3VQ6A

Hiv-1 in core domain in complex with (1-methyl-5-phenyl-1h-pyrazol-4-yl)methanol
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
145
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 52
structure length 145
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq6A00
4FLWA 4CHPA 4BDPA 4M3RA 3NF9A 3MXJA 3RMAA 3O3HA 4IBNA 1S6QA 2YV0X 3AO4A 2D0CA 3K5OA 1NK9A 1YTUA 2VG7A 4CF8A 4DLGA 3DLBA 2NUBA 3LWMA 3VQ9A 4E7IA 3QERA 2QKBA 2HHTA 1RBSA 4CFBA 4MFBA 5HRPA 3TABA 3DI6A 1B9FA 3K5LA 2RF2A 3ZSXA 4F8RA 4BWJA 3P83D 1ASUA 1VRTA 1XWLA 3I0RA 3S3NA 4DMNA 4ZHRA 3D0PA 5JS1A 4CGHA 1QQCA 2GBZA 1L3SA 4K8ZA 1FXXA 2D5RA 1CZBA 2DFEA 4KTWA 3NF7A 5DMRA 2VG6A 3VQ4A 4Q5VA 1DLOA 3ZT2A 3ZT4A 1S1XA 1GOAA 2I5JA 1TL3A 3NH1A 3WNEA 3OYKA 3L8BA 2HHQA 2VG5A 4GW6A 4OGEA 2DFFA 1XHZA 1C1CA 4M3TA 4DTPA 1VSMA 2XY8A 1RDAA 2KFNA 1XHXA 4H4OA 3QINA 3ZSWA 2W42A 4CCHA 4ELTA 3QO9A 4RW6A 1NK8A 3VA3A 4PQUA 3MECA 2XY6A 3SQ0A 4F3TA 1RT5A 3AO5A 3CM6A 3VQCA 3JYTA 3SV4A 4FZYA 3RWUA 2YNIA 3C6UA 4I7FA 1ZBIA 1L3VA 4NYFA 1CLQA 2G8FA 1KRPA 3OYGA 1C1BA 1JLAA 1ZBFA 3O4QA 4KHNA 3K58A 1NK0A 2X6SA 3HK2A 4M41A 3AVAA 4CJ3A 4FLTA 2KTQA 4PA1A 4CECA 2IS3A 4CHYA 1RDBA 3DLRA 4HHTA 4FLXA 1RTHA 2B5JA 3V9ZA 1U48A 1S9EA 4DSIA 3HYFA 3V1RA 2YNFA 3L2UA 4W5RA 1ZYQA 3IAYA 3LALA 1HNIA 4M45A 1JLCA 4B9UA 1RTIA 4ID1A 4J2DA 4EP5A 3RR7A 1RT7A 4J2BA 4AH9A 4Y1DA 4F3OA 3K2PA 2Y1JA 1NJYA 1BGXT 4LSLA 2FBTA 4DTJA 4CGIA 1NOZA 5KRSA 1DTTA 4BWMA 4B8AB 1YT3A 3DYAA 4TSXA 1RT4A 1HRHA 3AO1A 5FRNA 1BHLA 4W5NA 2HVIA 4M3UA 3V9UA 4JS4A 3HSTB 1KVBA 1X1PA 1KVCA 1WSFA 3SQ2A 1ASWA 3OYHA 3HXMA 1VRUA 1RNHA 3KIOA 4KTQA 1W9HA 3OS1A 4M42A 3NE6A 1TAQA 1TV6A 4Z0UA 4CJ5A 1WSJA 3HVRA 4IFYA 4CGGA 4O44A 1IG9A 1C0MA 1UA0A 3VQPA 2GV9A 1T8EA 3LWLA 3NF8A 2E4LA 1RBRA 4C8LA 2YNHA 1VSFA 3K57A 1D9DA 2P51A 1IKVA 3SPYA 2WOMA 4FJ8A 4OLAA 1JLEA 3E01A 2KFZA 3TAMA 3SQ4A 4Y1CA 4L8RB 3HPHA 2YHBA 1KTQA 4M3ZA 4CJPA 3T3FA 1QE1A 3LANA 1Z25A 1HPZA 1BI4B 4CF9A 5C25A 4YNQA 4HUGA 1JLBA 3VQQA 3SV3A 1W0HA 2YNGA 2G8KA 1WSEA 4ELUA 4LH5A 4LSNA 4CJVA 2QXFA 3ZSRA 3RMDA 4HCBA 5I3UA 3LP0A 2Z1HA 4DF8A 3AVJA 3ISNC 3IG1A 1HQEA 1UAXA 2ZE2A 3V1QA 4LD0A 2KW4A 2R7YA 3TAGA 3DLEA 1RT6A 1NK4A 3PY8A 2AJQA 3PUFA 2P5GA 3KD5E 1WNSA 3SZ2A 3RRHA 4OGCA 1EP4A 3V9SA 5HROA 1T05A 4N76A 4FLYA 1ZBHA 1LWCA 4ZTFA 4CF2A 4OKJA 4DU4A 1FK9A 3QIOA 4O4GA 4M3XA 1I39A 4OJRA 3QEXA 4RW9A 4BE0A 1JXBA 3WNGA 1C0TA 3MEEA 3K59A 4CJLA 3NCIA 1XC9A 2VWJA 3LDSA 3LZJA 4W5QA 3RMCA 1JL1A 2EX3A 3K5MA 3TANA 2G8VA 4FJXA 3VQ5A 4NCAA 2IOCA 4N47A 2ETJA 1JL2A 1WLJA 4HUEA 4I9QA 3CFPA 1RT3A 5HRNA 2E6MA 1LV5A 2RN2A 4DTRA 3AO2A 3QEPA 4IKFA 1JLQA 3UIQA 2LSNA 3SPZA 4I2PA 4Q0BA 3B6OA 2FBXA 2PYLA 2XHBA 4OVLA 4FCYA 4DU1A 3ZSQA 3EY1A 3DOKA 3SJJA 4CE9A 5J2QA 3PO5A 4FJJA 1BCMA 1VSHA 4CK3A 3K5NA 1IO2A 1NK7A 3KLIA 1NKEA 4MQ3A 1BQMA 4CGFA 1B92A 2XY5A 4IFVA 3ALYA 3L3UA 1Q9XA 1F21A 1JLFA 3LP2A 4FJ5A 1TGOA 4FJLA 4KAZA 2B6AA 3H08A 3QEVA 4DFKA 1U47A 3OS2A 4ICLA 1K6YA 2HHUA 5HBMA 4PY5A 1SV5A 1TK8A 4W5OA 2G8HA 4Z4EA 2HHWA 4AHVA 4CGJA 3L2WA 3TAFA 3L2VA 3TI0A 4B3OA 1WAJA 4N41A 4ZTJA 4RG8A 4DTMA 2HHSA 2GUIA 4B9TA 3HT3A 3L2QA 4FXDA 4DFPA 4KV8A 3S3MA 1A5WA 1VK0A 3HJFA 1BISA 4E7KA 3AVKA 3S3OA 3OJUA 2XRIA 4E19A 4R5PA 3S9HA 5SWMA 1J5OA 1SL2A 3AA2A 3T1AA 1WSHA 2OPSA 2D0AA 2ZQBA 1Q8IA 3DRPA 4FW2A 1IKXA 1U04A 4CEQA 3OYLA 4HTUA 4AILC 1DTQA 3TAEA 4CEFA 3PV8A 2A1RA 3SYZA 1ZBLA 4EZ6A 4CEDA 3M8RA 4DSLA 4JRPA 1HYVA 4CIGA 1TKTA 1FKOA 2PZSA 4FW1A 3NAEA 3P1GA 4KI4A 3CG7A 4B9VA 4CJSA 2HNZA 5HRSA 3AVLA 3U3GA 1CXUA 3KLGA 4DTNA 4CEOA 3G10A 1EKEA 4HCCA 4FJHA 4H4MA 5JS2A 4DQQA 3LAKA 1LAVA 3ITHA 1TK5A 1J53A 1T7PA 3AA5X 3SUNA 3AV9A 4CHQA 2KQ2A 3VQEA 1A5XA 1TKDA 4CEZA 2A1SA 1RBVA 1O1WA 1VSKA 1QSSA 4AHRA 1I3AA 1JLGA 4F2SA 2FC0A 2KZMA 1ASVA 1IH7A 4DU3A 3F9KA 4IDKA 1TKZA 5HRRA 4CEAA 4RW4A 1TVRA 3KLEA 3TARA 2BGGA 4B8CA 3ZT1A 3CM5A 4O0JA 2Y1IA 3OYMA 2X74A 2EHGA 2OPPA 1WN7A 1YVUA 3OYDA 2B4JA 4E3SA 1JXEA 1T03A 4HVJA 3NDKA 3KTQA 5J2NA 1EXQA 3AVHA 3KK1A 1X9WA 3PO4A 2IDOA 4CIEA 1S9GA 3A2FA 4CJFA 3V4IA 1L3UA 2DFHA 1RBUA 4CK1A 1NK5A 3SQ1A 4DSKA 4CIFA 4O55A 3ZSZA 4CF0A 1TK0A 1BQNA 4KREA 1RILA 5J2PA 4QOZB 4JLHA 4K8XA 4BDZA 3CYMA 4CJTA 4W5TA 3V9XA 4KI6A 2VWKA 3ZSVA 4CJQA 4B9SA 5KRTA 3G0ZA 4UQGA 1SL0A 2IC3A 2HMIA 4FLZA 3SUQA 2YKMA 3C94A 3PX0A 3FFIA 1X9MA 2RPIA 2KZZA 1Q9YA 3IS9A 4DWIA 2DTUA 4KRFA 5EU7A 3WNHA 3RTVA 2BANA 2FBYA 2WONA 5FDLA 3NGZA 3NGIA 3CFRA 3SCXA 4J2EA 1KLMA 3MEDA 3KKSA 3LPUA 3VQDA 5K14A 4DSFA 1S1VA 4I2QA 4CJWA 1C6VA 4XIUA 4FJ7A 2HNDA 4DTXA 1UOCA 4HUFA 2OZSA 3D45A 1WSGA 1S1WA 1S6PA 4LH4A 4CFCA 3DOLA 3HL8A 1S1TA 5KI6A 1U45A 3C95A 4FZXC 4DSJA 3TWHA 4CJ4A 3NHGA 4E0DA 3VN5A 4CHZA 1NJWA 2Z1IA 3RRGA 4KHYA 3WNFA 1C0UA 4FM1A 1BIZA 2OPQA 1S1UA 1YTAA 3NGYA 4CERA 4CGDA 5CYMA 3U6FA 3OJSA 1N6QA 1SUQA 3VQ8A 3VQ6A 4DSEA 1NOYA 4G1QA 1NKBA 2OA8A 4DQPA 1SKWA 3V6DA 2E6LA 4KB0A 3DLHA 1HMVA 2P1JA 3JSMA 3MEGA 5J1EA 3LPTA 4KPYA 1J54A 4FK4A 3L3VA 4FLUA 3HO1A 2IAJA 1RDDA 1IKYA 2G8IA 1WSIA 3HVTA 1SKRA 1D9FA 1CXQA 3F73A 3I8DA 2XY7A 2PYJA 2F8TA 4E89A 1RBTA 1KCFA 4E1MA 1N5YA 3KKRA 4BACA 4DLEA 4CJRA 3AVCA 1LW0A 5CZ1A 1RDCA 2BE2A 3QEIA 4FJ9A 3ZT0A 2XO7A 1R0AA 4FLVA 4RW8A 1BIUA 4CF1A 4FVMA 4GVMA 3CFOA 4LY7A 1WAFA 3M8QA 1Y97A 1RTJA 4DTSA 3LP1A 4CJEA 3OYCA 4BE1A 3OYEA 2ITGA 2YKNA 3AA4A 2YHAA 1D5AA 4DS5A 1REVA 1TKXA 4PUOA 1TL1A 4O5BA 4EP4A 1JKHA 3BGRA 3DLGA 1KFSA 3AO3A 4AHTA 3AA3A 3IRXA 3OYIA 1EETA 3AVGA 4FJGA 4AHUA 2Z1GA 1CZ9A 2RKIA 5CY4A 4CK2A 3KLFA 2FBVA 1Z26A 3VQ7A 3OYNA 1IKWA 4DFMA 1HJRA 4KO0A 3LAMA 3OS0A 3EYZA 4CJKA 1SKSA 2HHXA 4KB1A 4E7LA 4FJMA 4FK0A 1A5VA 2F96A 3HP9A 3QIPA 3OY9A 2F8SA 1HYSA 1U49A 3HPOA 5CYQA 3DMJA 1X9SA 3DLKA 5T7BA 1L3TA 4CEEA 1KFDA 3DRSA 3OYJA 2OPRA 1EX4A 3TAQA 2ATQA 4FJKA 3QNOA 3NH2A 2G8WA 1QS4A 5KGWA 3O4NA 3HPGA 3LP3A 4CFAA 4CFDA 3PX4A 1NJXA 2OYQA 3L2RA 4FK2A 2P5OA 4FJIA 1KVAA 1BI4A 4KTZA 3RR8A 5HP1A 1NKCA 4IG3A 3VQAA 4DQRA 4J2AA 2O4GA 1UWBA 4FM2A 3M8PA 4Z4FA 1BL3A 1B9DA 1RCHA 3I0SA 2IGIA 5SZTA 1VSIA 1LAWA 4OPKA 3NBPA 1GOBA 3NF6A 1NJZA 1BCOA 1VSDA 5CZ2A 4F2RA 4NYNA 3QEWA 4C8KA 3ASMA 4BE2A 1NK6A 3SUPA 4KFBA 4C8MA 4DTUA 3TAPA 4CJUA 5D3GA 4CEBA 1QSLA 4OKEA 1ITGA 4I9LA 4DS4A 4B08A 3MXMA 5C24A 2HHVA 3P5JA 4NCBA 2X6NA 3U3YA 2X78A 3TR8A 4E1NA 4GMJB 5FRMA 4Z4GA 1VSEA 4QAGA 4WE1A 4QCLA 1U4BA 3AVMA 3ULDA 1L5UA 4O0IA 3OYFA 4M3WA 2HVHA 3THVA 4KHQA 1VSJA 4KKOA 4B9NA 4OLBA 2DY4A 2BDPA 3V9WA 3QETA 2HW3A 1KSPA 4FYDA 1VSLA 3HM9A 1GOCA 3EZ5A 4KHWA 4H8KA 4DF4A 4DQSA 3V81A 4IG0A 3KLHA 4F4KA 2QKKA 3KD1E 4Z4IA 3V1OA 4N5SA 3SI6A 1LWEA 4ELVA 4YFUA 4CESA 2QK9A 4CHOA 4AHSA 1SL1A 1QHTA 5FROA 3M8SA 1HNVA 3DRRA 3KK2A 3SUOA 5I42A 4DQIA 4NCGA 2Q3SA 3AVBA 3QESA 1QTMA 4C8OA 3QNNA 1UA1A 3VQBA 2HB5A 5C42A 3AVIA 1C1AA 3AVNA 4KHUA 3OVNA 3OYBA 4JS5A 2ZD1A 3C6TA 3NH0A 3O3GA 4N56A 4BDYA 3ZSYA 4DTOA 4E7JA 1KLNA 3MAQA 3KK3A 4B9LA 4M3YA 2JLEA 4AHCA 4Z4CA 3MXIA 1LWFA 1XI1A 1MU2A 3AVFA 2HNYA 2O4IA 3RMBA 3ZT3A 2G8UA 3QLHA 1RT1A 1J9AA 3ZCMA 4OPJA 3OYAA 4CHNA 3LZIA 1HQUA 1ZBUA 4JRQA 3SNNA 1QSYA 3BDPA 2JGUA 5J2MA 3DM2A 5DK5A 1RTDA 4FJNA 1LW2A 3KJVA 1D8YA 4C8NA 4DG1A 4Z4HA 3VA0A 3B6PA 3O3FA 4B9MA 3CQ8A 2OZMA 4EZ9A 2D0BA 4RW7A 5KGXA 5E41A 3HP6A 3PX6A 4PWDA 1S5JA 1RT2A 4ID5A 3T19A 4DFJA 2Z1JA 5HLFA 4FZZA 1FKPA 1G15A 2PY5A 3NFAA 4E7HA 4FM0A 4KHSA 3ZSOA 4OKKA 5KTQA 1TAUA 1HYZA
chains in the Genus database with same CATH superfamily
4FLWA 3MK6A 1NK9A 2D0CA 3TU5A 4BC3A 2VG7A 4CF8A 4DLGA 1LCUA 4OPAA 5DM7L 2NUBA 3VQ9A 1RBSA 4CFBA 5HRPA 3K5LA 2E2PA 3P83D 2E2NA 3ENHA 4DCHA 4DMNA 3D0PA 3CCMN 1L3SA 4GV3A 5ADXH 3O1WA 1CZBA 1LOTB 3ZT4A 1XUPO 3R1XA 1TL3A 3EEQA 5AQGA 4GW6A 4A62A 4WFBL 1OVQA 4DTPA 1RDAA 1XHXA 4H4OA 3QINA 1XNQK 3ZSWA 4BR9A 1QZ5A 3MECA 5FPMA 1RT5A 3AO5A 3JYTA 3SV4A 4CD3A 4H5TA 3BY5A 3OA9A 1L3VA 3OYGA 1C1BA 2E1YA 3O4QA 4KHNA 4KH5A 1U2VA 4CHYA 1Z6RA 1RDBA 3DLRA 1S9EA 2GWJA 2YNFA 4W5RA 1Q86O 1ZYQA 3LALA 4L3QA 3FR0A 4J2DA 2NRVA 3RR7A 4GKKK 4J2BA 3THYB 2Y1JA 4BR7A 1BGXT 2P9NB 2GELA 3D2FB 4DTJA 4KHPK 5KRSA 5BRDA 1DTTA 3B8AX 4B8AB 1YT3A 4BRAA 4JI4K 3CERA 1RT4A 3AO1A 1BHLA 4LF8K 3V9UA 3VETA 3H1QA 5M1OA 3SQ2A 3OYHA 4CZMA 4B3MK 2GUPA 3J80O 3KIOA 3OS1A 4DUZK 3O9SA 1TV6A 5AQOA 4BG9A 5GINA 4CJ5A 4IFYA 3LWLA 4C8LA 5FPNA 3SPYA 2WOMA 4FJ8A 2ASPA 2QW9A 4Y1CA 4M3ZA 4CJPA 1QE1A 4YNQA 1HPZA 1JLBA 3VQQA 2HBJA 2YNGA 1WSEA 2CGJA 4LSNA 2QXFA 3ZSRA 1VQLN 5I3UA 2Z1HA 5F2RA 2FF3B 1ATRA 3ISNC 1HQEA 1N33K 1UAXA 1OH8A 3TAGA 3PY8A 2AJQA 1NK4A 1WNSA 3SZ2A 4OGCA 1VQ7N 3WUHA 2WTUA 4XH1A 4BRHA 2V7ZA 4OKJA 3QIOA 4O4GA 4M3XA 4H0PA 3WNGA 3A5LC 3NCIA 4BC5A 3LDSA 3FZFA 4W5QA 2G8VA 4NLCA 3UKUB 4NCAA 4N47A 2ETJA 1RT3A 1DKGD 3A5NC 2E6MA 3QEPA 2LSNA 1VQ4N 2FBXA 3M6GA 4FCYA 1OH5A 3EY1A 3SJJA 5J2QA 4YDUA 1BCMA 2P9KB 1IO2A 2O8FB 3D2EB 4CGFA 3ATVA 4IFVA 1Q9XA 2VQEK 1IV0A 2OCEA 3QB0A 1K6YA 4BG8A 1TK8A 1Q18A 2G8HA 4G9ZA 3L2WA 3TAFA 3EL2A 4B3OA 4JKHA 5CR4A 3HT3A 1ZXOA 1VK0A 