4CF8A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf8A00
1R0AA 3PX4A 1HNIA 1LW2A 3OVNA 3NF7A 4BWMA 4I2PA 1EX4A 4KFBA 2I5JA 4Q0BA 3QO9A 4CJ3A 1L5UA 2O4GA 3PX0A 3SUQA 2VG7A 3KLIA 5CYMA 2HHSA 3PO5A 4DFPA 1U04A 4B3OA 3RRGA 2YV0X 4J2DA 1JXBA 2HVHA 1FKOA 4O4GA 5D3GA 3KTQA 3AVGA 3LP2A 1L3VA 3NF6A 1D5AA 3AO3A 4M3UA 4FLWA 4CHOA 1KTQA 4CIGA 4CF2A 2B5JA 1L3TA 4CGJA 1JKHA 4L8RB 3G0ZA 4HUEA 4KHNA 4FZZA 4FW2A 3MXJA 3TAQA 4CJQA 4N41A 4CEQA 2D0BA 1LAVA 1Y97A 2ETJA 2IOCA 4ICLA 5SWMA 1S1XA 5SZTA 3OYNA 3K5LA 1J5OA 4FJLA 1RDDA 1WSIA 3EYZA 1K6YA 3ZCMA 1RTJA 4KHQA 3K5NA 2LSNA 1C6VA 4PUOA 3LP0A 1RT6A 2DFFA 3AVBA 3C95A 3RWUA 2IGIA 4M3ZA 3DLRA 4CJPA 1BQMA 1RT2A 4KAZA 2HNDA 2IAJA 4R5PA 3AO5A 1XHZA 4AHRA 4BACA 4M3WA 4IFVA 1VRTA 4FCYA 2YKNA 1TKZA 3QIOA 4E1NA 4CCHA 1KLMA 1QS4A 4I9LA 2KQ2A 1WLJA 3QIPA 3O3GA 4B9TA 1U49A 3CFRA 3OY9A 4BE2A 1S1VA 4KHYA 3DLBA 3VQAA 4Z4IA 4OKJA 4FJ7A 3S3OA 4M3YA 3L3VA 3AVMA 4LSLA 1DTQA 4DU3A 5HBMA 2XY6A 3WNGA 3OS2A 2Y1IA 2VWKA 1D8YA 1GOBA 5CZ2A 4CFBA 2ITGA 5HRSA 2QKKA 4DSIA 4FJXA 3F9KA 4CF1A 4CFCA 2G8WA 3M8SA 3C6TA 4KB1A 1HNVA 2R7YA 3QESA 5KGWA 4H4OA 4CFDA 1ZBLA 1QSSA 5JS1A 4FK0A 2IDOA 4E7KA 1RTHA 3U3YA 4DSKA 3ZT2A 1BIUA 3NH2A 1VSDA 4HUGA 4DTNA 2HNZA 3AVAA 4Y1DA 3TAMA 1IKVA 4IG0A 3ZSOA 5HRPA 3HVTA 4H8KA 4CHZA 2BE2A 4FJ5A 3HJFA 5KTQA 3L2WA 3RTVA 1F21A 3OYIA 4DFJA 4OJRA 3MXIA 1Z25A 4HTUA 2ZE2A 1JLAA 3V1RA 3VQ9A 4Z4EA 2Z1GA 1TKXA 1RILA 4CGIA 4CK3A 1LWCA 4DSEA 3K2PA 2X6NA 1KFSA 3WNEA 5DK5A 4BDYA 4DTSA 3P83D 4RG8A 4YFUA 4KTWA 3LDSA 3QEPA 4KI6A 4FW1A 3ZSRA 2HHWA 1RCHA 1BISA 4YNQA 3QEWA 3DLHA 4CHNA 1BI4B 3AVCA 1X1PA 3AA2A 3AO2A 3ASMA 4C8LA 4ZHRA 5HROA 4M41A 1JLQA 1Q8IA 3QEVA 1ZBHA 3FFIA 2HHUA 2W42A 3HPGA 2RF2A 4BWJA 4RW7A 1S1WA 4N47A 1X9WA 1CLQA 2YHBA 1RT7A 3OYJA 3SUOA 4FJGA 5FRMA 1RT1A 2P51A 1QHTA 2WONA 2O4IA 2DTUA 3OYBA 3AO4A 1NKEA 2KFZA 4OVLA 1NOYA 4WE1A 4J2BA 1XC9A 4FM2A 4DF8A 3AV9A 3PY8A 2G8VA 2DFEA 2Z1HA 4CJ5A 2XY5A 4FJKA 3HK2A 3SV3A 4LY7A 3AVHA 2G8IA 4DG1A 1WN7A 4FLYA 3SPZA 3ZSYA 4DU4A 2Q3SA 3OYEA 4OKEA 3ULDA 1NJYA 1BI4A 3H08A 5I3UA 1BCOA 4FJ9A 3S3MA 1C0MA 1NJXA 2HW3A 2QK9A 4CJFA 3NHGA 3SCXA 3ZSZA 1KVAA 2F96A 5C24A 4DTPA 4OPJA 4TSXA 3VN5A 5KRSA 5KRTA 3CM5A 3TANA 1FXXA 1KVBA 1VSKA 3QLHA 4FZXC 4Z4CA 3ZSVA 4F4KA 3U6FA 3ZT0A 2PY5A 3I0RA 5EU7A 3LANA 4B9VA 1SKRA 4Z0UA 3G10A 3AVJA 1J53A 3LPTA 3LPUA 3RMDA 3TAPA 1S5JA 1TK5A 2HHQA 1JLEA 3DI6A 3DRRA 2A1SA 3KJVA 4NYNA 4W5OA 3CQ8A 2G8UA 4J2AA 1EKEA 3AVNA 1IH7A 3K5MA 2Z1JA 3NAEA 3VQ4A 3D45A 3JSMA 4DSFA 3QEIA 3TI0A 2WOMA 1IKWA 2QKBA 2B4JA 4M3RA 4M42A 1MU2A 3KD1E 2D0AA 4DMNA 4HVJA 3HXMA 1X9MA 3A2FA 2KFNA 3DLEA 4B9NA 4N76A 4FJIA 2GBZA 3IS9A 4CEAA 3SZ2A 3F73A 1TVRA 3NCIA 1TKTA 1HYZA 4CK2A 4EP4A 1G15A 3UIQA 3LZIA 3RMCA 3SUPA 1TK0A 1LW0A 5CZ1A 1Q9YA 4F3OA 2X6SA 4KKOA 3OYCA 3DRPA 4FLUA 4KHSA 4PY5A 4HHTA 2XY7A 3ZSWA 1JXEA 1REVA 2Z1IA 2X78A 3V1QA 1S6QA 5C25A 1IKYA 1T8EA 1L3UA 4DSJA 5KI6A 4QAGA 3I0SA 1SL1A 3AO1A 1X9SA 4DTRA 1CXQA 3VQQA 4E19A 3HT3A 1UAXA 3PX6A 3TAEA 2B6AA 1HYSA 4KHUA 3OYFA 4DF4A 4I7FA 1WSHA 3M8QA 3PO4A 3S3NA 3K58A 4CGHA 4RW6A 4CJTA 1WNSA 2OPPA 5J2PA 4N5SA 1SUQA 3D0PA 3THVA 1JL1A 1TK8A 3KK1A 2YKMA 4CF0A 3V9ZA 1GOAA 2HNYA 1NKBA 5DMRA 4FLTA 3EY1A 2HHXA 1S1TA 1TAUA 3KKSA 4C8OA 3M8PA 1IKXA 5C42A 4CJRA 1RTDA 3ITHA 4GMJB 5HLFA 4FJNA 3HPHA 1NK5A 1RNHA 4DTMA 2RPIA 4M45A 3B6PA 5J2QA 1VSHA 4K8ZA 1B9DA 3V9WA 4DLEA 4CEFA 3V1OA 4LH5A 4CJWA 1VSLA 3OYDA 3KLFA 4CIEA 3L2VA 4OGCA 3OS1A 1KRPA 4OLBA 4QCLA 3HSTB 3OYGA 1XHXA 4RW9A 1TGOA 3QNOA 1I3AA 4ZTJA 1RT3A 3VA3A 4B9SA 4I9QA 1Z26A 4XIUA 2KTQA 4C8NA 2JGUA 3OS0A 3CFOA 2HVIA 2BANA 2PZSA 1BGXT 4FM1A 3SI6A 1NK8A 1U47A 1C0TA 3QEXA 1WSGA 3NF9A 3I8DA 3K59A 2F8SA 2XO7A 3L2QA 4LD0A 3LAMA 1VK0A 4ZTFA 1JLFA 4DTUA 3LWMA 4F3TA 1HRHA 2ZQBA 3VA0A 3T1AA 1HPZA 1T7PA 4FXDA 1J9AA 1LWEA 1BL3A 4AHTA 1NK4A 2FBTA 3SUNA 3KK2A 3U3GA 3ZT1A 4CERA 2P5GA 1S9GA 1VRUA 4CE9A 4BDZA 4H4MA 4B9MA 4DQIA 1XWLA 2OPQA 1QE1A 3HPOA 1JL2A 1S1UA 1TAQA 2NUBA 4HCCA 3IRXA 4KV8A 5HRNA 1BCMA 1C0UA 3O4NA 1SL0A 3OYHA 4NCGA 4O0JA 4OLAA 1TV6A 1DLOA 1CZBA 2D5RA 1A5XA 2E6LA 4CEDA 1QSLA 3CM6A 2IC3A 4PA1A 1RBUA 3SPYA 1NK0A 1VSFA 1ZYQA 4KB0A 1RDAA 1Q9XA 1KCFA 3KLHA 4CJKA 3AVFA 4QOZB 1B9FA 3KKRA 3O4QA 3AVKA 4NYFA 1T05A 5HRRA 3IG1A 3L2UA 1UA0A 3V6DA 4PWDA 4FK4A 1SKSA 2DY4A 4CESA 4GVMA 3TWHA 1ASUA 3VQEA 1ZBIA 4O0IA 3OYLA 2RKIA 4M3XA 4HUFA 1RDBA 2EX3A 4LSNA 3RR8A 1EXQA 4G1QA 2HB5A 4KTQA 4M3TA 3NBPA 1NKCA 4Z4FA 1VSIA 5K14A 5E41A 1QTMA 1SL2A 2QXFA 4MQ3A 4CGFA 1NJZA 3O3HA 3TAGA 4KHWA 4CF8A 3RMAA 1KSPA 3IAYA 1RBSA 4CJSA 2F8TA 4FLZA 4FJJA 1VSJA 2VG5A 1FK9A 2E6MA 4I2QA 3O3FA 2HHTA 2G8HA 4CEOA 4W5RA 3KLGA 3OYMA 5JS2A 4FJMA 4E7IA 2XY8A 3PV8A 4KRFA 1YVUA 3AVLA 3NFAA 1N5YA 3TARA 1T03A 3DOKA 2PYJA 3RR7A 1NK6A 3HL8A 3MEGA 1KVCA 4CJ4A 1JLBA 3JYTA 3DYAA 4C8MA 3QINA 2X74A 3M8RA 3T3FA 4CECA 1U4BA 1KLNA 4LH4A 4CJEA 4GW6A 4HCBA 1UOCA 4DQSA 2D0CA 1JLGA 3VQPA 5J1EA 3ISNC 4AHSA 4BE1A 2EHGA 4B8AB 1RBRA 1BIZA 1LAWA 3L3UA 3P5JA 4W5TA 3EZ5A 4B08A 3V81A 3HM9A 3HYFA 3AA4A 3KIOA 4B9UA 4CJVA 4F2SA 4IDKA 3SYZA 4BDPA 1IG9A 2OYQA 2JLEA 3VQ5A 4DWIA 2XRIA 4KO0A 1VSMA 2OPSA 1HMVA 4OPKA 3NGZA 3SV4A 3SQ2A 3NGYA 4Z4HA 4DQRA 4FLVA 4DTXA 4E7JA 3TAFA 4DQQA 4C8KA 4FK2A 3MAQA 1S9EA 1WAFA 3TR8A 3QETA 2KW4A 4ELTA 4IFYA 4IG3A 1ASVA 4IBNA 3VQ8A 4E1MA 3LP1A 4CGGA 1DTTA 4NCBA 1RTIA 3TABA 4DSLA 1HYVA 4NCAA 2HHVA 1CZ9A 4OGEA 3KD5E 1CXUA 5FDLA 2G8KA 4O44A 5CY4A 3VQCA 3T19A 2PYLA 2Y1JA 3V4IA 3MXMA 3OJUA 3NE6A 1BHLA 4CIFA 1YTAA 5CYQA 3NH1A 4ID5A 2IS3A 1NOZA 4RW8A 2VWJA 1YTUA 3K5OA 1HQUA 3KLEA 1HQEA 3P1GA 2P1JA 3HP6A 1J54A 2FC0A 4JRPA 2FBXA 1N6QA 2OZSA 4F2RA 3OJSA 3V9SA 4FYDA 4JS5A 3MEDA 4CEZA 3BGRA 3LALA 3NDKA 4KPYA 5FRNA 4W5QA 1SV5A 3E01A 2KZZA 3DOLA 3QERA 1NK9A 4W5NA 3HVRA 4FJ8A 1B92A 1D9FA 2YNGA 4DTJA 4K8XA 3BDPA 2BGGA 3PUFA 1RT5A 4ID1A 3LP3A 3ZSQA 5HP1A 3OYAA 3V9UA 1NJWA 4CK1A 4AHVA 4ELVA 4DS4A 5FROA 3VQ6A 4CGDA 1W0HA 2DFHA 4JS4A 4UQGA 4DQPA 2OA8A 2YHAA 4DS5A 2HMIA 3DM2A 3DMJA 4O55A 4EZ6A 4EP5A 5J2NA 3LAKA 3CG7A 2OZMA 4O5BA 5J2MA 1RBVA 1TL3A 1RBTA 5KGXA 4PQUA 3WNHA 1C1AA 3SQ0A 1TKDA 2FBYA 4OKKA 4CJUA 4Q5VA 1EETA 4CHYA 2YNFA 4E7HA 2A1RA 2G8FA 4J2EA 3AVIA 4KI4A 3C94A 3RRHA 4AILC 4AHCA 3V9XA 3SNNA 2BDPA 4CEEA 3VQDA 3ZSXA 1LV5A 2GUIA 4RW4A 1QSYA 1RT4A 1U45A 4EZ9A 3MEEA 5I42A 3ZT4A 3KK3A 3DLKA 3SJJA 4Y1CA 3OYKA 3L2RA 4DLGA 4CJLA 4E0DA 4BE0A 1NK7A 3NH0A 3LWLA 1D9DA 1WAJA 4DU1A 3QNNA 1VSEA 2YNIA 4E89A 4DFKA 3RMBA 1BQNA 3AA5X 4CHPA 4E3SA 3SQ4A 4FJHA 1C1BA 3WNFA 2RN2A 1UA1A 4FM0A 1JLCA 4FZYA 4FLXA 3NF8A 2YNHA 1FKPA 1QQCA 1S6PA 4E7LA 2GV9A 1GOCA 4KTZA 3HP9A 4AH9A 3SQ1A 3NGIA 3DRSA 1SKWA 2P5OA 4MFBA 1IO2A 3VQBA 1O1WA 1WSJA 1ITGA 4IKFA 2KZMA 1TL1A 1I39A 3ZT3A 4JLHA 4CEBA 4B9LA 3MECA 3VQ7A 3L8BA 4B8CA 3S9HA 1LWFA 1RDCA 1KFDA 1WSFA 3ALYA 4N56A 3K57A 4CF9A 4F8RA 3HO1A 1C1CA 4CFAA 3LZJA 2ATQA 1XI1A 1U48A 4Z4GA 4DTOA 2E4LA 1WSEA 1ZBFA 2FBVA 2VG6A 1HJRA 4AHUA 4JRQA 5T7BA 3B6OA 4CHQA 4DFMA 3CYMA 4KREA 2XHBA 3AA3A 2OPRA 1W9HA 1A5WA 1YT3A 1L3SA 2AJQA 3C6UA 1EP4A 1ZBUA 3CFPA 4ELUA 1A5VA 1UWBA 2ZD1A 1ASWA 3DLGA 4FVMA
chains in the Genus database with same CATH superfamily
1T44A 3FFKB 1LW2A 1X9JA 3OVNA 2NRTA 4KFBA 4PKGA 4BRFA 1L5UA 2O4GA 1VQNN 3KLIA 3PO5A 4DFPA 2YV0X 4J2DA 1JXBA 1FKOA 3H46O 5JLFA 3KTQA 3AVGA 5JLHA 4K0KK 1Q82O 1YHQN 1KTQA 3CJ7A 5I9EB 4HUEA 4N41A 4F9OA 4JN4A 5SWMA 2D0BA 3J7YP 4OLAA 3G4SN 1K8KA 4PUOA 3ZETB 4H0PA 3RWUA 3DLRA 1MDUB 2W6LA 3TPQA 3BY5A 4FCYA 3SBGA 5AQXA 4E1NA 1KLMA 5CR4A 4CZHA 2KQ2A 3UKUA 3VEYA 3CFRA 4C1NK 3FR0A 3CJBA 3DLBA 2IVOA 4JK8A 2O8CB 4M3YA 3AVMA 3HTVA 1N8RO 3OA9A 1D8YA 1GOBA 4B1UB 1QVFM 2ITGA 5HRSA 4FJXA 5AQOA 4IEIA 1U2VA 3M8SA 1ZBLA 5JS1A 1BA1A 2FSJA 4E7KA 3O9TA 4DSKA 4DR1K 4PHTX 1VQLN 3MX2A 4DTNA 3AVAA 4Y1DA 3TAMA 5HRPA 4H8KA 4CHZA 5AQHA 3L2WA 3RTVA 1K8AO 1T3VA 4MO4A 1Z25A 4Z94A 4HTUA 3VQ9A 4FOEA 1TKXA 3THYA 4BDYA 1YUWA 4RG8A 4YFUA 4KTWA 3O9QA 3LDSA 1SS6A 1YVNA 3O1BA 3AVCA 3ZLJA 2P9UA 3AO2A 2QW9A 3HI0A 5HROA 4MO5A 1JLQA 1Q8IA 4LF8K 3E9OA 2HHUA 2W42A 2RF2A 1CLQA 5JICA 1K73O 2UXCK 3SUOA 3MCPA 4G9ZA 2KFZA 1LCUA 1ATNA 4YOXA 3PY8A 4CJ5A 4FJKA 4BGAA 1N36K 2P9LA 3IKMA 1NGEA 3SPZA 4DV3K 3ZSYA 3OYEA 3S41A 1BI4A 3NHGA 1KVAA 5BPNA 5C24A 3TANA 1KVBA 3KWGA 3TTFA 3GG4A 3THWB 2KKZA 3TAPA 3LPUA 1J53A 3DRRA 3CQ8A 2G8UA 4BR2A 4XH4A 3KHYA 1EKEA 1IH7A 4DSFA 3VQ4A 3D45A 3QEIA 2WOMA 1IKWA 3G71N 2B4JA 3R3LA 3LL3A 2J4RA 3KD1E 2CGJA 4A57A 4B9NA 4N76A 3IS9A 4JI5K 3SZ2A 3NCIA 2Q31A 1BWFO 3SUPA 3PSFA 4F3OA 4KKOA 4KHSA 1OH6A 3D2FB 4JD2A 4QAGA 3HOSA 1SL1A 3VPZA 5AQRA 4DTRA 3HT3A 3O9RA 4A2BA 2B6AA 4KHUA 4JKGB 2E2PA 5BRFA 3K58A 2ZJQL 2P9PB 1WNSA 1G99A 2W41A 2YKMA 4CF0A 3V9ZA 1GOAA 2HNYA 1NKBA 1NGDA 5KPRA 3UKRB 3N4PA 5C42A 3BZKA 5GINA 4HWIA 4GMJB 4FJNA 1NK5A 3V9WA 1YJWN 4OGCA 3OYGA 2V52B 1NMNA 4ZTJA 1Q18A 4YHHK 1RT3A 3AAPA 3MN6A 1Z26A 2KTQA 3O08A 4YDUA 