2E2QA

Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 110
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA01
1BG3A 4BR4A 4NB4A 3VF6A 4PL7A 5ADXH 3FZMA 1RFQA 3FZFA 1NGDA 5AQVA 3GL1A 4BRPA 3I8BA 3VPZA 1BOTO 3FZHA 2P9UA 4RTFD 2ZGZA 1U6ZA 5FPNA 3ID8A 3IDHA 5BRFA 3SMSA 3DAWA 3MN9A 2ZGYA 4Y0WA 3IUCA 1QQNA 5BREA 4JD2B 1ATRA 4PKIA 4EFHA 1U2VA 3CQXA 5AZIB 2CH5A 1C0GA 5BPLA 2A42A 5FPMA 4GY2B 4XH4A 3O8MA 5JICA 1BA0A 4FOEA 1Z6RA 2QWRA 2V7YA 1JCEA 4FWLA 3HM8A 3FR0A 3VEOA 4BRIA 1ATNA 1X3MA 2E2PA 1NGJA 3LDNA 2HOEA 3O08A 1HKGA 3QFPA 2QW9A 5EY4A 2QWPA 4B1XB 3VOVA 3C7NA 4A62A 2YI1A 5AQSA 3SMPA 3A0IX 2YJFA 4MO5A 4H5RA 2Q0RA 2FXUA 3BP8A 5TKYA 1J6ZA 3ATVA 2ITMA 4ISFA 1QQMA 1SZ2A 3BEXA 3ZX2A 5KQDA 5AQHA 3H3NO 3VEZA 4BG9A 3J8AA 4CZGA 4EAHD 4ISEA 1XUPO 1GLFO 2NLXA 2F9TA 3JS6A 4BRCA 2IIRA 4IWVA 1KXPA 5AQIA 4XH1A 1Z05A 5AQRA 1KAYA 3GBTA 3WXJA 4BC2A 5LJVA 2YHYA 3CI5A 3UKUA 3VENA 1BUPA 3EN9A 4CJ7A 4H5VA 1HX1A 1NGBA 1NGCA 5KPZA 4CZEA 2GWKA 3HI0A 1ZXOA 3U9DA 2QXLA 3S41A 4CD3A 1KAXA 1E4GT 1V4TA 3DJCA 1NGIA 3IMXA 3VEVA 5I9EB 4MO4A 2W41A 5AQWA 3WXKA 4BQZA 5KPTA 3DXMA 3FFKB 5AQQA 5F0XA 2YHXA 3B8AX 1XQSC 4IJAA 3CJCA 2CGLA 1BA1A 5AFUH 1H1VA 3LDOA 2FLOA 4RCHA 1D4XA 2D1KA 4BC3A 2WUSA 3L0QA 3HSCA 3SK3A 1T6DA 1HUXA 4BGAA 1DKGD 1C0FA 2BUPA 4BRLA 3ZX3A 5BN8A 5LJWA 5E26A 1K8KB 3BUZB 3FZLA 3A5MC 3EZWA 1NGHA 3D2FB 2E88A 5ADXA 4I6MA 4BRNA 4FSVA 3WUHA 4B1VA 3H1VX 4BRDA 5AQPA 4FWOA 2FSKA 2CGKA 3GE1A 1GLCG 4AM6A 4BVPA 4CBWA 3HZ6A 3MMVA 1YUWA 4L3QA 2E2OA 2Q97A 1CZAN 4XEIA 4F9OA 1SQKA 4HWIA 2ZF5O 4FWQA 4EHTA 3ULEA 1TUYA 4K25A 1NM1A 1IG8A 2P9PB 3CJAA 5AQOA 4WQ5A 2CGJA 4BRGA 2P9SA 4K42A 3W3DA 4IZ9A 3MDQA 3U8XA 3UKRB 4GNIA 4WQ4A 1P8ZA 3SLCA 1NLVA 2VCPA 4PKHA 3MCPA 4B1ZA 3WQTA 1OKJA 5AQJA 4LC9B 5AQTA 4IO8A 1DGKN 4CZIA 3EL2A 3FE1A 4CZFA 5JLFA 1MWKA 2UYTA 1MA9B 1X9JA 2A40A 5BPMA 2AA4A 2V7ZA 2YHWA 2I7PA 3ATUA 4YDUA 3AARA 3M6GA 3WEEB 2VWBA 1S22A 1RGIA 2YJEA 5BN9A 4JD2A 1NMDA 3I33A 5AZIA 3DXKB 3UE5A 4CBXA 4BR9A 5JMVA 5AQYA 3ENHA 2GELA 3DWLA 1DEJA 5BR9A 2F9WA 3GG4A 2BTFA 3CERA 4FWPA 3QB0A 5LY3A 4JNEA 5FPEA 3KZBA 1WUAA 4H0YB 5AQGA 3VETA 5AR0A 4FWMA 3KVGA 3LL3A 2P9IB 4DCHA 4JHDB 4K43A 4BQLA 3TU5A 4CI6A 3H3OB 4FWKA 2E8AA 1RDWX 3TPQA 3VEWA 5AFUA 1WOQA 4WYBA 3M1FA 2GUPA 4BR7A 3HBTA 3QFUA 1TYQB 3LDLA 2QWQA 4E1JA 3BF3A 4BRFA 3A5OC 5KQ8A 1LOTB 3FGUA 2QWNA 3WT0A 4FOIA 2A3ZA 3H46O 4BRKA 2FSJA 4CZLA 3R8EA 3OHRA 2NZTA 3MN6A 3BF1A 5FPDA 3VEXA 3WXLA 4B1UB 3MN7A 1BWFO 4JHDA 4O8KA 3D2EB 4J8FA 3WQUA 3WXIA 4EHUA 4RWTA 2QWLA 4QS7A 2W40A 3UB5A 3VGKA 2A41A 4B1YB 4CD1A 2FSNA 5AZJB 1Y64A 1HJOA 4M7XA 3ZX0A 4BROA 2Q1NA 2Q31A 1QZ5A 4H5TA 3VGMA 2VYPA 3CJ7A 2QM1A 4MLHA 2Q0UA 4QS9A 3W0LA 2GTDA 2P9KB 3EO3A 2P9NB 2KHOA 3MN5A 3R6MA 4QS8A 4DB3A 3M3ZA 1G99A 4CBUA 1YAGA 3ZEUB 3LM9A 1HLUA 4H0OA 2D4WA 5AQMA 4O5FA 3AAQA 2YCHA 2FF6A 4H0TB 2IVPA 5AQXA 3QICA 2E2QA 4K41A 1NWKA 5KPRA 4HTLA 1GLBG 3JXUA 4H5NA 2FF3B 5EXWA 3AY9A 2OANA 1K8KA 3MK6A 4FPBA 4BG8A 5F2RA 2DPNA 3P4IA 4Z94A 3QMLA 4ISGA 3CETA 3LDQA 1MDUB 5AQKA 3D2FA 1XC3A 2QWMA 2V51B 2P9NA 1JCFA 2I7NA 5AQLA 1TUUA 1ESVA 5F1XA 4CZMA 1U2VB 3EKSA 2A5XA 3O4WA 1HKCA 3O1BA 4FWSA 3EKUA 1HKBA 5EOYA 4H03B 1GLLO 4M7YA 4C23A 3ZETB 1QHAA 4A61A 4MLEA 3LM2A 1GLEG 2GWJA 3G25A 2ZWHA 1KAZA 2P9PA 4BREA 4H5WA 2GEMA 1LCUA 1T6CA 1X3NA 3C7NB 3H6EA 5AQNA 1BO5O 3VEYA 2P9LB 4CZKA 2IVNA 1HPMA 3CHWA 3UKRA 4BRMA 2Q2RA 3IFRA 4DHYA 1NGGA 4CZHA 3H1QA 3U4LA 5B8HA 1MWMA 5CE3A 3A5LC 1GLJO 1NBWA 3C0BA 1V4SA 3R9PA 3ENOA 3ZETA 3QBXA 4PL8A 1E4FT 4BR0A 2HMPA 1NGFA 1BDGA 4DQ8A 3UKUB 2E1ZA 3O5BA 3CJ1A 3O80A 3CIPA 5BRDA 3VGLA 3D7EO 2E1YA 2P9LA 3HTVA 2PBDA 4NO7A 4BC5A 3F9MA 4IXCA 4PKGA 1IJJA 1ZBSA 3WEEA 3GOIA 4BR5A 2V52B 1ATSA 4XH5A 4BGBA 4B9QA 3GDQA 5ELZA 3DXKA 3O1WA 1YVNA 1GLAG 1BU6O 2QWOA 3KHYA 4WQ5C 3DXMB 4BC4A 3VERA 3CQYA 4BVOA 3VESA 3LDPA 3CJBA 3H45C 2NRHA 1T44A 4B1WB 2PAVA 2IVOA 2AP1A 4WQ4C 4CZJA 1ZC6A 4FWNA 3CJ9A 5AQZA 3RSEB 2D0OA 1YXQA 4IJNA 2P9IA 4AM7A 2HF3A 1SAZA 3QBWA 2ASMA 4JN4A 1S3XA 3A5NC 3VF2A 1TYQA 5E84A 2E2NA 2Q36A 4FWRA 2A6AA 1Q18A 4BRAA 4FL9A 4YDUC 3L4IA 4BRHA 5AQFA 3U9ZA 4I6MB 2ASPA 5EX5A 2CH6A 2E20A 2H3GX 5EVZA 3RSEA 4FO0A 4A2BA 1QZ6A 4H0PA 1NGAA 1QQOA 3D2EA 4KBOA 4BR2A 4JAXA 2EWSA 1R59O 5AZJA 5BPNA 4EIAA 2HF4A 3SJHA 2D0PA 4FPAA 3ULEB 1GLDG 3FZKA 1EQYA 3A8YA 3VF4A 5BRHA 4H0VB 4BRQA 2P9UB 3AAPA 2P9SB 3O6WA 1JCGA 3FLCO 4A2AA 2J4RA 2P9KA 3QDKA 4M63C 5JLHA 5AQUA 1NGEA 2ASOA 3L6QA 3ZEUA 4H0XB
chains in the Genus database with same CATH superfamily
3J7AP 3BZCA 4NB4A 4DTMA 5J2PA 3VQPA 3FZMA 1VK0A 5HP1A 1T05A 3GL1A 3V6DA 4NLCA 4IFYA 2R7YA 2HVHA 2VQFK 3MWPA 5FPNA 4AF1A 5BRFA 4E7JA 3SMSA 3DAWA 2ZGYA 2YX6A 1ATRA 1A5VA 3CQXA 3JYTA 1C0GA 4M3XA 3KIOA 3O8MA 5JICA 1EXQA 1RBVA 4DF8A 3FR0A 1ATNA 3LDNA 1NMNA 2PYLA 4B1XB 2QWPA 4FLTA 5FLXO 5CR4A 4CGFA 3NF6A 2YJFA 2OZSA 4OKEA 2KW4A 4HUGA 3BP8A 4DUZK 1J6ZA 3QLHA 2ITMA 4ISFA 1VQ7N 1SZ2A 2ITGA 4N47A 3BEXA 4O44A 4CJUA 1S1UA 4CZGA 4EAHD 1OH5A 1NJYA 1D9DA 4DU4A 4ZTJA 4PY5A 3M8RA 5HOOA 2G8VA 3LZJA 3P83D 2F8TA 3F2KA 4H5VA 3P31A 1DLOA 5AJ3K 1SL1A 1NGCA 3OY9A 4AHUA 3HI0A 3U9DA 2YKNA 3LAMA 3OYAA 1TL3A 1SUQA 1V4TA 3RMBA 5GAGP 3C65A 3LP2A 4IOAL 3THXB 4B9TA 5AQQA 5F0XA 1BGXT 4GV9A 4FK0A 3B8AX 3SQ1A 3KWIA 1WSGA 3VQ8A 1XQSC 1C1CA 3DRRA 5AFUH 4W5RA 1H1VA 3CMEN 3K5MA 1D4XA 3THYB 1A5WA 2Z1IA 3AO5A 3SK3A 1SL0A 4C8KA 4BGAA 4Q0BA 4W5NA 3M8SA 5E26A 4OX9K 3HVTA 3D2FB 3OBWA 4FJLA 1NK5A 2Z1JA 4FSVA 4E1MA 3H1VX 2B5JA 4BRDA 4FW2A 4FWOA 4JKGB 1IKXA 3CYMA 4AM6A 5SZTA 3MMVA 5M1QA 4F2RA 4FVUA 1SQKA 4WFNL 2ZF5O 2E6MA 4M3WA 4FM0A 1HJRA 4O8UA 2P9PB 1BI4A 5AQOA 3QERA 4K0KK 1ITGA 4CGDA 2CGJA 1X9SA 4IZ9A 3V1OA 4WQ4A 3ENBA 2O8FB 4LF7K 1XWLA 3Q7CA 4IEIA 1RDDA 2BH1A 1IH7A 5AQTA 4KH5A 1L3SA 5J2QA 4JI7K 3T1HK 4IOCL 5LMNK 4KRFA 1O1WA 4NCAA 4AHVA 3SYZA 4E19A 2ZJRL 1S1XA 2GV9A 1RGIA 4HUEA 4KHNA 4K8XA 1KFSA 3PSFA 1NMDA 4CJQA 2YV0X 5AZIA 3RRGA 3V1QA 2GELA 5KGWA 4RG8A 3T69A 5C42A 1QVFM 2F9WA 3CF5L 3CERA 5C10A 3LANA 3M8PA 4DTPA 1VQLN 4WFBL 5FPEA 1N34K 5AQGA 4NCBA 2FBYA 3LL3A 3ZLJA 2P9IB 5C2FA 4K43A 4B9VA 1M90O 4KB1A 2HVIA 3OYEA 3HYFA 1RDWX 1WSJA 5AFUA 3HBTA 2WFBA 2QWQA 3LDLA 4KV8A 3O4NA 1GOBA 3J80O 4BE0A 1HR0K 3MXJA 5KI6A 1VRTA 2ZJQL 4ZTFA 3FGUA 3ZSZA 4A59A 3MXMA 2A3ZA 4BRKA 3R8EA 3BF1A 3VEXA 3D45A 3ZT1A 4JHDA 4O8KA 3WQUA 3WXIA 4EHUA 4J8FA 2G8FA 4JI8K 3VGKA 4QS7A 1WNSA 3UB5A 4B1YB 2FSNA 2RHKA 3AVNA 4FLUA 4YORA 3CM6A 2Q1NA 2GBZA 3RR8A 1XHXA 4I2QA 4DTOA 3SUPA 5EU7A 3VGMA 4JI0K 3VQ5A 2HW3A 4CEDA 3CCSN 1QSLA 1QSYA 1HMVA 2XRIA 4LF9K 4DTRA 2P9KB 2P9NB 3R6MA 4IO9L 1G99A 1VSMA 3HM9A 1KC8O 4H0OA 3HVRA 2D4WA 5AQMA 3AAQA 2YCHA 2IVPA 4YOXA 3QICA 1NWKA 4HTLA 1UOCA 3HP6A 4I2PA 4M3UA 3MK6A 4FPBA 4BG8A 3PLAA 4B3SK 3P4IA 4Z94A 3QMLA 4PWDA 4CF9A 2UUAK 3LDQA 2O4IA 1J53A 4Y1CA 1NK8A 2NRVA 5K14A 2G8HA 1TUUA 3BY5A 4CZMA 2A5XA 2D0BA 3NH1A 1EWRA 1HKBA 3OYIA 3LWLA 1DTTA 3ZT3A 2LSNA 4H03B 2NUBA 5HRRA 4CF2A 4DSEA 4A61A 1Q81O 4CJVA 4CJKA 1GLEG 1IBLK 3KK2A 1KAZA 2YNFA 3CFOA 4JK7A 1HNIA 4DQIA 1BQMA 3CC4N 2GEMA 1LCUA 2DY4A 1X3NA 1RBUA 4CZKA 4LFCK 4PHTX 2HHHK 1TKXA 1HPMA 5GADP 2YNHA 4F4KA 4DHYA 2XHBA 4E3SA 3H1QA 1NJWA 4CK2A 2Y1IA 1V4SA 3QBXA 4PL8A 1JLEA 3VQDA 1QHTA 4DQ8A 3BDPA 2E1ZA 3CJ1A 4KTQA 3AO1A 3HPOA 2E1YA 3HTVA 2PBDA 4NO7A 4CERA 3WEEA 3F9MA 3E1YA 1RDUA 3O9QA 2V52B 1ASWA 1VQPN 4JK8A 3UIQA 1XNRK 4AQYK 1ATSA 3VQEA 3NGYA 3NAEA 3LALA 3CCJN 4DMNA 3AO4A 4IG3A 4DV0K 2IDOA 3CJBA 3PY8A 1NK7A 4B1WB 1KTQA 1XI1A 1KLNA 2IVOA 2JLEA 3RVCA 1YJ9N 4FWNA 3KK3A 3IKMA 3RSEB 2UU9K 4FJ9A 4QAGA 3NHGA 2FBVA 5GIOA 4ELTA 3WXMB 3QBWA 2ASMA 3TSPA 4JN4A 1TK8A 3VF2A 3TAFA 4Z4FA 4JKAA 5GIPA 3OYKA 4Z4GA 3NMUA 3NFAA 1HYVA 4N41A 2BE2A 2WONA 1BHLA 1VQ6N 5EVZA 1QZ6A 3AVGA 1SL2A 1C1AA 4BR2A 5HRPA 4JAXA 2EWSA 1JXEA 