3ZEUA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
RILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 73
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zeuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zeuA02
3C7NA 3QICA 4QS8A 1HPMA 3WEEB 1V4TA 2QWPA 4A61A 5AQLA 5ADXA 1IJJA 5F0XA 3VEVA 4H5NA 2QWRA 3LDQA 3QBWA 1Z6RA 3CI5A 2HOEA 4RWTA 3RSEB 1E4FT 2UYTA 2CGLA 2P9KB 1E4GT 5EXWA 1ZBSA 1XC3A 3ZX0A 4H0VB 3VPZA 5AZJA 4M7XA 2D1KA 1T44A 4B1XB 4JN4A 5F2RA 3MN9A 3FZMA 4H5RA 5FPMA 1ATSA 4BQLA 4BVOA 3JS6A 1TYQA 2Q0RA 2E20A 4IZ9A 5E26A 1GLBG 4CZKA 2DPNA 4BRFA 3A8YA 2NZTA 1RDWX 1HUXA 2YCHA 3VENA 2HF3A 1HKGA 3FZLA 2P9PB 4B9QA 3H46O 5AQXA 5EX5A 2P9NB 3R9PA 4HTLA 4YDUC 3MN6A 3QDKA 1J6ZA 1T6CA 1KXPA 3D2EB 1BG3A 1GLEG 4BGAA 2E2NA 1DEJA 2YHXA 1NGEA 3WXIA 3ATUA 1NGAA 5AQFA 4BR7A 4MLHA 3SMPA 2QXLA 3DAWA 2FF3B 3O4WA 4CZFA 1HJOA 4ISFA 5AQWA 3P4IA 3O1BA 3UKUB 5CE3A 4BQZA 4FPBA 3A5LC 2J4RA 3WEEA 1NBWA 1KAZA 5BR9A 1HLUA 2YHYA 3C7NB 1X3NA 4H0YB 3D7EO 3I33A 3LDNA 3CQYA 3VF2A 2VYPA 4MLEA 2F9TA 3RSEA 4EHUA 3WXLA 5LJWA 1SZ2A 1JCEA 5FPNA 1JCGA 1GLCG 5LJVA 1KAYA 1U2VA 3R6MA 2BTFA 5AQQA 4RTFD 3AAQA 1BA1A 2QWQA 4QS7A 3AY9A 4ISEA 3DWLA 4M63C 1QZ5A 1RGIA 4FWMA 3H3OB 4O8KA 4BC5A 4BR9A 2PBDA 2E2QA 2E2PA 4H5WA 4BRAA 5AQTA 3GG4A 1TYQB 3SJHA 3ENHA 1YXQA 3HBTA 4H5TA 3MN7A 2P9PA 3VEXA 5BRHA 2WUSA 5B8HA 4BC3A 5JLFA 3WXJA 4K43A 5JLHA 4BR4A 1DKGD 4BRQA 4BROA 1C0GA 4BVPA 3KZBA 1DGKN 4BRLA 5KPZA 1KAXA 4GNIA 5KPRA 2FF6A 3O5BA 4BC4A 5FPEA 3QB0A 3UKUA 2E1ZA 2ZF5O 2V7ZA 4H03B 5BREA 2D4WA 2ZGYA 4FPAA 1GLDG 4IJAA 3WUHA 5AFUA 3JXUA 3SLCA 3VGMA 5I9EB 4MO5A 2VWBA 4XH1A 5LY3A 4FOEA 5AQSA 3A0IX 1BA0A 4NB4A 5TKYA 3MCPA 4BRIA 2Q1NA 3L0QA 2GTDA 2YJFA 1U2VB 5AR0A 2BUPA 3CERA 3VETA 4CZLA 3H1VX 3VERA 2QWMA 3FGUA 4H0OA 2CH6A 4EFHA 1NLVA 1SAZA 5JMVA 4FOIA 4H0XB 1EQYA 4JNEA 4I6MB 4O5FA 4F9OA 5AFUH 4RCHA 3ZX2A 4IWVA 1QQNA 3MN5A 4CBXA 4PKGA 4NO7A 4A2AA 2GEMA 3W0LA 4J8FA 1Z05A 2AP1A 3DXMB 3F9MA 5ADXH 1V4SA 1NGGA 3ULEB 4AM6A 4CBUA 2QWOA 3H1QA 4LC9B 4PL8A 5EY4A 3MK6A 5EVZA 1YAGA 1CZAN 1XQSC 3IFRA 4CBWA 3B8AX 2CGJA 3BEXA 4B1VA 5AQNA 5AQKA 5AQGA 4IJNA 2NLXA 4Z94A 1QQMA 1ZXOA 3VEOA 4PL7A 4BRDA 2CGKA 2GWJA 1NGHA 2Q97A 3O8MA 5BRDA 3IMXA 3J8AA 3L6QA 4CI6A 3U4LA 3CETA 1Y64A 3CJBA 3H45C 3WT0A 3SMSA 4H0PA 3I8BA 3VEZA 3CIPA 5ELZA 4BRPA 3EO3A 4ISGA 3O6WA 4H0TB 3A5MC 3G25A 4B1UB 2I7NA 3O1WA 3WQUA 4BR2A 4PKHA 3QMLA 2Q0UA 3OHRA 2FXUA 2IVPA 5AQIA 3AARA 5AQVA 4FO0A 3VESA 1G99A 1RFQA 3U9DA 4I6MA 2E88A 2ZWHA 1NGIA 2OANA 4CZGA 3U8XA 4DQ8A 2HF4A 3VGLA 3EKUA 4K41A 5F1XA 2P9IB 5E84A 2VCPA 3DXMA 3LL3A 3ULEA 1NM1A 3GDQA 3W3DA 4IO8A 1C0FA 1OKJA 3ZEUA 1Q18A 2ASPA 3HZ6A 1X9JA 4WYBA 4B1WB 3VEYA 1ESVA 4BC2A 4BRNA 3ZETB 3FE1A 3AAPA 3HSCA 4A2BA 3GBTA 1MWMA 2Q31A 4KBOA 1TUUA 2FLOA 1H1VA 1S3XA 4GY2B 4M7YA 1XUPO 2FSKA 2CH5A 1NMDA 5AQYA 4EHTA 1BOTO 3D2FA 3BP8A 1LCUA 3LDPA 3HM8A 2NRHA 4WQ4C 1X3MA 3VF4A 2E2OA 3GOIA 4JAXA 3SK3A 4WQ5C 3S41A 3QFUA 2HMPA 5AZIA 3UKRB 4FWLA 5AQPA 2QM1A 4HWIA 3VF6A 3CJ7A 3BF1A 3FR0A 4CZMA 4CJ7A 5AQZA 3UE5A 4B1YB 2A41A 5AQOA 2ZGZA 3H3NO 5BN8A 3U9ZA 2EWSA 5AQRA 3HTVA 3A5OC 1BU6O 2IVNA 1ATRA 3O80A 3CJ9A 3WXKA 3H6EA 3L4IA 4MO4A 3C0BA 4FWQA 3ZX3A 4QS9A 5BN9A 1S22A 3QFPA 4WQ4A 2W41A 4WQ5A 5BPNA 1GLFO 1K8KB 3FZHA 1MA9B 2AA4A 2P9SB 5AQHA 4EAHD 2P9IA 2PAVA 1HKBA 1WUAA 3A5NC 2A40A 3EKSA 1GLLO 3EL2A 4FWSA 3KVGA 5AQJA 2V51B 3ZEUB 2I7PA 3FFKB 1NGDA 3ZETA 2IVOA 4BG9A 1TUYA 2YHWA 1NGBA 3LM2A 3O08A 1HKCA 2QWLA 5AQUA 4A62A 4FWNA 2D0OA 3DXKA 1NGJA 3BF3A 4C23A 3VGKA 3BUZB 3UB5A 3GL1A 4E1JA 2H3GX 5FPDA 4BRGA 5BPLA 2IIRA 3VEWA 1WOQA 3M3ZA 3D2FB 4FL9A 3MDQA 4BG8A 2YI1A 4AM7A 3UKRA 4XEIA 2QWNA 3CQXA 2GWKA 1ZC6A 3MMVA 4CZJA 4DHYA 4FSVA 4BR0A 4BRKA 5AZIB 1BWFO 4CD1A 4JHDB 3GE1A 4K42A 4XH4A 5KQDA 2QW9A 4BRCA 3CJ1A 1HX1A 4BRHA 1QHAA 1MDUB 4JD2A 5JICA 2P9LA 4BREA 1NGFA 1GLJO 4CZIA 3TPQA 4BRMA 2P9UB 1T6DA 3CJAA 1YUWA 2V7YA 1YVNA 3QBXA 1ATNA 1D4XA 5BRFA 2V52B 1K8KA 4IXCA 2P9SA 4YDUA 3R8EA 2ASMA 4XH5A 3CHWA 1R59O 1P8ZA 2P9KA 1SQKA 2E8AA 2F9WA 2Q2RA 2ITMA 4CZHA 3IDHA 2ASOA 2A6AA 1MWKA 5AZJB 3FZFA 2A3ZA 1NGCA 2FSJA 4BR5A 3LM9A 3FZKA 4H5VA 3CJCA 4Y0WA 4B1ZA 2GELA 3LDOA 3ATVA 1U6ZA 3DXKB 4K25A 2E1YA 1NWKA 4FWRA 3IUCA 1QZ6A 2Q36A 2FSNA 5KQ8A 3ENOA 4L3QA 1BUPA 2P9NA 1GLAG 2A42A 4CD3A 4BGBA 2KHOA 3DJCA 5EOYA 3D2EA 4JHDA 5AQMA 3TU5A 2YJEA 3EZWA 3M1FA 4DCHA 2W40A 1LOTB 5BPMA 3FLCO 1IG8A 1BO5O 4FWOA 2GUPA 4PKIA 1BDGA 4DB3A 3ID8A 4JD2B 3EN9A 4FWPA 3VOVA 2P9UA 1JCFA 2P9LB 4EIAA 2A5XA 3HI0A 3LDLA 1QQOA 2D0PA 3M6GA 4FWKA 3KHYA 4CZEA 5KPTA 3WQTA
chains in the Genus database with same CATH superfamily
3OBWA 2QWPA 2PZSA 4JRQA 1IJJA 3E01A 5F0XA 4H5NA 3TTFA 4PWDA 1XNRK 4RWTA 2UYTA 1VSJA 1FK9A 2FBXA 1FXXA 4FLTA 1VQ7N 3T7ZA 1E4GT 3T1YK 3OTOK 2D1KA 1T44A 4GVMA 4B1XB 4CEBA 3LWLA 1S1VA 1RBTA 5FPMA 3SQ2A 2E20A 1Q9XA 3DRSA 3V6DA 1J5OA 1LWFA 3PV8A 2NZTA 2HHXA 3CXCM 3TARA 3VENA 2F96A 2HBJA 2P9PB 1KC8O 2KFZA 2P9NB 3MN6A 2ZJQL 4FJNA 4LFAK 1J6ZA 1HNVA 1B92A 1GLEG 1NGEA 1JLCA 3THWB 3WXIA 4M3WA 1NGAA 5AQFA 2XY6A 4MLHA 4OGEA 1IKYA 3DAWA 2FF3B 4CZFA 1HNWK 4PQUA 5J2NA 3P4IA 3O1BA 4BQZA 5HL7L 4FPBA 2VG7A 3SQ4A 1BQMA 3WEEA 4Z4CA 1KAZA 5BR9A 4CJPA 1CZBA 5HRSA 4DQPA 1QHTA 4FZXC 4MDAA 4EHUA 3TI0A 1JCGA 5H1SQ 1RDDA 2OPSA 1BIZA 1FKOA 1N33K 4FW2A 4HCBA 2QWQA 1SL2A 1VRUA 3P5JA 3OS1A 4WF9L 3KIOA 4FWMA 3E9LA 4O8KA 4BR9A 2F4VK 1QE1A 2E2QA 2P1JA 2X78A 3RRGA 3QNOA 4E7JA 1WSFA 4IDHA 4B3MK 2G8UA 5JLFA 5K14A 4CJEA 4BROA 2W6KA 1E3MA 4BE2A 1Q82O 1KVAA 3NVKA 3P39A 4BRLA 4G9ZA 3N4QA 1NJWA 2HHVA 3CCSN 1BCMA 3O4NA 4FJKA 3ZSWA 3MXMA 5FPEA 2NRXA 3KLEA 1IKXA 2V7ZA 4B9MA 4CVNE 1GLDG 3WUHA 4LF8K 1RDBA 3ITHA 3HVRA 2VWBA 4XH1A 5LY3A 3OYLA 3I0RA 3SV3A 5AQSA 1TGOA 4FVMA 3A0IX 1BA0A 4JK7A 4DG1A 4JRPA 3MCPA 1X1PA 4BRIA 3K5OA 2YHBA 3NFAA 4KTQA 1U2VB 5AR0A 3VQ8A 1QVGM 3VETA 5C15A 4DF4A 2QWMA 4KTWA 4H0OA 4JI8K 2CH6A 1MU2A 1SAZA 2KZMA 4LH4A 4JNEA 4I6MB 4F3TA 4HUEA 1L3SA 4FJ9A 4FK4A 3SPYA 4PKGA 4NO7A 1ITGA 1M1KO 2GEMA 3NF8A 3W0LA 2AP1A 1RDUA 2RKIA 1NGGA 4B9SA 4CF9A 3J7YP 4PL8A 1K73O 5EY4A 4X65K 1RT7A 4CJWA 5FRMA 1CZAN 1XQSC 3WXMB 2ZD1A 3CCRN 4CBWA 2CGJA 4DQSA 1VSMA 4KKOA 1RT6A 3JAMO 3DLKA 3BZCA 5AQKA 5AQGA 4Z94A 1QQMA 1HMVA 4LSLA 4BRDA 2CGKA 1A5VA 1VK0A 5C24A 1BISA 5BRDA 3KJVA 1CXUA 1VQ9N 3P83D 1U47A 1BGXT 1Y64A 3CJBA 4WE1A 3CC4N 4QOZB 3OYDA 4OKJA 1BQNA 4DFPA 3CMAN 3E66A 3I8BA 4MDBA 4JS5A 4YY3K 4BRPA 3EO3A 5C25A 2ZJRL 1RT5A 4I2PA 4PKHA 3D0PA 2FXUA 2IVPA 5AQVA 3AARA 2QI2A 3L2UA 2IOCA 1UAXA 2E88A 2QEXN 4CZGA 4FJXA 3EKUA 3V1QA 2FC0A 2P9IB 4CHPA 3F9KA 2YNGA 3TTCA 4ZTJA 4FM2A 3AVKA 3ZEUA 3AVGA 5GIOA 5T7BA 3LWMA 4IKFA 3VEYA 5HOOA 3AAPA 4A2BA 3AVMA 4DTPA 3GBTA 3AA4A 1TUUA 4DTJA 2FLOA 1K9MO 1H1VA 4OLBA 1XUPO 5M1QA 2VWJA 1BOTO 4FJ8A 3BP8A 2WTUA 1RT1A 3KK7A 4M3RA 3LDPA 1S6QA 3VF4A 3SK3A 3QFUA 2HMPA 3HPHA 4DSIA 1O1WA 4UY8O 2O8FA 4E7KA 4FJHA 4A5AA 4C8OA 1WSEA 3BF1A 4CJ7A 3THYA 2RF2A 3UE5A 2A41A 3U9ZA 5AQRA 1QSLA 1UA1A 3A5OC 3NHGA 1L3UA 3O80A 4CEQA 3C0BA 4GKJK 1KLMA 5BN9A 4FLWA 3OYGA 5JVHL 1K8KB 3L2VA 1MA9B 1TK8A 1SKWA 4LF7K 4K8XA 1RNHA 1B9FA 3NF7A 4KPYA 2PAVA 3AA2A 1M90O 1HKBA 4DFMA 4YOXA 4DF8A 1L3TA 3EL2A 4E19A 4FWSA 4W5OA 3KVGA 5AQJA 1YI2N 4CFAA 3FFKB 3MAQA 4J2AA 2IVOA 3PX4A 4PHTX 3ZT0A 4A62A 2HBMA 1HJRA 4C23A 4LF9K 2HNYA 4B9NA 3SJJA 3GL1A 2H3GX 3O9QA 3DOKA 3VQCA 3AGRA 5BPLA 5DM7L 3L2QA 2G8KA 3M3ZA 4FL9A 1RT4A 3KWGA 3MDQA 3CC2N 2Q3SA 2YI1A 4AM7A 4I2QA 2HHUA 3MMVA 4KAZA 1ZBIA 5AZIB 5CY4A 4JHDB 3N4PA 2NRRA 4K42A 4XH4A 2HVIA 4B3SK 3C6AA 1XNQK 2P9LA 4BREA 1VSLA 4DR5K 3J7ZO 4ELUA 4CZIA 3IS9A 1LW0A 4OKKA 4Z0UA 5D3GA 2XRIA 1YUWA 2V7YA 4KHUA 1ATNA 1D4XA 4K0KK 1KSPA 4LF4K 2P9SA 1I94K 4CJVA 4YDUA 1VQ5N 5C2FA 1WAJA 2RN2A 5GAHP 3VQQA 2QXFA 4JKHA 4RW9A 3VQAA 2OCEA 3OYCA 4LSNA 