4B9QA 2BANA 1D4XA 2F8SA 3NF9A 3K59A 3J81O 4BRMA 4JKAA 4LD0A 4F3TA 3CMAN 3VA0A 3T1AA 1HPZA 3IDHA 1J9AA 3BUZB 4YORA 1LWEA 3SMPA 1YXQA 4OX9K 5FPEA 4AM6A 3U3GA 4A5BA 3VTIA 1S9GA 4DQIA 1NBWA 1XWLA 1YIJN 1QE1A 1EWQA 1S1UA 5M1NA 3IRXA 4IOXA 3H6EA 5AQZA 3OYHA 1T6DA 4NCGA 1TV6A 1DKGD 2VYPA 1A5XA 4BR7A 4CEDA 1QSLA 3CM6A 1NGGA 2GWJA 1RBUA 3T1HK 3SPYA 4KB0A 1O13A 1NJIO 1Q9XA 2QEXN 3KLHA 3D7EO 3AVKA 1DEJA 4IXCA 2DY4A 3WEEB 4JI2K 2E8AA 3MMVA 3VQEA 3VF6A 4M3XA 3A5MC 5AJ3K 3GL1A 4LSNA 3VESA 1EXQA 1YITN 3RR8A 2HB5A 1WUAA 4KTQA 1VSIA 5E41A 3C7NB 4KH4A 2EWSA 4BC2A 2UUCK 2P9SA 3I55N 1HJOA 3RMAA 3H45C 3LDOA 2E6MA 4FWOA 1HR0K 4RTFD 2QI2A 4FJMA 4E7IA 3PV8A 1YVUA 3DOKA 1HPMA 1NGCA 4X65K 3HZ6A 4NXNK 4CECA 1U4BA 1KLNA 4HCBA 2D0CA 3ID8A 1BIZA 1LAWA 3L3UA 4B08A 3HYFA 3SYZA 4BDPA 4CVNE 2OYQA 2JLEA 1NWKA 3VQ5A 3SV4A 3SQ2A 2WUSA 5F1XA 4CZLA 3HM8A 3TAFA 1WAFA 3LDPA 4IG3A 1HKCA 4I6MB 1MWKA 1RTIA 4OGEA 5HOOA 4H0TB 3E9PA 4O44A 3VQCA 1YJ9N 3T19A 2O8BA 3CPWM 1YTAA 4JKCA 3L4IA 3O1WA 3AAQA 3NH1A 5AR0A 3K5OA 1GLFO 1HQEA 1BA0A 5FPDA 3HP6A 1J54A 2FBXA 2OZSA 3MEDA 4RCHA 3NDKA 4KPYA 5FRNA 4AM7A 4XEIA 4IJAA 1M1KO 3EE8A 1MA9B 1B92A 1TYQA 4JI1K 4ID1A 3I8BA 3ZSQA 2VCPA 4JKEA 3OBWA 4AHVA 4CGDA 1W0HA 4JS4A 3H1QA 3VOVA 2YHAA 4CBXA 4KH6A 3DM2A 1QHAA 4O55A 5J2NA 3VGLA 4O5BA 5J2MA 1OKJA 1Z05A 3NVKA 4CHYA 4E7HA 2G8FA 2QWNA 2QTDA 2BDPA 1GLCG 1LV5A 3ENBA 4RW4A 1QSYA 2P9IA 5I42A 1KXPA 5C10A 3ENHA 4Y1CA 3CC2N 3NH0A 4DU1A 4BY9C 2YNIA 5FLXO 2AP1A 2OCEA 3ZEUA 1BQNA 5MLCQ 2AA4A 3DAWA 3EL2A 2QM1A 3Q7BA 1WSJA 4FPBA 1TL1A 1I39A 4JLHA 4CEBA 3L8BA 3S9HA 3K57A 2W40A 1VQ4N 2ITMA 4F8RA 3VEWA 2GWKA 4BVPA 2ATQA 5M1QA 4JI6K 1XI1A 1WSEA 2HF4A 2UUBK 3TTCA 1W9HA 5TKWA 1A5WA 1IG8A 2VWKA 1ASWA 1U45A 3DLGA 3CMEN 4JI7K 3MX5A 3RSEB 4BWMA 4I2PA 4JK9A 2FF3B 3SAGA 2I5JA 4LF4K 3WXJA 3FZKA 3PX0A 3MN9A 2HVHA 1L3VA 3NF6A 4FLWA 2O8DB 4H03B 4CF2A 2YCHA 2B5JA 4L8RB 4FZZA 1Y64A 4FW2A 3MXJA 3TAQA 4CJQA 5ADXH 1D9FA 1LAVA 4FJLA 1J5OA 1S1XA 5AQUA 1QZ5A 1WSIA 2NRZA 1K6YA 2VQFK 4KHQA 1C6VA 3JAMO 2ZF5O 1W7AA 2IGIA 4IZ9A 1XMQK 2HBLA 3SBTA 4M3ZA 1RT2A 1VQ7N 3CCQN 4BACA 5AQFA 1TKZA 4CCHA 1SAZA 4BE2A 4OKJA 4FJ7A 3OS2A 1XC3A 2VGNA 4OPHA 4CF1A 4CFCA 3C65A 3FZHA 1HNVA 3FZLA 5KGWA 3EEQA 3ULEB 1HX1A 1RTHA 3HRGA 4NLBA 1VSDA 3ZX3A 4V19S 4M7XA 2HNZA 3CCUN 3HBTA 1DGKN 3ZSOA 5AQJA 2BE2A 3HJFA 5KTQA 1RDWX 4FWLA 3OYIA 4BRNA 4DFJA 3MXIA 3ENOA 5GAHP 1JLAA 3E1YA 4Z4EA 3O80A 1RILA 1ATRA 3DXKB 1LWCA 2X6NA 1KFSA 4DTSA 3P83D 2H3GX 4KI6A 3L6QA 1BISA 4YNQA 3DLHA 1ATSA 1ESVA 1X1PA 4ISEA 2HHHK 4ZHRA 4M41A 1JCGA 4EHUA 3FFIA 4BWJA 1S1WA 1RT7A 3EKSA 4LFCK 2P51A 1QHTA 1NKEA 5GIOA 2PBDA 1XC9A 1VQPN 4FM2A 1Q7YO 3HK2A 2Z1HA 4LY7A 2G8IA 4DG1A 3CJCA 4FLYA 4WCEL 4DU4A 2Q3SA 3ULDA 1NJYA 5FPMA 3H08A 2ASOA 3S3MA 2E1ZA 2HW3A 4YOTA 3SCXA 1T05A 4BC5A 5KRTA 5KPZA 3QLHA 3FZFA 3UB5A 4CBWA 3U6FA 3I0RA 5C2DA 1SKRA 3RMDA 2HHQA 1S5JA 3DI6A 3AVNA 2QWRA 2Z1JA 2F9WA 2UYTA 4FWQA 2GX9A 3MWTA 3A5NC 3HXMA 3A2FA 2KFNA 3DLEA 4C23A 2GBZA 4CEAA 2GELA 1TVRA 1VHXA 4EP4A 3LZIA 3C6AA 3RMCA 1YJNN 1LW0A 2CH6A 5AZJB 2CGKA 1NMDA 3ZSWA 4JHDA 1FJGK 1S6QA 1L3UA 4DSJA 4CJ7A 1X9SA 1CXQA 2NZTA 3VQQA 4LF9K 2HF3A 1I94K 3TAEA 2ZJPL 5C15A 4DF4A 4H5RA 5AQTA 4QS7A 5BN8A 5LJWA 2OPPA 5J2PA 3THVA 4J8FA 4DR4K 1TK8A 3KK1A 1JJ2M 4CZGA 3CCMN 5DMRA 2NLXA 5EX5A 1TAUA 3CIPA 4C8OA 2DPNA 1IKXA 3O9SA 4M45A 3CI5A 4K8ZA 3KLFA 4LH5A 1T7PA 1VSLA 4CIEA 4QCLA 1XHXA 4I9QA 3QNOA 4H0XB 2NRWA 4XIUA 3CFOA 1MWMA 1X3NA 4DV6K 2PZSA 5B8HA 1NK8A 4BQLA 3DXMB 3IMXA 2XO7A 4EHTA 3LAMA 4ZTFA 1JLFA 3LWMA 5F0XA 2ZQBA 3QMLA 3O9UA 4IOAL 1NK4A 4Y0WA 3LDLA 3T1YK 3M6GA 2OPQA 2NUBA 4MDAA 4HCCA 2WTUA 5KQ8A 3O4NA 5E26A 1SL0A 1ZC6A 5TKYA 4O0JA 4JEPA 1CZBA 2E6LA 2IC3A 1NK0A 1RDAA 2V7ZA 5AQQA 1HKBA 3MDQA 3O4QA 4NYFA 3LDNA 5AQPA 5HRRA 3W3DA 1UA0A 3V6DA 5EY4A 4FK4A 2JWLA 4CESA 1ASUA 4K41A 4O0IA 1ZBIA 4DR7K 3OYLA 4U67L 3A5LC 3NBPA 5LJVA 4Z4FA 2PFUA 1QTMA 3AARA 4PKHA 3TAGA 4KHWA 4CF8A 3WUHA 3IAYA 1RBSA 2F8TA 4FLZA 4JKHA 3ATUA 4CZEA 4I2QA 2WBNA 4KRFA 3NFAA 1EWRA 4FO0A 3HL8A 4PKIA 4O8KA 1KVCA 2HBMA 3JYTA 1KC8O 3QINA 3M8RA 2A42A 3I56N 4CJEA 2YJFA 4GW6A 1UOCA 4DR5K 4DQSA 1JLGA 2BH1A 3FGUA 3THXA 5C2FA 4B9UA 4F2SA 1IG9A 4DWIA 2XRIA 4KO0A 3CPEA 4Z4HA 4O8UA 4AF1A 4FLVA 4DTXA 4E7JA 2CGLA 4DQQA 1S9EA 2P9NB 1Z6RA 4E1MA 3VQ8A 5KQDA 4A61A 3LP1A 3VGKA 2NRHA 5AZIB 4BG9A 2O8EA 2P9KA 3TABA 4DSLA 2HHVA 1CZ9A 4BRCA 1CXUA 4LFAK 2G8KA 3MXMA 4WQ5C 4MDBA 1BHLA 4CIFA 4ID5A 3CJAA 4WFBL 1ZXOA 1IJJA 4IOCL 1NM1A 2P1JA 3P1GA 3TTDA 2FC0A 4F2RA 3V9SA 3A0IX 3BGRA 1VQON 1SV5A 3E01A 3K9JA 3QERA 5AFUA 4W5NA 3DWLA 4BRGA 1XUPO 3V9UA 1NJWA 5LMNK 4CK1A 2QWPA 5GAGP 2RE2A 4EP5A 2O8FB 3KK7A 4X66K 1RBVA 1RBTA 4PQUA 3WNHA 4O5FA 4XH5A 2A1RA 4BRHA 3AVIA 4BRAA 4WFAL 2GUIA 4KBOA 3JS6A 2UU9K 3WQUA 3AGRA 4DLGA 3QICA 1N32K 3QB0A 1D9DA 4H5WA 3QNNA 4A62A 3RMBA 3FE1A 4CHPA 3CQYA 3WNFA 1UA1A 4FM0A 3NF8A 1FKPA 1S6PA 3U8XA 4AH9A 1ZBSA 2QA4N 1IO2A 1ITGA 4IKFA 3MECA 3VQ7A 3A8YA 5AQYA 4YOUA 1LWFA 4N56A 3LZJA 3MN7A 4Z4GA 2VG6A 5EXWA 2FBVA 5EVZA 3AY9A 4DFMA 4LC9B 3BF1A 3CYMA 3KZBA 4KREA 3AA3A 3D2EA 4DR3K 1ZBUA 5BR8K 4ELUA 1UWBA 3OTOK 4DTPA 1NLVA 3VF2A 4LFBK 1K8KB 3PX4A 1HNIA 1EX4A 4GY2B 3G6EN 3SUQA 5CYMA 5BPMA 1W2BM 3MN5A 1U04A 3RRGA 1NGJA 4NO7A 4O4GA 3LP2A 1NU0A 1D5AA 2KLAA 3VMFB 4M3UA 4CHOA 1E4GT 3TSQA 3UKUB 1L3TA 4DV1K 1JKHA 1VQMN 3G0ZA 4CEQA 4ICLA 3OYNA 2OTLN 1RDDA 3D6RA 3ZCMA 4JKFA 2LSNA 3K5NA 1RT6A 2DFFA 1U2VB 3C95A 1FW6A 1T6CA 4FWRA 4CJPA 2HNDA 1CZAN 4R5PA 1XHZA 4AHRA 2GUPA 4E1JA 3GBTA 4M3WA 3SAHA 5LL6Z 1VQ5N 4PL8A 3O6WA 3QIOA 4BC4A 4WYBA 1QS4A 4I9LA 1WLJA 4B9TA 1U49A 3KVGA 4KHYA 1NGIA 4JYAK 2E2QA 5E84A 4H5VA 3S3OA 3L3VA 4LSLA 3CCVN 3THYB 3Q7CA 3WNGA 5CZ2A 2QKKA 3J80O 3ZETA 4OO1J 3F9KA 2FF6A 3R6MA 2R7YA 3CCJN 2P9UB 4H4OA 4GKKK 4FK0A 2HOEA 2IDOA 4BRDA 3CJ1A 3ZT2A 3BF3A 4HUGA 4H0OA 3HVTA 1BO5O 2F4VK 1QQOA 4FJ5A 3VENA 3P39A 3P4IA 3SJHA 5DM7L 3V1RA 2A3ZA 4CK3A 3J7ZO 2UXDK 2O8CA 5LMUK 3K2PA 3WXLA 3JXUA 3WNEA 5DK5A 1JCFA 2P9LB 1KAZA 3QEPA 3ZSRA 3EE9A 4YOVA 4M63C 3QEWA 1BI4B 4IO8A 3ASMA 4CZJA 3QEVA 1BU6O 2BUPA 2FLOA 2QWLA 4RW7A 2OANA 2WFBA 2YHBA 3OYJA 3ZYYX 4FJGA 1RT1A 2O4IA 3OYBA 3AO4A 3MCAB 1YF5L 4NLCA 3TU5A 2G8VA 2DFEA 3SV3A 4LF6K 1WN7A 2Q36A 3C6HA 2I7PA 1BCOA 1V4SA 1NJXA 2BTFA 4B3MK 2F96A 3CCRN 4TSXA 3E9LA 3CM5A 5F2RA 4FZXC 1VSKA 4GV6A 4Z4CA 3ZSVA 4F4KA 3ZT0A 5EU7A 1N34K 4B9VA 1TK5A 3LPTA 4JD2B 2YJEA 3NMUA 2A1SA 4J2AA 3K5MA 3TI0A 3JSMA 1KQSM 1YI2N 1MU2A 1OVYA 2D0AA 4HVJA 1X9MA 1VQKN 2ASPA 2FSNA 4JI0K 2YHWA 3H3NO 1HYZA 4CK2A 4ILJA 3UIQA 4FVUA 4IFEA 1TK0A 4IO9L 1Q9YA 4FLUA 1KAYA 3DRPA 3THWA 5BRDA 4PY5A 4HHTA 4BRPA 2XY7A 3V1QA 1REVA 1T8EA 2X78A 5C25A 1IKYA 3K0SA 5KI6A 3I0SA 4BR5A 4E19A 3QFPA 1IV0A 3PX6A 4I7FA 1WSHA 4BREA 1BUPA 3PO4A 1EO1A 3S3NA 2VGMA 3WXIA 4CJTA 3CCLN 1SUQA 3D0PA 1JL1A 1ILYA 2ZGYA 2YI1A 4FLTA 2HHXA 1S1TA 4ISFA 4ILHA 3M8PA 5BR9A 3HPHA 3SMSA 1RNHA 2UXBK 3B6PA 5J2QA 5C12A 2IVPA 4CEFA 3V1OA 4CJWA 1KRPA 3L2VA 3D2FA 4OLBA 4GV3A 1TGOA 1I3AA 5AQLA 4B9SA 4JKGA 1C0GA 1VAZA 3L0QA 2HVIA 4IJNA 1BGXT 2P9PA 3M5RA 1U47A 1C0TA 1WSGA 4DCHA 3G25A 1S72N 3OHRA 1VK0A 4JKBA 1HRHA 4FXDA 3UKRA 4AHTA 2FBTA 2Q0UA 2YHYA 3J8AA 3SUNA 2P5GA 3PIPL 4BDZA 4B9MA 2QWOA 3HPOA 1TAQA 1C0UA 4DHYA 2P9SB 3LM2A 4DKWA 1DLOA 3OBYA 4PA1A 1VSFA 1ZYQA 1KCFA 4JI3K 3KWIA 3AVFA 4QOZB 3KKRA 4FPAA 3C0BA 3F9MA 3IG1A 3TSPA 5AQMA 3L2UA 4PWDA 4GVMA 4OPAA 1NGBA 4FWPA 1RDBA 2EX3A 4HUFA 2UUAK 3T7ZA 4H5TA 4M3TA 1NKCA 5CE3A 3CHWA 5IT9O 2GTDA 3WXMB 1SL2A 2QXFA 4MQ3A 4CGFA 1NJZA 4C1NI 1KSPA 2D0OA 1E3MA 4CJSA 1FK9A 3QBXA 5BREA 2G8HA 4CEOA 4CI6A 4U7BA 3OYMA 3KLGA 4DUYK 5JS2A 1T03A 2PYJA 3RR7A 1NK6A 3WEEA 4B3RK 3DJCA 3MEGA 4BROA 4CJ4A 1R59O 3OW2M 4CBUA 4AQYK 3R1XA 3DYAA 4C8MA 2X74A 1N33K 4LH4A 4L3QA 3VQPA 2O8BB 3C7NA 3ISNC 3LM9A 4B1ZA 2EHGA 4CZMA 1RBRA 4FSVA 5J1EA 4W5TA 3P5JA 3F5TA 4BR4A 3HM9A 2QXLA 3KIOA 4IDKA 4EFHA 2OPSA 1HMVA 4OPKA 3NGZA 3NGYA 4B1XB 4DUZK 4C8KA 4FK2A 4ILGB 3QETA 4ELTA 1ASVA 1QZ6A 4CGGA 1HYVA 2ZGZA 3KD5E 1QQNA 5BRHA 1RDUA 1TYQB 3PIOL 5FDLA 2PYLA 2Y1JA 3V4IA 3OJUA 3NE6A 3O4WA 4YDUC 5ELZA 4RWTA 2IS3A 4RW8A 2VWJA 1HQUA 3KLEA 2A40A 1BOTO 4JRPA 1N6QA 3OJSA 3H3OB 4JNEA 4FYDA 3ZX0A 4JS5A 4CEZA 4JAXA 5FPNA 4I6MA 1OH5A 4X64K 1P90A 1NK9A 5AQGA 2P9IB 5AQSA 4FJ8A 4K8XA 4DTJA 3PLAA 3BDPA 3VTHA 2ZJRL 1GLLO 3LP3A 3QDKA 2E2NA 5H1SQ 5FROA 3VQ6A 2DFHA 2FXUA 5HL7L 4DQPA 3R9PA 3ZEUB 4DS5A 3DMJA 4EZ6A 3LAKA 5JVGL 1XMOK 2OZMA 4X62K 1TL3A 5KGXA 2NRRA 3SQ0A 1TKDA 4OKKA 4CJUA 4Q5VA 3CCSN 4KI4A 3C94A 5JVHL 3RRHA 1GLJO 3O5BA 1IBMK 1HLUA 3ZSXA 3M1FA 3MEEA 3WXKA 4H0VB 3ZT4A 1GLEG 4CD3A 3SJJA 3WQTA 2F9TA 3CC4N 5AQKA 1WAJA 1VSEA 4E89A 4DFKA 2A6AA 3AA5X 4ISGA 2RN2A 4FZYA 4FLXA 4YOWA 2YNHA 5ADXA 4E7LA 2GV9A 1GOCA 3CQXA 3HP9A 1OVQA 3SQ1A 3NGIA 3DRSA 1SKWA 2P5OA 3VEOA 1TUYA 3ZT3A 2JWKA 4B9LA 1VQ6N 4B8CA 1WBDA 1RDCA 1WSFA 1KFDA 3ALYA 3HSCA 3HO1A 1C1CA 