3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
1WSGA 1SV5B 4K4TA 4ZHRB 4JS4A 4O4GB 2F8EX 3NH2A 4KI4A 1SKRA 3AO4A 2W9CA 3HVWA 3LP1B 3OYFA 2HNZB 4CEQA 4Y34A 1DTQA 4KE5A 4K4YA 4DTPA 1ASVA 2HHVA 2FBVA 1S9EB 2HMIA 3RMBA 4GMJB 3QEIA 1ASUA 5EWEA 1SH3A 1S1VB 3TAGA 3KHGA 3P1GA 3L2VA 4CIGA 5C24B 2BDPA 5KG2A 4CHOA 4G1QA 4IFYA 1N5YB 3L2WA 2ETJA 3ZSOA 4O0IA 4ECYA 5F8JA 1XI1A 4KREA 1C1BB 1NK6A 3QO9A 1TK0A 1LWCA 5JUMA 3PR5B 2B43A 2X78A 4RNMA 2V4RA 2WONB 4E7LA 3QO9B 4RNFA 1RBTA 1C1BA 2KW4A 3LPUA 1JL1A 4DL6A 4IG0A 3SJJA 4DSLA 3QETA 1KFDA 3KNAA 3K2PA 4CHPA 3FQKA 3KLVA 4ZMMA 5F8NA 2XRIA 3DLKB 4OPKA 4AH9A 2R2TA 5KFXA 1X9SA 3I0SB 4NLSA 3WNFA 3OYGA 1JXLA 3MEGB 3TAQA 4ID5A 5KT5A 4FBTA 1DTQB 1C2PA 3KKSA 2HNZA 1QQCA 3LP1A 1KSPA 3HHKA 5EDWA 1JLCB 2WTFA 3IRXB 3V6DB 3IGNA 2JEGA 1LW0A 2G8KA 4CGJA 3PVXA 5KT6A 1HYVA 4OVLA 1RT2A 4DSIA 4O3NA 4Z4IA 4R8UB 3IS9B 4CJFA 4YNQA 4ECQA 4FJ7A 1RDRA 5I42A 1WNSA 4URSA 5KT4A 2XO7A 2XCPA 4KRFA 3QLHA 3DLRA 1A5XA 3DM2B 4M3UA 3S3MA 1Z4UA 4ED6A 3BGRA 3ITHB 2YNGB 4DSKA 4DL2A 5KGXA 1NK5A 1FKPA 3ZT2A 1T8EA 3VQDA 3OJSA 3QGHA 1D1UA 3V4IA 3NL0A 4DWIA 1BIUA 3CFRA 3FFIB 3RB6A 4MK9A 1XR7A 2YKNA 2OPQA 3RAQA 4CK1A 4PUOB 4CEOA 3D0PA 4ECSA 5EUHA 4EYIB 1MU2B 1S1UA 1VRTB 3N6LA 1TV6B 4NLTA 4AHRA 3L2UA 4H8KA 4CJTA 1NKCA 1RT7B 5HP1B 1SUQB 1TVRB 3NAEA 4H4MB 1JLBB 4IDKB 4MK7A 2QK9A 3TAMB 4JUZA 4FLTA 2UVRA 5CYMB 5KRTA 1K1QA 2OPRB 4EEYA 4F4ZA 4F2RA 4Y2CA 4CJKA 1S6QA 4U7CA 3DI6A 4DTJA 4TY8B 4K8ZA 3PO5A 2PYJA 3EYZA 5KFLA 3GQCA 3I5AA 2W8KA 3V9ZA 3PW2A 5D3GB 4LQ9A 3LP3A 4M3RA 1HPZA 4ZVEA 1XHXA 2IOCA 3HVTB 3PW4A 4OLBA 3OL9A 5KFDA 4MK8A 3F73A 1NOYA 2AGPA 3SYZA 4CJLA 1S48A 4NCAA 2ATQA 4CJVA 2ZKUA 1DLOB 5KFHA 1HPZB 1T7PA 2AX1A 1KFSA 3IG1A 3O3GA 3C6TA 1TKXB 4TY8A 3AVKA 3SNNA 2R8JA 5T14A 2VWKA 2D0CA 3JSMB 4FBUA 1RA7A 2I1RA 4C8MA 3NCIA 4CEFA 4WZMA 3AO2A 2E9RX 2UVUA 4NLGA 4PA1A 3V9XA 2YHBA 1JLBA 3DRPB 4IDKA 5DGAA 4BDPA 3CJ2A 1SUQA 4EZ9A 4RW6B 4DU3A 4C8OA 5F9LA 2X6NA 1QSSA 1QTMA 4URGA 4Q45A 4CK2A 3P83D 2XI3A 3LP2B 1VRUA 5J2QB 3CFPA 4BDYA 5KFMA 1TL1B 4GW6A 4C8KA 4TLRA 3OYJA 2J6SA 4PUOA 2IM3A 3HT3A 4WFYA 1SH2A 1GOCA 2OPQB 1SKWA 3CFOA 2VA2A 5KG0A 5DG8A 2ZE2A 3CQ8A 2C2DA 4AHSA 3HPGA 4HKQA 2IM2A 3PHEA 4KTQA 1UAXA 1IKYB 4UQGA 2G8IA 4LSNB 1RNHA 4CEBA 5KFNA 2YKMB 4BACA 1RTIA 4ZTFA 4BDZA 4M41A 1XC9A 3MFIA 4DU4A 1K1SA 4B9MA 2AU0A 3KOAA 1J9AA 5I3UA 3QLHB 4E7IA 3MR5A 1NHUA 1RBUA 1JXEA 1IM4A 3PW0A 3WNGA 3IS9A 4R8UA 4CIFA 4DL7A 3NFAA 1RBVA 4CJRA 4WXWA 4ZPCA 4EO6A 2C2EA 1X1PA 4E89A 3G86A 1TL1A 3DYAA 2JC0A 2DPJA 5KFJA 4NCBA 2IM1A 4NLVA 1Q9XA 1C0UA 5JS2A 4IRCA 3VA0A 1IG9A 3AV9A 3GYNA 4TXSA 4KBIA 1B9FA 4EBEA 3MEDA 2ALZA 1YTAA 4KTZA 3MEGA 1S97A 4OGCA 4RW7B 3I0SA 4IG3B 3KHRA 2AGQA 1TKXA 3C6TB 3NH1A 2IA6A 2P1JA 1QSYA 1NOZA 1I39A 4KSEB 3HM9A 1DLOA 1EX4A 2FJXA 4IKFA 2AQ4A 4B08A 4J9QA 4OPJA 1B9DA 1KVCA 4Y3CA 4RW4A 1TP7A 1BCMA 2ILYA 5DQGA 4CHNA 4WE1A 4OKJA 4E1NA 4FJHA 5DGBA 3KLHB 3K58A 1RTJA 3DLHA 4W5TA 1RDAA 3OYNA 5D3GA 1RCHA 1GOBA 3M9MB 1IKWA 3CG7A 1S1WA 4U6PA 3V9SA 3H4BA 1QHTA 1KVAA 3OVNA 1RT4B 4FS1A 3K57A 3ZSZA 1S1VA 3TAMA 1XWLA 2D41A 2HNDA 2E6LA 4E1MA 2FVCA 2DPIA 2BGGA 4FLYA 1L3TA 4CHQA 1REVB 2B5JB 1JIHA 3AVLA 2FLNA 3M8RA 4YQWA 1NKEA 1BQMA 1TV6A 4CJ4A 1N48A 4CFDA 3VQBA 2EHGA 4Y1DA 3G6XA 5KFQA 4LD0A 3AVCA 4O4GA 2W9AA 4B9TA 3MECA 1RT5A 1ITGA 1S9FA 1NK7A 4CGFA 4DTXA 3SUQA 4YR2A 3IGVA 3H5SA 1VSHA 4DEZA 4DQRA 4F8RA 1N6QA 1G15A 1FKPB 3AO3A 1VSLA 4KI6A 1HNVA 4ECRA 2HHTA 1SL0A 3ZSWA 4Z4HA 4ED3A 5DK5A 2KZZA 5DLGA 2BE2A 5JS1A 4CGGA 2AJQA 2UVWA 1KHVA 5K14B 1S5JA 5CZ2A 4PQUB 1RT1B 2B6AA 1S0OA 2DTUA 4J2BA 3KLGA 4ICLA 4N56A 3M9NB 3PY8A 2OPSA 1RT2B 5DQHA 3OSPA 2VG7A 1LW0B 3QERA 3CJ5A 3RB4A 2G8FA 4CHYA 3V6DA 2AWZA 4K4ZA 3DLEB 1UA0A 1EP4B 1GX5A 3KK2B 4O3PA 3IAYA 2IDOA 3DLGA 1ASWA 1YTUA 4CF9A 4HCBA 4ZVFA 4F3OA 2Z1HA 4TQSA 3G6VA 4CJQA 2X74A 3C94A 1VSKA 3DLKA 3AVHA 1IO2A 1QE1B 2I5JB 3PW7A 4J2DA 4CGIA 4KFBB 1RT3A 2OZMA 4IFVB 5DQIA 4EZ6A 2V0NA 5KFYA 4I7FA 4FVMA 5JXSA 2WONA 4TYAA 3NGIA 3KK3A 3QESA 1LWCB 2WHOA 1S6PB 3OYBA 4XPEA 3SFGA 2FBXA 2XHBA 1N5YA 3RB3A 4FJ8A 4ZVGA 4DTOA 3N6NA 3CWJA 4NLXA 3Q8PB 5C24A 2E4LA 4CHZA 3ASMA 1RT6B 3H4DA 3EPGA 1EXQA 4MIBA 1CLQA 1JL2A 3PW5A 4HUGA 4DSJA 5L1KA 4XIUA 2HMIB 3AA4A 4BE0A 1S9EA 4DTUA 1A5WA 1ZBFA 4KO0A 4KHYA 1TQLA 4EO8A 4O0JA 3L2QA 3VQEA 4ZP6A 1KLNA 3TARA 3OYMA 2A1SA 1ZBHA 4B3OB 4QWBA 2JGUA 3V81B 1LWFA 4FLXA 2CKWA 3U3GA 3OYAA 1QAIA 4NRTA 3SUPA 4QWCA 5F8GA 4O4RA 3LWLA 3AA5X 2HB5A 3VA3A 3KJVA 1XR5A 1SKSA 3OYLA 2JEIA 3V1QA 4LQ3A 1RA6A 4YP3A 2C2RA 3VQ7A 3PJXA 2V9WA 5F9NA 5KT7A 3DLBA 2QE5A 3BDPA 3VQ4A 1LWEB 3H59A 4NYNA 1NJWA 1W9HA 2R2RA 1IKXB 4EBDA 4PWDB 1R0AA 2RF2A 1K6YA 4GVMA 2PYLA 1NK0A 2G8WA 3T5JA 3KD5E 3NGZA 4LSLB 3SUOA 4RUCA 3ALYA 3TAPA 2RPIA 3G10A 3MF5A 3RMDA 4ELUA 4MFBA 4DG1B 4IH7A 1XR6A 4I2PB 4FW2A 3OYEA 3O3FA 3SZ2A 4DQIA 1JLEA 1BI4A 3LANA 4N5SA 1D0EA 2ZQBA 3AO1A 4J9LA 2GIRA 1C1CB 4Q8EA 4KB0A 3DMJB 3NH0A 4OJRA 2QV6A 3NF9A 2WOMA 2QKKA 2VA3A 4Q0BA 3OL8A 4CJ5A 5FROA 1WNEA 5FDLB 3SPYA 