4CF8A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf8A00
1JLFA 4FW2A 3RR8A 2WOMA 1X9SA 1HQEA 3AVKA 5KTQA 5HRSA 3AO3A 1NOYA 3FFIA 4DU3A 1T7PA 3HO1A 4DTJA 4DSFA 3KLHA 1REVA 4KFBA 2XY6A 1TGOA 3SJJA 4PA1A 1N6QA 4IFYA 4W5TA 1RT6A 4DSLA 4CJWA 2EX3A 3AA3A 2QKBA 3ALYA 1S1UA 4DTSA 5FRNA 1FXXA 1XI1A 3HL8A 1T8EA 3KLIA 3T1AA 3L2RA 1TAQA 4KTZA 2HVIA 3KKSA 3C94A 1I39A 4J2AA 1NK9A 2F8TA 4O4GA 2PYLA 1X9WA 2KFNA 4CJSA 4CIEA 4E3SA 4IG0A 1BIUA 1RCHA 4DQPA 3K2PA 3QIPA 3LWMA 3KJVA 4FJHA 4IG3A 4KHWA 2D5RA 2HNZA 3T19A 4B8CA 2XY7A 4FJIA 4M42A 3DLKA 1CZBA 4ID1A 4OGEA 2F8SA 1RT3A 1O1WA 4TSXA 2AJQA 4CHOA 5J2NA 1S1VA 3NGZA 2JGUA 3NF6A 1CZ9A 3AVGA 3ZT0A 2O4GA 2ATQA 2BANA 3G0ZA 1QHTA 3NGIA 4B9NA 4HCCA 5J1EA 4OLAA 2IDOA 3DMJA 4M3TA 1J5OA 2IGIA 5D3GA 2KZMA 1RDAA 3D45A 1L3UA 2HHWA 2HW3A 3AVFA 1IKWA 3ZT3A 1XHZA 5DMRA 1VSHA 1HQUA 4CHQA 4NCBA 1SKSA 2E6LA 4CEQA 1NK6A 4H4MA 3KLEA 3KK1A 1CXQA 3ZT2A 5SWMA 3DLGA 4EZ9A 3SI6A 1Z25A 4OVLA 3VQ6A 1WNSA 3PUFA 4LSNA 3VQEA 4CIFA 1KLMA 3SYZA 3SNNA 1MU2A 1NK8A 4CF1A 3SQ0A 3K5NA 1S6QA 1Z26A 4GVMA 4QAGA 3P1GA 5CZ1A 3OYIA 1KVAA 5KI6A 1C0TA 1TL3A 4N47A 4FJXA 4OKKA 3L8BA 2B4JA 3QINA 4CJRA 4XIUA 3KLFA 4HUGA 2G8WA 3C6TA 1NJXA 2D0BA 4FJJA 1RBTA 4ELTA 2FBTA 3SUOA 3ZSZA 3V9WA 1A5XA 4FJKA 4F4KA 1JXEA 3TAPA 2I5JA 1RTDA 4G1QA 3RWUA 4Z4GA 5KRTA 3NF7A 5J2PA 2YKMA 4KHQA 4ELVA 1CLQA 2RF2A 3D0PA 1CXUA 2YHAA 3H08A 4EP5A 4ZTFA 1NK4A 1TK0A 4IKFA 3I8DA 1BCOA 1NKBA 3BDPA 3LANA 1ZBHA 4B9VA 2KW4A 4CERA 1XC9A 2A1SA 4NYNA 1QS4A 1QSLA 4KRFA 4J2EA 1VSMA 3JYTA 3VQQA 1VSFA 4AH9A 3KTQA 1RBSA 1GOCA 2YNFA 1S9EA 3LALA 4CEFA 2YNIA 4B9MA 4E7JA 2YNGA 3V4IA 1IKVA 4FLUA 2B5JA 3NH0A 1SL0A 4CF2A 4HHTA 3K5OA 4DFJA 3KD1E 4HVJA 5JS2A 3KK3A 3CM5A 4NCGA 1TKZA 3SV3A 2HHVA 2Y1IA 1WSFA 3S3NA 1J9AA 1JKHA 3U6FA 4Z4CA 1G15A 4F8RA 1DLOA 4C8NA 3DLEA 4GW6A 3NH1A 3HT3A 3TAMA 5J2MA 4FW1A 4M3UA 2HB5A 3TWHA 3IS9A 3KKRA 1IO2A 3MEGA 4RG8A 3L2QA 4JRQA 3TAGA 2IAJA 3DLBA 1C1AA 1QQCA 3VQAA 4YNQA 2BGGA 3HM9A 3PY8A 1WSJA 3VQDA 4MFBA 2G8HA 4ICLA 2VG5A 5HRRA 4B9UA 3M8QA 2R7YA 1JLAA 5HRNA 4FJ8A 1EP4A 1RT5A 3ZT4A 3QIOA 4CEDA 3NFAA 2G8IA 3IAYA 3MEDA 4RW6A 3SPZA 1RTHA 3HPOA 4KHSA 4ELUA 1GOAA 3ZSRA 4DSEA 3TR8A 4CF8A 1RTIA 3NGYA 3V9SA 3MXJA 3F9KA 3OYDA 4DSIA 4KREA 1A5VA 3MXMA 1XHXA 4DMNA 1NKEA 4AHVA 1TL1A 3QO9A 2FBYA 1UA1A 3VA3A 2Q3SA 4PQUA 3CM6A 4B8AB 4J2DA 2G8FA 1HMVA 3HJFA 1TK5A 4DQIA 4HUEA 2HHQA 4I2QA 1KLNA 4M3XA 3HVTA 3VQBA 3SV4A 4DU1A 4BDYA 4PUOA 1BHLA 1BL3A 4CGDA 4BE0A 4OLBA 2ITGA 2DY4A 3A2FA 3LP1A 4CJVA 3TANA 3PX0A 1EKEA 1KVBA 2ZD1A 4FLTA 1HYVA 5CYQA 4KKOA 3JSMA 3VN5A 2P5OA 3AVNA 3OYJA 1YTUA 4BDZA 4BWMA 1B9FA 1C0UA 4MQ3A 4CEZA 3SCXA 1TKDA 4FM2A 4I2PA 4E1MA 3OY9A 4B9LA 3LDSA 3L3UA 4FZXC 3V9UA 2IS3A 3WNHA 1X9MA 1BI4B 3SQ4A 4H4OA 1QE1A 3DOKA 4Z4IA 5JS1A 1KVCA 3ZSYA 4FLVA 4CHYA 3RMBA 3AO2A 4W5OA 4C8LA 5C42A 1S1TA 4M3RA 3SQ2A 1UWBA 4EP4A 3E01A 1U4BA 1IG9A 1JL1A 4CEBA 2YHBA 1TVRA 5I42A 4K8ZA 2D0AA 4CJTA 4M41A 3AVBA 2HMIA 1RDBA 1TKTA 3NE6A 3SZ2A 1RILA 1L5UA 4RW8A 4IFVA 1VSIA 4OGCA 3NHGA 4JRPA 2DFHA 2IOCA 3LPUA 4I7FA 4AHUA 4Y1DA 2XHBA 3ZT1A 3NF9A 3SUPA 1BISA 3WNEA 3TI0A 2KTQA 4Z0UA 4BWJA 4RW9A 5HROA 3U3GA 1LW2A 4FLZA 3LAKA 1JLEA 2W42A 1BGXT 5CYMA 4DTMA 4DLGA 4CGIA 3ASMA 4CF9A 4O5BA 3M8RA 4CHZA 4FK0A 3HVRA 3OYCA 4CHPA 3AO4A 5J2QA 2GUIA 3LP3A 3B6PA 2E6MA 5C25A 4ID5A 3K5LA 1ZYQA 2QKKA 1B92A 1U04A 1RT1A 1VK0A 2IC3A 2X6NA 3K58A 3QETA 2VG7A 4FJLA 4PWDA 4KV8A 4FYDA 2Y1JA 5SZTA 4E7HA 3NAEA 2YNHA 4FLYA 3OS1A 1LWCA 1RNHA 4KB0A 3WNGA 1DTTA 4AHSA 1SL2A 4C8OA 3OYLA 1GOBA 4JLHA 2O4IA 1LW0A 1RTJA 2D0CA 1JLBA 3QESA 1N5YA 1BQNA 2DFEA 4E19A 1WAFA 2PYJA 2G8VA 4KHYA 4DG1A 4DFKA 3VQ4A 1WSEA 1KFSA 3HK2A 4KAZA 4CEOA 2RPIA 1UOCA 3KLGA 3CFRA 4FLWA 4K8XA 2GBZA 3T3FA 3HP9A 4EZ6A 3O4QA 1ITGA 1VSDA 4CEAA 4RW7A 2RKIA 4CJEA 1SUQA 1JL2A 3K57A 3ULDA 3CQ8A 3M8PA 3VQ9A 1YTAA 2ZQBA 3KK2A 3DLRA 3NDKA 3RMAA 1QSSA 1WSIA 4NCAA 1S1XA 4LY7A 4M3YA 4CFBA 3DLHA 3LP2A 1NJYA 4I9LA 1KFDA 5CY4A 4O0IA 4JS5A 4DS4A 3S9HA 3OJSA 3SQ1A 1SKRA 1ZBIA 3NF8A 3TARA 3AVIA 3VQPA 4N41A 1BCMA 1LAWA 2X6SA 5CZ2A 4CJLA 4FK2A 4NYFA 3IRXA 1VSKA 3VQ8A 4DFMA 3EZ5A 1FKOA 2QK9A 3OYHA 4KB1A 4B9TA 3QEXA 3DM2A 4KPYA 3VA0A 1T03A 1KCFA 3ISNC 1ZBLA 3TAEA 1R0AA 2YKNA 4GMJB 1KRPA 4BE1A 4Z4HA 3AV9A 4CIGA 1HYZA 1EETA 3OYKA 1VSLA 4DQQA 1C1BA 3O4NA 5HP1A 4DQSA 4DLEA 3LP0A 4LH4A 1LWFA 3L2WA 4DTOA 4DF4A 1Q9XA 4O44A 4KI6A 2HHTA 4Z4EA 4CJ5A 3OS0A 4CJQA 4N5SA 3LPTA 1IKXA 4R5PA 2OPPA 3F73A 1WSGA 4F2SA 3MAQA 5HLFA 4DQRA 1U48A 3OS2A 3RRGA 3HPGA 4OKEA 5C24A 5KGXA 4CCHA 3ZSQA 4Q5VA 2FC0A 3NH2A 4BE2A 4AHCA 4OKJA 4CJFA 1D8YA 4FJ9A 1ASVA 1TKXA 1X1PA 1QSYA 3KIOA 1S1WA 2BDPA 3AVCA 4AHTA 3K59A 4YFUA 2PY5A 2QXFA 3DRSA 2Z1IA 4QCLA 3C95A 1NKCA 3QEIA 1ZBFA 3VQ5A 3QEVA 1LAVA 4DWIA 1UAXA 3CG7A 3CFOA 4FJGA 3UIQA 3NBPA 1W9HA 4FZZA 4IBNA 4O0JA 4CGHA 4DS5A 2G8UA 1ASUA 1RT7A 2VG6A 3VQCA 4JS4A 4J2BA 2P5GA 4KO0A 1D5AA 2GV9A 3O3FA 4FLXA 1S5JA 2HNYA 1EX4A 1BQMA 1NOZA 2YV0X 3QNNA 3TAFA 3S3OA 3V1OA 4B9SA 4KI4A 1RDDA 4FXDA 2HHUA 1RBVA 3SPYA 1TAUA 4OPJA 3CFPA 5KGWA 5DK5A 1C6VA 3DRPA 3AO1A 1JLCA 3PX6A 5HBMA 3V1RA 4E0DA 5E41A 3OYEA 4BACA 2BE2A 1U47A 4UQGA 4KTWA 4B3OA 4B08A 4FK4A 3TABA 2OZMA 1SV5A 3ZSVA 4F3TA 4FCYA 1L3SA 1I3AA 1WSHA 2VWJA 4CK3A 3RMDA 4AILC 3S3MA 1Q9YA 1EXQA 3ZSWA 2OYQA 1J54A 2KQ2A 4O55A 4C8KA 3AA2A 3OYGA 2FBVA 3QEPA 4CECA 4CFCA 3ITHA 2HVHA 3P83D 4DTXA 4H8KA 4FJNA 3C6UA 1VRUA 1ZBUA 3PV8A 4CFAA 4DF8A 2X78A 5FDLA 1NK7A 4CGFA 1C0MA 3O3GA 4CJKA 3DRRA 3LZJA 3RTVA 2OPRA 1RT4A 4N56A 4LH5A 4CK1A 2KZZA 2DTUA 4FJ7A 1U49A 2X74A 3DI6A 1VSEA 2G8KA 2OA8A 1BI4A 4DTUA 3DOLA 4OJRA 3V1QA 4KHUA 1WAJA 4Y1CA 1VSJA 3LAMA 3MECA 4E7IA 3L3VA 1WLJA 1ASWA 1RT2A 3QNOA 3V81A 1LWEA 3G10A 3OYBA 2XY5A 1L3TA 1KSPA 1RBUA 3AA5X 1TK8A 3AVHA 2OZSA 4CE9A 4FZYA 1BIZA 1K6YA 1L3VA 4LD0A 4E89A 4I9QA 4LSLA 2XO7A 3PO4A 4E7KA 4PY5A 1WN7A 5EU7A 1HPZA 4E7LA 3PX4A 1D9DA 1KTQA 3HXMA 1RBRA 2RN2A 3ZSXA 1F21A 3QLHA 2OPQA 3EY1A 3PO5A 2P1JA 4CGJA 1JLGA 5K14A 1XWLA 4DU4A 2LSNA 3AO5A 3QEWA 3ZCMA 3RR7A 3AVMA 4OPKA 1S9GA 3HP6A 1YT3A 3VQ7A 3OVNA 4M3WA 2JLEA 3ZSOA 3OYNA 3TAQA 4W5RA 2ZE2A 4FJ5A 2EHGA 4CESA 3I0SA 3OYAA 4DSJA 3K5MA 4DTNA 2NUBA 4CJUA 1Y97A 3CYMA 3NCIA 5I3UA 4KHNA 4Q0BA 4W5NA 2DFFA 3V6DA 4CK2A 2XY8A 2ETJA 4DTRA 5FRMA 1QTMA 4CEEA 4Z4FA 3L2UA 3IG1A 4IDKA 3THVA 2Z1HA 1HYSA 2PZSA 1JXBA 1RDCA 1J53A 1S6PA 4ZTJA 3B6OA 4CGGA 5HRPA 4ZHRA 4DFPA 1UA0A 4DSKA 2OPSA 1NK5A 1NK0A 4KTQA 3WNFA 1HJRA 3HSTB 1DTQA 2A1RA 1U45A 1SKWA 4W5QA 4HCBA 4M3ZA 3KD5E 3RRHA 1HNVA 2VWKA 2Z1GA 4QOZB 5FROA 2WONA 3OJUA 1T05A 3M8SA 4L8RB 3BGRA 1W0HA 4CJPA 1NJWA 4F3OA 1HRHA 4E1NA 3V9XA 2HNDA 4HUFA 4DTPA 2XRIA 4M45A 4CHNA 3QERA 1HNIA 3EYZA 4WE1A 3LZIA 2KFZA 1IH7A 2B6AA 3SUNA 2Z1JA 4CJ3A 1VRTA 4AHRA 1NJZA 3MEEA 4FJMA 3O3HA 4RW4A 3SUQA 3AA4A 4CJ4A 1YVUA 3P5JA 2HHSA 1B9DA 1Q8IA 4FVMA 4BDPA 1IKYA 1A5WA 2F96A 3OYMA 2HHXA 3AVLA 3U3YA 3HYFA 4N76A 3V9ZA 3L2VA 3DYAA 1FK9A 5T7BA 1TV6A 2P51A 4HTUA 1LV5A 3HPHA 1SL1A 3MXIA 4F2RA 2E4LA 3I0RA 1FKPA 4C8MA 3LWLA 3AVAA 3RMCA 1JLQA 4FM1A 1D9FA 3AVJA 4CF0A 5KRSA 1C1CA 3OYFA 4FM0A 4CFDA 2FBXA
chains in the Genus database with same CATH superfamily
1JLFA 1T3VA 3PIOL 1HQEA 4A57A 3VGKA 5KTQA 2O8EB 4YOYA 3D6RA 1WBDA 2QWLA 3KZBA 3HO1A 3MCAB 2F4VK 3KLHA 3HSCA 3THXB 3O9QA 3BY5A 3AA3A 3ALYA 2UUCK 3O9RA 4DTSA 4IEIA 2VWBA 2Q97A 4DR3K 2HBJA 1XI1A 3HL8A 1NBWA 3KLIA 3T1AA 1T6CA 3FFKB 3C94A 1NK9A 1X9WA 5LY3A 4CJSA 2KFNA 1BIUA 1JCGA 3QIPA 3LWMA 4BRQA 4KHWA 4M42A 2HNZA 4B8CA 2F8SA 4BVOA 1HLUA 1O1WA 3NGZA 4ISFA 4JKFA 1N33K 4FSVA 2YJFA 2NNWA 2IGIA 1DT9A 2E8AA 1J5EK 2HHWA 1IKWA 3ZT3A 4H5TA 3CPWM 3VERA 4CZLA 4CHQA 4NCBA 3CCUN 4CEQA 2A41A 1NGEA 4ILJA 4A5BA 1ZBSA 3DLGA 3O4WA 2P9PA 4WQ4C 3SYZA 3PUFA 4LSNA 1KLMA 1ZC6A 3SQ0A 2QW9A 1Z26A 4QAGA 3P1GA 5LMUK 3CXCM 1KVAA 4GV3A 1C0TA 1TL3A 1S22A 3L8BA 5JMVA 3KLFA 2G8WA 3C6TA 3SUOA 3K0SA 3CCVN 3ZSZA 5JVHL 2I5JA 4Z4GA 3WXKA 3EE9A 4QS9A 2ASPA 3QMLA 3CC4N 4EFHA 2KW4A 3AARA 2E2NA 4DV7K 1VSFA 4Q0BA 3KTQA 4A5AA 2YNIA 4FWQA 1RDWX 5BN9A 3NH0A 4K43A 3BP8A 3PSIA 3CM5A 3ENOA 3OTOK 4MO4A 1G15A 4GW6A 3HT3A 1M1KO 5GADP 4FW1A 1VQ7N 3IS9A 1KXPA 1IO2A 4JRQA 2IAJA 5FPDA 3AGKA 3VQDA 2NZTA 4MFBA 2VG5A 5LJWA 3M8QA 3O5BA 3E1YA 5HRNA 1EP4A 1RT5A 3I56N 1G99A 2CGLA 4KHSA 1JCFA 3CI5A 3ZSRA 4DSEA 3NGYA 3V9SA 3CCRN 4LFBK 3MXJA 3DJCA 3OYDA 4DSIA 3SAHA 3VPZA 1A5VA 4A61A 3MXMA 1BWFO 2QI2A 4HTLA 5AR0A 5AQFA 4DV5K 3VA3A 4B8AB 2G8FA 4DU1A 3U9DA 1BHLA 4CGDA 4BE0A 4OLBA 4JKGA 3TANA 1EKEA 5CYQA 3QFPA 3FZKA 4KH4A 3OYJA 2WFBA 1GLEG 3D7EO 1TKDA 5AQPA 3Q7CA 5IT9O 3TU5A 2IS3A 3V9UA 4AM7A 2A40A 1BI4B 2GEMA 1NGIA 4Z4IA 5JS1A 3G71N 1KVCA 3D2EB 3SJHA 4C8LA 5C42A 4CEBA 4C23A 4CBWA 4M41A 2VQFK 3AVBA 5AQSA 1TKTA 4G9ZA 1RILA 2E20A 2WBNA 2P9KB 4RW8A 1IV0A 4IFVA 4OGCA 4B1WB 2KTQA 3TI0A 3F5TA 4FVUA 1LW2A 1XMOK 3PSFA 3ASMA 4CF9A 4CHZA 2OTLN 3OYCA 4A2BA 4K25A 2E2QA 