1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
3V9UA 2DPIA 5J2MB 2RDJA 3VQSA 2GV9A 5J2PB 3NF6A 4OGEA 4CGFA 1C0UB 5KFNA 3K5NA 3ZSOA 4FK2A 2OPSB 3DLEA 3EZ5A 3TQ1A 1WN7A 3HPOA 4KHUA 1FKOB 3RBEA 3LP0A 4JS4A 2JGUA 5D3GB 3TANA 2G8IA 3MF5A 4OGCA 3AVHA 2GBZA 4HUFA 3DM2A 2ASDA 4F4ZA 2AX1A 3PX6A 1JL1A 4FM0A 3U3GA 2OPRB 3V6DA 5KFZA 3P83D 1RDRA 3V6HA 3TAFA 2ZKUA 1S5JA 2G8KA 5KFAA 1KRPA 1LW2A 2DFHA 1TVRB 5KFIA 2EC0A 2IMWP 5DG7A 1U49A 4HTUA 2VA2A 1IG9A 5KFGA 3ZSRA 4JV2A 4M95A 1FKOA 3CO9A 5KT6A 4DTXA 4W5OA 1JX4A 4Q8EA 2HHWA 4DQSA 4WE1B 3NBPA 4PUOA 2KTQA 4CEAA 3HVRA 3K57A 2GIQA 3CM5A 1IKVA 3SJJA 1SV5A 1S1XB 2OPPB 1K1QA 4TY8B 3LANA 5DLFA 5T14A 3OHAA 3NCIA 4FZZA 2WHOA 4O4GB 2GIRA 4R8UB 3DOKB 1NJYA 4OKKA 2PY5A 3KLHB 4ED6A 1YVFA 3PW4A 1BCMA 3UIQA 4I2QA 1HQUB 3V9XA 4FJHA 1JLBA 1Q8IA 4TXSA 3ZSZA 4K4SA 3AA4A 4M3TA 5HROB 3VA3A 4CGIA 5JUMA 4J9RA 4E19A 1NJWA 2HHQA 1CZBA 4PQUB 3TVKA 1SKSA 3V81A 4YR3A 3IGNA 4GW6A 3RR7A 3H4DA 4YFUA 1K6YA 1DTTA 3HXMA 4KSEB 4Q0BA 2W9AA 3DM2B 3PW5A 3QNOA 3KIOA 3FQLA 1JKHA 2P5GA 1C0TB 3GIKA 1RTDA 3PO4A 3QO9A 4J2EA 5DGAA 1QHTA 3EPGA 4EBCA 4NLWA 4FS1A 4R5PB 3RRGA 5C25B 1IKYB 4ED3A 4BDPA 2A1RA 4EZ6A 4URQU 1VK0A 4IG3A 4CJTA 3V1QA 4MK8A 3RAXA 4YR2A 4FJMA 1G15A 4BDYA 4CJVA 3CDUA 4KHMA 4B3OA 1XR7A 2YNIB 3ZSYA 1HPZA 1C1CB 3IGVA 3CM6A 5KI6A 4MK9A 3H5UA 4ZPAA 1XHZA 4NCAA 3S9HA 2HMIB 4J2BA 3ALYA 5HLFA 4NYFA 1YT3A 3O4QA 3OYHA 5C5JA 3MTKA 2HHTA 3RMBA 1D1UA 4ZP7A 3QEIA 1U45A 1NK7A 3H08A 3M9MB 1RT2A 4Q44A 1ZBIA 4HVJA 2WONB 2KZZA 4CGDA 3I5AA 1L3VA 5KFUA 2OPQB 3DYAA 2VG5A 1BQMA 1S0NA 4EO8A 2GC8A 5C42A 5CYMA 1WAJA 5DQIA 3BREA 2OH2A 3VQPA 2BRKA 4Y1CA 1VRTA 3AVCA 1J53A 1SL0A 5EWFA 1BL3A 3SQ2A 3MEGB 5KFWA 4WFZA 5F8MA 4DTSA 5CZ1A 3SV3A 1TK0A 3LAMA 2IC3A 4KTWA 1ASVA 4DQRA 1L3SA 3NF7A 3TAMA 4DFKA 2DFEA 4DEZA 5KT2A 3DOKA 3HSTB 1HMVB 4CESA 4TQRA 4DMNA 3NE6A 3ISND 3DLGA 4ECYA 4RW8A 1GOCA 3EPIA 3KJVB 4KHSA 4B8AB 4DTMA 2FVCA 4ZP9A 3KHGA 4RZRA 4DTPA 4QWEA 3QYYA 1CXQA 3BSCA 1SH2A 1JLQA 3KK2B 2R8JA 1GX5A 3VA0A 1QE1B 4FYDA 4F4YA 4E0DA 1UA1A 2V0NA 4ZTFA 4YMEA 3KLEA 2VG5B 3CWJA 3M8QA 2OZSA 2YNFA 5F8HA 2X6SA 2IM1A 1LW0B 3TABA 3GV5B 1NKCA 4KV8A 3CJ5A 5KG3A 2B43A 3Q8SB 4WYWA 3H5YA 1WSFA 3LPUA 1X9WA 1TL3A 1EETA 3V6JA 1UWBA 2G8WA 4KAIA 3PW0A 2UVUA 2O4IA 2BRLA 1C6VA 3DLRA 4U6PA 4DU1A 1KFSA 5KG6A 3PJXA 2RKIA 4EBDA 2VWKA 5CY4A 3NH2A 3SFGA 2XO7A 3M9OB 2J6SA 3M8SA 1RTJB 1S0OA 4CGJA 4DTOA 4NLPA 1TAUA 3VQ4A 3V9SA 2OYQA 4O55A 4LSLB 2E6MA 4LH5A 4ECSA 1D9DA 1DTTB 2UUTA 4CIEA 1TV6B 3L8BA 4HUGA 1CSJA 4Z4FA 3K5MA 2DY4A 3UDLA 1S1UB 1TK5A 4MQ3A 3RRHA 1D9FA 1JLAA 4ZHRB 1S0MA 4B9UA 2ILYA 4KB1A 4K4VA 3I8DA 3JYTB 1Y97A 2ATLA 4L8RB 1RTHA 3LALA 4FJ8A 4J9LA 1TK8A 2YNHA 2RDIA 4NZ0A 3K59A 3H5XA 3LWLA 1NHUA 5L1KA 2XGQA 3HM9A 4KFBB 3JYTA 4DQPA 3CJ4A 3AO3A 3HPHA 4DF4A 4BE1A 4LSLA 1ZTWA 4PQUA 4XPEA 1QAIA 4B3OB 4AHRA 2ZE2A 4EP5A 1S1VA 2Y1JA 1TV6A 2XY5A 4MH8A 1Z25A 1KSPA 1A5WA 3DRRA 2W42A 4FJ9A 4ZP8A 1IKVB 2JEFA 1QS4A 3RB6A 1RT3A 3D45A 4MKAA 3DMJB 5KFCA 2HAIA 3G86A 1LV5A 2AWZA 2UVVA 2YNIA 3MFIA 1FKPB 2FLLA 4WZQA 1FK9B 1NKEA 2AX0A 3AVKA 2YNFB 1SL1A 4DFJA 4M3UA 2RF2A 2ETJA 2WONA 2HVIA 2ZD1B 1EXQA 4JS5A 2R8KA 2JEJA 2XCPA 4CJFA 4N56A 3DLKB 2BE2A 4OPKA 4B9NA 5HROA 3OL6A 3T3FA 3CIZA 4J9KA 1QE1A 1SUQA 5KT7A 4K8XA 4FJ7A 3KLFB 1C0TA 4DTUA 2YNHB 3P5JA 4KHNA 3PX4A 3BJYA 4O0JA 1O1WA 4O3RA 4RW7A 4NLQA 1JLAB 4HHTA 3TAPA 1I6JA 1KVAA 1DLOA 4KHRA 4C8LA 3V6DB 1RT3B 1SKWA 5FRMA 3TAMB 4OPJA 1HARA 1S6QA 1RT7B 4TY8A 4FJIA 1TL1A 3TAGA 1I3AA 3RMDA 1JIHA 2WK4A 3QIPB 3S3MA 3ITHB 5C25A 4H8KA 3UPFA 2B6AB 1RTIA 4W5NA 4J9QA 2D7SA 4FXDA 3HPGA 2YKMA 3HYFA 2R8HA 1C0UA 3MR5A 4TSXA 2IAJB 5C42B 3PJWA 2IM2A 3ICLA 3I0RB 1S1XA 2OPPA 3WNEA 2WOMB 2R2UA 1KLMB 3AO2A 3NGYA 3QETA 3LP1B 3KD1E 4IH5A 4CHOA 4FM1A 5I3UB 2D5RA 3WNFA 4U7CA 2HNZA 4M41A 1RT2B 4NLYA 2W9BA 4DQIA 1EP4B 3OSNA 1N6QA 1J5OB 4HCBA 5D3GA 3KLFA 5KFYA 3QEPA 3CVKA 2BANA 4CJLA 2D3ZA 4IDKA 2J6TA 1HPZB 1ZYQA 1RT1A 1QSYA 2X78A 3QIPA 1WNEA 5J2PA 4X2BA 5I42B 3NMAA 3DRRB 2VWJA 4E7HA 4EZ9A 1LWEB 1SV5B 2Z1GA 3O3FA 5L1JA 1RCHA 4CERA 2PYJA 4CHZA 2X74A 3UR0A 3C6UB 1DLOB 4CEZA 1LW0A 1VSJA 3L2UA 2CJQA 4WXWA 3KMSA 4DSJA 5EU7A 3E01B 2RKIB 2KZMA 1NK8A 1XC9A 3SPYA 1C1BB 1RAJA 1JKHB 1S9GB 3QEXA 2R2TA 4I2PB 4RW6A 1FXXA 3NFAA 4Y2CA 3RR8A 4J9MA 4O44A 2EHGA 3L3VA 4C8KA 4ZVFA 1T8EA 1RT6A 5KG7A 1RBUA 3LPTA 3THVA 4CJPA 1FK9A 4AILC 1HQUA 3SPZA 4ED1A 1YVUA 2E9TA 1BI4A 3SI6A 3KK1B 4M3XA 1Q9XA 3V9ZA 2ALZA 3QZ8A 5K14A 1RILA 4DU3A 3JSMB 4NLDA 3DMJA 5T7BA 2Q3SA 4QWDA 4CJ5A 3D0PA 5J1EB 4BWMA 4RNOA 4C8OA 4UQGA 3K2PA 4DS4A 2D41A 3F9KA 1Q9YA 4CHNA 1EX4A 4LQ9A 4CFBA 1R0AB 5CYQA 2VG7A 1GOAA 1NK5A 4FLWA 4IRCA 2F8EX 3RMAA 1IKYA 4CCHA 4QWBA 1BCOA 3DDKA 3VQ7A 3PR5B 4M42A 2D3UA 1TAQA 3C94A 2W7PA 3C6TA 2BQUA 3K5OA 1S9EA 4N47A 4FM2A 2HNDB 1HYSB 4RUAA 3DLBA 4KBIA 5J2QB 4Y2AA 4M3WA 4HKQA 4C8MA 3OYAA 2QV6A 1TQLA 3QIOA 4QOZB 2J6UA 4FS2A 3SYZA 4CJ3A 5DMRA 2FJWA 3OYNA 4ECQA 3OYKA 4JRQA 2JEIA 1RTJA 4N5SA 2WOMA 3OL7A 4NLTA 1HJRA 5KFTA 3VQQA 4H4MB 