1SH0A 4B9LA 4IRKA 4X2BA 3ZT0A 5KFOA 1TKTA 1NJXA 4F4YA 1LAVA 4FZZA 1JLQB 3OL6A 4I9QA 5CYQB 4ZPBA 3RTVA 1UWBB 5HRPA 4C8NA 1L3UA 2FBYA 3Q8SB 5HROA 4CFBA 1VSDA 4MQ3A 1S0MA 2QKBA 3K5OA 3Q8RB 2W7OA 3QNOA 4FJLA 4F2SA 4KV8A 5HBMB 4NCGB 4ECVA 4FZXC 4J9NA 4ZP9A 1F21A 3E01A 2IAJA 2YNIA 2D3UA 3QIDA 5F8LA 4FJIA 4M3TA 4CJPA 4DLGA 4YMEA 5J2NB 5J2MB 3U6FA 4E7KA 1WN7A 3OHBA 4K4WA 1Z26A 1GOAA 4CEZA 2A1RA 4FJ9A 2ATLA 2XCAA 2BANA 2YNFB 4CEDA 1TK8A 1C6VA 2RDJA 2W9BB 1LAWA 3KHLA 2Q3SA 4EP4A 2P51A 1UOCA 4CCHA 1T05A 2ASLA 4W5QA 2HHXA 1TKZA 3GV8B 1S9GB 3OYDA 4Y2AA 5KFEA 3GIJA 5J1EB 4WFZA 2R2SA 5KFFA 3H98A 1U09A 2OA8A 5EWGA 2O5DA 4CJSA 1S1XA 4K4SA 4JRQA 3GILA 3NF6A 5KFWA 4J9PA 4CFAA 3S3OA 2GIQA 1ZBLA 1WAFA 3KLFB 1ZYQA 1KLMB 2KFNA 3S3NA 3ZCMA 3ZSXA 3TVKA 3TQ1A 1T3NA 4L8RB 2CJQA 4EP5A 4M95A 2HNYB 4WXOA 3DRSB 3OYKA 4FYDA 3B6OA 4QWAA 2IBKA 2HWHA 4ZP8A 5L1IA 3TANA 2EC0A 1VK0A 3H5YA 4PY5A 5EWFA 3TAEA 2VG6A 4G3IA 1JLFB 1S0NA 5HRRA 2BQ3A 4QCLA 2RKIB 5KI6A 3OSNA 1BCOA 1HRHA 1KRPA 4KAZA 1HQEA 3PO4A 2YHAA 1HNIA 4JV1A 4JLHA 4CFCA 3RR8A 3OHAA 1JLGB 2O4IA 5KT2A 4R5PB 4I9LA 4AHUA 1UA1A 1JKHB 4IOBA 2F8TA 2AX0A 3H08A 2O4GA 3T1AA 1NK9A 3V6KA 3MEEA 2XC9A 2JC1A 3OS0A 3HP6A 3KK1B 4NLYA 4ZP7A 3CM6A 1IH7A 2GBZA 1JKHA 1BGXT 5SWMA 1ZBIA 4YFUA 4M3XA 4O55A 4NLRA 2BRKA 4R0EA 1FK9A 4ZPAA 4B9VA 3D45A 3LWMA 5CZ1A 2KZMA 2C22A 3VQQA 1KCFA 4H4OA 3HYFA 2RKIA 1RAJA 4M45A 2FJVA 2VG5B 1T03A 3SI6A 3OL7A 4DU1A 4RW8B 5L9XA 3V6HA 3DRSA 1HARA 3FQLA 3V9WA 1EETA 1N4LA 2D3ZA 5KFTA 1OS5A 2IS3A 3LP0A 3CJ4A 1WLJA 3MR3A 2WRMA 1KLMA 4DFPA 4M42A 4FJMA 2Z1GA 5HLFA 4RNOA 5F8IA 3NBPB 1HYSB 3HO1A 1FKOA 3HSTB 3HK2A 3H5UA 3BSAA 1J54A 3FRZA 4Q8FA 4W5NA 4KPYA 3NHGA 3I8DA 4ID1A 1LW2B 3NDKA 5L1JA 1HQUB 2OPPA 3BQ2A 3NF8A 5SZTA 3AA3A 3M8QB 5J2PA 4RW9A 3QGIA 1TKZB 2E9ZA 1LW2A 5KFZA 3DOKB 3BJYA 3BSCA 4I2QB 2UVVA 4TN2A 1TK5A 1WSJA 3LAKA 1RTDB 2YNFA 4O3OA 4ECTA 3NBPA 3I5BA 1RDBA 3D28A 4JV0A 4QW9A 3NKYA 4DL3A 5C42A 2DFHA 3AVBA 1RTHB 1IKVB 3DRRA 4O44A 1B92A 4DF4A 1QS4A 4K8XA 4NCGA 3LZJA 4IR9A 2LSNA 4J9KA 3DOLA 4K4VA 3M8PA 1Z25A 2YV0X 1HJRA 4WYLA 1NK4A 2R2UA 4BE1A 4B9SA 1JLQA 3KKRA 2YNHB 1TKTB 3HL8A 4E19A 3RMAA 4CIEA 1RDCA 4OKEA 1FK9B 1J5OB 3AVIA 4CK3A 4OLAA 4Z4CA 2JLEA 2UUTA 2WOMB 4ED2A 3ZSYA 4FK0A 1N56A 1C1AA 4F3TA 1JLAB 2D0BA 2X6SA 3MEEB 3C6UB 5C5JA 1NK8A 2XY6A 3PX6A 3U3YA 3JYTA 1O1WA 1S1TB 3V9UA 4ED1A 1JLEB 3I0RB 1BI4B 3ZSRA 3KD1E 4F50A 3OLAA 1VSIA 1JLGA 4MH8A 3PX4A 3BQ0A 5EU7A 3KLEB 3T5HA 4FLZA 5FRMA 1BIZA 2ZD1B 2Z1JA 3ZT3A 2Y1IA 1WSHA 4DFKA 4LY7A 2D7SA 3RB0A 5C25B 5KFBA 2FBTA 4HYKA 3K5LA 2HHSA 4H54A 4KHWA 2RF2B 3PV8A 3MXIA 4PWDA 1IKXA 5KG3A 3EPIA 2XGQA 3SQ1A 1CXUA 2IC3A 1ZTTA 4AHTA 3TWHA 4FM0A 2HNYA 3H2LA 1SL2A 2BRLA 2OH2A 2ASJA 4XPCA 4F4KA 4FZYA 4Q43A 3QZ8A 3OS1A 3OJUA 3V1OA 4JS5A 3RBEA 3F9KA 2XY8A 3PUFA 1W0HA 1HMVA 3RWUA 4MKAA 2W7PA 1KTQA 2FLPA 4CJWA 2HW3A 2R8IA 2FC0A 2W8LA 1U48A 3GIIA 4O3QA 5KG7A 1QUVA 5F8MA 4ELVA 1VSFA 3NF7A 4CGHA 1TL3B 4FJJA 3SI8A 4CERA 3CVKA 2FJWA 3E01B 3CO9A 1S6PA 4CEAA 3RRGA 3NE6A 4HUFA 2HHQA 4ED8A 5F8HA 4KV8B 3QIPB 4K50A 4KHSA 1RYRA 1ZETA 5KFGA 2V4QA 4NLWA 3MR2A 1BQNA 5KFVA 1NNDA 4I7FB 1BL3A 1UWBA 2F96A 3K59A 5CYQA 2W42A 4HUEA 4IFVA 1VSEA 1C0TA 3GIMA 4KFBA 5C25A 4IKAA 5KFRA 4DFMA 3HP9A 4B9UA 4DQSA 4O3RA 1QE1A 3L3VA 3UQSA 3IN5A 1Q8IA 1DTTA 4BE2A 2FVSA 1NJZA 3ZT4A 3HVAA 4FM1A 2XY7A 2ASDA 1WSFA 4KKOA 2XI2A 4KHMA 4BWMA 5KG5A 4DTNA 2J6TA 3I0RA 2XY5A 2NUBA 3I5CA 3KK2A 3HVRA 3NAIA 4KKOB 3K5NA 3A2FA 4DL4A 1U45A 1JLAA 4Z4EA 3VQ6A 4MFBB 5DLFA 1BHLA 3N6MA 4WZQA 1DTTB 1S4FA 4FS2A 3MXJA 4NLDA 2D5RA 2D0AA 4JRPA 3GV7B 2JEJA 1RT1A 1C0TB 2B6AB 4IR1A 2YNHA 5K14A 3MXMA 4ZTJA 1D9FA 4QOZB 2BE2B 4FCYA 3M8SA 4DS5A 4CESA 1BQNB 5KFSA 3M8PB 1HNVB 4FW1A 4TQRA 3DOLB 2P5OA 3QIPA 1SL1A 4DFJA 4DLEA 4NLUA 1I6JA 3BREA 4GC6A 5FRNA 3G0ZA 4RNHA 1EKEA 4NYFA 1RT5B 3MECB 1IKVA 3L2RA 2PZSA 1TL3A 5C42B 3HPHA 4NZ0A 5DG9A 2RN2A 1RILA 4B8AB 4GC7A 1TAQA 3AVGA 2EX3A 2IM0A 2IMWP 4CEEA 1S49A 4CF1A 3OYHA 4FXDA 4DQQA 4J9MA 3DOKA 3T19A 3CJ0A 4Q5VA 4B9NA 4ECWA 2PY5A 1HMVB 5KFPA 4W5OA 2HNDB 5KFAA 3M8QA 2OPPB 4ZPDA 3QIOA 4J2EA 1RT6A 2HHWA 5KG1A 3AO5A 4RG8A 2G8UA 1RT4A 3QYYA 2WCXA 1FKOB 1HYSA 4IBNA 1S1WB 3TR8A 3TI0A 3ZSQA 5HLFB 2FVQA 4IQXA 3HJFA 3T5LA 4KHUA 4Y1CA 5KGWA 4E0DA 1KVBA 3RAXA 4AHCA 3KK3B 1RTJB 3KLHA 4FK4A 4MKBA 3NAHA 3LP0B 4ZVHA 4QWEA 2XGPA 4WE1B 4Z4GA 3UPFA 5KFKA 2IC3B 3QINA 2Z1IA 2FLLA 2R8GA 4OKKA 1RT3B 2VG5A 1T03B 3KMQA 2P5GA 3PR4A 1YT3A 4NRUA 1RYSA 3SCXA 1Q9YA 2WK4A 1CZBA 3OY9A 5HRNA 4H4OB 1JXBA 3ULDA 3H40A 3MR6A 5DG7A 4NLPA 3Q8QB 2ZD1A 3CM5A 4XO0A 3VQ5A 3KLEA 4IG3A 2FVRA 2DFEA 2DFFA 4WYWA 3V6JA 1X9MA 3LALA 2R8HA 3LAMA 3AVAA 4Q44A 4FJNA 1XHZA 2IJNA 1S1TA 3UR0A 3JYTB 3S9HA 1C0UB 3C6UA 1U47A 3FDSA 4HHTA 3P5JA 2HAIA 3DYAB 2OZSA 4ECXA 2C28A 4R5PA 2OPSB 1MMLA 1J5OA 3AVMA 3OYCA 5CY4A 4ICLB 3QEXA 3BSOA 4PQUA 3NGDA 5E41A 2E6MA 4F4WA 4KHNA 3CYMA 1WAJA 3K5MA 2VG6B 1VSMA 4QAGA 1YVFA 4M94A 3V1RA 3KTQA 1RBSA 4KTWA 3SUNA 1GX6A 3VQPA 2Y1JA 2AGOA 3VQSA 4O44B 3DRRB 2OYQA 