1VK0A 2BUPA 2X6NA 3WEEB 1VQON 1N34K 4CZHA 3DLLL 2Y1JA 3A5MC 4FLYA 3OS1A 3WEEA 3UKUA 3WNGA 3GG4A 4JLHA 2O4IA 1LW0A 4CBUA 2NRZA 2O8FA 1CZAN 3O9TA 4H0PA 3QESA 3GL1A 3CCLN 3E9PA 1WAFA 2CH6A 2HBLA 3H46O 4DG1A 1QQNA 3HK2A 4FLWA 4K8XA 2GBZA 3IMXA 1VSDA 1ITGA 4BRGA 3CPEA 1JL2A 3G25A 3KK2A 4IJAA 5BR8K 1YITN 4GVEA 1NJYA 4JS5A 1K8AO 4JEPA 3OJSA 3VQPA 1NJIO 4CJLA 5CZ2A 4H5RA 3VTIA 4NYFA 4IZ9A 4DFMA 2QK9A 1FW6A 3DM2A 2D4WA 1ZBLA 2YKNA 3SBTA 3H45C 1KRPA 3H6EA 1HYZA 1YHQN 1EETA 4DQQA 4X62K 4DHYA 4DLEA 3LP0A 5BPMA 1X3NA 3GBTA 2QTDA 3O1WA 5C24A 4O5FA 5KGXA 3O9SA 4Q5VA 2FC0A 3M1FA 1BG3A 3FLCO 4CJFA 1X1PA 4YDUA 4DV1K 4DKWA 4AHTA 3K59A 4YFUA 5BREA 2D0PA 2P9SA 2Z1IA 4QCLA 1J6ZA 3SMPA 3QEVA 4FJGA 3BEXA 3CG7A 4FZZA 4O0JA 3AY9A 4KO0A 1D5AA 2GV9A 3D2FB 5M1NA 3S3OA 2YV0X 4KI4A 3TAFA 3V1OA 4PKIA 5BPNA 1RBVA 5LL6Z 4OPJA 5KGWA 1YUWA 4B9QA 5E41A 4ISGA 4BACA 4YOUA 1HKGA 4BRDA 1K8KB 4B08A 2OZMA 1SV5A 4CK3A 1EXQA 4C8KA 2KQ2A 4O55A 2O8FB 3E9LA 4BRFA 3FZFA 5FDLA 1WBBA 4CGFA 5AQXA 1RT4A 4LH5A 1VQNN 2KZZA 3CMAN 2OA8A 3DOLA 4OJRA 4BROA 4KHUA 1WAJA 3T69A 4O8UA 4YY3K 3ZX0A 3QNOA 3D2EA 5AZJB 1BIZA 4NXMK 5AQMA 4CW7B 2HMPA 4I9QA 4E7KA 1WN7A 1HPZA 4NO7A 3RSEA 4E7LA 3O08A 2RN2A 1N36K 1JLGA 1XWLA 2V52B 4WQ4A 4YDUC 2ASOA 3AVMA 3SMSA 1S9GA 4OPKA 3VQ7A 3VEVA 3C7NB 3ZSOA 4W5RA 4BREA 4BR5A 4IFEA 4CESA 4DSJA 1KAZA 5EOYA 4BQLA 3NCIA 1M90O 2ETJA 3IG1A 4IDKA 2QWMA 2Z1HA 2QWNA 1JXBA 1S6PA 1J53A 4ZTJA 4DFPA 1NLVA 3HTVA 3WNFA 1HJRA 4GV6A 4W5QA 1SQKA 5FROA 1GLJO 2WONA 3LM2A 1VQLN 4F3OA 1GLFO 4E1NA 4JYAK 1IG8A 2QM1A 3VF6A 4HUFA 2GTDA 2XRIA 4IO8A 5C2DA 4DTPA 2Q1NA 3QERA 3LZIA 1IH7A 2B6AA 3O8MA 1NJZA 4FJMA 1ILYA 3SUQA 1T6DA 2VQEK 1B9DA 1BOTO 4CVNE 4N76A 4JI2K 5T7BA 4HTUA 3MXIA 2P9LA 4F2RA 2E4LA 5HL7L 1JLQA 1D9FA 3VEZA 4FJNA 4FM0A 4CFDA 2WOMA 3AVKA 3BF3A 4RWTA 4GKJK 2Q0RA 1NOYA 3FFIA 1VQMN 4DU3A 4DTJA 3PLAA 2XY6A 1TGOA 3SJJA 4DSLA 1S1UA 2UXBK 1NM1A 4KH6A 3C6HA 2VCPA 3L2RA 1K9MO 3KKSA 4BRHA 2F8TA 2PYLA 2YHYA 2I7NA 1Q82O 4IG3A 1X9JA 2D5RA 3T19A 3DLKA 4ID1A 4OGEA 1RT3A 2AJQA 3P39A 1S1VA 5J2NA 1E4GT 2BANA 2ATQA 1QHTA 3ZX2A 3NGIA 5J1EA 4IO9L 3DMJA 4BRNA 5D3GA 2KZMA 3MN6A 3O1BA 1XHZA 5DMRA 3EE8A 3R9PA 2E6LA 2O8BB 4H4MA 5JVGL 3WUHA 1P8ZA 4JI6K 4A2AA 3ZT2A 2Q31A 3EN9A 3SI6A 1OH7A 4OVLA 3VQ6A 3VQEA 2PBDA 4JN4A 2E1ZA 4CF1A 1HNWK 5KI6A 4N47A 1U2VB 2B4JA 2IVPA 3W3DA 2WC9A 4HUGA 4FO0A 2CGKA 4B1UB 4ELTA 3QBXA 2UUAK 3TAPA 1RTDA 4G1QA 1JJ2M 3NF7A 1CLQA 1T44A 2ZF5O 3D0PA 1CXUA 4EP5A 4ZTFA 4IKFA 1TK0A 1BCOA 3BDPA 4YOWA 3LANA 1YJWN 4CERA 2A1SA 5JICA 4NYNA 4J2EA 1VSMA 3JYTA 1YI2N 4CZIA 3DXMB 2P9IB 3C6AA 3J80O 1IKVA 4CF2A 3E66A 4DFJA 4NCGA 2HHVA 3EEQA 5EVZA 3S3NA 4JI1K 4F8RA 4JI5K 4C8NA 3DLEA 4M3UA 5M1QA 4RG8A 3MEGA 2O8CB 3DLBA 1C1AA 3VQAA 4BR9A 2BGGA 2IVOA 2QWPA 3HM9A 1WSJA 2YCHA 3J7ZO 1GLDG 3N4QA 1JLAA 4FJ8A 3THWB 3ZT4A 4RW6A 3SPZA 1RTHA 3HPOA 4ELUA 3THWA 3JS6A 1OVYA 2OANA 3L4IA 5AQTA 2J4RA 2P9UA 1XHXA 4DMNA 2WTUA 1TL1A 3QO9A 3HJFA 3VENA 3HVTA 1VQ8N 3CJ7A 4PUOA 1BL3A 3A2FA 4CZJA 2E5LK 3PX0A 3QBWA 4FLTA 1HYVA 3JSMA 2P5OA 3VN5A 4Z94A 3WXJA 4BC4A 4MQ3A 4FWOA 4JI0K 4B9LA 4LF5K 4E1MA 1RFQA 1N8RO 1EO1A 5FPMA 3SQ4A 4H4OA 1QE1A 3DOKA 3ZSYA 4DV6K 1XQSC 4M3RA 3E01A 3EL2A 1JL1A 4FPAA 3T7ZA 3HI0A 5I42A 2D0AA 4X66K 1E3MA 1RDBA 2I7PA 3SZ2A 4EHUA 5ADXA 1L5UA 3NHGA 4JRPA 4AHUA 2IOCA 1TUYA 3ZT1A 3NF9A 1V4SA 1U2VA 4Z0UA 4X64K 3U3GA 4FLZA 2HOEA 3VGLA 4B1VA 4DLGA 4CGIA 4B3MK 4O5BA 3A8YA 3CCJN 3HVRA 4B3RK 4FWKA 3AO4A 4B1YB 2W40A 3LP3A 4K41A 2E6MA 5C25A 4ID5A 1ZYQA 1NGDA 3MN9A 1RT1A 3K58A 3IDHA 4PWDA 2VGMA 2YNHA 3NVKA 3C0BA 1LWCA 1GOBA 2D0CA 1JLBA 4B1ZA 2D1KA 3VEXA 1YJ9N 4E19A 4DR4K 1Z6RA 3WQUA 4KHYA 4DFKA 1OKJA 1WSEA 2RPIA 1MWMA 2YI1A 3LDQA 3HP9A 4EZ6A 3O4QA 4CJEA 3VQ9A 1KAXA 1YTAA 2V7YA 2ZQBA 2NLXA 3O6WA 1WSIA 4NCAA 1S1XA 5M1PA 3DLHA 5C10A 3A5OC 3CC7N 4DS4A 5CY4A 1SKRA 3KVGA 3NF8A 3AVIA 4N41A 1BCMA 4YHHK 2NRWA 1HKBA 3IRXA 3EZ5A 3ENHA 3OYHA 4KB1A 4KPYA 4JKCA 3VA0A 1T03A 3TAEA 4GMJB 3AV9A 2YHXA 3OYKA 5AZIA 4H0OA 4LH4A 3L2WA 4O44A 4Z4EA 4CJ5A 1YAGA 4N5SA 3LPTA 3TTCA 5KQ8A 2OPPA 2YHWA 4QS8A 5HLFA 1U48A 3RRGA 4CCHA 1U6ZA 5KQDA 5AQOA 2BDPA 3VEWA 3AAPA 3FE1A 3R1XA 3CMEN 4KH5A 3VQ5A 3QEIA 3T1YK 1W9HA 3AAQA 4IBNA 4CGHA 1Z05A 2G8UA 4JS4A 3VQCA 4BY9C 3DXKA 3H3OB 3TTFA 3O3FA 1EX4A 2DPNA 5KPRA 3O80A 4B9SA 2HHUA 1TAUA 4FWPA 3PX6A 3H1QA 3G6EN 3OYEA 2BE2A 4UQGA 4KTWA 4B3OA 1HPMA 4H0VB 3TABA 1EWRA 2P9KA 1I3AA 1WSHA 3JAMO 4BQZA 3SLCA 4CZFA 1DEJA 1Q9YA 3ZSWA 2ZJPL 1KC8O 2FBVA 1YJNN 5C12A 3ITHA 1NGBA 3P83D 4H8KA 4DTXA 4EAHD 5F0XA 3PV8A 4CFAA 4DF8A 1C0MA 3LZJA 4X65K 4CK1A 2X74A 3LM9A 2G8KA 4ILHA 1BI4A 2E88A 2ZWHA 5BN8A 5LMNK 4H5VA 2H3GX 2PFUA 1WLJA 3V81A 1RT2A 3G10A 3WQTA 1KSPA 3AA5X 3AVHA 3UKUB 4FZYA 2W6LA 4MDBA 4I6MA 1NGGA 3PX4A 1KTQA 3LDNA 2F7TA 2OPQA 3EY1A 4CGJA 5K14A 4B3TK 1VQPN 2RE2A 4OX9K 5AQLA 1Q81O 1YT3A 4M3WA 2KHOA 3OYNA 4H0YB 3UB5A 3LDLA 3CYMA 1FJGK 5I3UA 3V6DA 4CK2A 4DTRA 3LDOA 4CEEA 4Z4FA 1RDCA 3ULEB 4CBXA 4CGGA 5HRPA 2OPSA 3DXMA 4KBOA 1S3XA 3VESA 1U45A 1SKWA 4JK7A 3KD5E 1HNVA 1HR0K 2UXDK 3OJUA 1T05A 2IIRA 3M8SA 2BH1A 5ELZA 4BR2A 3GDQA 5GAHP 1ESVA 4WE1A 1C0FA 5KPTA 2KFZA 3P31A 3THXA 1IBLK 4AHRA 5AQNA 3MEEA 4RW4A 5FPEA 3AA4A 4FWNA 3P5JA 1Q18A 1Q8IA 2HHXA 1IKYA 1A5WA 1BO5O 3THYA 1TV6A 1LV5A 4C8MA 2FF3B 3LWLA 3RMCA 3OYFA 1C1CA 1O13A 4MLHA 3JXUA 4AQYK 3A0IX 4FW2A 1X9SA 3CJBA 5HRSA 3EZWA 4HWIA 4UY8O 1T7PA 1NGCA 4DSFA 1REVA 4KFBA 3QFUA 4PA1A 1N6QA 3MWPA 4FOIA 4W5TA 1RT6A 4LF8K 3KK7A 4EHTA 3J81O 4FWMA 1I94K 1FXXA 1T8EA 4I6MB 3CC2N 4BC2A 1TAQA 2RHKA 4KTZA 2HVIA 3R6MA 3S41A 4J2AA 1I39A 4O4GA 2CH5A 4IG0A 4DQPA 3U9ZA 3KJVA 2Q0UA 4CZGA 2AP1A 4FJIA 4FWRA 4TSXA 2JGUA 3NF6A 3ATVA 2VGNA 3AVGA 1S72N 2O4GA 4H03B 4HCCA 4DR7K 2QXLA 3D2FA 3U4LA 2ZJRL 2HSTA 1RDAA 3LL3A 1QZ5A 3D45A 2HW3A 5F2RA 2PAVA 1KD1O 1VQKN 1HQUA 1SKSA 4JKDA 1R59O 1WOQA 3KK1A 2HBMA 5AQUA 1CXQA 5SWMA 2UYTA 4CIFA 1WNSA 4KHPK 1TYQA 1EQYA 1MU2A 2P9IA 1NK8A 2O8DB 4JHDA 4AM6A 1HKCA 3K5NA 3OYIA 3A5LC 4GVMA 5CZ1A 4OKKA 3HM8A 3QINA 3CCSN 4XIUA 1BDGA 1C0GA 1NJXA 1W7AA 2FBTA 4FJKA 2KKZA 1JXEA 1OVQA 3RWUA 2GUPA 4J8FA 5KRTA 5J2PA 4ELVA 1W2BM 3NMUA 1NGAA 1NK4A 1W97L 3I8DA 2QWOA 4OPAA 1QSLA 4KRFA 4XH1A 3VQQA 4AH9A 1RBSA 1GOCA 2YNGA 3V4IA 1X3MA 4HHTA 3K5OA 3TSUA 3CCQN 3MN5A 4HVJA 3KK3A 5BR9A 4GNIA 3SV3A 4LF4K 4LF9K 1JKHA 1DLOA 2GX9A 3NH1A 3TAMA 5J2MA 2HB5A 3TWHA 2GWJA 3VEOA 3ZETB 3L2QA 5AQQA 3ULEA 3PY8A 3FR0A 5C15A 5HRRA 4B9UA 2R7YA 1KAYA 3QIOA 3NFAA 2G8IA 3F9MA 3MEDA 2OTJN 1BA0A 1GOAA 2E2PA 3TR8A 4CF8A 3TPQA 2ZJQL 4DR2K 3MX5A 1GLBG 1XNQK 2Q3SA 4J2DA 2JWKA 5I9EB 5GINA 1HMVA 1TK5A 4DQIA 4HUEA 1KLNA 4M3XA 1GLCG 3LP1A 5E84A 2V51B 4KKOA 3AVNA 4BWMA 4CEZA 1C0UA 4H5NA 3SCXA 4I2PA 2P9SB 3VTHA 3LDSA 3L3UA 4FZXC 3WNHA 1X9MA 3ZEUB 5AQYA 4MO5A 3QB0A 4OO1J 4Y0WA 3CJAA 3AO2A 4W5OA 5M1KA 1S1TA 3SQ2A 4EP4A 1NGJA 2YHBA 1TVRA 3F2KA 4DCHA 4K8ZA 5BRDA 2HMIA 2Q36A 3M6GA 3NE6A 1ATSA 1K8KA 3HOSA 1DGKN 1Q7YO 2E2OA 5BRHA 3GE1A 4Y1DA 4WFAL 1BISA 3WNEA 1VQ4N 4RW9A 3LAKA 1BGXT 3CQXA 3MCPA 4DTMA 4XH5A 4PKHA 2GUIA 3B6PA 3HBTA 3K5LA 2QKKA 1U04A 3VEYA 4KV8A 2A6AA 5SZTA 4E7HA 3NAEA 1QZ6A 3VMFB 4DR6K 1RNHA 4GV9A 4AHSA 1DTTA 1SL2A 4C8OA 4MDAA 3OBWA 3OYLA 4DUZK 1RTJA 5F1XA 5AQGA 2NRHA 3P38A 1N5YA 1BQNA 2AA4A 3MMVA 2YJEA 3C65A 2E1YA 2G8VA 1IJJA 3VQ4A 1KFSA 2ZGYA 3CFRA 1SZ2A 3ULDA 3K57A 4PQUA 2RKIA 1SUQA 3CQ8A 3M8PA 4NXNK 3MDQA 3RMAA 1QSSA 4LY7A 4CFBA 1XC3A 4I9LA 1KFDA 4YORA 4C1NK 4O0IA 3S9HA 2OCEA 1ZBIA 4BRKA 2O8CA 4FK2A 4JKAA 3VQ8A 5GIOA 3QEXA 1KCFA 5AQIA 4BGBA 1R0AA 4BR0A 4BE1A 4Z4HA 4CIGA 4CJ7A 4JI3K 1VSLA 4GY2B 3O4NA 4GKKK 1LWFA 4FPBA 4DF4A 1NMDA 1Q9XA 1WUAA 5AFUA 4KI6A 3WXMB 2HHTA 4CJQA 4R5PA 4CZKA 4F2SA 3OS2A 3L0QA 4BE2A 4JKGB 1P90A 1GLLO 1D8YA 3FGUA 1ASVA 1QSYA 1S1WA 3AVCA 1WB9A 2PY5A 2QXFA 3DRSA 3L6QA 3C95A 3FZHA 3IFRA 1NKCA 1LAVA 1UAXA 3CFOA 3IUCA 3I8BA 4DS5A 1RT7A 2VG6A 3SBGA 4H5WA 2P5GA 4DB3A 4WQ5C 1GLAG 2JWLA 1NOZA 3WT0A 4DV4K 3ID6A 3HOTA 3UE5A 3SPYA 3CFPA 5DK5A 2ASMA 3DRPA 3AO1A 4IWVA 3V1RA 3KWGA 4WCEL 4FK4A 5H1SQ 1Y64A 3ZSVA 2FXUA 5GAGP 4JHDB 2D0OA 2A3ZA 3VGMA 3BZCA 4ILGB 3AA2A 5MLCQ 3CD6N 2UU9K 4CFCA 3DAWA 3C6UA 2NRTA 2X78A 3QDKA 4CJKA 3RTVA 2OPRA 4H0TB 2DTUA 1U49A 5JLHA 4H0XB 4Y1CA 3LAMA 3MECA 3ZEUA 4E7IA 3L3VA 1QVGM 1ASWA 5AQHA 4B9VA 3OYBA 1BU6O 1L3TA 1RBUA 1TK8A 2OZSA 5A2QO 1K6YA 4PL7A 1MA9B 4YOXA 4LD0A 5DM6L 4M7XA 3PO4A 4PY5A 5EU7A 2P9NA 1HX1A 3T1HK 5B8HA 1F21A 3QLHA 4LF7K 2P1JA 1VAZA 4DU4A 3AO5A 1SAZA 5AQWA 4E1JA 5BRFA 3OVNA 2JLEA 1XUPO 5AJ3K 3TAQA 2QWRA 2ZE2A 1XMQK 2EHGA 3I0SA 3I33A 3O9UA 3K5MA 3CCMN 2NUBA 4KHNA 1Y97A 1VHXA 4CZEA 2XY8A 5FRMA 5FPNA 3EO3A 5ADXH 3CF5L 3L2UA 3THVA 1HYSA 1D9DA 4DSKA 2FSJA 3B6OA 4PL8A 1UA0A 1NK5A 4CD1A 4IOCL 2A1RA 2HBKA 3RRHA 1ATRA 2VWKA 2Z1GA 4QOZB 2UXCK 3BGRA 1W0HA 4RCHA 4CJPA 3V9XA 3VF2A 4M45A 5LJVA 3EYZA 4XH4A 2FF6A 3SUNA 2Z1JA 4IDHA 1VRTA 3B8AX 3O3HA 1YVUA 