3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna complex
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
4ZP9A 3PO4A 2FVCA 4K4TA 1HPZA 4JS4A 3VQAA 5C42A 3DOLA 3KLFA 4NRTA 4URGA 1KRPA 4MIBA 5I3UB 5KT7A 2ITGA 2JEFA 3MR6A 4FLYA 3SNNA 4AHRA 2YV0X 4F8RA 3PR4A 4H8KA 1U45A 3SV3A 4IH7A 3VQCA 4CERA 1NNDA 3NGYA 1S1TA 1B9FA 3C6TA 1TL1A 3CO9A 1QSYA 5D3GB 4F50A 3NAEA 4M3WA 1ZETA 1VRUB 5E41A 2YNFA 3KLGA 2HVIA 4OLAA 3N6NA 2BQRA 3P1GA 1LW0B 3AVJA 1X9MA 1CLQA 2D41A 4GW6A 4ZHRA 4DL5A 4ECYA 2YKNB 1JXBA 4URSA 3S3NA 5KFJA 2C22A 5C42B 3DOLB 3KLFB 4CGGA 2HB5A 4Y3CA 5I42A 4BWJA 2RKIB 3BSNA 4KV8A 3QIOA 4KRFA 3DRRB 1KFDA 4JS5A 4E0DA 1CZ9A 1X9WA 2V4RA 3IAYA 4K4YA 1RDRA 2AQ4A 3H4BA 3VA0A 4ECSA 4KE5A 3QEXA 3ITHA 2Z1IA 2YNHA 3B6OA 5J2MA 2FVQA 3C6TB 1TL1B 2HAIA 4CJQA 4IKAA 4YR0A 3WNEA 4FJKA 1RTJA 1SKWA 3T5LA 2ZQBA 3SZ2A 2YNFB 4QW8A 3KLGB 3RRHA 1X1PA 1C1CA 4CESA 3OLAA 4EZ6A 1HNVA 4J9QA 4FJLA 4TQRA 4OVLA 4ZHRB 2GC8A 1XR7A 4E7HA 3ALYA 1KSPA 4O4GA 2O4IA 2ZE2B 1U47A 3HVRA 4IDKB 3P83D 4AHTA 3L2WA 5I42B 4KV8B 3QINA 4CEBA 4XIUA 4QWDA 5DQHA 4RNOA 1RTIA 5KFOA 1S1XA 3H4DA 3OS0A 3MEEA 3RBDA 1CXQA 3GIJA 2YNHB 4KHUA 4KTZA 3VQ7A 5J2MB 3FDSA 3KOAA 5HROA 2FJVA 1WSHA 3HT3A 1S0OA 1VSHA 4E1NA 3OHAA 3H5YA 2ILZA 1NK6A 3MR2A 5J2PA 3PX6A 4FJIA 4ID5A 1C1CB 4ELUA 2QK9A 3UIQA 1J54A 1U4BA 1NKEA 3FFIB 2W7OA 1L3VA 3DDKA 3PV8A 1T3NA 3OL7A 2HNYA 5EWGA 3KK1A 4DG1A 3PJXA 3U3GA 2OZSA 1NHVA 2HWHA 2B4JA 4BDPA 4TN2A 4RZRA 1KVCA 4MH8A 4EP4A 2D3UA 1MMLA 1RTIB 1VSFA 2DFFA 1S1XB 1NJYA 4PUOA 1TV6A 2AX0A 4DSIA 2FC0A 3MEEB 3ZSVA 1ZTWA 2IC3A 1RBRA 4DS4A 1JXEA 4J9RA 4JV1A 4BE2A 4HCCA 2XO7A 3LPUA 4B8CA 1S1WA 1NOZA 3QZ8A 4EBCA 1TKXB 4ELVA 3CM5A 1Q9YA 4ID5B 4ECQA 2BQUA 4DSFA 1RBTA 5K14B 3LP1A 3D28A 4K4SA 3V9WA 3GV5B 3IRXB 1S9FA 2B6AB 2R8GA 4TLRA 3NFAA 2HNYB 3AA2A 4OGEA 4TYAA 4Z4CA 3HPOA 3KK1B 4J9LA 4DG1B 1NHUA 1L5UA 4IRCA 5KFBA 3TR8A 3FSIA 2BANA 3NF7A 4W5OA 5T7BA 3PO5A 3VQSA 4O44A 4ZP8A 3NDKA 4K4XA 3HM9A 4E7LA 1TV6B 2KFNA 4CJFA 3NH1A 4O5BA 1RYRA 1KVAA 2IC3B 3L3VA 4Z4GA 4FJ8A 1LAWA 3H08A 1ZTTA 2ASJA 3QEIA 1S1WB 4Q0BA 2R8HA 2D3ZA 1RYSA 3B6PA 3SUOA 2BGGA 1S1VB 1SV5A 3SCXA 3M8QA 4J9OA 4CHZA 5KFMA 4WZMA 1HYSA 4HVJA 3NL0A 4HUGA 4OL8A 3LP1B 1WSFA 1C1BA 4MK9A 5KG3A 4BDZA 1BI4A 2JC1A 4DTMA 4KFBA 2YHBA 3Q8PB 4FJHA 1S48A 1BIUA 4PWDA 4FJ7A 4ECXA 2NUBA 2BANB 5DMRA 4DMNA 3BSAA 4IH5A 1W9HA 4O44B 3WNGA 4E7KA 5KG7A 1TK5A 1D1UA 4CJKA 1NKCA 4FK2A 3ZT0A 1NK4A 5HRSA 2JEGA 2J6SA 5EWEA 2BR0A 1JL2A 4BDYA 3E01A 4L8RB 5KFTA 1ASUA 3AVCA 4YFUA 1UAXA 4XPCA 2OYQA 1TVRA 4YR3A 2W8LA 1HYSB 3U3YA 3TAEA 4J9MA 3ZSYA 4CK2A 3D0PA 4O3SA 3RB4A 1BI4B 3K2PA 3H5XA 2HVHA 1NK0A 1KLNA 4R8UA 4PWDB 3NMAA 4B9TA 3KNAA 4HKQA 1TKTA 5KGXA 4O0JA 4N41A 4H4OA 1ITGA 2X6SA 3Q8SB 3F9KA 1TKZA 5DG9A 4CJWA 4ECWA 4LSNB 4DWIA 2BRKA 3C6UA 1A5XA 2KFZA 2E9RX 1JLFA 2GIQA 4FW1A 1ZYQA 3IGVA 4FCYA 3E01B 1TVRB 1K6YA 2BE2A 3EZUA 4NLPA 4MKAA 3G6VA 4M94A 1MU2B 4M95A 5F8MA 1EXQA 1X9SA 4ED7A 4JLHA 2IM2A 3NH0A 1YT3A 4IFVB 3OYKA 4B3OA 4TY8A 4NCAA 3LZIA 4CFAA 2OPRA 4I9LA 1W0HA 1SL2A 3H5SA 2FVPA 4R8UB 2VWJA 3VQ6A 1S5JA 3KK2B 4XO0A 2W7PA 1TKTB 1D9FA 1EETB 2VG7A 5J1EA 4Y2CA 2YNIA 4FVMA 1N56A 4H4OB 3H59A 4KI4A 3AVBA 3DYAA 3UR0A 1S0MA 4UQGA 3H40A 1RILA 2IGIA 4CCHA 4CJTA 4HHTA 1RTDA 3DRSA 3HHKA 2JC0A 5EDWA 3C6UB 1A5VA 3M9MB 1JLFB 1TL3A 1I6JA 3OYFA 4ZP6A 2IJNA 4CFDA 3KLIA 3OVNA 4YP3A 3ZSWA 2DY4A 4CF9A 4K8ZA 4NLWA 1L3SA 3UPFA 2BE2B 4CHYA 1YVUA 4KB7A 3BJYA 3I5BA 4PQUA 3I0RA 3HL8A 1XR6A 4B3OB 1VSDA 4TQSA 3RB6A 1IG9A 5KFIA 3VQ8A 1K1SA 2OPRB 1KFSA 4DSEA 3BGRA 1DTQA 4RW7A 4IG3A 1L3TA 1HQEA 1D9DA 4DQQA 2GIRA 3DLBA 2FJXA 5HBMA 2XGQA 2VG7B 5J1EB 2FLNA 3NCIA 4MK7A 3DOKA 4OPJA 3O3GA 3DYAB 1SL1A 2X6NA 2IBKA 1RTDB 3DRSB 3G86A 4I7FB 3MR5A 2A1SA 3GILA 3C94A 4ED1A 4JV2A 4WZQA 3T5HA 3C95A 4ZTFA 3HVWA 3T19A 1U04A 1TL3B 1Y97A 4QWBA 5KFZA 1W25A 1JKHA 4ZVHA 3G6YA 4ECVA 1EP4A 3VQPA 5KG5A 4FW2A 3LAKA 3KD1E 1KCFA 4WYWA 4OLBA 4PQUB 3I0RB 3M8PB 2DPJA 3SQ1A 4DTNA 2Z1GA 4CGJA 4EO6A 3SFGA 2QKBA 4Q8EA 2JGUA 1U09A 2HHQA 1DTQB 4RW7B 4FLVA 2FJWA 4IG3B 1YTAA 1T8EA 1HQEB 5HBMB 4GVMA 4WXWA 3DOKB 5HLFA 3HKWA 3NGDA 5CYQA 4AILC 2DFEA 1TK8A 3AVHA 4IFYA 3PX0A 1RT7B 1QSSA 3AO2A 1HNIA 1IKWA 2VG5A 4U6PA 4X2BA 2XY6A 2XY5A 4EYHB 3NBPA 1JKHB 2XI3A 5KFYA 3IG1A 3KK3A 1ZBUA 3LALA 1EP4B 4FXDA 1S10A 2VA2A 3QETA 2XRIA 4NLXA 2W42A 1JLBB 2HHUA 1NOYA 4JRQA 2J6UA 3OYCA 4CGIA 3BQ0A 2XGPA 2X78A 3AVAA 4NCBA 2QE5A 1C0UA 1LWFA 1SH2A 4BWMA 4Q44A 3THVA 2RDIA 1HYZA 4EBDA 1RT5B 4CHOA 4OGCA 5HLFB 4CJ3A 5CYQB 4WFXA 3AVIA 4WFYA 5FROA 3VQ5A 4M3YA 3PR5B 4IFYB 3I5CA 2PZSA 3TAGA 4BE0A 4AHCA 1FKPA 2RPIA 3ZCMA 4E7JA 4QOZB 1TQLA 1IKWB 3K5MA 2VG5B 4FBUA 5KFCA 3Q8QB 5KG0A 3DMJA 2O4GA 2HMIA 1IKXA 2CKWA 1NJWA 3IG1B 3QIPA 1HPZB 3KK3B 1LAVA 2V9WA 3SQ0A 2WONA 3OJSA 3PW4A 2G8UA 1BCMA 4OKEA 1SL0A 1SH3A 2ETJA 4DQSA 1JLEA 1JL1A 4F2RA 3LPTA 5KFUA 4FBTA 1VSLA 4DL2A 1LWFB 4B08A 4QWAA 1S1TB 4KBIA 2WOMA 4AHVA 1QQCA 4R5PA 3TWHA 1S9GA 4NYFA 2EHGA 4WE1A 4KHQA 1WAJA 4FLUA 1NJZA 2KZMA 4FZYA 4CF1A 3TVKA 