3VQ6A

Hiv-1 in core domain in complex with (1-methyl-5-phenyl-1h-pyrazol-4-yl)methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
145
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 52
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq6A00
3BGRA 1RBRA 1S5JA 4OKKA 4M45A 1TK5A 4CJQA 2ATQA 3ISNC 2B6AA 4I2PA 1Q9YA 2VG7A 2XY8A 3ZSQA 3CQ8A 3L2WA 3G0ZA 1RDCA 4JLHA 5KGWA 4DFKA 1NK9A 1D9DA 5HROA 1U47A 3M8QA 5E41A 3AA4A 3CYMA 4IBNA 4I2QA 3EY1A 1BL3A 1RTDA 1LAWA 3MXJA 3FFIA 3NH1A 1KSPA 1HPZA 4O55A 1J54A 3D0PA 1WSJA 1VSHA 1WSGA 3SPZA 3PY8A 4FJGA 4M3UA 4PUOA 3ZCMA 3SQ1A 3L3VA 1BIUA 1TKXA 3V1QA 4CEEA 4CHPA 4O44A 4CHYA 1UOCA 3HPOA 1NJWA 2GV9A 4OGEA 1TKZA 4CEZA 4CEOA 1BQMA 1BCMA 4R5PA 1NKCA 3AVHA 3HO1A 2G8IA 3ZSOA 4FK4A 1YT3A 1S9EA 1ASUA 1MU2A 2IAJA 3VQ6A 1TAQA 2ZQBA 4FM2A 1L3TA 3WNFA 1A5WA 3NF6A 4OPJA 4CJUA 1NJXA 4AHSA 3LP1A 3V4IA 1CZ9A 1VSLA 3OS2A 3V9UA 4TSXA 4DU1A 1CLQA 3EZ5A 4C8KA 4AHUA 1WAFA 3DLGA 2XHBA 5K14A 3QNNA 2RN2A 2PZSA 2OYQA 4CE9A 3V6DA 4AILC 1I39A 3AO3A 4CJFA 3NGIA 3NF8A 2P5GA 4J2AA 4RW4A 4F3TA 1FKPA 1JXBA 3TANA 3ZT2A 3KKSA 2FC0A 3QERA 3DYAA 2ITGA 4B9NA 3RRGA 4C8OA 1WNSA 3ZSWA 3KLHA 3OJUA 1BQNA 2ETJA 1SKWA 4KHUA 4HCBA 4DTNA 4E0DA 1W9HA 3RWUA 5KI6A 2NUBA 5CY4A 1QS4A 3VQPA 2OZSA 4M3ZA 4CHNA 3V9SA 1NK7A 2HB5A 4OKEA 1X9SA 3F9KA 4E19A 3OS0A 3LPTA 1ZBUA 5KRSA 1U45A 4B9SA 3SV4A 4NCGA 4QAGA 3VA0A 1QE1A 4HVJA 2IOCA 3VQCA 3MXIA 4I9QA 2HHXA 3AO5A 1J5OA 4DTRA 1T03A 4B9TA 2GUIA 4J2EA 2DFFA 5HRSA 1VSDA 1SL2A 4CF1A 5FROA 5T7BA 3SUNA 1L3SA 4FZZA 3VQDA 2P5OA 3LWMA 4CF8A 1IKYA 3K59A 1T7PA 4OLAA 3SNNA 4M3RA 3RMBA 4DSJA 4HUEA 3SUPA 4OKJA 1RNHA 3LZIA 1TAUA 3NE6A 1J9AA 4BDPA 1TK8A 2JLEA 3K5MA 3BDPA 4B8AB 1XHZA 3DLEA 1RILA 4ID1A 1NK8A 1RT2A 1VSMA 3LANA 3T19A 4DQRA 4FXDA 1FXXA 2D0BA 3NH0A 3CG7A 1JLFA 2VWJA 1GOCA 4CGGA 3WNGA 4CECA 3QEXA 4GMJB 3WNHA 4FM0A 1DTTA 2KQ2A 3DLKA 3K57A 1RTIA 1VSIA 4CGIA 3KK2A 2A1SA 2XY5A 3K5NA 2PYJA 3C6TA 1T8EA 4ID5A 1TK0A 4N47A 1NK5A 4DQIA 1HQEA 4MFBA 4FW2A 3ZT3A 4CK2A 3KK3A 4DTUA 4FJLA 4KHNA 4IFVA 3SQ4A 2G8HA 4HCCA 5CYQA 3TAGA 1ASVA 4NCBA 4PY5A 4IFYA 4ICLA 3NF7A 3SV3A 2BANA 5KRTA 4EP5A 3QEVA 3ZT0A 4CJWA 4O0JA 4J2DA 4F4KA 2OZMA 2F8SA 5CYMA 1N5YA 4E89A 4DS5A 4RG8A 1TL3A 2DFHA 1JLQA 3LP0A 4CJPA 2DFEA 1SL1A 4WE1A 4CJ5A 1ZYQA 4FJIA 3SI6A 1F21A 2HNDA 2YHAA 5CZ1A 2E6MA 4E7JA 2I5JA 4CEBA 4CK1A 3OY9A 4E7KA 3VQEA 4OJRA 3TAPA 1KVBA 2KTQA 5DK5A 3F73A 4AH9A 4FK0A 4M3XA 2HHWA 3AO4A 3LP3A 3NF9A 4CEDA 2FBVA 1NOZA 4M3TA 1W0HA 2OPPA 3PO4A 1XHXA 3KKRA 1SKSA 2R7YA 1EXQA 3O3FA 1YTUA 2X6SA 1WN7A 1L5UA 1RDBA 2RKIA 3VQ7A 1XWLA 3LAMA 3RMDA 2QKBA 1HNVA 4AHVA 3QETA 4H4MA 5DMRA 1U48A 1ZBHA 1KLMA 4W5NA 3PX6A 3PUFA 4DQSA 4CF9A 2KW4A 4M3YA 2G8FA 4XIUA 3ZSZA 1IKXA 2Z1JA 1EKEA 3AVMA 4LH5A 4KREA 1ZBFA 4KTWA 3OJSA 4HHTA 1HYZA 1BHLA 4NCAA 3PX4A 1NJYA 4CFCA 5J2QA 3SQ0A 3OYMA 5I3UA 4CF2A 3SZ2A 4Z4FA 3ZSYA 2YNIA 3H08A 1NK6A 2BGGA 4B9UA 4FJHA 2EHGA 3O3GA 3TARA 3RTVA 1JKHA 1JLAA 2P1JA 2Y1JA 1D9FA 4L8RB 2LSNA 3DOLA 4E3SA 4KB1A 1GOAA 1RT5A 1WLJA 4E1NA 2YNHA 4DFPA 4K8ZA 3TAQA 4QCLA 3OYBA 1IH7A 3M8PA 3U3YA 3LALA 3I8DA 1T05A 3PO5A 4DLGA 2DTUA 1UWBA 3AV9A 3MEGA 1JXEA 3AVAA 1UAXA 3RMCA 1RCHA 3HP6A 3PX0A 1IG9A 1VSEA 3NBPA 1BI4B 4B9MA 4DFJA 3ITHA 2G8WA 4KAZA 1GOBA 3NHGA 1HNIA 3ASMA 4CCHA 4DWIA 3IS9A 4LSNA 4CGDA 1ITGA 3O4QA 3ZT1A 1S1VA 1X9MA 1L3VA 1S6PA 4Z4CA 4Z4GA 4J2BA 4ELUA 1KVCA 4CJ3A 2KFZA 1RT1A 3ZSRA 1QSYA 3OYAA 3NAEA 1HYVA 1J53A 1JLCA 1S6QA 3HSTB 3VN5A 1B9DA 3OS1A 3K58A 1B92A 4HUFA 3T3FA 3PV8A 1U4BA 1HYSA 4FJJA 4W5QA 1I3AA 3KLFA 3RR8A 3O4NA 3L3UA 4JS5A 4MQ3A 3V1OA 4YNQA 3S3OA 4RW8A 3OYCA 1KFDA 3P5JA 1RBUA 3OYDA 4CERA 3HL8A 4DFMA 2B5JA 4I9LA 2PY5A 4F2RA 3HP9A 1EX4A 4CJSA 4KRFA 4FVMA 4DQQA 4EP4A 4AHRA 1NKBA 4CJTA 3C6UA 4GW6A 1VSKA 4FZYA 2OPQA 4DSKA 1C1CA 1KCFA 3I0SA 1KTQA 1K6YA 3DLHA 3K2PA 3UIQA 2G8KA 4FLYA 4FJXA 3S9HA 1HJRA 1JL1A 1B9FA 1Z25A 3LAKA 4CHOA 3ULDA 3IAYA 3NGYA 2HHVA 4O4GA 3KLIA 3VQ8A 1R0AA 4I7FA 4KV8A 1ZBIA 3OYJA 4FZXC 2X78A 4DG1A 2HHQA 1BGXT 1S9GA 2O4GA 2RPIA 1TL1A 5C24A 3QEWA 4OGCA 3QEIA 3DRSA 1U49A 3KTQA 4FYDA 4DTSA 1LWEA 3DLBA 2Q3SA 4E7LA 1C1AA 1RDDA 3E01A 3DM2A 4CIEA 4M42A 5HRRA 1LWFA 4NYFA 1O1WA 3SUQA 2VG6A 3THVA 2ZE2A 3CFOA 3AVGA 3TAMA 4LH4A 4KO0A 5HLFA 4M3WA 1Z26A 4AHCA 2AJQA 3U3GA 3DOKA 4B9LA 3QO9A 1DTQA 4G1QA 5JS2A 4DF8A 4UQGA 5J2MA 2OPRA 1HMVA 4W5TA 1RDAA 4PA1A 4IKFA 1D8YA 5SZTA 3L2UA 3KD5E 1C0MA 4RW6A 3AVBA 1Q8IA 2Z1IA 4CGFA 1XC9A 3NCIA 4W5OA 3M8RA 3JSMA 2P51A 1EP4A 3LP2A 4N56A 3L2RA 5C25A 3KIOA 3B6OA 5JS1A 4ELVA 4CJ4A 3OYKA 3V9XA 3DMJA 3OYHA 3QIOA 4CFAA 3HPGA 1VSJA 2IDOA 4KTZA 3AVLA 3SYZA 3AVJA 5J2PA 4O0IA 3SQ2A 1N6QA 4EZ9A 4B3OA 2QK9A 2HW3A 3VQ4A 3D45A 4CJLA 3DRRA 3MEEA 3G10A 3OYFA 3V9ZA 3QNOA 3HVRA 4CHQA 3SJJA 3L8BA 4E1MA 3IRXA 4IG3A 1C0TA 3NDKA 4DSEA 4FM1A 4FLTA 3V9WA 4DS4A 2RF2A 2G8UA 1WSIA 2EX3A 2IGIA 3MAQA 3TABA 4JRQA 1YVUA 4DF4A 3CM6A 4HUGA 4FLVA 4CJKA 2JGUA 4LSLA 2Z1HA 2D5RA 1RTJA 3MECA 2VG5A 1TKTA 3L2QA 4KB0A 1RBSA 3TWHA 4PQUA 2QXFA 1BISA 1CZBA 1X1PA 4DU4A 1SV5A 2XRIA 3U6FA 4ZTJA 3KJVA 4M41A 3ZSVA 3QEPA 5D3GA 2W42A 1S1WA 4AHTA 3C95A 5SWMA 1RT6A 1KLNA 3CM5A 5C42A 4KTQA 4HTUA 3S3NA 1SKRA 3B6PA 4NYNA 1Q9XA 1TGOA 3L2VA 4BE0A 1WSFA 2F8TA 4O5BA 1XI1A 3TR8A 4F8RA 2F96A 3AVFA 1LAVA 3DRPA 5KGXA 5HP1A 4KHWA 3NGZA 3HJFA 1RTHA 4CJEA 1LV5A 3AVIA 4ZHRA 1EETA 4FW1A 4CESA 1FK9A 1BI4A 3MXMA 5EU7A 4CK3A 2G8VA 2QKKA 1RBTA 4CFDA 2IS3A 4BDYA 4KHQA 1TVRA 4DTOA 2YV0X 2BE2A 5HRPA 4C8LA 3IG1A 1KVAA 2YNFA 3QIPA 4Z0UA 1SUQA 2WONA 1RT4A 1A5VA 4CEFA 4H4OA 4KHYA 1FKOA 2XO7A 4FJ5A 3VQAA 2WOMA 4OVLA 4DTXA 3NFAA 2KZZA 3T1AA 3MEDA 2FBYA 4RW9A 4OPKA 3SCXA 3V81A 1YTAA 4FLXA 1ASWA 2HHUA 1NOYA 4C8NA 3KK1A 4PWDA 1NK0A 1KRPA 3RMAA 4E7IA 1QTMA 1UA0A 2OA8A 2HVIA 3RR7A 5HBMA 4DSLA 4LY7A 4FCYA 3SPYA 4DQPA 4QOZB 1JL2A 1NK4A 3AVKA 4RW7A 4CFBA 4Q0BA 3OYIA 3HK2A 2YNGA 4BWJA 2HVHA 2A1RA 4B8CA 1IKVA 4Z4IA 1QSSA 4Y1DA 3HT3A 2HNZA 4Z4EA 4CJVA 3HPHA 5FRNA 3S3MA 1BCOA 3K5LA 3CFRA 3ZT4A 1G15A 1VRTA 4CIFA 3AA5X 1D5AA 4FJNA 4F2SA 3P83D 4DLEA 4ZTFA 4EZ6A 2Z1GA 3LPUA 1IKWA 1HRHA 4CJRA 2YKMA 4BACA 4W5RA 5FRMA 1S1UA 1WSEA 4N5SA 4DSFA 1C0UA 1Y97A 1VRUA 2HHSA 1JLEA 4ELTA 1NJZA 2X6NA 3HYFA 3QLHA 3KLEA 1WSHA 2OPSA 4Y1CA 1BIZA 2IC3A 3OYGA 1C1BA 2E4LA 3O3HA 3VA3A 4DTPA 4DTMA 3VQ5A 1DLOA 1S1XA 4FLZA 4GVMA 5J2NA 5FDLA 4CHZA 1QHTA 1RT7A 3QINA 3K5OA 3TAEA 4FJKA 4IDKA 1KFSA 4JS4A 1SL0A 3AVNA 2O4IA 5J1EA 5HRNA 1VK0A 4CIGA 4FJ7A 3LDSA 1RT3A 3AO2A 2HMIA 4E7HA 4KPYA 2E6LA 3DLRA 4B08A 1TKDA 4KKOA 4K8XA 3OYLA 3AVCA 3HXMA 4IG0A 4BDZA 1C6VA 1LW2A 3HM9A 4FJ8A 4BWMA 3V1RA 3SUOA 3LWLA 4H8KA 3C94A 3QESA 1IO2A 3KLGA 2FBXA 4KHSA 1VSFA 1L3UA 4FJ9A 1A5XA 3JYTA 2GBZA 4JRPA 4DU3A 2XY6A 2PYLA 5CZ2A 4BE2A 2KFNA 4DSIA 4Q5VA 4CF0A 1ZBLA 2ZD1A 1LWCA 3P1GA 2D0AA 2FBTA 3VQQA 4Z4HA 5I42A 3WNEA 2DY4A 4C8MA 4F3OA 4N41A 1QSLA 3CFPA 2VWKA 3TI0A 3EYZA 3HVTA 4FLUA 2Y1IA 3KD1E 1U04A 3ZSXA 1UA1A 2HHTA 3A2FA 3AA3A 2BDPA 3TAFA 1JLBA 4CGHA 2D0CA 2X74A 2YHBA 3VQBA 1TV6A 3OYNA 4DTJA 3DI6A 4N76A 1WAJA 3OVNA 4CEQA 1X9WA 3AO1A 2YKNA 5KTQA 3ALYA 2B4JA 3OYEA 1CXUA 3NH2A 1QQCA 3M8SA 1NKEA 4KI6A 4OLBA 1LW0A 1HQUA 4KFBA 2XY7A 4B9VA 4FK2A 1CXQA 1RBVA 1REVA 4DMNA 4BE1A 4FLWA 3AA2A 3RRHA 4LD0A 3I0RA 4FJMA 1JLGA 2KZMA 4KI4A 2HNYA 4CGJA 1S1TA 3VQ9A 4YFUA 3LZJA 4CEAA
chains in the Genus database with same CATH superfamily
3EZWA 1RBRA 1S5JA 1Q9YA 3ZSQA 3L2WA 1RDCA 4JLHA 1U47A 3FZMA 5M1QA 3AA4A 3O8MA 4IBNA 2P9SA 3MXJA 4JI6K 3CJBA 4ISGA 3SPZA 3A8YA 2QWMA 2Q1NA 3ZX3A 4QS8A 3T1YK 3ZCMA 3SQ1A 4B3RK 3GL1A 4CHPA 2GV9A 4OGEA 3MMVA 1BCMA 4XH1A 3CF5L 4ILGB 1NGFA 4AM6A 1ASUA 3UKRB 2IAJA 3CETA 3LM2A 3NF6A 4OPJA 4LF4K 2NRWA 2P9PA 3ULEA 4R79A 1QQOA 3DLLL 3ULEB 2XHBA 2PZSA 2RN2A 3E9PA 3V6DA 4AILC 1I39A 4J2AA 2HBKA 3NF8A 5LJVA 2P5GA 4BR4A 4F3TA 1FKPA 3KKSA 2FC0A 1VQ9N 3RRGA 1T6DA 2NRZA 3VF2A 1SKWA 5FLXO 2NUBA 3VQPA 3WXJA 2W6LA 2HOEA 2HB5A 4OKEA 1GLCG 1ZBUA 2QWLA 4NCGA 4QAGA 4I9QA 3MXIA 3ZX0A 2HHXA 1J5OA 4DTRA 1T03A 2YHWA 1IBMK 4BC4A 1VSDA 4JAXA 2FF6A 3VQDA 3LWMA 3K59A 1KQSM 5BN8A 3RMBA 3CPWM 1E4GT 2Q0RA 3QICA 3VENA 1TK8A 2JLEA 2D1KA 3HZ6A 4ILJA 4OPAA 5AQIA 3BDPA 4B8AB 4B1UB 3DLEA 3U9DA 1RILA 4ID1A 1NK8A 1HKBA 2IVNA 1VSMA 4FXDA 3T19A 4DQRA 3CG7A 1GOCA 3RSEA 2O8BA 3WNGA 3QEXA 2KQ2A 4OO1J 3WXLA 3C6TA 4ID5A 4CD1A 4DTUA 4MFBA 4YOWA 4CK2A 4MLEA 1X3NA 4NCBA 1ASVA 4PY5A 5KRTA 4EP5A 5JS1A 3BEXA 3ZT0A 4F4KA 2ZWHA 1W2BM 1IBLK 2QWQA 3E1YA 5C0YA 4RG8A 1TL3A 1JLQA 1SL1A 4WE1A 1ZYQA 2YI1A 4DV3K 2E6MA 4E7JA 3D7EO 4IOXA 3NF9A 3LDPA 1XHXA 3T69A 4LF7K 2X6SA 5AQSA 1YHQN 2RKIA 4FVUA 3LAMA 4B1YB 3RMDA 1HNVA 1ZBHA 5DMRA 4CZMA 2KHOA 3WEEB 2IVPA 2KW4A 2Q36A 2G8FA 1IKXA 3AVMA 1OVYA 3A5LC 4IOCL 3OJSA 4A61A 2AP1A 3O1WA 4NCAA 4NB4A 4DR4K 5JICA 3SQ0A 3J8AA 4Z4FA 2BGGA 5F2RA 1KC8O 5JMVA 1MA9B 2P1JA 1GOAA 4LC9B 4X65K 1BO5O 5EVZA 1IH7A 3CHWA 3LALA 4DLGA 2DTUA 1BUPA 2P9IB 3AAQA 1JXEA 4DR2K 