1K6YA 1NNEA 1ZBUA 3NVMA 4OPAA 2Q2RA 2HVHA 2ASOA 5M1NA 2Z1GA 3AO3A 1HYZA 3K9KA 3HXMA 1NGCA 2WBNA 1BL3A 4FXDA 4B1ZA 2GELA 2HHSA 4N47A 1OH8A 3MXIA 2W42A 2E1YA 1TKZA 1NWKA 2IC3A 3AGKA 4FWRA 3IUCA 3IAYA 4F8RA 5JVGL 2FSNA 1IV0A 3ENOA 4L3QA 3VQ7A 1BUPA 2P9NA 1TK0A 3NBPA 4IFVA 4DQRA 4BGBA 3DJCA 4FLYA 4I9QA 1EWQA 3CF5L 3K9JA 3UIQA 2B4JA 2W40A 3T1AA 3THWA 3G0ZA 1T3VA 4G1QA 4PKIA 1S1WA 1WAFA 4CHOA 4BE0A 3EN9A 3HVTA 4EIAA 2P9UA 4BWMA 3DRPA 3HI0A 2GUIA 2O8DB 3LPUA 4E1JA 4CZEA 5KPTA 3CCMN 3OYJA 1ZBLA 1HPMA 1YJWN 1NJYA 4AHCA 1XHXA 3L3UA 4A61A 2G8HA 5AQLA 5ADXA 3PSFA 1TAQA 2CGLA 2UXBK 2VQFK 3OS0A 3WNHA 5EXWA 1ZBSA 1XC3A 5DK5A 3ZX0A 3HRGA 4JN4A 4FJ7A 4NYFA 3MN9A 4YOTA 1ATSA 3ENBA 4OO1J 1YJ9N 3NH0A 3BDPA 3DI6A 2DPNA 4BRFA 1RDWX 3IKMA 2YCHA 4JK8A 2HF3A 2XY7A 4FJLA 4RW4A 2D5RA 4ID5A 4JI4K 4B9QA 5EX5A 3J80O 1NK9A 1ILYA 1KFDA 4HTLA 4YDUC 4AF1A 1NOZA 1IH7A 1BG3A 3E1YA 4KB0A 3HSTB 3ZSQA 5KRTA 3OYBA 4BR7A 4FJMA 3UKUB 4O5BA 2NNWA 3RMDA 4C8NA 3SPZA 1GOCA 1S9GA 3D7EO 1VQON 3EY1A 3O9TA 3VF2A 4MLEA 3RSEA 3QNNA 2B6AA 1JCEA 4GKKK 4JKGB 2G8FA 4ID1A 1GLCG 1U2VA 3LP0A 4DU3A 3HYFA 3R6MA 2KTQA 3ZSVA 2BTFA 3AAQA 1BA1A 4QS7A 2E6MA 3AY9A 5MLCQ 3AO5A 2RHKA 4ISEA 3NAEA 2ETJA 3K5MA 3H3OB 4BC5A 2PYJA 5EU7A 1WSJA 2E2PA 4N41A 4IFYA 4KTZA 4BRAA 3OYMA 2JGUA 1YXQA 4H5TA 3MN7A 3VEXA 2O4GA 3ULDA 2WUSA 4B3TK 3WXJA 2UUBK 1VQ4N 4FLXA 1C0GA 4QAGA 1DGKN 4WFAL 1NKCA 3KLIA 4CFBA 2OZMA 4JI0K 4DWIA 1VQMN 2ZE2A 4W5QA 2FF6A 2IGIA 3AVHA 4BC4A 5J1EA 4YHHK 4DTNA 3QB0A 1UOCA 4HUFA 4IOAL 2ZF5O 1JL2A 3U3YA 5BREA 1QSYA 1YIJN 4U7BA 3SBTA 4DQQA 5AFUA 3TABA 5GAEP 2BANA 4Z4HA 3VGMA 3K0SA 2NRVA 1BI4A 2YKMA 1KVCA 1P90A 2NRWA 3SUPA 2A1SA 2Q1NA 3L0QA 2JWLA 2D0BA 2GTDA 4GVEA 4BDZA 1X9MA 1KLNA 2BUPA 3CERA 2ZQBA 4O0JA 3FGUA 1NLVA 4Q5VA 5JMVA 4FOIA 3C6HA 4H0XB 3KLHA 1BIUA 3K2PA 4AHRA 4CBXA 4RCHA 1WNSA 2IS3A 1NJXA 2VQEK 1NG9A 3HP9A 1Z05A 1C0MA 3ULEB 1OH5A 4CBUA 3IG1A 3TAFA 2G8VA 4LC9B 5EVZA 3CCEN 3MECA 1C1CA 1YAGA 1C1BA 2F8TA 1YF5L 4DSEA 1U04A 1TKXA 3O9UA 1TL1A 4F3OA 2D0AA 4NLBA 3CFOA 3O9RA 4DR3K 1WSHA 3AVLA 2E4LA 3RRHA 4LF5K 3VEOA 4CF8A 2GWJA 1NGHA 4CJFA 1JXBA 4ILGB 3S3MA 3IMXA 3EE9A 3L6QA 4CI6A 3U4LA 3TWHA 3H45C 2Z1IA 1EWRA 2UXCK 3M8PA 1SS6A 4AILC 4DU1A 4DS5A 1HPZA 3VEZA 3G71N 3KK1A 1VSHA 4K8ZA 4DS4A 4E1MA 4B1UB 3QEVA 3O1WA 3DLBA 3I55N 2Q0UA 3OHRA 4CGJA 1KFSA 5AQIA 1QSSA 3CCLN 3SQ0A 4KHQA 1G99A 3VQ9A 1B9DA 2OANA 4DQ8A 2HF4A 4CHYA 4FK2A 3DXMA 1ZYQA 3W3DA 4FYDA 4GV6A 1C0FA 2QKKA 3AV9A 5HRRA 4WYBA 4FZZA 4KH6A 3EEQA 3O4QA 3RMAA 3ZETB 3HSCA 4E89A 4ZHRA 4KBOA 3HOSA 3WNEA 3T1HK 1RTHA 1S3XA 4M7YA 4YFUA 4JI5K 1NMDA 3ZSOA 4DR2K 4KB1A 2I5JA 1LCUA 4Q0BA 2NRHA 4WQ4C 1X3MA 1NK7A 4M3XA 3GOIA 4WQ5C 4CIFA 5AZIA 1WSIA 4FWLA 4OPKA 1IKVA 4HWIA 2KQ2A 3CJ7A 1OH7A 4B9VA 3F2KA 3QERA 3TSUA 2HW3A 4UQGA 2IVNA 1ATRA 3WXKA 3G6EN 3L4IA 4FWQA 3ZX3A 4IDKA 2HSTA 1XMQK 4M41A 3I8DA 1UA0A 2YKNA 3AVCA 3I0SA 3RR8A 1W97L 1WUAA 4CW7B 3EKSA 1U4BA 4CFCA 1N32K 1JLFA 3O3GA 3MWPA 4DSJA 1WN7A 2W6LA 1NGDA 4AQYK 2Z1HA 4YOVA 4KHSA 4RW8A 1TUYA 3LM2A 4FJJA 1HKCA 5GINA 4CJLA 5AQUA 4FWNA 4GW6A 2D0OA 3VGKA 5FPDA 3E9PA 2UXDK 4GMJB 2FBTA 3CCVN 4N56A 1HNZK 2QK9A 4AHVA 3SI6A 3D2FB 3AVBA 3SBGA 4BE1A 4BG8A 3UKRA 3M8QA 2VGNA 2DFHA 3SYZA 3B6PA 1NK8A 3MEGA 5KQDA 5FLXO 4RG8A 3CYMA 1HX1A 1TVRA 3FFIA 1HYVA 3SZ2A 2ZJPL 4CJRA 1GLJO 2JLEA 3RMCA 2O8DA 4WCEL 3OYIA 1U48A 4M3UA 5BRFA 4FM1A 3IRXA 3VTHA 4Z4FA 3LAKA 3CHWA 3KKRA 1R59O 2HBLA 1OVYA 2DFFA 1SQKA 2E8AA 2ITMA 4CZHA 1N5YA 4LY7A 4YOWA 2KLAA 4KHYA 4FLVA 1RBRA 1HYSA 2WONA 1SKSA 1YVUA 3DLLL 2OYQA 4BR5A 2FSJA 3LM9A 1VHXA 3DRRA 3CJCA 5GAGP 4CF2A 1U6ZA 3DXKB 3CPWM 4CHZA 3LAMA 5KQ8A 4XIUA 1VQ6N 4Z4EA 4CK2A 1GLAG 2NRZA 4CEOA 4CIEA 3KLFA 4ELVA 3THXB 3DLHA 3EZWA 4N5SA 3QLHA 4B8AB 5BPMA 4IO9L 1IG8A 3D6RA 1Q7YO 4IEIA 2EHGA 4FWPA 3HPOA 4HCCA 2A5XA 3LDLA 1U45A 2D0PA 2NUBA 5FDLA 4DV7K 2QA4N 4FWKA 5KGWA 4BR0A 3QICA 4QS8A 4NCAA 4DV0K 4CJ3A 2BGGA 2XY5A 1J54A 3WEEB 3HK2A 4JI3K 4FJ5A 1S1XA 3KWIA 1FJGK 3NF9A 3VEVA 3KK2A 2QWRA 3QBWA 4M3ZA 4E7HA 3CI5A 1F21A 1E4FT 1L3VA 2P9KB 2HHWA 3KKSA 3TAGA 3TAPA 2VWKA 4CJUA 5AZJA 4ICLA 4CGFA 3NMUA 2KFNA 5F2RA 4FM0A 1L5UA 4FK0A 1LW2A 2X6SA 1NU0A 2BH1A 3L3VA 2Q0RA 1ASWA 5M1KA 4ILJA 4NCBA 4IZ9A 1GLBG 4CEZA 4CZKA 4JI1K 1HUXA 3LP1A 3K5LA 4CFDA 5C0YA 1HKGA 1KD1O 3FZLA 3H46O 4B8CA 4O55A 2IAJA 3R9PA 1QVFM 3QDKA 3J7AP 4KV8A 4CJ4A 3D2EB 4IOXA 3HM9A 1RBSA 4B3OA 1RDAA 3ATUA 3SMPA 1HJOA 1WBBA 5AQWA 3Q7BA 5CE3A 3JYTA 1Q81O 3U3GA 3NCIA 3A5LC 2J4RA 1NBWA 4U67L 1HLUA 3C7NB 3DLEA 3I33A 2VYPA 4PA1A 3KK3A 4CCHA 1FW6A 2FBYA 3WXLA 1GOBA 5LJWA 1TKDA 2PYLA 5FPNA 2PFUA 5LJVA 1KAYA 1TKTA 5DMRA 4DTRA 4C8LA 5AQQA 4RTFD 4DLEA 5C2DA 5GIPA 3ZT3A 1QZ5A 3AVNA 1RGIA 4CGHA 3KD1E 4CGIA 2RPIA 3VQ5A 1TYQB 3SJHA 5CYQA 4N76A 1XWLA 2P9PA 5DM6L 2XO7A 1EXQA 5B8HA 4HUGA 2O8CB 3ZT1A 2R7YA 5JLHA 4BR4A 1DKGD 1HNIA 2F7TA 1DT9A 2P51A 4M42A 4BVPA 3BY5A 4Z4GA 2UU9K 4Y1CA 1Z26A 4M3TA 4BACA 4DMNA 5KPZA 1KAXA 3QEWA 1WB9A 1YTUA 3NGIA 4IG3A 3O5BA 1LWEA 3AVJA 1RCHA 1O13A 1JLBA 4H03B 5C12A 2ZGYA 4IJAA 3V81A 3SLCA 1DTTA 5I9EB 4MO5A 3V9ZA 3HJFA 3SAFA 3KLGA 3OS2A 4DTXA 5TKYA 4KHNA 4DV1K 1ASUA 2E6LA 1D8YA 4NXNK 4I9LA 3P38A 2GV9A 3VQDA 3CM6A 1T7PA 4DV3K 2ITGA 3LP2A 5GADP 3VA3A 3H1VX 4AHTA 2UUAK 4FLZA 4HVJA 4JI6K 1QS4A 4DFKA 4RW7A 2FBVA 5AFUH 4IWVA 1HRHA 3VQPA 3SUQA 4CJQA 4J8FA 2OTJN 3F9MA 4CK1A 4DSFA 4W5RA 3H1QA 4R79A 3MK6A 3CCJN 3IFRA 4QCLA 2G8IA 3JSMA 3B8AX 1LAWA 1X9WA 3L2RA 3QEXA 4KHWA 4B1VA 3PO5A 1Q8IA 4CEEA 5AQNA 1S6PA 3SQ1A 4CF1A 4IJNA 4EZ9A 3E9OA 1DTQA 1ZXOA 4PL7A 1RTJA 4O4GA 4DTOA 4X64K 2Q97A 4ZTFA 5J2MA 3Q7CA 2O8FB 1WSGA 3EZ5A 3SMSA 3ISNC 2YNHA 5JS1A 5HRNA 1N34K 2HBKA 5M1PA 3CIPA 3OYEA 3O6WA 4H0TB 2O4IA 1KVBA 3G25A 3WQUA 3QMLA 1EETA 1W7AA 3L8BA 1RFQA 3U9DA 4JKDA 4X62K 3NH2A 3I56N 4I6MA 2ZWHA 4FZYA 1NGIA 3CQ8A 3BZKA 4J2BA 3U8XA 3RR7A 3VGLA 1EKEA 3C94A 4K41A 1N8RO 4B9TA 5E84A 2VCPA 5HP1A 3ZT4A 2HNDA 2HHTA 1OKJA 1VAZA 4E1NA 2ASPA 3HZ6A 1X9JA 3J81O 3OYAA 3THVA 2GBZA 4B1WB 4BRNA 4KH5A 4OPHA 1RDCA 4OVLA 3FE1A 2Q31A 3CFRA 5KTQA 1S72N 3AA5X 2CH5A 4EHTA 5AQYA 3D2FA 4F2RA 4E0DA 4CJ5A 1NK5A 3RWUA 3PY8A 3M5RA 4JAXA 3S41A 3V9UA 1W0HA 1SL0A 4F4KA 5KRSA 2QM1A 4DTUA 3VF6A 1HQEA 3FR0A 3NE6A 5AQZA 3NF6A 2P5OA 5BN8A 1VSIA 3MX5A 4H4OA 4DV5K 3TAQA 1CXQA 4JKAA 1JLAA 1I39A 3H6EA 4QS9A 1S22A 4WQ4A 4WQ5A 2AA4A 3ZCMA 2P9SB 5HRPA 4EAHD 2P9IA 4AHUA 4DUZK 2YHAA 3A5NC 1C0UA 1GLLO 4NCGA 3AVAA 5CZ2A 3EE8A 4F2SA 3WNFA 4DSKA 2I7PA 4BG9A 4O44A 2YHWA 1NGBA 1FKPA 5LMNK 2RE2A 4DR4K 3DXKA 4A5BA 1NGJA 2BDPA 3A2FA 3QIOA 3QETA 4BRGA 4KI6A 1OVQA 1QTMA 3MEEA 4LF6K 4DV6K 1WOQA 1VQNN 3VQBA 4XEIA 2QWNA 3CQXA 2GWKA 3DLRA 3MEDA 3THXA 3HOTA 3NGYA 3HL8A 3QEPA 4FSVA 4CHNA 2OPRA 4BRKA 3BGRA 3MXJA 4X66K 4JKFA 1BWFO 4YOYA 2G8WA 4M3YA 2VG5A 4CD1A 4DV2K 4DTMA 4BRCA 1CLQA 4NYNA 3OYNA 3PLAA 1RTIA 3CMEN 4BRHA 4MFBA 4B9LA 1MDUB 5CYMA 5JICA 1NGFA 4YORA 1SV5A 3TPQA 2P9UB 1T6DA 1YVNA 3QBXA 4ELTA 3OBYA 4BY9C 3C65A 1K8KA 4IXCA 3SCXA 1TV6A 3ZSZA 3R8EA 4OPJA 3CCQN 1TAUA 3V1RA 1NK4A 2WFBA 1P8ZA 2P9KA 1ZBHA 1RT3A 3OVNA 4KO0A 1R0AA 1IO2A 2DY4A 3CD6N 2OZSA 1X9SA 3NH1A 3QINA 3IDHA 3VTIA 3P31A 1JJ2M 4A57A 3FZFA 4OKEA 2A3ZA 4IBNA 4PUOA 3FZKA 4Y0WA 4JLHA 4JEPA 3RMBA 2JWKA 1QZ6A 4CJSA 2Y1JA 2B5JA 2A42A 1YITN 1Y97A 3PUFA 3QIPA 3SUOA 1XHZA 4DR6K 3TR8A 3D2EA 4JHDA 3TU5A 4CGGA 4FVUA 3M1FA 4DCHA 4W5TA 3AA3A 4JS4A 1W2BM 1LWCA 4FWOA 1NK6A 4DB3A 2QKBA 3TSPA 5AJ3K 4JD2B 2KKZA 3VOVA 1J9AA 1VRTA 1RILA 1QQOA 4FW1A 3KHYA 3WQTA 2BE2A 3C7NA 3O3FA 3KTQA 3V1OA 4DFJA 4W5NA 1V4TA 3MX2A 4C8MA 3PX6A 3LDQA 3LDSA 1Z6RA 2HOEA 2P5GA 2AJQA 3RSEB 1IKWA 2HMIA 4BDYA 4CIGA 1NKBA 4H0VB 3VPZA 4M7XA 4NXMK 4JKBA 5CR4A 3LZIA 3S3OA 4MQ3A 3FZMA 4H5RA 2HNZA 2O8BB 4BQLA 4BVOA 3OW2M 3JS6A 2LSNA 1KTQA 3HT3A 1TYQA 1D5AA 5E26A 3M8SA 3CCUN 