1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
1WSHA 5CZ1A 4QWEA 5KG7A 4Q0BB 4FM2A 4WFXA 5C42A 1Q9YA 2W9CA 1RDRA 3AVKA 3L2RA 5DG7A 2GIRA 5E41A 2IA6A 1JLEB 4KHQA 3OYJA 1RTDA 1NK5A 2FC0A 2WOMB 3OL8A 2FVSA 3MEEA 3KLEB 4CIFA 4KTZA 4F3TA 2C2EA 4CGHA 2QKBA 4WFYA 1KLMA 3NGZA 3IG1B 3TABA 5J2NB 1C2PA 3QYYA 3M8PB 4ZP8A 4OKKA 2IAJB 5EUHA 1T94A 3SFUA 3HK2A 1BQMA 1QAIA 4LSNA 4TQRA 4O3PA 3ITHB 4J9RA 1UAXA 3OSPA 1WSEA 5HBMB 5DLFA 2D7SA 3GILA 1RA7A 4HCCA 1RT3A 4ECSA 2JC0A 4TYBA 3FQLA 4IG0B 4CK3A 2HNDA 4CESA 2YKNA 1S4FA 1CXUA 3LPTA 3VQDA 3VA0A 5DLGA 1EETB 3NF7A 3KMQA 4AHTA 1S9GA 3AA3A 2HW3A 2W7PA 4IFYB 4DFPA 4DTMA 1A5XA 3DM2B 1HPZB 2XI2A 1MMLA 2XWYA 4BACA 4IKFA 3HHKA 3BJYA 1RTIA 1TKXB 1JLGA 2V0NA 3I5CA 4DF8A 1DLOA 5C5JA 3L2QA 3OL7A 4M3RA 3DLHA 3OHAA 1S1UA 1W25A 3MR6A 4G1QB 4EO8A 4KBIA 2IDOA 1BL3A 3D28A 3QEIA 2UUWA 5L1LA 3D0PA 4C8LA 3QETA 1RT2B 3H40A 4CHPA 4DL3A 4F4KA 2QK9A 3BGRA 3KK2A 3M9MB 2QE5A 4ECRA 3DRRB 4KV8A 1BISA 1NOZA 4IH7A 1IO2A 1GOBA 1U09A 2ATLA 3TQ1A 4EP4A 2JEFA 3CYMA 2FJWA 3CFPA 3V9XA 3DOLB 4URSA 1JXLA 2B43A 1RT5B 2B5JB 3ZSYA 3LZIA 1UA1A 4NLXA 4Y34A 4J9OA 3OLAA 3N6NA 1X9WA 3UDLA 1RYSA 1RDAA 4B9MA 1VSDA 3AVLA 2D0AA 4HUEA 3RBEA 5KFVA 3OJSA 3VQ4A 4RW4A 1HQUB 2B6AB 3MXIA 4B9SA 3MTKA 4E1MA 3AVMA 2ZKUA 1ZBLA 4FS1A 2RF2A 1C0TB 4KRFA 4DL4A 3IN5A 3O4QA 4M41A 4AILC 4ED7A 1RA6A 3KLIA 3H4DA 3FFIB 5FRMA 1REVB 4B3OB 4FJLA 3EY1A 3PJXA 4Q44A 1QTMA 3DRRA 1BCMA 2E9ZA 4B9TA 1Q8IA 3WNHA 4Q45A 3FFIA 4ID5A 3DYAA 4E7JA 4N76A 4URQU 1X9MA 5D3GA 1SUQA 4IG3B 3ICLA 1U48A 5L1KA 4ECZA 2F8TA 5D3GB 3VQAA 1JKHB 4QWAA 3K58A 4KPYA 3SYZA 3VQPA 3OYDA 4PUOB 3CJ3A 3TI0A 3IGNA 2R2RA 3GYNA 3NE6A 3LP0A 5KT5A 3VQCA 3ISNC 3NF6A 1TL1B 2R2SA 4MQ3A 2FBXA 2A1RA 4YMEA 3DLKB 5KFGA 5HROA 2XGPA 1ZBUA 2W9BA 2HHTA 3FRZA 4J2BA 4GMJB 3RB6A 3DLBA 3T1AA 1WSJA 4KKOB 3V9ZA 4YQWA 5KFFA 5DMRA 4ZVFA 2KZMA 2RN2A 2CJQA 5KT7A 4CEDA 1LWEA 3ZSZA 4OLAA 4PA1A 5C25A 4EYIB 2CKWA 1SUQB 3M8SA 2UVRA 3KJVA 2OZMA 2W9CB 4O4GA 1HPZA 4JV2A 3RAXA 3G86A 4FK4A 1RT1B 4C8KA 2G8FA 3SJJA 1X9SA 1EX4A 4ZHRB 4EBCA 3HYFA 1C0UA 2OPRB 4MK7A 3LDSA 4NLYA 3A2FA 3B6OA 1K1QA 5KG6A 3U3GA 3BQ2A 1S0MA 1Z4UA 2HB5A 1JL1A 5L1JA 4J2DA 3LANA 2YNHA 1S1TA 4BWJA 3UR0A 4CFAA 1ZBFA 4IG0A 4DTUA 3KOAA 3HP9A 3RMAA 4CHNA 2AGQA 4ZPBA 2DFEA 3P83D 4ZVGA 2OPQA 2EHGA 1KVBA 4FLTA 3CIZA 4WYWA 3ZT3A 4MIBA 5C42B 3E51A 1NOYA 2G8VA 5J2PA 4AHUA 1SV5A 4J9SA 4JRPA 2EC0A 1QE1A 1HNVA 3DLGB 1ZTWA 2C2DA 3KK1A 4OKJA 4HTUA 1Z26A 3ZT1A 4O4GB 4XPEA 4FXDA 5KFYA 2Z1IA 1ITGA 1SL2A 2AX1A 1U4BA 1RTIB 3DLRA 3TAGA 4FJ8A 1VSLA 5L9XA 1YTAA 5KT6A 4NCGA 4DSEA 4GVMA 3ZSRA 1S1UB 4BDZA 4F50A 5KG5A 4G1QA 4N5SA 4MFBA 1ZETA 4UQGA 3OYFA 1L3SA 1JLBB 1A5VA 4QPXA 3V4IA 3HO1A 2O5DA 2IC3B 1RDBA 2OA8A 1BQNA 1S1VA 3OYAA 4NYFA 3SV3A 4YR3A 1S10A 2AQ4A 2ILYA 3AO5A 4NLUA 3H5YA 4W5RA 3U6FA 1D8YA 4RW6A 4JS5A 1NK8A 1VK0A 3MAQA 1KLNA 3K2PA 4EZ9A 4M95A 3MEGA 4O55A 1BHLA 2IGIA 3NKYA 4CJLA 1JX4A 4M45A 3CFRA 3QEVA 1VRUA 2R8HA 4JRQA 2Y1JA 3QGIA 1NK4A 4ELUA 4FZZA 4DFJA 2YKNB 1J5OA 1S5JA 4ECYA 4KAZA 4NLSA 2D0BA 4CJ5A 4MH8A 4J9NA 1Z25A 1L3UA 1TVRB 1IKYA 4PWDB 1FK9A 4M3ZA 2G8HA 3AA5X 4GC6A 4O44A 1T03A 1D1UA 3MECB 3BQ0A 2UVVA 2F8SA 1VSFA 4K4UA 4C8OA 2R8KA 3PUFA 4C8NA 4DTXA 2HHSA 3IS9A 3S9HA 3SPYA 1TL3B 4FLUA 3QEPA 1N5YB 2VG7B 3V1QA 4ELVA 4ICLB 2VG5B 2IC3A 2YNIB 4E0DA 1HYVA 4FJNA 5KG3A 4K8ZA 3QNNA 3MR2A 1FKOB 4Y2AA 2FLNA 3HPGA 3T19A 2D41A 3OSNA 4DQRA 1GOAA 4BDYA 3G6XA 2ZE2B 5EWEA 3K5OA 1KCFA 4M3WA 3PO5A 4ID1A 4RU9A 2XY5A 2XGQA 4RNFA 3PW2A 2LSNA 3OYHA 2F96A 4O3RA 2FVRA 1U04A 1LV5A 3CJ5A 1WN7A 3DMJA 1YVFA 4RW9B 1RDDA 1SH2A 4ED6A 4I7FB 3RAQA 4DMNA 3I5AA 3GIJA 1C0UB 3DOLA 2YHAA 3K5NA 4DU3A 4O0IA 5J2QA 4WXWA 4LH4A 3E01A 2HHVA 3QGHA 4QW9A 3V81A 3KIOA 4O44B 5F8MA 5J2QB 3VQBA 4RNHA 3KHGA 1R0AA 2JGUA 3S3OA 2BQRA 1N6QB 3N6LA 4QWDA 3BREA 1DTQB 5I3UA 3GV8B 4CE9A 1S0NA 1D9DA 4RW8B 3QNOA 1XHXA 4KFBB 3V6KA 5KT3A 5JS2A 3M8QB 2P51A 1GOCA 4IQXA 3AVNA 5KG1A 3OJUA 4O5BA 3DYAB 4C8MA 1RTJB 3SCXA 3QESA 1RTDB 1D5AA 1XR5A 4Q5VA 4BWMA 1S6PA 4LQ9A 5EU7A 4K4XA 1JLEA 3VQQA 5F9NA 2RKIA 1RBVA 5KFHA 4Q8EA 4K4TA 4M42A 1TKZA 2VG6A 4HUGA 3KLFA 5FDLB 3JSMA 4M3TA 4IH6A 2V4QA 4K8XA 1S1TB 2XC9A 3AVCA 3KK3B 1IKXA 4DS5A 4K50A 4CEEA 4KI6A 4KHNA 3D5MA 1JLBA 5EDWA 3I0RA 5KI6A 5HROB 3HJFA 5HBMA 2KTQA 3ALYA 4I2PA 4CFDA 5DK5A 3D45A 2E6MA 2X6SA 3KHHA 4RUCA 1TK0A 2E9TA 3OYEA 3HVTA 5HRPA 5KFCA 1LW2A 3DLEB 1QE1B 2FJXA 1QAJA 3PX6A 3NDKA 3NH2A 3H59A 4JLHA 2BE2A 3VQ6A 1JXBA 3V1RA 4AHRA 4TY8A 1LW0B 4WE1B 2XHBA 3FSIA 2BR0A 4DTNA 1CXQA 1VRTB 2ZD1A 2FLPA 2BE2B 4B8CA 3KJVB 5KG0A 1S0OA 1JXEA 4TY8B 2ASLA 1EKEA 1JLGB 4LD0A 2YNGB 2IM1A 2G8WA 1KFSA 4CF1A 2GBZA 1ASUA 2D5RA 4CHQA 4OPKA 2HAIA 2WHOA 4DTOA 1S49A 1DLOB 4DTPA 1T03B 4B9LA 3L3UA 2PYJA 1HMVB 3OYBA 4LSLA 2FVPA 1RT7A 1BI4A 4KB0A 5K14B 1QQCA 4Z4GA 3PX4A 1IH7A 3OYNA 1N48A 5J1EA 4O3QA 4LY7A 3ZCMA 3SQ1A 4PQUA 2OPSB 4KO0B 3CDUA 3TARA 1RDCA 4WXOA 4OKEA 1BQMB 4Q43A 2KW4A 3QZ7A 2R8IA 4DSJA 2OPSA 4KO0A 2KFNA 4CHYA 2JLEA 2AGPA 4WFZA 2O4GA 4U6PA 