3ZEUA

Structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
229
structure length
229
Chain Sequence
RILAIDTATEACSVALWNNGTINAHFELCPREHTQRILPMVQEILAASGASLNEIDALAFGRGPGSFTGVRIGIGIAQGLALGANLPMIGVSTLATMAQGAWRKTGATRVLAAIDARMGEVYWAEYQRDAQGVWQGEETEAVLKPERVGERLKQLSGEWATVGTGWSAWPDLAKECGLTLHDGEVSLPAAEDMLPIASQKLAAGETVAVEHAEPVYLRNEVAWKKLPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE M22 PEPTIDASE YEAZ
publication title Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Hydrolase
total genus 73
structure length 229
sequence length 229
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zeuA01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zeuA02
3DJCA 3JXUA 3FZMA 3UKRB 3TU5A 2UYTA 2ZGYA 2QWOA 1X3MA 2P9SA 1T6DA 1SQKA 2QW9A 1TYQA 4BGAA 4CBUA 1HPMA 2YHXA 4BRNA 3GDQA 3A0IX 3H3OB 3RSEA 3MN6A 2P9LA 4PKGA 4H5VA 5EOYA 5BRHA 1XQSC 3VEVA 3FLCO 1KXPA 5AQLA 2FSKA 5AZIA 4B1VA 1HX1A 5E84A 4J8FA 4F9OA 1K8KA 1C0FA 3LL3A 1T44A 2I7PA 3O08A 4BRFA 1NGFA 3R8EA 3IFRA 1T6CA 1DEJA 3QBWA 2QWRA 2Q0UA 5F1XA 2IVOA 1DKGD 1HKBA 3VEWA 5LJVA 4XEIA 3ENOA 3SK3A 1RGIA 5TKYA 5AQVA 2E2PA 1NMDA 4HWIA 4CD1A 4I6MA 5FPNA 3A5OC 4BRIA 4M7YA 1GLLO 3ZETB 2FXUA 4BRCA 3BP8A 1DGKN 1U2VB 3FZHA 4M7XA 3VEZA 3VERA 4JHDB 4BC5A 3H45C 1RFQA 2HF3A 3ZX2A 4B1UB 2ZGZA 3D2EB 1X9JA 2CH6A 4B1WB 4EIAA 5ELZA 4FOEA 2P9PB 2GUPA 4B1YB 3U4LA 5AZJA 2KHOA 2P9NA 3ZX0A 4BR5A 2QXLA 3DAWA 4FPAA 3CJCA 4ISEA 4NB4A 1HJOA 4CBWA 2P9IB 3BUZB 3C7NA 4H0PA 2E1ZA 4BRGA 2D4WA 3EN9A 2GELA 3HI0A 2YCHA 3VEXA 3MN7A 2DPNA 1U2VA 2A6AA 3LDNA 2YHWA 3D2FA 3H3NO 3IUCA 3KVGA 2WUSA 3FFKB 3D2EA 2F9TA 2P9PA 5KPRA 4BREA 5AFUA 2GEMA 2Q1NA 3VESA 1GLFO 4AM7A 3QB0A 1G99A 1C0GA 2YJEA 5I9EB 3LM9A 3O1WA 4A2AA 5EX5A 3HSCA 4JD2B 3HTVA 3CERA 1Y64A 1Q18A 2P9KA 1QZ6A 4WYBA 4GY2B 3WQTA 3AAQA 2P9UA 3WXKA 2I7NA 4Y0WA 3H1VX 2OANA 1BA1A 3M1FA 1MA9B 1V4SA 4H5WA 4JN4A 3UKUB 5B8HA 3CETA 1V4TA 4GNIA 1S3XA 4BROA 4BRHA 4BG8A 5AQSA 1NWKA 1TUUA 3J8AA 1YUWA 3A5LC 5E26A 3GE1A 2FSJA 1JCGA 3EO3A 3LDQA 3O1BA 3U9ZA 4JD2A 2PAVA 3I8BA 3CJAA 4KBOA 4QS7A 1Z05A 4RWTA 4A62A 1WOQA 5KPTA 4BR9A 4FWPA 2BTFA 3ZEUB 4FO0A 4QS8A 1J6ZA 2VCPA 2F9WA 3AARA 2V7ZA 2ASOA 3UKUA 3D7EO 4CZJA 5LY3A 2ASPA 4IXCA 3IMXA 4BVOA 2EWSA 3EL2A 1QHAA 3MN9A 4IO8A 3HBTA 4FSVA 5AQQA 5AQRA 1BDGA 2Q2RA 4IJAA 3LDPA 2V52B 4O5FA 4IJNA 5JLFA 3CQXA 2QWQA 3UKRA 2V7YA 3MK6A 4FPBA 2D0OA 1NM1A 3S41A 4BR4A 2ZWHA 3U8XA 4HTLA 4H03B 4CZMA 5F2RA 1OKJA 3VGKA 2QWMA 3M3ZA 5FPEA 4BRLA 4A2BA 3R9PA 4CZFA 1SZ2A 4BR7A 3WQUA 3MCPA 1GLCG 4AM6A 5EVZA 1S22A 3ULEB 5AQUA 3ATVA 1GLAG 2FF3B 3FE1A 3LDOA 3BEXA 1HLUA 4YDUA 3UB5A 4BQLA 3DWLA 2GWJA 4B9QA 4CZGA 4CZIA 4CD3A 4MO5A 1MWKA 4H5RA 4PL7A 3L6QA 3MDQA 1XUPO 4H0XB 3HM8A 4BRMA 4EHTA 2W41A 1ATNA 5BN9A 2IVNA 2D0PA 3VEOA 3FZFA 2Q97A 5AQNA 4FWSA 3ZETA 5BRDA 1JCEA 1HKGA 4BC3A 4JHDA 1KAXA 3WXLA 5EXWA 3L0QA 3LDLA 1QQOA 1IJJA 3B8AX 4XH4A 1ZC6A 1BG3A 3HZ6A 1NGHA 2E2OA 3QDKA 3VGLA 3SLCA 5AQMA 2CH5A 3DXKB 3AY9A 4WQ5A 1E4FT 1NGGA 2NRHA 2ZF5O 5FPMA 5KPZA 5AQIA 3WUHA 1KAZA 2P9IA 4FOIA 4DQ8A 2QWNA 2V51B 3A5NC 4BGBA 4JNEA 3I33A 3W3DA 2FLOA 4BR0A 3VOVA 5F0XA 4FL9A 2IVPA 3KZBA 4M63C 2QWPA 2H3GX 4FWMA 2E20A 4H0TB 5BPNA 5BRFA 2IIRA 3QBXA 3MMVA 3U9DA 4CZLA 2AP1A 4C23A 1BU6O 1NGBA 4YDUC 1NGCA 1RDWX 1GLDG 3A5MC 3DXKA 3FZLA 3IDHA 3BF1A 5AQHA 3DXMB 5CE3A 4EHUA 2AA4A 2NZTA 4RCHA 3QFUA 3O8MA 2CGLA 2FF6A 4ISGA 3O4WA 5ADXH 4FWKA 4IWVA 2P9SB 2E8AA 3UE5A 4BG9A 1TUYA 1TYQB 2A41A 3L4IA 1GLJO 4CJ7A 2E88A 4FWRA 3FGUA 3RSEB 4H0YB 4CBXA 4CZHA 1ATSA 1P8ZA 3EZWA 4DB3A 3VEYA 4BQZA 3M6GA 3OHRA 4BC2A 5JLHA 3G25A 4H0OA 4WQ5C 2GTDA 4A61A 1MWMA 4E1JA 4BR2A 1H1VA 5AZIB 4K25A 3CI5A 5BR9A 1K8KB 2Q0RA 3JS6A 3DXMA 4K43A 4XH5A 3ID8A 4H5TA 5AQJA 1BUPA 3W0LA 3ATUA 3EKSA 2NLXA 4PKIA 4BRDA 3O6WA 3ZEUA 1IG8A 1ZXOA 3WXJA 2QM1A 4I6MB 5JMVA 5AR0A 5FPDA 2J4RA 2E2NA 1BOTO 4WQ4A 3VGMA 1D4XA 4EFHA 3QMLA 5AQYA 3MN5A 3GOIA 3VPZA 4MLHA 2ITMA 3WXIA 5LJWA 1BWFO 3WEEB 5AZJB 2VWBA 3CJ7A 2P9NB 5AQKA 1KAYA 1QQNA 3GBTA 4PL8A 2PBDA 3ENHA 3KHYA 2A5XA 2GWKA 3CQYA 3EKUA 4H5NA 2A3ZA 4BRKA 1NGAA 3VF4A 3C7NB 1ESVA 3VENA 4FWQA 2YJFA 2HOEA 3GL1A 1CZAN 1X3NA 2VYPA 2QWLA 4BVPA 4PKHA 3CIPA 1NGEA 2CGJA 5AQTA 3D2FB 3A8YA 5KQDA 4DCHA 4LC9B 5KQ8A 2HF4A 4L3QA 3H46O 2Q36A 3ULEA 5BPLA 5BPMA 1NLVA 1NGDA 3WEEA 2BUPA 2HMPA 3BF3A 5AQOA 4NO7A 2ASMA 4RTFD 3ZX3A 4O8KA 4CZKA 4B1ZA 1BO5O 5AQWA 1MDUB 1YVNA 1SAZA 5AQGA 2A40A 2P9KB 4XH1A 4BRQA 1NBWA 3LM2A 3CJ1A 4ISFA 2CGKA 3WT0A 3FR0A 2P9UB 1EQYA 4WQ4C 3SJHA 4BRAA 4FWNA 2A42A 3VF2A 4Z94A 1BA0A 3QICA 3C0BA 1WUAA 1NGJA 3VETA 5AFUH 1XC3A 2FSNA 4H0VB 4FWLA 1QQMA 3GG4A 4BC4A 1GLEG 3AAPA 4DHYA 5AQXA 2W40A 4QS9A 3O5BA 1Z6RA 1LOTB 4EAHD 2Q31A 4JAXA 3SMSA 1HKCA 4K41A 3H6EA 5AQPA 5BN8A 4CZEA 1GLBG 1HUXA 5JICA 4CI6A 1ATRA 1YXQA 1R59O 2D1KA 5AQZA 3R6MA 3P4IA 3TPQA 1YAGA 4K42A 5EY4A 5ADXA 4IZ9A 4FWOA 1QZ5A 3O80A 3VF6A 3F9MA 1U6ZA 1JCFA 3SMPA 2P9LB 3CHWA 3QFPA 3FZKA 2YI1A 3H1QA 5BREA 2YHYA 4MLEA 4B1XB 1NGIA 2E1YA 2E2QA 5AQFA 3CJ9A 4BRPA 1E4GT 1ZBSA 3CJBA 4MO4A 1LCUA
chains in the Genus database with same CATH superfamily
3THXA 2HHQA 4EP5A 1NJYA 4EZ9A 2P9SA 1TAQA 3MEGA 1T6DA 1UWBA 2BANA 3I8DA 2DTUA 3DLBA 4BRNA 4IOAL 2VG5A 3RSEA 3MN6A 2UXBK 2P9LA 4PKGA 2BE2A 1RILA 1SS6A 4HUEA 5C2FA 4W5NA 4JKGB 3FLCO 5AZIA 4B1VA 4HUFA 1NK7A 1K8KA 3EEQA 4FJIA 1NGFA 3R8EA 3IFRA 3KKSA 4Z0UA 4DTMA 2D5RA 3CM5A 1VSHA 2YNHA 4LFAK 3VEWA 1YTUA 3NGYA 1S9GA 5TKYA 2E2PA 4HWIA 2YNGA 4YFUA 3DLKA 4Q5VA 3ZCMA 4DR4K 4W5QA 2R7YA 3BP8A 3L3UA 3VEZA 3S3MA 2HF3A 4JK9A 4QAGA 4YORA 1C6VA 4FZXC 2NRWA 2XRIA 3J80O 2P9PB 3KK2A 4DFKA 4OLAA 4FM2A 3K0SA 3DAWA 3CPWM 1VAZA 1KRPA 4FVUA 4FXDA 4ISEA 2E5LK 1VSMA 1BIUA 4H0PA 5CR4A 3G71N 5TKWA 3CYMA 1J54A 1L3TA 4IBNA 2P5OA 4CJKA 1T7PA 3DRRA 3VTIA 1CZ9A 4IO9L 2P9PA 5KPRA 1KFSA 4BREA 1VQMN 3P31A 1GLFO 5J2MA 1X9MA 3K2PA 4DU3A 3LM9A 5EX5A 4EP4A 4JD2B 4R5PA 3C6TA 3HTVA 3RR8A 4DQSA 4J2EA 3VTHA 3PY8A 1NK9A 3AAQA 3EZ5A 3EYZA 4Y0WA 1RBUA 2HBLA 3HOSA 1LW0A 4DKWA 1BA1A 2HVHA 1MA9B 3UKUB 1TVRA 1V4TA 1HQUA 1HMVA 4GNIA 4ELVA 4Z4EA 1FW6A 2KFNA 1RBVA 3HRGA 5AQSA 4NLCA 3AVFA 3LDQA 1IH7A 4JD2A 3O9RA 4JI4K 3I8BA 5C10A 1S6PA 1X1PA 3CJAA 3QNOA 4QS7A 1JLGA 3V9WA 4Y1DA 4B3TK 4JK7A 1WOQA 3ZEUB 4IG0A 1IBLK 1J6ZA 1IKVA 1OVYA 2VWKA 3UKUA 4CZJA 4JEPA 4DR7K 3M8QA 3THWB 3EL2A 3B6OA 3KIOA 2NRXA 3U3GA 4AHTA 2X6NA 1BDGA 1C0UA 1XHXA 4CJPA 3AVCA 3CQXA 4DFPA 2G8WA 2V7YA 1TK5A 2ZWHA 4JKFA 4IFEA 1I39A 3NCIA 4I2PA 3THWA 5FPEA 4B3MK 3BY5A 4RW8A 4DUZK 4CHZA 3WNFA 4BR7A 1Q82O 2O8EB 4NYFA 4OPAA 1S22A 4M41A 4K8ZA 5KGXA 3KWGA 3FE1A 5C15A 3BEXA 4CEOA 3UB5A 4BQLA 1TKXA 1EWQA 4FM0A 5HRNA 1ASVA 4WFAL 3SZ2A 1YJNN 4JV5K 4M45A 1IV0A 3F5TA 1RDCA 4H5RA 4AF1A 5HLFA 1XUPO 3OJUA 3SUOA 3AA4A 3O3GA 4LF4K 3VEOA 4X64K 1HNXK 4IFYA 3TAPA 4BC3A 1BCMA 5EXWA 3NBPA 3HVRA 4B3SK 3D0PA 4OGCA 1KVCA 5AQMA 3DXKB 4DR6K 3M8PA 1NGGA 5KPZA 4KHSA 4PHTX 1NK0A 4OKEA 1XNQK 1DT9A 2P9IA 1TAUA 4FOIA 2V51B 3DOLA 3I33A 3TTCA 3W3DA 2OZMA 3NAEA 1VQPN 4BR0A 1VQ8N 4JI3K 2JWKA 5J2PA 2QWPA 3SUPA 1JLAA 2XY8A 4NCBA 3CF5L 5DM6L 1EX4A 2IIRA 4CZLA 2HHUA 1NGCA 1RDWX 4CF1A 1SL2A 1GLDG 3DXKA 3T1HK 3FZLA 3S9HA 3IDHA 1HQEA 5AQHA 3NH2A 3DRSA 4OPKA 2B4JA 3O9SA 3KLHA 3TARA 1C1BA 2CGLA 4ISGA 4FW1A 2RN2A 1IO2A 1QSSA 4NXMK 1W97L 4FWKA 5ADXH 4IWVA 2E8AA 4YNQA 4Z4HA 5M1KA 1TYQB 1GLJO 1VK0A 4FWRA 1VSDA 3FGUA 3OTOK 1S1VA 3P83D 2PYJA 3IS9A 4H0YB 1T3VA 1P8ZA 1WN7A 4DB3A 2G8FA 4DR5K 4K25A 1HJRA 4RG8A 3SV3A 5BR9A 3AA2A 3LPUA 2ZE2A 4CIEA 3CCRN 1ASUA 3VQQA 4PUOA 1HYZA 3KK1A 4JI2K 3Q7CA 3W0LA 3IKMA 3AA5X 3VMFB 4JI0K 4CGFA 1CXQA 1JLFA 1ZXOA 4AQYK 2QM1A 4GV3A 4M3XA 5FPDA 2WOMA 1O13A 2J4RA 1K6YA 2E2NA 1D4XA 4G1QA 5AQYA 4CJ4A 4IOCL 3MN5A 3T19A 4A5AA 3SUQA 3TSQA 3ZT1A 4ZHRA 1KVBA 4TSXA 3WEEB 3T1YK 4CF8A 2HHHK 2EX3A 2A5XA 2YNFA 2ZJPL 4BDZA 1VQ7N 3R3LA 4BRKA 1WLJA 3VENA 4JI1K 1NKBA 