2HHSA 4BDPA 3A5NC 3AVLA 4BRIA 3U3YA 3MN7A 4FWLA 3V9ZA 1FK9A 1SS6A 2P51A 1DKGD 3HPHA 3I0RA 1FKPA 3K9KA 3J7AP 3AVAA 3AVJA 4FL9A 2FBXA 4EIAA 4OLAA 4WFBL 3RR8A 4YOVA 3DXKB 3AO3A 3QICA 4JKHA 3KHYA 4IFYA 4CJWA 2EX3A 3P4IA 2QKBA 3VETA 1NWKA 4PKGA 5FRNA 1TYQB 4CIEA 4E3SA 1RCHA 5AQZA 3K2PA 4FJHA 2XY7A 1CZBA 2FLOA 4CHOA 1NMNA 3H3NO 1CZ9A 2NRVA 3ZT0A 4BRCA 4K42A 4JD2A 3G0ZA 2IVNA 4B9NA 2O8EA 2IDOA 4M3TA 1J5OA 4JKEA 4JD2B 1L3UA 3N4PA 3AVFA 2FSNA 4FOEA 1VSHA 1JCEA 1NK6A 3ENBA 3KLEA 4EZ9A 5TKWA 1YVNA 1Z25A 4BC3A 5M1OA 3CQYA 3SNNA 4LF6K 1VQ6N 1S6QA 1KQSM 1BA1A 1LCUA 4FJXA 1LOTB 5EX5A 4CJRA 5E26A 1HUXA 2D0BA 4FJJA 1VQ9N 1RBTA 4BR4A 3I55N 3V9WA 1A5XA 3ID8A 3R8EA 4F4KA 3EKUA 4XEIA 3UKRA 4DV3K 2BTFA 2YKMA 4KHQA 2RF2A 5C2FA 2Q2RA 2YHAA 3H08A 3FZLA 4DV2K 5EY4A 1NKBA 1ZBHA 1XC9A 2QEXN 4DUYK 1QS4A 3AGRA 2V7ZA 2YNFA 3LALA 1S9EA 4BRPA 4CEFA 4B9MA 4E7JA 5AQRA 2ITMA 4FLUA 2B5JA 1SL0A 4O8KA 4BRMA 3KD1E 5JS2A 2GELA 1TKZA 5GAEP 4JI7K 4JI4K 2Y1IA 1WSFA 4U67L 1J9AA 3U6FA 4Z4CA 2VYPA 4C1NI 2P9LB 3KKRA 3TAGA 3TSPA 1QQCA 4YNQA 4IOAL 2G8HA 3E9OA 4ICLA 4JAXA 3HZ6A 1EWQA 4ISEA 1MWKA 4CEDA 5AZIB 3IAYA 5CR4A 3CJCA 5DM7L 1YF5L 4BG8A 3OA9A 4A59A 1RTIA 4BRLA 3F9KA 3VOVA 4KREA 1YIJN 1NKEA 4AHVA 2W41A 2FBYA 1UA1A 2GWKA 3CM6A 3HRGA 2HHQA 5HOOA 4I2QA 3TTDA 3VQBA 3SV4A 4B3SK 1BUPA 4CI6A 4BDYA 1K73O 2ITGA 2DY4A 4CJVA 4NLBA 1KVBA 2ZD1A 3RVCA 5CHIA 1YTUA 4BDZA 1B9FA 4PHTX 4FM2A 3OY9A 4NB4A 4IOXA 3ZLJA 3RMBA 4FLVA 4CHYA 2HHHK 3SAFA 1UWBA 1IG9A 1U4BA 1ATNA 3K9JA 5AZJA 4CJTA 4WF9L 1VSIA 1NGHA 2DFHA 4BRAA 3LPUA 4I7FA 4JKBA 5AQKA 3ZX3A 2XHBA 3SUPA 5C0YA 4IEEA 4K0KK 4BWJA 5HROA 1NU0A 1JLEA 3C7NA 2W42A 5CYMA 3M8RA 1ZXOA 1QQMA 4FK0A 1E4FT 4CHPA 5J2QA 4CD3A 4R79A 1B92A 2QWQA 4BGAA 3BUZB 2CGJA 2IC3A 3QETA 2VG7A 4FJLA 1HJOA 4FYDA 4MLEA 5AQVA 3MWTA 3CETA 4KB0A 1OH5A 2O8DA 3TSQA 2DFEA 4BVPA 2PYJA 2YX6A 2HF3A 3KWIA 4JI8K 4KAZA 4CEOA 1UOCA 3KLGA 3T3FA 3QEPA 4CEAA 4RW7A 3DLRA 3NDKA 2NRXA 4M3YA 4YOTA 3LP2A 4BC5A 2HF4A 3IKMA 3SQ1A 4F9OA 3J8AA 5EXWA 3TARA 4JV5K 1LAWA 2X6SA 4RTFD 1RDUA 2P9NB 1VSKA 3CJ1A 4JK9A 1FKOA 3NVMA 3CJ9A 4DR5K 4B9TA 3ISNC 4OPHA 4V19S 2ZM6K 3CIPA 1C1BA 5HP1A 4DQSA 2EWSA 1OH6A 4DTOA 4JK8A 3OS0A 4CZMA 5KPZA 1IKXA 3F73A 1WSGA 3MAQA 3M5RA 4DQRA 3HPGA 4OKEA 3WXLA 3ZSQA 3NH2A 3H1VX 4AHCA 4OKJA 2A42A 4M7YA 4FJ9A 1TKXA 3KIOA 1N32K 4IJNA 3THYB 3LDPA 4QS7A 3U8XA 4L3QA 3ATUA 1IBMK 5AFUH 1ZBFA 4DWIA 3G4SN 3WXIA 3UIQA 3NBPA 1QHAA 4U7BA 4J2BA 1ASUA 3MK6A 4DQ8A 3QNNA 4FLXA 1S5JA 2HNYA 1BQMA 4FXDA 1RDDA 4BR7A 3L4QA 1V4TA 1QVFM 2ZGZA 3GOIA 1C6VA 1JLCA 1OH8A 3BF1A 5HBMA 2A5XA 1Q86O 4E0DA 1U47A 4LFAK 1QQOA 2P9PB 3MX2A 4F3TA 4FCYA 1L3SA 4BG9A 2VWJA 3RMDA 4AILC 3S3MA 1H1VA 2OYQA 1J54A 4FWSA 3OYGA 4CECA 2HVHA 1VQ5N 1VRUA 1ZBUA 3CHWA 1NK7A 4DV0K 3O3GA 3DRRA 2NRRA 3Q7BA 4N56A 4FJ7A 3DI6A 1VSEA 4DTUA 3V1QA 2F9TA 1VSJA 3EKSA 4WYBA 2XY5A 1LWEA 3CERA 1HNZK 3OW2M 4CE9A 1XNRK 3W0LA 3RSEB 5TKYA 2O8BA 4M63C 1L3VA 4E89A 4DR1K 4LSLA 2XO7A 3HXMA 1RBRA 4LC9B 3ZSXA 3PO5A 3J7YP 2LSNA 2W6KA 4WQ5A 3QEWA 3ZCMA 3RR7A 4A62A 3HP6A 3OBYA 3R3LA 5AQJA 4FJ5A 3VF4A 3OYAA 4DTNA 1NNEA 3ZYYX 4CJUA 4IXCA 3PIPL 4W5NA 4WFNL 2DFFA 3OHRA 3SK3A 1D4XA 1QTMA 1MDUB 5GIPA 2F9WA 4AF1A 1NGFA 2PZSA 5JLFA 4ZHRA 1RGIA 1NK0A 1TUUA 1NG9A 4KTQA 1YXQA 3HSTB 1DTQA 4HCBA 4M3ZA 2FSKA 3CCEN 4JNEA 2KLAA 4L8RB 2QA4N 1NJWA 1HRHA 2UUBK 4LFCK 2HNDA 3M3ZA 5M1FA 5BPLA 4CHNA 1HNIA 4B1XB 5IWAK 1IBKK 4CJ3A 2P9UB 3FZMA 3BZKA 4CJ4A 3ZETA 5FLXO 4FVMA 3UKRB 2F96A 3OYMA 3SAGA 1HNXK 3DWLA 3HYFA 3L2VA 5CE3A 3DYAA 1SL1A 2WUSA 4CF0A 5KRSA 4NLCA 4FM1A
chains in the Genus database with same CATH topology
1JLFA 4FW2A 3RR8A 2WOMA 1X9SA 1HQEA 3AVKA 5KTQA 5HRSA 3AO3A 1NOYA 3FFIA 4DU3A 1T7PA 3HO1A 4DTJA 4DSFA 3KLHA 1REVA 4KFBA 2XY6A 1TGOA 3SJJA 4PA1A 1N6QA 4IFYA 4W5TA 1RT6A 4DSLA 4CJWA 2EX3A 3AA3A 2QKBA 3ALYA 1S1UA 4DTSA 5FRNA 1FXXA 1XI1A 3HL8A 1T8EA 3KLIA 3T1AA 3L2RA 1TAQA 4KTZA 2HVIA 3KKSA 3C94A 1I39A 4J2AA 1NK9A 2F8TA 4O4GA 2PYLA 1X9WA 2KFNA 4CJSA 4CIEA 4E3SA 4IG0A 1BIUA 1RCHA 4DQPA 3K2PA 3QIPA 3LWMA 3KJVA 4FJHA 4IG3A 4KHWA 2D5RA 2HNZA 3T19A 4B8CA 2XY7A 4FJIA 4M42A 3DLKA 1CZBA 4ID1A 4OGEA 2F8SA 1RT3A 1O1WA 4TSXA 2AJQA 4CHOA 5J2NA 1S1VA 3NGZA 2JGUA 3NF6A 1CZ9A 3AVGA 3ZT0A 2O4GA 2ATQA 2BANA 3G0ZA 1QHTA 3NGIA 4B9NA 4HCCA 5J1EA 4OLAA 2IDOA 3DMJA 4M3TA 1J5OA 2IGIA 5D3GA 2KZMA 1RDAA 3D45A 1L3UA 2HHWA 2HW3A 3AVFA 1IKWA 3ZT3A 1XHZA 5DMRA 1VSHA 1HQUA 4CHQA 4NCBA 1SKSA 2E6LA 4CEQA 1NK6A 4H4MA 3KLEA 3KK1A 1CXQA 3ZT2A 5SWMA 3DLGA 4EZ9A 3SI6A 1Z25A 4OVLA 3VQ6A 1WNSA 3PUFA 4LSNA 3VQEA 4CIFA 1KLMA 3SYZA 3SNNA 1MU2A 1NK8A 4CF1A 3SQ0A 3K5NA 1S6QA 1Z26A 4GVMA 4QAGA 3P1GA 5CZ1A 3OYIA 1KVAA 5KI6A 1C0TA 1TL3A 4N47A 4FJXA 4OKKA 3L8BA 2B4JA 3QINA 4CJRA 4XIUA 3KLFA 4HUGA 2G8WA 3C6TA 1NJXA 2D0BA 4FJJA 1RBTA 4ELTA 2FBTA 3SUOA 3ZSZA 3V9WA 1A5XA 4FJKA 4F4KA 1JXEA 3TAPA 2I5JA 1RTDA 4G1QA 3RWUA 4Z4GA 5KRTA 3NF7A 5J2PA 2YKMA 4KHQA 4ELVA 1CLQA 2RF2A 3D0PA 1CXUA 2YHAA 3H08A 4EP5A 4ZTFA 1NK4A 1TK0A 4IKFA 3I8DA 1BCOA 1NKBA 3BDPA 3LANA 1ZBHA 4B9VA 2KW4A 4CERA 1XC9A 2A1SA 4NYNA 1QS4A 1QSLA 4KRFA 4J2EA 1VSMA 3JYTA 3VQQA 1VSFA 4AH9A 3KTQA 1RBSA 1GOCA 2YNFA 1S9EA 3LALA 4CEFA 2YNIA 4B9MA 4E7JA 2YNGA 3V4IA 1IKVA 4FLUA 2B5JA 3NH0A 1SL0A 4CF2A 4HHTA 3K5OA 4DFJA 3KD1E 4HVJA 5JS2A 3KK3A 3CM5A 4NCGA 1TKZA 3SV3A 2HHVA 2Y1IA 1WSFA 3S3NA 1J9AA 1JKHA 3U6FA 4Z4CA 1G15A 4F8RA 1DLOA 4C8NA 3DLEA 4GW6A 3NH1A 3HT3A 3TAMA 5J2MA 4FW1A 4M3UA 2HB5A 3TWHA 3IS9A 3KKRA 1IO2A 3MEGA 4RG8A 3L2QA 4JRQA 3TAGA 2IAJA 3DLBA 1C1AA 1QQCA 3VQAA 4YNQA 2BGGA 3HM9A 3PY8A 1WSJA 3VQDA 4MFBA 2G8HA 4ICLA 2VG5A 5HRRA 4B9UA 3M8QA 2R7YA 1JLAA 5HRNA 4FJ8A 1EP4A 1RT5A 3ZT4A 3QIOA 4CEDA 3NFAA 2G8IA 3IAYA 3MEDA 4RW6A 3SPZA 1RTHA 3HPOA 4KHSA 4ELUA 1GOAA 3ZSRA 4DSEA 3TR8A 4CF8A 1RTIA 3NGYA 3V9SA 3MXJA 3F9KA 3OYDA 4DSIA 4KREA 1A5VA 3MXMA 1XHXA 4DMNA 1NKEA 4AHVA 1TL1A 3QO9A 2FBYA 1UA1A 3VA3A 2Q3SA 4PQUA 3CM6A 4B8AB 4J2DA 2G8FA 1HMVA 3HJFA 1TK5A 4DQIA 4HUEA 2HHQA 4I2QA 1KLNA 4M3XA 3HVTA 3VQBA 3SV4A 4DU1A 4BDYA 4PUOA 1BHLA 1BL3A 4CGDA 4BE0A 4OLBA 2ITGA 2DY4A 3A2FA 3LP1A 4CJVA 3TANA 3PX0A 1EKEA 1KVBA 2ZD1A 4FLTA 1HYVA 5CYQA 4KKOA 3JSMA 3VN5A 2P5OA 3AVNA 3OYJA 1YTUA 4BDZA 4BWMA 1B9FA 1C0UA 4MQ3A 4CEZA 3SCXA 1TKDA 4FM2A 4I2PA 4E1MA 3OY9A 4B9LA 3LDSA 3L3UA 4FZXC 3V9UA 2IS3A 3WNHA 1X9MA 1BI4B 3SQ4A 4H4OA 1QE1A 3DOKA 4Z4IA 5JS1A 1KVCA 3ZSYA 4FLVA 4CHYA 3RMBA 3AO2A 4W5OA 4C8LA 5C42A 1S1TA 4M3RA 3SQ2A 1UWBA 4EP4A 3E01A 1U4BA 1IG9A 1JL1A 4CEBA 2YHBA 1TVRA 5I42A 4K8ZA 2D0AA 4CJTA 4M41A 3AVBA 2HMIA 1RDBA 1TKTA 3NE6A 3SZ2A 1RILA 1L5UA 4RW8A 4IFVA 1VSIA 4OGCA 3NHGA 4JRPA 2DFHA 2IOCA 3LPUA 4I7FA 4AHUA 4Y1DA 2XHBA 3ZT1A 3NF9A 3SUPA 1BISA 3WNEA 3TI0A 2KTQA 4Z0UA 4BWJA 4RW9A 5HROA 3U3GA 1LW2A 4FLZA 3LAKA 1JLEA 2W42A 1BGXT 5CYMA 4DTMA 4DLGA 4CGIA 3ASMA 4CF9A 4O5BA 3M8RA 4CHZA 4FK0A 3HVRA 3OYCA 4CHPA 3AO4A 5J2QA 2GUIA 3LP3A 3B6PA 2E6MA 5C25A 4ID5A 3K5LA 1ZYQA 2QKKA 1B92A 1U04A 1RT1A 1VK0A 2IC3A 2X6NA 3K58A 3QETA 2VG7A 4FJLA 4PWDA 4KV8A 4FYDA 2Y1JA 5SZTA 4E7HA 3NAEA 2YNHA 4FLYA 3OS1A 1LWCA 1RNHA 4KB0A 3WNGA 1DTTA 4AHSA 1SL2A 4C8OA 3OYLA 1GOBA 4JLHA 2O4IA 1LW0A 1RTJA 2D0CA 1JLBA 3QESA 1N5YA 1BQNA 2DFEA 4E19A 1WAFA 2PYJA 2G8VA 4KHYA 4DG1A 4DFKA 3VQ4A 1WSEA 1KFSA 3HK2A 4KAZA 4CEOA 2RPIA 1UOCA 3KLGA 3CFRA 4FLWA 4K8XA 2GBZA 3T3FA 3HP9A 4EZ6A 3O4QA 1ITGA 1VSDA 4CEAA 4RW7A 2RKIA 4CJEA 1SUQA 1JL2A 3K57A 3ULDA 3CQ8A 3M8PA 3VQ9A 1YTAA 2ZQBA 3KK2A 3DLRA 3NDKA 3RMAA 1QSSA 1WSIA 4NCAA 1S1XA 4LY7A 4M3YA 4CFBA 3DLHA 3LP2A 1NJYA 4I9LA 1KFDA 5CY4A 4O0IA 4JS5A 4DS4A 3S9HA 3OJSA 3SQ1A 1SKRA 1ZBIA 3NF8A 3TARA 3AVIA 3VQPA 4N41A 1BCMA 1LAWA 2X6SA 5CZ2A 4CJLA 4FK2A 4NYFA 3IRXA 1VSKA 3VQ8A 4DFMA 3EZ5A 1FKOA 2QK9A 3OYHA 4KB1A 4B9TA 3QEXA 3DM2A 4KPYA 3VA0A 1T03A 1KCFA 3ISNC 1ZBLA 3TAEA 1R0AA 2YKNA 4GMJB 1KRPA 4BE1A 4Z4HA 3AV9A 4CIGA 1HYZA 1EETA 3OYKA 1VSLA 4DQQA 1C1BA 3O4NA 5HP1A 4DQSA 4DLEA 3LP0A 4LH4A 1LWFA 3L2WA 4DTOA 4DF4A 1Q9XA 4O44A 4KI6A 2HHTA 4Z4EA 4CJ5A 3OS0A 4CJQA 4N5SA 3LPTA 1IKXA 4R5PA 2OPPA 3F73A 1WSGA 4F2SA 3MAQA 5HLFA 4DQRA 1U48A 3OS2A 3RRGA 3HPGA 4OKEA 5C24A 5KGXA 4CCHA 3ZSQA 4Q5VA 2FC0A 3NH2A 4BE2A 4AHCA 4OKJA 4CJFA 1D8YA 4FJ9A 1ASVA 1TKXA 1X1PA 1QSYA 3KIOA 1S1WA 2BDPA 3AVCA 4AHTA 3K59A 4YFUA 2PY5A 2QXFA 3DRSA 2Z1IA 4QCLA 3C95A 1NKCA 3QEIA 1ZBFA 3VQ5A 3QEVA 1LAVA 4DWIA 1UAXA 3CG7A 3CFOA 4FJGA 3UIQA 3NBPA 1W9HA 4FZZA 4IBNA 4O0JA 4CGHA 4DS5A 2G8UA 1ASUA 1RT7A 2VG6A 3VQCA 4JS4A 4J2BA 2P5GA 4KO0A 1D5AA 2GV9A 3O3FA 4FLXA 1S5JA 2HNYA 1EX4A 1BQMA 1NOZA 2YV0X 3QNNA 3TAFA 3S3OA 3V1OA 4B9SA 4KI4A 1RDDA 4FXDA 2HHUA 1RBVA 3SPYA 1TAUA 4OPJA 3CFPA 5KGWA 5DK5A 1C6VA 3DRPA 3AO1A 1JLCA 3PX6A 5HBMA 3V1RA 4E0DA 5E41A 3OYEA 4BACA 2BE2A 1U47A 4UQGA 4KTWA 4B3OA 4B08A 4FK4A 3TABA 2OZMA 1SV5A 3ZSVA 4F3TA 4FCYA 1L3SA 1I3AA 1WSHA 2VWJA 4CK3A 3RMDA 4AILC 3S3MA 1Q9YA 1EXQA 3ZSWA 2OYQA 1J54A 