3HYFA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
143
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
molecule keywords Reverse transcriptase/RNaseH
total genus 46
structure length 143
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hyfA00
4LD0A 4DFKA 1S1WA 1T03A 4FYDA 1Q9XA 4C8NA 4I2PA 4KFBA 3VQPA 4CEQA 4CCHA 2G8WA 3QIOA 1KRPA 4Z4GA 3K5OA 4B9VA 5KTQA 1RT1A 3DOLA 3G0ZA 3S9HA 4KHWA 1WSJA 1WN7A 4CF9A 5KGXA 3P83D 2YKMA 3E01A 3ZSYA 2XY5A 3K5NA 3MEDA 2GBZA 4KB1A 1RTJA 3OS0A 3TAQA 4FLXA 4KAZA 4WE1A 1EKEA 2O4IA 1GOAA 3LWMA 4IBNA 1RT5A 1UA1A 1C1AA 4DMNA 3OYKA 2IDOA 4OPJA 4DS4A 2A1RA 4QCLA 1KCFA 3DMJA 4ELVA 3TANA 4CF0A 2HNZA 1IKYA 1ASUA 3V81A 1L3TA 4JLHA 4L8RB 3DLKA 1Z26A 4Z4EA 4KPYA 2D5RA 1HNIA 3NF6A 2YNGA 1C1CA 3VQDA 3MXIA 2Z1GA 3QEWA 2XY7A 5FDLA 1CXQA 1JLQA 1WAJA 3IRXA 4KREA 2OPPA 1LWFA 4MQ3A 3TWHA 3V9XA 1RDCA 1RDDA 4B08A 1UAXA 4Z4HA 4E7HA 3VQ6A 3LZJA 5K14A 1NKEA 1RDBA 1TK8A 3ZSVA 1JXBA 3KD5E 4DWIA 1LWEA 2QK9A 3HM9A 3P5JA 4E7JA 2BANA 4N76A 2KTQA 3L3UA 1S1XA 2IGIA 4KTWA 2RKIA 4N5SA 4OLAA 2JLEA 2BGGA 1RILA 3LANA 5J2PA 4BE1A 2OZSA 5CY4A 2YHBA 3HPHA 1GOBA 1VRUA 1BL3A 4IDKA 1RTIA 4FJ5A 4Y1CA 1U49A 4ZHRA 2DFHA 4M45A 4QAGA 4YNQA 3V9SA 3LP3A 4N56A 4NCBA 1Q8IA 3I0SA 3PUFA 4AHSA 1U4BA 4H4OA 1ITGA 3OYGA 4RG8A 3ZT4A 3D45A 1VSEA 3QESA 4MFBA 1D9DA 2G8IA 3AVCA 2X6NA 1RT3A 3SI6A 4B9UA 1CLQA 4FK2A 3VQEA 3RMBA 3QIPA 1VSJA 2KFZA 1BIUA 4IG0A 4C8MA 3AVFA 1QSSA 1RBRA 4HCCA 1S9GA 3H08A 3MECA 3NGZA 3TAFA 3DLHA 4E1MA 2XO7A 4IFVA 3QLHA 3NHGA 4W5RA 3CFPA 4KHYA 1NK6A 4ELTA 2HNDA 1NJWA 4CGJA 4E7IA 1CZBA 4KHQA 3NF7A 3RR8A 3PV8A 3ASMA 1BCMA 1QS4A 1Y97A 4KTZA 4N47A 3DLEA 4AHCA 4W5TA 1TVRA 2E6LA 3L3VA 3OY9A 4HHTA 2XRIA 2AJQA 1LW2A 2IS3A 5C24A 1X9MA 1I39A 3VN5A 1KLNA 4GMJB 3OYLA 1BI4B 1DTTA 4DSIA 3SV4A 5SWMA 4FW2A 4DQRA 1IH7A 3RRGA 4CJSA 3D0PA 3SPYA 4FJGA 2HHVA 4CFCA 4CGGA 4W5OA 3OYCA 4FZXC 4FK0A 1J9AA 4M42A 3IS9A 4CHYA 4OPKA 3I0RA 3SUOA 1HJRA 1MU2A 4PA1A 4LY7A 3WNFA 1L3UA 4CEBA 4IKFA 1EETA 4CK3A 4DTMA 2IAJA 2RN2A 3ZT0A 4KO0A 4CK2A 1ZBIA 1IKVA 1ZBUA 1DLOA 4CHNA 3CYMA 1TAQA 3F9KA 4ICLA 1KSPA 3NGIA 3HVTA 3AO4A 2O4GA 4CJ4A 3VA3A 1TV6A 5HRPA 4LH4A 4Z4IA 2F96A 3SQ4A 1RBSA 3AVKA 3HSTB 4DTSA 1Q9YA 1XWLA 4M3RA 4F2RA 2IOCA 4FJ8A 4CJLA 3LP0A 3OS2A 1SKWA 2B4JA 1VSMA 1NOZA 1FXXA 3FFIA 5EU7A 3AVNA 4CGDA 4CF2A 4JS5A 3HPOA 4HVJA 2GV9A 4OKKA 3JYTA 4BDYA 1NK7A 1SL0A 2HMIA 2KFNA 1HPZA 4DSJA 3L2UA 4O44A 4HUEA 3M8PA 4CF1A 3SUQA 2ZQBA 3DRPA 3KKRA 4F2SA 3AVGA 3C94A 4N41A 1HRHA 2F8TA 1QHTA 4IG3A 5CYMA 3ZT1A 4O0IA 4FLUA 1G15A 4DSEA 1J5OA 4F3OA 4E1NA 4FJJA 4DSFA 1L5UA 2FBVA 3MXJA 4CJVA 1VRTA 3LAKA 4NCGA 2ETJA 4CHQA 2G8HA 3KD1E 4O0JA 4C8OA 4H8KA 3NH2A 3L2WA 3AV9A 3HL8A 3K59A 3TAEA 4DTPA 5J2QA 1KVBA 1RT7A 3AVHA 3AVMA 4BWJA 3T19A 1NK4A 1JLCA 1S1TA 5T7BA 2D0BA 3SUPA 3NE6A 4DLGA 1JLGA 4G1QA 1NJXA 3PY8A 4O55A 4RW4A 4E7LA 1BIZA 4W5NA 1A5WA 3O3FA 4CJRA 4HCBA 3ZSOA 5HBMA 4CECA 1VSLA 3U6FA 1WLJA 3OYBA 2OPQA 2ITGA 3AVIA 4FVMA 2G8FA 4O5BA 4DTRA 3HP9A 5KI6A 4OGCA 4TSXA 1TK5A 4OVLA 1BHLA 2OPRA 4B8CA 5KRTA 3SQ1A 2HHUA 3QO9A 2BE2A 3AO1A 3MEGA 5FRMA 3M8QA 1JL2A 1LW0A 3VQCA 5C42A 1NK9A 1S9EA 4DQIA 3RR7A 2KQ2A 4CJ3A 4CJ5A 1KTQA 2HHSA 4JRQA 3DRSA 1RT4A 2P5GA 1JLBA 1WSIA 4BDPA 3B6PA 3HYFA 3NDKA 3V4IA 2YKNA 2G8VA 2BDPA 4HUFA 1SV5A 1K6YA 1B9FA 4OKEA 3HVRA 3SZ2A 4CHOA 4DQQA 3MXMA 3VQ5A 1DTQA 1IKWA 3HT3A 3V9UA 3C6UA 1UWBA 3DM2A 4CEOA 3V9ZA 2QXFA 1A5VA 4OLBA 4JS4A 3RMCA 3ZT2A 3O4QA 4AILC 3DRRA 3LWLA 3QEPA 3CM5A 4F4KA 4PWDA 1HYZA 1S1VA 4FM0A 3RTVA 4CHPA 2VG6A 3QEXA 5I3UA 1TK0A 3EZ5A 5HLFA 1CZ9A 4LSLA 4HUGA 2KZMA 2OZMA 4CEDA 1L3VA 4DS5A 1VSKA 1QQCA 3ISNC 3S3MA 3QEIA 2E6MA 1C0UA 4B3OA 4CFAA 5D3GA 2HHTA 1KFSA 3DLGA 3KKSA 4M3UA 3SQ0A 1BCOA 1C0TA 2HW3A 1LAVA 4IFYA 3K57A 2DFFA 3U3GA 1BGXT 3V9WA 4DFPA 3CG7A 1C1BA 3CFRA 2HHWA 1RTHA 4CIGA 4DF8A 3RMAA 3PO4A 3OYFA 1CXUA 4B8AB 3VQQA 3SPZA 2YNHA 4BACA 3AVLA 1FKOA 4FJIA 3AA4A 3VQ7A 2I5JA 4M3WA 3KK1A 2PYJA 1NKCA 2RF2A 1RDAA 4DTOA 4OGEA 1HQEA 4KV8A 4DTUA 3SUNA 4FJ7A 4QOZB 2VWKA 4AHRA 3L2VA 3M8SA 1U45A 3ZSZA 1TKXA 1U48A 3WNHA 2VG7A 1RT2A 1FKPA 4FJXA 2D0CA 3BGRA 3NCIA 5HRRA 4R5PA 3THVA 5SZTA 3SQ2A 4CJQA 4CIFA 1ASWA 2X78A 3KLGA 4J2DA 4EP5A 3HJFA 2KZZA 1T05A 1EXQA 2Z1JA 1NJZA 1SL1A 2ATQA 3DLRA 3IG1A 1YTUA 1KFDA 1TAUA 1XHZA 4Z0UA 4M3ZA 4YFUA 4BWMA 4KKOA 1JXEA 1VSDA 2Z1HA 1KVAA 1XHXA 4FM2A 2HVHA 1XC9A 2RPIA 3CQ8A 4DF4A 4DU4A 3OYAA 4KHSA 3A2FA 1ZBFA 2P1JA 3ZSXA 3L2QA 2R7YA 3PX6A 4CEEA 4Y1DA 4M3XA 3CM6A 3NGYA 4CJTA 4B9MA 2QKBA 4FW1A 4LSNA 3RWUA 2OA8A 1EX4A 3OJSA 1RBTA 1VK0A 1L3SA 3V1QA 1RTDA 4ZTFA 2Z1IA 2W42A 4I2QA 4OKJA 3ZT3A 3SNNA 4C8KA 1EP4A 4BE2A 4FJKA 1IO2A 4B9LA 2HVIA 4Q0BA 1ZBHA 3HPGA 4E19A 3K2PA 3VQ9A 3QNOA 3T1AA 1SKRA 3VQ8A 1TKZA 4J2AA 1J53A 3BDPA 3ZCMA 4B9SA 3AO2A 4FK4A 1TGOA 1C0MA 4CEFA 3OYIA 4XIUA 3HP6A 1HNVA 1IKXA 5DK5A 4CJEA 3C6TA 2F8SA 3V6DA 3NFAA 2EX3A 2A1SA 2DFEA 1I3AA 3AA5X 1JLFA 3KIOA 4EZ6A 3CFOA 4F3TA 1TKTA 2WONA 4CFBA 3DOKA 3PX4A 4CIEA 4CGIA 4EZ9A 3QNNA 5HRNA 4PUOA 1YVUA 1Z25A 1HYSA 1FK9A 4E7KA 2YV0X 1WAFA 1VSIA 3NF8A 1VSHA 5CZ1A 3LP1A 3TR8A 4KHUA 1RBUA 3HK2A 3T3FA 2OPSA 1NJYA 3U3YA 1X9SA 1JLEA 1KVCA 2HB5A 3QINA 1QE1A 4I9LA 3VQBA 4CK1A 4CEZA 1BQMA 2KW4A 2FBXA 4ZTJA 3K5MA 1D8YA 5FRNA 3QETA 1RT6A 3S3OA 3VQAA 3ZSQA 3NH0A 4FJ9A 2B6AA 1O1WA 4FZZA 4FM1A 2E4LA 2PZSA 4J2BA 3PX0A 4E89A 3OYDA 4BDZA 2FBTA 3NAEA 3TABA 1S5JA 3S3NA 2P5OA 1BI4A 1W9HA 4KB0A 3QERA 1KLMA 3KK3A 1C6VA 3EY1A 4DG1A 3OYNA 3LPUA 1T8EA 1RBVA 3OS1A 4DTXA 2WOMA 4ELUA 1S6PA 4NYNA 3O3GA 3OJUA 2ZE2A 4DTJA 2FC0A 3QEVA 1WSHA 4KRFA 4PQUA 1D5AA 4E3SA 2DTUA 2XY6A 1B92A 3SV3A 4H4MA 4NYFA 4DQPA 2XY8A 1NOYA 1UA0A 4I7FA 4FJMA 5JS2A 3PO5A 3I8DA 5KRSA 4FJNA 1NKBA 3RMDA 3AVAA 4DU3A 2DY4A 3VA0A 2Q3SA 4CGHA 4Q5VA 4DFJA 1TKDA 2PY5A 2PYLA 1W0HA 4FLZA 4M3YA 1F21A 4OJRA 3K5LA 1N6QA 4J2EA 5E41A 4AH9A 4JRPA 3OVNA 4AHVA 3EYZA 4RW7A 1HQUA 3O4NA 4CEAA 3L8BA 3SJJA 5DMRA 1GOCA 4FCYA 4DQSA 4RW6A 3WNGA 3MEEA 4CJWA 4PY5A 1S1UA 3TAMA 3F73A 3NH1A 3V1OA 3SCXA 3KTQA 4DSLA 4UQGA 4K8ZA 4Z4FA 1TL1A 1HMVA 3KJVA 1JL1A 5HRSA 2IC3A 4CJPA 2P51A 1ASVA 4ID5A 3NF9A 4CERA 3TAGA 1SL2A 2EHGA 4M3TA 3JSMA 4HTUA 4CJKA 1NK0A 4ID1A 3NBPA 3OYJA 1X1PA 1RNHA 5CYQA 4DLEA 5HP1A 2Y1IA 2X6SA 1SKSA 4FLVA 1QSLA 4B9TA 2X74A 2YHAA 1TL3A 4RW9A 3WNEA 2OYQA 4RW8A 1YT3A 3ITHA 2D0AA 1RCHA 4Z4CA 1QTMA 1S6QA 4CHZA 3KK2A 1WSEA 2YNFA 2JGUA 4CJUA 2LSNA 3LDSA 1U47A 4EP4A 4DU1A 4F8RA 2VWJA 1NK8A 4C8LA 4O4GA 4BE0A 1WSFA 1WSGA 4K8XA 3HXMA 5JS1A 3B6OA 3O3HA 3UIQA 3V1RA 3ALYA 4FLWA 1JLAA 3KLEA 2VG5A 3SYZA 1IG9A 3M8RA 4FJLA 3AA3A 4CFDA 3TI0A 5CZ2A 2G8KA 5J2MA 1NK5A 4FZYA 4NCAA 5J1EA 3LAMA 1BQNA 1HYVA 1D9FA 1ZBLA 2NUBA 2HNYA 4FLYA 4CE9A 3G10A 4KI6A 1LWCA 3MAQA 1N5YA 4KHNA 3OYHA 1J54A 3AVJA 3KLHA 3OYMA 3L2RA 3VQ4A 1BISA 1B9DA 3LALA 3LZIA 1UOCA 4GVMA 4LH5A 5I42A 4DSKA 3TAPA 4B9NA 2ZD1A 1LV5A 4KI4A 4W5QA 3RRHA 4E0DA 3OYEA 4I9QA 1R0AA 1LAWA 3ULDA 2QKKA 2FBYA 2HHQA 1U04A 2Y1JA 1A5XA 3AO3A 1X9WA 1WNSA 3DLBA 3P1GA 1ZYQA 1VSFA 3ZSRA 4CJFA 5C25A 3HO1A 4CF8A 3K58A 1T7PA 4KTQA 1XI1A 3AA2A 4M41A 5FROA 4DTNA 4DFMA 4FLTA 2B5JA 1SUQA 3DI6A 3IAYA 5HROA 1JKHA 1YTAA 2XHBA 3AO5A 3ZSWA 3KLIA 3C95A 3KLFA 4CESA 2YNIA 4FJHA 3LP2A 2G8UA 2GUIA 4FXDA 3DYAA 3AVBA 4AHTA 1REVA 3LPTA 4GW6A 4AHUA 4CGFA 2HHXA 5J2NA 1QSYA 5KGWA 3TARA
chains in the Genus database with same CATH superfamily
4LD0A 1T03A 4B1YB 4C8NA 4CEQA 4M7XA 4CCHA 3K5OA 4B9VA 1KAXA 1WSJA 1WN7A 5KGXA 2YKMA 3ZSYA 3TAQA 4FLXA 3ZX3A 1GOAA 3O9QA 4JEPA 2VQEK 4DMNA 4YOYA 3IKMA 2IIRA 2ZWHA 1L3TA 4L8RB 4Z4EA 1Z26A 4LC9B 3DXKB 2YNGA 3VQDA 3E9OA 3MXIA 1JLQA 4ISGA 4KREA 4EHTA 4MQ3A 3EN9A 3O80A 4E7HA 2ASPA 3ULEA 2P9PB 1JXBA 4JI8K 4IDHA 1LWEA 2O8EA 2BANA 4KTWA 1RDUA 2JLEA 2BGGA 4OLAA 4CVNE 5J2PA 1GLJO 5CY4A 2YHBA 4GV9A 3HPHA 4BC5A 1RTIA 3K9KA 4Y1CA 2DFHA 1VQ5N 5AZJA 4N56A 2WFBA 5ELZA 4NCBA 3I0SA 3PUFA 3BEXA 4AHSA 1NGJA 4H4OA 1OH8A 2IVPA 4IWVA 3EEQA 3W3DA 3ZT4A 3QESA 4MFBA 5AQZA 3QIPA 2KFZA 1SS6A 5BR8K 4IG0A 2CGKA 1QSSA 1S9GA 3H08A 2YJEA 3TAFA 2XO7A 3QLHA 4W5RA 4KHYA 1NK6A 4ELTA 1NJWA 1CZBA 5GIPA 5AQOA 4N47A 1BCMA 1Y97A 3L3VA 4DB3A 1LW2A 5C24A 3HOSA 1I39A 1YITN 3OYLA 1BI4B 3R8EA 4C23A 2VQFK 5SWMA 3SV4A 2HBKA 1W2BM 2HHVA 4GV6A 1R59O 4CFCA 3C6HA 3OYCA 4FZXC 4M42A 3MWTA 4IOCL 3CPWM 1MU2A 4LY7A 3LM9A 1L3UA 4CEBA 4FL9A 3OBWA 4CJ7A 1IKVA 5LL6Z 4OO1J 4ICLA 3F9KA 4JKEA 5AQYA 4LF7K 3AO4A 2O4GA 4CJ4A 1TV6A 4Z4IA 1TUYA 1RBSA 3AVKA 3CERA 4M3RA 4F2RA 2IOCA 3SMPA 3CMAN 2RE2A 1FXXA 4DR4K 3HPOA 4OKKA 1YUWA 4AM6A 1NGEA 3UE5A 4OLBA 4LF9K 2ZQBA 3KKRA 3BZKA 1HRHA 2F8TA 4DSEA 5CYMA 4F3OA 1Q86O 4E1NA 1L5UA 3MXJA 3GG4A 4O0JA 4JI0K 3TAEA 4DTPA 1KVBA 4BWJA 3AVMA 3T19A 1NK4A 1S1TA 1YXQA 2P9IA 1YHQN 4OPHA 4E7LA 1BIZA 3O4WA 4CZIA 4OPAA 2ITGA 3AVIA 3O9RA 4O5BA 3HP9A 3SBTA 1BHLA 2OPRA 4B8CA 2HHUA 1BU6O 3QO9A 3O1BA 3HM8A 2KQ2A 4CJ3A 1KTQA 2HHSA 5C2FA 3E9PA 4BDPA 4LF8K 5F0XA 5CE3A 