3JYTA

K65r mutant hiv-1 reverse transcriptase cross-linked to ds-dna and complexed with datp as the incoming nucleotide substrate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna complex
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Structural basis for the role of the K65r mutation in HIV-1 reverse transcriptase polymerization, excision antagonism, and tenofovir resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 132
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3jytA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jytA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3jytA05
3U3GA 2QKKA 3OL9A 4Q44A 4FJ9A 3TAMB 3F9KA 3V6DA 1HNVB 3MFIA 3O4QA 1WSGA 3IAYA 1JLEB 2E4LA 2WB4A 5JS2A 2FLPA 1TKZB 2OPQA 1RA7A 1D1UA 2WOMA 4PUOB 4NCGA 1NJWA 1TL1B 3QEVA 1RTJB 1LW2A 4J9RA 3EZ5A 4ECRA 4O3SA 3NMAA 4MIBA 4YFUA 3HXMA 4KAZA 4MKAA 3N6MA 5I3UA 4KB0A 4NRUA 4KTQA 4F4XA 4CHOA 2GBZA 4TQRA 1SV5A 1BQNB 3MEGA 4CE9A 4LH4A 3CJ2A 1U48A 4WE1B 4CGHA 3BSCA 2UVUA 1FKOA 3GQCA 3VQQA 3OYGA 4ZHRA 1ASVA 1TL3A 2GV9A 4FJJA 4CHQA 3CG7A 4RU9A 2FLLA 4I2PB 3O3FA 3V81B 1RT1A 4CJEA 1RAJA 2E9ZA 3G86A 1RT7B 4NZ0A 2OA8A 2P5GA 3TWHA 3VQ9A 5HRRA 1LWEA 1LW2B 4CF8A 4QW8A 2YNGA 4MH8A 1W25A 4ZPBA 1TP7A 4DTSA 5I3UB 1W9HA 3NGIA 5DQGA 4KHYA 3OLAA 1S1VA 2ZE2A 3DLEB 3KLFA 3L3UA 4B9MA 2YNFA 1HYVA 3LP3A 3MEGB 4FJNA 2C28A 1S0OA 3UPFA 5C24B 2W9BA 1RT3A 3RBDA 1ZETA 1D9DA 1FKOB 1S9FA 2ETJA 3BJYA 2G8UA 4ZHRB 1TL3B 1SL2A 4KAIA 3AVGA 4RW9A 2IGIA 2DFFA 4RW4A 3SPYA 4M45A 4Y2AA 5L1IA 4L8RB 2VWKA 3LWMA 3MF5A 1JLQB 3MR5A 1KVAA 2VA2A 1YVFA 4CESA 2I5JA 2BRKA 5KFGA 1S97A 3UIQA 5F8LA 3K59A 1LWEB 4DF4A 3NAEA 4ZVFA 3SUNA 2VG7A 2J6TA 1S1UA 3P5JA 3CDUA 5J2MA 5DK5A 2WHOA 4JRPA 2VWJA 1KCFA 4LQ3A 3KLVA 2ZE2B 2R8JA 1J53A 2YNFB 3NKYA 4DMNA 2X6SA 3JYTA 3H4BA 4ZVEA 4CJLA 4EO8A 3DLKA 1XR6A 3ZSRA 2AU0A 3O3HA 4K4YA 5KFUA 4RW4B 5J1EB 4HCBA 4AHVA 3B6PA 1HQUA 2GC8A 3SI6A 1NKEA 1Q9YA 3T5JA 4RNHA 1JXEA 1ZBUA 2QK9A 4DTRA 4ECVA 2G8KA 2I5JB 3BQ1A 3AVAA 5KRTA 5C25A 2BQUA 4YQWA 4TY8A 3PZPA 2VG7B 5J2MB 1DTTB 3K5OA 4M3UA 2LSNA 4Q5VA 4OL8A 4Q43A 3MECA 4WZMA 2HMIA 1I6JA 4ZMMA 4CGGA 3C6UA 1TAUA 5SWMA 4CFDA 1WSIA 3CM5A 4RW8B 4X2BA 3DYAA 1JLCA 1CSJA 5FRNA 3FSIA 3HVAA 2FVQA 4PWDA 2JGUA 3DLKB 1RILA 2EC0A 3AV9A 4I7FA 4HHTA 5HRNA 4C8OA 4QWAA 4FK4A 1HQUB 1J5OB 1UAXA 3V9XA 4WFXA 2F8SA 3DRRB 4JV1A 4EZ6A 4FM2A 3D5MA 1VK0A 4BDPA 5C25B 5KFNA 2DTUA 1RDDA 4TY8B 3AVKA 4DS5A 3NBPB 2D3UA 1N56A 3VA3A 3SQ4A 1ASWA 3NF7A 2HMIB 2DFEA 3UQSA 4E7JA 1L3SA 2B6AB 3I0RB 5KFFA 2HNDA 4DL6A 3DYAB 3IS9A 3L2WA 3RMCA 3GV8B 1QE1B 3DLBA 5KG6A 1N6QB 4PWDB 1TKDA 1FK9A 3N6LA 3SUOA 4ECTA 1NK6A 4IFYB 4I7FB 4DTPA 1KVCA 4B9NA 3CDEA 4BE2A 3V1QA 3MXJA 4R8UA 2OPPA 4FS1A 4PY5A 4KB7A 4ZP9A 1N4LA 3PW4A 4CEFA 4H4OA 1TV6B 3V9SA 2I1RA 4Y3CA 1C1BA 1C0MA 1UA0A 4ICLB 3EPIA 3LPTA 2KW4A 3TAEA 4O44A 3TQ1A 4W5OA 2D3ZA 3U6FA 4DF8A 4KHRA 3QEPA 3SFUA 1RYRA 4FK0A 2XGPA 1RTHA 3SQ2A 3NFAA 4JUZA 4KFBA 4FLVA 4NLQA 5K14B 2ILZA 1N5YA 4ELVA 2HNDB 3HKWA 4RUCA 2XY7A 4HUEA 4ELTA 4J9QA 3IS9B 3M9OB 1XHXA 3SV3A 2F96A 4KPYA 1FK9B 2IMWP 4DFMA 4TLRA 2IS3A 4R8UB 2YV0X 2IJFA 2G8FA 4ECSA 4XPCA 5KFJA 1S5JA 1VSKA 4H4OB 3P1GA 4C8KA 1JX4A 3T5LA 1C1BB 1IKYB 1GOAA 4FJIA 1ZTWA 3ZT4A 3ZSOA 5JS1A 1XHZA 4O44B 2R8GA 4NYZA 2D7SA 3PHEA 2E9TA 4EZ9A 4O0JA 5L9XA 2AGPA 4CJKA 4C8NA 1YT3A 3NE6A 4KTZA 2R8IA 3AO1A 1NK9A 4B8AB 1N5YB 5DQIA 3RB4A 1C0TA 2YHAA 3ZSVA 1KFSA 1U09A 3LWLA 4B08A 4E89A 1KVBA 2AWZA 1VSDA 4IH6A 3H40A 3MEDA 1LWFA 4KI4A 3QEWA 4FJLA 1QAJA 2V4RA 4Q0BA 3FRZA 2DY4A 2D41A 4FBTA 2W9CA 4K4UA 1KLMA 4CJFA 5KFRA 1D9FA 3QO9A 4I9QA 5KFAA 3LP0B 1TAQA 3VQ4A 1SL1A 4WXWA 3TANA 3OSNA 3HJFA 3VQSA 3RB3A 4DLGA 2IC3A 4DFKA 2PYJA 1HJRA 4ED7A 3EYZA 2G8IA 1X1PA 4EBEA 4YMEA 1G15A 1SH2A 3L2VA 4ID5A 4HKQA 3CJ5A 1REVA 4J9SA 4CHPA 4CGJA 2HHTA 3BGRA 3M9MB 2JEIA 2YNHA 4DU3A 1HYSB 1K1QA 4KHMA 5DG7A 4KHUA 2XY5A 4MK8A 1BCMA 3LAMA 2OZSA 5KG4A 1LWFB 3V1OA 1SUQA 4Q0BB 3VQDA 5I42B 2W9CB 3MXMA 3PO5A 3LZIA 1J54A 3K5LA 1TKTA 3AA5X 1RNHA 3M8PB 3QO9B 1U47A 5KT3A 3MR3A 3PJWA 4CECA 4CGIA 4F4ZA 4CGDA 4QOZB 4OKKA 4NLUA 4FJGA 3OYLA 3HT3A 3S9HA 3AVNA 2ZKUA 3V1RA 1CXUA 1S6QB 1SKSA 4KE5A 1WNSA 2IC3B 3ZCMA 1LAVA 4FJMA 4FXDA 3AVJA 2HNZA 2QKBA 1MMLA 4BE1A 2Z1JA 4ID5B 1ZYQA 1REVB 3FDSA 4CF9A 4HYKA 5C42A 3BGRB 1TKXB 2DFHA 3G6YA 5KT6A 4OGCA 1TQLA 1U45A 4FLUA 3QINA 4EYHB 3PVXA 4ZP6A 4YP3A 2AQ4A 1SUQB 2OYQA 3T1AA 3NF8A 4FS2A 2P51A 1EKEA 4NYFA 5KFKA 2IOCA 4LQ9A 3WNGA 3G6XA 1WSHA 4IH5A 3V6HA 3OL6A 5KRSA 5JXSA 3TR8A 1RDRA 1B92A 5KI6A 4DQPA 4LY7A 3ITHB 4MQ3A 4OJRA 1JLAA 2R2TA 3AVHA 3BQ0A 2HW3A 4DG1A 1R0AA 3AO4A 2O4IA 1C2PA 3KLEA 4CEQA 1NJXA 2HNZB 3OYKA 1QSYA 4E7LA 4YR3A 4DLEA 4DSEA 3PW5A 5EWGA 2OPRB 4FLZA 3TAPA 5C42B 4R5PA 4C8LA 4JS5A 4IFVA 4F4YA 4JV0A 1SL0A 3TI0A 2UUTA 1NOYA 3HPOA 4K4TA 5SZTA 5T14A 4NCAA 4CEEA 2YHBA 3GV7B 2NUBA 4IRDA 1VSMA 4LSNA 4FBUA 3PX6A 3OYFA 3QZ8A 1JLAB 3LAKA 3K5NA 3QIPB 3LP1A 3RMDA 1S1XA 4O5BA 1R0AB 4K4WA 4J2BA 4Y2CA 4J9OA 3H5XA 4URQU 1BISA 3V6KA 3V6DB 3T19A 4Z0UA 4BWMA 2RDIA 4J2DA 2V0NA 4FVMA 2OPQB 1NNDA 4MFBA 2WOMB 