2E2QA

Crystal structure of sulfolobus tokodaii hexokinase in complex with xylose, mg2+, and adp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
297
structure length
297
Chain Sequence
MMIIVGVDAGGTKTKAVAYDCEGNFIGEGSSGPGNYHNVGLTRAIENIKEAVKIAAKGEADVVGMGVAGLDSKFDWENFTPLASLIAPKVIIQHDGVIALFAETLGEPGVVVIAGTGSVVEGYNGKEFLRVGGRGWLLSDDGSAYWVGRKALRKVLKMMDGLENKTILYNKVLKTINVKDLDELVMWSYTSSCQIDLVASIAKAVDEAANEGDTVAMDILKQGAELLASQAVYLARKIGTNKVYLKGGMFRSNIYHKFFTLYLEKEGIISDLGKRSPEIGAVILAYKEVGCDIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HEXOKINASE
publication title Crystal structures of an ATP-dependent hexokinase with broad substrate specificity from the hyperthermophilic archaeon Sulfolobus tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 110
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.7.1.1: Hexokinase.
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01869 BcrAD_BadFG BadF/BadG/BcrA/BcrD ATPase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2e2qA01
2VYPA 4JD2B 1JCFA 4BQZA 3CETA 1RGIA 2F9TA 3QDKA 3VPZA 1GLAG 4BRPA 3ID8A 3MN5A 3FFKB 5KPTA 4H0YB 2J4RA 2IVPA 1NM1A 1KAZA 4CZHA 5KQ8A 3ULEB 2NRHA 4H0VB 3SMSA 3H6EA 4QS9A 3O4WA 4XH5A 1HKBA 4BRMA 2P9PB 3TPQA 4H0OA 3FR0A 4AM6A 4YDUC 2QW9A 4A2AA 3FLCO 2QWOA 1NBWA 2CGJA 2A40A 1NLVA 4ISFA 3D2EA 3IDHA 3LM2A 1MWMA 4FWMA 5AQVA 1U6ZA 5E84A 3WEEA 4EHUA 5AQJA 3QB0A 4CZKA 2IVNA 2E2PA 1QQOA 5EY4A 2QWMA 1LOTB 4H5NA 5F2RA 2YHYA 3WXJA 3HI0A 4K42A 3IFRA 2FXUA 2E88A 2GWKA 4PL7A 1HUXA 4WQ5C 2E2QA 2P9IA 4BG9A 1GLLO 3VEWA 2A3ZA 2H3GX 2HMPA 5AQSA 3SLCA 5BPLA 2V51B 1WOQA 1KAXA 3MMVA 2P9LA 5JLHA 3M3ZA 1ESVA 2CGKA 4B1UB 4F9OA 4H03B 3ZX2A 3EL2A 3ENOA 3UKRB 4RWTA 3LM9A 3VOVA 5BRDA 4BC4A 3SJHA 2I7PA 3ZETB 5E26A 1BO5O 4K43A 3QBXA 3FZFA 4FWNA 4A61A 3S41A 1IG8A 3WXLA 5FPEA 2P9NB 2ZF5O 2QWLA 3WEEB 1QQMA 5BRFA 2AP1A 3RSEA 3WQTA 2WUSA 4Z94A 3U4LA 4O5FA 1DEJA 4LC9B 3C0BA 5EOYA 2V7ZA 4BQLA 1KAYA 1TYQA 5AQNA 4BC5A 5JLFA 4H0TB 3AAPA 3MK6A 3LDQA 3OHRA 4FWLA 4FPBA 3O5BA 3VEVA 4BGAA 4CZJA 1NGDA 3BF1A 5FPDA 5JICA 1C0FA 3CQYA 1ZC6A 1HJOA 3A5NC 4DQ8A 4CBXA 3A0IX 1MWKA 3GBTA 1YVNA 2FF3B 2ITMA 5AQLA 1Z6RA 2Q97A 3MCPA 2D1KA 3ZX3A 2A42A 2P9LB 4ISEA 1U2VA 2QWRA 4FOIA 1ZXOA 4B1VA 4BC2A 3BEXA 3LDNA 4B9QA 1S3XA 5AFUA 3VEZA 4XEIA 1GLEG 3UB5A 4B1ZA 3VETA 1BA0A 3WUHA 4CD1A 2GTDA 1HKGA 3HZ6A 3VERA 4FWPA 5AZIA 2ZGZA 1BDGA 4B1WB 1X3MA 3EZWA 3VGLA 5AQOA 1YAGA 2HOEA 4BR7A 3RSEB 1HKCA 1T6CA 1NGIA 2I7NA 4FWKA 2GEMA 1TYQB 4PKGA 4CZFA 4H5WA 2E1ZA 2OANA 4H0PA 2IIRA 5FPNA 1WUAA 2E2OA 3P4IA 3O80A 2QWQA 4O8KA 4ISGA 3WXKA 2V52B 4BRHA 2PBDA 3FZMA 3VEYA 3GOIA 1XUPO 2FLOA 1JCGA 1NGHA 2D4WA 3DXKA 4M7YA 2PAVA 4FL9A 1GLCG 4HWIA 1HLUA 3VF2A 4JHDA 2GWJA 3O1BA 4RCHA 1ATNA 4NB4A 2D0PA 3F9MA 2P9UA 1U2VB 2UYTA 1RDWX 3KVGA 3H3NO 3BF3A 1NGGA 5AQYA 4JN4A 1CZAN 1D4XA 4FSVA 3R9PA 3I33A 3TU5A 4IWVA 5AZIB 4WQ4A 1T6DA 3VF4A 4CBUA 5TKYA 1NGJA 3H1VX 1T44A 1HPMA 1EQYA 1C0GA 3QFPA 3WXIA 3A5OC 5EX5A 4FPAA 5AFUH 5LY3A 3HSCA 3U9DA 4RTFD 5BRHA 1R59O 3FZKA 1YUWA 5LJVA 4H0XB 2P9KA 3HM8A 3M1FA 5AQKA 1BA1A 2QM1A 4E1JA 3WQUA 1NGBA 1QZ6A 3ATUA 2EWSA 3LL3A 3ENHA 3A5MC 4BRKA 2ASMA 3I8BA 2CH6A 1XQSC 1NWKA 3R6MA 4GY2B 2YJEA 4BROA 1X9JA 4BRCA 3DXKB 1ATSA 5JMVA 5ADXA 1BG3A 3EN9A 3QFUA 1V4SA 3D2EB 3DWLA 4JHDB 4IJAA 5KPZA 2BUPA 3H46O 2P9UB 5BPNA 1MDUB 4BR2A 3VF6A 1X3NA 5AQPA 5BPMA 5AQZA 1JCEA 2ZWHA 1Q18A 3DXMA 1BU6O 3LDOA 3G25A 1XC3A 3H45C 4EHTA 3O6WA 3UE5A 2KHOA 1SZ2A 1E4GT 4FWSA 4JNEA 4KBOA 4MLEA 5AQGA 4BR9A 2P9SA 3J8AA 4I6MA 5F0XA 2P9IB 3CJBA 3DAWA 5KQDA 4EFHA 3AARA 3W0LA 5BN8A 3L0QA 1GLJO 2CH5A 3QBWA 4CZGA 3FGUA 3L6QA 3DJCA 2VWBA 4BRNA 1K8KA 4QS8A 2GELA 5AQQA 4MO5A 3CHWA 4BRLA 3LDLA 3LDPA 5BR9A 3ZEUA 1RFQA 4BRGA 3WT0A 4PKHA 2Q1NA 4MO4A 3O1WA 4WQ4C 3M6GA 1SQKA 3ATVA 4CBWA 2E20A 4BVOA 4CI6A 5CE3A 4DCHA 3C7NA 3W3DA 4BREA 1G99A 4BRAA 3R8EA 2QXLA 3L4IA 2FSJA 4K41A 5ADXH 2W40A 4FO0A 3DXMB 3D2FA 3A8YA 3CJCA 3H3OB 2IVOA 4JAXA 1V4TA 4GNIA 3UKUA 1QQNA 4Y0WA 1BOTO 3GL1A 3IMXA 4B1XB 2P9SB 4BRDA 3O08A 3ZX0A 4I6MB 5F1XA 3O8MA 4MLHA 5BN9A 5AZJA 1BUPA 3U8XA 4BVPA 2FF6A 4BGBA 2YJFA 3MN9A 1K8KB 3IUCA 4M7XA 3EKSA 3VGKA 3CJ1A 4C23A 4HTLA 2E8AA 4AM7A 1NGFA 4BR4A 3CI5A 3ZEUB 3HTVA 3SMPA 3GE1A 4XH1A 2VCPA 3UKRA 2AA4A 4DHYA 1NGCA 4CJ7A 1S22A 3MDQA 3ZETA 4L3QA 5FPMA 2HF4A 3C7NB 3FZHA 4EIAA 1ATRA 3HBTA 3EO3A 2Q0RA 1GLBG 1NGAA 3BUZB 3JS6A 3H1QA 5AQTA 3MN7A 4B1YB 5AQUA 2A5XA 4FWOA 4H5TA 2P9NA 3AAQA 3D2FB 1DGKN 3GDQA 3VENA 3D7EO 2NZTA 5AQIA 2ASOA 2DPNA 3UKUB 1IJJA 5BREA 4PKIA 3AY9A 1J6ZA 3QMLA 2YCHA 5LJWA 4QS7A 2Q2RA 5AQRA 1E4FT 4CZLA 3VEOA 3VEXA 3CIPA 4BRFA 1TUUA 1Z05A 5AZJB 2FSKA 2NLXA 1P8ZA 5AQXA 4IO8A 1YXQA 1QZ5A 1NGEA 3CJ7A 4H5VA 4CD3A 2A41A 1GLDG 4BRQA 2CGLA 1Y64A 1SAZA 3FE1A 4WYBA 4J8FA 4FOEA 3GG4A 1MA9B 3MN6A 1H1VA 4IZ9A 4YDUA 1TUYA 5AQWA 4NO7A 2A6AA 3B8AX 3JXUA 3QICA 1HX1A 3A5LC 4IJNA 4PL8A 3KHYA 1GLFO 2D0OA 2HF3A 2GUPA 1BWFO 2ZGYA 1OKJA 3U9ZA 4BRIA 4JD2A 4BR0A 2F9WA 2V7YA 4BC3A 4EAHD 2E1YA 1DKGD 2YHWA 1ZBSA 1LCUA 2P9KB 4XH4A 3KZBA 5AQFA 4IXCA 5KPRA 2Q36A 2W41A 4H5RA 2YHXA 3CERA 3ULEA 4CZMA 4FWRA 3VESA 5I9EB 2P9PA 3CQXA 4BG8A 2QWNA 5ELZA 5AR0A 1KXPA 3SK3A 5AQHA 2ASPA 5AQMA 4A2BA 4CZEA 3CJ9A 2QWPA 1QHAA 4WQ5A 2E2NA 3FZLA 5B8HA 4FWQA 3BP8A 2FSNA 3CJAA 1NMDA 5EVZA 4K25A 4M63C 4CZIA 2Q0UA 2YI1A 3EKUA 3VGMA 4BR5A 4DB3A 2Q31A 5EXWA 2BTFA 4A62A
chains in the Genus database with same CATH superfamily
4LF8K 4PWDA 1VQ8N 3VPZA 2KTQA 4E0DA 1KFSA 3CYMA 2PYJA 1HKBA 1A5WA 4J2AA 3SYZA 4AM6A 1IG9A 5C24A 4YDUC 1SL1A 3THWB 5FRMA 3VQQA 3FLCO 3VTHA 1NBWA 3M8RA 3SZ2A 3IDHA 4E89A 3OS2A 1RDCA 4FWMA 4N76A 5AQVA 5E84A 1XMOK 4JKDA 2IVNA 3I0SA 4DSFA 1QQOA 1BQMA 1NKBA 4GW6A 1HNIA 2RHKA 2QWMA 4U67L 3O4NA 1FKOA 2QA4N 3K9KA 4OVLA 3K9JA 3VQBA 3SUNA 4PL7A 3EZ5A 1G15A 3QLHA 5GIPA 4CJ3A 1ITGA 3L3UA 4C8MA 1J53A 4EP5A 3TAGA 4BG9A 3G10A 4CERA 1TAUA 1GLLO 3LP0A 4I7FA 3TTFA 2IGIA 2HBKA 4M42A 4DQRA 4KB1A 2V51B 4EP4A 5H1SQ 3HOSA 4DTUA 1KAXA 4M3UA 1ESVA 3AVKA 4JEPA 4ILJA 1C1AA 3ZX2A 3VOVA 4RW7A 5BRDA 4BC4A 4DTMA 3ZETB 4FJIA 1ZBUA 3J7YP 1VQMN 1TL1A 2OPSA 5CR4A 1IG8A 2HVIA 2P9NB 2O8EA 2ZF5O 3WQTA 4Z94A 2X6NA 2Z1IA 3HP9A 5EOYA 3SQ0A 4LF9K 2W6LA 4G1QA 4V19S 5JLFA 4W5NA 1Q9YA 3AAPA 3K5OA 4N5SA 3SI6A 2IOCA 4CZJA 1NGDA 5JICA 3A5NC 4IKFA 3NGZA 3A0IX 4JKEA 2FF3B 3RR7A 1NG9A 1YTUA 3HPHA 3S3MA 1KRPA 3C6AA 1YT3A 3IS9A 4B8AB 3PX0A 4DTNA 4B1VA 4CGFA 1J5EK 3LDNA 3HRGA 4W5TA 1GLEG 3VETA 5M1NA 3VERA 5AZIA 3V1RA 4B1WB 1RBRA 2O8EB 1OH5A 3DI6A 4Z4HA 3OYAA 1NGIA 4FJNA 4CCHA 4FWKA 2GEMA 4CZFA 4X62K 2Q3SA 2B4JA 2IIRA 3OA9A 4MQ3A 1LV5A 3L2RA 4O8KA 3OYMA 4IEEA 1JXBA 2PBDA 2PY5A 3PX6A 1VQ9N 1C1CA 2FLOA 1NGHA 2D0BA 2OPRA 4GMJB 3KK3A 3KK2A 1SV5A 1QSLA 2KFNA 4CK1A 1YTAA 4I9QA 1GLCG 4FZYA 1HLUA 1T8EA 4LF7K 3O1BA 3S3OA 2IAJA 1NOZA 2P9UA 2E4LA 4KTQA 5M1OA 3A2FA 3M8SA 4CE9A 3R3LA 4O0JA 4DU1A 4DU4A 3SNNA 4FZZA 4H4OA 5AZIB 1T6DA 4CBUA 1NGJA 2W6KA 1IKXA 1EQYA 1HYSA 2RE2A 4FPAA 4C8KA 2HW3A 3U9DA 5BRHA 3T3FA 1IH7A 4EZ9A 1WN7A 1YUWA 1OVQA 1LWCA 1B9DA 2P9KA 1C0TA 4E1JA 5HROA 5KRSA 4F3TA 3A5MC 2QTDA 1GOBA 2ASMA 3TAQA 1BI4A 1XQSC 4GY2B 4FM0A 1X9JA 1BIUA 1ATSA 1VSDA 4JKFA 5JMVA 1WSEA 4OPJA 4IEIA 3D2EB 4IJAA 4FW2A 4CHNA 4LFCK 5LMNK 1ZBIA 2P9UB 5BPNA 5JS1A 5BPMA 1JXEA 3QIOA 3N4QA 1CXQA 2ZWHA 3QERA 4EHTA 1T05A 4KBOA 2GUIA 3JAMO 3G4SN 2A1RA 3AV9A 2UUAK 4MLEA 4M3WA 5K14A 1QVFM 3NVKA 2WBNA 5F0XA 5KQDA 1X9MA 3AARA 1SKWA 1GLJO 2CH5A 1Q81O 4JRPA 4B9TA 1C0MA 3OYKA 3RRHA 4MO5A 3ZT0A 1JLGA 5BR9A 1BI4B 1NJIO 4IOAL 4YFUA 4FJ5A 1RFQA 3ZSYA 3LPUA 4DTPA 4BRGA 4PKHA 2Q1NA 1RBTA 3O1WA 4WQ4C 3DLRA 1SKRA 3M6GA 2HNYA 3ATVA 1Q7YO 3HOTA 3EE8A 4YNQA 3I8DA 4IDHA 2QKKA 4DFKA 3PUFA 2FSJA 4C8OA 4FO0A 3D2FA 2BDPA 1VRUA 2IVOA 4B9SA 4JAXA 3CCSN 1Q9XA 5DM7L 1W0HA 1QQNA 4Y0WA 4CJPA 3GL1A 4DV3K 4BRDA 4DTSA 3PV8A 1L5UA 5F1XA 1FJGK 3ZSZA 4UY8O 3O8MA 3O9UA 4NXMK 4DSEA 