2E2QA

Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords HEXOKINASE
total genus 110
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA01
3DAWA 2P9KB 3VEXA 4B1UB 5KPRA 1Y64A 3C7NB 3CHWA 4IWVA 4B1ZA 4H0PA 1V4SA 4BVOA 1GLJO 1HKGA 4FL9A 4JNEA 4QS8A 1U2VA 3ZX2A 4BRQA 3CQXA 1OKJA 3DJCA 3VF2A 1MWKA 4K41A 4BR5A 3WXIA 1GLAG 3VERA 3O5BA 2HOEA 4RWTA 2PBDA 4B1XB 2P9KA 1HX1A 2QWOA 4IJNA 3BF3A 4B1YB 4PKGA 1NM1A 3CJCA 4YDUC 4E1JA 4QS9A 3HTVA 1DGKN 5AQMA 3C7NA 5JMVA 4JD2A 3AAPA 1ZC6A 2QW9A 2CH6A 4CZJA 2VCPA 4FOEA 1HLUA 2OANA 3EZWA 2GEMA 4ISFA 4JD2B 3VEWA 1ATNA 3MN5A 3MCPA 1GLLO 5KPZA 3QB0A 4JHDB 4B1VA 4WQ4A 4CBUA 3CQYA 1MDUB 4A61A 3C0BA 3O1WA 3DXKB 2A41A 1TUYA 4M7XA 1NGFA 4H03B 5LJWA 3VGKA 4CD3A 3L4IA 2QWNA 4XEIA 1BA1A 5AQSA 4CD1A 1NWKA 1EQYA 2DPNA 5BRHA 3H46O 2QWLA 3GOIA 1XC3A 2V52B 1JCGA 5JICA 4BRIA 3QBXA 3VETA 4BG8A 4FSVA 4WQ4C 4BRDA 3HM8A 3O8MA 4FWSA 2FSNA 2E2NA 1NMDA 1H1VA 2H3GX 2QXLA 4IO8A 4NO7A 5ELZA 4BC3A 2FXUA 2D0PA 1RDWX 3UB5A 3VGLA 4FWQA 4H5WA 4H5VA 2Q1NA 4BREA 5FPEA 3GBTA 4DCHA 3ATVA 2NZTA 3UKRB 1E4FT 3FZKA 2FSJA 4CZHA 3ULEB 3ATUA 3ZETA 2J4RA 2Q31A 2A5XA 3D2EA 2V51B 3VENA 2P9SB 2A42A 1SQKA 3LL3A 1KAXA 4QS7A 3FZFA 2YHWA 3BUZB 2E2PA 3VF6A 5I9EB 3P4IA 3MK6A 4CBWA 5JLFA 3LDOA 3LM9A 3ENHA 3MN6A 4IJAA 5BPMA 2P9PB 3M3ZA 5AQTA 5AR0A 1QZ5A 4CZEA 4O8KA 1LOTB 1QQOA 3A5NC 2Q2RA 3FZLA 1MA9B 4BRAA 4H0VB 2FLOA 4MLEA 3SK3A 2VYPA 3CERA 3F9MA 4EHTA 5LY3A 3ZEUA 3FFKB 1P8ZA 1U6ZA 2I7PA 5BREA 1BU6O 3TU5A 1TYQB 3DXKA 3O08A 3ZEUB 2UYTA 1KAYA 3O6WA 4EAHD 4H0YB 3S41A 1ZXOA 4BC5A 5AQKA 4EHUA 5ADXH 5AZJB 1J6ZA 4BR0A 3H45C 3EN9A 5TKYA 2YI1A 4WQ5C 4FPAA 4FOIA 3UKUA 3M1FA 5E26A 1NGJA 2IIRA 1SZ2A 3I8BA 4NB4A 2W41A 5AQOA 3OHRA 3VGMA 4H0TB 2D0OA 1SAZA 1NBWA 3QICA 2V7YA 2W40A 3M6GA 4FWMA 3LDQA 4FPBA 4M63C 1K8KB 2QM1A 1BA0A 3HZ6A 4EFHA 1CZAN 4FWOA 4FWPA 1BDGA 2P9SA 4BRGA 3MN7A 2E8AA 2Q97A 1ATSA 1E4GT 3L6QA 3CJBA 3ULEA 5AQZA 4C23A 3HBTA 4CI6A 4DQ8A 4BQZA 3IUCA 2QWMA 1LCUA 3ENOA 3H1VX 3W3DA 3VEOA 4BRPA 2VWBA 4BGBA 3U9ZA 1HKBA 1JCEA 2Q0RA 2CGJA 3BP8A 3QDKA 5KQ8A 5FPMA 3DWLA 2E1ZA 5AQWA 1ATRA 1Z6RA 3JS6A 4XH1A 3VF4A 5JLHA 3GE1A 4CZLA 1G99A 2ITMA 4M7YA 3VOVA 2FF6A 5BN8A 1NGAA 4H0OA 1TYQA 4A2BA 4L3QA 2PAVA 1KAZA 2ZWHA 4A2AA 4GY2B 3WEEB 4CJ7A 4BQLA 3AAQA 4H5TA 1X3NA 2NRHA 4J8FA 1JCFA 3VEVA 4I6MB 2P9LB 5AQGA 5KQDA 3FZMA 5EY4A 5AQFA 2CH5A 4BRCA 1BOTO 1RGIA 4RCHA 1C0FA 2F9TA 1YUWA 5AQHA 4HTLA 4JAXA 5AQJA 2A40A 3ZX0A 1QHAA 3AY9A 3R9PA 4BRLA 3LDPA 3D2EB 3D7EO 2NLXA 2E88A 2GUPA 4BRMA 4CZMA 5EX5A 4CZGA 3RSEA 3B8AX 1IJJA 3CI5A 3FR0A 2E1YA 3J8AA 1NLVA 1T6CA 3SJHA 2QWPA 1GLEG 3A5MC 1GLFO 3DXMB 4DB3A 5F0XA 4H5RA 1KXPA 2P9NA 2AA4A 3A8YA 2YJEA 2Q36A 1HPMA 1NGBA 3EKUA 3SMSA 3UKUB 3AARA 4MO5A 1GLDG 4BRKA 3H3OB 1T6DA 2ASPA 2IVOA 1X9JA 3H3NO 3IFRA 1NGHA 2QWRA 2ZGYA 1U2VB 3EKSA 5EVZA 4BR9A 3CJ1A 2YHYA 3LDNA 4CZFA 5FPNA 5AQRA 3QBWA 2CGKA 4ISEA 3EO3A 4AM7A 4PKHA 5EXWA 2P9UB 1NGGA 3MDQA 3GG4A 2HF3A 3GDQA 3MMVA 4JHDA 4GNIA 3R8EA 3ID8A 1WOQA 1HJOA 2GWKA 5AQLA 4CZIA 4K42A 3SMPA 5BRFA 3W0LA 1MWMA 5EOYA 3I33A 2FSKA 2HMPA 4BGAA 1DEJA 1NGEA 1IG8A 1QQMA 3G25A 2P9PA 3VPZA 4FO0A 4K25A 3CIPA 1NGDA 1RFQA 5BN9A 3WEEA 1Q18A 3BF1A 4EIAA 4F9OA 2GTDA 3WXJA 3TPQA 5AQUA 2E20A 2F9WA 1S22A 5AQIA 4WQ5A 3A5OC 2P9LA 1BUPA 3VEYA 5B8HA 3SLCA 3VEZA 5AQQA 5AFUA 1BWFO 1HUXA 1TUUA 3O1BA 4XH5A 4XH4A 2BUPA 4LC9B 5F2RA 4PL7A 1QZ6A 4H5NA 3L0QA 5CE3A 2E2QA 5AZIB 3BEXA 2E2OA 2D4WA 4PL8A 3H6EA 2FF3B 1YVNA 2BTFA 3LDLA 5AQNA 1Z05A 5AZIA 1ZBSA 4B1WB 4KBOA 3QFUA 2KHOA 3KHYA 2QWQA 4O5FA 4RTFD 5AFUH 1ESVA 4JN4A 2ASMA 4FWNA 1V4TA 4Y0WA 4IXCA 5E84A 3WQTA 4A62A 4K43A 1XQSC 1YAGA 3WQUA 5F1XA 2P9NB 4BR4A 1BG3A 4BROA 2EWSA 3ZETB 1XUPO 2WUSA 3CJ7A 4BC4A 3WXLA 3R6MA 3U4LA 5BRDA 5AQVA 3JXUA 3FE1A 3UKRA 4BRNA 3QFPA 4MO4A 5AQYA 3DXMA 4CBXA 4DHYA 2A6AA 2GELA 3IMXA 2P9UA 3LM2A 1S3XA 2IVPA 4Z94A 1GLBG 4BC2A 2ASOA 5AQPA 4WYBA 3KVGA 1DKGD 3O4WA 3U9DA 2ZF5O 2IVNA 3FZHA 1C0GA 3WUHA 2Q0UA 4BG9A 3KZBA 4AM6A 3CJAA 3A5LC 4FWRA 2YCHA 3GL1A 2P9IA 1X3MA 3FGUA 5ADXA 5LJVA 4BR7A 4I6MA 4BVPA 2YJFA 4YDUA 2AP1A 2A3ZA 3WT0A 2P9IB 3QMLA 3U8XA 1YXQA 2I7NA 3HSCA 4B9QA 3UE5A 5AQXA 3VESA 4BR2A 1QQNA 4ISGA 1NGCA 4HWIA 3EL2A 4IZ9A 1NGIA 4BRHA 3MN9A 1T44A 3A0IX 3FLCO 1R59O 2CGLA 1BO5O 3CJ9A 4CZKA 3ZX3A 4PKIA 3WXKA 5BR9A 3D2FB 4MLHA 5AZJA 5BPLA 4FWLA 2YHXA 3IDHA 5BPNA 5FPDA 4FWKA 2GWJA 5KPTA 1K8KA 4H0XB 3RSEB 4BRFA 3HI0A 3O80A 1D4XA 3CETA 2ZGZA 2HF4A 2V7ZA 3H1QA 3D2FA 1HKCA 1WUAA 1GLCG 2D1KA
chains in the Genus database with same CATH superfamily
1EWQA 1XC9A 2HHUA 1ZBFA 1CXUA 1HNIA 3J81O 1JXBA 5GAEP 4FJ8A 1Q9YA 1CZ9A 1J54A 1NK4A 1OH8A 2NRTA 5K14A 4I9LA 2F96A 1GLJO 4A57A 4FL9A 4CHQA 4EZ9A 1E3MA 3M8PA 4BRQA 3DLBA 4OPJA 5KRTA 3SUNA 3KWIA 4E0DA 4B1XB 4EZ6A 3BF3A 4B1YB 4W5TA 4ZHRA 1NM1A 4DR6K 4JYAK 2P5OA 3HPGA 3HOTA 2WFBA 3K9KA 1HLUA 4IOAL 4DV3K 2GEMA 4ISFA 3RMAA 3VEWA 3OYAA 4LF6K 3NGZA 1FW6A 2JGUA 1LAWA 1VSKA 2Z1HA 4WQ4A 4DV6K 4Z0UA 4RW6A 2ZQBA 4DS5A 2RF2A 3C0BA 3NGYA 2VWKA 5CY4A 2RE2A 3TTDA 3QINA 1C0MA 1N8RO 4DLGA 1REVA 4XEIA 1BA1A 3TTCA 2DPNA 1VQ8N 4JS4A 3SI6A 1XC3A 4IBNA 4DTOA 4O5BA 2VWJA 4A5AA 4BG8A 4WQ4C 4OKEA 4NLBA 2UUAK 4FWSA 1QQCA 3G71N 3V9XA 5LL6Z 2QXLA 2ATQA 5ELZA 3OBWA 4GMJB 5FROA 3KLFA 4IOCL 4FLWA 4ELTA 3VGLA 3UB5A 4FLTA 1VQMN 1FJGK 2OA8A 4IEEA 4RG8A 4IFYA 4DCHA 3ATVA 3THWA 3BZCA 3KTQA 4B3SK 3LP2A 3ATUA 3OBYA 4WFAL 5HRSA 3CPWM 2V51B 3VENA 1KRPA 1RTJA 4CJFA 2NUBA 1RBUA 3BUZB 3VF6A 4AHVA 5I9EB 4LF4K 3MXMA 3DLHA 3D6RA 4CBWA 3LP3A 3SUOA 3LDOA 3LM9A 3ENHA 3O3GA 3TAGA 3T1HK 3V81A 2P9PB 3M3ZA 4RW8A 5AR0A 3E01A 4CGFA 4O8KA 4DLEA 1Y97A 3BDPA 3A5NC 3CC4N 2X6SA 3ZCMA 5CHIA 2KW4A 2VYPA 4BE2A 3F9MA 4GW6A 2QEXN 3AVIA 1OH7A 2A1RA 1BU6O 4DSLA 3TSUA 4IDHA 1RDCA 3O08A 3O9SA 2JWLA 4BDYA 2UYTA 3THXA 2QXFA 3O6WA 3E66A 4H0YB 2XY5A 3S41A 1IO2A 2WC9A 5AQKA 3QNNA 3CFOA 3H45C 4GV6A 3PIOL 4JI2K 3EN9A 3OTOK 1Q9XA 4FPAA 1N33K 4FOIA 2UUCK 4JLHA 1DLOA 5E26A 1NGJA 3P31A 4DQPA 2HHHK 4KI4A 3ULDA 5AQOA 3OHRA 1VQLN 3CMEN 1SAZA 3QIOA 3QICA 3M6GA 1BA0A 4EFHA 4FWOA 1KLMA 4FWPA 2P9SA 3MN7A 2Q97A 4LH5A 4FJXA 3OJUA 2BDPA 1ATSA 3HVTA 3CJBA 2HSTA 1B9DA 4KO0A 5AQZA 3M8SA 4Z4HA 4ZTFA 3HO1A 2FC0A 4FJHA 1KFSA 3K5OA 3AVAA 4M3UA 3H1VX 1S1VA 4CEEA 4JKCA 2Q0RA 5KQ8A 2HBJA 2ZE2A 4M3YA 1M90O 3E9PA 1YJNN 3HOSA 1UA1A 4C8KA 4M7YA 1NGAA 3JSMA 4U7BA 2HNZA 4L3QA 4KB1A 1KAZA 2ZWHA 4OPKA 4A2AA 3AA5X 4IFVA 3NGIA 3WEEB 1VQPN 4BQLA 4IFEA 4J2AA 4CESA 5KQDA 5M1OA 4UY8O 4BRCA 5AQFA 2CH5A 4L8RB 1P90A 3DLGA 5AQHA 5HL7L 2A40A 1TV6A 1T7PA 3SJJA 3MECA 3R9PA 1KTQA 2E88A 4BRMA 3CCSN 5EX5A 3F2KA 3Q7BA 4CIFA 3KWGA 1BCOA 3J8AA 1NLVA 2QWPA 4LF5K 4FJJA 4CEFA 4DB3A 1KXPA 4LSNA 1ASUA 5C10A 4IKFA 4KFBA 4DTSA 2O8CB 2HVHA 4BRKA 4IDKA 4FLYA 4JKDA 4E7HA 2XY8A 4B3RK 4N56A 2ZGYA 1JKHA 2RPIA 4YHHK 3CJ1A 1VQ4N 3O9RA 4CZFA 2G8IA 3QIPA 1U47A 3EO3A 1N34K 2X78A 3P5JA 4DV1K 1ILYA 2P9UB 4CJEA 3GG4A 2HF3A 1D8YA 3VQ9A 3KKSA 1WAFA 4HCBA 2EX3A 4M3RA 3HP9A 5AQLA 4CZIA 1U48A 5BRFA 4LFAK 2Q3SA 1SS6A 5FRNA 2FSKA 2HMPA 4X62K 3ID6A 4BGAA 2HBLA 4DSJA 2O8EB 4DF8A 2IC3A 2O4IA 4KHPK 4K25A 2F8TA 1JL2A 1RFQA 4MDAA 4B3MK 5BN9A 1ZBIA 2O8FA 4OLBA 5GAHP 1S22A 4KHYA 5AQIA 4WQ5A 1YTAA 4CHOA 3VEYA 2YKNA 3K9JA 3SLCA 1QVFM 1HQUA 3O1BA 3T3FA 4XH5A 4PL7A 3RR8A 4H4OA 4CJ5A 3BEXA 1T3VA 3VQAA 4AHCA 3OYIA 4I9QA 5TKWA 4CEQA 4CEZA 5HOOA 2FF3B 2BTFA 4KBOA 2QK9A 4O5FA 2XY6A 2G8UA 4M3TA 4JN4A 1S1TA 4JI0K 4FWNA 4KH6A 4DQQA 1NJYA 3QLHA 4CJQA 4A62A 1XQSC 3WQUA 2P9NB 3ITHA 4FM1A 4C8OA 3KJVA 1J9AA 3CJ7A 4JV5K 1S6QA 1WSJA 5AQVA 3I56N 4DQRA 5BR8K 4WFBL 3SCXA 1D9DA 1J53A 4JKEA 3CFRA 3LM2A 4BC2A 2Z1GA 2QI2A 5A2QO 4WYBA 4N5SA 4FJ9A 4NXMK 3O4WA 3RTVA 1KLNA 1J5OA 3FZHA 2JWKA 3KLHA 3WUHA 4OLAA 2W6LA 1RTIA 4BG9A 3AGRA 1WBDA 3KLGA 4Y1CA 3NDKA 3C6HA 3I0SA 