4FLUA 1RBVA 3A8YA 3LALA 3DLGA 2O8CA 3TANA 1VQLN 5AQXA 3O3HA 3M8RA 1KCFA 3CFPA 4DR1K 3CM5A 1T6CA 4CGDA 1KXPA 3HP6A 3V9XA 5C10A 1G15A 4BGAA 3K57A 2E2NA 1DEJA 2YHXA 2O8EB 2X74A 2QXLA 3O4WA 4R5PA 4ISFA 3V9SA 5CHIA 1Q9YA 3G4SN 3F73A 3D45A 1C1AA 3LANA 3OYFA 1WLJA 4NLCA 2YHYA 4H0YB 1X3NA 4GV9A 4DLGA 1S1UA 3LDNA 4CF0A 3CQYA 3ASMA 3TAMA 3TAEA 2F9TA 4LD0A 1BI4B 4KRFA 1SZ2A 3PO4A 1D9FA 1VSDA 3T3FA 2Y1IA 3ZT2A 1TL3A 4M63C 3DWLA 3SAGA 3CC7N 2PBDA 4H5WA 5AQTA 3GG4A 5IWAK 5FRNA 4LFBK 2VG6A 3ENHA 1T03A 3HBTA 2VGMA 5M1FA 3VQ6A 5BRHA 4BC3A 1NKEA 3DMJA 4K43A 4BRQA 3L2WA 2ZM6K 3KZBA 4C1NI 4DU4A 1XC9A 4CECA 3OJUA 3V4IA 4GNIA 5KPRA 4DTSA 4L8RB 1A5XA 3UKUA 4EZ6A 2E1ZA 4E7IA 4H8KA 1NK0A 1NJZA 4HHTA 2D4WA 5TKWA 1KQSM 4FPAA 4JYAK 2IDOA 3JXUA 5LL6Z 4CESA 5HROA 5SZTA 3QESA 3R3LA 3VMFB 3KD5E 2ATQA 4FOEA 1NJIO 4JKGA 4NB4A 3K5NA 5C42A 3EYZA 4EP4A 3PIOL 1SL1A 3TSQA 2YJFA 3O9SA 1RTDA 1VQKN 3AO1A 4CZLA 4B9UA 1D9DA 3PX0A 3RVCA 3VERA 5A2QO 3AO2A 4EFHA 1GOAA 1A5WA 1EQYA 1JLEA 4O5FA 4F9OA 3ZX2A 1QQNA 3MN5A 4BWJA 4A2AA 4KHPK 2KW4A 3SUNA 3DXMB 5ADXH 1JKHA 1V4SA 4CEDA 4IG0A 4AM6A 2QWOA 4JI2K 4IOCL 5E41A 1JXEA 3ZSXA 4V19S 4J2DA 3LPTA 4OGCA 5LMUK 4WFBL 1HR0K 5J2QA 2X6NA 3BEXA 3DM2A 4DR7K 2HHHK 1EP4A 1N36K 1U49A 1RBUA 3T69A 4DV4K 2NLXA 4CHQA 4HTUA 1IBMK 1KRPA 1IG9A 3O8MA 4B3RK 3J8AA 2A1RA 3CETA 3WT0A 4LH5A 5CZ1A 2YNFA 3HPGA 4I7FA 1T05A 3AVFA 4H0PA 4KI4A 5ELZA 4CK3A 4ISGA 5I3UA 4IEEA 4PY5A 3MCAB 3A5MC 5IT9O 2I7NA 1EO1A 4DUYK 4BR2A 3R1XA 3PIPL 4FO0A 3LP3A 3VESA 2XHBA 3K59A 1ASVA 3OY9A 4DKWA 1CZ9A 4C8KA 3H08A 2HB5A 5F1XA 2E5LK 3LL3A 3ULEA 1NM1A 3GDQA 4IO8A 3HO1A 1T8EA 1Q18A 1J5EK 1W9HA 3CG7A 4O8UA 3OJSA 2YNIA 5FROA 1REVA 3SNNA 1SUQA 1ESVA 1OH6A 3VQEA 3K58A 4BC2A 4WFNL 2OPQA 4E3SA 1YT3A 4CJKA 1MWMA 2DFEA 5HBMA 4GY2B 1NOYA 3P1GA 3OYKA 5I42A 2FSKA 3QO9A 1YJNN 3HM8A 3TTDA 2E2OA 1LAVA 3OA9A 4TSXA 1XMOK 3T19A 3UKRB 3SAHA 4EP5A 4JK9A 5AQPA 2WC9A 3RTVA 4CZMA 1RT2A 2GX9A 4B1YB 3B6OA 5AQOA 2OA8A 2YV0X 2ZGZA 3H3NO 2EWSA 3HTVA 1BU6O 3CJ9A 4JV5K 3G10A 2OTLN 4MO4A 2UUCK 1UWBA 3WNGA 3QFPA 1XI1A 4CE9A 1JLGA 2W41A 5M1OA 5BPNA 1GLFO 3FZHA 4CJTA 5AQHA 4Z4IA 5SWMA 2NRTA 4AH9A 1VQPN 4J2EA 3DOLA 1N6QA 1S5JA 3PSIA 3NGZA 2A40A 2DTUA 3LZJA 1S1TA 4AHSA 1S9EA 4O0IA 1BHLA 2V51B 3ZEUB 4OLAA 1VSEA 1HNXK 3AVIA 3ZETA 2PY5A 4KREA 3CPEA 2EX3A 3O08A 4JKEA 4Y1DA 2QWLA 3ZLJA 1JL1A 1LV5A 3BF3A 1SKRA 3F5TA 3ALYA 3S9HA 3BUZB 3UB5A 4RW6A 1IBKK 5KGXA 2IIRA 3VEWA 4YNQA 4IFEA 4C1NK 1I3AA 3AO4A 4A59A 1ZC6A 4CZJA 4DHYA 1EX4A 3SV4A 1JLQA 3GE1A 2QW9A 3CJ1A 4ILHA 3V9WA 1QHAA 3THYB 4JD2A 3ZSYA 4BRMA 2Z1JA 3CJAA 1HQUA 4OJRA 2V52B 1YTAA 3VQ4A 1WBDA 1TK5A 4FJGA 1K8AO 4GV3A 1YHQN 2ASMA 4XH5A 1ZBFA 1J53A 5HLFA 1C0TA 2F9WA 3OYHA 1C6VA 4E7LA 4YOUA 2A6AA 2F8SA 4DQIA 1MWKA 4H4MA 4LFCK 5AZJB 2O8BA 1DLOA 4JI7K 3U6FA 5JS2A 1IBLK 4H5VA 3VN5A 4CEAA 4M45A 3VA0A 3LDOA 4CEFA 3MWTA 4KFBA 3ATVA 4KH4A 1VQ8N 4K25A 2Q36A 3DYAA 3C6UA 4OX9K 1VSKA 2QTDA 1VSFA 2KZZA 4BDPA 1Z25A 1NMNA 4CD3A 4FCYA 3C6TA 2KHOA 2OPPA 5J2PA 5EOYA 3C95A 5AQMA 2YJEA 3QEIA 4FJIA 2XY8A 1BCOA 2YX6A 2O8EA 1LOTB 3FLCO 3S3NA 5BR8K 1BO5O 3NDKA 2GUPA 2HHQA 1Q86O 1BDGA 3L4QA 2D0CA 4DSLA 3ID8A 2WOMA 3ZYYX 1JCFA 1QQCA 2P9LB 5KI6A 4CERA 3M6GA 3ZSRA 4B08A 3ID6A 4JKCA
chains in the Genus database with same CATH topology
3C7NA 3QICA 3OBWA 4QS8A 1HPMA 3WEEB 1YJWN 1V4TA 2QWPA 3MX2A 4A61A 5AQLA 5ADXA 1IJJA 3KWIA 3VEVA 5F0XA 4H5NA 3TTFA 2QWRA 3LDQA 3QBWA 1Z6RA 3CI5A 2HOEA 4RWTA 3RSEB 1E4FT 2UYTA 2CGLA 2P9KB 1VQ7N 3T7ZA 1E4GT 5EXWA 1ZBSA 1XC3A 3ZX0A 4H0VB 3HRGA 3VPZA 5AZJA 4M7XA 2D1KA 1T44A 3NMUA 4B1XB 4JN4A 5F2RA 4JKBA 5CR4A 3MN9A 4YOTA 3FZMA 4H5RA 5FPMA 1ATSA 3ENBA 4BQLA 4OO1J 4BVOA 3OW2M 3JS6A 2BH1A 1TYQA 2Q0RA 2E20A 1YJ9N 5M1KA 4ILJA 4IZ9A 5E26A 1GLBG 4CZKA 2DPNA 3CCUN 4BRFA 3A8YA 2NZTA 1RDWX 1HUXA 3CXCM 3IKMA 2YCHA 4JK8A 3VENA 2HF3A 2HBJA 5C0YA 1HKGA 1KD1O 3FZLA 2P9PB 4B9QA 1VQLN 3H46O 5AQXA 5EX5A 1KC8O 1ILYA 2P9NB 1QVFM 3R9PA 4HTLA 4YDUC 3MN6A 2ZJQL 3QDKA 4AF1A 1J6ZA 1T6CA 1KXPA 3D2EB 1BG3A 3E1YA 1GLEG 5C10A 4IOXA 4BGAA 2E2NA 1DEJA 2YHXA 1NGEA 3WXIA 3ATUA 1NGAA 5AQFA 4BR7A 4MLHA 3SMPA 2QXLA 3DAWA 2FF3B 3O4WA 4CZFA 1HJOA 4ISFA 5AQWA 3P4IA 3O1BA 3Q7BA 3UKUB 5CE3A 5CHIA 3G4SN 4BQZA 5HL7L 1Q81O 4FPBA 3A5LC 2NNWA 2J4RA 3WEEA 1NBWA 4U67L 1KAZA 4NLCA 5BR9A 1HLUA 2YHYA 3C7NB 1X3NA 4H0YB 4GV9A 3D7EO 3I33A 3LDNA 1VQON 3CQYA 3O9TA 3VF2A 2VYPA 4MLEA 2F9TA 4MDAA 3RSEA 4EHUA 3WXLA 5LJWA 1SZ2A 1JCEA 4JKGB 5FPNA 2PFUA 1JCGA 1GLCG 5LJVA 5H1SQ 1KAYA 1U2VA 3R6MA 2BTFA 5AQQA 4RTFD 3AAQA 1BA1A 2QWQA 4QS7A 5C2DA 3AY9A 5MLCQ 2RHKA 5GIPA 4ISEA 3DWLA 4M63C 4WF9L 3SAGA 1QZ5A 1RGIA 4FWMA 3CC7N 3E9LA 3H3OB 4O8KA 4BC5A 4BR9A 2PBDA 2E2QA 2E2PA 4H5WA 4BRAA 5AQTA 3GG4A 1TYQB 3SJHA 3ENHA 1YXQA 4IDHA 3HBTA 4H5TA 3MN7A 2P9PA 3VEXA 2VGMA 5DM6L 5M1FA 5BRHA 2WUSA 5B8HA 4BC3A 5JLFA 3WXJA 4K43A 5JLHA 1VQ4N 4BR4A 1DKGD 2F7TA 4BRQA 1DT9A 4BROA 1C0GA 4BVPA 3KZBA 1DGKN 4WFAL 4C1NI 1Q82O 3NVKA 3P39A 4BRLA 4G9ZA 5KPZA 3N4QA 1KAXA 3CCSN 4GNIA 1VQMN 5KPRA 2FF6A 3O5BA 4BC4A 5FPEA 2NRXA 3QB0A 3UKUA 2E1ZA 4IOAL 2ZF5O 2V7ZA 1O13A 4H03B 5BREA 5C12A 1YIJN 1KQSM 2D4WA 5TKWA 4U7BA 3SBTA 2ZGYA 4FPAA 1GLDG 4IJAA 3WUHA 5AFUA 5GAEP 3JXUA 3SLCA 3VGMA 3R3LA 5I9EB 3VMFB 4MO5A 2VWBA 4XH1A 5LY3A 3SAFA 2NRVA 4FOEA 1NJIO 5AQSA 2NRWA 1BA0A 1P90A 3A0IX 4JKGA 4JK7A 4NB4A 5TKYA 3MCPA 4BRIA 2Q1NA 3P38A 3PIOL 3L0QA 2JWLA 2GTDA 4GVEA 3TSQA 2YJFA 1U2VB 3O9SA 2BUPA 3CERA 5AR0A 3VETA 4CZLA 5C15A 1QVGM 1VQKN 5GADP 3H1VX 3RVCA 2QWMA 3FGUA 4H0OA 3VERA 2CH6A 4EFHA 1NLVA 1SAZA 5JMVA 4FOIA 3C6HA 4H0XB 1EQYA 4JNEA 4I6MB 4O5FA 4F9OA 5AFUH 4RCHA 3ZX2A 4IWVA 1QQNA 3MN5A 4CBXA 4CZEA 4PKGA 4NO7A 4A2AA 1M1KO 2GEMA 3W0LA 4J8FA 2OTJN 1Z05A 2AP1A 1RDUA 3DXMB 3F9MA 1V4SA 5ADXH 1NGGA 3ULEB 4AM6A 4CBUA 2QWOA 3H1QA 4IOCL 4LC9B 4PL8A 4R79A 5EY4A 1K73O 3MK6A 5EVZA 3CCEN 1YAGA 1CZAN 1XQSC 3IFRA 3CCJN 1YF5L 3WXMB 3CCRN 4CBWA 3B8AX 2CGJA 4WFBL 3O9UA 3BEXA 4B1VA 5AQNA 5AQKA 5AQGA 3T69A 4NLBA 3O9RA 2NLXA 4IJNA 4Z94A 1QQMA 3E9OA 1ZXOA 3VEOA 4PL7A 4BRDA 2CGKA 2GWJA 1NGHA 2Q97A 3O8MA 4ILGB 5BRDA 3IMXA 3EE9A 3Q7CA 1VQ9N 3J8AA 3L6QA 4CI6A 3U4LA 3CETA 1Y64A 3CJBA 3H45C 3WT0A 3SMSA 3CC4N 4H0PA 1SS6A 3CMAN 3E66A 3I8BA 2HBKA 5M1PA 3CIPA 4MDBA 3VEZA 5ELZA 3G71N 4BRPA 3EO3A 4ISGA 4IEEA 3O6WA 3MCAB 3A5MC 4H0TB 3G25A 4B1UB 2ZJRL 2I7NA 3O1WA 3WQUA 1EO1A 4BR2A 3R1XA 3QMLA 2Q0UA 3OHRA 4PKHA 3PIPL 3I55N 2FXUA 2IVPA 5AQIA 3AARA 5AQVA 4FO0A 3CCLN 2QI2A 3VESA 1G99A 1RFQA 3U9DA 4JKDA 3I56N 4I6MA 2E88A 2ZWHA 1NGIA 2OANA 2QEXN 4CZGA 3U8XA 4DQ8A 2HF4A 3VGLA 4DKWA 3EKUA 4K41A 5F1XA 2P9IB 1N8RO 3TTCA 5E84A 2VCPA 3DXMA 3LL3A 3ULEA 1NM1A 3GDQA 3W3DA 4IO8A 4GV6A 1C0FA 1OKJA 1VAZA 3ZEUA 1Q18A 2ASPA 3HZ6A 1X9JA 5GIOA 4O8UA 4WYBA 4B1WB 4KH6A 3VEYA 1ESVA 4BC2A 4BRNA 4KH5A 4OPHA 3ZETB 4WFNL 3FE1A 5HOOA 3AAPA 3HSCA 4A2BA 3GBTA 1MWMA 2Q31A 4KBOA 3HOSA 1TUUA 2FLOA 1S72N 1H1VA 1S3XA 4GY2B 1K9MO 4M7YA 1XUPO 5M1QA 2FSKA 2CH5A 1NMDA 5AQYA 4EHTA 1BOTO 3D2FA 3BP8A 1YJNN 3KK7A 1LCUA 3LDPA 3HM8A 2NRHA 4WQ4C 1X3MA 3TTDA 2E2OA 3GOIA 3M5RA 3OA9A 4JAXA 4WQ5C 3SK3A 3VF4A 3S41A 3QFUA 2HMPA 5AZIA 3UKRB 3SAHA 4FWLA 4UY8O 4JK9A 5AQPA 2QM1A 2WC9A 4A5AA 4HWIA 3VF6A 3CJ7A 3BF1A 3FR0A 4CZMA 4CJ7A 2GX9A 5AQZA 3UE5A 4B1YB 2A41A 5AQOA 2ZGZA 3H3NO 5BN8A 3U9ZA 2EWSA 5AQRA 3HTVA 3F2KA 3MX5A 3A5OC 3TSUA 1BU6O 2IVNA 1ATRA 4JKAA 3O80A 3CJ9A 3WXKA 3G6EN 3H6EA 3L4IA 2OTLN 4MO4A 3C0BA 4FWQA 3ZX3A 4QS9A 5BN9A 1S22A 2HSTA 3QFPA 4WQ4A 2W41A 4WQ5A 5M1OA 5BPNA 1GLFO 5JVHL 1K8KB 3FZHA 1MA9B 2AA4A 2P9SB 5AQHA 4EAHD 2NRTA 2P9IA 1VQPN 2PAVA 1M90O 1HKBA 1W97L 1WUAA 3A5NC 4YOXA 2A40A 3EKSA 1GLLO 3EL2A 4FWSA 3MWPA 3KVGA 5AQJA 2V51B 3ZEUB 3EE8A 1YI2N 2I7PA 3FFKB 1NGDA 3ZETA 2IVOA 4BG9A 3CPEA 4YOVA 4PHTX 1TUYA 2YHWA 1NGBA 3LM2A 3O08A 