1RTHA 3RR7A 3LDSA 3KLFA 3SV3A 1FXXA 3DDKA 5J2QA 1RTDA 1BQMB 1QAJA 3AVFA 3O4NA 1REVA 2B5JA 4DS4A 4I2QA 3ICLA 4CF0A 3OS2A 5J1EA 4TSXA 2BQRA 3UIQA 4FLWA 3DRPA 1NKBA 4RW9B 3AVJA 5J2PB 2G8HA 3T3FA 1S9GA 1HQUA 3FSIA 3NGYA 4NLQA 4N76A 3WNHA 3MFHA 4TY9A 4OGEA 3JSMA 3LZIA 2W9BA 2UUWA 3ZT1A 3LPTA 2BANB 3MTKA 3QEVA 4E7JA 1IKWB 1CSJA 3IG1B 1RBRA 3HXMA 3CDUA 4K4XA 3AA2A 4YR3A 3UDLA 3VQCA 3QEPA 2YNIB 2IAJB 3SV4A 3CDWA 1U49A 4ED0A 1EETB 4E7HA 4N47A 4J9SA 2IGIA 4RW4B 4E3SA 3HVTA 1VSJA 4RW8A 3ZSVA 3SQ2A 4C8LA 4FLUA 1D9DA 4M3WA 4WFXA 5HROB 1ZTWA 4CECA 3H5XA 4ECUA 4FM2A 3PX0A 1Y97A 4CF2A 4CGDA 4RNNA 3HKWA 1T94A 1HYZA 4RW7A 4RUAA 2OPRA 2KQ2A 4JV2A 4AILC 4QPXA 3MEDB 4W5RA 4O5BA 1CXQA 4H4MA 2KTQA 3QZ7A 1TVRA 3KK1A 3DMJA 5HP1A 2IJFA 4NLOA 3G6YA 4DL5A 1YVUA 4KB7A 1VRTA 3QEWA 3SPZA 2E9TA 5KFCA 2F8SA 3SQ4A 3GV5B 1S10A 4DF8A 3GIKA 4KAIA 2YKNB 3OYIA 4KHRA 2QXFA 1HNIB 3FFIA 1HQEB 3V4IB 3OLBA 4LSLA 3ISND 3RRHA 4MIAA 3T5KA 1WSEA 5KG6A 5I3UB 4DTMA 1JLFA 2RDIA 3O4QA 3SQ0A 4DTRA 1W25A 2YNGA 3EZUA 3RMCA 3BGRB 3DM2A 1R0AB 1RTIB 2YKMA 1U04A 3E51A 4ELTA 4LSNA 1TGOA 1IKYA 5I42B 2ITGA 1TAUA 4QW8A 3KIOA 2ZE2B 1NJYA 5KTQA 3NMAA 2KFZA 4AHVA 3WNEA 3C95A 3KJVB 1TKDA 1VRUB 3LP2A 4M3ZA 1S1XB 4DTSA 1LWFB 3IRXA 3V81A 3VQ9A 5HRSA 4RW6A 4J9OA 1JLCA 2G8VA 4B3OA 3BQ1A 4EBCA 1L3VA 1D8YA 3M9OB 3EZ5A 4RZRA 2R7YA 4ID5B 1J53A 3HPOA 1T05B 2BR0A 3B6PA 3BR9A 4KO0B 4ECZA 1ZBUA 4FJXA 4TYBA 2BQUA 1RDDA 2HVHA 1L3SA 4FJKA 4J2AA 2JEFA 4IRDA 5J2NA 5J2MA 1A5VA 4K4UA 5KG4A 1I3AA 4IG0B 4J9RA 4IH6A 2DY4A 5KFUA 4Z0UA 1WSIA 5HBMA 2R8KA 3RBDA 3KMSA 4EYHB 4CJ3A 3D5MA 4BWJA 4DQPA 3PZPA 5L1LA 4CE9A 2HWIA 4KHQA 4RU9A 1NHVA 4Z4FA 4HVJA 3TAFA 4HCCA 1X9WA 4LH5A 4M3YA 3CJ3A 3DI6B 1C0MA 4IFYB 1S6QB 1LV5A 4G1QB 2B4JA 4QWDA 4OL8A 5DMRA 5FDLA 1BISA 1D5AA 2VWJA 5KT3A 3THVA 2I5JA 5CYMA 2FVPA 2GC8A 4Q0BB 1KHWA 4IH5A 1CZ9A 5KRSA 3BSNA 3L3UA 4KB1A 2XWYA 4URQU 3AVNA 4YR0A 2HHUA 1RT7A 1C1CA 4DSFA 5T7BA 3DLGB 1L5UA 1S1UB 4ED7A 4FK2A 1MU2A 3KHHA 4LH4A 2ILZA 4FJ5A 2W9CB 3CDEA 3PJWA 4N41A 1EP4A 4DMNA 4ZHRA 3DLEA 4I2PA 3ISNC 4DG1A 1SV5A 4NYZA 4B8CA 1QSLA 3KLIA 4CJEA 4FLVA 2VG7B 4FJGA 4CF8A 3SFUA 3VQAA 3KLGB 2WB4A 1U4BA 3L8BA 3ITHA 4CJUA 2J6UA 3QGGA 3EY1A 4F4XA 2GUIA 5KFIA 3VN5A 4HTUA 1LWEA 1JX4A 4DSEA 1N6QB 3O3HA 3MAQA 3VQ8A 4O3SA 2HVIA 3CIZA 3KLIB 2GV9A 3QNNA 3TABA
chains in the Genus database with same CATH superfamily
5J1NA 2C3YA 2R4FA 1SV5B 5LMUK 2B4PA 4H0PA 1OPIA 4JS4A 2W9CA 5TKYA 3LDQA 4CEQA 3GR0A 1DTQA 4DN0A 1NGBA 4DTPA 5C0YA 1S9EB 4NI2A 2PIIA 1XMQF 3RMBA 3QEIA 5J1PA 2CJYB 5GINA 1SJ4P 3P1GA 1QLNA 3H2VE 2EBGA 2Q43A 4CDIA 2BDPA 4CHOA 2EKYA 4IFYA 1QQNA 3ET6A 3NEKA 1U2VB 3MXHP 1H98A 2IA0A 4ECYA 2LKZA 5HL7L 3QO9A 1TK0A 5JUMA 1F5BA 1FEEA 2O8FA 2B43A 4P7TA 4DJBA 4P72A 2DY9A 3EVOA 2X78A 5KPZA 3AD8C 1J2VA 2L48A 2WONB 1B0PA 2UYTA 4RNFA 1C1BA 4FVUA 2KW4A 1KONA 3LPUA 1JL1A 2UZAA 3R6MA 4DSLA 2DK2A 3K2PA 5ETPA 2CXEA 2VQEK 1DQ9A 4Y65A 2XB2D 3HSZA 5KFXA 1YIJS 4NLSA 4JI6J 1NBEB 5KT5A 3KKSA 2HNZA 3PM9A 4OHWA 4HT5A 5F2RA 3LP1A 4KBOA 2BJ3A 1IXKA 2X3DA 1JLCB 3CCES 3VAKA 1HHSA 4ZPTR 2WTFA 2O8DB 1UFLA 4B9QA 1TR0A 3BPDA 1VQ6N 1T3OA 3IS9B 1H1VA 1UJ5A 2XO7A 1VJWA 3R5BA 4ED6A 3ITHB 2YNGB 1UW9A 5KGXA 3VAHA 3EWGA 1NK5A 1FKPA 2GQ2A 2QWQA 3QGHA 3CC7N 3MMBB 2JFDA 3V4IA 4GVLA 4DWIA 1BIUA 3CFRA 4DV2J 3M6GA 1XR7A 3RAQA 2JLFA 3O1BA 4FKYA 1H3DA 5EUHA 4HTLA 3WZ0A 1MU2B 3OXFA 2JLGA 3F44A 5IT9Y 2GWKA 1Y5NB 4NLTA 4AHRA 2IDEA 3M2VB 4C9DA 1GFWB 3TOQA 3HX9A 3CW2C 1NKCA 4LIWA 2RQKA 3NAEA 4IDKB 4C3MA 2FGCA 3QWUA 4MK7A 4MT1A 2QK9A 4JUZA 2VQEF 1GXLA 2XLIA 5CYMB 2PFDA 3TZZA 2OPRB 4CJKA 1S6QA 3FE1A 3CCUS 2HZVA 1Y3JA 4OX6A 4TY8B 4K8ZA 1OWXA 2PYJA 4GO7X 2LXIA 2CNKB 2BJEA 2C2ZB 3J81Y 3V9ZA 1ZPWX 3OR1A 2HK2A 2RS2A 3VGLA 5EGYA 1H74A 4ZVEA 1R31A 1REGX 4JYAJ 5F0XA 3G82B 3HVTB 3PW4A 4OLBA 3OL9A 2VBYA 3F73A 2AGPA 3SYZA 1PAEX 4OZ0A 4CJVA 4TLQA 2WSFC 3RYLA 1ZA2B 3SBMA 3O1LA 4HH0A 3CCRN 3KWGA 4ZVOB 1TKXB 3WXJA 3N28A 3MX2A 3JSMB 4HI2A 5AFUA 1UJ4A 3NCIA 4CEFA 3W1YC 3OXLA 2OFHX 4RPFA 4WZMA 3V9XA 1HWKA 4LF4J 2YHBA 1VLYA 1JLBA 5BYSA 4BDPA 3PNIA 2IVYA 2P6SA 4PYAA 3SBGA 4RW6B 1Y5IB 2NRRA 4DU3A 4CIOA 2XI3A 1VRUA 3CERA 1K8KB 3CC2N 4WFYA 1GOCA 2MKHA 3O44A 4JI1F 1SKWA 2VA2A 3SBTA 5E3RA 2ZE2A 2J7KA 1NSQA 2G8IA 4UQGA 2EG1A 3R1LA 4LSNB 4CEBA 5KFNA 1YK9A 4CZIA 4Z94A 4EK2A 4CLWA 3KOAA 1B99A 1T6CA 4LC9B 1NHUA 5H9EJ 1IM4A 4YHHK 1GXTA 4DHYA 2ZBCA 3NFAA 4BC7A 3D6MB 4CJRA 4ZPCA 2UU9F 4JNEA 2C2EA 1X1PA 4CZEA 1TL1A 3DYAA 2JC0A 2GFFA 2DPJA 2HRUA 5KFJA 1EX8A 4NCBA 1SS6A 5JS2A 4JI4K 2H3EB 3GYNA 4TXSA 4KBIA 1F2GA 1B9FA 3MEDA 2ALZA 4DR2K 3DGVA 3D6HB 1Q95G 3MEGA 3I0SA 4IG3B 3FGVA 5AQJA 4P2FA 3OT9A 8ATCB 4ZA1A 2KYZA 4DV5J 3PXGa 1NH7A 5CR4A 1X3NA 1SQEA 1QSYA 5M2RA 1NOZA 1KQSR 4DV5F 3O08A 3JS6A 3P96A 2KN4A 4GVBA 3CPWM 1N32J 4DV2K 4DR4K 1DLOA 1XK8A 2G0JA 2GS8A 1YRXA 4B08A 5BXIA 3GP9A 3MN6A 3DJCA 1BCMA 2DR5A 3TSUA 3MM9B 2CQ1A 4YORA 4CHNA 2W2NP 2ZWHA 4OKJA 2W2PP 2BJ8A 3FUYA 3KLHB 3K58A 2QA4N 1RTJA 4WFNL 4P2XA 2QSFA 3AD9C 1RDAA 2HF4A 