1R59O 4ILGB 5AZJA 4DQSA 3OYMA 3EYZA 2VWKA 5JS1A 3L4QA 4R79A 4FPAA 3FZKA 4CEOA 3A8YA 3O9UA 3R3LA 3WNFA 5BRHA 5M1FA 1BI4B 2X78A 3LP0A 3AAPA 3HP9A 4FZZA 1QVGM 1Q9XA 4A2AA 1FKOA 4NYFA 5T7BA 4M63C 5JLHA 4CIGA 4FJ7A 3CCVN 3IRXA 2E6LA 1BG3A 1RDCA 5ADXH 3ZSQA 2HHSA 3DOKA 3OYCA 5CY4A 3I8BA 4ZHRA 2Z1HA 2P9UA 2RF2A 1HRHA 1U6ZA 1WSIA 2HHQA 4YOUA 1IKYA 3NH2A 3IDHA 2P1JA 3ZT0A 3MN9A 1W2BM 1UA1A 1K9MO 1ASVA 4JKBA 4O55A 1YJNN 5AZIB 3DLBA 3K5OA 2A42A 1CXUA 3H08A 5FPMA 3DLGA 1Z6RA 3VQAA 2QWRA 1I39A 2ZE2A 4FWLA 4FZXC 1WAJA 2E2PA 4UQGA 3CCQN 1KCFA 1UA0A 4DSLA 2HOEA 2OTJN 4FLYA 2QI2A 2OPSA 4FJHA 4PQUA 3MCAB 3SPYA 3OTOK 2YI1A 3E01A 5AQSA 3ZSXA 3M5RA 4GV6A 1D5AA 4ID1A 4M3ZA 3NVKA 4RW7A 3ZX2A 3AVAA 5KQDA 4F2SA 3VEZA 4ISEA 4BE1A 2F9TA 3QEVA 2IIRA 4IWVA 1KXPA 1Z05A 3N4QA 3ASMA 5AQRA 3WXJA 2DFHA 3TTCA 2YHYA 2X74A 3VENA 1VQON 1KFDA 1BUPA 4OLAA 2D5RA 3DM2A 3EN9A 3S9HA 5KPZA 1ZXOA 2AJQA 5JVGL 3T1AA 1KAXA 1NGIA 3LAKA 5KPTA 4BQZA 3DXMA 4B9SA 3SV4A 3EEQA 3LDOA 4RCHA 3QNOA 1FK9A 3RMDA 4DR5K 3K9JA 3HSCA 3M8QA 1IKWA 1B92A 1HNXK 4DQQA 1DKGD 2VG5A 4CGJA 5J2MA 2XY6A 1C0FA 4BRLA 1Z26A 2Y1JA 4KH6A 3TAMA 4C8MA 4LFBK 3EZWA 2PY5A 1K73O 2O8EA 2E88A 5ADXA 3AGRA 4I6MA 1TGOA 1WSHA 3NE6A 2FSKA 2CGKA 1B9FA 4YY3K 1T8EA 3GE1A 4O0JA 4CBWA 4BVPA 4DFKA 1SKRA 3CQ8A 3AA4A 4IFVA 2Q97A 3RMAA 1YI2N 4F9OA 2JWLA 1JXBA 5TKWA 3TAPA 2G8WA 1UAXA 1IG8A 5SWMA 1BIUA 1GOAA 1VQ9N 2GX9A 1VSEA 5M1NA 4DWIA 4GNIA 3K0SA 4ELUA 3L2UA 2XY7A 3SLCA 2VCPA 2QEXN 3I0RA 4PKHA 4DR2K 4B1ZA 3DLLL 2KQ2A 1OKJA 5AQJA 2WTUA 4IO8A 1L3VA 4B9UA 1MWKA 4C8NA 3T19A 4CEAA 4A57A 3U3GA 1X9JA 1GOCA 1NKCA 3PO4A 4FM1A 3M6GA 3WEEB 5C0YA 3V81A 1CZBA 3I55N 4JD2A 3IS9A 1TKDA 4F3OA 4OGEA 1F21A 4BR9A 4H4OA 2QKBA 5BR9A 4WFAL 3L2WA 2BTFA 4FWPA 3QB0A 3AA2A 1T7PA 1CXQA 4HVJA 1WLJA 1WUAA 3F5TA 4EZ6A 1RT1A 1HQUA 1K8AO 3L2RA 3CFPA 4UY8O 3TU5A 3H3OB 2G8UA 3TPQA 3VEWA 3HXMA 4AHRA 4GMJB 1ASUA 2GUPA 4F3TA 3QFUA 3CCMN 5DM7L 5FDLA 3BF3A 2HBJA 3C6HA 2QWNA 4CJ4A 4MDAA 1NJIO 2NZTA 1BL3A 3MN6A 5FPDA 4B1UB 3MXIA 4X65K 3MN7A 3TWHA 4CJPA 2D0CA 3VA0A 5AZJB 1Y64A 5CZ2A 1HJOA 3OBYA 4M7XA 2O8DB 4BROA 1OH6A 1NOYA 3NBPA 4O0IA 1VSIA 4B3RK 2VYPA 2QTDA 4MLHA 4BDYA 3EO3A 3MN5A 4QS8A 3K5NA 3M3ZA 3HK2A 1RDAA 4CBUA 4IKFA 1YAGA 3HL8A 3O9TA 3V9WA 1HLUA 4C1NK 2EX3A 4DFJA 2FF6A 3HSTB 5AQXA 2E2QA 3TSQA 3F9KA 3OYHA 1GLBG 4H5NA 3O3FA 3E9LA 1VHXA 2OANA 1K8KA 4FLZA 1LAVA 1HQEA 3CCUN 1MDUB 3DRSA 5AQKA 4NLBA 4LH4A 2QWMA 1Q8IA 4DSIA 2KLAA 1HNVA 1JCFA 2I7NA 3KWGA 1XC9A 2VQEK 2DFFA 3PO5A 4NCGA 1JLFA 3EKSA 3O1BA 1KVAA 4E7IA 4JI4K 3EKUA 5EOYA 4YOVA 1W0HA 3C6AA 2KZZA 4C23A 4IDKA 1Q7YO 4CJEA 2HHXA 3NVMA 3NGZA 3G25A 1NOZA 2ZWHA 1VSFA 1WSEA 4U7BA 3V9UA 2YHAA 3OS0A 1L5UA 3PUFA 1HNZK 1I3AA 1BO5O 4CJ3A 3OYNA 4C8LA 2IVNA 3KK7A 4E89A 3SNNA 3CHWA 3UKRA 3O4QA 4Z4CA 4CJTA 4FLVA 1MWMA 5CE3A 1S6PA 1OVYA 1NBWA 3C0BA 3ZETA 1EO1A 4DKWA 5CYMA 4DTJA 3AA5X 4BR0A 4DTUA 4GVEA 1LV5A 5MLCQ 1NGFA 1VSLA 1BDGA 1TK0A 1VAZA 4OPAA 1TAUA 3VGLA 4J2EA 4DSFA 2OTLN 2P9LA 4KAZA 1XNQK 3GOIA 4KTWA 2F96A 3NF7A 3D0PA 1I94K 1QTMA 3VN5A 4Z0UA 4BGBA 2IOCA 3GDQA 4B9QA 3PX4A 3OJUA 3THWA 4DF4A 1XHZA 5HRSA 3ALYA 3ZSWA 3CD6N 3SZ2A 4JYAK 4E7HA 3KHYA 1S72N 4IEEA 4CHQA 3DXMB 1WB9A 3QO9A 3VESA 3A2FA 4RW8A 3OYBA 4PUOA 1JL1A 3KJVA 4CZJA 1ZBFA 3VTIA 3KD5E 3CJ9A 1VSKA 5AQZA 3CC7N 4IJNA 4JK9A 2YHBA 2HF3A 4C1NI 3RTVA 4AHSA 1C6VA 4CEFA 2QA4N 1S3XA 3A5NC 5LL6Z 4GKJK 1TYQA 1X9MA 4EZ9A 2Q36A 1S5JA 4O5BA 3OW2M 1OH8A 4YDUC 4J2BA 4LY7A 1WSFA 4JLHA 2O8EB 4CIEA 4LFAK 4I6MB 5EX5A 4CHZA 2E20A 2H3GX 4FO0A 1TV6A 4H0PA 1DT9A 3D2EA 4JS5A 4U67L 4YOYA 1TVRA 5BPNA 4FLXA 3QNNA 3SAFA 3G71N 1NK0A 3K5LA 3VF4A 5HL7L 4H0VB 1N33K 3OYGA 2BDPA 4FJNA 2OCEA 4DFMA 3VQ4A 1JCGA 2J4RA 3VQBA 3LDSA 3LP3A 3U3YA 3ZEUA 1Y97A 3SBGA 3MEEA 3SPZA 4BR4A 3VF6A 3CPEA 3SQ0A 2G8KA 3CXCM 1U48A 1RFQA 3FZFA 2HHUA 4AHCA 3CMAN 1NGDA 5AQVA 4KKOA 3P5JA 3SJJA 5I3UA 4BRPA 1LWFA 1YTAA 1EETA 3PX6A 2HHVA 3DOLA 3FZHA 1M1KO 2ZGZA 5KTQA 1ZBIA 3DLRA 4AILC 3HO1A 3IUCA 1QQNA 5BREA 4FM2A 2GUIA 4JD2B 4PKIA 4B8AB 4AHTA 4EFHA 1U2VA 5HRNA 2CH5A 3AVJA 4XH4A 3HOSA 1JCEA 4RW9A 4C8OA 2Z1GA 3VEOA 3IAYA 3WNEA 1X3MA 1NGJA 4DS4A 1RT3A 1HKGA 1RDBA 5EY4A 3TAEA 4YOWA 2P5OA 4FJKA 1C0MA 2ZM6K 3C7NA 1WBBA 4A62A 5CHIA 1E3MA 4MO5A 4H5RA 2FXUA 5TKYA 1QQMA 5E41A 3OA9A 5C24A 4BG9A 3J8AA 1HYZA 4MDBA 4N56A 4CW7B 4DTNA 1K6YA 1YF5L 2NLXA 2F8SA 3AVKA 4BRCA 4JRPA 2HBLA 5AQIA 1J5EK 4XH1A 3VMFB 1KAYA 4BC2A 4DR3K 2UXDK 4DV6K 3AVBA 3V1RA 1C0TA 4DQPA 2KZMA 4E1NA 4R5PA 1FXXA 1HX1A 1LW0A 4CZEA 2QXLA 1L3UA 1U45A 5DK5A 1QS4A 3IMXA 4MO4A 3DLKA 4B3MK 4X66K 1U04A 1N6QA 1YT3A 5D3GA 3CJCA 4V19S 1BA1A 3K9KA 4KTZA 4DV1K 4CJSA 1IBMK 2WOMA 2FLOA 3ZYYX 5KGXA 4M3RA 4CCHA 3L0QA 4FCYA 3HPHA 3SUQA 3NH0A 4DR1K 4CFBA 4ILJA 5BN8A 5LJWA 4KHPK 2O8BA 2D0AA 3RWUA 1K8KB 4IFEA 4ILHA 2WBNA 3SUNA 4OO1J 1IO2A 3FZLA 1TK5A 2PFUA 4DU3A 1NGHA 4QCLA 4OJRA 3SAGA 5GAHP 4OPJA 4BRNA 3WUHA 3OYLA 5AQPA 3THYA 1S1TA 1A5XA 3KLHA 3TAGA 3L8BA 3EE8A 1J54A 1RT6A 1YUWA 1RNHA 2E2OA 3LPTA 3OS2A 4B08A 3G6EN 1CZAN 2ATQA 3L3UA 3MECA 4ICLA 4CESA 4HWIA 3F73A 1ZBLA 1U4BA 1G15A 2ZQBA 4EHTA 4K25A 2BGGA 4B9LA 1RTJA 4CF1A 1NM1A 3N4PA 4JI6K 4M42A 3CJAA 4KHSA 1YTUA 2P9SA 1EKEA 3MDQA 4CEEA 3UKRB 4JKGA 3LZIA 2DFEA 1P8ZA 1RT5A 2IGIA 1NLVA 3MCPA 3EE9A 4OGCA 2OYQA 3R1XA 4NXMK 4LC9B 1DGKN 5JLFA 4I9LA 3G4SN 3SQ2A 1OVQA 2AA4A 2I7PA 5BR8K 3O3GA 3ATUA 4YDUA 2VWBA 3NGIA 2B4JA 4CJFA 5BN9A 1NK9A 5GAEP 4IBNA 4CGIA 3I33A 3THWB 3OYJA 1IV0A 3UE5A 4CBXA 5JMVA 1JKHA 4KI6A 5AQYA 4GW6A 3DWLA 1C0UA 1REVA 3GG4A 4I7FA 1S9GA 2ZD1A 1NG9A 4CFCA 3QINA 3K57A 5DMRA 3CCEN 2VG7A 4JHDB 2KTQA 1TKZA 3MX5A 4BQLA 1QSSA 5GINA 4BDZA 4KB0A 3AO3A 4FWKA 2PZSA 4CHPA 2IC3A 1WOQA 4WYBA 3PSIA 3NF8A 4BR7A 1S6QA 1TYQB 4FJ5A 4CJLA 3U6FA 4FJXA 4FJ8A 4E1JA 4FXDA 1QQCA 2HNYA 4PA1A 4BRFA 3A5OC 4OKKA 5KQ8A 3EY1A 3K2PA 3H46O 1X1PA 2FSJA 4B3TK 3TSUA 4CZLA 2O8CA 3WXLA 3D2EB 3EZ5A 3HPGA 4RWTA 2QWLA 2W40A 1NU0A 2A41A 4CD1A 5LMUK 1NNEA 3ZX0A 4CFDA 3KKSA 3VQ7A 1BQNA 3C94A 3HRGA 3T7ZA 2PYJA 2Q31A 1QZ5A 3E9PA 4FYDA 2RPIA 4CK1A 2NRTA 3ZT2A 2QM1A 1J9AA 4QS9A 3W0LA 5FRNA 3ZSRA 5IT9O 4CK3A 2FBXA 3MX2A 3ZEUB 3LM9A 2RN2A 2IS3A 1S1WA 3RMCA 4O5FA 4AH9A 4H0TB 1BIZA 4K41A 2KFNA 4ELVA 2F4VK 2FF3B 1WN7A 3C95A 1YVUA 2FBTA 3CETA 1SKSA 1KVCA 3ZSOA 1JLAA 3T1YK 2RKIA 2V51B 1Q9YA 2P9NA 1RILA 5AQLA 2I5JA 2KKZA 3CC2N 3VQ9A 1U2VB 3SQ4A 3O4WA 2QXFA 1HPZA 4CEQA 3SCXA 3QEPA 4FWSA 4CJRA 2B6AA 1N5YA 4JKDA 2NRXA 1QHAA 4M3YA 4MLEA 3LM2A 4KHUA 3WNGA 1ZYQA 2Q3SA 4Y1DA 4BREA 3J7ZO 4H5WA 1T6CA 3C7NB 1Q86O 3PX0A 3VEYA 4J2AA 4BE2A 4LD0A 4BRMA 4E0DA 2Q2RA 3IFRA 4W5TA 2EHGA 5KRTA 5B8HA 1W9HA 4IOXA 3R9PA 1Z25A 3ENOA 1XMQK 4DTXA 3PV8A 4M41A 4IDHA 2G8IA 4DLEA 1LW2A 4CEBA 4GKKK 1EP4A 4KHQA 3AO2A 3HT3A 3L2QA 4DTSA 3O80A 3CIPA 5BRDA 3IG1A 3D7EO 3QETA 1JLQA 3VQCA 4IXCA 4PKGA 4O4GA 2NRWA 2HMIA 5ELZA 3DXKA 3O1WA 1YVNA 2QWOA 5HROA 3CPWM 4CF0A 3OS1A 2F7TA 4WQ5C 4CEZA 3VQQA 4BC4A 1VQMN 2YNGA 3V9SA 3LDPA 3H45C 1T44A 4NXNK 2PAVA 3Q7BA 5H1SQ 4DR4K 1RTDA 3HOTA 2UXCK 2D0OA 5CYQA 1YXQA 2WC9A 4XIUA 4AM7A 4CFAA 4FLWA 4DV5K 3SI6A 1SAZA 5JVHL 3CFRA 2VGMA 3NF9A 4MQ3A 5I42A 4FK2A 1FJGK 3OJSA 4OLBA 1D9FA 2O8BB 1XMOK 2OPQA 4FL9A 3TTDA 1DTQA 3L4IA 3U9ZA 3PIOL 4CIFA 1NK6A 5HBMA 4IG0A 4EP4A 2CH6A 3DI6A 3RSEA 5DM6L 4DU1A 3QEXA 3NDKA 4LF4K 1NJXA 4FK4A 2ETJA 2HF4A 3C6TA 4KO0A 1EQYA 3DRPA 1KD1O 2P9UB 4FJIA 2P9SB 3TABA 3D6RA 3SUOA 4KI4A 1RTHA 3FLCO 5AQUA 1NGEA 3L6QA 4H4MA 1RT4A 4PL7A 4CJWA 3FFIA 4MFBA 1TL1A 3KD1E 4DG1A 2OPRA 4LSLA 1YHQN 4JEPA 3VPZA 1BOTO 4RTFD 3J81O 5IWAK 1J5OA 3ID8A 1JJ2M 2VWJA 4Y0WA 2HB5A 3QEIA 5M1OA 5BPLA 1U49A 3S3NA 1VQ5N 2OPPA 4GY2B 4DV3K 1BA0A 4FOEA 3KTQA 3V9XA 2JGUA 2V7YA 5KRSA 3AGKA 5M1KA 3HM8A 1U47A 1RTIA 4BRIA 3PIPL 1SV5A 3AVLA 3O08A 3QFPA 2QW9A 3CCRN 4DSJA 