2E4LA 3CIPA 5EU7A 2HHXA 4O5BA 3A8YA 5KQ8A 4ELUA 3H46O 3ULEA 2QKBA 4IOXA 3T1AA 3WEEA 2BUPA 4DFMA 4DG1A 2IOCA 2JGUA 4CW7B 1LWEA 1L3SA 2WONA 3NFAA 4CZKA 4PQUA 4B1ZA 5AQWA 4YOVA 1SAZA 3TANA 2A40A 4XH1A 3LM2A 3CJ1A 1VSLA 1EQYA 2W6KA 1VSKA 4R79A 1M90O 3VF2A 1I3AA 4CJLA 1BQMA 1BA0A 3VETA 1KLNA 4ID5A 1XC3A 2O4GA 4DSFA 3PLAA 1J5EK 4H0VB 3OYAA 2P5GA 3LAMA 1WSFA 1RDDA 3NF6A 3CMEN 1QQMA 2QI2A 3GG4A 4FJ8A 2Z1HA 2W40A 3O9QA 2VG7A 3AO5A 4EAHD 1HKCA 4K41A 2OZSA 1GLBG 5JICA 4CI6A 4LD0A 4E7KA 3KLGA 1WSHA 3CC7N 2G8UA 1FKPA 5AQZA 3P4IA 4A57A 1JLCA 2KZZA 2YV0X 4MDAA 4IZ9A 4FWOA 4FLUA 3QEXA 3CCLN 3F9MA 1RCHA 3LPTA 4DTUA 3CXCM 3SMPA 3NVMA 1QE1A 3V1QA 3FZKA 3SNNA 2YHYA 1XMOK 1NKCA 4IEEA 2O8BA 4OJRA 4CJ3A 5KTQA 3KD5E 3M5RA 4FJXA 1J5OA 1D8YA 4PL8A 3KLFA 4IEIA 2KKZA 3JXUA 3RR7A 2UYTA 2QWOA 1TKZA 3SBGA 1SQKA 3V1RA 4YOYA 4GV9A 3ZSZA 1QVFM 4QCLA 3GDQA 2QKKA 4HTUA 3PX0A 4JKCA 4WFNL 5M1QA 1YT3A 4H5VA 4BE0A 5EOYA 4UQGA 2OPRA 4DR2K 1T8EA 1XI1A 1JL1A 5J2NA 4LH5A 3O08A 4BRFA 1RTHA 2WFBA 4KREA 4E3SA 1T6CA 4JK8A 1DEJA 3KLEA 3K5LA 4BE1A 4LF8K 5F1XA 3D45A 3O9TA 3B6PA 5C24A 4DV6K 3LDSA 3ENOA 3E9OA 2I5JA 2KFZA 3I55N 4CD1A 3V9XA 4I6MA 4DTJA 4WFBL 1QSYA 4HHTA 3OS2A 1S5JA 5KRTA 3MXIA 1GLLO 3ZETB 2FXUA 1U2VB 2OCEA 4M7XA 3TAFA 3QEVA 3ZSYA 1VSJA 4EIAA 4CVNE 1RBSA 4B1YB 3U4LA 2XY7A 1WB9A 3KLIA 4B8AB 2GELA 3QIOA 1YJ9N 3MX2A 3K9JA 3VEXA 1U2VA 2A6AA 1REVA 4O44A 3D2FA 4KI6A 3FFKB 1Q81O 3UIQA 1HNWK 5AFUA 2GEMA 4E7HA 1Q8IA 4CF2A 3QB0A 1RTDA 4CCHA 1C0GA 4MQ3A 2YJEA 3O1WA 4A2AA 4M42A 2HHWA 1X9WA 1YHQN 3CERA 1Q18A 2P9KA 1QZ6A 2GV9A 4OVLA 4KTWA 2P9UA 2OTJN 3WXKA 1VQON 4ZTFA 1JLEA 4ZTJA 5FDLA 3H1VX 2OANA 3ZLJA 5JS2A 3V9SA 3M1FA 4H5WA 1QSLA 2Y1IA 5B8HA 2ZJQL 4OLBA 1EKEA 4BROA 4AHRA 4JI6K 3AVIA 2FSJA 3M8RA 3EO3A 3O1BA 2VGMA 5DMRA 3T69A 3MWTA 3SQ4A 4GKKK 1BQNA 1JLQA 5GAHP 5FRNA 4RWTA 4A62A 1BI4B 4BR9A 1Z26A 1N34K 1S6QA 2B5JA 3PX6A 4M3ZA 4QS8A 3QLHA 3BZKA 2F9WA 1R0AA 1LV5A 3D7EO 3THVA 3V9UA 2ASPA 3SPZA 4F4KA 1DTQA 4IDHA 4DQQA 4CEBA 1HRHA 5AQRA 2O8DB 2V52B 1QTMA 3E9LA 4FLYA 3PIPL 3MK6A 3HPOA 4BR4A 4KO0A 4HTLA 2KQ2A 1RT4A 4DF8A 3SPYA 4YOWA 2QWMA 4BRLA 1RT6A 1SZ2A 4O0IA 3L2QA 1GLCG 4JKGA 1RDBA 5EVZA 1S1TA 3OS1A 4DMNA 4FLVA 1UOCA 3HL8A 3WNEA 2O8DA 1OVQA 1WBDA 1OH8A 4YDUA 5E41A 3DWLA 4JS4A 2WBNA 3SYZA 1RT3A 1W9HA 4MO5A 1MWKA 2XHBA 3L6QA 3MDQA 1SKRA 2UUAK 4LF7K 3HM8A 4KHUA 4EHTA 3CCQN 1ATNA 5BN9A 3ALYA 2IVNA 3QIPA 3OYHA 1Q86O 1K8AO 4FWSA 3QEWA 4CHYA 5HRRA 1JCEA 1KAXA 4YHHK 2UU9K 3WXLA 3L0QA 1TV6A 3DLEA 3LDLA 1JJ2M 3BDPA 1QQOA 1T05A 3B8AX 4XH4A 2YKNA 4FW2A 3QDKA 2E2OA 4OGEA 4KTZA 3CCEN 3O4NA 4G9ZA 2CH5A 3K59A 1E4FT 3CPEA 4DV4K 1KCFA 4MFBA 4X62K 4KH5A 2NRHA 5AQIA 3WUHA 1KAZA 2QWNA 4FJJA 3ASMA 3A5NC 4CHQA 4OKKA 3C94A 4C8MA 2FLOA 2ATQA 3HSTB 5F0XA 2EHGA 3OYIA 1TKDA 3AVGA 3KZBA 2HHSA 4FWMA 5BPNA 4OPJA 2AP1A 4I9QA 4JS5A 2D0AA 1NGBA 4YDUC 2X78A 4FK0A 4W5RA 1YF5L 4ID1A 4W5TA 4O4GA 1Q7YO 3DXMB 1Q9YA 3I0SA 4RCHA 2FF6A 1QQCA 4ICLA 2IGIA 3HYFA 1IG9A 4LF6K 3VQAA 2A41A 1YJWN 1NMNA 2GUIA 3L4IA 2E88A 1G15A 1ZBFA 3MXJA 3VEYA 4CFBA 4BWJA 3M6GA 4BC2A 4FK4A 1VQNN 4GV6A 3RRGA 2GTDA 4A61A 1MWMA 1TKTA 4E1JA 4PWDA 4DTRA 1XHZA 5LL6Z 4OPHA 1HNVA 3DXMA 1C1AA 4XH5A 1RDUA 4H5TA 3MAQA 2F7TA 1B9FA 3AVKA 4O0JA 3EKSA 4NCAA 4PKIA 4BRDA 2Z1JA 3ZEUA 4DWIA 3V4IA 4CESA 4F3OA 2A1RA 4CIGA 2B6AA 3S3OA 3VGMA 1ASWA 3WNHA 3KD1E 1UA1A 4EFHA 3QMLA 4CEDA 1BIZA 3MECA 2DY4A 3F9KA 3D6RA 3CM6A 5KI6A 3VPZA 1EP4A 2OPQA 3DLHA 5AZJB 5FROA 3RMCA 2P9NB 1WSEA 2OTLN 4N41A 5HBMA 5AQKA 5C42A 1RT5A 4B3RK 3KHYA 3CQYA 2KLAA 2JLEA 3C7NB 4F2SA 1EXQA 2YJFA 1ZBLA 2HOEA 4N47A 3TAMA 1X3NA 1ZBHA 4BVPA 2RF2A 3OYNA 1U45A 2RE2A 2CGJA 5AQTA 4F3TA 4JI7K 2O8EA 1NOZA 4L3QA 5BPLA 5BPMA 1NGDA 3N4QA 5AQOA 4B9NA 4NO7A 1NNEA 4YOUA 3SBTA 1MDUB 3DOKA 4CGJA 3CCSN 4FJKA 4UY8O 2NRZA 1SV5A 3NE6A 1NBWA 4ISFA 4Z4CA 3P1GA 3SJHA 3ZSRA 4FWNA 3VA3A 2A42A 3CFOA 4JRQA 4DSLA 5I3UA 4IG3A 4CJTA 1WUAA 1LAWA 1NGJA 4RW6A 2FSNA 3KTQA 2FBVA 1S72N 3LANA 3I0RA 3LAKA 1SKSA 3NF7A 2O4IA 4FLTA 2BGGA 4DTXA 3CD6N 1GOAA 3ID6A 4LSNA 3SCXA 2E6MA 4JI8K 1YXQA 2Z1IA 1LWFA 2D1KA 4C8NA 3HJFA 3SUNA 1YAGA 1C0MA 5EY4A 5ADXA 1YITN 4Z4FA 3VF6A 1TL3A 1GOBA 2HSTA 1U6ZA 1I94K 2Q3SA 4FZZA 1VSEA 4CERA 5BREA 4PY5A 3NF8A 5AQFA 3L4QA 3CJ9A 3P38A 1T03A 1E4GT 4F8RA 3VN5A 3J7YP 1ZBSA 3DJCA 1HPZA 3CCUN 3UKRB 3FZMA 1SL0A 4RW4A 3TU5A 4DV3K 2ZGYA 4LF9K 1IKYA 1TYQA 4BGAA 5C0YA 4CBUA 1F21A 1HPMA 1VQ9N 3VQ5A 3A0IX 3H3OB 1NK6A 1HYSA 3ISNC 4ELTA 4KV8A 5HRSA 4NLBA 5BRHA 3VEVA 1JL2A 1KXPA 5AQLA 2FSKA 4JKHA 3ZSOA 5E84A 4F9OA 1C0FA 3CCJN 1T44A 2I7PA 3OYEA 3VQ9A 4DSEA 3SAHA 3OYBA 4CF0A 2VG6A 3PSFA 5LMNK 2FBXA 3QBWA 2QWRA 3PO4A 2Q0UA 5CZ1A 1DKGD 4FK2A 3JSMA 5LJVA 2HBJA 4XEIA 2HVIA 5FPNA 3L2VA 3A5OC 4BRIA 4CEAA 4ILHA 2QXFA 3AO4A 3VQ6A 2O8CB 1SUQA 3FZHA 3OYFA 4JHDB 4IDKA 1RFQA 2FBTA 2NRTA 5IWAK 1MU2A 4ILJA 4B1UB 1IBKK 3D2EB 2XY6A 4DQPA 3AVAA 1HYVA 4KRFA 2HMIA 5ELZA 4CJWA 4CJVA 4DSJA 2GUPA 3OYDA 2WC9A 2QXLA 3HOTA 4FPAA 3KK3A 2RKIA 3WXMB 3CJCA 2E6LA 2AJQA 1WSGA 1RNHA 1HJOA 3JAMO 3BUZB 1A5XA 2E1ZA 4BRGA 3SQ1A 1WSIA 2D4WA 3EN9A 4LFBK 3TABA 2YCHA 2PFUA 3H08A 4L8RB 3OBYA 3DLLL 2YHWA 1KSPA 1D5AA 3D2EA 1M1KO 3ZSVA 3ZSXA 4N56A 4KTQA 4CJEA 1RT1A 4CECA 2Q1NA 4W5OA 2BDPA 3LZJA 1C1CA 2DFFA 1G99A 5J2QA 3KK7A 5I9EB 4C1NI 3K9KA 5C12A 3E01A 1VQ6N 3P5JA 4C8LA 4WYBA 4CGDA 3OVNA 2YHBA 2D0CA 4JRPA 4LF5K 4DV7K 4CHOA 1W2BM 1U04A 4CK1A 2P1JA 1V4SA 2NRRA 3AVHA 4JN4A 3OBWA 3CETA 4I7FA 1TGOA 2NUBA 1VSIA 4HCBA 3VA0A 1TUUA 1YUWA 3A5LC 3V6DA 3U9ZA 2PAVA 4FJ5A 2W42A 2OA8A 3PV8A 4KH6A 1TL1A 5KPTA 3DYAA 1EO1A 2VGNA 4XIUA 4FO0A 3DRPA 3OYJA 3OJSA 4CF9A 3RWUA 2O8FB 2NRVA 4YOTA 4IXCA 3ZT3A 3O3FA 4H4OA 3RMAA 1NU0A 1QHAA 4IO8A 1WNSA 1S1UA 1NK8A 5K14A 3CC4N 5AQQA 3K57A 1QHTA 4IJNA 4A5BA 5JLFA 5CY4A 2IC3A 4FPBA 2D0OA 1NM1A 3S41A 4DV1K 4CFDA 3MEEA 5F2RA 1OKJA 3ZSWA 4DTNA 3VGKA 3HK2A 5AJ3K 4NYNA 3M3ZA 1IBMK 1ITGA 1WAJA 4A2BA 4RW7A 3AV9A 3WQUA 3CG7A 4B08A 4AM6A 3BZCA 3N4PA 4X65K 5AQUA 4M3TA 4DQIA 1GLAG 3QETA 4WE1A 2XO7A 2FF3B 3AO2A 1RDAA 3LP2A 1VQ4N 4JYAK 2GWJA 3F73A 4B9QA 4CZGA 4CZIA 2GBZA 3DI6A 4AILC 5A2QO 1ZYQA 4H0XB 4E7JA 4FJ9A 4BRMA 2W41A 4CJ5A 4CHNA 2F8SA 2HB5A 4V19S 3QEPA 3FZFA 2Q97A 5AQNA 1RTJA 4BDPA 3ZETA 5BRDA 3VQDA 3T3FA 2YKMA 4E0DA 3CMAN 4J2BA 1IJJA 1BG3A 4WQ5A 3AY9A 4KFBA 4B9LA 3K5OA 3DLRA 5FPMA 4Y1CA 4DTPA 4N76A 4DSKA 4KPYA 3DLGA 5GAGP 2PY5A 4IKFA 5IT9O 3Q7BA 3JYTA 3NHGA 4KKOA 1S1XA 4U67L 4M63C 4H8KA 1QS4A 2H3GX 2E20A 4H0TB 5M1OA 1YTAA 4A59A 1BISA 3THYB 3QBXA 5MLCQ 4C23A 1NJWA 3LALA 4DUYK 1BU6O 3NVKA 4E89A 4JKEA 2F96A 2QEXN 4H4MA 3KWIA 1U48A 4FYDA 1TK8A 5CE3A 2AA4A 3NH1A 3THXB 4BE2A 3O4WA 4GVMA 4KHPK 3C6HA 2P9SB 4BG9A 3DMJA 5HROA 4JLHA 1TUYA 4CEZA 4BY9C 3PUFA 3RSEB 3MWPA 4CBXA 1ATSA 2HBKA 3EZWA 1E3MA 5JLHA 3G25A 4WQ5C 4DV5K 4BR2A 1H1VA 1JXBA 5AZIB 4FVMA 3CI5A 4DU4A 1YI2N 1K8KB 2Q0RA 3ID8A 1XC9A 2IDOA 2ZJRL 4B9TA 1N8RO 2VQEK 4DS5A 1BI4A 2NLXA 1BL3A 4FLZA 3LP3A 2YX6A 1IG8A 3WXJA 5JMVA 5AR0A 1VQ5N 2UUCK 4CEQA 4WQ4A 4MDBA 2G8IA 5HOOA 1XWLA 4KHNA 5D3GA 1JLBA 1CZBA 3BGRA 3G6EN 4WF9L 4MLHA 3WXIA 5LMUK 3VQ7A 2G8KA 4FJ7A 3NH0A 1ZBUA 2IAJA 4M3YA 2A3ZA 1NGAA 3VF4A 1ZBIA 1OH6A 3P39A 1ESVA 3C65A 3GL1A 1CZAN 2QTDA 2VYPA 4CJRA 4HVJA 4PKHA 4LY7A 1NGEA 3TAGA 2Q36A 3SJJA 4AHSA 1LW2A 3TI0A 2RHKA 4CGHA 4CIFA 2HMPA 3HM9A 3QEIA 1VSFA 4KAZA 3J7AP 4KB1A 3KJVA 3HPHA 1YVNA 1NOYA 4FJHA 4PA1A 4BRQA 1UA0A 2CGKA 3WT0A 3FR0A 4WQ4C 5H1SQ 4BRAA 3FFIA 3V1OA 4IFVA 2WTUA 3QICA 3OA9A 2OPSA 4CGGA 4CHPA 3S3NA 3NGZA 3TAEA 3J7ZO 3I56N 1K73O 4BC4A 1GLEG 3AAPA 4DHYA 3MCAB 1KTQA 4DTOA 4HCCA 1Z6RA 2HBMA 1LOTB 2Q31A 3AA3A 5AQPA 1SL1A 5BN8A 4CZEA 4DSIA 3LWMA 5FRMA 4DLEA 3R6MA 3AVJA 4M3WA 4J2AA 3TPQA 2KZMA 1FK9A 1VRUA 3TSUA 3O80A 2FC0A 1IKXA 2XY5A 3AGKA 3NMUA 1JCFA 4AHUA 3CHWA 3RRHA 2YI1A 3H1QA 3QNNA 4MLEA 4B1XB 4BRPA 1L5UA 3VQPA 1LCUA 