1T03A

Hiv-1 reverse transcriptase crosslinked to tenofovir terminated template-primer (complex p)
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
558
structure length
558
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
molecule keywords Synthetic oligonucleotide template
source organism Human immunodeficiency virus 1
molecule tags Transferase/antibody/dna
total genus 128
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t03A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t03A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t03A05
1RBSA 1C1BB 1C0UA 3CDUA 1N5YB 1D9DA 3AA2A 4ID5B 3C6TA 3PO4A 4Z4HA 4ED3A 1TKXA 1N4LA 4TLRA 5KG2A 1RYSA 1RTDB 3KTQA 1L5UA 4QWEA 1TV6B 4KHNA 3NH2A 2I5JB 1Q8IA 1WNSA 3L3UA 1XC9A 1ZBLA 3GYNA 4KB1A 2IS3A 3NF7A 5CZ2A 4KV8B 3H5UA 4CERA 4HUFA 2X6SA 3VQ5A 1NK8A 3QNOA 5KG0A 4IH7A 4IQXA 1ASUA 1S5JA 1UWBB 3S3MA 3H4BA 4EEYA 4CHOA 1TAQA 4ELTA 2HNYA 4CFBA 2O5DA 2VG5B 2BE2B 1WSJA 3GIMA 3OYJA 1JL1A 4I9LA 4NLPA 3KNAA 2X78A 3V9ZA 4FJ8A 2HNDA 1K1SA 5F9LA 5KFVA 3G6YA 4FJ7A 3L3VA 3V6DB 3H5XA 5EWFA 4DFMA 4GMJB 4H54A 3GIKA 2HNZB 4O3QA 1HRHA 4F4ZA 4NLXA 5HROB 4CGGA 4KB7A 3FFIB 3H59A 4AHRA 2B43A 1N48A 5KFGA 4FLUA 4NZ0A 3SFGA 4DL6A 4XIUA 1CXQA 1NHVA 4J9MA 4KHMA 3ITHB 2B5JB 4OPJA 4B08A 4KAZA 5F8MA 1TGOA 4Q0BB 4R8UB 3I8DA 1RAJA 4AHVA 2XY8A 4FW1A 1C1BA 1BIUA 4F4XA 5KFPA 2Z1GA 2KZMA 1N5YA 4M45A 1WSFA 4ID5A 4WYWA 2OYQA 3AA3A 4J2EA 1WNEA 3DLEB 3T5LA 1BISA 1SKRA 2B4JA 1RTDA 3M9OB 4DFKA 1KVCA 2G8HA 3SUOA 1TV6A 2E6LA 1S49A 2OPRB 1RBVA 4M3UA 3PJXA 4TXSA 3VN5A 2WTFA 1VSIA 5C42A 5J2PB 4ECYA 4Y3CA 3V9SA 2FLPA 4CECA 1NK5A 3T5JA 1ITGA 1NK9A 4I7FB 3KMQA 3TARA 3VQ7A 4NCBA 5KFLA 1UWBA 4WE1B 4K4TA 3OSPA 3OYBA 5FDLB 4KI4A 1ASVA 4PY5A 2VG5A 2BE2A 1WSHA 3KHRA 2W7OA 1D0EA 3O4QA 5K14B 3QERA 3RMCA 2V4RA 4FK4A 3V6DA 3NE6A 4B3OB 2FBTA 4RUCA 2DFEA 5KFYA 3AVNA 2HNZA 4NLTA 1SL2A 1F21A 3AVJA 5HROA 2W9AA 4ED0A 3DLBA 1EXQA 4ZPBA 3FFIA 1RT2A 4CK2A 4IR1A 3MR5A 1T3NA 4QWDA 3GILA 2W8KA 4U7CA 2IMWP 3M8PB 3BSCA 3MR6A 2KTQA 1GX5A 2VA3A 4YFUA 4KFBB 3RMAA 4LH4A 4QWBA 3VQEA 2IC3B 5FROA 2ASLA 3ITHA 2B5JA 3F9KA 3QEIA 4KRFA 4NLGA 4AHSA 4Q0BA 4R8UA 4OPKA 5EDWA 4FJJA 2KFNA 1DTQB 4OKJA 5DK5A 5DLFA 1RTIB 1KHVA 5KFXA 3VQSA 4EZ6A 4IRCA 5FRNA 1C0TB 4EYIB 4E7HA 1Z4UA 1QQCA 3VQDA 4M3TA 2OPRA 4IBNA 4CEFA 1GOAA 4O4RA 4F4KA 4ECTA 1J5OB 2AQ4A 4K4ZA 2Z1JA 4CFDA 2YNIB 1YT3A 1U4BA 3KIOA 3LAKA 4KTWA 5J2PA 1JLCB 5J2MB 5KFNA 1WSEA 4RNNA 4KPYA 1RT3A 4RNHA 4I7FA 4IH5A 1NJYA 4KKOA 4DQSA 2GIQA 3HVWA 3VQ8A 4ECWA 4AHUA 4JUZA 4DLGA 2XI3A 4HVJA 3I5BA 5F8LA 3CDEA 2JEIA 1QS4A 1ZBUA 2XGPA 1S97A 4NRTA 3VQ9A 4FS1A 3AVMA 3FQKA 2D41A 1RNHA 3TAEA 4F3TA 2P5OA 2ZQBA 1EETB 3SFUA 1JLBB 2HHTA 3RAXA 1C0MA 1YVUA 4K4YA 3BJYA 1LV5A 4MKAA 3N6LA 4Q45A 3P5JA 4ECZA 3TQ1A 4B3OA 3PX4A 3V9UA 1KCFA 1Z26A 3OHBA 4ECUA 3T19A 3PV8A 3RWUA 3DDKA 4ZP6A 4Z0UA 4AHTA 5KT5A 4DTRA 4C8MA 2AGPA 2BANB 4GC6A 4ZPDA 2IAJB 3U3YA 3M8PA 2ZKUA 4FJHA 3AVGA 4KFBA 1QAJA 2IC3A 3V6JA 3NGYA 4OKKA 2HHSA 5J2NB 3CFPA 2AX1A 1I3AA 1C1CB 4CJ5A 1QSLA 2BQUA 3JSMB 3BDPA 1DTQA 3B6PA 3K58A 4HUEA 1TP7A 1RTIA 1CXUA 4O4GA 1RTHB 2Q3SA 5KFJA 1LWCB 5KFSA 2YKMB 2IM0A 1C0TA 4ZPAA 4FS2A 4ECXA 2RPIA 4NLDA 4RW6B 2XCAA 1B9DA 2Z1IA 3TABA 4M3RA 3VQQA 4QW8A 3SUQA 4MKBA 3RBEA 1BQMB 3V9WA 3OYLA 2BR0A 2AGOA 4CGJA 2W7PA 4DSEA 1RDCA 2YNIA 5C24B 1S10A 2OPPB 2R2TA 4KAIA 2ASDA 4EBEA 4RU9A 2RN2A 4IH6A 1RCHA 4HYKA 1BHLA 3S3NA 4K4UA 3L8BA 2ZE2B 1IKXA 5I3UB 5KFKA 1VRTB 4DFJA 3F73A 2HHVA 1HYVA 1NK6A 2OA8A 2D3ZA 2R2RA 3QIOA 4C8LA 3IGVA 5KFOA 1J9AA 1K6YA 3MFIA 1EETA 4KTQA 1T94A 5C5JA 3LANA 3VQBA 4CJQA 4N5SA 4BE2A 1KFSA 3UIQA 4K8ZA 3TVKA 1QAIA 3WNEA 1Q9YA 4NLRA 3EY1A 1VSFA 4CJUA 3CDWA 3RB4A 4B9SA 4RUAA 4FM0A 3NHGA 4F8RA 5KRSA 1EKEA 4ED1A 1TL3A 2BANA 3M8SA 1A5WA 3NFAA 2HW3A 3NAEA 1T03B 4CE9A 2AU0A 3H08A 3CJ4A 1TL1A 1CZ9A 2IAJA 3CJ2A 2HAIA 1NOZA 1NKEA 4ZPCA 4RW7B 1D9FA 4AILC 1HARA 4PQUB 5J1EB 3N6MA 5KFAA 3Q8SB 5J2NA 1ZBHA 2R8KA 3M8QB 4KO0B 1C1CA 1A5XA 1NK7A 4HUGA 4IFVB 3JSMA 2WOMB 2AGQA 4LY7A 3IRXA 1JXLA 3HT3A 4B9TA 4J9SA 4JS4A 1RTHA 5F8HA 4YMEA 3UQSA 1LWCA 4W5TA 1N6QB 1S0MA 2YKMA 1S0OA 3HHKA 4RW6A 4ZMMA 3DM2B 2O4IA 2ITGA 4DSJA 1MMLA 3TAPA 3MEDA 2VG6B 1BQMA 5F8IA 2ALZA 3B6OA 1C2PA 2IM3A 3V6HA 4BDZA 3QZ8A 5C24A 5HRNA 2OPPA 1S48A 3I0SB 2YNHB 4KHQA 3BGRB 1KHWA 1TKTB 2ZE2A 3I5CA 5I3UA 4LSNA 4YR2A 1YTUA 1VRTA 1TK8A 4Q5VA 1TK5A 1BCMA 4M94A 1FXXA 1IM4A 3C94A 4DTUA 1NKCA 1QE1A 4MK8A 2BRLA 1VSJA 1WN7A 1BCOA 2GIRA 4Y1DA 3ULDA 3LP3A 3NBPB 4LH5A 3ZSRA 3NGIA 4DLEA 4F3OA 3EPGA 2FVRA 3HM9A 3KLFB 4W5NA 2J6UA 4CEDA 3LZJA 3BSOA 3DOLB 4NLWA 4MIBA 3G0ZA 1KLMB 4NYFA 3KKRA 1T03A 2HMIA 1IKVB 1S0NA 4RW7A 2J6SA 3BSAA 5J1EA 1S1XB 4JV2A 4O44B 3M8QA 4O55A 4WYLA 4KO0A 3O3FA 5DQHA 4CGHA 3E51A 3OY9A 5KFQA 4PUOB 4CHZA 4WXOA 3KK3A 1WSGA 5KT7A 3V6KA 3K5OA 4FZZA 1NHUA 1KVBA 4ZHRB 4Y2AA 3OYCA 3IGNA 1N6QA 3QO9B 2AWZA 5KT2A 1FKPB 3SUPA 1XHXA 2HWIA 4CHPA 3DM2A 4CJFA 2G8IA 1JLAB 3VQAA 4O3RA 3WNGA 3H5YA 3L2WA 1LWFB 1BQNB 4FJKA 4CJ3A 2F8TA 1J54A 5KFMA 1NJZA 4CJ4A 3S9HA 3SV3A 4CF2A 1L3VA 4ECQA 4R0EA 