4CFAA 1RFQA 1U48A 4GVEA 1HJRA 4XH1A 3VEVA 5T7BA 4CHQA 2XHBA 4DV7K 2OPRA 4NB4A 1L3SA 1YT3A 5M1PA 1GLDG 1EP4A 3CFPA 2IVNA 4R79A 1XNRK 1R0AA 3NF7A 4WF9L 4Q0BA 3QO9A 1U6ZA 4CJ3A 4JV5K 4WQ4A 4CZIA 2HHSA 2VG7A 4BR9A 4B3OA 1OH8A 1HNXK 4K25A 4B1VA 5D3GA 4BG8A 3AO3A 4B3TK 1NGAA 4CIGA 4CGJA 4KHNA 4CD1A 1J6ZA 3ATVA 4CZKA 4DV0K 2IOCA 2ETJA 1Y97A 4BR0A 5SZTA 3M3ZA 3K5LA 2HBKA 3EYZA 3GOIA 1RTJA 3RSEA 3LP0A 3AVBA 1YAGA 1BQMA 4KAZA 2IAJA 3AO5A 4IFVA 1VRTA 2YKNA 3VETA 3T69A 5BN9A 2O8DA 2E2OA 3QIPA 3O3GA 2ASMA 3OY9A 4NXMK 1S1VA 4Z4IA 3VQAA 4IWVA 1DTQA 4DU3A 4FWKA 5HBMA 2XY6A 3DLLL 3LDQA 2Y1IA 4CFBA 4DSIA 4KH5A 2G8WA 3C6TA 2E5LK 4KB1A 3QESA 4CFDA 1QSSA 1QQMA 3U3YA 1BIUA 3NH2A 4DB3A 4JI4K 1S3XA 2V7YA 3SK3A 1IKVA 4IG0A 1WBBA 1TUUA 2IIRA 1F21A 2E88A 1Q86O 4OJRA 2ZE2A 1OH7A 1XNQK 2Z1GA 4CGIA 4DSEA 4B1WB 4FW1A 2HHWA 4DQ8A 1RCHA 1GLBG 4CHNA 4QS9A 2A41A 3AA2A 4C8LA 1Q81O 4BVOA 3ULEA 4A2AA 1ZBHA 5AQVA 3GDQA 3CETA 1E4FT 3HPGA 4N47A 1X9WA 5FRMA 3HOTA 2WONA 2DTUA 3ID6A 3U4LA 3CXCM 4OVLA 1NOYA 3U9ZA 4WE1A 2QWQA 4A59A 4J2BA 2Q97A 3TSUA 4DF8A 3AV9A 3DXKA 2XY5A 1LOTB 3AVHA 2KHOA 4OKEA 2VQEK 5I3UA 4QS8A 4FJ9A 1C0MA 3L4QA 2QK9A 4CJFA 3ZSZA 3QBWA 3VN5A 5KRSA 4OPJA 1M90O 1FXXA 4FWSA 2PY5A 2HSTA 3LANA 4JHDB 4Z0UA 3G10A 3AVJA 4YY3K 3CD6N 1JLEA 3KJVA 4NYNA 4W5OA 2RHKA 4BGBA 3NAEA 2QKBA 1IBLK 4YOYA 4M3RA 4M42A 3BP8A 4DMNA 4FJIA 1BDGA 5BPLA 3F73A 1TKTA 1SQKA 1G15A 4A5AA 3VGMA 5CZ1A 1EQYA 2X6SA 3OYCA 1JXEA 2Z1IA 3AO1A 1HYSA 1UAXA 3VERA 3OYFA 5GAEP 3M8QA 1HUXA 4CGHA 4RW6A 3W0LA 4DV2K 4IDHA 4N5SA 3AGKA 1W97L 2PAVA 3E66A 4H5NA 3EY1A 3KKSA 1RTDA 4CJRA 3ITHA 3EKUA 5A2QO 5HLFA 4DTMA 2RPIA 5AZJA 1VSHA 1B9DA 4DLEA 2BGGA 3OYDA 3OS1A 3HSTB 1HKGA 2E1YA 5M1FA 4RW9A 3VA3A 2ZM6K 4C8NA 2JGUA 4WQ5A 3OS0A 1K9MO 3FLCO 5C0YA 4FM1A 3SI6A 3QEXA 3I8DA 3PSIA 3L2QA 4DTUA 1IBKK 4H0YB 1BL3A 5AQIA 3MWPA 3KK2A 2WC9A 3ZT1A 4CERA 1VRUA 3R8EA 4CE9A 4H4MA 2HBJA 4GNIA 3CC7N 1JL2A 3U9DA 1VQ9N 3VEZA 4BRKA 4KV8A 5HRNA 1BCMA 1DT9A 2I7NA 2E20A 2A5XA 3EO3A 2D5RA 3ZX2A 1KD1O 3VEXA 3DXMA 4FWNA 4CJKA 2CH5A 1B9FA 1NGHA 2FSKA 1SKSA 3CJ9A 3TWHA 4FL9A 5LY3A 4JI8K 2D0PA 2RKIA 2Q0RA 4CW7B 5AQNA 4FWMA 4G1QA 4EAHD 2ZWHA 5K14A 3THXB 3CCEN 4B3SK 1X3MA 3O3HA 5DM6L 4MLEA 4GV9A 3QFUA 2NNWA 1WB9A 4FJJA 1VSJA 2VG5A 5JMVA 2V51B 3O3FA 2HHTA 4W5RA 1GLAG 3EN9A 2XY8A 4BRIA 1JCEA 3AVLA 1J5EK 1N5YA 3TARA 4PL7A 1JLBA 2O8EB 2P9KB 3P31A 3H1VX 2OTJN 3T3FA 3NVMA 2QWMA 5CHIA 4AHSA 4BE1A 4B8AB 3RVCA 3EZ5A 3V81A 3AA4A 4CJVA 3BZCA 1HNWK 4JKDA 4UY8O 1VSMA 4DQRA 1WOQA 4WFNL 3MAQA 3TR8A 2KW4A 4IFYA 3N4QA 4IBNA 4B1YB 3EZWA 1DTTA 4NCBA 2HMPA 4NCAA 4DR2K 5CY4A 3VF4A 3WT0A 1KAXA 5M1OA 1BG3A 5CYQA 5IWAK 1NOZA 1YTUA 2D4WA 5GADP 5AQWA 3P38A 4MLHA 4DR6K 3MK6A 4K42A 1VQ8N 2F7TA 2P9NA 4DV5K 1V4TA 3LALA 5KPTA 4W5QA 2KZZA 3DOLA 5AZIA 4IEEA 4JK7A 3GE1A 2Q2RA 3IUCA 3HVRA 3CF5L 2YNGA 4EIAA 1SZ2A 2NRVA 3PUFA 1QVGM 1RT5A 5HP1A 3B8AX 3OYAA 4GKJK 4ELVA 4DS4A 3J7AP 3I33A 4FOIA 2NRXA 3FZMA 4UQGA 2OA8A 2HMIA 4BC3A 4BQZA 3CG7A 3O8MA 1C1AA 4K43A 2FBYA 3IFRA 1EETA 2YNFA 5GIPA 4J2EA 1RGIA 4AILC 3SNNA 4AHCA 3V9XA 2YX6A 3SAFA 4CEEA 3VQDA 2D1KA 1RT4A 4EZ9A 3KK3A 3DLKA 3K9KA 2W6KA 1NGFA 3OYKA 3L2RA 4CJLA 4E0DA 3BEXA 4BE0A 1NK7A 3CERA 3LWLA 4KHPK 3D2EB 2Q1NA 2GEMA 1S22A 4E3SA 5EOYA 3SQ4A 2O8FA 4FJHA 1C1BA 1JLCA 2VWBA 3SLCA 1H1VA 1QQCA 3A5OC 4KTZA 4BRLA 4BRQA 5AFUH 1C0FA 4MFBA 3VQBA 1O1WA 2KZMA 4DV4K 1XQSC 4LF5K 4HTLA 4CF9A 5M1KA 3F2KA 4DTOA 2E4LA 4M7YA 1ZBFA 1NNEA 1HNZK 4AHUA 2YHXA 4JRQA 4WQ4C 1P8ZA 3B6OA 1NG9A 2AJQA 4CZFA 3C6UA 1A5VA 3UE5A 4LF7K 2ZD1A 4FVMA
chains in the Genus database with same CATH topology
1R0AA 3PX4A 1HNIA 1LW2A 3OVNA 3NF7A 4BWMA 4I2PA 1EX4A 4KFBA 2I5JA 4Q0BA 3QO9A 4CJ3A 1L5UA 2O4GA 3PX0A 3SUQA 2VG7A 3KLIA 5CYMA 2HHSA 3PO5A 4DFPA 1U04A 4B3OA 3RRGA 2YV0X 4J2DA 1JXBA 2HVHA 1FKOA 4O4GA 5D3GA 3KTQA 3AVGA 3LP2A 1L3VA 3NF6A 1D5AA 3AO3A 4M3UA 4FLWA 4CHOA 1KTQA 4CIGA 4CF2A 2B5JA 1L3TA 4CGJA 1JKHA 4L8RB 3G0ZA 4HUEA 4KHNA 4FZZA 4FW2A 3MXJA 3TAQA 4CJQA 4N41A 4CEQA 2D0BA 1LAVA 1Y97A 2ETJA 2IOCA 4ICLA 5SWMA 1S1XA 5SZTA 3OYNA 3K5LA 1J5OA 4FJLA 1RDDA 1WSIA 3EYZA 1K6YA 3ZCMA 1RTJA 4KHQA 3K5NA 2LSNA 1C6VA 4PUOA 3LP0A 1RT6A 2DFFA 3AVBA 3C95A 3RWUA 2IGIA 4M3ZA 3DLRA 4CJPA 1BQMA 1RT2A 4KAZA 2HNDA 2IAJA 4R5PA 3AO5A 1XHZA 4AHRA 4BACA 4M3WA 4IFVA 1VRTA 4FCYA 2YKNA 1TKZA 3QIOA 4E1NA 4CCHA 1KLMA 1QS4A 4I9LA 2KQ2A 1WLJA 3QIPA 3O3GA 4B9TA 1U49A 3CFRA 3OY9A 4BE2A 1S1VA 4KHYA 3DLBA 3VQAA 4Z4IA 4OKJA 4FJ7A 3S3OA 4M3YA 3L3VA 3AVMA 4LSLA 1DTQA 4DU3A 5HBMA 2XY6A 3WNGA 3OS2A 2Y1IA 2VWKA 1D8YA 1GOBA 5CZ2A 4CFBA 2ITGA 5HRSA 2QKKA 4DSIA 4FJXA 3F9KA 4CF1A 4CFCA 2G8WA 3M8SA 3C6TA 4KB1A 1HNVA 2R7YA 3QESA 5KGWA 4H4OA 4CFDA 1ZBLA 1QSSA 5JS1A 4FK0A 2IDOA 4E7KA 1RTHA 3U3YA 4DSKA 3ZT2A 1BIUA 3NH2A 1VSDA 4HUGA 4DTNA 2HNZA 3AVAA 4Y1DA 3TAMA 1IKVA 4IG0A 3ZSOA 5HRPA 3HVTA 4H8KA 4CHZA 2BE2A 4FJ5A 3HJFA 5KTQA 3L2WA 3RTVA 1F21A 3OYIA 4DFJA 4OJRA 3MXIA 1Z25A 4HTUA 2ZE2A 1JLAA 3V1RA 3VQ9A 4Z4EA 2Z1GA 1TKXA 1RILA 4CGIA 4CK3A 1LWCA 4DSEA 3K2PA 2X6NA 1KFSA 3WNEA 5DK5A 4BDYA 4DTSA 3P83D 4RG8A 4YFUA 4KTWA 3LDSA 3QEPA 4KI6A 4FW1A 3ZSRA 2HHWA 1RCHA 1BISA 4YNQA 3QEWA 3DLHA 4CHNA 1BI4B 3AVCA 1X1PA 3AA2A 3AO2A 3ASMA 4C8LA 4ZHRA 5HROA 4M41A 1JLQA 1Q8IA 3QEVA 1ZBHA 3FFIA 2HHUA 2W42A 3HPGA 2RF2A 4BWJA 4RW7A 1S1WA 4N47A 1X9WA 1CLQA 2YHBA 1RT7A 3OYJA 3SUOA 4FJGA 5FRMA 1RT1A 2P51A 1QHTA 2WONA 2O4IA 2DTUA 3OYBA 3AO4A 1NKEA 2KFZA 4OVLA 1NOYA 4WE1A 4J2BA 1XC9A 4FM2A 4DF8A 3AV9A 3PY8A 2G8VA 2DFEA 2Z1HA 4CJ5A 2XY5A 4FJKA 3HK2A 3SV3A 4LY7A 3AVHA 2G8IA 4DG1A 1WN7A 4FLYA 3SPZA 3ZSYA 4DU4A 2Q3SA 3OYEA 4OKEA 3ULDA 1NJYA 1BI4A 3H08A 5I3UA 1BCOA 4FJ9A 3S3MA 1C0MA 1NJXA 2HW3A 2QK9A 4CJFA 3NHGA 3SCXA 3ZSZA 1KVAA 2F96A 5C24A 4DTPA 4OPJA 4TSXA 3VN5A 5KRSA 5KRTA 3CM5A 3TANA 1FXXA 1KVBA 1VSKA 3QLHA 4FZXC 4Z4CA 3ZSVA 4F4KA 3U6FA 3ZT0A 2PY5A 3I0RA 5EU7A 3LANA 4B9VA 1SKRA 4Z0UA 3G10A 3AVJA 1J53A 3LPTA 3LPUA 3RMDA 3TAPA 1S5JA 1TK5A 2HHQA 1JLEA 3DI6A 3DRRA 2A1SA 3KJVA 4NYNA 4W5OA 3CQ8A 2G8UA 4J2AA 1EKEA 3AVNA 1IH7A 3K5MA 2Z1JA 3NAEA 3VQ4A 3D45A 3JSMA 4DSFA 3QEIA 3TI0A 2WOMA 1IKWA 2QKBA 2B4JA 4M3RA 4M42A 1MU2A 3KD1E 2D0AA 4DMNA 4HVJA 3HXMA 1X9MA 3A2FA 2KFNA 3DLEA 4B9NA 4N76A 4FJIA 2GBZA 3IS9A 4CEAA 3SZ2A 3F73A 1TVRA 3NCIA 1TKTA 1HYZA 4CK2A 4EP4A 1G15A 3UIQA 3LZIA 3RMCA 3SUPA 1TK0A 1LW0A 5CZ1A 1Q9YA 4F3OA 2X6SA 4KKOA 3OYCA 3DRPA 4FLUA 4KHSA 4PY5A 4HHTA 2XY7A 3ZSWA 1JXEA 1REVA 2Z1IA 2X78A 3V1QA 1S6QA 5C25A 1IKYA 1T8EA 1L3UA 4DSJA 5KI6A 4QAGA 3I0SA 1SL1A 3AO1A 1X9SA 4DTRA 1CXQA 3VQQA 4E19A 3HT3A 1UAXA 3PX6A 3TAEA 2B6AA 1HYSA 4KHUA 3OYFA 4DF4A 4I7FA 1WSHA 3M8QA 3PO4A 3S3NA 3K58A 4CGHA 4RW6A 4CJTA 1WNSA 2OPPA 5J2PA 4N5SA 1SUQA 3D0PA 3THVA 1JL1A 1TK8A 3KK1A 2YKMA 4CF0A 3V9ZA 1GOAA 2HNYA 1NKBA 5DMRA 4FLTA 3EY1A 2HHXA 1S1TA 1TAUA 3KKSA 4C8OA 3M8PA 1IKXA 5C42A 4CJRA 1RTDA 3ITHA 4GMJB 5HLFA 4FJNA 3HPHA 1NK5A 1RNHA 4DTMA 2RPIA 4M45A 3B6PA 5J2QA 1VSHA 4K8ZA 1B9DA 3V9WA 4DLEA 4CEFA 3V1OA 4LH5A 4CJWA 1VSLA 3OYDA 3KLFA 4CIEA 3L2VA 4OGCA 3OS1A 1KRPA 4OLBA 4QCLA 3HSTB 3OYGA 1XHXA 4RW9A 1TGOA 3QNOA 1I3AA 4ZTJA 1RT3A 3VA3A 4B9SA 4I9QA 1Z26A 4XIUA 2KTQA 4C8NA 2JGUA 3OS0A 3CFOA 2HVIA 2BANA 2PZSA 1BGXT 4FM1A 3SI6A 1NK8A 1U47A 1C0TA 3QEXA 1WSGA 3NF9A 3I8DA 3K59A 2F8SA 2XO7A 3L2QA 4LD0A 3LAMA 1VK0A 4ZTFA 1JLFA 4DTUA 3LWMA 4F3TA 1HRHA 2ZQBA 3VA0A 3T1AA 1HPZA 1T7PA 4FXDA 1J9AA 1LWEA 1BL3A 4AHTA 1NK4A 2FBTA 3SUNA 3KK2A 3U3GA 3ZT1A 4CERA 2P5GA 1S9GA 1VRUA 4CE9A 4BDZA 4H4MA 4B9MA 4DQIA 1XWLA 2OPQA 1QE1A 3HPOA 1JL2A 1S1UA 1TAQA 2NUBA 4HCCA 3IRXA 4KV8A 5HRNA 1BCMA 1C0UA 3O4NA 1SL0A 3OYHA 4NCGA 4O0JA 4OLAA 1TV6A 1DLOA 1CZBA 2D5RA 1A5XA 2E6LA 4CEDA 1QSLA 3CM6A 2IC3A 4PA1A 1RBUA 3SPYA 1NK0A 1VSFA 1ZYQA 4KB0A 1RDAA 1Q9XA 1KCFA 3KLHA 4CJKA 3AVFA 4QOZB 1B9FA 3KKRA 3O4QA 3AVKA 4NYFA 1T05A 5HRRA 3IG1A 3L2UA 1UA0A 3V6DA 4PWDA 4FK4A 1SKSA 2DY4A 4CESA 4GVMA 3TWHA 1ASUA 3VQEA 1ZBIA 4O0IA 3OYLA 2RKIA 4M3XA 4HUFA 1RDBA 2EX3A 4LSNA 3RR8A 1EXQA 4G1QA 2HB5A 4KTQA 4M3TA 3NBPA 1NKCA 4Z4FA 1VSIA 5K14A 5E41A 1QTMA 1SL2A 2QXFA 4MQ3A 4CGFA 1NJZA 3O3HA 3TAGA 4KHWA 4CF8A 3RMAA 1KSPA 3IAYA 1RBSA 4CJSA 2F8TA 4FLZA 4FJJA 1VSJA 2VG5A 1FK9A 2E6MA 4I2QA 3O3FA 2HHTA 2G8HA 4CEOA 4W5RA 3KLGA 3OYMA 5JS2A 4FJMA 4E7IA 2XY8A 3PV8A 4KRFA 1YVUA 3AVLA 3NFAA 1N5YA 3TARA 1T03A 3DOKA 2PYJA 3RR7A 1NK6A 3HL8A 3MEGA 1KVCA 4CJ4A 1JLBA 3JYTA 3DYAA 4C8MA 3QINA 2X74A 3M8RA 3T3FA 4CECA 1U4BA 1KLNA 4LH4A 4CJEA 4GW6A 4HCBA 1UOCA 4DQSA 2D0CA 1JLGA 3VQPA 5J1EA 3ISNC 4AHSA 4BE1A 2EHGA 4B8AB 1RBRA 1BIZA 1LAWA 3L3UA 3P5JA 4W5TA 3EZ5A 4B08A 3V81A 3HM9A 3HYFA 3AA4A 3KIOA 4B9UA 4CJVA 4F2SA 4IDKA 3SYZA 4BDPA 1IG9A 2OYQA 2JLEA 3VQ5A 4DWIA 2XRIA 4KO0A 1VSMA 2OPSA 1HMVA 4OPKA 3NGZA 3SV4A 3SQ2A 3NGYA 4Z4HA 4DQRA 4FLVA 4DTXA 4E7JA 3TAFA 4DQQA 4C8KA 4FK2A 3MAQA 1S9EA 1WAFA 3TR8A 3QETA 2KW4A 4ELTA 4IFYA 4IG3A 1ASVA 