3SAGA 4C1NK 1N33K 1X3MA 5DK5A 3QINA 2QW9A 4KHWA 5BR8K 2YHXA 3U3YA 2F8TA 1L3VA 1A5VA 1K9MO 3HPGA 1XQSC 3L2UA 3PSIA 1HX1A 2ZD1A 4J8FA 3LL3A 5GADP 4AHVA 3O9UA 3VQ8A 3OYKA 3AVNA 2RPIA 4LSLA 1NJZA 3QERA 4HUGA 3TWHA 4E1MA 3MXMA 1BHLA 2IVOA 4DQRA 1HKBA 2Y1JA 3SK3A 1RGIA 4AH9A 5AQVA 1OH5A 1NMDA 3SAFA 3ZT4A 2HNYA 5JS1A 4M7YA 4NXNK 4FM1A 5HL7L 3L2RA 1HNIA 3AGRA 4BRCA 3T7ZA 5C2DA 1DGKN 1FKOA 3VERA 4BC5A 3H45C 3ZX2A 4U7BA 1B92A 2ZGZA 1X9JA 2CH6A 4B1WB 1NJIO 1EETA 4GW6A 4FOEA 1WSJA 5CHIA 3O4QA 5AZJA 4LFCK 2KHOA 2P9NA 3ZX0A 3C6UA 4BR5A 2PYLA 5HP1A 4DTSA 2HHTA 4CJFA 4AHCA 4Z4IA 3HXMA 4NB4A 4CBWA 2P9IB 1RBRA 3G10A 3C7NA 2QK9A 5CYQA 3HI0A 3NGIA 3LZIA 3MN7A 2DPNA 3V9ZA 3R1XA 3LDNA 3CCVN 3H3NO 3IUCA 4CEFA 4FCYA 3KVGA 1U47A 4J2DA 2WUSA 4JKAA 1BGXT 1DLOA 2F9TA 4CFAA 2LSNA 1J9AA 3VESA 4AM7A 3HO1A 4NCGA 3OYGA 3HSCA 1U4BA 3IG1A 4YOXA 1Y64A 3NDKA 4B9MA 4GY2B 4DS4A 4DU1A 3WQTA 2GX9A 4DV2K 1CXUA 2I7NA 4GVEA 4B9SA 4YY3K 3EE9A 1NK4A 3ZSQA 2YNIA 4BACA 4EZ6A 4WCEL 1VRTA 3TSPA 4E19A 1Z25A 1S3XA 2IS3A 4KI4A 4BRHA 3ZT0A 4BG8A 1NWKA 3J8AA 5E26A 3GE1A 1JCGA 5GIOA 3TTFA 1GOCA 3AO3A 3CFRA 3OYMA 3RMBA 4KBOA 3HP6A 1Z05A 1C0TA 3OY9A 1VQKN 4M3RA 3CFPA 1VQLN 3ENBA 2KW4A 2BTFA 4FWPA 5I42A 4DR3K 2VCPA 3AARA 2V7ZA 2ASOA 2W6LA 3OS0A 5LY3A 3IMXA 4BVOA 2EWSA 4DF4A 3MN9A 2ITGA 3VQEA 3HBTA 4FSVA 3LWLA 2Q2RA 4IJAA 3LDPA 4O5FA 3TR8A 3WNGA 3RMDA 3K5NA 2QWQA 3UKRA 3HP9A 4CFCA 3U8XA 1IKWA 1N5YA 4H03B 4O55A 4CZMA 3U6FA 4DV0K 5T7BA 1NK5A 1B9DA 4F2RA 3R9PA 4CZFA 3TTDA 4QOZB 3MCPA 1HNZK 3OYCA 3CC2N 1WAFA 3ULEB 2ZM6K 3KKRA 3CCMN 3ATVA 3QO9A 2X74A 4I9LA 4E7IA 4N5SA 4M3UA 3J81O 4FJGA 4K8XA 3LDOA 1HLUA 4LH4A 4I2QA 3M8SA 4DLGA 2OPPA 3NF9A 4FJMA 4CD3A 4B9VA 4PL7A 5DM7L 4B8CA 1KFDA 2Z1GA 5KGWA 4Z4GA 3CQ8A 3EY1A 3L2WA 1D9DA 1U49A 2D0PA 2X6SA 2O8CA 4JKDA 1HKGA 2G8VA 4FJLA 3ITHA 4JHDA 3RVCA 1ZC6A 2NNWA 3HZ6A 3VGLA 1NGHA 3SLCA 4CJUA 1RTIA 1D9FA 1TK0A 2PZSA 2ZF5O 4BDYA 5FLXO 1DTTA 3HVTA 4KB0A 4DQ8A 3K5MA 4BGBA 5C25A 4JNEA 3AVLA 3VOVA 4GKJK 4FL9A 1UAXA 2IVPA 4GMJB 3MEDA 5M1NA 2QA4N 4E1NA 5BRFA 3MMVA 4RW9A 3U9DA 4OO1J 4B3OA 2KTQA 3A5MC 3BF1A 5HRPA 4O8UA 4JKBA 3E1YA 4KH4A 3HT3A 2JWLA 3SV4A 2O8BB 4EHUA 2NZTA 4CJSA 3QFUA 1P90A 2BH1A 3IRXA 3O8MA 4CK3A 2HHVA 1S9EA 3L3VA 3UE5A 1A5WA 2D0BA 4CJ7A 3IAYA 2UUBK 3RTVA 1YVUA 3EE8A 1N36K 4DR1K 4CZHA 3MX5A 4BQZA 3OHRA 4CK2A 4H0OA 2G8HA 1XMQK 4CE9A 5M1FA 1O1WA 3LP1A 1JKHA 2HW3A 3JS6A 3AO1A 3A2FA 4K43A 3SQ0A 1KVAA 3VQBA 5AQJA 1BUPA 5JVGL 1N32K 2VQFK 1NJXA 1JXEA 3SQ2A 3ATUA 4FLXA 3ULDA 4ILGB 3TAQA 3LP0A 3O6WA 1CLQA 1RT7A 4C8OA 4CJQA 2UXCK 4I6MB 3V81A 4JI5K 2O8FA 1BOTO 4X66K 4DFJA 1LAVA 1X9SA 1BCOA 1NKEA 1RBTA 2OYQA 3GOIA 3SI6A 2ITMA 5LJWA 1BWFO 5M1PA 3C6AA 5JVHL 2VWBA 3CJ7A 1KAYA 1QQNA 3GBTA 3PIOL 3VQCA 2PBDA 3ENHA 3G0ZA 1J53A 2GWKA 3EKUA 1EWRA 4H5NA 5GINA 1W0HA 4FWQA 5CYMA 1FXXA 2P51A 1LWCA 3ZYYX 2VWJA 2QWLA 3AVBA 3D2FB 4OX9K 3PX4A 1FJGK 5KQDA 4DCHA 4LC9B 3C95A 1KD1O 2HF4A 1W7AA 2DFEA 2YHAA 4E7LA 1NLVA 1NG9A 3BF3A 1HR0K 2F4VK 2ASMA 4C8KA 4RTFD 3ZX3A 4CEEA 4O8KA 1BO5O 1KQSM 5AQGA 2P9KB 3OW2M 4FZYA 5SZTA 3PO5A 2P9UB 1YIJN 3K58A 3VQ4A 2HNZA 2ETJA 4Z94A 1L3UA 3C0BA 4FLWA 2UXDK 3QESA 5AFUH 3L8BA 1RT2A 5SWMA 3O3HA 1N6QA 4FWLA 5AQXA 2ZQBA 4CGIA 4QS9A 4KHYA 3O5BA 5CZ2A 4JAXA 4KHQA 3SMSA 4B9UA 3AVMA 3H6EA 3ZT2A 3OYLA 5GIPA 5KRSA 1HUXA 1KLMA 1ATRA 1WBBA 3E66A 1R59O 1XNRK 4Q0BA 1S1WA 4K42A 1KC8O 4BWMA 1SKWA 2A1SA 3DM2A 3G4SN 5J1EA 1QZ5A 2FBYA 1VHXA 3F2KA 5GAEP 4FJNA 3THYA 1Y97A 1Q9XA 1OH7A 2P9LB 2DFHA 3QFPA 2HNDA 4K0KK 1QVGM 1NGIA 2E1YA 2E2QA 4OKJA 3E9PA 1ILYA 3CJBA 4MO4A
chains in the Genus database with same CATH topology
3DJCA 2KKZA 3CCUN 3JXUA 3FZMA 3UKRB 3SAGA 4C1NK 3TU5A 2UYTA 2ZGYA 2QWOA 1X3MA 2P9SA 1T6DA 3SBGA 1SQKA 2QW9A 4YOYA 1TYQA 4BGAA 5C0YA 4CBUA 1HPMA 2YHXA 4BRNA 1VQ9N 4GV9A 1QVFM 4IOAL 3GDQA 3A0IX 3H3OB 3RSEA 3MN6A 4JKCA 4WFNL 2P9LA 4PKGA 1SS6A 5M1QA 5C2FA 4H5VA 5EOYA 1K9MO 4NLBA 5BRHA 4JKGB 1XQSC 3VEVA 3FLCO 1KXPA 5AQLA 2FSKA 5AZIA 4B1VA 1HX1A 4JKHA 5E84A 4J8FA 4F9OA 1K8KA 1C0FA 3LL3A 5GADP 3CCJN 1T44A 2I7PA 3O08A 3O9UA 4BRFA 1NGFA 3R8EA 3IFRA 3SAHA 2WFBA 1T6CA 4JK8A 1DEJA 3QBWA 2QWRA 2Q0UA 5F1XA 3O9TA 2IVOA 1DKGD 1HKBA 3VEWA 5LJVA 2HBJA 3ENOA 4XEIA 3E9OA 3SK3A 3I55N 1RGIA 5TKYA 5AQVA 2E2PA 1NMDA 4HWIA 4CD1A 4I6MA 3SAFA 5FPNA 3A5OC 4BRIA 4M7YA 4WFBL 4ILHA 5HL7L 1GLLO 3ZETB 2FXUA 3AGRA 4BRCA 3T7ZA 3BP8A 1DGKN 5C2DA 1U2VB 3FZHA 4M7XA 3VEZA 3VERA 4JHDB 4BC5A 3H45C 1RFQA 2NRTA 2HF3A 4JK9A 4ILJA 4YORA 3ZX2A 4B1UB 2ZGZA 3D2EB 4U7BA 1X9JA 2CH6A 4B1WB 2NRWA 4EIAA 1NJIO 5ELZA 4FOEA 2P9PB 2GUPA 4B1YB 5CHIA 2WC9A 3U4LA 5AZJA 2KHOA 2P9NA 3ZX0A 4BR5A 2QXLA 3HOTA 3DAWA 4FPAA 3CPWM 1VAZA 3WXMB 3CJCA 4FVUA 4ISEA 4NB4A 1HJOA 4CBWA 2P9IB 3BUZB 3C7NA 4H0PA 5CR4A 2E1ZA 4BRGA 3G71N 2D4WA 3EN9A 2GELA 1YJ9N 5TKWA 3HI0A 3MX2A 3K9JA 2YCHA 3VEXA 2PFUA 3MN7A 3OBYA 2DPNA 3R1XA 3DLLL 1U2VA 2A6AA 3LDNA 2YHWA 3D2FA 3CCVN 3H3NO 3IUCA 3KVGA 2WUSA 3FFKB 4JKAA 3D2EA 3VTIA 1Q81O 1M1KO 2F9TA 4IO9L 2P9PA 5KPRA 4BREA 5AFUA 1VQMN 2GEMA 2Q1NA 3VESA 3P31A 1GLFO 4AM7A 3QB0A 1G99A 1C0GA 2YJEA 3KK7A 5I9EB 3LM9A 3O1WA 4C1NI 4A2AA 5EX5A 3HSCA 3K9KA 5C12A 4JD2B 1YHQN 1VQ6N 3HTVA 3CERA 4YOXA 1Y64A 1Q18A 2P9KA 1QZ6A 4WYBA 4GY2B 3VTHA 3WQTA 2GX9A 3AAQA 2P9UA 2OTJN 3WXKA 1VQON 2I7NA 4Y0WA 4GVEA 2HBLA 3H1VX 2OANA 3EE9A 3HOSA 4DKWA 1W2BM 1BA1A 3M1FA 1MA9B 1V4SA 2NRRA 4H5WA 4WCEL 4JN4A 3TSPA 3UKUB 3OBWA 5B8HA 3CETA 1V4TA 2ZJQL 4GNIA 1S3XA 4BROA 4BRHA 4BG8A 3HRGA 1NWKA 1TUUA 3J8AA 1YUWA 3A5LC 4NLCA 5E26A 3GE1A 2FSJA 1JCGA 3EO3A 3LDQA 3O1BA 3TTFA 4JD2A 3U9ZA 5GIOA 2PAVA 3O9RA 2VGMA 3I8BA 5C10A 3T69A 3MWTA 3CJAA 4KBOA 4QS7A 1Z05A 5GAHP 1VQKN 4RWTA 4KH6A 4JK7A 1WOQA 4A62A 1VQLN 5KPTA 3ENBA 4FWPA 2BTFA 4BR9A 1EO1A 3ZEUB 2VGNA 4FO0A 4QS8A 1J6ZA 2VCPA 1OVYA 2F9WA 3AARA 2V7ZA 2ASOA 3UKUA 3D7EO 2NRVA 4CZJA 4JEPA 5LY3A 2ASPA 4YOTA 4IXCA 3IMXA 4BVOA 2EWSA 3EL2A 2NRXA 4IDHA 1QHAA 3MN9A 4IO8A 3HBTA 3CC4N 4FSVA 5AQQA 5AQRA 1BDGA 2Q2RA 4IJAA 3LDPA 2V52B 4O5FA 4IJNA 4A5BA 3CQXA 5JLFA 3E9LA 2QWQA 3UKRA 3PIPL 2V7YA 3MK6A 4FPBA 2D0OA 1NM1A 3S41A 4BR4A 2ZWHA 3U8XA 4JKFA 4HTLA 4H03B 4CZMA 5F2RA 1OKJA 4IFEA 3VGKA 4YOWA 2QWMA 3M3ZA 5FPEA 4BRLA 4A2BA 3R9PA 4CZFA 1SZ2A 3TTDA 4BR7A 3WQUA 3MCPA 1GLCG 4JKGA 1Q82O 4AM6A 5EVZA 4OPAA 3N4PA 3CC2N 1S22A 3ULEB 5AQUA 3CCMN 3ATVA 1GLAG 3KWGA 2FF3B 3FE1A 5C15A 3LDOA 3BEXA 1HLUA 4YDUA 3UB5A 4BQLA 3DWLA 4WFAL 1YJNN 2WBNA 2GWJA 1VQ4N 4B9QA 4CZGA 4CZIA 4CD3A 3F5TA 4MO5A 1MWKA 4H5RA 4AF1A 4PL7A 5DM7L 3L6QA 3MDQA 1XUPO 4H0XB 3HM8A 4BRMA 4EHTA 2QA4N 3CCQN 2W41A 1ATNA 5BN9A 2IVNA 2D0PA 3VEOA 3FZFA 1Q86O 1K8AO 2Q97A 5AQNA 4FWSA 3ZETA 5BRDA 4JKDA 1JCEA 1HKGA 4BC3A 4JHDA 1KAXA 3WXLA 5EXWA 3L0QA 3LDLA 1JJ2M 3RVCA 3CMAN 1QQOA 1IJJA 3B8AX 4XH4A 1ZC6A 2NNWA 1BG3A 3HZ6A 1NGHA 2E2OA 3QDKA 3VGLA 3SLCA 3CCEN 5AQMA 4G9ZA 2CH5A 3DXKB 3AY9A 4WQ5A 1E4FT 3CPEA 4KH5A 1NGGA 2NRHA 2ZF5O 5FPMA 5KPZA 4PHTX 5AQIA 1DT9A 1KAZA 2P9IA 3WUHA 4FOIA 4DQ8A 2QWNA 2V51B 3A5NC 4BGBA 5GAGP 3Q7BA 4JNEA 3I33A 3TTCA 3W3DA 1VQPN 2FLOA 4BR0A 3VOVA 5F0XA 4U67L 1VQ8N 4FL9A 2IVPA 2JWKA 3KZBA 2QWPA 4M63C 2H3GX 4FWMA 2E20A 5M1NA 4H0TB 5M1OA 5BPNA 3CF5L 5BRFA 4A59A 5DM6L 2IIRA 3QBXA 3MMVA 5AQSA 3U9DA 4CZLA 5MLCQ 2AP1A 4C23A 4OO1J 1BU6O 1NGBA 4YDUC 1NGCA 1RDWX 4JKEA 3NVKA 1GLDG 3A5MC 3DXKA 3FZLA 3IDHA 3BF1A 4O8UA 4JKBA 3E1YA 2QEXN 1YF5L 4KH4A 2JWLA 1Q7YO 3KWIA 5AQHA 3DXMB 5CE3A 4EHUA 3O9SA 2AA4A 2NZTA 4RCHA 3QFUA 1P90A 2BH1A 3O8MA 2CGLA 2FF6A 4ISGA 3O4WA 1W97L 5ADXH 4FWKA 4IWVA 3C6HA 2P9SB 2E8AA 3UE5A 4BG9A 5M1KA 1TUYA 1TYQB 2A41A 1YJWN 3L4IA 1GLJO 4CJ7A 2E88A 4FWRA 3FGUA 4BY9C 3MWPA 3EE8A 3RSEB 4H0YB 4CBXA 1T3VA 4CZHA 1ATSA 1P8ZA 2HBKA 3EZWA 3MX5A 3VEYA 4BQZA 4DB3A 3M6GA 3OHRA 4BC2A 5JLHA 3G25A 4H0OA 1VQNN 4GV6A 4WQ5C 5M1FA 2GTDA 4A61A 1MWMA 4E1JA 4BR2A 1H1VA 5AZIB 4K25A 