4CF8A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf8A00
2P1JA 2VWKA 4KHWA 2KZZA 2Z1HA 3ZT3A 3SPYA 2OPRA 1NJZA 1O1WA 1TK5A 1EXQA 1J54A 3AO3A 4KB1A 2B5JA 2BANA 3QETA 4UQGA 3NAEA 3OYGA 5C42A 3HP9A 1TKDA 1HNIA 3M8PA 1S9EA 3VQDA 3CM5A 4Z4CA 5KTQA 3IRXA 2VWJA 2YV0X 3QEPA 3VQCA 4DFPA 2G8HA 5C25A 2ITGA 4FJLA 2HB5A 4OLAA 4E1NA 3NCIA 1SV5A 2IAJA 3SCXA 3LP2A 1EX4A 1RT1A 3ZSZA 1C0TA 2A1RA 4FVMA 4RG8A 3MXMA 4XIUA 3K57A 4QAGA 3VQ5A 1RDAA 1W9HA 4CFBA 4C8OA 1KFDA 4JRPA 4DSJA 2YNHA 1L3UA 2IC3A 3KTQA 4ELTA 2HHXA 4JS4A 4O0JA 5C24A 1WSGA 1Z25A 3THVA 1S1VA 3V6DA 1WSHA 1LW2A 4HUGA 2QK9A 3NH2A 4BDPA 2OZSA 2YNGA 3I0SA 4DG1A 1RT5A 2Z1IA 4OVLA 4CEZA 3I0RA 4FLYA 2F8TA 4M45A 1R0AA 2ETJA 1VK0A 3O3HA 3K58A 1QQCA 4CEAA 3SQ2A 3QESA 3HXMA 1SKRA 1JLCA 1WAJA 1RILA 1NK8A 1RTHA 3F9KA 2EX3A 1NK4A 3HPOA 4HTUA 3TAPA 4CERA 1N6QA 5KGWA 3ITHA 3VA3A 4CEDA 3E01A 1WLJA 1JLFA 3HSTB 1D8YA 4HCBA 2XHBA 4RW8A 2DFEA 3V9UA 4FM2A 2DY4A 1KCFA 3DRPA 1HQEA 4F3TA 5JS2A 4CF2A 4M42A 1REVA 2F96A 3NF7A 1NK0A 4CF8A 2G8FA 4NCBA 3U3YA 1GOCA 4N41A 1KVBA 2HNYA 1JL1A 1HQUA 4BE2A 1ZYQA 4FZXC 3G10A 4KTWA 4CJLA 2DTUA 4IDKA 2FBTA 2FBVA 4FW1A 4FM0A 4DFKA 1IKYA 1UOCA 2I5JA 3NF6A 3V9WA 1S9GA 3ZT0A 1L3VA 3HJFA 3NH1A 5HRRA 1LWEA 3KKRA 3LDSA 4I7FA 4CF0A 4KKOA 3VQQA 1KSPA 1A5WA 3ALYA 3HPGA 4HHTA 1IKXA 4DTRA 4FZYA 4DTJA 5HBMA 3LWLA 3ULDA 4DTPA 1JL2A 3OYNA 5K14A 1C0MA 3VQ9A 1N5YA 1D9FA 3ZSXA 3D45A 3QO9A 3V1OA 1VSFA 3PUFA 4FZZA 1XHZA 4CJQA 1F21A 1BIZA 4EP5A 3QERA 3QNNA 4FJNA 3TI0A 4DMNA 1KFSA 1JLGA 1BI4B 4KI6A 4M3XA 1FKPA 3B6OA 4JRQA 3V9XA 4NYNA 3S3NA 4B9TA 3NGIA 2P5OA 4DSLA 4F4KA 4KRFA 3QEIA 2YNFA 1BISA 3SQ0A 1IG9A 3OYBA 4CF1A 2XY7A 1RDBA 3AVLA 3V1QA 2XY5A 1RT6A 1VRUA 4AHVA 4CJKA 3SUOA 4E7LA 2OYQA 1IO2A 4EP4A 4Q5VA 4DTXA 1J5OA 3AVCA 2KFZA 4KAZA 3P1GA 4H4OA 3C6UA 1TKZA 1TAUA 3MEEA 4FJXA 3RTVA 1JXBA 3JYTA 1LV5A 1SKWA 3K2PA 4BDZA 3NHGA 5J1EA 1SL1A 3SYZA 4GVMA 1BCOA 1RBRA 3DYAA 3QLHA 4HUEA 1WSEA 4DTUA 4CHYA 4DQPA 3AVHA 3HM9A 1JLQA 4HUFA 1B92A 2E4LA 4F2SA 3TAQA 2OPPA 2HHSA 3HPHA 4MFBA 1X9MA 1C0UA 3BGRA 3VQBA 1HYVA 4NYFA 3O3GA 3LZIA 2X6SA 3V81A 3DLHA 1VSKA 2HNDA 1NJWA 1RBSA 3QNOA 3AVKA 3PX4A 3MXIA 4IBNA 5D3GA 4YFUA 4E7HA 4CE9A 3AVJA 3F73A 1Z26A 2KW4A 4AHRA 4KFBA 1L3SA 4IG3A 4B9VA 4DSEA 3T1AA 1EETA 3LALA 1VSLA 5FRMA 2BDPA 5HRPA 4PY5A 1KRPA 5DK5A 4FJHA 2RKIA 4DTMA 1W0HA 1ITGA 4OKEA 4FJ5A 3FFIA 5CZ2A 4YNQA 4R5PA 4CGJA 3OYLA 2OZMA 1S1TA 4CIGA 4BE0A 3AV9A 3NDKA 4RW4A 1ZBIA 2X74A 4DQSA 4OGCA 5HRNA 4CJPA 2E6LA 1VSJA 3T19A 3PX6A 4CCHA 3G0ZA 1YVUA 4W5RA 4B9NA 5KRSA 4EZ9A 5DMRA 3MEDA 4KHSA 3CQ8A 3VQPA 2O4GA 1RNHA 3S9HA 1UAXA 4B9LA 4B8AB 1YT3A 1WN7A 2E6MA 4B8CA 5HLFA 3ZT4A 1KLNA 3SPZA 3TARA 4CJUA 2G8WA 2D0BA 3NH0A 3L2UA 4O5BA 3AVFA 4AHSA 1L5UA 4O55A 1QSSA 1IKWA 1ASWA 1S1UA 4FXDA 4IFYA 3QINA 4N5SA 4F3OA 5KRTA 3A2FA 4DTOA 3K5LA 3ZSWA 1QE1A 3KD1E 5FROA 4PQUA 2R7YA 1VSIA 4AHCA 4BWMA 4E1MA 3M8SA 3K5OA 4M3ZA 4CJSA 4CFAA 2FC0A 4FJ8A 3AA3A 3OJUA 3L3UA 3SZ2A 3AVNA 4ICLA 3KLIA 1S5JA 3RR8A 2HHWA 2ZQBA 1VSHA 2YHBA 3OVNA 1Y97A 5CYQA 2ATQA 2D0CA 1NJYA 2HVHA 1D5AA 3ZCMA 4N76A 4Y1CA 3OYMA 3LPUA 3LZJA 3NGZA 1LAVA 3RRHA 1CZBA 3K5MA 1VSMA 4M41A 3K59A 3H08A 3EZ5A 1NKCA 3L2QA 4J2EA 2VG5A 4DU1A 4DLEA 5I42A 1NKBA 4F2RA 1I3AA 4FJGA 3L2VA 1I39A 3AO1A 4CK1A 2B6AA 4OGEA 3DOLA 4CJWA 1ZBLA 1EKEA 4DTSA 4CHZA 4KHYA 3DMJA 1RT3A 4DSIA 1G15A 4Z4HA 4DQRA 3VA0A 4FJIA 4BWJA 1J53A 2XY8A 3ZSOA 4CHPA 4AHUA 2O4IA 1S6QA 3KJVA 1ASUA 2GUIA 2ZD1A 2D0AA 3VN5A 4CJRA 3VQAA 2JLEA 4NCGA 1GOAA 4G1QA 2IOCA 2WOMA 1BQNA 2NUBA 1BL3A 2B4JA 1XWLA 4C8NA 3LWMA 3L8BA 4LD0A 5J2NA 2HVIA 4I2QA 4HCCA 2YKMA 3L2RA 1HYSA 4IKFA 3AVBA 3OYDA 1X9SA 3DI6A 1X9WA 4AHTA 3TANA 5J2QA 1S1XA 2HMIA 4B9UA 5J2PA 4L8RB 2GBZA 1WSFA 3IS9A 3O3FA 1U48A 4DF4A 1RCHA 3AO4A 3OS2A 1SL0A 3HL8A 4W5NA 3U3GA 1CXUA 2BGGA 3QEVA 3DLBA 1TKTA 2VG7A 1IH7A 3DM2A 1U45A 3IAYA 3ZSVA 1QHTA 3KK3A 3SNNA 2AJQA 3SQ4A 4Z4EA 3C6TA 1S1WA 1U49A 1U47A 3MEGA 4I9LA 2HW3A 1BQMA 1WSJA 2F8SA 3AA2A 1HNVA 3QEXA 1T7PA 3KLEA 2EHGA 4M3TA 3TAGA 3KLFA 2PYLA 4CF9A 1TAQA 4GMJB 1YTAA 1IKVA 3C95A 4FYDA 2KFNA 4FJMA 1TVRA 4Z4GA 1A5VA 4ID5A 1KTQA 3AVIA 3PO4A 3WNHA 1X1PA 4WE1A 4LSLA 2G8KA 3WNEA 4DQQA 1LWFA 3KLGA 1RBTA 4DTNA 2D5RA 1HPZA 1FK9A 4O0IA 1KLMA 3CFPA 1UA1A 2Z1GA 2ZE2A 4OKKA 4PWDA 3AO5A 3VQ7A 3AA4A 1DTQA 4BACA 3OYAA 3OYKA 4QOZB 5SWMA 1SKSA 3V4IA 2X78A 5HRSA 2DFFA 1NK9A 1TKXA 1NK6A 2WONA 1B9DA 4B9MA 1L3TA 4ID1A 1VSDA 4CJTA 2HHTA 2HHVA 1NK5A 1LAWA 1TL1A 3QEWA 4Y1DA 1CXQA 1GOBA 3O4QA 4Z4FA 1C1CA 1XC9A 4B3OA 3RMDA 1T03A 4CJ4A 4ELVA 4AILC 3HP6A 1JLBA 2QKKA 3OJSA 3K5NA 1NOYA 4KTQA 1LW0A 4QCLA 1XHXA 1XI1A 3PY8A 4FLXA 3AVMA 4FK4A 1SUQA 3SUQA 4LH4A 2OPSA 1SL2A 1JXEA 1FXXA 3TAFA 3C94A 2Y1IA 3WNFA 3KD5E 3MXJA 3AVAA 4CIFA 4CECA 4FLWA 2XY6A 4E19A 5HP1A 2G8UA 1B9FA 4CGFA 4FJ9A 5T7BA 4CK3A 1NK7A 1TK0A 3DLGA 1BCMA 1RDDA 2P5GA 3L3VA 4K8ZA 4E7IA 3I8DA 5FDLA 2XO7A 2VG6A 4FJJA 4CGDA 5HROA 3BDPA 1T8EA 1EP4A 1ASVA 1U04A 2DFHA 3NFAA 4CESA 4CHQA 3OYFA 3ISNC 4LSNA 4DU3A 4EZ6A 1QSYA 3OYCA 4RW7A 1U4BA 1KVCA 4KB0A 1VRTA 3T3FA 3LANA 3LAMA 1NJXA 1MU2A 1QS4A 2YHAA 4KO0A 3SI6A 3JSMA 5KI6A 4C8KA 3TAEA 2G8IA 1BGXT 1DTTA 4CFCA 4RW6A 3EY1A 4FM1A 3SUPA 1C1BA 2G8VA 4CEEA 3OY9A 1RT4A 4CHNA 3LP3A 4PUOA 3RRGA 1ZBUA 2JGUA 1FKOA 4IFVA 4E7KA 4CGGA 3CM6A 2KZMA 1RBUA 1RBVA 4DFMA 4W5QA 2PZSA 4M3WA 2YKNA 2P51A 3P83D 3V1RA 2RN2A 1HRHA 3SQ1A 4IG0A 1DLOA 4O4GA 5KGXA 4FLVA 4C8MA 4N47A 3S3OA 3QIOA 3O4NA 4KREA 3HVTA 2IDOA 4CFDA 3P5JA 4CGIA 4KHUA 2A1SA 2RPIA 5J2MA 3ZSQA 4J2AA 4PA1A 4HVJA 5EU7A 4FLUA 4E3SA 4CK2A 4CIEA 3M8RA 3ZT1A 3L2WA 1HYZA 4NCAA 2IS3A 3RMCA 1S6PA 3KK1A 3SV3A 3SJJA 3PO5A 3AA5X 1CLQA 4CEBA 4C8LA 3LP1A 5I3UA 4MQ3A 4KHQA 3RMBA 3LP0A 2XRIA 4CJ3A 4CEQA 5JS1A 4BDYA 4E7JA 3DOKA 3VQ8A 1BIUA 1TGOA 4BE1A 2PY5A 2FBYA 4KV8A 1RTJA 1RTDA 1TV6A 4I9QA 3PX0A 4FK2A 4N56A 1J9AA 3CG7A 4DF8A 4ZTFA 3RWUA 4H8KA 1A5XA 4F8RA 2IGIA 4J2BA 1K6YA 4OPKA 3ZT2A 3M8QA 3OYHA 3WNGA 4ZTJA 2QKBA 4DFJA 4DSKA 3MAQA 2W42A 2Y1JA 4W5OA 1TK8A 4M3UA 4OLBA 4KPYA 3MECA 2X6NA 3DLEA 2HHUA 4LH5A 3HK2A 3EYZA 3SV4A 1WAFA 4OPJA 4B08A 1QTMA 1RTIA 1UA0A 4CEOA 1RT7A 3V9ZA 3NGYA 3TABA 3OS1A 4FK0A 4Z4IA 4B9SA 3OYEA 1RDCA 2FBXA 1ZBFA 3DLKA 2RF2A 2Q3SA 3KIOA 3ZSYA 4Q0BA 4AH9A 1LWCA 4E89A 3DLRA 4RW9A 3HYFA 5CY4A 4CJEA 2PYJA 2YNIA 3CFRA 2KQ2A 4CGHA 3RR7A 4GW6A 4FJ7A 4TSXA 3OYJA 2QXFA 4ZHRA 1RT2A 4KI4A 2HNZA 4I2PA 3HO1A 3OS0A 1NOZA 4JLHA 4DLGA 3KKSA 1JLEA 3VQ6A 5E41A 4W5TA 1Q8IA 4OKJA 1VSEA 4DS4A 3VQ4A 4J2DA 3QIPA 4KTZA 3TWHA 1BI4A 3NF9A 1TL3A 4FLTA 1JLAA 1HMVA 4FJKA 5FRNA 3AO2A 3VQEA 2OA8A 3S3MA 2GV9A 3TR8A 3NF8A 2LSNA 4DS5A 3UIQA 1JKHA 4CHOA 4FW2A 3U6FA 4O44A 1D9DA 3RMAA 1BHLA 3CYMA 1WNSA 4H4MA 1YTUA 3AVGA 3ZSRA 3HT3A 3B6PA 1QSLA 3KK2A 4K8XA 1HJRA 3CFOA 1T05A 3NE6A 4Z0UA 5CYMA 4JS5A 4DU4A 3OYIA 1C1AA 3DRSA 1C6VA 4M3YA 3IG1A 2Z1JA 3LAKA 3PV8A 3SUNA 4KHNA 2HHQA 4OJRA 2KTQA 3LPTA 4ELUA 1ZBHA 4CEFA 2BE2A 2OPQA 3NBPA 4E0DA 4CJFA 3HVRA 1NKEA 3DRRA 5SZTA 1CZ9A 4FLZA 4M3RA 1UWBA 5CZ1A 4FCYA 3V9SA 4CJ5A 1Q9YA 3D0PA 3KLHA 4DQIA 4DWIA 3TAMA 4LY7A 1KVAA 3ASMA 4DSFA 1WSIA 4CJVA 1Q9XA
chains in the Genus database with same CATH superfamily
2P1JA 2KZZA 1XUPO 2Z1HA 4FWSA 3HM8A 1TK5A 4JKAA 1J54A 3AO3A 4NLBA 3NAEA 4H0YB 3M8PA 5H1SQ 5AQKA 3IRXA 1R59O 3VQCA 1GLLO 2ITGA 4OLAA 3BZCA 4H03B 3SCXA 4DUYK 1EX4A 1RT1A 4FVMA 1RDAA 2FLOA 4DSJA 1XC3A 2IC3A 4HWIA 3PIPL 2ZJQL 3MCPA 2HHXA 4BGBA 1LW2A 2QK9A 4BDPA 1N8RO 4DG1A 3I0RA 1S3XA 4MDBA 1QQCA 3K58A 3SQ2A 3Q7BA 3HXMA 3D2EA 1RTHA 3F9KA 1WOQA 2FSKA 3A5NC 3TAPA 1N6QA 5KGWA 3VENA 4AF1A 3PLAA 4HCBA 2XHBA 3V9UA 4FM2A 3CJAA 4F3TA 4AM6A 5JS2A 2F96A 3NF7A 2O8DB 2HNYA 2I7NA 1HQUA 2J4RA 4FZXC 3G10A 2DTUA 4CJLA 2FBTA 4GNIA 2E88A 4JKEA 1HX1A 3NF6A 1S9GA 4IJNA 3ZT0A 3HJFA 1LWEA 4I7FA 5HBMA 3LWLA 1D9FA 1BDGA 3ZSXA 3O80A 3UKRA 4NB4A 1BIZA 4EP5A 3H3OB 1KFSA 1Q18A 3S3NA 3HI0A 4NYNA 3WEEB 4DSLA 4KRFA 4C1NK 2YNFA 2P9SB 3OYBA 2CGKA 1HNWK 3AVLA 2O8CB 1C0GA 4IWVA 3V1QA 2QA4N 1RT6A 3TTFA 4E7LA 2KFZA 4KAZA 4CBUA 3MEEA 3JYTA 3NHGA 5BREA 5F0XA 1YF5L 1RBRA 1WSEA 4CHYA 4KBOA 1VQKN 3FE1A 2NZTA 2YCHA 4JI4K 4F2SA 3VQBA 3LZIA 2QW9A 2HNDA 4IXCA 3MXIA 3AVJA 2A42A 1V4SA 4IG3A 4JI2K 4DSEA 4B9VA 3T1AA 1EETA 1QZ6A 5AQSA 4YOYA 3LALA 2BDPA 2QWOA 4PY5A 1KRPA 5DK5A 3CMAN 4FJHA 2RKIA 2Q0UA 2OZMA 1Z6RA 1K73O 3RSEA 2X74A 3T19A 4CCHA 3R3LA 4EZ9A 4FWPA 5DMRA 1UAXA 1DT9A 4B8CA 3MX2A 4HTLA 3ZT4A 3SPZA 4CZEA 3D2EB 3AAQA 3EE9A 3M6GA 5AQXA 3AVFA 1QSSA 3EE8A 4IJAA 1NLVA 4N5SA 5KRTA 3L4IA 4JI6K 3KD1E 5FROA 4PQUA 4M3ZA 4AHCA 4E1MA 3O9QA 4CJSA 3LDOA 2QWRA 4FJ8A 3VEXA 5LJVA 3N4PA 1HLUA 3KLIA 3J7AP 1VSHA 1Y97A 3UB5A 2D1KA 1I94K 3CHWA 3NGZA 1LAVA 1VAZA 2PBDA 5F2RA 4M41A 3TPQA 5AQLA 4M7YA 5GIOA 1I39A 4CK1A 4OGEA 1EKEA 4DTSA 5C10A 1E3MA 4KHYA 3UKRB 1RT3A 4Z4HA 4DQRA 4AHUA 3KJVA 3WUHA 3VQAA 2JLEA 3KZBA 3R1XA 1BQNA 3EKSA 2B4JA 4C8NA 1WUAA 4LD0A 4I2QA 