3HYFA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
143
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Reverse transcriptase/RNaseH
publication title RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 46
structure length 143
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hyfA00
2HW3A 3HP6A 1L3TA 3KK3A 1GOAA 4E89A 1LW2A 3TAQA 4KRFA 1KFDA 1RBSA 1X9SA 4F2RA 4B9UA 2Y1JA 4YFUA 2G8WA 1RT1A 4KPYA 3ZT1A 3MXIA 4MQ3A 5EU7A 4KHUA 3S9HA 1RT2A 1WSEA 2YKNA 1TK8A 2G8FA 1X9WA 4DMNA 5D3GA 4FJXA 3HYFA 1HNVA 2Z1HA 3DLEA 1BL3A 4O0JA 2Z1JA 4LSNA 5HP1A 1U04A 3OYEA 3QNOA 1Z25A 1IO2A 1JLAA 5CYMA 4M45A 3SV4A 4CJUA 3QERA 1T05A 4AHCA 4FJ5A 1WSJA 4DTUA 3QEVA 1VSIA 4CK2A 3OJUA 4WE1A 5HBMA 4W5QA 4DTPA 3AO5A 4B8CA 1JLFA 3EYZA 4KHQA 1C0MA 3L8BA 2EHGA 3ZSQA 1SV5A 2DY4A 1REVA 2DFFA 3QINA 1RDBA 4J2DA 4FW1A 4PQUA 2HVIA 1B92A 2ZQBA 3CYMA 3T19A 1BHLA 3TAPA 3ZSRA 1JLCA 3VQQA 1NOZA 3MECA 2W42A 1VSDA 1RILA 2HNYA 3DRPA 2OA8A 1TVRA 4CF2A 4CHNA 3OYHA 3V9WA 1EP4A 1WLJA 3QNNA 1UA1A 1Q8IA 4B9LA 1QQCA 4H8KA 3C6TA 4KI6A 1B9FA 1ZYQA 3OYFA 1RT4A 4AHRA 3RRGA 1VSEA 4IFVA 2OPSA 1BQNA 3F73A 2HHWA 4BACA 4FM2A 3C95A 1U4BA 3TI0A 1RT7A 1KLMA 3RMCA 2KFNA 3D0PA 1Q9XA 1S9GA 1XHXA 4CJ3A 2HHXA 4KI4A 3K59A 4DF4A 1TK5A 1FKPA 3AVCA 2ITGA 2WONA 4HUEA 1U45A 4F8RA 2Z1IA 3JYTA 4B3OA 4AHVA 3NBPA 3VN5A 3O3HA 3OYDA 1W9HA 1SL1A 4IFYA 1L3UA 1KRPA 4DQIA 4FJJA 1VSFA 2I5JA 1C1CA 2HB5A 4W5OA 3V4IA 1RT5A 4FJHA 1RDAA 4W5NA 4I7FA 1CXUA 4E1MA 4M3WA 2PZSA 1SKRA 4LSLA 4AH9A 3PX0A 4QCLA 4IKFA 4B8AB 4Z4CA 4DQQA 1ITGA 1S1XA 4CFDA 3CM6A 4QAGA 3ZSXA 1NJYA 1O1WA 3K2PA 5J1EA 4NYFA 2ZD1A 1LW0A 4M3UA 4DLEA 4KB1A 4CGDA 3AO3A 3VQCA 3V81A 1IKWA 4M41A 1VRUA 3HM9A 1B9DA 4DTSA 1KFSA 1FKOA 4FK0A 4CFCA 1DTQA 3LPUA 3MEEA 4BDYA 4M3XA 1TKZA 4DU1A 4DFPA 1WSFA 4CIFA 2KFZA 1QSYA 3KLFA 3VQ7A 2OPRA 4FM0A 1Y97A 4KHWA 1ASUA 1CZBA 4JLHA 4DSKA 1NKEA 3VA0A 1BCMA 4Q5VA 1S1VA 3V9SA 2XY7A 1XI1A 4F3TA 3NGZA 1N6QA 2XRIA 1RNHA 3FFIA 1U49A 3F9KA 4M3YA 4CCHA 3L3VA 4FJMA 4CJQA 2IGIA 4E1NA 2X74A 2Z1GA 1N5YA 3THVA 2JGUA 3G10A 5CY4A 1BQMA 3SQ1A 4FZYA 3AV9A 3QEXA 4M3ZA 3AVAA 4KHNA 4DSEA 3LP3A 4KTQA 4Z4FA 3ZT4A 3NDKA 3P5JA 4DU3A 2D0CA 1TK0A 5HLFA 1KLNA 4CEEA 4CHQA 4RW4A 4BE0A 1KVCA 3KLIA 3SV3A 3T3FA 2PYJA 4EZ9A 4CJVA 4K8XA 3LP1A 3AO1A 3PO4A 3NF7A 3DLRA 4IBNA 3QLHA 4CESA 3K5NA 4J2EA 4KHSA 4BE1A 4BWJA 4OLAA 3PO5A 3SPYA 4PY5A 3VQPA 3V1RA 3L2WA 4FJ9A 4OPJA 2OYQA 4E0DA 3JSMA 4EP5A 1HRHA 1XWLA 4CHZA 2P5OA 4CJ5A 2XO7A 3PV8A 4CJ4A 1SL2A 4KFBA 4HUFA 3ZT3A 3KLGA 4N41A 3TAFA 4AHUA 1LWEA 4FJNA 2G8KA 1TKTA 2YV0X 4AHSA 4LY7A 4R5PA 4BE2A 1XC9A 3DLHA 1CLQA 4I9QA 4W5TA 1W0HA 3ISNC 4OVLA 3WNEA 4B9SA 3HO1A 4CERA 3SYZA 4AILC 4DS5A 3SUPA 1NK0A 3VQAA 4XIUA 4FLYA 3IAYA 3SNNA 4NCAA 1A5XA 2WOMA 3VQBA 3SQ2A 2HHUA 3V1OA 1IKYA 2IC3A 3OS0A 4DS4A 5KRSA 4FLZA 4B9MA 4CJPA 4FM1A 1ASVA 3UIQA 2HVHA 3AA2A 3RR8A 3DRSA 5I3UA 1QSSA 3KLHA 4J2BA 2VWJA 2AJQA 1IKVA 4ZHRA 4F2SA 4E7IA 3B6PA 1A5WA 4FLWA 4GW6A 5FROA 3WNHA 1D8YA 2OZSA 1NJXA 4CGHA 2VG5A 3L2UA 3AA3A 4IDKA 1EXQA 5J2QA 5E41A 2A1RA 4DTNA 2G8VA 1CZ9A 4PUOA 1RT6A 3VQ6A 4N56A 4Q0BA 1RTHA 3O4NA 4CEAA 3D45A 2FBVA 2YHBA 4MFBA 3AVJA 4CHPA 1SL0A 4LH4A 4CEQA 2ATQA 1EX4A 3LWLA 4AHTA 4CJWA 4JS4A 1LV5A 2O4GA 4BDPA 1G15A 2E6MA 3DLKA 4O0IA 2P51A 3L2RA 4KTZA 1VK0A 4BDZA 4C8KA 3OYGA 4CFBA 4CEOA 3KKRA 4CFAA 1BIZA 2KQ2A 2B4JA 3LWMA 2BDPA 4FZXC 1UOCA 3AVMA 3NFAA 1MU2A 3OYCA 1NK6A 1L3SA 2VG7A 1JL2A 4BWMA 1X9MA 1S9EA 4Y1DA 2P5GA 1VSJA 3I8DA 3TARA 3KD5E 2VG6A 2QK9A 3SI6A 4C8OA 1U48A 4N5SA 4OKKA 2A1SA 3DLGA 4OJRA 1RDCA 4DTOA 4G1QA 3HVRA 3RRHA 1ZBHA 5KGWA 1JLQA 4FLTA 3OYIA 4DWIA 2YNFA 3T1AA 2PY5A 5C25A 1T8EA 3CM5A 4FK4A 3NGYA 1QE1A 1TKXA 4CF8A 1RTJA 5KRTA 2O4IA 1JLGA 3CG7A 1DTTA 4CJEA 5HRSA 2F8SA 1QTMA 4DSJA 5FRNA 3AVGA 4DQSA 3NCIA 4DTJA 4F4KA 2B5JA 4L8RB 5T7BA 4OPKA 3DOLA 3HT3A 1NK7A 1X1PA 5SZTA 4FXDA 4DG1A 4ID1A 2YKMA 3AO2A 3OYLA 3KK1A 3LZIA 3TWHA 1C1BA 2B6AA 4TSXA 2BE2A 4I2PA 4GVMA 1UAXA 3NF9A 4KV8A 3CFOA 4OKEA 4J2AA 5FRMA 3G0ZA 4C8NA 3AVIA 4F3OA 3SQ0A 3L2QA 4E7HA 3WNFA 2OPQA 5JS2A 3ITHA 4C8MA 1HQEA 2KZZA 1SUQA 3SCXA 4FCYA 1C0TA 2YNIA 3LDSA 2XY8A 2VWKA 3ZT2A 1IH7A 1S1UA 3P1GA 4OKJA 4O4GA 4PA1A 4KB0A 3I0RA 2P1JA 4DQPA 3AO4A 3AVLA 3OYBA 2DFHA 2HHSA 1JL1A 1HPZA 1UWBA 3LALA 5DMRA 3V9XA 2RPIA 1R0AA 2KW4A 4ID5A 1QS4A 2LSNA 3ZCMA 3NGIA 3TANA 1RTDA 4FVMA 1WN7A 3PUFA 4DLGA 3LANA 1U47A 5FDLA 4M3RA 2QKBA 1I39A 2R7YA 3KK2A 5C42A 3IS9A 1KVBA 2E4LA 3DYAA 3OS1A 4HVJA 3QIOA 3TABA 4OLBA 3U3GA 5HROA 3NH1A 2QKKA 5CYQA 3SPZA 3SUOA 1K6YA 3LP0A 4FJLA 3K5OA 4O5BA 1SKWA 3SUNA 3RMDA 4FJKA 5K14A 1TAUA 2RF2A 4RW9A 1IG9A 3RMAA 2FBTA 2E6LA 4RG8A 4CF9A 2G8HA 1HYVA 1TGOA 3HPHA 4CHYA 4CJRA 1F21A 3M8SA 4ELVA 1KCFA 1VSHA 1LWFA 2Q3SA 4NCBA 3NF6A 3OYAA 4KKOA 1J5OA 3BDPA 4N76A 1JLBA 3AVFA 3LAKA 4ZTFA 1C6VA 4DSFA 5HRPA 4NCGA 4E7LA 4CK3A 4DFKA 3V9UA 4CK1A 1WSHA 5DK5A 1NK5A 4O44A 3HK2A 2HHVA 3QESA 4OGCA 2IDOA 3KJVA 1NK9A 3RWUA 1RTIA 1VSMA 4E19A 4DTXA 3NF8A 1NJWA 1TV6A 2HNDA 3EZ5A 4Z4GA 3IG1A 3U3YA 2FBXA 3OJSA 3ZT0A 3O3FA 1LAWA 1UA0A 3DLBA 5CZ1A 4Z4IA 4YNQA 1FXXA 5SWMA 3NH2A 4FZZA 4JRQA 1BISA 3MEDA 4JRPA 4HUGA 3IRXA 3QIPA 3NHGA 4EZ6A 3AVKA 4FJIA 3ZSYA 4CJTA 1NKBA 4CGFA 3LP2A 4DF8A 2HHTA 4Y1CA 1YTAA 1T7PA 1NK8A 1RBUA 1VSLA 3ZSWA 1YVUA 3VQ5A 1HNIA 3OYNA 3KD1E 3QEPA 3KIOA 1VRTA 3ZSVA 2FBYA 3C6UA 5J2PA 2X6SA 1WAFA 3AVHA 1GOBA 1LAVA 5C24A 4GMJB 4EP4A 3SJJA 4ZTJA 3TR8A 4B08A 2GBZA 5J2MA 2DFEA 4FJGA 1I3AA 2D5RA 3V6DA 2IOCA 3HP9A 4CIGA 4NYNA 4ICLA 2F96A 4UQGA 1T03A 3RR7A 3LZJA 4H4MA 4DSLA 3M8QA 3CFRA 1S1TA 2ETJA 1NK4A 1HJRA 3VQ4A 4I2QA 3V9ZA 4DU4A 1A5VA 1S6QA 2IS3A 4M42A 1SKSA 4FLXA 4CJKA 3MAQA 3A2FA 2G8UA 3M8RA 3DOKA 3HXMA 4O55A 3CQ8A 4ELUA 1S5JA 3MEGA 2BGGA 4RW8A 1JLEA 4Z0UA 3ULDA 2GV9A 4OGEA 1D9FA 4KAZA 2HNZA 3SZ2A 2YNHA 4LD0A 3HPGA 3O3GA 1LWCA 3DM2A 4CGGA 3L2VA 4IG3A 4Z4HA 3AA4A 3VQ9A 4FJ7A 1WSGA 4IG0A 4CE9A 1HYSA 1C0UA 4W5RA 4M3TA 4K8ZA 1KSPA 4Z4EA 2D0AA 2D0BA 1D9DA 3OVNA 4QOZB 3KTQA 1RCHA 1L5UA 3MXMA 3I0SA 3NE6A 1KVAA 2XHBA 1RBTA 4LH5A 4FYDA 3HL8A 5HRNA 2Y1IA 1TL3A 2QXFA 2F8TA 3RTVA 1J9AA 4KHYA 3QO9A 1J54A 4I9LA 3QEIA 1S1WA 4FLUA 4DFMA 4CECA 4CJSA 4HCBA 2GUIA 3OYJA 4CF1A 3HPOA 3CFPA 1QSLA 3C94A 3K58A 2XY5A 2IAJA 3ALYA 3QEWA 3LPTA 1IKXA 3WNGA 4ELTA 3PX6A 4HTUA 1BIUA 3LAMA 1ASWA 1XHZA 4CIEA 4DQRA 3QETA 4DTRA 2PYLA 4KREA 1YT3A 1NJZA 2KZMA 3TAMA 1TKDA 1Q9YA 1KTQA 2EX3A 1Z26A 3ASMA 1RBVA 3KKSA 3TAGA 2G8IA 3BGRA 1QHTA 1NKCA 4FW2A 1EETA 1TL1A 3PX4A 4CJFA 5CZ2A 2XY6A 4CEBA 5I42A 4C8LA 4PWDA 4B9VA 1HMVA 3S3OA 1RT3A 1JXEA 3VQ8A 1CXQA 4CJLA 3K57A 4JS5A 1YTUA 2OZMA 3DI6A 5KGXA 4DTMA 1VSKA 1RBRA 3K5MA 3MXJA 2DTUA 3U6FA 2JLEA 5HRRA 3OYKA 3DMJA 2ZE2A 1BI4A 3AA5X 4KTWA 4CEZA 3AVBA 5KI6A 3OY9A 1D5AA 4HHTA 1ZBLA 3S3NA 2X78A 1ZBIA 3SUQA 1FK9A 3DRRA 4KO0A 3VA3A 3K5LA 3O4QA 1GOCA 1TAQA 1WNSA 4H4OA 4N47A 2KTQA 1WSIA 2HHQA 3M8PA 1C1AA 4DSIA 3HSTB 1JKHA 1BCOA 3OYMA 3SQ4A 1ZBFA 4CEFA 3TAEA 3H08A 3P83D 4E7JA 4HCCA 5J2NA 4B9NA 4DFJA 4B9TA 1EKEA 4CEDA 2YHAA 4RW6A 1BI4B 4FK2A 1RDDA 1DLOA 4FLVA 2BANA 2X6NA 3VQEA 3L3UA 4RW7A 4CHOA 3NH0A 1S6PA 2RN2A 1HQUA 4E7KA 2YNGA 2RKIA 5KTQA 1NOYA 2HMIA 1BGXT 3HVTA 2OPPA 4E3SA 4CGJA 1L3VA 5JS1A 3V1QA 3VQDA 1JXBA 3NAEA 4FJ8A 3KLEA 3HJFA 3AVNA 3ZSOA 3S3MA 3RMBA 2FC0A 1J53A 1HYZA 1ZBUA 3B6OA 3OS2A 1WAJA 3PY8A 4CF0A 3ZSZA 3E01A 4CGIA 2NUBA 3EY1A
chains in the Genus database with same CATH superfamily
3BEXA 1L3TA 4HTLA 4E89A 5ADXA 3TTFA 2Y1JA 1RT1A 2NRZA 3C0BA 1TK8A 1X9WA 4DMNA 5LY3A 4FJXA 3DLEA 3WQUA 4LSNA 4IEIA 4CVNE 1BA0A 4DTPA 3AO5A 1QZ5A 1KAYA 3EYZA 4GKKK 1REVA 1IJJA 2DFFA 3QINA 4J2DA 1BA1A 2ZQBA 3TAPA 3VQQA 1NU0A 3IUCA 2W42A 2HNYA 4CF2A 4CHNA 3OYHA 3QNNA 1UA1A 4KI6A 1XQSC 3OYFA 3D2EA 2OPSA 1BQNA 3F73A 1RFQA 3C95A 3TI0A 1RT7A 3D0PA 1Q9XA 4CJ3A 3ULEB 3EE9A 2HHHK 4DF4A 3AVCA 4B3OA 3OTOK 4ILJA 2Z1IA 3E9OA 3VN5A 4FWLA 3ZETA 2HB5A 3V4IA 4BGAA 2ZWHA 4I7FA 2GTDA 1SKRA 5FPMA 1YXQA 4IKFA 4H0OA 5EOYA 3CJ7A 1YI2N 4QAGA 5J1EA 4X66K 4DLEA 4X62K 3EKUA 3EE8A 4K43A 1HKGA 3HM9A 1B9DA 3WXMB 4M3XA 3MEEA 4DU1A 4DFPA 1NWKA 1WSFA 1QQOA 4KHWA 2CGKA 3VQ7A 3IKMA 4CZMA 3ATUA 1NKEA 3VA0A 1BCMA 2E2OA 1S1VA 1TYQA 3V9SA 1XI1A 3W0LA 1RNHA 1U49A 2UU9K 4M3YA 4CCHA 4FJMA 4JD2B 3DJCA 2FXUA 1N5YA 3AV9A 4B3RK 2NRHA 4KHNA 4Z4FA 4KTQA 3ZT4A 4DU3A 4WQ4A 4CZFA 2D0CA 3SJHA 4K8XA 4EIAA 1KVCA 3SV3A 3D2FB 3GBTA 3A5LC 3NF7A 4IO8A 3QLHA 4CESA 3K5NA 1XMQK 3SPYA 3VQPA 3D7EO 3V1RA 4FJ9A 4LFCK 4MO4A 4KH4A 3JSMA 1HRHA 5LJWA 1SL2A 4CJ4A 4KFBA 4PKHA 3TAFA 4NLBA 4AHUA 1LWEA 1YJNN 3O9RA 4KH5A 4R5PA 4WCEL 4LY7A 3DLHA 3WNEA 3PLAA 1D4XA 3SYZA 3SUPA 2P9LB 1NNEA 3O4WA 5M1FA 4FLYA 4X65K 1EO1A 1A5XA 2WOMA 2HHUA 3V1OA 4CJPA 3RR8A 1IKVA 4ZHRA 3ZYYX 4E7IA 1A5WA 2OZSA 2VG5A 3HBTA 4DR1K 5J2QA 4I6MA 4JI4K 3HOTA 4Q0BA 1RTHA 4DV6K 5C0YA 1EX4A 1LV5A 4CZIA 1G15A 3MX5A 3L2RA 2P51A 4O5FA 3G6EN 3KKRA 1VQON 2V7ZA 4FZXC 1L3SA 3NFAA 1NK6A 2VGNA 1X9MA 