3CI5A 1YI2N 4OPHA 1K8KB 2Q0RA 3JS6A 5BR9A 3DXMA 4K43A 4XH5A 1RDUA 3ID8A 4H5TA 5AQJA 1BUPA 3CCRN 5JVGL 2ZJRL 3Q7CA 2F7TA 3W0LA 1N8RO 3IKMA 3VMFB 3ATUA 3EKSA 2NLXA 4PKIA 4ILGB 4BRDA 3O6WA 3ZEUA 2YX6A 1IG8A 1ZXOA 3WXJA 2QM1A 4GV3A 4I6MB 5JMVA 5AR0A 5FPDA 1VQ5N 1O13A 2J4RA 2E2NA 1BOTO 4MDBA 4WQ4A 3VGMA 5HOOA 1D4XA 4EFHA 3QMLA 5AQYA 4IOCL 3MN5A 3G6EN 4A5AA 3D6RA 3TSQA 3GOIA 3VPZA 4WF9L 4MLHA 2ITMA 3WXIA 5LJWA 1BWFO 3WEEB 5M1PA 3C6AA 5JVHL 5AZJB 2VWBA 3CJ7A 2P9NB 2OTLN 5AQKA 1KAYA 1QQNA 3GBTA 3PIOL 4PL8A 2PBDA 3ENHA 3KHYA 2A5XA 2GWKA 3CQYA 3EKUA 2ZJPL 1VQ7N 2KLAA 4H5NA 2A3ZA 3R3LA 4BRKA 1NGAA 3VF4A 3C7NB 5GINA 3P39A 1ESVA 3VENA 4FWQA 2YJFA 3C65A 2HOEA 3GL1A 3ZYYX 1CZAN 1X3NA 2QTDA 2QWLA 2VYPA 4BVPA 4PKHA 3CIPA 2RE2A 1NGEA 2CGJA 5AQTA 3D2FB 3A8YA 5KQDA 4DCHA 4LC9B 5KQ8A 1KD1O 2HF4A 4L3QA 3H46O 2Q36A 3ULEA 5BPLA 4IOXA 5BPMA 1NLVA 1NGDA 3WEEA 2RHKA 2BUPA 2HMPA 3BF3A 3N4QA 5AQOA 4NO7A 2ASMA 4RTFD 4YOUA 3ZX3A 4O8KA 4CZKA 4B1ZA 1BO5O 5AQWA 1MDUB 3SBTA 1YVNA 1SAZA 4YOVA 3CCSN 1KQSM 5AQGA 2A40A 2P9KB 4XH1A 2NRZA 4UY8O 3OW2M 4BRQA 1NBWA 3LM2A 3CJ1A 4ISFA 2CGKA 3WT0A 3FR0A 2P9UB 1EQYA 4R79A 1YIJN 4WQ4C 5H1SQ 3SJHA 4BRAA 4FWNA 1M90O 2A42A 3VF2A 4Z94A 1BA0A 3QICA 3C0BA 3OA9A 1WUAA 1NGJA 3VETA 5AFUH 1XC3A 2FSNA 3PLAA 4H0VB 1S72N 3J7ZO 3I56N 4FWLA 1K73O 3CMEN 1QQMA 2QI2A 3GG4A 4BC4A 1GLEG 3AAPA 4DHYA 3MCAB 5AQXA 2W40A 3CD6N 4QS9A 3O9QA 3O5BA 1Z6RA 2HBMA 1LOTB 3ID6A 4EAHD 2Q31A 4JAXA 3SMSA 1HKCA 4K41A 3H6EA 5AQPA 5BN8A 4CZEA 1GLBG 5GIPA 1HUXA 5JICA 4CI6A 1ATRA 1YXQA 3E66A 1R59O 3CC7N 2D1KA 5AQZA 3R6MA 3P4IA 3TPQA 1YAGA 4K42A 4A57A 1KC8O 5EY4A 4MDAA 5ADXA 4IZ9A 3TSUA 1YITN 3G4SN 4FWOA 1QZ5A 3F2KA 3O80A 5GAEP 3VF6A 3CCLN 3F9MA 2HSTA 1U6ZA 3AGKA 3CXCM 3NMUA 1JCFA 3SMPA 2P9LB 3NVMA 3CHWA 3QFPA 3FZKA 2YI1A 3H1QA 1QVGM 5BREA 2YHYA 4MLEA 4B1XB 1ILYA 1NGIA 2E1YA 2E2QA 5AQFA 3L4QA 3CJ9A 3P38A 4IEEA 4BRPA 1E4GT 3E9PA 3M5RA 1ZBSA 3CJBA 4MO4A 4IEIA 1LCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJC A;  3JXU A;  3FZM A;  3UKR B;  3TU5 A;  2UYT A;  2ZGY A;  2QWO A;  1X3M A;  2P9S A;  1T6D A;  1SQK A;  2QW9 A;  1TYQ A;  4BGA A;  4CBU A;  1HPM A;  2YHX A;  4BRN A;  3GDQ A;  3A0I X;  3H3O B;  3RSE A;  3MN6 A;  2P9L A;  4PKG A;  4H5V A;  5EOY A;  5BRH A;  1XQS C;  3VEV A;  3FLC O;  1KXP A;  5AQL A;  2FSK A;  5AZI A;  4B1V A;  1HX1 A;  5E84 A;  4J8F A;  4F9O A;  1K8K A;  1C0F A;  3LL3 A;  1T44 A;  2I7P A;  3O08 A;  4BRF A;  1NGF A;  3R8E A;  3IFR A;  1T6C A;  1DEJ A;  3QBW A;  2QWR A;  2Q0U A;  5F1X A;  2IVO A;  1DKG D;  1HKB A;  3VEW A;  5LJV A;  4XEI A;  3ENO A;  3SK3 A;  1RGI A;  5TKY A;  5AQV A;  2E2P A;  1NMD A;  4HWI A;  4CD1 A;  4I6M A;  5FPN A;  3A5O C;  4BRI A;  4M7Y A;  1GLL O;  3ZET B;  2FXU A;  4BRC A;  3BP8 A;  1DGK N;  1U2V B;  3FZH A;  4M7X A;  3VEZ A;  3VER A;  4JHD B;  4BC5 A;  3H45 C;  1RFQ A;  2HF3 A;  3ZX2 A;  4B1U B;  2ZGZ A;  3D2E B;  1X9J A;  2CH6 A;  4B1W B;  4EIA A;  5ELZ A;  4FOE A;  2P9P B;  2GUP A;  4B1Y B;  3U4L A;  5AZJ A;  2KHO A;  2P9N A;  3ZX0 A;  4BR5 A;  2QXL A;  3DAW A;  4FPA A;  3CJC A;  4ISE A;  4NB4 A;  1HJO A;  4CBW A;  2P9I B;  3BUZ B;  3C7N A;  4H0P A;  2E1Z A;  4BRG A;  2D4W A;  3EN9 A;  2GEL A;  3HI0 A;  2YCH A;  3VEX A;  3MN7 A;  2DPN A;  1U2V A;  2A6A A;  3LDN A;  2YHW A;  3D2F A;  3H3N O;  3IUC A;  3KVG A;  2WUS A;  3FFK B;  3D2E A;  2F9T A;  2P9P A;  5KPR A;  4BRE A;  5AFU A;  2GEM A;  2Q1N A;  3VES A;  1GLF O;  4AM7 A;  3QB0 A;  1G99 A;  1C0G A;  2YJE A;  5I9E B;  3LM9 A;  3O1W A;  4A2A A;  5EX5 A;  3HSC A;  4JD2 B;  3HTV A;  3CER A;  1Y64 A;  1Q18 A;  2P9K A;  1QZ6 A;  4WYB A;  4GY2 B;  3WQT A;  3AAQ A;  2P9U A;  3WXK A;  2I7N A;  4Y0W A;  3H1V X;  2OAN A;  1BA1 A;  3M1F A;  1MA9 B;  1V4S A;  4H5W A;  4JN4 A;  3UKU B;  5B8H A;  3CET A;  1V4T A;  4GNI A;  1S3X A;  4BRO A;  4BRH A;  4BG8 A;  5AQS A;  1NWK A;  1TUU A;  3J8A A;  1YUW A;  3A5L C;  5E26 A;  3GE1 A;  2FSJ A;  1JCG A;  3EO3 A;  3LDQ A;  3O1B A;  3U9Z A;  4JD2 A;  2PAV A;  3I8B A;  3CJA A;  4KBO A;  4QS7 A;  1Z05 A;  4RWT A;  4A62 A;  1WOQ A;  5KPT A;  4BR9 A;  4FWP A;  2BTF A;  3ZEU B;  4FO0 A;  4QS8 A;  1J6Z A;  2VCP A;  2F9W A;  3AAR A;  2V7Z A;  2ASO A;  3UKU A;  3D7E O;  4CZJ A;  5LY3 A;  2ASP A;  4IXC A;  3IMX A;  4BVO A;  2EWS A;  3EL2 A;  1QHA A;  3MN9 A;  4IO8 A;  3HBT A;  4FSV A;  5AQQ A;  5AQR A;  1BDG A;  2Q2R A;  4IJA A;  3LDP A;  2V52 B;  4O5F A;  4IJN A;  5JLF A;  3CQX A;  2QWQ A;  3UKR A;  2V7Y A;  3MK6 A;  4FPB A;  2D0O A;  1NM1 A;  3S41 A;  4BR4 A;  2ZWH A;  3U8X A;  4HTL A;  4H03 B;  4CZM A;  5F2R A;  1OKJ A;  3VGK A;  2QWM A;  3M3Z A;  5FPE A;  4BRL A;  4A2B A;  3R9P A;  4CZF A;  1SZ2 A;  4BR7 A;  3WQU A;  3MCP A;  1GLC G;  4AM6 A;  5EVZ A;  1S22 A;  3ULE B;  5AQU A;  3ATV A;  1GLA G;  2FF3 B;  3FE1 A;  3LDO A;  3BEX A;  1HLU A;  4YDU A;  3UB5 A;  4BQL A;  3DWL A;  2GWJ A;  4B9Q A;  4CZG A;  4CZI A;  4CD3 A;  4MO5 A;  1MWK A;  4H5R A;  4PL7 A;  3L6Q A;  3MDQ A;  1XUP O;  4H0X B;  3HM8 A;  4BRM A;  4EHT A;  2W41 A;  1ATN A;  5BN9 A;  2IVN A;  2D0P A;  3VEO A;  3FZF A;  2Q97 A;  5AQN A;  4FWS A;  3ZET A;  5BRD A;  1JCE A;  1HKG A;  4BC3 A;  4JHD A;  1KAX A;  3WXL A;  5EXW A;  3L0Q A;  3LDL A;  1QQO A;  1IJJ A;  3B8A X;  4XH4 A;  1ZC6 A;  1BG3 A;  3HZ6 A;  1NGH A;  2E2O A;  3QDK A;  3VGL A;  3SLC A;  5AQM A;  2CH5 A;  3DXK B;  3AY9 A;  4WQ5 A;  1E4F T;  1NGG A;  2NRH A;  2ZF5 O;  5FPM A;  5KPZ A;  5AQI A;  3WUH A;  1KAZ A;  2P9I A;  4FOI A;  4DQ8 A;  2QWN A;  2V51 B;  3A5N C;  4BGB A;  4JNE A;  3I33 A;  3W3D A;  2FLO A;  4BR0 A;  3VOV A;  5F0X A;  4FL9 A;  2IVP A;  3KZB A;  4M63 C;  2QWP A;  2H3G X;  4FWM A;  2E20 A;  4H0T B;  5BPN A;  5BRF A;  2IIR A;  3QBX A;  3MMV A;  3U9D A;  4CZL A;  2AP1 A;  4C23 A;  1BU6 O;  1NGB A;  4YDU C;  1NGC A;  1RDW X;  1GLD G;  3A5M C;  3DXK A;  3FZL A;  3IDH A;  3BF1 A;  5AQH A;  3DXM B;  5CE3 A;  4EHU A;  2AA4 A;  2NZT A;  4RCH A;  3QFU A;  3O8M A;  2CGL A;  2FF6 A;  4ISG A;  3O4W A;  5ADX H;  4FWK A;  4IWV A;  2P9S B;  2E8A A;  3UE5 A;  4BG9 A;  1TUY A;  1TYQ B;  2A41 A;  3L4I A;  1GLJ O;  4CJ7 A;  2E88 A;  4FWR A;  3FGU A;  3RSE B;  4H0Y B;  4CBX A;  4CZH A;  1ATS A;  1P8Z A;  3EZW A;  4DB3 A;  3VEY A;  4BQZ A;  3M6G A;  3OHR A;  4BC2 A;  5JLH A;  3G25 A;  4H0O A;  4WQ5 C;  2GTD A;  4A61 A;  1MWM A;  4E1J A;  4BR2 A;  1H1V A;  5AZI B;  4K25 A;  3CI5 A;  5BR9 A;  1K8K B;  2Q0R A;  3JS6 A;  3DXM A;  4K43 A;  4XH5 A;  3ID8 A;  4H5T A;  5AQJ A;  1BUP A;  3W0L A;  3ATU A;  3EKS A;  2NLX A;  4PKI A;  4BRD A;  3O6W A;  3ZEU A;  1IG8 A;  1ZXO A;  3WXJ A;  2QM1 A;  4I6M B;  5JMV A;  5AR0 A;  5FPD A;  2J4R A;  2E2N A;  1BOT O;  4WQ4 A;  3VGM A;  1D4X A;  4EFH A;  3QML A;  5AQY A;  3MN5 A;  3GOI A;  3VPZ A;  4MLH A;  2ITM A;  3WXI A;  5LJW A;  1BWF O;  3WEE B;  5AZJ B;  2VWB A;  3CJ7 A;  2P9N B;  5AQK A;  1KAY A;  1QQN A;  3GBT A;  4PL8 A;  2PBD A;  3ENH A;  3KHY A;  2A5X A;  2GWK A;  3CQY A;  3EKU A;  4H5N A;  2A3Z A;  4BRK A;  1NGA A;  3VF4 A;  3C7N B;  1ESV A;  3VEN A;  4FWQ A;  2YJF A;  2HOE A;  3GL1 A;  1CZA N;  1X3N A;  2VYP A;  2QWL A;  4BVP A;  4PKH A;  3CIP A;  1NGE A;  2CGJ A;  5AQT A;  3D2F B;  3A8Y A;  5KQD A;  4DCH A;  4LC9 B;  5KQ8 A;  2HF4 A;  4L3Q A;  3H46 O;  2Q36 A;  3ULE A;  5BPL A;  5BPM A;  1NLV A;  1NGD A;  3WEE A;  2BUP A;  2HMP A;  3BF3 A;  5AQO A;  4NO7 A;  2ASM A;  4RTF D;  3ZX3 A;  4O8K A;  4CZK A;  4B1Z A;  1BO5 O;  5AQW A;  1MDU B;  1YVN A;  1SAZ A;  5AQG A;  2A40 A;  2P9K B;  4XH1 A;  4BRQ A;  1NBW A;  3LM2 A;  3CJ1 A;  4ISF A;  2CGK A;  3WT0 A;  3FR0 A;  2P9U B;  1EQY A;  4WQ4 C;  3SJH A;  4BRA A;  4FWN A;  2A42 A;  3VF2 A;  4Z94 A;  1BA0 A;  3QIC A;  3C0B A;  1WUA A;  1NGJ A;  3VET A;  5AFU H;  1XC3 A;  2FSN A;  4H0V B;  4FWL A;  1QQM A;  3GG4 A;  4BC4 A;  1GLE G;  3AAP A;  4DHY A;  5AQX A;  2W40 A;  4QS9 A;  3O5B A;  1Z6R A;  1LOT B;  4EAH D;  2Q31 A;  4JAX A;  3SMS A;  1HKC A;  4K41 A;  3H6E A;  5AQP A;  5BN8 A;  4CZE A;  1GLB G;  1HUX A;  5JIC A;  4CI6 A;  1ATR A;  1YXQ A;  1R59 O;  2D1K A;  5AQZ A;  3R6M A;  3P4I A;  3TPQ A;  1YAG A;  4K42 A;  5EY4 A;  5ADX A;  4IZ9 A;  4FWO A;  1QZ5 A;  3O80 A;  3VF6 A;  3F9M A;  1U6Z A;  1JCF A;  3SMP A;  2P9L B;  3CHW A;  3QFP A;  3FZK A;  2YI1 A;  3H1Q A;  5BRE A;  2YHY A;  4MLE A;  4B1X B;  1NGI A;  2E1Y A;  2E2Q A;  5AQF A;  3CJ9 A;  4BRP A;  1E4G T;  1ZBS A;  3CJB A;  4MO4 A;  1LCU A; 
