3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
4DTJA 4NCGB 2D7SA 4DSKA 3GIMA 4ZP7A 4DFKA 3MXIA 2YKNB 3K5LA 3VQCA 3HL8A 3CM6A 4ECWA 1YTAA 2D41A 3AVFA 3V1QA 1TL3A 3IG1B 3JSMA 4CHZA 3NL0A 4JRPA 4DTMA 4CK2A 1SKRA 3M8PB 4F4KA 4IH7A 1LAWA 1T7PA 4KV8A 4DF4A 1LW0A 3PR4A 3NHGA 4LSNB 4CGHA 1RT2A 4DQRA 3RB6A 4CHPA 1VSIA 2WONA 5I3UA 2HVIA 5KFUA 5HRSA 3G6XA 4KHWA 3MFHA 3ITHB 5KFIA 2DFHA 4FJ8A 1FK9B 4DTOA 4WE1B 4RW8B 3FFIA 3PW5A 3QZ8A 2HHTA 5EWEA 4FS2A 3SUPA 1I39A 4TY8A 1B92A 3SPYA 2WOMB 4WZQA 2FVCA 3O4QA 3LZJA 3GV8B 4G3IA 4Q43A 4O55A 1BCOA 3AA4A 2OPSB 4DFMA 3NF7A 3QNNA 3KK3A 3HM9A 4QOZB 4K4UA 4NRTA 3KHHA 3DOKB 1S1XA 3RB0A 2YNFB 2HVHA 1RT3A 4RUAA 3TAEA 5KI6A 2PY5A 1TKXA 3TANA 2DFEA 4ZVHA 3V4IB 2IJNA 5D3GA 3OHAA 3HT3A 3L2QA 1TP7A 4AHUA 1BQMB 1RA6A 5J1EB 1YTUA 3LP2B 4EZ6A 3L3UA 3UPFA 1DTTB 3C94A 1HMVB 4BDPA 3QNOA 4CF8A 2HMIB 3TABA 3LWLA 2V0NA 1BCMA 5FDLA 2FBYA 3V9ZA 4TY9A 3O3FA 2KFNA 4CJ5A 2OPPB 5KFNA 3G10A 4QAGA 3OVNA 4QWDA 1FXXA 3MXMA 4IDKB 1ITGA 2BRKA 1ASVA 4M42A 4FJ7A 2WHOA 4CJLA 3DRRB 3GV7B 4OGCA 5J2QA 5F8HA 4Q8FA 3DM2A 4WXWA 4K8XA 1CZBA 3BQ2A 1RT4B 3AO3A 2YNGB 1IKXB 4CEDA 1RDRA 5E41A 3K5MA 1KCFA 4MIAA 4RW6B 4DU4A 4BWMA 1RDAA 2R2TA 2W8KA 1ZBLA 4Z4EA 4KPYA 4PWDA 4GC7A 4FJHA 4Q8EA 4LSLA 4DL6A 4DL7A 4M41A 3OYEA 4FYDA 3I0SB 1QQCA 4CEBA 3OL8A 4KAIA 1HYZA 3NBPB 2IM3A 4OKKA 3KLFA 4QWEA 2F8EX 3H5SA 5C25B 4CEAA 1NHUA 4CHOA 4CFBA 4Q0BA 4XPCA 2B6AA 1LWCA 2D0AA 3AO1A 3RMDA 4ECUA 4RG8A 4NLYA 1C0UB 4M94A 4TXSA 1L3UA 3OL7A 4ZPAA 5KFRA 3PJWA 2IA6A 2I1RA 4Y2CA 3Q8PB 3QIPB 5CYQA 2WCXA 3RR8A 4B9NA 4TSXA 5L9XA 4DLEA 2JEIA 1EP4A 4FJXA 2R2UA 1IKYA 1QS4A 1N6QA 1QSLA 3GIKA 5I42B 1SH2A 4NLWA 1LW2B 2DPJA 4B9LA 3HVTA 1RT1B 1XWLA 2J6SA 4OKJA 4ZMMA 2BQRA 4MK8A 2HAIA 3MEGB 5L1IA 5L1LA 1UAXA 4CE9A 4J9LA 3PVXA 4Q5VA 3B6OA 3WNEA 4B3OB 4NCGA 3KHLA 3L3VA 3AO4A 5L1JA 4BACA 4HCBA 3OJUA 1RBSA 3PR5B 4M3UA 4Z4GA 4MK7A 2AWZA 4ECZA 1NK4A 3TVKA 3QIOA 1VRTA 4KSEB 3N6LA 4DL2A 3K2PA 4E7KA 3IG1A 2HNZA 4RW4B 4PA1A 2J6TA 4FM1A 4ZVEA 4FJNA 3OSPA 3H5XA 1KSPA 1Q9XA 1KHVA 2HB5A 4LSNA 5T7BA 4CESA 5KG3A 3NF6A 1BL3A 1JLBB 1EKEA 4L8RB 3SUOA 5T14A 3C6UB 3AO2A 3OLBA 3NGZA 1JKHA 3QLHB 3ITHA 1LV5A 3T5LA 2HHQA 3NH2A 3AA2A 4RW8A 4U6PA 3OS2A 4DFPA 1HNVB 3M8SA 4ID1A 3CVKA 2XWYA 2WOMA 3MECA 4HYKA 1WSFA 4K8ZA 4NLUA 1HJRA 3EZ5A 4DU1A 3DMJB 3TAPA 2FVRA 1RBTA 1YT3A 3OYAA 3C6TA 4E3SA 4O3NA 1U48A 4WYWA 1RILA 3KK2B 4YR0A 3N6MA 4FLXA 3V4IA 1LWEA 1KRPA 1W0HA 3NH1A 1HYSB 4Y1CA 4I2QB 2OPQB 5KG5A 1TVRB 3QYYA 3RWUA 3KOAA 5J1EA 3ULDA 3HJFA 3AVIA 5FRMA 4IR1A 3DRSB 3LP2A 2E9ZA 3AVHA 2OPRA 4NLQA 3VQEA 1N48A 4IFVA 2W9BB 3PHEA 4ECSA 3PW2A 3H5UA 4ZPBA 4EZ9A 2G8IA 1HQEA 1S48A 4C8OA 1NK5A 4GVMA 2D5RA 2HMIA 3OJSA 4ID5B 1NHVA 4TQRA 5KT2A 4DTRA 2Y1JA 2QKKA 3GQCA 4J9KA 1VSKA 2VG6A 2O5DA 1FKPB 2W7PA 3QESA 1RTJA 1QSYA 4DS4A 4W5QA 4OL8A 5F8IA 2JC1A 5DG8A 2DFFA 4N41A 1RDCA 1NJZA 3DRRA 4RW9B 1T05B 1S97A 2FJWA 3L2RA 3SCXA 3H08A 4FJ9A 3VQBA 3SPZA 4TQSA 2OZMA 1WSIA 3H4DA 3BJYA 4H4OB 4DQSA 1RT4A 1IKXA 4FBTA 3E51A 4K4TA 4FK0A 1REVA 3BSCA 1NKBA 4KI4A 5DQGA 3GV5B 4O5BA 2Z1IA 4LH4A 3KLHA 1RYSA 4I7FB 2GIRA 3L2UA 4ZPCA 3LP3A 3HP6A 4B9SA 1NK8A 4OGEA 4RUCA 4W5OA 3JYTB 3SYZA 2IOCA 3QEPA 3F9KA 3AV9A 3P5JA 1WSHA 1SV5B 4IKFA 1KVAA 1JLEB 3NBPA 3NE6A 3OHBA 3QGIA 1VSLA 3THVA 1C1CB 2G8FA 4CERA 1GOCA 4KRFA 2R8JA 2CKWA 3V6DB 4WFXA 4M3RA 4DSEA 1HPZA 3QGGA 4KBIA 1C0UA 2XY7A 3VQQA 4ICLB 2WB4A 4CFAA 4KHQA 3MEDB 5J2PB 3KJVB 3AVJA 5CYMB 5SWMA 2YHAA 5FRNA 5KFBA 5JXSA 5I42A 5K14A 2O4GA 1RT1A 1FKOB 4ECRA 2X74A 2Y1IA 4IG0B 1JLAA 3MEGA 1LAVA 1IG9A 3CWJA 4CK3A 1RT6B 4KTQA 2W8LA 3DOLA 1RTIB 1WAJA 4KO0A 5HROB 1VSFA 3TARA 4B3OA 2BE2A 3U3YA 3RR7A 1QE1A 4B9MA 2XHBA 5KT7A 1TK0A 2JLEA 3T5KA 2RF2B 1SKWA 2B43A 3RTVA 3LDSA 1S6PB 1MU2A 4E7JA 4E7IA 4EO6A 2NUBA 4I2PA 1HRHA 3DLEB 5C24B 3SV4A 3OYHA 1U45A 1QAIA 1J5OA 1S9EB 2Z1HA 4R8UB 3DLBA 3Q8RB 4FW1A 4ELTA 3HPOA 3QEWA 3B6PA 4EBEA 3HPHA 1JLFA 4YFUA 4AH9A 5HLFA 3GILA 3NMAA 2Z1JA 3GIIA 4CIEA 3V1RA 4CHQA 1KVBA 1EX4A 3KD5E 3NGIA 3QLHA 1UOCA 4K4SA 4F3OA 4RNFA 5KFMA 1BQNA 1HNVA 5DLFA 1IKVB 2FC0A 4CK1A 3VQ5A 5C42B 4MFBB 2VA3A 4KAZA 3IS9B 3I0RA 4LQ9A 4E7LA 3QEVA 2ALZA 3NCIA 2ILZA 3TAFA 3G6YA 3KNAA 3DRPB 4J9QA 5F8MA 3MTKA 1NKEA 4IH5A 3DMJA 5F8NA 1JXLA 3K58A 1Z26A 4NYNA 4NLGA 2QK9A 3NH0A 3QGHA 5J2MB 4RU9A 4NCAA 2HNDB 4U7CA 3KK2A 4B9TA 4ECVA 1TKZA 3RBEA 3O3GA 3IN5A 4E89A 5KFSA 4J9RA 1U49A 2GIQA 4I2QA 2OPQA 1VSDA 2D0CA 1XI1A 3CYMA 1HQUA 3DRSA 2HNYB 4F4YA 4OPKA 4CHYA 5F9LA 5F8LA 4F8RA 2XGPA 3KLGB 1LWFA 4PQUA 1WSJA 5KT4A 4RNNA 4JLHA 2AQ4A 2ZD1A 2E6LA 2XRIA 4WYLA 3Q8QB 4UQGA 1FKPA 2BQUA 1JLGB 2HWIA 4CCHA 2OA8A 2E4LA 3ZSYA 2FLPA 4IG3B 3D45A 4RW9A 1T05A 1J53A 1ZBHA 3CJ4A 3KKSA 3KMQA 3AVKA 4H4OA 1RT7B 4KHYA 3H4BA 2E9RX 3WNGA 2R2SA 5KFWA 3OYCA 3RB3A 2GUIA 4CEEA 4JV2A 3KD1E 3KK1A 1RTHA 1RA7A 3MAQA 5KG7A 1WNEA 3IRXA 3C95A 4W5TA 1N5YB 4Q44A 4CIGA 1S1VB 4IQXA 4ECQA 3SFUA 3V9UA 2RKIB 4NLPA 1BI4B 1RTDB 2X6SA 3QERA 1SV5A 3CJ2A 1JLCB 1S1WA 4KKOA 2BRLA 5KGWA 3V1OA 2UVVA 1C1BB 