3HJFA 2WBNA 4QS8A 4CW7B 3OJUA 3S9HA 4FL9A 3T1AA 2OPSA 3TI0A 5GAGP 1U04A 5ELZA 3OBWA 1DTQA 5AQNA 4DSLA 4JRPA 4CIGA 5AZIA 3ZX0A 3MWPA 4WF9L 4CJSA 1DEJA 3U3GA 3WT0A 3W0LA 1OVYA 3P31A 4FJHA 4DB3A 2Q0RA 1T7PA 3AA5X 1XMOK 3AV9A 4CHQA 1A5XA 4BRDA 3ULEB 4CEZA 1BA1A 1ATSA 1VSKA 3CMAN 1I3AA 1JLGA 2DPNA 3J81O 4CEAA 4JKDA 4C23A 4CZLA 3J7YP 3DLLL 3CM5A 3J8AA 4O0JA 2VWBA 3O8MA 1X3NA 4H0XB 3OYMA 4JI7K 2X74A 1WN7A 2IVNA 4HVJA 2OTLN 3AVHA 3PO4A 2IDOA 3GDQA 1S9GA 4CK1A 4O55A 4JI8K 5C10A 1BQNA 3BEXA 4W5TA 1VQKN 4CJQA 5KRTA 3G0ZA 2IC3A 4FLZA 2YKMA 3MDQA 3C94A 1S22A 3PX0A 4PL8A 2ZGYA 4EAHD 1Q9YA 5FPDA 2DTUA 5AQKA 1VQMN 3GG4A 3CCQN 4WQ4A 1NJIO 4H5VA 2EWSA 4LF6K 4DSFA 1S1VA 1C6VA 4JKBA 4FJ7A 2HNDA 4DTXA 3CJBA 2NRRA 1WSGA 1S1WA 4I6MB 4CFCA 1S1TA 3C95A 3R6MA 3VMFB 2P9LB 5BR8K 4CJ4A 3VN5A 2E1ZA 2HMPA 4KHYA 1VHXA 3WNFA 1S1UA 4CGDA 3Q7CA 5B8HA 4DSEA 3RSEA 5ADXA 3DLHA 2P1JA 4IJNA 3WXMB 3MEGA 3BZKA 3CJCA 1RDUA 1RDDA 1IKYA 5AQSA 1KAXA 2F8TA 4E89A 3J7AP 1HPMA 4E1MA 1JCEA 1N5YA 4QS7A 1RDCA 4FJ9A 4NXMK 3ZT0A 2XO7A 3ZEUB 4FVMA 3THYA 3SLCA 3M8QA 1Y97A 3VEVA 1QQOA 3OYCA 2YKNA 2ASOA 3DXKB 5AQJA 3SAGA 1TL1A 3TSQA 1JKHA 3DLGA 1GLCG 4AQYK 4JI5K 2Q0UA 4CI6A 3OYIA 1CZ9A 5CY4A 4DFMA 4FWOA 3EYZA 4CJKA 3I33A 4FK0A 3H6EA 1U49A 5CYQA 3VF6A 3SK3A 4FVUA 4CEEA 2NZTA 2ATQA 4WQ4C 4LF9K 4O8KA 4M7XA 1QVGM 1QS4A 3O4NA 2WUSA 3LP3A 3IUCA 4CZEA 5F1XA 4DR3K 5AQQA 4FWLA 3EE8A 2WC9A 3VF2A 4LF5K 1NLVA 1VSIA 1J6ZA 3NBPA 4EHUA 3O9TA 1VSDA 2P9IB 4F2RA 5F0XA 3QEWA 1VQNN 3ASMA 5LJVA 4C8MA 4GKJK 4CEBA 4DS4A 3MXMA 1X9JA 3O6WA 1NWKA 4NCBA 2P9PB 5JVHL 2UXBK 3ZETB 4QCLA 1U4BA 4GY2B 2E2QA 3OYFA 5M1NA 3UKUA 3RVCA 5BPNA 4IOCL 2BDPA 3QETA 2HW3A 2ZJPL 3EZWA 3HM9A 2E2OA 4DF4A 5AQVA 4J8FA 2QKKA 2O8CB 3ID8A 4CD1A 4N5SA 3SI6A 2GTDA 5C12A 3TSPA 3CCSN 2KHOA 1E3MA 3D2EA 3KK2A 3DRRA 1RGIA 3QESA 1IBKK 3AVIA 1C1AA 4BQZA 2ZD1A 3NH0A 4N56A 4BDYA 3VTIA 3AARA 1ZC6A 1VQON 3CJ7A 4AHCA 4FWKA 5H1SQ 4OPJA 2YHXA 3O9RA 4FPBA 1HJOA 1NGFA 2CGKA 4EZ9A 5HOOA 4ID5A 5HLFA 4E7HA 4FM0A 4OKKA 2YJFA 1HYZA 4BDPA 3NF9A 3RMAA 3AO4A 3K5OA 4JD2B 3MN6A 3DLBA 2HHTA 2W40A 3TABA 3ULEA 2RF2A 3ZSXA 3UE5A 2QXLA 2ZWHA 1XWLA 3S3NA 3KWGA 5JS1A 4CGHA 2GBZA 2QM1A 2PBDA 4F9OA 1FXXA 2D5RA 5AQWA 4Q5VA 4KTWA 1M90O 4IEIA 1VQ8N 4IZ9A 4BY9C 3HOTA 3VGMA 3WNEA 3HM8A 3OYKA 4H5WA 3L8BA 1YI2N 2HHQA 2VG5A 1T44A 4O8UA 4OGEA 4JI0K 1XHZA 4CBWA 4M3TA 2W42A 4CCHA 4RW6A 4PQUA 3SMSA 2XY6A 3QFPA 3SQ0A 4JK9A 4YHHK 4B1YB 4FZYA 4MLEA 3C6UA 1CLQA 2G8FA 1HKGA 1ZBFA 1NK0A 2X6SA 1YXQA 3AVAA 4CJ3A 4FLTA 1JJ2M 3CXCM 3CHWA 3GL1A 4HHTA 4FLXA 2B5JA 4DSIA 5AZJB 4DR4K 4JKCA 5EXWA 3FLCO 3A8YA 4ID1A 3I56N 4EP5A 3VEXA 1RT7A 4AH9A 4C1NK 4Y1DA 5GAEP 4I6MA 2HSTA 4FPAA 2P9LA 4BWMA 3G4SN 3VTHA 5FRNA 3HI0A 2O8DB 3VEZA 1KVCA 1XC3A 1KXPA 4A57A 3M1FA 1VRUA 3HXMA 3K0SA 4Z0UA 1TYQB 5M1QA 4CGGA 3HVRA 4O44A 3UB5A 3MX2A 2GV9A 4B3SK 1MDUB 1RBRA 1U6ZA 2HBLA 4U7BA 3K57A 3DXMB 2P51A 2QWOA 4OLAA 3E01A 3SQ4A 3T3FA 4IO8A 1Z25A 4HUGA 3T7ZA 3AGKA 1GLDG 1D4XA 3O08A 2A5XA 3LP0A 3AVJA 3IG1A 1BOTO 4M63C 4LD0A 2R7YA 3DLEA 3PUFA 3DXKA 5LMUK 1T05A 3RRHA 1T3VA 5HROA 3KD5E 4N76A 4FLYA 3QBWA 4DU4A 1FK9A 4OJRA 1BU6O 3O9QA 3CCRN 1XC9A 4E1JA 4MLHA 3RMCA 2EX3A 3QDKA 3CCVN 4YOVA 3VQ5A 5C15A 4DR1K 4BQLA 1JL2A 2QWQA 4DR6K 1LV5A 4DTRA 3AO2A 4K25A 3HSCA 4LFCK 3SPZA 2QWPA 4NXNK 2XHBA 4OVLA 4WYBA 5AQLA 3ZSQA 4Y0WA 4CE9A 4FJJA 2QWLA 4MO4A 1NKEA 4YOUA 4X62K 2XY5A 3ENOA 1F21A 1JLFA 3LP2A 2ZM6K 3UKRB 2B6AA 3ZX2A 3H08A 4DFKA 3OS2A 2Q31A 2FLOA 2W6LA 5AFUH 4N41A 4ZTJA 2P9PA 1M1KO 3ZETA 1HKCA 3L2QA 3S3MA 3AVKA 1YITN 4E19A 4R5PA 1HNXK 4O5FA 1SQKA 3AA2A 4FW2A 2D0AA 2V52B 1Q8IA 3OYLA 2A1RA 4HTUA 4CEFA 4BRGA 3CQYA 4CEDA 1HYVA 3HZ6A 1TKTA 1FKOA 4KI4A 3P1GA 2O8CA 2HNZA 3AGRA 2A40A 3CCLN 2QWNA 1EKEA 3J7ZO 4HCCA 5JS2A 3LAKA 3ITHA 1J53A 3SUNA 1NGHA 2KQ2A 3QFUA 4BC2A 2A1SA 1QSSA 4AHRA 4F2SA 2KZMA 2OANA 3F9KA 4RW4A 1TVRA 3CIPA 2BGGA 4GV6A 2OPPA 1BUPA 1YVUA 1T03A 1JXEA 3KTQA 1EXQA 4B3RK 3SJHA 1X9WA 2YI1A 4CIEA 4ILHA 3GE1A 4CJFA 3O4WA 3V4IA 4DSKA 3SQ1A 3ZSZA 4X66K 1TK0A 4KREA 4K8XA 3C0BA 1HLUA 2QTDA 3ZSVA 1KC8O 4BRNA 4UQGA 1SL0A 2HMIA 1BG3A 3FFIA 2KZZA 3IS9A 4DWIA 3WNHA 4JD2A 2BANA 3AAPA 5M1KA 5FDLA 3NGZA 4C1NI 2A41A 5KQ8A 3KKSA 4XIUA 3C65A 5C2FA 1WUAA 4HUFA 1N36K 2OZSA 3D45A 3DOLA 3HL8A 5KI6A 3TWHA 1R59O 4E0DA 5BRHA 1T6CA 4IWVA 3CCUN 1C0UA 4MDAA 4FM1A 4DV7K 3U6FA 1N6QA 1IJJA 4JN4A 5C2DA 1YUWA 4KPYA 3L3VA 2UUAK 3AAQA 4FLUA 2HOEA 3HVTA 1D9FA 1CXQA 2XY7A 2PYJA 3AY9A 4BACA 4DLEA 4BRLA 1NGAA 5AZJA 3SAFA 3QEIA 3A5MC 1R0AA 4FLVA 1WBBA 3CJ9A 4CBUA 2HF3A 3E1YA 5CHIA 4RWTA 3AA4A 1D5AA 4DS5A 1TKXA 4O5BA 1KFSA 2Q97A 5C0YA 4AF1A 3IRXA 3AVGA 3D7EO 4AHUA 3VEOA 4LF7K 3GOIA 2FBVA 1Z26A 4B1ZA 4YY3K 2HHXA 4B9QA 3OY9A 2P9UA 1TYQA 3DMJA 1X9SA 3DLKA 5T7BA 2BUPA 4DV3K 3DRSA 4JNEA 3OYJA 2OPRA 1EX4A 1NG9A 4DV5K 3DXMA 3WXKA 2NRHA 1BDGA 1HX1A 1KAZA 3PX4A 4CFDA 1VQPN 3RR8A 3VQAA 4DQRA 1UWBA 4Z4FA 1RCHA 4IOXA 2IGIA 1OH7A 3MWTA 3BF3A 1JCGA 2KLAA 1BCOA 5CZ2A 3LDLA 4BRKA 3SUPA 4KFBA 3TAPA 2CGLA 4CJUA 3MN9A 4OKEA 1ITGA 3VEWA 2HHVA 2X6NA 2X78A 5GAHP 1GLBG 2IIRA 4GMJB 4DV4K 4Z4GA 1K8KA 1VSEA 4QAGA 4YOWA 1RFQA 4DV1K 4YDUC 4KHQA 4B9NA 2BTFA 2FXUA 2QWRA 4A5AA 4YOXA 3LDOA 4FYDA 4A2AA 1GOCA 1NGJA 5BN8A 3FZMA 4IG0A 1EWQA 4PKGA 4JKEA 4CESA 2F4VK 2QK9A 2UXDK 1NMDA 1ILYA 1SL1A 2NRXA 2D0PA 4JI3K 4DV2K 3KZBA 2Q3SA 3LDQA 2VGMA 4C8OA 1XNRK 3UKRA 3VQBA 1E4GT 3U9DA 1VAZA 3THXB 4KHUA 3P38A 3OYBA 3K9KA 5AR0A 1X3MA 4BC4A 1KLNA 4B9LA 3KK3A 2JLEA 3WEEB 1XI1A 1MU2A 3AVFA 2O4IA 1VQ9N 4DV6K 3QLHA 3LZIA 4CHNA 1HQUA 1QSYA 3U4LA 5DK5A 1WB9A 1D8YA 4C8NA 2NRZA 3EKUA 3VA0A 4B9MA 2OZMA 3LDPA 5E41A 5KGXA 3PX6A 5AFUA 1RT2A 3T19A 4DFJA 2GX9A 1G15A 2UUBK 3NFAA 3ZSOA 2ASMA 1P90A 4Z94A 5AQFA 3CPWM 3MXJA 1NGBA 3E9OA 4GVEA 1NGDA 2YV0X 1YIJN 2UUCK 4H0TB 2P9NA 3D2FA 3LWMA 3QERA 4ILGB 2F7TA 2QKBA 3MCPA 4AM6A 4F8RA 1B9FA 1ASUA 1IBMK 4ZHRA 3EKSA 2NNWA 4K8ZA 1YJWN 5DMRA 3VQ4A 2ZF5O 4FWPA 4FWQA 1VQ6N 3ZT2A 3H3OB 5JICA 3PIPL 2Q2RA 1YJ9N 1VSMA 2KFNA 4ELTA 2O8EB 3QO9A 4FWMA 1NK8A 3VA3A 3VQCA 5TKYA 2VYPA 5JVGL 4BRPA 2YNIA 3JAMO 1VQ5N 3FFKB 4I7FA 4OX9K 1KRPA 3SBGA 1BWFO 4DHYA 3HK2A 2KTQA 2Q36A 4CECA 3QNOA 2IS3A 1U48A 3V9ZA 3HYFA 4U67L 1WBDA 3IAYA 4FWNA 4CJ7A 4B9UA 3K2PA 3C6HA 1S3XA 3FE1A 3WXLA 1V4TA 5LMNK 4M3UA 1KVBA 1ASWA 4B1WB 4BR0A 4M42A 1TAQA 1QZ6A 1WSJA 1IG9A 1YAGA 1C0MA 5E84A 3VQPA 4JK7A 1T6DA 1VSFA 2P9KA 1JLEA 2O8FA 4PHTX 4JV5K 3HPHA 1KTQA 2JWKA 4B1UB 5C25A 4ELUA 1O13A 4LH5A 3NMUA 3MX5A 3RMDA 3IFRA 4HCBA 3L0QA 4JKAA 4H03B 1EP4A 1ZBHA 5JLHA 3ZYYX 4JHDB 1HNWK 3TTCA 3CCEN 4DR7K 1I39A 4WFNL 2HBMA 4RW9A 4FOEA 4CJLA 2VWJA 3LZJA 1JL1A 4FOIA 4A5BA 4FJXA 3C6AA 1NGGA 1WLJA 2VQFK 4JI1K 4BVOA 1KAYA 1NGCA 3UIQA 3N4PA 1QQMA 4Q0BA 3B6OA 2PYLA 3R9PA 4IO9L 4DU1A 3DOKA 4FSVA 3PO5A 1CZAN 1VSHA 4CK3A 3K5NA 1NK7A 4MQ3A 5BREA 4FJLA 4KAZA 3QEVA 1U47A 2ITMA 2HHUA 5HBMA 4PY5A 4Z4EA 3L2VA 5GADP 1HUXA 1C0GA 5AQZA 5AQPA 4BR5A 4DTMA 4FXDA 1A5WA 1BISA 5EY4A 3S3OA 3O9UA 2XRIA 1WSHA 1Q7YO 2ZQBA 4CEQA 4AILC 3KK7A 4EZ6A 3TAEA 3PV8A 1ZBLA 3M8RA 3VEYA 3NAEA 2WFBA 4B9VA 3AVLA 4DTNA 1KD1O 4X65K 1EO1A 4DQQA 1TK5A 3A0IX 4NB4A 3CC4N 1TKDA 1RBVA 1O1WA 2GEMA 4PL7A 1ASVA 1IH7A 5HRRA 4IDKA 1TKZA 3KLEA 3PLAA 2W6KA 3ZT1A 5IWAK 1TUYA 2Y1IA 3WEEA 1ATNA 1P8ZA 2B4JA 4E3SA 3NDKA 4BRMA 1QQNA 3T1YK 3QICA 2IVOA 1L3UA 2DFHA 1NK5A 4CIFA 4CF0A 1RILA 1GLJO 4QOZB 4JLHA 1S72N 4BDZA 3CYMA 4CVNE 3OBYA 3ZEUA 2F9WA 5EOYA 4KRFA 5IT9O 3RTVA 3P4IA 3WXJA 2A42A 5AZIB 3NGIA 3HBTA 3SCXA 4J2EA 1V4SA 2UYTA 5BPMA 2I7PA 4I2QA 4PKHA 4LH4A 3L6QA 2HBKA 3FZHA 3PSIA 3LL3A 1MWKA 2AA4A 3RRGA 1YF5L 2AP1A 1BIZA 2OPQA 4DV0K 3ATUA 5CYMA 4JI2K 3OJSA 3R8EA 3CC2N 3V6DA 4H0YB 2E6LA 5AQIA 4KB0A 4CZIA 1HMVA 4MDBA 3DJCA 5J1EA 3HO1A 2IAJA 1BA0A 1WSIA 3H3NO 1SKRA 1HR0K 3F73A 4ISEA 3H46O 1RBTA 5CZ1A 2P9IA 3BF1A 1HKBA 1BIUA 2E88A 1EQYA 1IBLK 4IFEA 1QVFM 1RTJA 3LP1A 4RCHA 4CJEA 4EHTA 3OYEA 2ITGA 4BE1A 1REVA 3JXUA 4EP4A 3AO3A 3U9ZA 3G6EN 3AA3A 1Q82O 4K0KK 4FJGA 2Z1GA 3ZLJA 4H5RA 4CK2A 3OYNA 1IKWA 3IMXA 4CZJA 1K8AO 1HJRA 4KO0A 3OS0A 1SKSA 4E7LA 1A5VA 2F96A 1L3TA 1KFDA 4DR5K 4BRCA 3RSEB 5KGWA 4LFAK 1N34K 3HPGA 2OYQA 2RHKA 3L2RA 4WCEL 4FJIA 1KVAA 3F2KA 1NKCA 2O4GA 3M8PA 1B9DA 3I0SA 5SZTA 4OPKA 1LAWA 5TKWA 4NYNA 3THWB 2NLXA 4BE2A 2ZGZA 1NK6A 1GLFO 2UXCK 1YHQN 4JHDA 3E9PA 1K73O 1QSLA 4B08A 5C24A 3P39A 3P5JA 3T69A 5AJ3K 3TSUA 3U3YA 4E1NA 5FRMA 2QA4N 4WE1A 5A2QO 2P9SB 5AQYA 3AVMA 4M3WA 2HVHA 3THVA 3CJ1A 1VSJA 4KKOA 4OLBA 4HTLA 4B1VA 5HL7L 4XH5A 2FSJA 2YHYA 3EZ5A 4NO7A 3KLHA 4F4KA 3KD1E 2HHHK 3K9JA 4BVPA 4YFUA 3BP8A 4CHOA 3EE9A 1QHTA 3M8SA 5I42A 1HNVA 3SUOA 4NCGA 1QTMA 3QNNA 1UA1A 5C42A 5MLCQ 4B1XB 2YCHA 1FW6A 3OVNA 4JS5A 3C6TA 4H0VB 3TTFA 3HRGA 3MAQA 4M3YA 5FPEA 4Z4CA 5CE3A 1LWFA 3MXIA 3RMBA 3ZT3A 2G8UA 1Q81O 3CD6N 1RT1A 3ZCMA 3OYAA 3V81A 4JEPA 1I94K 4JRQA 4JKGB 2JGUA 5J2MA 1RTDA 4GNIA 4FJNA 1WOQA 2FF6A 3VENA 4DG1A 4Z4HA 3B6PA 