3S3NA 1EO1A 2P9IA 1VSJA 4I6MA 1S9GA 4BVPA 2YJFA 1NOZA 1RT1A 3NFAA 4YDUA 4HUFA 4HVJA 2P9IB 4H8KA 2VGNA 4DSIA 3UE5A 1HNXK 1NGCA 1GOCA 4IZ9A 1JLCA 4DU3A 2PFUA 4BRHA 2Z1IA 4FJ7A 4OPAA 1R59O 3EZ5A 2ZJQL 5T7BA 4PKIA 2JLEA 3V6DA 4ICLA 5BPLA 2YHXA 2GWJA 3ZT4A 1T05A 4GVEA 3RSEB 3SQ1A 1IBMK 2G8WA 1MU2A 3OYGA 3D2FA 1WUAA 3J7ZO 4CF8A 2W42A 1VSFA 4FJ5A 3VEXA 3SAGA 1KVAA 4CF2A 3SNNA 4LF7K 2DFEA 2HHTA 2O8CA 1Y64A 3C7NB 1K73O 2D0BA 4DFKA 4CJ3A 1HKGA 4JNEA 4QS8A 1HMVA 3SBGA 2OPPA 1OKJA 3VF2A 1MWKA 3AVHA 4K41A 4BR5A 3WXIA 2R7YA 3VERA 2HOEA 1HNZK 1WSIA 1WSGA 1RTHA 2PYLA 3J80O 4YDUC 2XY7A 4E1JA 4U67L 2WTUA 1SL0A 3MXJA 4JD2A 4HCCA 2CH6A 4OGEA 2E6MA 2OANA 1TK8A 1GOAA 4JD2B 1ATNA 3MN5A 1YJ9N 3K2PA 3LANA 5KPZA 4B1VA 1XMOK 3EE8A 1TL3A 1MDUB 2KFNA 3MWPA 5KI6A 4CK2A 3DXKB 3M8QA 4IO9L 1TUYA 4CFCA 3NMUA 1CXQA 5LJWA 2HB5A 3CCMN 1JXEA 3L4IA 1QE1A 1RDUA 2YV0X 1NWKA 4DV5K 3VQ7A 1S6PA 4CK1A 5JICA 3QBXA 3NAEA 3AA4A 4CGGA 1NJIO 4FSVA 3O8MA 4TSXA 5HBMA 4DTXA 2FSNA 4B9SA 4DUZK 1QS4A 3QERA 2H3GX 1WSEA 1RDDA 2O8DB 2D0PA 4XIUA 4H5WA 3OYMA 4H5VA 4MDBA 4BREA 2OPRA 1HNVA 2FBVA 3FZKA 1NK0A 4Z4FA 2O4GA 3G4SN 4OJRA 3KK2A 2A42A 4JKHA 1SQKA 4FJIA 4Z4IA 2QKKA 1KAXA 1U04A 3O4NA 3V9ZA 2E2PA 4CJSA 1U49A 1KFDA 3P4IA 3KLIA 5JLFA 3ZSVA 3G10A 4NXNK 3MN6A 5BPMA 2XHBA 3CC2N 1RT7A 1NK7A 3C94A 4JI4K 4OKKA 3OYDA 3ZT1A 1LOTB 1QQOA 4DF4A 1L5UA 3NF9A 4CFBA 4E7LA 4MLEA 1XNQK 3QESA 2NRXA 4LF8K 4FM0A 3K57A 4R5PA 4IEIA 2D0CA 2HMIA 4JKGA 3QEVA 4FK2A 1TYQB 1S1UA 3G0ZA 1EXQA 3DXKA 4DV0K 3IG1A 1W2BM 3K5NA 3PO4A 3AO1A 3IAYA 1X9MA 3OS0A 4BR0A 3MEGA 4LF9K 4CEDA 4CGJA 5TKYA 2HNYA 2X74A 2YI1A 1ZYQA 2OPQA 3ZYYX 4ILJA 3UKUA 4CJ4A 3SAFA 4AQYK 1TKXA 3NE6A 4DUYK 3M1FA 4CECA 3KKRA 1SZ2A 3P1GA 5C25A 3R3LA 3L3VA 4CJWA 2IOCA 2FBTA 3DOKA 3OA9A 2UXCK 3THWB 3I0RA 1QHTA 1NBWA 2F7TA 4FPBA 4FWMA 3V9UA 1HJRA 3VA3A 5GINA 2NRZA 1C1BA 3ENBA 3L6QA 1I39A 4OKJA 1JLAA 4DQ8A 4JKBA 1ZBLA 3ENOA 1VSIA 4BRPA 2UUBK 4KHUA 3M5RA 4IG3A 4IOXA 2EHGA 4WFNL 3DWLA 3CCEN 4XH1A 4CZLA 3CG7A 5LMNK 4LD0A 4PA1A 2ITMA 1TL1A 2FF6A 4WCEL 3OJSA 1TYQA 2RHKA 4FVUA 2HHWA 3ASMA 4CJ7A 1GOBA 3K0SA 4JK7A 4J8FA 1JCFA 4I6MB 1NU0A 1NKBA 1JLGA 1BOTO 3PY8A 1C0FA 3SYZA 1YUWA 5AQJA 2X6NA 1QHAA 1Q8IA 1VRTA 1YT3A 1S1WA 2NLXA 4DV4K 4CJRA 2GUPA 1BL3A 3RR7A 1C1CA 2WOMA 4CZGA 2KTQA 5JS2A 2ZD1A 1IJJA 3CI5A 3Q7CA 4CJVA 3QNOA 3O3FA 1QSLA 4YOVA 2YNFA 4FZYA 1GLFO 1K8AO 5F0XA 3TAFA 4BY9C 3AVLA 4W5QA 5IWAK 3A8YA 2YJEA 1RBRA 4PWDA 3UKUB 3KK1A 3OYBA 4YOXA 4MO5A 1GLDG 3L2UA 4JI3K 1T6DA 1I94K 2IVOA 1D5AA 1X9JA 1NK9A 3IFRA 4FLUA 1NGHA 2KZZA 1U2VB 3WXMB 3SV3A 5AQRA 5EXWA 4C1NK 2OPSA 3GDQA 3MMVA 4JHDA 1FKPA 2PY5A 2O8FB 2IS3A 5HROA 1B9FA 4K42A 5I42A 1VQKN 1MWMA 3QEPA 2HHXA 3I33A 4X64K 4BDZA 4GKJK 1BQNA 2HHSA 1DEJA 1NGEA 3DRSA 1IG8A 1QQMA 3SBTA 1M1KO 4E7JA 1NGDA 1TAQA 3AVKA 3WEEA 4F4KA 1Q18A 3BF1A 4F9OA 3LZJA 3B6OA 3QEXA 4CHPA 3THYB 3MCAB 3A5OC 3HVRA 1Q82O 3ALYA 1BUPA 5AFUA 1BWFO 4O0JA 3AV9A 2BUPA 3WNFA 5FRMA 4FJMA 4BWJA 2D4WA 3SV4A 4PL8A 1U45A 1VSHA 3CCVN 4CERA 4KTQA 4A5BA 1IKWA 5AQNA 4DWIA 3IKMA 4FM2A 3KHYA 4RTFD 4Y0WA 4IXCA 5E84A 3SPYA 1VSEA 3OYHA 4K43A 5C2DA 1YAGA 5F1XA 1BG3A 2EWSA 1XHZA 4CCHA 2WUSA 3VQEA 2ZJPL 3R6MA 3U4LA 2GV9A 3DRRA 1TK5A 3O9UA 3T1AA 4BRNA 2VG7A 4CEBA 3DXMA 4CBXA 4DG1A 4C1NI 3EYZA 4DTNA 5M1KA 2ITGA 5C2FA 2A6AA 3G6EN 2GELA 3IMXA 3SQ4A 1BGXT 1KC8O 4F3OA 4OPHA 4Z94A 2WBNA 4FLXA 4WF9L 2ASOA 5M1NA 5AQPA 5E41A 1U4BA 1KVBA 3KVGA 1DKGD 3U9DA 4FCYA 3TI0A 2ZF5O 3LALA 4CF1A 3C6UA 3THXB 3VQDA 4CIEA 1YI2N 2VG6A 3KZBA 4AM6A 3PX0A 4BR7A 3R1XA 1W97L 4GVMA 3NCIA 3K59A 2AP1A 2A3ZA 2P51A 4B3OA 2YX6A 4JK9A 5FDLA 1YXQA 4B9QA 3OYEA 3HT3A 4B08A 2Z1JA 1VQ6N 1NNEA 3VESA 4ZTJA 1QQNA 4ISGA 3H08A 3EL2A 3PV8A 1NGIA 4AF1A 3FLCO 4BWMA 2CGLA 4E1NA 1S72N 3ZX3A 3WXKA 3D2FB 5AZJA 1G15A 3WNHA 4DTPA 5BPNA 4E3SA 5FPDA 1LWFA 3D45A 5GAGP 4ILGB 4HUGA 5KPTA 2OTJN 5SZTA 3CETA 1Q7YO 4K0KK 2V7ZA 3H1QA 3C6AA 2A1SA 1BI4A 2D1KA 1KD1O 2HVIA 2O8DA 1YITN 3DAWA 2P9KB 4B1UB 4DU1A 3P38A 5KPRA 4IWVA 1JLQA 3CHWA 4AHUA 1RT5A 4H0PA 4M3XA 3DLRA 4FZXC 4JI8K 2DFFA 3OYKA 3HPHA 2ETJA 1LWCA 3DJCA 4W5OA 4M3WA 2D5RA 3AVGA 4QOZB 3O5BA 1NG9A 1TAUA 4RWTA 3AVJA 3CXCM 4R79A 4QS9A 3HTVA 4CK3A 5AQMA 3C7NA 5JMVA 2KQ2A 1L3TA 3AAPA 1ZC6A 2QW9A 1NJWA 2VCPA 3EZWA 4O55A 5DK5A 1L3SA 1W0HA 1GLLO 2VQEK 3QB0A 4JHDB 3VQ6A 3V9WA 1WN7A 3CQYA 3OS1A 4ILHA 3KLEA 1WB9A 4FLVA 1NK8A 4Q0BA 3O1WA 2A41A 1J5EK 4M7XA 3K5MA 1NGFA 2FBYA 3L8BA 4HHTA 3CC7N 1CLQA 3ZT0A 3VGKA 4CD3A 5CR4A 2QWNA 5IT9O 3AO2A 3VTIA 4E7IA 3PIPL 3BGRA 5BRHA 2B6AA 3H46O 2QWLA 3GOIA 3JAMO 4JRQA 2NRVA 2V52B 1JCGA 1C0TA 4BRIA 5AJ3K 5GADP 3VETA 4BRDA 1S9EA 4CGIA 1HYZA 4O44A 2E2NA 2W6KA 1NMDA 4DR3K 3DM2A 4JI1K 1JL1A 2RKIA 5M1QA 3V4IA 1RDWX 2FBXA 5HRRA 4AHSA 2HHVA 1SUQA 3GBTA 2NZTA 3UKRB 1E4FT 3L4QA 3NVMA 4CZHA 4JKFA 3ZETA 4ELUA 2J4RA 4EP4A 2A5XA 3D2EA 3L2VA 2P9SB 5C0YA 4KV8A 4QS7A 3FZFA 2YHWA 4CE9A 3PO5A 4B3TK 4Z4GA 1SKRA 1S5JA 1FK9A 1T03A 1NKEA 1CZBA 1FKOA 5AQTA 5J2NA 4DR1K 4M41A 1S1XA 1EWRA 1QZ5A 3KK7A 4YFUA 4DFPA 2HHQA 4Q5VA 4PQUA 2Q2RA 3FZLA 1MA9B 3U3YA 3SK3A 1XWLA 3LWMA 3QETA 5LY3A 3WNGA 4Z4CA 1P8ZA 1U6ZA 2I7PA 5BREA 3TU5A 3THYA 1JJ2M 4QAGA 4JS5A 1KAYA 3NH1A 1ZXOA 3VQBA 3LPUA 3VQQA 5ADXH 5AZJB 4DSKA 4BE0A 4CFAA 4JI5K 5DMRA 4WQ5C 1B92A 4M42A 2UXBK 1WLJA 5DM7L 1HQEA 3AVCA 3ZSYA 4NB4A 4KHNA 3WNEA 4B9VA 1EKEA 2W41A 5KTQA 3VGMA 2D0OA 1TKTA 2P5GA 5CZ1A 2V7YA 1K8KB 4B9MA 3HZ6A 1CZAN 4A59A 3E1YA 3CCLN 1BDGA 4WE1A 1BI4B 4E1MA 3AO5A 5C15A 3VA0A 3RWUA 2KKZA 3AO3A 4C23A 1C6VA 3HBTA 3THVA 2YHBA 3TSQA 1A5VA 5GIPA 1F21A 3W3DA 3F73A 3VEOA 2VWBA 1HKBA 1JCEA 3HRGA 1SL2A 3PSIA 4M3ZA 1QTMA 4CJLA 1IBKK 1RBVA 2PZSA 5AQWA 3C95A 3HK2A 3VF4A 5GIOA 3GE1A 1ITGA 2QKBA 4O4GA 2QTDA 3DMJA 3VOVA 4H0OA 1T8EA 3KD1E 4A2BA 3U6FA 4W5NA 1YJWN 4FJKA 4F2RA 4GY2B 3QEWA 2D0AA 2DY4A 4CIGA 3AAQA 4DQSA 1X3NA 1XHXA 4NCBA 1VRUA 5AQGA 3FZMA 1RDAA 4B9UA 1RGIA 4RCHA 1TGOA 4FXDA 2IGIA 4RW4A 4N47A 3NH2A 3ZX0A 5JVHL 5J1EA 4CF0A 3KK3A 3L3UA 4PUOA 2NRRA 4BRLA 3D2EB 4X65K 3DI6A 2RN2A 1RT2A 4YOTA 1VAZA 5I3UA 3MXIA 3RSEA 2G8KA 1DT9A 3B8AX 3FR0A 1T6CA 1LWEA 3SJHA 4B8CA 1TKZA 3A5MC 1K6YA 1YVUA 4H5RA 3PX4A 2AA4A 3TWHA 1Z25A 2Q36A 1HPMA 3EKUA 1Q86O 3SMSA 3AARA 2KFZA 2ASPA 3EEQA 3VQ5A 4FLZA 3H3NO 2ZJRL 2HBMA 1O1WA 3DLKA 4BR9A 5EVZA 3RRHA 2YHYA 3LDNA 3U3GA 3DLLL 2P1JA 4F8RA 4PKHA 3L2QA 4ELVA 4DS4A 3MDQA 3O9TA 1HYVA 4ID1A 3MX5A 1A5XA 4GNIA 3R8EA 3RMBA 3ID8A 1WOQA 1HJOA 3V1OA 2GWKA 3SMPA 1BCMA 4O0IA 1ZBUA 3J7AP 2F4VK 2YNHA 1KSPA 3G25A 4NYNA 2P9PA 2UU9K 2HBKA 3VPZA 4FO0A 3J7YP 3CIPA 4F2SA 4EIAA 2BGGA 2DTUA 4E89A 2GTDA 1NMNA 5AQUA 2E20A 2F9WA 3ZT3A 2P9LA 4C8NA 5LMUK 2YHAA 3O4QA 1TUUA 3VQPA 4LC9B 5F2RA 3ZT2A 1QZ6A 3NF7A 4H5NA 5CE3A 2E2QA 5AZIB 4AHRA 3AVNA 2VGMA 2E5LK 2IDOA 5SWMA 2HNDA 3H6EA 1VQNN 3ZLJA 4MQ3A 1RNHA 3HJFA 3DRPA 4DR5K 4DV7K 3QFUA 4FW1A 4CEAA 2KHOA 5CYMA 2QWQA 5D3GA 4O8UA 1NJXA 2ASMA 3WQTA 4YORA 4CHYA 1C0UA 3PSFA 3I55N 4KHSA 4DU4A 4I7FA 4BROA 4GKKK 3ZETB 1XUPO 2B5JA 4RW9A 4C8MA 2Y1IA 3WXLA 3TANA 1N6QA 1L3VA 2XRIA 3FE1A 5KGWA 3UKRA 3QFPA 4MO4A 2O8BB 3VQ8A 5AQYA 4LFCK 1IH7A 4YOWA 1KVCA 2NRWA 1HYSA 2P9UA 1S3XA 2E4LA 2IVPA 3M8RA 4CJPA 1GLBG 5FLXO 4CJUA 4BACA 3OYFA 1QSYA 1W9HA 2IVNA 3E9OA 4DSFA 3A5LC 1N5YA 3ZSRA 3OYCA 4FWRA 1KCFA 2YCHA 3CQ8A 1RT6A 1X3MA 2GUIA 3HPOA 3IRXA 3IS9A 3ZSXA 1QVGM 3WT0A 3HM9A 3QMLA 2KLAA 3U8XA 3HSCA 4PHTX 3ZSZA 4YNQA 2VQFK 4FK0A 5AQXA 3V1QA 3L2WA 4BR2A 3NBPA 3A2FA 3C65A 4YOYA 1VHXA 1T44A 3SZ2A 3A0IX 3CJ9A 3HSTB 5BR9A 2GX9A 1VSDA 1NJZA 3IDHA 1LV5A 3HI0A 4KTWA 2HF4A 2OYQA 3RRGA 3TSPA 2I5JA 5H1SQ 1TK0A 3T1YK 1IG9A 4BVOA 4B1ZA 1V4SA 3CMAN 1O13A 4K8ZA 2WONA 4LH4A 1U2VA 3ZX2A 3CQXA 4F3TA 1XI1A 2G8FA 3HL8A 1SKWA 1GLAG 4C8LA 2PBDA 3CCRN 2P9KA 1HX1A 2QWOA 2YKMA 4IJNA 4JKAA 4PKGA 