2E2QA

Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transferase
molecule keywords HEXOKINASE
total genus 110
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA01
5KQ8A 2CGLA 1Z6RA 2F9TA 3WXLA 3P4IA 3WQUA 1ZBSA 4FWRA 1EQYA 3H1VX 5EXWA 1DGKN 1DKGD 5TKYA 2Q1NA 1GLBG 4CZHA 2PAVA 3WEEB 2IVNA 4CI6A 3H1QA 3LDNA 3WQTA 3VF4A 2GELA 5AQXA 4NO7A 3MN9A 4CZGA 2D4WA 1TUUA 2EWSA 4BQLA 4O8KA 3VETA 5BRFA 4DB3A 2IVPA 3AAQA 3VOVA 1GLFO 2ZWHA 1HKBA 4IJNA 4MO4A 1ESVA 4Y0WA 3BUZB 4ISGA 2CGKA 2Q0UA 5EVZA 4FWMA 2A3ZA 3VGMA 1S22A 3CETA 5BN9A 1C0GA 1QZ5A 3L4IA 2QXLA 4MLEA 5FPMA 2A5XA 3FFKB 4MLHA 3CERA 3CJ7A 5AQPA 3O1BA 4BC3A 3O6WA 4JHDA 1OKJA 4A62A 2P9UB 2ASOA 2E20A 3QFPA 1LCUA 5BPLA 2FXUA 4BRKA 4H0XB 2AP1A 2FF3B 4L3QA 1HUXA 4QS9A 2P9NA 3EZWA 3SLCA 3ZEUB 1KAYA 3D2EA 2V7ZA 3L0QA 1JCGA 3ATVA 3GBTA 3GOIA 3IUCA 3GE1A 3HI0A 3RSEB 3H6EA 3UKUA 3WEEA 3ZX3A 4BRIA 1Y64A 2ZF5O 4A2BA 3GG4A 3IFRA 3ULEB 5AFUH 5AQRA 1BWFO 2VYPA 4BVOA 2IVOA 5CE3A 2QWQA 1K8KA 4I6MA 4BRFA 3I8BA 3BP8A 5FPDA 3HSCA 5AQVA 4CBUA 1ATNA 5AZJA 5AFUA 3A5OC 4YDUA 4BC5A 5EOYA 4CJ7A 3D2EB 4JD2A 3FR0A 1NGEA 3VEZA 3O8MA 4EHTA 1MA9B 3KVGA 2P9LA 2A42A 4H0VB 2A6AA 3ID8A 1NGCA 1NLVA 2D0PA 3BEXA 2E2PA 5F1XA 5JLHA 3AY9A 5KPZA 5E84A 5FPEA 2GWJA 4M7XA 3M3ZA 1T6DA 4K25A 4JD2B 4DQ8A 3J8AA 2QW9A 4IZ9A 2P9UA 3VEXA 1K8KB 3B8AX 5AQOA 3U9ZA 2F9WA 3A5NC 5ADXA 5AQUA 5F2RA 3QDKA 3WXIA 4B1XB 3KZBA 4JNEA 3H46O 3U4LA 4BGBA 4B9QA 3VERA 4H03B 3D2FB 1XQSC 2FF6A 3SMPA 3ULEA 2QWLA 3VGLA 3CJ9A 3ZEUA 5JLFA 2GTDA 2P9KA 3UKUB 4CZIA 5B8HA 4H5TA 4EIAA 3SK3A 1YVNA 1TYQB 4H0PA 3VEWA 1BU6O 4B1VA 4XEIA 1X9JA 4BR5A 4ISFA 3G25A 2P9NB 3L6QA 3H3NO 2DPNA 4H5VA 4Z94A 3QBXA 4DHYA 2P9KB 1JCEA 2A40A 3FZLA 4B1ZA 4CZMA 2CH6A 1XUPO 1MWKA 1NGGA 2H3GX 3O4WA 2BTFA 3TPQA 2P9PB 4BVPA 2YJEA 3A5MC 3C7NB 3EO3A 5EY4A 2Q0RA 4BR0A 3EL2A 4EHUA 3VF6A 5FPNA 5BN8A 2FSJA 4WQ4A 1T44A 3CHWA 4IWVA 1E4GT 4AM7A 3QB0A 5BRDA 1ZC6A 2Q31A 3LDOA 2NZTA 5AQQA 5BPMA 2P9IB 2E2QA 2VWBA 3OHRA 2BUPA 1C0FA 5BPNA 4BG9A 3CJ1A 4JAXA 4FWSA 1Q18A 1KXPA 3H45C 4FOIA 4DCHA 3CJAA 4FWQA 5E26A 3DJCA 4H0YB 2QWPA 3WT0A 3MCPA 2QWMA 3DAWA 3LM2A 3VESA 4BR9A 4BRHA 1V4SA 2WUSA 4YDUC 4BRCA 1NGAA 4PL8A 3WUHA 1HKCA 3MK6A 4K41A 4FOEA 4BRDA 3BF3A 3A0IX 5AQIA 2GUPA 2D1KA 1X3MA 5AQLA 3R9PA 4A2AA 2A41A 1E4FT 4FWNA 1HX1A 4H5RA 1V4TA 2E2OA 1BOTO 3DWLA 4HTLA 3VGKA 2ASMA 3W0LA 2P9LB 3LM9A 3VEVA 5LY3A 2YCHA 4BQZA 4FL9A 1HJOA 2UYTA 2GEMA 2P9IA 4WQ5C 3VENA 2YHYA 4CD3A 4MO5A 4ISEA 1NWKA 4B1YB 3GDQA 2CGJA 2VCPA 2YJFA 4WQ4C 4WYBA 5AZJB 2W40A 1G99A 4XH5A 3O5BA 1J6ZA 3CQYA 2FLOA 3ZETA 4FSVA 1YUWA 2QM1A 1NM1A 4B1UB 2QWNA 3HTVA 4CZJA 2I7NA 2I7PA 5I9EB 4PL7A 3ZX2A 1NGBA 2P9SA 5ADXH 3JXUA 1BA0A 4EAHD 5AQKA 2E1YA 2AA4A 3TU5A 1T6CA 3MDQA 4BRMA 1ATSA 3FLCO 3FZHA 3LDQA 4PKIA 2HF4A 1ATRA 4PKHA 3IDHA 3EN9A 1ZXOA 4PKGA 4KBOA 2E1ZA 3WXJA 5AQSA 1RGIA 1NGFA 2V52B 1MWMA 3CQXA 2HMPA 4A61A 2PBDA 2YI1A 3MN6A 3KHYA 2ASPA 3AARA 3MMVA 4CZFA 4EFHA 1GLEG 1MDUB 5AQFA 4CZLA 3DXKB 4CZKA 1GLDG 1GLAG 1QQMA 2FSNA 4J8FA 1HPMA 3C0BA 3ZX0A 1BUPA 4IJAA 5BR9A 5AQJA 2FSKA 2GWKA 3HM8A 3CIPA 4FWPA 5EX5A 1GLLO 3R6MA 3UKRA 4NB4A 1WUAA 4BR7A 4BC4A 4GY2B 3W3DA 5KPRA 4QS7A 1U2VB 2D0OA 4FWKA 5AR0A 4BGAA 5JICA 3LDLA 1Z05A 3RSEA 4BRQA 5AZIA 5AQZA 1QQOA 3D2FA 4K42A 1SZ2A 2IIRA 1NGJA 2NLXA 2ZGYA 1CZAN 3QFUA 3LL3A 4BR4A 2Q36A 1NMDA 3QBWA 3UE5A 3BF1A 4IXCA 5BRHA 4CBWA 2E2NA 1BDGA 3SMSA 1NGDA 3O80A 4RCHA 3SJHA 3HBTA 3FZFA 2J4RA 1KAZA 1NBWA 5LJWA 1DEJA 2OANA 4H0TB 2E8AA 5ELZA 3VPZA 1NGHA 1HLUA 5AQGA 3U9DA 4BRPA 1IJJA 1RDWX 3H3OB 3QMLA 4FWLA 1H1VA 3ENOA 5AQMA 3ENHA 4JN4A 4BG8A 3DXKA 2HOEA 3LDPA 4CZEA 1BO5O 3A8YA 2YHWA 3FGUA 2E88A 3ATUA 4I6MB 4WQ5A 4H5NA 1NGIA 1JCFA 4BC2A 1QQNA 5AZIB 3HZ6A 1IG8A 3UB5A 4BREA 1TYQA 5AQWA 5AQTA 2ZGZA 4M63C 1GLCG 2QWRA 3O08A 4M7YA 4IO8A 5LJVA 1U6ZA 1YAGA 3A5LC 3ZETB 2Q2RA 4BRLA 2Q97A 3WXKA 2HF3A 3R8EA 1YXQA 4H5WA 3MN5A 3C7NA 4GNIA 1X3NA 1TUYA 3CJBA 1GLJO 3U8XA 1BG3A 4B1WB 3IMXA 3VEYA 4CD1A 1D4XA 5JMVA 4LC9B 3CJCA 4C23A 3JS6A 2ITMA 3FE1A 1WOQA 3EKSA 2P9PA 5KPTA 4HWIA 4K43A 3DXMB 1XC3A 1P8ZA 4XH4A 1HKGA 5F0XA 3GL1A 5BREA 2YHXA 1RFQA 1QZ6A 5AQYA 2P9SB 1QHAA 3M1FA 5AQHA 1R59O 2W41A 4AM6A 2V7YA 2CH5A 3F9MA 3VF2A 3CI5A 2QWOA 2V51B 4FPBA 3EKUA 1U2VA 4XH1A 4BRNA 2KHOA 4BRAA 5AQNA 3FZKA 3UKRB 4QS8A 3M6GA 4RTFD 4H0OA 3VEOA 1SQKA 3I33A 4BROA 3QICA 3D7EO 4F9OA 3FZMA 1LOTB 1S3XA 2NRHA 3MN7A 1KAXA 3S41A 4CBXA 4O5FA 3DXMA 3AAPA 4FO0A 4BRGA 4BR2A 1BA1A 5KQDA 4JHDB 4RWTA 1SAZA 4FWOA 3O1WA 4FPAA 4E1JA
chains in the Genus database with same CATH superfamily
1C1AA 2F9TA 2RF2A 3L2VA 3WXLA 4WF9L 2OA8A 3WQUA 1ZBSA 3QNOA 1EQYA 2ZE2A 3H1VX 3SUNA 3OW2M 3C65A 5TKYA 5DM7L 1XMOK 1NK0A 1GLBG 2PAVA 3WEEB 3RMBA 4CFBA 2O8DB 3LDNA 4CJUA 1N34K 3MN9A 4KHWA 3H08A 3L2UA 2R7YA 3AVKA 4ICLA 3VETA 3PO4A 5BRFA 4JKGB 3KLHA 2PFUA 3VOVA 3OYIA 1GLFO 3HPOA 3OYAA 4MO4A 1W0HA 4CW7B 1ESVA 4Y0WA 4DQRA 3VTHA 4CHOA 3OBYA 3BUZB 2QTDA 1A5VA 1CXQA 2AJQA 4CJPA 1HJRA 4O0IA 5FPMA 2A5XA 4DV7K 1S1WA 3CJ7A 5AQPA 3CFRA 4FCYA 4N76A 3RR8A 1LW0A 1QE1A 4DR6K 4A62A 2P9UB 3ZT4A 4FK0A 2DFFA 4BRKA 4CVNE 1HUXA 3HYFA 4B9MA 3V4IA 3EZWA 3ZEUB 3TR8A 3D2EA 2V7ZA 3OYDA 3CMAN 3OS0A 4IOCL 3IUCA 2B4JA 1GOAA 1WNSA 4FW2A 3RSEB 4DV6K 3WEEA 3F5TA 3ZX3A 1Y64A 3GG4A 2VG6A 1OH7A 1SS6A 4B9TA 2KKZA 4BVOA 1BWFO 3NF9A 2IVOA 4WFNL 2QWQA 1SV5A 4I6MA 1JLEA 3V9XA 4BRFA 2G8FA 3BP8A 5FPDA 3NMUA 2YHAA 4B9LA 5HRPA 2IS3A 5AFUA 4E7JA 1HNWK 2B5JA 3QINA 4JI1K 4CJ7A 1BCOA 2YV0X 4FZZA 4DSFA 2IOCA 4H0VB 5C15A 2A6AA 3ID8A 3KIOA 3VQ7A 2W42A 1KVCA 3BEXA 2E2PA 3AV9A 1QS4A 3QERA 4JRPA 4M7XA 3M3ZA 1RBRA 4JD2B 4CEDA 4DWIA 4IZ9A 2P9UA 1K8KB 4DTJA 1L3TA 3U9ZA 1IBLK 5HRRA 2KZZA 5AQUA 5F2RA 4F8RA 3WXIA 4DUYK 3MX2A 4B9QA 4H03B 3D2FB 4M3XA 4JI6K 3DYAA 3ULEA 2PYLA 1VSIA 2X78A 2P9KA 3OA9A 4CZIA 4H5TA 3NGYA 5FRNA 1YVNA 4LF7K 2Z1GA 1BU6O 4H4MA 1X9JA 1HQUA 4ISFA 4H8KA 2P9NB 2DPNA 1EX4A 4DHYA 1EO1A 4DFKA 4JI8K 4KH5A 2CH6A 1XUPO 3KK7A 1MWKA 1NGGA 4X66K 3AO1A 2YHBA 2YNGA 3O4WA 2NRWA 2BTFA 2P9PB 1SKWA 2O8BB 2YJEA 3A5MC 1W97L 3MXMA 4M45A 2XY7A 3CCJN 4WQ4A 3CHWA 3BY5A 3TSPA 1ZC6A 4WFBL 5AQQA 4GVEA 2WBNA 4CIGA 5BPMA 1JL1A 3T69A 2E2QA 2VWBA 2BUPA 3DLGA 3SQ4A 1X9MA 3HP9A 4B8CA 1N6QA 4F3OA 3IS9A 3N4PA 3SBGA 3CFOA 1KXPA 1QHTA 3KLFA 4IFYA 3HVTA 1KC8O 4FWQA 3K5OA 3WT0A 3S9HA 3DAWA 5CYQA 2JLEA 1RDBA 4YDUC 4FM1A 2KTQA 5CHIA 3K59A 4FOEA 3BF3A 4CEOA 2KW4A 2GUPA 1M1KO 4IDKA 1JLBA 4A2AA 1S1UA 3CMEN 1HX1A 3DWLA 4LFAK 1BOTO 5DK5A 2ASMA 3VEVA 4BQZA 4FL9A 4I2QA 4Z4GA 3VQCA 2NRXA 3O9QA 4B08A 2P9IA 4WQ5C 3C6UA 5EU7A 4CD3A 3WNGA 4CF8A 4J2AA 4GKKK 1NWKA 3HVRA 2CGJA 2VCPA 4WQ4C 5AZJB 3AO2A 1UA0A 4PQUA 2ZJPL 3ZSXA 5I3UA 1VQ5N 2G8UA 3ASMA 1J6ZA 4CK3A 1NM1A 2D5RA 1RDCA 2QWNA 4E7HA 3CCUN 1Y97A 2I7PA 5I9EB 3HO1A 5ADXH 4ZTJA 4CGJA 4QCLA 4OPJA 3C6TA 5AQKA 4DV0K 2G8VA 3O4QA 1RDAA 3FLCO 2KQ2A 4PKIA 3PY8A 4MQ3A 1U48A 4PKHA 4DTOA 2XY6A 3IDHA 3ALYA 4KPYA 2D0CA 3AVIA 5K14A 2VQEK 4PKGA 4ELVA 5AQSA 2HHSA 3F2KA 5J2NA 1NU0A 1ZBHA 4DF4A 3B6PA 2YI1A 3MN6A 3KHYA 3KD5E 1JLAA 3VQEA 3VMFB 4CGDA 5HOOA 4CZKA 3MWTA 3SAGA 1HPMA 1BUPA 5AQJA 2FSKA 2RN2A 2GWKA 3HM8A 1HNXK 4DUZK 1RT4A 5EX5A 1YI2N 1GLLO 4PA1A 4C8LA 3NAEA 4NB4A 2IAJA 1ZBUA 4BC4A 4DS5A 1IKYA 4RW9A 3DMJA 3THYB 1U2VB 5AR0A 4KH6A 1Z05A 4BRQA 5AQZA 3VQ4A 3D2FA 3SBTA 4KB1A 1EKEA 1SZ2A 4K42A 1N5YA 3RVCA 2F7TA 4LF6K 4PUOA 3QFUA 1VQMN 2O8FA 1NK6A 3CCMN 1BDGA 3SMSA 4UQGA 3S3OA 1KAZA 3CXCM 2OANA 2O8FB 1JLFA 1HLUA 1VQLN 4PHTX 4BRPA 1RDWX 3JYTA 3HXMA 1SKSA 3DXKA 3OYEA 1BO5O 1SKRA 4LH5A 1I39A 4KKOA 3V1OA 3FGUA 3P83D 3ITHA 3HZ6A 1BIZA 4OKEA 3ZT1A 5KTQA 5AQWA 3ZSOA 3DLEA 3PSFA 2NUBA 4HUFA 4F3TA 3TANA 4WCEL 1XNQK 4BY9C 4IO8A 1UWBA 1YAGA 2VGNA 4MDBA 4BRLA 4DS4A 3PUFA 4O8UA 5BR8K 1VQ9N 2HF3A 3R8EA 1YXQA 4OGEA 4CIFA 3I56N 