJA 3NF6A 2V2ZA 5U47A 1QZ5A 2VDHA 3FZLA 3L3UA 4ZHRB 1YXQA 1KC8T 2YHXA 2VGMA 4ZPBA 4HKQA 4O8UA 4YUDA 3C14A 3G8SA 1Z05A 3KHYA 1XTZA 3AO3A 1PYSB 3PW2A 3ZTOA 1RXOB 3FEXB 3OBYA 1Q7YO 2XCAA 4B3RJ 5IWAK 5IOLA 5HK4A 3BN7A 1MWQA 3QATA 4JV2A 4DQRA 5IQ6A 2AJQA 1RDBA 4ZPVR 4H0OA 3DLBA 1XNRF 3WX4A 1TYQA 2ZUAA 2H1YA 3BKUA 4E0DA 1M1KO 3L2WA 4MDBA 3AJ2A 2PE8A 4LF7F 1HJOA 2YTCA 1TKZB 4IYQA 1NZAA 2ZM6J 2C2NA 3OHRA 4C7QA 4CZEA 5T7LB 4KHPJ 4JV5J 1KQGB 4DG1A 2XO7A 3PRBA 1ZAVA 1CC8A 3MK6A 4H5NA 2W1BA 4LFCK 3BS9A 2VF3A 2H5IB 3BB5A 4HI2A 3CERA 1RT7B 2CXEA 2VBWA 2W24A 4DCJB 3PKMA 3I55N 3HMJG 5J2PB 3R5CA 3K57A 3F9MA 5AJ3J 3CCLS 3I0RB 4I0WA 3SCJE 3SDEA 2DNNA 3D7EO 4M5GA 4NLDA 1KLMA 4F50A 2XMKA 1GH8A 2OPRB 1C1CA 2W7AA 4A4JA 1P1TA 4LF9J 2V50A 1RHMB 2ZJQQ 1WC1A 2H4YB 5H9FK 2CJBA 5FRMA 4M5NA 4PQUA 2FJBB 1ZBIA 2M88A 3ZZUA 2HGLA 2KM8B 4R8UB 4M3YA 1KQSR 4ZITA 1OS5A 4FXVA 5HANA 3VQAA 4Z7CA 4QJVA 1YJWN 1K47A 2FJWA 3PW0A 3KWIA 2VDIA 3S1TA 3HULA 3O9SA 3J8AA 2XM3A 5KQDA 1AROP 4PG6A 4UUXA 4NLXA 2DRDA 2H48B 2HBRB 1S72N 2MDAA 2XBPA 4CZIA 4NXNK 3EJMA 1DT9A 1Y3JA 5F9NA 4TQRA 4ZPAA 4JYAK 2MYFA 3PJ9A 2ZBPA 1R8BA 3R7BB 4XH4A 4OZ0A 4Z4HA 1BC6A 2DR6A 3NMAA 2CUYA 4I69A 3B6PA 3V1OA 4CH0S 1K0TA 2QYCA 1NPKA 2LA4A 3CCES 1N88A 3U1NA 3QT6A 4PA1A 4RBUA 3BDPA 4ILLA 1T0TV 2DXEA 3RW6A 3O9RA 3FZFA 3CEDA 2ZE2A 2OEMA 3VQQA 3AOBA 4BHQA 3Q8PB 3L0QA 1JLEB 4MIBA 4EBCA 1WOSA 3OJUA 3DLKA 2MY7A 3BDEA 5CZVA 3LM9A 1HR0F 5ETOA 8RUCA 2X1FA 3KLIA 4IH5A 4DV5K 4LF6K 5MLCV 2MQLA 1YRUA 1X5SA 1NK5A 5B8HA 1H2UX 1UL3A 1RK8A 2ZHAA 4RCHA 2CPIA 1S6QB 1QHTA 5LMUJ 4FZYA 4LSZB 4OV6A 4RW9A 5F41A 2Q6BA 2R9LA 1UVIA 4KHQA 4OYWA 2L41A 2FVCA 3NMUA 1WC3A 2ADBA 2UUAJ 4JI1F 8ATCB 3FR0A 4Q2LA 1VSJA 2DVIA 5KFUA 2HVEA 3TRGA 4EIAA 3AT1B 3SLCA 4BR2A 3O6WA 5FPMA 