4CF8A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cf8A00
1JXBA 4Z4HA 4RW4A 2HHWA 2VG5A 3DRSA 3ZSZA 1RT2A 4FJKA 1QS4A 3MEEA 4FXDA 3MXIA 4J2BA 1JL1A 2RPIA 3HVTA 1TGOA 3ZT0A 4FZXC 4KHUA 4CGDA 1KRPA 3VQQA 4HUFA 4FLTA 1NOYA 5DMRA 1S1TA 2HB5A 4AH9A 1L5UA 3IG1A 4CJ3A 2YV0X 3RMCA 2OPSA 3SUPA 1VSIA 1EXQA 2Z1HA 3LALA 2D5RA 5HBMA 3VQEA 3CFOA 4WE1A 4CGJA 2XY7A 3CQ8A 1JLFA 3HSTB 2QKKA 1L3UA 4C8KA 4KPYA 4OKJA 1FKPA 1LAVA 4C8LA 2BE2A 1BCOA 4GW6A 4Z0UA 4CJTA 4PA1A 3WNEA 3V9XA 3K59A 3DLKA 3DRPA 4ID5A 3OYCA 1WSJA 4Y1CA 3AVNA 1I3AA 1VRTA 4RW6A 5J1EA 3L2QA 4FM0A 3OJUA 1J53A 4AILC 3VQAA 1IH7A 1JL2A 3SYZA 4L8RB 1JXEA 3C94A 2BGGA 3HK2A 1U49A 3K5MA 1B92A 3RMAA 1SKWA 3FFIA 2D0CA 3VQ7A 3KIOA 1D9FA 2G8KA 4CJQA 4KI4A 4W5QA 4BWMA 4JRQA 4ZTJA 3ZSRA 4DSLA 3QIOA 1ITGA 1IKVA 1O1WA 2JGUA 2GV9A 1VSDA 4CEEA 3P83D 4AHVA 4EP5A 5HRSA 1VSHA 3OYLA 2QKBA 1UA0A 4B08A 3AA2A 3AVHA 3ISNC 1X1PA 4FCYA 1KVCA 2KZZA 1RT5A 4I2PA 2G8HA 2IDOA 2FC0A 1ASWA 1L3SA 3DYAA 1VSMA 3NE6A 3HPGA 1J9AA 3C95A 2PZSA 3VQDA 1IKWA 3QEIA 4C8MA 3HP6A 3V9UA 4R5PA 3O3GA 4M3UA 4CEQA 3AVMA 3BDPA 3PUFA 3SNNA 4CEAA 1NK6A 4B9UA 1X9WA 1UAXA 2E6LA 4CK2A 3OY9A 4FW1A 3OYEA 2HNYA 4CJFA 5I3UA 4CHQA 3QEVA 5HRRA 4DTNA 3AV9A 2AJQA 3DLEA 4M41A 4FM2A 4DQIA 4LSNA 3WNHA 4DTRA 4DFPA 3MXJA 3HM9A 1WSGA 4CK1A 5HP1A 4H4OA 3H08A 1JKHA 3M8RA 3K5NA 4DTOA 3OS2A 3THVA 1X9SA 4N5SA 1T03A 2RF2A 1EX4A 3RMDA 3DLHA 4OLAA 2G8WA 5FDLA 3ULDA 1T05A 3HXMA 2VG7A 1J54A 1LAWA 3AA5X 4DFMA 4J2EA 2KQ2A 3TARA 4FK2A 1RCHA 4M3RA 3SV4A 4DFKA 4DU1A 3T1AA 1REVA 1UWBA 1RTHA 2YHAA 4HVJA 4Q5VA 3O3HA 1NK5A 3PX0A 4OKEA 3U6FA 4FJXA 4CJRA 1TAUA 4AHCA 3ZSWA 3ZSVA 5C25A 3ZSXA 1Y97A 4IFYA 3LDSA 1TK8A 2XHBA 4FZZA 2HVHA 3KKRA 4Q0BA 5EU7A 3S9HA 3RR8A 1Q8IA 3SV3A 4CJSA 4FK4A 2HHTA 3DLRA 1TKTA 3AVFA 4I2QA 2XY5A 1BI4B 4CF9A 3HPOA 4Z4EA 4FM1A 3G0ZA 4N56A 1XC9A 1JLQA 4LY7A 3DRRA 4DS5A 3SI6A 1C0UA 1HNVA 3AVLA 4DLEA 3TANA 4CK3A 1TV6A 1Z25A 4QAGA 4DSFA 3M8SA 1NK4A 1ZBIA 1LWCA 3DOKA 3NHGA 4E1NA 3CFRA 4DS4A 4DTPA 1ASUA 4KB0A 5J2PA 3WNFA 4ZTFA 1CXUA 1TKDA 2G8FA 4KHQA 4DTJA 1LWFA 3NGYA 1NKCA 3NF8A 2KZMA 3PV8A 1B9FA 4KI6A 2LSNA 3KLIA 2RKIA 4XIUA 2G8UA 1KCFA 4DWIA 4DSIA 1RBUA 4LSLA 2YNFA 4E19A 4Z4CA 3L2UA 3D45A 3PX6A 5I42A 1QTMA 3OYHA 4CIGA 2HHSA 3NGZA 3L2WA 1WN7A 4W5OA 3ZT3A 4CCHA 1NK0A 4FJMA 2YKMA 1SKSA 4DQSA 2IC3A 1HQEA 2OPQA 2X6SA 5E41A 1HMVA 3DMJA 1SL1A 1CLQA 1VSEA 3T3FA 1NKBA 2NUBA 1C1BA 5FROA 2HHXA 3LP1A 4CEZA 1WSEA 3OS0A 3SUQA 1LW2A 1QSYA 3IAYA 4QOZB 1FK9A 4M45A 4O0IA 3K5LA 4B9NA 1RTIA 5SZTA 4LH4A 1KVAA 4BDYA 4PQUA 4FJ7A 1HYVA 5DK5A 4CGHA 4Z4IA 1S1UA 4AHTA 4TSXA 3AA4A 2KFZA 4CGFA 3TAFA 3NH0A 4E7JA 3HVRA 4B9MA 4I9QA 2KFNA 3QO9A 4KAZA 1BL3A 3SQ0A 3SPZA 3V9ZA 1WAJA 1KLNA 2WONA 2ZE2A 3QLHA 3KKSA 4KHNA 3KLHA 4HTUA 2ATQA 3MEGA 3S3NA 4LD0A 4B9SA 1FKOA 4FVMA 4N47A 1WSIA 1S1WA 3TWHA 4OPJA 3LP2A 3ALYA 5T7BA 1NK8A 4W5TA 2HHVA 4CJPA 1D5AA 3AVIA 4Z4GA 3S3MA 1NKEA 3O4QA 3ZT1A 3OYJA 3K5OA 1VSLA 4JLHA 3DM2A 2JLEA 3CG7A 3HP9A 4DQPA 3CM5A 1KSPA 2IGIA 2P1JA 4PY5A 2VWJA 1IKXA 4M42A 4W5NA 3B6PA 4CFCA 3KD1E 2IS3A 3M8PA 3HJFA 2DY4A 1XWLA 3B6OA 3AVJA 2W42A 1DTQA 1LV5A 3LANA 4CECA 3OYMA 3TAPA 4B9VA 2PYLA 3KLEA 4DSKA 2FBVA 3U3YA 3OJSA 4CEOA 3TAEA 4JRPA 1VSFA 3TI0A 1L3TA 5J2NA 1S9GA 3C6UA 3HPHA 1NJWA 4HUGA 4FJNA 1CZBA 2IOCA 3MEDA 5KRTA 4DG1A 3VA0A 1YT3A 3QIPA 4O55A 1Z26A 1HJRA 3RR7A 4F3TA 5HRNA 2YHBA 4AHRA 4EP4A 3NH1A 1CXQA 5FRMA 3ZSOA 1KFDA 3KK1A 3OYBA 4DTUA 3L2VA 1RDCA 4FJJA 4J2AA 2XY8A 3QINA 4HCCA 4ELVA 4KFBA 1ZYQA 4F4KA 2X6NA 4RW8A 1S1VA 3KLFA 1RBVA 1QQCA 5K14A 3SPYA 2GBZA 3ZSYA 1U04A 3QEPA 4DTSA 3SQ4A 4CJLA 3NH2A 1X9MA 3WNGA 2O4GA 3RRHA 3QNNA 2F8SA 2VWKA 4CJVA 5SWMA 1BIZA 1JLAA 3V1RA 4BDZA 2P51A 3AO1A 2Z1GA 3NDKA 1HNIA 3VQPA 2HNZA 4K8ZA 3SQ2A 2PYJA 4M3TA 4CEDA 3MXMA 3TAGA 1VK0A 3AVGA 4DU4A 4OLBA 1K6YA 3O3FA 4O0JA 3QERA 4CJUA 3PX4A 2E6MA 4NYNA 4CHZA 4KTQA 1RDAA 2KW4A 3KJVA 1KLMA 1RT7A 1XHXA 1DLOA 2IAJA 1VRUA 3ZCMA 4CJEA 3C6TA 3QESA 3PO5A 3UIQA 2A1SA 4FW2A 4ID1A 3TR8A 3K58A 4HUEA 4HHTA 4E7KA 4OPKA 4FYDA 3MAQA 2YKNA 3L3UA 3VA3A 4HCBA 4J2DA 1ASVA 4KHYA 4IKFA 2HMIA 3RRGA 4H4MA 4UQGA 2OZSA 2OA8A 3RWUA 3OYAA 3VQ6A 1R0AA 3DLGA 4DF8A 5FRNA 4H8KA 3CM6A 1C6VA 4NYFA 3LWMA 5HLFA 3BGRA 3OYNA 3LWLA 1N6QA 1LWEA 1RNHA 1VSKA 4O5BA 3NAEA 3SUNA 1RT4A 3V1QA 3V1OA 1HYSA 1TL1A 3JSMA 4E89A 3CFPA 4YFUA 1S1XA 3M8QA 1J5OA 1WLJA 1BGXT 1GOCA 2QXFA 4KV8A 5CY4A 1Q9YA 1HQUA 3OYGA 4KO0A 1XHZA 1HPZA 3D0PA 3OYIA 4FJHA 4FJIA 1RBSA 3EYZA 3LPTA 3L3VA 4CERA 1WNSA 1U45A 1QE1A 1U47A 2Z1IA 3VQ4A 3I0RA 1S5JA 1UOCA 2X74A 5CYQA 4DMNA 3QEXA 1ZBLA 4ELTA 1WSFA 5C42A 2BDPA 3AVAA 2DFEA 4ICLA 1QSLA 2Y1JA 1MU2A 1S9EA 3IS9A 4CF2A 4PUOA 5D3GA 2B5JA 2WOMA 1JLBA 1T8EA 3V9SA 4EZ9A 4B9TA 3NF9A 3VN5A 4BE1A 4F8RA 4IBNA 3NBPA 2DFFA 4M3YA 3A2FA 4CEBA 3CYMA 5KGXA 1KFSA 4KHSA 4Z4FA 4B8CA 1ZBHA 4CFBA 4KREA 1TL3A 4FJ5A 1F21A 4E7HA 4B3OA 4PWDA 4FLYA 2X78A 2BANA 4KTZA 2PY5A 2P5GA 2DFHA 2QK9A 4OKKA 4G1QA 1KTQA 4DFJA 1S6PA 3E01A 1A5XA 1TKXA 4O4GA 3S3OA 1N5YA 3ASMA 1GOBA 3K2PA 5JS2A 2Z1JA 4DQRA 1EKEA 1IKYA 4IDKA 2XY6A 4CHPA 5CZ1A 3MECA 4FJ8A 3NFAA 4CFDA 3V6DA 1BHLA 1U48A 4GVMA 2EHGA 3EY1A 4OJRA 3VQ5A 4FLXA 4KHWA 1RT3A 4FLUA 1RBRA 3OYFA 1C0TA 1ZBFA 3LAMA 3OVNA 3P1GA 4IFVA 4EZ6A 2HHQA 4N41A 2ETJA 3SZ2A 3G10A 4CEFA 3QNOA 4B9LA 4CFAA 5HRPA 4E1MA 3AVCA 2EX3A 1RDBA 3VQCA 1BCMA 4AHSA 3F9KA 5C24A 4KKOA 4YNQA 1GOAA 4C8OA 5J2MA 3IRXA 3DOLA 1NJYA 1YVUA 3P5JA 1RT1A 4FLWA 1EP4A 3DLBA 2ITGA 4N76A 3O4NA 4IG3A 3VQ9A 4DQQA 4BWJA 2Q3SA 2XO7A 1IG9A 4F2RA 4FLZA 1BI4A 3KD5E 3HT3A 3HYFA 3LAKA 3QEWA 1QHTA 3ZSQA 4CHYA 1RBTA 3HL8A 4CF0A 3SQ1A 3LP0A 3OYKA 3V9WA 2YNHA 1LW0A 4FLVA 3AA3A 3AO2A 1BQMA 1JLEA 1NOZA 5KGWA 4K8XA 5JS1A 4M3WA 4OGEA 1HYZA 3K57A 2YNGA 2F8TA 4W5RA 2OPPA 3DI6A 2RN2A 4ZHRA 4CF1A 1VSJA 2HHUA 1BQNA 1SL2A 1I39A 1D8YA 3VQBA 4CHOA 3L8BA 4I7FA 2DTUA 2F96A 1HRHA 3KLGA 3RTVA 4FZYA 1JLCA 4CF8A 4CGGA 3V4IA 4I9LA 1SV5A 5J2QA 3TAQA 1SKRA 4M3XA 1W0HA 3AO3A 4C8NA 1TK0A 1W9HA 4BACA 4DTXA 1TVRA 3NCIA 1WSHA 2A1RA 4CGIA 2KTQA 3ZT4A 4QCLA 3RMBA 3PO4A 3SCXA 2B6AA 1JLGA 1TAQA 1IO2A 4NCGA 1SUQA 3T19A 1A5WA 4CIFA 1CZ9A 3OS1A 4E7IA 4FK0A 4E0DA 2FBTA 4KB1A 2ZQBA 4JS4A 4DTMA 4BDPA 3I8DA 3AVKA 4RG8A 3L2RA 1NJXA 1G15A 1C1CA 5KTQA 1A5VA 4E7LA 2D0AA 4NCBA 1YTUA 2I5JA 1RDDA 4DSJA 3I0SA 1Q9XA 1S6QA 4DF4A 2ZD1A 2G8VA 4FJ9A 1NK7A 5KI6A 2O4IA 4DLGA 4Y1DA 4GMJB 4E3SA 2B4JA 3KK2A 4CE9A 3AO5A 3OYDA 3EZ5A 1BIUA 1BISA 3NGIA 3ZT2A 4DSEA 2G8IA 2XRIA 3LPUA 2HW3A 1C0MA 3AO4A 1KVBA 4F2SA 3SUOA 4LH5A 1SL0A 4CJ4A 5KRSA 4M3ZA 3TABA 4MQ3A 4CJ5A 3LZJA 1C1AA 1DTTA 4KTWA 1U4BA 3KK3A 3ITHA 4CJKA 1RT6A 4JS5A 1L3VA 2YNIA 4KRFA 1QSSA 1RTDA 1T7PA 2R7YA 1XI1A 4FJLA 1UA1A 1D9DA 1YTAA 3NF7A 2OYQA 4OGCA 3V81A 3QETA 1FXXA 5CZ2A 3U3GA 3JYTA 4BE2A 1NJZA 1NK9A 2HVIA 1RTJA 4AHUA 1WAFA 3LZIA 1B9DA 5HROA 4BE0A 3PY8A 4MFBA 3TAMA 4ELUA 2GUIA 1TK5A 2Y1IA 4O44A 4B8AB 4IG0A 3KTQA 4CIEA 1ZBUA 3F73A 2HNDA 2D0BA 3LP3A 4NCAA 2OZMA 2P5OA 2E4LA 2FBXA 4CESA 4FJGA 4DU3A 4CJWA 1TKZA 3HO1A 2VG6A 5CYMA 3AVBA 3SJJA 4F3OA 1RILA 2FBYA 4OVLA 2OPRA 4RW7A 4CHNA 3NF6A 3VQ8A 1EETA 4RW9A
chains in the Genus database with same CATH superfamily
4Z4HA 4RW4A 3ZSZA 4J8FA 3MXIA 5ADXH 1JL1A 3D2EA 3HVTA 4CZJA 3ZT0A 5C15A 4FLTA 3LM2A 3HRGA 5M1QA 2YV0X 3RMCA 1FW6A 1VSIA 2QW9A 4LF4K 3VQEA 1ATSA 3ATVA 4CGJA 2XY7A 1L3UA 4KPYA 4OKJA 1LAVA 1HLUA 1W7AA 4IFEA 3WNEA 3K59A 3BEXA 3OYCA 1WSJA 1VRTA 4NLBA 4BVPA 1IBKK 3OJUA 1U49A 3AAPA 3K5MA 3FFIA 1NGCA 3D7EO 4W5QA 2GX9A 5AQYA 4ZTJA 3ZSRA 1ITGA 4JK9A 2GV9A 3ZEUA 1UA0A 4B08A 3AA2A 3AVHA 3MK6A 1KVCA 4Y0WA 3J81O 3DYAA 2YHXA 2PZSA 3TPQA 1UAXA 4B3TK 3CXCM 4OPAA 3MX5A 4DFPA 1WBBA 4CBXA 3THYA 4H4OA 3H08A 2E2NA 1YI2N 3F2KA 4I6MB 4N5SA 2NRHA 1QQOA 5BN8A 1ATNA 3K9KA 3MN5A 2VG7A 1J54A 1RCHA 4M3RA 4U67L 4DFKA 3VEWA 3N4QA 1QZ6A 3SK3A 5C25A 4WFAL 2XHBA 2VGNA 1Q8IA 3BZCA 3SV3A 5A2QO 3QICA 5ADXA 1TKTA 2XY5A 3AY9A 2ZJPL 2QWOA 4LY7A 3DRRA 4CD1A 3SI6A 4ISFA 3AVLA 2CH5A 3VF6A 4CK3A 3TANA 1Z25A 1Q81O 3DJCA 1LWCA 3DOKA 3NHGA 1XMOK 4WQ5A 4DS4A 3SAGA 3CD6N 3E1YA 4DV6K 4DTJA 3NGYA 2W6LA 3NF8A 4GY2B 4IWVA 3PV8A 1B9FA 4RCHA 5AQIA 4GV9A 1HUXA 4JD2A 2PYJA 2YNFA 4E19A 4Z4CA 3L2UA 1NU0A 4BRMA 1QTMA 4CIGA 3L2WA 4W5OA 4CCHA 3JAMO 3IUCA 4DQSA 1HQEA 2E20A 3QFPA 1VSEA 3T3FA 1C1BA 5KQ8A 3R8EA 3LP1A 4H5RA 4XEIA 1LW2A 1LCUA 3K5LA 5ELZA 1RTIA 4PQUA 1KVAA 1S1UA 5C12A 2UUAK 2F9TA 1BA1A 2KFNA 1BL3A 2Q2RA 1NG9A 1FKOA 4FVMA 3UKRA 1WSIA 5AQVA 4OPJA 1NK8A 3THXA 4Z4GA 3EE8A 5JLFA 2UXDK 4WQ4C 4DQPA 4PY5A 2P1JA 4W5NA 4CFCA 3HJFA 2W42A 2QWNA 1DTQA 4KH4A 3LANA 3OYMA 2WFBA 5AQLA 4BR5A 1E4FT 4IJNA 4QS9A 3OJSA 3TAEA 4JRPA 1VSFA 3TI0A 2IIRA 2P9PA 3LDNA 2ASOA 3QIPA 4O55A 3RR7A 1HJRA 4F3TA 4JKGB 5HRNA 2YHBA 1CXQA 5AQSA 1KFDA 3J7ZO 3KK1A 3GE1A 1NNEA 3QINA 4HCCA 1VHXA 1ZYQA 2X6NA 5K14A 4BGBA 1U04A 4DTSA 3SQ4A 4CJLA 1X9MA 3WNGA 5AZJB 3H1VX 1BUPA 1JLAA 3PSIA 