2KQ2A 4O55A 4C8KA 3AA2A 3OYGA 2FBVA 3QEPA 4CECA 4CFCA 3ITHA 2HVHA 3P83D 4DTXA 4H8KA 4FJNA 3C6UA 1VRUA 1ZBUA 3PV8A 4CFAA 4DF8A 2X78A 5FDLA 1NK7A 4CGFA 1C0MA 3O3GA 4CJKA 3DRRA 3LZJA 3RTVA 2OPRA 1RT4A 4N56A 4LH5A 4CK1A 2KZZA 2DTUA 4FJ7A 1U49A 2X74A 3DI6A 1VSEA 2G8KA 2OA8A 1BI4A 4DTUA 3DOLA 4OJRA 3V1QA 4KHUA 1WAJA 4Y1CA 1VSJA 3LAMA 3MECA 4E7IA 3L3VA 1WLJA 1ASWA 1RT2A 3QNOA 3V81A 1LWEA 3G10A 3OYBA 2XY5A 1L3TA 1KSPA 1RBUA 3AA5X 1TK8A 3AVHA 2OZSA 4CE9A 4FZYA 1BIZA 1K6YA 1L3VA 4LD0A 4E89A 4I9QA 4LSLA 2XO7A 3PO4A 4E7KA 4PY5A 1WN7A 5EU7A 1HPZA 4E7LA 3PX4A 1D9DA 1KTQA 3HXMA 1RBRA 2RN2A 3ZSXA 1F21A 3QLHA 2OPQA 3EY1A 3PO5A 2P1JA 4CGJA 1JLGA 5K14A 1XWLA 4DU4A 2LSNA 3AO5A 3QEWA 3ZCMA 3RR7A 3AVMA 4OPKA 1S9GA 3HP6A 1YT3A 3VQ7A 3OVNA 4M3WA 2JLEA 3ZSOA 3OYNA 3TAQA 4W5RA 2ZE2A 4FJ5A 2EHGA 4CESA 3I0SA 3OYAA 4DSJA 3K5MA 4DTNA 2NUBA 4CJUA 1Y97A 3CYMA 3NCIA 5I3UA 4KHNA 4Q0BA 4W5NA 2DFFA 3V6DA 4CK2A 2XY8A 2ETJA 4DTRA 5FRMA 1QTMA 4CEEA 4Z4FA 3L2UA 3IG1A 4IDKA 3THVA 2Z1HA 1HYSA 2PZSA 1JXBA 1RDCA 1J53A 1S6PA 4ZTJA 3B6OA 4CGGA 5HRPA 4ZHRA 4DFPA 1UA0A 4DSKA 2OPSA 1NK5A 1NK0A 4KTQA 3WNFA 1HJRA 3HSTB 1DTQA 2A1RA 1U45A 1SKWA 4W5QA 4HCBA 4M3ZA 3KD5E 3RRHA 1HNVA 2VWKA 2Z1GA 4QOZB 5FROA 2WONA 3OJUA 1T05A 3M8SA 4L8RB 3BGRA 1W0HA 4CJPA 1NJWA 4F3OA 1HRHA 4E1NA 3V9XA 2HNDA 4HUFA 4DTPA 2XRIA 4M45A 4CHNA 3QERA 1HNIA 3EYZA 4WE1A 3LZIA 2KFZA 1IH7A 2B6AA 3SUNA 2Z1JA 4CJ3A 1VRTA 4AHRA 1NJZA 3MEEA 4FJMA 3O3HA 4RW4A 3SUQA 3AA4A 4CJ4A 1YVUA 3P5JA 2HHSA 1B9DA 1Q8IA 4FVMA 4BDPA 1IKYA 1A5WA 2F96A 3OYMA 2HHXA 3AVLA 3U3YA 3HYFA 4N76A 3V9ZA 3L2VA 3DYAA 1FK9A 5T7BA 1TV6A 2P51A 4HTUA 1LV5A 3HPHA 1SL1A 3MXIA 4F2RA 2E4LA 3I0RA 1FKPA 4C8MA 3LWLA 3AVAA 3RMCA 1JLQA 4FM1A 1D9FA 3AVJA 4CF0A 5KRSA 1C1CA 3OYFA 4FM0A 4CFDA 2FBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLF A;  4FW2 A;  3RR8 A;  2WOM A;  1X9S A;  1HQE A;  3AVK A;  5KTQ A;  5HRS A;  3AO3 A;  1NOY A;  3FFI A;  4DU3 A;  1T7P A;  3HO1 A;  4DTJ A;  4DSF A;  3KLH A;  1REV A;  4KFB A;  2XY6 A;  1TGO A;  3SJJ A;  4PA1 A;  1N6Q A;  4IFY A;  4W5T A;  1RT6 A;  4DSL A;  4CJW A;  2EX3 A;  3AA3 A;  2QKB A;  3ALY A;  1S1U A;  4DTS A;  5FRN A;  1FXX A;  1XI1 A;  3HL8 A;  1T8E A;  3KLI A;  3T1A A;  3L2R A;  1TAQ A;  4KTZ A;  2HVI A;  3KKS A;  3C94 A;  1I39 A;  4J2A A;  1NK9 A;  2F8T A;  4O4G A;  2PYL A;  1X9W A;  2KFN A;  4CJS A;  4CIE A;  4E3S A;  4IG0 A;  1BIU A;  1RCH A;  4DQP A;  3K2P A;  3QIP A;  3LWM A;  3KJV A;  4FJH A;  4IG3 A;  4KHW A;  2D5R A;  2HNZ A;  3T19 A;  4B8C A;  2XY7 A;  4FJI A;  4M42 A;  3DLK A;  1CZB A;  4ID1 A;  4OGE A;  2F8S A;  1RT3 A;  1O1W A;  4TSX A;  2AJQ A;  4CHO A;  5J2N A;  1S1V A;  3NGZ A;  2JGU A;  3NF6 A;  1CZ9 A;  3AVG A;  3ZT0 A;  2O4G A;  2ATQ A;  2BAN A;  3G0Z A;  1QHT A;  3NGI A;  4B9N A;  4HCC A;  5J1E A;  4OLA A;  2IDO A;  3DMJ A;  4M3T A;  1J5O A;  2IGI A;  5D3G A;  2KZM A;  1RDA A;  3D45 A;  1L3U A;  2HHW A;  2HW3 A;  3AVF A;  1IKW A;  3ZT3 A;  1XHZ A;  5DMR A;  1VSH A;  1HQU A;  4CHQ A;  4NCB A;  1SKS A;  2E6L A;  4CEQ A;  1NK6 A;  4H4M A;  3KLE A;  3KK1 A;  1CXQ A;  3ZT2 A;  5SWM A;  3DLG A;  4EZ9 A;  3SI6 A;  1Z25 A;  4OVL A;  3VQ6 A;  1WNS A;  3PUF A;  4LSN A;  3VQE A;  4CIF A;  1KLM A;  3SYZ A;  3SNN A;  1MU2 A;  1NK8 A;  4CF1 A;  3SQ0 A;  3K5N A;  1S6Q A;  1Z26 A;  4GVM A;  4QAG A;  3P1G A;  5CZ1 A;  3OYI A;  1KVA A;  5KI6 A;  1C0T A;  1TL3 A;  4N47 A;  4FJX A;  4OKK A;  3L8B A;  2B4J A;  3QIN A;  4CJR A;  4XIU A;  3KLF A;  4HUG A;  2G8W A;  3C6T A;  1NJX A;  2D0B A;  4FJJ A;  1RBT A;  4ELT A;  2FBT A;  3SUO A;  3ZSZ A;  3V9W A;  1A5X A;  4FJK A;  4F4K A;  1JXE A;  3TAP A;  2I5J A;  1RTD A;  4G1Q A;  3RWU A;  4Z4G A;  5KRT A;  3NF7 A;  5J2P A;  2YKM A;  4KHQ A;  4ELV A;  1CLQ A;  2RF2 A;  3D0P A;  1CXU A;  2YHA A;  3H08 A;  4EP5 A;  4ZTF A;  1NK4 A;  1TK0 A;  4IKF A;  3I8D A;  1BCO A;  1NKB A;  3BDP A;  3LAN A;  1ZBH A;  4B9V A;  2KW4 A;  4CER A;  1XC9 A;  2A1S A;  4NYN A;  1QS4 A;  1QSL A;  4KRF A;  4J2E A;  1VSM A;  3JYT A;  3VQQ A;  1VSF A;  4AH9 A;  3KTQ A;  1RBS A;  1GOC A;  2YNF A;  1S9E A;  3LAL A;  4CEF A;  2YNI A;  4B9M A;  4E7J A;  2YNG A;  3V4I A;  1IKV A;  4FLU A;  2B5J A;  3NH0 A;  1SL0 A;  4CF2 A;  4HHT A;  3K5O A;  4DFJ A;  3KD1 E;  4HVJ A;  5JS2 A;  3KK3 A;  3CM5 A;  4NCG A;  1TKZ A;  3SV3 A;  2HHV A;  2Y1I A;  1WSF A;  3S3N A;  1J9A A;  1JKH A;  3U6F A;  4Z4C A;  1G15 A;  4F8R A;  1DLO A;  4C8N A;  3DLE A;  4GW6 A;  3NH1 A;  3HT3 A;  3TAM A;  5J2M A;  4FW1 A;  4M3U A;  2HB5 A;  3TWH A;  3IS9 A;  3KKR A;  1IO2 A;  3MEG A;  4RG8 A;  3L2Q A;  4JRQ A;  3TAG A;  2IAJ A;  3DLB A;  1C1A A;  1QQC A;  3VQA A;  4YNQ A;  2BGG A;  3HM9 A;  3PY8 A;  1WSJ A;  3VQD A;  4MFB A;  2G8H A;  4ICL A;  2VG5 A;  5HRR A;  4B9U A;  3M8Q A;  2R7Y A;  1JLA A;  5HRN A;  4FJ8 A;  1EP4 A;  1RT5 A;  3ZT4 A;  3QIO A;  4CED A;  3NFA A;  2G8I A;  3IAY A;  3MED A;  4RW6 A;  3SPZ A;  1RTH A;  3HPO A;  4KHS A;  4ELU A;  1GOA A;  3ZSR A;  4DSE A;  3TR8 A;  4CF8 A;  1RTI A;  3NGY A;  3V9S A;  3MXJ A;  3F9K A;  3OYD A;  4DSI A;  4KRE A;  1A5V A;  3MXM A;  1XHX A;  4DMN A;  1NKE A;  4AHV A;  1TL1 A;  3QO9 A;  2FBY A;  1UA1 A;  3VA3 A;  2Q3S A;  4PQU A;  3CM6 A;  4B8A B;  4J2D A;  2G8F A;  1HMV A;  3HJF A;  1TK5 A;  4DQI A;  4HUE A;  2HHQ A;  4I2Q A;  1KLN A;  4M3X A;  3HVT A;  3VQB A;  3SV4 A;  4DU1 A;  4BDY A;  4PUO A;  1BHL A;  1BL3 A;  4CGD A;  4BE0 A;  4OLB A;  2ITG A;  2DY4 A;  3A2F A;  3LP1 A;  4CJV A;  3TAN A;  3PX0 A;  1EKE A;  1KVB A;  2ZD1 A;  4FLT A;  1HYV A;  5CYQ A;  4KKO A;  3JSM A;  3VN5 A;  2P5O A;  3AVN A;  3OYJ A;  1YTU A;  4BDZ A;  4BWM A;  1B9F A;  1C0U A;  4MQ3 A;  4CEZ A;  3SCX A;  1TKD A;  4FM2 A;  4I2P A;  4E1M A;  3OY9 A;  4B9L A;  3LDS A;  3L3U A;  4FZX C;  3V9U A;  2IS3 A;  3WNH A;  1X9M A;  1BI4 B;  3SQ4 A;  4H4O A;  1QE1 A;  3DOK A;  4Z4I A;  5JS1 A;  1KVC A;  3ZSY A;  4FLV A;  4CHY A;  3RMB A;  3AO2 A;  4W5O A;  4C8L A;  5C42 A;  1S1T A;  4M3R A;  3SQ2 A;  1UWB A;  4EP4 A;  3E01 A;  1U4B A;  1IG9 A;  1JL1 A;  4CEB A;  2YHB A;  1TVR A;  5I42 A;  4K8Z A;  2D0A A;  4CJT A;  4M41 A;  3AVB A;  2HMI A;  1RDB A;  1TKT A;  3NE6 A;  3SZ2 A;  1RIL A;  1L5U A;  4RW8 A;  4IFV A;  1VSI A;  4OGC A;  3NHG A;  4JRP A;  2DFH A;  2IOC A;  3LPU A;  4I7F A;  4AHU A;  4Y1D A;  2XHB A;  3ZT1 A;  3NF9 A;  3SUP A;  1BIS A;  3WNE A;  3TI0 A;  2KTQ A;  4Z0U A;  4BWJ A;  4RW9 A;  5HRO A;  3U3G A;  1LW2 A;  4FLZ A;  3LAK A;  1JLE A;  2W42 A;  1BGX T;  5CYM A;  4DTM A;  4DLG A;  4CGI A;  3ASM A;  4CF9 A;  4O5B A;  3M8R A;  4CHZ A;  4FK0 A;  3HVR A;  3OYC A;  4CHP A;  3AO4 A;  5J2Q A;  2GUI A;  3LP3 A;  3B6P A;  2E6M A;  5C25 A;  4ID5 A;  3K5L A;  1ZYQ A;  2QKK A;  1B92 A;  1U04 A;  1RT1 A;  1VK0 A;  2IC3 A;  2X6N A;  3K58 A;  3QET A;  2VG7 A;  4FJL A;  4PWD A;  4KV8 A;  4FYD A;  2Y1J A;  5SZT A;  4E7H A;  3NAE A;  2YNH A;  4FLY A;  3OS1 A;  1LWC A;  1RNH A;  4KB0 A;  3WNG A;  1DTT A;  4AHS A;  1SL2 A;  4C8O A;  3OYL A;  1GOB A;  4JLH A;  2O4I A;  1LW0 A;  1RTJ A;  2D0C A;  1JLB A;  3QES A;  1N5Y A;  1BQN A;  2DFE A;  4E19 A;  1WAF A;  2PYJ A;  2G8V A;  4KHY A;  4DG1 A;  4DFK A;  3VQ4 A;  1WSE A;  1KFS A;  3HK2 A;  4KAZ A;  4CEO A;  2RPI A;  1UOC A;  3KLG A;  3CFR A;  4FLW A;  4K8X A;  2GBZ A;  3T3F A;  3HP9 A;  4EZ6 A;  3O4Q A;  1ITG A;  1VSD A;  4CEA A;  4RW7 A;  2RKI A;  4CJE A;  1SUQ A;  1JL2 A;  3K57 A;  3ULD A;  3CQ8 A;  3M8P A;  3VQ9 A;  1YTA A;  2ZQB A;  3KK2 A;  3DLR A;  3NDK A;  3RMA A;  1QSS A;  1WSI A;  4NCA A;  1S1X A;  4LY7 A;  4M3Y A;  4CFB A;  3DLH A;  3LP2 A;  1NJY A;  4I9L A;  1KFD A;  5CY4 A;  4O0I A;  4JS5 A;  4DS4 A;  3S9H A;  3OJS A;  3SQ1 A;  1SKR A;  1ZBI A;  3NF8 A;  3TAR A;  3AVI A;  3VQP A;  4N41 A;  1BCM A;  1LAW A;  2X6S A;  5CZ2 A;  4CJL A;  4FK2 A;  4NYF A;  3IRX A;  1VSK A;  3VQ8 A;  4DFM A;  3EZ5 A;  1FKO A;  2QK9 A;  3OYH A;  4KB1 A;  4B9T A;  3QEX A;  3DM2 A;  4KPY A;  3VA0 A;  1T03 A;  1KCF A;  3ISN C;  1ZBL A;  3TAE A;  1R0A A;  2YKN A;  4GMJ B;  1KRP A;  4BE1 A;  4Z4H A;  3AV9 A;  4CIG A;  1HYZ A;  1EET A;  3OYK A;  1VSL A;  4DQQ A;  1C1B A;  3O4N A;  5HP1 A;  4DQS A;  4DLE A;  3LP0 A;  4LH4 A;  1LWF A;  3L2W A;  4DTO A;  4DF4 A;  1Q9X A;  4O44 A;  4KI6 A;  2HHT A;  4Z4E A;  4CJ5 A;  3OS0 A;  4CJQ A;  4N5S A;  3LPT A;  1IKX A;  4R5P A;  2OPP A;  3F73 A;  1WSG A;  4F2S A;  3MAQ A;  5HLF A;  4DQR A;  1U48 A;  3OS2 A;  3RRG A;  3HPG A;  4OKE A;  5C24 A;  5KGX A;  4CCH A;  3ZSQ A;  4Q5V A;  2FC0 A;  3NH2 A;  4BE2 A;  4AHC A;  4OKJ A;  4CJF A;  1D8Y A;  4FJ9 A;  1ASV A;  1TKX A;  1X1P A;  1QSY A;  3KIO A;  1S1W A;  2BDP A;  3AVC A;  4AHT A;  3K59 A;  4YFU A;  2PY5 A;  2QXF A;  3DRS A;  2Z1I A;  4QCL A;  3C95 A;  1NKC A;  3QEI A;  1ZBF A;  3VQ5 A;  