3VOVA 2HHTA 4DQRA 3SMPA 3A0IX 3J7YP 2Q0RA 1W97L 1YIJN 3ATVA 3LP1A 1JLCA 5AQHA 3H3NO 2YNIA 4DR6K 2E5LK 1LWCA 1XUPO 1GLFO 3JS6A 2DTUA 1VSDA 2X6SA 4YFUA 2A1RA 3GBTA 3E9OA 5LJVA 5C2DA 3CI5A 3UKUA 1BCOA 1EX4A 3V9ZA 4CHOA 4F8RA 3L3VA 4DUYK 4HUFA 4CJ7A 2O8CB 2OA8A 4I9QA 2VGNA 1NGBA 4J2DA 4FVMA 1R0AA 2GWKA 3O9SA 1T3VA 3S41A 4CD3A 1E4GT 3DJCA 1RBSA 3VEVA 5I9EB 4CE9A 2W41A 5AQWA 3WXKA 4DV4K 1NJZA 3FFKB 2YHXA 4DV7K 1BISA 2W42A 1SS6A 4IJAA 2CGLA 2VG6A 1CZ9A 4YHHK 2D1KA 4LF6K 4KHWA 4BC3A 2WUSA 1T6DA 1HUXA 1N32K 4WE1A 4A5BA 1B9DA 1TKTA 4CECA 2BUPA 3ZX3A 1O13A 1ILYA 3BUZB 3L2VA 2IAJA 1KRPA 3A5MC 4Z4HA 3RRHA 1JL2A 4B1VA 4B9MA 3MWTA 4L8RB 1WBDA 4H8KA 4JV5K 3LWMA 3I8DA 1GLCG 3ISNC 3HZ6A 4DSKA 4DV2K 4L3QA 4KREA 5C15A 4XEIA 2O4GA 5HLFA 4FWQA 3ULEA 1TUYA 3SAHA 3TR8A 1VQKN 4WQ5A 4BRGA 3ID6A 3OYDA 1NKBA 4K42A 5M1PA 3W3DA 3P39A 3KLGA 3U8XA 4BWMA 1N8RO 2UUBK 3THVA 5FROA 4X64K 4FJGA 3P1GA 5C12A 4W5QA 2ZJPL 3ZSVA 3G0ZA 1IG9A 4CGHA 3WQTA 1MU2A 4BACA 4CZIA 4G9ZA 3I56N 3B6PA 4HCBA 3EL2A 2XO7A 3FE1A 4CZFA 2UYTA 4W5OA 3TAQA 1MA9B 1SKWA 3QEWA 2A40A 5BPMA 2V7ZA 4Z4IA 4JI1K 2YHWA 5J1EA 3LPUA 3AARA 1S22A 1N36K 1D8YA 2YJEA 2YKMA 4E7KA 4ID5A 4JKHA 1S1VA 1WAFA 3DXKB 1HNWK 4CVNE 3P38A 4FZYA 1KQSM 4M45A 3ITHA 3ENHA 3MEGA 1DEJA 3G10A 1LWEA 2OZMA 3AVIA 1HYSA 3VQ6A 3AVHA 4YOTA 5LY3A 4LH5A 3WNHA 2QK9A 4JNEA 3KZBA 4H0YB 4KHYA 2NRZA 3TTFA 3VETA 3B6OA 5AR0A 4FWMA 4JKEA 3KVGA 4DCHA 2P51A 3KLFA 1VQ8N 4CI6A 1KSPA 2HSTA 4BWJA 2E8AA 4FW1A 3BGRA 3M1FA 1VSHA 2HNDA 4CJ5A 3BZKA 1TAQA 4EP5A 1LOTB 4OPKA 3WT0A 4FOIA 3V4IA 3OHRA 1BWFO 4CHYA 3JSMA 3CG7A 4FJJA 4LF5K 3CCLN 4KH4A 4QOZB 3DMJA 4NYNA 4DFPA 2KFZA 3THXA 4BY9C 4H5TA 3CM5A 2P5GA 4K8ZA 1VSJA 1YJWN 3CJ7A 3DLEA 5FRMA 2Q0UA 4KPYA 2GTDA 1RCHA 2KHOA 4CF8A 4DB3A 4GVMA 3QESA 1RT7A 1S9EA 4DS5A 4N5SA 1JLGA 1ZBHA 3ZSYA 3MEDA 4JS4A 2O8DA 5KPRA 2JWKA 3AA3A 3JXUA 4DR7K 5EXWA 3O3HA 3AY9A 1P90A 1KLMA 4OVLA 2DPNA 5F2RA 4HCCA 3K59A 4ISGA 4E7LA 3D2FA 1XC3A 2E4LA 1RBTA 2W6LA 2QKKA 1C1BA 1ESVA 4CHNA 5F1XA 3QIPA 3DYAA 1HKCA 1NKEA 2HBKA 4BDPA 2XY5A 1RBRA 3T3FA 2FC0A 2HNZA 3KLEA 1Q82O 1GLLO 3VA3A 4M7YA 3ZETB 4WCEL 2BANA 2UUCK 2GWJA 4DLGA 4JI2K 2P9PA 3C6UA 3KK1A 3NCIA 5AQNA 3H6EA 3AV9A 2P9LB 3TANA 5A2QO 1X9WA 4G1QA 2O8FA 4RW6A 4OPHA 1NGGA 3ZT4A 4CZHA 1QE1A 3U4LA 3KLIA 3A5LC 1GLJO 4JKFA 4JRQA 2HHWA 3K58A 1YITN 1E4FT 4HTUA 2HMPA 4X62K 3S3MA 3UKUB 4TSXA 3O5BA 3SBTA 1T03A 3E66A 4BC5A 2A1SA 4RW4A 1IJJA 1ZBSA 1VRUA 4BR5A 4GV3A 3QIOA 3O9RA 3AVFA 1OH7A 4XH5A 4WF9L 2NRRA 3MAQA 3HJFA 1GLAG 1BU6O 1IBKK 2HBMA 1FW6A 3VERA 4B8CA 3CQYA 4BVOA 3JAMO 4LF8K 1UWBA 4JI3K 1RT2A 2NRHA 3OVNA 3VTHA 2AP1A 4WQ4C 1ZBUA 1FKPA 1ZC6A 5C25A 4HHTA 4KFBA 2W6KA 1JLBA 3SV3A 2P9IA 4Q5VA 4B3OA 4LSNA 5CZ1A 1W7AA 2X6NA 3ZCMA 4M3TA 2NNWA 4B9NA 3I0SA 1NK4A 5E84A 2E2NA 4FWRA 5JS2A 2A6AA 3TARA 1LAWA 1Q18A 4BRAA 1EWQA 3OYFA 4BRHA 5AQFA 2XY8A 2ASPA 4A5AA 1VQNN 1KVBA 4YNQA 4A2BA 1NGAA 1QQOA 4JI5K 4KBOA 2UXBK 5J2NA 3ULDA 3S3OA 4FJMA 1IKVA 4CGGA 4EIAA 3SJHA 2D0PA 3ULEB 1GLDG 1VQ4N 4BRQA 3AVMA 3TI0A 3O6WA 3DLHA 3KKRA 2RE2A 4Z4EA 4N76A 1BCMA 4JKCA 1L3TA 3RR7A 2P9KA 3QDKA 4OKJA 3AVCA 1CLQA 2ASOA 4H0XB
chains in the Genus database with same CATH topology
1BG3A 4BR4A 4NB4A 3VF6A 4PL7A 3CPEA 5ADXH 3CXCM 3FZMA 1RFQA 3FZFA 3CMAN 1NGDA 5AQVA 1YHQN 4JEPA 3GL1A 4BRPA 3I8BA 3VPZA 1BOTO 3FZHA 2P9UA 4NLCA 4RTFD 1M1KO 2ZGZA 1U6ZA 4YOUA 3MWPA 5FPNA 3ID8A 3IDHA 4AF1A 5BRFA 1JJ2M 3SMSA 3DAWA 3MN9A 2ZGYA 4Y0WA 1W2BM 3IUCA 1QQNA 2YX6A 5BREA 1K9MO 4JKBA 4JD2B 1ATRA 4PKIA 1YJNN 4EFHA 1U2VA 3CQXA 5AZIB 2CH5A 1C0GA 5M1OA 5BPLA 2A42A 5FPMA 1VQ5N 4GY2B 4XH4A 3O8MA 5JICA 1BA0A 4FOEA 1Z6RA 2QWRA 2V7YA 3HOSA 1JCEA 3AGKA 4FWLA 5M1KA 3HM8A 3FR0A 3VEOA 4BRIA 1ATNA 1X3MA 3PIPL 2E2PA 1NGJA 3LDNA 3CCQN 2HOEA 3O08A 2OTJN 2QI2A 1HKGA 3QFPA 2QW9A 5EY4A 2QWPA 4B1XB 4YOWA 3CCRN 3VOVA 3MCAB 3C7NA 5CR4A 4A62A 2YI1A 5AQSA 3SMPA 5CHIA 3M5RA 3A0IX 2YJFA 4MO5A 4GV6A 4H5RA 2Q0RA 1W97L 2FXUA 3BP8A 1YIJN 5TKYA 1J6ZA 3ATVA 2ITMA 4ISFA 1QQMA 1VQ7N 3NVKA 1SZ2A 3BEXA 3ZX2A 5KQDA 5AQHA 3H3NO 3OA9A 3VEZA 4BG9A 3J8AA 4MDBA 4CZGA 4EAHD 4ISEA 1XUPO 1GLFO 1YF5L 2F9TA 2NLXA 3JS6A 4BRCA 2HBLA 2IIRA 1KXPA 4IWVA 4XH1A 1Z05A 5AQIA 3N4QA 3VMFB 5AQRA 1KAYA 3GBTA 3WXJA 3TTCA 3E9OA 4BC2A 5LJVA 2YHYA 5C2DA 3CI5A 3UKUA 3VENA 5HOOA 1VQON 1BUPA 3EN9A 3F2KA 4H5VA 3P31A 4CJ7A 1HX1A 2VGNA 1NGBA 1NGCA 5KPZA 4CZEA 2GWKA 3HI0A 1ZXOA 3U9DA 2QXLA 3O9SA 5JVGL 1T3VA 3S41A 4CD3A 1KAXA 1E4GT 1V4TA 3DJCA 5GAGP 1NGIA 3IMXA 3C65A 3VEVA 5I9EB 4MO4A 2W41A 4IOAL 5AQWA 3WXKA 4BQZA 5KPTA 3DXMA 3FFKB 5AQQA 5F0XA 4GV9A 2YHXA 3B8AX 3KWIA 1SS6A 1XQSC 4IJAA 3CJCA 2CGLA 1BA1A 3K9KA 5AFUH 1H1VA 3CMEN 3LDOA 2FLOA 4RCHA 1D4XA 2D1KA 3ZYYX 4BC3A 2WUSA 3L0QA 3K9JA 3HSCA 3SK3A 1T6DA 1HUXA 4BGAA 1DKGD 4A5BA 1C0FA 4ILJA 2BUPA 4BRLA 3ZX3A 5BN8A 5LJWA 1O13A 1ILYA 5E26A 1K8KB 3BUZB 4IFEA 4KH6A 4ILHA 2WBNA 4OO1J 3FZLA 3A5MC 2PFUA 3EZWA 1NGHA 3D2FB 3OBWA 1K73O 3SAGA 2E88A 5ADXA 5GAHP 3AGRA 4I6MA 4BRNA 4FSVA 3WUHA 4B1VA 3H1VX 4BRDA 3MWTA 5AQPA 4FWOA 2FSKA 2CGKA 4JKGB 3GE1A 1GLCG 4AM6A 4BVPA 3EE8A 4CBWA 3HZ6A 3MMVA 5M1QA 1YUWA 4L3QA 5C15A 2E2OA 2Q97A 1CZAN 4XEIA 4F9OA 3G6EN 1YI2N 4FVUA 1SQKA 4HWIA 4WFNL 2ZF5O 2JWLA 4FWQA 4EHTA 3ULEA 1TUYA 4K25A 3SAHA 5TKWA 4O8UA 1NM1A 3N4PA 1IG8A 1VQKN 2P9PB 3CJAA 5AQOA 4WQ5A 2CGJA 3ID6A 4BRGA 2P9SA 1VQ9N 4K42A 5M1PA 2GX9A 3W3DA 3P39A 4IZ9A 3MDQA 3U8XA 5M1NA 1N8RO 3UKRB 4GNIA 4JKGA 4WQ4A 3ENBA 1P8ZA 3Q7CA 4IEIA 3SLCA 5C12A 2BH1A 1NLVA 2VCPA 2QEXN 4PKHA 3MCPA 3EE9A 2ZJPL 4B1ZA 3R1XA 3DLLL 3WQTA 1OKJA 5AQJA 4LC9B 5AQTA 4IO8A 1DGKN 4CZIA 4KH5A 3I56N 4G9ZA 3EL2A 3FE1A 4CZFA 5JLFA 1MWKA 2UYTA 1MA9B 4A57A 4IOCL 1X9JA 3G4SN 2A40A 5BPMA 2AA4A 2V7ZA 2YHWA 2I7PA 3ATUA 4YDUA 3AARA 3M6GA 3WEEB 2VWBA 2ZJRL 1S22A 5C0YA 1RGIA 2YJEA 5BN9A 5GAEP 4JD2A 3I55N 4JKHA 1NMDA 3I33A 5AZIA 3DXKB 3P38A 3UE5A 4CBXA 4BR9A 5JMVA 1KQSM 5AQYA 3ENHA 2GELA 3DWLA 1DEJA 3T69A 5BR9A 4WFAL 1QVFM 2F9WA 3GG4A 3CF5L 2BTFA 3CERA 5C10A 4FWPA 3QB0A 4YOTA 5LY3A 1VQLN 4JNEA 4WFBL 5FPEA 3KZBA 1WUAA 3F5TA 4H0YB 5AQGA 3CCEN 2NRZA 3TTFA 3VETA 5AR0A 4FWMA 4JKEA 3KVGA 3LL3A 1K8AO 2P9IB 4DCHA 4JHDB 5C2FA 4K43A 4BQLA 3MX5A 4UY8O 1M90O 5GINA 1VQ8N 3TU5A 4CI6A 3H3OB 4FWKA 2HSTA 2E8AA 1RDWX 3TPQA 3VEWA 5AFUA 1WOQA 4WYBA 3M1FA 2GUPA 4BR7A 3HBTA 3QFUA 1TYQB 2WFBA 2QWQA 3LDLA 3CCMN 5DM7L 4E1JA 3BF3A 4BRFA 3A5OC 5KQ8A 2HBJA 2ZJQL 3C6HA 1LOTB 3FGUA 4A59A 2QWNA 3WT0A 4FOIA 2A3ZA 3H46O 4BRKA 2FSJA 4MDAA 3TSUA 4CZLA 3R8EA 3OHRA 2NZTA 3MN6A 3BF1A 5FPDA 1NJIO 3VEXA 3WXLA 4B1UB 3MN7A 1BWFO 4JHDA 4O8KA 3D2EB 4J8FA 3WQUA 3WXIA 4EHUA 4RWTA 2QWLA 4QS7A 2W40A 3UB5A 3VGKA 2A41A 4B1YB 4CD1A 2FSNA 2RHKA 5AZJB 3CCLN 1Y64A 4YORA 1HJOA 3OBYA 4KH4A 4M7XA 3ZX0A 4BROA 2Q1NA 3HRGA 3T7ZA 4BY9C 2Q31A 1QZ5A 3E9PA 4H5TA 3VGMA 2NRTA 2VYPA 1YJWN 3CCSN 3CJ7A 2QM1A 2QTDA 4MLHA 2Q0UA 4QS9A 3W0LA 2GTDA 2P9KB 3EO3A 2P9NB 2KHOA 3MN5A 3R6MA 4QS8A 4IO9L 4DB3A 3M3ZA 1G99A 4GV3A 3MX2A 4CBUA 1YAGA 3O9TA 3ZEUB 3LM9A 1HLUA 4H0OA 1KC8O 4C1NK 2D4WA 5AQMA 4O5FA 3AAQA 2YCHA 2FF6A 4H0TB 2IVPA 5AQXA 4YOXA 3QICA 2E2QA 4K41A 1NWKA 3TSQA 5KPRA 4HTLA 2JWKA 1GLBG 3JXUA 4H5NA 2FF3B 5EXWA 3E9LA 3AY9A 2OANA 1K8KA 3MK6A 4FPBA 4BG8A 3PLAA 1P90A 5F2RA 2DPNA 3P4IA 4Z94A 3QMLA 4ISGA 3CETA 3LDQA 3CCUN 1MDUB 5AQKA 3D2FA 4NLBA 1XC3A 2QWMA 2NRVA 2KLAA 2V51B 2P9NA 1JCFA 2I7NA 2KKZA 3KWGA 5AQLA 3CC2N 1TUUA 1ESVA 5F1XA 4CZMA 1U2VB 3EKSA 2A5XA 3O4WA 1HKCA 3O1BA 4FWSA 2HBKA 3EKUA 1HKBA 5EOYA 4YOVA 1Q82O 4H03B 3C6AA 1GLLO 4M7YA 4C23A 4JKDA 2NRXA 3ZETB 1QHAA 1Q7YO 4WCEL 4A61A 4MLEA 1Q81O 3LM2A 3NVMA 1GLEG 2GWJA 3G25A 2ZWHA 1KAZA 4U7BA 2P9PA 4JK7A 4BREA 3J7ZO 4H5WA 2GEMA 1LCUA 1T6CA 1X3NA 3C7NB 3H6EA 5AQNA 3CC4N 1Q86O 1BO5O 3VEYA 2P9LB 4CZKA 4PHTX 2IVNA 3KK7A 