3VEVA 4BDZA 1V4SA 3VQPA 2ZGYA 2P9LA 3SQ2A 5KPZA 1BDGA 4H0VB 3QDKA 3TAGA 1U2VB 3QERA 1VQKN 1EWRA 4JKDA 1QHAA 2E6MA 3H3OB 4KH6A 5GAGP 3NVKA 4CHZA 4FO0A 3SAHA 1YJNN 4DR4K 2CH6A 2KW4A 2IAJA 1KAZA 4CJEA 4RTFD 4HUEA 4E7KA 5EXWA 1GLBG 2BUPA 5EY4A 4R79A 1ASVA 3IDHA 3VQ6A 1R0AA 4H8KA 5HLFA 4WQ4A 3BGRA 3OYNA 3LWLA 4AQYK 1N6QA 1RNHA 4IXCA 1XUPO 3T7ZA 1HYSA 3V1QA 3V1OA 3CFPA 4B1ZA 3CCJN 3SMPA 1HQUA 3O08A 3WEEA 4DUYK 3CCVN 3C7NB 5M1NA 1N36K 3HM8A 5CYQA 4ELTA 5C42A 4C1NI 2Y1JA 4CF2A 4FWQA 3V9SA 3NF9A 2F4VK 1VQON 3NBPA 1NBWA 3CYMA 1TL3A 4FJ5A 3CJ9A 1QZ5A 4KTZA 2OANA 4OKKA 1VQ5N 3E01A 1A5XA 4EAHD 4O8UA 5JS2A 1U6ZA 2W40A 4FJ8A 3V6DA 2Q36A 3MCPA 3R3LA 1NWKA 4GVMA 4OJRA 5AQHA 5MLCQ 4FLXA 5GIOA 3P1GA 4IFVA 4N41A 2ETJA 2A5XA 3G6EN 3AVCA 2EX3A 4NXMK 2E88A 3HBTA 2ASMA 1RT1A 4FLWA 4N76A 4IG3A 1WOQA 3BF1A 3VQ9A 3L4IA 1IG9A 4F2RA 3QEWA 3DXKA 3OHRA 2BH1A 2QI2A 3OYKA 1K9MO 2YNHA 4HWIA 5JMVA 4JHDB 3CJCA 3AO2A 3N4PA 4OGEA 4JKEA 4XH5A 3DI6A 2Q0RA 3VEOA 2HHUA 3VQBA 4I7FA 2DTUA 4BRKA 2F96A 3RTVA 1JLCA 2HOEA 4I9LA 3CQYA 1HNZK 1JCFA 3CC2N 5KPTA 1TVRA 3SCXA 2B6AA 5LY3A 1TAQA 1SUQA 1A5WA 1CZ9A 4FK0A 4E0DA 3TTCA 4YY3K 5KTQA 2D0AA 1YTUA 4A62A 3MWPA 1HJOA 3WXKA 1Q9XA 3CETA 2G8VA 4FJ9A 1NK7A 5KI6A 1HPMA 4GMJB 3O4WA 3OYDA 3D2FA 3EZ5A 2G8IA 2XRIA 3KVGA 4DR7K 2GUPA 4F2SA 4M3ZA 3TABA 3LZJA 1C1AA 4PKIA 1U4BA 3ITHA 3EZWA 4H0XB 3S41A 1RT6A 1L3VA 1QSSA 4A57A 3RSEB 1YJWN 2R7YA 4KBOA 2QTDA 1D9DA 5HL7L 4BC2A 2OYQA 3CERA 3QETA 1FXXA 3JYTA 4BE2A 1NK9A 2HVIA 4LFAK 5HROA 1WAFA 3MWTA 4BE0A 3PY8A 3A5NC 2O8EA 3VEZA 2YHYA 3UKUB 3F73A 1N8RO 2HNDA 3LP3A 4PL7A 2E4LA 3ULEA 4FJGA 2V51B 3AGKA 2VG6A 3AVBA 4NXNK 1NGBA 1SAZA 3TTDA 3O9RA 3SLCA 3J80O 2HHWA 3F9MA 3SBGA 2VG5A 2ZWHA 2Q31A 4FJKA 1QS4A 5AQJA 4J2BA 2ZF5O 4FZXC 1TGOA 1YVNA 4HUFA 1NOYA 3VGLA 1S1TA 1V4TA 2HB5A 3CCQN 5JLHA 1J5EK 4BC3A 3T1HK 3SUPA 3LM9A 3THWB 2D5RA 5HBMA 4LF8K 1W97L 4FVUA 3UB5A 2J4RA 4GW6A 2I7NA 3G25A 3A5OC 3V9XA 1M90O 1HX1A 4XH4A 3DLKA 2FSNA 4Y1CA 4FM0A 4AILC 4MDBA 5J1EA 4B1WB 1IH7A 3SYZA 1JXEA 2BGGA 3ZETB 2E1YA 5AZIA 5BREA 3RMAA 1SKWA 2A40A 2G8KA 4KI4A 1WUAA 4BWMA 4JRQA 5BPNA 3T1YK 3ATUA 4DHYA 1VSDA 4EP5A 4AHVA 2RHKA 2UYTA 4I2PA 2G8HA 1NGIA 1L3SA 3C95A 3VQDA 1ESVA 3QEIA 2I7PA 3V9UA 1GLJO 4R5PA 1NK6A 2GWJA 3JXUA 4CK2A 3OY9A 2HNYA 5I3UA 5FPNA 4CZFA 3QEVA 5HRRA 1D4XA 4DTNA 3CCEN 4M41A 1X3MA 3FGUA 4JI4K 4FM2A 3Q7CA 3J7AP 1K8AO 3MXJA 3HM9A 4CK1A 1VQ8N 3WXIA 5AQMA 4UY8O 1JKHA 3M8RA 4DTOA 1ATRA 4X64K 1T03A 1EX4A 4BRQA 4OLAA 1VQ6N 2D0OA 2NRTA 5FDLA 3ULDA 3VERA 2P9NB 3H3NO 2CGKA 3ZX3A 2KQ2A 4B1UB 4DU1A 4YORA 1C0GA 3T1AA 1Y64A 5FLXO 2RE2A 2NRVA 3PX0A 4OKEA 1T6DA 1TYQA 1OH5A 3ZSVA 1TK8A 4IFYA 4CZGA 3LDSA 4FZZA 1DT9A 4JK7A 3KKRA 4Q0BA 2EWSA 4GVEA 2HHTA 1I94K 4Z4EA 3P31A 4BR0A 2NZTA 5DM6L 1X9JA 4DS5A 1HNVA 3O9UA 4JEPA 4X66K 1TV6A 5F0XA 4O8KA 1ZBIA 1GLEG 2AA4A 1NGJA 4K43A 5GADP 4E1NA 4DTPA 1ASUA 5J2PA 1CXUA 1TKDA 1LWFA 1NKCA 4H5VA 5BR9A 3CCUN 3ID8A 3R1XA 1S3XA 5AFUH 3EKUA 1RBUA 2O8DB 3PX6A 2PFUA 3D45A 3BY5A 5FPEA 3ZT3A 1JJ2M 1NK0A 4JI5K 2YKMA 2OPQA 3PSFA 5E41A 1DEJA 5TKWA 2HHXA 1WSEA 4LFCK 2DPNA 4JYAK 4IDHA 5SZTA 4FJ7A 3LDPA 4AHTA 1T44A 4E7JA 4B9MA 3QO9A 1BOTO 2YCHA 4H0YB 1WAJA 4BRAA 2ZE2A 3V9ZA 1KLNA 3KKSA 4KHNA 4HTUA 2ATQA 3MEGA 4B9SA 1K73O 4N47A 3WT0A 1GLDG 3ALYA 1NGAA 5CE3A 3S3MA 3O4QA 4CBWA 3ZT1A 3M5RA 4WQ5C 3OYJA 4B3MK 3SAFA 3K5OA 4JLHA 3CG7A 2IGIA 4K25A 2VWJA 1IKXA 3B6PA 2HF3A 2IS3A 3M8PA 3HZ6A 1LV5A 3VESA 3KLEA 4DSKA 4YOWA 3U3YA 4CEOA 1YJ9N 2YI1A 2A6AA 4FPBA 3HPHA 4X62K 4ILHA 4DG1A 4A61A 4LF9K 4DB3A 4AHRA 4EP4A 3NH1A 2HBLA 3OYBA 1IBMK 5LJWA 4KFBA 3KLFA 2YJEA 1GLFO 4NO7A 3NVMA 3E9PA 5E84A 1QVFM 2O4GA 4A5AA 3D2EB 2QWMA 1BIZA 4WF9L 2Z1GA 3A5MC 3NDKA 1HNIA 3ZX0A 3MXMA 5AFUA 3AVGA 2P9UA 4O0JA 4ILGB 4DR5K 4CJUA 1WBDA 1Z05A 3KHYA 3FLCO 1RT7A 1DLOA 3ZCMA 3LDQA 3QB0A 4FW2A 3TR8A 4HHTA 4OPKA 5AQNA 4FWRA 2YKNA 2O8FA 3VA3A 4KHYA 4FWNA 4IKFA 2OA8A 4JKCA 2FXUA 3OYAA 3DLGA 4FL9A 4DF8A 3ZEUB 2ZM6K 3BP8A 1VSKA 1KXPA 2V7YA 3NAEA 4DUZK 4YFUA 3M8QA 1NGEA 3HSCA 1WLJA 5CY4A 1Q9YA 1J5OA 3DLLL 4KO0A 4CBUA 3OYIA 4DR3K 3EYZA 4CI6A 4CERA 1QE1A 3VQ4A 1ZBLA 3I0RA 1S5JA 2X74A 3F5TA 1WSFA 1RGIA 1S22A 2DFEA 2ZJRL 1MU2A 4EHTA 2WOMA 1T8EA 3THYB 3B8AX 4BE1A 4F8RA 4M3YA 3U9ZA 1DKGD 4CEBA 5KGXA 4KREA 3A0IX 2KKZA 4B3OA 4PWDA 2YJFA 2DFHA 3HOSA 1S6PA 1N5YA 1TKXA 3S3OA 2D0PA 3ASMA 5AQQA 2Z1JA 4JI0K 4DQRA 1EKEA 2GEMA 2XY6A 1YF5L 3MECA 4PHTX 1K8KA 3OYFA 1ZBFA 2HHQA 3SZ2A 3M3ZA 3QNOA 4B9LA 4E1MA 4AHSA 3VTIA 2V7ZA 5C24A 4KKOA 4DV1K 3IRXA 1YVUA 1EP4A 3VEXA 3DLBA 4BWJA 1BI4A 3HYFA 3LAKA 3M6GA 2YX6A 4JD2B 4BROA 4BRFA 3AA3A 1BQMA 5KGWA 1NGGA 1NOZA 4M3WA 1HYZA 1R59O 5JICA 4ZHRA 4CF1A 1VSJA 1BQNA 4OO1J 1SL2A 1I39A 3PIOL 4F9OA 1HRHA 1EQYA 4CGGA 3TAQA 1SKRA 3FZKA 4BG8A 3RVCA 3U4LA 4M63C 2HHHK 3DXMA 1WSHA 5I9EB 3NCIA 2KTQA 3ZT4A 3RMBA 2UXCK 3UKRB 1IO2A 3T19A 4E7IA 3OS1A 3THXB 4JS4A 1H1VA 1BG3A 3I8DA 4M7XA 3HI0A 3J8AA 1J6ZA 3BUZB 2I5JA 1RDDA 4DSJA 4DF4A 2ZD1A 4IOXA 3FZFA 4Y1DA 3KK2A 1O13A 1BISA 2HW3A 1YAGA 1C0MA 3AO4A 4YDUC 4LH5A 4JNEA 4CJ4A 2P9PB 4CJ5A 1DTTA 4BRLA 4CJKA 4JI2K 3CCLN 1T7PA 1XI1A 3GDQA 5GINA 4FJLA 1UA1A 1SZ2A 4OGCA 5CZ2A 4MDAA 4AHUA 3JS6A 3KK7A 1B9DA 4JKAA 4ELUA 4MFBA 3TAMA 2GUIA 4IEIA 1TK5A 2Y1IA 4IG0A 1ZBUA 3O9SA 5GIPA 4DU3A 1TKZA 3HO1A 2P9LB 3SJJA 4RW7A 2FBYA 5JVHL 2WUSA 1JXBA 3TSUA 2QWPA 3DRSA 1RT2A 3E66A 4FXDA 5AQFA 1XNRK 4KHUA 3BZKA 5M1OA 4CGDA 1TUYA 1KRPA 3I33A 3VQQA 2ZJQL 4FWSA 2AP1A 3FFKB 1L5UA 3IG1A 3ENBA 4FWKA 1T6CA 2Z1HA 3ID6A 4WE1A 3MN6A 1JLFA 3HSTB 2QKKA 2KHOA 4C8KA 2H3GX 3EE9A 2BE2A 1BCOA 2P9IA 4PA1A 1IG8A 1I3AA 3AVNA 4DQ8A 4L8RB 3C94A 4GNIA 1Q82O 2IVOA 4NB4A 3Q7BA 3QIOA 1O1WA 1IKVA 2QWRA 3VENA 4CEEA 1NMDA 3OYLA 3P83D 1VSHA 4YDUA 5C0YA 1X1PA 3VF2A 4FCYA 2KZZA 2IDOA 5BRFA 1ASWA 3FZHA 2CGJA 3NE6A 3HPGA 4A2BA 1IKWA 3HP6A 3AVMA 3BDPA 3E9OA 3SMSA 3SNNA 4B9UA 3OYEA 4FW1A 1VQNN 4CJFA 3RSEA 4CHQA 3CJBA 3WXJA 2AJQA 3DLEA 1NGFA 3WNHA 4DTRA 1N32K 4H5TA 1WSGA 4A59A 2JWLA 5HP1A 4AM6A 3P38A 3THVA 3CJ1A 1X9SA 1YUWA 3RMDA 3DLHA 4H0OA 5LMUK 3I8BA 3EO3A 2G8WA 3VETA 3HXMA 3AA5X 3P39A 2QM1A 3SV4A 1REVA 2YHAA 4H5NA 4Q5VA 3O3HA 1NK5A 4ILJA 1BA0A 4B9QA 3U6FA 4AHCA 3ZSWA 1Y97A 2HVHA 5CR4A 5EU7A 3RR8A 4CJSA 4CZIA 2NNWA 3AVFA 3VTHA 4FSVA 4CF9A 4CVNE 3HPOA 4H0PA 3G0ZA 3DXKB 3FZLA 4N56A 3PIPL 4DV3K 4QAGA 3M8SA 1MDUB 3WNFA 4ZTFA 2P9KA 1ZXOA 2LSNA 3H6EA 3KLIA 2E2QA 4XIUA 4YOUA 1KCFA 4BQZA 4DWIA 1BWFO 3T69A 4LSLA 5I42A 1NMNA 3U8XA 2HHSA 4FJMA 1VAZA 2QA4N 1SKSA 2X6SA 3TTFA 1HMVA 3SBTA 1SL1A 3IMXA 1NKBA 1EWQA 5FROA 1QSYA 1CZAN 2UUBK 4QOZB 4OX9K 4BRCA 4B9NA 4LH4A 1HYVA 4AF1A 1IJJA 4NLCA 4CGFA 2O8BB 3TAFA 3HVRA 4I9QA 3U9DA 4KAZA 1GLCG 2WONA 3QLHA 3UE5A 3KLHA 3CCSN 4X65K 1RDUA 4LD0A 4EHUA 3D2FB 1S1WA 3CJ7A 3LP2A 1QVGM 4CJPA 5AQRA 1NKEA 1N34K 4B3RK 1VQ7N 3DM2A 2JLEA 3HP9A 4M42A 1VQ4N 2DY4A 1XWLA 1SQKA 3B6OA 5AQKA 5AQPA 3CIPA 4B9VA 3TAPA 3IFRA 1Z6RA 1S9GA 3C6UA 1NJWA 4HUGA 4FJNA 3MEDA 5M1PA 4WCEL 2O8EB 1Z26A 3VPZA 4M7YA 3ULEB 1GLAG 4PL8A 3GL1A 4DR6K 4A5BA 2XY8A 4E1JA 4F4KA 4PKGA 1QQCA 3SPYA 2GBZA 4LF6K 1HNXK 3QNNA 3RRHA 5GAHP 2VWKA 4CJVA 5SWMA 1ILYA 3K9JA 2P51A 3AO1A 3O80A 3MX2A 1OVQA 2HNZA 2O8DA 3M1FA 5FPDA 5LL6Z 3QBXA 1VK0A 4DU4A 1K6YA 3O3FA 1KQSM 3MN9A 4JV5K 2W6KA 4FWPA 1HR0K 3A8YA 4NYNA 3MMVA 1RDAA 3L0QA 4FYDA 1L3TA 1XHXA 3QESA 3ZLJA 3C6TA 3UIQA 3K58A 3CJAA 3MAQA 3P4IA 4G9ZA 3O6WA 4WFBL 5AZIB 4HCBA 3RRGA 4H4MA 4UQGA 2CGLA 5FRNA 1NGHA 1C6VA 4NYFA 3LWMA 1MWKA 1LWEA 3SUNA 4JI3K 1RT4A 1OH7A 1TL1A 4E89A 1S1XA 1GOCA 4MLEA 3OYGA 1HPZA 5AQXA 3VGKA 3HOTA 1U45A 5TKYA 2O8CB 2Z1IA 2VYPA 5BPMA 3QEXA 3L4QA 4QS8A 2BDPA 4EFHA 3AVAA 3OBYA 4ICLA 3H1QA 1QSLA 4JI7K 4PUOA 1JLBA 2FF3B 4B9TA 1ZC6A 3VN5A 4IBNA 5M1FA 2DFFA 3MCAB 4B8CA 2KLAA 1KC8O 1F21A 3CHWA 4DCHA 2PY5A 2X78A 2BANA 4HTLA 2VCPA 2QK9A 1KTQA 4DFJA 2HHVA 5EX5A 4O4GA 3K2PA 1GOBA 3G71N 1IKYA 1TYQB 4BQLA 4CHPA 4I6MA 5CZ1A 5AJ3K 1OH8A 3NFAA 4O5FA 5C2DA 1BHLA 3SJHA 1HNWK 3EY1A 3VQ5A 2IVNA 3H46O 4EZ6A 2P9SB 4CFAA 1XQSC 1RDBA 3VQCA 1BCMA 1QQNA 4YNQA 2VQEK 1GOAA 5BRDA 5J2MA 5LMNK 1NJYA 4FWLA 1NJIO 4BRDA 3R6MA 1S72N 3VF4A 3OBWA 4DQQA 4DR2K 2Q3SA 2XO7A 4FLZA 5B8HA 1RBTA 4CF0A 3SQ1A 3LP0A 3V9WA 4FPAA 2UUCK 1LW0A 2NRWA 1NGDA 1JLEA 4ISGA 3E9LA 3K57A 2JWKA 4IO8A 4B1XB 4W5RA 2OPPA 1Q7YO 2FSKA 2OTJN 4CZMA 2E5LK 1D8YA 2E2OA 3PLAA 4FZYA 1E3MA 4BR2A 3V4IA 4LF7K 5F2RA 2WTUA 4FOEA 4KH5A 1TK0A 4JI1K 4BRGA 2A1RA 5AQZA 4CGIA 4GKJK 3PO4A 1JLGA 5BRHA 2VWBA 2QEXN 4DTMA 3OA9A 3AVKA 5H1SQ 4RG8A 3L2RA 1C1CA 1A5VA 1VQLN 3I0SA 1S6QA 4C1NK 3FR0A 5AQTA 4E3SA 3AO5A 3CMAN 4RWTA 3VOVA 3LPUA 1KVBA 5AQWA 5KRSA 2F7TA 3C6AA 1KD1O 1XC3A 4BRPA 4KTWA 3KK3A 4JS5A 3LDOA 3LL3A 2YNIA 4KRFA 2HBKA 3TSPA 1YTAA 1KAXA 4BRNA 1NJZA 4DV4K 4O44A 4PKHA 4JKGA 4NCAA 4LC9B 3WQUA 2P5OA 2FBXA 4CESA 5CHIA 2OZMA 4CJWA 1P90A 4IZ9A 4OVLA 2OPRA 4V19S 1EETA 2P9UB 3GBTA 4MO5A 3MEEA 1XMQK 