3ASMA 2KZZA 4ECZA 2ATQA 3OSPA 1FKPB 3KHRA 4DU1A 4Y2AA 4E89A 4N5SA 3M8RA 2VA3A 2AJQA 2HMIB 3QGGA 3ZSZA 4W5TA 3QIPB 3M9OB 5DK5A 3KLEA 3G10A 3SI6A 2F8EX 2OZMA 1IKYA 4IBNA 3N6MA 1RBSA 1HYVA 1RDCA 1S4FA 1RA7A 3OYDA 1S9EA 3ZT4A 5JXSA 3GIIA 4C8LA 1S49A 1ZBFA 3MTKA 5KFVA 3PW2A 1RT3A 4ED6A 3ITHB 2AGQA 1VRTA 2EC0A 3BSCA 1HQUA 2WOMB 4R5PB 2R8KA 3LWMA 3V6HA 5L1KA 1RTJB 4DFKA 3LP3A 2AX1A 4FJXA 4LY7A 4U7CA 2OPQA 1VSMA 4DL3A 4JV0A 3S3MA 1HNVB 5FRMA 1I3AA 1FK9A 1OS5A 1JXLA 2KTQA 1BQNA 3OYHA 4OPKA 3CG7A 4O4GB 4Z4FA 4EP5A 4DQPA 1LWCA 3KLEB 4FLZA 4AH9A 5F8JA 3TANA 4E1MA 4O55A 1SH0A 4ZVFA 3CFOA 3ULDA 2QV6A 2W9CA 2GBZA 1IM4A 3QLHA 3DLHA 3SQ4A 1RT3B 3BDPA 1VRTB 3MR3A 3RBEA 1VK0A 4O3QA 5KT4A 5HROB 5J2NA 4DF8A 4ICLA 3AO3A 3KKSA 5FDLA 3AV9A 3O4NA 2IOCA 5KFFA 4DU3A 2D0AA 2OPQB 3FQLA 5J2PB 5EWFA 4K4WA 5JS2A 1S1UA 4IH6A 4F3OA 4JUZA 2X74A 4ED2A 3O3FA 4CF8A 3KIOA 1NJXA 4CF0A 3V6JA 3Q8RB 3K5OA 1BQNB 1RCHA 1LWCB 2XY7A 5KT5A 3NH2A 1RA6A 3AO5A 4M3UA 3JYTA 5KG2A 4C8OA 4CHPA 3HO1A 3OYMA 3OYEA 4Z4HA 3CM6A 1YTUA 4B9VA 1I39A 2W9CB 3V1RA 4KREA 2OH2A 4F4ZA 4PUOB 3QLHB 4CIEA 3OLBA 3HJFA 4OKJA 4I2QA 1RT6A 2FVSA 3QEWA 3SUQA 4URQU 4W5NA 1Q8IA 1NK7A 4M3RA 5FDLB 3L8BA 1REVA 3BQ2A 5KFDA 1T03A 2R8IA 1J5OA 4KKOA 1S6QA 4QW9A 4DLGA 2F96A 1C0TA 4KPYA 1N6QA 4FS1A 3MFHA 3G0ZA 4GMJB 4ED8A 2HHWA 1FXXA 4DTPA 3EPIA 3JYTB 5KFAA 3E51A 4J9NA 3HK2A 5KFLA 1XWLA 3VQDA 3QGIA 2B43A 1JLGA 4RNHA 1JX4A 3AA4A 4W5QA 1RT6B 4M42A 5DGBA 1XC9A 3RR7A 3PHEA 4Q0BB 4LH4A 4CJRA 1REVB 3PW5A 3OL6A 4F4WA 2FBXA 5SWMA 4RW6A 1SV5B 4DQRA 1J5OB 3M8QB 4KKOB 2R2SA 2P5GA 1WLJA 1BQMA 2HWIA 3SPYA 1XI1A 5KT6A 3DLGA 1C1BB 2Z1HA 1U49A 3K57A 3V1OA 1N6QB 3OL8A 2WCXA 1T7PA 4LSLA 1D5AA 1UOCA 3OY9A 5KFXA 1UA1A 4KFBB 4GC7A 1TKDA 2W8KA 3RB3A 4K4VA 2WHOA 4NLOA 4ECRA 2FBTA 4HUFA 2VG6A 4DU4A 4DFMA 4W5RA 3DI6A 3QEPA 4KHWA 3QO9A 1JLGB 4ZPBA 1KLMA 5DQIA 2Z1JA 5KFKA 4B9MA 5HP1A 5KFPA 4IRDA 4QPXA 4YR2A 3OS1A 3AVLA 4J2DA 5JS1A 4G1QA 2IDOA 3AO4A 4CHNA 3HP9A 4RW6B 1LV5A 4ZPAA 2ZD1A 1SKSA 1BQMB 3SUPA 3QZ7A 2O5DA 2AGPA 4C8MA 3DLGB 2UUWA 5CYMA 4KTWA 4LSLB 3OHBA 3ZSXA 4YMEA 3TQ1A 4IR9A 3FRZA 1F21A 4Q8FA 4IRKA 1HJRA 3L2UA 3EPGA 1Z25A 4FM0A 4ZP7A 3I5AA 3GV8B 4N56A 1GOAA 2AWZA 4I9QA 1VSKA 2Y1JA 2VG6B 2HHTA 3H5UA 4J2AA 1KHVA 3GYNA 1C0MA 4NLGA 4B9LA 3AVMA 1TKZB 3QO9B 4CHQA 2IMWP 2P1JA 4XPEA 1R0AA 1NK9A 3MEDA 3NKYA 2A1RA 5HP1B 2C2RA 5HRRA 1CSJA 4MQ3A 2E9ZA 4QWCA 4RUAA 4G1QB 3HP6A 1LWEA 3TI0A 2ZD1B 1TP7A 2IM1A 4K50A 3HVAA 1C6VA 2XHBA 1O1WA 4QCLA 5CYMB 3WNFA 4TY8B 4CEAA 3TAMA 4CIGA 4RNNA 4WXOA 4DL6A 3DLEA 3L2RA 3RMAA 5C24A 1VSEA 3NAIA 2YNIB 2C2DA 3H2LA 4QAGA 4EEYA 1N5YA 4J2EA 3EY1A 1S6PA 3PJWA 4DQIA 5DLGA 4IR1A 1R0AB 3K59A 3LP0A 5KFSA 4FK0A 3DLRA 3CJ2A 3SFUA 3WNHA 3OL9A 2B5JA 1WNEA 3KLIB 1FKOA 1C2PA 1LWEB 3EYZA 3OYNA 2R7YA 4EBEA 5F9NA 5F8HA 5L1JA 4KO0A 1GX6A 5CZ2A 3BREA 4DTUA 3KHHA 2UVRA 2FBVA 2QXFA 2JEIA 3TAMB 3BGRB 2HHXA 3DLEB 2HW3A 1IKVA 3L2QA 3D45A 5C24B 4IG0A 3OYLA 1JLCA 1RT4A 1SKRA 3I0SA 4M41A 3V9UA 4DEZA 4J9KA 1RT1A 3ICLA 1N5YB 4F4KA 4HTUA 1S6PB 1ZBHA 4NLTA 3LP0B 4CECA 4FM1A 2YNGA 4F4XA 4MKBA 1TK0A 1XHXA 1RDBA 3QGHA 3NGIA 3HYFA 1FKOB 1NK5A 3QNOA 3KJVA 4DSLA 1VRUA 1RBUA 4KB0A 4KO0B 1LW0A 2R2TA 4I2PA 5HRPA 1S0NA 5KFRA 2YKNA 2V4QA 1IKVB 5EU7A 4IG0B 4M3XA 1JLCB 1RT4B 2J6TA 2RKIA 3I0SB 2KW4A 4BE1A 5KG6A 1RT1B 3DRRA 2LSNA 2YKMA 2ASDA 5CY4A 4CGFA 3ISND 2XI2A 2OA8A 3AVNA 3EZ5A 5C5JA 3HPHA 1TGOA 3K5LA 2E4LA 4IKFA 3CFPA 2YNGB 3LWLA 2Q3SA 4FJGA 1J53A 5L9XA 2V0NA 3QYYA 1CXUA 1HNIB 4DSKA 5KT3A 3NBPB 3KJVB 1RBVA 3HVTA 3S9HA 4DTXA 3DRPA 1IH7A 4KHSA 1QE1A 2IAJA 4Y1CA 3KLVA 4WYLA 3NHGA 4FJ5A 1LW2A 3GIMA 2R8JA 2RF2A 3I8DA 3PVXA 4I2PB 4CEQA 4CK1A 3AVKA 4Q5VA 2FVRA 4KB1A 1Z4UA 3SQ2A 1G15A 3RR8A 1C0UB 2UVUA 2ZE2A 1JIHA 4IDKA 3V9ZA 4B9SA 4DTJA 5KFEA 1N4LA 2ZKUA 4HUEA 2YKMB 4K4UA 3TARA 3RAXA 5F8NA 4RW4A 2BRLA 3OSNA 1B92A 2C28A 1HRHA 4O4RA 3AO1A 1QUVA 2D0CA 1IO2A 2XWYA 4B9UA 5KFWA 3OYGA 4GC6A 4DSJA 1WNSA 5DQGA 4LQ3A 4LD0A 4NLVA 3D5MA 3DMJB 1IKXB 3OYJA 3HVTB 2WONB 4IOBA 3DRPB 3NF9A 1QE1B 2IAJB 3MXMA 4J9SA 4YNQA 2EX3A 4KSEB 2P51A 4CE9A 1JLEB 1LW2B 3MEGA 2RF2B 4G3IA 3FFIA 4DL7A 4TSXA 4MFBA 1BGXT 3VQ4A 4Z0UA 4M3ZA 3MAQA 3K58A 5KI6A 3V9SA 5DG7A 4E19A 4HYKA 4ELTA 4Z4IA 3VN5A 4CEZA 1Z26A 1S9GB 1Q9XA 4WE1B 4FK4A 4RW4B 4H4MA 2QKKA 2UVWA 3V9XA 2WB4A 4J9PA 3RMBA 4DTSA 2RN2A 2BQ3A 4TY9A 3MFIA 4RG8A 3UDLA 4ZMMA 4H54A 1BIZA 1QSLA 4DS5A 4CJUA 3LZJA 5DG8A 2G8IA 4ZPDA 1K1QA 4FS2A 3CJ0A 1UA0A 4HCBA 1TKXA 3HPGA 5KGWA 4CEDA 1IKYB 1SUQA 3M9NB 3RMDA 4N76A 2FLPA 5SZTA 3CDWA 3S3OA 3P5JA 3JSMA 3GIKA 3SPZA 5K14A 3MEGB 3L2VA 3IRXA 4ZVGA 1KVBA 4MFBB 1S9EB 2B6AA 1KTQA 2D7SA 3NE6A 4FLWA 3KMSA 4CEOA 3RWUA 5C25A 4Y34A 4M3TA 1WAFA 5L1LA 3IS9A 2ASLA 3KHGA 3PW7A 1HQUB 2WRMA 3QIDA 3BSOA 2CJQA 3T5JA 4DL4A 2R2RA 4H4MB 4C8NA 4FYDA 3O3HA 2UVVA 3VQ9A 4NLDA 2IA6A 3KD5E 3CJ5A 1JLAA 1RT2A 1DTTA 2G8WA 5F8LA 4CJ5A 4RW9A 2HNZA 1RDDA 1FK9B 1ZBIA 2OPSA 3ZT3A 5FRNA 4CF2A 3SUNA 3QEVA 1A5WA 4WFZA 4YQWA 2G8HA 1S1VA 1WSEA 3ISNC 1SUQB 4CJVA 3HSTB 3DLKA 1T94A 