2E2QA

Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
total genus 110
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA01
2E2QA 2P9PB 4QS9A 4KBOA 4BRGA 4PKGA 1JCGA 2HF3A 3WQUA 4H0OA 5BN8A 1IG8A 3M6GA 3A5NC 1RDWX 3U4LA 3VGMA 3DWLA 1NGFA 2FF6A 1X3NA 2J4RA 5AQWA 4FOEA 3WXKA 4CBWA 4IWVA 3L6QA 3ULEB 4A2AA 3ATUA 4BR0A 2ASOA 2E20A 3FZKA 5AQVA 5AQQA 4J8FA 4K42A 2CH6A 2E2OA 3CJAA 3FE1A 2Q97A 3O1WA 2P9UA 4XH5A 4BVOA 1C0GA 2A3ZA 2ASMA 2GUPA 4K43A 3FZHA 1QZ5A 4DB3A 2Q0RA 3CJBA 2E2PA 1NBWA 3HI0A 2F9WA 1G99A 1NGBA 1NGDA 2YHYA 1HX1A 4BC4A 1KAZA 3G25A 2KHOA 4PL7A 4BQZA 1NGCA 4H0TB 3FZMA 2FLOA 3QDKA 2IVPA 3VETA 3C7NA 3CIPA 3FR0A 3EKUA 2YHXA 1LCUA 3VEZA 3VENA 3O1BA 4M7XA 4H0XB 5TKYA 5EY4A 4BGBA 4BRFA 3SLCA 4FWOA 3VF2A 4BR9A 1GLCG 1YAGA 3BEXA 3VGLA 4EHUA 1QQNA 4JAXA 2HMPA 4BR4A 1Y64A 2VWBA 4BRAA 4GNIA 1KXPA 4MO4A 5JMVA 1RFQA 3H1VX 3W0LA 4XH1A 3MCPA 1E4GT 3UKUB 3O80A 5FPEA 1S22A 1JCFA 3O5BA 3VF6A 3VPZA 4BC3A 3ULEA 4FWPA 3O08A 4FWSA 2CGKA 2QWRA 2FSKA 4IJAA 3BF1A 1X3MA 3MN6A 3D2EB 3JS6A 3EO3A 4AM6A 4H5NA 4CZLA 2P9NB 3I33A 4CZMA 1NGEA 1EQYA 3BUZB 4BRKA 4F9OA 2P9LB 3R6MA 1C0FA 1R59O 4PL8A 1QZ6A 2QWOA 2E1YA 2VCPA 5E26A 3VEOA 3VERA 4O5FA 1XQSC 3ATVA 3QICA 3RSEB 1T44A 4H5TA 3DJCA 5FPMA 1NGJA 1BOTO 4C23A 3ID8A 4E1JA 2CGLA 4CBUA 3VEVA 3UB5A 4CJ7A 1TUUA 1WOQA 2ZF5O 1NWKA 3QFUA 1GLLO 1XUPO 3ZX2A 4BRDA 1KAYA 2PAVA 4H5VA 4B9QA 5EX5A 4FWQA 1X9JA 3R8EA 1SQKA 2AP1A 1ZXOA 3UKRB 3GOIA 2BUPA 4BRQA 5KQDA 1J6ZA 2F9TA 2P9SB 1GLBG 4BR2A 4FO0A 4CZJA 5KQ8A 1QHAA 3FLCO 3L0QA 2YJEA 5FPDA 2FXUA 3EL2A 4IJNA 1BG3A 4A2BA 5EOYA 2FF3B 1OKJA 1Z05A 2QWNA 5AZJB 4FWNA 2QWQA 3UKUA 2E88A 4FWMA 4JD2B 1V4TA 3A8YA 4CI6A 4IZ9A 3P4IA 2E1ZA 1Z6RA 3WXJA 5AQGA 2QM1A 4O8KA 3WUHA 3D2FA 2QWLA 4YDUC 4ISFA 3SMPA 3O8MA 1IJJA 2Q31A 3D2EA 2YHWA 3HSCA 5LY3A 3UE5A 4BGAA 4MLEA 2P9NA 3GDQA 4BR5A 1GLAG 2D0PA 1NGIA 3ZEUB 1V4SA 2P9LA 3H1QA 4RTFD 5F2RA 5JLHA 3ZX0A 3KZBA 2P9IB 3VOVA 3LDPA 4PKIA 3H46O 4NB4A 4B1WB 5AQPA 4QS7A 3MMVA 2CGJA 4B1YB 4CZKA 4YDUA 2GTDA 4B1ZA 3RSEA 3CHWA 4EHTA 1MWMA 3AAPA 3B8AX 1ATSA 1YUWA 2D1KA 1BA1A 3FZLA 5AQKA 4BVPA 1XC3A 3LDLA 4RCHA 3SK3A 4CZIA 3O6WA 3HZ6A 4H0YB 5ADXH 3IFRA 1P8ZA 5AQRA 1SAZA 4FSVA 3LDOA 3CQXA 1GLDG 3H3OB 1DKGD 1HJOA 4WQ4C 1T6DA 2A6AA 1K8KA 4EIAA 5AZIB 2FSJA 4FPBA 3U8XA 3UKRA 1Q18A 4CD1A 4BG9A 5AQZA 2P9SA 5AQTA 4CBXA 5F1XA 1NGGA 4IXCA 5FPNA 3VEXA 3D2FB 2ZGZA 5AQNA 4M7YA 5AQXA 2IIRA 1ESVA 3ZETB 5AZJA 2Q0UA 5AQOA 1YVNA 4I6MB 4QS8A 3F9MA 2I7NA 3AARA 3JXUA 3SJHA 1ATRA 4WQ4A 4JD2A 3IMXA 4B1VA 4BC2A 1QQOA 3R9PA 3A0IX 3CJ7A 3VESA 3ENHA 4LC9B 3DXKB 3GE1A 3L4IA 5AQFA 2IVOA 5AQYA 3VF4A 3MN9A 3WEEA 3IUCA 1HKCA 4AM7A 4EAHD 4PKHA 4BR7A 1BUPA 2NZTA 4BRNA 1DGKN 2YJFA 2ITMA 3U9ZA 3BP8A 4FWRA 3ZEUA 2V7YA 3WT0A 1GLJO 4XEIA 4CD3A 1TYQB 3WQTA 1BO5O 2P9IA 3H3NO 2WUSA 4HTLA 5AQJA 2ZWHA 4MLHA 1GLFO 2GWKA 2W41A 3A5OC 4MO5A 2YI1A 3FGUA 3MDQA 5AQHA 5BPNA 5KPTA 1H1VA 4JN4A 5BPLA 4H0PA 1K8KB 2E8AA 2YCHA 4ISGA 3WXLA 5ADXA 4BQLA 2EWSA 5AQMA 3J8AA 3A5LC 2V52B 3BF3A 4K41A 1MWKA 1U2VA 3LDNA 4K25A 1RGIA 3O4WA 4WYBA 4L3QA 4A61A 2Q2RA 1HKBA 1NGHA 4BREA 1U6ZA 2W40A 3KHYA 2PBDA 5AZIA 2H3GX 1ZBSA 3DAWA 4H0VB 3MN7A 4M63C 4HWIA 3HTVA 5AQSA 4BROA 3HBTA 5E84A 3I8BA 2Q1NA 1NLVA 1YXQA 5BRFA 5BN9A 4XH4A 3VEWA 3MN5A 4CZFA 1BWFO 3WEEB 2NRHA 3ZETA 2IVNA 3CJCA 3EN9A 2A5XA 4I6MA 5AFUH 1S3XA 3GG4A 2A41A 2OANA 1T6CA 3LM9A 4DHYA 3CERA 4RWTA 3DXMB 4H03B 3QFPA 3DXKA 3LL3A 2GWJA 4BC5A 3CQYA 5CE3A 2QXLA 2HOEA 3CI5A 3U9DA 1ATNA 4JHDA 2ASPA 4BRMA 2AA4A 3A5MC 2Q36A 3SMSA 1HPMA 4IO8A 5AQUA 4BG8A 4EFHA 4BRPA 3FZFA 2QW9A 3QMLA 4FWKA 5AQLA 3VEYA 1TYQA 3LM2A 3EKSA 4NO7A 3C0BA 3FFKB 1GLEG 2HF4A 1U2VB 4BRHA 2D4WA 3D7EO 4B1XB 2P9KA 3EZWA 5F0XA 5BRDA 2E2NA 3WXIA 3QBXA 3GBTA 2QWPA 4ISEA 2BTFA 1HLUA 5AQIA 4FPAA 3AAQA 1HUXA 1CZAN 3HM8A 2D0OA 4FWLA 1WUAA 3S41A 2V51B 1NM1A 3LDQA 3H6EA 5KPRA 2P9PA 5BR9A 3TU5A 5JLFA 1TUYA 3KVGA 3M3ZA 2ZGYA 3TPQA 2V7ZA 5AR0A 5EXWA 3IDHA 3W3DA 5LJWA 4WQ5C 4Y0WA 1D4XA 2GELA 4BRCA 3GL1A 2GEMA 2DPNA 4H5WA 3ENOA 2QWMA 2VYPA 1JCEA 4GY2B 2P9UB 3OHRA 5ELZA 5AFUA 5BRHA 1QQMA 4FOIA 3H45C 2I7PA 4JHDB 5EVZA 3CETA 4A62A 1SZ2A 3CJ1A 5JICA 3MK6A 4DQ8A 5I9EB 1NMDA 1BA0A 3QBWA 1MDUB 4B1UB 3ZX3A 1NGAA 3DXMA 4WQ5A 4Z94A 4DCHA 2FSNA 1MA9B 3M1FA 4CZEA 3CJ9A 1E4FT 5B8HA 5BPMA 2P9KB 2NLXA 5LJVA 3C7NB 2UYTA 1BDGA 4FL9A 3VGKA 2CH5A 2A40A 1DEJA 4BRLA 5KPZA 1HKGA 4H5RA 1ZC6A 5BREA 2A42A 1KAXA 1LOTB 1BU6O 3AY9A 4JNEA 4CZHA 3QB0A 4CZGA 4BRIA
chains in the Genus database with same CATH superfamily
3UIQA 2BGGA 2KQ2A 1JCGA 1SS6A 1WLJA 3TAQA 3U4LA 4LF8K 4DUZK 3DWLA 1NGFA 1X3NA 4FOEA 4DQPA 4IFYA 2ZE2A 2HNYA 4CBWA 5CHIA 2XY8A 3TAGA 2HBLA 4A2AA 1S1TA 3O9QA 3ITHA 4U7BA 2OPSA 3WNHA 4B3RK 2XY5A 2CH6A 4AHSA 4JK7A 2Q97A 2Z1HA 3QESA 3O1WA 3TARA 4CK2A 1JLEA 3ZCMA 1YTUA 4BY9C 4C8LA 4FVUA 2E2PA 2KTQA 2ZM6K 5DMRA 2RF2A 3NHGA 4KHYA 3G4SN 3FZMA 2HB5A 2FLOA 1S72N 4DV5K 5HRPA 4DQRA 2DFHA 1XMOK 3VENA 3O1BA 4RW9A 2WFBA 4BGBA 5J2MA 4RW8A 1VQKN 5M1KA 1RCHA 4BR9A 4FJMA 3BEXA 1QQNA 2HMPA 3HM9A 2BANA 3V1OA 1WSFA 4GNIA 4MO4A 4JI2K 3H1VX 1DTTA 2IS3A 3BZKA 4AH9A 3SNNA 5HBMA 1S22A 4LSLA 3SUPA 4BC3A 4K8XA 1FXXA 3O08A 5M1PA 1BQMA 1TKZA 3BF1A 3E01A 1IBMK 4RW4A 3D2EB 2QK9A 4AM6A 4CZLA 3OYEA 1LWFA 1NGEA 1EQYA 1IKWA 4IOXA 5FROA 5CYMA 1C0FA 1R59O 2F96A 2QWOA 2WOMA 5FRMA 3NH1A 4B9LA 3LANA 3WNEA 5FDLA 1S6PA 4WF9L 5HRRA 4H5TA 3OS2A 5IWAK 3CFOA 2CGLA 4NXNK 3AVJA 3VEVA 4CJ7A 1WOQA 3QFUA 1GLLO 1O1WA 4JI8K 2HBJA 1S6QA 4DQSA 3HJFA 4CJVA 1X9JA 3R8EA 2AP1A 4Z4CA 4E7JA 3AGRA 3TSPA 1J6ZA 4QOZB 4FO0A 4YNQA 2KLAA 3KTQA 1QHAA 3FLCO 3L0QA 5J2PA 1WSJA 4FJHA 4ZHRA 1VSJA 3V9UA 2YX6A 1YF5L 4H4MA 3QETA 3SUNA 3J7AP 1Q81O 1OKJA 1Z05A 5AZJB 4GKKK 3OYNA 4FWMA 2VQFK 4FM2A 4B9NA 1ZBFA 4IZ9A 2D0CA 3AO1A 3ULDA 1Z6RA 3WXJA 5AQGA 1TK5A 4JI5K 3VQQA 1IJJA 4CHZA 1NMNA 3D2EA 2YHWA 3HSCA 4DTRA 1E3MA 1HPZA 4IOCL 4DV4K 3DLEA 4DS4A 3H1QA 4DTJA 4RTFD 4JK8A 3ZX0A 4DSKA 3AVNA 4YOYA 3KZBA 4LFAK 4QS7A 3MMVA 2XY6A 1IBKK 4B1YB 1S9GA 3TAFA 2YNGA 2BDPA 4YDUA 2GTDA 2UUAK 4EP4A 4DF8A 3AAPA 1RT4A 4FLWA 1N6QA 4KFBA 3NGZA 3LDLA 3SK3A 4CZIA 3NVKA 2WTUA 3TR8A 1X9WA 4KB0A 5ADXH 5SZTA 3L3VA 4NCGA 4FSVA 1HJOA 1RNHA 4WQ4C 4ZTFA 5HRNA 2FSJA 1QVFM 3DOKA 1Q18A 4JI3K 3PX0A 1YJWN 2KW4A 4M45A 4MDAA 5AQTA 2UXDK 4CBXA 2JGUA 3KIOA 1GOBA 1LAWA 4M7YA 1NJXA 4CF1A 1RDCA 5A2QO 4CHNA 3E9LA 5AZJA 1U49A 3E1YA 4JLHA 4QS8A 1SKSA 3AARA 4F2SA 1ATRA 4CJLA 1XI1A 3SQ1A 4C8NA 4DU1A 3THXB 1EP4A 1SL0A 4FJ5A 5AQFA 2IVOA 3VF4A 4DSIA 3ID6A 3WEEA 2OZMA 2Q3SA 2NZTA 4ELTA 1DGKN 1NK0A 1LWCA 3VQAA 3U9ZA 1QS4A 4E1MA 3E9OA 3QNNA 1L3VA 3WT0A 4PQUA 4CD3A 3VQ6A 4AF1A 5AJ3K 3H3NO 2NRXA 4C8MA 2YKNA 1GLFO 3P39A 4ILGB 4JI7K 2YI1A 3HXMA 3F5TA 2VG5A 5AQHA 5BPNA 1H1VA 3V9XA 3K5MA 1KRPA 3J81O 4ISGA 1UA1A 1U2VA 4JK9A 3VQ9A 3VA3A 3PO5A 3OS0A 2HHVA 3PY8A 4FYDA 3NAEA 4M3YA 4IKFA 4LSNA 1OH6A 4BREA 1U6ZA 3KHYA 4CFAA 2YNHA 3CCJN 1KC8O 1ZBSA 3AVKA 4B08A 4H0VB 2UU9K 2F4VK 4FXDA 3PUFA 2F8TA 1T8EA 2XO7A 4HWIA 4N56A 5E84A 3ZLJA 1J5EK 1TKDA 5BN9A 2FC0A 3CQ8A 4FLUA 1C1CA 1BWFO 4LH4A 2IVNA 4CJSA 4I9QA 4FJKA 3OJSA 4DR1K 2Y1JA 4H03B 3THXA 2RE2A 1Q9XA 2GWJA 4BC5A 4DR4K 3F73A 1IKXA 4A5AA 3U9DA 1ATNA 4JHDA 2ASPA 4BRMA 2AA4A 1W9HA 2Q36A 3SMSA 4IO8A 2OA8A 4DLGA 3FZFA 2EHGA 4B9MA 4NO7A 3C0BA 3FFKB 1RDAA 2HF4A 3D7EO 1L3SA 4HUGA 4O44A 3K5OA 3V9SA 1WSIA 5BRDA 2E2NA 4KHQA 3T1YK 3GBTA 4DV2K 3RRGA 1HLUA 3QEWA 3VQEA 3AAQA 3KK7A 5FRNA 1Q82O 1J54A 4O0IA 4ID1A 3MWPA 3H6EA 2P9PA 5BR9A 4OO1J 3HP6A 3TU5A 1BHLA 1W0HA 3M3ZA 4FJLA 4CJKA 2GBZA 1VQ4N 4LFBK 3KLEA 3AVHA 5LJWA 1D4XA 1RDDA 4IG3A 3NF8A 4GW6A 2DPNA 4CEQA 5JVGL 4FLYA 4FM0A 4DU4A 3C6HA 3G10A 3SAFA 1R0AA 3NBPA 3H45C 3SJJA 1WAJA 3TAMA 3MK6A 3SZ2A 4OVLA 1YIJN 2WONA 4DKWA 4A59A 3AVFA 2P1JA 4PA1A 3ZX3A 1W97L 