4IBNA 3VQ8A 4E1MA 3LP1A 4CGGA 1DTTA 4NCBA 1RTIA 3TABA 4DSLA 1HYVA 4NCAA 2HHVA 1CZ9A 4OGEA 3KD5E 1CXUA 5FDLA 2G8KA 4O44A 5CY4A 3VQCA 3T19A 2PYLA 2Y1JA 3V4IA 3MXMA 3OJUA 3NE6A 1BHLA 4CIFA 1YTAA 5CYQA 3NH1A 4ID5A 2IS3A 1NOZA 4RW8A 2VWJA 1YTUA 3K5OA 1HQUA 3KLEA 1HQEA 3P1GA 2P1JA 3HP6A 1J54A 2FC0A 4JRPA 2FBXA 1N6QA 2OZSA 4F2RA 3OJSA 3V9SA 4FYDA 4JS5A 3MEDA 4CEZA 3BGRA 3LALA 3NDKA 4KPYA 5FRNA 4W5QA 1SV5A 3E01A 2KZZA 3DOLA 3QERA 1NK9A 4W5NA 3HVRA 4FJ8A 1B92A 1D9FA 2YNGA 4DTJA 4K8XA 3BDPA 2BGGA 3PUFA 1RT5A 4ID1A 3LP3A 3ZSQA 5HP1A 3OYAA 3V9UA 1NJWA 4CK1A 4AHVA 4ELVA 4DS4A 5FROA 3VQ6A 4CGDA 1W0HA 2DFHA 4JS4A 4UQGA 4DQPA 2OA8A 2YHAA 4DS5A 2HMIA 3DM2A 3DMJA 4O55A 4EZ6A 4EP5A 5J2NA 3LAKA 3CG7A 2OZMA 4O5BA 5J2MA 1RBVA 1TL3A 1RBTA 5KGXA 4PQUA 3WNHA 1C1AA 3SQ0A 1TKDA 2FBYA 4OKKA 4CJUA 4Q5VA 1EETA 4CHYA 2YNFA 4E7HA 2A1RA 2G8FA 4J2EA 3AVIA 4KI4A 3C94A 3RRHA 4AILC 4AHCA 3V9XA 3SNNA 2BDPA 4CEEA 3VQDA 3ZSXA 1LV5A 2GUIA 4RW4A 1QSYA 1RT4A 1U45A 4EZ9A 3MEEA 5I42A 3ZT4A 3KK3A 3DLKA 3SJJA 4Y1CA 3OYKA 3L2RA 4DLGA 4CJLA 4E0DA 4BE0A 1NK7A 3NH0A 3LWLA 1D9DA 1WAJA 4DU1A 3QNNA 1VSEA 2YNIA 4E89A 4DFKA 3RMBA 1BQNA 3AA5X 4CHPA 4E3SA 3SQ4A 4FJHA 1C1BA 3WNFA 2RN2A 1UA1A 4FM0A 1JLCA 4FZYA 4FLXA 3NF8A 2YNHA 1FKPA 1QQCA 1S6PA 4E7LA 2GV9A 1GOCA 4KTZA 3HP9A 4AH9A 3SQ1A 3NGIA 3DRSA 1SKWA 2P5OA 4MFBA 1IO2A 3VQBA 1O1WA 1WSJA 1ITGA 4IKFA 2KZMA 1TL1A 1I39A 3ZT3A 4JLHA 4CEBA 4B9LA 3MECA 3VQ7A 3L8BA 4B8CA 3S9HA 1LWFA 1RDCA 1KFDA 1WSFA 3ALYA 4N56A 3K57A 4CF9A 4F8RA 3HO1A 1C1CA 4CFAA 3LZJA 2ATQA 1XI1A 1U48A 4Z4GA 4DTOA 2E4LA 1WSEA 1ZBFA 2FBVA 2VG6A 1HJRA 4AHUA 4JRQA 5T7BA 3B6OA 4CHQA 4DFMA 3CYMA 4KREA 2XHBA 3AA3A 2OPRA 1W9HA 1A5WA 1YT3A 1L3SA 2AJQA 3C6UA 1EP4A 1ZBUA 3CFPA 4ELUA 1A5VA 1UWBA 2ZD1A 1ASWA 3DLGA 4FVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R0A A;  3PX4 A;  1HNI A;  1LW2 A;  3OVN A;  3NF7 A;  4BWM A;  4I2P A;  1EX4 A;  4KFB A;  2I5J A;  4Q0B A;  3QO9 A;  4CJ3 A;  1L5U A;  2O4G A;  3PX0 A;  3SUQ A;  2VG7 A;  3KLI A;  5CYM A;  2HHS A;  3PO5 A;  4DFP A;  1U04 A;  4B3O A;  3RRG A;  2YV0 X;  4J2D A;  1JXB A;  2HVH A;  1FKO A;  4O4G A;  5D3G A;  3KTQ A;  3AVG A;  3LP2 A;  1L3V A;  3NF6 A;  1D5A A;  3AO3 A;  4M3U A;  4FLW A;  4CHO A;  1KTQ A;  4CIG A;  4CF2 A;  2B5J A;  1L3T A;  4CGJ A;  1JKH A;  4L8R B;  3G0Z A;  4HUE A;  4KHN A;  4FZZ A;  4FW2 A;  3MXJ A;  3TAQ A;  4CJQ A;  4N41 A;  4CEQ A;  2D0B A;  1LAV A;  1Y97 A;  2ETJ A;  2IOC A;  4ICL A;  5SWM A;  1S1X A;  5SZT A;  3OYN A;  3K5L A;  1J5O A;  4FJL A;  1RDD A;  1WSI A;  3EYZ A;  1K6Y A;  3ZCM A;  1RTJ A;  4KHQ A;  3K5N A;  2LSN A;  1C6V A;  4PUO A;  3LP0 A;  1RT6 A;  2DFF A;  3AVB A;  3C95 A;  3RWU A;  2IGI A;  4M3Z A;  3DLR A;  4CJP A;  1BQM A;  1RT2 A;  4KAZ A;  2HND A;  2IAJ A;  4R5P A;  3AO5 A;  1XHZ A;  4AHR A;  4BAC A;  4M3W A;  4IFV A;  1VRT A;  4FCY A;  2YKN A;  1TKZ A;  3QIO A;  4E1N A;  4CCH A;  1KLM A;  1QS4 A;  4I9L A;  2KQ2 A;  1WLJ A;  3QIP A;  3O3G A;  4B9T A;  1U49 A;  3CFR A;  3OY9 A;  4BE2 A;  1S1V A;  4KHY A;  3DLB A;  3VQA A;  4Z4I A;  4OKJ A;  4FJ7 A;  3S3O A;  4M3Y A;  3L3V A;  3AVM A;  4LSL A;  1DTQ A;  4DU3 A;  5HBM A;  2XY6 A;  3WNG A;  3OS2 A;  2Y1I A;  2VWK A;  1D8Y A;  1GOB A;  5CZ2 A;  4CFB A;  2ITG A;  5HRS A;  2QKK A;  4DSI A;  4FJX A;  3F9K A;  4CF1 A;  4CFC A;  2G8W A;  3M8S A;  3C6T A;  4KB1 A;  1HNV A;  2R7Y A;  3QES A;  5KGW A;  4H4O A;  4CFD A;  1ZBL A;  1QSS A;  5JS1 A;  4FK0 A;  2IDO A;  4E7K A;  1RTH A;  3U3Y A;  4DSK A;  3ZT2 A;  1BIU A;  3NH2 A;  1VSD A;  4HUG A;  4DTN A;  2HNZ A;  3AVA A;  4Y1D A;  3TAM A;  1IKV A;  4IG0 A;  3ZSO A;  5HRP A;  3HVT A;  4H8K A;  4CHZ A;  2BE2 A;  4FJ5 A;  3HJF A;  5KTQ A;  3L2W A;  3RTV A;  1F21 A;  3OYI A;  4DFJ A;  4OJR A;  3MXI A;  1Z25 A;  4HTU A;  2ZE2 A;  1JLA A;  3V1R A;  3VQ9 A;  4Z4E A;  2Z1G A;  1TKX A;  1RIL A;  4CGI A;  4CK3 A;  1LWC A;  4DSE A;  3K2P A;  2X6N A;  1KFS A;  3WNE A;  5DK5 A;  4BDY A;  4DTS A;  3P83 D;  4RG8 A;  4YFU A;  4KTW A;  3LDS A;  3QEP A;  4KI6 A;  4FW1 A;  3ZSR A;  2HHW A;  1RCH A;  1BIS A;  4YNQ A;  3QEW A;  3DLH A;  4CHN A;  1BI4 B;  3AVC A;  1X1P A;  3AA2 A;  3AO2 A;  3ASM A;  4C8L A;  4ZHR A;  5HRO A;  4M41 A;  1JLQ A;  1Q8I A;  3QEV A;  1ZBH A;  3FFI A;  2HHU A;  2W42 A;  3HPG A;  2RF2 A;  4BWJ A;  4RW7 A;  1S1W A;  4N47 A;  1X9W A;  1CLQ A;  2YHB A;  1RT7 A;  3OYJ A;  3SUO A;  4FJG A;  5FRM A;  1RT1 A;  2P51 A;  1QHT A;  2WON A;  2O4I A;  2DTU A;  3OYB A;  3AO4 A;  1NKE A;  2KFZ A;  4OVL A;  1NOY A;  4WE1 A;  4J2B A;  1XC9 A;  4FM2 A;  4DF8 A;  3AV9 A;  3PY8 A;  2G8V A;  2DFE A;  2Z1H A;  4CJ5 A;  2XY5 A;  4FJK A;  3HK2 A;  3SV3 A;  4LY7 A;  3AVH A;  2G8I A;  4DG1 A;  1WN7 A;  4FLY A;  3SPZ A;  3ZSY A;  4DU4 A;  2Q3S A;  3OYE A;  4OKE A;  3ULD A;  1NJY A;  1BI4 A;  3H08 A;  5I3U A;  1BCO A;  4FJ9 A;  3S3M A;  1C0M A;  1NJX A;  2HW3 A;  2QK9 A;  4CJF A;  3NHG A;  3SCX A;  3ZSZ A;  1KVA A;  2F96 A;  5C24 A;  4DTP A;  4OPJ A;  4TSX A;  3VN5 A;  5KRS A;  5KRT A;  3CM5 A;  3TAN A;  1FXX A;  1KVB A;  1VSK A;  3QLH A;  4FZX C;  4Z4C A;  3ZSV A;  4F4K A;  3U6F A;  3ZT0 A;  2PY5 A;  3I0R A;  5EU7 A;  3LAN A;  4B9V A;  1SKR A;  4Z0U A;  3G10 A;  3AVJ A;  1J53 A;  3LPT A;  3LPU A;  3RMD A;  3TAP A;  1S5J A;  1TK5 A;  2HHQ A;  1JLE A;  3DI6 A;  3DRR A;  2A1S A;  3KJV A;  4NYN A;  4W5O A;  3CQ8 A;  2G8U A;  4J2A A;  1EKE A;  3AVN A;  1IH7 A;  3K5M A;  2Z1J A;  3NAE A;  3VQ4 A;  3D45 A;  3JSM A;  4DSF A;  3QEI A;  3TI0 A;  2WOM A;  1IKW A;  2QKB A;  2B4J A;  4M3R A;  4M42 A;  1MU2 A;  3KD1 E;  2D0A A;  4DMN A;  4HVJ A;  3HXM A;  1X9M A;  3A2F A;  2KFN A;  3DLE A;  4B9N A;  4N76 A;  4FJI A;  2GBZ A;  3IS9 A;  4CEA A;  3SZ2 A;  3F73 A;  1TVR A;  3NCI A;  1TKT A;  1HYZ A;  4CK2 A;  4EP4 A;  1G15 A;  3UIQ A;  3LZI A;  3RMC A;  3SUP A;  1TK0 A;  1LW0 A;  5CZ1 A;  1Q9Y A;  4F3O A;  2X6S A;  4KKO A;  3OYC A;  3DRP A;  4FLU A;  4KHS A;  4PY5 A;  4HHT A;  2XY7 A;  3ZSW A;  1JXE A;  1REV A;  2Z1I A;  2X78 A;  3V1Q A;  1S6Q A;  5C25 A;  1IKY A;  1T8E A;  1L3U A;  4DSJ A;  5KI6 A;  4QAG A;  3I0S A;  1SL1 A;  3AO1 A;  1X9S A;  4DTR A;  1CXQ A;  3VQQ A;  4E19 A;  3HT3 A;  1UAX A;  3PX6 A;  3TAE A;  2B6A A;  1HYS A;  4KHU A;  3OYF A;  4DF4 A;  4I7F A;  1WSH A;  3M8Q A;  3PO4 A;  3S3N A;  3K58 A;  4CGH A;  4RW6 A;  4CJT A;  1WNS A;  2OPP A;  5J2P A;  4N5S A;  1SUQ A;  3D0P A;  3THV A;  1JL1 A;  1TK8 A;  3KK1 A;  2YKM A;  4CF0 A;  3V9Z A;  1GOA A;  2HNY A;  1NKB A;  5DMR A;  4FLT A;  3EY1 A;  2HHX A;  1S1T A;  1TAU A;  3KKS A;  4C8O A;  3M8P A;  1IKX A;  5C42 A;  4CJR A;  1RTD A;  3ITH A;  4GMJ B;  5HLF A;  4FJN A;  3HPH A;  1NK5 A;  1RNH A;  4DTM A;  2RPI A;  4M45 A;  3B6P A;  5J2Q A;  1VSH A;  4K8Z A;  1B9D A;  3V9W A;  4DLE A;  4CEF A;  3V1O A;  4LH5 A;  4CJW A;  1VSL A;  3OYD A;  3KLF A;  4CIE A;  3L2V A;  4OGC A;  3OS1 A;  1KRP A;  4OLB A;  4QCL A;  3HST B;  3OYG A;  1XHX A;  4RW9 A;  1TGO A;  3QNO A;  1I3A A;  4ZTJ A;  1RT3 A;  3VA3 A;  4B9S A;  4I9Q A;  1Z26 A;  4XIU A;  2KTQ A;  4C8N A;  2JGU A;  3OS0 A;  3CFO A;  2HVI A;  2BAN A;  2PZS A;  1BGX T;  4FM1 A;  3SI6 A;  1NK8 A;  1U47 A;  1C0T A;  3QEX A;  1WSG A;  3NF9 A;  3I8D A;  3K59 A;  2F8S A;  2XO7 A;  3L2Q A;  4LD0 A;  3LAM A;  1VK0 A;  4ZTF A;  1JLF A;  4DTU A;  3LWM A;  4F3T A;  1HRH A;  2ZQB A;  3VA0 A;  3T1A A;  1HPZ A;  1T7P A;  4FXD A;  1J9A A;  1LWE A;  1BL3 A;  4AHT A;  1NK4 A;  2FBT A;  3SUN A;  3KK2 A;  3U3G A;  3ZT1 A;  4CER A;  2P5G A;  1S9G A;  1VRU A;  4CE9 A;  4BDZ A;  4H4M A;  4B9M A;  4DQI A;  1XWL A;  2OPQ A;  1QE1 A;  3HPO A;  1JL2 A;  1S1U A;  1TAQ A;  2NUB A;  4HCC A;  3IRX A;  4KV8 A;  5HRN A;  1BCM A;  1C0U A;  3O4N A;  1SL0 A;  3OYH A;  4NCG A;  4O0J A;  4OLA A;  1TV6 A;  1DLO A;  1CZB A;  2D5R A;  1A5X A;  2E6L A;  4CED A;  1QSL A;  3CM6 A;  2IC3 A;  4PA1 A;  1RBU A;  3SPY A;  1NK0 A;  1VSF A;  1ZYQ A;  4KB0 A;  1RDA A;  1Q9X A;  1KCF A;  3KLH A;  4CJK A;  3AVF A;  4QOZ B;  1B9F A;  3KKR A;  3O4Q A;  3AVK A;  4NYF A;  1T05 A;  5HRR A;  3IG1 A;  3L2U A;  1UA0 A;  3V6D A;  4PWD A;  4FK4 A;  1SKS A;  2DY4 A;  4CES A;  4GVM A;  3TWH A;  1ASU A;  3VQE A;  1ZBI A;  4O0I A;  3OYL A;  2RKI A;  4M3X A;  4HUF A;  1RDB A;  2EX3 A;  4LSN A;  3RR8 A;  1EXQ A;  4G1Q A;  2HB5 A;  4KTQ A;  4M3T A;  3NBP A;  1NKC A;  4Z4F A;  1VSI A;  5K14 A;  5E41 A;  1QTM A;  1SL2 A;  2QXF A;  4MQ3 A;  4CGF A;  1NJZ A;  3O3H A;  3TAG A;  4KHW A;  4CF8 A;  3RMA A;  1KSP A;  3IAY A;  1RBS A;  4CJS A;  2F8T A;  4FLZ A;  4FJJ A;  1VSJ A;  2VG5 A;  1FK9 A;  2E6M A;  4I2Q A;  3O3F A;  2HHT A;  2G8H A;  4CEO A;  4W5R A;  3KLG A;  3OYM A;  5JS2 A;  4FJM A;  4E7I A;  2XY8 A;  3PV8 A;  4KRF A;  1YVU A;  3AVL A;  3NFA A;  1N5Y A;  3TAR A;  1T03 A;  