4FM0A 3LZIA 4H4MA 1IM4A 1S0MA 1XR7A 3LANA 3H40A 1VSEA 3KLIB 2FBVA 1D0EA 3V6DA 2XY6A 1RDBA 4FJKA 3DI6B 5C5JA 1RBVA 4ICLA 4DG1B 4XIUA 3EPIA 3BSOA 4K4ZA 4ZP8A 3U3GA 5J2PA 4NCBA 3VA0A 4IR9A 3PW0A 1TL1B 3MR5A 3CM5A 2FJXA 1S9GB 3RMAA 4TYAA 2XGQA 2B5JB 3O3HA 4QWCA 2UUWA 4FBUA 1S0NA 1HYVA 4W5RA 3ZSXA 2IJFA 5CY4A 1RTIA 4CJFA 3EZUA 5DQIA 4M3ZA 1ZTWA 5KG0A 3QIDA 1HNIB 4F4XA 1DLOB 4DF8A 1NNDA 2P1JA 2B4JA 4QCLA 1TAUA 4E1NA 4YMEA 1SH0A 4KHRA 2FBXA 4RW7A 3CG7A 4Y1DA 4IOBA 2CJQA 1JL2A 4YP3A 4CHNA 1T8EA 4DTSA 4G1QA 5KT3A 1B9FA 4B8CA 2XO7A 4W5NA 5EU7A 4TLRA 1CXQA 4KHSA 4PY5A 4FLTA 3DLEA 4NLTA 1WSGA 2XI3A 4DTPA 2EHGA 1KFDA 3I8DA 1S9EA 2A1RA 1D1UA 4R8UA 4KREA 2IAJA 1VRUA 2ZE2B 3KLEA 3I5CA 1T3NA 3CJ5A 4CJSA 3SV3A 4RZRA 4EBDA 2KFZA 5SZTA 1MMLA 3PO5A 4KB7A 3DYAA 2KW4A 3V9XA 3BGRB 1IKWB 5KFHA 1X9SA 1KLMA 3NAIA 2XCPA 4GMJB 4IFYB 3AVMA 2V9WA 1JLQB 3ZSVA 3IGNA 1BIUA 1ZBIA 3MEEB 1IKVA 4EO8A 2VG7B 3DLRA 5C42A 4MFBA 1KHWA 3RAQA 1T94A 4JV0A 4EYHB 1A5WA 4CFCA 1ASUA 2I5JB 3NKYA 2ETJA 4IRKA 1XC9A 1B9DA 4CF2A 2EX3A 2VWKA 2YKNA 3CQ8A 3DLHA 4URQU 4N56A 3VQSA 2WK4A 4ED7A 1YVFA 1D8YA 5CZ2A 2HNDA 5DG7A 4F3TA 3AVGA 2ILYA 1NK9A 3M8PA 1EETB 2BR0A 3WNHA 4NLXA 5KFZA 1S1TB 4O4GB 5HBMB 2HNYA 5KG6A 4F2RA 4LQ3A 3SI6A 3OS0A 4JV1A 3M9MB 4Z4FA 2OZSA 5JS1A 2RDIA 1BISA 1FK9A 1C2PA 4WE1A 1DTQB 4HTUA 3OYMA 1RNHA 5HRNA 4TN2A 3CFRA 3UDLA 3CFOA 3OS1A 5KFTA 4KTZA 3LALA 1WSEA 1U04A 4CGFA 3TAMB 2KQ2A 1L3TA 2OPSA 1W9HA 4J2AA 1RT7A 3H2LA 3P1GA 3CJ0A 3LP1B 1O1WA 4O3PA 1GX6A 3ZT2A 3VA3A 3DOKA 2F8SA 4CJ3A 4CJEA 2YNFA 3OYLA 4KTWA 1N5YA 4NRUA 3LAKA 3AVCA 5DGAA 4OPJA 2XY8A 1Q8IA 2RKIA 2QXFA 1BQMA 3AO5A 4ELVA 5KFAA 4CJUA 4Y34A 1C1BA 3BSAA 3NFAA 2W7OA 1TL3B 3K59A 1RBUA 3PV8A 1DTTA 1XR5A 3OL9A 1HMVA 2XC9A 2JEJA 2G8HA 1G15A 4DFJA 3DI6A 1LW0B 3HXMA 3SQ1A 3SI8A 3MXJA 4JS5A 2UVWA 2OPPA 3VQ9A 2WONB 5I3UB 4IDKA 3BREA 2B5JA 3LPTA 2QE5A 4N76A 3N6NA 1I6JA 5KFVA 3FFIB 3RMCA 3M8QB 2LSNA 2YNGA 2WRMA 4RW6A 3VQDA 5CZ1A 2AX0A 1Y97A 1DLOA 3TAGA 3QZ7A 4E1MA 3PZPA 1R0AB 3PJXA 4ZTFA 2P5OA 2F96A 3KHGA 4FLVA 4DS5A 3ZSZA 3I0SA 2AGQA 4CF0A 1KLNA 5EUHA 1QSSA 3MR6A 1ASWA 3PW7A 1S1XB 2DPIA 4I9QA 2R2RA 1QUVA 4KHUA 2G8VA 2XI2A 1RT3B 5C25A 2A1SA 4CJPA 1TKXB 3RB4A 5KFDA 4AHSA 3HVWA 4IKAA 3L8BA 5HP1B 5KRSA 4O3RA 4FW2A 1VSMA 5DMRA 3CDEA 1BIZA 1RYRA 3OY9A 4Z4IA 4CEOA 1T03B 1J9AA 2V4QA 4B9UA 3ZT1A 2IC3B 3OL6A 5KFCA 2GV9A 1A5VA 3QIPA 1IKWA 4AHVA 4C8MA 1VK0A 3LP0B 4IFYA 1WLJA 2R7YA 1LW2A 5KFXA 2R8HA 1UA1A 4MQ3A 1CLQA 3HO1A 4M3YA 2VG7A 1XHZA 4O3SA 4R0EA 5KT6A 2RN2A 3V81B 2UVUA 3ZSRA 1RCHA 4CJ4A 3G0ZA 1QAJA 4IRCA 1UWBB 5KFQA 3KIOA 2C2RA 3P83D 3PX0A 1VSJA 2AJQA 4O0IA 1JXEA 3NDKA 2XY5A 2JEGA 3SZ2A 5KG1A 1QHTA 4DWIA 2FLNA 1SH3A 3VN5A 3PO4A 1RAJA 2PZSA 2VA2A 4RW4A 1D5AA 4O4RA 3PW4A 1S1TA 5KFKA 4EBCA 4O4GA 1ZBUA 5HBMA 5F8GA 4CGJA 1C0MA 4RNOA 4YR3A 4EP4A 1JLBA 3KLFB 3CO9A 3KHRA 3FSIA 3C6UA 1S49A 4DU3A 4Q0BB 1S1UB 1U09A 1LWCB 1D9FA 3G6VA 4KHMA 4FJMA 1CXUA 4KI6A 2PYLA 3SJJA 3LWMA 2HHVA 4BWJA 3KKRA 3BSNA 1D9DA 4NLDA 4JUZA 1XHXA 4GW6A 3D28A 4B08A 1EP4B 3BQ1A 3TAMA 5F9NA 1SL0A 5DG9A 2OH2A 4DL5A 1NOZA 1K1QA 3LPUA 3RAXA 4F4ZA 2BGGA 2ITGA 4MKBA 3HK2A 3TI0A 4NYFA 4FJLA 4K4VA 4CJQA 3RBDA 2VWJA 4J9NA 3V9SA 4FVMA 4NLOA 1HYSA 3VQ6A 1TVRA 3SQ2A 3T5HA 4BE2A 4J2EA 1VRTB 4FJ5A 2W9BA 2HNZB 4F50A 2R8GA 2YKMB 1SUQB 4FZXC 4YNQA 1S5JA 3ALYA 4ID5A 4M3TA 4CJKA 3PX4A 1K6YA 4ZP9A 3E01B 1SL2A 4N5SA 4R5PB 4DQIA 4CF9A 1A5XA 5KFEA 3HKWA 5KT5A 4JRQA 5DLGA 3Q8SB 4WFYA 1Z25A 3S3OA 4MK9A 4QW9A 5KFFA 1GOAA 2IGIA 1JKHB 3UQSA 4O44B 2AU0A 4KHNA 1I3AA 4H54A 4RNMA 2RDJA 4IH6A 3I5AA 3M8QA 2ZKUA 2HHUA 4AHRA 3L2VA 4NLVA 4Z4CA 2JC0A 3MECB 4XO0A 3GYNA 1R0AA 4FJGA 4I7FA 2FVPA 1RBRA 4JS4A 5JS2A 4FCYA 3TAQA 4O3QA 3OYNA 3CDUA 5DQHA 3JYTA 3I5BA 4M45A 2FJVA 2YNIB 2J6UA 1JLEA 2BANB 4J9SA 3C6TB 1C1CA 2IM2A 3V6JA 2E6MA 3KTQA 2IMWP 3DDKA 2V4RA 3M8RA 4QWBA 3NGYA 3BDPA 3OYKA 2W42A 1LWEB 5HP1A 2JEFA 2JGUA 4C8LA 2C28A 1KVCA 1S0OA 4NLRA 5EWFA 1X9MA 1T03A 4NZ0A 3MEDA 2IC3A 4HKQA 3KJVA 5CYMA 4YQWA 4CJTA 2OPRB 4CGIA 1C6VA 4IFVB 1NOYA 1UA0A 3LP0A 4CEZA 2X78A 1HQEB 4M95A 1CSJA 2R8IA 3A2FA 2BQ3A 2FBTA 4DSFA 4ZVFA 4M3XA 2YNHB 5KTQA 2HWHA 1FKOA 4CECA 4PUOB 4FLWA 3FDSA 4ECTA 4IG0A 4KFBB 3VQ7A 2VG6B 3G86A 3ISNC 1CZ9A 1RTJB 3U6FA 1RT5B 1RT6A 4HVJA 4HUFA 3V81A 5HROA 4FXDA 2KTQA 4Q45A 1UWBA 1NKCA 3CJ3A 2R8KA 4E7HA 2IS3A 3EYZA 2RF2A 2C2DA 3DLGB 1JX4A 2Z1GA 3ICLA 5KRTA 1S6PA 3ZT3A 3IGVA 3HYFA 1REVB 5C24A 3AVNA 4FJIA 2YV0X 3M9OB 3KLHB 1NJYA 3QO9B 3SUNA 1Z4UA 3ZT0A 4FZYA 3QEXA 3ISND 4FLYA 1TV6B 1HARA 2W9CB 1IH7A 2OYQA 3DLKB 3HP9A 4AILC 4B8AB 4N47A 4CJWA 2DY4A 3GIJA 1S1UA 1S4FA 4E19A 3AVAA 3ZT4A 4BE1A 1S6QB 3T5JA 4DL3A 2IDOA 2HHWA 1HPZB 4XPEA 3BR9A 3SFGA 3RRGA 1U47A 4J9MA 4ED3A 3ZSQA 3IS9A 1BGXT 1WN7A 1TK5A 5KFPA 3AA3A 4FM2A 4QWAA 4ED1A 1SKSA 3QEIA 2P51A 4HHTA 3MFIA 1NK0A 1N56A 2IM1A 3EPGA 3DRPA 5K14B 1WAFA 3HVAA 4EYIB 4E0DA 1JLAB 4OVLA 3FQLA 2G8KA 1L3SA 3UIQA 1IO2A 4WZMA 3VQAA 2C2EA 3DOLB 4KO0B 5J2MA 2BE2B 3TWHA 1QE1B 1VSHA 3AVLA 3VQ8A 4GC6A 