1DGKN 1GLAG 1VSEA 1M1KO 4DV7K 3MWTA 5GIOA 5AQRA 5LL6Z 4YY3K 1CZAN 3IS9A 3FE1A 3VOVA 1KVCA 1RT1A 1KAXA 4I6MA 1J53A 1JLCA 1B9DA 1ILYA 1HYSA 1I3AA 3KLFA 4FWNA 4FWOA 1ZXOA 4MQ3A 1P90A 3OYDA 2Q2RA 1RBUA 5C2DA 4CERA 4BRGA 1QHAA 1YI2N 1XNRK 4CJSA 5AQQA 5BRHA 1YJNN 4CJTA 1HNWK 5BREA 4FZYA 1C1CA 1KCFA 5BN9A 3UIQA 1K6YA 2G8KA 1B9FA 4CHOA 4UY8O 2HHVA 4O4GA 1R0AA 3MX5A 3OYJA 4FZXC 2HHQA 4DG1A 3QEWA 3KTQA 4B1WB 3QEIA 4DTSA 1LWEA 4BR2A 2A40A 4E7LA 4M42A 5HRRA 1VQON 1O1WA 1BDGA 3SUQA 2VG6A 2ZE2A 2QWPA 3AVGA 3TAMA 4LH4A 4H0YB 4FOEA 3D6RA 3DOKA 3O1BA 4B9LA 3QO9A 4UQGA 4OX9K 4PA1A 3WUHA 3AVBA 3VEOA 1XMOK 4CGFA 3M8RA 3O9TA 2P51A 1EP4A 3FZHA 4C1NI 4DR7K 4CJ4A 3OYKA 4WCEL 4JKFA 1VSJA 5KPZA 3SYZA 1GLFO 3D45A 3DRRA 3MEEA 2WBNA 2V7YA 3D2EB 3T7ZA 1H1VA 3NDKA 4PL7A 2EX3A 3TABA 2E2OA 4FLVA 2H3GX 2JGUA 2D5RA 4KB0A 5M1OA 2VYPA 4ZTJA 3QEPA 4JKBA 1S1WA 4AHTA 3R3LA 2JWKA 3C95A 1RT6A 4Y0WA 1KLNA 3D2FA 1NNEA 3S3NA 1LOTB 3B6PA 3I55N 1G99A 3E66A 3ENOA 4BVPA 3K0SA 4F8RA 4BRQA 5KGXA 3FFKB 3O6WA 4K25A 4CESA 1FK9A 1XUPO 1BI4A 5EU7A 1RBTA 3A5NC 1NMDA 5HRPA 3THXA 4NXNK 4C8LA 2YNFA 3L4QA 1ESVA 5JVHL 3FZLA 1SUQA 3CCUN 1RT4A 4H4OA 4KHYA 3THXB 2XO7A 2E88A 4FJ5A 2WOMA 1QQMA 2PFUA 3T1AA 4OPKA 3SCXA 1YTAA 5F1XA 5AQKA 2Q31A 4BRIA 4JKGB 3UKUA 4PWDA 1QTMA 3O9QA 4DHYA 4FCYA 4QOZB 1NK4A 5AQXA 1X3MA 1GLBG 1YUWA 3VEZA 4B8CA 3G4SN 4JI1K 4JEPA 3VGLA 4DV1K 2HNZA 3J7ZO 4Z4EA 2UXCK 3HPHA 5FRNA 2CGJA 1YF5L 2ZJPL 1BCOA 1G15A 2NRHA 1Y64A 4FJNA 3P83D 4DLEA 5AQYA 4ZTFA 4EIAA 2YKMA 5BR8K 4H0OA 1C0UA 3GOIA 2QEXN 1NJZA 3QLHA 1HKGA 2WC9A 2PBDA 3OYGA 2IC3A 2ZJQL 2E4LA 4BRPA 4DTPA 4FLZA 4JKCA 3LM9A 3K5OA 4FJKA 1MWKA 4IDKA 1X9JA 3CIPA 3VGMA 4FJ7A 3VEVA 2E2NA 2QW9A 1QVGM 4KPYA 2E6LA 4K8XA 4FJ8A 5GIPA 2JWLA 4CD3A 4OPHA 2FBXA 3JAMO 1L3UA 4PKGA 2XY6A 4DU3A 4DSIA 5M1FA 5ADXA 3VQQA 3QMLA 3WNEA 4N41A 3HVTA 1UA1A 4YDUC 2BDPA 2YHYA 3CCSN 4KH6A 1JLBA 4DTJA 1MDUB 4N76A 5KTQA 1KAYA 4H0TB 3PIOL 3S41A 3OYEA 1NKEA 3BP8A 3CERA 4GNIA 4AQYK 4K43A 1CXQA 1RBVA 4DMNA 1HUXA 3AA2A 1JLGA 5BPMA 4LF8K 5DM6L 3LZJA 3BGRA 4OKKA 3J80O 1QZ5A 4M45A 2ATQA 4I2PA 2B6AA 1HJOA 2XY8A 5HROA 5E41A 3CYMA 3EY1A 3FFIA 1VQLN 3SJHA 4O55A 1J54A 1VSHA 1WSGA 4M3UA 4FWKA 2P9KA 4CHYA 4O44A 1TKZA 1BQMA 4IOAL 2VQEK 1YT3A 4BC3A 1MU2A 3VQ6A 3WNFA 2GELA 3CJ1A 1NJXA 3LP1A 3HRGA 3EZ5A 3ZEUA 4C8KA 4DB3A 5K14A 4YDUA 1W97L 2UXDK 4CE9A 4IZ9A 4RW4A 4BQLA 5B8HA 4JD2B 2F7TA 1JXBA 3TANA 3CXCM 3ZT2A 3MX2A 5A2QO 3QERA 1KXPA 4HWIA 2UUCK 2ITGA 1TYQA 3ID8A 4C8OA 1WNSA 4M3YA 1BQNA 3MCPA 2ZF5O 5KI6A 2O8DA 5AZJA 2OZSA 4M3ZA 3V9SA 3J7YP 1IJJA 3F9KA 4FWRA 3WQUA 4B9TA 4FO0A 3F5TA 4J2EA 2DFFA 1QZ6A 4CF1A 3O5BA 3SUNA 1IKYA 1HX1A 4OLAA 3LZIA 3P31A 4BDPA 1XHZA 1FXXA 3NH0A 1JLFA 5KQ8A 2VWJA 1N36K 5JLFA 4CGGA 4CECA 1VSIA 3THYA 2XY5A 3K5NA 1T8EA 1TK0A 4N47A 4DQIA 3Q7BA 4FW2A 4FJLA 2QWOA 4KHNA 3SQ4A 3THYB 5MLCQ 5CYQA 4HCCA 5C12A 4IFYA 3SV3A 2BANA 4O0JA 2RHKA 5AQTA 4E89A 5JVGL 3HM8A 4CJPA 4RTFD 2ASPA 4CK1A 4E7KA 5H1SQ 3MWPA 3OHRA 4YORA 3F73A 3VF4A 4FK0A 3AO4A 4H0VB 3T1HK 4M3TA 1LCUA 2OPPA 1EXQA 3O3FA 1YTUA 1Q7YO 3VQ7A 4PKHA 1U48A 4W5NA 3EN9A 4DQSA 3MN9A 4CZGA 4V19S 2NNWA 4ISEA 3ZSZA 4KREA 1EKEA 3ZX2A 3Q7CA 4BRCA 1HYZA 1GLDG 4CFCA 3OYMA 3H08A 3UKRA 3WQTA 4CBUA 3MN7A 2VCPA 4BR5A 1JLAA 5I9EB 1D9FA 2E2PA 4BY9C 3DOLA 3VEWA 4E3SA 1WLJA 3HSCA 1N34K 5GADP 3OYBA 3U3YA 4M63C 3I8DA 1VQ7N 1V4SA 3AVAA 4BRAA 3H3OB 3RMCA 3HP6A 3M6GA 3QBXA 1VQ8N 1NLVA 4LSNA 3I8BA 3O4QA 1L3VA 4JI5K 3N4PA 4CJ3A 1SAZA 3BUZB 3PV8A 3VN5A 3K58A 3A5MC 4HUFA 4JKDA 1U4BA 1K8KA 1JCGA 4WFAL 1XC3A 3S3OA 3CJCA 1K8KB 3AY9A 3O4WA 3HP9A 1EX4A 4FVMA 4EP4A 4AHRA 1NKBA 3C6UA 4GW6A 1VSKA 2OPQA 3I0SA 1KTQA 3PSFA 3DLHA 3K2PA 4FJXA 3S9HA 3ULDA 1ATRA 3KLIA 4NLCA 5CR4A 3JS6A 4KV8A 2WTUA 2X78A 2YX6A 5C24A 1S9GA 2RPIA 4FWQA 4FYDA 1U49A 3E01A 3DM2A 3ATUA 3CCQN 5HLFA 4M3WA 4JKEA 4AHCA 3U3GA 1ATSA 2UYTA 3HOTA 1DTQA 5J2MA 4W5TA 1RDAA 4FWPA 2FSNA 3H3NO 3K9JA 3SAGA 4CZEA 1C0MA 1HPMA 1XC9A 4N56A 3L2RA 3KIOA 3B6OA 3NVKA 4ELVA 3U4LA 4IO8A 5M1KA 2IDOA 4KTZA 1NGJA 1OH6A 4BRHA 3SBGA 3H6EA 2HW3A 4PL8A 3CC7N 3VQ4A 1RGIA 3V9ZA 2A6AA 3J7AP 3HVRA 1HKCA 4BC5A 4CHQA 4WFBL 4E1MA 3IRXA 3WEEA 1NG9A 4IG3A 1C0TA 4GY2B 4FM1A 2CH6A 3V9WA 2RF2A 4B1XB 4DS4A 2G8UA 2O8FB 1RFQA 4U7BA 4JRQA 2AA4A 3DXKB 2NRRA 2Q0UA 4MO4A 2VG5A 3TWHA 2E1ZA 1CZBA 1X1PA 1SV5A 2XRIA 5ELZA 3TTDA 3KJVA 2CGLA 4M7YA 4LF6K 4JKHA 3ZSVA 3E9LA 2W42A 4BRNA 3ZYYX 1VHXA 4WQ4C 5AJ3K 4BROA 1YXQA 1YVNA 3IKMA 4O5BA 4GV6A 2F96A 3AVFA 3DRPA 2P9IA 3SMPA 4DV2K 5HP1A 4KHWA 1RTHA 3HJFA 4CJEA 1LV5A 3EO3A 4ZHRA 4FW1A 2O8EB 4CK3A 1GLJO 2G8VA 4CFDA 2IS3A 1VQ4N 5AFUA 4A59A 1A5VA 4FWMA 2PAVA 1FJGK 3VQAA 4OVLA 3NFAA 2UUAK 1ASWA 5EOYA 4C8NA 3KK1A 1NGGA 3VMFB 4KBOA 5JLHA 2VGMA 4CFBA 3OBWA 1RDWX 4CJVA 3CFRA 4CIFA 1Q81O 4LF9K 3QFUA 4WQ4A 3LPUA 3VPZA 3M5RA 4W5RA 1WSEA 4N5SA 4DSFA 1Y97A 4H5NA 5LJWA 1Q82O 4FWSA 3OW2M 1BIZA 3AGRA 4A2BA 1DLOA 1EWQA 3MCAB 5J2NA 5FDLA 4H03B 4WYBA 1QHTA 5AQHA 4H0PA 4J8FA 4JS4A 3AVNA 2WFBA 1VK0A 3KVGA 3LL3A 3H46O 1KAZA 1VQNN 3LDSA 4E7HA 3TU5A 4AM7A 4B08A 2NLXA 1TKDA 3HXMA 1C6VA 1LW2A 4YOUA 4BWMA 4BRMA 3SUOA 3O9UA 3ENBA 4H8KA 1NJIO 1VSFA 3D2EA 3JYTA 4BE2A 1ZBLA 3O9SA 1LWCA 3P1GA 2FBTA 5I42A 3CMEN 4C8MA 4LFAK 3CFPA 3EYZA 4NXMK 3KD1E 2HHTA 4H0XB 3AA3A 3UE5A 2P9NB 4CEQA 3PIPL 2YKNA 1CXUA 1QQCA 4H5VA 1YIJN 1LW0A 3SLCA 1WB9A 2IVOA 3WT0A 1REVA 4FLWA 3RRHA 4LD0A 3ZLJA 3QB0A 3VTHA 1S1TA 3VQ9A 4YFUA 4CEAA 4X62K 1HLUA 1TK5A 3ISNC 3CQ8A 1NK9A 3G0ZA 5KGWA 4DFKA 4LF5K 1D9DA 5IT9O 4JN4A 4I2QA 1BL3A 2A41A 3NH1A 1KSPA 2BTFA 1T44A 1WSJA 3D0PA 3EE9A 4FJGA 4PUOA 3L2QA 4CEEA 3V1QA 4CEZA 4CJ7A 4CEOA 2W40A 3SAFA 4R5PA 2G8IA 4ILHA 3RVCA 3ZSOA 4FK4A 1L3TA 1TAQA 4IFEA 1A5WA 1NGCA 1N8RO 4GKKK 3V4IA 4JKGA 1CZ9A 4TSXA 1CLQA 4M7XA 4AHUA 1WAFA 3TSUA 1EO1A 3DLGA 3QNNA 4JI3K 4FL9A 2OYQA 5TKWA 3KZBA 4DKWA 1YJWN 4ISFA 1BA0A 3AO3A 4BRLA 4CJFA 3U9ZA 2GWKA 3O9RA 1C0GA 1S72N 4BRFA 4K41A 5C15A 1XMQK 1ATNA 4YOXA 3DYAA 4B9NA 3FZFA 3KLHA 3OTOK 2ETJA 3ZETB 4DTNA 3GDQA 1NGHA 5KPTA 3RWUA 1OKJA 4A5BA 4PHTX 3FZKA 1QS4A 4XEIA 4CHNA 1NK7A 3OS0A 3LPTA 4DUYK 5KRSA 3O08A 3TPQA 3VA0A 3VQCA 5AQUA 2W41A 4IJAA 2GUIA 1DEJA 1BA1A 3I33A 4F9OA 3LDQA 1FW6A 1K9MO 2KLAA 2A3ZA 3SUPA 4OKJA 1RNHA 1TAUA 1J9AA 4BR0A 3K5MA 3EEQA 4JK8A 1RT2A 1C0FA 2D0BA 1SS6A 2E2QA 5FPEA 1JCEA 3WNHA 1DTTA 3ZT3A 3UB5A 4IFVA 2WUSA 3TAGA 2OTLN 3NF7A 3QEVA 2F8SA 4CJWA 2OZMA 1N5YA 5C10A 4DS5A 2DFHA 2DFEA 2IIRA 3NVMA 4CJ5A 4FJIA 2HNDA 2YHAA 4O8UA 2I7NA 4CEBA 2KTQA 5DK5A 1NOZA 1W0HA 3PO4A 4FWLA 3KKRA 2R7YA 2VGNA 4EAHD 1WN7A 3OBYA 1XWLA 3QETA 1Q86O 1JJ2M 1KLMA 3PX6A 3PLAA 3PUFA 5GINA 2YCHA 2ZJRL 4XIUA 2Z1JA 5M1NA 4LH5A 4KTWA 4HHTA 1BHLA 2QA4N 5HOOA 3PX4A 1NJYA 5J2QA 5ADXH 3W3DA 4BVOA 4CF2A 3SZ2A 1NK6A 4FJHA 2QI2A 4C1NK 3RTVA 2BUPA 2Y1JA 4A62A 1WBBA 4KB1A 1RT5A 4E1NA 4K8ZA 2HF4A 3L0QA 4QCLA 4B9QA 2OCEA 3AV9A 3R1XA 3QFPA 4JD2A 1IG9A 3NBPA 3U8XA 4B9MA 4DFJA 3ITHA 2G8WA 4KAZA 4JI4K 3CJ7A 3IMXA 3NHGA 1HNIA 3ASMA 4CCHA 1X9MA 1HR0K 1ITGA 3ZT1A 1S1VA 3HBTA 4YOYA 4Z4CA 4J2BA 3OYAA 3NAEA 1S6QA 3HSTB 3OS1A 1OH5A 1B92A 4DR3K 4CZJA 4FJJA 4A2AA 4W5QA 2V52B 4JS5A 3F9MA 3QBWA 3V1OA 4YNQA 1KD1O 3I56N 1TUYA 4RW8A 1KFDA 3P5JA 3VESA 3CCJN 3HL8A 3LDLA 4DFMA 3CJ9A 2B5JA 4F2RA 3IDHA 4BR7A 4DQ8A 4GKJK 4FLYA 1HNZK 5E84A 1U2VA 5AQMA 4GVEA 3VEXA 1Z25A 3LAKA 1U2VB 1NGAA 4I7FA 3VGKA 1ZBIA 2QWRA 4JI7K 3HI0A 2FXUA 1RDDA 4CIEA 1LWFA 4JK9A 3TSPA 4CZKA 3FGUA 5AQOA 2AJQA 2ASMA 5JS2A 2OPRA 3TSQA 1OH8A 4IKFA 1D8YA 5SZTA 4B3SK 3EKUA 4RW6A 1W7AA 3AAPA 4YOVA 4W5OA 3CCLN 1M90O 3F2KA 2E5LK 3V9XA 3OYHA 3QIOA 3A0IX 3NMUA 3HPGA 4EHUA 3AVLA 4H5RA 2D0OA 3AVJA 5J2PA 3EL2A 4O0IA 1N6QA 3L6QA 3CCEN 4MDBA 4EFHA 4CJLA 3B8AX 4CBXA 3EKSA 3SJJA 3L8BA 3FLCO 1WSIA 2IGIA 4BGBA 4DF4A 2HMPA 1U6ZA 4CJKA 4IXCA 4LSLA 3DXMB 1VQMN 3MECA 1Z6RA 1TKTA 1RBSA 4PQUA 3EE8A 1BISA 4DU4A 3IUCA 3U6FA 1EWRA 5D3GA 4CZLA 4HTUA 4B3MK 4NYNA 1TGOA 3L2VA 4BE0A 2F9WA 1BOTO 1XI1A 1LAVA 3NGZA 5M1PA 3SBTA 2QKKA 2P9SB 4BDYA 4DTOA 3WXKA 2BE2A 3IG1A 3QIPA 2WONA 4CI6A 1FKOA 1I94K 4QS7A 2NRTA 4AF1A 2KZZA 3MEDA 1O13A 4RW9A 5BPLA 5AQJA 1E4FT 3VF6A 2P9PB 2O8CA 2HBLA 3G25A 1KRPA 4E7IA 2HVIA 5GAEP 2GEMA 5HBMA 1ZBSA 4DSLA 4LY7A 1K8AO 3IFRA 4CVNE 2O8CB 2YJFA 3DWLA 3AVKA 3HK2A 2YNGA 4BWJA 2HVHA 4CW7B 1IKVA 4Z4IA 5F0XA 5BRFA 3HT3A 3ZT4A 4KH5A 4DR6K 2HHHK 1VRTA 1D5AA 3CI5A 4EHTA 1IKWA 1HRHA 4CZHA 2QM1A 2HHSA 4BQZA 2X6NA 3CMAN 3KLEA 1WSHA 2HBMA 5AQVA 3L4IA 4DR5K 4DTMA 1E3MA 3VQ5A 1S1XA 4GVMA 5AQPA 5IWAK 1RT7A 3QINA 4BC2A 4IDHA 1SL0A 4Z94A 5J1EA 5HRNA 1K73O 5BR9A 3CQYA 3AO2A 2BH1A 4KKOA 4MLHA 3AVCA 4BDZA 4IG0A 3HM9A 3VEYA 3MK6A 2NRVA 3LWLA 4KH4A 3C94A 3QESA 1DKGD 3RSEB 1BG3A 4KHSA 3K9KA 2GBZA 5KQDA 2O8BB 2PYLA 4CBWA 4CF0A 4YHHK 4Q5VA 4K42A 4K0KK 2GWJA 2O8FA 4B3TK 4YOTA 4BRKA 4FLUA 2Y1IA 1U04A 3DXKA 3TAFA 3OYNA 2YHBA 1SQKA 3VQBA 3HOSA 5AZIA 1P8ZA 3MN6A 2ASOA 2DPNA 2B4JA 5AZIB 3M8SA 4OLBA 1T3VA 