3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
5EUHA 4ZPBA 3BSCA 1GOCA 5HRPA 5F9NA 3O4NA 2ASJA 3MTKA 2GUIA 5KFRA 3SV4A 2R8JA 4O3RA 3HP9A 1NOYA 3V6DB 2R2TA 1N5YB 4Y2AA 2WONB 4O3NA 4R0EA 1EETB 5J2PA 3ALYA 2QXFA 1N6QA 3ZT1A 5KFLA 3SYZA 4XPCA 3ZSYA 2J6TA 3MR5A 2XY8A 4F2RA 1RT4B 2QE5A 5KFWA 4EZ9A 3SI6A 2G8KA 1BGXT 3OYFA 1LWEB 2V9WA 2UVVA 1RT1B 5L1IA 4JUZA 5L9XA 3NFAA 3CVKA 2JLEA 2XC9A 1GOAA 4IH5A 1CZBA 4IFVA 1IM4A 3KLIB 4CEQA 1KFDA 4DQRA 4H8KA 1SL2A 2FC0A 1TL3A 2VG6B 4YR0A 1TL3B 2VG6A 3BR9A 1RDBA 2DPJA 1UWBA 2HNYB 5KFEA 4AHSA 3IS9A 1A5VA 3NF8A 1ZTTA 4JRQA 3C6TB 4EBDA 1XHXA 3VQDA 3T3FA 5KG3A 3L2VA 5L1JA 4Q0BB 3HVTB 3A2FA 2ILZA 4AHCA 3AVBA 2YNHA 1TL1A 1YTUA 3DRPB 5J2MA 1SH3A 3HKWA 5I42A 4ED8A 4IH7A 4KB0A 3QNNA 4ICLA 4GC6A 1C0TB 3H5XA 1LAVA 5DG7A 4IDKA 4CGJA 2ASDA 4J9QA 1TKTA 4O44B 4CEDA 2GIQA 3GILA 4HUFA 1RYRA 2IMWP 4K4WA 1RDDA 5KFBA 4CHPA 3OYCA 1VRTA 2IM3A 4AHVA 4ELTA 4DSLA 4I2QA 3GIIA 3GIKA 1W9HA 5C5JA 4RNOA 1ZTWA 2HHSA 3DLBA 3ZSQA 4E7LA 1C1BB 5DQGA 3QIOA 3V1OA 1KLMA 5KFXA 4IKFA 4WE1B 3H4BA 1IKVB 1UA1A 3FFIB 1LAWA 3CDWA 3ISNC 3LP1B 5F8MA 1EKEA 4FZXC 4CEBA 1HYSA 2G8HA 2OPSB 3IRXB 2JC1A 1FXXA 3UPFA 4U6PA 3G6YA 4C8NA 4HUGA 3T5HA 1LWFA 2UVUA 2R8KA 3I8DA 2XY5A 2R8IA 2RKIB 5KG4A 3EPIA 4IFYB 3QINA 1RT4A 4RUAA 3F73A 1JLBA 2V4RA 4IG3B 2RF2A 3H59A 3SPYA 3E51A 5DGAA 2KW4A 3QYYA 3PJWA 3G6VA 1J5OB 1S6PB 1NK4A 1J5OA 4NLTA 3MXMA 3DLHA 3HJFA 1B9FA 4M3XA 4ZVFA 3HPOA 2EHGA 5JS2A 4CIFA 4IKAA 3OYJA 3DOLB 3M8SA 4ELUA 5J1EA 5KT5A 3BDPA 4FLWA 4J9LA 1VRUA 1S97A 2JGUA 1NK5A 3NAEA 2ETJA 3OY9A 4CK1A 4Z4FA 1TL1B 4TY8B 4U7CA 1TAQA 1RYSA 4TY8A 4Q43A 1ZETA 3OHAA 4OVLA 1LWCB 3ZT4A 3TABA 2XO7A 4FYDA 3SPZA 2P5OA 3D45A 3MXJA 3HHKA 1KTQA 4DFMA 4DF8A 2YKNA 3LAMA 2FLPA 1FKOA 2JEIA 3ZSZA 4TY9A 1IKXA 4Q45A 3N6LA 1B92A 4TQRA 2J6SA 1UA0A 1RDAA 3QGHA 1SL1A 2VWKA 5FRNA 4RW6B 3KHLA 2EX3A 2W8KA 1NJWA 4DMNA 5KRTA 3KLVA 1EXQA 1Q9XA 1TKZB 2IJNA 2OPPB 3ICLA 3LP0A 2BE2B 5KFIA 3NH1A 1JX4A 1N48A 4NYNA 4QOZB 4E7HA 3OSNA 4MKAA 1S1XA 5CYMA 1HYZA 4Z4EA 2A1SA 1HNIB 5HP1B 1HPZB 1WSJA 1HNIA 3KLHA 5HP1A 1IKVA 3VQCA 3CJ4A 2KZMA 3JSMA 4TYBA 3M9MB 3T1AA 1S5JA 3L8BA 3VQ6A 3L2RA 3LALA 3AO2A 3DRRB 3RR8A 4EP4A 1TQLA 1U04A 4NLGA 3GYNA 2Z1GA 4W5RA 4FLVA 2WOMB 1B9DA 2ITGA 2HVHA 1I39A 3KLGA 4CJ4A 4DTMA 3MEEB 3QERA 4O0IA 1WAJA 4JV0A 3H40A 3V6HA 1S0MA 3G6XA 3CDEA 4O4RA 4KHSA 2O4GA 1S6PA 4NLDA 3PZPA 2OZMA 4LSLB 2YNFB 3ZT3A 1MU2B 2XCPA 3JYTA 2R2SA 4RW8A 3NGDA 4F4WA 3U3GA 4ZP6A 1RTDB 5J1EB 1RT7B 2ASLA 1C0UA 2Z1HA 2XGPA 4K50A 4JV1A 4TLRA 5KG7A 3CG7A 3SFUA 1L3SA 3G10A 2IA6A 3RBEA 3VA0A 4M3UA 4CGHA 2KTQA 4ZTJA 4K4TA 1EX4A 4B9LA 4C8KA 3I0RB 3DMJB 2ATLA 2XI2A 3DMJA 3TWHA 4B9VA 2YV0X 3SZ2A 3VQ4A 4ECUA 1D1UA 3MR3A 4PQUB 4FBTA 1IKWA 1TKZA 4Y1DA 4DSFA 4ZHRA 4ZHRB 3H08A 4PA1A 3V1QA 2E4LA 1L3TA 2HHQA 3AA2A 1KVCA 5T14A 3CFOA 1JLQB 1X9SA 2WCXA 4F50A 2AGPA 4TN2A 3U3YA 4KHWA 2FVRA 4J9MA 1ZBIA 3OL6A 5T7BA 5FRMA 1U45A 4XIUA 3RWUA 2IJFA 1LW2A 1RT3B 5KFUA 3T5KA 1TVRA 4CF1A 2AGQA 3G0ZA 3PW7A 3AVFA 4Y3CA 4O5BA 3KLHB 4IG0A 4JLHA 4MFBB 3KLGB 3DDKA 3TAQA 4B9NA 3ULDA 3QIPB 1KHVA 2B4JA 2WK4A 4N41A 2DY4A 4B3OA 5JXSA 2I5JA 1CLQA 2WOMA 3KHRA 1CZ9A 3I5AA 4OKJA 2LSNA 3VA3A 4NLWA 3TARA 4GW6A 4NLXA 4BE2A 1NJXA 5EWFA 3PX6A 2HB5A 4K4ZA 4K4UA 3HK2A 4ED6A 3PV8A 3BJYA 3KK2A 1WSFA 1RT1A 3PX4A 2HVIA 4RW7B 2AGOA 4RW7A 3QLHB 5KFDA 4KPYA 2ZE2B 5L1KA 1S1VA 2HNZB 1C2PA 3I0RA 3ZSOA 3RB3A 3K59A 2P5GA 3M8QA 4E3SA 2PYJA 4FXDA 4DQSA 1S6QA 4W5NA 1S6QB 1J53A 4MIBA 3IS9B 2YNIB 3KTQA 4CEAA 3K58A 4WXWA 4NLUA 4FJKA 4RW9B 5D3GA 5DLGA 4NZ0A 4HHTA 4RW9A 2IM1A 4CJPA 4CEZA 4N56A 3RB4A 1OS5A 4LSNB 1VSEA 3LANA 1D8YA 1SKRA 3QGIA 2F96A 2YNHB 2ZD1A 2JEFA 4DS5A 1DTQA 1ITGA 1Z4UA 2OPRB 2HAIA 4MH8A 1VK0A 3LP2B 2OPRA 4KTWA 4QWAA 4CFBA 3LZJA 2ATQA 4WXOA 3HYFA 3V9ZA 4KE5A 3LWMA 1XC9A 5KFOA 3KD1E 4Z4HA 5KFYA 3D28A 4CJUA 1U09A 2AQ4A 4H4MB 2OPQB 1BQNA 4R8UA 3CQ8A 4MK8A 1UAXA 3QIPA 4M3ZA 4FLTA 3OL7A 3HPGA 3V6DA 4YNQA 4DTJA 3SQ4A 4QCLA 2XI3A 1ZBUA 4MQ3A 3V1RA 2G8UA 3AVCA 3PO5A 1WN7A 1C1BA 4NYFA 4RU9A 2DFFA 5DK5A 5K14B 3QNOA 4XPEA 4DSKA 4ELVA 3DM2B 3M8PB 4EZ6A 1C1AA 5F8NA 2W9CB 3CFPA 1RBUA 2FJXA 3RMDA 1HQUB 3ZCMA 2G8VA 1HMVA 3SCXA 1JL1A 3VQ8A 4KTZA 4FLZA 4ED2A 3RTVA 5KFKA 4RNHA 2YKMB 5I3UA 4NLOA 4IR9A 3NAHA 1TP7A 1QHTA 3LAKA 1QUVA 1RNHA 3MECB 1S1UA 1Z25A 1SUQB 1SH0A 3SV3A 1U47A 3KIOA 2HNYA 3CJ3A 3ZSXA 5KFNA 3ZT2A 4OGEA 2PZSA 3OYBA 4FJLA 1BCOA 1XWLA 2G8WA 4ZTFA 4ECSA 4FBUA 4Q44A 2WTFA 4CF9A 1VRUB 4NCAA 3BSOA 5CZ2A 1L3UA 3NL0A 1VSLA 2R8HA 2IS3A 4YR2A 2XY6A 3D5MA 3VQSA 3PW4A 1HYVA 4CJWA 5KFHA 3T5JA 2W42A 3NF9A 3DRPA 5J2MB 1S1TB 3KJVB 4FM0A 4NLRA 4GVMA 4CF0A 3OYGA 4O3PA 3MEDA 3MEGB 1K6YA 1NK6A 2AWZA 1RBVA 3GV5B 1NJYA 4NRUA 4OPKA 4M3WA 4URGA 2RDIA 1TKXA 3CIZA 1K1SA 1Q9YA 4FJ5A 4FCYA 1YVFA 4CJVA 1JL2A 3OYDA 2BGGA 1NK7A 5KG1A 1D9DA 3TR8A 1J54A 3I5BA 4F2SA 3NAIA 4E7JA 3OS0A 3GIJA 3PUFA 2IC3A 3NE6A 3OYKA 3LP1A 5KFJA 4ZP9A 4W5OA 3AA5X 5JUMA 2W9CA 3PX0A 4HYKA 4XO0A 4DG1B 3HM9A 4K8ZA 5HBMB 5J2NA 2CKWA 2KFZA 1HPZA 