3CJCA 4BDPA 1DGKN 1EETA 3AVBA 5CYQA 3OYNA 4CZJA 4DQIA 4FOEA 5JVGL 1RBTA 1YHQN 1XNRK 4KHQA 1JLBA 1X9SA 1D9FA 1LW2A 3MCPA 1NKCA 4CBUA 5JS1A 4OO1J 3CM6A 4A61A 1UA0A 1YIJN 1OH5A 2UXDK 3PLAA 3TAEA 1VSMA 1RBSA 3AVFA 5HP1A 5C24A 4H03B 4CW7B 3VMFB 4DTMA 1WBBA 5DM6L 3BY5A 3AA3A 4CD1A 5AQSA 3PX6A 4NLCA 4KRFA 1WNSA 1EQYA 4X66K 2OCEA 4FJGA 1UWBA 3NF6A 5KGXA 4GV9A 4HUEA 5CZ2A 3CM5A 4UQGA 3S3MA 3HM8A 4QCLA 4KH4A 4DSEA 4GV3A 1H1VA 3O9QA 4IO8A 4NO7A 4BC3A 2FXUA 4LSLA 1IBLK 1W7AA 4FWQA 1VQ7N 3NVKA 2Q1NA 5FPEA 1JLFA 2FSJA 1VQON 3ULEB 3HXMA 4NYFA 1LW0A 1BISA 2B4JA 1YTUA 2Q31A 5J2PA 1WSFA 1Q81O 4J2EA 4FK4A 3LL3A 4DKWA 3FFIA 1RT3A 3V1RA 1IKVA 1DTQA 1KQSM 4NCGA 4JI6K 3MK6A 4IJAA 3TTFA 4E7KA 1QSSA 4B8AB 4CZEA 3LAKA 1ZBHA 3DYAA 4KH5A 1BHLA 1OVQA 5HRPA 3O3HA 4BRAA 4H0VB 2FLOA 3CERA 4MFBA 3L2RA 4LFBK 4EHTA 1SV5A 5M1FA 3LP0A 3ZEUA 3BZKA 3FFKB 3RMDA 1ASWA 2IAJA 3ZEUB 2G8VA 3CD6N 4EAHD 1RDBA 4BC5A 3TAMA 4EHUA 3SPZA 1J6ZA 2Y1JA 3LAMA 3VQCA 4JEPA 3AA2A 3OW2M 3LPTA 3N4PA 4Z4EA 4NCAA 3RMCA 1WSHA 4CVNE 1YF5L 2IIRA 1XMQK 3I8BA 1VSLA 3ZSOA 2GBZA 1HPZA 5HLFA 2HW3A 4B9LA 4H0TB 3OVNA 2OZMA 4M63C 4KAZA 4AH9A 2W40A 2AJQA 3LDQA 3T7ZA 2QM1A 4BRGA 4JI7K 2E8AA 3AVMA 1E4GT 1FXXA 1VQ9N 5J2QA 3ULEA 3SQ0A 5EU7A 3D0PA 4CI6A 4BQZA 3IUCA 3JYTA 2QWMA 1LCUA 4H4MA 4I2QA 4BGBA 1ASVA 2VG5A 3U9ZA 3QO9A 2CGJA 3BP8A 3QDKA 4CHZA 5FPMA 2E1ZA 3B6PA 1ATRA 1Z6RA 3JS6A 5JLHA 2F8SA 1G99A 1X1PA 3QEIA 4KKOA 4K8XA 3TAPA 5BN8A 3E9LA 1RT4A 3P39A 2PAVA 4FJNA 4YOUA 3ZSQA 4J2DA 3F5TA 4DTJA 4H5TA 3CCQN 1HRHA 3TARA 5MLCQ 1C1AA 2NRHA 3VEVA 4DR7K 2P9LB 4E19A 5EY4A 4PY5A 3PUFA 1A5WA 2F9TA 4DV2K 2PYJA 3DOLA 3MWTA 2KZMA 4HTLA 4JAXA 5HRNA 3NH0A 3AY9A 3LDPA 3D7EO 1SKSA 4JKGB 3K5LA 4CZMA 3S3OA 5M1PA 1TKDA 3VN5A 2E6LA 4FVMA 2E1YA 4G1QA 3TR8A 1GLEG 3C6TA 1N36K 1N32K 3DXMB 4YY3K 2P9NA 4I2PA 4J2BA 1NGBA 3OYJA 4DR4K 4CJKA 4G9ZA 4DR2K 3H3OB 4JK8A 3CF5L 3UIQA 4LY7A 3CFPA 1RCHA 2XO7A 2QWRA 3EKSA 3AO4A 5FPNA 1UAXA 3QBWA 2CGKA 4ISEA 4AM7A 1K9MO 3VTHA 1NGGA 4CJTA 4CGDA 3LDSA 1WAJA 1HNWK 4RW7A 4ID5A 4DFJA 2BANA 4DMNA 4KREA 3F9KA 4JRPA 3P83D 3W0LA 1IV0A 5EOYA 1OH6A 2OTLN 2YNGA 3LZIA 4KB0A 2QA4N 3K58A 4OGCA 4N76A 3EE9A 2O8BA 1LAVA 3HYFA 1IKXA 4CFDA 2O8EA 4CGHA 3WXJA 2LSNA 3S9HA 3TPQA 4OX9K 1X9WA 3OS2A 3TABA 5B8HA 3OY9A 3HP6A 3VEZA 5AQQA 1HUXA 4IG0A 4XH4A 1NOYA 3L0QA 3OYLA 2E2OA 4KHWA 4FJLA 3CYMA 4HTUA 4OVLA 1YVNA 4B9NA 1RILA 3LDLA 4N41A 4FW2A 1Z05A 3N4QA 5AZIA 1ZBSA 4B1WB 5AFUH 1JLEA 1ESVA 1V4TA 3CPEA 4CEOA 3RVCA 3MEDA 4BR4A 3V9SA 3VQ4A 1OVYA 4BC4A 3KIOA 2YNIA 1BIUA 2NNWA 3MEEA 3NF8A 5BRDA 3CCUN 3JXUA 1EP4A 4KPYA 4AHTA 1I3AA 3MX2A 1BIZA 4DHYA 3EY1A 1NK6A 3SQ2A 4DTUA 1VK0A 4B9TA 3SUPA 4V19S 1TVRA 3NHGA 1Z26A 4DTRA 1VQ5N 1DTTA 1IKYA 4KI6A 1HR0K 1C0GA 3KD5E 2G8HA 2Q0UA 3ISNC 2ZM6K 3ZSWA 3CJAA 4FYDA 3GL1A 3LWLA 1R0AA 3T19A 3FGUA 5ADXA 4KTZA 5LJVA 4CHNA 5C42A 4FZZA 2OZSA 3TAQA 5J2MA 1UOCA 4BE1A 2I7NA 1L3UA 3AGKA 1NK5A 4HWIA 1BQMA 3MAQA 3MN9A 5C12A 1EX4A 1SL1A 3SAHA 1BO5O 4CZKA 5KRSA 4Y1DA 4EP5A 4MLHA 2BE2A 4M45A 4FWLA 1RTDA 4FWKA 3CCJN 2DFHA 4DFMA 1K8KA 3DLEA 4H0XB 3I8DA 4BRFA 3O80A 1D4XA 4W5RA 2ZGZA 4AILC 3SUQA 3T69A 2BH1A 1HKCA 3LP1A 4CF9A 1GLCG
chains in the Genus database with same CATH topology
1YITN 3DAWA 2P9KB 3VEXA 3SAGA 4B1UB 5GAEP 3P38A 5H1SQ 2NRTA 5KPRA 1Y64A 3C7NB 3CHWA 4IWVA 4B1ZA 4H0PA 1V4SA 4BVOA 1K73O 3CMAN 1GLJO 4A57A 1O13A 1HKGA 4FL9A 4JNEA 4QS8A 1U2VA 3SBGA 3ZX2A 4BRQA 3CQXA 1OKJA 3DJCA 3VF2A 1MWKA 4K41A 4BR5A 3WXIA 1GLAG 3VERA 3O5BA 2HOEA 3KWIA 4RWTA 3CXCM 2PBDA 3CCRN 4B1XB 2P9KA 1HX1A 2QWOA 4IJNA 3BF3A 4B1YB 4R79A 4JKAA 1NM1A 4PKGA 3CJCA 4YDUC 4E1JA 4QS9A 3HTVA 4U67L 1DGKN 5AQMA 3C7NA 5JMVA 4JD2A 3AAPA 1ZC6A 2QW9A 2CH6A 4CZJA 3HOTA 2VCPA 4FOEA 5JVGL 2WFBA 3K9KA 1YHQN 1HLUA 2OANA 3EZWA 4IOAL 2GEMA 4ISFA 4JD2B 3VEWA 1ATNA 3MN5A 1YJ9N 3MCPA 1GLLO 5KPZA 3QB0A 4JHDB 4B1VA 4WQ4A 4CBUA 4OO1J 3EE8A 3CQYA 1MDUB 4ILHA 4A61A 1YIJN 3MWPA 3C0BA 3PLAA 3O1WA 3DXKB 2A41A 4IO9L 1TUYA 4M7XA 1NGFA 4H03B 2RE2A 3TTDA 3VMFB 3NMUA 5LJWA 3CC7N 5DM6L 3CCMN 3VGKA 4CD3A 5CR4A 3L4IA 2QWNA 1N8RO 4XEIA 1BA1A 5AQSA 4CD1A 4NLCA 1RDUA 3VTIA 3TTCA 1NWKA 3PIPL 1EQYA 2DPNA 5BRHA 1VQ8N 3H46O 2QWLA 3GOIA 1XC3A 2NRVA 4GV9A 2V52B 1JCGA 5JICA 4BRIA 3QBXA 4A5AA 5GADP 3VETA 4BG8A 4FSVA 4WQ4C 4BRDA 1NJIO 3HM8A 3O8MA 4NLBA 4FWSA 4KH4A 2FSNA 2E2NA 3G71N 1NMDA 4GV3A 1H1VA 3O9QA 2H3GX 2QXLA 4IO8A 4NO7A 5ELZA 3OBWA 4BC3A 4IOCL 5M1QA 2FXUA 2D0PA 1RDWX 3UB5A 3VGLA 4FWQA 4H5WA 1VQ7N 4H5VA 3NVKA 4MDBA 2Q1NA 4BREA 5FPEA 1VQMN 4IEEA 3GBTA 4DCHA 3ATVA 2NZTA 3UKRB 1E4FT 3L4QA 3FZKA 3NVMA 2FSJA 4CZHA 1VQON 3ULEB 4JKFA 3ATUA 3G4SN 3OBYA 3ZETA 4WFAL 2J4RA 2Q31A 2A5XA 3D2EA 2V51B 3VENA 2P9SB 3CPWM 2A42A 4JKHA 1SQKA 1Q81O 5C0YA 3LL3A 1KAXA 4QS7A 3FZFA 2YHWA 4DKWA 3BUZB 2E2PA 3VF6A 1KQSM 5I9EB 3P4IA 3D6RA 3MK6A 4CBWA 5JLFA 3LDOA 3LM9A 3ENHA 3MN6A 4IJAA 3TTFA 5BPMA 2P9PB 3M3ZA 5AQTA 3CC2N 5AR0A 1QZ5A 3KK7A 4CZEA 4O8KA 4KH5A 1LOTB 1QQOA 3A5NC 2Q2RA 3FZLA 1MA9B 4BRAA 3CC4N 4H0VB 2FLOA 4MLEA 3SK3A 5CHIA 2NRXA 2VYPA 3CERA 3F9MA 2QEXN 4EHTA 5LY3A 5M1FA 4IEIA 3ZEUA 3FFKB 1P8ZA 1U6ZA 2I7PA 5BREA 1BU6O 3TU5A 4JKGA 1JJ2M 1TYQB 3TSUA 4IDHA 3DXKA 3O08A 3O9SA 3ZEUB 2JWLA 3CD6N 2UYTA 1W2BM 1KAYA 3O6WA 4EAHD 3E66A 4H0YB 3S41A 1ZXOA 2WC9A 5AQKA 4BC5A 4EHUA 5ADXH 5AZJB 1J6ZA 4BR0A 3H45C 4GV6A 3PIOL 3EN9A 4JEPA 5TKYA 2YI1A 3OW2M 4WQ5C 4FPAA 4FOIA 3ZYYX 3N4PA 4ILJA 3UKUA 3SAFA 5DM7L 3M1FA 5E26A 1NGJA 3P31A 1YF5L 2IIRA 1SZ2A 3I8BA 4NB4A 2W41A 5AQOA 3R3LA 3OHRA 3VGMA 4H0TB 1VQLN 3CMEN 2D0OA 3OA9A 1SAZA 1NBWA 2F7TA 2V7YA 2W40A 3M6GA 3QICA 3LDQA 4FWMA 4FPBA 4M63C 3T7ZA 1K8KB 2QM1A 1BA0A 3HZ6A 4EFHA 1CZAN 4FWOA 4A59A 3E1YA 4FWPA 1BDGA 3CCLN 2P9SA 4BRGA 3MN7A 2NRZA 2E8AA 2Q97A 5GINA 3ENBA 1ATSA 1E4GT 3L6QA 3CJBA 1VQ9N 2HSTA 5C15A 3ULEA 5AQZA 2KKZA 4C23A 3HBTA 3TSQA 4CI6A 4DQ8A 4BQZA 4JKBA 3IUCA 5GIPA 2QWMA 1LCUA 3ENOA 3H1VX 3W3DA 3VEOA 4BRPA 2VWBA 4BGBA 4JKCA 3U9ZA 1HKBA 1JCEA 3HRGA 3M5RA 2Q0RA 4IOXA 2CGJA 3BP8A 3QDKA 5KQ8A 5FPMA 4WFNL 3DWLA 2E1ZA 3CCEN 2HBJA 5AQWA 1ATRA 1Z6RA 3JS6A 4XH1A 3VF4A 5JLHA 5GIOA 3GE1A 4CZLA 1M90O 3E9PA 1G99A 2QTDA 1YJNN 3HOSA 2ITMA 4M7YA 3VOVA 2FF6A 4WCEL 5BN8A 1NGAA 4H0OA 3E9LA 1TYQA 2RHKA 3P39A 4A2BA 4U7BA 4L3QA 2PAVA 4FVUA 1KAZA 2ZWHA 1YJWN 4A2AA 4YOUA 4GY2B 3WEEB 4CJ7A 4BQLA 3AAQA 3F5TA 4H5TA 4IFEA 1VQPN 3CCQN 1X3NA 4JK7A 5MLCQ 2NRHA 4J8FA 1JCFA 3VEVA 4I6MB 2P9LB 5AQGA 5M1OA 3FZMA 5EY4A 5AQFA 2CH5A 4BRCA 5KQDA 4UY8O 1BOTO 1RGIA 4RCHA 1C0FA 2F9TA 3MWTA 1P90A 1YUWA 5AQHA 4HTLA 4JAXA 5AQJA 2A40A 5HL7L 3ZX0A 5JVHL 1QHAA 3AY9A 2NRRA 3R9PA 4BRLA 3LDPA 3D2EB 3D7EO 2NLXA 2E88A 2GUPA 4JKGB 4BRMA 3CCSN 4CZMA 5EX5A 5M1PA 4CZGA 4YOTA 1VAZA 3F2KA 3RSEA 3Q7BA 1DT9A 3KWGA 3B8AX 1IJJA 3CI5A 3Q7CA 3FR0A 2E1YA 3J8AA 1NLVA 1T6CA 3SJHA 2QWPA 4YOVA 1GLEG 3A5MC 1GLFO 1K8AO 3DXMB 4DB3A 5F0XA 4BY9C 4H5RA 1KXPA 2P9NA 2AA4A 5C10A 3A8YA 2YJEA 2Q36A 1HPMA 1NGBA 3EKUA 1Q86O 3SMSA 4G9ZA 3UKUB 3AARA 4YOXA 4MO5A 1GLDG 4BRKA 3H3OB 1T6DA 4JKDA 4JK8A 2ASPA 2IVOA 3CF5L 1X9JA 3H3NO 3IFRA 2ZJRL 2HBMA 1NGHA 2QWRA 2ZGYA 1U2VB 3EKSA 5EVZA 3WXMB 3CJ1A 2YHYA 3LDNA 4BR9A 1VQ4N 3O9RA 4CZFA 5FPNA 5AQRA 3QBWA 2CGKA 4ISEA 3DLLL 3EO3A 4AM7A 4PKHA 1K9MO 5EXWA 3VTHA 1ILYA 2P9UB 1NGGA 3MDQA 3O9TA 4C1NK 3GG4A 2HF3A 3GDQA 3MMVA 3MX5A 4JHDA 4GNIA 3R8EA 3ID8A 1WOQA 1HJOA 2GWKA 5AQLA 4CZIA 4K42A 3SMPA 5BRFA 3W0LA 1VQKN 1MWMA 5EOYA 1SS6A 3I33A 2FSKA 2HMPA 3ID6A 4BGAA 2OTLN 1DEJA 2HBLA 1NGEA 2QA4N 1IG8A 1QQMA 3EE9A 3SBTA 3G25A 1M1KO 2P9PA 2HBKA 3VPZA 4FO0A 4K25A 3CIPA 1NGDA 1RFQA 4MDAA 5BN9A 3WEEA 1Q18A 3BF1A 4EIAA 4F9OA 2GTDA 3WXJA 3TPQA 5AQUA 2E20A 2F9WA 5GAHP 1S22A 5AQIA 3MCAB 4WQ5A 3A5OC 2P9LA 1Q82O 1BUPA 3VEYA 5B8HA 3K9JA 3SLCA 3VEZA 5AQQA 5AFUA 1BWFO 1HUXA 1QVFM 1TUUA 