4B9SA 4O5BA 3HO1A 3SAHA 1Q8IA 3KLGA 3KJVA 3CJ9A 5B8HA 3MWTA 2P9KB 2IAJA 1NK7A 5LJVA 3C7NB 1IBLK 2NRTA 3VGKA 4I2QA 2A40A 2O8BB 1HKGA 3V1RA 2B4JA 4H5RA 3NF7A 5BREA 4UY8O 1WSHA 4BE0A 3LP3A 3CM5A 4B3SK 1KLMA 1XNRK 3U3YA 4J2EA 4QS9A 2NRWA 4PKGA 2HF3A 4U67L 4DUYK 3SBTA 4H0OA 2R7YA 1IG8A 1IKVA 3ZSWA 1EWRA 1HYSA 3VGMA 2QA4N 2FF6A 5KGXA 3AO4A 3V9ZA 4YOVA 1TL1A 1I94K 2JWLA 5J1EA 4JI4K 2ATQA 1ITGA 3L6QA 3M8RA 2F7TA 1BL3A 4FZXC 4CEOA 4CEDA 2E20A 3L2RA 2ETJA 1XNQK 1VSLA 4J8FA 3CJAA 1N33K 4J2AA 4PWDA 2XHBA 1S9EA 1C0GA 2A3ZA 2ASMA 1D9DA 2PYJA 4DB3A 3AVIA 1BI4B 3LDSA 3HI0A 1NBWA 1G99A 1WNSA 2YHYA 3VQ4A 1HYVA 3HVTA 1KAZA 1NKEA 4E3SA 1HNVA 1RTHA 2YHBA 3ZSQA 3OYJA 1LW0A 4DTNA 1QHTA 4BQZA 1NGCA 4H0TB 3OYMA 3QEXA 2O4GA 4F2RA 3C7NA 2ITGA 4KH4A 1RT1A 2G8FA 4Z4FA 3EKUA 3PIPL 1TKXA 1JLCA 1N5YA 5DM6L 4M7XA 4J2DA 4NLBA 3DYAA 4H0XB 1W7AA 5EY4A 3TI0A 1SL1A 1RT6A 1OVYA 3TWHA 1K9MO 4FJ9A 5C15A 3SLCA 1KVCA 3F2KA 2XY7A 4FWOA 3CCUN 3OBYA 3VGLA 4AHUA 3MEEA 4DR5K 2UXCK 3AVLA 1KXPA 5JMVA 1D9FA 3HK2A 3UKUB 1VQ8N 3O80A 4CESA 1KD1O 1X9MA 3KWGA 3O5BA 4PUOA 1U47A 1EX4A 4CJEA 4FWSA 3IG1A 5HRSA 2QWRA 4RG8A 1HJRA 2PY5A 1Q9YA 3PX6A 3MN6A 4DR6K 3CPEA 1VHXA 4H5NA 3O9TA 3BUZB 4BRKA 4F4KA 4F9OA 3R6MA 3TAEA 4PL8A 4JKCA 1QZ6A 2ZD1A 1TKTA 1BI4A 4DFKA 3Q7CA 1VSMA 3VERA 4IDKA 4CHYA 1NK6A 2G8KA 4NCBA 4W5NA 3ATVA 2X6SA 3RSEB 1JL2A 1HYZA 5FPMA 4C23A 3VA0A 4CHOA 4FLTA 4C1NI 4DTMA 3L3UA 2ZF5O 1NWKA 3IS9A 5EU7A 2PYLA 4DSLA 4E1NA 2PAVA 1QSSA 4LY7A 3KKSA 5EX5A 4KKOA 1SQKA 4FCYA 4BRQA 4KAZA 5KQDA 2P9SB 3AA2A 4CZJA 3SQ2A 4B9TA 4KH6A 5M1OA 4FJ8A 1BG3A 1IH7A 2FBYA 2O8FB 4DF4A 1VQON 3LPUA 4FWNA 2QWQA 3EE9A 3UKUA 3A8YA 1XHZA 1HRHA 4B3OA 1YT3A 2IOCA 4CGDA 4O8KA 3WUHA 3ZSVA 2HHQA 3ZT1A 4ISFA 3O8MA 3OYHA 1Z26A 4MLEA 3NMUA 3GDQA 5GINA 4UQGA 5F2RA 4FZZA 4CJPA 1WBDA 4B1WB 2HBMA 3BGRA 4DV3K 5TKWA 3OYFA 3D0PA 3VQPA 3I8DA 3RSEA 4CJ3A 3CHWA 4EHTA 1MWMA 4KI4A 1YUWA 3MX2A 2KZMA 1O13A 1QTMA 3NH2A 5AQKA 1XC3A 2KKZA 4RCHA 3AVAA 2OTJN 4H0YB 3OVNA 5AQRA 1T3VA 2D0BA 4FJ7A 2VGNA 4O4GA 4LFCK 2HVHA 1GLDG 3H3OB 1DKGD 4CFCA 3J7ZO 2A6AA 1K8KA 2NUBA 3ZSXA 4CEBA 3MEDA 4EIAA 4HUFA 3SV4A 4FLVA 1HNXK 1JLFA 4HCCA 3E66A 1C1BA 2O8CA 3NF6A 2KFZA 3RRHA 2P9SA 4CF0A 5F1XA 5FPNA 3D6RA 2O8FA 2IIRA 3C65A 2Q0UA 4LF5K 3DLRA 3H08A 2I7NA 1SL2A 3KK2A 3IMXA 1NK9A 4X65K 1QQOA 2UUCK 3A0IX 4NYFA 3VESA 2HHUA 3ENHA 4LC9B 3GE1A 3T7ZA 2HW3A 1JL1A 3O3HA 4JKEA 3MN9A 1HKCA 4AM7A 5T7BA 4BR7A 5KRTA 1BUPA 2NRVA 1IKYA 3SUOA 3BP8A 4FWRA 2V7YA 4M3WA 2D5RA 4F3OA 1GLJO 2Z1GA 3WQTA 1BO5O 1QE1A 4DTPA 3ZT3A 1LV5A 4HTLA 2ZWHA 3O3GA 4DLEA 3B6PA 5KGWA 4MO5A 3HOSA 3MDQA 1NJWA 5BPLA 4H0PA 3RMBA 2P5GA 3EY1A 4M3RA 5ADXA 4BQLA 3U3GA 1ZBIA 4DR3K 4K41A 2V52B 3BF3A 4GVMA 1RBVA 2I5JA 4FJIA 1OH7A 3OBWA 4WYBA 4L3QA 4HCBA 1HKBA 1NGHA 4R79A 2PBDA 3DAWA 5DM7L 4M63C 5AQSA 1FK9A 4YOUA 1KLNA 3I8BA 1S1XA 3AVCA 3OTOK 4XH4A 4IEEA 3NH0A 4DV1K 3WEEB 4YOWA 2A5XA 4EP5A 1S3XA 3DLHA 3CERA 2RHKA 2GV9A 4RWTA 4E7HA 1VQMN 3AO2A 3O4NA 4X64K 4AHTA 1VK0A 2ZJRL 2B6AA 4LF4K 2QXLA 2HOEA 3RR7A 4CGIA 3BDPA 5KTQA 3FFIA 5C24A 1NJIO 4EFHA 5AQUA 4BG8A 4A5BA 1LAVA 3TTCA 3J7YP 4Z4GA 4DTXA 4FZYA 3L4QA 1GLEG 4QAGA 1U2VB 3RMCA 3QEPA 4B1XB 3EZWA 2RN2A 2Z1IA 1ZBUA 3WXIA 2BTFA 1JKHA 1M90O 1HUXA 1CZAN 4B9VA 3HL8A 3OA9A 4GMJB 3NVMA 3ENBA 1WUAA 4JKGB 2V51B 4W5OA 3O3FA 1VQNN 1J9AA 3LAMA 4YORA 4JV5K 3KWIA 3SBGA 1IO2A 3WXMB 4CHPA 4AQYK 3W3DA 4G9ZA 2HHXA 4WQ5C 4Y0WA 2JWKA 2GEMA 2WC9A 3SQ0A 4LF6K 3ENOA 3LP2A 2G8WA 2YNFA 4GY2B 2P9UB 4B8AB 4ZTJA 3LPTA 4DV0K 1TAUA 1BISA 1SV5A 1EXQA 3CCVN 1X9SA 4FJJA 3P31A 1Z25A 4FW2A 3AO5A 2I7PA 4JHDB 1WAFA 1RT7A 1SZ2A 3WNGA 3K5LA 1TVRA 4B3MK 4DQ8A 5I9EB 1NMDA 1BA0A 3DRRA 4WFAL 4JS4A 3ZSYA 1MDUB 3NFAA 4IFVA 2FSNA 1MA9B 3M1FA 5HOOA 3G0ZA 1IV0A 4CEAA 5BPMA 3K9KA 4FL9A 2UYTA 4FLXA 1VQ9N 1DEJA 1KTQA 4BRLA 2UUBK 4CCHA 4DQQA 2LSNA 1ZC6A 2A42A 1RTDA 3DI6A 3AY9A 1KVAA 2E2QA 3DLBA 2P9PB 3BZCA 1DTQA 2OTLN 5GAHP 1YHQN 4O8UA 3AGKA 5GIPA 5BN8A 3L2QA 3TTDA 1SKRA 5E41A 5JVHL 3A5NC 1RDWX 4DTOA 5IT9O 1DLOA 4JKGA 4PY5A 5AQWA 3ZYYX 1NJZA 3MXIA 3ALYA 1NKBA 4JI6K 1C0MA 4H4OA 4CGJA 3ULEB 2JLEA 3R1XA 3ATUA 4CECA 4BR0A 1EETA 3MCAB 3CC7N 5KI6A 1JLQA 2GX9A 5MLCQ 2ZJPL 5AQVA 3KLHA 2VG7A 4IDHA 3ZSOA 5C10A 4DFMA 2P9UA 4MQ3A 4DFJA 2GUPA 3P1GA 4K43A 3ZSZA 2D0AA 1NGBA 1NGDA 5GAGP 1HX1A 4BC4A 2OPQA 4CJFA 2GUIA 3NDKA 4DTSA 3P83D 1BQNA 2KHOA 3ZSRA 1NK8A 3L2VA 3EYZA 4I9LA 4OJRA 4PHTX 1N8RO 2QKBA 3QDKA 2IVPA 4LD0A 1VQLN 1VQ6N 2YHXA 1RDBA 1C6VA 3K9JA 1XWLA 2QKKA 4GV9A 3OYLA 3M8PA 3TSUA 3TABA 4BRFA 3KD1E 1ILYA 5M1NA 1KSPA 3VF2A 1TL3A 4JAXA 4CF8A 1YJNN 4FK0A 4BR4A 1Y64A 2VWBA 4CGHA 3CF5L 4HHTA 1RFQA 3S3MA 2W6KA 3VQBA 3W0LA 5M1QA 1E4GT 3NE6A 5FPEA 1N34K 1JCFA 3SCXA 3VPZA 4HTUA 3ULEA 2E6LA 3NF9A 4FWPA 3HVRA 2CGKA 4OGEA 4AHRA 4OPKA 4FLZA 4DSFA 4I7FA 5I42A 4CIEA 3DMJA 3MX5A 3EO3A 3C6UA 3NGYA 3K5NA 3OY9A 2P9LB 3C94A 1ZBHA 3CCSN 4GV3A 4DMNA 4M3UA 1YTAA 1BIZA 4BWJA 3VEOA 3O9RA 4O5FA 1CXUA 4AILC 4KHPK 4BE2A 3RMDA 2PZSA 3QICA 1T44A 5HROA 1WBBA 1CZBA 1NGJA 1BOTO 4Z0UA 3ID8A 4DSJA 4E1JA 4CBUA 4KTQA 2VQEK 3UB5A 3OYCA 2YNIA 1RTJA 5C25A 3JYTA 3K58A 3N4PA 4BRDA 1KAYA 4X66K 3J80O 4RW6A 2X78A 3JAMO 1I39A 1VSFA 2HBKA 4L8RB 3TAPA 2YV0X 4IO9L 1FW6A 2BUPA 3V1QA 2F9TA 2PFUA 4FVMA 5KQ8A 2VWKA 3BY5A 4CW7B 3VTHA 1D8YA 3EL2A 4IJNA 4A2BA 3PV8A 1QSYA 2FBTA 2FF3B 1TGOA 1K6YA 4JD2B 1VSEA 1I3AA 4CJRA 2E1ZA 3R3LA 5DK5A 1NK5A 4CK1A 4KPYA 1UWBA 3D2FA 2QWLA 4YDUC 4N47A 2EX3A 3SMPA 2IC3A 4YY3K 4DR2K 3NCIA 1B9FA 3UE5A 2Z1JA 1Q7YO 4BR5A 1GLAG 2D0PA 4LF9K 1V4SA 2P9LA 1RILA 1KFSA 2P9IB 3VOVA 3H46O 5AQPA 1CLQA 1OVQA 5D3GA 4CZKA 3LP0A 4JI0K 1TK8A 3SV3A 4B1ZA 1ASVA 2DFEA 2A1SA 1Q86O 1ATSA 2D1KA 3HP9A 3FZLA 1RBTA 3LWLA 3VQ5A 4J2BA 3VQ8A 3O6WA 3HZ6A 3OS1A 3IFRA 1HNWK 1P8ZA 1SAZA 2HSTA 3CQXA 5CR4A 3PSIA 3OYDA 5AZIB 5C2FA 3PSFA 5CY4A 4FPBA 3CYMA 5HP1A 4CD1A 4WCEL 4BG9A 1KFDA 2VG6A 1JXEA 1RBUA 2A1RA 2P5OA 1NGGA 4IXCA 3VEXA 2ZGZA 4CIGA 5AQNA 3CMEN 3AA4A 3CXCM 3SQ4A 1ESVA 4CEEA 1XHXA 5AQOA 5GADP 4I6MB 2QEXN 3F9MA 1SUQA 4WQ4A 4N5SA 1K8AO 4JD2A 4JKAA 4Z4HA 4BC2A 3OYIA 3R9PA 3CJ7A 1REVA 3IRXA 3L4IA 5AQYA 5C12A 4X62K 4DSEA 4EAHD 4PKHA 1F21A 4M3XA 3DLKA 2YJFA 2ITMA 3CMAN 2G8VA 1NU0A 4CJTA 1VQ5N 3KD5E 4C8OA 1TYQB 2ZQBA 2P9IA 4CF9A 4DR7K 3B6OA 1N32K 2NRRA 2GWKA 2W41A 3A5OC 2AJQA 1VAZA 5KPTA 5J2QA 4JN4A 3KLIA 1BGXT 1K8KB 2YCHA 2OYQA 3K0SA 3WXLA 3D45A 2O8CB 3J8AA 1OH8A 3U6FA 2IDOA 1GOAA 1MWKA 3LDNA 1MU2A 4K25A 3K2PA 1RGIA 3QIOA 4JKBA 4IEIA 4YHHK 1L3TA 3O4WA 4DU3A 4A61A 2Q2RA 4KO0A 5AZIA 1RT2A 5HL7L 5K14A 1TK0A 2QI2A 2QXFA 2ZJQL 4A57A 3HTVA 4BWMA 1VQPN 2Q1NA 4E19A 5BRFA 3LP1A 3VEWA 3MN5A 3ZT0A 5LMUK 2NRHA 4DV6K 1RDUA 4DS5A 3EN9A 4E89A 4I6MA 5AFUH 4F3TA 2A41A 1S5JA 2OANA 1T6CA 3LM9A 4DHYA 1JLBA 3DXMB 4OKJA 4CJQA 3LL3A 5CZ2A 3CPWM 4OGCA 3A5MC 3V9WA 4BRPA 5AQLA 2QW9A 3QMLA 4FWKA 3TTFA 1TYQA 3LM2A 4OX9K 3RVCA 4BRHA 1RT5A 4KHSA 5J2NA 5F0XA 1VSIA 4XIUA 4JYAK 3LZIA 2QWPA 4ISEA 5AQIA 2P51A 4FPAA 4QCLA 4ILJA 1W2BM 4NLCA 3S41A 3A2FA 1NM1A 3CCLN 2F8SA 5KPRA 1VRTA 5JLFA 3QERA 1TUYA 3KVGA 3M8SA 2ZGYA 1VSKA 2V7ZA 1NJYA 1JXBA 1EO1A 2GELA 4BRCA 2OZSA 3CFRA 4H5WA 3OW2M 4W5QA 5LMNK 2VYPA 1JCEA 3OHRA 4I2PA 4JS5A 3P5JA 4GKJK 3CC4N 5BRHA 1B92A 1QQMA 3V81A 5EVZA 3CETA 3MECA 2G8UA 4KB1A 2YHAA 2HNZA 1NGAA 3DXMA 4O55A 2NRZA 4WFBL 4Z4EA 3AA3A 1E4FT 2NLXA 2YKMA 4NXMK 2HMIA 4OKEA 4FM1A 3CCRN 5KPZA 3TANA 3RMAA 2UXBK 3C95A 1L3UA 1U45A 4CEFA 1KAXA 1LOTB 4JRPA 1BU6O 3MXMA 3QB0A 4CZGA 3OJUA 4BRIA 1ZYQA 1C0UA 4KBOA 4BRGA 1HNZK 3WQUA 1NOZA 3M6GA 3HPHA 5M1FA 2J4RA 3WXKA 1VSDA 1YI2N 4OLBA 4IWVA 3VQDA 4N41A 3AA5X 2ASOA 1NK4A 3DLGA 3FZKA 4JKHA 2XRIA 2Y1IA 3P38A 1HR0K 3DM2A 4N76A 5AQQA 4K42A 2E2OA 2DTUA 4W5RA 3FE1A 3CCMN 2OPPA 1UA0A 4XH5A 3ZT4A 4BVOA 4BDZA 2G8HA 3SPYA 2O4IA 