1TUYA 3I8DA 3KD5E 2QK9A 1JJ2M 3O5BA 5LMNK 4B1UB 4DTOA 3HVRA 2YJEA 4DWIA 4FLTA 4QS8A 2I7PA 2PBDA 2UUCK 4F9OA 3CCVN 3S41A 4MDBA 1DTTA 2P9PA 5HRSA 4FWMA 1QTMA 3ZLJA 5FRNA 4DQSA 3F2KA 3NCIA 4DTJA 2O8EB 5E84A 2YJFA 1MWKA 1NK7A 5SZTA 3A0IX 3KK1A 1Q82O 4DR7K 2B6AA 2CH6A 4I2PA 5EVZA 4GVMA 4J2AA 3CFOA 4ISEA 4C8NA 3SQ0A 4E7HA 3WNFA 1T6DA 2OCEA 3LDSA 1IH7A 1S1UA 3KWGA 3MN9A 3H1QA 2VCPA 3AO4A 2VGMA 2DFHA 4AQYK 1HPZA 5DMRA 4NB4A 1NMDA 3ZCMA 3SMPA 3BY5A 3LANA 4JEPA 4MDAA 4M3RA 4NLCA 2P9NB 3DYAA 3OHRA 4OLBA 1GLLO 4EFHA 2GUPA 3P4IA 3CC4N 3LP0A 3CCQN 2UYTA 3RMAA 1HLUA 4CF9A 1VQLN 3CCUN 2O8FB 3L0QA 1HNXK 1LWFA 3LAKA 1C6VA 4NCGA 3NMUA 1WSHA 5DK5A 1NK9A 3VF4A 2KLAA 1RGIA 1VSMA 3DXKA 4DTXA 1FJGK 2FSNA 2HNDA 3EZ5A 4RTFD 4Z4GA 3DLBA 2FBXA 3RVCA 3O3FA 1UA0A 2FF3B 4FZZA 4FJIA 3ZSYA 4CJTA 3KK7A 3O1WA 1YVUA 3OYNA 3KD1E 3QEPA 2P9IB 1GOBA 4EP4A 1LAVA 4GMJB 5TKYA 4JI3K 2DFEA 4FJGA 1NGHA 3CQYA 3JXUA 4NYNA 3RR7A 2D4WA 4H4MA 4RWTA 2ETJA 3VQ4A 1A5VA 5AQUA 4BR0A 3MAQA 2O8DA 2G8UA 4DV3K 3CQ8A 2BGGA 2HNZA 3SZ2A 1VQPN 4DR3K 3HPGA 3FZLA 1LWCA 4CGGA 3CPEA 3GOIA 3VQ9A 1E4FT 4IG0A 3MN7A 4DHYA 5M1KA 4K8ZA 2D0BA 4QOZB 4NXMK 1RCHA 4JKAA 1OVYA 3I0SA 3NE6A 1KVAA 4FYDA 3HL8A 4IJAA 1VQ6N 2Y1IA 1TL3A 2F8TA 4KHYA 4I9LA 2GUIA 4CZHA 3K58A 3O8MA 3ALYA 4WFAL 4IWVA 1IKXA 4JI5K 4PL8A 4DTRA 2VWBA 2PYLA 1YT3A 1TKDA 1Q9YA 1Z26A 3RSEA 1RBVA 3LDOA 3TAGA 3ENBA 3SLCA 3ENHA 1KC8O 4JKBA 4CD3A 3S3OA 1JXEA 3VQ8A 2F7TA 3THWB 3I33A 4CJLA 2P9UA 4BRAA 2OZMA 3DI6A 5KGXA 1VSKA 1RBRA 4WYBA 2DTUA 2JLEA 3BP8A 4CEZA 1ZBLA 2Q1NA 3SUQA 3VA3A 3K5LA 3VGMA 3O4QA 5ADXH 2HHQA 2IIRA 3M8PA 4YY3K 4PKGA 5TKWA 1OH6A 1BCOA 1ZBFA 5M1QA 4BRIA 4HCCA 3WEEB 4YOXA 3SMSA 5KPZA 2A41A 4DFJA 4B9TA 1BI4B 1RDDA 2V7YA 3L3UA 2RN2A 3VMFB 5CR4A 1L3VA 1YJWN 1HKBA 3AVNA 3ZSOA 5A2QO 1J53A 1HYZA 3OS2A 4CBXA 4CF0A 2NRXA 4EHTA 5HLFA 2E8AA 3VEZA 2NUBA 4CGIA 2HW3A 1NGBA 1LW2A 1RBSA 1X9SA 4KPYA 3MXIA 5AQPA 2FLOA 2QA4N 4KHUA 1RT2A 3VESA 1C0FA 5D3GA 3THYA 1BL3A 2WTUA 5HP1A 1IO2A 5CYMA 3TSPA 4CJUA 1R59O 4MLHA 4AHCA 4FJ5A 3QEVA 5F0XA 1VSIA 3OJUA 3M3ZA 1C0MA 3ZSQA 2DY4A 1RDBA 3ULEA 4FW1A 4FWQA 3TPQA 1VQ5N 3ZSRA 1JLCA 5AQMA 3EEQA 1RILA 2OA8A 3DRPA 3H6EA 1Q8IA 4H0XB 3FZMA 5KQDA 3DXMA 4H8KA 1ZBSA 1B9FA 1ZYQA 4AHRA 4EAHD 4IFVA 3HTVA 2E1YA 5BR8K 3E1YA 1XHXA 2HHXA 2WUSA 3K59A 1U45A 1EWRA 4B3TK 4IO9L 1T44A 5AQJA 4DQIA 2QEXN 2RHKA 2I5JA 5GINA 1VQ7N 2QWLA 1RDAA 4E1MA 2BUPA 3H3OB 2PZSA 4AH9A 4CW7B 1ITGA 4BR7A 4CFDA 3CM6A 1O1WA 4Z94A 4NYFA 3VTHA 1BWFO 4M3UA 1VQ9N 4EHUA 4JD2A 4DTSA 1FKOA 5C15A 4BDYA 3HRGA 4K42A 2YI1A 3WQTA 3FZHA 4CIFA 2OPRA 1N32K 4JLHA 1NGIA 1HKCA 4Q5VA 3L6QA 3O6WA 4F3TA 5C10A 5GAHP 1SS6A 3Q7BA 1QZ6A 2NNWA 2E2NA 4DKWA 1NGFA 4B3SK 2P9KA 3KZBA 5CY4A 4DSEA 3LP3A 3BUZB 2DPNA 2I7NA 1KLNA 4RW4A 1O13A 3KLIA 3T3FA 4A62A 3TSQA 4B1WB 3LDPA 3LP1A 3AO1A 3DLRA 4IBNA 4H0PA 3A5NC 3J80O 4OLAA 3E66A 2F9TA 3JS6A 2OYQA 4E0DA 3W3DA 4LF8K 4CHZA 3F5TA 3ZEUB 4HUFA 3ZT3A 3A5OC 4FJNA 2G8KA 1CLQA 2YV0X 2GELA 1GLJO 3CI5A 4BQLA 3O9QA 4I9QA 4YHHK 4DS5A 1NK0A 3O9TA 5F2RA 4A57A 3SNNA 3CC7N 3SQ2A 1IKYA 4FM1A 1ASVA 3UIQA 3AA2A 1QSSA 2VWJA 2AJQA 1GLCG 3B6PA 4FLWA 4GW6A 5FROA 5C2FA 2ZJQL 3CQXA 1NJXA 4IOXA 4DB3A 4IDKA 2A1RA 5E41A 4XH4A 4DTNA 4DQ8A 5BN9A 2FBVA 3AVJA 5AQNA 4BG8A 4CHPA 1SL0A 4LFAK 4CJWA 1ATNA 3H45C 2Q36A 3A5MC 3DLKA 1JCFA 4BRDA 4KTZA 1VK0A 4BDZA 1HNWK 4K25A 4CEOA 2ZGZA 1BIZA 2BDPA 2O8CA 2VG7A 1JL2A 1S9EA 3TARA 2Q2RA 3SI6A 1Q18A 4OKKA 2A1SA 3P39A 4B1VA 4G1QA 1VQNN 4GV3A 1KAXA 1T8EA 3WXIA 4A59A 2O4IA 2F8SA 3KWIA 1U2VB 3AVGA 5T7BA 3DOLA 4ISGA 2EWSA 1X1PA 4ID1A 4O8KA 3OYLA 1C1BA 1M1KO 4TSXA 1DGKN 1UAXA 4GV9A 2O8BB 4F3OA 3SK3A 4CZEA 5FPDA 2OPQA 1HQEA 2KZZA 2XY8A 3HI0A 3P1GA 4PA1A 4IXCA 2P1JA 4MLEA 4QS9A 3UKUA 4DQPA 1NGGA 2HHSA 4GVEA 3MCPA 4AF1A 3V9XA 3N4PA 1R0AA 3NGIA 2GEMA 2LSNA 2O8FA 4DLGA 3VPZA 4BG9A 1U47A 5FDLA 1NJIO 3C6AA 3IS9A 3OW2M 2BTFA 5CYQA 5JVHL 3SPZA 2QWQA 5CE3A 5AZJB 3OBWA 1K6YA 4FJLA 4O5BA 3SUNA 4BRQA 4LF6K 5K14A 2RF2A 4RW9A 2W41A 1JCGA 4RG8A 1GLFO 1TGOA 3HPHA 1F21A 3CCSN 3NF6A 3OYAA 2D1KA 4K41A 3J7AP 3ID8A 4XH5A 2WFBA 4DSFA 2Q31A 4E7LA 4CK3A 1HX1A 1Z05A 3A8YA 4DV2K 3V9UA 4O8UA 4K0KK 3MWTA 4O44A 3QESA 4DUZK 3KJVA 2P9IA 2HSTA 3OA9A 4E19A 2VQEK 2UXDK 2JWKA 4JI2K 3C6HA 3IG1A 3OJSA 1FXXA 1G99A 1BISA 5AQOA 4JRPA 3GDQA 2NLXA 2UXCK 4CGFA 3LP2A 4WQ5C 3CJAA 5M1NA 2HHTA 4Y1CA 1T7PA 1NK8A 4DV7K 3VQ5A 1YIJN 1FW6A 2FBYA 3C6UA 3SBGA 4A2BA 5C24A 5FLXO 4JHDB 2GWKA 1XNQK 3TR8A 4B08A 3MN6A 1NGAA 5J2MA 1GLAG 2D5RA 3THXA 4CIGA 2ZJPL 3FE1A 2F96A 4UQGA 3LZJA 5EXWA 2E2PA 5DM6L 5BREA 3M8QA 1J6ZA 3CCRN 1NK4A 3V9ZA 4DU4A 4M42A 1I94K 1SKSA 4FLXA 4FWSA 2OTLN 4CZJA 3DOKA 4O55A 4R79A 1S5JA 4RW8A 3CHWA 4Z0UA 3VETA 4OGEA 5AQYA 4KAZA 3QB0A 3G4SN 2YNHA 3L2VA 4U67L 4IG3A 3AA4A 4FJ7A 4CE9A 1HYSA 2JWLA 1KSPA 3KTQA 1NM1A 1L5UA 2E5LK 2XHBA 1RBTA 4LH5A 5HRNA 1DKGD 5HOOA 1YHQN 1XNRK 1VQ8N 3QO9A 1J54A 1BOTO 3QEIA 1S1WA 4HCBA 4CECA 4CI6A 3OYJA 3CFPA 1QSLA 3THWA 3C94A 3LPTA 4ELTA 3D2EB 4MO5A 2CGLA 4FVUA 1ASWA 4CJ7A 1NGCA 4LF5K 2HF4A 4KREA 1NJZA 3UE5A 2W6KA 3N4QA 2EX3A 4HWIA 4BC3A 1KXPA 2GX9A 4BVPA 3PX4A 5CZ2A 2XY6A 4CEBA 2E88A 3T7ZA 4C8LA 3VEOA 1W2BM 1V4TA 3WEEA 4JS5A 3AGRA 1YTUA 4A61A 3MXJA 2ZF5O 4DV5K 1IG8A 1WOQA 1BI4A 3AA5X 4KTWA 3S3NA 3SAGA 4JK7A 4LF7K 3O9SA 1GOCA 5AQQA 4DR2K 2KTQA 1C1AA 1SZ2A 4DSIA 3MDQA 4DCHA 3OYMA 3H08A 3WT0A 3CD6N 4V19S 4E7JA 3CC2N 3MN5A 1DLOA 4FLVA 2BANA 2ZM6K 2X6NA 4FWRA 4OO1J 4CHOA 3NH0A 5BR9A 3HOSA 1Z6RA 3HM8A 4FL9A 1HQUA 4E7KA 2VQFK 5KTQA 1NOYA 1HNZK 4JI7K 4XEIA 3V1QA 3VQDA 1Q7YO 1K8KA 1JXBA 3VTIA 3MCAB 2FF6A 3FZFA 2FC0A 5AZIB 2AP1A 1U6ZA 2HF3A 3E01A 3EY1A 2AA4A 3KK3A 2WBNA 1K73O 3TAQA 4KRFA 4F2RA 4B9UA 4M7YA 3AARA 2G8WA 1YUWA 4MQ3A 4OPHA 1EQYA 1WSEA 2G8FA 2Z1HA 4B1ZA 3G71N 1U04A 5BRHA 1S72N 3OYEA 3QFUA 1JLAA 4DR6K 4M45A 1KAZA 1T05A 2QWOA 1WSJA 4FO0A 4IFEA 5HBMA 4W5QA 1BU6O 5AQVA 4KHQA 3VERA 1SV5A 3CJBA 1DEJA 2HVIA 4RCHA 5JICA 1B92A 3QDKA 3CYMA 4H0VB 5C2DA 3MECA 1VSDA 4IOAL 3QFPA 1TVRA 3LL3A 3LM9A 1EP4A 1WLJA 2V52B 3SBTA 1QQCA 3O1BA 1RT4A 4JK8A 1VSEA 1NGEA 4BACA 4FM2A 1U4BA 4I6MB 3RMCA 1S9GA 1LCUA 1QVFM 4KI4A 4CZKA 4F8RA 2WONA 3JYTA 3NBPA 3OYDA 4FWOA 1M90O 1W9HA 1KRPA 3WXKA 1YVNA 1VSFA 1C1CA 4JI8K 4W5OA 1IBMK 4FJHA 4W5NA 3E9PA 4LSLA 4BR9A 1KD1O 1S22A 4QCLA 4B8AB 3MK6A 1S1XA 3U8XA 4C1NK 3K2PA 4ILGB 1HJOA 4KB1A 4PL7A 3VQCA 4BRHA 2Q0RA 1IKWA 2YCHA 4IJNA 4M41A 3JAMO 3I56N 4FK0A 4CFCA 4DR4K 1DTQA 1TKZA 2Q0UA 3AGKA 1QSYA 3O9UA 1Y97A 2D0OA 4DUYK 4DSKA 4CZGA 4AM6A 2P9PB 1N6QA 4WQ5A 2XRIA 3FFIA 3HZ6A 3L3VA 5AQSA 3EL2A 2UXBK 2X74A 3R3LA 4BR4A 3THVA 4OPAA 3G10A 3SQ1A 1BQMA 4FZYA 1VAZA 3ZEUA 4M3ZA 3MWPA 3P5JA 2ASMA 1TK0A 4CEEA 4CHQA 4IDHA 4CJVA 2A42A 3M1FA 3PO4A 4J2EA 5M1PA 5KPRA 4BWJA 4PY5A 3TTDA 3L2WA 4OPJA 3P38A 4YOTA 1XWLA 2V51B 1NLVA 4CJ5A 2XO7A 1TUUA 2E2QA 4N41A 3QMLA 1XC9A 1P90A 4BE2A 1W0HA 1N36K 3HO1A 1BG3A 4CERA 4AILC 4GNIA 4DV1K 5JLHA 5GAEP 3VQBA 1BO5O 2IC3A 4DS4A 2HVHA 1MA9B 3LDNA 4BRNA 4F2SA 1VHXA 1JCEA 2NRTA 1D8YA 3VOVA 4CGHA 5KQ8A 3L2UA 1OH8A 2G8VA 4PUOA 1ESVA 1RT6A 2YX6A 3VQ6A 5DM7L 4LC9B 4CEAA 3D45A 2YHBA 2P9SB 4CEQA 4WQ4C 2ATQA 4X64K 4AHTA 3LWLA 4BDPA 2KHOA 4BY9C 2F9WA 2E6MA 3CMAN 3B8AX 3GL1A 3OYGA 5KPTA 5BRFA 4CFAA 2KQ2A 2B4JA 3C7NB 1MU2A 1U2VA 1W97L 4WFNL 1ILYA 3NVKA 2P5GA 4UY8O 1VSJA 4AM7A 2VG6A 1WBDA 3UB5A 1U48A 4N5SA 3DLGA 4OJRA 1RDCA 4BROA 3H46O 4C23A 4U7BA 5JMVA 2PY5A 5GIPA 3QICA 5C25A 1BUPA 3NGYA 3CCLN 1TKXA 3O08A 4JKCA 5KRTA 3CG7A 4CJEA 2CH5A 3UKRB 2QWMA 3M5RA 4DSJA 4BRPA 4BRGA 4F4KA 2HOEA 2B5JA 4L8RB 4LFBK 2O8DB 4JYAK 1IV0A 3QBXA 3IMXA 5BN8A 2QWPA 2BE2A 3NF9A 1NBWA 3G0ZA 3AVIA 3E9LA 4A5BA 3L2QA 4L3QA 3ITHA 1HPMA 4C8MA 1SUQA 3SCXA 4C1NI 4FCYA 1X3MA 1C0TA 3D2FA 3ZT2A 4IZ9A 1DT9A 4OKJA 4O4GA 3I0RA 2J4RA 4H5NA 1JL1A 1UWBA 3CF5L 2E20A 2RPIA 1QS4A 3TANA 1WN7A 3PUFA 1X9JA 3TSUA 3KK2A 4FSVA 1KVBA 3OS1A 3TABA 3U3GA 5FPEA 3NH1A 3GG4A 2P9LA 3K5OA 1SKWA 3RSEB 5HL7L 2FBTA 2E6LA 1HYVA 3CJCA 3M8SA 4CHYA 1VSHA 3EO3A 4NCBA 4N76A 4KKOA 1J5OA 4ZTFA 5FPNA 2W40A 2P9UB 3Q7CA 3PSIA 5HRPA 3H3NO 4CK1A 1NK5A 3HK2A 2HHVA 4OGCA 1QQNA 1NJWA 4JHDA 3U3YA 4Z4IA 1LAWA 1XUPO 2ASPA 3NH2A 1SQKA 3MEDA 4H5RA 3AY9A 4HUGA 1LOTB 3IRXA 4B1XB 4EZ6A 3AVKA 1NKBA 1S3XA 4DF8A 1YTAA 4BQZA 4B3MK 1RBUA 2YHXA 5J2PA 2X6SA 1WAFA 2NRVA 3BF3A 3AVHA 5I9EB 3SJJA 4BC4A 4ZTJA 1RDUA 2GBZA 1I3AA 1HUXA 5MLCQ 2IOCA 3AAPA 3CJ9A 1T03A 2ZGYA 4A5AA 3CFRA 3R8EA 4BR2A 1S6QA 2IS3A 2O8EA 3A2FA 1X3NA 3M8RA 1EWQA 3HXMA 3K0SA 3THYB 4ELUA 1Q81O 3MEGA 1JLEA 4YOYA 2A6AA 4LD0A 4Z4HA 3VF6A 1OVQA 5EY4A 3LDLA 4W5RA 1NGJA 4M3TA 4YOUA 4Z4EA 5BPNA 3WUHA 4WF9L 2HMPA 3RTVA 3TTCA 4J8FA 4FLUA 1NGDA 4CJSA 4JKGB 2NRWA 4CF1A 1BDGA 2P9NA 2XY5A 3DXMB 2IAJA 2W6LA 3QEWA 3WNGA 3PX6A 1BIUA 3LAMA 4CIEA 3QETA 4A2AA 4JI0K 3VEXA 3FR0A 4BC2A 1KTQA 3ASMA 3BGRA 1QHTA 5B8HA 2PAVA 4FW2A 3VENA 1TL1A 4CJFA 3CIPA 3NVMA 5I42A 1N8RO 4PWDA 4B9VA 1RT3A 4QS7A 5GIOA 