3VN5A 3DRPA 3HL8A 4R5PB 1EXQA 3Q8PB 1HNIB 2R7YA 4ZMMA 4DFKA 3L8BA 1VRTA 2ZD1B 4R0EA 1IG9A 2B4JA 4O3NA 3LWLA 2J6UA 4O4RA 3H2LA 1KFDA 4DSFA 3V6JA 1SH3A 5KFKA 4DTJA 3PJWA 2RF2B 1TKXA 4Z4EA 5DQIA 2HWIA 4HCBA 4N47A 1N6QA 3C6TA 1NKBA 3AVBA 3S3MA 4XPCA 4CFCA 1NK6A 4KV8B 5SZTA 1QHTA 3NAIA 3MFHA 4IRCA 3O3FA 4ID5B 3G10A 3MXMA 2R2TA 3KTQA 1RT4A 2HMIA 3QZ8A 3MEDB 5KFSA 3PO4A 5HLFA 2W8KA 4JV0A 1RT3B 1SH0A 2XRIA 4AHCA 4FLWA 4FJ5A 4ZPDA 3KD1E 1QUVA 2WB4A 3U3YA 3DMJB 3H08A 4H54A 4FS2A 4FZXC 4H8KA 2BGGA 4RNNA 4TQSA 4CJVA 4Z4FA 4F4WA 3NGIA 4FJMA 3OYLA 1JIHA 2IM2A 1RNHA 4RUAA 4CK1A 3GIKA 4M3UA 3CG7A 4DL6A 3NGYA 4WZMA 4CCHA 5KFTA 3RMCA 1NJWA 1HQUA 2B6AA 2HHWA 4CEZA 3CM6A 3KLIB 3OYCA 4FJIA 3AVFA 3OS0A 3FQKA 2VG7A 4NLGA 4ECUA 3LP1A 4IH5A 5C25B 1RT2A 4DL7A 5KT4A 3HVTB 3IS9B 3EZUA 1RILA 1C0TA 4E19A 4KFBA 4KSEB 1X1PA 4CEQA 5KFEA 1D9FA 1Y97A 1RBSA 4AHSA 3QEXA 5KFUA 4FLYA 3KD5E 1JLFA 1HYSB 2X74A 2FVCA 4NLRA 4R8UA 1SKWA 2HWHA 2RKIB 2F8EX 4ZHRA 3OY9A 3HT3A 4O0JA 2OYQA 5DGBA 1SKSA 4IKAA 1S1WB 1DTTA 2OH2A 3QIPA 3SPZA 2YNFA 4FJXA 1NHUA 1JL2A 3RR7A 3LP0B 4BE2A 3VQEA 3KLFB 5KFRA 3AV9A 2WONA 3EYZA 2ILZA 5JUMA 4ZPCA 1ZBIA 1KLMB 2YNHB 4DU4A 2WK4A 4J2AA 2X6NA 3O3GA 1WSFA 1FKPA 2WCXA 3KMSA 1Q9XA 4CF8A 3SQ2A 1HQEA 3DRSB 2W9AA 1RCHA 4U7CA 1L5UA 4RNOA 2UVWA 3PZPA 1IKWA 4MIAA 1S6QA 5FROA 4CJQA 4I9LA 1C1BB 2HHQA 1SKRA 4ZVEA 5HRNA 1CSJA 1LWEB 3M8QA 3CDEA 3L3VA 1SV5B 4GC7A 3NAEA 3OS1A 4DWIA 1KTQA 1NJXA 4F8RA 3DLGA 4M3XA 3TAMA 2WOMA 3EPIA 1LAVA 2C2RA 3IGVA 2QXFA 2IJNA 4AHVA 4DG1A 4CJPA 1HMVA 1T05B 1S1WA 1VSMA 4IOBA 1JLQB 3OVNA 4CJRA 4IRKA 3V9WA 1IKXB 2PY5A 4ED1A 5KFJA 5EWGA 4WYLA 5KFOA 5HP1A 3S3NA 2P1JA 4W5OA 5JXSA 3TAQA 4NLQA 4EBDA 1J54A 1RBTA 2D3ZA 4ZVHA 4NCBA 4ED3A 4NCAA 4DSIA 1TGOA 1F21A 3OL9A 3SUNA 1GX5A 4IFVA 4E7IA 1S6QB 3OL6A 3B6PA 4CFBA 4FBUA 4IDKA 4ZP9A 2YKMA 1XI1A 3SQ4A 4BE0A 1TKTA 1RT6B 5HRRA 4J2EA 4CHZA 3WNGA 1S48A 4X2BA 3AVHA 2DFHA 4RNMA 3RB0A 1J5OB 3OHBA 4YNQA 5KFXA 5T14A 4BDPA 2FJVA 4URGA 3THVA 3MXJA 5SWMA 4TSXA 1C0MA 1HRHA 3NHGA 4WE1A 4E7HA 4MK8A 3LALA 3V1OA 1TVRA 2G8KA 3PW4A 3AA2A 4ZTJA 1NKEA 3C6UA 2IS3A 3L2WA 3CJ4A 4ELTA 4ZTFA 2FLLA 1N4LA 4KHMA 1B9DA 3ZSQA 1TP7A 3H5UA 2DY4A 5KG2A 1XR6A 4RW7A 4QOZB 1CLQA 4OL8A 3UQSA 4LSLB 2DFFA 4KHYA 4MKBA 4CJSA 4EO6A 3TVKA 4AH9A 3MEGB 4MKAA 4E89A 2HMIB 4FJKA 4KHUA 1ZYQA 4LQ3A 4O3OA 3SUPA 3WNEA 4DSLA 4RW6B 2I5JB 2KQ2A 4ECWA 5KFBA 3VA3A 3MFIA 1NK7A 3AVIA 3QIOA 1WAFA 3ZSOA 4RW9A 3O3HA 1RTHB 1IKVA 3EZ5A 4KREA 3ULDA 1W9HA 4KB1A 1OS5A 2R8JA 4IRDA 3V9UA 2ITGA 4DU1A 3UIQA 5J2MA 1KHVA 1NJYA 4Y1CA 3LWMA 1ZTTA 3QERA 2E4LA 3EPGA 2JEIA 3MR5A 4FBTA 1GX6A 1S9FA 5I3UB 3NF8A 1W0HA 4DLGA 2IJFA 4CJ3A 5F8GA 2O4IA 2VA3A 1DTQA 2W7OA 4CGJA 2AJQA 3AO2A 1TL3A 1U49A 1XC9A 3V6DB 3GIIA 3PW7A 1J9AA 4DF4A 1VSIA 4CEBA 4EZ6A 4FLZA 1YVUA 2ZE2A 2Z1JA 3TANA 2BQ3A 3LAMA 4CGGA 5FDLA 3CJ0A 3KK3A 4CJFA 4OGCA 3CDWA 3GIMA 2Z1HA 1JLQA 5KT2A 3IRXA 3KLEA 2ASDA 3ZSXA 5C24A 4OJRA 1JLCA 4TXSA 4QWBA 2WONB 3BSAA 2XY8A 1R0AB 4CJTA 5C24B 4J9LA 4ECVA 4O3SA 2IMWP 4ZP7A 1G15A 2IAJA 3OYGA 1SL1A 4DTSA 2PZSA 4Z4CA 1RBUA 2D3UA 3I0SA 2HHUA 3RRHA 3NH1A 3DLEA 4HVJA 4K4VA 1RT6A 3OYKA 4FCYA 3V9SA 1QS4A 2HNZB 1LWFA 1EETA 3KLGB 1LAWA 1T7PA 2AX0A 3ZSVA 3HVAA 4B9VA 4OLBA 2C28A 5DG9A 5KRSA 4FK2A 3SUOA 3CVKA 4QWCA 4N56A 1ASVA 3KNAA 3HVRA 2E6LA 2DPJA 4DSKA 4NYZA 4W5TA 4DL5A 2IBKA 3DOKB 4F4XA 3AO3A 2VWJA 4B9UA 4FJ7A 3V4IB 3SI6A 3M8RA 1TKDA 2BANA 3K5MA 3M8PA 1C1CA 1I39A 3ZT0A 2GV9A 2P5OA 4Z0UA 1C6VA 2W8LA 5F8LA 5KGXA 3NBPA 4I2QB 3RMDA 2XY7A 2A1SA 2XI3A 2YHBA 3TWHA 3CFOA 2BRKA 5KFQA 2BQUA 4E1NA 4J9MA 3DDKA 5L1IA 1IKWB 5KFWA 2EX3A 2GC8A 1CZBA 1S9GB 1SL0A 1B92A 2YKMB 2HNYA 1NHVA 4NLTA 4IFYA 3OYIA 2AWZA 4DLEA 4EYHB 2FBTA 1EP4B 4B8AB 1MU2A 3KHLA 1HNVB 3GV5B 4H4MB 1TKZB 2VG6B 2ZQBA 3JSMB 4F4YA 4TYAA 3Q8SB 4CHOA 3T5KA 5DGAA 2UUTA 3MF5A 2NUBA 3RB3A 1RBRA 5DG8A 2XCPA 1TK5A 3O4NA 3JYTB 1BIUA 4IR9A 3BGRB 3KK2B 4PQUB 4DFMA 3NMAA 5KFNA 3RR8A 1HYZA 1S97A 5KFAA 3IG1A 4NYNA 2W42A 5KFLA 3H98A 1KRPA 4FK0A 4J9PA 1S1XB 3K59A 4TN2A 3ITHA 4DL2A 1O1WA 1KVCA 4IDKB 5KFDA 1LW2B 1VSKA 3LP3A 2HNDB 3G6VA 1L3VA 2WRMA 1IKVB 3DRPB 3IAYA 4ED8A 1TKTB 2FBVA 3T5LA 4M3YA 1IM4A 4JV1A 4R5PA 4G3IA 4ED2A 3SQ0A 3KK1B 1EP4A 3AO4A 1TL1A 3MECA 1K1SA 2GUIA 1NKCA 4CEFA 4FVMA 4FJGA 4KI4A 2JC1A 3PR4A 4TY9A 3P1GA 4JS4A 3F9KA 5F8JA 1YT3A 3QEWA 3VQ5A 4RW4B 4QW8A 4KE5A 4RW7B 2Q3SA 2UVUA 4FJ9A 2Z1GA 4K4WA 5J1EB 3HM9A 3NFAA 1JLAB 1JLFB 3ASMA 4HKQA 5HRSA 4ICLA 1FXXA 3AA4A 2YNIA 4R8UB 3G6YA 4W5QA 2J6TA 3K5LA 3GQCA 4KTQA 4B3OA 5DQHA 4FJHA 4LH5A 1FKOA 3TR8A 1RT4B 3BQ1A 4PUOA 4YR0A 2KFZA 4KAIA 4PY5A 3NL0A 1JKHA 4DS4A 4H4OA 1RT1A 4FYDA 1UOCA 4IBNA 1RTHA 5I42A 4DEZA 3I8DA 1T3NA 4KHSA 2JEJA 4M94A 1T8EA 2Y1IA 1FK9B 4NLDA 4CEOA 5I42B 3FDSA 3VQ7A 4OPJA 3I0RB 5KFMA 2C22A 2W9BB 5KFZA 5KG4A 4I2PB 2VWKA 3LZJA 3NH0A 2AGOA 4F4ZA 4CJ4A 3NBPB 4I2QA 4Q0BA 5FRNA 2DPIA 4Z4IA 1WSIA 4CIGA 3TAPA 2HNZA 5CYMA 1TK8A 1I6JA 3KLGA 2BRLA 2D0CA 4Z4HA 3QGGA 3V6DA 5CY4A 3RB4A 3CWJA 2DTUA 5CYMB 5KFPA 2HVIA 