4JKEA 1HKCA 2QWLA 5GINA 2RE2A 5AQUA 4A62A 2HBMA 4FWNA 2D0OA 3DXKA 4A5BA 1NGJA 3BF3A 4C23A 3F5TA 3VGKA 3BUZB 3UB5A 3GL1A 3E9PA 2H3GX 3O9QA 4E1JA 5FPDA 3AGRA 4BRGA 5BPLA 3CCVN 5DM7L 2IIRA 3VEWA 4IFEA 1WOQA 4C1NK 3M3ZA 1VQNN 3D2FB 4FL9A 3KWGA 3MDQA 3SBGA 3CC2N 4BG8A 2YI1A 4AM7A 3UKRA 4A59A 4XEIA 2QWNA 3CQXA 2GWKA 1ZC6A 2VGNA 3MMVA 4CZJA 3HOTA 4DHYA 4FSVA 4BR0A 4BRKA 4JKFA 1BWFO 5AZIB 4YOYA 4CD1A 4JHDB 3N4PA 2NRRA 3GE1A 4K42A 4XH4A 2QW9A 4BRCA 5KQDA 3CJ1A 4ILHA 1HX1A 3PLAA 3CMEN 4BRHA 3C6AA 1QHAA 2ZJPL 1MDUB 4JD2A 5JICA 2P9LA 4BREA 1NGFA 4YORA 1GLJO 3J7ZO 4CZIA 3TPQA 4BRMA 2P9UB 1T6DA 3CJAA 1YUWA 2V7YA 4WCEL 1YVNA 3QBXA 1ATNA 3OBYA 1D4XA 5BRFA 3C65A 2V52B 1K8KA 4BY9C 4IXCA 2P9SA 4YDUA 1VQ5N 5C2FA 1K8AO 4GV3A 3R8EA 3VTHA 3CCQN 5GAHP 1YHQN 2ASMA 4XH5A 3CHWA 2WFBA 1R59O 4JKHA 1P8ZA 2HBLA 2P9KA 1OVYA 1SQKA 2E8AA 3CD6N 3NVMA 4OPAA 2F9WA 2Q2RA 2ITMA 4CZHA 4YOUA 3IDHA 3VTIA 2ASOA 2A6AA 5M1NA 2KLAA 3P31A 4YOWA 1JJ2M 1MWKA 3K9KA 5AZJB 4A57A 3FZFA 3DLLL 2A3ZA 1NGCA 2FSJA 2WBNA 3LM9A 4BR5A 3FZKA 4H5VA 3CJCA 4Y0WA 4B1ZA 2GELA 3LDOA 5GAGP 3MWTA 3ATVA 4KH4A 1U6ZA 3DXKB 4JEPA 2E1YA 2JWKA 4K25A 3CPWM 1VQ8N 1NWKA 4FWRA 3AGKA 3IUCA 1QZ6A 2Q36A 2FSNA 5KQ8A 5JVGL 3ENOA 4L3QA 1VQ6N 1BUPA 2P9NA 2QTDA 1GLAG 2A42A 2NRZA 1YITN 4CD3A 4BGBA 2KHOA 3DJCA 5EOYA 3D2EA 4JHDA 3CF5L 5AQMA 3K9JA 2YJEA 3EZWA 3TU5A 4FVUA 2YX6A 3M1FA 4DCHA 2W40A 1LOTB 5BPMA 4IO9L 3FLCO 1IG8A 1W2BM 1BO5O 3D6RA 1T3VA 1Q7YO 4FWOA 2GUPA 4PKIA 1BDGA 1Q86O 4IEIA 3L4QA 4DB3A 3ID8A 3TSPA 2KKZA 4JD2B 3EN9A 4FWPA 3VOVA 2P9UA 1JCFA 2P9LB 3ZYYX 4EIAA 2A5XA 3HI0A 3LDLA 1QQOA 2D0PA 3M6GA 2QA4N 3ID6A 4FWKA 3KHYA 4JKCA 5KPTA 3CCMN 3WQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7N A;  3QIC A;  4QS8 A;  1HPM A;  3WEE B;  1V4T A;  2QWP A;  4A61 A;  5AQL A;  5ADX A;  1IJJ A;  5F0X A;  3VEV A;  4H5N A;  2QWR A;  3LDQ A;  3QBW A;  1Z6R A;  3CI5 A;  2HOE A;  4RWT A;  3RSE B;  1E4F T;  2UYT A;  2CGL A;  2P9K B;  1E4G T;  5EXW A;  1ZBS A;  1XC3 A;  3ZX0 A;  4H0V B;  3VPZ A;  5AZJ A;  4M7X A;  2D1K A;  1T44 A;  4B1X B;  4JN4 A;  5F2R A;  3MN9 A;  3FZM A;  4H5R A;  5FPM A;  1ATS A;  4BQL A;  4BVO A;  3JS6 A;  1TYQ A;  2Q0R A;  2E20 A;  4IZ9 A;  5E26 A;  1GLB G;  4CZK A;  2DPN A;  4BRF A;  3A8Y A;  2NZT A;  1RDW X;  1HUX A;  2YCH A;  3VEN A;  2HF3 A;  1HKG A;  3FZL A;  2P9P B;  4B9Q A;  3H46 O;  5AQX A;  5EX5 A;  2P9N B;  3R9P A;  4HTL A;  4YDU C;  3MN6 A;  3QDK A;  1J6Z A;  1T6C A;  1KXP A;  3D2E B;  1BG3 A;  1GLE G;  4BGA A;  2E2N A;  1DEJ A;  2YHX A;  1NGE A;  3WXI A;  3ATU A;  1NGA A;  5AQF A;  4BR7 A;  4MLH A;  3SMP A;  2QXL A;  3DAW A;  2FF3 B;  3O4W A;  4CZF A;  1HJO A;  4ISF A;  5AQW A;  3P4I A;  3O1B A;  3UKU B;  5CE3 A;  4BQZ A;  4FPB A;  3A5L C;  2J4R A;  3WEE A;  1NBW A;  1KAZ A;  5BR9 A;  1HLU A;  2YHY A;  3C7N B;  1X3N A;  4H0Y B;  3D7E O;  3I33 A;  3LDN A;  3CQY A;  3VF2 A;  2VYP A;  4MLE A;  2F9T A;  3RSE A;  4EHU A;  3WXL A;  5LJW A;  1SZ2 A;  1JCE A;  5FPN A;  1JCG A;  1GLC G;  5LJV A;  1KAY A;  1U2V A;  3R6M A;  2BTF A;  5AQQ A;  4RTF D;  3AAQ A;  1BA1 A;  2QWQ A;  4QS7 A;  3AY9 A;  4ISE A;  3DWL A;  4M63 C;  1QZ5 A;  1RGI A;  4FWM A;  3H3O B;  4O8K A;  4BC5 A;  4BR9 A;  2PBD A;  2E2Q A;  2E2P A;  4H5W A;  4BRA A;  5AQT A;  3GG4 A;  1TYQ B;  3SJH A;  3ENH A;  1YXQ A;  3HBT A;  4H5T A;  3MN7 A;  2P9P A;  3VEX A;  5BRH A;  2WUS A;  5B8H A;  4BC3 A;  5JLF A;  3WXJ A;  4K43 A;  5JLH A;  4BR4 A;  1DKG D;  4BRQ A;  4BRO A;  1C0G A;  4BVP A;  3KZB A;  1DGK N;  4BRL A;  5KPZ A;  1KAX A;  4GNI A;  5KPR A;  2FF6 A;  3O5B A;  4BC4 A;  5FPE A;  3QB0 A;  3UKU A;  2E1Z A;  2ZF5 O;  2V7Z A;  4H03 B;  5BRE A;  2D4W A;  2ZGY A;  4FPA A;  1GLD G;  4IJA A;  3WUH A;  5AFU A;  3JXU A;  3SLC A;  3VGM A;  5I9E B;  4MO5 A;  2VWB A;  4XH1 A;  5LY3 A;  4FOE A;  5AQS A;  3A0I X;  1BA0 A;  4NB4 A;  5TKY A;  3MCP A;  4BRI A;  2Q1N A;  3L0Q A;  2GTD A;  2YJF A;  1U2V B;  5AR0 A;  2BUP A;  3CER A;  3VET A;  4CZL A;  3H1V X;  3VER A;  2QWM A;  3FGU A;  4H0O A;  2CH6 A;  4EFH A;  1NLV A;  1SAZ A;  5JMV A;  4FOI A;  4H0X B;  1EQY A;  4JNE A;  4I6M B;  4O5F A;  4F9O A;  5AFU H;  4RCH A;  3ZX2 A;  4IWV A;  1QQN A;  3MN5 A;  4CBX A;  4PKG A;  4NO7 A;  4A2A A;  2GEM A;  3W0L A;  4J8F A;  1Z05 A;  2AP1 A;  3DXM B;  3F9M A;  5ADX H;  1V4S A;  1NGG A;  3ULE B;  4AM6 A;  4CBU A;  2QWO A;  3H1Q A;  4LC9 B;  4PL8 A;  5EY4 A;  3MK6 A;  5EVZ A;  1YAG A;  1CZA N;  1XQS C;  3IFR A;  4CBW A;  3B8A X;  2CGJ A;  3BEX A;  4B1V A;  5AQN A;  5AQK A;  5AQG A;  4IJN A;  2NLX A;  4Z94 A;  1QQM A;  1ZXO A;  3VEO A;  4PL7 A;  4BRD A;  2CGK A;  2GWJ A;  1NGH A;  2Q97 A;  3O8M A;  5BRD A;  3IMX A;  3J8A A;  3L6Q A;  4CI6 A;  3U4L A;  3CET A;  1Y64 A;  3CJB A;  3H45 C;  3WT0 A;  3SMS A;  4H0P A;  3I8B A;  3VEZ A;  3CIP A;  5ELZ A;  4BRP A;  3EO3 A;  4ISG A;  3O6W A;  4H0T B;  3A5M C;  3G25 A;  4B1U B;  2I7N A;  3O1W A;  3WQU A;  4BR2 A;  4PKH A;  3QML A;  2Q0U A;  3OHR A;  2FXU A;  2IVP A;  5AQI A;  3AAR A;  5AQV A;  4FO0 A;  3VES A;  1G99 A;  1RFQ A;  3U9D A;  4I6M A;  2E88 A;  2ZWH A;  1NGI A;  2OAN A;  4CZG A;  3U8X A;  4DQ8 A;  2HF4 A;  3VGL A;  3EKU A;  4K41 A;  5F1X A;  2P9I B;  5E84 A;  2VCP A;  3DXM A;  3LL3 A;  3ULE A;  1NM1 A;  3GDQ A;  3W3D A;  4IO8 A;  1C0F A;  1OKJ A;  3ZEU A;  1Q18 A;  2ASP A;  3HZ6 A;  1X9J A;  4WYB A;  4B1W B;  3VEY A;  1ESV A;  4BC2 A;  4BRN A;  3ZET B;  3FE1 A;  3AAP A;  3HSC A;  4A2B A;  3GBT A;  1MWM A;  2Q31 A;  4KBO A;  1TUU A;  2FLO A;  1H1V A;  1S3X A;  4GY2 B;  4M7Y A;  1XUP O;  2FSK A;  2CH5 A;  1NMD A;  5AQY A;  4EHT A;  1BOT O;  3D2F A;  3BP8 A;  1LCU A;  3LDP A;  3HM8 A;  2NRH A;  4WQ4 C;  1X3M A;  3VF4 A;  2E2O A;  3GOI A;  4JAX A;  3SK3 A;  4WQ5 C;  3S41 A;  3QFU A;  2HMP A;  5AZI A;  3UKR B;  4FWL A;  5AQP A;  2QM1 A;  4HWI A;  3VF6 A;  3CJ7 A;  3BF1 A;  3FR0 A;  4CZM A;  4CJ7 A;  5AQZ A;  3UE5 A;  4B1Y B;  2A41 A;  5AQO A;  2ZGZ A;  3H3N O;  5BN8 A;  3U9Z A;  2EWS A;  5AQR A;  3HTV A;  3A5O C;  1BU6 O;  2IVN A;  1ATR A;  3O80 A;  3CJ9 A;  3WXK A;  3H6E A;  3L4I A;  4MO4 A;  3C0B A;  4FWQ A;  3ZX3 A;  4QS9 A;  5BN9 A;  1S22 A;  3QFP A;  4WQ4 A;  2W41 A;  4WQ5 A;  5BPN A;  1GLF O;  1K8K B;  3FZH A;  1MA9 B;  2AA4 A;  2P9S B;  5AQH A;  4EAH D;  2P9I A;  2PAV A;  1HKB A;  1WUA A;  3A5N C;  2A40 A;  3EKS A;  1GLL O;  3EL2 A;  4FWS A;  3KVG A;  5AQJ A;  2V51 B;  3ZEU B;  2I7P A;  3FFK B;  1NGD A;  3ZET A;  2IVO A;  4BG9 A;  1TUY A;  2YHW A;  1NGB A;  3LM2 A;  3O08 A;  1HKC A;  2QWL A;  5AQU A;  4A62 A;  4FWN A;  2D0O A;  3DXK A;  1NGJ A;  3BF3 A;  4C23 A;  3VGK A;  3BUZ B;  3UB5 A;  3GL1 A;  4E1J A;  2H3G X;  5FPD A;  4BRG A;  5BPL A;  2IIR A;  3VEW A;  1WOQ A;  3M3Z A;  3D2F B;  4FL9 A;  3MDQ A;  4BG8 A;  2YI1 A;  4AM7 A;  3UKR A;  4XEI A;  2QWN A;  3CQX A;  2GWK A;  1ZC6 A;  3MMV A;  4CZJ A;  4DHY A;  4FSV A;  4BR0 A;  4BRK A;  5AZI B;  1BWF O;  4CD1 A;  4JHD B;  3GE1 A;  4K42 A;  4XH4 A;  5KQD A;  2QW9 A;  4BRC A;  3CJ1 A;  1HX1 A;  4BRH A;  1QHA A;  1MDU B;  4JD2 A;  5JIC A;  2P9L A;  4BRE A;  1NGF A;  1GLJ O;  4CZI A;  3TPQ A;  4BRM A;  2P9U B;  1T6D A;  3CJA A;  1YUW A;  2V7Y A;  1YVN A;  3QBX A;  1ATN A;  1D4X A;  5BRF A;  2V52 B;  1K8K A;  4IXC A;  2P9S A;  4YDU A;  3R8E A;  2ASM A;  4XH5 A;  3CHW A;  1R59 O;  1P8Z A;  2P9K A;  1SQK A;  2E8A A;  2F9W A;  2Q2R A;  2ITM A;  4CZH A;  3IDH A;  2ASO A;  2A6A A;  1MWK A;  5AZJ B;  3FZF A;  2A3Z A;  1NGC A;  2FSJ A;  4BR5 A;  3LM9 A;  3FZK A;  4H5V A;  3CJC A;  4Y0W A;  4B1Z A;  2GEL A;  3LDO A;  3ATV A;  1U6Z A;  3DXK B;  4K25 A;  2E1Y A;  1NWK A;  4FWR A;  3IUC A;  1QZ6 A;  2Q36 A;  2FSN A;  5KQ8 A;  3ENO A;  4L3Q A;  1BUP A;  2P9N A;  1GLA G;  2A42 A;  4CD3 A;  4BGB A;  2KHO A;  3DJC A;  5EOY A;  3D2E A;  4JHD A;  5AQM A;  3TU5 A;  2YJE A;  3EZW A;  3M1F A;  4DCH A;  2W40 A;  1LOT B;  5BPM A;  3FLC O;  1IG8 A;  1BO5 O;  4FWO A;  2GUP A;  4PKI A;  1BDG A;  4DB3 A;  3ID8 A;  4JD2 B;  3EN9 A;  4FWP A;  3VOV A;  2P9U A;  1JCF A;  2P9L B;  4EIA A;  2A5X A;  3HI0 A;  3LDL A;  1QQO A;  2D0P A;  3M6G A;  4FWK A;  3KHY A;  4CZE A;  5KPT A;  3WQT A; 