3C7NA 4GNIA 2NNWA 3CJBA 1SL1A 1NMNA 3CJCA 1CZBA 3C95A 3HSTB 2ZM6K 1WOQA 3LP2A 3DRPA 4CJWA 4HWIA 2DTUA 4K43A 2XHBA 3DXMB 1XC3A 5F0XA 4DTUA 1WSEA 1QZ6A 4HCBA 2V7YA 2UXCK 2CH5A 3F9MA 4GVMA 2V51B 3LPTA 3CCEN 2QEXN 1TGOA 1U2VA 2OPSA 2XRIA 4XH1A 4CHNA 4BRNA 4XIUA 2KHOA 2OYQA 1QSYA 3P38A 1TL1A 1ASVA 3MEGA 5FLXO 2BGGA 3O9RA 3KLGA 3FZKA 4CHZA 2JWKA 1X9WA 4RG8A 3OYFA 4BACA 4B9UA 3EZ5A 1BA1A 2G8KA 4AHSA 3O1WA 3ZYYX 2I5JA 3N4QA 4ZHRA 5HROA 3AA2A 1Q9YA 4KAZA 5SZTA 3R1XA 1HMVA 4CFCA 4X62K 3VA0A 3P4IA 4DTSA 4FWRA 5EXWA 1DGKN 4CK1A 1RBSA 2X6SA 1DKGD 1NKCA 3V1RA 3U3GA 4FM0A 3H1QA 3VF4A 5TKWA 4DFMA 1NJXA 5CYMA 1D8YA 2Q3SA 4YOVA 1HYZA 3A2FA 2IVPA 3AAQA 1HNVA 1HKBA 4IJNA 3LWLA 2W6LA 1KCFA 1S6QA 3I8DA 3K2PA 2Q0UA 4JI0K 1W9HA 2A3ZA 3VGMA 2YNFA 1C0GA 1LW2A 3KJVA 2QXLA 4MLEA 2GUIA 2HB5A 3DOKA 1EETA 1WSHA 3FFKB 2Y1JA 3CERA 4IDHA 3CF5L 1VSJA 3P39A 5M1PA 2GBZA 4LY7A 3I55N 2E20A 3QFPA 1IV0A 2OCEA 1NK4A 1LCUA 1A5WA 4DU3A 3CYMA 4FJLA 4CCHA 3EEQA 1IG9A 2FF3B 5JVGL 4OPHA 4DR3K 3SLCA 1WSIA 3L0QA 3OTOK 4FZXC 3GOIA 4JI3K 3M8RA 4DQIA 3H6EA 1RT1A 3DLLL 3DI6A 2ZF5O 4O55A 4A2BA 3IFRA 3ULEB 5AFUH 3OYGA 3IRXA 1BI4B 4MFBA 1REVA 5CE3A 1K8KA 2B6AA 3SQ2A 3I8BA 4B3SK 3CCRN 4CFAA 4CBUA 1ATNA 4J2BA 3A5OC 4YDUA 5EOYA 4C1NI 3O8MA 3L2QA 3HRGA 1MA9B 4LF8K 3VQDA 2G8HA 2BDPA 1KFDA 4DV3K 5J1EA 1DT9A 4OPAA 3AY9A 5KPZA 3DLHA 2GWJA 4K25A 4DQ8A 5IWAK 2QW9A 3VEXA 1VQNN 4FJXA 5GAHP 3A5NC 3QDKA 3V9UA 4JNEA 3U4LA 1C1CA 1SUQA 5JS1A 3THXB 3T1AA 3U6FA 4FVUA 2QWLA 3O4NA 3CJ9A 4K0KK 2QA4N 1S9EA 4NCBA 3OS2A 1SL0A 5B8HA 4HTUA 3SK3A 1TYQB 3CC4N 4M41A 3ISNC 4DV1K 4JKHA 1JCEA 2A40A 3SV3A 5LMNK 2KZMA 4B1ZA 1NJIO 1KD1O 2FC0A 3LZIA 2F96A 3TABA 2YKNA 4M42A 3C7NB 5EY4A 3OS1A 2IDOA 5T7BA 4BR0A 2HHWA 2UXBK 3VF6A 1HQEA 5FPNA 2FSJA 1NNEA 2XY5A 3LP1A 1VSKA 1YJNN 4BWMA 1E4GT 1X9SA 1TVRA 4KTQA 5BRDA 5DM6L 2NZTA 2P9IB 3OVNA 1JLCA 3TTCA 1C0FA 5BPNA 1K8AO 1L3VA 4JAXA 4FWSA 3AVMA 1Q18A 1VSMA 1T7PA 5C10A 3PX4A 1RTHA 3H45C 4FOIA 4CJ4A 4HUEA 4H0YB 3LM2A 4CEFA 1C0UA 4I9LA 1V4SA 4BRCA 2Z1IA 4KHYA 3CG7A 1WB9A 1ITGA 1TKXA 3JSMA 4LF4K 3HM9A 2D1KA 1JXEA 1X3MA 5AQLA 4N41A 3Q7BA 3E9LA 4FWNA 4HTLA 1U49A 1XMQK 3AVAA 3LM9A 2Y1IA 4J2DA 1HYSA 2YCHA 4JKFA 4FK2A 4FLZA 4B9SA 3DOLA 4GV3A 3DLRA 3EY1A 1NG9A 3AA4A 3HP6A 4B1YB 3SUPA 1FKOA 4FJMA 2RKIA 4FM2A 3ZSWA 4XH5A 3K5MA 4ELTA 4R5PA 1VQON 3BZKA 4OX9K 3ZETA 4FSVA 1YUWA 5GAGP 1J5OA 4B1UB 4NCAA 4CZJA 3AVHA 4A5AA 1QVGM 4YOTA 3L4QA 4FJ9A 1FXXA 1ATSA 3FZHA 2HF4A 1ATRA 1YITN 4DSEA 4AQYK 4IOAL 1S1TA 4BE0A 4DU1A 1NOZA 4CJEA 1RGIA 2V52B 1MWMA 3CC2N 2HMPA 2P5OA 2ASPA 3LP3A 3AARA 3MMVA 4EZ9A 1CZ9A 3P31A 4AH9A 5C0YA 5AQFA 5HP1A 4ILJA 3DXKB 4B9VA 1GLAG 1RBUA 2FSNA 4J8FA 3C0BA 3K5LA 4IJAA 3HOTA 3NF8A 1JLQA 3P5JA 4AHCA 4DFJA 1O13A 3R6MA 4HCCA 5FRMA 4IFEA 1WUAA 1OVYA 4M3YA 3HPGA 5C2DA 1WBBA 3W3DA 2HNZA 2D0OA 1S72N 4N56A 1VRTA 1XI1A 1NKBA 4JKAA 4E7KA 1CXUA 2PZSA 1QQOA 4U7BA 3SJJA 4A57A 1NGJA 3ZLJA 3NE6A 2ZJRL 1NMDA 3Q7CA 4E19A 4CBWA 2E2NA 3TSQA 4RCHA 3HBTA 3SUQA 3FZFA 1NBWA 1NKEA 4JLHA 2E8AA 3M8PA 3TAFA 3VPZA 3U9DA 4YY3K 1C1BA 1RTDA 1VRUA 3H3OB 4F2RA 4CJTA 1W7AA 3T19A 3V9WA 4FLUA 5C12A 3SPZA 3D0PA 4KTZA 2YHWA 2Z1HA 1KLNA 2E88A 1KQSM 1LAWA 3SV4A 4WQ5A 2OPRA 4DSLA 3SQ1A 1QQNA 3TTFA 5GIPA 3UB5A 4CJVA 3ZSZA 1TYQA 4CESA 1EWQA 3PV8A 2VG5A 5FROA 2ZGZA 4M63C 4CJRA 2QWRA 4ILHA 4UY8O 1QTMA 3QO9A 4I9QA 4LFBK 2Q97A 1XNRK 3NGZA 3WXKA 3QEIA 4BWJA 4H5WA 1GLJO 4CF9A 3IMXA 1D4XA 3CFPA 3O3HA 3J7AP 3ZT0A 4E7LA 3FFIA 3MECA 1U47A 2WC9A 4BE1A 3TAQA 3V81A 1IH7A 3BGRA 3OYJA 1P8ZA 3AVNA 2VWJA 4KB0A 3O3GA 1TL3A 3NH0A 1FKPA 3OYKA 3GL1A 5BREA 2P51A 1RFQA 4B3TK 3ZSRA 1R59O 2F4VK 4GKJK 5SWMA 3ZT2A 2OPQA 4FPBA 4DFPA 1TAQA 1HYVA 3CCLN 1TK8A 1R0AA 4BRAA 1ZBFA 1CLQA 3ZSYA 1OH5A 3UKRB 3M6GA 3KD1E 4H0OA 4FJGA 2BH1A 4BROA 4X64K 3D7EO 4DLGA 4CF1A 1EP4A 3S41A 1YIJN 4DR2K 4DQSA 1JJ2M 1VQKN 4PWDA 3AAPA 4FO0A 3THWB 4BRGA 3NF6A 2HVHA 1TK5A 4B9NA 4JHDB 3SNNA 4RWTA 4FWOA 5KGXA 3OBWA 1BIUA 4LSLA 4BDYA 4FPAA 2CGLA 3G0ZA 1Z6RA 3VQ8A 3HK2A 4KRFA 1IO2A 2HHTA 1QSLA 3KKSA 1VQ8N 2O8BA 2UUAK 4IBNA 5CR4A 2IVNA 4BE2A 4GW6A 2P5GA 1UOCA 2GELA 4NO7A 1I94K 4CZGA 3CPWM 2FBVA 3MAQA 3RMDA 1HNZK 5KRTA 4Q5VA 2VWKA 2ZWHA 4ZTFA 4M3WA 3K57A 4NXMK 1NJZA 1W2BM 3WNEA 1GOCA 1N32K 3CETA 1RNHA 1QZ5A 3L4IA 3KWIA 3TWHA 5JS2A 3OY9A 3ZCMA 1RT5A 1WLJA 4DTXA 4JRQA 4QOZB 3BZCA 3O6WA 1HRHA 1OKJA 2ASOA 3G4SN 2FXUA 2EX3A 4H0XB 2GX9A 1HNIA 2AP1A 4IOXA 4CIEA 4OJRA 4FVMA 5MLCQ 4C8NA 5KI6A 1GOBA 4DTMA 4M3TA 1ASUA 3ATVA 3GBTA 4RW6A 5I42A 3QESA 3GE1A 4LFCK 3SQ0A 2UU9K 3AA5X 3UKUA 4BDPA 4BRIA 1YVUA 3SUOA 4CGFA 3LWMA 3THXA 1OH6A 5AQRA 2VYPA 4Y1DA 1BGXT 1G15A 4CK2A 3J7ZO 5AQVA 1RTIA 1TKDA 4BC5A 2D0AA 3HL8A 3D2EB 1NGEA 4EHTA 4DR7K 2D0PA 3IKMA 3PIPL 4IO9L 3ZSQA 1ILYA 1E3MA 3PSIA 3J8AA 3B8AX 1JLGA 2F9WA 5ADXA 4Y1CA 1U04A 3V9SA 3KZBA 3THYA 3H46O 2O4GA 3OJUA 4EP4A 3MXIA 2P1JA 3VERA 1L5UA 3L3VA 3NF7A 1N33K 4CGHA 3DRRA 4CEEA 5GAEP 2GTDA 5M1FA 2KLAA 3J81O 2OTJN 1SL2A 4EIAA 4H0PA 3VEWA 4B1VA 4XEIA 4JKBA 2ETJA 3D45A 3MWPA 3H3NO 4H5VA 1HR0K 3QBXA 4JK8A 4RW8A 2P9KB 4OO1J 4IG3A 3T7ZA 4V19S 3QIPA 3QEVA 3V1QA 4YOUA 4L8RB 4DV4K 4WFAL 3VTIA 4EP5A 3TPQA 2O8CB 4DV2K 3EO3A 4O5BA 2Q0RA 5M1QA 3AVJA 4Z4HA 4JKEA 4GV9A 1T44A 4IWVA 3IAYA 3THWA 3AVCA 4JYAK 1N8RO 2WONA 4AM7A 1Z25A 1K9MO 3QB0A 3LDOA 1VHXA 4G1QA 4OPKA 1KFSA 3OHRA 1IBKK 1LAVA 3QEWA 2OPPA 4HUGA 4AHRA 4DCHA 3CJAA 2QWPA 1S1VA 3J7YP 1YF5L 4KHPK 2QWMA 1LWEA 3VESA 4BR9A 3RTVA 1NOYA 2WUSA 1EXQA 3AVBA 4PL8A 1HKCA 3R3LA 4CHPA 4K41A 1VQPN 1B92A 5C42A 3R9PA 2HMIA 4H5RA 4FJ7A 4B3RK 1M90O 3W0LA 4CJLA 3VQBA 4FLTA 1L3UA 2PYJA 1HJOA 2UYTA 4M3RA 1WSGA 1Z26A 4B3MK 2GEMA 1XHZA 2YHYA 4W5RA 4E1MA 1VSFA 3SI6A 1NK7A 3GDQA 2YJFA 2W40A 1G99A 3RR7A 4WE1A 1K6YA 2X6NA 3G10A 1RT3A 2FLOA 2YNIA 5J2QA 3AGKA 3E1YA 2I7NA 4A5BA 4PL7A 3ZX2A 1NGBA 3JXUA 1J9AA 4X65K 4EAHD 5DMRA 2HHQA 2D0BA 4Z0UA 3CCVN 2AA4A 2HSTA 3MDQA 4FJNA 3T1HK 3VA3A 3LDQA 4JV5K 3NCIA 4JKCA 4O4GA 1TK0A 3LAMA 1ZXOA 1BQNA 3AO5A 4DR1K 4A61A 3VQ5A 2PBDA 2NRVA 4CJSA 4I2PA 3MEDA 5AJ3K 5HRNA 5J2MA 2WFBA 5H1SQ 2DFHA 1MDUB 4CZLA 4CEQA 1GLDG 1QQMA 1ZBLA 4DMNA 3AGRA 4C8KA 4M3UA 1WSJA 4FWPA 2KFNA 3S3MA 4JI7K 1RT6A 2IC3A 4CE9A 2ATQA 2W6KA 3RMAA 4BR7A 5J2PA 4DR4K 3O9SA 1VQ7N 3L2WA 5KPRA 4QS7A 4B3OA 3K9KA 4BGAA 4JK7A 2O8EA 5JICA 3LDLA 5HRSA 5AZIA 1UA1A 2WTUA 4NXNK 2IIRA 3M8QA 4RW7A 1C0MA 2ZGYA 1CZAN 3LP0A 3G71N 1RDUA 3ZT3A 1OVQA 3MEEA 4U67L 4IXCA 5BRHA 4DQPA 4CF0A 1YT3A 1BCMA 3O80A 3SJHA 2G8IA 1VSHA 1RILA 4G9ZA 4MDAA 3ID6A 5LJWA 3SYZA 1NGHA 1NK9A 1IJJA 1FJGK 3CM5A 4FWLA 4OLBA 2O8CA 3K58A 1H1VA 5AQMA 3ENHA 3VQAA 4JN4A 2UUBK 2HOEA 2ITGA 1XC9A 3I0RA 3A8YA 1T05A 4N47A 1KVAA 5CY4A 3ATUA 4I6MB 4HHTA 1O1WA 4H5NA 4KHQA 4BC2A 5AZIB 1WN7A 1A5XA 4BREA 4E7IA 3G6EN 1FK9A 1JXBA 3VQ6A 3O08A 1T03A 2RPIA 3OYBA 1KRPA 4IG0A 3ZETB 2UXDK 5M1NA 2ZQBA 4LH4A 5LMUK 3L3UA 1X3NA 4B1WB 4W5QA 4KHSA 5JMVA 4DTRA 4C23A 4YNQA 3O9UA 2ITMA 3TAPA 3IG1A 3PO5A 3QIOA 4YOXA 2UUCK 3EKSA 2PY5A 5KPTA 1DLOA 2BE2A 5IT9O 3F9KA 5HLFA 4XH4A 2IGIA 2QI2A 4OLAA 4CHYA 2YHXA 1KTQA 3EE9A 5AQYA 1Q8IA 3DLBA 4KHNA 2DFEA 3MX5A 1JKHA 1WAFA 4CJKA 1WBDA 1RBTA 2HBKA 1VQ6N 4DR5K 3T3FA 4YOWA 4DF8A 3D6RA 3K9JA 4DG1A 5AQNA 4QS8A 4RTFD 3C6HA 1SQKA 3P1GA 3LZJA 4FLYA 1T3VA 3TSUA 4F9OA 3VN5A 3MN7A 1KAXA 3S3NA 4CBXA 3KK1A 3DXMA 1T8EA 4OKKA 4IEEA 4OKJA 3ENBA 3QEXA 2QKBA 1BISA 1SAZA 4BDZA 4N5SA 1RBVA 3LALA 5KQ8A 5C2FA 2HVIA 3TI0A 1NJYA 1BI4A 3OJSA 4PY5A 2XY8A 2Q1NA 4CZHA 3NHGA 3CM6A 3PX6A 1U45A 3TAGA 4CI6A 4CJ5A 3WQTA 4JI2K 3CQ8A 2E4LA 1LWCA 5AQXA 3CPEA 2D4WA 2E6MA 1TUUA 2EWSA 4BQLA 4O8KA 1IKXA 3TAMA 4DB3A 2OTLN 3F73A 1S5JA 4LD0A 4W5NA 3AO4A 4YORA 4AHVA 4ISGA 2CGKA 1YJ9N 5EVZA 4FWMA 1S22A 5BN9A 2O8DA 4ELUA 2OZSA 4MLHA 5KGWA 3EYZA 3T1YK 4FJKA 4FJ8A 3O1BA 4KTWA 4BC3A 