1DLOA 4NCGB 2FVSA 3KK3A 1RT5A 2XI2A 2HNYA 4FLYA 3H98A 3SV4A 3HYFA 1JL1A 4IFVB 3CFOA 3ULDA 5KT4A 4RZRA 3GYNA 5CY4A 3QLHA 1SV5B 1K1SA 2KZMA 3TABA 1U04A 1RDAA 1RT2A 1JL2A 2JEJA 3OVNA 4E1MA 3F73A 1DTQA 4LSNB 4LD0A 4RW6A 3NAHA 4QAGA 1C0UA 4Z4CA 3QESA 3KJVA 1S1XB 3T5HA 5CZ1A 3OYHA 3N6NA 3IRXA 2FBVA 4TXSA 1RT1B 1LW0A 4M42A 2XWYA 2QE5A 3K2PA 2JC1A 1DLOB 1NHVA 3MXIA 1IG9A 1RT5B 2HNYB 2YNGB 4CHZA 3P83D 1YTAA 3GILA 1T05A 2Y1IA 3IG1A 4CIFA 3PW2A 4Q8FA 1S1VB 3OS2A 4TQSA 3EY1A 3AVLA 1JLFA 3KLFB 3KHLA 4O3RA 3RRGA 3O3GA 5KFIA 1TVRA 5KFPA 3QLHB 1Z26A 3L8BA 1ZTTA 4K50A 4LH5A 3NH2A 4RW7A 2W9BB 1IKXA 5HRPA 1T94A 4AHCA 1UA1A 1RT2B 1RT3B 3DRSA 1S48A 1DTQB 4NLXA 4E1NA 2ASLA 3KLHA 1VSEA 2HHUA 1C0UB 4B9TA 3KJVB 3LP2A 4RW9B 1L3TA 1BIUA 1S4FA 3KHHA 3S3NA 3H5SA 4DFJA 3DMJA 2HHXA 2HHWA 3IRXB 4DSIA 4IDKA 5F8HA 2ALZA 1LW0B 3UDLA 3HO1A 2Q3SA 3GIMA 2BE2A 4CEZA 1GX6A 5J2PA 3H59A 4JV2A 2B4JA 4CCHA 1S1UB 3I5CA 3NAIA 1RBUA 3CO9A 3PO4A 1KHWA 4DL2A 5DGAA 4FW1A 3VQAA 4DQQA 4NLYA 3IG1B 3AA2A 1RT4A 1LAWA 3G6VA 3V9ZA 4TYBA 2IM1A 3DI6A 1TVRB 4ZTFA 1U49A 1IKXB 3JYTB 1C1CA 5DG8A 2IA6A 4CF2A 4F8RA 2WCXA 3GV5B 3VQPA 3V9WA 3KHGA 4B9VA 3KLHB 4WXOA 3HVTA 2WTFA 3FQKA 3M8RA 4OGEA 2XY6A 2RF2A 2O5DA 1NKCA 1EETA 4ZP8A 1HMVA 1KLNA 3G0ZA 4KV8A 4IDKB 2BR0A 4K4XA 3KD5E 5L1LA 3AO5A 2XO7A 3SUQA 2BE2B 1BQMA 4TY9A 5L1KA 4Y1DA 2C2RA 3QGGA 4MIAA 1KSPA 3HP9A 3QERA 1O1WA 4KTWA 3ICLA 3MECB 1SH3A 1RT4B 3WNHA 4N47A 3C6UB 4M3TA 1BHLA 3S3MA 1RTDA 1NKBA 2W42A 1RYSA 3DI6B 4J9MA 5KFXA 3QYYA 4J9LA 2HHVA 1JLCB 3C94A 3VQ5A 5HP1A 4CJWA 5FROA 1RTIA 3KNAA 3I8DA 4LSLA 3AO3A 4BDZA 3I0SA 4DQRA 3OYCA 1S9EA 3WNEA 3NL0A 3OY9A 5KFZA 4U7CA 2AJQA 3PR5B 4KV8B 1JXLA 3RB0A 3C95A 4GW6A 4AILC 1LV5A 3FFIA 5KG5A 1IKWA 4J9KA 3HVRA 2Z1HA 5KFDA 4O4GA 4M3YA 2IDOA 3OSPA 3NDKA 4ZPDA 3CVKA 4RNFA 4CJUA 3ISNC 1RTDB 4ZTJA 1B9FA 1CXQA 5L1JA 1ZBIA 5FRMA 5HP1B 1X9MA 1VSFA 2HHQA 1FKPA 4ED2A 1N48A 2B5JA 1RTIB 1SKRA 3I0SB 1XI1A 1S9EB 3UR0A 4ECUA 4IOBA 4ED0A 3KK2A 3NCIA 3QETA 1VSLA 4QWCA 2OPPB 4Z4GA 3NH1A 1FXXA 1C6VA 4DL7A 2HB5A 4HTUA 1S49A 4K8ZA 2FJVA 2OZMA 3FFIB 2XRIA 1CZ9A 4IG3A 1IKWB 5CZ2A 4XIUA 4M41A 1QSSA 2XCAA 4NYNA 4F50A 2YKMA 5D3GA 4CJVA 1T7PA 3D28A 1RTHB 4FK2A 2AX0A 4MK7A 3PY8A 4FLTA 3NGZA 1RBVA 3RR7A 4BACA 4KFBB 3BREA 2Z1IA 3LZJA 2E6LA 5KFSA 3I5AA 3ZT1A 4OLBA 4E0DA 3GIKA 3DDKA 4AH9A 5EDWA 1FKPB 4IR1A 2B5JB 4J2EA 4NLDA 4CJ3A 4J9NA 2GIRA 5F8JA 3V6JA 2OPSA 1KFDA 1B9DA 2BGGA 2DPJA 3KK2B 2X78A 4J2AA 4QPXA 5J2QA 2ZD1A 3SCXA 3ZSZA 1S9GA 4O3OA 3OJUA 4JRQA 4TYAA 1A5XA 4ECXA 1D8YA 2BQ3A 5KG1A 4CFAA 3VQ6A 4DU1A 4IG3B 4OPKA 2KZZA 4OPJA 1VSHA 3TVKA 3KD1E 5DGBA 3H08A 2KFNA 1HARA 1BI4A 2D5RA 3KLIA 3AVMA 3D45A 1NJZA 2VA3A 1RT6A 4DL4A 1C0TB 4ZP7A 3ZSQA 3BSAA 5DMRA 4NLWA 3AO2A 3MTKA 1SKWA 3PR4A 3MEDB 3DLHA 2A1RA 2OPSB 3ISND 4KB1A 4Z4EA 3GIJA 1NK7A 1KLMB 5EWFA 2ZD1B 1S9GB 3L2RA 3KLGA 4DWIA 4IR9A 4CJRA 4DU4A 3HPGA 4XO0A 4F2RA 1WSFA 5KFOA 3PV8A 3NH0A 3RAXA 1U4BA 3QIDA 2JC0A 5KTQA 3CDWA 1GOCA 4DQIA 3PUFA 4IRKA 4B9SA 4N41A 4NLRA 3BR9A 1TGOA 1WN7A 3QEXA 1BI4B 4DS4A 4FJ7A 4HUFA 4KI6A 3VQ8A 5HLFA 3RAQA 1WLJA 4M3XA 3L2UA 3K5MA 1RT6B 2AGQA 2FBXA 4I9LA 2XY8A 2HWIA 2YNHB 2YKNA 3Q8SB 2R2RA 4IKAA 4ED1A 1NK0A 3IGNA 1JLEA 3THVA 3O4NA 4DSLA 2ASDA 4JLHA 1JXBA 3LPUA 2KQ2A 4M3RA 1WSJA 3OYMA 2XCPA 5KFYA 1NK4A 3SYZA 1TKTB 2Z1GA 4GC6A 3KLGB 3PX0A 3JSMA 3NF9A 3OS1A 4HCCA 4CEBA 1OS5A 4O3NA 5KFWA 4CJSA 3V9UA 3VN5A 4IH7A 3CYMA 4KHNA 4QWEA 1NOZA 4H4MA 4PQUA 1ZBFA 3MAQA 4Y34A 5KG7A 4WE1A 2FJWA 3HP6A 2JLEA 3RTVA 3NF6A 1JIHA 3IN5A 4K8XA 1VSIA 3L3VA 3PX4A 4K4VA 1JLGA 1KTQA 1L5UA 4OLAA 2WRMA 3PW0A 1Q8IA 2G8WA 4I2PA 4AHTA 3V81A 4DSKA 3BSOA 3DLRA 4GMJB 2FVCA 1NJYA 1RT7A 2UVVA 4FJKA 4CFBA 5CYMA 4KSEB 2D0AA 2IAJA 4BDYA 4JS4A 3KOAA 4CHNA 1NK5A 4NCBA 4DL5A 3JSMB 4WFZA 2D0BA 1S6PA 1QUVA 2O4GA 3IGVA 5T7BA 2UVRA 3M8SA 1YVUA 4F4KA 2B43A 2YNIA 3U3YA 3KMSA 2BRLA 1CZBA 3DLEA 1GOBA 1UWBA 3OS0A 4KO0A 4DG1B 4H4MB 5HBMA 4PQUB 3OLBA 2GIQA 2C22A 3KLEB 2PYLA 4IG0A 5C24A 1S0NA 1Y97A 1TK5A 3VQ7A 3Q8QB 2DPIA 3H2LA 4CEAA 4QWDA 3T3FA 4GVMA 3OHAA 2IJNA 1JLGB 3AA4A 2VG6A 4R5PB 3DLGA 3PJXA 1TK8A 2R8HA 4AHRA 1JLQA 1Z25A 5KFVA 2F8EX 2W7OA 1RCHA 4MK9A 3D0PA 3HK2A 5CYMB 3PW7A 4CIEA 4U6PA 2HVIA 2IAJB 2QV6A 5FDLA 3HHKA 3L2QA 1VRTA 4KKOA 4CK1A 4WYWA 1S6PB 3SJJA 2EHGA 4KREA 4FLXA 2FC0A 2YNIB 1QTMA 3LP1B 3RMAA 2UVWA 3Q8RB 1UWBB 1S0MA 4KO0B 5HBMB 3KHRA 5DLFA 4IG0B 3AVBA 2ATLA 4K4SA 1T03A 5F8IA 5KGXA 2W8LA 5KGWA 3OYIA 4DSJA 3LANA 2E9RX 3VA0A 4CIGA 1JLBA 3SUPA 1KRPA 4MFBB 5CYQA 2XGQA 2BANA 1GX5A 2EX3A 2GUIA 3QGIA 5DLGA 3LALA 4KHWA 3KK3B 3A2FA 5J1EA 2VG6B 3HM9A 5KT2A 4ECQA 3DLGB 3KTQA 4NLOA 2IBKA 3DOLA 4WYLA 2G8VA 3BDPA 4MKBA 5EUHA 2BQRA 3BSNA 4DTMA 3I5BA 1BIZA 1XR5A 5KG2A 5FDLB 2PZSA 4CJ5A 2XC9A 1HYZA 1VRTB 5KFHA 1RA6A 4KKOB 1DTTA 1XWLA 4IKFA 3DOKA 2R2SA 4URSA 4RW6B 4ED6A 3TAGA 3KK1A 1RDCA 2FVPA 2CJQA 4O4RA 3VQBA 4ZVHA 2C2DA 1WAJA 3HSTB 4CHYA 3CJ3A 4RW8A 1ZBHA 4DFPA 3QGHA 1J9AA 1T03B 3OHBA 4M95A 2FJXA 1HQEA 4H54A 4Z4FA 4NRTA 1JLBB 2ZQBA 4ZPAA 1WSEA 4FZZA 5CYQB 1QAIA 2BANB 4AHSA 2R7YA 2AX1A 4TN2A 1VSJA 3BQ2A 