1HQUA 4B9VA 4FK2A 2GUPA 5AQFA 2KZMA 4KI4A 2HNYA 4CGJA 1YJ9N 4CJQA 1J5EK 1Q18A 2VG7A 2GTDA 3C6AA 2O8EA 1NU0A 2YJEA 3M8QA 4FSVA 1RTDA 3HTVA 1LAWA 1R59O 4MDAA 1HPZA 3TTFA 3CQXA 3PY8A 1J6ZA 5BPNA 3L3VA 1BIUA 1TKXA 2UU9K 3CPEA 4DV6K 1UOCA 3HPOA 1NJWA 2YHXA 4BGAA 4BG8A 1NKCA 3AVHA 3HO1A 1S9EA 5FPMA 4A5AA 2ZQBA 3GBTA 4FM2A 1NGBA 4CJUA 3THWA 4AHSA 2FF3B 1VSLA 3OS2A 3LDNA 3V9UA 4DU1A 3THWB 2UUBK 2QXLA 4IEEA 5BRDA 3G71N 3NGIA 3MDQA 3R9PA 1VQ6N 4B1VA 4FPAA 3C0BA 2E1YA 2OANA 3CC2N 1VQPN 5HL7L 3ZSWA 4KHUA 3OJUA 1VQKN 4HCBA 3CC4N 4E0DA 1W9HA 4I6MB 1Z05A 5CY4A 2NRXA 5AFUH 1X9SA 4E19A 1U45A 4B9SA 3SV4A 3FR0A 2GX9A 1QE1A 4HVJA 2IOCA 1IG8A 3AO5A 4DR1K 1QQNA 5HRSA 5AQWA 1SL2A 4FZZA 5FROA 5T7BA 3WXIA 1L3SA 2P5OA 1GLLO 4CF8A 4WQ5C 1T7PA 3SNNA 1OH7A 4M3RA 2UXBK 4DSJA 4HUEA 3CCMN 3NE6A 4NO7A 3H45C 1N32K 3A5OC 2FSJA 4NLBA 1NGDA 2VQFK 3LANA 4XH5A 4JNEA 3GE1A 4GMJB 4FM0A 2ZM6K 3DLKA 3K57A 1RTIA 4BG9A 4CGIA 3KK2A 2A1SA 1VQ5N 2RE2A 2PYJA 4O5FA 1NK5A 1HQEA 3KK3A 1TUUA 2G8HA 4ICLA 2P9NA 4J2DA 5CYMA 3H1VX 3P38A 3LP0A 1D4XA 3AARA 3SI6A 1F21A 1T6CA 5CZ1A 2F9TA 1S3XA 4KHPK 2I5JA 3OY9A 2V7ZA 1MWMA 4OJRA 1KVBA 3VQEA 4B1ZA 3TAPA 4AH9A 4M3XA 2HHWA 3LP3A 4CEDA 2FBVA 3R8EA 3VTIA 4JV5K 2J4RA 1SKSA 3P4IA 1L5UA 1RDBA 4JHDA 4H5WA 1DT9A 2QKBA 4AHVA 4H4MA 4WQ5A 2Q97A 4IJNA 4CF9A 4QS9A 3GG4A 4JHDB 3DAWA 3KWIA 1ZBFA 3BF3A 2A5XA 4A57A 2OTJN 4JKAA 3J81O 3ZSYA 2YNIA 4B9UA 2EHGA 3SMSA 3O3GA 3TARA 4U67L 4G9ZA 1JKHA 4L8RB 2LSNA 3D2FB 3AGKA 5EX5A 4DFPA 2YNHA 3TAQA 3M8PA 3QDKA 4XH4A 4WF9L 1T05A 3PO5A 5GAGP 1UWBA 3MEGA 1UAXA 1RCHA 3PX0A 1XNQK 1BI4B 3M1FA 1GOBA 2V51B 4DWIA 4CGDA 4Z4GA 3OA9A 1S6PA 5GAHP 3PSIA 3ZETA 4ELUA 2KFZA 3ZSRA 2KKZA 3BZCA 1QSYA 4IEIA 1HYVA 5AQGA 3T3FA 5AR0A 3RR8A 3O4NA 3L3UA 5KPRA 4FPBA 5DM7L 5E26A 3OYCA 3BZKA 1WOQA 3UKUB 4LFCK 4I9LA 2PY5A 4GV9A 3VETA 4E1JA 4KRFA 4DQQA 1YAGA 2A42A 4DSKA 4IWVA 2EWSA 1HJRA 1JL1A 3IAYA 1NGEA 5LMUK 3NGYA 1NBWA 1S22A 3VQ8A 4O8KA 2ZGYA 3W0LA 1BGXT 3C7NA 2O4GA 1TL1A 1NMNA 4OGCA 3DRSA 4JI0K 3DLBA 2Q3SA 4JI2K 1C1AA 5EY4A 4RWTA 3C7NB 4NYFA 4X66K 3THVA 3CFOA 5AQZA 4KO0A 4FOIA 5C2FA 3R6MA 1Z26A 5LY3A 4G1QA 4DF8A 2ITMA 1HMVA 1V4TA 2HSTA 5CHIA 3L2UA 3KK7A 3KD5E 2CH5A 4WFNL 1Q8IA 2Z1IA 4GV3A 3NCIA 3JSMA 3LP2A 5AQLA 4C23A 5C25A 3DMJA 4CFAA 3SQ2A 4EZ9A 4B3OA 2QK9A 4RCHA 3OYFA 1QVFM 3G10A 2I7PA 1IBKK 3QNOA 2W6KA 3BY5A 1N33K 4DSEA 4FLTA 3N4QA 3MAQA 5TKYA 1YVUA 3CM6A 4HUGA 4JI8K 2Z1HA 5AQNA 1RTJA 4JYAK 2QTDA 1XQSC 2QXFA 5EXWA 5CE3A 4M41A 1ZC6A 3SAHA 5SWMA 2HBJA 3CM5A 5C42A 4KTQA 1SKRA 1Q9XA 3H1QA 1IV0A 3CD6N 2HF3A 1WSFA 2F8TA 3CJAA 3TR8A 3AVIA 1NWKA 5LMNK 4DV0K 1EETA 3MXMA 2P9LA 4KHQA 3MN5A 2FLOA 1TVRA 2YV0X 2P9LB 3BF1A 1BU6O 4CZIA 1KVAA 4Z0UA 4PKIA 2P9KB 4CEFA 4X64K 3JXUA 3CCVN 4DTXA 2NZTA 2FBYA 3LDOA 3V81A 4FLXA 3P39A 2HHUA 1NOYA 1NK0A 3RMAA 2OA8A 1UA0A 3ZEUB 3RR7A 5FPNA 4DCHA 3SPYA 4DQPA 3VERA 1JL2A 4RW7A 4Q0BA 3OYIA 3C6HA 2A1RA 1NGIA 1QSSA 1SZ2A 4Y1DA 2VWBA 3S3MA 3K5LA 3O80A 3AA5X 4JK7A 3DJCA 3M3ZA 4F2SA 4EZ6A 1NM1A 3ID6A 2Z1GA 4CJRA 4BACA 5FRMA 1TYQB 1S1UA 4BREA 4DV4K 1VRUA 1JLEA 4ELTA 1GLEG 2O8DB 3HYFA 5AZJB 4Y1CA 2OPSA 4H5TA 3VA3A 1C1BA 3O3HA 3ENHA 1JCFA 4LFBK 1WUAA 3KHYA 4CHZA 4DUZK 3TAEA 4BR9A 1KFSA 5FPDA 1HNXK 3WXMB 2O4IA 2D0PA 4CIGA 3G6EN 2F4VK 1RT3A 2HMIA 2CGKA 3DLRA 2E20A 3OYLA 2D4WA 4L3QA 1EQYA 2P9UA 3KWGA 3V1RA 1VAZA 1IO2A 1RDUA 3KLGA 4FJ9A 4IO9L 1BWFO 1A5XA 2P9UB 4JRPA 2KFNA 5CZ2A 4MO5A 2ZD1A 3TTCA 2D0AA 4Z4HA 2DY4A 1OVQA 4F3OA 1QSLA 2VWKA 3C65A 3TI0A 3ZSXA 3DXMA 3A2FA 3ATVA 3E9OA 2E8AA 4CGHA 2D0CA 2X74A 1TV6A 4BRDA 4DV5K 3DI6A 1YITN 1WAJA 3OVNA 1X9WA 3AO1A 3ALYA 2FSKA 3NH2A 4KI6A 4CZFA 3SK3A 4HTLA 4KFBA 2XY7A 4BE1A 2QWNA 3I0RA 4FJMA 2ZGZA 3CCRN 5I3UA 1WBDA
chains in the Genus database with same CATH topology
3BGRA 1RBRA 1S5JA 4OKKA 4M45A 1TK5A 4CJQA 2ATQA 3ISNC 2B6AA 4I2PA 1Q9YA 2VG7A 2XY8A 3ZSQA 3CQ8A 3L2WA 3G0ZA 1RDCA 4JLHA 5KGWA 4DFKA 1NK9A 1D9DA 5HROA 1U47A 3M8QA 5E41A 3AA4A 3CYMA 4IBNA 4I2QA 3EY1A 1BL3A 1RTDA 1LAWA 3MXJA 3FFIA 3NH1A 1KSPA 1HPZA 4O55A 1J54A 3D0PA 1WSJA 1VSHA 1WSGA 3SPZA 3PY8A 4FJGA 4M3UA 4PUOA 3ZCMA 3SQ1A 3L3VA 1BIUA 1TKXA 3V1QA 4CEEA 4CHPA 4O44A 4CHYA 1UOCA 3HPOA 1NJWA 2GV9A 4OGEA 1TKZA 4CEZA 4CEOA 1BQMA 1BCMA 4R5PA 1NKCA 3AVHA 3HO1A 2G8IA 3ZSOA 4FK4A 1YT3A 1S9EA 1ASUA 1MU2A 2IAJA 3VQ6A 1TAQA 2ZQBA 4FM2A 1L3TA 3WNFA 1A5WA 3NF6A 4OPJA 4CJUA 1NJXA 4AHSA 3LP1A 3V4IA 1CZ9A 1VSLA 3OS2A 3V9UA 4TSXA 4DU1A 1CLQA 3EZ5A 4C8KA 4AHUA 1WAFA 3DLGA 2XHBA 5K14A 3QNNA 2RN2A 2PZSA 2OYQA 4CE9A 3V6DA 4AILC 1I39A 3AO3A 4CJFA 3NGIA 3NF8A 2P5GA 4J2AA 4RW4A 4F3TA 1FKPA 1JXBA 3TANA 3ZT2A 3KKSA 2FC0A 3QERA 3DYAA 2ITGA 4B9NA 3RRGA 4C8OA 1WNSA 3ZSWA 3KLHA 3OJUA 1BQNA 2ETJA 1SKWA 4KHUA 4HCBA 4DTNA 4E0DA 1W9HA 3RWUA 5KI6A 2NUBA 5CY4A 1QS4A 3VQPA 2OZSA 4M3ZA 4CHNA 3V9SA 1NK7A 2HB5A 4OKEA 1X9SA 3F9KA 4E19A 3OS0A 3LPTA 1ZBUA 5KRSA 1U45A 4B9SA 3SV4A 4NCGA 4QAGA 3VA0A 1QE1A 4HVJA 2IOCA 3VQCA 3MXIA 4I9QA 2HHXA 3AO5A 1J5OA 4DTRA 1T03A 4B9TA 2GUIA 4J2EA 2DFFA 5HRSA 1VSDA 1SL2A 4CF1A 5FROA 5T7BA 3SUNA 1L3SA 4FZZA 3VQDA 2P5OA 3LWMA 4CF8A 1IKYA 3K59A 1T7PA 4OLAA 3SNNA 4M3RA 3RMBA 4DSJA 4HUEA 3SUPA 4OKJA 1RNHA 3LZIA 1TAUA 3NE6A 1J9AA 4BDPA 1TK8A 2JLEA 3K5MA 3BDPA 4B8AB 1XHZA 3DLEA 1RILA 4ID1A 1NK8A 1RT2A 1VSMA 3LANA 3T19A 4DQRA 4FXDA 1FXXA 2D0BA 3NH0A 3CG7A 1JLFA 2VWJA 1GOCA 4CGGA 3WNGA 4CECA 3QEXA 4GMJB 3WNHA 4FM0A 1DTTA 2KQ2A 3DLKA 3K57A 1RTIA 1VSIA 4CGIA 3KK2A 2A1SA 2XY5A 3K5NA 2PYJA 3C6TA 1T8EA 4ID5A 1TK0A 4N47A 1NK5A 4DQIA 1HQEA 4MFBA 4FW2A 3ZT3A 4CK2A 3KK3A 4DTUA 4FJLA 4KHNA 4IFVA 3SQ4A 2G8HA 4HCCA 5CYQA 3TAGA 1ASVA 4NCBA 4PY5A 4IFYA 4ICLA 3NF7A 3SV3A 2BANA 5KRTA 4EP5A 3QEVA 3ZT0A 4CJWA 4O0JA 4J2DA 4F4KA 2OZMA 2F8SA 5CYMA 1N5YA 4E89A 4DS5A 4RG8A 1TL3A 2DFHA 1JLQA 3LP0A 4CJPA 2DFEA 1SL1A 4WE1A 4CJ5A 1ZYQA 4FJIA 3SI6A 1F21A 2HNDA 2YHAA 5CZ1A 2E6MA 4E7JA 2I5JA 4CEBA 4CK1A 3OY9A 4E7KA 3VQEA 4OJRA 3TAPA 1KVBA 2KTQA 5DK5A 3F73A 4AH9A 4FK0A 4M3XA 2HHWA 3AO4A 3LP3A 3NF9A 4CEDA 2FBVA 1NOZA 4M3TA 1W0HA 2OPPA 3PO4A 1XHXA 3KKRA 1SKSA 2R7YA 1EXQA 3O3FA 1YTUA 2X6SA 1WN7A 1L5UA 1RDBA 2RKIA 3VQ7A 1XWLA 3LAMA 3RMDA 2QKBA 1HNVA 4AHVA 3QETA 4H4MA 5DMRA 1U48A 1ZBHA 1KLMA 4W5NA 3PX6A 3PUFA 4DQSA 4CF9A 2KW4A 4M3YA 2G8FA 4XIUA 3ZSZA 1IKXA 2Z1JA 1EKEA 3AVMA 4LH5A 4KREA 1ZBFA 4KTWA 3OJSA 4HHTA 1HYZA 1BHLA 4NCAA 3PX4A 1NJYA 4CFCA 5J2QA 3SQ0A 3OYMA 5I3UA 4CF2A 3SZ2A 4Z4FA 3ZSYA 2YNIA 3H08A 1NK6A 2BGGA 4B9UA 4FJHA 2EHGA 3O3GA 3TARA 3RTVA 1JKHA 1JLAA 2P1JA 2Y1JA 1D9FA 4L8RB 2LSNA 3DOLA 4E3SA 4KB1A 1GOAA 1RT5A 1WLJA 4E1NA 2YNHA 4DFPA 4K8ZA 3TAQA 4QCLA 3OYBA 1IH7A 3M8PA 3U3YA 3LALA 3I8DA 1T05A 3PO5A 4DLGA 2DTUA 1UWBA 3AV9A 3MEGA 1JXEA 3AVAA 1UAXA 3RMCA 1RCHA 3HP6A 3PX0A 1IG9A 1VSEA 3NBPA 1BI4B 4B9MA 4DFJA 3ITHA 2G8WA 4KAZA 1GOBA 3NHGA 1HNIA 3ASMA 4CCHA 4DWIA 3IS9A 4LSNA 4CGDA 1ITGA 3O4QA 3ZT1A 1S1VA 1X9MA 1L3VA 1S6PA 4Z4CA 4Z4GA 4J2BA 4ELUA 1KVCA 4CJ3A 2KFZA 1RT1A 3ZSRA 1QSYA 3OYAA 3NAEA 1HYVA 1J53A 1JLCA 1S6QA 3HSTB 3VN5A 1B9DA 3OS1A 3K58A 1B92A 4HUFA 3T3FA 3PV8A 1U4BA 1HYSA 4FJJA 4W5QA 1I3AA 3KLFA 3RR8A 3O4NA 3L3UA 4JS5A 4MQ3A 3V1OA 4YNQA 3S3OA 4RW8A 3OYCA 1KFDA 3P5JA 1RBUA 3OYDA 4CERA 3HL8A 4DFMA 2B5JA 4I9LA 2PY5A 4F2RA 3HP9A 1EX4A 4CJSA 4KRFA 4FVMA 4DQQA 4EP4A 4AHRA 1NKBA 4CJTA 3C6UA 4GW6A 1VSKA 4FZYA 2OPQA 4DSKA 1C1CA 1KCFA 3I0SA 1KTQA 1K6YA 3DLHA 3K2PA 3UIQA 2G8KA 4FLYA 4FJXA 3S9HA 1HJRA 1JL1A 1B9FA 1Z25A 3LAKA 4CHOA 3ULDA 3IAYA 3NGYA 2HHVA 4O4GA 3KLIA 3VQ8A 1R0AA 4I7FA 4KV8A 1ZBIA 3OYJA 4FZXC 2X78A 4DG1A 2HHQA 1BGXT 1S9GA 2O4GA 2RPIA 1TL1A 5C24A 3QEWA 4OGCA 3QEIA 3DRSA 1U49A 3KTQA 4FYDA 4DTSA 1LWEA 3DLBA 2Q3SA 4E7LA 1C1AA 1RDDA 3E01A 3DM2A 4CIEA 4M42A 5HRRA 1LWFA 4NYFA 1O1WA 3SUQA 2VG6A 3THVA 2ZE2A 3CFOA 3AVGA 3TAMA 4LH4A 4KO0A 5HLFA 4M3WA 1Z26A 4AHCA 2AJQA 3U3GA 3DOKA 4B9LA 3QO9A 1DTQA 4G1QA 5JS2A 4DF8A 4UQGA 5J2MA 2OPRA 1HMVA 4W5TA 1RDAA 4PA1A 4IKFA 1D8YA 5SZTA 3L2UA 3KD5E 1C0MA 4RW6A 3AVBA 1Q8IA 2Z1IA 4CGFA 1XC9A 3NCIA 4W5OA 3M8RA 3JSMA 2P51A 1EP4A 3LP2A 4N56A 3L2RA 5C25A 3KIOA 3B6OA 5JS1A 4ELVA 4CJ4A 3OYKA 3V9XA 3DMJA 3OYHA 3QIOA 4CFAA 3HPGA 1VSJA 2IDOA 4KTZA 3AVLA 3SYZA 3AVJA 5J2PA 4O0IA 3SQ2A 1N6QA 4EZ9A 4B3OA 2QK9A 2HW3A 3VQ4A 3D45A 4CJLA 3DRRA 3MEEA 3G10A 3OYFA 3V9ZA 3QNOA 3HVRA 4CHQA 3SJJA 3L8BA 4E1MA 3IRXA 4IG3A 1C0TA 3NDKA 4DSEA 4FM1A 4FLTA 3V9WA 4DS4A 2RF2A 2G8UA 1WSIA 2EX3A 2IGIA 3MAQA 3TABA 4JRQA 1YVUA 4DF4A 3CM6A 4HUGA 4FLVA 4CJKA 2JGUA 4LSLA 2Z1HA 2D5RA 1RTJA 3MECA 2VG5A 1TKTA 3L2QA 4KB0A 1RBSA 3TWHA 4PQUA 2QXFA 1BISA 1CZBA 1X1PA 4DU4A 1SV5A 2XRIA 3U6FA 4ZTJA 3KJVA 4M41A 3ZSVA 3QEPA 5D3GA 2W42A 1S1WA 4AHTA 3C95A 5SWMA 1RT6A 1KLNA 3CM5A 5C42A 4KTQA 4HTUA 3S3NA 1SKRA 3B6PA 4NYNA 1Q9XA 1TGOA 3L2VA 4BE0A 1WSFA 2F8TA 4O5BA 1XI1A 3TR8A 4F8RA 2F96A 3AVFA 1LAVA 3DRPA 5KGXA 5HP1A 4KHWA 3NGZA 3HJFA 1RTHA 4CJEA 1LV5A 3AVIA 4ZHRA 1EETA 4FW1A 4CESA 1FK9A 1BI4A 