3NDKA 4C8OA 4JHDA 3NBPA 3KK3A 1J54A 3M8SA 4C1NK 4OGCA 5BPLA 1Q81O 5LL6Z 2HW3A 4L3QA 4QS9A 3OYMA 4YHHK 2P9NA 1BQMA 1RT7A 5HBMA 1KAYA 1VK0A 1JCGA 4KO0A 2JWLA 4AHTA 3JAMO 4DV5K 3MXJA 3HI0A 2KFZA 3THVA 2G8WA 4ILGB 4W5OA 4AHUA 4FYDA 3C6AA 1EWRA 4DLEA 3TTDA 3NVMA 1P90A 2O4IA 3TARA 4CEBA 3LPUA 1TKZA 4JI4K 4FLXA 3HSCA 3SCXA 2YKMA 2NRZA 2XO7A 5AZJA 2WOMA 1NK5A 1TV6A 2ZD1A 3FR0A 4JD2A 3VEZA 2P9LA 2A42A 3KVGA 1NGCA 1NLVA 1DTTA 3RRHA 4AILC 5F1XA 5JLHA 3LAKA 2HBMA 5E84A 5FPEA 3V9ZA 1T6DA 3NH1A 5GIOA 5GADP 3KLEA 5AQOA 3O9TA 2FBTA 3WNHA 4B1XB 4BGBA 1HPZA 1XQSC 4KHUA 2FF6A 3SMPA 3V6DA 3VGLA 1VAZA 4DU4A 3ZEUA 5JLFA 1NJWA 3UKUB 4CEZA 3AO3A 1D5AA 4LF9K 2HHUA 1RT2A 4BR5A 4JS5A 3G25A 4E89A 3L6QA 4Z94A 2E6LA 4CJ3A 3FZLA 3OYCA 4CZMA 3L2RA 5C25A 5M1OA 3VQPA 4CHQA 4RW4A 2H3GX 5D3GA 4DQQA 1WAJA 4GMJB 4CGIA 2JGUA 3NFAA 3KK2A 4CECA 1VSLA 1Q9XA 4BVPA 3J80O 4K8XA 4Z4EA 1C0TA 1RCHA 3EL2A 3DLKA 3MCAB 4B8AB 3WNFA 3NH2A 2VGMA 4EHUA 2GV9A 5BN8A 4Z4FA 3QLHA 4A59A 4DKWA 2NRTA 2Q31A 3HOSA 4JKGA 2HHXA 4CEAA 4NYNA 3OYNA 1IKWA 1X1PA 2YNHA 4FW1A 4BG9A 4FLVA 1DTQA 3CJ1A 2RHKA 1S1XA 3PLAA 5GINA 2VG7A 5E26A 4JS4A 3DJCA 3MCPA 1L3SA 4AF1A 3BDPA 3QETA 4BRHA 2QKKA 2RE2A 4W5TA 1NGAA 3WUHA 3LANA 3DM2A 3MK6A 3SAHA 4BRDA 3A0IX 3KKRA 5AQIA 3QEPA 3HPHA 4HVJA 3TAEA 2A41A 1E4FT 1V4TA 2E2OA 2HBJA 1UAXA 3VQQA 3VGKA 2E5LK 2P9LB 3I0SA 5LY3A 4KV8A 1XWLA 2YX6A 3VENA 4GV6A 4LF5K 4C8MA 4MO5A 4ISEA 4NLBA 4KI6A 4KH4A 1RDDA 4WYBA 1LWFA 4O44A 3O5BA 4JI5K 2DY4A 3B6OA 3CQYA 1D9DA 3AVGA 2QM1A 4TSXA 4FK4A 2QXFA 3NVKA 1FW6A 3K0SA 4YOYA 3HTVA 1JL2A 2O8EB 4F2SA 2P9SA 3RMCA 1BA0A 3ULDA 3VQ9A 1J5EK 4ID1A 2E1YA 3TU5A 1T6CA 4BRMA 3K5NA 1K73O 3CC7N 4R79A 3KWGA 4FJIA 2OZMA 4IFVA 3EN9A 3QNNA 1TKTA 4KBOA 4JEPA 2E1ZA 3WXJA 4CJFA 3L8BA 3CQXA 1NGFA 5FDLA 3DRSA 3RRGA 4DTPA 1NK8A 3SPYA 2ZJQL 3AVFA 2FBYA 4CZFA 1RTJA 4EFHA 4FJHA 1GLEG 4Q0BA 4FXDA 2F8TA 3O3FA 3ZX0A 5BR9A 4K8ZA 2A1SA 2HHHK 4KREA 3AVLA 1ZBIA 3CIPA 4FZYA 5C24A 4EZ6A 1N36K 3UKRA 4DTNA 4GY2B 2HNYA 4FWKA 5M1KA 3E9OA 1IKVA 1Q86O 1D9FA 4H4OA 3M5RA 3RSEA 1U4BA 1BHLA 4CJQA 3RWUA 5KRSA 2NLXA 1B9DA 3LL3A 3NGIA 1MU2A 4BR4A 1Q7YO 2Q36A 3UE5A 3QBWA 5JVHL 3BF1A 3UIQA 1NGDA 1YTUA 1BL3A 2J4RA 1VSEA 1DEJA 4H0TB 5ELZA 3U3YA 1YJWN 1IBMK 1C6VA 5AQGA 3EE8A 3HJFA 2FBXA 4DSIA 3QMLA 3PIOL 3OYLA 3ENOA 4BG8A 2X74A 3CCQN 3LDPA 4CZEA 1VSDA 3E01A 4CGGA 1ASWA 5HL7L 1ZYQA 1KSPA 1F21A 5A2QO 3KTQA 1YTAA 3E66A 1NGIA 1JCFA 2HBLA 1IG8A 4ID5A 4IKFA 5CZ2A 3LDSA 5AQTA 1LV5A 1S9GA 3E9PA 4CF2A 3CCSN 3C94A 4M3ZA 1QVFM 4YFUA 3WXMB 1B9FA 1I3AA 5E41A 1YHQN 1GLCG 2HNDA 4M7YA 4FJJA 2F8SA 5LJVA 1U6ZA 3SZ2A 3A5LC 1OH8A 2Q2RA 3AA3A 1KLMA 3MN5A 1VQ4N 1TUYA 3U8XA 1BG3A 4CD1A 3VEYA 3KLIA 4LC9B 3JS6A 4JKDA 3FE1A 5CZ1A 2P9PA 4E0DA 4CFDA 1QQCA 4NLCA 4LSNA 4JK9A 2VQFK 1HKGA 4KFBA 3HT3A 2P9SB 1QHAA 2BANA 3M1FA 2W41A 5AQHA 4AM6A 4F4KA 4DSJA 1TAUA 4J2EA 4NYFA 3ZSVA 3VF2A 4E1NA 4O0JA 3CI5A 2QWOA 4Z4IA 1WSFA 1J53A 2LSNA 3EKUA 2NRRA 3SAFA 2Z1JA 1S6PA 4I7FA 4FJ5A 1KVBA 4FLWA 3VEOA 4CERA 2EHGA 3PX0A 3I33A 2A1RA 3CD6N 3QICA 1XHXA 1LOTB 1S3XA 3FZMA 2NRHA 2HHVA 4O5FA 1QSSA 4IEIA 4NCGA 4E3SA 2QK9A 4OVLA 4BR2A 5KQDA 4KI4A 4QAGA 1Q82O 3OYHA 4Z4CA 4DSKA 4E1JA
chains in the Genus database with same CATH topology
5KQ8A 2CGLA 5C2FA 1Z6RA 2F9TA 3R1XA 3WXLA 4WF9L 3P4IA 3WQUA 1ZBSA 4FWRA 1EQYA 3H1VX 5EXWA 1DGKN 3OW2M 3C65A 1DKGD 5TKYA 5DM7L 1VQ8N 2Q1NA 1GLBG 4CZHA 2PAVA 3WEEB 5CR4A 2IVNA 4CI6A 3H1QA 3LDNA 3WQTA 3VF4A 5TKWA 2GELA 5AQXA 4NO7A 3MN9A 4CZGA 3CPEA 2D4WA 3CPWM 1TUUA 2EWSA 4YOVA 4BQLA 4O8KA 3VETA 5BRFA 4JKGB 4DB3A 2IVPA 3AAQA 2PFUA 2OTLN 3VOVA 1GLFO 2ZWHA 1HKBA 4IJNA 4MO4A 1ESVA 4Y0WA 4YORA 3VTHA 3OBYA 4WFBL 3BUZB 2QTDA 4ISGA 2CGKA 1W2BM 1YJ9N 2Q0UA 5EVZA 4FWMA 2A3ZA 3VGMA 1S22A 3CETA 5BN9A 1C0GA 1QZ5A 3L4IA 2QXLA 4MLEA 5FPMA 2A5XA 3KWIA 3FFKB 4MLHA 3CERA 4IDHA 3CJ7A 5AQPA 3CF5L 3O1BA 4BC3A 3P39A 3O6WA 4JHDA 5M1PA 1OKJA 4A62A 2P9UB 3I55N 2ASOA 2E20A 3QFPA 3G4SN 4C1NK 1LCUA 5BPLA 1Q81O 2FXUA 4BRKA 4H0XB 2GX9A 2AP1A 4IOXA 2FF3B 4L3QA 1HUXA 4QS9A 5JVGL 5MLCQ 2P9NA 4OPHA 3EZWA 3SLCA 3ZEUB 1KAYA 3D2EA 2V7ZA 3L0QA 1JCGA 3CMAN 3ATVA 2JWLA 3GBTA 4IOCL 3GOIA 3IUCA 3GE1A 3HI0A 3RSEB 3H6EA 3DLLL 3UKUA 3WEEA 3F5TA 3ZX3A 4BRIA 1Y64A 2ZF5O 4ILGB 4A2BA 3GG4A 3IFRA 3C6AA 3ULEB 1SS6A 5AFUH 2KKZA 3TTDA 5AQRA 1BWFO 2VYPA 4BVOA 2IVOA 5CE3A 2QWQA 3NVMA 1K8KA 4WFNL 1P90A 4I6MA 4BRFA 3J7ZO 3I8BA 3BP8A 5FPDA 3CCRN 3NMUA 3HSCA 5AQVA 2NRZA 4CBUA 1ATNA 5AZJA 5AFUA 3A5OC 4YDUA 4BC5A 5EOYA 4CJ7A 3D2EB 4C1NI 4JD2A 3FR0A 1NGEA 3VEZA 3O8MA 4EHTA 3HRGA 1MA9B 2P9LA 2A42A 3KVGA 4H0VB 5C15A 2A6AA 3ID8A 1NGCA 1NLVA 2D0PA 3BEXA 2E2PA 3IKMA 5F1XA 1DT9A 5JLHA 4OPAA 3AY9A 5KPZA 3PIPL 2HBMA 5E84A 5FPEA 2GWJA 4M7XA 4IO9L 3M3ZA 1T6DA 4K25A 1ILYA 4JD2B 4DQ8A 5GIOA 3J8AA 2QW9A 4IZ9A 2P9UA 3VEXA 1K8KB 3B8AX 5GADP 1VQNN 5AQOA 3U9ZA 2F9WA 5GAHP 3A5NC 5ADXA 5AQUA 3O9TA 5F2RA 3QDKA 3WXIA 4B1XB 3KZBA 4JNEA 3H46O 3U4LA 3MX2A 4BGBA 4B9QA 3VERA 4H03B 3D2FB 1XQSC 2FF6A 4FVUA 3SMPA 3ULEA 2QWLA 3VGLA 1VAZA 3CJ9A 3ZEUA 5GAEP 5JLFA 2GTDA 2P9KA 5M1FA 2QA4N 3OA9A 2KLAA 3UKUB 4CZIA 2OTJN 5B8HA 4H5TA 4EIAA 3SK3A 1YVNA 1TYQB 3CC4N 4H0PA 3VEWA 1BU6O 4B1VA 4XEIA 1X9JA 4JKBA 3MWPA 4BR5A 4ISFA 3G25A 2P9NB 3L6QA 3H3NO 2DPNA 4H5VA 4Z94A 3QBXA 4JKHA 4JK8A 2P9KB 4DHYA 3T7ZA 4OO1J 1JCEA 1EO1A 2A40A 3FZLA 4KH5A 4B1ZA 4CZMA 2CH6A 1XUPO 3KK7A 1NJIO 5M1OA 1MWKA 1NGGA 1KD1O 4YOUA 2H3GX 3O4WA 2NRWA 4WFAL 2BTFA 3VTIA 3TPQA 2P9PB 4BVPA 2YJEA 3A5MC 3C7NB 3EO3A 5EY4A 2Q0RA 1W97L 3EL2A 3MCAB 4BR0A 5M1QA 2VGMA 4EHUA 3VF6A 5FPNA 5BN8A 4JKEA 3CCJN 4GV9A 2FSJA 4WQ4A 1T44A 3CHWA 4IWVA 4A59A 1YJNN 4DKWA 1E4GT 1N8RO 4AM7A 1K9MO 3QB0A 3TSPA 2NRTA 5BRDA 1ZC6A 2Q31A 3LDOA 2NZTA 4GVEA 2WBNA 4JKGA 5AQQA 2P9IB 5BPMA 2E2QA 2VWBA 3OHRA 2BUPA 3T69A 3TTCA 1C0FA 5BPNA 4BG9A 1K8AO 3CJ1A 4JAXA 4FWSA 1Q18A 2RHKA 3N4PA 3SBGA 5C10A 1KXPA 3PLAA 1KC8O 3H45C 5GINA 4FOIA 4DCHA 3CJAA 4FWQA 5E26A 3DJCA 4H0YB 2QWPA 3WT0A 1YF5L 3MCPA 4AF1A 2QWMA 3DAWA 3LM2A 3VESA 4BR9A 4BRHA 1V4SA 2RE2A 2WUSA 4YDUC 4BRCA 1NGAA 4PL8A 3WUHA 5CHIA 1HKCA 3MK6A 3R3LA 4K41A 3SAHA 1VQPN 4FOEA 4BRDA 3BF3A 3A0IX 5AQIA 2GUPA 1M1KO 2D1KA 1X3MA 5AQLA 3R9PA 4A2AA 3CMEN 2A41A 3E9LA 1E4FT 3Q7BA 1HX1A 4FWNA 3DWLA 1V4TA 1BOTO 2E2OA 2HBJA 4H5RA 1M90O 3VGKA 2ASMA 3W0LA 2P9LB 3LM9A 3VEVA 5LY3A 2YCHA 4BQZA 4FL9A 4JKFA 1HJOA 2UYTA 2NRXA 3O9QA 5DM6L 2GEMA 2P9IA 4WQ5C 2YX6A 3VENA 4GV3A 4GV6A 2YHYA 4CD3A 4MO5A 4ISEA 4NLBA 1NWKA 4KH4A 4B1YB 3GDQA 2CGJA 2VCPA 2YJFA 4WQ4C 4WYBA 5AZJB 2W40A 1G99A 2ZJPL 4XH5A 3O5BA 1VQ5N 1J6ZA 3CQYA 2FLOA 1VQON 3ZETA 4FSVA 1YUWA 2QM1A 5GAGP 1NM1A 3NVKA 4B1UB 4YOYA 2QWNA 3AGKA 3E1YA 3HTVA 4CZJA 2I7NA 3CCUN 4A5BA 2I7PA 5I9EB 4A5AA 4PL7A 3ZX2A 1NGBA 2P9SA 5ADXH 1QVGM 3JXUA 4YOTA 1BA0A 3L4QA 4EAHD 5AQKA 2E1YA 2AA4A 2HSTA 1T6CA 3TU5A 3MDQA 4BRMA 3HOSA 1ATSA 3CCVN 3FLCO 3FZHA 3LDQA 4PKIA 1K73O 3CC7N 2HF4A 3KWGA 4R79A 1ATRA 4JKCA 4PKHA 3IDHA 1YITN 3EN9A 4IOAL 1ZXOA 4PKGA 4KBOA 4JEPA 2E1ZA 3WXJA 5AQSA 3F2KA 1RGIA 1NGFA 2V52B 1MWMA 3CQXA 3CC2N 2HMPA 4A61A 2PBDA 2YI1A 2ZJQL 3MN6A 2ASPA 2NRVA 3AARA 3KHYA 3MMVA 4CZFA 4EFHA 1GLEG 3P31A 2WFBA 5H1SQ 5C0YA 3VMFB 1MDUB 5AQFA 4CZLA 4ILJA 3DXKB 5HOOA 4CZKA 1GLDG 1GLAG 1QQMA 3MWTA 2FSNA 3SAGA 4J8FA 1HPMA 3C0BA 3ZX0A 3AGRA 1BUPA 4IJAA 5BR9A 5AQJA 3HOTA 2FSKA 2GWKA 3HM8A 3CIPA 4FWPA 5EX5A 1YI2N 1GLLO 1O13A 3R6MA 3UKRA 4NB4A 4IFEA 1WUAA 1OVYA 4BR7A 5C2DA 4BC4A 3O9SA 4GY2B 1VQ7N 3W3DA 5KPRA 4QS7A 1U2VB 2D0OA 4FWKA 1S72N 5AR0A 3K9KA 3E9OA 4BGAA 4JK7A 4KH6A 4JKAA 5JICA 5M1KA 3LDLA 1Z05A 1Q86O 3M5RA 3RSEA 5AZIA 5AQZA 1QQOA 4BRQA 3D2FA 3SBTA 4K42A 1SZ2A 4U7BA 2IIRA 4A57A 3RVCA 1NGJA 2F7TA 2NLXA 2ZGYA 1CZAN 3G71N 1RDUA 3QFUA 3LL3A 1VQMN 4BR4A 2ZJRL 1Q7YO 2Q36A 1NMDA 3Q7CA 3QBWA 3UE5A 