4BE0A 4FLWA 1J5OA 3DOLB 4ECZA 3OYJA 1T05B 4DTOA 4HUGA 3DRRA 1I39A 4E19A 1JLFB 2D0CA 4O0IA 3Q8PB 3NGDA 4E3SA 4DTNA 3ASMA 4RNOA 1S1TA 4RW7B 1QS4A 5KG3A 3RBEA 3OJSA 1TK0A 3NBPA 4EBCA 3DRSB 4EYIB 2KFZA 1ITGA 1WAFA 4YR2A 3TAQA 3DOKB 3KIOA 5KFTA 3KK1B 2RDJA 3LP2B 5KFEA 2B6AA 3I0RA 4I2QA 3CFPA 4B3OA 1RBTA 5DG9A 4J9PA 3SNNA 3MR2A 4Q8EA 3DMJB 4KBIA 1ZBLA 4FM0A 4W5NA 4EBDA 4FW2A 3TAFA 1QE1A 1BCOA 3KKSA 3OL7A 4FJHA 1HQEB 4DTUA 1N6QA 1W0HA 4OKJA 4IFYA 4KRFA 1D0EA 5F9LA 3VQCA 4H8KA 5J2PB 4N56A 3ZSWA 4ZVGA 4NLPA 3RWUA 4R0EA 5EWEA 1T8EA 2QXFA 3QZ7A 1TV6A 4YNQA 3CJ4A 3RR8A 4ICLA 4RUAA 1LWCA 4CFCA 3T5KA 1KHVA 3H5UA 3LDSA 3S3OA 1S1TB 4F3OA 3ZT0A 1C1CB 4NLTA 2FBYA 4IQXA 4ZPCA 4G1QA 4TSXA 4B9LA 1EX4A 3MFHA 4DSFA 2RPIA 3HVTB 4W5TA 4FCYA 4DQSA 4CEOA 5K14A 3NGYA 2RF2B 3QNNA 4I2QB 4B3OB 2FLNA 1EETB 1L3UA 2JEFA 4M94A 1NHUA 4RG8A 2Y1JA 2CKWA 1CLQA 3ZSYA 1HMVB 3SQ1A 3SI8A 4CF1A 2W8KA 3AVIA 5EU7A 4CJ4A 4O3QA 2XI3A 4ED8A 1BQMB 1WNEA 4OKEA 1UOCA 3E01A 4C8MA 3H5YA 5C5JA 3WNFA 2X74A 3TARA 3MEEA 1IKYA 1LWCB 5KT5A 3ZT3A 4UQGA 4QW9A 3OYAA 3H4DA 2R8KA 1X9SA 1I3AA 3FQLA 3HL8A 2G8HA 3RB6A 5F8NA 4G3IA 4G1QB 4Z4HA 3E51A 3MR6A 2A1SA 4LSLB 5HRSA 2F8TA 3V4IA 4EO6A 1C1AA 4CJQA 3K58A 2FBTA 2BDPA 2V4QA 4DEZA 1K6YA 5KFCA 4CJTA 2OH2A 2J6SA 5DQHA 3KMQA 1IKVA 5J2NA 4F2SA 5KFLA 2ATQA 3SPZA 1QSLA 3CWJA 1S10A 1RBRA 3E01B 1HPZA 4O4GB 4DTJA 4N76A 3CM6A 3SQ0A 3EPGA 4KHQA 3LP0A 3MEEB 4CERA 4CK2A 2RKIA 3SZ2A 4FZYA 4WZQA 5E41A 1XR7A 2WONA 1VRUA 2R2UA 4CJPA 1ASUA 4NLSA 4HVJA 3CFRA 1IO2A 1A5VA 2ILYA 4FJ8A 3V4IB 4URGA 1D5AA 2P1JA 4WFYA 4NLGA 4Z4IA 1IM4A 4E7KA 4Y1CA 4BWJA 1HYSA 4QCLA 3NHGA 5JUMA 5KFMA 3DM2A 3K57A 4CF0A 1IKVB 2JEGA 5J2NB 2IM3A 2V9WA 2AGOA 3OYBA 4W5RA 4DTXA 1X9WA 1F21A 1HNIA 1XC9A 2HHSA 2VG5A 4B9UA 5I42A 4FYDA 3G10A 1Q9XA 4EEYA 4CK3A 4IRCA 3ALYA 1HPZB 3M8QA 1BL3A 5F8MA 2YKMB 5D3GB 3M8PA 3EZUA 3HVWA 5HROA 1EP4A 1BGXT 2IM2A 4AHUA 2RKIB 1SH0A 4ED3A 1S1WA 2WONB 4NLVA 4QWBA 4Q45A 4O55A 1VRUB 1HRHA 1S6QA 1RDBA 2W7PA 3RRHA 5F9NA 1IH7A 1Z4UA 4E7HA 3CQ8A 2WK4A 2ITGA 4ELUA 3OYDA 5J2QB 3QEIA 1TKXA 1NK8A 3RMBA 1EXQA 4FJXA 1MU2A 4ECWA 3DM2B 3DRPA 3QNOA 2PY5A 3GIIA 2HAIA 4PA1A 2HVHA 4B8CA 2UUWA 4IBNA 2E6MA 1HNIB 1YTUA 2VG5B 4M3WA 3OYEA 3CJ0A 4CEDA 3M8QB 5KG0A 4FM1A 2P5OA 4FJ5A 4F4WA 4ECYA 3KLIB 2C2EA 3C6TA 4YR0A 5HROB 1EP4B 4O3PA 3ITHA 4XPEA 4W5QA 1JKHA 2IM0A 4K4ZA 1S1WB 1QQCA 3TAMA 4OVLA 3QIOA 1HNVA 2KTQA 5KT7A 1TKZA 4PUOA 3OL8A 5F8GA 1TL1A 4EP5A 2HWHA 1T3NA 2OPRA 3AVCA 4ID1A 3ZT2A 1RTJA 4DL3A 2FVRA 4RNMA 1MU2B 4RNNA 2ASJA 3DRPB 4M3ZA 4EP4A 1A5WA 2W9AA 3KKRA 2J6UA 4E7IA 5KFQA 1BQNA 3VQEA 5KFBA 4CGFA 3CIZA 2XHBA 3HPHA 3AA3A 3AVFA 4KHSA 5HLFB 2RN2A 3OYNA 3C6TB 3QIPA 1RBSA 3B6OA 4GC7A 1JKHB 3M9NB 2X6NA 3ZSXA 4N5SA 4F3TA 3SFGA 1L3VA 1QHTA 4FZXC 2YKNB
chains in the Genus database with same CATH superfamily
4MIWA 2QKKA 4JYAK 4Q44A 2IVMA 3D0HE 3TAMB 1HNVB 2HHPA 3O4QA 4WKYA 3IAYA 1JLEB 5JS2A 1E6YA 1H1VA 1M90T 2MZJA 5AQYA 1K9MO 1D1UA 4PUOB 4NCGA 4KR0B 2CJBA 2BUNA 4J9RA 2YPZA 3JTNA 1IBKJ 5M1NA 4JI3J 4MIBA 3MMCA 2CA9A 3N6MA 3S7RA 4CTAA 5EY4A 4KTQA 4MMOA 3X1LB 1HNWK 3MEGA 4CE9A 4LH4A 3CJ2A 1U48A 1XC3A 4GVBB 3VQQA 3OYGA 4YS2A 2M7SA 2QLJB 1HWIA 3F2KA 3ELHA 3NOGA 5DM6Q 3CC4S 2XMJA 4BR2A 4M5NA 1WORA 2MQLA 3O3FA 1E6YB 1U25A 4F0KA 4IJNA 3PSIA 2OA8A 2VC0A 3W63A 3VQ9A 3DNCA 2XMWA 1LWEA 4DR7F 4QW8A 1G3OA 1R3NA 3MMCB 4DTSA 2POKA 1W9HA 5H9EK 3NGIA 2F1FA 2D4WA 3PDNA 1U0SA 4AQYJ 4B9MA 2N3LA 1OYEA 1GLJO 3MEGB 4C97A 3OA9A 2G8UA 1HNZJ 2P9LA 3FZHA 1T11A 1QVGR 1BA0A 3W2WB 3KG1A 4RW4A 1YK9A 3SPYA 4Y2AA 5CH7B 2D0OA 1VBZA 2BH1A 2VWKA 1B7YB 1VBXA 4NZ7A 1JLQB 2WVFA 3FNNA 2NPFA 2DHXA 1NGGA 2B51A 2MXYA 5KFGA 4Q7AA 2VQEJ 1S97A 2Q2RA 5F8LA 3K59A 1LWEB 4DF4A 3QJJA 1KC8O 3V2UC 3HOTA 2J6TA 3P5JA 5DK5A 1PSDA 3EM1A 2VWJA 4OYBA 1KCFA 3U7JA 1S76D 5F0WA 5AQJA 1V3ZA 2UXBK 5HATA 1SI9A 1YJVA 2LA6A 1FO1A 4K7QA 2D3O1 3H4BA 4IOCL 4ZVEA 3RGIA 1FI4A 5I3QA 1XR6A 1MDUB 4FPIA 4FYVB 3MD1A 3J8AA 4QZVB 4RW4B 5J1EB 2OIHA 3SI6A 2B7BB 2Z58B 1Q9YA 5JJBA 2QGFB 2QK9A 2G8KA 4ECVA 5C25A 5DJBA 2UUAK 3VV2B 1P1LA 1CJTA 1ZXOA 4WF9L 1QAYA 3OTOF 1SJ4P 1DTTB 3FZFA 3H46O 4M3UA 2KJVA 4Q5VA 4OL8A 3MECA 2QRRA 1N34K 1O8BA 3KJQB 4JEPA 5LXYA 3MUVP 3W61A 4CFDA 1ZAWA 1H2TZ 4LF2A 2XS5A 3TTFA 3AAPA 5FRNA 3HHNB 2GVZB 2LA4A 3CERA 4I7FA 2Q31A 2NXJA 3Q24A 4B3SF 5HRNA 3HSZA 4C8OA 1DARA 2MSSA 5IT9Y 4FK4A 3W66A 4UW2A 2HFOA 4OYWA 4B1ZA 3VEYA 3DLLL 2GHWA 1N54B 3V9XA 4DPXA 3NP5A 3NS7B 7FD1A 1UFKA 5C25B 2ZUGA 3ZNUA 1U1LA 1FCAA 2MMYA 2G2YA 3VA3A 3NGKA 2HG4A 4JV5J 3GG0A 3SQ4A 1KNZA 1BDGA 2F7VA 1OVQA 2DFEA 3UQSA 2B6AB 5A6PA 3PNIA 2CQ4A 1QDUB 2N3OA 2NZ4A 4HHHA 1TKDA 3SUOA 4IFYB 4I7FB 3LM9A 2MZTA 4DTPA 1W7AA 4JI8K 1VQ4S 1MWYA 3V1QA 3MXJA 4NI2A 4PY5A 4BS2A 4KB7A 4CEFA 4QQBA 5FJ4A 3CPWM 1NM2A 1C1BA 3K2YA 1UA0A 2UU9K 1TZ0A 4EFAC 2M0GB 2QG9B 2C3OA 2ZHBA 4K5SA 1RWUA 4UUWA 2HHHJ 3WBZA 4HACA 2O8DA 1PBUA 4FK0A 2XGPA 1RTHA 3NFAA 4DV5K 2HEKA 4FLVA 2R7RA 4W4MA 4NLQA 3C2PA 2ILZA 1N5YA 1F5CA 2V51B 2Q0UA 1FDBA 2J7WA 4HUEA 4ELTA 3J7AN 3SQGB 4AYBD 2F96A 4X62K 1HI0P 4KPYA 5HVGA 2G13A 4J9UE 1WKKA 3MPUB 