3FZHA 5C2DA 1QZ5A 2Q0RA 3CJBA 4G1QA 2F9WA 1G15A 3AVBA 5I3UA 4KH5A 3G25A 1NKCA 3L2WA 4PL7A 2VGMA 2G8IA 2O8DB 4JRQA 1WSGA 3OYKA 5KRSA 3RTVA 3VETA 4M42A 3CIPA 2X6NA 2HVIA 4DQIA 3FR0A 3AV9A 4KV8A 3MAQA 1LCUA 3VEZA 3I56N 3SUQA 1N36K 5TKYA 3T3FA 1XMQK 4CK3A 3Q7BA 4M41A 4OPJA 4EZ6A 1S1UA 1GLCG 1YAGA 4KI6A 1FKOA 4EHUA 2OPRA 4E0DA 1A5WA 4KTZA 2HHTA 3HYFA 3S9HA 4BRAA 1GOCA 3KK3A 4XH1A 3MCPA 4IFEA 4H8KA 1VRUA 1EWQA 3C6TA 3VF6A 4FK4A 3T1AA 2FSKA 2QTDA 4IJAA 1X3MA 4BDPA 3EEQA 4Q5VA 3JS6A 2P9NB 3I33A 4CZMA 3E9PA 5GAEP 2NNWA 3PO4A 3O9UA 3CCQN 3DRSA 2E1YA 2VCPA 2X74A 3NGIA 5E26A 3LZJA 2O8EB 1ASUA 4CFBA 1XQSC 3N4QA 3OYGA 3L2UA 1S1VA 4K0KK 2O8DA 5C0YA 3DJCA 1U4BA 4EZ9A 2BH1A 3O9SA 4CHQA 3VN5A 3HPOA 3QIPA 1JLAA 3DRPA 1C1AA 1TUUA 1BCOA 4GV6A 1XUPO 3ZX2A 1M1KO 4H5VA 1RBSA 4E7KA 4B9QA 3HRGA 4CF2A 4FWQA 2E4LA 1Y97A 4RW7A 1HMVA 1ZXOA 3UKRB 3GOIA 3EZ5A 2DFFA 4DV7K 3PLAA 3CG7A 4OKKA 1L5UA 4BR2A 1GLBG 3LALA 2YJEA 4B3TK 1QQCA 5FPDA 2FXUA 4KHNA 2HHSA 1KQSM 5EOYA 4FJXA 1D5AA 2QWNA 1J5OA 3CFPA 4F8RA 1XC9A 2E88A 2FBVA 4GVEA 1UAXA 2W6LA 3DLLL 4MFBA 1V4TA 4CI6A 4AHVA 1ASWA 3P4IA 4FJGA 4FK2A 1NG9A 4DWIA 2QM1A 1A5XA 3F9KA 1VQ7N 1WB9A 1DT9A 4DG1A 1VSHA 3S3OA 2Q31A 1RBRA 5LY3A 4KTWA 4BGAA 2P9NA 3O4QA 3HPGA 1S1WA 1NGIA 4CEZA 4OPHA 3ZEUB 3VQCA 1CXQA 5JLHA 4R5PA 3LDPA 3ZT2A 4PKIA 2HHHK 4NB4A 4K8ZA 5BR8K 4JI1K 2O8EA 2CGJA 2RPIA 3THYB 4ELUA 3CD6N 3HOTA 3QEIA 3B8AX 3HT3A 3PX4A 1C0TA 3I0RA 1U48A 1BA1A 4Y1CA 4BVPA 1SKWA 3EE8A 1LWEA 1T7PA 2KFNA 4YOTA 1BIUA 3LDOA 4M3ZA 3V6DA 1T6DA 4FJNA 3CC2N 1JLGA 4M3TA 2WBNA 3U8XA 3UKRA 4V19S 1P90A 3CM6A 4CE9A 3AVGA 1FJGK 1T05A 5AQZA 5SWMA 4DFPA 1OH5A 3D2FB 2VWJA 4CIFA 5AQXA 3ZETB 4BDYA 3LWMA 1YVNA 3QLHA 3VQ7A 1B9DA 3I55N 3JXUA 3SJHA 3T1HK 2HNDA 4CFDA 4E7LA 3VTIA 4B1VA 5GIOA 1X1PA 3V4IA 1K73O 3K57A 3DXKB 3WNFA 5H1SQ 3K59A 4KRFA 3JSMA 3IUCA 1TAQA 1KVBA 3AVMA 1ZBLA 1J53A 4BRNA 4HVJA 4AHCA 4CGGA 5FLXO 3ZEUA 3KLFA 4W5TA 4XEIA 4OPAA 4KREA 2WUSA 5AQJA 2FBXA 3PIOL 4Y1DA 3QO9A 4MLHA 4BACA 3THYA 3FGUA 4ILHA 2E8AA 2E5LK 3THVA 2EWSA 4TSXA 5AQMA 3A5LC 3QINA 3RR8A 1IG9A 1HQEA 4CJUA 3OYAA 3G71N 5JS2A 3SI6A 3MEGA 1HQUA 3AO3A 2B5JA 5JS1A 2W40A 4CJWA 2H3GX 3MN7A 1FKPA 4BROA 3HBTA 4Q0BA 3T69A 1NLVA 1YXQA 4CZFA 3I0SA 3RWUA 4OLAA 2W42A 3ZETA 1T03A 3CJCA 1JJ2M 3LAKA 3IKMA 1HNIA 3GG4A 2IGIA 2HHWA 1QVGM 2RKIA 4Z4IA 3C6AA 3QFPA 3DXKA 4NCAA 4O0JA 4B9UA 4E7IA 3CQYA 5CE3A 3QNOA 3CI5A 5LL6Z 3OYBA 2DY4A 4ICLA 5HLFA 1HPMA 1WN7A 3SYZA 4CGFA 3ASMA 3VEYA 2E6MA 3THWB 3EKSA 1TV6A 1LW2A 2D4WA 4YOXA 2P9KA 1WSEA 4C8KA 4C1NK 4JKFA 2O8BA 3QBXA 5CZ1A 3TSQA 3DOLA 3HM8A 1A5VA 3VMFB 2D0OA 4CJ5A 4FWLA 1NNEA 4CERA 4IG0A 3S3NA 1YJ9N 4ID5A 4WFNL 1QSLA 3LDQA 2BE2A 3SAGA 3KK1A 2OCEA 2KZZA 4WE1A 3TPQA 4LF7K 1YVUA 5AR0A 5EXWA 3IDHA 5CYQA 3ISNC 3HSTB 4IBNA 3GL1A 1RTIA 3QEVA 2QWMA 3KKRA 1BCMA 5ELZA 1EKEA 5AFUA 4KHWA 1UOCA 3T19A 1CZ9A 3M5RA 4FOIA 4A62A 3CJ1A 4NYNA 5JICA 4ELVA 4CJ4A 3G6EN 4B8CA 1U04A 3QBWA 1KCFA 1RT3A 4B1UB 4WQ5A 4JEPA 4Z94A 3IAYA 4DCHA 4CVNE 3CCEN 4IOAL 5C42A 4CZEA 4BE1A 4KHUA 1BDGA 3MXJA 3SPZA 3L8BA 4LH5A 1NOYA 2CH5A 4JKDA 3M8QA 4HUEA 3THWA 1YITN 4MDBA 4DTUA 4JNEA 4CZHA 4FW1A 4YFUA
chains in the Genus database with same CATH topology
2E2QA 2P9PB 4QS9A 2OTLN 4KBOA 5GAHP 2NRWA 1YHQN 4BRGA 4PKGA 1JCGA 2HF3A 1SS6A 4O8UA 4U67L 3WQUA 3SBTA 3AGKA 4H0OA 5GIPA 5BN8A 1IG8A 3M6GA 3TTDA 5JVHL 3A5NC 1RDWX 3U4LA 3VGMA 4JKGA 3DWLA 1NGFA 2QA4N 2FF6A 1X3NA 5M1FA 2J4RA 5AQWA 4FOEA 3WXKA 3ZYYX 4YOVA 1YI2N 2JWLA 4CBWA 5CHIA 4IWVA 2HBLA 3L6QA 3ULEB 4A2AA 3R1XA 2F7TA 3ATUA 3O9QA 2ASOA 4BR0A 3MCAB 2E20A 4U7BA 3CC7N 3FZKA 4JKHA 2GX9A 3P38A 5MLCQ 2ZJPL 5AQVA 5AQQA 4J8FA 4K42A 2CH6A 2E2OA 3CJAA 4IDHA 3FE1A 5C10A 4JK7A 3CCMN 2Q97A 3O1WA 2P9UA 4XH5A 4BVOA 1C0GA 2A3ZA 2ASMA 2GUPA 4K43A 3FZHA 4BY9C 5C2DA 1QZ5A 4DB3A 2Q0RA 3CJBA 4FVUA 2E2PA 1NBWA 3HI0A 2F9WA 1G99A 1NGBA 1NGDA 2YHYA 5GAGP 1HX1A 4BC4A 1KAZA 4KH5A 3G25A 2KHOA 4PL7A 2VGMA 4BQZA 1NGCA 4H0TB 3G4SN 3FZMA 1N8RO 4PHTX 2FLOA 1S72N 3QDKA 2IVPA 3VETA 3C7NA 3CIPA 4KH4A 1VQLN 3FR0A 1VQ6N 3EKUA 2YHXA 3PIPL 1LCUA 3K9JA 3VEZA 3VENA 5DM6L 3O1BA 3I56N 4M7XA 4NLBA 4H0XB 5TKYA 4GV9A 2WFBA 5EY4A 4BGBA 3TSUA 1OVYA 1K9MO 3Q7BA 4BRFA 5C15A 1VQKN 5M1KA 3SLCA 1ILYA 3F2KA 5M1NA 4FWOA 3VF2A 4BR9A 3CCUN 1GLCG 1YAGA 3BEXA 3OBYA 3VGLA 4EHUA 1QQNA 4JAXA 1YJNN 2HMPA 4BR4A 1Y64A 2VWBA 3CF5L 4BRAA 4GNIA 1KXPA 4MO4A 5JMVA 1RFQA 3H1VX 3W0LA 4XH1A 3MCPA 4IFEA 5M1QA 1E4GT 3UKUB 1VQ8N 3O80A 1KD1O 5FPEA 1S22A 1JCFA 3KWGA 3O5BA 3VF6A 3VPZA 4BC3A 3ULEA 4FWPA 3O08A 5M1PA 4FWSA 2CGKA 2QWRA 2FSKA 2QTDA 3BF1A 1X3MA 4IJAA 3MN6A 3D2EB 3JS6A 3EO3A 3MX5A 3CPEA 4AM6A 4H5NA 4CZLA 3O9TA 2P9NB 3I33A 4CZMA 1NGEA 1EQYA 3BUZB 3E9PA 5GAEP 4BRKA 2NNWA 4F9OA 4IOXA 2P9LB 3R6MA 3CCSN 1C0FA 1R59O 4PL8A 4GV3A 3O9UA 1QZ6A 4JKCA 3CCQN 2QWOA 3Q7CA 2E1YA 2VCPA 5E26A 3VEOA 3O9RA 3VERA 4O5FA 1XQSC 3ATVA 3N4QA 3QICA 4WF9L 3RSEB 1T44A 5C0YA 4H5TA 3DJCA 5FPMA 1NGJA 1BOTO 2BH1A 3ID8A 3O9SA 4C23A 4E1JA 2CGLA 4CBUA 3VEVA 3UB5A 4CJ7A 4C1NI 1TUUA 1WOQA 2ZF5O 4GV6A 1NWKA 3N4PA 3QFUA 1GLLO 1XUPO 3ZX2A 4BRDA 1KAYA 2PAVA 4H5VA 1M1KO 2HBJA 4B9QA 3HRGA 5EX5A 4FWQA 2HBKA 1X9JA 3R8EA 1SQKA 2AP1A 1ZXOA 3UKRB 4IO9L 3GOIA 3AGRA 3PLAA 2BUPA 3TSPA 4BRQA 5KQDA 1J6ZA 2F9TA 2P9SB 1GLBG 2PFUA 4BR2A 4FO0A 4CZJA 2KLAA 5KQ8A 1QHAA 3FLCO 3L0QA 2YJEA 4KH6A 5M1OA 5FPDA 2FXUA 3VTHA 3EL2A 4IJNA 1BG3A 2YX6A 5EOYA 1YF5L 4A2BA 1KQSM 1Q81O 1VQON 2FF3B 1OKJA 1Z05A 2QWNA 5AZJB 4FWNA 2QWQA 3EE9A 2E88A 3UKUA 4FWMA 4GVEA 3DLLL 4JD2B 1V4TA 3A8YA 4CI6A 4IZ9A 3P4IA 2E1ZA 1Z6RA 3R3LA 3WXJA 5AQGA 2QM1A 4O8KA 3WUHA 3D2FA 1VQ7N 2QWLA 4YDUC 4ISFA 1DT9A 3SMPA 3O8MA 1IJJA 2Q31A 3D2EA 2YHWA 3HSCA 5LY3A 3UE5A 4BGAA 4MLEA 2P9NA 1Q7YO 3NMUA 3GDQA 5GINA 4BR5A 4IOCL 1GLAG 2D0PA 1NGIA 4OPHA 3ZEUB 1V4SA 2P9LA 3H1QA 4RTFD 5F2RA 5JLHA 4JK8A 3ZX0A 4YOYA 3KZBA 2P9IB 3VOVA 3LDPA 4PKIA 3H46O 4NB4A 4B1WB 2HBMA 5AQPA 4QS7A 3MMVA 2CGJA 4B1YB 5TKWA 4CZKA 4YDUA 2GTDA 4B1ZA 3RSEA 3CD6N 3CHWA 4EHTA 3HOTA 1MWMA 3AAPA 3B8AX 1Q86O 1ATSA 1YUWA 3MX2A 1O13A 2D1KA 1BA1A 3FZLA 5AQKA 4BVPA 1XC3A 2KKZA 3NVKA 3LDLA 4RCHA 3SK3A 4CZIA 3EE8A 2OTJN 3O6WA 3HZ6A 4H0YB 5ADXH 3IFRA 1P8ZA 5AQRA 1SAZA 1T3VA 4YOTA 2HSTA 2VGNA 4FSVA 3LDOA 3CQXA 5CR4A 1GLDG 3H3OB 1DKGD 1HJOA 4WQ4C 1T6DA 3J7ZO 2A6AA 1K8KA 4EIAA 5AZIB 2FSJA 5C2FA 3CC2N 1QVFM 2WBNA 4FPBA 3U8XA 3UKRA 1P90A 3E66A 1Q18A 4CD1A 4WCEL 1YJWN 4BG9A 5AQZA 2P9SA 4MDAA 5AQTA 4CBXA 5F1XA 1NGGA 4IXCA 5FPNA 3VEXA 3D2FB 2ZGZA 5AQNA 3D6RA 3CMEN 4M7YA 5AQXA 3CXCM 2IIRA 1ESVA 3ZETB 3C65A 3E9LA 5AZJA 2Q0UA 5AQOA 3E1YA 1YVNA 5GADP 4I6MB 4QS8A 2QEXN 3F9MA 2I7NA 3AARA 3I55N 3JXUA 3SJHA 1ATRA 4WQ4A 1K8AO 4JD2A 4JKAA 3IMXA 3VTIA 4B1VA 4BC2A 1QQOA 5GIOA 3R9PA 3A0IX 3CJ7A 3VESA 1K73O 3ENHA 4LC9B 3DXKB 5H1SQ 3GE1A 3L4IA 3T7ZA 5AQFA 2IVOA 5AQYA 3VF4A 5C12A 4JKEA 3ID6A 3MN9A 3WEEA 3IUCA 1HKCA 4AM7A 4EAHD 4PKHA 4BR7A 1BUPA 2NZTA 2NRVA 4BRNA 1DGKN 2YJFA 2ITMA 3CMAN 3U9ZA 3BP8A 4FWRA 3ZEUA 3E9OA 2V7YA 1VQ5N 3WT0A 1GLJO 4XEIA 4CD3A 1TYQB 4OPAA 3WQTA 1BO5O 2P9IA 4AF1A 3H3NO 2WUSA 4HTLA 5AQJA 2ZWHA 2NRXA 3PIOL 2NRRA 4MLHA 1GLFO 2GWKA 3P39A 4ILGB 2W41A 3A5OC 4MO5A 3HOSA 1VAZA 2YI1A 3FGUA 3F5TA 3MDQA 5AQHA 5BPNA 1H1VA 5KPTA 4ILHA 4JN4A 5BPLA 4H0PA 1K8KB 2E8AA 2YCHA 4ISGA 3WXLA 5ADXA 4BQLA 2EWSA 5AQMA 3J8AA 3A5LC 2V52B 3BF3A 4K41A 1MWKA 1U2VA 3LDNA 4K25A 4JKBA 1RGIA 4JK9A 4IEIA 3O4WA 3OBWA 4WYBA 3G71N 4L3QA 4A61A 2Q2RA 1HKBA 1NGHA 4BREA 4R79A 1U6ZA 2W40A 3KHYA 2PBDA 5AZIA 2H3GX 5HL7L 3CCJN 1KC8O 1ZBSA 3DAWA 4H0VB 2QI2A 2ZJQL 5DM7L 3MN7A 4A57A 4M63C 4HWIA 3HTVA 5AQSA 4BROA 3HBTA 4YOUA 5E84A 3T69A 3I8BA 1VQPN 2Q1NA 1NLVA 1YXQA 5BRFA 5BN9A 4XH4A 3VEWA 4IEEA 3MN5A 4CZFA 1BWFO 3WEEB 2NRHA 3ZETA 1RDUA 2IVNA 3CJCA 3EN9A 1JJ2M 4YOWA 2A5XA 