1WNSA 3KMSA 1S10A 5KFYA 4LH5A 3K57A 3OYGA 1MU2B 4DTXA 4F2SA 2VG5B 4CJVA 5L1KA 4I2PB 5J2NB 4FLUA 4AHTA 4ZHRB 3TR8A 2G8WA 3OLAA 4CF1A 2YKMA 1EXQA 1SUQA 1J5OB 3KLGA 3K5OA 4I9LA 1J54A 2D0BA 4OKEA 2P5GA 4DTNA 4ED2A 1W25A 1NK6A 4ELUA 3WNFA 2IBKA 2HHXA 3UR0A 1TKTB 3E01A 5KG4A 4R5PA 4DSLA 1JLFB 4J2DA 1JLGA 3HVRA 1ZBFA 4YR2A 2HHSA 5HLFB 3MF5A 4IBNA 1JIHA 1C0TB 4IG3A 5KFLA 4ED6A 5HRRA 4O44A 4ZTJA 1GOBA 4F4WA 1TKDA 1BQNB 4KE5A 2DTUA 2O4IA 4HUGA 3K5NA 3QINA 3V6KA 3SQ0A 3I0RB 2AGPA 3OYJA 2FLLA 4CJRA 3EY1A 3OSNA 1S1VA 3FRZA 3AVBA 1BI4A 1RTDA 2GBZA 4NYZA 2ASLA 2YNIA 4DL4A 1JLCA 2BANA 3HSTB 4KB0A 3L2WA 3V6HA 3CDWA 4J2BA 1L3VA 3JSMB 4WFZA 3NGDA 2ZQBA 3KLIA 1ZETA 4AHCA 1TKZB 4URGA 2AX1A 4LD0A 1X1PA 4CEQA 3QETA 4KV8B 3VQPA 4HCCA 4Y2AA 4DG1A 1SL1A 3LAMA 4ZP6A 1BHLA 2WTFA 1HQUB 4C8KA 1RT2B 1TL1A 1S9GA 3SUQA 5DGBA 4PQUB 1LWFB 2D3UA 4J9OA 2YNHA 2IM0A 4PUOA 2ZD1B 4FLZA 4KFBA 4M3WA 1NJWA 2QKBA 1TK8A 2W9AA 1QTMA 2X6NA 1RT5A 1KTQA 3NAHA 2PYJA 3HPGA 4K4XA 4TY8B 4ED0A 4BE0A 1HNIA 1JXBA 2G8UA 4Z0UA 2ATQA 3PX6A 3ASMA 4MKAA 4NLSA 1TAQA 1X9WA 2GC8A 2FVQA 3DLGA 2UUTA 1NK7A 3OYDA 3PY8A 4BDZA 4MH8A 4QW8A 3KK3B 5EWGA 5KGXA 5JUMA 2FVSA 3T19A 3KK1B 4EP5A 1ZYQA 1RTHB 2BDPA 3CIZA 3FQKA 5F8JA 3IRXB 4OJRA 4X2BA 2ASJA 4FS1A 3QO9A 1TGOA 1GX5A 2ATLA 4CEFA 2ZE2A 3OYBA 4J9PA 5EDWA 5D3GB 3O4NA 4ZPDA 4KB1A 1ZTTA 3RMBA 4HUEA 1TV6A 1Q9YA 2W9CA 1KFSA 3S9HA 4RNHA 4ZVGA 1S1WB 4IRDA 4KKOB 3DLKA 4TYBA 2QV6A 4DQQA 2HW3A 3BGRA 4H4MB 4DEZA 2KZMA 4WXOA 1K1SA 4DSJA 1C1AA 1S6QA 3D5MA 1RDDA 4EEYA 4ED8A 1JLQA 3T3FA 4C8NA 1U4BA 3MEEA 5FDLB 2UVRA 2F8TA 1L5UA 3F73A 4B9VA 4O3OA 3OYIA 4K4YA 2EC0A 2YHBA 3IAYA 4FK4A 3OYFA 4BDYA 4QPXA 1OS5A 3H5YA 3AA5X 4DLGA 4FK2A 2I5JA 4URSA 3RRHA 3TQ1A 4OLAA 5J2QB 3V9WA 2KZZA 3S3NA 3SNNA 3DM2B 4H8KA 3S3MA 1TQLA 3H59A 4ECXA 1F21A 4CGDA 4CIFA 2Q3SA 4Z4HA 3H98A 3MR3A 2ASDA 2XCAA 4MIBA 1EETA 4PWDB 4ECYA 4RW7B 4LSLB 3M9NB 2RPIA 4CGGA 4DMNA 4G1QB 2AGOA 4O0JA 3NF9A 2VG5A 1YVUA 5J2NA 4DQPA 2E9TA 5KFGA 5HRPA 4ZHRA 5DK5A 5KG2A 4K4WA 2IAJB 2B6AB 1XR6A 1VRUB 3KLEB 3NF8A 4FJJA 1DTQA 1TKTA 1NJXA 3SQ4A 3NAEA 3ZCMA 5KFJA 5FROA 3ZSOA 3DYAB 3VQ4A 1C0TA 5CYQB 1KLMB 3D0PA 1IKYB 3HHKA 3BQ0A 1N6QB 3PUFA 3CFPA 4Y3CA 1JL1A 4K50A 5KFOA 2D3ZA 3HVTB 4OLBA 3LP1A 3T1AA 3MR2A 4FZZA 2C22A 1N4LA 3KLVA 4LY7A 3ZSWA 4DSIA 4DTUA 1S9FA 4CFDA
chains in the Genus database with same CATH superfamily
2J9DA 3GIMA 2DT9A 3MXIA 4N8NA 2HGNA 2B4UA 2CG4A 2YKNB 4C48A 3VQCA 3VF4A 1DT9A 3HL8A 5DDPC 4DR6J 2SXLA 2YWHA 3AVFA 5JVHL 3IG1B 3W2WA 3FZBA 4CHZA 4CK2A 1SKRA 5MLCV 3M8PB 1LAWA 1DQAA 3MI7X 1LW0A 3LDOA 3PR4A 1LEOA 2QWPA 3NHGA 2KJWA 4FN5A 2HFVA 5IC4B 2JLFA 4M63C 4LF6F 2WONA 4O23A 5D8HB 3TUZC 5HRSA 4PG8A 2O8FB 4M5IA 2DFHA 4NPOA 1FK9B 4C3LA 4X4OA 2VYPA 1FD2A 1V6HA 2HHTA 1WOPA 5EWEA 2VJUA 3GB0A 4QQBA 1T3OA 4WZQA 3O4QA 2X51A 2DIVA 3SDEB 3FBBA 3NY0A 1IBMJ 2VFVA 4M8LA 3BO4A 3KK3A 4K4UA 4NRTA 1S1XA 2OUGA 2GQQA 2YNFB 1RT3A 4RUAA 2BE7D 1N8RT 3TAEA 1TKXA 3TSUA 1O0PA 2HS0A 3CMQA 2HHPA 3UDEA 1NBWA 1XN9A 2F4FA 1X4GA 3BGFA 1TP7A 4AHUA 4QYRA 1BQMB 4L75A 4OHWA 1DAXA 2JOQA 5E0OA 3HM8A 3LOUA 1VHXA 3MN5A 1HMVB 4GKJF 1GMVA 3L7UA 1H2VZ 3QBXA 2CNNB 4H03B 3WQTA 2HMIB 2V0NA 2HFUA 5FDLA 2RMLA 4JI5K 1UFWA 4UOFA 4H5TA 4CJ5A 4C1NK 3G4SS 1NPPA 1UVLA 2W6LA 3OVNA 1F5CA 4QWDA 3UCZP 3R5AA 3CCVN 1ASVA 2E2PA 4FJ7A 4QIFA 3GV7B 4OGCA 1W97L 3BYPA 5F8HA 1LFWA 4Q8FA 2LQBA 3DM2A 4DCHA 2MKSA 4WXWA 2E1CA 2J7WA 3BQ2A 3B8HA 1JQGA 1OO0B 1PILA 3AO3A 3A5OC 3VR1A 4W4MA 4I64A 5E41A 4MIAA 3J7ZT 5CYJA 1GQEA 4Z4EA 2P9SA 4KPYA 4PWDA 4Q8EA 3RAMA 1QQCA 3OL8A 4KAIA 3ZEUB 1NLKL 3IBWA 4OKKA 4ZIVA 1LWCA 3WT0A 3AO1A 3KVGA 1HKAA 1C0UB 1S3XA 5IZHA 4ZPAA 5T7LA 5KFRA 1BC6A 4BC4A 3L7PA 4ZPTR 5CHIA 5CYQA 3RR8A 4TSXA 2JEIA 3GJRB 1G6BA 4ZCMA 4FO0A 3L4QA 2XS7A 3WUHA 1BE4A 3CJ8A 4BVOA 2CPHA 2BQRA 2K7KA 5CQGA 2ZH3A 2MY7A 1KS2A 2AKWB 4LFBK 1YF5L 4LF8J 1XMOK 3X3UA 3WNEA 3O44A 2O8DA 2G1DA 3SAHA 3KHLA 2DR9A 2WW8A 5L1JA 3EWGA 2PMZD 2A2CA 4ED4A 3S8SA 1ATRA 2JWKA 4ATNA 4M3UA 3A3NB 5HK4A 3VF6A 4ECZA 2YWWA 3EICA 4DUZK 3N6LA 4DL2A 3MWTA 5C2DA 5I3QA 3IG1A 1HHSA 4E7KA 3HZEA 3AA9A 2O67A 1N33J 2P9NB 2NSCA 3JAMO 1UFKA 2ZM6K 3AGKA 5GAEP 1KOHA 3MUMP 4FM1A 1H74A 4ZVEA 3I9V9 2ZUGA 4XDCA 1KHVA 2DHAA 3LGMA 5HOOA 4FPAA 2W2NP 1FTCA 2JZ5A 4OZNA 1EKEA 1IBMF 2K8GA 3AO2A 3OLBA 5IC6B 4NI2A 2O8FA 3FEYB 4K8RA 4AE5A 3VETA 5CD4H 3BPDA 2P9UB 5A8KA 1YRXA 4Q2LA 3FUYA 1XNRJ 3D3BJ 2XWYA 3CPEA 2UXBK 5C2FA 4BGBA 2VBXA 5BYQA 4ZITA 2MB0B 1U24A 3QGPA 3DMJB 4QR2A 1OQ3A 3HOSA 1YT3A 2XNRA 3ZLJA 3TEGA 2Y9HA 4I69A 2L48A 4WJBA 4WYWA 3IWNC 2BXJA 1RILA 3M1VB 1HUXA 3BO3A 3J7Z5 4FLXA 2PA3A 1LWEA 1KRPA 2CQBA 1Q8KA 3LQVA 1OH6A 2G1HA 2OPQB 3Q2TC 1N32J 3QJLA 3TX8A 3DRSB 1HHTP 1XTZA 2BJ1A 4FWOA 5EGYA 1RP5A 3PHEA 4ECSA 1T11A 4ZPBA 1HQEA 4X4QA 4GVMA 3VZIA 4OPAA 4FXVA 2HMIA 4TQRA 2Y1JA 2QKKA 3HLUA 5SUHA 3GQCA 2VG6A 2W7PA 3QESA 5LJ5Y 3EX7B 3O1WA 2F5GA 4OX9K 5AZJA 3K7RA 4A2BA 2HIYA 5DZ7A 2DFFA 3FGVA 2FJWA 1IQZA 2QIFA 3FK4A 2ZHAA 2YHWA 4USVA 3H4DA 3KG1A 4H4OB 1KN6A 