2V51B 3R3LA 3CQ8A 3HOSA 4BGAA 1MWMA 4BREA 2Z1JA 3IKMA 1FKPA 3CC7N 3GBTA 3CCJN 5KTQA 3O80A 1TAUA 3DM2A 4CHPA 4M3RA 3CQXA 4UY8O 4XH4A 3O3HA 4IBNA 5JMVA 1S6QA 2A3ZA 1YTUA 4E7IA 5AQTA 2YJEA 1GLEG 1YVNA 4MFBA 3DI6A 4KH4A 4BWJA 3FZLA 1VRTA 3I0RA 3L4IA 5BR9A 2NRTA 4KBOA 1QQCA 3H1VX 2O8DA 4IOAL 2DFEA 3NF7A 2VG6A 3C7NB 1DLOA 1S1XA 1GOAA 2I5JA 3NH1A 2J4RA 3G25A 1OKJA 2DFFA 2E8AA 1C1CA 2A6AA 4ISFA 2XY8A 5M1FA 3WXIA 1NNEA 5AQRA 3VF4A 4CZFA 2NRWA 3ZX3A 3MN5A 4F3TA 3CM6A 3RWUA 5KPRA 2V7YA 1ZBIA 4NYFA 1JLAA 5I9EB 3K58A 4M41A 4DKWA 4EFHA 4PA1A 1RTHA 3V1RA 3L2UA 4PKIA 4BGBA 1HNIA 4M45A 1JLCA 1RTIA 1W7AA 2F9TA 4F3OA 1NJYA 1W2BM 4LSLA 2FBTA 2IVPA 4XEIA 4CGIA 1NOZA 3H45C 2QEXN 1DT9A 3DYAA 4TSXA 1HRHA 4W5NA 2HVIA 3WQTA 1G99A 4JS4A 3HSTB 1X1PA 1WSFA 3KWIA 3CF5L 1RNHA 3FZKA 4KTQA 1GLLO 1W9HA 3NE6A 1H1VA 3QMLA 3OW2M 2D1KA 1UA0A 4WFAL 1T8EA 4BRQA 2D0OA 2E4LA 3NF8A 2YNHA 1D9DA 1IKVA 1W97L 2KFZA 3TAMA 2PFUA 4L8RB 2YHBA 3LANA 1FJGK 1BI4B 4CF9A 3SV3A 1W0HA 2G8KA 4FWRA 1J5EK 4CJVA 4DF8A 2ZE2A 3V1QA 2KKZA 3NVKA 2KW4A 4BRIA 1RT6A 3Q7BA 4ILJA 2P5GA 3V9SA 1DGKN 4JK8A 2CH5A 1LWCA 4ZTFA 4CF2A 3QEXA 4LFBK 3TTDA 4BE0A 3E66A 1JXBA 1C0TA 3MEEA 3K59A 4BR4A 3OHRA 4OPHA 3QBXA 4DQ8A 4AM7A 2BH1A 4IXCA 3K5MA 3TANA 1ZBSA 2IOCA 4DUYK 4I9QA 4HUEA 3CFPA 5HRNA 2RN2A 3S41A 4IKFA 3D6RA 1JLQA 4I2PA 4MO5A 3BUZB 2JWLA 2O8BB 2W41A 4CBXA 3KLIA 5LY3A 3PSFA 1BQMA 1B92A 2E20A 3JS6A 3ALYA 3F9MA 3L3UA 3BZCA 1SZ2A 4HWIA 4FJ5A 1TGOA 3THWA 1JCFA 1NU0A 3CJAA 2RE2A 3G71N 5M1PA 4ICLA 2HHWA 1SV5A 4NLBA 4W5OA 4BR2A 4AHVA 4CGJA 3N4QA 1WAJA 4RG8A 2HHSA 2GUIA 4B9TA 1SS6A 2I7NA 4IEEA 4DFPA 4KV8A 2P9SA 2Q1NA 2OTJN 4LF4K 4E7KA 3MMVA 5SWMA 1J5OA 1SL2A 4K41A 5AQXA 3DRPA 4JYAK 1IKXA 2CH6A 4BRFA 3SYZA 2PZSA 3LDNA 4CZKA 2ZJRL 4FW1A 1NGIA 2FSNA 4FO0A 3CG7A 3VGLA 5HRSA 1SAZA 1CXUA 3KLGA 4LC9B 4CEOA 3G10A 5AQHA 4H4MA 1LAVA 1HNZK 2HF4A 3VQEA 3L4QA 3T1HK 2YHWA 5BN9A 2FC0A 5EVZA 4DU3A 4FWSA 3TARA 4JAXA 2D4WA 4B8CA 5E26A 2EHGA 3OYDA 4M7YA 5J2NA 3KK1A 2PAVA 4JKGA 3A2FA 1RBUA 3CMEN 4JI6K 3F5TA 1XQSC 5GIOA 5J2PA 4CJTA 4EIAA 3V9XA 4KI6A 2VWKA 3EN9A 4B9SA 1NGEA 3SUQA 3SAHA 3PIOL 1X9MA 2RPIA 3WQUA 1U2VB 5EU7A 1C0FA 2FBYA 2WONA 3CFRA 1RDWX 1TUUA 1KLMA 3MEDA 3LPUA 3VQDA 5K14A 4CJWA 1KQSM 4K43A 1NBWA 1UOCA 4QS9A 3VOVA 1S6PA 1U45A 4FZXC 4ISGA 4DSJA 3C7NA 4H5NA 3NHGA 4B3TK 4K42A 4CHZA 1NJWA 2Z1IA 2VCPA 4IJAA 3DWLA 3NGYA 1YTAA 3I8BA 4CERA 1NOYA 1SUQA 3VQ8A 3VQ6A 4DQPA 3LM9A 4G1QA 1NKBA 2OA8A 1SKWA 2QI2A 3JSMA 2ZJQL 3LPTA 1J54A 4FK4A 3U8XA 5GIPA 1MA9B 4A2BA 2G8IA 3I8DA 3M3ZA 1KCFA 3FGUA 4RTFD 3KKRA 4CJRA 1LW0A 3AVCA 2BE2A 3E9LA 4RW8A 4A59A 4CF1A 4KH6A 3ID6A 3CFOA 4GVMA 4LY7A 1WAFA 5AQUA 4DTSA 2YHAA 4PUOA 3KVGA 3BGRA 4OO1J 3LM2A 1E4FT 4AHTA 3A5OC 1EETA 3NVMA 3O1BA 2RKIA 3KLFA 1HYSA 3VQ7A 5AQMA 3EO3A 3LAMA 3W3DA 4IDHA 2E5LK 4KB1A 4WQ5A 4FJMA 3HP9A 3QIPA 4YORA 2F8SA 4V19S 3HPOA 3TAQA 4FJKA 3NH2A 2G8WA 5LJWA 1ESVA 5KPTA 3SMPA 4CFAA 4X64K 1NJXA 4H0OA 4FK2A 2P5OA 3I55N 1BI4A 4KTZA 3VESA 5HP1A 1XMQK 4IG3A 4J2AA 4FM2A 1BL3A 4JKFA 3THXA 1GOBA 3NF6A 5KQDA 1NJZA 5BRFA 3MCAB 4C8KA 3M5RA 3CI5A 1N32K 4GV9A 5FLXO 4DTUA 1IG8A 5D3GA 1Y64A 4I9LA 1YJNN 5LL6Z 1N8RO 3TR8A 1NMNA 1QHAA 3O5BA 3VGKA 4BROA 3ULDA 1L5UA 4O0IA 2FSKA 3SBTA 5DM6L 2DY4A 3IDHA 3V9WA 3TPQA 1KSPA 1VSLA 4A61A 2P9UB 4CZGA 1EWRA 4KHWA 4H8KA 4DQSA 1Z05A 3KHYA 5EX5A 4YOYA 4Z4IA 1OH6A 3V1OA 2O8BA 1LWEA 4ELVA 4AHSA 5FROA 4DQIA 3AVBA 2QWMA 3CETA 2HB5A 3AVNA 3VPZA 5BPLA 3CPEA 4CZHA 4WQ5C 3ENBA 3OTOK 3O3GA 1BO5O 3ZSYA 5JLFA 4E7JA 4DTOA 4YOTA 3MN7A 2VGNA 2O8EA 2HNYA 1J9AA 5KPZA 1ZBUA 2H3GX 3SNNA 3VERA 3BDPA 1GLAG 2GWKA 1LW2A 3KJVA 3DAWA 1K8KB 3O3FA 2D0BA 4RW7A 3HP6A 1K9MO 2UU9K 4PWDA 3HTVA 1S5JA 4FZZA 1NM1A 4R79A 2YX6A 2PY5A 4KHSA 4DR2K
chains in the Genus database with same CATH topology
4FLWA 4CHPA 4BDPA 4M3RA 3NF9A 3MXJA 3RMAA 3O3HA 4IBNA 1S6QA 2YV0X 3AO4A 2D0CA 3K5OA 1NK9A 1YTUA 2VG7A 4CF8A 4DLGA 3DLBA 2NUBA 3LWMA 3VQ9A 4E7IA 3QERA 2QKBA 2HHTA 1RBSA 4CFBA 4MFBA 5HRPA 3TABA 3DI6A 1B9FA 3K5LA 2RF2A 3ZSXA 4F8RA 4BWJA 3P83D 1ASUA 1VRTA 1XWLA 3I0RA 3S3NA 4DMNA 4ZHRA 3D0PA 5JS1A 4CGHA 1QQCA 2GBZA 1L3SA 4K8ZA 1FXXA 2D5RA 1CZBA 2DFEA 4KTWA 3NF7A 5DMRA 2VG6A 3VQ4A 4Q5VA 1DLOA 3ZT2A 3ZT4A 1S1XA 1GOAA 2I5JA 1TL3A 3NH1A 3WNEA 3OYKA 3L8BA 2HHQA 2VG5A 4GW6A 4OGEA 2DFFA 1XHZA 1C1CA 4M3TA 4DTPA 1VSMA 2XY8A 1RDAA 2KFNA 1XHXA 4H4OA 3QINA 3ZSWA 2W42A 4CCHA 4ELTA 3QO9A 4RW6A 1NK8A 3VA3A 4PQUA 3MECA 2XY6A 3SQ0A 4F3TA 1RT5A 3AO5A 3CM6A 3VQCA 3JYTA 3SV4A 4FZYA 3RWUA 2YNIA 3C6UA 4I7FA 1ZBIA 1L3VA 4NYFA 1CLQA 2G8FA 1KRPA 3OYGA 1C1BA 1JLAA 1ZBFA 3O4QA 4KHNA 3K58A 1NK0A 2X6SA 3HK2A 4M41A 3AVAA 4CJ3A 4FLTA 2KTQA 4PA1A 4CECA 2IS3A 4CHYA 1RDBA 3DLRA 4HHTA 4FLXA 1RTHA 2B5JA 3V9ZA 1U48A 1S9EA 4DSIA 3HYFA 3V1RA 2YNFA 3L2UA 4W5RA 1ZYQA 3IAYA 3LALA 1HNIA 4M45A 1JLCA 4B9UA 1RTIA 4ID1A 4J2DA 4EP5A 3RR7A 1RT7A 4J2BA 4AH9A 4Y1DA 4F3OA 3K2PA 2Y1JA 1NJYA 1BGXT 4LSLA 2FBTA 4DTJA 4CGIA 1NOZA 5KRSA 1DTTA 4BWMA 4B8AB 1YT3A 3DYAA 4TSXA 1RT4A 1HRHA 3AO1A 5FRNA 1BHLA 4W5NA 2HVIA 4M3UA 3V9UA 4JS4A 3HSTB 1KVBA 1X1PA 1KVCA 1WSFA 3SQ2A 1ASWA 3OYHA 3HXMA 1VRUA 1RNHA 3KIOA 4KTQA 1W9HA 3OS1A 4M42A 3NE6A 1TAQA 1TV6A 4Z0UA 4CJ5A 1WSJA 3HVRA 4IFYA 4CGGA 4O44A 1IG9A 1C0MA 1UA0A 3VQPA 2GV9A 1T8EA 3LWLA 3NF8A 2E4LA 1RBRA 4C8LA 2YNHA 1VSFA 3K57A 1D9DA 2P51A 1IKVA 3SPYA 2WOMA 4FJ8A 4OLAA 1JLEA 3E01A 2KFZA 3TAMA 3SQ4A 4Y1CA 4L8RB 3HPHA 2YHBA 1KTQA 4M3ZA 4CJPA 3T3FA 1QE1A 3LANA 1Z25A 1HPZA 1BI4B 4CF9A 5C25A 4YNQA 4HUGA 1JLBA 3VQQA 3SV3A 1W0HA 2YNGA 2G8KA 1WSEA 4ELUA 4LH5A 4LSNA 4CJVA 2QXFA 3ZSRA 3RMDA 4HCBA 5I3UA 3LP0A 2Z1HA 4DF8A 3AVJA 3ISNC 3IG1A 1HQEA 1UAXA 2ZE2A 3V1QA 4LD0A 2KW4A 2R7YA 3TAGA 3DLEA 1RT6A 1NK4A 3PY8A 2AJQA 3PUFA 2P5GA 3KD5E 1WNSA 3SZ2A 3RRHA 4OGCA 1EP4A 3V9SA 5HROA 1T05A 4N76A 4FLYA 1ZBHA 1LWCA 4ZTFA 4CF2A 4OKJA 4DU4A 1FK9A 3QIOA 4O4GA 4M3XA 1I39A 4OJRA 3QEXA 4RW9A 4BE0A 1JXBA 3WNGA 1C0TA 3MEEA 3K59A 4CJLA 3NCIA 1XC9A 2VWJA 3LDSA 3LZJA 4W5QA 3RMCA 1JL1A 2EX3A 3K5MA 3TANA 2G8VA 4FJXA 3VQ5A 4NCAA 2IOCA 4N47A 2ETJA 1JL2A 1WLJA 4HUEA 4I9QA 3CFPA 1RT3A 5HRNA 2E6MA 1LV5A 2RN2A 4DTRA 3AO2A 3QEPA 4IKFA 1JLQA 3UIQA 2LSNA 3SPZA 4I2PA 4Q0BA 3B6OA 2FBXA 2PYLA 2XHBA 4OVLA 4FCYA 4DU1A 3ZSQA 3EY1A 3DOKA 3SJJA 4CE9A 5J2QA 3PO5A 4FJJA 1BCMA 1VSHA 4CK3A 3K5NA 1IO2A 1NK7A 3KLIA 1NKEA 4MQ3A 1BQMA 4CGFA 1B92A 2XY5A 4IFVA 3ALYA 3L3UA 1Q9XA 1F21A 1JLFA 3LP2A 4FJ5A 1TGOA 4FJLA 4KAZA 2B6AA 3H08A 3QEVA 4DFKA 1U47A 3OS2A 4ICLA 1K6YA 2HHUA 5HBMA 4PY5A 1SV5A 1TK8A 4W5OA 2G8HA 4Z4EA 2HHWA 4AHVA 4CGJA 3L2WA 3TAFA 3L2VA 3TI0A 4B3OA 1WAJA 4N41A 4ZTJA 4RG8A 4DTMA 2HHSA 2GUIA 4B9TA 3HT3A 3L2QA 4FXDA 4DFPA 4KV8A 3S3MA 1A5WA 1VK0A 3HJFA 1BISA 4E7KA 3AVKA 3S3OA 3OJUA 2XRIA 4E19A 4R5PA 3S9HA 5SWMA 1J5OA 1SL2A 3AA2A 3T1AA 1WSHA 2OPSA 2D0AA 2ZQBA 1Q8IA 3DRPA 4FW2A 1IKXA 1U04A 4CEQA 3OYLA 4HTUA 4AILC 1DTQA 3TAEA 4CEFA 3PV8A 2A1RA 3SYZA 1ZBLA 4EZ6A 4CEDA 3M8RA 4DSLA 4JRPA 1HYVA 4CIGA 1TKTA 1FKOA 2PZSA 4FW1A 3NAEA 3P1GA 4KI4A 3CG7A 4B9VA 4CJSA 2HNZA 5HRSA 3AVLA 3U3GA 1CXUA 3KLGA 4DTNA 4CEOA 3G10A 1EKEA 4HCCA 4FJHA 4H4MA 5JS2A 4DQQA 3LAKA 1LAVA 3ITHA 1TK5A 1J53A 1T7PA 3AA5X 3SUNA 3AV9A 4CHQA 2KQ2A 3VQEA 1A5XA 1TKDA 4CEZA 2A1SA 1RBVA 1O1WA 1VSKA 1QSSA 4AHRA 1I3AA 1JLGA 4F2SA 2FC0A 2KZMA 1ASVA 1IH7A 4DU3A 3F9KA 4IDKA 1TKZA 5HRRA 4CEAA 4RW4A 1TVRA 3KLEA 3TARA 2BGGA 4B8CA 3ZT1A 3CM5A 4O0JA 2Y1IA 3OYMA 2X74A 2EHGA 2OPPA 1WN7A 1YVUA 3OYDA 2B4JA 4E3SA 1JXEA 1T03A 4HVJA 3NDKA 3KTQA 5J2NA 1EXQA 3AVHA 3KK1A 1X9WA 3PO4A 2IDOA 4CIEA 1S9GA 3A2FA 4CJFA 3V4IA 1L3UA 2DFHA 1RBUA 4CK1A 1NK5A 3SQ1A 4DSKA 4CIFA 4O55A 3ZSZA 4CF0A 1TK0A 1BQNA 4KREA 1RILA 5J2PA 4QOZB 4JLHA 4K8XA 4BDZA 3CYMA 4CJTA 4W5TA 3V9XA 4KI6A 2VWKA 3ZSVA 4CJQA 4B9SA 5KRTA 3G0ZA 4UQGA 1SL0A 2IC3A 2HMIA 4FLZA 3SUQA 2YKMA 3C94A 3PX0A 3FFIA 1X9MA 2RPIA 2KZZA 1Q9YA 3IS9A 4DWIA 2DTUA 4KRFA 5EU7A 3WNHA 3RTVA 2BANA 2FBYA 2WONA 5FDLA 3NGZA 3NGIA 3CFRA 3SCXA 4J2EA 1KLMA 3MEDA 3KKSA 3LPUA 3VQDA 5K14A 4DSFA 1S1VA 4I2QA 4CJWA 1C6VA 4XIUA 4FJ7A 2HNDA 4DTXA 1UOCA 4HUFA 2OZSA 3D45A 1WSGA 1S1WA 1S6PA 4LH4A 4CFCA 3DOLA 3HL8A 1S1TA 5KI6A 1U45A 3C95A 4FZXC 4DSJA 3TWHA 4CJ4A 3NHGA 4E0DA 3VN5A 4CHZA 1NJWA 2Z1IA 3RRGA 4KHYA 3WNFA 1C0UA 4FM1A 1BIZA 2OPQA 1S1UA 1YTAA 3NGYA 4CERA 4CGDA 5CYMA 3U6FA 3OJSA 1N6QA 1SUQA 3VQ8A 3VQ6A 4DSEA 1NOYA 4G1QA 1NKBA 2OA8A 4DQPA 1SKWA 3V6DA 2E6LA 4KB0A 3DLHA 1HMVA 2P1JA 3JSMA 3MEGA 5J1EA 3LPTA 4KPYA 1J54A 4FK4A 3L3VA 4FLUA 3HO1A 2IAJA 1RDDA 1IKYA 2G8IA 1WSIA 3HVTA 1SKRA 1D9FA 1CXQA 3F73A 3I8DA 2XY7A 2PYJA 2F8TA 4E89A 1RBTA 1KCFA 4E1MA 1N5YA 3KKRA 4BACA 4DLEA 4CJRA 3AVCA 1LW0A 5CZ1A 1RDCA 2BE2A 3QEIA 4FJ9A 3ZT0A 2XO7A 1R0AA 4FLVA 4RW8A 1BIUA 4CF1A 4FVMA 4GVMA 3CFOA 4LY7A 1WAFA 3M8QA 1Y97A 1RTJA 4DTSA 3LP1A 4CJEA 3OYCA 4BE1A 3OYEA 2ITGA 2YKNA 3AA4A 2YHAA 1D5AA 4DS5A 1REVA 1TKXA 4PUOA 1TL1A 4O5BA 4EP4A 1JKHA 3BGRA 3DLGA 