2YKMA 3VTHA 4IKFA 3OYDA 1X9SA 5J2PA 1NGJA 1U48A 1NMNA 4DF4A 1RCHA 2HSTA 3OS2A 3IKMA 3U3GA 1CXUA 4H5TA 3A5OC 1WBBA 2KLAA 2VG7A 1U45A 5KPRA 5BPMA 4Z4EA 4CBWA 3J8AA 3EO3A 3MEGA 1WSJA 2F8SA 4PL7A 3DWLA 3IFRA 3QEXA 2EHGA 4DR7K 3QFUA 4CF9A 2HF4A 4GMJB 4U7BA 4FYDA 1RGIA 4WFBL 3P39A 1TVRA 3PO4A 1X1PA 4XH5A 2G8KA 4YDUC 1LWFA 3KLGA 3G6EN 4YHHK 4DTNA 2P9IA 1UA1A 2ZGZA 3AA4A 4OX9K 5SWMA 3CJCA 1SKSA 3RSEB 3V4IA 2Q1NA 2X78A 4Y0WA 4X65K 2D0PA 2WC9A 3U9DA 2VCPA 4ID1A 4CJTA 2HHTA 4JKGB 5HL7L 4JKBA 1Z05A 4B3SK 3O4QA 1XC9A 4JKDA 1QQMA 5AQFA 3HP6A 4DHYA 3A5LC 3K5NA 4GVEA 4QCLA 1XHXA 4FLXA 4BR0A 2VYPA 1QHAA 2KKZA 1SL2A 1SZ2A 1FXXA 3TAFA 3J80O 2V7YA 4CIFA 4CGFA 5T7BA 3CMEN 3DLGA 1RDDA 3L3VA 4K8ZA 4RWTA 2ZJRL 2VG6A 2P9LA 1ILYA 4FJJA 4BR2A 3OYFA 1GLEG 5BRFA 1U4BA 1NGAA 4DR6K 1ATNA 5KPZA 4JI1K 4H0VB 4AQYK 3JSMA 5KI6A 5AQRA 2G8IA 3EY1A 4RW6A 3R9PA 1VQPN 4JN4A 4PUOA 2NRWA 1FKOA 2HOEA 4CGGA 3CM6A 1RBUA 4DFMA 4W5QA 3SBTA 2HF3A 4QS7A 4IG0A 4EHTA 3QIOA 3O4NA 1HR0K 5FPNA 4LFBK 4KHUA 2PAVA 3H6EA 3ZSQA 4PA1A 2QM1A 2RHKA 4HVJA 4YOWA 4E3SA 4CK2A 3ZT1A 3D7EO 3KK1A 3PO5A 4BR7A 3AA5X 3VEWA 3VPZA 3SAGA 2XRIA 2FF3B 3VQ8A 5BRHA 2GWJA 2FBYA 1TV6A 4CBXA 3PX0A 1O13A 1J9AA 1T6DA 3CG7A 5GADP 1W2BM 4ZTFA 4F8RA 4J2BA 3MN6A 3ZT2A 3OYHA 2QKBA 4FVUA 3MAQA 4W5OA 4M3UA 3MECA 2X6NA 3DLEA 4IDHA 3HK2A 3EYZA 4JI7K 1YI2N 4CEOA 1RT7A 3OS1A 3O9UA 3OYEA 1RDCA 3ZSYA 4A59A 3KIOA 4DR3K 4AH9A 1LWCA 3HYFA 3CJ9A 3CFRA 3SMPA 1X3NA 2KQ2A 1Q7YO 1K9MO 4GW6A 3OYJA 3G25A 3TTCA 1TYQA 4ZHRA 1RT2A 4KI4A 2HNZA 4ILHA 2NRZA 4DLGA 1JLEA 1NGIA 3GDQA 1Q8IA 1VSEA 3VQ4A 3QIPA 4KTZA 5DM7L 3D2FA 3NF9A 1TL3A 4FJKA 5FRNA 3AO2A 3VQEA 2GV9A 2LSNA 2UYTA 1JKHA 1D9DA 4O44A 2QWLA 2A3ZA 1YTUA 3HTVA 4XEIA 4A62A 4Z0UA 5CYMA 2CH6A 3OYIA 1C6VA 3SUNA 3IUCA 4ELUA 2BE2A 4BROA 2P9LB 1VQ7N 1RDUA 4E0DA 4CJFA 2IIRA 5AQZA 4X66K 3HVRA 2VGNA 3VESA 4DR1K 5SZTA 4FLZA 5AQUA 3QB0A 5CZ1A 4FCYA 4GV6A 4DQIA 3W3DA 3TAMA 4DWIA 4PL8A 3ASMA 1JL1A 2H3GX 1WSIA 4LFAK 2O8EA 2VWKA 2PFUA 3SPYA 1EWQA 2OPRA 1O1WA 1TUYA 1EXQA 4KB1A 3FGUA 2B5JA 3QETA 3OYGA 5C42A 1HNIA 4Z4CA 4FJLA 2HB5A 1SV5A 2IAJA 3MCAB 3ZSZA 1C0TA 2A1RA 3MXMA 4XIUA 2WFBA 3K57A 4C8OA 2YNHA 4DB3A 5JLFA 3D6RA 3CJ1A 4BR4A 4FPBA 3KTQA 1Z25A 1S1VA 1W7AA 3V6DA 3QMLA 4C23A 3ENHA 1RT5A 4WQ4C 3CERA 4M45A 4JYAK 3O3HA 1JLCA 1RILA 2EX3A 1NK4A 3L6QA 4CEDA 3E01A 1WLJA 1NNEA 3SMSA 1KD1O 3JS6A 4RW8A 2DFEA 5TKWA 4CZMA 4BRNA 3ZEUB 1XMOK 1NK0A 4CF8A 1GOCA 3H46O 4IFEA 2UUAK 2YJEA 4IDKA 3LM2A 4FW1A 2D0OA 3VGMA 3DLLL 4GV3A 1OVYA 3LDSA 4WQ5A 2A40A 4DTRA 1IKXA 4DTJA 3I55N 3F5TA 5AFUH 1TYQB 4JI0K 5BR8K 1GLCG 3UKUB 1VSFA 3PUFA 4CJQA 4KI6A 3D2FB 2P5OA 2ZWHA 3NGIA 5C2FA 1BISA 1IG9A 4CF1A 3O1BA 1VRUA 4AHVA 5LY3A 1IO2A 4Q5VA 1ZBSA 3P1GA 4H4OA 4IOAL 1TAUA 3WEEA 3RTVA 3K2PA 2QTDA 2P9SA 4GVMA 3VMFB 1BCOA 5M1QA 5EY4A 4DQPA 3AVHA 1ZC6A 2V7ZA 1B92A 2E4LA 2GEMA 4MFBA 1C0UA 3DLHA 1KC8O 4NYFA 4YY3K 3AVKA 2GWKA 2ASPA 5D3GA 2KW4A 4BRHA 5EOYA 2QWPA 4LF6K 3CCJN 4DTMA 2VWBA 4K42A 3FFIA 5CZ2A 4R5PA 4X64K 4B3RK 1S1TA 4BE0A 2IVPA 3NDKA 5LMNK 1ZBIA 4DQSA 4OGCA 4BREA 5HRNA 1Q86O 1VSJA 3PX6A 3EN9A 2ASMA 2YHXA 4CZFA 3BF1A 3BUZB 4KHSA 4LC9B 2WTUA 4B1YB 5M1OA 5EXWA 3MWPA 4B8AB 2E6MA 1WN7A 1P8ZA 1GLBG 1KLNA 4WCEL 3CCQN 3ULEB 1N34K 3ENOA 2D0BA 1S22A 3NH0A 4FWQA 1OH7A 4O5BA 4AHSA 1L5UA 1IKWA 4FSVA 1S1UA 3A2FA 3J7YP 3RVCA 1IV0A 3T1HK 2R7YA 4BG9A 4BWMA 3K5OA 4CFAA 2CGLA 4CD3A 3AVNA 1YHQN 3H3NO 1SQKA 3OVNA 1NJYA 2HVHA 3LDPA 4Y1CA 3LPUA 1VSMA 3H08A 3WQUA 4J2EA 2VG5A 1NKBA 1VQNN 1XNQK 1ZBLA 4O5FA 4CJWA 2RE2A 1EWRA 4DSIA 1G15A 4FOEA 1FW6A 1VHXA 2XY8A 3ZSOA 2O8BA 4CHPA 2NLXA 4O8KA 2D0AA 4CJRA 1XMQK 4NCGA 4JKHA 2W40A 3L8BA 3CXCM 1XWLA 5J2NA 2HVIA 3AVBA 4AHTA 5C2DA 1S1XA 3CC4N 2HMIA 1NGGA 4B9UA 4L8RB 1WSFA 5AFUA 4CZGA 3HL8A 3A0IX 3NVMA 3MMVA 1MA9B 3AAPA 3SNNA 3SQ4A 3C6TA 1S1WA 3DXKA 1U49A 4BC4A 2HW3A 1BQMA 1S72N 3KLEA 4M3TA 4DR5K 4RTFD 1T6CA 3AVIA 3CJBA 3EZWA 3L4QA 2D5RA 1HPZA 3CFPA 4B3TK 3OYAA 3OYKA 4QOZB 4BRCA 4CZLA 1B9DA 1VSDA 3EEQA 1TL1A 4Z4FA 4B3OA 1NJIO 3E9LA 4ELVA 1J6ZA 5LL6Z 1JLBA 2QEXN 2QKKA 3OJSA 3FR0A 1NOYA 1XI1A 3PY8A 4FK4A 1JXEA 2Y1IA 4JKGA 3WNFA 4BRGA 3AVAA 4JI8K 2IVOA 2XY6A 2G8UA 2WBNA 1B9FA 4FPAA 1NK7A 3J81O 3I8DA 5FDLA 2E1ZA 2YI1A 3BDPA 1T8EA 1EP4A 1ASVA 2DFHA 4CESA 4CHQA 3ISNC 1Q81O 1NBWA 1VRTA 3T3FA 3LAMA 4OPHA 2YHAA 4KO0A 3R8EA 4A2AA 3K9KA 3CC2N 1DTTA 1ATRA 3SUPA 4PHTX 1W97L 4CEEA 3OY9A 4CHNA 5AQHA 4IOXA 2JGUA 2O8BB 3WQTA 4DUZK 4XH4A 1E4FT 1K8AO 4M3WA 2YKNA 3VGKA 3V1RA 2RN2A 3THYB 1N33K 3OHRA 4FLVA 3S3OA 5GAGP 3AY9A 4CGIA 5AJ3K 3C65A 5AQNA 5BRDA 3M8RA 4B1VA 3WT0A 4KH5A 1HYZA 3WXMB 3SV3A 2E8AA 1HKBA 4CEBA 1NG9A 3LP1A 3LP0A 2E5LK 3DXKB 4BDYA 3B8AX 3DOKA 3LDNA 4E7JA 1BIUA 2PY5A 4KV8A 2JWKA 4FK2A 4DV5K 2E2QA 4DF8A 1A5XA 3M8QA 2Y1JA 1TK8A 4LF4K 4GY2B 3PIOL 1WAFA 1RTIA 3SJHA 1UA0A 3MDQA 2KHOA 4FK0A 4Z4IA 4B9SA 1EO1A 2W41A 2FBXA 3DLKA 2RF2A 2Q3SA 4E89A 4RW9A 2NRXA 2YNIA 4CZKA 2AP1A 2UXCK 4C1NI 4FJ7A 4TSXA 2NRHA 4I2PA 3VQ6A 4J2DA 4Z94A 3TWHA 1BI4A 5E26A 4FWOA 2OA8A 3S3MA 3U6FA 5AQIA 3B6PA 5GINA 3KK2A 1QSLA 1HJRA 1C1AA 2HHQA 3HBTA 4A2BA 1ZBHA 5E84A 5I9EB 1HJOA 2OPQA 3OW2M 1OH8A 1YXQA 1UWBA 1VQMN 3CI5A 1KVAA 2BUPA 3VF4A 3ZT3A 1NJZA 2VQFK 5GAHP 2E2OA 3THWB 2Q0RA 4UQGA 3AGKA 4EHUA 1TKDA 3VQDA 2YV0X 2E1YA 3QEPA 2G8HA 5C25A 4L3QA 4E1NA 3LP2A 3KVGA 4RG8A 2E2PA 4QAGA 4CFBA 4JRPA 4DCHA 1VQON 1L3UA 5LMUK 5IWAK 4MO4A 4YOTA 3O6WA 3ZLJA 1GLAG 4O0JA 3CQXA 4JS4A 2CGJA 2P9PA 1C0FA 3NH2A 2OZSA 1OKJA 5JVGL 4CEZA 2F8TA 4OVLA 2BH1A 1R0AA 1VK0A 4CEAA 3N4QA 3M3ZA 1IBMK 4JK8A 1NK8A 3QICA 4EFHA 3HPOA 4CERA 1JLFA 3HSTB 1D8YA 2DY4A 1KCFA 3DRPA 1HQEA 5M1FA 4CF2A 4M42A 1REVA 4H5RA 3FZMA 4NCBA 2G8FA 3U3YA 4N41A 1KVBA 5F1XA 2FBVA 4FWLA 1JCEA 4FM0A 3V9WA 1UOCA 2I5JA 3CPWM 4H0OA 5AZIA 4BQLA 3ID6A 1L3VA 3O08A 3NH1A 3ZEUA 3KKRA 1VQLN 1KAZA 1A5WA 4HHTA 4FZYA 4DTPA 1JL2A 3M1FA 3VQ9A 1N5YA 4BC2A 3D45A 3QO9A 4DV1K 4MDAA 3V1OA 3VTIA 4FZZA 1XHZA 4FJNA 3TI0A 1BI4B 4BRPA 1KQSM 1FKPA 3B6OA 4B9TA 4BC3A 4F4KA 3KWIA 4B1XB 1NGBA 4ISGA 3UKUA 4CJKA 2WUSA 3SUOA 1J5OA 3SAHA 3C6UA 1TKZA 1P90A 3ATUA 3H1VX 4FJXA 3MX5A 4JI3K 1JXBA 3QBWA 1LV5A 3U8XA 3MWTA 5J1EA 2HBMA 2AA4A 3DYAA 3E9OA 3HM9A 1ZXOA 3TAQA 3A5MC 3HPHA 3BGRA 3O3GA 1HYVA 3NMUA 2X6SA 3V81A 1NGCA 4K25A 1YJ9N 1VSKA 3C6AA 4X62K 1NJWA 1RBSA 1HNXK 3GL1A 4CE9A 1Z26A 1KAYA 4AHRA 4KFBA 3NVKA 1YITN 3JXUA 1W0HA 1MWKA 4OKEA 4FJ5A 4YNQA 3O9TA 3W0LA 1EQYA 5GIPA 3I8BA 4CJPA 3SLCA 5CE3A 4W5RA 5KRSA 2P9PB 3MEDA 3CQ8A 1X9JA 2IVNA 2O4GA 1RNHA 2A5XA 3VQPA 4B9LA 2JWLA 1N32K 4DV2K 3E1YA 3TARA 2G8WA 3GE1A 4JK9A 5M1NA 3MK6A 4O55A 4R79A 5DM6L 5FPDA 1ASWA 4FXDA 4RCHA 4DTOA 3K5LA 3GOIA 4NO7A 1VSIA 3M8SA 1K8KB 2W6KA 2FC0A 2GUPA 3ULEA 3QFPA 3L3UA 4AM7A 4ICLA 2P9NA 1S5JA 3RR8A 2HHWA 2ZQBA 2YHBA 4BRLA 1LOTB 1D5AA 4N76A 1BA0A 5AZIB 3LZJA 3RRHA 4B1UB 3O4WA 5AQMA 3K5MA 3T1YK 4DKWA 3EZ5A 1NKCA 4DU1A 4DLEA 4F2RA 1I3AA 4FJGA 2B6AA 3BY5A 3DOLA 4CW7B 1YUWA 1DEJA 3IDHA 2V52B 3FZHA 3VA0A 1CZAN 4BWJA 4FJIA 1XNRK 2O4IA 2Q31A 2ZD1A 5JICA 3QBXA 1GOAA 4G1QA 3LWMA 4PKGA 4HCCA 3L2RA 5BN9A 4O8UA 5FLXO 4UY8O 1SAZA 2GBZA 3IS9A 4NXNK 1SL0A 5MLCQ 4W5NA 2BGGA 3CCSN 3QEVA 3DLBA 3DM2A 4BR5A 4B3MK 4WQ5C 2OANA 3KK3A 3CF5L 5BR9A 4U67L 3AA2A 3UE5A 3TAGA 2PYLA 1TAQA 2KFNA 1IKVA 3F2KA 2HHHK 1A5VA 4Z4GA 3WNEA 5IT9O 3CJ7A 3P31A 3THXA 1NGDA 2HBKA 2EWSA 4O0IA 2GX9A 1KLMA 3TTDA 2Z1GA 1GLDG 3LDQA 3VQ7A 1DTQA 4BACA 4IOCL 4BR9A 3KK7A 1NK9A 1TKXA 4F9OA 4JV5K 1IBLK 1D4XA 2ITMA 3U4LA 4DR2K 1L3TA 3GG4A 1NK5A 4Y1DA 1GOBA 3H1QA 5C0YA 1U2VA 4AILC 5M1KA 3C7NA 5JLHA 3CETA 1LW0A 4BRFA 3ENBA 4FOIA 3VOVA 3SUQA 4LH4A 2OPSA 2CH5A 5AZJA 3C94A 4ISFA 3MXJA 4JKCA 4FLWA 5HP1A 4FJ9A 1TK0A 1BCMA 2P5GA 2QXLA 2F7TA 3OBWA 1HKGA 1NGHA 3CCLN 4IO9L 4LFCK 2ZJPL 2P9NB 3WXJA 1NMDA 3DXMB 4H5NA 2Q97A 2Q2RA 1U04A 3NFAA 4LSNA 4MO5A 1KAXA 4EAHD 5C15A 4RW7A 4DU3A 1KVCA 1QSYA 4KB0A 5BN8A 3LANA 1M90O 1QS4A 3SI6A 1BGXT 3F9MA 1C1BA 2G8VA 4CZJA 3LP3A 3RRGA 4IFVA 5AQPA 3I56N 1BUPA 1BWFO 1RBVA 2P51A 3GBTA 3P83D 3H45C 3G4SN 1HRHA 3SQ1A 1DLOA 4C8MA 4K41A 4A61A 3ZX2A 4N47A 3HVTA 2IDOA 3BZKA 3P5JA 2A1SA 2RPIA 4BC5A 4B9QA 2W6LA 5CR4A 3TSQA 2P9KA 4FLUA 2ZGYA 4CIEA 3TU5A 2IS3A 4JI5K 3THYA 4XH1A 3K0SA 4WFAL 4MQ3A 4A5BA 3ZYYX 3RMBA 4CJ3A 3VGLA 4IZ9A 5ELZA 1HUXA 1BU6O 3O9RA 3VEYA 1RTDA 1RTJA 4QS9A 2QWMA 4I9QA 4CVNE 3RWUA 4H8KA 4I6MA 4BG8A 4ZTJA 3WNGA 4DSKA 1U6ZA 2QWQA 4OLBA 2HMPA 3THXB 4KPYA 4JD2A 4LH5A 3SV4A 4B08A 2FXUA 1QTMA 4KH4A 2QI2A 2UXDK 3E9PA 3NGYA 1ZBFA 1ATSA 4Q0BA 3DLRA 2VQEK 4KHPK 4CJEA 2PYJA 2NRVA 5KQDA 3RR7A 3CCEN 3AARA 1NOZA 1U2VB 4OKJA 4DS4A 1ESVA 4DV4K 4FLTA 3C7NB 3QDKA 1JLAA 1HMVA 2NNWA 3TR8A 4FW2A 3BP8A 1BHLA 1WNSA 5AQQA 5AZJB 3AVGA 3ZSRA 5EVZA 5FPEA 3HT3A 4K8XA 4B1WB 1T05A 3NE6A 4JS5A 2HHSA 1OVQA 3IG1A 3LAKA 4KHNA 4OJRA 3LPTA 5TKYA 1QZ5A 2NRRA 1YAGA 3DRRA 4PKHA 5EX5A 4J8FA 3VEZA 4M3RA 4BRMA 4H0XB 3KLHA 4CGDA 1YJNN 4DSFA 1Q9XA 4KHWA 2UUBK 5LJWA 1VQ9N 1N36K 2BANA 3KWGA 1YIJN 1JCGA 3HP9A 4BRKA 1S9EA 3CM5A 1OH6A 5KTQA 2VWJA 2GELA 4DFPA 4FL9A 3FFKB 3NCIA 1DGKN 3C0BA 3VQ5A 1W9HA 3THWA 4OO1J 1KFDA 3HOTA 5JMVA 1QQOA 2NRTA 3K9JA 2F4VK 4ELTA 5C24A 2P9KB 1T44A 1WSGA 3THVA 3CIPA 4MLEA 1WSHA 4HUGA 1DKGD 2YNGA 3I0SA 3VF2A 2Z1IA 4BRAA 4FLYA 2ETJA 3WXKA 1QVFM 3QESA 1SKRA 5CHIA 1WAJA 4YOUA 4HTUA 3ITHA 3VA3A 1YVNA 4MLHA 1BG3A 5B8HA 2E2NA 4I6MB 4DR4K 4WF9L 4LF5K 1ZYQA 1NWKA 4JD2B 4BE2A 4KTWA 1NGFA 4JAXA 3FZLA 1NGEA 2YHWA 5C12A 4DFKA 1IKYA 3CCRN 3CC7N 3M5RA 4BRIA 3HZ6A 5HRRA 4CF0A 4KKOA 3VQQA 1KSPA 3HPGA 3ALYA 3ULDA 3OYNA 4JK7A 5K14A 5AQYA 1C0MA 1GLJO 4DV3K 1V4TA 3CCUN 3VEOA 3OTOK 1F21A 3QERA 3FZFA 3QNNA 4M3XA 2OCEA 4DMNA 1JLGA 4JRQA 3V9XA 4YDUA 3QEIA 3P38A 3SQ0A 3ID8A 3SBGA 2XY7A 1QVGM 1RDBA 2UUCK 3R6MA 2UU9K 3TSPA 2XY5A 4FO0A 2OYQA 4EP4A 4DTXA 3AVCA 1E4GT 2P9UA 1SKWA 5AQOA 4BVOA 4BDZA 4JHDA 1SL1A 3SYZA 4QS8A 2HBLA 1IBKK 3QLHA 4HUEA 4DTUA 4JEPA 4V19S 1JLQA 4HUFA 4A5AA 2OPPA 5AQVA 1X9MA 1Q9YA 2HHUA 3HSCA 3EL2A 4NXMK 3QNOA 3PX4A 4IBNA 4YFUA 4E7HA 2UXBK 3F73A 2F9TA 1L3SA 4DV0K 3FLCO 3JAMO 3MN5A 1VSLA 3CCMN 5FRMA 5HRPA 1BO5O 4G9ZA 1ITGA 3WXLA 1SS6A 5AQGA 3OYLA 4JKFA 4CGJA 4CIGA 3AV9A 4RW4A 2HBJA 1TUUA 1WB9A 2E6LA 3G0ZA 1YVUA 1JCFA 4B9NA 3L0QA 4IO8A 1GLFO 3S9HA 1NU0A 3ZX0A 1YT3A 3MN7A 5HLFA 4H0TB 1QQNA 1HKCA 4CJUA 4E1JA 3L2UA 3T69A 3C6HA 4IFYA 3QINA 3O8MA 4F3OA 4GKKK 4BY9C 3ZSWA 1QE1A 4PKIA 1M1KO 4FWNA 3AA3A 3OJUA 3SZ2A 3EKUA 3A8YA 4DV6K 5CYQA 2ATQA 2D0CA 5AQJA 5KPTA 3ZCMA 3CQYA 3OYMA 2V51B 3VETA 5BPNA 1CZBA 2OTJN 3K59A 1K8KA 2A41A 3ZX3A 3L2QA 5I42A 5KQ8A 3L2VA 3AO1A 1X3MA 3E66A 4CHZA 3DMJA 4CJ7A 4LF9K 1J53A 3LM9A 4YOXA 5BPLA 1S6QA 1ASUA 2GUIA 3VN5A 4YOVA 2IOCA 1FJGK 2WOMA 2NUBA 1BL3A 3LL3A 1HYSA 1BA1A 5A2QO 3DI6A 1X9WA 1WBDA 3U9ZA 3TANA 4H0PA 5J2QA 1YJWN 1XQSC 4EIAA 2ZF5O 3O3FA 3AO4A 4ISEA 2P9UB 3J7ZO 4H5VA 4JHDB 1TKTA 4NLCA 1IH7A 3IAYA 3ZSVA 1QHTA 4ILGB 2AJQA 3BF3A 4BRDA 2P9IB 4CD1A 1U47A 4I9LA 3KHYA 3CCVN 1MWMA 1HNVA 3SAFA 3G71N 1T7PA 4BGAA 3KLFA 5ADXH 1YTAA 3C95A 5FPMA 4BQZA 3ATVA 4FJMA 4ID5A 1KTQA 2I7PA 3WNHA 4WE1A 1NM1A 4LSLA 4WFNL 4DQQA 2FF6A 1RBTA 4YORA 1Q82O 1FK9A 4PWDA 2ZE2A 3HRGA 4OKKA 5HOOA 3AO5A 3VEVA 4DQ8A 2FSNA 5M1PA 1OH5A 5HRSA 2DFFA 3I33A 1NK6A 1KXPA 2WONA 4B9MA 1IJJA 2HHVA 1LAWA 3ZETA 3AGRA 3QEWA 1CXQA 1C1CA 1LCUA 3OBYA 3RMDA 4B1ZA 1T03A 4CJ4A 2DPNA 2YX6A 4KTQA 1VQ6N 3AVMA 1SUQA 3VF6A 3KD5E 3DJCA 4CECA 4E19A 1HPMA 4CK3A 1VQ5N 4OPAA 4E7IA 2XO7A 4LF8K 1Y64A 4LF7K 5HROA 2YJFA 4DV7K 2O8FA 4EZ6A 3OYCA 4WQ4A 1NJXA 1MU2A 3PSIA 4C8KA 3TAEA 1T3VA 1RFQA 4FM1A 3DXMA 1RT4A 1ZBUA 4IEIA 4E7KA 2KZMA 2PZSA 3LDLA 4O4GA 5KGXA 5AR0A 4KREA 4FWKA 2VGMA 4CFDA 5J2MA 3T7ZA 4J2AA 1IG8A 3TSUA 1HNZK 5JVHL 1MDUB 5EU7A 2FSJA 5AQWA 3L2WA 4NCAA 1J5EK 3CD6N 3RMCA 1S6PA 3SJJA 5AQTA 2QWNA 1CLQA 2YHYA 4A57A 4CI6A 3VERA 4C8LA 5I3UA 4FWMA 4KHQA 4CEQA 5JS1A 1RDWX 3O9SA 1TGOA 2A6AA 4BE1A 3WXIA 4M63C 3DAWA 4N56A 2ZM6K 3P4IA 2OTLN 2D4WA 2IGIA 1K6YA 4OPKA 3Q7CA 4DFJA 3FZKA 2W42A 4GV9A 3SK3A 2O8DA 3CPEA 4CZHA 4OPJA 4M7XA 1VQ8N 4WYBA 3V9ZA 3TABA 1BOTO 4K0KK 5CY4A 5ADXA 4CGHA 4FWRA 2QXFA 2Q36A 3ZETB 3O5BA 3HO1A 3OS0A 4JLHA 3KKSA 1VQ4N 5E41A 4W5TA 4BRQA 3MN9A 4H5WA 2ASOA 3UIQA 3NF8A 4DS5A 4CHOA 3RMAA 3CYMA 4H4MA 4KH6A 1JJ2M 3S41A 2O8CA 3CFOA 3IMXA 2GTDA 4GKJK 5GAEP 4IEEA 4DU4A 3DRSA 2O8EB 2F9WA 4M3YA 2Z1JA 3PV8A 2KTQA 4K43A 4BVPA 4CEFA 1G99A 3NBPA 3HOSA 4ILJA 1NKEA 4CZIA 1H1VA 3O1WA 1CZ9A 2BTFA 2O8FB 3V9SA 4CJ5A 2E20A 3D0PA 3PSFA 3OA9A 4JNEA 3BEXA 4LY7A 4CFCA 4CJVA
chains in the Genus database with same CATH topology
2P1JA 2VWKA 4KHWA 2KZZA 2Z1HA 3ZT3A 3SPYA 2OPRA 1NJZA 1O1WA 1TK5A 1EXQA 1J54A 3AO3A 4KB1A 2B5JA 2BANA 3QETA 4UQGA 3NAEA 3OYGA 5C42A 3HP9A 1TKDA 1HNIA 3M8PA 1S9EA 3VQDA 3CM5A 4Z4CA 5KTQA 3IRXA 2VWJA 2YV0X 3QEPA 3VQCA 4DFPA 2G8HA 5C25A 2ITGA 4FJLA 2HB5A 4OLAA 4E1NA 3NCIA 1SV5A 2IAJA 3SCXA 3LP2A 1EX4A 1RT1A 3ZSZA 1C0TA 2A1RA 4FVMA 4RG8A 3MXMA 4XIUA 3K57A 4QAGA 3VQ5A 1RDAA 1W9HA 4CFBA 4C8OA 1KFDA 4JRPA 4DSJA 2YNHA 1L3UA 2IC3A 3KTQA 4ELTA 2HHXA 4JS4A 4O0JA 5C24A 1WSGA 1Z25A 3THVA 1S1VA 3V6DA 1WSHA 1LW2A 4HUGA 2QK9A 3NH2A 4BDPA 2OZSA 2YNGA 3I0SA 4DG1A 1RT5A 2Z1IA 4OVLA 4CEZA 3I0RA 4FLYA 2F8TA 4M45A 1R0AA 2ETJA 1VK0A 3O3HA 3K58A 1QQCA 4CEAA 3SQ2A 3QESA 3HXMA 1SKRA 1JLCA 1WAJA 1RILA 1NK8A 1RTHA 3F9KA 2EX3A 1NK4A 3HPOA 4HTUA 3TAPA 4CERA 1N6QA 5KGWA 3ITHA 3VA3A 4CEDA 3E01A 1WLJA 1JLFA 3HSTB 1D8YA 4HCBA 2XHBA 4RW8A 2DFEA 3V9UA 4FM2A 2DY4A 1KCFA 3DRPA 1HQEA 4F3TA 5JS2A 4CF2A 4M42A 1REVA 2F96A 3NF7A 1NK0A 4CF8A 2G8FA 4NCBA 3U3YA 1GOCA 4N41A 1KVBA 2HNYA 1JL1A 1HQUA 4BE2A 1ZYQA 4FZXC 3G10A 4KTWA 4CJLA 2DTUA 4IDKA 2FBTA 2FBVA 4FW1A 4FM0A 4DFKA 1IKYA 1UOCA 2I5JA 3NF6A 3V9WA 1S9GA 3ZT0A 1L3VA 3HJFA 3NH1A 5HRRA 1LWEA 3KKRA 3LDSA 4I7FA 4CF0A 4KKOA 3VQQA 1KSPA 1A5WA 3ALYA 3HPGA 4HHTA 1IKXA 4DTRA 4FZYA 4DTJA 5HBMA 3LWLA 3ULDA 4DTPA 1JL2A 3OYNA 5K14A 1C0MA 3VQ9A 1N5YA 1D9FA 3ZSXA 3D45A 3QO9A 3V1OA 1VSFA 3PUFA 4FZZA 1XHZA 4CJQA 1F21A 1BIZA 4EP5A 3QERA 3QNNA 4FJNA 3TI0A 4DMNA 1KFSA 1JLGA 1BI4B 4KI6A 4M3XA 1FKPA 3B6OA 4JRQA 3V9XA 4NYNA 3S3NA 4B9TA 3NGIA 2P5OA 4DSLA 4F4KA 4KRFA 3QEIA 2YNFA 1BISA 3SQ0A 1IG9A 3OYBA 4CF1A 2XY7A 1RDBA 3AVLA 3V1QA 2XY5A 1RT6A 1VRUA 4AHVA 4CJKA 3SUOA 4E7LA 2OYQA 1IO2A 4EP4A 4Q5VA 4DTXA 1J5OA 3AVCA 2KFZA 4KAZA 3P1GA 4H4OA 3C6UA 1TKZA 1TAUA 3MEEA 4FJXA 3RTVA 1JXBA 3JYTA 1LV5A 1SKWA 3K2PA 4BDZA 3NHGA 5J1EA 1SL1A 3SYZA 4GVMA 1BCOA 1RBRA 3DYAA 3QLHA 4HUEA 1WSEA 4DTUA 4CHYA 4DQPA 3AVHA 3HM9A 1JLQA 4HUFA 1B92A 2E4LA 4F2SA 3TAQA 2OPPA 2HHSA 3HPHA 4MFBA 1X9MA 1C0UA 3BGRA 3VQBA 1HYVA 4NYFA 3O3GA 3LZIA 2X6SA 3V81A 3DLHA 1VSKA 2HNDA 1NJWA 1RBSA 3QNOA 3AVKA 3PX4A 3MXIA 4IBNA 5D3GA 4YFUA 4E7HA 4CE9A 3AVJA 3F73A 1Z26A 2KW4A 4AHRA 4KFBA 1L3SA 4IG3A 4B9VA 4DSEA 3T1AA 1EETA 3LALA 1VSLA 5FRMA 2BDPA 5HRPA 4PY5A 1KRPA 5DK5A 4FJHA 2RKIA 4DTMA 1W0HA 1ITGA 4OKEA 4FJ5A 3FFIA 5CZ2A 4YNQA 4R5PA 4CGJA 3OYLA 2OZMA 1S1TA 4CIGA 4BE0A 3AV9A 3NDKA 4RW4A 1ZBIA 2X74A 4DQSA 4OGCA 5HRNA 4CJPA 2E6LA 1VSJA 3T19A 3PX6A 4CCHA 3G0ZA 1YVUA 4W5RA 4B9NA 5KRSA 4EZ9A 5DMRA 3MEDA 4KHSA 3CQ8A 3VQPA 2O4GA 1RNHA 3S9HA 1UAXA 4B9LA 4B8AB 1YT3A 1WN7A 2E6MA 4B8CA 5HLFA 3ZT4A 1KLNA 3SPZA 3TARA 4CJUA 2G8WA 2D0BA 3NH0A 3L2UA 4O5BA 3AVFA 4AHSA 1L5UA 4O55A 1QSSA 1IKWA 1ASWA 1S1UA 4FXDA 4IFYA 3QINA 4N5SA 4F3OA 5KRTA 3A2FA 4DTOA 3K5LA 3ZSWA 1QE1A 3KD1E 5FROA 4PQUA 2R7YA 1VSIA 4AHCA 4BWMA 4E1MA 3M8SA 3K5OA 4M3ZA 4CJSA 4CFAA 2FC0A 4FJ8A 3AA3A 3OJUA 3L3UA 3SZ2A 3AVNA 4ICLA 3KLIA 1S5JA 3RR8A 2HHWA 2ZQBA 1VSHA 2YHBA 3OVNA 1Y97A 5CYQA 2ATQA 2D0CA 1NJYA 2HVHA 1D5AA 3ZCMA 4N76A 4Y1CA 3OYMA 3LPUA 3LZJA 3NGZA 1LAVA 3RRHA 1CZBA 3K5MA 1VSMA 4M41A 3K59A 3H08A 3EZ5A 1NKCA 3L2QA 4J2EA 2VG5A 4DU1A 4DLEA 5I42A 1NKBA 4F2RA 1I3AA 4FJGA 3L2VA 1I39A 3AO1A 4CK1A 2B6AA 4OGEA 3DOLA 4CJWA 1ZBLA 1EKEA 4DTSA 4CHZA 4KHYA 3DMJA 1RT3A 4DSIA 1G15A 4Z4HA 4DQRA 3VA0A 4FJIA 4BWJA 1J53A 2XY8A 3ZSOA 4CHPA 4AHUA 2O4IA 1S6QA 3KJVA 1ASUA 2GUIA 2ZD1A 2D0AA 3VN5A 4CJRA 3VQAA 2JLEA 4NCGA 1GOAA 4G1QA 2IOCA 2WOMA 1BQNA 2NUBA 1BL3A 2B4JA 1XWLA 4C8NA 3LWMA 3L8BA 4LD0A 5J2NA 2HVIA 4I2QA 4HCCA 2YKMA 3L2RA 1HYSA 4IKFA 3AVBA 3OYDA 1X9SA 3DI6A 1X9WA 4AHTA 3TANA 5J2QA 1S1XA 2HMIA 4B9UA 5J2PA 4L8RB 2GBZA 1WSFA 3IS9A 3O3FA 1U48A 4DF4A 1RCHA 3AO4A 3OS2A 1SL0A 3HL8A 4W5NA 3U3GA 1CXUA 2BGGA 3QEVA 3DLBA 1TKTA 2VG7A 1IH7A 3DM2A 1U45A 3IAYA 3ZSVA 1QHTA 3KK3A 3SNNA 2AJQA 3SQ4A 4Z4EA 3C6TA 1S1WA 1U49A 1U47A 3MEGA 4I9LA 2HW3A 1BQMA 1WSJA 2F8SA 3AA2A 1HNVA 3QEXA 1T7PA 3KLEA 2EHGA 4M3TA 3TAGA 3KLFA 2PYLA 4CF9A 1TAQA 4GMJB 1YTAA 1IKVA 3C95A 4FYDA 2KFNA 4FJMA 1TVRA 4Z4GA 1A5VA 4ID5A 1KTQA 3AVIA 3PO4A 3WNHA 1X1PA 4WE1A 4LSLA 2G8KA 3WNEA 4DQQA 1LWFA 3KLGA 1RBTA 4DTNA 2D5RA 1HPZA 1FK9A 4O0IA 1KLMA 3CFPA 1UA1A 2Z1GA 2ZE2A 4OKKA 4PWDA 3AO5A 3VQ7A 3AA4A 1DTQA 4BACA 3OYAA 3OYKA 4QOZB 5SWMA 1SKSA 3V4IA 2X78A 5HRSA 2DFFA 1NK9A 1TKXA 1NK6A 2WONA 1B9DA 4B9MA 1L3TA 4ID1A 1VSDA 4CJTA 2HHTA 2HHVA 1NK5A 1LAWA 1TL1A 3QEWA 4Y1DA 1CXQA 1GOBA 3O4QA 4Z4FA 1C1CA 1XC9A 4B3OA 3RMDA 1T03A 4CJ4A 4ELVA 4AILC 3HP6A 1JLBA 2QKKA 3OJSA 3K5NA 1NOYA 4KTQA 1LW0A 4QCLA 1XHXA 1XI1A 3PY8A 4FLXA 3AVMA 4FK4A 1SUQA 3SUQA 4LH4A 2OPSA 1SL2A 1JXEA 1FXXA 3TAFA 3C94A 2Y1IA 3WNFA 3KD5E 3MXJA 3AVAA 4CIFA 4CECA 4FLWA 2XY6A 4E19A 5HP1A 2G8UA 1B9FA 4CGFA 4FJ9A 5T7BA 4CK3A 1NK7A 1TK0A 3DLGA 1BCMA 1RDDA 2P5GA 3L3VA 4K8ZA 4E7IA 3I8DA 5FDLA 2XO7A 2VG6A 4FJJA 4CGDA 5HROA 3BDPA 1T8EA 1EP4A 1ASVA 1U04A 2DFHA 3NFAA 4CESA 4CHQA 3OYFA 3ISNC 4LSNA 4DU3A 4EZ6A 1QSYA 3OYCA 4RW7A 1U4BA 1KVCA 4KB0A 1VRTA 3T3FA 3LANA 3LAMA 1NJXA 1MU2A 1QS4A 2YHAA 4KO0A 3SI6A 3JSMA 5KI6A 4C8KA 3TAEA 2G8IA 1BGXT 1DTTA 4CFCA 4RW6A 3EY1A 4FM1A 3SUPA 1C1BA 2G8VA 4CEEA 3OY9A 1RT4A 4CHNA 3LP3A 4PUOA 3RRGA 1ZBUA 2JGUA 1FKOA 4IFVA 4E7KA 4CGGA 3CM6A 2KZMA 