4I9LA 4FM1A 3NCIA 4Z0UA 1KLNA 3DM2A 3QETA 5C42A 1QQCA 1S49A 1JLGA 1JLGB 3V4IA 4CFDA 3QEXA 3KLFB 1UOCA 2VA2A 3MF5A 4O3QA 1FK9B 4WYLA 4AHUA 3HVAA 1KRPA 1QTMA 3MEEA 2BQUA 3GQCA 4CECA 1HNVA 2HWIA 1KSPA 4K4YA 2IOCA 4LQ9A 4KO0A 5FDLB 4KO0B 4ECXA 4ZPAA 4Q0BA 1S1UB 1IKYA 5KFMA 4K4XA 4ZP8A 4BE1A 3HVRA 3JYTB 1KFSA 2PY5A 4CE9A 4G1QA 3CWJA 3SJJA 2W9AA 3AVIA 2V4QA 3K5MA 1SKSA 4FJMA 4CGGA 3DI6B 4CJRA 2O5DA 4ECZA 4AHRA 4F4ZA 5I42B 5CY4A 5KFGA 3AO1A 4MIAA 4ICLB 4EBEA 4FW1A 1NKCA 2X74A 2X78A 3CJ2A 4YR3A 4WZMA 2QKKA 4ED3A 1FKOB 3C6UB 1VSMA 4KI6A 3O4QA 3T5LA 3TAMA 4CEFA 3OS1A 5KT2A 1BHLA 4CJ5A 1RBTA 4N5SA 3Q8RB 1RBRA 4M3RA 3EZ5A 2UVWA 4B8CA 4LH4A 3M9OB 4HVJA 1QSLA 4RW4B 5DLFA 1TAUA 4AH9A 3FQLA 3HSTB 3TAGA 4DF4A 2F8TA 4DG1A 1IH7A 3OL9A 3DLKB 1WAFA 5HBMA 4PWDA 1WNEA 4DTRA 4WE1A 4FJHA 1HARA 4Q5VA 3FFIA 3KKRA 3JSMB 2IC3B 1JLBB 5KFFA 1JLCA 4JRPA 2RF2B 1RT3A 4M42A 4J9OA 3KK3A 1RTJA 3MAQA 3V9UA 1LWEA 4URQU 4DLEA 4ED7A 4CFCA 2BRLA 5J2NB 1LWFB 3NDKA 2RKIA 4L8RB 2G8FA 3I0SB 2HMIB 4HCCA 4ZP7A 4B9SA 1C1CB 3H5YA 3AVHA 1F21A 4KV8B 3H2LA 3SUNA 3ITHB 3V6JA 1HQEB 1FK9A 3AVJA 3OYLA 3QEPA 2R8GA 4MK9A 3SFGA 4KHQA 2Y1JA 4ID5B 4BDYA 4N76A 1N56A 1RT7A 1NOZA 1IKYB 4R5PA 3QESA 4C8OA 3DLGB 5KT3A 3IGVA 5L1LA 2E6MA 1RDRA 3HVWA 4ECWA 2BR0A 1QE1B 3DYAB 3CJ0A 1C6VA 5DGBA 2KZZA 3DI6A 3FRZA 4DFPA 1ZYQA 1JKHA 1BL3A 1RDCA 3O3HA 4FJGA 3GV7B 4AHTA 2B6AB 5HLFB 1SV5A 5KFPA 2UUTA 3QO9A 1TK0A 2B5JA 3RMAA 4LH5A 2WRMA 2C28A 2DTUA 4B9TA 2YNIA 3NBPA 4Y34A 4OKEA 4IDKB 4NCGA 3HP6A 1TKTB 4RW4A 2YHAA 4KTQA 5HROB 1RT5A 2YNGB 4CESA 4J2EA 3VQBA 2QV6A 2X6NA 5KG0A 4CHQA 1VRTB 3O3FA 2ZQBA 4FJNA 1CXQA 5CYMB 4CJQA 3K5LA 4DQQA 4DTOA 5J2QA 4DU1A 3NGZA 2IGIA 2O4IA 2W7OA 4IRDA 5F8IA 3H4DA 2F8EX 3WNHA 2BE2A 1ASVA 2VG5A 1JLFA 4Z4CA 3OYAA 2FVCA 3DRRA 5EWGA 4EYHB 5KT6A 4B08A 2OPSA 3IRXA 5HRNA 4CHNA 1KHWA 3NH2A 3DLKA 4KREA 4B8AB 1BI4B 1X9WA 3DRSB 4DTXA 4GC7A 1BQNB 1ASUA 2HNDB 4KFBB 5KG2A 4CIEA 4B3OB 2HWHA 4CIGA 2VA3A 1BCMA 3OLAA 3BGRA 1KCFA 3AVLA 3SUQA 2UUWA 4NYZA 4PUOA 2AX1A 3OYHA 4F4KA 2HHXA 4ECRA 4QWCA 4BDPA 3Q8PB 1I3AA 3VQ9A 3SUPA 4E0DA 3DLEA 4DQPA 1HQEA 4R5PB 4MK7A 1D0EA 5F8JA 1NHUA 2BQ3A 3HO1A 4ECVA 3OSPA 1XR7A 4ID5A 3KHHA 1RTDA 3KNAA 1S9EA 2ZE2A 4KBIA 3RAQA 5I3UB 3B6PA 5SWMA 4DS4A 2Y1IA 3B6OA 1RT6B 3MECA 4Q8FA 4ZPCA 3N6MA 3BREA 4E7IA 2UVRA 1QE1A 4DSEA 4ECYA 2ALZA 3O3GA 3HPHA 2VWJA 2B6AA 3SQ2A 4BE0A 5KGXA 1MMLA 2W9BA 5KTQA 3EPGA 3CYMA 4RG8A 1JLQA 1KVBA 3H98A 1S9GA 3VN5A 3LPUA 1S0NA 1NKBA 1RTIB 5CYQA 1RTIA 1RT5B 2YNGA 4DSJA 3LP2A 3LP0B 5KFVA 4FJIA 3MEDB 4DWIA 4QWDA 4ED0A 4RNMA 1QAIA 4ECQA 1TK5A 4OLAA 4Y2CA 4J9NA 3S3NA 3TVKA 4IRKA 2P51A 4NCBA 2JEJA 4OPJA 1TK8A 3UIQA 4H4OB 1JLAB 2D7SA 2WB4A 4CGIA 3RRGA 4C8MA 3TQ1A 2E9TA 4UQGA 3V9SA 5EU7A 4KHRA 2R2RA 2DFEA 3LDSA 2R2UA 5HRSA 5KGWA 4CGFA 3RB6A 3AV9A 3VQEA 3M8PA 4WFXA 2XY7A 1ZBHA 3NF7A 4H54A 2IAJB 1LV5A 4LSLA 1Y97A 1N6QB 3L3UA 4QW9A 4RNNA 4OGCA 3CFRA 3N6NA 2BANA 3VQPA 3V9XA 4WFYA 1S9EB 1BQMA 1IO2A 1S1VB 3V4IB 3F9KA 3KD5E 2HNZA 2A1RA 1C0UB 1NK0A 4YMEA 3THVA 1RT6A 1VSKA 4J9SA 4ZVEA 3FSIA 2FBYA 3HXMA 1SUQA 1UWBB 3CM6A 1U48A 1NK8A 2Q3SA 1FKPA 3EZUA 3U6FA 4DFJA 2FBVA 3KLIA 3I5CA 1CXUA 5CZ1A 4URSA 2P1JA 1XHZA 3RMCA 3L2UA 3OJUA 3MFIA 2ZD1B 4F3TA 4QWEA 3KOAA 1DTQB 4DTSA 3BSNA 3PJXA 4E1MA 3IG1A 1S1TA 3KJVA 3P1GA 3IG1B 2C2EA 1LWCA 3K2PA 2W9BB 2BRKA 2J6UA 3HVTA 4TQSA 2E6LA 4CHOA 3KKSA 3QEIA 3PY8A 1L3VA 1S9GB 3KLEA 4ZVGA 2DFHA 3GV8B 4QPXA 2C22A 1YT3A 4O44A 4BWJA 4QAGA 3AA4A 1J9AA 4R8UB 4B9UA 1WSIA 3LP3A 3TI0A 4KI4A 2RPIA 1WNSA 4O3OA 1EP4A 4M94A 4DSIA 1TVRB 4JS5A 3EYZA 3NGYA 1WLJA 2IDOA 4JS4A 3CDUA 1T8EA 2X6SA 4OKKA 4CJKA 3G86A 3AVKA 2HHTA 4IOBA 4DEZA 1HYSB 3ZSWA 4BACA 1N5YA 4O0JA 3AVMA 2ILYA 3QZ8A 4IBNA 4I2QB 1S1XB 2I5JB 4FVMA 2IAJA 1QSSA 3Q8SB 1HMVB 3AO4A 2D3ZA 2V0NA 4YFUA 4OLBA 3IN5A 4CJSA 5KRSA 4PWDB 2FVSA 1S0OA 3MR6A 1W25A 4EO6A 2DPIA 4FJ9A 4DL7A 4EO8A 4M45A 5C42B 1BQMB 1GOBA 2IM2A 1R0AA 4HCBA 4NLPA 3KK2B 4I2PB 4EBCA 2OH2A 3V9WA 2G8IA 4IFYA 4M3YA 1C1CA 5F8LA 2C2RA 3WNEA 5E41A 3V81B 4LQ3A 5DQIA 4PY5A 4KV8A 1TV6A 1RA6A 2D0BA 1U4BA 3DOKB 2FVPA 1DLOB 1S1WA 1W0HA 3E01B 3OJSA 1ZBLA 4CF2A 3E01A 3CO9A 1MU2A 2XGQA 2AU0A 3QEVA 4FJXA 5KG6A 3AO5A 3T19A 3VQ7A 5F8GA 4GMJB 4CEOA 4OJRA 1SL0A 4FK2A 4J9RA 3ZSRA 4O55A 4WFZA 5EDWA 2GC8A 3OS2A 3MEGA 1S10A 3VQ5A 1T94A 4HUEA 3AVNA 4DL3A 5DG9A 4TSXA 3C95A 2W7PA 1S9FA 3K5NA 4JV2A 3OYNA 4FZZA 1S48A 2D5RA 1SV5B 2W8LA 2FJVA 2D0CA 4MFBA 1T03A 1VSFA 5EWEA 1T7PA 5DG8A 2I1RA 2VG7B 2VG7A 4PQUA 1T05B 1IKWB 1VSHA 1JLEA 3S3OA 4H4MA 4NLSA 2OPQA 3KK1A 3NF6A 4YP3A 2OPPA 1EP4B 3OL8A 1ZBFA 1RCHA 3ISND 3L2WA 4RW6A 4DQIA 2FLNA 3VQAA 3K57A 2RN2A 3NH0A 1KLMB 3IAYA 2AX0A 4BWMA 1YVUA 3SI8A 5KFTA 4M95A 1S4FA 3C94A 2R7YA 2VG5B 4NLYA 1LW2B 4K4SA 2JC0A 1JLCB 2WHOA 3KLFA 1RA7A 4LD0A 1REVA 4FLUA 4TYAA 4N47A 4DTPA 1CSJA 3TAPA 1SKWA 3SQ0A 4IG3A 2HMIA 3P83D 3DLRA 2HNDA 2GIRA 3V81A 4CJ3A 2Z1IA 3L3VA 4G3IA 3KMSA 4I2PA 4NRTA 4TXSA 4CJLA 1VSDA 4KAZA 4FK4A 4KHUA 3RR7A 3PHEA 2HHUA 3ASMA 2IBKA 4FJJA 3C6TA 