#chains in the Genus database with same CATH topology
 3OBW A;  2QWP A;  2PZS A;  4JRQ A;  1IJJ A;  3E01 A;  5F0X A;  4H5N A;  3TTF A;  4PWD A;  1XNR K;  4RWT A;  2UYT A;  1VSJ A;  1FK9 A;  2FBX A;  1FXX A;  4FLT A;  1VQ7 N;  3T7Z A;  1E4G T;  3T1Y K;  3OTO K;  2D1K A;  1T44 A;  4GVM A;  4B1X B;  4CEB A;  3LWL A;  1S1V A;  1RBT A;  5FPM A;  3SQ2 A;  2E20 A;  1Q9X A;  3DRS A;  3V6D A;  1J5O A;  1LWF A;  3PV8 A;  2NZT A;  2HHX A;  3CXC M;  3TAR A;  3VEN A;  2F96 A;  2HBJ A;  2P9P B;  1KC8 O;  2KFZ A;  2P9N B;  3MN6 A;  2ZJQ L;  4FJN A;  4LFA K;  1J6Z A;  1HNV A;  1B92 A;  1GLE G;  1NGE A;  1JLC A;  3THW B;  3WXI A;  4M3W A;  1NGA A;  5AQF A;  2XY6 A;  4MLH A;  4OGE A;  1IKY A;  3DAW A;  2FF3 B;  4CZF A;  1HNW K;  4PQU A;  5J2N A;  3P4I A;  3O1B A;  4BQZ A;  5HL7 L;  4FPB A;  2VG7 A;  3SQ4 A;  1BQM A;  3WEE A;  4Z4C A;  1KAZ A;  5BR9 A;  4CJP A;  1CZB A;  5HRS A;  4DQP A;  1QHT A;  4FZX C;  4MDA A;  4EHU A;  3TI0 A;  1JCG A;  5H1S Q;  1RDD A;  2OPS A;  1BIZ A;  1FKO A;  1N33 K;  4FW2 A;  4HCB A;  2QWQ A;  1SL2 A;  1VRU A;  3P5J A;  3OS1 A;  4WF9 L;  3KIO A;  4FWM A;  3E9L A;  4O8K A;  4BR9 A;  2F4V K;  1QE1 A;  2E2Q A;  2P1J A;  2X78 A;  3RRG A;  3QNO A;  4E7J A;  1WSF A;  4IDH A;  4B3M K;  2G8U A;  5JLF A;  5K14 A;  4CJE A;  4BRO A;  2W6K A;  1E3M A;  4BE2 A;  1Q82 O;  1KVA A;  3NVK A;  3P39 A;  4BRL A;  4G9Z A;  3N4Q A;  1NJW A;  2HHV A;  3CCS N;  1BCM A;  3O4N A;  4FJK A;  3ZSW A;  3MXM A;  5FPE A;  2NRX A;  3KLE A;  1IKX A;  2V7Z A;  4B9M A;  4CVN E;  1GLD G;  3WUH A;  4LF8 K;  1RDB A;  3ITH A;  3HVR A;  2VWB A;  4XH1 A;  5LY3 A;  3OYL A;  3I0R A;  3SV3 A;  5AQS A;  1TGO A;  4FVM A;  3A0I X;  1BA0 A;  4JK7 A;  4DG1 A;  4JRP A;  3MCP A;  1X1P A;  4BRI A;  3K5O A;  2YHB A;  3NFA A;  4KTQ A;  1U2V B;  5AR0 A;  3VQ8 A;  1QVG M;  3VET A;  5C15 A;  4DF4 A;  2QWM A;  4KTW A;  4H0O A;  4JI8 K;  2CH6 A;  1MU2 A;  1SAZ A;  2KZM A;  4LH4 A;  4JNE A;  4I6M B;  4F3T A;  4HUE A;  1L3S A;  4FJ9 A;  4FK4 A;  3SPY A;  4PKG A;  4NO7 A;  1ITG A;  1M1K O;  2GEM A;  3NF8 A;  3W0L A;  2AP1 A;  1RDU A;  2RKI A;  1NGG A;  4B9S A;  4CF9 A;  3J7Y P;  4PL8 A;  1K73 O;  5EY4 A;  4X65 K;  1RT7 A;  4CJW A;  5FRM A;  1CZA N;  1XQS C;  3WXM B;  2ZD1 A;  3CCR N;  4CBW A;  2CGJ A;  4DQS A;  1VSM A;  4KKO A;  1RT6 A;  3JAM O;  3DLK A;  3BZC A;  5AQK A;  5AQG A;  4Z94 A;  1QQM A;  1HMV A;  4LSL A;  4BRD A;  2CGK A;  1A5V A;  1VK0 A;  5C24 A;  1BIS A;  5BRD A;  3KJV A;  1CXU A;  1VQ9 N;  3P83 D;  1U47 A;  1BGX T;  1Y64 A;  3CJB A;  4WE1 A;  3CC4 N;  4QOZ B;  3OYD A;  4OKJ A;  1BQN A;  4DFP A;  3CMA N;  3E66 A;  3I8B A;  4MDB A;  4JS5 A;  4YY3 K;  4BRP A;  3EO3 A;  5C25 A;  2ZJR L;  1RT5 A;  4I2P A;  4PKH A;  3D0P A;  2FXU A;  2IVP A;  5AQV A;  3AAR A;  2QI2 A;  3L2U A;  2IOC A;  1UAX A;  2E88 A;  2QEX N;  4CZG A;  4FJX A;  3EKU A;  3V1Q A;  2FC0 A;  2P9I B;  4CHP A;  3F9K A;  2YNG A;  3TTC A;  4ZTJ A;  4FM2 A;  3AVK A;  3ZEU A;  3AVG A;  5GIO A;  5T7B A;  3LWM A;  4IKF A;  3VEY A;  5HOO A;  3AAP A;  4A2B A;  3AVM A;  4DTP A;  3GBT A;  3AA4 A;  1TUU A;  4DTJ A;  2FLO A;  1K9M O;  1H1V A;  4OLB A;  1XUP O;  5M1Q A;  2VWJ A;  1BOT O;  4FJ8 A;  3BP8 A;  2WTU A;  1RT1 A;  3KK7 A;  4M3R A;  3LDP A;  1S6Q A;  3VF4 A;  3SK3 A;  3QFU A;  2HMP A;  3HPH A;  4DSI A;  1O1W A;  4UY8 O;  2O8F A;  4E7K A;  4FJH A;  4A5A A;  4C8O A;  1WSE A;  3BF1 A;  4CJ7 A;  3THY A;  2RF2 A;  3UE5 A;  2A41 A;  3U9Z A;  5AQR A;  1QSL A;  1UA1 A;  3A5O C;  3NHG A;  1L3U A;  3O80 A;  4CEQ A;  3C0B A;  4GKJ K;  1KLM A;  5BN9 A;  4FLW A;  3OYG A;  5JVH L;  1K8K B;  3L2V A;  1MA9 B;  1TK8 A;  1SKW A;  4LF7 K;  4K8X A;  1RNH A;  1B9F A;  3NF7 A;  4KPY A;  2PAV A;  3AA2 A;  1M90 O;  1HKB A;  4DFM A;  4YOX A;  4DF8 A;  1L3T A;  3EL2 A;  4E19 A;  4FWS A;  4W5O A;  3KVG A;  5AQJ A;  1YI2 N;  4CFA A;  3FFK B;  3MAQ A;  4J2A A;  2IVO A;  3PX4 A;  4PHT X;  3ZT0 A;  4A62 A;  2HBM A;  1HJR A;  4C23 A;  4LF9 K;  2HNY A;  4B9N A;  3SJJ A;  3GL1 A;  2H3G X;  3O9Q A;  3DOK A;  3VQC A;  3AGR A;  5BPL A;  5DM7 L;  3L2Q A;  2G8K A;  3M3Z A;  4FL9 A;  1RT4 A;  3KWG A;  3MDQ A;  3CC2 N;  2Q3S A;  2YI1 A;  4AM7 A;  4I2Q A;  2HHU A;  3MMV A;  4KAZ A;  1ZBI A;  5AZI B;  5CY4 A;  4JHD B;  3N4P A;  2NRR A;  4K42 A;  4XH4 A;  2HVI A;  4B3S K;  3C6A A;  1XNQ K;  2P9L A;  4BRE A;  1VSL A;  4DR5 K;  3J7Z O;  4ELU A;  4CZI A;  3IS9 A;  1LW0 A;  4OKK A;  4Z0U A;  5D3G A;  2XRI A;  1YUW A;  2V7Y A;  4KHU A;  1ATN A;  1D4X A;  4K0K K;  1KSP A;  4LF4 K;  2P9S A;  1I94 K;  4CJV A;  4YDU A;  1VQ5 N;  5C2F A;  1WAJ A;  2RN2 A;  5GAH P;  3VQQ A;  2QXF A;  4JKH A;  4RW9 A;  3VQA A;  2OCE A;  3OYC A;  4LSN A;  1K6Y A;  1NNE A;  1ZBU A;  3NVM A;  4OPA A;  2Q2R A;  2HVH A;  2ASO A;  5M1N A;  2Z1G A;  3AO3 A;  1HYZ A;  3K9K A;  3HXM A;  1NGC A;  2WBN A;  1BL3 A;  4FXD A;  4B1Z A;  2GEL A;  2HHS A;  4N47 A;  1OH8 A;  3MXI A;  2W42 A;  2E1Y A;  1TKZ A;  1NWK A;  2IC3 A;  3AGK A;  4FWR A;  3IUC A;  3IAY A;  4F8R A;  5JVG L;  2FSN A;  1IV0 A;  3ENO A;  4L3Q A;  3VQ7 A;  1BUP A;  2P9N A;  1TK0 A;  3NBP A;  4IFV A;  4DQR A;  4BGB A;  3DJC A;  4FLY A;  4I9Q A;  1EWQ A;  3CF5 L;  3K9J A;  3UIQ A;  2B4J A;  2W40 A;  3T1A A;  3THW A;  3G0Z A;  1T3V A;  4G1Q A;  4PKI A;  1S1W A;  1WAF A;  4CHO A;  4BE0 A;  3EN9 A;  3HVT A;  4EIA A;  2P9U A;  4BWM A;  3DRP A;  3HI0 A;  2GUI A;  2O8D B;  3LPU A;  4E1J A;  4CZE A;  5KPT A;  3CCM N;  3OYJ A;  1ZBL A;  1HPM A;  1YJW N;  1NJY A;  4AHC A;  1XHX A;  3L3U A;  4A61 A;  2G8H A;  5AQL A;  5ADX A;  3PSF A;  1TAQ A;  2CGL A;  2UXB K;  2VQF K;  3OS0 A;  3WNH A;  5EXW A;  1ZBS A;  1XC3 A;  5DK5 A;  3ZX0 A;  3HRG A;  4JN4 A;  4FJ7 A;  4NYF A;  3MN9 A;  4YOT A;  1ATS A;  3ENB A;  4OO1 J;  1YJ9 N;  3NH0 A;  3BDP A;  3DI6 A;  2DPN A;  4BRF A;  1RDW X;  3IKM A;  2YCH A;  4JK8 A;  2HF3 A;  2XY7 A;  4FJL A;  4RW4 A;  2D5R A;  4ID5 A;  4JI4 K;  4B9Q A;  5EX5 A;  3J80 O;  1NK9 A;  1ILY A;  1KFD A;  4HTL A;  4YDU C;  4AF1 A;  1NOZ A;  1IH7 A;  1BG3 A;  3E1Y A;  4KB0 A;  3HST B;  3ZSQ A;  5KRT A;  3OYB A;  4BR7 A;  4FJM A;  3UKU B;  4O5B A;  2NNW A;  3RMD A;  4C8N A;  3SPZ A;  1GOC A;  1S9G A;  3D7E O;  1VQO N;  3EY1 A;  3O9T A;  3VF2 A;  4MLE A;  3RSE A;  3QNN A;  2B6A A;  1JCE A;  4GKK K;  4JKG B;  2G8F A;  4ID1 A;  1GLC G;  1U2V A;  3LP0 A;  4DU3 A;  3HYF A;  3R6M A;  2KTQ A;  3ZSV A;  2BTF A;  3AAQ A;  1BA1 A;  4QS7 A;  2E6M A;  3AY9 A;  5MLC Q;  3AO5 A;  2RHK A;  4ISE A;  3NAE A;  2ETJ A;  3K5M A;  3H3O B;  4BC5 A;  2PYJ A;  5EU7 A;  1WSJ A;  2E2P A;  4N41 A;  4IFY A;  4KTZ A;  4BRA A;  3OYM A;  2JGU A;  1YXQ A;  4H5T A;  3MN7 A;  3VEX A;  2O4G A;  3ULD A;  2WUS A;  4B3T K;  3WXJ A;  2UUB K;  1VQ4 N;  4FLX A;  1C0G A;  4QAG A;  1DGK N;  4WFA L;  1NKC A;  3KLI A;  4CFB A;  2OZM A;  4JI0 K;  4DWI A;  1VQM N;  2ZE2 A;  4W5Q A;  2FF6 A;  2IGI A;  3AVH A;  4BC4 A;  5J1E A;  4YHH K;  4DTN A;  3QB0 A;  1UOC A;  4HUF A;  4IOA L;  2ZF5 O;  1JL2 A;  3U3Y A;  5BRE A;  1QSY A;  1YIJ N;  4U7B A;  3SBT A;  4DQQ A;  5AFU A;  3TAB A;  5GAE P;  2BAN A;  4Z4H A;  3VGM A;  3K0S A;  2NRV A;  1BI4 A;  2YKM A;  1KVC A;  1P90 A;  2NRW A;  3SUP A;  2A1S A;  2Q1N A;  3L0Q A;  2JWL