3JSMB 3TAPA 2HNDA 4NRUA 2IS3A 1HARA 5C25B 2PY5A 1VSIA 3V6KA 3FQKA 4CK3A 1GOCA 1ZBLA 3BQ1A 2R2UA 4Y1DA 3IS9B 2G8FA 4KI6A 3N6LA 2UUTA 5J2NB 2OPPA 3UQSA 4RUCA 3RRGA 3CYMA 4E7IA 4FJMA 1YVFA 4ICLB 2GUIA 4O3OA 3SYZA 4TYBA 3PX4A 4RW8A 3LANA 2I1RA 5KFNA 3QNNA 4KAZA 1S1UB 1JLAB 1RT2B 3CQ8A 3SI8A 1DTTB 2F8SA 4FLTA 4RW9B 3NGZA 2HNZB 2HHSA 1T05A 2YHAA 4DF4A 4ZTJA 4B9NA 5CZ1A 2OPSB 1QTMA 4NLYA 2XCAA 4J2BA 4NLQA 4KTQA 3ZSQA 4ID1A 3NF8A 4AHUA 3L3UA 3RB0A 3V6DA 2AGOA 4DFJA 4LQ9A 1BISA 3O4QA 3DLKB 4NYNA 1XR5A 4MK8A 5KRSA 2HNDB 3F73A 4FJNA 4ECUA 3MXIA 2P5OA 3MECA 2BDPA 2I5JA 1ASVA 1QS4A 2FBYA 4C8KA 4I2QB 4RNMA 3MXJA 4N47A 3G6XA 2OPPB 4TXSA 1RNHA 3LP2A 3CDUA 4FZZA 4OKKA 3MF5A 3NAHA 4RW8B 1B9DA 1T03B 3KMQA 2DTUA 4NZ0A 3VQQA 4LSNA 1S6QB 1WSIA 1NK8A 3OYIA 3ZT2A 3A2FA 1RTHA 1T05B 2DPIA 2GV9A 1C0TB 1QHTA 1WSGA 3ZT1A 3TAQA 3VQEA 1NKBA 4KHRA 4MIAA 3KHLA 3V6DB 3V81A 3PUFA 5J2QA 4F3TA 4F2SA 3IGNA 4DTOA 1MU2A 4FM2A 2W9AA 4KAIA 5F9LA 5F8IA 3VA3A 4IFVA 2WK4A 3OJUA 5L1IA 3MECB 2I5JB 2KQ2A 5KFQA 3CFRA 4FJJA 3KKRA 5KRTA 3PZPA 4NYZA 3KK2A 1WSJA 4O0IA 1EETA 1D0EA 2JLEA 1ASWA 3LP2B 5EUHA 1C1AA 2XY8A 5KG4A 3ZSRA 2E9TA 3PW0A 2C2EA 1RAJA 1BCOA 3T1AA 1GOBA 4NLSA 3CJ4A 1BL3A 1RTHB 4O3PA 3AA3A 4O3RA 2DFHA 4OJRA 3KLHA 3SJJA 3U6FA 2E6LA 1CZBA 4E3SA 2ILYA 5DGAA 3V81B 5J2QB 1QAIA 5DLFA 5JUMA 3OYAA 4CGHA 4AHSA 3DI6B 2D5RA 5T14A 4FZXC 1S97A 4CJ4A 4LH5A 4CJPA 1KLMB 2XC9A 3TABA 4CEEA 2IM0A 3BR9A 1RDAA 4EO8A 4ECTA 3DM2A 1JLQA 4RNFA 1N48A 4Q43A 1UWBA 2IJFA 1DLOA 2VWKA 4K4ZA 3RTVA 4CEFA 1QAJA 3KTQA 2FLLA 2W9BA 3TAFA 5KG1A 4I7FA 4PA1A 2G8KA 4FJ9A 3CJ3A 3CVKA 3HXMA 1GX5A 1WN7A 2AU0A 3KLHB 3K5NA 5F8GA 4EYIB 4RU9A 5KTQA 3OYBA 4Q45A 2RDJA 4O3NA 4QWEA 3AA5X 3NF6A 4K8XA 1L3UA 2F8TA 4R0EA 3RAQA 4CFBA 2D0BA 4ED0A 3H98A 3AVFA 3M8PA 4CJLA 1EKEA 3GQCA 1TAUA 3MEDB 4IQXA 3CDEA 3DM2B 1JLQB 2WTFA 1UWBB 3QERA 4JRPA 3V4IA 1DLOB 1HMVA 4DFPA 2W9BB 4NCGA 1BHLA 2ATLA 3ZSOA 4KHNA 4ZPCA 1RT7A 4NLUA 2PYJA 1D8YA 3LDSA 3LAMA 1XHZA 4BACA 5KFGA 4M45A 4CIFA 2HHVA 4DLEA 1KHWA 2G8VA 2JEJA 2ALZA 1VSJA 3T3FA 4ZVEA 3M8SA 4CGDA 1J9AA 4KHYA 4B8AB 5I3UA 3AVGA 2Y1IA 3OS2A 3T5KA 4ED3A 1JLBA 4PY5A 3PY8A 1EX4A 3VQBA 4CFCA 4FLXA 3IN5A 1TAQA 2IM3A 3SV4A 4DTRA 4Z4EA 2XCPA 5HRNA 2E6MA 1U48A 4NLRA 4F4YA 2B5JB 3V4IB 1RT5A 3CIZA 3QESA 3RMCA 5D3GA 3CWJA 1HMVB 4CJSA 4NCGB 4CJEA 4EZ9A 5KFHA 2PYLA 3GV7B 4KHMA 5KT2A 3V1QA
chains in the Genus database with same CATH superfamily
2AJ1A 1EX8A 4JS4A 3DOLA 2HOEA 1HIYA 1KQSR 4MIBA 1Y64A 2ITGA 3SNNA 1W2IA 4UUXA 1X5OA 1NZAA 3OBWA 5KAKA 3BBBA 1R8HA 3CCTA 3HJVA 4JP8A 2J9DE 1U45A 3GIRA 4IH7A 1UJ6A 1HUXA 3CC4N 1HW9A 1VC5A 2DIVA 4DJBA 3NGYA 5D0GA 2VASA 2ZJPL 1B9FA 4F50A 2DHHA 5MAOA 2YNFA 2OJ3A 2HVZA 4H0TB 1XC3A 3AVJA 3CD7A 3HDSA 4P71A 2LKZA 3MM8B 4GW6A 3WC2A 3TW0A 1JXBA 4ZCIA 1V3ZA 3R2CJ 3NMUA 5KFJA 2GJIA 2BZ2A 2VQFK 3KDNA 1UFKA 4K0KJ 5I42A 2ZWPA 2RKIB 3O6WA 3I96A 3FCHA 1X9WA 5EN1A 1TUYA 2V4RA 3IAYA 5F0WA 1RDRA 1I3OB 4K4YA 4DR7J 2YVSA 4PG6A 2ZJQL 3JAMU 4DPTA 1UVKA 3BKFA 2RRBA 3DN9A 3D2FA 4BRIA 2C2OB 5JVHQ 4IKAA 4YR0A 2V8DA 4LFCJ 3MMCB 3P5TL 4DX6A 3LM2A 3AD9C 2NCKL 5JICA 4QIEA 4USTA 1C1CA 1TUVA 5D0EA 1RXOB 3OLAA 4EZ6A 3CSKA 1VQSA 4CD3A 4PG8A 4NA2A 4B3TF 1XR7A 3IR5B 3ALYA 5B0DA 5L38A 4O4GA 3M6XA 1DBDA 4KV8B 5M1QA 1ROFA 3QINA 3GDQA 4YOVA 4CEBA 3MMBA 3CJKA 4QWDA 2GELA 4RNOA 4GV3A 2UXCJ 1H7XA 4IOCQ 3H4DA 4M1KA 3MEEA 3J8AA 2BA9A 1YHQN 3H46O 2HFOA 2AA4A 3GPAA 2YX4A 4QPTA 3SK3A 5HROA 4WTYA 5J1PA 3F56A 1N36K 3BGFA 1VQON 1GQEA 1LQ9A 3HT3A 1S0OA 1NMDA 4FJIA 2XMKA 4ELUA 2HZCA 2CXEA 1U4BA 1NKEA 3FFIB 2W7OA 2O8CB 1L3VA 3PV8A 3A8KA 2COLA 4UZBA 2N82B 4DPWA 4LF9J 2DNNA 3MN6A 3KK1A 4DG1A 4JHDA 4F0HA 3U3GA 4DR3F 4BDPA 4RZRA 1VQ4N 1UMJA 1VSFA 1O8BA 1S1XB 2JHEA 1TV6A 3N79A 2RHQB 2YTCA 1IVZA 2FC0A 2F9WA 5AQNA 1JXEA 4I6WA 4BE2A 2Z2YB 1D09B 4EBCA 2V51B 3E9PA 1KONA 2UUCJ 2J8AA 4DU7A 3NS7B 2DNLA 4ID5B 3A12A 3GV5B 3IRXB 1S9FA 4MLEA 5J1NA 3SAHA 3EVOA 2HBJA 2ZITA 2D3O1 2FHOB 3AA2A 4NWBA 3LPYA 3J7YU 3HPOA 2GQCA 4NYOA 5KFBA 2W4PA 2GAHC 3FSIA 1R6YA 1W26A 1FE0A 3J7YI 3DOMB 4CH1A 3VQSA 3C46A 2XSFA 2XS7A 4E7LA 4WQ4A 2KFNA 4O5BA 1KVAA 1B64A 2VQEJ 3RSEB 4Z4GA 1LAWA 3H08A 2BJ3A 3QEIA 3D6HB 5AQJA 2ZH9A 2E7VA 4BC9A 1RYSA 4JI3J 1ELOA 3SCXA 3OUYA 4CHZA 1WOOA 3NL0A 3C15B 3LP1B 5ETRA 1U0SA 2VH7A 5KG3A 1NPKA 4ZA1A 3ZZ0A 3SXLA 2C1EB 4DTMA 4KFBA 3C6AA 3Q8PB 1VQ6S 1BIUA 1QM9A 4HACB 3VAJA 4PWDA 4FJ7A 1WC4A 1QLNA 3CCSN 2IVMA 5DMRA 3UCUP 2XS5A 4DMNA 1W9HA 1VIXA 1VK3A 2N4DA 2BH1A 3VGTA 3FSXA 1TK5A 4CJKA 4JBCA 1NK4A 3ULEA 1WOQA 2JEGA 3WIUA 2J6SA 2CG8A 2J9EA 4CO3A 1GMWA 4YFUA 5I4MA 2RQCA 1TVRA 4DR4K 1ILYA 2W8LA 1HYSB 4M5JA 2F4VK 1FEEA 1Q95G 3D0PA 1VAZA 1BI4B 3K2PA 3KG0A 4LRFA 1R89A 1NK0A 2W2QP 3ISZA 1TKTA 4M63A 5BREA 4N41A 1KD1T 2E88A 1PGZA 2EVZA 1E6VA 2OKQA 5DG9A 1WI8A 2MQQA 4YB7A 1XMOK 2BRKA 2MY7A 2RS2A 1A5XA 1VS3A 4CO4A 5C2CA 3W65A 4FW1A 4OYOA 5U47A 3DXSX 2KO1A 3CMAS 2ZH1A 1EXQA 2GMJA 2GVDB 1YT3A 4CRJA 1CJVB 3EICA 1XNQK 3OT9A 2AYMA 2OPRA 4P10A 2HIYA 2VWJA 1S5JA 2YQ3A 4LF7J 4Y2CA 