1KFSA 3AO3A 4AHTA 3AA3A 3IRXA 3OYIA 1EETA 3AVGA 4FJGA 4AHUA 2Z1GA 1CZ9A 2RKIA 5CY4A 4CK2A 3KLFA 2FBVA 1Z26A 3VQ7A 3OYNA 1IKWA 4DFMA 1HJRA 4KO0A 3LAMA 3OS0A 3EYZA 4CJKA 1SKSA 2HHXA 4KB1A 4E7LA 4FJMA 4FK0A 1A5VA 2F96A 3HP9A 3QIPA 3OY9A 2F8SA 1HYSA 1U49A 3HPOA 5CYQA 3DMJA 1X9SA 3DLKA 5T7BA 1L3TA 4CEEA 1KFDA 3DRSA 3OYJA 2OPRA 1EX4A 3TAQA 2ATQA 4FJKA 3QNOA 3NH2A 2G8WA 1QS4A 5KGWA 3O4NA 3HPGA 3LP3A 4CFAA 4CFDA 3PX4A 1NJXA 2OYQA 3L2RA 4FK2A 2P5OA 4FJIA 1KVAA 1BI4A 4KTZA 3RR8A 5HP1A 1NKCA 4IG3A 3VQAA 4DQRA 4J2AA 2O4GA 1UWBA 4FM2A 3M8PA 4Z4FA 1BL3A 1B9DA 1RCHA 3I0SA 2IGIA 5SZTA 1VSIA 1LAWA 4OPKA 3NBPA 1GOBA 3NF6A 1NJZA 1BCOA 1VSDA 5CZ2A 4F2RA 4NYNA 3QEWA 4C8KA 3ASMA 4BE2A 1NK6A 3SUPA 4KFBA 4C8MA 4DTUA 3TAPA 4CJUA 5D3GA 4CEBA 1QSLA 4OKEA 1ITGA 4I9LA 4DS4A 4B08A 3MXMA 5C24A 2HHVA 3P5JA 4NCBA 2X6NA 3U3YA 2X78A 3TR8A 4E1NA 4GMJB 5FRMA 4Z4GA 1VSEA 4QAGA 4WE1A 4QCLA 1U4BA 3AVMA 3ULDA 1L5UA 4O0IA 3OYFA 4M3WA 2HVHA 3THVA 4KHQA 1VSJA 4KKOA 4B9NA 4OLBA 2DY4A 2BDPA 3V9WA 3QETA 2HW3A 1KSPA 4FYDA 1VSLA 3HM9A 1GOCA 3EZ5A 4KHWA 4H8KA 4DF4A 4DQSA 3V81A 4IG0A 3KLHA 4F4KA 2QKKA 3KD1E 4Z4IA 3V1OA 4N5SA 3SI6A 1LWEA 4ELVA 4YFUA 4CESA 2QK9A 4CHOA 4AHSA 1SL1A 1QHTA 5FROA 3M8SA 1HNVA 3DRRA 3KK2A 3SUOA 5I42A 4DQIA 4NCGA 2Q3SA 3AVBA 3QESA 1QTMA 4C8OA 3QNNA 1UA1A 3VQBA 2HB5A 5C42A 3AVIA 1C1AA 3AVNA 4KHUA 3OVNA 3OYBA 4JS5A 2ZD1A 3C6TA 3NH0A 3O3GA 4N56A 4BDYA 3ZSYA 4DTOA 4E7JA 1KLNA 3MAQA 3KK3A 4B9LA 4M3YA 2JLEA 4AHCA 4Z4CA 3MXIA 1LWFA 1XI1A 1MU2A 3AVFA 2HNYA 2O4IA 3RMBA 3ZT3A 2G8UA 3QLHA 1RT1A 1J9AA 3ZCMA 4OPJA 3OYAA 4CHNA 3LZIA 1HQUA 1ZBUA 4JRQA 3SNNA 1QSYA 3BDPA 2JGUA 5J2MA 3DM2A 5DK5A 1RTDA 4FJNA 1LW2A 3KJVA 1D8YA 4C8NA 4DG1A 4Z4HA 3VA0A 3B6PA 3O3FA 4B9MA 3CQ8A 2OZMA 4EZ9A 2D0BA 4RW7A 5KGXA 5E41A 3HP6A 3PX6A 4PWDA 1S5JA 1RT2A 4ID5A 3T19A 4DFJA 2Z1JA 5HLFA 4FZZA 1FKPA 1G15A 2PY5A 3NFAA 4E7HA 4FM0A 4KHSA 3ZSOA 4OKKA 5KTQA 1TAUA 1HYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLW A;  4CHP A;  4BDP A;  4M3R A;  3NF9 A;  3MXJ A;  3RMA A;  3O3H A;  4IBN A;  1S6Q A;  2YV0 X;  3AO4 A;  2D0C A;  3K5O A;  1NK9 A;  1YTU A;  2VG7 A;  4CF8 A;  4DLG A;  3DLB A;  2NUB A;  3LWM A;  3VQ9 A;  4E7I A;  3QER A;  2QKB A;  2HHT A;  1RBS A;  4CFB A;  4MFB A;  5HRP A;  3TAB A;  3DI6 A;  1B9F A;  3K5L A;  2RF2 A;  3ZSX A;  4F8R A;  4BWJ A;  3P83 D;  1ASU A;  1VRT A;  1XWL A;  3I0R A;  3S3N A;  4DMN A;  4ZHR A;  3D0P A;  5JS1 A;  4CGH A;  1QQC A;  2GBZ A;  1L3S A;  4K8Z A;  1FXX A;  2D5R A;  1CZB A;  2DFE A;  4KTW A;  3NF7 A;  5DMR A;  2VG6 A;  3VQ4 A;  4Q5V A;  1DLO A;  3ZT2 A;  3ZT4 A;  1S1X A;  1GOA A;  2I5J A;  1TL3 A;  3NH1 A;  3WNE A;  3OYK A;  3L8B A;  2HHQ A;  2VG5 A;  4GW6 A;  4OGE A;  2DFF A;  1XHZ A;  1C1C A;  4M3T A;  4DTP A;  1VSM A;  2XY8 A;  1RDA A;  2KFN A;  1XHX A;  4H4O A;  3QIN A;  3ZSW A;  2W42 A;  4CCH A;  4ELT A;  3QO9 A;  4RW6 A;  1NK8 A;  3VA3 A;  4PQU A;  3MEC A;  2XY6 A;  3SQ0 A;  4F3T A;  1RT5 A;  3AO5 A;  3CM6 A;  3VQC A;  3JYT A;  3SV4 A;  4FZY A;  3RWU A;  2YNI A;  3C6U A;  4I7F A;  1ZBI A;  1L3V A;  4NYF A;  1CLQ A;  2G8F A;  1KRP A;  3OYG A;  1C1B A;  1JLA A;  1ZBF A;  3O4Q A;  4KHN A;  3K58 A;  1NK0 A;  2X6S A;  3HK2 A;  4M41 A;  3AVA A;  4CJ3 A;  4FLT A;  2KTQ A;  4PA1 A;  4CEC A;  2IS3 A;  4CHY A;  1RDB A;  3DLR A;  4HHT A;  4FLX A;  1RTH A;  2B5J A;  3V9Z A;  1U48 A;  1S9E A;  4DSI A;  3HYF A;  3V1R A;  2YNF A;  3L2U A;  4W5R A;  1ZYQ A;  3IAY A;  3LAL A;  1HNI A;  4M45 A;  1JLC A;  4B9U A;  1RTI A;  4ID1 A;  4J2D A;  4EP5 A;  3RR7 A;  1RT7 A;  4J2B A;  4AH9 A;  4Y1D A;  4F3O A;  3K2P A;  2Y1J A;  1NJY A;  1BGX T;  4LSL A;  2FBT A;  4DTJ A;  4CGI A;  1NOZ A;  5KRS A;  1DTT A;  4BWM A;  4B8A B;  1YT3 A;  3DYA A;  4TSX A;  1RT4 A;  1HRH A;  3AO1 A;  5FRN A;  1BHL A;  4W5N A;  2HVI A;  4M3U A;  3V9U A;  4JS4 A;  3HST B;  1KVB A;  1X1P A;  1KVC A;  1WSF A;  3SQ2 A;  1ASW A;  3OYH A;  3HXM A;  1VRU A;  1RNH A;  3KIO A;  4KTQ A;  1W9H A;  3OS1 A;  4M42 A;  3NE6 A;  1TAQ A;  1TV6 A;  4Z0U A;  4CJ5 A;  1WSJ A;  3HVR A;  4IFY A;  4CGG A;  4O44 A;  1IG9 A;  1C0M A;  1UA0 A;  3VQP A;  2GV9 A;  1T8E A;  3LWL A;  3NF8 A;  2E4L A;  1RBR A;  4C8L A;  2YNH A;  1VSF A;  3K57 A;  1D9D A;  2P51 A;  1IKV A;  3SPY A;  2WOM A;  4FJ8 A;  4OLA A;  1JLE A;  3E01 A;  2KFZ A;  3TAM A;  3SQ4 A;  4Y1C A;  4L8R B;  3HPH A;  2YHB A;  1KTQ A;  4M3Z A;  4CJP A;  3T3F A;  1QE1 A;  3LAN A;  1Z25 A;  1HPZ A;  1BI4 B;  4CF9 A;  5C25 A;  4YNQ A;  4HUG A;  1JLB A;  3VQQ A;  3SV3 A;  1W0H A;  2YNG A;  2G8K A;  1WSE A;  4ELU A;  4LH5 A;  4LSN A;  4CJV A;  2QXF A;  3ZSR A;  3RMD A;  4HCB A;  5I3U A;  3LP0 A;  2Z1H A;  4DF8 A;  3AVJ A;  3ISN C;  3IG1 A;  1HQE A;  1UAX A;  2ZE2 A;  3V1Q A;  4LD0 A;  2KW4 A;  2R7Y A;  3TAG A;  3DLE A;  1RT6 A;  1NK4 A;  3PY8 A;  2AJQ A;  3PUF A;  2P5G A;  3KD5 E;  1WNS A;  3SZ2 A;  3RRH A;  4OGC A;  1EP4 A;  3V9S A;  5HRO A;  1T05 A;  4N76 A;  4FLY A;  1ZBH A;  1LWC A;  4ZTF A;  4CF2 A;  4OKJ A;  4DU4 A;  1FK9 A;  3QIO A;  4O4G A;  4M3X A;  1I39 A;  4OJR A;  3QEX A;  4RW9 A;  4BE0 A;  1JXB A;  3WNG A;  1C0T A;  3MEE A;  3K59 A;  4CJL A;  3NCI A;  1XC9 A;  2VWJ A;  3LDS A;  3LZJ A;  4W5Q A;  3RMC A;  1JL1 A;  2EX3 A;  3K5M A;  3TAN A;  2G8V A;  4FJX A;  3VQ5 A;  4NCA A;  2IOC A;  4N47 A;  2ETJ A;  1JL2 A;  1WLJ A;  4HUE A;  4I9Q A;  3CFP A;  1RT3 A;  5HRN A;  2E6M A;  1LV5 A;  2RN2 A;  4DTR A;  3AO2 A;  3QEP A;  4IKF A;  1JLQ A;  3UIQ A;  2LSN A;  3SPZ A;  4I2P A;  4Q0B A;  3B6O A;  2FBX A;  2PYL A;  2XHB A;  4OVL A;  4FCY A;  4DU1 A;  3ZSQ A;  3EY1 A;  3DOK A;  3SJJ A;  4CE9 A;  5J2Q A;  3PO5 A;  4FJJ A;  1BCM A;  1VSH A;  4CK3 A;  3K5N A;  1IO2 A;  1NK7 A;  3KLI A;  1NKE A;  4MQ3 A;  1BQM A;  4CGF A;  1B92 A;  2XY5 A;  4IFV A;  3ALY A;  3L3U A;  1Q9X A;  1F21 A;  1JLF A;  3LP2 A;  4FJ5 A;  1TGO A;  4FJL A;  4KAZ A;  2B6A A;  3H08 A;  3QEV A;  4DFK A;  1U47 A;  3OS2 A;  4ICL A;  1K6Y A;  2HHU A;  5HBM A;  4PY5 A;  1SV5 A;  1TK8 A;  4W5O A;  2G8H A;  4Z4E A;  2HHW A;  4AHV A;  4CGJ A;  3L2W A;  3TAF A;  3L2V A;  3TI0 A;  4B3O A;  1WAJ A;  4N41 A;  4ZTJ A;  4RG8 A;  4DTM A;  2HHS A;  2GUI A;  4B9T A;  3HT3 A;  3L2Q A;  4FXD A;  4DFP A;  4KV8 A;  3S3M A;  1A5W A;  1VK0 A;  3HJF A;  1BIS A;  4E7K A;  3AVK A;  3S3O A;  3OJU A;  2XRI A;  4E19 A;  4R5P A;  3S9H A;  5SWM A;  1J5O A;  1SL2 A;  3AA2 A;  3T1A A;  1WSH A;  2OPS A;  2D0A A;  2ZQB A;  1Q8I A;  3DRP A;  4FW2 A;  1IKX A;  1U04 A;  4CEQ A;  3OYL A;  4HTU A;  4AIL C;  1DTQ A;  3TAE A;  4CEF A;  3PV8 A;  2A1R A;  3SYZ A;  1ZBL A;  4EZ6 A;  4CED A;  3M8R A;  4DSL A;  4JRP A;  1HYV A;  4CIG A;  1TKT A;  1FKO A;  2PZS A;  4FW1 A;  3NAE A;  3P1G A;  4KI4 A;  3CG7 A;  4B9V A;  4CJS A;  2HNZ A;  5HRS A;  3AVL A;  3U3G A;  1CXU A;  3KLG A;  4DTN A;  4CEO A;  3G10 A;  1EKE A;  4HCC A;  4FJH A;  4H4M A;  5JS2 A;  4DQQ A;  3LAK A;  1LAV A;  3ITH A;  1TK5 A;  1J53 A;  1T7P A;  3AA5 X;  3SUN A;  3AV9 A;  4CHQ A;  2KQ2 A;  3VQE A;  1A5X A;  1TKD A;  4CEZ A;  2A1S A;  1RBV A;  1O1W A;  1VSK A;  1QSS A;  4AHR A;  1I3A A;  1JLG A;  4F2S A;  2FC0 A;  2KZM A;  1ASV A;  1IH7 A;  4DU3 A;  3F9K A;  4IDK A;  1TKZ A;  5HRR A;  4CEA A;  4RW4 A;  1TVR A;  3KLE A;  3TAR A;  2BGG A;  4B8C A;  3ZT1 A;  3CM5 A;  4O0J A;  2Y1I A;  3OYM A;  2X74 A;  2EHG A;  2OPP A;  1WN7 A;  1YVU A;  3OYD A;  2B4J A;  4E3S A;  1JXE A;  1T03 A;  4HVJ A;  3NDK A;  3KTQ A;  5J2N A;  1EXQ A;  3AVH A;  3KK1 A;  1X9W A;  3PO4 A;  2IDO A;  4CIE A;  1S9G A;  3A2F A;  4CJF A;  3V4I A;  1L3U A;  2DFH A;  1RBU A;  4CK1 A;  1NK5 A;  3SQ1 A;  4DSK A;  4CIF A;  4O55 A;  3ZSZ A;  4CF0 A;  1TK0 A;  1BQN A;  4KRE A;  1RIL A;  5J2P A;  4QOZ B;  4JLH A;  4K8X A;  4BDZ A;  3CYM A;  4CJT A;  4W5T A;  3V9X A;  4KI6 A;  2VWK A;  3ZSV A;  4CJQ A;  4B9S A;  5KRT A;  3G0Z A;  4UQG A;  1SL0 A;  2IC3 A;  2HMI A;  4FLZ A;  3SUQ A;  2YKM A;  3C94 A;  3PX0 A;  3FFI A;  1X9M A;  2RPI A;  2KZZ A;  1Q9Y A;  3IS9 A;  4DWI A;  2DTU A;  4KRF A;  5EU7 A;  3WNH A;  3RTV A;  2BAN A;  2FBY A;  2WON A;  5FDL A;  3NGZ A;  3NGI A;  3CFR A;  3SCX A;  4J2E A;  1KLM A;  3MED A;  3KKS A;  3LPU A;  3VQD A;  5K14 A;  4DSF A;  1S1V A;  4I2Q A;  4CJW A;  1C6V A;  4XIU A;  4FJ7 A;  2HND A;  4DTX A;  1UOC A;  4HUF A;  2OZS A;  3D45 A;  1WSG A;  1S1W A;  1S6P A;  4LH4 A;  4CFC A;  3DOL A;  3HL8 A;  1S1T A;  5KI6 A;  1U45 A;  3C95 A;  4FZX C;  4DSJ A;  3TWH A;  4CJ4 A;  3NHG A;  4E0D A;  3VN5 A;  4CHZ A;  1NJW A;  2Z1I A;  3RRG A;  4KHY A;  3WNF A;  1C0U A;  4FM1 A;  1BIZ A;  2OPQ A;  1S1U A;  1YTA A;  3NGY A;  4CER A;  4CGD A;  5CYM A;  3U6F A;  3OJS A;  1N6Q A;  1SUQ A;  3VQ8 A;  3VQ6 A;  4DSE A;  1NOY A;  4G1Q A;  1NKB A;  2OA8 A;  4DQP A;  1SKW A;  3V6D A;  2E6L A;  4KB0 A;  3DLH A;  1HMV A;  2P1J A;  