3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
4CK2A 5C24A 4ECZA 3HPGA 4OPJA 3M9MB 4CIGA 3L2VA 5KFJA 1S9EB 2EHGA 3GQCA 3ZSQA 1SUQA 2Y1JA 2VG6A 4FJMA 1T03A 3CFRA 5L1LA 5DGBA 2FVSA 3RRHA 2RKIA 3ITHA 3ICLA 4NRTA 1L3VA 2YKMA 1IKYB 5EWEA 4HTUA 1C0TB 1C1BA 1WNSA 3SFUA 3IRXB 4YQWA 2IAJA 1BL3A 4EBCA 5T14A 1YVFA 1HRHA 2YNFB 2E6LA 3EY1A 4CK1A 5KFZA 5CYQA 3NAHA 4NYZA 2ZD1A 1NJWA 2G8IA 3QNNA 3TAEA 1SH0A 1U4BA 4K4YA 3CJ2A 1MU2A 4FK0A 1LWFA 3DLKA 3N6NA 4IOBA 4PQUA 4FYDA 2C28A 3H4BA 4XO0A 5KGWA 1BCOA 1SH2A 1TL3A 2HAIA 2YHAA 4GC7A 1CZBA 1EETB 3G6VA 4M3WA 3CFOA 2V9WA 1KSPA 4RW6A 3DRPB 4TLRA 1JKHB 3KD5E 3VQ9A 3DLGA 3LWLA 3M8PA 3PHEA 4ZPDA 4F8RA 4IH5A 5KT6A 5HROB 2OH2A 2FLPA 5HP1A 1UWBB 1HYZA 1VRTB 3WNFA 3RMDA 3VQBA 3KLGA 1TKZB 1S1WB 3I5AA 4WZMA 5FDLB 3QYYA 4B8AB 1NKBA 2IC3B 3L2QA 4IR9A 4IH7A 5KG6A 3ISND 1K1QA 2UUTA 1RBRA 1T3NA 4DTSA 2I5JB 2ATQA 2XHBA 4O5BA 3UDLA 1C1AA 2W9BA 3DMJB 4M94A 1GX5A 4QW8A 3WNGA 3UIQA 4NCGB 4B08A 4QOZB 2AU0A 4Z0UA 2NUBA 3C6UA 4G1QA 4K8ZA 3CM5A 1LW2A 3KK2B 3BREA 3G6YA 3TARA 5J1EB 3I0RB 5C42A 3VQDA 4CF8A 1WSJA 3KTQA 3UQSA 3DLEA 3CJ3A 4MQ3A 4CEDA 2WOMA 5EDWA 3DLRA 4ZVEA 1S6PB 5JS1A 2XGPA 2Q3SA 1XHZA 2D41A 3SYZA 3NBPB 3V81A 2OZMA 3ZSVA 4ICLA 1K6YA 4O4GB 3KLFB 3OYDA 3AVMA 4TYAA 2GV9A 3QEWA 2IMWP 4RNMA 4FJ8A 4LSNB 4O44B 3LP3A 1S6QA 5KTQA 5KRTA 3ZSYA 2YV0X 1YVUA 5L1JA 3AVFA 1VSMA 2HW3A 1QUVA 3MEGA 1ZBHA 4QWAA 2ASLA 4ECUA 5F8MA 4J2EA 4LQ3A 4IKFA 4B9LA 4GMJB 4TY8A 5T7BA 1R0AB 3VN5A 1YTUA 2IM0A 3V9XA 4B3OA 4DL2A 4MK7A 3FSIA 1KTQA 3H98A 4F4KA 2XGQA 4ZVGA 4FJNA 1TL1B 4U7CA 3VQSA 5J2MA 2WK4A 3OYEA 3OSNA 2FVQA 3OLAA 1RT6A 1KLMA 4J9KA 4CEQA 1QE1B 3MEEA 1W25A 1RDRA 3PW2A 4DTOA 3MFIA 5F8GA 2FC0A 5K14B 1SKSA 4IH6A 4R8UB 1VSFA 4IBNA 4ECXA 4X2BA 2KTQA 2OPPA 2IJFA 2HHSA 1NJXA 4M45A 1TV6B 3TQ1A 4JS4A 2BQ3A 1S9GA 3QEVA 4RUAA 1JLCA 1HQEB 3DOLA 4RW8B 3NF8A 4Y34A 1SKWA 2YNHB 1YT3A 4TQRA 5KFSA 4DS5A 1IH7A 1JIHA 5DG7A 3AA2A 1HNIA 3UPFA 3QEXA 4FJJA 1XC9A 2HHTA 4IRDA 2ITGA 5KG7A 4Q43A 3RWUA 1J5OB 4KREA 4CJQA 4CGIA 2HNYB 3RBEA 4IRKA 1KLNA 4ZHRA 3AVLA 4BACA 4ED2A 4NLVA 2DFFA 4YR3A 1Y97A 5FROA 1JLAA 1A5WA 5KG4A 4ECRA 4E89A 3PO5A 1DLOA 3NH0A 4KO0B 3TANA 3TAMA 4C8OA 1RYSA 2FJWA 2VG5A 4AH9A 5FRNA 4E7KA 4MK9A 2HB5A 5JXSA 2OPRB 4NLOA 4AHSA 3KHHA 1NHUA 3KJVB 1JLEB 4ECTA 3I8DA 2IOCA 3NGYA 4U6PA 1BIUA 2KZMA 3LP1A 3OL9A 4CGDA 3LALA 3I0SA 3NAIA 3V6HA 3MECA 3PO4A 3MR2A 1U49A 1BHLA 2ZE2B 4CHQA 5KFPA 1WSEA 4E0DA 3PZPA 2IGIA 4MFBA 2FLLA 4NCAA 3H2LA 1JLBB 4ZP8A 5I42A 2O4GA 4F4WA 2QV6A 4FLYA 2V4RA 3KK1B 4QW9A 1C1CA 5KT4A 2BQUA 3OYJA 2PYJA 4CIEA 4CHNA 4ELUA 4KB0A 2BRKA 4IFVB 4DTRA 4M41A 4DU1A 4J2AA 4EZ6A 3QERA 3E01A 3DRRB 4NLPA 1VSIA 1HPZA 3PX0A 1S5JA 5KFIA 1S48A 1S1VB 3PR5B 4KAIA 1TK0A 3CG7A 2YKNB 3CJ4A 5KG2A 4Y2AA 1U47A 1UA1A 5HLFB 5HRPA 3MEDA 2FVCA 4CJVA 1XHXA 1W0HA 3VQCA 3F9KA 2GIRA 4H4OA 3QNOA 1LWEB 4PUOA 4KBIA 1RTIA 1WN7A 3S9HA 1JXEA 4OKJA 4CJFA 2QKBA 1RTDB 1CXUA 2Z1JA 3VQPA 1IKXA 1KRPA 3KIOA 3B6OA 4W5NA 3DYAA 4J2DA 4B9SA 4IQXA 3NH2A 1RAJA 1S0OA 4KKOA 1EP4A 4RG8A 4KHSA 4DEZA 3NF7A 2QE5A 1QQCA 2LSNA 1SV5A 3PVXA 1RT5A 3SV4A 2XCPA 4YMEA 4BE0A 4Q0BB 4OJRA 4DF8A 4WYWA 3DLHA 4B9VA 2DPIA 4CFBA 5SWMA 4Q44A 3V4IB 2P5OA 4MK8A 4J9LA 1A5VA 3T1AA 1NK0A 1EXQA 2YNGB 1TKTA 4CHZA 3NL0A 3NGIA 2Y1IA 3NCIA 2AJQA 3N6LA 2FBYA 4DS4A 4CF0A 1SL2A 3D28A 2WCXA 4EBEA 3O4NA 1SKRA 3QGGA 4F4XA 4J9NA 3S3NA 3KKRA 1J5OA 2G8VA 2Z1HA 4OKKA 3TVKA 1C0UA 1BQMA 1ASVA 5DGAA 1RT2B 3ZT3A 2YHBA 5KT7A 4ZVHA 4DSJA 4LD0A 2XRIA 3ZSZA 1WSGA 2B6AA 3HL8A 4IKAA 4ED7A 1NJYA 1ASWA 4Q8FA 4FJGA 1U04A 3L2UA 5J2PA 4ED8A 4CECA 3LP2A 4WE1B 3B6PA 1WAFA 4CEOA 4EP5A 4IFYA 3RMCA 2OYQA 4DF4A 3QIOA 3O3FA 1D5AA 4CIFA 1S1UB 4Y3CA 3K58A 3O3GA 2W7PA 4FW2A 4CEFA 2OPSB 3T5HA 4DFJA 3M8QB 3CDEA 3C6TB 1RT3A 4FK4A 4CHOA 3DI6A 4IG0B 2FJVA 5HRNA 3PR4A 4B9NA 4KHWA 5D3GA 2ATLA 3SQ0A 4ZPAA 3IAYA 3S3OA 4E3SA 4J9SA 3THVA 4CGJA 4FXDA 1NK7A 4JV2A 1HNVA 4DL4A 1KFSA 3MR6A 4DMNA 4WFZA 4QWDA 3AO4A 1NNDA 4I7FB 1RBSA 2XCAA 1TP7A 1ZBLA 3ZT0A 3V9UA 1JLQB 4PWDB 4KRFA 3LANA 3TAGA 3QLHA 4YNQA 3NFAA 3AVNA 1RT7B 4K8XA 3FFIA 3V6DA 3K2PA 4HVJA 2B5JA 5KFGA 1SL0A 3RB6A 1J54A 1RTJB 2XY7A 4IDKB 1JL2A 4I2QB 4KV8B 3IGNA 4TN2A 3V1RA 3PJXA 3GIKA 1NK6A 3AVBA 1S1TA 1S49A 4RW9B 4Y2CA 3KLIB 3D5MA 4Z4FA 1UOCA 4RUCA 4C8NA 4TXSA 1JXBA 4ZP6A 4CJPA 1T05B 1LWCB 1CLQA 3A2FA 1U09A 1EX4A 3NHGA 3DRSB 4FM2A 3AO3A 2XO7A 3QZ8A 4AHTA 4F2SA 5L1KA 2X78A 4O55A 4O3SA 4W5QA 1SH3A 4FLUA 3OHAA 1I3AA 1NK9A 4LH5A 4RNFA 4IR1A 5HBMA 4QWCA 2ALZA 3IS9B 1ZETA 1N6QB 3HVTA 4OVLA 4RW7B 4EEYA 2UVUA 1ZBIA 2X74A 3AA5X 1D8YA 2YNIB 4Q8EA 1CSJA 2GUIA 5KT2A 3HSTB 2XY6A 3T3FA 1JLGB 1RDDA 3IG1B 2RF2A 3QIPA 4XPCA 1LW0B 2WRMA 4GC6A 2IM3A 4KAZA 1BI4A 1N5YA 2P1JA 3SI8A 3BSAA 1QS4A 3RMAA 1VSHA 4ZP9A 4DSFA 1QAIA 3SUQA 1HYSB 1HQUB 5KFFA 2D0CA 3G0ZA 5C25B 3PW4A 3ISNC 2G8FA 4FJ9A 5KFOA 3HP9A 4CEZA 5I3UB 4N5SA 2GIQA 4EYIB 5J2NA 3GV5B 1REVB 2RPIA 3QGIA 4O0JA 1N56A 1GOBA 1ITGA 4CK3A 3VA0A 4J9QA 3OLBA 3V1QA 4R0EA 3KHRA 3AVJA 4JRQA 5CZ2A 1FKOB 