3QEV A;  1LAV A;  4DWI A;  1UAX A;  3CG7 A;  3CFO A;  4FJG A;  3UIQ A;  3NBP A;  1W9H A;  4FZZ A;  4IBN A;  4O0J A;  4CGH A;  4DS5 A;  2G8U A;  1ASU A;  1RT7 A;  2VG6 A;  3VQC A;  4JS4 A;  4J2B A;  2P5G A;  4KO0 A;  1D5A A;  2GV9 A;  3O3F A;  4FLX A;  1S5J A;  2HNY A;  1EX4 A;  1BQM A;  1NOZ A;  2YV0 X;  3QNN A;  3TAF A;  3S3O A;  3V1O A;  4B9S A;  4KI4 A;  1RDD A;  4FXD A;  2HHU A;  1RBV A;  3SPY A;  1TAU A;  4OPJ A;  3CFP A;  5KGW A;  5DK5 A;  1C6V A;  3DRP A;  3AO1 A;  1JLC A;  3PX6 A;  5HBM A;  3V1R A;  4E0D A;  5E41 A;  3OYE A;  4BAC A;  2BE2 A;  1U47 A;  4UQG A;  4KTW A;  4B3O A;  4B08 A;  4FK4 A;  3TAB A;  2OZM A;  1SV5 A;  3ZSV A;  4F3T A;  4FCY A;  1L3S A;  1I3A A;  1WSH A;  2VWJ A;  4CK3 A;  3RMD A;  4AIL C;  3S3M A;  1Q9Y A;  1EXQ A;  3ZSW A;  2OYQ A;  1J54 A;  2KQ2 A;  4O55 A;  4C8K A;  3AA2 A;  3OYG A;  2FBV A;  3QEP A;  4CEC A;  4CFC A;  3ITH A;  2HVH A;  3P83 D;  4DTX A;  4H8K A;  4FJN A;  3C6U A;  1VRU A;  1ZBU A;  3PV8 A;  4CFA A;  4DF8 A;  2X78 A;  5FDL A;  1NK7 A;  4CGF A;  1C0M A;  3O3G A;  4CJK A;  3DRR A;  3LZJ A;  3RTV A;  2OPR A;  1RT4 A;  4N56 A;  4LH5 A;  4CK1 A;  2KZZ A;  2DTU A;  4FJ7 A;  1U49 A;  2X74 A;  3DI6 A;  1VSE A;  2G8K A;  2OA8 A;  1BI4 A;  4DTU A;  3DOL A;  4OJR A;  3V1Q A;  4KHU A;  1WAJ A;  4Y1C A;  1VSJ A;  3LAM A;  3MEC A;  4E7I A;  3L3V A;  1WLJ A;  1ASW A;  1RT2 A;  3QNO A;  3V81 A;  1LWE A;  3G10 A;  3OYB A;  2XY5 A;  1L3T A;  1KSP A;  1RBU A;  3AA5 X;  1TK8 A;  3AVH A;  2OZS A;  4CE9 A;  4FZY A;  1BIZ A;  1K6Y A;  1L3V A;  4LD0 A;  4E89 A;  4I9Q A;  4LSL A;  2XO7 A;  3PO4 A;  4E7K A;  4PY5 A;  1WN7 A;  5EU7 A;  1HPZ A;  4E7L A;  3PX4 A;  1D9D A;  1KTQ A;  3HXM A;  1RBR A;  2RN2 A;  3ZSX A;  1F21 A;  3QLH A;  2OPQ A;  3EY1 A;  3PO5 A;  2P1J A;  4CGJ A;  1JLG A;  5K14 A;  1XWL A;  4DU4 A;  2LSN A;  3AO5 A;  3QEW A;  3ZCM A;  3RR7 A;  3AVM A;  4OPK A;  1S9G A;  3HP6 A;  1YT3 A;  3VQ7 A;  3OVN A;  4M3W A;  2JLE A;  3ZSO A;  3OYN A;  3TAQ A;  4W5R A;  2ZE2 A;  4FJ5 A;  2EHG A;  4CES A;  3I0S A;  3OYA A;  4DSJ A;  3K5M A;  4DTN A;  2NUB A;  4CJU A;  1Y97 A;  3CYM A;  3NCI A;  5I3U A;  4KHN A;  4Q0B A;  4W5N A;  2DFF A;  3V6D A;  4CK2 A;  2XY8 A;  2ETJ A;  4DTR A;  5FRM A;  1QTM A;  4CEE A;  4Z4F A;  3L2U A;  3IG1 A;  4IDK A;  3THV A;  2Z1H A;  1HYS A;  2PZS A;  1JXB A;  1RDC A;  1J53 A;  1S6P A;  4ZTJ A;  3B6O A;  4CGG A;  5HRP A;  4ZHR A;  4DFP A;  1UA0 A;  4DSK A;  2OPS A;  1NK5 A;  1NK0 A;  4KTQ A;  3WNF A;  1HJR A;  3HST B;  1DTQ A;  2A1R A;  1U45 A;  1SKW A;  4W5Q A;  4HCB A;  4M3Z A;  3KD5 E;  3RRH A;  1HNV A;  2VWK A;  2Z1G A;  4QOZ B;  5FRO A;  2WON A;  3OJU A;  1T05 A;  3M8S A;  4L8R B;  3BGR A;  1W0H A;  4CJP A;  1NJW A;  4F3O A;  1HRH A;  4E1N A;  3V9X A;  2HND A;  4HUF A;  4DTP A;  2XRI A;  4M45 A;  4CHN A;  3QER A;  1HNI A;  3EYZ A;  4WE1 A;  3LZI A;  2KFZ A;  1IH7 A;  2B6A A;  3SUN A;  2Z1J A;  4CJ3 A;  1VRT A;  4AHR A;  1NJZ A;  3MEE A;  4FJM A;  3O3H A;  4RW4 A;  3SUQ A;  3AA4 A;  4CJ4 A;  1YVU A;  3P5J A;  2HHS A;  1B9D A;  1Q8I A;  4FVM A;  4BDP A;  1IKY A;  1A5W A;  2F96 A;  3OYM A;  2HHX A;  3AVL A;  3U3Y A;  3HYF A;  4N76 A;  3V9Z A;  3L2V A;  3DYA A;  1FK9 A;  5T7B A;  1TV6 A;  2P51 A;  4HTU A;  1LV5 A;  3HPH A;  1SL1 A;  3MXI A;  4F2R A;  2E4L A;  3I0R A;  1FKP A;  4C8M A;  3LWL A;  3AVA A;  3RMC A;  1JLQ A;  4FM1 A;  1D9F A;  3AVJ A;  4CF0 A;  5KRS A;  1C1C A;  3OYF A;  4FM0 A;  4CFD A;  2FBX A; 
#chains in the Genus database with same CATH topology
 1JLF A;  1T3V A;  3PIO L;  1HQE A;  4A57 A;  3VGK A;  5KTQ A;  2O8E B;  4YOY A;  3D6R A;  1WBD A;  2QWL A;  3KZB A;  3HO1 A;  3MCA B;  2F4V K;  3KLH A;  3HSC A;  3THX B;  3O9Q A;  3BY5 A;  3AA3 A;  3ALY A;  2UUC K;  3O9R A;  4DTS A;  4IEI A;  2VWB A;  2Q97 A;  4DR3 K;  2HBJ A;  1XI1 A;  3HL8 A;  1NBW A;  3KLI A;  3T1A A;  1T6C A;  3FFK B;  3C94 A;  1NK9 A;  1X9W A;  5LY3 A;  4CJS A;  2KFN A;  1BIU A;  1JCG A;  3QIP A;  3LWM A;  4BRQ A;  4KHW A;  4M42 A;  2HNZ A;  4B8C A;  2F8S A;  4BVO A;  1HLU A;  1O1W A;  3NGZ A;  4ISF A;  4JKF A;  1N33 K;  4FSV A;  2YJF A;  2NNW A;  2IGI A;  1DT9 A;  2E8A A;  1J5E K;  2HHW A;  1IKW A;  3ZT3 A;  4H5T A;  3CPW M;  3VER A;  4CZL A;  4CHQ A;  4NCB A;  3CCU N;  4CEQ A;  2A41 A;  1NGE A;  4ILJ A;  4A5B A;  1ZBS A;  3DLG A;  3O4W A;  2P9P A;  4WQ4 C;  3SYZ A;  3PUF A;  4LSN A;  1KLM A;  1ZC6 A;  3SQ0 A;  2QW9 A;  1Z26 A;  4QAG A;  3P1G A;  5LMU K;  3CXC M;  1KVA A;  4GV3 A;  1C0T A;  1TL3 A;  1S22 A;  3L8B A;  5JMV A;  3KLF A;  2G8W A;  3C6T A;  3SUO A;  3K0S A;  3CCV N;  3ZSZ A;  5JVH L;  2I5J A;  4Z4G A;  3WXK A;  3EE9 A;  4QS9 A;  2ASP A;  3QML A;  3CC4 N;  4EFH A;  2KW4 A;  3AAR A;  2E2N A;  4DV7 K;  1VSF A;  4Q0B A;  3KTQ A;  4A5A A;  2YNI A;  4FWQ A;  1RDW X;  5BN9 A;  3NH0 A;  4K43 A;  3BP8 A;  3PSI A;  3CM5 A;  3ENO A;  3OTO K;  4MO4 A;  1G15 A;  4GW6 A;  3HT3 A;  1M1K O;  5GAD P;  4FW1 A;  1VQ7 N;  3IS9 A;  1KXP A;  1IO2 A;  4JRQ A;  2IAJ A;  5FPD A;  3AGK A;  3VQD A;  2NZT A;  4MFB A;  2VG5 A;  5LJW A;  3M8Q A;  3O5B A;  3E1Y A;  5HRN A;  1EP4 A;  1RT5 A;  3I56 N;  1G99 A;  2CGL A;  4KHS A;  1JCF A;  3CI5 A;  3ZSR A;  4DSE A;  3NGY A;  3V9S A;  3CCR N;  4LFB K;  3MXJ A;  3DJC A;  3OYD A;  4DSI A;  3SAH A;  3VPZ A;  1A5V A;  4A61 A;  3MXM A;  1BWF O;  2QI2 A;  4HTL A;  5AR0 A;  5AQF A;  4DV5 K;  3VA3 A;  4B8A B;  2G8F A;  4DU1 A;  3U9D A;  1BHL A;  4CGD A;  4BE0 A;  4OLB A;  4JKG A;  3TAN A;  1EKE A;  5CYQ A;  3QFP A;  3FZK A;  4KH4 A;  3OYJ A;  2WFB A;  1GLE G;  3D7E O;  1TKD A;  5AQP A;  3Q7C A;  5IT9 O;  3TU5 A;  2IS3 A;  3V9U A;  4AM7 A;  2A40 A;  1BI4 B;  2GEM A;  1NGI A;  4Z4I A;  5JS1 A;  3G71 N;  1KVC A;  3D2E B;  3SJH A;  4C8L A;  5C42 A;  4CEB A;  4C23 A;  4CBW A;  4M41 A;  2VQF K;  3AVB A;  5AQS A;  1TKT A;  4G9Z A;  1RIL A;  2E20 A;  2WBN A;  2P9K B;  4RW8 A;  1IV0 A;  4IFV A;  4OGC A;  4B1W B;  2KTQ A;  3TI0 A;  3F5T A;  4FVU A;  1LW2 A;  1XMO K;  3PSF A;  3ASM A;  4CF9 A;  4CHZ A;  2OTL N;  3OYC A;  4A2B A;  4K25 A;  2E2Q A;  1VK0 A;  2BUP A;  2X6N A;  3WEE B;  1VQO N;  1N34 K;  4CZH A;  3DLL L;  2Y1J A;  3A5M C;  4FLY A;  3OS1 A;  3WEE A;  3UKU A;  3WNG A;  3GG4 A;  4JLH A;  2O4I A;  1LW0 A;  4CBU A;  2NRZ A;  2O8F A;  1CZA N;  3O9T A;  4H0P A;  3QES A;  3GL1 A;  3CCL N;  3E9P A;  1WAF A;  2CH6 A;  2HBL A;  3H46 O;  4DG1 A;  1QQN A;  3HK2 A;  4FLW A;  4K8X A;  2GBZ A;  3IMX A;  1VSD A;  1ITG A;  4BRG A;  3CPE A;  1JL2 A;  3G25 A;  3KK2 A;  4IJA A;  5BR8 K;  1YIT N;  4GVE A;  1NJY A;  4JS5 A;  1K8A O;  4JEP A;  3OJS A;  3VQP A;  1NJI O;  4CJL A;  5CZ2 A;  4H5R A;  3VTI A;  4NYF A;  4IZ9 A;  4DFM A;  2QK9 A;  1FW6 A;  3DM2 A;  2D4W A;  1ZBL A;  2YKN A;  3SBT A;  3H45 C;  1KRP A;  3H6E A;  1HYZ A;  1YHQ N;  1EET A;  4DQQ A;  4X62 K;  4DHY A;  4DLE A;  3LP0 A;  5BPM A;  1X3N A;  3GBT A;  2QTD A;  3O1W A;  5C24 A;  4O5F A;  5KGX A;  3O9S A;  4Q5V A;  2FC0 A;  3M1F A;  1BG3 A;  3FLC O;  4CJF A;  1X1P A;  4YDU A;  4DV1 K;  4DKW A;  4AHT A;  3K59 A;  4YFU A;  5BRE A;  2D0P A;  2P9S A;  2Z1I A;  4QCL A;  1J6Z A;  3SMP A;  3QEV A;  4FJG A;  3BEX A;  3CG7 A;  4FZZ A;  4O0J A;  3AY9 A;  4KO0 A;  1D5A A;  2GV9 A;  3D2F B;  5M1N A;  3S3O A;  2YV0 X;  4KI4 A;  3TAF A;  3V1O A;  4PKI A;  5BPN A;  1RBV A;  5LL6 Z;  4OPJ A;  5KGW A;  1YUW A;  4B9Q A;  5E41 A;  4ISG A;  4BAC A;  4YOU A;  1HKG A;  4BRD A;  1K8K B;  4B08 A;  2OZM A;  1SV5 A;  4CK3 A;  1EXQ A;  4C8K A;  2KQ2 A;  4O55 A;  2O8F B;  3E9L A;  4BRF A;  3FZF A;  5FDL A;  1WBB A;  4CGF A;  5AQX A;  1RT4 A;  4LH5 A;  1VQN N;  2KZZ A;  3CMA N;  2OA8 A;  3DOL A;  4OJR A;  4BRO A;  4KHU A;  1WAJ A;  3T69 A;  4O8U A;  4YY3 K;  3ZX0 A;  3QNO A;  3D2E A;  5AZJ B;  1BIZ A;  4NXM K;  5AQM A;  4CW7 B;  2HMP A;  4I9Q A;  4E7K A;  1WN7 A;  1HPZ A;  4NO7 A;  3RSE A;  4E7L A;  3O08 A;  2RN2 A;  1N36 K;  1JLG A;  1XWL A;  2V52 B;  4WQ4 A;  4YDU C;  2ASO A;  3AVM A;  3SMS A;  1S9G A;  4OPK A;  3VQ7 A;  3VEV A;  3C7N B;  3ZSO A;  4W5R A;  4BRE A;  4BR5 A;  4IFE A;  4CES A;  4DSJ A;  1KAZ A;  5EOY A;  4BQL A;  3NCI A;  1M90 O;  2ETJ A;  3IG1 A;  4IDK A;  2QWM A;  2Z1H A;  2QWN A;  1JXB A;  1S6P A;  1J53 A;  4ZTJ A;  4DFP A;  1NLV A;  3HTV A;  3WNF A;  1HJR A;  4GV6 A;  4W5Q A;  1SQK A;  5FRO A;  1GLJ O;  2WON A;  3LM2 A;  1VQL N;  4F3O A;  1GLF O;  4E1N A;  4JYA K;  1IG8 A;  2QM1 A;  3VF6 A;  4HUF A;  2GTD A;  2XRI A;  4IO8 A;  5C2D A;  4DTP A;  2Q1N A;  3QER A;  3LZI A;  1IH7 A;  2B6A A;  3O8M A;  1NJZ A;  4FJM A;  1ILY A;  3SUQ A;  1T6D A;  2VQE K;  1B9D A;  1BOT O;  4CVN E;  4N76 A;  4JI2 K;  5T7B A;  4HTU A;  3MXI A;  2P9L A;  4F2R A;  2E4L A;  5HL7 L;  1JLQ A;  1D9F A;  3VEZ A;  4FJN A;  4FM0 A;  4CFD A;  2WOM A;  