5AZJA 2RPIA 3H45C 4L3QA 3MDQA 3R9PA 5DMRA 4KHPK 4AH9A 4JI8K 4CJ3A 1RFQA 4DR1K 2O8FB 2OPSA 1EXQA 3LALA 3CFOA 1U2VA 4CW7B 3CQ8A 2UU9K 1P8ZA 1NLVA 1JCGA 1FKPA 4C8LA 3KZBA 4Z0UA 2A3ZA 4CJTA 3DRPA 4ID5A 4RW6A 3L2QA 1J53A 3VQAA 2YHWA 1JL2A 3VGMA 3HK2A 1B92A 3GG4A 1D9FA 2D0CA 3VQ7A 3KIOA 3CC4N 4CJQA 3CI5A 4LF5K 4DSLA 2JGUA 3L6QA 5HRSA 2QKBA 3ISNC 5EOYA 1RT5A 2D4WA 3I56N 2FC0A 1EO1A 4Z94A 1VSMA 1J9AA 3D6RA 4C8MA 3O3GA 4M3UA 4CEQA 3PUFA 4CEAA 1X9WA 2E6LA 3C7NA 3AV9A 3ZX2A 5AQGA 2NRRA 3K0SA 4DQIA 3IKMA 4LSNA 4DKWA 2HMPA 2PAVA 2Q1NA 1T3VA 3O1WA 3AAQA 5C2FA 3K5NA 3OS2A 2FLOA 2RF2A 4B1VA 2ITMA 1K8KB 1T05A 1NM1A 1GLLO 2ASPA 4CZKA 4DFMA 1LAWA 4J2EA 4FK2A 3TARA 2NLXA 4HVJA 1UWBA 1RTHA 2HF4A 4FJXA 4CJRA 1TAUA 2UXBK 4BC4A 3ZYYX 3G4SN 3ZSXA 4BGAA 4BG9A 4U7BA 3VEYA 1Q86O 3CQXA 3S9HA 4FK4A 3DLRA 5EVZA 4I2QA 1BI4B 2FSJA 5BR8K 4FM1A 3CCRN 1XC9A 1JLQA 3WXMB 1C0UA 5BN9A 4DLEA 3OW2M 3W3DA 4DSFA 1NK4A 3CFRA 4KB0A 2GWKA 2BTFA 4KHQA 2G8FA 2KZMA 4KI6A 4BREA 3NMUA 2RKIA 4JAXA 2G8UA 4DSIA 3QFUA 2E2PA 3OYHA 3NGZA 4JHDA 1WN7A 3AARA 4B1YB 5AQUA 1ZBSA 2IC3A 1CLQA 3DMJA 3DXMB 2NUBA 4CEZA 3OS0A 3ENOA 3SUQA 3IAYA 1FK9A 4M45A 4O0IA 4BDYA 4WYBA 3ENHA 5DK5A 4CGHA 4Z4IA 2GTDA 4TSXA 3AA4A 2KFZA 3NH0A 2IVPA 2PBDA 4YOYA 3SPZA 3SQ0A 4C23A 3S3NA 1WB9A 3TWHA 4GV3A 3MN7A 5T7BA 4W5TA 3TSQA 1D5AA 3AVIA 4DV2K 2F9WA 4JKHA 2GELA 4IO9L 5HOOA 4GKKK 1VSLA 2W41A 3CM5A 1KSPA 3C6HA 3WEEB 3KD1E 1W2BM 5KQDA 3AVJA 4CECA 3CF5L 2PYLA 2FBVA 1HKBA 3TU5A 5BPLA 4BR9A 5J2NA 1VQMN 5M1KA 4YOTA 1CZBA 1TUUA 2IOCA 5KRTA 3VA0A 5F1XA 1YT3A 3I55N 1MA9B 1YIJN 1YITN 4IJAA 5FRMA 3ZSOA 3DWLA 4DTUA 3C65A 3L2VA 1RDCA 4FJJA 4J2AA 4ELVA 3WXLA 5JVGL 4RW8A 1S1VA 1RBVA 4MO4A 3ZSYA 3QEPA 1YHQN 3NH2A 4EIAA 2F8SA 1BO5O 4YOVA 3UKUA 3V1RA 5AR0A 5LJVA 4K8ZA 4M3TA 1OVYA 4CEDA 5KPRA 4OLBA 1G99A 3PX4A 4BR7A 5AQOA 4DV0K 4BRIA 3O5BA 1DGKN 4KTQA 2P9IB 2HBMA 4BRHA 3KJVA 4CZHA 1KLMA 4FLUA 1VRUA 3PO5A 2A1SA 3WQTA 4ID1A 2NRZA 3EL2A 4JKBA 2O8BA 4IEEA 3QMLA 3L3UA 3THWA 4J2DA 4A2AA 4MLHA 2HMIA 2OZSA 3RWUA 3CM6A 3DAWA 3VMFB 2FF6A 3CCMN 2QWLA 4O5BA 2ZGZA 4K41A 1RDWX 5FPMA 3JSMA 3ZETA 4GV6A 2QXLA 3FE1A 1BGXT 2QXFA 4KV8A 1XHZA 4FJHA 3D0PA 4FJIA 1RBSA 3LPTA 3OTOK 3L3VA 1U47A 1WNSA 4JKFA 2WC9A 1UOCA 1VQPN 4DMNA 5C10A 3LDLA 3EN9A 3W0LA 2HBJA 1S9EA 3IS9A 1LOTB 5D3GA 2B5JA 4EZ9A 1FJGK 4BR4A 4H5WA 3A2FA 1KFSA 4Z4FA 4KHSA 1ZBHA 1MWMA 3O9QA 4CFBA 3O1BA 4E7HA 4FLYA 2P5GA 1JCEA 4G1QA 3FZMA 2A42A 2QWQA 2Q97A 4YHHK 4DV7K 3CC7N 1QQMA 4IDKA 1C0FA 4CFDA 4XH1A 1U48A 4KHWA 2EHGA 1RT3A 2VQFK 1RBRA 3EEQA 1Q18A 1C0TA 2P9NA 2OCEA 3LAMA 3OVNA 5E26A 3G10A 3QBWA 4CEFA 3EKSA 5HRPA 3KWIA 1N33K 3O8MA 1IBLK 4CZLA 3F9KA 3HTVA 4C8OA 3DOLA 3P5JA 2ITGA 4K0KK 3O4NA 2P9KB 2OTLN 3KD5E 4IOAL 2V52B 3HT3A 1E4GT 4BVOA 4FWMA 3WUHA 1QHTA 3ZSQA 4CHYA 3HL8A 1IV0A 4JI6K 4BY9C 4FLVA 3CMEN 4K8XA 3A5LC 5JS1A 2YNGA 2F8TA 2RN2A 3O9TA 1XNQK 4CHOA 3L8BA 3BF3A 4QS7A 4JN4A 3KLGA 1KAYA 4DV5K 4CF8A 1SV5A 4H0TB 3J7YP 5J2QA 4M3XA 1W0HA 2O8CA 3AO3A 4C8NA 1W9HA 4BACA 4DTXA 2D1KA 4QCLA 1YXQA 4NCGA 4CIFA 1X3NA 2FBTA 4KB1A 2ZQBA 1HKCA 4BDPA 1NJXA 2HSTA 2NRXA 1G15A 4E7LA 2A41A 4JK8A 4NCBA 4WFNL 4FOIA 4FWOA 3CPEA 2Q0UA 2O4IA 4DLGA 1HKGA 2B4JA 2E8AA 4CE9A 3CPWM 3C0BA 1BIUA 3NGIA 3GOIA 3ZT2A 4DSEA 3KWGA 4BC5A 4CJ7A 5IT9O 3SUOA 1SL0A 4OPHA 4LFBK 4MQ3A 1VQ9N 2P9SA 4IOCL 2E1ZA 3AGRA 4CD3A 5GAEP 1RTDA 1OH6A 4ISEA 3NF7A 3V81A 3U3GA 1SS6A 1RTJA 3LZIA 1M1KO 1BU6O 5DM7L 2VGMA 4B8AB 3KTQA 4CIEA 2D0BA 4H03B 4B3SK 1OKJA 4YOXA 4K42A 5CYMA 2WBNA 5IWAK 4F3OA 1RILA 4CZEA 4CHNA 4AM7A 3NF6A 3VQ8A 4RW9A
chains in the Genus database with same CATH topology
1JXBA 4Z4HA 4RW4A 2HHWA 2VG5A 3DRSA 3ZSZA 1RT2A 4FJKA 1QS4A 3MEEA 4FXDA 3MXIA 4J2BA 1JL1A 2RPIA 3HVTA 1TGOA 3ZT0A 4FZXC 4KHUA 4CGDA 1KRPA 3VQQA 4HUFA 4FLTA 1NOYA 5DMRA 1S1TA 2HB5A 4AH9A 1L5UA 3IG1A 4CJ3A 2YV0X 3RMCA 2OPSA 3SUPA 1VSIA 1EXQA 2Z1HA 3LALA 2D5RA 5HBMA 3VQEA 3CFOA 4WE1A 4CGJA 2XY7A 3CQ8A 1JLFA 3HSTB 2QKKA 1L3UA 4C8KA 4KPYA 4OKJA 1FKPA 1LAVA 4C8LA 2BE2A 1BCOA 4GW6A 4Z0UA 4CJTA 4PA1A 3WNEA 3V9XA 3K59A 3DLKA 3DRPA 4ID5A 3OYCA 1WSJA 4Y1CA 3AVNA 1I3AA 1VRTA 4RW6A 5J1EA 3L2QA 4FM0A 3OJUA 1J53A 4AILC 3VQAA 1IH7A 1JL2A 3SYZA 4L8RB 1JXEA 3C94A 2BGGA 3HK2A 1U49A 3K5MA 1B92A 3RMAA 1SKWA 3FFIA 2D0CA 3VQ7A 3KIOA 1D9FA 2G8KA 4CJQA 4KI4A 4W5QA 4BWMA 4JRQA 4ZTJA 3ZSRA 4DSLA 3QIOA 1ITGA 1IKVA 1O1WA 2JGUA 2GV9A 1VSDA 4CEEA 3P83D 4AHVA 4EP5A 5HRSA 1VSHA 3OYLA 2QKBA 1UA0A 4B08A 3AA2A 3AVHA 3ISNC 1X1PA 4FCYA 1KVCA 2KZZA 1RT5A 4I2PA 2G8HA 2IDOA 2FC0A 1ASWA 1L3SA 3DYAA 1VSMA 3NE6A 3HPGA 1J9AA 3C95A 2PZSA 3VQDA 1IKWA 3QEIA 4C8MA 3HP6A 3V9UA 4R5PA 3O3GA 4M3UA 4CEQA 3AVMA 3BDPA 3PUFA 3SNNA 4CEAA 1NK6A 4B9UA 1X9WA 1UAXA 2E6LA 4CK2A 3OY9A 4FW1A 3OYEA 2HNYA 4CJFA 5I3UA 4CHQA 3QEVA 5HRRA 4DTNA 3AV9A 2AJQA 3DLEA 4M41A 4FM2A 4DQIA 4LSNA 3WNHA 4DTRA 4DFPA 3MXJA 3HM9A 1WSGA 4CK1A 5HP1A 4H4OA 3H08A 1JKHA 3M8RA 3K5NA 4DTOA 3OS2A 3THVA 1X9SA 4N5SA 1T03A 2RF2A 1EX4A 3RMDA 3DLHA 4OLAA 2G8WA 5FDLA 3ULDA 1T05A 3HXMA 2VG7A 1J54A 1LAWA 3AA5X 4DFMA 4J2EA 2KQ2A 3TARA 4FK2A 1RCHA 4M3RA 3SV4A 4DFKA 4DU1A 3T1AA 1REVA 1UWBA 1RTHA 2YHAA 4HVJA 4Q5VA 3O3HA 1NK5A 3PX0A 4OKEA 3U6FA 4FJXA 4CJRA 1TAUA 4AHCA 3ZSWA 3ZSVA 5C25A 3ZSXA 1Y97A 4IFYA 3LDSA 1TK8A 2XHBA 4FZZA 2HVHA 3KKRA 4Q0BA 5EU7A 3S9HA 3RR8A 1Q8IA 3SV3A 4CJSA 4FK4A 2HHTA 3DLRA 1TKTA 3AVFA 4I2QA 2XY5A 1BI4B 4CF9A 3HPOA 4Z4EA 4FM1A 3G0ZA 4N56A 1XC9A 1JLQA 4LY7A 3DRRA 4DS5A 3SI6A 1C0UA 1HNVA 3AVLA 4DLEA 3TANA 4CK3A 1TV6A 1Z25A 4QAGA 4DSFA 3M8SA 1NK4A 1ZBIA 1LWCA 3DOKA 3NHGA 4E1NA 3CFRA 4DS4A 4DTPA 1ASUA 4KB0A 5J2PA 3WNFA 4ZTFA 1CXUA 1TKDA 2G8FA 4KHQA 4DTJA 1LWFA 3NGYA 1NKCA 3NF8A 2KZMA 3PV8A 1B9FA 4KI6A 2LSNA 3KLIA 2RKIA 4XIUA 2G8UA 1KCFA 4DWIA 4DSIA 1RBUA 4LSLA 2YNFA 4E19A 4Z4CA 3L2UA 3D45A 3PX6A 5I42A 1QTMA 3OYHA 4CIGA 2HHSA 3NGZA 3L2WA 1WN7A 4W5OA 3ZT3A 4CCHA 1NK0A 4FJMA 2YKMA 1SKSA 4DQSA 2IC3A 1HQEA 2OPQA 2X6SA 5E41A 1HMVA 3DMJA 1SL1A 1CLQA 1VSEA 3T3FA 1NKBA 2NUBA 1C1BA 5FROA 2HHXA 3LP1A 4CEZA 1WSEA 3OS0A 3SUQA 1LW2A 1QSYA 3IAYA 4QOZB 1FK9A 4M45A 4O0IA 3K5LA 4B9NA 1RTIA 5SZTA 4LH4A 1KVAA 4BDYA 4PQUA 4FJ7A 1HYVA 5DK5A 4CGHA 4Z4IA 1S1UA 4AHTA 4TSXA 3AA4A 2KFZA 4CGFA 3TAFA 3NH0A 4E7JA 3HVRA 4B9MA 4I9QA 2KFNA 3QO9A 4KAZA 1BL3A 3SQ0A 3SPZA 3V9ZA 1WAJA 1KLNA 2WONA 2ZE2A 3QLHA 3KKSA 4KHNA 3KLHA 4HTUA 2ATQA 3MEGA 3S3NA 4LD0A 4B9SA 1FKOA 4FVMA 4N47A 1WSIA 1S1WA 3TWHA 4OPJA 3LP2A 3ALYA 5T7BA 1NK8A 4W5TA 2HHVA 4CJPA 1D5AA 3AVIA 4Z4GA 3S3MA 1NKEA 3O4QA 3ZT1A 3OYJA 3K5OA 1VSLA 4JLHA 3DM2A 2JLEA 3CG7A 3HP9A 4DQPA 3CM5A 1KSPA 2IGIA 2P1JA 4PY5A 2VWJA 1IKXA 4M42A 4W5NA 3B6PA 4CFCA 3KD1E 2IS3A 3M8PA 3HJFA 2DY4A 1XWLA 3B6OA 3AVJA 2W42A 1DTQA 1LV5A 3LANA 4CECA 3OYMA 3TAPA 4B9VA 2PYLA 3KLEA 4DSKA 2FBVA 3U3YA 3OJSA 4CEOA 3TAEA 4JRPA 1VSFA 3TI0A 1L3TA 5J2NA 1S9GA 3C6UA 3HPHA 1NJWA 4HUGA 4FJNA 1CZBA 2IOCA 3MEDA 5KRTA 4DG1A 3VA0A 1YT3A 3QIPA 4O55A 1Z26A 1HJRA 3RR7A 4F3TA 5HRNA 2YHBA 4AHRA 4EP4A 3NH1A 1CXQA 5FRMA 3ZSOA 1KFDA 3KK1A 3OYBA 4DTUA 3L2VA 1RDCA 4FJJA 4J2AA 2XY8A 3QINA 4HCCA 4ELVA 4KFBA 1ZYQA 4F4KA 2X6NA 4RW8A 1S1VA 3KLFA 1RBVA 1QQCA 5K14A 3SPYA 2GBZA 3ZSYA 1U04A 3QEPA 4DTSA 3SQ4A 4CJLA 3NH2A 1X9MA 3WNGA 2O4GA 3RRHA 3QNNA 2F8SA 2VWKA 4CJVA 5SWMA 1BIZA 1JLAA 3V1RA 4BDZA 2P51A 3AO1A 2Z1GA 3NDKA 1HNIA 3VQPA 2HNZA 4K8ZA 3SQ2A 2PYJA 4M3TA 4CEDA 3MXMA 3TAGA 1VK0A 3AVGA 4DU4A 4OLBA 1K6YA 3O3FA 4O0JA 3QERA 4CJUA 3PX4A 2E6MA 4NYNA 4CHZA 4KTQA 1RDAA 2KW4A 3KJVA 1KLMA 1RT7A 1XHXA 1DLOA 2IAJA 1VRUA 3ZCMA 4CJEA 3C6TA 3QESA 3PO5A 3UIQA 2A1SA 4FW2A 4ID1A 3TR8A 3K58A 4HUEA 4HHTA 4E7KA 4OPKA 4FYDA 3MAQA 2YKNA 3L3UA 3VA3A 4HCBA 4J2DA 1ASVA 4KHYA 4IKFA 2HMIA 3RRGA 4H4MA 4UQGA 2OZSA 2OA8A 3RWUA 3OYAA 3VQ6A 1R0AA 3DLGA 4DF8A 5FRNA 4H8KA 3CM6A 1C6VA 4NYFA 3LWMA 5HLFA 3BGRA 3OYNA 3LWLA 1N6QA 1LWEA 1RNHA 1VSKA 4O5BA 3NAEA 3SUNA 1RT4A 3V1QA 3V1OA 1HYSA 1TL1A 3JSMA 4E89A 3CFPA 4YFUA 1S1XA 3M8QA 1J5OA 1WLJA 1BGXT 1GOCA 2QXFA 4KV8A 5CY4A 1Q9YA 1HQUA 3OYGA 4KO0A 1XHZA 1HPZA 3D0PA 3OYIA 4FJHA 4FJIA 1RBSA 3EYZA 3LPTA 3L3VA 4CERA 1WNSA 1U45A 1QE1A 1U47A 2Z1IA 3VQ4A 3I0RA 1S5JA 1UOCA 2X74A 5CYQA 4DMNA 3QEXA 1ZBLA 4ELTA 1WSFA 5C42A 2BDPA 3AVAA 2DFEA 4ICLA 1QSLA 2Y1JA 1MU2A 1S9EA 3IS9A 4CF2A 4PUOA 5D3GA 2B5JA 2WOMA 1JLBA 1T8EA 3V9SA 4EZ9A 4B9TA 3NF9A 3VN5A 4BE1A 4F8RA 4IBNA 3NBPA 2DFFA 4M3YA 3A2FA 4CEBA 3CYMA 5KGXA 1KFSA 4KHSA 4Z4FA 4B8CA 1ZBHA 4CFBA 4KREA 1TL3A 4FJ5A 1F21A 4E7HA 4B3OA 4PWDA 4FLYA 2X78A 2BANA 4KTZA 2PY5A 2P5GA 2DFHA 2QK9A 4OKKA 4G1QA 1KTQA 4DFJA 1S6PA 3E01A 1A5XA 1TKXA 4O4GA 3S3OA 1N5YA 3ASMA 1GOBA 3K2PA 5JS2A 2Z1JA 4DQRA 1EKEA 1IKYA 4IDKA 2XY6A 4CHPA 5CZ1A 3MECA 4FJ8A 3NFAA 4CFDA 3V6DA 1BHLA 1U48A 4GVMA 2EHGA 3EY1A 4OJRA 3VQ5A 4FLXA 4KHWA 1RT3A 4FLUA 1RBRA 3OYFA 1C0TA 1ZBFA 3LAMA 3OVNA 3P1GA 4IFVA 4EZ6A 2HHQA 4N41A 2ETJA 3SZ2A 3G10A 4CEFA 3QNOA 4B9LA 4CFAA 