3MXMA 5EU7A 4CK3A 2G8VA 2QKKA 1RBTA 4CFDA 2IS3A 4BDYA 4KHQA 1TVRA 4DTOA 2YV0X 2BE2A 5HRPA 4C8LA 3IG1A 1KVAA 2YNFA 3QIPA 4Z0UA 1SUQA 2WONA 1RT4A 1A5VA 4CEFA 4H4OA 4KHYA 1FKOA 2XO7A 4FJ5A 3VQAA 2WOMA 4OVLA 4DTXA 3NFAA 2KZZA 3T1AA 3MEDA 2FBYA 4RW9A 4OPKA 3SCXA 3V81A 1YTAA 4FLXA 1ASWA 2HHUA 1NOYA 4C8NA 3KK1A 4PWDA 1NK0A 1KRPA 3RMAA 4E7IA 1QTMA 1UA0A 2OA8A 2HVIA 3RR7A 5HBMA 4DSLA 4LY7A 4FCYA 3SPYA 4DQPA 4QOZB 1JL2A 1NK4A 3AVKA 4RW7A 4CFBA 4Q0BA 3OYIA 3HK2A 2YNGA 4BWJA 2HVHA 2A1RA 4B8CA 1IKVA 4Z4IA 1QSSA 4Y1DA 3HT3A 2HNZA 4Z4EA 4CJVA 3HPHA 5FRNA 3S3MA 1BCOA 3K5LA 3CFRA 3ZT4A 1G15A 1VRTA 4CIFA 3AA5X 1D5AA 4FJNA 4F2SA 3P83D 4DLEA 4ZTFA 4EZ6A 2Z1GA 3LPUA 1IKWA 1HRHA 4CJRA 2YKMA 4BACA 4W5RA 5FRMA 1S1UA 1WSEA 4N5SA 4DSFA 1C0UA 1Y97A 1VRUA 2HHSA 1JLEA 4ELTA 1NJZA 2X6NA 3HYFA 3QLHA 3KLEA 1WSHA 2OPSA 4Y1CA 1BIZA 2IC3A 3OYGA 1C1BA 2E4LA 3O3HA 3VA3A 4DTPA 4DTMA 3VQ5A 1DLOA 1S1XA 4FLZA 4GVMA 5J2NA 5FDLA 4CHZA 1QHTA 1RT7A 3QINA 3K5OA 3TAEA 4FJKA 4IDKA 1KFSA 4JS4A 1SL0A 3AVNA 2O4IA 5J1EA 5HRNA 1VK0A 4CIGA 4FJ7A 3LDSA 1RT3A 3AO2A 2HMIA 4E7HA 4KPYA 2E6LA 3DLRA 4B08A 1TKDA 4KKOA 4K8XA 3OYLA 3AVCA 3HXMA 4IG0A 4BDZA 1C6VA 1LW2A 3HM9A 4FJ8A 4BWMA 3V1RA 3SUOA 3LWLA 4H8KA 3C94A 3QESA 1IO2A 3KLGA 2FBXA 4KHSA 1VSFA 1L3UA 4FJ9A 1A5XA 3JYTA 2GBZA 4JRPA 4DU3A 2XY6A 2PYLA 5CZ2A 4BE2A 2KFNA 4DSIA 4Q5VA 4CF0A 1ZBLA 2ZD1A 1LWCA 3P1GA 2D0AA 2FBTA 3VQQA 4Z4HA 5I42A 3WNEA 2DY4A 4C8MA 4F3OA 4N41A 1QSLA 3CFPA 2VWKA 3TI0A 3EYZA 3HVTA 4FLUA 2Y1IA 3KD1E 1U04A 3ZSXA 1UA1A 2HHTA 3A2FA 3AA3A 2BDPA 3TAFA 1JLBA 4CGHA 2D0CA 2X74A 2YHBA 3VQBA 1TV6A 3OYNA 4DTJA 3DI6A 4N76A 1WAJA 3OVNA 4CEQA 1X9WA 3AO1A 2YKNA 5KTQA 3ALYA 2B4JA 3OYEA 1CXUA 3NH2A 1QQCA 3M8SA 1NKEA 4KI6A 4OLBA 1LW0A 1HQUA 4KFBA 2XY7A 4B9VA 4FK2A 1CXQA 1RBVA 1REVA 4DMNA 4BE1A 4FLWA 3AA2A 3RRHA 4LD0A 3I0RA 4FJMA 1JLGA 2KZMA 4KI4A 2HNYA 4CGJA 1S1TA 3VQ9A 4YFUA 3LZJA 4CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BGR A;  1RBR A;  1S5J A;  4OKK A;  4M45 A;  1TK5 A;  4CJQ A;  2ATQ A;  3ISN C;  2B6A A;  4I2P A;  1Q9Y A;  2VG7 A;  2XY8 A;  3ZSQ A;  3CQ8 A;  3L2W A;  3G0Z A;  1RDC A;  4JLH A;  5KGW A;  4DFK A;  1NK9 A;  1D9D A;  5HRO A;  1U47 A;  3M8Q A;  5E41 A;  3AA4 A;  3CYM A;  4IBN A;  4I2Q A;  3EY1 A;  1BL3 A;  1RTD A;  1LAW A;  3MXJ A;  3FFI A;  3NH1 A;  1KSP A;  1HPZ A;  4O55 A;  1J54 A;  3D0P A;  1WSJ A;  1VSH A;  1WSG A;  3SPZ A;  3PY8 A;  4FJG A;  4M3U A;  4PUO A;  3ZCM A;  3SQ1 A;  3L3V A;  1BIU A;  1TKX A;  3V1Q A;  4CEE A;  4CHP A;  4O44 A;  4CHY A;  1UOC A;  3HPO A;  1NJW A;  2GV9 A;  4OGE A;  1TKZ A;  4CEZ A;  4CEO A;  1BQM A;  1BCM A;  4R5P A;  1NKC A;  3AVH A;  3HO1 A;  2G8I A;  3ZSO A;  4FK4 A;  1YT3 A;  1S9E A;  1ASU A;  1MU2 A;  2IAJ A;  3VQ6 A;  1TAQ A;  2ZQB A;  4FM2 A;  1L3T A;  3WNF A;  1A5W A;  3NF6 A;  4OPJ A;  4CJU A;  1NJX A;  4AHS A;  3LP1 A;  3V4I A;  1CZ9 A;  1VSL A;  3OS2 A;  3V9U A;  4TSX A;  4DU1 A;  1CLQ A;  3EZ5 A;  4C8K A;  4AHU A;  1WAF A;  3DLG A;  2XHB A;  5K14 A;  3QNN A;  2RN2 A;  2PZS A;  2OYQ A;  4CE9 A;  3V6D A;  4AIL C;  1I39 A;  3AO3 A;  4CJF A;  3NGI A;  3NF8 A;  2P5G A;  4J2A A;  4RW4 A;  4F3T A;  1FKP A;  1JXB A;  3TAN A;  3ZT2 A;  3KKS A;  2FC0 A;  3QER A;  3DYA A;  2ITG A;  4B9N A;  3RRG A;  4C8O A;  1WNS A;  3ZSW A;  3KLH A;  3OJU A;  1BQN A;  2ETJ A;  1SKW A;  4KHU A;  4HCB A;  4DTN A;  4E0D A;  1W9H A;  3RWU A;  5KI6 A;  2NUB A;  5CY4 A;  1QS4 A;  3VQP A;  2OZS A;  4M3Z A;  4CHN A;  3V9S A;  1NK7 A;  2HB5 A;  4OKE A;  1X9S A;  3F9K A;  4E19 A;  3OS0 A;  3LPT A;  1ZBU A;  5KRS A;  1U45 A;  4B9S A;  3SV4 A;  4NCG A;  4QAG A;  3VA0 A;  1QE1 A;  4HVJ A;  2IOC A;  3VQC A;  3MXI A;  4I9Q A;  2HHX A;  3AO5 A;  1J5O A;  4DTR A;  1T03 A;  4B9T A;  2GUI A;  4J2E A;  2DFF A;  5HRS A;  1VSD A;  1SL2 A;  4CF1 A;  5FRO A;  5T7B A;  3SUN A;  1L3S A;  4FZZ A;  3VQD A;  2P5O A;  3LWM A;  4CF8 A;  1IKY A;  3K59 A;  1T7P A;  4OLA A;  3SNN A;  4M3R A;  3RMB A;  4DSJ A;  4HUE A;  3SUP A;  4OKJ A;  1RNH A;  3LZI A;  1TAU A;  3NE6 A;  1J9A A;  4BDP A;  1TK8 A;  2JLE A;  3K5M A;  3BDP A;  4B8A B;  1XHZ A;  3DLE A;  1RIL A;  4ID1 A;  1NK8 A;  1RT2 A;  1VSM A;  3LAN A;  3T19 A;  4DQR A;  4FXD A;  1FXX A;  2D0B A;  3NH0 A;  3CG7 A;  1JLF A;  2VWJ A;  1GOC A;  4CGG A;  3WNG A;  4CEC A;  3QEX A;  4GMJ B;  3WNH A;  4FM0 A;  1DTT A;  2KQ2 A;  3DLK A;  3K57 A;  1RTI A;  1VSI A;  4CGI A;  3KK2 A;  2A1S A;  2XY5 A;  3K5N A;  2PYJ A;  3C6T A;  1T8E A;  4ID5 A;  1TK0 A;  4N47 A;  1NK5 A;  4DQI A;  1HQE A;  4MFB A;  4FW2 A;  3ZT3 A;  4CK2 A;  3KK3 A;  4DTU A;  4FJL A;  4KHN A;  4IFV A;  3SQ4 A;  2G8H A;  4HCC A;  5CYQ A;  3TAG A;  1ASV A;  4NCB A;  4PY5 A;  4IFY A;  4ICL A;  3NF7 A;  3SV3 A;  2BAN A;  5KRT A;  4EP5 A;  3QEV A;  3ZT0 A;  4CJW A;  4O0J A;  4J2D A;  4F4K A;  2OZM A;  2F8S A;  5CYM A;  1N5Y A;  4E89 A;  4DS5 A;  4RG8 A;  1TL3 A;  2DFH A;  1JLQ A;  3LP0 A;  4CJP A;  2DFE A;  1SL1 A;  4WE1 A;  4CJ5 A;  1ZYQ A;  4FJI A;  3SI6 A;  1F21 A;  2HND A;  2YHA A;  5CZ1 A;  2E6M A;  4E7J A;  2I5J A;  4CEB A;  4CK1 A;  3OY9 A;  4E7K A;  3VQE A;  4OJR A;  3TAP A;  1KVB A;  2KTQ A;  5DK5 A;  3F73 A;  4AH9 A;  4FK0 A;  4M3X A;  2HHW A;  3AO4 A;  3LP3 A;  3NF9 A;  4CED A;  2FBV A;  1NOZ A;  4M3T A;  1W0H A;  2OPP A;  3PO4 A;  1XHX A;  3KKR A;  1SKS A;  2R7Y A;  1EXQ A;  3O3F A;  1YTU A;  2X6S A;  1WN7 A;  1L5U A;  1RDB A;  2RKI A;  3VQ7 A;  1XWL A;  3LAM A;  3RMD A;  2QKB A;  1HNV A;  4AHV A;  3QET A;  4H4M A;  5DMR A;  1U48 A;  1ZBH A;  1KLM A;  4W5N A;  3PX6 A;  3PUF A;  4DQS A;  4CF9 A;  2KW4 A;  4M3Y A;  2G8F A;  4XIU A;  3ZSZ A;  1IKX A;  2Z1J A;  1EKE A;  3AVM A;  4LH5 A;  4KRE A;  1ZBF A;  4KTW A;  3OJS A;  4HHT A;  1HYZ A;  1BHL A;  4NCA A;  3PX4 A;  1NJY A;  4CFC A;  5J2Q A;  3SQ0 A;  3OYM A;  5I3U A;  4CF2 A;  3SZ2 A;  4Z4F A;  3ZSY A;  2YNI A;  3H08 A;  1NK6 A;  2BGG A;  4B9U A;  4FJH A;  2EHG A;  3O3G A;  3TAR A;  3RTV A;  1JKH A;  1JLA A;  2P1J A;  2Y1J A;  1D9F A;  4L8R B;  2LSN A;  3DOL A;  4E3S A;  4KB1 A;  1GOA A;  1RT5 A;  1WLJ A;  4E1N A;  2YNH A;  4DFP A;  4K8Z A;  3TAQ A;  4QCL A;  3OYB A;  1IH7 A;  3M8P A;  3U3Y A;  3LAL A;  3I8D A;  1T05 A;  3PO5 A;  4DLG A;  2DTU A;  1UWB A;  3AV9 A;  3MEG A;  1JXE A;  3AVA A;  1UAX A;  3RMC A;  1RCH A;  3HP6 A;  3PX0 A;  1IG9 A;  1VSE A;  3NBP A;  1BI4 B;  4B9M A;  4DFJ A;  3ITH A;  2G8W A;  4KAZ A;  1GOB A;  3NHG A;  1HNI A;  3ASM A;  4CCH A;  4DWI A;  3IS9 A;  4LSN A;  4CGD A;  1ITG A;  3O4Q A;  3ZT1 A;  1S1V A;  1X9M A;  1L3V A;  1S6P A;  4Z4C A;  4Z4G A;  4J2B A;  4ELU A;  1KVC A;  4CJ3 A;  2KFZ A;  1RT1 A;  3ZSR A;  1QSY A;  3OYA A;  3NAE A;  1HYV A;  1J53 A;  1JLC A;  1S6Q A;  3HST B;  3VN5 A;  1B9D A;  3OS1 A;  3K58 A;  1B92 A;  4HUF A;  3T3F A;  3PV8 A;  1U4B A;  1HYS A;  4FJJ A;  4W5Q A;  1I3A A;  3KLF A;  3RR8 A;  3O4N A;  3L3U A;  4JS5 A;  4MQ3 A;  3V1O A;  4YNQ A;  3S3O A;  4RW8 A;  3OYC A;  1KFD A;  3P5J A;  1RBU A;  3OYD A;  4CER A;  3HL8 A;  4DFM A;  2B5J A;  4I9L A;  2PY5 A;  4F2R A;  3HP9 A;  1EX4 A;  4CJS A;  4KRF A;  4FVM A;  4DQQ A;  4EP4 A;  4AHR A;  1NKB A;  4CJT A;  3C6U A;  4GW6 A;  1VSK A;  4FZY A;  2OPQ A;  4DSK A;  1C1C A;  1KCF A;  3I0S A;  1KTQ A;  1K6Y A;  3DLH A;  3K2P A;  3UIQ A;  2G8K A;  4FLY A;  4FJX A;  3S9H A;  1HJR A;  1JL1 A;  1B9F A;  1Z25 A;  3LAK A;  4CHO A;  3ULD A;  3IAY A;  3NGY A;  2HHV A;  4O4G A;  3KLI A;  3VQ8 A;  1R0A A;  4I7F A;  4KV8 A;  1ZBI A;  3OYJ A;  4FZX C;  2X78 A;  4DG1 A;  2HHQ A;  1BGX T;  1S9G A;  2O4G A;  2RPI A;  1TL1 A;  5C24 A;  3QEW A;  4OGC A;  3QEI A;  3DRS A;  1U49 A;  3KTQ A;  4FYD A;  4DTS A;  1LWE A;  3DLB A;  2Q3S A;  4E7L A;  1C1A A;  1RDD A;  3E01 A;  3DM2 A;  4CIE A;  4M42 A;  5HRR A;  1LWF A;  4NYF A;  1O1W A;  3SUQ A;  2VG6 A;  3THV A;  2ZE2 A;  3CFO A;  3AVG A;  3TAM A;  4LH4 A;  4KO0 A;  5HLF A;  4M3W A;  1Z26 A;  4AHC A;  2AJQ A;  3U3G A;  3DOK A;  4B9L A;  3QO9 A;  1DTQ A;  4G1Q A;  5JS2 A;  4DF8 A;  4UQG A;  5J2M A;  2OPR A;  1HMV A;  4W5T A;  1RDA A;  4PA1 A;  4IKF A;  1D8Y A;  5SZT A;  3L2U A;  3KD5 E;  1C0M A;  4RW6 A;  3AVB A;  1Q8I A;  2Z1I A;  4CGF A;  1XC9 A;  3NCI A;  4W5O A;  3M8R A;  3JSM A;  2P51 A;  1EP4 A;  3LP2 A;  4N56 A;  3L2R A;  5C25 A;  3KIO A;  3B6O A;  5JS1 A;  4ELV A;  4CJ4 A;  3OYK A;  3V9X A;  3DMJ A;  3OYH A;  3QIO A;  4CFA A;  3HPG A;  1VSJ A;  2IDO A;  4KTZ A;  3AVL A;  3SYZ A;  3AVJ A;  5J2P A;  4O0I A;  3SQ2 A;  1N6Q A;  4EZ9 A;  4B3O A;  2QK9 A;  2HW3 A;  3VQ4 A;  3D45 A;  4CJL A;  3DRR A;  3MEE A;  3G10 A;  3OYF A;  3V9Z A;  3QNO A;  3HVR A;  4CHQ A;  3SJJ A;  3L8B A;  4E1M A;  3IRX A;  4IG3 A;  1C0T A;  3NDK A;  4DSE A;  4FM1 A;  4FLT A;  3V9W A;  4DS4 A;  2RF2 A;  2G8U A;  1WSI A;  2EX3 A;  2IGI A;  3MAQ A;  3TAB A;  4JRQ A;  1YVU A;  4DF4 A;  3CM6 A;  4HUG A;  4FLV A;  4CJK A;  2JGU A;  4LSL A;  2Z1H A;  2D5R A;  1RTJ A;  3MEC A;  2VG5 A;  1TKT A;  3L2Q A;  4KB0 A;  1RBS A;  3TWH A;  4PQU A;  2QXF A;  1BIS A;  1CZB A;  1X1P A;  4DU4 A;  1SV5 A;  2XRI A;  3U6F A;  4ZTJ A;  3KJV A;  4M41 A;  3ZSV A;  3QEP A;  5D3G A;  2W42 A;  1S1W A;  4AHT A;  3C95 A;  5SWM A;  1RT6 A;  1KLN A;  3CM5 A;  5C42 A;  4KTQ A;  4HTU A;  3S3N A;  1SKR A;  3B6P A;  4NYN A;  1Q9X A;  1TGO A;  3L2V A;  4BE0 A;  1WSF A;  2F8T A;  4O5B A;  1XI1 A;  3TR8 A;  4F8R A;  2F96 A;  3AVF A;  1LAV A;  3DRP A;  5KGX A;  5HP1 A;  4KHW A;  3NGZ A;  3HJF A;  1RTH A;  4CJE A;  1LV5 A;  3AVI A;  4ZHR A;  1EET A;  4FW1 A;  4CES A;  1FK9 A;  1BI4 A;  3MXM A;  5EU7 A;  4CK3 A;  2G8V A;  2QKK A;  1RBT A;  4CFD A;  2IS3 A;  4BDY A;  4KHQ A;  1TVR A;  4DTO A;  2YV0 X;  2BE2 A;  5HRP A;  4C8L A;  3IG1 A;  1KVA A;  2YNF A;  3QIP A;  4Z0U A;  1SUQ A;  2WON A;  1RT4 A;  1A5V A;  4CEF A;  4H4O A;  4KHY A;  1FKO A;  2XO7 A;  4FJ5 A;  3VQA A;  2WOM A;  4OVL A;  4DTX A;  3NFA A;  2KZZ A;  3T1A A;  3MED A;  2FBY A;  4RW9 A;  4OPK A;  3SCX A;  3V81 A;  1YTA A;  4FLX A;  1ASW A;  2HHU A;  1NOY A;  4C8N A;  3KK1 A;  4PWD A;  1NK0 A;  1KRP A;  3RMA A;  4E7I A;  1QTM A;  1UA0 A;  2OA8 A;  2HVI A;  3RR7 A;  5HBM A;  4DSL A;  4LY7 A;  4FCY A;  3SPY A;  4DQP A;  4QOZ B;  1JL2 A;  1NK4 A;  3AVK A;  4RW7 A;  4CFB A;  4Q0B A;  3OYI A;  3HK2 A;  2YNG A;  4BWJ A;  2HVH A;  2A1R A;  4B8C A;  1IKV A;  4Z4I A;  1QSS A;  4Y1D A;  3HT3 A;  2HNZ A;  4Z4E A;  4CJV A;  3HPH A;  5FRN A;  3S3M A;  1BCO A;  3K5L A;  3CFR A;  3ZT4 A;  1G15 A;  1VRT A;  4CIF A;  3AA5 X;  1D5A A;  4FJN A;  4F2S A;  3P83 D;  4DLE A;  4ZTF A;  4EZ6 A;  2Z1G A;  3LPU A;  1IKW A;  1HRH A;  4CJR A;  2YKM A;  4BAC A;  4W5R A;  5FRM A;  1S1U A;  1WSE A;  4N5S A;  4DSF A;  1C0U A;  1Y97 A;  1VRU A;  2HHS A;  1JLE A;  4ELT A;  1NJZ A;  2X6N A;  3HYF A;  3QLH A;  3KLE A;  1WSH A;  2OPS A;  4Y1C A;  1BIZ A;  2IC3 A;  3OYG A;  1C1B A;  2E4L A;  3O3H A;  3VA3 A;  4DTP A;  4DTM A;  3VQ5 A;  1DLO A;  1S1X A;  4FLZ A;  4GVM A;  5J2N A;  5FDL A;  4CHZ A;  1QHT A;  1RT7 A;  3QIN A;  3K5O A;  3TAE A;  4FJK A;  4IDK A;  1KFS A;  4JS4 A;  1SL0 A;  3AVN A;  2O4I A;  5J1E A;  5HRN A;  1VK0 A;  4CIG A;  4FJ7 A;  3LDS A;  1RT3 A;  3AO2 A;  2HMI A;  4E7H A;  4KPY A;  2E6L A;  3DLR A;  4B08 A;  1TKD A;  4KKO A;  4K8X A;  3OYL A;  3AVC A;  3HXM A;  4IG0 A;  4BDZ A;  1C6V A;  1LW2 A;  3HM9 A;  4FJ8 A;  4BWM A;  3V1R A;  3SUO A;  3LWL A;  4H8K A;  3C94 A;  3QES A;  1IO2 A;  3KLG A;  2FBX A;  4KHS A;  1VSF A;  1L3U A;  4FJ9 A;  1A5X A;  3JYT A;  2GBZ A;  4JRP A;  4DU3 A;  2XY6 A;  2PYL A;  5CZ2 A;  4BE2 A;  2KFN A;  4DSI A;  4Q5V A;  4CF0 A;  1ZBL A;  2ZD1 A;  1LWC A;  3P1G A;  2D0A A;  2FBT A;  3VQQ A;  4Z4H A;  5I42 A;  3WNE A;  2DY4 A;  4C8M A;  4F3O A;  4N41 A;  1QSL A;  3CFP A;  2VWK A;  3TI0 A;  3EYZ A;  3HVT A;  4FLU A;  2Y1I A;  3KD1 E;  1U04 A;  3ZSX A;  1UA1 A;  2HHT A;  3A2F A;  3AA3 A;  2BDP A;  3TAF A;  1JLB A;  4CGH A;  2D0C A;  2X74 A;  2YHB A;  3VQB A;  1TV6 A;  3OYN A;  4DTJ A;  3DI6 A;  4N76 A;  1WAJ A;  3OVN A;  4CEQ A;  1X9W A;  3AO1 A;  2YKN A;  5KTQ A;  3ALY A;  2B4J A;  3OYE A;  1CXU A;  3NH2 A;  1QQC A;  3M8S A;  1NKE A;  4KI6 A;  4OLB A;  1LW0 A;  1HQU A;  4KFB A;  2XY7 A;  4B9V A;  4FK2 A;  1CXQ A;  1RBV A;  1REV A;  4DMN A;  4BE1 A;  4FLW A;  3AA2 A;  3RRH A;  4LD0 A;  3I0R A;  4FJM A;  1JLG A;  2KZM A;  4KI4 A;  2HNY A;  4CGJ A;  1S1T A;  3VQ9 A;  4YFU A;  3LZJ A;  4CEA A; 
#chains in the Genus database with same CATH topology
 3EZW A;  1RBR A;  1S5J A;  1Q9Y A;  3ZSQ A;  3L2W A;  1RDC A;  4JLH A;  1U47 A;  3FZM A;  5M1Q A;  3AA4 A;  3O8M A;  4IBN A;  2P9S A;  3MXJ A;  4JI6 K;  3CJB A;  4ISG A;  3SPZ A;  3A8Y A;  2QWM A;  2Q1N A;  3ZX3 A;  4QS8 A;  3T1Y K;  3ZCM A;  3SQ1 A;  4B3R K;  3GL1 A;  4CHP A;  2GV9 A;  4OGE A;  3MMV A;  1BCM A;  4XH1 A;  3CF5 L;  4ILG B;  1NGF A;  4AM6 A;  1ASU A;  3UKR B;  2IAJ A;  3CET A;  3LM2 A;  3NF6 A;  4OPJ A;  4LF4 K;  2NRW A;  2P9P A;  3ULE A;  4R79 A;  1QQO A;  3DLL L;  3ULE B;  2XHB A;  2PZS A;  2RN2 A;  3E9P A;  3V6D A;  4AIL C;  1I39 A;  4J2A A;  2HBK A;  3NF8 A;  5LJV A;  2P5G A;  4BR4 A;  4F3T A;  1FKP A;  3KKS A;  2FC0 A;  1VQ9 N;  3RRG A;  1T6D A;  2NRZ A;  3VF2 A;  1SKW A;  5FLX O;  2NUB A;  3VQP A;  3WXJ A;  2W6L A;  2HOE A;  2HB5 A;  4OKE A;  1GLC G;  1ZBU A;  2QWL A;  4NCG A;  4QAG A;  4I9Q A;  3MXI A;  3ZX0 A;  2HHX A;  1J5O A;  4DTR A;  1T03 A;  2YHW A;  1IBM K;  4BC4 A;  1VSD A;  4JAX A;  2FF6 A;  3VQD A;  3LWM A;  3K59 A;  1KQS M;  5BN8 A;  3RMB A;  3CPW M;  1E4G T;  2Q0R A;  3QIC A;  3VEN A;  1TK8 A;  2JLE A;  2D1K A;  3HZ6 A;  4ILJ A;  4OPA A;  5AQI A;  3BDP A;  4B8A B;  4B1U B;  3DLE A;  3U9D A;  1RIL A;  4ID1 A;  1NK8 A;  1HKB A;  2IVN A;  1VSM A;  4FXD A;  3T19 A;  4DQR A;  3CG7 A;  1GOC A;  3RSE A;  2O8B A;  3WNG A;  3QEX A;  2KQ2 A;  4OO1 J;  3WXL A;  3C6T A;  4ID5 A;  4CD1 A;  4DTU A;  4MFB A;  4YOW A;  4CK2 A;  4MLE A;  1X3N A;  4NCB A;  1ASV A;  4PY5 A;  5KRT A;  4EP5 A;  5JS1 A;  3BEX A;  3ZT0 A;  4F4K A;  2ZWH A;  1W2B M;  1IBL K;  2QWQ A;  3E1Y A;  5C0Y A;  4RG8 A;  1TL3 A;  1JLQ A;  1SL1 A;  4WE1 A;  1ZYQ A;  2YI1 A;  4DV3 K;  2E6M A;  4E7J A;  3D7E O;  4IOX A;  3NF9 A;  3LDP A;  1XHX A;  3T69 A;  4LF7 K;  2X6S A;  5AQS A;  1YHQ N;  2RKI A;  4FVU A;  3LAM A;  4B1Y B;  3RMD A;  1HNV A;  1ZBH A;  5DMR A;  4CZM A;  2KHO A;  3WEE B;  2IVP A;  2KW4 A;  2Q36 A;  2G8F A;  1IKX A;  3AVM A;  1OVY A;  3A5L C;  4IOC L;  3OJS A;  4A61 A;  2AP1 A;  3O1W A;  4NCA A;  4NB4 A;  4DR4 K;  5JIC A;  3SQ0 A;  3J8A A;  4Z4F A;  2BGG A;  5F2R A;  1KC8 O;  5JMV A;  1MA9 B;  2P1J A;  1GOA A;  4LC9 B;  4X65 K;  1BO5 O;  5EVZ A;  1IH7 A;  3CHW A;  3LAL A;  4DLG A;  2DTU A;  1BUP A;  2P9I B;  3AAQ A;  1JXE A;  4DR2 K;  1DGK N;  1GLA G;  1VSE A;  1M1K O;  4DV7 K;  3MWT A;  5GIO A;  5AQR A;  5LL6 Z;  4YY3 K;  1CZA N;  3IS9 A;  3FE1 A;  3VOV A;  1KVC A;  1RT1 A;  1KAX A;  4I6M A;  1J53 A;  1JLC A;  1B9D A;  1ILY A;  1HYS A;  1I3A A;  3KLF A;  4FWN A;  4FWO A;  1ZXO A;  4MQ3 A;  1P90 A;  3OYD A;  2Q2R A;  1RBU A;  5C2D A;  4CER A;  4BRG A;  1QHA A;  1YI2 N;  1XNR K;  4CJS A;  5AQQ A;  5BRH A;  1YJN N;  4CJT A;  1HNW K;  5BRE A;  4FZY A;  1C1C A;  1KCF A;  5BN9 A;  3UIQ A;  1K6Y A;  2G8K A;  1B9F A;  4CHO A;  4UY8 O;  2HHV A;  4O4G A;  1R0A A;  3MX5 A;  3OYJ A;  4FZX C;  2HHQ A;  4DG1 A;  3QEW A;  3KTQ A;  4B1W B;  3QEI A;  4DTS A;  1LWE A;  4BR2 A;  2A40 A;  4E7L A;  4M42 A;  5HRR A;  1VQO N;  1O1W A;  1BDG A;  3SUQ A;  2VG6 A;  2ZE2 A;  2QWP A;  3AVG A;  3TAM A;  4LH4 A;  4H0Y B;  4FOE A;  3D6R A;  3DOK A;  3O1B A;  4B9L A;  3QO9 A;  4UQG A;  4OX9 K;  4PA1 A;  3WUH A;  3AVB A;  3VEO A;  1XMO K;  4CGF A;  3M8R A;  3O9T A;  2P51 A;  1EP4 A;  3FZH A;  4C1N I;  4DR7 K;  4CJ4 A;  3OYK A;  4WCE L;  4JKF A;  1VSJ A;  5KPZ A;  3SYZ A;  1GLF O;  3D45 A;  3DRR A;  3MEE A;  2WBN A;  2V7Y A;  3D2E B;  3T7Z A;  1H1V A;  3NDK A;  4PL7 A;  2EX3 A;  3TAB A;  2E2O A;  4FLV A;  2H3G X;  2JGU A;  2D5R A;  4KB0 A;  5M1O A;  2VYP A;  4ZTJ A;  3QEP A;  4JKB A;  1S1W A;  4AHT A;  3R3L A;  2JWK A;  3C95 A;  1RT6 A;  4Y0W A;  1KLN A;  3D2F A;  1NNE A;  3S3N A;  1LOT B;  3B6P A;  3I55 N;  1G99 A;  3E66 A;  3ENO A;  4BVP A;  3K0S A;  4F8R A;  4BRQ A;  5KGX A;  3FFK B;  3O6W A;  4K25 A;  4CES A;  1FK9 A;  1XUP O;  1BI4 A;  5EU7 A;  1RBT A;  3A5N C;  1NMD A;  5HRP A;  3THX A;  4NXN K;  4C8L A;  2YNF A;  3L4Q A;  1ESV A;  5JVH L;  3FZL A;  1SUQ A;  3CCU N;  1RT4 A;  4H4O A;  4KHY A;  3THX B;  2XO7 A;  2E88 A;  4FJ5 A;  2WOM A;  1QQM A;  2PFU A;  3T1A A;  4OPK A;  3SCX A;  1YTA A;  5F1X A;  5AQK A;  2Q31 A;  4BRI A;  4JKG B;  3UKU A;  4PWD A;  1QTM A;  3O9Q A;  4DHY A;  4FCY A;  4QOZ B;  1NK4 A;  5AQX A;  1X3M A;  1GLB G;  1YUW A;  3VEZ A;  4B8C A;  3G4S N;  4JI1 K;  4JEP A;  3VGL A;  4DV1 K;  2HNZ A;  3J7Z O;  4Z4E A;  2UXC K;  3HPH A;  5FRN A;  2CGJ A;  1YF5 L;  2ZJP L;  1BCO A;  1G15 A;  2NRH A;  1Y64 A;  4FJN A;  3P83 D;  4DLE A;  5AQY A;  4ZTF A;  4EIA A;  2YKM A;  5BR8 K;  4H0O A;  1C0U A;  3GOI A;  2QEX N;  1NJZ A;  3QLH A;  1HKG A;  2WC9 A;  2PBD A;  3OYG A;  2IC3 A;  2ZJQ L;  2E4L A;  4BRP A;  4DTP A;  4FLZ A;  4JKC A;  3LM9 A;  3K5O A;  4FJK A;  1MWK A;  4IDK A;  1X9J A;  3CIP A;  3VGM A;  4FJ7 A;  3VEV A;  2E2N A;  2QW9 A;  1QVG M;  4KPY A;  2E6L A;  4K8X A;  4FJ8 A;  5GIP A;  2JWL A;  4CD3 A;  4OPH A;  2FBX A;  3JAM O;  1L3U A;  4PKG A;  2XY6 A;  4DU3 A;  4DSI A;  5M1F A;  5ADX A;  3VQQ A;  3QML A;  3WNE A;  4N41 A;  3HVT A;  1UA1 A;  4YDU C;  2BDP A;  2YHY A;  3CCS N;  4KH6 A;  1JLB A;  4DTJ A;  1MDU B;  4N76 A;  5KTQ A;  1KAY