3AVK A;  3BF3 A;  4RWT A;  4GKJ K;  2Q0R A;  1NOY A;  3FFI A;  1VQM N;  4DU3 A;  4DTJ A;  3PLA A;  2XY6 A;  1TGO A;  3SJJ A;  4DSL A;  1S1U A;  2UXB K;  1NM1 A;  4KH6 A;  3C6H A;  2VCP A;  3L2R A;  1K9M O;  3KKS A;  4BRH A;  2F8T A;  2PYL A;  2YHY A;  2I7N A;  1Q82 O;  4IG3 A;  1X9J A;  2D5R A;  3T19 A;  3DLK A;  4ID1 A;  4OGE A;  1RT3 A;  2AJQ A;  3P39 A;  1S1V A;  5J2N A;  1E4G T;  2BAN A;  2ATQ A;  1QHT A;  3ZX2 A;  3NGI A;  5J1E A;  4IO9 L;  3DMJ A;  4BRN A;  5D3G A;  2KZM A;  3MN6 A;  3O1B A;  1XHZ A;  5DMR A;  3EE8 A;  3R9P A;  2E6L A;  2O8B B;  4H4M A;  5JVG L;  3WUH A;  1P8Z A;  4JI6 K;  4A2A A;  3ZT2 A;  2Q31 A;  3EN9 A;  3SI6 A;  1OH7 A;  4OVL A;  3VQ6 A;  3VQE A;  2PBD A;  4JN4 A;  2E1Z A;  4CF1 A;  1HNW K;  5KI6 A;  4N47 A;  1U2V B;  2B4J A;  2IVP A;  3W3D A;  2WC9 A;  4HUG A;  4FO0 A;  2CGK A;  4B1U B;  4ELT A;  3QBX A;  2UUA K;  3TAP A;  1RTD A;  4G1Q A;  1JJ2 M;  3NF7 A;  1CLQ A;  1T44 A;  2ZF5 O;  3D0P A;  1CXU A;  4EP5 A;  4ZTF A;  4IKF A;  1TK0 A;  1BCO A;  3BDP A;  4YOW A;  3LAN A;  1YJW N;  4CER A;  2A1S A;  5JIC A;  4NYN A;  4J2E A;  1VSM A;  3JYT A;  1YI2 N;  4CZI A;  3DXM B;  2P9I B;  3C6A A;  3J80 O;  1IKV A;  4CF2 A;  3E66 A;  4DFJ A;  4NCG A;  2HHV A;  3EEQ A;  5EVZ A;  3S3N A;  4JI1 K;  4F8R A;  4JI5 K;  4C8N A;  3DLE A;  4M3U A;  5M1Q A;  4RG8 A;  3MEG A;  2O8C B;  3DLB A;  1C1A A;  3VQA A;  4BR9 A;  2BGG A;  2IVO A;  2QWP A;  3HM9 A;  1WSJ A;  2YCH A;  3J7Z O;  1GLD G;  3N4Q A;  1JLA A;  4FJ8 A;  3THW B;  3ZT4 A;  4RW6 A;  3SPZ A;  1RTH A;  3HPO A;  4ELU A;  3THW A;  3JS6 A;  1OVY A;  2OAN A;  3L4I A;  5AQT A;  2J4R A;  2P9U A;  1XHX A;  4DMN A;  2WTU A;  1TL1 A;  3QO9 A;  3HJF A;  3VEN A;  3HVT A;  1VQ8 N;  3CJ7 A;  4PUO A;  1BL3 A;  3A2F A;  4CZJ A;  2E5L K;  3PX0 A;  3QBW A;  4FLT A;  1HYV A;  3JSM A;  2P5O A;  3VN5 A;  4Z94 A;  3WXJ A;  4BC4 A;  4MQ3 A;  4FWO A;  4JI0 K;  4B9L A;  4LF5 K;  4E1M A;  1RFQ A;  1N8R O;  1EO1 A;  5FPM A;  3SQ4 A;  4H4O A;  1QE1 A;  3DOK A;  3ZSY A;  4DV6 K;  1XQS C;  4M3R A;  3E01 A;  3EL2 A;  1JL1 A;  4FPA A;  3T7Z A;  3HI0 A;  5I42 A;  2D0A A;  4X66 K;  1E3M A;  1RDB A;  2I7P A;  3SZ2 A;  4EHU A;  5ADX A;  1L5U A;  3NHG A;  4JRP A;  4AHU A;  2IOC A;  1TUY A;  3ZT1 A;  3NF9 A;  1V4S A;  1U2V A;  4Z0U A;  4X64 K;  3U3G A;  4FLZ A;  2HOE A;  3VGL A;  4B1V A;  4DLG A;  4CGI A;  4B3M K;  4O5B A;  3A8Y A;  3CCJ N;  3HVR A;  4B3R K;  4FWK A;  3AO4 A;  4B1Y B;  2W40 A;  3LP3 A;  4K41 A;  2E6M A;  5C25 A;  4ID5 A;  1ZYQ A;  1NGD A;  3MN9 A;  1RT1 A;  3K58 A;  3IDH A;  4PWD A;  2VGM A;  2YNH A;  3NVK A;  3C0B A;  1LWC A;  1GOB A;  2D0C A;  1JLB A;  4B1Z A;  2D1K A;  3VEX A;  1YJ9 N;  4E19 A;  4DR4 K;  1Z6R A;  3WQU A;  4KHY A;  4DFK A;  1OKJ A;  1WSE A;  2RPI A;  1MWM A;  2YI1 A;  3LDQ A;  3HP9 A;  4EZ6 A;  3O4Q A;  4CJE A;  3VQ9 A;  1KAX A;  1YTA A;  2V7Y A;  2ZQB A;  2NLX A;  3O6W A;  1WSI A;  4NCA A;  1S1X A;  5M1P A;  3DLH A;  5C10 A;  3A5O C;  3CC7 N;  4DS4 A;  5CY4 A;  1SKR A;  3KVG A;  3NF8 A;  3AVI A;  4N41 A;  1BCM A;  4YHH K;  2NRW A;  1HKB A;  3IRX A;  3EZ5 A;  3ENH A;  3OYH A;  4KB1 A;  4KPY A;  4JKC A;  3VA0 A;  1T03 A;  3TAE A;  4GMJ B;  3AV9 A;  2YHX A;  3OYK A;  5AZI A;  4H0O A;  4LH4 A;  3L2W A;  4O44 A;  4Z4E A;  4CJ5 A;  1YAG A;  4N5S A;  3LPT A;  3TTC A;  5KQ8 A;  2OPP A;  2YHW A;  4QS8 A;  5HLF A;  1U48 A;  3RRG A;  4CCH A;  1U6Z A;  5KQD A;  5AQO A;  2BDP A;  3VEW A;  3AAP A;  3FE1 A;  3R1X A;  3CME N;  4KH5 A;  3VQ5 A;  3QEI A;  3T1Y K;  1W9H A;  3AAQ A;  4IBN A;  4CGH A;  1Z05 A;  2G8U A;  4JS4 A;  3VQC A;  4BY9 C;  3DXK A;  3H3O B;  3TTF A;  3O3F A;  1EX4 A;  2DPN A;  5KPR A;  3O80 A;  4B9S A;  2HHU A;  1TAU A;  4FWP A;  3PX6 A;  3H1Q A;  3G6E N;  3OYE A;  2BE2 A;  4UQG A;  4KTW A;  4B3O A;  1HPM A;  4H0V B;  3TAB A;  1EWR A;  2P9K A;  1I3A A;  1WSH A;  3JAM O;  4BQZ A;  3SLC A;  4CZF A;  1DEJ A;  1Q9Y A;  3ZSW A;  2ZJP L;  1KC8 O;  2FBV A;  1YJN N;  5C12 A;  3ITH A;  1NGB A;  3P83 D;  4H8K A;  4DTX A;  4EAH D;  5F0X A;  3PV8 A;  4CFA A;  4DF8 A;  1C0M A;  3LZJ A;  4X65 K;  4CK1 A;  2X74 A;  3LM9 A;  2G8K A;  4ILH A;  1BI4 A;  2E88 A;  2ZWH A;  5BN8 A;  5LMN K;  4H5V A;  2H3G X;  2PFU A;  1WLJ A;  3V81 A;  1RT2 A;  3G10 A;  3WQT A;  1KSP A;  3AA5 X;  3AVH A;  3UKU B;  4FZY A;  2W6L A;  4MDB A;  4I6M A;  1NGG A;  3PX4 A;  1KTQ A;  3LDN A;  2F7T A;  2OPQ A;  3EY1 A;  4CGJ A;  5K14 A;  4B3T K;  1VQP N;  2RE2 A;  4OX9 K;  5AQL A;  1Q81 O;  1YT3 A;  4M3W A;  2KHO A;  3OYN A;  4H0Y B;  3UB5 A;  3LDL A;  3CYM A;  1FJG K;  5I3U A;  3V6D A;  4CK2 A;  4DTR A;  3LDO A;  4CEE A;  4Z4F A;  1RDC A;  3ULE B;  4CBX A;  4CGG A;  5HRP A;  2OPS A;  3DXM A;  4KBO A;  1S3X A;  3VES A;  1U45 A;  1SKW A;  4JK7 A;  3KD5 E;  1HNV A;  1HR0 K;  2UXD K;  3OJU A;  1T05 A;  2IIR A;  3M8S A;  2BH1 A;  5ELZ A;  4BR2 A;  3GDQ A;  5GAH P;  1ESV A;  4WE1 A;  1C0F A;  5KPT A;  2KFZ A;  3P31 A;  3THX A;  1IBL K;  4AHR A;  5AQN A;  3MEE A;  4RW4 A;  5FPE A;  3AA4 A;  4FWN A;  3P5J A;  1Q18 A;  1Q8I A;  2HHX A;  1IKY A;  1A5W A;  1BO5 O;  3THY A;  1TV6 A;  1LV5 A;  4C8M A;  2FF3 B;  3LWL A;  3RMC A;  3OYF A;  1C1C A;  1O13 A;  4MLH A;  3JXU A;  4AQY K;  3A0I X;  4FW2 A;  1X9S A;  3CJB A;  5HRS A;  3EZW A;  4HWI A;  4UY8 O;  1T7P A;  1NGC A;  4DSF A;  1REV A;  4KFB A;  3QFU A;  4PA1 A;  1N6Q A;  3MWP A;  4FOI A;  4W5T A;  1RT6 A;  4LF8 K;  3KK7 A;  4EHT A;  3J81 O;  4FWM A;  1I94 K;  1FXX A;  1T8E A;  4I6M B;  3CC2 N;  4BC2 A;  1TAQ A;  2RHK A;  4KTZ A;  2HVI A;  3R6M A;  3S41 A;  4J2A A;  1I39 A;  4O4G A;  2CH5 A;  4IG0 A;  4DQP A;  3U9Z A;  3KJV A;  2Q0U A;  4CZG A;  2AP1 A;  4FJI A;  4FWR A;  4TSX A;  2JGU A;  3NF6 A;  3ATV A;  2VGN A;  3AVG A;  1S72 N;  2O4G A;  4H03 B;  4HCC A;  4DR7 K;  2QXL A;  3D2F A;  3U4L A;  2ZJR L;  2HST A;  1RDA A;  3LL3 A;  1QZ5 A;  3D45 A;  2HW3 A;  5F2R A;  2PAV A;  1KD1 O;  1VQK N;  1HQU A;  1SKS A;  4JKD A;  1R59 O;  1WOQ A;  3KK1 A;  2HBM A;  5AQU A;  1CXQ A;  5SWM A;  2UYT A;  4CIF A;  1WNS A;  4KHP K;  1TYQ A;  1EQY A;  1MU2 A;  2P9I A;  1NK8 A;  2O8D B;  4JHD A;  4AM6 A;  1HKC A;  3K5N A;  3OYI A;  3A5L C;  4GVM A;  5CZ1 A;  4OKK A;  3HM8 A;  3QIN A;  3CCS N;  4XIU A;  1BDG A;  1C0G A;  1NJX A;  1W7A A;  2FBT A;  4FJK A;  2KKZ A;  1JXE A;  1OVQ A;  3RWU A;  2GUP A;  4J8F A;  5KRT A;  5J2P A;  4ELV A;  1W2B M;  3NMU A;  1NGA A;  1NK4 A;  1W97 L;  3I8D A;  2QWO A;  4OPA A;  1QSL A;  4KRF A;  4XH1 A;  3VQQ A;  4AH9 A;  1RBS A;  1GOC A;  2YNG A;  3V4I A;  1X3M A;  4HHT A;  3K5O A;  3TSU A;  3CCQ N;  3MN5 A;  4HVJ A;  3KK3 A;  5BR9 A;  4GNI A;  3SV3 A;  4LF4 K;  4LF9 K;  1JKH A;  1DLO A;  2GX9 A;  3NH1 A;  3TAM A;  5J2M A;  2HB5 A;  3TWH A;  2GWJ A;  3VEO A;  3ZET B;  3L2Q A;  5AQQ A;  3ULE A;  3PY8 A;  3FR0 A;  5C15 A;  5HRR A;  4B9U A;  2R7Y A;  1KAY A;  3QIO A;  3NFA A;  2G8I A;  3F9M A;  3MED A;  2OTJ N;  1BA0 A;  1GOA A;  2E2P A;  3TR8 A;  4CF8 A;  3TPQ A;  2ZJQ L;  4DR2 K;  3MX5 A;  1GLB G;  1XNQ K;  2Q3S A;  4J2D A;  2JWK A;  5I9E B;  5GIN A;  1HMV A;  1TK5 A;  4DQI A;  4HUE A;  1KLN A;  4M3X A;  1GLC G;  3LP1 A;  5E84 A;  2V51 B;  4KKO A;  3AVN A;  4BWM A;  4CEZ A;  1C0U A;  4H5N A;  3SCX A;  4I2P A;  2P9S B;  3VTH A;  3LDS A;  3L3U A;  4FZX C;  3WNH A;  1X9M A;  3ZEU B;  5AQY A;  4MO5 A;  3QB0 A;  4OO1 J;  4Y0W A;  3CJA A;  3AO2 A;  4W5O A;  5M1K A;  1S1T A;  3SQ2 A;  4EP4 A;  1NGJ A;  2YHB A;  1TVR A;  3F2K A;  4DCH A;  4K8Z A;  5BRD A;  2HMI A;  2Q36 A;  3M6G A;  3NE6 A;  1ATS A;  1K8K A;  3HOS A;  1DGK N;  1Q7Y O;  2E2O A;  5BRH A;  3GE1 A;  4Y1D A;  4WFA L;  1BIS A;  3WNE A;  1VQ4 N;  4RW9 A;  3LAK A;  1BGX T;  3CQX A;  3MCP A;  4DTM A;  4XH5 A;  4PKH A;  2GUI A;  3B6P A;  3HBT A;  3K5L A;  2QKK A;  1U04 A;  3VEY A;  4KV8 A;  2A6A A;  5SZT A;  4E7H A;  3NAE A;  1QZ6 A;  3VMF B;  4DR6 K;  1RNH A;  4GV9 A;  4AHS A;  1DTT A;  1SL2 A;  4C8O A;  4MDA A;  3OBW A;  3OYL A;  4DUZ K;  1RTJ A;  5F1X A;  5AQG A;  2NRH A;  3P38 A;  1N5Y A;  1BQN A;  2AA4 A;  3MMV A;  2YJE A;  3C65 A;  2E1Y A;  2G8V A;  1IJJ A;  3VQ4 A;  1KFS A;  2ZGY A;  3CFR A;  1SZ2 A;  3ULD A;  3K57 A;  4PQU A;  2RKI A;  1SUQ A;  3CQ8 A;  3M8P A;  4NXN K;  3MDQ A;  3RMA A;  1QSS A;  4LY7 A;  4CFB A;  1XC3 A;  4I9L A;  1KFD A;  4YOR A;  4C1N K;  4O0I A;  3S9H A;  2OCE A;  1ZBI A;  4BRK A;  2O8C A;  4FK2 A;  4JKA A;  3VQ8 A;  5GIO A;  3QEX A;  1KCF A;  5AQI A;  4BGB A;  1R0A A;  4BR0 A;  4BE1 A;  4Z4H A;  4CIG A;  4CJ7 A;  4JI3 K;  1VSL A;  4GY2 B;  3O4N A;  4GKK K;  1LWF A;  4FPB A;  4DF4 A;  1NMD A;  1Q9X A;  1WUA A;  5AFU A;  4KI6 A;  3WXM B;  2HHT A;  4CJQ A;  4R5P A;  4CZK A;  4F2S A;  3OS2 A;  3L0Q A;  4BE2 A;  4JKG B;  1P90 A;  1GLL O;  1D8Y A;  3FGU