4LF5K 2QWLA 1DTQA 3HT3A 3C6UA 1UWBA 4ILHA 3LWLA 3QEPA 3CM5A 4PWDA 1NM1A 4K42A 3O9UA 3QEXA 1TK0A 1ZC6A 1L3VA 5D3GA 3QICA 2HHTA 2HMPA 3V9WA 2YHYA 3S41A 4CZMA 4DF8A 5C0YA 3PO4A 4B8AB 4JKGA 1JCFA 4BACA 2ASMA 3CC4N 3HTVA 3L4IA 3FZLA 3CJ9A 3VQ7A 4BRPA 3KK1A 1NKCA 4FJ7A 4IEEA 4QOZB 4CBUA 3M8SA 1U48A 3TSUA 3ZX0A 4ISFA 4EAHD 3AGKA 5HRRA 4CJQA 1OVQA 2O8FA 3BZCA 4B1WB 3HJFA 1SL1A 3DLRA 4I6MA 4JI6K 2GUPA 5BPMA 1XHZA 4BWMA 1JXEA 1KVAA 2D0OA 4BRDA 3Q7CA 3CQ8A 3WT0A 4DU4A 4KHSA 2GX9A 1ZBFA 2P1JA 3ZSXA 5AQWA 1GLDG 2GELA 4O8UA 3JXUA 4M3XA 3NGYA 4CJTA 2NRVA 3OJSA 4YOXA 1BO5O 3LDQA 4R79A 4H03B 2A41A 3G25A 4BRNA 1RTDA 4ZTFA 5TKYA 3VQ8A 1TKZA 1J53A 3AO2A 4M63C 3HP6A 4H0TB 1HKBA 3UKUB 5AJ3K 4CZGA 2PBDA 2A1SA 4EZ6A 3D2EA 1TKTA 1QQOA 4CIEA 4CGIA 2RHKA 5HRNA 1Z25A 1HYSA 3TR8A 2YHWA 1X9SA 1RDWX 4CEZA 5M1PA 1HLUA 5FPNA 1D8YA 2KW4A 4ZTJA 5FRNA 1IBLK 4XH4A 1RT6A 1YJNN 3VQAA 3ZSQA 4JK8A 1O1WA 3H1QA 4E89A 3OYDA 4BDZA 5GINA 1NMDA 1K8KB 3KK3A 2CH6A 3EY1A 3OYNA 3VF4A 4WQ4A 2KHOA 3FE1A 1P90A 3I33A 3CCLN 4FOIA 5LMUK 3M3ZA 2ZE2A 2Q97A 4E3SA 1GLBG 2WBNA 4NLBA 5M1QA 4I7FA 5JS2A 3VGLA 4DU3A 2DY4A 4DFJA 1W0HA 5GADP 5AQXA 1KC8O 2FXUA 3BY5A 4AQYK 4WQ4C 3MMVA 1NGCA 3KWIA 4KH5A 1WOQA 2IVNA 5GAGP 2OTLN 3D2EB 4PY5A 3SCXA 4LFCK 3V1OA 2FSNA 4BRCA 1HNZK 4CJPA 2E20A 2HF3A 1ASVA 3O9TA 2YHXA 1FJGK 4HTUA 4ID1A 1E4FT 5CYQA 5BR9A 3NVKA 4FVUA 2UXBK 3FLCO 4LFAK 1YT3A 2D0AA 3CIPA 2JGUA 4CJUA 4H0XB 4EP4A 4BRGA 4BE0A 1WSFA 3HXMA 3B6OA 4FLWA 2VG5A 3FZFA 2JWLA 2P9KA 4BROA 3BUZB 5M1NA 4YOTA 3I8BA 1HYVA 4FSVA 1M1KO 3HRGA 4FLYA 4KI6A 3WQTA 3G10A 1LWCA 1J54A 3OA9A 4H5WA 3AVJA 2O8CB 1BISA 4DR3K 1UOCA 3CCSN 1IJJA 2YX6A 4B9NA 5LMNK 3ENBA 3J8AA 3CF5L 4I9QA 4LF4K 1K8KA 4FWSA 1YVNA 3QB0A 3ULDA 2QKKA 1U04A 2Y1JA 3DLBA 4DV4K 4GVEA 2QWNA 1ZYQA 3K58A 2VCPA 1RFQA 3AA2A 2E2NA 5GIOA 4M41A 5FROA 3OTOK 4IO8A 1HKGA 3CCUN 3G71N 3C95A 3KLFA 2YNIA 2G8UA 3MX2A 4JKBA 1VQ4N 3GDQA 1VQ7N 5C10A 4FWLA 4H0VB 3MN5A 4MLHA 4Z4GA 1RT1A 4KHWA 3G0ZA 3U4LA 4FWNA 2ZJPL 2ZJRL 4A61A 3P83D 4BRIA 3K5NA 4KB1A 3SBGA 2O8FB 1EKEA 1QQNA 4H0PA 5AFUH 3OYKA 2IDOA 2A1RA 4JI2K 1OH7A 4CF0A 2HNZA 3V81A 4LF6K 3R9PA 3NF6A 2YI1A 1C1CA 2YCHA 2XY7A 1CXQA 1WAJA 4CZFA 3CCRN 4B3RK 3V9XA 1RDCA 1RDDA 1XUPO 2KLAA 4B08A 2OANA 1RDBA 3ZSVA 3KZBA 3THXA 3F2KA 2QK9A 4JI7K 3P5JA 1YI2N 2KTQA 4DV1K 1W7AA 1HPMA 1BL3A 2UUBK 1QVFM 3L0QA 1U49A 5BRHA 4M45A 3V9SA 3LP3A 1Q8IA 4ISEA 4JK9A 1U4BA 4RG8A 1D9DA 4BQZA 2X6NA 1CLQA 4X62K 2EWSA 3ZEUA 3VQEA 4YORA 1BUPA 4C8MA 4HCCA 3VF2A 3NGZA 3MECA 4K25A 5H1SQ 4E1MA 3DLHA 5CR4A 4WYBA 4CGJA 4KHQA 3C6AA 3PV8A 3ASMA 4AHCA 4HHTA 3N4QA 1S72N 4M7YA 1GLLO 1X9MA 4GMJB 4DSIA 1V4TA 4JK7A 1IH7A 4FJGA 1VAZA 4GNIA 1J9AA 3SUOA 4DV2K 4DV0K 2RN2A 1NMNA 3TPQA 4BVOA 4B1ZA 5IT9O 1X9JA 4CHNA 2PAVA 3CYMA 2E88A 5HRPA 2F96A 3SQ4A 3HSTB 3THWB 4V19S 1OVYA 1Q9YA 3O8MA 4CJLA 4JI3K 3OS2A 1VQ8N 5EU7A 3AVNA 4J2EA 3ZYYX 3JYTA 2HMIA 4HUEA 3LM2A 3M8PA 4CF1A 4N41A 3ENHA 1QHTA 1J5OA 1G15A 2FBVA 4CJVA 1VRTA 2UUCK 2YJFA 3J7YP 2G8HA 4WQ5C 4H8KA 3NH2A 5J2QA 1I94K 3AVHA 1U2VB 2D0BA 3SUPA 2Q1NA 1BDGA 1JLGA 3RVCA 4G1QA 4WF9L 4O55A 4RW4A 3CCQN 1A5WA 3O3FA 4BG8A 4CJRA 4HCBA 1NLVA 3ZSOA 4CZHA 4CECA 1VSLA 3MN9A 4DTRA 1TK5A 5AQPA 1TYQB 3VPZA 3MEGA 1YF5L 3M8QA 1D4XA 1NGHA 1LW0A 3VQCA 4DKWA 5C42A 1NK9A 2P9SA 4JRQA 4K41A 3DRSA 1WSIA 3SAHA 3V4IA 2BDPA 1K6YA 3MXMA 3HVRA 4DQQA 3VQ5A 1IKWA 3V9UA 3BF1A 3RMCA 5JMVA 2VGMA 1HYZA 1S1VA 3TSPA 3RTVA 4WFAL 5I3UA 1CZ9A 2F9TA 2KZMA 4BGBA 1VSKA 1QQCA 1S22A 3S3MA 3QEIA 4B3OA 1KFSA 4M3UA 3SQ0A 3J81O 2HW3A 2AP1A 1BGXT 5EOYA 3CG7A 3E1YA 1RTHA 4O5FA 1BG3A 4DCHA 1CXUA 3OYFA 3VQQA 3J7ZO 3ZEUB 2YNHA 5JLHA 3AVLA 1QQMA 4KHPK 4WFNL 2I7PA 1FKOA 5JVHL 2RF2A 1RDAA 4DTOA 4KV8A 3ZSZA 1TKXA 5EVZA 3WNHA 4FJXA 4CBWA 3E9LA 4JI4K 4IJAA 3THVA 5SZTA 1Q81O 4J2DA 3SMSA 3KVGA 4JKGB 1T05A 1NJZA 4YHHK 1KFDA 4Z0UA 1XHXA 4DR2K 4B3MK 4C1NK 2HVHA 3U8XA 3OYAA 3J7AP 2R7YA 3C7NB 4BR7A 4CEEA 2FF6A 4BRQA 1W97L 4FW1A 3WXIA 1YAGA 1C0GA 3AAPA 2OA8A 1VK0A 3E66A 5AQGA 1TUUA 4C8KA 5ADXH 4DV6K 2A42A 3K2PA 2H3GX 5BPLA 1XNQK 5AQFA 2Q31A 4PHTX 3AY9A 3LDOA 1QZ5A 1C0FA 1ZXOA 2W6KA 3CJCA 5DK5A 2F8SA 3V6DA 3NFAA 2EX3A 1I3AA 4F3TA 2A6AA 3CFOA 4BR0A 3DOKA 2HBJA 4GV3A 1V4SA 3QNNA 3H6EA 4PUOA 1YVUA 1FK9A 4DV3K 1VSHA 5CZ1A 5AQLA 3HK2A 2QEXN 2A40A 4B3TK 2W41A 4EIAA 3FZHA 2E2PA 3CCMN 1M90O 1JLEA 2GTDA 4B3SK 1QE1A 4AM7A 1N8RO 1IG8A 3AAQA 3ATVA 2FBXA 3HSCA 3QETA 4O8KA 1JCGA 3S3OA 5C2DA 4BQLA 2E4LA 2FBTA 5LY3A 3S3NA 1W9HA 3C7NA 1C6VA 2P9SB 2HSTA 3HI0A 1RBVA 4U7BA 2WOMA 4A57A 4DTJA 1WSHA 1HJOA 4PQUA 4KRFA 2DTUA 1X3MA 1B92A 3SV3A 3DXKA 4H4MA 2XY8A 1UA0A 1T6DA 4FJNA 5DM7L 3RMDA 1TKDA 2PY5A 2PYLA 1Z05A 3Q7BA 3AGRA 3K5LA 1N6QA 4AHVA 4YOWA 3A8YA 4A62A 3O4NA 4CW7B 4CEAA 5DMRA 1GOCA 4FCYA 4RW6A 1S1UA 2O8DB 1EQYA 4Z4FA 1IBKK 1IBMK 3EL2A 2FSKA 4IJNA 3NBPA 1X1PA 5BN9A 1RNHA 5HP1A 3D6RA 2X6SA 4B9TA 2NZTA 2OYQA 3ITHA 4JAXA 1X3NA 1RCHA 3KK2A 4H5VA 2YNFA 4F8RA 2ZM6K 4C8LA 2NRZA 2OTJN 3MCPA 4BR4A 1N36K 4K8XA 3V1RA 3ALYA 1JLAA 3KLEA 1IG9A 3AA3A 4CFDA 2W6LA 5CZ2A 1K8AO 3DXMB 2NUBA 3KK7A 4XH1A 4CBXA 5ADXA 1B9DA 4LH5A 3UKRA 3D2FA 1ZBSA 4GVMA 4EFHA 2E2QA 3TAPA 3A0IX 5KQDA 2NNWA 4W5QA 1VHXA 1VQKN 1ATNA 2P9UA 3OYEA 1KD1O 1R0AA 1KQSM 3THXB 1A5XA 4ILGB 1X9WA 3H3OB 3UB5A 3P1GA 2D4WA 1VSFA 2VYPA 4CJFA 3CPEA 4BRHA 1XI1A 3WXLA 4DFMA 4JI1K 5HROA 1JKHA 3AO5A 2PFUA 4B1UB 3KLIA 4YDUC 2O8BA 4FJHA 2V7YA 3RSEB 3AVBA 1SAZA 4AHUA 1WB9A 4CGFA 3ZX2A 3EZWA 5J2NA 3BF3A 4DFKA 1S1WA 4MDBA 4FYDA 5KTQA 4RTFD 3S9HA 4CF9A 3E01A 4WCEL 3CCJN 3VTHA 3CC2N 3MEDA 2GBZA 1RTJA 3OS0A 4KAZA 4B1VA 2O4IA 5BPNA 5JLFA 4IBNA 3VEXA 1RT5A 3M1FA 1UA1A 1C1AA 3FR0A 4OPJA 3K0SA 3DMJA 2P9LA 1ASUA 2QI2A 4KPYA 2D5RA 2Z1GA 5FDLA 1NGDA 5AQJA 3LDPA 3L4QA 4Z4HA 4BRMA 3VESA 5K14A 2BUPA 4PKHA 2NRHA 3KD5E 4NXNK 4H0OA 3VENA 4DWIA 1VQ6N 2NRWA 3L3UA 4IZ9A 1S1XA 2IGIA 3FZMA 1RILA 3LANA 4CZLA 4BE1A 4QS7A 1GOBA 4IDKA 3SK3A 4QAGA 4KH4A 2BH1A 2P9KB 1MWMA 3OYGA 1DT9A 3D45A 1VSEA 1EO1A 3HOTA 2G8IA 3AVCA 4F9OA 3SI6A 1RT3A 4B9UA 1J5EK 4FK2A 2F9WA 3RMBA 3H46O 1VQON 4UY8O 3AVFA 1RBRA 4JYAK 3A5NC 3M5RA 3NHGA 3CJ7A 4FWPA 4E7IA 3NF7A 5F1XA 3RR8A 4KTZA 3VA0A 1U2VA 3DLEA 1TVRA 2E6LA 3SJHA 3ID6A 1SQKA 3W0LA 3R1XA 3SAGA 3VN5A 1KLNA 4JKAA 4GKKK 3THYA 2UXCK 3RRGA 4ILJA 3D0PA 3SPYA 2CH5A 4BR2A 4W5OA 3O6WA 3IS9A 2Q36A 4CHYA 1U6ZA 5FPDA 5BRDA 1P8ZA 3WNFA 4IKFA 1EETA 4DTMA 2IAJA 3ZT0A 4KO0A 2UU9K 4BR5A 1EWQA 1KSPA 1DKGD 3O08A 3NGIA 3HVTA 3VA3A 4LH4A 2J4RA 3ZETA 3H45C 5AZIB 4DTSA 1XWLA 4FJ8A 2ITMA 3F5TA 1SKWA 1VSMA 4CGDA 4JS4A 2UYTA 1NK7A 2KFNA 4DSJA 2NRXA 1WUAA 4F2SA 3DRPA 2QXLA 4FLUA 1VQ9N 2V7ZA 2ETJA 1T3VA 3T7ZA 4C8OA 5JVGL 3JS6A 3AV9A 3HL8A 4DR7K 3ZLJA 4Z94A 1RT7A 1JLCA 5T7BA 4KH6A 4FO0A 2QWPA 1CZAN 2F7TA 5HBMA 2OPQA 3T69A 4OGCA 2BE2A 3CJAA 3RR7A 4CJ5A 5AQQA 2P5GA 4PKIA 3HYFA 2G8VA 4HUFA 1B9FA 4IXCA 4CEOA 4BR9A 5KQ8A 3ZT2A 3O4QA 4AILC 4WQ5A 2E2OA 2QWMA 4FM0A 1ILYA 2VG6A 4BRLA 5HL7L 4QS8A 3IFRA 4HUGA 2OZMA 3CI5A 4DS5A 1C0UA 3A5LC 4CFAA 3DLGA 1C0TA 3T1YK 1LAVA 4IFYA 2DFFA 2QTDA 1N34K 3U3GA 3KHYA 4K43A 5BRFA 1C1BA 3CFRA 2Q0UA 3O1WA 1ATSA 4CIGA 3ZETB 3CQXA 5FLXO 1ATRA 4B9QA 3THWA 3SPZA 1JCEA 1NGAA 2NLXA 3WXJA 2PYJA 3R3LA 4OGEA 1HQEA 4MO4A 4DTUA 1Q7YO 1IV0A 2VWKA 3L2VA 1QVGM 4FWQA 5AZJB 1RT2A 2D0CA 1TYQA 5LJVA 1HKCA 3NCIA 4R5PA 3SQ2A 4QS9A 4CIFA 1EXQA 2ATQA 3THYB 1YTUA 3M6GA 3MN7A 4KKOA 1VSDA 2Z1HA 1K73O 4FM2A 3TTFA 4BC4A 1XC9A 3CQYA 3I56N 3A2FA 1KXPA 5AQRA 3OBYA 2P9IB 2P9UB 4B9MA 2QKBA 3CETA 1XC3A 3RWUA 1EX4A 1NBWA 2A5XA 1RBTA 2DPNA 2Z1IA 2W42A 4I2QA 3SNNA 4H0YB 3ZT3A 4JV5K 1BOTO 1IO2A 4CD1A 4FJKA 2QWOA 3HPGA 4E19A 3QNOA 3T1AA 1SKRA 4J2AA 5GAEP 4B9SA 3P38A 1TGOA 1C0MA 4FK4A 3EO3A 2NRRA 4CEFA 2O8BB 1HNVA 3J80O 3VEYA 4CJEA 3AA5X 1JLFA 3KIOA 3QDKA 3ATUA 2HOEA 2Q0RA 4KBOA 4KHUA 1RBUA 3T3FA 1NJYA 3U9DA 2HB5A 3QINA 1BQMA 2O8EB 3K5MA 5HOOA 3WUHA 3NH0A 4FJ9A 3WXKA 3JAMO 4FM1A 2P9LB 4J2BA 4NB4A 3EKUA 3NAEA 4J8FA 1BI4A 5C15A 4DV5K 3QERA 1KLMA 4C1NI 3LPUA 3OS1A 4DTXA 1MWKA 4ELUA 4BGAA 4NYNA 5F2RA 1E3MA 3OJUA 1NGIA 2P9PA 5TKWA 4NYFA 4DQPA 4JD2B 1NOYA 2FLOA 1N33K 5BREA 1HNWK 1BA1A 3AVAA 3WXMB 2Q3SA 5EX5A 4CI6A 1F21A 5E41A 4AH9A 3OVNA 4IEIA 3EYZA 1HQUA 3VF6A 1K9MO 2VGNA 4DQSA 4CD3A 5KPTA 3IDHA 3MEEA 3F73A 4K8ZA 3NH1A 3KTQA 4DSLA 4JD2A 1MDUB 1TL1A 1HMVA 3KJVA 1T44A 1JL1A 4CZKA 5HRSA 1E4GT 2P51A 2QM1A 3TAGA 1SL2A 2EHGA 2A3ZA 3JSMA 3RSEA 3A5MC 4CJKA 3SLCA 3OYJA 4DLEA 1SKSA 1Q82O 2YHAA 5CHIA 4DV7K 1YIJN 5EXWA 1DEJA 2D0PA 4Z4CA 4BC2A 1S6QA 1WSEA 4MO5A 4A59A 2LSNA 5JICA 1NK8A 4O4GA 2BTFA 4BY9C 1WSGA 1OKJA 4DR5K 3O3HA 4FJLA 3SYZA 3M8RA 3MWPA 3TI0A 2G8KA 4NCAA 5J1EA 1XMOK 3LAMA 1S3XA 1D9FA 2HNYA 3DJCA 1N5YA 4KHNA 3OYHA 3DAWA 4WFBL 3OYMA 4DSKA 3A5OC 3EE9A 2ZD1A 1LV5A 3VTIA 3RRHA 3G6EN 4E0DA 2VWBA 1LAWA 2FBYA 3PSIA 3AO3A 4NO7A 4DUZK 3VEZA 3HO1A 4A2BA 4KTQA 1NGFA 4DTNA 4CZJA 4FLTA 1SUQA 3DI6A 5M1FA 3IAYA 1YTAA 2XHBA 3ZSWA 4CESA 