A;  2D0B A;  2GTD A;  4GVE A;  4BDZ A;  1X9M A;  1KLN A;  2BUP A;  3CER A;  2ZQB A;  4O0J A;  3FGU A;  1NLV A;  4Q5V A;  5JMV A;  4FOI A;  3C6H A;  4H0X B;  3KLH A;  1BIU A;  3K2P A;  4AHR A;  4CBX A;  4RCH A;  1WNS A;  2IS3 A;  1NJX A;  2VQE K;  1NG9 A;  3HP9 A;  1Z05 A;  1C0M A;  3ULE B;  1OH5 A;  4CBU A;  3IG1 A;  3TAF A;  2G8V A;  4LC9 B;  5EVZ A;  3CCE N;  3MEC A;  1C1C A;  1YAG A;  1C1B A;  2F8T A;  1YF5 L;  4DSE A;  1U04 A;  1TKX A;  3O9U A;  1TL1 A;  4F3O A;  2D0A A;  4NLB A;  3CFO A;  3O9R A;  4DR3 K;  1WSH A;  3AVL A;  2E4L A;  3RRH A;  4LF5 K;  3VEO A;  4CF8 A;  2GWJ A;  1NGH A;  4CJF A;  1JXB A;  4ILG B;  3S3M A;  3IMX A;  3EE9 A;  3L6Q A;  4CI6 A;  3U4L A;  3TWH A;  3H45 C;  2Z1I A;  1EWR A;  2UXC K;  3M8P A;  1SS6 A;  4AIL C;  4DU1 A;  4DS5 A;  1HPZ A;  3VEZ A;  3G71 N;  3KK1 A;  1VSH A;  4K8Z A;  4DS4 A;  4E1M A;  4B1U B;  3QEV A;  3O1W A;  3DLB A;  3I55 N;  2Q0U A;  3OHR A;  4CGJ A;  1KFS A;  5AQI A;  1QSS A;  3CCL N;  3SQ0 A;  4KHQ A;  1G99 A;  3VQ9 A;  1B9D A;  2OAN A;  4DQ8 A;  2HF4 A;  4CHY A;  4FK2 A;  3DXM A;  1ZYQ A;  3W3D A;  4FYD A;  4GV6 A;  1C0F A;  2QKK A;  3AV9 A;  5HRR A;  4WYB A;  4FZZ A;  4KH6 A;  3EEQ A;  3O4Q A;  3RMA A;  3ZET B;  3HSC A;  4E89 A;  4ZHR A;  4KBO A;  3HOS A;  3WNE A;  3T1H K;  1RTH A;  1S3X A;  4M7Y A;  4YFU A;  4JI5 K;  1NMD A;  3ZSO A;  4DR2 K;  4KB1 A;  2I5J A;  1LCU A;  4Q0B A;  2NRH A;  4WQ4 C;  1X3M A;  1NK7 A;  4M3X A;  3GOI A;  4WQ5 C;  4CIF A;  5AZI A;  1WSI A;  4FWL A;  4OPK A;  1IKV A;  4HWI A;  2KQ2 A;  3CJ7 A;  1OH7 A;  4B9V A;  3F2K A;  3QER A;  3TSU A;  2HW3 A;  4UQG A;  2IVN A;  1ATR A;  3WXK A;  3G6E N;  3L4I A;  4FWQ A;  3ZX3 A;  4IDK A;  2HST A;  1XMQ K;  4M41 A;  3I8D A;  1UA0 A;  2YKN A;  3AVC A;  3I0S A;  3RR8 A;  1W97 L;  1WUA A;  4CW7 B;  3EKS A;  1U4B A;  4CFC A;  1N32 K;  1JLF A;  3O3G A;  3MWP A;  4DSJ A;  1WN7 A;  2W6L A;  1NGD A;  4AQY K;  2Z1H A;  4YOV A;  4KHS A;  4RW8 A;  1TUY A;  3LM2 A;  4FJJ A;  1HKC A;  5GIN A;  4CJL A;  5AQU A;  4FWN A;  4GW6 A;  2D0O A;  3VGK A;  5FPD A;  3E9P A;  2UXD K;  4GMJ B;  2FBT A;  3CCV N;  4N56 A;  1HNZ K;  2QK9 A;  4AHV A;  3SI6 A;  3D2F B;  3AVB A;  3SBG A;  4BE1 A;  4BG8 A;  3UKR A;  3M8Q A;  2VGN A;  2DFH A;  3SYZ A;  3B6P A;  1NK8 A;  3MEG A;  5KQD A;  5FLX O;  4RG8 A;  3CYM A;  1HX1 A;  1TVR A;  3FFI A;  1HYV A;  3SZ2 A;  2ZJP L;  4CJR A;  1GLJ O;  2JLE A;  3RMC A;  2O8D A;  4WCE L;  3OYI A;  1U48 A;  4M3U A;  5BRF A;  4FM1 A;  3IRX A;  3VTH A;  4Z4F A;  3LAK A;  3CHW A;  3KKR A;  1R59 O;  2HBL A;  1OVY A;  2DFF A;  1SQK A;  2E8A A;  2ITM A;  4CZH A;  1N5Y A;  4LY7 A;  4YOW A;  2KLA A;  4KHY A;  4FLV A;  1RBR A;  1HYS A;  2WON A;  1SKS A;  1YVU A;  3DLL L;  2OYQ A;  4BR5 A;  2FSJ A;  3LM9 A;  1VHX A;  3DRR A;  3CJC A;  5GAG P;  4CF2 A;  1U6Z A;  3DXK B;  3CPW M;  4CHZ A;  3LAM A;  5KQ8 A;  4XIU A;  1VQ6 N;  4Z4E A;  4CK2 A;  1GLA G;  2NRZ A;  4CEO A;  4CIE A;  3KLF A;  4ELV A;  3THX B;  3DLH A;  3EZW A;  4N5S A;  3QLH A;  4B8A B;  5BPM A;  4IO9 L;  1IG8 A;  3D6R A;  1Q7Y O;  4IEI A;  2EHG A;  4FWP A;  3HPO A;  4HCC A;  2A5X A;  3LDL A;  1U45 A;  2D0P A;  2NUB A;  5FDL A;  4DV7 K;  2QA4 N;  4FWK A;  5KGW A;  4BR0 A;  3QIC A;  4QS8 A;  4NCA A;  4DV0 K;  4CJ3 A;  2BGG A;  2XY5 A;  1J54 A;  3WEE B;  3HK2 A;  4JI3 K;  4FJ5 A;  1S1X A;  3KWI A;  1FJG K;  3NF9 A;  3VEV A;  3KK2 A;  2QWR A;  3QBW A;  4M3Z A;  4E7H A;  3CI5 A;  1F21 A;  1E4F T;  1L3V A;  2P9K B;  2HHW A;  3KKS A;  3TAG A;  3TAP A;  2VWK A;  4CJU A;  5AZJ A;  4ICL A;  4CGF A;  3NMU A;  2KFN A;  5F2R A;  4FM0 A;  1L5U A;  4FK0 A;  1LW2 A;  2X6S A;  1NU0 A;  2BH1 A;  3L3V A;  2Q0R A;  1ASW A;  5M1K A;  4ILJ A;  4NCB A;  4IZ9 A;  1GLB G;  4CEZ A;  4CZK A;  4JI1 K;  1HUX A;  3LP1 A;  3K5L A;  4CFD A;  5C0Y A;  1HKG A;  1KD1 O;  3FZL A;  3H46 O;  4B8C A;  4O55 A;  2IAJ A;  3R9P A;  1QVF M;  3QDK A;  3J7A P;  4KV8 A;  4CJ4 A;  3D2E B;  4IOX A;  3HM9 A;  1RBS A;  4B3O A;  1RDA A;  3ATU A;  3SMP A;  1HJO A;  1WBB A;  5AQW A;  3Q7B A;  5CE3 A;  3JYT A;  1Q81 O;  3U3G A;  3NCI A;  3A5L C;  2J4R A;  1NBW A;  4U67 L;  1HLU A;  3C7N B;  3DLE A;  3I33 A;  2VYP A;  4PA1 A;  3KK3 A;  4CCH A;  1FW6 A;  2FBY A;  3WXL A;  1GOB A;  5LJW A;  1TKD A;  2PYL A;  5FPN A;  2PFU A;  5LJV A;  1KAY A;  1TKT A;  5DMR A;  4DTR A;  4C8L A;  5AQQ A;  4RTF D;  4DLE A;  5C2D A;  5GIP A;  3ZT3 A;  1QZ5 A;  3AVN A;  1RGI A;  4CGH A;  3KD1 E;  4CGI A;  2RPI A;  3VQ5 A;  1TYQ B;  3SJH A;  5CYQ A;  4N76 A;  1XWL A;  2P9P A;  5DM6 L;  2XO7 A;  1EXQ A;  5B8H A;  4HUG A;  2O8C B;  3ZT1 A;  2R7Y A;  5JLH A;  4BR4 A;  1DKG D;  1HNI A;  2F7T A;  1DT9 A;  2P51 A;  4M42 A;  4BVP A;  3BY5 A;  4Z4G A;  2UU9 K;  4Y1C A;  1Z26 A;  4M3T A;  4BAC A;  4DMN A;  5KPZ A;  1KAX A;  3QEW A;  1WB9 A;  1YTU A;  3NGI A;  4IG3 A;  3O5B A;  1LWE A;  3AVJ A;  1RCH A;  1O13 A;  1JLB A;  4H03 B;  5C12 A;  2ZGY A;  4IJA A;  3V81 A;  3SLC A;  1DTT A;  5I9E B;  4MO5 A;  3V9Z A;  3HJF A;  3SAF A;  3KLG A;  3OS2 A;  4DTX A;  5TKY A;  4KHN A;  4DV1 K;  1ASU A;  2E6L A;  1D8Y A;  4NXN K;  4I9L A;  3P38 A;  2GV9 A;  3VQD A;  3CM6 A;  1T7P A;  4DV3 K;  2ITG A;  3LP2 A;  5GAD P;  3VA3 A;  3H1V X;  4AHT A;  2UUA K;  4FLZ A;  4HVJ A;  4JI6 K;  1QS4 A;  4DFK A;  4RW7 A;  2FBV A;  5AFU H;  4IWV A;  1HRH A;  3VQP A;  3SUQ A;  4CJQ A;  4J8F A;  2OTJ N;  3F9M A;  4CK1 A;  4DSF A;  4W5R A;  3H1Q A;  4R79 A;  3MK6 A;  3CCJ N;  3IFR A;  4QCL A;  2G8I A;  3JSM A;  3B8A X;  1LAW A;  1X9W A;  3L2R A;  3QEX A;  4KHW A;  4B1V A;  3PO5 A;  1Q8I A;  4CEE A;  5AQN A;  1S6P A;  3SQ1 A;  4CF1 A;  4IJN A;  4EZ9 A;  3E9O A;  1DTQ A;  1ZXO A;  4PL7 A;  1RTJ A;  4O4G A;  4DTO A;  4X64 K;  2Q97 A;  4ZTF A;  5J2M A;  3Q7C A;  2O8F B;  1WSG A;  3EZ5 A;  3SMS A;  3ISN C;  2YNH A;  5JS1 A;  5HRN A;  1N34 K;  2HBK A;  5M1P A;  3CIP A;  3OYE A;  3O6W A;  4H0T B;  2O4I A;  1KVB A;  3G25 A;  3WQU A;  3QML A;  1EET A;  1W7A A;  3L8B A;  1RFQ A;  3U9D A;  4JKD A;  4X62 K;  3NH2 A;  3I56 N;  4I6M A;  2ZWH A;  4FZY A;  1NGI A;  3CQ8 A;  3BZK A;  4J2B A;  3U8X A;  3RR7 A;  3VGL A;  1EKE A;  3C94 A;  4K41 A;  1N8R O;  4B9T A;  5E84 A;  2VCP A;  5HP1 A;  3ZT4 A;  2HND A;  2HHT A;  1OKJ A;  1VAZ A;  4E1N A;  2ASP A;  3HZ6 A;  1X9J A;  3J81 O;  3OYA A;  3THV A;  2GBZ A;  4B1W B;  4BRN A;  4KH5 A;  4OPH A;  1RDC A;  4OVL A;  3FE1 A;  2Q31 A;  3CFR A;  5KTQ A;  1S72 N;  3AA5 X;  2CH5 A;  4EHT A;  5AQY A;  3D2F A;  4F2R A;  4E0D A;  4CJ5 A;  1NK5 A;  3RWU A;  3PY8 A;  3M5R A;  4JAX A;  3S41 A;  3V9U A;  1W0H A;  1SL0 A;  4F4K A;  5KRS A;  2QM1 A;  4DTU A;  3VF6 A;  1HQE A;  3FR0 A;  3NE6 A;  5AQZ A;  3NF6 A;  2P5O A;  5BN8 A;  1VSI A;  3MX5 A;  4H4O A;  4DV5 K;  3TAQ A;  1CXQ A;  4JKA A;  1JLA A;  1I39 A;  3H6E A;  4QS9 A;  1S22 A;  4WQ4 A;  4WQ5 A;  2AA4 A;  3ZCM A;  2P9S B;  5HRP A;  4EAH D;  2P9I A;  4AHU A;  4DUZ K;  2YHA A;  3A5N C;  1C0U A;  1GLL O;  4NCG A;  3AVA A;  5CZ2 A;  3EE8 A;  4F2S A;  3WNF A;  4DSK A;  2I7P A;  4BG9 A;  4O44 A;  2YHW A;  1NGB A;  1FKP A;  5LMN K;  2RE2 A;  4DR4 K;  3DXK A;  4A5B A;  1NGJ A;  2BDP A;  3A2F A;  3QIO A;  3QET A;  4BRG A;  4KI6 A;  1OVQ A;  1QTM A;  3MEE A;  4LF6 K;  4DV6 K;  1WOQ A;  1VQN N;  3VQB A;  4XEI A;  2QWN A;  3CQX A;  2GWK A;  3DLR A;  3MED A;  3THX A;  3HOT A;  3NGY A;  3HL8 A;  3QEP A;  4FSV A;  4CHN A;  2OPR A;  4BRK A;  3BGR A;  3MXJ A;  4X66 K;  4JKF A;  1BWF O;  4YOY A;  2G8W A;  4M3Y A;  2VG5 A;  4CD1 A;  4DV2 K;  4DTM A;  4BRC A;  1CLQ A;  4NYN A;  3OYN A;  3PLA A;  1RTI A;  3CME N;  4BRH A;  4MFB A;  4B9L A;  1MDU B;  5CYM A;  5JIC A;  1NGF A;  4YOR A;  1SV5 A;  3TPQ A;  