4OKEA 1T7PA 3I0SA 4URGA 4CEQA 3PW4A 2YNHA 2JEFA 4KHUA 3BGRA 2EC0A 4W5RA 3CM6A 1TKTA 1S9GB 2V0NA 4M3WA 3T5KA 3NH1A 3SCXA 2HVHA 2AJQA 1HQUB 3ZT2A 1REVB 3D0PA 3KLEB 4CHYA 3PX0A 4O3PA 3PW2A 3ZSQA 3QGGA 4EP5A 2UVWA 4Y2CA 3ZT3A 3VQPA 4DTJA 3NBPA 2NUBA 4W5QA 1B92A 4H4MB 4MK7A 4FVMA 4ELVA 3HPOA 1U04A 3QEXA 3H4DA 2YNGA 2G8KA 2P51A 1IKYB 2R8GA 4FXDA 2OZMA 1KLMA 3K57A 2DPJA 2W42A 1I6JA 2BRKA 1KFDA 3OYKA 4HCCA 4HCBA 2C22A 5SZTA 1U09A 2YV0X 4O3NA 4DTOA 3MEGB 3SYZA 1RDDA 4J9PA 4O44A 2HHQA 2DFHA 3AVCA 4AHCA 3N6NA 1RT4B 4PUOA 3LALA 4RW4B 2IM1A 5F8NA 4BDYA 3KK1B 3OYIA 2I5JA 4KHWA 2R2SA 1BGXT 4ZHRA 3T1AA 3ISNC 3QO9A 4B8CA 1FKPA 4KV8A 3AVFA 5EUHA 1JLAA 2HB5A 4I2PB 3QETA 1SL0A 4Q44A 1BQNA 4DL2A 1WSIA 1XR6A 4NYNA 2Y1IA 5JS1A 4FM2A 4O0JA 5KG4A 2FBVA 3AO3A 4EP4A 3NL0A 3C6UB 2XHBA 2C2DA 1FK9B 1CSJA 3QNNA 5L1JA 1BI4B 1RT6B 1S9GA 4F2SA 2IDOA 4DL4A 2UVRA 3THVA 4PA1A 2G8VA 4KB0A 1HQUA 1REVA 3MECB 3KLEA 1JL2A 3UPFA 4MFBB 3EZUA 4FLVA 1XI1A 1LAVA 5T14A 3L2QA 4DTNA 4RW8B 4IRDA 1L3SA 4FJXA 4M41A 3KD1E 4H4MA 3BR9A 4KHRA 5KFWA 3TAFA 3ZSWA 1CLQA 4YP3A 4LQ9A 4E7IA 1HYSB 4ZP9A 3QZ7A 3HPGA 2HVIA 2XI2A 1SH2A 4FBTA 1MU2B 3HPHA 2G8WA 3V4IB 2WCXA 4UQGA 1IKYA 3AA4A 4Z4EA 4WZMA 3G6XA 3NF8A 1TK0A 2R7YA 2DTUA 1S4FA 3QEWA 4O5BA 3P1GA 1ZBFA 3DI6B 4FZXC 4MIAA 2IBKA 3TAQA 3MEGA 3RB6A 1RBUA 3RMDA 1SV5B 2VWJA 4NRUA 2FC0A 4CJPA 2WK4A 5KFIA 3DLEA 2JEJA 2EX3A 1WAFA 1RT4A 3AVIA 4CJRA 3P83D 4JRPA 3L2VA 4RW4A 4CEAA 3KK1A 4CGIA 3AVBA 3QLHB 1WAJA 1KSPA 3ZCMA 4AH9A 4FJLA 1JLEB 3KMSA 5DG8A 1S1UB 2KFZA 4NCGB 4I2PA 3PUFA 4Z4GA 3MAQA 2BDPA 3CWJA 3KHHA 2IA6A 4WE1A 4E19A 3NCIA 3OVNA 4H8KA 2JLEA 5FDLA 3C6UA 5E41A 1JIHA 1FK9A 3ZSVA 1RDBA 4O3OA 4E0DA 1RT6A 1UA1A 1C6VA 3BQ2A 4K8XA 4DQQA 4QCLA 3SPZA 3G6VA 3IAYA 2D7SA 5K14A 5DG9A 4CGFA 3ZSYA 4DQPA 4ED8A 3A2FA 3QIPB 3JYTB 2I1RA 4CEEA 4MFBA 4CF9A 2XY6A 4XPCA 4FZYA 2JC1A 4LQ3A 1R0AB 4QWCA 2VG7B 4RW8A 3OSNA 2W9CB 1ZTWA 2A1SA 2XC9A 1Y97A 1HYSA 1U45A 3NH0A 3MR3A 4N56A 4G1QB 1HPZB 1MU2A 5L1IA 2GBZA 1DTTB 1GX6A 3V4IA 2O4GA 4CFAA 2G8UA 3NAIA 4EYHB 5HBMB 2E6MA 2VWKA 2C28A 4WXWA 4DEZA 3V1QA 1RYRA 4M3YA 1JLGB 4O3SA 4J9LA 3DI6A 1S9EB 2IOCA 3RRHA 1QUVA 3DMJB 1SV5A 3L2RA 3K5LA 3LZIA 4NLSA 1ZBIA 3ICLA 2BQ3A 5F9NA 4B9LA 3QLHA 2OH2A 5CZ1A 1X9MA 2KZZA 4Z4CA 1J5OA 3HJFA 2FVPA 3LWMA 4ZP7A 4EO8A 2IJFA 1JLEA 2JC0A 3PX6A 1JLCA 5J2MA 4NCGA 1L3UA 4OVLA 4ZTFA 2HHXA 3ZT4A 2F8SA 3H2LA 1RTJB 2DY4A 3CYMA 1K1QA 4I2QB 5CY4A 4E7LA 3MXIA 3O3GA 4CIEA 4EZ9A 4IR9A 1SKWA 5EWGA 1TKZB 1JLBA 1S1VB 3OL7A 4J2AA 4RZRA 5KG1A 1RDAA 2QV6A 4DL3A 3QIPA 3JYTA 1HQEB 1Q9XA 3PW5A 1GOCA 2LSNA 4Q8FA 1CZBA 1IKWB 4C8KA 1XHZA 2XRIA 1R0AA 4KREA 2VG7A 5KG3A 1T8EA 2C2EA 2X74A 2W9CA 4BWMA 4DTSA 4Q43A 4E89A 4ECRA 4EO6A 4G1QA 3G10A 1HPZA 4BE1A 4TY8B 4E7KA 1DTTA 3V81B 3KJVB 4FJMA 1LW2B 2FVQA 5HBMA 2ASJA 2DFFA 1VSDA 3PR5B 3CVKA 3RR8A 3KLHB 1JLGA 3HP9A 2OZSA 5C25B 3RMBA 4XPEA 4C8OA 4MK9A 2E9TA 4CFCA 2IJNA 3DMJA 2A1RA 3IG1B 4Y1CA 3HXMA 2R2UA 3DLKB 4FJGA 3FQLA 1U49A 2FBXA 1U47A 1TAUA 1BIZA 3KLGB 1QSYA 5DLGA 1RA7A 2F8EX 5L9XA 3KD5E 4JV1A 3ASMA 2GV9A 4W5OA 2HWHA 4J9OA 4BACA 4DL5A 3MEEB 1OS5A 4B9UA 4BDPA 2FVCA 4F4WA 3ZT0A 4ZP8A 4DS5A 4J9QA 4NLUA 4I2QA 1S6PB 3E01B 3K59A 3WNFA 2D0BA 3V1OA 4CK3A 4DU1A 3OS1A 4CJWA 1TKZA 3AVHA 3GV7B 1S1VA 3V9XA 3I5AA 3V1RA 4DWIA 1RT5B 3AO4A 3NF6A 4CCHA 3HSTB 1NK0A 1HQEA 4WFZA 1TKDA 3L2UA 1U48A 1UAXA 1IKWA 1SH0A 4QOZB 3BQ1A 5HRSA 1X9SA 3PO5A 3CJ3A 3ZSXA 3KK2B 2WB4A 2QXFA 3QINA 5FRMA 4H4OB 3SPYA 4RW9B 1VSKA 4EBDA 4FJNA 5KFRA 3UR0A 3U6FA 4ZVFA 1ZTTA 1DLOB 5I42B 4URQU 3AO5A 4M3ZA 4PQUA 4N41A 2YHBA 3AA5X 4IFVA 1C1AA 4M42A 3KLHA 2WOMA 3GQCA 4J2DA 1RT1B 3HP6A 3KOAA 5DGAA 3FRZA 2D0AA 3LP2B 3IG1A 3M9MB 3MFHA 4K4XA 3DLKA 2R8HA 1KVAA 2ATQA 3Q8PB 1FKOB 5HP1B 5KRTA 2VG6A 4CIGA 3KLGA 4ED6A 3RBDA 1TQLA 2YHAA 3HVAA 4HTUA 4JLHA 1NNDA 3NDKA 1GOBA 4EBCA 3D5MA 3GIIA 5KFCA 4KHSA 1SL1A 3AVAA 4OL8A 2R8JA 3MEEA 1NJXA 4B9MA 5C42B 3TAMB 3PR4A 4OGCA 5CYMB 3DRRB 3QEPA 3CQ8A 3ALYA 4ID1A 3DLRA 4M3XA 3DOKB 3I0RB 3GIJA 3PY8A 3VA3A 2ATLA 2EHGA 1X1PA 2QE5A 1S6PA 3E01A 5F8GA 2GC8A 4FBUA 2HHWA 4FW2A 3PVXA 4YQWA 2FBYA 4IG0B 3OYAA 4WFXA 4BWJA 3AV9A 5KG5A 3LP0B 4C8NA 4L8RB 1RT5A 3BSNA 3HO1A 4DMNA 4IRKA 3KKSA 3SI8A 4CESA 3KLFA 5DQIA 1IO2A 1NKBA 4K50A 5KFBA 2FJXA 3H5SA 4K4SA 4B9VA 4URSA 3KK2A 4DTPA 3DOLA 4RNOA 4H4OA 2W9BB 4RW9A 4K4VA 4DSLA 3GV5B 2V9WA 5L1LA 1RT2B 2JEGA 1W0HA 1DLOA 1IKVA 5I42A 2QK9A 4TQRA 2C2RA 5KGWA 4FJIA 1EP4B 1S1XA 5HRPA 2WONB 2PYJA 1WLJA 4RG8A 4QPXA 3OYHA 3CFRA 3IN5A 1SUQB 2R8IA 2KW4A 3QYYA 3OLBA 2E9RX 3PJWA 1RT1A 5JS2A 1RBRA 3SV4A 1JX4A 4DSIA 3DRSB 3LP2A 1ZETA 5JUMA 2HHUA 3RTVA 4FLTA 4G3IA 3NAHA 4KBIA 4OLAA 2PYLA 2UVUA 1FKOA 5HP1A 3SNNA 3PW0A 3O3HA 2UUTA 3CM5A 1LWFA 4TSXA 1NJWA 4YR3A 3T3FA 3WNHA 5F8JA 3HVRA 2XGQA 1QHTA 1KLNA 4ZVHA 4IFYB 4CIFA 5HLFB 4Q8EA 4ZVGA 3TAMA 3Q8RB 1S1TB 1W9HA 5CYMA 1VSHA 3DRRA 1Z25A 1RT3B 3U3GA 4ICLB 4KKOB 3ZSZA 4YNQA 2YNFB 4J9NA 3DOKA 3I0RA 5KG6A 3LDSA 4LD0A 1SKSA 2DPIA 3T5HA 4CEZA 4DG1B 5KFUA 3ZSOA 4IG0A 3TANA 3Q8QB 3TWHA 5KTQA 3LP0A 1T05B 4CJEA 4RNMA 3C95A 1VSEA 1S1WB 4KI6A 