3LP2A 2GUIA 4FXDA 3DYAA 3LPTA 4GW6A 2HHXA 1YJ9N 3TARA 2CGLA 3QBXA 1VQNN 4NLCA 1Q9XA 4I2PA 4KFBA 3VQPA 2G8WA 3QIOA 1KRPA 3DOLA 2WC9A 2ZGZA 2XY5A 2AA4A 4WE1A 4A5BA 3LWMA 4DS4A 4QCLA 1KCFA 4ELVA 3BP8A 3TANA 1IKYA 3QFPA 1NGGA 4JLHA 3DLKA 2QWQA 1HNIA 2FF3B 3QEWA 4U67L 1LOTB 3IRXA 2OPPA 1Z6RA 1LWFA 3TWHA 4BRKA 1UAXA 2P9NB 3VQ6A 3CJ1A 3LZJA 1NKEA 1TK8A 4YOUA 4DR6K 4FWMA 2OCEA 3HM9A 4E7JA 4N76A 2GEMA 1QHAA 2RKIA 4N5SA 3LDNA 2D1KA 2OZSA 3FFKB 4IO9L 1VRUA 1ESVA 4NXMK 4FJ5A 2IVOA 5AQKA 4ZHRA 4YNQA 3GE1A 4JN4A 2WTUA 1ITGA 1EWRA 5FPMA 5I9EB 1BWFO 1NG9A 1VSJA 1NU0A 1BIUA 5FPEA 3TTDA 4FWKA 4JNEA 3TU5A 2F4VK 4IFVA 3CFPA 1Y64A 2HNDA 3K9JA 3OHRA 3CC7N 2HHHK 1QS4A 4W5TA 3OY9A 4M3ZA 4YY3K 2XRIA 2AJQA 3QMLA 2IS3A 3CMEN 4YDUA 3O9SA 3MK6A 1DTTA 4DQRA 4FW2A 1FW6A 4CJSA 4H5NA 4Y0WA 4CGGA 4FK0A 4A2AA 4JKCA 4OPKA 2QW9A 1GLFO 3I0RA 1HJRA 4PA1A 1Q18A 5AQSA 4RCHA 4CK3A 1MA9B 1XQSC 2ZF5O 3GOIA 4JKDA 4CK2A 1ZBIA 5AQUA 1ZBUA 2GWJA 3CD6N 1DLOA 4IOXA 1TAQA 3VEVA 4FPAA 1WBDA 4BREA 4CZEA 1KAZA 3ENOA 3LP0A 2B4JA 4JS5A 1NOZA 3FFIA 4CF2A 4X65K 4BDYA 4HVJA 2GV9A 1SL0A 1HR0K 4PL8A 1HPZA 3L2UA 4O44A 3SUQA 3AVGA 3C94A 4IG3A 3ZT1A 2FSJA 3WEEA 4O0IA 3PIOL 3DLLL 4FJJA 1SZ2A 3VEWA 4DSFA 4PKGA 3LAKA 4NCGA 4CHQA 3KD1E 1VQLN 3L2WA 4BRAA 1QZ6A 5BN8A 3K59A 5A2QO 2W40A 4FOEA 4BVPA 3P39A 4LFBK 3NE6A 4DLGA 1NJXA 3PY8A 4W5NA 4BG9A 3O5BA 3U6FA 1WLJA 1RGIA 4B1XB 3OYBA 4FVMA 2G8FA 4FZZA 5KI6A 4TSXA 4OVLA 4HTLA 5KRTA 3SQ1A 2P9NA 3AO1A 5FRMA 1JL2A 1S9EA 4DQIA 5DM6L 3SAFA 1LCUA 4H5RA 1RT4A 2GWKA 1JLBA 3B6PA 5AR0A 3UKUA 4A5AA 3NDKA 2YKNA 3D2FB 3UKRB 3SZ2A 1SV5A 4OKEA 4CHOA 1NGBA 3V9ZA 3DM2A 2QXFA 1A5VA 3VGMA 3DRRA 4F4KA 1N32K 4JHDB 4DQ8A 3HZ6A 5E26A 4CHPA 4H5TA 3EZ5A 5HLFA 4LSLA 4CEDA 3ISNC 3MX5A 2E6MA 3KKSA 3QFUA 4L3QA 1BCOA 3VERA 3CJBA 1XNRK 3K57A 4JI5K 4JKHA 3NMUA 2O8DA 4DFPA 2HHWA 4IOAL 3RMAA 5E84A 1DGKN 4DHYA 1HNXK 1JJ2M 4FJIA 3AA4A 2I5JA 3DWLA 4M3WA 4DUYK 3SUNA 1OH6A 5GAHP 4AHRA 1NNEA 1U45A 3CXCM 2VG7A 4BRFA 1FKPA 3BGRA 4IFEA 1ASWA 2X78A 3KLGA 4EP5A 3WQUA 2E5LK 2KZZA 1BA0A 2Z1JA 2E1YA 3IG1A 3HBTA 1TAUA 4YFUA 1OH5A 3AARA 3GBTA 2RPIA 4FWRA 4DF4A 4MLEA 3L2QA 3PX6A 4Y1DA 3CM6A 3T1HK 1NJIO 3CHWA 3H3NO 4LSNA 1XMQK 2V51B 2UXDK 2WUSA 1L3SA 2O8CA 3MN6A 3H1VX 3V1QA 4OKJA 1T6CA 5AZIA 4YOVA 1EP4A 4BE2A 2V52B 2HVIA 4B9LA 4Q0BA 4JKFA 1ZBHA 3VETA 3VQ9A 3CCEN 3PSFA 3BDPA 3ZCMA 4EHUA 4X64K 5AQNA 3OYIA 5AQHA 4XIUA 2HBLA 1IKXA 3C6TA 2KKZA 4BC3A 2DFEA 2WONA 4CFBA 3PX4A 5IWAK 4EZ9A 5AQTA 3VEOA 4E7KA 2YV0X 1WAFA 1VSIA 3NF8A 3LP1A 5LJWA 1GLEG 2OPSA 3U3YA 3P4IA 3EKSA 1KVCA 4I9LA 3IMXA 3VQBA 4CK1A 1GLCG 4GKJK 3L6QA 2JWKA 2B6AA 4K0KK 4MDAA 3U9ZA 2PZSA 3PX0A 3TABA 1S5JA 2P5OA 3OW2M 4KB0A 3VOVA 3TSQA 3KWGA 4DG1A 3PLAA 1T8EA 4G9ZA 1S6PA 3C65A 3IUCA 3O3GA 5AFUA 3R6MA 3QEVA 2FC0A 1YJWN 3FGUA 1D5AA 2XY6A 3FZKA 3CCVN 2Q2RA 3DXMA 1VQMN 4FJMA 3PO5A 5C12A 5KRSA 3I8DA 1NKBA 5AQMA 1HX1A 5EY4A 4CGHA 4Q5VA 3EE8A 4FPBA 4FLZA 4M3YA 3G4SN 4OJRA 2NRTA 4JRPA 4I6MB 2E1ZA 4RW7A 4E1JA 3L8BA 3SJJA 5AQVA 3LDLA 2QWRA 5AQIA 3WNGA 4PL7A 3WEEB 4CJWA 3TAMA 1VQPN 1KAYA 1GLAG 5MLCQ 4UQGA 2ZGYA 3TTCA 3F9MA 2IC3A 4ID5A 4JHDA 4CERA 1O13A 3NF9A 4M3TA 4FWOA 3LL3A 5B8HA 2UUAK 1NK0A 1J6ZA 2Y1IA 1QSLA 4FLVA 2X74A 4RW9A 1TL3A 3WNEA 4OX9K 4RW8A 5KPRA 1QTMA 3MCAB 4CHZA 5M1KA 4HWIA 3C0BA 3LDSA 4RWTA 1U47A 4DU1A 4GY2B 2VWJA 4DR1K 2QA4N 5JS1A 1G99A 3UIQA 4X66K 5J2MA 1NK5A 4FZYA 1BQNA 1ZBLA 3GL1A 4CE9A 5M1OA 3MAQA 3KLHA 3L2RA 3D7EO 3I55N 3VQ4A 3LALA 3LZIA 1H1VA 5I42A 1HUXA 3ID8A 1WBBA 2HBMA 4KI4A 3ULEB 4AF1A 3VMFB 2HHQA 3PIPL 1WNSA 2ASOA 3ZSRA 5C25A 4CF8A 1T7PA 3N4PA 2I7NA 3MDQA 5KPZA 3QBWA 2B5JA 2ZJQL 1NWKA 2CGJA 3NVMA 4AHTA 1REVA 4XEIA 3VGKA 3B8AX 3P31A 2E8AA 1QSYA 5KGWA 2HF4A 4XH5A
chains in the Genus database with same CATH topology
4LD0A 4DFKA 1S1WA 1T03A 4FYDA 1Q9XA 4C8NA 4I2PA 4KFBA 3VQPA 4CEQA 4CCHA 2G8WA 3QIOA 1KRPA 4Z4GA 3K5OA 4B9VA 5KTQA 1RT1A 3DOLA 3G0ZA 3S9HA 4KHWA 1WSJA 1WN7A 4CF9A 5KGXA 3P83D 2YKMA 3E01A 3ZSYA 2XY5A 3K5NA 3MEDA 2GBZA 4KB1A 1RTJA 3OS0A 3TAQA 4FLXA 4KAZA 4WE1A 1EKEA 2O4IA 1GOAA 3LWMA 4IBNA 1RT5A 1UA1A 1C1AA 4DMNA 3OYKA 2IDOA 4OPJA 4DS4A 2A1RA 4QCLA 1KCFA 3DMJA 4ELVA 3TANA 4CF0A 2HNZA 1IKYA 1ASUA 3V81A 1L3TA 4JLHA 4L8RB 3DLKA 1Z26A 4Z4EA 4KPYA 2D5RA 1HNIA 3NF6A 2YNGA 1C1CA 3VQDA 3MXIA 2Z1GA 3QEWA 2XY7A 5FDLA 1CXQA 1JLQA 1WAJA 3IRXA 4KREA 2OPPA 1LWFA 4MQ3A 3TWHA 3V9XA 1RDCA 1RDDA 4B08A 1UAXA 4Z4HA 4E7HA 3VQ6A 3LZJA 5K14A 1NKEA 1RDBA 1TK8A 3ZSVA 1JXBA 3KD5E 4DWIA 1LWEA 2QK9A 3HM9A 3P5JA 4E7JA 2BANA 4N76A 2KTQA 3L3UA 1S1XA 2IGIA 4KTWA 2RKIA 4N5SA 4OLAA 2JLEA 2BGGA 1RILA 3LANA 5J2PA 4BE1A 2OZSA 5CY4A 2YHBA 3HPHA 1GOBA 1VRUA 1BL3A 4IDKA 1RTIA 4FJ5A 4Y1CA 1U49A 4ZHRA 2DFHA 4M45A 4QAGA 4YNQA 3V9SA 3LP3A 4N56A 4NCBA 1Q8IA 3I0SA 3PUFA 4AHSA 1U4BA 4H4OA 1ITGA 3OYGA 4RG8A 3ZT4A 3D45A 1VSEA 3QESA 4MFBA 1D9DA 2G8IA 3AVCA 2X6NA 1RT3A 3SI6A 4B9UA 1CLQA 4FK2A 3VQEA 3RMBA 3QIPA 1VSJA 2KFZA 1BIUA 4IG0A 4C8MA 3AVFA 1QSSA 1RBRA 4HCCA 1S9GA 3H08A 3MECA 3NGZA 3TAFA 3DLHA 4E1MA 2XO7A 4IFVA 3QLHA 3NHGA 4W5RA 3CFPA 4KHYA 1NK6A 4ELTA 2HNDA 1NJWA 4CGJA 4E7IA 1CZBA 4KHQA 3NF7A 3RR8A 3PV8A 3ASMA 1BCMA 1QS4A 1Y97A 4KTZA 4N47A 3DLEA 4AHCA 4W5TA 1TVRA 2E6LA 3L3VA 3OY9A 4HHTA 2XRIA 2AJQA 1LW2A 2IS3A 5C24A 1X9MA 1I39A 3VN5A 1KLNA 4GMJB 3OYLA 1BI4B 1DTTA 4DSIA 3SV4A 5SWMA 4FW2A 4DQRA 1IH7A 3RRGA 4CJSA 3D0PA 3SPYA 4FJGA 2HHVA 4CFCA 4CGGA 4W5OA 3OYCA 4FZXC 4FK0A 1J9AA 4M42A 3IS9A 4CHYA 4OPKA 3I0RA 3SUOA 1HJRA 1MU2A 4PA1A 4LY7A 3WNFA 1L3UA 4CEBA 4IKFA 1EETA 4CK3A 4DTMA 2IAJA 2RN2A 3ZT0A 4KO0A 4CK2A 1ZBIA 1IKVA 1ZBUA 1DLOA 4CHNA 3CYMA 1TAQA 3F9KA 4ICLA 1KSPA 3NGIA 3HVTA 3AO4A 2O4GA 4CJ4A 3VA3A 1TV6A 5HRPA 4LH4A 4Z4IA 2F96A 3SQ4A 1RBSA 3AVKA 3HSTB 4DTSA 1Q9YA 1XWLA 4M3RA 4F2RA 2IOCA 4FJ8A 4CJLA 3LP0A 3OS2A 1SKWA 2B4JA 1VSMA 1NOZA 1FXXA 3FFIA 5EU7A 3AVNA 4CGDA 4CF2A 4JS5A 3HPOA 4HVJA 2GV9A 4OKKA 3JYTA 4BDYA 1NK7A 1SL0A 2HMIA 2KFNA 1HPZA 4DSJA 3L2UA 4O44A 4HUEA 3M8PA 4CF1A 3SUQA 2ZQBA 3DRPA 3KKRA 4F2SA 3AVGA 3C94A 4N41A 1HRHA 2F8TA 1QHTA 4IG3A 5CYMA 3ZT1A 4O0IA 4FLUA 1G15A 4DSEA 1J5OA 4F3OA 4E1NA 4FJJA 4DSFA 1L5UA 2FBVA 3MXJA 4CJVA 1VRTA 3LAKA 4NCGA 2ETJA 4CHQA 2G8HA 3KD1E 4O0JA 4C8OA 4H8KA 3NH2A 3L2WA 3AV9A 3HL8A 3K59A 3TAEA 4DTPA 5J2QA 1KVBA 1RT7A 3AVHA 3AVMA 4BWJA 3T19A 1NK4A 1JLCA 1S1TA 5T7BA 2D0BA 3SUPA 3NE6A 4DLGA 1JLGA 4G1QA 1NJXA 3PY8A 4O55A 4RW4A 4E7LA 1BIZA 4W5NA 1A5WA 3O3FA 4CJRA 4HCBA 3ZSOA 5HBMA 4CECA 1VSLA 3U6FA 1WLJA 3OYBA 2OPQA 2ITGA 3AVIA 4FVMA 2G8FA 4O5BA 4DTRA 3HP9A 5KI6A 4OGCA 4TSXA 1TK5A 4OVLA 1BHLA 2OPRA 4B8CA 5KRTA 3SQ1A 2HHUA 3QO9A 2BE2A 3AO1A 3MEGA 5FRMA 3M8QA 1JL2A 1LW0A 3VQCA 5C42A 1NK9A 1S9EA 4DQIA 3RR7A 2KQ2A 4CJ3A 4CJ5A 1KTQA 2HHSA 4JRQA 3DRSA 1RT4A 2P5GA 1JLBA 1WSIA 4BDPA 3B6PA 3HYFA 3NDKA 3V4IA 2YKNA 2G8VA 2BDPA 4HUFA 1SV5A 1K6YA 1B9FA 4OKEA 3HVRA 3SZ2A 4CHOA 4DQQA 3MXMA 3VQ5A 1DTQA 1IKWA 3HT3A 3V9UA 3C6UA 1UWBA 3DM2A 4CEOA 3V9ZA 2QXFA 1A5VA 4OLBA 4JS4A 3RMCA 3ZT2A 3O4QA 4AILC 3DRRA 3LWLA 3QEPA 3CM5A 4F4KA 4PWDA 1HYZA 1S1VA 4FM0A 3RTVA 4CHPA 2VG6A 3QEXA 5I3UA 1TK0A 3EZ5A 5HLFA 1CZ9A 4LSLA 4HUGA 2KZMA 2OZMA 4CEDA 1L3VA 4DS5A 1VSKA 1QQCA 3ISNC 3S3MA 3QEIA 2E6MA 1C0UA 4B3OA 4CFAA 5D3GA 2HHTA 1KFSA 3DLGA 3KKSA 4M3UA 3SQ0A 1BCOA 1C0TA 2HW3A 1LAVA 4IFYA 3K57A 2DFFA 3U3GA 1BGXT 3V9WA 4DFPA 3CG7A 1C1BA 3CFRA 2HHWA 1RTHA 4CIGA 4DF8A 3RMAA 3PO4A 3OYFA 1CXUA 4B8AB 3VQQA 3SPZA 2YNHA 4BACA 3AVLA 1FKOA 4FJIA 3AA4A 3VQ7A 2I5JA 4M3WA 3KK1A 2PYJA 1NKCA 2RF2A 1RDAA 4DTOA 4OGEA 1HQEA 4KV8A 4DTUA 3SUNA 4FJ7A 4QOZB 2VWKA 4AHRA 3L2VA 3M8SA 1U45A 3ZSZA 1TKXA 1U48A 3WNHA 2VG7A 1RT2A 1FKPA 4FJXA 2D0CA 3BGRA 3NCIA 5HRRA 4R5PA 3THVA 5SZTA 3SQ2A 4CJQA 4CIFA 1ASWA 2X78A 3KLGA 4J2DA 4EP5A 3HJFA 2KZZA 1T05A 1EXQA 2Z1JA 1NJZA 1SL1A 2ATQA 3DLRA 3IG1A 1YTUA 1KFDA 1TAUA 1XHZA 4Z0UA 4M3ZA 4YFUA 4BWMA 4KKOA 1JXEA 1VSDA 2Z1HA 1KVAA 1XHXA 4FM2A 2HVHA 1XC9A 2RPIA 3CQ8A 4DF4A 4DU4A 3OYAA 4KHSA 3A2FA 1ZBFA 2P1JA 3ZSXA 3L2QA 2R7YA 3PX6A 4CEEA 4Y1DA 4M3XA 3CM6A 3NGYA 4CJTA 4B9MA 2QKBA 4FW1A 4LSNA 3RWUA 2OA8A 1EX4A 3OJSA 1RBTA 1VK0A 1L3SA 3V1QA 1RTDA 4ZTFA 2Z1IA 2W42A 4I2QA 4OKJA 3ZT3A 3SNNA 4C8KA 1EP4A 4BE2A 4FJKA 1IO2A 4B9LA 2HVIA 4Q0BA 1ZBHA 3HPGA 4E19A 3K2PA 3VQ9A 3QNOA 3T1AA 1SKRA 3VQ8A 1TKZA 4J2AA 1J53A 3BDPA 3ZCMA 4B9SA 3AO2A 4FK4A 1TGOA 1C0MA 4CEFA 3OYIA 4XIUA 3HP6A 1HNVA 1IKXA 5DK5A 4CJEA 3C6TA 2F8SA 3V6DA 3NFAA 2EX3A 2A1SA 2DFEA 1I3AA 3AA5X 1JLFA 3KIOA 4EZ6A 3CFOA 4F3TA 1TKTA 2WONA 4CFBA 3DOKA 3PX4A 4CIEA 4CGIA 4EZ9A 3QNNA 5HRNA 4PUOA 1YVUA 1Z25A 1HYSA 1FK9A 4E7KA 2YV0X 1WAFA 1VSIA 3NF8A 1VSHA 5CZ1A 3LP1A 3TR8A 4KHUA 1RBUA 3HK2A 3T3FA 2OPSA 1NJYA 3U3YA 1X9SA 1JLEA 1KVCA 2HB5A 3QINA 1QE1A 4I9LA 3VQBA 4CK1A 4CEZA 1BQMA 2KW4A 2FBXA 4ZTJA 3K5MA 1D8YA 5FRNA 3QETA 1RT6A 3S3OA 3VQAA 3ZSQA 3NH0A 4FJ9A 2B6AA 1O1WA 4FZZA 4FM1A 2E4LA 2PZSA 4J2BA 3PX0A 4E89A 3OYDA 4BDZA 2FBTA 3NAEA 