3BF1A 4U67L 4IXCA 5BRHA 3CCMN 4CBWA 5JVHL 2E2NA 3TSQA 1BDGA 3SMSA 1NGDA 3O80A 4RCHA 3SJHA 3HBTA 3FZFA 2J4RA 4G9ZA 1KAZA 1NBWA 4MDAA 3ID6A 5LJWA 3CXCM 1DEJA 2OANA 4H0TB 2E8AA 5ELZA 3VPZA 1YJWN 1NGHA 1HLUA 1VQLN 4PHTX 5AQGA 3U9DA 3EE8A 4BRPA 1IJJA 1RDWX 3H3OB 3QMLA 4FWLA 4HTLA 3PIOL 1H1VA 3ENOA 5AQMA 3ENHA 4JN4A 4BG8A 3CCQN 3DXKA 2HOEA 3LDPA 4CZEA 1BO5O 5C12A 3A8YA 2YHWA 3FGUA 2E88A 5HL7L 1KQSM 3ATUA 4I6MB 4WQ5A 4H5NA 3E66A 1NGIA 1JCFA 2HBLA 1QQNA 5AZIB 3HZ6A 1IG8A 3TTFA 4BC2A 5GIPA 3UB5A 4BREA 1TYQA 5AQWA 3G6EN 5AQTA 3E9PA 3CCSN 1QVFM 3WXMB 2ZGZA 4M63C 1YHQN 1GLCG 4WCEL 2QWRA 3O08A 4ILHA 4M7YA 4BY9C 4UY8O 4IO8A 5LJVA 1U6ZA 1YAGA 3A5LC 3ZETB 2Q2RA 2VGNA 4MDBA 4BRLA 2Q97A 4O8UA 1VQ9N 3WXKA 2HF3A 3R8EA 5M1NA 1YXQA 4H5WA 3MN5A 3C7NA 4GNIA 1X3NA 1TUYA 2NNWA 3CJBA 3I56N 1GLJO 3U8XA 1VQ4N 1BG3A 4B1WB 3IMXA 3VEYA 4CD1A 1D4XA 5JMVA 4LC9B 3CJCA 4C23A 3JS6A 4JKDA 3O9UA 2ITMA 3FE1A 1WOQA 2WC9A 4YOXA 3EKSA 2P9PA 5KPTA 4HWIA 4K43A 4NLCA 4JK9A 3DXMB 1XC3A 1P8ZA 4XH4A 1HKGA 2QI2A 5F0XA 3GL1A 5BREA 2YHXA 3EE9A 1RFQA 1QZ6A 5AQYA 2P9SB 1QHAA 3M1FA 5AQHA 1R59O 2W41A 4AM6A 2V7YA 2CH5A 3F9MA 3VF2A 3CI5A 2QWOA 3MX5A 2V51B 4FPBA 3CCEN 3EKUA 2QEXN 2HBKA 1U2VA 2NRRA 3SAFA 4XH1A 1VQ6N 4BRNA 4YOWA 3CCLN 2KHOA 3D6RA 3K9JA 3P38A 4BRAA 3O9RA 5AQNA 3FZKA 3UKRB 4QS8A 3M6GA 2JWKA 4RTFD 4H0OA 3VEOA 3C6HA 2BH1A 1SQKA 3I33A 4BROA 1T3VA 3CD6N 3QICA 3D7EO 3TSUA 1LOTB 1S3XA 3FZMA 4F9OA 2NRHA 3MN7A 1KAXA 3S41A 1YIJN 4CBXA 4O5FA 3DXMA 4IEEA 4IEIA 3ENBA 3AAPA 4FO0A 1JJ2M 1VQKN 4BRGA 4BR2A 1BA1A 5KQDA 4JHDB 4RWTA 1SAZA 4FWOA 3O1WA 3OBWA 3ZYYX 1Q82O 3N4QA 4FPAA 4E1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KQ8 A;  2CGL A;  1Z6R A;  2F9T A;  3WXL A;  3P4I A;  3WQU A;  1ZBS A;  4FWR A;  1EQY A;  3H1V X;  5EXW A;  1DGK N;  1DKG D;  5TKY A;  2Q1N A;  1GLB G;  4CZH A;  2PAV A;  3WEE B;  2IVN A;  4CI6 A;  3H1Q A;  3LDN A;  3WQT A;  3VF4 A;  2GEL A;  5AQX A;  4NO7 A;  3MN9 A;  4CZG A;  2D4W A;  1TUU A;  2EWS A;  4BQL A;  4O8K A;  3VET A;  5BRF A;  4DB3 A;  2IVP A;  3AAQ A;  3VOV A;  1GLF O;  2ZWH A;  1HKB A;  4IJN A;  4MO4 A;  1ESV A;  4Y0W A;  3BUZ B;  4ISG A;  2CGK A;  2Q0U A;  5EVZ A;  4FWM A;  2A3Z A;  3VGM A;  1S22 A;  3CET A;  5BN9 A;  1C0G A;  1QZ5 A;  3L4I A;  2QXL A;  4MLE A;  5FPM A;  2A5X A;  3FFK B;  4MLH A;  3CER A;  3CJ7 A;  5AQP A;  3O1B A;  4BC3 A;  3O6W A;  4JHD A;  1OKJ A;  4A62 A;  2P9U B;  2ASO A;  2E20 A;  3QFP A;  1LCU A;  5BPL A;  2FXU A;  4BRK A;  4H0X B;  2AP1 A;  2FF3 B;  4L3Q A;  1HUX A;  4QS9 A;  2P9N A;  3EZW A;  3SLC A;  3ZEU B;  1KAY A;  3D2E A;  2V7Z A;  3L0Q A;  1JCG A;  3ATV A;  3GBT A;  3GOI A;  3IUC A;  3GE1 A;  3HI0 A;  3RSE B;  3H6E A;  3UKU A;  3WEE A;  3ZX3 A;  4BRI A;  1Y64 A;  2ZF5 O;  4A2B A;  3GG4 A;  3IFR A;  3ULE B;  5AFU H;  5AQR A;  1BWF O;  2VYP A;  4BVO A;  2IVO A;  5CE3 A;  2QWQ A;  1K8K A;  4I6M A;  4BRF A;  3I8B A;  3BP8 A;  5FPD A;  3HSC A;  5AQV A;  4CBU A;  1ATN A;  5AZJ A;  5AFU A;  3A5O C;  4YDU A;  4BC5 A;  5EOY A;  4CJ7 A;  3D2E B;  4JD2 A;  3FR0 A;  1NGE A;  3VEZ A;  3O8M A;  4EHT A;  1MA9 B;  3KVG A;  2P9L A;  2A42 A;  4H0V B;  2A6A A;  3ID8 A;  1NGC A;  1NLV A;  2D0P A;  3BEX A;  2E2P A;  5F1X A;  5JLH A;  3AY9 A;  5KPZ A;  5E84 A;  5FPE A;  2GWJ A;  4M7X A;  3M3Z A;  1T6D A;  4K25 A;  4JD2 B;  4DQ8 A;  3J8A A;  2QW9 A;  4IZ9 A;  2P9U A;  3VEX A;  1K8K B;  3B8A X;  5AQO A;  3U9Z A;  2F9W A;  3A5N C;  5ADX A;  5AQU A;  5F2R A;  3QDK A;  3WXI A;  4B1X B;  3KZB A;  4JNE A;  3H46 O;  3U4L A;  4BGB A;  4B9Q A;  3VER A;  4H03 B;  3D2F B;  1XQS C;  2FF6 A;  3SMP A;  3ULE A;  2QWL A;  3VGL A;  3CJ9 A;  3ZEU A;  5JLF A;  2GTD A;  2P9K A;  3UKU B;  4CZI A;  5B8H A;  4H5T A;  4EIA A;  3SK3 A;  1YVN A;  1TYQ B;  4H0P A;  3VEW A;  1BU6 O;  4B1V A;  4XEI A;  1X9J A;  4BR5 A;  4ISF A;  3G25 A;  2P9N B;  3L6Q A;  3H3N O;  2DPN A;  4H5V A;  4Z94 A;  3QBX A;  4DHY A;  2P9K B;  1JCE A;  2A40 A;  3FZL A;  4B1Z A;  4CZM A;  2CH6 A;  1XUP O;  1MWK A;  1NGG A;  2H3G X;  3O4W A;  2BTF A;  3TPQ A;  2P9P B;  4BVP A;  2YJE A;  3A5M C;  3C7N B;  3EO3 A;  5EY4 A;  2Q0R A;  4BR0 A;  3EL2 A;  4EHU A;  3VF6 A;  5FPN A;  5BN8 A;  2FSJ A;  4WQ4 A;  1T44 A;  3CHW A;  4IWV A;  1E4G T;  4AM7 A;  3QB0 A;  5BRD A;  1ZC6 A;  2Q31 A;  3LDO A;  2NZT A;  5AQQ A;  5BPM A;  2P9I B;  2E2Q A;  2VWB A;  3OHR A;  2BUP A;  1C0F A;  5BPN A;  4BG9 A;  3CJ1 A;  4JAX A;  4FWS A;  1Q18 A;  1KXP A;  3H45 C;  4FOI A;  4DCH A;  3CJA A;  4FWQ A;  5E26 A;  3DJC A;  4H0Y B;  2QWP A;  3WT0 A;  3MCP A;  2QWM A;  3DAW A;  3LM2 A;  3VES A;  4BR9 A;  4BRH A;  1V4S A;  2WUS A;  4YDU C;  4BRC A;  1NGA A;  4PL8 A;  3WUH A;  1HKC A;  3MK6 A;  4K41 A;  4FOE A;  4BRD A;  3BF3 A;  3A0I X;  5AQI A;  2GUP A;  2D1K A;  1X3M A;  5AQL A;  3R9P A;  4A2A A;  2A41 A;  1E4F T;  4FWN A;  1HX1 A;  4H5R A;  1V4T A;  2E2O A;  1BOT O;  3DWL A;  4HTL A;  3VGK A;  2ASM A;  3W0L A;  2P9L B;  3LM9 A;  3VEV A;  5LY3 A;  2YCH A;  4BQZ A;  4FL9 A;  1HJO A;  2UYT A;  2GEM A;  2P9I A;  4WQ5 C;  3VEN A;  2YHY A;  4CD3 A;  4MO5 A;  4ISE A;  1NWK A;  4B1Y B;  3GDQ A;  2CGJ A;  2VCP A;  2YJF A;  4WQ4 C;  4WYB A;  5AZJ B;  2W40 A;  1G99 A;  4XH5 A;  3O5B A;  1J6Z A;  3CQY A;  2FLO A;  3ZET A;  4FSV A;  1YUW A;  2QM1 A;  1NM1 A;  4B1U B;  2QWN A;  3HTV A;  4CZJ A;  2I7N A;  2I7P A;  5I9E B;  4PL7 A;  3ZX2 A;  1NGB A;  2P9S A;  5ADX H;  3JXU A;  1BA0 A;  4EAH D;  5AQK A;  2E1Y A;  2AA4 A;  3TU5 A;  1T6C A;  3MDQ A;  4BRM A;  1ATS A;  3FLC O;  3FZH A;  3LDQ A;  4PKI A;  2HF4 A;  1ATR A;  4PKH A;  3IDH A;  3EN9 A;  1ZXO A;  4PKG A;  4KBO A;  2E1Z A;  3WXJ A;  5AQS A;  1RGI A;  1NGF A;  2V52 B;  1MWM A;  3CQX A;  2HMP A;  4A61 A;  2PBD A;  2YI1 A;  3MN6 A;  3KHY A;  2ASP A;  3AAR A;  3MMV A;  4CZF A;  4EFH A;  1GLE G;  1MDU B;  5AQF A;  4CZL A;  3DXK B;  4CZK A;  1GLD G;  1GLA G;  1QQM A;  2FSN A;  4J8F A;  1HPM A;  3C0B A;  3ZX0 A;  1BUP A;  4IJA A;  5BR9 A;  5AQJ A;  2FSK A;  2GWK A;  3HM8 A;  3CIP A;  4FWP A;  5EX5 A;  1GLL O;  3R6M A;  3UKR A;  4NB4 A;  1WUA A;  4BR7 A;  4BC4 A;  4GY2 B;  3W3D A;  5KPR A;  4QS7 A;  1U2V B;  2D0O A;  4FWK A;  5AR0 A;  4BGA A;  5JIC A;  3LDL A;  1Z05 A;  3RSE A;  4BRQ A;  5AZI A;  5AQZ A;  1QQO A;  3D2F A;  4K42 A;  1SZ2 A;  2IIR A;  1NGJ A;  2NLX A;  2ZGY A;  1CZA N;  3QFU A;  3LL3 A;  4BR4 A;  2Q36 A;  1NMD A;  3QBW A;  3UE5 A;  3BF1 A;  4IXC A;  5BRH A;  4CBW A;  2E2N A;  1BDG A;  3SMS A;  1NGD A;  3O80 A;  4RCH A;  3SJH A;  3HBT A;  3FZF A;  2J4R A;  1KAZ A;  1NBW A;  5LJW A;  1DEJ A;  2OAN A;  4H0T B;  2E8A A;  5ELZ A;  3VPZ A;  1NGH A;  1HLU A;  5AQG A;  3U9D A;  4BRP A;  1IJJ A;  1RDW X;  3H3O B;  3QML A;  4FWL A;  1H1V A;  3ENO A;  5AQM A;  3ENH A;  4JN4 A;  4BG8 A;  3DXK A;  2HOE A;  3LDP A;  4CZE A;  1BO5 O;  3A8Y A;  2YHW A;  3FGU A;  2E88 A;  3ATU A;  4I6M B;  4WQ5 A;  4H5N A;  1NGI A;  1JCF A;  4BC2 A;  1QQN A;  5AZI B;  3HZ6 A;  1IG8 A;  3UB5 A;  4BRE A;  1TYQ A;  5AQW A;  5AQT A;  2ZGZ A;  4M63 C;  1GLC G;  2QWR A;  3O08 A;  4M7Y A;  4IO8 A;  5LJV A;  1U6Z A;  1YAG A;  3A5L C;  3ZET B;  2Q2R A;  4BRL A;  2Q97 A;  3WXK A;  2HF3 A;  3R8E A;  1YXQ A;  4H5W A;  3MN5 A;  3C7N A;  4GNI A;  1X3N A;  1TUY A;  3CJB A;  1GLJ O;  3U8X A;  1BG3 A;  4B1W B;  3IMX A;  3VEY A;  4CD1 A;  1D4X A;  5JMV A;  4LC9 B;  3CJC A;  4C23 A;  3JS6 A;  2ITM A;  3FE1 A;  1WOQ A;  3EKS A;  2P9P A;  5KPT A;  4HWI A;  4K43 A;  3DXM B;  1XC3 A;  1P8Z A;  4XH4 A;  1HKG A;  5F0X A;  3GL1 A;  5BRE A;  2YHX A;  1RFQ A;  1QZ6 A;  5AQY A;  2P9S B;  1QHA A;  3M1F A;  5AQH A;  1R59 O;  2W41 A;  4AM6 A;  2V7Y A;  2CH5 A;  3F9M A;  3VF2 A;  3CI5 A;  2QWO A;  2V51 B;  4FPB A;  3EKU A;  1U2V A;  4XH1 A;  4BRN A;  2KHO A;  4BRA A;  5AQN A;  3FZK A;  3UKR B;  4QS8 A;  3M6G A;  4RTF D;  4H0O A;  3VEO A;  1SQK A;  3I33 A;  4BRO A;  3QIC A;  3D7E O;  4F9O A;  3FZM A;  1LOT B;  1S3X A;  2NRH A;  3MN7 A;  1KAX A;  3S41 A;  4CBX A;  4O5F A;  3DXM A;  3AAP A;  4FO0 A;  4BRG A;  4BR2 A;  1BA1 A;  5KQD A;  4JHD B;  4RWT A;  1SAZ A;  4FWO A;  3O1W A;  4FPA A;  4E1J A; 
