1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibody/dna
molecule keywords Synthetic oligonucleotide template
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
3I5BA 3DDKA 3NGYA 1QE1A 1NHVA 1U04A 3H98A 3K5NA 5KFUA 4CJ3A 5F8JA 1LV5A 4DFJA 4IH7A 2IOCA 3KK1B 1JIHA 3OYNA 4HHTA 4U6PA 1KSPA 5J2NA 4O5BA 4XPEA 3AVGA 4NLUA 2ASDA 3QIDA 3CFPA 2B6AB 2UVVA 4E7JA 1W9HA 3V4IA 3U3YA 1S1TA 5J2PB 5HP1A 4J9KA 2XY5A 1T7PA 2ZD1A 1LWCB 1EXQA 4KFBA 4C8NA 3SQ4A 1K1SA 4CGHA 5HRPA 2HWIA 4IFVB 4FM0A 3FFIB 1A5VA 4DL5A 2F8TA 4OPKA 4KTQA 3GIIA 1JLEB 4CEAA 5DLGA 3OL7A 3KKSA 4ZTFA 3N6LA 4BDPA 4BACA 2E9TA 2WTFA 4MK8A 3SQ1A 3V81B 3KK2A 3KLGB 4PWDA 3FSIA 5F8MA 4O55A 3F9KA 3LAMA 1FKPB 2AWZA 3HPGA 4ID5A 3RMAA 3OY9A 3CJ2A 5KG0A 3T3FA 2I5JA 2GBZA 1TAUA 4DQQA 4ED7A 4RG8A 1RTDA 4Q8EA 2O5DA 4R8UA 3L2UA 2P5GA 1TK5A 1XR6A 4ZHRB 3HP9A 1C1AA 2XGPA 4IR1A 4KHWA 2HMIA 3EPIA 4R5PB 4E1NA 4KHQA 3I5AA 4ZTJA 3UIQA 3LP2B 3PR4A 3T5JA 2D41A 3LPTA 4IRKA 1JLGA 4RW9B 4CFDA 3FRZA 1RT1B 1KTQA 1HMVB 3U6FA 4FBUA 4ZVFA 3AO3A 4QCLA 1SV5A 4QPXA 2FBTA 4EP5A 4IFYB 1S0NA 3OL9A 3PJXA 3QLHA 3HSTB 4CEBA 4K50A 2O4GA 1KLMA 1NKEA 3PHEA 4CJFA 4BE2A 2OPPA 3KIOA 1VSEA 5KT3A 3OL8A 1QE1B 4K4TA 4I2QA 3HHKA 3RB3A 4TQSA 3DLRA 4FLTA 4N47A 2XCAA 3DMJA 4HUEA 1NKCA 1ASUA 3S3MA 3O3HA 1QAIA 4CJPA 3K59A 2XGQA 2AGOA 1VSLA 3V6DA 3MEDA 5KG7A 3V1RA 3KTQA 3E01A 4EO6A 4RW6A 4WE1A 4OKEA 3RB6A 4CF9A 3AVMA 3QESA 1S1TB 5HP1B 4M3XA 3KMSA 4CJLA 3ZSQA 4FJ5A 3HKWA 4DU3A 1RTHA 2YNGA 4FK0A 4X2BA 4M3RA 1VSKA 4CIFA 4FM1A 2I1RA 3CIZA 1LAVA 4B9NA 4PUOA 2WB4A 3HPOA 2FVSA 3PW4A 4AHRA 3KKRA 5KFMA 3VQDA 5FRNA 3KK2B 1D8YA 4EEYA 1IKVB 3KLHA 3PX0A 3BSOA 3VA0A 5KFGA 4KRFA 4ID5B 2HHVA 4KHUA 4TYAA 2BE2A 2YNIA 2I5JB 4EZ6A 3C94A 1TV6B 1RTDB 2G8VA 1SKRA 4R8UB 4DFKA 4URGA 4LSLB 3SQ0A 4ZPDA 1N6QA 4ZPCA 2V0NA 3GYNA 3QEIA 1TKXA 3FDSA 2RPIA 3NF9A 4CGGA 1R0AA 4HCBA 4Z0UA 3PW2A 1HNIA 3TAEA 4Y1CA 4E0DA 3LZJA 1ITGA 1JLGB 1N56A 1BISA 4CEZA 2IM0A 1VSHA 3KLFA 3AA5X 3FQKA 4CGFA 3CDUA 4WXWA 1DTTA 1S49A 3KLIA 4ECRA 4DQRA 1HPZA 2C22A 5I3UA 4RW8A 1RT7A 2OPQB 3ICLA 3QLHB 1T94A 4I2PA 4Y34A 1KLMB 2IAJA 3A2FA 1BGXT 3TANA 2HHTA 4KSEB 3S3OA 4CCHA 4L8RB 2OPPB 4H4MA 1TKZA 2P5OA 1RT5B 4B3OA 1RT4A 4I2QB 2W7OA 3DMJB 3KLEA 4H4OA 2RDJA 2BQUA 4NLSA 2D3UA 4KBIA 4G1QA 1IKYA 5KFRA 4C8MA 1NJXA 3V6DB 3EZUA 3HVTB 3E01B 2ZKUA 3SI8A 3THVA 4RW6B 4B8CA 1U45A 5D3GB 4WE1B 3GV8B 4DL3A 4KHNA 5KFNA 3OVNA 2YV0X 4HUGA 3QGIA 3JSMA 5KGXA 1LWEA 1RTHB 2YNGB 1QTMA 1BI4A 2ILZA 4N5SA 3BSCA 1YVUA 4PUOB 1RNHA 3TARA 3UQSA 5KFQA 3VQ6A 4CJTA 4CHNA 4DF8A 3CG7A 1ZTWA 1BIUA 4FW2A 3HP6A 3QGHA 2BANA 4ED1A 3NGZA 4FJGA 2W9AA 4CHYA 1A5WA 2R8KA 3KD5E 3TAMA 1NK6A 1VRUA 4W5RA 4FJ7A 3UPFA 3LAKA 4FJJA 4EO8A 4K8ZA 2YHAA 1JKHA 2BE2B 3LP1A 5CYQA 1WSGA 3SZ2A 2YNHA 4FZZA 2HHQA 1N6QB 1L3VA 1TAQA 3AVAA 2X78A 4NLOA 1KFDA 1TKXB 2KTQA 1W25A 3C6UA 1R0AB 2BQ3A 3HVWA 1BL3A 3AO1A 1HNIB 3ZSVA 4ECYA 3NL0A 3OYCA 3GV7B 2VG6B 3I0SA 4OGEA 1S9GA 5KRSA 1WAFA 2Q3SA 1QAJA 3KLFB 2ALZA 2OYQA 4DQSA 3NHGA 3M9NB 1DTTB 1TK8A 4FLWA 3KLIB 3AO2A 4F4KA 4QW9A 5I3UB 5KFCA 1ZYQA 1RT7B 1RAJA 4TYBA 3NBPB 4I2PB 3CJ5A 2IAJB 3T5KA 4K8XA 4NLRA 5HRNA 2HHUA 1TKZB 4ECXA 3MEGA 2UUWA 2QK9A 4B3OB 1RT4B 5CYMA 2OPSA 4MK9A 3SJJA 3KLEB 4H4OB 2DFHA 2ITGA 4G1QB 1IKYB 3NFAA 2Z1GA 3HL8A 4FLXA 4CHOA 2JGUA 3CJ4A 2E6LA 2OZSA 4HYKA 2G8IA 4Z4IA 1S9EA 4KREA 3OS2A 4IDKA 4EYIB 3NAEA 1X9WA 2G8UA 3O3GA 3MEEA 3AVJA 2VA2A 5F8GA 3L3VA 2W9BA 1S48A 1SH0A 3JSMB 4LQ9A 1GX5A 1LWEB 1RT6B 3L2QA 4IG3A 4DEZA 1BI4B 4MKAA 1WLJA 4QWAA 3L2WA 1LAWA 4IH6A 3OYMA 1C2PA 1HQUA 4JV2A 2JLEA 4B9UA 3AA3A 2EHGA 4KO0A 3B6PA 2Z1IA 5JS1A 4KB0A 3D5MA 4NLPA 1ZBUA 4NCAA 2BANB 4E7LA 4WXOA 4RNMA 1VSDA 1VRUB 3OYKA 2YKMB 1S0MA 4RNOA 1NKBA 4K4ZA 4Y1DA 1LW2A 3KD1E 1JKHB 3ZSYA 3LP1B 1RDDA 3M8SA 2OZMA 4BE1A 4I9LA 4IOBA 1ZBIA 4NLVA 4AHCA 5KG2A 2YNHB 4BWMA 3HPHA 4DL7A 1ZETA 2GC8A 4ED3A 5C42A 3V9SA 5KFHA 3PW7A 5JUMA 3V6KA 1TL3A 1TVRA 1N4LA 4H54A 5KG4A 4EYHB 3ZT1A 2IM3A 3I0SB 1JL1A 1S9GB 1J54A 2YKNA 4YFUA 1RTIA 3VQQA 2FJWA 4ELVA 5T14A 2IA6A 4QAGA 1VSFA 4DTOA 3HVAA 4FJXA 3CQ8A 2GUIA 2E9RX 3ISND 4KE5A 4O3QA 4CJVA 4DSEA 3CO9A 2OPRA 1TKTB 3MF5A 4O3RA 1TKDA 1NK0A 1SL0A 2R2SA 1RT3A 1A5XA 4DL6A 5KFAA 1GOBA 4ECUA 1KHVA 3DLKA 5CYMB 2OPSB 4CIGA 3AV9A 5KFDA 5DGBA 3V1OA 4CECA 4DTUA 1CSJA 4NRTA 4TXSA 4Z4GA 2EC0A 3RTVA 3Q8PB 1S9EB 3SQ2A 3MEEB 4JUZA 3HO1A 2W9BB 5C5JA 2G8FA 3OLAA 4ZVEA 5EWEA 5HBMA 4IG3B 1NK4A 3QIPB 3OJUA 3NMAA 3SFUA 3H5YA 1TL1A 1HQUB 4O3PA 4KO0B 4ED8A 3TVKA 4E7IA 1X1PA 3QZ8A 4JS5A 4O44A 3PX6A 1VK0A 3IGNA 4EBCA 4R0EA 3K5LA 2NUBA 4WYLA 2OA8A 3MXIA 4AHSA 3G6YA 2BR0A 4CGDA 4NYZA 3PO4A 4J9PA 4DF4A 3HK2A 3OYEA 4NRUA 3MFIA 4ID1A 4DLEA 3TAGA 3QINA 2ASLA 5L1KA 3OS0A 5C42B 4ZP7A 4J9MA 2FVPA 2UUTA 4NLYA 3H08A 1TL3B 4ELUA 5T7BA 3PVXA 1TVRB 4CIEA 4IR9A 3NH1A 5KI6A 3H5SA 1WNEA 4ZVHA 1WN7A 4KB7A 5KFPA 1S1WA 3V9WA 2LSNA 4CF2A 1KRPA 2O4IA 2YKNB 3ZT3A 2DFEA 2FLNA 1RTIB 1RCHA 4ICLA 4K4WA 1JLFA 3L2RA 4JRPA 5DQIA 5FDLA 3H4DA 3Q8RB 3PO5A 4FLVA 4CERA 2XY7A 4KHSA 3MR2A 2OPRB 4Q44A 