3K8WA 3JAMO 4H4OB 3MURP 4DV0J 2IGIA 2RB7A 3F9MA 4HHTA 3DRSA 3HHKA 3E9LA 4WFAQ 4ES1A 4NYPA 2J7UA 3ZX2A 1A5VA 1RP5A 4CZMA 1WG1A 3ZSWA 2EFNA 1NGCA 1YVUA 2K7KA 3HHNB 1QY7A 4KB7A 1Z05A 4LF4F 3O1LA 1JJHA 4B3OB 1HBOB 2I8EA 1ZM3A 4DSEA 3CJBA 4JKFA 1L3TA 1HQEA 4OMFG 3DFEA 5J1EB 3NCIA 4OPJA 4HTIA 3ILIA 3TJ9A 4I7FB 1T6CA 3M30A 3AD7C 3ATUA 3NCRA 4ED1A 1O51A 4A8WA 1VYAA 4PL8A 1DJ0A 1U04A 1TL3B 4QWBA 2HS3A 3NGUA 5FPNA 3G6YA 3ZZOA 3KD1E 2MLXA 1KCFA 2CPEA 2WVBA 2JDJA 4ISEA 3CCJS 2DPJA 2QKBA 2HBKA 2DRDA 4Q8EA 5D4LA 1G3OA 4RW7B 4MT1A 2FJWA 4IG3B 1YTAA 2CA9A 5HBMB 3OXFA 1GFWB 2O8BA 1BQXA 5HLFA 3DWLA 5CYQA 3THXB 3UB5A 3PX0A 1B7FA 1QSSA 3EGZA 1IKWA 1DQ8A 3LDQA 3NBPA 1JKHB 1OO0B 1ZBUA 1Q86T 3O08A 3NS5A 4BVPA 2VV5A 1NZ8A 1CJKB 2VA2A 3QETA 3M2RB 1JLBB 3NGRA 3TR5A 3OYCA 1XMBA 3VGUA 4CGIA 1M5HA 3BQ0A 2RSQA 2QL9B 4L72B 1UFLA 2CJ9A 1SH2A 2CPDA 2MQOA 3MEKA 1B0TA 2RDIA 1EWRA 5DM6L 4BRLA 3THYA 4PCQA 3MM7A 5F41A 3S7RA 2CQBA 5FROA 3WT0A 2CAJA 3QQCD 2LMIA 3TAGA 3TTCA 4BE0A 1NGAA 4CWBA 2RPIA 1TQLA 5ETNA 2Q3PA 3Q8QB 4OYPA 2O4GA 2P9IB 3KK3B 1LAVA 1WORA 3MGJA 3UVJB 5HMYA 3A1YG 2FHJA 4USJC 4FWPA 4OKEA 3JQJA 2KI2A 4DR7K 2GV1A 2FJDB 5CZVA 2FSKA 1KN6A 3ENVA 2GFFA 3GONA 4X4NA 3ENWA 3SCJE 2R3VA 4QWAA 4UY8T 4AHVA 1QQCA 3JTOA 4LFCK 5BR8F 4I67A 2EHGA 4H5RA 4OZJA 4CF1A 3TNVA 2LQ5A 3GB0A 4ECZA 4KBOA 3KHRA 1RGVA 4MAKA 3EE9A 1N88A 1NH8A 2AJQA 3VR1A 3QIPB 5ETKA 4DV5K 3A3NB 5DK5A 3SI6A 2DO0A 2WUSA 4FVUA 2UXCK 1X4GA 1RDCA 3GSIA 2M52A 2YCHA 1Q5VA 1RA7A 1S9EA 2D0OA 4C8LA 5L46A 1S49A 5KFVA 4ENOA 1KP6A 3PW2A 2AGQA 3ZO7A 4XTTA 1VCTA 3G71N 2WOMB 2H5EA 4DV6J 3D2FB 3L4QA 3LWMA 3BR8A 2XLIA 2HLUA 3GJTB 1WC3A 3D66A 3F0NA 4U7CA 2E5LF 1VSMA 3WC0A 2RH3A 1WF0A 4XH5A 1WJ9A 1I3AA 1Y11A 4LF9K 2C2KB 5HOOA 2KTQA 4KY3A 2PI4A 4OPKA 1W2BM 2APOA 4O4GB 2UXBJ 4EP5A 3KLEB 3R97A 2HWTA 1VQ8N 5F8JA 5D4PA 3MMBB 3CJKB 3CCZA 2V2ZA 4ZVFA 2OFHX 2ZEJA 5HVGA 1IM4A 1CG2A 2OMOA 1V9OA 1SQGA 1LKZA 2VONA 2CJAA 1NH7A 1ZZFA 4O3QA 5KT4A 5HROB 5J2NA 4IOXA 1GLCG 3SEOA 4UQTA 3M8ZA 2CZVC 3FQLA 2E66A 3FFKB 4JUZA 2YX7A 4ED2A 3O3FA 4CF8A 1RHMB 3Q8RB 3K5OA 1U2FA 5THWA 1YJ9S 4DR5F 2B7CB 2FB0A 4GO7X 4CLLA 2LDYA 5KT5A 1RA6A 3JYTA 4M5HA 3HO1A 3U8XA 3O6QA 3NOCA 1YTUA 4B9VA 2VQEK 1EKRA 1FD8A 1X4FA 3M8WA 4DDFA 3KG1A 3M2UB 2FD2A 2LFVA 2YWEA 3C0BA 4W5NA 1Q8IA 3DXKA 1K9MO 5CD4H 4M3RA 1VHFA 2IYGA 1AW0A 5ETVA 4F26A 3SIPB 4NO7A 5KFDA 2ERRA 2P2CB 2P9NA 4QW9A 5GADP 1VGYA 1HX1A 4G6VB 2IDEA 4OYMA 2V4JA 1C0TA 5DDPC 3G0ZA 4GMJB 5E2QA 5HVFA 1RLDA 4DTPA 3MM5A 2DR8A 1C0GA 4FWSA 3UKRA 4HWIA 4ZVQB 2RQKA 2Z4PA 3HOSA 3R1HA 3HK2A 4EU0A 2MGZA 5KFLA 2VUGA 3QGIA 4PPDA 5A8RB 4OJ1A 1QUPA 3W5XA 4ZCLA 2J4RA 5ETOA 2JLGA 5F3TA 4JOUA 4J37A 3JTNA 1E4GT 5BRHA 3FE1A 3L6QA 3CD5A 4DQRA 1SB6A 4KKOB 4BROA 4LFAK 4WIIA 4C3KA 1SJ1A 2CQCA 2VDHA 5KT6A 4F9OA 2Z1HA 1T7PA 2WCXA 2J0WA 2E29A 4PWUA 5GMKa 4KFBB 1TMMA 3AOCA 1XNRF 1MSWD 4H0VB 1FX2A 2FBTA 4HUFA 1HI1A 1SQFA 1RBAA 2FGCA 1IM6A 1JLGB 3GCXP 1S7HA 1NDPA 3Q8YA 1HWLA 4IRDA 4ZIVA 4B3MK 1OJ4A 2VQFF 5JS1A 2IDOA 3DXMB 5CA5A 3HP9A 1LV5A 4ZPAA 1C4CA 1H7WA 5AE1A 3SUPA 4ANDA 4BG9A 3E3XA 2O5DA 4CO0A 3OFGA 4C8MA 4CZGA 2DT9A 4LSLB 1SS6A 1Y10A 1TFWA 5A8WB 2KRRA 1OSCA 2CPHA 4X4QA 1G7CB 1H3DA 1F21A 4IRKA 3QPIA 4ZN3A 4FM0A 1R8CA 2F9TA 3MPUB 2AWZA 1YRUA 2E7XA 2Y1JA 2VG6B 3HLUA 2CGKA 1C0MA 2LQJA 5F1XA 4B9LA 4MKYA 2QJ3A 2IMWP 2FHKA 1RQ0A 4GV9A 2C2RA 5HRRA 2HZAA 1WKLA 3R5AA 1OQ6A 2IMOA 2ZD1B 3QBWA 3Q0AA 3CCVS 2B56A 1C6VA 4CZIA 2OEMA 1LNQA 3VETA 3V5RA 2E1CA 3K7RA 4CEAA 3WDOA 1BA0A 4CIGA 3CCQS 4WXOA 3GCWP 2E5GA 2JVOA 3DLEA 2QL5B 1KVJA 5H9EK 2W6LA 5GAGI 1KTVA 1RUSA 4DV3J 1N36F 4EFAC 4V1Ak 3M6WA 3H2LA 2W1BA 4EEYA 1N5YA 1BWEA 3SAGA 3PJWA 4DQIA 4BQZA 3K59A 3IDHA 4IO9Q 2NRRA 1FERA 4BRHA 3OL9A 3AB4B 2B5JA 2YWWA 1TL5A 1ITPA 3BZKA 3VTIA 1ZM2A 2VOPA 1C2PA 3C6HA 1LWEB 2O66A 4EBEA 4KO0A 1GX6A 1GTHA 5CZ2A 4Y6IA 4DTUA 3AARA 3H6EA 5M1OA 1AROP 4OX9J 3EN9A 2M70A 4FF1A 3D2EB 1RB0A 3BS9A 2HHXA 1AUDA 3D45A 4H0XB 5EX5A 4IJAA 1VDHA 4QR2A 3EE8A 4M41A 2BUNA 4DEZA 4WIQA 2HGMA 1YX2A 1RT1A 2P9KA 2A40A 3SQGA 2R7RA 1S6PB 1AFIA 1DEJA 1ZBHA 1M1KT 5AT1B 2MZRA 3M30B 4FF2A 4ILLA 2YNGA 4OI1A 1FTRA 4MKBA 2HRTA 3QGHA 2IBOA 3CC4S 3HYFA 2J76E 4DCHA 4DSLA 2B4VA 3GFYA 2YKAA 5IT9U 4BC2A 2CGJA 4JD2A 2KT5A 2LQBA 2R2TA 5F0UA 2L08A 2Z56B 4M5DB 3CCMN 1S0NA 2M2BA 1GLJO 1K8KA 4I6MA 1JLCB 1RT4B 3I0SB 4AL7A 2ZGZA 2O8BB 4RUBA 2CQHA 2HS4A 2KL8A 2YKMA 2ASDA 3ISND 1X4CA 2EK1A 4K2JA 4I1TA 3FBCA 4NA3A 1R27B 2OA8A 2PA3A 5C5JA 2NXNA 2H9ZA 2E4LA 4FJGA 4B02A 3QYYA 1SJ4P 4DSKA 4LFBJ 3NBPB 4NXMJ 1X5PA 3BYPA 1RBVA 3S9HA 4G1IA 4DTXA 5B08A 4CLUA 2Y1LB 4Y1CA 1JB0C 1IBKJ 3KLVA 2D1KA 3GIMA 2RF2A 4I2PB 3IP0A 2H54B 2KG0A 2FVRA 5DM7L 3SQ2A 1JWWA 2RUSA 3V9ZA 2XMMA 1X4HA 5EX3A 2YWGA 2LEPA 3DCAA 4HUEA 3TUIC 1GMUA 3MM7B 3TO8A 4DR4F 4PPZA 2QA4N 4A47A 4O4RA 3AO1A 2F4VF 2GS8A 3H90A 3UN5A 3T6JA 4BR0A 2FC8A 3PM9A 4DKWA 3WXIA 1VQYA 4IUFA 1YHQS 1RWMB 3U7JA 4BY9C 2OELA 3WX4A 3DRPB 4DV4K 3NCPA 2IAJB 5LL6Z 4J9SA 2WSFC 2EX3A 4CE9A 2ZH3A 3MEGA 4KC5A 1BWFO 2PFDA 5D78A 