2WHOA 4Z4HA 1HMVA 3PX4A 2A1SA 3KKSA 1KCFA 4E19A 2DFHA 3OSPA 3KLHA 1S9FA 1TAUA 4RNNA 4FJKA 4LY7A 3M8QA 5DQIA 4E1MA 4ZP7A 3OYCA 3Q8QB 3V9WA 2W7OA 1VSKA 2R8KA 4IG0A 3BDPA 4K4ZA 1GX6A 3DOKB 1X1PA 3ZT4A 4ZVFA 4LSLA 4OKEA 3MAQA 5DLFA 4DFMA 4HCCA 4OGEA 1TK5A 1JLFA 1RT1A 5KFYA 1RILA 4KFBA 3JYTB 4FJXA 3JSMA 3K59A 3BQ2A 4E7LA 3HVAA 1W9HA 4BDYA 1RCHA 3H4DA 3QEIA 4HUFA 2XY5A 3V1OA 3FRZA 1EKEA 1BISA 4BWJA 4CE9A 4I2PA 1DTTB 4NCBA 2VWJA 3U3YA 1IM4A 1L3SA 1XR6A 2V0NA 4CJLA 3LP0B 4M3RA 3BJYA 4FLWA 1S9EA 2HHVA 4CEBA 1RBVA 4CEAA 2E4LA 1Q9YA 1KFDA 4K50A 2HNDB 1S1XB 4DTMA 3HPHA 4KB7A 2DTUA 1IKYA 2RDJA 5KFBA 1C0TA 4FLTA 3QO9B 5CYMB 3IRXA 5KFVA 2PZSA 4ID1A 1T05A 2YNFA 2E6MA 3HXMA 4JUZA 1RBUA 1YTAA 1ZBFA 1FK9B 5J2QB 2R8HA 2AX0A 4RU9A 5E41A 3L8BA 2AQ4A 2ZQBA 1SL1A 5KFQA 3P1GA 3H08A 3AVIA 5HRSA 4B9UA 5KG1A 4ECVA 4DU3A 1TAQA 1KVCA 4YR0A 1MMLA 3MFHA 2RDIA 2BGGA 1EETA 4YR2A 4CCHA 2OPQB 3FQLA 2ASDA 3DRPA 1JKHA 3C94A 3SUNA 3VQ4A 3ZT1A 2KZZA 4RW4B 1L3UA 4J9RA 3CIZA 4F3OA 2IA6A 4N41A 5CY4A 3GV7B 2C2EA 5KT3A 5KFAA 5HROA 2XI2A 4NYFA 1O1WA 3V6KA 4E1NA 2ASJA 1UWBA 2BANB 1VRTA 4KTWA 4CJ5A 1DTQB 1TKXB 1TKZA 1B92A 2O5DA 3RTVA 1S1WA 1ZYQA 2G8WA 5FDLA 4FS2A 4FM0A 2IC3A 3VQ5A 2HNZB 4TQSA 3GYNA 1RTHB 3V9SA 3NMAA 4BDZA 4KSEB 4MKBA 4EO8A 2I5JA 3HKWA 2Z1GA 3DMJA 2FVPA 3QINA 3DM2B 4NCGA 1L5UA 3SUOA 1RT4B 3CDWA 4ED0A 3ZT2A 3ALYA 4NYNA 4IG3B 4CGHA 3KK2A 3ZSRA 1NK5A 1VRUB 5J1EA 2JLEA 4B8CA 2HHUA 3I0RA 1JX4A 3OVNA 2IBKA 4FCYA 2CJQA 3KLEB 4NLXA 3OYKA 3K5MA 3AV9A 1TVRB 1WAJA 3T5JA 1S6PA 1BQNB 3EYZA 4FZXC 1IKVB 4OLAA 3H5UA 3KK3B 1RA7A 3NAEA 3NBPA 3K5LA 2IJNA 3H59A 3H40A 4O4GA 3KLFA 3MTKA 2W9CB 3QESA 4EP4A 4O4RA 4DSKA 4GW6A 1IKWB 3NE6A 4NLUA 5JUMA 2C2RA 4LSNA 4O44A 4BWMA 2WONB 4R5PB 3SUPA 2JEFA 4DG1B 4M3XA 1LAVA 3OS2A 4FLVA 3RAQA 4YP3A 3AO5A 5DK5A 2VG7B 2IM2A 3T5KA 1QSSA 1FKPB 2BE2B 3KHLA 1UAXA 3PV8A 1R0AA 4KHQA 3GILA 4H4MB 4CJEA 4CHPA 1JXLA 1J9AA 4MKAA 4FZZA 4IRCA 3BGRB 1F21A 4ID5B 3CFPA 2UVRA 1TL1A 2XY8A 3H5SA 1WSFA 4E7IA 1I6JA 4CFDA 1WNEA 5C24B 3AO2A 4W5RA 1QE1A 5F8IA 5KFCA 1GOCA 1D0EA 2QXFA 2AGOA 2EC0A 3PW7A 2EX3A 3TAPA 1SUQB 2DPJA 2VG6B 3OYBA 4KHNA 5K14A 1T03B 3OYIA 3LPTA 4R8UA 4DTXA 2AGPA 2RKIB 3ITHB 2YKMB 2KW4A 4E7HA 3I5CA 4FS1A 1NOZA 4QCLA 1TV6A 1C1BB 1RA6A 2IAJB 4FJIA 4YFUA 1B9DA 3AVGA 5DG8A 2PY5A 3VQQA 4BE1A 1HQEA 1QSYA 4URGA 2HVHA 5CYQB 2D0BA 4RW8A 1VSLA 2ZD1B 4ECQA 1LV5A 3SV3A 3Q8RB 1OS5A 4WZQA 4FK2A 1BIZA 4CJ3A 4JV0A 2YNHA 1MU2B 4M3ZA 1LWFB 1QHTA 4LH4A 3TAFA 3DLKB 5KFHA 3L2WA 3LZIA 3OJSA 2F96A 1VK0A 4PQUB 4ZMMA 4W5TA 2D3ZA 5KG3A 2VA2A 1WSHA 1TL3B 1C6VA 3L2RA 4JV1A 3HJFA 3NF9A 3OYMA 2HNYA 2B4JA 3AA3A 2QK9A 3OL6A 1RDBA 5F8HA 5F8LA 4RW6B 5EWGA 2O4IA 1RTHA 3DLGB 4B9TA 3M8PB 3SNNA 2R8GA 3ASMA 4WXOA 3RBDA 5HP1B 3BSOA 4KO0A 1RBTA 2DFEA 4JS5A 4PY5A 3EZUA 2IDOA 3WNEA 5KFXA 4WXWA 4WFYA 2VA3A 2JC0A 3OHBA 3DDKA 2ETJA 2OPRA 3O4QA 4J9OA 2Z1IA 3KJVA 1VRUA 1JLEA 4F4YA 3U3GA 4O3QA 2HWHA 5DMRA 4QPXA 4K4SA 4FLXA 2JEGA 4BDPA 4CF1A 3KNAA 2W9BB 1NKCA 1RDCA 4HCBA 5EWFA 2OA8A 4K4WA 2ZE2A 3LPUA 1T94A 3C6UB 4G1QB 1QTMA 1HARA 3S3MA 5FRMA 1LW2B 5EUHA 1JLBA 5C42B 1ZTWA 4PA1A 4ED3A 3ZSOA 3KK1A 4EO6A 2JGUA 4R5PA 2F8TA 4J9MA 2JEIA 1NJZA 3DLEB 2QKKA 2WOMB 4IFVA 3SCXA 3SQ2A 2J6UA 4NZ0A 4ECWA 3DLBA 5KGXA 3DRRA 3V81B 3CVKA 5KFNA 4ECSA 4G3IA 3IGVA 3HT3A 1NHVA 4DLEA 4ICLB 4C8MA 1N48A 4FZYA 1S1VA 3GIIA 1X9WA 2YKNA 2HHXA 4F2RA 2C2DA 3AVCA 2FLNA 1VSJA 1D9FA 1S6QB 1A5XA 5HLFA 4OPKA 3FDSA 3MEGB 4HHTA 3TAQA 1LWEA 4TY8B 1ASUA 1RNHA 1RTDA 5HRRA 4B3OB 4CESA 4NLWA 4N76A 2GC8A 4HYKA 4HUGA 3QETA 3TABA 3ZSXA 2W9AA 3OJUA 2VWKA 5J2MB 3OYLA 4URQU 1RT6B 1KLMB 3KMSA 4K4XA 4DQRA 4MIAA 4CF9A 4KB1A 4CFCA 4Q0BA 3MEEB 2R8IA 1FXXA 5KRSA 4B9MA 3V4IA 4OL8A 1GOAA 2YNGA 2XWYA 4ELVA 3LAKA 3U6FA 2OPPB 3G6XA 1IO2A 2DY4A 3M8RA 4FBTA 2FBTA 1KHWA 1S9GB 1JLCB 3KD1E 3H5YA 4KPYA 3I5BA 3DOLB 2D3UA 4H54A 2X6SA 1RT2A 4ECYA 4F4ZA 3MF5A 4ELTA 4Y1CA 1Q9XA 4FW1A 2RN2A 1KVBA 4O3NA 1TGOA 2W8KA 2P5GA 5KT5A 3F73A 1HNIB 2PYLA 3T5LA 4WE1A 2ILYA 4EBDA 4DTNA 3RR8A 4KHUA 2E9TA 2BR0A 1IG9A 4ZHRB 3BQ1A 2R7YA 1S1UA 3OYHA 2HHQA 1RYRA 5DQGA 2OPSA 4CJSA 3CDUA 4DL5A 1U48A 5F9NA 3HO1A 1S4FA 3C6TA 2JEJA 3QZ7A 1JLAB 4DSIA 1DLOB 4EYHB 4DL7A 3TWHA 5KFLA 3HPOA 5JS2A 3TAMB 2R8JA 2VG5B 1XR5A 4FJHA 3CM6A 4FJ5A 3Q8PB 1ZTTA 4CERA 1NKEA 1VSEA 4QWBA 4CJRA 3H5XA 2BDPA 3NGDA 3PJWA 4KI6A 1TQLA 3LP1B 5C5JA 4TYBA 3PY8A 4K4UA 4I7FA 3SJJA 3I0SB 3MECB 1T8EA 4ZPCA 5F8NA 4DSLA 4KE5A 3T19A 3NKYA 1JLQA 4PWDA 4AHCA 5DQHA 4ED1A 2KFZA 1Z26A 1QSLA 4OGCA 1RT7A 4DFKA 3EPGA 1NK8A 2CKWA 4DTUA 4MFBB 1NK4A 2I1RA 2X6NA 2GBZA 4F3TA 2HHWA 5I42B 1RTJA 5F9LA 4M95A 3OS1A 4KHRA 3VQAA 1TK8A 4IDKA 5KFMA 3M9NB 3D45A 4Z4GA 4I2QA 4KV8A 4Q5VA 1C1CB 3BQ0A 4KHMA 3D0PA 2UVWA 2IS3A 3G86A 1XWLA 3OS0A 3VQ8A 4RW9A 3KLIA 3PW5A 2D7SA 3MXIA 4I9QA 3MXMA 4W5OA 4RNHA 1BCMA 2V4QA 3E01B 4QAGA 1S0NA 1LWCA 1HPZB 2HMIB 2R2RA 3LZJA 3DRSA 2J6TA 3MXJA 4MIBA 4J9PA 1WSIA 1HYVA 4URSA 3PUFA 1ZBUA 3MEDB 4H4OB 3IS9A 4DQQA 2WTFA 4PUOB 3VA3A 1N6QA 3P5JA 3L3VA 4NLRA 