3JSM A;  3MEG A;  5J1E A;  3LPT A;  4KPY A;  1J54 A;  4FK4 A;  3L3V A;  4FLU A;  3HO1 A;  2IAJ A;  1RDD A;  1IKY A;  2G8I A;  1WSI A;  3HVT A;  1SKR A;  1D9F A;  1CXQ A;  3F73 A;  3I8D A;  2XY7 A;  2PYJ A;  2F8T A;  4E89 A;  1RBT A;  1KCF A;  4E1M A;  1N5Y A;  3KKR A;  4BAC A;  4DLE A;  4CJR A;  3AVC A;  1LW0 A;  5CZ1 A;  1RDC A;  2BE2 A;  3QEI A;  4FJ9 A;  3ZT0 A;  2XO7 A;  1R0A A;  4FLV A;  4RW8 A;  1BIU A;  4CF1 A;  4FVM A;  4GVM A;  3CFO A;  4LY7 A;  1WAF A;  3M8Q A;  1Y97 A;  1RTJ A;  4DTS A;  3LP1 A;  4CJE A;  3OYC A;  4BE1 A;  3OYE A;  2ITG A;  2YKN A;  3AA4 A;  2YHA A;  1D5A A;  4DS5 A;  1REV A;  1TKX A;  4PUO A;  1TL1 A;  4O5B A;  4EP4 A;  1JKH A;  3BGR A;  3DLG A;  1KFS A;  3AO3 A;  4AHT A;  3AA3 A;  3IRX A;  3OYI A;  1EET A;  3AVG A;  4FJG A;  4AHU A;  2Z1G A;  1CZ9 A;  2RKI A;  5CY4 A;  4CK2 A;  3KLF A;  2FBV A;  1Z26 A;  3VQ7 A;  3OYN A;  1IKW A;  4DFM A;  1HJR A;  4KO0 A;  3LAM A;  3OS0 A;  3EYZ A;  4CJK A;  1SKS A;  2HHX A;  4KB1 A;  4E7L A;  4FJM A;  4FK0 A;  1A5V A;  2F96 A;  3HP9 A;  3QIP A;  3OY9 A;  2F8S A;  1HYS A;  1U49 A;  3HPO A;  5CYQ A;  3DMJ A;  1X9S A;  3DLK A;  5T7B A;  1L3T A;  4CEE A;  1KFD A;  3DRS A;  3OYJ A;  2OPR A;  1EX4 A;  3TAQ A;  2ATQ A;  4FJK A;  3QNO A;  3NH2 A;  2G8W A;  1QS4 A;  5KGW A;  3O4N A;  3HPG A;  3LP3 A;  4CFA A;  4CFD A;  3PX4 A;  1NJX A;  2OYQ A;  3L2R A;  4FK2 A;  2P5O A;  4FJI A;  1KVA A;  1BI4 A;  4KTZ A;  3RR8 A;  5HP1 A;  1NKC A;  4IG3 A;  3VQA A;  4DQR A;  4J2A A;  2O4G A;  1UWB A;  4FM2 A;  3M8P A;  4Z4F A;  1BL3 A;  1B9D A;  1RCH A;  3I0S A;  2IGI A;  5SZT A;  1VSI A;  1LAW A;  4OPK A;  3NBP A;  1GOB A;  3NF6 A;  1NJZ A;  1BCO A;  1VSD A;  5CZ2 A;  4F2R A;  4NYN A;  3QEW A;  4C8K A;  3ASM A;  4BE2 A;  1NK6 A;  3SUP A;  4KFB A;  4C8M A;  4DTU A;  3TAP A;  4CJU A;  5D3G A;  4CEB A;  1QSL A;  4OKE A;  1ITG A;  4I9L A;  4DS4 A;  4B08 A;  3MXM A;  5C24 A;  2HHV A;  3P5J A;  4NCB A;  2X6N A;  3U3Y A;  2X78 A;  3TR8 A;  4E1N A;  4GMJ B;  5FRM A;  4Z4G A;  1VSE A;  4QAG A;  4WE1 A;  4QCL A;  1U4B A;  3AVM A;  3ULD A;  1L5U A;  4O0I A;  3OYF A;  4M3W A;  2HVH A;  3THV A;  4KHQ A;  1VSJ A;  4KKO A;  4B9N A;  4OLB A;  2DY4 A;  2BDP A;  3V9W A;  3QET A;  2HW3 A;  1KSP A;  4FYD A;  1VSL A;  3HM9 A;  1GOC A;  3EZ5 A;  4KHW A;  4H8K A;  4DF4 A;  4DQS A;  3V81 A;  4IG0 A;  3KLH A;  4F4K A;  2QKK A;  3KD1 E;  4Z4I A;  3V1O A;  4N5S A;  3SI6 A;  1LWE A;  4ELV A;  4YFU A;  4CES A;  2QK9 A;  4CHO A;  4AHS A;  1SL1 A;  1QHT A;  5FRO A;  3M8S A;  1HNV A;  3DRR A;  3KK2 A;  3SUO A;  5I42 A;  4DQI A;  4NCG A;  2Q3S A;  3AVB A;  3QES A;  1QTM A;  4C8O A;  3QNN A;  1UA1 A;  3VQB A;  2HB5 A;  5C42 A;  3AVI A;  1C1A A;  3AVN A;  4KHU A;  3OVN A;  3OYB A;  4JS5 A;  2ZD1 A;  3C6T A;  3NH0 A;  3O3G A;  4N56 A;  4BDY A;  3ZSY A;  4DTO A;  4E7J A;  1KLN A;  3MAQ A;  3KK3 A;  4B9L A;  4M3Y A;  2JLE A;  4AHC A;  4Z4C A;  3MXI A;  1LWF A;  1XI1 A;  1MU2 A;  3AVF A;  2HNY A;  2O4I A;  3RMB A;  3ZT3 A;  2G8U A;  3QLH A;  1RT1 A;  1J9A A;  3ZCM A;  4OPJ A;  3OYA A;  4CHN A;  3LZI A;  1HQU A;  1ZBU A;  4JRQ A;  3SNN A;  1QSY A;  3BDP A;  2JGU A;  5J2M A;  3DM2 A;  5DK5 A;  1RTD A;  4FJN A;  1LW2 A;  3KJV A;  1D8Y A;  4C8N A;  4DG1 A;  4Z4H A;  3VA0 A;  3B6P A;  3O3F A;  4B9M A;  3CQ8 A;  2OZM A;  4EZ9 A;  2D0B A;  4RW7 A;  5KGX A;  5E41 A;  3HP6 A;  3PX6 A;  4PWD A;  1S5J A;  1RT2 A;  4ID5 A;  3T19 A;  4DFJ A;  2Z1J A;  5HLF A;  4FZZ A;  1FKP A;  1G15 A;  2PY5 A;  3NFA A;  4E7H A;  4FM0 A;  4KHS A;  3ZSO A;  4OKK A;  5KTQ A;  1TAU A;  1HYZ A; 
#chains in the Genus database with same CATH topology
 4FLW A;  3MK6 A;  1NK9 A;  2D0C A;  3TU5 A;  4BC3 A;  2VG7 A;  4CF8 A;  4DLG A;  1LCU A;  4OPA A;  5DM7 L;  2NUB A;  3VQ9 A;  1RBS A;  4CFB A;  5HRP A;  3K5L A;  2E2P A;  3P83 D;  2E2N A;  3ENH A;  4DCH A;  4DMN A;  3D0P A;  3CCM N;  1L3S A;  4GV3 A;  5ADX H;  3O1W A;  1CZB A;  1LOT B;  3ZT4 A;  1XUP O;  3R1X A;  1TL3 A;  3EEQ A;  5AQG A;  4GW6 A;  4A62 A;  4WFB L;  1OVQ A;  4DTP A;  1RDA A;  1XHX A;  4H4O A;  3QIN A;  1XNQ K;  3ZSW A;  4BR9 A;  1QZ5 A;  3MEC A;  5FPM A;  1RT5 A;  3AO5 A;  3JYT A;  3SV4 A;  4CD3 A;  4H5T A;  3BY5 A;  3OA9 A;  1L3V A;  3OYG A;  1C1B A;  2E1Y A;  3O4Q A;  4KHN A;  4KH5 A;  1U2V A;  4CHY A;  1Z6R A;  1RDB A;  3DLR A;  1S9E A;  2GWJ A;  2YNF A;  4W5R A;  1Q86 O;  1ZYQ A;  3LAL A;  4L3Q A;  3FR0 A;  4J2D A;  2NRV A;  3RR7 A;  4GKK K;  4J2B A;  3THY B;  2Y1J A;  4BR7 A;  1BGX T;  2P9N B;  2GEL A;  3D2F B;  4DTJ A;  4KHP K;  5KRS A;  5BRD A;  1DTT A;  3B8A X;  4B8A B;  1YT3 A;  4BRA A;  4JI4 K;  3CER A;  1RT4 A;  3AO1 A;  1BHL A;  4LF8 K;  3V9U A;  3VET A;  3H1Q A;  5M1O A;  3SQ2 A;  3OYH A;  4CZM A;  4B3M K;  2GUP A;  3J80 O;  3KIO A;  3OS1 A;  4DUZ K;  3O9S A;  1TV6 A;  5AQO A;  4BG9 A;  5GIN A;  4CJ5 A;  4IFY A;  3LWL A;  4C8L A;  5FPN A;  3SPY A;  2WOM A;  4FJ8 A;  2ASP A;  2QW9 A;  4Y1C A;  4M3Z A;  4CJP A;  1QE1 A;  4YNQ A;  1HPZ A;  1JLB A;  3VQQ A;  2HBJ A;  2YNG A;  1WSE A;  2CGJ A;  4LSN A;  2QXF A;  3ZSR A;  1VQL N;  5I3U A;  2Z1H A;  5F2R A;  2FF3 B;  1ATR A;  3ISN C;  1HQE A;  1N33 K;  1UAX A;  1OH8 A;  3TAG A;  3PY8 A;  2AJQ A;  1NK4 A;  1WNS A;  3SZ2 A;  4OGC A;  1VQ7 N;  3WUH A;  2WTU A;  4XH1 A;  4BRH A;  2V7Z A;  4OKJ A;  3QIO A;  4O4G A;  4M3X A;  4H0P A;  3WNG A;  3A5L C;  3NCI A;  4BC5 A;  3LDS A;  3FZF A;  4W5Q A;  2G8V A;  4NLC A;  3UKU B;  4NCA A;  4N47 A;  2ETJ A;  1RT3 A;  1DKG D;  3A5N C;  2E6M A;  3QEP A;  2LSN A;  1VQ4 N;  2FBX A;  3M6G A;  4FCY A;  1OH5 A;  3EY1 A;  3SJJ A;  5J2Q A;  4YDU A;  1BCM A;  2P9K B;  1IO2 A;  2O8F B;  3D2E B;  4CGF A;  3ATV A;  4IFV A;  1Q9X A;  2VQE K;  1IV0 A;  2OCE A;  3QB0 A;  1K6Y A;  4BG8 A;  1TK8 A;  1Q18 A;  2G8H A;  4G9Z A;  3L2W A;  3TAF A;  3EL2 A;  4B3O A;  4JKH A;  5CR4 A;  3HT3 A;  1ZXO A;  1VK0 A;  3HJF A;  2WBN A;  4QS8 A;  4CW7 B;  3OJU A;  3S9H A;  4FL9 A;  3T1A A;  2OPS A;  3TI0 A;  5GAG P;  1U04 A;  5ELZ A;  3OBW A;  1DTQ A;  5AQN A;  4DSL A;  4JRP A;  4CIG A;  5AZI A;  3ZX0 A;  3MWP A;  4WF9 L;  4CJS A;  1DEJ A;  3U3G A;  3WT0 A;  3W0L A;  1OVY A;  3P31 A;  4FJH A;  4DB3 A;  2Q0R A;  1T7P A;  3AA5 X;  1XMO K;  3AV9 A;  4CHQ A;  1A5X A;  4BRD A;  3ULE B;  4CEZ A;  1BA1 A;  1ATS A;  1VSK A;  3CMA N;  1I3A A;  1JLG A;  2DPN A;  3J81 O;  4CEA A;  4JKD A;  4C23 A;  4CZL A;  3J7Y P;  3DLL L;  3CM5 A;  3J8A A;  4O0J A;  2VWB A;  3O8M A;  1X3N A;  4H0X B;  3OYM A;  4JI7 K;  2X74 A;  1WN7 A;  2IVN A;  4HVJ A;  2OTL N;  3AVH A;  3PO4 A;  2IDO A;  3GDQ A;  1S9G A;  4CK1 A;  4O55 A;  4JI8 K;  5C10 A;  1BQN A;  3BEX A;  4W5T A;  1VQK N;  4CJQ A;  5KRT A;  3G0Z A;  2IC3 A;  4FLZ A;  2YKM A;  3MDQ A;  3C94 A;  1S22 A;  3PX0 A;  4PL8 A;  2ZGY A;  4EAH D;  1Q9Y A;  5FPD A;  2DTU A;  5AQK A;  1VQM N;  3GG4 A;  3CCQ N;  4WQ4 A;  1NJI O;  4H5V A;  2EWS A;  4LF6 K;  4DSF A;  1S1V A;  1C6V A;  4JKB A;  4FJ7 A;  2HND A;  4DTX A;  3CJB A;  2NRR A;  1WSG A;  1S1W A;  4I6M B;  4CFC A;  1S1T A;  3C95 A;  3R6M A;  3VMF B;  2P9L B;  5BR8 K;  4CJ4 A;  3VN5 A;  2E1Z A;  2HMP A;  4KHY A;  1VHX A;  3WNF A;  1S1U A;  4CGD A;  3Q7C A;  5B8H A;  4DSE A;  3RSE A;  5ADX A;  3DLH A;  2P1J A;  4IJN A;  3WXM B;  3MEG A;  3BZK A;  3CJC A;  1RDU A;  1RDD A;  1IKY A;  5AQS A;  1KAX A;  2F8T A;  4E89 A;  3J7A P;  1HPM A;  4E1M A;  1JCE A;  1N5Y A;  4QS7 A;  1RDC A;  4FJ9 A;  4NXM K;  3ZT0 A;  2XO7 A;  3ZEU B;  4FVM A;  3THY A;  3SLC A;  3M8Q A;  1Y97 A;  3VEV A;  1QQO A;  3OYC A;  2YKN A;  2ASO A;  3DXK B;  5AQJ A;  3SAG A;  1TL1 A;  3TSQ A;  1JKH A;  3DLG A;  1GLC G;  4AQY K;  4JI5 K;  2Q0U A;  4CI6 A;  3OYI A;  1CZ9 A;  5CY4 A;  4DFM A;  4FWO A;  3EYZ A;  4CJK A;  3I33 A;  4FK0 A;  3H6E A;  1U49 A;  5CYQ A;  3VF6 A;  3SK3 A;  4FVU A;  4CEE A;  2NZT A;  2ATQ A;  4WQ4 C;  4LF9 K;  4O8K A;  4M7X A;  1QVG M;  1QS4 A;  3O4N A;  2WUS A;  3LP3 A;  3IUC A;  4CZE A;  5F1X A;  4DR3 K;  5AQQ A;  4FWL A;  3EE8 A;  2WC9 A;  3VF2 A;  4LF5 K;  1NLV A;  1VSI A;  1J6Z A;  3NBP A;  4EHU A;  3O9T A;  1VSD A;  2P9I B;  4F2R A;  5F0X A;  3QEW A;  1VQN N;  3ASM A;  5LJV A;  4C8M A;  4GKJ K;  4CEB A;  4DS4 A;  3MXM A;  1X9J A;  3O6W A;  1NWK A;  4NCB A;  2P9P B;  5JVH L;  2UXB K;  3ZET B;  4QCL A;  1U4B A;  4GY2 B;  2E2Q A;  3OYF A;  5M1N A;  3UKU A;  3RVC A;  5BPN A;  4IOC L;  2BDP A;  3QET A;  2HW3 A;  2ZJP L;  3EZW A;  3HM9 A;  2E2O A;  4DF4 A;  5AQV A;  4J8F A;  2QKK A;  2O8C B;  3ID8 A;  4CD1 A;  4N5S A;  3SI6 A;  2GTD A;  5C12 A;  3TSP A;  3CCS N;  2KHO A;  1E3M A;  3D2E A;  3KK2 A;  3DRR A;  1RGI A;  3QES A;  1IBK K;  3AVI A;  1C1A A;  4BQZ A;  2ZD1 A;  3NH0 A;  4N56 A;  4BDY A;  3VTI A;  3AAR A;  1ZC6 A;  1VQO N;  3CJ7 A;  4AHC A;  4FWK A;  5H1S Q;  4OPJ A;  2YHX