1RDAA 3KLGA 1S1TA 4FCYA 5J1EA 3PZPA 4NLOA 2VG6A 1KVCA 2IAJA 2BQ3A 2P1JA 4EYHB 2GUIA 5KT3A 1J54A 3GYNA 3MAQA 3CG7A 1NJXA 3LP0B 3Q8QB 4URGA 3DLGB 4J9OA 4FLYA 1HNIA 4ELVA 3QZ7A 4KV8B 4LH4A 3ZT3A 1SKRA 4B08A 3DYAB 2XY8A 1TL1B 2XWYA 3GIMA 3TWHA 1T7PA 5JXSA 1JLEB 2HHSA 2XI2A 5C24B 5J2NA 1GX6A 4FBUA 2QKKA 4O5BA 2BANB 1UA0A 3C6TB 3KOAA 4B9LA 3CDEA 3GIJA 1KCFA 5CYMB 2YV0X 3D5MA 3TI0A 1VSDA 4J2DA 1BQMB 4BE2A 4RU9A 2D0BA 3E01A 4GC6A 3KLIA 3Q8RB 2XRIA 2B5JA 2CKWA 3QGIA 4KHWA 4WXOA 3HKWA 4B9MA 5CZ2A 2HNYB 5KFVA 4OKEA 1A5XA 2R8IA 4DL5A 4MK7A 1WAFA 4ZVEA 4C8NA 2IOCA 3MEEB 1UWBB 5EDWA 2IM0A 2XC9A 1VSKA 2JLEA 4ECUA 2P51A 1RT4B 2YNGB 1NOYA 4CEQA 4QCLA 3LDSA 3L3UA 1NOZA 4AHUA 3BR9A 3KKSA 1TKZA 2F8TA 3ZT1A 2IDOA 3CYMA 3L2WA 1RT6B 2UVWA 2FBXA 5I3UA 3SUQA 3PUFA 5F8JA 3TAQA 3I5CA 3GV8B 4K4YA 3KK3A 5KRTA 1B9DA 3OL9A 5KG0A 4Z4HA 1S9EB 2BDPA 5HRNA 1N56A 3WNGA 4YQWA 3CQ8A 2G8HA 3FFIB 1N6QB 1J5OA 5L9XA 4IG0A 3PW2A 2BQRA 4CF0A 2X6NA 1JLEA 2AJQA 5L1IA 1EP4A 1TKTB 1SH0A 3OJSA 4Q0BB 3KJVA 5KG1A 2W9BB 4ECZA 4RW4A 3DI6B 5KFQA 3EYZA 1RDBA 5DGBA 3G6XA 4Q45A 2C28A 2I5JA 3MXMA 5KT4A 1UAXA 3CJ2A 4BACA 4XPCA 5JS2A 3NAEA 3SQ4A 1S6QB 4CGGA 3NF8A 3NGDA 3AVNA 3BQ1A 1RT1B 1IH7A 4F3TA 5KFFA 1RBSA 4KTQA 4QWAA 1T3NA 1TP7A 4YR0A 3GILA 1BI4B 4FJ5A 2HWHA 3CFOA 1X9MA 5HBMB 1NJZA 3CJ0A 4ZVGA 4J9SA 1W0HA 2FJXA 2YHAA 2AGOA 2R2RA 4ID5B 4QAGA 1L3UA 4LSNB 1HYVA 4DWIA 3QEWA 3QIDA 1EKEA 2XHBA 4KHYA 2JC0A 4G3IA 1GOBA 5KG4A 3K5LA 3PO5A 4DFPA 1BIUA 4RNHA 3IG1A 2OA8A 1TKTA 3OVNA 4R0EA 1NHVA 2JEGA 3FFIA 4QW8A 5HP1A 1RTHB 2A1SA 1HQEA 3AVAA 1KHVA 4IBNA 2D0CA 4ELTA 4DL7A 2I1RA 3C6UA 5J2NB 5KTQA 1CLQA 5KFKA 3EY1A 4DSIA 3N6MA 4CE9A 5KGWA 2OZMA 4CGHA 3ZSWA 3DOLB 4NLGA 3OS1A 2HNYA 4E1NA 3I0RA 1RT7A 3ZSXA 3VQ5A 1ZBHA 4ED0A 3RWUA 4FK4A 4CEOA 4CK1A 4ECTA 3QGGA 2ASJA 3IS9B 4B9SA 5FDLB 3MEEA 2B6AA 5FRNA 1T03A 5KFHA 1U09A 3AO5A 1VSFA 3OYBA 3FRZA 1TVRA 3T5LA 2UUWA 4H4MA 2FBVA 3HO1A 1QQCA 3ISNC 3OS0A 3OYEA 2NUBA 3IG1B 3AV9A 2QK9A 3ZT4A 4GVMA 4FLXA 3MXJA 4NYZA 1S97A 1UOCA 1RBRA 4DG1A 2E9ZA 2DFFA 4M94A 1NNDA 4MFBB 3AVFA 3U3YA 2IS3A 3I5BA 4FJJA 1S9FA 1JLFA 1W25A 4F8RA 4B9TA 4K4XA 4ZHRA 1JLQB 5KFPA 3ZSQA 1C1AA 5L1LA 3MR6A 4H54A 5KFBA 4EEYA 4E7LA 2FVRA 3VQBA 3I0SB 4Q5VA 1TL3B 3OL8A 1MMLA 2YNGA 4DSLA 3IRXB 1JXLA 4M3ZA 3T19A 1HYZA 1LAVA 4YNQA 3OYCA 4NYNA 4ECXA 3OYJA 3PHEA 4KE5A 4O3QA 4E7KA 1QUVA 3OYLA 3E51A 3DRSA 4IG0B 1DTQB 4F4XA 3SQ0A 5KFDA 5KFOA 4KPYA 4OLBA 4NRTA 3MR2A 3NAHA 3F73A 2FVPA 3KK1A 4F50A 4LD0A 3VQEA 5EWGA 5JS1A 3D28A 3O3HA 1S48A 2KFZA 5DG9A 4JRPA 4BE0A 5F8NA 4MFBA 4DL2A 1NKBA 4DSKA 1I39A 2W8KA 2HNZB 1Z26A 3ZT2A 1HMVA 1HNVB 1WSJA 3B6PA 4QPXA 1TKDA 4ZTJA 3ZCMA 3AO4A 4DS5A 2YKMB 3O3GA 3OYMA 2XY6A 5KG5A 1BISA 4O3OA 4GC7A 4IKAA 3NF9A 5DG8A 1S10A 1TKXA 3MEGA 2G8VA 4ZMMA 3OY9A 2C2RA 3M8RA 4WZMA 4EYIB 4ID1A 3L2QA 1WSEA 3NDKA 1EETB 3VQAA 4FJKA 3H59A 1ZTTA 1RA6A 1VSHA 3CFPA 4DL4A 3V4IB 3G0ZA 3HP6A 3HVTA 3V9WA 4F4KA 4W5QA 1N5YB 3NH0A 1RA7A 4CIGA 2LSNA 1BIZA 4ZVHA 2PYLA 3LP2B 5KFEA 1C0MA 3NBPB 3AVMA 5KFJA 1IO2A 3ASMA 2AU0A 3G6YA 1JXEA 3LZJA 2BGGA 2EX3A 4CJEA 2IJNA 4CF2A 4KKOA 4GMJB 1B92A 2W9CB 1RYSA 1TGOA 1C1CA 1R0AA 3BGRB 4CJSA 3GV7B 3T5KA 1VSLA 4TLRA 3G10A 4KO0B 1ZBFA 4NCBA 3LP2A 1C1BA 3LAKA 3FQKA 4B8CA 1IKXB 2VG6B 4YP3A 2AGPA 4CECA 4KO0A 1N5YA 3M8PA 1LAWA 1QAJA 5DQGA 3ULDA 4CJ4A 3SUNA 5FROA 3RAQA 4IQXA 1T94A 3MR3A 4IR1A 4F2SA 4FLVA 1S1WA 2W9CA 4OKJA 2BR0A 2FBTA 3M8QB 3LP3A 3K58A 2FVQA 2F96A 3RB3A 3BSOA 4Y3CA 4ECRA 4TYAA 4B9VA 3H98A 3HP9A 2JC1A 5K14B 3DI6A 5KFMA 3OSPA 1QSLA 3C95A 1MU2B 4CJRA 4AH9A 1J9AA 2HWIA 2B4JA 1U48A 3AVIA 2W7OA 3KD5E 1XR6A 3SFUA 3KHLA 4EO6A 1T03B 4Y1DA 1WSIA 2KFNA 4K8ZA 2BE2B 4RW9A 4OL8A 4ECWA 4O44B 4DU4A 1ASWA 2PZSA 4O4GA 2FC0A 1HNIB 3RB0A 4IRDA 4AHVA 4IH7A 1S1WB 2FBYA 2E6LA 4E1MA 2AGQA 2XCAA 5F8IA 4K4TA 4IOBA 3S3NA 4F2RA 4W5TA 4DTJA 3T5JA 4RNNA 1A5VA 1NK0A 3QINA 4H4OB 4FJGA 3BQ2A 3PVXA 3T1AA 3KLEB 4ELUA 3DLKA 4J9PA 4AHTA 4DTNA 4RW9B 1X1PA 2ZD1A 1U04A 4FW2A 2IBKA 3M9NB 4NLVA 2R2SA 3VQ8A 3TAEA 1JLCB 1N48A 3SI8A 4TN2A 4RW6B 4XO0A 1C2PA 4CF9A 3KK2A 4I7FA 4KRFA 1REVB 5HLFB 3CFRA 2QE5A 4KREA 4BDZA 3CJ3A 4KB0A 2W8LA 3N6NA 4TQSA 3DRPB 4Q8FA 1RNHA 1XR5A 3B6OA 2HHUA 1S1UA 4PWDA 4KI6A 4LSNA 5HRRA 3VN5A 2E4LA 3A2FA 2RN2A 3O4NA 2FLNA 3NKYA 3UQSA 4QWCA 5DLGA 5KRSA 4IFVA 1TKXB 3P1GA 4I2QB 4FW1A 1XWLA 3RMCA 2FLPA 4J2AA 1IKWB 3M8PB 3H2LA 4K4UA 1RTIB 4CJKA 4DFMA 1QTMA 4K4WA 4NCGB 3NH1A 4M45A 4MIAA 5EWEA 4R8UA 4PA1A 3ZSVA 4I7FB 4WFXA 3KLGB 4DL3A 1S6PB 4ZPCA 4Z4CA 1JLCA 4ZPDA 3V1RA 3LWMA 4IFYB 3AA3A 2YKNA 1Z4UA 4J9NA 4DTRA 3BGRA 4CEDA 4FJLA 4CIFA 3KHHA 2C2EA 1RDCA 1B9FA 1XHXA 4RW7B 4IFYA 2Z1JA 3HL8A 4AHSA 4H4OA 3FSIA 1KLNA 3KNAA 1S9GA 1JLBB 1DTQA 1JXBA 2V4RA 2HB5A 3H4BA 4DQQA 2ZQBA 3SUPA 3WNHA 1SUQB 3TR8A 1W9HA 4NLUA 5DK5A 1ZBUA 2OPSA 3IS9A 4FLUA 2V4QA 2HHXA 1KTQA 5F9LA 4JLHA 4E7IA 1RT5A 2RF2B 4AHCA 3AA5X 4CHYA 5J2MA 5KFSA 4K50A 1VRUA 5I42A 3BSNA 3DOLA 3OYDA 1S1VB 5HBMA 1LWCB 1RT5B 3QEVA 3V4IA 4K4ZA 3IRXA 3EZUA 4PUOB 1WSHA 4IDKB 