4I6MB 2VFVA 1KP6A 3J81j 1HBNA 1S1WA 4U6PA 3H4BA 2K1RB 3E8OA 2E2OA 1T44A 3N5BA 2L41A 2V4JB 4V19J 5C2DA 2XWXA 3QJJA 2W2MP 4OYAA 2V8DA 4HT7A 4LF8J 4KRWA 2E6LA 2EFPA 3QMQA 5CHIA 3KDNA 9RUBA 4RWWA 4FLYA 1L3TA 3M8RA 4OYMA 2FLNA 1S22A 3AVLA 1VQMS 3E9LA 1BQMA 4CJ4A 3HMJG 1M1HA 4EWTA 4WP9A 1GLFO 2HFZA 3D6FB 4LD0A 1PO6A 3AVCA 1S7HA 5CHCB 3MECA 1RT5A 2O1PA 1AZSA 3M8YA 4GV6A 1RXOB 1RZMA 1QZ5A 3BBBA 3OVAA 1HW9A 2P9PB 3D0GE 1VSHA 2MKIA 4F8RA 1UEVA 5B08A 1VSLA 4ECRA 2IIRA 2HHTA 5IV3A 2WTUA 2XLJA 4NXMF 5DLGA 2YHYA 4BCAA 4GV3A 4A57A 2ZBIA 2B6AA 3HI0A 1FI4A 3KLGA 1KQGB 1U02A 4N56A 2UUCK 3HHLB 3PY8A 1N0UA 1LW0B 3QERA 3UCUP 1RAIB 3CJ5A 3Q22A 3V6DA 2AWZA 3BO4A 5C12A 5DM7L 3CCMS 2DHXA 4O3PA 1GNKA 3BV8A 2CGKA 1YJ7A 4CBXA 3R6GB 5K8MA 4A47A 2DGUA 1OMSA 4F3OA 3FBCA 1ZBTA 5BR8F 4BRGA 2I5JB 5D4OA 4Q7AA 1CULA 4J2DA 1XEZA 3M30B 4ATNA 2DYAA 4IFVB 3J7YI 2GQQA 5DQIA 2GCFA 3K0JA 2LU1A 5BR9A 1SZ2A 1CG2A 3V5RA 2Q79A 1EO1A 5AQYA 2ACMA 1U25A 2PBDA 2VASA 2QG9B 2O8CB 3OFEA 4CLUA 3WUHA 2A1BA 1NXIA 2FBXA 4Y6IA 4FJ8A 4DTOA 2C2KB 2DXEA 3CWJA 1URNA 1D8ZA 2E4LA 2YVSA 1UZHA 3EPGA 3GG4A 4DV4K 4UOCA 2P6TA 4NO7A 2N7YA 1PGZA 1A5WA 4OI6A 3JS9A 1TQLA 1I5OB 4O0JA 4DDFA 3FMBA 3L2QA 4ZP6A 3CJKB 2AJFE 1KLNA 3TARA 3IBWA 2MJUA 1ZBHA 4BQLA 2VGNA 3OFFA 2JWNA 3V81B 2F5GA 2UUCJ 4FLXA 3U3GA 4NRTA 1YG0A 3VTHA 1IV0A 2DISA 3C14B 4FN5A 2ADCA 1XR5A 1QVFM 2H1YA 2DCUB 3D0IE 1Q86T 2V9WA 2J9CA 5KT7A 1RADB 3BDPA 3VQ4A 1LWEB 4UY8O 3H59A 1NJWA 4NYNA 3CNQP 4PWUA 3W9JA 2M5YA 3GE9A 4B3SF 3HOSA 2R2RA 4EBDA 4KH5A 1AUSL 4LF8K 2MHEA 3GPAA 4MLHA 1EB0A 2L9DA 3O9TA 4K25A 4TNOA 2DH7A 2DNOA 1HNXK 1XJWB 3NGZA 3TAPA 1RWXB 4DOZA 2VBXA 4OX9F 4FOIA 4USMA 3RMDA 3MM6B 4MFBA 2AV5A 1P8GA 1SC4B 4ELUA 3FZMA 4WQ4A 5JJBA 4YY3K 4OZ2A 3R5GA 2VOOA 3MAAB 3LANA 1DHMA 2HYIB 1D0EA 3UDEA 4JK8A 1HI0P 1DAXA 3ENQA 3DMJB 3N4PA 3MCSA 3NH0A 3MHYA 2VA3A 4Q0BA 2KVIA 1M0SA 4CJ5A 1KC8O 4IRKA 4X2BA 3G2XA 1BD6A 4NZ6A 3ZT0A 3ZZYA 1FDBA 1NJXA 4F4YA 1JLQB 3OL6A 3KZBA 4HHJA 2WVCA 4ZPBA 2UUAK 2FBYA 2KL8A 1L3KA 3A8YA 1NDLA 3ILLA 2E29A 5H9FK 3VF6A 1NSPA 2D9PA 2O8BA 3TUPA 1T9XA 4F2SA 1N36F 3VF0B 2MPUA 2W6LA 1NGFA 4JV5J 3E01A 2IAJA 4FJIA 1VQ7S 4ZJOA 4DLGA 5J2MB 1KD1O 4JV5F 4UY8T 3PYGA 2V69A 3OHBA 1FX2A 4K4WA 4DR2J 3HHLD 3PIPL 4HVZA 3Q86A 3UE5A 1U8SA 1TK8A 3QATA 1C6VA 4CD1A 3F9MA 2DJWA 1LAWA 4FDFA 3KHLA 1TL7B 3LQVA 1LCUA 4OI0A 2P51A 3JSBA 4IOCL 1T05A 2NXEA 1RAAB 1RAEB 5J1EB 4WFZA 3H8YA 4YS2A 2UUBK 3POTB 5KFFA 4GKKF 2O5DA 4CLPA 2E1PA 4LRAA 4CW7B 3NF6A 1YQHA 3WBZA 4CFAA 1X4FA 3MM5B 1ZBLA 2GEMA 3ZCMA 3ZSXA 1XMQK 5HJYA 3TQ1A 1T3NA 2SXLA 1PIEA 4FYDA 2P2CB 5DZ6A 4QWAA 3A8KA 4C11B 3R7SB 4ZP8A 4ZK7M 4MO4A 1NPKA 5EWFA 4Y2IA 4V19X 1JLFB 2BTFA 1Q79A 2AYMA 3M2RA 4QCLA 2RKIB 5KI6A 1RABB 2HRTA 1U6FA 4NOHA 3FC9A 2VFSA 3RG6A 3MZIA 5CCMA 1LFPA 4JLHA 2BZ2A 3RR8A 3SDEA 4I9LA 2OMLA 3CC7S 2AX0A 2DIVA 2VQEJ 2WVEA 1S12A 5HL7Q 3T1AA 3FZ2A 4AFFA 2YHWA 4ANEA 3IM9A 1JKHA 1J27A 3OV7A 5SWMA 4YFUA 3HHLC 5AQUA 2VZ9A 4K0KJ 4NLRA 2BRKA 4MKYA 1UVMA 3Q0AA 4JYAF 3OFGA 2GJIA 1X60A 3VQQA 1UMJA 3CMAS 3HYFA 1RAJA 3U1LA 3FR0A 3CEDA 2FJVA 5A8KA 1T03A 1KOHA 3IBCB 2WZ1A 3UKRB 3DRSA 3FQLA 1FDNA 2JX2A 2D3ZA 1R6YA 1WDDA 3R6LB 2GGPB 3CJ4A 2YXLA 2HWTA 3P39A 4IXCA 1YUWA 3CCVN 3THWA 1KLMA 3AQPA 4XH5A 3U9DA 4OI4A 4M42A 1VC0A 4F7VA 1XNRF 5JMVA 2Z1GA 5HLFA 4J5OA 1VQYA 3H5UA 3BSAA 5AQFA 4Q8FA 2BOAA 3I8DA 4ZCLA 1LW2B 3O8WA 3T6BA 3BQ2A 3NF8A 3AA3A 5J2PA 2QX0A 1TKZB 1LW2A 5CE3A 1RWWB 4KHPK 2ZJPQ 3ENHA 4I2QB 2F63A 2I8EA 1KQSM 3Q2TC 3CB4A 4UW2A 4TN2A 2B8QA 3LAKA 3UCZP 2V8VA 1RDBA 3O3LA 3NKYA 2FJBB 2ZNYA 2MKKA 3MUTP 3NNAA 1BWFO 1QS4A 4LFAK 2R42A 1RE1B 3IAS9 4K8XA 3A1YG 3LZJA 2P9NA 1IWGA 4K4VA 3NGSA 1FWKA 1JK9B 4WYLA 3CF5L 4BRIA 4FPBA 2PC6A 4B9SA 2NRVA 3CJSA 5DDRC 1OVQA 3Q83A 5AQNA 2YWFA 1J5OB 3AVIA 4Z4CA 2JLEA 3DN9A 2WOMB 3RVCA 4F3TA 1JLAB 1UZDA 5AQHA 3AY0A 3C6UB 2IJRA 5C5JA 5DJBA 4DV6K 3JYTA 2XNRA 4ED1A 3QGPA 3OLAA 3HZGA 4JKAA 4MH8A 3PX4A 5HVGA 1JJ2R 3O6WA 3HFVA 4OZ5A 2W4DA 4NXMK 3ZT3A 3H42A 5DDQC 3BS9A 2X51A 4YB1P 4DFKA 3EDQB 2OSRA 1FRMA 3D2WA 4NYOA 3LTOA 4H54A 2RF2B 4LREA 1IKXA 5KG3A 4QIEA 1IR2A 1CXUA 1ZTTA 4LFCF 4AHTA 3TWHA 4JI1K 4FM0A 3AOBA 3H2LA 1SL2A 1B64A 2ASMA 1SQKA 2BRLA 2ASJA 5HATA 3ZZTA 4ANCA 2QT7A 4YOWA 4DPOA 1VQSA 4JKGB 5BRDA 3MM5A 3OS1A 1VI7A 3OJUA 4U9RA 2QL9B 4K41A 2MQNA 5BREA 4JS5A 2BBEA 3Q8UA 2XY8A 3POTA 5H1SQ 4GRSA 2AZ3A 4CLFA 3CCQS 1U26A 5AXKA 2W7PA 2ZUGA 1KTQA 2U2FA 5AQIA 2R8IA 2RHKA 4CH7A 2NREA 3PRDA 4DPUA 5KG7A 1IBCB 3HM8A 1W97L 4KC5A 3IR5B 5AR0A 2FYXA 3SI8A 3MCMA 5D8HB 1PYOB 3E01B 4ILRA 4WFBQ 3NE6A 4DV6F 1EWRA 1UEUA 2A40A 2MGZA 4K50A 2O8BB 1RYRA 1ZETA 3UD3P 3MR2A 4F25A 5EHHA 2X1BA 5KFVA 2B51A 4I7FB 3K59A 1B3TA 2OANA 4HUEA 2DBBA 4RWXA 2HBMA 2RDDA 4KFBA 4DV4F 4U67Q 5DRKA 4B9UA 4DQSA 1YHQS 4O3RA 2GHWA 1MROA 4U8YA 3UQSA 4X4UA 3QFHA 4MMOA 4BE2A 3W8PA 2Y8YA 3HVAA 4B3RF 1IBMK 4FM1A 4F4AA 4C3KA 2VC0A 1BC6A 4KHMA 3MMCB 4DX7A 3U1MA 3I0RA 2NUBA 3MAAA 3TR5A 2EWHA 4LF5J 3O8MA 2QO3A 1WACA 4Z4EA 1O8BA 4FWLA 4MFBB 5DLFA 1BHLA 4I68A 