3TABA 1S5JA 3S3NA 2P5OA 1BI4A 1W9HA 4KB0A 3QERA 1KLMA 3KK3A 1C6VA 3EY1A 4DG1A 3OYNA 3LPUA 1T8EA 1RBVA 3OS1A 4DTXA 2WOMA 4ELUA 1S6PA 4NYNA 3O3GA 3OJUA 2ZE2A 4DTJA 2FC0A 3QEVA 1WSHA 4KRFA 4PQUA 1D5AA 4E3SA 2DTUA 2XY6A 1B92A 3SV3A 4H4MA 4NYFA 4DQPA 2XY8A 1NOYA 1UA0A 4I7FA 4FJMA 5JS2A 3PO5A 3I8DA 5KRSA 4FJNA 1NKBA 3RMDA 3AVAA 4DU3A 2DY4A 3VA0A 2Q3SA 4CGHA 4Q5VA 4DFJA 1TKDA 2PY5A 2PYLA 1W0HA 4FLZA 4M3YA 1F21A 4OJRA 3K5LA 1N6QA 4J2EA 5E41A 4AH9A 4JRPA 3OVNA 4AHVA 3EYZA 4RW7A 1HQUA 3O4NA 4CEAA 3L8BA 3SJJA 5DMRA 1GOCA 4FCYA 4DQSA 4RW6A 3WNGA 3MEEA 4CJWA 4PY5A 1S1UA 3TAMA 3F73A 3NH1A 3V1OA 3SCXA 3KTQA 4DSLA 4UQGA 4K8ZA 4Z4FA 1TL1A 1HMVA 3KJVA 1JL1A 5HRSA 2IC3A 4CJPA 2P51A 1ASVA 4ID5A 3NF9A 4CERA 3TAGA 1SL2A 2EHGA 4M3TA 3JSMA 4HTUA 4CJKA 1NK0A 4ID1A 3NBPA 3OYJA 1X1PA 1RNHA 5CYQA 4DLEA 5HP1A 2Y1IA 2X6SA 1SKSA 4FLVA 1QSLA 4B9TA 2X74A 2YHAA 1TL3A 4RW9A 3WNEA 2OYQA 4RW8A 1YT3A 3ITHA 2D0AA 1RCHA 4Z4CA 1QTMA 1S6QA 4CHZA 3KK2A 1WSEA 2YNFA 2JGUA 4CJUA 2LSNA 3LDSA 1U47A 4EP4A 4DU1A 4F8RA 2VWJA 1NK8A 4C8LA 4O4GA 4BE0A 1WSFA 1WSGA 4K8XA 3HXMA 5JS1A 3B6OA 3O3HA 3UIQA 3V1RA 3ALYA 4FLWA 1JLAA 3KLEA 2VG5A 3SYZA 1IG9A 3M8RA 4FJLA 3AA3A 4CFDA 3TI0A 5CZ2A 2G8KA 5J2MA 1NK5A 4FZYA 4NCAA 5J1EA 3LAMA 1BQNA 1HYVA 1D9FA 1ZBLA 2NUBA 2HNYA 4FLYA 4CE9A 3G10A 4KI6A 1LWCA 3MAQA 1N5YA 4KHNA 3OYHA 1J54A 3AVJA 3KLHA 3OYMA 3L2RA 3VQ4A 1BISA 1B9DA 3LALA 3LZIA 1UOCA 4GVMA 4LH5A 5I42A 4DSKA 3TAPA 4B9NA 2ZD1A 1LV5A 4KI4A 4W5QA 3RRHA 4E0DA 3OYEA 4I9QA 1R0AA 1LAWA 3ULDA 2QKKA 2FBYA 2HHQA 1U04A 2Y1JA 1A5XA 3AO3A 1X9WA 1WNSA 3DLBA 3P1GA 1ZYQA 1VSFA 3ZSRA 4CJFA 5C25A 3HO1A 4CF8A 3K58A 1T7PA 4KTQA 1XI1A 3AA2A 4M41A 5FROA 4DTNA 4DFMA 4FLTA 2B5JA 1SUQA 3DI6A 3IAYA 5HROA 1JKHA 1YTAA 2XHBA 3AO5A 3ZSWA 3KLIA 3C95A 3KLFA 4CESA 2YNIA 4FJHA 3LP2A 2G8UA 2GUIA 4FXDA 3DYAA 3AVBA 4AHTA 1REVA 3LPTA 4GW6A 4AHUA 4CGFA 2HHXA 5J2NA 1QSYA 5KGWA 3TARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD0 A;  4DFK A;  1S1W A;  1T03 A;  4FYD A;  1Q9X A;  4C8N A;  4I2P A;  4KFB A;  3VQP A;  4CEQ A;  4CCH A;  2G8W A;  3QIO A;  1KRP A;  4Z4G A;  3K5O A;  4B9V A;  5KTQ A;  1RT1 A;  3DOL A;  3G0Z A;  3S9H A;  4KHW A;  1WSJ A;  1WN7 A;  4CF9 A;  5KGX A;  3P83 D;  2YKM A;  3E01 A;  3ZSY A;  2XY5 A;  3K5N A;  3MED A;  2GBZ A;  4KB1 A;  1RTJ A;  3OS0 A;  3TAQ A;  4FLX A;  4KAZ A;  4WE1 A;  1EKE A;  2O4I A;  1GOA A;  3LWM A;  4IBN A;  1RT5 A;  1UA1 A;  1C1A A;  4DMN A;  3OYK A;  2IDO A;  4OPJ A;  4DS4 A;  2A1R A;  4QCL A;  1KCF A;  3DMJ A;  4ELV A;  3TAN A;  4CF0 A;  2HNZ A;  1IKY A;  1ASU A;  3V81 A;  1L3T A;  4JLH A;  4L8R B;  3DLK A;  1Z26 A;  4Z4E A;  4KPY A;  2D5R A;  1HNI A;  3NF6 A;  2YNG A;  1C1C A;  3VQD A;  3MXI A;  2Z1G A;  3QEW A;  2XY7 A;  5FDL A;  1CXQ A;  1JLQ A;  1WAJ A;  3IRX A;  4KRE A;  2OPP A;  1LWF A;  4MQ3 A;  3TWH A;  3V9X A;  1RDC A;  1RDD A;  4B08 A;  1UAX A;  4Z4H A;  4E7H A;  3VQ6 A;  3LZJ A;  5K14 A;  1NKE A;  1RDB A;  1TK8 A;  3ZSV A;  1JXB A;  3KD5 E;  4DWI A;  1LWE A;  2QK9 A;  3HM9 A;  3P5J A;  4E7J A;  2BAN A;  4N76 A;  2KTQ A;  3L3U A;  1S1X A;  2IGI A;  4KTW A;  2RKI A;  4N5S A;  4OLA A;  2JLE A;  2BGG A;  1RIL A;  3LAN A;  5J2P A;  4BE1 A;  2OZS A;  5CY4 A;  2YHB A;  3HPH A;  1GOB A;  1VRU A;  1BL3 A;  4IDK A;  1RTI A;  4FJ5 A;  4Y1C A;  1U49 A;  4ZHR A;  2DFH A;  4M45 A;  4QAG A;  4YNQ A;  3V9S A;  3LP3 A;  4N56 A;  4NCB A;  1Q8I A;  3I0S A;  3PUF A;  4AHS A;  1U4B A;  4H4O A;  1ITG A;  3OYG A;  4RG8 A;  3ZT4 A;  3D45 A;  1VSE A;  3QES A;  4MFB A;  1D9D A;  2G8I A;  3AVC A;  2X6N A;  1RT3 A;  3SI6 A;  4B9U A;  1CLQ A;  4FK2 A;  3VQE A;  3RMB A;  3QIP A;  1VSJ A;  2KFZ A;  1BIU A;  4IG0 A;  4C8M A;  3AVF A;  1QSS A;  1RBR A;  4HCC A;  1S9G A;  3H08 A;  3MEC A;  3NGZ A;  3TAF A;  3DLH A;  4E1M A;  2XO7 A;  4IFV A;  3QLH A;  3NHG A;  4W5R A;  3CFP A;  4KHY A;  1NK6 A;  4ELT A;  2HND A;  1NJW A;  4CGJ A;  4E7I A;  1CZB A;  4KHQ A;  3NF7 A;  3RR8 A;  3PV8 A;  3ASM A;  1BCM A;  1QS4 A;  1Y97 A;  4KTZ A;  4N47 A;  3DLE A;  4AHC A;  4W5T A;  1TVR A;  2E6L A;  3L3V A;  3OY9 A;  4HHT A;  2XRI A;  2AJQ A;  1LW2 A;  2IS3 A;  5C24 A;  1X9M A;  1I39 A;  3VN5 A;  1KLN A;  4GMJ B;  3OYL A;  1BI4 B;  1DTT A;  4DSI A;  3SV4 A;  5SWM A;  4FW2 A;  4DQR A;  1IH7 A;  3RRG A;  4CJS A;  3D0P A;  3SPY A;  4FJG A;  2HHV A;  4CFC A;  4CGG A;  4W5O A;  3OYC A;  4FZX C;  4FK0 A;  1J9A A;  4M42 A;  3IS9 A;  4CHY A;  4OPK A;  3I0R A;  3SUO A;  1HJR A;  1MU2 A;  4PA1 A;  4LY7 A;  3WNF A;  1L3U A;  4CEB A;  4IKF A;  1EET A;  4CK3 A;  4DTM A;  2IAJ A;  2RN2 A;  3ZT0 A;  4KO0 A;  4CK2 A;  1ZBI A;  1IKV A;  1ZBU A;  1DLO A;  4CHN A;  3CYM A;  1TAQ A;  3F9K A;  4ICL A;  1KSP A;  3NGI A;  3HVT A;  3AO4 A;  2O4G A;  4CJ4 A;  3VA3 A;  1TV6 A;  5HRP A;  4LH4 A;  4Z4I A;  2F96 A;  3SQ4 A;  1RBS A;  3AVK A;  3HST B;  4DTS A;  1Q9Y A;  1XWL A;  4M3R A;  4F2R A;  2IOC A;  4FJ8 A;  4CJL A;  3LP0 A;  3OS2 A;  1SKW A;  2B4J A;  1VSM A;  1NOZ A;  1FXX A;  3FFI A;  5EU7 A;  3AVN A;  4CGD A;  4CF2 A;  4JS5 A;  3HPO A;  4HVJ A;  2GV9 A;  4OKK A;  3JYT A;  4BDY A;  1NK7 A;  1SL0 A;  2HMI A;  2KFN A;  1HPZ A;  4DSJ A;  3L2U A;  4O44 A;  4HUE A;  3M8P A;  4CF1 A;  3SUQ A;  2ZQB A;  3DRP A;  3KKR A;  4F2S A;  3AVG A;  3C94 A;  4N41 A;  1HRH A;  2F8T A;  1QHT A;  4IG3 A;  5CYM A;  3ZT1 A;  4O0I A;  4FLU A;  1G15 A;  4DSE A;  1J5O A;  4F3O A;  4E1N A;  4FJJ A;  4DSF A;  1L5U A;  2FBV A;  3MXJ A;  4CJV A;  1VRT A;  3LAK A;  4NCG A;  2ETJ A;  4CHQ A;  2G8H A;  3KD1 E;  4O0J A;  4C8O A;  4H8K A;  3NH2 A;  3L2W A;  3AV9 A;  3HL8 A;  3K59 A;  3TAE A;  4DTP A;  5J2Q A;  1KVB A;  1RT7 A;  3AVH A;  3AVM A;  4BWJ A;  3T19 A;  1NK4 A;  1JLC A;  1S1T A;  5T7B A;  2D0B A;  3SUP A;  3NE6 A;  4DLG A;  1JLG A;  4G1Q A;  1NJX A;  3PY8 A;  4O55 A;  4RW4 A;  4E7L A;  1BIZ A;  4W5N A;  1A5W A;  3O3F A;  4CJR A;  4HCB A;  3ZSO A;  5HBM A;  4CEC A;  1VSL A;  3U6F A;  1WLJ A;  3OYB A;  2OPQ A;  2ITG A;  3AVI A;  4FVM A;  2G8F A;  4O5B A;  4DTR A;  3HP9 A;  5KI6 A;  4OGC A;  4TSX A;  1TK5 A;  4OVL A;  1BHL A;  2OPR A;  4B8C A;  5KRT A;  3SQ1 A;  2HHU A;  3QO9 A;  2BE2 A;  3AO1 A;  3MEG A;  5FRM A;  3M8Q A;  1JL2 A;  1LW0 A;  3VQC A;  5C42 A;  1NK9 A;  1S9E A;  4DQI A;  3RR7 A;  2KQ2 A;  4CJ3 A;  4CJ5 A;  1KTQ A;  2HHS A;  4JRQ A;  3DRS A;  1RT4 A;  2P5G A;  1JLB A;  1WSI A;  4BDP A;  3B6P A;  3HYF A;  3NDK A;  3V4I A;  2YKN A;  2G8V A;  2BDP A;  4HUF A;  1SV5 A;  1K6Y A;  1B9F A;  4OKE A;  3HVR A;  3SZ2 A;  4CHO A;  4DQQ A;  3MXM A;  3VQ5 A;  1DTQ A;  1IKW A;  3HT3 A;  3V9U A;  3C6U A;  1UWB A;  3DM2 A;  4CEO A;  3V9Z A;  2QXF A;  1A5V A;  4OLB A;  4JS4 A;  3RMC A;  3ZT2 A;  3O4Q A;  4AIL C;  3DRR A;  3LWL A;  3QEP A;  3CM5 A;  4F4K A;  4PWD A;  1HYZ A;  1S1V A;  4FM0 A;  3RTV A;  4CHP A;  2VG6 A;  3QEX A;  5I3U A;  1TK0 A;  3EZ5 A;  5HLF A;  1CZ9 A;  4LSL A;  4HUG A;  2KZM A;  2OZM A;  4CED A;  1L3V A;  4DS5 A;  1VSK A;  1QQC A;  3ISN C;  3S3M A;  3QEI A;  2E6M A;  1C0U A;  4B3O A;  4CFA A;  5D3G A;  2HHT A;  1KFS A;  3DLG A;  3KKS A;  4M3U A;  3SQ0 A;  1BCO A;  1C0T A;  2HW3 A;  1LAV A;  4IFY A;  3K57 A;  2DFF A;  3U3G A;  1BGX T;  3V9W A;  4DFP A;  3CG7 A;  1C1B A;  3CFR A;  2HHW A;  1RTH A;  4CIG A;  4DF8 A;  3RMA A;  3PO4 A;  3OYF A;  1CXU A;  4B8A B;  3VQQ A;  3SPZ A;  2YNH A;  4BAC A;  3AVL A;  1FKO A;  4FJI A;  3AA4 A;  3VQ7 A;  2I5J A;  4M3W A;  3KK1 A;  2PYJ A;  1NKC A;  2RF2 A;  1RDA A;  4DTO A;  4OGE A;  1HQE A;  4KV8 A;  4DTU A;  3SUN A;  4FJ7 A;  4QOZ B;  2VWK A;  4AHR A;  3L2V A;  3M8S A;  1U45 A;  3ZSZ A;  1TKX A;  1U48 A;  3WNH A;  2VG7 A;  1RT2 A;  1FKP A;  4FJX A;  2D0C A;  3BGR A;  3NCI A;  5HRR A;  4R5P A;  3THV A;  5SZT A;  3SQ2 A;  4CJQ A;  4CIF A;  1ASW A;  2X78 A;  3KLG A;  4J2D A;  4EP5 A;  3HJF A;  2KZZ A;  1T05 A;  1EXQ A;  2Z1J A;  1NJZ A;  1SL1 A;  2ATQ A;  3DLR A;  3IG1 A;  1YTU A;  1KFD A;  1TAU A;  1XHZ A;  4Z0U A;  4M3Z A;  4YFU A;  4BWM A;  4KKO A;  1JXE A;  1VSD A;  2Z1H A;  1KVA A;  1XHX A;  4FM2 A;  2HVH A;  1XC9 A;  2RPI A;  3CQ8 A;  4DF4 A;  4DU4 A;  3OYA A;  4KHS A;  3A2F A;  1ZBF A;  2P1J A;  3ZSX A;  3L2Q A;  2R7Y A;  3PX6 A;  4CEE A;  4Y1D A;  4M3X A;  3CM6 A;  3NGY A;  4CJT A;  4B9M A;  2QKB A;  4FW1 A;  4LSN A;  3RWU A;  2OA8 A;  1EX4 A;  3OJS A;  1RBT A;  1VK0 A;  1L3S A;  3V1Q A;  1RTD A;  4ZTF A;  2Z1I A;  2W42 A;  4I2Q A;  4OKJ A;  3ZT3 A;  3SNN A;  4C8K A;  1EP4 A;  4BE2 A;  4FJK A;  1IO2 A;  4B9L A;  2HVI A;  4Q0B A;  1ZBH A;  3HPG A;  4E19 A;  3K2P A;  3VQ9 A;  3QNO A;  3T1A A;  1SKR A;  3VQ8 A;  1TKZ A;  4J2A A;  1J53 A;  3BDP A;  3ZCM A;  4B9S A;  3AO2 A;  4FK4 A;  1TGO A;  1C0M A;  4CEF A;  3OYI A;  4XIU A;  3HP6 A;  1HNV A;  1IKX A;  5DK5 A;  4CJE A;  3C6T A;  2F8S A;  3V6D A;  3NFA A;  2EX3 