3CJ5A 2QK9A 3UQSA 3ZSVA 1DTTB 4DU4A 2HW3A 3QZ7A 3DOKA 4HKQA 5F8HA 5FDLA 1DLOA 1S1WB 2GBZA 4CK2A 3MFHA 4NLVA 2E9ZA 3UR0A 4FW2A 1QSYA 3OYIA 1RBSA 2FJWA 1VSJA 2NUBA 3RBDA 1GX5A 3LZIA 3DYAA 5F9LA 4QWBA 3EY1A 3C6UA 4CERA 4J2BA 4ZVHA 1NJZA 4CHZA 3MR2A 3IGNA 4DFKA 4Z4IA 3TAMB 4X2BA 2QKBA 2YKNB 2B5JB 3PW5A 2OA8A 4K8XA 3TANA 1IKXB 3NBPB 3KHGA 4FZYA 4ECTA 1SH2A 1T05A 2HHVA 1JLEB 4F4XA 4EEYA 4ID1A 4RUCA 2YHBA 4AILC 3BSAA 1GX6A 1WSHA 2JEGA 4FLYA 2XRIA 4LSNA 2Z1JA 4CJEA 2FVQA 4LY7A 3S9HA 3M8RA 4J9KA 1Z26A 3OYMA 5KFSA 3KK1B 4E7KA 4K4VA 4FS2A 1YTAA 4ZPDA 1RTJB 4F8RA 3BQ1A 1REVB 3PR5B 2D41A 4DU3A 1KVAA 3P5JA 1BI4A 1X9MA 4IG0B 3DRSA 3BQ0A 2HHWA 4W5QA 4ZMMA 1JLAA 4H4OA 3NKYA 4KKOA 5C24B 4KKOB 5C24A 1D5AA 3WNGA 1LW0B 5HRRA 3HT3A 5K14A 4FJ8A 3OLBA 4I9QA 4M41A 1XR5A 4DTNA 3DOLA 1HRHA 5DMRA 4O4GA 3AA3A 1NHVA 3HL8A 2KFNA 2OYQA 3ITHA 2D0AA 1D9FA 4FLXA 4MKBA 3FDSA 1HQUA 3TAFA 4QW8A 1RTHA 3DLGA 2ZKUA 3RB0A 4CHYA 4W5TA 5SZTA 4RW8B 3H5SA 4DL5A 4NLQA 1BIZA 1U49A 5FROA 4CCHA 1DTTA 4IH6A 4J2DA 1JXLA 4CGDA 5HLFA 4E19A 4FJ7A 3LPTA 1C0MA 3M8QB 2KQ2A 4YQWA 1FKPB 4NCGB 4Y1CA 1WSGA 3CM5A 1T3NA 1G15A 3QIDA 2F8SA 5HROA 5D3GB 4DL6A 2FBXA 2IM0A 4F4YA 3QO9B 5KFQA 1XI1A 4CK3A 3UDLA 5JS1A 2E9RX 4FK0A 3V6KA 4C8LA 3VQQA 2AJQA 3M9NB 3BQ2A 1NKEA 1HJRA 1QS4A 2GV9A 3SNNA 4KHMA 4IR1A 2D3UA 4DTUA 4DL2A 4E1NA 1JIHA 1TKDA 3NMAA 3WNFA 4DLGA 4RNFA 1QAJA 3TAEA 5C25B 4KFBA 3KK3B 4KHNA 1I6JA 5KFCA 4E89A 3AVGA 3SUOA 4CFAA 2C2DA 1IG9A 4J9PA 2WONA 4Q8EA 4O3SA 4FS1A 1EETA 5J2PB 1RT2B 3PR4A 1RT2A 5KI6A 4CJTA 3AVAA 1TGOA 3I0SA 3BGRB 4EYIB 1A5XA 4KAIA 3RRHA 1A5WA 4OL8A 4PUOB 3RMBA 4CJFA 2PYLA 2OZSA 2EC0A 4CEEA 2B43A 2FLLA 1WSEA 3ZT0A 4WZQA 3PVXA 3AO3A 2BDPA 3DLEB 3QGGA 1VSIA 1RTHB 1LW0A 4F3OA 2YNFA 3GIMA 1NNDA 2BANB 3K5OA 4O4GB 1O1WA 3L2QA 4KHYA 4RZRA 2YKMA 1NK9A 2BQRA 1R0AB 3Q8QB 4IQXA 1L5UA 3OHBA 4HTUA 3NHGA 3D0PA 4KRFA 1ASWA 1N4LA 3QLHA 3PW0A 2FBTA 4B9MA 1HNVB 4IRCA 4IFVB 3RAXA 4ED1A 2XWYA 4Z4GA 4J2AA 1TV6B 1JKHB 5KFAA 1Q8IA 4CF8A 5KFZA 3SQ1A 3PW2A 4KB7A 2XCAA 4I7FA 1BIUA 1JXEA 4M3TA 3S3MA 4I7FB 4EP5A 3KMQA 2CJQA 4G1QB 1JXBA 3MXIA 1X1PA 4BDZA 5KG5A 3FQKA 5KT7A 1K1QA 4DL4A 4KSEB 2RDJA 4FM2A 3OVNA 3OYEA 5KT4A 1XR6A 1C0TA 3LWLA 2XHBA 5J2QB 3KLEB 1TKXB 5CYQB 1BISA 3QEWA 4WYWA 3PO4A 1RAJA 3NGIA 1RILA 5C25A 3H5UA 5DQHA 1JLFB 1T03B 4KB1A
chains in the Genus database with same CATH superfamily
5EUHA 2J7KA 4ZPBA 4F0MA 1UTAA 2YWFA 3A8EA 3IMXA 1S5ZA 3O4NA 4RL1A 3HP9A 2AEFA 3MCSA 4KHPJ 4FWKA 1N5YB 1PGZA 4Y2AA 4O3NA 4A8SA 1EETB 2JVOA 3DXKB 5KFLA 3CJSA 3ZSYA 2XY8A 1EO1A 3PACA 2XS2A 3D1OA 5KFWA 1YG0A 1R0BG 4NX9A 3OYFA 2HFOA 1PCAA 2YHYA 3DNCA 2FIUA 4YN3B 2UUCJ 4M5GA 2N7YA 3KLIB 1KFDA 3O1LA 3P39A 1SL2A 5D0EA 1GXLA 3BR9A 3LPYA 4BC3A 1EAYC 4DHVA 5KFEA 1XERA 3DC2A 2CDQA 1VQMS 2IDLA 3C6TB 4EBDA 3PXGa 5ETTA 1Q95G 3NNHA 3L2VA 2K8GA 1U02A 3VWSA 1WWHA 2ZUAA 4MYUA 1TL1A 2G2ZA 4CZKA 1KQSR 2C2ZB 5HMZA 5KOWA 5ETPA 3VEZA 4BGAA 2R7TA 4B3TJ 5BYSA 1Q18A 4CLYA 2ZFHA 4N8NA 4BBYA 1DBDA 2KLAA 4ICLA 5AQLA 2UUBF 4Y28C 5DG7A 4IDKA 3BO2A 3ENOA 4CEDA 2GIQA 5HK4A 4X4OA 2IMWP 4JI0K 2H3EB 3GIKA 4JKGA 4W90B 2EWSA 4RNOA 1ZTWA 4LRFA 2IVOA 5KFXA 1EZZB 2UXBF 4WE1B 2CQDA 3H4BA 3FFIB 4HVZA 2L48A 1TL7A 3MMBB 2DNKA 1HYSA 2G8HA 5AR0A 1HBOA 3O9QA 2JC1A 2FHJD 4HUGA 1LWFA 2UVUA 3I8DA 1UVMA 2R8IA 2O8BA 5KG4A 3ZNUA 2V4RA 4LRAA 4YY3F 2P9EA 5I9EB 1QAYA 1U2FA 3PJWA 3G6VA 2GO9A 3R6LB 1J5OB 4A5BA 2LEPA 4B02A 5E3CA 1B9FA 4ZVFA 3HPOA 1TUUA 5ETMA 2QA1A 3DOLB 2DNOA 2DXFA 1RUSA 2B9EA 4HTJA 2HBLA 5ETQA 2HG4A 4J9LA 2F9JA 1VC6A 3TA2A 1VRUA 4DR3K 4DR4K 1NK5A 4WFBL 4KGZB 4K8RA 2ETJA 3OY9A 1NLVA 4A8XA 4U7CA 4OX8A 1CULA 1S72N 2HGNA 3OHAA 4OVLA 3THXB 3TSQA 4F0HA 3H6EA 1UKUA 2VODA 2XO7A 4FYDA 4DUZF 4KHPK 2W6LA 4DF8A 1JXVA 3LAMA 2JEIA 2V50A 1DRZA 4TY9A 3UWTA 1ZBTA 4TQRA 3O3LA 2J6SA 1FD8A 5F0XA 4H0XB 4CWBA 1NGHA 1UPMB 4HWIA 3UO0A 3U27A 1NJWA 3DWLA 1UCNA 3KLVA 1EXQA 1TKZB 5BRHA 1FKAF 3PG9A 4USWA 4LF6K 3LP0A 4AQYF 3NH1A 1WG1A 1N48A 3Q83A 3OSNA 4DCHA 3C65A 3SAGA 4RO0A 1Q53A 4ZOSA 2KRBA 4V19J 4FKXA 4UUXA 3BEGB 3KLHA 1IKVA 4MYTA 5K5MA 3VQCA 3OTOJ 2A3JA 3T1AA 3WXIA 4OX9K 3VQ6A 3DRRB 2UV8G 2FB0A 1XNQF 1VQKS 5BYQA 1IWAA 1F0XA 2OD4A 4JI2J 2OFGX 1YQHA 2Y8WA 1GTEA 4W5RA 3VHQA 2ITGA 4RTFD 1I39A 3D2EA 4CJ4A 4DTMA 3MEEB 5CCMA 4DR7F 4O0IA 2WVEA 2LQJA 1WAJA 4ZN1A 1TUWA 3V6HA 1S79A 3CDEA 4O4RA 3MEKA 1ITPA 2O4GA 1YHQN 1H6KX 3PZPA 3R8EA 4LSLB 2RQMA 4FWLA 3KKFA 5C2GA 2C3UA 2XCPA 4UY8O 2JL9A 2AP6A 5J1EB 2EBGA 2PEHA 2EG1A 3NS5A 2Z1HA 1X31C 2XGPA 2MHEA 3BS9A 4JI1F 1X4BA 3DGPB 1L3SA 2RILA 3T1HF 3HTVA 2MQLA 4CGHA 1VRQC 2GX8A 2LKZA 4K2JA 2KTQA 1DQ8A 4RWWA 2B8PA 1HIYA 4C8KA 3I0RB 2BW7A 4H5WA 1SXLA 3DMJB 3OPKA 4KGKA 2XI2A 3DMJA 4B9VA 2YV0X 3LW5C 3IDHA 3EVMA 1Z1ZA 2KRRA 5AXKA 4LFCF 1IKWA 3Q2TC 3GE9A 4PA1A 3ZX3A 2HHQA 2P9KA 3AA2A 2VBZA 2WCXA 4F50A 4TN2A 3U3YA 5D15A 4QYZK 2QFJA 1HNXF 4O5FA 4WQ4A 4C0BA 3RWUA 1LW2A 5KFUA 1ACMB 4LF7F 3UN5A 3TYTA 3FBEA 3VR1A 3ZC4A 3PW7A 1RE1B 1I5OB 3TAQA 4PG6A 2LDIA 3QIPB 2DNPA 3LDLA 2B4JA 