2VL1A 2B6AB 1FD8A 2I38A 1H0HB 4BDPA 2I1RA 4RBVA 5KT5A 5DG7A 4BVOA 3K5LA 1GMVA 4DX8H 4Y0FA 4KPYA 5ETVA 4AFFA 4Y65A 1JLCB 4P52A 1CS4B 1URRA 2GAGC 3B4DA 3HTVA 4RPFA 1T6DA 2XCPA 1Y3KA 5H1SQ 1WC4A 4YOVA 5I3UA 1OY9A 1Q5VA 4EZ6A 2YJFA 1N33J 4CEFA 2LSNA 3AAWB 3H2LA 1N52B 1KAYA 1XERA 2KN4A 3GIJA 3DXBA 4UY8T 2J9EA 1YTAA 1WC6A 3QO9A 1MN9A 1L3TA 2FHMA 4X4PA 3F56A 5C7PA 2UVRA 1HNVB 3BO3A 3JSYA 4FSVA 1WC5A 4UY85 1M5HA 3BEXA 3ZETB 2Q79A 2Q6CA 4CZFA 1SIZA 5E84A 3I0SB 4R0JA 3OHAA 2P9IB 5IM0B 5F2RA 3LPYA 3BEGB 4BCAA 3DAWA 3CFRA 2MZSA 4DV1K 1JXEA 4YEAA 4QPTA 1FK9A 3T19A 2E2PA 4DR4J 1OIAA 1G3OA 2A2CA 1EETA 3RRHA 2FY8A 3PR4A 5E26A 4OI3A 4PCQA 4MO5A 2HAFA 4OYOA 1MMLA 3CNQP 1AYEA 3KG1A 1REVB 2DIVA 2DNKA 3RMDA 4NLVA 2I7NA 2BE7D 2M4MA 3SFGA 4CK3A 3M8RA 1YHQS 1G7CB 2NRWA 4J9PA 3AVJA 4RBTA 2ZDPA 3J7A1 4J2AA 4MIAA 3O1WA 4BE2A 3EVOA 1GOAA 1ZC6A 3MEDA 3W64A 1HBOB 1FTCA 4HDGA 2W6KA 2DR7A 1YSJA 3S01A 4RNMA 2NRRA 3ZT3A 4WZQA 2YHAA 2PSZA 1YITS 5C5JA 4CLKA 3BH7B 1VQKN 3VGKA 3EO3A 2NREA 4EGLA 2WONB 5HP1A 3H40A 1M1GA 1OVQA 4ED0A 4EO6A 2VQFF 3HD1A 2AYBA 4CEZA 2HMPA 5AQUA 5K8PA 1RSCA 1SH2A 1E6VB 4UOFA 4F4AA 1FHTA 3G6XA 2O8BB 2RD5C 3L2VA 3OL6A 1PGZA 4J8FA 3M32B 4HYKA 4FPAA 2MKKA 4FVUA 4N7TA 1VK3A 3QJLA 4FS2A 1RA6A 3SQ4A 3DM2B 3W0LA 2GMLA 4EO8A 3IR7B 1RLCL 1AZSA 4LSNA 4KI6A 5C42A 1EB0A 2D69A 1WUUA 4NA3A 2G8WA 3K5NA 3NP5A 4DHVA 2HS3A 3J7ZO 1XC3A 4ILGB 4LBHA 1HNXK 1RB0A 4CIFA 4X65F 1VSEA 3L3VA 4LBPA 1CZAN 3TUPA 1C1BA 1XHZA 3FZKA 4Z7YA 1KCFA 3EZ5A 4DTSA 2ZH2A 2Z2LA 4V19J 5B0EA 3VALA 3QEWA 2AQ4A 4CJ5A 3QERA 2KZZA 3HXMA 4F26A 3L2RA 1GT8A 3CC2S 2EEYA 3ET6A 4BC9A 2NXNA 5FDLA 4FWQA 4JK7A 1BOTO 4CJLA 4YY3K 4ED6A 4LFBJ 5H9EJ 1VHXA 2DRBA 1LK5A 4FOEA 2PY5A 4KGZB 3CCLN 3KKSA 1F60B 4J9NA 1S0NA 2HMIB 4OO1J 4CLSA 