A;  2A1S A;  2DFE A;  1I3A A;  3AA5 X;  1JLF A;  3KIO A;  4EZ6 A;  3CFO A;  4F3T A;  1TKT A;  2WON A;  4CFB A;  3DOK A;  3PX4 A;  4CIE A;  4CGI A;  4EZ9 A;  3QNN A;  5HRN A;  4PUO A;  1YVU A;  1Z25 A;  1HYS A;  1FK9 A;  4E7K A;  2YV0 X;  1WAF A;  1VSI A;  3NF8 A;  1VSH A;  5CZ1 A;  3LP1 A;  3TR8 A;  4KHU A;  1RBU A;  3HK2 A;  3T3F A;  2OPS A;  1NJY A;  3U3Y A;  1X9S A;  1JLE A;  1KVC A;  2HB5 A;  3QIN A;  1QE1 A;  4I9L A;  3VQB A;  4CK1 A;  4CEZ A;  1BQM A;  2KW4 A;  2FBX A;  4ZTJ A;  3K5M A;  1D8Y A;  5FRN A;  3QET A;  1RT6 A;  3S3O A;  3VQA A;  3ZSQ A;  3NH0 A;  4FJ9 A;  2B6A A;  1O1W A;  4FZZ A;  4FM1 A;  2E4L A;  2PZS A;  4J2B A;  3PX0 A;  4E89 A;  3OYD A;  4BDZ A;  2FBT A;  3NAE A;  3TAB A;  1S5J A;  3S3N A;  2P5O A;  1BI4 A;  1W9H A;  4KB0 A;  3QER A;  1KLM A;  3KK3 A;  1C6V A;  3EY1 A;  4DG1 A;  3OYN A;  3LPU A;  1T8E A;  1RBV A;  3OS1 A;  4DTX A;  2WOM A;  4ELU A;  1S6P A;  4NYN A;  3O3G A;  3OJU A;  2ZE2 A;  4DTJ A;  2FC0 A;  3QEV A;  1WSH A;  4KRF A;  4PQU A;  1D5A A;  4E3S A;  2DTU A;  2XY6 A;  1B92 A;  3SV3 A;  4H4M A;  4NYF A;  4DQP A;  2XY8 A;  1NOY A;  1UA0 A;  4I7F A;  4FJM A;  5JS2 A;  3PO5 A;  3I8D A;  5KRS A;  4FJN A;  1NKB A;  3RMD A;  3AVA A;  4DU3 A;  2DY4 A;  3VA0 A;  2Q3S A;  4CGH A;  4Q5V A;  4DFJ A;  1TKD A;  2PY5 A;  2PYL A;  1W0H A;  4FLZ A;  4M3Y A;  1F21 A;  4OJR A;  3K5L A;  1N6Q A;  4J2E A;  5E41 A;  4AH9 A;  4JRP A;  3OVN A;  4AHV A;  3EYZ A;  4RW7 A;  1HQU A;  3O4N A;  4CEA A;  3L8B A;  3SJJ A;  5DMR A;  1GOC A;  4FCY A;  4DQS A;  4RW6 A;  3WNG A;  3MEE A;  4CJW A;  4PY5 A;  1S1U A;  3TAM A;  3F73 A;  3NH1 A;  3V1O A;  3SCX A;  3KTQ A;  4DSL A;  4UQG A;  4K8Z A;  4Z4F A;  1TL1 A;  1HMV A;  3KJV A;  1JL1 A;  5HRS A;  2IC3 A;  4CJP A;  2P51 A;  1ASV A;  4ID5 A;  3NF9 A;  4CER A;  3TAG A;  1SL2 A;  2EHG A;  4M3T A;  3JSM A;  4HTU A;  4CJK A;  1NK0 A;  4ID1 A;  3NBP A;  3OYJ A;  1X1P A;  1RNH A;  5CYQ A;  4DLE A;  5HP1 A;  2Y1I A;  2X6S A;  1SKS A;  4FLV A;  1QSL A;  4B9T A;  2X74 A;  2YHA A;  1TL3 A;  4RW9 A;  3WNE A;  2OYQ A;  4RW8 A;  1YT3 A;  3ITH A;  2D0A A;  1RCH A;  4Z4C A;  1QTM A;  1S6Q A;  4CHZ A;  3KK2 A;  1WSE A;  2YNF A;  2JGU A;  4CJU A;  2LSN A;  3LDS A;  1U47 A;  4EP4 A;  4DU1 A;  4F8R A;  2VWJ A;  1NK8 A;  4C8L A;  4O4G A;  4BE0 A;  1WSF A;  1WSG A;  4K8X A;  3HXM A;  5JS1 A;  3B6O A;  3O3H A;  3UIQ A;  3V1R A;  3ALY A;  4FLW A;  1JLA A;  3KLE A;  2VG5 A;  3SYZ A;  1IG9 A;  3M8R A;  4FJL A;  3AA3 A;  4CFD A;  3TI0 A;  5CZ2 A;  2G8K A;  5J2M A;  1NK5 A;  4FZY A;  4NCA A;  5J1E A;  3LAM A;  1BQN A;  1HYV A;  1D9F A;  1ZBL A;  2NUB A;  2HNY A;  4FLY A;  4CE9 A;  3G10 A;  4KI6 A;  1LWC A;  3MAQ A;  1N5Y A;  4KHN A;  3OYH A;  1J54 A;  3AVJ A;  3KLH A;  3OYM A;  3L2R A;  3VQ4 A;  1BIS A;  1B9D A;  3LAL A;  3LZI A;  1UOC A;  4GVM A;  4LH5 A;  5I42 A;  4DSK A;  3TAP A;  4B9N A;  2ZD1 A;  1LV5 A;  4KI4 A;  4W5Q A;  3RRH A;  4E0D A;  3OYE A;  4I9Q A;  1R0A A;  1LAW A;  3ULD A;  2QKK A;  2FBY A;  2HHQ A;  1U04 A;  2Y1J A;  1A5X A;  3AO3 A;  1X9W A;  1WNS A;  3DLB A;  3P1G A;  1ZYQ A;  1VSF A;  3ZSR A;  4CJF A;  5C25 A;  3HO1 A;  4CF8 A;  3K58 A;  1T7P A;  4KTQ A;  1XI1 A;  3AA2 A;  4M41 A;  5FRO A;  4DTN A;  4DFM A;  4FLT A;  2B5J A;  1SUQ A;  3DI6 A;  3IAY A;  5HRO A;  1JKH A;  1YTA A;  2XHB A;  3AO5 A;  3ZSW A;  3KLI A;  3C95 A;  3KLF A;  4CES A;  2YNI A;  4FJH A;  3LP2 A;  2G8U A;  2GUI A;  4FXD A;  3DYA A;  3AVB A;  4AHT A;  1REV A;  3LPT A;  4GW6 A;  4AHU A;  4CGF A;  2HHX A;  5J2N A;  1QSY A;  5KGW A;  3TAR A; 
#chains in the Genus database with same CATH topology
 4LD0 A;  1T03 A;  4B1Y B;  4C8N A;  4CEQ A;  4M7X A;  4CCH A;  3K5O A;  4B9V A;  1KAX A;  1WSJ A;  1WN7 A;  5KGX A;  2YKM A;  3ZSY A;  3TAQ A;  4FLX A;  3ZX3 A;  1GOA A;  3O9Q A;  4JEP A;  2VQE K;  4DMN A;  4YOY A;  3IKM A;  2IIR A;  2ZWH A;  1L3T A;  4L8R B;  4Z4E A;  1Z26 A;  4LC9 B;  3DXK B;  2YNG A;  3VQD A;  3E9O A;  3MXI A;  1JLQ A;  4ISG A;  4KRE A;  4EHT A;  4MQ3 A;  3EN9 A;  3O80 A;  4E7H A;  2ASP A;  3ULE A;  2P9P B;  1JXB A;  4JI8 K;  4IDH A;  1LWE A;  2O8E A;  2BAN A;  4KTW A;  1RDU A;  2JLE A;  2BGG A;  4OLA A;  4CVN E;  5J2P A;  1GLJ O;  5CY4 A;  2YHB A;  4GV9 A;  3HPH A;  4BC5 A;  1RTI A;  3K9K A;  4Y1C A;  2DFH A;  1VQ5 N;  5AZJ A;  4N56 A;  2WFB A;  5ELZ A;  4NCB A;  3I0S A;  3PUF A;  3BEX A;  4AHS A;  1NGJ A;  4H4O A;  1OH8 A;  2IVP A;  4IWV A;  3EEQ A;  3W3D A;  3ZT4 A;  3QES A;  4MFB A;  5AQZ A;  3QIP A;  2KFZ A;  1SS6 A;  5BR8 K;  4IG0 A;  2CGK A;  1QSS A;  1S9G A;  3H08 A;  2YJE A;  3TAF A;  2XO7 A;  3QLH A;  4W5R A;  4KHY A;  1NK6 A;  4ELT A;  1NJW A;  1CZB A;  5GIP A;  5AQO A;  4N47 A;  1BCM A;  1Y97 A;  3L3V A;  4DB3 A;  1LW2 A;  5C24 A;  3HOS A;  1I39 A;  1YIT N;  3OYL A;  1BI4 B;  3R8E A;  4C23 A;  2VQF K;  5SWM A;  3SV4 A;  2HBK A;  1W2B M;  2HHV A;  4GV6 A;  1R59 O;  4CFC A;  3C6H A;  3OYC A;  4FZX C;  4M42 A;  3MWT A;  4IOC L;  3CPW M;  1MU2 A;  4LY7 A;  3LM9 A;  1L3U A;  4CEB A;  4FL9 A;  3OBW A;  4CJ7 A;  1IKV A;  5LL6 Z;  4OO1 J;  4ICL A;  3F9K A;  4JKE A;  5AQY A;  4LF7 K;  3AO4 A;  2O4G A;  4CJ4 A;  1TV6 A;  4Z4I A;  1TUY A;  1RBS A;  3AVK A;  3CER A;  4M3R A;  4F2R A;  2IOC A;  3SMP A;  3CMA N;  2RE2 A;  1FXX A;  4DR4 K;  3HPO A;  4OKK A;  1YUW A;  4AM6 A;  1NGE A;  3UE5 A;  4OLB A;  4LF9 K;  2ZQB A;  3KKR A;  3BZK A;  1HRH A;  2F8T A;  4DSE A;  5CYM A;  4F3O A;  1Q86 O;  4E1N A;  1L5U A;  3MXJ A;  3GG4 A;  4O0J A;  4JI0 K;  3TAE A;  4DTP A;  1KVB A;  4BWJ A;  3AVM A;  3T19 A;  1NK4 A;  1S1T A;  1YXQ A;  2P9I A;  1YHQ N;  4OPH A;  4E7L A;  1BIZ A;  3O4W A;  4CZI A;  4OPA A;  2ITG A;  3AVI A;  3O9R A;  4O5B A;  3HP9 A;  3SBT A;  1BHL A;  2OPR A;  4B8C A;  2HHU A;  1BU6 O;  3QO9 A;  3O1B A;  3HM8 A;  2KQ2 A;  4CJ3 A;  1KTQ A;  2HHS A;  5C2F A;  3E9P A;  4BDP A;  4LF8 K;  5F0X A;  5CE3 A;  4LF5 K;  2QWL A;  1DTQ A;  3HT3 A;  3C6U A;  1UWB A;  4ILH A;  3LWL A;  3QEP A;  3CM5 A;  4PWD A;  1NM1 A;  4K42 A;  3O9U A;  3QEX A;  1TK0 A;  1ZC6 A;  1L3V A;  5D3G A;  3QIC A;  2HHT A;  2HMP A;  3V9W A;  2YHY A;  3S41 A;  4CZM A;  4DF8 A;  5C0Y A;  3PO4 A;  4B8A B;  4JKG A;  1JCF A;  4BAC A;  2ASM A;  3CC4 N;  3HTV A;  3L4I A;  3FZL A;  3CJ9 A;  3VQ7 A;  4BRP A;  3KK1 A;  1NKC A;  4FJ7 A;  4IEE A;  4QOZ B;  4CBU A;  3M8S A;  1U48 A;  3TSU A;  3ZX0 A;  4ISF A;  4EAH D;  3AGK A;  5HRR A;  4CJQ A;  1OVQ A;  2O8F A;  3BZC A;  4B1W B;  3HJF A;  1SL1 A;  3DLR A;  4I6M A;  4JI6 K;  2GUP A;  5BPM A;  1XHZ A;  4BWM A;  1JXE A;  1KVA A;  2D0O A;  4BRD A;  3Q7C A;  3CQ8 A;  3WT0 A;  4DU4 A;  4KHS A;  2GX9 A;  1ZBF A;  2P1J A;  3ZSX A;  5AQW A;  1GLD G;  2GEL A;  4O8U A;  3JXU A;  4M3X A;  3NGY A;  4CJT A;  2NRV A;  3OJS A;  4YOX A;  1BO5 O;  3LDQ A;  4R79 A;  4H03 B;  2A41 A;  3G25 A;  4BRN A;  1RTD A;  4ZTF A;  5TKY A;  3VQ8 A;  1TKZ A;  1J53 A;  3AO2 A;  4M63 C;  3HP6 A;  4H0T B;  1HKB A;  3UKU B;  5AJ3 K;  4CZG A;  2PBD A;  2A1S A;  4EZ6 A;  3D2E A;  1TKT A;  1QQO A;  4CIE A;  4CGI A;  2RHK A;  5HRN A;  1Z25 A;  1HYS A;  3TR8 A;  2YHW A;  1X9S A;  1RDW X;  4CEZ A;  5M1P A;  1HLU A;  5FPN A;  1D8Y A;  2KW4 A;  4ZTJ A;  5FRN A;  1IBL K;  4XH4 A;  1RT6 A;  1YJN N;  3VQA A;  3ZSQ A;  4JK8 A;  1O1W A;  3H1Q A;  4E89 A;  3OYD A;  4BDZ A;  5GIN A;  1NMD A;  1K8K B;  3KK3 A;  2CH6 A;  3EY1 A;  3OYN A;  3VF4 A;  4WQ4 A;  2KHO A;  3FE1 A;  1P90 A;  3I33 A;  3CCL N;  4FOI A;  5LMU K;  3M3Z A;  2ZE2 A;  2Q97 A;  4E3S A;  1GLB G;  2WBN A;  4NLB A;  5M1Q A;  4I7F A;  5JS2 A;  3VGL A;  4DU3 A;  2DY4 A;  4DFJ A;  1W0H A;  5GAD P;  5AQX A;  1KC8 O;  2FXU A;  3BY5 A;  4AQY K;  4WQ4 C;  3MMV A;  1NGC A;  3KWI A;  4KH5 A;  1WOQ A;  2IVN A;  5GAG P;  2OTL N;  3D2E B;  4PY5 A;  3SCX A;  4LFC K;  3V1O A;  2FSN A;  4BRC A;  1HNZ K;  4CJP A;  2E20 A;  2HF3 A;  1ASV A;  3O9T A;  2YHX A;  1FJG K;  4HTU A;  4ID1 A;  1E4F T;  5CYQ A;  5BR9 A;  3NVK A;  4FVU A;  2UXB K;  3FLC O;  4LFA K;  1YT3 A;  2D0A A;  3CIP A;  2JGU A;  4CJU A;  4H0X B;  4EP4 A;  4BRG A;  4BE0 A;  1WSF A;  3HXM A;  3B6O A;  4FLW A;  2VG5 A;  3FZF A;  2JWL A;  2P9K A;  4BRO A;  3BUZ B;  5M1N A;  4YOT A;  3I8B A;  1HYV A;  4FSV A;  1M1K O;  3HRG A;  4FLY A;  4KI6 A;  3WQT A;  3G10 A;  1LWC A;  1J54 A;  3OA9 A;  4H5W A;  3AVJ A;  2O8C B;  1BIS A;  4DR3 K;  1UOC A;  3CCS N;  1IJJ A;  2YX6 A;  4B9N A;  5LMN K;  3ENB A;  3J8A A;  3CF5 L;  4I9Q A;  4LF4 K;  1K8K A;  4FWS A;  1YVN A;  3QB0 A;  3ULD A;  2QKK A;  1U04 A;  2Y1J A;  3DLB A;  4DV4 K;  4GVE A;  2QWN A;  1ZYQ A;  3K58 A;  2VCP A;  1RFQ A;  3AA2 A;  2E2N A;  5GIO A;  4M41 A;  5FRO A;  3OTO K;  4IO8 A;  1HKG A;  3CCU N;  3G71 N;  3C95 A;  3KLF A;  2YNI A;  2G8U A;  3MX2 A;  4JKB A;  1VQ4 N;  3GDQ A;  1VQ7 N;  5C10 