5HRPA 4E1MA 3AVCA 2EX3A 1RDBA 3VQCA 1BCMA 4AHSA 3F9KA 5C24A 4KKOA 4YNQA 1GOAA 4C8OA 5J2MA 3IRXA 3DOLA 1NJYA 1YVUA 3P5JA 1RT1A 4FLWA 1EP4A 3DLBA 2ITGA 4N76A 3O4NA 4IG3A 3VQ9A 4DQQA 4BWJA 2Q3SA 2XO7A 1IG9A 4F2RA 4FLZA 1BI4A 3KD5E 3HT3A 3HYFA 3LAKA 3QEWA 1QHTA 3ZSQA 4CHYA 1RBTA 3HL8A 4CF0A 3SQ1A 3LP0A 3OYKA 3V9WA 2YNHA 1LW0A 4FLVA 3AA3A 3AO2A 1BQMA 1JLEA 1NOZA 5KGWA 4K8XA 5JS1A 4M3WA 4OGEA 1HYZA 3K57A 2YNGA 2F8TA 4W5RA 2OPPA 3DI6A 2RN2A 4ZHRA 4CF1A 1VSJA 2HHUA 1BQNA 1SL2A 1I39A 1D8YA 3VQBA 4CHOA 3L8BA 4I7FA 2DTUA 2F96A 1HRHA 3KLGA 3RTVA 4FZYA 1JLCA 4CF8A 4CGGA 3V4IA 4I9LA 1SV5A 5J2QA 3TAQA 1SKRA 4M3XA 1W0HA 3AO3A 4C8NA 1TK0A 1W9HA 4BACA 4DTXA 1TVRA 3NCIA 1WSHA 2A1RA 4CGIA 2KTQA 3ZT4A 4QCLA 3RMBA 3PO4A 3SCXA 2B6AA 1JLGA 1TAQA 1IO2A 4NCGA 1SUQA 3T19A 1A5WA 4CIFA 1CZ9A 3OS1A 4E7IA 4FK0A 4E0DA 2FBTA 4KB1A 2ZQBA 4JS4A 4DTMA 4BDPA 3I8DA 3AVKA 4RG8A 3L2RA 1NJXA 1G15A 1C1CA 5KTQA 1A5VA 4E7LA 2D0AA 4NCBA 1YTUA 2I5JA 1RDDA 4DSJA 3I0SA 1Q9XA 1S6QA 4DF4A 2ZD1A 2G8VA 4FJ9A 1NK7A 5KI6A 2O4IA 4DLGA 4Y1DA 4GMJB 4E3SA 2B4JA 3KK2A 4CE9A 3AO5A 3OYDA 3EZ5A 1BIUA 1BISA 3NGIA 3ZT2A 4DSEA 2G8IA 2XRIA 3LPUA 2HW3A 1C0MA 3AO4A 1KVBA 4F2SA 3SUOA 4LH5A 1SL0A 4CJ4A 5KRSA 4M3ZA 3TABA 4MQ3A 4CJ5A 3LZJA 1C1AA 1DTTA 4KTWA 1U4BA 3KK3A 3ITHA 4CJKA 1RT6A 4JS5A 1L3VA 2YNIA 4KRFA 1QSSA 1RTDA 1T7PA 2R7YA 1XI1A 4FJLA 1UA1A 1D9DA 1YTAA 3NF7A 2OYQA 4OGCA 3V81A 3QETA 1FXXA 5CZ2A 3U3GA 3JYTA 4BE2A 1NJZA 1NK9A 2HVIA 1RTJA 4AHUA 1WAFA 3LZIA 1B9DA 5HROA 4BE0A 3PY8A 4MFBA 3TAMA 4ELUA 2GUIA 1TK5A 2Y1IA 4O44A 4B8AB 4IG0A 3KTQA 4CIEA 1ZBUA 3F73A 2HNDA 2D0BA 3LP3A 4NCAA 2OZMA 2P5OA 2E4LA 2FBXA 4CESA 4FJGA 4DU3A 4CJWA 1TKZA 3HO1A 2VG6A 5CYMA 3AVBA 3SJJA 4F3OA 1RILA 2FBYA 4OVLA 2OPRA 4RW7A 4CHNA 3NF6A 3VQ8A 1EETA 4RW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXB A;  4Z4H A;  4RW4 A;  2HHW A;  2VG5 A;  3DRS A;  3ZSZ A;  1RT2 A;  4FJK A;  1QS4 A;  3MEE A;  4FXD A;  3MXI A;  4J2B A;  1JL1 A;  2RPI A;  3HVT A;  1TGO A;  3ZT0 A;  4FZX C;  4KHU A;  4CGD A;  1KRP A;  3VQQ A;  4HUF A;  4FLT A;  1NOY A;  5DMR A;  1S1T A;  2HB5 A;  4AH9 A;  1L5U A;  3IG1 A;  4CJ3 A;  2YV0 X;  3RMC A;  2OPS A;  3SUP A;  1VSI A;  1EXQ A;  2Z1H A;  3LAL A;  2D5R A;  5HBM A;  3VQE A;  3CFO A;  4WE1 A;  4CGJ A;  2XY7 A;  3CQ8 A;  1JLF A;  3HST B;  2QKK A;  1L3U A;  4C8K A;  4KPY A;  4OKJ A;  1FKP A;  1LAV A;  4C8L A;  2BE2 A;  1BCO A;  4GW6 A;  4Z0U A;  4CJT A;  4PA1 A;  3WNE A;  3V9X A;  3K59 A;  3DLK A;  3DRP A;  4ID5 A;  3OYC A;  1WSJ A;  4Y1C A;  3AVN A;  1I3A A;  1VRT A;  4RW6 A;  5J1E A;  3L2Q A;  4FM0 A;  3OJU A;  1J53 A;  4AIL C;  3VQA A;  1IH7 A;  1JL2 A;  3SYZ A;  4L8R B;  1JXE A;  3C94 A;  2BGG A;  3HK2 A;  1U49 A;  3K5M A;  1B92 A;  3RMA A;  1SKW A;  3FFI A;  2D0C A;  3VQ7 A;  3KIO A;  1D9F A;  2G8K A;  4CJQ A;  4KI4 A;  4W5Q A;  4BWM A;  4JRQ A;  4ZTJ A;  3ZSR A;  4DSL A;  3QIO A;  1ITG A;  1IKV A;  1O1W A;  2JGU A;  2GV9 A;  1VSD A;  4CEE A;  3P83 D;  4AHV A;  4EP5 A;  5HRS A;  1VSH A;  3OYL A;  2QKB A;  1UA0 A;  4B08 A;  3AA2 A;  3AVH A;  3ISN C;  1X1P A;  4FCY A;  1KVC A;  2KZZ A;  1RT5 A;  4I2P A;  2G8H A;  2IDO A;  2FC0 A;  1ASW A;  1L3S A;  3DYA A;  1VSM A;  3NE6 A;  3HPG A;  1J9A A;  3C95 A;  2PZS A;  3VQD A;  1IKW A;  3QEI A;  4C8M A;  3HP6 A;  3V9U A;  4R5P A;  3O3G A;  4M3U A;  4CEQ A;  3AVM A;  3BDP A;  3PUF A;  3SNN A;  4CEA A;  1NK6 A;  4B9U A;  1X9W A;  1UAX A;  2E6L A;  4CK2 A;  3OY9 A;  4FW1 A;  3OYE A;  2HNY A;  4CJF A;  5I3U A;  4CHQ A;  3QEV A;  5HRR A;  4DTN A;  3AV9 A;  2AJQ A;  3DLE A;  4M41 A;  4FM2 A;  4DQI A;  4LSN A;  3WNH A;  4DTR A;  4DFP A;  3MXJ A;  3HM9 A;  1WSG A;  4CK1 A;  5HP1 A;  4H4O A;  3H08 A;  1JKH A;  3M8R A;  3K5N A;  4DTO A;  3OS2 A;  3THV A;  1X9S A;  4N5S A;  1T03 A;  2RF2 A;  1EX4 A;  3RMD A;  3DLH A;  4OLA A;  2G8W A;  5FDL A;  3ULD A;  1T05 A;  3HXM A;  2VG7 A;  1J54 A;  1LAW A;  3AA5 X;  4DFM A;  4J2E A;  2KQ2 A;  3TAR A;  4FK2 A;  1RCH A;  4M3R A;  3SV4 A;  4DFK A;  4DU1 A;  3T1A A;  1REV A;  1UWB A;  1RTH A;  2YHA A;  4HVJ A;  4Q5V A;  3O3H A;  1NK5 A;  3PX0 A;  4OKE A;  3U6F A;  4FJX A;  4CJR A;  1TAU A;  4AHC A;  3ZSW A;  3ZSV A;  5C25 A;  3ZSX A;  1Y97 A;  4IFY A;  3LDS A;  1TK8 A;  2XHB A;  4FZZ A;  2HVH A;  3KKR A;  4Q0B A;  5EU7 A;  3S9H A;  3RR8 A;  1Q8I A;  3SV3 A;  4CJS A;  4FK4 A;  2HHT A;  3DLR A;  1TKT A;  3AVF A;  4I2Q A;  2XY5 A;  1BI4 B;  4CF9 A;  3HPO A;  4Z4E A;  4FM1 A;  3G0Z A;  4N56 A;  1XC9 A;  1JLQ A;  4LY7 A;  3DRR A;  4DS5 A;  3SI6 A;  1C0U A;  1HNV A;  3AVL A;  4DLE A;  3TAN A;  4CK3 A;  1TV6 A;  1Z25 A;  4QAG A;  4DSF A;  3M8S A;  1NK4 A;  1ZBI A;  1LWC A;  3DOK A;  3NHG A;  4E1N A;  3CFR A;  4DS4 A;  4DTP A;  1ASU A;  4KB0 A;  5J2P A;  3WNF A;  4ZTF A;  1CXU A;  1TKD A;  2G8F A;  4KHQ A;  4DTJ A;  1LWF A;  3NGY A;  1NKC A;  3NF8 A;  2KZM A;  3PV8 A;  1B9F A;  4KI6 A;  2LSN A;  3KLI A;  2RKI A;  4XIU A;  2G8U A;  1KCF A;  4DWI A;  4DSI A;  1RBU A;  4LSL A;  2YNF A;  4E19 A;  4Z4C A;  3L2U A;  3D45 A;  3PX6 A;  5I42 A;  1QTM A;  3OYH A;  4CIG A;  2HHS A;  3NGZ A;  3L2W A;  1WN7 A;  4W5O A;  3ZT3 A;  4CCH A;  1NK0 A;  4FJM A;  2YKM A;  1SKS A;  4DQS A;  2IC3 A;  1HQE A;  2OPQ A;  2X6S A;  5E41 A;  1HMV A;  3DMJ A;  1SL1 A;  1CLQ A;  1VSE A;  3T3F A;  1NKB A;  2NUB A;  1C1B A;  5FRO A;  2HHX A;  3LP1 A;  4CEZ A;  1WSE A;  3OS0 A;  3SUQ A;  1LW2 A;  1QSY A;  3IAY A;  4QOZ B;  1FK9 A;  4M45 A;  4O0I A;  3K5L A;  4B9N A;  1RTI A;  5SZT A;  4LH4 A;  1KVA A;  4BDY A;  4PQU A;  4FJ7 A;  1HYV A;  5DK5 A;  4CGH A;  4Z4I A;  1S1U A;  4AHT A;  4TSX A;  3AA4 A;  2KFZ A;  4CGF A;  3TAF A;  3NH0 A;  4E7J A;  3HVR A;  4B9M A;  4I9Q A;  2KFN A;  3QO9 A;  4KAZ A;  1BL3 A;  3SQ0 A;  3SPZ A;  3V9Z A;  1WAJ A;  1KLN A;  2WON A;  2ZE2 A;  3QLH A;  3KKS A;  4KHN A;  3KLH A;  4HTU A;  2ATQ A;  3MEG A;  3S3N A;  4LD0 A;  4B9S A;  1FKO A;  4FVM A;  4N47 A;  1WSI A;  1S1W A;  3TWH A;  4OPJ A;  3LP2 A;  3ALY A;  5T7B A;  1NK8 A;  4W5T A;  2HHV A;  4CJP A;  1D5A A;  3AVI A;  4Z4G A;  3S3M A;  1NKE A;  3O4Q A;  3ZT1 A;  3OYJ A;  3K5O A;  1VSL A;  4JLH A;  3DM2 A;  2JLE A;  3CG7 A;  3HP9 A;  4DQP A;  3CM5 A;  1KSP A;  2IGI A;  2P1J A;  4PY5 A;  2VWJ A;  1IKX A;  4M42 A;  4W5N A;  3B6P A;  4CFC A;  3KD1 E;  2IS3 A;  3M8P A;  3HJF A;  2DY4 A;  1XWL A;  3B6O A;  3AVJ A;  2W42 A;  1DTQ A;  1LV5 A;  3LAN A;  4CEC A;  3OYM A;  3TAP A;  4B9V A;  2PYL A;  3KLE A;  4DSK A;  2FBV A;  3U3Y A;  3OJS A;  4CEO A;  3TAE A;  4JRP A;  1VSF A;  3TI0 A;  1L3T A;  5J2N A;  1S9G A;  3C6U A;  3HPH A;  1NJW A;  4HUG A;  4FJN A;  1CZB A;  2IOC A;  3MED A;  5KRT A;  4DG1 A;  3VA0 A;  1YT3 A;  3QIP A;  4O55 A;  1Z26 A;  1HJR A;  3RR7 A;  4F3T A;  5HRN A;  2YHB A;  4AHR A;  4EP4 A;  3NH1 A;  1CXQ A;  5FRM A;  3ZSO A;  1KFD A;  3KK1 A;  3OYB A;  4DTU A;  3L2V A;  1RDC A;  4FJJ A;  4J2A A;  2XY8 A;  3QIN A;  4HCC A;  4ELV A;  4KFB A;  1ZYQ A;  4F4K A;  2X6N A;  4RW8 A;  1S1V A;  3KLF A;  1RBV A;  1QQC A;  5K14 A;  3SPY A;  2GBZ A;  3ZSY A;  1U04 A;  3QEP A;  4DTS A;  3SQ4 A;  4CJL A;  3NH2 A;  1X9M A;  3WNG A;  2O4G A;  3RRH A;  3QNN A;  2F8S A;  2VWK A;  4CJV A;  5SWM A;  1BIZ A;  1JLA A;  3V1R A;  4BDZ A;  2P51 A;  3AO1 A;  2Z1G A;  3NDK A;  1HNI A;  3VQP A;  2HNZ A;  4K8Z A;  3SQ2 A;  2PYJ A;  4M3T A;  4CED A;  3MXM A;  3TAG A;  1VK0 A;  3AVG A;  4DU4 A;  4OLB A;  1K6Y A;  3O3F A;  4O0J A;  3QER A;  4CJU A;  3PX4 A;  2E6M A;  4NYN A;  4CHZ A;  4KTQ A;  1RDA A;  2KW4 A;  3KJV A;  1KLM A;  1RT7 A;  1XHX A;  1DLO A;  2IAJ A;  1VRU A;  3ZCM A;  4CJE A;  3C6T A;  3QES A;  3PO5 A;  3UIQ A;  2A1S A;  4FW2 A;  4ID1 A;  3TR8 A;  3K58 A;  4HUE A;  4HHT A;  4E7K A;  4OPK A;  4FYD A;  3MAQ A;  2YKN A;  3L3U A;  3VA3 A;  4HCB A;  4J2D A;  1ASV A;  4KHY A;  4IKF A;  2HMI A;  3RRG A;  4H4M A;  4UQG A;  2OZS A;  2OA8 A;  3RWU A;  3OYA A;  3VQ6 A;  1R0A A;  3DLG A;  4DF8 A;  5FRN A;  4H8K A;  3CM6 A;  1C6V A;  4NYF A;  3LWM A;  5HLF A;  3BGR A;  3OYN A;  3LWL A;  1N6Q A;  1LWE A;  1RNH A;  1VSK A;  4O5B A;  3NAE A;  3SUN A;  1RT4 A;  3V1Q A;  3V1O A;  1HYS A;  1TL1 A;  3JSM A;  4E89 A;  3CFP A;  4YFU A;  1S1X A;  3M8Q A;  1J5O A;  1WLJ A;  1BGX T;  1GOC A;  2QXF A;  4KV8 A;  5CY4 A;  1Q9Y A;  1HQU A;  3OYG A;  4KO0 A;  1XHZ A;  1HPZ A;  3D0P A;  3OYI A;  4FJH A;  4FJI A;  1RBS A;  3EYZ A;  3LPT A;  3L3V A;  4CER A;  1WNS A;  1U45 A;  1QE1 A;  1U47 A;  2Z1I A;  3VQ4 A;  3I0R A;  1S5J A;  1UOC A;  2X74 A;  5CYQ A;  4DMN A;  3QEX A;  1ZBL A;  4ELT A;  1WSF A;  5C42 A;  2BDP A;  3AVA A;  2DFE A;  4ICL A;  1QSL A;  2Y1J A;  1MU2 A;  1S9E A;  3IS9 A;  4CF2 A;  4PUO A;  5D3G A;  2B5J A;  2WOM A;  1JLB A;  1T8E A;  3V9S A;  4EZ9 A;  4B9T A;  3NF9 A;  3VN5 A;  4BE1 A;  