1OJ4A 2DY4A 2I5JA 2ZJQQ 1RHRB 2WOMA 3KHRA 1U0SA 2I38A 2LSNA 4OKJA 4CBWA 3VGLA 4NLWA 4BE2A 4XH4A 1H3DA 5HMWA 3PX6A 5LJ3Y 4CM0A 3T9NA 3BJYA 1PSDA 2QG9B 5D77A 1C0GA 2HK3A 1H7XA 3PX4A 4OV1A 1EHWA 5KFDA 3ENBA 4DPOA 3R7SB 1Z6RA 4RPFA 1S1VA 3BBCA 3R97A 3RJMB 2RS2A 2LU1A 4E3SA 4DQSA 1S6QA 3QBXA 2OEMA 3SMPA 4W5NA 1S6QB 4X4SA 1M5VC 3IS9B 4CEAA 3K58A 5LY3A 1KN6A 4RW9B 4HHTA 3K8WA 4CJPA 3OR1A 2Z4PA 1JK9B 1E6VA 1OS5A 5IFMA 3AD8C 4LSNB 2V9KA 3LANA 1SKRA 2WBRA 2ZD1A 2JEFA 3KDOA 4NXNK 4JI2K 1ITGA 1Z4UA 2OPRA 4KTWA 5GIOA 1NGEA 2PAVA 3BO4A 4L6V3 3LO3A 2CQ0A 3V9ZA 4KE5A 1T6CA 1XC9A 2NCKL 3KD1E 2OSRA 2LQ5A 5KFYA 4Z4HA 2DHXA 5GVQA 2AQ4A 4H4MB 5K9FA 2FUG9 3FEZA 2KFYA 3CQ8A 3N0VA 4PQAA 4M3ZA 5HSPA 1VQLS 2I8EA 1NGDA 3FJ2A 5JMVA 1NG9A 4QCLA 1RHKB 2G8UA 1E3MA 3UR3C 2K3IA 5DK5A 3M2VB 2R3VA 2LDYA 2QLBB 4DSKA 5LMUK 2XMUA 3TJ9A 3DLJA 1PYTA 3QFPA 1F5AA 1FTCA 3CFPA 2AHOB 1WHWA 1RBUA 2A41A 3I9V9 4JI3J 2XB2D 2FJXA 4DX6A 4A8WA 1HMVA 1KQGB 3SCXA 1JL1A 3VQ8A 4KTZA 1IM6A 2FJAB 2GIFA 3BN7A 4WF9L 3RTVA 2HZVA 1CJUA 4IR9A 3JTOA 3MM6B 1QHTA 3LAKA 1VISA 1QUVA 2HQDA 5D0HA 2EKYA 4NA1A 4HLBA 3F44A 2CGKA 3RSEA 2HNYA 5LMNF 3ZSXA 3W8GA 1DY3A 1HI8A 2KI2A 1OYDA 1XWLA 2G8WA 4RBTA 2VV5A 4Q44A 2WTFA 4CF9A 2LU2A 3BSOA 5CZ2A 3OV7A 1ZAXA 3WXMB 3CC7S 1YX2A 3VQSA 4QS8A 3CQYA 1HYVA 4A59A 5D0GA 3QSIA 2W42A 3NF9A 3KJVB 4FM0A 1T9TA 5ETNA 2I6WA 4B1UB 4GVMA 2IY5B 2MQQA 2J5AA 5HAOA 4O3PA 1VQLN 1SI9A 1XK8A 3PLAA 2F40A 2AWZA 3MX5A 5B09A 5M1PA 1TKXA 3M2RA 1K1SA 4M5KA 3IAM9 2AT1B 3ZZYA 3OYDA 1NK7A 1EKRA 3SEOA 1I1GA 4USVA 3TR8A 2QWQA 3THTA 3I5BA 1XNRJ 3OS0A 1CQMA 2BYCA 3PUFA 4CZMA 3OYKA 1FDBA 1KAZA 3UE5A 5KPZA 1Q81T 4I9LA 3FLCO 1KLNA 5FPDA 3DM2A 5C42A 1QQCA 4OO1J 1JLGB 2BJ8A 3WEEA 1VJWA 4CFDA 1A7GE 2G1DA 5DS7A 3KLFB 1ZXOA 4JI6K 3OBIA 2XNQA 3MF5A 3NS7B 2BOAA 4RBVA 4WYLA 4AHUA 3HVAA 5AT1B 4PRFA 1QY7A 4NI2A 3I31A 1HNVA 2HWIA 4X4RA 3J7YI 1YJNS 1KSPA 3R2DJ 3KK7A 3V2UC 2XMTA 4LQ9A 2DO4A 1M5SA 3L3CA 3SMSA 1XC3A 3MMVA 4CE9A 4G1QA 2A6MA 2X1BA 3K5MA 4FJMA 2QA4G 2UU9J 4G1IA 3R1LA 4ECZA 4AHRA 2P6SA 5CY4A 5KFGA 3AO1A 4MIAA 3NS6A 4ICLB 3PFOA 4OHZA 5DDOC 3CCQN 5A2QO 4WZMA 4ED3A 2UUBJ 1Q81O 3MOZA 5GAGP 3C6UB 4KI6A 4M5NA 2EK1A 4CLTA 2MGZB 4WCEQ 3NP5A 1R89A 3TAMA 2J0WA 3HI0A 3O80A 1BU6O 2CQ4A 3D6MB 5DO2A 3MN7A 1YJWN 1QSLA 4AH9A 2BJ9A 2GO8A 4RCHA 2CQ3A 4NXMF 3TAGA 2VQFK 2H3GX 4BRKA 3OL9A 3W3SA 1WAFA 5GMDA 3DXBA 4WPAA 4FJHA 4ZA1A 4Q5VA 1WF2A 3FFIA 2HPUA 2ACYA 2DK2A 1JLBB 5KFFA 2CVIA 1TL7B 4CBXA 4J9OA 1RTJA 2CG4A 4GVLA 3MAQA 2UYTA 2V67A 3C14B 2GVZA 3HFVA 1Q8LA 4KC5A 5J2NB 4USHA 2Z2LA 4L8RB 3MZIA 2O8BB 3DRYA 2QSWA 4HCCA 4A46A 5C12A 4FWPA 5CD4H 5L39A 1F21A 1KVIA 4UZBA 3H2LA 4K7QA 2KJVA 3ENAA 1FK9A 2WW4A 4L76A 3CCQS 2JOQA 3SFGA 2HRUA 1RT7A 1I51B 1YDLA 2AW0A 2AIRB 2QM1A 1IKYB 2XMWA 4MKVA 4DL0C 5E33A 5DM6Q 2F65A 1RDRA 2V2KA 3HVWA 3P49B 1NLKL 4F25A 3VAMA 4ECWA 1QE1B 3DYAB 2BJDA 2GHVC 4DFPA 4JHDA 4Z2XA 2GCFA 4FJGA 1NMDA 6FD1A 3M1VB 4E98A 2K06A 2HQCA 1TK0A 4YB7A 4CTAB 2YNIA 2QW9A 4OKEA 4LF7K 4RW4A 4DQ8A 5KQ8A 1KAYA 2RNEA 3CJCA 4MMOA 3G4SS 3P4IA 1HBMB 2QV6A 3IA0A 2X6NA 3KJQB 2DHSA 2ZQBA 4FJNA 2NXUA 4CJQA 4DQQA 3K5LA 2DVIA 4WIQA 3QJPA 4IFEA 2O4IA 2XLIA 5T7LB 5F8IA 4WU3A 3GB0A 3WNHA 4Z4CA 1LK5A 4GKKK 2HRTA 3QAEA 2FVCA 3DRRA 5EWGA 4C1NK 2OPSA 3IRXA 1FDAA 4B1XB 4CHNA 4C97A 1HWLA 3NH2A 2R7XA 4HEA9 4AL7A 3KUHA 8RUCA 1XTZA 1VIOA 4GC7A 2LP4A 1ASUA 1MSWD 3O44A 4Z7CA 2OTLN 5KG2A 2YI1A 4LRBA 4CT8A 4B3RK 4OYBA 4B3OB 4CIEA 2D69A 2WTUA 5CXTA 4LJMA 4NYZA 2IIHA 2MKCA 4F4KA 1NBWA 1I3AA 3VQ9A 3SUPA 4RKUC 1HNWJ 4MK7A 2GZOA 2ZBCA 2BQ3A 5AFUH 3D2WA 1KTVA 3U4LA 4ID5A 4L74A 3KHHA 2RE1A 2Z0GA 1R59O 4X65K 4PZVA 2KXHA 3B6PA 1X4DA 1NGGA 1VQ9N 2Y1IA 4FPRA 3MECA 3BF3A 2MZTA 3U8XA 2F5GA 4E7IA 1T44A 2UVRA 4DV0J 1U0HB 3FBCA 4A48A 2CA9A 3O3GA 1U24A 2E2PA 3SQ2A 4BE0A 4B3SK 4C2MA 5FJ4A 3AQPA 1UVLA 3CYMA 2P9KB 4QJVA 5C2FA 1WKKA 3Q23A 3VCDA 1F6TA 1YKWA 3B78A 3CIMA 3THWA 2ZC3A 1NKBA 1S0NA 1RT5B 2YNGA 1F9FA 2Q2RA 4LF9F 3HDSA 5BN8A 4DWIA 3OTEA 2MMYA 4RNMA 2MQOA 2HAFA 1D9AA 4UW2A 2M88A 4JYAK 2ACMA 4ECQA 2YJEA 2RQKA 2P51A 4NCBA 2BE9B 2JEJA 2NR0A 1RU2A 1P8ZA 2D7SA 4OZ3A 2E9TA 3V9SA 1KQKA 2XNRA 4KHRA 3VMFB 4YY3J 4PKDB 4A2AA 5HRSA 1Y5LB 2KKHA 4CGFA 4ERDA 3AV9A 2B51A 3M8PA 3JXOA 4OLOA 1K0TA 4OZ0A 2FF3B 1HJOA 2MQNA 3K7RA 1ZBHA 1N6QB 4YOWA 4CO2A 1UAWA 3FEYB 4WFYA 2O8DA 3WEEB 3I96A 2O8DB 2XZTB 3FZFA 4LF7J 3F56A 4LMZA 1RB0A 3RW7A 4ZVEA 5GAEP 4CI0B 2DO0A 2Q3SA 1FKPA 4Q7AA 1PC5A 3I5CA 1N33K 5BYRA 4NLCA 4URSA 2P1JA 3Q86A 4DV7J 5B7WA 4K2XA 3IFEA 1MWYA 3WUHA 4QOTA 2ZD1B 3JS6A 3NEKA 3PYEA 4DV6J 2ZHAA 3BSNA 2XSFA 4NWBA 4E1MA 3ILIA 1S1TA 5KOXA 4ED4A 3L6QA 2C2EA 2W9BB 2BRKA 1Y4ZB 4B3MF 4LF8J 4ZVPB 2P9GA 2FGCA 4JN4A 3R5JB 2GVDA 1S9GB 2CPHA 3JXUA 2DFHA 1HBNA 3HSCA 1LWXA 3D7SB 2DXEA 1WNSA 3G82B 3HSGA 4OJ3A 4M94A 3C16B 4DSIA 1XMOJ 3EYZA 3NGYA 1WELA 4XDDA 4H03B 1Q4RA 3CDUA 1NZ8A 1T8EA 3SCLE 2HZCA 2HHTA 1RHJB 3H0PA 4TLQA 1PILA 4FDFA 1WDDA 4X65J 3MMBA 1HYSB 3VAJA 5H9EJ 4BACA 1HBOB 4IBNA 4I2QB 4BR9A 1IV0A 3NVKA 4FVMA 