A;  3O9R A;  4FPB A;  1HJO A;  1NGF A;  2CGK A;  4EZ9 A;  5HOO A;  4ID5 A;  5HLF A;  4E7H A;  4FM0 A;  4OKK A;  2YJF A;  1HYZ A;  4BDP A;  3NF9 A;  3RMA A;  3AO4 A;  3K5O A;  4JD2 B;  3MN6 A;  3DLB A;  2HHT A;  2W40 A;  3TAB A;  3ULE A;  2RF2 A;  3ZSX A;  3UE5 A;  2QXL A;  2ZWH A;  1XWL A;  3S3N A;  3KWG A;  5JS1 A;  4CGH A;  2GBZ A;  2QM1 A;  2PBD A;  4F9O A;  1FXX A;  2D5R A;  5AQW A;  4Q5V A;  4KTW A;  1M90 O;  4IEI A;  1VQ8 N;  4IZ9 A;  4BY9 C;  3HOT A;  3VGM A;  3WNE A;  3HM8 A;  3OYK A;  4H5W A;  3L8B A;  1YI2 N;  2HHQ A;  2VG5 A;  1T44 A;  4O8U A;  4OGE A;  4JI0 K;  1XHZ A;  4CBW A;  4M3T A;  2W42 A;  4CCH A;  4RW6 A;  4PQU A;  3SMS A;  2XY6 A;  3QFP A;  3SQ0 A;  4JK9 A;  4YHH K;  4B1Y B;  4FZY A;  4MLE A;  3C6U A;  1CLQ A;  2G8F A;  1HKG A;  1ZBF A;  1NK0 A;  2X6S A;  1YXQ A;  3AVA A;  4CJ3 A;  4FLT A;  1JJ2 M;  3CXC M;  3CHW A;  3GL1 A;  4HHT A;  4FLX A;  2B5J A;  4DSI A;  5AZJ B;  4DR4 K;  4JKC A;  5EXW A;  3FLC O;  3A8Y A;  4ID1 A;  3I56 N;  4EP5 A;  3VEX A;  1RT7 A;  4AH9 A;  4C1N K;  4Y1D A;  5GAE P;  4I6M A;  2HST A;  4FPA A;  2P9L A;  4BWM A;  3G4S N;  3VTH A;  5FRN A;  3HI0 A;  2O8D B;  3VEZ A;  1KVC A;  1XC3 A;  1KXP A;  4A57 A;  3M1F A;  1VRU A;  3HXM A;  3K0S A;  4Z0U A;  1TYQ B;  5M1Q A;  4CGG A;  3HVR A;  4O44 A;  3UB5 A;  3MX2 A;  2GV9 A;  4B3S K;  1MDU B;  1RBR A;  1U6Z A;  2HBL A;  4U7B A;  3K57 A;  3DXM B;  2P51 A;  2QWO A;  4OLA A;  3E01 A;  3SQ4 A;  3T3F A;  4IO8 A;  1Z25 A;  4HUG A;  3T7Z A;  3AGK A;  1GLD G;  1D4X A;  3O08 A;  2A5X A;  3LP0 A;  3AVJ A;  3IG1 A;  1BOT O;  4M63 C;  4LD0 A;  2R7Y A;  3DLE A;  3PUF A;  3DXK A;  5LMU K;  1T05 A;  3RRH A;  1T3V A;  5HRO A;  3KD5 E;  4N76 A;  4FLY A;  3QBW A;  4DU4 A;  1FK9 A;  4OJR A;  1BU6 O;  3O9Q A;  3CCR N;  1XC9 A;  4E1J A;  4MLH A;  3RMC A;  2EX3 A;  3QDK A;  3CCV N;  4YOV A;  3VQ5 A;  5C15 A;  4DR1 K;  4BQL A;  1JL2 A;  2QWQ A;  4DR6 K;  1LV5 A;  4DTR A;  3AO2 A;  4K25 A;  3HSC A;  4LFC K;  3SPZ A;  2QWP A;  4NXN K;  2XHB A;  4OVL A;  4WYB A;  5AQL A;  3ZSQ A;  4Y0W A;  4CE9 A;  4FJJ A;  2QWL A;  4MO4 A;  1NKE A;  4YOU A;  4X62 K;  2XY5 A;  3ENO A;  1F21 A;  1JLF A;  3LP2 A;  2ZM6 K;  3UKR B;  2B6A A;  3ZX2 A;  3H08 A;  4DFK A;  3OS2 A;  2Q31 A;  2FLO A;  2W6L A;  5AFU H;  4N41 A;  4ZTJ A;  2P9P A;  1M1K O;  3ZET A;  1HKC A;  3L2Q A;  3S3M A;  3AVK A;  1YIT N;  4E19 A;  4R5P A;  1HNX K;  4O5F A;  1SQK A;  3AA2 A;  4FW2 A;  2D0A A;  2V52 B;  1Q8I A;  3OYL A;  2A1R A;  4HTU A;  4CEF A;  4BRG A;  3CQY A;  4CED A;  1HYV A;  3HZ6 A;  1TKT A;  1FKO A;  4KI4 A;  3P1G A;  2O8C A;  2HNZ A;  3AGR A;  2A40 A;  3CCL N;  2QWN A;  1EKE A;  3J7Z O;  4HCC A;  5JS2 A;  3LAK A;  3ITH A;  1J53 A;  3SUN A;  1NGH A;  2KQ2 A;  3QFU A;  4BC2 A;  2A1S A;  1QSS A;  4AHR A;  4F2S A;  2KZM A;  2OAN A;  3F9K A;  4RW4 A;  1TVR A;  3CIP A;  2BGG A;  4GV6 A;  2OPP A;  1BUP A;  1YVU A;  1T03 A;  1JXE A;  3KTQ A;  1EXQ A;  4B3R K;  3SJH A;  1X9W A;  2YI1 A;  4CIE A;  4ILH A;  3GE1 A;  4CJF A;  3O4W A;  3V4I A;  4DSK A;  3SQ1 A;  3ZSZ A;  4X66 K;  1TK0 A;  4KRE A;  4K8X A;  3C0B A;  1HLU A;  2QTD A;  3ZSV A;  1KC8 O;  4BRN A;  4UQG A;  1SL0 A;  2HMI A;  1BG3 A;  3FFI A;  2KZZ A;  3IS9 A;  4DWI A;  3WNH A;  4JD2 A;  2BAN A;  3AAP A;  5M1K A;  5FDL A;  3NGZ A;  4C1N I;  2A41 A;  5KQ8 A;  3KKS A;  4XIU A;  3C65 A;  5C2F A;  1WUA A;  4HUF A;  1N36 K;  2OZS A;  3D45 A;  3DOL A;  3HL8 A;  5KI6 A;  3TWH A;  1R59 O;  4E0D A;  5BRH A;  1T6C A;  4IWV A;  3CCU N;  1C0U A;  4MDA A;  4FM1 A;  4DV7 K;  3U6F A;  1N6Q A;  1IJJ A;  4JN4 A;  5C2D A;  1YUW A;  4KPY A;  3L3V A;  2UUA K;  3AAQ A;  4FLU A;  2HOE A;  3HVT A;  1D9F A;  1CXQ A;  2XY7 A;  2PYJ A;  3AY9 A;  4BAC A;  4DLE A;  4BRL A;  1NGA A;  5AZJ A;  3SAF A;  3QEI A;  3A5M C;  1R0A A;  4FLV A;  1WBB A;  3CJ9 A;  4CBU A;  2HF3 A;  3E1Y A;  5CHI A;  4RWT A;  3AA4 A;  1D5A A;  4DS5 A;  1TKX A;  4O5B A;  1KFS A;  2Q97 A;  5C0Y A;  4AF1 A;  3IRX A;  3AVG A;  3D7E O;  4AHU A;  3VEO A;  4LF7 K;  3GOI A;  2FBV A;  1Z26 A;  4B1Z A;  4YY3 K;  2HHX A;  4B9Q A;  3OY9 A;  2P9U A;  1TYQ A;  3DMJ A;  1X9S A;  3DLK A;  5T7B A;  2BUP A;  4DV3 K;  3DRS A;  4JNE A;  3OYJ A;  2OPR A;  1EX4 A;  1NG9 A;  4DV5 K;  3DXM A;  3WXK A;  2NRH A;  1BDG A;  1HX1 A;  1KAZ A;  3PX4 A;  4CFD A;  1VQP N;  3RR8 A;  3VQA A;  4DQR A;  1UWB A;  4Z4F A;  1RCH A;  4IOX A;  2IGI A;  1OH7 A;  3MWT A;  3BF3 A;  1JCG A;  2KLA A;  1BCO A;  5CZ2 A;  3LDL A;  4BRK A;  3SUP A;  4KFB A;  3TAP A;  2CGL A;  4CJU A;  3MN9 A;  4OKE A;  1ITG A;  3VEW A;  2HHV A;  2X6N A;  2X78 A;  5GAH P;  1GLB G;  2IIR A;  4GMJ B;  4DV4 K;  4Z4G A;  1K8K A;  1VSE A;  4QAG A;  4YOW A;  1RFQ A;  4DV1 K;  4YDU C;  4KHQ A;  4B9N A;  2BTF A;  2FXU A;  2QWR A;  4A5A A;  4YOX A;  3LDO A;  4FYD A;  4A2A A;  1GOC A;  1NGJ A;  5BN8 A;  3FZM A;  4IG0 A;  1EWQ A;  4PKG A;  4JKE A;  4CES A;  2F4V K;  2QK9 A;  2UXD K;  1NMD A;  1ILY A;  1SL1 A;  2NRX A;  2D0P A;  4JI3 K;  4DV2 K;  3KZB A;  2Q3S A;  3LDQ A;  2VGM A;  4C8O A;  1XNR K;  3UKR A;  3VQB A;  1E4G T;  3U9D A;  1VAZ A;  3THX B;  4KHU A;  3P38 A;  3OYB A;  3K9K A;  5AR0 A;  1X3M A;  4BC4 A;  1KLN A;  4B9L A;  3KK3 A;  2JLE A;  3WEE B;  1XI1 A;  1MU2 A;  3AVF A;  2O4I A;  1VQ9 N;  4DV6 K;  3QLH A;  3LZI A;  4CHN A;  1HQU A;  1QSY A;  3U4L A;  5DK5 A;  1WB9 A;  1D8Y A;  4C8N A;  2NRZ A;  3EKU A;  3VA0 A;  4B9M A;  2OZM A;  3LDP A;  5E41 A;  5KGX A;  3PX6 A;  5AFU A;  1RT2 A;  3T19 A;  4DFJ A;  2GX9 A;  1G15 A;  2UUB K;  3NFA A;  3ZSO A;  2ASM A;  1P90 A;  4Z94 A;  5AQF A;  3CPW M;  3MXJ A;  1NGB A;  3E9O A;  4GVE A;  1NGD A;  2YV0 X;  1YIJ N;  2UUC K;  4H0T B;  2P9N A;  3D2F A;  3LWM A;  3QER A;  4ILG B;  2F7T A;  2QKB A;  3MCP A;  4AM6 A;  4F8R A;  1B9F A;  1ASU A;  1IBM K;  4ZHR A;  3EKS A;  2NNW A;  4K8Z A;  1YJW N;  5DMR A;  3VQ4 A;  2ZF5 O;  4FWP A;  4FWQ A;  1VQ6 N;  3ZT2 A;  3H3O B;  5JIC A;  3PIP L;  2Q2R A;  1YJ9 N;  1VSM A;  2KFN A;  4ELT A;  2O8E B;  3QO9 A;  4FWM A;  1NK8 A;  3VA3 A;  3VQC A;  5TKY A;  2VYP A;  5JVG L;  4BRP A;  2YNI A;  3JAM O;  1VQ5 N;  3FFK B;  4I7F A;  4OX9 K;  1KRP A;  3SBG A;  1BWF O;  4DHY A;  3HK2 A;  2KTQ A;  2Q36 A;  4CEC A;  3QNO A;  2IS3 A;  1U48 A;  3V9Z A;  3HYF A;  4U67 L;  1WBD A;  3IAY A;  4FWN A;  4CJ7 A;  4B9U A;  3K2P A;  3C6H A;  1S3X A;  3FE1 A;  3WXL A;  1V4T A;  5LMN K;  4M3U A;  1KVB A;  1ASW A;  4B1W B;  4BR0 A;  4M42 A;  1TAQ A;  1QZ6 A;  1WSJ A;  1IG9 A;  1YAG A;  1C0M A;  5E84 A;  3VQP A;  4JK7 A;  1T6D A;  1VSF A;  2P9K A;  1JLE A;  2O8F A;  4PHT X;  4JV5 K;  3HPH A;  1KTQ A;  2JWK A;  4B1U B;  5C25 A;  4ELU A;  1O13 A;  4LH5 A;  3NMU A;  3MX5 A;  3RMD A;  3IFR A;  4HCB A;  3L0Q A;  4JKA A;  4H03 B;  1EP4 A;  1ZBH A;  5JLH A;  3ZYY X;  4JHD B;  1HNW K;  3TTC A;  3CCE N;  4DR7 K;  1I39 A;  4WFN L;  2HBM A;  4RW9 A;  4FOE A;  4CJL A;  2VWJ A;  3LZJ A;  1JL1 A;  4FOI A;  4A5B A;  4FJX A;  3C6A A;  1NGG A;  1WLJ A;  2VQF K;  4JI1 K;  4BVO A;  1KAY A;  1NGC A;  3UIQ A;  3N4P A;  1QQM A;  4Q0B A;  3B6O A;  2PYL A;  3R9P A;  4IO9 L;  4DU1 A;  3DOK A;  4FSV A;  3PO5 A;  1CZA N;  1VSH A;  4CK3 A;  3K5N A;  1NK7 A;  4MQ3 A;  5BRE A;  4FJL A;  4KAZ A;  3QEV A;  1U47 A;  2ITM A;  2HHU A;  5HBM A;  4PY5 A;  4Z4E A;  3L2V A;  5GAD P;  1HUX A;  1C0G A;  5AQZ A;  5AQP A;  4BR5 A;  4DTM A;  4FXD A;  1A5W A;  1BIS A;  5EY4 A;  3S3O A;  3O9U A;  2XRI A;  1WSH A;  1Q7Y O;  2ZQB A;  4CEQ A;  4AIL C;  3KK7 A;  4EZ6 A;  3TAE A;  3PV8 A;  1ZBL A;  3M8R A;  3VEY A;  3NAE A;  2WFB A;  4B9V A;  3AVL A;  4DTN A;  1KD1 O;  4X65 K;  1EO1 A;  4DQQ A;  1TK5 A;  3A0I X;  4NB4 A;  3CC4 N;  1TKD A;  1RBV A;  1O1W A;  2GEM A;  4PL7 A;  1ASV A;  1IH7 A;  5HRR A;  4IDK A;  1TKZ A;  3KLE A;  3PLA A;  2W6K A;  3ZT1 A;  5IWA K;  1TUY A;  2Y1I A;  3WEE A;  1ATN A;  1P8Z A;  2B4J A;  4E3S A;  3NDK A;  4BRM A;  1QQN A;  3T1Y K;  3QIC A;  2IVO A;  1L3U A;  2DFH A;  1NK5 A;  4CIF A;  4CF0 A;  1RIL A;  1GLJ O;  4QOZ B;  4JLH A;  1S72 N;  4BDZ A;  3CYM A;  4CVN E;  3OBY A;  3ZEU A;  2F9W A;  5EOY A;  4KRF A;  5IT9 O;  3RTV A;  3P4I A;  3WXJ A;  2A42 A;  5AZI B;  3NGI A;  3HBT A;  3SCX A;  4J2E A;  1V4S A;  2UYT A;  5BPM A;  2I7P A;  4I2Q A;  4PKH A;  4LH4 A;  3L6Q A;  2HBK A;  3FZH A;  3PSI A;  3LL3 A;  1MWK A;  2AA4 A;  3RRG A;  1YF5 L;  2AP1 A;  1BIZ A;  2OPQ A;  4DV0 K;  3ATU A;  5CYM A;  4JI2 K;  3OJS A;  3R8E A;  3CC2 N;  3V6D A;  4H0Y B;  2E6L A;  5AQI A;  4KB0 A;  4CZI A;  1HMV A;  4MDB A;  3DJC A;  5J1E A;  3HO1 A;  2IAJ A;  1BA0 A;  1WSI A;  3H3N O;  1SKR A;  1HR0 K;  3F73 A;  4ISE A;  3H46 O;  1RBT A;  5CZ1 A;  2P9I A;  3BF1 A;  1HKB A;  1BIU A;  2E88 A;  1EQY A;  1IBL K;  4IFE A;  1QVF M;  1RTJ A;  3LP1 A;  4RCH A;  4CJE A;  4EHT A;  3OYE A;  2ITG