4PKIA 5E26A 3SAFA 1VQ4N 4DTMA 3K5MA 5HRRA 4IEEA 3OYKA 5I3UA 4HHTA 1D5AA 1ZBIA 2X78A 4JK9A 3CCJN 1FK9A 3DRRA 4KO0A 4FOIA 4XH1A 4ISFA 1WNSA 4H4OA 4N47A 1WUAA 1WSIA 2HBMA 3K9KA 3CETA 4DR5K 1E4GT 2QXLA 2QWNA 3HSTB 1JKHA 5AZIA 4IOCL 4CEFA 3TAEA 3VGKA 4B9NA 3CXCM 3R9PA 4NXNK 4CEDA 4RW6A 4FK2A 4YORA 3VQEA 4RW7A 1S6PA 4KBOA 4M63C 2YNGA 2RKIA 2HMIA 3HVTA 2OPPA 4CGJA 2P9KB 3NAEA 3KLEA 3HJFA 3S3MA 3FLCO 3RMBA 2NZTA 1ZBUA 3B6OA 1WAJA 5GADP 4YOWA 5H1SQ 3ZSZA 3HP6A 1GOAA 5GAGP 1KFDA 4YFUA 3ZT1A 4H5WA 5EU7A 3S9HA 2YKNA 3HYFA 1HNVA 4O0JA 2Z1JA 1YF5L 3J7ZO 3QNOA 1Z25A 3SV4A 3QERA 2YHYA 5ELZA 4DTUA 4CK2A 4WE1A 4JKDA 2FSJA 3C65A 1JLFA 3FGUA 5AQHA 4B8CA 5AQXA 3L8BA 2EHGA 4JKEA 4PQUA 4DV0K 1QHAA 3T19A 1BHLA 2OANA 3KVGA 1NOZA 3V9WA 1IBLK 4B9LA 3C6TA 3RRGA 3BZCA 2HHWA 4E1JA 2KFNA 1KLMA 3ID6A 3QBWA 3HSCA 1TK5A 1FKPA 2ITGA 4HUEA 3DLLL 3DAWA 4AHVA 3O3HA 1L3UA 1SL1A 3U9DA 4IFYA 4FJJA 1J5EK 1RT5A 2QWRA 2FSKA 1CXUA 4M3WA 3L4QA 3PX0A 4Z4CA 4DQQA 1NJYA 3ZSXA 1GLEG 2O8CB 2ZD1A 2VYPA 1LW0A 3FZKA 4CGDA 3AO3A 3R6MA 3V81A 1V4SA 1VRUA 1KFSA 3ZETB 3LPUA 3U9ZA 2UUAK 2KFZA 3KLFA 4FM0A 1ASUA 3ZX3A 1CZBA 2XY7A 3NGZA 2QW9A 1ATRA 1ATSA 3P31A 3F9KA 4GY2B 1OKJA 4CJQA 3VF2A 1VQKN 3FFKB 2IGIA 4E1NA 2Z1GA 5AQFA 2JGUA 5BRDA 3VGLA 3QEXA 3AVAA 2NRRA 3H1VX 5BPMA 3NDKA 3ZX0A 4FWPA 4EZ9A 3R1XA 4BE0A 1TYQB 2PYJA 4PHTX 1CZAN 4FOEA 4BRFA 4BR5A 1ZXOA 3UKUB 4KHSA 4BE1A 3PO5A 3GE1A 5AJ3K 3VEYA 5LL6Z 4JI1K 4EP5A 2P5OA 3PV8A 3J81O 3KLGA 3I8BA 5AQWA 1TKTA 4AHSA 4W5TA 3ISNC 3G25A 4OVLA 4WFBL 4B9SA 4OX9K 1P8ZA 3VQAA 4XIUA 3IAYA 4NCAA 4KH6A 2P9SA 3D6RA 3OS0A 5KRSA 4FLZA 4B9MA 1QQMA 3AAQA 3DRSA 4CBWA 4J2BA 3KLHA 4FWKA 3T1YK 4BGBA 4ILHA 3C7NA 3WNHA 1KQSM 1E3MA 1MDUB 5M1OA 3MX2A 1K8AO 3AA3A 1T6CA 1EXQA 5AQIA 1CZ9A 4N56A 3O4NA 1T3VA 4MFBA 1NMNA 4LH4A 4BREA 1VQMN 4JS4A 3ATVA 2O4GA 1XMOK 4O0IA 4C8KA 4CFBA 5LJVA 1IBKK 4LF9K 3LWMA 1UOCA 3AVMA 3UKRA 3OYCA 4FWNA 4JKHA 4BWMA 3IFRA 4Y1DA 5AQGA 4C8OA 5F1XA 4YDUC 3RRHA 1ZBHA 3THXB 5KGWA 1JLQA 3OYIA 1ZC6A 2YNFA 3T1AA 2HBLA 3CM5A 4DV4K 4FK4A 3CCMN 2A40A 1QE1A 4H03B 4CF8A 1RTJA 2ZJRL 1JLGA 4H5TA 5IT9O 4M7XA 2F4VK 3DWLA 4BRCA 4OPKA 3HT3A 3VEVA 5BPLA 4FXDA 4DG1A 3TWHA 2YKMA 3AO2A 3LZIA 1OH7A 5JLFA 4OKEA 4KV8A 3CMEN 1C0GA 2OTJN 3K9JA 5AQTA 3CPWM 5JS2A 1Y64A 3L4IA 2QM1A 4BRLA 4G9ZA 2YNIA 5AQKA 2VWKA 2WC9A 4NO7A 4KB0A 5C12A 3AVLA 3OYBA 1OH5A 3LALA 2ITMA 3WXJA 2BH1A 2KW4A 4ID5A 1RTDA 2GWJA 3F9MA 2Q97A 3PIPL 4FVMA 3EKSA 1MWMA 3J7YP 5LMUK 5AFUH 2QKBA 1I39A 1YAGA 4JAXA 3CERA 5C42A 2R7YA 2E4LA 5IWAK 4LF4K 4HVJA 2D0PA 3QIOA 3MMVA 4CD1A 1YJ9N 5HROA 4H0TB 4H5VA 2QKKA 4JNEA 3SUOA 3IDHA 4BVOA 3BZKA 1HR0K 3RMDA 2IVNA 2IVOA 4FJKA 3U4LA 1TAUA 1IG9A 4Y0WA 5AQLA 2G8HA 3LDQA 1H1VA 4CBUA 3PSFA 4CJRA 2YHWA 4ELVA 1KCFA 2Q3SA 3BDPA 1JLBA 3AVFA 1GLBG 4DFKA 2KKZA 3RWUA 2IDOA 1RTIA 3NF8A 1TV6A 2ASOA 3EZWA 3ZT0A 3CCEN 5CZ1A 4YNQA 5SWMA 3OBYA 4JRQA 3T69A 3QIPA 5AR0A 3NHGA 1WB9A 2E1ZA 2PFUA 1VSLA 3ZSWA 1QVGM 1HNIA 3KIOA 1VRTA 3ZSVA 4JI6K 3DXKB 3VEWA 1K8KB 3V6DA 2CGJA 3HP9A 4ICLA 1SAZA 4DSLA 1S1TA 1YITN 3LM2A 3WXLA 1HJRA 4I2QA 5EX5A 4JN4A 4CJKA 2RE2A 2QTDA 1W7AA 1GLDG 4B1YB 4BRMA 3ULDA 2GV9A 1D9FA 1N34K 2O8BA 4JKFA 4JKGA 2H3GX 3O3GA 4B9QA 3DM2A 4GV6A 1WSGA 4JV5K 3O80A 1C0UA 3PIOL 2D0AA 1D9DA 3OVNA 3MXMA 3J8AA 2QXFA 2A5XA 2UUBK 4KHPK 1J9AA 2IVPA 4DFMA 5AQRA 3HPOA 3M6GA 3SAHA 4HTUA 1XHZA 4DQRA 3BF1A 5CHIA 5AZJA 4BRKA 2KZMA 3TAMA 3KKSA 2G8IA 3T1HK 1NKCA 1EETA 3EN9A 2A3ZA 1HMVA 4FPAA 3KHYA 4CZLA 1NG9A 1CXQA 3ENOA 3K57A 3ZX2A 1N33K 3U6FA 3DMJA 2ZE2A 3OY9A 5FRMA 3AVBA 1RDWX 5KI6A 4FPBA 5JVGL 2HBKA 3TU5A 1TAQA 1Q86O 5AQZA 4GKJK 1WBBA 3SQ4A 3P83D 3I55N 5J2NA 1EKEA 2QI2A 2YHAA 4BC5A 4H0YB 2HBJA 1XC3A 3CJ1A 1K9MO 5AFUA 1BGXT 4E3SA 5JS1A 4FJ8A 4YOVA 4YDUA 3PY8A
chains in the Genus database with same CATH topology
2HW3A 3HP6A 1L3TA 3KK3A 1GOAA 4E89A 1LW2A 3TAQA 4KRFA 1KFDA 1RBSA 1X9SA 4F2RA 4B9UA 2Y1JA 4YFUA 2G8WA 1RT1A 4KPYA 3ZT1A 3MXIA 4MQ3A 5EU7A 4KHUA 3S9HA 1RT2A 1WSEA 2YKNA 1TK8A 2G8FA 1X9WA 4DMNA 5D3GA 4FJXA 3HYFA 1HNVA 2Z1HA 3DLEA 1BL3A 4O0JA 2Z1JA 4LSNA 5HP1A 1U04A 3OYEA 3QNOA 1Z25A 1IO2A 1JLAA 5CYMA 4M45A 3SV4A 4CJUA 3QERA 1T05A 4AHCA 4FJ5A 1WSJA 4DTUA 3QEVA 1VSIA 4CK2A 3OJUA 4WE1A 5HBMA 4W5QA 4DTPA 3AO5A 4B8CA 1JLFA 3EYZA 4KHQA 1C0MA 3L8BA 2EHGA 3ZSQA 1SV5A 2DY4A 1REVA 2DFFA 3QINA 1RDBA 4J2DA 4FW1A 4PQUA 2HVIA 1B92A 2ZQBA 3CYMA 3T19A 1BHLA 3TAPA 3ZSRA 1JLCA 3VQQA 1NOZA 3MECA 2W42A 1VSDA 1RILA 2HNYA 3DRPA 2OA8A 1TVRA 4CF2A 4CHNA 3OYHA 3V9WA 1EP4A 1WLJA 3QNNA 1UA1A 1Q8IA 4B9LA 1QQCA 4H8KA 3C6TA 4KI6A 1B9FA 1ZYQA 3OYFA 1RT4A 4AHRA 3RRGA 1VSEA 4IFVA 2OPSA 1BQNA 3F73A 2HHWA 4BACA 4FM2A 3C95A 1U4BA 3TI0A 1RT7A 1KLMA 3RMCA 2KFNA 3D0PA 1Q9XA 1S9GA 1XHXA 4CJ3A 2HHXA 4KI4A 3K59A 4DF4A 1TK5A 1FKPA 3AVCA 2ITGA 2WONA 4HUEA 1U45A 4F8RA 2Z1IA 3JYTA 4B3OA 4AHVA 3NBPA 3VN5A 3O3HA 3OYDA 1W9HA 1SL1A 4IFYA 1L3UA 1KRPA 4DQIA 4FJJA 1VSFA 2I5JA 1C1CA 2HB5A 4W5OA 3V4IA 1RT5A 4FJHA 1RDAA 4W5NA 4I7FA 1CXUA 4E1MA 4M3WA 2PZSA 1SKRA 4LSLA 4AH9A 3PX0A 4QCLA 4IKFA 4B8AB 4Z4CA 4DQQA 1ITGA 1S1XA 4CFDA 3CM6A 4QAGA 3ZSXA 1NJYA 1O1WA 3K2PA 5J1EA 4NYFA 2ZD1A 1LW0A 4M3UA 4DLEA 4KB1A 4CGDA 3AO3A 3VQCA 3V81A 1IKWA 4M41A 1VRUA 3HM9A 1B9DA 4DTSA 1KFSA 1FKOA 4FK0A 4CFCA 1DTQA 3LPUA 3MEEA 4BDYA 4M3XA 1TKZA 4DU1A 4DFPA 1WSFA 4CIFA 2KFZA 1QSYA 3KLFA 3VQ7A 2OPRA 4FM0A 1Y97A 4KHWA 1ASUA 1CZBA 4JLHA 4DSKA 1NKEA 3VA0A 1BCMA 4Q5VA 1S1VA 3V9SA 2XY7A 1XI1A 4F3TA 3NGZA 1N6QA 2XRIA 1RNHA 3FFIA 1U49A 3F9KA 4M3YA 4CCHA 3L3VA 4FJMA 4CJQA 2IGIA 4E1NA 2X74A 2Z1GA 1N5YA 3THVA 2JGUA 3G10A 5CY4A 1BQMA 3SQ1A 4FZYA 3AV9A 3QEXA 4M3ZA 3AVAA 4KHNA 4DSEA 3LP3A 4KTQA 4Z4FA 3ZT4A 3NDKA 3P5JA 4DU3A 2D0CA 1TK0A 5HLFA 1KLNA 4CEEA 4CHQA 4RW4A 4BE0A 1KVCA 3KLIA 3SV3A 3T3FA 2PYJA 4EZ9A 4CJVA 4K8XA 3LP1A 3AO1A 3PO4A 3NF7A 3DLRA 4IBNA 3QLHA 4CESA 3K5NA 4J2EA 4KHSA 4BE1A 4BWJA 4OLAA 3PO5A 3SPYA 4PY5A 3VQPA 3V1RA 3L2WA 4FJ9A 4OPJA 2OYQA 4E0DA 3JSMA 4EP5A 1HRHA 1XWLA 4CHZA 2P5OA 4CJ5A 2XO7A 3PV8A 4CJ4A 1SL2A 4KFBA 4HUFA 3ZT3A 3KLGA 4N41A 3TAFA 4AHUA 1LWEA 4FJNA 2G8KA 1TKTA 2YV0X 4AHSA 4LY7A 4R5PA 4BE2A 1XC9A 3DLHA 1CLQA 4I9QA 4W5TA 1W0HA 3ISNC 4OVLA 3WNEA 4B9SA 3HO1A 4CERA 3SYZA 4AILC 4DS5A 3SUPA 1NK0A 3VQAA 4XIUA 4FLYA 3IAYA 3SNNA 4NCAA 1A5XA 2WOMA 3VQBA 3SQ2A 2HHUA 3V1OA 1IKYA 2IC3A 3OS0A 4DS4A 5KRSA 4FLZA 4B9MA 4CJPA 4FM1A 1ASVA 3UIQA 2HVHA 3AA2A 3RR8A 3DRSA 5I3UA 1QSSA 3KLHA 4J2BA 2VWJA 2AJQA 1IKVA 4ZHRA 4F2SA 4E7IA 3B6PA 1A5WA 4FLWA 4GW6A 5FROA 3WNHA 1D8YA 2OZSA 1NJXA 4CGHA 2VG5A 3L2UA 3AA3A 4IDKA 1EXQA 5J2QA 5E41A 2A1RA 4DTNA 2G8VA 1CZ9A 4PUOA 1RT6A 3VQ6A 4N56A 4Q0BA 1RTHA 3O4NA 4CEAA 3D45A 2FBVA 2YHBA 4MFBA 3AVJA 4CHPA 1SL0A 4LH4A 4CEQA 2ATQA 1EX4A 3LWLA 4AHTA 4CJWA 4JS4A 1LV5A 2O4GA 4BDPA 1G15A 2E6MA 3DLKA 4O0IA 2P51A 3L2RA 4KTZA 1VK0A 4BDZA 4C8KA 3OYGA 4CFBA 4CEOA 3KKRA 4CFAA 1BIZA 2KQ2A 2B4JA 3LWMA 2BDPA 4FZXC 1UOCA 3AVMA 3NFAA 1MU2A 3OYCA 1NK6A 1L3SA 2VG7A 1JL2A 4BWMA 1X9MA 1S9EA 4Y1DA 2P5GA 1VSJA 3I8DA 3TARA 3KD5E 2VG6A 2QK9A 3SI6A 4C8OA 1U48A 4N5SA 4OKKA 2A1SA 3DLGA 4OJRA 1RDCA 4DTOA 4G1QA 3HVRA 3RRHA 1ZBHA 5KGWA 1JLQA 4FLTA 3OYIA 4DWIA 2YNFA 3T1AA 2PY5A 5C25A 1T8EA 3CM5A 4FK4A 3NGYA 1QE1A 1TKXA 4CF8A 1RTJA 5KRTA 2O4IA 1JLGA 3CG7A 1DTTA 4CJEA 5HRSA 2F8SA 1QTMA 4DSJA 5FRNA 3AVGA 4DQSA 3NCIA 4DTJA 4F4KA 2B5JA 4L8RB 5T7BA 4OPKA 3DOLA 3HT3A 1NK7A 1X1PA 5SZTA 4FXDA 4DG1A 4ID1A 2YKMA 3AO2A 3OYLA 3KK1A 3LZIA 3TWHA 1C1BA 2B6AA 4TSXA 2BE2A 4I2PA 4GVMA 1UAXA 3NF9A 4KV8A 3CFOA 4OKEA 4J2AA 5FRMA 3G0ZA 4C8NA 3AVIA 4F3OA 3SQ0A 3L2QA 4E7HA 3WNFA 2OPQA 5JS2A 3ITHA 4C8MA 1HQEA 2KZZA 1SUQA 3SCXA 4FCYA 1C0TA 2YNIA 3LDSA 2XY8A 2VWKA 3ZT2A 1IH7A 1S1UA 3P1GA 4OKJA 4O4GA 4PA1A 4KB0A 3I0RA 2P1JA 4DQPA 3AO4A 3AVLA 3OYBA 2DFHA 2HHSA 1JL1A 1HPZA 1UWBA 3LALA 5DMRA 3V9XA 2RPIA 1R0AA 2KW4A 4ID5A 1QS4A 2LSNA 3ZCMA 3NGIA 3TANA 1RTDA 4FVMA 1WN7A 3PUFA 4DLGA 3LANA 1U47A 5FDLA 4M3RA 2QKBA 1I39A 2R7YA 3KK2A 5C42A 3IS9A 1KVBA 2E4LA 3DYAA 3OS1A 4HVJA 3QIOA 3TABA 4OLBA 3U3GA 5HROA 3NH1A 2QKKA 5CYQA 3SPZA 3SUOA 1K6YA 3LP0A 4FJLA 3K5OA 4O5BA 1SKWA 3SUNA 3RMDA 4FJKA 5K14A 1TAUA 2RF2A 4RW9A 1IG9A 3RMAA 2FBTA 2E6LA 4RG8A 4CF9A 2G8HA 1HYVA 1TGOA 3HPHA 4CHYA 4CJRA 1F21A 3M8SA 4ELVA 1KCFA 1VSHA 1LWFA 2Q3SA 4NCBA 3NF6A 3OYAA 4KKOA 1J5OA 3BDPA 4N76A 1JLBA 3AVFA 3LAKA 4ZTFA 1C6VA 4DSFA 5HRPA 4NCGA 4E7LA 4CK3A 4DFKA 3V9UA 4CK1A 1WSHA 5DK5A 1NK5A 4O44A 3HK2A 2HHVA 3QESA 4OGCA 2IDOA 3KJVA 1NK9A 3RWUA 1RTIA 1VSMA 4E19A 4DTXA 3NF8A 1NJWA 1TV6A 2HNDA 3EZ5A 4Z4GA 3IG1A 3U3YA 2FBXA 3OJSA 3ZT0A 3O3FA 1LAWA 1UA0A 3DLBA 5CZ1A 4Z4IA 4YNQA 1FXXA 5SWMA 3NH2A 4FZZA 4JRQA 1BISA 3MEDA 4JRPA 4HUGA 3IRXA 3QIPA 3NHGA 4EZ6A 3AVKA 4FJIA 3ZSYA 4CJTA 1NKBA 4CGFA 3LP2A 4DF8A 2HHTA 4Y1CA 1YTAA 1T7PA 1NK8A 1RBUA 1VSLA 3ZSWA 1YVUA 3VQ5A 1HNIA 3OYNA 3KD1E 3QEPA 3KIOA 1VRTA 3ZSVA 2FBYA 3C6UA 5J2PA 2X6SA 1WAFA 3AVHA 1GOBA 1LAVA 5C24A 4GMJB 