A;  4FWL A;  4H0V B;  3MN5 A;  4MLH A;  4Z4G A;  1RT1 A;  4KHW A;  3G0Z A;  3U4L A;  4FWN A;  2ZJP L;  2ZJR L;  4A61 A;  3P83 D;  4BRI A;  3K5N A;  4KB1 A;  3SBG A;  2O8F B;  1EKE A;  1QQN A;  4H0P A;  5AFU H;  3OYK A;  2IDO A;  2A1R A;  4JI2 K;  1OH7 A;  4CF0 A;  2HNZ A;  3V81 A;  4LF6 K;  3R9P A;  3NF6 A;  2YI1 A;  1C1C A;  2YCH A;  2XY7 A;  1CXQ A;  1WAJ A;  4CZF A;  3CCR N;  4B3R K;  3V9X A;  1RDC A;  1RDD A;  1XUP O;  2KLA A;  4B08 A;  2OAN A;  1RDB A;  3ZSV A;  3KZB A;  3THX A;  3F2K A;  2QK9 A;  4JI7 K;  3P5J A;  1YI2 N;  2KTQ A;  4DV1 K;  1W7A A;  1HPM A;  1BL3 A;  2UUB K;  1QVF M;  3L0Q A;  1U49 A;  5BRH A;  4M45 A;  3V9S A;  3LP3 A;  1Q8I A;  4ISE A;  4JK9 A;  1U4B A;  4RG8 A;  1D9D A;  4BQZ A;  2X6N A;  1CLQ A;  4X62 K;  2EWS A;  3ZEU A;  3VQE A;  4YOR A;  1BUP A;  4C8M A;  4HCC A;  3VF2 A;  3NGZ A;  3MEC A;  4K25 A;  5H1S Q;  4E1M A;  3DLH A;  5CR4 A;  4WYB A;  4CGJ A;  4KHQ A;  3C6A A;  3PV8 A;  3ASM A;  4AHC A;  4HHT A;  3N4Q A;  1S72 N;  4M7Y A;  1GLL O;  1X9M A;  4GMJ B;  4DSI A;  1V4T A;  4JK7 A;  1IH7 A;  4FJG A;  1VAZ A;  4GNI A;  1J9A A;  3SUO A;  4DV2 K;  4DV0 K;  2RN2 A;  1NMN A;  3TPQ A;  4BVO A;  4B1Z A;  5IT9 O;  1X9J A;  4CHN A;  2PAV A;  3CYM A;  2E88 A;  5HRP A;  2F96 A;  3SQ4 A;  3HST B;  3THW B;  4V19 S;  1OVY A;  1Q9Y A;  3O8M A;  4CJL A;  4JI3 K;  3OS2 A;  1VQ8 N;  5EU7 A;  3AVN A;  4J2E A;  3ZYY X;  3JYT A;  2HMI A;  4HUE A;  3LM2 A;  3M8P A;  4CF1 A;  4N41 A;  3ENH A;  1QHT A;  1J5O A;  1G15 A;  2FBV A;  4CJV A;  1VRT A;  2UUC K;  2YJF A;  3J7Y P;  2G8H A;  4WQ5 C;  4H8K A;  3NH2 A;  5J2Q A;  1I94 K;  3AVH A;  1U2V B;  2D0B A;  3SUP A;  2Q1N A;  1BDG A;  1JLG A;  3RVC A;  4G1Q A;  4WF9 L;  4O55 A;  4RW4 A;  3CCQ N;  1A5W A;  3O3F A;  4BG8 A;  4CJR A;  4HCB A;  1NLV A;  3ZSO A;  4CZH A;  4CEC A;  1VSL A;  3MN9 A;  4DTR A;  1TK5 A;  5AQP A;  1TYQ B;  3VPZ A;  3MEG A;  1YF5 L;  3M8Q A;  1D4X A;  1NGH A;  1LW0 A;  3VQC A;  4DKW A;  5C42 A;  1NK9 A;  2P9S A;  4JRQ A;  4K41 A;  3DRS A;  1WSI A;  3SAH A;  3V4I A;  2BDP A;  1K6Y A;  3MXM A;  3HVR A;  4DQQ A;  3VQ5 A;  1IKW A;  3V9U A;  3BF1 A;  3RMC A;  5JMV A;  2VGM A;  1HYZ A;  1S1V A;  3TSP A;  3RTV A;  4WFA L;  5I3U A;  1CZ9 A;  2F9T A;  2KZM A;  4BGB A;  1VSK A;  1QQC A;  1S22 A;  3S3M A;  3QEI A;  4B3O A;  1KFS A;  4M3U A;  3SQ0 A;  3J81 O;  2HW3 A;  2AP1 A;  1BGX T;  5EOY A;  3CG7 A;  3E1Y A;  1RTH A;  4O5F A;  1BG3 A;  4DCH A;  1CXU A;  3OYF A;  3VQQ A;  3J7Z O;  3ZEU B;  2YNH A;  5JLH A;  3AVL A;  1QQM A;  4KHP K;  4WFN L;  2I7P A;  1FKO A;  5JVH L;  2RF2 A;  1RDA A;  4DTO A;  4KV8 A;  3ZSZ A;  1TKX A;  5EVZ A;  3WNH A;  4FJX A;  4CBW A;  3E9L A;  4JI4 K;  4IJA A;  3THV A;  5SZT A;  1Q81 O;  4J2D A;  3SMS A;  3KVG A;  4JKG B;  1T05 A;  1NJZ A;  4YHH K;  1KFD A;  4Z0U A;  1XHX A;  4DR2 K;  4B3M K;  4C1N K;  2HVH A;  3U8X A;  3OYA A;  3J7A P;  2R7Y A;  3C7N B;  4BR7 A;  4CEE A;  2FF6 A;  4BRQ A;  1W97 L;  4FW1 A;  3WXI A;  1YAG A;  1C0G A;  3AAP A;  2OA8 A;  1VK0 A;  3E66 A;  5AQG A;  1TUU A;  4C8K A;  5ADX H;  4DV6 K;  2A42 A;  3K2P A;  2H3G X;  5BPL A;  1XNQ K;  5AQF A;  2Q31 A;  4PHT X;  3AY9 A;  3LDO A;  1QZ5 A;  1C0F A;  1ZXO A;  2W6K A;  3CJC A;  5DK5 A;  2F8S A;  3V6D A;  3NFA A;  2EX3 A;  1I3A A;  4F3T A;  2A6A A;  3CFO A;  4BR0 A;  3DOK A;  2HBJ A;  4GV3 A;  1V4S A;  3QNN A;  3H6E A;  4PUO A;  1YVU A;  1FK9 A;  4DV3 K;  1VSH A;  5CZ1 A;  5AQL A;  3HK2 A;  2QEX N;  2A40 A;  4B3T K;  2W41 A;  4EIA A;  3FZH A;  2E2P A;  3CCM N;  1M90 O;  1JLE A;  2GTD A;  4B3S K;  1QE1 A;  4AM7 A;  1N8R O;  1IG8 A;  3AAQ A;  3ATV A;  2FBX A;  3HSC A;  3QET A;  4O8K A;  1JCG A;  3S3O A;  5C2D A;  4BQL A;  2E4L A;  2FBT A;  5LY3 A;  3S3N A;  1W9H A;  3C7N A;  1C6V A;  2P9S B;  2HST A;  3HI0 A;  1RBV A;  4U7B A;  2WOM A;  4A57 A;  4DTJ A;  1WSH A;  1HJO A;  4PQU A;  4KRF A;  2DTU A;  1X3M A;  1B92 A;  3SV3 A;  3DXK A;  4H4M A;  2XY8 A;  1UA0 A;  1T6D A;  4FJN A;  5DM7 L;  3RMD A;  1TKD A;  2PY5 A;  2PYL A;  1Z05 A;  3Q7B A;  3AGR A;  3K5L A;  1N6Q A;  4AHV A;  4YOW A;  3A8Y A;  4A62 A;  3O4N A;  4CW7 B;  4CEA A;  5DMR A;  1GOC A;  4FCY A;  4RW6 A;  1S1U A;  2O8D B;  1EQY A;  4Z4F A;  1IBK K;  1IBM K;  3EL2 A;  2FSK A;  4IJN A;  3NBP A;  1X1P A;  5BN9 A;  1RNH A;  5HP1 A;  3D6R A;  2X6S A;  4B9T A;  2NZT A;  2OYQ A;  3ITH A;  4JAX A;  1X3N A;  1RCH A;  3KK2 A;  4H5V A;  2YNF A;  4F8R A;  2ZM6 K;  4C8L A;  2NRZ A;  2OTJ N;  3MCP A;  4BR4 A;  1N36 K;  4K8X A;  3V1R A;  3ALY A;  1JLA A;  3KLE A;  1IG9 A;  3AA3 A;  4CFD A;  2W6L A;  5CZ2 A;  1K8A O;  3DXM B;  2NUB A;  3KK7 A;  4XH1 A;  4CBX A;  5ADX A;  1B9D A;  4LH5 A;  3UKR A;  3D2F A;  1ZBS A;  4GVM A;  4EFH A;  2E2Q A;  3TAP A;  3A0I X;  5KQD A;  2NNW A;  4W5Q A;  1VHX A;  1VQK N;  1ATN A;  2P9U A;  3OYE A;  1KD1 O;  1R0A A;  1KQS M;  3THX B;  1A5X A;  4ILG B;  1X9W A;  3H3O B;  3UB5 A;  3P1G A;  2D4W A;  1VSF A;  2VYP A;  4CJF A;  3CPE A;  4BRH A;  1XI1 A;  3WXL A;  4DFM A;  4JI1 K;  5HRO A;  1JKH A;  3AO5 A;  2PFU A;  4B1U B;  3KLI A;  4YDU C;  2O8B A;  4FJH A;  2V7Y A;  3RSE B;  3AVB A;  1SAZ A;  4AHU A;  1WB9 A;  4CGF A;  3ZX2 A;  3EZW A;  5J2N A;  3BF3 A;  4DFK A;  1S1W A;  4MDB A;  4FYD A;  5KTQ A;  4RTF D;  3S9H A;  4CF9 A;  3E01 A;  4WCE L;  3CCJ N;  3VTH A;  3CC2 N;  3MED A;  2GBZ A;  1RTJ A;  3OS0 A;  4KAZ A;  4B1V A;  2O4I A;  5BPN A;  5JLF A;  4IBN A;  3VEX A;  1RT5 A;  3M1F A;  1UA1 A;  1C1A A;  3FR0 A;  4OPJ A;  3K0S A;  3DMJ A;  2P9L A;  1ASU A;  2QI2 A;  4KPY A;  2D5R A;  2Z1G A;  5FDL A;  1NGD A;  5AQJ A;  3LDP A;  3L4Q A;  4Z4H A;  4BRM A;  3VES A;  5K14 A;  2BUP A;  4PKH A;  2NRH A;  3KD5 E;  4NXN K;  4H0O A;  3VEN A;  4DWI A;  1VQ6 N;  2NRW A;  3L3U A;  4IZ9 A;  1S1X A;  2IGI A;  3FZM A;  1RIL A;  3LAN A;  4CZL A;  4BE1 A;  4QS7 A;  1GOB A;  4IDK A;  3SK3 A;  4QAG A;  4KH4 A;  2BH1 A;  2P9K B;  1MWM A;  3OYG A;  1DT9 A;  3D45 A;  1VSE A;  1EO1 A;  3HOT A;  2G8I A;  3AVC A;  4F9O A;  3SI6 A;  1RT3 A;  4B9U A;  1J5E K;  4FK2 A;  2F9W A;  3RMB A;  3H46 O;  1VQO N;  4UY8 O;  3AVF A;  1RBR A;  4JYA K;  3A5N C;  3M5R A;  3NHG A;  3CJ7 A;  4FWP A;  4E7I A;  3NF7 A;  5F1X A;  3RR8 A;  4KTZ A;  3VA0 A;  1U2V A;  3DLE A;  1TVR A;  2E6L A;  3SJH A;  3ID6 A;  1SQK A;  3W0L A;  3R1X A;  3SAG A;  3VN5 A;  1KLN A;  4JKA A;  4GKK K;  3THY A;  2UXC K;  3RRG A;  4ILJ A;  3D0P A;  3SPY A;  2CH5 A;  4BR2 A;  4W5O A;  3O6W A;  3IS9 A;  2Q36 A;  4CHY A;  1U6Z A;  5FPD A;  5BRD A;  1P8Z A;  3WNF A;  4IKF A;  1EET A;  4DTM A;  2IAJ A;  3ZT0 A;  4KO0 A;  2UU9 K;  4BR5 A;  1EWQ A;  1KSP A;  1DKG D;  3O08 A;  3NGI A;  3HVT A;  3VA3 A;  4LH4 A;  2J4R A;  3ZET A;  3H45 C;  5AZI B;  4DTS A;  1XWL A;  4FJ8 A;  2ITM A;  3F5T A;  1SKW A;  1VSM A;  4CGD A;  4JS4 A;  2UYT A;  1NK7 A;  2KFN A;  4DSJ A;  2NRX A;  1WUA A;  4F2S A;  3DRP A;  2QXL A;  4FLU A;  1VQ9 N;  2V7Z A;  2ETJ A;  1T3V A;  3T7Z A;  4C8O A;  5JVG L;  3JS6 A;  3AV9 A;  3HL8 A;  4DR7 K;  3ZLJ A;  4Z94 A;  1RT7 A;  1JLC A;  5T7B A;  4KH6 A;  4FO0 A;  2QWP A;  1CZA N;  2F7T A;  5HBM A;  2OPQ A;  3T69 A;  4OGC A;  2BE2 A;  3CJA A;  3RR7 A;  4CJ5 A;  5AQQ A;  2P5G A;  4PKI A;  3HYF A;  2G8V A;  4HUF A;  1B9F A;  4IXC A;  4CEO A;  4BR9 A;  5KQ8 A;  3ZT2 A;  3O4Q A;  4AIL C;  4WQ5 A;  2E2O A;  2QWM A;  4FM0 A;  1ILY A;  2VG6 A;  4BRL A;  5HL7 L;  4QS8 A;  3IFR A;  4HUG A;  2OZM A;  3CI5 A;  4DS5 A;  1C0U A;  3A5L C;  4CFA A;  3DLG A;  1C0T A;  3T1Y K;  1LAV A;  4IFY A;  2DFF A;  2QTD A;  1N34 K;  3U3G A;  3KHY A;  4K43 A;  5BRF A;  1C1B A;  3CFR A;  2Q0U A;  3O1W A;  1ATS A;  4CIG A;  3ZET B;  3CQX A;  5FLX O;  1ATR A;  4B9Q A;  3THW A;  3SPZ A;  1JCE A;  1NGA A;  2NLX A;  3WXJ A;  2PYJ A;  3R3L A;  4OGE A;  1HQE A;  4MO4 A;  4DTU A;  1Q7Y O;  1IV0 A;  2VWK A;  3L2V A;  1QVG M;  4FWQ A;  5AZJ B;  1RT2 A;  2D0C A;  1TYQ A;  5LJV A;  1HKC A;  3NCI A;  4R5P A;  3SQ2 A;  4QS9 A;  4CIF A;  1EXQ A;  2ATQ A;  3THY B;  1YTU A;  3M6G A;  3MN7 A;  4KKO A;  1VSD A;  2Z1H A;  1K73 O;  4FM2 A;  3TTF A;  4BC4 A;  1XC9 A;  3CQY A;  3I56 N;  3A2F A;  1KXP A;  5AQR A;  3OBY A;  2P9I B;  2P9U B;  4B9M A;  2QKB A;  3CET A;  1XC3 A;  3RWU A;  1EX4 A;  1NBW A;  2A5X A;  1RBT A;  2DPN A;  2Z1I A;  2W42 A;  4I2Q A;  3SNN A;  4H0Y B;  3ZT3 A;  4JV5 K;  1BOT O;  1IO2 A;  4CD1 A;  4FJK A;  2QWO A;  3HPG A;  4E19 A;  3QNO A;  3T1A A;  1SKR A;  4J2A A;  5GAE P;  4B9S A;  3P38 A;  1TGO A;  1C0M A;  4FK4 A;  3EO3 A;  2NRR A;  4CEF A;  2O8B B;  1HNV A;  3J80 O;  3VEY A;  4CJE A;  3AA5 X;  1JLF A;  3KIO A;  3QDK A;  3ATU A;  2HOE A;  2Q0R A;  4KBO A;  4KHU A;  1RBU A;  3T3F A;  1NJY A;  3U9D A;  2HB5 A;  3QIN A;  1BQM A;  2O8E B;  3K5M A;  5HOO A;  3WUH A;  3NH0 A;  4FJ9 A;  3WXK A;  3JAM O;  