4I9QA 3TAMB 1DTTB 1T05A 2E9RX 1UA0A 3QIPB 3C95A 3F73A 1MU2B 1N56A 3SZ2A 4CJKA 4OGEA 4Y2CA 3KLHA 2FVQA 2IM0A 1LWCA 3DI6A 3SNNA 4CIEA 4MK9A 3T5JA 4OVLA 3LP2A 5KGWA 4NCGB 2BANB 1U47A 3T5HA 1RT7B 3JYTA 1BI4B 1C1CB 3QIDA 1D0EA 4L8RB 3OLBA 1QSYA 1S9EB 5J2NA 1RYRA 5CZ2A 4CF9A 1QSLA 1TAUA 4NRTA 3RBDA 2XCAA 1FKPB 3SI8A 4DQSA 3LPUA 1UWBB 1QSSA 4ECTA 4CECA 3HKWA 3MR3A 4YFUA 4RG8A 1LW0A 3H4BA 3RTVA 3CJ2A 2WTFA 2RDJA 4ECXA 1TV6A 2XO7A 2OPQB 2HNYB 1RTJA 4F3OA 3LAKA 1KHWA 2G8UA 3AO1A 4H4MA 1KVAA 4QCLA 2ASJA 3RMBA 3OYMA 3HP6A 2OZSA 5F8HA 4Q8FA 1TAQA 3TAFA 4HUFA 5CYQA 3MEEB 4RZRA 1WSGA 3GV7B 4FW2A 1YTUA 2YNGA 2OPRA 2R8GA 4NRUA 4HYKA 4ECQA 3L2UA 3BR9A 3Q8QB 5KRTA 4KHWA 1N5YA 5KFIA 1VSHA 4B08A 1KSPA 3SFGA 3ZSWA 3CM5A 4XO0A 3DOKA 4CGDA 4FM0A 5JS1A 4FW1A 1BQNB 1S1VB 2RPIA 4KTWA 4MFBB 3G0ZA 3HPHA 1JLAA 1C1AA 2QKKA 2RDIA 4IFVB 3QINA 3PV8A 4DQPA 4WZQA 2VA2A 3NF9A 3L2VA 3SV4A 4CF0A 1VSEA 1VRUB 3M9NB 3C94A 4NLWA 2IM3A 1HJRA 3I5BA 3NCIA 4YR2A 3QLHB 5J2PB 1RAJA 2P5GA 2V4RA 3KKSA 3Q8RB 5J2MB 4CJUA 3CO9A 1VSJA 3NGDA 4CF2A 4CJEA 3V6HA 5T7BA 3QO9A 3QLHA 4K4ZA 3HPOA 1WLJA 1NK0A 3C6UB 2GIQA 2QV6A 3E01B 3VQ8A 1IKYB 4PWDA 4CGFA 3HXMA 3PHEA 4TLRA 3OS2A 4BE1A 4J9QA 1NJZA 3AVGA 4J9KA 1J53A 3BDPA 4EP5A 4E3SA 4KHRA 3UPFA 2XY6A 1U45A 5K14A 4IR1A 5KTQA 4FZYA 3C6TB 1REVA 4F2RA 1S1XA 1TQLA 1B9FA 2J6SA 2OPPB 1NK9A 4GW6A 2VG5A 2FBYA 4F2SA 5DQGA 3KHRA 1L3TA 2ALZA 4NLPA 2OPPA 4JUZA 4NZ0A 2HHXA 1BGXT 1ZBHA 4K4YA 4XIUA 1HNIA 3NAHA 4H4OB 2I5JA 3WNFA 4KB7A 2BDPA 3KLHB 3CQ8A 3QO9B 5F8IA 4FLVA 5F8NA 4Y1DA 3SUQA 3DM2A 3M9OB 1RT5A 2B5JA 1I3AA 4B9NA 4I7FA 4DQQA 4QAGA 4EEYA 1JLCB 3VQ9A 4CGIA 4W5NA 3BSOA 3T3FA 4HHTA 4CEAA 2AU0A 3PW0A 2ETJA 1HQEB 3DRSA 4E7LA 1WAJA 1BCOA 4N41A 2I1RA 4KKOA 2IOCA 3PW5A 4CERA 1C1BA 3ISND 3I0SB 3BSNA 4ZP6A 3KLVA 4ED0A 3K57A 3N6MA 5F9LA 1K6YA 1HYSA 2HVHA 2KZZA 1XR7A 4FLXA 3LP1B 1CZ9A 2PYLA 3MEDA 1LWFB 4RW8A 5HLFB 4Y3CA 1WNSA 4IG3A 3P5JA 2V9WA 2ATQA 3HSTB 3PY8A 1LWCB 4DG1B 5CYQB 3ZT2A 3IRXB 4CJWA 3KKRA 4K4SA 1S6PB 2JEGA 5EWFA 4NLVA 3PVXA 3PX0A 3H5XA 3DI6B 3ZT4A 4CK2A 1S9EA 3PR5B 1A5WA 4E7KA 4YP3A 3AVAA 3BSCA 2X78A 2G8IA 1WNEA 4FJJA 3TAEA 5HP1B 2YV0X 4ZPAA 2YNFB 3VQSA 3LP2B 4DQIA 3RWUA 3DLKA 3RRGA 3V81B 4EBEA 2R2UA 1BIZA 1XHZA 3H5SA 4FM1A 1NNDA 3HVWA 4DTRA 4LSNB 3AVJA 4NLOA 1XWLA 1ASWA 1UWBA 1HARA 1TV6B
chains in the Genus database with same CATH superfamily
1WSHA 5CZ1A 2Z4PA 2IIHA 4LF8F 1YHQN 2CQ3A 4Q0BB 2AJFE 4CP5A 2QW9A 3D66A 4YY3J 4WFXA 5C42A 2JRSA 2GNKA 2WW8A 1NH7A 3BPDA 3R5AA 2DXDA 2Q6CA 5DDRC 2ZEJA 3R6MA 5AE2A 2P9KB 3OYJA 5GAHU 2GTDA 5A0YA 5L9NA 5ADZA 1RCOB 3AA9A 3HOTA 3ID6A 5E5NA 4LR7A 4CO4A 3KKFA 1N52B 2GGPA 2P9CA 1CQMA 4CIFA 2O8DA 2QKBA 1FT8A 2VQEF 2FIUA 3FMWA 3QQCD 5IC4B 3LGMA 4LRCA 1C2PA 2OFGX 2G0CA 2VF3A 2E1ZA 4ZP8A 2VFUA 1HA1A 1T94A 3L95X 1BQMA 4MJKA 4TQRA 4LSNA 3CCUS 4J9RA 1UAXA 1IV0A 3THXA 4DR1J 2ROGA 1RT3A 3WIUA 2JC0A 4ECSA 4IG0B 1FRLA 4EU0A 2HNDA 3A8IA 3LPTA 3VQDA 5DLGA 4JI6F 1KAXA 3K0SA 3JS6A 2YVSA 5DS7A 2EWSA 1H6KX 2W7PA 4FNHA 5CD4A 2BJEA 4BACA 3RAMA 3G71S 1K73O 1TKXB 4U95A 1JLGA 3I5CA 3OL7A 3LQVA 3M2VA 1JJ4A 3R1XA 5JLHA 3SQGA 4EO8A 1QD1A 3C65A 3D28A 2DNPA 5L1LA 3CE8A 2EPIA 4X66K 2HK3A 9RUBA 1Q81T 4EHUA 4ECRA 4AM6A 3DRRB 3ZNJ1 1C0GA 1WI8A 1GOBA 4WFNL 4USWA 4EP4A 2MKYA 2GO9A 2C2ZB 3FSYA 1RJJA 4XTTA 1M1HA 3N4QA 4M5DA 3CCLS 2QMWA 1K8AT 1BMQB 2CZ4A 3OTOK 4H4KA 3H6EA 4ID8A 1RT5B 2OTJN 3FE1A 1S0VA 2AIRB 4EAHD 4CD1A 2W6KA 5M1QA 3UDLA 1N0UA 3NOGA 3AOBA 1VSDA 2D0AA 1WF1A 3RBEA 2Q3PA 3HHLD 4RW4A 3GG0A 4B9SA 3MTKA 4E1MA 3AVMA 4OHZA 2ZKUA 1Q7YO 1OH5A 1ZBLA 4O5FA 2RF2A 3M7VA 4DL4A 3PTWA 2XSFA 4KGXB 4ED7A 2DRDA 1AUSL 1RA6A 2GJIA 3FFIB 2HBJA 4FJLA 3PJXA 3IMXA 3EX7B 1QVFM 1IBMF 2DD8S 4QYZJ 4E7JA 4N76A 4URQU 1X9MA 2P9UA 4B02A 5D3GA 1KWMA 3OFEA 4JEPA 4IG3B 2GZOA 1DURA 2YWEA 3FFKB 3W8GA 1TELA 2V4JA 4L3QA 3QRRA 4X66J 1W7WA 2ZH5A 3K58A 4KPYA 4BRLA 3VQPA 3OYDA 5E3AA 2Q66A 3IGNA 3GYNA 1R8BA 2I9SA 2ZF5O 5KT5A 3VQCA 4DX6A 3NF6A 2A1RA 1ZH5A 4JI0F 3OA9A 1FDDA 4YMEA 4GKKF 5KFGA 1YJNS 2NS1B 4IOAQ 2VASA 1VQ5S 3NEKA 1VQ6N 2RVJA 9ATCB 1IWAA 4V19X 4ZVFA 5KT7A 3CC2N 4YN3B 3SDEA 3ZSZA 4OLAA 2ROPA 2CVIA 4P73A 4CM2A 2UUAF 4PA1A 4WYBA 3MM6A 3NP5A 1F5AA 3A8YA 2DGUA 1UFKA 1YJRA 2CKWA 2M4MA 3H7HB 3R5CA 3KJVA 3A3NB 3BPSP 4O4GA 1LXNA 1HPZA 4JV2A 3RAXA 3L6QA 4U67Q 3O1LA 1UEVA 3X1LB 3ETMA 4DR4J 1RAOA 1C4CA 2P9PB 4DU8A 5C12A 2E7VA 4MK7A 3LDSA 4L74A 1K1QA 5KG6A 1ZZFA 3B6OA 4C8YA 2UXCF 3O6QA 3BQ2A 3ID8A 2HB5A 1GK8A 2YNHA 3M1VA 3U4LA 4CFAA 1ZBFA 1RP5A 1CS4B 3MOZA 2B9YA 4QR1A 3KOAA 3HP9A 5AQVA 4CHNA 4ZPBA 4OZLA 2OPQA 2L9DA 3MK6A 3CPWR 4DB3A 1KBRA 2IVMA 5H1SV 1ZOTA 1SV5A 4JRPA 3CSKA 2YKQA 3WQPA 2Z2ZA 6FDRA 4OLOA 2OSRA 2HHHJ 3O44A 2M3DA 1Z26A 5KAKA 3A1YG 2Z1IA 2U1AA 2OKQA 4FO0A 1F3FA 4JI3J 4A8OA 2ALYB 1RTIB 2KM8B 3AARA 1YTAA 4DSEA 5IZHA 3ZSRA 1S1UB 2D0PA 4BDZA 1WORA 1Y00A 4ED4A 1ILYA 2CQHA 4G1QA 3MHYA 1L3SA 1NCLA 4QPXA 4NASA 1MW7A 3OTBA 3CULA 4Z2XA 1GXLA 4HACA 1FI4A 3W63A 2AJ4A 3H5YA 4RW6A 2QM1A 3BKUA 3MEGA 5M2RA 1BHLA 