4F2RA 5KT4A 1RT3B 4KTZA 5KT7A 2C28A 3OL6A 3CM5A 3M9OB 4B9LA 1SUQB 1NK7A 1B9FA 4RNHA 2EX3A 5EWGA 1QHTA 1IM4A 3I5CA 5KRTA 4DTXA 1HJRA 3BGRA 4DS5A 4DSLA 4WYWA 1O1WA 2WONA 3ISNC 3NKYA 5HROA 3AO4A 4CJQA 3NF7A 2HHXA 5CY4A 4MIBA 1ZTTA 4CJKA 1REVA 5HBMB 2E4LA 4DTPA 3DM2A 3TQ1A 2PY5A 3UR0A 4KAZA 4CEOA 2ILYA 2HW3A 4O0JA 1TL1B 3KMQA 5DG9A 1N5YA 2BGGA 4O44B 1LWFA 1CLQA 5J2NB 3QIOA 4NLQA 2D0AA 1RDCA 3DLBA 3I0RA 3V4IB 2A1SA 1BHLA 3CDWA 2ZD1B 4KFBB 1KVAA 3H5XA 4F8RA 3T5LA 3KOAA 3IS9A 2WK4A 2AGQA 4PA1A 4CJSA 3ITHA 5F8LA 4IRDA 2FVQA 5DG8A 4KHMA 1HYZA 1ZBLA 4MIAA 4PWDB 4FJMA 1S1VA 1RT2A 4M41A 1S1WB 3DLHA 4BDYA 2A1RA 5L1JA 2BQRA 4K4VA 3TAQA 1IKXA 4LY7A 1D0EA 4WFYA 4ICLB 2J6UA 4QWEA 1C1CA 1JLFB 4TQRA 3V9ZA 3VQPA 1FKOA 4K4XA 2BDPA 3RMBA 5FDLB 3K57A 1KVBA 1SL1A 1RBUA 5C24A 4KPYA 4CF1A 5EDWA 2RKIA 2KFZA 1XHZA 2HMIB 5KFXA 1VSIA 4DL2A 3LWMA 3G6VA 4M42A 4AHVA 4GC6A 3G86A 5KGWA 2V9WA 1D5AA 2JEGA 4YP3A 3KNAA 2Z1HA 4B9TA 4FBTA 3RBEA 2HNDA 4M3WA 3IG1A 4MH8A 2FJVA 5KG5A 1SV5B 4NLDA 3QEVA 3C6TA 2WONB 1TQLA 1HARA 1WSEA 4FK2A 3V9XA 3MTKA 2ATLA 4NLXA 1REVB 3S9HA 3NGIA 1KHWA 1FK9A 1NK8A 3TABA 4ZPAA 2W8LA 3RAQA 4CHZA 4DLGA 4DFMA 3P83D 3IN5A 3DM2B 3LP3A 4FJNA 1EP4A 3ZSZA 2PZSA 3DOKA 1WSJA 5E41A 3LP0A 4ELTA 1JXLA 3MEDB 3QEWA 1CZ9A 2QKBA 2W9CA 1N5YB 1QSLA 4F3TA 1LWFB 4Q45A 2R8IA 2FVRA 3HXMA 4Z4FA 4E7HA 4J2DA 3I0RB 3OYFA 1YTAA 4NLWA 5KT5A 4OVLA 3NH0A 3NH2A 4I7FA 3QNOA 1NOYA 1NOZA 2J6SA 5KT6A 1KVCA 2VWKA 2XI2A 1U09A 4W5NA 1S6PA 5DMRA 3BQ0A 2BRKA 3CVKA 3EPGA 1U49A 1NJYA 3TWHA 5DQHA 4YR0A 1IO2A 2Y1IA 4NLTA 4O3OA 1S1VB 1EETA 1RILA 3RBDA 3KLHB 5KFBA 5KT2A 3KJVA 5F8HA 2DFFA 1TP7A 4CEQA 2G8WA 4F4XA 1IKWA 4Y2CA 1KLNA 4FW1A 3VQAA 1DLOA 4F3OA 1IKXB 2VWJA 4FM2A 3ZSXA 4Q0BA 1C1CB 2YNIB 1FKOB 4J9SA 3RMDA 1NNDA 4LSNA 3ULDA 3TAFA 3I8DA 1BCMA 4G3IA 4F4ZA 4FZXC 5HRSA 3MFHA 2D0CA 3DLGA 2UVWA 4GVMA 3OLBA 4CJRA 4CE9A 4AH9A 1WAJA 4CJWA 2RKIB 1C0UA 3DLEA 4B8AB 2XWYA 4O4RA 4FS2A 1VSMA 2DTUA 3K5MA 1BQNA 3LANA 5SWMA 4XIUA 3LALA 1YVFA 4JV1A 2HNDB 3IG1B 2JC0A 3MXJA 3M8QA 5L1LA 4TLRA 5CZ1A 4QW8A 4RW4A 4E7KA 3V9UA 1HPZB 1S1UA 2GV9A 4RW8B 3C6TB 4ZP6A 4HCCA 1C0MA 5KFFA 2IC3A 3RB0A 1U48A 1XR5A 4NLGA 4Z4EA 4B08A 4IRCA 4ECSA 4H4MB 2R2RA 3DOLA 3MR3A 4M3UA 2YHBA 2V4RA 1XWLA 4AHTA 3M8RA 1I6JA 2G8HA 3AO5A 4KKOA 1EP4B 4BE0A 3DOKB 3N6MA 4OKKA 2VA3A 1DTQA 3LP0B 4M3TA 2PYJA 5KFWA 4Z4CA 2W9CB 2XC9A 2IM1A 4FLUA 2C2EA 3WNHA 1MU2A 3KHLA 4O3NA 3SUQA 2AX0A 2Y1JA 4K4YA 3TAPA 1QSSA 1RBRA 1JLQA 3K2PA 4I7FB 4CHPA 4H8KA 1CXUA 2CJQA 1S6PB 3V6HA 2V4QA 4GC7A 5L1IA 2ETJA 5FRMA 5I42A 3DRPA 1UOCA 3KK3A 3OYDA 1EETB 2FLPA 3GQCA 1SKSA 3KJVB 4ECVA 1IKWB 3TAMB 5KFZA 1DLOB 4URQU 3S3NA 5JS2A 1G15A 3AVKA 3QZ7A 2ZE2A 2YNFA 4DU1A 3DYAA 3OS1A 2HVHA 5CYQB 1SH2A 3RB4A 4QWCA 4TN2A 3HVRA 4OLBA 1RYRA 4LSNB 4CJUA 4Y2AA 3WNGA 1K1QA 2P1JA 2HVIA 3SV3A 3OYGA 3DLGB 3HM9A 1L5UA 3HYFA 3EY1A 3GILA 4DSFA 3BREA 1C0UB 3QEXA 3DLEB 3C6UB 5CZ2A 3CJ0A 4O0IA 2W8KA 3K5OA 4N76A 3BR9A 4DL4A 1UA1A 2GIRA 4B9MA 4F4YA 3UDLA 4WFXA 1Q9XA 1BQNB 3QO9A 2QE5A 2XI3A 1CZBA 3M8QB 2XY6A 4CEFA 4OL8A 4FJKA 4K4UA 3QNNA 4F4WA 1RBSA 3PJWA 1S1UB 3PW5A 3ZSWA 4ECZA 4KTWA 3QETA 5SZTA 2IC3B 1BCOA 4FS1A 2R8JA 1XHXA 1L3SA 4M3ZA 4W5TA 1GX6A 3BQ2A 1EKEA 3VQ7A 2DY4A 3DOLB 1S0OA 2W7PA 3MEGB 5KFLA 1NJZA 1S10A 1ZBHA 4ED2A 4ZP9A 4CF0A 4KKOB 3OYJA 1Q8IA 2F8EX 3AVBA 4ZHRA 4DTSA 4MQ3A 4B9VA 1DTQB 4MK7A 1IG9A 3OYIA 3G6XA 4IDKB 1MU2B 1I3AA 4CJ4A 1QQCA 4OKJA 5DGAA 1VRTA 3OSNA 3AA2A 5F8IA 1JLQB 1Z26A 4KI4A 2FJXA 3TI0A 1ASVA 3Q8SB 2R8GA 3T19A 2IJNA 5I42B 1XI1A 3KK3B 1D1UA 3SUNA 3SUPA 4CK1A 4E3SA 3ZCMA 4RW7A 2AX1A 1RTJA 4WZMA 4DSJA 3BJYA 4NYFA 1XC9A 5KFTA 4CF8A 4NZ0A 4W5QA 2ZE2B 2YNFB 1LW2B 3DYAB 2KZMA 4LH4A 3KHGA 1OS5A 5EUHA 1S5JA 3CJ3A 1QSYA 4U7CA 3RR8A 3ZT4A 1WNSA 3GIJA 1UA0A 1SH3A 3MXMA 1D9FA 3QEPA 2IMWP 4FJLA 4MFBA 2IBKA 3H4BA 2XRIA 4FJ9A 4O3SA 4DFPA 3CWJA 2WCXA 1D9DA 4BDZA 2VG7A 3G0ZA 3RAXA 3QO9B 3GIMA 3OSPA 3MR6A 3WNFA 4URSA 3OHBA 4ED6A 3SI6A 2JEJA 2RN2A 3WNEA 1BQMA 1IKVA 1JXBA 3BQ1A 4PY5A 1NJWA 2P51A 2UVUA 4IKFA 2X6SA 1F21A 3NDKA 1U47A 1RBVA 3OYBA 4DG1A 1C0TA 3DLKB 1KCFA 4GMJB 4AHUA 2HNZA 1UAXA 1TV6A 4TY9A 4J9LA 2RDIA 1B9DA 4FVMA 3QERA 3NGDA 4LSLA 3VN5A 2RF2A 2GIQA 3VQCA 3IGVA 1HRHA 4OPJA 2G8KA 4IH5A 3B6OA 1J9AA 3OHAA 4WFZA 3K58A 4JLHA 1VRTB 5F8NA 3ZSRA 3T1AA 1JLAA 4RNFA 4FLZA 1U4BA 3VQEA 4O4GA 5J1EA 1T03A 3CFRA 5KG3A 1S1XA 4PQUA 3MECA 3G10A 3V1QA 2OPQA 4OGCA 4J9NA 2VG5A 4YMEA 1Y97A 4XO0A 4RW7B 4FJ8A 1RTJB 3VQSA 4J9RA 3PZPA 1RT5A 5FROA 1W0HA 3DRSA 4HVJA 3CFOA 3QYYA 5DQGA 5F9LA 3HVTA 5J2MA 2KFNA 2FBXA 5D3GA 1EX4A 2OH2A 2IM2A 4LD0A 4MFBB 1S97A 3HJFA 1K6YA 4E1MA 4TY8A 4DTJA 2E6MA 1Z4UA 2VG7B 3KLVA 3MAQA 3SPZA 4J2EA 5L9XA 4AILC 4Z4HA 2B5JA 5KFVA 2IJFA 3SYZA 1MMLA 5F9NA 3NAIA 1VSJA 3O4NA 1BQMB 1RYSA 3IRXA 3HT3A 5KFIA 2X74A 3PR5B 4BWJA 2R2UA 3T5HA 1WSFA 4KHYA 1ZBFA 5HLFA 2IGIA 3D28A 1I39A 4DG1B 1C0TB 3RRGA 2HNZB 4DS4A 4JV0A 4ZMMA 1B92A 2KW4A 5HRRA 1Z25A 3ASMA 3VQ8A 2RF2B 4M3YA 4IBNA 2XY8A 1RA6A 3AVHA 4J9QA 3BGRB 3ZT0A 2F96A 1LW0A 2ZQBA 