1RBUA 1RBVA 4DFMA 4W5QA 2PZSA 4M3WA 2YKNA 2P51A 3P83D 3V1RA 2RN2A 1HRHA 3SQ1A 4IG0A 1DLOA 4O4GA 5KGXA 4FLVA 4C8MA 4N47A 3S3OA 3QIOA 3O4NA 4KREA 3HVTA 2IDOA 4CFDA 3P5JA 4CGIA 4KHUA 2A1SA 2RPIA 5J2MA 3ZSQA 4J2AA 4PA1A 4HVJA 5EU7A 4FLUA 4E3SA 4CK2A 4CIEA 3M8RA 3ZT1A 3L2WA 1HYZA 4NCAA 2IS3A 3RMCA 1S6PA 3KK1A 3SV3A 3SJJA 3PO5A 3AA5X 1CLQA 4CEBA 4C8LA 3LP1A 5I3UA 4MQ3A 4KHQA 3RMBA 3LP0A 2XRIA 4CJ3A 4CEQA 5JS1A 4BDYA 4E7JA 3DOKA 3VQ8A 1BIUA 1TGOA 4BE1A 2PY5A 2FBYA 4KV8A 1RTJA 1RTDA 1TV6A 4I9QA 3PX0A 4FK2A 4N56A 1J9AA 3CG7A 4DF8A 4ZTFA 3RWUA 4H8KA 1A5XA 4F8RA 2IGIA 4J2BA 1K6YA 4OPKA 3ZT2A 3M8QA 3OYHA 3WNGA 4ZTJA 2QKBA 4DFJA 4DSKA 3MAQA 2W42A 2Y1JA 4W5OA 1TK8A 4M3UA 4OLBA 4KPYA 3MECA 2X6NA 3DLEA 2HHUA 4LH5A 3HK2A 3EYZA 3SV4A 1WAFA 4OPJA 4B08A 1QTMA 1RTIA 1UA0A 4CEOA 1RT7A 3V9ZA 3NGYA 3TABA 3OS1A 4FK0A 4Z4IA 4B9SA 3OYEA 1RDCA 2FBXA 1ZBFA 3DLKA 2RF2A 2Q3SA 3KIOA 3ZSYA 4Q0BA 4AH9A 1LWCA 4E89A 3DLRA 4RW9A 3HYFA 5CY4A 4CJEA 2PYJA 2YNIA 3CFRA 2KQ2A 4CGHA 3RR7A 4GW6A 4FJ7A 4TSXA 3OYJA 2QXFA 4ZHRA 1RT2A 4KI4A 2HNZA 4I2PA 3HO1A 3OS0A 1NOZA 4JLHA 4DLGA 3KKSA 1JLEA 3VQ6A 5E41A 4W5TA 1Q8IA 4OKJA 1VSEA 4DS4A 3VQ4A 4J2DA 3QIPA 4KTZA 3TWHA 1BI4A 3NF9A 1TL3A 4FLTA 1JLAA 1HMVA 4FJKA 5FRNA 3AO2A 3VQEA 2OA8A 3S3MA 2GV9A 3TR8A 3NF8A 2LSNA 4DS5A 3UIQA 1JKHA 4CHOA 4FW2A 3U6FA 4O44A 1D9DA 3RMAA 1BHLA 3CYMA 1WNSA 4H4MA 1YTUA 3AVGA 3ZSRA 3HT3A 3B6PA 1QSLA 3KK2A 4K8XA 1HJRA 3CFOA 1T05A 3NE6A 4Z0UA 5CYMA 4JS5A 4DU4A 3OYIA 1C1AA 3DRSA 1C6VA 4M3YA 3IG1A 2Z1JA 3LAKA 3PV8A 3SUNA 4KHNA 2HHQA 4OJRA 2KTQA 3LPTA 4ELUA 1ZBHA 4CEFA 2BE2A 2OPQA 3NBPA 4E0DA 4CJFA 3HVRA 1NKEA 3DRRA 5SZTA 1CZ9A 4FLZA 4M3RA 1UWBA 5CZ1A 4FCYA 3V9SA 4CJ5A 1Q9YA 3D0PA 3KLHA 4DQIA 4DWIA 3TAMA 4LY7A 1KVAA 3ASMA 4DSFA 1WSIA 4CJVA 1Q9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1J A;  2VWK A;  4KHW A;  2KZZ A;  2Z1H A;  3ZT3 A;  3SPY A;  2OPR A;  1NJZ A;  1O1W A;  1TK5 A;  1EXQ A;  1J54 A;  3AO3 A;  4KB1 A;  2B5J A;  2BAN A;  3QET A;  4UQG A;  3NAE A;  3OYG A;  5C42 A;  3HP9 A;  1TKD A;  1HNI A;  3M8P A;  1S9E A;  3VQD A;  3CM5 A;  4Z4C A;  5KTQ A;  3IRX A;  2VWJ A;  2YV0 X;  3QEP A;  3VQC A;  4DFP A;  2G8H A;  5C25 A;  2ITG A;  4FJL A;  2HB5 A;  4OLA A;  4E1N A;  3NCI A;  1SV5 A;  2IAJ A;  3SCX A;  3LP2 A;  1EX4 A;  1RT1 A;  3ZSZ A;  1C0T A;  2A1R A;  4FVM A;  4RG8 A;  3MXM A;  4XIU A;  3K57 A;  4QAG A;  3VQ5 A;  1RDA A;  1W9H A;  4CFB A;  4C8O A;  1KFD A;  4JRP A;  4DSJ A;  2YNH A;  1L3U A;  2IC3 A;  3KTQ A;  4ELT A;  2HHX A;  4JS4 A;  4O0J A;  5C24 A;  1WSG A;  1Z25 A;  3THV A;  1S1V A;  3V6D A;  1WSH A;  1LW2 A;  4HUG A;  2QK9 A;  3NH2 A;  4BDP A;  2OZS A;  2YNG A;  3I0S A;  4DG1 A;  1RT5 A;  2Z1I A;  4OVL A;  4CEZ A;  3I0R A;  4FLY A;  2F8T A;  4M45 A;  1R0A A;  2ETJ A;  1VK0 A;  3O3H A;  3K58 A;  1QQC A;  4CEA A;  3SQ2 A;  3QES A;  3HXM A;  1SKR A;  1JLC A;  1WAJ A;  1RIL A;  1NK8 A;  1RTH A;  3F9K A;  2EX3 A;  1NK4 A;  3HPO A;  4HTU A;  3TAP A;  4CER A;  1N6Q A;  5KGW A;  3ITH A;  3VA3 A;  4CED A;  3E01 A;  1WLJ A;  1JLF A;  3HST B;  1D8Y A;  4HCB A;  2XHB A;  4RW8 A;  2DFE A;  3V9U A;  4FM2 A;  2DY4 A;  1KCF A;  3DRP A;  1HQE A;  4F3T A;  5JS2 A;  4CF2 A;  4M42 A;  1REV A;  2F96 A;  3NF7 A;  1NK0 A;  4CF8 A;  2G8F A;  4NCB A;  3U3Y A;  1GOC A;  4N41 A;  1KVB A;  2HNY A;  1JL1 A;  1HQU A;  4BE2 A;  1ZYQ A;  4FZX C;  3G10 A;  4KTW A;  4CJL A;  2DTU A;  4IDK A;  2FBT A;  2FBV A;  4FW1 A;  4FM0 A;  4DFK A;  1IKY A;  1UOC A;  2I5J A;  3NF6 A;  3V9W A;  1S9G A;  3ZT0 A;  1L3V A;  3HJF A;  3NH1 A;  5HRR A;  1LWE A;  3KKR A;  3LDS A;  4I7F A;  4CF0 A;  4KKO A;  3VQQ A;  1KSP A;  1A5W A;  3ALY A;  3HPG A;  4HHT A;  1IKX A;  4DTR A;  4FZY A;  4DTJ A;  5HBM A;  3LWL A;  3ULD A;  4DTP A;  1JL2 A;  3OYN A;  5K14 A;  1C0M A;  3VQ9 A;  1N5Y A;  1D9F A;  3ZSX A;  3D45 A;  3QO9 A;  3V1O A;  1VSF A;  3PUF A;  4FZZ A;  1XHZ A;  4CJQ A;  1F21 A;  1BIZ A;  4EP5 A;  3QER A;  3QNN A;  4FJN A;  3TI0 A;  4DMN A;  1KFS A;  1JLG A;  1BI4 B;  4KI6 A;  4M3X A;  1FKP A;  3B6O A;  4JRQ A;  3V9X A;  4NYN A;  3S3N A;  4B9T A;  3NGI A;  2P5O A;  4DSL A;  4F4K A;  4KRF A;  3QEI A;  2YNF A;  1BIS A;  3SQ0 A;  1IG9 A;  3OYB A;  4CF1 A;  2XY7 A;  1RDB A;  3AVL A;  3V1Q A;  2XY5 A;  1RT6 A;  1VRU A;  4AHV A;  4CJK A;  3SUO A;  4E7L A;  2OYQ A;  1IO2 A;  4EP4 A;  4Q5V A;  4DTX A;  1J5O A;  3AVC A;  2KFZ A;  4KAZ A;  3P1G A;  4H4O A;  3C6U A;  1TKZ A;  1TAU A;  3MEE A;  4FJX A;  3RTV A;  1JXB A;  3JYT A;  1LV5 A;  1SKW A;  3K2P A;  4BDZ A;  3NHG A;  5J1E A;  1SL1 A;  3SYZ A;  4GVM A;  1BCO A;  1RBR A;  3DYA A;  3QLH A;  4HUE A;  1WSE A;  4DTU A;  4CHY A;  4DQP A;  3AVH A;  3HM9 A;  1JLQ A;  4HUF A;  1B92 A;  2E4L A;  4F2S A;  3TAQ A;  2OPP A;  2HHS A;  3HPH A;  4MFB A;  1X9M A;  1C0U A;  3BGR A;  3VQB A;  1HYV A;  4NYF A;  3O3G A;  3LZI A;  2X6S A;  3V81 A;  3DLH A;  1VSK A;  2HND A;  1NJW A;  1RBS A;  3QNO A;  3AVK A;  3PX4 A;  3MXI A;  4IBN A;  5D3G A;  4YFU A;  4E7H A;  4CE9 A;  3AVJ A;  3F73 A;  1Z26 A;  2KW4 A;  4AHR A;  4KFB A;  1L3S A;  4IG3 A;  4B9V A;  4DSE A;  3T1A A;  1EET A;  3LAL A;  1VSL A;  5FRM A;  2BDP A;  5HRP A;  4PY5 A;  1KRP A;  5DK5 A;  4FJH A;  2RKI A;  4DTM A;  1W0H A;  1ITG A;  4OKE A;  4FJ5 A;  3FFI A;  5CZ2 A;  4YNQ A;  4R5P A;  4CGJ A;  3OYL A;  2OZM A;  1S1T A;  4CIG A;  4BE0 A;  3AV9 A;  3NDK A;  4RW4 A;  1ZBI A;  2X74 A;  4DQS A;  4OGC A;  5HRN A;  4CJP A;  2E6L A;  1VSJ A;  3T19 A;  3PX6 A;  4CCH A;  3G0Z A;  1YVU A;  4W5R A;  4B9N A;  5KRS A;  4EZ9 A;  5DMR A;  3MED A;  4KHS A;  3CQ8 A;  3VQP A;  2O4G A;  1RNH A;  3S9H A;  1UAX A;  4B9L A;  4B8A B;  1YT3 A;  1WN7 A;  2E6M A;  4B8C A;  5HLF A;  3ZT4 A;  1KLN A;  3SPZ A;  3TAR A;  4CJU A;  2G8W A;  2D0B A;  3NH0 A;  3L2U A;  4O5B A;  3AVF A;  4AHS A;  1L5U A;  4O55 A;  1QSS A;  1IKW A;  1ASW A;  1S1U A;  4FXD A;  4IFY A;  3QIN A;  4N5S A;  4F3O A;  5KRT A;  3A2F A;  4DTO A;  3K5L A;  3ZSW A;  1QE1 A;  3KD1 E;  5FRO A;  4PQU A;  2R7Y A;  1VSI A;  4AHC A;  4BWM A;  4E1M A;  3M8S A;  3K5O A;  4M3Z A;  4CJS A;  4CFA A;  2FC0 A;  4FJ8 A;  3AA3 A;  3OJU A;  3L3U A;  3SZ2 A;  3AVN A;  4ICL A;  3KLI A;  1S5J A;  3RR8 A;  2HHW A;  2ZQB A;  1VSH A;  2YHB A;  3OVN A;  1Y97 A;  5CYQ A;  2ATQ A;  2D0C A;  1NJY A;  2HVH A;  1D5A A;  3ZCM A;  4N76 A;  4Y1C A;  3OYM A;  3LPU A;  3LZJ A;  3NGZ A;  1LAV A;  3RRH A;  1CZB A;  3K5M A;  1VSM A;  4M41 A;  3K59 A;  3H08 A;  3EZ5 A;  1NKC A;  3L2Q A;  4J2E A;  2VG5 A;  4DU1 A;  4DLE A;  5I42 A;  1NKB A;  4F2R A;  1I3A A;  4FJG A;  3L2V A;  1I39 A;  3AO1 A;  4CK1 A;  2B6A A;  4OGE A;  3DOL A;  4CJW A;  1ZBL A;  1EKE A;  4DTS A;  4CHZ A;  4KHY A;  3DMJ A;  1RT3 A;  4DSI A;  1G15 A;  4Z4H A;  4DQR A;  3VA0 A;  4FJI A;  4BWJ A;  1J53 A;  2XY8 A;  3ZSO A;  4CHP A;  4AHU A;  2O4I A;  1S6Q A;  3KJV A;  1ASU A;  2GUI A;  2ZD1 A;  2D0A A;  3VN5 A;  4CJR A;  3VQA A;  2JLE A;  4NCG A;  1GOA A;  4G1Q A;  2IOC A;  2WOM A;  1BQN A;  2NUB A;  1BL3 A;  2B4J A;  1XWL A;  4C8N A;  3LWM A;  3L8B A;  4LD0 A;  5J2N A;  2HVI A;  4I2Q A;  4HCC A;  2YKM A;  3L2R A;  1HYS A;  4IKF A;  3AVB A;  3OYD A;  1X9S A;  3DI6 A;  1X9W A;  4AHT A;  3TAN A;  5J2Q A;  1S1X A;  2HMI A;  4B9U A;  5J2P A;  4L8R B;  2GBZ A;  1WSF A;  3IS9 A;  3O3F A;  1U48 A;  4DF4 A;  1RCH A;  3AO4 A;  3OS2 A;  1SL0 A;  3HL8 A;  4W5N A;  3U3G A;  1CXU A;  2BGG A;  3QEV A;  3DLB A;  1TKT A;  2VG7 A;  1IH7 A;  3DM2 A;  1U45 A;  3IAY A;  3ZSV A;  1QHT A;  3KK3 A;  3SNN A;  2AJQ A;  3SQ4 A;  4Z4E A;  3C6T A;  1S1W A;  1U49 A;  1U47 A;  3MEG A;  4I9L A;  2HW3 A;  1BQM A;  1WSJ A;  2F8S A;  3AA2 A;  1HNV A;  3QEX A;  1T7P A;  3KLE A;  2EHG A;  4M3T A;  3TAG A;  3KLF A;  2PYL A;  4CF9 A;  1TAQ A;  4GMJ B;  1YTA A;  1IKV A;  3C95 A;  4FYD A;  2KFN A;  4FJM A;  1TVR A;  4Z4G A;  1A5V A;  4ID5 A;  1KTQ A;  3AVI A;  3PO4 A;  3WNH A;  1X1P A;  4WE1 A;  4LSL A;  2G8K A;  3WNE A;  4DQQ A;  1LWF A;  3KLG A;  1RBT A;  4DTN A;  2D5R A;  1HPZ A;  1FK9 A;  4O0I A;  1KLM A;  3CFP A;  1UA1 A;  2Z1G A;  2ZE2 A;  4OKK A;  4PWD A;  3AO5 A;  3VQ7 A;  3AA4 A;  1DTQ A;  4BAC A;  3OYA A;  3OYK A;  4QOZ B;  5SWM A;  1SKS A;  3V4I A;  2X78 A;  5HRS A;  2DFF A;  1NK9 A;  1TKX A;  1NK6 A;  2WON A;  1B9D A;  4B9M A;  1L3T A;  4ID1 A;  1VSD A;  4CJT A;  2HHT A;  2HHV A;  1NK5 A;  1LAW A;  1TL1 A;  3QEW A;  4Y1D A;  1CXQ A;  1GOB A;  3O4Q A;  4Z4F A;  1C1C A;  1XC9 A;  4B3O A;  3RMD A;  1T03 A;  4CJ4 A;  4ELV A;  4AIL C;  3HP6 A;  1JLB A;  2QKK A;  3OJS A;  3K5N A;  1NOY A;  4KTQ A;  1LW0 A;  4QCL A;  1XHX A;  1XI1 A;  3PY8 A;  4FLX A;  3AVM A;  4FK4 A;  1SUQ A;  3SUQ A;  4LH4 A;  2OPS A;  1SL2 A;  1JXE A;  1FXX A;  3TAF A;  3C94 A;  2Y1I A;  3WNF A;  3KD5 E;  3MXJ A;  3AVA A;  