1HPMA 3CHWA 3UKRA 4BRMA 5GADP 2Q2RA 3IFRA 4OPHA 1NGGA 4CZHA 4DHYA 3H1QA 3U4LA 5B8HA 1MWMA 4IOXA 5CE3A 3A5LC 1GLJO 1NBWA 1OVYA 4JKFA 3C0BA 1V4SA 3R9PA 3ENOA 3ZETA 3QBXA 4PL8A 1EO1A 4DKWA 1YITN 1E4FT 4BR0A 4GVEA 5MLCQ 2HMPA 4IDHA 1NGFA 1BDGA 4DQ8A 1VAZA 4OPAA 3UKUB 2E1ZA 3O5BA 3CJ1A 3O80A 3CIPA 3SBTA 5BRDA 3VGLA 3D7EO 2E1YA 2P9LA 3HTVA 2OTLN 3E66A 2PBDA 4NO7A 4BC5A 3F9MA 3E1YA 4IXCA 1IJJA 1ZBSA 4PKGA 1RDUA 3GOIA 3O9QA 3WEEA 2V52B 4BR5A 1VQPN 4JK8A 3O9RA 1ATSA 4XH5A 2NRWA 4BGBA 4WF9L 4B9QA 3GDQA 2NRRA 5ELZA 3DXKA 3O1WA 1YVNA 1GLAG 1BU6O 2QWOA 3CD6N 3CPWM 3KHYA 1S72N 4IEEA 3CCJN 2F7TA 2HBMA 4WQ5C 3DXMB 4BC4A 3VERA 1VQMN 3CQYA 4BVOA 3VESA 3LDPA 3CJBA 3H45C 2NRHA 1T44A 4B1WB 2PAVA 3Q7BA 3VTHA 2IVOA 2AP1A 4WQ4C 3RVCA 4CZJA 5H1SQ 3VTIA 3HOTA 1YJ9N 1ZC6A 4FWNA 3CJ9A 3CC7N 5AQZA 3IKMA 3RSEB 2D0OA 1YXQA 2WC9A 4IJNA 4JK9A 2P9IA 5GIOA 4AM7A 3WXMB 2HF3A 4C1NI 1SAZA 5JVHL 3QBWA 2VGMA 2ASMA 3TSPA 4JN4A 2NNWA 2QA4N 1S3XA 3A5NC 3VF2A 1TYQA 4JKAA 5E84A 2E2NA 2Q36A 4FWRA 2A6AA 5GIPA 1Q18A 4BRAA 3NMUA 3OW2M 4FL9A 3TTDA 4YDUC 3L4IA 4BRHA 5AQFA 3U9ZA 3PIOL 4I6MB 2ASPA 5EX5A 4A5AA 1VQNN 1VQ6N 2CH6A 2E20A 2H3GX 5EVZA 3RSEA 4FO0A 4A2BA 5DM6L 1QZ6A 4H0PA 1NGAA 1DT9A 1QQOA 3D2EA 4KBOA 4U67L 4BR2A 4YOYA 4JAXA 2EWSA 1R59O 4ILGB 5AZJA 5BPNA 4EIAA 2HF4A 3L4QA 3SJHA 2D0PA 4FPAA 3ULEB 4R79A 1GLDG 3SAFA 3G71N 3FZKA 1EQYA 1VQ4N 1KD1O 5M1FA 3A8YA 3O9UA 3R3LA 4H0VB 3VF4A 5BRHA 5HL7L 4BRQA 2P9UB 3AAPA 2P9SB 3O6WA 2RE2A 1QVGM 3D6RA 4JKCA 1JCGA 3FLCO 4A2AA 2J4RA 2P9KA 3QDKA 4M63C 5JLHA 5AQUA 1NGEA 2ASOA 3L6QA 3ZEUA 3CCVN 4H0XB 3SBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG3 A;  4BR4 A;  4NB4 A;  3VF6 A;  4PL7 A;  5ADX H;  3FZM A;  1RFQ A;  3FZF A;  1NGD A;  5AQV A;  3GL1 A;  4BRP A;  3I8B A;  3VPZ A;  1BOT O;  3FZH A;  2P9U A;  4RTF D;  2ZGZ A;  1U6Z A;  5FPN A;  3ID8 A;  3IDH A;  5BRF A;  3SMS A;  3DAW A;  3MN9 A;  2ZGY A;  4Y0W A;  3IUC A;  1QQN A;  5BRE A;  4JD2 B;  1ATR A;  4PKI A;  4EFH A;  1U2V A;  3CQX A;  5AZI B;  2CH5 A;  1C0G A;  5BPL A;  2A42 A;  5FPM A;  4GY2 B;  4XH4 A;  3O8M A;  5JIC A;  1BA0 A;  4FOE A;  1Z6R A;  2QWR A;  2V7Y A;  1JCE A;  4FWL A;  3HM8 A;  3FR0 A;  3VEO A;  4BRI A;  1ATN A;  1X3M A;  2E2P A;  1NGJ A;  3LDN A;  2HOE A;  3O08 A;  1HKG A;  3QFP A;  2QW9 A;  5EY4 A;  2QWP A;  4B1X B;  3VOV A;  3C7N A;  4A62 A;  2YI1 A;  5AQS A;  3SMP A;  3A0I X;  2YJF A;  4MO5 A;  4H5R A;  2Q0R A;  2FXU A;  3BP8 A;  5TKY A;  1J6Z A;  3ATV A;  2ITM A;  4ISF A;  1QQM A;  1SZ2 A;  3BEX A;  3ZX2 A;  5KQD A;  5AQH A;  3H3N O;  3VEZ A;  4BG9 A;  3J8A A;  4CZG A;  4EAH D;  4ISE A;  1XUP O;  1GLF O;  2NLX A;  2F9T A;  3JS6 A;  4BRC A;  2IIR A;  4IWV A;  1KXP A;  5AQI A;  4XH1 A;  1Z05 A;  5AQR A;  1KAY A;  3GBT A;  3WXJ A;  4BC2 A;  5LJV A;  2YHY A;  3CI5 A;  3UKU A;  3VEN A;  1BUP A;  3EN9 A;  4CJ7 A;  4H5V A;  1HX1 A;  1NGB A;  1NGC A;  5KPZ A;  4CZE A;  2GWK A;  3HI0 A;  1ZXO A;  3U9D A;  2QXL A;  3S41 A;  4CD3 A;  1KAX A;  1E4G T;  1V4T A;  3DJC A;  1NGI A;  3IMX A;  3VEV A;  5I9E B;  4MO4 A;  2W41 A;  5AQW A;  3WXK A;  4BQZ A;  5KPT A;  3DXM A;  3FFK B;  5AQQ A;  5F0X A;  2YHX A;  3B8A X;  1XQS C;  4IJA A;  3CJC A;  2CGL A;  1BA1 A;  5AFU H;  1H1V A;  3LDO A;  2FLO A;  4RCH A;  1D4X A;  2D1K A;  4BC3 A;  2WUS A;  3L0Q A;  3HSC A;  3SK3 A;  1T6D A;  1HUX A;  4BGA A;  1DKG D;  1C0F A;  2BUP A;  4BRL A;  3ZX3 A;  5BN8 A;  5LJW A;  5E26 A;  1K8K B;  3BUZ B;  3FZL A;  3A5M C;  3EZW A;  1NGH A;  3D2F B;  2E88 A;  5ADX A;  4I6M A;  4BRN A;  4FSV A;  3WUH A;  4B1V A;  3H1V X;  4BRD A;  5AQP A;  4FWO A;  2FSK A;  2CGK A;  3GE1 A;  1GLC G;  4AM6 A;  4BVP A;  4CBW A;  3HZ6 A;  3MMV A;  1YUW A;  4L3Q A;  2E2O A;  2Q97 A;  1CZA N;  4XEI A;  4F9O A;  1SQK A;  4HWI A;  2ZF5 O;  4FWQ A;  4EHT A;  3ULE A;  1TUY A;  4K25 A;  1NM1 A;  1IG8 A;  2P9P B;  3CJA A;  5AQO A;  4WQ5 A;  2CGJ A;  4BRG A;  2P9S A;  4K42 A;  3W3D A;  4IZ9 A;  3MDQ A;  3U8X A;  3UKR B;  4GNI A;  4WQ4 A;  1P8Z A;  3SLC A;  1NLV A;  2VCP A;  4PKH A;  3MCP A;  4B1Z A;  3WQT A;  1OKJ A;  5AQJ A;  4LC9 B;  5AQT A;  4IO8 A;  1DGK N;  4CZI A;  3EL2 A;  3FE1 A;  4CZF A;  5JLF A;  1MWK A;  2UYT A;  1MA9 B;  1X9J A;  2A40 A;  5BPM A;  2AA4 A;  2V7Z A;  2YHW A;  2I7P A;  3ATU A;  4YDU A;  3AAR A;  3M6G A;  3WEE B;  2VWB A;  1S22 A;  1RGI A;  2YJE A;  5BN9 A;  4JD2 A;  1NMD A;  3I33 A;  5AZI A;  3DXK B;  3UE5 A;  4CBX A;  4BR9 A;  5JMV A;  5AQY A;  3ENH A;  2GEL A;  3DWL A;  1DEJ A;  5BR9 A;  2F9W A;  3GG4 A;  2BTF A;  3CER A;  4FWP A;  3QB0 A;  5LY3 A;  4JNE A;  5FPE A;  3KZB A;  1WUA A;  4H0Y B;  5AQG A;  3VET A;  5AR0 A;  4FWM A;  3KVG A;  3LL3 A;  2P9I B;  4DCH A;  4JHD B;  4K43 A;  4BQL A;  3TU5 A;  4CI6 A;  3H3O B;  4FWK A;  2E8A A;  1RDW X;  3TPQ A;  3VEW A;  5AFU A;  1WOQ A;  4WYB A;  3M1F A;  2GUP A;  4BR7 A;  3HBT A;  3QFU A;  1TYQ B;  3LDL A;  2QWQ A;  4E1J A;  3BF3 A;  4BRF A;  3A5O C;  5KQ8 A;  1LOT B;  3FGU A;  2QWN A;  3WT0 A;  4FOI A;  2A3Z A;  3H46 O;  4BRK A;  2FSJ A;  4CZL A;  3R8E A;  3OHR A;  2NZT A;  3MN6 A;  3BF1 A;  5FPD A;  3VEX A;  3WXL A;  4B1U B;  3MN7 A;  1BWF O;  4JHD A;  4O8K A;  3D2E B;  4J8F A;  3WQU A;  3WXI A;  4EHU A;  4RWT A;  2QWL A;  4QS7 A;  2W40 A;  3UB5 A;  3VGK A;  2A41 A;  4B1Y B;  4CD1 A;  2FSN A;  5AZJ B;  1Y64 A;  1HJO A;  4M7X A;  3ZX0 A;  4BRO A;  2Q1N A;  2Q31 A;  1QZ5 A;  4H5T A;  3VGM A;  2VYP A;  3CJ7 A;  2QM1 A;  4MLH A;  2Q0U A;  4QS9 A;  3W0L A;  2GTD A;  2P9K B;  3EO3 A;  2P9N B;  2KHO A;  3MN5 A;  3R6M A;  4QS8 A;  4DB3 A;  3M3Z A;  1G99 A;  4CBU A;  1YAG A;  3ZEU B;  3LM9 A;  1HLU A;  4H0O A;  2D4W A;  5AQM A;  4O5F A;  3AAQ A;  2YCH A;  2FF6 A;  4H0T B;  2IVP A;  5AQX A;  3QIC A;  2E2Q A;  4K41 A;  1NWK A;  5KPR A;  4HTL A;  1GLB G;  3JXU A;  4H5N A;  2FF3 B;  5EXW A;  3AY9 A;  2OAN A;  1K8K A;  3MK6 A;  4FPB A;  4BG8 A;  5F2R A;  2DPN A;  3P4I A;  4Z94 A;  3QML A;  4ISG A;  3CET A;  3LDQ A;  1MDU B;  5AQK A;  3D2F A;  1XC3 A;  2QWM A;  2V51 B;  2P9N A;  1JCF A;  2I7N A;  5AQL A;  1TUU A;  1ESV A;  5F1X A;  4CZM A;  1U2V B;  3EKS A;  2A5X A;  3O4W A;  1HKC A;  3O1B A;  4FWS A;  3EKU A;  1HKB A;  5EOY A;  4H03 B;  1GLL O;  4M7Y A;  4C23 A;  3ZET B;  1QHA A;  4A61 A;  4MLE A;  3LM2 A;  1GLE G;  2GWJ A;  3G25 A;  2ZWH A;  1KAZ A;  2P9P A;  4BRE A;  4H5W A;  2GEM A;  1LCU A;  1T6C A;  1X3N A;  3C7N B;  3H6E A;  5AQN A;  1BO5 O;  3VEY A;  2P9L B;  4CZK A;  2IVN A;  1HPM A;  3CHW A;  3UKR A;  4BRM A;  2Q2R A;  3IFR A;  4DHY A;  1NGG A;  4CZH A;  3H1Q A;  3U4L A;  5B8H A;  1MWM A;  5CE3 A;  3A5L C;  1GLJ O;  1NBW A;  3C0B A;  1V4S A;  3R9P A;  3ENO A;  3ZET A;  3QBX A;  4PL8 A;  1E4F T;  4BR0 A;  2HMP A;  1NGF A;  1BDG A;  4DQ8 A;  3UKU B;  2E1Z A;  3O5B A;  3CJ1 A;  3O80 A;  3CIP A;  5BRD A;  3VGL A;  3D7E O;  2E1Y A;  2P9L A;  3HTV A;  2PBD A;  4NO7 A;  4BC5 A;  3F9M A;  4IXC A;  4PKG A;  1IJJ A;  1ZBS A;  3WEE A;  3GOI A;  4BR5 A;  2V52 B;  1ATS A;  4XH5 A;  4BGB A;  4B9Q A;  3GDQ A;  5ELZ A;  3DXK A;  3O1W A;  1YVN A;  1GLA G;  1BU6 O;  2QWO A;  3KHY A;  4WQ5 C;  3DXM B;  4BC4 A;  3VER A;  3CQY A;  4BVO A;  3VES A;  3LDP A;  3CJB A;  3H45 C;  2NRH A;  1T44 A;  4B1W B;  2PAV A;  2IVO A;  2AP1 A;  4WQ4 C;  4CZJ A;  1ZC6 A;  4FWN A;  3CJ9 A;  5AQZ A;  3RSE B;  2D0O A;  1YXQ A;  4IJN A;  2P9I A;  4AM7 A;  2HF3 A;  1SAZ A;  3QBW A;  2ASM A;  4JN4 A;  1S3X A;  3A5N C;  3VF2 A;  1TYQ A;  5E84 A;  2E2N A;  2Q36 A;  4FWR A;  2A6A A;  1Q18 A;  4BRA A;  4FL9 A;  4YDU C;  3L4I A;  4BRH A;  5AQF A;  3U9Z A;  4I6M B;  2ASP A;  5EX5 A;  2CH6 A;  2E20 A;  2H3G X;  5EVZ A;  3RSE A;  4FO0 A;  4A2B A;  1QZ6 A;  4H0P A;  1NGA A;  1QQO A;  3D2E A;  4KBO A;  4BR2 A;  4JAX A;  2EWS A;  1R59 O;  5AZJ A;  5BPN A;  4EIA A;  2HF4 A;  3SJH A;  2D0P A;  4FPA A;  3ULE B;  1GLD G;  3FZK A;  1EQY A;  3A8Y A;  3VF4 A;  5BRH A;  4H0V B;  4BRQ A;  2P9U B;  3AAP A;  2P9S B;  3O6W A;  1JCG A;  3FLC O;  4A2A A;  2J4R A;  2P9K A;  3QDK A;  4M63 C;  5JLH A;  5AQU A;  1NGE A;  2ASO A;  3L6Q A;  3ZEU A;  4H0X B; 