2P9U B;  1T6D A;  1YVN A;  3QBX A;  4ELT A;  3OBY A;  4BY9 C;  3C65 A;  1K8K A;  4IXC A;  3SCX A;  1TV6 A;  3ZSZ A;  3R8E A;  4OPJ A;  3CCQ N;  1TAU A;  3V1R A;  1NK4 A;  2WFB A;  1P8Z A;  2P9K A;  1ZBH A;  1RT3 A;  3OVN A;  4KO0 A;  1R0A A;  1IO2 A;  2DY4 A;  3CD6 N;  2OZS A;  1X9S A;  3NH1 A;  3QIN A;  3IDH A;  3VTI A;  3P31 A;  1JJ2 M;  4A57 A;  3FZF A;  4OKE A;  2A3Z A;  4IBN A;  4PUO A;  3FZK A;  4Y0W A;  4JLH A;  4JEP A;  3RMB A;  2JWK A;  1QZ6 A;  4CJS A;  2Y1J A;  2B5J A;  2A42 A;  1YIT N;  1Y97 A;  3PUF A;  3QIP A;  3SUO A;  1XHZ A;  4DR6 K;  3TR8 A;  3D2E A;  4JHD A;  3TU5 A;  4CGG A;  4FVU A;  3M1F A;  4DCH A;  4W5T A;  3AA3 A;  4JS4 A;  1W2B M;  1LWC A;  4FWO A;  1NK6 A;  4DB3 A;  2QKB A;  3TSP A;  5AJ3 K;  4JD2 B;  2KKZ A;  3VOV A;  1J9A A;  1VRT A;  1RIL A;  1QQO A;  4FW1 A;  3KHY A;  3WQT A;  2BE2 A;  3C7N A;  3O3F A;  3KTQ A;  3V1O A;  4DFJ A;  4W5N A;  1V4T A;  3MX2 A;  4C8M A;  3PX6 A;  3LDQ A;  3LDS A;  1Z6R A;  2HOE A;  2P5G A;  2AJQ A;  3RSE B;  1IKW A;  2HMI A;  4BDY A;  4CIG A;  1NKB A;  4H0V B;  3VPZ A;  4M7X A;  4NXM K;  4JKB A;  5CR4 A;  3LZI A;  3S3O A;  4MQ3 A;  3FZM A;  4H5R A;  2HNZ A;  2O8B B;  4BQL A;  4BVO A;  3OW2 M;  3JS6 A;  2LSN A;  1KTQ A;  3HT3 A;  1TYQ A;  1D5A A;  5E26 A;  3M8S A;  3CCU N;  4FLU A;  1RBV A;  3A8Y A;  3LAL A;  3DLG A;  2O8C A;  3TAN A;  1VQL N;  5AQX A;  3O3H A;  3M8R A;  1KCF A;  3CFP A;  4DR1 K;  3CM5 A;  1T6C A;  4CGD A;  1KXP A;  3HP6 A;  3V9X A;  5C10 A;  1G15 A;  4BGA A;  3K57 A;  2E2N A;  1DEJ A;  2YHX A;  2O8E B;  2X74 A;  2QXL A;  3O4W A;  4R5P A;  4ISF A;  3V9S A;  5CHI A;  1Q9Y A;  3G4S N;  3F73 A;  3D45 A;  1C1A A;  3LAN A;  3OYF A;  1WLJ A;  4NLC A;  2YHY A;  4H0Y B;  1X3N A;  4GV9 A;  4DLG A;  1S1U A;  3LDN A;  4CF0 A;  3CQY A;  3ASM A;  3TAM A;  3TAE A;  2F9T A;  4LD0 A;  1BI4 B;  4KRF A;  1SZ2 A;  3PO4 A;  1D9F A;  1VSD A;  3T3F A;  2Y1I A;  3ZT2 A;  1TL3 A;  4M63 C;  3DWL A;  3SAG A;  3CC7 N;  2PBD A;  4H5W A;  5AQT A;  3GG4 A;  5IWA K;  5FRN A;  4LFB K;  2VG6 A;  3ENH A;  1T03 A;  3HBT A;  2VGM A;  5M1F A;  3VQ6 A;  5BRH A;  4BC3 A;  1NKE A;  3DMJ A;  4K43 A;  4BRQ A;  3L2W A;  2ZM6 K;  3KZB A;  4C1N I;  4DU4 A;  1XC9 A;  4CEC A;  3OJU A;  3V4I A;  4GNI A;  5KPR A;  4DTS A;  4L8R B;  1A5X A;  3UKU A;  4EZ6 A;  2E1Z A;  4E7I A;  4H8K A;  1NK0 A;  1NJZ A;  4HHT A;  2D4W A;  5TKW A;  1KQS M;  4FPA A;  4JYA K;  2IDO A;  3JXU A;  5LL6 Z;  4CES A;  5HRO A;  5SZT A;  3QES A;  3R3L A;  3VMF B;  3KD5 E;  2ATQ A;  4FOE A;  1NJI O;  4JKG A;  4NB4 A;  3K5N A;  5C42 A;  3EYZ A;  4EP4 A;  3PIO L;  1SL1 A;  3TSQ A;  2YJF A;  3O9S A;  1RTD A;  1VQK N;  3AO1 A;  4CZL A;  4B9U A;  1D9D A;  3PX0 A;  3RVC A;  3VER A;  5A2Q O;  3AO2 A;  4EFH A;  1GOA A;  1A5W A;  1EQY A;  1JLE A;  4O5F A;  4F9O A;  3ZX2 A;  1QQN A;  3MN5 A;  4BWJ A;  4A2A A;  4KHP K;  2KW4 A;  3SUN A;  3DXM B;  5ADX H;  1JKH A;  1V4S A;  4CED A;  4IG0 A;  4AM6 A;  2QWO A;  4JI2 K;  4IOC L;  5E41 A;  1JXE A;  3ZSX A;  4V19 S;  4J2D A;  3LPT A;  4OGC A;  5LMU K;  4WFB L;  1HR0 K;  5J2Q A;  2X6N A;  3BEX A;  3DM2 A;  4DR7 K;  2HHH K;  1EP4 A;  1N36 K;  1U49 A;  1RBU A;  3T69 A;  4DV4 K;  2NLX A;  4CHQ A;  4HTU A;  1IBM K;  1KRP A;  1IG9 A;  3O8M A;  4B3R K;  3J8A A;  2A1R A;  3CET A;  3WT0 A;  4LH5 A;  5CZ1 A;  2YNF A;  3HPG A;  4I7F A;  1T05 A;  3AVF A;  4H0P A;  4KI4 A;  5ELZ A;  4CK3 A;  4ISG A;  5I3U A;  4IEE A;  4PY5 A;  3MCA B;  3A5M C;  5IT9 O;  2I7N A;  1EO1 A;  4DUY K;  4BR2 A;  3R1X A;  3PIP L;  4FO0 A;  3LP3 A;  3VES A;  2XHB A;  3K59 A;  1ASV A;  3OY9 A;  4DKW A;  1CZ9 A;  4C8K A;  3H08 A;  2HB5 A;  5F1X A;  2E5L K;  3LL3 A;  3ULE A;  1NM1 A;  3GDQ A;  4IO8 A;  3HO1 A;  1T8E A;  1Q18 A;  1J5E K;  1W9H A;  3CG7 A;  4O8U A;  3OJS A;  2YNI A;  5FRO A;  1REV A;  3SNN A;  1SUQ A;  1ESV A;  1OH6 A;  3VQE A;  3K58 A;  4BC2 A;  4WFN L;  2OPQ A;  4E3S A;  1YT3 A;  4CJK A;  1MWM A;  2DFE A;  5HBM A;  4GY2 B;  1NOY A;  3P1G A;  3OYK A;  5I42 A;  2FSK A;  3QO9 A;  1YJN N;  3HM8 A;  3TTD A;  2E2O A;  1LAV A;  3OA9 A;  4TSX A;  1XMO K;  3T19 A;  3UKR B;  3SAH A;  4EP5 A;  4JK9 A;  5AQP A;  2WC9 A;  3RTV A;  4CZM A;  1RT2 A;  2GX9 A;  4B1Y B;  3B6O A;  5AQO A;  2OA8 A;  2YV0 X;  2ZGZ A;  3H3N O;  2EWS A;  3HTV A;  1BU6 O;  3CJ9 A;  4JV5 K;  3G10 A;  2OTL N;  4MO4 A;  2UUC K;  1UWB A;  3WNG A;  3QFP A;  1XI1 A;  4CE9 A;  1JLG A;  2W41 A;  5M1O A;  5BPN A;  1GLF O;  3FZH A;  4CJT A;  5AQH A;  4Z4I A;  5SWM A;  2NRT A;  4AH9 A;  1VQP N;  4J2E A;  3DOL A;  1N6Q A;  1S5J A;  3PSI A;  3NGZ A;  2A40 A;  2DTU A;  3LZJ A;  1S1T A;  4AHS A;  1S9E A;  4O0I A;  1BHL A;  2V51 B;  3ZEU B;  4OLA A;  1VSE A;  1HNX K;  3AVI A;  3ZET A;  2PY5 A;  4KRE A;  3CPE A;  2EX3 A;  3O08 A;  4JKE A;  4Y1D A;  2QWL A;  3ZLJ A;  1JL1 A;  1LV5 A;  3BF3 A;  1SKR A;  3F5T A;  3ALY A;  3S9H A;  3BUZ B;  3UB5 A;  4RW6 A;  1IBK K;  5KGX A;  2IIR A;  3VEW A;  4YNQ A;  4IFE A;  4C1N K;  1I3A A;  3AO4 A;  4A59 A;  1ZC6 A;  4CZJ A;  4DHY A;  1EX4 A;  3SV4 A;  1JLQ A;  3GE1 A;  2QW9 A;  3CJ1 A;  4ILH A;  3V9W A;  1QHA A;  3THY B;  4JD2 A;  3ZSY A;  4BRM A;  2Z1J A;  3CJA A;  1HQU A;  4OJR A;  2V52 B;  1YTA A;  3VQ4 A;  1WBD A;  1TK5 A;  4FJG A;  1K8A O;  4GV3 A;  1YHQ N;  2ASM A;  4XH5 A;  1ZBF A;  1J53 A;  5HLF A;  1C0T A;  2F9W A;  3OYH A;  1C6V A;  4E7L A;  4YOU A;  2A6A A;  2F8S A;  4DQI A;  1MWK A;  4H4M A;  4LFC K;  5AZJ B;  2O8B A;  1DLO A;  4JI7 K;  3U6F A;  5JS2 A;  1IBL K;  4H5V A;  3VN5 A;  4CEA A;  4M45 A;  3VA0 A;  3LDO A;  4CEF A;  3MWT A;  4KFB A;  3ATV A;  4KH4 A;  1VQ8 N;  4K25 A;  2Q36 A;  3DYA A;  3C6U A;  4OX9 K;  1VSK A;  2QTD A;  1VSF A;  2KZZ A;  4BDP A;  1Z25 A;  1NMN A;  4CD3 A;  4FCY A;  3C6T A;  2KHO A;  2OPP A;  5J2P A;  5EOY A;  3C95 A;  5AQM A;  2YJE A;  3QEI A;  4FJI A;  2XY8 A;  1BCO A;  2YX6 A;  2O8E A;  1LOT B;  3FLC O;  3S3N A;  5BR8 K;  1BO5 O;  3NDK A;  2GUP A;  2HHQ A;  1Q86 O;  1BDG A;  3L4Q A;  2D0C A;  4DSL A;  3ID8 A;  2WOM A;  3ZYY X;  1JCF A;  1QQC A;  2P9L B;  5KI6 A;  4CER A;  3M6G A;  3ZSR A;  4B08 A;  3ID6 A;  4JKC A; 
#chains in the Genus database with same CATH homology
 3C7N A;  3QIC A;  3OBW A;  4QS8 A;  1HPM A;  3WEE B;  1YJW N;  1V4T A;  2QWP A;  3MX2 A;  4A61 A;  5AQL A;  5ADX A;  1IJJ A;  3KWI A;  3VEV A;  5F0X A;  4H5N A;  3TTF A;  2QWR A;  3LDQ A;  3QBW A;  1Z6R A;  3CI5 A;  2HOE A;  4RWT A;  3RSE B;  1E4F T;  2UYT A;  2CGL A;  2P9K B;  1VQ7 N;  3T7Z A;  1E4G T;  5EXW A;  1ZBS A;  1XC3 A;  3ZX0 A;  4H0V B;  3HRG A;  3VPZ A;  5AZJ A;  4M7X A;  2D1K A;  1T44 A;  3NMU A;  4B1X B;  4JN4 A;  5F2R A;  4JKB A;  5CR4 A;  3MN9 A;  4YOT A;  3FZM A;  4H5R A;  5FPM A;  1ATS A;  3ENB A;  4BQL A;  4OO1 J;  4BVO A;  3OW2 M;  3JS6 A;  2BH1 A;  1TYQ A;  2Q0R A;  2E20 A;  1YJ9 N;  5M1K A;  4ILJ A;  4IZ9 A;  5E26 A;  1GLB G;  4CZK A;  2DPN A;  3CCU N;  4BRF A;  3A8Y A;  2NZT A;  1RDW X;  1HUX A;  3CXC M;  3IKM A;  2YCH A;  4JK8 A;  3VEN A;  2HF3 A;  2HBJ A;  5C0Y A;  1HKG A;  1KD1 O;  3FZL A;  2P9P B;  4B9Q A;  1VQL N;  3H46 O;  5AQX A;  5EX5 A;  1KC8 O;  1ILY A;  2P9N B;  1QVF M;  3R9P A;  4HTL A;  4YDU C;  3MN6 A;  2ZJQ L;  3QDK A;  4AF1 A;  1J6Z A;  1T6C A;  1KXP A;  3D2E B;  1BG3 A;  3E1Y A;  1GLE G;  5C10 A;  4IOX A;  4BGA A;  2E2N A;  1DEJ A;  2YHX A;  1NGE A;  3WXI A;  3ATU A;  1NGA A;  5AQF A;  4BR7 A;  4MLH A;  3SMP A;  2QXL A;  3DAW A;  2FF3 B;  3O4W A;  4CZF A;  1HJO A;  4ISF A;  5AQW A;  3P4I A;  3O1B A;  3Q7B A;  3UKU B;  5CE3 A;  5CHI A;  3G4S N;  4BQZ A;  5HL7 L;  1Q81 O;  4FPB A;  3A5L C;  2NNW A;  2J4R A;  3WEE A;  1NBW A;  4U67 L;  1KAZ A;  4NLC A;  5BR9 A;  