#chains in the Genus database with same CATH topology
 3THX A;  2HHQ A;  4EP5 A;  1NJY A;  4EZ9 A;  2P9S A;  1TAQ A;  3MEG A;  1T6D A;  1UWB A;  2BAN A;  3I8D A;  2DTU A;  3DLB A;  4BRN A;  4IOA L;  2VG5 A;  3RSE A;  3MN6 A;  2UXB K;  2P9L A;  4PKG A;  2BE2 A;  1RIL A;  1SS6 A;  4HUE A;  5C2F A;  4W5N A;  4JKG B;  3FLC O;  5AZI A;  4B1V A;  4HUF A;  1NK7 A;  1K8K A;  3EEQ A;  4FJI A;  1NGF A;  3R8E A;  3IFR A;  3KKS A;  4Z0U A;  4DTM A;  2D5R A;  3CM5 A;  1VSH A;  2YNH A;  4LFA K;  3VEW A;  1YTU A;  3NGY A;  1S9G A;  5TKY A;  2E2P A;  4HWI A;  2YNG A;  4YFU A;  3DLK A;  4Q5V A;  3ZCM A;  4DR4 K;  4W5Q A;  2R7Y A;  3BP8 A;  3L3U A;  3VEZ A;  3S3M A;  2HF3 A;  4JK9 A;  4QAG A;  4YOR A;  1C6V A;  4FZX C;  2NRW A;  2XRI A;  3J80 O;  2P9P B;  3KK2 A;  4DFK A;  4OLA A;  4FM2 A;  3K0S A;  3DAW A;  3CPW M;  1VAZ A;  1KRP A;  4FVU A;  4FXD A;  4ISE A;  2E5L K;  1VSM A;  1BIU A;  4H0P A;  5CR4 A;  3G71 N;  5TKW A;  3CYM A;  1J54 A;  1L3T A;  4IBN A;  2P5O A;  4CJK A;  1T7P A;  3DRR A;  3VTI A;  1CZ9 A;  4IO9 L;  2P9P A;  5KPR A;  1KFS A;  4BRE A;  1VQM N;  3P31 A;  1GLF O;  5J2M A;  1X9M A;  3K2P A;  4DU3 A;  3LM9 A;  5EX5 A;  4EP4 A;  4JD2 B;  4R5P A;  3C6T A;  3HTV A;  3RR8 A;  4DQS A;  4J2E A;  3VTH A;  3PY8 A;  1NK9 A;  3AAQ A;  3EZ5 A;  3EYZ A;  4Y0W A;  1RBU A;  2HBL A;  3HOS A;  1LW0 A;  4DKW A;  1BA1 A;  2HVH A;  1MA9 B;  3UKU B;  1TVR A;  1V4T A;  1HQU A;  1HMV A;  4GNI A;  4ELV A;  4Z4E A;  1FW6 A;  2KFN A;  1RBV A;  3HRG A;  5AQS A;  4NLC A;  3AVF A;  3LDQ A;  1IH7 A;  4JD2 A;  3O9R A;  4JI4 K;  3I8B A;  5C10 A;  1S6P A;  1X1P A;  3CJA A;  3QNO A;  4QS7 A;  1JLG A;  3V9W A;  4Y1D A;  4B3T K;  4JK7 A;  1WOQ A;  3ZEU B;  4IG0 A;  1IBL K;  1J6Z A;  1IKV A;  1OVY A;  2VWK A;  3UKU A;  4CZJ A;  4JEP A;  4DR7 K;  3M8Q A;  3THW B;  3EL2 A;  3B6O A;  3KIO A;  2NRX A;  3U3G A;  4AHT A;  2X6N A;  1BDG A;  1C0U A;  1XHX A;  4CJP A;  3AVC A;  3CQX A;  4DFP A;  2G8W A;  2V7Y A;  1TK5 A;  2ZWH A;  4JKF A;  4IFE A;  1I39 A;  3NCI A;  4I2P A;  3THW A;  5FPE A;  4B3M K;  3BY5 A;  4RW8 A;  4DUZ K;  4CHZ A;  3WNF A;  4BR7 A;  1Q82 O;  2O8E B;  4NYF A;  4OPA A;  1S22 A;  4M41 A;  4K8Z A;  5KGX A;  3KWG A;  3FE1 A;  5C15 A;  3BEX A;  4CEO A;  3UB5 A;  4BQL A;  1TKX A;  1EWQ A;  4FM0 A;  5HRN A;  1ASV A;  4WFA L;  3SZ2 A;  1YJN N;  4JV5 K;  4M45 A;  1IV0 A;  3F5T A;  1RDC A;  4H5R A;  4AF1 A;  5HLF A;  1XUP O;  3OJU A;  3SUO A;  3AA4 A;  3O3G A;  4LF4 K;  3VEO A;  4X64 K;  1HNX K;  4IFY A;  3TAP A;  4BC3 A;  1BCM A;  5EXW A;  3NBP A;  3HVR A;  4B3S K;  3D0P A;  4OGC A;  1KVC A;  5AQM A;  3DXK B;  4DR6 K;  3M8P A;  1NGG A;  5KPZ A;  4KHS A;  4PHT X;  1NK0 A;  4OKE A;  1XNQ K;  1DT9 A;  2P9I A;  1TAU A;  4FOI A;  2V51 B;  3DOL A;  3I33 A;  3TTC A;  3W3D A;  2OZM A;  3NAE A;  1VQP N;  4BR0 A;  1VQ8 N;  4JI3 K;  2JWK A;  5J2P A;  2QWP A;  3SUP A;  1JLA A;  2XY8 A;  4NCB A;  3CF5 L;  5DM6 L;  1EX4 A;  2IIR A;  4CZL A;  2HHU A;  1NGC A;  1RDW X;  4CF1 A;  1SL2 A;  1GLD G;  3DXK A;  3T1H K;  3FZL A;  3S9H A;  3IDH A;  1HQE A;  5AQH A;  3NH2 A;  3DRS A;  4OPK A;  2B4J A;  3O9S A;  3KLH A;  3TAR A;  1C1B A;  2CGL A;  4ISG A;  4FW1 A;  2RN2 A;  1IO2 A;  1QSS A;  4NXM K;  1W97 L;  4FWK A;  5ADX H;  4IWV A;  2E8A A;  4YNQ A;  4Z4H A;  5M1K A;  1TYQ B;  1GLJ O;  1VK0 A;  4FWR A;  1VSD A;  3FGU A;  3OTO K;  1S1V A;  3P83 D;  2PYJ A;  3IS9 A;  4H0Y B;  1T3V A;  1P8Z A;  1WN7 A;  4DB3 A;  2G8F A;  4DR5 K;  4K25 A;  1HJR A;  4RG8 A;  3SV3 A;  5BR9 A;  3AA2 A;  3LPU A;  2ZE2 A;  4CIE A;  3CCR N;  1ASU A;  3VQQ A;  4PUO A;  1HYZ A;  3KK1 A;  4JI2 K;  3Q7C A;  3W0L A;  3IKM A;  3AA5 X;  3VMF B;  4JI0 K;  4CGF A;  1CXQ A;  1JLF A;  1ZXO A;  4AQY K;  2QM1 A;  4GV3 A;  4M3X A;  5FPD A;  2WOM A;  1O13 A;  2J4R A;  1K6Y A;  2E2N A;  1D4X A;  4G1Q A;  5AQY A;  4CJ4 A;  4IOC L;  3MN5 A;  3T19 A;  4A5A A;  3SUQ A;  3TSQ A;  3ZT1 A;  4ZHR A;  1KVB A;  4TSX A;  3WEE B;  3T1Y K;  4CF8 A;  2HHH K;  2EX3 A;  2A5X A;  2YNF A;  2ZJP L;  4BDZ A;  1VQ7 N;  3R3L A;  4BRK A;  1WLJ A;  3VEN A;  4JI1 K;  1NKB A;  2E4L A;  3CIP A;  5EU7 A;  2HHX A;  4O5B A;  3A8Y A;  5KQ8 A;  4ELU A;  3H46 O;  3ULE A;  2QKB A;  4IOX A;  3T1A A;  3WEE A;  2BUP A;  4DFM A;  4DG1 A;  2IOC A;  2JGU A;  4CW7 B;  1LWE A;  1L3S A;  2WON A;  3NFA A;  4CZK A;  4PQU A;  4B1Z A;  5AQW A;  4YOV A;  1SAZ A;  3TAN A;  2A40 A;  4XH1 A;  3LM2 A;  3CJ1 A;  1VSL A;  1EQY A;  2W6K A;  1VSK A;  4R79 A;  1M90 O;  3VF2 A;  1I3A A;  4CJL A;  1BQM A;  1BA0 A;  3VET A;  1KLN A;  4ID5 A;  1XC3 A;  2O4G A;  4DSF A;  3PLA A;  1J5E K;  4H0V B;  3OYA A;  2P5G A;  3LAM A;  1WSF A;  1RDD A;  3NF6 A;  3CME N;  1QQM A;  2QI2 A;  3GG4 A;  4FJ8 A;  2Z1H A;  2W40 A;  3O9Q A;  2VG7 A;  3AO5 A;  4EAH D;  1HKC A;  4K41 A;  2OZS A;  1GLB G;  5JIC A;  4CI6 A;  4LD0 A;  4E7K A;  3KLG A;  1WSH A;  3CC7 N;  2G8U A;  1FKP A;  5AQZ A;  3P4I A;  4A57 A;  1JLC A;  2KZZ A;  2YV0 X;  4MDA A;  4IZ9 A;  4FWO A;  4FLU A;  3QEX A;  3CCL N;  3F9M A;  1RCH A;  3LPT A;  4DTU A;  3CXC M;  3SMP A;  3NVM A;  1QE1 A;  3V1Q A;  3FZK A;  3SNN A;  2YHY A;  1XMO K;  1NKC A;  4IEE A;  2O8B A;  4OJR A;  4CJ3 A;  5KTQ A;  3KD5 E;  3M5R A;  4FJX A;  1J5O A;  1D8Y A;  4PL8 A;  3KLF A;  4IEI A;  2KKZ A;  3JXU A;  3RR7 A;  2UYT A;  2QWO A;  1TKZ A;  3SBG A;  1SQK A;  3V1R A;  4YOY A;  4GV9 A;  3ZSZ A;  1QVF M;  4QCL A;  3GDQ A;  2QKK A;  4HTU A;  3PX0 A;  4JKC A;  4WFN L;  5M1Q A;  1YT3 A;  4H5V A;  4BE0 A;  5EOY A;  4UQG A;  2OPR A;  4DR2 K;  1T8E A;  1XI1 A;  1JL1 A;  5J2N A;  4LH5 A;  3O08 A;  4BRF A;  1RTH A;  2WFB A;  4KRE A;  4E3S A;  1T6C A;  4JK8 A;  1DEJ A;  3KLE A;  3K5L A;  4BE1 A;  4LF8 K;  5F1X A;  3D45 A;  3O9T A;  3B6P A;  5C24 A;  4DV6 K;  3LDS A;  3ENO A;  3E9O A;  2I5J A;  2KFZ A;  3I55 N;  4CD1 A;  3V9X A;  4I6M A;  4DTJ A;  4WFB L;  1QSY A;  4HHT A;  3OS2 A;  1S5J A;  5KRT A;  3MXI A;  1GLL O;  3ZET B;  2FXU A;  1U2V B;  2OCE A;  4M7X A;  3TAF A;  3QEV A;  3ZSY A;  1VSJ A;  4EIA A;  4CVN E;  1RBS A;  4B1Y B;  3U4L A;  2XY7 A;  1WB9 A;  3KLI A;  4B8A B;  2GEL A;  3QIO A;  1YJ9 N;  3MX2 A;  3K9J A;  3VEX A;  1U2V A;  2A6A A;  1REV A;  4O44 A;  3D2F A;  4KI6 A;  3FFK B;  1Q81 O;  3UIQ A;  1HNW K;  5AFU A;  2GEM A;  4E7H A;  1Q8I A;  4CF2 A;  3QB0 A;  1RTD A;  4CCH A;  1C0G A;  4MQ3 A;  2YJE A;  3O1W A;  4A2A A;  4M42 A;  2HHW A;  1X9W A;  1YHQ N;  3CER A;  1Q18 A;  2P9K A;  1QZ6 A;  2GV9 A;  4OVL A;  4KTW A;  2P9U A;  2OTJ N;  3WXK A;  1VQO N;  4ZTF A;  1JLE A;  4ZTJ A;  5FDL A;  3H1V X;  2OAN A;  3ZLJ A;  5JS2 A;  3V9S A;  3M1F A;  4H5W A;  1QSL A;  2Y1I A;  5B8H A;  2ZJQ L;  4OLB A;  1EKE A;  4BRO A;  4AHR A;  4JI6 K;  3AVI A;  2FSJ A;  3M8R A;  3EO3 A;  3O1B A;  2VGM A;  5DMR A;  3T69 A;  3MWT A;  3SQ4 A;  4GKK K;  1BQN A;  1JLQ A;  5GAH P;  5FRN A;  4RWT A;  4A62 A;  1BI4 B;  4BR9 A;  1Z26 A;  1N34 K;  1S6Q A;  2B5J A;  3PX6 A;  4M3Z A;  4QS8 A;  3QLH A;  3BZK A;  2F9W A;  1R0A A;  1LV5 A;  3D7E O;  3THV A;  3V9U A;  2ASP A;  3SPZ A;  