3P45B 1H73A 3D6TB 4AM7A 3NKYA 2NZCA 2CJXB 3K9KA 2ZHBA 3MGJA 2KFYA 5A2QO 1VRUA 2C3UA 1NO8A 5GAEU 1QHAA 2E2NA 3QWPA 4JYAK 4ELUA 2L3MA 2PE8A 2OEKA 1J5OA 1OVYA 4CNZA 2J8AA 3R97A 4U7UD 4NLSA 1S7HA 4C3MA 4MH8A 3AGRA 4J9NA 1TVRB 1WC1A 1FK9A 4M3ZA 3TEGA 3M8YA 3AA5X 3C66A 1VQSA 1QQNA 1VHFA 1BO5O 1VSFA 4C8OA 3PUFA 2HF3A 3S9HA 3SPYA 1TL3B 2MKIA 4ZLPA 3PYEA 4FLUA 2IC3A 1RE1B 1ATSA 3DDIA 2V50A 4QIWD 4OX7A 1N5TA 3QNNA 4Y2AA 2FLNA 3T19A 3Q2SC 2GELA 4DQRA 3G6XA 5EWEA 2OSQA 2KB2A 4M3WA 3CHWA 4DR7J 3PO5A 2A41A 4ID1A 1OY9A 1JCFA 2HHPA 2XY5A 6AT1B 2XMWA 3NGUA 2UUCJ 4O3RA 2E7WA 1TUYA 2N3OA 2A3ZA 3CJ5A 1SCJB 3DMJA 4Y2KA 2E66A 4ED6A 2XB2D 3RAQA 2BVZA 4ETXA 1C0UB 1FNXH 1DBDA 4M5LA 1ZM3A 4WXWA 4LH4A 5HQLA 3V81A 1ATRA 3KIOA 3L3CA 5F8MA 5J2QB 4NLCA 1R0AA 3AQOA 2JGUA 1N6QB 4QWDA 4B1UB 2RB7A 3DC2A 2JFDA 5JMVA 1DTQB 1RLCL 2ABYA 3J7YI 3WX4A 5F0UA 5EXWA 3BH7B 2MZTA 1XHXA 1ZBSA 3M8QB 2QWOA 4ES2A 3AVNA 1YAGA 1D5AA 4B3SK 1XR5A 2BZ2A 4BWMA 1S6PA 2W25A 5EU7A 2OTJS 4JI1F 1U0SA 4UY8T 1HW8A 1S57A 2CPYA 1Q82T 1YI2S 3KUEA 3HT0A 3SJHA 4HUGA 1T9WA 5FDLB 2RU3A 4M3TA 4IH6A 2V67A 3R1LA 2B9XA 2HQIA 3D7SB 2C2KB 5LJ3Y 2R9LA 1B7YB 4DS5A 5AR0A 4KI6A 2V8PA 2HS4A 4JI5F 4KYZA 1P27B 1JNRB 3WQTA 3JQKA 1DT9A 1YIJS 3W9IA 4FWNA 5HBMA 1SKUB 3L4BC 4CZCA 5LXRA 2IPOB 4NXNF 3KHHA 2DNKA 4TLQA 4OQJA 3HVTA 3O8WA 4USMA 1VC6A 2MPUA 3DLEB 4DV3K 2FJXA 1S6OA 3PX6A 2AV5A 3IA0A 3TSQA 3QBXA 3SAFA 3ZZOA 4AHRA 5F3ZA 2F7TA 4HT5A 4WU3A 4WE1B 5AZIB 2E2PA 2ZD1A 2BE2B 3SIPB 1S0OA 5ELZA 4TY8B 2ASLA 4LD0A 2G8WA 3E3XA 4WTYA 1TL4A 2D5RA 4CHQA 3ENAA 4YOWA 4OFZA 2WHOA 1DLOB 1T03B 2PI5A 2PYJA 1HMVB 2G2OA 4K0KK 2J8SA 2FVPA 1RT7A 4KB0A 4YOEA 3AY9A 2CG4A 1Q4RA 2F9DA 1VS3A 4OJHA 1U26A 3AAQA 4AL5A 3KWIA 1F6TA 2IFXA 3PX4A 1NWKA 4LF6J 3PM9A 1HBNA 3AA8A 2OPSB 4WXOA 2JWLA 1BQMB 4OKEA 2E5LF 5FJ4A 5JICA 4CLPA 1B3TA 4CH1A 1FRKA 3A13A 4RO0A 1DY3A 4FPRA 2O4GA 1FVSA 3DRPA 4C0OC 4NMXA 3EKUA 3NS6A 2R7YA 3E9PA 4ZK7M 4JI2J 1WEXA 2Y3YA 1W2BM 4KHPF 1DQ8A 2O3DA 3LWLA 1S7IA 3GZ7A 2QLWA 1DAXA 4TU7A 1HLWA 5DQIA 1WC3A 3A5LC 4MKYA 4DR5F 1IXKA 3C6TA 3S3MA 3N79A 4CFCA 5JVGL 2QEXS 1NK6A 4EFAC 1F5BA 3NAIA 1KC8T 2I38A 4IRCA 3O3FA 3UKRA 4W90B 2WSCC 1AROP 3TTDA 4C11A 2OCEA 2BYCA 3VF6A 2HMIA 2QWRA 3I96A 2A2DA 3P5BP 3G4SS 2W8KA 1HNZK 1RAAB 1U1OA 4HT7A 4JV0A 2P9LB 1Q7YT 3KD1E 2MQ8A 3DMJB 4H54A 1WC4A 3C3LA 3GTYX 2W2PP 4Z4FA 3BBFA 2IM2A 4QYRA 4M63A 5KPZA 4RUAA 3W60A 4PL7A 4IEIA 1GLCG 2EFPA 3ZETA 3R9PA 4CCHA 4DR7K 5IV3A 2WVCA 4YY3F 4CO0A 2B0GA 1XNRJ 3DXKB 3MCNA 3Q7CA 1NBWA 4C1NI 5L8RC 3EZUA 5KT4A 4AL7A 4KSEB 1PYSB 4XDDA 2I6WA 4DN0A 3T9NA 1SJQA 3O3LA 1R89A 3M2UB 4DV4K 3CPEA 1RBSA 3IM9A 3ZZPA 4HHHA 2FHMA 4C0HA 1SJFA 1V3RA 2FGOA 3M6UA 3MZIA 4R8UA 1NMNA 3ENOA 2HWHA 4OYPA 3VAMA 2ZHOA 2P9PA 1E4GT 1VGYA 3EZWA 2IVNA 2R7QA 4RBUA 1FJCA 4ZS6A 4BRNA 2PA3A 2O8CB 2HS0A 2V94A 2YNFA 1I5OB 3AQPA 3RUBL 5KFRA 3AV9A 2GA7A 3WEEB 2EG1A 5JUMA 1VCTA 4ZPCA 1QDUB 3R7BB 4RWWA 4ZIVA 2EKYA 2NRRA 3KMSA 3SQ2A 1HQEA 4NA2A 3WC2A 3FNNA 1L5UA 1KTVA 4NWBA 1M90T 3PZPA 4MIAA 5K20B 4CJQA 2AJ2A 1T9VA 1AFIA 2QFIA 5CAAA 3CDEA 1RWVB 1XNRF 2HQ3A 3VERA 3OS1A 3QGPA 1KTQA 2KVIA 2VC1A 1VQLN 2W2QP 1O0PA 2VWBA 3PACA 4A2BA 1HMVA 5U47A 1S1WA 4DPYA 1RHJB 2HLUA 1XN9A 3Q2TC 4ES3A 2UXBK 2A5XA 4CTAB 4ED1A 3JAMO 4LREA 4FVCA 3S3NA 4LRFA 3GE1A 5K8PA 3PXGa 2AJ0A 4W5OA 5JXSA 3TAQA 3GFHA 1RBTA 4ZVHA 4NCAA 1F21A 1SZ2A 1N34F 1GX5A 2M70A 2D69A 1M5PC 4LFAF 3ZLJA 3B6PA 1FVQA 2IVFB 4FBUA 4ZP9A 2YKMA 4LBHA 3CC7S 1MN9A 1XMQF 4A8FA 3VETA 4DV4J 4Y6IA 5C2DA 3I55N 4I68A 2DBBA 1S48A 1P8GA 2Q97A 2DFHA 4RNMA 5KFXA 2XSJB 5T14A 2RD5C 4URGA 2JVOA 3THVA 1W7AA 5SWMA 4TSXA 1HRHA 4WE1A 4ZVOB 2MQPA 2NREA 4ILJA 3OPKA 3VEOA 2M5YA 2IS3A 3L2WA 3CCMN 1EKSA 4ELTA 3B4DA 4DUYJ 3H5UA 2OIHA 2NCKL 2HQCA 1CLQA 2VDIA 3MPYA 3UQSA 2KVQE 4CJSA 4EO6A 4A47A 1MWQA 4FJKA 4KHUA 2ZJQQ 2QA4N 2OEJA 2EK1A 2XHCA 4LQ3A 1GQEA 1H1VA 3VAIA 2CGKA 2G9OA 3BGOP 3G25A 3NGTA 4DSLA 2L48A 2KXFA 3R6GB 4B3RF 4I6AA 5KFBA 3VA3A 3MFIA 2I7PA 3I82A 4Z7CA 3AVIA 1FDNA 4GKJK 1WBDA 4RW9A 3VEWA 2J9EA 1RTHB 3EZ5A 2PMZD 1W9HA 2R8JA 4IRDA 5J2MA 1EWQA 1NJYA 3LWMA 3GYGA 4BR0A 2JEIA 3MR5A 1GX6A 4G1IA 4ILMA 3KWMA 2Z2MA 2CUYA 3CD6N 2QWQA 2VA3A 4DR2J 1RWNB 3MM8A 2WVFA 1VQ7S 2IY5B 2MKCA 3ILIA 1XC9A 4JI4K 1EHWA 3GIIA 2E5LJ 4DF4A 2IBOA 3FSXA 1Q78A 3CMES 1TYQB 2BKNA 3MMCA 3OVAA 3DKDA 3O1BA 3TANA 2BQ3A 4PG5A 5ETNA 2LDIA 5LY3A 2Z30B 4CJFA 1WTBA 3CDWA 3ZTPA 2Z1HA 3KLEA 2LLZA 2ASDA 3ZSXA 3S6EA 3O9SA 1XC3A 3UW1A 2HLTA 1FX4A 3MPWA 2B8QA 3BN7A 1R0AB 3K5PA 5C24B 4ECVA 4O3SA 4YB6A 3SSSA 4OX6A 1W97L 4ZP7A 5FD1A 2LEBA 2E44A 4F7VA 2HHUA 2DEIA 3GSIA 1RT6A 3H45C 3RBZA 2YPZA 4MAKA 3TTCA 4X65K 1LWFA 2FPHX 2AX0A 3PRVA 2GEMA 4BLGA 2C28A 1M5VC 3SMSA 5DG9A 3CCMS 5KRSA 1NLVA 1UWAA 4DV1K 5IT0A 2RMLA 4FWMA 3AD9C 3HVRA 1XK8A 2Z2YB 5AQJA 1YJVA 3V4MA 4NYZA 3KWGA 3PFEA 4W5TA 3WXJA 5M1OA 4ZJLA 3NMUA 2HYIB 4U8YA 2BANA 1G7CB 4F04B 3D7EO 4PPZA 2P5OA 1X5TA 4JN4A 1C6VA 2W8LA 2VBZA 4G1PA 4W98A 5F8LA 3NBPA 4I2QB 5ETRA 3K0JA 2M8DB 2XY7A 3B4MA 2WVBA 2YHBA 3TWHA 