5AZJA 2IAJA 1HMVB 1ZAVA 2V0NA 4OLBA 2BJEA 2CVEA 1IBLK 2DPIA 1KKHA 2VGNA 4NL5A 4BRIA 4BVPA 4PXDA 2ZJPQ 2CZ9A 2Q0UA 4OYMA 3MN6A 1W7AA 4BR2A 3W5YA 2DY9A 2EFGA 3K0JA 2V69A 4DV4F 3KK2B 2UUAK 4I2PB 1CLFA 3GYGA 4NXMJ 2OH2A 2O8CB 2ZH1A 5H9FJ 1VQPN 4AUKA 3V4MA 2C2RA 1FJ7A 3V81B 4OJGA 4WKRA 1RA6A 1S22A 2P9CA 3FZKA 1YGYA 2FVPA 1DLOB 1S1WA 4KH4A 1VQ6N 3OJSA 1LFPA 3CO9A 1MU2A 4TU9A 1RWOB 1IBKF 1K9MO 2RHSB 3T19A 3GFZA 1AT1B 5F8GA 3FKBA 2RU3A 1O0PA 1J5EJ 1VQMN 5EHHA 1X4GA 4JYAJ 4H5TA 3ZSRA 4CBUA 4Q2MA 1LCUA 3N4QA 3EUNA 1ZM3A 2FJEB 3VQ5A 2BW2A 4TSXA 2W7PA 4AE5A 1K8AT 5LL6Z 2HYIB 2JDJA 1U1MA 2DR6A 1S48A 4DZDA 5EN1A 2ROPA 2FJVA 2M5YA 1T03A 3ZXWA 3H1QA 4YDUC 3ADAC 2VDHA 5EWEA 1VAZA 1T7PA 2ZBRA 2VG7B 2DJWA 2VG7A 4PQUA 1RHUB 1H72C 1APSA 3ATVA 4NZ7A 3D1QA 3NF6A 1TU0B 4CO4A 1ZBFA 5M1FA 5F0WA 1RCHA 3PYGA 5FPEA 2NXJA 3VPZA 2A6OA 3NH0A 1KLMB 2F4VJ 2AX0A 1TMMA 4B1ZA 5ELZA 2YKPA 3TOQA 4M95A 2VG5B 2A1BA 2JC0A 2AEJA 3FGVA 2WHOA 1RA7A 3ENVA 3G6ES 4F3QA 4TYAA 1UFWA 2B4OA 2EC2A 3TAPA 1SKWA 1HFEL 3ZO7A 3DXSX 3P83D 4PL8A 2XHWA 2GIRA 3VAIA 1JWWA 2OMOA 2BUNA 1RADB 3CMQA 3N4WA 2HSEB 2COLA 2V63A 2KKZA 3P8BB 4LF5F 4DV6F 2BBEA 4KAZA 4QS9A 5BR9A 4KHUA 1O5JA 2HHUA 1M0SA 4G9ZA 1D3WA 3CJ5A 4DU4A 2JRSA 3QZ7A 2IVNA 5F8HA 4YHHF 2XS7A 4X66F 2G13A 4HT5A 3UR0A 3VF2A 3DGPA 1XMOK 1NPKA 9ATCB 1Q7YT 4ETXA 3RBDA 1UEUA 2H51B 3BKUA 4OJ1A 3LZIA 3Q2SC 2JHEA 3EZOA 1S72S 1M5HA 2ZWPA 3MM5B 4CHZA 3MR2A 2NPIA 3IGNA 3TAMB 1Q79A 3TO8A 4ILGB 2QKBA 3R5DA 2YKNB 3PW5A 2PD1A 2OA8A 3VEYA 3KHGA 1SH2A 1T05A 1JLEB 4RUCA 2YHBA 2P9PA 1IBLJ 1VHIA 4FLYA 2QWNA 3OT9A 2L9DA 3UVJB 2ZJRL 3THWB 1SB6A 4M7YA 3AODA 3GJQB 3WQUA 1Z26A 1NSQA 1ZPWX 4IOCL 2YH0A 5KFSA 4IOXA 3BH6B 4K4VA 3TVZA 1RTJB 1NB7A 3BQ1A 2ZH6A 2QXLA 1REVB 2GFFA 4DPUA 2XHCA 1RAGB 1KVAA 3P5JA 1WC4A 4IJNA 4BRMA 1X60A 3BEXA 5IC4B 2A3ZA 4ZITA 4ZVOB 4X62K 3TJAA 4KQZA 4ZMMA 3VF6A 1MMNA 1IJEB 2Z57B 3GIRA 2E1CA 4X65F 1VQKN 3GR0A 1XUPO 1CG2A 2RJZA 4DV5J 4CZJA 3VEWA 5CA5A 3OLBA 4M41A 4CW7B 4CZIA 5H1SQ 1VQNN 4WTOB 3HL8A 4DI6A 1D9FA 2D0AA 3T41A 3FDSA 1HQUA 4CHYA 2Z8QA 2NLXA 5KPRA 1Q5YA 5LJWA 1ZZFA 2IDEA 4NLQA 2DNLA 5IWAJ 1U49A 1DTTA 7AT1B 3TEHB 1GAOA 1G6BA 3GG1A 3GOIA 2EFPA 3LPTA 1OYEA 4FWMA 1RAOA 3ZEUA 1KAXA 4RU2A 4C0HA 1FKPB 4Y1CA 2F8SA 3W2VA 5HQ8A 5D3GB 4DV7F 3I56S 2ZH4A 4CH0S 5KFQA 4M7XA 3T1HJ 3MCMA 1EX8A 5M1QA 3UDLA 4ALZA 4OLPA 3DDNA 2HBJA 4DUYK 1CEZA 4DR5F 4C8LA 3R27A 4Y0FA 2AJQA 4LT6A 5IT9U 3JB9k 3NGKA 1HJRA 2PA3A 3SNNA 4KHMA 1RWMB 4A4JA 4JK9A 1TKDA 3CPWM 2HVDA 2ZBQA 3CETA 4DV4J 3IWXA 4B1VA 5IQ6A 3KK3B 4DR2K 5KFCA 4KH0B 1WBDA 3BO3A 2KDOA 4Q8EA 1NGBA 5J2PB 2DGQA 3EKSA 2LMIA 4MDBA 3BGRB 3T1YJ 4PUOB 3RMBA 2PYLA 5DDRC 2OZSA 1OH6A 2GWJA 2U1AA 2XS5A 1F60B 5AJ3J 1VSIA 1IBKJ 1V9OA 2N3LA 1N33F 3ONQA 1X4CA 5LSLA 5AE2A 4FWOA 3K5OA 1HW8A 2BQRA 1ZA2B 1L5UA 3OHBA 4B3TF 1UJ4A 4Z37A 2I0XA 4WF9Q 2UZAA 4CZFA 3NHGA 3FC9A 3D0PA 3QLHA 2FBTA 1VBYA 4H5RA 4B9MA 2DISA 4IFVB 3RAXA 1GMVA 1FFWB 1TYQA 1Z05A 1TR0A 5IT9Y 1Q8IA 3D0GE 3THPA 3UKRB 1BIUA 4M3TA 5HQLA 3S3MA 3KMQA 2G9OA 1JXBA 2Z2YB 2E2NA 1KOOA 3RAMA 1IBMJ 3GONA 2HOEA 5KG5A 4MDAA 3G71N 1VJQA 4QS7A 2QJ3A 2RMLA 1K1QA 2RHKA 2B9XA 4E1JA 4KSEB 2RDJA 2CRLA 4K0KJ 2CPEA 3OVNA 2BV3A 1C0TA 1BA1A 3LWLA 2XHBA 5J2QB 1TKXB 5ETLA 2P2CB 3ZX0A 3NMRA 1RAJA 2ROEA 3FVYA 4Y6IA 1SQFA 4I56A 3C15A 3M32A 1T03B 4KB1A 4BY9C 5D4LA 1GOCA 5HRPA 3UCZP 3MTKA 2GUIA 5KFRA 3AQOA 1U8SA 1R8BA 3V6DB 2GQ2A 5JVHL 4PKIA 2WONB 2C2NA 4NMLA 3C6HA 2R7OA 3EE8A 1N6QA 3SYZA 4XPCA 4JB8B 3W61A 3MR5A 3FGUA 2J9EA 2QE5A 1RAHB 3SI6A 2G8KA 2UVVA 4I6MA 2QMXA 5L9XA 3NFAA 4DXLA 2JLEA 1RI7A 3MN5A 2MKHA 3MGJA 2QC3A 3OFEA 2DNQA 2LQBA 2VPYB 3QFWA 4CEQA 1SC4B 5JVGL 4TU7A 1N52B 1TL3A 2JLGA 1TL3B 3BBFA 1WD6A 3TUJC 1RDBA 2ADCA 4CP5A 4Y2MA 4LFAJ 3MPUB 2J0SD 3IS9A 2VJUA 1A5VA 1ZTTA 3VF4A 3AHPA 2C2KB 3VV2B 3BPSP 3TEGA 4Q0BB 3CCVS 2HKEA 3CCES 3A2FA 1A6LA 2CNOB 4AHCA 1O8BA 2YNHA 3IBFB 4AQYK 4GV9A 5J2MA 1LQ9A 2UUCK 1SH3A 2APOA 1NGJA 2ZGYA 4ED8A 2D4WA 2PI4A 1EJ7L 2DEIA 1WORA 1DHMA 2RAQA 4EHUA 5JLFA 3H5XA 1XNQK 1ICEB 4HUFA 1OY8A 1Q16B 4K4WA 1RDDA 5KFBA 2PFUA 4CHPA 3GU0A 3OYCA 3NGUA 4I2QA 4DR7K 1XMQF 1GMWD 3AGKA 2J8AA 3ZSQA 1C1BB 4CZGA 3QIOA 4X4UA 3N28A 4I0WA 3ISNC 3DHWC 5F8MA 1EKEA 4FZXC 3TR5A 2Y1RI 5GAHI 1FXXA 3ULEA 3LQVA 1MLAA 3UPFA 1K8AO 5C2CA 3MAHA 5IWAF 3T5HA 2RKIB 1V3SA 3LDOA 1BA0A 4GV3A 3D9BA 3QINA 1RT4A 1RWNB 4RUAA 3F73A 3SAHA 4IG3B 1RBAA 3O2IA 2RF2A 2MXYA 2AZ3A 3H59A 2BJ1A 3E51A 1WEXA 2MDAA 4J7CA 2FJBB 1S6PB 1B0VA 1U1KA 3DLHA 5LXRA 3HJFA 4M3XA 1K9MT 1OH5A 4FYYB 4K0KK 3AFGA 3M30A 1NZAA 1GFWB 2NSBA 4ELUA 2R7RA 1UZDA 4FVUA 2ZOGA 3A13A 5D4PA 3D68A 4DR6F 1S97A 4X4QA 5A8KB 1R43A 3FZMA 4WFNQ 3NAEA 1K44A 2A18A 2VPXB 2V52B 4CK1A 3CCUS 2WVBA 1S0VA 3JTPA 1LWCB 2CADA 3ZT4A 2DY1A 4DR1K 3RGIA 2FY1A 1CPZA 2FHMA 1GLFO 1HNXK 3D45A 4U67L 5TKYA 1R8PA 4CTAA 4OYAA 2FLPA 3ZSZA 1FKOA 3QMQA 3LGNA 1GXUA 1IKXA 3BGFA 4Q45A 2XMAA 5E7OB 1B92A 4BRAA 2Q1NA 2V4JA 1RDAA 3K2YA 2OAUA 3SCIE 3ETMA 1SL1A 4CLUA 3R1XA 3SBGA 1NAQA 2DGUA 4DMNA 5KRTA 4H0VB 