4ICLA 4WE1A 3H5SA 3KLIB 3SV4A 3DLEB 2C22A 3G6VA 1X9SA 1KHWA 4F4WA 3FDSA 1JLGB 2FJVA 1KFDA 4E89A 1LWFB 1RTDB 2E9RX 1SL2A 1YTAA 1RYRA 3IN5A 2R7YA 3PX0A 1S1TB 4R5PA 2QKBA 4LY7A 4RNFA 4HUEA 4PY5A 1KVBA 2P5OA 1ITGA 4Z4EA 3Q8PB 3MECB 4WYLA 1KLMA 4DF8A 1N4LA 4KFBA 4FK0A 2XY7A 4JV0A 3BSAA 3NGZA 1JL2A 1ZBLA 5E41A 1HYSA 4I9QA 2G8FA 1FKPA 4IKFA 3QLHA 2DPJA 3KK3B 1RBTA 4I2PA 4TYBA 4TY9A 4Z4IA 4CEEA 4RG8A 4ZPBA 2QXFA 1T05B 2HVHA 1K1SA 4CJUA 3KHRA 4CHPA 3AVGA 5KFXA 4OJRA 4ICLB 4LQ3A 4NLRA 3OLBA 1VSEA 2ITGA 3VQ6A 4CFAA 4PWDB 1LWCA 1WLJA 3MEDB 4CK2A 4OVLA 4RW4B 5KGXA 3DRPA 3MXIA 2IC3B 2IJFA 1SH3A 1VSIA 1IKXA 4RNMA 2RPIA 4EBEA 1OS5A 4CF1A 1ASUA 3RB4A 1LW2B 1VRTB 4CK3A 2ASLA 1BQNA 4RUCA 1HRHA 5SZTA 1MU2A 1YTUA 5F8GA 1S4FA 3QO9B 1RDDA 3T5HA 2OPRA 3SNNA 2OPQA 4IH6A 4KKOB 1D0EA 3OYFA 4JV1A 2HW3A 3H40A 3HJFA 4FZYA 3RBDA 2YHBA 3NHGA 3HVWA 3SQ1A 3QNNA 3KKRA 4ECVA 3HVAA 2HNDA 3OJUA 4Q43A 3DLHA 2KW4A 4FBTA 2UVRA 1D5AA 4I9LA 3I0SA 3LZIA 4CJQA 4FZXC 4Z0UA 2ILZA 4KTZA 5DQHA 1L5UA 3KMQA 4OLAA 4NCGA 4IRKA 2C2DA 4KB7A 1XI1A 2XGPA 2D0AA 3HHKA 1ZETA 4M3YA 3KTQA 4FJNA 3KLHA 5KFRA 3PY8A 3MEDA 3SZ2A 4NLSA 4XIUA 1F21A 3AVLA 1JLFB 2AQ4A 3S3OA 3HK2A 3AO1A 4Y34A 1NK9A 3SUOA 4N76A 4Z4GA 2WB4A 1LWEA 3ZT0A 1BHLA 4DL6A 4BWJA 2I5JB 4FLZA 3QESA 3BDPA 2DTUA 4WFYA 4NRUA 3JSMA 4O3NA 3VQDA 4FLTA 4N41A 1BQNB 5HP1B 4KI4A 1HNVA 5F9NA 2R8GA 4M3RA 3VQ9A 4E3SA 5F8LA 2WCXA 4O0IA 3AA2A 1TKZB 2O5DA 2VA3A 1S49A 2V9WA 3OYGA 3L2VA 3V81B 4MKBA 4NLXA 5J2QA 4ED8A 3HVTB 1D8YA 3OYIA 1RT4A 4URSA 4DSFA 3VQCA 4G1QB 3OLAA 4ID5A 2YKNB 3RTVA 1CZ9A 2G8UA 1WNSA 4O3PA 5KT5A 1BGXT 1L3TA 4FJXA 2FVSA 3DRSB 3NAIA 3GQCA 1LWFA 3OS2A 4W5RA 2HMIA 3OHBA 4EP4A 3V1OA 3QERA 1JLGA 5SWMA 2WRMA 1VSMA 4O4RA 2O4GA 4JUZA 1IKWA 3AVBA 2VG7B 1CXUA 3QLHB 5EUHA 3ITHA 1HQEB 3NL0A 3V6KA 4DSEA 3GIIA 3N6LA 4IFVB 1IM4A 2ATQA 1RBVA 1QSSA 4MIBA 2IA6A 1U47A 4KAZA 2IGIA 3KLVA 3MECA 4G1QA 1T05A 2ZE2B 3L2RA 1NK6A 4KHQA 3PW7A 4ED7A 2KQ2A 4CFDA 2B5JB 4DLEA 1U4BA 4CJWA 3LP1A 1WSGA 4CEBA 4ED2A 4O3SA 5KFLA 4HCCA 2XI3A 4FVMA 1S6PA 2F8SA 2HHVA 4HYKA 5HRSA 4DLGA 2Z1HA 1REVA 3HT3A 4E7JA 5HRPA 3CDWA 3QGHA 4CEFA 3PR4A 4IR9A 4RW8B 4CFCA 4DG1B 5FDLA 3AVJA 4QW9A 5CYQB 3U6FA 1NK4A 5C24A 2Y1IA 3MFHA 3NGIA 2IM3A 4F3OA 3SCXA 4CF8A 5KG2A 3PV8A 2Z1IA 3TARA 4ZP6A 3BQ0A 2WTFA 3IAYA 1VRUB 4IG3B 4CHQA
chains in the Genus database with same CATH superfamily
4ZA1A 5IC6B 5E3QA 3Q7CA 3TEHB 2GV9A 3VVTA 3QFWA 4CGFA 4YOVA 2RVJA 5KFNA 2IRYA 4FK2A 3HPOA 3U9DA 1HNWF 1Q5VA 2E1YA 4U7UK 5HN0A 2JGUA 4OGCA 3AVHA 2GX8A 2GBZA 4HUFA 1YLXA 4JYAF 1JL1A 1FF2A 3DRXA 4V19J 4FM0A 1XK8A 1AZSA 1RDRA 2UXBJ 2RQKA 1RSCA 3V6HA 1EQMA 2DGWA 3M2RB 1VQMN 1WEZA 3KJFB 4GVBB 3AY0A 2P9SA 3M8YA 3FZKA 3EGNA 2ZH1A 1LXJA 4WP9A 1ELOA 3P5TL 2HHWA 1CJTB 4WE1B 3NBPA 1ITPA 1BUXA 2DNNA 4UOHA 4CEAA 4IOXA 2GIQA 3CM5A 2W2OP 2LDIA 2Q6BA 2OPPB 5DLFA 2VFUA 4FZZA 3OHAA 1OH7A 3I87A 4EWTA 4OKKA 1SJFA 1FNMA 2RQ4A 3I6PA 3PW4A 3MAAA 3RW6A 4JI1J 3P5BP 1Q8IA 4TXSA 2ZBQA 5HL7L 1ESVA 2ZBPA 5I3QA 4JKBA 5HROB 3VA3A 2XO6A 2W7AA 1M5PC 1CZBA 3U1LA 3TVKA 2Y0SD 4ILLA 1ZS6A 2AJFE 4U67L 3V81A 4YR3A 2FSNA 3IGNA 4WTYA 4X62F 1K6YA 4P6QA 4KSEB 2W9AA 1T9WA 3KIOA 3RVCA 2P5GA 1SXLA 1P9YA 5CH7B 4LF2A 3PO4A 1MWZA 1KEKA 3ZLJA 5DGAA 1VAZA 2K2PA 1CC7A 3TA2A 1YK9A 5C25B 1VR6A 1IKYB 4ED3A 4BDPA 2B51A 1XNRJ 5IT9U 4ZVOB 2CPXA 4MK8A 2AD9A 1HW9A 2FC8A 2KRRA 4OMFG 4JKCA 2K1RA 4CD1A 3CDUA 4KHMA 2YNIB 2CQ3A 1RXOB 2OHDA 3TPQA 1WC4A 4DV4K 2BOAA 5KI6A 3W5YA 4MK9A 2KLAA 2OTJS 1SQEA 1EQ0A 1XHZA 4NCAA 4DUTA 5K8OA 2HMIB 4J2BA 5GVQA 1IVZA 4U8YA 3U1MA 3SCJE 1VQPN 3C16A 3OTDA 2W40A 3EKUA 5A6PA 5LJ5Y 3M9MB 1CJVB 4TU9A 1EIYB 4Q44A 4IO8A 3W7BA 3B8HA 4YOTA 3I96A 2VPZB 2UUBK 4WP3A 3I5AA 1VQ7N 1L3VA 7FDRA 4DCJB 2UUAJ 3U02A 4B3SJ 3VENA 1B0PA 5CYMA 3JS9A 2CJKA 3BO3A 4V19X 2BRKA 3MPDA 4Y1CA 3AVCA 3QT6A 2V7ZA 3SQ2A 4DHVA 4LIRA 5CZ1A 2HBQB 3B82A 2JNJA 3SV3A 3QWPA 3W65A 1ASVA 3NLCA 1KS2A 2LXUA 4CESA 3O9QA 2OEJA 1GH8A 3DLGA 4ECYA 2AJ2A 4B8AB 2Q6CA 4IQMA 4RZRA 1S4EA 1EKSA 4KRWA 2R8JA 1GX5A 3BN4A 4FYDA 3BGOP 3IWNC 3OA9A 2ZH8A 4ZTFA 2G0IA 1BD6A 2X1GA 4DV7K 2OZSA 1LW0B 3TABA 1NKCA 4KV8A 3CJ5A 5KG3A 3K9KA 2D9PA 2B43A 1TL3A 2HF3A 2LP4A 1UWBA 2XBPA 3PW0A 2GELA 2VQEK 2O8DA 3TWZA 1W7AA 5EGYA 1B7YB 2HKEA 5KG6A 5IV3A 5AQYA 1H73A 3P6YC 4CGJA 4DTOA 2H5EA 4NLPA 1TAUA 2O8CB 3VQ4A 3BGUA 2OYQA 2ZDOA 1JWWA 3DU5A 2RB7A 2MQQA 4A8WA 2E6MA 4ECSA 4RTFD 3O8WA 2F4FA 1CSJA 3H3OB 5KAKA 3G9CA 3D54A 3QMLA 5M2PA 4ZHRB 1WHWA 5M1KA 3I8DA 1Q8BA 4P2XA 2KVIA 1KAYA 3LALA 5CCLA 1IJFB 2LU1A 1R27B 1YJ7A 2O8EB 1MWYA 3QT5A 3CEDA 3HM9A 1VMBA 3WEEB 3AO3A 4X4SA 4BE1A 2DIVA 1ZTWA 1U2RA 4X4QA 4PQUA 2B56A 2NXUA 3MPUB 4KH6A 2C3UA 1N88A 3EVOA 2Y1JA 1GLBG 1Z25A 3D6HB 1KSPA 5E26A 2F4VK 3J7ZO 1Z1ZA 1TL4A 2HQFA 3D45A 2NPFA 3F41A 3DMJB 5KFCA 1SC3B 4LVNP 2F4VF 2IVYA 2GIFA 2FLLA 3QT7A 1CULA 4NA3A 4WZQA 3QJLA 2N3LA 3MCOA 2AX0A 3ONQA 4N7TA 1SL1A 4DFJA 2J0QD 2HLTA 4DR1F 5CYJA 4YY3J 5C2GA 5IC4B 4JS5A 3A8JA 4N56A 5M1PA 3OL6A 2Y0BB 3T3FA 3CIZA 3O5TB 1N32F 4ZK7M 