4FM1 A;  2P9L B;  4J2B A;  4NB4 A;  3EKU A;  3NAE A;  4J8F A;  1BI4 A;  5C15 A;  4DV5 K;  3QER A;  1KLM A;  4C1N I;  3LPU A;  3OS1 A;  4DTX A;  1MWK A;  4ELU A;  4BGA A;  4NYN A;  5F2R A;  1E3M A;  3OJU A;  1NGI A;  2P9P A;  5TKW A;  4NYF A;  4DQP A;  4JD2 B;  1NOY A;  2FLO A;  1N33 K;  5BRE A;  1HNW K;  1BA1 A;  3AVA A;  3WXM B;  2Q3S A;  5EX5 A;  4CI6 A;  1F21 A;  5E41 A;  4AH9 A;  3OVN A;  4IEI A;  3EYZ A;  1HQU A;  3VF6 A;  1K9M O;  2VGN A;  4DQS A;  4CD3 A;  5KPT A;  3IDH A;  3MEE A;  3F73 A;  4K8Z A;  3NH1 A;  3KTQ A;  4DSL A;  4JD2 A;  1MDU B;  1TL1 A;  1HMV A;  3KJV A;  1T44 A;  1JL1 A;  4CZK A;  5HRS A;  1E4G T;  2P51 A;  2QM1 A;  3TAG A;  1SL2 A;  2EHG A;  2A3Z A;  3JSM A;  3RSE A;  3A5M C;  4CJK A;  3SLC A;  3OYJ A;  4DLE A;  1SKS A;  1Q82 O;  2YHA A;  5CHI A;  4DV7 K;  1YIJ N;  5EXW A;  1DEJ A;  2D0P A;  4Z4C A;  4BC2 A;  1S6Q A;  1WSE A;  4MO5 A;  4A59 A;  2LSN A;  5JIC A;  1NK8 A;  4O4G A;  2BTF A;  4BY9 C;  1WSG A;  1OKJ A;  4DR5 K;  3O3H A;  4FJL A;  3SYZ A;  3M8R A;  3MWP A;  3TI0 A;  2G8K A;  4NCA A;  5J1E A;  1XMO K;  3LAM A;  1S3X A;  1D9F A;  2HNY A;  3DJC A;  1N5Y A;  4KHN A;  3OYH A;  3DAW A;  4WFB L;  3OYM A;  4DSK A;  3A5O C;  3EE9 A;  2ZD1 A;  1LV5 A;  3VTI A;  3RRH A;  3G6E N;  4E0D A;  2VWB A;  1LAW A;  2FBY A;  3PSI A;  3AO3 A;  4NO7 A;  4DUZ K;  3VEZ A;  3HO1 A;  4A2B A;  4KTQ A;  1NGF A;  4DTN A;  4CZJ A;  4FLT A;  1SUQ A;  3DI6 A;  5M1F A;  3IAY A;  1YTA A;  2XHB A;  3ZSW A;  4CES A;  3LP2 A;  2GUI A;  4FXD A;  3DYA A;  3LPT A;  4GW6 A;  2HHX A;  1YJ9 N;  3TAR A;  2CGL A;  3QBX A;  1VQN N;  4NLC A;  1Q9X A;  4I2P A;  4KFB A;  3VQP A;  2G8W A;  3QIO A;  1KRP A;  3DOL A;  2WC9 A;  2ZGZ A;  2XY5 A;  2AA4 A;  4WE1 A;  4A5B A;  3LWM A;  4DS4 A;  4QCL A;  1KCF A;  4ELV A;  3BP8 A;  3TAN A;  1IKY A;  3QFP A;  1NGG A;  4JLH A;  3DLK A;  2QWQ A;  1HNI A;  2FF3 B;  3QEW A;  4U67 L;  1LOT B;  3IRX A;  2OPP A;  1Z6R A;  1LWF A;  3TWH A;  4BRK A;  1UAX A;  2P9N B;  3VQ6 A;  3CJ1 A;  3LZJ A;  1NKE A;  1TK8 A;  4YOU A;  4DR6 K;  4FWM A;  2OCE A;  3HM9 A;  4E7J A;  4N76 A;  2GEM A;  1QHA A;  2RKI A;  4N5S A;  3LDN A;  2D1K A;  2OZS A;  3FFK B;  4IO9 L;  1VRU A;  1ESV A;  4NXM K;  4FJ5 A;  2IVO A;  5AQK A;  4ZHR A;  4YNQ A;  3GE1 A;  4JN4 A;  2WTU A;  1ITG A;  1EWR A;  5FPM A;  5I9E B;  1BWF O;  1NG9 A;  1VSJ A;  1NU0 A;  1BIU A;  5FPE A;  3TTD A;  4FWK A;  4JNE A;  3TU5 A;  2F4V K;  4IFV A;  3CFP A;  1Y64 A;  2HND A;  3K9J A;  3OHR A;  3CC7 N;  2HHH K;  1QS4 A;  4W5T A;  3OY9 A;  4M3Z A;  4YY3 K;  2XRI A;  2AJQ A;  3QML A;  2IS3 A;  3CME N;  4YDU A;  3O9S A;  3MK6 A;  1DTT A;  4DQR A;  4FW2 A;  1FW6 A;  4CJS A;  4H5N A;  4Y0W A;  4CGG A;  4FK0 A;  4A2A A;  4JKC A;  4OPK A;  2QW9 A;  1GLF O;  3I0R A;  1HJR A;  4PA1 A;  1Q18 A;  5AQS A;  4RCH A;  4CK3 A;  1MA9 B;  1XQS C;  2ZF5 O;  3GOI A;  4JKD A;  4CK2 A;  1ZBI A;  5AQU A;  1ZBU A;  2GWJ A;  3CD6 N;  1DLO A;  4IOX A;  1TAQ A;  3VEV A;  4FPA A;  1WBD A;  4BRE A;  4CZE A;  1KAZ A;  3ENO A;  3LP0 A;  2B4J A;  4JS5 A;  1NOZ A;  3FFI A;  4CF2 A;  4X65 K;  4BDY A;  4HVJ A;  2GV9 A;  1SL0 A;  1HR0 K;  4PL8 A;  1HPZ A;  3L2U A;  4O44 A;  3SUQ A;  3AVG A;  3C94 A;  4IG3 A;  3ZT1 A;  2FSJ A;  3WEE A;  4O0I A;  3PIO L;  3DLL L;  4FJJ A;  1SZ2 A;  3VEW A;  4DSF A;  4PKG A;  3LAK A;  4NCG A;  4CHQ A;  3KD1 E;  1VQL N;  3L2W A;  4BRA A;  1QZ6 A;  5BN8 A;  3K59 A;  5A2Q O;  2W40 A;  4FOE A;  4BVP A;  3P39 A;  4LFB K;  3NE6 A;  4DLG A;  1NJX A;  3PY8 A;  4W5N A;  4BG9 A;  3O5B A;  3U6F A;  1WLJ A;  1RGI A;  4B1X B;  3OYB A;  4FVM A;  2G8F A;  4FZZ A;  5KI6 A;  4TSX A;  4OVL A;  4HTL A;  5KRT A;  3SQ1 A;  2P9N A;  3AO1 A;  5FRM A;  1JL2 A;  1S9E A;  4DQI A;  5DM6 L;  3SAF A;  1LCU A;  4H5R A;  1RT4 A;  2GWK A;  1JLB A;  3B6P A;  5AR0 A;  3UKU A;  4A5A A;  3NDK A;  2YKN A;  3D2F B;  3UKR B;  3SZ2 A;  1SV5 A;  4OKE A;  4CHO A;  1NGB A;  3V9Z A;  3DM2 A;  2QXF A;  1A5V A;  3VGM A;  3DRR A;  4F4K A;  1N32 K;  4JHD B;  4DQ8 A;  3HZ6 A;  5E26 A;  4CHP A;  4H5T A;  3EZ5 A;  5HLF A;  4LSL A;  4CED A;  3ISN C;  3MX5 A;  2E6M A;  3KKS A;  3QFU A;  4L3Q A;  1BCO A;  3VER A;  3CJB A;  1XNR K;  3K57 A;  4JI5 K;  4JKH A;  3NMU A;  2O8D A;  4DFP A;  2HHW A;  4IOA L;  3RMA A;  5E84 A;  1DGK N;  4DHY A;  1HNX K;  1JJ2 M;  4FJI A;  3AA4 A;  2I5J A;  3DWL A;  4M3W A;  4DUY K;  3SUN A;  1OH6 A;  5GAH P;  4AHR A;  1NNE A;  1U45 A;  3CXC M;  2VG7 A;  4BRF A;  1FKP A;  3BGR A;  4IFE A;  1ASW A;  2X78 A;  3KLG A;  4EP5 A;  3WQU A;  2E5L K;  2KZZ A;  1BA0 A;  2Z1J A;  2E1Y A;  3IG1 A;  3HBT A;  1TAU A;  4YFU A;  1OH5 A;  3AAR A;  3GBT A;  2RPI A;  4FWR A;  4DF4 A;  4MLE A;  3L2Q A;  3PX6 A;  4Y1D A;  3CM6 A;  3T1H K;  1NJI O;  3CHW A;  3H3N O;  4LSN A;  1XMQ K;  2V51 B;  2UXD K;  2WUS A;  1L3S A;  2O8C A;  3MN6 A;  3H1V X;  3V1Q A;  4OKJ A;  1T6C A;  5AZI A;  4YOV A;  1EP4 A;  4BE2 A;  2V52 B;  2HVI A;  4B9L A;  4Q0B A;  4JKF A;  1ZBH A;  3VET A;  3VQ9 A;  3CCE N;  3PSF A;  3BDP A;  3ZCM A;  4EHU A;  4X64 K;  5AQN A;  3OYI A;  5AQH A;  4XIU A;  2HBL A;  1IKX A;  3C6T A;  2KKZ A;  4BC3 A;  2DFE A;  2WON A;  4CFB A;  3PX4 A;  5IWA K;  4EZ9 A;  5AQT A;  3VEO A;  4E7K A;  2YV0 X;  1WAF A;  1VSI A;  3NF8 A;  3LP1 A;  5LJW A;  1GLE G;  2OPS A;  3U3Y A;  3P4I A;  3EKS A;  1KVC A;  4I9L A;  3IMX A;  3VQB A;  4CK1 A;  1GLC G;  4GKJ K;  3L6Q A;  2JWK A;  2B6A A;  4K0K K;  4MDA A;  3U9Z A;  2PZS A;  3PX0 A;  3TAB A;  1S5J A;  2P5O A;  3OW2 M;  4KB0 A;  3VOV A;  3TSQ A;  3KWG A;  4DG1 A;  3PLA A;  1T8E A;  4G9Z A;  1S6P A;  3C65 A;  3IUC A;  3O3G A;  5AFU A;  3R6M A;  3QEV A;  2FC0 A;  1YJW N;  3FGU A;  1D5A A;  2XY6 A;  3FZK A;  3CCV N;  2Q2R A;  3DXM A;  1VQM N;  4FJM A;  3PO5 A;  5C12 A;  5KRS A;  3I8D A;  1NKB A;  5AQM A;  1HX1 A;  5EY4 A;  4CGH A;  4Q5V A;  3EE8 A;  4FPB A;  4FLZ A;  4M3Y A;  3G4S N;  4OJR A;  2NRT A;  4JRP A;  4I6M B;  2E1Z A;  4RW7 A;  4E1J A;  3L8B A;  3SJJ A;  5AQV A;  3LDL A;  2QWR A;  5AQI A;  3WNG A;  4PL7 A;  3WEE B;  4CJW A;  3TAM A;  1VQP N;  1KAY A;  1GLA G;  5MLC Q;  4UQG A;  2ZGY A;  3TTC A;  3F9M A;  2IC3 A;  4ID5 A;  4JHD A;  4CER A;  1O13 A;  3NF9 A;  4M3T A;  4FWO A;  3LL3 A;  5B8H A;  2UUA K;  1NK0 A;  1J6Z A;  2Y1I A;  1QSL A;  4FLV A;  2X74 A;  4RW9 A;  1TL3 A;  3WNE A;  4OX9 K;  4RW8 A;  5KPR A;  1QTM A;  3MCA B;  4CHZ A;  5M1K A;  4HWI A;  3C0B A;  3LDS A;  4RWT A;  1U47 A;  4DU1 A;  4GY2 B;  2VWJ A;  4DR1 K;  2QA4 N;  5JS1 A;  1G99 A;  3UIQ A;  4X66 K;  5J2M A;  1NK5 A;  4FZY A;  1BQN A;  1ZBL A;  3GL1 A;  4CE9 A;  5M1O A;  3MAQ A;  3KLH A;  3L2R A;  3D7E O;  3I55 N;  3VQ4 A;  3LAL A;  3LZI A;  1H1V A;  5I42 A;  1HUX A;  3ID8 A;  1WBB A;  2HBM A;  4KI4 A;  3ULE B;  4AF1 A;  3VMF B;  2HHQ A;  3PIP L;  1WNS A;  2ASO A;  3ZSR A;  5C25 A;  4CF8 A;  1T7P A;  3N4P A;  2I7N A;  3MDQ A;  5KPZ A;  3QBW A;  2B5J A;  2ZJQ L;  1NWK A;  2CGJ A;  3NVM A;  4AHT A;  1REV A;  4XEI A;  3VGK A;  3B8A X;  3P31 A;  2E8A A;  1QSY A;  5KGW A;  2HF4 A;  4XH5 A; 
#chains in the Genus database with same CATH homology
 4LD0 A;  4DFK A;  1S1W A;  1T03 A;  4FYD A;  1Q9X A;  4C8N A;  4I2P A;  4KFB A;  3VQP A;  4CEQ A;  4CCH A;  2G8W A;  3QIO A;  1KRP A;  4Z4G A;  3K5O A;  4B9V A;  5KTQ A;  1RT1 A;  3DOL A;  3G0Z A;  3S9H A;  4KHW A;  1WSJ A;  1WN7 A;  4CF9 A;  5KGX A;  3P83 D;  2YKM A;  3E01 A;  3ZSY A;  2XY5 A;  3K5N A;  3MED A;  2GBZ A;  4KB1 A;  1RTJ A;  3OS0 A;  3TAQ A;  4FLX A;  4KAZ A;  4WE1 A;  1EKE A;  2O4I A;  1GOA A;  3LWM A;  4IBN A;  1RT5 A;  1UA1 A;  1C1A A;  4DMN A;  3OYK A;  2IDO A;  4OPJ A;  4DS4 A;  2A1R A;  4QCL A;  1KCF A;  3DMJ A;  4ELV A;  3TAN A;  4CF0 A;  2HNZ A;  1IKY A;  1ASU A;  3V81 A;  1L3T A;  4JLH A;  4L8R B;  3DLK A;  1Z26 A;  4Z4E A;  4KPY A;  2D5R A;  1HNI A;  3NF6 A;  2YNG A;  1C1C A;  3VQD A;  3MXI A;  2Z1G A;  3QEW A;  2XY7 A;  5FDL A;  1CXQ A;  1JLQ A;  1WAJ A;  3IRX A;  4KRE A;  2OPP A;  1LWF A;  4MQ3 A;  3TWH A;  3V9X A;  1RDC A;  1RDD A;  4B08 A;  1UAX A;  4Z4H A;  4E7H A;  3VQ6 A;  3LZJ A;  5K14 A;  1NKE A;  1RDB A;  1TK8 A;  3ZSV A;  1JXB A;  3KD5 E;  4DWI A;  1LWE A;  2QK9 A;  3HM9 A;  3P5J A;  4E7J A;  2BAN A;  4N76 A;  2KTQ A;  3L3U A;  1S1X A;  2IGI A;  4KTW A;  2RKI A;  4N5S A;  4OLA A;  2JLE A;  2BGG A;  1RIL A;  3LAN A;  5J2P A;  4BE1 A;  2OZS A;  5CY4 A;  2YHB A;  3HPH A;  1GOB A;  1VRU A;  1BL3 A;  4IDK A;  1RTI A;  4FJ5 A;  4Y1C A;  1U49 A;  4ZHR A;  2DFH A;  4M45 A;  4QAG A;  4YNQ A;  3V9S A;  3LP3 A;  4N56 A;  4NCB A;  1Q8I A;  3I0S A;  3PUF A;  4AHS A;  1U4B A;  4H4O A;  1ITG A;  3OYG A;  4RG8 A;  3ZT4 A;  3D45 A;  1VSE A;  3QES A;  4MFB A;  1D9D A;  2G8I A;  3AVC A;  2X6N A;  1RT3 A;  3SI6 A;  4B9U A;  1CLQ A;  4FK2 A;  3VQE A;  3RMB A;  