3CFPA 2PO4A 3E9LA 3PJXA 3ENOA 2BRKA 3BZQA 1U45A 3AARA 3VTHA 3BM7A 3FMWA 2OPSB 2VIHA 2N7CA 1NJXA 5RUBA 3MEEA 1KOHA 1VBYA 3JS9A 5KFFA 1U2VA 2CH5A 2RVJA 5HRSA 2UU9J 2YH1A 3FSXA 1FRMA 3H45C 1CJVB 1WF2A 4WTYA 2XLKA 2WB1D 4O5BA 4ZPCA 5I4MA 4DI6A 1DRZA 3JYTA 3Q24A 4F0HA 3C0BA 1XMOJ 4FBTA 1JJCB 2PDAA 4OX8A 3QWUA 4XH1A 4JKGA 1N5YB 2RHKA 1ITPA 3V6KA 4FJNA 1VCTA 5KT6A 2D0AA 4BWJA 1VQPS 3DI6B 2GGPA 3D0HE 1WHXA 4DR2K 4DWIA 4AD6A 2RN2A 3OYDA 2KYXA 1NK0A 3IMQJ 2DPJA 4AXJA 3AQOA 1S4FA 4MK9A 2FHJD 1YX2A 2FSKA 4P2MA 2YKAA 2OIHA 1WNEA 4ZLNA 4LFAJ 5CYQB 3CCEN 3OV7A 4IH6A 4ZS6A 3NS6A 3GFXA 5IS2A 1VR6A 4FJMA 2FF6A 3TAMB 4I6MA 1EKEA 5KT3A 2N4DA 4JEPA 4AQYK 3GOIA 2WC9A 4ZPWR 4DFPA 1FJGK 1WKLA 1SH3A 3J7AN 3F41A 4P2SA 1FDNA 2XMVA 2GS8A 3OTOK 5IFMA 2RB7A 3QFHA 3GFHA 1U1OA 4O0JA 4MFBA 1NGFA 2YQ0A 2KO1A 3ZSRA 3R1HA 3LA0A 2GIFA 2YV0X 2AV5A 1OYDA 2CQPA 1R8CA 5FRNA 3AHPA 5G0RB 3OHBA 1PAUB 1TQLA 2ZM6F 4AUKA 3UIQA 1PAEX 4NYFA 4W5TA 2MQMA 3J7ZT 4KHPF 2CPJA 4JV5F 1S10A 2P6TA 3VQPA 3OS0A 1JLFA 4DR6J 3GFYA 3NXZA 4CLUA 3J7Z5 4JKBA 2J9CA 4XH5A 3TX0A 4MIWA 3MDFA 2MXYA 4TYAA 2V8PA 5LJWA 1RACB 3E9OA 4BR5A 4IO9L 2M5YA 5DJBA 1SJFA 3DLEB 1WOOA 4DTUA 2F5GA 5CHIA 4N77A 1E3MA 1CSJA 3MOZA 3M7VA 4F25A 5EY4A 3QPIA 4A8OA 4WP9A 1GLJO 3Q8SB 2BE9B 2DH8A 2WUSA 3CM5A 4FKXA 4R25A 2D3ZA 2QRRA 2BACA 1NUEA 5D6GA 2W6LA 4IFVA 2MZQA 5HMZA 1RDDA 4IO9Q 5L38A 3ZSQA 3PDNA 5BJRA 4CJRA 1FNXH 3DGVA 2J8AA 3LDPA 4PY5A 4KT0C 1Q1KA 2CJXB 1NMNA 3AD8C 4Y2AA 1DLOA 2CPEA 2CVEA 3NS5A 4F3MA 4QR2A 3C14B 3LTOA 3I5BA 3VA3A 3OSNA 3AVCA 4LRFA 1YZ7A 5ETPA 1ZA1B 4GC6A 1NDLA 1T11A 3R3LA 2D9PA 2WHOA 4GVEA 3GQCA 1XR7A 3KVGA 4XAKA 5A0YA 3ZSVA 4ICLA 2Z1HA 3KLVA 1JLGA 1SS6A 4M5HA 5F8GA 3K8WA 1TYQB 4WQ5A 2XY6A 4V19X 4ED2A 3VA0A 1DTQA 2RH3A 3HSJA 4PG4A 5DMRA 