1S4FA 2IHR1 3MXJA 4IOCQ 4CO2A 3VETA 1PJ5A 4Q2MA 3P4UB 2CJ9A 3OVBA 2W4CA 2K3IA 1PBAA 2JEJA 4EMDA 3TU5A 2YNHA 5K14A 4ZPVR 4CO0A 3W3SA 3W66A 1RHQB 2A18A 3M8PB 1HNVB 4FW1A 1TMMA 2EFGA 3G4SN 1NMEB 2BE7D 3J7Z5 2VBWA 4NYFA 4JI5K 1H2VZ 1LK7A 5C42B 4JKHA 4NZ0A 1E3MA 5L39A 3AVGA 2IM0A 5ETOA 4CEEA 1S49A 4CF1A 2HAFA 5E7OB 3CCLN 3ZZ0A 1E6VA 2UUCF 4AF1A 4ECWA 4BRAA 2HNDB 4FYVB 1WOSA 3HLUA 4J2EA 4JI3J 3AO5A 2CJAA 2KFYA 1RT4A 1HWJA 5AJ3F 3FZHA 2IMOA 2QLXA 4NEYA 3EUNA 1IBMF 3ISZA 2CNOB 3TR8A 3TI0A 3ZSQA 1C0FA 3BB5A 2P8IA 2CUYA 4JKGA 3TEHB 2O8CA 4KGMA 1S99A 2J7UA 2JVOA 5AQVA 5AZIB 2XGPA 4WE1B 3EXYA 1DRZA 2VG5A 3KMQA 4LFBJ 2CQPA 3M30A 4C3LA 1RCOB 3SCXA 2EXUA 5HRNA 4FL9A 5AQXA 3M32A 5U47A 5L38A 4WFAQ 2B9XA 1YJRA 2FVRA 5CAAA 2DFEA 2FIUA 4WYWA 3V6JA 1X9MA 3EGNA 3LAMA 2YCHA 3GBTA 5JVGL 1XHZA 3ENOA 1J6ZA 1IBLK 3JYTB 2DNPA 1C0UB 3C6UA 1JNRB 1RI7A 3P5JA 2HAIA 1MA9B 2LQ9A 3F56A 2DGQA 3BBCA 2VYPA 1MMLA 1J5OA 3AVMA 1XN9A 2M3DA 4U95A 2X1FA 4DUZK 3FZLA 3BBFA 2M88A 2MLZA 4KHNA 2LXUA 1TUYA 1FJGJ 3K5MA 2VG6B 3QFUA 3H0PA 4QAGA 2DNZA 1PBUA 3UNGC 1ZM4A 2DR7A 2KKZA 1GX6A 1X31C 4Y0WA 4FWSA 5GAGP 2GA7A 4A8YA 1DT9A 4X64J 1EHWA 1Y11A 3IWNC 1JCFA 3KLFA 4PG7A 3SV3A 4I6YA 4BRLA 1RKIA 2MSTA 4LF2A 1DZ5A 1BQMB 3AVFA 3A13A 2Q66A 4X65F 4I2QA 1RWNB 5EX3A 5FPMA 3QB0A 2U1AA 4CF0A 3OS2A 1RDWX 1G4CA 1NKBA 3M2UB 5J2PB 2G8HA 1S9GA 1IBLJ 1NPRA 3NGYA 3ETMA 4AL7A 3VEYA 2ZH2A 4YY3F 1IBLF 3GMGA 5KAKA 3J7ZO 3DHWC 3ZT1A 3MTKA 3SQGB 1V5VA 1NBWA 4BC2A 5HSPA 2CGLA 2EEYA 1RBRA 3HXMA 1MDUB 4K4XA 3THWB 3CCSN 2GGPA 3VTIA 4LBPA 2V8GA 4N47A 4QZVB 5AE3A 4E3SA 1CJKB 4JD2A 2PEBA 3ZSVA 3SQ2A 4P10A 4FLUA 4DV0F 5CH7B 1D9DA 5E5NA 3LO3A 4QIWD 4WFXA 5HROB 1W7AA 3QFWA 1A0OB 4AL6A 3UNYA 1R89A 2AP6A 4DUZF 5G4DA 3R9LA 4HLBA 4DUYJ 5I3PA 4BG9A 1RWOB 4JI5J 4MO5A 1RSCA 4P73A 2PMWA 4JV2A 4AILC 3HHDA 4WKYA 2XSJA 3MEDB 4QIFA 4H4MA 3QZ7A 5HP1A 1CC7A 2IJFA 5K5MA 2J76E 2ITMA 3VGMA 4DL5A 3HCXA 1R8CA 2VONA 1T9YA 2HQIA 3TUZC 2LA6A 4JI7J 4H0OA 1Y0HA 4F36A 3GIKA 2YKNB 3AAWB 2QL5B 1SJ3P 2V2ZA 3FFIA 2LA4A 3SCJE 2NUHA 3ISND 4MIAA 2V8HA 3T5KA 2LYVA 5AQKA 3BUZB 3M2RB 4C23A 1JLFA 3O4QA 1F5AA 1URRA 1PG5B 3DM2A 4Y2MA 3C6AA 4LSNA 2VDHA 1TGOA 2ITGA 1TAUA 3J8AA 5HO4A 4L72B 4PG6A 2ZE2B 3G4SS 3CQXA 5KTQA 3NMAA 2KFZA 1VLOA 2C2OB 1YTYA 3WNEA 1VQ6S 3PCOB 3KJVB 3M1VB 2CPZA 1TKDA 1ACMB 1VRUB 4LIRA 4RW6A 4J9OA 2AKWB 1F9HA 2CDRB 4O8UA 2G8VA 2Q2RA 4P75A 2KB2A 1T05B 2BR0A 3B6PA 3BR9A 3GFYA 3P38A 1APSA 1L3SA 3NG8A 4IRDA 5J2MA 1I3AA 1LNQA 4BVPA 4J9RA 1NO8A 4JBCA 1WKKA 1VHXA 3OW2M 1RWUA 3V4MA 4QS9A 2RS8A 3G82A 2R8KA 2DRAA 3RBDA 3KMSA 3MPVA 4EYHB 1NZ8A 3J80U 4DQPA 3PZPA 2HK3A 5L1LA 4CE9A 4RO0A 4RWTA 3TAFA 1S76D 1YJTA 4AXIA 3A5MC 5T41A 2YX1A 1S6QB 4YOXA 2RHQB 4QWDA 2F9DA 2IYIA 2VWJA 5KT3A 5CYMA 4I69A 4Q0BB 3UKUB 3NP5A 4CBUA 5KRSA 4P6QA 3BSNA 4KB1A 3EE9A 3W62A 3AVNA 1HD0A 1O0PA 4FF4A 3EZOA 1WG5A 4PPDA 2HIYA 3I6PA 1CZAN 1L5UA 1N34K 2LU2A 4JI2J 1CLFA 1GLJO 1MU2A 4NXNF 4LH4A 4FJ5A 2ILZA 5D0GA 2Z2YB 5A76A 5HQLA 4NXNJ 4DMNA 3DLEA 3ISNC 1K0TA 2W7AA 1PYSB 4HHHA 3IWLA 4B8CA 4DR4F 4CJEA 1S0VA 2VG7B 1G3OA 1H73A 4FJGA 3ULHA 4OZLA 2AYGA 2Z2MA 3SFUA 2QWLA 2R7WA 1RU1A 4IQMA 2YH0A 3A3PB 2JOQA 2E2PA 4WCEQ 3ITHA 4AE5A 3NOGA 2VODA 2XMJA 4YOUA 1O51A 3GYGA 2GUIA 1FO1A 4RL1A 3TJ9A 3UN5A 3VN5A 3B82A 1LWEA 1N6QB 1SJFA 1SI9A 3O3HA 4O3SA 2KG1A 5LSLA 3QNNA 1WSGA 2YKAA 3OTEA 2VWBA 2VUGA 4O4GB 2F8EX 3J7AN 1N8RT 3NH2A 3AO4A 2DEIA 1AFJA 1R6VA 5ADZA 3LP1B 2KXNB 3A5NC 3DCAA 2HNZB 1WB9A 3CJKA 4KE5A 5IZHA 3VERA 4DV1F 2HHVA 1K73O 3ID6A 2J9DA 1SQGA 4LFAJ 2LLZA 5EWEA 1X5TA 3MWPA 3HSCA 3TAGA 2HEKA 3A0IX 1K9MO 1FDAA 4U8VA 5KG2A 4AQYF 1EZZB 1P9YA 3Q7CA 2ETJA 4O0IA 3BF3A 4KREA 1C1BB 2FF3B 3WXIA 1TMJA 2E7VA 1OQ3A 5AQRA 4ER8A 4KH6A 4RNMA 1FA0A 1GTEA 3QO9B 1T95A 3UW1A 4MLEA 4RR5A 7AT1B 1U2VA 4DL6A 4L3QA 1NRKA 4B3RJ 5GMDA 3DLLQ 3QETA 4CHPA 1CULB 2Z58B 2Q1LA 2XRIA 4OPKA 4AH9A 2R7TA 2VQFJ 2MY7A 1RKJA 3OYGA 2AEMA 3MWBA 5T7LB 3TAQA 1N0VC 3CGIA 1MMNA 3MD3A 2IY5B 4JYAK 1DTQB 1QQCA 3MMVA 3HHKA 5EDWA 2NYHA 2VD3A 1TUWA 4M63A 1ITPA 5I4MA 4H5VA 3V6DB 1Y7PA 5E3AA 4A8OA 4DR3J 1LW0A 4JI0J 4IOAQ 4OVLA 3PSFA 3M6WA 3EGWB 2CYYA 4YNQA 1GMWA 4JI4J 5KPRA 1WNSA 3DXMA 4AD6A 5KT4A 4KRFA 3QLHA 4E2FB 1A5XA 2XSFA 3DM2B 2V9KA 2XS2A 4PHTX 4M3UA 1Z4UA 1FTCA 4DL2A 1YKWA 3ULEA 2PD1A 4RCHA 3D1QA 1T8EA 3MOJB 2HFSA 3OJSA 2ERRA 4X62K 1D1UA 4Z37A 3NL0A 2ZOMA 3FFIB 3RB6A 1VQNS 1FRIA 2BVZA 2YKNA 4K7QA 4CK1A 4PUOB 2FSKA 2KYXA 1PCAA 2RAQA 4HEA9 4EYIB 1S1UA 4X4SA 2LEBA 3CCWA 3J80Y 3D7SB 5HP1B 1QD1A 1SUQB 1U1LA 4H4MB 2YQ3A 3VAJA 1F0XA 2XSJB 4FLTA 4YUDA 1Z05A 3CJRA 4EEYA 2H5IB 3BZCA 4U7CA 2AYEA 3DI6A 5MLCV 4DX6A 2PN6A 3VEXA 1UAWA 2ZH6A 4F26A 2QWNA 3EYZA 3GQCA 2E2NA 3I5AA 3IR7B 1EARA 4M3RA 1HPZA 1B7YB 4CZKA 1P27B 2G0IA 1VRQC 5GVQA 1CJKA 2IOCA 2MKSA 2CJXB 2QA2A 5KFDA 4MK8A 4MKVA 2VPWB 3H20A 5AFUH 5HMXA 1U1KA 1DLOB 1HPZB 3GJTB 4ZOSA 1NMDA 4GVBB 3PYEA 4OYPA 2AYBA 2RE2A 3AVKA 3SNNA 2KM8B 5AE2A 5T14A 1T3VA 2I1RA 2W6KA 2DO0A 4NLGA 1FRXA 4PA1A 3M2UA 3RAMA 3CJ2A 1SUQA 4EZ9A 