2P9IA 2BRKA 4E1NA 2CGJA 2EX3A 1GLLO 1CZBA 5G4DA 5HMZA 1NHVA 1R0CB 3OYIA 1X5PA 2AP1A 2CQCA 4CZGA 4DLEA 4K43A 4HI2A 4EYHB 2BOPA 2FBTA 1EP4B 1HNVB 4H4MB 1NZ8A 1IJJA 1VQYA 3TX8A 2V51B 3Q8SB 3CJ8A 1PJ6A 2A10A 2R7WA 3BS9A 5DGAA 2UUTA 2XYPB 1NMDA 2XCPA 2YPYA 3KNGA 3M32A 3UDCA 4CDIA 3U02A 2JNJA 3BGRB 4YOXA 2LQ5A 2MKSA 1BA0A 3BYPA 3RR8A 4DCOB 2W42A 3H98A 2HK2A 2XHWA 4JI2F 4RBVA 3UDVA 4J9PA 2E5JA 1IQZA 2ZBPA 5D8HB 3K2YA 3EVWA 2AYEA 1PCAA 2LEPA 3PRDA 3VZIA 1O1WA 1RK8A 3H2UB 1VQ4N 4IDKB 2UUAJ 2YCHA 1L3VA 1A9NB 2WRMA 1RTZA 4ED8A 4USUA 4HR2A 3H3NO 4JV1A 2XBPA 2IVPA 3GL1A 1TR0A 2ZH8A 2ZH2A 5DETA 4FVMA 3P4IA 2CAJA 1Q79A 1FXDA 4TY9A 1SAZA 3QEWA 4FSVA 5A8WA 2XS7A 3VQ5A 1FFGB 3LM9A 2F4VK 2Q3SA 3TPQA 3H46O 1JLFB 4ICLA 3DXBA 3AA4A 2UXDK 3LA0A 2MQMA 3K5LA 2J6TA 4NEZA 3U9DA 4KTQA 4BG8A 4A4JA 3ZZYA 2EFNA 2HFNA 2GMLA 2KO1A 2KFZA 4PY5A 1XTZA 2DK2A 1CJTB 3SQOP 3HLUA 2JJ4D 4FYDA 2AZ1A 5K9FA 5LJWA 3QT8A 3UDEA 2KXNB 1RTHA 5I42A 3SCJE 2FXUA 3O6WA 3IDHA 1T8EA 2Y1IA 1OWXA 1FK9B 5AJ3J 2R42A 2VPZB 2CA9A 1B99A 4HLBA 1DARA 4UT4A 4GNIA 3QJLA 1GMUA 3LZJA 2PDAA 5FRNA 4PABA 3SXLA 3H25A 2ZH9A 1TK8A 2P8IA 4JI7F 3M6GA 3J8AA 5BPMA 4HTIA 4BRHA 2CJBA 3KJNB 1N54B 1HR0K 2O66A 2WB1D 3FBBA 2LXUA 1Y10A 1VC5A 3U1LA 1YIJN 2HVIA 2KHOA 2HBLA 1UA0A 3R1HA 3QIPB 5AFUH 2JOQA 2XYHB 2CPFA 1MU2B 4R0JA 1N56A 5AXKA 4OGEA 5I3PA 2HRUA 2MQOA 1LWCA 3DI6A 4CIEA 3MUMP 3O08A 2BANB 1U47A 3EE3A 3GDQA 1RT7B 3JAMU 5CCLA 3W64A 4L8RB 4YHHJ 5H9EK 3AB2B 2XTJP 1S72N 5J2NA 3VEYA 3VGVA 3N4WA 2BA9A 3QJJA 1V5IB 2B56A 4ZIWA 1FKPB 3LPUA 3ENBA 1QSSA 1CS4A 1LXJA 2DIUA 4F67A 4RG8A 1YK9A 1H7WA 3CJ2A 4ECXA 2OPQB 3LAKA 4BRKA 3AO1A 1KVAA 4GVEA 2R7XA 4ER8A 5FIIA 5BRHA 2GHVC 4QU7A 5BN8A 2CZ9A 1XERA 4RZRA 1WSGA 1TMMA 5AT1B 1YTUA 2ZH4A 3UNGC 5BRDA 4J9VA 2M2BA 4NRUA 4OYWA 2HIQA 2E1AA 2E2OA 2P9GA 3BR9A 2MQLA 1U2CA 1N5YA 5KFIA 3SFGA 4CGDA 4FM0A 3CC2S 1BQNB 1S1VB 3SBGA 1EO1A 5K8OA 4KTWA 3G0ZA 3HPHA 3UVJB 3I9ZA 4I56A 2QKKA 3CJKA 1U7LA 2B7CB 3SV4A 3L2VA 4CF0A 2V5HG 1VSEA 3WHIA 1ZPWX 1JB0C 2ZVIA 2IM3A 2LQ8A 2P5GA 4PEOA 3KKSA 5J2MB 3TUIC 3CO9A 2GQ2A 4NXNJ 4CJEA 3V6HA 2WBNA 3BZQA 3T6JA 3QLHA 2IIRA 3FRYA 3UE2A 4GMKA 4LC9B 2GIQA 4NPOA 1T02A 3VQ8A 3F56A 4CGFA 4KH4A 3PHEA 3OS2A 4YB1P 1CEZA 4HHJA 4J9QA 3AVGA 1VQ8N 2W01A 3TW0A 2QT7A 1WHYA 2CWXA 2O8DB 4ZCIA 4BR5A 4YHHK 2HHHF 4AF1A 5B0AA 4WFAL 3BEXA 4IYQA 2YHXA 1QUPA 2LU2A 1UFLA 4GW6A 2KKZA 2M52A 3GP9A 3KHRA 3K17A 2QA4S 1RHKB 1Q7LB 1G2EA 4WIQA 5GMEA 4NZ0A 1BGXT 2LU1A 3NG8A 1VLYA 4P7TA 4H4OB 1SBRA 3A3PB 2BDPA 2QEXN 3CCLN 3KLHB 2EG2A 3CQ8A 2R7RA 1N36K 5F8IA 4FLVA 4V19S 1SC1B 3DM2A 4B9NA 5C10A 1VOMA 1RU1A 4DQQA 1JLCB 1UL3A 5JVHQ 3BH6B 3THWB 2MSTA 3P3DA 4CEAA 2AU0A 2KJWA 1K0TA 1QQOA 1YJ9S 1JJ2R 1BCOA 1H2VZ 4N41A 1SQEA 2IOCA 4CERA 2RHQB 2VBYA 2ZDPA 1C1BA 3QAEA 1NGGA 3I0SB 3BSNA 4ZP6A 3KLVA 5DM7L 3JQJA 3K57A 3N6MA 5F9LA 4X84A 2KZZA 4FLXA 1KR4A 3EGZA 4I1TA 3M05A 2GQQA 2W2OP 2V9WA 3I31A 3PY8A 1Q8KA 2MKKA 5CYQB 4OHXA 3CCZA 1S6PB 4U96A 3DXMB 2YWWA 4JI3K 5CQGA 3H5XA 3TUPA 3ZT4A 1N5QA 2RHSB 4BRMA 4B3TF 3US5A 4CK2A 3GBTA 3PR5B 4E7KA 1I3OB 2X78A 2FF6A 4A57A 3RJMB 1KQSM 2YV0X 4DUZK 4TU8A 3VQSA 1K8AO 3LP2B 4DQIA 1NGIA 4B17A 3RWUA 3EDQB 2FY8A 3RRGA 1YRUA 2CQPA 5GAEI 4CLTA 4EBEA 2PMHA 3HZ6A 2WC9A 4QR0A 1NU4A 3FZKA 2XMKA 4FXVA 1K0VA 4LSNB 3AVJA 4LF5F 4NLOA 1ASWA 1UWBA 1TV6B 3N01A 1F3VA 3Q22A 5A2QU 1R8CA 4PPDA 3FUYA 2LXIA 3JB9k 1Q9YA 3WQUA 2CPIA 4WP9A 3AVKA 4DV7F 5F2RA 1TTHB 4JYAJ 2FHKA 3AD8C 1GAOA 2VFTA 3CNQP 3UN3A 4PG4A 2B4VA 4BS2A 2EK6A 2FSNA 2DR6A 4B1ZA 1Q53A 2PIIA 4BVPA 3W62A 4KH1B 4R79A 4F3TA 2C2EA 1Q16B 3VGTA 4LFBJ 1SQFA 4CGHA 1X3NA 1ZPVA 3UVJA 1QAXA 2AYMA 1Y5NB 3CJKB 3TABA 5J2NB 3QYYA 3M8PB 2V8HA 3N4PA 1KONA 3PHTA 3D68A 2Q43A 3HJVA 1WSEA 4L75A 3ITHB 2RQMA 2X1BA 1PSDA 2DGWA 1RAFB 4LRBA 3WC0A 4I6YA 4IOCL 1VQ7N 2VBWA 1U8SA 3CCUN 3SDEB 2QA2A 4CESA 3ZX2A 1S4FA 3KVGA 2BJ9A 2X3DA 2O8BB 1EETB 3W3SA 2F8MA 4ALZA 2GWKA 3NF7A 4N77A 3KMQA 3CPWM 5BR8J 2QLFB 1S9GA 2MQNA 3AA3A 2HW3A 1GH8A 3ZTRA 1HPZB 2XI2A 4FVUA 2VQFK 3BYRA 5M2UA 3HHKA 3JTPA 3BJYA 2QL9B 2V0NA 3R5GA 5D6GA 2E29A 3OHAA 1AB8A 2A42A 4UUWA 3MR6A 4HDGA 1Z2LA 5KQDA 2WVEA 3N5BA 2UUWA 3QEIA 3D0PA 3J80O 4ZVTB 1BC6A 4CHPA 4DL3A 3KK2A 1XMBA 2ZJPL 1GNKA 2CQ2A 4M8LA 4JI8K 3TQ1A 4DUTA 3BUZB 5AXMA 1KXPA 2JEFA 1Y0HA 4C9DA 2FJWA 3CFPA 4RUHA 3DOLB 4URSA 2ERRA 2B43A 4OYOA 3ZSYA 5EY4A 3LZIA 2ZBIA 4Y34A 2DNYA 4J9OA 4BREA 3CXCM 2H65B 1RDAA 4B9MA 1AFJA 3AVLA 4JI7J 2ZZNA 5AQYA 3TZWA 2F7VA 3D6MB 3ZYYX 3TSPA 4TNOA 4GY2B 3VOVA 2IHR1 1I94K 3IN5A 1HNWK 4AILC 5BPLA 4WP8A 1CG2A 3LM2A 1BOTO 4B3OB 4CO3A 3W3DA 2WBMA 4Q44A 1RBOB 4RUBA 1GLDG 4Q45A 3FFIA 4ID5A 1RWPB 2HFUA 2OUGA 3D54A 3ULHA 4DR2F 1U6ZA 1VBKA 5D3GB 2VPXB 2GIFA 2RDDA 3D9BA 4YOTA 3AHPA 3OXFA 3UE5A 2R2RA 5HL7L 3CD5A 2E5GA 3BGUA 4CBXA 2VCPA 3U1MA 3R2CJ 2R2SA 2GMJA 3OTCA 3LDQA 3DLKB 2ZGZA 3UCGA 5HROA 4GVBA 2XGPA 3HI9A 3FBFA 3CCVN 5ETQA 3DLBA 5FLXY 1V3SA 1RWKB 3WX8A 2RN2A 4GVLA 2CJQA 2C3YA 2HZVA 2MJUA 3NXZA 2BJDA 4I6MB 4OZ1A 3VF4A 4OHWA 5K8MA 3PIOQ 1K8KA 