3DRPB 1JLFB 3TI0A 2P5GA 5KFTA 3OYGA 4JS5A 2W9BA 2CJQA 4I9QA 4M95A 5KI6A 2RF2B 5SWMA 3SQ4A 1JLQB 4TY9A 2XY7A 2FLNA 1QTMA 4FLYA 4ECSA 3QESA 4CK1A 2RKIB 1EP4A 1VSMA 3OYMA 2WONA 4DL7A 3RRGA 1D5AA 2FLLA 1W25A 4HHTA 3MXJA 3CJ5A 4NLVA 1SUQA 2QKBA 1LWEB 2Y1JA 4J2BA 3DRSA 2ILZA 4K4WA 4B9NA 3QIDA 1JXEA 3DYAB 2BQRA 3K5MA 4E7JA 3SUNA 1X9WA 3LAMA 5L1KA 4OJRA 4O4GB 4IG3B 2E9ZA 4CJSA 5KFZA 3UDLA 3EYZA 3SQ1A 4R5PB 3FDSA 4FLZA 5EWEA 4CF8A 4CF1A 3OYFA 2FJWA 1IG9A 4IFYA 4LSLB 5HLFA 4CHQA 4CGDA 1S9FA 4OGEA 1XR5A 1S1TA 4JRQA 3K2PA 1BI4A 2PZSA 4ICLA 4ECVA 3OS0A 1HNIB 2YNFA 3D45A 3LPUA 5EU7A 4NLQA 1IKXB 2D5RA 4ZTJA 3MECA 4DQRA 2AX0A 5CYQB 3IS9B 4DG1A 3QEVA 3ZT1A 4BE0A 3H40A 2XO7A 4N76A 3PZPA 1LW0B 4FM1A 5KGXA 2RDJA 4TN2A 2B6AB 1T05A 3PHEA 2CKWA 1S1WA 3DLGB 3EPIA 4E1MA 3DRPA 2RDIA 4FLWA 4E3SA 3TAGA 1JXBA 1JLFA 3OJUA 4IOBA 3VQ6A 3OYDA 1S6QB 2ILYA 3OHAA 1BL3A 3HVTB 3OL6A 4WFYA 1YTAA 2RF2A 1JLQA 1TL3B 3OJSA 1HNVB 4IKAA 3AVLA 3AO1A 1TL1B 4DSKA 3BREA 2RKIA 4DTXA 3RAQA 3M9NB 2QKKA 3KHGA 1XWLA 4ED2A 3TR8A 4F50A 2XWYA 4PWDB 2P1JA 4ED7A 2GUIA 1LWEA 4Y34A 4DU3A 4RNFA 5DGBA 4ELUA 3IRXB 3RB0A 3DYAA 4J9RA 4MQ3A 2OPQB 2G8FA 5J2QB 4NYZA 1NOYA 3LPTA 4NCAA 2YKNB 4IG3A 2F96A 1S1UA 1KTQA 2WRMA 3HL8A 1RDRA 4IDKB 4CF0A 1B9FA 3OL8A 4R5PA 3MEDB 4IKFA 3D28A 3VQCA 1J53A 4E1NA 5KT3A 3OYEA 2ZD1B 3BQ0A 4FJ5A 3KLIB 4LSLA 5DG7A 1G15A 4FLXA 1VSLA 1HMVB 1JKHB 4DF4A 1HJRA 2Z1HA 2JGUA 4DS4A 4DF8A 4B8AB 2ETJA 4YR0A 4KTZA 4ZVEA 3PW7A 3HYFA 1HNIA 5HRRA 3S3OA 1VK0A 4TQSA 4NLYA 3VA0A 4LSNB 3MR2A 4QAGA 3DLHA 4HKQA 1ZYQA 1N56A 5CYQA 3IS9A 3SJJA 4DSFA 1UA0A 4OLBA 1LW0A 1QE1B 4DQIA 4DTMA 4CEBA 2B6AA 1TVRB 4MH8A 2KQ2A 1RT7B 1ASWA 1LAWA 5JXSA 4QW9A 3OL9A 3OS2A 3DLGA 5KFHA 4CEOA 5KG7A 4NLOA 3SQ0A 3NKYA 4Z4FA 5D3GB 3CJ0A 1VRUB 5KFFA 1S6QA 5T7BA 3HVTA 3NGDA 3LP1B 5DMRA 2X6NA 1HNVA 3EZ5A 4XO0A 3GV8B 2HMIB 3RB3A 1S9EA 4CJTA 3QGIA 2OPSB 2J6TA 2PY5A 3KLVA 4X2BA 1C0UB 3C6TB 4PWDA 2UUWA 3AVKA 3NGZA 4KHYA 4QWAA 1TKXB 2UVVA 4FK0A 3SZ2A 3LWLA 3ISND 2VA2A 1D8YA 4J9KA 3KK3B 1RA6A 2OPQA 4TYBA 3HK2A 5J2QA 3NF9A 4O0IA 5KFDA 3CIZA 4CJKA 3SI6A 3MF5A 3MXMA 3CFOA 2YKNA 4FK2A 3M8RA 4DU4A 2D3UA 4IDKA 4FJ9A 4F4YA 3MTKA 2XCPA 3H98A 3OYNA 4KE5A 3CG7A 2WHOA 1RILA 2ZD1A 1RTJA 1UOCA 3KLIA 2FJVA 1YVFA 2W8LA 5KFEA 2D0CA 1HMVA 5KT4A 1JKHA 1A5VA 4TYAA 3NMAA 4N47A 4JV0A 2HNYB 1NK4A 3HKWA 2V4QA 4DFPA 2FVSA 4CJLA 5DQGA 4KSEB 4WZQA 3OLAA 3FSIA 2IGIA 2HNDB 1EX4A 1RBTA 4GVMA 1KRPA 1TVRA 2IM2A 1I39A 1HYZA 1RT7A 1SH3A 4FCYA 2E4LA 3CO9A 3KHLA 1IH7A 2BGGA 5KT6A 1QSSA 4FYDA 1XR7A 4TY8A 4CJVA 3V81A 3O4NA 3KJVA 1O1WA 5D3GA 1D1UA 1VRUA 2XY5A 3SQ2A 4Z4IA 4U6PA 3K5NA 2YNGB 1LW2A 3AO2A 3QGHA 3VQ4A 3LP1A 1L3TA 3RR7A 4GW6A 5C25A 3G86A 4F2RA 4GC7A 4CHNA 2OPSA
chains in the Genus database with same CATH superfamily
1VFJA 1RBSA 2VWBA 1AUDA 2X1BA 1IBKK 1C1BB 3WXKA 1UFWA 2O8EA 2HWTA 3IXQA 4ID5B 2B4UA 1V6HA 2DIUA 4C0BA 4TLRA 5KG2A 4M63C 2ZH7A 3OQ2A 3ENBA 2CQPA 3O1BA 3GONA 1NEEA 3NH2A 2KT5A 1WNSA 3R1HA 1OH6A 2XQCA 4K59A 3MXHP 2IS3A 3NF7A 2DRDA 4DUYJ 4RL1A 2PT0A 1HNZJ 1M5VC 1FFGB 3MD1A 4IQXA 3GL1A 1ASUA 2G2OA 4DV5F 4MAKA 1YG0A 4OHXA 3L7OA 2BM1A 3TQEA 4EEYA 1TAQA 4ID8A 1NCLA 2HNYA 4FKYA 1T9XA 2N4DA 5E26A 1KQSM 2IDLA 4I9LA 3NGUA 5JVGQ 3KNAA 2X78A 4FJ7A 2F3JA 3L3VA 2CPIA 4CD1A 2EFOA 3GIKA 2IRXA 1HRHA 3QT5A 4NLXA 5HROB 3W64A 5D4NA 2UXCK 4Y0FA 3R97A 4AHRA 5KFGA 4JI2F 3R5AA 2CQHA 3QJPA 3OTOK 1R59O 3SFGA 3KWGA 3PFOA 1FWKA 4ZPTR 4QIEA 5IZHA 4NA3A 4B08A 1W7AA 2HEKA 1TGOA 1FRXA 3LM2A 4F4XA 5KFPA 3NMUA 5C0YA 1N5YA 2DNQA 4J2EA 1UJ4A 3DLEB 2CZVC 3GTYX 5E0OA 3T5LA 5HN0A 2B4JA 1RTDA 2QZ8A 4DFKA 2G8HA 1HWIA 3I31A 3SUOA 1S49A 2CFXA 3O1WA 3QBXA 4Z7YA 2DRAA 2Y1LB 4F26A 2WTFA 1VSIA 5C42A 4Y3CA 4B3RF 2FLPA 3HSZA 3KFWX 3SBMA 2QL5B 4M1KA 1RWPB 4NCBA 3VQ7A 3DHWC 5KFLA 4WE1B 2NLXA 1G99A 3BDEA 5FDLB 4PY5A 3ATUA 1Y5LB 1NDCA 3KHRA 3EDQB 4GV3A 3H3NO 2UUCJ 1D0EA 3B8AX 3O4QA 3R8EA 2P9LA 1X5OA 4E98A 4BGAA 2Z2ZA 3NE6A 2FBTA 1J5EK 2EG1A 3J81U 3P39A 4I1TA 2BUPA 3JAMU 3DLBA 4PYAA 4K2XA 1EXQA 3BYRA 1VGYA 5BPLA 1P8ZA 3D2FA 2L9WA 4QQBA 1EWQA 5KPZA 2JOQA 4A5BA 4KFBB 3LM9A 2C3MA 4QWBA 1XMQJ 3F9KA 4KRFA 1GLFO 4NLGA 4AHSA 3PSFA 4B9QA 4Q0BA 4R8UA 3I56S 5JLHA 2MZTA 5GADP 2W6LA 4DR7J 5DK5A 5KFXA 1URNA 1XUPO 4EZ6A 1HPMA 1NGEA 4EYIB 3KG0A 1Z4UA 3B6BA 1QQCA 3VQDA 4M3TA 4IBNA 3D6FB 2ZH8A 1GOAA 4CEFA 3F41A 4O4RA 3ZXWA 4B1UB 4BR9A 3UCZP 3PIPL 4ECTA 4NI2B 1U4BA 2YNIB 1YT3A 3LAKA 3MMAB 2B9WA 5J2MB 1WELA 3MHYA 3TVZA 3IP0A 4CIOA 5HQMA 3LDPA 3AA9A 4USWA 1RU2A 4I7FA 4IH5A 1NJYA 3PRDA 5E84A 2A10A 5EGYA 3MDQA 4DCHA 3DRXA 4CRJA 4M5NA 3VAFA 5ELZA 4NRTA 1K73O 4X4QA 4ZVQB 3P38A 2WW4A 3FQKA 4HHUA 2D41A 2W2OP 1AW0A 4RKUC 1U1OA 4DV1F 4F0KA 4UY85 8ATCB 1YVUA 4CLPA 4MKAA 4C9DA 4AQYF 1VQ5S 4FZVA 2BA9A 3VMFB 4B3OA 1KCFA 3PV8A 3RWUA 3DDKA 4B3SJ 4ZVSB 2BANB 4C0HA 2YBVA 1VIXA 2MKCA 2YKPA 3QWPA 5KOXA 3M8PA 4CZCA 3AVGA 4F0MA 2IC3A 3V6JA 3ID8A 2HHSA 4A61A 2AX1A 2HZAA 1XMOK 3JSMB 3Q2TC 3T69A 1TP7A 2YWKA 1RTIA 3LUYA 3TEGA 3GDQA 4O4GA 2ZZMA 1RTHB 1Q5YA 2HGNA 1WOQA 2Q3SA 1T95A 4JAXA 1C0TA 2RPIA 2XCAA 4M3RA 4K43A 1BQMB 