3O1BA 4XH5A 4XH4A 2BUPA 4LC9B 5F2RA 4PL7A 1QZ6A 4H5NA 3L0QA 5CE3A 2E2QA 5AZIB 3BEXA 1T3VA 2E2OA 3J7ZO 2VGMA 2D4WA 4PL8A 5TKWA 5HOOA 3CCVN 3H6EA 2FF3B 1YVNA 4A5BA 1VQNN 2BTFA 3LDLA 5AQNA 1Z05A 3N4QA 5AZIA 1ZBSA 3IKMA 4B1WB 4KBOA 3QFUA 2KHOA 3KHYA 2QWQA 4O5FA 4RTFD 5AFUH 1ESVA 4O8UA 4JN4A 2ASMA 4FWNA 1V4TA 4KH6A 3CPEA 4IXCA 4Y0WA 5E84A 3WQTA 4YORA 4A62A 3RVCA 4K43A 1XQSC 5C2DA 3I55N 1KD1O 1YAGA 3WQUA 5F1XA 2P9NB 4BR4A 1BG3A 4BROA 2EWSA 3ZETB 1XUPO 2WUSA 3CJ7A 1OVYA 2ZJPL 4BC4A 3WXLA 3R6MA 3U4LA 2NNWA 5BRDA 3CCUN 5AQVA 3FE1A 3JXUA 3O9UA 3UKRA 4BRNA 4WFBL 3I56N 3QFPA 4MO4A 5AQYA 3MX2A 3DXMA 4JKEA 4CBXA 4C1NI 4DHYA 5M1KA 4YOWA 5C2FA 2A6AA 3G6EN 2GELA 3IMXA 2NRWA 2P9UA 3LM2A 1S3XA 1KC8O 2IVPA 4OPHA 4Z94A 2WBNA 1GLBG 4WF9L 4BC2A 1VQ5N 2QI2A 2ASOA 5M1NA 5AQPA 4WYBA 3KVGA 1DKGD 3O4WA 3U9DA 2ZF5O 2IVNA 3FZHA 2JWKA 1C0GA 3E9OA 3WUHA 2Q0UA 4BG9A 1YI2N 3AGRA 3KZBA 4AM6A 3CJAA 3A5LC 3C6HA 4FWRA 2YCHA 1EO1A 3GL1A 2P9IA 1X3MA 3FGUA 5ADXA 5LJVA 4BR7A 3R1XA 4I6MA 1W97L 2YJFA 4BVPA 4YDUA 1QVGM 2AP1A 2A3ZA 3WT0A 2P9IB 2YX6A 2VGNA 4JK9A 3QMLA 2KLAA 3U8XA 1YXQA 2I7NA 3HSCA 4B9QA 4PHTX 3UE5A 1VQ6N 5AQXA 3AGKA 3VESA 4BR2A 1QQNA 4ISGA 1NGCA 4HWIA 3C65A 3EL2A 4IZ9A 4YOYA 1NGIA 2PFUA 3MN9A 4BRHA 5C12A 1T44A 3A0IX 4AF1A 3FLCO 4OPAA 3SAHA 1R59O 2CGLA 1BO5O 3CJ9A 4CZKA 2ZJQL 1S72N 3ZX3A 4PKIA 3WXKA 5BR9A 2GX9A 3D2FB 4MLHA 5AZJA 5BPLA 4FWLA 2YHXA 3IDHA 5BPNA 5FPDA 4FWKA 5GAGP 4ILGB 2GWJA 3CCJN 5KPTA 2OTJN 1K8KA 4GVEA 4H0XB 3RSEB 4BRFA 3HI0A 3O80A 1D4XA 3CETA 1Q7YO 2ZGZA 2HF4A 2V7ZA 3D2FA 1HKCA 1WUAA 2BH1A 3H1QA 1GLCG 3C6AA 3T69A 3TSPA 2D1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAW A;  2P9K B;  3VEX A;  4B1U B;  5KPR A;  1Y64 A;  3C7N B;  3CHW A;  4IWV A;  4B1Z A;  4H0P A;  1V4S A;  4BVO A;  1GLJ O;  1HKG A;  4FL9 A;  4JNE A;  4QS8 A;  1U2V A;  3ZX2 A;  4BRQ A;  3CQX A;  1OKJ A;  3DJC A;  3VF2 A;  1MWK A;  4K41 A;  4BR5 A;  3WXI A;  1GLA G;  3VER A;  3O5B A;  2HOE A;  4RWT A;  2PBD A;  4B1X B;  2P9K A;  1HX1 A;  2QWO A;  4IJN A;  3BF3 A;  4B1Y B;  4PKG A;  1NM1 A;  3CJC A;  4YDU C;  4E1J A;  4QS9 A;  3HTV A;  1DGK N;  5AQM A;  3C7N A;  5JMV A;  4JD2 A;  3AAP A;  1ZC6 A;  2QW9 A;  2CH6 A;  4CZJ A;  2VCP A;  4FOE A;  1HLU A;  2OAN A;  3EZW A;  2GEM A;  4ISF A;  4JD2 B;  3VEW A;  1ATN A;  3MN5 A;  3MCP A;  1GLL O;  5KPZ A;  3QB0 A;  4JHD B;  4B1V A;  4WQ4 A;  4CBU A;  3CQY A;  1MDU B;  4A61 A;  3C0B A;  3O1W A;  3DXK B;  2A41 A;  1TUY A;  4M7X A;  1NGF A;  4H03 B;  5LJW A;  3VGK A;  4CD3 A;  3L4I A;  2QWN A;  4XEI A;  1BA1 A;  5AQS A;  4CD1 A;  1NWK A;  1EQY A;  2DPN A;  5BRH A;  3H46 O;  2QWL A;  3GOI A;  1XC3 A;  2V52 B;  1JCG A;  5JIC A;  4BRI A;  3QBX A;  3VET A;  4BG8 A;  4FSV A;  4WQ4 C;  4BRD A;  3HM8 A;  3O8M A;  4FWS A;  2FSN A;  2E2N A;  1NMD A;  1H1V A;  2H3G X;  2QXL A;  4IO8 A;  4NO7 A;  5ELZ A;  4BC3 A;  2FXU A;  2D0P A;  1RDW X;  3UB5 A;  3VGL A;  4FWQ A;  4H5W A;  4H5V A;  2Q1N A;  4BRE A;  5FPE A;  3GBT A;  4DCH A;  3ATV A;  2NZT A;  3UKR B;  1E4F T;  3FZK A;  2FSJ A;  4CZH A;  3ULE B;  3ATU A;  3ZET A;  2J4R A;  2Q31 A;  2A5X A;  3D2E A;  2V51 B;  3VEN A;  2P9S B;  2A42 A;  1SQK A;  3LL3 A;  1KAX A;  4QS7 A;  3FZF A;  2YHW A;  3BUZ B;  2E2P A;  3VF6 A;  5I9E B;  3P4I A;  3MK6 A;  4CBW A;  5JLF A;  3LDO A;  3LM9 A;  3ENH A;  3MN6 A;  4IJA A;  5BPM A;  2P9P B;  3M3Z A;  5AQT A;  5AR0 A;  1QZ5 A;  4CZE A;  4O8K A;  1LOT B;  1QQO A;  3A5N C;  2Q2R A;  3FZL A;  1MA9 B;  4BRA A;  4H0V B;  2FLO A;  4MLE A;  3SK3 A;  2VYP A;  3CER A;  3F9M A;  4EHT A;  5LY3 A;  3ZEU A;  3FFK B;  1P8Z A;  1U6Z A;  2I7P A;  5BRE A;  1BU6 O;  3TU5 A;  1TYQ B;  3DXK A;  3O08 A;  3ZEU B;  2UYT A;  1KAY A;  3O6W A;  4EAH D;  4H0Y B;  3S41 A;  1ZXO A;  4BC5 A;  5AQK A;  4EHU A;  5ADX H;  5AZJ B;  1J6Z A;  4BR0 A;  3H45 C;  3EN9 A;  5TKY A;  2YI1 A;  4WQ5 C;  4FPA A;  4FOI A;  3UKU A;  3M1F A;  5E26 A;  1NGJ A;  2IIR A;  1SZ2 A;  3I8B A;  4NB4 A;  2W41 A;  5AQO A;  3OHR A;  3VGM A;  4H0T B;  2D0O A;  1SAZ A;  1NBW A;  3QIC A;  2V7Y A;  2W40 A;  3M6G A;  4FWM A;  3LDQ A;  4FPB A;  4M63 C;  1K8K B;  2QM1 A;  1BA0 A;  3HZ6 A;  4EFH A;  1CZA N;  4FWO A;  4FWP A;  1BDG A;  2P9S A;  4BRG A;  3MN7 A;  2E8A A;  2Q97 A;  1ATS A;  1E4G T;  3L6Q A;  3CJB A;  3ULE A;  5AQZ A;  4C23 A;  3HBT A;  4CI6 A;  4DQ8 A;  4BQZ A;  3IUC A;  2QWM A;  1LCU A;  3ENO A;  3H1V X;  3W3D A;  3VEO A;  4BRP A;  2VWB A;  4BGB A;  3U9Z A;  1HKB A;  1JCE A;  2Q0R A;  2CGJ A;  3BP8 A;  3QDK A;  5KQ8 A;  5FPM A;  3DWL A;  2E1Z A;  5AQW A;  1ATR A;  1Z6R A;  3JS6 A;  4XH1 A;  3VF4 A;  5JLH A;  3GE1 A;  4CZL A;  1G99 A;  2ITM A;  4M7Y A;  3VOV A;  2FF6 A;  5BN8 A;  1NGA A;  4H0O A;  1TYQ A;  4A2B A;  4L3Q A;  2PAV A;  1KAZ A;  2ZWH A;  4A2A A;  4GY2 B;  3WEE B;  4CJ7 A;  4BQL A;  3AAQ A;  4H5T A;  1X3N A;  2NRH A;  4J8F A;  1JCF A;  3VEV A;  4I6M B;  2P9L B;  5AQG A;  5KQD A;  3FZM A;  5EY4 A;  5AQF A;  2CH5 A;  4BRC A;  1BOT O;  1RGI A;  4RCH A;  1C0F A;  2F9T A;  1YUW A;  5AQH A;  4HTL A;  4JAX A;  5AQJ A;  2A40 A;  3ZX0 A;  1QHA A;  3AY9 A;  3R9P A;  4BRL A;  3LDP A;  3D2E B;  3D7E O;  2NLX A;  2E88 A;  2GUP A;  4BRM A;  4CZM A;  5EX5 A;  4CZG A;  3RSE A;  3B8A X;  1IJJ A;  3CI5 A;  3FR0 A;  2E1Y A;  3J8A A;  1NLV A;  1T6C A;  3SJH A;  2QWP A;  1GLE G;  3A5M C;  1GLF O;  3DXM B;  4DB3 A;  5F0X A;  4H5R A;  1KXP A;  2P9N A;  2AA4 A;  3A8Y A;  2YJE A;  2Q36 A;  1HPM A;  1NGB A;  3EKU A;  3SMS A;  3UKU B;  3AAR A;  4MO5 A;  1GLD G;  4BRK A;  3H3O B;  1T6D A;  2ASP A;  2IVO A;  1X9J A;  3H3N O;  3IFR A;  1NGH A;  2QWR A;  2ZGY A;  1U2V B;  3EKS A;  5EVZ A;  4BR9 A;  3CJ1 A;  2YHY A;  3LDN A;  4CZF A;  5FPN A;  5AQR A;  3QBW A;  2CGK A;  4ISE A;  3EO3 A;  4AM7 A;  4PKH A;  5EXW A;  2P9U B;  1NGG A;  3MDQ A;  3GG4 A;  2HF3 A;  3GDQ A;  3MMV A;  4JHD A;  4GNI A;  3R8E A;  3ID8 A;  1WOQ A;  1HJO A;  2GWK A;  5AQL A;  4CZI A;  4K42 A;  3SMP A;  5BRF A;  3W0L A;  1MWM A;  5EOY A;  3I33 A;  2FSK A;  2HMP A;  4BGA A;  1DEJ A;  1NGE A;  1IG8 A;  1QQM A;  3G25 A;  2P9P A;  3VPZ A;  4FO0 A;  4K25 A;  3CIP A;  1NGD A;  1RFQ A;  5BN9 A;  3WEE A;  1Q18 A;  3BF1 A;  4EIA A;  4F9O A;  2GTD A;  3WXJ A;  3TPQ A;  5AQU A;  2E20 A;  2F9W A;  1S22 A;  5AQI A;  4WQ5 A;  3A5O C;  2P9L A;  1BUP A;  3VEY A;  5B8H A;  3SLC A;  3VEZ A;  5AQQ A;  5AFU A;  1BWF O;  1HUX A;  1TUU A;  3O1B A;  4XH5 A;  4XH4 A;  2BUP A;  4LC9 B;  5F2R A;  4PL7 A;  1QZ6 A;  4H5N A;  3L0Q A;  5CE3 A;  2E2Q A;  5AZI B;  3BEX A;  2E2O A;  2D4W A;  4PL8 A;  3H6E A;  2FF3 B;  1YVN A;  2BTF A;  3LDL A;  5AQN A;  1Z05 A;  5AZI A;  1ZBS A;  4B1W B;  4KBO A;  3QFU A;  2KHO A;  3KHY A;  2QWQ A;  4O5F A;  4RTF D;  5AFU H;  1ESV A;  4JN4 A;  2ASM A;  4FWN A;  1V4T A;  4Y0W A;  4IXC A;  5E84 A;  3WQT A;  4A62 A;  4K43 A;  1XQS C;  1YAG A;  3WQU A;  5F1X A;  2P9N B;  4BR4 A;  1BG3 A;  4BRO A;  2EWS A;  3ZET B;  1XUP O;  2WUS A;  3CJ7 A;  4BC4 A;  3WXL A;  3R6M A;  3U4L A;  5BRD A;  5AQV A;  3JXU A;  3FE1 A;  3UKR A;  4BRN A;  3QFP A;  4MO4 A;  5AQY A;  3DXM A;  4CBX A;  4DHY A;  2A6A A;  2GEL A;  3IMX A;  2P9U A;  3LM2 A;  1S3X A;  2IVP A;  4Z94 A;  1GLB G;  4BC2 A;  2ASO A;  5AQP A;  4WYB A;  3KVG A;  1DKG D;  3O4W A;  3U9D A;  2ZF5 O;  2IVN A;  3FZH A;  1C0G A;  3WUH A;  2Q0U A;  4BG9 A;  3KZB A;  4AM6 A;  3CJA A;  3A5L C;  4FWR A;  2YCH A;  3GL1 A;  2P9I A;  1X3M A;  3FGU A;  5ADX A;  5LJV A;  4BR7 A;  4I6M A;  4BVP A;  2YJF A;  4YDU A;  2AP1 A;  2A3Z A;  3WT0 A;  2P9I B;  3QML A;  3U8X A;  1YXQ A;  2I7N A;  3HSC A;  4B9Q A;  3UE5 A;  5AQX A;  3VES A;  4BR2 A;  1QQN A;  4ISG A;  1NGC A;  4HWI A;  3EL2 A;  4IZ9 A;  1NGI A;  4BRH A;  3MN9 A;  1T44 A;  3A0I X;  3FLC O;  1R59 O;  2CGL A;  1BO5 O;  3CJ9 A;  4CZK A;  3ZX3 A;  4PKI A;  3WXK A;  5BR9 A;  3D2F B;  4MLH A;  5AZJ A;  5BPL A;  4FWL A;  2YHX A;  3IDH A;  5BPN A;  5FPD A;  4FWK A;  2GWJ A;  5KPT A;  1K8K A;  4H0X B;  3RSE B;  4BRF A;  3HI0 A;  3O80 A;  1D4X A;  3CET A;  2ZGZ A;  2HF4 A;  2V7Z A;  3H1Q A;  3D2F A;  1HKC A;  1WUA A;  1GLC G;  2D1K A; 