1XMQJ 5CHIA 4QIWD 3LL3A 4NI2B 4OJ1A 1SVDA 3BBBA 5AQKA 1C1BB 2KVIA 1GOAA 4WFBL 4JK7A 3ZT4A 1Y9OA 3RU0A 1FEHA 1OH8A 4KH6A 3E8OA 4PXEA 2QLBB 2E9TA 4HACB 2O8DB 3A8IA 2ZOFA 2RHQB 4O0JA 2ZZTA 4DB3A 4CJKA 4C8NA 5ETLA 1XMBA 2XMMA 1FJ7A 4LF9K 4CJ7A 1VOMA 4ZPWR 1N5YB 2YHAA 2YWEA 2P9UA 5A6WA 2F9WA 4ZN3A 4C0BA 4EFHA 2HBKA 5HO4A 3O9RA 2GAHC 1KVBA 4E89A 3MEDA 4UOHA 2DYAA 1LWFA 3QEWA 4FJLA 1QAJA 3NCRA 1JJCB 1WD6A 3HHEA 4CLZA 3M6WA 4WPAA 2CJKA 2VU5A 3QO9A 3FUYA 4U8YA 2R7UA 3VQ4A 3OSNA 4DPYA 4DV3J 3Q23A 3A3OB 3CCSN 5D15A 4JV5F 2XZWA 4DLGA 4RR5A 4DFKA 2F4VJ 3T6BA 3EYZA 4EBEA 2Z2LA 4YMEA 2PI4A 2FZGB 1REVA 5LJ5Y 4CHPA 2YX1A 2HHTA 3BGRA 2YNHA 3DFEA 1NNEA 2DHGA 2NPIA 1ZM4A 2UXCK 3A0IX 5KG4A 1LWFB 2DRAA 3VQDA 5I42B 3PO5A 2CQGA 2AYBA 2ATCB 1G1XA 2U1AA 3L9ZA 3QO9B 1U47A 1XNQK 3PJWA 4D3GA 4M5IA 5JMNA 2E5IA 4CGDA 2YWFA 3CMEN 1KQSM 4HH0A 2HHHF 2YH1A 4OKKA 4DCPB 1K8KA 2GGPA 3HT3A 3S9HA 3V1RA 4F9OA 2IJRA 2WUSA 1CXUA 5AJ3J 1H38A 4YY3F 2QWPA 3P96A 3GFHA 3BYRA 4FXDA 2HNZA 1XNRJ 1MMLA 3Q2TC 4BE1A 2Z1JA 1O6XA 5F1XA 1IBKK 1REVB 2GNKA 3BGRB 3G6YA 1TQLA 2GJIA 4IYQA 1U45A 3LF0A 4ZCIA 1VDHA 3PVXA 4ZP6A 3OV7A 2YWGA 3T1AA 2UZAA 2P51A 2QWQA 4DV2J 4ID8A 4ES1A 2IOCA 2YPYA 2E5LK 4IH5A 3V6HA 3OL6A 2YXLA 5JXSA 2R7WA 1PILA 1B92A 2BW7A 4G9ZA 1RHQB 4LY7A 4MQ3A 3JQKA 4FWNA 1OSCA 5AE3A 3ZTPA 2XYPB 1DRZA 1RP5A 3MPDA 2V4JA 4ATNA 4CO1A 3TA0A 2HNZB 3OYKA 4Y28C 3NMRA 4DLEA 4DSEA 2CNOB 2BEFA 4R5PA 2M70A 1FRXA 4F4YA 4JV0A 2JSXA 2ZHOA 1YJRA 4UZBA 2RD5C 2UUTA 2ZJPL 3N28A 1D09B 4K4TA 4DV3F 3CJTA 5E0OA 1HNZK 5F41A 3CCSS 1VSMA 1HWUA 5DM7L 2W41A 3QZ8A 4IEIA 2F4VF 1EARA 2DXFA 2DR5A 2RVJA 3AOCA 5B0FA 1UZDA 4WYBA 1F3FA 1YSJA 1KVJA 5IWAJ 1VJWA 2FHJA 2IDLA 3OVAA 1AFJA 2L9WA 5ETMA 3MUTP 2ZBQA 2FVSA 4I6MB 4H03B 1NGHA 3SV4A 2H4WB 1ZBTA 3HYFA 1YZ6A 5HL7Q 3CFOA 5HJXA 5KT4A 1PYTA 3JAMO 2B9WA 4DX7A 1ELOA 2PIIA 1KN6A 2VDHA 1WG5A 4A46A 2KZMA 3TABA 3CW2C 3CMES 3VGLA 4ILRA 1RDAA 4RUBA 3OVNA 4E1MA 3HCXA 5A8KB 1DTQA 4K2XA 4LD0A 5AQNA 5JVGQ 1N32F 4QAGA 3R2CJ 3B8AX 4LF6K 2J76E 4LRCA 2VPZB 1YGYA 2EXUA 3N6NA 3I32A 1H6KX 4QR1A 2FBVA 1RT1B 2K7KA 1XMOJ 2XWYA 1TUWA 1NB7A 2BM0A 3AA8A 1NHVA 4PKGA 5ETSA 4JHDA 2PGCA 4L72B 2IBOA 1SJ3P 1VHXA 1YTAA 2V8GA 4DV2F 1WI8A 4YDUC 1T05A 2KKZA 3KLFB 3KHLA 3H42A 1TVRA 4NPOA 5IT9O 2ROPA 1ZTTA 2W9BB 2O8FB 2J5AA 1JJ2R 1DTQB 2DO4A 3CGIA 5LJWA 5ETNA 1S4FA 4WFNL 3HZGA 1F5AA 2HHXA 2ZH5A 5MLCV 4IDKA 4KC5A 3J7Z5 5G0RA 3UDLA 5L8RC 4PPDA 2P9PA 2BE2A 1GX6A 4JV2A 2B4JA 4IDHA 2AD9A 2XHWA 1LCUA 3PO4A 3VQAA 4DQQA 1T6DA 4LR7A 4FW1A 2H3EB 4A8YA 2LFVA 3D66A 3MWBA 3VMFB 1TVRB 2GJFA 2DIUA 2B4PA 3SBMA 3JYTB 1WBDA 1RSCA 3M5RA 1RHRB 3VQPA 3V9WA 3KHGA 3PTWA 4WXOA 1LNQA 1GAOA 3P4UB 1ULRA 4M1KA 3I33A 3FQKA 3B82A 2KLAA 3CC2N 2O5DA 3SXLA 2CFXA 4ZP8A 3TOQA 2K8GA 3M8ZA 2ZJQL 1KLNA 1EIYB 4KV8A 4IDKB 2DGOA 4BRAA 5M1QA 3DXSX 1B99A 2BR0A 5G0RB 3AQPA 3KD5E 4UTGA 2P9PB 9ATCB 3Q86A 2BE2B 1BQMA 2WSCC 3CJRA 4Y1DA 4BRIA 1T9VA 3PG9A 1YX2A 3HP9A 2MB0B 3VAFA 3LPYA 4DX5A 3KHYA 4KTWA 4HWIA 2BZ2A 2LEAA 2YQ0A 1HKGA 2DGSA 2P9NB 2X51A 5MAOA 2GAGC 4N47A 5C2CA 4ZLJA 3WNHA 3OTEA 3C6UB 1NKBA 2W42A 1RYSA 5KFXA 1HBMA 1OO0B 3HFZB 1JLCB 5HP1A 2ZM6K 3CHWA 1R6YA 3GLJA 3I8DA 4LSLA 3IXQA 4DQRA 4PQAA 1S9EA 3OVBA 4A5BA 1YAGA 5ELZA 1OY8A 2PMWA 2AJQA 5EHHA 2RUSA 4OV6A 4K0KJ 4JK8A 4KV8B 4HVZA 1JXLA 3POTA 4GW6A 2WVEA 3IAS9 4CW7B 5KG5A 1JCEA 2NXEA 5ITHA 3HVRA 3CDBA 3DLJA 5AQZA 2Z1HA 4O4GA 5CR4A 1Y10A 4ZPTR 3SAFA 3NDKA 2HK3A 3BS9A 4U9RA 4RNFA 4FP9A 4ZTJA 5GAEP 1JXVA 1HBMB 1YIJN 3C6AA 5HP1B 2A3ZA 2C3MA 1N48A 1EWQA 2XYGB 1ITPA 3VCDA 1S9EB 4ED0A 4LRAA 3KK2A 1VSLA 4Z4GA 3NH1A 1HW9A 4HH1A 1RXOB 2IYIA 2HB5A 1HWLA 4HTUA 3AAWB 2VPXB 1S49A 3MDFA 3POTB 4K25A 2E1YA 4IG3A 2G2ZA 4HHJA 5CZ2A 4A47A 2W4CA 2ZJRQ 2RNEA 5D3GA 2OMOA 3EVMA 2UXBF 3VF6A 4MK7A 2FY1A 4HEA9 3QMLA 4JKDA 4KFBB 1HBUA 4ZCMA 3JAMU 2YKOA 4E0DA 5HN0A 4NEZA 4J2EA 4WIQA 3CC2S 4CH7A 4J9NA 2HZCA 2MQ8A 5F8JA 2OPSA 2G1HA 3KK2B 4QPXA 2E2PA 2ZD1A 1FNXH 3ZSZA 2R7TA 2VFSA 3OR1B 4WK1A 4TYAA 1A5XA 3CXCM 2VONA 3J7ZT 3D2EA 3SAHA 1D8YA 2BQ3A 2JFKA 2V63A 4CFAA 5AJ3K 4X4VA 4IG3B 1CZAN 1RFQA 2KZZA 3QSIA 1FJGF 3VENA 5LT5A 1KVIA 2W2OP 3G87A 2M4MA 3H08A 1BI4A 4JI2J 1NJZA 3D45A 1HBUB 2MZSA 1RT6A 1PAEX 3HHLD 1C0TB 4ZP7A 3VGSA 2DO0A 3ZSQA 3BSAA 4Q2LA 2OGUA 2UXDK 4WBFA 3MTKA 1F9HA 3PR4A 2FUG9 3FZMA 2NRZA 2OPSB 3TZZA 3CPEA 5FLXO 1VQ6N 4B1XB 4Z4EA 2E5JA 1NPKA 4LSZB 1LQ9A 1U0HA 5IQ6A 1T6CA 1KLMB 3H8YA 2ZD1B 1G2EA 4CLWA 1UEVA 4LRBA 3L2RA 3KLGA 4IR9A 3AD7C 2C2OB 1RADB 1NSPA 2P9EA 3D2EB 4DU4A 3T69A 2BJ9A 1K73T 2Q6CA 2QA4G 2R42A 4NXNJ 3MR7A 2CQ2A 4LFBJ 3QIDA 2JC0A 1GOCA 3TTDA 3KDOA 1I3OB 3D6RA 1YKWA 2DXEA 1RWOB 1TGOA 1WN7A 3QEXA 1T9YA 1BI4B 5HLFA 1E4FT 1YIJS 2A40A 2EWHA 5ETVA 1RT6B 1HNXF 2FBXA 1W2BR 2VWBA 2XY8A 2DNZA 4Y2IA 1F2GA 3I82A 5M1PA 2R2RA 4UQTA 2VBWA 2LU1A 4Y6IA 4ZJQA 2DR9A 1VC6A 3FEXB 4ZITA 3O4NA 2BOPA 2ASDA 3GU0A 2PC6A 4J37A 5EOYA 1U0HB 2XYHB 2XCPA 5KFYA 3SYZA 3QRPA 1VMBA 2W4DA 3KLGB 2HQFA 2YH0A 3NF9A 5D4NA 3TEHB 4YHHJ 1OS5A 2Z56B 2E1ZA 3V9UA 3VN5A 3OBIA 2CPDA 1NOZA 2UUCK 3GR1A 2J9CA 4Y34A 4BC2A 2FJWA 1AXQA 2JLEA 