4EP4A 3SJJA 4ZTJA 3TR8A 4B08A 2GBZA 5J2MA 2DFEA 4FJGA 1I3AA 2D5RA 3V6DA 2IOCA 3HP9A 4CIGA 4NYNA 4ICLA 2F96A 4UQGA 1T03A 3RR7A 3LZJA 4H4MA 4DSLA 3M8QA 3CFRA 1S1TA 2ETJA 1NK4A 1HJRA 3VQ4A 4I2QA 3V9ZA 4DU4A 1A5VA 1S6QA 2IS3A 4M42A 1SKSA 4FLXA 4CJKA 3MAQA 3A2FA 2G8UA 3M8RA 3DOKA 3HXMA 4O55A 3CQ8A 4ELUA 1S5JA 3MEGA 2BGGA 4RW8A 1JLEA 4Z0UA 3ULDA 2GV9A 4OGEA 1D9FA 4KAZA 2HNZA 3SZ2A 2YNHA 4LD0A 3HPGA 3O3GA 1LWCA 3DM2A 4CGGA 3L2VA 4IG3A 4Z4HA 3AA4A 3VQ9A 4FJ7A 1WSGA 4IG0A 4CE9A 1HYSA 1C0UA 4W5RA 4M3TA 4K8ZA 1KSPA 4Z4EA 2D0AA 2D0BA 1D9DA 3OVNA 4QOZB 3KTQA 1RCHA 1L5UA 3MXMA 3I0SA 3NE6A 1KVAA 2XHBA 1RBTA 4LH5A 4FYDA 3HL8A 5HRNA 2Y1IA 1TL3A 2QXFA 2F8TA 3RTVA 1J9AA 4KHYA 3QO9A 1J54A 4I9LA 3QEIA 1S1WA 4FLUA 4DFMA 4CECA 4CJSA 4HCBA 2GUIA 3OYJA 4CF1A 3HPOA 3CFPA 1QSLA 3C94A 3K58A 2XY5A 2IAJA 3ALYA 3QEWA 3LPTA 1IKXA 3WNGA 4ELTA 3PX6A 4HTUA 1BIUA 3LAMA 1ASWA 1XHZA 4CIEA 4DQRA 3QETA 4DTRA 2PYLA 4KREA 1YT3A 1NJZA 2KZMA 3TAMA 1TKDA 1Q9YA 1KTQA 2EX3A 1Z26A 3ASMA 1RBVA 3KKSA 3TAGA 2G8IA 3BGRA 1QHTA 1NKCA 4FW2A 1EETA 1TL1A 3PX4A 4CJFA 5CZ2A 2XY6A 4CEBA 5I42A 4C8LA 4PWDA 4B9VA 1HMVA 3S3OA 1RT3A 1JXEA 3VQ8A 1CXQA 4CJLA 3K57A 4JS5A 1YTUA 2OZMA 3DI6A 5KGXA 4DTMA 1VSKA 1RBRA 3K5MA 3MXJA 2DTUA 3U6FA 2JLEA 5HRRA 3OYKA 3DMJA 2ZE2A 1BI4A 3AA5X 4KTWA 4CEZA 3AVBA 5KI6A 3OY9A 1D5AA 4HHTA 1ZBLA 3S3NA 2X78A 1ZBIA 3SUQA 1FK9A 3DRRA 4KO0A 3VA3A 3K5LA 3O4QA 1GOCA 1TAQA 1WNSA 4H4OA 4N47A 2KTQA 1WSIA 2HHQA 3M8PA 1C1AA 4DSIA 3HSTB 1JKHA 1BCOA 3OYMA 3SQ4A 1ZBFA 4CEFA 3TAEA 3H08A 3P83D 4E7JA 4HCCA 5J2NA 4B9NA 4DFJA 4B9TA 1EKEA 4CEDA 2YHAA 4RW6A 1BI4B 4FK2A 1RDDA 1DLOA 4FLVA 2BANA 2X6NA 3VQEA 3L3UA 4RW7A 4CHOA 3NH0A 1S6PA 2RN2A 1HQUA 4E7KA 2YNGA 2RKIA 5KTQA 1NOYA 2HMIA 1BGXT 3HVTA 2OPPA 4E3SA 4CGJA 1L3VA 5JS1A 3V1QA 3VQDA 1JXBA 3NAEA 4FJ8A 3KLEA 3HJFA 3AVNA 3ZSOA 3S3MA 3RMBA 2FC0A 1J53A 1HYZA 1ZBUA 3B6OA 3OS2A 1WAJA 3PY8A 4CF0A 3ZSZA 3E01A 4CGIA 2NUBA 3EY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HW3 A;  3HP6 A;  1L3T A;  3KK3 A;  1GOA A;  4E89 A;  1LW2 A;  3TAQ A;  4KRF A;  1KFD A;  1RBS A;  1X9S A;  4F2R A;  4B9U A;  2Y1J A;  4YFU A;  2G8W A;  1RT1 A;  4KPY A;  3ZT1 A;  3MXI A;  4MQ3 A;  5EU7 A;  4KHU A;  3S9H A;  1RT2 A;  1WSE A;  2YKN A;  1TK8 A;  2G8F A;  1X9W A;  4DMN A;  5D3G A;  4FJX A;  3HYF A;  1HNV A;  2Z1H A;  3DLE A;  1BL3 A;  4O0J A;  2Z1J A;  4LSN A;  5HP1 A;  1U04 A;  3OYE A;  3QNO A;  1Z25 A;  1IO2 A;  1JLA A;  5CYM A;  4M45 A;  3SV4 A;  4CJU A;  3QER A;  1T05 A;  4AHC A;  4FJ5 A;  1WSJ A;  4DTU A;  3QEV A;  1VSI A;  4CK2 A;  3OJU A;  4WE1 A;  5HBM A;  4W5Q A;  4DTP A;  3AO5 A;  4B8C A;  1JLF A;  3EYZ A;  4KHQ A;  1C0M A;  3L8B A;  2EHG A;  3ZSQ A;  1SV5 A;  2DY4 A;  1REV A;  2DFF A;  3QIN A;  1RDB A;  4J2D A;  4FW1 A;  4PQU A;  2HVI A;  1B92 A;  2ZQB A;  3CYM A;  3T19 A;  1BHL A;  3TAP A;  3ZSR A;  1JLC A;  3VQQ A;  1NOZ A;  3MEC A;  2W42 A;  1VSD A;  1RIL A;  2HNY A;  3DRP A;  2OA8 A;  1TVR A;  4CF2 A;  4CHN A;  3OYH A;  3V9W A;  1EP4 A;  1WLJ A;  3QNN A;  1UA1 A;  1Q8I A;  4B9L A;  1QQC A;  4H8K A;  3C6T A;  4KI6 A;  1B9F A;  1ZYQ A;  3OYF A;  1RT4 A;  4AHR A;  3RRG A;  1VSE A;  4IFV A;  2OPS A;  1BQN A;  3F73 A;  2HHW A;  4BAC A;  4FM2 A;  3C95 A;  1U4B A;  3TI0 A;  1RT7 A;  1KLM A;  3RMC A;  2KFN A;  3D0P A;  1Q9X A;  1S9G A;  1XHX A;  4CJ3 A;  2HHX A;  4KI4 A;  3K59 A;  4DF4 A;  1TK5 A;  1FKP A;  3AVC A;  2ITG A;  2WON A;  4HUE A;  1U45 A;  4F8R A;  2Z1I A;  3JYT A;  4B3O A;  4AHV A;  3NBP A;  3VN5 A;  3O3H A;  3OYD A;  1W9H A;  1SL1 A;  4IFY A;  1L3U A;  1KRP A;  4DQI A;  4FJJ A;  1VSF A;  2I5J A;  1C1C A;  2HB5 A;  4W5O A;  3V4I A;  1RT5 A;  4FJH A;  1RDA A;  4W5N A;  4I7F A;  1CXU A;  4E1M A;  4M3W A;  2PZS A;  1SKR A;  4LSL A;  4AH9 A;  3PX0 A;  4QCL A;  4IKF A;  4B8A B;  4Z4C A;  4DQQ A;  1ITG A;  1S1X A;  4CFD A;  3CM6 A;  4QAG A;  3ZSX A;  1NJY A;  1O1W A;  3K2P A;  5J1E A;  4NYF A;  2ZD1 A;  1LW0 A;  4M3U A;  4DLE A;  4KB1 A;  4CGD A;  3AO3 A;  3VQC A;  3V81 A;  1IKW A;  4M41 A;  1VRU A;  3HM9 A;  1B9D A;  4DTS A;  1KFS A;  1FKO A;  4FK0 A;  4CFC A;  1DTQ A;  3LPU A;  3MEE A;  4BDY A;  4M3X A;  1TKZ A;  4DU1 A;  4DFP A;  1WSF A;  4CIF A;  2KFZ A;  1QSY A;  3KLF A;  3VQ7 A;  2OPR A;  4FM0 A;  1Y97 A;  4KHW A;  1ASU A;  1CZB A;  4JLH A;  4DSK A;  1NKE A;  3VA0 A;  1BCM A;  4Q5V A;  1S1V A;  3V9S A;  2XY7 A;  1XI1 A;  4F3T A;  3NGZ A;  1N6Q A;  2XRI A;  1RNH A;  3FFI A;  1U49 A;  3F9K A;  4M3Y A;  4CCH A;  3L3V A;  4FJM A;  4CJQ A;  2IGI A;  4E1N A;  2X74 A;  2Z1G A;  1N5Y A;  3THV A;  2JGU A;  3G10 A;  5CY4 A;  1BQM A;  3SQ1 A;  4FZY A;  3AV9 A;  3QEX A;  4M3Z A;  3AVA A;  4KHN A;  4DSE A;  3LP3 A;  4KTQ A;  4Z4F A;  3ZT4 A;  3NDK A;  3P5J A;  4DU3 A;  2D0C A;  1TK0 A;  5HLF A;  1KLN A;  4CEE A;  4CHQ A;  4RW4 A;  4BE0 A;  1KVC A;  3KLI A;  3SV3 A;  3T3F A;  2PYJ A;  4EZ9 A;  4CJV A;  4K8X A;  3LP1 A;  3AO1 A;  3PO4 A;  3NF7 A;  3DLR A;  4IBN A;  3QLH A;  4CES A;  3K5N A;  4J2E A;  4KHS A;  4BE1 A;  4BWJ A;  4OLA A;  3PO5 A;  3SPY A;  4PY5 A;  3VQP A;  3V1R A;  3L2W A;  4FJ9 A;  4OPJ A;  2OYQ A;  4E0D A;  3JSM A;  4EP5 A;  1HRH A;  1XWL A;  4CHZ A;  2P5O A;  4CJ5 A;  2XO7 A;  3PV8 A;  4CJ4 A;  1SL2 A;  4KFB A;  4HUF A;  3ZT3 A;  3KLG A;  4N41 A;  3TAF A;  4AHU A;  1LWE A;  4FJN A;  2G8K A;  1TKT A;  2YV0 X;  4AHS A;  4LY7 A;  4R5P A;  4BE2 A;  1XC9 A;  3DLH A;  1CLQ A;  4I9Q A;  4W5T A;  1W0H A;  3ISN C;  4OVL A;  3WNE A;  4B9S A;  3HO1 A;  4CER A;  3SYZ A;  4AIL C;  4DS5 A;  3SUP A;  1NK0 A;  3VQA A;  4XIU A;  4FLY A;  3IAY A;  3SNN A;  4NCA A;  1A5X A;  2WOM A;  3VQB A;  3SQ2 A;  2HHU A;  3V1O A;  1IKY A;  2IC3 A;  3OS0 A;  4DS4 A;  5KRS A;  4FLZ A;  4B9M A;  4CJP A;  4FM1 A;  1ASV A;  3UIQ A;  2HVH A;  3AA2 A;  3RR8 A;  3DRS A;  5I3U A;  1QSS A;  3KLH A;  4J2B A;  2VWJ A;  2AJQ A;  1IKV A;  4ZHR A;  4F2S A;  4E7I A;  3B6P A;  1A5W A;  4FLW A;  4GW6 A;  5FRO A;  3WNH A;  1D8Y A;  2OZS A;  1NJX A;  4CGH A;  2VG5 A;  3L2U A;  3AA3 A;  4IDK A;  1EXQ A;  5J2Q A;  5E41 A;  2A1R A;  4DTN A;  2G8V A;  1CZ9 A;  4PUO A;  1RT6 A;  3VQ6 A;  4N56 A;  4Q0B A;  1RTH A;  3O4N A;  4CEA A;  3D45 A;  2FBV A;  2YHB A;  4MFB A;  3AVJ A;  4CHP A;  1SL0 A;  4LH4 A;  4CEQ A;  2ATQ A;  1EX4 A;  3LWL A;  4AHT A;  4CJW A;  4JS4 A;  1LV5 A;  2O4G A;  4BDP A;  1G15 A;  2E6M A;  3DLK A;  4O0I A;  2P51 A;  3L2R A;  4KTZ A;  1VK0 A;  4BDZ A;  4C8K A;  3OYG A;  4CFB A;  4CEO A;  3KKR A;  4CFA A;  1BIZ A;  2KQ2 A;  2B4J A;  3LWM A;  2BDP A;  4FZX C;  1UOC A;  3AVM A;  3NFA A;  1MU2 A;  3OYC A;  1NK6 A;  1L3S A;  2VG7 A;  1JL2 A;  4BWM A;  1X9M A;  1S9E A;  4Y1D A;  2P5G A;  1VSJ A;  3I8D A;  3TAR A;  3KD5 E;  2VG6 A;  2QK9 A;  3SI6 A;  4C8O A;  1U48 A;  4N5S A;  4OKK A;  2A1S A;  3DLG A;  4OJR A;  1RDC A;  4DTO A;  4G1Q A;  3HVR A;  3RRH A;  1ZBH A;  5KGW A;  1JLQ A;  4FLT A;  3OYI A;  4DWI A;  2YNF A;  3T1A A;  2PY5 A;  5C25 A;  1T8E A;  3CM5 A;  4FK4 A;  3NGY A;  1QE1 A;  1TKX A;  4CF8 A;  1RTJ A;  5KRT A;  2O4I A;  1JLG A;  3CG7 A;  1DTT A;  4CJE A;  5HRS A;  2F8S A;  1QTM A;  4DSJ A;  5FRN A;  3AVG A;  4DQS A;  3NCI A;  4DTJ A;  4F4K A;  2B5J A;  4L8R B;  5T7B A;  4OPK A;  3DOL A;  3HT3 A;  1NK7 A;  1X1P A;  5SZT A;  4FXD A;  4DG1 A;  4ID1 A;  2YKM A;  3AO2 A;  3OYL A;  3KK1 A;  3LZI A;  3TWH A;  1C1B A;  2B6A A;  4TSX A;  2BE2 A;  4I2P A;  4GVM A;  1UAX A;  3NF9 A;  4KV8 A;  3CFO A;  4OKE A;  4J2A A;  5FRM A;  3G0Z A;  4C8N A;  3AVI A;  4F3O A;  3SQ0 A;  3L2Q A;  4E7H A;  3WNF A;  2OPQ A;  5JS2 A;  3ITH A;  4C8M A;  1HQE A;  2KZZ A;  1SUQ A;  3SCX A;  4FCY A;  1C0T A;  2YNI A;  3LDS A;  2XY8 A;  2VWK A;  3ZT2 A;  1IH7 A;  1S1U A;  3P1G A;  4OKJ A;  4O4G A;  4PA1 A;  4KB0 A;  3I0R A;  2P1J A;  4DQP A;  3AO4 A;  3AVL A;  3OYB A;  2DFH A;  2HHS A;  1JL1 A;  1HPZ A;  1UWB A;  3LAL A;  5DMR A;  3V9X A;  2RPI A;  1R0A A;  2KW4 A;  4ID5 A;  1QS4 A;  2LSN A;  3ZCM A;  3NGI A;  3TAN A;  1RTD A;  4FVM A;  1WN7 A;  3PUF A;  4DLG A;  3LAN A;  1U47 A;  5FDL A;  4M3R A;  2QKB A;  1I39 A;  2R7Y A;  3KK2 A;  5C42 A;  3IS9 A;  1KVB A;  2E4L A;  3DYA A;  3OS1 A;  4HVJ A;  3QIO A;  3TAB A;  4OLB A;  3U3G A;  5HRO A;  3NH1 A;  2QKK A;  5CYQ A;  3SPZ A;  3SUO A;  1K6Y A;  3LP0 A;  4FJL A;  3K5O A;  4O5B A;  1SKW A;  3SUN A;  3RMD A;  4FJK A;  5K14 A;  1TAU A;  2RF2 A;  4RW9 A;  1IG9 A;  3RMA A;  2FBT A;  2E6L A;  4RG8 A;  4CF9 A;  2G8H A;  1HYV A;  1TGO A;  3HPH A;  4CHY A;  4CJR A;  1F21 A;  3M8S A;  4ELV A;  1KCF A;  1VSH A;  1LWF A;  2Q3S A;  4NCB A;  3NF6 A;  3OYA A;  4KKO A;  1J5O A;  3BDP A;  4N76 A;  1JLB A;  3AVF A;  3LAK A;  4ZTF A;  1C6V A;  4DSF A;  5HRP A;  4NCG A;  4E7L A;  4CK3 A;  4DFK A;  3V9U A;  4CK1 A;  1WSH A;  5DK5 A;  1NK5 A;  4O44 A;  3HK2 A;  2HHV A;  3QES A;  