2X3GA 2OGUA 1FDDA 2PI4A 4J9VA 2X6NA 4URGA 4CK2A 2R7UA 4BDYA 4K5RA 4ZS6A 1TL1B 3OYJA 2WVDA 3OPKA 4PUOA 2IM3A 3X1LB 1SH2A 3WQPA 2IRYA 1BDGA 5KG0A 3TRGA 3FBBA 3CQ8A 5HMWA 4AHSA 2BJ1A 3PHEA 1QVGR 3WX8A 4OFZA 4BACA 1RTIA 4CLSA 4BDZA 3ULEB 2BEFA 1XC9A 4CQ1A 3CQYA 5B8HA 1Y10A 1J9AA 4WFBL 2G2YA 2VIHA 3QLHB 1FD2A 2VPYB 4E7IA 1RBUA 3S6EA 3DXMB 1R8BA 4X84A 1KR4A 1Y00A 3WNGA 3ENVA 1QVFR 2ZWOA 1ICEB 2V51B 1NGJA 1UCNA 2HLTA 4E89A 2CNNB 2V7YA 2G1HA 1HUXA 2VU5A 2V2VA 1Q9XA 1C0UA 5ETVA 2QYGA 4GKKK 4OJHA 2HQDA 5T7LA 1S97A 3GWCA 3EGZA 3GG0A 2NRWA 2XYGB 2AGQA 3M32B 3MDFA 1TKXA 3NH1A 2IA6A 3ILIA 5FPDA 4KSEB 4DR5K 5LSOA 3HM9A 1NGDA 1EX4A 4DV0J 4W4MA 2BACA 4IKFA 1RQ0A 2V5HG 4OPJA 3U02A 4WE1A 3T1YK 4E1NA 5AZIA 4DR6K 3FZBA 3DLHA 5CCLA 4JKCA 2CVEA 3OYNA 1RCHA 1GOBA 3M9MB 1IKWA 1KBRA 1Y4ZB 3OVNA 1RT4B 3ZSZA 3CD0A 1UEKA 3K5PA 4DCPB 1HR0K 2MZJA 2D41A 2HNDA 1NSKL 4UY85 4E1MA 2JWKA 2UV8A 3P49B 1Q7YO 1NM2A 2B5JB 3CC2S 4YQWA 1VQKN 3IMQJ 3EL2A 2ZWPA 4O4GA 3VEVA 1ITGA 4J8FA 3TO8A 2XMVA 4B1VA 3SUQA 3G9CA 4DQRA 1U1PA 3LUYA 1N6QA 1G15A 1FKPB 3AO3A 1F9EB 1WC1A 4KI6A 1HNVA 1YVNA 1SL0A 2NUUG 3O5BA 1WC5A 2N4CA 2NSCA 1KHVA 5K14B 1EJ7L 1S0OA 2DTUA 2CQ3A 3W2WA 2DH8A 1GLLO 3I9ZA 4OMFG 2R7QA 2OPSA 3FCHA 3OSPA 2VG7A 1LXJA 4NXNK 4CHYA 1Q8KA 1G1XA 2F9TA 3DLEB 1UA0A 4UUXA 3HZEA 2GNKA 3CO0P 3NWRA 3EO3A 1M5HA 2XQCA 4A8WA 2IDOA 4R79A 2O8EB 3MMCA 1ASWA 1YTUA 2PFUA 2Z1HA 4F3QA 1RAOA 3VHQA 1GLCG 5SUHA 3AJ2A 3HBTA 2X74A 3C94A 3UKUA 1VSKA 3PW7A 1MROB 4A8QA 2FPHX 5B7WA 4ZVPB 1HR0F 4CGIA 4WIIA 4KFBB 5M1PA 2GELA 4WJBA 1S59A 1CJTB 4EZ6A 5BYQA 1SVDA 5KFYA 2YX6A 4I7FA 2VGMA 2FHMA 4J37A 5JXSA 2WONA 1WJ9A 3TP2A 3HDSA 3ENWA 4XH1A 2UU9K 2FJAB 4HWIA 1B0TA 2XMAA 4XPEA 3SFGA 2XHBA 3RB3A 4ZVGA 3ZNUA 4JI6F 1WSVA 3EGVA 1UW4A 4BROA 2JHEA 4GMKA 4DV3F 3CULA 2QL7B 1CLQA 3PW5A 4DSJA 4LF9J 4XIUA 4A2BA 4NI2B 3AA4A 1S9EA 1ZBFA 3O9SA 1U0SA 2ZUAA 2UUAF 1M5SA 5M1NA 2WVFA 2P9IB 1HKAA 2F40A 1ZAWA 2JGUA 1HNZJ 4J90A 5F8GA 4O4RA 2MQMA 1ESVA 3LWLA 3J80O 2J8AA 3KJVA 3M1VA 4ZVQB 2CPEA 1YLXA 2MKCA 1RA6A 2FHJA 2MXYA 2X7IA 4UZCA 5FD1A 1YBTA 3BZQA 3LM2A 1IKXB 4USJC 2RF2A 1K6YA 3W5YA 3QICA 4GVMA 3BO2A 1LKZA 2G8WA 2QFJA 2LCWA 3WIVA 5IOLA 3DRXA 2RPIA 3G10A 1MWYA 4KIAA 4FW2A 2OD4A 4ERDA 3OYEA 1XIQA 1HBUA 5B0FA 4M5IA 3FRYA 2P9GA 2VJVA 4LF9K 4PXCA 2UXDF 2J9EA 4OI2A 2FJDB 3K7RA 1GMVA 3SSRA 2WW8A 4Q8EA 4KB0A 3QAEA 3BDEA 1RBLA 4U7UD 4OJRA 3CDBA 4C48A 2WOMA 3A4TA 4AYBD 4KGKA 1O6XA 2H4WB 1WNEA 2Q0RA 1QVGM 3MUMP 4B9LA 1HBOB 1YITN 2LQJA 4LR9A 3PYFA 5KFOA 2L9NA 4LF4K 4FZZA 4USWA 3RTVA 4C8NA 5HROA 4CFBA 1RBAA 4M63C 4MQ3A 3W5ZA 4WPAA 2QLFB 5LXYA 1KAZA 4JD2B 2GO8A 2Q0UA 1FRKA 3QNOA 4FJLA 3DKDA 3I55S 4ECVA 4J9NA 3CSKA 2K06A 3AH6A 3VV2B 2Y1RI 4YMEA 3AT1B 4WF9Q 3VENA 4FJ9A 1FX4A 3SQGA 2ATLA 2XCAA 2KJVA 4CEDA 2RH3A 2RDJA 2CFXA 1VQ9N 3G8TA 2Q3SA 3I96A 1BMQB 2J0SD 5AQQA 2ASLA 2HHXA 4W5QA 3CT9A 1TKZA 4OZJA 3OVSA 4WFAL 1S9GB 1N52B 3LPYA 3PJ9A 5KFEA 4H5NA 3GIJA 2ZM6F 1JB0C 1NLKL 3H98A 2V68A 4ILGB 2ZJRQ 3GILA 3JTNA 4XDDA 3B4MA 5KFWA 3WX4A 4LF1A 3KLFB 1KLMB 2KFNA 4OPAA 1V4TA 3S3NA 4L74A 4DU7A 3O4WA 3DXBA 2YJFA 2CJQA 2YHXA 2J8SA 4WXOA 3DRSB 3TTDA 5E3QA 3B6OA 3F41A 3VOVA 2I38A 4BREA 1LQ9A 1KAYA 5L1IA 2UP1A 3TANA 5BYRA 1VK0A 3L95X 5A8KB 2Z2LA 3ZETB 2VG6A 3TAEA 2RJZA 1S0NA 5HRRA 2VH7A 2BUNA 2MHNA 4WQ5A 1LFWA 1BCOA 4A4JA 5GAHI 1HRHA 3ZNJ1 1KRPA 4ID8A 1WOOA 3SIPB 3TUIC 1HQEA 4ZIWA 2MZ1A 2YHAA 3HT0A 1HNIA 4JV1A 4CFCA 1FRHA 5THWA 1P1TA 2IFXA 3OHAA 2O4IA 2RU9A 1JKHB 3RSEB 2O4GA 3GYXB 4QBUA 1S3XA 1NG9A 3MEEA 2FSNA 3HP6A 3CM6A 2AD9A 1Q4RA 1BGXT 2UUBJ 1YI2S 2GBZA 1PILA 3AJDA 1FRLA 2E1ZA 3SDEB 2UUBF 4BGBA 2LMIA 2E66A 1FK9A 1FXDA 3LWMA 3G87A 5CZ1A 2KZMA 2C22A 1S72S 2XS7A 2RKIA 3C6HA 3W2VA 1YGYA 2YX4A 3R2CJ 2VG5B 3GFZA 3AHPA 2KJWA 4C11A 3EE8A 2GQCA 4FPIA 4JK7A 5AQWA 2NXJA 2OLWA 4X4PA 5KFTA 4JK9A 2H48B 2HVDA 1WLJA 4M5NA 2WRMA 4PYDA 3IC1A 2F7VA 2DT9A 4PXDA 2QLWA 2M8HA 5M1QA 3HK2A 2VC1A 4X62J 2CPDA 3GOIA 2D0PA 5BR8J 4X62F 2RQCA 3NDKA 2DCLA 5GADI 1SKUB 2DNRA 4UZBA 4RW9A 1P8ZA 4BBYA 2Q97A 3SEOA 1XNQJ 4KH4A 2Y8WA 2RB7A 1MWKA 1E6VB 1IR1A 3L09A 1TK5A 1YZ6A 4LFCK 4ECTA 2JFKA 4YEAA 5BN8A 4JV0A 4DL3A 3G6ES 5C42A 2PDAA 3RW7A 1RTHB 4BGAA 1AXQA 3T1YF 4WYBA 2LQ5A 2MKYA 4NXMJ 3MN7A 2JRSA 1B92A 4DF4A 4OX7A 1KKHA 1OH5A 4J9KA 2AJ0A 3EICA 1DGKN 5JVGQ 3I55N 4UOGA 3I56S 4Y28C 4LF5K 3M8PA 2YV0X 1NK4A 4MDAA 4RTFD 1JLQA 2YNHB 3RMAA 4CIEA 1WOPA 4OKEA 2KHCA 3TX8A 3IBFB 2KM8C 1NGIA 4C8YA 4ED2A 3RW6A 3ZSYA 2VICA 5GAEP 4WWSA 2D0BA 3NNCA 2YI1A 2X6SA 4OJ3A 4JKDA 2GX8A 1Q7YT 2XY6A 4WQ4C 3PX6A 5KQDA 4RJVA 2FUG9 3I0RB 3ZSRA 3B8HA 2RUGA 5K8NA 4OLOA 4DV2F 2O67A 4P2SA 4X4QA 5EU7A 3KXDA 4FWQA 2QA4S 2ZD1B 4ZDNA 1HWUA 2Z1JA 5JMNA 2G2ZA 1V6HA 5ETKA 2IPOB 1OKJA 3GB0A 4LY7A 2FHJD 3TZYA 2FBTA 4HYKA 3HOTA 1HKBA 3MXIA 2DR9A 2HURA 2R7XA 3R27A 2QA1A 3CCVS 2EFNA 3C15B 2MGZB 4XPCA 4FZYA 4F0KA 2E7WA 2EFQA 2COLA 3C14A 1UVNA 4X4NA 3C2PA 5C2CA 4WTYA 1BXNA 4FSVA 1F60B 4M5HA 3QDKA 5IT0A 4MKAA 3CETA 3B6BA 3JAMY 4GVEA 2FC0A 3JXOA 1M1KO 1SC6A 4O3QA 