A;  1ASV A;  1QSY A;  1S1W A;  3AVC A;  1WB9 A;  2PY5 A;  2QXF A;  3DRS A;  3L6Q A;  3C95 A;  3FZH A;  3IFR A;  1NKC A;  1LAV A;  1UAX A;  3CFO A;  3IUC A;  3I8B A;  4DS5 A;  1RT7 A;  2VG6 A;  3SBG A;  4H5W A;  2P5G A;  4DB3 A;  4WQ5 C;  1GLA G;  2JWL A;  1NOZ A;  3WT0 A;  4DV4 K;  3ID6 A;  3HOT A;  3UE5 A;  3SPY A;  3CFP A;  5DK5 A;  2ASM A;  3DRP A;  3AO1 A;  4IWV A;  3V1R A;  3KWG A;  4WCE L;  4FK4 A;  5H1S Q;  1Y64 A;  3ZSV A;  2FXU A;  5GAG P;  4JHD B;  2D0O A;  2A3Z A;  3VGM A;  3BZC A;  4ILG B;  3AA2 A;  5MLC Q;  3CD6 N;  2UU9 K;  4CFC A;  3DAW A;  3C6U A;  2NRT A;  2X78 A;  3QDK A;  4CJK A;  3RTV A;  2OPR A;  4H0T B;  2DTU A;  1U49 A;  5JLH A;  4H0X B;  4Y1C A;  3LAM A;  3MEC A;  3ZEU A;  4E7I A;  3L3V A;  1QVG M;  1ASW A;  5AQH A;  4B9V A;  3OYB A;  1BU6 O;  1L3T A;  1RBU A;  1TK8 A;  2OZS A;  5A2Q O;  1K6Y A;  4PL7 A;  1MA9 B;  4YOX A;  4LD0 A;  5DM6 L;  4M7X A;  3PO4 A;  4PY5 A;  5EU7 A;  2P9N A;  1HX1 A;  3T1H K;  5B8H A;  1F21 A;  3QLH A;  4LF7 K;  2P1J A;  1VAZ A;  4DU4 A;  3AO5 A;  1SAZ A;  5AQW A;  4E1J A;  5BRF A;  3OVN A;  2JLE A;  1XUP O;  5AJ3 K;  3TAQ A;  2QWR A;  2ZE2 A;  1XMQ K;  2EHG A;  3I0S A;  3I33 A;  3O9U A;  3K5M A;  3CCM N;  2NUB A;  4KHN A;  1Y97 A;  1VHX A;  4CZE A;  2XY8 A;  5FRM A;  5FPN A;  3EO3 A;  5ADX H;  3CF5 L;  3L2U A;  3THV A;  1HYS A;  1D9D A;  4DSK A;  2FSJ A;  3B6O A;  4PL8 A;  1UA0 A;  1NK5 A;  4CD1 A;  4IOC L;  2A1R A;  2HBK A;  3RRH A;  1ATR A;  2VWK A;  2Z1G A;  4QOZ B;  2UXC K;  3BGR A;  1W0H A;  4RCH A;  4CJP A;  3V9X A;  3VF2 A;  4M45 A;  5LJV A;  3EYZ A;  4XH4 A;  2FF6 A;  3SUN A;  2Z1J A;  4IDH A;  1VRT A;  3B8A X;  3O3H A;  1YVU A;  2HHS A;  4BDP A;  3A5N C;  3AVL A;  4BRI A;  3U3Y A;  3MN7 A;  4FWL A;  3V9Z A;  1FK9 A;  1SS6 A;  2P51 A;  1DKG D;  3HPH A;  3I0R A;  1FKP A;  3K9K A;  3J7A P;  3AVA A;  3AVJ A;  4FL9 A;  2FBX A;  4EIA A;  4OLA A;  4WFB L;  3RR8 A;  4YOV A;  3DXK B;  3AO3 A;  3QIC A;  4JKH A;  3KHY A;  4IFY A;  4CJW A;  2EX3 A;  3P4I A;  2QKB A;  3VET A;  1NWK A;  4PKG A;  5FRN A;  1TYQ B;  4CIE A;  4E3S A;  1RCH A;  5AQZ A;  3K2P A;  4FJH A;  2XY7 A;  1CZB A;  2FLO A;  4CHO A;  1NMN A;  3H3N O;  1CZ9 A;  2NRV A;  3ZT0 A;  4BRC A;  4K42 A;  4JD2 A;  3G0Z A;  2IVN A;  4B9N A;  2O8E A;  2IDO A;  4M3T A;  1J5O A;  4JKE A;  4JD2 B;  1L3U A;  3N4P A;  3AVF A;  2FSN A;  4FOE A;  1VSH A;  1JCE A;  1NK6 A;  3ENB A;  3KLE A;  4EZ9 A;  5TKW A;  1YVN A;  1Z25 A;  4BC3 A;  5M1O A;  3CQY A;  3SNN A;  4LF6 K;  1VQ6 N;  1S6Q A;  1KQS M;  1BA1 A;  1LCU A;  4FJX A;  1LOT B;  5EX5 A;  4CJR A;  5E26 A;  1HUX A;  2D0B A;  4FJJ A;  1VQ9 N;  1RBT A;  4BR4 A;  3I55 N;  3V9W A;  1A5X A;  3ID8 A;  3R8E A;  4F4K A;  3EKU A;  4XEI A;  3UKR A;  4DV3 K;  2BTF A;  2YKM A;  4KHQ A;  2RF2 A;  5C2F A;  2Q2R A;  2YHA A;  3H08 A;  3FZL A;  4DV2 K;  5EY4 A;  1NKB A;  1ZBH A;  1XC9 A;  2QEX N;  4DUY K;  1QS4 A;  3AGR A;  2V7Z A;  2YNF A;  3LAL A;  1S9E A;  4BRP A;  4CEF A;  4B9M A;  4E7J A;  5AQR A;  2ITM A;  4FLU A;  2B5J A;  1SL0 A;  4O8K A;  4BRM A;  3KD1 E;  5JS2 A;  2GEL A;  1TKZ A;  5GAE P;  4JI7 K;  4JI4 K;  2Y1I A;  1WSF A;  4U67 L;  1J9A A;  3U6F A;  4Z4C A;  2VYP A;  4C1N I;  2P9L B;  3KKR A;  3TAG A;  3TSP A;  1QQC A;  4YNQ A;  4IOA L;  2G8H A;  3E9O A;  4ICL A;  4JAX A;  3HZ6 A;  1EWQ A;  4ISE A;  1MWK A;  4CED A;  5AZI B;  3IAY A;  5CR4 A;  3CJC A;  5DM7 L;  1YF5 L;  4BG8 A;  3OA9 A;  4A59 A;  1RTI A;  4BRL A;  3F9K A;  3VOV A;  4KRE A;  1YIJ N;  1NKE A;  4AHV A;  2W41 A;  2FBY A;  1UA1 A;  2GWK A;  3CM6 A;  3HRG A;  2HHQ A;  5HOO A;  4I2Q A;  3TTD A;  3VQB A;  3SV4 A;  4B3S K;  1BUP A;  4CI6 A;  4BDY A;  1K73 O;  2ITG A;  2DY4 A;  4CJV A;  4NLB A;  1KVB A;  2ZD1 A;  3RVC A;  5CHI A;  1YTU A;  4BDZ A;  1B9F A;  4PHT X;  4FM2 A;  3OY9 A;  4NB4 A;  4IOX A;  3ZLJ A;  3RMB A;  4FLV A;  4CHY A;  2HHH K;  3SAF A;  1UWB A;  1IG9 A;  1U4B A;  1ATN A;  3K9J A;  5AZJ A;  4CJT A;  4WF9 L;  1VSI A;  1NGH A;  2DFH A;  4BRA A;  3LPU A;  4I7F A;  4JKB A;  5AQK A;  3ZX3 A;  2XHB A;  3SUP A;  5C0Y A;  4IEE A;  4K0K K;  4BWJ A;  5HRO A;  1NU0 A;  1JLE A;  3C7N A;  2W42 A;  5CYM A;  3M8R A;  1ZXO A;  1QQM A;  4FK0 A;  1E4F T;  4CHP A;  5J2Q A;  4CD3 A;  4R79 A;  1B92 A;  2QWQ A;  4BGA A;  3BUZ B;  2CGJ A;  2IC3 A;  3QET A;  2VG7 A;  4FJL A;  1HJO A;  4FYD A;  4MLE A;  5AQV A;  3MWT A;  3CET A;  4KB0 A;  1OH5 A;  2O8D A;  3TSQ A;  2DFE A;  4BVP A;  2PYJ A;  2YX6 A;  2HF3 A;  3KWI A;  4JI8 K;  4KAZ A;  4CEO A;  1UOC A;  3KLG A;  3T3F A;  3QEP A;  4CEA A;  4RW7 A;  3DLR A;  3NDK A;  2NRX A;  4M3Y A;  4YOT A;  3LP2 A;  4BC5 A;  2HF4 A;  3IKM A;  3SQ1 A;  4F9O A;  3J8A A;  5EXW A;  3TAR A;  4JV5 K;  1LAW A;  2X6S A;  4RTF D;  1RDU A;  2P9N B;  1VSK A;  3CJ1 A;  4JK9 A;  1FKO A;  3NVM A;  3CJ9 A;  4DR5 K;  4B9T A;  3ISN C;  4OPH A;  4V19 S;  2ZM6 K;  3CIP A;  1C1B A;  5HP1 A;  4DQS A;  2EWS A;  1OH6 A;  4DTO A;  4JK8 A;  3OS0 A;  4CZM A;  5KPZ A;  1IKX A;  3F73 A;  1WSG A;  3MAQ A;  3M5R A;  4DQR A;  3HPG A;  4OKE A;  3WXL A;  3ZSQ A;  3NH2 A;  3H1V X;  4AHC A;  4OKJ A;  2A42 A;  4M7Y A;  4FJ9 A;  1TKX A;  3KIO A;  1N32 K;  4IJN A;  3THY B;  3LDP A;  4QS7 A;  3U8X A;  4L3Q A;  3ATU A;  1IBM K;  5AFU H;  1ZBF A;  4DWI A;  3G4S N;  3WXI A;  3UIQ A;  3NBP A;  1QHA A;  4U7B A;  4J2B A;  1ASU A;  3MK6 A;  4DQ8 A;  3QNN A;  4FLX A;  1S5J A;  2HNY A;  1BQM A;  4FXD A;  1RDD A;  4BR7 A;  3L4Q A;  1V4T A;  1QVF M;  2ZGZ A;  3GOI A;  1C6V A;  1JLC A;  1OH8 A;  3BF1 A;  5HBM A;  2A5X A;  1Q86 O;  4E0D A;  1U47 A;  4LFA K;  1QQO A;  2P9P B;  3MX2 A;  4F3T A;  4FCY A;  1L3S A;  4BG9 A;  2VWJ A;  3RMD A;  4AIL C;  3S3M A;  1H1V A;  2OYQ A;  1J54 A;  4FWS A;  3OYG A;  4CEC A;  2HVH A;  1VQ5 N;  1VRU A;  1ZBU A;  3CHW A;  1NK7 A;  4DV0 K;  3O3G A;  3DRR A;  2NRR A;  3Q7B A;  4N56 A;  4FJ7 A;  3DI6 A;  1VSE A;  4DTU A;  3V1Q A;  2F9T A;  1VSJ A;  3EKS A;  4WYB A;  2XY5 A;  1LWE A;  3CER A;  1HNZ K;  3OW2 M;  4CE9 A;  1XNR K;  3W0L A;  3RSE B;  5TKY A;  2O8B A;  4M63 C;  1L3V A;  4E89 A;  4DR1 K;  4LSL A;  2XO7 A;  3HXM A;  1RBR A;  4LC9 B;  3ZSX A;  3PO5 A;  3J7Y P;  2LSN A;  2W6K A;  4WQ5 A;  3QEW A;  3ZCM A;  3RR7 A;  4A62 A;  3HP6 A;  3OBY A;  3R3L A;  5AQJ A;  4FJ5 A;  3VF4 A;  3OYA A;  4DTN A;  1NNE A;  3ZYY X;  4CJU A;  4IXC A;  3PIP L;  4W5N A;  4WFN L;  2DFF A;  3OHR A;  3SK3 A;  1D4X A;  1QTM A;  1MDU B;  5GIP A;  2F9W A;  4AF1 A;  1NGF A;  2PZS A;  5JLF A;  4ZHR A;  1RGI A;  1NK0 A;  1TUU A;  1NG9 A;  4KTQ A;  1YXQ A;  3HST B;  1DTQ A;  4HCB A;  4M3Z A;  2FSK A;  3CCE N;  4JNE A;  2KLA A;  4L8R B;  2QA4 N;  1NJW A;  1HRH A;  2UUB K;  4LFC K;  2HND A;  3M3Z A;  5M1F A;  5BPL A;  4CHN A;  1HNI A;  4B1X B;  5IWA K;  1IBK K;  4CJ3 A;  2P9U B;  3FZM A;  3BZK A;  4CJ4 A;  3ZET A;  5FLX O;  4FVM A;  3UKR B;  2F96 A;  3OYM A;  3SAG A;  1HNX K;  3DWL A;  3HYF A;  3L2V A;  5CE3 A;  3DYA A;  1SL1 A;  2WUS A;  4CF0 A;  5KRS A;  4NLC A;  4FM1 A; 
#chains in the Genus database with same CATH homology
 1JLF A;  4FW2 A;  3RR8 A;  2WOM A;  1X9S A;  1HQE A;  3AVK A;  5KTQ A;  5HRS A;  3AO3 A;  1NOY A;  3FFI A;  4DU3 A;  1T7P A;  3HO1 A;  4DTJ A;  4DSF A;  3KLH A;  1REV A;  4KFB A;  2XY6 A;  1TGO A;  3SJJ A;  4PA1 A;  1N6Q A;  4IFY A;  4W5T A;  1RT6 A;  4DSL A;  4CJW A;  2EX3 A;  3AA3 A;  2QKB A;  3ALY A;  1S1U A;  4DTS A;  5FRN A;  1FXX A;  1XI1 A;  3HL8 A;  1T8E A;  3KLI A;  3T1A A;  3L2R A;  1TAQ A;  4KTZ A;  2HVI A;  3KKS A;  3C94 A;  1I39 A;  4J2A A;  1NK9 A;  2F8T A;  4O4G A;  2PYL A;  1X9W A;  2KFN A;  4CJS A;  4CIE A;  4E3S A;  4IG0 A;  1BIU A;  1RCH A;  4DQP A;  3K2P A;  3QIP A;  3LWM A;  3KJV A;  4FJH A;  4IG3 A;  4KHW A;  2D5R A;  2HNZ A;  3T19 A;  4B8C A;  2XY7 A;  4FJI A;  4M42 A;  3DLK A;  1CZB A;  4ID1 A;  4OGE A;  2F8S A;  1RT3 A;  1O1W A;  4TSX A;  2AJQ A;  4CHO A;  5J2N A;  1S1V A;  3NGZ A;  2JGU A;  3NF6 A;  1CZ9 A;  3AVG A;  3ZT0 A;  2O4G A;  2ATQ A;  2BAN A;  3G0Z A;  1QHT A;  3NGI A;  4B9N A;  4HCC A;  5J1E A;  4OLA A;  2IDO A;  3DMJ A;  4M3T A;  1J5O A;  2IGI A;  5D3G A;  2KZM A;  1RDA A;  3D45 A;  1L3U A;  2HHW A;  2HW3 A;  3AVF A;  1IKW A;  3ZT3 A;  1XHZ A;  5DMR A;  1VSH A;  1HQU A;  4CHQ A;  4NCB A;  1SKS A;  2E6L A;  4CEQ A;  1NK6 A;  4H4M A;  3KLE A;  3KK1 A;  1CXQ A;  3ZT2 A;  5SWM A;  3DLG A;  4EZ9 A;  3SI6 A;  1Z25 A;  4OVL A;  3VQ6 A;  1WNS A;  3PUF A;  4LSN A;  3VQE A;  4CIF A;  1KLM A;  3SYZ A;  3SNN A;  1MU2 A;  1NK8 A;  4CF1 A;  3SQ0 A;  3K5N A;  1S6Q A;  1Z26 A;  4GVM A;  4QAG A;  3P1G A;  5CZ1 A;  3OYI A;  1KVA A;  5KI6 A;  1C0T A;  1TL3 A;  4N47 A;  4FJX A;  4OKK A;  3L8B A;  2B4J A;  3QIN A;  4CJR A;  4XIU A;  3KLF A;  4HUG A;  2G8W A;  3C6T A;  1NJX A;  2D0B A;  