2MHEA 4OZNA 4RPFA 2J9EA 5AQSA 1RUSA 2BJ8A 6FDRA 1S10A 2R2TA 4UOFA 4WTOB 4DPUA 2RN2A 3KUHA 4XH4A 2XSFA 4HYKA 2J76E 4FYVB 4DV4J 1T9YA 2V67A 4CWBA 3L8BA 4J9UE 5KFKA 1TUVA 2HHVA 1HYVA 1ZOTA 3Q8VA 5LSLA 1N88A 2M52A 2FJAB 5KFOA 1J9AA 3OUYB 2MKYA 4JI4F 3PSIA 5E33A 1EETA 4ZPVR 3ZZYA 1EWRA 3J7ZO 1T94A 2XG8A 4OI1A 4KHPJ 1KFSA 4K8ZA 3TVKA 3AB4B 4A8FA 3WNEA 2QEXN 2VUGA 1VSFA 1WG1A 4CJUA 4JYAF 3CCES 5T7LB 1F3VA 1R31A 3CDWA 2CQ3A 1M1KT 1HI1A 2E1ZA 4KGKA 3NHGA 1EKEA 1TL3A 1FA0A 2ZHOA 2DR7A 1A5WA 3H08A 3CJ4A 2E7XA 1CZ9A 3CJ2A 2PFFB 2FJBB 3TO8A 3DGPA 4F25A 2FSJA 2HIQA 5J1EB 3N6MA 5HMWA 5J2NA 2ZH1A 3BS9A 1C1CA 2XS7A 4BR2A 4IFVB 2NYIA 5DS7A 4LY7A 5DDRC 3CJKA 3HT3A 5CR4A 1R6YA 4H0YB 5F8HA 1IBLJ 1LWCA 4W5TA 3WEEB 3ILJA 2YKMA 3THYB 4RW6A 4D3GA 1OMSA 1UPPA 2VG6B 1PC4A 5HOOA 2KG1A 2LQBA 3B6OA 3ZFVA 3EE8A 3QZ8A 1TL5A 5M1KA 1X5SA 2BKOA 1MN9A 2QWMA 2G0JA 4KHQA 2GQQA 1KHWA 3CCLS 2L9NA 1BCMA 1FXXA 3W0LA 1F9HA 3CD6S 3C94A 4DTUA 2C3OA 4MK8A 1E6YA 3QJJA 4Y1DA 1WD6A 3NBPB 4NXMJ 4DLEA 2MHNA 3KLFB 1IWAA 4FNHA 3I96A 1CJTA 3K8VA 3BSOA 1WI6A 4N7TA 1HHTP 2F4VJ 3G0ZA 2B4PA 3A3NB 1T03A 3AJ2A 1T11A 4TLQA 5HVFA 1IJJA 4RW7A 1X3NA 4EUVA 2J6SA 1S1XB 3FZMA 3M8QA 5AXNA 1NG9A 4KO0A 5DQHA 2YPZA 5KFQA 4WXOA 4C7QA 4WCEL 2ADBA 1WSGA 3IA0A 2VHGA 1M5KC 3K5OA 4FZZA 1NHUA 2CYYA 3FLCO 2K1RA 3IGNA 2E5LF 5LL6Z 1N6QA 1CJUB 2ACMA 2AWZA 4CO1A 4A8SA 2YH1A 1FEHA 3SAFA 4I6MB 4JEPA 1FJGK 1NSPA 4USJC 5MAOA 1LWFB 1ZBSA 4PXBA 4FWOA 3S9HA 1UZHA 1L3VA 4YHHK 3C15B 4ECQA 4R0EA 1Y4ZB 3HX9A 4KHUA 3BGRA 2EC0A 3D66A 4W5RA 1N36J 3SCXA 1R7IA 2OSRA 4RWTA 3ZT2A 3DN9A 1N0VC 3J80U 1KVIA 4CHYA 4I64A 2Q0RA 3PX0A 3PW2A 2AV5A 5EY4A 4OYWA 2DD8S 2UVWA 2ZH5A 4Y2CA 2KHCA 3ZT3A 3VQPA 4DTJA 4W5QA 2JFDA 4O8UA 4FWQA 4MK7A 3TZYA 3HPOA 2G8KA 1IKYB 1EJ7L 1KLMA 1SC6A 2BRKA 1VQ6S 4HCCA 3H2VE 1Q8LA 4ZLLA 4DTOA 4M5DB 1WI8A 3GU0A 3SYZA 1RDDA 4EFHA 1GTEA 3AVCA 1WBDA 4NZ7A 2D9OA 2Q43A 3QB0A 1XNQK 1J2VA 4LR9A 2UUBF 2M4MA 3ISNC 3GFXA 1TUYA 2GIFA 1HKAA 2HB5A 4C3MA 4GKKK 4K5SA 1BDGA 3DLLQ 1FEEA 1Q86O 1FDAA 3GPAA 3NL0A 4FWLA 1BY9A 3AHPA 3P5BP 2XMWA 2KRRA 3THTA 3TRGA 4CLTA 2XHBA 1FK9B 3UCUP 1F60B 1S9GA 4ZPWR 4KR0B 3THVA 3QGPA 1P8GA 1Z1ZA 3M1VA 2A3JA 1JL2A 3JXUA 3TUPA 1FXRA 4HEA9 3LGMA 3AXMA 1VISA 2H5JB 5BR8J 4BY9C 2NXEA 3L2QA 4ES2A 4DTNA 1VAZA 4X62K 4RW8B 1O8BA 3BR9A 4KHRA 2KYXA 1IR2A 4LQ9A 5ETPA 1YJ7A 1OO0B 4ZP9A 2VQFJ 2FD2A 1IXKA 3UN2A 2P9GA 2RHSB 3DJCA 3AA4A 4Z4EA 5B7WA 1M1HA 1U1KA 3NF8A 1VDHA 3OFGA 5DO2A 3OBYA 1RADB 1S4FA 4O5BA 1ESVA 3THPA 3P1GA 1ZBFA 1TUUA 3DI6B 3G4SN 2DNHA 4LF9J 4DV0J 1WF1A 2QA2A 1WHWA 2AT1B 2WK4A 4ENOA 3KDNA 3K7RA 2JEJA 1WAFA 1AZSA 4OI2A 3ULEA 3RVCA 4RW4A 4CEAA 5I3PA 1NU4A 3KK1A 4DV7K 4ZN3A 2EI5A 1WC1A 4A47A 3RUBL 2E2OA 3A5OC 2AEMA 1TMJA 5GADI 4BRLA 3CC2N 4AH9A 1WF2A 4DB3A 5DG8A 5CD4A 2KFZA 4NCGB 5HMZA 2BJ9A 4Z4GA 4DPWA 2ZOGA 5BPNA 4YDUA 2I38A 3KHHA 1ITPA 1BA1A 1TL7B 5M2RA 4H8KA 2YKQA 3BZQA 3R6GB 1GFWB 1RDBA 2HHHJ 1C6VA 5AQQA 3IAYA 2GMLA 2DXDA 2ZUGA 4ED8A 3A2FA 2DR6A 4CEEA 4ZCIA 4CF9A 2XNRA 4C48A 4FL9A 2MQPA 3H90A 4BVPA 2JC1A 1R0AB 5D78A 1H2TZ 5CZXA 2J7KA 1ZTWA 3GJTB 5AQYA 3QPIA 3EZOA 1U45A 2QWPA 1J27A 2NRRA 5L1IA 2GBZA 3V4IA 1YJNN 4C2MA 3VAIA 5BYSA 2PAVA 2VH7A 4I6WA 4EYHB 3F44A 2IMOA 1FO1A 3V1QA 1JLGB 1S9EB 1R43A 2V8GA 2IOCA 3RRHA 2HGLA 1QUVA 4JI5K 2FHJD 1X3MA 1HBMA 2CPJA 1XK8A 1NHKL 5CZ1A 2R7QA 2KZZA 4M7XA 2VOPA 3MI7X 1J5OA 2B3TB 2ZOMA 4ZP7A 1KVJA 2IJFA 1H38A 1JLCA 3EDRB 4HTIA 4A8QA 4ZTFA 5JLFA 4JI0J 3THWB 2ZWOA 4I2QB 3A8IA 1IBMF 1RHRB 4CIEA 3M8ZA 3QT8A 1SKUB 4USUA 3BZKA 3O5TB 3MN6A 1MSWD 3UE2A 1X5TA 4J2AA 4LJMA 4RZRA 2VKZG 1VQ9S 2QV6A 1IBKJ 1YJWS 3WUHA 3JYTA 3TX0A 4CBUA 1HQEB 2VG7A 4A57A 5KG3A 2X74A 1MG7A 2QMWA 4Q43A 3E9PA 4M5JA 1Q7YT 1S4EA 3OR1B 3JXOA 1DTTA 3DU6A 4Y6IA 5AQGA 1GEHA 3QAUA 1FF2A 5AQRA 2ZVSA 3CCJS 1LW2B 2HFOA 4RWXA 2DFFA 3CMES 2UYTA 3D4JA 2VKRA 3ILIA 2VQEF 3THXB 3KLHB 3HP9A 5C25B 1CULB 1QUPA 4XPEA 4MK9A 2RQCA 4C8ZA 3E8OA 4EIAA 3DMJA 1VQPN 3VESA 4BQLA 3DLKB 4FJGA 3FE1A 1NZ8A 4PG5A 4YB1P 2KJWA 3KLGB 5DLGA 3TSUA 1RA7A 5L9XA 4LF7J 1R8PA 3ASMA 2BOAA 2GV9A 5HL7Q 2P9IA 3OD2A 1Q82O 1TYQB 4BACA 4DL5A 5D4PA 4BDPA 2UXCJ 4F4WA 3ZT0A 2BJ7A 2XZDB 2GHVC 4DS5A 4HTLA 4NPOA 3CIPA 1HQ2A 4LMZA 2M8HA 3WNFA 3V1OA 3KWMA 4RU2A 4K0KF 4CJWA 2GAHC 3FBFA 5THWA 2VODA 1RT5B 4CCHA 1KD1T 1TKDA 1HKBA 3L2UA 3TUZC 4QOTA 2W4CA 1X9SA 3KK2B 1P9QC 3W5XA 2QXFA 3SDEA 2DNOA 2PA8D 4H4OB 5FRMA 3OV7A 4RW9B 3J7YI 4LBIA 1EB0A 3E66A 4P7VA 2CJBA 1K47A 1KQFB 2GV1A 2M0GB 3NGKA 2PA3A 4WFBL 4M42A 3PYFA 1OH5A 2W4PA 3MDFA 4ZLNA 1KEKA 5DGAA 3FRZA 5IV4A 2OIHA 1Q8KA 3FZFA 2A2DA 1QQNA 3IG1A 2CWKA 2AYEA 1WJ9A 4HACB 3U1MA 3MCMA 2Q2RA 1I94J 3NS6A 1F3FA 4ED6A 5A8WA 4JLHA 5D0HA 3NDKA 4EBCA 4WKRA 4DR1K 1QM9A 3GIIA 1J5EJ 3BH6B 1SL1A 3AVAA 3CCVN 1UVMA 2GCFA 4X84A 1NJXA 2O8DA 4LFCJ 3TAMB 3PR4A 1SQEA 3QEPA 4DZDA 3ALYA 2FSNA 3DLRA 3M05A 4AYBD 2A6OA 4M3XA 3I0RB 3MCPA 2ATLA 4F4AA 2QE5A 4DR4K 3E01A 2QSWA 1RJJA 1Q95G 2R7SA 3TPQA 3FZKA 1NLKL 1K8AT 2ZM6F 3SLCA 3OYAA 4H03B 2GVZA 1HBUA 1UCNA 4C8NA 2AJ4A 3BSNA 3KKSA 3SI8A 5DQIA 3G25A 2HAFA 2FJXA 5IC6B 2DVIA 