3L8BA 4JI3K 2FF6A 4Q5VA 4M41A 4BGBA 3VQ7A 4M7XA 2G8WA 3DRSA 3VGKA 4HTLA 2VG6A 2XHBA 2E8AA 2WONA 3HTVA 1JL2A 3QEXA 1TKTA 2UU9K 3AA2A 3GE1A 1TK5A 4JI1K 2VCPA 1HQEA 4DHYA 1QQCA 5IWAK 2HNZA 3MDQA 2NRTA 3DM2A 1KLMA 1W9HA 2Q0RA 3EO3A 2OYQA 3DOKA 3JS6A 1D9FA 4Z4IA 4UQGA 3THYA 3NVMA 4FWOA 1KVBA 3D2FB 1LAVA 4DV5K 4CJQA 3VENA 3N4PA 5AQIA 3RRGA 2ASOA 3QMLA 2YCHA 3ID6A 2JLEA 3CXCM 4CZLA 3VEOA 1JLEA 3CIPA 1M1KO 1Z05A 3BZCA 4NLCA 1S6QA 2VQFK 1N33K 1YXQA 1TKDA 1QZ5A 1NGEA 2D0CA 4A5AA 4IBNA 3E9OA 4FCYA 4BDPA 3J7AP 3FE1A 4HUEA 3UIQA 4KI4A 4J8FA 1MA9B 3B8AX 4PL8A 1I94K 1HX1A 2XO7A 4BDZA 1S1TA 1GLFO 4Z4GA 5DK5A 1BWFO 3G0ZA 5IT9O 1FKPA 3D6RA 4JD2A 4FXDA 3OTOK 2F9WA 2E1YA 2YHWA 3V9WA 3ASMA 4Z4CA 3OBYA 5KGWA 4IXCA 1KD1O 3EYZA 4NCBA 2VWKA 3PSFA 3B6PA 3CERA 3ULEA 2VGMA 4IO9L 2P9PA 1HYZA 3CQXA 4BG8A 1YJNN 4ELTA 1KXPA 2BGGA 3CQ8A 3VQCA 1VHXA 4DR4K 3CJ9A 3PIPL 1LWFA 1QHAA 4B3SK 1S9GA 1WB9A 3FZLA 4O5BA 1QSSA 2FSNA 3CJAA 3VA0A 4OLAA 1WLJA 1NMDA 4K25A 3O3GA 3NF7A 2NRWA 3F73A 4CHQA 3E9PA 4DTJA 4HCCA 3O3FA 1EX4A 3NMUA 3CCLN 1UAXA 3NHGA 2F7TA 2YX6A 1YHQN 1WSJA 4J2EA 4BR5A 4CECA 2O8CA 4KHNA 5EXWA 3NDKA 4O55A 3E66A 4JD2B 5FROA 3KD5E 3CETA 3L2VA 1RGIA 2F9TA 4RW6A 2ZM6K 5GIOA 3TARA 3AVJA 4CZHA 5KQ8A 3ULEB 2YHBA 5HOOA 3H6EA 4OGCA 2P9PB 1JLQA 1WBBA 1HNXK 3TPQA 1REVA 2IDOA 3FR0A 1RBSA 2QW9A 3ZCMA 4CEDA 3KK1A 3THVA 2A40A 2WC9A 3PLAA 3LM2A 4YOVA 1U6ZA 1IBLK 1ASUA 3HM9A 3WEEA 5AQJA 3K59A 1D9DA 3V1OA 3IAYA 3ALYA 5CY4A 1LOTB 4H5NA 2FC0A 5F2RA 2YHYA 3WXJA 4CEBA 3HK2A 4K42A 2E88A 4KH6A 1XI1A 3E9LA 4YY3K 3T19A 4BE1A 2P9IA 1DT9A 4CFBA 2H3GX 3NBPA 3OYEA 4CJ5A 1WOQA 2PFUA 5HBMA 4FJMA 3M3ZA 3CF5L 4F9OA 1W97L 3EL2A 1WSIA 2O8FA 1KFDA 2I7PA 3VQ8A 4LF6K 1BO5O 1TGOA 3QBXA 1RT5A 3FZFA 5C2FA 3CC4N 1RT2A 4BWJA 4F4KA 3S41A 2HHWA 3SQ1A 1VQ7N 4B9NA 3WEEB 3QEWA 1QQMA 5HRNA 2AP1A 2WUSA 4O5FA 1DEJA 3C0BA 2P5GA 4BQLA 1TYQA 4BC5A 1Z26A 3L3VA 2DFHA 3AO2A 4CHPA 3LDQA 4FPBA 3O5BA 4IFEA 2O8BA 4OLBA 3BF1A 4NYNA 1ASVA 3KWIA 3TAPA 3SBGA 1NKCA 4DQ8A 1RDUA 1TL3A 1BCMA 1MWKA 3GBTA 4B3MK 2F96A 2XY5A 2BANA 5AQLA 3TTCA 2Q97A 4ELUA 3KLIA 5LL6Z 4FLYA 3RWUA 4CF2A 3ZSXA 3K5NA 4CJVA 3QO9A 1UA1A 1ZBHA 2HHHK 2QWRA 2O4IA 3VEZA 4XEIA 3UB5A 3SQ2A 4B1ZA 1BA0A 4E3SA 4Z4FA 1S1VA 3WUHA 4CD1A 2X6SA 3AA5X 2GTDA 1HKGA 1VQ4N 3TSQA 3VQAA 1X3MA 3EZWA 5AQOA 3V1QA 2F8TA 4JLHA 4FJKA 1B9FA 5FRNA 1TK0A 4YOYA 1TYQB 4PKGA 4CHOA 4H5WA 2E1ZA 2OANA 4H0PA 3K58A 3ENBA 2NRZA 4CEAA 1WUAA 3P4IA 4DWIA 1L3VA 4ISGA 5GAGP 2P5OA 4DR6K 1J54A 3CM6A 3FZMA 2LSNA 2WFBA 3HJFA 3CFRA 3GOIA 1XUPO 4DSLA 3HXMA 3DXKA 4DQQA 5CYMA 2PAVA 3V9XA 4IG3A 4QAGA 3V4IA 2D0PA 4KRFA 3NH0A 1QVGM 3KWGA 1U04A 2GBZA 3EEQA 4CJRA 3CPEA 3KVGA 1NGGA 5CYQA 4CGHA 4JKCA 4FSVA 3I33A 1JLBA 3CMEN 4DV6K 1FW6A 1NK9A 1E3MA 3PO4A 3WXIA 1LW0A 5C2DA 5EX5A 5AFUH 2HB5A 3LPTA 5LY3A 1I39A 4RTFD 4CEOA 3FZKA 4DS4A 4H0XB 4CJUA 3P83D 4JI8K 3ZLJA 4E19A 3M1FA 4B9MA 1BA1A 3WQUA 1NGBA 1QZ6A 5C10A 4E1MA 1JKHA 4BRKA 2GX9A 3ZT3A 4KKOA 4BROA 4BRCA 3DXKB 1BG3A 1YITN 3AVAA 3DWLA 2O4GA 5KPZA 3H46O 4DTXA 5M1QA 1MDUB 4BR2A 4JI0K 4CGDA 3OYBA 4DQIA 3HSTB 1Q18A 3AA4A 3DXMA 3LDOA 2OA8A 4ID5A 3T1AA 3LP3A 5HRPA 3QNNA 3F9KA 2KHOA 3DLBA 2DFEA 1TV6A 4A57A 4OPKA 2YNGA 3SPYA 4I6MA 1UA0A 3W0LA 5BN8A 3PX4A 3VMFB 4GV9A 2Z1HA 4CIEA 1NKEA 2OZSA 4BRNA 1K8KA 4DQSA 4KH5A 4QS8A 3VQ5A 3LDSA 3QEVA 4LFAK 3CHWA 3MWTA 4JKGA 4BRLA 2P1JA 4DTOA 3LDLA 2AJQA 2WOMA 1XMQK 2Y1IA 1X9SA 3MXIA 1NU0A 3NF8A 4JI7K 4MO4A 1TVRA 4YORA 4CK3A 3L2WA 1OH8A 3QIPA 3LP1A 5CE3A 1QE1A 2RF2A 4N56A 3VQEA 3L4IA 4FLTA 4FLZA 3IKMA 3CC7N 4FLUA 1VSKA 2W40A 5ADXH 3DXMB 3O9RA 3A8YA 3H3OB 5C42A 3SUPA 5I3UA 1WAJA 3UKUA 3AGKA 3TANA 4B1XB 4OX9K 3QEIA 1QHTA 3CCJN 4I6MB 5SWMA 5BN9A 3LANA 5AZJA 4M3XA 3HO1A 4ZTJA 2ZJPL 2KZMA 3MN9A 1K8KB 3IUCA 4B8CA 1NK7A 3TAMA 4JKGB 1NGFA 4YOXA 3CI5A 1W2BM 3RMBA 2UXBK 3U3YA 3SMPA 3AVMA 2YKMA 3UKRA 4C8LA 1I3AA 4CJ7A 4DR5K 3OYIA 2HF4A 3FZHA 1GOAA 4C1NK 3BUZB 3H1QA 5AQTA 4B1YB 2VWJA 3FFIA 2A5XA 1DGKN 1BHLA 4AHCA 2E5LK 4W5OA 2NZTA 1Z25A 4B3RK 3UKUB 4MDBA 4AH9A 2B5JA 4M3TA 2NRXA 2BE2A 3AVFA 4DV1K 3H08A 4B9LA 2QKBA 2DY4A 1VSEA 3THXA 1DTTA 5AZJB 3VA3A 3ZYYX 4LF5K 4ZHRA 4IO8A 2HVHA 4FJXA 1J9AA 2A41A 1JJ2M 3I55N 3KJVA 1T3VA 1GLDG 1A5VA 3CMAN 1Y64A 2G8UA 2G8HA 1S6PA 4WYBA 2HHUA 4FOEA 4CJSA 3QINA 4NO7A 2A6AA 2FBVA 4IJNA 3KHYA 4DU3A 2JWKA 2GUPA 4HCBA 4KB0A 1W7AA 3SV4A 2V7YA 2YHAA 2P9KB 3CCQN 1JL1A 2HNDA 1RILA 4C8NA 4DUYK 3E1YA 4CJLA 2YHXA 3VN5A 1KSPA 4FWRA 1HNWK 2QI2A 2ZJQL 5ELZA 3OYCA 3THXB 1TKXA 3HPOA 3P5JA 1WNSA 5AQMA 3BDPA 4LF4K 2QWPA 3LAMA 3OJSA 4H4MA 4WQ5A 3WNFA 4CFCA 3TWHA 2Z1GA 4FWQA 3RTVA 3O4QA 4GKJK 5GADP 4JI6K 4KHUA 4RW4A 1KLNA 4GV3A 4DV2K 2YI1A 1IBMK 3VGMA 1EETA 5KI6A 2Q31A 4M3ZA 4HVJA 2BTFA 1S1UA 5J2QA 4O44A 4LSLA 4BQZA 3LWMA 3QDKA 1GLAG 4WF9L 4BRPA 3R1XA 3ID8A 3MN5A 4CJEA 2A1SA 3CD6N 2VG7A 2NRHA 1EKEA 4H0VB 3SMSA 4QS9A 4XH5A 3JYTA 4I9LA 3MWPA 1EWQA 3D45A 3ZT4A 4CF0A 4GKKK 1N32K 1IV0A 3AO4A 5JVHL 1TK8A 2OPPA 4A2AA 1S5JA 4JI2K 2CGJA 1NLVA 4ISFA 4DMNA 4PHTX 1HMVA 1MWMA 3OBWA 1NK0A 2ATQA 4CFDA 4A5BA 3WNGA 1NK5A 4NCAA 4WCEL 3MEEA 4CZKA 1VQKN 5C25A 3M8QA 3TSUA 5EY4A 4KAZA 2FBYA 1FXXA 4QOZB 3IFRA 2FXUA 4JS5A 2GWKA 2ZE2A 3CG7A 5J2NA 4CEEA 4NXNK 1HUXA 2E2QA 1S1WA 3RMCA 2A3ZA 2HMPA 3ULDA 2HBMA 5BPLA 3P38A 4CJFA 1YI2N 4JK9A 2P9LA 5JLHA 2CGKA 3QESA 4FM2A 1UOCA 4MDAA 4H03B 2IC3A 4RWTA 1N5YA 4I2QA 3MECA 2IS3A 5HRSA 4EZ6A 3SJHA 5E26A 3LWLA 4K43A 5BR8K 1KTQA 4FWNA 4A61A 4ELVA 1HJRA 3THYB 4FVMA 3WXLA 5FPEA 2BH1A 4M3YA 3ISNC 5BRFA 1K8AO 3U4LA 4B9UA 5TKWA 4LC9B 3NFAA 1HNVA 3V81A 2V7ZA 4JKHA 1KAYA 1RTJA 2KLAA 4H0TB 3OYNA 1O1WA 5HLFA 3OHRA 1YIJN 4FWLA 2X78A 3T1HK 1C0FA 4AQYK 1ZC6A 4WFBL 3ITHA 1IKYA 1NJXA 3VQDA 1D5AA 4CBXA 4JKAA 4KTZA 1RT3A 1Z6RA 1N36K 2D1KA 2P9LB 4CVNE 3I0RA 4ISEA 1U2VA 3BEXA 4B9QA 4W5QA 4CGGA 3AVNA 5AFUA 3NGYA 4GV6A 4HUGA 2HMIA 4DFPA 3T7ZA 5I42A 2O8DA 4FLVA 4PQUA 4CHZA 3HZ6A 4FWPA 2ZGZA 1T03A 1YAGA 2HOEA 4YOTA 3AVBA 3SAHA 3J80O 4B3TK 5FPNA 2E2OA 3O80A 2QWQA 5JS2A 1NNEA 2NRRA 3NGIA 1OVYA 3M8PA 1K73O 5CHIA 2V52B 4BRHA 1BISA 4IOCL 4KPYA 1JCGA 1VK0A 1N8RO 2UUBK 4KH4A 1U48A 4FYDA 1NK6A 2FBTA 4JHDA 2NRVA 2GWJA 4RCHA 4OKEA 4DR3K 4DF8A 4R5PA 3ZSQA 3O3HA 4DR7K 2HSTA 2P51A 1U2VB 5FLXO 3S9HA 5MLCQ 1RDWX 2YNIA 3H3NO 3BF3A 4CHYA 5AQYA 3M5RA 3NH1A 1CZAN 1D4XA 3R9PA 3TU5A 2O8DB 2O8CB 3S3NA 2JWLA 4IOXA 4AHVA 5TKYA 3H1VX 1T44A 1C0GA 3QFPA 4KHPK 3ZT2A 5J2MA 3TAFA 1S72N 3HSCA 4WFNL 1IO2A 4KO0A 1KCFA 1XC9A 4ILGB 4DFMA 3NF6A 4N41A 3HM8A 3V9SA 1L3SA 2QM1A 3Q7BA 1TKZA 3ATUA 1RBUA 2EWSA 3ENHA 1Y97A 3I56N 2NNWA 3B6OA 2CH6A 1NWKA 4O4GA 4F3OA 5ADXA 4CFAA 4IFYA 3EN9A 3IG1A 4FJ9A 2HHTA 1BQNA 1V4SA 4JHDB 3AVCA 3AVIA 2BUPA 3VQPA 4RW9A 3AA3A 4FK4A 2G8IA 1JCEA 2HHQA 3G25A 4CF9A 3J7ZO 3O6WA 3UE5A 4E7JA 4OO1J 1E4GT 1WBDA 3MAQA 3L4QA 1LAWA 4BR9A 5AQGA 1CXUA 5HP1A 2DFFA 3C6UA 3SPZA 3J8AA 1HQUA 2P9IB 3DAWA 2D0AA 2ITGA 3L0QA 5KRTA 3LP2A 3OYDA 3F2KA 1KVAA 1TAQA 3C65A 3NH2A 3QBWA 4CZGA 3L6QA 3OJUA 4GVEA 3DJCA 1HNZK 1RNHA 3LAKA 1U49A 2OTJN 3DMJA 3SV3A 4F2RA 5KGXA 3OYLA 4DLEA 4B9VA 4DG1A 2O8FB 4BWMA 3ZEUA 3DLGA 3VQ6A 2ZJRL 4KHSA 3WT0A 1ILYA 1SQKA 3DLKA 4KREA 2E20A 4BVOA 2HHVA 4BREA 4BRAA 1IBKK 3PY8A 3DLHA 1X1PA 4RW8A 4ID1A 4KHYA 3CJCA 2DTUA 5GINA 1LWEA 4CIFA 5KTQA 2R7YA 1EWRA 4FLWA 2OTLN 4LY7A 2ETJA 3RMAA 2O8BB 1BOTO 5E41A 3IMXA 4O0IA 3O08A 3KLGA 5DMRA 4E7LA 2OZMA 1NJWA 4PY5A 4MLHA 1BUPA 3U8XA 4BVPA 3V9UA 4OKJA 3OYGA 3ZSOA 3ZSVA 1UWBA 4E7IA 1YJWN 4X66K 4KI6A 3TTDA 1CZBA 2KKZA 3NCIA 3ZEUB 4J2BA 4CJKA 4DR1K 4Z0UA 4XH1A 4CJTA 1DTQA 1NGCA 1OH6A 3ZETA 4L3QA 4CGJA 4KV8A 1ATRA 4BY9C 3HBTA 1GLBG 1JLFA 2OCEA 1IKWA 3MN7A 4AHRA 5D3GA 2UXDK 1VRTA 2P9NA 3U6FA 1VSIA 3CFPA 3GDQA 5HRRA 4B08A 2DPNA 3HP6A 1IJJA 2E6LA 1J6ZA 5LJWA 4QS7A 1VAZA 4K8XA 3VEXA 4BRFA 4HUFA 4ICLA 4IG0A 3C6TA 3HT3A 2KW4A 1GOCA 1XHZA 2NLXA 1RT7A 2PZSA 5AQXA 3K5MA 4BDYA 1VQNN 4FK2A 3CPWM 