3DOK A;  2PYJ A;  3RR7 A;  1NK6 A;  3HL8 A;  3MEG A;  1KVC A;  4CJ4 A;  1JLB A;  3JYT A;  3DYA A;  4C8M A;  3QIN A;  2X74 A;  3M8R A;  3T3F A;  4CEC A;  1U4B A;  1KLN A;  4LH4 A;  4CJE A;  4GW6 A;  4HCB A;  1UOC A;  4DQS A;  2D0C A;  1JLG A;  3VQP A;  5J1E A;  3ISN C;  4AHS A;  4BE1 A;  2EHG A;  4B8A B;  1RBR A;  1BIZ A;  1LAW A;  3L3U A;  3P5J A;  4W5T A;  3EZ5 A;  4B08 A;  3V81 A;  3HM9 A;  3HYF A;  3AA4 A;  3KIO A;  4B9U A;  4CJV A;  4F2S A;  4IDK A;  3SYZ A;  4BDP A;  1IG9 A;  2OYQ A;  2JLE A;  3VQ5 A;  4DWI A;  2XRI A;  4KO0 A;  1VSM A;  2OPS A;  1HMV A;  4OPK A;  3NGZ A;  3SV4 A;  3SQ2 A;  3NGY A;  4Z4H A;  4DQR A;  4FLV A;  4DTX A;  4E7J A;  3TAF A;  4DQQ A;  4C8K A;  4FK2 A;  3MAQ A;  1S9E A;  1WAF A;  3TR8 A;  3QET A;  2KW4 A;  4ELT A;  4IFY A;  4IG3 A;  1ASV A;  4IBN A;  3VQ8 A;  4E1M A;  3LP1 A;  4CGG A;  1DTT A;  4NCB A;  1RTI A;  3TAB A;  4DSL A;  1HYV A;  4NCA A;  2HHV A;  1CZ9 A;  4OGE A;  3KD5 E;  1CXU A;  5FDL A;  2G8K A;  4O44 A;  5CY4 A;  3VQC A;  3T19 A;  2PYL A;  2Y1J A;  3V4I A;  3MXM A;  3OJU A;  3NE6 A;  1BHL A;  4CIF A;  1YTA A;  5CYQ A;  3NH1 A;  4ID5 A;  2IS3 A;  1NOZ A;  4RW8 A;  2VWJ A;  1YTU A;  3K5O A;  1HQU A;  3KLE A;  1HQE A;  3P1G A;  2P1J A;  3HP6 A;  1J54 A;  2FC0 A;  4JRP A;  2FBX A;  1N6Q A;  2OZS A;  4F2R A;  3OJS A;  3V9S A;  4FYD A;  4JS5 A;  3MED A;  4CEZ A;  3BGR A;  3LAL A;  3NDK A;  4KPY A;  5FRN A;  4W5Q A;  1SV5 A;  3E01 A;  2KZZ A;  3DOL A;  3QER A;  1NK9 A;  4W5N A;  3HVR A;  4FJ8 A;  1B92 A;  1D9F A;  2YNG A;  4DTJ A;  4K8X A;  3BDP A;  2BGG A;  3PUF A;  1RT5 A;  4ID1 A;  3LP3 A;  3ZSQ A;  5HP1 A;  3OYA A;  3V9U A;  1NJW A;  4CK1 A;  4AHV A;  4ELV A;  4DS4 A;  5FRO A;  3VQ6 A;  4CGD A;  1W0H A;  2DFH A;  4JS4 A;  4UQG A;  4DQP A;  2OA8 A;  2YHA A;  4DS5 A;  2HMI A;  3DM2 A;  3DMJ A;  4O55 A;  4EZ6 A;  4EP5 A;  5J2N A;  3LAK A;  3CG7 A;  2OZM A;  4O5B A;  5J2M A;  1RBV A;  1TL3 A;  1RBT A;  5KGX A;  4PQU A;  3WNH A;  1C1A A;  3SQ0 A;  1TKD A;  2FBY A;  4OKK A;  4CJU A;  4Q5V A;  1EET A;  4CHY A;  2YNF A;  4E7H A;  2A1R A;  2G8F A;  4J2E A;  3AVI A;  4KI4 A;  3C94 A;  3RRH A;  4AIL C;  4AHC A;  3V9X A;  3SNN A;  2BDP A;  4CEE A;  3VQD A;  3ZSX A;  1LV5 A;  2GUI A;  4RW4 A;  1QSY A;  1RT4 A;  1U45 A;  4EZ9 A;  3MEE A;  5I42 A;  3ZT4 A;  3KK3 A;  3DLK A;  3SJJ A;  4Y1C A;  3OYK A;  3L2R A;  4DLG A;  4CJL A;  4E0D A;  4BE0 A;  1NK7 A;  3NH0 A;  3LWL A;  1D9D A;  1WAJ A;  4DU1 A;  3QNN A;  1VSE A;  2YNI A;  4E89 A;  4DFK A;  3RMB A;  1BQN A;  3AA5 X;  4CHP A;  4E3S A;  3SQ4 A;  4FJH A;  1C1B A;  3WNF A;  2RN2 A;  1UA1 A;  4FM0 A;  1JLC A;  4FZY A;  4FLX A;  3NF8 A;  2YNH A;  1FKP A;  1QQC A;  1S6P A;  4E7L A;  2GV9 A;  1GOC A;  4KTZ A;  3HP9 A;  4AH9 A;  3SQ1 A;  3NGI A;  3DRS A;  1SKW A;  2P5O A;  4MFB A;  1IO2 A;  3VQB A;  1O1W A;  1WSJ A;  1ITG A;  4IKF A;  2KZM A;  1TL1 A;  1I39 A;  3ZT3 A;  4JLH A;  4CEB A;  4B9L A;  3MEC A;  3VQ7 A;  3L8B A;  4B8C A;  3S9H A;  1LWF A;  1RDC A;  1KFD A;  1WSF A;  3ALY A;  4N56 A;  3K57 A;  4CF9 A;  4F8R A;  3HO1 A;  1C1C A;  4CFA A;  3LZJ A;  2ATQ A;  1XI1 A;  1U48 A;  4Z4G A;  4DTO A;  2E4L A;  1WSE A;  1ZBF A;  2FBV A;  2VG6 A;  1HJR A;  4AHU A;  4JRQ A;  5T7B A;  3B6O A;  4CHQ A;  4DFM A;  3CYM A;  4KRE A;  2XHB A;  3AA3 A;  2OPR A;  1W9H A;  1A5W A;  1YT3 A;  1L3S A;  2AJQ A;  3C6U A;  1EP4 A;  1ZBU A;  3CFP A;  4ELU A;  1A5V A;  1UWB A;  2ZD1 A;  1ASW A;  3DLG A;  4FVM A; 
#chains in the Genus database with same CATH topology
 1T44 A;  3FFK B;  1LW2 A;  1X9J A;  3OVN A;  2NRT A;  4KFB A;  4PKG A;  4BRF A;  1L5U A;  2O4G A;  1VQN N;  3KLI A;  3PO5 A;  4DFP A;  2YV0 X;  4J2D A;  1JXB A;  1FKO A;  3H46 O;  5JLF A;  3KTQ A;  3AVG A;  5JLH A;  4K0K K;  1Q82 O;  1YHQ N;  1KTQ A;  3CJ7 A;  5I9E B;  4HUE A;  4N41 A;  4F9O A;  4JN4 A;  5SWM A;  2D0B A;  3J7Y P;  4OLA A;  3G4S N;  1K8K A;  4PUO A;  3ZET B;  4H0P A;  3RWU A;  3DLR A;  1MDU B;  2W6L A;  3TPQ A;  3BY5 A;  4FCY A;  3SBG A;  5AQX A;  4E1N A;  1KLM A;  5CR4 A;  4CZH A;  2KQ2 A;  3UKU A;  3VEY A;  3CFR A;  4C1N K;  3FR0 A;  3CJB A;  3DLB A;  2IVO A;  4JK8 A;  2O8C B;  4M3Y A;  3AVM A;  3HTV A;  1N8R O;  3OA9 A;  1D8Y A;  1GOB A;  4B1U B;  1QVF M;  2ITG A;  5HRS A;  4FJX A;  5AQO A;  4IEI A;  1U2V A;  3M8S A;  1ZBL A;  5JS1 A;  1BA1 A;  2FSJ A;  4E7K A;  3O9T A;  4DSK A;  4DR1 K;  4PHT X;  1VQL N;  3MX2 A;  4DTN A;  3AVA A;  4Y1D A;  3TAM A;  5HRP A;  4H8K A;  4CHZ A;  5AQH A;  3L2W A;  3RTV A;  1K8A O;  1T3V A;  4MO4 A;  1Z25 A;  4Z94 A;  4HTU A;  3VQ9 A;  4FOE A;  1TKX A;  3THY A;  4BDY A;  1YUW A;  4RG8 A;  4YFU A;  4KTW A;  3O9Q A;  3LDS A;  1SS6 A;  1YVN A;  3O1B A;  3AVC A;  3ZLJ A;  2P9U A;  3AO2 A;  2QW9 A;  3HI0 A;  5HRO A;  4MO5 A;  1JLQ A;  1Q8I A;  4LF8 K;  3E9O A;  2HHU A;  2W42 A;  2RF2 A;  1CLQ A;  5JIC A;  1K73 O;  2UXC K;  3SUO A;  3MCP A;  4G9Z A;  2KFZ A;  1LCU A;  1ATN A;  4YOX A;  3PY8 A;  4CJ5 A;  4FJK A;  4BGA A;  1N36 K;  2P9L A;  3IKM A;  1NGE A;  3SPZ A;  4DV3 K;  3ZSY A;  3OYE A;  3S41 A;  1BI4 A;  3NHG A;  1KVA A;  5BPN A;  5C24 A;  3TAN A;  1KVB A;  3KWG A;  3TTF A;  3GG4 A;  3THW B;  2KKZ A;  3TAP A;  3LPU A;  1J53 A;  3DRR A;  3CQ8 A;  2G8U A;  4BR2 A;  4XH4 A;  3KHY A;  1EKE A;  1IH7 A;  4DSF A;  3VQ4 A;  3D45 A;  3QEI A;  2WOM A;  1IKW A;  3G71 N;  2B4J A;  3R3L A;  3LL3 A;  2J4R A;  3KD1 E;  2CGJ A;  4A57 A;  4B9N A;  4N76 A;  3IS9 A;  4JI5 K;  3SZ2 A;  3NCI A;  2Q31 A;  1BWF O;  3SUP A;  3PSF A;  4F3O A;  4KKO A;  4KHS A;  1OH6 A;  3D2F B;  4JD2 A;  4QAG A;  3HOS A;  1SL1 A;  3VPZ A;  5AQR A;  4DTR A;  3HT3 A;  3O9R A;  4A2B A;  2B6A A;  4KHU A;  4JKG B;  2E2P A;  5BRF A;  3K58 A;  2ZJQ L;  2P9P B;  1WNS A;  1G99 A;  2W41 A;  2YKM A;  4CF0 A;  3V9Z A;  1GOA A;  2HNY A;  1NKB A;  1NGD A;  5KPR A;  3UKR B;  3N4P A;  5C42 A;  3BZK A;  5GIN A;  4HWI A;  4GMJ B;  4FJN A;  1NK5 A;  3V9W A;  1YJW N;  4OGC A;  3OYG A;  2V52 B;  1NMN A;  4ZTJ A;  1Q18 A;  4YHH K;  1RT3 A;  3AAP A;  3MN6 A;  1Z26 A;  2KTQ A;  3O08 A;  4YDU A;  4B9Q A;  2BAN A;  1D4X A;  2F8S A;  3NF9 A;  3K59 A;  3J81 O;  4BRM A;  4JKA A;  4LD0 A;  4F3T A;  3CMA N;  3VA0 A;  3T1A A;  1HPZ A;  3IDH A;  1J9A A;  3BUZ B;  4YOR A;  1LWE A;  3SMP A;  1YXQ A;  4OX9 K;  5FPE A;  4AM6 A;  3U3G A;  4A5B A;  3VTI A;  1S9G A;  4DQI A;  1NBW A;  1XWL A;  1YIJ N;  1QE1 A;  1EWQ A;  1S1U A;  5M1N A;  3IRX A;  4IOX A;  3H6E A;  5AQZ A;  3OYH A;  1T6D A;  4NCG A;  1TV6 A;  1DKG D;  2VYP A;  1A5X A;  4BR7 A;  4CED A;  1QSL A;  3CM6 A;  1NGG A;  2GWJ A;  1RBU A;  3T1H K;  3SPY A;  4KB0 A;  1O13 A;  1NJI O;  1Q9X A;  2QEX N;  3KLH A;  3D7E O;  3AVK A;  1DEJ A;  4IXC A;  2DY4 A;  3WEE B;  4JI2 K;  2E8A A;  3MMV A;  3VQE A;  3VF6 A;  4M3X A;  3A5M C;  5AJ3 K;  3GL1 A;  4LSN A;  3VES A;  1EXQ A;  1YIT N;  3RR8 A;  2HB5 A;  1WUA A;  4KTQ A;  1VSI A;  5E41 A;  3C7N B;  4KH4 A;  2EWS A;  4BC2 A;  2UUC K;  2P9S A;  3I55 N;  1HJO A;  3RMA A;  3H45 C;  3LDO A;  2E6M A;  4FWO A;  1HR0 K;  4RTF D;  2QI2 A;  4FJM A;  4E7I A;  3PV8 A;  1YVU A;  3DOK A;  1HPM A;  1NGC A;  4X65 K;  3HZ6 A;  4NXN K;  4CEC A;  1U4B A;  1KLN A;  4HCB A;  2D0C A;  3ID8 A;  1BIZ A;  1LAW A;  3L3U A;  4B08 A;  3HYF A;  3SYZ A;  4BDP A;  4CVN E;  2OYQ A;  2JLE A;  1NWK A;  3VQ5 A;  3SV4 A;  3SQ2 A;  2WUS A;  5F1X A;  4CZL A;  3HM8 A;  3TAF A;  1WAF A;  3LDP A;  4IG3 A;  1HKC A;  4I6M B;  1MWK A;  1RTI A;  4OGE A;  5HOO A;  4H0T B;  3E9P A;  4O44 A;  3VQC A;  1YJ9 N;  3T19 A;  2O8B A;  3CPW M;  1YTA A;  4JKC A;  3L4I A;  3O1W A;  3AAQ A;  3NH1 A;  5AR0 A;  3K5O A;  1GLF O;  1HQE A;  1BA0 A;  5FPD A;  3HP6 A;  1J54 A;  2FBX A;  2OZS A;  3MED A;  4RCH A;  3NDK A;  4KPY A;  5FRN A;  4AM7 A;  4XEI A;  4IJA A;  1M1K O;  3EE8 A;  1MA9 B;  1B92 A;  1TYQ A;  4JI1 K;  4ID1 A;  3I8B A;  3ZSQ A;  2VCP A;  4JKE A;  3OBW A;  4AHV A;  4CGD A;  1W0H A;  4JS4 A;  3H1Q A;  3VOV A;  2YHA A;  4CBX A;  4KH6 A;  3DM2 A;  1QHA A;  4O55 A;  5J2N A;  3VGL A;  4O5B A;  5J2M A;  1OKJ A;  1Z05 A;  3NVK A;  4CHY A;  4E7H A;  2G8F A;  2QWN A;  2QTD A;  2BDP A;  1GLC G;  1LV5 A;  3ENB A;  4RW4 A;  1QSY A;  2P9I A;  5I42 A;  1KXP A;  5C10 A;  3ENH A;  4Y1C A;  3CC2 N;  3NH0 A;  4DU1 A;  4BY9 C;  2YNI A;  5FLX O;  2AP1 A;  2OCE A;  3ZEU A;  1BQN A;  5MLC Q;  2AA4 A;  3DAW A;  3EL2 A;  2QM1 A;  3Q7B A;  1WSJ A;  4FPB A;  1TL1 A;  1I39 A;  4JLH A;  4CEB A;  3L8B A;  3S9H A;  3K57 A;  2W40 A;  1VQ4 N;  2ITM A;  4F8R A;  3VEW A;  2GWK A;  4BVP A;  2ATQ A;  5M1Q A;  4JI6 K;  1XI1 A;  1WSE A;  2HF4 A;  2UUB K;  3TTC A;  1W9H A;  5TKW A;  1A5W A;  1IG8 A;  2VWK A;  1ASW A;  1U45 A;  3DLG A;  3CME N;  4JI7 K;  3MX5 A;  3RSE B;  4BWM A;  4I2P A;  4JK9 A;  2FF3 B;  3SAG