4Q45A 1RTIB 4RW7A 1D1UA 4ZTJA 1IKXB 4CJUA 3RR7A 2YNIA 3DYAB 4KKOB 2XI3A 2AGQA 3HM9A 1EP4B 3OL7A 5L1IA 1JLGA 3IG1A 4M42A 4FLZA 3NH1A 1LW0A 4Z4IA 5KG5A 1SV5B 2AX1A 1RT5B 4L8RB 3AVKA 1I39A 3UR0A 1HYSA 1HQUA 4O3PA 5C25A 3QEPA 3CJ0A 1WLJA 4K4TA 5I3UA 4O3RA 1TKTB 1X9SA 2FVRA 1XI1A 1REVA 3KHGA 3K5OA 4UQGA 1Q8IA 4CGGA 3HVRA 3OYFA 2FBXA 3SPZA 4NLDA 3OL8A 4HKQA 1FKOA 1K1SA 3K57A 4DL6A 5KFTA 3OY9A 1C0UB 1BQMB 4XPEA 4NLSA 4H8KA 3L3UA 4DWIA 3K5NA 3RAXA 3V9ZA 2KFNA 2B6AB 4LQ9A 3PX6A 3WNHA 3RB4A 5J2PB 3CYMA 3BSNA 2P51A 2OZSA 3LP2B 3ZSWA 1LAWA 3DOKA 3SFGA 4GVMA 4BE2A 3SZ2A 4IFYB 3VQ7A 3JYTA 4CGFA 2JC1A 3G10A 1CXQA 2G8HA 2F8EX 3NGZA 4AHRA 2J6SA 1RT3B 2FJXA 3CWJA 2W42A 4C8LA 3DI6B 4OLBA 3EZ5A 4MH8A 1DTTA 1L3TA 3MR3A 1Z25A 2ZKUA 4AHUA 4NRUA 2E9RX 5CZ1A 3OYAA 3M8SA 5DG9A 2R2TA 4DQSA 3LP0A 5D3GB 2W8LA 3RB3A 4DTJA 1HNVB 4O0IA 4DQIA 2HNDA 3FQKA 4CJ4A 1S97A 1S1XA 2ILZA 5KG0A 3P83D 4ZTFA 4FVMA 4TSXA 2HVIA 1UA0A 3VQEA 3ZCMA 3LAMA 1C2PA 3QO9A 5CYMA 2BRLA 4CEEA 2B43A 3PW0A 1KVAA 3QLHB 3OYGA 1Z4UA 4KTZA 3LDSA 2F8SA 3SPYA 3FFIB 2HMIA 3V6DB 3BSCA 2B5JB 3M9OB 4JLHA 1FK9A 5J2QA 4M3UA 1QAJA 3C95A 5KFUA 2WB4A 4Z4CA 4HUEA 2E9ZA 3AVAA 4K4VA 5F8JA 1S1TB 5KFKA 2IM1A 3LWMA 3ULDA 3KLVA 3KOAA 1KHVA 2UUWA 3QGHA 3TI0A 4RNOA 4DFPA 1RDAA 2C22A 2OPQA 2G8KA 1C0MA 4TY9A 4ZPBA 3RMBA 4FJ7A 3O3HA 5KFWA 1X9MA 4RW4A 5DLGA 4KTQA 5EU7A 4DSEA 3N6MA 2A1RA 1S10A 5KFRA 5HBMB 4WFXA 2KQ2A 2BANA 3VQ6A 4CJKA 3GV8B 4DU4A 3HVTB 3AO1A 1DTQA 1TKXA 2XC9A 5KFDA 3HHKA 3V6JA 2G8UA 4F50A 3KMQA 2HNZA 3RB0A 1D9DA 4CHYA 4O3OA 4FM1A 3SQ4A 1CZ9A 3SQ1A 4N47A 2RF2B 3QIPB 1BI4B 1N5YB 3OYNA 4JRPA 1T7PA 3CJ5A 4E7JA 3DM2A 4WYLA 1RT4A 3EPIA 3KLGB 4DTPA 4DL3A 2BQRA 4IG3A 5KFEA 4Z4EA 3TR8A 4DQPA 1NOYA 4M3TA 1HJRA 4KHYA 4XIUA 4I9LA 5J2NB 3SI6A 1G15A 1BGXT 3KLEA 3Q8SB 3NDKA 3IN5A 4ED6A 1TVRA 4NLGA 4CJTA 2FBVA 1HMVB 4DLGA 1BQNA 1B9FA 4CJWA 1IKVA 4KI4A 3GIMA 3KK3A 4CF2A 3AVHA 4QWEA 3KLHB 1XR7A 4EZ9A 4FBUA 3GIJA 2HWIA 2W9CA 2AWZA 4RZRA 4AHVA 4CFAA 3AA4A 3HYFA 1IKWA 5KI6A 3NF6A 4AILC 1N4LA 5SZTA 2WONA 2UVVA 4J2BA 4DG1A 4LSLB 4NLTA 1S0MA 3CQ8A 3QIDA 4NLYA 2VG7A 3BR9A 1JLFB 1TKDA 1RT1B 4KFBB 4FJLA 2D0AA 1FKPA 2BE2A 2R2UA 3E51A 3MR5A 3JSMB 4Y1DA 3RRGA 3HVWA 4N56A 4H4MA 3CO9A 2R2SA 4C8KA 3HP6A 3BGRA 1VSDA 2D5RA 4ID5A 4NLQA 1J53A 1JL1A 3HK2A 4I2PB 1U45A 4M3YA 5L9XA
chains in the Genus database with same CATH superfamily
2IBOA 3OQ2A 4CIGA 4UY8O 4NASA 1K44A 2EHGA 3ZSQA 3I55S 2VG6A 4FJMA 3A8IA 4BRIA 2OEKA 3UVJB 1FWKA 3C6AA 2BVZA 2FGOA 4ZPWR 5EWEA 4HTUA 5ETOA 4F3QA 4PR6A 3IRXB 3T1YJ 4X65J 3O08A 3BZCA 4F36A 1S6UA 1V4TA 2Z4PA 1S12A 3CMEN 4RTFD 2GMLA 5AQWA 1EWRA 2RSQA 1GEHA 1DRZA 4IOCQ 4ZN3A 4M7YA 4DPXA 4L75A 5B7WA 2VICA 3QNNA 1CLFA 2DISA 3EXCX 2V5HG 2O01C 5B0FA 1LWFA 2Q43A 3RSEB 1CG2A 4BR4A 2O8BB 4PQUA 3G71S 4O23A 3H4BA 4XO0A 4I0WA 3THYA 5KQDA 1HR0F 2VD3A 1TL3A 5AQPA 2HAIA 3Q2TC 2YHAA 1EIYB 2ZJRQ 3OXGA 1CZBA 1UWAA 3CFOA 4DUZF 3KD5E 3UNYA 3M8PA 3PHEA 4ZPDA 1N33F 3PEJA 4I6YA 4CI0B 3ZLJA 1EQYA 5HVFA 5HROB 4JD2A 5HJXA 3QT8A 4GKKF 5HP1A 1V3RA 1UWBB 1HW8A 1HYZA 1W7WA 3RMDA 1NZ8A 2XHCA 1U1LA 1HUXA 5AQVA 3AAPA 1YDLA 2J7KA 4AQYF 5M1OA 4IR9A 4HT5A 2UUTA 4LF6J 3B78A 1RBRA 3O80A 2I5JB 2RNEA 2KT2A 3C46A 1EKRA 3UDLA 2IYGA 1I51B 4HR2A 3WNGA 3UIQA 2D74B 2AU0A 3FJ2A 5B0EA 1UFLA 2NUBA 3MHYA 4BR2A 3EEQA 3FZ2A 4MAKA 1LW2A 1D09B 3BREA 2DHXA 1CQNA 5J1EB 4IEIA 3LDQA 2H51B 1AYEA 4LRBA 3KTQA 3DXKA 1UVMA 2VKZG 4F02A 4CEDA 1YJNN 1XMQJ 2VZ9A 4A46A 5JS1A 2GMHA 3OBYA 3HHLA 3R6MA 1NRKA 4V1Ak 4DN9A 1Q7YO 2UUCJ 1HR0K 2UZAA 1MWMA 3VCDA 3QEWA 1SCJB 4RNMA 4FJ8A 3N01A 3ZZZA 4LFAF 2AA4A 3ZSYA 4DUZK 4RBUA 1YVUA 1YG0A 2P6TA 1N33K 2ASLA 1WF0A 3TA2A 5IXUA 1GXUA 3GYGA 4GKKK 3VN5A 1DURA 3M30A 4DL2A 4MK7A 4XH1A 3FSIA 4NI2B 3WIUA 1A9NB 3ULEB 3TU5A 2O8EA 4ZVGA 5FJ4A 1TL1B 1D8ZA 4AQYK 2LQ8A 5J2MA 2LU1A 2WK4A 3VEZA 3OSNA 5LT5A 3OLAA 5D77A 1RT6A 2DIUA 4CEQA 3UKRA 1W25A 1RADB 3PW2A 4BGAA 5F8GA 2FLOA 3GPAA 5D78A 1SKSA 4IH6A 2DEJA 4YHHF 4I64A 1VIOA 2HS0A 2KTQA 2XZDB 1VYAA 2IJFA 5JJBA 1YJWS 1AB8A 5A8KA 2XTJP 4HTLA 2ACYA 3TQ1A 2GX8A 3EICA 3J7AN 3G8TA 4LFBF 4K5RA 1FRMA 4BBYA 5C12A 3W5YA 3CC4N 3QEVA 4DV2J 2P5VA 3T9NA 1ULRA 3FFKB 5CA5A 1WKKA 1SKWA 1TU0B 4WKYA 3MUTP 4WCEQ 2MKJA 2CADA 4DS5A 1JIHA 2EKYA 3LM2A 3THWB 4FJJA 4UY85 3QICA 4IRDA 1F2HA 3ZZRA 2HNYB 3IA0A 5ETPA 1KLNA 4LFAK 3HHNB 1B4SA 1LOTB 2G0CA 3BBFA 3D4JA 5MLCV 3U9ZA 2ASMA 2JWKA 1EX8A 1M1HA 1Y00A 2OTLS 2EI5A 7FDRA 4AH9A 4PPDA 1EQ0A 3BF4A 1U6FA 3WIVA 2I7PA 2DNKA 3DC2A 4ECTA 3I8DA 2BUNA 3NGYA 1HI1A 1HNZK 5C2GA 1BIUA 2GX9A 2WTUA 3LP1A 3OL9A 2BKPA 4CGDA 2AMCB 1UEVA 1W7AA 3CCTA 3LH2S 1N32F 3DRYA 2KT3A 1U49A 1NB7A 3QSIA 1PYTA 4YHHK 4LBHA 4AL6A 1HBUB 3FGVA 4E0DA 1LXNA 3KWMA 2FLLA 4CZJA 4UUXA 4LFBK 3LGHA 3N28A 1JLBB 1BQXA 3N5FA 4JI2J 5I42A 5FLXY 2QV6A 4FLYA 3S8SA 1C1CA 1VFJA 4KH4A 3C8YA 5KT4A 2BQUA 3OYJA 1RWKB 4CIEA 4ELUA 5AQIA 3PKYA 5AXLA 4TU8A 4IFVB 3K8VA 1C0GA 4CJ7A 2CPDA 1HBOA 3LM9A 4P52A 3LDPA 1NCLA 5A8WA 5KFIA 1ACMB 4OMFG 3CCZA 3FC9A 2GEMA 5M1KA 4CBWA 