3CF5Q 2GO9A 5E33A 4K4TA 4FK0A 1VQKN 1NKBA 1HBNB 5DQGA 3UN5A 2QWRA 2Z1IA 4MO5A 4AQYJ 2KLAA 1AUDA 1T0TV 4OGEA 5B0AA 3JYTB 2IOCA 3PKYA 3QPIA 5AQSA 2RQKA 1RZMA 3DHXA 1T9VA 4AL7A 1GOCA 2P9PB 3CJCA 2KHCA 2I38A 4YOVA 1RWWB 1JCGA 3V6DB 4WFXA 2KU7A 1HPZA 2DNHA 3QGGA 2DEJA 2ROGA 1C0UA 3FZHA 4J9UE 4LF8F 2WB4A 3PHTA 3MEDB 2QX0A 5CYMB 3ZZOA 2DYAA 4QIWD 4DHVA 5JXSA 4JOUA 2AD9A 1FKOB 4ECRA 2X74A 2QWOA 1F9EB 4I0WA 1LAVA 3IRWP 4B9QA 4CK3A 2R7RA 4JI1J 4KTQA 1NB2A 5DM6Q 3TARA 1H3DA 2QN6B 2ZNYA 4B9MA 1FRIA 2B7CB 5JLFA 3PIOL 5KT7A 4PXDA 2RF2B 4QYZK 4DV4K 2L3MA 3LDSA 1S6PB 1MU2A 2MSTA 2EKYA 1HI8A 2E1RA 2ROPA 1YVNA 4E7JA 1OYDA 2E2NA 4E7IA 3CD6N 2CJKA 1HRHA 3JQKA 5HATA 3DLEB 1U45A 4C7QA 2P9NA 1QAIA 1J5OA 1S9EB 2DTJA 1J27A 1XNRF 3ZZPA 3LW5C 4ELTA 4ZN1A 3HPOA 3PRDA 4LBPA 3WEEA 3PLAA 2IRYA 4EBEA 3E2EA 3HPHA 1JLFA 1M90O 3KUEA 3GILA 3MMAB 3NMAA 2Z1JA 4I6MB 1X4HA 2RAQA 4CHQA 1KVBA 1IJFB 1H7WA 3FR0A 3KD5E 2BJDA 4LVOP 4F3OA 2KB2A 4UY8T 4OJGA 2CGJA 2P9UA 4C23A 2ABYA 3BPSP 3U1NA 2QMUB 4P7VA 1H0HB 1RHKB 3LM9A 4CK1A 1ILYA 2GVZB 4CDIA 2F40A 1UJ6A 3NCIA 5BJRA 2ILZA 1N32F 5A0YA 1PCAA 4J9QA 5F8MA 5AQOA 3M05A 3DMJA 1V4SA 2F9DA 2JH3A 5TKYA 5ETOA 3TZWA 2QK9A 5J2MB 4RU9A 2V6AA 3M1VA 5KPRA 5AQWA 1OY9A 4WIIA 2MQOA 1HNXK 5KFSA 4BQZA 3MX5A 2OPQA 4FYWB 1VSDA 2YBVA 2KL8A 1HQUA 4BRQA 3DRSA 3C46A 1FRJA 2HNYB 2N7YA 4F4YA 1R27B 4XTTA 1X5PA 1IBKK 4W92B 2QL7B 1IVZA 4PQUA 1WSJA 3I87A 4RNNA 4FVUA 4GV3A 1M0SA 5J1NA 1FX2A 3MAAB 1WKLA 2V2ZA 4X4VA 3SXLA 4DCPB 1KP6A 2NZCA 4KHPJ 2LP4A 1IBLJ 2E4LA 4AQYF 2L41A 4ETXA 3ZSYA 4IG3B 2NZ4A 4AD6A 2YHYA 1J53A 3AD8C 1ZBHA 5IXUA 3AVKA 4CZFA 4EK2A 4H4OA 3ATVA 4KHYA 2WSFC 5FLXY 3WNGA 5KFWA 4CO0A 3C15B 3MURP 5JLHA 1HBNA 3KK1A 3KD1E 4MTPA 2NRTA 4CBWA 1MA9B 1N5YB 2GJIA 3UD5A 1PAEX 1CULB 1OWXA 3VGSA 3V9UA 4PWUA 1BI4B 3G6EN 1RTDB 1Q86O 2VU5A 3CJ2A 2QWLA 1S1WA 4KKOA 1NPKA 2BRLA 3V1OA 4WU2A 2P9PA 4S0MA 4JV5J 2F8HA 1VSEA 3MCPA 3V6DA 2XY6A 2Z30B 3DRXA 1H38A 2AP1A 4JI1F 1RDBA 1NSAA 4FPBA 5C5JA 2K7JA 2DB1A 4TVAB 1NM1A 3BSOA 4K4ZA 4NCBA 3VA0A 3PW0A 3CM5A 1S9GB 4OI1A 1NB7A 1GTHA 3LDNA 2B5JB 3MTJA 4EMDA 2GTDA 1SCJB 2KYZA 2YH0A 4BCAA 2UUWA 2R42A 1HYVA 2XNQA 4A8SA 2QEXN 3BR8A 2DEIA 4PL7A 1N5QA 4UY85 1NMEB 2DO4A 3M8ZA 4K2JA 3BB5A 4OZ5A 1C4CA 4RLEA 3K89A 5KG0A 4FF1A 1HNIB 3MM8B 2MKKA 1FJGJ 1AZSB 4YMEA 2GAHC 5E26A 2Z2LA 1SH0A 4Y1DA 1EHWA 4YP3A 1NGEA 1T8EA 4OFZA 5EU7A 3L0QA 2DK2A 1CXQA 4PY5A 1RAAB 3M8YA 2XZTB 3DLEA 4NLTA 2L08A 2RHQB 1S9EA 2DGXA 5CABA 1MW7A 2HMPA 2B9EA 2Q1LA 4KH5A 1T3NA 2BEFA 4RZRA 3VAMA 1XEZA 4C8YA 2F9JA 5SZTA 3PO5A 3OV7A 4X62J 4WFAQ 3QFHA 3QBCA 3ETMA 4J5OA 3CCMS 2HS3A 3DLRA 2GVZA 3A5NC 3PCOB 3RAQA 1T94A 1T44A 4JV0A 1QY7A 3MDQA 2HS4A 1DQ8A 2LYVA 3UVJA 4CP5A 1F0XA 1FX4A 1ASUA 2I5JB 1UCNA 2R9LA 3LPEA 2VWKA 1RAGB 2D69A 3BKTA 3VQTA 3CQ8A 1DRZA 4DV0J 3JB9k 3VQSA 4ED7A 1RWVB 2JFKA 3UD4P 4G9ZA 5CZ2A 2MGZA 1RBLA 4KYZA 3DN9A 2MQMA 4J91A 1NK9A 2BR0A 3WNHA 1EARA 4H0YB 1CLFA 1P90A 1WOQA 4KHPF 1IBLF 3NCPA 1H73A 5IWAJ 2ZOGA 2HNYA 4F2RA 3AFGA 3M9MB 1JNRB 3T69A 1F2HA 3EGWB 1C2PA 2ASMA 4H5RA 2LXFA 1HWUA 3DXMB 3MAAA 1ICEB 2EK1A 3SSQA 1R6YA 5HRNA 5K5MA 4TN2A 2M52A 3CFRA 4P2FA 3VVUA 4IYQA 3CCLN 1K8KB 3CFOA 1YK9A 2UUCJ 1U1PA 4C4WA 4ZVUB 1U04A 2DR6A 1HQ2A 1WC5A 2M70A 4IUFA 1URNA 3BN4A 3SSRA 3AT1B 4OX8A 2HVEA 3H2LA 1RAOA 2G0IA 4C1NI 4HDHA 1GX6A 5FIIA 4JV5F 1GLBG 3DOKA 3ENVA 4CJEA 2QL9B 3OR2B 1N5YA 2B56A 2O8BA 1CULA 2OTLS 2C42A 5EX3A 1VQ5S 3I55S 1CC7A 2AIRB 2MKCA 2GHPA 3T6JA 3AO5A 1RWUA 4K5SA 5K8PA 3CIMA 3K59A 5JVGQ 4AXIA 1RBUA 3PV8A 3OL9A 3I56N 1S5ZA 5GAEI 1HLUA 2VQEJ 1G15A 4DFJA 4B3TJ 5A2QU 1HNWK 1LOUA 3SI8A 1N88A 1FJGF 3MXJA 1TL5A 2MPUA 4FWMA 2W4PA 1WC4A 3BREA 2B5JA 3UKUB 4NA1A 2QE5A 4N76A 3N6NA 4EAHD 3OFGA 3GCWP 3M8QB 2JVRA 2YNGA 1IXKA 1Q5YA 2KO1A 3U7JA 3VQDA 3D1OA 1AZSA 3TAGA 3QZ7A 1U2VB 2FSKA 2A40A 2UV8A 5AXMA 3PJXA 4ZTFA 2P5OA 2JRSA 4X62F 3I0SA 4M5DB 2QLFB 2QA4S 4OV1A 4I9QA 3JAMY 1WF0A 2XI2A 1YRUA 3HVWA 5G4DA 3L8BA 1NPRA 4MYTA 4FW2A 3TVYA 3OVAA 2QLXA 5DMRA 1Q18A 4BG9A 1J9AA 4B9UA 2IC3B 2BJ9A 1A5VA 4AHVA 2V2VA 1WLJA 5AQUA 4DV0F 2CPZA 3SBMA 1UA1A 1J2VA 4U7UK 3BF4A 1CLQA 3Q7CA 1IG8A 3O1LA 2GA7A 1XHZA 4KBOA 4KH0B 5KT6A 4USIA 3M32A 2UVUA 3ZSRA 3ZZZA 1QAJA 5IWAF 1UWBB 3SMPA 2C2RA 1HW9A 3J81O 4L72B 1JXEA 2LDIA 4JI8J 3TUJC 2ACMA 3QT7A 1WI6A 4P2MA 1C4AA 4DWIA 2FLNA 2EG1A 3ENQA 4CIOA 4PKDB 3BGLA 4M1KA 4OJHA 3J80U 2EG2A 4JI4K 2P6SA 4DPUA 1HL6A 4OLOA 3OTOJ 3W0LA 1RGVA 5ITHA 1JJHA 2UUCF 4CT9A 2W6KA 3DXSX 2VOPA 2H5IB 3QSYB 3KLFB 2YX4A 2YY3A 4Q0BB 5E7OB 4QR1A 3T9ZA 2NRRA 3RU0A 1ZM2A 1CJVB 2AMCB 3SJJA 5IT9U 3ZZTA 4BWJA 4J37A 3KKRA 4L73A 3BSNA 3H8YA 3KDOA 4GW6A 1SL0A 1UTAA 1NLVA 5DG9A 4DL5A 1NOZA 3KHYA 2NRHA 4F4ZA 4EHTA 2BGGA 2IPOB 1SJFA 2GMHA 2VQEF 4B3TF 1VBZA 4DOZA 4USWA 1XNQJ 1UEKA 3BDEA 3VQ6A 1TVRA 1WF2A 3W62A 1KQSR 5DETA 2FYXA 2FHJA 4A47A 4FJ5A 1QTNB 3EE3A 1UVJA 1YBTA 4A59A 2YKMB 4PG7A 5LMNK 2NXJA 3HZGA 2E2QA 4H5WA 4CF9A 3HKWA 4BR0A 5DLGA 1GMWD 5DM7Q 1P27B 3S3OA 5KFFA 2KH9A 3MEKA 3LDLA 4KQZA 2AU0A 1I3AA 2F1FA 