3RTVA 3NF6A 1A7GE 3CMQA 4ILGB 1WC0A 1X5SA 4LF5K 1CEZA 3PX4A 4X62F 5IZHA 4QBUA 1VSIA 3L3VA 1L5UA 3WXKA 4USMA 1Y5NB 4OLAA 4OHZA 5HMXA 2NLWA 1NO8A 4OQJA 3PW0A 4K41A 1Q8IA 2G8WA 3BSOA 4GVLA 2W25A 2VZ9A 2P6SA 2AW0A 4AXIA 3IWXA 4KSEB 1N36K 2J0WA 1J2VA 1NK5A 4NCBA 1S5ZA 2D0BA 5AR0A 3IGVA 1MWKA 4N8NA 1X4GA 3SDEA 2OP5A 4USTA 2C22A 1OH7A 3W9HA 4LF9F 3KLEB 5C24A 3BBFA 2YJFA 1G6BA 3EE3A 4KGKA 3VQ7A 4BRGA 5HOOA 3TZWA 1FDNA 3F5TA 2CXEA 2FJBB 2F4FA 1FDDA 3FCVA 1GLAG 4DR2J 3OXFA 2VG6A 3UDEA 1RK8A 1VQ6S 1JNZB 4AHRA 2DVIA 3P6YC 2F8EX 2XEXA 1TUYA 3P5TL 5H1SQ 3CCUN 2N4CA 4LFBF 1J6ZA 2F65A 1VRTA 4KKOA 4BR5A 4ERDA 2EHGA 5G4DA 1LEOA 4FLXA 4RWXA 2I0XA 3LP1B 3EGWB 3SDEB 3ATVA 3VAIA 3KHRA 3PHTA 1YJTA 3M6VA 3AY0A 4DSJA 3LANA 3FGUA 4JI1F 3SUPA 4LIRA 3W9JA 3JSRA 3CD0A 3MZIA 2GUIA 3A2FA 1YLXA 2VG6B 2HFUA 5KT2A 4K59A 2UYTA 2BQRA 1HL6A 1RLCL 2V68A 5LMNF 4Y2MA 5J1PA 1X3NA 4ZS6A 4CBWA 5KG2A 1PC4A 4FNHA 4CJ5A 2AP6A 1VRTB 5KFHA 4KKOB 3EO3A 2YX7A 4RW6B 1VQNN 2ZKTA 2FVPA 2CJQA 5EVZA 4ANDA 3VF0B 4CHYA 3EWGA 2VASA 4P2SA 3PM9A 4DFPA 1ZBHA 3WXLA 8RUCA 3HD2A 2VF3A 3G71S 3GBTA 1Q78A 2PBDA 2CWXA 1B3TA 1WUAA 3GWCA 4AM7A 1VSJA 3BQ2A 4ZVTB 1VHFA 5ETQA 1J5OA 2QLFB 4ECZA 4CZMA 4O8UA 3TSPA 4DUZK 2CWKA 4H4KC 5F0XA 3I8BA 1JLFB 4O0IA 2E5LF 4OJ3A 5CE3A 3NGDA 2DGXA 5FLXU 4RNOA 2IVOA 5LL6d 1OQ6A 3O2IA 3JSYA 3DRSB 1P90A 1ITGA 3TAQA 4YUDA 3KIOA 1X4FA 5KFTA 2RDJA 1WDDA 3I0RA 5DG9A 1N88A 3M2UB 3MR2A 4K0KK 4KBIA 3E66A 4YOVA 4DR2F 1FWLA 3W3DA 1BCOA 2VJVA 3KKSA 4FJHA 4DTUA 1N6QA 4QOTA 3MM7A 1D9AA 1IV0A 3VQCA 3TP2A 5THWA 4RWTA 4ZVGA 2KXFA 4WIIA 5LM7E 4R0EA 1S3XA 1VQSA 2NYHA 3CC7N 3AFGA 3QZ7A 1TV6A 3CCUS 4YNQA 3CJ4A 2LXIA 3RR8A 1YBUA 2G2OA 4JI5J 3I31A 1H73A 3O9SA 3BBCA 4KH0B 4F3OA 1C1CB 3LDPA 4TSXA 3TTCA 1EX4A 2W2QP 3B4DA 4OHXA 4AL5A 4LFAF 1NRKA 2RPIA 4FCYA 4NMLA 4DQSA 3SCIE 3NGYA 3EGVA 1EETB 1L3UA 1ATRA 2CG8A 4M94A 4C3MA 4RG8A 4ETXA 1CLQA 2GTDA 3ZSYA 2JWKA 4CF1A 2HVDA 4PAAA 3CB4A 3Q7BA 2QFIA 2GIFA 1HJOA 3U02A 1T9UA 3VESA 1UOCA 1FE4A 5KOXA 3K5PA 2EKNA 1IBMJ 3TARA 5BYQA 2LQ9A 2V7ZA 3HL8A 3AB2B 3GG1A 1DFDA 1VQNS 1SC4B 1DAXA 1S4EA 1VGYA 3E51A 3PIOL 1X9JA 3D6TB 4PG6A 2A1SA 1Q0NA 4A4JA 4EO6A 3C16A 1DGKN 2RJZA 2DNYA 5KFCA 4CJTA 2OH2A 2J6SA 2E7VA 5B0BA 1IKVA 2XZDB 4WQ4A 1DT9A 1PYOB 3SPZA 3NOCA 3CWJA 1YHQN 2WVCA 2B9EA 4JI2K 1MROB 4WP9A 5LY3A 3EPGA 3NMUA 3BR8A 2M8DB 1RTZA 3WQUA 2RKIA 3H1QA 3TSQA 3CCVN 2HBJA 3R5CA 4OYAA 4QU6A 4CJPA 4UOGA 4NLSA 4HVJA 4CZFA 1H3DA 1A5VA 2CUYA 2ILYA 4C2MA 1CC7A 2VUGA 1HBNA 1D5AA 3W1YC 3C16B 5AFUH 3AJDA 2ADBA 4Z4IA 1IM4A 1DURA 4BWJA 1HYSA 2FHOB 2ZH2A 4C8ZA 4E2FB 4CLUA 1IKVB 2ZH1A 2G0JA 2IM3A 1NXIA 3TRGA 3OYBA 1Q7LB 1PC5A 3G10A 1DZ5A 4M7YA 1NU4A 1N33J 9RUBA 1BGXT 4AHUA 2RKIB 3J7YU 3QFUA 3E9LA 3RRHA 2JJ4D 1Q82O 4NWBA 3I56N 1OPIA 4OI2A 3CCRN 1RB0A 3OYDA 2QWLA 1NGFA 1EXQA 4ECWA 4JAXA 2MLYA 2QSWA 2HVHA 4DHVA 4PA1A 1T9XA 2UUWA 3BZKA 4OIXA 4IOCQ 2QFJA 2BJ8A 1F9FA 1SC1B 3H6EA 5IV4A 3KLIB 3IMQJ 2NRHA 3ITHA 3A3PB 4W5QA 4K4ZA 4NB4A 1K8AO 4OYMA 2ZM6F 1M0SA 1CS4A 5IFMA 3UNYA 4RL1A 3J7YI 2KTQA 3MM5A 1QM9A 4LUBA 3OL8A 3CF5L 2B8QA 1TL1A 1Q8BA 2OPRA 2FHMA 2BJ3A 2ASJA 1YHQS 2JVOA 4B3TF 3VHQA 3BH7B 2ROGA 3KKRA 3VGVA 3VPZA 3WIUA 1IJJA 1BQNA 2CDQA 3N0VA 3CIZA 1TYQA 2XHBA 3QAEA 3WIVA 3CCVS 2DRBA 3TQEA 3R6GB 2FC8A 2W6KA 1RCOB 3QIPA 3B6OA 4GC7A 2BTFA 4X65J 3AGRA 3QT8A 1ROFA 2YKNB 4H5VA 1CS4B 2GELA 3GFZA 3DLLQ 3U3GA 4NO7A 3CCMN 4GV6A 3MFIA 3MM5B 2YVSA 1FD2A 4AF1A 2E4LA 3H90A 4U8VA 1RGIA 1RA7A 4BREA 2WOMA 1TL1B 4LF8F 2CQHA 4ECRA 3ZX3A 4FF4A 1WOOA 1HI1A 4MKAA 5I3UA 3KUGA 4ALZA 4NRUA 1VQ8N 4LFCK 2GBZA 4F25A 5DZ7A 4TQRA 4DCHA 2ZZMA 4BRFA 1BQNB 5H9FK 1E3MA 4WE1B 1TYQB 5DDPC 2P9IA 2UVUA 2Q43A 3R7BB 4JOUA 3TUJC 1X0PA 2Y9HA 3MGJA 4DR3J 4WJBA 2I6WA 4YDXA 4WQ5C 1H74A 4NASA 1TL3A 2GV9A 2CJXB 3I56S 5RUBA 4CHQA 5JLFA 3CG7A 3CCRS 3MCNA 2A10A 1WF1A 2K1RA 2YTCA 2MPUA 4F0MA 1RAJA 3G86A 1NGAA 1RT7B 5HRRA 1DY3A 2UUBK 4MH8A 4ZPBA 2VQFJ 3SCLE 4C48A 5I3UB 2M9KA 2H4YB 2W6LA 2ALYB 5DQGA 1I94J 2BJDA 4RLEA 3ZX2A 1CULA 1YJNS 1S0VA 2IVFB 3O80A 4I1TA 3UPFA 4L74A 4CBXA 4ZOSA 2P9IB 3QPIA 1RT3A 4G1IA 3L7PA 4CT8A 2DNQA 4NX9A 4EK2A 4DR6F 1TL3B 4NL5A 1O51A 3RSEB 2UXDF 3MCMA 2DFFA 2IGIA 3VEVA 2FB0A 1RU1A 3OTBA 2K1RB 3CD5A 3LWMA 4Y2KA 1QY7A 3MR5A 1U24A 2I5JA 3MDQA 3UIQA 3OTDA 3Q22A 3NAEA 4IO8A 2LMIA 3W5XA 3CDUA 5J2MA 1GEHA 2DNLA 1Y64A 2HURA 2F7TA 3CJ8A 2J9DA 3LPEA 2VODA 1J53A 3NKYA 4DMNA 3CCZA 2E1PA 2X6SA 4HR2A 1Q7YO 3LDLA 4CJLA 2KH9A 4GKKJ 4AE5A 4EO8A 4JK9A 3DLKA 4IQMA 5K8OA 3BKUA 1V5IB 3O3HA 3CCMS 3J81O 4CBUA 4M5KA 2ZBIA 4HCBA 3THWA 1VLOA 3B6PA 3CULA 3P39A 1KWMA 3MD3A 1SJ1A 2I5JB 2Z0GA 1TL7B 4LRFA 1UVJA 4MKYA 2H48B 2BQUA 1NDLA 1IR2A 1Y3KA 4TY8A 3PZPA 4C3KA 5J2MB 3ID8A 1RACB 2LSNA 4Q43A 2UUCF 4JI7K 4RCHA 1I6JA 1IR0A 2I8EA 5SWMA 5FIIA 3DYAA 2VBYA 4QPTA 3HVAA 4LF5F 1CBKA 3C7NB 2JGUA 3DLKB 2EC0A 3D2FB 2EC2A 2AMCB 4U7UK 2XNRA 3THWB 1BC6A 2AEMA 4G65A 1UAXA 2CPFA 4CYUA 1N36F 2F8SA 3DRRB 2MQMA 4DI6A 1SBRA 5A76A 2EFGA 3GIRA 4OI4A 4TY8B 4WTOB 5SUHA 1EX8A 4JKBA 2D3UA 4J7CA 1Y00A 4HDGA 5C15A 3PIPL 3A5LC 1EAYC 3OR2A 1L3SA 3P49B 2F9TA 1S7IA 