4Y2AA 1WKJA 3MEDA 4JI4K 5A0YB 1W0HA 5GAHP 4H4OA 1BG3A 3TUJC 4ZLJA 2V51B 4JBCA 3DLJA 3HF5A 5B0GA 4BRLA 1LNQA 3AARA 4KBIA 2Z56B 1HWIA 4OKJA 3NP5A 1X4CA 4FF2A 2Z1JA 1IKXA 3D7SB 4W5NA 3J80O 4IQXA 3NH2A 1EP4A 4RG8A 4HDGA 3D0GE 4KHSA 3BH6B 3O1LA 3GCWP 3W5ZA 4Y2MA 2ZDPA 3GBTA 1QQCA 2H5EA 3PVXA 5TKWA 3SAFA 2PA3A 3DDIA 4YMEA 4Q0BB 1HNWF 2HVDA 3VTHA 2CZVC 2LU2A 5SWMA 1N32K 3O1WA 4I1TA 4IXCA 2F63A 4MK8A 1A5VA 1EXQA 2P6SA 4CHZA 3Q86A 1G2EA 1KWMA 4CF0A 4K5SA 1SL2A 1V5VA 2WCXA 3LA0A 1F0XA 3ADAC 3L4QA 2VWBA 2WSFC 3A8JA 1HHSA 2WC9A 1J5OA 3OW2R 2G8VA 3SAGA 4DV0J 4OKKA 3TVKA 1BQMA 2HEKA 3W2VA 8AT1B 3ZT3A 2G0JA 4IO9Q 3P96A 3MAAA 4J91A 2DXDA 2GNKA 4Q8FA 2GHPA 3L2UA 4ED8A 3LP2A 2W01A 4WE1B 4I6MA 4A8SA 1WAFA 3M2UB 2OYQA 2W2OP 3O3FA 2QLXA 1S1UB 4CEFA 1WC5A 2P8IA 4JI3J 3CDEA 3EVOA 1B64A 5BPMA 2B0GA 2WAQD 2ZM6J 1VQ9N 2DY1A 2VQFJ 2HQDA 4NL5A 4IG0B 2FJVA 1TUYA 3PR4A 2L48A 4CD3A 1ITPA 4KHWA 5D3GA 2ATLA 2QC3A 1N5VA 2UXCF 4JV2A 2NXEA 3FK4A 3AODA 1K8AT 2C3OA 3S41A 1AFJA 1HNWK 3ZZOA 2V2QA 4I7FB 3RW7A 1D3WA 1OQ6A 5T7LA 3V9UA 5CXTA 1DJ0A 5IT9O 2DRBA 3CC2S 1S77D 3AOBA 3NFAA 5E3AA 1DBDA 1RT7B 2N3LA 1P6TA 3QQCD 4MLEA 4RCHA 2B5JA 2RQKA 3RB6A 1UPPA 1RTJB 2HFOA 4IDKB 2I8EA 4KV8B 2I0XA 1YBAA 4KYZA 4ZVRB 2GAHC 3UD3P 4C1NK 3PJXA 1NK6A 2CQBA 3AVBA 4FKYA 3MMAA 2DGUA 4RW9B 4DV5F 5F3ZA 2XYPB 3IXQA 2HFVA 3L09A 2DVIA 3A2FA 5AZJB 4FVUA 3NXZA 4JKEA 3V4MA 3L3CA 5H9EK 2XO7A 3QZ8A 4AHTA 2W24A 4W5QA 2X78A 4EI2A 5GAEP 2NZTA 4K43A 4ILRA 1SH3A 4FLUA 1ESVA 5HBMA 3ZX3A 1ZAXA 1J5EJ 4MLHA 4BR0A 1SQGA 4JI8J 1HWUA 5AE1A 4EEYA 4DZ6A 1B70B 5F41A 3CCLS 4NYOA 4EHUA 1ZBIA 2BA9A 5FLXU 2OTJN 4FN5A 2VJVA 3CPEA 1B0PA 3U1NA 3EE8A 3MX5A 2RF2A 4XPCA 2UXCK 2WRMA 1N5YA 5LL6Z 3EXYA 1OH5A 1QS4A 5JMVA 1QAIA 5KFFA 4Y2IA 1HA1A 1QD1A 2K1RB 2G8FA 1MSWD 2A18A 4RO0A 8ATCB 4GKJJ 2VGMA 4UOFA 4O0JA 3GV5B 4CZFA 2RPIA 3QGIA 1X3NA 3NMUA 4P2FA 4PYAA 3OLBA 4O5FA 3LGNA 3GJSB 5KPZA 3WT0A 3O4WA 4ZVTB 4JI5F 1UW9A 5BN8A 3M3ZA 3C16A 4CLYA 4ETXA 4KHPF 5HQLA 2A1SA 1KCFA 2DFHA 3OSPA 1RHJB 1S9FA 3KUHA 3TP2A 3BKUA 1F6TA 3M8QA 4DV5K 4ZP7A 3OYCA 3AH6A 2R8KA 2QLWA 3BDPA 5FPDA 3KZBA 2J5AA 3ZT4A 4DQ8A 2YX1A 3JSRA 5DLFA 3WX8A 1R8CA 3R3LA 3CCUS 1E6YA 5KFYA 4KFBA 3BGOP 3JSMA 3PDNA 1QY7A 3HVAA 1W9HA 1EJ7L 3LDOA 2IPOB 3QEIA 5D4NA 2Z8QA 1OKJA 2HBJA 3H6EA 2C3PA 1EKEA 1IBMJ 4JKBA 1F9HA 2OKQA 4I2PA 3VGVA 1X4DA 2V0NA 2HBMA 4CJLA 1VQ7N 2NPIA 4H5NA 3R5BA 1EB0A 4FLWA 1A6LA 2AEMA 2HHVA 1RBVA 2E4LA 2EBGA 1KFDA 4PHTX 4QS7A 4KB7A 4P73A 2KJWA 3CC7S 2DO4A 2I6WA 5M2PA 2EPIA 1JWWA 1IKYA 1CJUB 1C0TA 3MMCA 1QVFM 4OYAA 4CIOA 5HAOA 3VERA 1T05A 5JLFA 3MM8B 2E6MA 5U47A 4P2XA 1RWXB 4AXIA 1ZBFA 5J2QB 4JI5K 3IR7B 1VQNN 4YUDA 5GAGU 1DGKN 4KHPK 3LTOA 2QFJA 2KLAA 3EDRB 3F9MA 4B9UA 3WHIA 4YR0A 3MFHA 3R8YA 2RDIA 1EETA 2OPQB 4DR6F 2QWOA 4ZJQA 1UVLA 3C94A 3SUNA 1PO6A 4LVNP 4BRAA 5KT3A 4IQMA 1RWUA 5BXIA 4CJ5A 2O5DA 1S1WA 1ZYQA 2G8WA 1WC6A 1RP5A 5HANA 4PG6A 5KOXA 4C6AA 3BO3A 3BS9A 3V9SA 3D2FB 2ADCA 4KSEB 2ZOFA 4MKBA 3W5XA 2ZNZA 4JYAJ 2BOAA 2KVQE 2IIRA 2AJ0A 1TMJA 1OPIA 2W2MP 3DM2B 4NCGA 1L5UA 3SUOA 3CDWA 2EFNA 1Z2ZA 3EZOA 2YX7A 4J90A 3POTB 4IG3B 2H4YB 3I56N 1H7XA 2P2CB 4B8CA 2HHUA 3I0RA 1U0SA 2BZ2A 3OYKA 4NLXA 3K5MA 4K2JA 3AV9A 3ZXWA 1Y0HA 2CPIA 2QGFB 2VFTA 3S7RA 4GVBA 3MR7A 3T5JA 3EYZA 4BGBA 4I69A 1K9MT 3ISZA 1RA7A 2AYEA 3NBPA 4IEEA 2GCFA 2J8AA 2IDLA 3QESA 1U2CA 4EP4A 4LF7J 3AQPA 1FD8A 2CVIA 2C2RA 4O44A 1WHXA 4DR6K 1BY9A 1WWHA 4LF9J 3IFEA 3GLJA 2JEFA 3WQTA 3AO5A 2IJRA 2VG7B 4ED4A 3T5KA 1FKPB 1FXRA 3E3XA 4KHQA 1I5OB 3NCPA 4DUYF 4H4MB 1MWYA 2QLJB 2KXHA 1SIZA 3DXSX 4MKAA 1D9AA 4IRCA 3G71N 3CFPA 3C19A 2UVRA 3CCJS 4LUBA 4CM2A 4NA1A 3GYXB 4PXCA 5A2QY 4CFDA 4W5RA 1KAYA 4A47A 5KFCA 3VTIA 5BYRA 2VG6B 4KHNA 1MMNA 1U8WA 3W7BA 5L39A 1S0VA 4ZA1A 3S01A 4DTXA 2AGPA 1QM9A 2GTDA 2DT9A 4CZMA 2GS8A 3GFXA 5DM6Q 3ZZPA 4E7HA 1NOZA 4QCLA 1JCFA 3I9ZA 2NCKL 4LT6A 4M5IA 2XMTA 4HI1A 3UB5A 1ZBTA 4CM0A 2PY5A 4BE1A 1HQEA 1HR0J 4RW8A 4EIAA 3FR0A 3QBXA 1SJ4P 4J7CA 4DOZA 5FPEA 4ZN1A 4WZQA 4FNIA 2YNHA 2FC9A 2FC8A 1VJQA 1LWFB 1QHTA 2YKOA 4LH4A 3OJSA 4DUZJ 1VK0A 4PQUB 2ZH1A 4B3TF 2IRYA 2D3ZA 4FOIA 5HN0A 2F7VA 1N33J 3THYB 2VA2A 4YY3K 1TL3B 2MKKA 2FB0A 1VS3A 4CZIA 3L2RA 4GKKJ 4JK7A 1SJQA 3OYMA 3CXCR 2G0IA 3OL6A 2P9EA 4J9VA 5F8LA 1MW7A 2O4IA 1RTHA 3LW5C 2MKYA 3M8PB 5HJYA 4WKRA 2YWWA 1FDNA 2F9WA 4USWA 2R8GA 3B8AX 4WQ5A 3TJAA 4JD2B 2P9SA 2RRAA 4DUYK 5HP1B 2E1AA 1RBTA 2Q1NA 2V2ZA 4WQ4C 4OI0A 2CAJA 2I38A 2YWFA 2UV8G 3WBZA 4J9OA 5BR8F 2EK1A 3GMGA 4KT0C 1JLEA 4F4YA 1RFQA 1MG7A 4YORA 2HOEA 4QPXA 1GLFO 5MLCQ 4JKAA 2JEGA 4BDPA 3KNAA 5AQJA 1RDCA 3BM7A 5EWFA 2PSZA 2YWHA 1T94A 3S3MA 4RWXA 1LW2B 3QATA 4PKHA 3VGTA 4PG4A 2BW7A 2M8DB 1YZ7A 3L7UA 1NJZA 3DXKB 3H2UB 2L9DA 4CBXA 2RRNA 4L3NA 2QKKA 3SCXA 3SQ2A 2HRTA 4LFAJ 5JICA 3HHLB 3TR5A 5BRFA 3DLBA 2DGSA 1GLCG 4EGLA 4B3TK 3DRRA 4DPOA 4OX7A 1NPKA 3KJQB 1MN9A 2Q0UA 3GIIA 4F2RA 2C2DA 1YJWN 3C66A 2QA4S 2CJKA 3FCWA 1R31A 3M6UA 1A5XA 5HLFA 3BUZB 1NO8A 2JWNA 2L3MA 3BKTA 2H1YA 4FPBA 4UTGA 3X1LB 1QHAA 4WIQA 2P9PA 