3OUYA 3F41A 2GA7A 2OPPB 3CPEA 3FEXB 1JX4A 1IUJA 2PEBA 4YEAA 5CYMA 1HYZA 4Z4EA 2GQCA 3QRPA 4JI5K 4AXIA 5JVHQ 1WSJA 1HNIA 2KU7A 2KHOA 3WIVA 3M9MB 3LPEA 4LFAK 3B54A 3L2RA 2NUHA 3FSXA 3WX8A 4EP4A 2BM1A 1PC4A 3NMUA 2Q43A 2E7XA 2D3OR 1XIQA 2HVHA 1Y9OA 1YAGA 2VICA 3CCUN 3CMES 2HHHK 3H40A 2VGMA 1S0MA 3G6XA 1NGCA 2DHHA 2QZ8A 4KHSA 4ZVQB 2GS8A 3JSYA 2HGMA 2YNFB 1WOPA 1U25A 2B8QA 1MROB 4JI1J 2YHXA 4UT4A 4YUDA 4NA3A 2AEMA 2CWKA 3AOBA 4OZNA 4DBQA 1S7IA 1N8RT 5DZ7A 5SUHA 1MN7A 2ASLA 5BR8K 3MM5A 1C0UA 1NDCA 3UN2A 4DR5K 2P9NA 2Y1LB 1GNKA 1DJ0A 4D3GA 3RBEA 2HFVA 3OQ2A 4X84A 4K4TA 2M52A 1EX4A 1RACB 4OHXA 1QM9A 4J37A 2BTFA 5EOYA 2AMCB 4CDIA 3TWHA 2KT2A 3SZ2A 1AZSA 1WDTA 2RS8A 2H48B 3DJCA 4ECUA 4WFBQ 3MR3A 4ZHRB 4HDGA 3MCNA 4R25A 2CAJA 1E6VB 4NA2A 3G4SN 3CFOA 1JLQB 4A8FA 4PXBA 1X4HA 3CCWA 1QTNB 1SJQA 2DD8S 4BC2A 4U7UD 5FRMA 1U45A 3VZHA 2RRBA 1WEZA 3U1LA 3AAPA 3T5KA 2V6AA 2PIIA 3GL1A 2HBYB 3T6JA 2MZRA 4JI4J 4Y3CA 1WTBA 4IYQA 3HCXA 4O8UA 2MKYA 3DDKA 1N34K 4PG8A 2L41A 2PC6A 1Y00A 1VQYA 4Q2LA 2D9PA 3I5AA 4PG5A 2Y9HA 3VA3A 5CHCB 2F8MA 4FKYA 1NJXA 3H20A 2HB5A 3L4IA 1RAFB 4QYZJ 4K4UA 3PRDA 2E2QA 4JV5F 4BHQA 3EJMA 1WSFA 3MMJA 2HVIA 4RW7B 2BVZA 4RW7A 4B3SF 4YB5A 1F9EB 5AQWA 1CJKB 2ZE2B 5L1KA 1C2PA 3NCQA 3POTB 2W1BA 3K59A 2BJ3A 2HFUA 4FXDA 4CLZA 2AJFE 4CRJA 2YNIB 4QZVB 4PWUA 4JI5J 2Q6CA 4NLUA 3TA0A 5D3GA 5DLGA 4NZ0A 3WC2A 2IM1A 3OA9A 4N56A 2M8DB 4I69A 1VSEA 2YNHB 4AF1A 1K0VA 5HO4A 2OPRB 1FA0A 1D4XA 2MTLA 3LP2B 2CQ1A 2QN6B 3B8HA 4CFBA 4QIFA 4WXOA 3W60A 2IYIA 4BC4A 1P9YA 3IBWA 1RDWX 3LWMA 3MK6A 2YY3A 5KFOA 1YJWS 4MIWA 1U09A 2OPQB 2X1AA 5E3PA 3CD5A 4X4TA 3OL7A 3PNIA 2YKAA 2YQ1A 1WOQA 3AB2B 2EPIA 1FI4A 2XI3A 1ZBUA 3VF0B 1W97L 2CPYA 1C1BA 4RU9A 2DFFA 4OYXA 2IJRA 4OI1A 4NXNJ 3NOGA 4ELVA 4LBIA 4EZ6A 1Y3KA 3WDOA 3I4HX 1C1AA 4I68A 2W9CB 1M1KT 2Z2MA 1Q78A 2P9IA 1FT8A 4FNHA 2W4DA 1HWIA 1T9YA 2L9WA 4RNHA 2YKMB 5I3UA 1TP7A 2ZZTA 3J81O 1HI0P 2CJKA 2HF3A 3MECB 2N82B 1Z25A 1X5PA 4BRNA 2FXUA 3ZT2A 4EAHD 2PZSA 3AGRA 5E2QA 3EKUA 1WJ9A 2K1RA 1BCOA 2GAGC 1SQKA 2YX7A 1FJGK 1OWXA 5IT9O 4NCAA 1L3UA 1IN0A 3NWRA 2R8HA 2HZAA 5B0BA 2XY6A 3D5MA 3N01A 3A0IX 4CJWA 3BR8A 4OQJA 2DGXA 3IRWP 3OW2M 4FYXB 5JJBA 1RBVA 4ZCIA 5D4NA 5LJVA 4NRUA 2WVCA 4OPKA 4URGA 2V2QA 1RGVA 3H8YA 4FJ5A 4ZVSB 2JJ4D 4FCYA 4CJVA 3CJBA 1JL2A 2BGGA 4HHUA 3OBWA 4V1Ak 4PYDA 3MDQA 4TKTA 4E7JA 1F5BA 3NNCA 3O6WA 3PKMA 2IC3A 2NUUG 4W5OA 3D7EO 5LXYA 1LEOA 4A47A 2WW8A 4UOFA 4K8ZA 3R6GB 2CKWA 1HPZA 4H4KA 4U7UK 4FM1A 4M5DB 4CH1A 1JLGA 3VEXA 3CCZA 3W9IA 1HD1A 2F3JA 1UOCA 1NBEB 3GE1A 2EKNA 2DYAA 3AOAA 3RZAA 2FJDB 4DR1F 3GQCA 2B7BB 2GJFA 1YZ6A 2G0CA 3O4WA 1RP5A 4K4YA 1YF5L 2OUGA 1S1UB 4JI8F 3HHNB 4LFCJ 3Q24A 2PY5A 3UDEA 2VHGA 4UOHA 1RGIA 3CWJA 3LH2S 1LKZA 2QFIA 3DI6B 4PYAA 3CQXA 3BN4A 4HH1A 3HOTA 2CQGA 4EBEA 4PR6A 4I64A 4C11B 3RU0A 2X74A 5D8HB 3R3LA 3OTOK 2H4WB 3L4QA 3W7BA 2FHOB 4OZLA 2LVWA 2VFVA 3ENHA 4MJKA 1YXQA 1NUEA 1VOMA 3MN9A 4CJ5A 1RBTA 4EI2A 2GTDA 1RBRA 4YOXA 4BREA 2AA4A 1VLYA 1W2BM 1FEHA 4B8CA 1T0TV 2ERRA 3BYRA 4NLBA 4FOIA 4YOUA 4I4BA 5F3ZA 3HHDA 3DHXA 2F8TA 4DG1A 1IH7A 5HBMA 4GVEA 1YWXA 1RK8A 2OI2A 3CD0A 3JSMB 1S6UA 4CO0A 2RF2B 3ATUA 3OTDA 2DTJA 4NO7A 4URQU 1EWRA 2BRLA 2Z56B 3G6EN 2RKIA 4HDHA 2G8FA 3I0SB 2HMIB 1NJIT 4B9SA 1C1CB 3H5YA 3SUNA 2F7TA 2RHQB 2H54B 5K20B 2VUGA 3BF1A 3IMQJ 5M2UA 5FD1A 1MW7A 3QEPA 4GMKA 2R8GA 3A3NB 4KHQA 3J8AA 4NEYA 2WZ1A 4CT9A 2MZQA 4A2BA 2WBNA 3MMAA 3NGTA 4ILJA 1WKJA 2E66A 3QESA 5KT3A 1OH7A 3EE9A 4IJAA 4X66J 5IT4A 1BC6A 3GSDA 1TUYA 5ETKA 3ZEUB 1Q5VA 2BR0A 3CJ0A 1C6VA 4ZLNA 3H2VE 3FRZA 1JKHA 3LF0A 5HLFB 2F7VA 3CCLN 1HBUB 5M1OA 4CM2A 5M2RA 3DRXA 4LH5A 1ZM2A 4B9TA 2C3YA 4Y34A 4NCGA 3HP6A 5AXLA 4DOZA 3KG1A 1RXOB 5HVHA 4KH5A 4LBHA 3VQBA 4J2EA 5BPMA 1G1XA 2R4FA 3O3FA 1VRTB 1HQ2A 4EIAA 5CYMB 2A2CA 3QWPA 4DTOA 3M05A 1SC6A 3TJ8A 5T7LA 4IRDA 1RWWB 1T9XA 4PXEA 4LRCA 3J7A1 3CGIA 2BE2A 4IQMA 2VG5A 4A5AA 4F36A 4EYHB 5KT6A 2NYHA 4B08A 1YRUA 3H25A 2ZJQL 2YWHA 2E2OA 2KT5A 1KHWA 3DLKA 2ZHBA 2Q1LA 4TVAB 1RABB 4B8AB 2MQMA 1Q8KA 1M5OC 1BI4B 1PBUA 4DTXA 3D2EB 4CLWA 1BQNB 3ZETA 4KFBB 1H2TZ 1KXPA 5B0AA 1DZ5A 1ESVA 2HWHA 2VA3A 4NE9C 5BRFA 2BMBA 4XH5A 3BB5A 1XMQJ 3SUQA 5HMXA 2ZH2A 4DV5F 3C8YA 2JVRA 2UXBK 3CCLS 3DLEA 1HQEA 3OBYA 5F8JA 2P9IB 1VQPS 3OSPA 3H1VX 2W2PP 1S9EA 4CJ7A 3A1YG 1NGIA 5AZIA 5I3UB 2K2PA 2G1HA 5SWMA 3I82A 4DS4A 1VQ6S 3B6OA 1RT6B 3M8YA 3BREA 3I9ZA 2OD6A 4AT1B 2GMLA 4HTLA 1QE1A 4DSEA 2RH3A 3H3NO 1RHQB 2BH1A 2YWKA 4IO9L 2B6AA 1HHQA 1SIZA 1MMLA 3HFKA 5KTQA 3OR1B 1YIJN 2N7CA 1JLQA 3BYPA 3H98A 2DNNA 5AQTA 1MWKA 5CYQA 3QBWA 1BOTO 4M8LA 5G0RB 3LP0B 5CHIA 1V6HA 3CC2S 2IVMA 2JZ5A 2B3TB 4V19X 1G3OA 3TVYA 4OLAA 2UUAF 4Y2CA 2XMJA 4IRKA 1CS4B 3UIQA 3SBMA 3C46A 4B3SJ 4CGIA 3PIOQ 3TQ1A 4AYBD 5EU7A 1X3NA 4DR4F 3WHIA 3RB6A 3T7ZA 4WFXA 2VBWA 3N4PA 2IAJB 2V34A 2LXUA 2AYMA 3L3UA 3J7AP 3CFRA 1FJGF 1O13A 4EFAC 3V9XA 1S1VB 3F9KA 2L08A 4M63A 4P2MA 1X0PA 3PIPQ 1WI6A 1NK0A 4YMEA 2OMLA 1N8RO 5DETA 3VQTA 3CPWR 1YIJS 1EB0A 1RBLA 3FSIA 1B0PA 2FBYA 3AJ2A 2W25A 