3IKMA 4I6MA 1S3XA 3GG4A 5AFUH 2A41A 2OANA 1T6CA 3LM9A 4DHYA 3CERA 2RHKA 4RWTA 1QVGM 1VQMN 3DXMB 4H03B 3C6AA 2RE2A 3QFPA 3DXKA 3LL3A 2ZJRL 2GWJA 4BC5A 3CPWM 3CQYA 5CE3A 2QXLA 4A5AA 2HOEA 3CI5A 3U9DA 1ATNA 4JHDA 2ASPA 4BRMA 2AA4A 3A5MC 1NJIO 2Q36A 3SMSA 1HPMA 4IO8A 5AQUA 4BG8A 4EFHA 4A5BA 4BRPA 3TTCA 3FZFA 2QW9A 3QMLA 4FWKA 5AQLA 3VEYA 3TTFA 1TYQA 3LM2A 3EKSA 4NO7A 3C0BA 3FFKB 3L4QA 3RVCA 1GLEG 2HF4A 1U2VB 4BRHA 2D4WA 3D7EO 4B1XB 4YOXA 2P9KA 3EZWA 5F0XA 4C1NK 4JKFA 5BRDA 2E2NA 3WXIA 3QBXA 3GBTA 2QWPA 4ISEA 2BTFA 1HLUA 5AQIA 3TSQA 4FPAA 3AAQA 1M90O 3KK7A 1HUXA 1CZAN 1Q82O 3OA9A 3HM8A 4ILJA 3VMFB 2D0OA 3NVMA 3ENBA 4FWLA 1W2BM 1WUAA 4JKGB 4NLCA 3MWPA 3S41A 2V51B 1NM1A 4WFNL 1YJ9N 3CCLN 1VQNN 3LDQA 3SAGA 3H6EA 5KPRA 2P9PA 5BR9A 4OO1J 3TU5A 5JLFA 4YORA 1TUYA 3KVGA 3M3ZA 2ZGYA 3KWIA 3SBGA 3TPQA 3WXMB 2V7ZA 5AR0A 1VQ4N 5EXWA 3IDHA 3W3DA 5LJWA 4G9ZA 4WQ5C 2JWKA 4Y0WA 1D4XA 1EO1A 2GELA 4BRCA 3GL1A 2GEMA 2WC9A 2DPNA 4H5WA 3OW2M 3ENOA 2QWMA 5JVGL 2VYPA 1JCEA 4GY2B 2P9UB 3OHRA 3C6HA 3SAFA 5ELZA 5AFUA 3CC4N 5BRHA 1QQMA 3CCVN 3M5RA 4FOIA 3P31A 3H45C 2I7PA 4JHDB 5EVZA 3CETA 4A62A 1SZ2A 3CJ1A 5JICA 3MK6A 4DQ8A 3G6EN 5I9EB 4DKWA 1YIJN 1NMDA 1BA0A 3QBWA 4A59A 4WFAL 1MDUB 4B1UB 3ZX3A 1NGAA 3DXMA 1W97L 4WQ5A 4JEPA 4Z94A 4DCHA 3CCEN 4IOAL 2FSNA 2NRZA 4WFBL 1MA9B 3M1FA 3SAHA 4CZEA 5HOOA 3CJ9A 1E4FT 5B8HA 5BPMA 3MWTA 2P9KB 2NLXA 3K9KA 5LJVA 3C7NB 2UYTA 1BDGA 4FL9A 2NRTA 3VGKA 2CH5A 2A40A 1VQ9N 3CCRN 1DEJA 4BRLA 5KPZA 1HKGA 4JKDA 4H5RA 1ZC6A 5BREA 4UY8O 2A42A 1YITN 1KAXA 1LOTB 1BU6O 3AY9A 4MDBA 4JNEA 4CZHA 3QB0A 4CZGA 4BRIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2Q A;  2P9P B;  4QS9 A;  4KBO A;  4BRG A;  4PKG A;  1JCG A;  2HF3 A;  3WQU A;  4H0O A;  5BN8 A;  1IG8 A;  3M6G A;  3A5N C;  1RDW X;  3U4L A;  3VGM A;  3DWL A;  1NGF A;  2FF6 A;  1X3N A;  2J4R A;  5AQW A;  4FOE A;  3WXK A;  4CBW A;  4IWV A;  3L6Q A;  3ULE B;  4A2A A;  3ATU A;  4BR0 A;  2ASO A;  2E20 A;  3FZK A;  5AQV A;  5AQQ A;  4J8F A;  4K42 A;  2CH6 A;  2E2O A;  3CJA A;  3FE1 A;  2Q97 A;  3O1W A;  2P9U A;  4XH5 A;  4BVO A;  1C0G A;  2A3Z A;  2ASM A;  2GUP A;  4K43 A;  3FZH A;  1QZ5 A;  4DB3 A;  2Q0R A;  3CJB A;  2E2P A;  1NBW A;  3HI0 A;  2F9W A;  1G99 A;  1NGB A;  1NGD A;  2YHY A;  1HX1 A;  4BC4 A;  1KAZ A;  3G25 A;  2KHO A;  4PL7 A;  4BQZ A;  1NGC A;  4H0T B;  3FZM A;  2FLO A;  3QDK A;  2IVP A;  3VET A;  3C7N A;  3CIP A;  3FR0 A;  3EKU A;  2YHX A;  1LCU A;  3VEZ A;  3VEN A;  3O1B A;  4M7X A;  4H0X B;  5TKY A;  5EY4 A;  4BGB A;  4BRF A;  3SLC A;  4FWO A;  3VF2 A;  4BR9 A;  1GLC G;  1YAG A;  3BEX A;  3VGL A;  4EHU A;  1QQN A;  4JAX A;  2HMP A;  4BR4 A;  1Y64 A;  2VWB A;  4BRA A;  4GNI A;  1KXP A;  4MO4 A;  5JMV A;  1RFQ A;  3H1V X;  3W0L A;  4XH1 A;  3MCP A;  1E4G T;  3UKU B;  3O80 A;  5FPE A;  1S22 A;  1JCF A;  3O5B A;  3VF6 A;  3VPZ A;  4BC3 A;  3ULE A;  4FWP A;  3O08 A;  4FWS A;  2CGK A;  2QWR A;  2FSK A;  4IJA A;  3BF1 A;  1X3M A;  3MN6 A;  3D2E B;  3JS6 A;  3EO3 A;  4AM6 A;  4H5N A;  4CZL A;  2P9N B;  3I33 A;  4CZM A;  1NGE A;  1EQY A;  3BUZ B;  4BRK A;  4F9O A;  2P9L B;  3R6M A;  1C0F A;  1R59 O;  4PL8 A;  1QZ6 A;  2QWO A;  2E1Y A;  2VCP A;  5E26 A;  3VEO A;  3VER A;  4O5F A;  1XQS C;  3ATV A;  3QIC A;  3RSE B;  1T44 A;  4H5T A;  3DJC A;  5FPM A;  1NGJ A;  1BOT O;  4C23 A;  3ID8 A;  4E1J A;  2CGL A;  4CBU A;  3VEV A;  3UB5 A;  4CJ7 A;  1TUU A;  1WOQ A;  2ZF5 O;  1NWK A;  3QFU A;  1GLL O;  1XUP O;  3ZX2 A;  4BRD A;  1KAY A;  2PAV A;  4H5V A;  4B9Q A;  5EX5 A;  4FWQ A;  1X9J A;  3R8E A;  1SQK A;  2AP1 A;  1ZXO A;  3UKR B;  3GOI A;  2BUP A;  4BRQ A;  5KQD A;  1J6Z A;  2F9T A;  2P9S B;  1GLB G;  4BR2 A;  4FO0 A;  4CZJ A;  5KQ8 A;  1QHA A;  3FLC O;  3L0Q A;  2YJE A;  5FPD A;  2FXU A;  3EL2 A;  4IJN A;  1BG3 A;  4A2B A;  5EOY A;  2FF3 B;  1OKJ A;  1Z05 A;  2QWN A;  5AZJ B;  4FWN A;  2QWQ A;  3UKU A;  2E88 A;  4FWM A;  4JD2 B;  1V4T A;  3A8Y A;  4CI6 A;  4IZ9 A;  3P4I A;  2E1Z A;  1Z6R A;  3WXJ A;  5AQG A;  2QM1 A;  4O8K A;  3WUH A;  3D2F A;  2QWL A;  4YDU C;  4ISF A;  3SMP A;  3O8M A;  1IJJ A;  2Q31 A;  3D2E A;  2YHW A;  3HSC A;  5LY3 A;  3UE5 A;  4BGA A;  4MLE A;  2P9N A;  3GDQ A;  4BR5 A;  1GLA G;  2D0P A;  1NGI A;  3ZEU B;  1V4S A;  2P9L A;  3H1Q A;  4RTF D;  5F2R A;  5JLH A;  3ZX0 A;  3KZB A;  2P9I B;  3VOV A;  3LDP A;  4PKI A;  3H46 O;  4NB4 A;  4B1W B;  5AQP A;  4QS7 A;  3MMV A;  2CGJ A;  4B1Y B;  4CZK A;  4YDU A;  2GTD A;  4B1Z A;  3RSE A;  3CHW A;  4EHT A;  1MWM A;  3AAP A;  3B8A X;  1ATS A;  1YUW A;  2D1K A;  1BA1 A;  3FZL A;  5AQK A;  4BVP A;  1XC3 A;  3LDL A;  4RCH A;  3SK3 A;  4CZI A;  3O6W A;  3HZ6 A;  4H0Y B;  5ADX H;  3IFR A;  1P8Z A;  5AQR A;  1SAZ A;  4FSV A;  3LDO A;  3CQX A;  1GLD G;  3H3O B;  1DKG D;  1HJO A;  4WQ4 C;  1T6D A;  2A6A A;  1K8K A;  4EIA A;  5AZI B;  2FSJ A;  4FPB A;  3U8X A;  3UKR A;  1Q18 A;  4CD1 A;  4BG9 A;  5AQZ A;  2P9S A;  5AQT A;  4CBX A;  5F1X A;  1NGG A;  4IXC A;  5FPN A;  3VEX A;  3D2F B;  2ZGZ A;  5AQN A;  4M7Y A;  5AQX A;  2IIR A;  1ESV A;  3ZET B;  5AZJ A;  2Q0U A;  5AQO A;  1YVN A;  4I6M B;  4QS8 A;  3F9M A;  2I7N A;  3AAR A;  3JXU A;  3SJH A;  1ATR A;  4WQ4 A;  4JD2 A;  3IMX A;  4B1V A;  4BC2 A;  1QQO A;  3R9P A;  3A0I X;  3CJ7 A;  3VES A;  3ENH A;  4LC9 B;  3DXK B;  3GE1 A;  3L4I A;  5AQF A;  2IVO A;  5AQY A;  3VF4 A;  3MN9 A;  3WEE A;  3IUC A;  1HKC A;  4AM7 A;  4EAH D;  4PKH A;  4BR7 A;  1BUP A;  2NZT A;  4BRN A;  1DGK N;  2YJF A;  2ITM A;  3U9Z A;  3BP8 A;  4FWR A;  3ZEU A;  2V7Y A;  3WT0 A;  1GLJ O;  4XEI A;  4CD3 A;  1TYQ B;  3WQT A;  1BO5 O;  2P9I A;  3H3N O;  2WUS A;  4HTL A;  5AQJ A;  2ZWH A;  4MLH A;  1GLF O;  2GWK A;  2W41 A;  3A5O C;  4MO5 A;  2YI1 A;  3FGU A;  3MDQ A;  5AQH A;  5BPN A;  5KPT A;  1H1V A;  4JN4 A;  5BPL A;  4H0P A;  1K8K B;  2E8A A;  2YCH A;  4ISG A;  3WXL A;  5ADX A;  4BQL A;  2EWS A;  5AQM A;  3J8A A;  3A5L C;  2V52 B;  3BF3 A;  4K41 A;  1MWK A;  1U2V A;  3LDN A;  4K25 A;  1RGI A;  3O4W A;  4WYB A;  4L3Q A;  4A61 A;  2Q2R A;  1HKB A;  1NGH A;  4BRE A;  1U6Z A;  2W40 A;  3KHY A;  2PBD A;  5AZI A;  2H3G X;  1ZBS A;  3DAW A;  4H0V B;  3MN7 A;  4M63 C;  4HWI A;  3HTV A;  5AQS A;  4BRO A;  3HBT A;  5E84 A;  3I8B A;  2Q1N A;  1NLV A;  1YXQ A;  5BRF A;  5BN9 A;  4XH4 A;  3VEW A;  3MN5 A;  4CZF A;  1BWF O;  3WEE B;  2NRH A;  3ZET A;  2IVN A;  3CJC A;  3EN9 A;  2A5X A;  4I6M A;  5AFU H;  1S3X A;  3GG4 A;  2A41 A;  2OAN A;  1T6C A;  3LM9 A;  4DHY A;  3CER A;  4RWT A;  3DXM B;  4H03 B;  3QFP A;  3DXK A;  3LL3 A;  2GWJ A;  4BC5 A;  3CQY A;  5CE3 A;  2QXL A;  2HOE A;  3CI5 A;  3U9D A;  1ATN A;  4JHD A;  2ASP A;  4BRM A;  2AA4 A;  3A5M C;  2Q36 A;  3SMS A;  1HPM A;  4IO8 A;  5AQU A;  4BG8 A;  4EFH A;  4BRP A;  3FZF A;  2QW9 A;  3QML A;  4FWK A;  5AQL A;  3VEY A;  1TYQ A;  3LM2 A;  3EKS A;  4NO7 A;  3C0B A;  3FFK B;  1GLE G;  2HF4 A;  1U2V B;  4BRH A;  2D4W A;  3D7E O;  4B1X B;  2P9K A;  3EZW A;  5F0X A;  5BRD A;  2E2N A;  3WXI A;  3QBX A;  3GBT A;  2QWP A;  4ISE A;  2BTF A;  1HLU A;  5AQI A;  4FPA A;  3AAQ A;  1HUX A;  1CZA N;  3HM8 A;  2D0O A;  4FWL A;  1WUA A;  3S41 A;  2V51 B;  1NM1 A;  3LDQ A;  3H6E A;  5KPR A;  2P9P A;  5BR9 A;  3TU5 A;  5JLF A;  1TUY A;  3KVG A;  3M3Z A;  2ZGY A;  3TPQ A;  2V7Z A;  5AR0 A;  5EXW A;  3IDH A;  3W3D A;  5LJW A;  4WQ5 C;  4Y0W A;  1D4X A;  2GEL A;  4BRC A;  3GL1 A;  2GEM A;  2DPN A;  4H5W A;  3ENO A;  2QWM A;  2VYP A;  1JCE A;  4GY2 B;  2P9U B;  3OHR A;  5ELZ A;  5AFU A;  5BRH A;  1QQM A;  4FOI A;  3H45 C;  2I7P A;  4JHD B;  5EVZ A;  3CET A;  4A62 A;  1SZ2 A;  3CJ1 A;  5JIC A;  3MK6 A;  4DQ8 A;  5I9E B;  1NMD A;  1BA0 A;  3QBW A;  1MDU B;  4B1U B;  3ZX3 A;  1NGA A;  3DXM A;  4WQ5 A;  4Z94 A;  4DCH A;  2FSN A;  1MA9 B;  3M1F A;  4CZE A;  3CJ9 A;  1E4F T;  5B8H A;  5BPM A;  2P9K B;  2NLX A;  5LJV A;  3C7N B;  2UYT A;  1BDG A;  4FL9 A;  3VGK A;  2CH5 A;  2A40 A;  1DEJ A;  4BRL A;  5KPZ A;  1HKG A;  4H5R A;  1ZC6 A;  5BRE A;  2A42 A;  1KAX A;  1LOT B;  1BU6 O;  3AY9 A;  4JNE A;  4CZH A;  3QB0 A;  4CZG A;  4BRI A; 