4FJHA 3AVCA 5HROB 1J5OA 3VQBA 2VG6A 3JYTA 2AU0A 2FVCA 4QWDA 3OYHA 1CXQA 2D3ZA 4RUCA 3P1GA 1JLAB 5J2QA 1TGOA 1S4FA 2CKWA 3BDPA 1S6QA 1JLCA 4NCGA 4O4GB 5J1EB 1T03B 2D7SA 2HHWA 1S1XB 4PQUB 1SKWA 1UWBA 3MECB 4IG0A 4DMNA 1BIZA 1HNVA 3NCIA 3NBPA 1TK0A 4NCBA 1JX4A 2VG5B 3FQLA 4JS4A 4CEDA 4Y3CA 1HYVA 2ASJA 4XPCA 1T05A 3DRSB 1X9MA 3SFGA 1QUVA 2Z1JA 4Q8FA 3AVIA 4DTRA 3RRHA 2AGPA 3IS9B 3V6JA 4J2BA 5J2MB 3ITHB 4KV8A 3GV5B 3CYMA 3PY8A 4DTNA 1RDAA 4CJ5A 4EP4A 4DSIA 4CHQA 2FBVA 2BRLA 1X9SA 4Q43A 1RT6A 1RT2B 2IS3A 2X6NA 4TY8B 4CK2A 1Q9YA 4ZVGA 4KAIA 4FYDA 1T3NA 4LQ3A 4J9OA 2B5JB 5DLFA 4QOZB 3EYZA 2D0BA 1GOAA 1HQEA 4CFAA 3OYLA 4E89A 3NF8A 2WRMA 3AVNA 3PX4A 3IRXB 5JXSA 3AVFA 2WOMA 3M8PA 5C24B 3CDEA 4OJRA 5K14A 3DRRA 4ECTA 1FXXA 1YTUA 2DPJA 2YKMA 5HLFB 2HNYA 4FCYA 2DPIA 4DTMA 2FC0A 1NHUA 2JEIA 4Q5VA 3SNNA 4TSXA 3VQ9A 4KB1A 3P5JA 3DI6A 4M45A 1N48A 5EU7A 4IQXA 3GIKA 4UQGA 4DQPA 1LW0B 1C6VA 4HUFA 4I9QA 4N41A 4GW6A 1C1BA 1J5OB 1RBTA 3JYTB 4YR2A 4KI6A 2IDOA 3LWLA 3RR7A 4EBEA 4RU9A 5J2QB 1FK9B 1S6QB 1JLCB 4NCGB 5DK5A 3IAYA 1S9FA 3RWUA 2HAIA 4RZRA 5KG6A 1UWBB 3BSAA 3SUOA 4IG0B 2PYLA 4FK4A 1HNVB 2D5RA 4YQWA 4WZQA 3M9MB 1TKTA 3PUFA 4W5OA 1HYSA 4CGIA 2E9ZA 4CJEA 1T05B 5KFEA 4CFBA 4C8KA 1RDBA 5KG1A 3AA4A 4C8LA 4RNNA 3D45A 3PW0A 1RDRA 4ECWA 4FXDA 3C95A 5C25A 4N56A 3PV8A 4KV8B 3H2LA 3EZ5A 2F8SA 4KHRA 4CGJA 1JLBA 3VA3A 3H40A 3L8BA 4JRQA 1JXEA 4NYNA 4CEEA 3QIPA 3Q8QB 3NAHA 4M95A 2XO7A 2XCPA 2QXFA 4K4SA 2R8HA 3N6NA 3AVLA 4Q0BB 3F73A 4CFCA 3BSNA 4DWIA 4DSKA 5KFJA 4B9SA 1HQEB 2J6TA 1L3UA 3KK1A 1J53A 3CM6A 2C2DA 2WHOA 2HHSA 2W42A 2QKKA 2WOMB 3M8PB 3SPYA 5K14B 2B6AA 3O3FA 3DRRB 2FLLA 1WSIA 5J2PA 2HNYB 1JL2A 3LPUA 1LWCA 2AQ4A 3L3UA 2UVRA 4IFVA 1GOCA 3FFIA 3OJSA 3ZT2A 4CESA 2KQ2A 1NK9A 4F2SA 3NF6A 4M94A 4OLAA 1JLEA 4DU4A 2C2RA 3DI6B 3KHHA 1RA7A 5DG7A 3L2VA 3U3GA 4DQIA 3ZSOA 2R7YA 2B43A 4RW4B 4HKQA 4RUAA 2HB5A 3V81A 4C8OA 3KLGA 3QGGA 2HWHA 4YNQA 1ASWA 1C1BB 2JEFA 2JC1A 1QS4A 4ZPBA 2R2TA 1FKPA 1SL2A 4MKBA 3TR8A 4ED0A 5KFSA 2ATQA 1T8EA 5KFKA 4F50A 1NK5A 3SV4A 3LZIA 2B4JA 5KTQA 1KFSA 3VQ4A 2XHBA 4LH5A 4IKAA 5EWFA 2FBYA 3OYAA 3MR5A 4FLYA 1HYSB 4ECQA 1YT3A 3LDSA 4R5PA 3KHRA 5KFOA 4CK3A 3H59A 3SCXA 4FJIA 3LP2A 1SUQA 4EZ9A 4RW9A 4HTUA 3RMCA 1L3TA 1RT1A 1HMVA 3E51A 2AJQA 2QV6A 4FZYA 1IH7A 5C25B 4E19A 4ZP8A 5KFYA 2KZZA 3H5UA 4J2AA 1WSHA 3D0PA 4IFYA 3O4QA 1JLBB 1XR7A 3ALYA 4QWBA 3VQ5A 3DRPB 4EBDA 3NE6A 4YR3A
chains in the Genus database with same CATH superfamily
3J80Y 2RHQB 2WB1D 4X64K 2GQCA 3CDAA 3VAJA 2M8HA 2M5YA 3KUHA 2DGVA 4BROA 2YX6A 3KK1B 3EDRB 4XPEA 1PYOB 3AVGA 4NLUA 1KTVA 2ACMA 4E7JA 3V4IA 3U3YA 1S1TA 1WBDA 5HP1A 5L8RC 2XY5A 4V19X 1BA1A 3MMBA 3T1HJ 4C8NA 5AE1A 4CGHA 2HWIA 3FFIB 4DL5A 4JI6F 3THWB 2PMHA 5FLXO 1VQ9S 3OL7A 4ZTFA 2RE1A 3CCWA 2GX8A 3CCVN 1ZAVA 2E9TA 4MK8A 3D1QA 3KK2A 1UTAA 3CCJS 1C4AA 5C15A 3QT6A 3L7UA 3LAMA 2PBDA 1Y5IB 2HFSA 2HIQA 1XQSC 3OY9A 3HF5A 4QU6A 3CC7S 3IA0A 1OH7A 2I5JA 3W63A 3SAHA 1TAUA 1VQ6S 1FEEA 4A8WA 4R8UA 2P5GA 1KD1T 2P9LB 1O0PA 2MZJA 1RAEB 3VZHA 4LSZB 4RCHA 1WF0A 5H1SQ 3RG6A 4DXLA 3TO8A 1RP5A 2Z56B 2PD1A 2RH3A 3SCIE 3VEVA 4E1NA 3I5AA 3PR4A 2D41A 4CRJA 4IRKA 1JLGA 4CFDA 1KTQA 5G0RA 4UQTA 4FBUA 4ZVFA 1MW7A 2Q0RA 2QMXA 2CDQA 4PR6A 4YDUC 2RHKA 3TWZA 4QPXA 2NREA 1HHQA 1K9MO 2J0WA 1FX4A 1S0NA 2WAQD 2B4VA 3A8YA 4CEBA 2O4GA 1KLMA 2V8GA 3OXFA 3KJFB 5KT3A 1R8PA 4K4TA 3RB3A 4N47A 3DMJA 1NKCA 3O3HA 2Q6CA 4CJPA 1VSLA 2CQIA 4ZCLA 4X66J 3M2UA 4LF6J 2YJEA 1LXJA 3AVMA 4O8UA 1K44A 3MOZA 1M5KC 3M4XA 4LFCJ 2QWNA 1F6TA 4JI2J 2EFGA 3UN2A 2IRYA 1NH7A 4CIFA 1NDPA 3I31A 2I1RA 3W3DA 1YITS 2FVSA 1EZZB 4CM0A 4AHRA 2K3IA 5KFMA 3VQDA 1QQMA 4EEYA 1RB0A 4YHHF 2LU2A 2LQJA 4DPOA 1WC6A 1B4SA 5HAOA 2HHVA 4CT9A 4OX9J 5AQQA 2O8FB 1HNZK 4TYAA 3BBCA 4AQYF 2BE2A 2W1BA 4EZ6A 2W41A 2OD6A 1RTDB 3C6AA 2G8VA 1OPIA 4ZJQA 1K73O 4XH4A 1TKXA 4X64J 1GLFO 1R0AA 3PW2A 1YI2N 3K8WA 1QAXA 3WC0A 2BA9A 4E0DA 1F9HA 4FSVA 1ITGA 2HFZA 3E8OA 4H0YB 3RVCA 1XERA 4CGFA 1WELA 4PKIA 3DNCA 1HPZA 4DV1F 2C22A 3H3NO 1QHAA 3HX9A 2A1BA 3QLHB 4Y34A 2WC9A 4KSEB 5K5MA 4L8RB 1OO0B 4PG4A 2P5OA 2XNQA 1QQOA 4I2QB 1ZA1B 3O9RA 2DRBA 4AM6A 4H4OA 4KBIA 1M90T 4RBUA 2E2QA 4C8MA 3V6DB 5E84A 3EZUA 3E01B 4OZ2A 2WVCA 3SI8A 4DMZA 4H4KC 3DRYA 2MXYA 4KHNA 1IN0A 3ZX0A 1S7HA 3JSMA 5KGXA 1S79A 1LWEA 4JAXA 3ZTPA 4A4JA 3MN5A 2YNGB 3QWUA 1M5PC 3H45C 3BYRA 4MTPA 2YX7A 1HBOB 1CZAN 4WCEL 3TARA 3DJCA 1FVQA 3A3NB 1RK8A 5D4NA 3CG7A 2J9DE 1UFKA 2G0JA 3MCSA 4FXVA 4FW2A 3CQXA 2BANA 4I0WA 4NEYA 2MQMA 2W9AA 3ZZYA 4CHYA 3KD5E 3GJSB 1VRUA 2YWFA 4CI0B 4DUTA 4I4BA 3LAKA 3O9SA 4ZVOB 5CYQA 2GX9A 4BR7A 1Y3KA 3Q89A 1N6QB 4XDCA 1KFDA 2HFUA 3HVWA 3AO1A 1HNIB 4UOFA 2FC9A 3NL0A 3OYCA 2C2NA 1BWFO 3IC1A 2VG6B 4F25A 2MGZA 3ADAC 4CH0S 2C3OA 4OGEA 3NGSA 2F1FA 1EQMA 1TYQB 2BTFA 3QT8A 1DTTB 1VQ8S 2HGMA 4QW9A 2X3GA 2CZ4A 1RAJA 4NX9A 1H38A 2BX6A 1Q8BA 4I2PB 2IAJB 4Z37A 5FLXY 4FF2A 2XULA 1TMJA 1TKZB 2ZKTA 4JHDB 4CM2A 2ZHOA 4B3OB 3SJJA 3ZC4A 5D4OA 2DFHA 4G1QB 5LL6d 4OZNA 4WQ4A 4CLYA 3FSXA 4CHOA 1XC3A 4QS8A 2G8IA 