#chains in the Genus database with same CATH topology
 1C1A A;  2F9T A;  2RF2 A;  3L2V A;  3WXL A;  4WF9 L;  2OA8 A;  3WQU A;  1ZBS A;  3QNO A;  1EQY A;  2ZE2 A;  3H1V X;  3SUN A;  3OW2 M;  3C65 A;  5TKY A;  5DM7 L;  1XMO K;  1NK0 A;  1GLB G;  2PAV A;  3WEE B;  3RMB A;  4CFB A;  2O8D B;  3LDN A;  4CJU A;  1N34 K;  3MN9 A;  4KHW A;  3H08 A;  3L2U A;  2R7Y A;  3AVK A;  4ICL A;  3VET A;  3PO4 A;  5BRF A;  4JKG B;  3KLH A;  2PFU A;  3VOV A;  3OYI A;  1GLF O;  3HPO A;  3OYA A;  4MO4 A;  1W0H A;  4CW7 B;  1ESV A;  4Y0W A;  4DQR A;  3VTH A;  4CHO A;  3OBY A;  3BUZ B;  2QTD A;  1A5V A;  1CXQ A;  2AJQ A;  4CJP A;  1HJR A;  4O0I A;  5FPM A;  2A5X A;  4DV7 K;  1S1W A;  3CJ7 A;  5AQP A;  3CFR A;  4FCY A;  4N76 A;  3RR8 A;  1LW0 A;  1QE1 A;  4DR6 K;  4A62 A;  2P9U B;  3ZT4 A;  4FK0 A;  2DFF A;  4BRK A;  4CVN E;  1HUX A;  3HYF A;  4B9M A;  3V4I A;  3EZW A;  3ZEU B;  3TR8 A;  3D2E A;  2V7Z A;  3OYD A;  3CMA N;  3OS0 A;  4IOC L;  3IUC A;  2B4J A;  1GOA A;  1WNS A;  4FW2 A;  3RSE B;  4DV6 K;  3WEE A;  3F5T A;  3ZX3 A;  1Y64 A;  3GG4 A;  2VG6 A;  1OH7 A;  1SS6 A;  4B9T A;  2KKZ A;  4BVO A;  1BWF O;  3NF9 A;  2IVO A;  4WFN L;  2QWQ A;  1SV5 A;  4I6M A;  1JLE A;  3V9X A;  4BRF A;  2G8F A;  3BP8 A;  5FPD A;  3NMU A;  2YHA A;  4B9L A;  5HRP A;  2IS3 A;  5AFU A;  4E7J A;  1HNW K;  2B5J A;  3QIN A;  4JI1 K;  4CJ7 A;  1BCO A;  2YV0 X;  4FZZ A;  4DSF A;  2IOC A;  4H0V B;  5C15 A;  2A6A A;  3ID8 A;  3KIO A;  3VQ7 A;  2W42 A;  1KVC A;  3BEX A;  2E2P A;  3AV9 A;  1QS4 A;  3QER A;  4JRP A;  4M7X A;  3M3Z A;  1RBR A;  4JD2 B;  4CED A;  4DWI A;  4IZ9 A;  2P9U A;  1K8K B;  4DTJ A;  1L3T A;  3U9Z A;  1IBL K;  5HRR A;  2KZZ A;  5AQU A;  5F2R A;  4F8R A;  3WXI A;  4DUY K;  3MX2 A;  4B9Q A;  4H03 B;  3D2F B;  4M3X A;  4JI6 K;  3DYA A;  3ULE A;  2PYL A;  1VSI A;  2X78 A;  2P9K A;  3OA9 A;  4CZI A;  4H5T A;  3NGY A;  5FRN A;  1YVN A;  4LF7 K;  2Z1G A;  1BU6 O;  4H4M A;  1X9J A;  1HQU A;  4ISF A;  4H8K A;  2P9N B;  2DPN A;  1EX4 A;  4DHY A;  1EO1 A;  4DFK A;  4JI8 K;  4KH5 A;  2CH6 A;  1XUP O;  3KK7 A;  1MWK A;  1NGG A;  4X66 K;  3AO1 A;  2YHB A;  2YNG A;  3O4W A;  2NRW A;  2BTF A;  2P9P B;  1SKW A;  2O8B B;  2YJE A;  3A5M C;  1W97 L;  3MXM A;  4M45 A;  2XY7 A;  3CCJ N;  4WQ4 A;  3CHW A;  3BY5 A;  3TSP A;  1ZC6 A;  4WFB L;  5AQQ A;  4GVE A;  2WBN A;  4CIG A;  5BPM A;  1JL1 A;  3T69 A;  2E2Q A;  2VWB A;  2BUP A;  3DLG A;  3SQ4 A;  1X9M A;  3HP9 A;  4B8C A;  1N6Q A;  4F3O A;  3IS9 A;  3N4P A;  3SBG A;  3CFO A;  1KXP A;  1QHT A;  3KLF A;  4IFY A;  3HVT A;  1KC8 O;  4FWQ A;  3K5O A;  3WT0 A;  3S9H A;  3DAW A;  5CYQ A;  2JLE A;  1RDB A;  4YDU C;  4FM1 A;  2KTQ A;  5CHI A;  3K59 A;  4FOE A;  3BF3 A;  4CEO A;  2KW4 A;  2GUP A;  1M1K O;  4IDK A;  1JLB A;  4A2A A;  1S1U A;  3CME N;  1HX1 A;  3DWL A;  4LFA K;  1BOT O;  5DK5 A;  2ASM A;  3VEV A;  4BQZ A;  4FL9 A;  4I2Q A;  4Z4G A;  3VQC A;  2NRX A;  3O9Q A;  4B08 A;  2P9I A;  4WQ5 C;  3C6U A;  5EU7 A;  4CD3 A;  3WNG A;  4CF8 A;  4J2A A;  4GKK K;  1NWK A;  3HVR A;  2CGJ A;  2VCP A;  4WQ4 C;  5AZJ B;  3AO2 A;  1UA0 A;  4PQU A;  2ZJP L;  3ZSX A;  5I3U A;  1VQ5 N;  2G8U A;  3ASM A;  1J6Z A;  4CK3 A;  1NM1 A;  2D5R A;  1RDC A;  2QWN A;  4E7H A;  3CCU N;  1Y97 A;  2I7P A;  5I9E B;  3HO1 A;  5ADX H;  4ZTJ A;  4CGJ A;  4QCL A;  4OPJ A;  3C6T A;  5AQK A;  4DV0 K;  2G8V A;  3O4Q A;  1RDA A;  3FLC O;  2KQ2 A;  4PKI A;  3PY8 A;  4MQ3 A;  1U48 A;  4PKH A;  4DTO A;  2XY6 A;  3IDH A;  3ALY A;  4KPY A;  2D0C A;  3AVI A;  5K14 A;  2VQE K;  4PKG A;  4ELV A;  5AQS A;  2HHS A;  3F2K A;  5J2N A;  1NU0 A;  1ZBH A;  4DF4 A;  3B6P A;  2YI1 A;  3MN6 A;  3KHY A;  3KD5 E;  1JLA A;  3VQE A;  3VMF B;  4CGD A;  5HOO A;  4CZK A;  3MWT A;  3SAG A;  1HPM A;  1BUP A;  5AQJ A;  2FSK A;  2RN2 A;  2GWK A;  3HM8 A;  1HNX K;  4DUZ K;  1RT4 A;  5EX5 A;  1YI2 N;  1GLL O;  4PA1 A;  4C8L A;  3NAE A;  4NB4 A;  2IAJ A;  1ZBU A;  4BC4 A;  4DS5 A;  1IKY A;  4RW9 A;  3DMJ A;  3THY B;  1U2V B;  5AR0 A;  4KH6 A;  1Z05 A;  4BRQ A;  5AQZ A;  3VQ4 A;  3D2F A;  3SBT A;  4KB1 A;  1EKE A;  1SZ2 A;  4K42 A;  1N5Y A;  3RVC A;  2F7T A;  4LF6 K;  4PUO A;  3QFU A;  1VQM N;  2O8F A;  1NK6 A;  3CCM N;  1BDG A;  3SMS A;  4UQG A;  3S3O A;  1KAZ A;  3CXC M;  2OAN A;  2O8F B;  1JLF A;  1HLU A;  1VQL N;  4PHT X;  4BRP A;  1RDW X;  3JYT A;  3HXM A;  1SKS A;  3DXK A;  3OYE A;  1BO5 O;  1SKR A;  4LH5 A;  1I39 A;  4KKO A;  3V1O A;  3FGU A;  3P83 D;  3ITH A;  3HZ6 A;  1BIZ A;  4OKE A;  3ZT1 A;  5KTQ A;  5AQW A;  3ZSO A;  3DLE A;  3PSF A;  2NUB A;  4HUF A;  4F3T A;  3TAN A;  4WCE L;  1XNQ K;  4BY9 C;  4IO8 A;  1UWB A;  1YAG A;  2VGN A;  4MDB A;  4BRL A;  4DS4 A;  3PUF A;  4O8U A;  5BR8 K;  1VQ9 N;  2HF3 A;  3R8E A;  1YXQ A;  4OGE A;  4CIF A;  3I56 N;  3C7N A;  4GNI A;  2NNW A;  3CJB A;  1SL1 A;  1NMN A;  3CJC A;  1CZB A;  3C95 A;  3HST B;  2ZM6 K;  1WOQ A;  3LP2 A;  3DRP A;  4CJW A;  4HWI A;  2DTU A;  4K43 A;  2XHB A;  3DXM B;  1XC3 A;  5F0X A;  4DTU A;  1WSE A;  1QZ6 A;  4HCB A;  2V7Y A;  2UXC K;  2CH5 A;  3F9M A;  4GVM A;  2V51 B;  3LPT A;  3CCE N;  2QEX N;  1TGO A;  1U2V A;  2OPS A;  2XRI A;  4XH1 A;  4CHN A;  4BRN A;  4XIU A;  2KHO A;  2OYQ A;  1QSY A;  3P38 A;  1TL1 A;  1ASV A;  3MEG A;  5FLX O;  2BGG A;  3O9R A;  3KLG A;  3FZK A;  4CHZ A;  2JWK A;  1X9W A;  4RG8 A;  3OYF A;  4BAC A;  4B9U A;  3EZ5 A;  1BA1 A;  2G8K A;  4AHS A;  3O1W A;  3ZYY X;  2I5J A;  3N4Q A;  4ZHR A;  5HRO A;  3AA2 A;  1Q9Y A;  4KAZ A;  5SZT A;  3R1X A;  1HMV A;  4CFC A;  4X62 K;  3VA0 A;  3P4I A;  4DTS A;  4FWR A;  5EXW A;  1DGK N;  4CK1 A;  1RBS A;  2X6S A;  1DKG D;  1NKC A;  3V1R A;  3U3G A;  4FM0 A;  3H1Q A;  3VF4 A;  5TKW A;  4DFM A;  1NJX A;  5CYM A;  1D8Y A;  2Q3S A;  4YOV A;  1HYZ A;  3A2F A;  2IVP A;  3AAQ A;  1HNV A;  1HKB A;  4IJN A;  3LWL A;  2W6L A;  1KCF A;  1S6Q A;  3I8D A;  3K2P A;  2Q0U A;  4JI0 K;  1W9H A;  2A3Z A;  3VGM A;  2YNF A;  1C0G A;  1LW2 A;  3KJV A;  2QXL A;  4MLE A;  2GUI A;  2HB5 A;  3DOK A;  1EET A;  1WSH A;  3FFK B;  2Y1J A;  3CER A;  4IDH A;  3CF5 L;  1VSJ A;  3P39 A;  5M1P A;  2GBZ A;  4LY7 A;  3I55 N;  2E20 A;  3QFP A;  1IV0 A;  2OCE A;  1NK4 A;  1LCU A;  1A5W A;  4DU3 A;  3CYM A;  4FJL A;  4CCH A;  3EEQ A;  1IG9 A;  2FF3 B;  5JVG L;  4OPH A;  4DR3 K;  3SLC A;  1WSI A;  3L0Q A;  3OTO K;  4FZX C;  3GOI A;  4JI3 K;  3M8R A;  4DQI A;  3H6E A;  1RT1 A;  3DLL L;  3DI6 A;  2ZF5 O;  4O55 A;  4A2B A;  3IFR A;  3ULE B;  5AFU H;  3OYG A;  3IRX A;  1BI4 B;  4MFB A;  1REV A;  5CE3 A;  1K8K A;  2B6A A;  3SQ2 A;  3I8B A;  4B3S K;  3CCR N;  4CFA A;  4CBU A;  1ATN A;  4J2B A;  3A5O C;  4YDU A;  5EOY A;  4C1N I;  3O8M A;  3L2Q A;  3HRG A;  1MA9 B;  4LF8 K;  3VQD A;  2G8H A;  2BDP A;  1KFD A;  4DV3 K;  5J1E A;  1DT9 A;  4OPA A;  3AY9 A;  5KPZ A;  3DLH A;  2GWJ A;  4K25 A;  4DQ8 A;  5IWA K;  2QW9 A;  3VEX A;  1VQN N;  4FJX A;  5GAH P;  3A5N C;  3QDK A;  3V9U A;  4JNE A;  3U4L A;  1C1C A;  1SUQ A;  5JS1 A;  3THX B;  3T1A A;  3U6F A;  4FVU A;  2QWL A;  3O4N A;  3CJ9 A;  4K0K K;  2QA4 N;  1S9E A;  4NCB A;  3OS2 A;  1SL0 A;  5B8H A;  4HTU A;  3SK3 A;  1TYQ B;  3CC4 N;  4M41 A;  3ISN C;  4DV1 K;  4JKH A;  1JCE A;  2A40 A;  3SV3 A;  5LMN K;  2KZM A;  4B1Z A;  1NJI O;  