3W60A 1HNXJ 1YJVA 3G6ES 3AOBA 3CULA 3DOLA 4JKAA 2AJ1A 1UETA 3A12A 1WUAA 4F3QA 2V9WA 5L1LA 1FDBA 1W0HA 4ALZA 5I42A 2XULA 1TMMA 1WC4A 2O1PA 2V2ZA 5KGWA 4FJIA 1EP4B 5L8RC 3SQOP 1UL3A 1N34K 4IOXA 1YRXA 1FFSB 3QYYA 3OLBA 1CEZA 3PJWA 5JS2A 3DRSB 3LP2A 3OBIA 3MPWA 5JUMA 2B56A 3EGNA 2ZBQA 4RWWA 4USTA 3NAHA 1Y9OA 3CXCM 3JQMA 3B82A 2PYLA 1T9WA 3A0IX 3DCAA 2FYXA 3PW0A 2UUTA 2GJIA 5FLXY 4JKBA 1QHTA 3GJSB 4IFYB 5GAHU 1RACB 5HLFB 2EK1A 1XNRF 1X4HA 3TYTA 4FOIA 2IVMA 2OANA 1FW6A 1VSHA 2HFNA 1W2BR 3LDNA 1RT3B 3U3GA 4U8YA 3VWSA 4ICLB 4J9NA 5KG6A 3L6QA 3LDSA 2LXIA 1NSAA 2H3GX 3IWNC 4IO9L 4DG1B 2HLUA 4ZJOA 2GHPA 7FDRA 3LP0A 2B7CB 2Q3PA 1CJKB 4LIRA 9RUBA 4IOAQ 4PG6A 3VEXA 4RNMA 3O9TA 5A8KB 4IO8A 1NGCA 4KI6A 3DRPB 3U27A 1M5HA 2D3OR 3QT7A 4QR1A 2IRUA 1RAGB 2W9BA 2FJDB 4OV1A 4EU0A 3U8XA 5SWMA 2XLIA 4TY9A 2NLWA 1SZ2A 2FLNA 5CQGA 1FD2A 4CK1A 3BH7B 2KL8A 3DAWA 1W25A 1K9MO 4AL6A 4LFBF 2P9CA 1N33K 4Q2LA 2WVDA 4IXCA 4HL9A 3MWTA 1F5CA 1LWEB 4K4WA 1JXEA 3DYAB 1Y7PA 3K5MA 1FWLA 4E7JA 2F4FA 5L1KA 2FGCA 2V4JB 3W3SA 2YX1A 3C2PA 4B3MJ 3UDLA 2HBZB 3US5A 2EBGA 4JI1J 2VBYA 3FDSA 3FZHA 4CF1A 5ETOA 2FJWA 2HRYA 4P2MA 3BUZB 3CJQA 4OGEA 2G4BA 3NWGA 4JI8K 4ECVA 3OS0A 3D45A 2QYCA 4GY2B 4NLQA 4GKJF 4UZCA 2HS3A 3M2RB 3MECA 4YY3F 3I55S 4NEYA 2GELA 2EEYA 3QEVA 3Q22A 3ZT1A 2H54B 4BE0A 2YWGA 2XO7A 4N76A 2RDJA 3ADAC 3J81O 3O8MA 1WTBA 3OW2M 1FWPA 2R7WA 3PHEA 2MMYA 4B3RK 4W92B 4E1MA 3NCPA 1GLLO 2V34A 4P6QA 3R7NB 2RILA 2OFHX 2LCWA 1Y3KA 3OHAA 4WFYA 4PQAA 2RF2A 3HCXA 2QA4S 1HNVB 2E5HA 3D54A 3FSXA 4OYBA 4U7UK 3CCRS 5CE3A 2RKIA 1SVDA 4ZA1A 1VHXA 2ZC3A 1XWLA 1GH8A 4ED2A 4PWDB 2P1JA 4MDAA 4JV5F 3L95X 2QI2A 4DU3A 2RVJA 1H0HB 3BV8A 1VQNN 2CJYB 5DGBA 4CNYA 4ELUA 4J9RA 4MQ3A 4NYZA 3RG6A 1YRUA 2ZC4A 2GO8A 3CJ1A 4NCAA 2YKNB 2V2KA 2F96A 2E88A 1K8KA 1S1UA 1WB9A 4HR2A 4CF0A 1B9FA 4HH0A 1KC8T 3MEDB 4IKFA 4DHVA 2CQIA 3Q8YA 2QLBB 3POTB 4LC9B 1HMVB 4DF4A 3MM9A 1WHVA 2E7WA 4CI6A 4DS4A 5ETVA 3RGIA 3PW7A 3HYFA 1GMVA 1HNIA 2XM3A 1BWEA 1VK0A 2FPHX 4NLYA 4TQSA 1Q1KA 3WDOA 5JVHQ 3T1HJ 1ZYQA 5LMNJ 2ZZNA 3T6JA 1Y0HA 3IMQJ 2IYIA 4DSFA 1HKGA 1LW0A 3SCLE 3O9RA 5DM7Q 3C8YA 4CEBA 1TVRB 4MH8A 2KQ2A 1N54B 3RU0A 5K5MA 1SJQA 1RHQB 2J8AA 4CEOA 4U9RA 2NRTA 4NLOA 1HNWF 2O01C 3Q83A 1VRUB 1VLOA 3TX8A 1S6QA 4H0XB 3HVTA 4CDIA 5IM0B 4LF2A 3A3PB 4WQ4A 4L3NA 3V5RA 4XO0A 3WHIA 2F5GA 3RB3A 4CJTA 1RKJA 3FEZA 3KLVA 2O8EB 3F9MA 4AQYK 3TZZA 1LFWA 1OJ4A 3VZIA 1VYAA 2UVVA 2B0GA 1MWQA 4I6AA 5G0RA 1W2BM 2CNOB 3QATA 3KK3B 4TYBA 3PYEA 2ZBPA 1HA1A 5KFDA 1KN6A 3ZX0A 3CIZA 4CJKA 3SI6A 3CC7S 4GVEA 2XS5A 1YAGA 4F4YA 3OYNA 3UO0A 1JCFA 3L3CA 2FJVA 2AP1A 2Q0UA 5KFEA 1E6VA 1JKHA 2VICA 2FHKA 3NMAA 2HNYB 1IG8A 5D4OA 2PEHA 4OX7A 4DFPA 2O67A 3QICA 5DQGA 3OTOF 4WTYA 3FSIA 3EEQA 2IGIA 2GWJA 1EX4A 3MN7A 1RBTA 3RJMB 2Y8WA 4DR6J 2O8CA 5I3QA 1Q7LB 1I39A 1V5IB 5J1PA 4CNZA 1RT7A 4CO3A 1U24A 2E4LA 1OPZA 1O5JA 2R7XA 1S3XA 1XBWA 1QSSA 1VJWA 4CJVA 3V81A 2UUAJ 5D3GA 3HOTA 2XY5A 4OHVA 2YNGB 4GKKJ 3QGHA 5E3AA 1EQMA 3R5CA 3ATVA 1VC5A 5F2RA 5A2QO 4NOHA 2ZJQQ 2OPSA 5EX5A 3HSJA 4ILRA 2ZH3A 1YKWA 1S57A 1C0UA 1N5YB 1D9DA 3AA2A 1RSCA 4JYAK 1X4GA 2KM8B 1N4LA 1RYSA 1RTDB 3MMCA 3KTQA 2OLWA 2QO3A 2UXBJ 4PXCA 2I5JB 1Q8IA 2XHWA 3QT6A 3LDLA 3E9LA 2HMPA 3NMRA 2AMCB 1P1LA 2ZNZA 4KV8B 1SQKA 3SAGA 1NK8A 3R2CJ 2DHSA 1S5JA 5EN1A 3H25A 1T9VA 1HBOA 1EAYC 3MM5A 4CZLA 2CGJA 2VBZA 4CHOA 1S6UA 4OI3A 4WFAL 1RGVA 2MQNA 1FRIA 4FPIA 2W2MP 3GIMA 5GAGP 3OYJA 1VMBA 4FJ8A 2YH0A 3PM9A 2NR0A 1K1SA 1O51A 5F9LA 5ADXH 2W7AA 3G6YA 3H5XA 4QIGA 2GVDA 2VFTA 3WQTA 4XAKA 1M1GA 4DV7J 4B3TF 3CIMA 3QFWA 2KM8C 3H59A 1FERA 2B43A 3D2FB 1N48A 4FLUA 3GYGA 3M6UA 4A2BA 5HSPA 4DL6A 1NLVA 3TZXA 1CXQA 1NHVA 5H9EJ 4J9MA 2R7RA 1B70B 5AE1A 4OPJA 4AD6A 5F8MA 4Q0BB 4J90A 4R8UB 3I8DA 3HZGA 2IY5B 3IR7B 3QRQA 3OFFA 5EX0A 3AA3A 1R0BG 4HTJA 4BC9A 1WNEA 3PIOQ 4OZLA 1OY9A 4JNEA 2V7YA 1KVCA 4I68A 4CZHA 3CCSN 1UFKA 2MSSA 4IOCL 3GB0A 5D77A 2KFYA 2V68A 2K7KA 3PJXA 4A4JA 4XDDA 4ECYA 1NGBA 4O0NA 4CECA 3V9SA 2B8QA 2V50A 2P9SA 1ITGA 1NK9A 4I7FB 1VHIA 2BE7D 1BUXA 1UWBA 2RD5C 1GAOA 3LTOA 2V7ZA 3PLAA 3OSPA 3OYBA 2VOOA 1RQ0A 4KI4A 4DUZK 2K3IA 1YUWA 2VG5A 4WK1A 2BE2A 1U8SA 3A13A 3I9V9 2GQ2A 3QAEA 1SS6A 3S01A 4JI5J 3RMCA 3U1NA 4KIAA 1KXPA 1R0CB 4FK4A 3V6DA 4B3OB 4H5NA 1XMOF 3AVNA 2XYHB 2ZHBA 4JKCA 3N4WA 2W9AA 1A6LA 4H5RA 3FFIA 1RT2A 4CLUA 1FDNA 4QWDA 2GZOA 1DEJA 3GILA 2W8KA 4U7CA 3M8PB 3C65A 1GX5A 4YFUA 4NEZA 3RMAA 2RE1A 2IC3B 1WORA 4ZK7M 2DGQA 4LRBA 4NXNF 5HAOA 4H0OA 1I5OB 2PE8A 4OFZA 4FPBA 4FJJA 2KFNA 5F41A 3N5BA 4CZIA 2DGUA 1GXLA 1RTIB 3VQSA 1C0TB 3SBTA 3EL2A 3SEOA 1X5PA 5HJXA 2BE9B 2ROGA 2AQ4A 2W2PP 2Z1JA 4G65A 4KTWA 5J2PA 4JHDA 2DXFA 1LQ9A 4RNNA 4KPYA 4RNHA 1N32J 2GIQA 3HVWA 4HDHA 3VQ8A 5JVGL 3GG0A 2XI3A 4HVJA 3I5BA 4DKWA 1QZ6A 1XIQA 2JEIA 4H4KA 1QS4A 4CYUA 1ZBUA 1S97A 3VQ9A 2A42A 4CH1A 3AVMA 3W62A 3TAEA 1RNHA 1LK7A 4NLBA 2P5OA 1EETB 6FD1A 1JLBB 2HHTA 1C0MA 4K4YA 3P5JA 5B0EA 1LOUA 3ELHA 4BR4A 1UMJA 2YJEA 2ZH2A 3MAHA 3V9UA 5KAKA 3PEJA 4Z0UA 4AHTA 1NGJA 3VERA 3VPZA 3AD7C 1W2IA 4LBHA 4GC6A 1JJCB 4ZPDA 2Q66A 5GAHP 4FJHA 2COLA 3C66A 3KJQB 