1ASUA 3MTJA 1RBLA 3Q23A 3VEYA 1RNHA 1RTDA 4F25A 1VHXA 3M30B 1KVKA 2LA4A 1CJVA 3CD7A 1K9MO 4N76A 3NOCA 1FHTA 4HYKA 4HUGA 2O8EB 5ITHA 4PABA 3TABA 5BR8K 3A12A 3OJUA 4YHHJ 5J2MB 1YQHA 3NVKA 1RT6B 4MIAA 5ETVA 1QZ5A 2YHWA 1TL7A 2R8IA 4A57A 3CHWA 2K3KA 3GFZA 4OL8A 1GOAA 1SC3B 5HI7A 2QEXS 3ILJA 1QQOA 4FWPA 1J2VA 2JFDA 3M6WA 2OD6A 5A8KB 2QM1A 1IO2A 2DY4A 3G82A 4A8OA 4FBTA 4ERDA 3FZLA 4BR5A 6AT1B 3LPEA 1RWOB 3KD1E 2EC2A 3I5BA 2D3UA 2CJYB 4USMA 3AQOA 1WEXA 5DETA 1VQ6S 4F4ZA 9ATCB 3W63A 1Q9XA 3CETA 1KVBA 4O3NA 1TGOA 3TZYA 4OJGA 2P5GA 2AYMA 3BGLA 4XK8C 3HSJA 5A2QU 5DM7Q 2QLFB 3DKDA 5A76A 2E9TA 3QAEA 3PIPL 3FSXA 1R27B 2BR0A 5IM0A 4EK2A 4OI4A 5GAHI 1U48A 1S4FA 3C6TA 4S0MA 3NOGA 2RD5C 2R8JA 4EFHA 1XR5A 3HZEA 2F40A 4KH0B 1N32J 3CSKA 5IZHA 3CM6A 4FJ5A 2HBZB 1WACA 1GMWD 3NVMA 2CPYA 2PGCA 1R3NA 2KHOA 2BDPA 2DR8A 5LJVA 4FP9A 2ZH5A 2BM1A 2M52A 3LP1B 1RHKB 3PY8A 3SJJA 1T9UA 1W2IA 4ZPCA 4KE5A 2RE1A 1XNQF 3VHQA 4QOTA 1RZMA 1QSLA 4DFKA 2GMJA 2X6NA 4QYZK 4F3TA 5I42B 3ZX0A 3M9NB 4I2QA 2B3TB 1C1CB 4OX8A 2QWNA 3BQ0A 4C0OC 2YKPA 1XTZA 2F9DA 2E1RA 2UVWA 2IS3A 3MWPA 3G86A 3VQ8A 3L7PA 4LREA 4C23A 1P8GA 4I9QA 2VPXB 4M5MA 4QAGA 1HBOB 3GJTB 1LWCA 2GHWA 3FVYA 5A8WB 3L4IA 1U8SA 3DRSA 2J6TA 3OXLA 2BJEA 2EK6A 3ZYYX 4URSA 3PUFA 2E66A 3MEDB 1TL4A 4FF3A 4H4OB 4ZITA 2XZWA 3AY9A 4C7QA 2F4VJ 3KG1A 1FX2A 4F0KA 4ZTJA 1IKXB 2B56A 5K9FA 2VONA 1HNWJ 3AHPA 3PTWA 2D1KA 3E2EA 1WI8A 1EP4B 5L46A 2BJDA 5GIOA 4G65A 4N8OA 3IG1A 2HQIA 4WWSA 2DGVA 2FYXA 3N4QA 3PIOL 2AX1A 1G3OA 3AVKA 2W25A 1J6ZA 2O8DA 1HQUA 5C25A 4A61A 3QEPA 1WDTA 1XNQK 2FVRA 2DH7A 1REVA 1YXQA 3VPZA 5E7OB 4UQGA 1OVYA 5AQYA 3AXMA 3IKMA 1APSA 1LK7A 2C3MA 1FKOA 3JTPA 4WQ4A 1B0VA 3J80Y 1BQMB 4ZCKA 3MMBB 3W2VB 5H9EJ 3MAAB 4NXNF 2KFNA 3DWLA 1C0FA 3WNHA 1BC6A 4H0PA 2W6KA 3LP2B 3CC2N 4I6MB 1YGYA 4FWMA 2AZ3A 2CQ2A 5IS2A 1S3XA 2W4DA 3JYTA 1CC7A 2PA8D 5J1PA 2G8HA 2HFUA 5GAEI 3PNIA 2HURA 3NGZA 3JAMO 1Q8KA 3O5TB 2DNYA 3OTDA 1RKJA 4C8LA 4BR9A 3EZ5A 4MH8A 2F9TA 3MR3A 1Z25A 4AHUA 4BRKA 2HVEA 2M3DA 2ITMA 4NA3A 2J0XA 2XS5A 3CMQA 4DQSA 3LP0A 3A1YG 2WBNA 5D3GB 4LR9A 2N82B 3RB3A 4OPAA 4DTJA 4DV3F 2DNOA 3NCRA 2RHSB 2Y0SD 2ILZA 2L9NA 1FKAF 3P83D 1TELA 4DR2K 5T7LB 3A13A 3H3OB 1C2PA 3NGUA 1U1MA 3R2DJ 2YPZA 4CEEA 1X4AA 3OYGA 1Z4UA 4KTZA 3LDSA 3CCLN 2HBYB 4OYPA 1T02A 3CULA 4TU9A 3BSCA 2B5JB 4DV5J 1SS6A 2KDOA 4JLHA 1YUWA 1RAGB 1RTZA 5HMZA 2GHVC 3PRVA 4HUEA 4V19S 3KKFA 3GSDA 1IM6A 1R6YA 3MMAB 3MPDA 3WX4A 1JMTA 4NXNK 2B4OA 3LWMA 3SSSA 1RDAA 5JVGQ 2C22A 1HQ2A 4QS8A 4TY9A 4ZPBA 3HI0A 3N79A 3TSPA 4A2BA 1GFWB 1UW4A 4LVOP 5EU7A 2VCPA 2GAGC 5IT9Y 1S10A 2WSCC 5HBMB 1Y7PA 3H3NO 4KGMA 1KP6A 2ASYA 1RB0A 4UOGA 1B99A 1P90A 4ZKAA 1VLYA 1OYEA 1S59A 1HJOA 3KMQA 1D9DA 2FHJD 2LXIA 8RUCA 1ELOA 4FM1A 4LC9B 1FDBA 6FD1A 4N47A 2RF2B 1O51A 3ENWA 3O9SA 4OYWA 4DV3K 1REGX 1N5YB 3CCUN 2Y1LB 2J9CA 5DRKA 3KLGB 5LY3A 2OLWA 3F44A 4DTPA 4DL3A 2BQRA 4JI5J 3TR8A 2XMVA 1KXPA 4JKFA 2MHEA 1U2RA 1X8DA 2O67A 4KHPJ 4E1JA 3VAFA 3SI6A 4M1KA 2MQ8A 3KLEA 1CVJA 3MM9A 1SPBP 3UFCX 3NEKA 3ZTQA 3C16B 4RUBA 1BQNA 4MMOA 1IKVA 2QA2A 3E9PA 5GVQA 3KK3A 3MDQA 2CYYA 4ZIWA 3VETA 4FBUA 1KKHA 3CC7N 2AWZA 1VBZA 3AA4A 4IUFA 3SCKE 5SZTA 3SJHA 1BWVA 4J2BA 4DG1A 1X7VA 4DPWA 2ASOA 1S0MA 3CQ8A 2C3UA 1E6YB 4PYDA 3IMQJ 1TKDA 4CZKA 2MGZA 4KFBB 4FJLA 1EKSA 2BE2A 2R2UA 3B6BA 3JSMB 4NMXA 1RWNB 3ET6A 3D2WA 4M5KA 3CO9A 1YIJS 3CJ9A 3DXBA 2IRUA 3PJ9A 3DU5A 2D5RA 4NLQA 2VH7A 1J53A 4HHJA 3KVGA 4YOVA 4I2PB 2QZ8A 3DFEA 4UOCA 1U45A 3MAHA 1M1KO 3LPYA 3IR6B 1PYOB 3LO3A 4ECZA 4L3QA 4OPJA 3M9MB 2F5GA 2NYIA 5KFJA 4BRDA 1H38A 3GQCA 1RUSA 1SUQA 1T03A 2F3JA 4LIWA 4OHVA 3CT9A 2FVSA 1ZA1B 2AD9A 3ITHA 3JS9A 1L3VA 1IKYB 3ZETA 1C0TB 3SFUA 3MMCB 4OI3A 3HD2A 4JV5J 1BL3A 4EBCA 1YVFA 3BB5A 2E6LA 3TVYA 5B0CA 1AA1B 5KFZA 5CYQA 1NJWA 3Q2SC 1U6BA 3IAM9 1U4BA 3EMTA 1MU2A 4DR6J 3J8AA 1YITN 3N6NA 2P9UA 4OV6A 2C28A 3PRDA 1FW6A 2P9NB 1BCOA 1SH2A 3V5RA 4DR4F 1AZSA 4GC7A 4QQBA 1Q86O 1EETB 4M3WA 3AJDA 3D67A 3EE3A 4ILJA 5I4MA 2A5XA 3VQ9A 2GQCA 5CHCB 2YQ0A 2OH2A 1UPMB 2FLPA 2DB1A 2O8CA 3AJ2A 3TRGA 3FEXB 1RLCL 1YJVA 4JKCA 3OBWA 3SXLA 4WBFA 4DMZA 5C10A 3RAMA 1S1WB 1NKBA 4B8AB 2CA9A 2H5JB 4FYVB 3ISND 1K1QA 3UE2A 3P39A 4OQJA 2P9KA 2WBRA 4DPTA 2FGCA 1N88A 2ATQA 3WXMB 4Q2MA 1C1AA 4M94A 2GJFA 2MZQA 4QW8A 4NCGB 2AHOB 4Z0UA 3QRRA 2CZ9A 3IUCA 3GWCA 5MAOA 1Y64A 3MM5A 4ITSA 2GQ2A 3TARA 3I0RB 3VWSA 5IT9U 3VQDA 4CF8A 3CCJN 3P49B 3R6LB 4IZ9A 3UQSA 3DLEA 5GMEA 4MQ3A 2BKOA 1NAQA 3K7RA 4GVBB 3PYDA 2UXDJ 3DLRA 4UZCA 1Q78A 5HK4A 3CMAS 3J7YU 2B7CB 3P5TL 4FZVA 2Q3SA 4ZCLA 4YOTA 3SYZA 4OPHA 1XHZA 2WBMA 3NBPB 1FJEB 2O3DA 3ZSVA 4P2SA 2MKSA 3AVMA 1G7CB 4O44B 2ZNYA 1HIYA 1S6QA 5KTQA 2UUBJ 2XWXA 3MCOA 5L1JA 3VEOA 2MYFA 4QWAA 3NGKA 4J2EA 3H42A 4IKFA 4B9LA 1W2BM 4GMJB 2RHQB 1Q0NA 1YTUA 2IM0A 5BJRA 3P5BP 4Q2LA 1KTQA 5BREA 4F4KA 5GADU 4FJNA 1CULA 2WFBA 3FLCO 3A5NC 3VQSA 3CCRS 4DX6A 1GT8A 2FVQA 1SXLA 1CC8A 3ILOA 4C3KA 2KI2A 1GQEA 4BVPA 4A8FA 3MEEA 1Q16B 3MFIA 4MDBA 5CZVA 3PSIA 3RSEA 3A3OB 3T1YF 4IBNA 1KVJA 2P9CA 1XUPO 