4RNMA 1CVJA 3M8QA 4AHRA 1KOOA 4A8MP 2DNLA 2V51B 3FLCO 1KNZA 4DV5J 3MECB 1FNXH 4JEPA 1E3MA 1S6UA 2UXDK 3VAGA 3ZETB 4I7FA 5ETMA 4FCYA 3TAQA 3OYNA 1YBUA 2MQPA 2LXUA 4M5DA 5JJBA 1JLEA 2R3VA 2Z2MA 3NRBA 2KJVA 1PYSB 3C6TB 4DPOA 2E6MA 1HA1A 2J5AA 1FA0A 1K47A 3M7VA 3M8RA 1K73O 1KAYA 2W42A 3J81j 4C8LA 2XMAA 3C6AA 2C28A 1KVCA 4P7TA 5HMWA 1UEUA 2HK3A 2VIHA 1MROB 2IC3A 4HKQA 3KJVA 4F25A 1SPBP 4CJTA 1CJUA 2GVDA 4P9SA 2NPFA 1C6VA 4CO1A 4PXEA 3HHNB 4JI8F 4NLCA 3CMAN 2YXLA 2X1AA 1W2BM 2HBYB 4ZVFA 4FPRA 2YNHB 2HWHA 4PUOB 3BF1A 4ECTA 4KFBB 3A3PB 4H0PA 5AZIA 5TKWA 3W8GA 2DXEA 2LEAA 4LR8A 1RT6A 4HUFA 5ETNA 1RAIB 2NSBA 4NXNK 3OTOF 5HJYA 4FXDA 1RACB 4JKEA 4L3NA 4Q45A 1UWBA 3N4WA 3GJSB 1X31C 2HPUA 1VQ4S 5AQKA 3ZZUA 3IGVA 2FZKB 3R7SB 3R5DA 5FD1A 4LUBA 5C24A 1UW9A 1BWVA 2Z56B 3ZTQA 1CZAN 4GV6A 4DR5K 4AM6A 1R7IA 2ACYA 1YJRA 5DJBA 4FLYA 1TV6B 1HARA 2UXCK 2R4FA 3ENOA 5JMVA 1YITN 1IR0A 3HP9A 5LOQA 1VQPN 4CJWA 3U27A 2YWFA 2W24A 3OR1B 1MWKA 4FYXB 3AVAA 1U1LA 3H3NO 3THXB 4DL3A 4DV3J 3O9SA 3ZYYX 1CJVA 4XPEA 2OIHA 5AQGA 1Q7LB 2AEJA 4JYAK 2O1PA 4A2AA 1U47A 2GO8A 4J9MA 2P9KB 3CJ1A 3AA3A 1XNQF 1SKSA 4ED1A 5B8HA 5J1PA 3CULA 3GMGA 3QWUA 2ERRA 1N56A 2IM1A 3DRPA 1FHTA 3PFEA 3OXFA 4C11B 3I96A 1JLAB 3FQLA 1B0TA 3UDCA 2YWKA 2CQPA 4V19X 4WZMA 2BJ8A 1RBOB 3W7BA 2MY8A 4FKXA 2A1BA 4B3MK 3TWHA 1QE1B 3GFZA 4J8FA 1VSHA 4WKRA 1BA1A 4GC6A 3KMSA 4ETZA 2JDJA 2B51A 3OYGA 3MN6A 3JQMA 2VG5B 4N77A 4WK3A 5L1KA 5F0XA 4FLUA 2CZ4A 2VWBA 4AUKA 1NGDA 3Q7BA 4AHTA 1HNZK 2NXNA 4CF1A 2FJEB 2YKMA 3M2RB 1EXQA 2P5GA 4ED2A 2IBKA 1IM6A 5GINA 2HHHF 4X4SA 4JAXA 3AAPA 4DV5F 4CM0A 4J2DA 4FWLA 1KQGB 3HVRA 1ZBFA 1OPZA 1UETA 2LKZA 3HSDA 1WTBA 5FPMA 1LFPA 1IV0A 5KFLA 4ED6A 3MCNA 1KD1O 1HX1A 2ZH1A 1DKGD 4GVBB 4KGMA 5CR4A 1PC4A 4WKYA 4IO1A 3V6KA 3MWPA 3OYJA 2YKAA 2DRAA 4M5KA 3ZETA 3OSNA 2J0SD 1VQKS 3AHPA 2GBZA 3HSTB 1X4DA 2RHKA 3HOTA 2J0WA 4U9RA 1ZETA 4AHCA 2AX1A 1FXRA 3EGZA 1VQ8N 4CEQA 1K44A 4J7CA 3RZAA 1SL1A 8ATCB 1S76D 4MKYA 2E5LK 4C8KA 2BTFA 3A13A 3GE9A 3O5BA 3SUQA 1P8ZA 1HFEL 1NXIA 2O8EB 2E5GA 1NSQA 2AP6A 4J9OA 2YNHA 4IEEA 4PUOA 3L4IA 2ZD1B 1UPMB 4KFBA 4JI3K 4M3WA 3BV8A 1QM9A 1TK8A 2HBKA 4OYAA 3DLLQ 2PSZA 4CO5A 3RBXA 2ATQA 1X9WA 2ZWPA 4YY3K 1NGGA 2ZWOA 4OI0A 1OH7A 1KR4A 2GFFA 4MH8A 5AQRA 5EWGA 4JI6J 5JUMA 4JKAA 5IM0B 1RTHB 2BDPA 2WVBA 5F8JA 2ASJA 3CD6S 4NEZA 1CC8A 2O8CB 2ATLA 4CEFA 3OYBA 5EDWA 4MKVA 5D3GB 3O4NA 3R5BA 1ZTTA 4FVCA 1TV6A 1U8WA 3OFHA 3S9HA 4RNHA 3ISZA 2QV6A 4DQQA 4H4MB 2HG4A 2PA8D 1X5TA 4DEZA 3OR1A 2B3TB 4PHTX 3GFXA 3THXA 3TA0A 2NRVA 3MM7B 4C8NA 1N54B 5GADU 3CJRA 1Q4RA 4K4YA 3N5FA 1RHRB 5LMUJ 1EQYA 3D2FB 4QPXA 3H5YA 4DR2K 3AA5X 4HT7A 2XYHB 4O5FA 4OLAA 5J2QB 1YQHA 4KR0B 4LFAK 2P9GA 5BN9A 3H2VE 1TQLA 3U02A 1E6VB 3H59A 2ZWHA 1BQXA 2VPWB 4CLUA 2CNLB 3DC2A 4CGDA 1F9HA 3ULEB 1WB9A 2ZF5O 1XJWB 1EETA 3CJKA 2EVZA 3R6MA 5ELZA 4CGGA 3DHWC 3MM6A 3BUZB 4O0JA 3NF9A 2VG5A 1YVUA 4BREA 3BZKA 2E9TA 2CQHA 4JN4A 1E6YB 5BREA 3M2RA 2FDNA 2DGTA 3NF8A 4CNYA 1DTQA 1NJXA 3SQ4A 3NNHA 2Y8WA 2HLUA 4U8YA 3EL2A 5KFJA 5AJ3K 2FZGB 2CQ0A 2NLXA 2LMIA 1KLMB 4DL0C 1NMDA 1N6QB 2FUG9 1QQNA 2D3ZA 5AQPA 1F5BA 1N4LA 3KLVA 1VI7A 5CA5A 3HFVA 3QT6A 3ZSWA 5LJVA 1XMQJ 2ASPA 1JNZB 2D7SA 4DSKA 4DFKA 1FWPA 5C12A 3K5LA 3CM6A 4K59A 1Y10A 4ECWA 1YTAA 4NX9A 1OYEA 5ETVA 4V19J 4DTMA 1QUPA 3NNAA 1HI1A 2W41A 2H1YA 3L4BC 4DF4A 2DO0A 2JVOA 4H5NA 3MK6A 1Y3JA 3F44A 2VFRA 1Q86T 4CGHA 2ZZNA 1U1MA 1VLYA 4DQRA 2D3O1 3RB6A 2AHOB 1V5IB 4IXCA 3R97A 4CBXA 2XMKA 2HKEA 5GAHP 4KHWA 3ITHB 3FZLA 2MHEA 4JI6F 4FJ8A 3MPDA 4DTOA 3TJ9A 3MM9A 1N36K 3FFIA 2Q43A 4X65J 3PW5A 4A46A 5IS2A 3SUPA 4E2FB 4FWKA 1B92A 3SPYA 4LF7K 1HHQA 4JKHA 4QS8A 1TUGB 4Q43A 1BCOA 2MQ8A 3K0JA 4BC3A 4LFCK 3QNNA 4BRIA 3H25A 5IM0A 3PYEA 4CWBA 2HVHA 3C19A 2AT1B 3TANA 3DAWA 5GMKa 4K0KK 2MZQA 4BHQA 3OUYB 2OSQA 4B1WB 1JJ4A 3CCSS 2IJNA 5D3GA 2CNOB 2UUAK 2LFVA 3OHAA 2CVEA 3L2QA 2HGLA 2VV5A 4LJMA 5LMUF 3MN7A 3H42A 5J1EB 1LQ9A 1YTUA 2R7QA 4EZ6A 3S7RA 2ZJQQ 3ILOA 2GMLA 1DTTB 4OYWA 2W25A 2F4VJ 3QNOA 3MM7A 5E84A 2OD4A 2W40A 1Q7YO 3M6VA 3SAGA 3V9ZA 2QC3A 4EGLA 2DGVA 5KFNA 1FF2A 1FXXA 1DHMA 2R7SA 3D2FA 1ITGA 3WXJA 2LDYA 4CJLA 3D66A 5J2QA 2OO4A 2KHOA 3O5TB 4CZGA 1X4AA 1MN7A 1CZBA 3D6FB 1RT4B 1IKXB 1KCFA 1OY6A 2H3GX 2EFNA 4DU4A 1OQ6A 1T3VA 2R2TA 1HR0J 2E2OA 4F0HA 2F9WA 1SC3B 4QU7A 4GC7A 1WI8A 4HT5A 3OHRA 4DL6A 2C3MA 5B0FA 4X64K 3OYEA 2OFHX 2V4JB 3PKMA 3RVCA 4CEBA 4NOHA 3W63A 1HYZA 3NBPB 2PO4A 2XB2D 3SMSA 4QWEA 2F8EX 5C25B 1NHUA 2YQ0A 2DKOB 2KG0A 4IO9Q 3KKFA 3VVTA 2D0AA 1IWGA 3RMDA 2GMJA 2ZH5A 2AYGA 3VTIA 4Y2IA 1YIJN 2HBZB 4B3SK 1XMQF 4GKJK 1MMNA 2M3DA 3CF5L 3Q8PB 3QIPB 4B9NA 4FJXA 1N6QA 3GIKA 5HN0A 3KK7A 1K9MO 4B02A 1SH2A 4NLWA 4B9LA 3CCLS 4OKJA 4L6V3 2J0QD 3GBTA 4MK8A 1EZZB 2XLIA 1VJQA 3F5TA 4C9DA 2HRUA 1RGIA 1U0HB 3UNGC 4B3OB 1S4EA 3L3VA 2V7YA 1WDTA 3K0SA 4BACA 3OJUA 3ENAA 3HHLB 1WDDA 2AWZA 4GVLA 2CPYA 3TVKA 4NL5A 4DU7A 2M8DB 5KPTA 3K2PA 1SQKA 3WXIA 4BVPA 4X65F 4DV1J 4OHVA 1FEEA 1NGFA 4FJNA 5B0EA 2QWMA 1Q9XA 2HB5A 3BYRA 2XWXA 1W7AA 1PG5B 