4ZLLA 1XC9A 4CGFA 3TA1A 3GMGA 1YHQN 3LANA 3QEVA 3R5JB 1IG9A 2ZJPL 4ECYA 4DG1B 4QS7A 1KVAA 3CI5A 4P74A 3OVBA 1NNEA 3S7RA 4FLTA 4HT5A 3V1QA 3GYGA 1YITN 1NCLA 3OR1A 2RRBA 3EGWB 5EWGA 3L8BA 2ZH5A 2YBVA 4ILRA 4DUYJ 4G65A 4C0BA 2J6TA 4HCBA 3IDHA 4ED5A 4CF8A 3SDEB 2ZJPQ 4QS9A 3GV5B 1KTQA 1RCOB 1KLMB 5A76A 3OYGA 1C1CB 3CM6A 4JUZA 4CGIA 1BLUA 3GFZA 1HKGA 2GVZA 5GAGP 2NZ4A 1KAXA 4LBIA 3WIUA 3RTVA 2CPXA 3NLCA 1SQEA 3EKUA 4PQUB 4WPAA 1L3SA 4KGKA 2QEXS 2RMLA 1D9FA 3HD2A 3QLHA 3O6QA 3HL8A 5KRTA 3NGRA 1VQMS 4DUZK 4OGEA 2A0FB 3H42A 3AVIA 5ETLA 3H08A 2BMBA 4EBDA 3ZSOA 2VG6A 3KNAA 5T41A 4CVNE 3AO5A 4DTOA 3OS1A 3GCXP 5I3PA 5KG5A 3OYBA 4ZCMA 3R9LA 2YX7A 1JCEA 1YBUA 1U1NA 4OV1A 3AJDA 1KQFB 1M90T 2B0GA 1HKCA 5ELZA 5HJXA 1VK8A 3LDNA 1JX4A 4KPCA 2QA1A 2DR9A 2WVBA 3DOMA 4ZJQA 4DMNA 3WHIA 2E5JA 1QSSA 1B64A 4FL9A 3C65A 3SUQA 5ETMA 5GINA 2EFNA 3CULA 3CC2N 3JXUA 4DZDA 4MDAA 1W2BR 1FI4A 1S77D 1UZHA 4NZ7A 4NYZA 3CC7S 1RYRA 1RWMB 1TL4A 5KFGA 3NGZA 3R5AA 3OQ2A 3ATVA 3L2QA 2RUGA 1N33F 3HSDA 3CJCA 3Q83A 4M94A 1YT3A 2CFXA 4IOXA 5IT9U 4CD3A 4JKDA 3QRRA 2CPYA 4B08A 1RHKB 4RW7A 2IM2A 1FJEB 2ZBRA 2ZE2B 1R8HA 3O4QA 3FSIA 3I56S 4BC7A 3SUOA 4CJWA 5B0DA 4ANCA 4WFNL 4HTUA 2HQIA 3DLKB 3VZHA 3C16A 1UVMA 1HNZJ 3KLIB 3CGIA 5C2CA 4B3TF 2UXCK 2A6AA 4YS2A 1KOOA 2QV6A 2KRBA 5J2MA 2E5HA 4DR4F 1S1XB 2DCLA 2R7UA 1R0CB 4Z94A 2DR5A 3ZT2A 1VRTB 2CQ3A 2EC0A 4RW9B 2RQMA 1VC0A 3V9SA 2BOPA 1IKXA 1KS2A 4WFNQ 2J0SD 5KFNA 4J9OA 3MXMA 1VQPN 2IDOA 3C95A 2CJAA 4YMEA 1FD2A 5CH7B 2LEAA 1FKAF 1K0VA 5I42A 2YKNA 2PEBA 5IC6B 3SI6A 2BW7A 2DNHA 3PYGA 4DDFA 5BYSA 3KDOA 3Q22A 3V6DA 1QVGM 2E8AA 3OFFA 1RBTA 4BR4A 4F36A 3EICA 4DLGA 2CQ4A 5JLHA 4OLOA 3RBDA 4HWIA 1ESVA 1RGIA 1QTMA 1CC7A 3L3CA 1QHAA 4O4RA 2HK3A 2IVFB 1NSPA 5D15A 1R7IA 1NWKA 