4OGC A;  2IDO A;  3KJV A;  1NK9 A;  3RWU A;  1RTI A;  1VSM A;  4E19 A;  4DTX A;  3NF8 A;  1NJW A;  1TV6 A;  2HND A;  3EZ5 A;  4Z4G A;  3IG1 A;  3U3Y A;  2FBX A;  3OJS A;  3ZT0 A;  3O3F A;  1LAW A;  1UA0 A;  3DLB A;  5CZ1 A;  4Z4I A;  4YNQ A;  1FXX A;  5SWM A;  3NH2 A;  4FZZ A;  4JRQ A;  1BIS A;  3MED A;  4JRP A;  4HUG A;  3IRX A;  3QIP A;  3NHG A;  4EZ6 A;  3AVK A;  4FJI A;  3ZSY A;  4CJT A;  1NKB A;  4CGF A;  3LP2 A;  4DF8 A;  2HHT A;  4Y1C A;  1YTA A;  1T7P A;  1NK8 A;  1RBU A;  1VSL A;  3ZSW A;  1YVU A;  3VQ5 A;  1HNI A;  3OYN A;  3KD1 E;  3QEP A;  3KIO A;  1VRT A;  3ZSV A;  2FBY A;  3C6U A;  5J2P A;  2X6S A;  1WAF A;  3AVH A;  1GOB A;  1LAV A;  5C24 A;  4GMJ B;  4EP4 A;  3SJJ A;  4ZTJ A;  3TR8 A;  4B08 A;  2GBZ A;  5J2M A;  2DFE A;  4FJG A;  1I3A A;  2D5R A;  3V6D A;  2IOC A;  3HP9 A;  4CIG A;  4NYN A;  4ICL A;  2F96 A;  4UQG A;  1T03 A;  3RR7 A;  3LZJ A;  4H4M A;  4DSL A;  3M8Q A;  3CFR A;  1S1T A;  2ETJ A;  1NK4 A;  1HJR A;  3VQ4 A;  4I2Q A;  3V9Z A;  4DU4 A;  1A5V A;  1S6Q A;  2IS3 A;  4M42 A;  1SKS A;  4FLX A;  4CJK A;  3MAQ A;  3A2F A;  2G8U A;  3M8R A;  3DOK A;  3HXM A;  4O55 A;  3CQ8 A;  4ELU A;  1S5J A;  3MEG A;  2BGG A;  4RW8 A;  1JLE A;  4Z0U A;  3ULD A;  2GV9 A;  4OGE A;  1D9F A;  4KAZ A;  2HNZ A;  3SZ2 A;  2YNH A;  4LD0 A;  3HPG A;  3O3G A;  1LWC A;  3DM2 A;  4CGG A;  3L2V A;  4IG3 A;  4Z4H A;  3AA4 A;  3VQ9 A;  4FJ7 A;  1WSG A;  4IG0 A;  4CE9 A;  1HYS A;  1C0U A;  4W5R A;  4M3T A;  4K8Z A;  1KSP A;  4Z4E A;  2D0A A;  2D0B A;  1D9D A;  3OVN A;  4QOZ B;  3KTQ A;  1RCH A;  1L5U A;  3MXM A;  3I0S A;  3NE6 A;  1KVA A;  2XHB A;  1RBT A;  4LH5 A;  4FYD A;  3HL8 A;  5HRN A;  2Y1I A;  1TL3 A;  2QXF A;  2F8T A;  3RTV A;  1J9A A;  4KHY A;  3QO9 A;  1J54 A;  4I9L A;  3QEI A;  1S1W A;  4FLU A;  4DFM A;  4CEC A;  4CJS A;  4HCB A;  2GUI A;  3OYJ A;  4CF1 A;  3HPO A;  3CFP A;  1QSL A;  3C94 A;  3K58 A;  2XY5 A;  2IAJ A;  3ALY A;  3QEW A;  3LPT A;  1IKX A;  3WNG A;  4ELT A;  3PX6 A;  4HTU A;  1BIU A;  3LAM A;  1ASW A;  1XHZ A;  4CIE A;  4DQR A;  3QET A;  4DTR A;  2PYL A;  4KRE A;  1YT3 A;  1NJZ A;  2KZM A;  3TAM A;  1TKD A;  1Q9Y A;  1KTQ A;  2EX3 A;  1Z26 A;  3ASM A;  1RBV A;  3KKS A;  3TAG A;  2G8I A;  3BGR A;  1QHT A;  1NKC A;  4FW2 A;  1EET A;  1TL1 A;  3PX4 A;  4CJF A;  5CZ2 A;  2XY6 A;  4CEB A;  5I42 A;  4C8L A;  4PWD A;  4B9V A;  1HMV A;  3S3O A;  1RT3 A;  1JXE A;  3VQ8 A;  1CXQ A;  4CJL A;  3K57 A;  4JS5 A;  1YTU A;  2OZM A;  3DI6 A;  5KGX A;  4DTM A;  1VSK A;  1RBR A;  3K5M A;  3MXJ A;  2DTU A;  3U6F A;  2JLE A;  5HRR A;  3OYK A;  3DMJ A;  2ZE2 A;  1BI4 A;  3AA5 X;  4KTW A;  4CEZ A;  3AVB A;  5KI6 A;  3OY9 A;  1D5A A;  4HHT A;  1ZBL A;  3S3N A;  2X78 A;  1ZBI A;  3SUQ A;  1FK9 A;  3DRR A;  4KO0 A;  3VA3 A;  3K5L A;  3O4Q A;  1GOC A;  1TAQ A;  1WNS A;  4H4O A;  4N47 A;  2KTQ A;  1WSI A;  2HHQ A;  3M8P A;  1C1A A;  4DSI A;  3HST B;  1JKH A;  1BCO A;  3OYM A;  3SQ4 A;  1ZBF A;  4CEF A;  3TAE A;  3H08 A;  3P83 D;  4E7J A;  4HCC A;  5J2N A;  4B9N A;  4DFJ A;  4B9T A;  1EKE A;  4CED A;  2YHA A;  4RW6 A;  1BI4 B;  4FK2 A;  1RDD A;  1DLO A;  4FLV A;  2BAN A;  2X6N A;  3VQE A;  3L3U A;  4RW7 A;  4CHO A;  3NH0 A;  1S6P A;  2RN2 A;  1HQU A;  4E7K A;  2YNG A;  2RKI A;  5KTQ A;  1NOY A;  2HMI A;  1BGX T;  3HVT A;  2OPP A;  4E3S A;  4CGJ A;  1L3V A;  5JS1 A;  3V1Q A;  3VQD A;  1JXB A;  3NAE A;  4FJ8 A;  3KLE A;  3HJF A;  3AVN A;  3ZSO A;  3S3M A;  3RMB A;  2FC0 A;  1J53 A;  1HYZ A;  1ZBU A;  3B6O A;  3OS2 A;  1WAJ A;  3PY8 A;  4CF0 A;  3ZSZ A;  3E01 A;  4CGI A;  2NUB A;  3EY1 A; 
#chains in the Genus database with same CATH topology
 3BEX A;  1L3T A;  4HTL A;  4E89 A;  5ADX A;  3TTF A;  2Y1J A;  1RT1 A;  2NRZ A;  3C0B A;  1TK8 A;  1X9W A;  4DMN A;  5LY3 A;  4FJX A;  3DLE A;  3WQU A;  4LSN A;  4IEI A;  4CVN E;  1BA0 A;  4DTP A;  3AO5 A;  1QZ5 A;  1KAY A;  3EYZ A;  4GKK K;  1REV A;  1IJJ A;  2DFF A;  3QIN A;  4J2D A;  1BA1 A;  2ZQB A;  3TAP A;  3VQQ A;  1NU0 A;  3IUC A;  2W42 A;  2HNY A;  4CF2 A;  4CHN A;  3OYH A;  3QNN A;  1UA1 A;  4KI6 A;  1XQS C;  3OYF A;  3D2E A;  2OPS A;  1BQN A;  3F73 A;  1RFQ A;  3C95 A;  3TI0 A;  1RT7 A;  3D0P A;  1Q9X A;  4CJ3 A;  3ULE B;  3EE9 A;  2HHH K;  4DF4 A;  3AVC A;  4B3O A;  3OTO K;  4ILJ A;  2Z1I A;  3E9O A;  3VN5 A;  4FWL A;  3ZET A;  2HB5 A;  3V4I A;  4BGA A;  2ZWH A;  4I7F A;  2GTD A;  1SKR A;  5FPM A;  1YXQ A;  4IKF A;  4H0O A;  5EOY A;  3CJ7 A;  1YI2 N;  4QAG A;  5J1E A;  4X66 K;  4DLE A;  4X62 K;  3EKU A;  3EE8 A;  4K43 A;  1HKG A;  3HM9 A;  1B9D A;  3WXM B;  4M3X A;  3MEE A;  4DU1 A;  4DFP A;  1NWK A;  1WSF A;  1QQO A;  4KHW A;  2CGK A;  3VQ7 A;  3IKM A;  4CZM A;  3ATU A;  1NKE A;  3VA0 A;  1BCM A;  2E2O A;  1S1V A;  1TYQ A;  3V9S A;  1XI1 A;  3W0L A;  1RNH A;  1U49 A;  2UU9 K;  4M3Y A;  4CCH A;  4FJM A;  4JD2 B;  3DJC A;  2FXU A;  1N5Y A;  3AV9 A;  4B3R K;  2NRH A;  4KHN A;  4Z4F A;  4KTQ A;  3ZT4 A;  4DU3 A;  4WQ4 A;  4CZF A;  2D0C A;  3SJH A;  4K8X A;  4EIA A;  1KVC A;  3SV3 A;  3D2F B;  3GBT A;  3A5L C;  3NF7 A;  4IO8 A;  3QLH A;  4CES A;  3K5N A;  1XMQ K;  3SPY A;  3VQP A;  3D7E O;  3V1R A;  4FJ9 A;  4LFC K;  4MO4 A;  4KH4 A;  3JSM A;  1HRH A;  5LJW A;  1SL2 A;  4CJ4 A;  4KFB A;  4PKH A;  3TAF A;  4NLB A;  4AHU A;  1LWE A;  1YJN N;  3O9R A;  4KH5 A;  4R5P A;  4WCE L;  4LY7 A;  3DLH A;  3WNE A;  3PLA A;  1D4X A;  3SYZ A;  3SUP A;  2P9L B;  1NNE A;  3O4W A;  5M1F A;  4FLY A;  4X65 K;  1EO1 A;  1A5X A;  2WOM A;  2HHU A;  3V1O A;  4CJP A;  3RR8 A;  1IKV A;  4ZHR A;  3ZYY X;  4E7I A;  1A5W A;  2OZS A;  2VG5 A;  3HBT A;  4DR1 K;  5J2Q A;  4I6M A;  4JI4 K;  3HOT A;  4Q0B A;  1RTH A;  4DV6 K;  5C0Y A;  1EX4 A;  1LV5 A;  4CZI A;  1G15 A;  3MX5 A;  3L2R A;  2P51 A;  4O5F A;  3G6E N;  3KKR A;  1VQO N;  2V7Z A;  4FZX C;  1L3S A;  3NFA A;  1NK6 A;  2VGN A;  1X9M A;  1TUY A;  3I8D A;  3KD5 E;  2QK9 A;  1JJ2 M;  3O5B A;  5LMN K;  4B1U B;  4DTO A;  3HVR A;  2YJE A;  4DWI A;  4FLT A;  4QS8 A;  2I7P A;  2PBD A;  2UUC K;  4F9O A;  3CCV N;  3S41 A;  4MDB A;  1DTT A;  2P9P A;  5HRS A;  4FWM A;  1QTM A;  3ZLJ A;  5FRN A;  4DQS A;  3F2K A;  3NCI A;  4DTJ A;  2O8E B;  5E84 A;  2YJF A;  1MWK A;  1NK7 A;  5SZT A;  3A0I X;  3KK1 A;  1Q82 O;  4DR7 K;  2B6A A;  2CH6 A;  4I2P A;  5EVZ A;  4GVM A;  4J2A A;  3CFO A;  4ISE A;  4C8N A;  3SQ0 A;  4E7H A;  3WNF A;  1T6D A;  2OCE A;  3LDS A;  1IH7 A;  1S1U A;  3KWG A;  3MN9 A;  3H1Q A;  2VCP A;  3AO4 A;  2VGM A;  2DFH A;  4AQY K;  1HPZ A;  5DMR A;  4NB4 A;  1NMD A;  3ZCM A;  3SMP A;  3BY5 A;  3LAN A;  4JEP A;  4MDA A;  4M3R A;  4NLC A;  2P9N B;  3DYA A;  3OHR A;  4OLB A;  1GLL O;  4EFH A;  2GUP A;  3P4I A;  3CC4 N;  3LP0 A;  3CCQ N;  2UYT A;  3RMA A;  1HLU A;  4CF9 A;  1VQL N;  3CCU N;  2O8F B;  3L0Q A;  1HNX K;  1LWF A;  3LAK A;  1C6V A;  4NCG A;  3NMU A;  1WSH A;  5DK5 A;  1NK9 A;  3VF4 A;  2KLA A;  1RGI A;  1VSM A;  3DXK A;  4DTX A;  1FJG K;  2FSN A;  2HND A;  3EZ5 A;  4RTF D;  4Z4G A;  3DLB A;  2FBX A;  3RVC A;  3O3F A;  1UA0 A;  2FF3 B;  4FZZ A;  4FJI A;  3ZSY A;  4CJT A;  3KK7 A;  3O1W A;  1YVU A;  3OYN A;  3KD1 E;  3QEP A;  2P9I B;  1GOB A;  4EP4 A;  1LAV A;  4GMJ B;  5TKY A;  4JI3 K;  2DFE A;  4FJG A;  1NGH A;  3CQY A;  3JXU A;  4NYN A;  3RR7 A;  2D4W A;  4H4M A;  4RWT A;  2ETJ A;  3VQ4 A;  1A5V A;  5AQU A;  4BR0 A;  3MAQ A;  2O8D A;  2G8U A;  4DV3 K;  3CQ8 A;  2BGG A;  2HNZ A;  3SZ2 A;  1VQP N;  4DR3 K;  3HPG A;  3FZL A;  1LWC A;  4CGG A;  3CPE A;  3GOI A;  3VQ9 A;  1E4F T;  4IG0 A;  3MN7 A;  4DHY A;  5M1K A;  4K8Z A;  2D0B A;  4QOZ B;  4NXM K;  1RCH A;  4JKA A;  1OVY A;  3I0S A;  3NE6 A;  1KVA A;  4FYD A;  3HL8 A;  4IJA A;  1VQ6 N;  2Y1I A;  1TL3 A;  2F8T A;  4KHY A;  4I9L A;  2GUI A;  4CZH A;  3K58 A;  3O8M A;  3ALY A;  4WFA L;  4IWV A;  1IKX A;  4JI5 K;  4PL8 A;  4DTR A;  2VWB A;  2PYL A;  1YT3 A;  1TKD A;  1Q9Y A;  1Z26 A;  3RSE A;  1RBV A;  3LDO A;  3TAG A;  3ENB A;  3SLC A;  3ENH A;  1KC8 O;  4JKB A;  4CD3 A;  3S3O A;  1JXE A;  3VQ8 A;  2F7T A;  3THW B;  3I33 A;  4CJL A;  2P9U A;  4BRA A;  2OZM A;  3DI6 A;  5KGX A;  1VSK A;  1RBR A;  4WYB A;  2DTU A;  2JLE A;  3BP8 A;  4CEZ A;  1ZBL A;  2Q1N A;  3SUQ A;  3VA3 A;  3K5L A;  3VGM A;  3O4Q A;  5ADX H;  2HHQ A;  2IIR A;  3M8P A;  4YY3 K;  4PKG A;  5TKW A;  1OH6 A;  1BCO A;  1ZBF A;  5M1Q A;  4BRI A;  4HCC A;  3WEE B;  4YOX A;  3SMS A;  5KPZ A;  2A41 A;  4DFJ A;  4B9T A;  1BI4 B;  1RDD A;  2V7Y A;  3L3U A;  2RN2 A;  3VMF B;  5CR4 A;  1L3V A;  1YJW N;  1HKB A;  3AVN A;  3ZSO A;  5A2Q O;  1J53 A;  1HYZ A;  3OS2 A;  4CBX A;  4CF0 A;  2NRX A;  4EHT A;  5HLF A;  2E8A A;  3VEZ A;  2NUB A;  4CGI A;  2HW3 A;  1NGB A;  1LW2 A;  1RBS A;  1X9S A;  4KPY A;  3MXI A;  5AQP A;  2FLO A;  2QA4 N;  4KHU A;  1RT2 A;  3VES A;  1C0F A;  