3I56S 3FRYA 3CB4A 2OEJA 4JK7A 3NF6A 1FJEB 1JLBB 4L8RB 2E20A 2YQ3A 3SUOA 5AT1B 5DM6L 4BRHA 3NGZA 2FHKA 1JKHA 3ITHA 5IV4A 1YHQN 1H1VA 1UVKA 2HHQA 1OVQA 4DFPA 3P5TL 4OJ1A 2RB7A 4ID1A 4RTFD 4DR6K 3PTWA 1ZZNA 3ZTSA 1SI9A 1Q8BA 3FZFA 3CCJS 1PJ7A 3CCQN 2ZH7A 1S99A 2W2PP 4PKHA 1ZPVA 4OI6A 3TAPA 2MQLA 4C98A 3FEXB 2FVRA 3OYAA 2F7TA 3OW2M 2F4VF 4E3SA 4GVEA 4O3NA 5D4LA 2VFUA 2NZTA 3HBTA 1OSCA 4U7UD 4NA2A 1HBUA 1Y64A 3WX4A 1ACMB 1LNQA 1NDCA 1HYSB 2HQDA 4PKIA 2YPZA 4DI6A 5J1EA 1SC1B 4MYUA 1VMBA 4NZ7A 3ULDA 1S6OA 3M2UB 3AVIA 5FRMA 3P3DA 1TR0A 1VQOS 2LQJA 4JD2B 2OPRA 3E8OA 3FGUA 3VQEA 4IFVA 2W9BB 3UE5A 5F3ZA 4EZ9A 1S12A 1PJ5A 4DX6A 5KT2A 1GFWB 4ZIWA 1P1LA 1RTJA 1QSYA 4Z37A 4HH0A 4W5QA 4OL8A 3NMUA 1LK5A 2JC1A 4DKWA 4N41A 1S97A 3OT9A 3H08A 4FJ9A 3VQBA 2DNRA 1NZAA 2U2FA 4RPFA 4LF4J 1RT4A 3A5MC 1IKXA 4FBTA 3GIRA 1REVA 3NOCA 4PKGA 4O5BA 3MWBA 1RYSA 3IM8A 4ZPCA 3X1LB 3HP6A 1NK8A 4PXBA 1YI2S 3HSJA 4U8VA 3AV9A 4IKFA 4RKUC 1KVAA 3NBPA 3NE6A 2FSNA 4KJIA 3B78A 2Q31A 3R5CA 3IWLA 3THVA 1C1CB 3PFOA 4KRFA 2EXUA 4OZLA 5CZVA 1NGJA 4M3RA 4WF9Q 4KBIA 5ETRA 2CNKB 3VQQA 4CFAA 5J2PB 2IVOA 2VOOA 1VQ7N 2J76E 2YHAA 1WSVA 2NYHA 5ETTA 1TUWA 1K8AT 4C3KA 3GR0A 5K14A 3C16A 3VEYA 4JI7J 1YLXA 3ENHA 1IG9A 3CWJA 1WUAA 3HF5A 2DNNA 4KGVB 2RS2A 3DOLA 1RTIB 3VENA 4DV1F 1NAQA 5HROB 1VSFA 4B3OA 4L3KA 1Y3KA 2VJVA 3RR7A 1U1RA 4WQ5A 3CPWR 4WTYA 5EX0A 3EVWA 2XHBA 3T5KA 1SKWA 4YHHJ 2WVFA 3ET6A 2K1RB 4FZVA 2ZBIA 3HHLA 5AQFA 2OTJS 1RAEB 3U4LA 1NSKL 4LFBJ 2DBBA 3SV4A 1EIYB 1XMOJ 3DLBA 5BR8J 2CDQA 2ZOMA 1R6VA 2QGFB 3F0NA 3ILJA 3D0HE 2XMWA 4YFUA 2CA9A 3SSSA 5HLFA 1X5OA 3H3OB 3V1RA 4LF8K 1BHNA 2CQGA 3G9CA 2DGQA 4YOUA 1P6TA 2ZM6J 4K4SA 4AL6A 1FDBA 5KFMA 1DJ0A 3DU5A 1BQNA 2QLWA 2QTWA 1IKVB 5DLFA 3TJAA 5C42B 2YTCA 5RUBA 3I0RA 1S22A 4E7LA 3EGVA 1Q82T 5FPNA 3UFCX 4USTA 3CI5A 1KQFB 2ALZA 1N33K 1G2EA 3KNAA 2IRXA 2R7XA 2OKQA 1NKEA 2JL9A 2ZBQA 5F8NA 4BC7A 3BH7B 3LA0A 2QT7A 1XERA 3NH0A 2OD6A 2UXBJ 4ES1A 4NCAA 2I7NA 5BPNA 2HNDB 1F9FA 4ECVA 1TKZA 4WFAL 4YN3B 4E89A 4OHXA 2YVSA 4J9RA 2GIQA 4NE9C 1X4EA 3WIVA 3M2UA 4OPKA 3CEDA 5L8RC 4ILHA 1A7GE 5F8LA 4BR9A 2GAGC 4LF4F 1XK8A 3GLJA 3OTCA 1K73T 2AQ4A 1DARA 1IR1A 2RRBA 2GV1A 4YS2A 3C14A 2DITA 3Q8QB 4UQGA 2KXNB 2BQUA 3TA2A 2BOPA 1JWWA 4LF5J 4CCHA 3HD2A 5E3AA 1P9QC 2H5EA 5CCMA 2NS1B 1RI7A 1F5AA 3DKDA 2AJ0A 4DPXA 1ELOA 1RT7B 3G25A 1N32K 2E9RX 3OYCA 3RB3A 2ATCB 1VC6A 3VERA 1R8BA 4JV2A 4USHA 4Z2XA 3CCZA 4OX9J 3MAQA 2BM1A 4H4KA 2MLZA 5KG7A 4CT8A 4W5TA 1ZAWA 3MN9A 1G99A 1S1VB 2DNKA 4DUYK 3IAS9 4X4PA 3WDOA 1FTRA 4DCJB 3QICA 3QERA 2P8IA 2K06A 1JLCB 2ZJPQ 2KHDA 5G0RB 3H20A 5KGWA 2UVVA 1C1BB 4IFEA 3D9BA 2RQMA 4YDDB 3T1YK 4TNOA 4RUHA 5HQMA 1XR7A 2QWQA 3IFRA 3KLIB 1U2RA 3GPAA 1D0EA 1N34K 4CBUA 3WIUA 2VONA 2E66A 2PEBA 4WFBQ 4XIUA 3QJPA 4ZP8A 1A6LA 4ZCLA 3H7HB 5J2PA 2ZGZA 4IR9A 3PM9A 2QYGA 4YHHF 4DX5A 1AA1B 5L38A 5GAHI 1E4FT 4NZ6A 3CPWM 4GY2B 4BG8A 1IN0A 4LFBF 3WZ0A 3QAUA 4YOWA 1XMOF 5D0RA 5CY4A 2QLJB 1RTIA 3EZUA 3SQOP 5BR8F 2GJ2A 3QIDA 4DF8A 1NNDA 4QCLA 5JVGL 1X4FA 1O5JA 2FHMA 1JL2A 2CJQA 4DUZF 3NLCA 2XO7A 3U1MA 5LT5A 1V4TA 4CZHA 4W5NA 1ZM3A 4TLRA 2ZM6F 4KHSA 4CO2A 4DBQA 4ZJOA 3VEWA 4DTPA 1S77D 4FSVA 3NGKA 2EHGA 4FF4A 3EDQB 1D1UA 2I0XA 2ZE2B 3QFWA 3WC2A 4DV4J 4EBDA 4CQ1A 4KB7A 1UMJA 3DYAA 2KW4A 3BN7A 3V2UC 1H7XA 3TZYA 1F3VA 2V9WA 1JLQB 5E5NA 3IGNA 3QATA 5D78A 3N4PA 3MEEB 5GMEA 1IKVA 2UXBF 2E1MC 3PEJA 5C42A 1KHWA 4PXCA 2ZZTA 1N5TA 4A8KA 1TMJA 3CJQA 1XQIA 4IRKA 4ITSA 2QMWA 1KD1T 3LDQA 4CF2A 2EX3A 4JK8A 4M5MA 1U1NA 3CC7S 1WHXA 2WK4A 1YVFA 1D8YA 1ZOTA 3ZX3A 2HNDA 1FE4A 3VCDA 4OYXA 5A2QY 3U9ZA 2ILYA 3GZ7A 3MD1A 1AYEA 4NLXA 2Q2RA 2QLBB 3V5RA 5HBMB 5D4OA 4DR1J 2IVFB 5KG6A 3GU0A 1VQ8S 2GQ2A 5CAAA 3OS0A 1KQKA 4DV6J 4ES3A 3R8YA 2YHXA 5M2UA 1QDUB 5I9EB 4M5GA 2D0PA 3I33A 2C3PA 2OZSA 5AQZA 4LBHA 4WE1A 1HNXJ 4BRAA 1PYOB 2FC9A 4OX9F 4C0HA 3OYMA 4EWTA 4OQJA 1RNHA 4KH1B 4ERDA 3UDLA 1ZM9A 1NGCA 3OS1A 5KFTA 3P96A 3LALA 1AFIA 3CC2N 1VAZA 2XHCA 2KQ2A 2VQFJ 2E1AA 3K9JA 2OPSA 3VGVA 4J2AA 1RT7A 3CJ0A 3LP1B 1O1WA 1R8CA 1X4BA 1YJ7A 1T9TA 4PEOA 4CJ3A 2X1FA 4JKCA 5ETLA 4KTWA 2MSSA 2B8PA 1ZC6A 2XY8A 3MOZA 1Q8IA 4QS9A 1M5SA 3KJFB 2QXFA 3PIPQ 4FWPA 4ELVA 3HI0A 4CJUA 4Y34A 1C1BA 3BSAA 2E29A 4YB7A 3W2WB 1XR5A 3MCOA 3AY9A 2JEJA 2G8HA 3VALA 2NXUA 2P9IB 1LW0B 4XH5A 3DDNA 2CJ9A 4CVNE 1VQMN 1QQMA 3J7A1 1VCTA 2OI2A 2OPPA 1FXDA 2WONB 3TA1A 4IDKA 4ANDA 5BXIA 3P39A 4GRSA 3LPTA 2H48B 2DD8S 3UKRA 1B3TA 1GXLA 5KFVA 3NCRA 5GAGU 1CPZA 3D1QA 4DMZA 1UZHA 5M1PA 2WRMA 1H98A 4RW6A 5F3TA 1Y97A 4DV4F 3PZPA 1Q5VA 4DN9A 3CCRS 2E44A 2H4YB 3MDFA 4EFHA 4I6YA 3FBEA 1B0PA 3KHGA 4DS5A 4FLVA 4RBTA 2DJWA 5EUHA 1QSSA 2NLWA 1S1XB 3PW7A 2R2RA 5DM7L 1RT3B 2NXEA 1TKXB 4WP3A 4AHSA 4ISGA 5IT9Y 4LF9J 4F04B 4CO4A 2GELA 3M1FA 5DS7A 1HLWA 1BIZA 1RYRA 4MMOA 1T03B 1NSPA 1RWMB 2V4QA 3ZTPA 3ZT1A 2WUSA 4IQMA 4B3RK 2GV9A 2EEYA 4NMXA 4RWXA 1VK0A 2C3UA 1YG0A 1LW2A 4OHYA 3GTYX 4CZMA 1EB0A 2ZJRQ 4CH1A 1UL3A 3TR5A 2IYGA 3E9LA 1KVJA 3W64A 1RCHA 4GMKA 5ADXA 2XYGB 3G0ZA 4IRCA 4JKGA 6FDRA 