1C6VA 4H5VA 3CJ7A 4CD3A 2KZZA 3AO5A 2NUBA 3LZIA 5CZ1A 2XY8A 2CGLA 2PYLA 4KTWA 1RTDA 2VG5A 3QEPA 1ZBFA 3CCMN 3GG4A 1H1VA 3CCRN 4IZ9A 4YDUA 1TUYA 5AQWA 4JRQA 4FJ7A 2XY6A 5LMUK 3WXMB 2D0OA 1K9MO 4JS4A 2ZGYA 1OKJA 3RR8A 4BR0A 4OKKA 4EAHD 1ZBSA 1LCUA 3QNOA 3KZBA 1SL2A 1RBVA 5AQFA 3CCVN 5KPRA 2Q36A 2W41A 5M1KA 4CESA 4ZTFA 4KFBA 1YVUA 3VQ4A 3VESA 2QWNA 4U7BA 1VQ6N 1S9EA 4FZXC 4Y1DA 4DS5A 5AQHA 4A2BA 5C12A 4DSJA 4CZEA 2GV9A 4JK8A 5EU7A 3LZJA 3AO3A 2QXFA 3KKRA 3HL8A 4N47A 4FJHA 3KLFA 2F8SA 4M63C 2Q0UA 3V6DA 3EKUA 2D5RA 1SS6A 4A62A 1VSHA 4NYFA 2VYPA 1SKSA 1JCFA 4RG8A 5M1FA 4YOWA 4KHWA 1LW2A 4JI4K 3FFKB 5KPTA 4H0YB 2J4RA 4C1NI 2IVPA 1NM1A 1KAZA 4MFBA 2XY7A 1L3TA 3O4WA 4BRMA 3OVNA 1WSGA 3EY1A 3EE9A 3KLHA 3KIOA 4H0OA 2HHSA 2QWOA 1YJ9N 2WTUA 3D2EA 3K2PA 3P31A 4B3OA 1XNQK 4EHUA 3QB0A 1C1BA 2E2PA 1HR0K 3PO5A 3PSIA 1L3UA 4K0KK 3HVTA 2KFZA 5C15A 2HHXA 3QETA 3G71N 3HI0A 4AHSA 4CJWA 1CLQA 3O9SA 3P1GA 1J5OA 4WQ5C 4L8RB 3VEWA 1RDBA 5AQSA 1N34K 3SLCA 4KHQA 3MMVA 2KQ2A 3MEGA 4B1UB 4JYAK 1VSMA 1BIZA 3ENOA 3UKRB 3LM9A 1DLOA 2QK9A 3ZT1A 4IFVA 3VTIA 3T69A 1NJYA 2QWLA 4LH5A 3TAEA 1VSJA 3OYJA 3RSEA 3SAFA 4X65K 4Y1CA 1KVCA 3SAGA 5AQNA 2YNFA 4OPAA 3P39A 3MK6A 1ZBLA 3AVHA 3OYHA 3VEVA 4BGAA 4FK0A 1NOYA 3DRPA 5FPDA 3JSMA 3CQYA 4NCGA 1HJOA 4J2DA 4BE2A 4TSXA 4JKBA 3K57A 2QEXN 1YVNA 2ITMA 3MCPA 3ZX3A 2A42A 2Y1JA 2OPQA 4FOIA 1ZXOA 3MEDA 4BC2A 3AO1A 1S3XA 3V9ZA 3CM5A 1HYVA 4Q0BA 1NJZA 3O9QA 4IDKA 3OY9A 4DSIA 4FJGA 1KQSM 4FLXA 3MX2A 2I5JA 1BDGA 1RT4A 3VGLA 1BCOA 4BR7A 3RSEB 1HKCA 1T6CA 4BE0A 4M3RA 3TSPA 5GAEP 4CJ4A 1B92A 4ILHA 2I7NA 4BACA 1XWLA 2UXCK 4G9ZA 4F2SA 3KTQA 3O9TA 3WXKA 4CEFA 3VEYA 3C6HA 3KK7A 1RDDA 1NK8A 2D4WA 4M7YA 4CGIA 3T1YK 1EXQA 4FL9A 3NAEA 4DF4A 4OJRA 4HWIA 1WSHA 4I2PA 2RN2A 3VF2A 3F5TA 1ATNA 4NB4A 3F9MA 5SZTA 4GVMA 1KC8O 4DQPA 1SL0A 2UYTA 1VQ5N 4JN4A 2E6MA 3SJJA 4IWVA 3BGRA 3DLEA 4DUZK 3NE6A 2B6AA 4WQ4A 3VF4A 4FW1A 2X74A 1HPMA 4H8KA 1T7PA 1RTHA 5CZ2A 3A5OC 2RPIA 4OPHA 4F8RA 3ZSRA 1R59O 5LJVA 3C94A 4FJLA 2F4VK 4O8UA 1WAFA 1JLAA 5AQKA 3LL3A 1RCHA 1BL3A 1RTIA 3I8BA 3SBTA 4JI5K 3R6MA 4FJ8A 1FK9A 2YJEA 4W5RA 4OGEA 3ZSWA 4E1NA 3QFUA 1VSLA 3PIOL 3RMDA 1EP4A 3VF6A 1X3NA 5AQPA 1QSYA 1YF5L 3AGRA 5AQZA 3HVRA 3DLLL 1BU6O 4R79A 1A5XA 1XC3A 3H45C 3IRXA 1SZ2A 4FWSA 2YNHA 4JNEA 1U4BA 2VQEK 5M1PA 2P9SA 4DV4K 3SCXA 4PA1A 3DOLA 1OH7A 3HPGA 3L2UA 3CJBA 3KKSA 4EFHA 3MXJA 4Z4EA 4CIGA 3BY5A 3FGUA 4M45A 3SQ4A 4FJJA 2VWBA 4NLBA 2GELA 5AQQA 4CF8A 3KLEA 3BZKA 3LDPA 3RVCA 4CEQA 1Q86O 4LFBK 1HRHA 3C95A 3SUOA 2YKNA 1ASWA 4CBWA 1RDAA 4CI6A 4DCHA 4WE1A 3KD1E 1XNRK 3C7NA 4JK7A 3W3DA 4AHUA 1G99A 3J81O 3R8EA 2QXLA 1EO1A 4CW7B 4K41A 2YV0X 4QCLA 4DSKA 1HPZA 4LH4A 4E7KA 3OYFA 3CC2N 1V4TA 4GNIA 1QTMA 1NMNA 1X9WA 3WNEA 2P9SB 3ZX0A 3TI0A 3E01A 4LD0A 3Q7CA 2YJFA 4WFAL 1SUQA 3EKSA 3CJ1A 4C23A 1F21A 1RT1A 3DYAA 4DLGA 4AM7A 3CFOA 4BR4A 4CF1A 1MU2A 5AJ3K 1RT6A 1VQPN 2AA4A 2HBJA 4HHTA 3G6EN 1S22A 3K5LA 5FPMA 5JVGL 3C7NB 4EIAA 3LALA 4DTRA 3U3GA 1VQLN 2G8VA 1NGAA 1QS4A 5AQUA 4H5TA 4CK2A 2Z1JA 3AAQA 3MCAB 3CCEN 4E7HA 3L2QA 5GAHP 1M90O 3D7EO 4CEZA 3CCUN 2EX3A 5BREA 4PKIA 3AY9A 2Q2RA 5AQRA 1E4FT 1Q8IA 4DV7K 1TUUA 3HYFA 5J1EA 4A59A 5FDLA 2FSKA 2ZQBA 1U47A 1P8ZA 1P90A 5J2PA 4DV0K 3SUQA 3NF9A 1U45A 4DR2K 1ZYQA 5C0YA 2UUCK 4FVUA 1JLCA 4BRQA 1SAZA 5DM6L 2JGUA 3VQ9A 4DFJA 3MN6A 3MX5A 4YOUA 3MXMA 3JXUA 3QICA 3A5LC 3D0PA 2VGNA 1N6QA 2HF3A 4XIUA 1XHXA 3U9ZA 1IKVA 4BRIA 3WNHA 2ZD1A 4BC3A 1DKGD 1WSFA 4XH4A 1Q82O 2FBXA 4H5RA 3K0SA 4CZMA 2G8FA 4PUOA 5I9EB 1VQON 3DRRA 4LSNA 4AILC 2XRIA 5AR0A 1K6YA 1R0AA 3SK3A 5A2QO 2EHGA 1C0UA 2ASPA 3AVLA 3THWA 4DKWA 5T7BA 1D8YA 3OS0A 2E2NA 5B8HA 3BP8A 4X64K 3AVGA 4FM1A 2W42A 2HBLA 5EVZA 3TABA 1BGXT 1S1XA 4AHTA 4K8ZA 3OW2M 3TR8A 4YHHK 4CZIA 4AF1A 1NK4A 2G8KA 1CZ9A 3OS1A 4HTUA 5HL7L 4JV5K 1VSFA 4DB3A 1O13A 2RKIA
chains in the Genus database with same CATH topology
2VYPA 4JD2B 1JCFA 4BQZA 3CETA 1RGIA 2F9TA 3QDKA 5M1FA 4YOWA 3VPZA 1GLAG 4WF9L 4BRPA 3CCRN 3R1XA 3ID8A 1VQ8N 3MN5A 3FFKB 5KPTA 4H0YB 2J4RA 4C1NI 5GIOA 3CD6N 2IVPA 1NM1A 1KAZA 4CZHA 5KQ8A 3ULEB 2NRHA 5HOOA 4H0VB 3SMSA 3H6EA 4QS9A 3O4WA 4XH5A 1HKBA 4BRMA 2P9PB 3MWPA 3EE9A 3TPQA 4H0OA 3FR0A 4AM6A 5JVHL 4YDUC 2QW9A 4A2AA 3FLCO 3VTHA 2QWOA 1YJ9N 1NBWA 2CGJA 2A40A 1NLVA 4ISFA 3D2EA 2WC9A 3IDHA 3PLAA 4PHTX 3LM2A 3OBWA 1MWMA 4FWMA 4YOVA 5AQVA 1U6ZA 3P31A 5E84A 4A5BA 4WCEL 3WEEA 4EHUA 5AQJA 3QB0A 4CZKA 1VQKN 4JKDA 2IVNA 2E2PA 1QQOA 3TSUA 5EY4A 2RHKA 2QWMA 1LOTB 4U67L 4H5NA 5C15A 5F2RA 2YHYA 3WXJA 3G71N 3HI0A 2QA4N 3K9KA 4K42A 3IFRA 2FXUA 3K9JA 2E88A 4KH6A 2GWKA 4PL7A 3O9SA 5GIPA 3E9LA 1HUXA 4WQ5C 2E2QA 2P9IA 1DT9A 4BG9A 1GLLO 3VEWA 2A3ZA 2H3GX 2HMPA 5AQSA 3TTFA 2HBKA 3SLCA 2HBMA 5BPLA 3P38A 2V51B 5H1SQ 3HOSA 1WOQA 2PFUA 1YI2N 4JK9A 1KAXA 3MMVA 2P9LA 5JLHA 3M3ZA 1ESVA 2CGKA 4B1UB 3CF5L 4JEPA 4F9OA 4ILJA 1W97L 4MDAA 4H03B 3ZX2A 3EL2A 3ENOA 3UKRB 4RWTA 3LM9A 3VOVA 5BRDA 4BC4A 3SJHA 2I7PA 3ZETB 5E26A 1BO5O 4K43A 3QBXA 1VQMN 3FZFA 4FWNA 5C2FA 4A61A 3CC4N 3VTIA 3S41A 3T69A 5CR4A 1VQ7N 1IG8A 3WXLA 5FPEA 2P9NB 2ZF5O 2QWLA 2BH1A 3WEEB 1QQMA 5BRFA 2AP1A 3RSEA 3WQTA 2WUSA 4Z94A 3SAFA 1K8AO 3U4LA 4O5FA 1DEJA 5TKWA 4LC9B 3C0BA 5EOYA 2V7ZA 3SAGA 4BQLA 4JKHA 1KAYA 1TYQA 5AQNA 4BC5A 5JLFA 4OPAA 4H0TB 2KLAA 3AAPA 3P39A 3MK6A 3LDQA 3OHRA 4FWLA 4FPBA 1YIJN 3O5BA 4IFEA 3VEVA 4BGAA 4CZJA 1NGDA 3BF1A 5FPDA 5JICA 3KWIA 1C0FA 3CQYA 1ZC6A 3SBGA 1HJOA 3A5NC 4WFBL 4DQ8A 1RDUA 4CBXA 4JKBA 3A0IX 4JKEA 1MWKA 3GBTA 2QEXN 4JKAA 1YVNA 2FF3B 2ITMA 3TTCA 5AQLA 1Z6RA 2Q97A 3MCPA 2D1KA 3ZX3A 2A42A 2P9LB 4ISEA 3C6AA 1U2VA 2QWRA 4FOIA 1ZXOA 4B1VA 4BC2A 3BEXA 3LDNA 3HRGA 1S3XA 4B9QA 5AFUA 3VEZA 4XEIA 1GLEG 3O9QA 3UB5A 4GV6A 4B1ZA 3T7ZA 3VETA 1BA0A 3WUHA 4CD1A 2GTDA 5M1NA 1HKGA 1KQSM 3HZ6A 3MX2A 3VERA 4FWPA 5AZIA 1VQ4N 2ZGZA 1BDGA 4B1WB 3TSQA 1X3MA 3EZWA 3VGLA 5AQOA 1YAGA 2HOEA 4BR7A 3RSEB 1HKCA 1T6CA 4YOTA 3TSPA 1NGIA 5GAEP 4ILHA 3SAHA 2I7NA 4FWKA 2GEMA 1TYQB 4PKGA 4CZFA 4YOYA 4H5WA 2E1ZA 2OANA 4H0PA 2IIRA 5FPNA 3ENBA 2NRZA 3OA9A 1WUAA 2E2OA 3P4IA 4G9ZA 3O9TA 2QWQA 3O80A 4O8KA 2NRRA 4IEEA 1OVYA 4ISGA 1K73O 3WXKA 5CHIA 2V52B 4BRHA 2PBDA 5GAGP 3FZMA 2WFBA 3VEYA 3C6HA 3KK7A 4IOCL 1VQ9N 3GOIA 1XUPO 2FLOA 1JCGA 1NGHA 1N8RO 2D4WA 3DXKA 4M7YA 2PAVA 4FL9A 4KH4A 1GLCG 4HWIA 1HLUA 3VF2A 4JHDA 2NRVA 2GWJA 3F5TA 3O1BA 4RCHA 1ATNA 4NB4A 2D0PA 3F9MA 1KC8O 2P9UA 2HSTA 1QVGM 1U2VB 3KWGA 5MLCQ 2UYTA 5M1OA 1RDWX 3CPEA 3KVGA 3H3NO 3BF3A 1VQ5N 1NGGA 5AQYA 3M5RA 4JN4A 1CZAN 1D4XA 4JKCA 4FSVA 3R3LA 3R9PA 3I33A 3TU5A 3CMEN 4IWVA 2JWLA 4IOXA 5AZIB 4WQ4A 1T6DA 3VF4A 4CBUA 5TKYA 1NGJA 3H1VX 1T44A 1HPMA 1EQYA 1C0GA 3QFPA 3WXIA 3A5OC 5C2DA 5EX5A 2RE2A 4FPAA 4OPHA 5AFUH 5LY3A 1S72N 3HSCA 3U9DA 4WFNL 4RTFD 5BRHA 1R59O 4ILGB 3FZKA 1YUWA 5LJVA 4H0XB 4O8UA 2P9KA 3HM8A 3M1FA 5AQKA 1BA1A 2QM1A 4E1JA 3WQUA 1NGBA 3Q7BA 1QZ6A 3ATUA 5C10A 2EWSA 3LL3A 3ENHA 3I56N 3A5MC 4BRKA 2GX9A 2NNWA 2QTDA 2ASMA 3I8BA 3SBTA 2CH6A 1XQSC 1NWKA 3R6MA 4GY2B 2YJEA 4BROA 1X9JA 4BRCA 3DXKB 1ATSA 4JKFA 5JMVA 5ADXA 1BG3A 3EN9A 1YITN 3QFUA 4IEIA 1V4SA 3D2EB 3PIOL 3DWLA 4JHDB 4IJAA 5KPZA 2BUPA 3H46O 2P9UB 5M1QA 5BPNA 1MDUB 4BR2A 3VF6A 1X3NA 5AQPA 5BPMA 1YF5L 3AGRA 5AQZA 1JCEA 3N4QA 2ZWHA 1Q18A 3DXMA 3DLLL 1BU6O 3LDOA 4R79A 3G25A 1XC3A 3H45C 4EHTA 3J7ZO 3O6WA 3UE5A 4OO1J 2KHOA 1SZ2A 1E4GT 4FWSA 4JNEA 4KBOA 3L4QA 3G4SN 4A57A 4MLEA 5AQGA 4BR9A 1QVFM 5M1PA 3NVKA 2P9SA 3J8AA 4I6MA 2WBNA 5F0XA 2P9IB 3CJBA 3DAWA 5KQDA 4EFHA 3AARA 3W0LA 5BN8A 3L0QA 1GLJO 2CH5A 1Q81O 3VMFB 4GV9A 3F2KA 3C65A 3QBWA 4CZGA 3FGUA 3L6QA 4GVEA 3DJCA 2VWBA 4BRNA 1K8KA 4KH5A 4NLBA 2GELA 4QS8A 5AQQA 4MO5A 2OTJN 3CHWA 3MWTA 4JKGA 4BRLA 3LDLA 3LDPA 5BR9A 3RVCA 3ZEUA 1NJIO 4IOAL 1RFQA 2ZJRL 4BRGA 3WT0A 1Q86O 4PKHA 2Q1NA 4MO4A 3O1WA 4WQ4C 1ILYA 4YORA 3M6GA 1SQKA 3ATVA 4CBWA 1Q7YO 3HOTA 3EE8A 2E20A 4BVOA 4CI6A 5CE3A 4DCHA 3C7NA 