5AFUA 4UOCA 5AZIA 3FC9A 1SUQB 2EEYA 3JXUA 3O5TB 3M8SA 3HHLC 2XM3A 3T1HF 1HLUA 1NLKL 1N33F 3AJDA 2OZMA 2W9CB 2EKNA 5IC6B 5HAOA 2QSWA 1RT1B 3E9LA 5AXLA 2KL8A 3SJJA 3QRPA 4JKDA 1C0UA 3OBWA 5M1PA 4UUXA 3BBCA 3A2FA 3U3GA 3I32A 1EB0A 4DR3F 1JL1A 4A2AA 4J2DA 1WG4A 4BWJA 3UR0A 1BWEA 2XWXA 3IRWP 2E88A 4LFCK 1BD6A 1QM9A 4DTUA 2Y1LB 3P83D 1CVJA 4ZVGA 2V9KA 4FLTA 2FC9A 3CDAA 4NI2B 3CI5A 4WYWA 3ZT3A 4MIBA 2O8FA 2ZZMA 4AHUA 1KS2A 4X4RA 1HNVA 3DLGB 1YSJA 3A3OB 1ZTWA 3H42A 4OYZA 2C2DA 1JNZB 4GO5X 4HTUA 1S99A 4NOHA 4OJGA 4XPEA 1ITGA 3ENVA 2P9KA 4I0WA 3LOUA 4X64K 3TAGA 1VSLA 3GG4A 3IWLA 5L9XA 5KT6A 4NCGA 4ENOA 4OJ1A 1BWVA 1YRTA 3SQGB 3AT1B 2FSJA 4N5SA 4NL5A 4XAKA 2VL1A 1TL7B 3G96A 3HO1A 5LMNJ 2O5DA 2IC3B 1PIEA 1BQNA 1S1VA 1IR1A 2AQ4A 5AE1A 1D8YA 3U6FA 1NK8A 1BLUA 3GR1A 3T9ZA 3DFEA 1KLNA 2BE7D 2OMLA 3G82A 3OVBA 1PJ7A 2IGIA 4WU2A 4DPWA 1VQOS 2ZJRQ 2H9ZA 2ZZTA 1AYEA 4BC9A 4DQ8A 2PMWA 1LFWA 4ZVRB 4M45A 4PCQA 1NK4A 1SC3B 2VIHA 1YJNN 4DFJA 3F0NA 1QJHA 1S5JA 4KAZA 2D0BA 3PYGA 3AH6A 3CCVS 1EQMA 3FZ2A 1Z25A 2GVZB 1FXRA 1J27A 2DR8A 1W2BR 1T03A 2CH5A 3BQ0A 2F8SA 2X51A 3TVZA 2C2MB 4K4UA 2R8KA 4DTXA 3ET6A 1X60A 2ZUAA 3VCDA 2NUHA 2Z0GA 4ELVA 5JLFA 3QFHA 4OYMA 2GVDA 2PA8D 3MR2A 1HNXF 5T41A 1FKOB 3I55S 2D41A 3OSNA 4HVZA 2PSZA 4AXIA 2ZE2B 1NPKA 4DV2J 2B8PA 3K5OA 2G0IA 1XBWA 1QLNA 2H3EB 4CM0A 2XGQA 4RNFA 1BHNA 3PW2A 3OYHA 2F96A 3MXHP 3I56S 1U04A 2P9LA 4KGVB 3MMCB 5D78A 1UVMA 3G71N 5B8HA 4KGZB 1G3OA 1DJ0A 3E01A 3Q89A 5HMXA 4DV6J 1TUUA 3UR3C 3MD1A 3CO0P 3VQBA 4RNHA 3O8MA 5DDPC 4PRFA 3C15A 3C7NB 3BREA 3GV8B 2ZH3A 1GTEA 1S0NA 2CQ4A 3HTVA 5DJBA 1J5EF 4V1Ak 2AZ3A 2KRBA 4JI0J 3MM6B 1RKIA 5KG1A 2W1BA 1MNEA 3DYAB 1VLOA 4C8MA 2YKAA 2ZJRL 2XMMA 2F1FA 2BJ7A 2ZOGA 4HI1A 1UEKA 1OSCA 2EFQA 4LQ9A 5E0OA 3GLJA 1KC8O 2RKIA 4RR5A 3QB0A 4X66F 1CJTA 4M42A 4CYUA 2AJ1A 3FCHA 4FL9A 4AE5A 2CG8A 2MEWA 2HRTA 1IKXA 4K50A 4M5HA 4KHNA 1JLBA 2FZGB 4PYDA 4IFEA 3CQYA 3HJFA 5HROB 3OTOF 3THXB 2KTQA 4I2PA 5DK5A 3D45A 3SLCA 3WXIA 4LFAJ 4RUCA 1NGEA 2E2QA 2LQBA 5HRPA 1RB0A 4J91A 1QY7A 1QE1B 1REGX 3WBZA 5AQHA 1X4CA 4JLHA 3VGKA 4DV2K 3V1RA 2RRAA 4J7CA 1SJ3P 2LXFA 1FE4A 2DR7A 5HVHA 4QOTA 4DTNA 1RACB 3VZHA 1EKEA 4NMLA 1JLGB 3WXKA 1KFSA 2MY7A 4JB8B 4CF1A 1WUAA 2Y0SD 1SJ1A 2VJUA 4OPKA 4DTOA 1IBMK 3L3UA 4WCEQ 1E6YA 5D0HA 4I6WA 2R4FA 1EKRA 1BI4A 2BTFA 1QQCA 1IH7A 5AE3A 3OYNA 4LMZA 5J1EA 1CQNA 4LY7A 4CZLA 3D0IE 3R2DJ 2YKPA 4KO0B 3CDUA 3N5FA 3TARA 1VQ8S 2FZCB 2K8GA 4Q43A 2KW4A 2R8IA 1WSRA 3OVSA 4DSJA 1Y3JA 2YX6A 3SAHA 4JI0K 1ZM4A 7FDRA 2AGPA 2GCFA 3MMJA 1XMOJ 4U6PA 4GKKK 1EXQA 5LL6Z 3IKMA 2DTJA 2QYCA 2HS3A 1SJ4P 1IG9A 3S1TA 4C7QA 2BUNA 1CPZA 4WBFA 5FPEA 2QLBB 1KD1O 3ATUA 3PJWA 2RF2B 1RQ0A 2OTLS 1TKXA 1FKAF 3D3BJ 2KT5A 4MTPA 3C8YA 4N47A 3H2VE 1I94J 2UYTA 3L4IA 1NKBA 1NDLA 4XPCA 2C2NA 3MN7A 4KV8B 1S12A 1VQPN 5SZTA 3MFHA 3G10A 2R2TA 2VICA 3AGKA 4L3KA 4UY85 1RT4A 1UPPA 5KFSA 2HURA 4IO8A 4EGLA 2YJFA 1SH0A 3W65A 2JZ5A 5EX3A 2XRIA 4AHCA 4ZPDA 4DV7J 1YBUA 4WCEL 3H08A 4FS2A 4H8KA 4RNNA 4TQSA 1Q18A 3NGIA 4M5DB 5AQQA 1JIHA 4P9SA 2D3OR 1E4FT 1FJGJ 3CG7A 2X7IA 1R7IA 3MN6A 3QAUA 5AQTA 4RWXA 1G6BA 1GEHA 2HHWA 3L0QA 1E6VB 1ZAXA 2UU9F 2E1RA 2Q79A 1CC8A 4PYAA 4NXMF 3RW6A 3HOSA 3OR1A 3W61A 4CBWA 1VIXA 4NLGA 2RAQA 3O1WA 4WK3A 1RT2A 1RILA 1C0TA 4KFBA 2ZWPA 2BJ3A 2EC2A 5AQMA 3IR5B 1Y97A 4C98A 3QEXA 8ATCB 4FLYA 3PKYA 2XG8A 2KG1A 4A5AA 4HTLA 3MMVA 2H1YA 4P10A 5LL6d 3O2IA 2XZWA 1SKWA 3J7AN 3FCWA 2HFZA 2DKOB 2FD2A 4IKAA 1S1WB 1DTTA 1PYTA 2OH2A 3QIPA 1J5EJ 2ZWOA 4WQ5A 4WIIA 4FJXA 1NHUA 3RR7A 2QA1A 4BE2A 3EYZA 2NNWA 2VFRA 2CPZA 1ZBIA 4B3MF 1KLMB 4IO1A 2IYGA 3DXSX 3A8KA 2X6NA 3CTRA 1R27B 3O3GA 1VQON 3GONA 4JYAF 3RU0A 1ACMB 1N5SA 1WWHA 3MM8B 1IKWA 1S77D 1C1BB 4I9LA 1ZC6A 2NR0A 5HRNA 1FW6A 5E3PA 1CSJA 4EFHA 5B0CA 1TUWA 3QJPA 2KDOA 1WC5A 4GC7A 3NAEA 1NJXA 4M3XA 4A62A 5BR8K 1F2GA 1U6BA 1LAVA 3IGVA 2DNGA 3CCRN 4CJPA 3L4QA 4J9UE 1VSMA 5EVZA 1T95A 1O13A 1U2VA 1IKXB 4Z7YA 5KFJA 4WYLA 2LEAA 3TVYA 2P1JA 1HWKA 4WFBQ 3OUYB 3NGKA 2QFJA 4ISEA 4NEYA 2DRBA 1PILA 2E1MC 4CLSA 4NCBA 4ED3A 2WAQD 4Y28C 1LOUA 1S6QB 2O8BA 2ADBA 4IDKA 4CH0S 1VQNN 2D74B 2GUPA 4E98A 4J2EA 4OV1A 1NJIO 4CHZA 3WNGA 4X2BA 4LF7F 1VRQC 1RCXB 3RB0A 4YNQA 3K7RA 2FJVA 3MXJA 2OD6A 1C0MA 3NHGA 4MK8A 4H5TA 1M5KC 3M2VB 2OI2A 1U1QA 1S22A 4NB4A 1RHRB 4OLPA 3C6UA 2VOPA 2FLLA 1D9AA 4KHMA 1HFEL 2NQPA 2HFSA 3CCRS 1X31C 1XR6A 4JI1K 1YZ6A 2YXLA 2DFFA 3G82B 4YDUA 2PFFB 4E89A 3VAGA 2BOAA 5HATA 2HMIB 1TUVA 4W4MA 2K2PA 2DJWA 4G9ZA 4UF4A 1YXQA 1Y64A 4U7UK 5C2FA 4BGBA 2XS5A 3SUPA 2J5AA 4RW6B 2I5JB 2ACYA 1BUXA 2EFOA 2KQ2A 4ECWA 4M7XA 3C14B 3VVTA 3VEVA 3SCLE 4NXNK 4F4AA 5DM7Q 3FZBA 3F41A 4KB1A 4DU1A 3UIQA 1KHVA 2UUBJ 1E6VA 3TRGA 3LDPA 1F9HA 2E4LA 2Y0BB 3BF1A 4FBTA 4WFNQ 4OZ5A 2HRYA 1T9XA 5CZVA 3VF2A 2FUG9 1WG5A 3CCSS 4CGJA 2H4YB 2NXEA 2F3JA 2BM1A 3AO2A 4WQ4C 3CGIA 4ZLJA 3O9TA 4OI4A 2DCUB 3R5JB 4YDXA 1VSIA 4K0KF 1NSPA 4CEBA 2NLWA 4WF9Q 3PG9A 2CFXA 3CCQS 4JI1J 2CNNB 1IN0A 2QWMA 1O8BA 3LAMA 4CGGA 3I56N 4OI2A 5ETOA 2E7XA 3GIMA 1KQKA 3MR7A 