1QE1A 1H7WA 2MZ1A 4FJ7A 1FFWB 3ENHA 4DTUA 2YNHB 3KJQB 3P5JA 2XNRA 4HT7A 3PX4A 4O0JA 2O8BA 4RW7A 3AA9A 4P2SA 3PIPL 1Y5IB 3VAKA 2CIMA 2DVIA 4C8LA 4HI1A 3V6DB 1LFWA 4CLFA 1RBOB 4TY8A 4FJIA 3BN7A 5FLXU 1I3AA 3DLJA 2YHXA 3RMDA 1G99A 4OHVA 1HBOB 2WK4A 1CZAN 3R1HA 3QIPB 3L09A 2B6AB 4W5NA 4J9QA 5CAAA 3HYFA 4F02A 2R8HA 2BA9A 4DV1F 3IP0A 2OIHA 4NXNK 1C0UA 2IYGA 5CR4A 1R6VA 3H0PA 5C42B 3ICLA 2VASA 2ZVIA 4B1XB 3SCLE 2GWJA 2IVNA 3WNEA 2R2UA 3DKDA 3WC0A 3NGYA 3LP1B 2CNOB 2QL7B 1GMUA 1CQMA 2CQ1A 5I3UB 2D5RA 4JI8F 1NGIA 2HNZA 3GCXP 7AT1B 4CLKA 1WUUA 2UUBF 5AQTA 4OV6A 1EP4B 1KR4A 3OSNA 1TTHB 4LBHA 2H5JB 3HCXA 3LPEA 4PEOA 4FNIA 2BANA 2VC1A 1X5SA 4IDKA 4USKA 2OKQA 1NGDA 4H0PA 2V67A 4X66J 2W4DA 1K8AT 3OBYA 5J2PA 3KWIA 3CD0A 2VWJA 1K0TA 5A8KA 2ZJQQ 4DV4J 3AODA 1RCHA 5E7OB 1N0UA 3WQPA 2X74A 2HHPA 4KHPF 5GAEI 1DLOB 3N01A 1IR1A 2EFNA 3HZEA 1LW0A 2Y8WA 4H0YB 4CLSA 4JK8A 4WXWA 2V69A 1AXQA 3V4MA 2BJ1A 4C3LA 3J81Y 1XC9A 3SPYA 2MKJA 2P9LB 2P5VA 2JFKA 3P38A 3QEXA 3THXB 1FXXA 5FPNA 3RR8A 1KN6A 4HR2A 5G0RB 1FNOA 4UT4A 3R6LB 2OELA 5KG7A 4FWNA 4DR6F 4HTLA 3EO3A 2NYIA 2J7UA 4RPFA 5EHHA 2MLYA 1HQUA 3DHWC 3KK1B 1Q9XA 2Q79A 2FY1A 2RRAA 3WXLA 2RIJA 4BQZA 2CQBA 4NLDA 4BG8A 2DB1A 2Q3SA 3F9MA 4QWDA 4I6MB 1NCLA 5J1EB 2CQIA 4ZS6A 4BWMA 1CJUB 3EZOA 1WDTA 3ZETA 1FFGB 4C8OA 1Q81O 3MMCA 3NP5A 5AJ3K 2PDAA 4CRJA 4CHNA 2FF6A 1M5SA 4WIQA 1M1GA 3FZ2A 1R0AB 2KH9A 4QBUA 1N5VA 2E1MC 4A46A 4FWQA 1YBUA 1EB0A 4TVAB 3TQEA 4CCHA 1BCOA 1U0HB 2YBVA 3QPIA 1WWHA 2QSWA 3C6TA 5ETSA 2VHGA 2F65A 4B3MK 2PSZA 2NUUG 1HYSB 1VQYA 1DQ8A 4WIIA 2CQHA 4HKQA 4DXLA 3OR2A 3VAGA 5K8PA 3OYAA 1G1XA 1FDAA 4FWSA 1PYTA 4C1NI 2QZ8A 5B0GA 1RUSA 4GKJF 3PG9A 3SYZA 3CXCM 1NWKA 5DMRA 3OYNA 4ECQA 4J91A 1HWUA 1HJRA 3VQQA 5AQOA 4H4MB 1NH8A 3KLGA 5J1EA 3PZPA 2YKOA 4DV0K 1SAZA 3O08A 2U1AA 5KT3A 3CMQA 1GLAG 3DLGB 3GFHA 3BBBA 1HNIA 4ELVA 4HVZA 1SJQA 5BN9A 1GQEA 1YHQS 4RWXA 1WKLA 2APOA 1TL1B 3R5BA 4WKYA 3TWHA 5U47A 2LVWA 3OW2R 5AZIB 1DJ0A 3DU6A 5J2NA 2WB1D 5BPLA 2IRXA 1AYEA 2KG1A 2KJVA 1UA0A 3C6TB 4RBUA 3PXGa 4NEZA 3D5MA 4BE2A 2FHOB 3CCMN 2D0BA 1ACMB 2G0JA 2EBEA 5GMKa 3Q8RB 2FZGB 2B5JA 2CKWA 3MMVA 2XTJP 3LOUA 1E4FT 1V6HA 3O9TA 1Q7YO 4RUHA 4B9MA 3UI3A 5CZ2A 1FCAA 2LMIA 4PL8A 4XH5A 3Q8VA 1F5AA 4WFBL 5AFUA 4FDFA 1WAFA 3D1OA 3HM8A 4DR7F 1HW8A 2EKYA 4DKWA 1A0OB 2XC9A 3RU0A 2XSJB 2HBRB 3N0VA 2L41A 5I4MA 1OY9A 1Y5LB 1TL7A 3R5DA 1IWAA 3LDSA 2MZSA 4Y0FA 1NOZA 3DXMB 4X4VA 3Q22A 1Q4RA 4GMKA 4GO5X 1MNEA 3KK3A 2F9JA 4K4YA 5KRTA 3OL9A 5KG0A 4JKGA 4Z4HA 1N8RT 1K47A 2BDPA 2FQQB 3Q2TC 2UUCF 4ZVQB 3FFIB 4LMZA 6FDRA 5L9XA 2GJ2A 4CF0A 2X6NA 3QJJA 1JLEA 4DU8A 3IBWA 5L1IA 1SH0A 3N28A 3HMJG 3DI6B 5KFQA 1DHMA 1J2VA 3W63A 4H5VA 2VIHA 3DNCA 2XYPB 3J81O 3DXMA 2EW9A 2ASYA 4CLYA 4BACA 1VQ4N 3NAEA 3SQ4A 1S6QB 3NGDA 1RT1B 1IH7A 2QO3A 3R5GA 4KTQA 4B3RK 1YZ6A 1TP7A 5LOQA 3GILA 2VBXA 2O8BB 3MX5A 4FWLA 2QWNA 1BI4B 3CFOA 1NJZA 1O51A 5F2RA 1T9TA 3QNWB 1RHMB 4FWOA 1KTVA 4XDCA 1L3UA 1HYVA 4LSNB 4FNHA 5FD1A 4DWIA 4KHYA 2JC0A 4C0BA 1SJ3P 2NZCA 4CTAB 5KG4A 3K5LA 1CJVA 4DFPA 1IBMK 1R0BG 3U27A 3W0LA 1K0VA 3ENVA 3O1BA 1Y3KA 3FFIA 3EE9A 1BUPA 4JI0K 3R7NB 1RTHB 2A1SA 5A2QU 1R43A 1JB0C 4EAHD 3AVAA 2D0CA 4WCEL 1HR0J 3JQMA 3C6UA 5J2NB 3IAS9 3N6MA 3H42A 2GAHC 4LR8A 2OZMA 2VPXB 4CGHA 2ROEA 3DOLB 2YCHA 4WK3A 4NLGA 2HNYA 4NWBA 2RHQB 2COLA 1HD1A 4ED0A 1S12A 2H3EB 4FK4A 4WF9L 4ECTA 2J7WA 5FDLB 2B6AA 1T03A 1ZAWA 3W3DA 4KIAA 1RAGB 4FL9A 4ZITA 1X60A 3VF4A 4H4MA 4PWUA 2FBVA 1QQCA 1FFSB 3ISNC 2MZTA 2ZH7A 3B78A 3OS0A 3OYEA 2NUBA 2W6KA 3AV9A 3C46A 4WFNQ 1B4SA 3ZT4A 4NYZA 3VAJA 1N5QA 4DR2J 1HL6A 2U2FA 1KAZA 3EE3A 4M94A 2DH8A 3AVFA 1JCEA 4OI6A 1FXLA 1TR0A 3VEZA 1JLFA 4F8RA 1XMQK 2E8AA 3FC9A 2X51A 4BVPA 4EIAA 1GXUA 1P8GA 3AXKA 1C1AA 1ZA2B 2LDYA 4H54A 1RGIA 4DUZJ 2UU9F 3I0SB 1TL3B 3OL8A 2GS8A 4DSLA 1JXLA 1VHFA 3X3UA 1HYZA 1LAVA 2ZKTA 3M1VB 3OBIA 2B8QA 4NYNA 2MDAA 4K8RA 3OYJA 3WQTA 1MWMA 2CGLA 4O3QA 2WVBA 2ZH3A 4W98A 2K3KA 2ZM6F 1PC4A 1DTQB 3WIUA 4ZDNA 5HMWA 3AT1B 4HEA9 1DBDA 2KRBA 3NAHA 2J0XA 3QRPA 1AW0A 2R7XA 5LJVA 5DG9A 4U7UD 1Q79A 2VB6A 4DCPB 5HOOA 3T6JA 4GKKF 2YH0A 4A48A 3TJ8A 4ZVUB 1Z26A 2E5LF 1H6KX 1NU4A 1G7CB 1FJGK 1LXNA 1XMOF 2E1ZA 1F5BA 1OH8A 1TKDA 3DXKB 3ZNJ1 3MWBA 4DS5A 3LQVA 2JZ5A 3OYMA 1M5KC 4H0TB 5KG5A 3QRQA 5DG8A 2MSSA 1BWFO 2HG4A 3ZZZA 2G8VA 2KT2A 3P4UB 4LR9A 1E6YA 3L2QA 1WSEA 1EETB 1ZTTA 5FPDA 3V4IB 5AT1B 2YKPA 3FZFA 5AQNA 1RA7A 1BIZA 4FPRA 3CJ9A 2EEYA 3SBGA 2DO4A 4QQBA 1C0MA 3NBPB 2OFHX 4FP9A 2IVPA 3VZIA 1HHQA 1V3SA 1YI2N 2IJNA 2DD8S 2HIYA 1F5CA 1HNZJ 1B92A 1TGOA 1C1CA 2QLJB 4CP5A 4NYOA 5DM6Q 3T5KA 3QBXA 1K8AO 3PYGA 1VSLA 3PTWA 5B0DA 1D9AA 1IWGA 4B17A 1F2GA 1C1BA 3LAKA 3NNCA 4CECA 4JI0J 1YJRA 3M8PA 2DY1A 1QAJA 2BE7D 4IO9Q 5BN8A 5DQGA 2JDJA 3ULDA 2CPDA 2KU7A 4ILJA 2VGNA 3S01A 1SQGA 2M3DA 3EGZA 2BR0A 3K58A 2DO0A 4OPAA 4OYOA 1XNQJ 2F96A 2JFDA 3ZX3A 3HFZB 2MLZA 4B9VA 4UQTA 2JC1A 5KFMA 1QSLA 1OVYA 4I6YA 4JKAA 1S59A 4CO3A 4P2FA 1K9MT 2OMOA 2GMLA 5FLXO 2HWIA 3D4JA 4NEYA 3CPWM 3TU5A 1HA1A 3SFUA 4M5GA 1T03B 