4F4K A;  1DTQ A;  4IDH A;  4DQQ A;  4CEB A;  1HRH A;  5AQR A;  2O8D B;  2V52 B;  1QTM A;  3E9L A;  4FLY A;  3PIP L;  3MK6 A;  3HPO A;  4BR4 A;  4KO0 A;  4HTL A;  2KQ2 A;  1RT4 A;  4DF8 A;  3SPY A;  4YOW A;  2QWM A;  4BRL A;  1RT6 A;  1SZ2 A;  4O0I A;  3L2Q A;  1GLC G;  4JKG A;  1RDB A;  5EVZ A;  1S1T A;  3OS1 A;  4DMN A;  4FLV A;  1UOC A;  3HL8 A;  3WNE A;  2O8D A;  1OVQ A;  1WBD A;  1OH8 A;  4YDU A;  5E41 A;  3DWL A;  4JS4 A;  2WBN A;  3SYZ A;  1RT3 A;  1W9H A;  4MO5 A;  1MWK A;  2XHB A;  3L6Q A;  3MDQ A;  1SKR A;  2UUA K;  4LF7 K;  3HM8 A;  4KHU A;  4EHT A;  3CCQ N;  1ATN A;  5BN9 A;  3ALY A;  2IVN A;  3QIP A;  3OYH A;  1Q86 O;  1K8A O;  4FWS A;  3QEW A;  4CHY A;  5HRR A;  1JCE A;  1KAX A;  4YHH K;  2UU9 K;  3WXL A;  3L0Q A;  1TV6 A;  3DLE A;  3LDL A;  1JJ2 M;  3BDP A;  1QQO A;  1T05 A;  3B8A X;  4XH4 A;  2YKN A;  4FW2 A;  3QDK A;  2E2O A;  4OGE A;  4KTZ A;  3CCE N;  3O4N A;  4G9Z A;  2CH5 A;  3K59 A;  1E4F T;  3CPE A;  4DV4 K;  1KCF A;  4MFB A;  4X62 K;  4KH5 A;  2NRH A;  5AQI A;  3WUH A;  1KAZ A;  2QWN A;  4FJJ A;  3ASM A;  3A5N C;  4CHQ A;  4OKK A;  3C94 A;  4C8M A;  2FLO A;  2ATQ A;  3HST B;  5F0X A;  2EHG A;  3OYI A;  1TKD A;  3AVG A;  3KZB A;  2HHS A;  4FWM A;  5BPN A;  4OPJ A;  2AP1 A;  4I9Q A;  4JS5 A;  2D0A A;  1NGB A;  4YDU C;  2X78 A;  4FK0 A;  4W5R A;  1YF5 L;  4ID1 A;  4W5T A;  4O4G A;  1Q7Y O;  3DXM B;  1Q9Y A;  3I0S A;  4RCH A;  2FF6 A;  1QQC A;  4ICL A;  2IGI A;  3HYF A;  1IG9 A;  4LF6 K;  3VQA A;  2A41 A;  1YJW N;  1NMN A;  2GUI A;  3L4I A;  2E88 A;  1G15 A;  1ZBF A;  3MXJ A;  3VEY A;  4CFB A;  4BWJ A;  3M6G A;  4BC2 A;  4FK4 A;  1VQN N;  4GV6 A;  3RRG A;  2GTD A;  4A61 A;  1MWM A;  1TKT A;  4E1J A;  4PWD A;  4DTR A;  1XHZ A;  5LL6 Z;  4OPH A;  1HNV A;  3DXM A;  1C1A A;  4XH5 A;  1RDU A;  4H5T A;  3MAQ A;  2F7T A;  1B9F A;  3AVK A;  4O0J A;  3EKS A;  4NCA A;  4PKI A;  4BRD A;  2Z1J A;  3ZEU A;  4DWI A;  3V4I A;  4CES A;  4F3O A;  2A1R A;  4CIG A;  2B6A A;  3S3O A;  3VGM A;  1ASW A;  3WNH A;  3KD1 E;  1UA1 A;  4EFH A;  3QML A;  4CED A;  1BIZ A;  3MEC A;  2DY4 A;  3F9K A;  3D6R A;  3CM6 A;  5KI6 A;  3VPZ A;  1EP4 A;  2OPQ A;  3DLH A;  5AZJ B;  5FRO A;  3RMC A;  2P9N B;  1WSE A;  2OTL N;  4N41 A;  5HBM A;  5AQK A;  5C42 A;  1RT5 A;  4B3R K;  3KHY A;  3CQY A;  2KLA A;  2JLE A;  3C7N B;  4F2S A;  1EXQ A;  2YJF A;  1ZBL A;  2HOE A;  4N47 A;  3TAM A;  1X3N A;  1ZBH A;  4BVP A;  2RF2 A;  3OYN A;  1U45 A;  2RE2 A;  2CGJ A;  5AQT A;  4F3T A;  4JI7 K;  2O8E A;  1NOZ A;  4L3Q A;  5BPL A;  5BPM A;  1NGD A;  3N4Q A;  5AQO A;  4B9N A;  4NO7 A;  1NNE A;  4YOU A;  3SBT A;  1MDU B;  3DOK A;  4CGJ A;  3CCS N;  4FJK A;  4UY8 O;  2NRZ A;  1SV5 A;  3NE6 A;  1NBW A;  4ISF A;  4Z4C A;  3P1G A;  3SJH A;  3ZSR A;  4FWN A;  3VA3 A;  2A42 A;  3CFO A;  4JRQ A;  4DSL A;  5I3U A;  4IG3 A;  4CJT A;  1WUA A;  1LAW A;  1NGJ A;  4RW6 A;  2FSN A;  3KTQ A;  2FBV A;  1S72 N;  3LAN A;  3I0R A;  3LAK A;  1SKS A;  3NF7 A;  2O4I A;  4FLT A;  2BGG A;  4DTX A;  3CD6 N;  1GOA A;  3ID6 A;  4LSN A;  3SCX A;  2E6M A;  4JI8 K;  1YXQ A;  2Z1I A;  1LWF A;  2D1K A;  4C8N A;  3HJF A;  3SUN A;  1YAG A;  1C0M A;  5EY4 A;  5ADX A;  1YIT N;  4Z4F A;  3VF6 A;  1TL3 A;  1GOB A;  2HST A;  1U6Z A;  1I94 K;  2Q3S A;  4FZZ A;  1VSE A;  4CER A;  5BRE A;  4PY5 A;  3NF8 A;  5AQF A;  3L4Q A;  3CJ9 A;  3P38 A;  1T03 A;  1E4G T;  4F8R A;  3VN5 A;  3J7Y P;  1ZBS A;  3DJC A;  1HPZ A;  3CCU N;  3UKR B;  3FZM A;  1SL0 A;  4RW4 A;  3TU5 A;  4DV3 K;  2ZGY A;  4LF9 K;  1IKY A;  1TYQ A;  4BGA A;  5C0Y A;  4CBU A;  1F21 A;  1HPM A;  1VQ9 N;  3VQ5 A;  3A0I X;  3H3O B;  1NK6 A;  1HYS A;  3ISN C;  4ELT A;  4KV8 A;  5HRS A;  4NLB A;  5BRH A;  3VEV A;  1JL2 A;  1KXP A;  5AQL A;  2FSK A;  4JKH A;  3ZSO A;  5E84 A;  4F9O A;  1C0F A;  3CCJ N;  1T44 A;  2I7P A;  3OYE A;  3VQ9 A;  4DSE A;  3SAH A;  3OYB A;  4CF0 A;  2VG6 A;  3PSF A;  5LMN K;  2FBX A;  3QBW A;  2QWR A;  3PO4 A;  2Q0U A;  5CZ1 A;  1DKG D;  4FK2 A;  3JSM A;  5LJV A;  2HBJ A;  4XEI A;  2HVI A;  5FPN A;  3L2V A;  3A5O C;  4BRI A;  4CEA A;  4ILH A;  2QXF A;  3AO4 A;  3VQ6 A;  2O8C B;  1SUQ A;  3FZH A;  3OYF A;  4JHD B;  4IDK A;  1RFQ A;  2FBT A;  2NRT A;  5IWA K;  1MU2 A;  4ILJ A;  4B1U B;  1IBK K;  3D2E B;  2XY6 A;  4DQP A;  3AVA A;  1HYV A;  4KRF A;  2HMI A;  5ELZ A;  4CJW A;  4CJV A;  4DSJ A;  2GUP A;  3OYD A;  2WC9 A;  2QXL A;  3HOT A;  4FPA A;  3KK3 A;  2RKI A;  3WXM B;  3CJC A;  2E6L A;  2AJQ A;  1WSG A;  1RNH A;  1HJO A;  3JAM O;  3BUZ B;  1A5X A;  2E1Z A;  4BRG A;  3SQ1 A;  1WSI A;  2D4W A;  3EN9 A;  4LFB K;  3TAB A;  2YCH A;  2PFU A;  3H08 A;  4L8R B;  3OBY A;  3DLL L;  2YHW A;  1KSP A;  1D5A A;  3D2E A;  1M1K O;  3ZSV A;  3ZSX A;  4N56 A;  4KTQ A;  4CJE A;  1RT1 A;  4CEC A;  2Q1N A;  4W5O A;  2BDP A;  3LZJ A;  1C1C A;  2DFF A;  1G99 A;  5J2Q A;  3KK7 A;  5I9E B;  4C1N I;  3K9K A;  5C12 A;  3E01 A;  1VQ6 N;  3P5J A;  4C8L A;  4WYB A;  4CGD A;  3OVN A;  2YHB A;  2D0C A;  4JRP A;  4LF5 K;  4DV7 K;  4CHO A;  1W2B M;  1U04 A;  4CK1 A;  2P1J A;  1V4S A;  2NRR A;  3AVH A;  4JN4 A;  3OBW A;  3CET A;  4I7F A;  1TGO A;  2NUB A;  1VSI A;  4HCB A;  3VA0 A;  1TUU A;  1YUW A;  3A5L C;  3V6D A;  3U9Z A;  2PAV A;  4FJ5 A;  2W42 A;  2OA8 A;  3PV8 A;  4KH6 A;  1TL1 A;  5KPT A;  3DYA A;  1EO1 A;  2VGN A;  4XIU A;  4FO0 A;  3DRP A;  3OYJ A;  3OJS A;  4CF9 A;  3RWU A;  2O8F B;  2NRV A;  4YOT A;  4IXC A;  3ZT3 A;  3O3F A;  4H4O A;  3RMA A;  1NU0 A;  1QHA A;  4IO8 A;  1WNS A;  1S1U A;  1NK8 A;  5K14 A;  3CC4 N;  5AQQ A;  3K57 A;  1QHT A;  4IJN A;  4A5B A;  5JLF A;  5CY4 A;  2IC3 A;  4FPB A;  2D0O A;  1NM1 A;  3S41 A;  4DV1 K;  4CFD A;  3MEE A;  5F2R A;  1OKJ A;  3ZSW A;  4DTN A;  3VGK A;  3HK2 A;  5AJ3 K;  4NYN A;  3M3Z A;  1IBM K;  1ITG A;  1WAJ A;  4A2B A;  4RW7 A;  3AV9 A;  3WQU A;  3CG7 A;  4B08 A;  4AM6 A;  3BZC A;  3N4P A;  4X65 K;  5AQU A;  4M3T A;  4DQI A;  1GLA G;  3QET A;  4WE1 A;  2XO7 A;  2FF3 B;  3AO2 A;  1RDA A;  3LP2 A;  1VQ4 N;  4JYA K;  2GWJ A;  3F73 A;  4B9Q A;  4CZG A;  4CZI A;  2GBZ A;  3DI6 A;  4AIL C;  5A2Q O;  1ZYQ A;  4H0X B;  4E7J A;  4FJ9 A;  4BRM A;  2W41 A;  4CJ5 A;  4CHN A;  2F8S A;  2HB5 A;  4V19 S;  3QEP A;  3FZF A;  2Q97 A;  5AQN A;  1RTJ A;  4BDP A;  3ZET A;  5BRD A;  3VQD A;  3T3F A;  2YKM A;  4E0D A;  3CMA N;  4J2B A;  1IJJ A;  1BG3 A;  4WQ5 A;  3AY9 A;  4KFB A;  4B9L A;  3K5O A;  3DLR A;  5FPM A;  4Y1C A;  4DTP A;  4N76 A;  4DSK A;  4KPY A;  3DLG A;  5GAG P;  2PY5 A;  4IKF A;  5IT9 O;  3Q7B A;  3JYT A;  3NHG A;  4KKO A;  1S1X A;  4U67 L;  4M63 C;  4H8K A;  1QS4 A;  2H3G X;  2E20 A;  4H0T B;  5M1O A;  1YTA A;  4A59 A;  1BIS A;  3THY B;  3QBX A;  5MLC Q;  4C23 A;  1NJW A;  3LAL A;  4DUY K;  1BU6 O;  3NVK A;  4E89 A;  4JKE A;  2F96 A;  2QEX N;  4H4M A;  3KWI A;  1U48 A;  4FYD A;  1TK8 A;  5CE3 A;  2AA4 A;  3NH1 A;  3THX B;  4BE2 A;  3O4W A;  4GVM A;  4KHP K;  3C6H A;  2P9S B;  4BG9 A;  3DMJ A;  5HRO A;  4JLH A;  1TUY A;  4CEZ A;  4BY9 C;  3PUF A;  3RSE B;  3MWP A;  4CBX A;  1ATS A;  2HBK A;  3EZW A;  1E3M A;  5JLH A;  3G25 A;  4WQ5 C;  4DV5 K;  4BR2 A;  1H1V A;  1JXB A;  5AZI B;  4FVM A;  3CI5 A;  4DU4 A;  1YI2 N;  1K8K B;  2Q0R A;  3ID8 A;  1XC9 A;  2IDO A;  2ZJR L;  4B9T A;  1N8R O;  2VQE K;  4DS5 A;  1BI4 A;  2NLX A;  1BL3 A;  4FLZ A;  3LP3 A;  2YX6 A;  1IG8 A;  3WXJ A;  5JMV A;  5AR0 A;  1VQ5 N;  2UUC K;  4CEQ A;  4WQ4 A;  4MDB A;  2G8I A;  5HOO A;  1XWL A;  4KHN A;  5D3G A;  1JLB A;  1CZB A;  3BGR A;  3G6E N;  4WF9 L;  4MLH A;  3WXI A;  5LMU K;  3VQ7 A;  2G8K A;  4FJ7 A;  3NH0 A;  1ZBU A;  2IAJ A;  4M3Y A;  2A3Z A;  1NGA A;  3VF4 A;  1ZBI A;  1OH6 A;  3P39 A;  1ESV A;  3C65 A;  3GL1 A;  1CZA N;  2QTD A;  2VYP A;  4CJR A;  