1KD1 O;  2FC0 A;  3LZI A;  2F96 A;  3TAB A;  2YKN A;  4M42 A;  3C7N B;  5EY4 A;  3OS1 A;  2IDO A;  5T7B A;  4BR0 A;  2HHW A;  2UXB K;  3VF6 A;  1HQE A;  5FPN A;  2FSJ A;  1NNE A;  2XY5 A;  3LP1 A;  1VSK A;  1YJN N;  4BWM A;  1E4G T;  1X9S A;  1TVR A;  4KTQ A;  5BRD A;  5DM6 L;  2NZT A;  2P9I B;  3OVN A;  1JLC A;  3TTC A;  1C0F A;  5BPN A;  1K8A O;  1L3V A;  4JAX A;  4FWS A;  3AVM A;  1Q18 A;  1VSM A;  1T7P A;  5C10 A;  3PX4 A;  1RTH A;  3H45 C;  4FOI A;  4CJ4 A;  4HUE A;  4H0Y B;  3LM2 A;  4CEF A;  1C0U A;  4I9L A;  1V4S A;  4BRC A;  2Z1I A;  4KHY A;  3CG7 A;  1WB9 A;  1ITG A;  1TKX A;  3JSM A;  4LF4 K;  3HM9 A;  2D1K A;  1JXE A;  1X3M A;  5AQL A;  4N41 A;  3Q7B A;  3E9L A;  4FWN A;  4HTL A;  1U49 A;  1XMQ K;  3AVA A;  3LM9 A;  2Y1I A;  4J2D A;  1HYS A;  2YCH A;  4JKF A;  4FK2 A;  4FLZ A;  4B9S A;  3DOL A;  4GV3 A;  3DLR A;  3EY1 A;  1NG9 A;  3AA4 A;  3HP6 A;  4B1Y B;  3SUP A;  1FKO A;  4FJM A;  2RKI A;  4FM2 A;  3ZSW A;  4XH5 A;  3K5M A;  4ELT A;  4R5P A;  1VQO N;  3BZK A;  4OX9 K;  3ZET A;  4FSV A;  1YUW A;  5GAG P;  1J5O A;  4B1U B;  4NCA A;  4CZJ A;  3AVH A;  4A5A A;  1QVG M;  4YOT A;  3L4Q A;  4FJ9 A;  1FXX A;  1ATS A;  3FZH A;  2HF4 A;  1ATR A;  1YIT N;  4DSE A;  4AQY K;  4IOA L;  1S1T A;  4BE0 A;  4DU1 A;  1NOZ A;  4CJE A;  1RGI A;  2V52 B;  1MWM A;  3CC2 N;  2HMP A;  2P5O A;  2ASP A;  3LP3 A;  3AAR A;  3MMV A;  4EZ9 A;  1CZ9 A;  3P31 A;  4AH9 A;  5C0Y A;  5AQF A;  5HP1 A;  4ILJ A;  3DXK B;  4B9V A;  1GLA G;  1RBU A;  2FSN A;  4J8F A;  3C0B A;  3K5L A;  4IJA A;  3HOT A;  3NF8 A;  1JLQ A;  3P5J A;  4AHC A;  4DFJ A;  1O13 A;  3R6M A;  4HCC A;  5FRM A;  4IFE A;  1WUA A;  1OVY A;  4M3Y A;  3HPG A;  5C2D A;  1WBB A;  3W3D A;  2HNZ A;  2D0O A;  1S72 N;  4N56 A;  1VRT A;  1XI1 A;  1NKB A;  4JKA A;  4E7K A;  1CXU A;  2PZS A;  1QQO A;  4U7B A;  3SJJ A;  4A57 A;  1NGJ A;  3ZLJ A;  3NE6 A;  2ZJR L;  1NMD A;  3Q7C A;  4E19 A;  4CBW A;  2E2N A;  3TSQ A;  4RCH A;  3HBT A;  3SUQ A;  3FZF A;  1NBW A;  1NKE A;  4JLH A;  2E8A A;  3M8P A;  3TAF A;  3VPZ A;  3U9D A;  4YY3 K;  1C1B A;  1RTD A;  1VRU A;  3H3O B;  4F2R A;  4CJT A;  1W7A A;  3T19 A;  3V9W A;  4FLU A;  5C12 A;  3SPZ A;  3D0P A;  4KTZ A;  2YHW A;  2Z1H A;  1KLN A;  2E88 A;  1KQS M;  1LAW A;  3SV4 A;  4WQ5 A;  2OPR A;  4DSL A;  3SQ1 A;  1QQN A;  3TTF A;  5GIP A;  3UB5 A;  4CJV A;  3ZSZ A;  1TYQ A;  4CES A;  1EWQ A;  3PV8 A;  2VG5 A;  5FRO A;  2ZGZ A;  4M63 C;  4CJR A;  2QWR A;  4ILH A;  4UY8 O;  1QTM A;  3QO9 A;  4I9Q A;  4LFB K;  2Q97 A;  1XNR K;  3NGZ A;  3WXK A;  3QEI A;  4BWJ A;  4H5W A;  1GLJ O;  4CF9 A;  3IMX A;  1D4X A;  3CFP A;  3O3H A;  3J7A P;  3ZT0 A;  4E7L A;  3FFI A;  3MEC A;  1U47 A;  2WC9 A;  4BE1 A;  3TAQ A;  3V81 A;  1IH7 A;  3BGR A;  3OYJ A;  1P8Z A;  3AVN A;  2VWJ A;  4KB0 A;  3O3G A;  1TL3 A;  3NH0 A;  1FKP A;  3OYK A;  3GL1 A;  5BRE A;  2P51 A;  1RFQ A;  4B3T K;  3ZSR A;  1R59 O;  2F4V K;  4GKJ K;  5SWM A;  3ZT2 A;  2OPQ A;  4FPB A;  4DFP A;  1TAQ A;  1HYV A;  3CCL N;  1TK8 A;  1R0A A;  4BRA A;  1ZBF A;  1CLQ A;  3ZSY A;  1OH5 A;  3UKR B;  3M6G A;  3KD1 E;  4H0O A;  4FJG A;  2BH1 A;  4BRO A;  4X64 K;  3D7E O;  4DLG A;  4CF1 A;  1EP4 A;  3S41 A;  1YIJ N;  4DR2 K;  4DQS A;  1JJ2 M;  1VQK N;  4PWD A;  3AAP A;  4FO0 A;  3THW B;  4BRG A;  3NF6 A;  2HVH A;  1TK5 A;  4B9N A;  4JHD B;  3SNN A;  4RWT A;  4FWO A;  5KGX A;  3OBW A;  1BIU A;  4LSL A;  4BDY A;  4FPA A;  2CGL A;  3G0Z A;  1Z6R A;  3VQ8 A;  3HK2 A;  4KRF A;  1IO2 A;  2HHT A;  1QSL A;  3KKS A;  1VQ8 N;  2O8B A;  2UUA K;  4IBN A;  5CR4 A;  2IVN A;  4BE2 A;  4GW6 A;  2P5G A;  1UOC A;  2GEL A;  4NO7 A;  1I94 K;  4CZG A;  3CPW M;  2FBV A;  3MAQ A;  3RMD A;  1HNZ K;  5KRT A;  4Q5V A;  2VWK A;  2ZWH A;  4ZTF A;  4M3W A;  3K57 A;  4NXM K;  1NJZ A;  1W2B M;  3WNE A;  1GOC A;  1N32 K;  3CET A;  1RNH A;  1QZ5 A;  3L4I A;  3KWI A;  3TWH A;  5JS2 A;  3OY9 A;  3ZCM A;  1RT5 A;  1WLJ A;  4DTX A;  4JRQ A;  4QOZ B;  3BZC A;  3O6W A;  1HRH A;  1OKJ A;  2ASO A;  3G4S N;  2FXU A;  2EX3 A;  4H0X B;  2GX9 A;  1HNI A;  2AP1 A;  4IOX A;  4CIE A;  4OJR A;  4FVM A;  5MLC Q;  4C8N A;  5KI6 A;  1GOB A;  4DTM A;  4M3T A;  1ASU A;  3ATV A;  3GBT A;  4RW6 A;  5I42 A;  3QES A;  3GE1 A;  4LFC K;  3SQ0 A;  2UU9 K;  3AA5 X;  3UKU A;  4BDP A;  4BRI A;  1YVU A;  3SUO A;  4CGF A;  3LWM A;  3THX A;  1OH6 A;  5AQR A;  2VYP A;  4Y1D A;  1BGX T;  1G15 A;  4CK2 A;  3J7Z O;  5AQV A;  1RTI A;  1TKD A;  4BC5 A;  2D0A A;  3HL8 A;  3D2E B;  1NGE A;  4EHT A;  4DR7 K;  2D0P A;  3IKM A;  3PIP L;  4IO9 L;  3ZSQ A;  1ILY A;  1E3M A;  3PSI A;  3J8A A;  3B8A X;  1JLG A;  2F9W A;  5ADX A;  4Y1C A;  1U04 A;  3V9S A;  3KZB A;  3THY A;  3H46 O;  2O4G A;  3OJU A;  4EP4 A;  3MXI A;  2P1J A;  3VER A;  1L5U A;  3L3V A;  3NF7 A;  1N33 K;  4CGH A;  3DRR A;  4CEE A;  5GAE P;  2GTD A;  5M1F A;  2KLA A;  3J81 O;  2OTJ N;  1SL2 A;  4EIA A;  4H0P A;  3VEW A;  4B1V A;  4XEI A;  4JKB A;  2ETJ A;  3D45 A;  3MWP A;  3H3N O;  4H5V A;  1HR0 K;  3QBX A;  4JK8 A;  4RW8 A;  2P9K B;  4OO1 J;  4IG3 A;  3T7Z A;  4V19 S;  3QIP A;  3QEV A;  3V1Q A;  4YOU A;  4L8R B;  4DV4 K;  4WFA L;  3VTI A;  4EP5 A;  3TPQ A;  2O8C B;  4DV2 K;  3EO3 A;  4O5B A;  2Q0R A;  5M1Q A;  3AVJ A;  4Z4H A;  4JKE A;  4GV9 A;  1T44 A;  4IWV A;  3IAY A;  3THW A;  3AVC A;  4JYA K;  1N8R O;  2WON A;  4AM7 A;  1Z25 A;  1K9M O;  3QB0 A;  3LDO A;  1VHX A;  4G1Q A;  4OPK A;  1KFS A;  3OHR A;  1IBK K;  1LAV A;  3QEW A;  2OPP A;  4HUG A;  4AHR A;  4DCH A;  3CJA A;  2QWP A;  1S1V A;  3J7Y P;  1YF5 L;  4KHP K;  2QWM A;  1LWE A;  3VES A;  4BR9 A;  3RTV A;  1NOY A;  2WUS A;  1EXQ A;  3AVB A;  4PL8 A;  1HKC A;  3R3L A;  4CHP A;  4K41 A;  1VQP N;  1B92 A;  5C42 A;  3R9P A;  2HMI A;  4H5R A;  4FJ7 A;  4B3R K;  1M90 O;  3W0L A;  4CJL A;  3VQB A;  4FLT A;  1L3U A;  2PYJ A;  1HJO A;  2UYT A;  4M3R A;  1WSG A;  1Z26 A;  4B3M K;  2GEM A;  1XHZ A;  2YHY A;  4W5R A;  4E1M A;  1VSF A;  3SI6 A;  1NK7 A;  3GDQ A;  2YJF A;  2W40 A;  1G99 A;  3RR7 A;  4WE1 A;  1K6Y A;  2X6N A;  3G10 A;  1RT3 A;  2FLO A;  2YNI A;  5J2Q A;  3AGK A;  3E1Y A;  2I7N A;  4A5B A;  4PL7 A;  3ZX2 A;  1NGB A;  3JXU A;  1J9A A;  4X65 K;  4EAH D;  5DMR A;  2HHQ A;  2D0B A;  4Z0U A;  3CCV N;  2AA4 A;  2HST A;  3MDQ A;  4FJN A;  3T1H K;  3VA3 A;  3LDQ A;  4JV5 K;  3NCI A;  4JKC A;  4O4G A;  1TK0 A;  3LAM A;  1ZXO A;  1BQN A;  3AO5 A;  4DR1 K;  4A61 A;  3VQ5 A;  2PBD A;  2NRV A;  4CJS A;  4I2P A;  3MED A;  5AJ3 K;  5HRN A;  5J2M A;  2WFB A;  5H1S Q;  2DFH A;  1MDU B;  4CZL A;  4CEQ A;  1GLD G;  1QQM A;  1ZBL A;  4DMN A;  3AGR A;  4C8K A;  4M3U A;  1WSJ A;  4FWP A;  2KFN A;  3S3M A;  4JI7 K;  1RT6 A;  2IC3 A;  4CE9 A;  2ATQ A;  2W6K A;  3RMA A;  4BR7 A;  5J2P A;  4DR4 K;  3O9S A;  1VQ7 N;  3L2W A;  5KPR A;  4QS7 A;  4B3O A;  3K9K A;  4BGA A;  4JK7 A;  2O8E A;  5JIC A;  3LDL A;  5HRS A;  5AZI A;  1UA1 A;  2WTU A;  4NXN K;  2IIR A;  3M8Q A;  4RW7 A;  1C0M A;  2ZGY A;  1CZA N;  3LP0 A;  3G71 N;  1RDU A;  3ZT3 A;  1OVQ A;  3MEE A;  4U67 L;  4IXC A;  5BRH A;  4DQP A;  4CF0 A;  1YT3 A;  1BCM A;  3O80 A;  3SJH A;  2G8I A;  1VSH A;  1RIL A;  4G9Z A;  4MDA A;  3ID6 A;  5LJW A;  3SYZ A;  1NGH A;  1NK9 A;  1IJJ A;  1FJG K;  3CM5 A;  4FWL A;  4OLB A;  2O8C A;  3K58 A;  1H1V A;  5AQM A;  3ENH A;  3VQA A;  4JN4 A;  2UUB K;  2HOE A;  2ITG A;  1XC9 A;  3I0R A;  3A8Y A;  1T05 A;  4N47 A;  1KVA A;  5CY4 A;  3ATU A;  4I6M B;  4HHT A;  1O1W A;  4H5N A;  4KHQ A;  4BC2 A;  5AZI B;  1WN7 A;  1A5X A;  4BRE A;  4E7I A;  3G6E N;  1FK9 A;  1JXB A;  3VQ6 A;  3O08 A;  1T03 A;  2RPI A;  3OYB A;  1KRP A;  4IG0 A;  3ZET B;  2UXD K;  5M1N A;  2ZQB A;  4LH4 A;  5LMU