1IXKA 3UCZP 3MWTA 5HJXA 4IDKA 3DGPA 5CZVA 1VQ4N 2E5GA 3HTVA 3CD0A 1SH0A 2QO3A 3TU5A 3TEGA 2ZGYA 1BI4B 1TFYA 1WLJA 3L2WA 3PYDA 1LAWA 1YGYA 3GFZA 2C3PA 4KH6A 1KS2A 4B3TF 3AA3A 2WVEA 2Z1IA 4C0HA 5JS1A 4JI5J 1U1NA 1ZBUA 1FJEB 2OD4A 3O5BA 1RHKB 4WXOA 3R9PA 4RNMA 5CE3A 4ETZA 4WFNL 1PAUB 4Y1DA 4FOEA 2FJEB 1PJ7A 3KKFA 2BW7A 2OZMA 3THYA 4IOBA 4NLVA 4AHCA 5CD4A 5C42A 3V6KA 2ZBCA 2AHOB 1PJ5A 1N4LA 1AXQA 4HDGA 3HFZB 4C11A 1JL1A 1EHWA 1YTYA 2UXCJ 3SAGA 1S9GB 4Y28C 1XNRJ 2FJWA 3TUZC 1VC6A 1T11A 2UP1A 5AXLA 3FZLA 2B4PA 2DJWA 2XMKA 1R3NA 1Y64A 4FJXA 1XTZA 3M2RA 4ZCKA 2E9RX 3T6JA 2VU5A 1XUPO 4CJVA 4DSEA 3SQGA 1TKTB 4O3RA 2HRTA 1A5XA 2DNZA 5J1PA 3L0QA 1GOBA 3MM5B 5KFDA 1F9FA 5DGBA 2UUBF 4OYBA 3V1OA 1U1MA 1CSJA 3CJKB 3Q8PB 2BJ3A 1S9EB 1HI8A 5I4MA 3SQ2A 4JEPA 1X9JA 2EWHA 3B82A 2VQEK 4LF9F 1VQSA 1G2EA 5DZ6A 5EWEA 3OUYA 1VHFA 1W2BM 1GXUA 1QLNA 2ZBQA 4IG3B 5L9NA 1E4GT 2QGFB 2XSJB 2W01A 3CCSS 2EC2A 3SFUA 4P75A 1X60A 1HQUB 4LR9A 4O3PA 1SIZA 4ED8A 3G25A 3TVKA 4E7IA 4WU2A 1VK0A 2DH9A 4AF1A 5IT4A 2AJ4A 2AP1A 2HURA 2R4FA 4CW7B 3GR1A 4ED4A 3D0GE 3MMAB 4F3QA 1IBLF 3CD7A 3D68A 5LJVA 2BR0A 5HMZA 3GSIA 4DF4A 3GR0A 1ACMB 3UKUA 4CP5A 1F3VA 3IUCA 1U0HB 2H5JB 5BJRA 4NLYA 2V4JB 5HO4A 3I8BA 3ILLA 1TVRB 3L09A 4IR9A 3B54A 3H5SA 4USKA 3R5BA 5IWAJ 3MCMA 1KRPA 1VI7A 3LOUA 2YKNB 4DR2F 1RTIB 1RAAB 4CLWA 2FSJA 1FRXA 3L2RA 3ZTQA 4LIRA 4JRPA 1VQMS 5FDLA 4IOCL 2GO9A 1CJVB 2HS4A 4CERA 1K8AT 5CD4H 2W2OP 2RRAA 3VEZA 1RWKB 5KT4A 5B0FA 1HBNA 2FDNA 3T69A 3TTFA 4K2XA 4BRLA 4WJBA 3L4BC 1FXDA 3R6LB 3RRKA 3K89A 4CO5A 1RWVB 5F1XA 4RNHA 5T7LB 1VBYA 3A0IX 5EWGA 4DS5A 1WORA 4CLUA 2AYEA 2VDHA 3LDOA 4WYWA 3BS9A 1O1WA 3D3BJ 3NKYA 3JQKA 3OBIA 1MNEA 3PKMA 4ILRA 2DNQA 5HBMB 5I3QA 1R89A 3DM2A 1Y00A 4YN3B 3TQ1A 4KAZA 4CEOA 3M1VA 5KAKA 5EN1A 5K9FA 2JLGA 2ZGZA 2ZH5A 3H1QA 1LWFA 4GKKF 2HEKA 2YQ3A 3QIOA 2E66A 1RDCA 3HBTA 3POTA 4NLBA 1JJCB 2KT5A 3I0RA 1JK9B 2ZD1B 1WJ9A 1KVAA 4M5KA 1T44A 2E7XA 5IM0B 4LVOP 3EL2A 1X0FA 4MDBA 2R7UA 2HPUA 5DG8A 5IZHA 3T6BA 3MCPA 1ZBLA 1S1VA 3MOJB 3R7BB 4R25A 2VFSA 5AQVA 2A1RA 2V6AA 4CIOA 2BQRA 4K4VA 3TAQA 1N34F 4LRAA 2ZH4A 4LY7A 5HSPA 4QWEA 1C1CA 4TQRA 4G65A 1LOUA 1WSVA 2VQEJ 1M1KO 1B64A 2HF4A 3E1YA 4ZVPB 4CF1A 3CD6N 2J5AA 4OI0A 3LPEA 2HMIB 1R8BA 4DN9A 4DL2A 1WD6A 4N7TA 3SDEA 2V9WA 3THTA 2ZH3A 1D5AA 1R8HA 3KNAA 3E66A 2Z1HA 3PDNA 4FBTA 3RBEA 2IA0A 3JXOA 2FJVA 1WTFA 2CNOB 1GFWB 5GMKa 1SV5B 1S72S 4NLDA 2P9PA 2WONB 2H54B 3FE1A 1HARA 2QIFA 2F4VK 2YCHA 1WSEA 2K1RB 3VEWA 3V9XA 2ATLA 4M7XA 1REVB 3S9HA 3W9JA 4ZPAA 4CHZA 3RAQA 2FB0A 1F1BB 3HSDA 3CXCM 1FDAA 1WSJA 3LP0A 3MEDB 3QEWA 2RIJA 4Q45A 1ZPVA 1NGHA 3BBFA 1Q8LA 4Z4FA 2HQFA 2ZJQQ 2DIUA 4CZHA 2WTUA 4J2DA 4FWMA 3NS6A 3HOTA 4KH1B 4DL0C 2OEMA 3P8BB 1Q81O 3NH2A 1NOYA 5ETSA 2CGJA 3HFVA 4KH0B 2QA4N 5E26A 2N3OA 3J7AN 3CVKA 3EPGA 1NJYA 3I33A 3TWHA 2FUG9 1U2CA 3JTNA 4O3OA 1T9UA 2AF6A 1RILA 3RBDA 2N4CA 5H1SV 2NRZA 5F8HA 3D6RA 2G8WA 2KRBA 1IKWA 5TKYA 2NXNA 3IWNC 1FVSA 5A8KA 3HHLA 3ZSXA 4PZVA 2LECA 2YNIB 2Z57B 3DWLA 1NHKL 2NUUG 4AM7A 1NNDA 3ULDA 3TAFA 1MLAA 3I8DA 4PHTX 4FZXC 5HRSA 2X7IA 3PIPL 3OFHA 3DLGA 1BUPA 2EW9A 5HK4A 5BPMA 1WG1A 1JWWA 4CJWA 2W4DA 2APOA 3CC4N 1C0UA 3DLEA 2GZOA 2XWYA 7AT1B 4DV0J 1C4CA 2UXDF 4S0MA 2B7CB 3QDKA 2GELA 2JC0A 5AR0A 1KQKA 1UZDA 3LO3A 4QW8A 1HD1A 4FP9A 4USUA 3S7RA 2JH3A 4RW8B 1UVIA 2IC3A 3RB0A 4NLGA 4Z4EA 3C16B 2J0XA 3MR3A 3RBXA 3HSJA 2XB2D 1QZ6A 2CWKA 2G8HA 4BE0A 3DOKB 3N6MA 5AJ3F 2BKOA 3L7OA 2C2EA 1DBDA 2UUAF 1RQ0A 3R5JB 1LNQA 4QBUA 2JVRA 2IDEA 3CMQA 3TAPA 4BREA 2NZTA 1Y11A 3GYGA 1YRUA 4H8KA 4BRQA 5B8HA 1S6PB 3V6HA 4GC7A 2GJFA 5L1IA 4CO4A 1VC0A 3VEOA 5I42A 1UOCA 3OYDA 5HMYA 1A0OB 4JB8B 1BXNA 5KPZA 3RU0A 3DGVA 3RUBL 4BRIA 1E6VB 2FLPA 3GQCA 1WC4A 1SKSA 3KJVB 3KFWX 5CZXA 4A8YA 2VC1A 4DU1A 2Y9HA 2WFBA 3E3XA 2R3VA 4KGXB 3FLCO 4TN2A 3HVRA 4OLBA 1RYRA 2F4FA 2F4VJ 3WNGA 3TZZA 3ETMA 3K5PA 2HVIA 4B17A 4DSFA 2NXEA 2Q97A 3QEXA 3AY9A 3K5OA 4N76A 3BR9A 2GIRA 4B9MA 4F4YA 4BC3A 2GVZA 3MPDA 1AUDA 2QE5A 4DR2K 2KH9A 1CS4B 2D0OA 1RBAA 4LRBA 4OL8A 5EGYA 2E1YA 3SLCA 3OXLA 5GIOA 2M52A 3IR7B 2RUGA 3I6PA 3MN9A 4ZK7M 1BCOA 4RBTA 1QJHA 3PSIA 4UT4A 1YJ7A 4QIVA 1EKEA 2DY9A 2DY4A 3HZ6A 2W7PA 1JNRB 2FHKA 5U47A 5KFLA 2E5IA 1ZBHA 1N36F 4ZP9A 3B4DA 4OZLA 2MY8A 5H9FJ 3PG9A 4JYAF 2N82B 1WG5A 1TU0B 3TUIC 4DR7F 2EBEA 1MWMA 4USTA 1NDKA 3G6XA 5ETLA 4CJ4A 4W4MA 4ANEA 4OKJA 4CO2A 2NYHA 2JL9A 1RAHB 4WFBL 4TVAB 3M1FA 5F8IA 4TLQA 3DAWA 4DV4F 1Z26A 3RSEA 1ELOA 3VVTA 3PSFA 2FJXA 4JKFA 3CULA 3H0PA 3QJPA 3OHRA 1UMJA 4H4KA 3ZX3A 3BP8A 3OT9A 3KK3B 2ZWHA 2VV5A 3EXCX 2W6LA 4E3SA 1U6FA 4RW7A 1X4EA 1RTJA 2BOPA 1DT9A 4NYFA 4NZ0A 3NY0A 4LRFA 1XMOJ 2MKKA 2GVDA 3D2EA 1SJFA 3U1NA 3ZZZA 5B7WA 4B3MF 3IR6B 2P9SA 3GIJA 1UA0A 1SH3A 2JJ4D 1BG3A 3MXMA 3BH6B 3O4WA 3QEPA 3BF4A 1NBWA 3W60A 2CPIA 1VLOA 2QLWA 1NWKA 2XRIA 4O3SA 2XS7A 1T02A 4DFPA 1FJ7A 1NSPA 2WCXA 1D9DA 4XH5A 3QO9B 4CDIA 3MR6A 1IR1A 2ZVIA 4URSA 3OHBA 4ED6A 4A2AA 3A5NC 3QBWA 2C42A 2Q31A 4ZLLA 2HIYA 2N4DA 2C2ZB 1AZSA 2R7OA 3CCRS 3SBTA 4Y65A 2DNRA 4DUZF 2PO4A 4OJGA 