3DGPB 5HANA 2CQCA 5J2NB 3J81Y 3CFPA 5A6WA 4C98A 5AQNA 1C1CB 4CJ5A 1VQ4S 4ZJLA 1PO6A 3IBFB 2WVCA 1Y10A 3CJKB 4A46A 2WBMA 1GQEA 1U1PA 5KPTA 5A8RA 1LWCB 2YKMB 3O1LA 2IM0A 4NLDA 4RW6B 3VQQA 2MY8A 4OI0A 2MY7A 1C4CA 4ILJA 3OYLA 7AT1B 2W7PA 4K41A 4DSEA 1RDCA 2DCUB 1NJIO 1K73T 1RABB 2IIRA 1MROA 3CUNA 1RCHA 2Q31A 1GT8A 2GAGC 1HR0F 2V8PA 4CZFA 5M1OA 4DFJA 1NPKA 4BC5A 2D3ZA 3C16A 3R9PA 2R2RA 1JB0C 2Q6CA 3QIOA 2P6SA 2HS4A 1UVNA 1K6YA 1WG4A 1E6YB 1ZBTA 2CQGA 5C5JA 1U02A 4N5SA 1VQON 3W1YC 2XO6A 4BROA 3GE1A 1QAIA 2BJDA 2O66A 1MA9B 3O44A 3W5ZA 3EY1A 1SC1B 1YWXA 1HIYA 1IN0A 3C6AA 3EICA 2QEXS 1CJTB 5E3QA 2MLYA 2OHDA 1PGZA 2Y8YA 3BB5A 1V4SA 4F8RA 4LFAK 2E5IA 5I4MA 3FUYA 2QXLA 1T03B 4CE9A 3P3DA 4DDFA 3IFRA 3UNYA 4ZPCA 4RW7B 4OV6A 1PC5A 1FJGF 4ILGB 5KFAA 1UP1A 2PMZD 2R8KA 3M8QB 4KO0B 2W01A 1A5XA 5AQMA 3BBCA 5DM6L 2WOMB 3R27A 4DR4J 4YHHF 3H1VX 1JXLA 4ITSA 4BRPA 2DNLA 2DY1A 1H2UX 4YMEA 3UQSA 2K2PA 2QFIA 1N6QB 3S6EA 1S0MA 3EVMA 1VC0A 3BM7A 4ZMMA 2ITGA 1MMLA 3TAPA 3JQKA 2PSZA 1U1NA 3UKUA 1C2PA 2F9WA 1V4TA 1YXQA 3C6HA 3CF5Q 2HFVA 4OX8A 5C24A 3MOJB 5HRNA 3O2IA 1S48A 3FZBA 4C97A 4JI7J 2ZJRQ 1UEUA 3FC9A 2QSFA 2IIHA 3BGRB 5DRKA 2OO4A 3J7ZT 2ZE2A 5F0XA 1NDLA 2ZH4A 1YTUA 1VRTA 2A0FB 1T44A 2MXYA 4G6VB 3OR2A 2FF6A 3O6QA 1NKCA 2NZ4A 1QE1A 3UD3P 4UTGA 1V3ZA 2BRLA 2BABA 1YJ9N 2ALYB 4GO7X 4BRAA 4F3OA 3EPGA 2FVRA 1QY7A 2AYBA 2M7SA 4P2FA 4ER8A 4HT5A 4CEDA 4X65J 4O23A 1PJ7A 1FVSA 4NLWA 2E1CA 1XNQF 1KLMB 1HL6A 1OH7A 3KKRA 2HMIA 2RE2A 2Q79A 4FOEA 1IKVB 1C0FA 4CLWA 1HD0A 3DGVA 1NGGA 2QFJA 4JV2A 2O8BB 4O55A 3UCGA 1KNZA 3E51A 3MCSA 4OX6A 4CHZA 2QN6B 4JKFA 5KT7A 3V6KA 3BGUA 4EMDA 1NMDA 3FK4A 3EMTA 3G71N 4DL0C 2YI1A 1RHKB 4J5OA 3SUPA 4CHPA 3QRPA 2G8IA 3U1LA 3MUVP 3WNGA 3L2WA 1VQ7N 2CPXA 4B1ZA 5A2QY 4U8VA 4FJKA 1NJZA 4DV5J 4X62F 2AEJA 4CF2A 2HBYB 3I87A 5K8MA 3I0SA 3D6RA 3JB9k 2YNHA 1YBUA 4OX9F 4ZN1A 1S9GB 1SB6A 3RW7A 3NH1A 3A1YG 5K8PA 5DDOC 2HVHA 3CMAN 2WBRA 3M1VB 1RISA 4ZVUB 1H7WA 5E5NA 1HI0P 3ZSQA 1RK8A 3CJCA 3M8WA 2CZ9A 1CBKA 5LMUK 4CLKA 1QQOA 1S7IA 1TU0B 1LOTB 2DHGA 1YZ6A 4JI2J 3R9LA 2V52B 2C2MB 1U04A 3Q86A 1RAFB 4CZMA 2P51A 3VF2A 4BRDA 3GCXP 4AFFA 2V2VA 4NA2A 1P9YA 2V51B 3K57A 2DPJA 3IMXA 4K0KK 2W42A 2HS0A 2MQLA 4L6V3 2C22A 3HHNB 4ILMA 3MM8A 5SZTA 3W2WA 3UN5A 2YV0X 4O3NA 1SI9A 5BREA 2LXUA 5GMDA 4J9PA 3CPEA 4O44A 2C1EB 2CUYA 2KDOA 4DX8H 3CW2C 4DMZA 5CABA 3ZO7A 1AZSB 3ULEB 4RW4B 1WWHA 3KK1B 1FNOA 3OYIA 1S59A 1JCEA 1BGXT 4ZHRA 3T1AA 2WVFA 3QO9A 2R4FA 2FDNA 4B8CA 2MDAA 5C15A 4KRWA 1JLAA 3NVMA 4B3RJ 2NREA 4Q44A 3CJTA 1NPRA 1XR6A 1FNMA 2WSEC 3EKUA 3HSGA 3MUMP 3RRKA 4PRFA 3PNIA 4O0JA 5KG4A 2FBVA 4EP4A 1R8AA 1MMDA 2C2DA 4BBYA 1DFDA 3QMLA 1O6XA 3C14A 2YVSA 5C12A 2IDOA 1RAEB 3KDOA 4DL4A 3AJDA 4KB0A 3P8BB 4GVBA 4OJGA 1IWGA 1B3TA 3KLEA 2XMJA 5L46A 1XI1A 1LAVA 2IVNA 4IRDA 4QS9A 4FJXA 4EHTA 3KD1E 4FDFA 4WIIA 4CP5A 5KFWA 1CS4A 3E9OA 4YP3A 3FVYA 1FRKA 2HVIA 2AHOB 2P9PA 1SH2A 5A0YA 3HPHA 3V4IB 1H72C 4BHQA 5BXIA 2RMLA 4C11A 2ZM6K 2R7YA 2BUNA 2FZGB 4DI6A 3CCMN 3TAQA 4YDUC 5M1QA 3MEGA 1AUSL 2J9CA 3RB6A 2MTLA 3HKZD 3RMDA 3BP8A 3DU5A 4GV6A 4CJPA 3DLEA 4IQMA 1RWWB 3G4SS 3AVIA 2CJAA 4CJRA 1YGYA 3P83D 4OO1J 2CG4A 3L2VA 3R7SB 4CGIA 3AVBA 1WAJA 4BLGA 5M2PA 3ENQA 2HZVA 2FHOB 3ZZRA 3IC1A 2OSQA 1KSPA 1Q86T 3KMSA 1UAWA 4M5KA 2GNKA 4I2PA 3MAQA 2BDPA 3JSBA 2M9KA 1ZZFA 2YPYA 2CVEA 2NNWA 4WE1A 3NCIA 4DR3K 1KQKA 1LK5A 1Y11A 2NRXA 5FDLA 3ZYYX 4QCLA 1KC8O 3HZEA 2GEMA 3G6VA 4DV1J 3OVSA 2HF4A 1NBEB 5FD1A 3M2VB 2FSKA 2JVOA 3IR5B 3JYTB 4AQYJ 4MFBA 1MWMA 5IQ6A 4BCAA 2XY6A 1VS3A 4XPCA 4FZYA 1S77D 4LQ3A 3AQPA 2VG7B 4LVNP 2HQGA 2ZDOA 1WHXA 3QFUA 4K25A 1GLDG 1HYSA 5HQ8A 3MR3A 4Y0WA 2GX8A 1DTTB 3HM8A 2RUGA 2UP1A 2CXEA 1NGFA 3ZC4A 1M0SA 1R8BA 3BN7A 1KQSR 5AJ3F 2NSBA 4MDBA 1YJNS 2VWKA 4QS8A 5MLCV 4WXWA 2H1YA 4M3YA 1C0GA 1EKRA 3DMJB 4JB8B 4BGBA 3LDQA 2FUG9 4OIXA 2DO4A 4YOUA 3LZIA 1ZAXA 3D6MB 1ZBIA 5GAHI 3H20A 1HJOA 3QRRA 4C8YA 2C42A 4WWSA 2DNRA 3CPWM 3DLLL 3QLHA 3A8JA 2OH2A 5K8NA 1X9MA 4Z4CA 5H9FK 3HJFA 4CI0B 4EO8A 2P9IB 2YX4A 2JC0A 3SXLA 5J2MA 2DGSA 3R5GA 3MX5A 4OVLA 4LFBK 2HHXA 3AQOA 1BC6A 1RTJB 2CNLB 1K1QA 4YDXA 2X3GA 1OH8A 2HGMA 4BRFA 4P10A 1NGDA 4FYXB 3TW0A 3VGSA 4JI4J 1OWXA 2H5IB 3OL7A 4KJIA 3CC4N 4M5GA 3MPUB 1RDAA 3SAHA 4QJVA 3HFKA 4FKXA 2QW9A 4DXLA 1X0FA 3PW5A 2LSNA 4OZ5A 1D9AA 4Q8FA 4JYAJ 4KREA 4FF2A 2QIFA 1T8EA 2CDRB 1SJ3P 1EHWA 3SDEB 2W9CA 4HI2A 2J5AA 4KY3A 4GRSA 2E66A 2J0SD 3K8WA 4FXWA 3MK6A 4G1QA 2HQ3A 3OTDA 4TY8B 4E7KA 4YOXA 3NP5A 3KJVB 4GKJK 2EWSA 1VLYA 1W97L 2E1PA 5HBMA 2D4WA 3QMQA 2ASJA 2E2PA 3G8TA 4DR1F 1VSDA 3PR5B 2AD9A 1DY3A 5E3CA 2OZSA 2E9TA 4LF8F 2JRSA 2A1RA 4ZLPA 3IG1B 2HQCA 1E3MA 3D1QA 1RP5A 3FQLA 1U49A 1VQPS 4CO5A 2FBXA 5LJWA 1ATNA 2YX7A 1BIZA 3D7SB 3KD5E 4L76A 4JV1A 4FWKA 4IO1A 4W5OA 2HWHA 4NLCA 2O8DB 1F0XA 1OS5A 3Q7CA 1BOTO 4ZP8A 3J81j 2WVEA 2GFFA 5DJBA 4J9QA 3JSRA 3VENA 3PDNA 2MKKA 3E01B 3OXGA 1HLWA 4DU1A 3OUYA 3CEDA 1HFEL 4LF6K 3IFEA 1TKZA 2GVZB 3MWPA 1HBUB 2R42A 4DU8A 1XEZA 3NF6A 2K7JA 3HRGA 3HSTB 2XTJP 4M5IA 4WFZA 2PFDA 1N34F 3D0HE 1UAXA 1IBCB 2VFVA 2OELA 2UXDK 3BQ1A 5HRSA 