4F8R A;  4IBN A;  3NBP A;  2DFF A;  4M3Y A;  3A2F A;  4CEB A;  3CYM A;  5KGX A;  1KFS A;  4KHS A;  4Z4F A;  4B8C A;  1ZBH A;  4CFB A;  4KRE A;  1TL3 A;  4FJ5 A;  1F21 A;  4E7H A;  4B3O A;  4PWD A;  4FLY A;  2X78 A;  2BAN A;  4KTZ A;  2PY5 A;  2P5G A;  2DFH A;  2QK9 A;  4OKK A;  4G1Q A;  1KTQ A;  4DFJ A;  1S6P A;  3E01 A;  1A5X A;  1TKX A;  4O4G A;  3S3O A;  1N5Y A;  3ASM A;  1GOB A;  3K2P A;  5JS2 A;  2Z1J A;  4DQR A;  1EKE A;  1IKY A;  4IDK A;  2XY6 A;  4CHP A;  5CZ1 A;  3MEC A;  4FJ8 A;  3NFA A;  4CFD A;  3V6D A;  1BHL A;  1U48 A;  4GVM A;  2EHG A;  3EY1 A;  4OJR A;  3VQ5 A;  4FLX A;  4KHW A;  1RT3 A;  4FLU A;  1RBR A;  3OYF A;  1C0T A;  1ZBF A;  3LAM A;  3OVN A;  3P1G A;  4IFV A;  4EZ6 A;  2HHQ A;  4N41 A;  2ETJ A;  3SZ2 A;  3G10 A;  4CEF A;  3QNO A;  4B9L A;  4CFA A;  5HRP A;  4E1M A;  3AVC A;  2EX3 A;  1RDB A;  3VQC A;  1BCM A;  4AHS A;  3F9K A;  5C24 A;  4KKO A;  4YNQ A;  1GOA A;  4C8O A;  5J2M A;  3IRX A;  3DOL A;  1NJY A;  1YVU A;  3P5J A;  1RT1 A;  4FLW A;  1EP4 A;  3DLB A;  2ITG A;  4N76 A;  3O4N A;  4IG3 A;  3VQ9 A;  4DQQ A;  4BWJ A;  2Q3S A;  2XO7 A;  1IG9 A;  4F2R A;  4FLZ A;  1BI4 A;  3KD5 E;  3HT3 A;  3HYF A;  3LAK A;  3QEW A;  1QHT A;  3ZSQ A;  4CHY A;  1RBT A;  3HL8 A;  4CF0 A;  3SQ1 A;  3LP0 A;  3OYK A;  3V9W A;  2YNH A;  1LW0 A;  4FLV A;  3AA3 A;  3AO2 A;  1BQM A;  1JLE A;  1NOZ A;  5KGW A;  4K8X A;  5JS1 A;  4M3W A;  4OGE A;  1HYZ A;  3K57 A;  2YNG A;  2F8T A;  4W5R A;  2OPP A;  3DI6 A;  2RN2 A;  4ZHR A;  4CF1 A;  1VSJ A;  2HHU A;  1BQN A;  1SL2 A;  1I39 A;  1D8Y A;  3VQB A;  4CHO A;  3L8B A;  4I7F A;  2DTU A;  2F96 A;  1HRH A;  3KLG A;  3RTV A;  4FZY A;  1JLC A;  4CF8 A;  4CGG A;  3V4I A;  4I9L A;  1SV5 A;  5J2Q A;  3TAQ A;  1SKR A;  4M3X A;  1W0H A;  3AO3 A;  4C8N A;  1TK0 A;  1W9H A;  4BAC A;  4DTX A;  1TVR A;  3NCI A;  1WSH A;  2A1R A;  4CGI A;  2KTQ A;  3ZT4 A;  4QCL A;  3RMB A;  3PO4 A;  3SCX A;  2B6A A;  1JLG A;  1TAQ A;  1IO2 A;  4NCG A;  1SUQ A;  3T19 A;  1A5W A;  4CIF A;  1CZ9 A;  3OS1 A;  4E7I A;  4FK0 A;  4E0D A;  2FBT A;  4KB1 A;  2ZQB A;  4JS4 A;  4DTM A;  4BDP A;  3I8D A;  3AVK A;  4RG8 A;  3L2R A;  1NJX A;  1G15 A;  1C1C A;  5KTQ A;  1A5V A;  4E7L A;  2D0A A;  4NCB A;  1YTU A;  2I5J A;  1RDD A;  4DSJ A;  3I0S A;  1Q9X A;  1S6Q A;  4DF4 A;  2ZD1 A;  2G8V A;  4FJ9 A;  1NK7 A;  5KI6 A;  2O4I A;  4DLG A;  4Y1D A;  4GMJ B;  4E3S A;  2B4J A;  3KK2 A;  4CE9 A;  3AO5 A;  3OYD A;  3EZ5 A;  1BIU A;  1BIS A;  3NGI A;  3ZT2 A;  4DSE A;  2G8I A;  2XRI A;  3LPU A;  2HW3 A;  1C0M A;  3AO4 A;  1KVB A;  4F2S A;  3SUO A;  4LH5 A;  1SL0 A;  4CJ4 A;  5KRS A;  4M3Z A;  3TAB A;  4MQ3 A;  4CJ5 A;  3LZJ A;  1C1A A;  1DTT A;  4KTW A;  1U4B A;  3KK3 A;  3ITH A;  4CJK A;  1RT6 A;  4JS5 A;  1L3V A;  2YNI A;  4KRF A;  1QSS A;  1RTD A;  1T7P A;  2R7Y A;  1XI1 A;  4FJL A;  1UA1 A;  1D9D A;  1YTA A;  3NF7 A;  2OYQ A;  4OGC A;  3V81 A;  3QET A;  1FXX A;  5CZ2 A;  3U3G A;  3JYT A;  4BE2 A;  1NJZ A;  1NK9 A;  2HVI A;  1RTJ A;  4AHU A;  1WAF A;  3LZI A;  1B9D A;  5HRO A;  4BE0 A;  3PY8 A;  4MFB A;  3TAM A;  4ELU A;  2GUI A;  1TK5 A;  2Y1I A;  4O44 A;  4B8A B;  4IG0 A;  3KTQ A;  4CIE A;  1ZBU A;  3F73 A;  2HND A;  2D0B A;  3LP3 A;  4NCA A;  2OZM A;  2P5O A;  2E4L A;  2FBX A;  4CES A;  4FJG A;  4DU3 A;  4CJW A;  1TKZ A;  3HO1 A;  2VG6 A;  5CYM A;  3AVB A;  3SJJ A;  4F3O A;  1RIL A;  2FBY A;  4OVL A;  2OPR A;  4RW7 A;  4CHN A;  3NF6 A;  3VQ8 A;  1EET A;  4RW9 A; 
#chains in the Genus database with same CATH topology
 4Z4H A;  4RW4 A;  3ZSZ A;  4J8F A;  3MXI A;  5ADX H;  1JL1 A;  3D2E A;  3HVT A;  4CZJ A;  3ZT0 A;  5C15 A;  4FLT A;  3LM2 A;  3HRG A;  5M1Q A;  2YV0 X;  3RMC A;  1FW6 A;  1VSI A;  2QW9 A;  4LF4 K;  3VQE A;  1ATS A;  3ATV A;  4CGJ A;  2XY7 A;  1L3U A;  4KPY A;  4OKJ A;  1LAV A;  1HLU A;  1W7A A;  4IFE A;  3WNE A;  3K59 A;  3BEX A;  3OYC A;  1WSJ A;  1VRT A;  4NLB A;  4BVP A;  1IBK K;  3OJU A;  1U49 A;  3AAP A;  3K5M A;  3FFI A;  1NGC A;  3D7E O;  4W5Q A;  2GX9 A;  5AQY A;  4ZTJ A;  3ZSR A;  1ITG A;  4JK9 A;  2GV9 A;  3ZEU A;  1UA0 A;  4B08 A;  3AA2 A;  3AVH A;  3MK6 A;  1KVC A;  4Y0W A;  3J81 O;  3DYA A;  2YHX A;  2PZS A;  3TPQ A;  1UAX A;  4B3T K;  3CXC M;  4OPA A;  3MX5 A;  4DFP A;  1WBB A;  4CBX A;  3THY A;  4H4O A;  3H08 A;  2E2N A;  1YI2 N;  3F2K A;  4I6M B;  4N5S A;  2NRH A;  1QQO A;  5BN8 A;  1ATN A;  3K9K A;  3MN5 A;  2VG7 A;  1J54 A;  1RCH A;  4M3R A;  4U67 L;  4DFK A;  3VEW A;  3N4Q A;  1QZ6 A;  3SK3 A;  5C25 A;  4WFA L;  2XHB A;  2VGN A;  1Q8I A;  3BZC A;  3SV3 A;  5A2Q O;  3QIC A;  5ADX A;  1TKT A;  2XY5 A;  3AY9 A;  2ZJP L;  2QWO A;  4LY7 A;  3DRR A;  4CD1 A;  3SI6 A;  4ISF A;  3AVL A;  2CH5 A;  3VF6 A;  4CK3 A;  3TAN A;  1Z25 A;  1Q81 O;  3DJC A;  1LWC A;  3DOK A;  3NHG A;  1XMO K;  4WQ5 A;  4DS4 A;  3SAG A;  3CD6 N;  3E1Y A;  4DV6 K;  4DTJ A;  3NGY A;  2W6L A;  3NF8 A;  4GY2 B;  4IWV A;  3PV8 A;  1B9F A;  4RCH A;  5AQI A;  4GV9 A;  1HUX A;  4JD2 A;  2PYJ A;  2YNF A;  4E19 A;  4Z4C A;  3L2U A;  1NU0 A;  4BRM A;  1QTM A;  4CIG A;  3L2W A;  4W5O A;  4CCH A;  3JAM O;  3IUC A;  4DQS A;  1HQE A;  2E20 A;  3QFP A;  1VSE A;  3T3F A;  1C1B A;  5KQ8 A;  3R8E A;  3LP1 A;  4H5R A;  4XEI A;  1LW2 A;  1LCU A;  3K5L A;  5ELZ A;  1RTI A;  4PQU A;  1KVA A;  1S1U A;  5C12 A;  2UUA K;  2F9T A;  1BA1 A;  2KFN A;  1BL3 A;  2Q2R A;  1NG9 A;  1FKO A;  4FVM A;  3UKR A;  1WSI A;  5AQV A;  4OPJ A;  1NK8 A;  3THX A;  4Z4G A;  3EE8 A;  5JLF A;  2UXD K;  4WQ4 C;  4DQP A;  4PY5 A;  2P1J A;  4W5N A;  4CFC A;  3HJF A;  2W42 A;  2QWN A;  1DTQ A;  4KH4 A;  3LAN A;  3OYM A;  2WFB A;  5AQL A;  4BR5 A;  1E4F T;  4IJN A;  4QS9 A;  3OJS A;  3TAE A;  4JRP A;  1VSF A;  3TI0 A;  2IIR A;  2P9P A;  3LDN A;  2ASO A;  3QIP A;  4O55 A;  3RR7 A;  1HJR A;  4F3T A;  4JKG B;  5HRN A;  2YHB A;  1CXQ A;  5AQS A;  1KFD A;  3J7Z O;  3KK1 A;  3GE1 A;  1NNE A;  3QIN A;  4HCC A;  1VHX A;  1ZYQ A;  2X6N A;  5K14 A;  4BGB A;  1U04 A;  4DTS A;  3SQ4 A;  4CJL A;  1X9M A;  3WNG A;  5AZJ B;  3H1V X;  1BUP A;  1JLA A;  3PSI A;  3VEV A;  4BDZ A;  1V4S A;  3VQP A;  2ZGY A;  2P9L A;  3SQ2 A;  5KPZ A;  1BDG A;  4H0V B;  3QDK A;  3TAG A;  1U2V B;  3QER A;  1VQK N;  1EWR A;  4JKD A;  1QHA A;  2E6M A;  3H3O B;  4KH6 A;  5GAG P;  3NVK A;  4CHZ A;  4FO0 A;  3SAH A;  1YJN N;  4DR4 K;  2CH6 A;  2KW4 A;  2IAJ A;  1KAZ A;  4CJE A;  4RTF D;  4HUE A;  4E7K A;  5EXW A;  1GLB G;  2BUP A;  5EY4 A;  4R79 A;  1ASV A;  3IDH A;  3VQ6 A;  1R0A A;  4H8K A;  5HLF A;  4WQ4 A;  3BGR A;  3OYN A;  3LWL A;  4AQY K;  1N6Q A;  1RNH A;  4IXC A;  1XUP O;  3T7Z A;  1HYS A;  3V1Q A;  3V1O A;  3CFP A;  4B1Z A;  3CCJ N;  3SMP A;  1HQU A;  3O08 A;  3WEE A;  4DUY K;  3CCV N;  3C7N B;  5M1N A;  1N36 K;  3HM8 A;  5CYQ A;  4ELT A;  5C42 A;  4C1N I;  2Y1J A;  4CF2 A;  4FWQ A;  3V9S A;  3NF9 A;  2F4V K;  1VQO N;  3NBP A;  1NBW A;  3CYM A;  1TL3 A;  4FJ5 A;  3CJ9 A;  1QZ5 A;  4KTZ A;  2OAN A;  4OKK A;  1VQ5 N;  3E01 A;  1A5X A;  4EAH D;  4O8U A;  5JS2 A;  1U6Z A;  2W40 A;  4FJ8 A;  3V6D A;  2Q36 A;  3MCP A;  3R3L A;  1NWK A;  4GVM A;  4OJR A;  5AQH A;  5MLC Q;  4FLX A;  5GIO A;  3P1G A;  4IFV A;  4N41 A;  2ETJ A;  2A5X A;  3G6E N;  3AVC A;  2EX3 A;  4NXM K;  2E88 A;  3HBT A;  2ASM A;  1RT1 A;  4FLW A;  4N76 A;  4IG3 A;  1WOQ A;  3BF1 A;  3VQ9 A;  3L4I A;  1IG9 A;  4F2R A;  3QEW A;  3DXK A;  3OHR A;  2BH1 A;  2QI2 A;  3OYK A;  1K9M O;  2YNH A;  4HWI A;  5JMV A;  4JHD B;  3CJC A;  3AO2 A;  3N4P A;  4OGE A;  4JKE A;  4XH5 A;  3DI6 A;  2Q0R A;  3VEO A;  2HHU A;  3VQB A;  4I7F A;  2DTU A;  4BRK A;  2F96 A;  3RTV A;  1JLC A;  2HOE A;  4I9L A;  3CQY A;  1HNZ K;  1JCF A;  3CC2 N;  5KPT A;  1TVR A;  3SCX A;  2B6A A;  5LY3 A;  1TAQ A;  1SUQ A;  1A5W A;  1CZ9 A;  4FK0 A;  4E0D A;  3TTC A;  4YY3 K;  5KTQ A;  2D0A A;  1YTU A;  4A62 A;  3MWP A;  1HJO A;  3WXK A;  1Q9X A;  3CET A;  2G8V A;  4FJ9 A;  1NK7 A;  5KI6 A;  1HPM A;  4GMJ B;  3O4W A;  3OYD A;  3D2F A;  3EZ5 A;  2G8I A;  2XRI A;  3KVG A;  4DR7 K;  2GUP A;  4F2S A;  4M3Z A;  3TAB A;  3LZJ A;  1C1A A;  4PKI A;  1U4B A;  3ITH A;  3EZW A;  4H0X B;  3S41 A;  1RT6 A;  1L3V A;  1QSS A;  4A57 A;  3RSE B;  1YJW N;  2R7Y A;  4KBO A;  2QTD A;  1D9D A;  5HL7 L;  4BC2 A;  2OYQ A;  3CER A;  3QET A;  1FXX A;  3JYT A;  4BE2 A;  1NK9 A;  2HVI A;  4LFA K;  5HRO A;  1WAF A;  3MWT A;  4BE0 A;  3PY8 A;  3A5N C;  2O8E A;  3VEZ A;  2YHY A;  3UKU B;  3F73 A;  1N8R O;  2HND A;  3LP3 A;  4PL7 A;  2E4L A;  3ULE A;  4FJG A;  2V51 B;  3AGK A;  2VG6 A;  3AVB A;  4NXN K;  1NGB A;  1SAZ A;  3TTD A;  3O9R A;  3SLC A;  3J80 O;  2HHW A;  3F9M A;  3SBG A;  2VG5 A;  2ZWH A;  2Q31 A;  4FJK A;  1QS4 A;  5AQJ A;  4J2B A;  2ZF5 O;  4FZX C;  1TGO A;  1YVN A;  4HUF A;  1NOY A;  3VGL