#chains in the Genus database with same CATH topology
 3UIQ A;  2BGG A;  2KQ2 A;  1JCG A;  1SS6 A;  1WLJ A;  3TAQ A;  3U4L A;  4LF8 K;  4DUZ K;  3DWL A;  1NGF A;  1X3N A;  4FOE A;  4DQP A;  4IFY A;  2ZE2 A;  2HNY A;  4CBW A;  5CHI A;  2XY8 A;  3TAG A;  2HBL A;  4A2A A;  1S1T A;  3O9Q A;  3ITH A;  4U7B A;  2OPS A;  3WNH A;  4B3R K;  2XY5 A;  2CH6 A;  4AHS A;  4JK7 A;  2Q97 A;  2Z1H A;  3QES A;  3O1W A;  3TAR A;  4CK2 A;  1JLE A;  3ZCM A;  1YTU A;  4BY9 C;  4C8L A;  4FVU A;  2E2P A;  2KTQ A;  2ZM6 K;  5DMR A;  2RF2 A;  3NHG A;  4KHY A;  3G4S N;  3FZM A;  2HB5 A;  2FLO A;  1S72 N;  4DV5 K;  5HRP A;  4DQR A;  2DFH A;  1XMO K;  3VEN A;  3O1B A;  4RW9 A;  2WFB A;  4BGB A;  5J2M A;  4RW8 A;  1VQK N;  5M1K A;  1RCH A;  4BR9 A;  4FJM A;  3BEX A;  1QQN A;  2HMP A;  3HM9 A;  2BAN A;  3V1O A;  1WSF A;  4GNI A;  4MO4 A;  4JI2 K;  3H1V X;  1DTT A;  2IS3 A;  3BZK A;  4AH9 A;  3SNN A;  5HBM A;  1S22 A;  4LSL A;  3SUP A;  4BC3 A;  4K8X A;  1FXX A;  3O08 A;  5M1P A;  1BQM A;  1TKZ A;  3BF1 A;  3E01 A;  1IBM K;  4RW4 A;  3D2E B;  2QK9 A;  4AM6 A;  4CZL A;  3OYE A;  1LWF A;  1NGE A;  1EQY A;  1IKW A;  4IOX A;  5FRO A;  5CYM A;  1C0F A;  1R59 O;  2F96 A;  2QWO A;  2WOM A;  5FRM A;  3NH1 A;  4B9L A;  3LAN A;  3WNE A;  5FDL A;  1S6P A;  4WF9 L;  5HRR A;  4H5T A;  3OS2 A;  5IWA K;  3CFO A;  2CGL A;  4NXN K;  3AVJ A;  3VEV A;  4CJ7 A;  1WOQ A;  3QFU A;  1GLL O;  1O1W A;  4JI8 K;  2HBJ A;  1S6Q A;  4DQS A;  3HJF A;  4CJV A;  1X9J A;  3R8E A;  2AP1 A;  4Z4C A;  4E7J A;  3AGR A;  3TSP A;  1J6Z A;  4QOZ B;  4FO0 A;  4YNQ A;  2KLA A;  3KTQ A;  1QHA A;  3FLC O;  3L0Q A;  5J2P A;  1WSJ A;  4FJH A;  4ZHR A;  1VSJ A;  3V9U A;  2YX6 A;  1YF5 L;  4H4M A;  3QET A;  3SUN A;  3J7A P;  1Q81 O;  1OKJ A;  1Z05 A;  5AZJ B;  4GKK K;  3OYN A;  4FWM A;  2VQF K;  4FM2 A;  4B9N A;  1ZBF A;  4IZ9 A;  2D0C A;  3AO1 A;  3ULD A;  1Z6R A;  3WXJ A;  5AQG A;  1TK5 A;  4JI5 K;  3VQQ A;  1IJJ A;  4CHZ A;  1NMN A;  3D2E A;  2YHW A;  3HSC A;  4DTR A;  1E3M A;  1HPZ A;  4IOC L;  4DV4 K;  3DLE A;  4DS4 A;  3H1Q A;  4DTJ A;  4RTF D;  4JK8 A;  3ZX0 A;  4DSK A;  3AVN A;  4YOY A;  3KZB A;  4LFA K;  4QS7 A;  3MMV A;  2XY6 A;  1IBK K;  4B1Y B;  1S9G A;  3TAF A;  2YNG A;  2BDP A;  4YDU A;  2GTD A;  2UUA K;  4EP4 A;  4DF8 A;  3AAP A;  1RT4 A;  4FLW A;  1N6Q A;  4KFB A;  3NGZ A;  3LDL A;  3SK3 A;  4CZI A;  3NVK A;  2WTU A;  3TR8 A;  1X9W A;  4KB0 A;  5ADX H;  5SZT A;  3L3V A;  4NCG A;  4FSV A;  1HJO A;  1RNH A;  4WQ4 C;  4ZTF A;  5HRN A;  2FSJ A;  1QVF M;  3DOK A;  1Q18 A;  4JI3 K;  3PX0 A;  1YJW N;  2KW4 A;  4M45 A;  4MDA A;  5AQT A;  2UXD K;  4CBX A;  2JGU A;  3KIO A;  1GOB A;  1LAW A;  4M7Y A;  1NJX A;  4CF1 A;  1RDC A;  5A2Q O;  4CHN A;  3E9L A;  5AZJ A;  1U49 A;  3E1Y A;  4JLH A;  4QS8 A;  1SKS A;  3AAR A;  4F2S A;  1ATR A;  4CJL A;  1XI1 A;  3SQ1 A;  4C8N A;  4DU1 A;  3THX B;  1EP4 A;  1SL0 A;  4FJ5 A;  5AQF A;  2IVO A;  3VF4 A;  4DSI A;  3ID6 A;  3WEE A;  2OZM A;  2Q3S A;  2NZT A;  4ELT A;  1DGK N;  1NK0 A;  1LWC A;  3VQA A;  3U9Z A;  1QS4 A;  4E1M A;  3E9O A;  3QNN A;  1L3V A;  3WT0 A;  4PQU A;  4CD3 A;  3VQ6 A;  4AF1 A;  5AJ3 K;  3H3N O;  2NRX A;  4C8M A;  2YKN A;  1GLF O;  3P39 A;  4ILG B;  4JI7 K;  2YI1 A;  3HXM A;  3F5T A;  2VG5 A;  5AQH A;  5BPN A;  1H1V A;  3V9X A;  3K5M A;  1KRP A;  3J81 O;  4ISG A;  1UA1 A;  1U2V A;  4JK9 A;  3VQ9 A;  3VA3 A;  3PO5 A;  3OS0 A;  2HHV A;  3PY8 A;  4FYD A;  3NAE A;  4M3Y A;  4IKF A;  4LSN A;  1OH6 A;  4BRE A;  1U6Z A;  3KHY A;  4CFA A;  2YNH A;  3CCJ N;  1KC8 O;  1ZBS A;  3AVK A;  4B08 A;  4H0V B;  2UU9 K;  2F4V K;  4FXD A;  3PUF A;  2F8T A;  1T8E A;  2XO7 A;  4HWI A;  4N56 A;  5E84 A;  3ZLJ A;  1J5E K;  1TKD A;  5BN9 A;  2FC0 A;  3CQ8 A;  4FLU A;  1C1C A;  1BWF O;  4LH4 A;  2IVN A;  4CJS A;  4I9Q A;  4FJK A;  3OJS A;  4DR1 K;  2Y1J A;  4H03 B;  3THX A;  2RE2 A;  1Q9X A;  2GWJ A;  4BC5 A;  4DR4 K;  3F73 A;  1IKX A;  4A5A A;  3U9D A;  1ATN A;  4JHD A;  2ASP A;  4BRM A;  2AA4 A;  1W9H A;  2Q36 A;  3SMS A;  4IO8 A;  2OA8 A;  4DLG A;  3FZF A;  2EHG A;  4B9M A;  4NO7 A;  3C0B A;  3FFK B;  1RDA A;  2HF4 A;  3D7E O;  1L3S A;  4HUG A;  4O44 A;  3K5O A;  3V9S A;  1WSI A;  5BRD A;  2E2N A;  4KHQ A;  3T1Y K;  3GBT A;  4DV2 K;  3RRG A;  1HLU A;  3QEW A;  3VQE A;  3AAQ A;  3KK7 A;  5FRN A;  1Q82 O;  1J54 A;  4O0I A;  4ID1 A;  3MWP A;  3H6E A;  2P9P A;  5BR9 A;  4OO1 J;  3HP6 A;  3TU5 A;  1BHL A;  1W0H A;  3M3Z A;  4FJL A;  4CJK A;  2GBZ A;  1VQ4 N;  4LFB K;  3KLE A;  3AVH A;  5LJW A;  1D4X A;  1RDD A;  4IG3 A;  3NF8 A;  4GW6 A;  2DPN A;  4CEQ A;  5JVG L;  4FLY A;  4FM0 A;  4DU4 A;  3C6H A;  3G10 A;  3SAF A;  1R0A A;  3NBP A;  3H45 C;  3SJJ A;  1WAJ A;  3TAM A;  3MK6 A;  3SZ2 A;  4OVL A;  1YIJ N;  2WON A;  4DKW A;  4A59 A;  3AVF A;  2P1J A;  4PA1 A;  3ZX3 A;  1W97 L;  4B9S A;  4O5B A;  3HO1 A;  3SAH A;  1Q8I A;  3KLG A;  3KJV A;  3CJ9 A;  5B8H A;  3MWT A;  2P9K B;  2IAJ A;  1NK7 A;  5LJV A;  3C7N B;  1IBL K;  2NRT A;  3VGK A;  4I2Q A;  2A40 A;  2O8B B;  1HKG A;  3V1R A;  2B4J A;  4H5R A;  3NF7 A;  5BRE A;  4UY8 O;  1WSH A;  4BE0 A;  3LP3 A;  3CM5 A;  4B3S K;  1KLM A;  1XNR K;  3U3Y A;  4J2E A;  4QS9 A;  2NRW A;  4PKG A;  2HF3 A;  4U67 L;  4DUY K;  3SBT A;  4H0O A;  2R7Y A;  1IG8 A;  1IKV A;  3ZSW A;  1EWR A;  1HYS A;  3VGM A;  2QA4 N;  2FF6 A;  5KGX A;  3AO4 A;  3V9Z A;  4YOV A;  1TL1 A;  1I94 K;  2JWL A;  5J1E A;  4JI4 K;  2ATQ A;  1ITG A;  3L6Q A;  3M8R A;  2F7T A;  1BL3 A;  4FZX C;  4CEO A;  4CED A;  2E20 A;  3L2R A;  2ETJ A;  1XNQ K;  1VSL A;  4J8F A;  3CJA A;  1N33 K;  4J2A A;  4PWD A;  2XHB A;  1S9E A;  1C0G A;  2A3Z A;  2ASM A;  1D9D A;  2PYJ A;  4DB3 A;  3AVI A;  1BI4 B;  3LDS A;  3HI0 A;  1NBW A;  1G99 A;  1WNS A;  2YHY A;  3VQ4 A;  1HYV A;  3HVT A;  1KAZ A;  1NKE A;  4E3S A;  1HNV A;  1RTH A;  2YHB A;  3ZSQ A;  3OYJ A;  1LW0 A;  4DTN A;  1QHT A;  4BQZ A;  1NGC A;  4H0T B;  3OYM A;  3QEX A;  2O4G A;  4F2R A;  3C7N A;  2ITG A;  4KH4 A;  1RT1 A;  2G8F A;  4Z4F A;  3EKU A;  3PIP L;  1TKX A;  1JLC A;  1N5Y A;  5DM6 L;  4M7X A;  4J2D A;  4NLB A;  3DYA A;  4H0X B;  1W7A A;  5EY4 A;  3TI0 A;  1SL1 A;  1RT6 A;  1OVY A;  3TWH A;  1K9M O;  4FJ9 A;  5C15 A;  3SLC A;  1KVC A;  3F2K A;  2XY7 A;  4FWO A;  3CCU N;  3OBY A;  3VGL A;  4AHU A;  3MEE A;  4DR5 K;  2UXC K;  3AVL A;  1KXP A;  5JMV A;  1D9F A;  3HK2 A;  3UKU B;  1VQ8 N;  3O80 A;  4CES A;  1KD1 O;  1X9M A;  3KWG A;  3O5B A;  4PUO A;  1U47 A;  1EX4 A;  4CJE A;  4FWS A;  3IG1 A;  5HRS A;  2QWR A;  4RG8 A;  1HJR A;  2PY5 A;  1Q9Y A;  3PX6 A;  3MN6 A;  4DR6 K;  3CPE A;  1VHX A;  4H5N A;  3O9T A;  3BUZ B;  4BRK A;  4F4K A;  4F9O A;  3R6M A;  3TAE A;  4PL8 A;  4JKC A;  1QZ6 A;  2ZD1 A;  1TKT A;  1BI4 A;  4DFK A;  3Q7C A;  1VSM A;  3VER A;  4IDK A;  4CHY A;  1NK6 A;  2G8K A;  4NCB A;  4W5N A;  3ATV A;  2X6S A;  3RSE B;  1JL2 A;  1HYZ A;  5FPM A;  4C23 A;  3VA0 A;  4CHO A;  4FLT A;  4C1N I;  4DTM A;  3L3U A;  2ZF5 O;  1NWK A;  3IS9 A;  5EU7 A;  2PYL A;  4DSL A;  4E1N A;  2PAV A;  1QSS A;  4LY7 A;  3KKS A;  5EX5 A;  4KKO A;  1SQK A;  4FCY A;  4BRQ A;  4KAZ A;  5KQD A;  2P9S B;  3AA2 A;  4CZJ A;  3SQ2 A;  4B9T A;  4KH6 A;  5M1O A;  4FJ8 A;  1BG3 A;  1IH7 A;  2FBY A;  2O8F B;  4DF4 A;  1VQO N;  