A;  2I5J A;  4LF4 K;  3WXJ A;  3FZK A;  3PX0 A;  3MN9 A;  2HVH A;  1L3V A;  3NF6 A;  4FLW A;  2O8D B;  4H03 B;  4CF2 A;  2YCH A;  2B5J A;  4L8R B;  4FZZ A;  1Y64 A;  4FW2 A;  3MXJ A;  3TAQ A;  4CJQ A;  5ADX H;  1D9F A;  1LAV A;  4FJL A;  1J5O A;  1S1X A;  5AQU A;  1QZ5 A;  1WSI A;  2NRZ A;  1K6Y A;  2VQF K;  4KHQ A;  1C6V A;  3JAM O;  2ZF5 O;  1W7A A;  2IGI A;  4IZ9 A;  1XMQ K;  2HBL A;  3SBT A;  4M3Z A;  1RT2 A;  1VQ7 N;  3CCQ N;  4BAC A;  5AQF A;  1TKZ A;  4CCH A;  1SAZ A;  4BE2 A;  4OKJ A;  4FJ7 A;  3OS2 A;  1XC3 A;  2VGN A;  4OPH A;  4CF1 A;  4CFC A;  3C65 A;  3FZH A;  1HNV A;  3FZL A;  5KGW A;  3EEQ A;  3ULE B;  1HX1 A;  1RTH A;  3HRG A;  4NLB A;  1VSD A;  3ZX3 A;  4V19 S;  4M7X A;  2HNZ A;  3CCU N;  3HBT A;  1DGK N;  3ZSO A;  5AQJ A;  2BE2 A;  3HJF A;  5KTQ A;  1RDW X;  4FWL A;  3OYI A;  4BRN A;  4DFJ A;  3MXI A;  3ENO A;  5GAH P;  1JLA A;  3E1Y A;  4Z4E A;  3O80 A;  1RIL A;  1ATR A;  3DXK B;  1LWC A;  2X6N A;  1KFS A;  4DTS A;  3P83 D;  2H3G X;  4KI6 A;  3L6Q A;  1BIS A;  4YNQ A;  3DLH A;  1ATS A;  1ESV A;  1X1P A;  4ISE A;  2HHH K;  4ZHR A;  4M41 A;  1JCG A;  4EHU A;  3FFI A;  4BWJ A;  1S1W A;  1RT7 A;  3EKS A;  4LFC K;  2P51 A;  1QHT A;  1NKE A;  5GIO A;  2PBD A;  1XC9 A;  1VQP N;  4FM2 A;  1Q7Y O;  3HK2 A;  2Z1H A;  4LY7 A;  2G8I A;  4DG1 A;  3CJC A;  4FLY A;  4WCE L;  4DU4 A;  2Q3S A;  3ULD A;  1NJY A;  5FPM A;  3H08 A;  2ASO A;  3S3M A;  2E1Z A;  2HW3 A;  4YOT A;  3SCX A;  1T05 A;  4BC5 A;  5KRT A;  5KPZ A;  3QLH A;  3FZF A;  3UB5 A;  4CBW A;  3U6F A;  3I0R A;  5C2D A;  1SKR A;  3RMD A;  2HHQ A;  1S5J A;  3DI6 A;  3AVN A;  2QWR A;  2Z1J A;  2F9W A;  2UYT A;  4FWQ A;  2GX9 A;  3MWT A;  3A5N C;  3HXM A;  3A2F A;  2KFN A;  3DLE A;  4C23 A;  2GBZ A;  4CEA A;  2GEL A;  1TVR A;  1VHX A;  4EP4 A;  3LZI A;  3C6A A;  3RMC A;  1YJN N;  1LW0 A;  2CH6 A;  5AZJ B;  2CGK A;  1NMD A;  3ZSW A;  4JHD A;  1FJG K;  1S6Q A;  1L3U A;  4DSJ A;  4CJ7 A;  1X9S A;  1CXQ A;  2NZT A;  3VQQ A;  4LF9 K;  2HF3 A;  1I94 K;  3TAE A;  2ZJP L;  5C15 A;  4DF4 A;  4H5R A;  5AQT A;  4QS7 A;  5BN8 A;  5LJW A;  2OPP A;  5J2P A;  3THV A;  4J8F A;  4DR4 K;  1TK8 A;  3KK1 A;  1JJ2 M;  4CZG A;  3CCM N;  5DMR A;  2NLX A;  5EX5 A;  1TAU A;  3CIP A;  4C8O A;  2DPN A;  1IKX A;  3O9S A;  4M45 A;  3CI5 A;  4K8Z A;  3KLF A;  4LH5 A;  1T7P A;  1VSL A;  4CIE A;  4QCL A;  1XHX A;  4I9Q A;  3QNO A;  4H0X B;  2NRW A;  4XIU A;  3CFO A;  1MWM A;  1X3N A;  4DV6 K;  2PZS A;  5B8H A;  1NK8 A;  4BQL A;  3DXM B;  3IMX A;  2XO7 A;  4EHT A;  3LAM A;  4ZTF A;  1JLF A;  3LWM A;  5F0X A;  2ZQB A;  3QML A;  3O9U A;  4IOA L;  1NK4 A;  4Y0W A;  3LDL A;  3T1Y K;  3M6G A;  2OPQ A;  2NUB A;  4MDA A;  4HCC A;  2WTU A;  5KQ8 A;  3O4N A;  5E26 A;  1SL0 A;  1ZC6 A;  5TKY A;  4O0J A;  4JEP A;  1CZB A;  2E6L A;  2IC3 A;  1NK0 A;  1RDA A;  2V7Z A;  5AQQ A;  1HKB A;  3MDQ A;  3O4Q A;  4NYF A;  3LDN A;  5AQP A;  5HRR A;  3W3D A;  1UA0 A;  3V6D A;  5EY4 A;  4FK4 A;  2JWL A;  4CES A;  1ASU A;  4K41 A;  4O0I A;  1ZBI A;  4DR7 K;  3OYL A;  4U67 L;  3A5L C;  3NBP A;  5LJV A;  4Z4F A;  2PFU A;  1QTM A;  3AAR A;  4PKH A;  3TAG A;  4KHW A;  4CF8 A;  3WUH A;  3IAY A;  1RBS A;  2F8T A;  4FLZ A;  4JKH A;  3ATU A;  4CZE A;  4I2Q A;  2WBN A;  4KRF A;  3NFA A;  1EWR A;  4FO0 A;  3HL8 A;  4PKI A;  4O8K A;  1KVC A;  2HBM A;  3JYT A;  1KC8 O;  3QIN A;  3M8R A;  2A42 A;  3I56 N;  4CJE A;  2YJF A;  4GW6 A;  1UOC A;  4DR5 K;  4DQS A;  1JLG A;  2BH1 A;  3FGU A;  3THX A;  5C2F A;  4B9U A;  4F2S A;  1IG9 A;  4DWI A;  2XRI A;  4KO0 A;  3CPE A;  4Z4H A;  4O8U A;  4AF1 A;  4FLV A;  4DTX A;  4E7J A;  2CGL A;  4DQQ A;  1S9E A;  2P9N B;  1Z6R A;  4E1M A;  3VQ8 A;  5KQD A;  4A61 A;  3LP1 A;  3VGK A;  2NRH A;  5AZI B;  4BG9 A;  2O8E A;  2P9K A;  3TAB A;  4DSL A;  2HHV A;  1CZ9 A;  4BRC A;  1CXU A;  4LFA K;  2G8K A;  3MXM A;  4WQ5 C;  4MDB A;  1BHL A;  4CIF A;  4ID5 A;  3CJA A;  4WFB L;  1ZXO A;  1IJJ A;  4IOC L;  1NM1 A;  2P1J A;  3P1G A;  3TTD A;  2FC0 A;  4F2R A;  3V9S A;  3A0I X;  3BGR A;  1VQO N;  1SV5 A;  3E01 A;  3K9J A;  3QER A;  5AFU A;  4W5N A;  3DWL A;  4BRG A;  1XUP O;  3V9U A;  1NJW A;  5LMN K;  4CK1 A;  2QWP A;  5GAG P;  2RE2 A;  4EP5 A;  2O8F B;  3KK7 A;  4X66 K;  1RBV A;  1RBT A;  4PQU A;  3WNH A;  4O5F A;  4XH5 A;  2A1R A;  4BRH A;  3AVI A;  4BRA A;  4WFA L;  2GUI A;  4KBO A;  3JS6 A;  2UU9 K;  3WQU A;  3AGR A;  4DLG A;  3QIC A;  1N32 K;  3QB0 A;  1D9D A;  4H5W A;  3QNN A;  4A62 A;  3RMB A;  3FE1 A;  4CHP A;  3CQY A;  3WNF A;  1UA1 A;  4FM0 A;  3NF8 A;  1FKP A;  1S6P A;  3U8X A;  4AH9 A;  1ZBS A;  2QA4 N;  1IO2 A;  1ITG A;  4IKF A;  3MEC A;  3VQ7 A;  3A8Y A;  5AQY A;  4YOU A;  1LWF A;  4N56 A;  3LZJ A;  3MN7 A;  4Z4G A;  2VG6 A;  5EXW A;  2FBV A;  5EVZ A;  3AY9 A;  4DFM A;  4LC9 B;  3BF1 A;  3CYM A;  3KZB A;  4KRE A;  3AA3 A;  3D2E A;  4DR3 K;  1ZBU A;  5BR8 K;  4ELU A;  1UWB A;  3OTO K;  4DTP A;  1NLV A;  3VF2 A;  4LFB K;  1K8K B;  3PX4 A;  1HNI A;  1EX4 A;  4GY2 B;  3G6E N;  3SUQ A;  5CYM A;  5BPM A;  1W2B M;  3MN5 A;  1U04 A;  3RRG A;  1NGJ A;  4NO7 A;  4O4G A;  3LP2 A;  1NU0 A;  1D5A A;  2KLA A;  3VMF B;  4M3U A;  4CHO A;  1E4G T;  3TSQ A;  3UKU B;  1L3T A;  4DV1 K;  1JKH A;  1VQM N;  3G0Z A;  4CEQ A;  4ICL A;  3OYN A;  2OTL N;  1RDD A;  3D6R A;  3ZCM A;  4JKF A;  2LSN A;  3K5N A;  1RT6 A;  2DFF A;  1U2V B;  3C95 A;  1FW6 A;  1T6C A;  4FWR A;  4CJP A;  2HND A;  1CZA N;  4R5P A;  1XHZ A;  4AHR A;  2GUP A;  4E1J A;  3GBT A;  4M3W A;  3SAH A;  5LL6 Z;  1VQ5 N;  4PL8 A;  3O6W A;  3QIO A;  4BC4 A;  4WYB A;  1QS4 A;  4I9L A;  1WLJ A;  4B9T A;  1U49 A;  3KVG A;  4KHY A;  1NGI A;  4JYA K;  2E2Q A;  5E84 A;  4H5V A;  3S3O A;  3L3V A;  4LSL A;  3CCV N;  3THY B;  3Q7C A;  3WNG A;  5CZ2 A;  2QKK A;  3J80 O;  3ZET A;  4OO1 J;  3F9K A;  2FF6 A;  3R6M A;  2R7Y A;  3CCJ N;  2P9U B;  4H4O A;  4GKK K;  4FK0 A;  2HOE A;  2IDO A;  4BRD A;  3CJ1 A;  3ZT2 A;  3BF3 A;  4HUG A;  4H0O A;  3HVT A;  1BO5 O;  2F4V K;  1QQO A;  4FJ5 A;  3VEN A;  3P39 A;  3P4I A;  3SJH A;  5DM7 L;  3V1R A;  2A3Z A;  4CK3 A;  3J7Z O;  2UXD K;  2O8C A;  5LMU K;  3K2P A;  3WXL A;  3JXU A;  3WNE A;  5DK5 A;  1JCF A;  2P9L B;  1KAZ A;  3QEP A;  3ZSR A;  3EE9 A;  4YOV A;  4M63 C;  3QEW A;  1BI4 B;  4IO8 A;  3ASM A;  4CZJ A;  3QEV A;  1BU6 O;  2BUP A;  2FLO A;  2QWL A;  4RW7 A;  2OAN A;  2WFB A;  2YHB A;  3OYJ A;  3ZYY X;  4FJG A;  1RT1 A;  2O4I A;  3OYB A;  3AO4 A;  3MCA B;  1YF5 L;  4NLC A;  3TU5 A;  2G8V A;  2DFE A;  3SV3 A;  4LF6 K;  1WN7 A;  2Q36 A;  3C6H A;  2I7P A;  1BCO A;  1V4S A;  1NJX A;  2BTF A;  4B3M K;  2F96 A;  3CCR N;  4TSX A;  3E9L A;  3CM5 A;  5F2R A;  4FZX C;  1VSK A;  4GV6 A;  4Z4C A;  3ZSV A;  4F4K A;  3ZT0 A;  5EU7 A;  1N34 K;  4B9V A;  1TK5 A;  3LPT A;  4JD2 B;  2YJE A;  3NMU A;  2A1S A;  4J2A A;  3K5M A;  3TI0 A;  3JSM A;  1KQS M;  1YI2 N;  1MU2 A;  1OVY A;  2D0A A;  4HVJ A;  1X9M A;  1VQK N;  2ASP A;  2FSN A;  4JI0 K;  2YHW A;  3H3N O;  1HYZ A;  4CK2 A;  4ILJ A;  3UIQ A;  4FVU A;  4IFE A;  1TK0 A;  4IO9 L;  1Q9Y A;  4FLU A;  1KAY A;  3DRP A;  3THW A;  5BRD A;  4PY5 A;  4HHT A;  4BRP A;  2XY7 A;  3V1Q A;  1REV A;  1T8E A;  2X78 A;  5C25 A;  1IKY A;  3K0S A;  5KI6 A;  3I0S A;  4BR5 A;  4E19 A;  3QFP A;  1IV0 A;  3PX6 A;  4I7F A;  1WSH A;  4BRE A;  1BUP A;  3PO4 A;  1EO1 A;  3S3N A;  2VGM A;  3WXI A;  4CJT A;  3CCL N;  1SUQ A;  3D0P A;  1JL1 A;  1ILY A;  2ZGY A;  2YI1 A;  4FLT A;  2HHX A;  1S1T A;  4ISF A;  4ILH A;  3M8P A;  5BR9 A;  3HPH A;  3SMS A;  1RNH A;  2UXB K;  3B6P A;  5J2Q A;  5C12 A;  2IVP A;  4CEF A;  3V1O A;  4CJW A;  1KRP A;  3L2V A;  3D2F A;  4OLB A;  4GV3 A;  1TGO A;  1I3A A;  5AQL A;  4B9S A;  4JKG A;  1C0G A;  1VAZ A;  3L0Q A;  2HVI A;  4IJN A;  1BGX T;  2P9P A;  3M5R A;  1U47 A;  1C0T A;  1WSG A;  4DCH A;  3G25 A;  1S72 N;  3OHR A;  1VK0 A;  4JKB A;  1HRH A;  4FXD A;  3UKR A;  4AHT A;  2FBT A;  2Q0U A;  2YHY A;  3J8A A;  3SUN A;  2P5G A;  3PIP L;  4BDZ A;  4B9M A;  2QWO A;  3HPO A;  1TAQ A;  1C0U A;  4DHY A;  2P9S B;  3LM2 A;  4DKW A;  1DLO A;  3OBY A;  4PA1 A;  1VSF A;  1ZYQ A;  1KCF A;  4JI3 K;  3KWI A;  3AVF A;  4QOZ B;  3KKR A;  4FPA A;  3C0B A;  3F9M A;  3IG1 A;  3TSP A;  5AQM A;  3L2U A;  4PWD A;  4GVM A;  4OPA A;  1NGB A;  4FWP A;  1RDB A;  2EX3 A;  4HUF A;  2UUA K;  3T7Z A;  4H5T A;  4M3T A;  1NKC A;  5CE3 A;  3CHW A;  5IT9 O;  2GTD A;  3WXM B;  1SL2 A;  2QXF A;  4MQ3 A;  4CGF A;  1NJZ A;  4C1N I;  1KSP A;  2D0O A;  1E3M A;  4CJS A;  1FK9 A;  3QBX A;  5BRE A;  2G8H A;  4CEO A;  4CI6 A;  4U7B A;  3OYM A;  3KLG A;  4DUY K;  5JS2 A;  1T03 A;  2PYJ A;  3RR7 A;  1NK6 A;  3WEE A;  4B3R K;  3DJC A;  3MEG A;  4BRO A;  4CJ4 A;  1R59 O;  3OW2 M;  4CBU A;  4AQY K;  3R1X A;  3DYA A;  4C8M A;  2X74 