4HHHA 2WB4A 2CQ0A 4DV2K 3BBBA 4EK2A 3PXGa 1NM1A 1VSKA 5KFRA 4P9SA 4MTPA 4OYMA 2PFUA 3IWXA 3BEXA 4ZS6A 5I42B 3G87A 2IVOA 1OYDA 4JI3K 4IFVA 3TJ8A 1C1AA 3EGVA 4J2DA 3HHDA 1VQKN 1KKHA 4OZ1A 2D0AA 3LP2B 2RHQB 2CPEA 3MFHA 4K4XA 4DUTA 2R8HA 4ES3A 3T1YK 2E5LJ 2LEPA 1Q82T 1HNWK 4N77A 2ATQA 4H0TB 4GNIA 2VG6A 4CIGA 3RBDA 1TQLA 2YHAA 4HTUA 5CYJA 3R6LB 1KVKA 1NNDA 5FPMA 1GOBA 3GCWP 1WEZA 3D5MA 1F2GA 3GFHA 2HFSA 1X0PA 1UPMB 2G2YA 4OL8A 2XWXA 4WIQA 1YJTA 4USMA 3DKDA 4OGCA 1WC6A 1IVZA 3CQ8A 5FPDA 4ID1A 4Y2IA 2A18A 1CC7A 3L4QA 3CCVS 1T9UA 2J9DE 3EN9A 4YS2A 3VA3A 4B1XB 1X1PA 1S99A 2YKOA 1S6PA 2LDIA 5A6PA 1R3NA 2ASYA 2HHWA 4YQWA 2FBYA 4OYOA 3GFZA 3D0GE 5KG5A 2FHJA 1MDUB 1K0VA 1SJ4P 3LP0B 1B0TA 4L8RB 3WXJA 2J0WA 2DXEA 3KUEA 3NCQA 3KLFA 2O8FA 4QU6A 2CPDA 2E1RA 4K50A 4OMFG 2P9EA 1N33F 2E29A 4R0JA 3SCJE 2IPOB 4K4SA 2CPZA 4URSA 1VQ6N 4DTPA 1UFLA 2DHAA 4RNOA 1M5SA 2W9BB 3CT9A 3T7ZA 1GLEG 2DGOA 2PN6A 4OYIA 3GV5B 2JDJA 4DJBA 1RE1B 5IOLA 2DEJA 1S1XA 5HRPA 2PYJA 4QPXA 1HUXA 4MT1A 3TTDA 2EFPA 4CLZA 4KGVB 4OI6A 2E9RX 1U0HA 4ILLA 4ZVRB 3TNVA 1JX4A 3A8YA 3GIRA 4NA1A 3CB4A 4PYDA 2Z2YB 3PG9A 3H42A 2UUBJ 3MOZA 5HL7L 3RTVA 4FLTA 4JI8F 5AE3A 1CJUA 1ZA1B 3EUNA 4KT0C 4ETZA 3TA1A 3AB2B 1RWOB 3IAM9 3CM5A 1LWFA 3P4IA 1QD1A 3T3FA 3WNHA 5F8JA 3HVRA 2MB0B 3PYDA 3C15A 1KQGB 2ERRA 1W9HA 5CYMA 4R79A 3DRRA 4KGZB 3UD5A 3PJ9A 4KKOB 4YNQA 3DOKA 2RIJA 1RAIB 1EARA 2CQ2A 2CGKA 1GXTA 3FMWA 2K3KA 5KFUA 1LWXA 5KTQA 5ETRA 4YB6A 3E3XA 1YHQN 3ZZOA 4DUYK 3HHLD 1HNZK 1VSEA 4ANCA 1VQLN 3CJRA 4A5AA 3S1TA 3CHWA 2RB7A 2NPFA 2P5GA 5KFTA 3OYGA 1T3OA 2M8DB 1LXNA 2CJQA 3ETMA 5BRHA 2XNQA 1VC6A 2RF2B 4QYRA 3SQ4A 4CO0A 4U7BA 1QTMA 4FLYA 4ECSA 4DR2F 2RKIB 2HVDA 2HVEA 3RRGA 3OHRA 2FLLA 3MXJA 2YCHA 4NLVA 1EQ0A 1SUQA 1YBAA 1OSDA 1Y5NB 5HVHA 2VCPA 2RUSA 1X4CA 5KPRA 2CQ4A 2Y1JA 4J2BA 4B9NA 3QIDA 1I3OB 3ZZUA 2GX9A 2BQRA 4B3TK 1AFIA 5IQQA 2QLXA 4ZCMA 2E1AA 2BM0A 3B4DA 2MQOA 2F8MA 3ILLA 1K8KB 2MKSA 5GAEP 3EYZA 3CGIA 5HJYA 3ZLJA 4FF4A 3SQ1A 4USKA 1IR1A 5D0GA 4RBUA 1NAQA 2RS2A 3B78A 2YHXA 3MM9B 1S9FA 4DPOA 1EQYA 3K2PA 3D6HB 2LEBA 2Z8QA 3F0NA 1UW4A 1HNIB 2YNFA 3R5BA 5EU7A 1IKXB 2D5RA 2QC3A 1Z2LA 3MCOA 4DQRA 2CH6A 3Q0AA 2H4WB 2XSJA 2VPYB 1QQMA 2R9LA 3H40A 1LW0B 3VGKA 1MLAA 4FM1A 5GVQA 4ZVPB 3MMBA 2CKWA 3UN3A 2VB6A 4UUXA 4IZ9A 4FLWA 1JXBA 3M30A 4YB5A 4IOBA 3VQ6A 2PEBA 5IV3A 1S6QB 2ILYA 1BL3A 1K9MT 3HVTB 1QLNA 4KGXB 2PI5A 2RHKA 1YTAA 1W26A 1JLQA 2A41A 2ATCB 4PR6A 4PXEA 3AO1A 1TL1B 4DSKA 2QMXA 2V9KA 3ET6A 3UI3A 2ROPA 5T41A 3C3LA 2ZJPQ 2VFRA 3KVGA 1VI7A 4N8OA 4OYXA 2GUIA 2J0XA 2LMIA 4RNFA 1TZ0A 3IRXB 4R25A 3RB0A 5AQXA 2JWNA 3H2UB 2G8FA 3LPTA 5F3ZA 3MX2A 1VQNS 1N5VA 5CHCB 2KXFA 2LP4A 1JNRB 1KTQA 5LXYA 2WRMA 2NXCA 3PEHA 5CXTA 1XMQK 3N4QA 5DDPC 4UZBA 2B51A 3LOUA 3BQ0A 4LSLA 4FLXA 4NXNK 2ZBRA 5MLCQ 1VSLA 3ZNUA 1E6VB 1NDKA 1JKHB 2HOEA 1BE4A 1IBMJ 2H4YB 2ETJA 5HRRA 4IOAL 3DLJA 4LSNB 3MR2A 4QAGA 1UZDA 3DLHA 4HKQA 3D3CJ 1N56A 4L74A 4WQ4C 3T9ZA 5CYQA 3IS9A 4DCJB 2RS8A 1UA0A 4BC3A 1OY8A 4OLBA 1T02A 4DQIA 2O8CB 4DTMA 1DHMA 2P9UA 1RT7B 2DY9A 1LAWA 4JN4A 1AA1B 5JXSA 4QW9A 2DITA 4ZLJA 5KFHA 4DX5A 2OD4A 4Z4FA 2R7OA 2OFGX 5C7PA 5D3GB 2YX6A 5AQZA 3NGDA 3I4PA 2UU9F 2X6NA 2ZZTA 3RBZA 5K20B 2VQEJ 2EFGA 1S9EA 1FESA 3QGIA 2OPSB 9ATCB 4IEIA 4MO5A 1TFWA 1RWKB 1C0UB 3PFEA 3NNHA 2NCKL 4K5RA 3NGZA 2QWNA 4KHYA 4QWAA 5A2QU 2BH1A 3MMCB 3MN9A 4B3SK 1RA6A 3DOMA 2QYGA 5ETQA 4DPTA 3NF9A 4MKYA 2Y0BB 2CGLA 3MXMA 4FK2A 1HBNA 2DR5A 4A2AA 4DU4A 1RAHB 4LRDA 1T9TA 1VK8A 3W8GA 2XCPA 2F9JA 3Q7BA 2ZD1A 2A5XA 1WDDA 3IKMA 1XERA 3MM5B 4F7VA 5KT4A 1A5VA 2FXUA 3X3UA 4CM0A 4N47A 1FTCA 2NSCA 2HYIB 1A7GE 3SIPB 4K0KJ 4FVUA 3R2DJ 2G1DA 2FVSA 4CJLA 4WZQA 4ZJQA 5F3TA 3M2UA 1F5AA 1F1BB 3VGUA 5IC4B 2XBPA 5AR0A 2GVDB 2IM2A 5AE2A 3AAPA 2CQBA 1HYZA 3CO9A 5CHIA 3SSQA 3KHLA 1IH7A 1YBTA 3N4PA 1XR7A 3O4NA 1O1WA 1HR0K 4JBCA 2PGCA 3K5NA 1U6FA 5AQVA 1LW2A 3H1QA 4J7CA 3VQ4A 3LP1A 3M7VA 3THXA 1YI2N 2Y1RI 4LREA 5C25A 4GW6A 5HMXA 4GC7A 1WC5A 4KHPK 4EWTA 1DQ8A 4NL5A 3AFGA 1APSA 2VJUA 4IWVA 1YJRA 3C6TA 3PO4A 3I82A 1TUWA 3H8YA 2PMWA 1L5UA 4QWEA 2LQ9A 4DUZF 2FY1A 4Y00A 3GYNA 4KB1A 2DNZA 3H5UA 5HVGA 4CZJA 1C4AA 4CERA 4HUFA 2X6SA 4DR5F 1PBUA 1R8CA 2P9SB 3QNOA 5JVHL 4IH7A 3VVTA 1DURA 1UWBB 2WW8A 3S3MA 3H4BA 1CZAN 5TKWA 2ZM6J 3DXKA 5DM7L 3LA0A 2VG5B 3LDOA 2BE2B 1WSJA 1FRHA 1HWLA 1B4SA 4U95A 4GMKA 2HNDA 2A40A 1R89A 1LXJA 2J9DA 3V6DB 5EWFA 4ANDA 4CZEA 4O3QA 4F4ZA 1PBAA 4L72B 4KB7A 3FFIB 3BF1A 2Q6BA 4LSZB 1ELOA 4XIUA 4KHMA 3M1FA 3U7JA 3GJQB 3L4BC 3PRVA 4USVA 4KAZA 3CDAA 1PILA 1RAJA 4AHVA 2XY8A 1BWFO 3EKSA 4NXMK 4XTTA 3K0SA 2Z1GA 2KZMA 4M45A 1WSFA 4JD2A 2M70A 1XTZA 4WYWA 1R8HA 4PZVA 1OYEA 1BISA 2ASMA 1Q0NA 2N3OA 4EI2A 3KK7A 4OJHA 1TV6A 2F4VK 3QQCD 1FT8A 1RBVA 2D1KA 3FCVA 4M3UA 3CCSS 1SJFA 4TXSA 3VN5A 3DXMA 1XNRJ 5J2PB 4JHDB 1SC3B 2VC0A 3L7UA 1NK5A 2CQDA 3T5JA 1REGX 1T0TV 3KMQA 3TARA 1R27B 1XMBA 2OAUA 2PIIA 4K4TA 1P6TA 2KYZA 4CYUB 3G8SA 4RBTA 1NBWA 3IM9A 5ETSA 3TJAA 2B9EA 3MD3A 1RWVB 5K14B 3QERA 4FWNA 4LVOP 1EKSA 2DFEA 1NO8A 5BN8A 2HNZA 4NLTA 5LJ5Y 3J7Z5 1S76D 1N36K 3KG4A 3QFHA 3VHQA 5FPNA 