#chains in the Genus database with same CATH topology
 3J7A P;  3BZC A;  4NB4 A;  4DTM A;  5J2P A;  3VQP A;  3FZM A;  1VK0 A;  5HP1 A;  1T05 A;  3GL1 A;  3V6D A;  4NLC A;  4IFY A;  2R7Y A;  2HVH A;  2VQF K;  3MWP A;  5FPN A;  4AF1 A;  5BRF A;  4E7J A;  3SMS A;  3DAW A;  2ZGY A;  2YX6 A;  1ATR A;  1A5V A;  3CQX A;  3JYT A;  1C0G A;  4M3X A;  3KIO A;  3O8M A;  5JIC A;  1EXQ A;  1RBV A;  4DF8 A;  3FR0 A;  1ATN A;  3LDN A;  1NMN A;  2PYL A;  4B1X B;  2QWP A;  4FLT A;  5FLX O;  5CR4 A;  4CGF A;  3NF6 A;  2YJF A;  2OZS A;  4OKE A;  2KW4 A;  4HUG A;  3BP8 A;  4DUZ K;  1J6Z A;  3QLH A;  2ITM A;  4ISF A;  1VQ7 N;  1SZ2 A;  2ITG A;  4N47 A;  3BEX A;  4O44 A;  4CJU A;  1S1U A;  4CZG A;  4EAH D;  1OH5 A;  1NJY A;  1D9D A;  4DU4 A;  4ZTJ A;  4PY5 A;  3M8R A;  5HOO A;  2G8V A;  3LZJ A;  3P83 D;  2F8T A;  3F2K A;  4H5V A;  3P31 A;  1DLO A;  5AJ3 K;  1SL1 A;  1NGC A;  3OY9 A;  4AHU A;  3HI0 A;  3U9D A;  2YKN A;  3LAM A;  3OYA A;  1TL3 A;  1SUQ A;  1V4T A;  3RMB A;  5GAG P;  3C65 A;  3LP2 A;  4IOA L;  3THX B;  4B9T A;  5AQQ A;  5F0X A;  1BGX T;  4GV9 A;  4FK0 A;  3B8A X;  3SQ1 A;  3KWI A;  1WSG A;  3VQ8 A;  1XQS C;  1C1C A;  3DRR A;  5AFU H;  4W5R A;  1H1V A;  3CME N;  3K5M A;  1D4X A;  3THY B;  1A5W A;  2Z1I A;  3AO5 A;  3SK3 A;  1SL0 A;  4C8K A;  4BGA A;  4Q0B A;  4W5N A;  3M8S A;  5E26 A;  4OX9 K;  3HVT A;  3D2F B;  3OBW A;  4FJL A;  1NK5 A;  2Z1J A;  4FSV A;  4E1M A;  3H1V X;  2B5J A;  4BRD A;  4FW2 A;  4FWO A;  4JKG B;  1IKX A;  3CYM A;  4AM6 A;  5SZT A;  3MMV A;  5M1Q A;  4F2R A;  4FVU A;  1SQK A;  4WFN L;  2ZF5 O;  2E6M A;  4M3W A;  4FM0 A;  1HJR A;  4O8U A;  2P9P B;  1BI4 A;  5AQO A;  3QER A;  4K0K K;  1ITG A;  4CGD A;  2CGJ A;  1X9S A;  4IZ9 A;  3V1O A;  4WQ4 A;  3ENB A;  2O8F B;  4LF7 K;  1XWL A;  3Q7C A;  4IEI A;  1RDD A;  2BH1 A;  1IH7 A;  5AQT A;  4KH5 A;  1L3S A;  5J2Q A;  4JI7 K;  3T1H K;  4IOC L;  5LMN K;  4KRF A;  1O1W A;  4NCA A;  4AHV A;  3SYZ A;  4E19 A;  2ZJR L;  1S1X A;  2GV9 A;  1RGI A;  4HUE A;  4KHN A;  4K8X A;  1KFS A;  3PSF A;  1NMD A;  4CJQ A;  2YV0 X;  5AZI A;  3RRG A;  3V1Q A;  2GEL A;  5KGW A;  4RG8 A;  3T69 A;  5C42 A;  1QVF M;  2F9W A;  3CF5 L;  3CER A;  5C10 A;  3LAN A;  3M8P A;  4DTP A;  1VQL N;  4WFB L;  5FPE A;  1N34 K;  5AQG A;  4NCB A;  2FBY A;  3LL3 A;  3ZLJ A;  2P9I B;  5C2F A;  4K43 A;  4B9V A;  1M90 O;  4KB1 A;  2HVI A;  3OYE A;  3HYF A;  1RDW X;  1WSJ A;  5AFU A;  3HBT A;  2WFB A;  2QWQ A;  3LDL A;  4KV8 A;  3O4N A;  1GOB A;  3J80 O;  4BE0 A;  1HR0 K;  3MXJ A;  5KI6 A;  1VRT A;  2ZJQ L;  4ZTF A;  3FGU A;  3ZSZ A;  4A59 A;  3MXM A;  2A3Z A;  4BRK A;  3R8E A;  3BF1 A;  3VEX A;  3D45 A;  3ZT1 A;  4JHD A;  4O8K A;  3WQU A;  3WXI A;  4EHU A;  4J8F A;  2G8F A;  4JI8 K;  3VGK A;  4QS7 A;  1WNS A;  3UB5 A;  4B1Y B;  2FSN A;  2RHK A;  3AVN A;  4FLU A;  4YOR A;  3CM6 A;  2Q1N A;  2GBZ A;  3RR8 A;  1XHX A;  4I2Q A;  4DTO A;  3SUP A;  5EU7 A;  3VGM A;  4JI0 K;  3VQ5 A;  2HW3 A;  4CED A;  3CCS N;  1QSL A;  1QSY A;  1HMV A;  2XRI A;  4LF9 K;  4DTR A;  2P9K B;  2P9N B;  3R6M A;  4IO9 L;  1G99 A;  1VSM A;  3HM9 A;  1KC8 O;  4H0O A;  3HVR A;  2D4W A;  5AQM A;  3AAQ A;  2YCH A;  2IVP A;  4YOX A;  3QIC A;  1NWK A;  4HTL A;  1UOC A;  3HP6 A;  4I2P A;  4M3U A;  3MK6 A;  4FPB A;  4BG8 A;  3PLA A;  4B3S K;  3P4I A;  4Z94 A;  3QML A;  4PWD A;  4CF9 A;  2UUA K;  3LDQ A;  2O4I A;  1J53 A;  4Y1C A;  1NK8 A;  2NRV A;  5K14 A;  2G8H A;  1TUU A;  3BY5 A;  4CZM A;  2A5X A;  2D0B A;  3NH1 A;  1EWR A;  1HKB A;  3OYI A;  3LWL A;  1DTT A;  3ZT3 A;  2LSN A;  4H03 B;  2NUB A;  5HRR A;  4CF2 A;  4DSE A;  4A61 A;  1Q81 O;  4CJV A;  4CJK A;  1GLE G;  1IBL K;  3KK2 A;  1KAZ A;  2YNF A;  3CFO A;  4JK7 A;  1HNI A;  4DQI A;  1BQM A;  3CC4 N;  2GEM A;  1LCU A;  2DY4 A;  1X3N A;  1RBU A;  4CZK A;  4LFC K;  4PHT X;  2HHH K;  1TKX A;  1HPM A;  5GAD P;  2YNH A;  4F4K A;  4DHY A;  2XHB A;  4E3S A;  3H1Q A;  1NJW A;  4CK2 A;  2Y1I A;  1V4S A;  3QBX A;  4PL8 A;  1JLE A;  3VQD A;  1QHT A;  4DQ8 A;  3BDP A;  2E1Z A;  3CJ1 A;  4KTQ A;  3AO1 A;  3HPO A;  2E1Y A;  3HTV A;  2PBD A;  4NO7 A;  4CER A;  3WEE A;  3F9M A;  3E1Y A;  1RDU A;  3O9Q A;  2V52 B;  1ASW A;  1VQP N;  4JK8 A;  3UIQ A;  1XNR K;  4AQY K;  1ATS A;  3VQE A;  3NGY A;  3NAE A;  3LAL A;  3CCJ N;  4DMN A;  3AO4 A;  4IG3 A;  4DV0 K;  2IDO A;  3CJB A;  3PY8 A;  1NK7 A;  4B1W B;  1KTQ A;  1XI1 A;  1KLN A;  2IVO A;  2JLE A;  3RVC A;  1YJ9 N;  4FWN A;  3KK3 A;  3IKM A;  3RSE B;  2UU9 K;  4FJ9 A;  4QAG A;  3NHG A;  2FBV A;  5GIO A;  4ELT A;  3WXM B;  3QBW A;  2ASM A;  3TSP A;  4JN4 A;  1TK8 A;  3VF2 A;  3TAF A;  4Z4F A;  4JKA A;  5GIP A;  3OYK A;  4Z4G A;  3NMU A;  3NFA A;  1HYV A;  4N41 A;  2BE2 A;  2WON A;  1BHL A;  1VQ6 N;  5EVZ A;  1QZ6 A;  3AVG A;  1SL2 A;  1C1A A;  4BR2 A;  5HRP A;  4JAX A;  2EWS A;  1JXE A;  1R59 O;  4ILG B;  5AZJ A;  4DQS A;  3OYM A;  3EYZ A;  2VWK A;  5JS1 A;  3L4Q A;  4R79 A;  4FPA A;  3FZK A;  4CEO A;  3A8Y A;  3O9U A;  3R3L A;  3WNF A;  5BRH A;  5M1F A;  1BI4 B;  2X78 A;  3LP0 A;  3AAP A;  3HP9 A;  4FZZ A;  1QVG M;  1Q9X A;  4A2A A;  1FKO A;  4NYF A;  5T7B A;  4M63 C;  5JLH A;  4CIG A;  4FJ7 A;  3CCV N;  3IRX A;  2E6L A;  1BG3 A;  1RDC A;  5ADX H;  3ZSQ A;  2HHS A;  3DOK A;  3OYC A;  5CY4 A;  3I8B A;  4ZHR A;  2Z1H A;  2P9U A;  2RF2 A;  1HRH A;  1U6Z A;  1WSI A;  2HHQ A;  4YOU A;  1IKY A;  3NH2 A;  3IDH A;  2P1J A;  3ZT0 A;  3MN9 A;  1W2B M;  1UA1 A;  1K9M O;  1ASV A;  4JKB A;  4O55 A;  1YJN N;  5AZI B;  3DLB A;  3K5O A;  2A42 A;  1CXU A;  3H08 A;  5FPM A;  3DLG A;  1Z6R A;  3VQA A;  2QWR A;  1I39 A;  2ZE2 A;  4FWL A;  4FZX C;  1WAJ A;  2E2P A;  4UQG A;  3CCQ N;  1KCF A;  1UA0 A;  4DSL A;  2HOE A;  2OTJ N;  4FLY A;  2QI2 A;  2OPS A;  4FJH A;  4PQU A;  3MCA B;  3SPY A;  3OTO K;  2YI1 A;  3E01 A;  5AQS A;  3ZSX A;  3M5R A;  4GV6 A;  1D5A A;  4ID1 A;  4M3Z A;  3NVK A;  4RW7 A;  3ZX2 A;  3AVA A;  5KQD A;  4F2S A;  3VEZ A;  4ISE A;  4BE1 A;  2F9T A;  3QEV A;  2IIR A;  4IWV A;  1KXP A;  1Z05 A;  3N4Q A;  3ASM A;  5AQR A;  3WXJ A;  2DFH A;  3TTC A;  2YHY A;  2X74 A;  3VEN A;  1VQO N;  1KFD A;  1BUP A;  4OLA A;  2D5R A;  3DM2 A;  3EN9 A;  3S9H A;  5KPZ A;  1ZXO A;  2AJQ A;  5JVG L;  3T1A A;  1KAX A;  1NGI A;  3LAK A;  5KPT A;  4BQZ A;  3DXM A;  4B9S A;  3SV4 A;  3EEQ A;  3LDO A;  4RCH A;  3QNO A;  1FK9 A;  3RMD A;  4DR5 K;  3K9J A;  3HSC A;  3M8Q A;  1IKW A;  1B92 A;  1HNX K;  4DQQ A;  1DKG D;  2VG5 A;  4CGJ A;  5J2M A;  2XY6 A;  1C0F A;  4BRL A;  1Z26 A;  2Y1J A;  4KH6 A;  3TAM A;  4C8M A;  4LFB K;  3EZW A;  2PY5 A;  1K73 O;  2O8E A;  2E88 A;  5ADX A;  3AGR A;  4I6M A;  1TGO A;  1WSH A;  3NE6 A;  2FSK A;  2CGK A;  1B9F A;  4YY3 K;  1T8E A;  3GE1 A;  4O0J A;  4CBW A;  4BVP A;  4DFK A;  1SKR A;  3CQ8 A;  3AA4 A;  4IFV A;  2Q97 A;  3RMA A;  1YI2 N;  4F9O A;  2JWL A;  1JXB A;  5TKW A;  3TAP A;  2G8W A;  1UAX A;  1IG8 A;  5SWM A;  1BIU A;  1GOA A;  1VQ9 N;  2GX9 A;  1VSE A;  5M1N A;  4DWI A;  4GNI A;  3K0S A;  4ELU A;  3L2U A;  2XY7 A;  3SLC A;  2VCP A;  2QEX N;  3I0R A;  4PKH A;  4DR2 K;  4B1Z A;  3DLL L;  2KQ2 A;  1OKJ A;  5AQJ A;  2WTU A;  4IO8 A;  1L3V A;  4B9U A;  1MWK A;  4C8N A;  3T19 A;  4CEA A;  4A57 A;  3U3G A;  1X9J A;  1GOC A;  1NKC A;  3PO4 A;  4FM1 