1VJWA 2VKRA 5HMYA 2GWKA 1JJ2R 5ETSA 4JS4A 3C14A 2RILA 1N0UA 3DDNA 4B3TJ 4WTYA 1S9GA 1HQEB 4DUTA 1P27B 5CABA 4RW8B 3NF8A 1T11A 1FNOA 5AT1B 2CG8A 3MD3A 2YNHB 1YT3A 4C97A 4K7QA 3UPFA 3T41A 1XC9A 1U2VA 3HBTA 2ITGA 5KG7A 4Q43A 3RWUA 2BMBA 4CJQA 4CGIA 2DNPA 2UYTA 4DHVA 2O8FA 3BY5A 4ED2A 1ZPVA 2QX0A 3MEKA 2D0OA 1WHYA 4YR3A 3JS6A 4MIWA 5BR8J 2J0SD 1A5WA 3PO5A 1RBOB 1VQ8S 3IM8A 2P9SB 3W2WA 3TANA 1SJFA 3TAMA 2ROGA 3BDEA 1RAOA 4C3LA 3SEOA 5FRNA 3VV2B 2KH9A 4AXJA 1JLEB 5LSOA 2BTFA 3RYLA 4O8UA 1T9VA 5DDQC 2QA4N 3M6XA 5HO4A 1DAXA 3LALA 1X5TA 4OYMA 3R7SB 3PKMA 3I0SA 4QR2A 1XC3A 3MR2A 3FZKA 1JCGA 2GJIA 3T1YK 2M70A 4CHQA 1WSEA 1WBBA 3PZPA 4BRPA 3NRBA 1U7LA 4ZLNA 3VMFB 1RJJA 2O4GA 3ZZYA 4F4WA 4QS9A 2V4RA 3GONA 1DFDA 4KB0A 2QA4G 4BRMA 5DDPC 4M41A 5KPTA 2C2ZB 1SB6A 1K0VA 2IHR1 1NJIO 3DRRB 1HPZA 1S5JA 1S48A 2QEXN 2ZC4A 1UCNA 2G2OA 1R0BG 4IOCL 3PR5B 3CG7A 2IVPA 3CJ4A 5KG2A 1QLNA 1I3OB 1U47A 5HLFB 2FVCA 1UAWA 3VQCA 3F9KA 3CGIA 4NX9A 1HKBA 2N3OA 2IVFB 1YSJA 2P9PB 5EHHA 1LOUA 2AYGA 4RX6A 3S9HA 2ZJRL 2QTDA 1RTDB 1VQ6N 1Q82O 3KIOA 1DHMA 3B6OA 1CJVB 4J2DA 1S57A 3ZZ0A 4DDFA 4KIAA 3EE9A 4UT4A 4IFEA 2E2OA 1HD1A 4I56A 4WFAQ 1SV5A 3PRBA 1Q18A 4CZCA 1LXJA 1TL7B 1CJKB 4WYWA 3TX8A 1H73A 2DXFA 4Q44A 5AQUA 3CIMA 4QYZJ 4QU6A 4JI6J 2MDAA 2P5OA 4I4BA 3FMWA 4AM7A 4UZBA 3NL0A 5EY4A 2DR7A 3THWA 2QMXA 1KC8T 2NXJA 5ADXH 3G82B 1HX1A 4ZLPA 2BE7D 5A8RA 3PEHA 1ASVA 4H0YB 4B1XB 5KT7A 2RHKA 4FPAA 4DSJA 3ZSZA 4G1PA 4ILGB 4ED7A 4BROA 1ASWA 3EWGA 3FUYA 4XDDA 1CJTA 1H72C 3QFWA 2YVSA 5AQRA 4IFYA 1PJ7A 3SSQA 1PSDA 5IM0B 1C4AA 2VFRA 2ZWOA 3TUPA 4CZHA 4CIFA 2ABYA 2E5JA 3K8WA 1VQOS 3T5HA 4RL1A 2QRRA 3NS6A 3C6TB 2KKZA 3Q8YA 3N0VA 4ES3A 3VF4A 2WUSA 4B9NA 4F9OA 3WXKA 3SQ0A 3IAYA 4Y0FA 2MZSA 4J9SA 4CGJA 1XNQJ 4FXDA 1NK7A 3UE5A 1HNVA 1OSDA 1DZ5A 4WFZA 3VF6A 3ENQA 1NNDA 3GL1A 1TP7A 3QDKA 2K06A 3ZT0A 3IO1A 1RAFB 4U95A 2CPZA 2HHHF 3GFYA 4XH5A 4W90B 3QLHA 3AVNA 2DBBA 3AJ1A 2NRVA 3K2PA 1SL0A 3QSYB 1YVNA 4DL0C 5K20B 1N5SA 2EXUA 3B4MA 4HHHA 4I2QB 3SQGA 3AOCA 3FZFA 2R7RA 3GIKA 5E3RA 3BBCA 4KR0B 1FVQA 4RUCA 4C8NA 1G1XA 2PEBA 5LMNF 1LWCB 1CLQA 2V94A 4M63A 2HQCA 5GIPA 3DRSB 4FM2A 3AO3A 4F2SA 2DITA 3CEDA 1I3AA 4LIRA 4RNFA 2ALZA 1WC0A 4WTOB 3FBEA 2X51A 3IAS9 1IJEB 3D1HA 3AA5X 1D8YA 2W2NP 1T0TV 4X4VA 3IG1B 1FX4A 2OO4A 3QWUA 2E5IA 1WKLA 4GMKA 2P1JA 3SI8A 3BSAA 3CPWM 1T3OA 4FWSA 3O9RA 3RMAA 3CCMS 1HQUB 1IXKA 2GQQA 2O8DB 4NMLA 2KM8B 3G0ZA 1IUJA 5C25B 2APOA 3PW4A 4J9UE 4FJ9A 5KFOA 2HFSA 9RUBA 2B8PA 2HHHK 2OEJA 4N5SA 1OY8A 2NRXA 2GIQA 4EYIB 2YKAA 3CJSA 1REVB 1N56A 1LFPA 2CDQA 2NRZA 4CK3A 3V1QA 4NXNJ 3P38A 4R0EA 3KHRA 2CPFA 4MO4A 2MKCA 5CZ2A 1V6HA 4CLFA 1FKOB 4Z4HA 1FWLA 2DGOA 3O2IA 1XMOF 1N5TA 2PMHA 2ZH8A 4EWTA 3CJTA 1T9XA 4LY7A 1SJ3P 2OEMA 3E9OA 3V9WA 2W7OA 1VSKA 5LMNK 1S6OA 4IG0A 1PILA 1BA0A 2PO4A 5D4LA 1X1PA 3MAQA 3QFUA 2EEYA 1AW0A 4OGEA 1RT1A 3JYTB 1KBRA 3D0HE 5L38A 4E7LA 2FHOB 4IWVA 3UKUA 4BDYA 1RCHA 4IO8A 3H4DA 2B9WA 4HUFA 1YJ9S 3V1OA 4DV3J 2B9EA 2YQ3A 5LMUF 2DGTA 3OTEA 4NCBA 1BMQB 5HQMA 1L3SA 2U2FA 3CB4A 3LP0B 3OD2A 2JX2A 4QR1A 1VMBA 3TSQA 4CEBA 4WPAA 2VC1A 2XULA 1Y10A 1ZOTA 2ZH4A 4CLUA 1E4FT 1VHIA 3BF1A 1NDPA 4JOUA 3J81O 2W2PP 4I6WA 4RBVA 4FLTA 4AF1A 1S72S 2R7SA 2PZSA 1X31C 2Q0RA 3AOAA 4BREA 3DNCA 2KN4A 4ZCMA 3HXMA 2MTLA 2HGNA 1RBUA 2VGNA 3QRQA 4RU9A 1EAYC 1XMOK 1TUGB 1SL1A 2AQ4A 5KFQA 3P1GA 2DEIA 3H08A 3HZ6A 4A8YA 1NBWA 2W6LA 5HRSA 4IJAA 4DU3A 4YR2A 2B4VA 5IWAF 2FSNA 3KG0A 3VQ4A 3RBXA 3ZT1A 4IO9L 4F3OA 2Z0GA 1T6CA 2OFGX 3K5PA 2KG1A 2ZM6K 2MZTA 3V6KA 4U7UK 4R25A 4K2XA 1VC5A 2W40A 4OZJA 3HOTA 4RBTA 3RTVA 1TKZA 1B3TA 5LMUK 3CNQP 5FDLA 2IC3A 5GAEU 4TQSA 4RLEA 3R1LA 1LEOA 1SJ1A 2YCHA 1VQ4S 3RBZA 2GELA 4BDZA 4F26A 1NSAA 4EO8A 1WC1A 4L74A 3A5LC 3QINA 4LR7A 4QIFA 2C42A 1H2VZ 3ZT2A 3HSGA 3MCAB 4U8YA 4AFFA 3CJAA 4CGHA 1YIJN 4JP8A 1KNZA 2GV1A 3ZSRA 3P45B 4WP3A 1VRUB 3OVNA 1BXNA 4CDIA 1IVZA 4K59A 1OYDA 4LRDA 4USIA 3KLEB 2ZUGA 1HLWA 3MM9B 3JB9k 1WAJA 4QYRA 1S6PA 1BQNB 1IKVB 3KK3B 4ILMA 3NAEA 5I9EB 3MPUB 1IV0A 2V6AA 1TFWA 1MN7A 2IJNA 3H40A 4CO1A 5CYJA 3NE6A 3AFGA 5JUMA 1UVNA 4LSNA 2Z2ZA 4PWWA 5IWAK 2HRYA 4DG1B 1LAVA 4C11A 4FLVA 2MSTA 5DK5A 2P9GA 4JAXA 2IM2A 2MGZB 1QSSA 2BE2B 3KHLA 2YI1A 1UAXA 3HHLD 1ZM4A 3ET6B 3FNNA 2NXCA 4CJEA 4CHPA 1J9AA 1NGEA 2DCUB 2FZCB 1FRIA 1TR0A 2VBZA 4Y00A 3A3PB 3H5SA 2AP1A 3EUNA 3U4LA 4QIWD 1I6JA 1ZM9A 3SLCA 4DR5F 3AO2A 2YH1A 1T9WA 2E1MC 2D9PA 4FDFA 1SUQB 4PRFA 1T03B 3TSUA 4NPOA 2HZVA 3LPTA 1YBTA 4LRFA 2BM0A 1LKZA 3ITHB 1HPMA 2A40A 1JQGA 3ZETB 3I5CA 1TV6A 1OJ4A 3RJMB 1B9DA 1X9JA 2BOPA 3VQQA 1QSYA 4DR4J 1RWPB 5KQ8A 5CYQB 2VV5A 4X66F 4ZPVR 4EAHD 3Q8RB 2PFDA 4YDUC 4J8FA 5IFMA 1BIZA 2OCEA 4JV0A 4M5JA 1MU2B 5C15A 4M3ZA 1M0SA 5KFHA 1H2UX 4PG5A 2F96A 4LF5J 2P9UB 3VGSA 4GVLA 1AZSB 3T9ZA 3LDNA 5E3QA 4JV1A 3NF9A 2ZGZA 2QIFA 3R7NB 2JLFA 2JZ5A 1BHNA 3AA9A 1U1RA 3CJ8A 3JSYA 1VC0A 3VEXA 2RQ4A 1XNRF 4A8QA 3THXA 3R5CA 3IWLA 4HH0A 3VQTA 3VAKA 4CNYA 4ZIVA 1BA1A 2DK2A 1S5ZA 1Q7YT 2O8CB 4KO0A 4PY5A 1W26A 3HKZD 1GNKA 3WNEA 5KFXA 3JAMU 