4JK7A 3W3DA 4BREA 1G99A 4BRAA 4IDHA 3R8EA 2QXLA 3L4IA 1EO1A 3IKMA 3CC7N 2FSJA 4K41A 5ADXH 2W40A 4FO0A 3DXMB 3D2FA 3O9RA 3A8YA 3CJCA 3H3OB 5GINA 2IVOA 4JAXA 3CCSN 3CC2N 5DM7L 1V4TA 4GNIA 2OTLN 3UKUA 1QQNA 3AGKA 4Y0WA 1BOTO 3GL1A 3IMXA 4B1XB 2P9SB 4BRDA 3O08A 3CCJN 3ZX0A 4I6MB 5F1XA 4UY8O 3O8MA 4MLHA 5BN9A 5AZJA 1BUPA 3U8XA 4BVPA 3O9UA 3Q7CA 2FF6A 4BGBA 2ZJPL 2YJFA 3MN9A 1K8KB 3IUCA 4M7XA 4WFAL 3EKSA 3VGKA 3CJ1A 4C23A 1YJWN 4HTLA 4JKGB 3TTDA 2E8AA 4AM7A 1NGFA 2KKZA 4BR4A 4YOXA 3CI5A 3ZEUB 3HTVA 1W2BM 3SMPA 3GE1A 4XH1A 1VQPN 2VCPA 3UKRA 2AA4A 2HBJA 4DHYA 1NGCA 4CJ7A 3G6EN 1S22A 3MDQA 3ZETA 2NRTA 4L3QA 5FPMA 2HF4A 5JVGL 3C7NB 3FZHA 4EIAA 1ATRA 4BY9C 3HBTA 1VQLN 2Q0RA 3EO3A 4C1NK 1GLBG 1NGAA 3BUZB 3JS6A 3H1QA 5AQTA 3MN7A 4B1YB 5AQUA 3NVMA 2A5XA 4FWOA 4H5TA 2P9NA 3AAQA 3D2FB 1DGKN 3MCAB 3CCEN 3GDQA 3VENA 1M90O 5GAHP 3D7EO 2NZTA 3N4PA 5AQIA 3CCUN 2ASOA 2DPNA 3UKUB 1IJJA 4MDBA 5BREA 4PKIA 3AY9A 1J6ZA 3QMLA 2YCHA 5LJWA 3ID6A 4QS7A 2NRXA 1VAZA 2Q2RA 5AQRA 1E4FT 4CZLA 3VEOA 3VEXA 3CIPA 4BRFA 3CXCM 1TUUA 1M1KO 1Z05A 4NLCA 5AZJB 4A59A 2FSKA 3ZYYX 2NLXA 1P8ZA 1P90A 5AQXA 4IO8A 1VQNN 1YXQA 3CPWM 1QZ5A 1NGEA 3CJ7A 4H5VA 4CD3A 2A41A 1JJ2M 3I55N 4A5AA 5C0YA 1T3VA 3E9OA 1GLDG 4FVUA 4BRQA 2CGLA 3CMAN 1Y64A 1SAZA 3FE1A 5DM6L 4WYBA 4J8FA 4FOEA 3CCMN 3GG4A 1MA9B 3MN6A 1H1VA 3MX5A 4IZ9A 4YDUA 1TUYA 4YOUA 4NO7A 5AQWA 2A6AA 3B8AX 3JXUA 3QICA 1HX1A 3A5LC 4IJNA 4PL8A 3KHYA 1GLFO 2VGNA 2JWKA 2D0OA 3WXMB 2HF3A 2GUPA 1BWFO 2ZGYA 1K9MO 1OKJA 3U9ZA 3D6RA 4BRIA 4JD2A 4BR0A 2F9WA 2V7YA 4BC3A 4EAHD 2E1YA 1DKGD 2YHWA 1ZBSA 1LCUA 2P9KB 3CCQN 4XH4A 1Q82O 3KZBA 3OBYA 5AQFA 4IXCA 3CCVN 5KPRA 2Q36A 2W41A 3E1YA 5M1KA 1KD1O 4H5RA 2YHXA 3CERA 3ULEA 4CZMA 4FWRA 3VESA 2VGMA 5I9EB 2P9PA 3CQXA 4IO9L 1VQON 2QI2A 2QWNA 5ELZA 5AR0A 4BG8A 4U7BA 2ZJQL 1YJNN 1KXPA 1VQ6N 3SK3A 5AQHA 2ASPA 5AQMA 4A2BA 5C12A 4CZEA 4DKWA 3CJ9A 2QWPA 3PIPL 1QHAA 4JK8A 2E2NA 4WQ5A 3FZLA 5B8HA 4FWQA 3BP8A 2FSNA 3CJAA 2HBLA 1NMDA 5EVZA 5GADP 4K25A 2NRWA 3E9PA 4M63C 3OW2M 4CZIA 2Q0UA 4AF1A 3NMUA 3CCLN 4GV3A 2YI1A 2F7TA 2YX6A 3EKUA 5HL7L 1YHQN 3VGMA 4BR5A 1SS6A 4DB3A 2Q31A 1O13A 5EXWA 2BTFA 4A62A 3E66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYP A;  4JD2 B;  1JCF A;  4BQZ A;  3CET A;  1RGI A;  2F9T A;  3QDK A;  3VPZ A;  1GLA G;  4BRP A;  3ID8 A;  3MN5 A;  3FFK B;  5KPT A;  4H0Y B;  2J4R A;  2IVP A;  1NM1 A;  1KAZ A;  4CZH A;  5KQ8 A;  3ULE B;  2NRH A;  4H0V B;  3SMS A;  3H6E A;  4QS9 A;  3O4W A;  4XH5 A;  1HKB A;  4BRM A;  2P9P B;  3TPQ A;  4H0O A;  3FR0 A;  4AM6 A;  4YDU C;  2QW9 A;  4A2A A;  3FLC O;  2QWO A;  1NBW A;  2CGJ A;  2A40 A;  1NLV A;  4ISF A;  3D2E A;  3IDH A;  3LM2 A;  1MWM A;  4FWM A;  5AQV A;  1U6Z A;  5E84 A;  3WEE A;  4EHU A;  5AQJ A;  3QB0 A;  4CZK A;  2IVN A;  2E2P A;  1QQO A;  5EY4 A;  2QWM A;  1LOT B;  4H5N A;  5F2R A;  2YHY A;  3WXJ A;  3HI0 A;  4K42 A;  3IFR A;  2FXU A;  2E88 A;  2GWK A;  4PL7 A;  1HUX A;  4WQ5 C;  2E2Q A;  2P9I A;  4BG9 A;  1GLL O;  3VEW A;  2A3Z A;  2H3G X;  2HMP A;  5AQS A;  3SLC A;  5BPL A;  2V51 B;  1WOQ A;  1KAX A;  3MMV A;  2P9L A;  5JLH A;  3M3Z A;  1ESV A;  2CGK A;  4B1U B;  4F9O A;  4H03 B;  3ZX2 A;  3EL2 A;  3ENO A;  3UKR B;  4RWT A;  3LM9 A;  3VOV A;  5BRD A;  4BC4 A;  3SJH A;  2I7P A;  3ZET B;  5E26 A;  1BO5 O;  4K43 A;  3QBX A;  3FZF A;  4FWN A;  4A61 A;  3S41 A;  1IG8 A;  3WXL A;  5FPE A;  2P9N B;  2ZF5 O;  2QWL A;  3WEE B;  1QQM A;  5BRF A;  2AP1 A;  3RSE A;  3WQT A;  2WUS A;  4Z94 A;  3U4L A;  4O5F A;  1DEJ A;  4LC9 B;  3C0B A;  5EOY A;  2V7Z A;  4BQL A;  1KAY A;  1TYQ A;  5AQN A;  4BC5 A;  5JLF A;  4H0T B;  3AAP A;  3MK6 A;  3LDQ A;  3OHR A;  4FWL A;  4FPB A;  3O5B A;  3VEV A;  4BGA A;  4CZJ A;  1NGD A;  3BF1 A;  5FPD A;  5JIC A;  1C0F A;  3CQY A;  1ZC6 A;  1HJO A;  3A5N C;  4DQ8 A;  4CBX A;  3A0I X;  1MWK A;  3GBT A;  1YVN A;  2FF3 B;  2ITM A;  5AQL A;  1Z6R A;  2Q97 A;  3MCP A;  2D1K A;  3ZX3 A;  2A42 A;  2P9L B;  4ISE A;  1U2V A;  2QWR A;  4FOI A;  1ZXO A;  4B1V A;  4BC2 A;  3BEX A;  3LDN A;  4B9Q A;  1S3X A;  5AFU A;  3VEZ A;  4XEI A;  1GLE G;  3UB5 A;  4B1Z A;  3VET A;  1BA0 A;  3WUH A;  4CD1 A;  2GTD A;  1HKG A;  3HZ6 A;  3VER A;  4FWP A;  5AZI A;  2ZGZ A;  1BDG A;  4B1W B;  1X3M A;  3EZW A;  3VGL A;  5AQO A;  1YAG A;  2HOE A;  4BR7 A;  3RSE B;  1HKC A;  1T6C A;  1NGI A;  2I7N A;  4FWK A;  2GEM A;  1TYQ B;  4PKG A;  4CZF A;  4H5W A;  2E1Z A;  2OAN A;  4H0P A;  2IIR A;  5FPN A;  1WUA A;  2E2O A;  3P4I A;  3O80 A;  2QWQ A;  4O8K A;  4ISG A;  3WXK A;  2V52 B;  4BRH A;  2PBD A;  3FZM A;  3VEY A;  3GOI A;  1XUP O;  2FLO A;  1JCG A;  1NGH A;  2D4W A;  3DXK A;  4M7Y A;  2PAV A;  4FL9 A;  1GLC G;  4HWI A;  1HLU A;  3VF2 A;  4JHD A;  2GWJ A;  3O1B A;  4RCH A;  1ATN A;  4NB4 A;  2D0P A;  3F9M A;  2P9U A;  1U2V B;  2UYT A;  1RDW X;  3KVG A;  3H3N O;  3BF3 A;  1NGG A;  5AQY A;  4JN4 A;  1CZA N;  1D4X A;  4FSV A;  3R9P A;  3I33 A;  3TU5 A;  4IWV A;  5AZI B;  4WQ4 A;  1T6D A;  3VF4 A;  4CBU A;  5TKY A;  1NGJ A;  3H1V X;  1T44 A;  1HPM A;  1EQY A;  1C0G A;  3QFP A;  3WXI A;  3A5O C;  5EX5 A;  4FPA A;  5AFU H;  5LY3 A;  3HSC A;  3U9D A;  4RTF D;  5BRH A;  1R59 O;  3FZK A;  1YUW A;  5LJV A;  4H0X B;  2P9K A;  3HM8 A;  3M1F A;  5AQK A;  1BA1 A;  2QM1 A;  4E1J A;  3WQU A;  1NGB A;  1QZ6 A;  3ATU A;  2EWS A;  3LL3 A;  3ENH A;  3A5M C;  4BRK A;  2ASM A;  3I8B A;  2CH6 A;  1XQS C;  1NWK A;  3R6M A;  4GY2 B;  2YJE A;  4BRO A;  1X9J A;  4BRC A;  3DXK B;  1ATS A;  5JMV A;  5ADX A;  1BG3 A;  3EN9 A;  3QFU A;  1V4S A;  3D2E B;  3DWL A;  4JHD B;  4IJA A;  5KPZ A;  2BUP A;  3H46 O;  2P9U B;  5BPN A;  1MDU B;  4BR2 A;  3VF6 A;  1X3N A;  5AQP A;  5BPM A;  5AQZ A;  1JCE A;  2ZWH A;  1Q18 A;  3DXM A;  1BU6 O;  3LDO A;  3G25 A;  1XC3 A;  3H45 C;  4EHT A;  3O6W A;  3UE5 A;  2KHO A;  1SZ2 A;  1E4G T;  4FWS A;  4JNE A;  4KBO A;  4MLE A;  5AQG A;  4BR9 A;  2P9S A;  3J8A A;  4I6M A;  5F0X A;  2P9I B;  3CJB A;  3DAW A;  5KQD A;  4EFH A;  3AAR A;  3W0L A;  5BN8 A;  3L0Q A;  1GLJ O;  2CH5 A;  3QBW A;  4CZG A;  3FGU A;  3L6Q A;  3DJC A;  2VWB A;  4BRN A;  1K8K A;  4QS8 A;  2GEL A;  5AQQ A;  4MO5 A;  3CHW A;  4BRL A;  3LDL A;  3LDP A;  5BR9 A;  3ZEU A;  1RFQ A;  4BRG A;  3WT0 A;  4PKH A;  2Q1N A;  4MO4 A;  3O1W A;  4WQ4 C;  3M6G A;  1SQK A;  3ATV A;  4CBW A;  2E20 A;  4BVO A;  4CI6 A;  5CE3 A;  4DCH A;  3C7N A;  3W3D A;  4BRE A;  1G99 A;  4BRA A;  3R8E A;  2QXL A;  3L4I A;  2FSJ A;  4K41 A;  5ADX H;  2W40 A;  4FO0 A;  3DXM B;  3D2F A;  3A8Y A;  3CJC A;  3H3O B;  2IVO A;  4JAX A;  1V4T A;  4GNI A;  3UKU A;  1QQN A;  4Y0W A;  1BOT O;  3GL1 A;  3IMX A;  4B1X B;  2P9S B;  4BRD A;  3O08 A;  3ZX0 A;  4I6M B;  5F1X A;  3O8M A;  4MLH A;  5BN9 A;  5AZJ A;  1BUP A;  3U8X A;  4BVP A;  2FF6 A;  4BGB A;  2YJF A;  3MN9 A;  1K8K B;  3IUC A;  4M7X A;  3EKS A;  3VGK A;  3CJ1 A;  4C23 A;  4HTL A;  2E8A A;  4AM7 A;  1NGF A;  4BR4 A;  3CI5 A;  3ZEU B;  3HTV A;  3SMP A;  3GE1 A;  4XH1 A;  2VCP A;  3UKR A;  2AA4 A;  4DHY A;  1NGC A;  4CJ7 A;  1S22 A;  3MDQ A;  3ZET A;  4L3Q A;  5FPM A;  2HF4 A;  3C7N B;  3FZH A;  4EIA A;  1ATR A;  3HBT A;  3EO3 A;  2Q0R A;  1GLB G;  1NGA A;  3BUZ B;  3JS6 A;  3H1Q A;  5AQT A;  3MN7 A;  4B1Y B;  5AQU A;  2A5X A;  4FWO A;  4H5T A;  2P9N A;  3AAQ A;  3D2F B;  1DGK N;  3GDQ A;  3VEN A;  3D7E O;  2NZT A;  5AQI A;  2ASO A;  2DPN A;  3UKU B;  1IJJ A;  5BRE A;  4PKI A;  3AY9 A;  1J6Z A;  3QML A;  2YCH A;  5LJW A;  4QS7 A;  2Q2R A;  5AQR A;  1E4F T;  4CZL A;  3VEO A;  3VEX A;  3CIP A;  4BRF A;  1TUU A;  1Z05 A;  5AZJ B;  2FSK A;  2NLX A;  1P8Z A;  5AQX A;  4IO8 A;  1YXQ A;  1QZ5 A;  1NGE A;  3CJ7 A;  4H5V A;  4CD3 A;  2A41 A;  1GLD G;  4BRQ A;  2CGL A;  1Y64 A;  1SAZ A;  3FE1 A;  4WYB A;  4J8F A;  4FOE A;  3GG4 A;  1MA9 B;  3MN6 A;  1H1V A;  4IZ9 A;  4YDU A;  1TUY A;  5AQW A;  4NO7 A;  2A6A A;  3B8A X;  3JXU A;  3QIC A;  1HX1 A;  3A5L C;  4IJN A;  4PL8 A;  3KHY A;  1GLF O;  2D0O A;  2HF3 A;  2GUP A;  1BWF O;  2ZGY A;  1OKJ A;  3U9Z A;  4BRI A;  4JD2 A;  4BR0 A;  2F9W A;  2V7Y A;  4BC3 A;  4EAH D;  2E1Y A;  1DKG D;  2YHW A;  1ZBS A;  1LCU A;  2P9K B;  4XH4 A;  3KZB A;  5AQF A;  4IXC A;  5KPR A;  2Q36 A;  2W41 A;  4H5R A;  2YHX A;  3CER A;  3ULE A;  4CZM A;  4FWR A;  3VES A;  5I9E B;  2P9P A;  3CQX A;  4BG8 A;  2QWN A;  5ELZ A;  5AR0 A;  1KXP A;  3SK3 A;  5AQH A;  2ASP A;  5AQM A;  4A2B A;  4CZE A;  3CJ9 A;  2QWP A;  1QHA A;  4WQ5 A;  2E2N A;  3FZL A;  5B8H A;  4FWQ A;  3BP8 A;  2FSN A;  3CJA A;  1NMD A;  5EVZ A;  4K25 A;  4M63 C;  4CZI A;  2Q0U A;  2YI1 A;  3EKU A;  3VGM A;  4BR5 A;  4DB3 A;  2Q31 A;  5EXW A;  2BTF A;  4A62 A; 