4BRCA 2JOQA 2QI2A 1BGXT 1WI6A 2HKEA 3CJRA 1XMOF 1K0VA 1CPZA 3AAQA 3MAQA 3MCMA 5KI6A 4DV6K 3V9SA 2EW9A 4U95A 4E19A 3J7ZO 2Q36A 3VESA 4Z4IA 1YJUA 2B9XA 2V8GA 2YBVA 5E7OB 2AJ0A 2KB2A 2HVEA 1T44A 4FK4A 4BLGA 3L3CA 2G9OA 3ZTPA 4RW4B 1GMVA 2WB4A 4PXDA 2DGSA 9RUBA 4TY9A 3MFIA 1XNQF 2UXBK 2PN6A 2XBPA 2AJ4A 2BE7D 1QSLA 1WDDA 5HN0A 3R3LA 2E1PA 4FS2A 3MPWA 4HCBA 5KGWA 1RWVB 2FLPA 2ZBCA 3S3OA 1S9EB 2B6AA 1KTQA 2HBMA 3NE6A 4FLWA 3KMSA 4A8YA 4AF1A 4M3TA 3NRBA 2DGOA 5L1LA 3FBBA 3BSOA 2CJQA 3IC1A 4UOGA 3T5JA 2W25A 4OZNA 2MKKA 2PC6A 1JLAA 2RD5C 3LW5C 4OJHA 4LF5J 2VFVA 2UUAF 2MSSA 2G8WA 5F8LA 5GMEA 3TEGA 3W62A 1HLWA 1PIEA 1ATRA 1ZBIA 3ZT3A 2WBNA 4JKGA 4Q2MA 3SUNA 1YRXA 2FC9A 4X66J 3JXUA 3BUZB 1WSEA 3ISNC 1SUQB 4CJVA 3HSTB 5B09A 2QL7B 4PYDA 3TAPA 4CH0S 4WQ5A 2IS3A 4AM7A 1T11A 2CGLA 1RZMA 3D1HA 2NREA 3FQKA 1GOCA 1TYQA 3LUYA 1YLXA 3KJQB 5J2NB 3RRGA 3CYMA 2GUIA 4NXNJ 3UW1A 2MZQA 4TYBA 2FZKB 2VBYA 3S01A 3DGVA 4G1PA 2YWHA 3QNNA 3SI8A 3R6MA 1T05A 4RKUC 1CC7A 2XCAA 3P45B 4OYZA 3SMSA 2KXFA 4USWA 2ATCB 4DFJA 1KVIA 4MK8A 2HNDB 1WACA 5EHHA 4CJ7A 2GTDA 4LF1A 3LGHA 2DEIA 4GVBB 2RT3A 3PYFA 2HBQB 4UY85 4AD6A 3A8IA 2FBYA 4RNMA 2EWSA 3ZYYX 3G6XA 3DXKB 1NMEB 2Q2RA 4TXSA 1NM1A 1RDWX 3LP2A 3CO0P 3W8PA 1YIJS 3E1YA 4RW8B 1H6KX 2DTUA 4NZ0A 2HQGA 3PIPL 5IT9O 4G9ZA 1RTHA 3QBCA 2DPIA 2GV9A 1C0TB 3OFFA 4CTAB 3KK7A 1PAEX 1CULA 5GADI 1UL3A 3ZT1A 2DITA 3VQEA 1M5PC 2NUHA 1NKBA 4MIAA 3V6DB 3V81A 3NWGA 2XM3A 4F2SA 4PABA 3MMVA 2YJFA 1HKBA 3G4SS 4A8QA 1FNXH 2W2NP 5HATA 5AQFA 3OJUA 2CYYA 2ZUAA 3NGTA 5KRTA 4NYZA 1XN9A 2ZBIA 3MZIA 1EETA 5AQSA 2Q97A 1OKJA 2WBMA 4A57A 2ZHBA 1ASWA 1EARA 5E26A 3WQUA 4ZVTB 3ZSRA 1PILA 2C2EA 1U1RA 1N0VC 4USUA 2CWXA 4DR7F 3T1AA 4CZKA 4MYTA 4DUYK 4H4KA 3CJ4A 2MEWA 1KVKA 3CD6N 3KLHA 3ZZYA 4X62J 2GA7A 4B3TJ 5E3RA 2LU2A 2UV8G 1H98A 1VISA 2G13A 5GIOA 2DEJA 4JK9A 5J2QB 2CQ1A 1MMDA 4LFCF 3LDOA 3UDCA 2AD9A 4CO5A 5DLFA 5JUMA 2J0QD 3OYAA 1M5SA 4AHSA 2HQFA 3TJAA 1IR2A 2DK2A 2Z2MA 4CJPA 4QR0A 4CEEA 4ECTA 3GG4A 1SIWB 4RNFA 3WEEB 1N48A 2ZH7A 1SIZA 3DAWA 2K1RB 5AQGA 4DV5F 2VWKA 3ENQA 2MJUA 4J9UE 2FLLA 3J80U 3BEGB 2UXCF 1U1MA 2V69A 2POKA 3IFRA 4PA1A 3OR1B 1TELA 3KXDA 3ID6A 5C15A 2CZ4A 3MCSA 1JK9B 1GX5A 5T7LA 1WN7A 3ZFVA 2ZOGA 3B4MA 4EYIB 2L41A 4CNZA 4PQAA 3TUZC 4TVAB 4RWWA 2P9LB 3AA8A 4DR3J 1P90A 4UZCA 2NZ4A 4K8XA 4R0EA 1WG5A 4ED0A 5H9FJ 2OIHA 3HHDA 3P49B 1V3SA 3D7SB 1UZDA 3F44A 3LGMA 1NBWA 1H2TZ 3G8QA 4K5SA 4H0YB 3BN4A 4IQXA 4LF9F 5ELZA 1UWBB 5JMVA 3IUCA 2BM1A 1DLOB 1WHYA 4WP8A 4DFPA 4C9DA 2DGXA 1VQ7N 4ZPCA 4CZCA 4NLUA 5A8KA 4CIFA 3UCZP 2J8SA 3L4IA 3C14A 4CP5A 4BRFA 4MO5A 2ALZA 1VSJA 5I3UA 3AVGA 2Y1IA 2GJFA 1HKAA 3UO0A 5L39A 1WC5A 3VQBA 3EEQA 3OW2M 1AZSA 4X4SA 3IN5A 3GZ7A 2XCPA 5HRNA 2E6MA 2H1YA 3RAMA 4NLRA 1LFPA 4F4YA 2B5JB 1VLOA 3LO3A 1RT5A 4X4VA 2N7CA 1FWLA 2A10A 2MY8A 4QS9A 3VTHA 5KFHA 3AQOA 3RVCA 3GV7B 2RAQA 2DR9A 1U2CA 2VQEF 4ZP9A 3PO4A 1YDLA 2FVCA 1HPZA 3VQAA 5C42A 3KLFA 2CQ4A 1KRPA 1CLFA 3W2VA 5KT7A 2L48A 3ENOA 3QT6A 4FLYA 3NNAA 1UJ5A 2P9KB 2IVNA 4C1NK 2DR5A 1RHQB 4F8RA 1AT1B 4NASA 2QMUB 3SV3A 5C2DA 4FNHA 3ENHA 4H03B 3MPDA 3IMQJ 4LFBK 4NXMK 1CS4A 1HL6A 3G82A 4NB4A 2QWQA 1NNDA 1S1TA 1TL1A 3QFUA 3GMGA 1G4CA 1IBKK 4GMKA 1XMQF 3KHYA 2DGUA 5E3QA 3KLGA 2HVIA 2GMLA 4OLAA 4LR9A 2XLKA 3FCVA 4LF6J 2M8HA 3B4DA 3UDVA 1X9MA 1CLQA 4IXCA 2D41A 4ZHRA 4DL5A 2N3LA 4ECYA 2NPIA 2X7IA 3GWCA 3S3NA 1FDDA 4KHPJ 2VDIA 2C22A 5IM0A 5E33A 2HB5A 4Y3CA 4I6MB 1S5ZA 2FHMA 3POTA 3F41A 3A8YA 3H3NO 1GNKA 3GYGA 1KFDA 4Z2XA 4EI2A 1MW7A 4JS5A 3CCWA 4LFAF 2E5HA 1RLCL 4OX8A 2V2VA 1QZ6A 3H4BA 3VA0A 4ECSA 4F0MA 4KE5A 3ITHA 2YNHA 2EEYA 5J2MA 2FVQA 4FVCA 4ZLNA 1FJ7A 3CF5L 3C6TB 4B3SJ 4CJQA 3FGUA 4BR4A 2QLWA 3R7BB 4RU2A 2RDDA 1CC8A 2MKJA 3D3CJ 5E3PA 1FE4A 3E2EA 1YXQA 4DMZA 1UVMA 1HNVA 4J9QA 1OVQA 1KSPA 3UN2A 2O4IA 2HRUA 4B3MF 3P83D 3L2WA 4QYZJ 3H20A 1IBLJ 1A6LA 1RGIA 2GHVC 5KFOA 1VQ8S 2IYIA 1S12A 1EIYB 3AT1B 1TL4A 2V8VA 4KHUA 4KTZA 2C3PA 1LOUA 1XIQA 2ACYA 2DNQA 1YF5L 3KOAA 1WSHA 5D8HB 5AR0A 5JLHA 1J5EK 3EUNA 3CCRN 3ELHA 5HANA 3TTFA 3O8MA 4O0NA 3H5YA 2ILZA 1NK6A 3MR2A 1D4XA 2A3JA 2YWKA 3X1LB 4WU2A 4LF4J 2RE1A 4OZLA 2IRXA 3DDKA 3Q2TC 2HNYA 5BJRA 2GQQA 2B51A 2DGWA 2W6KA 1TUGB 2HZVA 2BX6A 3MAHA 1NHVA 1EHWA 4TN2A 2X1FA 4OI0A 5AQUA 4EP4A 1Q5YA 4A5BA 4NEZA 3FMBA 1F2HA 3US5A 5K5MA 2CPXA 4B1ZA 4LF8J 4ZJOA 1RTIB 3U27A 3J80O 4DSIA 3WZ0A 1V4TA 2ASMA 3WQTA 2IC3A 1RBRA 1X0FA 3ZXWA 4X66K 4HR2A 4J9RA 4JV1A 5BN9A 4HCCA 1S1WA 3BF4A 5IQQA 4FPIA 3W3DA 1WHXA 4YN3B 3QZ8A 4XH4A 4IO1A 4IWVA 4G65A 1Q9YA 5LOQA 3P8BB 3LQVA 3QSYB 4AE5A 3V9WA 1B7YB 4K4SA 3O9SA 1Q0NA 2B6AB 1VQLS 3OBIA 3R7SB 3NFAA 5FLXU 3H2UB 1V5VA 3M2VA 4LSZB 1L5UA 4M63C 4HI1A 4NXNK 4OZ0A 3NF7A 2A1BA 4CZLA 2D74B 2W4DA 2WTUA 3NDKA 1M5OC 3O9UA 3NH1A 2J5AA 1DARA 2Y3YA 2I2YA 3EDQB 4R25A 4JKGB 1ZTTA 3KWGA 4Q0BA 5GAHP 2N7YA 1CJUB 2D3ZA 3K89A 3OHRA 3HZ6A 1IR1A 4USVA 4J9OA 5KFMA 4HVJA 4HUGA 4CQ1A 1X5TA 2E20A 1WSFA 3CCEN 1M1GA 1QZ5A 4BDZA 4WK3A 1S77D 1Y0HA 3BEXA 1F9HA 2YHBA 1S48A 3AJ2A 4CZEA 5D0HA 3S8SA 2AV5A 