A;  4BE1 A;  1REV A;  3JXU A;  4EP4 A;  3AO3 A;  3U9Z A;  3G6E N;  3AA3 A;  1Q82 O;  4K0K K;  4FJG A;  2Z1G A;  3ZLJ A;  4H5R A;  4CK2 A;  3OYN A;  1IKW A;  3IMX A;  4CZJ A;  1K8A O;  1HJR A;  4KO0 A;  3OS0 A;  1SKS A;  4E7L A;  1A5V A;  2F96 A;  1L3T A;  1KFD A;  4DR5 K;  4BRC A;  3RSE B;  5KGW A;  4LFA K;  1N34 K;  3HPG A;  2OYQ A;  2RHK A;  3L2R A;  4WCE L;  4FJI A;  1KVA A;  3F2K A;  1NKC A;  2O4G A;  3M8P A;  1B9D A;  3I0S A;  5SZT A;  4OPK A;  1LAW A;  5TKW A;  4NYN A;  3THW B;  2NLX A;  4BE2 A;  2ZGZ A;  1NK6 A;  1GLF O;  2UXC K;  1YHQ N;  4JHD A;  3E9P A;  1K73 O;  1QSL A;  4B08 A;  5C24 A;  3P39 A;  3P5J A;  3T69 A;  5AJ3 K;  3TSU A;  3U3Y A;  4E1N A;  5FRM A;  2QA4 N;  4WE1 A;  5A2Q O;  2P9S B;  5AQY A;  3AVM A;  4M3W A;  2HVH A;  3THV A;  3CJ1 A;  1VSJ A;  4KKO A;  4OLB A;  4HTL A;  4B1V A;  5HL7 L;  4XH5 A;  2FSJ A;  2YHY A;  3EZ5 A;  4NO7 A;  3KLH A;  4F4K A;  3KD1 E;  2HHH K;  3K9J A;  4BVP A;  4YFU A;  3BP8 A;  4CHO A;  3EE9 A;  1QHT A;  3M8S A;  5I42 A;  1HNV A;  3SUO A;  4NCG A;  1QTM A;  3QNN A;  1UA1 A;  5C42 A;  5MLC Q;  4B1X B;  2YCH A;  1FW6 A;  3OVN A;  4JS5 A;  3C6T A;  4H0V B;  3TTF A;  3HRG A;  3MAQ A;  4M3Y A;  5FPE A;  4Z4C A;  5CE3 A;  1LWF A;  3MXI A;  3RMB A;  3ZT3 A;  2G8U A;  1Q81 O;  3CD6 N;  1RT1 A;  3ZCM A;  3OYA A;  3V81 A;  4JEP A;  1I94 K;  4JRQ A;  4JKG B;  2JGU A;  5J2M A;  1RTD A;  4GNI A;  4FJN A;  1WOQ A;  2FF6 A;  3VEN A;  4DG1 A;  4Z4H A;  3B6P A;  2V51 B;  3R3L A;  3CQ8 A;  3HOS A;  4BGA A;  1MWM A;  4BRE A;  2Z1J A;  3IKM A;  1FKP A;  3CC7 N;  3GBT A;  3CCJ N;  5KTQ A;  3O80 A;  1TAU A;  3DM2 A;  4CHP A;  4M3R A;  3CQX A;  4UY8 O;  4XH4 A;  3O3H A;  4IBN A;  5JMV A;  1S6Q A;  2A3Z A;  1YTU A;  4E7I A;  5AQT A;  2YJE A;  1GLE G;  1YVN A;  4MFB A;  3DI6 A;  4KH4 A;  4BWJ A;  3FZL A;  1VRT A;  3I0R A;  3L4I A;  5BR9 A;  2NRT A;  4KBO A;  1QQC A;  3H1V X;  2O8D A;  4IOA L;  2DFE A;  3NF7 A;  2VG6 A;  3C7N B;  1DLO A;  1S1X A;  1GOA A;  2I5J A;  3NH1 A;  2J4R A;  3G25 A;  1OKJ A;  2DFF A;  2E8A A;  1C1C A;  2A6A A;  4ISF A;  2XY8 A;  5M1F A;  3WXI A;  1NNE A;  5AQR A;  3VF4 A;  4CZF A;  2NRW A;  3ZX3 A;  3MN5 A;  4F3T A;  3CM6 A;  3RWU A;  5KPR A;  2V7Y A;  1ZBI A;  4NYF A;  1JLA A;  5I9E B;  3K58 A;  4M41 A;  4DKW A;  4EFH A;  4PA1 A;  1RTH A;  3V1R A;  3L2U A;  4PKI A;  4BGB A;  1HNI A;  4M45 A;  1JLC A;  1RTI A;  1W7A A;  2F9T A;  4F3O A;  1NJY A;  1W2B M;  4LSL A;  2FBT A;  2IVP A;  4XEI A;  4CGI A;  1NOZ A;  3H45 C;  2QEX N;  1DT9 A;  3DYA A;  4TSX A;  1HRH A;  4W5N A;  2HVI A;  3WQT A;  1G99 A;  4JS4 A;  3HST B;  1X1P A;  1WSF A;  3KWI A;  3CF5 L;  1RNH A;  3FZK A;  4KTQ A;  1GLL O;  1W9H A;  3NE6 A;  1H1V A;  3QML A;  3OW2 M;  2D1K A;  1UA0 A;  4WFA L;  1T8E A;  4BRQ A;  2D0O A;  2E4L A;  3NF8 A;  2YNH A;  1D9D A;  1IKV A;  1W97 L;  2KFZ A;  3TAM A;  2PFU A;  4L8R B;  2YHB A;  3LAN A;  1FJG K;  1BI4 B;  4CF9 A;  3SV3 A;  1W0H A;  2G8K A;  4FWR A;  1J5E K;  4CJV A;  4DF8 A;  2ZE2 A;  3V1Q A;  2KKZ A;  3NVK A;  2KW4 A;  4BRI A;  1RT6 A;  3Q7B A;  4ILJ A;  2P5G A;  3V9S A;  1DGK N;  4JK8 A;  2CH5 A;  1LWC A;  4ZTF A;  4CF2 A;  3QEX A;  4LFB K;  3TTD A;  4BE0 A;  3E66 A;  1JXB A;  1C0T A;  3MEE A;  3K59 A;  4BR4 A;  3OHR A;  4OPH A;  3QBX A;  4DQ8 A;  4AM7 A;  2BH1 A;  4IXC A;  3K5M A;  3TAN A;  1ZBS A;  2IOC A;  4DUY K;  4I9Q A;  4HUE A;  3CFP A;  5HRN A;  2RN2 A;  3S41 A;  4IKF A;  3D6R A;  1JLQ A;  4I2P A;  4MO5 A;  3BUZ B;  2JWL A;  2O8B B;  2W41 A;  4CBX A;  3KLI A;  5LY3 A;  3PSF A;  1BQM A;  1B92 A;  2E20 A;  3JS6 A;  3ALY A;  3F9M A;  3L3U A;  3BZC A;  1SZ2 A;  4HWI A;  4FJ5 A;  1TGO A;  3THW A;  1JCF A;  1NU0 A;  3CJA A;  2RE2 A;  3G71 N;  5M1P A;  4ICL A;  2HHW A;  1SV5 A;  4NLB A;  4W5O A;  4BR2 A;  4AHV A;  4CGJ A;  3N4Q A;  1WAJ A;  4RG8 A;  2HHS A;  2GUI A;  4B9T A;  1SS6 A;  2I7N A;  4IEE A;  4DFP A;  4KV8 A;  2P9S A;  2Q1N A;  2OTJ N;  4LF4 K;  4E7K A;  3MMV A;  5SWM A;  1J5O A;  1SL2 A;  4K41 A;  5AQX A;  3DRP A;  4JYA K;  1IKX A;  2CH6 A;  4BRF A;  3SYZ A;  2PZS A;  3LDN A;  4CZK A;  2ZJR L;  4FW1 A;  1NGI A;  2FSN A;  4FO0 A;  3CG7 A;  3VGL A;  5HRS A;  1SAZ A;  1CXU A;  3KLG A;  4LC9 B;  4CEO A;  3G10 A;  5AQH A;  4H4M A;  1LAV A;  1HNZ K;  2HF4 A;  3VQE A;  3L4Q A;  3T1H K;  2YHW A;  5BN9 A;  2FC0 A;  5EVZ A;  4DU3 A;  4FWS A;  3TAR A;  4JAX A;  2D4W A;  4B8C A;  5E26 A;  2EHG A;  3OYD A;  4M7Y A;  5J2N A;  3KK1 A;  2PAV A;  4JKG A;  3A2F A;  1RBU A;  3CME N;  4JI6 K;  3F5T A;  1XQS C;  5GIO A;  5J2P A;  4CJT A;  4EIA A;  3V9X A;  4KI6 A;  2VWK A;  3EN9 A;  4B9S A;  1NGE A;  3SUQ A;  3SAH A;  3PIO L;  1X9M A;  2RPI A;  3WQU A;  1U2V B;  5EU7 A;  1C0F A;  2FBY A;  2WON A;  3CFR A;  1RDW X;  1TUU A;  1KLM A;  3MED A;  3LPU A;  3VQD A;  5K14 A;  4CJW A;  1KQS M;  4K43 A;  1NBW A;  1UOC A;  4QS9 A;  3VOV A;  1S6P A;  1U45 A;  4FZX C;  4ISG A;  4DSJ A;  3C7N A;  4H5N A;  3NHG A;  4B3T K;  4K42 A;  4CHZ A;  1NJW A;  2Z1I A;  2VCP A;  4IJA A;  3DWL A;  3NGY A;  1YTA A;  3I8B A;  4CER A;  1NOY A;  1SUQ A;  3VQ8 A;  3VQ6 A;  4DQP A;  3LM9 A;  4G1Q A;  1NKB A;  2OA8 A;  1SKW A;  2QI2 A;  3JSM A;  2ZJQ L;  3LPT A;  1J54 A;  4FK4 A;  3U8X A;  5GIP A;  1MA9 B;  4A2B A;  2G8I A;  3I8D A;  3M3Z A;  1KCF A;  3FGU A;  4RTF D;  3KKR A;  4CJR A;  1LW0 A;  3AVC A;  2BE2 A;  3E9L A;  4RW8 A;  4A59 A;  4CF1 A;  4KH6 A;  3ID6 A;  3CFO A;  4GVM A;  4LY7 A;  1WAF A;  5AQU A;  4DTS A;  2YHA A;  4PUO A;  3KVG A;  3BGR A;  4OO1 J;  3LM2 A;  1E4F T;  4AHT A;  3A5O C;  1EET A;  3NVM A;  3O1B A;  2RKI A;  3KLF A;  1HYS A;  3VQ7 A;  5AQM A;  3EO3 A;  3LAM A;  3W3D A;  4IDH A;  2E5L K;  4KB1 A;  4WQ5 A;  4FJM A;  3HP9 A;  3QIP A;  4YOR A;  2F8S A;  4V19 S;  3HPO A;  3TAQ A;  4FJK A;  3NH2 A;  2G8W A;  5LJW A;  1ESV A;  5KPT A;  3SMP A;  4CFA A;  4X64 K;  1NJX A;  4H0O A;  4FK2 A;  2P5O A;  3I55 N;  1BI4 A;  4KTZ A;  3VES A;  5HP1 A;  1XMQ K;  4IG3 A;  4J2A A;  4FM2 A;  1BL3 A;  4JKF A;  3THX A;  1GOB A;  3NF6 A;  5KQD A;  1NJZ A;  5BRF A;  3MCA B;  4C8K A;  3M5R A;  3CI5 A;  1N32 K;  4GV9 A;  5FLX O;  4DTU A;  1IG8 A;  5D3G A;  1Y64 A;  4I9L A;  1YJN N;  5LL6 Z;  1N8R O;  3TR8 A;  1NMN A;  1QHA A;  3O5B A;  3VGK A;  4BRO A;  3ULD A;  1L5U A;  4O0I A;  2FSK A;  3SBT A;  5DM6 L;  2DY4 A;  3IDH A;  3V9W A;  3TPQ A;  1KSP A;  1VSL A;  4A61 A;  2P9U B;  4CZG A;  1EWR A;  4KHW A;  4H8K A;  4DQS A;  1Z05 A;  3KHY A;  5EX5 A;  4YOY A;  4Z4I A;  1OH6 A;  3V1O A;  2O8B A;  1LWE A;  4ELV A;  4AHS A;  5FRO A;  4DQI A;  3AVB A;  2QWM A;  3CET A;  2HB5 A;  3AVN A;  3VPZ A;  5BPL A;  3CPE A;  4CZH A;  4WQ5 C;  3ENB A;  3OTO K;  3O3G A;  1BO5 O;  3ZSY A;  5JLF A;  4E7J A;  4DTO A;  4YOT A;  3MN7 A;  2VGN A;  2O8E A;  2HNY A;  1J9A A;  5KPZ A;  1ZBU A;  2H3G X;  3SNN A;  3VER A;  3BDP A;  1GLA G;  2GWK A;  1LW2 A;  3KJV A;  3DAW A;  1K8K B;  3O3F A;  2D0B A;  4RW7 A;  3HP6 A;  1K9M O;  2UU9 K;  4PWD A;  3HTV A;  1S5J A;  4FZZ A;  1NM1 A;  4R79 A;  2YX6 A;  2PY5 A;  4KHS A;  4DR2 K; 
#chains in the Genus database with same CATH homology
 4FLW A;  4CHP A;  4BDP A;  4M3R A;  3NF9 A;  3MXJ A;  3RMA A;  3O3H A;  4IBN A;  1S6Q A;  2YV0 X;  3AO4 A;  2D0C A;  3K5O A;  1NK9 A;  1YTU A;  2VG7 A;  4CF8 A;  4DLG A;  3DLB A;  2NUB A;  3LWM A;  3VQ9 A;  4E7I A;  3QER A;  2QKB A;  2HHT A;  1RBS A;  4CFB A;  4MFB A;  5HRP A;  3TAB A;  3DI6 A;  1B9F A;  3K5L A;  2RF2 A;  3ZSX A;  4F8R A;  4BWJ A;  3P83 D;  1ASU A;  1VRT A;  1XWL A;  3I0R A;  3S3N A;  4DMN A;  4ZHR A;  3D0P A;  5JS1 A;  4CGH A;  1QQC A;  2GBZ A;  1L3S A;  4K8Z A;  1FXX A;  2D5R A;  1CZB A;  2DFE A;  4KTW A;  3NF7 A;  5DMR A;  2VG6 A;  3VQ4 A;  4Q5V A;  1DLO A;  3ZT2 A;  3ZT4 A;  1S1X A;  1GOA A;  2I5J A;  1TL3 A;  3NH1 A;  3WNE A;  3OYK A;  3L8B A;  2HHQ A;  2VG5 A;  4GW6 A;  4OGE A;  2DFF A;  1XHZ A;  1C1C A;  4M3T A;  4DTP A;  1VSM A;  2XY8 A;  1RDA A;  2KFN A;  1XHX A;  4H4O A;  3QIN A;  3ZSW A;  2W42 A;  4CCH A;  4ELT A;  3QO9 A;  4RW6 A;  1NK8 A;  3VA3 A;  4PQU A;  3MEC A;  2XY6 A;  3SQ0 A;  4F3T A;  1RT5 A;  3AO5 A;  3CM6 A;  3VQC A;  3JYT A;  3SV4 A;  4FZY A;  3RWU A;  2YNI A;  3C6U A;  4I7F A;  1ZBI A;  1L3V A;  4NYF A;  1CLQ A;  2G8F A;  1KRP A;  3OYG A;  1C1B A;  1JLA A;  1ZBF A;  3O4Q A;  4KHN A;  3K58 A;  1NK0 A;  2X6S A;  3HK2 A;  4M41 A;  3AVA A;  4CJ3 A;  4FLT A;  2KTQ A;  4PA1 A;  4CEC A;  2IS3 A;  4CHY A;  1RDB A;  3DLR A;  4HHT A;  4FLX A;  1RTH A;  2B5J A;  3V9Z A;  1U48 A;  1S9E A;  4DSI A;  3HYF A;  3V1R A;  2YNF A;  3L2U A;  4W5R A;  1ZYQ A;  3IAY A;  3LAL A;  1HNI A;  4M45 A;  1JLC A;  4B9U A;  1RTI A;  4ID1 A;  4J2D A;  4EP5 A;  3RR7 A;  1RT7 A;  4J2B A;  4AH9 A;  4Y1D A;  4F3O A;  3K2P A;  2Y1J A;  1NJY A;  1BGX T;  4LSL A;  2FBT A;  