K;  3L3U A;  1X3N A;  4B1W B;  4W5Q A;  4KHS A;  5JMV A;  4DTR A;  4C23 A;  4YNQ A;  3O9U A;  2ITM A;  3TAP A;  3IG1 A;  3PO5 A;  3QIO A;  4YOX A;  2UUC K;  3EKS A;  2PY5 A;  5KPT A;  1DLO A;  2BE2 A;  5IT9 O;  3F9K A;  5HLF A;  4XH4 A;  2IGI A;  2QI2 A;  4OLA A;  4CHY A;  2YHX A;  1KTQ A;  3EE9 A;  5AQY A;  1Q8I A;  3DLB A;  4KHN A;  2DFE A;  3MX5 A;  1JKH A;  1WAF A;  4CJK A;  1WBD A;  1RBT A;  2HBK A;  1VQ6 N;  4DR5 K;  3T3F A;  4YOW A;  4DF8 A;  3D6R A;  3K9J A;  4DG1 A;  5AQN A;  4QS8 A;  4RTF D;  3C6H A;  1SQK A;  3P1G A;  3LZJ A;  4FLY A;  1T3V A;  3TSU A;  4F9O A;  3VN5 A;  3MN7 A;  1KAX A;  3S3N A;  4CBX A;  3KK1 A;  3DXM A;  1T8E A;  4OKK A;  4IEE A;  4OKJ A;  3ENB A;  3QEX A;  2QKB A;  1BIS A;  1SAZ A;  4BDZ A;  4N5S A;  1RBV A;  3LAL A;  5KQ8 A;  5C2F A;  2HVI A;  3TI0 A;  1NJY A;  1BI4 A;  3OJS A;  4PY5 A;  2XY8 A;  2Q1N A;  4CZH A;  3NHG A;  3CM6 A;  3PX6 A;  1U45 A;  3TAG A;  4CI6 A;  4CJ5 A;  3WQT A;  4JI2 K;  3CQ8 A;  2E4L A;  1LWC A;  5AQX A;  3CPE A;  2D4W A;  2E6M A;  1TUU A;  2EWS A;  4BQL A;  4O8K A;  1IKX A;  3TAM A;  4DB3 A;  2OTL N;  3F73 A;  1S5J A;  4LD0 A;  4W5N A;  3AO4 A;  4YOR A;  4AHV A;  4ISG A;  2CGK A;  1YJ9 N;  5EVZ A;  4FWM A;  1S22 A;  5BN9 A;  2O8D A;  4ELU A;  2OZS A;  4MLH A;  5KGW A;  3EYZ A;  3T1Y K;  4FJK A;  4FJ8 A;  3O1B A;  4KTW A;  4BC3 A;  3NDK A;  4C8O A;  4JHD A;  3NBP A;  3KK3 A;  1J54 A;  3M8S A;  4C1N K;  4OGC A;  5BPL A;  1Q81 O;  5LL6 Z;  2HW3 A;  4L3Q A;  4QS9 A;  3OYM A;  4YHH K;  2P9N A;  1BQM A;  1RT7 A;  5HBM A;  1KAY A;  1VK0 A;  1JCG A;  4KO0 A;  2JWL A;  4AHT A;  3JAM O;  4DV5 K;  3MXJ A;  3HI0 A;  2KFZ A;  3THV A;  2G8W A;  4ILG B;  4W5O A;  4AHU A;  4FYD A;  3C6A A;  1EWR A;  4DLE A;  3TTD A;  3NVM A;  1P90 A;  2O4I A;  3TAR A;  4CEB A;  3LPU A;  1TKZ A;  4JI4 K;  4FLX A;  3HSC A;  3SCX A;  2YKM A;  2NRZ A;  2XO7 A;  5AZJ A;  2WOM A;  1NK5 A;  1TV6 A;  2ZD1 A;  3FR0 A;  4JD2 A;  3VEZ A;  2P9L A;  2A42 A;  3KVG A;  1NGC A;  1NLV A;  1DTT A;  3RRH A;  4AIL C;  5F1X A;  5JLH A;  3LAK A;  2HBM A;  5E84 A;  5FPE A;  3V9Z A;  1T6D A;  3NH1 A;  5GIO A;  5GAD P;  3KLE A;  5AQO A;  3O9T A;  2FBT A;  3WNH A;  4B1X B;  4BGB A;  1HPZ A;  1XQS C;  4KHU A;  2FF6 A;  3SMP A;  3V6D A;  3VGL A;  1VAZ A;  4DU4 A;  3ZEU A;  5JLF A;  1NJW A;  3UKU B;  4CEZ A;  3AO3 A;  1D5A A;  4LF9 K;  2HHU A;  1RT2 A;  4BR5 A;  4JS5 A;  3G25 A;  4E89 A;  3L6Q A;  4Z94 A;  2E6L A;  4CJ3 A;  3FZL A;  3OYC A;  4CZM A;  3L2R A;  5C25 A;  5M1O A;  3VQP A;  4CHQ A;  4RW4 A;  2H3G X;  5D3G A;  4DQQ A;  1WAJ A;  4GMJ B;  4CGI A;  2JGU A;  3NFA A;  3KK2 A;  4CEC A;  1VSL A;  1Q9X A;  4BVP A;  3J80 O;  4K8X A;  4Z4E A;  1C0T A;  1RCH A;  3EL2 A;  3DLK A;  3MCA B;  4B8A B;  3WNF A;  3NH2 A;  2VGM A;  4EHU A;  2GV9 A;  5BN8 A;  4Z4F A;  3QLH A;  4A59 A;  4DKW A;  2NRT A;  2Q31 A;  3HOS A;  4JKG A;  2HHX A;  4CEA A;  4NYN A;  3OYN A;  1IKW A;  1X1P A;  2YNH A;  4FW1 A;  4BG9 A;  4FLV A;  1DTQ A;  3CJ1 A;  2RHK A;  1S1X A;  3PLA A;  5GIN A;  2VG7 A;  5E26 A;  4JS4 A;  3DJC A;  3MCP A;  1L3S A;  4AF1 A;  3BDP A;  3QET A;  4BRH A;  2QKK A;  2RE2 A;  4W5T A;  1NGA A;  3WUH A;  3LAN A;  3DM2 A;  3MK6 A;  3SAH A;  4BRD A;  3A0I X;  3KKR A;  5AQI A;  3QEP A;  3HPH A;  4HVJ A;  3TAE A;  2A41 A;  1E4F T;  1V4T A;  2E2O A;  2HBJ A;  1UAX A;  3VQQ A;  3VGK A;  2E5L K;  2P9L B;  3I0S A;  5LY3 A;  4KV8 A;  1XWL A;  2YX6 A;  3VEN A;  4GV6 A;  4LF5 K;  4C8M A;  4MO5 A;  4ISE A;  4NLB A;  4KI6 A;  4KH4 A;  1RDD A;  4WYB A;  1LWF A;  4O44 A;  3O5B A;  4JI5 K;  2DY4 A;  3B6O A;  3CQY A;  1D9D A;  3AVG A;  2QM1 A;  4TSX A;  4FK4 A;  2QXF A;  3NVK A;  1FW6 A;  3K0S A;  4YOY A;  3HTV A;  1JL2 A;  2O8E B;  4F2S A;  2P9S A;  3RMC A;  1BA0 A;  3ULD A;  3VQ9 A;  1J5E K;  4ID1 A;  2E1Y A;  3TU5 A;  1T6C A;  4BRM A;  3K5N A;  1K73 O;  3CC7 N;  4R79 A;  3KWG A;  4FJI A;  2OZM A;  4IFV A;  3EN9 A;  3QNN A;  1TKT A;  4KBO A;  4JEP A;  2E1Z A;  3WXJ A;  4CJF A;  3L8B A;  3CQX A;  1NGF A;  5FDL A;  3DRS A;  3RRG A;  4DTP A;  1NK8 A;  3SPY A;  2ZJQ L;  3AVF A;  2FBY A;  4CZF A;  1RTJ A;  4EFH A;  4FJH A;  1GLE G;  4Q0B A;  4FXD A;  2F8T A;  3O3F A;  3ZX0 A;  5BR9 A;  4K8Z A;  2A1S A;  2HHH K;  4KRE A;  3AVL A;  1ZBI A;  3CIP A;  4FZY A;  5C24 A;  4EZ6 A;  1N36 K;  3UKR A;  4DTN A;  4GY2 B;  2HNY A;  4FWK A;  5M1K A;  3E9O A;  1IKV A;  1Q86 O;  1D9F A;  4H4O A;  3M5R A;  3RSE A;  1U4B A;  1BHL A;  4CJQ A;  3RWU A;  5KRS A;  2NLX A;  1B9D A;  3LL3 A;  3NGI A;  1MU2 A;  4BR4 A;  1Q7Y O;  2Q36 A;  3UE5 A;  3QBW A;  5JVH L;  3BF1 A;  3UIQ A;  1NGD A;  1YTU A;  1BL3 A;  2J4R A;  1VSE A;  1DEJ A;  4H0T B;  5ELZ A;  3U3Y A;  1YJW N;  1IBM K;  1C6V A;  5AQG A;  3EE8 A;  3HJF A;  2FBX A;  4DSI A;  3QML A;  3PIO L;  3OYL A;  3ENO A;  4BG8 A;  2X74 A;  3CCQ N;  3LDP A;  4CZE A;  1VSD A;  3E01 A;  4CGG A;  1ASW A;  5HL7 L;  1ZYQ A;  1KSP A;  1F21 A;  5A2Q O;  3KTQ A;  1YTA A;  3E66 A;  1NGI A;  1JCF A;  2HBL A;  1IG8 A;  4ID5 A;  4IKF A;  5CZ2 A;  3LDS A;  5AQT A;  1LV5 A;  1S9G A;  3E9P A;  4CF2 A;  3CCS N;  3C94 A;  4M3Z A;  1QVF M;  4YFU A;  3WXM B;  1B9F A;  1I3A A;  5E41 A;  1YHQ N;  1GLC G;  2HND A;  4M7Y A;  4FJJ A;  2F8S A;  5LJV A;  1U6Z A;  3SZ2 A;  3A5L C;  1OH8 A;  2Q2R A;  3AA3 A;  1KLM A;  3MN5 A;  1VQ4 N;  1TUY A;  3U8X A;  1BG3 A;  4CD1 A;  3VEY A;  3KLI A;  4LC9 B;  3JS6 A;  4JKD A;  3FE1 A;  5CZ1 A;  2P9P A;  4E0D A;  4CFD A;  1QQC A;  4NLC A;  4LSN A;  4JK9 A;  2VQF K;  1HKG A;  4KFB A;  3HT3 A;  2P9S B;  1QHA A;  2BAN A;  3M1F A;  2W41 A;  5AQH A;  4AM6 A;  4F4K A;  4DSJ A;  1TAU A;  4J2E A;  4NYF A;  3ZSV A;  3VF2 A;  4E1N A;  4O0J A;  3CI5 A;  2QWO A;  4Z4I A;  1WSF A;  1J53 A;  2LSN A;  3EKU A;  2NRR A;  3SAF A;  2Z1J A;  1S6P A;  4I7F A;  4FJ5 A;  1KVB A;  4FLW A;  3VEO A;  4CER A;  2EHG A;  3PX0 A;  3I33 A;  2A1R A;  3CD6 N;  3QIC A;  1XHX A;  1LOT B;  1S3X A;  3FZM A;  2NRH A;  2HHV A;  4O5F A;  1QSS A;  4IEI A;  4NCG A;  4E3S A;  2QK9 A;  4OVL A;  4BR2 A;  5KQD A;  4KI4 A;  4QAG A;  1Q82 O;  3OYH A;  4Z4C A;  4DSK A;  4E1J A; 
#chains in the Genus database with same CATH homology
 5KQ8 A;  2CGL A;  5C2F A;  1Z6R A;  2F9T A;  3R1X A;  3WXL A;  4WF9 L;  3P4I A;  3WQU A;  1ZBS A;  4FWR A;  1EQY A;  3H1V X;  5EXW A;  1DGK N;  3OW2 M;  3C65 A;  1DKG D;  5TKY A;  5DM7 L;  1VQ8 N;  2Q1N A;  1GLB G;  4CZH A;  2PAV A;  3WEE B;  5CR4 A;  2IVN A;  4CI6 A;  3H1Q A;  3LDN A;  3WQT A;  3VF4 A;  5TKW A;  2GEL A;  5AQX A;  4NO7 A;  3MN9 A;  4CZG A;  3CPE A;  2D4W A;  3CPW M;  1TUU A;  2EWS A;  4YOV A;  4BQL A;  4O8K A;  3VET A;  5BRF A;  4JKG B;  4DB3 A;  2IVP A;  3AAQ A;  2PFU A;  2OTL N;  3VOV A;  1GLF O;  2ZWH A;  1HKB A;  4IJN A;  4MO4 A;  1ESV A;  4Y0W A;  4YOR A;  3VTH A;  3OBY A;  4WFB L;  3BUZ B;  2QTD A;  4ISG A;  2CGK A;  1W2B M;  1YJ9 N;  2Q0U A;  5EVZ A;  4FWM A;  2A3Z A;  3VGM A;  1S22 A;  3CET A;  5BN9 A;  1C0G A;  1QZ5 A;  3L4I A;  2QXL A;  4MLE A;  5FPM A;  2A5X A;  3KWI A;  3FFK B;  4MLH A;  3CER A;  4IDH A;  3CJ7 A;  5AQP A;  3CF5 L;  3O1B A;  4BC3 A;  3P39 A;  3O6W A;  4JHD A;  5M1P A;  1OKJ A;  4A62 A;  2P9U B;  3I55 N;  2ASO A;  2E20 A;  3QFP A;  3G4S N;  4C1N K;  1LCU A;  5BPL A;  1Q81 O;  2FXU A;  4BRK A;  4H0X B;  2GX9 A;  2AP1 A;  4IOX A;  2FF3 B;  4L3Q A;  1HUX A;  4QS9 A;  5JVG L;  5MLC Q;  2P9N A;  4OPH A;  3EZW A;  3SLC A;  3ZEU B;  1KAY A;  3D2E A;  2V7Z A;  3L0Q A;  1JCG A;  3CMA N;  3ATV A;  2JWL A;  3GBT A;  4IOC L;  3GOI A;  3IUC A;  3GE1 A;  3HI0 A;  3RSE B;  3H6E A;  3DLL L;  3UKU A;  3WEE A;  3F5T A;  3ZX3 A;  4BRI A;  1Y64 A;  2ZF5 O;  4ILG B;  4A2B A;  3GG4 A;  