4M1KA 4WK1A 2AKWB 1UAXA 1TV6A 3NGDA 2MQPA 3WXLA 2BJ1A 1PBAA 1HRHA 1EX8A 3RW6A 2G8KA 2MQQA 2GGPB 3KJNB 3B6OA 2A5XA 2RMLA 1J9AA 3GL1A 2VGMA 5L46A 1MWZA 4JKHA 2WBRA 3P6YC 4OO1J 4ZITA 4WFZA 4JLHA 1VRTB 2XMVA 5F8NA 1TUVA 1BDGA 3ULHA 3ZZRA 4WWSA 3CMES 1JLAA 4OYXA 4FLZA 1U4BA 2VD3A 1PC4A 3FR0A 4PYDA 5KG3A 1UETA 4JI7K 1S1XA 2UU9F 1TL4A 2P5VA 2P9UB 1V5VA 1VHXA 3W5XA 2Z58B 4J9NA 3CERA 2CIMA 3PHTA 4YMEA 1Y97A 4FJ8A 3BGUA 3PZPA 4PKHA 4IDHA 1KD1O 4HVJA 1KEKA 2VFVA 1LXNA 1HX1A 5DQGA 3VQTA 2M3DA 4OHVA 3FKBA 3ZTSA 5AQMA 2CWXA 1EX4A 2NSCA 5CYJA 3H2VE 4ZA1A 2DTJA 1S97A 1FXLA 1U8WA 3A3PB 4C23A 1Q82O 4NB4A 2VG7B 2KN4A 3CCVS 2RRNA 3KLVA 5L9XA 2VHGA 3OFGA 2B5JA 1N52B 2Y8YA 1RWWB 4LC9B 1MMLA 3NAIA 1VSJA 5BR9A 3IRXA 2J76E 2MQNA 2X3DA 3BM7A 2X74A 4QZVB 3PR5B 2R2UA 3T5HA 2QA1A 2HAFA 4LF8J 4KHYA 2A42A 2OHDA 3D28A 3CIPA 3CCTA 4DG1B 4ILLA 1YLXA 3RRGA 2HNZB 4JV0A 3TTDA 1KNZA 5HRRA 4ETXA 4CLPA 1VOMA 2RF2B 4H5NA 2GV1A 4R0JA 5GAGP 2VF3A 2ZJPL 3AVHA 3LW5C 4OX6A 4Q2LA 3ULEA 2ALYB 4B3SF 4CZGA 5JLHA 4FJHA 3BDEA 3HFKA 3QGPA 4NOHA 5FD1A 4WTOB 3R5CA 1UL3A 4IUFA 3P1GA 2EKNA 1R6YA 2CKWA 3O8MA 1S6QA 5J1EB 1NGGA 1T03B 2G1DA 3M32B 2HHWA 2ABYA 4PQUB 1HBUA 2MKYA 4DV5K 2FZCB 2VG5B 2VWBA 3FQLA 3C65A 2ZH8A 4FWKA 4XPCA 3EUNA 3DRSB 1P9QC 1YKWA 2XMJA 1C0GA 3AVIA 4PXDA 2BE7D 4CTAB 4DV3J 2KM8B 3PY8A 1KDNA 2VPZB 1RDAA 3RW7A 4IJAA 4EP4A 4DSIA 4CHQA 1N54B 1RHQB 4A5AA 5L38A 1X9SA 1RT6A 1RT2B 3TNVA 2IS3A 2GJIA 4TY8B 3PFOA 4WCEQ 5AQJA 3Q2SC 3NOCA 4BHQA 4PABA 4UW2A 5AZIB 1GOAA 3WUHA 2WRMA 3R9LA 3PX4A 2GHWA 3O1BA 3AVFA 3M8PA 3QFWA 2RQ4A 3OR2B 3UE2A 1NG9A 1M90O 2YKMA 3B8HA 2V52B 4JI7J 3G6EN 1OY8A 2BBEA 3GJQB 3QFPA 3SNNA 2E5LK 1VQKN 4TSXA 4BRKA 3BF1A 1HWKA 3X3UA 1W26A 5AQHA 5DDQC 5A2QU 2BJDA 2NCKL 2O1PA 2IIRA 3DLLL 2E1MC 2P9NA 1V5IB 2BW2A 5LM7E 1YI2S 5EU7A 4IQXA 4DQPA 1C6VA 4I9QA 1U0SA 4HUFA 2QW9A 1C1BA 5RUBA 3H25A 1RBTA 2RE2A 2VGNA 3NCRA 3EVMA 1YJNN 4RU9A 5J2QB 2Q36A 1JLCB 3HD2A 2A18A 3WQUA 1GMVA 2HAIA 1U1PA 4JKGA 3SUOA 4IG0B 1BE4A 1HNVB 4RBVA 3MMCA 2P9IA 4MYTA 3PUFA 2E9ZA 5BR8K 1R8AA 4CJEA 2BVZA 2ERRA 1T05B 5H9EK 2A41A 1I51B 4C8KA 3UR3C 4U96A 3AA4A 3D45A 4KBOA 2O8BB 3FCVA 1RDRA 3U02A 1DZ5A 1GXLA 2VPXB 4YY3F 3H2LA 2FGOA 2F8SA 4CGJA 2DCUB 4DQ8A 4QIEA 2GHPA 3H40A 1E6YB 4NXNF 1YBUA 4F02A 2FLOA 1TELA 3Q8QB 3NAHA 4B02A 5E33A 3L3CA 3A5MC 2XMUA 4Q0BB 1YDLA 5BPNA 4DSKA 5KFJA 4B9SA 2QN6B 1L3UA 3KK1A 3GE9A 2YHWA 1OSDA 5C0YA 1MSWD 3DRXA 4AE5A 4WFNQ 4K0KF 5K14B 1CJKB 4QIGA 1G3OA 1WSIA 2ZWOA 4WKYA 2BJ8A 1KQFB 1IBKK 5ETTA 4IYQA 4OYWA 1NGCA 1IBMJ 4DV5J 3D9BA 3FFIA 3OJSA 4P6QA 3THWA 1NK9A 1NMEB 4OLAA 4DU4A 3SK3A 1GXTA 5BRHA 3U3GA 4DQIA 5JLFA 5AQLA 2R7YA 4HKQA 2MJUA 4YNQA 1ASWA 2Z2YB 2JC1A 5D15A 1QS4A 1QQNA 1DHMA 1U1RA 3SCJE 5AXKA 3ELHA 4RLEA 2O67A 4K25A 3TUJC 2DNOA 2VJVA 4LT6A 2MMYA 4BRFA 2ASYA 2P9LA 5KTQA 3HHDA 2DVIA 4YOYA 2XHBA 1QVGR 4GMKA 4X62K 3AOBA 3MR5A 4FLYA 4E1JA 1YT3A 2X1BA 3KHRA 2OP5A 3O9UA 4BBYA 2Q1NA 2ZC3A 1SUQA 4EZ9A 2AIRB 3SIPB 3T1YF 3RMCA 1T0TV 4FZYA 1IH7A 1BU6O 2VOPA 1AROP 5ETNA 5KFYA 1VQ4S 3H5UA 2ZNYA 3ZZPA 4P7TA 4QWBA 1RHRB 1APSA 2DBBA 2E5LJ 2ASPA 3NE6A 4NXMK 3DOMB 2JHEA 4BRPA 3DDKA 3NGYA 3HZGA 4USJC 2XS2A 5ETPA 2CQGA 1U04A 2IVOA 5KFUA 4CJ3A 2KKHA 3EGNA 2JFKA 4DR4F 1LV5A 1HR0K 4DFJA 4AD6A 4F9OA 5EVZA 2IOCA 1Q86T 2LDYA 4HHTA 4DJBA 4JKAA 5J2NA 4O5BA 1HNXK 2O8CB 3UNYA 2B6AB 2MSTA 2UVVA 1GNKA 1W9HA 1YHQN 5J2PB 4J9KA 1T7PA 4WKRA 2IPOB 4KFBA 2O8DB 3SQ4A 3CGIA 4C2MA 3UI3A 5HRPA 4ILMA 5A0YB 3EGVA 4KTQA 3IMQJ 1JLEB 3KKSA 1S5ZA 2ZJRL 3R3LA 3CJRA 5BR8J 5H9EJ 2WTFA 4OYIA 3SQ1A 2IHR1 4O55A 1M1GA 1UJ6A 1U02A 2OEJA 5IT9O 1FHTA 2O8FA 3T3FA 4J37A 2VQFK 4IOCQ 2GBZA 4M5IA 1RTDA 1MWYA 4DV7K 3AJ1A 1AYEA 3J80U 1URNA 2DHAA 3HP9A 4DR6K 5IC4B 4IR1A 4QOTA 3R3TA 4KHWA 2E20A 1NGBA 3UIQA 1HNWK 3LP2B 1CULB 3DU5A 3T5JA 3LPTA 1FNOA 3FRZA 1HMVB 4ZVRB 1FWPA 1UKUA 1R43A 2G2OA 3H42A 3H7HB 3G8SA 1DKGD 2PI4A 3D1OA 4DV6K 2DNGA 4IFYB 4KHPK 2RQMA 3OL9A 5BYRA 3QLHA 1EQYA 4NLCA 1NKEA 4BE2A 1VSEA 2VONA 1QE1B 4ERDA 4I2QA 3THXB 3HHKA 4MKYA 5DETA 4TQSA 3G87A 3DLRA 1ASUA 1BWEA 3AXMA 1K8AO 1QAIA 1Q8KA 3K59A 4U95A 1U6BA 3V6DA 3BY5A 3U1MA 3V1RA 1F3FA 1Q7YT 1NO8A 3E01A 1ZH5A 3BO3A 4ISFA 3UVJB 5GAEP 1CJTA 3MCAB 1HLUA 3FEXB 2VYPA 4CF9A 3QESA 2HRUA 4CJLA 1RCXB 2XMAA 3ZNUA 2XHWA 3ZSQA 5CQGA 3R8YA 4FJ5A 3CO0P 1FTRA 2HQIA 2YNGA 4M3RA 1VSKA 2OI2A 3SQOP 4X62J 1OH6A 1LAVA 1HBOA 1LCUA 2K7JA 2PDAA 3WQPA 1IJJA 2C3UA 2KFYA 4A8KA 1FD2A 3LQVA 2YBVA 4ID8A 2CPFA 1HKGA 3UB5A 1IKVB 3VEXA 3PX0A 3VGVA 4NA2A 3R97A 5KFGA 4OI4A 4WTYA 4MO5A 1SAZA 4KHUA 2DPNA 2O3DA 4QR0A 2XBPA 3C0BA 3C94A 3BEXA 4ZOSA 2KLAA 3M6XA 4NXMJ 1N6QA 1P8ZA 4ZPCA 1Z05A 3QEIA 3TZXA 3LDLA 4HCBA 4Z0UA 3LTOA 1HNIA 3VGTA 3TAEA 1D3WA 5HQ8A 1X5PA 4DUYF 1HR0J 2CPHA 4GKJK 1ITPA 2E1ZA 2CGLA 4DR3K 4CEZA 4EWTA 3EN9A 2IM0A 3AA5X 1G7CB 5F41A 4WXWA 1TYQA 1DTTA 4DV2K 3DCAA 3OA9A 1JJ4A 4LBHA 2OPQB 2L9WA 2RHSB 4I2PA 1NZAA 2IAJA 1XQIA 1BGXT 2HHTA 4CCHA 2HHHK 1TKZA 4JHDA 3OPKA 4B3OA 5GIPA 4XAKA 3CB4A 2MHEA 2QC3A 5ADXA 4G1QA 2B51A 1NJXA 1NLVA 1CQMA 