2E5LK 1P90A 5A8KA 3I4PA 4PKDB 3MN5A 2CGLA 5M1KA 4QIFA 4OJRA 2L41A 1JLCA 3D2WA 3VTIA 4TXSA 4UOHA 3K8VA 4UQTA 3ZZRA 1IBLF 1C0FA 2WONB 3ZZTA 3BF3A 1VQ9S 2XY8A 3G6ES 3OYGA 1SL1A 7AT1B 3T1HJ 1YZ7A 4KHPK 2PZSA 1YVNA 4JP8A 1RBUA 3W8PA 2D3UA 3H0PA 4QIGA 3I0SA 2W24A 2RSQA 4MT1A 3QDKA 2MB0B 8AT1B 1V5VA 4B3MJ 4BC2A 2D9OA 1QS4A 3ZXWA 7FD1A 4C2MA 4AQYJ 1HI1A 2QMXA 5BYQA 4DR5K 3ZSVA 2RQKA 1HKGA 4FK2A 3SUOA 3CVKA 2F5GA 4N56A 5A2QY 2KT3A 3FZMA 4P72A 3BKFA 4K41A 2D1CA 2VJVA 1P9YA 1U1PA 2JSXA 2O67A 3GPAA 2VWJA 4DR5J 3IR6B 4B9UA 2BE9B 2EXUA 3CCJN 1TKDA 4Q2LA 1CLFA 5GAGU 1I39A 1C1CA 2GV9A 3NCRA 4KJIA 2MQQA 1OY8A 1NPRA 5KGXA 4CRJA 3RMDA 3NY0A 4BRFA 1FTCA 3FR0A 2E5HA 2ZWHA 1UVKA 4DR7F 3DDKA 1IKWB 4DR3J 4YY3K 2GC8A 3OR2B 2DXFA 2DNZA 2HNYA 1U6FA 3U7JA 4KC5A 3Q8YA 2QL7B 3C16A 2CPDA 2XNQA 4JKGB 3RSEB 3CJAA 4B8AB 3DOMB 1MU2A 2CVEA 1NG9A 3GV5B 1TKZB 2VG6B 2IRXA 2AKWB 3JSMB 3CDBA 4TYAA 3CJQA 1NBEB 3MF5A 2NUBA 4USIA 1RBRA 5LM7E 5DG8A 1E6YB 3O4NA 4IOXA 3UKRB 2RNEA 5E3CA 3QMQA 3NMAA 3CMQA 2YHWA 1Y5IB 3OW2M 5KFAA 4NYNA 2AMCB 1FXLA 3W0LA 2GHWA 3HD2A 1KRPA 3K59A 1MROB 4TN2A 3ITHA 4DL2A 1U8WA 2NYIA 1FFSB 2VBXA 3G87A 3JXOA 4G6VB 4CJ7A 1Y3KA 2HNDB 4ZLLA 4FNIA 2HMPA 5T7LB 3DRPB 3IAYA 3GOIA 1PAUB 2QLXA 2J7UA 2UV8A 1UW9A 5IQQA 4G3IA 4R5PA 1G1XA 4ED2A 2QWNA 3KK1B 2YH1A 3GJTB 1Y5LB 3LF0A 3AO4A 2DHXA 3MCMA 2GUIA 1NKCA 3B6BA 4KQZA 2LQ9A 1JMTA 4FJGA 2GMHA 1UPMB 2JC1A 1QQMA 3PR4A 1XNRK 3Q86A 1U1KA 1YTYA 2WBRA 2ZOFA 3SCIE 3MWBA 5KOWA 1EAYC 2CNOB 3BM7A 4K4WA 2BV3A 2J7KA 4JK7A 4FF1A 5A8WB 4MYTA 4NZ7A 4ILHA 3UD3P 4HKQA 2CXEA 5LJVA 4R8UB 2UXBF 3GQCA 2V4JB 3MCAB 5I3QA 4B3OA 4LF4F 4YUDA 4FJHA 3GCXP 3QSIA 5C0YA 4JKCA 4PUOA 4JKEA 3CIMA 2GAHC 3IBFB 1LFPA 1PBUA 4CZMA 1P8ZA 4NXMJ 2HSTA 5IOLA 1UOCA 1ZM9A 5G0RA 4FYXB 2CPXA 4DEZA 3GG1A 2HF4A 4KHSA 4M94A 1IBKF 2MLYA 3VQTA 1HBMA 4FYYB 4GV9A 4P2XA 3I0RB 1HR0J 4DUYK 3QWUA 2W9BB 2H5IB 4X4PA 3TA1A 5KG4A 4I2PB 2VWKA 5AQWA 2XMJA 3NH0A 1M5HA 2NZTA 2DPIA 4Z4IA 2ZVSA 4HTJA 1WSIA 4CIGA 4BROA 5BJRA 5JMNA 2B9WA 2BW7A 4F0KA 1CJVA 5AXNA 3TNVA 2D0CA 3QGGA 4E1JA 5CY4A 3RB4A 2DTUA 5CYMB 3UB5A 4ZLNA 4BRCA 4BQZA 1MDUB 3CF5L 3A5MC 1DTTB 2DNLA 3EVOA 3C95A 1Z05A 2DNRA 2M7SA 2YQ1A 1UVNA 3KLHA 4CT9A 1FHTA 3JSYA 3T5JA 5A8KB 4IO9L 3TU5A 4OV6A 1BI4B 3JYTA 5IT9U 1C1CB 3QIDA 1D0EA 3OLBA 3J80U 1YUWA 4B3RK 3A8JA 2N7CA 1OKJA 1X8DA 2XO6A 3IMQJ 5CZ2A 2J9CA 1D8ZA 3C15B 3PCOB 3C7NA 4CF9A 1TAUA 1Q8BA 3TWZA 4MMOA 4DQSA 4CLWA 2KXHA 3DU5A 4OZJA 4BC5A 3AOCA 5AJ3F 4YFUA 3MR3A 1FX2A 2OGUA 2QWPA 2WTFA 1TV6A 2KH9A 4P7VA 1R6YA 4F3OA 2P9SA 4DZ6A 2G8UA 1M5OC 2ZNYA 1VK8A 2ASJA 2BW2A 1UJ5A 3OYMA 1KVKA 3R7NB 2OZSA 2W4CA 1SI9A 4LIRA 1TAQA 3O4WA 4MO5A 3F9MA 3J7A1 1UVLA 2YNGA 3UCZP 3HSGA 4PWWA 3L2UA 3Q8QB 4DX8H 2JWKA 5KRTA 4KHWA 4USVA 2VU5A 1CZAN 1VSHA 1KSPA 2O01C 3MDFA 3B8AX 1UP1A 2YX1A 4B1VA 2RPIA 1JLAA 2ZH7A 3CIPA 1C1AA 1R59O 2H3GX 4WZQA 5LJ5Y 4ZJQA 1W2IA 1VRUB 1FRMA 2MGZA 1DGKN 3UKUB 4C0BA 2YI1A 3C94A 2FZKB 4NLWA 2CQ1A 1HJRA 2HGMA 3NCIA 4A8SA 3DAWA 3F2KA 1RAJA 2VYPA 1WC6A 1T3OA 3R5DA 3SSRA 3IO1A 1KNZA 4CF2A 2H4WB 1S4EA 2RS2A 2RIJA 1HKCA 4FOIA 3QO9A 5T7BA 4K4ZA 1WLJA 4JNEA 3C6UB 3AXKA 3OXGA 1WACA 3E01B 1IKYB 3HXMA 4OZNA 1L3KA 2NSBA 3UWTA 4BE1A 1R43A 2G0JA 2DNQA 4X65F 2ZBCA 1IBMJ 4J9KA 2A2CA 5L39A 2OLWA 1HWIA 4FPIA 4KT0C 3J7AP 4KHRA 2XY6A 5K14A 1RUSA 4Y2IA 1U0HA 3HULA 4GV6A 2DO0A 2H48B 3PEJA 1WHXA 3I87A 1UJ6A 2B51A 8RUCA 1DEJA 1RBLA 1NDKA 1TQLA 1U02A 2OPPB 1NK9A 2VG5A 4M5KA 3C46A 5DQGA 3A4TA 3C14A 4JUZA 1YRXA 2OMOA 2LVWA 1HNIA 2DH7A 5BRFA 3CCJS 2HBZB 5GAGP 3R8EA 5BYRA 3MWTA 4IUFA 2XMVA 5C2CA 3M9OB 2B5JA 2VOOA 4LFBF 4QAGA 4EEYA 3VQ9A 4CGIA 4W5NA 3BSOA 3LO3A 1F5CA 4HHTA 4IO9Q 4JD2A 2ETJA 3DRSA 2HAFA 1WAJA 4OMFG 1PGZA 5ETSA 2I1RA 4KKOA 3PW5A 2WUSA 4XH1A 3BY5A 1WB9A 3W2VB 3ISND 2P9UB 3MAAA 1K6YA 1R0BG 3NCQA 1U2FA 4UW2A 1IBKJ 3LP1B 3MEDA 4JAXA 3SBTA 1AW0A 1YQHA 5ETPA 4RW8A 1ULRA 1YBTA 3P38A 4MYUA 4DV0J 1B0TA 2KU7A 3M6XA 1ZAWA 2RILA 3BB5A 4F0HA 2R7OA 1WELA 4OX9K 3IRXB 4CJWA 5B0DA 2JEGA 3PX0A 4NLVA 4AD6A 2OANA 5A8RA 1YJ7A 1A5WA 3JS9A 4YP3A 3AVAA 3BP8A 1FJGF 3BSCA 2DHHA 3QT5A 1WNEA 3BBBA 4P52A 4ZPAA 4C97A 1X4FA 3VGMA 1R8AA 2H5EA 2DNNA 3D6HB 4FWSA 4JV5K 2J4RA 1NNDA 4I67A 4PAAA 1N36J 1XWLA 4NA3A 3CCWA 2CRLA 3W5XA 4WF9L 3HHLA 2YQ0A 4FM2A 4DR6F 2W9CA 1HD1A 3HSCA 2WSFC 2GIRA 5E41A 2F4VF 2CPHA 3TZYA 2IVOA 2WVDA 2KYXA 4KGMA 4B9QA 4KHQA 1QTNB 2GV1A 1RTDA 3CC7N 2FC0A 2WOMB 3OL8A 4LVNP 2ZHAA 2UXDF 1NH8A 2FVSA 4KTZA 5GAEP 4ES1A 2MHEA 2X3GA 2R7SA 4WFYA 1KLMA 1H2TZ 1O5JA 4PZVA 1J6ZA 1FTRA 3IG1B 3MURP 2QJ3A 5ITHA 2RQ4A 4K59A 1LK5A 2RH3A 4OKKA 3D2EB 2IAJB 5EUHA 3SFUA 3HK2A 2ZFHA 1QAIA 4O3PA 1GLEG 5DLFA 2D7SA 3GILA 4HCCA 4TYBA 2O1PA 4ZA1A 2UUBF 3FQLA 3BZKA 4CK3A 3A0IX 2ZM6K 4L76A 1CXUA 3UO0A 4MO4A 3MPUB 1RWXB 4ISFA 4OYXA 3GSDA 3PDNA 1P1TA 1HI8A 2D9PA 4KGKA 2BKOA 4FYWB 1OH7A 4IFYB 4DFPA 1Z2ZA 1O6XA 2W41A 4DR1K 1IR2A 3FZLA 2K7JA 1RTIA 1OSDA 3NLCA 4WPAA 2A40A 3OTDA 4DF8A 1DLOA 4IZ9A 4KIAA 1P6TA 4M3RA 3D0HE 1S1UA 5AQPA 1YJUA 4OJ3A 4G1QB 2LDYA 