3M30A 3AOAA 1KSPA 2IVYA 3AB4B 2RDDA 1OYEA 5I3UB 4X66K 2CDRB 5GIPA 5THWA 1D8YA 3ZSWA 1HYVA 4GVMA 1R6VA 2HHTA 4KQZA 1HWJA 4AHTA 5ETSA 3C6TB 2FLLA 2VBXA 1U48A 3QO9B 3VQ6A 5L39A 1X5TA 1VQ4N 2HB5A 3RBZA 2IBKA 3D28A 5KTQA 2IPOB 2G8FA 1UW9A 3JSBA 3W2VA 1KVBA 1T9XA 2QI2A 1HARA 2Z2MA 5KT2A 4DR7K 2ZZMA 1YUWA 2VOOA 4KHMA 1AUSL 1FK9B 3D68A 2V67A 2HHSA 3TEGA 2MEWA 2X3DA 1VC5A 4FBUA 1EETB 2DCUB 3SQGA 1NOZA 5EUHA 2BW2A 3MPWA 4CE9A 4FF2A 2ACYA 2FC8A 3UI3A 1QD1A 1KONA 4RUBA 5KFXA 3Q8RB 4B3SJ 3MEDB 4RWWA 1RBRA 2HFSA 1G1XA 3UQSA 3ZT0A 3I8BA 4ZVSB 1ZBLA 2BR0A 3TQ1A 4KI4A 3LGNA 3TANA 2ZFHA 1Z26A 3LDOA 3HHDA 2W4CA 3H0PA 2CQ0A 4NO7A 1K9MO 4FJ9A 3O44A 3NVMA 2QO3A 2HYIB 5GAHP 1KR4A 5KFVA 5EDWA 1WAJA 2VZ9A 3MX2A 3NGDA 2OZSA 3DLLL 1GOBA 3TEHB 1KFSA 2UU9F 5HP1B 4LIRA 3V4IA 4NASA 1RE1B 2O4IA 3K5OA 1VBZA 3B6BA 1S99A 2HQ3A 3RZAA 1DFDA 3AQPA 4DN9A 3KK3A 5BYQA 1XMBA 3EKSA 2KT3A 4HEA9 1J5EF 2YCHA 4FNIA 1K8KB 2ZZTA 4WIIA 3OVNA 3WNEA 1AZSB 3ASMA 4LSNB 1UJ4A 3IWNC 2DNGA 3DLLQ 4K8RA 1LWFA 5C42B 1GXLA 3VAGA 4I6AA 3UCUP 4XTTA 4FYVB 1LQ9A 1BWVA 3HFKA 3BF4A 3CF5L 1LFWA 3AA4A 2YPZA 1HI0P 1SAZA 2J0QD 4DV6F 1C1BB 2DNZA 3PZPA 4ES3A 3CD5A 4ANEA 5HQMA 4LFAF 3NY0A 3MMCA 2LU1A 2LKZA 3NCIA 2E9ZA 2B4PA 1C0TA 3MCAB 4BRHA 3EYZA 4L76A 3R6GB 4NLBA 4RTFD 5GVQA 3ET6B 4JKFA 2OTJS 5FDLB 4DPUA 2FVRA 2UVWA 1HWLA 3CCRS 3ULEA 1U09A 2W8LA 1VSIA 3C15A 1W7AA 2E2QA 2MGZA 3KKRA 4OX6A 4JI8K 2EKNA 4QW9A 2HAIA 1RBLA 3BGRA 4OJ3A 3Q8UA 2HK2A 1ATSA 1MSWD 4HUGA 2OAUA 5HMXA 2YQ1A 3TTDA 1MWKA 4DCOB 4CBXA 3MEEB 1CQMA 1ASWA 2ASOA 3PVXA 1ZPVA 5F8IA 1FRKA 2QEXN 2KHOA 4CP5A 3OVAA 1U2VB 2K7KA 3G25A 1WG1A 4GKJJ 1QQOA 4KAIA 1VQMN 2OD4A 1N36K 3KFWX 2AD9A 4Q7AA 4A8MP 1XN9A 3O3HA 1X9SA 5B0FA 1TUVA 4EYHB 1KVCA 3VGMA 3JYTB 1FVQA 2IDLA 5LSOA 4Q44A 4WQ5C 