3HVTB 2QWMA 2ZKUA 2A6OA 4B8CA 4WE1B 3GV8B 4DL3A 5LMNK 2FHOB 2YV0X 2A3JA 1Z6RA 4M8LA 2FGCA 5A76A 1IM6A 2QMUB 2ASOA 1BI4A 2ILZA 4DR6J 3BSCA 1YVUA 2VASA 4DF8A 3CCMN 2XEXA 1BIUA 3EE9A 4ED1A 4FJGA 3CPWR 1KONA 3CC2N 1NGJA 1FRLA 4J9UE 3A8JA 3J81j 2QX0A 4W5RA 1TUWA 4DV6J 1UAWA 2V2VA 2G2ZA 4KHPJ 1WSGA 4M63A 4WU3A 4OHXA 3PIPQ 2P9EA 3MR7A 3CD6S 1BLUA 4FZZA 1M5VC 3TJAA 3H46O 2VZ9A 2HZVA 1W25A 3C6UA 1S0VA 4BRHA 3LUYA 2AEFA 3LL3A 1V3RA 5D4PA 4BC5A 1S9GA 4DR1K 1WAFA 4A47A 5TKWA 2OYQA 4DQSA 2W7AA 2VKRA 2ACYA 1TK8A 3AO2A 4F4KA 5I3UB 1RT7B 2OO4A 4TYBA 2NUHA 4JK8A 2H9ZA 4J9VA 4NLRA 3U1LA 1HUXA 1Q1KA 2HHUA 3VENA 3MEGA 3MM5A 1NRKA 2FIUA 3CNQP 2ITGA 4DZDA 1QY7A 2Z1GA 4FLXA 2CNNB 2ZHBA 2YXLA 1HFEL 3CJKA 4B1VA 1M0SA 1S9EA 4GY2B 2NXCA 3OS2A 3NAEA 2MEWA 2G8UA 3O3GA 4NYPA 3AVJA 5F8GA 1SJRA 1S48A 3CTRA 1CC8A 4CLTA 2QA4S 1U2VB 4IG3A 2DR6A 2KXFA 4A48A 3UFCX 4DEZA 2XSJA 5ADZA 2AEJA 4MKAA 2V5HG 3SSSA 1C2PA 1HQUA 5ADXH 2E2PA 3N9UC 4B1UB 2OGUA 2AP6A 1CPZA 1BO5O 2EHGA 2F9WA 4KB0A 4NLPA 4DR3J 4HHUA 2KM8C 4I6WA 1VSDA 1XNQF 1CBKA 4GVEA 3OYKA 3MMAA 2XS5A 1S0MA 1NKBA 4K4ZA 5AQOA 3WBZA 1JKHB 2UUCF 4DR5F 4BE1A 1NMDA 5GMDA 5FLXU 4BWMA 3HPHA 4JI4F 2HVZA 3CC4S 4ED3A 5A8RB 2HHHJ 1U0HA 5E5NA 5KFHA 2FJDB 2V4JA 4ES2A 1OH5A 1TVRA 1VJQA 2COLA 4EYHB 4U8YA 2YKNA 3AB2B 4NPOA 2GFFA 1RTIA 4ELVA 3FFKB 4QAGA 4DPWA 3EKUA 5LMNJ 4B3TJ 2YHYA 3AD8C 2GUIA 4DKWA 1KC8T 1CJVA 4O3QA 2DGOA 4K8RA 2R2SA 6FDRA 5KFAA 2CDRB 3DLKA 5CYMB 3FZKA 2OPSB 2BMBA 2LA4A 1WEXA 2Y0BB 2MPUA 1QUPA 5T7LA 4TXSA 3V2UC 3HI9A 1PCAA 4EGLA 1SZ2A 3IBFB 3GTYX 1EO1A 4WFBQ 4JUZA 3HO1A 2W6KA 3MM7B 2W9BB 3TSUA 4JI8K 1NZ8A 3BKFA 2G8FA 3OLAA 2H3GX 5HBMA 3FJ2A 3D7EO 3VOVA 1NK4A 3OJUA 3QT5A 4IOAL 2PN6A 3NMAA 2HFOA 1XMQF 4KO0B 4I69A 1X1PA 4JS5A 4F36A 3IGNA 5AFUA 4CLSA 2Z30B 4RL1A 3MPYA 2E2NA 4WYLA 2OA8A 1YRXA 4A8FA 2D0PA 4CGDA 4NYZA 3OYEA 4L74A 4DLEA 2GUPA 1X7VA 2F9DA 3G9CA 3QINA 4AT1B 4H0PA 4J9MA 4WP3A 2Y8WA 2UUTA 4YORA 3B78A 1TUUA 1TL3B 4UY8T 2HS0A 4C7QA 3NH1A 2CPDA 1XN9A 3D4JA 4KB7A 1ATRA 5AXMA 4UY85 3WEEB 2Q6BA 1ZZFA 2D4WA 5FPEA 1SC3B 2X1FA 4CYUB 2HSTA 1UPPA 5GAHU 4GVBB 1RWPB 3LDNA 5CA5A 2ZF5O 2RNEA 3H4DA 4FLVA 2QL7B 2ZOGA 4X66F 2XY7A 3FZMA 3MR2A 2M2BA 5HL7L 5LL6Z 1F2HA 5K20B 5C2DA 5IC6B 1S12A 3BYPA 4YB1P 4LFCF 4DUYK 4JI2F 1HHTP 1NK7A 1OH8A 2CJ9A 4USHA 1B9FA 3LDPA 2QEXN 4NL5A 1QHTA 4FWOA 4DTXA 2VBXA 1TL7B 1B99A 4IEIA 5D8HB 1NSQA 5GADP 2WONA 3ISNC 5HROA 1ZM2A 5HANA 1KAZA 2B9YA 4CJQA 2HHXA 4MIBA 3QNWB 1REVA 4YOUA 1RGVA 1FKAF 4OX9F 1GLJO 1GLBG 4HHJA 4J5OA 2ILYA 2B8PA 2HW3A 1UP1A 4O0JA 4DU7A 1TL1B 4LFAF 2QJ3A 4JI0F 2BGGA 3GCWP 2D0AA 3DLBA 1KP6A 1RWMB 4X64F 3O1LA 4ZN1A 3V4IB 5AQXA 3KJQB 4X4QA 3CDWA 3AXKA 1S77D 2RJZA 4WYBA 2VH7A 4DB3A 4CJSA 2WK4A 3RZAA 3ITHA 1N8RT 1S4EA 3DKDA 4EFHA 4OLOA 3FBEA 1HYZA 4MIAA 4DCPB 3KNGA 4ZPTR 3CJSA 1S1WB 2OMOA 2R7WA 5AQWA 5L1JA 3P4IA 2AYMA 4WFYA 2CQDA 4ICLB 4LBIA 2J6UA 2XTJP 4PL8A 4JI8J 4K4XA 3K8VA 2DO4A 3F9MA 3N4PA 2PA3A 3N79A 4AFFA 4BLGA 1FT8A 2NRHA 1W7WA 5EDWA 2O01C 5GAHI 2Y1RI 4JV5K 1VSIA 5CCMA 3F44A 3LWMA 4OV6A 3P5TL 3G86A 5KGWA 1P90A 2JEGA 3M6WA 2ZJPQ 2XM3A 4B9TA 4PRFA 4M3WA 4HT5A 1NPKA 1DQ8A 1EWQA 4DHYA 2QLFB 4PL7A 3JSRA 3P96A 5KG5A 3FZ2A 5B09A 3QEVA 1TQLA 2DNKA 1B7FA 1FJGK 2A6MA 3C16A 5M2UA 1FDNA 1FK9A 1XK8A 3VAIA 4DLGA 4QS7A 4IZ9A 3NS7B 1MWKA 3QQCD 3DOKA 1JXLA 1CZ9A 2QKBA 1IQTA 1N5YB 2KXHA 3J7ZT 2R8IA 2FVRA 5JICA 4GVLA 2DNYA 1RAIB 2VL1A 4F26A 1YTAA 3A4TA 4P72A 3J7Z5 1KAYA 2PFDA 3NH0A 1YRTA 3QNOA 1NOZA 2XLJA 2N7CA 1HWLA 3I96A 1K0VA 4W5NA 1LFPA 1S6PA 3CJ7A 3BQ0A 1U49A 4Y6IA 1ZZNA 4YOWA 2CQHA 1NU4A 1IO2A 3S6EA 4WP9A 1FDDA 2JX2A 2ZEJA 1E6VA 3KJVA 2L9NA 2DFFA 4CEQA 3SJHA 1J5EK 2CJXB 2XO6A 2D3O1 2BYCA 2VWJA 5E2QA 5AQRA 3M2VB 1SC4B 3RMDA 2D69A 2ZWPA 4LIWA 2UVWA 3BF3A 4GVMA 2QWOA 4PWUA 1HNZF 4AH9A 1WAJA 4B8AB 3FEYB 2ZVSA 2ZUAA 3SSRA 4PXCA 3QT7A 4O4RA 4FS2A 1VSMA 3DLLQ 3LANA 4XIUA 2PT0A 1CS4A 2CQCA 4DX6A 2HNDB 5L1LA 2J4RA 5D78A 1MMDA 2I2YA 4E7KA 3M6GA 1FTCA 4MT1A 3NP5A 3V9UA 1HPZB 3FC9A 1ATSA 2GV9A 3C6TB 4ZP6A 5KFFA 1NNEA 4UF4A 1LOTB 1RDWX 4M3UA 1ICEB 2V4RA 4JK7A 3M8ZA 3M8RA 3AO5A 4KYZA 3MZIA 1IUJA 3T1HK 1EP4B 3SXLA 2C3MA 4OKKA 2VA3A 2O66A 4M3TA 1HQ2A 4Z4CA 4FYVB 3ET6B 2XC9A 4JKBA 2IM1A 1ROFA 3KHLA 3SUQA 2I6WA 4ZPVR 4DU8A 5D0RA 2AX0A 4K4YA 3C2PA 1RTZA 3PIOL 4GRSA 2IYGA 1RBRA 4I7FB 2HFVA 2DNHA 4CHPA 1CXUA 3C6HA 3PRBA 5DO2A 1YBTA 3HHLD 1B3TA 2ETJA 5FRMA 3DRPA 3KK3A 4LF5K 1YXQA 1ZOTA 2YWGA 4IEEA 1UW4A 4A8OA 5FPNA 1FNMA 4HHHA 4ECVA 3EE3A 2NRXA 1LK5A 1DLOB 1FE0A 1G15A 1EKSA 1Y0HA 3OVAA 5CYQB 1JCGA 4LSNB 4AL5A 2K06A 1K1QA 2P1JA 4LF4K 2VKZG 3G6ES 4BRAA 2DNPA 2HG4A 2UUAJ 3HYFA 4DI6A 2BM0A 2SXLA 3GILA 2Y1LB 1VQKS 3BREA 4RR5A 3WIUA 4DHVA 2OLWA 3MD1A 2W8KA 4DL4A 4WFXA 1Q9XA 2BJ9A 3M30B 3QO9A 2KT2A 4KPCA 1CZBA 1PILA 2UV8G 2XQCA 3M8QB 2XY6A 4FJKA 4OZ5A 1RDUA 3I4PA 3PJWA 3U9ZA 1D09B 4RUBA 2E5HA 1S1UB 5EX3A 3ZSWA 4ECZA 1YJNS 1DQAA 5GMEA 4FS1A 2R8JA 1XHXA 4M3ZA 5B0AA 3BQ2A 2D9OA 3DOLB 4LF6K 4TNOA 2KYZA 5AQKA 1YJVA 3IM8A 3OXGA 3IKMA 3OYJA 1LWXA 2F8EX 1WB9A 4ZHRA 