#chains in the Genus database with same CATH topology
 4LF8 K;  4PWD A;  1VQ8 N;  3VPZ A;  2KTQ A;  4E0D A;  1KFS A;  3CYM A;  2PYJ A;  1HKB A;  1A5W A;  4J2A A;  3SYZ A;  4AM6 A;  1IG9 A;  5C24 A;  4YDU C;  1SL1 A;  3THW B;  5FRM A;  3VQQ A;  3FLC O;  3VTH A;  1NBW A;  3M8R A;  3SZ2 A;  3IDH A;  4E89 A;  3OS2 A;  1RDC A;  4FWM A;  4N76 A;  5AQV A;  5E84 A;  1XMO K;  4JKD A;  2IVN A;  3I0S A;  4DSF A;  1QQO A;  1BQM A;  1NKB A;  4GW6 A;  1HNI A;  2RHK A;  2QWM A;  4U67 L;  3O4N A;  1FKO A;  2QA4 N;  3K9K A;  4OVL A;  3K9J A;  3VQB A;  3SUN A;  4PL7 A;  3EZ5 A;  1G15 A;  3QLH A;  5GIP A;  4CJ3 A;  1ITG A;  3L3U A;  4C8M A;  1J53 A;  4EP5 A;  3TAG A;  4BG9 A;  3G10 A;  4CER A;  1TAU A;  1GLL O;  3LP0 A;  4I7F A;  3TTF A;  2IGI A;  2HBK A;  4M42 A;  4DQR A;  4KB1 A;  2V51 B;  4EP4 A;  5H1S Q;  3HOS A;  4DTU A;  1KAX A;  4M3U A;  1ESV A;  3AVK A;  4JEP A;  4ILJ A;  1C1A A;  3ZX2 A;  3VOV A;  4RW7 A;  5BRD A;  4BC4 A;  4DTM A;  3ZET B;  4FJI A;  1ZBU A;  3J7Y P;  1VQM N;  1TL1 A;  2OPS A;  5CR4 A;  1IG8 A;  2HVI A;  2P9N B;  2O8E A;  2ZF5 O;  3WQT A;  4Z94 A;  2X6N A;  2Z1I A;  3HP9 A;  5EOY A;  3SQ0 A;  4LF9 K;  2W6L A;  4G1Q A;  4V19 S;  5JLF A;  4W5N A;  1Q9Y A;  3AAP A;  3K5O A;  4N5S A;  3SI6 A;  2IOC A;  4CZJ A;  1NGD A;  5JIC A;  3A5N C;  4IKF A;  3NGZ A;  3A0I X;  4JKE A;  2FF3 B;  3RR7 A;  1NG9 A;  1YTU A;  3HPH A;  3S3M A;  1KRP A;  3C6A A;  1YT3 A;  3IS9 A;  4B8A B;  3PX0 A;  4DTN A;  4B1V A;  4CGF A;  1J5E K;  3LDN A;  3HRG A;  4W5T A;  1GLE G;  3VET A;  5M1N A;  3VER A;  5AZI A;  3V1R A;  4B1W B;  1RBR A;  2O8E B;  1OH5 A;  3DI6 A;  4Z4H A;  3OYA A;  1NGI A;  4FJN A;  4CCH A;  4FWK A;  2GEM A;  4CZF A;  4X62 K;  2Q3S A;  2B4J A;  2IIR A;  3OA9 A;  4MQ3 A;  1LV5 A;  3L2R A;  4O8K A;  3OYM A;  4IEE A;  1JXB A;  2PBD A;  2PY5 A;  3PX6 A;  1VQ9 N;  1C1C A;  2FLO A;  1NGH A;  2D0B A;  2OPR A;  4GMJ B;  3KK3 A;  3KK2 A;  1SV5 A;  1QSL A;  2KFN A;  4CK1 A;  1YTA A;  4I9Q A;  1GLC G;  4FZY A;  1HLU A;  1T8E A;  4LF7 K;  3O1B A;  3S3O A;  2IAJ A;  1NOZ A;  2P9U A;  2E4L A;  4KTQ A;  5M1O A;  3A2F A;  3M8S A;  4CE9 A;  3R3L A;  4O0J A;  4DU1 A;  4DU4 A;  3SNN A;  4FZZ A;  4H4O A;  5AZI B;  1T6D A;  4CBU A;  1NGJ A;  2W6K A;  1IKX A;  1EQY A;  1HYS A;  2RE2 A;  4FPA A;  4C8K A;  2HW3 A;  3U9D A;  5BRH A;  3T3F A;  1IH7 A;  4EZ9 A;  1WN7 A;  1YUW A;  1OVQ A;  1LWC A;  1B9D A;  2P9K A;  1C0T A;  4E1J A;  5HRO A;  5KRS A;  4F3T A;  3A5M C;  2QTD A;  1GOB A;  2ASM A;  3TAQ A;  1BI4 A;  1XQS C;  4GY2 B;  4FM0 A;  1X9J A;  1BIU A;  1ATS A;  1VSD A;  4JKF A;  5JMV A;  1WSE A;  4OPJ A;  4IEI A;  3D2E B;  4IJA A;  4FW2 A;  4CHN A;  4LFC K;  5LMN K;  1ZBI A;  2P9U B;  5BPN A;  5JS1 A;  5BPM A;  1JXE A;  3QIO A;  3N4Q A;  1CXQ A;  2ZWH A;  3QER A;  4EHT A;  1T05 A;  4KBO A;  2GUI A;  3JAM O;  3G4S N;  2A1R A;  3AV9 A;  2UUA K;  4MLE A;  4M3W A;  5K14 A;  1QVF M;  3NVK A;  2WBN A;  5F0X A;  5KQD A;  1X9M A;  3AAR A;  1SKW A;  1GLJ O;  2CH5 A;  1Q81 O;  4JRP A;  4B9T A;  1C0M A;  3OYK A;  3RRH A;  4MO5 A;  3ZT0 A;  1JLG A;  5BR9 A;  1BI4 B;  1NJI O;  4IOA L;  4YFU A;  4FJ5 A;  1RFQ A;  3ZSY A;  3LPU A;  4DTP A;  4BRG A;  4PKH A;  2Q1N A;  1RBT A;  3O1W A;  4WQ4 C;  3DLR A;  1SKR A;  3M6G A;  2HNY A;  3ATV A;  1Q7Y O;  3HOT A;  3EE8 A;  4YNQ A;  3I8D A;  4IDH A;  2QKK A;  4DFK A;  3PUF A;  2FSJ A;  4C8O A;  4FO0 A;  3D2F A;  2BDP A;  1VRU A;  2IVO A;  4B9S A;  4JAX A;  3CCS N;  1Q9X A;  5DM7 L;  1W0H A;  1QQN A;  4Y0W A;  4CJP A;  3GL1 A;  4DV3 K;  4BRD A;  4DTS A;  3PV8 A;  1L5U A;  5F1X A;  1FJG K;  3ZSZ A;  4UY8 O;  3O8M A;  3O9U A;  4NXM K;  4DSE A;  3L8B A;  4JI3 K;  2FF6 A;  4Q5V A;  4M41 A;  4BGB A;  3VQ7 A;  4M7X A;  2G8W A;  3DRS A;  3VGK A;  4HTL A;  2VG6 A;  2XHB A;  2E8A A;  2WON A;  3HTV A;  1JL2 A;  3QEX A;  1TKT A;  2UU9 K;  3AA2 A;  3GE1 A;  1TK5 A;  4JI1 K;  2VCP A;  1HQE A;  4DHY A;  1QQC A;  5IWA K;  2HNZ A;  3MDQ A;  2NRT A;  3DM2 A;  1KLM A;  1W9H A;  2Q0R A;  3EO3 A;  2OYQ A;  3DOK A;  3JS6 A;  1D9F A;  4Z4I A;  4UQG A;  3THY A;  3NVM A;  4FWO A;  1KVB A;  3D2F B;  1LAV A;  4DV5 K;  4CJQ A;  3VEN A;  3N4P A;  5AQI A;  3RRG A;  2ASO A;  3QML A;  2YCH A;  3ID6 A;  2JLE A;  3CXC M;  4CZL A;  3VEO A;  1JLE A;  3CIP A;  1M1K O;  1Z05 A;  3BZC A;  4NLC A;  1S6Q A;  2VQF K;  1N33 K;  1YXQ A;  1TKD A;  1QZ5 A;  1NGE A;  2D0C A;  4A5A A;  4IBN A;  3E9O A;  4FCY A;  4BDP A;  3J7A P;  3FE1 A;  4HUE A;  3UIQ A;  4KI4 A;  4J8F A;  1MA9 B;  3B8A X;  4PL8 A;  1I94 K;  1HX1 A;  2XO7 A;  4BDZ A;  1S1T A;  1GLF O;  4Z4G A;  5DK5 A;  1BWF O;  3G0Z A;  5IT9 O;  1FKP A;  3D6R A;  4JD2 A;  4FXD A;  3OTO K;  2F9W A;  2E1Y A;  2YHW A;  3V9W A;  3ASM A;  4Z4C A;  3OBY A;  5KGW A;  4IXC A;  1KD1 O;  3EYZ A;  4NCB A;  2VWK A;  3PSF A;  3B6P A;  3CER A;  3ULE A;  2VGM A;  4IO9 L;  2P9P A;  1HYZ A;  3CQX A;  4BG8 A;  1YJN N;  4ELT A;  1KXP A;  2BGG A;  3CQ8 A;  3VQC A;  1VHX A;  4DR4 K;  3CJ9 A;  3PIP L;  1LWF A;  1QHA A;  4B3S K;  1S9G A;  1WB9 A;  3FZL A;  4O5B A;  1QSS A;  2FSN A;  3CJA A;  3VA0 A;  4OLA A;  1WLJ A;  1NMD A;  4K25 A;  3O3G A;  3NF7 A;  2NRW A;  3F73 A;  4CHQ A;  3E9P A;  4DTJ A;  4HCC A;  3O3F A;  1EX4 A;  3NMU A;  3CCL N;  1UAX A;  3NHG A;  2F7T A;  2YX6 A;  1YHQ N;  1WSJ A;  4J2E A;  4BR5 A;  4CEC A;  2O8C A;  4KHN A;  5EXW A;  3NDK A;  4O55 A;  3E66 A;  4JD2 B;  5FRO A;  3KD5 E;  3CET A;  3L2V A;  1RGI A;  2F9T A;  4RW6 A;  2ZM6 K;  5GIO A;  3TAR A;  3AVJ A;  4CZH A;  5KQ8 A;  3ULE B;  2YHB A;  5HOO A;  3H6E A;  4OGC A;  2P9P B;  1JLQ A;  1WBB A;  1HNX K;  3TPQ A;  1REV A;  2IDO A;  3FR0 A;  1RBS A;  2QW9 A;  3ZCM A;  4CED A;  3KK1 A;  3THV A;  2A40 A;  2WC9 A;  3PLA A;  3LM2 A;  4YOV A;  1U6Z A;  1IBL K;  1ASU A;  3HM9 A;  3WEE A;  5AQJ A;  3K59 A;  1D9D A;  3V1O A;  3IAY A;  3ALY A;  5CY4 A;  1LOT B;  4H5N A;  2FC0 A;  5F2R A;  2YHY A;  3WXJ A;  4CEB A;  3HK2 A;  4K42 A;  2E88 A;  4KH6 A;  1XI1 A;  3E9L A;  4YY3 K;  3T19 A;  4BE1 A;  2P9I A;  1DT9 A;  4CFB A;  2H3G X;  3NBP A;  3OYE A;  4CJ5 A;  1WOQ A;  2PFU A;  5HBM A;  4FJM A;  3M3Z A;  3CF5 L;  4F9O A;  1W97 L;  3EL2 A;  1WSI A;  2O8F A;  1KFD A;  2I7P A;  3VQ8 A;  4LF6 K;  1BO5 O;  1TGO A;  3QBX A;  1RT5 A;  3FZF A;  5C2F A;  3CC4 N;  1RT2 A;  4BWJ A;  4F4K A;  3S41 A;  2HHW A;  3SQ1 A;  1VQ7 N;  4B9N A;  3WEE B;  3QEW A;  1QQM A;  5HRN A;  2AP1 A;  2WUS A;  4O5F A;  1DEJ A;  3C0B A;  2P5G A;  4BQL A;  1TYQ A;  4BC5 A;  1Z26 A;  3L3V A;  2DFH A;  3AO2 A;  4CHP A;  3LDQ A;  4FPB A;  3O5B A;  4IFE A;  2O8B A;  4OLB A;  3BF1 A;  4NYN A;  1ASV A;  3KWI A;  3TAP A;  3SBG A;  1NKC A;  4DQ8 A;  1RDU A;  1TL3 A;  1BCM A;  1MWK A;  3GBT A;  4B3M K;  2F96 A;  2XY5 A;  2BAN A;  5AQL A;  3TTC A;  2Q97 A;  4ELU A;  3KLI A;  5LL6 Z;  4FLY A;  3RWU A;  4CF2 A;  3ZSX A;  3K5N A;  4CJV A;  3QO9 A;  1UA1 A;  1ZBH A;  2HHH K;  2QWR A;  2O4I A;  3VEZ A;  4XEI A;  3UB5 A;  3SQ2 A;  4B1Z A;  1BA0 A;  4E3S A;  4Z4F A;  1S1V A;  3WUH A;  4CD1 A;  2X6S A;  3AA5 X;  2GTD A;  1HKG A;  1VQ4 N;  3TSQ A;  3VQA A;  1X3M A;  3EZW A;  5AQO A;  3V1Q A;  2F8T A;  4JLH A;  4FJK A;  1B9F A;  5FRN A;  1TK0 A;  4YOY A;  1TYQ B;  4PKG A;  4CHO A;  4H5W A;  2E1Z A;  2OAN A;  4H0P A;  3K58 A;  3ENB A;  2NRZ A;  4CEA A;  1WUA A;  3P4I A;  4DWI A;  1L3V A;  4ISG A;  5GAG P;  2P5O A;  4DR6 K;  1J54 A;  3CM6 A;  3FZM A;  2LSN A;  2WFB A;  3HJF A;  3CFR A;  3GOI A;  1XUP O;  4DSL A;  3HXM A;  3DXK A;  4DQQ A;  5CYM A;  2PAV A;  3V9X A;  4IG3 A;  4QAG A;  3V4I A;  2D0P A;  4KRF A;  3NH0 A;  1QVG M;  3KWG A;  1U04 A;  2GBZ A;  3EEQ A;  4CJR A;  3CPE A;  3KVG A;  1NGG A;  5CYQ A;  4CGH A;  4JKC A;  4FSV A;  3I33 A;  1JLB A;  3CME N;  4DV6 K;  1FW6 A;  1NK9 A;  1E3M A;  3PO4 A;  3WXI A;  1LW0 A;  5C2D A;  5EX5 A;  5AFU H;  2HB5 A;  3LPT A;  5LY3 A;  1I39 A;  4RTF D;  4CEO A;  3FZK A;  4DS4 A;  4H0X B;  4CJU A;  3P83 D;  4JI8 K;  3ZLJ A;  4E19 A;  3M1F A;  4B9M A;  1BA1 A;  3WQU A;  1NGB A;  1QZ6 A;  5C10 A;  4E1M A;  1JKH A;  4BRK A;  2GX9 A;  3ZT3 A;  4KKO A;  4BRO A;  4BRC A;  3DXK B;  1BG3 A;  1YIT N;  3AVA A;  3DWL A;  2O4G A;  5KPZ A;  3H46 O;  4DTX A;  5M1Q A;  1MDU B;  4BR2 A;  4JI0 K;  4CGD A;  3OYB A;  4DQI A;  3HST B;  1Q18 A;  3AA4 A;  3DXM A;  3LDO A;  2OA8 A;  4ID5 A;  3T1A A;  3LP3 A;  5HRP A;  3QNN A;  3F9K A;  2KHO A;  3DLB A;  2DFE A;  1TV6 A;  4A57 A;  4OPK A;  2YNG A;  3SPY A;  4I6M A;  1UA0 A;  3W0L A;  5BN8 A;  3PX4 A;  3VMF B;  4GV9 A;  2Z1H A;  4CIE A;  1NKE A;  2OZS A;  4BRN A;  1K8K A;  4DQS A;  4KH5 A;  4QS8 A;  3VQ5 A;  3LDS A;  3QEV A;  4LFA K;  3CHW A;  3MWT A;  4JKG A;  4BRL A;  2P1J A;  4DTO A;  3LDL A;  2AJQ A;  2WOM A;  1XMQ K;  2Y1I A;  1X9S A;  3MXI A;  1NU0 A;  3NF8 A;  4JI7 K;  4MO4 A;  1TVR A;  4YOR A;  4CK3 A;  3L2W A;  1OH8 A;  3QIP A;  3LP1 A;  5CE3 A;  1QE1 A;  2RF2 A;  4N56 A;  3VQE A;  3L4I A;  4FLT A;  4FLZ A;  3IKM A;  3CC7 N;  4FLU A;  1VSK A;  2W40 A;  5ADX H;  3DXM B;  3O9R A;  3A8Y A;  3H3O B;  5C42 A;  3SUP A;  5I3U A;  1WAJ A;  3UKU A;  3AGK A;  3TAN A;  4B1X B;  4OX9 K;  3QEI A;  1QHT A;  3CCJ N;  4I6M B;  5SWM A;  5BN9 A;  3LAN A;  5AZJ A;  4M3X A;  3HO1 A;  4ZTJ A;  2ZJP L;  2KZM A;  3MN9 A;  1K8K B;  3IUC A;  4B8C A;  1NK7 A;  3TAM A;  4JKG B;  1NGF A;  4YOX A;  3CI5 A;  1W2B M;  3RMB A;  2UXB K;  3U3Y A;  3SMP A;  3AVM A;  2YKM A;  3UKR A;  4C8L A;  1I3A A;  4CJ7 A;  4DR5 K;  3OYI A;  2HF4 A;  3FZH A;  1GOA A;  4C1N K;  3BUZ B;  3H1Q A;  5AQT A;  4B1Y B;  2VWJ A;  3FFI A;  2A5X A;  1DGK N;  1BHL A;  4AHC A;  2E5L K;  4W5O A;  2NZT A;  1Z25 A;  4B3R K;  3UKU B;  4MDB A;  4AH9 A;  2B5J A;  4M3T A;  2NRX A;  2BE2 A;  3AVF A;  4DV1 K;  3H08 A;  4B9L A;  2QKB A;  2DY4 A;  1VSE A;  3THX A;  1DTT A;  5AZJ B;  3VA3 A;  3ZYY X;  4LF5 K;  4ZHR A;  4IO8 A;  2HVH A;  4FJX A;  1J9A A;  2A41 A;  1JJ2 M;  3I55 N;  3KJV A;  1T3V A;  1GLD G;  1A5V A;  3CMA N;  1Y64 A;  2G8U A;  2G8H A;  1S6P A;  4WYB A;  2HHU A;  4FOE A;  4CJS A;  3QIN A;  4NO7 A;  2A6A A;  2FBV A;  4IJN A;  3KHY A;  4DU3 A;  2JWK A;  2GUP A;  4HCB A;  4KB0 A;  1W7A A;  3SV4 A;  2V7Y A;  2YHA A;  2P9K B;  3CCQ N;  1JL1 A;  2HND A;  1RIL A;  4C8N A;  4DUY K;  3E1Y A;  4CJL A;  2YHX A;  3VN5 A;  1KSP A;  4FWR A;  1HNW K;  2QI2 A;  2ZJQ L;  5ELZ A;  3OYC A;  3THX B;  1TKX A;  3HPO A;  3P5J A;  1WNS A;  5AQM A;  3BDP A;  4LF4 K;  2QWP A;  3LAM A;  3OJS A;  4H4M A;  4WQ5 A;  3WNF A;  4CFC A;  3TWH A;  2Z1G A;  4FWQ A;  3RTV A;  3O4Q A;  4GKJ K;  5GAD P;  4JI6 K;  4KHU A;  4RW4 A;  1KLN A;  4GV3 A;  4DV2 K;  2YI1 A;  1IBM K;  3VGM A;  1EET A;  5KI6 A;  2Q31 A;  4M3Z A;  4HVJ A;  2BTF A;  1S1U A;  5J2Q A;  4O44 A;  4LSL A;  4BQZ A;  3LWM A;  3QDK A;  1GLA G;  4WF9 L;  4BRP A;  3R1X A;  3ID8 A;  3MN5 A;  4CJE A;  2A1S A;  3CD6 N;  2VG7 A;  2NRH A;  1EKE A;  4H0V B;  3SMS A;  4QS9 A;  4XH5 A;  3JYT A;  4I9L A;  3MWP A;  1EWQ A;  3D45 A;  3ZT4 A;  4CF0 A;  4GKK K;  1N32 K;  1IV0 A;  3AO4 A;  5JVH L;  1TK8 A;  2OPP A;  4A2A A;  1S5J A;  4JI2 K;  2CGJ A;  1NLV A;  4ISF A;  4DMN A;  4PHT X;  1HMV A;  1MWM A;  3OBW A;  1NK0 A;  2ATQ A;  4CFD A;  4A5B A;  3WNG A;  1NK5 A;  4NCA A;  4WCE L;  3MEE A;  4CZK A;  1VQK N;  5C25 A;  3M8Q A;  3TSU A;  5EY4 A;  4KAZ A;  2FBY A;  1FXX A;  4QOZ B;  3IFR A;  2FXU A;  4JS5 A;  2GWK A;  2ZE2 A;  3CG7 A;  5J2N A;  4CEE A;  4NXN K;  1HUX A;  2E2Q A;  1S1W A;  3RMC A;  2A3Z A;  2HMP A;  3ULD A;  2HBM A;  5BPL A;  3P38 A;  4CJF A;  1YI2 N;  4JK9 A;  2P9L A;  5JLH A;  2CGK A;  3QES A;  4FM2 A;  1UOC A;  4MDA A;  4H03 B;  2IC3 A;  4RWT A;  1N5Y A;  4I2Q A;  3MEC A;  2IS3 A;  5HRS A;  4EZ6 A;  3SJH A;  5E26 A;  3LWL A;  4K43 A;  5BR8 K;  1KTQ A;  4FWN A;  4A61 A;  4ELV A;  1HJR A;  3THY B;  4FVM A;  3WXL A;  5FPE A;  2BH1 A;  4M3Y A;  3ISN C;  5BRF A;  1K8A O;  3U4L A;  4B9U A;  5TKW A;  4LC9 B;  3NFA A;  1HNV A;  3V81 A;  2V7Z A;  4JKH A;  1KAY A;  1RTJ A;  2KLA A;  4H0T B;  3OYN A;  1O1W A;  5HLF A;  3OHR A;  1YIJ N;  4FWL A;  2X78 A;  3T1H K;  1C0F A;  4AQY K;  1ZC6 A;  4WFB L;  3ITH A;  1IKY A;  1NJX A;  3VQD A;  1D5A A;  4CBX A;  4JKA A;  4KTZ A;  1RT3 A;  1Z6R A;  1N36 K;  2D1K A;  2P9L B;  4CVN E;  3I0R A;  4ISE A;  1U2V A;  3BEX A;  4B9Q A;  4W5Q A;  4CGG A;  3AVN A;  5AFU A;  3NGY A;  4GV6 A;  4HUG A;  2HMI A;  4DFP A;  3T7Z A;  5I42 A;  2O8D A;  4FLV A;  4PQU A;  4CHZ A;  3HZ6 A;  4FWP A;  2ZGZ A;  1T03 A;  1YAG A;  2HOE A;  4YOT A;  3AVB A;  3SAH A;  3J80 O;  4B3T K;  5FPN A;  2E2O A;  3O80 A;  2QWQ A;  5JS2 A;  1NNE A;  2NRR A;  3NGI A;  1OVY A;  3M8P A;  1K73 O;  5CHI A;  2V52 B;  4BRH A;  1BIS A;  4IOC L;  4KPY A;  1JCG A;  1VK0 A;  1N8R O;  2UUB K;  4KH4 A;  1U48 A;  4FYD A;  1NK6 A;  2FBT A;  4JHD A;  2NRV A;  2GWJ A;  4RCH A;  4OKE A;  4DR3 K;  4DF8 A;  4R5P A;  3ZSQ A;  3O3H A;  4DR7 K;  2HST A;  2P51 A;  1U2V B;  5FLX O;  3S9H A;  5MLC Q;  1RDW X;  2YNI A;  3H3N O;  3BF3 A;  4CHY A;  5AQY A;  3M5R A;  3NH1 A;  1CZA N;  1D4X A;  3R9P A;  3TU5 A;  2O8D B;  2O8C B;  3S3N A;  2JWL A;  4IOX A;  4AHV A;  5TKY A;  3H1V X;  1T44 A;  1C0G A;  3QFP A;  4KHP K;  3ZT2 A;  5J2M A;  3TAF A;  1S72 N;  3HSC A;  4WFN L;  1IO2 A;  4KO0 A;  1KCF A;  1XC9 A;  4ILG B;  4DFM A;  3NF6 A;  4N41 A;  3HM8 A;  3V9S A;  1L3S A;  2QM1 A;  3Q7B A;  1TKZ A;  3ATU A;  1RBU A;  2EWS A;  3ENH A;  1Y97 A;  3I56 N;  2NNW A;  3B6O A;  2CH6 A;  1NWK A;  4O4G A;  4F3O A;  5ADX A;  4CFA A;  4IFY A;  3EN9 A;  3IG1 A;  4FJ9 A;  2HHT A;  1BQN A;  1V4S A;  4JHD B;  3AVC A;  3AVI A;  2BUP A;  3VQP A;  4RW9 A;  3AA3 A;  4FK4 A;  2G8I A;  1JCE A;  2HHQ A;  3G25 A;  4CF9 A;  3J7Z O;  3O6W A;  3UE5 A;  4E7J A;  4OO1 J;  1E4G T;  1WBD A;  3MAQ A;  3L4Q A;  1LAW A;  4BR9 A;  5AQG A;  1CXU A;  5HP1 A;  2DFF A;  3C6U A;  3SPZ A;  3J8A A;  1HQU A;  2P9I B;  3DAW A;  2D0A A;  2ITG A;  3L0Q A;  5KRT A;  3LP2 A;  3OYD A;  3F2K A;  1KVA A;  1TAQ A;  3C65 A;  3NH2 A;  3QBW A;  4CZG A;  3L6Q A;  3OJU A;  4GVE A;  3DJC A;  1HNZ K;  1RNH A;  3LAK A;  1U49 A;  2OTJ N;  3DMJ A;  3SV3 A;  4F2R A;  5KGX A;  3OYL A;  4DLE A;  4B9V A;  4DG1 A;  2O8F B;  4BWM A;  3ZEU A;  3DLG A;  3VQ6 A;  2ZJR L;  4KHS A;  3WT0 A;  1ILY A;  1SQK A;  3DLK A;  4KRE A;  2E20 A;  4BVO A;  2HHV A;  4BRE A;  4BRA A;  1IBK K;  3PY8 A;  3DLH A;  1X1P A;  4RW8 A;  4ID1 A;  4KHY A;  3CJC A;  2DTU A;  5GIN A;  1LWE A;  4CIF A;  5KTQ A;  2R7Y A;  1EWR A;  4FLW A;  2OTL N;  4LY7 A;  2ETJ A;  3RMA A;  2O8B B;  1BOT O;  5E41 A;  3IMX A;  4O0I A;  3O08 A;  3KLG A;  5DMR A;  4E7L A;  2OZM A;  1NJW A;  4PY5 A;  4MLH A;  1BUP A;  3U8X A;  4BVP A;  3V9U A;  4OKJ A;  3OYG A;  3ZSO A;  3ZSV A;  1UWB A;  4E7I A;  1YJW N;  