2KFNA 4V19S 2NRWA 2BE2B 2VBWA 4OI2A 3T1HK 3D6MB 4OL8A 3OVBA 4LBPA 2FC0A 3RB0A 5F1XA 3LL3A 2DNLA 1DQ9A 1O8BA 1NPRA 3N4QA 5AQQA 2AGQA 5F8IA 4P9SA 3HOTA 2GGPA 3HBTA 3UE5A 4W5TA 4OI0A 3G96A 3MCSA 1A5VA 1RABB 1QAXA 1T6DA 3PVXA 4BRMA 2NSCA 1FWLA 2EFVA 1UFKA 1FDNA 4RW9B 2POKA 2MKCA 3P4IA 4FW2A 2IBKA 3M9NB 4CBWA 1VLOA 4BRKA 1JLCB 2ZWHA 2Z0GA 2YJFA 1YVNA 2LEPA 4CF9A 2G1HA 4ZPTR 4I7FA 5HLFB 1NGAA 2QWQA 3CFRA 1H2UX 4DV7J 2OSQA 2X1AA 3BBFA 4PWDA 3NCPA 4LSNA 4CYUA 2GUPA 1Q95G 1RQ0A 2R7VA 3QFUA 1PYOB 1H3DA 3WX4A 1HKAA 2DNGA 4ED5A 1CULB 4I2QB 1PJ7A 1XWLA 2P9IB 1B70B 1QVFR 3M8PB 3H2LA 2BJ8A 1RTIB 4DFMA 1QTMA 4DZDA 4K4WA 5GIPA 5A8WA 3SSSA 4WFXA 3OHRA 2Z4PA 1YX2A 4ZPCA 1JLCA 4ZPDA 4IFYB 4CW7B 3ZXWA 3ZZYA 5E3CA 4ZLLA 2LFVA 3MPVA 2ATCB 1CBKA 4IFYA 3Q83A 4YDDB 4H4OA 3FSIA 1JNRB 1S9GA 1JLBB 2X7IA 2CXEA 4BC3A 2J4RA 3T1YJ 2HB5A 4BRIA 4DQQA 2ZQBA 1FJGF 4C98A 3TR8A 1W9HA 4NLUA 3BM7A 4FZVA 3ZZRA 4CQ1A 3IS9A 3CCTA 2W2QP 2LQJA 5HVHA 4OJGA 4E7IA 3CC7S 1U6BA 5ETVA 4PKIA 4CHYA 1WHYA 2HBZB 4JI2J 3VAMA 1RT5B 1UJ5A 4B02A 3CCLS 4K4ZA 3IRXA 4PUOB 3R5AA 1WSHA 3H5SA 3SV4A 5F3TA 2C22A 3G6VA 1Q7LB 4CLTA 2V8GA 4D3HA 1JLGB 1VS3A 3D3BJ 4C11B 4YHHK 3FFKB 1YTAA 5LMUK 2RU9A 2Z2YB 1S1TB 4R5PA 2DR7A 1HX1A 1F60B 1XN9A 4LY7A 2MMYA 1GTHA 3SMPA 4PY5A 3IRWP 1ITGA 2A10A 2HURA 2QA4G 3Q8PB 3MECB 2CNLB 2QL5B 1BG3A 4JV0A 1E4GT 3OTOJ 3NGZA 4C0HA 3OVSA 5E41A 1OPIA 3N4WA 5JLFA 5LL6Z 1WOQA 4I9QA 2CPHA 4W92B 4IKFA 4DUYF 3NGSA 2DGVA 3KK3B 4JBCA 1RBTA 4I2PA 4BLGA 3ILOA 2ASOA 4LF4J 4CEEA 2ZJQL 3E9PA 1I5OB 4ZPBA 4L74A 4M5DB 1X3MA 1UZHA 3FBCA 1G4CA 3TUIC 4OJRA 1TL7B 2PFDA 1EWQA 3MI7X 5HQMA 3OLBA 2M52A 2ITGA 5BPMA 3VQ6A 4I0WA 3TNVA 1LWCA 2KI2A 3MEDB 3L6QA 4OVLA 2HQ3A 3G82A 2NLXA 5IS2A 1VQ5N 4CF1A 5B0CA 5GAHP 4PHTX 4CK3A 2RS8A 5DDOC 2M8HA 1YTUA 2AEFA 4RX6A 4GVLA 3HKZD 1R7IA 4USWA 3T5HA 4FWRA 1S5ZA 4ID8A 5BYSA 4KHPK 5EY4A 3NVKA 1VHXA 3TTDA 4FZYA 3SQ1A 1S7HA 2C2OB 2JLGA 1BWVA 4HL9A 1W7WA 3DLHA 2UVRA 1JQGA 3LZIA 3HFKA 4EFAC 4A61A 2QX0A 4KTZA 3NGUA 2RE1A 1LWXA 2RH3A 2HQIA 5K9FA 4OLAA 2GAGC 2XGPA 5GAEP 3HHKA 4M3YA 3FGVA 4E8UA 4ISGA 3PY8A 3MEDA 4IOCQ 4XIUA 2QL9B 4A8XA 3AVLA 2YH1A 1RU2A 3OW2M 2AQ4A 3A8EA 3LGHA 3PIPQ 1LWEA 4JNEA 3ZT0A 2CYYA 4EHUA 1RBLA 4Z7CA 5AQVA 1NUEA 3UNGC 3C66A 3JSYA 4B3TJ 4DCHA 3H1VX 4O3NA 1PO6A 2L9DA 4FLTA 4N41A 4Q2MA 1BQNB 2XB2D 3OUYA 1C0FA 5F9NA 2N4CA 2CG8A 4GVBA 3B54A 2NREA 3AA2A 1TKZB 2CPYA 2Y8YA 4LF9K 2V9WA 5J1NA 3WXMB 3V81B 1KVIA 4ED8A 3HVTB 1RT4A 4NO7A 3MD3A 1N34K 2DR8A 1RAIB 5B8HA 1CZ9A 4JV5J 3KG4A 4C7QA 4JI6F 3SBTA 3GQCA 3OS2A 4EP4A 3QERA 1JLGA 3KK7A 2MLXA 3GP9A 4O4RA 2N82B 3AVBA 1CXUA 4C1NK 5E84A 3GIIA 1RAEB 2DRDA 1V4TA 3BYRA 2ASMA 4YOUA 4E2FB 2B7BB 2VFRA 1TL5A 2D1CA 4MLHA 1T05A 2ZE2B 1EO1A 3L2RA 2DNQA 4KHQA 4KR0B 4DPWA 3R5CA 3OD2A 2B5JB 4DPYA 1UCNA 3GR0A 4CJWA 4B1ZA 1IQTA 4RBTA 4H5NA 2XI3A 4FVMA 2QC3A 5HRSA 4DLGA 1R8CA 4E7JA 5H9FK 3HHDA 3ZZPA 4DI6A 3HJVA 2AA4A 3OT9A 2VYPA 3QGHA 4IR9A 4IWVA 1YG0A 5JICA 3AVJA 2QGFB 4TLQA 3D2EB 5KOWA 2Y1IA 3MOJB 3R8YA 3MFHA 2IM3A 5L8RC 4ZP6A 2FUG9 3BQ0A 2WTFA 1JIHA 3NGRA 1VRUB 3QJPA 3OV7A 3VAIA 1D4XA 4UY8O 2O67A 3Q89A 3I82A 4OGEA 2A2DA 3QRRA 4DR7J 3K5NA 4CBXA 5CD4A 4X64J 3LP0A 2EVZA 5D3GB 1C4AA 3IA0A 2DT9A 2AX1A 3PX6A 5HJYA 3HI9A 3BZCA 3U3GA 2FC9A 4ILHA 3V6DA 2YXLA 1OYDA 4OJ3A 1EAYC 3C15A 4IJAA 2G8KA 2DFHA 2XZTB 3P49B 2DIUA 2P9NA 1TVRB 3ZZOA 1I94J 3C7NB 5IOLA 3SLCA 4JV2A 5KT6A 1FKOA 3CO9A 2L9NA 4DTXA 4W5OA 4OO1J 3J7YU 4KH0B 4PUOA 4ED4A 5TKWA 1AT1B 3K57A 2FZKB 3R8EA 1NEEA 3SJJA 1C0GA 2PMZD 5T14A 1FEHA 4NXMK 2MZQA 3DOKB 2E1CA 1HWLA 2GCFA 1KDNA 4OIXA 1YJ9N 5B08A 1PC5A 5AE3A 4ENOA 5AJ3J 5LL6d 2J76E 4TU7A 2IDEA 1HQUB 2P9SB 4FJHA 1BLUA 3C6AA 3ZSZA 1YXQA 3QQCD 4CO1A 2EC2A 3F0NA 1NJWA 5LSLA 5ETOA 1SKSA 3R1XA 1YITS 3H4DA 4YFUA 1HJOA 4HHUA 4I68A 4ZLJA 3FQLA 4USMA 3THYA 1V3ZA 5I3PA 2VDHA 3GIKA 4CLWA 3GE1A 3MAAB 2UXBK 1QHTA 1NMEB 3EPGA 4NLWA 1NGGA 4R5PB 1CLFA 2F8HA 3E3XA 2N4DA 1R3NA 3I55S 2YQ0A 4IG3A 4CJTA 3V1QA 3BF4A 2O8CA 4B3OA 4DR3K 3ZSYA 4P75A 4BC2A 3QICA 4A4JA 2Z56B 4DR6K 1BXNA 5A2QY 4JV5K 3GFZA 3Q86A 5IT9O 1YT3A 3ALYA 4NYFA 3O4QA 3RBZA 4YOEA 2HFNA 3JAMO 5C5JA 3MTKA 3M4XA 1A9NB 1IN0A 2XG8A 3H08A 1N33J 1Y5NB 1PBUA 4F9OA 2JWNA 4ETZA 1FTCA 1Z2ZA 2KZZA 1FJEB 1WG4A 4DV2K 1BO5O 2NPIA 5KFUA 1U2VA 1CS4B 1S0NA 4EO8A 3QT8A 4AM6A 1WAJA 5DQIA 3CB4A 2OH2A 2Z30B 1HBNB 4DV6J 2CQ2A 3CNQP 2DNPA 3VQPA 2DR5A 3RSEA 1VRTA 5GADI 3C14B 1J53A 4USHA 3CGIA 5EWFA 1BL3A 4JI1F 2O1PA 4ALZA 2E66A 3PFOA 2IC3A 4KTWA 1QAYA 1VQKS 3CC7N 1V4SA 5LMNF 3NF7A 4R0JA 5AQGA 4DFKA 1S99A 2DFEA 1Q78A 5KT2A 3DOKA 4AD6A 2B9EA 4CH0S 4DV3K 2RRNA 3D2FA 4DMNA 4IO9L 1R59O 3EPIA 4KHSA 3RBXA 4I6AA 3MCAB 2V63A 3OTEA 4ZN1A 3GG0A 1JLQA 1H1VA 4IYQA 3VA0A 1QE1B 3ATVA 1B3TA 2V0NA 4IOCL 2ACYA 4LFAK 2BKPA 3J7AP 2YNFA 4CO4A 4LRDA 4WYBA 4YB1P 1OO0B 1YBAA 2V52B 4WFAL 1M90O 3MD1A 2PA8D 4P72A 4WYWA 1X9WA 3LPUA 2V4JA 4KAIA 1WI8A 2ASPA 1IR0A 3M6XA 3PJXA 2RKIA 1RAHB 5CY4A 5DZ6A 2CQ0A 2XO7A 3CCRS 4UY85 2J6SA 3DWLA 5J1PA 3M8SA 4QS7A 3TVZA 2DCUB 