4CIF A;  4CEC A;  4FLW A;  2XY6 A;  4E19 A;  5HP1 A;  2G8U A;  1B9F A;  4CGF A;  4FJ9 A;  5T7B A;  4CK3 A;  1NK7 A;  1TK0 A;  3DLG A;  1BCM A;  1RDD A;  2P5G A;  3L3V A;  4K8Z A;  4E7I A;  3I8D A;  5FDL A;  2XO7 A;  2VG6 A;  4FJJ A;  4CGD A;  5HRO A;  3BDP A;  1T8E A;  1EP4 A;  1ASV A;  1U04 A;  2DFH A;  3NFA A;  4CES A;  4CHQ A;  3OYF A;  3ISN C;  4LSN A;  4DU3 A;  4EZ6 A;  1QSY A;  3OYC A;  4RW7 A;  1U4B A;  1KVC A;  4KB0 A;  1VRT A;  3T3F A;  3LAN A;  3LAM A;  1NJX A;  1MU2 A;  1QS4 A;  2YHA A;  4KO0 A;  3SI6 A;  3JSM A;  5KI6 A;  4C8K A;  3TAE A;  2G8I A;  1BGX T;  1DTT A;  4CFC A;  4RW6 A;  3EY1 A;  4FM1 A;  3SUP A;  1C1B A;  2G8V A;  4CEE A;  3OY9 A;  1RT4 A;  4CHN A;  3LP3 A;  4PUO A;  3RRG A;  1ZBU A;  2JGU A;  1FKO A;  4IFV A;  4E7K A;  4CGG A;  3CM6 A;  2KZM A;  1RBU A;  1RBV A;  4DFM A;  4W5Q A;  2PZS A;  4M3W A;  2YKN A;  2P51 A;  3P83 D;  3V1R A;  2RN2 A;  1HRH A;  3SQ1 A;  4IG0 A;  1DLO A;  4O4G A;  5KGX A;  4FLV A;  4C8M A;  4N47 A;  3S3O A;  3QIO A;  3O4N A;  4KRE A;  3HVT A;  2IDO A;  4CFD A;  3P5J A;  4CGI A;  4KHU A;  2A1S A;  2RPI A;  5J2M A;  3ZSQ A;  4J2A A;  4PA1 A;  4HVJ A;  5EU7 A;  4FLU A;  4E3S A;  4CK2 A;  4CIE A;  3M8R A;  3ZT1 A;  3L2W A;  1HYZ A;  4NCA A;  2IS3 A;  3RMC A;  1S6P A;  3KK1 A;  3SV3 A;  3SJJ A;  3PO5 A;  3AA5 X;  1CLQ A;  4CEB A;  4C8L A;  3LP1 A;  5I3U A;  4MQ3 A;  4KHQ A;  3RMB A;  3LP0 A;  2XRI A;  4CJ3 A;  4CEQ A;  5JS1 A;  4BDY A;  4E7J A;  3DOK A;  3VQ8 A;  1BIU A;  1TGO A;  4BE1 A;  2PY5 A;  2FBY A;  4KV8 A;  1RTJ A;  1RTD A;  1TV6 A;  4I9Q A;  3PX0 A;  4FK2 A;  4N56 A;  1J9A A;  3CG7 A;  4DF8 A;  4ZTF A;  3RWU A;  4H8K A;  1A5X A;  4F8R A;  2IGI A;  4J2B A;  1K6Y A;  4OPK A;  3ZT2 A;  3M8Q A;  3OYH A;  3WNG A;  4ZTJ A;  2QKB A;  4DFJ A;  4DSK A;  3MAQ A;  2W42 A;  2Y1J A;  4W5O A;  1TK8 A;  4M3U A;  4OLB A;  4KPY A;  3MEC A;  2X6N A;  3DLE A;  2HHU A;  4LH5 A;  3HK2 A;  3EYZ A;  3SV4 A;  1WAF A;  4OPJ A;  4B08 A;  1QTM A;  1RTI A;  1UA0 A;  4CEO A;  1RT7 A;  3V9Z A;  3NGY A;  3TAB A;  3OS1 A;  4FK0 A;  4Z4I A;  4B9S A;  3OYE A;  1RDC A;  2FBX A;  1ZBF A;  3DLK A;  2RF2 A;  2Q3S A;  3KIO A;  3ZSY A;  4Q0B A;  4AH9 A;  1LWC A;  4E89 A;  3DLR A;  4RW9 A;  3HYF A;  5CY4 A;  4CJE A;  2PYJ A;  2YNI A;  3CFR A;  2KQ2 A;  4CGH A;  3RR7 A;  4GW6 A;  4FJ7 A;  4TSX A;  3OYJ A;  2QXF A;  4ZHR A;  1RT2 A;  4KI4 A;  2HNZ A;  4I2P A;  3HO1 A;  3OS0 A;  1NOZ A;  4JLH A;  4DLG A;  3KKS A;  1JLE A;  3VQ6 A;  5E41 A;  4W5T A;  1Q8I A;  4OKJ A;  1VSE A;  4DS4 A;  3VQ4 A;  4J2D A;  3QIP A;  4KTZ A;  3TWH A;  1BI4 A;  3NF9 A;  1TL3 A;  4FLT A;  1JLA A;  1HMV A;  4FJK A;  5FRN A;  3AO2 A;  3VQE A;  2OA8 A;  3S3M A;  2GV9 A;  3TR8 A;  3NF8 A;  2LSN A;  4DS5 A;  3UIQ A;  1JKH A;  4CHO A;  4FW2 A;  3U6F A;  4O44 A;  1D9D A;  3RMA A;  1BHL A;  3CYM A;  1WNS A;  4H4M A;  1YTU A;  3AVG A;  3ZSR A;  3HT3 A;  3B6P A;  1QSL A;  3KK2 A;  4K8X A;  1HJR A;  3CFO A;  1T05 A;  3NE6 A;  4Z0U A;  5CYM A;  4JS5 A;  4DU4 A;  3OYI A;  1C1A A;  3DRS A;  1C6V A;  4M3Y A;  3IG1 A;  2Z1J A;  3LAK A;  3PV8 A;  3SUN A;  4KHN A;  2HHQ A;  4OJR A;  2KTQ A;  3LPT A;  4ELU A;  1ZBH A;  4CEF A;  2BE2 A;  2OPQ A;  3NBP A;  4E0D A;  4CJF A;  3HVR A;  1NKE A;  3DRR A;  5SZT A;  1CZ9 A;  4FLZ A;  4M3R A;  1UWB A;  5CZ1 A;  4FCY A;  3V9S A;  4CJ5 A;  1Q9Y A;  3D0P A;  3KLH A;  4DQI A;  4DWI A;  3TAM A;  4LY7 A;  1KVA A;  3ASM A;  4DSF A;  1WSI A;  4CJV A;  1Q9X A; 
#chains in the Genus database with same CATH topology
 2P1J A;  2KZZ A;  1XUP O;  2Z1H A;  4FWS A;  3HM8 A;  1TK5 A;  4JKA A;  1J54 A;  3AO3 A;  4NLB A;  3NAE A;  4H0Y B;  3M8P A;  5H1S Q;  5AQK A;  3IRX A;  1R59 O;  3VQC A;  1GLL O;  2ITG A;  4OLA A;  3BZC A;  4H03 B;  3SCX A;  4DUY K;  1EX4 A;  1RT1 A;  4FVM A;  1RDA A;  2FLO A;  4DSJ A;  1XC3 A;  2IC3 A;  4HWI A;  3PIP L;  2ZJQ L;  3MCP A;  2HHX A;  4BGB A;  1LW2 A;  2QK9 A;  4BDP A;  1N8R O;  4DG1 A;  3I0R A;  1S3X A;  4MDB A;  1QQC A;  3K58 A;  3SQ2 A;  3Q7B A;  3HXM A;  3D2E A;  1RTH A;  3F9K A;  1WOQ A;  2FSK A;  3A5N C;  3TAP A;  1N6Q A;  5KGW A;  3VEN A;  4AF1 A;  3PLA A;  4HCB A;  2XHB A;  3V9U A;  4FM2 A;  3CJA A;  4F3T A;  4AM6 A;  5JS2 A;  2F96 A;  3NF7 A;  2O8D B;  2HNY A;  2I7N A;  1HQU A;  2J4R A;  4FZX C;  3G10 A;  2DTU A;  4CJL A;  2FBT A;  4GNI A;  2E88 A;  4JKE A;  1HX1 A;  3NF6 A;  1S9G A;  4IJN A;  3ZT0 A;  3HJF A;  1LWE A;  4I7F A;  5HBM A;  3LWL A;  1D9F A;  1BDG A;  3ZSX A;  3O80 A;  3UKR A;  4NB4 A;  1BIZ A;  4EP5 A;  3H3O B;  1KFS A;  1Q18 A;  3S3N A;  3HI0 A;  4NYN A;  3WEE B;  4DSL A;  4KRF A;  4C1N K;  2YNF A;  2P9S B;  3OYB A;  2CGK A;  1HNW K;  3AVL A;  2O8C B;  1C0G A;  4IWV A;  3V1Q A;  2QA4 N;  1RT6 A;  3TTF A;  4E7L A;  2KFZ A;  4KAZ A;  4CBU A;  3MEE A;  3JYT A;  3NHG A;  5BRE A;  5F0X A;  1YF5 L;  1RBR A;  1WSE A;  4CHY A;  4KBO A;  1VQK N;  3FE1 A;  2NZT A;  2YCH A;  4JI4 K;  4F2S A;  3VQB A;  3LZI A;  2QW9 A;  2HND A;  4IXC A;  3MXI A;  3AVJ A;  2A42 A;  1V4S A;  4IG3 A;  4JI2 K;  4DSE A;  4B9V A;  3T1A A;  1EET A;  1QZ6 A;  5AQS A;  4YOY A;  3LAL A;  2BDP A;  2QWO A;  4PY5 A;  1KRP A;  5DK5 A;  3CMA N;  4FJH A;  2RKI A;  2Q0U A;  2OZM A;  1Z6R A;  1K73 O;  3RSE A;  2X74 A;  3T19 A;  4CCH A;  3R3L A;  4EZ9 A;  4FWP A;  5DMR A;  1UAX A;  1DT9 A;  4B8C A;  3MX2 A;  4HTL A;  3ZT4 A;  3SPZ A;  4CZE A;  3D2E B;  3AAQ A;  3EE9 A;  3M6G A;  5AQX A;  3AVF A;  1QSS A;  3EE8 A;  4IJA A;  1NLV A;  4N5S A;  5KRT A;  3L4I A;  4JI6 K;  3KD1 E;  5FRO A;  4PQU A;  4M3Z A;  4AHC A;  4E1M A;  3O9Q A;  4CJS A;  3LDO A;  2QWR A;  4FJ8 A;  3VEX A;  5LJV A;  3N4P A;  1HLU A;  3KLI A;  3J7A P;  1VSH A;  1Y97 A;  3UB5 A;  2D1K A;  1I94 K;  3CHW A;  3NGZ A;  1LAV A;  1VAZ A;  2PBD A;  5F2R A;  4M41 A;  3TPQ A;  5AQL A;  4M7Y A;  5GIO A;  1I39 A;  4CK1 A;  4OGE A;  1EKE A;  4DTS A;  5C10 A;  1E3M A;  4KHY A;  3UKR B;  1RT3 A;  4Z4H A;  4DQR A;  4AHU A;  3KJV A;  3WUH A;  3VQA A;  2JLE A;  3KZB A;  3R1X A;  1BQN A;  3EKS A;  2B4J A;  4C8N A;  1WUA A;  4LD0 A;  4I2Q A;  2YKM A;  3VTH A;  4IKF A;  3OYD A;  1X9S A;  5J2P A;  1NGJ A;  1U48 A;  1NMN A;  4DF4 A;  1RCH A;  2HST A;  3OS2 A;  3IKM A;  3U3G A;  1CXU A;  4H5T A;  3A5O C;  1WBB A;  2KLA A;  2VG7 A;  1U45 A;  5KPR A;  5BPM A;  4Z4E A;  4CBW A;  3J8A A;  3EO3 A;  3MEG A;  1WSJ A;  2F8S A;  4PL7 A;  3DWL A;  3IFR A;  3QEX A;  2EHG A;  4DR7 K;  3QFU A;  4CF9 A;  2HF4 A;  4GMJ B;  4U7B A;  4FYD A;  1RGI A;  4WFB L;  3P39 A;  1TVR A;  3PO4 A;  1X1P A;  4XH5 A;  2G8K A;  4YDU C;  1LWF A;  3KLG A;  3G6E N;  4YHH K;  4DTN A;  2P9I A;  1UA1 A;  2ZGZ A;  3AA4 A;  4OX9 K;  5SWM A;  3CJC A;  1SKS A;  3RSE B;  3V4I A;  2Q1N A;  2X78 A;  4Y0W A;  4X65 K;  2D0P A;  2WC9 A;  3U9D A;  2VCP A;  4ID1 A;  4CJT A;  2HHT A;  4JKG B;  5HL7 L;  4JKB A;  1Z05 A;  4B3S K;  3O4Q A;  1XC9 A;  4JKD A;  1QQM A;  5AQF A;  3HP6 A;  4DHY A;  3A5L C;  3K5N A;  4GVE A;  4QCL A;  1XHX A;  4FLX A;  4BR0 A;  2VYP A;  1QHA A;  2KKZ A;  1SL2 A;  1SZ2 A;  1FXX A;  3TAF A;  3J80 O;  2V7Y A;  4CIF A;  4CGF A;  5T7B A;  3CME N;  3DLG A;  1RDD A;  3L3V A;  4K8Z A;  4RWT A;  2ZJR L;  2VG6 A;  2P9L A;  1ILY A;  4FJJ A;  4BR2 A;  3OYF A;  1GLE G;  5BRF A;  1U4B A;  1NGA A;  4DR6 K;  1ATN A;  5KPZ A;  4JI1 K;  4H0V B;  4AQY K;  3JSM A;  5KI6 A;  5AQR A;  2G8I A;  3EY1 A;  4RW6 A;  3R9P A;  1VQP N;  4JN4 A;  4PUO A;  2NRW A;  1FKO A;  2HOE A;  4CGG A;  3CM6 A;  1RBU A;  4DFM A;  4W5Q A;  3SBT A;  2HF3 A;  4QS7 A;  4IG0 A;  4EHT A;  3QIO A;  3O4N A;  1HR0 K;  5FPN A;  4LFB K;  4KHU A;  2PAV A;  3H6E A;  3ZSQ A;  4PA1 A;  2QM1 A;  2RHK A;  4HVJ A;  4YOW A;  4E3S A;  4CK2 A;  3ZT1 A;  3D7E O;  3KK1 A;  3PO5 A;  4BR7 A;  3AA5 X;  3VEW A;  3VPZ A;  3SAG A;  2XRI A;  2FF3 B;  3VQ8 A;  5BRH A;  2GWJ A;  2FBY A;  1TV6 A;  4CBX A;  3PX0 A;  1O13 A;  1J9A A;  1T6D A;  3CG7 A;  5GAD P;  1W2B M;  4ZTF A;  4F8R A;  4J2B A;  3MN6 A;  3ZT2 A;  3OYH A;  2QKB A;  4FVU A;  3MAQ A;  4W5O A;  4M3U A;  3MEC A;  2X6N A;  3DLE A;  4IDH A;  3HK2 A;  3EYZ A;  4JI7 K;  1YI2 N;  4CEO A;  1RT7 A;  3OS1 A;  3O9U A;  3OYE A;  1RDC A;  3ZSY A;  4A59 A;  3KIO A;  4DR3 K;  4AH9 A;  1LWC A;  3HYF A;  3CJ9 A;  3CFR A;  3SMP A;  1X3N A;  2KQ2 A;  1Q7Y O;  1K9M O;  4GW6 A;  3OYJ A;  3G25 A;  3TTC A;  1TYQ A;  4ZHR A;  1RT2 A;  4KI4 A;  2HNZ A;  4ILH A;  2NRZ A;  4DLG A;  1JLE A;  1NGI A;  3GDQ A;  1Q8I A;  1VSE A;  3VQ4 A;  3QIP A;  4KTZ A;  5DM7 L;  3D2F A;  3NF9 A;  1TL3 A;  4FJK A;  5FRN A;  3AO2 A;  3VQE A;  2GV9 A;  2LSN A;  2UYT A;  1JKH A;  1D9D A;  4O44 A;  2QWL A;  2A3Z A;  1YTU A;  3HTV A;  4XEI A;  4A62 A;  4Z0U A;  5CYM A;  2CH6 A;  3OYI A;  1C6V A;  3SUN A;  3IUC A;  4ELU A;  2BE2 A;  4BRO A;  2P9L B;  