3VGMA 2WW8A 2VBZA 3DYAB 3L2WA 3RMCA 2HFSA 4W98A 5HJYA 4ZVPB 3CCJS 3CDEA 4BE2A 1WELA 4R8UA 2OPPA 1OQ3A 4ZP9A 3HBTA 1ZA2B 3EKSA 4H4OA 3V9SA 4PYAA 1WACA 1QQOA 4CZIA 4CYUB 4ICLB 3EPIA 4BRCA 3VAJA 3TAEA 2HVEA 5GADU 5AZIB 1VJQA 3QEPA 3SFUA 1HIYA 2Z2YB 3SQ2A 3U1LA 3GCWP 3WX8A 4JUZA 3MN6A 1UKUA 1U1NA 1U1QA 3HZEA 2VPYB 5EX0A 3FJ2A 4GKKF 3JXUA 5K14B 3OR2B 4ELVA 3NS6A 2X1FA 3JQMA 3HKWA 3CJAA 1X4AA 2V9KA 3CDAA 4BC7A 3M9OB 3SV3A 1RWXB 1XHXA 2R7SA 2BJEA 1MN9A 3D7EO 2ZJPQ 4DFMA 2IS3A 5GIOA 4R8UB 1GH8A 3G82A 2G8FA 5KFJA 1S5JA 1U6ZA 3J80Y 1N33K 3RUBL 4H4OB 3P1GA 2HS0A 1TL5A 5HVFA 3T5LA 4MO4A 5E5NA 1NPPA 4XDDA 4F3QA 1IKYB 4FJIA 4YN3B 1ZTWA 1NZAA 1HI8A 3PACA 4C8YA 1FXRA 1NGEA 3D1OA 5D0EA 2D7SA 1EJ7L 4EZ9A 2JDJA 5GADI 3NE6A 1UJ5A 3VAGA 4OFZA 1Q5VA 2R8IA 3LGMA 3M3ZA 3V4MA 5CCLA 3OBWA 2DISA 3ENAA 3A8JA 1U09A 1VQPN 1VSDA 3H40A 4ZK7M 5EX5A 2FHJD 2GA7A 2Q1LA 5AE2A 3G82B 3DOMA 4DUZF 3HJVA 4I9QA 1TAQA 3TANA 2QM1A 5M2RA 1YF5L 3HJFA 4YOTA 4A8SA 1CJKA 3VQSA 3RB3A 1NDPA 5E3RA 3R5GA 4F4AA 2IC3A 2PYJA 1HJRA 4HDHA 4ZDNA 3F56A 1ATSA 3L2VA 4ID5A 4P72A 2B7CB 3M9MB 2JEIA 2WC9A 3S01A 1K1QA 4KHUA 4DCJB 1OY6A 1BCMA 2V6AA 1SQFA 3WXJA 1WB9A 2HKEA 1ZOTA 3SSSA 3VQTA 1WKLA 2YKQA 3T1YJ 5C12A 4NA1A 5AQGA 3BM7A 1ZZNA 2D9OA 3DN9A 1TKTA 1Q81T 3OPKA 1WBBA 3AA5X 3M8PB 1EB0A 3MR3A 4X65K 3OXLA 2GO9A 4WFNQ 1CJKB 1SKSA 4KE5A 2RSQA 2IC3B 2VH7A 1P8ZA 4ITSA 1RJJA 2MGZB 1XTZA 1X5PA 2QKBA 3BGFA 1RHUB 4ID5B 4CO2A 1ZYQA 4C7QA 1SPBP 2V50A 5LSLA 4X4PA 1TKXB 2Q66A 2DFHA 1BUXA 3CCTA 4OGCA 2D3OR 5BPMA 3LW5C 3C0BA 4X4SA 2CJYB 2AQ4A 2QMXA 3NF8A 2BKNA 4FS2A 3F9MA 4DR4J 5A2QU 3WNGA 2PMHA 3G6XA 3AXMA 4DU7A 2OD4A 4DR3K 3QATA 1UVLA 3TR8A 4KHPK 4X64J 3RAMA 5AQFA 1C0FA 4OJRA 1RKJA 1JLAA 1ZPVA 3AVHA 3BQ0A 3CQXA 2NRXA 2HW3A 4KYZA 1BU6O 4DG1A 4DN0A 3AO4A 5K9FA 5GMKa 3A8YA 2ZJQQ 2O4IA 4YB6A 3S41A 3VAMA 2ZVSA 4LF1A 3HRGA 3I4PA 1K9MT 3UO0A 4P7VA 1RBLA 1NJXA 3SAGA 4DV7K 4H5NA 4E7LA 2RHSB 2XLKA 4CZKA 2VQFK 1VQPS 2LKZA 4OZ3A 4JS5A 2VD3A 1VQ7N 4OHWA 4ZCLA 1SL0A 1I94K 2P2CB 2E5HA 1V4SA 3TI0A 4LR9A 3FKBA 3DHXA 2B3TB 4CO3A 3OW2M 5SZTA 2VJUA 1XJWB 2LQJA 3RBXA 2YHBA 1HKAA 3BGLA 4H5RA 4IRDA 1X5OA 1BXNA 4HTJA 2CJ9A 5A0YA 1JLAB 4BQLA 2P9KA 1VHIA 3RMDA 1S1XA 1YRUA 2ZOGA 1U8WA 4O5BA 5CA5A 4K4WA 4J2BA 3MOZA 4Y2CA 3BDEA 1BISA 3CJ7A 3V6KA 3V6DB 1AW0A 2OEKA 2ZJRL 2RDIA 2E1AA 3BEGB 1PJ5A 2OPQB 1NNDA 2D74B 4PG8A 1DLOA 4IOAQ 4TLQA 3UN3A 1Z6RA 3H98A 3ZFVA 3T1YF 1S72N 1JL1A 2CQ1A 1AZSA 1D8ZA 3GYNA 3IFEA 3AJ1A 3IUCA 5CY4A 3QLHA 1SV5B 2VFUA 5D0HA 4NXMK 5D6GA 1RT2A 3FSYA 1RWMB 2VKRA 2CQCA 3NAHA 3KWGA 3QESA 5M2PA 1RAOA 1S1XB 3M05A 3HHLA 1NU0A 4OLPA 4M5LA 4TXSA 1QQNA 2ZWHA 2CGKA 1LW0A 2RB7A 4M42A 3K2PA 1KC8T 1DLOB 1WEZA 1VQ9N 1QVFR 5E33A 2Y8WA 2JOQA 2YNGB 1NBEB 4DV0J 1UCNA 3P83D 3AD9C 2CRLA 1S1VB 3EY1A 3ZZPA 3PRVA 4FWKA 1AZSB 1R7IA 3QLHB 3L8BA 5AQQA 4LH5A 3C65A 5HRPA 1T94A 1KTVA 3A4TA 1RT2B 3UCUP 1T44A 1XQIA 4E1NA 1B4SA 2ASLA 1VSEA 3RVCA 3TO8A 3E9OA 1RE1B 3LP2A 4RW9B 1L3TA 3HHLB 1WWHA 1BIUA 3S3NA 4AD6A 4DV1J 3DMJA 3R7NB 1DEJA 2X3DA 3HKZD 4DL0C 1LW0B 4BLGA 1PJ6A 2Q3SA 3GIMA 1VQ7S 5J2PA 4ZLNA 3A13A 3O3LA 1S1UB 2YQ1A 3NAIA 1RBUA 4A8OA 5DGAA 2CNKB 4AL6A 1RWNB 4JI4K 3AA2A 3VF4A 3G6VA 2AZ3A 4OZJA 4EGLA 5FPMA 2OSQA 4FWPA 2XSJA 2IA6A 2GQQA 2WCXA 3GV5B 5AXMA 4B9VA 2A5XA 2EBGA 1MA9B 3HVTA 2WTFA 3LTOA 4OGEA 4Y0FA 2HS4A 3BZCA 1CC8A 4RBVA 2FC9A 4FL9A 1JJHA 3LGHA 1Y11A 2FSKA 2Z4PA 4EIAA 5L1LA 1T3OA 3HM8A 1S72S 2XO7A 2JVRA 3WC2A 4TY9A 5L1KA 2ZGZA 3C19A 2C2RA 2VIHA 1UFLA 4LFCF 2IVNA 2X3GA 3Q2SC 4DR1K 4M3TA 3S3MA 1RTDA 3QFPA 2BUPA 1IBLJ 3VF2A 3QYYA 1EZZB 4I56A 2XSJB 3HTVA 4CJWA 4KGZB 2ZEJA 4BDZA 3R5DA 3KYLA 3TJAA 3WNEA 2F9DA 4JI0J 4OYXA 5DZ6A 2ZH9A 1P1TA 1VQ9S 4DV0F 3ZZUA 4AILC 1LV5A 5A2QY 3FFIA 5LMUK 1HKBA 4UZCA 3C15A 1IKWA 3D1HA 1I5OB 2QEXS 4UOFA 3DWLA 3UD3P 1BLUA 3GDQA 4OX9K 3ISNC 1RTDB 1IXKA 1B9FA 1CXQA 3T41A 1ZBIA 2CH5A 3TA2A 3CJKA 2HHQA 1KAXA 1BQXA 3H3NO 4DV1F 1SKRA 4LJMA 5ETKA 4IOBA 3NCIA 4QWCA 3NNHA 4GMKA 1C6VA 4DUYK 1WOPA 3VERA 3C8YA 3W60A 3RBZA 4LF4J 3FFIB 4BY9C 2XRIA 3MMJA 1IKWB 4XIUA 3FBCA 2XULA 3NRBA 3N79A 1VQMS 4B3RJ 1TL4A 2YKMA 4CJVA 4ER8A 2AX0A 1BUPA 3RR7A 3NGZA 2Z1IA 3LZJA 2E6LA 5KFSA 3ISZA 3I5AA 4BR4A 3GIKA 4KY3A 4AH9A 1RWKB 3CJKB 2HQIA 4NLDA 1TMMA 2GIRA 2ZWOA 1B9DA 4USIA 2GJ2A 4BHQA 2DPJA 2RHKA 5J2QA 3IFRA 4JRQA 1H7WA 4PZVA 1BY9A 3RRKA 3RW7A 4IZ9A 4WQ5A 3R8YA 3CUNA 3OFEA 5T7LB 3D7SB 5FPEA 4OPJA 1FRLA 4XDCA 3KD1E 5DETA 2VA3A 1F3VA 3WXMB 4A5AA 2RH3A 3EMTA 1KKHA 3BPDA 4TVAB 2Q1NA 2MKCA 4MLHA 3QRQA 5DMRA 2RQ4A 1HFEL 1DQAA 1SKWA 4KB1A 2ZH4A 4DR4K 1M5OC 1N5QA 3GIJA 5B09A 1NK7A 4O23A 3CJQA 3IM9A 2ZDPA 1PCAA 4X64K 2AJ4A 3GJRB 3H45C 1GLFO 2H1YA 3FLCO 1WSFA 5KFOA 2P8IA 4DR7J 2F63A 4OYOA 3W5YA 4ES3A 1CPZA 5KTQA 2XQCA 4HT5A 2CQBA 2H9ZA 4NLRA 1VIOA 2A0FB 4CLKA 4RTFD 3MX5A 5F3ZA 3VQ8A 4HUFA 4KI6A 2QSFA 3GE1A 1WLJA 1F9EB 3L2UA 2QYCA 3ENQA 2AGQA 3KJFB 1FTCA 3H3OB 2CG4A 5F3TA 5M1OA 4ED1A 1NK0A 3WUHA 2OJ3A 1JLEA 3UE5A 2VDIA 3OBYA 3LPUA 1PKUA 1WSJA 3OYMA 2Y1LB 1FERA 2J7KA 3FVYA 3UWTA 4LF4F 4I67A 4IFEA 2Z1GA 4GC6A 3THXB 2A41A 3JSMA 3GONA 4DV4F 2MHNA 