5D3G A;  3THY A;  1BL3 A;  2WTU A;  5HP1 A;  1IO2 A;  5CYM A;  3TSP A;  4CJU A;  1R59 O;  4MLH A;  4AHC A;  4FJ5 A;  3QEV A;  5F0X A;  1VSI A;  3OJU A;  3M3Z A;  1C0M A;  3ZSQ A;  2DY4 A;  1RDB A;  3ULE A;  4FW1 A;  4FWQ A;  3TPQ A;  1VQ5 N;  3ZSR A;  1JLC A;  5AQM A;  3EEQ A;  1RIL A;  2OA8 A;  3DRP A;  3H6E A;  1Q8I A;  4H0X B;  3FZM A;  5KQD A;  3DXM A;  4H8K A;  1ZBS A;  1B9F A;  1ZYQ A;  4AHR A;  4EAH D;  4IFV A;  3HTV A;  2E1Y A;  5BR8 K;  3E1Y A;  1XHX A;  2HHX A;  2WUS A;  3K59 A;  1U45 A;  1EWR A;  4B3T K;  4IO9 L;  1T44 A;  5AQJ A;  4DQI A;  2QEX N;  2RHK A;  2I5J A;  5GIN A;  1VQ7 N;  2QWL A;  1RDA A;  4E1M A;  2BUP A;  3H3O B;  2PZS A;  4AH9 A;  4CW7 B;  1ITG A;  4BR7 A;  4CFD A;  3CM6 A;  1O1W A;  4Z94 A;  4NYF A;  3VTH A;  1BWF O;  4M3U A;  1VQ9 N;  4EHU A;  4JD2 A;  4DTS A;  1FKO A;  5C15 A;  4BDY A;  3HRG A;  4K42 A;  2YI1 A;  3WQT A;  3FZH A;  4CIF A;  2OPR A;  1N32 K;  4JLH A;  1NGI A;  1HKC A;  4Q5V A;  3L6Q A;  3O6W A;  4F3T A;  5C10 A;  5GAH P;  1SS6 A;  3Q7B A;  1QZ6 A;  2NNW A;  2E2N A;  4DKW A;  1NGF A;  4B3S K;  2P9K A;  3KZB A;  5CY4 A;  4DSE A;  3LP3 A;  3BUZ B;  2DPN A;  2I7N A;  1KLN A;  4RW4 A;  1O13 A;  3KLI A;  3T3F A;  4A62 A;  3TSQ A;  4B1W B;  3LDP A;  3LP1 A;  3AO1 A;  3DLR A;  4IBN A;  4H0P A;  3A5N C;  3J80 O;  4OLA A;  3E66 A;  2F9T A;  3JS6 A;  2OYQ A;  4E0D A;  3W3D A;  4LF8 K;  4CHZ A;  3F5T A;  3ZEU B;  4HUF A;  3ZT3 A;  3A5O C;  4FJN A;  2G8K A;  1CLQ A;  2YV0 X;  2GEL A;  1GLJ O;  3CI5 A;  4BQL A;  3O9Q A;  4I9Q A;  4YHH K;  4DS5 A;  1NK0 A;  3O9T A;  5F2R A;  4A57 A;  3SNN A;  3CC7 N;  3SQ2 A;  1IKY A;  4FM1 A;  1ASV A;  3UIQ A;  3AA2 A;  1QSS A;  2VWJ A;  2AJQ A;  1GLC G;  3B6P A;  4FLW A;  4GW6 A;  5FRO A;  5C2F A;  2ZJQ L;  3CQX A;  1NJX A;  4IOX A;  4DB3 A;  4IDK A;  2A1R A;  5E41 A;  4XH4 A;  4DTN A;  4DQ8 A;  5BN9 A;  2FBV A;  3AVJ A;  5AQN A;  4BG8 A;  4CHP A;  1SL0 A;  4LFA K;  4CJW A;  1ATN A;  3H45 C;  2Q36 A;  3A5M C;  3DLK A;  1JCF A;  4BRD A;  4KTZ A;  1VK0 A;  4BDZ A;  1HNW K;  4K25 A;  4CEO A;  2ZGZ A;  1BIZ A;  2BDP A;  2O8C A;  2VG7 A;  1JL2 A;  1S9E A;  3TAR A;  2Q2R A;  3SI6 A;  1Q18 A;  4OKK A;  2A1S A;  3P39 A;  4B1V A;  4G1Q A;  1VQN N;  4GV3 A;  1KAX A;  1T8E A;  3WXI A;  4A59 A;  2O4I A;  2F8S A;  3KWI A;  1U2V B;  3AVG A;  5T7B A;  3DOL A;  4ISG A;  2EWS A;  1X1P A;  4ID1 A;  4O8K A;  3OYL A;  1C1B A;  1M1K O;  4TSX A;  1DGK N;  1UAX A;  4GV9 A;  2O8B B;  4F3O A;  3SK3 A;  4CZE A;  5FPD A;  2OPQ A;  1HQE A;  2KZZ A;  2XY8 A;  3HI0 A;  3P1G A;  4PA1 A;  4IXC A;  2P1J A;  4MLE A;  4QS9 A;  3UKU A;  4DQP A;  1NGG A;  2HHS A;  4GVE A;  3MCP A;  4AF1 A;  3V9X A;  3N4P A;  1R0A A;  3NGI A;  2GEM A;  2LSN A;  2O8F A;  4DLG A;  3VPZ A;  4BG9 A;  1U47 A;  5FDL A;  1NJI O;  3C6A A;  3IS9 A;  3OW2 M;  2BTF A;  5CYQ A;  5JVH L;  3SPZ A;  2QWQ A;  5CE3 A;  5AZJ B;  3OBW A;  1K6Y A;  4FJL A;  4O5B A;  3SUN A;  4BRQ A;  4LF6 K;  5K14 A;  2RF2 A;  4RW9 A;  2W41 A;  1JCG A;  4RG8 A;  1GLF O;  1TGO A;  3HPH A;  1F21 A;  3CCS N;  3NF6 A;  3OYA A;  2D1K A;  4K41 A;  3J7A P;  3ID8 A;  4XH5 A;  2WFB A;  4DSF A;  2Q31 A;  4E7L A;  4CK3 A;  1HX1 A;  1Z05 A;  3A8Y A;  4DV2 K;  3V9U A;  4O8U A;  4K0K K;  3MWT A;  4O44 A;  3QES A;  4DUZ K;  3KJV A;  2P9I A;  2HST A;  3OA9 A;  4E19 A;  2VQE K;  2UXD K;  2JWK A;  4JI2 K;  3C6H A;  3IG1 A;  3OJS A;  1FXX A;  1G99 A;  1BIS A;  5AQO A;  4JRP A;  3GDQ A;  2NLX A;  2UXC K;  4CGF A;  3LP2 A;  4WQ5 C;  3CJA A;  5M1N A;  2HHT A;  4Y1C A;  1T7P A;  1NK8 A;  4DV7 K;  3VQ5 A;  1YIJ N;  1FW6 A;  2FBY A;  3C6U A;  3SBG A;  4A2B A;  5C24 A;  5FLX O;  4JHD B;  2GWK A;  1XNQ K;  3TR8 A;  4B08 A;  3MN6 A;  1NGA A;  5J2M A;  1GLA G;  2D5R A;  3THX A;  4CIG A;  2ZJP L;  3FE1 A;  2F96 A;  4UQG A;  3LZJ A;  5EXW A;  2E2P A;  5DM6 L;  5BRE A;  3M8Q A;  1J6Z A;  3CCR N;  1NK4 A;  3V9Z A;  4DU4 A;  4M42 A;  1I94 K;  1SKS A;  4FLX A;  4FWS A;  2OTL N;  4CZJ A;  3DOK A;  4O55 A;  4R79 A;  1S5J A;  4RW8 A;  3CHW A;  4Z0U A;  3VET A;  4OGE A;  5AQY A;  4KAZ A;  3QB0 A;  3G4S N;  2YNH A;  3L2V A;  4U67 L;  4IG3 A;  3AA4 A;  4FJ7 A;  4CE9 A;  1HYS A;  2JWL A;  1KSP A;  3KTQ A;  1NM1 A;  1L5U A;  2E5L K;  2XHB A;  1RBT A;  4LH5 A;  5HRN A;  1DKG D;  5HOO A;  1YHQ N;  1XNR K;  1VQ8 N;  3QO9 A;  1J54 A;  1BOT O;  3QEI A;  1S1W A;  4HCB A;  4CEC A;  4CI6 A;  3OYJ A;  3CFP A;  1QSL A;  3THW A;  3C94 A;  3LPT A;  4ELT A;  3D2E B;  4MO5 A;  2CGL A;  4FVU A;  1ASW A;  4CJ7 A;  1NGC A;  4LF5 K;  2HF4 A;  4KRE A;  1NJZ A;  3UE5 A;  2W6K A;  3N4Q A;  2EX3 A;  4HWI A;  4BC3 A;  1KXP A;  2GX9 A;  4BVP A;  3PX4 A;  5CZ2 A;  2XY6 A;  4CEB A;  2E88 A;  3T7Z A;  4C8L A;  3VEO A;  1W2B M;  1V4T A;  3WEE A;  4JS5 A;  3AGR A;  1YTU A;  4A61 A;  3MXJ A;  2ZF5 O;  4DV5 K;  1IG8 A;  1WOQ A;  1BI4 A;  3AA5 X;  4KTW A;  3S3N A;  3SAG A;  4JK7 A;  4LF7 K;  3O9S A;  1GOC A;  5AQQ A;  4DR2 K;  2KTQ A;  1C1A A;  1SZ2 A;  4DSI A;  3MDQ A;  4DCH A;  3OYM A;  3H08 A;  3WT0 A;  3CD6 N;  4V19 S;  4E7J A;  3CC2 N;  3MN5 A;  1DLO A;  4FLV A;  2BAN A;  2ZM6 K;  2X6N A;  4FWR A;  4OO1 J;  4CHO A;  3NH0 A;  5BR9 A;  3HOS A;  1Z6R A;  3HM8 A;  4FL9 A;  1HQU A;  4E7K A;  2VQF K;  5KTQ A;  1NOY A;  1HNZ K;  4JI7 K;  4XEI A;  3V1Q A;  3VQD A;  1Q7Y O;  1K8K A;  1JXB A;  3VTI A;  3MCA B;  2FF6 A;  3FZF A;  2FC0 A;  5AZI B;  2AP1 A;  1U6Z A;  2HF3 A;  3E01 A;  3EY1 A;  2AA4 A;  3KK3 A;  2WBN A;  1K73 O;  3TAQ A;  4KRF A;  4F2R A;  4B9U A;  4M7Y A;  3AAR A;  2G8W A;  1YUW A;  4MQ3 A;  4OPH A;  1EQY A;  1WSE A;  2G8F A;  2Z1H A;  4B1Z A;  3G71 N;  1U04 A;  5BRH A;  1S72 N;  3OYE A;  3QFU A;  1JLA A;  4DR6 K;  4M45 A;  1KAZ A;  1T05 A;  2QWO A;  1WSJ A;  4FO0 A;  4IFE A;  5HBM A;  4W5Q A;  1BU6 O;  5AQV A;  4KHQ A;  3VER A;  1SV5 A;  3CJB A;  1DEJ A;  2HVI A;  4RCH A;  5JIC A;  1B92 A;  3QDK A;  3CYM A;  4H0V B;  5C2D A;  3MEC A;  1VSD A;  4IOA L;  3QFP A;  1TVR A;  3LL3 A;  3LM9 A;  1EP4 A;  1WLJ A;  2V52 B;  3SBT A;  1QQC A;  3O1B A;  1RT4 A;  4JK8 A;  1VSE A;  1NGE A;  4BAC A;  4FM2 A;  1U4B A;  4I6M B;  3RMC A;  1S9G A;  1LCU A;  1QVF M;  4KI4 A;  4CZK A;  4F8R A;  2WON A;  3JYT A;  3NBP A;  3OYD A;  4FWO A;  1M90 O;  1W9H A;  1KRP A;  3WXK A;  1YVN A;  1VSF A;  1C1C A;  4JI8 K;  4W5O A;  1IBM K;  4FJH A;  4W5N A;  3E9P A;  4LSL A;  4BR9 A;  1KD1 O;  1S22 A;  4QCL A;  4B8A B;  3MK6 A;  1S1X A;  3U8X A;  4C1N K;  3K2P A;  4ILG B;  1HJO A;  4KB1 A;  4PL7 A;  3VQC A;  4BRH A;  2Q0R A;  1IKW A;  2YCH A;  4IJN A;  4M41 A;  3JAM O;  3I56 N;  4FK0 A;  4CFC A;  4DR4 K;  1DTQ A;  1TKZ A;  2Q0U A;  3AGK A;  1QSY A;  3O9U A;  1Y97 A;  2D0O A;  4DUY K;  4DSK A;  4CZG A;  4AM6 A;  2P9P B;  1N6Q A;  4WQ5 A;  2XRI A;  3FFI A;  3HZ6 A;  3L3V A;  5AQS A;  3EL2 A;  2UXB K;  2X74 A;  3R3L A;  4BR4 A;  3THV A;  4OPA A;  3G10 A;  3SQ1 A;  1BQM A;  4FZY A;  1VAZ A;  3ZEU A;  4M3Z A;  3MWP A;  3P5J A;  2ASM A;  1TK0 A;  4CEE A;  4CHQ A;  4IDH A;  4CJV A;  2A42 A;  3M1F A;  3PO4 A;  4J2E A;  5M1P A;  5KPR A;  4BWJ A;  4PY5 A;  3TTD A;  3L2W A;  4OPJ A;  3P38 A;  4YOT A;  1XWL A;  2V51 B;  1NLV A;  4CJ5 A;  2XO7 A;  1TUU A;  2E2Q A;  4N41 A;  3QML A;  1XC9 A;  1P90 A;  4BE2 A;  1W0H A;  1N36 K;  3HO1 A;  1BG3 A;  4CER A;  4AIL C;  4GNI A;  4DV1 K;  5JLH A;  5GAE P;  3VQB A;  1BO5 O;  2IC3 A;  4DS4 A;  2HVH A;  1MA9 B;  3LDN A;  4BRN A;  4F2S A;  1VHX A;  1JCE A;  2NRT A;  1D8Y A;  3VOV A;  4CGH A;  5KQ8 A;  3L2U A;  1OH8 A;  2G8V A;  4PUO A;  1ESV A;  1RT6 A;  2YX6 A;  3VQ6 A;  5DM7 L;  4LC9 B;  4CEA A;  3D45 A;  2YHB A;  2P9S B;  4CEQ A;  4WQ4 C;  2ATQ A;  4X64 K;  4AHT A;  3LWL A;  4BDP A;  2KHO A;  4BY9 C;  2F9W A;  2E6M A;  3CMA N;  3B8A X;  3GL1 A;  3OYG A;  5KPT A;  5BRF A;  4CFA A;  2KQ2 A;  2B4J A;  3C7N B;  1MU2 A;  1U2V A;  1W97 L;  4WFN L;  1ILY A;  3NVK A;  2P5G A;  4UY8 O;  1VSJ A;  4AM7 A;  2VG6 A;  1WBD A;  3UB5 A;  1U48 A;  4N5S A;  3DLG A;  4OJR A;  1RDC A;  4BRO A;  3H46 O;  4C23 A;  4U7B A;  5JMV A;  2PY5 A;  5GIP A;  3QIC A;  5C25 A;  1BUP A;  3NGY A;  3CCL N;  1TKX A;  3O08 A;  4JKC A;  5KRT A;  3CG7 A;  4CJE A;  2CH5 A;  3UKR B;  2QWM A;  3M5R A;  4DSJ A;  4BRP A;  4BRG A;  4F4K A;  2HOE A;  2B5J A;  4L8R B;  4LFB K;  2O8D B;  4JYA K;  1IV0 A;  3QBX A;  3IMX A;  5BN8 A;  2QWP A;  2BE2 A;  3NF9 A;  1NBW A;  3G0Z A;  3AVI A;  3E9L A;  4A5B A;  3L2Q A;  4L3Q A;  3ITH A;  1HPM A;  4C8M A;  1SUQ A;  3SCX A;  4C1N I;  4FCY A;  1X3M A;  1C0T A;  3D2F A;  3ZT2 A;  4IZ9 A;  1DT9 A;  4OKJ A;  4O4G A;  3I0R A;  2J4R A;  4H5N A;  1JL1 A;  1UWB A;  3CF5 L;  2E20 A;  2RPI A;  1QS4 A;  3TAN A;  1WN7 A;  3PUF A;  1X9J A;  3TSU A;  3KK2 A;  4FSV A;  1KVB A;  3OS1 A;  3TAB A;  3U3G A;  5FPE A;  3NH1 A;  3GG4 A;  2P9L A;  3K5O