1HLU A;  2YHY A;  3C7N B;  1X3N A;  4H0Y B;  4GV9 A;  3D7E O;  3I33 A;  3LDN A;  1VQO N;  3CQY A;  3O9T A;  3VF2 A;  2VYP A;  4MLE A;  2F9T A;  4MDA A;  3RSE A;  4EHU A;  3WXL A;  5LJW A;  1SZ2 A;  1JCE A;  4JKG B;  5FPN A;  2PFU A;  1JCG A;  1GLC G;  5LJV A;  5H1S Q;  1KAY A;  1U2V A;  3R6M A;  2BTF A;  5AQQ A;  4RTF D;  3AAQ A;  1BA1 A;  2QWQ A;  4QS7 A;  5C2D A;  3AY9 A;  5MLC Q;  2RHK A;  5GIP A;  4ISE A;  3DWL A;  4M63 C;  4WF9 L;  3SAG A;  1QZ5 A;  1RGI A;  4FWM A;  3CC7 N;  3E9L A;  3H3O B;  4O8K A;  4BC5 A;  4BR9 A;  2PBD A;  2E2Q A;  2E2P A;  4H5W A;  4BRA A;  5AQT A;  3GG4 A;  1TYQ B;  3SJH A;  3ENH A;  1YXQ A;  4IDH A;  3HBT A;  4H5T A;  3MN7 A;  2P9P A;  3VEX A;  2VGM A;  5DM6 L;  5M1F A;  5BRH A;  2WUS A;  5B8H A;  4BC3 A;  5JLF A;  3WXJ A;  4K43 A;  5JLH A;  1VQ4 N;  4BR4 A;  1DKG D;  2F7T A;  4BRQ A;  1DT9 A;  4BRO A;  1C0G A;  4BVP A;  3KZB A;  1DGK N;  4WFA L;  4C1N I;  1Q82 O;  3NVK A;  3P39 A;  4BRL A;  4G9Z A;  5KPZ A;  3N4Q A;  1KAX A;  3CCS N;  4GNI A;  1VQM N;  5KPR A;  2FF6 A;  3O5B A;  4BC4 A;  5FPE A;  2NRX A;  3QB0 A;  3UKU A;  2E1Z A;  4IOA L;  2ZF5 O;  2V7Z A;  1O13 A;  4H03 B;  5BRE A;  5C12 A;  1YIJ N;  1KQS M;  2D4W A;  5TKW A;  4U7B A;  3SBT A;  2ZGY A;  4FPA A;  1GLD G;  4IJA A;  3WUH A;  5AFU A;  5GAE P;  3JXU A;  3SLC A;  3VGM A;  3R3L A;  5I9E B;  3VMF B;  4MO5 A;  2VWB A;  4XH1 A;  5LY3 A;  3SAF A;  2NRV A;  4FOE A;  1NJI O;  5AQS A;  2NRW A;  1BA0 A;  1P90 A;  3A0I X;  4JKG A;  4JK7 A;  4NB4 A;  5TKY A;  3MCP A;  4BRI A;  2Q1N A;  3P38 A;  3PIO L;  3L0Q A;  2JWL A;  2GTD A;  4GVE A;  3TSQ A;  2YJF A;  1U2V B;  3O9S A;  2BUP A;  3CER A;  5AR0 A;  3VET A;  4CZL A;  5C15 A;  1QVG M;  1VQK N;  5GAD P;  3H1V X;  3RVC A;  2QWM A;  3FGU A;  4H0O A;  3VER A;  2CH6 A;  4EFH A;  1NLV A;  1SAZ A;  5JMV A;  4FOI A;  3C6H A;  4H0X B;  1EQY A;  4JNE A;  4I6M B;  4O5F A;  4F9O A;  5AFU H;  4RCH A;  3ZX2 A;  4IWV A;  1QQN A;  3MN5 A;  4CBX A;  4CZE A;  4PKG A;  4NO7 A;  4A2A A;  1M1K O;  2GEM A;  3W0L A;  4J8F A;  2OTJ N;  1Z05 A;  2AP1 A;  1RDU A;  3DXM B;  3F9M A;  1V4S A;  5ADX H;  1NGG A;  3ULE B;  4AM6 A;  4CBU A;  2QWO A;  3H1Q A;  4IOC L;  4LC9 B;  4PL8 A;  4R79 A;  5EY4 A;  1K73 O;  3MK6 A;  5EVZ A;  3CCE N;  1YAG A;  1CZA N;  1XQS C;  3IFR A;  3CCJ N;  1YF5 L;  3WXM B;  3CCR N;  4CBW A;  3B8A X;  2CGJ A;  4WFB L;  3O9U A;  3BEX A;  4B1V A;  5AQN A;  5AQK A;  5AQG A;  3T69 A;  4NLB A;  3O9R A;  2NLX A;  4IJN A;  4Z94 A;  1QQM A;  3E9O A;  1ZXO A;  3VEO A;  4PL7 A;  4BRD A;  2CGK A;  2GWJ A;  1NGH A;  2Q97 A;  3O8M A;  4ILG B;  5BRD A;  3IMX A;  3EE9 A;  3Q7C A;  1VQ9 N;  3J8A A;  3L6Q A;  4CI6 A;  3U4L A;  3CET A;  1Y64 A;  3CJB A;  3H45 C;  3WT0 A;  3SMS A;  3CC4 N;  4H0P A;  1SS6 A;  3CMA N;  3E66 A;  3I8B A;  2HBK A;  5M1P A;  3CIP A;  4MDB A;  3VEZ A;  5ELZ A;  3G71 N;  4BRP A;  3EO3 A;  4ISG A;  4IEE A;  3O6W A;  3MCA B;  3A5M C;  4H0T B;  3G25 A;  4B1U B;  2ZJR L;  2I7N A;  3O1W A;  3WQU A;  1EO1 A;  4BR2 A;  3R1X A;  3QML A;  2Q0U A;  3OHR A;  4PKH A;  3PIP L;  3I55 N;  2FXU A;  2IVP A;  5AQI A;  3AAR A;  5AQV A;  4FO0 A;  3CCL N;  2QI2 A;  3VES A;  1G99 A;  1RFQ A;  3U9D A;  4JKD A;  3I56 N;  4I6M A;  2E88 A;  2ZWH A;  1NGI A;  2OAN A;  2QEX N;  4CZG A;  3U8X A;  4DQ8 A;  2HF4 A;  3VGL A;  4DKW A;  3EKU A;  4K41 A;  5F1X A;  2P9I B;  1N8R O;  3TTC A;  5E84 A;  2VCP A;  3DXM A;  3LL3 A;  3ULE A;  1NM1 A;  3GDQ A;  3W3D A;  4IO8 A;  4GV6 A;  1C0F A;  1OKJ A;  1VAZ A;  3ZEU A;  1Q18 A;  2ASP A;  3HZ6 A;  1X9J A;  5GIO A;  4O8U A;  4WYB A;  4B1W B;  4KH6 A;  3VEY A;  1ESV A;  4BC2 A;  4BRN A;  4KH5 A;  4OPH A;  3ZET B;  4WFN L;  3FE1 A;  5HOO A;  3AAP A;  3HSC A;  4A2B A;  3GBT A;  1MWM A;  2Q31 A;  4KBO A;  3HOS A;  1TUU A;  2FLO A;  1S72 N;  1H1V A;  1S3X A;  4GY2 B;  1K9M O;  4M7Y A;  1XUP O;  5M1Q A;  2FSK A;  2CH5 A;  1NMD A;  5AQY A;  4EHT A;  1BOT O;  3D2F A;  3BP8 A;  1YJN N;  3KK7 A;  1LCU A;  3LDP A;  3HM8 A;  2NRH A;  4WQ4 C;  1X3M A;  3TTD A;  2E2O A;  3GOI A;  3M5R A;  3OA9 A;  4JAX A;  4WQ5 C;  3SK3 A;  3VF4 A;  3S41 A;  3QFU A;  2HMP A;  5AZI A;  3UKR B;  3SAH A;  4FWL A;  4UY8 O;  4JK9 A;  5AQP A;  2QM1 A;  2WC9 A;  4A5A A;  4HWI A;  3VF6 A;  3CJ7 A;  3BF1 A;  3FR0 A;  4CZM A;  4CJ7 A;  2GX9 A;  5AQZ A;  3UE5 A;  4B1Y B;  2A41 A;  5AQO A;  2ZGZ A;  3H3N O;  5BN8 A;  3U9Z A;  2EWS A;  5AQR A;  3HTV A;  3F2K A;  3MX5 A;  3A5O C;  3TSU A;  1BU6 O;  2IVN A;  1ATR A;  4JKA A;  3O80 A;  3CJ9 A;  3WXK A;  3G6E N;  3H6E A;  3L4I A;  2OTL N;  4MO4 A;  3C0B A;  4FWQ A;  3ZX3 A;  4QS9 A;  5BN9 A;  1S22 A;  2HST A;  3QFP A;  4WQ4 A;  2W41 A;  4WQ5 A;  5M1O A;  5BPN A;  1GLF O;  5JVH L;  1K8K B;  3FZH A;  1MA9 B;  2AA4 A;  2P9S B;  5AQH A;  4EAH D;  2NRT A;  2P9I A;  1VQP N;  2PAV A;  1M90 O;  1HKB A;  1W97 L;  1WUA A;  3A5N C;  4YOX A;  2A40 A;  3EKS A;  1GLL O;  3EL2 A;  4FWS A;  3MWP A;  3KVG A;  5AQJ A;  2V51 B;  3ZEU B;  3EE8 A;  1YI2 N;  2I7P A;  3FFK B;  1NGD A;  3ZET A;  2IVO A;  4BG9 A;  3CPE A;  4YOV A;  4PHT X;  1TUY A;  2YHW A;  1NGB A;  3LM2 A;  3O08 A;  4JKE A;  1HKC A;  2QWL A;  5GIN A;  2RE2 A;  5AQU A;  4A62 A;  2HBM A;  4FWN A;  2D0O A;  3DXK A;  4A5B A;  1NGJ A;  3BF3 A;  4C23 A;  3F5T A;  3VGK A;  3BUZ B;  3UB5 A;  3GL1 A;  3E9P A;  2H3G X;  3O9Q A;  4E1J A;  5FPD A;  3AGR A;  4BRG A;  5BPL A;  3CCV N;  5DM7 L;  2IIR A;  3VEW A;  4IFE A;  1WOQ A;  4C1N K;  3M3Z A;  1VQN N;  3D2F B;  4FL9 A;  3KWG A;  3MDQ A;  3SBG A;  3CC2 N;  4BG8 A;  2YI1 A;  4AM7 A;  3UKR A;  4A59 A;  4XEI A;  2QWN A;  3CQX A;  2GWK A;  1ZC6 A;  2VGN A;  3MMV A;  4CZJ A;  3HOT A;  4DHY A;  4FSV A;  4BR0 A;  4BRK A;  4JKF A;  1BWF O;  5AZI B;  4YOY A;  4CD1 A;  4JHD B;  3N4P A;  2NRR A;  3GE1 A;  4K42 A;  4XH4 A;  2QW9 A;  4BRC A;  5KQD A;  3CJ1 A;  4ILH A;  1HX1 A;  3PLA A;  3CME N;  4BRH A;  3C6A A;  1QHA A;  2ZJP L;  1MDU B;  4JD2 A;  5JIC A;  2P9L A;  4BRE A;  1NGF A;  4YOR A;  1GLJ O;  3J7Z O;  4CZI A;  3TPQ A;  4BRM A;  2P9U B;  1T6D A;  3CJA A;  1YUW A;  2V7Y A;  4WCE L;  1YVN A;  3QBX A;  1ATN A;  3OBY A;  1D4X A;  5BRF A;  3C65 A;  2V52 B;  1K8K A;  4BY9 C;  4IXC A;  2P9S A;  4YDU A;  1VQ5 N;  5C2F A;  1K8A O;  4GV3 A;  3R8E A;  3VTH A;  3CCQ N;  5GAH P;  1YHQ N;  2ASM A;  4XH5 A;  3CHW A;  2WFB A;  1R59 O;  4JKH A;  1P8Z A;  2HBL A;  2P9K A;  1OVY A;  1SQK A;  2E8A A;  3CD6 N;  3NVM A;  4OPA A;  2F9W A;  2Q2R A;  2ITM A;  4CZH A;  4YOU A;  3IDH A;  3VTI A;  2ASO A;  2A6A A;  5M1N A;  2KLA A;  3P31 A;  4YOW A;  1JJ2 M;  1MWK A;  3K9K A;  5AZJ B;  4A57 A;  3FZF A;  3DLL L;  2A3Z A;  1NGC A;  2FSJ A;  2WBN A;  3LM9 A;  4BR5 A;  3FZK A;  4H5V A;  3CJC A;  4Y0W A;  4B1Z A;  2GEL A;  3LDO A;  5GAG P;  3MWT A;  3ATV A;  4KH4 A;  1U6Z A;  3DXK B;  4JEP A;  2E1Y A;  2JWK A;  4K25 A;  3CPW M;  1VQ8 N;  1NWK A;  4FWR A;  3AGK A;  3IUC A;  1QZ6 A;  2Q36 A;  2FSN A;  5KQ8 A;  5JVG L;  3ENO A;  4L3Q A;  1VQ6 N;  1BUP A;  2P9N A;  2QTD A;  1GLA G;  2A42 A;  2NRZ A;  1YIT N;  4CD3 A;  4BGB A;  2KHO A;  3DJC A;  5EOY A;  3D2E A;  4JHD A;  3CF5 L;  5AQM A;  3K9J A;  2YJE A;  3EZW A;  3TU5 A;  4FVU A;  2YX6 A;  3M1F A;  4DCH A;  2W40 A;  1LOT B;  5BPM A;  4IO9 L;  3FLC O;  1IG8 A;  1W2B M;  1BO5 O;  3D6R A;  1T3V A;  1Q7Y O;  4FWO A;  2GUP A;  4PKI A;  1BDG A;  1Q86 O;  4IEI A;  3L4Q A;  4DB3 A;  3ID8 A;  3TSP A;  2KKZ A;  4JD2 B;  3EN9 A;  4FWP A;  3VOV A;  2P9U A;  1JCF A;  2P9L B;  3ZYY X;  4EIA A;  2A5X A;  3HI0 A;  3LDL A;  1QQO A;  2D0P A;  3M6G A;  2QA4 N;  3ID6 A;  4FWK A;  3KHY A;  4JKC A;  5KPT A;  3CCM N;  3WQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...