3MWTA 1VQ7N 2WFBA 4DFJA 1S76D 4M1KA 4JKEA 3POTA 1IR2A 5CZ1A 2QSFA 3RMCA 2YX6A 3CJAA 3CC2N 3H2UB 4QWEA 3IP0A 1U1NA 3JS9A 5C7PA 3WIUA 3O5TB 3IG1B 2I9SA 5I4MA 4RR5A 2EFOA 5H1SV 2PDAA 3HVTA 2KXNB 1W2IA 2EFVA 3QEIA 1RHMB 1YUWA 1O51A 3KLEA 4ZVGA 3QT8A 1NSKL 3M2RB 3LM9A 4ER8A 3M8ZA 1S77D 3AA4A 2RPIA 1XQSC 3UD5A 2KJWA 5AQJA 4DV2J 2M4MA 5HVGA 5F41A 2IDOA 1KBRA 3L7OA 4ZIWA 2QIFA 4K41A 3NOCA 2LEAA 3ET6A 5AQRA 3TUPA 2FC8A 3M1FA 1X7VA 4DV6K 4DEZA 1N5YA 2ILYA 1N88A 3ZLJA 1QSSA 2E1RA 4LF8K 4YFUA 2D3ZA 1G7CB 2FVSA 2VYPA 2ZH7A 1S0OA 4EO6A 4JD2B 2VPWB 2BJ7A 5F0UA 1HHTP 2HHPA 2QA2A 2IFXA 4HCBA 4NLPA 2RE2A 2O3DA 3TZWA 3WQTA 3SMZA 1RAIB 3IO1A 1HNZJ 2C3MA 3V9WA 3VTHA 3A5LC 1OKJA 4IFYA 1VQNS 4IO9Q 1AFIA 1C1CA 3BGUA 2QWMA 5F8LA 4BRPA 2K1RB 2J9DE 4KV8A 5HJXA 1VIXA 2KG1A 1W0HA 4CYUA 3E01B 3CJ8A 4CF2A 3E01A 1VLOA 1RAAB 2DH7A 3QEVA 4JKBA 4P7TA 1BY9A 4JKDA 3D3BJ 4J9RA 5HOOA 4MAKA 4O55A 2GC8A 3C3LA 1HWJA 1BXNA 5IM0A 1Y64A 4OV6A 4DL3A 5DG9A 4NXMK 2BKNA 3DOMB 2ATCB 4OZ1A 3I56N 3OYNA 1M90O 1SV5B 4S0MA 1LFWA 3A3PB 2D0CA 4DCJB 4H0PA 2DNMA 4M63C 3HHLB 5DG8A 2I1RA 3HHLA 2VD3A 3TU5A 3MCPA 3VESA 1VSHA 3MX2A 4H4MA 4NLSA 4EHTA 3R5GA 3KK1A 2EXUA 3OTOF 2OPPA 1EP4B 1UFKA 4P72A 1Y11A 3L2WA 1SPBP 4RW6A 2FLNA 1AA1B 3K57A 1URNA 3OFFA 1GLBG 3OXLA 4BWMA 1YVUA 3SI8A 5HATA 1UVJA 1S4FA 4NLYA 1LW2B 4QR0A 1JLCB 5EGYA 3KLFA 3CJKB 2O67A 2VH7A 5LMNJ 2WSFC 2DBBA 4X4VA 4DTPA 2KYZA 4M5JA 4X4PA 3SQ0A 3DLRA 3HHLD 2Z1IA 3QGPA 5MLCQ 1YK9A 4G3IA 3UCGA 4NRTA 4TXSA 4YB1P 1VSDA 3OXGA 4FK4A 2AV5A 1D8ZA 3RR7A 1B3TA 3GDQA 5C0YA 1BE4A 5FDLA 3K5PA 5A6WA 3OFHA 4CK2A 3MFHA 3I55N 2Y0BB 2MSTA 1WG5A 5AE3A 4ZN3A 2JLFA 4O8KA 5DDQC 2P9UA 1GX5A 5BREA 1CULB 3DYAA 4QWBA 3C6UA 3GPAA 4AD6A 1WI8A 4ZVHA 3ULHA 2SXLA 1KQSM 1AZSB 1QD1A 5A8RA 3TANA 3NBPB 3J80O 1FO1A 4ZKAA 4EEYA 3VEVA 4C3MA 4ID1A 1QVGM 1TL4A 4UUWA 2GQQA 5E26A 2DRBA 2JEGA 4JOUA 2XRIA 3O08A 1DQAA 4LSNA 4FVCA 3MPVA 2Z1JA 5CZVA 2FVQA 3CCSN 3OVSA 3BGLA 3I6PA 2B7CB 4JNEA 3OYMA 1HNZK 4B3RF 4E7KA 2O01C 1YTAA 1HNWK 3LM2A 4AXJA 2XYPB 3GFXA 3C14A 4YOVA 4UTGA 2DNGA 3PR5B 3O5BA 2D41A 2R9LA 2Z58B 4FNIA 2R7VA 1X9MA 3DRSA 3MHYA 1YJ7A 2EEYA 5AXNA 2CJBA 1E4GT 2Z30B 1UPPA 1HHSA 1IBCB 4KKOA 5AQZA 4KKOB 1D5AA 4DV0K 3RW6A 3UDCA 5HRRA 4MLEA 5IV4A 3M2VA 1TTHB 3BY5A 3M30B 3DLLL 1X5OA 2Y3YA 1HRHA 4O4GA 3QNWB 5ETRA 3GTYX 1Y3JA 2KFNA 2OYQA 4J9UE 2QA4S 3P5TL 2G2YA 2VU5A 4QW8A 4C8YA 4YDUA 1AUDA 5ADZA 5IC6B 2UXDK 2HLUA 2X3GA 3J7YP 4JI8J 4QPTA 3H5SA 2VB6A 4DL5A 2VWBA 4KJIA 4CCHA 2NYIA 3D2FA 4J2DA 1JXLA 3MM9A 3F2KA 3D67A 2P9LA 2WVFA 2BZ2A 3KUGA 3GG4A 3OFGA 3IAS9 1UMJA 4DU7A 1CZAN 2FYXA 3CCEN 3QO9B 5JS1A 4OI2A 3CJRA 2E9RX 4FK0A 3V6KA 5CYJA 4ZS6A 4LBPA 3M9NB 5A0YA 1QHAA 5A0YB 5GADI 4YB6A 3K17A 4LF1A 4GV6A 4IR1A 4KBOA 1JIHA 1KP6A 4IUFA 3OR2A 3OR2B 3EGVA 3WNFA 3W0LA 1QVFR 2FSKA 2ASMA 3W2WB 1OY6A 2QRRA 1QAXA 4E89A 3AVGA 4YORA 2QA4N 1ROFA 2PA8D 4O3SA 3NNAA 1TMJA 4RX6A 2CJ9A 4CJTA 2E5GA 1N33J 3AVAA 4KAIA 4DUYJ 2KM8C 2B43A 3OTCA 2FLLA 3N79A 3QJJA 5L8RC 1WSEA 2RT3A 4H5VA 4JI4F 2VFUA 2EFQA 4ZPWR 3AO3A 2BDPA 3DLEB 3QGGA 3IXQA 4A8OA 1LW0A 3VAKA 2XYGB 5CE3A 2YNFA 5D6GA 3GIMA 1NPRA 1SJRA 2EBEA 2DGTA 1RDUA 2BANB 2HBKA 5DDPC 2CDRB 4KHYA 2YKMA 2YWWA 2VF3A 3Q8QB 4IQXA 2VC0A 3S01A 4LFBF 2E29A 5HJYA 4GO7X 1ASWA 5JICA 5AQFA 3CCTA 2DGWA 3DLLQ 3UDVA 4ED1A 2XWYA 4Z4GA 5KFAA 3W63A 2XM3A 5KFZA 4EU0A 3QPIA 4FF3A 1K8KB 1R31A 4LVOP 5AJ3K 4G1QB 3F5TA 3MXIA 1N5SA 2DPNA 4BDZA 3MPDA 5H9EK 3CJ7A 2JH3A 4P71A 4DL4A 3US5A 2MLYA 4DB3A 4FM2A 1KWMA 4DR6J 1XR6A 3KWGA 3N5BA 2KL8A 4CO3A 1S3XA 5CYQB 2FHJA 1SJ1A 3PO4A 5A2QY 3NGIA 5C25A 2U2FA 1CC7A 3H42A 3HSJA 3HT0A 1FJCA 2J8SA 3EDQB 2K7JA 5I3PA 1OY9A 1UW4A 2ASJA 3HSDA 2MHNA 1VQ8N 1HR0J 1IBMK 2MLXA 2R2TA 4R0EA 5J2PA 2AYGA 3ALYA 2QXFA 4BQZA 3VTIA 3Q8VA 1TFWA 5BXIA 1J5EK 3AT1B 5B8HA 3U9DA 5FIIA 2W24A 2OEJA 4Z94A 4EZ9A 1YJNN 1KD1O 3MPYA 1LWEB 4KH6A 1U1RA 2E44A 3IKMA 1RT1B 5L1IA 4JUZA 5LSRA 5LM7E 2YWGA 2HFZA 2GHPA 1SBRA 3ZZZA 1GOAA 1RQ0A 1N0VC 1KONA 2DNHA 4IH5A 1AFJA 1CZBA 1S7HA 4UQTA 1VDHA 1P1LA 2M3DA 4YR0A 3C66A 1T9WA 4ILLA 3BZCA 4UZCA 1TUVA 2HNYB 3SQGA 2FSNA 4AHSA 4DCOB 5GAGI 3NF8A 1BUXA 4QIEA 2JFDA 3VQDA 3AXKA 5KG3A 5L1JA 1VYAA 3ZTQA 3HVTB 3BM7A 1U26A 2F4VK 4LF6F 4GKKF 1YTUA 3DRPB 3PHTA 1VMBA 1KC8T 2ZM6J 2ALYB 3G2XA 3DN9A 1DFDA 5I42A 1UFLA 2NRVA 3G82A 3S6EA 3O1BA 2CFXA 4AM6A 3TZXA 1KVJA 1TKTA 2XZWA 2C2OB 1FW6A 3GILA 1RYRA 4CZCA 2OANA 5BPNA 3TTFA 1VQ4N 2IM3A 4ELTA 4AHVA 4DSLA 1W9HA 4G1PA 5C5JA 1N32K 3UNGC 3DLBA 4E7LA 3D6HB 1UJ5A 5DQGA 3V1OA 1OQ3A 2KO1A 3SIPB 1IKVB 1UA1A 2A10A 3WT0A 4LR8A 1BWFO 3LP1B 2X1GA 4CEBA 3R1HA 4Y2IA 4QR1A 3TZZA 4L73A 2OPSB 3IRXB 3U1MA 4CD1A 3PFEA 1P90A 3G6YA 4C8NA 5HVFA 3Q8UA 4C0OC 2XY5A 1F1BB 3ZTRA 1YI2S 5HMYA 4ENOA 3EM1A 1XNQJ 2I7NA 3DDIA 3SPYA 2KW4A 3M2UB 4FP9A 1NK4A 5DJBA 4CIFA 1T02A 3MURP 4IKAA 2P5VA 3F9MA 3M8SA 1PKUA 4RJVA 4G65A 3MMAB 3BDPA 4FLWA 2QX0A 4CLPA 3VENA 2JGUA 3GCWP 3HLUA 1FRLA 1T9UA 1YBUA 3HJVA 2CPIA 4Z4FA 4WU2A 1TAQA 4Y0WA 4Q43A 3E2EA 2PN6A 2O8FB 3FCWA 1ZETA 2MJUA 