A;  1N33 K;  4LH4 A;  4L3Q A;  3VQP A;  2O8B B;  3C7N A;  3ISN C;  3LM9 A;  4B1Z A;  2EHG A;  4CZM A;  1RBR A;  4FSV A;  5J1E A;  4W5T A;  3P5J A;  3F5T A;  4BR4 A;  3HM9 A;  2QXL A;  3KIO A;  4IDK A;  4EFH A;  2OPS A;  1HMV A;  4OPK A;  3NGZ A;  3NGY A;  4B1X B;  4DUZ K;  4C8K A;  4FK2 A;  4ILG B;  3QET A;  4ELT A;  1ASV A;  1QZ6 A;  4CGG A;  1HYV A;  2ZGZ A;  3KD5 E;  1QQN A;  5BRH A;  1RDU A;  1TYQ B;  3PIO L;  5FDL A;  2PYL A;  2Y1J A;  3V4I A;  3OJU A;  3NE6 A;  3O4W A;  4YDU C;  5ELZ A;  4RWT A;  2IS3 A;  4RW8 A;  2VWJ A;  1HQU A;  3KLE A;  2A40 A;  1BOT O;  4JRP A;  1N6Q A;  3OJS A;  3H3O B;  4JNE A;  4FYD A;  3ZX0 A;  4JS5 A;  4CEZ A;  4JAX A;  5FPN A;  4I6M A;  1OH5 A;  4X64 K;  1P90 A;  1NK9 A;  5AQG A;  2P9I B;  5AQS A;  4FJ8 A;  4K8X A;  4DTJ A;  3PLA A;  3BDP A;  3VTH A;  2ZJR L;  1GLL O;  3LP3 A;  3QDK A;  2E2N A;  5H1S Q;  5FRO A;  3VQ6 A;  2DFH A;  2FXU A;  5HL7 L;  4DQP A;  3R9P A;  3ZEU B;  4DS5 A;  3DMJ A;  4EZ6 A;  3LAK A;  5JVG L;  1XMO K;  2OZM A;  4X62 K;  1TL3 A;  5KGX A;  2NRR A;  3SQ0 A;  1TKD A;  4OKK A;  4CJU A;  4Q5V A;  3CCS N;  4KI4 A;  3C94 A;  5JVH L;  3RRH A;  1GLJ O;  3O5B A;  1IBM K;  1HLU A;  3ZSX A;  3M1F A;  3MEE A;  3WXK A;  4H0V B;  3ZT4 A;  1GLE G;  4CD3 A;  3SJJ A;  3WQT A;  2F9T A;  3CC4 N;  5AQK A;  1WAJ A;  1VSE A;  4E89 A;  4DFK A;  2A6A A;  3AA5 X;  4ISG A;  2RN2 A;  4FZY A;  4FLX A;  4YOW A;  2YNH A;  5ADX A;  4E7L A;  2GV9 A;  1GOC A;  3CQX A;  3HP9 A;  1OVQ A;  3SQ1 A;  3NGI A;  3DRS A;  1SKW A;  2P5O A;  3VEO A;  1TUY A;  3ZT3 A;  2JWK A;  4B9L A;  1VQ6 N;  4B8C A;  1WBD A;  1RDC A;  1WSF A;  1KFD A;  3ALY A;  3HSC A;  3HO1 A;  1C1C A;  4CFA A;  1RFQ A;  1U48 A;  4GVE A;  1HJR A;  4XH1 A;  3VEV A;  5T7B A;  4CHQ A;  2XHB A;  4DV7 K;  2OPR A;  4NB4 A;  1L3S A;  1YT3 A;  5M1P A;  1GLD G;  1EP4 A;  3CFP A;  2IVN A;  4R79 A;  1XNR K;  1R0A A;  3NF7 A;  4WF9 L;  4Q0B A;  3QO9 A;  1U6Z A;  4CJ3 A;  4JV5 K;  4WQ4 A;  4CZI A;  2HHS A;  2VG7 A;  4BR9 A;  4B3O A;  1OH8 A;  1HNX K;  4K25 A;  4B1V A;  5D3G A;  4BG8 A;  3AO3 A;  4B3T K;  1NGA A;  4CIG A;  4CGJ A;  4KHN A;  4CD1 A;  1J6Z A;  3ATV A;  4CZK A;  4DV0 K;  2IOC A;  2ETJ A;  1Y97 A;  4BR0 A;  5SZT A;  3M3Z A;  3K5L A;  2HBK A;  3EYZ A;  3GOI A;  1RTJ A;  3RSE A;  3LP0 A;  3AVB A;  1YAG A;  1BQM A;  4KAZ A;  2IAJ A;  3AO5 A;  4IFV A;  1VRT A;  2YKN A;  3VET A;  3T69 A;  5BN9 A;  2O8D A;  2E2O A;  3QIP A;  3O3G A;  2ASM A;  3OY9 A;  4NXM K;  1S1V A;  4Z4I A;  3VQA A;  4IWV A;  1DTQ A;  4DU3 A;  4FWK A;  5HBM A;  2XY6 A;  3DLL L;  3LDQ A;  2Y1I A;  4CFB A;  4DSI A;  4KH5 A;  2G8W A;  3C6T A;  2E5L K;  4KB1 A;  3QES A;  4CFD A;  1QSS A;  1QQM A;  3U3Y A;  1BIU A;  3NH2 A;  4DB3 A;  4JI4 K;  1S3X A;  2V7Y A;  3SK3 A;  1IKV A;  4IG0 A;  1WBB A;  1TUU A;  2IIR A;  1F21 A;  2E88 A;  1Q86 O;  4OJR A;  2ZE2 A;  1OH7 A;  1XNQ K;  2Z1G A;  4CGI A;  4DSE A;  4B1W B;  4FW1 A;  2HHW A;  4DQ8 A;  1RCH A;  1GLB G;  4CHN A;  4QS9 A;  2A41 A;  3AA2 A;  4C8L A;  1Q81 O;  4BVO A;  3ULE A;  4A2A A;  1ZBH A;  5AQV A;  3GDQ A;  3CET A;  1E4F T;  3HPG A;  4N47 A;  1X9W A;  5FRM A;  3HOT A;  2WON A;  2DTU A;  3ID6 A;  3U4L A;  3CXC M;  4OVL A;  1NOY A;  3U9Z A;  4WE1 A;  2QWQ A;  4A59 A;  4J2B A;  2Q97 A;  3TSU A;  4DF8 A;  3AV9 A;  3DXK A;  2XY5 A;  1LOT B;  3AVH A;  2KHO A;  4OKE A;  2VQE K;  5I3U A;  4QS8 A;  4FJ9 A;  1C0M A;  3L4Q A;  2QK9 A;  4CJF A;  3ZSZ A;  3QBW A;  3VN5 A;  5KRS A;  4OPJ A;  1M90 O;  1FXX A;  4FWS A;  2PY5 A;  2HST A;  3LAN A;  4JHD B;  4Z0U A;  3G10 A;  3AVJ A;  4YY3 K;  3CD6 N;  1JLE A;  3KJV A;  4NYN A;  4W5O A;  2RHK A;  4BGB A;  3NAE A;  2QKB A;  1IBL K;  4YOY A;  4M3R A;  4M42 A;  3BP8 A;  4DMN A;  4FJI A;  1BDG A;  5BPL A;  3F73 A;  1TKT A;  1SQK A;  1G15 A;  4A5A A;  3VGM A;  5CZ1 A;  1EQY A;  2X6S A;  3OYC A;  1JXE A;  2Z1I A;  3AO1 A;  1HYS A;  1UAX A;  3VER A;  3OYF A;  5GAE P;  3M8Q A;  1HUX A;  4CGH A;  4RW6 A;  3W0L A;  4DV2 K;  4IDH A;  4N5S A;  3AGK A;  1W97 L;  2PAV A;  3E66 A;  4H5N A;  3EY1 A;  3KKS A;  1RTD A;  4CJR A;  3ITH A;  3EKU A;  5A2Q O;  5HLF A;  4DTM A;  2RPI A;  5AZJ A;  1VSH A;  1B9D A;  4DLE A;  2BGG A;  3OYD A;  3OS1 A;  3HST B;  1HKG A;  2E1Y A;  5M1F A;  4RW9 A;  3VA3 A;  2ZM6 K;  4C8N A;  2JGU A;  4WQ5 A;  3OS0 A;  1K9M O;  3FLC O;  5C0Y A;  4FM1 A;  3SI6 A;  3QEX A;  3I8D A;  3PSI A;  3L2Q A;  4DTU A;  1IBK K;  4H0Y B;  1BL3 A;  5AQI A;  3MWP A;  3KK2 A;  2WC9 A;  3ZT1 A;  4CER A;  1VRU A;  3R8E A;  4CE9 A;  4H4M A;  2HBJ A;  4GNI A;  3CC7 N;  1JL2 A;  3U9D A;  1VQ9 N;  3VEZ A;  4BRK A;  4KV8 A;  5HRN A;  1BCM A;  1DT9 A;  2I7N A;  2E20 A;  2A5X A;  3EO3 A;  2D5R A;  3ZX2 A;  1KD1 O;  3VEX A;  3DXM A;  4FWN A;  4CJK A;  2CH5 A;  1B9F A;  1NGH A;  2FSK A;  1SKS A;  3CJ9 A;  3TWH A;  4FL9 A;  5LY3 A;  4JI8 K;  2D0P A;  2RKI A;  2Q0R A;  4CW7 B;  5AQN A;  4FWM A;  4G1Q A;  4EAH D;  2ZWH A;  5K14 A;  3THX B;  3CCE N;  4B3S K;  1X3M A;  3O3H A;  5DM6 L;  4MLE A;  4GV9 A;  3QFU A;  2NNW A;  1WB9 A;  4FJJ A;  1VSJ A;  2VG5 A;  5JMV A;  2V51 B;  3O3F A;  2HHT A;  4W5R A;  1GLA G;  3EN9 A;  2XY8 A;  4BRI A;  1JCE A;  3AVL A;  1J5E K;  1N5Y A;  3TAR A;  4PL7 A;  1JLB A;  2O8E B;  2P9K B;  3P31 A;  3H1V X;  2OTJ N;  3T3F A;  3NVM A;  2QWM A;  5CHI A;  4AHS A;  4BE1 A;  4B8A B;  3RVC A;  3EZ5 A;  3V81 A;  3AA4 A;  4CJV A;  3BZC A;  1HNW K;  4JKD A;  4UY8 O;  1VSM A;  4DQR A;  1WOQ A;  4WFN L;  3MAQ A;  3TR8 A;  2KW4 A;  4IFY A;  3N4Q A;  4IBN A;  4B1Y B;  3EZW A;  1DTT A;  4NCB A;  2HMP A;  4NCA A;  4DR2 K;  5CY4 A;  3VF4 A;  3WT0 A;  1KAX A;  5M1O A;  1BG3 A;  5CYQ A;  5IWA K;  1NOZ A;  1YTU A;  2D4W A;  5GAD P;  5AQW A;  3P38 A;  4MLH A;  4DR6 K;  3MK6 A;  4K42 A;  1VQ8 N;  2F7T A;  2P9N A;  4DV5 K;  1V4T A;  3LAL A;  5KPT A;  4W5Q A;  2KZZ A;  3DOL A;  5AZI A;  4IEE A;  4JK7 A;  3GE1 A;  2Q2R A;  3IUC A;  3HVR A;  3CF5 L;  2YNG A;  4EIA A;  1SZ2 A;  2NRV A;  3PUF A;  1QVG M;  1RT5 A;  5HP1 A;  3B8A X;  3OYA A;  4GKJ K;  4ELV A;  4DS4 A;  3J7A P;  3I33 A;  4FOI A;  2NRX A;  3FZM A;  4UQG A;  2OA8 A;  2HMI A;  4BC3 A;  4BQZ A;  3CG7 A;  3O8M A;  1C1A A;  4K43 A;  2FBY A;  3IFR A;  1EET A;  2YNF A;  5GIP A;  4J2E A;  1RGI A;  4AIL C;  3SNN A;  4AHC A;  3V9X A;  2YX6 A;  3SAF A;  4CEE A;  3VQD A;  2D1K A;  1RT4 A;  4EZ9 A;  3KK3 A;  3DLK A;  3K9K A;  2W6K A;  1NGF A;  3OYK A;  3L2R A;  4CJL A;  4E0D A;  3BEX A;  4BE0 A;  1NK7 A;  3CER A;  3LWL A;  4KHP K;  3D2E B;  2Q1N A;  2GEM A;  1S22 A;  4E3S A;  5EOY A;  3SQ4 A;  2O8F A;  4FJH A;  1C1B A;  1JLC A;  2VWB A;  3SLC A;  1H1V A;  1QQC A;  3A5O C;  4KTZ A;  4BRL A;  4BRQ A;  5AFU H;  1C0F A;  4MFB A;  3VQB A;  1O1W A;  2KZM A;  4DV4 K;  1XQS C;  4LF5 K;  4HTL A;  4CF9 A;  5M1K A;  3F2K A;  4DTO A;  2E4L A;  4M7Y A;  1ZBF A;  1NNE A;  1HNZ K;  4AHU A;  2YHX A;  4JRQ A;  4WQ4 C;  1P8Z A;  3B6O A;  1NG9 A;  2AJQ A;  4CZF A;  3C6U A;  1A5V A;  3UE5 A;  4LF7 K;  2ZD1 A;  4FVM A; 
#chains in the Genus database with same CATH homology
 1R0A A;  3PX4 A;  1HNI A;  1LW2 A;  3OVN A;  3NF7 A;  4BWM A;  4I2P A;  1EX4 A;  4KFB A;  2I5J A;  4Q0B A;  3QO9 A;  4CJ3 A;  1L5U A;  2O4G A;  3PX0 A;  3SUQ A;  2VG7 A;  3KLI A;  5CYM A;  2HHS A;  3PO5 A;  4DFP A;  1U04 A;  4B3O A;  3RRG A;  2YV0 X;  4J2D A;  1JXB A;  2HVH A;  1FKO A;  4O4G A;  5D3G A;  3KTQ A;  3AVG A;  3LP2 A;  1L3V A;  3NF6 A;  1D5A A;  3AO3 A;  4M3U A;  4FLW A;  4CHO A;  1KTQ A;  4CIG A;  4CF2 A;  2B5J A;  1L3T A;  4CGJ A;  1JKH A;  4L8R B;  3G0Z A;  4HUE A;  4KHN A;  4FZZ A;  4FW2 A;  3MXJ A;  3TAQ A;  4CJQ A;  4N41 A;  4CEQ A;  2D0B A;  1LAV A;  1Y97 A;  2ETJ A;  2IOC A;  4ICL A;  5SWM A;  1S1X A;  5SZT A;  3OYN A;  3K5L A;  1J5O A;  4FJL A;  1RDD A;  1WSI A;  3EYZ A;  1K6Y A;  3ZCM A;  1RTJ A;  4KHQ A;  3K5N A;  2LSN A;  1C6V A;  4PUO A;  3LP0 A;  1RT6 A;  2DFF A;  3AVB A;  3C95 A;  3RWU A;  2IGI A;  4M3Z A;  3DLR A;  4CJP A;  1BQM A;  1RT2 A;  4KAZ A;  2HND A;  2IAJ A;  4R5P A;  3AO5 A;  1XHZ A;  4AHR A;  4BAC A;  4M3W A;  4IFV A;  1VRT A;  4FCY A;  2YKN A;  1TKZ A;  3QIO A;  4E1N A;  4CCH A;  1KLM A;  1QS4 A;  4I9L A;  2KQ2 A;  1WLJ A;  3QIP A;  3O3G A;  4B9T A;  1U49 A;  3CFR A;  3OY9 A;  4BE2 A;  1S1V A;  4KHY A;  3DLB A;  3VQA A;  4Z4I A;  4OKJ A;  4FJ7 A;  3S3O A;  4M3Y A;  3L3V A;  3AVM A;  4LSL A;  1DTQ A;  4DU3 A;  5HBM A;  2XY6 A;  3WNG A;  3OS2 A;  2Y1I A;  2VWK A;  1D8Y A;  1GOB A;  5CZ2 A;  4CFB A;  2ITG A;  5HRS A;  2QKK A;  4DSI A;  4FJX A;  3F9K A;  4CF1 A;  4CFC A;  2G8W A;  3M8S A;  3C6T A;  4KB1 A;  1HNV A;  2R7Y A;  3QES A;  5KGW A;  4H4O A;  4CFD A;  1ZBL A;  1QSS A;  5JS1 A;  4FK0 A;  2IDO A;  4E7K A;  1RTH A;  3U3Y A;  4DSK A;  3ZT2 A;  1BIU A;  3NH2 A;  