1QQOA 4CGHA 3D0HE 4FJJA 2JNJA 2ZF5O 3CVKA 3R9PA 4I4BA 4CEAA 2H4YB 1MLAA 2QZ8A 3QIPB 4BRKA 3BF4A 2YQ1A 5KFGA 4M7XA 2V4QA 4OPHA 2MZTA 1YBAA 1NNDA 5DZ7A 1FF2A 2HS0A 1UWBA 3F0NA 5CYQA 4OX9J 1BQXA 2QA4G 4IFVA 5JVHL 3ADAC 3HF5A 4IKAA 1AA1B 5KFRA 3HP9A 4G9ZA 5AQSA 1JQGA 2HOEA 1N32K 3TX0A 1NJZA 4BLGA 3CI5A 4G6VB 3F2KA 2XY7A 2ASDA 5LJVA 2B4UA 3FZKA 2XI2A 5KG5A 3MPUB 4F0MA 2FC8A 1BWVA 1U2FA 4KKOB 3K5NA 4ZCIA 4DL4A 1U45A 1JLAA 2V2QA 3A5OC 3VQ6A 3VMFB 3T9ZA 3N6MA 2M9KA 1DTTB 4KPCA 2ABYA 4FS2A 3N4WA 4QR2A 3T1HF 4NLDA 3HHLA 4NA1A 2KH9A 2V6AA 1MW7A 4ZITA 2D0AA 2ATCB 4EHTA 4JRPA 3MM8B 3GV7B 2B6AB 1C0TB 2E88A 1D9FA 3AQOA 4ZTJA 3WHIA 1ZS6A 3VQTA 1MN9A 3M8SA 2MZSA 5IFMA 1BQNB 3OBYA 1NJIO 4P9SA 4OZ1A 3CD6S 2P9NB 1OVYA 2P9PA 3NGRA 1I6JA 5GMKa 5FRNA 5HANA 4LF9F 1AZSB 5EX0A 1RT5B 3MECB 3L2RA 1TL3A 5L9NA 4KR0B 5DG9A 2RN2A 3UVJB 3CJCA 3D6TB 1SIWB 2BKOA 2EX3A 1SIZA 4RLEA 2HQGA 4DQQA 3AXKA 4KH1B 4B9NA 1HMVB 1O5JA 1GLEG 1CVJA 4W5OA 2MQLA 3QIOA 3OD2A 1RT6A 2MZRA 1FHTA 2HHWA 5IT4A 3FBFA 2V4JA 2M0GB 4I6AA 2K1RA 3ZTSA 4ILHA 4IBNA 1S1WB 5HLFB 2NRHA 1YRTA 4KHUA 4I6MA 4E0DA 3JAMU 1KVBA 3NMUA 3KK3B 1RTJB 2E44A 3KLHA 4FK4A 2X1GA 3W7BA 4Z4GA 4K5SA 2IC3B 1YX2A 3UKRA 4A5BA 5H9EK 4WU3A 3U7JA 1RT3B 1T03B 2P5GA 2UXBK 3T1HK 1C0GA 2DXDA 2Q3PA 5IC4B 2AMCB 1LXNA 3QWPA 3R97A 3J7AP 2UXDJ 1FNMA 1Q8BA 3VQ5A 3KLEA 4IG3A 2LEPA 3PKYA 2BV3A 3RZAA 2R8HA 2DNMA 5GIPA 4ITSA 1WTFA 2IJNA 3GJQB 2QWRA 4LF6F 4BHQA 3DLLL 3SAGA 2HFOA 4DKWA 2NXCA 4AUKA 4LF6J 2YKPA 1NWKA 1SB6A 4OO1J 3DYAB 4U67L 4QYZJ 4NB4A 2PO4A 3US5A 2JJ4D 2JVRA 4BS2A 2QYCA 3QEXA 3VPZA 3BSOA 4PQUA 1MG7A 3AJ1A 1NNEA 1I94K 2J7WA 3C19A 2DGVA 5AZJB 1YVFA 3FKBA 4RKUC 3KTQA 1VQ5S 2HIQA 4KTWA 1H7WA 1WDTA 3VQSA 5AQPA 4N8OA 2OYQA 3HKZD 3R2DJ 2ADBA 1RAFB 4YDUC 3HFZB 3WXMB 1BE4A 1FXXA 3I33A 1M5OC 3DDKA 1RTDA 4JHDB 4ILLA 3W5XA 3O4NA 5ETRA 3PSIA 4DS4A 3ICLA 4C0HA 5J1EA 4TSXA 4H5RA 4FLWA 3FSIA 2ZHBA 4NLQA 2O01C 2CQIA 2W41A 5F0WA 2XMUA 3V2UC 4OGEA 3JSMA 3CCJN 1TL7A 1EQ0A 2AHOB 4X4OA 3DU5A 1HKGA 1NDCA 1R8PA 2PA8D 1VFJA 3W0LA 2NZ4A 3CDUA 2CPJA 3VQCA 2IYGA 3QEPA 3DAWA 4OV1A 2IAJB 2QIFA 5HAOA 3SV4A 1U49A 4KT0C 4ED0A 1OYDA 4J9SA 5JVHQ 3HVTA 4ZKAA 1DBDA 4RW8A 3PEJA 1HNXJ 2DNHA 3JXUA 4NA2A 4C8LA 3QT6A 2HBJA 3D68A 5IM0B 2GO9A 4NWBA 2OCEA 4WK1A 5IT9O 4FM2A 1ZC6A 4LF7F 4CF2A 2ZFHA 4RNNA 1IVZA 1T94A 1I94F 4RUAA 2OPRA 3VF4A 4YB6A 2CQCA 3AOCA 1M1KT 4W5RA 5LMNF 2UXCK 3KK1A 2XYHB 5IWAK 3DMJA 1QZ6A 4CNZA 2CH6A 3QRQA 3M2VA 3G6YA 4NPOA 5AQMA 4LRDA 3PIOL 4A8SA 3AB4B 3SPZA 5KFCA 5FPEA 2Y3YA 4MTPA 2C3PA 3H6EA 4TVAB 3HHNB 3LM9A 2KLAA 4XAKA 3WEEB 3MM6A 4IO9Q 2QXFA 1WI8A 4TU9A 3V4IB 3OLBA 2Z57B 4DV4J 3RRHA 3MMBA 2V67A 1YI2N 1DY3A 5KG6A 2CQHA 3MCNA 3AA8A 3CJBA 1YJNN 3Q8YA 2YNGA 2CWKA 1YXQA 2L08A 4OI3A 1U04A 3R3LA 2Y0BB 4ELTA 1IKYA 4DR5F 3DXKB 3LF0A 3CD6N 5BJRA 1MMDA 2HHHK 1TL4A 3JSYA 2F8HA 4DV7J 1MWZA 2OSQA 4BRFA 2BYCA 3LP2A 4M3ZA 3D2EB 4KHPF 1S1XB 4DTSA 3MI7X 2O8DA 3V81A 1OQ6A 1JLCA 4EBCA 3L7UA 1V3SA 1ZH5A 3S7RA 4W90B 4RZRA 1WHWA 4CD3A 2MEWA 3DHXA 3PFOA 1U2RA 4PCQA 1J5EJ 3KHYA 1HW8A 3QNWB 4DR7F 1RDDA 2MKJA 1N54B 4QR1A 3VALA 2WFBA 5E26A 2KG0A 4J2AA 5AQLA 2JEFA 1MWMA 1VAZA 3K8VA 4K4UA 1W7WA 4DZDA 4YHHF 2RRBA 4IH6A 2DY4A 1TU0B 3GCXP 4OJ1A 2ACYA 4U7BA 1WC6A 2H54B 2FTRA 4CJ3A 1E4FT 2O8FB 3D5MA 1BWEA 5AXNA 2HWIA 4KHQA 5EN1A 5ETMA 4Z4FA 4DV1K 2G2OA 1X9WA 3L0QA 4LH5A 2DD8S 3ET6B 3CJ3A 1C0MA 4IFYB 3I56N 4OL8A 5FDLA 1EKSA 3THVA 3NNHA 5DMRA 3CJQA 5DM6Q 2I5JA 3TA1A 2CAJA 1KVJA 2XWYA 4URQU 3IP0A 1BY9A 1C1CA 4DSFA 3IM8A 2M7SA 1Y5LB 3N4QA 1RU2A 1GH8A 2XZDB 2W9CB 4Z7YA 1IBKK 5HN0A 3CMQA 4C8ZA 1SV5A 2E5GA 1Q8LA 2M52A 2NSBA 3W3DA 4NYZA 1QSLA 4MYUA 4FLVA 3SSQA 3VF2A 5D78A 3VQAA 3KLGB 3LPEA 2WB4A 1RHRB 2HKEA 4LBHA 3L8BA 5FLXO 1NLVA 1X9JA 4CJUA 2WW4A 2P9UB 2J6UA 3EY1A 4CLLA 3KJQB 3S01A 5I3QA 2WAQD 1WF2A 1PC5A 2NZCA 2R7VA 3MAQA 3VQ8A 2GAGC 2N82B 3KLIB 3THYB 1OY6A 1Y64A 4M8LA 1QAXA 2YWWA 4K4TA 4DX8H 4FXVA 2CRLA 2ZM6K 4ZHRB 2ZOFA 3HD1A 1SKRA 3HVWA 2ZH9A 1P9QC 3AOAA 4D3HA 5F1XA 1UJ6A 4Y34A 3CCJS 5KQ8A 1ASVA 4DPXA 2ASYA 2FBVA 6FD1A 2HMIA 3FVYA 4BR4A 2J4RA 1ASUA 4QPTA 4ILMA 4LUBA 1SH3A 2DXFA 2BKPA 2BKNA 3KHGA 2GW8A 3I9V9 5C24B 5K9FA 4CT8A 4YOYA 4G1QA 1AUDA 1ATNA 3L2WA 3ZSOA 1GMWD 1G2EA 1HBNB 1LWCA 1VS3A 3PDNA 3M8ZA 4I67A 1HNWJ 4FKXA 2ZBRA 3MM9A 3D6RA 2V4RA 4E7LA 2HBRB 3L9ZA 4LRFA 5HMZA 2OAUA 2D1CA 3KNAA 1RHUB 3BN4A 1WEZA 3KLVA 5F8NA 4R0JA 2D69A 3CIPA 2MLXA 2ZH8A 1F3VA 3I0SB 1XMOK 1X3MA 2XHWA 3MEGB 4ID5A 2DRBA 3G6EN 3BF1A 4FWPA 4OLPA 1KSPA 3MPYA 4L75A 1KDNA 1VGYA 5BR8K 3TQEA 1WHXA 3WIUA 5I9EB 2JEGA 2G8KA 4DL0C 4CGJA 3PVXA 3QFPA 1FFGB 4DSIA 2EFVA 4O3NA 5HQMA 4WF9L 4Z4IA 1KS2A 4CJFA 1RP5A 4JP8A 1HI8A 1RDRA 5I42A 3TVZA 3TTFA 4A46A 1YJNS 3DLRA 2VJUA 3MMAA 1X8DA 4UT4A 4DSKA 3H3NO 2CPYA 2QEXN 2HBLA 3VQDA 1OH7A 2KHDA 5ETLA 5LJWA 1KXPA 2J0QD 3A3OB 4MK9A 4A59A 2B7CB 2KT5A 3KUEA 3MR7A 3L7OA 3JTPA 3VEWA 4OI1A 3D0PA 4ECSA 4PKIA 4FYXB 2CJKA 1K8KA 5ADXH 1TV6B 2HFNA 1XMOJ 5KOWA 2ZOGA 1UVJA 2F9WA 1NM1A 4H8KA 4CJTA 1WD6A 1RT7B 1Q16B 