3V9SA 4O55A 3MK6A 4LSLB 3NXZA 3ILIA 4FKXA 3GLJA 2Q31A 1B0TA 5DETA 1D9DA 3L8BA 4HUGA 1RZMA 2X1FA 2FHJA 3G8TA 3UDLA 3BPSP 3J7YP 5G0RA 3RRHA 4FN5A 1Y97A 3ELHA 2O8EA 2XLKA 3N5FA 1TK8A 2YNHA 2RDIA 1WTBA 4K42A 3LWLA 1WDDA 1XERA 2CQ4A 1NHUA 3CJRA 4RWTA 4Q2LA 3JYTA 3NMRA 3PIOL 4JI7F 3CJ4A 3CJKA 1MA9B 4B1VA 4CZLA 2ADCA 2EPIA 4B3OB 2ZE2A 5AJ3F 2L3MA 2O66A 3QSIA 4MH8A 3E8OA 4FVCA 4X4TA 5JVHQ 4ZP8A 1IKVB 4LFCK 2DNMA 3BR8A 2BUNA 2WC9A 1ZM2A 2DGUA 4ZPWR 3KZBA 4UOFA 1LV5A 5AQFA 4G6VB 2AWZA 2FHJD 3MFIA 3AD9C 4X65K 1FK9B 1SVDA 1NKEA 3KUHA 1XNQF 2FDNA 4M3UA 4LUBA 1PSDA 1J27A 3C2PA 1EXQA 1WOSA 4OPKA 1K73O 2CZVC 3I56S 2P9PA 2H5IB 4FYWB 1IBCB 1TELA 4PG8A 4K7QA 1WF1A 3BJYA 1K9MO 1O1WA 2JWKA 4NLQA 1VIOA 1I6JA 2D9OA 4B3RF 1DLOA 3O9SA 3M1VA 4KHRA 2ZH4A 4K43A 1RISA 1SPBP 1SKWA 5M2UA 1S72N 1F3VA 3ULEB 1OKJA 4Y28C 5BR8F 2OTJN 3ITHB 2VOOA 3UPFA 1RTIA 2DNYA 4FXDA 1P8ZA 1T9UA 4TSXA 2IAJB 3ZEUA 4OYIA 4TNOA 3PJWA 3IM9A 3I0RB 4M1KA 2HHHF 1S1XA 1I51B 1XMOK 4ZCIA 2QFIA 1LKZA 3JTNA 3J7YI 3EXCX 4U7CA 3NOGA 4DMZA 3SDEA 1D09B 1LCUA 5D3GA 4YDUC 1NSKL 3AAPA 5IQ6A 3CVKA 3MUVP 2Q2RA 5EN1A 4CJLA 2D3ZA 3LDQA 1ZYQA 3QIPA 2QTWA 2RRBA 4X2BA 2XMKA 1X4AA 3UCGA 2R9LA 4EZ9A 1LWEB 1H7XA 2QA2A 3LF0A 4Y6IA 4E1JA 3CD5A 3TSUA 3C6UB 4PXBA 3CHWA 3R9PA 2GA7A 1VSJA 4C23A 4PRFA 1FESA 3OVAA 1KOHA 1WELA 4DSJA 4ZVPB 5DM6L 1NK8A 3H46O 1OYEA 2F63A 3MN9A 1JKHB 3EX7B 5AXMA 2V2KA 3NFAA 3MUTP 4L73A 1NB7A 1NAQA 5JMVA 2RSQA 3CC2S 3O1LA 2ZZTA 3CO0P 5DRKA 2EHGA 5AE1A 2UZAA 5GMEA 4ZVFA 1U26A 4PG5A 4PG4A 2OGUA 1Q1KA 1QVGR 1MW7A 2YWHA 4CJPA 2AMCB 4MO4A 3A5OC 1YVUA 5A8RA 3SI6A 3T9NA 1NGHA 4M3XA 3V9ZA 1HWIA 1QUPA 2F9TA 2HMPA 5GINA 3DMJA 2MKSA 2GMJA 2WZ1A 4CJ5A 3D0PA 1PILA 3WIVA 4KH4A 4ZIWA 4RNOA 3MPYA 1EZZB 4LFBJ 4DU7A 5CZXA 1S0VA 3GE9A 1EX4A 2ZZMA 2IPOB 4LQ9A 1JK9B 4X64K 2XSFA 1GOAA 1NK5A 4DUZK 4IRCA 3IM8A 2CPZA 1VQ6N 1O5JA 4QWBA 3ZFVA 2F1FA 2BX6A 4ZVRB 4M42A 2NUHA 2D3UA 1GXTA 4X4NA 3UDEA 2W7PA 3K5OA 3ID6A 4JKGB 4FM2A 3CJ7A 5F0UA 3MM5B 4MDBA 5AQHA 4NASA 2C3YA 3DLBA 5J2QB 4X66F 3DXSX 4UUWA 3N5BA 2QV6A 4DPUA 4B3SK 2EKNA 2ZWOA 3OTOF 3BYPA 4QOZB 2VQEJ 2C2KB 4U67Q 4FS2A 2NS1B 5F3ZA 4DV5J 4Y2MA 2FJWA 2YHYA 1RWXB 4N5SA 3OL7A 4WPAA 5KFTA 4QR1A 1OQ3A 2IAJA 4K0KJ 2BQ3A 3VV2B 2HLUA 1Q86O 2DNOA 1J54A 1NJXA 2ZUGA 3Q8QB 4RU2A 3FCWA 1BY9A 5B0EA 1ROFA 3HHNB 3LO3A 1WHVA 5M1QA 2J0SD 1F9HA 3UKUB 1SKRA 2XY8A 3SK3A 2VJUA 1T7PA 3WXIA 5JXSA 3ILLA 1U0SA 2HHSA 2XI2A 5C24B 1GX6A 1R31A 2HBKA 3J80O 2VD3A 2DHXA 4B9LA 3ETMA 4IJNA 2IY5B 1WC0A 3VZHA 4DB3A 1GT8A 1BQMB 1ATRA 4LF9J 2A42A 4USUA 4U7BA 1IBMJ 3TP2A 2AYBA 2XRIA 1HIYA 4QIWD 4WXOA 4OZLA 3JQJA 2DJWA 1GXLA 2HPUA 2ZBIA 2FGOA 2PFUA 2HNYB 2ZVSA 3W62A 4OKEA 1FE0A 4LF7J 4MDAA 4G1IA 3H8YA 3K2YA 3A4TA 3E2EA 4MK7A 2C1EB 3VAHA 1WTFA 4H5RA 3MEEB 5EDWA 2IM0A 1XBWA 3E9OA 3VGKA 4ECUA 4QS8A 5HSPA 1N54B 3KUEA 2YNGB 2LCWA 4QCLA 1J5EF 3L3UA 1CQNA 3D6FB 2J9CA 3BR9A 2EFPA 2V7YA 2IDOA 3CYMA 3EKSA 1IBLK 2IIRA 2UVWA 2FBXA 1S6UA 4CM0A 8ATCB 5F8JA 3L7PA 3GV8B 3K8WA 2OANA 3L3CA 4CO5A 3CQ8A 2G8HA 2FGCA 1O0PA 1J5OA 2H48B 4DHYA 2YWWA 3CCQN 3T9ZA 2FTRA 3IBFB 4M5MA 3OJSA 2DH7A 3AH6A 4ES2A 3CMEN 4AM7A 4R25A 4ECZA 3TR5A 3EYZA 4DV6K 3P45B 4LRFA 5DGBA 2XLJA 3F44A 3G6XA 3EJMA 3UFCX 1WC5A 1U8WA 3MMCB 4V1Ak 3CJ2A 1DT9A 5JS2A 2HGLA 1YRXA 2RJZA 4A5BA 1M0SA 1RBSA 3GR1A 4MT1A 4CI0B 2CRLA 2HWHA 2BJEA 2OO4A 3PFEA 2NXJA 4P7TA 4ZVGA 4J9SA 3CCLN 5K5MA 2MKIA 2BM0A 4ID5B 2VKRA 2DGQA 3GJRB 3QEWA 2IA0A 1EKEA 3FE1A 1Y10A 4BGAA 4C0OC 3MTJA 3MX2A 3WEEA 4RNHA 3IG1A 4KJIA 3UN2A 5IZHA 1NPKA 3KKFA 4P71A 4F26A 1U0HA 2JEGA 4DQ8A 1MN9A 4B3MF 2ZUAA 1YRTA 4PZVA 3MDFA 5LMNK 2WVEA 1XC3A 1ZZFA 2ZFHA 3QGPA 4DSIA 1NM1A 1M5HA 4KY3A 3AQPA 3R7BB 4JD2A 4UOGA 3ZSWA 2XM3A 3VQ5A 4FPIA 5AQUA 3RWUA 3FEYB 5LJ3Y 4DN9A 3CJAA 1PJ5A 5C15A 3IS9B 3MEEA 1WC6A 2PA3A 3CCVS 3MM7B 4OYPA 1ZXOA 1SBRA 1Q82T 4I6MA 3NCQA 2JHEA 3K0JA 3OYBA 3N79A 1F1BB 2WSFC 1UZDA 1HBMA 3WC2A 3IG1B 2QK9A 4ZCKA 4YY3F 1G3OA 5E3RA 3RZAA 5A6WA 4DG1A 2BACA 2DFFA 5SUHA 4B3SF 1NNDA 1N32J 3FBEA 4MFBB 1HKBA 1F6TA 3RG6A 3BS9A 2NXEA 1RWMB 3HHLD 4K4XA 3Q2SC 3CSKA 1N32K 3VEYA 3VEVA 4NA1A 2IHR1 3M6WA 2IIHA 3A5MC 5KFBA 4EEYA 2FVRA 2J5AA 2EK6A 1NLKL 2B7CB 4CM2A 1FRIA 4M3ZA 3FZBA 2HK2A 4HLBA 1DGKN 3I9V9 2HRTA 4O0NA 3G2XA 3PHEA 2DITA 3HT0A 3E51A 2C2MB 5ETKA 4M8LA 2F7TA 3TX0A 3VGTA 3BO2A 1K73T 1HQ2A 5KFDA 4H03B 3MR2A 3F73A 2FVPA 3R27A 3UD4P 4LD0A 5JS1A 2XZDB 1U8SA 3O3HA 1WJ9A 2KFZA 3VEWA 5M1FA 4DV1K 2W2PP 4YHHJ 2E5GA 1QHAA 1SC6A 1BU6O 1PJ6A 2KYZA 4MKYA 2YX4A 3GIRA 2HSTA 3MMAB 1I39A 2HNZB 3SQOP 3JSRA 4RLEA 1HMVA 1HNVB 4JI3F 3B6PA 4WKRA 4WBFA 4ZTJA 2UUCK 3GFYA 2QYCA 3EUNA 2YKMB 3L7OA 4NXMF 3T7ZA 1SJ4P 4O3OA 4H4KC 1TKXA 3DHXA 2NCKL 2EK1A 2YWFA 2F3JA 2C2RA 3RGIA 2GWKA 4WZMA 4ID1A 4FJKA 3VQAA 2ZWPA 1S6OA 4YORA 2GO9A 4DR1J 1VSHA 2JRSA 3FBBA 3GTYX 4DL4A 1YGYA 3G0ZA 2I2YA 3M30A 3HP6A 3UKRA 3V9WA 3TX8A 4CIGA 1YAGA 1PKUA 4ZVHA 3A0IX 1IBLF 3LP2B 2XMTA 2VPYB 3AVMA 3VF6A 1QZ5A 2FJEB 2Q0RA 2AU0A 3G6YA 1OPZA 2H65B 4KT0C 3JB9k 3THXA 2HWTA 3P39A 1YJ9S 