#chains in the Genus database with same CATH topology
 1EWQ A;  1XC9 A;  2HHU A;  1ZBF A;  1CXU A;  1HNI A;  3J81 O;  1JXB A;  5GAE P;  4FJ8 A;  1Q9Y A;  1CZ9 A;  1J54 A;  1NK4 A;  1OH8 A;  2NRT A;  5K14 A;  4I9L A;  2F96 A;  1GLJ O;  4A57 A;  4FL9 A;  4CHQ A;  4EZ9 A;  1E3M A;  3M8P A;  4BRQ A;  3DLB A;  4OPJ A;  5KRT A;  3SUN A;  3KWI A;  4E0D A;  4B1X B;  4EZ6 A;  3BF3 A;  4B1Y B;  4W5T A;  4ZHR A;  1NM1 A;  4DR6 K;  4JYA K;  2P5O A;  3HPG A;  3HOT A;  2WFB A;  3K9K A;  1HLU A;  4IOA L;  4DV3 K;  2GEM A;  4ISF A;  3RMA A;  3VEW A;  3OYA A;  4LF6 K;  3NGZ A;  1FW6 A;  2JGU A;  1LAW A;  1VSK A;  2Z1H A;  4WQ4 A;  4DV6 K;  4Z0U A;  4RW6 A;  2ZQB A;  4DS5 A;  2RF2 A;  3C0B A;  3NGY A;  2VWK A;  5CY4 A;  2RE2 A;  3TTD A;  3QIN A;  1C0M A;  1N8R O;  4DLG A;  1REV A;  4XEI A;  1BA1 A;  3TTC A;  2DPN A;  1VQ8 N;  4JS4 A;  3SI6 A;  1XC3 A;  4IBN A;  4DTO A;  4O5B A;  2VWJ A;  4A5A A;  4BG8 A;  4WQ4 C;  4OKE A;  4NLB A;  2UUA K;  4FWS A;  1QQC A;  3G71 N;  3V9X A;  5LL6 Z;  2QXL A;  2ATQ A;  5ELZ A;  3OBW A;  4GMJ B;  5FRO A;  3KLF A;  4IOC L;  4FLW A;  4ELT A;  3VGL A;  3UB5 A;  4FLT A;  1VQM N;  1FJG K;  2OA8 A;  4IEE A;  4RG8 A;  4IFY A;  4DCH A;  3ATV A;  3THW A;  3BZC A;  3KTQ A;  4B3S K;  3LP2 A;  3ATU A;  3OBY A;  4WFA L;  5HRS A;  3CPW M;  2V51 B;  3VEN A;  1KRP A;  1RTJ A;  4CJF A;  2NUB A;  1RBU A;  3BUZ B;  3VF6 A;  4AHV A;  5I9E B;  4LF4 K;  3MXM A;  3DLH A;  3D6R A;  4CBW A;  3LP3 A;  3SUO A;  3LDO A;  3LM9 A;  3ENH A;  3O3G A;  3TAG A;  3T1H K;  3V81 A;  2P9P B;  3M3Z A;  4RW8 A;  5AR0 A;  3E01 A;  4CGF A;  4O8K A;  4DLE A;  1Y97 A;  3BDP A;  3A5N C;  3CC4 N;  2X6S A;  3ZCM A;  5CHI A;  2KW4 A;  2VYP A;  4BE2 A;  3F9M A;  4GW6 A;  2QEX N;  3AVI A;  1OH7 A;  2A1R A;  1BU6 O;  4DSL A;  3TSU A;  4IDH A;  1RDC A;  3O08 A;  3O9S A;  2JWL A;  4BDY A;  2UYT A;  3THX A;  2QXF A;  3O6W A;  3E66 A;  4H0Y B;  2XY5 A;  3S41 A;  1IO2 A;  2WC9 A;  5AQK A;  3QNN A;  3CFO A;  3H45 C;  4GV6 A;  3PIO L;  4JI2 K;  3EN9 A;  3OTO K;  1Q9X A;  4FPA A;  1N33 K;  4FOI A;  2UUC K;  4JLH A;  1DLO A;  5E26 A;  1NGJ A;  3P31 A;  4DQP A;  2HHH K;  4KI4 A;  3ULD A;  5AQO A;  3OHR A;  1VQL N;  3CME N;  1SAZ A;  3QIO A;  3QIC A;  3M6G A;  1BA0 A;  4EFH A;  4FWO A;  1KLM A;  4FWP A;  2P9S A;  3MN7 A;  2Q97 A;  4LH5 A;  4FJX A;  3OJU A;  2BDP A;  1ATS A;  3HVT A;  3CJB A;  2HST A;  1B9D A;  4KO0 A;  5AQZ A;  3M8S A;  4Z4H A;  4ZTF A;  3HO1 A;  2FC0 A;  4FJH A;  1KFS A;  3K5O A;  3AVA A;  4M3U A;  3H1V X;  1S1V A;  4CEE A;  4JKC A;  2Q0R A;  5KQ8 A;  2HBJ A;  2ZE2 A;  4M3Y A;  1M90 O;  3E9P A;  1YJN N;  3HOS A;  1UA1 A;  4C8K A;  4M7Y A;  1NGA A;  3JSM A;  4U7B A;  2HNZ A;  4L3Q A;  4KB1 A;  1KAZ A;  2ZWH A;  4OPK A;  4A2A A;  3AA5 X;  4IFV A;  3NGI A;  3WEE B;  1VQP N;  4BQL A;  4IFE A;  4J2A A;  4CES A;  5KQD A;  5M1O A;  4UY8 O;  4BRC A;  5AQF A;  2CH5 A;  4L8R B;  1P90 A;  3DLG A;  5AQH A;  5HL7 L;  2A40 A;  1TV6 A;  1T7P A;  3SJJ A;  3MEC A;  3R9P A;  1KTQ A;  2E88 A;  4BRM A;  3CCS N;  5EX5 A;  3F2K A;  3Q7B A;  4CIF A;  3KWG A;  1BCO A;  3J8A A;  1NLV A;  2QWP A;  4LF5 K;  4FJJ A;  4CEF A;  4DB3 A;  1KXP A;  4LSN A;  1ASU A;  5C10 A;  4IKF A;  4KFB A;  4DTS A;  2O8C B;  2HVH A;  4BRK A;  4IDK A;  4FLY A;  4JKD A;  4E7H A;  2XY8 A;  4B3R K;  4N56 A;  2ZGY A;  1JKH A;  2RPI A;  4YHH K;  3CJ1 A;  1VQ4 N;  3O9R A;  4CZF A;  2G8I A;  3QIP A;  1U47 A;  3EO3 A;  1N34 K;  2X78 A;  3P5J A;  4DV1 K;  1ILY A;  2P9U B;  4CJE A;  3GG4 A;  2HF3 A;  1D8Y A;  3VQ9 A;  3KKS A;  1WAF A;  4HCB A;  2EX3 A;  4M3R A;  3HP9 A;  5AQL A;  4CZI A;  1U48 A;  5BRF A;  4LFA K;  2Q3S A;  1SS6 A;  5FRN A;  2FSK A;  2HMP A;  4X62 K;  3ID6 A;  4BGA A;  2HBL A;  4DSJ A;  2O8E B;  4DF8 A;  2IC3 A;  2O4I A;  4KHP K;  4K25 A;  2F8T A;  1JL2 A;  1RFQ A;  4MDA A;  4B3M K;  5BN9 A;  1ZBI A;  2O8F A;  4OLB A;  5GAH P;  1S22 A;  4KHY A;  5AQI A;  4WQ5 A;  1YTA A;  4CHO A;  3VEY A;  2YKN A;  3K9J A;  3SLC A;  1QVF M;  1HQU A;  3O1B A;  3T3F A;  4XH5 A;  4PL7 A;  3RR8 A;  4H4O A;  4CJ5 A;  3BEX A;  1T3V A;  3VQA A;  4AHC A;  3OYI A;  4I9Q A;  5TKW A;  4CEQ A;  4CEZ A;  5HOO A;  2FF3 B;  2BTF A;  4KBO A;  2QK9 A;  4O5F A;  2XY6 A;  2G8U A;  4M3T A;  4JN4 A;  1S1T A;  4JI0 K;  4FWN A;  4KH6 A;  4DQQ A;  1NJY A;  3QLH A;  4CJQ A;  4A62 A;  1XQS C;  3WQU A;  2P9N B;  3ITH A;  4FM1 A;  4C8O A;  3KJV A;  1J9A A;  3CJ7 A;  4JV5 K;  1S6Q A;  1WSJ A;  5AQV A;  3I56 N;  4DQR A;  5BR8 K;  4WFB L;  3SCX A;  1D9D A;  1J53 A;  4JKE A;  3CFR A;  3LM2 A;  4BC2 A;  2Z1G A;  2QI2 A;  5A2Q O;  4WYB A;  4N5S A;  4FJ9 A;  4NXM K;  3O4W A;  3RTV A;  1KLN A;  1J5O A;  3FZH A;  2JWK A;  3KLH A;  3WUH A;  4OLA A;  2W6L A;  1RTI A;  4BG9 A;  3AGR A;  1WBD A;  3KLG A;  4Y1C A;  3NDK A;  3C6H A;  3I0S A;  3S3N A;  1EO1 A;  2P9I A;  1VSJ A;  4I6M A;  1S9G A;  4BVP A;  2YJF A;  1NOZ A;  1RT1 A;  3NFA A;  4YDU A;  4HUF A;  4HVJ A;  2P9I B;  4H8K A;  2VGN A;  4DSI A;  3UE5 A;  1HNX K;  1NGC A;  1GOC A;  4IZ9 A;  1JLC A;  4DU3 A;  2PFU A;  4BRH A;  2Z1I A;  4FJ7 A;  4OPA A;  1R59 O;  3EZ5 A;  2ZJQ L;  5T7B A;  4PKI A;  2JLE A;  3V6D A;  4ICL A;  5BPL A;  2YHX A;  2GWJ A;  3ZT4 A;  1T05 A;  4GVE A;  3RSE B;  3SQ1 A;  1IBM K;  2G8W A;  1MU2 A;  3OYG A;  3D2F A;  1WUA A;  3J7Z O;  4CF8 A;  2W42 A;  1VSF A;  4FJ5 A;  3VEX A;  3SAG A;  1KVA A;  4CF2 A;  3SNN A;  4LF7 K;  2DFE A;  2HHT A;  2O8C A;  1Y64 A;  3C7N B;  1K73 O;  2D0B A;  4DFK A;  4CJ3 A;  1HKG A;  4JNE A;  4QS8 A;  1HMV A;  3SBG A;  2OPP A;  1OKJ A;  3VF2 A;  1MWK A;  3AVH A;  4K41 A;  4BR5 A;  3WXI A;  2R7Y A;  3VER A;  2HOE A;  1HNZ K;  1WSI A;  1WSG A;  1RTH A;  2PYL A;  3J80 O;  4YDU C;  2XY7 A;  4E1J A;  4U67 L;  2WTU A;  1SL0 A;  3MXJ A;  4JD2 A;  4HCC A;  2CH6 A;  4OGE A;  2E6M A;  2OAN A;  1TK8 A;  1GOA A;  4JD2 B;  1ATN A;  3MN5 A;  1YJ9 N;  3K2P A;  3LAN A;  5KPZ A;  4B1V A;  1XMO K;  3EE8 A;  1TL3 A;  1MDU B;  2KFN A;  3MWP A;  5KI6 A;  4CK2 A;  3DXK B;  3M8Q A;  4IO9 L;  1TUY A;  4CFC A;  3NMU A;  1CXQ A;  5LJW A;  2HB5 A;  3CCM N;  1JXE A;  3L4I A;  1QE1 A;  1RDU A;  2YV0 X;  1NWK A;  4DV5 K;  3VQ7 A;  1S6P A;  4CK1 A;  5JIC A;  3QBX A;  3NAE A;  3AA4 A;  4CGG A;  1NJI O;  4FSV A;  3O8M A;  4TSX A;  5HBM A;  4DTX A;  2FSN A;  4B9S A;  4DUZ K;  1QS4 A;  3QER A;  2H3G X;  1WSE A;  1RDD A;  2O8D B;  2D0P A;  4XIU A;  4H5W A;  3OYM A;  4H5V A;  4MDB A;  4BRE A;  2OPR A;  1HNV A;  2FBV A;  3FZK A;  1NK0 A;  4Z4F A;  2O4G A;  3G4S N;  4OJR A;  3KK2 A;  2A42 A;  4JKH A;  1SQK A;  4FJI A;  4Z4I A;  2QKK A;  1KAX A;  1U04 A;  3O4N A;  3V9Z A;  2E2P A;  4CJS A;  1U49 A;  1KFD A;  3P4I A;  3KLI A;  5JLF A;  3ZSV A;  3G10 A;  4NXN K;  3MN6 A;  5BPM A;  2XHB A;  3CC2 N;  1RT7 A;  1NK7 A;  3C94 A;  4JI4 K;  4OKK A;  3OYD A;  3ZT1 A;  1LOT B;  1QQO A;  4DF4 A;  1L5U A;  3NF9 A;  4CFB A;  4E7L A;  4MLE A;  1XNQ K;  3QES A;  2NRX A;  4LF8 K;  4FM0 A;  3K57 A;  4R5P A;  4IEI A;  2D0C A;  2HMI A;  4JKG A;  3QEV A;  4FK2 A;  1TYQ B;  1S1U A;  3G0Z A;  1EXQ A;  3DXK A;  4DV0 K;  3IG1 A;  1W2B M;  3K5N A;  3PO4 A;  3AO1 A;  3IAY A;  1X9M A;  3OS0 A;  4BR0 A;  3MEG A;  4LF9 K;  4CED A;  4CGJ A;  5TKY A;  2HNY A;  2X74 A;  2YI1 A;  1ZYQ A;  