A;  4H0T B;  3PIO L;  3S41 A;  3OYE A;  1NKE A;  3BP8 A;  3CER A;  4GNI A;  4AQY K;  4K43 A;  1CXQ A;  1RBV A;  4DMN A;  1HUX A;  3AA2 A;  1JLG A;  5BPM A;  4LF8 K;  5DM6 L;  3LZJ A;  3BGR A;  4OKK A;  3J80 O;  1QZ5 A;  4M45 A;  2ATQ A;  4I2P A;  2B6A A;  1HJO A;  2XY8 A;  5HRO A;  5E41 A;  3CYM A;  3EY1 A;  3FFI A;  1VQL N;  3SJH A;  4O55 A;  1J54 A;  1VSH A;  1WSG A;  4M3U A;  4FWK A;  2P9K A;  4CHY A;  4O44 A;  1TKZ A;  1BQM A;  4IOA L;  2VQE K;  1YT3 A;  4BC3 A;  1MU2 A;  3VQ6 A;  3WNF A;  2GEL A;  3CJ1 A;  1NJX A;  3LP1 A;  3HRG A;  3EZ5 A;  3ZEU A;  4C8K A;  4DB3 A;  5K14 A;  4YDU A;  1W97 L;  2UXD K;  4CE9 A;  4IZ9 A;  4RW4 A;  4BQL A;  5B8H A;  4JD2 B;  2F7T A;  1JXB A;  3TAN A;  3CXC M;  3ZT2 A;  3MX2 A;  5A2Q O;  3QER A;  1KXP A;  4HWI A;  2UUC K;  2ITG A;  1TYQ A;  3ID8 A;  4C8O A;  1WNS A;  4M3Y A;  1BQN A;  3MCP A;  2ZF5 O;  5KI6 A;  2O8D A;  5AZJ A;  2OZS A;  4M3Z A;  3V9S A;  3J7Y P;  1IJJ A;  3F9K A;  4FWR A;  3WQU A;  4B9T A;  4FO0 A;  3F5T A;  4J2E A;  2DFF A;  1QZ6 A;  4CF1 A;  3O5B A;  3SUN A;  1IKY A;  1HX1 A;  4OLA A;  3LZI A;  3P31 A;  4BDP A;  1XHZ A;  1FXX A;  3NH0 A;  1JLF A;  5KQ8 A;  2VWJ A;  1N36 K;  5JLF A;  4CGG A;  4CEC A;  1VSI A;  3THY A;  2XY5 A;  3K5N A;  1T8E A;  1TK0 A;  4N47 A;  4DQI A;  3Q7B A;  4FW2 A;  4FJL A;  2QWO A;  4KHN A;  3SQ4 A;  3THY B;  5MLC Q;  5CYQ A;  4HCC A;  5C12 A;  4IFY A;  3SV3 A;  2BAN A;  4O0J A;  2RHK A;  5AQT A;  4E89 A;  5JVG L;  3HM8 A;  4CJP A;  4RTF D;  2ASP A;  4CK1 A;  4E7K A;  5H1S Q;  3MWP A;  3OHR A;  4YOR A;  3F73 A;  3VF4 A;  4FK0 A;  3AO4 A;  4H0V B;  3T1H K;  4M3T A;  1LCU A;  2OPP A;  1EXQ A;  3O3F A;  1YTU A;  1Q7Y O;  3VQ7 A;  4PKH A;  1U48 A;  4W5N A;  3EN9 A;  4DQS A;  3MN9 A;  4CZG A;  4V19 S;  2NNW A;  4ISE A;  3ZSZ A;  4KRE A;  1EKE A;  3ZX2 A;  3Q7C A;  4BRC A;  1HYZ A;  1GLD G;  4CFC A;  3OYM A;  3H08 A;  3UKR A;  3WQT A;  4CBU A;  3MN7 A;  2VCP A;  4BR5 A;  1JLA A;  5I9E B;  1D9F A;  2E2P A;  4BY9 C;  3DOL A;  3VEW A;  4E3S A;  1WLJ A;  3HSC A;  1N34 K;  5GAD P;  3OYB A;  3U3Y A;  4M63 C;  3I8D A;  1VQ7 N;  1V4S A;  3AVA A;  4BRA A;  3H3O B;  3RMC A;  3HP6 A;  3M6G A;  3QBX A;  1VQ8 N;  1NLV A;  4LSN A;  3I8B A;  3O4Q A;  1L3V A;  4JI5 K;  3N4P A;  4CJ3 A;  1SAZ A;  3BUZ B;  3PV8 A;  3VN5 A;  3K58 A;  3A5M C;  4HUF A;  4JKD A;  1U4B A;  1K8K A;  1JCG A;  4WFA L;  1XC3 A;  3S3O A;  3CJC A;  1K8K B;  3AY9 A;  3O4W A;  3HP9 A;  1EX4 A;  4FVM A;  4EP4 A;  4AHR A;  1NKB A;  3C6U A;  4GW6 A;  1VSK A;  2OPQ A;  3I0S A;  1KTQ A;  3PSF A;  3DLH A;  3K2P A;  4FJX A;  3S9H A;  3ULD A;  1ATR A;  3KLI A;  4NLC A;  5CR4 A;  3JS6 A;  4KV8 A;  2WTU A;  2X78 A;  2YX6 A;  5C24 A;  1S9G A;  2RPI A;  4FWQ A;  4FYD A;  1U49 A;  3E01 A;  3DM2 A;  3ATU A;  3CCQ N;  5HLF A;  4M3W A;  4JKE A;  4AHC A;  3U3G A;  1ATS A;  2UYT A;  3HOT A;  1DTQ A;  5J2M A;  4W5T A;  1RDA A;  4FWP A;  2FSN A;  3H3N O;  3K9J A;  3SAG A;  4CZE A;  1C0M A;  1HPM A;  1XC9 A;  4N56 A;  3L2R A;  3KIO A;  3B6O A;  3NVK A;  4ELV A;  3U4L A;  4IO8 A;  5M1K A;  2IDO A;  4KTZ A;  1NGJ A;  1OH6 A;  4BRH A;  3SBG A;  3H6E A;  2HW3 A;  4PL8 A;  3CC7 N;  3VQ4 A;  1RGI A;  3V9Z A;  2A6A A;  3J7A P;  3HVR A;  1HKC A;  4BC5 A;  4CHQ A;  4WFB L;  4E1M A;  3IRX A;  3WEE A;  1NG9 A;  4IG3 A;  1C0T A;  4GY2 B;  4FM1 A;  2CH6 A;  3V9W A;  2RF2 A;  4B1X B;  4DS4 A;  2G8U A;  2O8F B;  1RFQ A;  4U7B A;  4JRQ A;  2AA4 A;  3DXK B;  2NRR A;  2Q0U A;  4MO4 A;  2VG5 A;  3TWH A;  2E1Z A;  1CZB A;  1X1P A;  1SV5 A;  2XRI A;  5ELZ A;  3TTD A;  3KJV A;  2CGL A;  4M7Y A;  4LF6 K;  4JKH A;  3ZSV A;  3E9L A;  2W42 A;  4BRN A;  3ZYY X;  1VHX A;  4WQ4 C;  5AJ3 K;  4BRO A;  1YXQ A;  1YVN A;  3IKM A;  4O5B A;  4GV6 A;  2F96 A;  3AVF A;  3DRP A;  2P9I A;  3SMP A;  4DV2 K;  5HP1 A;  4KHW A;  1RTH A;  3HJF A;  4CJE A;  1LV5 A;  3EO3 A;  4ZHR A;  4FW1 A;  2O8E B;  4CK3 A;  1GLJ O;  2G8V A;  4CFD A;  2IS3 A;  1VQ4 N;  5AFU A;  4A59 A;  1A5V A;  4FWM A;  2PAV A;  1FJG K;  3VQA A;  4OVL A;  3NFA A;  2UUA K;  1ASW A;  5EOY A;  4C8N A;  3KK1 A;  1NGG A;  3VMF B;  4KBO A;  5JLH A;  2VGM A;  4CFB A;  3OBW A;  1RDW X;  4CJV A;  3CFR A;  4CIF A;  1Q81 O;  4LF9 K;  3QFU A;  4WQ4 A;  3LPU A;  3VPZ A;  3M5R A;  4W5R A;  1WSE A;  4N5S A;  4DSF A;  1Y97 A;  4H5N A;  5LJW A;  1Q82 O;  4FWS A;  3OW2 M;  1BIZ A;  3AGR A;  4A2B A;  1DLO A;  1EWQ A;  3MCA B;  5J2N A;  5FDL A;  4H03 B;  4WYB A;  1QHT A;  5AQH A;  4H0P A;  4J8F A;  4JS4 A;  3AVN A;  2WFB A;  1VK0 A;  3KVG A;  3LL3 A;  3H46 O;  1KAZ A;  1VQN N;  3LDS A;  4E7H A;  3TU5 A;  4AM7 A;  4B08 A;  2NLX A;  1TKD A;  3HXM A;  1C6V A;  1LW2 A;  4YOU A;  4BWM A;  4BRM A;  3SUO A;  3O9U A;  3ENB A;  4H8K A;  1NJI O;  1VSF A;  3D2E A;  3JYT A;  4BE2 A;  1ZBL A;  3O9S A;  1LWC A;  3P1G A;  2FBT A;  5I42 A;  3CME N;  4C8M A;  4LFA K;  3CFP A;  3EYZ A;  4NXM K;  3KD1 E;  2HHT A;  4H0X B;  3AA3 A;  3UE5 A;  2P9N B;  4CEQ A;  3PIP L;  2YKN A;  1CXU A;  1QQC A;  4H5V A;  1YIJ N;  1LW0 A;  3SLC A;  1WB9 A;  2IVO A;  3WT0 A;  1REV A;  4FLW A;  3RRH A;  4LD0 A;  3ZLJ A;  3QB0 A;  3VTH A;  1S1T A;  3VQ9 A;  4YFU A;  4CEA A;  4X62 K;  1HLU A;  1TK5 A;  3ISN C;  3CQ8 A;  1NK9 A;  3G0Z A;  5KGW A;  4DFK A;  4LF5 K;  1D9D A;  5IT9 O;  4JN4 A;  4I2Q A;  1BL3 A;  2A41 A;  3NH1 A;  1KSP A;  2BTF A;  1T44 A;  1WSJ A;  3D0P A;  3EE9 A;  4FJG A;  4PUO A;  3L2Q A;  4CEE A;  3V1Q A;  4CEZ A;  4CJ7 A;  4CEO A;  2W40 A;  3SAF A;  4R5P A;  2G8I A;  4ILH A;  3RVC A;  3ZSO A;  4FK4 A;  1L3T A;  1TAQ A;  4IFE A;  1A5W A;  1NGC A;  1N8R O;  4GKK K;  3V4I A;  4JKG A;  1CZ9 A;  4TSX A;  1CLQ A;  4M7X A;  4AHU A;  1WAF A;  3TSU A;  1EO1 A;  3DLG A;  3QNN A;  4JI3 K;  4FL9 A;  2OYQ A;  5TKW A;  3KZB A;  4DKW A;  1YJW N;  4ISF A;  1BA0 A;  3AO3 A;  4BRL A;  4CJF A;  3U9Z A;  2GWK A;  3O9R A;  1C0G A;  1S72 N;  4BRF A;  4K41 A;  5C15 A;  1XMQ K;  1ATN A;  4YOX A;  3DYA A;  4B9N A;  3FZF A;  3KLH A;  3OTO K;  2ETJ A;  3ZET B;  4DTN A;  3GDQ A;  1NGH A;  5KPT A;  3RWU A;  1OKJ A;  4A5B A;  4PHT X;  3FZK A;  1QS4 A;  4XEI A;  4CHN A;  1NK7 A;  3OS0 A;  3LPT A;  4DUY K;  5KRS A;  3O08 A;  3TPQ A;  3VA0 A;  3VQC A;  5AQU A;  2W41 A;  4IJA A;  2GUI A;  1DEJ A;  1BA1 A;  3I33 A;  4F9O A;  3LDQ A;  1FW6 A;  1K9M O;  2KLA A;  2A3Z A;  3SUP A;  4OKJ A;  1RNH A;  1TAU A;  1J9A A;  4BR0 A;  3K5M A;  3EEQ A;  4JK8 A;  1RT2 A;  1C0F A;  2D0B A;  1SS6 A;  2E2Q A;  5FPE A;  1JCE A;  3WNH A;  1DTT A;  3ZT3 A;  3UB5 A;  4IFV A;  2WUS A;  3TAG A;  2OTL N;  3NF7 A;  3QEV A;  2F8S A;  4CJW A;  2OZM A;  1N5Y A;  5C10 A;  4DS5 A;  2DFH A;  2DFE A;  2IIR A;  3NVM A;  4CJ5 A;  4FJI A;  2HND A;  2YHA A;  4O8U A;  2I7N A;  4CEB A;  2KTQ A;  5DK5 A;  1NOZ A;  1W0H A;  3PO4 A;  4FWL A;  3KKR A;  2R7Y A;  2VGN A;  4EAH D;  1WN7 A;  3OBY A;  1XWL A;  3QET A;  1Q86 O;  1JJ2 M;  1KLM A;  3PX6 A;  3PLA A;  3PUF A;  5GIN A;  2YCH A;  2ZJR L;  4XIU A;  2Z1J A;  5M1N A;  4LH5 A;  4KTW A;  4HHT A;  1BHL A;  2QA4 N;  5HOO A;  3PX4 A;  1NJY A;  5J2Q A;  5ADX H;  3W3D A;  4BVO A;  4CF2 A;  3SZ2 A;  1NK6 A;  4FJH A;  2QI2 A;  4C1N K;  3RTV A;  2BUP A;  2Y1J A;  4A62 A;  1WBB A;  4KB1 A;  1RT5 A;  4E1N A;  4K8Z A;  2HF4 A;  3L0Q A;  4QCL A;  4B9Q A;  2OCE A;  3AV9 A;  3R1X A;  3QFP A;  4JD2 A;  1IG9 A;  3NBP A;  3U8X A;  4B9M A;  4DFJ A;  3ITH A;  2G8W A;  4KAZ A;  4JI4 K;  3CJ7 A;  3IMX A;  3NHG A;  1HNI A;  3ASM A;  4CCH A;  1X9M A;  1HR0 K;  1ITG A;  3ZT1 A;  1S1V A;  3HBT A;  4YOY A;  4Z4C A;  4J2B A;  3OYA A;  3NAE A;  1S6Q A;  3HST B;  3OS1 A;  1OH5 A;  1B92 A;  4DR3 K;  4CZJ A;  4FJJ A;  4A2A A;  4W5Q A;  2V52 B;  4JS5 A;  3F9M A;  3QBW A;  3V1O A;  4YNQ A;  1KD1 O;  3I56 N;  1TUY A;  4RW8 A;  1KFD A;  3P5J A;  3VES A;  3CCJ N;  3HL8 A;  3LDL A;  4DFM A;  3CJ9 A;  2B5J A;  4F2R A;  3IDH A;  4BR7 A;  4DQ8 A;  4GKJ K;  4FLY A;  1HNZ K;  5E84 A;  1U2V A;  5AQM A;  4GVE A;  3VEX A;  1Z25 A;  3LAK A;  1U2V B;  1NGA A;  4I7F A;  3VGK A;  1ZBI A;  2QWR A;  4JI7 K;  3HI0 A;  2FXU A;  1RDD A;  4CIE A;  1LWF A;  4JK9 A;  3TSP A;  4CZK A;  3FGU A;  5AQO A;  2AJQ A;  2ASM A;  5JS2 A;  2OPR A;  3TSQ A;  1OH8 A;  4IKF A;  1D8Y A;  5SZT A;  4B3S K;  3EKU A;  4RW6 A;  1W7A A;  3AAP A;  4YOV A;  4W5O A;  3CCL N;  1M90 O;  3F2K A;  2E5L K;  3V9X A;  3OYH A;  3QIO A;  3A0I X;  3NMU A;  3HPG A;  4EHU A;  3AVL A;  4H5R A;  2D0O A;  3AVJ A;  5J2P A;  3EL2 A;  4O0I A;  1N6Q A;  3L6Q A;  3CCE N;  4MDB A;  4EFH A;  4CJL A;  3B8A X;  4CBX A;  3EKS A;  3SJJ A;  3L8B A;  3FLC O;  1WSI A;  2IGI A;  4BGB A;  4DF4 A;  2HMP A;  1U6Z A;  4CJK A;  4IXC A;  4LSL A;  3DXM B;  1VQM N;  3MEC A;  1Z6R A;  1TKT A;  1RBS A;  4PQU A;  3EE8 A;  1BIS A;  4DU4 A;  3IUC A;  3U6F A;  1EWR A;  5D3G A;  4CZL A;  