4HVJ A;  4PKH A;  4LY7 A;  1NGE A;  3TAG A;  2Q36 A;  3SJJ A;  4AHS A;  1LW2 A;  3TI0 A;  2RHK A;  4CGH A;  4CIF A;  2HMP A;  3HM9 A;  3QEI A;  1VSF A;  4KAZ A;  3J7A P;  4KB1 A;  3KJV A;  3HPH A;  1YVN A;  1NOY A;  4FJH A;  4PA1 A;  4BRQ A;  1UA0 A;  2CGK A;  3WT0 A;  3FR0 A;  4WQ4 C;  5H1S Q;  4BRA A;  3FFI A;  3V1O A;  4IFV A;  2WTU A;  3QIC A;  3OA9 A;  2OPS A;  4CGG A;  4CHP A;  3S3N A;  3NGZ A;  3TAE A;  3J7Z O;  3I56 N;  1K73 O;  4BC4 A;  1GLE G;  3AAP A;  4DHY A;  3MCA B;  1KTQ A;  4DTO A;  4HCC A;  1Z6R A;  2HBM A;  1LOT B;  2Q31 A;  3AA3 A;  5AQP A;  1SL1 A;  5BN8 A;  4CZE A;  4DSI A;  3LWM A;  5FRM A;  4DLE A;  3R6M A;  3AVJ A;  4M3W A;  4J2A A;  3TPQ A;  2KZM A;  1FK9 A;  1VRU A;  3TSU A;  3O80 A;  2FC0 A;  1IKX A;  2XY5 A;  3AGK A;  3NMU A;  1JCF A;  4AHU A;  3CHW A;  3RRH A;  2YI1 A;  3H1Q A;  3QNN A;  4MLE A;  4B1X B;  4BRP A;  1L5U A;  3VQP A;  1LCU A;  3SAG A;  4C1N K;  1N33 K;  1X3M A;  5DK5 A;  3QIN A;  2QW9 A;  4KHW A;  5BR8 K;  2YHX A;  3U3Y A;  2F8T A;  1L3V A;  1A5V A;  1K9M O;  3HPG A;  1XQS C;  3L2U A;  3PSI A;  1HX1 A;  2ZD1 A;  4J8F A;  3LL3 A;  5GAD P;  4AHV A;  3O9U A;  3VQ8 A;  3OYK A;  3AVN A;  2RPI A;  4LSL A;  1NJZ A;  3QER A;  4HUG A;  3TWH A;  4E1M A;  3MXM A;  1BHL A;  2IVO A;  4DQR A;  1HKB A;  2Y1J A;  3SK3 A;  1RGI A;  4AH9 A;  5AQV A;  1OH5 A;  1NMD A;  3SAF A;  3ZT4 A;  2HNY A;  5JS1 A;  4M7Y A;  4NXN K;  4FM1 A;  5HL7 L;  3L2R A;  1HNI A;  3AGR A;  4BRC A;  3T7Z A;  5C2D A;  1DGK N;  1FKO A;  3VER A;  4BC5 A;  3H45 C;  3ZX2 A;  4U7B A;  1B92 A;  2ZGZ A;  1X9J A;  2CH6 A;  4B1W B;  1NJI O;  1EET A;  4GW6 A;  4FOE A;  1WSJ A;  5CHI A;  3O4Q A;  5AZJ A;  4LFC K;  2KHO A;  2P9N A;  3ZX0 A;  3C6U A;  4BR5 A;  2PYL A;  5HP1 A;  4DTS A;  2HHT A;  4CJF A;  4AHC A;  4Z4I A;  3HXM A;  4NB4 A;  4CBW A;  2P9I B;  1RBR A;  3G10 A;  3C7N A;  2QK9 A;  5CYQ A;  3HI0 A;  3NGI A;  3LZI A;  3MN7 A;  2DPN A;  3V9Z A;  3R1X A;  3LDN A;  3CCV N;  3H3N O;  3IUC A;  4CEF A;  4FCY A;  3KVG A;  1U47 A;  4J2D A;  2WUS A;  4JKA A;  1BGX T;  1DLO A;  2F9T A;  4CFA A;  2LSN A;  1J9A A;  3VES A;  4AM7 A;  3HO1 A;  4NCG A;  3OYG A;  3HSC A;  1U4B A;  3IG1 A;  4YOX A;  1Y64 A;  3NDK A;  4B9M A;  4GY2 B;  4DS4 A;  4DU1 A;  3WQT A;  2GX9 A;  4DV2 K;  1CXU A;  2I7N A;  4GVE A;  4B9S A;  4YY3 K;  3EE9 A;  1NK4 A;  3ZSQ A;  2YNI A;  4BAC A;  4EZ6 A;  4WCE L;  1VRT A;  3TSP A;  4E19 A;  1Z25 A;  1S3X A;  2IS3 A;  4KI4 A;  4BRH A;  3ZT0 A;  4BG8 A;  1NWK A;  3J8A A;  5E26 A;  3GE1 A;  1JCG A;  5GIO A;  3TTF A;  1GOC A;  3AO3 A;  3CFR A;  3OYM A;  3RMB A;  4KBO A;  3HP6 A;  1Z05 A;  1C0T A;  3OY9 A;  1VQK N;  4M3R A;  3CFP A;  1VQL N;  3ENB A;  2KW4 A;  2BTF A;  4FWP A;  5I42 A;  4DR3 K;  2VCP A;  3AAR A;  2V7Z A;  2ASO A;  2W6L A;  3OS0 A;  5LY3 A;  3IMX A;  4BVO A;  2EWS A;  4DF4 A;  3MN9 A;  2ITG A;  3VQE A;  3HBT A;  4FSV A;  3LWL A;  2Q2R A;  4IJA A;  3LDP A;  4O5F A;  3TR8 A;  3WNG A;  3RMD A;  3K5N A;  2QWQ A;  3UKR A;  3HP9 A;  4CFC A;  3U8X A;  1IKW A;  1N5Y A;  4H03 B;  4O55 A;  4CZM A;  3U6F A;  4DV0 K;  5T7B A;  1NK5 A;  1B9D A;  4F2R A;  3R9P A;  4CZF A;  3TTD A;  4QOZ B;  3MCP A;  1HNZ K;  3OYC A;  3CC2 N;  1WAF A;  3ULE B;  2ZM6 K;  3KKR A;  3CCM N;  3ATV A;  3QO9 A;  2X74 A;  4I9L A;  4E7I A;  4N5S A;  4M3U A;  3J81 O;  4FJG A;  4K8X A;  3LDO A;  1HLU A;  4LH4 A;  4I2Q A;  3M8S A;  4DLG A;  2OPP A;  3NF9 A;  4FJM A;  4CD3 A;  4B9V A;  4PL7 A;  5DM7 L;  4B8C A;  1KFD A;  2Z1G A;  5KGW A;  4Z4G A;  3CQ8 A;  3EY1 A;  3L2W A;  1D9D A;  1U49 A;  2D0P A;  2X6S A;  2O8C A;  4JKD A;  1HKG A;  2G8V A;  4FJL A;  3ITH A;  4JHD A;  3RVC A;  1ZC6 A;  2NNW A;  3HZ6 A;  3VGL A;  1NGH A;  3SLC A;  4CJU A;  1RTI A;  1D9F A;  1TK0 A;  2PZS A;  2ZF5 O;  4BDY A;  5FLX O;  1DTT A;  3HVT A;  4KB0 A;  4DQ8 A;  3K5M A;  4BGB A;  5C25 A;  4JNE A;  3AVL A;  3VOV A;  4GKJ K;  4FL9 A;  1UAX A;  2IVP A;  4GMJ B;  3MED A;  5M1N A;  2QA4 N;  4E1N A;  5BRF A;  3MMV A;  4RW9 A;  3U9D A;  4OO1 J;  4B3O A;  2KTQ A;  3A5M C;  3BF1 A;  5HRP A;  4O8U A;  4JKB A;  3E1Y A;  4KH4 A;  3HT3 A;  2JWL A;  3SV4 A;  2O8B B;  4EHU A;  2NZT A;  4CJS A;  3QFU A;  1P90 A;  2BH1 A;  3IRX A;  3O8M A;  4CK3 A;  2HHV A;  1S9E A;  3L3V A;  3UE5 A;  1A5W A;  2D0B A;  4CJ7 A;  3IAY A;  2UUB K;  3RTV A;  1YVU A;  3EE8 A;  1N36 K;  4DR1 K;  4CZH A;  3MX5 A;  4BQZ A;  3OHR A;  4CK2 A;  4H0O A;  2G8H A;  1XMQ K;  4CE9 A;  5M1F A;  1O1W A;  3LP1 A;  1JKH A;  2HW3 A;  3JS6 A;  3AO1 A;  3A2F A;  4K43 A;  3SQ0 A;  1KVA A;  3VQB A;  5AQJ A;  1BUP A;  5JVG L;  1N32 K;  2VQF K;  1NJX A;  1JXE A;  3SQ2 A;  3ATU A;  4FLX A;  3ULD A;  4ILG B;  3TAQ A;  3LP0 A;  3O6W A;  1CLQ A;  1RT7 A;  4C8O A;  4CJQ A;  2UXC K;  4I6M B;  3V81 A;  4JI5 K;  2O8F A;  1BOT O;  4X66 K;  4DFJ A;  1LAV A;  1X9S A;  1BCO A;  1NKE A;  1RBT A;  2OYQ A;  3GOI A;  3SI6 A;  2ITM A;  5LJW A;  1BWF O;  5M1P A;  3C6A A;  5JVH L;  2VWB A;  3CJ7 A;  1KAY A;  1QQN A;  3GBT A;  3PIO L;  3VQC A;  2PBD A;  3ENH A;  3G0Z A;  1J53 A;  2GWK A;  3EKU A;  1EWR A;  4H5N A;  5GIN A;  1W0H A;  4FWQ A;  5CYM A;  1FXX A;  2P51 A;  1LWC A;  3ZYY X;  2VWJ A;  2QWL A;  3AVB A;  3D2F B;  4OX9 K;  3PX4 A;  1FJG K;  5KQD A;  4DCH A;  4LC9 B;  3C95 A;  1KD1 O;  2HF4 A;  1W7A A;  2DFE A;  2YHA A;  4E7L A;  1NLV A;  1NG9 A;  3BF3 A;  1HR0 K;  2F4V K;  2ASM A;  4C8K A;  4RTF D;  3ZX3 A;  4CEE A;  4O8K A;  1BO5 O;  1KQS M;  5AQG A;  2P9K B;  3OW2 M;  4FZY A;  5SZT A;  3PO5 A;  2P9U B;  1YIJ N;  3K58 A;  3VQ4 A;  2HNZ A;  2ETJ A;  4Z94 A;  1L3U A;  3C0B A;  4FLW A;  2UXD K;  3QES A;  5AFU H;  3L8B A;  1RT2 A;  5SWM A;  3O3H A;  1N6Q A;  4FWL A;  5AQX A;  2ZQB A;  4CGI A;  4QS9 A;  4KHY A;  3O5B A;  5CZ2 A;  4JAX A;  4KHQ A;  3SMS A;  4B9U A;  3AVM A;  3H6E A;  3ZT2 A;  3OYL A;  5GIP A;  5KRS A;  1HUX A;  1KLM A;  1ATR A;  1WBB A;  3E66 A;  1R59 O;  1XNR K;  4Q0B A;  1S1W A;  4K42 A;  1KC8 O;  4BWM A;  1SKW A;  2A1S A;  3DM2 A;  3G4S N;  5J1E A;  1QZ5 A;  2FBY A;  1VHX A;  3F2K A;  5GAE P;  4FJN A;  3THY A;  1Y97 A;  1Q9X A;  1OH7 A;  2P9L B;  2DFH A;  3QFP A;  2HND A;  4K0K K;  1QVG M;  1NGI A;  2E1Y A;  2E2Q A;  4OKJ A;  3E9P A;  1ILY A;  3CJB A;  4MO4 A; 
#chains in the Genus database with same CATH homology
 3DJC A;  2KKZ A;  3CCU N;  3JXU A;  3FZM A;  3UKR B;  3SAG A;  4C1N K;  3TU5 A;  2UYT A;  2ZGY A;  2QWO A;  1X3M A;  2P9S A;  1T6D A;  3SBG A;  1SQK A;  2QW9 A;  4YOY A;  1TYQ A;  4BGA A;  5C0Y A;  4CBU A;  1HPM A;  2YHX A;  4BRN A;  1VQ9 N;  4GV9 A;  1QVF M;  4IOA L;  3GDQ A;  3A0I X;  3H3O B;  3RSE A;  3MN6 A;  4JKC A;  4WFN L;  2P9L A;  4PKG A;  1SS6 A;  5M1Q A;  5C2F A;  4H5V A;  5EOY A;  1K9M O;  4NLB A;  5BRH A;  4JKG B;  1XQS C;  3VEV A;  3FLC O;  1KXP A;  5AQL A;  2FSK A;  5AZI A;  4B1V A;  1HX1 A;  4JKH A;  5E84 A;  4J8F A;  4F9O A;  1K8K A;  1C0F A;  3LL3 A;  5GAD P;  3CCJ N;  1T44 A;  2I7P A;  3O08 A;  3O9U A;  4BRF A;  1NGF A;  3R8E A;  3IFR A;  3SAH A;  2WFB A;  1T6C A;  4JK8 A;  1DEJ A;  3QBW A;  2QWR A;  2Q0U A;  5F1X A;  3O9T A;  2IVO A;  1DKG D;  1HKB A;  3VEW A;  5LJV A;  2HBJ A;  3ENO A;  4XEI A;  3E9O A;  3SK3 A;  3I55 N;  1RGI A;  5TKY A;  5AQV A;  2E2P A;  1NMD A;  4HWI A;  4CD1 A;  4I6M A;  3SAF A;  5FPN A;  3A5O C;  4BRI A;  4M7Y A;  4WFB L;  4ILH A;  5HL7 L;  1GLL O;  3ZET B;  2FXU A;  3AGR A;  4BRC A;  3T7Z A;  3BP8 A;  1DGK N;  5C2D A;  1U2V B;  3FZH A;  4M7X A;  3VEZ A;  3VER A;  4JHD B;  4BC5 A;  3H45 C;  1RFQ A;  2NRT A;  2HF3 A;  4JK9 A;  4ILJ A;  4YOR A;  3ZX2 A;  4B1U B;  2ZGZ A;  3D2E B;  4U7B A;  1X9J A;  2CH6 A;  4B1W B;  2NRW A;  4EIA A;  1NJI O;  5ELZ A;  4FOE A;  2P9P B;  2GUP A;  4B1Y B;  5CHI A;  2WC9 A;  