4X66 K;  4KI6 A;  3TTD A;  1CZB A;  2KKZ A;  3NCI A;  3ZEU B;  4J2B A;  4CJK A;  4DR1 K;  4Z0U A;  4XH1 A;  4CJT A;  1DTQ A;  1NGC A;  1OH6 A;  3ZET A;  4L3Q A;  4CGJ A;  4KV8 A;  1ATR A;  4BY9 C;  3HBT A;  1GLB G;  1JLF A;  2OCE A;  1IKW A;  3MN7 A;  4AHR A;  5D3G A;  2UXD K;  1VRT A;  2P9N A;  3U6F A;  1VSI A;  3CFP A;  3GDQ A;  5HRR A;  4B08 A;  2DPN A;  3HP6 A;  1IJJ A;  2E6L A;  1J6Z A;  5LJW A;  4QS7 A;  1VAZ A;  4K8X A;  3VEX A;  4BRF A;  4HUF A;  4ICL A;  4IG0 A;  3C6T A;  3HT3 A;  2KW4 A;  1GOC A;  1XHZ A;  2NLX A;  1RT7 A;  2PZS A;  5AQX A;  3K5M A;  4BDY A;  1VQN N;  4FK2 A;  3CPW M;  1C6V A;  4H5V A;  3CJ7 A;  4CD3 A;  2KZZ A;  3AO5 A;  2NUB A;  3LZI A;  5CZ1 A;  2XY8 A;  2CGL A;  2PYL A;  4KTW A;  1RTD A;  2VG5 A;  3QEP A;  1ZBF A;  3CCM N;  3GG4 A;  1H1V A;  3CCR N;  4IZ9 A;  4YDU A;  1TUY A;  5AQW A;  4JRQ A;  4FJ7 A;  2XY6 A;  5LMU K;  3WXM B;  2D0O A;  1K9M O;  4JS4 A;  2ZGY A;  1OKJ A;  3RR8 A;  4BR0 A;  4OKK A;  4EAH D;  1ZBS A;  1LCU A;  3QNO A;  3KZB A;  1SL2 A;  1RBV A;  5AQF A;  3CCV N;  5KPR A;  2Q36 A;  2W41 A;  5M1K A;  4CES A;  4ZTF A;  4KFB A;  1YVU A;  3VQ4 A;  3VES A;  2QWN A;  4U7B A;  1VQ6 N;  1S9E A;  4FZX C;  4Y1D A;  4DS5 A;  5AQH A;  4A2B A;  5C12 A;  4DSJ A;  4CZE A;  2GV9 A;  4JK8 A;  5EU7 A;  3LZJ A;  3AO3 A;  2QXF A;  3KKR A;  3HL8 A;  4N47 A;  4FJH A;  3KLF A;  2F8S A;  4M63 C;  2Q0U A;  3V6D A;  3EKU A;  2D5R A;  1SS6 A;  4A62 A;  1VSH A;  4NYF A;  2VYP A;  1SKS A;  1JCF A;  4RG8 A;  5M1F A;  4YOW A;  4KHW A;  1LW2 A;  4JI4 K;  3FFK B;  5KPT A;  4H0Y B;  2J4R A;  4C1N I;  2IVP A;  1NM1 A;  1KAZ A;  4MFB A;  2XY7 A;  1L3T A;  3O4W A;  4BRM A;  3OVN A;  1WSG A;  3EY1 A;  3EE9 A;  3KLH A;  3KIO A;  4H0O A;  2HHS A;  2QWO A;  1YJ9 N;  2WTU A;  3D2E A;  3K2P A;  3P31 A;  4B3O A;  1XNQ K;  4EHU A;  3QB0 A;  1C1B A;  2E2P A;  1HR0 K;  3PO5 A;  3PSI A;  1L3U A;  4K0K K;  3HVT A;  2KFZ A;  5C15 A;  2HHX A;  3QET A;  3G71 N;  3HI0 A;  4AHS A;  4CJW A;  1CLQ A;  3O9S A;  3P1G A;  1J5O A;  4WQ5 C;  4L8R B;  3VEW A;  1RDB A;  5AQS A;  1N34 K;  3SLC A;  4KHQ A;  3MMV A;  2KQ2 A;  3MEG A;  4B1U B;  4JYA K;  1VSM A;  1BIZ A;  3ENO A;  3UKR B;  3LM9 A;  1DLO A;  2QK9 A;  3ZT1 A;  4IFV A;  3VTI A;  3T69 A;  1NJY A;  2QWL A;  4LH5 A;  3TAE A;  1VSJ A;  3OYJ A;  3RSE A;  3SAF A;  4X65 K;  4Y1C A;  1KVC A;  3SAG A;  5AQN A;  2YNF A;  4OPA A;  3P39 A;  3MK6 A;  1ZBL A;  3AVH A;  3OYH A;  3VEV A;  4BGA A;  4FK0 A;  1NOY A;  3DRP A;  5FPD A;  3JSM A;  3CQY A;  4NCG A;  1HJO A;  4J2D A;  4BE2 A;  4TSX A;  4JKB A;  3K57 A;  2QEX N;  1YVN A;  2ITM A;  3MCP A;  3ZX3 A;  2A42 A;  2Y1J A;  2OPQ A;  4FOI A;  1ZXO A;  3MED A;  4BC2 A;  3AO1 A;  1S3X A;  3V9Z A;  3CM5 A;  1HYV A;  4Q0B A;  1NJZ A;  3O9Q A;  4IDK A;  3OY9 A;  4DSI A;  4FJG A;  1KQS M;  4FLX A;  3MX2 A;  2I5J A;  1BDG A;  1RT4 A;  3VGL A;  1BCO A;  4BR7 A;  3RSE B;  1HKC A;  1T6C A;  4BE0 A;  4M3R A;  3TSP A;  5GAE P;  4CJ4 A;  1B92 A;  4ILH A;  2I7N A;  4BAC A;  1XWL A;  2UXC K;  4G9Z A;  4F2S A;  3KTQ A;  3O9T A;  3WXK A;  4CEF A;  3VEY A;  3C6H A;  3KK7 A;  1RDD A;  1NK8 A;  2D4W A;  4M7Y A;  4CGI A;  3T1Y K;  1EXQ A;  4FL9 A;  3NAE A;  4DF4 A;  4OJR A;  4HWI A;  1WSH A;  4I2P A;  2RN2 A;  3VF2 A;  3F5T A;  1ATN A;  4NB4 A;  3F9M A;  5SZT A;  4GVM A;  1KC8 O;  4DQP A;  1SL0 A;  2UYT A;  1VQ5 N;  4JN4 A;  2E6M A;  3SJJ A;  4IWV A;  3BGR A;  3DLE A;  4DUZ K;  3NE6 A;  2B6A A;  4WQ4 A;  3VF4 A;  4FW1 A;  2X74 A;  1HPM A;  4H8K A;  1T7P A;  1RTH A;  5CZ2 A;  3A5O C;  2RPI A;  4OPH A;  4F8R A;  3ZSR A;  1R59 O;  5LJV A;  3C94 A;  4FJL A;  2F4V K;  4O8U A;  1WAF A;  1JLA A;  5AQK A;  3LL3 A;  1RCH A;  1BL3 A;  1RTI A;  3I8B A;  3SBT A;  4JI5 K;  3R6M A;  4FJ8 A;  1FK9 A;  2YJE A;  4W5R A;  4OGE A;  3ZSW A;  4E1N A;  3QFU A;  1VSL A;  3PIO L;  3RMD A;  1EP4 A;  3VF6 A;  1X3N A;  5AQP A;  1QSY A;  1YF5 L;  3AGR A;  5AQZ A;  3HVR A;  3DLL L;  1BU6 O;  4R79 A;  1A5X A;  1XC3 A;  3H45 C;  3IRX A;  1SZ2 A;  4FWS A;  2YNH A;  4JNE A;  1U4B A;  2VQE K;  5M1P A;  2P9S A;  4DV4 K;  3SCX A;  4PA1 A;  3DOL A;  1OH7 A;  3HPG A;  3L2U A;  3CJB A;  3KKS A;  4EFH A;  3MXJ A;  4Z4E A;  4CIG A;  3BY5 A;  3FGU A;  4M45 A;  3SQ4 A;  4FJJ A;  2VWB A;  4NLB A;  2GEL A;  5AQQ A;  4CF8 A;  3KLE A;  3BZK A;  3LDP A;  3RVC A;  4CEQ A;  1Q86 O;  4LFB K;  1HRH A;  3C95 A;  3SUO A;  2YKN A;  1ASW A;  4CBW A;  1RDA A;  4CI6 A;  4DCH A;  4WE1 A;  3KD1 E;  1XNR K;  3C7N A;  4JK7 A;  3W3D A;  4AHU A;  1G99 A;  3J81 O;  3R8E A;  2QXL A;  1EO1 A;  4CW7 B;  4K41 A;  2YV0 X;  4QCL A;  4DSK A;  1HPZ A;  4LH4 A;  4E7K A;  3OYF A;  3CC2 N;  1V4T A;  4GNI A;  1QTM A;  1NMN A;  1X9W A;  3WNE A;  2P9S B;  3ZX0 A;  3TI0 A;  3E01 A;  4LD0 A;  3Q7C A;  2YJF A;  4WFA L;  1SUQ A;  3EKS A;  3CJ1 A;  4C23 A;  1F21 A;  1RT1 A;  3DYA A;  4DLG A;  4AM7 A;  3CFO A;  4BR4 A;  4CF1 A;  1MU2 A;  5AJ3 K;  1RT6 A;  1VQP N;  2AA4 A;  2HBJ A;  4HHT A;  3G6E N;  1S22 A;  3K5L A;  5FPM A;  5JVG L;  3C7N B;  4EIA A;  3LAL A;  4DTR A;  3U3G A;  1VQL N;  2G8V A;  1NGA A;  1QS4 A;  5AQU A;  4H5T A;  4CK2 A;  2Z1J A;  3AAQ A;  3MCA B;  3CCE N;  4E7H A;  3L2Q A;  5GAH P;  1M90 O;  3D7E O;  4CEZ A;  3CCU N;  2EX3 A;  5BRE A;  4PKI A;  3AY9 A;  2Q2R A;  5AQR A;  1E4F T;  1Q8I A;  4DV7 K;  1TUU A;  3HYF A;  5J1E A;  4A59 A;  5FDL A;  2FSK A;  2ZQB A;  1U47 A;  1P8Z A;  1P90 A;  5J2P A;  4DV0 K;  3SUQ A;  3NF9 A;  1U45 A;  4DR2 K;  1ZYQ A;  5C0Y A;  2UUC K;  4FVU A;  1JLC A;  4BRQ A;  1SAZ A;  5DM6 L;  2JGU A;  3VQ9 A;  4DFJ A;  3MN6 A;  3MX5 A;  4YOU A;  3MXM A;  3JXU A;  3QIC A;  3A5L C;  3D0P A;  2VGN A;  1N6Q A;  2HF3 A;  4XIU A;  1XHX A;  3U9Z A;  1IKV A;  4BRI A;  3WNH A;  2ZD1 A;  4BC3 A;  1DKG D;  1WSF A;  4XH4 A;  1Q82 O;  2FBX A;  4H5R A;  3K0S A;  4CZM A;  2G8F A;  4PUO A;  5I9E B;  1VQO N;  3DRR A;  4LSN A;  4AIL C;  2XRI A;  5AR0 A;  1K6Y A;  1R0A A;  3SK3 A;  5A2Q O;  2EHG A;  1C0U A;  2ASP A;  3AVL A;  3THW A;  4DKW A;  5T7B A;  1D8Y A;  3OS0 A;  2E2N A;  5B8H A;  3BP8 A;  4X64 K;  3AVG A;  4FM1 A;  2W42 A;  2HBL A;  5EVZ A;  3TAB A;  1BGX T;  1S1X A;  4AHT A;  4K8Z A;  3OW2 M;  3TR8 A;  4YHH K;  4CZI A;  4AF1 A;  1NK4 A;  2G8K A;  1CZ9 A;  3OS1 A;  4HTU A;  5HL7 L;  4JV5 K;  1VSF A;  4DB3 A;  1O13 A;  2RKI A; 
#chains in the Genus database with same CATH homology
 2VYP A;  4JD2 B;  1JCF A;  4BQZ A;  3CET A;  1RGI A;  2F9T A;  3QDK A;  5M1F A;  4YOW A;  3VPZ A;  1GLA G;  4WF9 L;  4BRP A;  3CCR N;  3R1X A;  3ID8 A;  1VQ8 N;  3MN5 A;  3FFK B;  5KPT A;  4H0Y B;  2J4R A;  4C1N I;  5GIO A;  3CD6 N;  2IVP A;  1NM1 A;  1KAZ A;  4CZH A;  5KQ8 A;  3ULE B;  2NRH A;  5HOO A;  4H0V B;  3SMS A;  3H6E A;  4QS9 A;  3O4W A;  4XH5 A;  1HKB A;  4BRM A;  2P9P B;  3MWP A;  3EE9 A;  3TPQ A;  4H0O A;  3FR0 A;  4AM6 A;  5JVH L;  4YDU C;  2QW9 A;  4A2A A;  3FLC O;  3VTH A;  2QWO A;  1YJ9 N;  1NBW A;  2CGJ A;  2A40 A;  1NLV A;  4ISF A;  3D2E A;  2WC9 A;  3IDH A;  3PLA A;  4PHT X;  3LM2 A;  3OBW A;  1MWM A;  4FWM A;  4YOV A;  5AQV A;  1U6Z A;  3P31 A;  5E84 A;  4A5B A;  4WCE L;  3WEE A;  4EHU A;  5AQJ A;  3QB0 A;  4CZK A;  1VQK N;  4JKD A;  2IVN A;  2E2P A;  1QQO A;  3TSU A;  5EY4 A;  2RHK A;  2QWM A;  1LOT B;  4U67 L;  4H5N A;  5C15 A;  5F2R A;  2YHY A;  3WXJ A;  3G71 N;  3HI0 A;  2QA4 N;  3K9K A;  4K42 A;  3IFR A;  2FXU A;  3K9J A;  2E88 A;  4KH6 A;  2GWK A;  4PL7 A;  3O9S A;  5GIP A;  3E9L A;  1HUX A;  4WQ5 C;  2E2Q A;  2P9I A;  1DT9 A;  4BG9 A;  1GLL O;  3VEW A;  2A3Z A;  2H3G X;  2HMP A;  5AQS A;  3TTF A;  2HBK A;  3SLC A;  2HBM A;  5BPL A;  3P38 A;  2V51 B;  5H1S Q;  3HOS A;  1WOQ A;  2PFU A;  1YI2 N;  4JK9 A;  1KAX A;  3MMV A;  2P9L A;  5JLH A;  3M3Z A;  1ESV A;  2CGK A;  4B1U B;  3CF5 L;  