4HTU A;  4B3M K;  4NYN A;  1TGO A;  3L2V A;  4BE0 A;  2F9W A;  1BOT O;  1XI1 A;  1LAV A;  3NGZ A;  5M1P A;  3SBT A;  2QKK A;  2P9S B;  4BDY A;  4DTO A;  3WXK A;  2BE2 A;  3IG1 A;  3QIP A;  2WON A;  4CI6 A;  1FKO A;  1I94 K;  4QS7 A;  2NRT A;  4AF1 A;  2KZZ A;  3MED A;  1O13 A;  4RW9 A;  5BPL A;  5AQJ A;  1E4F T;  3VF6 A;  2P9P B;  2O8C A;  2HBL A;  3G25 A;  1KRP A;  4E7I A;  2HVI A;  5GAE P;  2GEM A;  5HBM A;  1ZBS A;  4DSL A;  4LY7 A;  1K8A O;  3IFR A;  4CVN E;  2O8C B;  2YJF A;  3DWL A;  3AVK A;  3HK2 A;  2YNG A;  4BWJ A;  2HVH A;  4CW7 B;  1IKV A;  4Z4I A;  5F0X A;  5BRF A;  3HT3 A;  3ZT4 A;  4KH5 A;  4DR6 K;  2HHH K;  1VRT A;  1D5A A;  3CI5 A;  4EHT A;  1IKW A;  1HRH A;  4CZH A;  2QM1 A;  2HHS A;  4BQZ A;  2X6N A;  3CMA N;  3KLE A;  1WSH A;  2HBM A;  5AQV A;  3L4I A;  4DR5 K;  4DTM A;  1E3M A;  3VQ5 A;  1S1X A;  4GVM A;  5AQP A;  5IWA K;  1RT7 A;  3QIN A;  4BC2 A;  4IDH A;  1SL0 A;  4Z94 A;  5J1E A;  5HRN A;  1K73 O;  5BR9 A;  3CQY A;  3AO2 A;  2BH1 A;  4KKO A;  4MLH A;  3AVC A;  4BDZ A;  4IG0 A;  3HM9 A;  3VEY A;  3MK6 A;  2NRV A;  3LWL A;  4KH4 A;  3C94 A;  3QES A;  1DKG D;  3RSE B;  1BG3 A;  4KHS A;  3K9K A;  2GBZ A;  5KQD A;  2O8B B;  2PYL A;  4CBW A;  4CF0 A;  4YHH K;  4Q5V A;  4K42 A;  4K0K K;  2GWJ A;  2O8F A;  4B3T K;  4YOT A;  4BRK A;  4FLU A;  2Y1I A;  1U04 A;  3DXK A;  3TAF A;  3OYN A;  2YHB A;  1SQK A;  3VQB A;  3HOS A;  5AZI A;  1P8Z A;  3MN6 A;  2ASO A;  2DPN A;  2B4J A;  5AZI B;  3M8S A;  4OLB A;  1T3V A;  1HQU A;  4B9V A;  4FK2 A;  2GUP A;  5AQF A;  2KZM A;  4KI4 A;  2HNY A;  4CGJ A;  1YJ9 N;  4CJQ A;  1J5E K;  1Q18 A;  2VG7 A;  2GTD A;  3C6A A;  2O8E A;  1NU0 A;  2YJE A;  3M8Q A;  4FSV A;  1RTD A;  3HTV A;  1LAW A;  1R59 O;  4MDA A;  1HPZ A;  3TTF A;  3CQX A;  3PY8 A;  1J6Z A;  5BPN A;  3L3V A;  1BIU A;  1TKX A;  2UU9 K;  3CPE A;  4DV6 K;  1UOC A;  3HPO A;  1NJW A;  2YHX A;  4BGA A;  4BG8 A;  1NKC A;  3AVH A;  3HO1 A;  1S9E A;  5FPM A;  4A5A A;  2ZQB A;  3GBT A;  4FM2 A;  1NGB A;  4CJU A;  3THW A;  4AHS A;  2FF3 B;  1VSL A;  3OS2 A;  3LDN A;  3V9U A;  4DU1 A;  3THW B;  2UUB K;  2QXL A;  4IEE A;  5BRD A;  3G71 N;  3NGI A;  3MDQ A;  3R9P A;  1VQ6 N;  4B1V A;  4FPA A;  3C0B A;  2E1Y A;  2OAN A;  3CC2 N;  1VQP N;  5HL7 L;  3ZSW A;  4KHU A;  3OJU A;  1VQK N;  4HCB A;  3CC4 N;  4E0D A;  1W9H A;  4I6M B;  1Z05 A;  5CY4 A;  2NRX A;  5AFU H;  1X9S A;  4E19 A;  1U45 A;  4B9S A;  3SV4 A;  3FR0 A;  2GX9 A;  1QE1 A;  4HVJ A;  2IOC A;  1IG8 A;  3AO5 A;  4DR1 K;  1QQN A;  5HRS A;  5AQW A;  1SL2 A;  4FZZ A;  5FRO A;  5T7B A;  3WXI A;  1L3S A;  2P5O A;  1GLL O;  4CF8 A;  4WQ5 C;  1T7P A;  3SNN A;  1OH7 A;  4M3R A;  2UXB K;  4DSJ A;  4HUE A;  3CCM N;  3NE6 A;  4NO7 A;  3H45 C;  1N32 K;  3A5O C;  2FSJ A;  4NLB A;  1NGD A;  2VQF K;  3LAN A;  4XH5 A;  4JNE A;  3GE1 A;  4GMJ B;  4FM0 A;  2ZM6 K;  3DLK A;  3K57 A;  1RTI A;  4BG9 A;  4CGI A;  3KK2 A;  2A1S A;  1VQ5 N;  2RE2 A;  2PYJ A;  4O5F A;  1NK5 A;  1HQE A;  3KK3 A;  1TUU A;  2G8H A;  4ICL A;  2P9N A;  4J2D A;  5CYM A;  3H1V X;  3P38 A;  3LP0 A;  1D4X A;  3AAR A;  3SI6 A;  1F21 A;  1T6C A;  5CZ1 A;  2F9T A;  1S3X A;  4KHP K;  2I5J A;  3OY9 A;  2V7Z A;  1MWM A;  4OJR A;  1KVB A;  3VQE A;  4B1Z A;  3TAP A;  4AH9 A;  4M3X A;  2HHW A;  3LP3 A;  4CED A;  2FBV A;  3R8E A;  3VTI A;  4JV5 K;  2J4R A;  1SKS A;  3P4I A;  1L5U A;  1RDB A;  4JHD A;  4H5W A;  1DT9 A;  2QKB A;  4AHV A;  4H4M A;  4WQ5 A;  2Q97 A;  4IJN A;  4CF9 A;  4QS9 A;  3GG4 A;  4JHD B;  3DAW A;  3KWI A;  1ZBF A;  3BF3 A;  2A5X A;  4A57 A;  2OTJ N;  4JKA A;  3J81 O;  3ZSY A;  2YNI A;  4B9U A;  2EHG A;  3SMS A;  3O3G A;  3TAR A;  4U67 L;  4G9Z A;  1JKH A;  4L8R B;  2LSN A;  3D2F B;  3AGK A;  5EX5 A;  4DFP A;  2YNH A;  3TAQ A;  3M8P A;  3QDK A;  4XH4 A;  4WF9 L;  1T05 A;  3PO5 A;  5GAG P;  1UWB A;  3MEG A;  1UAX A;  1RCH A;  3PX0 A;  1XNQ K;  1BI4 B;  3M1F A;  1GOB A;  2V51 B;  4DWI A;  4CGD A;  4Z4G A;  3OA9 A;  1S6P A;  5GAH P;  3PSI A;  3ZET A;  4ELU A;  2KFZ A;  3ZSR A;  2KKZ A;  3BZC A;  1QSY A;  4IEI A;  1HYV A;  5AQG A;  3T3F A;  5AR0 A;  3RR8 A;  3O4N A;  3L3U A;  5KPR A;  4FPB A;  5DM7 L;  5E26 A;  3OYC A;  3BZK A;  1WOQ A;  3UKU B;  4LFC K;  4I9L A;  2PY5 A;  4GV9 A;  3VET A;  4E1J A;  4KRF A;  4DQQ A;  1YAG A;  2A42 A;  4DSK A;  4IWV A;  2EWS A;  1HJR A;  1JL1 A;  3IAY A;  1NGE A;  5LMU K;  3NGY A;  1NBW A;  1S22 A;  3VQ8 A;  4O8K A;  2ZGY A;  3W0L A;  1BGX T;  3C7N A;  2O4G A;  1TL1 A;  1NMN A;  4OGC A;  3DRS A;  4JI0 K;  3DLB A;  2Q3S A;  4JI2 K;  1C1A A;  5EY4 A;  4RWT A;  3C7N B;  4NYF A;  4X66 K;  3THV A;  3CFO A;  5AQZ A;  4KO0 A;  4FOI A;  5C2F A;  3R6M A;  1Z26 A;  5LY3 A;  4G1Q A;  4DF8 A;  2ITM A;  1HMV A;  1V4T A;  2HST A;  5CHI A;  3L2U A;  3KK7 A;  3KD5 E;  2CH5 A;  4WFN L;  1Q8I A;  2Z1I A;  4GV3 A;  3NCI A;  3JSM A;  3LP2 A;  5AQL A;  4C23 A;  5C25 A;  3DMJ A;  4CFA A;  3SQ2 A;  4EZ9 A;  4B3O A;  2QK9 A;  4RCH A;  3OYF A;  1QVF M;  3G10 A;  2I7P A;  1IBK K;  3QNO A;  2W6K A;  3BY5 A;  1N33 K;  4DSE A;  4FLT A;  3N4Q A;  3MAQ A;  5TKY A;  1YVU A;  3CM6 A;  4HUG A;  4JI8 K;  2Z1H A;  5AQN A;  1RTJ A;  4JYA K;  2QTD A;  1XQS C;  2QXF A;  5EXW A;  5CE3 A;  4M41 A;  1ZC6 A;  3SAH A;  5SWM A;  2HBJ A;  3CM5 A;  5C42 A;  4KTQ A;  1SKR A;  1Q9X A;  3H1Q A;  1IV0 A;  3CD6 N;  2HF3 A;  1WSF A;  2F8T A;  3CJA A;  3TR8 A;  3AVI A;  1NWK A;  5LMN K;  4DV0 K;  1EET A;  3MXM A;  2P9L A;  4KHQ A;  3MN5 A;  2FLO A;  1TVR A;  2YV0 X;  2P9L B;  3BF1 A;  1BU6 O;  4CZI A;  1KVA A;  4Z0U A;  4PKI A;  2P9K B;  4CEF A;  4X64 K;  3JXU A;  3CCV N;  4DTX A;  2NZT A;  2FBY A;  3LDO A;  3V81 A;  4FLX A;  3P39 A;  2HHU A;  1NOY A;  1NK0 A;  3RMA A;  2OA8 A;  1UA0 A;  3ZEU B;  3RR7 A;  5FPN A;  4DCH A;  3SPY A;  4DQP A;  3VER A;  1JL2 A;  4RW7 A;  4Q0B A;  3OYI A;  3C6H A;  2A1R A;  1NGI A;  1QSS A;  1SZ2 A;  4Y1D A;  2VWB A;  3S3M A;  3K5L A;  3O80 A;  3AA5 X;  4JK7 A;  3DJC A;  3M3Z A;  4F2S A;  4EZ6 A;  1NM1 A;  3ID6 A;  2Z1G A;  4CJR A;  4BAC A;  5FRM A;  1TYQ B;  1S1U A;  4BRE A;  4DV4 K;  1VRU A;  1JLE A;  4ELT A;  1GLE G;  2O8D B;  3HYF A;  5AZJ B;  4Y1C A;  2OPS A;  4H5T A;  3VA3 A;  1C1B A;  3O3H A;  3ENH A;  1JCF A;  4LFB K;  1WUA A;  3KHY A;  4CHZ A;  4DUZ K;  3TAE A;  4BR9 A;  1KFS A;  5FPD A;  1HNX K;  3WXM B;  2O4I A;  2D0P A;  4CIG A;  3G6E N;  2F4V K;  1RT3 A;  2HMI A;  2CGK A;  3DLR A;  2E20 A;  3OYL A;  2D4W A;  4L3Q A;  1EQY A;  2P9U A;  3KWG A;  3V1R A;  1VAZ A;  1IO2 A;  1RDU A;  3KLG A;  4FJ9 A;  4IO9 L;  1BWF O;  1A5X A;  2P9U B;  4JRP A;  2KFN A;  5CZ2 A;  4MO5 A;  2ZD1 A;  3TTC A;  2D0A A;  4Z4H A;  2DY4 A;  1OVQ A;  4F3O A;  1QSL A;  2VWK A;  3C65 A;  3TI0 A;  3ZSX A;  3DXM A;  3A2F A;  3ATV A;  3E9O A;  2E8A A;  4CGH A;  2D0C A;  2X74 A;  1TV6 A;  4BRD A;  4DV5 K;  3DI6 A;  1YIT N;  1WAJ A;  3OVN A;  1X9W A;  3AO1 A;  3ALY A;  2FSK A;  3NH2 A;  4KI6 A;  4CZF A;  3SK3 A;  4HTL A;  4KFB A;  2XY7 A;  4BE1 A;  2QWN A;  3I0R A;  4FJM A;  2ZGZ A;  3CCR N;  5I3U A;  1WBD A; 
#chains in the Genus database with same CATH homology
 3BGR A;  1RBR A;  1S5J A;  4OKK A;  4M45 A;  1TK5 A;  4CJQ A;  2ATQ A;  3ISN C;  2B6A A;  4I2P A;  1Q9Y A;  2VG7 A;  2XY8 A;  3ZSQ A;  3CQ8 A;  3L2W A;  3G0Z A;  1RDC A;  4JLH A;  5KGW A;  4DFK A;  1NK9 A;  1D9D A;  5HRO A;  1U47 A;  3M8Q A;  5E41 A;  3AA4 A;  3CYM A;  4IBN A;  4I2Q A;  3EY1 A;  1BL3 A;  1RTD A;  1LAW A;  3MXJ A;  3FFI A;  3NH1 A;  1KSP A;  1HPZ A;  4O55 A;  1J54 A;  3D0P A;  1WSJ A;  1VSH A;  1WSG A;  3SPZ A;  3PY8 A;  4FJG A;  4M3U A;  4PUO A;  3ZCM A;  3SQ1 A;  3L3V A;  1BIU A;  1TKX A;  3V1Q A;  4CEE A;  4CHP A;  4O44 A;  4CHY A;  1UOC A;  3HPO A;  1NJW A;  2GV9 A;  4OGE A;  1TKZ A;  4CEZ A;  4CEO A;  1BQM A;  1BCM A;  4R5P A;  1NKC A;  3AVH A;  3HO1 A;  2G8I A;  3ZSO A;  4FK4 A;  1YT3 A;  1S9E A;  1ASU A;  1MU2 A;  2IAJ A;  3VQ6 A;  1TAQ A;  2ZQB A;  4FM2 A;  1L3T A;  3WNF A;  1A5W A;  3NF6 A;  4OPJ A;  4CJU A;  1NJX A;  4AHS A;  3LP1 A;  3V4I A;  1CZ9 A;  1VSL A;  3OS2 A;  3V9U A;  4TSX A;  4DU1 A;  1CLQ A;  3EZ5 A;  4C8K A;  4AHU A;  1WAF A;  3DLG A;  2XHB A;  5K14 A;  3QNN A;  2RN2 A;  2PZS A;  2OYQ A;  4CE9 A;  3V6D A;  4AIL C;  1I39 A;  3AO3 A;  4CJF A;  3NGI A;  3NF8 A;  2P5G A;  4J2A A;  4RW4 A;  4F3T A;  1FKP A;  1JXB A;  3TAN A;  3ZT2 A;  3KKS A;  2FC0 A;  3QER A;  3DYA A;  2ITG A;  4B9N A;  3RRG A;  4C8O A;  1WNS A;  3ZSW A;  3KLH A;  3OJU A;  1BQN A;  2ETJ A;  1SKW A;  4KHU A;  4HCB A;  4DTN A;  4E0D A;  1W9H A;  3RWU A;  5KI6 A;  2NUB A;  5CY4 A;  1QS4 A;  3VQP A;  2OZS A;  4M3Z A;  4CHN A;  3V9S A;  1NK7 A;  2HB5 A;  4OKE A;  1X9S A;  3F9K A;  4E19 A;  3OS0 A;  3LPT A;  1ZBU A;  5KRS A;  1U45 A;  4B9S A;  3SV4 A;  4NCG A;  4QAG A;  3VA0 A;  