3QIP A;  1VSJ A;  2KFZ A;  1BIU A;  4IG0 A;  4C8M A;  3AVF A;  1QSS A;  1RBR A;  4HCC A;  1S9G A;  3H08 A;  3MEC A;  3NGZ A;  3TAF A;  3DLH A;  4E1M A;  2XO7 A;  4IFV A;  3QLH A;  3NHG A;  4W5R A;  3CFP A;  4KHY A;  1NK6 A;  4ELT A;  2HND A;  1NJW A;  4CGJ A;  4E7I A;  1CZB A;  4KHQ A;  3NF7 A;  3RR8 A;  3PV8 A;  3ASM A;  1BCM A;  1QS4 A;  1Y97 A;  4KTZ A;  4N47 A;  3DLE A;  4AHC A;  4W5T A;  1TVR A;  2E6L A;  3L3V A;  3OY9 A;  4HHT A;  2XRI A;  2AJQ A;  1LW2 A;  2IS3 A;  5C24 A;  1X9M A;  1I39 A;  3VN5 A;  1KLN A;  4GMJ B;  3OYL A;  1BI4 B;  1DTT A;  4DSI A;  3SV4 A;  5SWM A;  4FW2 A;  4DQR A;  1IH7 A;  3RRG A;  4CJS A;  3D0P A;  3SPY A;  4FJG A;  2HHV A;  4CFC A;  4CGG A;  4W5O A;  3OYC A;  4FZX C;  4FK0 A;  1J9A A;  4M42 A;  3IS9 A;  4CHY A;  4OPK A;  3I0R A;  3SUO A;  1HJR A;  1MU2 A;  4PA1 A;  4LY7 A;  3WNF A;  1L3U A;  4CEB A;  4IKF A;  1EET A;  4CK3 A;  4DTM A;  2IAJ A;  2RN2 A;  3ZT0 A;  4KO0 A;  4CK2 A;  1ZBI A;  1IKV A;  1ZBU A;  1DLO A;  4CHN A;  3CYM A;  1TAQ A;  3F9K A;  4ICL A;  1KSP A;  3NGI A;  3HVT A;  3AO4 A;  2O4G A;  4CJ4 A;  3VA3 A;  1TV6 A;  5HRP A;  4LH4 A;  4Z4I A;  2F96 A;  3SQ4 A;  1RBS A;  3AVK A;  3HST B;  4DTS A;  1Q9Y A;  1XWL A;  4M3R A;  4F2R A;  2IOC A;  4FJ8 A;  4CJL A;  3LP0 A;  3OS2 A;  1SKW A;  2B4J A;  1VSM A;  1NOZ A;  1FXX A;  3FFI A;  5EU7 A;  3AVN A;  4CGD A;  4CF2 A;  4JS5 A;  3HPO A;  4HVJ A;  2GV9 A;  4OKK A;  3JYT A;  4BDY A;  1NK7 A;  1SL0 A;  2HMI A;  2KFN A;  1HPZ A;  4DSJ A;  3L2U A;  4O44 A;  4HUE A;  3M8P A;  4CF1 A;  3SUQ A;  2ZQB A;  3DRP A;  3KKR A;  4F2S A;  3AVG A;  3C94 A;  4N41 A;  1HRH A;  2F8T A;  1QHT A;  4IG3 A;  5CYM A;  3ZT1 A;  4O0I A;  4FLU A;  1G15 A;  4DSE A;  1J5O A;  4F3O A;  4E1N A;  4FJJ A;  4DSF A;  1L5U A;  2FBV A;  3MXJ A;  4CJV A;  1VRT A;  3LAK A;  4NCG A;  2ETJ A;  4CHQ A;  2G8H A;  3KD1 E;  4O0J A;  4C8O A;  4H8K A;  3NH2 A;  3L2W A;  3AV9 A;  3HL8 A;  3K59 A;  3TAE A;  4DTP A;  5J2Q A;  1KVB A;  1RT7 A;  3AVH A;  3AVM A;  4BWJ A;  3T19 A;  1NK4 A;  1JLC A;  1S1T A;  5T7B A;  2D0B A;  3SUP A;  3NE6 A;  4DLG A;  1JLG A;  4G1Q A;  1NJX A;  3PY8 A;  4O55 A;  4RW4 A;  4E7L A;  1BIZ A;  4W5N A;  1A5W A;  3O3F A;  4CJR A;  4HCB A;  3ZSO A;  5HBM A;  4CEC A;  1VSL A;  3U6F A;  1WLJ A;  3OYB A;  2OPQ A;  2ITG A;  3AVI A;  4FVM A;  2G8F A;  4O5B A;  4DTR A;  3HP9 A;  5KI6 A;  4OGC A;  4TSX A;  1TK5 A;  4OVL A;  1BHL A;  2OPR A;  4B8C A;  5KRT A;  3SQ1 A;  2HHU A;  3QO9 A;  2BE2 A;  3AO1 A;  3MEG A;  5FRM A;  3M8Q A;  1JL2 A;  1LW0 A;  3VQC A;  5C42 A;  1NK9 A;  1S9E A;  4DQI A;  3RR7 A;  2KQ2 A;  4CJ3 A;  4CJ5 A;  1KTQ A;  2HHS A;  4JRQ A;  3DRS A;  1RT4 A;  2P5G A;  1JLB A;  1WSI A;  4BDP A;  3B6P A;  3HYF A;  3NDK A;  3V4I A;  2YKN A;  2G8V A;  2BDP A;  4HUF A;  1SV5 A;  1K6Y A;  1B9F A;  4OKE A;  3HVR A;  3SZ2 A;  4CHO A;  4DQQ A;  3MXM A;  3VQ5 A;  1DTQ A;  1IKW A;  3HT3 A;  3V9U A;  3C6U A;  1UWB A;  3DM2 A;  4CEO A;  3V9Z A;  2QXF A;  1A5V A;  4OLB A;  4JS4 A;  3RMC A;  3ZT2 A;  3O4Q A;  4AIL C;  3DRR A;  3LWL A;  3QEP A;  3CM5 A;  4F4K A;  4PWD A;  1HYZ A;  1S1V A;  4FM0 A;  3RTV A;  4CHP A;  2VG6 A;  3QEX A;  5I3U A;  1TK0 A;  3EZ5 A;  5HLF A;  1CZ9 A;  4LSL A;  4HUG A;  2KZM A;  2OZM A;  4CED A;  1L3V A;  4DS5 A;  1VSK A;  1QQC A;  3ISN C;  3S3M A;  3QEI A;  2E6M A;  1C0U A;  4B3O A;  4CFA A;  5D3G A;  2HHT A;  1KFS A;  3DLG A;  3KKS A;  4M3U A;  3SQ0 A;  1BCO A;  1C0T A;  2HW3 A;  1LAV A;  4IFY A;  3K57 A;  2DFF A;  3U3G A;  1BGX T;  3V9W A;  4DFP A;  3CG7 A;  1C1B A;  3CFR A;  2HHW A;  1RTH A;  4CIG A;  4DF8 A;  3RMA A;  3PO4 A;  3OYF A;  1CXU A;  4B8A B;  3VQQ A;  3SPZ A;  2YNH A;  4BAC A;  3AVL A;  1FKO A;  4FJI A;  3AA4 A;  3VQ7 A;  2I5J A;  4M3W A;  3KK1 A;  2PYJ A;  1NKC A;  2RF2 A;  1RDA A;  4DTO A;  4OGE A;  1HQE A;  4KV8 A;  4DTU A;  3SUN A;  4FJ7 A;  4QOZ B;  2VWK A;  4AHR A;  3L2V A;  3M8S A;  1U45 A;  3ZSZ A;  1TKX A;  1U48 A;  3WNH A;  2VG7 A;  1RT2 A;  1FKP A;  4FJX A;  2D0C A;  3BGR A;  3NCI A;  5HRR A;  4R5P A;  3THV A;  5SZT A;  3SQ2 A;  4CJQ A;  4CIF A;  1ASW A;  2X78 A;  3KLG A;  4J2D A;  4EP5 A;  3HJF A;  2KZZ A;  1T05 A;  1EXQ A;  2Z1J A;  1NJZ A;  1SL1 A;  2ATQ A;  3DLR A;  3IG1 A;  1YTU A;  1KFD A;  1TAU A;  1XHZ A;  4Z0U A;  4M3Z A;  4YFU A;  4BWM A;  4KKO A;  1JXE A;  1VSD A;  2Z1H A;  1KVA A;  1XHX A;  4FM2 A;  2HVH A;  1XC9 A;  2RPI A;  3CQ8 A;  4DF4 A;  4DU4 A;  3OYA A;  4KHS A;  3A2F A;  1ZBF A;  2P1J A;  3ZSX A;  3L2Q A;  2R7Y A;  3PX6 A;  4CEE A;  4Y1D A;  4M3X A;  3CM6 A;  3NGY A;  4CJT A;  4B9M A;  2QKB A;  4FW1 A;  4LSN A;  3RWU A;  2OA8 A;  1EX4 A;  3OJS A;  1RBT A;  1VK0 A;  1L3S A;  3V1Q A;  1RTD A;  4ZTF A;  2Z1I A;  2W42 A;  4I2Q A;  4OKJ A;  3ZT3 A;  3SNN A;  4C8K A;  1EP4 A;  4BE2 A;  4FJK A;  1IO2 A;  4B9L A;  2HVI A;  4Q0B A;  1ZBH A;  3HPG A;  4E19 A;  3K2P A;  3VQ9 A;  3QNO A;  3T1A A;  1SKR A;  3VQ8 A;  1TKZ A;  4J2A A;  1J53 A;  3BDP A;  3ZCM A;  4B9S A;  3AO2 A;  4FK4 A;  1TGO A;  1C0M A;  4CEF A;  3OYI A;  4XIU A;  3HP6 A;  1HNV A;  1IKX A;  5DK5 A;  4CJE A;  3C6T A;  2F8S A;  3V6D A;  3NFA A;  2EX3 A;  2A1S A;  2DFE A;  1I3A A;  3AA5 X;  1JLF A;  3KIO A;  4EZ6 A;  3CFO A;  4F3T A;  1TKT A;  2WON A;  4CFB A;  3DOK A;  3PX4 A;  4CIE A;  4CGI A;  4EZ9 A;  3QNN A;  5HRN A;  4PUO A;  1YVU A;  1Z25 A;  1HYS A;  1FK9 A;  4E7K A;  2YV0 X;  1WAF A;  1VSI A;  3NF8 A;  1VSH A;  5CZ1 A;  3LP1 A;  3TR8 A;  4KHU A;  1RBU A;  3HK2 A;  3T3F A;  2OPS A;  1NJY A;  3U3Y A;  1X9S A;  1JLE A;  1KVC A;  2HB5 A;  3QIN A;  1QE1 A;  4I9L A;  3VQB A;  4CK1 A;  4CEZ A;  1BQM A;  2KW4 A;  2FBX A;  4ZTJ A;  3K5M A;  1D8Y A;  5FRN A;  3QET A;  1RT6 A;  3S3O A;  3VQA A;  3ZSQ A;  3NH0 A;  4FJ9 A;  2B6A A;  1O1W A;  4FZZ A;  4FM1 A;  2E4L A;  2PZS A;  4J2B A;  3PX0 A;  4E89 A;  3OYD A;  4BDZ A;  2FBT A;  3NAE A;  3TAB A;  1S5J A;  3S3N A;  2P5O A;  1BI4 A;  1W9H A;  4KB0 A;  3QER A;  1KLM A;  3KK3 A;  1C6V A;  3EY1 A;  4DG1 A;  3OYN A;  3LPU A;  1T8E A;  1RBV A;  3OS1 A;  4DTX A;  2WOM A;  4ELU A;  1S6P A;  4NYN A;  3O3G A;  3OJU A;  2ZE2 A;  4DTJ A;  2FC0 A;  3QEV A;  1WSH A;  4KRF A;  4PQU A;  1D5A A;  4E3S A;  2DTU A;  2XY6 A;  1B92 A;  3SV3 A;  4H4M A;  4NYF A;  4DQP A;  2XY8 A;  1NOY A;  1UA0 A;  4I7F A;  4FJM A;  5JS2 A;  3PO5 A;  3I8D A;  5KRS A;  4FJN A;  1NKB A;  3RMD A;  3AVA A;  4DU3 A;  2DY4 A;  3VA0 A;  2Q3S A;  4CGH A;  4Q5V A;  4DFJ A;  1TKD A;  2PY5 A;  2PYL A;  1W0H A;  4FLZ A;  4M3Y A;  1F21 A;  4OJR A;  3K5L A;  1N6Q A;  4J2E A;  5E41 A;  4AH9 A;  4JRP A;  3OVN A;  4AHV A;  3EYZ A;  4RW7 A;  1HQU A;  3O4N A;  4CEA A;  3L8B A;  3SJJ A;  5DMR A;  1GOC A;  4FCY A;  4DQS A;  4RW6 A;  3WNG A;  3MEE A;  4CJW A;  4PY5 A;  1S1U A;  3TAM A;  3F73 A;  3NH1 A;  3V1O A;  3SCX A;  3KTQ A;  4DSL A;  4UQG A;  4K8Z A;  4Z4F A;  1TL1 A;  1HMV A;  3KJV A;  1JL1 A;  5HRS A;  2IC3 A;  4CJP A;  2P51 A;  1ASV A;  4ID5 A;  3NF9 A;  4CER A;  3TAG A;  1SL2 A;  2EHG A;  4M3T A;  3JSM A;  4HTU A;  4CJK A;  1NK0 A;  4ID1 A;  3NBP A;  3OYJ A;  1X1P A;  1RNH A;  5CYQ A;  4DLE A;  5HP1 A;  2Y1I A;  2X6S A;  1SKS A;  4FLV A;  1QSL A;  4B9T A;  2X74 A;  2YHA A;  1TL3 A;  4RW9 A;  3WNE A;  2OYQ A;  4RW8 A;  1YT3 A;  3ITH A;  2D0A A;  1RCH A;  4Z4C A;  1QTM A;  1S6Q A;  4CHZ A;  3KK2 A;  1WSE A;  2YNF A;  2JGU A;  4CJU A;  2LSN A;  3LDS A;  1U47 A;  4EP4 A;  4DU1 A;  4F8R A;  2VWJ A;  1NK8 A;  4C8L A;  4O4G A;  4BE0 A;  1WSF A;  1WSG A;  4K8X A;  3HXM A;  5JS1 A;  3B6O A;  3O3H A;  3UIQ A;  3V1R A;  3ALY A;  4FLW A;  1JLA A;  3KLE A;  2VG5 A;  3SYZ A;  1IG9 A;  3M8R A;  4FJL A;  3AA3 A;  4CFD A;  3TI0 A;  5CZ2 A;  2G8K A;  5J2M A;  1NK5 A;  4FZY A;  4NCA A;  5J1E A;  3LAM A;  1BQN A;  1HYV A;  1D9F A;  1ZBL A;  2NUB A;  2HNY A;  4FLY A;  4CE9 A;  3G10 A;  4KI6 A;  1LWC A;  3MAQ A;  1N5Y A;  4KHN A;  3OYH A;  1J54 A;  3AVJ A;  3KLH A;  3OYM A;  3L2R A;  3VQ4 A;  1BIS A;  1B9D A;  3LAL A;  3LZI A;  1UOC A;  4GVM A;  4LH5 A;  5I42 A;  4DSK A;  3TAP A;  4B9N A;  2ZD1 A;  1LV5 A;  4KI4 A;  4W5Q A;  3RRH A;  4E0D A;  3OYE A;  4I9Q A;  1R0A A;  1LAW A;  3ULD A;  2QKK A;  2FBY A;  2HHQ A;  1U04 A;  2Y1J A;  1A5X A;  3AO3 A;  1X9W A;  1WNS A;  3DLB A;  3P1G A;  1ZYQ A;  1VSF A;  3ZSR A;  4CJF A;  5C25 A;  3HO1 A;  4CF8 A;  3K58 A;  1T7P A;  4KTQ A;  1XI1 A;  3AA2 A;  4M41 A;  5FRO A;  4DTN A;  4DFM A;  4FLT A;  2B5J A;  1SUQ A;  3DI6 A;  3IAY A;  5HRO A;  1JKH A;  1YTA A;  2XHB A;  3AO5 A;  3ZSW A;  3KLI A;  3C95 A;  3KLF A;  4CES A;  2YNI A;  4FJH A;  3LP2 A;  2G8U A;  2GUI A;  4FXD A;  3DYA A;  3AVB A;  4AHT A;  1REV A;  3LPT A;  4GW6 A;  4AHU A;  4CGF A;  2HHX A;  5J2N A;  1QSY A;  5KGW A;  3TAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...