2OPQ A;  3ZYY X;  4ILJ A;  3UKU A;  4CJ4 A;  3SAF A;  4AQY K;  1TKX A;  3NE6 A;  4DUY K;  3M1F A;  4CEC A;  3KKR A;  1SZ2 A;  3P1G A;  5C25 A;  3R3L A;  3L3V A;  4CJW A;  2IOC A;  2FBT A;  3DOK A;  3OA9 A;  2UXC K;  3THW B;  3I0R A;  1QHT A;  1NBW A;  2F7T A;  4FPB A;  4FWM A;  3V9U A;  1HJR A;  3VA3 A;  5GIN A;  2NRZ A;  1C1B A;  3ENB A;  3L6Q A;  1I39 A;  4OKJ A;  1JLA A;  4DQ8 A;  4JKB A;  1ZBL A;  3ENO A;  1VSI A;  4BRP A;  2UUB K;  4KHU A;  3M5R A;  4IG3 A;  4IOX A;  2EHG A;  4WFN L;  3DWL A;  3CCE N;  4XH1 A;  4CZL A;  3CG7 A;  5LMN K;  4LD0 A;  4PA1 A;  2ITM A;  1TL1 A;  2FF6 A;  4WCE L;  3OJS A;  1TYQ A;  2RHK A;  4FVU A;  2HHW A;  3ASM A;  4CJ7 A;  1GOB A;  3K0S A;  4JK7 A;  4J8F A;  1JCF A;  4I6M B;  1NU0 A;  1NKB A;  1JLG A;  1BOT O;  3PY8 A;  1C0F A;  3SYZ A;  1YUW A;  5AQJ A;  2X6N A;  1QHA A;  1Q8I A;  1VRT A;  1YT3 A;  1S1W A;  2NLX A;  4DV4 K;  4CJR A;  2GUP A;  1BL3 A;  3RR7 A;  1C1C A;  2WOM A;  4CZG A;  2KTQ A;  5JS2 A;  2ZD1 A;  1IJJ A;  3CI5 A;  3Q7C A;  4CJV A;  3QNO A;  3O3F A;  1QSL A;  4YOV A;  2YNF A;  4FZY A;  1GLF O;  1K8A O;  5F0X A;  3TAF A;  4BY9 C;  3AVL A;  4W5Q A;  5IWA K;  3A8Y A;  2YJE A;  1RBR A;  4PWD A;  3UKU B;  3KK1 A;  3OYB A;  4YOX A;  4MO5 A;  1GLD G;  3L2U A;  4JI3 K;  1T6D A;  1I94 K;  2IVO A;  1D5A A;  1X9J A;  1NK9 A;  3IFR A;  4FLU A;  1NGH A;  2KZZ A;  1U2V B;  3WXM B;  3SV3 A;  5AQR A;  5EXW A;  4C1N K;  2OPS A;  3GDQ A;  3MMV A;  4JHD A;  1FKP A;  2PY5 A;  2O8F B;  2IS3 A;  5HRO A;  1B9F A;  4K42 A;  5I42 A;  1VQK N;  1MWM A;  3QEP A;  2HHX A;  3I33 A;  4X64 K;  4BDZ A;  4GKJ K;  1BQN A;  2HHS A;  1DEJ A;  1NGE A;  3DRS A;  1IG8 A;  1QQM A;  3SBT A;  1M1K O;  4E7J A;  1NGD A;  1TAQ A;  3AVK A;  3WEE A;  4F4K A;  1Q18 A;  3BF1 A;  4F9O A;  3LZJ A;  3B6O A;  3QEX A;  4CHP A;  3THY B;  3MCA B;  3A5O C;  3HVR A;  1Q82 O;  3ALY A;  1BUP A;  5AFU A;  1BWF O;  4O0J A;  3AV9 A;  2BUP A;  3WNF A;  5FRM A;  4FJM A;  4BWJ A;  2D4W A;  3SV4 A;  4PL8 A;  1U45 A;  1VSH A;  3CCV N;  4CER A;  4KTQ A;  4A5B A;  1IKW A;  5AQN A;  4DWI A;  3IKM A;  4FM2 A;  3KHY A;  4RTF D;  4Y0W A;  4IXC A;  5E84 A;  3SPY A;  1VSE A;  3OYH A;  4K43 A;  5C2D A;  1YAG A;  5F1X A;  1BG3 A;  2EWS A;  1XHZ A;  4CCH A;  2WUS A;  3VQE A;  2ZJP L;  3R6M A;  3U4L A;  2GV9 A;  3DRR A;  1TK5 A;  3O9U A;  3T1A A;  4BRN A;  2VG7 A;  4CEB A;  3DXM A;  4CBX A;  4DG1 A;  4C1N I;  3EYZ A;  4DTN A;  5M1K A;  2ITG A;  5C2F A;  2A6A A;  3G6E N;  2GEL A;  3IMX A;  3SQ4 A;  1BGX T;  1KC8 O;  4F3O A;  4OPH A;  4Z94 A;  2WBN A;  4FLX A;  4WF9 L;  2ASO A;  5M1N A;  5AQP A;  5E41 A;  1U4B A;  1KVB A;  3KVG A;  1DKG D;  3U9D A;  4FCY A;  3TI0 A;  2ZF5 O;  3LAL A;  4CF1 A;  3C6U A;  3THX B;  3VQD A;  4CIE A;  1YI2 N;  2VG6 A;  3KZB A;  4AM6 A;  3PX0 A;  4BR7 A;  3R1X A;  1W97 L;  4GVM A;  3NCI A;  3K59 A;  2AP1 A;  2A3Z A;  2P51 A;  4B3O A;  2YX6 A;  4JK9 A;  5FDL A;  1YXQ A;  4B9Q A;  3OYE A;  3HT3 A;  4B08 A;  2Z1J A;  1VQ6 N;  1NNE A;  3VES A;  4ZTJ A;  1QQN A;  4ISG A;  3H08 A;  3EL2 A;  3PV8 A;  1NGI A;  4AF1 A;  3FLC O;  4BWM A;  2CGL A;  4E1N A;  1S72 N;  3ZX3 A;  3WXK A;  3D2F B;  5AZJ A;  1G15 A;  3WNH A;  4DTP A;  5BPN A;  4E3S A;  5FPD A;  1LWF A;  3D45 A;  5GAG P;  4ILG B;  4HUG A;  5KPT A;  2OTJ N;  5SZT A;  3CET A;  1Q7Y O;  4K0K K;  2V7Z A;  3H1Q A;  3C6A A;  2A1S A;  1BI4 A;  2D1K A;  1KD1 O;  2HVI A;  2O8D A;  1YIT N;  3DAW A;  2P9K B;  4B1U B;  4DU1 A;  3P38 A;  5KPR A;  4IWV A;  1JLQ A;  3CHW A;  4AHU A;  1RT5 A;  4H0P A;  4M3X A;  3DLR A;  4FZX C;  4JI8 K;  2DFF A;  3OYK A;  3HPH A;  2ETJ A;  1LWC A;  3DJC A;  4W5O A;  4M3W A;  2D5R A;  3AVG A;  4QOZ B;  3O5B A;  1NG9 A;  1TAU A;  4RWT A;  3AVJ A;  3CXC M;  4R79 A;  4QS9 A;  3HTV A;  4CK3 A;  5AQM A;  3C7N A;  5JMV A;  2KQ2 A;  1L3T A;  3AAP A;  1ZC6 A;  2QW9 A;  1NJW A;  2VCP A;  3EZW A;  4O55 A;  5DK5 A;  1L3S A;  1W0H A;  1GLL O;  2VQE K;  3QB0 A;  4JHD B;  3VQ6 A;  3V9W A;  1WN7 A;  3CQY A;  3OS1 A;  4ILH A;  3KLE A;  1WB9 A;  4FLV A;  1NK8 A;  4Q0B A;  3O1W A;  2A41 A;  1J5E K;  4M7X A;  3K5M A;  1NGF A;  2FBY A;  3L8B A;  4HHT A;  3CC7 N;  1CLQ A;  3ZT0 A;  3VGK A;  4CD3 A;  5CR4 A;  2QWN A;  5IT9 O;  3AO2 A;  3VTI A;  4E7I A;  3PIP L;  3BGR A;  5BRH A;  2B6A A;  3H46 O;  2QWL A;  3GOI A;  3JAM O;  4JRQ A;  2NRV A;  2V52 B;  1JCG A;  1C0T A;  4BRI A;  5AJ3 K;  5GAD P;  3VET A;  4BRD A;  1S9E A;  4CGI A;  1HYZ A;  4O44 A;  2E2N A;  2W6K A;  1NMD A;  4DR3 K;  3DM2 A;  4JI1 K;  1JL1 A;  2RKI A;  5M1Q A;  3V4I A;  1RDW X;  2FBX A;  5HRR A;  4AHS A;  2HHV A;  1SUQ A;  3GBT A;  2NZT A;  3UKR B;  1E4F T;  3L4Q A;  3NVM A;  4CZH A;  4JKF A;  3ZET A;  4ELU A;  2J4R A;  4EP4 A;  2A5X A;  3D2E A;  3L2V A;  2P9S B;  5C0Y A;  4KV8 A;  4QS7 A;  3FZF A;  2YHW A;  4CE9 A;  3PO5 A;  4B3T K;  4Z4G A;  1SKR A;  1S5J A;  1FK9 A;  1T03 A;  1NKE A;  1CZB A;  1FKO A;  5AQT A;  5J2N A;  4DR1 K;  4M41 A;  1S1X A;  1EWR A;  1QZ5 A;  3KK7 A;  4YFU A;  4DFP A;  2HHQ A;  4Q5V A;  4PQU A;  2Q2R A;  3FZL A;  1MA9 B;  3U3Y A;  3SK3 A;  1XWL A;  3LWM A;  3QET A;  5LY3 A;  3WNG A;  4Z4C A;  1P8Z A;  1U6Z A;  2I7P A;  5BRE A;  3TU5 A;  3THY A;  1JJ2 M;  4QAG A;  4JS5 A;  1KAY A;  3NH1 A;  1ZXO A;  3VQB A;  3LPU A;  3VQQ A;  5ADX H;  5AZJ B;  4DSK A;  4BE0 A;  4CFA A;  4JI5 K;  5DMR A;  4WQ5 C;  1B92 A;  4M42 A;  2UXB K;  1WLJ A;  5DM7 L;  1HQE A;  3AVC A;  3ZSY A;  4NB4 A;  4KHN A;  3WNE A;  4B9V A;  1EKE A;  2W41 A;  5KTQ A;  3VGM A;  2D0O A;  1TKT A;  2P5G A;  5CZ1 A;  2V7Y A;  1K8K B;  4B9M A;  3HZ6 A;  1CZA N;  4A59 A;  3E1Y A;  3CCL N;  1BDG A;  4WE1 A;  1BI4 B;  4E1M A;  3AO5 A;  5C15 A;  3VA0 A;  3RWU A;  2KKZ A;  3AO3 A;  4C23 A;  1C6V A;  3HBT A;  3THV A;  2YHB A;  3TSQ A;  1A5V A;  5GIP A;  1F21 A;  3W3D A;  3F73 A;  3VEO A;  2VWB A;  1HKB A;  1JCE A;  3HRG A;  1SL2 A;  3PSI A;  4M3Z A;  1QTM A;  4CJL A;  1IBK K;  1RBV A;  2PZS A;  5AQW A;  3C95 A;  3HK2 A;  3VF4 A;  5GIO A;  3GE1 A;  1ITG A;  2QKB A;  4O4G A;  2QTD A;  3DMJ A;  3VOV A;  4H0O A;  1T8E A;  3KD1 E;  4A2B A;  3U6F A;  4W5N A;  1YJW N;  4FJK A;  4F2R A;  4GY2 B;  3QEW A;  2D0A A;  2DY4 A;  4CIG A;  3AAQ A;  4DQS A;  1X3N A;  1XHX A;  4NCB A;  1VRU A;  5AQG A;  3FZM A;  1RDA A;  4B9U A;  1RGI A;  4RCH A;  1TGO A;  4FXD A;  2IGI A;  4RW4 A;  4N47 A;  3NH2 A;  3ZX0 A;  5JVH L;  5J1E A;  4CF0 A;  3KK3 A;  3L3U A;  4PUO A;  2NRR A;  4BRL A;  3D2E B;  4X65 K;  3DI6 A;  2RN2 A;  1RT2 A;  4YOT A;  1VAZ A;  5I3U A;  3MXI A;  3RSE A;  2G8K A;  1DT9 A;  3B8A X;  3FR0 A;  1T6C A;  1LWE A;  3SJH A;  4B8C A;  1TKZ A;  3A5M C;  1K6Y A;  1YVU A;  4H5R A;  3PX4 A;  2AA4 A;  3TWH A;  1Z25 A;  2Q36 A;  1HPM A;  3EKU A;  1Q86 O;  3SMS A;  3AAR A;  2KFZ A;  2ASP A;  3EEQ A;  3VQ5 A;  4FLZ A;  3H3N O;  2ZJR L;  2HBM A;  1O1W A;  3DLK A;  4BR9 A;  5EVZ A;  3RRH A;  2YHY A;  3LDN A;  3U3G A;  3DLL L;  2P1J A;  4F8R A;  4PKH A;  3L2Q A;  4ELV A;  4DS4 A;  3MDQ A;  3O9T A;  1HYV A;  4ID1 A;  3MX5 A;  1A5X A;  4GNI A;  3R8E A;  3RMB A;  3ID8 A;  1WOQ A;  1HJO A;  3V1O A;  2GWK A;  3SMP A;  1BCM A;  4O0I A;  1ZBU A;  3J7A P;  2F4V K;  2YNH A;  1KSP A;  3G25 A;  4NYN A;  2P9P A;  2UU9 K;  2HBK A;  3VPZ A;  4FO0 A;  3J7Y P;  3CIP A;  4F2S A;  4EIA A;  2BGG A;  2DTU A;  4E89 A;  2GTD A;  1NMN A;  5AQU A;  2E20 A;  2F9W A;  3ZT3 A;  2P9L A;  4C8N A;  5LMU K;  2YHA A;  3O4Q A;  1TUU A;  3VQP A;  4LC9 B;  5F2R A;  3ZT2 A;  1QZ6 A;  3NF7 A;  4H5N A;  5CE3 A;  2E2Q A;  5AZI B;  4AHR A;  3AVN A;  2VGM A;  2E5L K;  2IDO A;  5SWM A;  2HND A;  3H6E A;  1VQN N;  3ZLJ A;  4MQ3 A;  1RNH A;  3HJF A;  3DRP A;  4DR5 K;  4DV7 