A;  1S1T A;  1V4T A;  2HB5 A;  3CCQ N;  5JLH A;  1J5E K;  4BC3 A;  3T1H K;  3SUP A;  3LM9 A;  3THW B;  2D5R A;  5HBM A;  4LF8 K;  1W97 L;  4FVU A;  3UB5 A;  2J4R A;  4GW6 A;  2I7N A;  3G25 A;  3A5O C;  3V9X A;  1M90 O;  1HX1 A;  4XH4 A;  3DLK A;  2FSN A;  4Y1C A;  4FM0 A;  4AIL C;  4MDB A;  5J1E A;  4B1W B;  1IH7 A;  3SYZ A;  1JXE A;  2BGG A;  3ZET B;  2E1Y A;  5AZI A;  5BRE A;  3RMA A;  1SKW A;  2A40 A;  2G8K A;  4KI4 A;  1WUA A;  4BWM A;  4JRQ A;  5BPN A;  3T1Y K;  3ATU A;  4DHY A;  1VSD A;  4EP5 A;  4AHV A;  2RHK A;  2UYT A;  4I2P A;  2G8H A;  1NGI A;  1L3S A;  3C95 A;  3VQD A;  1ESV A;  3QEI A;  2I7P A;  3V9U A;  1GLJ O;  4R5P A;  1NK6 A;  2GWJ A;  3JXU A;  4CK2 A;  3OY9 A;  2HNY A;  5I3U A;  5FPN A;  4CZF A;  3QEV A;  5HRR A;  1D4X A;  4DTN A;  3CCE N;  4M41 A;  1X3M A;  3FGU A;  4JI4 K;  4FM2 A;  3Q7C A;  3J7A P;  1K8A O;  3MXJ A;  3HM9 A;  4CK1 A;  1VQ8 N;  3WXI A;  5AQM A;  4UY8 O;  1JKH A;  3M8R A;  4DTO A;  1ATR A;  4X64 K;  1T03 A;  1EX4 A;  4BRQ A;  4OLA A;  1VQ6 N;  2D0O A;  2NRT A;  5FDL A;  3ULD A;  3VER A;  2P9N B;  3H3N O;  2CGK A;  3ZX3 A;  2KQ2 A;  4B1U B;  4DU1 A;  4YOR A;  1C0G A;  3T1A A;  1Y64 A;  5FLX O;  2RE2 A;  2NRV A;  3PX0 A;  4OKE A;  1T6D A;  1TYQ A;  1OH5 A;  3ZSV A;  1TK8 A;  4IFY A;  4CZG A;  3LDS A;  4FZZ A;  1DT9 A;  4JK7 A;  3KKR A;  4Q0B A;  2EWS A;  4GVE A;  2HHT A;  1I94 K;  4Z4E A;  3P31 A;  4BR0 A;  2NZT A;  5DM6 L;  1X9J A;  4DS5 A;  1HNV A;  3O9U A;  4JEP A;  4X66 K;  1TV6 A;  5F0X A;  4O8K A;  1ZBI A;  1GLE G;  2AA4 A;  1NGJ A;  4K43 A;  5GAD P;  4E1N A;  4DTP A;  1ASU A;  5J2P A;  1CXU A;  1TKD A;  1LWF A;  1NKC A;  4H5V A;  5BR9 A;  3CCU N;  3ID8 A;  3R1X A;  1S3X A;  5AFU H;  3EKU A;  1RBU A;  2O8D B;  3PX6 A;  2PFU A;  3D45 A;  3BY5 A;  5FPE A;  3ZT3 A;  1JJ2 M;  1NK0 A;  4JI5 K;  2YKM A;  2OPQ A;  3PSF A;  5E41 A;  1DEJ A;  5TKW A;  2HHX A;  1WSE A;  4LFC K;  2DPN A;  4JYA K;  4IDH A;  5SZT A;  4FJ7 A;  3LDP A;  4AHT A;  1T44 A;  4E7J A;  4B9M A;  3QO9 A;  1BOT O;  2YCH A;  4H0Y B;  1WAJ A;  4BRA A;  2ZE2 A;  3V9Z A;  1KLN A;  3KKS A;  4KHN A;  4HTU A;  2ATQ A;  3MEG A;  4B9S A;  1K73 O;  4N47 A;  3WT0 A;  1GLD G;  3ALY A;  1NGA A;  5CE3 A;  3S3M A;  3O4Q A;  4CBW A;  3ZT1 A;  3M5R A;  4WQ5 C;  3OYJ A;  4B3M K;  3SAF A;  3K5O A;  4JLH A;  3CG7 A;  2IGI A;  4K25 A;  2VWJ A;  1IKX A;  3B6P A;  2HF3 A;  2IS3 A;  3M8P A;  3HZ6 A;  1LV5 A;  3VES A;  3KLE A;  4DSK A;  4YOW A;  3U3Y A;  4CEO A;  1YJ9 N;  2YI1 A;  2A6A A;  4FPB A;  3HPH A;  4X62 K;  4ILH A;  4DG1 A;  4A61 A;  4LF9 K;  4DB3 A;  4AHR A;  4EP4 A;  3NH1 A;  2HBL A;  3OYB A;  1IBM K;  5LJW A;  4KFB A;  3KLF A;  2YJE A;  1GLF O;  4NO7 A;  3NVM A;  3E9P A;  5E84 A;  1QVF M;  2O4G A;  4A5A A;  3D2E B;  2QWM A;  1BIZ A;  4WF9 L;  2Z1G A;  3A5M C;  3NDK A;  1HNI A;  3ZX0 A;  3MXM A;  5AFU A;  3AVG A;  2P9U A;  4O0J A;  4ILG B;  4DR5 K;  4CJU A;  1WBD A;  1Z05 A;  3KHY A;  3FLC O;  1RT7 A;  1DLO A;  3ZCM A;  3LDQ A;  3QB0 A;  4FW2 A;  3TR8 A;  4HHT A;  4OPK A;  5AQN A;  4FWR A;  2YKN A;  2O8F A;  3VA3 A;  4KHY A;  4FWN A;  4IKF A;  2OA8 A;  4JKC A;  2FXU A;  3OYA A;  3DLG A;  4FL9 A;  4DF8 A;  3ZEU B;  2ZM6 K;  3BP8 A;  1VSK A;  1KXP A;  2V7Y A;  3NAE A;  4DUZ K;  4YFU A;  3M8Q A;  1NGE A;  3HSC A;  1WLJ A;  5CY4 A;  1Q9Y A;  1J5O A;  3DLL L;  4KO0 A;  4CBU A;  3OYI A;  4DR3 K;  3EYZ A;  4CI6 A;  4CER A;  1QE1 A;  3VQ4 A;  1ZBL A;  3I0R A;  1S5J A;  2X74 A;  3F5T A;  1WSF A;  1RGI A;  1S22 A;  2DFE A;  2ZJR L;  1MU2 A;  4EHT A;  2WOM A;  1T8E A;  3THY B;  3B8A X;  4BE1 A;  4F8R A;  4M3Y A;  3U9Z A;  1DKG D;  4CEB A;  5KGX A;  4KRE A;  3A0I X;  2KKZ A;  4B3O A;  4PWD A;  2YJF A;  2DFH A;  3HOS A;  1S6P A;  1N5Y A;  1TKX A;  3S3O A;  2D0P A;  3ASM A;  5AQQ A;  2Z1J A;  4JI0 K;  4DQR A;  1EKE A;  2GEM A;  2XY6 A;  1YF5 L;  3MEC A;  4PHT X;  1K8K A;  3OYF A;  1ZBF A;  2HHQ A;  3SZ2 A;  3M3Z A;  3QNO A;  4B9L A;  4E1M A;  4AHS A;  3VTI A;  2V7Z A;  5C24 A;  4KKO A;  4DV1 K;  3IRX A;  1YVU A;  1EP4 A;  3VEX A;  3DLB A;  4BWJ A;  1BI4 A;  3HYF A;  3LAK A;  3M6G A;  2YX6 A;  4JD2 B;  4BRO A;  4BRF A;  3AA3 A;  1BQM A;  5KGW A;  1NGG A;  1NOZ A;  4M3W A;  1HYZ A;  1R59 O;  5JIC A;  4ZHR A;  4CF1 A;  1VSJ A;  1BQN A;  4OO1 J;  1SL2 A;  1I39 A;  3PIO L;  4F9O A;  1HRH A;  1EQY A;  4CGG A;  3TAQ A;  1SKR A;  3FZK A;  4BG8 A;  3RVC A;  3U4L A;  4M63 C;  2HHH K;  3DXM A;  1WSH A;  5I9E B;  3NCI A;  2KTQ A;  3ZT4 A;  3RMB A;  2UXC K;  3UKR B;  1IO2 A;  3T19 A;  4E7I A;  3OS1 A;  3THX B;  4JS4 A;  1H1V A;  1BG3 A;  3I8D A;  4M7X A;  3HI0 A;  3J8A A;  1J6Z A;  3BUZ B;  2I5J A;  1RDD A;  4DSJ A;  4DF4 A;  2ZD1 A;  4IOX A;  3FZF A;  4Y1D A;  3KK2 A;  1O13 A;  1BIS A;  2HW3 A;  1YAG A;  1C0M A;  3AO4 A;  4YDU C;  4LH5 A;  4JNE A;  4CJ4 A;  2P9P B;  4CJ5 A;  1DTT A;  4BRL A;  4CJK A;  4JI2 K;  3CCL N;  1T7P A;  1XI1 A;  3GDQ A;  5GIN A;  4FJL A;  1UA1 A;  1SZ2 A;  4OGC A;  5CZ2 A;  4MDA A;  4AHU A;  3JS6 A;  3KK7 A;  1B9D A;  4JKA A;  4ELU A;  4MFB A;  3TAM A;  2GUI A;  4IEI A;  1TK5 A;  2Y1I A;  4IG0 A;  1ZBU A;  3O9S A;  5GIP A;  4DU3 A;  1TKZ A;  3HO1 A;  2P9L B;  3SJJ A;  4RW7 A;  2FBY A;  5JVH L;  2WUS A;  1JXB A;  3TSU A;  2QWP A;  3DRS A;  1RT2 A;  3E66 A;  4FXD A;  5AQF A;  1XNR K;  4KHU A;  3BZK A;  5M1O A;  4CGD A;  1TUY A;  1KRP A;  3I33 A;  3VQQ A;  2ZJQ L;  4FWS A;  2AP1 A;  3FFK B;  1L5U A;  3IG1 A;  3ENB A;  4FWK A;  1T6C A;  2Z1H A;  3ID6 A;  4WE1 A;  3MN6 A;  1JLF A;  3HST B;  2QKK A;  2KHO A;  4C8K A;  2H3G X;  3EE9 A;  2BE2 A;  1BCO A;  2P9I A;  4PA1 A;  1IG8 A;  1I3A A;  3AVN A;  4DQ8 A;  4L8R B;  3C94 A;  4GNI A;  1Q82 O;  2IVO A;  4NB4 A;  3Q7B A;  3QIO A;  1O1W A;  1IKV A;  2QWR A;  3VEN A;  4CEE A;  1NMD A;  3OYL A;  3P83 D;  1VSH A;  4YDU A;  5C0Y A;  1X1P A;  3VF2 A;  4FCY A;  2KZZ A;  2IDO A;  5BRF A;  1ASW A;  3FZH A;  2CGJ A;  3NE6 A;  3HPG A;  4A2B A;  1IKW A;  3HP6 A;  3AVM A;  3BDP A;  3E9O A;  3SMS A;  3SNN A;  4B9U A;  3OYE A;  4FW1 A;  1VQN N;  4CJF A;  3RSE A;  4CHQ A;  3CJB A;  3WXJ A;  2AJQ A;  3DLE A;  1NGF A;  3WNH A;  4DTR A;  1N32 K;  4H5T A;  1WSG A;  4A59 A;  2JWL A;  5HP1 A;  4AM6 A;  3P38 A;  3THV A;  3CJ1 A;  1X9S A;  1YUW A;  3RMD A;  3DLH A;  4H0O A;  5LMU K;  3I8B A;  3EO3 A;  2G8W A;  3VET A;  3HXM A;  3AA5 X;  3P39 A;  2QM1 A;  3SV4 A;  1REV A;  2YHA A;  4H5N A;  4Q5V A;  3O3H A;  1NK5 A;  4ILJ A;  1BA0 A;  4B9Q A;  3U6F A;  4AHC A;  3ZSW A;  1Y97 A;  2HVH A;  5CR4 A;  5EU7 A;  3RR8 A;  4CJS A;  4CZI A;  2NNW A;  3AVF A;  3VTH A;  4FSV A;  4CF9 A;  4CVN E;  3HPO A;  4H0P A;  3G0Z A;  3DXK B;  3FZL A;  4N56 A;  3PIP L;  4DV3 K;  4QAG A;  3M8S A;  1MDU B;  3WNF A;  4ZTF A;  2P9K A;  1ZXO A;  2LSN A;  3H6E A;  3KLI A;  2E2Q A;  4XIU A;  4YOU A;  1KCF A;  4BQZ A;  4DWI A;  1BWF O;  3T69 A;  4LSL A;  5I42 A;  1NMN A;  3U8X A;  2HHS A;  4FJM A;  1VAZ A;  2QA4 N;  1SKS A;  2X6S A;  3TTF A;  1HMV A;  3SBT A;  1SL1 A;  3IMX A;  1NKB A;  1EWQ A;  5FRO A;  1QSY A;  1CZA N;  2UUB K;  4QOZ B;  4OX9 K;  4BRC A;  4B9N A;  4LH4 A;  1HYV A;  4AF1 A;  1IJJ A;  4NLC A;  4CGF A;  2O8B B;  3TAF A;  3HVR A;  4I9Q A;  3U9D A;  4KAZ A;  1GLC G;  2WON A;  3QLH A;  3UE5 A;  3KLH A;  3CCS N;  4X65 K;  1RDU A;  4LD0 A;  4EHU A;  3D2F B;  1S1W A;  3CJ7 A;  3LP2 A;  1QVG M;  4CJP A;  5AQR A;  1NKE A;  1N34 K;  4B3R K;  1VQ7 N;  3DM2 A;  2JLE A;  3HP9 A;  4M42 A;  1VQ4 N;  2DY4 A;  1XWL A;  1SQK A;  3B6O A;  5AQK A;  5AQP A;  3CIP A;  4B9V A;  3TAP A;  3IFR A;  1Z6R A;  1S9G A;  3C6U A;  1NJW A;  4HUG A;  4FJN A;  3MED A;  5M1P A;  4WCE L;  2O8E B;  1Z26 A;  3VPZ A;  4M7Y A;  3ULE B;  1GLA G;  4PL8 A;  3GL1 A;  4DR6 K;  4A5B A;  2XY8 A;  4E1J A;  4F4K A;  4PKG A;  1QQC A;  3SPY A;  2GBZ A;  4LF6 K;  1HNX K;  3QNN A;  3RRH A;  5GAH P;  2VWK A;  4CJV A;  5SWM A;  1ILY A;  3K9J A;  2P51 A;  3AO1 A;  3O80 A;  3MX2 A;  1OVQ A;  2HNZ A;  2O8D A;  3M1F A;  5FPD A;  5LL6 Z;  3QBX A;  1VK0 A;  4DU4 A;  1K6Y A;  3O3F A;  1KQS M;  3MN9 A;  4JV5 K;  2W6K A;  4FWP A;  1HR0 K;  3A8Y A;  4NYN A;  3MMV A;  1RDA A;  3L0Q A;  4FYD A;  1L3T A;  1XHX A;  3QES A;  3ZLJ A;  3C6T A;  3UIQ A;  3K58 A;  3CJA A;  3MAQ A;  3P4I A;  4G9Z A;  3O6W A;  4WFB L;  5AZI B;  4HCB A;  3RRG A;  4H4M A;  4UQG A;  2CGL A;  5FRN A;  1NGH A;  1C6V A;  4NYF A;  3LWM A;  1MWK A;  1LWE A;  3SUN A;  4JI3 K;  1RT4 A;  1OH7 A;  1TL1 A;  4E89 A;  1S1X A;  1GOC A;  4MLE A;  3OYG A;  1HPZ A;  5AQX A;  3VGK A;  3HOT A;  1U45 A;  5TKY A;  2O8C B;  2Z1I A;  2VYP A;  5BPM A;  3QEX A;  3L4Q A;  4QS8 A;  2BDP A;  4EFH A;  3AVA A;  3OBY A;  4ICL A;  3H1Q A;  1QSL A;  4JI7 K;  4PUO A;  1JLB A;  2FF3 B;  4B9T A;  1ZC6 A;  3VN5 A;  4IBN A;  5M1F A;  2DFF A;  3MCA