A;  1SKW A;  3RSE B;  5HL7 L;  2FBT A;  2E6L A;  1HYV A;  3CJC A;  3M8S A;  4CHY A;  1VSH A;  3EO3 A;  4NCB A;  4N76 A;  4KKO A;  1J5O A;  4ZTF A;  5FPN A;  2W40 A;  2P9U B;  3Q7C A;  3PSI A;  5HRP A;  3H3N O;  4CK1 A;  1NK5 A;  3HK2 A;  2HHV A;  4OGC A;  1QQN A;  1NJW A;  4JHD A;  3U3Y A;  4Z4I A;  1LAW A;  1XUP O;  2ASP A;  3NH2 A;  1SQK A;  3MED A;  4H5R A;  3AY9 A;  4HUG A;  1LOT B;  3IRX A;  4B1X B;  4EZ6 A;  3AVK A;  1NKB A;  1S3X A;  4DF8 A;  1YTA A;  4BQZ A;  4B3M K;  1RBU A;  2YHX A;  5J2P A;  2X6S A;  1WAF A;  2NRV A;  3BF3 A;  3AVH A;  5I9E B;  3SJJ A;  4BC4 A;  4ZTJ A;  1RDU A;  2GBZ A;  1I3A A;  1HUX A;  5MLC Q;  2IOC A;  3AAP A;  3CJ9 A;  1T03 A;  2ZGY A;  4A5A A;  3CFR A;  3R8E A;  4BR2 A;  1S6Q A;  2IS3 A;  2O8E A;  3A2F A;  1X3N A;  3M8R A;  1EWQ A;  3HXM A;  3K0S A;  3THY B;  4ELU A;  1Q81 O;  3MEG A;  1JLE A;  4YOY A;  2A6A A;  4LD0 A;  4Z4H A;  3VF6 A;  1OVQ A;  5EY4 A;  3LDL A;  4W5R A;  1NGJ A;  4M3T A;  4YOU A;  4Z4E A;  5BPN A;  3WUH A;  4WF9 L;  2HMP A;  3RTV A;  3TTC A;  4J8F A;  4FLU A;  1NGD A;  4CJS A;  4JKG B;  2NRW A;  4CF1 A;  1BDG A;  2P9N A;  2XY5 A;  3DXM B;  2IAJ A;  2W6L A;  3QEW A;  3WNG A;  3PX6 A;  1BIU A;  3LAM A;  4CIE A;  3QET A;  4A2A A;  4JI0 K;  3VEX A;  3FR0 A;  4BC2 A;  1KTQ A;  3ASM A;  3BGR A;  1QHT A;  5B8H A;  2PAV A;  4FW2 A;  3VEN A;  1TL1 A;  4CJF A;  3CIP A;  3NVM A;  5I42 A;  1N8R O;  4PWD A;  4B9V A;  1RT3 A;  4QS7 A;  5GIO A;  4PKI A;  5E26 A;  3SAF A;  1VQ4 N;  4DTM A;  3K5M A;  5HRR A;  4IEE A;  3OYK A;  5I3U A;  4HHT A;  1D5A A;  1ZBI A;  2X78 A;  4JK9 A;  3CCJ N;  1FK9 A;  3DRR A;  4KO0 A;  4FOI A;  4XH1 A;  4ISF A;  1WNS A;  4H4O A;  4N47 A;  1WUA A;  1WSI A;  2HBM A;  3K9K A;  3CET A;  4DR5 K;  1E4G T;  2QXL A;  2QWN A;  3HST B;  1JKH A;  5AZI A;  4IOC L;  4CEF A;  3TAE A;  3VGK A;  4B9N A;  3CXC M;  3R9P A;  4NXN K;  4CED A;  4RW6 A;  4FK2 A;  4YOR A;  3VQE A;  4RW7 A;  1S6P A;  4KBO A;  4M63 C;  2YNG A;  2RKI A;  2HMI A;  3HVT A;  2OPP A;  4CGJ A;  2P9K B;  3NAE A;  3KLE A;  3HJF A;  3S3M A;  3FLC O;  3RMB A;  2NZT A;  1ZBU A;  3B6O A;  1WAJ A;  5GAD P;  4YOW A;  5H1S Q;  3ZSZ A;  3HP6 A;  1GOA A;  5GAG P;  1KFD A;  4YFU A;  3ZT1 A;  4H5W A;  5EU7 A;  3S9H A;  2YKN A;  3HYF A;  1HNV A;  4O0J A;  2Z1J A;  1YF5 L;  3J7Z O;  3QNO A;  1Z25 A;  3SV4 A;  3QER A;  2YHY A;  5ELZ A;  4DTU A;  4CK2 A;  4WE1 A;  4JKD A;  2FSJ A;  3C65 A;  1JLF A;  3FGU A;  5AQH A;  4B8C A;  5AQX A;  3L8B A;  2EHG A;  4JKE A;  4PQU A;  4DV0 K;  1QHA A;  3T19 A;  1BHL A;  2OAN A;  3KVG A;  1NOZ A;  3V9W A;  1IBL K;  4B9L A;  3C6T A;  3RRG A;  3BZC A;  2HHW A;  4E1J A;  2KFN A;  1KLM A;  3ID6 A;  3QBW A;  3HSC A;  1TK5 A;  1FKP A;  2ITG A;  4HUE A;  3DLL L;  3DAW A;  4AHV A;  3O3H A;  1L3U A;  1SL1 A;  3U9D A;  4IFY A;  4FJJ A;  1J5E K;  1RT5 A;  2QWR A;  2FSK A;  1CXU A;  4M3W A;  3L4Q A;  3PX0 A;  4Z4C A;  4DQQ A;  1NJY A;  3ZSX A;  1GLE G;  2O8C B;  2ZD1 A;  2VYP A;  1LW0 A;  3FZK A;  4CGD A;  3AO3 A;  3R6M A;  3V81 A;  1V4S A;  1VRU A;  1KFS A;  3ZET B;  3LPU A;  3U9Z A;  2UUA K;  2KFZ A;  3KLF A;  4FM0 A;  1ASU A;  3ZX3 A;  1CZB A;  2XY7 A;  3NGZ A;  2QW9 A;  1ATR A;  1ATS A;  3P31 A;  3F9K A;  4GY2 B;  1OKJ A;  4CJQ A;  3VF2 A;  1VQK N;  3FFK B;  2IGI A;  4E1N A;  2Z1G A;  5AQF A;  2JGU A;  5BRD A;  3VGL A;  3QEX A;  3AVA A;  2NRR A;  3H1V X;  5BPM A;  3NDK A;  3ZX0 A;  4FWP A;  4EZ9 A;  3R1X A;  4BE0 A;  1TYQ B;  2PYJ A;  4PHT X;  1CZA N;  4FOE A;  4BRF A;  4BR5 A;  1ZXO A;  3UKU B;  4KHS A;  4BE1 A;  3PO5 A;  3GE1 A;  5AJ3 K;  3VEY A;  5LL6 Z;  4JI1 K;  4EP5 A;  2P5O A;  3PV8 A;  3J81 O;  3KLG A;  3I8B A;  5AQW A;  1TKT A;  4AHS A;  4W5T A;  3ISN C;  3G25 A;  4OVL A;  4WFB L;  4B9S A;  4OX9 K;  1P8Z A;  3VQA A;  4XIU A;  3IAY A;  4NCA A;  4KH6 A;  2P9S A;  3D6R A;  3OS0 A;  5KRS A;  4FLZ A;  4B9M A;  1QQM A;  3AAQ A;  3DRS A;  4CBW A;  4J2B A;  3KLH A;  4FWK A;  3T1Y K;  4BGB A;  4ILH A;  3C7N A;  3WNH A;  1KQS M;  1E3M A;  1MDU B;  5M1O A;  3MX2 A;  1K8A O;  3AA3 A;  1T6C A;  1EXQ A;  5AQI A;  1CZ9 A;  4N56 A;  3O4N A;  1T3V A;  4MFB A;  1NMN A;  4LH4 A;  4BRE A;  1VQM N;  4JS4 A;  3ATV A;  2O4G A;  1XMO K;  4O0I A;  4C8K A;  4CFB A;  5LJV A;  1IBK K;  4LF9 K;  3LWM A;  1UOC A;  3AVM A;  3UKR A;  3OYC A;  4FWN A;  4JKH A;  4BWM A;  3IFR A;  4Y1D A;  5AQG A;  4C8O A;  5F1X A;  4YDU C;  3RRH A;  1ZBH A;  3THX B;  5KGW A;  1JLQ A;  3OYI A;  1ZC6 A;  2YNF A;  3T1A A;  2HBL A;  3CM5 A;  4DV4 K;  4FK4 A;  3CCM N;  2A40 A;  1QE1 A;  4H03 B;  4CF8 A;  1RTJ A;  2ZJR L;  1JLG A;  4H5T A;  5IT9 O;  4M7X A;  2F4V K;  3DWL A;  4BRC A;  4OPK A;  3HT3 A;  3VEV A;  5BPL A;  4FXD A;  4DG1 A;  3TWH A;  2YKM A;  3AO2 A;  3LZI A;  1OH7 A;  5JLF A;  4OKE A;  4KV8 A;  3CME N;  1C0G A;  2OTJ N;  3K9J A;  5AQT A;  3CPW M;  5JS2 A;  1Y64 A;  3L4I A;  2QM1 A;  4BRL A;  4G9Z A;  2YNI A;  5AQK A;  2VWK A;  2WC9 A;  4NO7 A;  4KB0 A;  5C12 A;  3AVL A;  3OYB A;  1OH5 A;  3LAL A;  2ITM A;  3WXJ A;  2BH1 A;  2KW4 A;  4ID5 A;  1RTD A;  2GWJ A;  3F9M A;  2Q97 A;  3PIP L;  4FVM A;  3EKS A;  1MWM A;  3J7Y P;  5LMU K;  5AFU H;  2QKB A;  1I39 A;  1YAG A;  4JAX A;  3CER A;  5C42 A;  2R7Y A;  2E4L A;  5IWA K;  4LF4 K;  4HVJ A;  2D0P A;  3QIO A;  3MMV A;  4CD1 A;  1YJ9 N;  5HRO A;  4H0T B;  4H5V A;  2QKK A;  4JNE A;  3SUO A;  3IDH A;  4BVO A;  3BZK A;  1HR0 K;  3RMD A;  2IVN A;  2IVO A;  4FJK A;  3U4L A;  1TAU A;  1IG9 A;  4Y0W A;  5AQL A;  2G8H A;  3LDQ A;  1H1V A;  4CBU A;  3PSF A;  4CJR A;  2YHW A;  4ELV A;  1KCF A;  2Q3S A;  3BDP A;  1JLB A;  3AVF A;  1GLB G;  4DFK A;  2KKZ A;  3RWU A;  2IDO A;  1RTI A;  3NF8 A;  1TV6 A;  2ASO A;  3EZW A;  3ZT0 A;  3CCE N;  5CZ1 A;  4YNQ A;  5SWM A;  3OBY A;  4JRQ A;  3T69 A;  3QIP A;  5AR0 A;  3NHG A;  1WB9 A;  2E1Z A;  2PFU A;  1VSL A;  3ZSW A;  1QVG M;  1HNI A;  3KIO A;  1VRT A;  3ZSV A;  4JI6 K;  3DXK B;  3VEW A;  1K8K B;  3V6D A;  2CGJ A;  3HP9 A;  4ICL A;  1SAZ A;  4DSL A;  1S1T A;  1YIT N;  3LM2 A;  3WXL A;  1HJR A;  4I2Q A;  5EX5 A;  4JN4 A;  4CJK A;  2RE2 A;  2QTD A;  1W7A A;  1GLD G;  4B1Y B;  4BRM A;  3ULD A;  2GV9 A;  1D9F A;  1N34 K;  2O8B A;  4JKF A;  4JKG A;  2H3G X;  3O3G A;  4B9Q A;  3DM2 A;  4GV6 A;  1WSG A;  4JV5 K;  3O80 A;  1C0U A;  3PIO L;  2D0A A;  1D9D A;  3OVN A;  3MXM A;  3J8A A;  2QXF A;  2A5X A;  2UUB K;  4KHP K;  1J9A A;  2IVP A;  4DFM A;  5AQR A;  3HPO A;  3M6G A;  3SAH A;  4HTU A;  1XHZ A;  4DQR A;  3BF1 A;  5CHI A;  5AZJ A;  4BRK A;  2KZM A;  3TAM A;  3KKS A;  2G8I A;  3T1H K;  1NKC A;  1EET A;  3EN9 A;  2A3Z A;  1HMV A;  4FPA A;  3KHY A;  4CZL A;  1NG9 A;  1CXQ A;  3ENO A;  3K57 A;  3ZX2 A;  1N33 K;  3U6F A;  3DMJ A;  2ZE2 A;  3OY9 A;  5FRM A;  3AVB A;  1RDW X;  5KI6 A;  4FPB A;  5JVG L;  2HBK A;  3TU5 A;  1TAQ A;  1Q86 O;  5AQZ A;  4GKJ K;  1WBB A;  3SQ4 A;  3P83 D;  3I55 N;  5J2N A;  1EKE A;  2QI2 A;  2YHA A;  4BC5 A;  4H0Y B;  2HBJ A;  1XC3 A;  3CJ1 A;  1K9M O;  5AFU A;  1BGX T;  4E3S A;  5JS1 A;  4FJ8 A;  4YOV A;  4YDU A;  3PY8 A; 
#chains in the Genus database with same CATH homology
 2HW3 A;  3HP6 A;  1L3T A;  3KK3 A;  1GOA A;  4E89 A;  1LW2 A;  3TAQ A;  4KRF A;  1KFD A;  1RBS A;  1X9S A;  4F2R A;  4B9U A;  2Y1J A;  4YFU A;  2G8W A;  1RT1 A;  4KPY A;  3ZT1 A;  3MXI A;  4MQ3 A;  5EU7 A;  4KHU A;  3S9H A;  1RT2 A;  1WSE A;  2YKN A;  1TK8 A;  2G8F A;  1X9W A;  4DMN A;  5D3G A;  4FJX A;  3HYF A;  1HNV A;  2Z1H A;  3DLE A;  1BL3 A;  4O0J A;  2Z1J A;  4LSN A;  5HP1 A;  1U04 A;  3OYE A;  3QNO A;  1Z25 A;  1IO2 A;  1JLA A;  5CYM A;  4M45 A;  3SV4 A;  4CJU A;  3QER A;  1T05 A;  4AHC A;  4FJ5 A;  1WSJ A;  4DTU A;  3QEV A;  1VSI A;  4CK2 A;  3OJU A;  4WE1 A;  5HBM A;  4W5Q A;  4DTP A;  3AO5 A;  4B8C A;  1JLF A;  3EYZ A;  4KHQ A;  1C0M A;  3L8B A;  2EHG A;  3ZSQ A;  1SV5 A;  2DY4 A;  1REV A;  2DFF A;  3QIN A;  1RDB A;  4J2D A;  4FW1 A;  4PQU A;  2HVI A;  1B92 A;  2ZQB A;  3CYM A;  3T19 A;  1BHL A;  3TAP A;  3ZSR A;  1JLC A;  3VQQ A;  1NOZ A;  3MEC A;  2W42 A;  1VSD A;  1RIL A;  2HNY A;  3DRP A;  2OA8 A;  1TVR A;  4CF2 A;  4CHN A;  3OYH A;  3V9W A;  1EP4 A;  1WLJ A;  3QNN A;  1UA1 A;  1Q8I A;  4B9L A;  1QQC A;  4H8K A;  3C6T A;  4KI6 A;  1B9F A;  1ZYQ A;  3OYF A;  1RT4 A;  4AHR A;  3RRG A;  1VSE A;  4IFV A;  2OPS A;  1BQN A;  3F73 A;  2HHW A;  4BAC A;  4FM2 A;  3C95 A;  1U4B A;  3TI0 A;  1RT7 A;  1KLM A;  3RMC A;  2KFN A;  3D0P A;  1Q9X A;  1S9G A;  1XHX A;  4CJ3 A;  2HHX A;  4KI4 A;  3K59 A;  4DF4 A;  1TK5 A;  1FKP A;  3AVC A;  2ITG A;  2WON A;  4HUE A;  1U45 A;  4F8R A;  2Z1I A;  3JYT A;  4B3O A;  4AHV A;  3NBP A;  3VN5 A;  3O3H A;  3OYD A;  1W9H A;  1SL1 A;  4IFY A;  1L3U A;  1KRP A;  4DQI A;  4FJJ A;  1VSF A;  2I5J A;  1C1C A;  2HB5 A;  4W5O A;  3V4I A;  1RT5 