1KOOA 4B3RF 2CVIA 4U7UD 3CIPA 4O3NA 1FD8A 4IH7A 2PSZA 5DRKA 3MWPA 4PXCA 1ZBFA 2VGMA 2DH7A 2IRUA 4GVBA 3IP0A 2YKPA 2X1BA 2WZ1A 4WCEL 4K4VA 1JLGA 1YJWN 2DPNA 4OYPA 1B7FA 5L39A 1ILYA 1UFWA 4DSKA 3BPSP 1JWWA 1OSDA 1OVYA 3W65A 3T6JA 4FO0A 2ACMA 4CHNA 4DL5A 4LRDA 3JSMB 2BACA 3MK6A 4YOUA 1QUVA 3E1YA 4OO1J 5T7BA 3MN9A 4F4KA 1REGX 2YNIA 3KMSA 1WDTA 5HBMA 3OTOJ 4K42A 4P52A 1F2HA 3FBEA 1EQMA 4IG0A 1OY9A 4CLTA 1RAHB 3HF5A 1Y97A 3EN9A 3L4IA 4JI6K 2FF3B 3Q8QB 2DPIA 4Z94A 3N9UC 3FBFA 5K8MA 4GVMA 1FRIA 3EXYA 4QJVA 3QWUA 2RAQA 3W2WA 4CH1A 1JLGB 5B08A 2VBXA 4A8KA 1FDAA 3DLGA 3PJXA 1KXPA 5B8HA 4B3SJ 1JLQA 2WSFC 5KFVA 5BPLA 1VQ5N 2JL9A 2QLWA 1HW8A 2W7OA 4MK9A 3D0PA 3PW7A 2L08A 4CIEA 4U6PA 2ZNYA 2D1CA 2E2QA 2M5YA 3PIOQ 1V5VA 2FJAB 3EEQA 4CK1A 2XMAA 4B02A 2YNIB 2UVWA 1S0MA 1RUSA 5HBMB 5J1NA 4JN4A 5DLFA 3VOVA 2YHYA 4IG0B 3IBFB 4A57A 1NUEA 4K4SA 3WXIA 1N0VC 5KGXA 4FWQA 4CIGA 4MFBB 3GCXP 2QXLA 1NAQA 2BANA 2EX3A 4XK8C 2HBRB 3LALA 3KK3B 3FGVA 5J1EA 4ECQA 3DLGB 2NYIA 4USVA 1WKJA 3BDPA 2KT3A 4DTMA 4CVNE 1XR5A 2PZSA 1R8CA 4OZLA 1XWLA 1DTTA 2HBMA 3L09A 2ZOMA 1XUPO 4ED6A 1FA0A 2CH6A 5FPDA 4O4RA 4ZVHA 3QGHA 2IVYA 3OHBA 4M95A 2GVZA 4H54A 4Z4FA 2V2KA 2W7AA 4NRTA 2YX4A 1YJWS 2ZQBA 1YBAA 4FZZA 2H65B 2KXHA 2BANB 2E5GA 3VALA 4AHSA 4NOHA 2OI2A 2AX1A 2RS8A 4E8UA 3GG4A 2AHOB 3OYJA 3MN5A 5D4OA 2D0CA 2NNWA 3R5BA 4WFAQ 3OHRA 4KHPF 1CVJA 4KH5A 2EG1A 4RW7B 5K20B 2CZ4A 3KDNA 1KD1O 2O8BB 3OJSA 4EBCA 4EYIB 5AQWA 2HQCA 1YJ7A 2UV8G 5B0DA 1Z2ZA 2QI2A 4JKGB 3I4HX 3A8KA 4IOXA 2B6AA 4I2QA 3CFPA 4B3OA 1RBTA 1J5EK 1WF0A 4OI1A 1RAEB 2QA4N 2I9SA 4DV7F 4W5NA 4A8FA 4BR9A 2LXFA 4AM6A 2MKYA 3UNGC 1W0HA 4OKJA 4IFYA 2HAFA 2ROEA 4XEIA 5BR8K 4N56A 2MSTA 2CIMA 5GAHP 5E2QA 3RWUA 1VQ5S 1GXTA 2YWKA 1T8EA 1YRXA 3MCOA 1WC3A 4FDFA 4RUAA 2RQCA 3BGUA 2FF6A 1RAAB 1NMEB 4M5MA 1O0PA 2LEBA 1RLDA 2W1BA 3C3LA 3Q83A 2NRRA 1MLAA 3QFHA 4MDBA 3CF5Q 3MFHA 1B0VA 2F9JA 4X66J 4F67A 4CEOA 3QNNA 2RF2B 4B3MK 4I2QB 4B3OB 2FLNA 1PJ7A 2JEFA 3SQGA 2HZVA 1HMVB 2CADA 3M32B 2DHAA 1EKSA 3AHPA 1F5BA 3MMVA 4DZDA 1WNEA 3R2DJ 1IWGA 2UP1A 1KQSR 5C5JA 3HSGA 2FJDB 1T3VA 1WOSA 1S99A 1P8GA 2E2NA 2G8HA 1W7WA 4LMZA 3G8TA 1X3MA 2VFVA 3K9JA 2JNJA 3MR6A 4NA2A 2QA1A 3BKFA 4YY3J 5AQSA 3DU5A 4LBIA 3JTOA 1Y0HA 2BDPA 4Q2MA 3VZIA 2RRBA 4C1NK 4ANCA 3MM8A 2RS2A 2DKOB 3RW6A 2EG2A 3KMQA 3GOIA 5J2NA 2OUGA 4KGMA 4F2SA 4FXWA 5KFLA 1GNKA 1RABB 2EBEA 4F26A 1S10A 3EVWA 2J7UA 1RBRA 1HPZA 4DTJA 5E3CA 4DZ6A 3CM6A 4H0PA 1K0TA 4RKUC 2HLUA 1U1OA 1UJ6A 1VS3A 4U67L 1ESVA 3TYTA 2RQMA 1XR7A 5HVHA 3MM6A 1VRUA 3R9PA 5BYRA 2R2UA 2DNRA 2CPHA 1ASUA 1VYAA 4KJIA 3PEHA 2KT5A 4FJ8A 3DRYA 4WP8A 4URGA 4WU3A 4NLGA 2YX6A 2WAQD 2PEHA 1SQEA 4Z7CA 3MTJA 1H72C 5KFMA 1AA1B 3MM8B 4DR7K 2V8VA 4DV6F 2XNQA 4FKXA 2JEGA 5J2NB 2V9WA 4RPFA 4W5RA 1HNIA 2HHSA 2VG5A 1NZ8A 1WUUA 5I42A 3L6QA 3THPA 1HPZB 3M8QA 4CO4A 1BL3A 4O0NA 3OTCA 1JNRB 2N82B 3O9UA 3EDRB 1SH0A 1ZA1B 2AYEA 3MM6B 4QWBA 1N5TA 4V19X 1VRUB 4X66F 3F41A 3FFKB 2VL1A 2WK4A 4ELUA 3W5ZA 3ZO7A 2HRUA 3T1HJ 5AQXA 4X4RA 5BPNA 3RMBA 4FJXA 2I7PA 2KL8A 1SC3B 3A3NB 1LXNA 5K5MA 4Y0WA 2KHCA 2E6MA 4ZIWA 1HNIB 4LF7F 1YTUA 2VG5B 5ETRA 3W64A 4DQ8A 3J7YP 4M5HA 3AT1B 3M8QB 2R7VA 2RU9A 2HGNA 3UR3C 2MQOA 4ECYA 4XH5A 3GSIA 4OYZA 4FXVA 3TJ8A 2K3KA 3GJSB 2ITMA 3D6FB 3UCZP 2KDOA 1NWKA 1E4GT 1HR0J 1M5KC 4OVLA 3QIOA 1N32J 4ILLA 1GFWB 5AQPA 1TKZA 2H5EA 4DR5J 3W7BA 3T9NA 4EP5A 2HWHA 1T3NA 4JI3K 3AVCA 3ZT2A 3G96A 1MWQA 3H2VE 1B70B 2VCPA 5BJRA 4RNNA 5LMUF 2ZC3A 2J8AA 4QS9A 3QBCA 3CETA 2W9AA 2KXNB 3VQEA 2G0IA 5CXTA 4BROA 4UY8O 3AA3A 4OX9F 1WSVA 3AVFA 3OYNA 4WQ4C 1Q16B 2DNHA 3M9NB 1SCJB 1U02A 4N5SA 2FXUA 1FRMA 2PA3A 1PYSB 3SFGA 5TKWA 1PBAA 1QHTA 4FZXC 2QN6B 1I51B 2GVDA 2C2NA 4OJGA 3OL9A 4B3SK 4FJ9A 3F9KA 4TKTA 2WB4A 1TKZB 2J0XA 2R3VA 1VK3A 4E1JA 4DUYF 1NJWA 1B64A 4I6WA 3QEVA 3F0NA 3NVMA 4I6MA 3NMAA 4YFUA 3PIPQ 2IVPA 4KAZA 3EE9A 4KB0A 1NLKL 4BRKA 4AQYK 1LXJA 4OZNA 1VC5A 4CHOA 4C9DA 2Y3YA 3GJQB 2LXUA 6AT1B 1KQGB 2YY3A 1F60B 3BSCA 5A8KA 2W40A 1FKOA 3GQCA 1URRA 4ZHRA 4USJC 1ASVA 3N01A 2GVDB 4HHUA 3T1HF 2FLLA 4I2PB 3V81B 4BRPA 1RT1A 3N5FA 4CJEA 2VQEK 2HGLA 2HRTA 2P5GA 3EVOA 4PCQA 3TWHA 3QMQA 1FW6A 2IIRA 2JHEA 1FWKA 1NJIT 4KT0C 2QYGA 1N52B 5CHCB 1TP7A 1R8PA 3OT9A 3CCEN 4KBOA 1X4CA 1Q86O 3OLAA 2IYGA 3DLEB 3KLFA 2YHXA 4BRNA 2YNFA 1HYVA 3LP3A 4FJNA 3S1TA 3THYB 2W9BA 4FWSA 2O8FA 1JQGA 3I55N 2GO8A 5DS7A 1ZETA 1D9DA 1FKOB 2XS2A 5B7WA 1S9FA 1HR0F 3BJYA 2ETJA 4ZHRB 1T9TA 1C4AA 1SL2A 3PYGA 3AVGA 4CH0S 1HBOA 2AJ0A 4DR5F 1TUVA 3VZHA 2OLWA 5L1IA 3IAM9 1Y7PA 1YZ7A 2VA2A 4PWUA 4CESA 4BG8A 4HTIA 3B6BA 2BRKA 3GFYA 3R3TA 1NG9A 4ZA1A 3SUNA 2GV1A 5T41A 3ILLA 2B0GA 2OELA 2FYXA 4JRPA 2NCKL 1UEKA 1RWPB 5H9EJ 1H2UX 2R8JA 3CD6N 2YNFB 2RQKA 5D4LA 3GR0A 2E1CA 3JYTA 3KWMA 3CEDA 1Q8KA 2BMBA 2ZGYA 3J7AP 2PAVA 3ENBA 3PSFA 4TU9A 5C2GA 1HBOB 2VICA 3GFXA 4AHVA 1YRTA 2GC8A 2ZH8A 1GTEA 2XMVA 1NKEA 3CO0P 4RNHA 1ZBUA 1RHMB 2MKHA 2DY1A 4DTRA 4GKJF 4HT7A 3BQ1A 3AVAA 3NWRA 4H0XB 5KRTA 1HUXA 3OFGA 1WI6A 4JV5K 1UP1A 4YB5A 4G6VB 1A9NB 4WZMA 2P9NA 4CGGA 1R8BA 3MPYA 3C6UA 2Q3PA 4BVOA 2BVZA 2EEYA 2UXBJ 2NQPA 