4DTJ A;  4CGI A;  1NOZ A;  5KRS A;  1DTT A;  4BWM A;  4B8A B;  1YT3 A;  3DYA A;  4TSX A;  1RT4 A;  1HRH A;  3AO1 A;  5FRN A;  1BHL A;  4W5N A;  2HVI A;  4M3U A;  3V9U A;  4JS4 A;  3HST B;  1KVB A;  1X1P A;  1KVC A;  1WSF A;  3SQ2 A;  1ASW A;  3OYH A;  3HXM A;  1VRU A;  1RNH A;  3KIO A;  4KTQ A;  1W9H A;  3OS1 A;  4M42 A;  3NE6 A;  1TAQ A;  1TV6 A;  4Z0U A;  4CJ5 A;  1WSJ A;  3HVR A;  4IFY A;  4CGG A;  4O44 A;  1IG9 A;  1C0M A;  1UA0 A;  3VQP A;  2GV9 A;  1T8E A;  3LWL A;  3NF8 A;  2E4L A;  1RBR A;  4C8L A;  2YNH A;  1VSF A;  3K57 A;  1D9D A;  2P51 A;  1IKV A;  3SPY A;  2WOM A;  4FJ8 A;  4OLA A;  1JLE A;  3E01 A;  2KFZ A;  3TAM A;  3SQ4 A;  4Y1C A;  4L8R B;  3HPH A;  2YHB A;  1KTQ A;  4M3Z A;  4CJP A;  3T3F A;  1QE1 A;  3LAN A;  1Z25 A;  1HPZ A;  1BI4 B;  4CF9 A;  5C25 A;  4YNQ A;  4HUG A;  1JLB A;  3VQQ A;  3SV3 A;  1W0H A;  2YNG A;  2G8K A;  1WSE A;  4ELU A;  4LH5 A;  4LSN A;  4CJV A;  2QXF A;  3ZSR A;  3RMD A;  4HCB A;  5I3U A;  3LP0 A;  2Z1H A;  4DF8 A;  3AVJ A;  3ISN C;  3IG1 A;  1HQE A;  1UAX A;  2ZE2 A;  3V1Q A;  4LD0 A;  2KW4 A;  2R7Y A;  3TAG A;  3DLE A;  1RT6 A;  1NK4 A;  3PY8 A;  2AJQ A;  3PUF A;  2P5G A;  3KD5 E;  1WNS A;  3SZ2 A;  3RRH A;  4OGC A;  1EP4 A;  3V9S A;  5HRO A;  1T05 A;  4N76 A;  4FLY A;  1ZBH A;  1LWC A;  4ZTF A;  4CF2 A;  4OKJ A;  4DU4 A;  1FK9 A;  3QIO A;  4O4G A;  4M3X A;  1I39 A;  4OJR A;  3QEX A;  4RW9 A;  4BE0 A;  1JXB A;  3WNG A;  1C0T A;  3MEE A;  3K59 A;  4CJL A;  3NCI A;  1XC9 A;  2VWJ A;  3LDS A;  3LZJ A;  4W5Q A;  3RMC A;  1JL1 A;  2EX3 A;  3K5M A;  3TAN A;  2G8V A;  4FJX A;  3VQ5 A;  4NCA A;  2IOC A;  4N47 A;  2ETJ A;  1JL2 A;  1WLJ A;  4HUE A;  4I9Q A;  3CFP A;  1RT3 A;  5HRN A;  2E6M A;  1LV5 A;  2RN2 A;  4DTR A;  3AO2 A;  3QEP A;  4IKF A;  1JLQ A;  3UIQ A;  2LSN A;  3SPZ A;  4I2P A;  4Q0B A;  3B6O A;  2FBX A;  2PYL A;  2XHB A;  4OVL A;  4FCY A;  4DU1 A;  3ZSQ A;  3EY1 A;  3DOK A;  3SJJ A;  4CE9 A;  5J2Q A;  3PO5 A;  4FJJ A;  1BCM A;  1VSH A;  4CK3 A;  3K5N A;  1IO2 A;  1NK7 A;  3KLI A;  1NKE A;  4MQ3 A;  1BQM A;  4CGF A;  1B92 A;  2XY5 A;  4IFV A;  3ALY A;  3L3U A;  1Q9X A;  1F21 A;  1JLF A;  3LP2 A;  4FJ5 A;  1TGO A;  4FJL A;  4KAZ A;  2B6A A;  3H08 A;  3QEV A;  4DFK A;  1U47 A;  3OS2 A;  4ICL A;  1K6Y A;  2HHU A;  5HBM A;  4PY5 A;  1SV5 A;  1TK8 A;  4W5O A;  2G8H A;  4Z4E A;  2HHW A;  4AHV A;  4CGJ A;  3L2W A;  3TAF A;  3L2V A;  3TI0 A;  4B3O A;  1WAJ A;  4N41 A;  4ZTJ A;  4RG8 A;  4DTM A;  2HHS A;  2GUI A;  4B9T A;  3HT3 A;  3L2Q A;  4FXD A;  4DFP A;  4KV8 A;  3S3M A;  1A5W A;  1VK0 A;  3HJF A;  1BIS A;  4E7K A;  3AVK A;  3S3O A;  3OJU A;  2XRI A;  4E19 A;  4R5P A;  3S9H A;  5SWM A;  1J5O A;  1SL2 A;  3AA2 A;  3T1A A;  1WSH A;  2OPS A;  2D0A A;  2ZQB A;  1Q8I A;  3DRP A;  4FW2 A;  1IKX A;  1U04 A;  4CEQ A;  3OYL A;  4HTU A;  4AIL C;  1DTQ A;  3TAE A;  4CEF A;  3PV8 A;  2A1R A;  3SYZ A;  1ZBL A;  4EZ6 A;  4CED A;  3M8R A;  4DSL A;  4JRP A;  1HYV A;  4CIG A;  1TKT A;  1FKO A;  2PZS A;  4FW1 A;  3NAE A;  3P1G A;  4KI4 A;  3CG7 A;  4B9V A;  4CJS A;  2HNZ A;  5HRS A;  3AVL A;  3U3G A;  1CXU A;  3KLG A;  4DTN A;  4CEO A;  3G10 A;  1EKE A;  4HCC A;  4FJH A;  4H4M A;  5JS2 A;  4DQQ A;  3LAK A;  1LAV A;  3ITH A;  1TK5 A;  1J53 A;  1T7P A;  3AA5 X;  3SUN A;  3AV9 A;  4CHQ A;  2KQ2 A;  3VQE A;  1A5X A;  1TKD A;  4CEZ A;  2A1S A;  1RBV A;  1O1W A;  1VSK A;  1QSS A;  4AHR A;  1I3A A;  1JLG A;  4F2S A;  2FC0 A;  2KZM A;  1ASV A;  1IH7 A;  4DU3 A;  3F9K A;  4IDK A;  1TKZ A;  5HRR A;  4CEA A;  4RW4 A;  1TVR A;  3KLE A;  3TAR A;  2BGG A;  4B8C A;  3ZT1 A;  3CM5 A;  4O0J A;  2Y1I A;  3OYM A;  2X74 A;  2EHG A;  2OPP A;  1WN7 A;  1YVU A;  3OYD A;  2B4J A;  4E3S A;  1JXE A;  1T03 A;  4HVJ A;  3NDK A;  3KTQ A;  5J2N A;  1EXQ A;  3AVH A;  3KK1 A;  1X9W A;  3PO4 A;  2IDO A;  4CIE A;  1S9G A;  3A2F A;  4CJF A;  3V4I A;  1L3U A;  2DFH A;  1RBU A;  4CK1 A;  1NK5 A;  3SQ1 A;  4DSK A;  4CIF A;  4O55 A;  3ZSZ A;  4CF0 A;  1TK0 A;  1BQN A;  4KRE A;  1RIL A;  5J2P A;  4QOZ B;  4JLH A;  4K8X A;  4BDZ A;  3CYM A;  4CJT A;  4W5T A;  3V9X A;  4KI6 A;  2VWK A;  3ZSV A;  4CJQ A;  4B9S A;  5KRT A;  3G0Z A;  4UQG A;  1SL0 A;  2IC3 A;  2HMI A;  4FLZ A;  3SUQ A;  2YKM A;  3C94 A;  3PX0 A;  3FFI A;  1X9M A;  2RPI A;  2KZZ A;  1Q9Y A;  3IS9 A;  4DWI A;  2DTU A;  4KRF A;  5EU7 A;  3WNH A;  3RTV A;  2BAN A;  2FBY A;  2WON A;  5FDL A;  3NGZ A;  3NGI A;  3CFR A;  3SCX A;  4J2E A;  1KLM A;  3MED A;  3KKS A;  3LPU A;  3VQD A;  5K14 A;  4DSF A;  1S1V A;  4I2Q A;  4CJW A;  1C6V A;  4XIU A;  4FJ7 A;  2HND A;  4DTX A;  1UOC A;  4HUF A;  2OZS A;  3D45 A;  1WSG A;  1S1W A;  1S6P A;  4LH4 A;  4CFC A;  3DOL A;  3HL8 A;  1S1T A;  5KI6 A;  1U45 A;  3C95 A;  4FZX C;  4DSJ A;  3TWH A;  4CJ4 A;  3NHG A;  4E0D A;  3VN5 A;  4CHZ A;  1NJW A;  2Z1I A;  3RRG A;  4KHY A;  3WNF A;  1C0U A;  4FM1 A;  1BIZ A;  2OPQ A;  1S1U A;  1YTA A;  3NGY A;  4CER A;  4CGD A;  5CYM A;  3U6F A;  3OJS A;  1N6Q A;  1SUQ A;  3VQ8 A;  3VQ6 A;  4DSE A;  1NOY A;  4G1Q A;  1NKB A;  2OA8 A;  4DQP A;  1SKW A;  3V6D A;  2E6L A;  4KB0 A;  3DLH A;  1HMV A;  2P1J A;  3JSM A;  3MEG A;  5J1E A;  3LPT A;  4KPY A;  1J54 A;  4FK4 A;  3L3V A;  4FLU A;  3HO1 A;  2IAJ A;  1RDD A;  1IKY A;  2G8I A;  1WSI A;  3HVT A;  1SKR A;  1D9F A;  1CXQ A;  3F73 A;  3I8D A;  2XY7 A;  2PYJ A;  2F8T A;  4E89 A;  1RBT A;  1KCF A;  4E1M A;  1N5Y A;  3KKR A;  4BAC A;  4DLE A;  4CJR A;  3AVC A;  1LW0 A;  5CZ1 A;  1RDC A;  2BE2 A;  3QEI A;  4FJ9 A;  3ZT0 A;  2XO7 A;  1R0A A;  4FLV A;  4RW8 A;  1BIU A;  4CF1 A;  4FVM A;  4GVM A;  3CFO A;  4LY7 A;  1WAF A;  3M8Q A;  1Y97 A;  1RTJ A;  4DTS A;  3LP1 A;  4CJE A;  3OYC A;  4BE1 A;  3OYE A;  2ITG A;  2YKN A;  3AA4 A;  2YHA A;  1D5A A;  4DS5 A;  1REV A;  1TKX A;  4PUO A;  1TL1 A;  4O5B A;  4EP4 A;  1JKH A;  3BGR A;  3DLG A;  1KFS A;  3AO3 A;  4AHT A;  3AA3 A;  3IRX A;  3OYI A;  1EET A;  3AVG A;  4FJG A;  4AHU A;  2Z1G A;  1CZ9 A;  2RKI A;  5CY4 A;  4CK2 A;  3KLF A;  2FBV A;  1Z26 A;  3VQ7 A;  3OYN A;  1IKW A;  4DFM A;  1HJR A;  4KO0 A;  3LAM A;  3OS0 A;  3EYZ A;  4CJK A;  1SKS A;  2HHX A;  4KB1 A;  4E7L A;  4FJM A;  4FK0 A;  1A5V A;  2F96 A;  3HP9 A;  3QIP A;  3OY9 A;  2F8S A;  1HYS A;  1U49 A;  3HPO A;  5CYQ A;  3DMJ A;  1X9S A;  3DLK A;  5T7B A;  1L3T A;  4CEE A;  1KFD A;  3DRS A;  3OYJ A;  2OPR A;  1EX4 A;  3TAQ A;  2ATQ A;  4FJK A;  3QNO A;  3NH2 A;  2G8W A;  1QS4 A;  5KGW A;  3O4N A;  3HPG A;  3LP3 A;  4CFA A;  4CFD A;  3PX4 A;  1NJX A;  2OYQ A;  3L2R A;  4FK2 A;  2P5O A;  4FJI A;  1KVA A;  1BI4 A;  4KTZ A;  3RR8 A;  5HP1 A;  1NKC A;  4IG3 A;  3VQA A;  4DQR A;  4J2A A;  2O4G A;  1UWB A;  4FM2 A;  3M8P A;  4Z4F A;  1BL3 A;  1B9D A;  1RCH A;  3I0S A;  2IGI A;  5SZT A;  1VSI A;  1LAW A;  4OPK A;  3NBP A;  1GOB A;  3NF6 A;  1NJZ A;  1BCO A;  1VSD A;  5CZ2 A;  4F2R A;  4NYN A;  3QEW A;  4C8K A;  3ASM A;  4BE2 A;  1NK6 A;  3SUP A;  4KFB A;  4C8M A;  4DTU A;  3TAP A;  4CJU A;  5D3G A;  4CEB A;  1QSL A;  4OKE A;  1ITG A;  4I9L A;  4DS4 A;  4B08 A;  3MXM A;  5C24 A;  2HHV A;  3P5J A;  4NCB A;  2X6N A;  3U3Y A;  2X78 A;  3TR8 A;  4E1N A;  4GMJ B;  5FRM A;  4Z4G A;  1VSE A;  4QAG A;  4WE1 A;  4QCL A;  1U4B A;  3AVM A;  3ULD A;  1L5U A;  4O0I A;  3OYF A;  4M3W A;  2HVH A;  3THV A;  4KHQ A;  1VSJ A;  4KKO A;  4B9N A;  4OLB A;  2DY4 A;  2BDP A;  3V9W A;  3QET A;  2HW3 A;  1KSP A;  4FYD A;  1VSL A;  3HM9 A;  1GOC A;  3EZ5 A;  4KHW A;  4H8K A;  4DF4 A;  4DQS A;  3V81 A;  4IG0 A;  3KLH A;  4F4K A;  2QKK A;  3KD1 E;  4Z4I A;  3V1O A;  4N5S A;  3SI6 A;  1LWE A;  4ELV A;  4YFU A;  4CES A;  2QK9 A;  4CHO A;  4AHS A;  1SL1 A;  1QHT A;  5FRO A;  3M8S A;  1HNV A;  3DRR A;  3KK2 A;  3SUO A;  5I42 A;  4DQI A;  4NCG A;  2Q3S A;  3AVB A;  3QES A;  1QTM A;  4C8O A;  3QNN A;  1UA1 A;  3VQB A;  2HB5 A;  5C42 A;  3AVI A;  1C1A A;  3AVN A;  4KHU A;  3OVN A;  3OYB A;  4JS5 A;  2ZD1 A;  3C6T A;  3NH0 A;  3O3G A;  4N56 A;  4BDY A;  3ZSY A;  4DTO A;  4E7J A;  1KLN A;  3MAQ A;  3KK3 A;  4B9L A;  4M3Y A;  2JLE A;  4AHC A;  4Z4C A;  3MXI A;  1LWF A;  1XI1 A;  1MU2 A;  3AVF A;  2HNY A;  2O4I A;  3RMB A;  3ZT3 A;  2G8U A;  3QLH A;  1RT1 A;  1J9A A;  3ZCM A;  4OPJ A;  3OYA A;  4CHN A;  3LZI A;  1HQU A;  1ZBU A;  4JRQ A;  3SNN A;  1QSY A;  3BDP A;  2JGU A;  5J2M A;  3DM2 A;  5DK5 A;  1RTD A;  4FJN A;  1LW2 A;  3KJV A;  1D8Y A;  4C8N A;  4DG1 A;  4Z4H A;  3VA0 A;  3B6P A;  3O3F A;  4B9M A;  3CQ8 A;  2OZM A;  4EZ9 A;  2D0B A;  4RW7 A;  5KGX A;  5E41 A;  3HP6 A;  3PX6 A;  4PWD A;  1S5J A;  1RT2 A;  4ID5 A;  3T19 A;  4DFJ A;  2Z1J A;  5HLF A;  4FZZ A;  1FKP A;  1G15 A;  2PY5 A;  3NFA A;  4E7H A;  4FM0 A;  4KHS A;  3ZSO A;  4OKK A;  5KTQ A;  1TAU A;  1HYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...