2VA3A 1VQPN 2ETJA 3O4QA 4BRFA 3F0NA 4JYAF 3KJVA 5HMWA 3IMXA 4A4JA 1E3MA 4DR5K 2P9KB 1MROA 4K4SA 3UN2A 3VALA 3BO4A 4P7VA 2QO3A 4HCBA 2OA8A 3CCQS 3UNGC 4L76A 5JVHL 1NB2A 2ZE2A 2QL9B 4RU2A 3MM5B 4OO1J 1ZM2A 4OI1A 4HT7A 1VQYA 2CDRB 2QWMA 3SBMA 4B1ZA 1VLOA 3ZSOA 4EO6A 2QN6B 3CCRN 2JEIA 3OFGA 4X66K 3DLEB 1YJRA 2KO1A 4C1NI 4PKIA 2LLZA 3C7NA 5GAGP 4NEZA 2HF3A 2NLXA 3IDHA 3OTCA 3QB0A 4OHWA 2HQGA 3IGVA 2E1CA 4USUA 3HT3A 4LF9F 4C8MA 2W41A 1S1VA 2FF6A 1X9WA 4PKGA 4FO0A 4ANDA 3AVCA 2ZVIA 5D0EA 2Q31A 1S6QB 4X4NA 3FGUA 3Q0AA 2FJBB 1XNRK 3HLUA 4HHTA 1LWEA 3TPQA 4DB3A 4X62F 1WSVA 3OVSA 3J7A1 2E5HA 1CULB 3FZBA 1S79A 3ZSXA 4JYAK 1NLVA 2P9IA 2XYHB 3OYLA 4GV3A 4URQU 4DQRA 4CF9A 4CFCA 1GLDG 3MEEB 3DXMA 2Y0BB 5D0GA 1FXXA 5KRSA 2WW8A 3V4IA 1NGCA 4YB7A 3UD4P 3W62A 4KJIA 3TYTA 4Z37A 1VQ8N 3U6FA 1YI2S 1PG5B 2Q79A 1NXIA 4WFBQ 4TKTA 1NDKA 3C14B 1WG5A 3EVWA 1WELA 4FF1A 5GMKa 1KHWA 3KFWX 1S9GB 4DV1F 2HF4A 2RIJA 1UJ6A 2X1GA 4H54A 3W9IA 4ECYA 1SQFA 4P2MA 1S4EA 3G8SA 1CPZA 4Y1CA 4NOHA 4FW1A 2RN2A 4LF7K 2W8KA 5KT5A 2NQPA 1LFWA 4LF9K 5D0HA 2ILYA 1U2VB 2YTCA 2PEHA 2HBRB 2HBQB 2LEBA 2IVMA 1PC4A 2IYIA 2VOPA 5F0UA 3LUYA 3TW0A 2GZOA 3OYHA 2O8FB 1KVIA 3Q8UA 1RYRA 4DI6A 1BDGA 3CDUA 2NUUG 4DL5A 3H1VX 3EGVA 1YHQS 2JEJA 4U7BA 4A59A 4EYHB 3KDNA 4ZDNA 5KFLA 2FY1A 3W2WB 4X62K 3TAMB 2VC0A 2W4PA 1RI7A 1VHFA 4FJHA 2AW0A 3MPWA 3Q8PB 1U1PA 1NKEA 2KG0A 1VSEA 4QWBA 1L3KA 2X3DA 3NGDA 2GW8A 2A42A 3I0SB 2KJVA 4BC3A 2ZVSA 1NGIA 1T8EA 1PC5A 2G1HA 5F8NA 4DSLA 4PWDA 4AHCA 2KFZA 4PXDA 1Z26A 4DTUA 3GFHA 2I1RA 2CGLA 1Q95G 3M05A 2HHWA 3OS1A 4M95A 4KHRA 5KFMA 3H0PA 4Z4GA 4DV1K 1UJ4A 1EZZB 5F0XA 1O6XA 4KHMA 3OS0A 2CH6A 1IJJA 4CLSA 3KLIA 1JJ2M 4N8NA 3DGPA 3MXIA 2MSSA 4RNHA 1BCMA 2V4QA 1KTVA 2AYBA 1BO5O 1HPZB 3OUYA 5IQ6A 2HMIB 1UZDA 2Y9HA 3SMSA 4CO2A 5ETLA 4PWUA 2R2RA 1LCUA 1VQLS 2XMUA 1WSIA 4U9RA 2NPFA 1ZBUA 4FPIA 4OZ2A 2DR6A 2AIRB 5AQHA 2FZGB 5E26A 3P5JA 5C7PA 3GG4A 5BPLA 4R0JA 2XM3A 3GJQB 1V3ZA 1N36J 2NYHA 4ZJOA 4YDUA 2AGQA 3OL7A 4JHDA 5L1IA 2J9EA 2LECA 4AL7A 4M42A 4FLZA 3P4IA 2XSJA 1O0PA 3P6YC 4JI0F 5KG5A 4Z4IA 1SV5B 2L41A 1X5OA 2AEJA 5M1FA 3VZHA 1Y5IB 2R3VA 3MK6A 3AXKA 3O9QA 1PJ6A 1VQON 4JKGA 4ATNA 5I3UA 1E4GT 3CMES 1RXOB 1O5JA 2K3IA 3KHGA 5AQZA 1KOHA 2PN6A 2HWTA 3OYFA 4NLDA 2AJ4A 1HNXF 5A8RB 4H8KA 1UL3A 3L3UA 3CW2C 3K5NA 1GXLA 2QMUB 3HT0A 2B51A 3N4WA 3EKUA 3PX6A 5IQQA 2LP4A 2FXUA 3RGIA 2DR9A 1DQ9A 3BSNA 2OZSA 1CJTB 4J5OA 3HSCA 3SFGA 4GVMA 1HHTP 2L9WA 3SZ2A 1WC3A 4IFYB 1WD6A 3VQ7A 4MO5A 2JC1A 2A6MA 4H5RA 1FE0A 3D0IE 4USHA 5EGYA 3D6RA 3CWJA 2OSQA 4OLBA 4JI1J 2XMKA 2ZKUA 1N8RT 1X0PA 3OYAA 2R2TA 5D4PA 1Z05A 3TTFA 4LRAA 2HHHJ 2AF6A 2W8LA 1HNVB 4P10A 3G25A 2JWLA 1HWKA 4CJ4A 1AUDA 3IWNC 3OVAA 3VGKA 5CZXA 1FDDA 4JI7F 1X3MA 3QO9A 5CYMA 2BRLA 1RAHB 1KVAA 3QLHB 5M1NA 2JRSA 3TWZA 2RB7A 3JTNA 4BC4A 3C6HA 5FD1A 2FSJA 1HNXK 4PPZA 4M3UA 2JLGA 3C95A 2OSRA 5LMNJ 5KOWA 3SQGB 5M2UA 2E9ZA 3QMLA 1BUXA 4K4VA 2UXBF 3HFKA 5KFKA 1CS4A 4KH5A 2CQ4A 3ULDA 3KLVA 5CCLA 2W2QP 3D1QA 5HL7L 1KHVA 5IC6B 4RNOA 1RCOB 1X60A 2ZEJA 3VGLA 2G8KA 1C0MA 3RMBA 4FJ7A 1WTFA 3JTOA 4DR1F 3O6QA 3NNHA 4RW4A 5DLGA 4DCOB 3QT7A 4KTQA 2GO9A 4FL9A 4DSEA 3N6MA 1R7IA 2HK3A 2F4VF 2H5IB 1MMDA 2BANA 1Q7LB 3GE1A 2AZ1A 3O44A 1IJFB 3TJ8A 1HKGA 3KYLA 3KDOA 5B0AA 1TKXA 2ZHOA 1H98A 4Z94A 2A6AA 4N7TA 1GMVA 4CHYA 2E2QA 4E98A 1IN0A 2GIFA 4FWNA 3TJ9A 2A1BA 2HSTA 1Q81O 2VJUA 2EFOA 5AQOA 3H8YA 4BLGA 3OYNA 1T7PA 3BEGB 3WUHA 2FJDB 1NU4A 1RT4A 3I31A 5AXMA 3MMBA 2FY8A 5C2DA 1T9TA 1M5OC 4JI7K 1Y3JA 1NOYA 2VPYB 2GVDA 1XMOJ 1YJ9N 1HI0P 3QBWA 3CJ1A 4BC5A 1Y4ZB 1FERA 3Q8SB 3NDKA 4FWLA 1NSKL 3CF5L 3ELHA 4ED6A 3EGZA 1F3FA 1DARA 5IC4B 2FBVA 4DLGA 1EHWA 1PYSB 3F5TA 4KI4A 2UXBK 3AVHA 3HX9A 4QWEA 1XEZA 2Z2LA 3GIJA 2W9CA 4AHVA 2EFPA 2JSXA 3GJRB 3J7ZT 5AE3A 4B1WB 4AILC 5IOLA 1Q53A 1S72N 4F0MA 4DR1K 5B09A 3CI5A 5LMUJ 2BH1A 3IRWP 1RT1B 3NG8A 3HM8A 3RRGA 3HVWA 2F4VK 3OTOF 2FSKA 3UKUB 2PI4A 3R5JB 3F2KA 1Q5YA 1VOMA 1Y5NB 5BRDA 3BGRA 4ID5A 3Q89A 5AQKA 2ALYB 3HULA 4B3MF 4M5HA 5L9XA 4CK2A 5C24A 3GP9A 2AV5A 3L2VA 2LXFA 2PBDA 4BRGA 3CTRA 3TTDA 2KL8A 2Y1JA 1RGVA 2CPHA 3B8HA 5L1LA 5DGBA 3ICLA 4NRTA 2YKMA 4IOAQ 2V34A 2Q6CA 4K42A 4CT9A 3PFEA 3I9V9 2D9OA 3O6WA 1NHKL 7FD1A 2IY5B 2ZJQL 2KRRA 1N8RO 3R1XA 3NAHA 5CE3A 1VQ4N 3TAEA 5AXNA 1SH0A 4K4YA 4FK0A 2RVJA 5DZ7A 1WF1A 2SXLA 5IWAJ 4OJ1A 3AD9C 2VL1A 3U7JA 4FYDA 4B3RF 1FVSA 4ISFA 3FE1A 3G6VA 3M7VA 2V9WA 1KSPA 4RW6A 4BRQA 3DLGA 3VZIA 4KH1B 3LWLA 4MYUA 3J81Y 4F8RA 3A5OC 3OTOK 1B0TA 2HFNA 3MUVP 3KLGA 1X5PA 2MQQA 2CUYA 1TKZB 4GV6A 1RHMB 3I5AA 3KXDA 2E7VA 2MLYA 5FDLB 2IC3B 2GGPA 2MZRA 4IH7A 2ZH2A 4B3MK 4NO7A 2E2PA 4DTSA 1R89A 1TTHB 2XHBA 3ZNUA 4O5BA 5LJ5Y 3MCPA 4ALZA 2CH5A 4B08A 2J4RA 4DV6F 3C6UA 4G1QA 2PC6A 4DCPB 4K0KF 3CM5A 4BRHA 3DU6A 4NYPA 4CI6A 3R5AA 2DGQA 3D6FB 2E1ZA 4ES1A 5M1PA 4ILLA 2RS8A 3I4PA 4NXMJ 2RDDA 4O8KA 5IV4A 5EDWA 3BKFA 3HFZB 4ZVEA 1S6PB 2DNZA 3CQXA 4C48A 1FRKA 2D41A 3KUEA 2CQ1A 4B3RK 4IYQA 3V81A 2PI5A 2OZMA 3UO0A 3R9LA 2QWLA 1HBNA 5B8HA 2FUG9 4LSNB 3NCQA 4C8ZA 