A;  3M6G A;  3WEE B;  5C0Y A;  3V81 A;  1CZB A;  3I55 N;  4JD2 A;  3IS9 A;  1TKD A;  4F3O A;  4OGE A;  1F21 A;  4BR9 A;  4H4O A;  2QKB A;  5BR9 A;  4WFA L;  3L2W A;  2BTF A;  4FWP A;  3QB0 A;  3AA2 A;  1T7P A;  1CXQ A;  4HVJ A;  1WLJ A;  1WUA A;  3F5T A;  4EZ6 A;  1RT1 A;  1HQU A;  1K8A O;  3L2R A;  3CFP A;  4UY8 O;  3TU5 A;  3H3O B;  2G8U A;  3TPQ A;  3VEW A;  3HXM A;  4AHR A;  4GMJ B;  1ASU A;  2GUP A;  4F3T A;  3QFU A;  3CCM N;  5DM7 L;  5FDL A;  3BF3 A;  2HBJ A;  3C6H A;  2QWN A;  4CJ4 A;  4MDA A;  1NJI O;  2NZT A;  1BL3 A;  3MN6 A;  5FPD A;  4B1U B;  3MXI A;  4X65 K;  3MN7 A;  3TWH A;  4CJP A;  2D0C A;  3VA0 A;  5AZJ B;  1Y64 A;  5CZ2 A;  1HJO A;  3OBY A;  4M7X A;  2O8D B;  4BRO A;  1OH6 A;  1NOY A;  3NBP A;  4O0I A;  1VSI A;  4B3R K;  2VYP A;  2QTD A;  4MLH A;  4BDY A;  3EO3 A;  3MN5 A;  4QS8 A;  3K5N A;  3M3Z A;  3HK2 A;  1RDA A;  4CBU A;  4IKF A;  1YAG A;  3HL8 A;  3O9T A;  3V9W A;  1HLU A;  4C1N K;  2EX3 A;  4DFJ A;  2FF6 A;  3HST B;  5AQX A;  2E2Q A;  3TSQ A;  3F9K A;  3OYH A;  1GLB G;  4H5N A;  3O3F A;  3E9L A;  1VHX A;  2OAN A;  1K8K A;  4FLZ A;  1LAV A;  1HQE A;  3CCU N;  1MDU B;  3DRS A;  5AQK A;  4NLB A;  4LH4 A;  2QWM A;  1Q8I A;  4DSI A;  2KLA A;  1HNV A;  1JCF A;  2I7N A;  3KWG A;  1XC9 A;  2VQE K;  2DFF A;  3PO5 A;  4NCG A;  1JLF A;  3EKS A;  3O1B A;  1KVA A;  4E7I A;  4JI4 K;  3EKU A;  5EOY A;  4YOV A;  1W0H A;  3C6A A;  2KZZ A;  4C23 A;  4IDK A;  1Q7Y O;  4CJE A;  2HHX A;  3NVM A;  3NGZ A;  3G25 A;  1NOZ A;  2ZWH A;  1VSF A;  1WSE A;  4U7B A;  3V9U A;  2YHA A;  3OS0 A;  1L5U A;  3PUF A;  1HNZ K;  1I3A A;  1BO5 O;  4CJ3 A;  3OYN A;  4C8L A;  2IVN A;  3KK7 A;  4E89 A;  3SNN A;  3CHW A;  3UKR A;  3O4Q A;  4Z4C A;  4CJT A;  4FLV A;  1MWM A;  5CE3 A;  1S6P A;  1OVY A;  1NBW A;  3C0B A;  3ZET A;  1EO1 A;  4DKW A;  5CYM A;  4DTJ A;  3AA5 X;  4BR0 A;  4DTU A;  4GVE A;  1LV5 A;  5MLC Q;  1NGF A;  1VSL A;  1BDG A;  1TK0 A;  1VAZ A;  4OPA A;  1TAU A;  3VGL A;  4J2E A;  4DSF A;  2OTL N;  2P9L A;  4KAZ A;  1XNQ K;  3GOI A;  4KTW A;  2F96 A;  3NF7 A;  3D0P A;  1I94 K;  1QTM A;  3VN5 A;  4Z0U A;  4BGB A;  2IOC A;  3GDQ A;  4B9Q A;  3PX4 A;  3OJU A;  3THW A;  4DF4 A;  1XHZ A;  5HRS A;  3ALY A;  3ZSW A;  3CD6 N;  3SZ2 A;  4JYA K;  4E7H A;  3KHY A;  1S72 N;  4IEE A;  4CHQ A;  3DXM B;  1WB9 A;  3QO9 A;  3VES A;  3A2F A;  4RW8 A;  3OYB A;  4PUO A;  1JL1 A;  3KJV A;  4CZJ A;  1ZBF A;  3VTI A;  3KD5 E;  3CJ9 A;  1VSK A;  5AQZ A;  3CC7 N;  4IJN A;  4JK9 A;  2YHB A;  2HF3 A;  4C1N I;  3RTV A;  4AHS A;  1C6V A;  4CEF A;  2QA4 N;  1S3X A;  3A5N C;  5LL6 Z;  4GKJ K;  1TYQ A;  1X9M A;  4EZ9 A;  2Q36 A;  1S5J A;  4O5B A;  3OW2 M;  1OH8 A;  4YDU C;  4J2B A;  4LY7 A;  1WSF A;  4JLH A;  2O8E B;  4CIE A;  4LFA K;  4I6M B;  5EX5 A;  4CHZ A;  2E20 A;  2H3G X;  4FO0 A;  1TV6 A;  4H0P A;  1DT9 A;  3D2E A;  4JS5 A;  4U67 L;  4YOY A;  1TVR A;  5BPN A;  4FLX A;  3QNN A;  3SAF A;  3G71 N;  1NK0 A;  3K5L A;  3VF4 A;  5HL7 L;  4H0V B;  1N33 K;  3OYG A;  2BDP A;  4FJN A;  2OCE A;  4DFM A;  3VQ4 A;  1JCG A;  2J4R A;  3VQB A;  3LDS A;  3LP3 A;  3U3Y A;  3ZEU A;  1Y97 A;  3SBG A;  3MEE A;  3SPZ A;  4BR4 A;  3VF6 A;  3CPE A;  3SQ0 A;  2G8K A;  3CXC M;  1U48 A;  1RFQ A;  3FZF A;  2HHU A;  4AHC A;  3CMA N;  1NGD A;  5AQV A;  4KKO A;  3P5J A;  3SJJ A;  5I3U A;  4BRP A;  1LWF A;  1YTA A;  1EET A;  3PX6 A;  2HHV A;  3DOL A;  3FZH A;  1M1K O;  2ZGZ A;  5KTQ A;  1ZBI A;  3DLR A;  4AIL C;  3HO1 A;  3IUC A;  1QQN A;  5BRE A;  4FM2 A;  2GUI A;  4JD2 B;  4PKI A;  4B8A B;  4AHT A;  4EFH A;  1U2V A;  5HRN A;  2CH5 A;  3AVJ A;  4XH4 A;  3HOS A;  1JCE A;  4RW9 A;  4C8O A;  2Z1G A;  3VEO A;  3IAY A;  3WNE A;  1X3M A;  1NGJ A;  4DS4 A;  1RT3 A;  1HKG A;  1RDB A;  5EY4 A;  3TAE A;  4YOW A;  2P5O A;  4FJK A;  1C0M A;  2ZM6 K;  3C7N A;  1WBB A;  4A62 A;  5CHI A;  1E3M A;  4MO5 A;  4H5R A;  2FXU A;  5TKY A;  1QQM A;  5E41 A;  3OA9 A;  5C24 A;  4BG9 A;  3J8A A;  1HYZ A;  4MDB A;  4N56 A;  4CW7 B;  4DTN A;  1K6Y A;  1YF5 L;  2NLX A;  2F8S A;  3AVK A;  4BRC A;  4JRP A;  2HBL A;  5AQI A;  1J5E K;  4XH1 A;  3VMF B;  1KAY A;  4BC2 A;  4DR3 K;  2UXD K;  4DV6 K;  3AVB A;  3V1R A;  1C0T A;  4DQP A;  2KZM A;  4E1N A;  4R5P A;  1FXX A;  1HX1 A;  1LW0 A;  4CZE A;  2QXL A;  1L3U A;  1U45 A;  5DK5 A;  1QS4 A;  3IMX A;  4MO4 A;  3DLK A;  4B3M K;  4X66 K;  1U04 A;  1N6Q A;  1YT3 A;  5D3G A;  3CJC A;  4V19 S;  1BA1 A;  3K9K A;  4KTZ A;  4DV1 K;  4CJS A;  1IBM K;  2WOM A;  2FLO A;  3ZYY X;  5KGX A;  4M3R A;  4CCH A;  3L0Q A;  4FCY A;  3HPH A;  3SUQ A;  3NH0 A;  4DR1 K;  4CFB A;  4ILJ A;  5BN8 A;  5LJW A;  4KHP K;  2O8B A;  2D0A A;  3RWU A;  1K8K B;  4IFE A;  4ILH A;  2WBN A;  3SUN A;  4OO1 J;  1IO2 A;  3FZL A;  1TK5 A;  2PFU A;  4DU3 A;  1NGH A;  4QCL A;  4OJR A;  3SAG A;  5GAH P;  4OPJ A;  4BRN A;  3WUH A;  3OYL A;  5AQP A;  3THY A;  1S1T A;  1A5X A;  3KLH A;  3TAG A;  3L8B A;  3EE8 A;  1J54 A;  1RT6 A;  1YUW A;  1RNH A;  2E2O A;  3LPT A;  3OS2 A;  4B08 A;  3G6E N;  1CZA N;  2ATQ A;  3L3U A;  3MEC A;  4ICL A;  4CES A;  4HWI A;  3F73 A;  1ZBL A;  1U4B A;  1G15 A;  2ZQB A;  4EHT A;  4K25 A;  2BGG A;  4B9L A;  1RTJ A;  4CF1 A;  1NM1 A;  3N4P A;  4JI6 K;  4M42 A;  3CJA A;  4KHS A;  1YTU A;  2P9S A;  1EKE A;  3MDQ A;  4CEE A;  3UKR B;  4JKG A;  3LZI A;  2DFE A;  1P8Z A;  1RT5 A;  2IGI A;  1NLV A;  3MCP A;  3EE9 A;  4OGC A;  2OYQ A;  3R1X A;  4NXM K;  4LC9 B;  1DGK N;  5JLF A;  4I9L A;  3G4S N;  3SQ2 A;  1OVQ A;  2AA4 A;  2I7P A;  5BR8 K;  3O3G A;  3ATU A;  4YDU A;  2VWB A;  3NGI A;  2B4J A;  4CJF A;  5BN9 A;  1NK9 A;  5GAE P;  4IBN A;  4CGI A;  3I33 A;  3THW B;  3OYJ A;  1IV0 A;  3UE5 A;  4CBX A;  5JMV A;  1JKH A;  4KI6 A;  5AQY A;  4GW6 A;  3DWL A;  1C0U A;  1REV A;  3GG4 A;  4I7F A;  1S9G A;  2ZD1 A;  1NG9 A;  4CFC A;  3QIN A;  3K57 A;  5DMR A;  3CCE N;  2VG7 A;  4JHD B;  2KTQ A;  1TKZ A;  3MX5 A;  4BQL A;  1QSS A;  5GIN A;  4BDZ A;  4KB0 A;  3AO3 A;  4FWK A;  2PZS A;  4CHP A;  2IC3 A;  1WOQ A;  4WYB A;  3PSI A;  3NF8 A;  4BR7 A;  1S6Q A;  1TYQ B;  4FJ5 A;  4CJL A;  3U6F A;  4FJX A;  4FJ8 A;  4E1J A;  4FXD A;  1QQC A;  2HNY A;  4PA1 A;  4BRF A;  3A5O C;  4OKK A;  5KQ8 A;  3EY1 A;  3K2P A;  3H46 O;  1X1P A;  2FSJ A;  4B3T K;  3TSU A;  4CZL A;  2O8C A;  3WXL A;  3D2E B;  3EZ5 A;  3HPG A;  4RWT A;  2QWL A;  2W40 A;  1NU0 A;  2A41 A;  4CD1 A;  5LMU K;  1NNE A;  3ZX0 A;  4CFD A;  3KKS A;  3VQ7 A;  1BQN A;  3C94 A;  3HRG A;  3T7Z A;  2PYJ A;  2Q31 A;  1QZ5 A;  3E9P A;  4FYD A;  2RPI A;  4CK1 A;  2NRT A;  3ZT2 A;  2QM1 A;  1J9A A;  4QS9 A;  3W0L A;  5FRN A;  3ZSR A;  5IT9 O;  4CK3 A;  2FBX A;  3MX2 A;  3ZEU B;  3LM9 A;  2RN2 A;  2IS3 A;  1S1W A;  3RMC A;  4O5F A;  4AH9 A;  4H0T B;  1BIZ A;  4K41 A;  2KFN A;  4ELV A;  2F4V K;  2FF3 B;  1WN7 A;  3C95 A;  1YVU A;  2FBT A;  3CET A;  1SKS A;  1KVC A;  3ZSO A;  1JLA A;  3T1Y K;  2RKI A;  2V51 B;  1Q9Y A;  2P9N A;  1RIL A;  5AQL A;  2I5J A;  2KKZ A;  3CC2 N;  3VQ9 A;  1U2V B;  3SQ4 A;  3O4W A;  2QXF A;  1HPZ A;  4CEQ A;  3SCX A;  3QEP A;  4FWS A;  4CJR A;  2B6A A;  1N5Y A;  4JKD A;  2NRX A;  1QHA A;  4M3Y A;  4MLE A;  3LM2 A;  4KHU A;  3WNG A;  1ZYQ A;  2Q3S A;  4Y1D A;  4BRE A;  3J7Z O;  4H5W A;  1T6C A;  3C7N B;  1Q86 O;  3PX0 A;  3VEY A;  4J2A A;  4BE2 A;  4LD0 A;  4BRM A;  4E0D A;  2Q2R A;  3IFR A;  4W5T A;  2EHG A;  5KRT A;  5B8H A;  1W9H A;  4IOX A;  3R9P A;  1Z25 A;  3ENO A;  1XMQ K;  4DTX A;  3PV8 A;  4M41 A;  4IDH A;  2G8I A;  4DLE A;  1LW2 A;  4CEB A;  4GKK K;  1EP4 A;  4KHQ A;  3AO2 A;  3HT3 A;  3L2Q A;  4DTS A;  3O80 A;  3CIP A;  5BRD A;  3IG1 A;  3D7E O;  3QET A;  1JLQ A;  3VQC A;  4IXC A;  