5KFQA 4DR1F 1W26A 3Q8VA 3P83D 2PT0A 5CXTA 4O0IA 4DV6F 3NDKA 1WEYA 3SZ2A 3SK3A 5F1XA 3J7YP 3FFKB 1X0PA 3PO4A 2H9ZA 3W1YC 1RFQA 1HNXF 4CM2A 4RW4A 2M2BA 3CJSA 5D77A 4O4RA 1FNOA 3E3XA 5KFKA 1ZBUA 5HBMA 1N5VA 1IBKF 5F8GA 1F6TA 4WFNQ 3DRYA 1I94J 3OFEA 4RNOA 2AA4A 3KHRA 2CQ2A 3FSIA 3O6QA 3C6UA 4DU3A 1S1UB 1LWCB 1D9FA 3G6VA 4FJMA 3CD7A 4NLBA 1ZAXA 3B4DA 5GIOA 3HTVA 3OTDA 2VDIA 4DV0K 2PE8A 4OI4A 3SJHA 4JUZA 4PABA 5HSPA 5F9NA 4LMZA 3LPUA 3I4PA 3RAXA 4QS7A 2OFGX 1SJ4P 2ITGA 5KAKA 3TI0A 2JNJA 4PPDA 4WQ4C 2VWJA 3RBDA 3V9SA 4UUWA 2QMXA 4FVMA 3TZXA 1RADB 2KN4A 1YBAA 1VS3A 2OHDA 3I9ZA 2X7IA 4DUTA 1BUXA 2UUCK 3VGUA 3UI3A 4F50A 2HRYA 1WBDA 4EI2A 1S5JA 5IT0A 3ALYA 2P9IA 4ID5A 2ZH4A 1UVNA 4CJKA 3E01B 1SL2A 4N5SA 4R5PB 1M1KO 4Y0FA 4WIQA 1RJJA 4H5VA 1A5XA 2KG1A 1FD8A 3Q8SB 4WFYA 1ZBSA 2ZH2A 4MK9A 3ZNUA 1WC3A 3AD7C 4NI2B 3UQSA 4DR3K 1Y5IB 4H54A 2IVMA 3OBWA 4IH6A 2VPZB 5A8KB 5AQXA 1Q7YT 2HHUA 1CEZA 3HULA 1NHKL 4LF9F 2WZ1A 3NEKA 4BRFA 1OMSA 3GYNA 1VQLS 5ETSA 5BYRA 1RBRA 1HBOA 4B3TK 3BP8A 3CDUA 1TTHB 3EJMA 4ZVQB 4OPHA 1T9YA 2BANB 4J9SA 1FDNA 4NO7A 3TSQA 1JJ2M 4QWBA 3QT5A 2KM8C 4JKFA 2EFQA 1LWEB 3ZZ0A 1S0OA 4NLRA 1T03A 4NZ0A 2XMTA 2PMHA 4JI2K 4CGIA 3MMJA 3CCUS 3D67A 1HQEB 3A2FA 1TFWA 5C0YA 2BQ3A 5B0DA 1C0GA 4DSFA 2FBTA 5KTQA 3F56A 1CBKA 4IG0A 2VG6B 3EZOA 3G86A 1YJNS 1NO8A 5KQ8A 4JKDA 2P9CA 4OI2A 2CADA 3U6FA 1RT5B 5AZJB 3OA9A 3VAFA 2KTQA 5AE2A 2Y1RI 4FPIA 4F4AA 5D4PA 2Z2YB 1NKCA 2R8KA 4E7HA 3EYZA 1K9MT 3FJ2A 1I94F 3KUGA 3DLGB 1JX4A 4TU7A 3ICLA 5KRTA 2RIJA 3ZT3A 5HQLA 2CH5A 3Q8YA 1Z2LA 5FLXU 1NRKA 3CNQP 2YV0X 1YJWN 3IBCB 1GLAG 1VFJA 4ZVTB 2CG8A 3CUNA 4BC9A 3ZT0A 1OH5A 1VQNN 3QEXA 2HFNA 2CQ1A 1IH7A 3VZHA 2CPEA 4CLZA 3DLKB 4AILC 3DLLL 4ZVOB 1AXQA 4N47A 2R7WA 4JI4J 3EXYA 1S1UA 1S4FA 4BE1A 4FKYA 3WHIA 2IDOA 1HPZB 3G4SN 4FP9A 5AXLA 4JI8K 4PCQA 4AM7A 2DIUA 4OV6A 2V50A 4ED3A 1YHQS 3IS9A 1BGXT 3MD3A 1WN7A 4M63A 1Q0NA 3MFIA 1TFYA 3EPGA 2CPXA 1WAFA 1RCOB 3EN9A 2B4OA 3A4TA 1UKUA 4EYIB 4E0DA 3FCHA 3TTFA 1QZ5A 1GXTA 2W2MP 3OXGA 5LXRA 2ZZMA 1SC4B 4J90A 5HMYA 1WHYA 2KDOA 5DDRC 3VQ8A 4F0KA 1S10A 3CCEN 3L95X 4LH5A 1MU2B 3F9MA 1DGKN 4F2SA 2XSJA 4CJVA 3VTHA 3HCXA 3QMLA 4ZHRB 1X8DA 2UU9K 3K5OA 1J5OB 3KLGA 3CMEN 4Y00A 2CGKA 1NK6A 3TYTA 2HHXA 1TKTB 3E01A 5KG4A 4R5PA 3WEEB 4RWWA 2CZ9A 2HOEA 1JLFB 1JLGA 2DCUB 2HHSA 3MF5A 3MXHP 4DPTA 1JIHA 1BO5O 3FKBA 4NA3A 1XNQK 3ZX2A 3GR1A 2V8PA 5LMNJ 1TKDA 3AJ1A 2DTUA 1T9XA 1IJEB 3UDVA 3QINA 1BWEA 2X1GA 3NWGA 2AYEA 2AGPA 4XH1A 2XS5A 4CJRA 1RISA 1PBUA 3EY1A 2WAQD 3PDNA 4PG6A 4F67A 5A0YB 3FRZA 2GWJA 2DY9A 2RQ4A 2XMUA 4NYZA 2HWTA 2ASLA 1WC1A 2BANA 2CJBA 2EFOA 3V6HA 3HSZA 5BRHA 4J2BA 2RU9A 3RUBL 4CJ7A 3NGDA 1NEEA 5E3QA 2NR0A 2IDLA 3IO1A 3GP9A 3I6PA 4N7TA 3TP2A 1HIYA 3VQPA 1JK9B 4Y2AA 4DG1A 2EBEA 1BOTO 1BHLA 1VIOA 1RXOB 3ID8A 1VQ9S 1NUEA 1HQUB 1NJIO 1RT2B 1TL1A 2KKZA 3CC4S 1FRLA 3D6TB 5DGBA 4PQUB 2QM1A 1VQ7S 2IM0A 4FLZA 1YTYA 1NJWA 2DNMA 2BV3A 1RT5A 1KTQA 3NAHA 1GXUA 4ZVRB 2NRWA 2BVZA 2ZVIA 2G8UA 4Z0UA 5E3PA 2RQCA 3IWXA 4ZVSB 3E1YA 4B17A 4NLSA 5D0EA 4YOEA 3AOAA 1L3KA 2GC8A 3DLGA 1U26A 5IT4A 2HF3A 3P4UB 4QW8A 4JI4F 5B08A 3KK1B 1U1QA 4NXNJ 5HVHA 1ZA2B 3FQKA 3MHYA 2M5YA 3PYFA 4X2BA 2WW4A 4TU8A 1GX5A 3BY5A 3BO2A 1YKWA 3ZNJ1 3GG0A 3RMBA 2IHR1 4X4NA 3EKUA 4HUEA 1Q9YA 2OEKA 1KFSA 3AAQA 4IEIA 4ZVGA 1S1WB 4KKOB 2FY1A 3VPZA 3DLKA 2J9CA 3BGRA 2CRLA 5CZXA 1U4BA 4A8QA 2UVRA 2F8TA 3FBCA 5AFUA 2B4VA 2FHJD 3VF0B 1MDUB 2EC0A 4ZS6A 2CJAA 2YHBA 3F2KA 4FK4A 3OYFA 1WORA 1VHFA 4DLGA 4C3MA 3J7AN 3RRHA 3CQXA 1HD0A 4H0TB 3M6GA 4JYAJ 5GAGI 3S3MA 2K2PA 1EKRA 2CYYA 4ECXA 3R9PA 1F21A 5DDQC 3N01A 1SIZA 2ZJQL 3MR3A 2RRNA 2XCAA 4OIXA 1X9JA 4DV3K 2HZAA 2RPIA 4MJKA 1XIQA 4DMNA 2ZH9A 2AGOA 1P9YA 5C7PA 1KVKA 5HRPA 4C0BA 4ZHRA 4HTIA 5LMNF 1R43A 1UW4A 3C8YA 3CDBA 2VZ9A 4B3MJ 2DRBA 4K4WA 2B6AB 2BJEA 1TKTA 3JTNA 2EC2A 1QQOA 3ZCMA 2QA2A 3ZSOA 3FZKA 4DR4J 1ROFA 1PAUB 3D0PA 1FVQA 4FOIA 5AQHA 3PUFA 3CFPA 4Y3CA 3HVTB 1Q1KA 3T1AA 2DNOA 4YEAA 3MR2A 3M3ZA 4BR4A 3CIPA 2GCFA 2UUBJ 2UXDF 1VHIA 4DTUA 2DHXA 3UVJB 1BA0A 2CDRB 3U1LA 1S9FA 4CFDA 3AODA 5D0GA 2RUSA 4NCGB 3QT8A 4IO9L 4HTLA 4F3MA 4UOHA 4B1ZA 1HW8A 2ZC3A 1VRQC 3J7YI 3OVBA 2XLJA 2FGCA 2Z58B 3GSDA 4BRLA 2VHGA 3V1QA 1X0FA 3P31A 1CJKA 1TL3A 2MGZB 3NL0A 2CPFA 4JRPA 4CYUA 3C6HA 4GV9A 4UY8O 4F4KA 5BR9A 1SXLA 1U6ZA 2L9NA 7FD1A 3W8PA 2KVIA 2ZUAA 5KQDA 2Y0BB 4LSNB 2FF3B 4P71A 1RT2A 3L7OA 2A6OA 4OX6A 4FOEA 4CHPA 1VSIA 5I3UA 1QVGR 1KWMA 1F60B 3TOQA 2HVIA 1LKZA 4BBYA 3G6XA 2UP1A 1LXJA 4Z94A 5KFIA 1QVFM 2KT2A 2QW9A 1QAXA 1BUPA 4NXNF 2E5LJ 2CWKA 2EI5A 5CHCB 2Q1NA 4QU6A 2HFZA 1HPMA 4F0MA 2FVCA 1HWKA 3LZJA 3GV8B 3MMVA 4G3IA 4O55A 1Q53A 4DFMA 3AA4A 3H90A 4CTAA 3NF7A 4JI3J 4H0VB 1N5SA 3KHHA 3DOKB 3EDRB 3RB0A 4NASA 3HI9A 4NYOA 1EX8A 5KI6A 2O8BB 2DFEA 2UV8G 4QJVA 3PNIA 3WXKA 4UOCA 3FZMA 4DV7J 1KBRA 1VK3A 1RU2A 3LP2B 2I2YA 5B0CA 3L3UA 3UPFA 4JYAF 5D6GA 3CQYA 3CTRA 3C94A 1BCMA 4RO0A 2DNQA 3BKFA 2FBYA 3T1HJ 2Q79A 1SJ1A 3SCIE 4KIAA 4WYBA 3QFPA 5A6WA 3G10A 4QAGA 3A8YA 2E1PA 5MAOA 2BRKA 4M42A 