1VQ7 N;  1RDU A;  4E0D A;  4CJF A;  2IIR A;  5AQZ A;  4X66 K;  3HVR A;  2VGN A;  3VES A;  4DR1 K;  5SZT A;  4FLZ A;  5AQU A;  3QB0 A;  5CZ1 A;  4FCY A;  4GV6 A;  4DQI A;  3W3D A;  3TAM A;  4DWI A;  4PL8 A;  3ASM A;  1JL1 A;  2H3G X;  1WSI A;  4LFA K;  2O8E A;  2VWK A;  2PFU A;  3SPY A;  1EWQ A;  2OPR A;  1O1W A;  1TUY A;  1EXQ A;  4KB1 A;  3FGU A;  2B5J A;  3QET A;  3OYG A;  5C42 A;  1HNI A;  4Z4C A;  4FJL A;  2HB5 A;  1SV5 A;  2IAJ A;  3MCA B;  3ZSZ A;  1C0T A;  2A1R A;  3MXM A;  4XIU A;  2WFB A;  3K57 A;  4C8O A;  2YNH A;  4DB3 A;  5JLF A;  3D6R A;  3CJ1 A;  4BR4 A;  4FPB A;  3KTQ A;  1Z25 A;  1S1V A;  1W7A A;  3V6D A;  3QML A;  4C23 A;  3ENH A;  1RT5 A;  4WQ4 C;  3CER A;  4M45 A;  4JYA K;  3O3H A;  1JLC A;  1RIL A;  2EX3 A;  1NK4 A;  3L6Q A;  4CED A;  3E01 A;  1WLJ A;  1NNE A;  3SMS A;  1KD1 O;  3JS6 A;  4RW8 A;  2DFE A;  5TKW A;  4CZM A;  4BRN A;  3ZEU B;  1XMO K;  1NK0 A;  4CF8 A;  1GOC A;  3H46 O;  4IFE A;  2UUA K;  2YJE A;  4IDK A;  3LM2 A;  4FW1 A;  2D0O A;  3VGM A;  3DLL L;  4GV3 A;  1OVY A;  3LDS A;  4WQ5 A;  2A40 A;  4DTR A;  1IKX A;  4DTJ A;  3I55 N;  3F5T A;  5AFU H;  1TYQ B;  4JI0 K;  5BR8 K;  1GLC G;  3UKU B;  1VSF A;  3PUF A;  4CJQ A;  4KI6 A;  3D2F B;  2P5O A;  2ZWH A;  3NGI A;  5C2F A;  1BIS A;  1IG9 A;  4CF1 A;  3O1B A;  1VRU A;  4AHV A;  5LY3 A;  1IO2 A;  4Q5V A;  1ZBS A;  3P1G A;  4H4O A;  4IOA L;  1TAU A;  3WEE A;  3RTV A;  3K2P A;  2QTD A;  2P9S A;  4GVM A;  3VMF B;  1BCO A;  5M1Q A;  5EY4 A;  4DQP A;  3AVH A;  1ZC6 A;  2V7Z A;  1B92 A;  2E4L A;  2GEM A;  4MFB A;  1C0U A;  3DLH A;  1KC8 O;  4NYF A;  4YY3 K;  3AVK A;  2GWK A;  2ASP A;  5D3G A;  2KW4 A;  4BRH A;  5EOY A;  2QWP A;  4LF6 K;  3CCJ N;  4DTM A;  2VWB A;  4K42 A;  3FFI A;  5CZ2 A;  4R5P A;  4X64 K;  4B3R K;  1S1T A;  4BE0 A;  2IVP A;  3NDK A;  5LMN K;  1ZBI A;  4DQS A;  4OGC A;  4BRE A;  5HRN A;  1Q86 O;  1VSJ A;  3PX6 A;  3EN9 A;  2ASM A;  2YHX A;  4CZF A;  3BF1 A;  3BUZ B;  4KHS A;  4LC9 B;  2WTU A;  4B1Y B;  5M1O A;  5EXW A;  3MWP A;  4B8A B;  2E6M A;  1WN7 A;  1P8Z A;  1GLB G;  1KLN A;  4WCE L;  3CCQ N;  3ULE B;  1N34 K;  3ENO A;  2D0B A;  1S22 A;  3NH0 A;  4FWQ A;  1OH7 A;  4O5B A;  4AHS A;  1L5U A;  1IKW A;  4FSV A;  1S1U A;  3A2F A;  3J7Y P;  3RVC A;  1IV0 A;  3T1H K;  2R7Y A;  4BG9 A;  4BWM A;  3K5O A;  4CFA A;  2CGL A;  4CD3 A;  3AVN A;  1YHQ N;  3H3N O;  1SQK A;  3OVN A;  1NJY A;  2HVH A;  3LDP A;  4Y1C A;  3LPU A;  1VSM A;  3H08 A;  3WQU A;  4J2E A;  2VG5 A;  1NKB A;  1VQN N;  1XNQ K;  1ZBL A;  4O5F A;  4CJW A;  2RE2 A;  1EWR A;  4DSI A;  1G15 A;  4FOE A;  1FW6 A;  1VHX A;  2XY8 A;  3ZSO A;  2O8B A;  4CHP A;  2NLX A;  4O8K A;  2D0A A;  4CJR A;  1XMQ K;  4NCG A;  4JKH A;  2W40 A;  3L8B A;  3CXC M;  1XWL A;  5J2N A;  2HVI A;  3AVB A;  4AHT A;  5C2D A;  1S1X A;  3CC4 N;  2HMI A;  1NGG A;  4B9U A;  4L8R B;  1WSF A;  5AFU A;  4CZG A;  3HL8 A;  3A0I X;  3NVM A;  3MMV A;  1MA9 B;  3AAP A;  3SNN A;  3SQ4 A;  3C6T A;  1S1W A;  3DXK A;  1U49 A;  4BC4 A;  2HW3 A;  1BQM A;  1S72 N;  3KLE A;  4M3T A;  4DR5 K;  4RTF D;  1T6C A;  3AVI A;  3CJB A;  3EZW A;  3L4Q A;  2D5R A;  1HPZ A;  3CFP A;  4B3T K;  3OYA A;  3OYK A;  4QOZ B;  4BRC A;  4CZL A;  1B9D A;  1VSD A;  3EEQ A;  1TL1 A;  4Z4F A;  4B3O A;  1NJI O;  3E9L A;  4ELV A;  1J6Z A;  5LL6 Z;  1JLB A;  2QEX N;  2QKK A;  3OJS A;  3FR0 A;  1NOY A;  1XI1 A;  3PY8 A;  4FK4 A;  1JXE A;  2Y1I A;  4JKG A;  3WNF A;  4BRG A;  3AVA A;  4JI8 K;  2IVO A;  2XY6 A;  2G8U A;  2WBN A;  1B9F A;  4FPA A;  1NK7 A;  3J81 O;  3I8D A;  5FDL A;  2E1Z A;  2YI1 A;  3BDP A;  1T8E A;  1EP4 A;  1ASV A;  2DFH A;  4CES A;  4CHQ A;  3ISN C;  1Q81 O;  1NBW A;  1VRT A;  3T3F A;  3LAM A;  4OPH A;  2YHA A;  4KO0 A;  3R8E A;  4A2A A;  3K9K A;  3CC2 N;  1DTT A;  1ATR A;  3SUP A;  4PHT X;  1W97 L;  4CEE A;  3OY9 A;  4CHN A;  5AQH A;  4IOX A;  2JGU A;  2O8B B;  3WQT A;  4DUZ K;  4XH4 A;  1E4F T;  1K8A O;  4M3W A;  2YKN A;  3VGK A;  3V1R A;  2RN2 A;  3THY B;  1N33 K;  3OHR A;  4FLV A;  3S3O A;  5GAG P;  3AY9 A;  4CGI A;  5AJ3 K;  3C65 A;  5AQN A;  5BRD A;  3M8R A;  4B1V A;  3WT0 A;  4KH5 A;  1HYZ A;  3WXM B;  3SV3 A;  2E8A A;  1HKB A;  4CEB A;  1NG9 A;  3LP1 A;  3LP0 A;  2E5L K;  3DXK B;  4BDY A;  3B8A X;  3DOK A;  3LDN A;  4E7J A;  1BIU A;  2PY5 A;  4KV8 A;  2JWK A;  4FK2 A;  4DV5 K;  2E2Q A;  4DF8 A;  1A5X A;  3M8Q A;  2Y1J A;  1TK8 A;  4LF4 K;  4GY2 B;  3PIO L;  1WAF A;  1RTI A;  3SJH A;  1UA0 A;  3MDQ A;  2KHO A;  4FK0 A;  4Z4I A;  4B9S A;  1EO1 A;  2W41 A;  2FBX A;  3DLK A;  2RF2 A;  2Q3S A;  4E89 A;  4RW9 A;  2NRX A;  2YNI A;  4CZK A;  2AP1 A;  2UXC K;  4C1N I;  4FJ7 A;  4TSX A;  2NRH A;  4I2P A;  3VQ6 A;  4J2D A;  4Z94 A;  3TWH A;  1BI4 A;  5E26 A;  4FWO A;  2OA8 A;  3S3M A;  3U6F A;  5AQI A;  3B6P A;  5GIN A;  3KK2 A;  1QSL A;  1HJR A;  1C1A A;  2HHQ A;  3HBT A;  4A2B A;  1ZBH A;  5E84 A;  5I9E B;  1HJO A;  2OPQ A;  3OW2 M;  1OH8 A;  1YXQ A;  1UWB A;  1VQM N;  3CI5 A;  1KVA A;  2BUP A;  3VF4 A;  3ZT3 A;  1NJZ A;  2VQF K;  5GAH P;  2E2O A;  3THW B;  2Q0R A;  4UQG A;  3AGK A;  4EHU A;  1TKD A;  3VQD A;  2YV0 X;  2E1Y A;  3QEP A;  2G8H A;  5C25 A;  4L3Q A;  4E1N A;  3LP2 A;  3KVG A;  4RG8 A;  2E2P A;  4QAG A;  4CFB A;  4JRP A;  4DCH A;  1VQO N;  1L3U A;  5LMU K;  5IWA K;  4MO4 A;  4YOT A;  3O6W A;  3ZLJ A;  1GLA G;  4O0J A;  3CQX A;  4JS4 A;  2CGJ A;  2P9P A;  1C0F A;  3NH2 A;  2OZS A;  1OKJ A;  5JVG L;  4CEZ A;  2F8T A;  4OVL A;  2BH1 A;  1R0A A;  1VK0 A;  4CEA A;  3N4Q A;  3M3Z A;  1IBM K;  4JK8 A;  1NK8 A;  3QIC A;  4EFH A;  3HPO A;  4CER A;  1JLF A;  3HST B;  1D8Y A;  2DY4 A;  1KCF A;  3DRP A;  1HQE A;  5M1F A;  4CF2 A;  4M42 A;  1REV A;  4H5R A;  3FZM A;  4NCB A;  2G8F A;  3U3Y A;  4N41 A;  1KVB A;  5F1X A;  2FBV A;  4FWL A;  1JCE A;  4FM0 A;  3V9W A;  1UOC A;  2I5J A;  3CPW M;  4H0O A;  5AZI A;  4BQL A;  3ID6 A;  1L3V A;  3O08 A;  3NH1 A;  3ZEU A;  3KKR A;  1VQL N;  1KAZ A;  1A5W A;  4HHT A;  4FZY A;  4DTP A;  1JL2 A;  3M1F A;  3VQ9 A;  1N5Y A;  4BC2 A;  3D45 A;  3QO9 A;  4DV1 K;  4MDA A;  3V1O A;  3VTI A;  4FZZ A;  1XHZ A;  4FJN A;  3TI0 A;  1BI4 B;  4BRP A;  1KQS M;  1FKP A;  3B6O A;  4B9T A;  4BC3 A;  4F4K A;  3KWI A;  4B1X B;  1NGB A;  4ISG A;  3UKU A;  4CJK A;  2WUS A;  3SUO A;  1J5O A;  3SAH A;  3C6U A;  1TKZ A;  1P90 A;  3ATU A;  3H1V X;  4FJX A;  3MX5 A;  4JI3 K;  1JXB A;  3QBW A;  1LV5 A;  3U8X A;  3MWT A;  5J1E A;  2HBM A;  2AA4 A;  3DYA A;  3E9O A;  3HM9 A;  1ZXO A;  3TAQ A;  3A5M C;  3HPH A;  3BGR A;  3O3G A;  1HYV A;  3NMU A;  2X6S A;  3V81 A;  1NGC A;  4K25 A;  1YJ9 N;  1VSK A;  3C6A A;  4X62 K;  1NJW A;  1RBS A;  1HNX K;  3GL1 A;  4CE9 A;  1Z26 A;  1KAY A;  4AHR A;  4KFB A;  3NVK A;  1YIT N;  3JXU A;  1W0H A;  1MWK A;  4OKE A;  4FJ5 A;  4YNQ A;  3O9T A;  3W0L A;  1EQY A;  5GIP A;  3I8B A;  4CJP A;  3SLC A;  5CE3 A;  4W5R A;  5KRS A;  2P9P B;  3MED A;  3CQ8 A;  1X9J A;  2IVN A;  2O4G A;  1RNH A;  2A5X A;  3VQP A;  4B9L A;  2JWL A;  1N32 K;  4DV2 K;  3E1Y A;  3TAR A;  2G8W A;  3GE1 A;  4JK9 A;  5M1N A;  3MK6 A;  4O55 A;  4R79 A;  5DM6 L;  5FPD A;  1ASW A;  4FXD A;  4RCH A;  4DTO A;  3K5L A;  3GOI A;  4NO7 A;  1VSI A;  3M8S A;  1K8K B;  2W6K A;  2FC0 A;  2GUP A;  3ULE A;  3QFP A;  3L3U A;  4AM7 A;  4ICL A;  2P9N A;  1S5J A;  3RR8 A;  2HHW A;  2ZQB A;  2YHB A;  4BRL A;  1LOT B;  1D5A A;  4N76 A;  1BA0 A;  5AZI B;  3LZJ A;  3RRH A;  4B1U B;  3O4W A;  5AQM A;  3K5M A;  3T1Y K;  4DKW A;  3EZ5 A;  1NKC A;  4DU1 A;  4DLE A;  4F2R A;  1I3A A;  4FJG A;  2B6A A;  3BY5 A;  3DOL A;  4CW7 B;  1YUW A;  1DEJ A;  3IDH A;  2V52 B;  3FZH A;  3VA0 A;  1CZA N;  4BWJ A;  4FJI A;  1XNR K;  2O4I A;  2Q31 A;  2ZD1 A;  5JIC A;  3QBX A;  1GOA A;  4G1Q A;  3LWM A;  4PKG A;  4HCC A;  3L2R A;  5BN9 A;  4O8U A;  5FLX O;  4UY8 O;  1SAZ A;  2GBZ A;  3IS9 A;  4NXN K;  1SL0 A;  5MLC Q;  4W5N A;  2BGG A;  3CCS N;  3QEV A;  3DLB A;  3DM2 A;  4BR5 A;  4B3M K;  4WQ5 C;  2OAN A;  3KK3 A;  3CF5 L;  5BR9 A;  4U67 L;  3AA2 A;  3UE5 A;  3TAG A;  2PYL A;  1TAQ A;  2KFN A;  1IKV A;  3F2K A;  2HHH K;  1A5V A;  4Z4G A;  3WNE A;  5IT9 O;  3CJ7 A;  3P31 A;  3THX A;  1NGD A;  2HBK A;  2EWS A;  4O0I A;  2GX9 A;  1KLM A;  3TTD A;  2Z1G A;  1GLD G;  3LDQ A;  3VQ7 A;  1DTQ A;  4BAC A;  4IOC L;  4BR9 A;  3KK7 A;  1NK9 A;  1TKX A;  4F9O A;  4JV5 K;  1IBL K;  1D4X A;  2ITM A;  3U4L A;  4DR2 K;  1L3T A;  3GG4 A;  1NK5 A;  4Y1D A;  1GOB A;  3H1Q A;  5C0Y A;  1U2V A;  4AIL C;  5M1K A;  3C7N A;  5JLH A;  3CET A;  1LW0 A;  4BRF A;  3ENB A;  4FOI A;  3VOV A;  3SUQ A;  4LH4 A;  2OPS A;  2CH5 A;  5AZJ A;  3C94 A;  4ISF A;  3MXJ A;  4JKC A;  4FLW A;  5HP1 A;  4FJ9 A;  1TK0 A;  1BCM A;  2P5G A;  2QXL A;  2F7T A;  3OBW A;  1HKG A;  1NGH A;  3CCL N;  4IO9 