4W92B 5D4PA 2VODA 2RJZA 3LDQA 5BREA 4JKGB 4B9MA 4F3TA 3SJHA 1AFJA 4NPOA 2NXJA 3SCLE 2FBXA 3SSRA 5JLFA 1WF0A 3MMBA 2R8HA 2GGPB 1AFIA 2NR0A 2Q43A 3CJKA 1WOPA 2D0OA 4CJ3A 4M63C 3O9TA 3N6LA 3CC7N 4YOEA 2L08A 1BG3A 4YOUA 1S59A 5KGWA 3MAQA 3QNNA 4TKTA 3PIPL 3KMSA 3SPYA 1EAYC 3LW5C 1NRKA 4OJHA 1N34K 5EN1A 4AYBD 1LCUA 4U67L 1QE1A 2HLUA 4CHQA 2DNLA 2BJ8A 1LKZA 2LEPA 4I6MB 2VYPA 1SJRA 1VQ9S 3TP2A 4WU2A 4E1NA 3I56N 1PG5B 4M3ZA 4CLWA 3LWMA 1SC6A 1ASVA 1HR0K 1MLAA 2KXFA 3ZTRA 2PFFB 1Y5NB 3N5BA 4I64A 4BREA 1TL1A 1IBLJ 1U04A 1YGYA 4OZ1A 3PIPQ 5DGBA 2FUG9 2W2QP 2IJRA 2QX0A 3QMQA 3OL8A 1SJ1A 2FZKB 3U3GA 4BRMA 1I3OB 5GMKa 1JK9B 1S0MA 3B82A 4H4OA 1FXXA 1HW8A 2DFEA 2W01A 3GU0A 1F1BB 4DZ6A 2R8KA 4NCBA 3EN9A 2IHR1 3FZ2A 4E98A 1PC5A 4DV3J 1JLFB 1C6VA 2IVMA 4CJ4A 3ETOA 3FMBA 3VQCA 3E51A 1NGEA 1JLQB 4KHUA 4YB1P 4ZVEA 4HHUA 2JSXA 5M1KA 2HRUA 2HHHJ 1S4EA 3DKDA 1ZAXA 2DGUA 1H98A 1NGDA 4CO4A 2IGIA 2XMAA 3KD1E 5HQ8A 3MECA 2OH2A 5KGXA 1RDWX 4DUYF 5EX5A 3MD1A 2V6AA 4DU1A 4C0OC 1XWLA 1NXIA 1PJ7A 4DV2K 4C97A 3IBFB 3VGVA 4CLLA 1NJIT 4B9UA 3BGFA 2A3ZA 4IFVB 4GO7X 1KKHA 2OEJA 2P51A 4O3RA 3B54A 2ZZNA 3OFEA 5LXYA 4CZHA 3MXIA 3DU5A 4WFZA 2HHQA 2DNYA 1RQ0A 1S9EA 3WQTA 4RLEA 5I3QA 3H2UB 3H5XA 1DLOB 3P4IA 3I4PA 3CJ2A 3D6FB 2DHHA 2RS2A 3R6LB 5LL6Z 3D0GE 1MWMA 4F04B 3OYEA 5DQIA 1I94F 1RAGB 2E5LJ 3NNAA 3P5JA 1SV5B 3FNNA 1NDCA 1LV5A 5A0YB 1BO5O 3VEOA 4ICLB 2IAJA 4GVLA 1JLGB 2F4VK 4F4ZA 3AY9A 4KH6A 4WFAL 4CZMA 1X4AA 4U95A 1X4HA 4CJKA 1DTQB 9ATCB 4QYZJ 3G87A 3M2RA 4FF4A 4PXEA 2C2MB 3N4PA 3CJ0A 2DHXA 3EPGA 4KH4A 3T1YK 2YWWA 4K5SA 4FM2A 4F4YA 1C4CA 4X4TA 2GTDA 1Y0HA 5KG2A 4HVZA 2FBYA 4WFAQ 3SUPA 2RU9A 3E1YA 2K06A 3AGRA 3CCWA 4KGMA 5IT9O 2Y0SD 1UEVA 3VR1A 1T9TA 4GKKJ 2EFOA 4KREA 1P6TA 4OKJA 4ECTA 4CGHA 4NCGB 