3IFR A;  3C6A A;  3ULE B;  1SS6 A;  5AFU H;  2KKZ A;  3TTD A;  5AQR A;  1BWF O;  2VYP A;  4BVO A;  2IVO A;  5CE3 A;  2QWQ A;  3NVM A;  1K8K A;  4WFN L;  1P90 A;  4I6M A;  4BRF A;  3J7Z O;  3I8B A;  3BP8 A;  5FPD A;  3CCR N;  3NMU A;  3HSC A;  5AQV A;  2NRZ A;  4CBU A;  1ATN A;  5AZJ A;  5AFU A;  3A5O C;  4YDU A;  4BC5 A;  5EOY A;  4CJ7 A;  3D2E B;  4C1N I;  4JD2 A;  3FR0 A;  1NGE A;  3VEZ A;  3O8M A;  4EHT A;  3HRG A;  1MA9 B;  2P9L A;  2A42 A;  3KVG A;  4H0V B;  5C15 A;  2A6A A;  3ID8 A;  1NGC A;  1NLV A;  2D0P A;  3BEX A;  2E2P A;  3IKM A;  5F1X A;  1DT9 A;  5JLH A;  4OPA A;  3AY9 A;  5KPZ A;  3PIP L;  2HBM A;  5E84 A;  5FPE A;  2GWJ A;  4M7X A;  4IO9 L;  3M3Z A;  1T6D A;  4K25 A;  1ILY A;  4JD2 B;  4DQ8 A;  5GIO A;  3J8A A;  2QW9 A;  4IZ9 A;  2P9U A;  3VEX A;  1K8K B;  3B8A X;  5GAD P;  1VQN N;  5AQO A;  3U9Z A;  2F9W A;  5GAH P;  3A5N C;  5ADX A;  5AQU A;  3O9T A;  5F2R A;  3QDK A;  3WXI A;  4B1X B;  3KZB A;  4JNE A;  3H46 O;  3U4L A;  3MX2 A;  4BGB A;  4B9Q A;  3VER A;  4H03 B;  3D2F B;  1XQS C;  2FF6 A;  4FVU A;  3SMP A;  3ULE A;  2QWL A;  3VGL A;  1VAZ A;  3CJ9 A;  3ZEU A;  5GAE P;  5JLF A;  2GTD A;  2P9K A;  5M1F A;  2QA4 N;  3OA9 A;  2KLA A;  3UKU B;  4CZI A;  2OTJ N;  5B8H A;  4H5T A;  4EIA A;  3SK3 A;  1YVN A;  1TYQ B;  3CC4 N;  4H0P A;  3VEW A;  1BU6 O;  4B1V A;  4XEI A;  1X9J A;  4JKB A;  3MWP A;  4BR5 A;  4ISF A;  3G25 A;  2P9N B;  3L6Q A;  3H3N O;  2DPN A;  4H5V A;  4Z94 A;  3QBX A;  4JKH A;  4JK8 A;  2P9K B;  4DHY A;  3T7Z A;  4OO1 J;  1JCE A;  1EO1 A;  2A40 A;  3FZL A;  4KH5 A;  4B1Z A;  4CZM A;  2CH6 A;  1XUP O;  3KK7 A;  1NJI O;  5M1O A;  1MWK A;  1NGG A;  1KD1 O;  4YOU A;  2H3G X;  3O4W A;  2NRW A;  4WFA L;  2BTF A;  3VTI A;  3TPQ A;  2P9P B;  4BVP A;  2YJE A;  3A5M C;  3C7N B;  3EO3 A;  5EY4 A;  2Q0R A;  1W97 L;  3EL2 A;  3MCA B;  4BR0 A;  5M1Q A;  2VGM A;  4EHU A;  3VF6 A;  5FPN A;  5BN8 A;  4JKE A;  3CCJ N;  4GV9 A;  2FSJ A;  4WQ4 A;  1T44 A;  3CHW A;  4IWV A;  4A59 A;  1YJN N;  4DKW A;  1E4G T;  1N8R O;  4AM7 A;  1K9M O;  3QB0 A;  3TSP A;  2NRT A;  5BRD A;  1ZC6 A;  2Q31 A;  3LDO A;  2NZT A;  4GVE A;  2WBN A;  4JKG A;  5AQQ A;  2P9I B;  5BPM A;  2E2Q A;  2VWB A;  3OHR A;  2BUP A;  3T69 A;  3TTC A;  1C0F A;  5BPN A;  4BG9 A;  1K8A O;  3CJ1 A;  4JAX A;  4FWS A;  1Q18 A;  2RHK A;  3N4P A;  3SBG A;  5C10 A;  1KXP A;  3PLA A;  1KC8 O;  3H45 C;  5GIN A;  4FOI A;  4DCH A;  3CJA A;  4FWQ A;  5E26 A;  3DJC A;  4H0Y B;  2QWP A;  3WT0 A;  1YF5 L;  3MCP A;  4AF1 A;  2QWM A;  3DAW A;  3LM2 A;  3VES A;  4BR9 A;  4BRH A;  1V4S A;  2RE2 A;  2WUS A;  4YDU C;  4BRC A;  1NGA A;  4PL8 A;  3WUH A;  5CHI A;  1HKC A;  3MK6 A;  3R3L A;  4K41 A;  3SAH A;  1VQP N;  4FOE A;  4BRD A;  3BF3 A;  3A0I X;  5AQI A;  2GUP A;  1M1K O;  2D1K A;  1X3M A;  5AQL A;  3R9P A;  4A2A A;  3CME N;  2A41 A;  3E9L A;  1E4F T;  3Q7B A;  1HX1 A;  4FWN A;  3DWL A;  1V4T A;  1BOT O;  2E2O A;  2HBJ A;  4H5R A;  1M90 O;  3VGK A;  2ASM A;  3W0L A;  2P9L B;  3LM9 A;  3VEV A;  5LY3 A;  2YCH A;  4BQZ A;  4FL9 A;  4JKF A;  1HJO A;  2UYT A;  2NRX A;  3O9Q A;  5DM6 L;  2GEM A;  2P9I A;  4WQ5 C;  2YX6 A;  3VEN A;  4GV3 A;  4GV6 A;  2YHY A;  4CD3 A;  4MO5 A;  4ISE A;  4NLB A;  1NWK A;  4KH4 A;  4B1Y B;  3GDQ A;  2CGJ A;  2VCP A;  2YJF A;  4WQ4 C;  4WYB A;  5AZJ B;  2W40 A;  1G99 A;  2ZJP L;  4XH5 A;  3O5B A;  1VQ5 N;  1J6Z A;  3CQY A;  2FLO A;  1VQO N;  3ZET A;  4FSV A;  1YUW A;  2QM1 A;  5GAG P;  1NM1 A;  3NVK A;  4B1U B;  4YOY A;  2QWN A;  3AGK A;  3E1Y A;  3HTV A;  4CZJ A;  2I7N A;  3CCU N;  4A5B A;  2I7P A;  5I9E B;  4A5A A;  4PL7 A;  3ZX2 A;  1NGB A;  2P9S A;  5ADX H;  1QVG M;  3JXU A;  4YOT A;  1BA0 A;  3L4Q A;  4EAH D;  5AQK A;  2E1Y A;  2AA4 A;  2HST A;  1T6C A;  3TU5 A;  3MDQ A;  4BRM A;  3HOS A;  1ATS A;  3CCV N;  3FLC O;  3FZH A;  3LDQ A;  4PKI A;  1K73 O;  3CC7 N;  2HF4 A;  3KWG A;  4R79 A;  1ATR A;  4JKC A;  4PKH A;  3IDH A;  1YIT N;  3EN9 A;  4IOA L;  1ZXO A;  4PKG A;  4KBO A;  4JEP A;  2E1Z A;  3WXJ A;  5AQS A;  3F2K A;  1RGI A;  1NGF A;  2V52 B;  1MWM A;  3CQX A;  3CC2 N;  2HMP A;  4A61 A;  2PBD A;  2YI1 A;  2ZJQ L;  3MN6 A;  2ASP A;  2NRV A;  3AAR A;  3KHY A;  3MMV A;  4CZF A;  4EFH A;  1GLE G;  3P31 A;  2WFB A;  5H1S Q;  5C0Y A;  3VMF B;  1MDU B;  5AQF A;  4CZL A;  4ILJ A;  3DXK B;  5HOO A;  4CZK A;  1GLD G;  1GLA G;  1QQM A;  3MWT A;  2FSN A;  3SAG A;  4J8F A;  1HPM A;  3C0B A;  3ZX0 A;  3AGR A;  1BUP A;  4IJA A;  5BR9 A;  5AQJ A;  3HOT A;  2FSK A;  2GWK A;  3HM8 A;  3CIP A;  4FWP A;  5EX5 A;  1YI2 N;  1GLL O;  1O13 A;  3R6M A;  3UKR A;  4NB4 A;  4IFE A;  1WUA A;  1OVY A;  4BR7 A;  5C2D A;  4BC4 A;  3O9S A;  4GY2 B;  1VQ7 N;  3W3D A;  5KPR A;  4QS7 A;  1U2V B;  2D0O A;  4FWK A;  1S72 N;  5AR0 A;  3K9K A;  3E9O A;  4BGA A;  4JK7 A;  4KH6 A;  4JKA A;  5JIC A;  5M1K A;  3LDL A;  1Z05 A;  1Q86 O;  3M5R A;  3RSE A;  5AZI A;  5AQZ A;  1QQO A;  4BRQ A;  3D2F A;  3SBT A;  4K42 A;  1SZ2 A;  4U7B A;  2IIR A;  4A57 A;  3RVC A;  1NGJ A;  2F7T A;  2NLX A;  2ZGY A;  1CZA N;  3G71 N;  1RDU A;  3QFU A;  3LL3 A;  1VQM N;  4BR4 A;  2ZJR L;  1Q7Y O;  2Q36 A;  1NMD A;  3Q7C A;  3QBW A;  3UE5 A;  3BF1 A;  4U67 L;  4IXC A;  5BRH A;  3CCM N;  4CBW A;  5JVH L;  2E2N A;  3TSQ A;  1BDG A;  3SMS A;  1NGD A;  3O80 A;  4RCH A;  3SJH A;  3HBT A;  3FZF A;  2J4R A;  4G9Z A;  1KAZ A;  1NBW A;  4MDA A;  3ID6 A;  5LJW A;  3CXC M;  1DEJ A;  2OAN A;  4H0T B;  2E8A A;  5ELZ A;  3VPZ A;  1YJW N;  1NGH A;  1HLU A;  1VQL N;  4PHT X;  5AQG A;  3U9D A;  3EE8 A;  4BRP A;  1IJJ A;  1RDW X;  3H3O B;  3QML A;  4FWL A;  4HTL A;  3PIO L;  1H1V A;  3ENO A;  5AQM A;  3ENH A;  4JN4 A;  4BG8 A;  3CCQ N;  3DXK A;  2HOE A;  3LDP A;  4CZE A;  1BO5 O;  5C12 A;  3A8Y A;  2YHW A;  3FGU A;  2E88 A;  5HL7 L;  1KQS M;  3ATU A;  4I6M B;  4WQ5 A;  4H5N A;  3E66 A;  1NGI A;  1JCF A;  2HBL A;  1QQN A;  5AZI B;  3HZ6 A;  1IG8 A;  3TTF A;  4BC2 A;  5GIP A;  3UB5 A;  4BRE A;  1TYQ A;  5AQW A;  3G6E N;  5AQT A;  3E9P A;  3CCS N;  1QVF M;  3WXM B;  2ZGZ A;  4M63 C;  1YHQ N;  1GLC G;  4WCE L;  2QWR A;  3O08 A;  4ILH A;  4M7Y A;  4BY9 C;  4UY8 O;  4IO8 A;  5LJV A;  1U6Z A;  1YAG A;  3A5L C;  3ZET B;  2Q2R A;  2VGN A;  4MDB A;  4BRL A;  2Q97 A;  4O8U A;  1VQ9 N;  3WXK A;  2HF3 A;  3R8E A;  5M1N A;  1YXQ A;  4H5W A;  3MN5 A;  3C7N A;  4GNI A;  1X3N A;  1TUY A;  2NNW A;  3CJB A;  3I56 N;  1GLJ O;  3U8X A;  1VQ4 N;  1BG3 A;  4B1W B;  3IMX A;  3VEY A;  4CD1 A;  1D4X A;  5JMV A;  4LC9 B;  3CJC A;  4C23 A;  3JS6 A;  4JKD A;  3O9U A;  2ITM A;  3FE1 A;  1WOQ A;  2WC9 A;  4YOX A;  3EKS A;  2P9P A;  5KPT A;  4HWI A;  4K43 A;  4NLC A;  4JK9 A;  3DXM B;  1XC3 A;  1P8Z A;  4XH4 A;  1HKG A;  2QI2 A;  5F0X A;  3GL1 A;  5BRE A;  2YHX A;  3EE9 A;  1RFQ A;  1QZ6 A;  5AQY A;  2P9S B;  1QHA A;  3M1F A;  5AQH A;  1R59 O;  2W41 A;  4AM6 A;  2V7Y A;  2CH5 A;  3F9M A;  3VF2 A;  3CI5 A;  2QWO A;  3MX5 A;  2V51 B;  4FPB A;  3CCE N;  3EKU A;  2QEX N;  2HBK A;  1U2V A;  2NRR A;  3SAF A;  4XH1 A;  1VQ6 N;  4BRN A;  4YOW A;  3CCL N;  2KHO A;  3D6R A;  3K9J A;  3P38 A;  4BRA A;  3O9R A;  5AQN A;  3FZK A;  3UKR B;  4QS8 A;  3M6G A;  2JWK A;  4RTF D;  4H0O A;  3VEO A;  3C6H A;  2BH1 A;  1SQK A;  3I33 A;  4BRO A;  1T3V A;  3CD6 N;  3QIC A;  3D7E O;  3TSU A;  1LOT B;  1S3X A;  3FZM A;  4F9O A;  2NRH A;  3MN7 A;  1KAX A;  3S41 A;  1YIJ N;  4CBX A;  4O5F A;  3DXM A;  4IEE A;  4IEI A;  3ENB A;  3AAP A;  4FO0 A;  1JJ2 M;  1VQK N;  4BRG A;  4BR2 A;  1BA1 A;  5KQD A;  4JHD B;  4RWT A;  1SAZ A;  4FWO A;  3O1W A;  3OBW A;  3ZYY X;  1Q82 O;  3N4Q A;  4FPA A;  4E1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...