3MCPA 2IRYA 2BANB 1YSJA 3W9IA 3PCOB 2YWFA 2P9SA 1S72N 1HKCA 4IH5A 3WNGA 4O44B 1DHMA 5JVGQ 1UP1A 1TUUA 5AXMA 4NOHA 3ZT0A 1FFSB 1CZAN 3THWA 1R3NA 2NUUG 3BBFA 3BPSP 4JI7K 2BR0A 3E01A 5KFTA 2L9NA 3AVCA 3EE3A 4XPCA 4YR3A 4FF4A 3TAEA 1VJWA 2I0XA 4O3SA 1WHWA 3GOIA 4BREA 4KH1B 2HVHA 1X4BA 3CJAA 3MAAB 1KLNA 2W40A 3KYLA 4HKQA 3KNAA 5KGXA 5AQXA 5BR8J 4UT4A 4F0KA 1Y5NB 2X6SA 1QVFM 3L09A 4LRBA 2HQ3A 3F9KA 5FIIA 3VOVA 3I55S 4X62K 4DWIA 4LMZA 3M32A 4A4JA 1F9EB 2VPYB 2FLOA 4KGKA 3L7OA 2FXUA 2V8PA 3ZZPA 2Q6CA 4FCYA 1LFWA 4AT1B 1MWQA 3B54A 1K6YA 3UCGA 1X9SA 4ED7A 3R9LA 3NH0A 1VQMS 4LT6A 4TY8A 3VQTA 4FPBA 3D6TB 3NNHA 2QXLA 4KH0B 4R8UB 2EG2A 3VQ6A 3WBZA 1JJ2R 2LQ9A 1SQEA 1EETB 2VG7A 4OPAA 2YNIA 1QHAA 2ZWOA 4DV4F 4UQGA 3H40A 3H3OB 4CCHA 5B0GA 1VBZA 1FCAA 1RTDA 3TZXA 2E5LJ 3OR2B 3GFHA 5G4DA 3C6UB 2UYTA 2LXUA 1MA9B 3M8YA 3UD4P 3M9MB 1JLFB 4ZP6A 4DV6F 3HULA 2X1BA 3OVNA 2X51A 4CT9A 4MLHA 1UW4A 4CF9A 4J91A 2HRYA 4E2FB 1VQPN 1L3SA 1X3MA 3KFWX 3VAIA 3VAGA 4CHYA 2BE2B 4FWKA 3MD3A 1MWYA 1DY3A 3C19A 1RAFB 1M5KC 1VSDA 3RB6A 5KFIA 3WHIA 3TZYA 1KFSA 3BGRA 1DTQA 1Q8KA 2UXBF 3R9PA 1NB2A 2IFXA 4HEA9 1WB9A 2ADCA 4DQQA 2XNQA 3DLBA 3VVTA 1RWWB 2FLNA 3EZOA 2VKRA 3DYAB 2E8AA 2IBKA 4DBQA 3G86A 3MR5A 4JV2A 3HVWA 4FWLA 2DRBA 4H0OA 2G1HA 3T19A 4DR5J 1Y97A 1W25A 3UDEA 4TLQA 5DETA 2H5IB 3PG9A 4ZVHA 1FI4A 4ECVA 2CJXB 1O5JA 1EP4A 4OQJA 4MDAA 3VQPA 3MX5A 1CEZA 2AJ2A 3AOAA 5LY3A 4PQUB 3I0RB 2PMHA 3R1LA 4DTNA 3SFGA 2JGUA 1U09A 1T8EA 3VEYA 3VGSA 2CPYA 4GVMA 3DOKB 1PC5A 1RKJA 1HBUB 3NGDA 3O9TA 4AILC 1TK8A 3NS6A 4IFYA 3OTCA 3T9ZA 3EVMA 2VG5A 4C1NI 2XY5A 4CNYA 2QYCA 5FLXO 4BRKA 4NMXA 5DS7A 1IWAA 2U2FA 3JQKA 2XRIA 2I7PA 4RBTA 4DX5A 4C4WA 5M2UA 3B78A 4OX7A 2DY9A 1MG7A 3Q22A 4JV5F 1F1BB 2XGPA 4NCBA 1UPPA 1F60B 3GJRB 1BG3A 1WUAA 4X4PA 3IBWA 4BR5A 2X1AA 1HYZA 4EBDA 1RT5B 4CHOA 5A2QU 3M6VA 4CJ3A 3NGSA 5ETMA 3PACA 3PRVA 3FBEA 4M3YA 2WW4A 4LF6K 3I5CA 1T9UA 4F02A 3O1WA 3P6YC 4AHCA 1FKPA 2WSCC 4E7JA 4KHPK 3K5MA 2P6SA 3DMJA 2NS1B 1H72C 2QFIA 2CKWA 4OI3A 3IG1B 1HPZB 4JN4A 1RAEB 3L0QA 1XNRJ 3W0LA 3Q2SC 5GAEU 4TKTA 2F9JA 2WONA 3SQ0A 1HW8A 1BUXA 1DRZA 1MWZA 3L4BC 2ETJA 1JL1A 4F2RA 3LPTA 2JWNA 3LF0A 1VSLA 4OHXA 4LBHA 3NWRA 2XMTA 2QLJB 1LWFB 2E1AA 3A5MC 4JI2J 4B3SK 1S1TB 4KBIA 2VIHA 3AJ1A 2BJDA 3BV8A 3MX2A 4NYFA 3L7PA 1NJZA 1RU1A 2V50A 4FZYA 5BPMA 2P9UA 2OCEA 3BKTA 3QRRA 3NEKA 3VCDA 4Y2AA 1FJCA 1F9FA 2AYBA 4C3MA 1HHTP 2HMIB 3QGGA 3ZSZA 3ATVA 5ETTA 2FYXA 2FIUA 3M9OB 3O8WA 4QYZK 3MUMP 5IM0B 4DR1K 4ZVUB 3G10A 1IBLK 2GWKA 1IKYA 1NU4A 2BV3A 3N6MA 3POTB 1E3MA 1HYVA 2GGPA 5C2GA 2NYIA 3OYDA 2CADA 4I6AA 3ZT4A 3CPWM 3HFVA 4DUYF 1QDUB 3VAHA 1RT3A 4ED6A 3ITHB 1VRTA 3G2XA 3LDLA 4YUDA 3VZHA 1KQFB 4R5PB 2XS2A 4FYXB 1ZM9A 2W2PP 3V6HA 4ATNA 1LOTB 4ZVRB 3LP3A 4NI2A 4FJXA 5A6WA 2R7QA 4X64K 4LY7A 1JNRB 2RRAA 2QMXA 4JV0A 3CT9A 3UKUB 1HNVB 3H1VX 1N8RO 1JXLA 1HNXJ 4HH0A 3CG7A 4DQPA 1T3VA 1LWCA 4CLSA 2WVCA 2PE8A 1VQNN 1N36J 4LF8K 3EDRB 2EG1A 4E1MA 1SH0A 2W9CA 4OV1A 5BXIA 3QLHA 3SQ4A 3ZLJA 4A8XA 3ET6A 1S79A 1FJGJ 3KKSA 2IVFB 5FDLA 2HFSA 3TX0A 3RJMB 5KFFA 5K20B 4DU3A 2D0AA 3D9BA 2OPQB 1BE4A 4KGZB 1S1UA 4IH6A 1HWIA 4YEAA 1TZ0A 3KIOA 4CF0A 1K9MT 4ZDNA 4FF3A 4U8VA 1PO6A 1BQNB 1VOMA 4L6V3 3NH2A 1SXLA 2DTJA 4CYUB 1T9TA 4WF9L 2G2OA 4OPHA 1YJNN 3AB2B 3JQMA 4M8LA 3OYEA 1DURA 3CM6A 4HHUA 4C3LA 4F4ZA 4FOIA 4WF9Q 3CC2N 4NPOA 3QFHA 2F8HA 3OLBA 1PBAA 1MWMA 4CLYA 3HJFA 2O01C 4OKJA 1RT6A 1Z2LA 4URQU 2V8HA 4QQBA 2DPNA 3MR7A 4FSVA 2H51B 4B1VA 3L8BA 1NDKA 3BQ2A 1G6BA 1T03A 2R8IA 1J5OA 3KZBA 1YKWA 2NXJA 3MFHA 1FXXA 4B9QA 4E8UA 4GY2B 3WUHA 3EGWB 3A3PB 3EPIA 5BYSA 2KT2A 2DR7A 4IJNA 3E51A 2VF3A 1U0HB 1Q8LA 1KAXA 3VQDA 1I51B 1EO1A 5KPZA 4OJ3A 4P74A 4I64A 2A6OA 4RL1A 4V19X 1N5VA 3ZTOA 3AA4A 4W5QA 3FVYA 3SSQA 5DGBA 1XC9A 3RR7A 5LXRA 4WBFA 4Q0BB 2DCUB 1REVB 3PW5A 2FBXA 1FW6A 1OVYA 2JWLA 1Q4RA 2MQ8A 2R2SA 2DKOB 1WLJA 1BQMA 5GAHI 2P5GA 1E6YB 3KNGA 4FDFA 2L9DA 3DLGA 2NZCA 2OI2A 3K57A 1N6QB 4L76A 1VHXA 2QWMA 1UOCA 3OY9A 4LFBF 4NXMF 2EFQA 2MZTA 4H5TA 3AAWB 4C0BA 3MM6A 2V94A 2W8KA 4X65F 4NLOA 1U1PA 3P31A 3QEPA 1K8AO 3QO9A 4ZPBA 1HBMB 5DQIA 3Q23A 2Z1JA 1WBDA 1N5QA 5A0YB 3THWB 4QPXA 4ER8A 3DC2A 3OS1A 3PJ9A 3AVLA 4G1QA 2WFBA 3AO4A 3S1TA 4RW6B 2K8GA 2V2KA 3PIOL 3QZ7A 3CJSA 4OV6A 3V4MA 3FKBA 2UUWA 5CYMA 4J8FA 4F3MA 1P27B 1XMOJ 1EQ0A 1VHIA 4MIWA 4PKDB 3PIOQ 3ZSXA 2XLJA 4YMEA 3TQ1A 3FRZA 1NGGA 1HJRA 1Z25A 1GOAA 4HI2A 4I9QA 3DNCA 2PGCA 3AVMA 4CLKA 4I68A 2EKYA 2P1JA 4XPEA 4ZVPB 5AXLA 2PMZD 3MEDA 3CJ8A 1RWUA 1Q78A 1XERA 5HP1B 2KFYA 1FT8A 2OEJA 4MQ3A 5HQMA 4QWCA 5K8PA 4LIRA 2QSWA 4OHWA 2HS0A 5HI7A 1HA1A 2NXEA 3TUJC 4UUWA 2IM1A 3HVAA 1OMSA 2XHBA 3LM9A 4FWNA 1EQMA 5KOXA 4QCLA 1KS2A 2F4FA 3J81Y 4TY8B 3U4LA 3TAMA 2BW2A 1Z1ZA 4ZITA 3PSIA 3GJSB 5C24A 3J7A1 5ETPA 1HNWJ 3A0IX 2YNIB 2A2DA 2C2DA 2GNKA 1J5EF 4AFFA 1TU0B 2ZC3A 5DLGA 1NAQA 2QEXN 4IR1A 3VEVA 1R0AB 2UUAJ 3LP0A 2O8DA 5BR9A 3O1BA 4F04B 3DLRA 5AQWA 3WNHA 3BYRA 2FZGB 4K7QA 1RJJA 1N0UA 5IT0A 2OMLA 3R5BA 3EYZA 3OYNA 4DV1K 1OH5A 3QRPA 3CCUS 2BABA 3U1MA 5DJBA 2FBVA 1RFQA 2HPUA 1FDNA 3I56S 3BGRB 4N8NA 4IFEA 2HW3A 4X66F 1IKVA 1FHTA 4KYZA 4IG0A 3EJMA 3V9UA 3HT0A 3JSYA 3CETA 2CPIA 2EFVA 3R5DA 5IT4A 1XEZA 2BKOA 2PAVA 2P9PB 5ADZA 2F40A 2HBLA 4HDHA 2NXCA 1QQOA 3C7NA 1FKOB 3K0JA 2KU7A 3QNOA 2EBEA 3KJVA 2NRZA 3R8EA 4NXNF 2ALYB 1J2VA 4U67Q 2HAFA 2B9YA 1LW0A 3W2WA 2OSQA 3T6BA 2VGMA 1DGKN 1O13A 3TZWA 3TTDA 2J7WA 1BA1A 2J6TA 3IFEA 3NXZA 2KW4A 5KG6A 3EL2A 3DRRA 2QG9B 2LSNA 3GBTA 1RBLA 4CGFA 4GO5X 2VB6A 4BBYA 2NZTA 1TGOA 3K5LA 3CFPA 3LWLA 2Q3SA 5L9XA 2V0NA 4CLWA 5D15A 2ZDOA 5KT3A 1XNRK 3NG8A 2OO4A 4KH6A 4XDDA 4IEIA 2KVIA 3IR6B 4KHSA 3R5GA 2ZJPQ 4WYLA 3GJQB 1IXKA 4FJ5A 1LW2A 3HHEA 2R8JA 3TZZA 2GX8A 3I8DA 5M1FA 4JI2K 2PD1A 2VJVA 2QT7A 1CJTB 2M4MA 3O9RA 4IDKA 4B9SA 4DTJA 4JI7F 1F6TA 1N4LA 4KGXB 5HL7L 4K4UA 3TARA 1TMJA 1MWKA 2MKYA 3RAXA 3OSNA 2PDAA 3BO3A 4JI0K 4FN5A 3I82A 3OYGA 4GC6A 1WNSA 5DQGA 5D77A 3J7ZT 3D5MA 3DMJB 2PEHA 2Y8YA 4A2BA 2ZJQQ 3HVTB 5HAOA 2WONB 2X3DA 1QE1B 3MXMA 1URRA 1ULRA 4ZIWA 5LJ5Y 4KSEB 4QBUA 2E2QA 3HM8A 1ZA2B 4TSXA 4X62F 4Z0UA 2YX1A 2VBWA 1I5OB 4HYKA 4DV5J 2ZJRL 3VN5A 4CEZA 3MOJB 4Q7AA 3ZEUB 4H4MA 2OD6A 4J9PA 3RMBA 3LH2S 1T9VA 4X4OA 4DTSA 2C3OA 1HNXK 3ZX0A 2HSTA 4RG8A 3UDLA 4CLPA 2WVDA 2UXDF 4ZMMA 4H54A 1BIZA 1R8BA 4FXWA 4CJUA 2U1AA 1K1QA 3CJ0A 3OTOK 1TKXA 3HPGA 4CEDA 1JQGA 1IKYB 3RU0A 3IA0A 4N76A 2J7KA 2GGPB 3JSMA 5K14A 4HL9A 2XYGB 3L2VA 4MFBB 5IQ6A 4CW7B 2D7SA 4CEOA 5C25A 1HKGA 1FFWB 4Y34A 2FY1A 4FPRA 2E7WA 1UVNA 1FJGK 5DDQC 3KHGA 3TX8A 2WRMA 4BRDA 7FDRA 2R2RA 4NI2B 4ANCA 4C8NA 4FYDA 4C23A 2ZC4A 2UVVA 3VQ9A 3T9NA 3CXCM 1HHQA 4QIWD 1RT2A 1NXIA 2LEAA 3EKSA 3CDBA 2ZZMA 2HNZA 2ZM6K 5FRNA 2C3YA 3R8YA 3VV2B 1UVIA 1A5WA 4YQWA 2G8HA 2VICA 3DLKA 2XQCA 2ITMA 1FRLA 2IIRA 2DJWA 2PY5A 4FKXA 5C12A 4CK3A 1B99A 6FDRA 3CCES 5AFUA 5BPNA 1RE1B 1KC8T 3NNCA 1Y5IB 3IS9B 2DGQA 3N6LA 5C2FA 3UQSA 4Z37A 1YVFA 3I9ZA 4O3OA 1NHKL 4LR8A 4DZ6A 5KFNA 2CH6A 4KAZA 1S1UB 1FWKA 1GLEG 1DTTB 2F8SA 4RW9B 3NGZA 1UZHA 2HHSA 2ACMA 2YHAA 4ZTJA 2OPSB 4NLYA 1HNZK 1HHSA 4KTQA 2Y1RI 4ID1A 2UP1A 1MN7A 3SMZA 4DPOA 3O4QA 4YOUA 5KRSA 3F73A 1SJFA 3HRGA 3MXIA 3CE8A 5CCMA 2BDPA 2W4CA 5AQTA 3ZETA 1ASVA 1QS4A 2W7AA 4C8KA 4OYXA 2OPPB 2V52B 4M5IA 1RNHA 2XG8A 4OKKA 1XMQJ 3D0GE 2K06A 3GP9A 2FGOA 1B9DA 1T03B 4DHVA 3KMQA 4LSNA 1WSIA 2YKPA 1NK8A 1N54B 2HMPA 4M5NA 3A2FA 1PJ7A 2B9EA 1NGJA 1VQ6N 2G2YA 1OY8A 2AIRB 3D0IE 3SCKE 2HBZB 2YH0A 3OXGA 2QWRA 4JKAA 4KHRA 3KHLA 1YITS 4JK8A 5KOWA 1CQNA 3BZQA 3IGNA 4U7BA 4DCOB 1X5SA 1ZM4A 4X4UA 4FM2A 2XSJB 2W9AA 4LFAJ 3W63A 4LF6F 5F9LA 2RVJA 5L1IA 3MECB 2I5JB 2KQ2A 2XEXA 3CFRA 4KHPF 1M1HA 3KK2A 1WSJA 4O0IA 1G99A 1FRIA 3FUYA 1MROB 1G1XA 5KG4A 2E9TA 1RAHB 2Z30B 1RAJA 2OTJS 2AW0A 4NLSA 3M1VA 3AA3A 3SJJA 3U6FA 1X8DA 5LT5A 4B3SF 3TJ8A 1BLUA 4B3MJ 1U02A 2RUGA 1OPZA 3C2PA 2VFRA 5C10A 2OD4A 2K7JA 4JB8B 4DX7A 4ERDA 2YX6A 1S97A 4CJ4A 4K42A 4DL0C 2V9KA 2QWPA 1JLQA 2IJFA 1TL7B 2GVZA 2MLYA 4DR1F 4BRPA 1IBLF 4CEFA 1QAJA 3CMAN 4LF2A 5KG1A 4WKRA 1UVLA 3D68A 1HBNB 5HQ8A 2MXYA 3HXMA 2AU0A 3K5NA 3CTRA 4ETXA 5KTQA 5E84A 8AT1B 2JL9A 4O3NA 2BMBA 4QWEA 1HNWK 2MYFA 3BP8A 3RAQA 5HVHA 2VBZA 2NRTA 4X64F 2UUAK 5B0CA 4CJLA 2P9EA 1EKEA 2HURA 1IJJA 1TAUA 3MEDB 4EWTA 1KNZA 3C3LA 5H1SQ 3DM2B 2WTFA 3PNIA 3V2UC 3H45C 4JRPA 5H9EJ 2OANA 2H4WB 3DGPA 2W9BB 4LF8F 5AZIA 2IHR1 2ATLA 3CJ9A 4QJVA 4OX6A 3C16A 4FO0A 3CMEN 2PYJA 1MLAA 2J0XA 2ZH6A 2I38A 1XHZA 5KFGA 1YI2S 4BRNA 4QZVB 3LDNA 3R5CA 2CNKB 1FTCA 1WKKA 1J9AA 4B8AB 4LIWA 4LRAA 5MLCQ 1T0TV 3T5KA 5FPDA 4ED3A 2YHXA 2PSZA 2RHKA 3T1HF 2ZHAA 3KJFB 2DXDA 4M5MA 3AHPA 1U48A 3V4IB 3AD8C 3QESA 1HMVB 3L7UA 4NCGB 4TNOA 3HSDA 4EZ9A 2DISA 3D1OA 5T41A 2PYLA 4LR7A 4CIOA 2OSRA 3L95X 3K9KA 1H2VZ 3MM8A 4U9RA 4K4TA 2QX0A 2MZJA 4NRTA 4URGA 4C11B 2MKSA 3BM7A 4DPYA 5IWAJ 2JEFA 2YV0X 3PKMA 2HFVA 1RABB 1W7WA 4H8KA 2VJUA 2AYEA 3QATA 2Y9HA 5I3QA 5HO4A 1VQKS 3VF6A 5SUHA 3SJHA 4YOWA 3HMJG 2LQ8A 2C2NA 3K2YA 3CO9A 1WTFA 1QSYA 5D3GB 1X4DA 3BH7B 2QLBB 2VYPA 3NAEA 2ROGA 4M3WA 3OV7A 3MMCA 5DM6Q 4GKJJ 1EQYA 4KGMA 3N6NA 3T1YJ 3P1GA 5LJ3Y 1FO1A 1LW0B 2E5JA 3CIMA 3MXHP 3DRYA 4BRGA 4URSA 1T9WA 4K25A 4FKYA 5A6PA 3DOLB 1R31A 3OQ2A 4BWJA 3BSNA 4KV8A 3QIOA 1S0VA 4DN0A 3DRRB 2HBYB 1CZ9A 3QT8A 2PBDA 2RQ4A 2EFGA 2VGNA 3A4TA 3QEXA 1JCGA 4DR2K 2Z1IA 1BHNA 3AJDA 1F2GA 3Q83A 2DHSA 4TU9A 2HAIA 1DAXA 1U2RA 1XJWB 1AXQA 3G8TA 3WNEA 4FJKA 1SKWA 3T5LA 1R6VA 2WBRA 4X84A 2QA2A 2E2OA 2ASOA 3SZ2A 2YNFB 4QW8A 5ETQA 4CESA 1BOTO 2E1RA 2O8CA 5EGYA 3FZKA 3DXBA 3GU0A 2HBRB 4E7HA 4BC4A 3C66A 1U47A 4DR6K 3ILOA 4IDKB 4AHTA 5I42B 1IBMK 3CI5A 1YJVA 4CDIA 2A5XA 3AOBA 3SSSA 2ZZNA 4DV4J 4XIUA 4NZ6A 2QZ8A 5DQHA 1VI7A 2LDIA 1S1XA 3OS0A 5FPEA 1FEHA 5DO2A 3RBDA 3FDSA 3IR7B 4CLZA 1XQIA 2FJVA 2QGFB 4AL6A 1VSHA 4E1NA 5ETLA 2O1PA 3QWUA 3QDKA 5J2PA 3PX6A 4ID5A 1C1CB 2QK9A 4O5FA 1BXNA 3VEWA 1ZAWA 2XMUA 1HFEL 3OBYA 1T3NA 2IVYA 2YXLA 4ALZA 5LSLA 3VWSA 3J7YP 3PJXA 2XZDB 2OZSA 4RWTA 2HWHA 1KVCA 4MH8A 1YBAA 3DOMA 3MM9A 2D3UA 1MMLA 2DFFA 1JJ4A 1NJYA 4NLCA 4PUOA 1NSAA 2AX0A 3AGRA 4RX6A 3U9DA 1SJQA 3MEEB 1ZTWA 4WFBL 