K;  3QFU A;  4FW1 A;  4CEA A;  2KHO A;  5CYM A;  2QWQ A;  5D3G A;  4O8U A;  1NJX A;  2ASM A;  3WQT A;  4YOR A;  4CHY A;  1C0U A;  3PSF A;  3I55 N;  4KHS A;  4DU4 A;  4I7F A;  4BRO A;  4GKK K;  3ZET B;  1XUP O;  2B5J A;  4RW9 A;  4C8M A;  2Y1I A;  3WXL A;  3TAN A;  1N6Q A;  1L3V A;  2XRI A;  3FE1 A;  5KGW A;  3UKR A;  3QFP A;  4MO4 A;  2O8B B;  3VQ8 A;  5AQY A;  4LFC K;  1IH7 A;  4YOW A;  1KVC A;  2NRW A;  1HYS A;  2P9U A;  1S3X A;  2E4L A;  2IVP A;  3M8R A;  4CJP A;  1GLB G;  5FLX O;  4CJU A;  4BAC A;  3OYF A;  1QSY A;  1W9H A;  2IVN A;  3E9O A;  4DSF A;  3A5L C;  1N5Y A;  3ZSR A;  3OYC A;  4FWR A;  1KCF A;  2YCH A;  3CQ8 A;  1RT6 A;  1X3M A;  2GUI A;  3HPO A;  3IRX A;  3IS9 A;  3ZSX A;  1QVG M;  3WT0 A;  3HM9 A;  3QML A;  2KLA A;  3U8X A;  3HSC A;  4PHT X;  3ZSZ A;  4YNQ A;  2VQF K;  4FK0 A;  5AQX A;  3V1Q A;  3L2W A;  4BR2 A;  3NBP A;  3A2F A;  3C65 A;  4YOY A;  1VHX A;  1T44 A;  3SZ2 A;  3A0I X;  3CJ9 A;  3HST B;  5BR9 A;  2GX9 A;  1VSD A;  1NJZ A;  3IDH A;  1LV5 A;  3HI0 A;  4KTW A;  2HF4 A;  2OYQ A;  3RRG A;  3TSP A;  2I5J A;  5H1S Q;  1TK0 A;  3T1Y K;  1IG9 A;  4BVO A;  4B1Z A;  1V4S A;  3CMA N;  1O13 A;  4K8Z A;  2WON A;  4LH4 A;  1U2V A;  3ZX2 A;  3CQX A;  4F3T A;  1XI1 A;  2G8F A;  3HL8 A;  1SKW A;  1GLA G;  4C8L A;  2PBD A;  3CCR N;  2P9K A;  1HX1 A;  2QWO A;  2YKM A;  4IJN A;  4JKA A;  4PKG A;  3CJC A;  4BDP A;  1DGK N;  1EET A;  3AVB A;  5CYQ A;  3OYN A;  4CZJ A;  4DQI A;  4FOE A;  5JVG L;  1RBT A;  1YHQ N;  1XNR K;  4KHQ A;  1JLB A;  1X9S A;  1D9F A;  1LW2 A;  3MCP A;  1NKC A;  4CBU A;  5JS1 A;  4OO1 J;  3CM6 A;  4A61 A;  1UA0 A;  1YIJ N;  1OH5 A;  2UXD K;  3PLA A;  3TAE A;  1VSM A;  1RBS A;  3AVF A;  5HP1 A;  5C24 A;  4H03 B;  4CW7 B;  3VMF B;  4DTM A;  1WBB A;  5DM6 L;  3BY5 A;  3AA3 A;  4CD1 A;  5AQS A;  3PX6 A;  4NLC A;  4KRF A;  1WNS A;  1EQY A;  4X66 K;  2OCE A;  4FJG A;  1UWB A;  3NF6 A;  5KGX A;  4GV9 A;  4HUE A;  5CZ2 A;  3CM5 A;  4UQG A;  3S3M A;  3HM8 A;  4QCL A;  4KH4 A;  4DSE A;  4GV3 A;  1H1V A;  3O9Q A;  4IO8 A;  4NO7 A;  4BC3 A;  2FXU A;  4LSL A;  1IBL K;  1W7A A;  4FWQ A;  1VQ7 N;  3NVK A;  2Q1N A;  5FPE A;  1JLF A;  2FSJ A;  1VQO N;  3ULE B;  3HXM A;  4NYF A;  1LW0 A;  1BIS A;  2B4J A;  1YTU A;  2Q31 A;  5J2P A;  1WSF A;  1Q81 O;  4J2E A;  4FK4 A;  3LL3 A;  4DKW A;  3FFI A;  1RT3 A;  3V1R A;  1IKV A;  1DTQ A;  1KQS M;  4NCG A;  4JI6 K;  3MK6 A;  4IJA A;  3TTF A;  4E7K A;  1QSS A;  4B8A B;  4CZE A;  3LAK A;  1ZBH A;  3DYA A;  4KH5 A;  1BHL A;  1OVQ A;  5HRP A;  3O3H A;  4BRA A;  4H0V B;  2FLO A;  3CER A;  4MFB A;  3L2R A;  4LFB K;  4EHT A;  1SV5 A;  5M1F A;  3LP0 A;  3ZEU A;  3BZK A;  3FFK B;  3RMD A;  1ASW A;  2IAJ A;  3ZEU B;  2G8V A;  3CD6 N;  4EAH D;  1RDB A;  4BC5 A;  3TAM A;  4EHU A;  3SPZ A;  1J6Z A;  2Y1J A;  3LAM A;  3VQC A;  4JEP A;  3AA2 A;  3OW2 M;  3LPT A;  3N4P A;  4Z4E A;  4NCA A;  3RMC A;  1WSH A;  4CVN E;  1YF5 L;  2IIR A;  1XMQ K;  3I8B A;  1VSL A;  3ZSO A;  2GBZ A;  1HPZ A;  5HLF A;  2HW3 A;  4B9L A;  4H0T B;  3OVN A;  2OZM A;  4M63 C;  4KAZ A;  4AH9 A;  2W40 A;  2AJQ A;  3LDQ A;  3T7Z A;  2QM1 A;  4BRG A;  4JI7 K;  2E8A A;  3AVM A;  1E4G T;  1FXX A;  1VQ9 N;  5J2Q A;  3ULE A;  3SQ0 A;  5EU7 A;  3D0P A;  4CI6 A;  4BQZ A;  3IUC A;  3JYT A;  2QWM A;  1LCU A;  4H4M A;  4I2Q A;  4BGB A;  1ASV A;  2VG5 A;  3U9Z A;  3QO9 A;  2CGJ A;  3BP8 A;  3QDK A;  4CHZ A;  5FPM A;  2E1Z A;  3B6P A;  1ATR A;  1Z6R A;  3JS6 A;  5JLH A;  2F8S A;  1G99 A;  1X1P A;  3QEI A;  4KKO A;  4K8X A;  3TAP A;  5BN8 A;  3E9L A;  1RT4 A;  3P39 A;  2PAV A;  4FJN A;  4YOU A;  3ZSQ A;  4J2D A;  3F5T A;  4DTJ A;  4H5T A;  3CCQ N;  1HRH A;  3TAR A;  5MLC Q;  1C1A A;  2NRH A;  3VEV A;  4DR7 K;  2P9L B;  4E19 A;  5EY4 A;  4PY5 A;  3PUF A;  1A5W A;  2F9T A;  4DV2 K;  2PYJ A;  3DOL A;  3MWT A;  2KZM A;  4HTL A;  4JAX A;  5HRN A;  3NH0 A;  3AY9 A;  3LDP A;  3D7E O;  1SKS A;  4JKG B;  3K5L A;  4CZM A;  3S3O A;  5M1P A;  1TKD A;  3VN5 A;  2E6L A;  4FVM A;  2E1Y A;  4G1Q A;  3TR8 A;  1GLE G;  3C6T A;  1N36 K;  1N32 K;  3DXM B;  4YY3 K;  2P9N A;  4I2P A;  4J2B A;  1NGB A;  3OYJ A;  4DR4 K;  4CJK A;  4G9Z A;  4DR2 K;  3H3O B;  4JK8 A;  3CF5 L;  3UIQ A;  4LY7 A;  3CFP A;  1RCH A;  2XO7 A;  2QWR A;  3EKS A;  3AO4 A;  5FPN A;  1UAX A;  3QBW A;  2CGK A;  4ISE A;  4AM7 A;  1K9M O;  3VTH A;  1NGG A;  4CJT A;  4CGD A;  3LDS A;  1WAJ A;  1HNW K;  4RW7 A;  4ID5 A;  4DFJ A;  2BAN A;  4DMN A;  4KRE A;  3F9K A;  4JRP A;  3P83 D;  3W0L A;  1IV0 A;  5EOY A;  1OH6 A;  2OTL N;  2YNG A;  3LZI A;  4KB0 A;  2QA4 N;  3K58 A;  4OGC A;  4N76 A;  3EE9 A;  2O8B A;  1LAV A;  3HYF A;  1IKX A;  4CFD A;  2O8E A;  4CGH A;  3WXJ A;  2LSN A;  3S9H A;  3TPQ A;  4OX9 K;  1X9W A;  3OS2 A;  3TAB A;  5B8H A;  3OY9 A;  3HP6 A;  3VEZ A;  5AQQ A;  1HUX A;  4IG0 A;  4XH4 A;  1NOY A;  3L0Q A;  3OYL A;  2E2O A;  4KHW A;  4FJL A;  3CYM A;  4HTU A;  4OVL A;  1YVN A;  4B9N A;  1RIL A;  3LDL A;  4N41 A;  4FW2 A;  1Z05 A;  3N4Q A;  5AZI A;  1ZBS A;  4B1W B;  5AFU H;  1JLE A;  1ESV A;  1V4T A;  3CPE A;  4CEO A;  3RVC A;  3MED A;  4BR4 A;  3V9S A;  3VQ4 A;  1OVY A;  4BC4 A;  3KIO A;  2YNI A;  1BIU A;  2NNW A;  3MEE A;  3NF8 A;  5BRD A;  3CCU N;  3JXU A;  1EP4 A;  4KPY A;  4AHT A;  1I3A A;  3MX2 A;  1BIZ A;  4DHY A;  3EY1 A;  1NK6 A;  3SQ2 A;  4DTU A;  1VK0 A;  4B9T A;  3SUP A;  4V19 S;  1TVR A;  3NHG A;  1Z26 A;  4DTR A;  1VQ5 N;  1DTT A;  1IKY A;  4KI6 A;  1HR0 K;  1C0G A;  3KD5 E;  2G8H A;  2Q0U A;  3ISN C;  2ZM6 K;  3ZSW A;  3CJA A;  4FYD A;  3GL1 A;  3LWL A;  1R0A A;  3T19 A;  3FGU A;  5ADX A;  4KTZ A;  5LJV A;  4CHN A;  5C42 A;  4FZZ A;  2OZS A;  3TAQ A;  5J2M A;  1UOC A;  4BE1 A;  2I7N A;  1L3U A;  3AGK A;  1NK5 A;  4HWI A;  1BQM A;  3MAQ A;  3MN9 A;  5C12 A;  1EX4 A;  1SL1 A;  3SAH A;  1BO5 O;  4CZK A;  5KRS A;  4Y1D A;  4EP5 A;  4MLH A;  2BE2 A;  4M45 A;  4FWL A;  1RTD A;  4FWK A;  3CCJ N;  2DFH A;  4DFM A;  1K8K A;  3DLE A;  4H0X B;  3I8D A;  4BRF A;  3O80 A;  1D4X A;  4W5R A;  2ZGZ A;  4AIL C;  3SUQ A;  3T69 A;  2BH1 A;  1HKC A;  3LP1 A;  4CF9 A;  1GLC G; 
#chains in the Genus database with same CATH homology
 1YIT N;  3DAW A;  2P9K B;  3VEX A;  3SAG A;  4B1U B;  5GAE P;  3P38 A;  5H1S Q;  2NRT A;  5KPR A;  1Y64 A;  3C7N B;  3CHW A;  4IWV A;  4B1Z A;  4H0P A;  1V4S A;  4BVO A;  1K73 O;  3CMA N;  1GLJ O;  4A57 A;  1O13 A;  1HKG A;  4FL9 A;  4JNE A;  4QS8 A;  1U2V A;  3SBG A;  3ZX2 A;  4BRQ A;  3CQX A;  1OKJ A;  3DJC A;  3VF2 A;  1MWK A;  4K41 A;  4BR5 A;  3WXI A;  1GLA G;  3VER A;  3O5B A;  2HOE A;  3KWI A;  4RWT A;  3CXC M;  2PBD A;  3CCR N;  4B1X B;  2P9K A;  1HX1 A;  2QWO A;  4IJN A;  3BF3 A;  4B1Y B;  4R79 A;  4JKA A;  1NM1 A;  4PKG A;  3CJC A;  4YDU C;  4E1J A;  4QS9 A;  3HTV A;  4U67 L;  1DGK N;  5AQM A;  3C7N A;  5JMV A;  4JD2 A;  3AAP A;  1ZC6 A;  2QW9 A;  2CH6 A;  4CZJ A;  3HOT A;  2VCP A;  4FOE A;  5JVG L;  2WFB A;  3K9K A;  1YHQ N;  1HLU A;  2OAN A;  3EZW A;  4IOA L;  2GEM A;  4ISF A;  4JD2 B;  3VEW A;  1ATN A;  3MN5 A;  1YJ9 N;  3MCP A;  1GLL O;  5KPZ A;  3QB0 A;  4JHD B;  4B1V A;  4WQ4 A;  4CBU A;  4OO1 J;  3EE8 A;  3CQY A;  1MDU B;  4ILH A;  4A61 A;  1YIJ N;  3MWP A;  3C0B A;  3PLA A;  3O1W A;  3DXK B;  2A41 A;  4IO9 L;  1TUY A;  4M7X A;  1NGF A;  4H03 B;  2RE2 A;  3TTD A;  3VMF B;  3NMU A;  5LJW A;  3CC7 N;  5DM6 L;  3CCM N;  3VGK A;  4CD3 A;  5CR4 A;  3L4I A;  2QWN A;  1N8R O;  4XEI A;  1BA1 A;  5AQS A;  4CD1 A;  4NLC A;  1RDU A;  3VTI A;  3TTC A;  1NWK A;  3PIP L;  1EQY A;  2DPN A;  5BRH A;  1VQ8 N;  3H46 O;  2QWL A;  3GOI A;  1XC3 A;  2NRV A;  4GV9 A;  2V52 B;  1JCG A;  5JIC A;  4BRI A;  3QBX A;  4A5A