A;  4FJH A;  1RDA A;  4W5N A;  4I7F A;  1CXU A;  4E1M A;  4M3W A;  2PZS A;  1SKR A;  4LSL A;  4AH9 A;  3PX0 A;  4QCL A;  4IKF A;  4B8A B;  4Z4C A;  4DQQ A;  1ITG A;  1S1X A;  4CFD A;  3CM6 A;  4QAG A;  3ZSX A;  1NJY A;  1O1W A;  3K2P A;  5J1E A;  4NYF A;  2ZD1 A;  1LW0 A;  4M3U A;  4DLE A;  4KB1 A;  4CGD A;  3AO3 A;  3VQC A;  3V81 A;  1IKW A;  4M41 A;  1VRU A;  3HM9 A;  1B9D A;  4DTS A;  1KFS A;  1FKO A;  4FK0 A;  4CFC A;  1DTQ A;  3LPU A;  3MEE A;  4BDY A;  4M3X A;  1TKZ A;  4DU1 A;  4DFP A;  1WSF A;  4CIF A;  2KFZ A;  1QSY A;  3KLF A;  3VQ7 A;  2OPR A;  4FM0 A;  1Y97 A;  4KHW A;  1ASU A;  1CZB A;  4JLH A;  4DSK A;  1NKE A;  3VA0 A;  1BCM A;  4Q5V A;  1S1V A;  3V9S A;  2XY7 A;  1XI1 A;  4F3T A;  3NGZ A;  1N6Q A;  2XRI A;  1RNH A;  3FFI A;  1U49 A;  3F9K A;  4M3Y A;  4CCH A;  3L3V A;  4FJM A;  4CJQ A;  2IGI A;  4E1N A;  2X74 A;  2Z1G A;  1N5Y A;  3THV A;  2JGU A;  3G10 A;  5CY4 A;  1BQM A;  3SQ1 A;  4FZY A;  3AV9 A;  3QEX A;  4M3Z A;  3AVA A;  4KHN A;  4DSE A;  3LP3 A;  4KTQ A;  4Z4F A;  3ZT4 A;  3NDK A;  3P5J A;  4DU3 A;  2D0C A;  1TK0 A;  5HLF A;  1KLN A;  4CEE A;  4CHQ A;  4RW4 A;  4BE0 A;  1KVC A;  3KLI A;  3SV3 A;  3T3F A;  2PYJ A;  4EZ9 A;  4CJV A;  4K8X A;  3LP1 A;  3AO1 A;  3PO4 A;  3NF7 A;  3DLR A;  4IBN A;  3QLH A;  4CES A;  3K5N A;  4J2E A;  4KHS A;  4BE1 A;  4BWJ A;  4OLA A;  3PO5 A;  3SPY A;  4PY5 A;  3VQP A;  3V1R A;  3L2W A;  4FJ9 A;  4OPJ A;  2OYQ A;  4E0D A;  3JSM A;  4EP5 A;  1HRH A;  1XWL A;  4CHZ A;  2P5O A;  4CJ5 A;  2XO7 A;  3PV8 A;  4CJ4 A;  1SL2 A;  4KFB A;  4HUF A;  3ZT3 A;  3KLG A;  4N41 A;  3TAF A;  4AHU A;  1LWE A;  4FJN A;  2G8K A;  1TKT A;  2YV0 X;  4AHS A;  4LY7 A;  4R5P A;  4BE2 A;  1XC9 A;  3DLH A;  1CLQ A;  4I9Q A;  4W5T A;  1W0H A;  3ISN C;  4OVL A;  3WNE A;  4B9S A;  3HO1 A;  4CER A;  3SYZ A;  4AIL C;  4DS5 A;  3SUP A;  1NK0 A;  3VQA A;  4XIU A;  4FLY A;  3IAY A;  3SNN A;  4NCA A;  1A5X A;  2WOM A;  3VQB A;  3SQ2 A;  2HHU A;  3V1O A;  1IKY A;  2IC3 A;  3OS0 A;  4DS4 A;  5KRS A;  4FLZ A;  4B9M A;  4CJP A;  4FM1 A;  1ASV A;  3UIQ A;  2HVH A;  3AA2 A;  3RR8 A;  3DRS A;  5I3U A;  1QSS A;  3KLH A;  4J2B A;  2VWJ A;  2AJQ A;  1IKV A;  4ZHR A;  4F2S A;  4E7I A;  3B6P A;  1A5W A;  4FLW A;  4GW6 A;  5FRO A;  3WNH A;  1D8Y A;  2OZS A;  1NJX A;  4CGH A;  2VG5 A;  3L2U A;  3AA3 A;  4IDK A;  1EXQ A;  5J2Q A;  5E41 A;  2A1R A;  4DTN A;  2G8V A;  1CZ9 A;  4PUO A;  1RT6 A;  3VQ6 A;  4N56 A;  4Q0B A;  1RTH A;  3O4N A;  4CEA A;  3D45 A;  2FBV A;  2YHB A;  4MFB A;  3AVJ A;  4CHP A;  1SL0 A;  4LH4 A;  4CEQ A;  2ATQ A;  1EX4 A;  3LWL A;  4AHT A;  4CJW A;  4JS4 A;  1LV5 A;  2O4G A;  4BDP A;  1G15 A;  2E6M A;  3DLK A;  4O0I A;  2P51 A;  3L2R A;  4KTZ A;  1VK0 A;  4BDZ A;  4C8K A;  3OYG A;  4CFB A;  4CEO A;  3KKR A;  4CFA A;  1BIZ A;  2KQ2 A;  2B4J A;  3LWM A;  2BDP A;  4FZX C;  1UOC A;  3AVM A;  3NFA A;  1MU2 A;  3OYC A;  1NK6 A;  1L3S A;  2VG7 A;  1JL2 A;  4BWM A;  1X9M A;  1S9E A;  4Y1D A;  2P5G A;  1VSJ A;  3I8D A;  3TAR A;  3KD5 E;  2VG6 A;  2QK9 A;  3SI6 A;  4C8O A;  1U48 A;  4N5S A;  4OKK A;  2A1S A;  3DLG A;  4OJR A;  1RDC A;  4DTO A;  4G1Q A;  3HVR A;  3RRH A;  1ZBH A;  5KGW A;  1JLQ A;  4FLT A;  3OYI A;  4DWI A;  2YNF A;  3T1A A;  2PY5 A;  5C25 A;  1T8E A;  3CM5 A;  4FK4 A;  3NGY A;  1QE1 A;  1TKX A;  4CF8 A;  1RTJ A;  5KRT A;  2O4I A;  1JLG A;  3CG7 A;  1DTT A;  4CJE A;  5HRS A;  2F8S A;  1QTM A;  4DSJ A;  5FRN A;  3AVG A;  4DQS A;  3NCI A;  4DTJ A;  4F4K A;  2B5J A;  4L8R B;  5T7B A;  4OPK A;  3DOL A;  3HT3 A;  1NK7 A;  1X1P A;  5SZT A;  4FXD A;  4DG1 A;  4ID1 A;  2YKM A;  3AO2 A;  3OYL A;  3KK1 A;  3LZI A;  3TWH A;  1C1B A;  2B6A A;  4TSX A;  2BE2 A;  4I2P A;  4GVM A;  1UAX A;  3NF9 A;  4KV8 A;  3CFO A;  4OKE A;  4J2A A;  5FRM A;  3G0Z A;  4C8N A;  3AVI A;  4F3O A;  3SQ0 A;  3L2Q A;  4E7H A;  3WNF A;  2OPQ A;  5JS2 A;  3ITH A;  4C8M A;  1HQE A;  2KZZ A;  1SUQ A;  3SCX A;  4FCY A;  1C0T A;  2YNI A;  3LDS A;  2XY8 A;  2VWK A;  3ZT2 A;  1IH7 A;  1S1U A;  3P1G A;  4OKJ A;  4O4G A;  4PA1 A;  4KB0 A;  3I0R A;  2P1J A;  4DQP A;  3AO4 A;  3AVL A;  3OYB A;  2DFH A;  2HHS A;  1JL1 A;  1HPZ A;  1UWB A;  3LAL A;  5DMR A;  3V9X A;  2RPI A;  1R0A A;  2KW4 A;  4ID5 A;  1QS4 A;  2LSN A;  3ZCM A;  3NGI A;  3TAN A;  1RTD A;  4FVM A;  1WN7 A;  3PUF A;  4DLG A;  3LAN A;  1U47 A;  5FDL A;  4M3R A;  2QKB A;  1I39 A;  2R7Y A;  3KK2 A;  5C42 A;  3IS9 A;  1KVB A;  2E4L A;  3DYA A;  3OS1 A;  4HVJ A;  3QIO A;  3TAB A;  4OLB A;  3U3G A;  5HRO A;  3NH1 A;  2QKK A;  5CYQ A;  3SPZ A;  3SUO A;  1K6Y A;  3LP0 A;  4FJL A;  3K5O A;  4O5B A;  1SKW A;  3SUN A;  3RMD A;  4FJK A;  5K14 A;  1TAU A;  2RF2 A;  4RW9 A;  1IG9 A;  3RMA A;  2FBT A;  2E6L A;  4RG8 A;  4CF9 A;  2G8H A;  1HYV A;  1TGO A;  3HPH A;  4CHY A;  4CJR A;  1F21 A;  3M8S A;  4ELV A;  1KCF A;  1VSH A;  1LWF A;  2Q3S A;  4NCB A;  3NF6 A;  3OYA A;  4KKO A;  1J5O A;  3BDP A;  4N76 A;  1JLB A;  3AVF A;  3LAK A;  4ZTF A;  1C6V A;  4DSF A;  5HRP A;  4NCG A;  4E7L A;  4CK3 A;  4DFK A;  3V9U A;  4CK1 A;  1WSH A;  5DK5 A;  1NK5 A;  4O44 A;  3HK2 A;  2HHV A;  3QES A;  4OGC A;  2IDO A;  3KJV A;  1NK9 A;  3RWU A;  1RTI A;  1VSM A;  4E19 A;  4DTX A;  3NF8 A;  1NJW A;  1TV6 A;  2HND A;  3EZ5 A;  4Z4G A;  3IG1 A;  3U3Y A;  2FBX A;  3OJS A;  3ZT0 A;  3O3F A;  1LAW A;  1UA0 A;  3DLB A;  5CZ1 A;  4Z4I A;  4YNQ A;  1FXX A;  5SWM A;  3NH2 A;  4FZZ A;  4JRQ A;  1BIS A;  3MED A;  4JRP A;  4HUG A;  3IRX A;  3QIP A;  3NHG A;  4EZ6 A;  3AVK A;  4FJI A;  3ZSY A;  4CJT A;  1NKB A;  4CGF A;  3LP2 A;  4DF8 A;  2HHT A;  4Y1C A;  1YTA A;  1T7P A;  1NK8 A;  1RBU A;  1VSL A;  3ZSW A;  1YVU A;  3VQ5 A;  1HNI A;  3OYN A;  3KD1 E;  3QEP A;  3KIO A;  1VRT A;  3ZSV A;  2FBY A;  3C6U A;  5J2P A;  2X6S A;  1WAF A;  3AVH A;  1GOB A;  1LAV A;  5C24 A;  4GMJ B;  4EP4 A;  3SJJ A;  4ZTJ A;  3TR8 A;  4B08 A;  2GBZ A;  5J2M A;  2DFE A;  4FJG A;  1I3A A;  2D5R A;  3V6D A;  2IOC A;  3HP9 A;  4CIG A;  4NYN A;  4ICL A;  2F96 A;  4UQG A;  1T03 A;  3RR7 A;  3LZJ A;  4H4M A;  4DSL A;  3M8Q A;  3CFR A;  1S1T A;  2ETJ A;  1NK4 A;  1HJR A;  3VQ4 A;  4I2Q A;  3V9Z A;  4DU4 A;  1A5V A;  1S6Q A;  2IS3 A;  4M42 A;  1SKS A;  4FLX A;  4CJK A;  3MAQ A;  3A2F A;  2G8U A;  3M8R A;  3DOK A;  3HXM A;  4O55 A;  3CQ8 A;  4ELU A;  1S5J A;  3MEG A;  2BGG A;  4RW8 A;  1JLE A;  4Z0U A;  3ULD A;  2GV9 A;  4OGE A;  1D9F A;  4KAZ A;  2HNZ A;  3SZ2 A;  2YNH A;  4LD0 A;  3HPG A;  3O3G A;  1LWC A;  3DM2 A;  4CGG A;  3L2V A;  4IG3 A;  4Z4H A;  3AA4 A;  3VQ9 A;  4FJ7 A;  1WSG A;  4IG0 A;  4CE9 A;  1HYS A;  1C0U A;  4W5R A;  4M3T A;  4K8Z A;  1KSP A;  4Z4E A;  2D0A A;  2D0B A;  1D9D A;  3OVN A;  4QOZ B;  3KTQ A;  1RCH A;  1L5U A;  3MXM A;  3I0S A;  3NE6 A;  1KVA A;  2XHB A;  1RBT A;  4LH5 A;  4FYD A;  3HL8 A;  5HRN A;  2Y1I A;  1TL3 A;  2QXF A;  2F8T A;  3RTV A;  1J9A A;  4KHY A;  3QO9 A;  1J54 A;  4I9L A;  3QEI A;  1S1W A;  4FLU A;  4DFM A;  4CEC A;  4CJS A;  4HCB A;  2GUI A;  3OYJ A;  4CF1 A;  3HPO A;  3CFP A;  1QSL A;  3C94 A;  3K58 A;  2XY5 A;  2IAJ A;  3ALY A;  3QEW A;  3LPT A;  1IKX A;  3WNG A;  4ELT A;  3PX6 A;  4HTU A;  1BIU A;  3LAM A;  1ASW A;  1XHZ A;  4CIE A;  4DQR A;  3QET A;  4DTR A;  2PYL A;  4KRE A;  1YT3 A;  1NJZ A;  2KZM A;  3TAM A;  1TKD A;  1Q9Y A;  1KTQ A;  2EX3 A;  1Z26 A;  3ASM A;  1RBV A;  3KKS A;  3TAG A;  2G8I A;  3BGR A;  1QHT A;  1NKC A;  4FW2 A;  1EET A;  1TL1 A;  3PX4 A;  4CJF A;  5CZ2 A;  2XY6 A;  4CEB A;  5I42 A;  4C8L A;  4PWD A;  4B9V A;  1HMV A;  3S3O A;  1RT3 A;  1JXE A;  3VQ8 A;  1CXQ A;  4CJL A;  3K57 A;  4JS5 A;  1YTU A;  2OZM A;  3DI6 A;  5KGX A;  4DTM A;  1VSK A;  1RBR A;  3K5M A;  3MXJ A;  2DTU A;  3U6F A;  2JLE A;  5HRR A;  3OYK A;  3DMJ A;  2ZE2 A;  1BI4 A;  3AA5 X;  4KTW A;  4CEZ A;  3AVB A;  5KI6 A;  3OY9 A;  1D5A A;  4HHT A;  1ZBL A;  3S3N A;  2X78 A;  1ZBI A;  3SUQ A;  1FK9 A;  3DRR A;  4KO0 A;  3VA3 A;  3K5L A;  3O4Q A;  1GOC A;  1TAQ A;  1WNS A;  4H4O A;  4N47 A;  2KTQ A;  1WSI A;  2HHQ A;  3M8P A;  1C1A A;  4DSI A;  3HST B;  1JKH A;  1BCO A;  3OYM A;  3SQ4 A;  1ZBF A;  4CEF A;  3TAE A;  3H08 A;  3P83 D;  4E7J A;  4HCC A;  5J2N A;  4B9N A;  4DFJ A;  4B9T A;  1EKE A;  4CED A;  2YHA A;  4RW6 A;  1BI4 B;  4FK2 A;  1RDD A;  1DLO A;  4FLV A;  2BAN A;  2X6N A;  3VQE A;  3L3U A;  4RW7 A;  4CHO A;  3NH0 A;  1S6P A;  2RN2 A;  1HQU A;  4E7K A;  2YNG A;  2RKI A;  5KTQ A;  1NOY A;  2HMI A;  1BGX T;  3HVT A;  2OPP A;  4E3S A;  4CGJ A;  1L3V A;  5JS1 A;  3V1Q A;  3VQD A;  1JXB A;  3NAE A;  4FJ8 A;  3KLE A;  3HJF A;  3AVN A;  3ZSO A;  3S3M A;  3RMB A;  2FC0 A;  1J53 A;  1HYZ A;  1ZBU A;  3B6O A;  3OS2 A;  1WAJ A;  3PY8 A;  4CF0 A;  3ZSZ A;  3E01 A;  4CGI A;  2NUB A;  3EY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...