1QE1 A;  4HVJ A;  2IOC A;  3VQC A;  3MXI A;  4I9Q A;  2HHX A;  3AO5 A;  1J5O A;  4DTR A;  1T03 A;  4B9T A;  2GUI A;  4J2E A;  2DFF A;  5HRS A;  1VSD A;  1SL2 A;  4CF1 A;  5FRO A;  5T7B A;  3SUN A;  1L3S A;  4FZZ A;  3VQD A;  2P5O A;  3LWM A;  4CF8 A;  1IKY A;  3K59 A;  1T7P A;  4OLA A;  3SNN A;  4M3R A;  3RMB A;  4DSJ A;  4HUE A;  3SUP A;  4OKJ A;  1RNH A;  3LZI A;  1TAU A;  3NE6 A;  1J9A A;  4BDP A;  1TK8 A;  2JLE A;  3K5M A;  3BDP A;  4B8A B;  1XHZ A;  3DLE A;  1RIL A;  4ID1 A;  1NK8 A;  1RT2 A;  1VSM A;  3LAN A;  3T19 A;  4DQR A;  4FXD A;  1FXX A;  2D0B A;  3NH0 A;  3CG7 A;  1JLF A;  2VWJ A;  1GOC A;  4CGG A;  3WNG A;  4CEC A;  3QEX A;  4GMJ B;  3WNH A;  4FM0 A;  1DTT A;  2KQ2 A;  3DLK A;  3K57 A;  1RTI A;  1VSI A;  4CGI A;  3KK2 A;  2A1S A;  2XY5 A;  3K5N A;  2PYJ A;  3C6T A;  1T8E A;  4ID5 A;  1TK0 A;  4N47 A;  1NK5 A;  4DQI A;  1HQE A;  4MFB A;  4FW2 A;  3ZT3 A;  4CK2 A;  3KK3 A;  4DTU A;  4FJL A;  4KHN A;  4IFV A;  3SQ4 A;  2G8H A;  4HCC A;  5CYQ A;  3TAG A;  1ASV A;  4NCB A;  4PY5 A;  4IFY A;  4ICL A;  3NF7 A;  3SV3 A;  2BAN A;  5KRT A;  4EP5 A;  3QEV A;  3ZT0 A;  4CJW A;  4O0J A;  4J2D A;  4F4K A;  2OZM A;  2F8S A;  5CYM A;  1N5Y A;  4E89 A;  4DS5 A;  4RG8 A;  1TL3 A;  2DFH A;  1JLQ A;  3LP0 A;  4CJP A;  2DFE A;  1SL1 A;  4WE1 A;  4CJ5 A;  1ZYQ A;  4FJI A;  3SI6 A;  1F21 A;  2HND A;  2YHA A;  5CZ1 A;  2E6M A;  4E7J A;  2I5J A;  4CEB A;  4CK1 A;  3OY9 A;  4E7K A;  3VQE A;  4OJR A;  3TAP A;  1KVB A;  2KTQ A;  5DK5 A;  3F73 A;  4AH9 A;  4FK0 A;  4M3X A;  2HHW A;  3AO4 A;  3LP3 A;  3NF9 A;  4CED A;  2FBV A;  1NOZ A;  4M3T A;  1W0H A;  2OPP A;  3PO4 A;  1XHX A;  3KKR A;  1SKS A;  2R7Y A;  1EXQ A;  3O3F A;  1YTU A;  2X6S A;  1WN7 A;  1L5U A;  1RDB A;  2RKI A;  3VQ7 A;  1XWL A;  3LAM A;  3RMD A;  2QKB A;  1HNV A;  4AHV A;  3QET A;  4H4M A;  5DMR A;  1U48 A;  1ZBH A;  1KLM A;  4W5N A;  3PX6 A;  3PUF A;  4DQS A;  4CF9 A;  2KW4 A;  4M3Y A;  2G8F A;  4XIU A;  3ZSZ A;  1IKX A;  2Z1J A;  1EKE A;  3AVM A;  4LH5 A;  4KRE A;  1ZBF A;  4KTW A;  3OJS A;  4HHT A;  1HYZ A;  1BHL A;  4NCA A;  3PX4 A;  1NJY A;  4CFC A;  5J2Q A;  3SQ0 A;  3OYM A;  5I3U A;  4CF2 A;  3SZ2 A;  4Z4F A;  3ZSY A;  2YNI A;  3H08 A;  1NK6 A;  2BGG A;  4B9U A;  4FJH A;  2EHG A;  3O3G A;  3TAR A;  3RTV A;  1JKH A;  1JLA A;  2P1J A;  2Y1J A;  1D9F A;  4L8R B;  2LSN A;  3DOL A;  4E3S A;  4KB1 A;  1GOA A;  1RT5 A;  1WLJ A;  4E1N A;  2YNH A;  4DFP A;  4K8Z A;  3TAQ A;  4QCL A;  3OYB A;  1IH7 A;  3M8P A;  3U3Y A;  3LAL A;  3I8D A;  1T05 A;  3PO5 A;  4DLG A;  2DTU A;  1UWB A;  3AV9 A;  3MEG A;  1JXE A;  3AVA A;  1UAX A;  3RMC A;  1RCH A;  3HP6 A;  3PX0 A;  1IG9 A;  1VSE A;  3NBP A;  1BI4 B;  4B9M A;  4DFJ A;  3ITH A;  2G8W A;  4KAZ A;  1GOB A;  3NHG A;  1HNI A;  3ASM A;  4CCH A;  4DWI A;  3IS9 A;  4LSN A;  4CGD A;  1ITG A;  3O4Q A;  3ZT1 A;  1S1V A;  1X9M A;  1L3V A;  1S6P A;  4Z4C A;  4Z4G A;  4J2B A;  4ELU A;  1KVC A;  4CJ3 A;  2KFZ A;  1RT1 A;  3ZSR A;  1QSY A;  3OYA A;  3NAE A;  1HYV A;  1J53 A;  1JLC A;  1S6Q A;  3HST B;  3VN5 A;  1B9D A;  3OS1 A;  3K58 A;  1B92 A;  4HUF A;  3T3F A;  3PV8 A;  1U4B A;  1HYS A;  4FJJ A;  4W5Q A;  1I3A A;  3KLF A;  3RR8 A;  3O4N A;  3L3U A;  4JS5 A;  4MQ3 A;  3V1O A;  4YNQ A;  3S3O A;  4RW8 A;  3OYC A;  1KFD A;  3P5J A;  1RBU A;  3OYD A;  4CER A;  3HL8 A;  4DFM A;  2B5J A;  4I9L A;  2PY5 A;  4F2R A;  3HP9 A;  1EX4 A;  4CJS A;  4KRF A;  4FVM A;  4DQQ A;  4EP4 A;  4AHR A;  1NKB A;  4CJT A;  3C6U A;  4GW6 A;  1VSK A;  4FZY A;  2OPQ A;  4DSK A;  1C1C A;  1KCF A;  3I0S A;  1KTQ A;  1K6Y A;  3DLH A;  3K2P A;  3UIQ A;  2G8K A;  4FLY A;  4FJX A;  3S9H A;  1HJR A;  1JL1 A;  1B9F A;  1Z25 A;  3LAK A;  4CHO A;  3ULD A;  3IAY A;  3NGY A;  2HHV A;  4O4G A;  3KLI A;  3VQ8 A;  1R0A A;  4I7F A;  4KV8 A;  1ZBI A;  3OYJ A;  4FZX C;  2X78 A;  4DG1 A;  2HHQ A;  1BGX T;  1S9G A;  2O4G A;  2RPI A;  1TL1 A;  5C24 A;  3QEW A;  4OGC A;  3QEI A;  3DRS A;  1U49 A;  3KTQ A;  4FYD A;  4DTS A;  1LWE A;  3DLB A;  2Q3S A;  4E7L A;  1C1A A;  1RDD A;  3E01 A;  3DM2 A;  4CIE A;  4M42 A;  5HRR A;  1LWF A;  4NYF A;  1O1W A;  3SUQ A;  2VG6 A;  3THV A;  2ZE2 A;  3CFO A;  3AVG A;  3TAM A;  4LH4 A;  4KO0 A;  5HLF A;  4M3W A;  1Z26 A;  4AHC A;  2AJQ A;  3U3G A;  3DOK A;  4B9L A;  3QO9 A;  1DTQ A;  4G1Q A;  5JS2 A;  4DF8 A;  4UQG A;  5J2M A;  2OPR A;  1HMV A;  4W5T A;  1RDA A;  4PA1 A;  4IKF A;  1D8Y A;  5SZT A;  3L2U A;  3KD5 E;  1C0M A;  4RW6 A;  3AVB A;  1Q8I A;  2Z1I A;  4CGF A;  1XC9 A;  3NCI A;  4W5O A;  3M8R A;  3JSM A;  2P51 A;  1EP4 A;  3LP2 A;  4N56 A;  3L2R A;  5C25 A;  3KIO A;  3B6O A;  5JS1 A;  4ELV A;  4CJ4 A;  3OYK A;  3V9X A;  3DMJ A;  3OYH A;  3QIO A;  4CFA A;  3HPG A;  1VSJ A;  2IDO A;  4KTZ A;  3AVL A;  3SYZ A;  3AVJ A;  5J2P A;  4O0I A;  3SQ2 A;  1N6Q A;  4EZ9 A;  4B3O A;  2QK9 A;  2HW3 A;  3VQ4 A;  3D45 A;  4CJL A;  3DRR A;  3MEE A;  3G10 A;  3OYF A;  3V9Z A;  3QNO A;  3HVR A;  4CHQ A;  3SJJ A;  3L8B A;  4E1M A;  3IRX A;  4IG3 A;  1C0T A;  3NDK A;  4DSE A;  4FM1 A;  4FLT A;  3V9W A;  4DS4 A;  2RF2 A;  2G8U A;  1WSI A;  2EX3 A;  2IGI A;  3MAQ A;  3TAB A;  4JRQ A;  1YVU A;  4DF4 A;  3CM6 A;  4HUG A;  4FLV A;  4CJK A;  2JGU A;  4LSL A;  2Z1H A;  2D5R A;  1RTJ A;  3MEC A;  2VG5 A;  1TKT A;  3L2Q A;  4KB0 A;  1RBS A;  3TWH A;  4PQU A;  2QXF A;  1BIS A;  1CZB A;  1X1P A;  4DU4 A;  1SV5 A;  2XRI A;  3U6F A;  4ZTJ A;  3KJV A;  4M41 A;  3ZSV A;  3QEP A;  5D3G A;  2W42 A;  1S1W A;  4AHT A;  3C95 A;  5SWM A;  1RT6 A;  1KLN A;  3CM5 A;  5C42 A;  4KTQ A;  4HTU A;  3S3N A;  1SKR A;  3B6P A;  4NYN A;  1Q9X A;  1TGO A;  3L2V A;  4BE0 A;  1WSF A;  2F8T A;  4O5B A;  1XI1 A;  3TR8 A;  4F8R A;  2F96 A;  3AVF A;  1LAV A;  3DRP A;  5KGX A;  5HP1 A;  4KHW A;  3NGZ A;  3HJF A;  1RTH A;  4CJE A;  1LV5 A;  3AVI A;  4ZHR A;  1EET A;  4FW1 A;  4CES A;  1FK9 A;  1BI4 A;  3MXM A;  5EU7 A;  4CK3 A;  2G8V A;  2QKK A;  1RBT A;  4CFD A;  2IS3 A;  4BDY A;  4KHQ A;  1TVR A;  4DTO A;  2YV0 X;  2BE2 A;  5HRP A;  4C8L A;  3IG1 A;  1KVA A;  2YNF A;  3QIP A;  4Z0U A;  1SUQ A;  2WON A;  1RT4 A;  1A5V A;  4CEF A;  4H4O A;  4KHY A;  1FKO A;  2XO7 A;  4FJ5 A;  3VQA A;  2WOM A;  4OVL A;  4DTX A;  3NFA A;  2KZZ A;  3T1A A;  3MED A;  2FBY A;  4RW9 A;  4OPK A;  3SCX A;  3V81 A;  1YTA A;  4FLX A;  1ASW A;  2HHU A;  1NOY A;  4C8N A;  3KK1 A;  4PWD A;  1NK0 A;  1KRP A;  3RMA A;  4E7I A;  1QTM A;  1UA0 A;  2OA8 A;  2HVI A;  3RR7 A;  5HBM A;  4DSL A;  4LY7 A;  4FCY A;  3SPY A;  4DQP A;  4QOZ B;  1JL2 A;  1NK4 A;  3AVK A;  4RW7 A;  4CFB A;  4Q0B A;  3OYI A;  3HK2 A;  2YNG A;  4BWJ A;  2HVH A;  2A1R A;  4B8C A;  1IKV A;  4Z4I A;  1QSS A;  4Y1D A;  3HT3 A;  2HNZ A;  4Z4E A;  4CJV A;  3HPH A;  5FRN A;  3S3M A;  1BCO A;  3K5L A;  3CFR A;  3ZT4 A;  1G15 A;  1VRT A;  4CIF A;  3AA5 X;  1D5A A;  4FJN A;  4F2S A;  3P83 D;  4DLE A;  4ZTF A;  4EZ6 A;  2Z1G A;  3LPU A;  1IKW A;  1HRH A;  4CJR A;  2YKM A;  4BAC A;  4W5R A;  5FRM A;  1S1U A;  1WSE A;  4N5S A;  4DSF A;  1C0U A;  1Y97 A;  1VRU A;  2HHS A;  1JLE A;  4ELT A;  1NJZ A;  2X6N A;  3HYF A;  3QLH A;  3KLE A;  1WSH A;  2OPS A;  4Y1C A;  1BIZ A;  2IC3 A;  3OYG A;  1C1B A;  2E4L A;  3O3H A;  3VA3 A;  4DTP A;  4DTM A;  3VQ5 A;  1DLO A;  1S1X A;  4FLZ A;  4GVM A;  5J2N A;  5FDL A;  4CHZ A;  1QHT A;  1RT7 A;  3QIN A;  3K5O A;  3TAE A;  4FJK A;  4IDK A;  1KFS A;  4JS4 A;  1SL0 A;  3AVN A;  2O4I A;  5J1E A;  5HRN A;  1VK0 A;  4CIG A;  4FJ7 A;  3LDS A;  1RT3 A;  3AO2 A;  2HMI A;  4E7H A;  4KPY A;  2E6L A;  3DLR A;  4B08 A;  1TKD A;  4KKO A;  4K8X A;  3OYL A;  3AVC A;  3HXM A;  4IG0 A;  4BDZ A;  1C6V A;  1LW2 A;  3HM9 A;  4FJ8 A;  4BWM A;  3V1R A;  3SUO A;  3LWL A;  4H8K A;  3C94 A;  3QES A;  1IO2 A;  3KLG A;  2FBX A;  4KHS A;  1VSF A;  1L3U A;  4FJ9 A;  1A5X A;  3JYT A;  2GBZ A;  4JRP A;  4DU3 A;  2XY6 A;  2PYL A;  5CZ2 A;  4BE2 A;  2KFN A;  4DSI A;  4Q5V A;  4CF0 A;  1ZBL A;  2ZD1 A;  1LWC A;  3P1G A;  2D0A A;  2FBT A;  3VQQ A;  4Z4H A;  5I42 A;  3WNE A;  2DY4 A;  4C8M A;  4F3O A;  4N41 A;  1QSL A;  3CFP A;  2VWK A;  3TI0 A;  3EYZ A;  3HVT A;  4FLU A;  2Y1I A;  3KD1 E;  1U04 A;  3ZSX A;  1UA1 A;  2HHT A;  3A2F A;  3AA3 A;  2BDP A;  3TAF A;  1JLB A;  4CGH A;  2D0C A;  2X74 A;  2YHB A;  3VQB A;  1TV6 A;  3OYN A;  4DTJ A;  3DI6 A;  4N76 A;  1WAJ A;  3OVN A;  4CEQ A;  1X9W A;  3AO1 A;  2YKN A;  5KTQ A;  3ALY A;  2B4J A;  3OYE A;  1CXU A;  3NH2 A;  1QQC A;  3M8S A;  1NKE A;  4KI6 A;  4OLB A;  1LW0 A;  1HQU A;  4KFB A;  2XY7 A;  4B9V A;  4FK2 A;  1CXQ A;  1RBV A;  1REV A;  4DMN A;  4BE1 A;  4FLW A;  3AA2 A;  3RRH A;  4LD0 A;  3I0R A;  4FJM A;  1JLG A;  2KZM A;  4KI4 A;  2HNY A;  4CGJ A;  1S1T A;  3VQ9 A;  4YFU A;  3LZJ A;  4CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...