4C3KA 4C7QA 2WUSA 1VQ4S 1YJVA 1UVKA 5CCLA 3SPZA 2P5OA 1HNZF 3AB4B 3MXJA 2W2MP 1KTQA 3UFCX 1U0HA 2CJYB 1HR0F 3R7NB 4X62J 2MB0B 1WC3A 2FQQB 1XEZA 1UA0A 2LLZA 1C0FA 3QGHA 4V19S 3T69A 2VWKA 5FRNA 4RW6B 5IZHA 3W3DA 1KEKA 5AQUA 1Q9XA 2F4FA 3T6BA 3ICLA 2BE2B 5KFIA 1V5VA 1XQIA 3WC0A 2OTLS 3CJKA 1S1XA 5AZJB 4TNOA 3T9ZA 1YJ9N 1HNIB 2A1SA 1HPZB 2B56A 1HNXJ 5HP1A 1JJCB 3Q22A 5D78A 1L3KA 3CJ4A 4TYBA 2MZJA 3L8BA 2PMHA 3AD7C 3AO2A 3GCXP 2EG2A 3UNYA 3CDBA 1ZBSA 3KWMA 3RR8A 1EIYB 5U47A 1U04A 3LUYA 4NLGA 3LTOA 3AD9C 4WP9A 3GYNA 1J27A 4FLVA 4FXWA 2WOMB 3SQOP 2HS0A 1B9DA 2HQGA 1H74A 4F04B 4OJHA 3KZBA 4PEOA 4BRHA 4DV1K 3J7AN 3CCJN 2XSJB 4C4WA 1QDUB 2LXFA 2CPZA 1JCFA 3UKUB 1S12A 4J91A 1MU2B 3JYTA 2R2SA 2HMPA 4RW8A 3IR6B 2D3O1 1NHKL 4F4WA 4B3MK 1RTDB 1RT7B 3ZZ0A 3IC1A 2A2DA 2HFSA 3A5NC 3ZTPA 1UJ6A 4DUYF 4RUHA 4JV1A 4TLRA 2IA6A 2AJ1A 3VA0A 4M3UA 1N32J 4XK8C 4DV4K 3SBTA 4K43A 2DNRA 2ATLA 1KD1T 2V7YA 1WUAA 1KS2A 3ZZOA 4BR7A 1ZM9A 4CO5A 1XNRF 1ZC6A 4IO1A 2Q97A 3E9LA 4GO5X 3J7Z5 3VQ4A 2IRUA 4DR3F 4F02A 4PQUB 1TKZA 4Y1DA 3J80Y 3MWPA 4DSFA 4ZHRA 3UD3P 2W2OP 1LXNA 3V1QA 2Z2ZA 3A8YA 3VALA 1IBKK 1L3TA 2QTWA 5T14A 4NYOA 4BRQA 3CJ9A 2GVDB 3AJDA 2AGPA 3MTJA 2QWOA 3O9SA 4KHWA 1ZBIA 2V8PA 3OL6A 3S1TA 3W9JA 5T7BA 1N5QA 2VFSA 3JSBA 3CCJS 3CD6S 1TVRA 3D54A 5TKWA 3AVFA 4O5BA 3CULA 3KLHB 1H2VZ 4B3TK 3KLGB 1X4FA 3S8SA 4LR9A 3CEDA 4WWSA 2UU9K 5M1NA 2ZOFA 1RJJA 1D09B 5JXSA 1CLQA 1CZ9A 1ATSA 5AQVA 3HF5A 1H98A 1VQOS 4K4ZA 3HK2A 3D2FB 1CJUB 4ED6A 2HBRB 3PV8A 4JK8A 1CJVA 4DN9A 3KK2A 2QT7A 1RT1A 5B0EA 4F67A 1IVZA 3GBTA 1VHXA 2AGOA 2CGLA 2JSXA 2NZTA 3PEHA 3EEQA 4JI4K 2PGCA 3M4XA 2ZGZA 4FWNA 4OI0A 4KPYA 2CGJA 3J80U 4QIVA 1Y10A 3G87A 3E9OA 3R3TA 2MKIA 3RB3A 4K25A 2P5GA 2PYJA 1FE4A 4X64K 3IM8A 2ZF5O 4MIBA 3FE1A 5JVGQ 4RWXA 3W64A 1VQ5S 4JBCA 4CEZA 4LRDA 3RB4A 3CD6N 5C10A 1DEJA 1FNXH 1D8YA 5AQYA 3QGIA 4I1TA 1S6OA 4DDFA 3M7VA 4F4AA 2HAIA 5JMNA 3ZX2A 1KQFB 3H3OB 1BLUA 3LZJA 4DR4J 2ATQA 4DV1J 4IZ9A 3ZZRA 2HRYA 3OHRA 1W26A 3LL3A 4U7BA 1AROP 4CJUA 4C8ZA 3W66A 2VQEK 2LXIA 1BQNA 4ZJQA 4BRLA 4LF5K 3QIPA 3LOUA 4FLTA 3HPGA 3V6DA 4DTJA 4BVOA 2GGPB 1B99A 4MQ3A 3ZZTA 2WB1D 3V1RA 3AVCA 1WC5A 2AJ4A 4OX7A 3HD1A 6AT1B 5K14B 1NMEB 3PYDA 1E4FT 4IOCQ 1LNQA 1XMOF 3S41A 2LQ9A 3TUIC 5DM6L 4UOCA 1HQUB 3ZCMA 1TFYA 2E1ZA 4ED2A 4CD3A 3C6AA 3A8KA 2QLJB 1VQ5N 4PPZA 1FNMA 2XZDB 4NLOA 3NAHA 3M2UA 4DPXA 2G0JA 1FDDA 1SUQB 1SH0A 3SV3A 4PL7A 1U47A 3CJ3A 5KFNA 4OX9J 4OGEA 4OHVA 1BO5O 3B4DA 3O6QA 1VQ7S 4ZTFA 1OVYA 3O8WA 2XG8A 4FBUA 1GH8A 3L7UA 3NL0A 1VSLA 4YR2A 1P6TA 2VQFF 3T5JA 4ED5A 5J2MB 2HFNA 1S1TB 4NLRA 5G4DA 3CC4N 3FRYA 3OYGA 2R7SA 2DR7A 2DGVA 2MPUA 3M32B 3MEGB 1K6YA 4C1NI 1NK6A 1YVNA 1C4AA 1FRJA 5CH7B 1NJYA 4C11A 2BEFA 3VERA 2QMWA 4M3WA 4B3RJ 3CIZA 1FDNA 1Q9YA 4LF8F 3ID8A 4NASA 2FPHX 4WP8A 3UVJA 2LECA 2V8HA 1BWVA 3M3ZA 1JJ2R 4OIXA 4PHTX 1J54A 2E1MC 4F2SA 4FPIA 4XTTA 3O9TA 1R8AA 2CNKB 3CERA 3UN3A 3CXCR 2V68A 5JUMA 3AA5X 3PX0A 2LFVA 4HYKA 4XO0A 4I6MB 4DG1B 5C2DA 5HBMB 5J2NA 3KWIA 2W01A 4X64J 2N4DA 3SDEB 1S49A 4N77A 2OIHA 3MM6A 4JI7J 4Y2KA 2VA2A 3CNQP 1V3RA 5BJRA 1FK9B 4DMZA 4I6WA 2QL9B 1NXIA 1RCOB 1FRKA 2BQUA 4B1WB 4CECA 4BR5A 1Q1KA 2BKPA 4FOEA 1VS3A 4OFZA 2IOCA 3CC4S 4ZCLA 1KC8O 5FDLB 3D6TB 4KO0B 4ECXA 4Q0BA 2XQCA 4KGVB 2DB1A 4ZP8A 5A6PA 4PCQA 4BE1A 4L3KA 3HVRA 3JYTB 1KFSA 4BR0A 2KT3A 5FLXO 2W9AA 2P9UB 2V4QA 3AVIA 4P2FA 4CGGA 4CJRA 2VQEJ 5F3TA 3S7RA 4ANEA 2J0QD 1U1LA 5HI7A 4F4ZA 3NY0A 3QFUA 2GWKA 1RSCA 1MMDA 1OIAA 2HURA 5GAEU 4FW1A 1NKCA 2X78A 3CJ2A 4YR3A 5A8RB 1PAEX 2IA0A 1VSMA 4IXCA 3O4QA 2C2MB 4W98A 1FXRA 2DXDA 3OS1A 5KT2A 3QAUA 3Q8RB 4M3RA 3EZ5A 1CJTB 4GRSA 4KRWA 3IM9A 5HL7Q 4LH4A 4RW4B 2CPJA 4OYWA 5THWA 5C15A 3EGZA 2HGLA 3FQLA 2G2OA 6FDRA 3HSTB 4HHHA 4DF4A 2FDNA 4BR4A 3CO0P 3TSUA 3P38A 5D0RA 4DV1F 5IOLA 3I4PA 4PWDA 1YLXA 1HARA 5B0DA 5BR8J 4CZLA 2RIJA 1T3OA 4DR5J 1RT3A 2GEMA 2PO4A 3K9KA 1R27B 4ED7A 4CFCA 1Y7PA 3NDKA 5HANA 4ZP7A 5GMEA 1M5KC 4EGLA 3WXJA 3HHLC 4DCPB 1U1OA 3MM8A 3ZFVA 4ZPVR 4KV8B 4BC7A 3MM8B 5B0FA 3ITHB 3V6JA 1FRMA 3A12A 3OD2A 3AVJA 4Z7YA 3C2PA 2HS3A 4DX8H 4MK9A 2DIUA 4JV5J 2PFFB 1NDLA 1N56A 1NOZA 3NGSA 2HSTA 4PKGA 3O9UA 1MWQA 3BKFA 3IGVA 3I55S 5L1LA 1HKAA 2B4VA 2E6MA 4LF9K 4AFFA 2ZKTA 5J1NA 4JI6F 1U6FA 5DGBA 2KZZA 1XJWB 1QJHA 3CSKA 5AZIB 2ZDPA 1BL3A 1TYQB 2QWLA 3O3HA 2BOPA 3N5FA 4WBFA 1SV5A 3CTRA 3QO9A 4PAAA 2B5JA 5ETOA 2JWLA 2WRMA 2C28A 2DTUA 1B4SA 5A76A 4IDKB 1N34J 2IHR1 4O0NA 2R7UA 2YHAA 1GT8A 5HROB 2JWNA 2CWXA 2RB7A 3HZGA 2HVEA 3SCKE 1SVDA 4CHQA 1PBAA 4JI7K 3E3XA 2R42A 1N34F 2VJVA 5J2QA 2A6AA 2KH9A 3NGZA 2W7OA 3FBFA 3H4DA 2F8EX 2EVZA 3VAFA 1EQMA 5G0RA 3RUBL 1ASVA 1JLFA 3OYAA 5HRNA 4ES2A 2CQCA 4KREA 2BXJA 3CJ1A 1T3VA 3P96A 3TW0A 3P4UB 1IXKA 4DV3J 3BDEA 1JJ2M 1BWEA 3FSYA 5ETSA 3RVCA 3W1YC 4OHYA 4CIGA 5IXUA 4BCAA 1P1TA 2LEBA 1KCFA 3AVLA 3I32A 4L75A 3KG0A 2NRZA 2UUWA 3JAMU 2AX1A 2ZVSA 2XSJA 3OYHA 4X64F 4QWCA 2DT9A 3KJNB 4WJBA 2IMOA 4E0DA 4DQPA 1U8WA 4R5PB 1D0EA 3QMLA 1NHUA 2UUCF 3RBXA 1N0UA 1XR7A 2UU9F 2GELA 4KYZA 1RTDA <