4H0OA 2K7JA 1H74A 2LCWA 2ZC3A 1OY9A 5KRTA 2V8HA 4C11B 1VQ9S 3AVFA 1VSMA 3K9JA 2HW3A 1QUVA 3MEGA 2WVEA 2FD2A 4ECUA 4DJBA 3D54A 4DR3F 3CCVN 2W4CA 2FDNA 4D3HA 4DR5J 2AJ1A 4B3OA 1K73O 1IWGA 1SJRA 4JK9A 1FE4A 1IG8A 3D1OA 1BOTO 1RDWX 2XGQA 2CPJA 1CBKA 1LWXA 5EVZA 4QIEA 3EGWB 3J7ZO 1KLMA 4J9KA 3GIRA 1RDRA 3RUBL 3TX0A 3ZNJ1 4JV5F 4CH7A 4WF9Q 4DV6K 4X2BA 4X66J 3ATUA 3W64A 1TV6B 2P9NA 5I3QA 1RWMB 3M8WA 1W2BR 5B0BA 3MWTA 1IQZA 2HRUA 3HSDA 2BQ3A 3L6QA 4JKDA 2AJ2A 2YJFA 3DOLA 2VOOA 3VGUA 1IH7A 5GAGI 1F5AA 1HNIA 3AAWB 3QEXA 5F0WA 1XNRJ 3CCQN 2HHTA 3I82A 2BJ9A 2ZBRA 3B82A 4PG8A 3RBEA 4IRKA 1VGYA 3AVLA 2WB1D 3QJPA 4BACA 3NS7B 3THXB 4OX6A 5ADXA 4DR3K 5FROA 1JLAA 2QWPA 4E89A 2RU3A 1DLOA 1G6BA 4M5DB 3NH0A 2ZBCA 2N7CA 4KO0B 2XSFA 4C8OA 2FJWA 4HHUA 1NH8A 4Z2XA 2P9LA 1MA9B 4MK9A 2HB5A 1KEKA 3GG0A 4DX7A 4FWKA 4AHSA 3KHHA 2J0QD 3KJVB 1KS2A 4XH4A 2HS3A 1SVDA 4U6PA 1MROB 1AT1B 2KZMA 2F8HA 1X4GA 1FO1A 3NAIA 3PO4A 3HSZA 1RE1B 4DU8A 4V19X 1BHLA 2JOQA 4JV5K 1WG4A 1DKGD 2ZE2B 3M32A 3I55N 5K8NA 1HWJA 3SCIE 1A0OB 1MWZA 2IGIA 4MFBA 4ER8A 3H2LA 3OV7A 3J81U 4K8RA 4ZP8A 4BC9A 2CQ3A 2UXDF 4QW9A 5HMXA 4JEPA 1VQKS 3H2VE 4CHNA 4E8UA 3C7NB 2NSCA 4DTRA 4J2AA 4I68A 3QERA 3E01A 2DNRA 4NLPA 1JK9B 2EFVA 1X4HA 1VSIA 3PX0A 2YJEA 2QTWA 3PM9A 3D6MB 2UUBF 1S1VB 4KAIA 2BABA 1YI2N 1UZHA 3C65A 3BYRA 4OFZA 4X62J 5EXWA 5HRPA 1C4CA 3NGRA 1VRQC 2GIRA 1U02A 1LWEB 4LF4F 2E20A 2QYGA 1RTIA 1WN7A 1JXEA 2QKBA 4FKXA 1CXUA 4DXLA 1BWFO 3ZTOA 4KKOA 4U7UD 4DEZA 4CO4A 5IV3A 2QE5A 2P9IB 3RRKA 1JXVA 1RT5A 3SV4A 4BE0A 4OJRA 4DF8A 1Q79A 3DXMB 2DPIA 3V4IB 4PXBA 4J9LA 4IDHA 4DV1J 4H5VA 1TKTA 1YHQN 3NGIA 3TEGA 3GZ7A 1RHUB 4BG8A 3NCIA 3N6LA 4Q7AA 4DKWA 2DHSA 3D28A 4EBEA 2XEXA 4HVZA 4F4XA 4TVAB 3M1VA 3S3NA 1RQ0A 4QJVA 3KKRA 1F9FA 4CWBA 2BEFA 2UXDK 1RU2A 5CD4H 2V69A 2XRIA 2V68A 1WSGA 3J7YP 1WHWA 4IKAA 5LSLA 4FJGA 3I32A 1B7YB 2E5LF 3QRPA 3B6PA 2UUBK 4EP5A 4L3KA 2ATCB 3RMCA 1NMEB 2LA6A 1I94F 1GK8A 4AYBD 3O3GA 3GR1A 4FW2A 4PKDB 1YZ6A 4LF4K 1RT3A 3DI6A 2R7TA 5HRNA 3CDBA 4KQZA 1WHVA 2OANA 5GADP 2NRWA 1UTAA 1RLDA 5E2QA 4ZPAA 4CNZA 4C4WA 3S3OA 3THVA 1NM1A 1VQLN 3M6VA 4DL4A 3SBGA 2EWHA 2HGLA 4OI2A 3I56S 1NGAA 2LYVA 3H90A 4C3MA 2QMWA 1NDLA 2XCAA 1SC4B 5G4DA 2QI2A 2BYCA 2V67A 4PWDB 2ZJPQ 3TTCA 2ROEA 3LANA 4KPCA 4J37A 1XN9A 5AZIA 2DXEA 4YNQA 1ATRA 1WEZA 2J76E 5AQQA 3VEVA 4K8XA 3FFIA 3H46O 2ZBIA 1XQSC 3SMZA 4YOEA 2XY7A 4LMZA 5LXRA 3BN4A 1U1NA 1JL2A 4CZGA 4TN2A 2A0FB 3D2EB 1M5VC 1GAOA 2ZGYA 1S1TA 1S49A 1VQMS 4DPYA 3IC1A 4Y2CA 3KLIB 2V63A 4Z4FA 1M5PC 3DGPB 4TXSA 2E5LK 4N77A 3OUYB 1U09A 1EX4A 4I6AA 1I94K 2XHWA 1SQEA 5DO2A 1NUEA 4P74A 3ZEUA 5D8HB 3S1TA 1ZETA 2OI2A 1CJKA 3HVTA 2GVZA 4OVLA 1IR2A 4HACA 2IA0A 2UVUA 5ETQA 4JI0J 4M5LA 2X74A 4OIXA 4Q8EA 4WU2A 3T6JA 4JHDB 2OTLN 1RDDA 2CGKA 1P1LA 3AD7C 1FFWB 5K8PA 3QIPA 1OSCA 2XSJB 4GC6A 4KAZA 1BI4A 4JI6F 2NR0A 4ANEA 1VSHA 4ZP9A 6FDRA 1VC6A 4DSFA 3SUQA 3C0BA 1U1OA 1Q1KA 2LQ5A 3D3BJ 2PT0A 3BR8A 1HNXJ 1EWQA 1QUPA 3CCSS 4JKGB 1ILYA 4CEZA 5I3UB 1NH7A 3D66A 3FCHA 3MM7A 5J2NA 4RUHA 3MN6A 5E5NA 3HMJG 2BACA 1Q8LA 3MOJB 1FEHA 4OX9F 2K7KA 2DTJA 2ZF5O 1HMVA 4X4SA 3PX4A 1FNMA 3KKSA 2G4BA 2FZKB 1UMJA 4CZEA 3KLHA 1UFKA 3QMQA 1TAUA 5H9FJ 3TQEA 3DHWC 2ZWHA 3CPWR 4PCQA 4ZVFA 4OKEA 4DFMA 1OVQA 1N0VC 1NWKA 3BYPA 4H5TA 1TK5A 1RILA 4ED5A 4FJXA 2RMLA 2XQCA 4GNIA 3A4TA 4OYOA 2BBEA 4CW7B 3HD1A 2DCLA 5LXYA 3RG6A 2YY3A 4DR7F 3ZX2A 1M5SA 4CTAA 2ZZMA 3FRZA 3W9HA 3MX2A 4BWJA 2DRAA 2V4JA 2ZKTA 1NM2A 2VWJA 4X4UA 1IM4A 2FHMA 2MMYA 1XR6A 4U67L 1OIAA 2C2OB 4JI7J 1HL6A 1ZZNA 1S9EA 4CEAA 4NEYA 4JI6K 4LFCJ 4K50A 3LL3A 1X4BA 2RQMA 3BPDA 5F1XA 3GCXP 4C0HA 1BLUA 4G6VB 3QO9B 5CYMB 3BBBA 2YPYA 5KFVA 3PFOA 3UW1A 4ID1A 4WFAL 4ES2A 2UXBJ 2YNFA 1HNZF 4OZ5A 4JUZA 1RISA 1YTAA 4OX9K 1YJTA 4CYUA 4F67A 2R8HA 3Q83A 2XO6A 1JCEA 4CT8A 5E41A 3L8BA 2ZQBA 4WK1A 2CPEA 2ZBPA 4DR1J 2PFFB 3CJQA 3A0IX 5AQXA 3AVIA 1YRUA 1CS4B 4ECVA 2VBYA 1TAQA 1KVCA 1P1TA 1MMLA 2XNQA 3CD0A 3FSYA 1VCTA 1Y3KA 1YJ7A 2ASDA 3DRPA 1JKHA 2KZZA 4RW4B 4J9RA 2IA6A 5CY4A 3GV7B 5KFAA 2XI2A 3AB4B 4A8MP 4E1NA 2ASJA 5BYSA 2KHCA 3R9PA 2BANB 1VRTA 4DR7K 3KHYA 4KTWA 3PYGA 1TKXB 1RHRB 3UCZP 1B92A 3BP8A 3R2CJ 4FM0A 2DH9A 2G1DA 1WF2A 1MWQA 4JI4F 1Q5VA 2HBKA 3GYNA 2ZH6A 3F41A 3HKWA 3O9UA 2Z1GA 4ZVPB 3OR2A 3DMJA 3MCSA 1RT4B 3ALYA 1QVGR 1ZAVA 2C3YA 2V8VA 3KK2A 1TUUA 2GVDB 2JL9A 2JLEA 2F4FA 1M1KT 2IBKA 1JNZB 4FCYA 3EJMA 3O1BA 1S99A 3O5BA 2PE8A 5LSRA 1R0CB 2D69A 3QJLA 1Z2LA 3TUIC 1ATSA 3CJ7A 1TMMA 2X3GA 4AE5A 3M8YA 3K5LA 2MZJA 4RWTA 1GLEG 4O4GA 3KLFA 3MTKA 2W9CB 5AQGA 5ETTA 4USTA 4O4RA 4DSKA 4GW6A 3OTOJ 3ZTRA 1O13A 3HHDA 2M9KA 4NLUA 4H0TB 4P9SA 4R5PB 4ZVUB 5JLHA 4M3XA 3OS2A 3IBWA 3NWGA 2ZUAA 1JJ4A 3RAQA 4YP3A 2V7YA 2RRBA 2CNNB 3PV8A 5F3TA 1R0AA 2OIHA 3GILA 4B3MJ 1H7WA 1UVJA 2ZBQA 1VIXA 2E1PA 1KR4A 2YHXA 2CQGA 5ELZA 3BGRB 1F21A 4ID5B 4B1UB 1Q86T 1HKAA 2XY8A 1SZ2A 3IM9A 1WSFA 4Y28C 2BW2A 4E7IA 5C24B 2R7XA 4BVOA 4BY9C 5HOOA 1QE1A 3LDLA 5F8IA 4BG9A 2OUGA 1U1KA 2QJ3A 3PW7A 4OZ3A 2EX3A 2Y8WA 2DPJA 4IJNA 2OP5A 4DV7F