3LPU A;  4FWN A;  2QWQ A;  3EE9 A;  3UKU A;  3A8Y A;  1XHZ A;  1HRH A;  4B3O A;  1YT3 A;  2IOC A;  4CGD A;  4O8K A;  3WUH A;  3ZSV A;  2HHQ A;  3ZT1 A;  4ISF A;  3O8M A;  3OYH A;  1Z26 A;  4MLE A;  3NMU A;  3GDQ A;  5GIN A;  4UQG A;  5F2R A;  4FZZ A;  4CJP A;  1WBD A;  4B1W B;  2HBM A;  3BGR A;  4DV3 K;  5TKW A;  3OYF A;  3D0P A;  3VQP A;  3I8D A;  3RSE A;  4CJ3 A;  3CHW A;  4EHT A;  1MWM A;  4KI4 A;  1YUW A;  3MX2 A;  2KZM A;  1O13 A;  1QTM A;  3NH2 A;  5AQK A;  1XC3 A;  2KKZ A;  4RCH A;  3AVA A;  2OTJ N;  4H0Y B;  3OVN A;  5AQR A;  1T3V A;  2D0B A;  4FJ7 A;  2VGN A;  4O4G A;  4LFC K;  2HVH A;  1GLD G;  3H3O B;  1DKG D;  4CFC A;  3J7Z O;  2A6A A;  1K8K A;  2NUB A;  3ZSX A;  4CEB A;  3MED A;  4EIA A;  4HUF A;  3SV4 A;  4FLV A;  1HNX K;  1JLF A;  4HCC A;  3E66 A;  1C1B A;  2O8C A;  3NF6 A;  2KFZ A;  3RRH A;  2P9S A;  4CF0 A;  5F1X A;  5FPN A;  3D6R A;  2O8F A;  2IIR A;  3C65 A;  2Q0U A;  4LF5 K;  3DLR A;  3H08 A;  2I7N A;  1SL2 A;  3KK2 A;  3IMX A;  1NK9 A;  4X65 K;  1QQO A;  2UUC K;  3A0I X;  4NYF A;  3VES A;  2HHU A;  3ENH A;  4LC9 B;  3GE1 A;  3T7Z A;  2HW3 A;  1JL1 A;  3O3H A;  4JKE A;  3MN9 A;  1HKC A;  4AM7 A;  5T7B A;  4BR7 A;  5KRT A;  1BUP A;  2NRV A;  1IKY A;  3SUO A;  3BP8 A;  4FWR A;  2V7Y A;  4M3W A;  2D5R A;  4F3O A;  1GLJ O;  2Z1G A;  3WQT A;  1BO5 O;  1QE1 A;  4DTP A;  3ZT3 A;  1LV5 A;  4HTL A;  2ZWH A;  3O3G A;  4DLE A;  3B6P A;  5KGW A;  4MO5 A;  3HOS A;  3MDQ A;  1NJW A;  5BPL A;  4H0P A;  3RMB A;  2P5G A;  3EY1 A;  4M3R A;  5ADX A;  4BQL A;  3U3G A;  1ZBI A;  4DR3 K;  4K41 A;  2V52 B;  3BF3 A;  4GVM A;  1RBV A;  2I5J A;  4FJI A;  1OH7 A;  3OBW A;  4WYB A;  4L3Q A;  4HCB A;  1HKB A;  1NGH A;  4R79 A;  2PBD A;  3DAW A;  5DM7 L;  4M63 C;  5AQS A;  1FK9 A;  4YOU A;  1KLN A;  3I8B A;  1S1X A;  3AVC A;  3OTO K;  4XH4 A;  4IEE A;  3NH0 A;  4DV1 K;  3WEE B;  4YOW A;  2A5X A;  4EP5 A;  1S3X A;  3DLH A;  3CER A;  2RHK A;  2GV9 A;  4RWT A;  4E7H A;  1VQM N;  3AO2 A;  3O4N A;  4X64 K;  4AHT A;  1VK0 A;  2ZJR L;  2B6A A;  4LF4 K;  2QXL A;  2HOE A;  3RR7 A;  4CGI A;  3BDP A;  5KTQ A;  3FFI A;  5C24 A;  1NJI O;  4EFH A;  5AQU A;  4BG8 A;  4A5B A;  1LAV A;  3TTC A;  3J7Y P;  4Z4G A;  4DTX A;  4FZY A;  3L4Q A;  1GLE G;  4QAG A;  1U2V B;  3RMC A;  3QEP A;  4B1X B;  3EZW A;  2RN2 A;  2Z1I A;  1ZBU A;  3WXI A;  2BTF A;  1JKH A;  1M90 O;  1HUX A;  1CZA N;  4B9V A;  3HL8 A;  3OA9 A;  4GMJ B;  3NVM A;  3ENB A;  1WUA A;  4JKG B;  2V51 B;  4W5O A;  3O3F A;  1VQN N;  1J9A A;  3LAM A;  4YOR A;  4JV5 K;  3KWI A;  3SBG A;  1IO2 A;  3WXM B;  4CHP A;  4AQY K;  3W3D A;  4G9Z A;  2HHX A;  4WQ5 C;  4Y0W A;  2JWK A;  2GEM A;  2WC9 A;  3SQ0 A;  4LF6 K;  3ENO A;  3LP2 A;  2G8W A;  2YNF A;  4GY2 B;  2P9U B;  4B8A B;  4ZTJ A;  3LPT A;  4DV0 K;  1TAU A;  1BIS A;  1SV5 A;  1EXQ A;  3CCV N;  1X9S A;  4FJJ A;  3P31 A;  1Z25 A;  4FW2 A;  3AO5 A;  2I7P A;  4JHD B;  1WAF A;  1RT7 A;  1SZ2 A;  3WNG A;  3K5L A;  1TVR A;  4B3M K;  4DQ8 A;  5I9E B;  1NMD A;  1BA0 A;  3DRR A;  4WFA L;  4JS4 A;  3ZSY A;  1MDU B;  3NFA A;  4IFV A;  2FSN A;  1MA9 B;  3M1F A;  5HOO A;  3G0Z A;  1IV0 A;  4CEA A;  5BPM A;  3K9K A;  4FL9 A;  2UYT A;  4FLX A;  1VQ9 N;  1DEJ A;  1KTQ A;  4BRL A;  2UUB K;  4CCH A;  4DQQ A;  2LSN A;  1ZC6 A;  2A42 A;  1RTD A;  3DI6 A;  3AY9 A;  1KVA A;  2E2Q A;  3DLB A;  2P9P B;  3BZC A;  1DTQ A;  2OTL N;  5GAH P;  1YHQ N;  4O8U A;  3AGK A;  5GIP A;  5BN8 A;  3L2Q A;  3TTD A;  1SKR A;  5E41 A;  5JVH L;  3A5N C;  1RDW X;  4DTO A;  5IT9 O;  1DLO A;  4JKG A;  4PY5 A;  5AQW A;  3ZYY X;  1NJZ A;  3MXI A;  3ALY A;  1NKB A;  4JI6 K;  1C0M A;  4H4O A;  4CGJ A;  3ULE B;  2JLE A;  3R1X A;  3ATU A;  4CEC A;  4BR0 A;  1EET A;  3MCA B;  3CC7 N;  5KI6 A;  1JLQ A;  2GX9 A;  5MLC Q;  2ZJP L;  5AQV A;  3KLH A;  2VG7 A;  4IDH A;  3ZSO A;  5C10 A;  4DFM A;  2P9U A;  4MQ3 A;  4DFJ A;  2GUP A;  3P1G A;  4K43 A;  3ZSZ A;  2D0A A;  1NGB A;  1NGD A;  5GAG P;  1HX1 A;  4BC4 A;  2OPQ A;  4CJF A;  2GUI A;  3NDK A;  4DTS A;  3P83 D;  1BQN A;  2KHO A;  3ZSR A;  1NK8 A;  3L2V A;  3EYZ A;  4I9L A;  4OJR A;  4PHT X;  1N8R O;  2QKB A;  3QDK A;  2IVP A;  4LD0 A;  1VQL N;  1VQ6 N;  2YHX A;  1RDB A;  1C6V A;  3K9J A;  1XWL A;  2QKK A;  4GV9 A;  3OYL A;  3M8P A;  3TSU A;  3TAB A;  4BRF A;  3KD1 E;  1ILY A;  5M1N A;  1KSP A;  3VF2 A;  1TL3 A;  4JAX A;  4CF8 A;  1YJN N;  4FK0 A;  4BR4 A;  1Y64 A;  2VWB A;  4CGH A;  3CF5 L;  4HHT A;  1RFQ A;  3S3M A;  2W6K A;  3VQB A;  3W0L A;  5M1Q A;  1E4G T;  3NE6 A;  5FPE A;  1N34 K;  1JCF A;  3SCX A;  3VPZ A;  4HTU A;  3ULE A;  2E6L A;  3NF9 A;  4FWP A;  3HVR A;  2CGK A;  4OGE A;  4AHR A;  4OPK A;  4FLZ A;  4DSF A;  4I7F A;  5I42 A;  4CIE A;  3DMJ A;  3MX5 A;  3EO3 A;  3C6U A;  3NGY A;  3K5N A;  3OY9 A;  2P9L B;  3C94 A;  1ZBH A;  3CCS N;  4GV3 A;  4DMN A;  4M3U A;  1YTA A;  1BIZ A;  4BWJ A;  3VEO A;  3O9R A;  4O5F A;  1CXU A;  4AIL C;  4KHP K;  4BE2 A;  3RMD A;  2PZS A;  3QIC A;  1T44 A;  5HRO A;  1WBB A;  1CZB A;  1NGJ A;  1BOT O;  4Z0U A;  3ID8 A;  4DSJ A;  4E1J A;  4CBU A;  4KTQ A;  2VQE K;  3UB5 A;  3OYC A;  2YNI A;  1RTJ A;  5C25 A;  3JYT A;  3K58 A;  3N4P A;  4BRD A;  1KAY A;  4X66 K;  3J80 O;  4RW6 A;  2X78 A;  3JAM O;  1I39 A;  1VSF A;  2HBK A;  4L8R B;  3TAP A;  2YV0 X;  4IO9 L;  1FW6 A;  2BUP A;  3V1Q A;  2F9T A;  2PFU A;  4FVM A;  5KQ8 A;  2VWK A;  3BY5 A;  4CW7 B;  3VTH A;  1D8Y A;  3EL2 A;  4IJN A;  4A2B A;  3PV8 A;  1QSY A;  2FBT A;  2FF3 B;  1TGO A;  1K6Y A;  4JD2 B;  1VSE A;  1I3A A;  4CJR A;  2E1Z A;  3R3L A;  5DK5 A;  1NK5 A;  4CK1 A;  4KPY A;  1UWB A;  3D2F A;  2QWL A;  4YDU C;  4N47 A;  2EX3 A;  3SMP A;  2IC3 A;  4YY3 K;  4DR2 K;  3NCI A;  1B9F A;  3UE5 A;  2Z1J A;  1Q7Y O;  4BR5 A;  1GLA G;  2D0P A;  4LF9 K;  1V4S A;  2P9L A;  1RIL A;  1KFS A;  2P9I B;  3VOV A;  3H46 O;  5AQP A;  1CLQ A;  1OVQ A;  5D3G A;  4CZK A;  3LP0 A;  4JI0 K;  1TK8 A;  3SV3 A;  4B1Z A;  1ASV A;  2DFE A;  2A1S A;  1Q86 O;  1ATS A;  2D1K A;  3HP9 A;  3FZL A;  1RBT A;  3LWL A;  3VQ5 A;  4J2B A;  3VQ8 A;  3O6W A;  3HZ6 A;  3OS1 A;  3IFR A;  1HNW K;  1P8Z A;  1SAZ A;  2HST A;  3CQX A;  5CR4 A;  3PSI A;  3OYD A;  5AZI B;  5C2F A;  3PSF A;  5CY4 A;  4FPB A;  3CYM A;  5HP1 A;  4CD1 A;  4WCE L;  4BG9 A;  1KFD A;  2VG6 A;  1JXE A;  1RBU A;  2A1R A;  2P5O A;  1NGG A;  4IXC A;  3VEX A;  2ZGZ A;  4CIG A;  5AQN A;  3CME N;  3AA4 A;  3CXC M;  3SQ4 A;  1ESV A;  4CEE A;  1XHX A;  5AQO A;  5GAD P;  4I6M B;  2QEX N;  3F9M A;  1SUQ A;  4WQ4 A;  4N5S A;  1K8A O;  4JD2 A;  4JKA A;  4Z4H A;  4BC2 A;  3OYI A;  3R9P A;  3CJ7 A;  1REV A;  3IRX A;  3L4I A;  5AQY A;  5C12 A;  4X62 K;  4DSE A;  4EAH D;  4PKH A;  1F21 A;  4M3X A;  3DLK A;  2YJF A;  2ITM A;  3CMA N;  2G8V A;  1NU0 A;  4CJT A;  1VQ5 N;  3KD5 E;  4C8O A;  1TYQ B;  2ZQB A;  2P9I A;  4CF9 A;  4DR7 K;  3B6O A;  1N32 K;  2NRR A;  2GWK A;  2W41 A;  3A5O C;  2AJQ A;  1VAZ A;  5KPT A;  5J2Q A;  4JN4 A;  3KLI A;  1BGX T;  1K8K B;  2YCH A;  2OYQ A;  3K0S A;  3WXL A;  3D45 A;  2O8C B;  3J8A A;  1OH8 A;  3U6F A;  2IDO A;  1GOA A;  1MWK A;  3LDN A;  1MU2 A;  4K25 A;  3K2P A;  1RGI A;  3QIO A;  4JKB A;  4IEI A;  4YHH K;  1L3T A;  3O4W A;  4DU3 A;  4A61 A;  2Q2R A;  4KO0 A;  5AZI A;  1RT2 A;  5HL7 L;  5K14 A;  1TK0 A;  2QI2 A;  2QXF A;  2ZJQ L;  4A57 A;  3HTV A;  4BWM A;  1VQP N;  2Q1N A;  4E19 A;  5BRF A;  3LP1 A;  3VEW A;  3MN5 A;  3ZT0 A;  5LMU K;  2NRH A;  4DV6 K;  1RDU A;  4DS5 A;  3EN9 A;  4E89 A;  4I6M A;  5AFU H;  4F3T A;  2A41 A;  1S5J A;  2OAN A;  1T6C A;  3LM9 A;  4DHY A;  1JLB A;  3DXM B;  4OKJ A;  4CJQ A;  3LL3 A;  5CZ2 A;  3CPW M;  4OGC A;  3A5M C;  3V9W A;  4BRP A;  5AQL A;  