B;  4B8C A;  2KLA A;  1KC8 O;  1F21 A;  3CHW A;  4DCH A;  2PY5 A;  2X78 A;  2BAN A;  4HTL A;  2VCP A;  2QK9 A;  1KTQ A;  4DFJ A;  2HHV A;  5EX5 A;  4O4G A;  3K2P A;  1GOB A;  3G71 N;  1IKY A;  1TYQ B;  4BQL A;  4CHP A;  4I6M A;  5CZ1 A;  5AJ3 K;  1OH8 A;  3NFA A;  4O5F A;  5C2D A;  1BHL A;  3SJH A;  1HNW K;  3EY1 A;  3VQ5 A;  2IVN A;  3H46 O;  4EZ6 A;  2P9S B;  4CFA A;  1XQS C;  1RDB A;  3VQC A;  1BCM A;  1QQN A;  4YNQ A;  2VQE K;  1GOA A;  5BRD A;  5J2M A;  5LMN K;  1NJY A;  4FWL A;  1NJI O;  4BRD A;  3R6M A;  1S72 N;  3VF4 A;  3OBW A;  4DQQ A;  4DR2 K;  2Q3S A;  2XO7 A;  4FLZ A;  5B8H A;  1RBT A;  4CF0 A;  3SQ1 A;  3LP0 A;  3V9W A;  4FPA A;  2UUC K;  1LW0 A;  2NRW A;  1NGD A;  1JLE A;  4ISG A;  3E9L A;  3K57 A;  2JWK A;  4IO8 A;  4B1X B;  4W5R A;  2OPP A;  1Q7Y O;  2FSK A;  2OTJ N;  4CZM A;  2E5L K;  1D8Y A;  2E2O A;  3PLA A;  4FZY A;  1E3M A;  4BR2 A;  3V4I A;  4LF7 K;  5F2R A;  2WTU A;  4FOE A;  4KH5 A;  1TK0 A;  4JI1 K;  4BRG A;  2A1R A;  5AQZ A;  4CGI A;  4GKJ K;  3PO4 A;  1JLG A;  5BRH A;  2VWB A;  2QEX N;  4DTM A;  3OA9 A;  3AVK A;  5H1S Q;  4RG8 A;  3L2R A;  1C1C A;  1A5V A;  1VQL N;  3I0S A;  1S6Q A;  4C1N K;  3FR0 A;  5AQT A;  4E3S A;  3AO5 A;  3CMA N;  4RWT A;  3VOV A;  3LPU A;  1KVB A;  5AQW A;  5KRS A;  2F7T A;  3C6A A;  1KD1 O;  1XC3 A;  4BRP A;  4KTW A;  3KK3 A;  4JS5 A;  3LDO A;  3LL3 A;  2YNI A;  4KRF A;  2HBK A;  3TSP A;  1YTA A;  1KAX A;  4BRN A;  1NJZ A;  4DV4 K;  4O44 A;  4PKH A;  4JKG A;  4NCA A;  4LC9 B;  3WQU A;  2P5O A;  2FBX A;  4CES A;  5CHI A;  2OZM A;  4CJW A;  1P90 A;  4IZ9 A;  4OVL A;  2OPR A;  4V19 S;  1EET A;  2P9U B;  3GBT A;  4MO5 A;  3MEE A;  1XMQ K;  5AZJ A;  2RPI A;  3H45 C;  4L3Q A;  3MDQ A;  3R9P A;  5DMR A;  4KHP K;  4AH9 A;  4JI8 K;  4CJ3 A;  1RFQ A;  4DR1 K;  2O8F B;  2OPS A;  1EXQ A;  3LAL A;  3CFO A;  1U2V A;  4CW7 B;  3CQ8 A;  2UU9 K;  1P8Z A;  1NLV A;  1JCG A;  1FKP A;  4C8L A;  3KZB A;  4Z0U A;  2A3Z A;  4CJT A;  3DRP A;  4ID5 A;  4RW6 A;  3L2Q A;  1J53 A;  3VQA A;  2YHW A;  1JL2 A;  3VGM A;  3HK2 A;  1B92 A;  3GG4 A;  1D9F A;  2D0C A;  3VQ7 A;  3KIO A;  3CC4 N;  4CJQ A;  3CI5 A;  4LF5 K;  4DSL A;  2JGU A;  3L6Q A;  5HRS A;  2QKB A;  3ISN C;  5EOY A;  1RT5 A;  2D4W A;  3I56 N;  2FC0 A;  1EO1 A;  4Z94 A;  1VSM A;  1J9A A;  3D6R A;  4C8M A;  3O3G A;  4M3U A;  4CEQ A;  3PUF A;  4CEA A;  1X9W A;  2E6L A;  3C7N A;  3AV9 A;  3ZX2 A;  5AQG A;  2NRR A;  3K0S A;  4DQI A;  3IKM A;  4LSN A;  4DKW A;  2HMP A;  2PAV A;  2Q1N A;  1T3V A;  3O1W A;  3AAQ A;  5C2F A;  3K5N A;  3OS2 A;  2FLO A;  2RF2 A;  4B1V A;  2ITM A;  1K8K B;  1T05 A;  1NM1 A;  1GLL O;  2ASP A;  4CZK A;  4DFM A;  1LAW A;  4J2E A;  4FK2 A;  3TAR A;  2NLX A;  4HVJ A;  1UWB A;  1RTH A;  2HF4 A;  4FJX A;  4CJR A;  1TAU A;  2UXB K;  4BC4 A;  3ZYY X;  3G4S N;  3ZSX A;  4BGA A;  4BG9 A;  4U7B A;  3VEY A;  1Q86 O;  3CQX A;  3S9H A;  4FK4 A;  3DLR A;  5EVZ A;  4I2Q A;  1BI4 B;  2FSJ A;  5BR8 K;  4FM1 A;  3CCR N;  1XC9 A;  1JLQ A;  3WXM B;  1C0U A;  5BN9 A;  4DLE A;  3OW2 M;  3W3D A;  4DSF A;  1NK4 A;  3CFR A;  4KB0 A;  2GWK A;  2BTF A;  4KHQ A;  2G8F A;  2KZM A;  4KI6 A;  4BRE A;  3NMU A;  2RKI A;  4JAX A;  2G8U A;  4DSI A;  3QFU A;  2E2P A;  3OYH A;  3NGZ A;  4JHD A;  1WN7 A;  3AAR A;  4B1Y B;  5AQU A;  1ZBS A;  2IC3 A;  1CLQ A;  3DMJ A;  3DXM B;  2NUB A;  4CEZ A;  3OS0 A;  3ENO A;  3SUQ A;  3IAY A;  1FK9 A;  4M45 A;  4O0I A;  4BDY A;  4WYB A;  3ENH A;  5DK5 A;  4CGH A;  4Z4I A;  2GTD A;  4TSX A;  3AA4 A;  2KFZ A;  3NH0 A;  2IVP A;  2PBD A;  4YOY A;  3SPZ A;  3SQ0 A;  4C23 A;  3S3N A;  1WB9 A;  3TWH A;  4GV3 A;  3MN7 A;  5T7B A;  4W5T A;  3TSQ A;  1D5A A;  3AVI A;  4DV2 K;  2F9W A;  4JKH A;  2GEL A;  4IO9 L;  5HOO A;  4GKK K;  1VSL A;  2W41 A;  3CM5 A;  1KSP A;  3C6H A;  3WEE B;  3KD1 E;  1W2B M;  5KQD A;  3AVJ A;  4CEC A;  3CF5 L;  2PYL A;  2FBV A;  1HKB A;  3TU5 A;  5BPL A;  4BR9 A;  5J2N A;  1VQM N;  5M1K A;  4YOT A;  1CZB A;  1TUU A;  2IOC A;  5KRT A;  3VA0 A;  5F1X A;  1YT3 A;  3I55 N;  1MA9 B;  1YIJ N;  1YIT N;  4IJA A;  5FRM A;  3ZSO A;  3DWL A;  4DTU A;  3C65 A;  3L2V A;  1RDC A;  4FJJ A;  4J2A A;  4ELV A;  3WXL A;  5JVG L;  4RW8 A;  1S1V A;  1RBV A;  4MO4 A;  3ZSY A;  3QEP A;  1YHQ N;  3NH2 A;  4EIA A;  2F8S A;  1BO5 O;  4YOV A;  3UKU A;  3V1R A;  5AR0 A;  5LJV A;  4K8Z A;  4M3T A;  1OVY A;  4CED A;  5KPR A;  4OLB A;  1G99 A;  3PX4 A;  4BR7 A;  5AQO A;  4DV0 K;  4BRI A;  3O5B A;  1DGK N;  4KTQ A;  2P9I B;  2HBM A;  4BRH A;  3KJV A;  4CZH A;  1KLM A;  4FLU A;  1VRU A;  3PO5 A;  2A1S A;  3WQT A;  4ID1 A;  2NRZ A;  3EL2 A;  4JKB A;  2O8B A;  4IEE A;  3QML A;  3L3U A;  3THW A;  4J2D A;  4A2A A;  4MLH A;  2HMI A;  2OZS A;  3RWU A;  3CM6 A;  3DAW A;  3VMF B;  2FF6 A;  3CCM N;  2QWL A;  4O5B A;  2ZGZ A;  4K41 A;  1RDW X;  5FPM A;  3JSM A;  3ZET A;  4GV6 A;  2QXL A;  3FE1 A;  1BGX T;  2QXF A;  4KV8 A;  1XHZ A;  4FJH A;  3D0P A;  4FJI A;  1RBS A;  3LPT A;  3OTO K;  3L3V A;  1U47 A;  1WNS A;  4JKF A;  2WC9 A;  1UOC A;  1VQP N;  4DMN A;  5C10 A;  3LDL A;  3EN9 A;  3W0L A;  2HBJ A;  1S9E A;  3IS9 A;  1LOT B;  5D3G A;  2B5J A;  4EZ9 A;  1FJG K;  4BR4 A;  4H5W A;  3A2F A;  1KFS A;  4Z4F A;  4KHS A;  1ZBH A;  1MWM A;  3O9Q A;  4CFB A;  3O1B A;  4E7H A;  4FLY A;  2P5G A;  1JCE A;  4G1Q A;  3FZM A;  2A42 A;  2QWQ A;  2Q97 A;  4YHH K;  4DV7 K;  3CC7 N;  1QQM A;  4IDK A;  1C0F A;  4CFD A;  4XH1 A;  1U48 A;  4KHW A;  2EHG A;  1RT3 A;  2VQF K;  1RBR A;  3EEQ A;  1Q18 A;  1C0T A;  2P9N A;  2OCE A;  3LAM A;  3OVN A;  5E26 A;  3G10 A;  3QBW A;  4CEF A;  3EKS A;  5HRP A;  3KWI A;  1N33 K;  3O8M A;  1IBL K;  4CZL A;  3F9K A;  3HTV A;  4C8O A;  3DOL A;  3P5J A;  2ITG A;  4K0K K;  3O4N A;  2P9K B;  2OTL N;  3KD5 E;  4IOA L;  2V52 B;  3HT3 A;  1E4G T;  4BVO A;  4FWM A;  3WUH A;  1QHT A;  3ZSQ A;  4CHY A;  3HL8 A;  1IV0 A;  4JI6 K;  4BY9 C;  4FLV A;  3CME N;  4K8X A;  3A5L C;  5JS1 A;  2YNG A;  2F8T A;  2RN2 A;  3O9T A;  1XNQ K;  4CHO A;  3L8B A;  3BF3 A;  4QS7 A;  4JN4 A;  3KLG A;  1KAY A;  4DV5 K;  4CF8 A;  1SV5 A;  4H0T B;  3J7Y P;  5J2Q A;  4M3X A;  1W0H A;  2O8C A;  3AO3 A;  4C8N A;  1W9H A;  4BAC A;  4DTX A;  2D1K A;  4QCL A;  1YXQ A;  4NCG A;  4CIF A;  1X3N A;  2FBT A;  4KB1 A;  2ZQB A;  1HKC A;  4BDP A;  1NJX A;  2HST A;  2NRX A;  1G15 A;  4E7L A;  2A41 A;  4JK8 A;  4NCB A;  4WFN L;  4FOI A;  4FWO A;  3CPE A;  2Q0U A;  2O4I A;  4DLG A;  1HKG A;  2B4J A;  2E8A A;  4CE9 A;  3CPW M;  3C0B A;  1BIU A;  3NGI A;  3GOI A;  3ZT2 A;  4DSE A;  3KWG A;  4BC5 A;  4CJ7 A;  5IT9 O;  3SUO A;  1SL0 A;  4OPH A;  4LFB K;  4MQ3 A;  1VQ9 N;  2P9S A;  4IOC L;  2E1Z A;  3AGR A;  4CD3 A;  5GAE P;  1RTD A;  1OH6 A;  4ISE A;  3NF7 A;  3V81 A;  3U3G A;  1SS6 A;  1RTJ A;  3LZI A;  1M1K O;  1BU6 O;  5DM7 L;  2VGM A;  4B8A B;  3KTQ A;  4CIE A;  2D0B A;  4H03 B;  4B3S K;  1OKJ A;  4YOX A;  4K42 A;  5CYM A;  2WBN A;  5IWA K;  4F3O A;  1RIL A;  4CZE A;  4CHN A;  4AM7 A;  3NF6 A;  3VQ8 A;  4RW9 A; 
#chains in the Genus database with same CATH homology
 1JXB A;  4Z4H A;  4RW4 A;  2HHW A;  2VG5 A;  3DRS A;  3ZSZ A;  1RT2 A;  4FJK A;  1QS4 A;  3MEE A;  4FXD A;  3MXI A;  4J2B A;  1JL1 A;  2RPI A;  3HVT A;  1TGO A;  3ZT0 A;  4FZX C;  4KHU A;  4CGD A;  1KRP A;  3VQQ A;  4HUF A;  4FLT A;  1NOY A;  5DMR A;  1S1T A;  2HB5 A;  4AH9 A;  1L5U A;  3IG1 A;  4CJ3 A;  2YV0 X;  3RMC A;  2OPS A;  3SUP A;  1VSI A;  1EXQ A;  2Z1H A;  3LAL A;  2D5R A;  5HBM A;  3VQE A;  3CFO A;  4WE1 A;  4CGJ A;  2XY7 A;  3CQ8 A;  1JLF A;  3HST B;  2QKK A;  1L3U A;  4C8K A;  4KPY A;  4OKJ A;  1FKP A;  1LAV A;  4C8L A;  2BE2 A;  1BCO A;  4GW6 A;  4Z0U A;  4CJT A;  4PA1 A;  3WNE A;  3V9X A;  3K59 A;  3DLK A;  3DRP A;  4ID5 A;  3OYC A;  1WSJ A;  4Y1C A;  3AVN A;  1I3A A;  1VRT A;  4RW6 A;  5J1E A;  3L2Q A;  4FM0 A;  3OJU A;  1J53 A;  4AIL C;  3VQA A;  1IH7 A;  1JL2 A;  3SYZ A;  4L8R B;  1JXE A;  3C94 A;  2BGG A;  3HK2 A;  1U49 A;  3K5M A;  1B92 A;  3RMA A;  1SKW A;  3FFI A;  2D0C A;  3VQ7 A;  3KIO A;  1D9F A;  2G8K A;  4CJQ A;  4KI4 A;  4W5Q A;  4BWM A;  4JRQ A;  4ZTJ A;  3ZSR A;  4DSL A;  3QIO A;  1ITG A;  1IKV A;  1O1W A;  2JGU A;  2GV9 A;  1VSD A;  4CEE A;  3P83 D;  4AHV A;  4EP5 A;  5HRS A;  1VSH A;  3OYL A;  2QKB A;  1UA0 A;  4B08 A;  3AA2 A;  3AVH A;  3ISN C;  1X1P A;  4FCY A;  1KVC A;  2KZZ A;  1RT5 A;  4I2P A;  2G8H A;  2IDO A;  2FC0 A;  1ASW A;  1L3S A;  3DYA A;  1VSM A;  3NE6 A;  3HPG A;  1J9A A;  3C95 A;  2PZS A;  3VQD A;  1IKW A;  3QEI A;  4C8M A;  3HP6 A;  3V9U A;  4R5P A;  3O3G A;  4M3U A;  4CEQ A;  3AVM A;  3BDP A;  3PUF A;  3SNN A;  4CEA A;  1NK6 A;  4B9U A;  1X9W A;  1UAX A;  2E6L A;  4CK2 A;  3OY9 A;  4FW1 A;  3OYE A;  2HNY A;  4CJF A;  5I3U A;  4CHQ A;  3QEV A;  5HRR A;  