2M88A 4DS4A 3RSEA 4QS7A 2XO7A 3LPUA 4B8CA 3R6GB 4NEYA 1TUWA 3OTEA 3QJPA 3OFHA 1TKXB 2MQLA 2GW8A 2F3JA 3CM5A 3TVYA 2HLTA 3Q86A 2ZH4A 1WD6A 4ECQA 1RBTA 3C15A 5K14B 3LP1A 3D28A 2G0JA 1NSQA 5F0XA 3OXLA 2R8GA 2CJBA 3KUEA 3EO3A 4TYAA 4Z4CA 3KK1B 2VCPA 4DG1B 1NHUA 4JHDB 3VPZA 4IRCA 1F3VA 3TR8A 2Q79A 4JI4J 4DV1F 1FNMA 3VGVA 5T7BA 1G2EA 4K4XA 3HM9A 1TV6B 2X1GA 1YJ9N 4UTGA 4ILJA 2CH5A 3L3VA 5HJYA 1S22A 2ASJA 2G0IA 2F8MA 4ZVOB 1MNEA 3B6PA 2BGGA 3HBTA 4A61A 3M8QA 1ZC6A 1HYSA 4A8FA 3NVMA 2M3DA 1C1BA 4MK9A 1NB7A 4JV5J 1BI4A 2JC1A 3BF3A 4A48A 3VMFB 1DQAA 2XO6A 2QO3A 4JI6F 4ECXA 1EKSA 4WU3A 1XMQK 4JK7A 3FJ2A 3D6FB 1UETA 4XAKA 2M9KA 1NDLA 3BSAA 5I3PA 4E7KA 3M3ZA 4D3HA 1A7GE 3AODA 1UVJA 1D1UA 3IO1A 1U6BA 3RZAA 4FYYB 1QVGM 5HRSA 5CZXA 5IFMA 1PBUA 2ABYA 5EWEA 4BDYA 3W61A 1UAXA 2OYQA 2B3TB 3OUYB 4ED5A 4V19J 1IQZA 1F0XA 4J9MA 3D0HE 5LJWA 5K9FA 2GVDA 4CK2A 1CJVA 3HD2A 3IBCB 4RUHA 3M7VA 2NSBA 4EGLA 2CNNB 3DJCA 1P9YA 1Q82T 4PWDB 3NMAA 4O0JA 5GINA 5CE3A 4H4OA 1ITGA 4RCHA 1W97L 1TKZA 2D9OA 3N9UC 4ECWA 4LSNB 3EZWA 4AXIA 3MTJA 4UW2A 2YI1A 3ULEB 4JI2F 2KFZA 1GTEA 3AQPA 4QOTA 4YS2A 1ZYQA 1NEEA 1EJ7L 1TVRB 2HGLA 2HG4A 3FGVA 3PHTA 3G6VA 4M94A 3GR0A 4M95A 2ZOMA 2CIMA 2IM2A 4JI0F 3VAFA 3OYKA 4B3OA 3MHYA 4DUYJ 4LREA 3LZIA 4CFAA 2B4OA 4I9LA 1W0HA 3H5SA 3BF1A 2FVPA 2G2ZA 3KK2B 2W7PA 3DLLL 4Y65A 1TKTB 4AL5A 5J1EA 2CQ3A 3IMXA 4KI4A 1S0MA 4EUVA 5EXWA 1E6VB 3PFOA 4CZJA 4YDDB 3MMJA 2DBBA 3Q24A 2QEXS 2NR0A 1OY6A 1YJWN 1TL3A 1WSRA 3W7BA 1HI8A 4X4RA 2DY4A 2YKQA 4K8ZA 2LXIA 3W8GA 4C97A 4CI0B 2ZOFA 3BJYA 2PFUA 5GAGU 3HL8A 3NCQA 1IG9A 2KKHA 4IO8A 1HNXF 2OPRB 1NGDA 4M5GA 5BPLA 4RW7A 4IG3A 1RISA 1RI7A 2GIRA 1HJOA 2FJXA 5HBMA 2XGQA 3IM9A 4RWXA 4JI8F 4F7VA 3ILJA 3W1YC 3O3GA 3CCVN 3OTOF 3AAPA 2KHCA 1VRQC 1SL1A 1BC6A 3DRSB 2A1SA 3GILA 1RADB 5DRKA 4I0WA 4OFZA 1KXPA 5AXKA 4E98A 1OH7A 1X0PA 3CPEA 1J27A 4RO0A 1BO5O 4ILGB 5KFZA 3FZBA 1JKHA 1FJGF 1VC6A 1OWXA 4L75A 4OI4A 4FW2A 1F5BA 3LAKA 1CJKA 3M2RA 4WYWA 2B9WA 3SBTA 3SQ1A 2Z1GA 2GMHA 4EO6A 3HZEA 5E0OA 5IS2A 4FLVA 1U26A 2ZM6F 1HQEB 2JRSA 2A3ZA 4JKCA 2LECA 2QA1A 2G4BA 4U7UK 1JJCB 4JKBA 1U1NA 4Z7CA 2LA4A 1S6UA 2AEJA 4OHYA 3UR3C 1AA1B 1DQ9A 3RW7A 3MCOA 4YDUC 4QU6A 3AO2A 4BRMA 4U6PA 4X2BA 1YBTA 3ULHA 2F65A 4JKHA 3RBZA 3L9ZA 5KFYA 2P9IA 3KK3A 4ZPVR 3LALA 3UVJA 5IWAK 4Y00A 1S10A 4YY3J 2Q0RA 2WVEA 2LCWA 4NLXA 2W42A 2HHUA 3LPEA 1U1QA 1NOYA 2ZNZA 1LEOA 2J6UA 5LMNJ 1QTNB 2X78A 3AVAA 2LU1A 2YQ0A 3JB9k 4DHYA 3MCAB 1HNZF 3THVA 5HLFB 2PFFB 3HZGA 2HSEB 3CJCA 5CYQB 4WFXA 4GKJK 3T1YK 3EXCX 2PZSA 3NGKA 3CJTA 5KPRA 5AE3A 3HSGA 1IKWB 3BO2A 4B1XB 3QIPA 2V9WA 3W9JA 4YDXA 5CCLA 4ED4A 2RE2A 5E3AA 2Q1LA 3DHWC 4X65J 1SH3A 5IV4A 5IZHA 3K0SA 3FSYA 4PXEA 4FBTA 2JJ4D 4P7TA 5HMXA 5JVHL 4DL2A 4Z94A 2PT0A 3CIPA 1W2BR 2AZ3A 2YPZA 2B4UA 2WOMA 1W7AA 3MPYA 2A0FB 2UV8A 5DM7Q 2KKZA 3THYB 2GHWA 2IPOB 1S9GA 2AP1A 5B0EA 4FLUA 4USIA 5CHIA 2G0CA 3KG4A 3ASMA 2ASPA 2NRXA 3A8JA 2KVQE 5LM7E 4DU1A 4N5SA 3M8RA 1GH8A 4W5TA 4WKYA 3BB5A 3QT7A 2VHGA 3KLEA 3ILLA 1YAGA 4IOCL 4PR6A 5C7PA 3NLCA 3O9QA 1VQOS 1RBSA 2ZF5O 4C6AA 2H65B 2P6TA 2GZOA 4OJGA 4X4TA 1N8RT 2MMYA 3A8EA 5JXSA 3GIIA 4RBVA 2O3DA 1ZBFA 2EC0A 5F2RA 1HQUA 4MJKA 1VBKA 1VQ5N 2PO4A 5L1KA 3JAMY 2WZ1A 3M6GA 3TOQA 4DFKA 1VQ4S 8ATCB 4DL3A 3S3MA 5BRFA 5FRMA 2E2NA 1OS5A 4YHHJ 2GAGC 5AJ3K 1RWKB 4B3RJ 3MK6A 1T02A 3IWLA 4H0PA 3HI9A 4FLZA 4P2XA 1Q7YO 1J5EJ 1EAYC 2H4YB 3TANA 1WUUA 1SQKA 2D0PA 3CFOA 4DOZA 1FWPA 1GXUA 3CMQA 2GBZA 4LC9B 5AQRA 3BO4A 3M2UA 2FJAB 5BYRA 1WEYA 2ZH8A 4KQZA 1Q1KA 3RBEA 1VK0A 1HNWF 4DF8A 4ICLA 5KQDA 1WSVA 1RACB 4JYAK 1R8AA 3HF5A 4WPAA 5J2PB 2MTLA 5EWFA 4ILMA 5JS2A 4F3OA 1X4EA 3ENAA 4ID8A 1JNZB 3V6JA 1N5TA 1QVGR 2OTLN 2XB2D 3ZNJ1 2FQQB 1IV0A 4JI4K 3GLJA 2UU9J 3N4QA 2P9GA 5KG2A 2KLAA 4C8OA 4CHPA 4C0HA 3MM9B 3OYMA 4NA1A 1TFYA 1I39A 3V1RA 5IV3A 2OH2A 5AZJA 4AQYK 4KREA 4PUOB 2N4CA 1Q79A 5A8RA 5DDRC 4DX8H 4LVNP 2LXFA 1MMNA 2ZH5A 1RU2A 3SUQA 3CJ1A 5K8NA 3N5BA 5BYQA 1RBOB 2AEFA 1NK7A 2VOOA 1K73O 3O80A 2AHOB 5AQQA 3CCSS 4KKOA 2MQPA 4JV5K 1K0TA 3X3UA 4DLGA 2F96A 4KPYA 4FS1A 1N32F 3CC7N 3RG6A 4ED8A 1IG8A 1PYTA 3IAS9 2YH1A 3JYTB 5KFAA 3K8VA 1RHJB 4J9NA 4P6QA 2Q6BA 2ROPA 2GO8A 4HT7A 3NVKA 1XWLA 3HHLA 2Q43A 2QRRA 2QYGA 1JLGA 4CVNE 1O0PA 3WXJA 5CYJA 1YRTA 3TSQA 1YJTA 2OHDA 2V34A 4LH4A 3DXMA 4CJRA 4PL7A 1K8AT 4ZS6A 4F4WA 5SWMA 3BGUA 3M8QB 2HWIA 5GADU 2P9NB 4B17A 2BKNA 1XI1A 2ZNYA 2V4JB 1U1KA 1C0FA 1C1BB 4Y0WA 3OL8A 4LSLA 1SVDA 1D5AA 1NLKL 5A8WA 4DZDA 3PIPQ 3T41A 5KFXA 1UA1A 3AXKA 3MM5B 1TKDA 3UKRB 2MPUA 4JI7J 3D3BJ 1YIJN 4TU8A 3P4UB 4ECRA 2VG6A 4DU4A 2MGZB 2EK6A 4DFMA 3DI6A 2O8EA 2AP6A 3MWPA 1KLMA 1F5AA 4CLTA 3HSJA 2JNJA 4B9MA 1PJ6A 4BC7A 4HHJA 3JS9A 3MWBA 4J90A 5IC6B 3PKYA 1S6OA 1SC6A 4CHNA 4ANEA 3G4SN 2ZD1A 1SKSA 4WJBA 2RQMA 4OYAA 2KT3A 3MDFA 4BVOA 3FK4A 1BUPA 3CD0A 4KTWA 3A13A 1UWAA 5GAGP 4DUZF 4DR2F 4IR9A 4ES3A 2OEKA 4B1WB 5KQ8A 3EPGA 2BM0A 4FZVA 4WFAL 3IWNC 4DN9A 3GV8B 4N56A 5TKWA 1VSKA 4R0JA 2HHTA 4NLGA 3GL1A 2D1CA 5CH7B 1TKZB 4CHQA 1K47A 3E9OA 4GV6A 2CPZA 3IM8A