4PKG A;  4O4G A;  2NRW A;  2HMI A;  5ELZ A;  3DXK A;  3O1W A;  1YVN A;  2QWO A;  5HRO A;  3CPW M;  4CF0 A;  3OS1 A;  2F7T A;  4WQ5 C;  4CEZ A;  3VQQ A;  4BC4 A;  1VQM N;  2YNG A;  3V9S A;  3LDP A;  3H45 C;  1T44 A;  4NXN K;  2PAV A;  3Q7B A;  5H1S Q;  4DR4 K;  1RTD A;  3HOT A;  2UXC K;  2D0O A;  5CYQ A;  1YXQ A;  2WC9 A;  4XIU A;  4AM7 A;  4CFA A;  4FLW A;  4DV5 K;  3SI6 A;  1SAZ A;  5JVH L;  3CFR A;  2VGM A;  3NF9 A;  4MQ3 A;  5I42 A;  4FK2 A;  1FJG K;  3OJS A;  4OLB A;  1D9F A;  2O8B B;  1XMO K;  2OPQ A;  4FL9 A;  3TTD A;  1DTQ A;  3L4I A;  3U9Z A;  3PIO L;  4CIF A;  1NK6 A;  5HBM A;  4IG0 A;  4EP4 A;  2CH6 A;  3DI6 A;  3RSE A;  5DM6 L;  4DU1 A;  3QEX A;  3NDK A;  4LF4 K;  1NJX A;  4FK4 A;  2ETJ A;  2HF4 A;  3C6T A;  4KO0 A;  1EQY A;  3DRP A;  1KD1 O;  2P9U B;  4FJI A;  2P9S B;  3TAB A;  3D6R A;  3SUO A;  4KI4 A;  1RTH A;  3FLC O;  5AQU A;  1NGE A;  3L6Q A;  4H4M A;  1RT4 A;  4PL7 A;  4CJW A;  3FFI A;  4MFB A;  1TL1 A;  3KD1 E;  4DG1 A;  2OPR A;  4LSL A;  1YHQ N;  4JEP A;  3VPZ A;  1BOT O;  4RTF D;  3J81 O;  5IWA K;  1J5O A;  3ID8 A;  1JJ2 M;  2VWJ A;  4Y0W A;  2HB5 A;  3QEI A;  5M1O A;  5BPL A;  1U49 A;  3S3N A;  1VQ5 N;  2OPP A;  4GY2 B;  4DV3 K;  1BA0 A;  4FOE A;  3KTQ A;  3V9X A;  2JGU A;  2V7Y A;  5KRS A;  3AGK A;  5M1K A;  3HM8 A;  1U47 A;  1RTI A;  4BRI A;  3PIP L;  1SV5 A;  3AVL A;  3O08 A;  3QFP A;  2QW9 A;  3CCR N;  4DSJ A;  3VOV A;  2HHT A;  4DQR A;  3SMP A;  3A0I X;  3J7Y P;  2Q0R A;  1W97 L;  1YIJ N;  3ATV A;  3LP1 A;  1JLC A;  5AQH A;  3H3N O;  2YNI A;  4DR6 K;  2E5L K;  1LWC A;  1XUP O;  1GLF O;  3JS6 A;  2DTU A;  1VSD A;  2X6S A;  4YFU A;  2A1R A;  3GBT A;  3E9O A;  5LJV A;  5C2D A;  3CI5 A;  3UKU A;  1BCO A;  1EX4 A;  3V9Z A;  4CHO A;  4F8R A;  3L3V A;  4DUY K;  4HUF A;  4CJ7 A;  2O8C B;  2OA8 A;  4I9Q A;  2VGN A;  1NGB A;  4J2D A;  4FVM A;  1R0A A;  2GWK A;  3O9S A;  1T3V A;  3S41 A;  4CD3 A;  1E4G T;  3DJC A;  1RBS A;  3VEV A;  5I9E B;  4CE9 A;  2W41 A;  5AQW A;  3WXK A;  4DV4 K;  1NJZ A;  3FFK B;  2YHX A;  4DV7 K;  1BIS A;  2W42 A;  1SS6 A;  4IJA A;  2CGL A;  2VG6 A;  1CZ9 A;  4YHH K;  2D1K A;  4LF6 K;  4KHW A;  4BC3 A;  2WUS A;  1T6D A;  1HUX A;  1N32 K;  4WE1 A;  4A5B A;  1B9D A;  1TKT A;  4CEC A;  2BUP A;  3ZX3 A;  1O13 A;  1ILY A;  3BUZ B;  3L2V A;  2IAJ A;  1KRP A;  3A5M C;  4Z4H A;  3RRH A;  1JL2 A;  4B1V A;  4B9M A;  3MWT A;  4L8R B;  1WBD A;  4H8K A;  4JV5 K;  3LWM A;  3I8D A;  1GLC G;  3ISN C;  3HZ6 A;  4DSK A;  4DV2 K;  4L3Q A;  4KRE A;  5C15 A;  4XEI A;  2O4G A;  5HLF A;  4FWQ A;  3ULE A;  1TUY A;  3SAH A;  3TR8 A;  1VQK N;  4WQ5 A;  4BRG A;  3ID6 A;  3OYD A;  1NKB A;  4K42 A;  5M1P A;  3W3D A;  3P39 A;  3KLG A;  3U8X A;  4BWM A;  1N8R O;  2UUB K;  3THV A;  5FRO A;  4X64 K;  4FJG A;  3P1G A;  5C12 A;  4W5Q A;  2ZJP L;  3ZSV A;  3G0Z A;  1IG9 A;  4CGH A;  3WQT A;  1MU2 A;  4BAC A;  4CZI A;  4G9Z A;  3I56 N;  3B6P A;  4HCB A;  3EL2 A;  2XO7 A;  3FE1 A;  4CZF A;  2UYT A;  4W5O A;  3TAQ A;  1MA9 B;  1SKW A;  3QEW A;  2A40 A;  5BPM A;  2V7Z A;  4Z4I A;  4JI1 K;  2YHW A;  5J1E A;  3LPU A;  3AAR A;  1S22 A;  1N36 K;  1D8Y A;  2YJE A;  2YKM A;  4E7K A;  4ID5 A;  4JKH A;  1S1V A;  1WAF A;  3DXK B;  1HNW K;  4CVN E;  3P38 A;  4FZY A;  1KQS M;  4M45 A;  3ITH A;  3ENH A;  3MEG A;  1DEJ A;  3G10 A;  1LWE A;  2OZM A;  3AVI A;  1HYS A;  3VQ6 A;  3AVH A;  4YOT A;  5LY3 A;  4LH5 A;  3WNH A;  2QK9 A;  4JNE A;  3KZB A;  4H0Y B;  4KHY A;  2NRZ A;  3TTF A;  3VET A;  3B6O A;  5AR0 A;  4FWM A;  4JKE A;  3KVG A;  4DCH A;  2P51 A;  3KLF A;  1VQ8 N;  4CI6 A;  1KSP A;  2HST A;  4BWJ A;  2E8A A;  4FW1 A;  3BGR A;  3M1F A;  1VSH A;  2HND A;  4CJ5 A;  3BZK A;  1TAQ A;  4EP5 A;  1LOT B;  4OPK A;  3WT0 A;  4FOI A;  3V4I A;  3OHR A;  1BWF O;  4CHY A;  3JSM A;  3CG7 A;  4FJJ A;  4LF5 K;  3CCL N;  4KH4 A;  4QOZ B;  3DMJ A;  4NYN A;  4DFP A;  2KFZ A;  3THX A;  4BY9 C;  4H5T A;  3CM5 A;  2P5G A;  4K8Z A;  1VSJ A;  1YJW N;  3CJ7 A;  3DLE A;  5FRM A;  2Q0U A;  4KPY A;  2GTD A;  1RCH A;  2KHO A;  4CF8 A;  4DB3 A;  4GVM A;  3QES A;  1RT7 A;  1S9E A;  4DS5 A;  4N5S A;  1JLG A;  1ZBH A;  3ZSY A;  3MED A;  4JS4 A;  2O8D A;  5KPR A;  2JWK A;  3AA3 A;  3JXU A;  4DR7 K;  5EXW A;  3O3H A;  3AY9 A;  1P90 A;  1KLM A;  4OVL A;  2DPN A;  5F2R A;  4HCC A;  3K59 A;  4ISG A;  4E7L A;  3D2F A;  1XC3 A;  2E4L A;  1RBT A;  2W6L A;  2QKK A;  1C1B A;  1ESV A;  4CHN A;  5F1X A;  3QIP A;  3DYA A;  1HKC A;  1NKE A;  2HBK A;  4BDP A;  2XY5 A;  1RBR A;  3T3F A;  2FC0 A;  2HNZ A;  3KLE A;  1Q82 O;  1GLL O;  3VA3 A;  4M7Y A;  3ZET B;  4WCE L;  2BAN A;  2UUC K;  2GWJ A;  4DLG A;  4JI2 K;  2P9P A;  3C6U A;  3KK1 A;  3NCI A;  5AQN A;  3H6E A;  3AV9 A;  2P9L B;  3TAN A;  5A2Q O;  1X9W A;  4G1Q A;  2O8F A;  4RW6 A;  4OPH A;  1NGG A;  3ZT4 A;  4CZH A;  1QE1 A;  3U4L A;  3KLI A;  3A5L C;  1GLJ O;  4JKF A;  4JRQ A;  2HHW A;  3K58 A;  1YIT N;  1E4F T;  4HTU A;  2HMP A;  4X62 K;  3S3M A;  3UKU B;  4TSX A;  3O5B A;  3SBT A;  1T03 A;  3E66 A;  4BC5 A;  2A1S A;  4RW4 A;  1IJJ A;  1ZBS A;  1VRU A;  4BR5 A;  4GV3 A;  3QIO A;  3O9R A;  3AVF A;  1OH7 A;  4XH5 A;  4WF9 L;  2NRR A;  3MAQ A;  3HJF A;  1GLA G;  1BU6 O;  1IBK K;  2HBM A;  1FW6 A;  3VER A;  4B8C A;  3CQY A;  4BVO A;  3JAM O;  4LF8 K;  1UWB A;  4JI3 K;  1RT2 A;  2NRH A;  3OVN A;  3VTH A;  2AP1 A;  4WQ4 C;  1ZBU A;  1FKP A;  1ZC6 A;  5C25 A;  4HHT A;  4KFB A;  2W6K A;  1JLB A;  3SV3 A;  2P9I A;  4Q5V A;  4B3O A;  4LSN A;  5CZ1 A;  1W7A A;  2X6N A;  3ZCM A;  4M3T A;  2NNW A;  4B9N A;  3I0S A;  1NK4 A;  5E84 A;  2E2N A;  4FWR A;  5JS2 A;  2A6A A;  3TAR A;  1LAW A;  1Q18 A;  4BRA A;  1EWQ A;  3OYF A;  4BRH A;  5AQF A;  2XY8 A;  2ASP A;  4A5A A;  1VQN N;  1KVB A;  4YNQ A;  4A2B A;  1NGA A;  1QQO A;  4JI5 K;  4KBO A;  2UXB K;  5J2N A;  3ULD A;  3S3O A;  4FJM A;  1IKV A;  4CGG A;  4EIA A;  3SJH A;  2D0P A;  3ULE B;  1GLD G;  1VQ4 N;  4BRQ A;  3AVM A;  3TI0 A;  3O6W A;  3DLH A;  3KKR A;  2RE2 A;  4Z4E A;  4N76 A;  1BCM A;  4JKC A;  1L3T A;  3RR7 A;  2P9K A;  3QDK A;  4OKJ A;  3AVC A;  1CLQ A;  2ASO A;  4H0X B; 
#chains in the Genus database with same CATH homology
 1BG3 A;  4BR4 A;  4NB4 A;  3VF6 A;  4PL7 A;  3CPE A;  5ADX H;  3CXC M;  3FZM A;  1RFQ A;  3FZF A;  3CMA N;  1NGD A;  5AQV A;  1YHQ N;  4JEP A;  3GL1 A;  4BRP A;  3I8B A;  3VPZ A;  1BOT O;  3FZH A;  2P9U A;  4NLC A;  4RTF D;  1M1K O;  2ZGZ A;  1U6Z A;  4YOU A;  3MWP A;  5FPN A;  3ID8 A;  3IDH A;  4AF1 A;  5BRF A;  1JJ2 M;  3SMS A;  3DAW A;  3MN9 A;  2ZGY A;  4Y0W A;  1W2B M;  3IUC A;  1QQN A;  2YX6 A;  5BRE A;  1K9M O;  4JKB A;  4JD2 B;  1ATR A;  4PKI A;  1YJN N;  4EFH A;  1U2V A;  3CQX A;  5AZI B;  2CH5 A;  1C0G A;  5M1O A;  5BPL A;  2A42 A;  5FPM A;  1VQ5 N;  4GY2 B;  4XH4 A;  3O8M A;  5JIC A;  1BA0 A;  4FOE A;  1Z6R A;  2QWR A;  2V7Y A;  3HOS A;  1JCE A;  3AGK A;  4FWL A;  5M1K A;  3HM8 A;  3FR0 A;  3VEO A;  4BRI A;  1ATN A;  1X3M A;  3PIP L;  2E2P A;  1NGJ A;  3LDN A;  3CCQ N;  2HOE A;  3O08 A;  2OTJ N;  2QI2 A;  1HKG A;  3QFP A;  2QW9 A;  5EY4 A;  2QWP A;  4B1X B;  4YOW A;  3CCR N;  3VOV A;  3MCA B;  3C7N A;  5CR4 A;  4A62 A;  2YI1 A;  5AQS A;  3SMP A;  5CHI A;  3M5R A;  3A0I X;  2YJF A;  4MO5 A;  4GV6 A;  4H5R A;  2Q0R A;  1W97 L;  2FXU A;  3BP8 A;  1YIJ N;  5TKY A;  1J6Z A;  3ATV A;  2ITM A;  4ISF A;  1QQM A;  1VQ7 N;  3NVK A;  1SZ2 A;  3BEX A;  3ZX2 A;  5KQD A;  5AQH A;  3H3N O;  3OA9 A;  3VEZ A;  4BG9 A;  3J8A A;  4MDB A;  4CZG A;  4EAH D;  4ISE A;  1XUP O;  1GLF O;  1YF5 L;  2F9T A;  2NLX A;  3JS6 A;  4BRC A;  2HBL A;  2IIR A;  1KXP A;  4IWV A;  4XH1 A;  1Z05 A;  5AQI A;  3N4Q A;  3VMF B;  5AQR A;  1KAY A;  