2M52A 4FWOA 4RW8B 1R27B 4X2BA 1JLCA 1VISA 3FSIA 3GYXB 1QD1A 1RILA 3AV9A 2BW2A 3H2UB 3OFFA 4JYAF 3ZC4A 1VK8A 2GWKA 1U26A 4QWAA 2HFVA 4LC9B 3CXCR 1AUDA 3P4IA 5DDQC 5KOWA 2BXJA 4JV1A 2COLA 3CD7A 4FM2A 3D5MA 4OI6A 3GTYX 1D4XA 2HHHK 1V9OA 2YBVA 2DTUA 2UUAJ 4M5DA 3NBPB 2XWXA 2B4OA 4F36A 4YY3K 1FEEA 1HNWF 4H5WA 4YB1P 1ASWA 3KZBA 3NF7A 4OZ2A 1FJGJ 2RE2A 4E7JA 2NUHA 2K7JA 3I55S 5KFFA 4MT1A 2HNDA 4JI6F 4DL6A 1HWKA 3TUIC 3IS9A 3GV8B 3R3LA 1QE1B 1ZAXA 1XMQK 3B4MA 1FK9A 4ECTA 1NK6A 4B9NA 2C3UA 1WC6A 2KHDA 1VBYA 2QMUB 4FS1A 1N4LA 1MMDA 3SSRA 1BWEA 2I1RA 4C0OC 1C0MA 1HD1A 5H1SV 5GINA 3LPTA 2KW4A 2MJUA 5KPZA 1FWPA 4U95A 3TQ1A 2D3ZA 4IOAL 5DDRC 2QL5B 4DF8A 4M5DB 1RYRA 4MTPA 3CD6S 1VC0A 4KFBA 3M2VA 4DPWA 2HNDB 1KDNA 3QRRA 2YWWA 1PGZA 4J9QA 3IS9B 3BO4A 1YUWA 1Y3JA 2E7XA 2E1RA 3EICA 2O8EA 3MAAA 1NEEA 1YXQA 1HNXJ 5LL6Z 1FK9B 4DPUA 5HAOA 2IMWP 1IM6A 4TLRA 4JI8J 2IJFA 4HI2A 4ECSA 3BYPA 5GADP 1VSKA 2ZZNA 1GXUA 3OR1A 3E3XA 1JX4A 5CQGA 4HLBA 2WW4A 5AQTA 4DV3K 5JS1A 4RWWA 2UU9J 3GL1A 2R8GA 1GLBG 5L9NA 2F4VK 5GMEA 3PHEA 2UV8A 2NSCA 5L9XA 4H0VB 4JP8A 3M1FA 3M2VB 1NK9A 4PYDA 4DV5J 3K8WA 2GMJA 3O08A 3RB4A 1C0TA 4EI2A 2DH8A 4I6AA 3DC2A 5LSRA 2I2YA 4B08A 1YDLA 4IH6A 2O8EB 3MAAB 4X62J 3QBXA 3HSCA 2V4RA 4Q0BA 3FRZA 2DY4A 2D41A 3WEEA 4K4UA 1KAZA 1KLMA 1T0TV 2AZ1A 2NRVA 1D9FA 2PA8D 3UDVA 3DHWC 1IQZA 3LP0B 2UUAF 4WXWA 3JTPA 1Q82T 4N8OA 2EPIA 1N32K 4A8WA 3LQVA 1N34F 1XNRK 2HBQB 3CC4N 1J5EF 3TR5A 1SH2A 3D6MB 1RBAA 4HKQA 4LF9J 1SIZA 4J9SA 3AOAA 4CGJA 1Q1KA 4DU3A 4PL8A 1YJ9N 4KHMA 5BR8F 5IT9U 1WEYA 2NZTA 3WHIA 4AT1B 3CCLN 4QYZJ 3LAMA 2OZSA 1UPPA 4DV2K 1SUQA 4Q0BB 1LK5A 3WEEB 1J54A 2DCUB 2AA4A 3UE2A 1RKIA 2R7OA 3VGUA 4CGIA 3D3CJ 4QOZB 4YOXA 3H7HB 4NLUA 4FJGA 1S59A 5AE1A 3ZXWA 2ZKUA 3ZZYA 2RDDA 1OKJA 3WC0A 1S6QB 1ICEB 1WNSA 3ZCMA 1RHKB 5BYSA 4B3MF 3QT6A 1NSQA 1FRKA 5IT4A 2KN4A 2GHVC 5FD1A 3FDSA 4CF9A 3HX9A 4JBCA 3UI3A 5C42A 4C3LA 2EK1A 5KT6A 5IT0A 1DQ9A 4JI1J 4JI8F 4FLUA 3QINA 3EJMA 4EYHB 1FF2A 4YP3A 2BA9A 1SUQB 2OYQA 3G8SA 3VETA 4LQ9A 4PKIA 1CLFA 3L7OA 2UU9F 4KH4A 3TUPA 5LMNJ 3BN4A 4DQPA 4A8QA 3BKTA 1XNQJ 2W2MP 2R2TA 2NZCA 4K5RA 4DOZA 5HANA 4P75A 1R0AA 4DV5F 2YHWA 4DXLA 3KLEA 3R27A 2D1KA 1ZAVA 5IWAK 5CZXA 1QSYA 2HLTA 1NH7A 1LKZA 3PXGa 2AT1B 2HQDA 5BXIA 3SCKE 5C42B 2B9YA 3HT0A 4CLPA 3QQCD 1TMJA 2H51B 4IFVA 2F5GA 4PRFA 5AQRA 2VFTA 1R31A 1NOYA 1RISA 1JCFA 4TU7A 3MPWA 2XG8A 4FF2A 4CEEA 3VAHA 4YEAA 4FPRA 5EGYA 2OEJA 2E5LJ 4LSNA 4BRDA 4P7TA 3LAKA 5HQLA 3LP1A 2D69A 3H20A 1R0AB 1BWVA 2A6AA 1OIAA 3T19A 1XMOK 4Z0UA 4AL7A 1B0PA 2V0NA 4FVMA 5M1FA 2GCFA 1NBWA 4NCGB 1YJ9S 4CI0B 5C10A 3US5A 1RCXB 2PO4A 3CCLS 2XI2A 2HNYA 4FLYA 5LOQA 1KS2A 2QTWA 4IFVB 3W8GA 4B9QA 3ULDA 1JMTA 4CTAB 3ENVA 2HGMA 3PYFA 4BR7A 4RZRA 1UVNA 1RHJB 1T95A 3LDQA 2FD2A 1K1SA 1U04A 1EO1A 1JL2A 2QL7B 1UL3A 3F73A 1M1KO 1GT8A 4LSNB 1SKUB 2EW9A 4RW6A 2JZ5A 1C0UA 3LOUA 3KJVA 5GAGU 2LP4A 3UKUA 3T5HA 4FN5A 2AJFE 3L4BC 1VQ4N 4LFAJ 3OYHA 3DGVA 2ASPA 3GZ7A 1U6BA 3IRXA 3E2EA 3JS9A 2QE5A 2JC1A 1X4EA 1X4BA 1QZ5A 5HQMA 1IG9A 2C42A 3UCGA 2HNYB 4CHZA 3DXMA 3UVJA 2UXCF 1NMDA 2QTDA 3GILA 1Z05A 5EN1A 2NREA 1FX4A 2AEFA 1GLDG 1UTAA 4MAKA 2Y1IA 4CIFA 3PW2A 4Q8FA 5IC6B 4TQSA 4LREA 3AVLA 1JLFA 2CNNB 2Q97A 5KFIA 1Q7YT 4OX8A 1XNQF 1Z26A 3TWZA 1GLLO 4L3NA 1UA1A 3DRSA 1S48A 2IY5B 3JAMY 3KLHA 2APOA 4BRQA 5BRHA 2P9LB 1H2VZ 3NGTA 2W2NP 2HHUA 1C0UB 3KJVB 3UKUB 3M2UA 3H5SA 4LF6J 4DFJA 2FQQB 5BREA 4IO9Q 3CIMA 2HFNA 5GAGI 3IRXB 4M8LA 1IBKF 5F8HA 2ALZA 4JI3F 5GIPA 3HO1A 2EWSA 2F40A 4CEZA 1MW7A 3EKUA 1UEUA 1YQHA 3DXMB 3UVJB 1V4TA 4M63A 1KHWA 4DL2A 1FJGK 1Y4ZB 4NLYA 1M1GA 4M5GA 2E66A 4DCOB 4TYBA 2IM1A 4YB7A 1H0HB 1R0CB 3DI6A 2IMOA 3AGKA 4ZTFA 2AJ1A 1U49A 1C1CA 1P9QC 3KLHB 1M5PC 3O5BA 4NMXA 2XY6A 1NKCA 2C2ZB 2ZBCA 1EETA 4J8FA 2J0SD 2PFUA 3DGPA 2CVEA 4NLBA 1RZMA 4K4XA 1FFWB 4OMFG 4A62A 3FR0A 4P9SA 3AO5A 3SUQA 1JK9B 2WBNA 3QB0A 3QGGA 4MIAA 1CJTB 1SJQA 1KSPA 3QERA 4AQYF 5TKYA 4OX6A 2XBPA 3MECB 3CMAN 1GMWA 1SH3A 3TNVA 4GY2B 2DT9A 2D0PA 3ATUA 3DI6B 1HNZF 3CSKA 1QZ6A 4J9LA 4B1YB 1HNXK 3SMZA 3HD1A 5GMDA 1DQ8A 5E3QA 1IVZA 3OYCA 3ULHA 1QVGM 1WTFA 5KFZA 4U7CA 4C23A 3DGPB 3T9ZA 3UD5A 2VQEF 3UN2A 3PR5B 1OWXA 3C95A 2V2ZA 5E3AA 2LECA 3R8EA 5C2FA 4J9KA 2AIRB 4NYOA 3W2VA 3ZTQA 3HHLC 1DJ0A 2OCEA 3JSBA 4M3YA 1MROA 2GQCA 4ZJOA 3OSPA 1U8SA 1Q8LA 3CE8A 3QJLA 4USUA 4WCEQ 2ZWPA 3W0LA 2DIVA 3QFWA 2VB6A 5L1JA 5FRMA 2DITA 4ED2A 2B5JA 3N5BA 1BE4A 4LF6F 2ZM6J 1M5VC 4ISEA 3BY5A 3EUNA 5JVHL 2HS3A 4K43A 1BMQB 3QETA 2Z2ZA 1P6TA 4DL7A 2GX8A 4DBQA 3FEYB 2M3DA 4K8ZA 2FJVA 1IWAA 2OZMA 4CRJA 1CZ9A 1OH5A 1J27A 2QJ3A 3W2VB 1XIQA 4NYNA 3VEXA 4RJVA 1SAZA 1T7PA 3OVSA 3VAKA 4B3TJ 1RTHB 4FSVA 3PY8A 1X8DA 4LVNP 1RBVA 3FCHA 2M88A 3HI0A 3ZLJA 4N77A 4CDIA 4B17A 3ZT1A 2L9DA 2IHR1 4N7TA 1VLYA 3DDKA 2C2KB 3FK4A 4QYZK 5EDWA 2G1DA 3OD2A 4IR1A 2B5JB 1X31C 1KFDA 2QX0A 2BE7D 1URNA 1R89A 3Q0AA 2DNPA 4TNOA 4O3OA 3EXCX 1LK7A 1S57A 3AJ2A 3NWGA 2L9NA 2NXCA 2AYGA 4NXNK 4LF8J 4LFBK 1U6FA 3CC7S 3FZKA 2F8HA 4OPKA 4WK3A 2GUPA 3CMAS 1EQYA 5L38A 2KFNA 2J4RA 3KLIA 3AVMA 4EU0A 4DL4A 4JI1K 2P9UB 2AJ2A 4WFAL 3EGNA 2RE1A