4CJEA 2EG2A 4DZ6A 2YHWA 1NGJA 4CTAA 2WBNA 3BGRB 4CJSA 2ALYB 4TLRA 4OZJA 2E1PA 2KHDA 3RJMB 3MMJA 2XHWA 2LXIA 2GEMA 1WSVA 1VQ9S 3FQKA 4QYZJ 2F4VJ 3MMBA 1LNQA 1Y00A 4KO0A 4AE5A 3HD1A 1NSQA 1TU0B 1N5TA 2ROPA 3RW7A 5AQMA 5D4PA 5FROA 4IQXA 3MR3A 4KQZA 1YRUA 4IR1A 1S1WA 3SIPB 2ZHAA 3KWMA 2G1DA 2FBTA 5DDQC 3CJBA 3VGSA 5M1OA 3BZKA 4Y3CA 1CG2A 4TYAA 3HP9A 5K14B 3CCSS 2LQ8A 2XHCA 4AH9A 1LK5A 2XWXA 1WB9A 2NQPA 1ZZNA 1R6YA 5H9EK 2B4JA 3IFEA 1KOOA 3I31A 1U2VB 4JK7A 3R3LA 1XR6A 2C2ZB 3MM7A 3Q8YA 1WSIA 1HBUB 4K8ZA 1MN7A 4CO2A 3HSJA 2AJ4A 1S77D 4O4GA 5A8KB 3M7VA 3DJCA 4AHVA 4IH7A 4UZBA 4DX5A 2CPEA 4HHHA 3VVUA 4NL5A 3Q0AA 4BR7A 1L3KA 3T5JA 1KKHA 5A8RB 3O1WA 4BRFA 1IR2A 3POTA 3D7SB 4EMDA 3UN3A 1PBAA 3BQ2A 3EEQA 4I4BA 2CPIA 4RJVA 2ZHBA 1ATSA 4K2JA 3KLEB 3EDRB 4DTNA 5LY3A 2BEFA 3OTBA 2LECA 3QFHA 2R2SA 3QWUA 1RBAA 4AQYK 4BRCA 1N48A 3SI8A 1WEXA 1H2VZ 4XO0A 2KJWA 3FEXB 5THWA 3CD6S 2VBZA 2GNKA 2I38A 2QE5A 3VOVA 4JI7J 2C3OA 4BDZA 1T0TV 1HNXJ 3CCWA 3CJ3A 4KB0A 3LUYA 2W8LA 3N6NA 3H90A 3B6OA 3AAWB 3CCRN 2E4LA 3O4NA 5C7PA 1WC3A 1VIXA 2Q36A 2B3TB 3UQSA 4DPOA 1CVJA 4CD3A 5KRSA 4A59A 1RB0A 3UKRB 4IFVA 2MJNA 4FW1A 2VFTA 1J6ZA 2ZGYA 2FLPA 1IQZA 4N8NA 2QA1A 1IKWB 4K4UA 2Y9HA 3NG8A 3NH1A 5IM0A 3D6TB 4LF6F 4PA1A 4BC5A 1V3RA 4ANEA 2CJXB 1XNRF 4BCAA 1VCTA 2GVDA 1TYQB 4Z4CA 3LWMA 1VFJA 3AA3A 4LF8J 3C15B 2QWMA 4DTRA 3BGRA 5LSOA 1HI0P 4CIFA 1VLYA 1XHXA 4RW7B 3C7NA 4OX7A 1FT8A 4IZ9A 1JXBA 5A0YB 1FNXH 2WW8A 3W64A 2PFFB 4GV6A 3SUPA 3N9UC 5T7LA 1S79A 3M05A 2OPSA 4FLUA 4ZN3A 2V4QA 3G8QA 2NSBA 1RT5A 2R7QA 3CQXA 2RQMA 1BWEA 3TSQA 1VRUA 3DOLA 1SC4B 5IT4A 3OYDA 5HBMA 1LWCB 3U7JA 3EZUA 4WE1A 3CPWR 4C8ZA 1BHNA 5HMYA 1RK8A 3AHPA 1KHWA 2BM1A 4F4WA 3FDSA 4QIVA 3ZO7A 4E89A 2E9RX 1FXRA 3PACA 1OH5A 2L08A 5HAOA 4ZCMA 4PKHA 3THPA 3DGPA 4HUEA 1KVBA 3ENAA 4NOHA 1UW9A 3CUNA 1U6ZA 3FKBA 4G1PA 3W5ZA 1KLMA 1N4LA 5ETTA 2RUGA 5E5NA 2A40A 3BSAA 3ZEUB 1H74A 2A41A 3TUPA 2HEKA 3QLHA 5ELZA 4RG8A 1VQ5S 1VI7A 1CPZA 2BABA 4UTGA 5AQWA 1ATNA 4TKTA 4WCEQ 3A3OB 2VODA 4CHPA 3CE8A 5KFXA 2YPYA 2FIUA 3A8IA 1BA0A 2E5LK 3NS7B 4LQ3A 2EFQA 4NLRA 4UZCA 4NB4A 4PWDB 1WLJA 2E2OA 4FYVB 5KGXA 2IC3B 1GEHA 1ZM4A 4K41A 1RGVA 3CCSN 3CCUS 5H9FJ 2RPIA 2O8DB 3FCHA 2R7RA 2ASLA 2V8VA 1BQNA 2OMLA 4EUVA 4RUCA 5SZTA 1V5VA 1MU2A 5F8GA 1S4FA 4CNZA 4FKYA 3QO9B 3D68A 1UW4A 1ZPWX 2MY8A 4KKOB 2CQDA 1D0EA 3BGLA 3OYFA 4JV1A 2HW3A 3DXBA 3QDKA 3H40A 3HJFA 2V9KA 3RBDA 2YHBA 3NHGA 3QNNA 3KDNA 1PG5B 3I55N 1PYSB 4ECVA 2CWXA 2HNDA 2DGOA 3OJUA 2V34A 4FBTA 4I9LA 3I0SA 5BXIA 2M88A 1YDLA 5DQHA 1L5UA 1MROA 5C2DA 4IRKA 2C2DA 2FJDB 2D0AA 3DGVA 4LF5J 2AZ1A 3SZ2A 1XMQF 4ZPVR 1F21A 2MQMA 4ZVTB 2WB4A 1TUWA 1FVSA 3D0GE 2JJ4D 3MN5A 4X65J 2QA4N 2FPHX 3TEGA 5DZ7A 2I5JB 4FLZA 1KQFB 2V2VA 2DTUA 2UXCF 3JSMA 3J7A1 5AXKA 3CCJS 4H0XB 3K7RA 3BGFA 1AFJA 3MWTA 2D3O1 5KQ8A 5HP1B 5HVGA 2VWBA 4E3SA 5F8LA 2WCXA 4YOYA 4GRSA 2BV3A 2GJFA 4LBIA 3L2VA 3THTA 4NLXA 1YJWN 1D8YA 4DSFA 4H0OA 4NZ7A 3VQCA 3OLAA 3ILJA 3RTVA 5M2RA 1FERA 2W1BA 2G8UA 1T02A 3L0QA 1L3TA 5K20B 4LF6J 4XTTA 4G65A 4YB7A 3RUBL 4W5RA 2HMIA 3V1OA 2LXFA 5SWMA 2NLWA 2WRMA 5CHIA 4NZ6A 3MWPA 2BJ3A 5LSRA 4JUZA 2VG7B 1U25A 2R3VA 1U1OA 2QLXA 3QBWA 1XNRK 2JSXA 1HNXK 2GHWA 1RBVA 4MIBA 2IA6A 3BDEA 1OMSA 2EI5A 4KAZA 1S22A 2NRZA 4EU0A 2Z57B 2KQ2A 4DLEA 1KNZA 2HF4A 1NZ8A 2G9OA 4CNYA 5KFLA 5D4LA 3ENOA 4HCCA 1BDGA 1WG1A 2HHVA 4HYKA 2Z1HA 1REVA 2ZJRL 3HT3A 4KGKA 4LFCF 2Z58B 1NSAA 3AJ2A 4A57A 4TU8A 3SQGA 4A8OA 4RW8B 4CFCA 3RYLA 4QW9A 5CYQB 1HNZF 3C6HA 3MCMA 1GMWA 2WSEC 1F0XA 5C24A 3ZTQA 4AL7A 3NGIA 1UTAA 3D7EO 4LF7K 3PV8A 2Z1IA 4HHJA 4IG3B 4CHQA 2PGCA 1FI4A 2DPIA 5J2MB 2RDJA 3VQSA 5J2PB 3NF6A 1MROB 1NDKA 2ZM6J 3BKTA 3ZSOA 1SIZA 3DLEA 3RSEB 3TQ1A 1WN7A 4KHUA 3RBEA 4JHDA 4ITSA 2G8IA 5KQDA 3BB5A 3DM2A 4KH5A 3AOCA 5IWAJ 1DZ5A 2GV1A 4FVUA 2R7WA 5HO4A 1B64A 1GLJO 4RR5A 1XMOJ 4EI2A 1CC8A 1RFQA 4OQJA 1S5JA 2H3GX 3QSYB 1LW2A 4OHXA 3GZ7A 5KFIA 2EC0A 1U49A 2IMWP 4I64A 2WFBA 4HTUA 3HI0A 2VA2A 4O8UA 1JX4A 4Q8EA 2FXUA 4DQSA 3L95X 3JXUA 4C97A 2KTQA 1XJWB 4PYDA 3HVRA 2E1RA 4DUZF 2ZJPL 3FZMA 4OX9F 4DV0J 1IKVA 1ZOTA 1OSDA 1SV5A 1S1XB 3D2WA 1QQNA 1VBXA 2HHHK 4TY8B 3NCIA 1JJ4A 1VQNS 3HULA 2WHOA 1KD1O 4R8UB 4PYAA 1VQOS 3OFHA 4QIEA 4OJHA 4MMOA 1YVFA 1FWPA 1X4DA 5T7LB 2HFUA 3VMFB 3UIQA 1YJWS 3CETA 4I2QA 1FKAF 3LPYA 3BO4A 3AA4A 3D1QA 4DV3J 1RI7A 2AYEA 2B9YA 4X62K 4AL5A 4CGIA 5JUMA 2A6OA 4J9RA 2XMAA 3TO8A 2DRAA 2VGMA 3AARA 3CDBA 1HWKA 2XQCA 4Q0BA 2NRRA 3MUMP 3A5NC 3QNOA 1JKHA 4ILGB 3GWCA 3OUYB 1X5PA 1KC8O 2OFGX 1TMMA 4EBCA 3JS6A 1YWXA 2MQPA 2IVFB 3RRGA 3M2UB 2E5IA 2VFSA 1RWWB 1XMBA 1PCAA 4URQU 5JVGQ 3CCEN 2VQFK 4X65F 4AFFA 4DV4F 3RAXA 4HH1A 4YR2A 4FJMA 2R42A 4CZIA 4CJVA 1O13A 2PMWA 3AB4B 1C1CB 2ZBRA 4HTIA 1VQ9N 2VPWB 3H5UA 3AOBA 4C3MA 5E3PA 4NMLA 3GBTA 2BTFA 1SJ1A 3BPDA 5CHCB 3GG4A 4ANCA 3OYHA 3M2UA 3RMBA 1HHSA 4ES3A 4ZOSA 2Z2LA 2QT7A 1ZBIA 4HVJA 2BVZA 3GB0A 3RRKA 1BA1A 2EFOA 2UV8A 2P2CB 2OPQB 2VG5A 3G6ES 2NRTA 3H45C 3BREA 2JWLA 1AUDA 2RUSA 2HBLA 2D3OR 1SL0A 5KFWA 4WFZA 4DTSA 4YOXA 