L;  4LFC K;  2ZJP L;  2P9N B;  3WXJ A;  1NMD A;  3DXM B;  4H5N A;  2Q97 A;  2Q2R A;  1U04 A;  3NFA A;  4LSN A;  4MO5 A;  1KAX A;  4EAH D;  5C15 A;  4RW7 A;  4DU3 A;  1KVC A;  1QSY A;  4KB0 A;  5BN8 A;  3LAN A;  1M90 O;  1QS4 A;  3SI6 A;  1BGX T;  3F9M A;  1C1B A;  2G8V A;  4CZJ A;  3LP3 A;  3RRG A;  4IFV A;  5AQP A;  3I56 N;  1BUP A;  1BWF O;  1RBV A;  2P51 A;  3GBT A;  3P83 D;  3H45 C;  3G4S N;  1HRH A;  3SQ1 A;  1DLO A;  4C8M A;  4K41 A;  4A61 A;  3ZX2 A;  4N47 A;  3HVT A;  2IDO A;  3BZK A;  3P5J A;  2A1S A;  2RPI A;  4BC5 A;  4B9Q A;  2W6L A;  5CR4 A;  3TSQ A;  2P9K A;  4FLU A;  2ZGY A;  4CIE A;  3TU5 A;  2IS3 A;  4JI5 K;  3THY A;  4XH1 A;  3K0S A;  4WFA L;  4MQ3 A;  4A5B A;  3ZYY X;  3RMB A;  4CJ3 A;  3VGL A;  4IZ9 A;  5ELZ A;  1HUX A;  1BU6 O;  3O9R A;  3VEY A;  1RTD A;  1RTJ A;  4QS9 A;  2QWM A;  4I9Q A;  4CVN E;  3RWU A;  4H8K A;  4I6M A;  4BG8 A;  4ZTJ A;  3WNG A;  4DSK A;  1U6Z A;  2QWQ A;  4OLB A;  2HMP A;  3THX B;  4KPY A;  4JD2 A;  4LH5 A;  3SV4 A;  4B08 A;  2FXU A;  1QTM A;  4KH4 A;  2QI2 A;  2UXD K;  3E9P A;  3NGY A;  1ZBF A;  1ATS A;  4Q0B A;  3DLR A;  2VQE K;  4KHP K;  4CJE A;  2PYJ A;  2NRV A;  5KQD A;  3RR7 A;  3CCE N;  3AAR A;  1NOZ A;  1U2V B;  4OKJ A;  4DS4 A;  1ESV A;  4DV4 K;  4FLT A;  3C7N B;  3QDK A;  1JLA A;  1HMV A;  2NNW A;  3TR8 A;  4FW2 A;  3BP8 A;  1BHL A;  1WNS A;  5AQQ A;  5AZJ B;  3AVG A;  3ZSR A;  5EVZ A;  5FPE A;  3HT3 A;  4K8X A;  4B1W B;  1T05 A;  3NE6 A;  4JS5 A;  2HHS A;  1OVQ A;  3IG1 A;  3LAK A;  4KHN A;  4OJR A;  3LPT A;  5TKY A;  1QZ5 A;  2NRR A;  1YAG A;  3DRR A;  4PKH A;  5EX5 A;  4J8F A;  3VEZ A;  4M3R A;  4BRM A;  4H0X B;  3KLH A;  4CGD A;  1YJN N;  4DSF A;  1Q9X A;  4KHW A;  2UUB K;  5LJW A;  1VQ9 N;  1N36 K;  2BAN A;  3KWG A;  1YIJ N;  1JCG A;  3HP9 A;  4BRK A;  1S9E A;  3CM5 A;  1OH6 A;  5KTQ A;  2VWJ A;  2GEL A;  4DFP A;  4FL9 A;  3FFK B;  3NCI A;  1DGK N;  3C0B A;  3VQ5 A;  1W9H A;  3THW A;  4OO1 J;  1KFD A;  3HOT A;  5JMV A;  1QQO A;  2NRT A;  3K9J A;  2F4V K;  4ELT A;  5C24 A;  2P9K B;  1T44 A;  1WSG A;  3THV A;  3CIP A;  4MLE A;  1WSH A;  4HUG A;  1DKG D;  2YNG A;  3I0S A;  3VF2 A;  2Z1I A;  4BRA A;  4FLY A;  2ETJ A;  3WXK A;  1QVF M;  3QES A;  1SKR A;  5CHI A;  1WAJ A;  4YOU A;  4HTU A;  3ITH A;  3VA3 A;  1YVN A;  4MLH A;  1BG3 A;  5B8H A;  2E2N A;  4I6M B;  4DR4 K;  4WF9 L;  4LF5 K;  1ZYQ A;  1NWK A;  4JD2 B;  4BE2 A;  4KTW A;  1NGF A;  4JAX A;  3FZL A;  1NGE A;  2YHW A;  5C12 A;  4DFK A;  1IKY A;  3CCR N;  3CC7 N;  3M5R A;  4BRI A;  3HZ6 A;  5HRR A;  4CF0 A;  4KKO A;  3VQQ A;  1KSP A;  3HPG A;  3ALY A;  3ULD A;  3OYN A;  4JK7 A;  5K14 A;  5AQY A;  1C0M A;  1GLJ O;  4DV3 K;  1V4T A;  3CCU N;  3VEO A;  3OTO K;  1F21 A;  3QER A;  3FZF A;  3QNN A;  4M3X A;  2OCE A;  4DMN A;  1JLG A;  4JRQ A;  3V9X A;  4YDU A;  3QEI A;  3P38 A;  3SQ0 A;  3ID8 A;  3SBG A;  2XY7 A;  1QVG M;  1RDB A;  2UUC K;  3R6M A;  2UU9 K;  3TSP A;  2XY5 A;  4FO0 A;  2OYQ A;  4EP4 A;  4DTX A;  3AVC A;  1E4G T;  2P9U A;  1SKW A;  5AQO A;  4BVO A;  4BDZ A;  4JHD A;  1SL1 A;  3SYZ A;  4QS8 A;  2HBL A;  1IBK K;  3QLH A;  4HUE A;  4DTU A;  4JEP A;  4V19 S;  1JLQ A;  4HUF A;  4A5A A;  2OPP A;  5AQV A;  1X9M A;  1Q9Y A;  2HHU A;  3HSC A;  3EL2 A;  4NXM K;  3QNO A;  3PX4 A;  4IBN A;  4YFU A;  4E7H A;  2UXB K;  3F73 A;  2F9T A;  1L3S A;  4DV0 K;  3FLC O;  3JAM O;  3MN5 A;  1VSL A;  3CCM N;  5FRM A;  5HRP A;  1BO5 O;  4G9Z A;  1ITG A;  3WXL A;  1SS6 A;  5AQG A;  3OYL A;  4JKF A;  4CGJ A;  4CIG A;  3AV9 A;  4RW4 A;  2HBJ A;  1TUU A;  1WB9 A;  2E6L A;  3G0Z A;  1YVU A;  1JCF A;  4B9N A;  3L0Q A;  4IO8 A;  1GLF O;  3S9H A;  1NU0 A;  3ZX0 A;  1YT3 A;  3MN7 A;  5HLF A;  4H0T B;  1QQN A;  1HKC A;  4CJU A;  4E1J A;  3L2U A;  3T69 A;  3C6H A;  4IFY A;  3QIN A;  3O8M A;  4F3O A;  4GKK K;  4BY9 C;  3ZSW A;  1QE1 A;  4PKI A;  1M1K O;  4FWN A;  3AA3 A;  3OJU A;  3SZ2 A;  3EKU A;  3A8Y A;  4DV6 K;  5CYQ A;  2ATQ A;  2D0C A;  5AQJ A;  5KPT A;  3ZCM A;  3CQY A;  3OYM A;  2V51 B;  3VET A;  5BPN A;  1CZB A;  2OTJ N;  3K59 A;  1K8K A;  2A41 A;  3ZX3 A;  3L2Q A;  5I42 A;  5KQ8 A;  3L2V A;  3AO1 A;  1X3M A;  3E66 A;  4CHZ A;  3DMJ A;  4CJ7 A;  4LF9 K;  1J53 A;  3LM9 A;  4YOX A;  5BPL A;  1S6Q A;  1ASU A;  2GUI A;  3VN5 A;  4YOV A;  2IOC A;  1FJG K;  2WOM A;  2NUB A;  1BL3 A;  3LL3 A;  1HYS A;  1BA1 A;  5A2Q O;  3DI6 A;  1X9W A;  1WBD A;  3U9Z A;  3TAN A;  4H0P A;  5J2Q A;  1YJW N;  1XQS C;  4EIA A;  2ZF5 O;  3O3F A;  3AO4 A;  4ISE A;  2P9U B;  3J7Z O;  4H5V A;  4JHD B;  1TKT A;  4NLC A;  1IH7 A;  3IAY A;  3ZSV A;  1QHT A;  4ILG B;  2AJQ A;  3BF3 A;  4BRD A;  2P9I B;  4CD1 A;  1U47 A;  4I9L A;  3KHY A;  3CCV N;  1MWM A;  1HNV A;  3SAF A;  3G71 N;  1T7P A;  4BGA A;  3KLF A;  5ADX H;  1YTA A;  3C95 A;  5FPM A;  4BQZ A;  3ATV A;  4FJM A;  4ID5 A;  1KTQ A;  2I7P A;  3WNH A;  4WE1 A;  1NM1 A;  4LSL A;  4WFN L;  4DQQ A;  2FF6 A;  1RBT A;  4YOR A;  1Q82 O;  1FK9 A;  4PWD A;  2ZE2 A;  3HRG A;  4OKK A;  5HOO A;  3AO5 A;  3VEV A;  4DQ8 A;  2FSN A;  5M1P A;  1OH5 A;  5HRS A;  2DFF A;  3I33 A;  1NK6 A;  1KXP A;  2WON A;  4B9M A;  1IJJ A;  2HHV A;  1LAW A;  3ZET A;  3AGR A;  3QEW A;  1CXQ A;  1C1C A;  1LCU A;  3OBY A;  3RMD A;  4B1Z A;  1T03 A;  4CJ4 A;  2DPN A;  2YX6 A;  4KTQ A;  1VQ6 N;  3AVM A;  1SUQ A;  3VF6 A;  3KD5 E;  3DJC A;  4CEC A;  4E19 A;  1HPM A;  4CK3 A;  1VQ5 N;  4OPA A;  4E7I A;  2XO7 A;  4LF8 K;  1Y64 A;  4LF7 K;  5HRO A;  2YJF A;  4DV7 K;  2O8F A;  4EZ6 A;  3OYC A;  4WQ4 A;  1NJX A;  1MU2 A;  3PSI A;  4C8K A;  3TAE A;  1T3V A;  1RFQ A;  4FM1 A;  3DXM A;  1RT4 A;  1ZBU A;  4IEI A;  4E7K A;  2KZM A;  2PZS A;  3LDL A;  4O4G A;  5KGX A;  5AR0 A;  4KRE A;  4FWK A;  2VGM A;  4CFD A;  5J2M A;  3T7Z A;  4J2A A;  1IG8 A;  3TSU A;  1HNZ K;  5JVH L;  1MDU B;  5EU7 A;  2FSJ A;  5AQW A;  3L2W A;  4NCA A;  1J5E K;  3CD6 N;  3RMC A;  1S6P A;  3SJJ A;  5AQT A;  2QWN A;  1CLQ A;  2YHY A;  4A57 A;  4CI6 A;  3VER A;  4C8L A;  5I3U A;  4FWM A;  4KHQ A;  4CEQ A;  5JS1 A;  1RDW X;  3O9S A;  1TGO A;  2A6A A;  4BE1 A;  3WXI A;  4M63 C;  3DAW A;  4N56 A;  2ZM6 K;  3P4I A;  2OTL N;  2D4W A;  2IGI A;  1K6Y A;  4OPK A;  3Q7C A;  4DFJ A;  3FZK A;  2W42 A;  4GV9 A;  3SK3 A;  2O8D A;  3CPE A;  4CZH A;  4OPJ A;  4M7X A;  1VQ8 N;  4WYB A;  3V9Z A;  3TAB A;  1BOT O;  4K0K K;  5CY4 A;  5ADX A;  4CGH A;  4FWR A;  2QXF A;  2Q36 A;  3ZET B;  3O5B A;  3HO1 A;  3OS0 A;  4JLH A;  3KKS A;  1VQ4 N;  5E41 A;  4W5T A;  4BRQ A;  3MN9 A;  4H5W A;  2ASO A;  3UIQ A;  3NF8 A;  4DS5 A;  4CHO A;  3RMA A;  3CYM A;  4H4M A;  4KH6 A;  1JJ2 M;  3S41 A;  2O8C A;  3CFO A;  3IMX A;  2GTD A;  4GKJ K;  5GAE P;  4IEE A;  4DU4 A;  3DRS A;  2O8E B;  2F9W A;  4M3Y A;  2Z1J A;  3PV8 A;  2KTQ A;  4K43 A;  4BVP A;  4CEF A;  1G99 A;  3NBP A;  3HOS A;  4ILJ A;  1NKE A;  4CZI A;  1H1V A;  3O1W A;  1CZ9 A;  2BTF A;  2O8F B;  3V9S A;  4CJ5 A;  2E20 A;  3D0P A;  3PSF A;  3OA9 A;  4JNE A;  3BEX A;  4LY7 A;  4CFC A;  4CJV A; 
#chains in the Genus database with same CATH homology
 2P1J A;  2VWK A;  4KHW A;  2KZZ A;  2Z1H A;  3ZT3 A;  3SPY A;  2OPR A;  1NJZ A;  1O1W A;  1TK5 A;  1EXQ A;  1J54 A;  3AO3 A;  4KB1 A;  2B5J A;  2BAN A;  3QET A;  4UQG A;  3NAE A;  3OYG A;  5C42 A;  3HP9 A;  1TKD A;  1HNI A;  3M8P A;  1S9E A;  3VQD A;  3CM5 A;  4Z4C A;  5KTQ A;  3IRX A;  2VWJ A;  2YV0 X;  3QEP A;  3VQC A;  4DFP A;  2G8H A;  5C25 A;  2ITG A;  4FJL A;  2HB5 A;  4OLA A;  4E1N A;  3NCI A;  1SV5 A;  2IAJ A;  3SCX A;  3LP2 A;  1EX4 A;  1RT1 A;  3ZSZ A;  1C0T A;  2A1R A;  4FVM A;  4RG8 A;  3MXM A;  4XIU A;  3K57 A;  4QAG A;  3VQ5 A;  1RDA A;  1W9H A;  4CFB A;  4C8O A;  1KFD A;  4JRP A;  4DSJ A;  2YNH A;  1L3U A;  2IC3 A;  3KTQ A;  4ELT A;  2HHX A;  4JS4 A;  4O0J A;  5C24 A;  1WSG A;  1Z25 A;  3THV A;  1S1V A;  3V6D A;  1WSH A;  1LW2 A;  4HUG A;  2QK9 A;  3NH2 A;  4BDP A;  2OZS A;  2YNG A;  3I0S A;  4DG1 A;  1RT5 A;  2Z1I A;  4OVL A;  4CEZ A;  3I0R A;  4FLY A;  2F8T A;  4M45 A;  1R0A A;  2ETJ A;  1VK0 A;  3O3H A;  3K58 A;  1QQC A;  4CEA A;  3SQ2 A;  3QES A;  3HXM A;  1SKR A;  1JLC A;  1WAJ A;  1RIL A;  1NK8 A;  1RTH A;  3F9K A;  2EX3 A;  1NK4 A;  3HPO A;  4HTU A;  3TAP A;  4CER A;  1N6Q A;  5KGW A;  3ITH A;  3VA3 A;  4CED A;  3E01 A;  1WLJ A;  1JLF A;  3HST B;  1D8Y A;  4HCB A;  2XHB A;  4RW8 A;  2DFE A;  3V9U A;  4FM2 A;  2DY4 A;  1KCF A;  3DRP A;  1HQE A;  4F3T A;  5JS2 A;  4CF2 A;  4M42 A;  1REV A;  2F96 A;  3NF7 A;  1NK0 A;  4CF8 A;  2G8F A;  4NCB A;  3U3Y A;  1GOC A;  4N41 A;  1KVB A;  2HNY A;  1JL1 A;  1HQU A;  4BE2 A;  1ZYQ A;  4FZX C;  3G10 A;  4KTW A;  4CJL A;  2DTU A;  4IDK A;  2FBT A;  2FBV A;  4FW1 A;  4FM0 A;  4DFK A;  1IKY A;  1UOC A;  2I5J A;  3NF6 A;  3V9W A;  1S9G A;  3ZT0 A;  