2QW9 A;  3QML A;  4FWK A;  3TTF A;  1TYQ A;  3LM2 A;  4OX9 K;  3RVC A;  4BRH A;  1RT5 A;  4KHS A;  5J2N A;  5F0X A;  1VSI A;  4XIU A;  4JYA K;  3LZI A;  2QWP A;  4ISE A;  5AQI A;  2P51 A;  4FPA A;  4QCL A;  4ILJ A;  1W2B M;  4NLC A;  3S41 A;  3A2F A;  1NM1 A;  3CCL N;  2F8S A;  5KPR A;  1VRT A;  5JLF A;  3QER A;  1TUY A;  3KVG A;  3M8S A;  2ZGY A;  1VSK A;  2V7Z A;  1NJY A;  1JXB A;  1EO1 A;  2GEL A;  4BRC A;  2OZS A;  3CFR A;  4H5W A;  3OW2 M;  4W5Q A;  5LMN K;  2VYP A;  1JCE A;  3OHR A;  4I2P A;  4JS5 A;  3P5J A;  4GKJ K;  3CC4 N;  5BRH A;  1B92 A;  1QQM A;  3V81 A;  5EVZ A;  3CET A;  3MEC A;  2G8U A;  4KB1 A;  2YHA A;  2HNZ A;  1NGA A;  3DXM A;  4O55 A;  2NRZ A;  4WFB L;  4Z4E A;  3AA3 A;  1E4F T;  2NLX A;  2YKM A;  4NXM K;  2HMI A;  4OKE A;  4FM1 A;  3CCR N;  5KPZ A;  3TAN A;  3RMA A;  2UXB K;  3C95 A;  1L3U A;  1U45 A;  4CEF A;  1KAX A;  1LOT B;  4JRP A;  1BU6 O;  3MXM A;  3QB0 A;  4CZG A;  3OJU A;  4BRI A;  1ZYQ A;  1C0U A;  4KBO A;  4BRG A;  1HNZ K;  3WQU A;  1NOZ A;  3M6G A;  3HPH A;  5M1F A;  2J4R A;  3WXK A;  1VSD A;  1YI2 N;  4OLB A;  4IWV A;  3VQD A;  4N41 A;  3AA5 X;  2ASO A;  1NK4 A;  3DLG A;  3FZK A;  4JKH A;  2XRI A;  2Y1I A;  3P38 A;  1HR0 K;  3DM2 A;  4N76 A;  5AQQ A;  4K42 A;  2E2O A;  2DTU A;  4W5R A;  3FE1 A;  3CCM N;  2OPP A;  1UA0 A;  4XH5 A;  3ZT4 A;  4BVO A;  4BDZ A;  2G8H A;  3SPY A;  2O4I A;  3FZH A;  5C2D A;  1QZ5 A;  2Q0R A;  3CJB A;  4G1Q A;  2F9W A;  1G15 A;  3AVB A;  5I3U A;  4KH5 A;  3G25 A;  1NKC A;  3L2W A;  4PL7 A;  2VGM A;  2G8I A;  2O8D B;  4JRQ A;  1WSG A;  3OYK A;  5KRS A;  3RTV A;  3VET A;  4M42 A;  3CIP A;  2X6N A;  2HVI A;  4DQI A;  3FR0 A;  3AV9 A;  4KV8 A;  3MAQ A;  1LCU A;  3VEZ A;  3I56 N;  3SUQ A;  1N36 K;  5TKY A;  3T3F A;  1XMQ K;  4CK3 A;  3Q7B A;  4M41 A;  4OPJ A;  4EZ6 A;  1S1U A;  1GLC G;  1YAG A;  4KI6 A;  1FKO A;  4EHU A;  2OPR A;  4E0D A;  1A5W A;  4KTZ A;  2HHT A;  3HYF A;  3S9H A;  4BRA A;  1GOC A;  3KK3 A;  4XH1 A;  3MCP A;  4IFE A;  4H8K A;  1VRU A;  1EWQ A;  3C6T A;  3VF6 A;  4FK4 A;  3T1A A;  2FSK A;  2QTD A;  4IJA A;  1X3M A;  4BDP A;  3EEQ A;  4Q5V A;  3JS6 A;  2P9N B;  3I33 A;  4CZM A;  3E9P A;  5GAE P;  2NNW A;  3PO4 A;  3O9U A;  3CCQ N;  3DRS A;  2E1Y A;  2VCP A;  2X74 A;  3NGI A;  5E26 A;  3LZJ A;  2O8E B;  1ASU A;  4CFB A;  1XQS C;  3N4Q A;  3OYG A;  3L2U A;  1S1V A;  4K0K K;  2O8D A;  5C0Y A;  3DJC A;  1U4B A;  4EZ9 A;  2BH1 A;  3O9S A;  4CHQ A;  3VN5 A;  3HPO A;  3QIP A;  1JLA A;  3DRP A;  1C1A A;  1TUU A;  1BCO A;  4GV6 A;  1XUP O;  3ZX2 A;  1M1K O;  4H5V A;  1RBS A;  4E7K A;  4B9Q A;  3HRG A;  4CF2 A;  4FWQ A;  2E4L A;  1Y97 A;  4RW7 A;  1HMV A;  1ZXO A;  3UKR B;  3GOI A;  3EZ5 A;  2DFF A;  4DV7 K;  3PLA A;  3CG7 A;  4OKK A;  1L5U A;  4BR2 A;  1GLB G;  3LAL A;  2YJE A;  4B3T K;  1QQC A;  5FPD A;  2FXU A;  4KHN A;  2HHS A;  1KQS M;  5EOY A;  4FJX A;  1D5A A;  2QWN A;  1J5O A;  3CFP A;  4F8R A;  1XC9 A;  2E88 A;  2FBV A;  4GVE A;  1UAX A;  2W6L A;  3DLL L;  4MFB A;  1V4T A;  4CI6 A;  4AHV A;  1ASW A;  3P4I A;  4FJG A;  4FK2 A;  1NG9 A;  4DWI A;  2QM1 A;  1A5X A;  3F9K A;  1VQ7 N;  1WB9 A;  1DT9 A;  4DG1 A;  1VSH A;  3S3O A;  2Q31 A;  1RBR A;  5LY3 A;  4KTW A;  4BGA A;  2P9N A;  3O4Q A;  3HPG A;  1S1W A;  1NGI A;  4CEZ A;  4OPH A;  3ZEU B;  3VQC A;  1CXQ A;  5JLH A;  4R5P A;  3LDP A;  3ZT2 A;  4PKI A;  2HHH K;  4NB4 A;  4K8Z A;  5BR8 K;  4JI1 K;  2O8E A;  2CGJ A;  2RPI A;  3THY B;  4ELU A;  3CD6 N;  3HOT A;  3QEI A;  3B8A X;  3HT3 A;  3PX4 A;  1C0T A;  3I0R A;  1U48 A;  1BA1 A;  4Y1C A;  4BVP A;  1SKW A;  3EE8 A;  1LWE A;  1T7P A;  2KFN A;  4YOT A;  1BIU A;  3LDO A;  4M3Z A;  3V6D A;  1T6D A;  4FJN A;  3CC2 N;  1JLG A;  4M3T A;  2WBN A;  3U8X A;  3UKR A;  4V19 S;  1P90 A;  3CM6 A;  4CE9 A;  3AVG A;  1FJG K;  1T05 A;  5AQZ A;  5SWM A;  4DFP A;  1OH5 A;  3D2F B;  2VWJ A;  4CIF A;  5AQX A;  3ZET B;  4BDY A;  3LWM A;  1YVN A;  3QLH A;  3VQ7 A;  1B9D A;  3I55 N;  3JXU A;  3SJH A;  3T1H K;  2HND A;  4CFD A;  4E7L A;  3VTI A;  4B1V A;  5GIO A;  1X1P A;  3V4I A;  1K73 O;  3K57 A;  3DXK B;  3WNF A;  5H1S Q;  3K59 A;  4KRF A;  3JSM A;  3IUC A;  1TAQ A;  1KVB A;  3AVM A;  1ZBL A;  1J53 A;  4BRN A;  4HVJ A;  4AHC A;  4CGG A;  5FLX O;  3ZEU A;  3KLF A;  4W5T A;  4XEI A;  4OPA A;  4KRE A;  2WUS A;  5AQJ A;  2FBX A;  3PIO L;  4Y1D A;  3QO9 A;  4MLH A;  4BAC A;  3THY A;  3FGU A;  4ILH A;  2E8A A;  2E5L K;  3THV A;  2EWS A;  4TSX A;  5AQM A;  3A5L C;  3QIN A;  3RR8 A;  1IG9 A;  1HQE A;  4CJU A;  3OYA A;  3G71 N;  5JS2 A;  3SI6 A;  3MEG A;  1HQU A;  3AO3 A;  2B5J A;  5JS1 A;  2W40 A;  4CJW A;  2H3G X;  3MN7 A;  1FKP A;  4BRO A;  3HBT A;  4Q0B A;  3T69 A;  1NLV A;  1YXQ A;  4CZF A;  3I0S A;  3RWU A;  4OLA A;  2W42 A;  3ZET A;  1T03 A;  3CJC A;  1JJ2 M;  3LAK A;  3IKM A;  1HNI A;  3GG4 A;  2IGI A;  2HHW A;  1QVG M;  2RKI A;  4Z4I A;  3C6A A;  3QFP A;  3DXK A;  4NCA A;  4O0J A;  4B9U A;  4E7I A;  3CQY A;  5CE3 A;  3QNO A;  3CI5 A;  5LL6 Z;  3OYB A;  2DY4 A;  4ICL A;  5HLF A;  1HPM A;  1WN7 A;  3SYZ A;  4CGF A;  3ASM A;  3VEY A;  2E6M A;  3THW B;  3EKS A;  1TV6 A;  1LW2 A;  2D4W A;  4YOX A;  2P9K A;  1WSE A;  4C8K A;  4C1N K;  4JKF A;  2O8B A;  3QBX A;  5CZ1 A;  3TSQ A;  3DOL A;  3HM8 A;  1A5V A;  3VMF B;  2D0O A;  4CJ5 A;  4FWL A;  1NNE A;  4CER A;  4IG0 A;  3S3N A;  1YJ9 N;  4ID5 A;  4WFN L;  1QSL A;  3LDQ A;  2BE2 A;  3SAG A;  3KK1 A;  2OCE A;  2KZZ A;  4WE1 A;  3TPQ A;  4LF7 K;  1YVU A;  5AR0 A;  5EXW A;  3IDH A;  5CYQ A;  3ISN C;  3HST B;  4IBN A;  3GL1 A;  1RTI A;  3QEV A;  2QWM A;  3KKR A;  1BCM A;  5ELZ A;  1EKE A;  5AFU A;  4KHW A;  1UOC A;  3T19 A;  1CZ9 A;  3M5R A;  4FOI A;  4A62 A;  3CJ1 A;  4NYN A;  5JIC A;  4ELV A;  4CJ4 A;  3G6E N;  4B8C A;  1U04 A;  3QBW A;  1KCF A;  1RT3 A;  4B1U B;  4WQ5 A;  4JEP A;  4Z94 A;  3IAY A;  4DCH A;  4CVN E;  3CCE N;  4IOA L;  5C42 A;  4CZE A;  4BE1 A;  4KHU A;  1BDG A;  3MXJ A;  3SPZ A;  3L8B A;  4LH5 A;  1NOY A;  2CH5 A;  4JKD A;  3M8Q A;  4HUE A;  3THW A;  1YIT N;  4MDB A;  4DTU A;  4JNE A;  4CZH A;  4FW1 A;  4YFU A; 
#chains in the Genus database with same CATH homology
 2E2Q A;  2P9P B;  4QS9 A;  2OTL N;  4KBO A;  5GAH P;  2NRW A;  1YHQ N;  4BRG A;  4PKG A;  1JCG A;  2HF3 A;  1SS6 A;  4O8U A;  4U67 L;  3WQU A;  3SBT A;  3AGK A;  4H0O A;  5GIP A;  5BN8 A;  1IG8 A;  3M6G A;  3TTD A;  5JVH L;  3A5N C;  1RDW X;  3U4L A;  3VGM A;  4JKG A;  3DWL A;  1NGF A;  2QA4 N;  2FF6 A;  1X3N A;  5M1F A;  2J4R A;  5AQW A;  4FOE A;  3WXK A;  3ZYY X;  4YOV A;  1YI2 N;  2JWL A;  4CBW A;  5CHI A;  4IWV A;  2HBL A;  3L6Q A;  3ULE B;  4A2A A;  3R1X A;  2F7T A;  3ATU A;  3O9Q A;  2ASO A;  4BR0 A;  3MCA B;  2E20 A;  4U7B A;  3CC7 N;  3FZK A;  4JKH A;  2GX9 A;  3P38 A;  5MLC Q;  2ZJP L;  5AQV A;  5AQQ A;  4J8F A;  4K42 A;  2CH6 A;  2E2O A;  3CJA A;  4IDH A;  3FE1 A;  5C10 A;  4JK7 A;  3CCM N;  2Q97 A;  3O1W A;  2P9U A;  4XH5 A;  4BVO A;  1C0G A;  2A3Z A;  2ASM A;  2GUP A;  4K43 A;  3FZH A;  4BY9 C;  5C2D A;  1QZ5 A;  4DB3 A;  2Q0R A;  3CJB A;  4FVU A;  2E2P A;  1NBW A;  3HI0 A;  2F9W A;  1G99 A;  1NGB A;  1NGD A;  2YHY A;  5GAG P;  1HX1 A;  4BC4 A;  1KAZ A;  4KH5 A;  3G25 A;  2KHO A;  4PL7 A;  2VGM A;  4BQZ A;  1NGC A;  4H0T B;  3G4S N;  3FZM A;  1N8R O;  4PHT X;  2FLO A;  1S72 N;  3QDK A;  2IVP A;  3VET A;  3C7N A;  3CIP A;  4KH4 A;  1VQL N;  3FR0 A;  1VQ6 N;  3EKU A;  2YHX A;  3PIP L;  1LCU A;  3K9J A;  3VEZ A;  3VEN A;  5DM6 L;  3O1B A;  3I56 N;  4M7X A;  4NLB A;  4H0X B;  5TKY A;  4GV9 A;  2WFB A;  5EY4 A;  4BGB A;  3TSU A;  1OVY A;  1K9M O;  3Q7B A;  4BRF A;  5C15 A;  1VQK N;  5M1K A;  3SLC A;  1ILY