4JEP A;  4F9O A;  4ILJ A;  1W97 L;  4MDA A;  4H03 B;  3ZX2 A;  3EL2 A;  3ENO A;  3UKR B;  4RWT A;  3LM9 A;  3VOV A;  5BRD A;  4BC4 A;  3SJH A;  2I7P A;  3ZET B;  5E26 A;  1BO5 O;  4K43 A;  3QBX A;  1VQM N;  3FZF A;  4FWN A;  5C2F A;  4A61 A;  3CC4 N;  3VTI A;  3S41 A;  3T69 A;  5CR4 A;  1VQ7 N;  1IG8 A;  3WXL A;  5FPE A;  2P9N B;  2ZF5 O;  2QWL A;  2BH1 A;  3WEE B;  1QQM A;  5BRF A;  2AP1 A;  3RSE A;  3WQT A;  2WUS A;  4Z94 A;  3SAF A;  1K8A O;  3U4L A;  4O5F A;  1DEJ A;  5TKW A;  4LC9 B;  3C0B A;  5EOY A;  2V7Z A;  3SAG A;  4BQL A;  4JKH A;  1KAY A;  1TYQ A;  5AQN A;  4BC5 A;  5JLF A;  4OPA A;  4H0T B;  2KLA A;  3AAP A;  3P39 A;  3MK6 A;  3LDQ A;  3OHR A;  4FWL A;  4FPB A;  1YIJ N;  3O5B A;  4IFE A;  3VEV A;  4BGA A;  4CZJ A;  1NGD A;  3BF1 A;  5FPD A;  5JIC A;  3KWI A;  1C0F A;  3CQY A;  1ZC6 A;  3SBG A;  1HJO A;  3A5N C;  4WFB L;  4DQ8 A;  1RDU A;  4CBX A;  4JKB A;  3A0I X;  4JKE A;  1MWK A;  3GBT A;  2QEX N;  4JKA A;  1YVN A;  2FF3 B;  2ITM A;  3TTC A;  5AQL A;  1Z6R A;  2Q97 A;  3MCP A;  2D1K A;  3ZX3 A;  2A42 A;  2P9L B;  4ISE A;  3C6A A;  1U2V A;  2QWR A;  4FOI A;  1ZXO A;  4B1V A;  4BC2 A;  3BEX A;  3LDN A;  3HRG A;  1S3X A;  4B9Q A;  5AFU A;  3VEZ A;  4XEI A;  1GLE G;  3O9Q A;  3UB5 A;  4GV6 A;  4B1Z A;  3T7Z A;  3VET A;  1BA0 A;  3WUH A;  4CD1 A;  2GTD A;  5M1N A;  1HKG A;  1KQS M;  3HZ6 A;  3MX2 A;  3VER A;  4FWP A;  5AZI A;  1VQ4 N;  2ZGZ A;  1BDG A;  4B1W B;  3TSQ A;  1X3M A;  3EZW A;  3VGL A;  5AQO A;  1YAG A;  2HOE A;  4BR7 A;  3RSE B;  1HKC A;  1T6C A;  4YOT A;  3TSP A;  1NGI A;  5GAE P;  4ILH A;  3SAH A;  2I7N A;  4FWK A;  2GEM A;  1TYQ B;  4PKG A;  4CZF A;  4YOY A;  4H5W A;  2E1Z A;  2OAN A;  4H0P A;  2IIR A;  5FPN A;  3ENB A;  2NRZ A;  3OA9 A;  1WUA A;  2E2O A;  3P4I A;  4G9Z A;  3O9T A;  2QWQ A;  3O80 A;  4O8K A;  2NRR A;  4IEE A;  1OVY A;  4ISG A;  1K73 O;  3WXK A;  5CHI A;  2V52 B;  4BRH A;  2PBD A;  5GAG P;  3FZM A;  2WFB A;  3VEY A;  3C6H A;  3KK7 A;  4IOC L;  1VQ9 N;  3GOI A;  1XUP O;  2FLO A;  1JCG A;  1NGH A;  1N8R O;  2D4W A;  3DXK A;  4M7Y A;  2PAV A;  4FL9 A;  4KH4 A;  1GLC G;  4HWI A;  1HLU A;  3VF2 A;  4JHD A;  2NRV A;  2GWJ A;  3F5T A;  3O1B A;  4RCH A;  1ATN A;  4NB4 A;  2D0P A;  3F9M A;  1KC8 O;  2P9U A;  2HST A;  1QVG M;  1U2V B;  3KWG A;  5MLC Q;  2UYT A;  5M1O A;  1RDW X;  3CPE A;  3KVG A;  3H3N O;  3BF3 A;  1VQ5 N;  1NGG A;  5AQY A;  3M5R A;  4JN4 A;  1CZA N;  1D4X A;  4JKC A;  4FSV A;  3R3L A;  3R9P A;  3I33 A;  3TU5 A;  3CME N;  4IWV A;  2JWL A;  4IOX A;  5AZI B;  4WQ4 A;  1T6D A;  3VF4 A;  4CBU A;  5TKY A;  1NGJ A;  3H1V X;  1T44 A;  1HPM A;  1EQY A;  1C0G A;  3QFP A;  3WXI A;  3A5O C;  5C2D A;  5EX5 A;  2RE2 A;  4FPA A;  4OPH A;  5AFU H;  5LY3 A;  1S72 N;  3HSC A;  3U9D A;  4WFN L;  4RTF D;  5BRH A;  1R59 O;  4ILG B;  3FZK A;  1YUW A;  5LJV A;  4H0X B;  4O8U A;  2P9K A;  3HM8 A;  3M1F A;  5AQK A;  1BA1 A;  2QM1 A;  4E1J A;  3WQU A;  1NGB A;  3Q7B A;  1QZ6 A;  3ATU A;  5C10 A;  2EWS A;  3LL3 A;  3ENH A;  3I56 N;  3A5M C;  4BRK A;  2GX9 A;  2NNW A;  2QTD A;  2ASM A;  3I8B A;  3SBT A;  2CH6 A;  1XQS C;  1NWK A;  3R6M A;  4GY2 B;  2YJE A;  4BRO A;  1X9J A;  4BRC A;  3DXK B;  1ATS A;  4JKF A;  5JMV A;  5ADX A;  1BG3 A;  3EN9 A;  1YIT N;  3QFU A;  4IEI A;  1V4S A;  3D2E B;  3PIO L;  3DWL A;  4JHD B;  4IJA A;  5KPZ A;  2BUP A;  3H46 O;  2P9U B;  5M1Q A;  5BPN A;  1MDU B;  4BR2 A;  3VF6 A;  1X3N A;  5AQP A;  5BPM A;  1YF5 L;  3AGR A;  5AQZ A;  1JCE A;  3N4Q A;  2ZWH A;  1Q18 A;  3DXM A;  3DLL L;  1BU6 O;  3LDO A;  4R79 A;  3G25 A;  1XC3 A;  3H45 C;  4EHT A;  3J7Z O;  3O6W A;  3UE5 A;  4OO1 J;  2KHO A;  1SZ2 A;  1E4G T;  4FWS A;  4JNE A;  4KBO A;  3L4Q A;  3G4S N;  4A57 A;  4MLE A;  5AQG A;  4BR9 A;  1QVF M;  5M1P A;  3NVK A;  2P9S A;  3J8A A;  4I6M A;  2WBN A;  5F0X A;  2P9I B;  3CJB A;  3DAW A;  5KQD A;  4EFH A;  3AAR A;  3W0L A;  5BN8 A;  3L0Q A;  1GLJ O;  2CH5 A;  1Q81 O;  3VMF B;  4GV9 A;  3F2K A;  3C65 A;  3QBW A;  4CZG A;  3FGU A;  3L6Q A;  4GVE A;  3DJC A;  2VWB A;  4BRN A;  1K8K A;  4KH5 A;  4NLB A;  2GEL A;  4QS8 A;  5AQQ A;  4MO5 A;  2OTJ N;  3CHW A;  3MWT A;  4JKG A;  4BRL A;  3LDL A;  3LDP A;  5BR9 A;  3RVC A;  3ZEU A;  1NJI O;  4IOA L;  1RFQ A;  2ZJR L;  4BRG A;  3WT0 A;  1Q86 O;  4PKH A;  2Q1N A;  4MO4 A;  3O1W A;  4WQ4 C;  1ILY A;  4YOR A;  3M6G A;  1SQK A;  3ATV A;  4CBW A;  1Q7Y O;  3HOT A;  3EE8 A;  2E20 A;  4BVO A;  4CI6 A;  5CE3 A;  4DCH A;  3C7N A;  4JK7 A;  3W3D A;  4BRE A;  1G99 A;  4BRA A;  4IDH A;  3R8E A;  2QXL A;  3L4I A;  1EO1 A;  3IKM A;  3CC7 N;  2FSJ A;  4K41 A;  5ADX H;  2W40 A;  4FO0 A;  3DXM B;  3D2F A;  3O9R A;  3A8Y A;  3CJC A;  3H3O B;  5GIN A;  2IVO A;  4JAX A;  3CCS N;  3CC2 N;  5DM7 L;  1V4T A;  4GNI A;  2OTL N;  3UKU A;  1QQN A;  3AGK A;  4Y0W A;  1BOT O;  3GL1 A;  3IMX A;  4B1X B;  2P9S B;  4BRD A;  3O08 A;  3CCJ N;  3ZX0 A;  4I6M B;  5F1X A;  4UY8 O;  3O8M A;  4MLH A;  5BN9 A;  5AZJ A;  1BUP A;  3U8X A;  4BVP A;  3O9U A;  3Q7C A;  2FF6 A;  4BGB A;  2ZJP L;  2YJF A;  3MN9 A;  1K8K B;  3IUC A;  4M7X A;  4WFA L;  3EKS A;  3VGK A;  3CJ1 A;  4C23 A;  1YJW N;  4HTL A;  4JKG B;  3TTD A;  2E8A A;  4AM7 A;  1NGF A;  2KKZ A;  4BR4 A;  4YOX A;  3CI5 A;  3ZEU B;  3HTV A;  1W2B M;  3SMP A;  3GE1 A;  4XH1 A;  1VQP N;  2VCP A;  3UKR A;  2AA4 A;  2HBJ A;  4DHY A;  1NGC A;  4CJ7 A;  3G6E N;  1S22 A;  3MDQ A;  3ZET A;  2NRT A;  4L3Q A;  5FPM A;  2HF4 A;  5JVG L;  3C7N B;  3FZH A;  4EIA A;  1ATR A;  4BY9 C;  3HBT A;  1VQL N;  2Q0R A;  3EO3 A;  4C1N K;  1GLB G;  1NGA A;  3BUZ B;  3JS6 A;  3H1Q A;  5AQT A;  3MN7 A;  4B1Y B;  5AQU A;  3NVM A;  2A5X A;  4FWO A;  4H5T A;  2P9N A;  3AAQ A;  3D2F B;  1DGK N;  3MCA B;  3CCE N;  3GDQ A;  3VEN A;  1M90 O;  5GAH P;  3D7E O;  2NZT A;  3N4P A;  5AQI A;  3CCU N;  2ASO A;  2DPN A;  3UKU B;  1IJJ A;  4MDB A;  5BRE A;  4PKI A;  3AY9 A;  1J6Z A;  3QML A;  2YCH A;  5LJW A;  3ID6 A;  4QS7 A;  2NRX A;  1VAZ A;  2Q2R A;  5AQR A;  1E4F T;  4CZL A;  3VEO A;  3VEX A;  3CIP A;  4BRF A;  3CXC M;  1TUU A;  1M1K O;  1Z05 A;  4NLC A;  5AZJ B;  4A59 A;  2FSK A;  3ZYY X;  2NLX A;  1P8Z A;  1P90 A;  5AQX A;  4IO8 A;  1VQN N;  1YXQ A;  3CPW M;  1QZ5 A;  1NGE A;  3CJ7 A;  4H5V A;  4CD3 A;  2A41 A;  1JJ2 M;  3I55 N;  4A5A A;  5C0Y A;  1T3V A;  3E9O A;  1GLD G;  4FVU A;  4BRQ A;  2CGL A;  3CMA N;  1Y64 A;  1SAZ A;  3FE1 A;  5DM6 L;  4WYB A;  4J8F A;  4FOE A;  3CCM N;  3GG4 A;  1MA9 B;  3MN6 A;  1H1V A;  3MX5 A;  4IZ9 A;  4YDU A;  1TUY A;  4YOU A;  4NO7 A;  5AQW A;  2A6A A;  3B8A X;  3JXU A;  3QIC A;  1HX1 A;  3A5L C;  4IJN A;  4PL8 A;  3KHY A;  1GLF O;  2VGN A;  2JWK A;  2D0O A;  3WXM B;  2HF3 A;  2GUP A;  1BWF O;  2ZGY A;  1K9M O;  1OKJ A;  3U9Z A;  3D6R A;  4BRI A;  4JD2 A;  4BR0 A;  2F9W A;  2V7Y A;  4BC3 A;  4EAH D;  2E1Y A;  1DKG D;  2YHW A;  1ZBS A;  1LCU A;  2P9K B;  3CCQ N;  4XH4 A;  1Q82 O;  3KZB A;  3OBY A;  5AQF A;  4IXC A;  3CCV N;  5KPR A;  2Q36 A;  2W41 A;  3E1Y A;  5M1K A;  1KD1 O;  4H5R A;  2YHX A;  3CER A;  3ULE A;  4CZM A;  4FWR A;  3VES A;  2VGM A;  5I9E B;  2P9P A;  3CQX A;  4IO9 L;  1VQO N;  2QI2 A;  2QWN A;  5ELZ A;  5AR0 A;  4BG8 A;  4U7B A;  2ZJQ L;  1YJN N;  1KXP A;  1VQ6 N;  3SK3 A;  5AQH A;  2ASP A;  5AQM A;  4A2B A;  5C12 A;  4CZE A;  4DKW A;  3CJ9 A;  2QWP A;  3PIP L;  1QHA A;  4JK8 A;  2E2N A;  4WQ5 A;  3FZL A;  5B8H A;  4FWQ A;  3BP8 A;  2FSN A;  3CJA A;  2HBL A;  1NMD A;  5EVZ A;  5GAD P;  4K25 A;  2NRW A;  3E9P A;  4M63 C;  3OW2 M;  4CZI A;  2Q0U A;  4AF1 A;  3NMU A;  3CCL N;  4GV3 A;  2YI1 A;  2F7T A;  2YX6 A;  3EKU A;  5HL7 L;  1YHQ N;  3VGM A;  4BR5 A;  1SS6 A;  4DB3 A;  2Q31 A;  1O13 A;  5EXW A;  2BTF A;  4A62 A;  3E66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...