1XMOF 5AJ3K 1VQ7N 1TVRB 7FD1A 3C16B 1JLBB 4IZ9A 7FDRA 3CJ9A 3SJHA 1YIJN 2CPHA 3ZZPA 1RAHB 3T69A 2P9SB 1VC5A 3BYRA 4LF8F 2F3JA 4JI8J 3P8BB 4DTJA 1VK3A 3MAHA 3PO5A 5KFLA 4FPRA 2DNGA 2GJFA 3DC2A 1Q81T 5RUBA 4LQ9A 5CYJA 2E1AA 2R7OA 1Z2ZA 3NCRA 1XHXA 4B1UB 1BHNA 1FEHA 4A8MP 4CH1A 3CMEN 4ENOA 1NOYA 3C66A 1UP1A 4CJLA 2ZKUA 3M1FA 1Q5YA 4A61A 1Q0NA 2HQCA 3OR1B 1KFSA 3QAUA 1NH8A 2WB1D 2YWKA 3C8YA 4WU2A 3O3GA 3DLJA 3E9PA 4TY8A 2KDOA 4WCEL 2W2QP 2R8JA 2XHCA 1ULRA 3TZXA 2D0CA 4FBUA 4X66J 2W40A 4CLTA 3ENAA 2E9RX 5IQ6A 2UVUA 3CDAA 4NLBA 2EPIA 4IDKA 3DRPB 4DCJB 4PG4A 1HHTP 2MYFA 2ZZTA 4CO3A 4P74A 4C8OA 1QSSA 4Q45A 3OR2A 4CYUB 3P83D 5J2QB 2LDIA 3C0BA 3W65A 1KNZA 1GTHA 3JB9k 2J6SA 2BM0A 4OZ3A 1JJ4A 1N33J 3CFOA 1ZAXA 5A2QO 2C2DA 1RWKB 3NGKA 4HKQA 5HOOA 3P45B 4KTQA 1UAXA 1N33F 4K8RA 4CZGA 2YKMB 1ZM2A 2VKRA 2VFTA 2GAHC 3GSIA 1JJHA 4ZTFA 4M41A 9ATCB 1ELOA 2VDIA 3MFIA 4DU4A 1SBRA 3QJLA 5I3UA 1YJVA 2HF3A 2GVDA 1FJ7A 4NL5A 4B1ZA 5ELZA 4HR2A 4JV5K 1Q7LB 4PAAA 4DMZA 3IS9A 4DL7A 1VYAA 4WXWA 4LR8A 4EO6A 2XM3A 2CWXA 3UR3C 3G86A 1VQPS 1U1RA 5H1SV 2B9YA 1T6DA 3C3LA 5MAOA 3CCRS 4IRCA 3VA0A 1IG9A 2H5JB 3AV9A 2A2CA 5A6PA 4CM0A 2ZDOA 1AT1B 3JQMA 2POKA 5CABA 1YTAA 3ZZOA 1JWWA 1BO5O 4OGCA 4RW7B 4AM6A 4PL7A 3KG1A 5AQTA 2JL9A 2NZTA 1BA0A 3C6TB 2BW2A 1OSCA 1I39A 1S72N 3P5BP 2F8MA 1F9FA 1SJRA 2A2DA 1S79A 4J9QA 4JB8B 1BG3A 1B9DA 4Y3CA 4RW4A 3GFHA 3UI3A 4DPYA 5DQGA 4FWOA 4JI3F 3A5LC 1E6YA 2AF6A 1I94J 4CLYA 1IN0A 2VF3A 5AJ3J 4W5TA 5D3GA 2YPZA 3CG7A 4B3TJ 3FEXB 4Y0FA 3V9SA 2IVMA 1AROP 1ZOTA 2L9WA 1KVKA 2WBNA 1BLUA 4FS1A 1C4CA 3K57A 1RUSA 3TAMA 2GVZB 1T9WA 3GZ7A 1XWLA 1FKAF 4KJIA 3JSRA 2FVCA 5DM6L 1S57A 2V7ZA 4CHQA 1REVB 4OHZA 2KKHA 1NKEA 1H6KX 1VQOS 1N48A 3OW2R 2EHGA 4Y1DA 3IMXA 5KFQA 3FLCO 1KQKA 2Z2ZA 2N3OA 3BKUA 3Q23A 3A3NB 1T9UA 3ZC4A 3P6YC 3IGVA 3H5SA 2ZDPA 1VQ9S 2VHGA 3IA0A 2QEXS 1LWXA 5A8RB 2C3MA 4DV3K 4FXWA 3PFEA 2KZZA 2P9KB 3HJVA 2AJQA 2OIHA 3C7NB 2UVWA 1WSRA 1S5JA 1VC6A 1IJFB 4KHPJ 4ICLA 2HHPA 3LGNA 3M9NB 1RT2B 2CQ4A 3N79A 4NYPA 3WT0A 1S6UA 3EVWA 3RB4A 2ZKTA 1IJEB 4OIXA 2G8FA 2PT0A 1FJGF 1EP4B 3R8YA 2MQPA 2QLBB 2OHDA 4DR3F 1GX5A 3C65A 3EEQA 2KVQE 3D7EO 3D1OA 3IAYA 3ZLJA 1K73T 4DCOB 1FFWB 4FNIA 3AFGA 2XMTA 2YTCA 2KO1A 4X4RA 2HBYB 3N9UC 4X64F 4ZVFA 2GUPA 4TQSA 3G6VA 2FXUA 2ZITA 2XMKA 3DLKA 1QE1B 3L4IA 2V2KA 1P6TA 3QMLA 4PL8A 2OZMA 2AIRB 2JDJA 2C42A 2XG8A 3OQ2A 4FVMA 1W2IA 4N7TA 4K59A 3OTOK 1XERA 2D0OA 5AQOA 3H25A 2DGSA 2A5XA 3KFWX 1NGHA 1FFSB 2PMHA 4DPWA 2KI2A 2LDYA 2Z30B 3MN5A 2HGMA 1NU4A 2MDAA 1S6PB 3CF5Q 3OYBA 3DOMA 1N5YA 5A6WA 3N6NA 4NLXA 3Q8PB 4E1JA 3D3CJ 5C10A 4CHZA 3H4DA 1UWAA 5LMUJ 4MIBA 1EXQA 4CO1A 2HQ3A 1GLAG 1EWQA 4M1KA 3OTCA 4KO0A 4KHYA 1Q5VA 4EO8A 2ZM6J 3VQEA 1N8RO 3O6QA 2A1SA 1YHQN 4B3OB 4QWBA 1LWFA 3OYAA 1QAIA 4HHUA 1NGCA 3SUPA 4QWCA 3AA5X 2YBVA 2HB5A 1YJ9N 3VA3A 1K0VA 4YDXA 4ES1A 3V1QA 4CM2A 1N5TA 3VQ7A 4YP3A 2FC9A 5F9NA 3DLBA 4DR6F 3BGFA 1ZXOA 4AM7A 3KJNB 1QAYA 4PWDB 3BGLA 4HACB 3K9KA 3L6QA 2E7XA 5DO2A 3J81O 1SJ1A 3THTA 1HHQA 1N5SA 3MM7A 3R1XA 2PYLA 4MYTA 1VQPN 1DJ0A 3O2IA 2GHPA 3ALYA 2HPUA 5GADU 4B3MK 1GAOA 3MF5A 2ROGA 4DG1B 4IH7A 1XR6A 4I2PB 2CZ9A 3O3FA 2HGLA 3SZ2A 4DQIA 1CQNA 4PXBA 4USHA 4B1XB 3NOCA 2GIRA 3CUNA 3NCQA 3KVGA 3FEYB 2OMOA 2QV6A 2QKKA 1KTVA 3OL8A 3TEGA 2E5HA 3K89A 5FROA 4USTA 3U4LA 2W24A 3CCLS 2VCPA 1TKTA 1LAVA 2YKOA 3BPSP 5GAEU 4ZLPA 4FWMA 2DGOA 4ZJLA 1S0MA 4CBWA 2QKBA 3K5OA 2W7OA 4JKFA 4J7CA 1TUVA 4OX8A 4KV8A 5HBMB 4NCGB 2H9ZA 2UV8G 2N4DA 4ZP9A 2VQFK 1X4AA 2GX9A 2D3UA 3QIDA 4DR1J 5J2NB 2C1EB 2J9DE 1WHYA 4DR1F 4IUFA 3R7BB 1Z26A 1P1LA 4EHUA 3GFXA 3S8SA 2NNWA 2YNFB 2VOPA 4NMXA 2CJBA 3EJMA 3R7NB 3W8GA 3HI9A 4NZ7A 4CCHA 1VISA 2Z8QA 2R2SA 2OA8A 3D2FA 3DNCA 1NMNA 4JRQA 3ZEUA 1OY9A 4J9PA 1EQMA 2MSSA 1N88A 3VGUA 4DUYF 1NB7A 1WAFA 3MOZA 4CTAB 4ZN1A 2NQPA 1RDUA 4L8RB 2HNYB 3PIPQ 4B3TK 3OYKA 1JCEA 2IBKA 4U7UK 1G99A 2XMMA 1XC3A 2OJ3A 1HD1A 2EC0A 4DZ6A 4G3IA 2G0CA 4A8XA 3CC4N 3OSNA 4CI0B 2CQ2A 3KNGA 4KAZA 3UDCA 3NWGA 4O0NA 1OPZA 4LRCA 2R7RA 1JLGB 4LFCJ 3ZTQA 1OO0B 4AHUA 3JQJA 3VAIA 1VHIA 5JLHA 4QJVA 1NB2A 2F8TA 4DR7K 1JJCB 2ASOA 3H08A 1GK8A 2D74B 4U96A 3FCWA 3V6KA 2NCKL 3KUHA 3OS0A 4NLYA 4BRQA 2DHHA 1IH7A 5BPLA 3B78A 3O1WA 4XTTA 3DGPB 4O55A 4P52A 1PJ6A 5AXMA 1P90A 4ZPAA 3CCZA 1KCFA 4H4OA 5IC6B 4M45A 3PRBA 4EFAC 2YJEA 5C15A 3SI6A 4DU1A 3V6HA 4F0HA 4ISFA 4CZFA 3V9WA 1EETA 1N4LA 3NXZA 1OS5A 2GV1A 3B54A 4PKDB 4X66F 2IIHA 3CPWR 2K2PA 4BRMA 4DFPA 3MMJA 4FJMA 2DTJA 2KT2A 1IQZA 4RNOA 4O23A 1EAYC 3D9BA 3NBPB 1J54A 4C97A 1JCGA 4EIAA 2QWMA 4KPYA 3BEXA 3CD5A 4ID1A 4PXEA 1RBOB 3SSSA 5C7PA 1HQUB 4UF4A 2OPPA 5SZTA 1K8AO 3QGIA 2D1KA 2YKQA 4P2MA 5KFZA 5CQGA 3BSCA 4I6WA 4LRBA 3LDNA 1WSJA 4O3OA 4E98A 1H38A 1FNOA 5HVHA 4YOEA 3NBPA 3ONQA 3I5BA 4QW9A 1YJWN 2DFHA 3AVBA 1IKVB 4JI3K 3DRRA 3DDIA 4O44A 3AGRA 3KUGA 2CQDA 3IXQA 1YWXA 3LOUA 3SMSA 2LSNA 3KG4A 4ZLJA 4ZLLA 3QBXA 2E20A 1Z25A 3L7PA 2ZVSA 2IVPA 2E5LJ 2R2UA 5GAHP 1LEOA 4BE1A 3GIRA 1OIAA 2OEJA 2XNQA 3CMAN 2E5LF 1CJVB 5HQ8A 3LL3A 2BH1A 3LH2S <