3U4L A;  5AZJ A;  2KHO A;  2P9N A;  3ZX0 A;  4BR5 A;  2QXL A;  3HOT A;  3DAW A;  4FPA A;  3CPW M;  1VAZ A;  3WXM B;  3CJC A;  4FVU A;  4ISE A;  4NB4 A;  1HJO A;  4CBW A;  2P9I B;  3BUZ B;  3C7N A;  4H0P A;  5CR4 A;  2E1Z A;  4BRG A;  3G71 N;  2D4W A;  3EN9 A;  2GEL A;  1YJ9 N;  5TKW A;  3HI0 A;  3MX2 A;  3K9J A;  2YCH A;  3VEX A;  2PFU A;  3MN7 A;  3OBY A;  2DPN A;  3R1X A;  3DLL L;  1U2V A;  2A6A A;  3LDN A;  2YHW A;  3D2F A;  3CCV N;  3H3N O;  3IUC A;  3KVG A;  2WUS A;  3FFK B;  4JKA A;  3D2E A;  3VTI A;  1Q81 O;  1M1K O;  2F9T A;  4IO9 L;  2P9P A;  5KPR A;  4BRE A;  5AFU A;  1VQM N;  2GEM A;  2Q1N A;  3VES A;  3P31 A;  1GLF O;  4AM7 A;  3QB0 A;  1G99 A;  1C0G A;  2YJE A;  3KK7 A;  5I9E B;  3LM9 A;  3O1W A;  4C1N I;  4A2A A;  5EX5 A;  3HSC A;  3K9K A;  5C12 A;  4JD2 B;  1YHQ N;  1VQ6 N;  3HTV A;  3CER A;  4YOX A;  1Y64 A;  1Q18 A;  2P9K A;  1QZ6 A;  4WYB A;  4GY2 B;  3VTH A;  3WQT A;  2GX9 A;  3AAQ A;  2P9U A;  2OTJ N;  3WXK A;  1VQO N;  2I7N A;  4Y0W A;  4GVE A;  2HBL A;  3H1V X;  2OAN A;  3EE9 A;  3HOS A;  4DKW A;  1W2B M;  1BA1 A;  3M1F A;  1MA9 B;  1V4S A;  2NRR A;  4H5W A;  4WCE L;  4JN4 A;  3TSP A;  3UKU B;  3OBW A;  5B8H A;  3CET A;  1V4T A;  2ZJQ L;  4GNI A;  1S3X A;  4BRO A;  4BRH A;  4BG8 A;  3HRG A;  1NWK A;  1TUU A;  3J8A A;  1YUW A;  3A5L C;  4NLC A;  5E26 A;  3GE1 A;  2FSJ A;  1JCG A;  3EO3 A;  3LDQ A;  3O1B A;  3TTF A;  4JD2 A;  3U9Z A;  5GIO A;  2PAV A;  3O9R A;  2VGM A;  3I8B A;  5C10 A;  3T69 A;  3MWT A;  3CJA A;  4KBO A;  4QS7 A;  1Z05 A;  5GAH P;  1VQK N;  4RWT A;  4KH6 A;  4JK7 A;  1WOQ A;  4A62 A;  1VQL N;  5KPT A;  3ENB A;  4FWP A;  2BTF A;  4BR9 A;  1EO1 A;  3ZEU B;  2VGN A;  4FO0 A;  4QS8 A;  1J6Z A;  2VCP A;  1OVY A;  2F9W A;  3AAR A;  2V7Z A;  2ASO A;  3UKU A;  3D7E O;  2NRV A;  4CZJ A;  4JEP A;  5LY3 A;  2ASP A;  4YOT A;  4IXC A;  3IMX A;  4BVO A;  2EWS A;  3EL2 A;  2NRX A;  4IDH A;  1QHA A;  3MN9 A;  4IO8 A;  3HBT A;  3CC4 N;  4FSV A;  5AQQ A;  5AQR A;  1BDG A;  2Q2R A;  4IJA A;  3LDP A;  2V52 B;  4O5F A;  4IJN A;  4A5B A;  3CQX A;  5JLF A;  3E9L A;  2QWQ A;  3UKR A;  3PIP L;  2V7Y A;  3MK6 A;  4FPB A;  2D0O A;  1NM1 A;  3S41 A;  4BR4 A;  2ZWH A;  3U8X A;  4JKF A;  4HTL A;  4H03 B;  4CZM A;  5F2R A;  1OKJ A;  4IFE A;  3VGK A;  4YOW A;  2QWM A;  3M3Z A;  5FPE A;  4BRL A;  4A2B A;  3R9P A;  4CZF A;  1SZ2 A;  3TTD A;  4BR7 A;  3WQU A;  3MCP A;  1GLC G;  4JKG A;  1Q82 O;  4AM6 A;  5EVZ A;  4OPA A;  3N4P A;  3CC2 N;  1S22 A;  3ULE B;  5AQU A;  3CCM N;  3ATV A;  1GLA G;  3KWG A;  2FF3 B;  3FE1 A;  5C15 A;  3LDO A;  3BEX A;  1HLU A;  4YDU A;  3UB5 A;  4BQL A;  3DWL A;  4WFA L;  1YJN N;  2WBN A;  2GWJ A;  1VQ4 N;  4B9Q A;  4CZG A;  4CZI A;  4CD3 A;  3F5T A;  4MO5 A;  1MWK A;  4H5R A;  4AF1 A;  4PL7 A;  5DM7 L;  3L6Q A;  3MDQ A;  1XUP O;  4H0X B;  3HM8 A;  4BRM A;  4EHT A;  2QA4 N;  3CCQ N;  2W41 A;  1ATN A;  5BN9 A;  2IVN A;  2D0P A;  3VEO A;  3FZF A;  1Q86 O;  1K8A O;  2Q97 A;  5AQN A;  4FWS A;  3ZET A;  5BRD A;  4JKD A;  1JCE A;  1HKG A;  4BC3 A;  4JHD A;  1KAX A;  3WXL A;  5EXW A;  3L0Q A;  3LDL A;  1JJ2 M;  3RVC A;  3CMA N;  1QQO A;  1IJJ A;  3B8A X;  4XH4 A;  1ZC6 A;  2NNW A;  1BG3 A;  3HZ6 A;  1NGH A;  2E2O A;  3QDK A;  3VGL A;  3SLC A;  3CCE N;  5AQM A;  4G9Z A;  2CH5 A;  3DXK B;  3AY9 A;  4WQ5 A;  1E4F T;  3CPE A;  4KH5 A;  1NGG A;  2NRH A;  2ZF5 O;  5FPM A;  5KPZ A;  4PHT X;  5AQI A;  1DT9 A;  1KAZ A;  2P9I A;  3WUH A;  4FOI A;  4DQ8 A;  2QWN A;  2V51 B;  3A5N C;  4BGB A;  5GAG P;  3Q7B A;  4JNE A;  3I33 A;  3TTC A;  3W3D A;  1VQP N;  2FLO A;  4BR0 A;  3VOV A;  5F0X A;  4U67 L;  1VQ8 N;  4FL9 A;  2IVP A;  2JWK A;  3KZB A;  2QWP A;  4M63 C;  2H3G X;  4FWM A;  2E20 A;  5M1N A;  4H0T B;  5M1O A;  5BPN A;  3CF5 L;  5BRF A;  4A59 A;  5DM6 L;  2IIR A;  3QBX A;  3MMV A;  5AQS A;  3U9D A;  4CZL A;  5MLC Q;  2AP1 A;  4C23 A;  4OO1 J;  1BU6 O;  1NGB A;  4YDU C;  1NGC A;  1RDW X;  4JKE A;  3NVK A;  1GLD G;  3A5M C;  3DXK A;  3FZL A;  3IDH A;  3BF1 A;  4O8U A;  4JKB A;  3E1Y A;  2QEX N;  1YF5 L;  4KH4 A;  2JWL A;  1Q7Y O;  3KWI A;  5AQH A;  3DXM B;  5CE3 A;  4EHU A;  3O9S A;  2AA4 A;  2NZT A;  4RCH A;  3QFU A;  1P90 A;  2BH1 A;  3O8M A;  2CGL A;  2FF6 A;  4ISG A;  3O4W A;  1W97 L;  5ADX H;  4FWK A;  4IWV A;  3C6H A;  2P9S B;  2E8A A;  3UE5 A;  4BG9 A;  5M1K A;  1TUY A;  1TYQ B;  2A41 A;  1YJW N;  3L4I A;  1GLJ O;  4CJ7 A;  2E88 A;  4FWR A;  3FGU A;  4BY9 C;  3MWP A;  3EE8 A;  3RSE B;  4H0Y B;  4CBX A;  1T3V A;  4CZH A;  1ATS A;  1P8Z A;  2HBK A;  3EZW A;  3MX5 A;  3VEY A;  4BQZ A;  4DB3 A;  3M6G A;  3OHR A;  4BC2 A;  5JLH A;  3G25 A;  4H0O A;  1VQN N;  4GV6 A;  4WQ5 C;  5M1F A;  2GTD A;  4A61 A;  1MWM A;  4E1J A;  4BR2 A;  1H1V A;  5AZI B;  4K25 A;  3CI5 A;  1YI2 N;  4OPH A;  1K8K B;  2Q0R A;  3JS6 A;  5BR9 A;  3DXM A;  4K43 A;  4XH5 A;  1RDU A;  3ID8 A;  4H5T A;  5AQJ A;  1BUP A;  3CCR N;  5JVG L;  2ZJR L;  3Q7C A;  2F7T A;  3W0L A;  1N8R O;  3IKM A;  3VMF B;  3ATU A;  3EKS A;  2NLX A;  4PKI A;  4ILG B;  4BRD A;  3O6W A;  3ZEU A;  2YX6 A;  1IG8 A;  1ZXO A;  3WXJ A;  2QM1 A;  4GV3 A;  4I6M B;  5JMV A;  5AR0 A;  5FPD A;  1VQ5 N;  1O13 A;  2J4R A;  2E2N A;  1BOT O;  4MDB A;  4WQ4 A;  3VGM A;  5HOO A;  1D4X A;  4EFH A;  3QML A;  5AQY A;  4IOC L;  3MN5 A;  3G6E N;  4A5A A;  3D6R A;  3TSQ A;  3GOI A;  3VPZ A;  4WF9 L;  4MLH A;  2ITM A;  3WXI A;  5LJW A;  1BWF O;  3WEE B;  5M1P A;  3C6A A;  5JVH L;  5AZJ B;  2VWB A;  3CJ7 A;  2P9N B;  2OTL N;  5AQK A;  1KAY A;  1QQN A;  3GBT A;  3PIO L;  4PL8 A;  2PBD A;  3ENH A;  3KHY A;  2A5X A;  2GWK A;  3CQY A;  3EKU A;  2ZJP L;  1VQ7 N;  2KLA A;  4H5N A;  2A3Z A;  3R3L A;  4BRK A;  1NGA A;  3VF4 A;  3C7N B;  5GIN A;  3P39 A;  1ESV A;  3VEN A;  4FWQ A;  2YJF A;  3C65 A;  2HOE A;  3GL1 A;  3ZYY X;  1CZA N;  1X3N A;  2QTD A;  2QWL A;  2VYP A;  4BVP A;  4PKH A;  3CIP A;  2RE2 A;  1NGE A;  2CGJ A;  5AQT A;  3D2F B;  3A8Y A;  5KQD A;  4DCH A;  4LC9 B;  5KQ8 A;  1KD1 O;  2HF4 A;  4L3Q A;  3H46 O;  2Q36 A;  3ULE A;  5BPL A;  4IOX A;  5BPM A;  1NLV A;  1NGD A;  3WEE A;  2RHK A;  2BUP A;  2HMP A;  3BF3 A;  3N4Q A;  5AQO A;  4NO7 A;  2ASM A;  4RTF D;  4YOU A;  3ZX3 A;  4O8K A;  4CZK A;  4B1Z A;  1BO5 O;  5AQW A;  1MDU B;  3SBT A;  1YVN A;  1SAZ A;  4YOV A;  3CCS N;  1KQS M;  5AQG A;  2A40 A;  2P9K B;  4XH1 A;  2NRZ A;  4UY8 O;  3OW2 M;  4BRQ A;  1NBW A;  3LM2 A;  3CJ1 A;  4ISF A;  2CGK A;  3WT0 A;  3FR0 A;  2P9U B;  1EQY A;  4R79 A;  1YIJ N;  4WQ4 C;  5H1S Q;  3SJH A;  4BRA A;  4FWN A;  1M90 O;  2A42 A;  3VF2 A;  4Z94 A;  1BA0 A;  3QIC A;  3C0B A;  3OA9 A;  1WUA A;  1NGJ A;  3VET A;  5AFU H;  1XC3 A;  2FSN A;  3PLA A;  4H0V B;  1S72 N;  3J7Z O;  3I56 N;  4FWL A;  1K73 O;  3CME N;  1QQM A;  2QI2 A;  3GG4 A;  4BC4 A;  1GLE G;  3AAP A;  4DHY A;  3MCA B;  5AQX A;  2W40 A;  3CD6 N;  4QS9 A;  3O9Q A;  3O5B A;  1Z6R A;  2HBM A;  1LOT B;  3ID6 A;  4EAH D;  2Q31 A;  4JAX A;  3SMS A;  1HKC A;  4K41 A;  3H6E A;  5AQP A;  5BN8 A;  4CZE A;  1GLB G;  5GIP A;  1HUX A;  5JIC A;  4CI6 A;  1ATR A;  1YXQ A;  3E66 A;  1R59 O;  3CC7 N;  2D1K A;  5AQZ A;  3R6M A;  3P4I A;  3TPQ A;  1YAG A;  4K42 A;  4A57 A;  1KC8 O;  5EY4 A;  4MDA A;  5ADX A;  4IZ9 A;  3TSU A;  1YIT N;  3G4S N;  4FWO A;  1QZ5 A;  3F2K A;  3O80 A;  5GAE P;  3VF6 A;  3CCL N;  3F9M A;  2HST A;  1U6Z A;  3AGK A;  3CXC M;  3NMU A;  1JCF A;  3SMP A;  2P9L B;  3NVM A;  3CHW A;  3QFP A;  3FZK A;  2YI1 A;  3H1Q A;  1QVG M;  5BRE A;  2YHY A;  4MLE A;  4B1X B;  1ILY A;  1NGI A;  2E1Y A;  2E2Q A;  5AQF A;  3L4Q A;  3CJ9 A;  3P38 A;  4IEE A;  4BRP A;  1E4G T;  3E9P A;  3M5R A;  1ZBS A;  3CJB A;  4MO4 A;  4IEI A;  1LCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...