2IDOA 3OR1B 1OQ6A 4YDDB 4C8LA 3GFZA 4IEEA 3QETA 1HIYA 2QK9A 1AZSA 4KV8A 1H2UX 1BISA 4IH7A 3CCES 1OH6A 3V2UC 4DV5K 2HVDA 1IO2A 1U09A 5J1PA 4RWTA 4ZPTR 2ZC3A 1U1NA 3GYXB 4DZDA 3NNCA 4HWIA 3V9XA 4MIWA 1MWMA 2J0SD 4LF9F 3HRGA 2B5JB 1UA1A 3JSRA 3N6NA 3HFZB 1UEUA 2F9WA 1IUJA 1JJ2M 2V2VA 1UMJA 2AYBA 4FWOA 1HQUB 2B6AB 3SK3A 3MXIA 4LF4J 3ENQA 3D4JA 4YOVA 1NDCA 4M41A 3BKTA 2IDLA 3R8YA 4BQLA 5FRMA 3EY1A 3VR1A 4NZ6A 1QTMA 3DRRA 1RWMB 1BCMA 4B9TA 2G2YA 3EN9A 3DYAA 3HZGA 2EW9A 1VQ9N 4JHDA 1SUQA 3ICLA 5F1XA 4FWLA 1U48A 3PLAA 4OIXA 1U25A 3VQAA 1KQSR 1JWWA 1KAYA 3CJ3A 3TI0A 3ZX0A 3LP0A 2GHPA 3KYLA 2FBXA 3MMAA 2HQDA 3Q24A 2K1RB 2DHSA 2APOA 2HSEB 2J0XA 3FRZA 4J2BA 1VQ6S 2W6LA 1MWKA 1ZBTA 1KAZA 4CBUA 2GJFA 4EMDA 4KKOB 4YQWA 1RDUA 5KFFA 5DMRA 3QBWA 1LWEA 3SSQA 5C25A 2ATCB 2OD4A 3NVKA 4EYIB 1X4AA 4Y00A 2CQIA 4YHHF 3DHXA 1N32K 2UVRA 2ZH6A 1YJWS 4X4UA 4A59A 2K7KA 2XZTB 4L72B 4XH4A 3VMFB 2C42A 3Q7BA 1PYOB 4FK4A 5HL7Q 4DCHA 2JLGA 3FLCO 1EX4A 3QPIA 3HKZD 1SQKA 2OPRB 5FPMA 1CULB 3FKBA 5B0GA 1Z4UA 5CYJA 1S0MA 3CB4A 5CXTA 3LANA 1MWYA 1S1TA 4X4NA 1U2VB 1ZM2A 2QO3A 3PIPQ 4LRDA 5AQGA 5LXYA 4FF2A 2Q31A 5LT5A 3RMAA 1N36F 1XEZA 5CHCB 4NYOA 5H9FK 2DFEA 2LMIA 2EHGA 2DY1A 3T1YJ 3CIZA 4C6AA 3RYLA 3OXLA 1JCEA 2AHOB 3FEZA 3RVCA 5GVQA 3WXMB 1X3MA 1NOYA 4BC7A 2ZGYA 1WF2A 2EC0A 1QE1A 1BDGA 3L7PA 3M3ZA 5J1NA 3DRYA 1RHUB 4Y65A 3KK1A 1F0XA 2VFSA 4Q2MA 3HSZA 1OPIA 3HF5A 4FXDA 2QWLA 2AX1A 3WIVA 2OTLN 4XK8C 1WKKA 1U4BA 1HWLA 1WDDA 2KKHA 4GVMA 4EIAA 2K06A 4NYPA 5KG5A 1ZETA 4UQGA 3OYFA 1JLBB 6FD1A 1A7GE 1VQNS 4CZIA 2Q1NA 3V4IA 4X62F 2POKA 1WDTA 1QAYA 2GVDB 4CZEA 3OYAA 2AP6A 1RAIB 1S10A 3W5ZA 2ILYA 1Y7PA 4JI3F 1U24A 2ZJPQ 4RKUC 3NGSA 4LR8A 3DU6A 2UXDJ 1VK0A 4B3TK 3MAQA 4B1WB 4M95A 1C4AA 3UD5A 3H90A 4CJLA 1YWXA 4B3SJ 4FYVB 2KHCA 3CFRA 2R8HA 4JRQA 3CEDA 3QGIA 2LP4A 3MPVA 1S5ZA 4DHYA 4CJ5A 2MYFA 4HHUA 2L08A 4LF5K 3E66A 3I33A 2BJ8A 1L3UA 1IKYA 1GLBG 1GXTA 1D1UA 3MECB 3AD7C 4YB7A 2HHSA 4DV7K 3IS9A 5I4MA 3LPEA 3VHQA 2VG7B 2KJVA 3V1QA 1MG7A 1NRKA 4ICLB 2VG5B 2WTUA 4E0DA 1HYVA 4FJNA 2KRRA 2GW8A 4C1NK 5E84A 1ATNA 3CERA 5AQUA 2V2KA 1GOAA 2I0XA 2F40A 3POTB 1HJOA 5EX5A 4RU9A 2EWHA 2AEMA 2RS8A 2HPUA 1LV5A 4FP9A 2YWFA 4RW9B 3BR8A 1FEEA 4I7FB 2ZNZA 5K5MA 1HBMB 4CLLA 2J9DA 3DOLA 5J2QA 4AT1B 2JDJA 2HHVA 1GXUA 1BA1A 4LF8J 2NXJA 3QGHA 2VH7A 3H1VX 5IT9O 4O44B 3FK4A 3DNCA 3KHGA 1EWRA 2BQRA 2QX0A 3N6LA 4DCJB 3NMRA 4FDFA 2O8EB 2H5JB 5CE3A 2DNHA 4GRSA 4Y2MA 3M2UA 3NNAA 1T9TA 3Q83A 1KD1T 4RW8B 2VQFF 3QNOA 3V6KA 5KT3A 5JS2A 2P51A 2N82B 1FERA 1Q1KA 2CADA 4A8KA 4JI8J 3SCXA 3QESA 3BO4A 1JLEA 3EDRB 4JHDB 3BZCA 2ZKTA 3JSMA 5FPNA 5HSPA 1EIYB 1HHQA 5I9EB 1S1TB 3TZZA 2XC9A 3AVCA 3KK3B 1UVIA 3M8WA 5A6WA 4CEEA 3CCEN 3D5MA 3CCSN 3KG1A 1VIOA 3MCPA 1UJ4A 3CJ9A 3I0RA 1B0PA 3KG0A 4A61A 3KJFB 3MMAB 5M1NA 2HGLA 1RGIA 3M6VA 5EX0A 2DGXA 1TK0A 2E9TA 4K8RA 1WEYA 1OMSA 4ZITA 4DCPB 2XZDB 4DV6K 3H59A 1JXBA 2QLJB 5AQXA 4TY8A 1IM6A 1FRXA 1LW0B 3ONQA 2XHBA 5HQ8A 2BR0A 5GINA 1CXQA 2FLPA 5KG0A 1Q86T 4ANEA 1JXEA 2E8AA 4V19J 2IM1A 5AQRA 1TZ0A 2FF3B 1S49A 4DTPA 4B1YB 1NEEA 1WUUA 2W7AA 3OUYA 3ELHA 4LSLA 3VGLA 3MM9B 4FKXA 4RTFD 1URRA 2XLKA 5K14B 4O8UA 4J8FA 4DR2K 3AFGA 1AUDA 1N48A 1ZZNA 3ZCMA 4P2FA 2MZSA 4H5RA 1HBNB 4FZVA 2OPSA 4CHYA 1RWUA 1RSCA 3AAWB 5HOOA 4WFZA 2XMTA 4UTGA 1B4SA 1HNIB 5LMUJ 3QATA 3KJQB 4LF6K 1RABB 2XEXA 4ZMMA 4DFKA 1SXLA 2P9NA 4DU7A 4ITSA 4C23A 1VRTA 1DFDA 4R0EA 4ETZA 2B4JA 2YX4A 3EZOA 3R5BA 2J6UA 4O4RA 1KFDA 5B0FA 3CD7A 5F3TA 4DSFA 3V6JA 5KFKA 4F3MA 4DTJA 3IC1A 4JKFA 2GWJA 2K3KA 4I69A 1HBUA 4M5NA 3B78A 3TUZC 4HCBA 5HI7A 3KDNA 1XQIA 3ISZA 2QIFA 3T1HK 2HIYA 3HFVA 4PXDA 4ID5B 4C3KA 3QNWB 3MXMA 3UNYA 1HKBA 3J7Z5 2I8EA 3QZ8A 3MEDB 3PO4A 5IT4A 4X65J 4C11B 4FLWA 4IDHA 2KG0A 3U3YA 4CLZA 4FZXC 2BGGA 4CJVA 2HBYB 2MLXA 1YLXA 4F4WA 3KUHA 2Q36A 1W26A 2PI4A 4LFCF 4FJMA 3TJ9A 1RNHA 3ZTQA 3MX5A 4TVAB 3EE8A 2QMUB 3GIKA 2UXBJ 3NS7B 4M3UA 4QS9A 2GO8A 3NGYA 4WZMA 5FLXU 4PWUA 1NJIT 3RMCA 1XMOF 4BRAA 1NJWA 4A8QA 2CH6A 4CEZA 4AQYK 1OVQA 4BRIA 2EVZA 2HG4A 1FJ7A 3OS0A 1U0HB 1YITN 5LMNK 3FQKA 2VG7A 4IH5A 5C25B 4DL7A 3HVTB 3IS9B 3R27A 4AFFA 3C2PA 4E19A 2J0QD 1X1PA 4CEQA 5KFEA 1D9FA 4X64F 5KFUA 5DM6L 1WBBA 1FO1A 2GX9A 1HYSB 5FLXO 2UU9J 2RU9A 3EMTA 1TYQA 4NLRA 3HCXA 2XMUA 3G2XA 2RKIB 1GMWA 3HT3A 2OYQA 4CLFA 1GMWD 4OI0A 5DGBA 1SKSA 1WG1A 4AYBD 3SPZA 1XJWB 4DR4K 1XNQF 2VUGA 1JL2A 3LP0B 3GIRA 2A6AA 1N8RO 3VENA 3KLFB 3NCPA 2WONA 2P2CB 2GX8A 3EGVA 4M1KA 1B7FA 3P8BB 2WK4A 4J2AA 1FKPA 2WCXA 1M1KT 4CF8A 3DRSB 1RCHA 3UCUP 1FE0A 4C4WA 2ZBQA 3EO3A 4RNOA 2VFVA 2G1DA 3TZXA 3Q8UA 4OZ2A 1S6QA 5FROA 3H3OB 4WFBL 3W2VA 2CQBA 4OYBA 3B8HA 3G8TA 2PBDA 4ZVEA 1BG3A 3T1YK 1Y11A 1RFQA 3FBCA 4K5RA 1LWEB 3L3VA 1VHXA 2QN6B 1YX2A 2VONA 3MI7X 5CABA 4Z94A 5ETVA 2NRVA 2WOMA 3EPIA 2C2RA 3QICA 2QXFA 4CI6A 5ADXH 3ADAC 5IV4A 1T05B 1HNXK 4CTAA 4IOBA 3O9RA 1R6VA 3OVNA 4CJRA 2VV5A 1F1BB 2KM8C 2J9DE 2PY5A 4FKYA 5EWGA 1OYDA 4K42A 4ILRA 3D2EA 4B3RJ 4X4VA 1KQFB 3LGNA 4EBDA 2P9IB 3GU0A 1V3ZA 4DSIA 1TGOA 4H03B 2XQCA