3GBT A;  3WXJ A;  3TTC A;  3E9O A;  4BC2 A;  5LJV A;  2YHY A;  5C2D A;  3CI5 A;  3UKU A;  3VEN A;  5HOO A;  1VQO N;  1BUP A;  3EN9 A;  3F2K A;  4H5V A;  3P31 A;  4CJ7 A;  1HX1 A;  2VGN A;  1NGB A;  1NGC A;  5KPZ A;  4CZE A;  2GWK A;  3HI0 A;  1ZXO A;  3U9D A;  2QXL A;  3O9S A;  5JVG L;  1T3V A;  3S41 A;  4CD3 A;  1KAX A;  1E4G T;  1V4T A;  3DJC A;  5GAG P;  1NGI A;  3IMX A;  3C65 A;  3VEV A;  5I9E B;  4MO4 A;  2W41 A;  4IOA L;  5AQW A;  3WXK A;  4BQZ A;  5KPT A;  3DXM A;  3FFK B;  5AQQ A;  5F0X A;  4GV9 A;  2YHX A;  3B8A X;  3KWI A;  1SS6 A;  1XQS C;  4IJA A;  3CJC A;  2CGL A;  1BA1 A;  3K9K A;  5AFU H;  1H1V A;  3CME N;  3LDO A;  2FLO A;  4RCH A;  1D4X A;  2D1K A;  3ZYY X;  4BC3 A;  2WUS A;  3L0Q A;  3K9J A;  3HSC A;  3SK3 A;  1T6D A;  1HUX A;  4BGA A;  1DKG D;  4A5B A;  1C0F A;  4ILJ A;  2BUP A;  4BRL A;  3ZX3 A;  5BN8 A;  5LJW A;  1O13 A;  1ILY A;  5E26 A;  1K8K B;  3BUZ B;  4IFE A;  4KH6 A;  4ILH A;  2WBN A;  4OO1 J;  3FZL A;  3A5M C;  2PFU A;  3EZW A;  1NGH A;  3D2F B;  3OBW A;  1K73 O;  3SAG A;  2E88 A;  5ADX A;  5GAH P;  3AGR A;  4I6M A;  4BRN A;  4FSV A;  3WUH A;  4B1V A;  3H1V X;  4BRD A;  3MWT A;  5AQP A;  4FWO A;  2FSK A;  2CGK A;  4JKG B;  3GE1 A;  1GLC G;  4AM6 A;  4BVP A;  3EE8 A;  4CBW A;  3HZ6 A;  3MMV A;  5M1Q A;  1YUW A;  4L3Q A;  5C15 A;  2E2O A;  2Q97 A;  1CZA N;  4XEI A;  4F9O A;  3G6E N;  1YI2 N;  4FVU A;  1SQK A;  4HWI A;  4WFN L;  2ZF5 O;  2JWL A;  4FWQ A;  4EHT A;  3ULE A;  1TUY A;  4K25 A;  3SAH A;  5TKW A;  4O8U A;  1NM1 A;  3N4P A;  1IG8 A;  1VQK N;  2P9P B;  3CJA A;  5AQO A;  4WQ5 A;  2CGJ A;  3ID6 A;  4BRG A;  2P9S A;  1VQ9 N;  4K42 A;  5M1P A;  2GX9 A;  3W3D A;  3P39 A;  4IZ9 A;  3MDQ A;  3U8X A;  5M1N A;  1N8R O;  3UKR B;  4GNI A;  4JKG A;  4WQ4 A;  3ENB A;  1P8Z A;  3Q7C A;  4IEI A;  3SLC A;  5C12 A;  2BH1 A;  1NLV A;  2VCP A;  2QEX N;  4PKH A;  3MCP A;  3EE9 A;  2ZJP L;  4B1Z A;  3R1X A;  3DLL L;  3WQT A;  1OKJ A;  5AQJ A;  4LC9 B;  5AQT A;  4IO8 A;  1DGK N;  4CZI A;  4KH5 A;  3I56 N;  4G9Z A;  3EL2 A;  3FE1 A;  4CZF A;  5JLF A;  1MWK A;  2UYT A;  1MA9 B;  4A57 A;  4IOC L;  1X9J A;  3G4S N;  2A40 A;  5BPM A;  2AA4 A;  2V7Z A;  2YHW A;  2I7P A;  3ATU A;  4YDU A;  3AAR A;  3M6G A;  3WEE B;  2VWB A;  2ZJR L;  1S22 A;  5C0Y A;  1RGI A;  2YJE A;  5BN9 A;  5GAE P;  4JD2 A;  3I55 N;  4JKH A;  1NMD A;  3I33 A;  5AZI A;  3DXK B;  3P38 A;  3UE5 A;  4CBX A;  4BR9 A;  5JMV A;  1KQS M;  5AQY A;  3ENH A;  2GEL A;  3DWL A;  1DEJ A;  3T69 A;  5BR9 A;  4WFA L;  1QVF M;  2F9W A;  3GG4 A;  3CF5 L;  2BTF A;  3CER A;  5C10 A;  4FWP A;  3QB0 A;  4YOT A;  5LY3 A;  1VQL N;  4JNE A;  4WFB L;  5FPE A;  3KZB A;  1WUA A;  3F5T A;  4H0Y B;  5AQG A;  3CCE N;  2NRZ A;  3TTF A;  3VET A;  5AR0 A;  4FWM A;  4JKE A;  3KVG A;  3LL3 A;  1K8A O;  2P9I B;  4DCH A;  4JHD B;  5C2F A;  4K43 A;  4BQL A;  3MX5 A;  4UY8 O;  1M90 O;  5GIN A;  1VQ8 N;  3TU5 A;  4CI6 A;  3H3O B;  4FWK A;  2HST A;  2E8A A;  1RDW X;  3TPQ A;  3VEW A;  5AFU A;  1WOQ A;  4WYB A;  3M1F A;  2GUP A;  4BR7 A;  3HBT A;  3QFU A;  1TYQ B;  2WFB A;  2QWQ A;  3LDL A;  3CCM N;  5DM7 L;  4E1J A;  3BF3 A;  4BRF A;  3A5O C;  5KQ8 A;  2HBJ A;  2ZJQ L;  3C6H A;  1LOT B;  3FGU A;  4A59 A;  2QWN A;  3WT0 A;  4FOI A;  2A3Z A;  3H46 O;  4BRK A;  2FSJ A;  4MDA A;  3TSU A;  4CZL A;  3R8E A;  3OHR A;  2NZT A;  3MN6 A;  3BF1 A;  5FPD A;  1NJI O;  3VEX A;  3WXL A;  4B1U B;  3MN7 A;  1BWF O;  4JHD A;  4O8K A;  3D2E B;  4J8F A;  3WQU A;  3WXI A;  4EHU A;  4RWT A;  2QWL A;  4QS7 A;  2W40 A;  3UB5 A;  3VGK A;  2A41 A;  4B1Y B;  4CD1 A;  2FSN A;  2RHK A;  5AZJ B;  3CCL N;  1Y64 A;  4YOR A;  1HJO A;  3OBY A;  4KH4 A;  4M7X A;  3ZX0 A;  4BRO A;  2Q1N A;  3HRG A;  3T7Z A;  4BY9 C;  2Q31 A;  1QZ5 A;  3E9P A;  4H5T A;  3VGM A;  2NRT A;  2VYP A;  1YJW N;  3CCS N;  3CJ7 A;  2QM1 A;  2QTD A;  4MLH A;  2Q0U A;  4QS9 A;  3W0L A;  2GTD A;  2P9K B;  3EO3 A;  2P9N B;  2KHO A;  3MN5 A;  3R6M A;  4QS8 A;  4IO9 L;  4DB3 A;  3M3Z A;  1G99 A;  4GV3 A;  3MX2 A;  4CBU A;  1YAG A;  3O9T A;  3ZEU B;  3LM9 A;  1HLU A;  4H0O A;  1KC8 O;  4C1N K;  2D4W A;  5AQM A;  4O5F A;  3AAQ A;  2YCH A;  2FF6 A;  4H0T B;  2IVP A;  5AQX A;  4YOX A;  3QIC A;  2E2Q A;  4K41 A;  1NWK A;  3TSQ A;  5KPR A;  4HTL A;  2JWK A;  1GLB G;  3JXU A;  4H5N A;  2FF3 B;  5EXW A;  3E9L A;  3AY9 A;  2OAN A;  1K8K A;  3MK6 A;  4FPB A;  4BG8 A;  3PLA A;  1P90 A;  5F2R A;  2DPN A;  3P4I A;  4Z94 A;  3QML A;  4ISG A;  3CET A;  3LDQ A;  3CCU N;  1MDU B;  5AQK A;  3D2F A;  4NLB A;  1XC3 A;  2QWM A;  2NRV A;  2KLA A;  2V51 B;  2P9N A;  1JCF A;  2I7N A;  2KKZ A;  3KWG A;  5AQL A;  3CC2 N;  1TUU A;  1ESV A;  5F1X A;  4CZM A;  1U2V B;  3EKS A;  2A5X A;  3O4W A;  1HKC A;  3O1B A;  4FWS A;  2HBK A;  3EKU A;  1HKB A;  5EOY A;  4YOV A;  1Q82 O;  4H03 B;  3C6A A;  1GLL O;  4M7Y A;  4C23 A;  4JKD A;  2NRX A;  3ZET B;  1QHA A;  1Q7Y O;  4WCE L;  4A61 A;  4MLE A;  1Q81 O;  3LM2 A;  3NVM A;  1GLE G;  2GWJ A;  3G25 A;  2ZWH A;  1KAZ A;  4U7B A;  2P9P A;  4JK7 A;  4BRE A;  3J7Z O;  4H5W A;  2GEM A;  1LCU A;  1T6C A;  1X3N A;  3C7N B;  3H6E A;  5AQN A;  3CC4 N;  1Q86 O;  1BO5 O;  3VEY A;  2P9L B;  4CZK A;  4PHT X;  2IVN A;  3KK7 A;  1HPM A;  3CHW A;  3UKR A;  4BRM A;  5GAD P;  2Q2R A;  3IFR A;  4OPH A;  1NGG A;  4CZH A;  4DHY A;  3H1Q A;  3U4L A;  5B8H A;  1MWM A;  4IOX A;  5CE3 A;  3A5L C;  1GLJ O;  1NBW A;  1OVY A;  4JKF A;  3C0B A;  1V4S A;  3R9P A;  3ENO A;  3ZET A;  3QBX A;  4PL8 A;  1EO1 A;  4DKW A;  1YIT N;  1E4F T;  4BR0 A;  4GVE A;  5MLC Q;  2HMP A;  4IDH A;  1NGF A;  1BDG A;  4DQ8 A;  1VAZ A;  4OPA A;  3UKU B;  2E1Z A;  3O5B A;  3CJ1 A;  3O80 A;  3CIP A;  3SBT A;  5BRD A;  3VGL A;  3D7E O;  2E1Y A;  2P9L A;  3HTV A;  2OTL N;  3E66 A;  2PBD A;  4NO7 A;  4BC5 A;  3F9M A;  3E1Y A;  4IXC A;  1IJJ A;  1ZBS A;  4PKG A;  1RDU A;  3GOI A;  3O9Q A;  3WEE A;  2V52 B;  4BR5 A;  1VQP N;  4JK8 A;  3O9R A;  1ATS A;  4XH5 A;  2NRW A;  4BGB A;  4WF9 L;  4B9Q A;  3GDQ A;  2NRR A;  5ELZ A;  3DXK A;  3O1W A;  1YVN A;  1GLA G;  1BU6 O;  2QWO A;  3CD6 N;  3CPW M;  3KHY A;  1S72 N;  4IEE A;  3CCJ N;  2F7T A;  2HBM A;  4WQ5 C;  3DXM B;  4BC4 A;  3VER A;  1VQM N;  3CQY A;  4BVO A;  3VES A;  3LDP A;  3CJB A;  3H45 C;  2NRH A;  1T44 A;  4B1W B;  2PAV A;  3Q7B A;  3VTH A;  2IVO A;  2AP1 A;  4WQ4 C;  3RVC A;  4CZJ A;  5H1S Q;  3VTI A;  3HOT A;  1YJ9 N;  1ZC6 A;  4FWN A;  3CJ9 A;  3CC7 N;  5AQZ A;  3IKM A;  3RSE B;  2D0O A;  1YXQ A;  2WC9 A;  4IJN A;  4JK9 A;  2P9I A;  5GIO A;  4AM7 A;  3WXM B;  2HF3 A;  4C1N I;  1SAZ A;  5JVH L;  3QBW A;  2VGM A;  2ASM A;  3TSP A;  4JN4 A;  2NNW A;  2QA4 N;  1S3X A;  3A5N C;  3VF2 A;  1TYQ A;  4JKA A;  5E84 A;  2E2N A;  2Q36 A;  4FWR A;  2A6A A;  5GIP A;  1Q18 A;  4BRA A;  3NMU A;  3OW2 M;  4FL9 A;  3TTD A;  4YDU C;  3L4I A;  4BRH A;  5AQF A;  3U9Z A;  3PIO L;  4I6M B;  2ASP A;  5EX5 A;  4A5A A;  1VQN N;  1VQ6 N;  2CH6 A;  2E20 A;  2H3G X;  5EVZ A;  3RSE A;  4FO0 A;  4A2B A;  5DM6 L;  1QZ6 A;  4H0P A;  1NGA A;  1DT9 A;  1QQO A;  3D2E A;  4KBO A;  4U67 L;  4BR2 A;  4YOY A;  4JAX A;  2EWS A;  1R59 O;  4ILG B;  5AZJ A;  5BPN A;  4EIA A;  2HF4 A;  3L4Q A;  3SJH A;  2D0P A;  4FPA A;  3ULE B;  4R79 A;  1GLD G;  3SAF A;  3G71 N;  3FZK A;  1EQY A;  1VQ4 N;  1KD1 O;  5M1F A;  3A8Y A;  3O9U A;  3R3L A;  4H0V B;  3VF4 A;  5BRH A;  5HL7 L;  4BRQ A;  2P9U B;  3AAP A;  2P9S B;  3O6W A;  2RE2 A;  1QVG M;  3D6R A;  4JKC A;  1JCG A;  3FLC O;  4A2A A;  2J4R A;  2P9K A;  3QDK A;  4M63 C;  5JLH A;  5AQU A;  1NGE A;  2ASO A;  3L6Q A;  3ZEU A;  3CCV N;  4H0X B;  3SBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...