1L3V A;  3HJF A;  3NH1 A;  5HRR A;  1LWE A;  3KKR A;  3LDS A;  4I7F A;  4CF0 A;  4KKO A;  3VQQ A;  1KSP A;  1A5W A;  3ALY A;  3HPG A;  4HHT A;  1IKX A;  4DTR A;  4FZY A;  4DTJ A;  5HBM A;  3LWL A;  3ULD A;  4DTP A;  1JL2 A;  3OYN A;  5K14 A;  1C0M A;  3VQ9 A;  1N5Y A;  1D9F A;  3ZSX A;  3D45 A;  3QO9 A;  3V1O A;  1VSF A;  3PUF A;  4FZZ A;  1XHZ A;  4CJQ A;  1F21 A;  1BIZ A;  4EP5 A;  3QER A;  3QNN A;  4FJN A;  3TI0 A;  4DMN A;  1KFS A;  1JLG A;  1BI4 B;  4KI6 A;  4M3X A;  1FKP A;  3B6O A;  4JRQ A;  3V9X A;  4NYN A;  3S3N A;  4B9T A;  3NGI A;  2P5O A;  4DSL A;  4F4K A;  4KRF A;  3QEI A;  2YNF A;  1BIS A;  3SQ0 A;  1IG9 A;  3OYB A;  4CF1 A;  2XY7 A;  1RDB A;  3AVL A;  3V1Q A;  2XY5 A;  1RT6 A;  1VRU A;  4AHV A;  4CJK A;  3SUO A;  4E7L A;  2OYQ A;  1IO2 A;  4EP4 A;  4Q5V A;  4DTX A;  1J5O A;  3AVC A;  2KFZ A;  4KAZ A;  3P1G A;  4H4O A;  3C6U A;  1TKZ A;  1TAU A;  3MEE A;  4FJX A;  3RTV A;  1JXB A;  3JYT A;  1LV5 A;  1SKW A;  3K2P A;  4BDZ A;  3NHG A;  5J1E A;  1SL1 A;  3SYZ A;  4GVM A;  1BCO A;  1RBR A;  3DYA A;  3QLH A;  4HUE A;  1WSE A;  4DTU A;  4CHY A;  4DQP A;  3AVH A;  3HM9 A;  1JLQ A;  4HUF A;  1B92 A;  2E4L A;  4F2S A;  3TAQ A;  2OPP A;  2HHS A;  3HPH A;  4MFB A;  1X9M A;  1C0U A;  3BGR A;  3VQB A;  1HYV A;  4NYF A;  3O3G A;  3LZI A;  2X6S A;  3V81 A;  3DLH A;  1VSK A;  2HND A;  1NJW A;  1RBS A;  3QNO A;  3AVK A;  3PX4 A;  3MXI A;  4IBN A;  5D3G A;  4YFU A;  4E7H A;  4CE9 A;  3AVJ A;  3F73 A;  1Z26 A;  2KW4 A;  4AHR A;  4KFB A;  1L3S A;  4IG3 A;  4B9V A;  4DSE A;  3T1A A;  1EET A;  3LAL A;  1VSL A;  5FRM A;  2BDP A;  5HRP A;  4PY5 A;  1KRP A;  5DK5 A;  4FJH A;  2RKI A;  4DTM A;  1W0H A;  1ITG A;  4OKE A;  4FJ5 A;  3FFI A;  5CZ2 A;  4YNQ A;  4R5P A;  4CGJ A;  3OYL A;  2OZM A;  1S1T A;  4CIG A;  4BE0 A;  3AV9 A;  3NDK A;  4RW4 A;  1ZBI A;  2X74 A;  4DQS A;  4OGC A;  5HRN A;  4CJP A;  2E6L A;  1VSJ A;  3T19 A;  3PX6 A;  4CCH A;  3G0Z A;  1YVU A;  4W5R A;  4B9N A;  5KRS A;  4EZ9 A;  5DMR A;  3MED A;  4KHS A;  3CQ8 A;  3VQP A;  2O4G A;  1RNH A;  3S9H A;  1UAX A;  4B9L A;  4B8A B;  1YT3 A;  1WN7 A;  2E6M A;  4B8C A;  5HLF A;  3ZT4 A;  1KLN A;  3SPZ A;  3TAR A;  4CJU A;  2G8W A;  2D0B A;  3NH0 A;  3L2U A;  4O5B A;  3AVF A;  4AHS A;  1L5U A;  4O55 A;  1QSS A;  1IKW A;  1ASW A;  1S1U A;  4FXD A;  4IFY A;  3QIN A;  4N5S A;  4F3O A;  5KRT A;  3A2F A;  4DTO A;  3K5L A;  3ZSW A;  1QE1 A;  3KD1 E;  5FRO A;  4PQU A;  2R7Y A;  1VSI A;  4AHC A;  4BWM A;  4E1M A;  3M8S A;  3K5O A;  4M3Z A;  4CJS A;  4CFA A;  2FC0 A;  4FJ8 A;  3AA3 A;  3OJU A;  3L3U A;  3SZ2 A;  3AVN A;  4ICL A;  3KLI A;  1S5J A;  3RR8 A;  2HHW A;  2ZQB A;  1VSH A;  2YHB A;  3OVN A;  1Y97 A;  5CYQ A;  2ATQ A;  2D0C A;  1NJY A;  2HVH A;  1D5A A;  3ZCM A;  4N76 A;  4Y1C A;  3OYM A;  3LPU A;  3LZJ A;  3NGZ A;  1LAV A;  3RRH A;  1CZB A;  3K5M A;  1VSM A;  4M41 A;  3K59 A;  3H08 A;  3EZ5 A;  1NKC A;  3L2Q A;  4J2E A;  2VG5 A;  4DU1 A;  4DLE A;  5I42 A;  1NKB A;  4F2R A;  1I3A A;  4FJG A;  3L2V A;  1I39 A;  3AO1 A;  4CK1 A;  2B6A A;  4OGE A;  3DOL A;  4CJW A;  1ZBL A;  1EKE A;  4DTS A;  4CHZ A;  4KHY A;  3DMJ A;  1RT3 A;  4DSI A;  1G15 A;  4Z4H A;  4DQR A;  3VA0 A;  4FJI A;  4BWJ A;  1J53 A;  2XY8 A;  3ZSO A;  4CHP A;  4AHU A;  2O4I A;  1S6Q A;  3KJV A;  1ASU A;  2GUI A;  2ZD1 A;  2D0A A;  3VN5 A;  4CJR A;  3VQA A;  2JLE A;  4NCG A;  1GOA A;  4G1Q A;  2IOC A;  2WOM A;  1BQN A;  2NUB A;  1BL3 A;  2B4J A;  1XWL A;  4C8N A;  3LWM A;  3L8B A;  4LD0 A;  5J2N A;  2HVI A;  4I2Q A;  4HCC A;  2YKM A;  3L2R A;  1HYS A;  4IKF A;  3AVB A;  3OYD A;  1X9S A;  3DI6 A;  1X9W A;  4AHT A;  3TAN A;  5J2Q A;  1S1X A;  2HMI A;  4B9U A;  5J2P A;  4L8R B;  2GBZ A;  1WSF A;  3IS9 A;  3O3F A;  1U48 A;  4DF4 A;  1RCH A;  3AO4 A;  3OS2 A;  1SL0 A;  3HL8 A;  4W5N A;  3U3G A;  1CXU A;  2BGG A;  3QEV A;  3DLB A;  1TKT A;  2VG7 A;  1IH7 A;  3DM2 A;  1U45 A;  3IAY A;  3ZSV A;  1QHT A;  3KK3 A;  3SNN A;  2AJQ A;  3SQ4 A;  4Z4E A;  3C6T A;  1S1W A;  1U49 A;  1U47 A;  3MEG A;  4I9L A;  2HW3 A;  1BQM A;  1WSJ A;  2F8S A;  3AA2 A;  1HNV A;  3QEX A;  1T7P A;  3KLE A;  2EHG A;  4M3T A;  3TAG A;  3KLF A;  2PYL A;  4CF9 A;  1TAQ A;  4GMJ B;  1YTA A;  1IKV A;  3C95 A;  4FYD A;  2KFN A;  4FJM A;  1TVR A;  4Z4G A;  1A5V A;  4ID5 A;  1KTQ A;  3AVI A;  3PO4 A;  3WNH A;  1X1P A;  4WE1 A;  4LSL A;  2G8K A;  3WNE A;  4DQQ A;  1LWF A;  3KLG A;  1RBT A;  4DTN A;  2D5R A;  1HPZ A;  1FK9 A;  4O0I A;  1KLM A;  3CFP A;  1UA1 A;  2Z1G A;  2ZE2 A;  4OKK A;  4PWD A;  3AO5 A;  3VQ7 A;  3AA4 A;  1DTQ A;  4BAC A;  3OYA A;  3OYK A;  4QOZ B;  5SWM A;  1SKS A;  3V4I A;  2X78 A;  5HRS A;  2DFF A;  1NK9 A;  1TKX A;  1NK6 A;  2WON A;  1B9D A;  4B9M A;  1L3T A;  4ID1 A;  1VSD A;  4CJT A;  2HHT A;  2HHV A;  1NK5 A;  1LAW A;  1TL1 A;  3QEW A;  4Y1D A;  1CXQ A;  1GOB A;  3O4Q A;  4Z4F A;  1C1C A;  1XC9 A;  4B3O A;  3RMD A;  1T03 A;  4CJ4 A;  4ELV A;  4AIL C;  3HP6 A;  1JLB A;  2QKK A;  3OJS A;  3K5N A;  1NOY A;  4KTQ A;  1LW0 A;  4QCL A;  1XHX A;  1XI1 A;  3PY8 A;  4FLX A;  3AVM A;  4FK4 A;  1SUQ A;  3SUQ A;  4LH4 A;  2OPS A;  1SL2 A;  1JXE A;  1FXX A;  3TAF A;  3C94 A;  2Y1I A;  3WNF A;  3KD5 E;  3MXJ A;  3AVA A;  4CIF A;  4CEC A;  4FLW A;  2XY6 A;  4E19 A;  5HP1 A;  2G8U A;  1B9F A;  4CGF A;  4FJ9 A;  5T7B A;  4CK3 A;  1NK7 A;  1TK0 A;  3DLG A;  1BCM A;  1RDD A;  2P5G A;  3L3V A;  4K8Z A;  4E7I A;  3I8D A;  5FDL A;  2XO7 A;  2VG6 A;  4FJJ A;  4CGD A;  5HRO A;  3BDP A;  1T8E A;  1EP4 A;  1ASV A;  1U04 A;  2DFH A;  3NFA A;  4CES A;  4CHQ A;  3OYF A;  3ISN C;  4LSN A;  4DU3 A;  4EZ6 A;  1QSY A;  3OYC A;  4RW7 A;  1U4B A;  1KVC A;  4KB0 A;  1VRT A;  3T3F A;  3LAN A;  3LAM A;  1NJX A;  1MU2 A;  1QS4 A;  2YHA A;  4KO0 A;  3SI6 A;  3JSM A;  5KI6 A;  4C8K A;  3TAE A;  2G8I A;  1BGX T;  1DTT A;  4CFC A;  4RW6 A;  3EY1 A;  4FM1 A;  3SUP A;  1C1B A;  2G8V A;  4CEE A;  3OY9 A;  1RT4 A;  4CHN A;  3LP3 A;  4PUO A;  3RRG A;  1ZBU A;  2JGU A;  1FKO A;  4IFV A;  4E7K A;  4CGG A;  3CM6 A;  2KZM A;  1RBU A;  1RBV A;  4DFM A;  4W5Q A;  2PZS A;  4M3W A;  2YKN A;  2P51 A;  3P83 D;  3V1R A;  2RN2 A;  1HRH A;  3SQ1 A;  4IG0 A;  1DLO A;  4O4G A;  5KGX A;  4FLV A;  4C8M A;  4N47 A;  3S3O A;  3QIO A;  3O4N A;  4KRE A;  3HVT A;  2IDO A;  4CFD A;  3P5J A;  4CGI A;  4KHU A;  2A1S A;  2RPI A;  5J2M A;  3ZSQ A;  4J2A A;  4PA1 A;  4HVJ A;  5EU7 A;  4FLU A;  4E3S A;  4CK2 A;  4CIE A;  3M8R A;  3ZT1 A;  3L2W A;  1HYZ A;  4NCA A;  2IS3 A;  3RMC A;  1S6P A;  3KK1 A;  3SV3 A;  3SJJ A;  3PO5 A;  3AA5 X;  1CLQ A;  4CEB A;  4C8L A;  3LP1 A;  5I3U A;  4MQ3 A;  4KHQ A;  3RMB A;  3LP0 A;  2XRI A;  4CJ3 A;  4CEQ A;  5JS1 A;  4BDY A;  4E7J A;  3DOK A;  3VQ8 A;  1BIU A;  1TGO A;  4BE1 A;  2PY5 A;  2FBY A;  4KV8 A;  1RTJ A;  1RTD A;  1TV6 A;  4I9Q A;  3PX0 A;  4FK2 A;  4N56 A;  1J9A A;  3CG7 A;  4DF8 A;  4ZTF A;  3RWU A;  4H8K A;  1A5X A;  4F8R A;  2IGI A;  4J2B A;  1K6Y A;  4OPK A;  3ZT2 A;  3M8Q A;  3OYH A;  3WNG A;  4ZTJ A;  2QKB A;  4DFJ A;  4DSK A;  3MAQ A;  2W42 A;  2Y1J A;  4W5O A;  1TK8 A;  4M3U A;  4OLB A;  4KPY A;  3MEC A;  2X6N A;  3DLE A;  2HHU A;  4LH5 A;  3HK2 A;  3EYZ A;  3SV4 A;  1WAF A;  4OPJ A;  4B08 A;  1QTM A;  1RTI A;  1UA0 A;  4CEO A;  1RT7 A;  3V9Z A;  3NGY A;  3TAB A;  3OS1 A;  4FK0 A;  4Z4I A;  4B9S A;  3OYE A;  1RDC A;  2FBX A;  1ZBF A;  3DLK A;  2RF2 A;  2Q3S A;  3KIO A;  3ZSY A;  4Q0B A;  4AH9 A;  1LWC A;  4E89 A;  3DLR A;  4RW9 A;  3HYF A;  5CY4 A;  4CJE A;  2PYJ A;  2YNI A;  3CFR A;  2KQ2 A;  4CGH A;  3RR7 A;  4GW6 A;  4FJ7 A;  4TSX A;  3OYJ A;  2QXF A;  4ZHR A;  1RT2 A;  4KI4 A;  2HNZ A;  4I2P A;  3HO1 A;  3OS0 A;  1NOZ A;  4JLH A;  4DLG A;  3KKS A;  1JLE A;  3VQ6 A;  5E41 A;  4W5T A;  1Q8I A;  4OKJ A;  1VSE A;  4DS4 A;  3VQ4 A;  4J2D A;  3QIP A;  4KTZ A;  3TWH A;  1BI4 A;  3NF9 A;  1TL3 A;  4FLT A;  1JLA A;  1HMV A;  4FJK A;  5FRN A;  3AO2 A;  3VQE A;  2OA8 A;  3S3M A;  2GV9 A;  3TR8 A;  3NF8 A;  2LSN A;  4DS5 A;  3UIQ A;  1JKH A;  4CHO A;  4FW2 A;  3U6F A;  4O44 A;  1D9D A;  3RMA A;  1BHL A;  3CYM A;  1WNS A;  4H4M A;  1YTU A;  3AVG A;  3ZSR A;  3HT3 A;  3B6P A;  1QSL A;  3KK2 A;  4K8X A;  1HJR A;  3CFO A;  1T05 A;  3NE6 A;  4Z0U A;  5CYM A;  4JS5 A;  4DU4 A;  3OYI A;  1C1A A;  3DRS A;  1C6V A;  4M3Y A;  3IG1 A;  2Z1J A;  3LAK A;  3PV8 A;  3SUN A;  4KHN A;  2HHQ A;  4OJR A;  2KTQ A;  3LPT A;  4ELU A;  1ZBH A;  4CEF A;  2BE2 A;  2OPQ A;  3NBP A;  4E0D A;  4CJF A;  3HVR A;  1NKE A;  3DRR A;  5SZT A;  1CZ9 A;  4FLZ A;  4M3R A;  1UWB A;  5CZ1 A;  4FCY A;  3V9S A;  4CJ5 A;  1Q9Y A;  3D0P A;  3KLH A;  4DQI A;  4DWI A;  3TAM A;  4LY7 A;  1KVA A;  3ASM A;  4DSF A;  1WSI A;  4CJV A;  1Q9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...