4DTN A;  3AV9 A;  2AJQ A;  3DLE A;  4M41 A;  4FM2 A;  4DQI A;  4LSN A;  3WNH A;  4DTR A;  4DFP A;  3MXJ A;  3HM9 A;  1WSG A;  4CK1 A;  5HP1 A;  4H4O A;  3H08 A;  1JKH A;  3M8R A;  3K5N A;  4DTO A;  3OS2 A;  3THV A;  1X9S A;  4N5S A;  1T03 A;  2RF2 A;  1EX4 A;  3RMD A;  3DLH A;  4OLA A;  2G8W A;  5FDL A;  3ULD A;  1T05 A;  3HXM A;  2VG7 A;  1J54 A;  1LAW A;  3AA5 X;  4DFM A;  4J2E A;  2KQ2 A;  3TAR A;  4FK2 A;  1RCH A;  4M3R A;  3SV4 A;  4DFK A;  4DU1 A;  3T1A A;  1REV A;  1UWB A;  1RTH A;  2YHA A;  4HVJ A;  4Q5V A;  3O3H A;  1NK5 A;  3PX0 A;  4OKE A;  3U6F A;  4FJX A;  4CJR A;  1TAU A;  4AHC A;  3ZSW A;  3ZSV A;  5C25 A;  3ZSX A;  1Y97 A;  4IFY A;  3LDS A;  1TK8 A;  2XHB A;  4FZZ A;  2HVH A;  3KKR A;  4Q0B A;  5EU7 A;  3S9H A;  3RR8 A;  1Q8I A;  3SV3 A;  4CJS A;  4FK4 A;  2HHT A;  3DLR A;  1TKT A;  3AVF A;  4I2Q A;  2XY5 A;  1BI4 B;  4CF9 A;  3HPO A;  4Z4E A;  4FM1 A;  3G0Z A;  4N56 A;  1XC9 A;  1JLQ A;  4LY7 A;  3DRR A;  4DS5 A;  3SI6 A;  1C0U A;  1HNV A;  3AVL A;  4DLE A;  3TAN A;  4CK3 A;  1TV6 A;  1Z25 A;  4QAG A;  4DSF A;  3M8S A;  1NK4 A;  1ZBI A;  1LWC A;  3DOK A;  3NHG A;  4E1N A;  3CFR A;  4DS4 A;  4DTP A;  1ASU A;  4KB0 A;  5J2P A;  3WNF A;  4ZTF A;  1CXU A;  1TKD A;  2G8F A;  4KHQ A;  4DTJ A;  1LWF A;  3NGY A;  1NKC A;  3NF8 A;  2KZM A;  3PV8 A;  1B9F A;  4KI6 A;  2LSN A;  3KLI A;  2RKI A;  4XIU A;  2G8U A;  1KCF A;  4DWI A;  4DSI A;  1RBU A;  4LSL A;  2YNF A;  4E19 A;  4Z4C A;  3L2U A;  3D45 A;  3PX6 A;  5I42 A;  1QTM A;  3OYH A;  4CIG A;  2HHS A;  3NGZ A;  3L2W A;  1WN7 A;  4W5O A;  3ZT3 A;  4CCH A;  1NK0 A;  4FJM A;  2YKM A;  1SKS A;  4DQS A;  2IC3 A;  1HQE A;  2OPQ A;  2X6S A;  5E41 A;  1HMV A;  3DMJ A;  1SL1 A;  1CLQ A;  1VSE A;  3T3F A;  1NKB A;  2NUB A;  1C1B A;  5FRO A;  2HHX A;  3LP1 A;  4CEZ A;  1WSE A;  3OS0 A;  3SUQ A;  1LW2 A;  1QSY A;  3IAY A;  4QOZ B;  1FK9 A;  4M45 A;  4O0I A;  3K5L A;  4B9N A;  1RTI A;  5SZT A;  4LH4 A;  1KVA A;  4BDY A;  4PQU A;  4FJ7 A;  1HYV A;  5DK5 A;  4CGH A;  4Z4I A;  1S1U A;  4AHT A;  4TSX A;  3AA4 A;  2KFZ A;  4CGF A;  3TAF A;  3NH0 A;  4E7J A;  3HVR A;  4B9M A;  4I9Q A;  2KFN A;  3QO9 A;  4KAZ A;  1BL3 A;  3SQ0 A;  3SPZ A;  3V9Z A;  1WAJ A;  1KLN A;  2WON A;  2ZE2 A;  3QLH A;  3KKS A;  4KHN A;  3KLH A;  4HTU A;  2ATQ A;  3MEG A;  3S3N A;  4LD0 A;  4B9S A;  1FKO A;  4FVM A;  4N47 A;  1WSI A;  1S1W A;  3TWH A;  4OPJ A;  3LP2 A;  3ALY A;  5T7B A;  1NK8 A;  4W5T A;  2HHV A;  4CJP A;  1D5A A;  3AVI A;  4Z4G A;  3S3M A;  1NKE A;  3O4Q A;  3ZT1 A;  3OYJ A;  3K5O A;  1VSL A;  4JLH A;  3DM2 A;  2JLE A;  3CG7 A;  3HP9 A;  4DQP A;  3CM5 A;  1KSP A;  2IGI A;  2P1J A;  4PY5 A;  2VWJ A;  1IKX A;  4M42 A;  4W5N A;  3B6P A;  4CFC A;  3KD1 E;  2IS3 A;  3M8P A;  3HJF A;  2DY4 A;  1XWL A;  3B6O A;  3AVJ A;  2W42 A;  1DTQ A;  1LV5 A;  3LAN A;  4CEC A;  3OYM A;  3TAP A;  4B9V A;  2PYL A;  3KLE A;  4DSK A;  2FBV A;  3U3Y A;  3OJS A;  4CEO A;  3TAE A;  4JRP A;  1VSF A;  3TI0 A;  1L3T A;  5J2N A;  1S9G A;  3C6U A;  3HPH A;  1NJW A;  4HUG A;  4FJN A;  1CZB A;  2IOC A;  3MED A;  5KRT A;  4DG1 A;  3VA0 A;  1YT3 A;  3QIP A;  4O55 A;  1Z26 A;  1HJR A;  3RR7 A;  4F3T A;  5HRN A;  2YHB A;  4AHR A;  4EP4 A;  3NH1 A;  1CXQ A;  5FRM A;  3ZSO A;  1KFD A;  3KK1 A;  3OYB A;  4DTU A;  3L2V A;  1RDC A;  4FJJ A;  4J2A A;  2XY8 A;  3QIN A;  4HCC A;  4ELV A;  4KFB A;  1ZYQ A;  4F4K A;  2X6N A;  4RW8 A;  1S1V A;  3KLF A;  1RBV A;  1QQC A;  5K14 A;  3SPY A;  2GBZ A;  3ZSY A;  1U04 A;  3QEP A;  4DTS A;  3SQ4 A;  4CJL A;  3NH2 A;  1X9M A;  3WNG A;  2O4G A;  3RRH A;  3QNN A;  2F8S A;  2VWK A;  4CJV A;  5SWM A;  1BIZ A;  1JLA A;  3V1R A;  4BDZ A;  2P51 A;  3AO1 A;  2Z1G A;  3NDK A;  1HNI A;  3VQP A;  2HNZ A;  4K8Z A;  3SQ2 A;  2PYJ A;  4M3T A;  4CED A;  3MXM A;  3TAG A;  1VK0 A;  3AVG A;  4DU4 A;  4OLB A;  1K6Y A;  3O3F A;  4O0J A;  3QER A;  4CJU A;  3PX4 A;  2E6M A;  4NYN A;  4CHZ A;  4KTQ A;  1RDA A;  2KW4 A;  3KJV A;  1KLM A;  1RT7 A;  1XHX A;  1DLO A;  2IAJ A;  1VRU A;  3ZCM A;  4CJE A;  3C6T A;  3QES A;  3PO5 A;  3UIQ A;  2A1S A;  4FW2 A;  4ID1 A;  3TR8 A;  3K58 A;  4HUE A;  4HHT A;  4E7K A;  4OPK A;  4FYD A;  3MAQ A;  2YKN A;  3L3U A;  3VA3 A;  4HCB A;  4J2D A;  1ASV A;  4KHY A;  4IKF A;  2HMI A;  3RRG A;  4H4M A;  4UQG A;  2OZS A;  2OA8 A;  3RWU A;  3OYA A;  3VQ6 A;  1R0A A;  3DLG A;  4DF8 A;  5FRN A;  4H8K A;  3CM6 A;  1C6V A;  4NYF A;  3LWM A;  5HLF A;  3BGR A;  3OYN A;  3LWL A;  1N6Q A;  1LWE A;  1RNH A;  1VSK A;  4O5B A;  3NAE A;  3SUN A;  1RT4 A;  3V1Q A;  3V1O A;  1HYS A;  1TL1 A;  3JSM A;  4E89 A;  3CFP A;  4YFU A;  1S1X A;  3M8Q A;  1J5O A;  1WLJ A;  1BGX T;  1GOC A;  2QXF A;  4KV8 A;  5CY4 A;  1Q9Y A;  1HQU A;  3OYG A;  4KO0 A;  1XHZ A;  1HPZ A;  3D0P A;  3OYI A;  4FJH A;  4FJI A;  1RBS A;  3EYZ A;  3LPT A;  3L3V A;  4CER A;  1WNS A;  1U45 A;  1QE1 A;  1U47 A;  2Z1I A;  3VQ4 A;  3I0R A;  1S5J A;  1UOC A;  2X74 A;  5CYQ A;  4DMN A;  3QEX A;  1ZBL A;  4ELT A;  1WSF A;  5C42 A;  2BDP A;  3AVA A;  2DFE A;  4ICL A;  1QSL A;  2Y1J A;  1MU2 A;  1S9E A;  3IS9 A;  4CF2 A;  4PUO A;  5D3G A;  2B5J A;  2WOM A;  1JLB A;  1T8E A;  3V9S A;  4EZ9 A;  4B9T A;  3NF9 A;  3VN5 A;  4BE1 A;  4F8R A;  4IBN A;  3NBP A;  2DFF A;  4M3Y A;  3A2F A;  4CEB A;  3CYM A;  5KGX A;  1KFS A;  4KHS A;  4Z4F A;  4B8C A;  1ZBH A;  4CFB A;  4KRE A;  1TL3 A;  4FJ5 A;  1F21 A;  4E7H A;  4B3O A;  4PWD A;  4FLY A;  2X78 A;  2BAN A;  4KTZ A;  2PY5 A;  2P5G A;  2DFH A;  2QK9 A;  4OKK A;  4G1Q A;  1KTQ A;  4DFJ A;  1S6P A;  3E01 A;  1A5X A;  1TKX A;  4O4G A;  3S3O A;  1N5Y A;  3ASM A;  1GOB A;  3K2P A;  5JS2 A;  2Z1J A;  4DQR A;  1EKE A;  1IKY A;  4IDK A;  2XY6 A;  4CHP A;  5CZ1 A;  3MEC A;  4FJ8 A;  3NFA A;  4CFD A;  3V6D A;  1BHL A;  1U48 A;  4GVM A;  2EHG A;  3EY1 A;  4OJR A;  3VQ5 A;  4FLX A;  4KHW A;  1RT3 A;  4FLU A;  1RBR A;  3OYF A;  1C0T A;  1ZBF A;  3LAM A;  3OVN A;  3P1G A;  4IFV A;  4EZ6 A;  2HHQ A;  4N41 A;  2ETJ A;  3SZ2 A;  3G10 A;  4CEF A;  3QNO A;  4B9L A;  4CFA A;  5HRP A;  4E1M A;  3AVC A;  2EX3 A;  1RDB A;  3VQC A;  1BCM A;  4AHS A;  3F9K A;  5C24 A;  4KKO A;  4YNQ A;  1GOA A;  4C8O A;  5J2M A;  3IRX A;  3DOL A;  1NJY A;  1YVU A;  3P5J A;  1RT1 A;  4FLW A;  1EP4 A;  3DLB A;  2ITG A;  4N76 A;  3O4N A;  4IG3 A;  3VQ9 A;  4DQQ A;  4BWJ A;  2Q3S A;  2XO7 A;  1IG9 A;  4F2R A;  4FLZ A;  1BI4 A;  3KD5 E;  3HT3 A;  3HYF A;  3LAK A;  3QEW A;  1QHT A;  3ZSQ A;  4CHY A;  1RBT A;  3HL8 A;  4CF0 A;  3SQ1 A;  3LP0 A;  3OYK A;  3V9W A;  2YNH A;  1LW0 A;  4FLV A;  3AA3 A;  3AO2 A;  1BQM A;  1JLE A;  1NOZ A;  5KGW A;  4K8X A;  5JS1 A;  4M3W A;  4OGE A;  1HYZ A;  3K57 A;  2YNG A;  2F8T A;  4W5R A;  2OPP A;  3DI6 A;  2RN2 A;  4ZHR A;  4CF1 A;  1VSJ A;  2HHU A;  1BQN A;  1SL2 A;  1I39 A;  1D8Y A;  3VQB A;  4CHO A;  3L8B A;  4I7F A;  2DTU A;  2F96 A;  1HRH A;  3KLG A;  3RTV A;  4FZY A;  1JLC A;  4CF8 A;  4CGG A;  3V4I A;  4I9L A;  1SV5 A;  5J2Q A;  3TAQ A;  1SKR A;  4M3X A;  1W0H A;  3AO3 A;  4C8N A;  1TK0 A;  1W9H A;  4BAC A;  4DTX A;  1TVR A;  3NCI A;  1WSH A;  2A1R A;  4CGI A;  2KTQ A;  3ZT4 A;  4QCL A;  3RMB A;  3PO4 A;  3SCX A;  2B6A A;  1JLG A;  1TAQ A;  1IO2 A;  4NCG A;  1SUQ A;  3T19 A;  1A5W A;  4CIF A;  1CZ9 A;  3OS1 A;  4E7I A;  4FK0 A;  4E0D A;  2FBT A;  4KB1 A;  2ZQB A;  4JS4 A;  4DTM A;  4BDP A;  3I8D A;  3AVK A;  4RG8 A;  3L2R A;  1NJX A;  1G15 A;  1C1C A;  5KTQ A;  1A5V A;  4E7L A;  2D0A A;  4NCB A;  1YTU A;  2I5J A;  1RDD A;  4DSJ A;  3I0S A;  1Q9X A;  1S6Q A;  4DF4 A;  2ZD1 A;  2G8V A;  4FJ9 A;  1NK7 A;  5KI6 A;  2O4I A;  4DLG A;  4Y1D A;  4GMJ B;  4E3S A;  2B4J A;  3KK2 A;  4CE9 A;  3AO5 A;  3OYD A;  3EZ5 A;  1BIU A;  1BIS A;  3NGI A;  3ZT2 A;  4DSE A;  2G8I A;  2XRI A;  3LPU A;  2HW3 A;  1C0M A;  3AO4 A;  1KVB A;  4F2S A;  3SUO A;  4LH5 A;  1SL0 A;  4CJ4 A;  5KRS A;  4M3Z A;  3TAB A;  4MQ3 A;  4CJ5 A;  3LZJ A;  1C1A A;  1DTT A;  4KTW A;  1U4B A;  3KK3 A;  3ITH A;  4CJK A;  1RT6 A;  4JS5 A;  1L3V A;  2YNI A;  4KRF A;  1QSS A;  1RTD A;  1T7P A;  2R7Y A;  1XI1 A;  4FJL A;  1UA1 A;  1D9D A;  1YTA A;  3NF7 A;  2OYQ A;  4OGC A;  3V81 A;  3QET A;  1FXX A;  5CZ2 A;  3U3G A;  3JYT A;  4BE2 A;  1NJZ A;  1NK9 A;  2HVI A;  1RTJ A;  4AHU A;  1WAF A;  3LZI A;  1B9D A;  5HRO A;  4BE0 A;  3PY8 A;  4MFB A;  3TAM A;  4ELU A;  2GUI A;  1TK5 A;  2Y1I A;  4O44 A;  4B8A B;  4IG0 A;  3KTQ A;  4CIE A;  1ZBU A;  3F73 A;  2HND A;  2D0B A;  3LP3 A;  4NCA A;  2OZM A;  2P5O A;  2E4L A;  2FBX A;  4CES A;  4FJG A;  4DU3 A;  4CJW A;  1TKZ A;  3HO1 A;  2VG6 A;  5CYM A;  3AVB A;  3SJJ A;  4F3O A;  1RIL A;  2FBY A;  4OVL A;  2OPR A;  4RW7 A;  4CHN A;  3NF6 A;  3VQ8 A;  1EET A;  4RW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...