1DTQB 2VCPA 3WZ0A 2GGPA 1J5EJ 2LEBA 2FC8A 2FJAB 4P73A 4IXCA 3OYIA 1KOOA 3IRWP 4IDKB 2KYXA 3MPWA 3Q0AA 2HBKA 3W3SA 3Q8UA 1VRTA 2DGTA 3OSNA 4M5LA 3TQEA 5K8OA 2RDDA 2C1EB 4P9SA 2FD2A 1NGIA 1RAFB 3TI0A 4G1IA 1Y7PA 2R8GA 1A6LA 3VALA 1X5TA 3HT0A 2CQ3A 2P9UA 2IJNA 3SUPA 4CK1A 1WF2A 4USIA 3AY0A 3M6VA 3FGUA 4Y2MA 1FE4A 3BJYA 3EEQA 4CF8A 5THWA 4NI2B 2KHOA 5E7OB 2NZ4A 3CF5L 2ZE2B 1NXIA 1V3ZA 3OTDA 2BM1A 3GB0A 3DYAB 1V3SA 2CFXA 1N5SA 4JYAJ 2HFNA 5EUHA 5AE3A 3CJ3A 4B3RK 2GTDA 4C6AA 4FDFA 2IYIA 1S6OA 2EG2A 2IBKA 1REGX 2K7KA 5DM7L 3FEZA 2ZJRQ 2VG7A 3TTCA 2DRAA 3GIMA 3K0SA 3AT1B 3SI6A 1ZM3A 3TYTA 2JEJA 4EUVA 4K7QA 1JXBA 4PY5A 2P51A 5HOOA 1DURA 1F21A 5JVGL 3OTOK 1RBVA 4DG1A 1Q86O 1KCFA 1RWXB 2HNZA 4FYYB 3HLUA 4FVMA 4J9LA 4LF5J 2CJKA 4LSLA 3JS6A 3VN5A 4QPTA 2RF2A 2IRUA 1P1TA 4OYAA 4V19S 1YK9A 2Q3PA 2WSFC 1RBOB 2KL8A 3OHAA 2QTWA 3V5RA 1MA9B 2HHPA 3ZSRA 3T1AA 2CQ2A 2BJEA 1FEHA 1E4FT 2V69A 4LF4J 4G6VB 2R9LA 2W2MP 5J1EA 2WSCC 1T03A 1U1QA 4XDDA 3M32A 4PQUA 1XEZA 2WUSA 3G10A 3QJJA 3A8IA 2VQEF 2J7UA 1FF2A 4RO0A 2FXUA 4OGCA 2VG5A 4QU7A 3VQSA 1UZHA 4E2FB 3UDEA 3GYXB 1RWUA 3JTPA 2HLUA 1RT5A 1W0HA 2OTLN 2L41A 4DUZJ 3DRSA 2HOEA 2I7NA 1K73T 3QYYA 5M1PA 2H4YB 3OW2R 4MIWA 2X1GA 1FCAA 1YHQS 5LXYA 4CTAA 5BN9A 5D3GA 5DZ7A 3QJLA 1NDLA 2VICA 3VESA 3T9NA 1BHNA 3HRGA 4K42A 2J0SD 3GJTB 4HI2A 4DCOB 1HLWA 2F3JA 4MFBB 1VIOA 4HACB 1GMUA 1QZ5A 1K6YA 4E1MA 4TY8A 4DTJA 1NGFA 2ZM6K 3WXIA 3SPZA 1Q4RA 2KHCA 3ZFVA 3F56A 4Z4HA 3FRYA 1V4TA 3SYZA 4KIAA 2HBJA 1RZMA 3O4NA 2LXIA 1BQMB 4QR1A 3ID8A 2JWLA 3OR2A 2WZ1A 4RJVA 3NNHA 1ZBFA 2KVQE 2IGIA 1MROB 2GIFA 1C0TB 2NYIA 2HS3A 4DS4A 4JI1K 3K9KA 2KW4A 2ZFHA 4N8OA 4AL7A 3VQ8A 2F7VA 4RPFA 4M3YA 4IBNA 2XY8A 2D1CA 3QICA 5M1OA 4L72B 1NJIT 1KQGB 4F7VA 3R5DA 4JI5K 4QWDA 3OYHA 3X1LB 2DXEA 2D3ZA 1YX2A 1FRIA 5J2QA 2MQ8A 1TGOA 4B3RJ 1JLCA 3W66A 4NEZA 1WDDA 4IG0A 1BIZA 1HNVA 2D9PA 3NBPA 1EB0A 5DJBA 3TEHB 1RAGB 3NMUA 4WF9L 2F7TA 4DOZA 1KOHA 1JMTA 4YEAA 1T05A 3CHWA 1N33K 3SFGA 1KVKA 3E2EA 4Q8FA 2Z1JA 3Q2TC 1BUXA 4W90B 4DTRA 4J90A 2O8BA 1F5CA 3VHQA 2UXCK 4J2BA 1XNRK 4BVPA 4X84A 3TSQA 4ZJOA 3OTOJ 1EIYB 4HDHA 5HVHA 4MLEA 3AD7C 1E6YA 3EZOA 3KYLA 2X6NA 2DGWA 1Q9YA 4ZVGA 2QLXA 3GCXP 3DXKA 4LQ3A 2JWKA 4J9OA 4QOZB 5HI7A 2I7PA 5HQLA 1ULRA 8AT1B 2VPYB 1DJ0A 2MYFA 4WK3A 2GAHC 3QBXA 1NDCA 3QAEA 3O80A 1KQSR 1VQLN 2FZKB 4OJRA 5K14A 3A8EA 1CJKA 4ECTA 1T3OA 1YTUA 3IR5B 1X5OA 5HLFB 1H3DA 1NHUA 2JEIA 1RWOB 3R5AA 1N0UA 3VQ9A 3MI7X 1NUEA 4OMFG 1JJ2R 4KB1A 1FRKA 3P5JA 3AOAA 1UVKA 4GW6A 2NR0A 1FWLA 2GQ2A 1GT8A 4C1NI 3JYTB 2KI2A 4ISEA 2IDOA 3LWLA 1RHUB 3RR7A 4BGAA 5HMWA 3C7NB 1YBAA 4OZ0A 3OTBA 2O8EA 5DK5A 4X4OA 2A10A 2AV5A 3BSAA 2UXBK 2PYLA 3R1HA 2F4VF 1S57A 1SVDA 4CGIA 2ZM6J 2W4CA 5B08A 5D4LA 5AQUA 4CFBA 1PAEX 1OJ4A 4OZ3A 4FF4A 3C14B 5KG1A 4RNNA 5IWAK 4FWRA 3UKRB 1X4GA 4QS9A 3JQJA 1GQEA 8ATCB 4JI1J 1YJ9N 3OFEA 4UZCA 4JRQA 3DOMA 4CEEA 3UWTA 3QIPA 4M95A 2XCPA 1WI8A 2K3KA 3CCMS 2R8HA 4YDDB 4I67A 1V6HA 2LDIA 3NLCA 3BSNA 2UV8A 1HQEB 3CC2S 2C2DA 4H5WA 2Z2MA 3QMLA 1OY9A 4Y00A 2WOMB 2O8CA 3WIVA 1JJ2M 2B6AA 3O3FA 5J2PA 1R8CA 3HCXA 1G1XA 2O8DA 3L3UA 3S01A 2B4OA 5A0YA 4F2SA 3NF6A 3OTEA 2B9EA 1JLEA 3DI6B 2HQGA 3AGKA 3UCGA 2ZBPA 3L2VA 1OYEA 2B43A 1N33J 4KGKA 3D6FB 2A40A 4C9DA 5JVHL 1WKJA 2N7YA 4U7UK 1FFWB 3I55N 3ZTRA 2BUPA 2B4UA 1SL2A 4ED0A 5KFSA 5KFKA 1VCTA 4F50A 1JB0C 1NK5A 2W24A 4HTLA 3VQ4A 4U7BA 2FBYA 3OYAA 4FWNA 2CZ9A 2AMCB 4ECQA 3LDSA 3SCXA 3H59A 3LP2A 1CULA 3ZEUB 2HWTA 2NS1B 1HMVA 2AJQA 4MMOA 3K17A 1IV0A 2LCWA 4LMZA 5HATA 4F0MA 4JKDA 3EVOA 2CH6A 4IFYA 1XR7A 1B0VA 3ZZTA 3JS9A 4EBDA 4IOAQ 2LP4A 3D3CJ 3CM6A 4A8SA 3I5BA 1K8KB 1QE1A 3THXA 1NHVA 9RUBA 2K2PA 1YVNA 2HBRB 4HTJA 2ZH1A 3ENBA 8RUCA 4P10A 4NASA 4IH7A 4I68A 2Z0GA 3CMAN 3OYNA 1KSPA 1GMWD 2E44A 3UVJA 1SXLA 3QIDA 2XMMA 4FNIA 2UXBJ 4FM0A 1A5VA 2F8TA 4OPKA 3RGIA 3GIIA 4CEAA 1H6KX 4IJNA 1RJJA 2J9EA 4BACA 2CAJA 5HQMA 1KXPA 2A3ZA 2IBOA 3V81B 2OEKA 3KLGB 4PWDA 3J7YP 5FJ4A 1Z2ZA 1OIAA 1H73A 2RSQA 4CBXA 2AWZA 4RX6A 3RMAA 4PWWA 3CJ2A 2GWKA 2OTJN 2KT3A 4DQQA 2F8MA 4RG8A 4CLKA 4Q8EA 1KVIA 2MHNA 5HL7Q 1TK5A 1AW0A 1C1AA 3ZLJA 3UW1A 2LKZA 3EPIA 2MLXA 4R5PB 4KHQA 4ZTJA 2AD9A 5LSLA 4RWXA 2I9SA 4B1XB 1RT1B 3U6FA 2D1KA 4BC7A 2L3MA 4Y0FA 3RSEB 2ZH9A 4UY8O 3AO3A 2P2CB 4EP5A 3J7AP 1RABB 3P39A 4A8MP 1W97L 2DT9A 4MKVA 2PEBA 3HSTB 4K50A 3HM8A 3ISZA 3IWXA 3PHEA 4CJFA 2PEHA 4JI3K 4LF8F 2DRDA 3OL8A 2FYXA 3S1TA 4ER8A 4FLTA 3RBZA 1MG7A 5JMNA 2XCAA 1X3MA 4HUEA 2NRTA 4DV0K 1UWAA 5KG7A 3CCLN 4RWWA 3G71N 2DO0A 4EO6A 2OUGA 4FZVA 2R42A 4WE1A 5AQPA 4GV3A 3TPQA 4M3XA 3KMSA 5LJ5Y 1VQPN 4XK8C 1F0XA 3H1VX 2C2MB 1SJQA 4A61A 4U7UD 3CIZA 3A13A 4LJMA 2E7VA 4I1TA 1RSCA 4B9NA 3MUMP 2G0IA 2WB4A 2KJWA 1T9YA 2EXUA 3HPOA 3OQ2A 1CC7A 1IJFB 3D2FB 5FRNA 3CUNA 1UJ4A 1WTBA 3KLHA 5AE2A 1X5SA 3BSOA 1YWXA 3VA0A 5E3QA 4KRFA 1RLDA 4ID5B 5BRFA 1YIJN 2FHJD 2IVMA 4YOXA 4H03B 4RWTA 3N5BA 1TV6B 2CUYA 2IIHA 3Q86A 2RQKA 3SQ0A 3GP9A 4ZPDA 4J8FA 5BN8A 3BGOP 3UN5A 3GYNA 1N5TA 1H74A 3CI5A 3NF9A 4X4UA 5LT5A 2U2FA 1FRJA 3VGSA 4X65J 4Y1CA 