3S8SA 2CGKA 2M7SA 3LAMA 4DQRA 2NXCA 4BC4A 4ZLNA 3HSTB 4KGMA 4YEAA 4TQRA 1NZAA 3BKFA 3NOCA 4K0KK 4IFEA 2BBEA 2J9EA 1GOCA 1NGEA 3KJVB 4HTJA 2FVCA 1VQON 5DDPC 5D0EA 4C6AA 1YITN 4DTPA 3QYYA 1CXQA 4LFCJ 4OLOA 3BSCA 3M2VB 3KK2B 3AJ1A 2Y3YA 2YX7A 4B1UB 4JOUA 3LDLA 1NBWA 3K5PA 2HBJA 4YMEA 4FO0A 3KLEA 2MZJA 3SSRA 2ADBA 3LDNA 3SAHA 3M8QA 3M2RA 2AHOB 3HSGA 5F8HA 1GTEA 3EICA 2IM1A 4OZ0A 1B7FA 3ZC4A 4DR3J 1QJHA 5D77A 3GV5B 4DOZA 2HSEB 2AIRB 1G6BA 3Q8SB 1HKCA 4JI4K 2P9EA 3H5YA 3OBWA 1EETA 4BRLA 2G8WA 1OY8A 3ZTSA 2UVUA 2O4IA 1C6VA 1TUYA 6FD1A 3DLRA 2LQ5A 4EBDA 1DEJA 5IWAF 3SFGA 2ZHOA 1WOOA 3DC2A 2MSTA 4ZJLA 2RMLA 4DUYK 3CCQS 5IWAK 1Y3JA 4OHWA 4LH5A 1DTTB 2UUTA 1TV6B 1Q16B 4BREA 4CYUB 3CULA 2OP5A 2DY4A 1S1UB 2E7WA 3GPAA 5IT0A 2G4BA 4K5SA 1E3MA 2C2NA 1AUSL 1SKUB 1JLAA 4B9UA 1S0MA 5K8NA 4KB1A 3FGUA 4K4VA 5A76A 3JYTB 2ATLA 4L8RB 4PKDB 2V8PA 4FJ8A 4KGZB 4NZ0A 1IV0A 3W61A 1OH6A 2LEAA 3CF5Q 4IXCA 1SCJB 5L1KA 2CPFA 4DQPA 3C8YA 2QA4S 4LSLA 4XPEA 3MM6B 2K8GA 2ZZNA 1HLUA 4XH4A 1ZBSA 1S1VA 4C2MA 2ZF5O 4EP5A 3SMZA 2XY5A 1A5WA 2W42A 4FJ9A 3EZWA 1QS4A 3RB6A 4M5DA 1RT3A 2QSFA 4BR0A 3PYDA 2NRVA 3SCKE 4FSVA 2DGSA 3UDCA 4DR1K 3CT9A 3P31A 2Z2ZA 2ZNYA 4GVEA 4FF3A 3SDEB 5JJBA 2VV5A 3AVKA 2YNFB 2FB0A 3SCIE 4BG9A 4BRGA 2RF2A 2ETJA 2OAUA 1JCFA 2MHEA 3OXFA 2JEJA 2XYGB 4CJFA 2BE2A 5HROA 4J9KA 4K8XA 4DR4F 3KLFB 3ZZUA 1C0TA 3VAFA 2XS7A 4JAXA 2BUPA 4O3RA 1BMQB 2V68A 3TAPA 1NPPA 3WQUA 2HQDA 2LA4A 3NS5A 1YJUA 1LK7A 1RT3B 3DCAA 5FRMA 3TAMB 4OPJA 3FBFA 1S6QA 5B0BA 2XEXA 3BBCA 4WWSA 1TL1A 3H2VE 3MN6A 1KQSM 3CIMA 1JJCB 1FTRA 2HQGA 1FRHA 5C25A 2CWKA 1B0VA 1NGBA 4JKHA 2D7SA 2YKMA 5LMUJ 2LQ9A 2GW8A 2XS2A 3TOQA 4ISEA 3MR5A 2EWHA 3P8BB 2QTDA 2KKHA 5GIOA 5C0YA 4LREA 3MMAA 4KYZA 1NHKL 3QETA 3KD1E 2XS5A 3UNYA 4P74A 2O3DA 4FM1A 2ZOFA 3CMAS 5I9EB 1RT2B 2W9BA 3K9JA 2DHGA 4DQIA 2DEJA 1YHQN 1J5OB 4HCBA 5KFYA 3KLFA 2P9NB 1Z05A 3QEPA 2FJAB 3TTCA 1M1HA 1X3NA 2J9DA 4J5OA 2PE8A 2P9IA 4LFAF 1HPZB 1RT1A 4F3MA 1QSYA 2D74B 5B0AA 2X78A 1UPPA 4CI6A 5I42B 3DRRB 1SV5B 4AXIA 4GKKJ 4JKFA 2Z1GA 3O3FA 5L1JA 2V2QA 2DNZA 5B0FA 4A2BA 4CIOA 2HVEA 4OZNA 4O5FA 2CJQA 3KMSA 2RQCA 2KZMA 3E01B 4X4RA 1C1BB 4WFNL 5BRDA 1RLDA 1S9GB 1EJ7L 5DM7Q 2R2TA 4RW6A 4OX8A 4Y2CA 2AF6A 4P73A 1WI6A 2JVRA 1E6VA 4K25A 1T8EA 3HHLC 4NYPA 2WBMA 1Y11A 3THVA 1FK9A 1NMDA 4AILC 2KVQE 3SPZA 5BR8J 1UMJA 1LFPA 4LRCA 1TFYA 2L48A 2ALZA 4MKVA 3QZ8A 5K14A 2BYCA 1RILA 1VQ6S 1T9VA 3T41A 5T7BA 3LM2A 4YOWA 2P9KB 3SJHA 1FW6A 4DS4A 1X7VA 2W2MP 3B8AX 1Y4ZB 2CAJA 4CFBA 3IDHA 2A5XA 5MLCV 5CYQA 2IDLA 4B3TF 2KYXA 5BRFA 2WSCC 3IKMA 3H25A 1LOTB 3RMAA 3VQ7A 3DDKA 4I56A 1R8HA 1WOPA 3PR5B 1TAQA 3C94A 5LJWA 3MHYA 2BQUA 2AJ0A 1WBBA 4RUAA 2ZEJA 3CQYA 3FZLA 4Y2AA 3THYB 4I1TA 2HOEA 4YN3B 3M8ZA 3ZTPA 2GTDA 4IEEA 4F67A 1UVKA 2J6UA 3KG1A 1UPMB 5HQ8A 2AP6A 5FPMA 4CJ3A 2L9WA 3W9JA 2JEIA 1RTJA 2MQNA 3DGPB 3IR6B 2GX9A 4GKJK 1Q0NA 1RDAA 1DKGD 2VG6A 1KVCA 4L6V3 3PKMA 4MJKA 2NNWA 2GUIA 2K7KA 5GMDA 3CG7A 3LP0B 3MZIA 1Q82O 2KHCA 5IV4A 3TJAA 3G82B 4URGA 4FLYA 1FDBA 3M30B 1H2TZ 2HZAA 3HZ6A 2H54B 1FX2A 4AT1B 1FJCA 4LH4A 3ZT3A 4B08A 2ZH5A 3DYAB 2UYTA 4YY3K 3GIMA 1YTYA 2XMMA 3F5TA 2LKZA 1JNZB 3GSDA 1TUUA 3O44A 2QKKA 4F0HA 3CDEA 2ZH6A 1KCFA 1R0CB 5CYMB 3L4IA 1WORA 2J8AA 2YV0X 2V8DA 4OLPA 5MAOA 4J2DA 3E01A 4MTPA 3HSZA 5KPZA 3WT0A 5CD4H 4EK2A 5ETRA 3KLIA 1ILYA 3U4LA 4C48A 2CQCA 1IJEB 1SI9A 4HACA 1CEZA 3NMUA 2GO8A 2KXHA 1A5XA 3O9RA 2R8IA 1Q86T 1N0VC 4JI7K 2P8IA 5HANA 1UWBB 5ETQA 4PG6A 2VU5A 3EM1A 4CZGA 5HJXA 3T1YK 2P51A 2BOPA 1RT4B 3ENWA 2GHVC 4BR4A 4CEQA 3TZYA 1FWKA 5FIIA 4A8FA 3L7UA 1U1QA 2VJVA 4AHUA 3KKSA 1TKZA 2Q1NA 3L2WA 1TUVA 4X4OA 3VALA 5I3UA 4BRQA 1T95A 3PUFA 4JI8K 3TAQA 3I5CA 3US5A 1B9DA 3EE8A 4OFZA 1EWRA 2FLOA 3OXLA 1S9EB 3TUZC 2HK3A 4M5IA 4M5HA 3WNGA 2E20A 4YQWA 1N6QB 2RE2A 4IG0A 5F0WA 2AJQA 1S76D 1TKTB 5A8WB 3ENBA 1ZM3A 4F0MA 4Q0BB 3KJVA 5KG1A 2K06A 5TKYA 5AQIA 1F2HA 3UDVA 5GADP 1VBYA 4RL1A 1U2CA 4Q45A 2C28A 2IJRA 3MXMA 2YJEA 4HDHA 2W2NP 4XPCA 1U6FA 2AV5A 2K7JA 1XUPO 5C12A 1UETA 4CGGA 4NLBA 1YKWA 3ET6B 3AVNA 3IMXA 3VTHA 3R2DJ 2CH5A 2JH3A 1T3NA 4YR0A 2MQOA 4K59A 4FJ5A 3ET6A 4UUXA 1X9MA 3CCJN 4WQ4A 2FJXA 1X4GA 2AGOA 2YHAA 5EXWA 2FJBB 2E29A 5IFMA 2MGZA 1IBMF 1DFDA 2XMWA 2DCLA 4QAGA 4DR5F 3PEJA 3QMQA 4JB8B 3K8VA 2ZJRQ 1X4EA 4G3IA 2E2PA 3DFEA 3PO5A 2PT0A 1BIUA 3AD7C 1R8PA 2OA8A 3MM9A 1TKTA 3OVNA 4R0EA 5EVZA 4ES1A 2CH6A 1HQEA 2QWPA 2EBGA 4IBNA 1KVJA 2DNHA 2I1RA 3GYGA 2DH9A 2E7XA 1DARA 1AZSB 4CE9A 5KGWA 3FNNA 1UJ4A 3EVMA 3UW1A 2BKNA 4FYXB 2QMWA 2BJDA 4OI3A 4E1NA 2PAVA 4CEOA 5D6GA 5JVGL 3QGGA 2D0OA 3E9LA 2PIIA 2ZC4A 4F3QA 5FRNA 5KFHA 3AO5A 1VSFA 2QJ3A 5ADXH 4DX8H 4AUKA 4NMXA 1TVRA 3T5LA 3ENQA 4RCHA 4A8KA 3HO1A 3FR0A 4BRAA 1QVFM 2B4UA 2EWSA 3VF2A 4L76A 4P7VA 4Y65A 1S97A 1UOCA 3W2VB 1GK8A 3VESA 1D8ZA 2KN4A 2ABYA 1KONA 1S9FA 1W25A 4B9TA 5AQXA 4LFBK 1U1PA 1JLQB 5KFPA 2OEKA 3AAQA 4DV0F 4OX9J 4U8VA 5L1LA 3RAMA 3MR6A 3MEKA 2WVCA 1VQPS 4CZJA 4Q5VA 3FZHA 1MMLA 2YNGA 1S72S 3IRXB 3DN9A 3T19A 1VQ8S 4JI8J 1NLVA 1N52B 2AEMA