2OANA 5A8RA 2XMTA 4NLSA 1YLXA 4JI3J 4BDYA 4J9SA 1RHQB 4UOCA 1EWRA 4ILJA 3AAQA 3LALA 3O08A 1ZBSA 1NGBA 2HBZB 2QWRA 2CQGA 3PACA 5HQLA 4FJ5A 3MCSA 1H1VA 5AR0A 1BY9A 4GV6A 1O6XA 4OI6A 3U02A 4FXWA 4KV8A 5BR8J 1QM9A 4NYPA 4IEIA 2X51A 4ELVA 2RSQA 3PJWA 3R97A 1J53A 3CWJA 2FVPA 1FX2A 2M8DB 4JI6K 5G4DA 4LF8K 3BF1A 2VG6B 3ILIA 3J81U 4YNQA 5KPZA 5GAGU 2UUBJ 3MZIA 3PYFA 1VK0A 3U7JA 3HM8A 3MPDA 4BC4A 2B56A 4J9LA 3K2PA 3TSUA 2EXUA 4C8YA 2DGQA 4NLCA 4F9OA 1W26A 4Z2XA 2HWTA 3GDQA 2VFRA 1URNA 3DOMB 4CFAA 1WKJA 3KLHA 4RWXA 4B9LA 3PNIA 1Q7LB 2P9EA 3VQSA 4EEYA 3RU0A 4ID1A 3VTIA 2OTJN 3CJ3A 3EUNA 1VBKA 4K5RA 4CGDA 3CCRN 1TMMA 3CETA 1NDPA 5KFMA 1NM1A 3NH0A 1XK8A 3AFGA 2ADCA 4J9KA 4IJNA 4KB7A 4ZVHA 3QEPA 5D4NA 1DHMA 2KHDA 5DGAA 4ILHA 3S3NA 4QPXA 1NPPA 4IQMA 3KK1A 4RW7B 5ADXH 3N6NA 4RUAA 3F44A 1VOMA 2VQEK 3OYCA 6AT1B 2V4JA 3J80U 2WCXA 4DV0F 3C16B 4NX9A 1IUJA 1S97A 1RT5A 1AT1B 1KD1O 3JB9k 2W7OA 1RLDA 2PYJA 2NUHA 5J2MB 5L9XA 1T7PA 2HBQB 2M8HA 4IOCL 4CH1A 4CNYA 3PX0A 2KJWA 2I6WA 1R6YA 5A2QU 1RJJA 1IJJA 3VENA 2MQPA 4O0NA 1T3VA 1IKXB 1U0SA 1YJ7A 1IBKK 4CESA 2I5JA 2HQFA 1G2EA 1YK9A 2D9OA 2CQBA 4B3SF 5I42B 4FLVA 2YKNB 4CZKA 4BG8A 5AQVA 2J0XA 1RBSA 4PXDA 1RYSA 2VICA 4CFDA 4IOCQ 4OX9J 3V6DB 2YQ3A 3D9BA 1XUPO 3O80A 2B9XA 1D1UA 4M3WA 5HBMA 4LH5A 4FWPA 1X31C 3UD5A 3HVAA 2KG1A 3NF9A 4FN5A 2CQCA 1NBWA 4B3RK 3HPHA 1IV0A 2C2DA 3H3OB 2F9JA 2MHNA 2GVDA 3M30B 2V94A 4C4WA 2P2CB 1QSLA 3Q2TC 1X1PA 1SIWB 4FW2A 5I9EB 1KLNA 1FWKA 5CA5A 3DXSX 2FQQB 3Q89A 4JBCA 3ZYYX 4USIA 1NZ8A 3JTPA 2BH1A 4JKCA 2DY1A 5A8KA 3UCZP 3T1AA 1TL7A 1QUVA 1F3VA 5JMNA 3ENBA 2ZM6K 1WORA 4ILMA 4ECWA 3SQ0A 3LO3A 3VAHA 4ID8A 3AODA 3W2VB 3TOQA 2RDIA 4CK2A 4KHPK 2IMOA 3AA9A 2O3DA 4UQTA 5AQXA 4DLEA 4E7KA 2E5IA 1ZETA 1Y00A 1A6LA 2D0CA 4B1ZA 1R43A 