A;  3F2K A;  5M1N A;  4FWO A;  3VF2 A;  4BR9 A;  3CCU N;  1GLC G;  1YAG A;  3BEX A;  3OBY A;  3VGL A;  4EHU A;  1QQN A;  4JAX A;  1YJN N;  2HMP A;  4BR4 A;  1Y64 A;  2VWB A;  3CF5 L;  4BRA A;  4GNI A;  1KXP A;  4MO4 A;  5JMV A;  1RFQ A;  3H1V X;  3W0L A;  4XH1 A;  3MCP A;  4IFE A;  5M1Q A;  1E4G T;  3UKU B;  1VQ8 N;  3O80 A;  1KD1 O;  5FPE A;  1S22 A;  1JCF A;  3KWG A;  3O5B A;  3VF6 A;  3VPZ A;  4BC3 A;  3ULE A;  4FWP A;  3O08 A;  5M1P A;  4FWS A;  2CGK A;  2QWR A;  2FSK A;  2QTD A;  3BF1 A;  1X3M A;  4IJA A;  3MN6 A;  3D2E B;  3JS6 A;  3EO3 A;  3MX5 A;  3CPE A;  4AM6 A;  4H5N A;  4CZL A;  3O9T A;  2P9N B;  3I33 A;  4CZM A;  1NGE A;  1EQY A;  3BUZ B;  3E9P A;  5GAE P;  4BRK A;  2NNW A;  4F9O A;  4IOX A;  2P9L B;  3R6M A;  3CCS N;  1C0F A;  1R59 O;  4PL8 A;  4GV3 A;  3O9U A;  1QZ6 A;  4JKC A;  3CCQ N;  2QWO A;  3Q7C A;  2E1Y A;  2VCP A;  5E26 A;  3VEO A;  3O9R A;  3VER A;  4O5F A;  1XQS C;  3ATV A;  3N4Q A;  3QIC A;  4WF9 L;  3RSE B;  1T44 A;  5C0Y A;  4H5T A;  3DJC A;  5FPM A;  1NGJ A;  1BOT O;  2BH1 A;  3ID8 A;  3O9S A;  4C23 A;  4E1J A;  2CGL A;  4CBU A;  3VEV A;  3UB5 A;  4CJ7 A;  4C1N I;  1TUU A;  1WOQ A;  2ZF5 O;  4GV6 A;  1NWK A;  3N4P A;  3QFU A;  1GLL O;  1XUP O;  3ZX2 A;  4BRD A;  1KAY A;  2PAV A;  4H5V A;  1M1K O;  2HBJ A;  4B9Q A;  3HRG A;  5EX5 A;  4FWQ A;  2HBK A;  1X9J A;  3R8E A;  1SQK A;  2AP1 A;  1ZXO A;  3UKR B;  4IO9 L;  3GOI A;  3AGR A;  3PLA A;  2BUP A;  3TSP A;  4BRQ A;  5KQD A;  1J6Z A;  2F9T A;  2P9S B;  1GLB G;  2PFU A;  4BR2 A;  4FO0 A;  4CZJ A;  2KLA A;  5KQ8 A;  1QHA A;  3FLC O;  3L0Q A;  2YJE A;  4KH6 A;  5M1O A;  5FPD A;  2FXU A;  3VTH A;  3EL2 A;  4IJN A;  1BG3 A;  2YX6 A;  5EOY A;  1YF5 L;  4A2B A;  1KQS M;  1Q81 O;  1VQO N;  2FF3 B;  1OKJ A;  1Z05 A;  2QWN A;  5AZJ B;  4FWN A;  2QWQ A;  3EE9 A;  2E88 A;  3UKU A;  4FWM A;  4GVE A;  3DLL L;  4JD2 B;  1V4T A;  3A8Y A;  4CI6 A;  4IZ9 A;  3P4I A;  2E1Z A;  1Z6R A;  3R3L A;  3WXJ A;  5AQG A;  2QM1 A;  4O8K A;  3WUH A;  3D2F A;  1VQ7 N;  2QWL A;  4YDU C;  4ISF A;  1DT9 A;  3SMP A;  3O8M A;  1IJJ A;  2Q31 A;  3D2E A;  2YHW A;  3HSC A;  5LY3 A;  3UE5 A;  4BGA A;  4MLE A;  2P9N A;  1Q7Y O;  3NMU A;  3GDQ A;  5GIN A;  4BR5 A;  4IOC L;  1GLA G;  2D0P A;  1NGI A;  4OPH A;  3ZEU B;  1V4S A;  2P9L A;  3H1Q A;  4RTF D;  5F2R A;  5JLH A;  4JK8 A;  3ZX0 A;  4YOY A;  3KZB A;  2P9I B;  3VOV A;  3LDP A;  4PKI A;  3H46 O;  4NB4 A;  4B1W B;  2HBM A;  5AQP A;  4QS7 A;  3MMV A;  2CGJ A;  4B1Y B;  5TKW A;  4CZK A;  4YDU A;  2GTD A;  4B1Z A;  3RSE A;  3CD6 N;  3CHW A;  4EHT A;  3HOT A;  1MWM A;  3AAP A;  3B8A X;  1Q86 O;  1ATS A;  1YUW A;  3MX2 A;  1O13 A;  2D1K A;  1BA1 A;  3FZL A;  5AQK A;  4BVP A;  1XC3 A;  2KKZ A;  3NVK A;  3LDL A;  4RCH A;  3SK3 A;  4CZI A;  3EE8 A;  2OTJ N;  3O6W A;  3HZ6 A;  4H0Y B;  5ADX H;  3IFR A;  1P8Z A;  5AQR A;  1SAZ A;  1T3V A;  4YOT A;  2HST A;  2VGN A;  4FSV A;  3LDO A;  3CQX A;  5CR4 A;  1GLD G;  3H3O B;  1DKG D;  1HJO A;  4WQ4 C;  1T6D A;  3J7Z O;  2A6A A;  1K8K A;  4EIA A;  5AZI B;  2FSJ A;  5C2F A;  3CC2 N;  1QVF M;  2WBN A;  4FPB A;  3U8X A;  3UKR A;  1P90 A;  3E66 A;  1Q18 A;  4CD1 A;  4WCE L;  1YJW N;  4BG9 A;  5AQZ A;  2P9S A;  4MDA A;  5AQT A;  4CBX A;  5F1X A;  1NGG A;  4IXC A;  5FPN A;  3VEX A;  3D2F B;  2ZGZ A;  5AQN A;  3D6R A;  3CME N;  4M7Y A;  5AQX A;  3CXC M;  2IIR A;  1ESV A;  3ZET B;  3C65 A;  3E9L A;  5AZJ A;  2Q0U A;  5AQO A;  3E1Y A;  1YVN A;  5GAD P;  4I6M B;  4QS8 A;  2QEX N;  3F9M A;  2I7N A;  3AAR A;  3I55 N;  3JXU A;  3SJH A;  1ATR A;  4WQ4 A;  1K8A O;  4JD2 A;  4JKA A;  3IMX A;  3VTI A;  4B1V A;  4BC2 A;  1QQO A;  5GIO A;  3R9P A;  3A0I X;  3CJ7 A;  3VES A;  1K73 O;  3ENH A;  4LC9 B;  3DXK B;  5H1S Q;  3GE1 A;  3L4I A;  3T7Z A;  5AQF A;  2IVO A;  5AQY A;  3VF4 A;  5C12 A;  4JKE A;  3ID6 A;  3MN9 A;  3WEE A;  3IUC A;  1HKC A;  4AM7 A;  4EAH D;  4PKH A;  4BR7 A;  1BUP A;  2NZT A;  2NRV A;  4BRN A;  1DGK N;  2YJF A;  2ITM A;  3CMA N;  3U9Z A;  3BP8 A;  4FWR A;  3ZEU A;  3E9O A;  2V7Y A;  1VQ5 N;  3WT0 A;  1GLJ O;  4XEI A;  4CD3 A;  1TYQ B;  4OPA A;  3WQT A;  1BO5 O;  2P9I A;  4AF1 A;  3H3N O;  2WUS A;  4HTL A;  5AQJ A;  2ZWH A;  2NRX A;  3PIO L;  2NRR A;  4MLH A;  1GLF O;  2GWK A;  3P39 A;  4ILG B;  2W41 A;  3A5O C;  4MO5 A;  3HOS A;  1VAZ A;  2YI1 A;  3FGU A;  3F5T A;  3MDQ A;  5AQH A;  5BPN A;  1H1V A;  5KPT A;  4ILH A;  4JN4 A;  5BPL A;  4H0P A;  1K8K B;  2E8A A;  2YCH A;  4ISG A;  3WXL A;  5ADX A;  4BQL A;  2EWS A;  5AQM A;  3J8A A;  3A5L C;  2V52 B;  3BF3 A;  4K41 A;  1MWK A;  1U2V A;  3LDN A;  4K25 A;  4JKB A;  1RGI A;  4JK9 A;  4IEI A;  3O4W A;  3OBW A;  4WYB A;  3G71 N;  4L3Q A;  4A61 A;  2Q2R A;  1HKB A;  1NGH A;  4BRE A;  4R79 A;  1U6Z A;  2W40 A;  3KHY A;  2PBD A;  5AZI A;  2H3G X;  5HL7 L;  3CCJ N;  1KC8 O;  1ZBS A;  3DAW A;  4H0V B;  2QI2 A;  2ZJQ L;  5DM7 L;  3MN7 A;  4A57 A;  4M63 C;  4HWI A;  3HTV A;  5AQS A;  4BRO A;  3HBT A;  4YOU A;  5E84 A;  3T69 A;  3I8B A;  1VQP N;  2Q1N A;  1NLV A;  1YXQ A;  5BRF A;  5BN9 A;  4XH4 A;  3VEW A;  4IEE A;  3MN5 A;  4CZF A;  1BWF O;  3WEE B;  2NRH A;  3ZET A;  1RDU A;  2IVN A;  3CJC A;  3EN9 A;  1JJ2 M;  4YOW A;  2A5X A;  3IKM A;  4I6M A;  1S3X A;  3GG4 A;  5AFU H;  2A41 A;  2OAN A;  1T6C A;  3LM9 A;  4DHY A;  3CER A;  2RHK A;  4RWT A;  1QVG M;  1VQM N;  3DXM B;  4H03 B;  3C6A A;  2RE2 A;  3QFP A;  3DXK A;  3LL3 A;  2ZJR L;  2GWJ A;  4BC5 A;  3CPW M;  3CQY A;  5CE3 A;  2QXL A;  4A5A A;  2HOE A;  3CI5 A;  3U9D A;  1ATN A;  4JHD A;  2ASP A;  4BRM A;  2AA4 A;  3A5M C;  1NJI O;  2Q36 A;  3SMS A;  1HPM A;  4IO8 A;  5AQU A;  4BG8 A;  4EFH A;  4A5B A;  4BRP A;  3TTC A;  3FZF A;  2QW9 A;  3QML A;  4FWK A;  5AQL A;  3VEY A;  3TTF A;  1TYQ A;  3LM2 A;  3EKS A;  4NO7 A;  3C0B A;  3FFK B;  3L4Q A;  3RVC A;  1GLE G;  2HF4 A;  1U2V B;  4BRH A;  2D4W A;  3D7E O;  4B1X B;  4YOX A;  2P9K A;  3EZW A;  5F0X A;  4C1N K;  4JKF A;  5BRD A;  2E2N A;  3WXI A;  3QBX A;  3GBT A;  2QWP A;  4ISE A;  2BTF A;  1HLU A;  5AQI A;  3TSQ A;  4FPA A;  3AAQ A;  1M90 O;  3KK7 A;  1HUX A;  1CZA N;  1Q82 O;  3OA9 A;  3HM8 A;  4ILJ A;  3VMF B;  2D0O A;  3NVM A;  3ENB A;  4FWL A;  1W2B M;  1WUA A;  4JKG B;  4NLC A;  3MWP A;  3S41 A;  2V51 B;  1NM1 A;  4WFN L;  1YJ9 N;  3CCL N;  1VQN N;  3LDQ A;  3SAG A;  3H6E A;  5KPR A;  2P9P A;  5BR9 A;  4OO1 J;  3TU5 A;  5JLF A;  4YOR A;  1TUY A;  3KVG A;  3M3Z A;  2ZGY A;  3KWI A;  3SBG A;  3TPQ A;  3WXM B;  2V7Z A;  5AR0 A;  1VQ4 N;  5EXW A;  3IDH A;  3W3D A;  5LJW A;  4G9Z A;  4WQ5 C;  2JWK A;  4Y0W A;  1D4X A;  1EO1 A;  2GEL A;  4BRC A;  3GL1 A;  2GEM A;  2WC9 A;  2DPN A;  4H5W A;  3OW2 M;  3ENO A;  2QWM A;  5JVG L;  2VYP A;  1JCE A;  4GY2 B;  2P9U B;  3OHR A;  3C6H A;  3SAF A;  5ELZ A;  5AFU A;  3CC4 N;  5BRH A;  1QQM A;  3CCV N;  3M5R A;  4FOI A;  3P31 A;  3H45 C;  2I7P A;  4JHD B;  5EVZ A;  3CET A;  4A62 A;  1SZ2 A;  3CJ1 A;  5JIC A;  3MK6 A;  4DQ8 A;  3G6E N;  5I9E B;  4DKW A;  1YIJ N;  1NMD A;  1BA0 A;  3QBW A;  4A59 A;  4WFA L;  1MDU B;  4B1U B;  3ZX3 A;  1NGA A;  3DXM A;  1W97 L;  4WQ5 A;  4JEP A;  4Z94 A;  4DCH A;  3CCE N;  4IOA L;  2FSN A;  2NRZ A;  4WFB L;  1MA9 B;  3M1F A;  3SAH A;  4CZE A;  5HOO A;  3CJ9 A;  1E4F T;  5B8H A;  5BPM A;  3MWT A;  2P9K B;  2NLX A;  3K9K A;  5LJV A;  3C7N B;  2UYT A;  1BDG A;  4FL9 A;  2NRT A;  3VGK A;  2CH5 A;  2A40 A;  1VQ9 N;  3CCR N;  1DEJ A;  4BRL A;  5KPZ A;  1HKG A;  4JKD A;  4H5R A;  1ZC6 A;  5BRE A;  4UY8 O;  2A42 A;  1YIT N;  1KAX A;  1LOT B;  1BU6 O;  3AY9 A;  4MDB A;  4JNE A;  4CZH A;  3QB0 A;  4CZG A;  4BRI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...