4FJJ A;  1RBT A;  4ELT A;  2FBT A;  3SUO A;  3ZSZ A;  3V9W A;  1A5X A;  4FJK A;  4F4K A;  1JXE A;  3TAP A;  2I5J A;  1RTD A;  4G1Q A;  3RWU A;  4Z4G A;  5KRT A;  3NF7 A;  5J2P A;  2YKM A;  4KHQ A;  4ELV A;  1CLQ A;  2RF2 A;  3D0P A;  1CXU A;  2YHA A;  3H08 A;  4EP5 A;  4ZTF A;  1NK4 A;  1TK0 A;  4IKF A;  3I8D A;  1BCO A;  1NKB A;  3BDP A;  3LAN A;  1ZBH A;  4B9V A;  2KW4 A;  4CER A;  1XC9 A;  2A1S A;  4NYN A;  1QS4 A;  1QSL A;  4KRF A;  4J2E A;  1VSM A;  3JYT A;  3VQQ A;  1VSF A;  4AH9 A;  3KTQ A;  1RBS A;  1GOC A;  2YNF A;  1S9E A;  3LAL A;  4CEF A;  2YNI A;  4B9M A;  4E7J A;  2YNG A;  3V4I A;  1IKV A;  4FLU A;  2B5J A;  3NH0 A;  1SL0 A;  4CF2 A;  4HHT A;  3K5O A;  4DFJ A;  3KD1 E;  4HVJ A;  5JS2 A;  3KK3 A;  3CM5 A;  4NCG A;  1TKZ A;  3SV3 A;  2HHV A;  2Y1I A;  1WSF A;  3S3N A;  1J9A A;  1JKH A;  3U6F A;  4Z4C A;  1G15 A;  4F8R A;  1DLO A;  4C8N A;  3DLE A;  4GW6 A;  3NH1 A;  3HT3 A;  3TAM A;  5J2M A;  4FW1 A;  4M3U A;  2HB5 A;  3TWH A;  3IS9 A;  3KKR A;  1IO2 A;  3MEG A;  4RG8 A;  3L2Q A;  4JRQ A;  3TAG A;  2IAJ A;  3DLB A;  1C1A A;  1QQC A;  3VQA A;  4YNQ A;  2BGG A;  3HM9 A;  3PY8 A;  1WSJ A;  3VQD A;  4MFB A;  2G8H A;  4ICL A;  2VG5 A;  5HRR A;  4B9U A;  3M8Q A;  2R7Y A;  1JLA A;  5HRN A;  4FJ8 A;  1EP4 A;  1RT5 A;  3ZT4 A;  3QIO A;  4CED A;  3NFA A;  2G8I A;  3IAY A;  3MED A;  4RW6 A;  3SPZ A;  1RTH A;  3HPO A;  4KHS A;  4ELU A;  1GOA A;  3ZSR A;  4DSE A;  3TR8 A;  4CF8 A;  1RTI A;  3NGY A;  3V9S A;  3MXJ A;  3F9K A;  3OYD A;  4DSI A;  4KRE A;  1A5V A;  3MXM A;  1XHX A;  4DMN A;  1NKE A;  4AHV A;  1TL1 A;  3QO9 A;  2FBY A;  1UA1 A;  3VA3 A;  2Q3S A;  4PQU A;  3CM6 A;  4B8A B;  4J2D A;  2G8F A;  1HMV A;  3HJF A;  1TK5 A;  4DQI A;  4HUE A;  2HHQ A;  4I2Q A;  1KLN A;  4M3X A;  3HVT A;  3VQB A;  3SV4 A;  4DU1 A;  4BDY A;  4PUO A;  1BHL A;  1BL3 A;  4CGD A;  4BE0 A;  4OLB A;  2ITG A;  2DY4 A;  3A2F A;  3LP1 A;  4CJV A;  3TAN A;  3PX0 A;  1EKE A;  1KVB A;  2ZD1 A;  4FLT A;  1HYV A;  5CYQ A;  4KKO A;  3JSM A;  3VN5 A;  2P5O A;  3AVN A;  3OYJ A;  1YTU A;  4BDZ A;  4BWM A;  1B9F A;  1C0U A;  4MQ3 A;  4CEZ A;  3SCX A;  1TKD A;  4FM2 A;  4I2P A;  4E1M A;  3OY9 A;  4B9L A;  3LDS A;  3L3U A;  4FZX C;  3V9U A;  2IS3 A;  3WNH A;  1X9M A;  1BI4 B;  3SQ4 A;  4H4O A;  1QE1 A;  3DOK A;  4Z4I A;  5JS1 A;  1KVC A;  3ZSY A;  4FLV A;  4CHY A;  3RMB A;  3AO2 A;  4W5O A;  4C8L A;  5C42 A;  1S1T A;  4M3R A;  3SQ2 A;  1UWB A;  4EP4 A;  3E01 A;  1U4B A;  1IG9 A;  1JL1 A;  4CEB A;  2YHB A;  1TVR A;  5I42 A;  4K8Z A;  2D0A A;  4CJT A;  4M41 A;  3AVB A;  2HMI A;  1RDB A;  1TKT A;  3NE6 A;  3SZ2 A;  1RIL A;  1L5U A;  4RW8 A;  4IFV A;  1VSI A;  4OGC A;  3NHG A;  4JRP A;  2DFH A;  2IOC A;  3LPU A;  4I7F A;  4AHU A;  4Y1D A;  2XHB A;  3ZT1 A;  3NF9 A;  3SUP A;  1BIS A;  3WNE A;  3TI0 A;  2KTQ A;  4Z0U A;  4BWJ A;  4RW9 A;  5HRO A;  3U3G A;  1LW2 A;  4FLZ A;  3LAK A;  1JLE A;  2W42 A;  1BGX T;  5CYM A;  4DTM A;  4DLG A;  4CGI A;  3ASM A;  4CF9 A;  4O5B A;  3M8R A;  4CHZ A;  4FK0 A;  3HVR A;  3OYC A;  4CHP A;  3AO4 A;  5J2Q A;  2GUI A;  3LP3 A;  3B6P A;  2E6M A;  5C25 A;  4ID5 A;  3K5L A;  1ZYQ A;  2QKK A;  1B92 A;  1U04 A;  1RT1 A;  1VK0 A;  2IC3 A;  2X6N A;  3K58 A;  3QET A;  2VG7 A;  4FJL A;  4PWD A;  4KV8 A;  4FYD A;  2Y1J A;  5SZT A;  4E7H A;  3NAE A;  2YNH A;  4FLY A;  3OS1 A;  1LWC A;  1RNH A;  4KB0 A;  3WNG A;  1DTT A;  4AHS A;  1SL2 A;  4C8O A;  3OYL A;  1GOB A;  4JLH A;  2O4I A;  1LW0 A;  1RTJ A;  2D0C A;  1JLB A;  3QES A;  1N5Y A;  1BQN A;  2DFE A;  4E19 A;  1WAF A;  2PYJ A;  2G8V A;  4KHY A;  4DG1 A;  4DFK A;  3VQ4 A;  1WSE A;  1KFS A;  3HK2 A;  4KAZ A;  4CEO A;  2RPI A;  1UOC A;  3KLG A;  3CFR A;  4FLW A;  4K8X A;  2GBZ A;  3T3F A;  3HP9 A;  4EZ6 A;  3O4Q A;  1ITG A;  1VSD A;  4CEA A;  4RW7 A;  2RKI A;  4CJE A;  1SUQ A;  1JL2 A;  3K57 A;  3ULD A;  3CQ8 A;  3M8P A;  3VQ9 A;  1YTA A;  2ZQB A;  3KK2 A;  3DLR A;  3NDK A;  3RMA A;  1QSS A;  1WSI A;  4NCA A;  1S1X A;  4LY7 A;  4M3Y A;  4CFB A;  3DLH A;  3LP2 A;  1NJY A;  4I9L A;  1KFD A;  5CY4 A;  4O0I A;  4JS5 A;  4DS4 A;  3S9H A;  3OJS A;  3SQ1 A;  1SKR A;  1ZBI A;  3NF8 A;  3TAR A;  3AVI A;  3VQP A;  4N41 A;  1BCM A;  1LAW A;  2X6S A;  5CZ2 A;  4CJL A;  4FK2 A;  4NYF A;  3IRX A;  1VSK A;  3VQ8 A;  4DFM A;  3EZ5 A;  1FKO A;  2QK9 A;  3OYH A;  4KB1 A;  4B9T A;  3QEX A;  3DM2 A;  4KPY A;  3VA0 A;  1T03 A;  1KCF A;  3ISN C;  1ZBL A;  3TAE A;  1R0A A;  2YKN A;  4GMJ B;  1KRP A;  4BE1 A;  4Z4H A;  3AV9 A;  4CIG A;  1HYZ A;  1EET A;  3OYK A;  1VSL A;  4DQQ A;  1C1B A;  3O4N A;  5HP1 A;  4DQS A;  4DLE A;  3LP0 A;  4LH4 A;  1LWF A;  3L2W A;  4DTO A;  4DF4 A;  1Q9X A;  4O44 A;  4KI6 A;  2HHT A;  4Z4E A;  4CJ5 A;  3OS0 A;  4CJQ A;  4N5S A;  3LPT A;  1IKX A;  4R5P A;  2OPP A;  3F73 A;  1WSG A;  4F2S A;  3MAQ A;  5HLF A;  4DQR A;  1U48 A;  3OS2 A;  3RRG A;  3HPG A;  4OKE A;  5C24 A;  5KGX A;  4CCH A;  3ZSQ A;  4Q5V A;  2FC0 A;  3NH2 A;  4BE2 A;  4AHC A;  4OKJ A;  4CJF A;  1D8Y A;  4FJ9 A;  1ASV A;  1TKX A;  1X1P A;  1QSY A;  3KIO A;  1S1W A;  2BDP A;  3AVC A;  4AHT A;  3K59 A;  4YFU A;  2PY5 A;  2QXF A;  3DRS A;  2Z1I A;  4QCL A;  3C95 A;  1NKC A;  3QEI A;  1ZBF A;  3VQ5 A;  3QEV A;  1LAV A;  4DWI A;  1UAX A;  3CG7 A;  3CFO A;  4FJG A;  3UIQ A;  3NBP A;  1W9H A;  4FZZ A;  4IBN A;  4O0J A;  4CGH A;  4DS5 A;  2G8U A;  1ASU A;  1RT7 A;  2VG6 A;  3VQC A;  4JS4 A;  4J2B A;  2P5G A;  4KO0 A;  1D5A A;  2GV9 A;  3O3F A;  4FLX A;  1S5J A;  2HNY A;  1EX4 A;  1BQM A;  1NOZ A;  2YV0 X;  3QNN A;  3TAF A;  3S3O A;  3V1O A;  4B9S A;  4KI4 A;  1RDD A;  4FXD A;  2HHU A;  1RBV A;  3SPY A;  1TAU A;  4OPJ A;  3CFP A;  5KGW A;  5DK5 A;  1C6V A;  3DRP A;  3AO1 A;  1JLC A;  3PX6 A;  5HBM A;  3V1R A;  4E0D A;  5E41 A;  3OYE A;  4BAC A;  2BE2 A;  1U47 A;  4UQG A;  4KTW A;  4B3O A;  4B08 A;  4FK4 A;  3TAB A;  2OZM A;  1SV5 A;  3ZSV A;  4F3T A;  4FCY A;  1L3S A;  1I3A A;  1WSH A;  2VWJ A;  4CK3 A;  3RMD A;  4AIL C;  3S3M A;  1Q9Y A;  1EXQ A;  3ZSW A;  2OYQ A;  1J54 A;  2KQ2 A;  4O55 A;  4C8K A;  3AA2 A;  3OYG A;  2FBV A;  3QEP A;  4CEC A;  4CFC A;  3ITH A;  2HVH A;  3P83 D;  4DTX A;  4H8K A;  4FJN A;  3C6U A;  1VRU A;  1ZBU A;  3PV8 A;  4CFA A;  4DF8 A;  2X78 A;  5FDL A;  1NK7 A;  4CGF A;  1C0M A;  3O3G A;  4CJK A;  3DRR A;  3LZJ A;  3RTV A;  2OPR A;  1RT4 A;  4N56 A;  4LH5 A;  4CK1 A;  2KZZ A;  2DTU A;  4FJ7 A;  1U49 A;  2X74 A;  3DI6 A;  1VSE A;  2G8K A;  2OA8 A;  1BI4 A;  4DTU A;  3DOL A;  4OJR A;  3V1Q A;  4KHU A;  1WAJ A;  4Y1C A;  1VSJ A;  3LAM A;  3MEC A;  4E7I A;  3L3V A;  1WLJ A;  1ASW A;  1RT2 A;  3QNO A;  3V81 A;  1LWE A;  3G10 A;  3OYB A;  2XY5 A;  1L3T A;  1KSP A;  1RBU A;  3AA5 X;  1TK8 A;  3AVH A;  2OZS A;  4CE9 A;  4FZY A;  1BIZ A;  1K6Y A;  1L3V A;  4LD0 A;  4E89 A;  4I9Q A;  4LSL A;  2XO7 A;  3PO4 A;  4E7K A;  4PY5 A;  1WN7 A;  5EU7 A;  1HPZ A;  4E7L A;  3PX4 A;  1D9D A;  1KTQ A;  3HXM A;  1RBR A;  2RN2 A;  3ZSX A;  1F21 A;  3QLH A;  2OPQ A;  3EY1 A;  3PO5 A;  2P1J A;  4CGJ A;  1JLG A;  5K14 A;  1XWL A;  4DU4 A;  2LSN A;  3AO5 A;  3QEW A;  3ZCM A;  3RR7 A;  3AVM A;  4OPK A;  1S9G A;  3HP6 A;  1YT3 A;  3VQ7 A;  3OVN A;  4M3W A;  2JLE A;  3ZSO A;  3OYN A;  3TAQ A;  4W5R A;  2ZE2 A;  4FJ5 A;  2EHG A;  4CES A;  3I0S A;  3OYA A;  4DSJ A;  3K5M A;  4DTN A;  2NUB A;  4CJU A;  1Y97 A;  3CYM A;  3NCI A;  5I3U A;  4KHN A;  4Q0B A;  4W5N A;  2DFF A;  3V6D A;  4CK2 A;  2XY8 A;  2ETJ A;  4DTR A;  5FRM A;  1QTM A;  4CEE A;  4Z4F A;  3L2U A;  3IG1 A;  4IDK A;  3THV A;  2Z1H A;  1HYS A;  2PZS A;  1JXB A;  1RDC A;  1J53 A;  1S6P A;  4ZTJ A;  3B6O A;  4CGG A;  5HRP A;  4ZHR A;  4DFP A;  1UA0 A;  4DSK A;  2OPS A;  1NK5 A;  1NK0 A;  4KTQ A;  3WNF A;  1HJR A;  3HST B;  1DTQ A;  2A1R A;  1U45 A;  1SKW A;  4W5Q A;  4HCB A;  4M3Z A;  3KD5 E;  3RRH A;  1HNV A;  2VWK A;  2Z1G A;  4QOZ B;  5FRO A;  2WON A;  3OJU A;  1T05 A;  3M8S A;  4L8R B;  3BGR A;  1W0H A;  4CJP A;  1NJW A;  4F3O A;  1HRH A;  4E1N A;  3V9X A;  2HND A;  4HUF A;  4DTP A;  2XRI A;  4M45 A;  4CHN A;  3QER A;  1HNI A;  3EYZ A;  4WE1 A;  3LZI A;  2KFZ A;  1IH7 A;  2B6A A;  3SUN A;  2Z1J A;  4CJ3 A;  1VRT A;  4AHR A;  1NJZ A;  3MEE A;  4FJM A;  3O3H A;  4RW4 A;  3SUQ A;  3AA4 A;  4CJ4 A;  1YVU A;  3P5J A;  2HHS A;  1B9D A;  1Q8I A;  4FVM A;  4BDP A;  1IKY A;  1A5W A;  2F96 A;  3OYM A;  2HHX A;  3AVL A;  3U3Y A;  3HYF A;  4N76 A;  3V9Z A;  3L2V A;  3DYA A;  1FK9 A;  5T7B A;  1TV6 A;  2P51 A;  4HTU A;  1LV5 A;  3HPH A;  1SL1 A;  3MXI A;  4F2R A;  2E4L A;  3I0R A;  1FKP A;  4C8M A;  3LWL A;  3AVA A;  3RMC A;  1JLQ A;  4FM1 A;  1D9F A;  3AVJ A;  4CF0 A;  5KRS A;  1C1C A;  3OYF A;  4FM0 A;  4CFD A;  2FBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...