A;  5GAD P;  3VET A;  4BG8 A;  4FSV A;  4WQ4 C;  4BRD A;  1NJI O;  3HM8 A;  3O8M A;  4NLB A;  4FWS A;  4KH4 A;  2FSN A;  2E2N A;  3G71 N;  1NMD A;  4GV3 A;  1H1V A;  3O9Q A;  2H3G X;  2QXL A;  4IO8 A;  4NO7 A;  5ELZ A;  3OBW A;  4BC3 A;  4IOC L;  5M1Q A;  2FXU A;  2D0P A;  1RDW X;  3UB5 A;  3VGL A;  4FWQ A;  4H5W A;  1VQ7 N;  4H5V A;  3NVK A;  4MDB A;  2Q1N A;  4BRE A;  5FPE A;  1VQM N;  4IEE A;  3GBT A;  4DCH A;  3ATV A;  2NZT A;  3UKR B;  1E4F T;  3L4Q A;  3FZK A;  3NVM A;  2FSJ A;  4CZH A;  1VQO N;  3ULE B;  4JKF A;  3ATU A;  3G4S N;  3OBY A;  3ZET A;  4WFA L;  2J4R A;  2Q31 A;  2A5X A;  3D2E A;  2V51 B;  3VEN A;  2P9S B;  3CPW M;  2A42 A;  4JKH A;  1SQK A;  1Q81 O;  5C0Y A;  3LL3 A;  1KAX A;  4QS7 A;  3FZF A;  2YHW A;  4DKW A;  3BUZ B;  2E2P A;  3VF6 A;  1KQS M;  5I9E B;  3P4I A;  3D6R A;  3MK6 A;  4CBW A;  5JLF A;  3LDO A;  3LM9 A;  3ENH A;  3MN6 A;  4IJA A;  3TTF A;  5BPM A;  2P9P B;  3M3Z A;  5AQT A;  3CC2 N;  5AR0 A;  1QZ5 A;  3KK7 A;  4CZE A;  4O8K A;  4KH5 A;  1LOT B;  1QQO A;  3A5N C;  2Q2R A;  3FZL A;  1MA9 B;  4BRA A;  3CC4 N;  4H0V B;  2FLO A;  4MLE A;  3SK3 A;  5CHI A;  2NRX A;  2VYP A;  3CER A;  3F9M A;  2QEX N;  4EHT A;  5LY3 A;  5M1F A;  4IEI A;  3ZEU A;  3FFK B;  1P8Z A;  1U6Z A;  2I7P A;  5BRE A;  1BU6 O;  3TU5 A;  4JKG A;  1JJ2 M;  1TYQ B;  3TSU A;  4IDH A;  3DXK A;  3O08 A;  3O9S A;  3ZEU B;  2JWL A;  3CD6 N;  2UYT A;  1W2B M;  1KAY A;  3O6W A;  4EAH D;  3E66 A;  4H0Y B;  3S41 A;  1ZXO A;  2WC9 A;  5AQK A;  4BC5 A;  4EHU A;  5ADX H;  5AZJ B;  1J6Z A;  4BR0 A;  3H45 C;  4GV6 A;  3PIO L;  3EN9 A;  4JEP A;  5TKY A;  2YI1 A;  3OW2 M;  4WQ5 C;  4FPA A;  4FOI A;  3ZYY X;  3N4P A;  4ILJ A;  3UKU A;  3SAF A;  5DM7 L;  3M1F A;  5E26 A;  1NGJ A;  3P31 A;  1YF5 L;  2IIR A;  1SZ2 A;  3I8B A;  4NB4 A;  2W41 A;  5AQO A;  3R3L A;  3OHR A;  3VGM A;  4H0T B;  1VQL N;  3CME N;  2D0O A;  3OA9 A;  1SAZ A;  1NBW A;  2F7T A;  2V7Y A;  2W40 A;  3M6G A;  3QIC A;  3LDQ A;  4FWM A;  4FPB A;  4M63 C;  3T7Z A;  1K8K B;  2QM1 A;  1BA0 A;  3HZ6 A;  4EFH A;  1CZA N;  4FWO A;  4A59 A;  3E1Y A;  4FWP A;  1BDG A;  3CCL N;  2P9S A;  4BRG A;  3MN7 A;  2NRZ A;  2E8A A;  2Q97 A;  5GIN A;  3ENB A;  1ATS A;  1E4G T;  3L6Q A;  3CJB A;  1VQ9 N;  2HST A;  5C15 A;  3ULE A;  5AQZ A;  2KKZ A;  4C23 A;  3HBT A;  3TSQ A;  4CI6 A;  4DQ8 A;  4BQZ A;  4JKB A;  3IUC A;  5GIP A;  2QWM A;  1LCU A;  3ENO A;  3H1V X;  3W3D A;  3VEO A;  4BRP A;  2VWB A;  4BGB A;  4JKC A;  3U9Z A;  1HKB A;  1JCE A;  3HRG A;  3M5R A;  2Q0R A;  4IOX A;  2CGJ A;  3BP8 A;  3QDK A;  5KQ8 A;  5FPM A;  4WFN L;  3DWL A;  2E1Z A;  3CCE N;  2HBJ A;  5AQW A;  1ATR A;  1Z6R A;  3JS6 A;  4XH1 A;  3VF4 A;  5JLH A;  5GIO A;  3GE1 A;  4CZL A;  1M90 O;  3E9P A;  1G99 A;  2QTD A;  1YJN N;  3HOS A;  2ITM A;  4M7Y A;  3VOV A;  2FF6 A;  4WCE L;  5BN8 A;  1NGA A;  4H0O A;  3E9L A;  1TYQ A;  2RHK A;  3P39 A;  4A2B A;  4U7B A;  4L3Q A;  2PAV A;  4FVU A;  1KAZ A;  2ZWH A;  1YJW N;  4A2A A;  4YOU A;  4GY2 B;  3WEE B;  4CJ7 A;  4BQL A;  3AAQ A;  3F5T A;  4H5T A;  4IFE A;  1VQP N;  3CCQ N;  1X3N A;  4JK7 A;  5MLC Q;  2NRH A;  4J8F A;  1JCF A;  3VEV A;  4I6M B;  2P9L B;  5AQG A;  5M1O A;  3FZM A;  5EY4 A;  5AQF A;  2CH5 A;  4BRC A;  5KQD A;  4UY8 O;  1BOT O;  1RGI A;  4RCH A;  1C0F A;  2F9T A;  3MWT A;  1P90 A;  1YUW A;  5AQH A;  4HTL A;  4JAX A;  5AQJ A;  2A40 A;  5HL7 L;  3ZX0 A;  5JVH L;  1QHA A;  3AY9 A;  2NRR A;  3R9P A;  4BRL A;  3LDP A;  3D2E B;  3D7E O;  2NLX A;  2E88 A;  2GUP A;  4JKG B;  4BRM A;  3CCS N;  4CZM A;  5EX5 A;  5M1P A;  4CZG A;  4YOT A;  1VAZ A;  3F2K A;  3RSE A;  3Q7B A;  1DT9 A;  3KWG A;  3B8A X;  1IJJ A;  3CI5 A;  3Q7C A;  3FR0 A;  2E1Y A;  3J8A A;  1NLV A;  1T6C A;  3SJH A;  2QWP A;  4YOV A;  1GLE G;  3A5M C;  1GLF O;  1K8A O;  3DXM B;  4DB3 A;  5F0X A;  4BY9 C;  4H5R A;  1KXP A;  2P9N A;  2AA4 A;  5C10 A;  3A8Y A;  2YJE A;  2Q36 A;  1HPM A;  1NGB A;  3EKU A;  1Q86 O;  3SMS A;  4G9Z A;  3UKU B;  3AAR A;  4YOX A;  4MO5 A;  1GLD G;  4BRK A;  3H3O B;  1T6D A;  4JKD A;  4JK8 A;  2ASP A;  2IVO A;  3CF5 L;  1X9J A;  3H3N O;  3IFR A;  2ZJR L;  2HBM A;  1NGH A;  2QWR A;  2ZGY A;  1U2V B;  3EKS A;  5EVZ A;  3WXM B;  3CJ1 A;  2YHY A;  3LDN A;  4BR9 A;  1VQ4 N;  3O9R A;  4CZF A;  5FPN A;  5AQR A;  3QBW A;  2CGK A;  4ISE A;  3DLL L;  3EO3 A;  4AM7 A;  4PKH A;  1K9M O;  5EXW A;  3VTH A;  1ILY A;  2P9U B;  1NGG A;  3MDQ A;  3O9T A;  4C1N K;  3GG4 A;  2HF3 A;  3GDQ A;  3MMV A;  3MX5 A;  4JHD A;  4GNI A;  3R8E A;  3ID8 A;  1WOQ A;  1HJO A;  2GWK A;  5AQL A;  4CZI A;  4K42 A;  3SMP A;  5BRF A;  3W0L A;  1VQK N;  1MWM A;  5EOY A;  1SS6 A;  3I33 A;  2FSK A;  2HMP A;  3ID6 A;  4BGA A;  2OTL N;  1DEJ A;  2HBL A;  1NGE A;  2QA4 N;  1IG8 A;  1QQM A;  3EE9 A;  3SBT A;  3G25 A;  1M1K O;  2P9P A;  2HBK A;  3VPZ A;  4FO0 A;  4K25 A;  3CIP A;  1NGD A;  1RFQ A;  4MDA A;  5BN9 A;  3WEE A;  1Q18 A;  3BF1 A;  4EIA A;  4F9O A;  2GTD A;  3WXJ A;  3TPQ A;  5AQU A;  2E20 A;  2F9W A;  5GAH P;  1S22 A;  5AQI A;  3MCA B;  4WQ5 A;  3A5O C;  2P9L A;  1Q82 O;  1BUP A;  3VEY A;  5B8H A;  3K9J A;  3SLC A;  3VEZ A;  5AQQ A;  5AFU A;  1BWF O;  1HUX A;  1QVF M;  1TUU A;  3O1B A;  4XH5 A;  4XH4 A;  2BUP A;  4LC9 B;  5F2R A;  4PL7 A;  1QZ6 A;  4H5N A;  3L0Q A;  5CE3 A;  2E2Q A;  5AZI B;  3BEX A;  1T3V A;  2E2O A;  3J7Z O;  2VGM A;  2D4W A;  4PL8 A;  5TKW A;  5HOO A;  3CCV N;  3H6E A;  2FF3 B;  1YVN A;  4A5B A;  1VQN N;  2BTF A;  3LDL A;  5AQN A;  1Z05 A;  3N4Q A;  5AZI A;  1ZBS A;  3IKM A;  4B1W B;  4KBO A;  3QFU A;  2KHO A;  3KHY A;  2QWQ A;  4O5F A;  4RTF D;  5AFU H;  1ESV A;  4O8U A;  4JN4 A;  2ASM A;  4FWN A;  1V4T A;  4KH6 A;  3CPE A;  4IXC A;  4Y0W A;  5E84 A;  3WQT A;  4YOR A;  4A62 A;  3RVC A;  4K43 A;  1XQS C;  5C2D A;  3I55 N;  1KD1 O;  1YAG A;  3WQU A;  5F1X A;  2P9N B;  4BR4 A;  1BG3 A;  4BRO A;  2EWS A;  3ZET B;  1XUP O;  2WUS A;  3CJ7 A;  1OVY A;  2ZJP L;  4BC4 A;  3WXL A;  3R6M A;  3U4L A;  2NNW A;  5BRD A;  3CCU N;  5AQV A;  3FE1 A;  3JXU A;  3O9U A;  3UKR A;  4BRN A;  4WFB L;  3I56 N;  3QFP A;  4MO4 A;  5AQY A;  3MX2 A;  3DXM A;  4JKE A;  4CBX A;  4C1N I;  4DHY A;  5M1K A;  4YOW A;  5C2F A;  2A6A A;  3G6E N;  2GEL A;  3IMX A;  2NRW A;  2P9U A;  3LM2 A;  1S3X A;  1KC8 O;  2IVP A;  4OPH A;  4Z94 A;  2WBN A;  1GLB G;  4WF9 L;  4BC2 A;  1VQ5 N;  2QI2 A;  2ASO A;  5M1N A;  5AQP A;  4WYB A;  3KVG A;  1DKG D;  3O4W A;  3U9D A;  2ZF5 O;  2IVN A;  3FZH A;  2JWK A;  1C0G A;  3E9O A;  3WUH A;  2Q0U A;  4BG9 A;  1YI2 N;  3AGR A;  3KZB A;  4AM6 A;  3CJA A;  3A5L C;  3C6H A;  4FWR A;  2YCH A;  1EO1 A;  3GL1 A;  2P9I A;  1X3M A;  3FGU A;  5ADX A;  5LJV A;  4BR7 A;  3R1X A;  4I6M A;  1W97 L;  2YJF A;  4BVP A;  4YDU A;  1QVG M;  2AP1 A;  2A3Z A;  3WT0 A;  2P9I B;  2YX6 A;  2VGN A;  4JK9 A;  3QML A;  2KLA A;  3U8X A;  1YXQ A;  2I7N A;  3HSC A;  4B9Q A;  4PHT X;  3UE5 A;  1VQ6 N;  5AQX A;  3AGK A;  3VES A;  4BR2 A;  1QQN A;  4ISG A;  1NGC A;  4HWI A;  3C65 A;  3EL2 A;  4IZ9 A;  4YOY A;  1NGI A;  2PFU A;  3MN9 A;  4BRH A;  5C12 A;  1T44 A;  3A0I X;  4AF1 A;  3FLC O;  4OPA A;  3SAH A;  1R59 O;  2CGL A;  1BO5 O;  3CJ9 A;  4CZK A;  2ZJQ L;  1S72 N;  3ZX3 A;  4PKI A;  3WXK A;  5BR9 A;  2GX9 A;  3D2F B;  4MLH A;  5AZJ A;  5BPL A;  4FWL A;  2YHX A;  3IDH A;  5BPN A;  5FPD A;  4FWK A;  5GAG P;  4ILG B;  2GWJ A;  3CCJ N;  5KPT A;  2OTJ N;  1K8K A;  4GVE A;  4H0X B;  3RSE B;  4BRF A;  3HI0 A;  3O80 A;  1D4X A;  3CET A;  1Q7Y O;  2ZGZ A;  2HF4 A;  2V7Z A;  3D2F A;  1HKC A;  1WUA A;  2BH1 A;  3H1Q A;  1GLC G;  3C6A A;  3T69 A;  3TSP A;  2D1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...