5H9FJ 4IR1A 3MR5A 4CK2A 2ZJQL 4OX9K 4YUDA 1QHAA 2QWRA 3MR6A 2K8GA 3OT9A 4LH4A 3VQEA 4A62A 5FROA 3VALA 2A6AA 3ITHA 2B5JA 1WG5A 4LFBJ 2HPUA 5AQLA 1WF0A 2ASOA 2VFSA 5EDWA 2BACA 4YORA 1OQ6A 1O13A 4X4NA 4OKJA 5DLFA 1RXOB 5A8RB 4KH1B 4LRCA 4H4KC 2AIRB 4IRCA 2QG9B 4UQTA 3ENWA 4NYOA 2H5EA 2NZTA 2OPRA 1RWNB 4AL7A 4DQ8A 1SIWB 4PKDB 4F4KA 3KKFA 1G4CA 4K4ZA 3VAJA 2V8DA 3KIOA 1RWUA 2E7VA 3NGTA 3N79A 5KOWA 4DZ6A 1MROB 1RT3A 2QX0A 1KP6A 3BGFA 5GAEI 4JUZA 4DLGA 1SQFA 2JSXA 3OVBA 5F8LA 4GKJJ 5D15A 1ZM4A 4JKEA 3GYXB 2HBRB 4BRNA 4YY3J 2FQQB 3C16B 3Q8UA 1WHYA 2EKNA 4FS1A 3EGZA 4LFAF 1YZ7A 3WX8A 3S41A 3JS6A 4F3TA 2ZQBA 3SFUA 3SQGA 4JKDA 2GHWA 4LF1A 4Q45A 3MM6A 5A8KA 1RBLA 4RUBA 4ISGA 4ECZA 1Q81T 1LNQA 3OFEA 2GTDA 2Z58B 3TQ1A 3ZZPA 3OHBA 4ECUA 3T19A 4RUHA 3P45B 1ACMB 2ZBCA 1ZA2B 4EHUA 1BU6O 4ZP6A 5KT5A 1U2VB 4C8MA 1QVGM 1WC3A 1ZM9A 3EE3A 3LGHA 1D8ZA 3U3YA 4DPXA 5AZIA 2KKHA 5EXWA 5HK4A 1YSJA 1JCGA 5BYRA 3PIOL 3G2XA 1I3AA 3LL3A 1QSLA 2BQUA 4JV5J 3ENOA 4BRCA 1S79A 3MZIA 3AD9C 1DTQA 2Z56B 1RKIA 3K58A 3B6PA 4HUEA 2ZWPA 4CLYA 5KFJA 1OKJA 3I9ZA 2E5JA 4ECXA 1B9DA 3TABA 4QW8A 5CA5A 5LM7E 4CZKA 3SUQA 4MKBA 3RBEA 3P31A 3UKUB 3V9WA 2E20A 2H65B 2AGOA 1K0TA 1WSRA 2NRZA 5C24B 4LF9K 4DV0K 2ASDA 1NSKL 3PKYA 3HOSA 4DV6F 2WZ1A 4IH6A 2AW0A 3S3NA 3J7AN 2ZE2B 3DNCA 4A8KA 2M88A 1VRTB 3D9BA 3CXCR 2Z4PA 4USHA 3OR2B 4IEEA 4EFAC 2Q1LA 2VASA 5IWAF 3BO2A 1X4FA 4KTQA 3LANA 3VQBA 2R7TA 4BR0A 1V3RA 3ZEUA 3UIQA 3HI0A 1Q9YA 3CI5A 4NLRA 2FF3B 2HQDA 3VEWA 1BUPA 4NASA 1VQOS 4B9SA 1MWKA 1RU1A 4RUAA 1HNWJ 4FM0A 4IUFA 2DPNA 2GQCA 4OHYA 4ED1A 1RI7A 3NFAA 2ZBIA 1UVJA 3NAEA 2AU0A 3BN4A 2IAJA 3V4MA 2BJ3A 2HAIA 2FJEB 2BKPA 4AILC 1PKUA 1SC4B 4PQUB 2MKIA 5AQJA 4NMXA 3R5DA 2NRHA 1NK7A 4HUGA 3M6XA 3W2VA 1VQSA 1Z2ZA 5GAGU 2E8AA 1H3DA 5ADZA 3SSSA 1E4GT 4J9SA 4JS4A 2MJNA 2KT3A 1M5OC 5AQKA 1S0OA 1NJIT 3AODA 2O4IA 3HBTA 4GV9A 3MEDA 4OI4A 5F8IA 4PPDA 5U47A 5AJ3K 5LT5A 3LPEA 4ANEA 5LY3A 4HVZA 2IM3A 1AB8A 1TELA 3POTA 4BDZA 2OPPA 3R1XA 3EXYA 5LMUF 2OEMA 3I0SB 3G9CA 1X4EA 2E1YA 2YNHB 4UY8O 5I3UA 4HT7A 4YR2A 2XMVA 2Y3YA 4QPTA 3OTOJ 4M94A 3N01A 3TWZA 2ZNYA 3NWRA 2Y0SD 4G9ZA 4X4RA 2GIRA 2HRUA 3ULDA 2NRVA 3FMBA 4LH5A 3ZSRA 2PD1A 3MGJA 1VBYA 2VONA 3HM9A 4DCOB 3ZTPA 1RB0A 1YJ9S 3TR5A 3LZJA 4PWUA 5DZ6A 4E2FB 3VAMA 4MIBA 1WKLA 5AFUH 5C2CA 3WC0A 1KWMA 3DXBA 3MM8B 3W2WB 2RQ4A 3BSAA 4XEIA 3OW2R 4O44B 3SCKE 5CH7B 1S7HA 4CGHA 3MPVA 3OY9A 2U1AA 3GJRB 1FTRA 2QLWA 3KK3A 2CA9A 5ETKA 1VQYA 3FCWA 4ZHRB 4Y2AA 3WXMB 4QYZK 3QO9B 1YX2A 5KT2A 4WQ5A 3A5MC 2JWLA 2WC9A 3GOIA 4FWMA 1XHXA 2HK3A 3DM2A 1SQGA 4CJFA 1JLAB 1ICEB 3VQAA 3D2EB 3G71S 2GS8A 3H5YA 1MMNA 2F65A 2MZQA 3NS5A 2IVPA 2MEWA 1XJWB 4CJ4A 5HATA 3EZWA 3SV3A 3HLUA 1VQ7S 4OKEA 1T7PA 4LF8K 3C0BA 2V8VA 4P74A 2DH8A 4URGA 4BRGA 3PW4A 4OZ0A 4LIWA 3CM6A 3VF4A 1TKTA 3C14B 4M3WA 3U4LA 4M5MA 2BBEA 3WT0A 4GVBB 3J8AA 3D0PA 1PAUB 4LF7K 3KLEB 2L41A 4O3PA 3AAQA 3ULHA 2KRBA 3CMAS 5M1NA 3MPDA 3QGGA 3H7HB 2VGNA 4QIFA 2H9ZA 1CS4B 1HKCA 4B3TJ 2HBQB 4NX9A 4FVMA 2P9PB 2E5GA 4WU2A 5A0YB 3QEXA 1F6TA 1BHNA 3BEGB 1QJHA 2QL7B 2YNGA 3MM7A 3R8YA 1A0OB 2R8GA 4C11B 5F0WA 2NXNA 3WBZA 2AJFE 1FXDA 1KFDA 3BPDA 3F2KA 1CG2A 4XH5A 1B99A 3MEGB 2BOPA 1KOOA 2KB2A 2DFHA 1N5SA 1TL4A 4BQZA 3N6NA 2XS2A 4PUOA 4DR3F 1G3OA 4RJVA 1MN7A 2I5JA 4KHWA 3CF5L 2M2BA 1FKPA 4KV8A 5B0DA 2ZJRL 5EUHA 4PPZA 2ZWHA 4I2PB 2FC9A 3QETA 1SL0A 3BF4A 1BQNA 4WF9Q 3JQJA 4DL2A 2L48A 4NYNA 1PAEX 2IFXA 2HFZA 4Y2KA 1QDUB 4FM2A 1IR0A 3NCRA 3NGSA 5B0AA 3AO3A 2JZ5A 1GXUA 1KTVA 2P9KA 1SJRA 4UOGA 1BI4B 1WUUA 4GVLA 3W9IA 3R5JB 3CJSA 4RO0A 4PA1A 1I94K 2G8VA 1HQUA 2HURA 1REVA 1T6CA 4MFBB 4FLVA 3R3TA 2U2FA 1Z6RA 3ZTRA 3SK3A 3WC2A 4Z2XA 5T14A 1OVYA 2Q1NA 1NPPA 2ZH9A 1FFWB 1XMOJ 2ZITA 4LFCK 2XLKA 3B8HA 4H4MA 2HLTA 3I8BA 3VAHA 2PBDA 3CO0P 1HYSB 2OUGA 5H1SV 3O9SA 4LR7A 1B7FA 4AXIA 2WCXA 2G8WA 4LF5F 4UQGA 2KXHA 1TK0A 3ZTOA 1IQTA 2DTUA 3QEWA 1BQXA 4NXNJ 3HULA 4C0OC 4FZXC 1FE0A 3DFEA 1RAAB 5D4LA 1RBUA 2VWJA 2XZWA 4NRUA 3D2WA 2OCEA 1CQMA 1HNXK 2EX3A 3CCMS 1GMWA 1RT4A 3TUIC 3AH6A 3FGVA 3RZAA 4JRPA 5DM6Q 4JKGA 1VOMA 4OJ1A 2C2OB 3M32A 3QLHB 3T9NA 1CJVA 3SJHA 2EC2A 4RTFD 1FHTA 4FJLA 3JS9A 4TNOA 3RBXA 1U1LA 4X66F 4Z37A 1JK9B 2IA6A 4E19A 1VQ8S 2CAJA 3HDSA 1QVFR 2OKQA 3C6UA 1JIHA 4AL5A 3ZSVA 4CT9A 4E0DA 3J7A1 2VL1A 1FCAA 1RT6A 3BQ2A 4DQQA 2C3PA 1UKUA 1UEKA 3JTNA 5DG9A 2VYPA 1JJ2M 2CJXB 3ZSYA 3E2EA 3P49B 5BJRA 5E3RA 2DNMA 1RHUB 1EIYB 2KHOA 3D1OA 4QWCA 2NS1B 3PYGA 4X64F 3OSNA 2W9CB 2A1SA 3IBWA 4G1QB 4ATNA 2OGUA 4C23A 1MU2A 4ZVOB 4WFNL 2O4GA 3CTRA 1AFJA 2G8UA 3QNWB 1VQ4N 2LU1A 3NAIA 2I8EA 2PC6A 4I4BA 4IYQA 3RW6A 5HBMB 2C28A 2KVQE 4DEZA 4AM7A 3H3OB 2AF6A 3PCOB 3PKMA 1BLUA 2VPZB 2HBJA 3RSEA 1SV5A 3L2RA 3D7EO 4CT8A 1XQIA 3MUTP 1WEXA 1IUJA 2BQ3A 4W98A 5F9NA 2H51B 2YWWA 3G8QA 2MKHA 4LF6F 2FVPA 3LWMA 4ISEA 3IR6B 1JLEA 3PX6A 2JJ4D 2I6WA 3M8YA 4DR2K 4DU7A 2OEKA 2DR9A 1WKKA 3H6EA 2ROEA 1FKAF 4U7UD 3GP9A 1L3UA 4YN3B 3ZT4A 2F8SA 3H2LA 2BMBA 2UXDF 2DY4A 2P5VA 3CYMA 2RQKA 2MGZA 1YTYA 2E2QA 1HR0J 4DV2F 2XMKA 3MXIA 3IBCB 1S72N 4IR9A 1SKWA 5EWGA 1TKZB 1JLBA 4B3MK 3SCIE 4JI1K </