3DRRB 2W4DA 2IDEA 5B0BA 3UCUP 4YDUC 4K8XA 4O0NA 3H46O 1WG4A 3UWTA 2YNGB 4B3MF 1U0SA 3K5MA 1UFLA 2RVJA 2W8KA 1ZBLA 2JX2A 3NGSA 1ULRA 3HX9A 4FWRA 4DR2J 1ATSA 4HLBA 2VODA 2JWLA 4FJHA 1WKJA 4P6QA 3D7EO 1N0UA 5DDOC 4DL7A 4M41A 1TUYA 4IOXA 5I4MA 4FYDA 3I0SB 5DRKA 4DR4F 1HNZF 4UZBA 4ILGB 2IM3A 2NREA 4CHOA 4L76A 4CFBA 2B9XA 4XPCA 2B6AA 4XDDA 4IO8A 1RUSA 4ECUA 3R9LA 1Z05A 4RG8A 2UUBF 3FEZA 2PDAA 3IXQA 4ZOSA 3OL7A 2VKZG 3PJWA 2I1RA 2XZDB 3P49B 4Y2CA 1UP1A 3K9KA 3U9DA 1EP4A 3DJCA 2R2UA 4PWWA 3JSBA 2XULA 4BRGA 1S7HA 3PJ9A 3EXCX 2CPJA 3HVTA 3KZBA 2J6SA 5LY3A 3NVMA 3CC2S 1R0CB 5L1IA 3AOCA 3POTA 4WBFA 4XAKA 4CE9A 1I3OB 3M32B 5AJ3J 1HJOA 4IJNA 5HAOA 3B6OA 2V8HA 4NCGA 4YDXA 1W2IA 4HCBA 4FL9A 4WF9L 2DH7A 4L74A 3OBYA 4P52A 1NK4A 1T6DA 4BRCA 3QIOA 2E88A 3PRVA 1VRTA 4KSEB 2GNKA 4I6AA 2HNZA 1QVGM 2J6TA 3JTOA 5EVZA 4CZLA 2E5LF 3OSPA 3H5XA 3BBBA 4OYOA 3BS9A 3JQJA 3EZWA 2NCKL 4Y2KA 4LSNA 3P5BP 1FT8A 5T7BA 4CESA 5LSOA 3KXDA 2DNYA 4JI3F 3T7ZA 3CCMN 1O51A 3A8IA 1LV5A 3AA2A 1RKJA 4U6PA 1TYQA 1U6BA 2RHSB 2RE2A 3CVKA 3FZ2A 1FE0A 1D8ZA 2FXUA 2B0GA 2BOAA 4DV7F 2MMYA 1U6FA 1HJRA 4J9VA 1WC6A 5IQ6A 1N36J 3I82A 4DU1A 1RWNB 1PC5A 2HBJA 2W2QP 2DGOA 4MDAA 1CS4B 2J9DE 4I67A 2X3DA 5AQNA 2PMWA 4LF7J 2MYFA 3KK2B 2Y8YA 5AE1A 4YR0A 3T1HF 1UJ5A 1GTEA 1W0HA 3NH1A 4I2QB 5KG5A 1TVRB 3QYYA 3RWUA 3KOAA 4LFCJ 3HJFA 1NU0A 3LP2A 2AYMA 3G96A 3OPKA 4X66J 2VBZA 2ZBPA 3H5UA 4WCEQ 2G8IA 4C8OA 1S48A 2V7ZA 4A5BA 4K0KJ 2CXEA 3VGMA 2LQ9A 3OJSA 2MKYA 1NHVA 2UUAJ 5CE3A 4J9KA 3AQOA 2O5DA 1FKPB 5AXNA 1RCXB 4DS4A 4DR2F 3Q8UA 4DHYA 4GNIA 3C66A 3DRRA 4RW9B 2GS8A 3VESA 4LFAF 3SCXA 3SPZA 2WVDA 1WSIA 3BJYA 4I1TA 1V3RA 2DR5A 5LXYA 3KYLA 3GFHA 3E51A 1WG1A 3VAIA 2OTLN 4KI4A 1PGZA 3E66A 1VQ5N 2XG8A 4LH4A 3KLHA 3HHDA 5GVQA 3QSIA 2HGMA 2F4VK 4I7FB 3L2UA 3LP3A 4B9SA 3DGPB 4RUCA 4W5OA 3SYZA 1IUJA 1SV5B 1JLEB 1Z2ZA 3OHBA 3QGIA 1VSLA 3OTEA 3BF3A 2G8FA 4ILRA 4CERA 4UOGA 4JI0K 3UB5A 1FEHA 3VEOA 2C1EB 2UYTA 4AT1B 4DSEA 1U7LA 3B54A 3D7SB 5AJ3F 5M1FA 2XY7A 4X64J 1YJTA 1YSJA 3JS6A 5K8OA 3KJVB 2LQ5A 3AVJA 3VGTA 1CJUB 2GVDB 5SWMA 5FRNA 5H9FK 1MSWD 5KFBA 1HR0K 4OYMA 4OO1J 4RU2A 4O8UA 2RILA 2AJ1A 1U8SA 2O4GA 2IVYA 3IA0A 5LSLA 2RD5C 3WBZA 2Y1IA 5AZIB 4B3SJ 2YH1A 1WSRA 4NEYA 3KJQB 2WVEA 1RT6B 4FYVB 3GDQA 2FZCB 2ZJPL 2W8LA 4P2SA 4KO0A 1W2BR 3T6BA 4DXLA 2BE2A 3U3YA 4PL8A 1WOSA 3NGRA 2JLEA 3TWZA 3HT0A 3RTVA 4EO6A 4I2PA 4WFBL 2Q66A 2BKNA 5C24B 3OYHA 3QFUA 1GMUA 2KT3A 4P73A 4ZK7M 3O4WA 3QEWA 3B6PA 2G2OA 5L9NA 3DOMA 5CH7B 5A6PA 2MXYA 1MWYA 4AH9A 1HBMA 3GIIA 4A8FA 4ZVPB 4CIEA 2N3LA 2E7VA 1N36F 1EX4A 1Q95G 2Q0UA 3D2EA 4RNFA 4CH7A 1M1KT 1GLDG 3D1HA 4LF7F 2PIIA 2VA3A 3QEVA 2XQCA 4ZJQA 3TAFA 2BBEA 2QSFA 3G6YA 1X3MA 4LFCF 3DRPB 1ATNA 2OANA 4DV1K 2C2ZB 4IH5A 3LUYA 4X66F 1JXLA 2AJ4A 2JHEA 3IAM9 1VLOA 1CS4A 4LR9A 4K0KF 1N0VC 4NLGA 3QGHA 4OJ3A 2UUAF 4U7CA 3KK2A 2PGCA 4OZJA 3P8BB 2BZ2A 3RBEA 3VV2B 2AZ3A 4I2QA 1D09B 2GGPB 3IKMA 5H9EJ 2CQIA 3NCQA 3THWA 2MKHA 1B64A 4USUA 2N82B 3ULHA 4F8RA 2XGPA 4IOAQ 1LWFA 3ELHA 3PACA 4JLHA 3WX8A 2E6LA 1NDPA 2XRIA 4WYLA 1FKPA 1WOOA 4CZKA 2HWIA 1JB0C 4UZCA 2OA8A 4A4JA 5EY4A 2FLPA 4RW9A 1BU6O 4CLFA 2OCEA 3KKSA 3KMQA 1SB6A 1IJJA 3CCVS 3H4BA 2R2SA 4U7BA 1CQNA 2GUIA 4CEEA 2HHHJ 2XTJP 3PXGa 4G1IA 2MZRA 1WNEA 3IRXA 2NRXA 5AR0A 2Z0GA 4X64F 4Q44A 2YX1A 4IQXA 3DGPA 3EE9A 2HZCA 2GX9A 1YJWS 3FE1A 4B1UB 1SV5A 2XHWA 4BGAA 4FM0A 1YJUA 4U96A 3LZIA 1VQNS 1IM4A 1S59A 3QRRA 3L3CA 3H40A 2FBVA 1ZS6A 4B3SF 3VAJA 4NXMJ 4JHDA 4FJKA 2A5XA 1SJ3P 1RBVA 4LF4K 3EPIA 3TW0A 4NWBA 3R7BB 3LH2S 4BY9C 2GWKA 3MR5A 3CETA 4KY3A 4DR7K 2YWGA 3RMAA 2H65B 4TYAA 4D3GA 2XGQA 3O3HA 5JICA 4W5RA 5IQQA 3ZSXA 3S6EA 3N9UC 3PIPL 2V63A 4OMFG 3SBGA 2FF6A 4M3ZA 1ZTWA 1NGIA 4F4XA 2KVQE 5K20B 1TAUA 2EPIA 2Z57B 4KHRA 4RW7A 2J8AA 3J81U 5KOXA 4DTSA 4G1QA 3U8XA 1ZPWX 3AB4B 1UPPA 4FF2A 4LR7A 1RTZA 3CCES 2BKPA 1FWKA 1S72N 1KFDA 2KRBA 2YJFA 2A1RA 5ADXH 2IAJA 1MMDA 1VRUA 3KLEA 3DNCA 3I5CA 2QZ8A 4JI7K 3SV3A 3DU6A 3CMES 2KFZA 1B7YB 2DXDA 1MMLA 3B6BA 2BUPA 4WPAA 2FJBB 4I56A 3D4JA 3RSEA 5KFHA 1FERA 2MQNA 1X9SA 1O6XA 3DLJA 4IFYB 4M5LA 3RBZA 2E1YA 3ZSVA 4CO3A 4EUVA 1RWOB 2VL1A 2GUPA 4YHHK 4LIRA 1BIUA 4DR6F 1ZBIA 3VWSA 3MCAB 2VG7B 2IRUA 1AUSL 2LQ8A 4CFCA 1VQ4N 2ZFHA 2FIUA 3FMBA 5HL7Q 1FVSA 2ETJA 5BR8K 2D4WA 2YKNA 3GCXP 4Y0WA 4URQU 3S01A 2P2CB 3KFWX 4ANCA 4N8OA 5DG7A 4AYBD 3AVGA 5GAEU 3M8PA 2MKIA 1EETB 3CJKB 4IOCQ 5KFZA 1M5HA 2GGPA 2VC1A 3MM6B 2EFVA 1ZAVA 2ZJRL 2YI1A 3SI6A 3O8WA 2VPXB 3P4IA 2VF3A 3HJVA 3M5RA 1FK9A 4K25A 1DTQB 2LXIA 2NNWA 1M5OC 4HI1A 4R25A 3SMZA 1NJIT 1TZ0A 3RJMB 5K9FA 2YJEA 3UR3C 4Q2MA 3SDEA 1QD1A 4A8XA 3CD5A 4O3PA 4ED5A 4QR0A 3VA3A 3BGOP 4WTOB 4MDBA 4WFNL 2YNFA 1U2FA 4NXMF 4KPCA 3W5YA 3OYLA 4HDGA 4NRUA 3VHQA 3DCAA 3LAKA 2EFPA 3AVCA 4DV2J 5DGAA 1NU4A 3NS6A 2AJ2A 2CFXA 1BQMA 4YOXA 1OY8A 4LF2A 4DCOB 4JBCA 2FC8A 5KFAA 2MQQA 4LF5K 3NFAA 2W7OA 2ZHOA 1VQ6N 3CCTA 3Q23A 1DFDA 1HMVA 2XC9A 2E1ZA 4BR5A 3RRKA 4DUYJ 2D1CA 4NMLA 2GEMA 1NMNA 3AB2B 3HHLD 3HXMA 3SQ1A 1E4GT 4OX7A 4JS5A 4LIWA 3GYXB 3ZX0A