4XTTA 4OZ1A 2QEXS 1RCOB 2R7VA 2WW4A 3LZJA 1N56A 1BISA 3MK6A 3CJQA 3KWGA 1VQ7N 3FQKA 2GCFA 4P2MA 1WKKA 1Y4ZB 3UCUP 3MUVP 1NGEA 5I3UA 3WHIA 1RT7A 2BEFA 3DDIA 1M5HA 5CCLA 2RU3A 2ZDOA 3Q8YA 2HBYB 2OPPB 4H4MA 1Z1ZA 5A2QY 2ITMA 4TU8A 3VETA 3FCWA 4JI7F 2WVFA 2BQUA 4NLSA 2D3UA 1Q53A 3JB9k 1Y5NB 4ZS6A 1X0PA 4LREA 2YX1A 5AZJB 2E1RA 3MEKA 4RW6B 3QATA 1U45A 3GOIA 4BG9A 5KFNA 1WKLA 2ASMA 4ENOA 4HUGA 3QGIA 1NBEB 1RTHB 4QIFA 1U2VA 2CNLB 2FPHX 3QPIA 1QTMA 1WI6A 1RACB 1UEVA 4N5SA 4PUOB 1O8BA 5KFQA 4CJTA 1RE1B 3KDNA 1F9EB 5H9FK 3LGHA 3QMQA 3VMFB 2G4BA 2OFHX 2H5IB 1QVFR 1A5WA 3TAMA 1NK6A 3R6MA 4ZLNA 4KY3A 1SQKA 4FJJA 4EO8A 2YHAA 1JKHA 4ISGA 3J7ZO 4ATNA 3W5YA 5M1FA 4JI3J 2HHQA 5A8RA 1L3VA 5GVQA 3AVAA 4OFZA 2X78A 1BQXA 5D0HA 3TSPA 1KN6A 2W2NP 3ULEB 1BL3A 3WXJA 3UD3P 3LDQA 4MDAA 3PJ9A 3MM8B 2LLZA 3GV7B 3SMPA 3UDVA 1S59A 5KRSA 2Q3SA 3KLFB 2ALZA 2P9KB 5A8WB 4FWPA 1XMOK 9ATCB 3KLIB 3AD9C 3VEYA 5KFCA 3C66A 2UZAA 1ZYQA 5M1QA 3CJ5A 2AJ1A 4K8XA 1P8GA 3FVYA 5HRNA 2BOAA 3IMXA 2IVFB 3LF0A 4PG5A 1EARA 4ZPWR 2E7WA 1YAGA 1RT4B 5CYMA 2OPSA 2DITA 4PKGA 4MK9A 4YDUA 4LF7K 3KLEB 1UW9A 5ELZA 1IKYB 3NFAA 4DV5F 2BZ2A 3HL8A 1Q5YA 3CJ4A 1MN7A 4AYBD 4Z4IA 4KREA 2V7ZA 2VA2A 3PIOQ 4C0BA 1MMNA 3MM7A 2W9BA 3OBWA 1ZS6A 4C3LA 1GLLO 1RT6B 1I94K 3L2QA 3D66A 4NWBA 2W25A 4QWAA 2HKEA 4IH6A 4MLHA 4FL9A 1WACA 3N01A 2AJFE 4JV2A 1FERA 2JLEA 3VF4A 4KO0A 3D5MA 4KRWA 3GIRA 4NCAA 3MAAB 3OV7A 3FBFA 2BH1A 1X4BA 3O9TA 2DH7A 1CEZA 2G1HA 4UUWA 3FGVA 3WXKA 2YKMB 3MTJA 4R79A 4BQZA 2VPWB 3O08A 4C3MA 3RYLA 1HBMB 1LW2A 3KD1E 2P6TA 3ZSYA 3LP1B 1AFJA 4I9LA 1ZBIA 3L9ZA 3THPA 2YNHB 2HRYA 3A5LC 1T9WA 1ZETA 2GC8A 1G99A 4OJ1A 1N32K 4A59A 3PW7A 2DD8S 1IVZA 1TL3A 3H90A 4BR2A 5G4DA 1VQON 2E5LF 5KG4A 1QTNB 5IT9U 2MY7A 3I0SB 2PI5A 2GMLA 5E3CA 3PLAA 3ZETB 4YFUA 4CYUA 1WG4A 5KOWA 4JNEA 1VSFA 4GVBA 3DXMB 4CBWA 4DTOA 2A2CA 2F65A 3HVAA 4WP8A 3ISND 2DXDA 4KE5A 3TRGA 3MF5A 5LMUK 1NK0A 1TKDA 1SL0A 2KG0A 1XNQJ 3CQYA 4ECUA 4LFBK 2GWJA 2UUCJ 3VV2B 1RU2A 4DTUA 5HVFA 5IXUA 4Z4GA 1OYDA 2YWWA 2EC0A 3U8XA 1TL7A 5BR8F 2DY1A 1H2UX 4ANDA 1VBXA 3AAWB 3MEEB 2LU1A 5C5JA 3G4SN 1U2FA 2CQ0A 3ID6A 4H5VA 2FHMA 3N28A 4LF8K 4E98A 1ZBSA 1WOQA 1Y10A 4YUDA 2FY1A 3H5YA 5LJ3Y 1TL1A 2X1AA 4ZN3A 3NGUA 1GTEA 3PX6A 4FXWA 3UO0A 1HWUA 3K5LA 2NUBA 3CF5Q 3GWCA 1H2VZ 2F63A 3WXMB 3BZCA 3IFEA 3EGWB 2Q66A 3MXIA 4AHSA 2BXJA 4L3KA 3PO4A 5KPRA 4ZCIA 3HK2A 2J0QD 2QLJB 4NRUA 3MFIA 4ID1A 4DDFA 4BS2A 5C2FA 2XMTA 3HHLC 5L1KA 3OS0A 1VQYA 4GNIA 1WHVA 2YKPA 3UD4P 5DM7Q 3GFXA 3H08A 1I5OB 5T7BA 4LF7J 2QXLA 4CIEA 1IBKF 1SJ3P 1V4SA 2RQCA 1WN7A 2NRVA 3V9WA 1S1WA 1WC1A 2ZNZA 3LA0A 3L4IA 4J91A 4FKYA 2DFEA 1RCHA 4ICLA 4K4WA 3NVMA 3CCUN 4IWVA 1XMQJ 5JVGQ 1I94J 5LOQA 2PGCA 2OPRB 2E1PA 1RT3B 4DV3K 5KT7A 5C2CA 3M9OB 4B9LA 1SUQB 3Q83A 3NVKA 1W7AA 3PTWA 4A8QA 3E9OA 4X62F 4KGVB 3I5CA 3BGRA 1Q82T 3MXHP 2WW8A 3KHYA 2HVEA 3NF7A 3SBMA 1R0CB 4BRNA 3Q24A 3TA0A 4CJKA 2E4LA 1N32J 4DTPA 2PY5A 1FFGB 4DX5A 5J1NA 2ROGA 4TKTA 3TJ9A 2PAVA 4CO3A 1PBUA 2YJFA 1PO6A 3KMQA 3NNAA 5AQIA 3ZZOA 4O0NA 5DG9A 1N5YA 4NXMF 3JTOA 4O44B 3PM9A 4HL9A 5E3RA 2AW0A 1CLQA 5J2NB 3NGKA 4NLQA 2DR9A 3HMJG 1BHLA 1HR0F 1BD6A 4KFBB 3H5XA 4F8RA 3T5LA 2YKAA 3IS9A 4PA1A 5F8LA 3IBCB 5LMUJ 4X4VA 1HNXF 4IRDA 3BEGB 1R59O 3BPDA 5A6PA 4IO8A 2FY8A 4LFBJ 4BQLA 4FJMA 2Y3YA 3CT9A 3VVUA 4M41A 4FF3A 3MAHA 3DLHA 4BDYA 2KU7A 3M2VA 1JLFB 3W9IA 3V9ZA 4LFAJ 2BDPA 3NGTA 3RMBA 4JI0J 1J6ZA 3K57A 3K7RA 1SL1A 1RBUA 5C24A 4KPYA 1N88A 1HHSA 1EQ0A 2V50A 2KFZA 3J81O 2PFFB 2VQFF 4L3NA 2YKOA 4DV7F 3G6VA 4M42A 3ZZ0A 4GC6A 2YWEA 1WOPA 2EK1A 2M70A 4DR6F 2HNDA 3BO2A 1X4FA 4BC9A 1X8DA 1VMBA 3R2CJ 1HNWF 2ADCA 3C6TA 4P2XA 3C15B 4AL6A 1F60B 4FK2A 2B3TB 3MTKA 4DX8H 4NLXA 3NGIA 1KHWA 1NK8A 3M5RA 3TABA 2W8LA 4DFMA 3WX8A 3P83D 3IN5A 3AOCA 3LP3A 4DV6F 3WDOA 3D0HE 4KHPF 1EP4A 3ZSZA 2PZSA 4BRDA 4ES1A 4WF9Q 1IBMK 3TZYA 4ELTA 1EWRA 3W2WB 2Z8QA 3ET6A 1QSLA 2ZC4A 2OTLS 1WOSA 4F3TA 2G9OA 3HSGA 3OBYA 3ENQA 1CJTB 3CJ1A 4BR4A 4NLWA 1I1GA 2LMIA 4ITSA 4OVLA 1WHYA 3LM2A 4I7FA 2YY3A 5BREA 5KT6A 2ZZNA 1KVCA 2VWKA 2XI2A 1U09A 1NJIO 3MMVA 5DMRA 1ZBTA 4X4TA 2BRKA 4PXEA 1KAXA 2Y1IA 2EFVA 4TU9A 5F2RA 4V1Ak 2CQPA 1H98A 2KXNB 5KT2A 1VIXA 4HTIA 4Y2CA 3AB4B 1DLOA 4H0XB 4F3OA 1IKXB 2AEMA 4FM2A 2V8PA 3VAKA 3E9PA 1FKOB 2NZCA 1ZM9A 2FF3B 4LSNA 4F4ZA 1NSKL 3KUEA 4M5HA 3MDFA 3OLBA 2P9CA 4CJRA 4CE9A 3DU6A 2BE9B 4JOUA 3D0IE 2RKIB 4A57A 1YZ6A 4JBCA 3JXUA 2DEJA 4M5DB 3KG4A 4FWSA 1RI7A 2J9CA 5F0UA 5SWMA 3LALA 3M30A 3IG1B 3MXJA 1NEEA 3M8QA 1S76D 1S22A 4OI1A 2BJ7A 4RW4A 4WQ5C 4NYOA 3O1WA 2M4MA 4L75A 3A5OC 1S1UA 2NLWA 4GKJF 1C0MA 2NPFA 3P45B 3AQOA 4DR3F 4WPAA 2WVBA 3BGFA 2R2RA 3DOLA 2UYTA 3R7SB 4AHTA 4DV2F 1XBWA 1I6JA 3J7A1 4N8NA 4FVUA 3GONA 1SJ4P 4KQZA 1UVJA 3TW0A 4DCHA 3EXYA 1V9OA 1DTQA 3DLJA 4L3QA 2W9CB 2HHHF 4FLUA 3WNHA 1HNZJ 1QM9A 3Q7CA 2YX4A 1VLYA 2Y1JA 2MLYA 5DDOC 2LEPA 1QSSA 2Q79A 4E8UA 4FKXA 3AARA 1VBZA 1M1HA 4CWBA 2DXFA 1ZM4A 3M8YA 2V4QA 2MB0B 1YZ7A 5LMNF 3MUTP 4HI1A 1W2BR 3HKZD 4LUBA 3SMSA 3ATVA 1EETB 2MKHA 3MMJA 4NI2A 5EXWA 1UEUA 4URQ