1VSD A;  4HUG A;  4DTN A;  2HNZ A;  3AVA A;  4Y1D A;  3TAM A;  1IKV A;  4IG0 A;  3ZSO A;  5HRP A;  3HVT A;  4H8K A;  4CHZ A;  2BE2 A;  4FJ5 A;  3HJF A;  5KTQ A;  3L2W A;  3RTV A;  1F21 A;  3OYI A;  4DFJ A;  4OJR A;  3MXI A;  1Z25 A;  4HTU A;  2ZE2 A;  1JLA A;  3V1R A;  3VQ9 A;  4Z4E A;  2Z1G A;  1TKX A;  1RIL A;  4CGI A;  4CK3 A;  1LWC A;  4DSE A;  3K2P A;  2X6N A;  1KFS A;  3WNE A;  5DK5 A;  4BDY A;  4DTS A;  3P83 D;  4RG8 A;  4YFU A;  4KTW A;  3LDS A;  3QEP A;  4KI6 A;  4FW1 A;  3ZSR A;  2HHW A;  1RCH A;  1BIS A;  4YNQ A;  3QEW A;  3DLH A;  4CHN A;  1BI4 B;  3AVC A;  1X1P A;  3AA2 A;  3AO2 A;  3ASM A;  4C8L A;  4ZHR A;  5HRO A;  4M41 A;  1JLQ A;  1Q8I A;  3QEV A;  1ZBH A;  3FFI A;  2HHU A;  2W42 A;  3HPG A;  2RF2 A;  4BWJ A;  4RW7 A;  1S1W A;  4N47 A;  1X9W A;  1CLQ A;  2YHB A;  1RT7 A;  3OYJ A;  3SUO A;  4FJG A;  5FRM A;  1RT1 A;  2P51 A;  1QHT A;  2WON A;  2O4I A;  2DTU A;  3OYB A;  3AO4 A;  1NKE A;  2KFZ A;  4OVL A;  1NOY A;  4WE1 A;  4J2B A;  1XC9 A;  4FM2 A;  4DF8 A;  3AV9 A;  3PY8 A;  2G8V A;  2DFE A;  2Z1H A;  4CJ5 A;  2XY5 A;  4FJK A;  3HK2 A;  3SV3 A;  4LY7 A;  3AVH A;  2G8I A;  4DG1 A;  1WN7 A;  4FLY A;  3SPZ A;  3ZSY A;  4DU4 A;  2Q3S A;  3OYE A;  4OKE A;  3ULD A;  1NJY A;  1BI4 A;  3H08 A;  5I3U A;  1BCO A;  4FJ9 A;  3S3M A;  1C0M A;  1NJX A;  2HW3 A;  2QK9 A;  4CJF A;  3NHG A;  3SCX A;  3ZSZ A;  1KVA A;  2F96 A;  5C24 A;  4DTP A;  4OPJ A;  4TSX A;  3VN5 A;  5KRS A;  5KRT A;  3CM5 A;  3TAN A;  1FXX A;  1KVB A;  1VSK A;  3QLH A;  4FZX C;  4Z4C A;  3ZSV A;  4F4K A;  3U6F A;  3ZT0 A;  2PY5 A;  3I0R A;  5EU7 A;  3LAN A;  4B9V A;  1SKR A;  4Z0U A;  3G10 A;  3AVJ A;  1J53 A;  3LPT A;  3LPU A;  3RMD A;  3TAP A;  1S5J A;  1TK5 A;  2HHQ A;  1JLE A;  3DI6 A;  3DRR A;  2A1S A;  3KJV A;  4NYN A;  4W5O A;  3CQ8 A;  2G8U A;  4J2A A;  1EKE A;  3AVN A;  1IH7 A;  3K5M A;  2Z1J A;  3NAE A;  3VQ4 A;  3D45 A;  3JSM A;  4DSF A;  3QEI A;  3TI0 A;  2WOM A;  1IKW A;  2QKB A;  2B4J A;  4M3R A;  4M42 A;  1MU2 A;  3KD1 E;  2D0A A;  4DMN A;  4HVJ A;  3HXM A;  1X9M A;  3A2F A;  2KFN A;  3DLE A;  4B9N A;  4N76 A;  4FJI A;  2GBZ A;  3IS9 A;  4CEA A;  3SZ2 A;  3F73 A;  1TVR A;  3NCI A;  1TKT A;  1HYZ A;  4CK2 A;  4EP4 A;  1G15 A;  3UIQ A;  3LZI A;  3RMC A;  3SUP A;  1TK0 A;  1LW0 A;  5CZ1 A;  1Q9Y A;  4F3O A;  2X6S A;  4KKO A;  3OYC A;  3DRP A;  4FLU A;  4KHS A;  4PY5 A;  4HHT A;  2XY7 A;  3ZSW A;  1JXE A;  1REV A;  2Z1I A;  2X78 A;  3V1Q A;  1S6Q A;  5C25 A;  1IKY A;  1T8E A;  1L3U A;  4DSJ A;  5KI6 A;  4QAG A;  3I0S A;  1SL1 A;  3AO1 A;  1X9S A;  4DTR A;  1CXQ A;  3VQQ A;  4E19 A;  3HT3 A;  1UAX A;  3PX6 A;  3TAE A;  2B6A A;  1HYS A;  4KHU A;  3OYF A;  4DF4 A;  4I7F A;  1WSH A;  3M8Q A;  3PO4 A;  3S3N A;  3K58 A;  4CGH A;  4RW6 A;  4CJT A;  1WNS A;  2OPP A;  5J2P A;  4N5S A;  1SUQ A;  3D0P A;  3THV A;  1JL1 A;  1TK8 A;  3KK1 A;  2YKM A;  4CF0 A;  3V9Z A;  1GOA A;  2HNY A;  1NKB A;  5DMR A;  4FLT A;  3EY1 A;  2HHX A;  1S1T A;  1TAU A;  3KKS A;  4C8O A;  3M8P A;  1IKX A;  5C42 A;  4CJR A;  1RTD A;  3ITH A;  4GMJ B;  5HLF A;  4FJN A;  3HPH A;  1NK5 A;  1RNH A;  4DTM A;  2RPI A;  4M45 A;  3B6P A;  5J2Q A;  1VSH A;  4K8Z A;  1B9D A;  3V9W A;  4DLE A;  4CEF A;  3V1O A;  4LH5 A;  4CJW A;  1VSL A;  3OYD A;  3KLF A;  4CIE A;  3L2V A;  4OGC A;  3OS1 A;  1KRP A;  4OLB A;  4QCL A;  3HST B;  3OYG A;  1XHX A;  4RW9 A;  1TGO A;  3QNO A;  1I3A A;  4ZTJ A;  1RT3 A;  3VA3 A;  4B9S A;  4I9Q A;  1Z26 A;  4XIU A;  2KTQ A;  4C8N A;  2JGU A;  3OS0 A;  3CFO A;  2HVI A;  2BAN A;  2PZS A;  1BGX T;  4FM1 A;  3SI6 A;  1NK8 A;  1U47 A;  1C0T A;  3QEX A;  1WSG A;  3NF9 A;  3I8D A;  3K59 A;  2F8S A;  2XO7 A;  3L2Q A;  4LD0 A;  3LAM A;  1VK0 A;  4ZTF A;  1JLF A;  4DTU A;  3LWM A;  4F3T A;  1HRH A;  2ZQB A;  3VA0 A;  3T1A A;  1HPZ A;  1T7P A;  4FXD A;  1J9A A;  1LWE A;  1BL3 A;  4AHT A;  1NK4 A;  2FBT A;  3SUN A;  3KK2 A;  3U3G A;  3ZT1 A;  4CER A;  2P5G A;  1S9G A;  1VRU A;  4CE9 A;  4BDZ A;  4H4M A;  4B9M A;  4DQI A;  1XWL A;  2OPQ A;  1QE1 A;  3HPO A;  1JL2 A;  1S1U A;  1TAQ A;  2NUB A;  4HCC A;  3IRX A;  4KV8 A;  5HRN A;  1BCM A;  1C0U A;  3O4N A;  1SL0 A;  3OYH A;  4NCG A;  4O0J A;  4OLA A;  1TV6 A;  1DLO A;  1CZB A;  2D5R A;  1A5X A;  2E6L A;  4CED A;  1QSL A;  3CM6 A;  2IC3 A;  4PA1 A;  1RBU A;  3SPY A;  1NK0 A;  1VSF A;  1ZYQ A;  4KB0 A;  1RDA A;  1Q9X A;  1KCF A;  3KLH A;  4CJK A;  3AVF A;  4QOZ B;  1B9F A;  3KKR A;  3O4Q A;  3AVK A;  4NYF A;  1T05 A;  5HRR A;  3IG1 A;  3L2U A;  1UA0 A;  3V6D A;  4PWD A;  4FK4 A;  1SKS A;  2DY4 A;  4CES A;  4GVM A;  3TWH A;  1ASU A;  3VQE A;  1ZBI A;  4O0I A;  3OYL A;  2RKI A;  4M3X A;  4HUF A;  1RDB A;  2EX3 A;  4LSN A;  3RR8 A;  1EXQ A;  4G1Q A;  2HB5 A;  4KTQ A;  4M3T A;  3NBP A;  1NKC A;  4Z4F A;  1VSI A;  5K14 A;  5E41 A;  1QTM A;  1SL2 A;  2QXF A;  4MQ3 A;  4CGF A;  1NJZ A;  3O3H A;  3TAG A;  4KHW A;  4CF8 A;  3RMA A;  1KSP A;  3IAY A;  1RBS A;  4CJS A;  2F8T A;  4FLZ A;  4FJJ A;  1VSJ A;  2VG5 A;  1FK9 A;  2E6M A;  4I2Q A;  3O3F A;  2HHT A;  2G8H A;  4CEO A;  4W5R A;  3KLG A;  3OYM A;  5JS2 A;  4FJM A;  4E7I A;  2XY8 A;  3PV8 A;  4KRF A;  1YVU A;  3AVL A;  3NFA A;  1N5Y A;  3TAR A;  1T03 A;  3DOK A;  2PYJ A;  3RR7 A;  1NK6 A;  3HL8 A;  3MEG A;  1KVC A;  4CJ4 A;  1JLB A;  3JYT A;  3DYA A;  4C8M A;  3QIN A;  2X74 A;  3M8R A;  3T3F A;  4CEC A;  1U4B A;  1KLN A;  4LH4 A;  4CJE A;  4GW6 A;  4HCB A;  1UOC A;  4DQS A;  2D0C A;  1JLG A;  3VQP A;  5J1E A;  3ISN C;  4AHS A;  4BE1 A;  2EHG A;  4B8A B;  1RBR A;  1BIZ A;  1LAW A;  3L3U A;  3P5J A;  4W5T A;  3EZ5 A;  4B08 A;  3V81 A;  3HM9 A;  3HYF A;  3AA4 A;  3KIO A;  4B9U A;  4CJV A;  4F2S A;  4IDK A;  3SYZ A;  4BDP A;  1IG9 A;  2OYQ A;  2JLE A;  3VQ5 A;  4DWI A;  2XRI A;  4KO0 A;  1VSM A;  2OPS A;  1HMV A;  4OPK A;  3NGZ A;  3SV4 A;  3SQ2 A;  3NGY A;  4Z4H A;  4DQR A;  4FLV A;  4DTX A;  4E7J A;  3TAF A;  4DQQ A;  4C8K A;  4FK2 A;  3MAQ A;  1S9E A;  1WAF A;  3TR8 A;  3QET A;  2KW4 A;  4ELT A;  4IFY A;  4IG3 A;  1ASV A;  4IBN A;  3VQ8 A;  4E1M A;  3LP1 A;  4CGG A;  1DTT A;  4NCB A;  1RTI A;  3TAB A;  4DSL A;  1HYV A;  4NCA A;  2HHV A;  1CZ9 A;  4OGE A;  3KD5 E;  1CXU A;  5FDL A;  2G8K A;  4O44 A;  5CY4 A;  3VQC A;  3T19 A;  2PYL A;  2Y1J A;  3V4I A;  3MXM A;  3OJU A;  3NE6 A;  1BHL A;  4CIF A;  1YTA A;  5CYQ A;  3NH1 A;  4ID5 A;  2IS3 A;  1NOZ A;  4RW8 A;  2VWJ A;  1YTU A;  3K5O A;  1HQU A;  3KLE A;  1HQE A;  3P1G A;  2P1J A;  3HP6 A;  1J54 A;  2FC0 A;  4JRP A;  2FBX A;  1N6Q A;  2OZS A;  4F2R A;  3OJS A;  3V9S A;  4FYD A;  4JS5 A;  3MED A;  4CEZ A;  3BGR A;  3LAL A;  3NDK A;  4KPY A;  5FRN A;  4W5Q A;  1SV5 A;  3E01 A;  2KZZ A;  3DOL A;  3QER A;  1NK9 A;  4W5N A;  3HVR A;  4FJ8 A;  1B92 A;  1D9F A;  2YNG A;  4DTJ A;  4K8X A;  3BDP A;  2BGG A;  3PUF A;  1RT5 A;  4ID1 A;  3LP3 A;  3ZSQ A;  5HP1 A;  3OYA A;  3V9U A;  1NJW A;  4CK1 A;  4AHV A;  4ELV A;  4DS4 A;  5FRO A;  3VQ6 A;  4CGD A;  1W0H A;  2DFH A;  4JS4 A;  4UQG A;  4DQP A;  2OA8 A;  2YHA A;  4DS5 A;  2HMI A;  3DM2 A;  3DMJ A;  4O55 A;  4EZ6 A;  4EP5 A;  5J2N A;  3LAK A;  3CG7 A;  2OZM A;  4O5B A;  5J2M A;  1RBV A;  1TL3 A;  1RBT A;  5KGX A;  4PQU A;  3WNH A;  1C1A A;  3SQ0 A;  1TKD A;  2FBY A;  4OKK A;  4CJU A;  4Q5V A;  1EET A;  4CHY A;  2YNF A;  4E7H A;  2A1R A;  2G8F A;  4J2E A;  3AVI A;  4KI4 A;  3C94 A;  3RRH A;  4AIL C;  4AHC A;  3V9X A;  3SNN A;  2BDP A;  4CEE A;  3VQD A;  3ZSX A;  1LV5 A;  2GUI A;  4RW4 A;  1QSY A;  1RT4 A;  1U45 A;  4EZ9 A;  3MEE A;  5I42 A;  3ZT4 A;  3KK3 A;  3DLK A;  3SJJ A;  4Y1C A;  3OYK A;  3L2R A;  4DLG A;  4CJL A;  4E0D A;  4BE0 A;  1NK7 A;  3NH0 A;  3LWL A;  1D9D A;  1WAJ A;  4DU1 A;  3QNN A;  1VSE A;  2YNI A;  4E89 A;  4DFK A;  3RMB A;  1BQN A;  3AA5 X;  4CHP A;  4E3S A;  3SQ4 A;  4FJH A;  1C1B A;  3WNF A;  2RN2 A;  1UA1 A;  4FM0 A;  1JLC A;  4FZY A;  4FLX A;  3NF8 A;  2YNH A;  1FKP A;  1QQC A;  1S6P A;  4E7L A;  2GV9 A;  1GOC A;  4KTZ A;  3HP9 A;  4AH9 A;  3SQ1 A;  3NGI A;  3DRS A;  1SKW A;  2P5O A;  4MFB A;  1IO2 A;  3VQB A;  1O1W A;  1WSJ A;  1ITG A;  4IKF A;  2KZM A;  1TL1 A;  1I39 A;  3ZT3 A;  4JLH A;  4CEB A;  4B9L A;  3MEC A;  3VQ7 A;  3L8B A;  4B8C A;  3S9H A;  1LWF A;  1RDC A;  1KFD A;  1WSF A;  3ALY A;  4N56 A;  3K57 A;  4CF9 A;  4F8R A;  3HO1 A;  1C1C A;  4CFA A;  3LZJ A;  2ATQ A;  1XI1 A;  1U48 A;  4Z4G A;  4DTO A;  2E4L A;  1WSE A;  1ZBF A;  2FBV A;  2VG6 A;  1HJR A;  4AHU A;  4JRQ A;  5T7B A;  3B6O A;  4CHQ A;  4DFM A;  3CYM A;  4KRE A;  2XHB A;  3AA3 A;  2OPR A;  1W9H A;  1A5W A;  1YT3 A;  1L3S A;  2AJQ A;  3C6U A;  1EP4 A;  1ZBU A;  3CFP A;  4ELU A;  1A5V A;  1UWB A;  2ZD1 A;  1ASW A;  3DLG A;  4FVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...