4CHPA 3THPA 2CNKB 4M7XA 1VYAA 2LFVA 2Y9HA 3FZBA 1PSDA 4DU4A 2IVOA 1RDUA 4Y6IA 3W5YA 1VC6A 4LF5K 1FJCA 2O67A 2YPYA 5AJ3K 4RW8A 2YX1A 3UCGA 3OTCA 2BA9A 1X3MA 4H03B 3QDKA 1NB7A 2E20A 1HBMA 1GLDG 1QTNB 5KFHA 2O8CA 1X4FA 2HLTA 3IGNA 5AXLA 3CCVS 4LF9K 4L73A 3DOKA 3TX8A 2HVDA 3JXOA 5BXIA 3RB6A 3NGIA 1N0VC 3JAMU 1IJEB 2HQDA 4USHA 4B1VA 2B4JA 3THWA 5GAGI 4GKJF 2CNLB 4BROA 3AXKA 3V4IB 3P3DA 1YJTA 1GMWD 2J0WA 3MWBA 1QAJA 2F8HA 2A6OA 1J5OA 4NLTA 3D0PA 4U6PA 2CKWA 2KHCA 3W9JA 3H4BA 2KT5A 1KVKA 3FFIA 3HKZD 2W8KA 2WOMA 4KTZA 5GAHU 1ZS6A 5L1LA 2E4LA 2F3JA 1VSDA 1LWFB 4QWDA 3BR8A 2QE5A 3J81j 5E41A 3D2FA 1M5KC 4UUWA 4DR5F 4JI2J 1S7IA 4WFBL 1UVKA 5C10A 3P45B 1ZBFA 3NGKA 3OW2M 3OUYA 1F2GA 2IM0A 2X1BA 2LQBA 3MMCB 3QWPA 1C0TB 1M1HA 5K5MA 5E0OA 3UVJA 1GMUA 2F9WA 3V9ZA 4Y1DA 4DSFA 4CECA 4PPDA 1NU0A 1HNIA 4DUTA 1NHUA 2JHEA 3H3NO 5DM6Q 2MLYA 2AZ3A 4BRPA 3L2UA 1D5AA 3ULEB 1CJTA 3RJMB 4RUHA 4ZP7A 1VS3A 1IBLF 3M6VA 4WFBQ 4JI0K 4FPBA 1ACMB 3I4HX 1YRTA 4ATNA 3C15B 1BQMA 3O2IA 2MGZB 4DL2A 3O4WA 1D8ZA 1VIOA 2DO0A 4IZ9A 3Q23A 4JI5F 3BGRB 5LMUK 5HJYA 2N3LA 2AYGA 3PXGa 2AGQA 1TMJA 3NF8A 3EZUA 5AQNA 4EUVA 1S1TA 4ECSA 5DS7A 2UUAK 3FQKA 1DURA 3H2VE 4LF4J 1YG0A 3SAGA 3FGVA 4CJQA 3QBXA 4NI2A 3QB0A 4DX6A 2B43A 2XHBA 4DV3F 1N32J 3ICLA 2XRIA 3TU5A 4Q2MA 2C2EA 3E01B 5AQQA 1MMNA 4CHNA 2BKOA 1SI9A 2HHHF 4K4YA 2IOCA 5ETRA 4BY9C 2QKKA 1RU1A 2K3IA 5F0UA 5H1SV 1V5IB 3CCQS 1I51B 3LWLA 3K5MA 2VG7A 3CD6N 1PKUA 3D2WA 1VQ6S 3H25A 4DS4A 4ZLPA 2HGMA 4DSKA 2ZOFA 3CJKB 5D4LA 1RWXB 1N33K 4HUEA 1EQMA 2QLBB 1CZBA 3DHWC 3NNHA 4Z4FA 2CJ9A 1XQIA 2F63A 4BLGA 4LREA 3TVYA 3ZNUA 3GIIA 5CYJA 1VI7A 1T3NA 1SPBP 4KBIA 5CCLA 1U25A 2BKNA 5LMNK 2VHGA 4AXIA 1HD1A 2QT7A 3CDAA 4EK2A 3IR5B 4YHHJ 5KFQA 4RZRA 5H9FJ 2E5LF 5IT0A 1BHLA 2QWNA</