3HYFA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
143
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/RNaseH
publication title RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
total genus 46
structure length 143
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hyfA00
1ITGA 1W0HA 3NE6A 4CF1A 5KI6A 4HUEA 3ULDA 3SPZA 4L8RB 3HP6A 1GOCA 4ZHRA 4O4GA 1C0MA 4RW9A 3K5NA 3SV3A 1NJYA 1KLNA 3V1RA 3O3HA 1NK8A 1UOCA 4CFCA 2DFHA 5C25A 2G8UA 2HHVA 3PX0A 3PUFA 3DOLA 2P1JA 4FJGA 1A5WA 2FBXA 2ZD1A 1VRUA 3OS0A 1SKSA 1VSFA 5D3GA 3K2PA 4Q0BA 3V1OA 1LV5A 2G8HA 4CK1A 4DU1A 1NK7A 1RBVA 1JLBA 4HCCA 4KI6A 1RDCA 1CLQA 1HQUA 3B6PA 3CFOA 3MEEA 4B9TA 4E7KA 4GVMA 3QESA 3NH2A 3SJJA 4DTPA 2IOCA 4KV8A 4DTSA 3HSTB 1KVAA 1ZBFA 4BE2A 4EZ6A 1T7PA 3SZ2A 1KVBA 1WSEA 3VQBA 3HO1A 3EZ5A 4DTUA 1HYSA 1U04A 2XY7A 2PYLA 1TL1A 3AVCA 2BE2A 3AV9A 4CERA 3O3FA 3KLEA 3EYZA 1S5JA 3DMJA 3M8RA 4I9LA 3HT3A 4HTUA 2X78A 4FLXA 1RT3A 1KSPA 3OYHA 3NGZA 4FJ7A 4KHQA 3HXMA 4Z4FA 3RMCA 3U3YA 4OKKA 4JS4A 3V1QA 3WNEA 1BQMA 5CYQA 2BGGA 3DRPA 5J2MA 1O1WA 3LALA 3OYMA 4DSIA 5E41A 4BDYA 1NJWA 1NKEA 1KRPA 3ASMA 1IKYA 4O55A 2YKNA 4KPYA 3ZSYA 3AVMA 3CFPA 3FFIA 4FLTA 4DSFA 5J1EA 3ZSZA 4FLZA 2HHUA 4CEQA 4CJRA 1LAWA 4E7LA 3LANA 3QINA 4ID1A 1ZBUA 4Y1DA 4Y1CA 4KREA 4CK3A 3SNNA 4BACA 3SUNA 5HROA 5EU7A 1KFDA 3G0ZA 1SV5A 4W5QA 2G8IA 4AILC 3M8SA 1RILA 5J2QA 2EHGA 2YNHA 4JLHA 4NYNA 1L3UA 1CXUA 3NH0A 2OPRA 3MECA 2Z1IA 3NF6A 3OYNA 1I39A 5JS1A 1S1TA 2P51A 4N56A 4NYFA 1ZYQA 2JGUA 4DQSA 1X9MA 2OPQA 4DTRA 2E6MA 2DFFA 3BGRA 4K8ZA 4CEBA 3NF9A 1QQCA 5T7BA 2HHWA 4JRQA 1NOZA 1NJXA 1NK6A 3OYKA 1WNSA 3ZSRA 1VRTA 4FJ5A 1TK8A 4FZYA 1J9AA 2AJQA 2OA8A 4CEEA 1EXQA 2B5JA 3AO1A 3OJUA 3RRHA 4FJJA 2YNGA 1IO2A 1HMVA 3C6UA 4NCBA 4FZZA 5FRNA 2VWKA 3NH1A 3OYAA 2KTQA 1DTQA 2LSNA 3TAFA 1TL3A 2D0BA 3QO9A 4OJRA 4M3XA 3S3MA 4FJKA 1WAJA 1VSLA 4EP5A 3NFAA 1YVUA 3NF7A 4KO0A 4CHQA 2WONA 4CJVA 3O4QA 5J2NA 4M3WA 3LZJA 3WNHA 3SYZA 1ZBLA 4BWJA 4DS4A 4O0JA 4C8KA 4CJ4A 1RTHA 1BHLA 4CJ5A 3QEXA 2YHBA 1U49A 3ZSWA 4E3SA 3MXMA 4ELTA 4FJLA 1VSHA 1WAFA 4CIEA 2PYJA 4C8MA 4DFMA 4CFAA 1RT2A 1U45A 2OPPA 4RW8A 3T3FA 3ZT4A 3EY1A 3AVJA 1BCMA 1K6YA 4DFKA 3RMAA 4FCYA 4CJFA 4KHSA 1RBTA 4B08A 4C8LA 3QEVA 4FXDA 1IG9A 3RMBA 1WSHA 1RT7A 3PX4A 1HNVA 3VA3A 2GBZA 2Y1JA 2GUIA 1FK9A 1UA0A 4KAZA 3LP2A 4CESA 1RCHA 3S3NA 5HRPA 3KD5E 1Q9YA 3VQ4A 3PX6A 1WLJA 1LWCA 4N47A 4CFDA 4FJNA 3LDSA 3ZT2A 4DTJA 4WE1A 4CJSA 4E7JA 2E4LA 4DS5A 1RTIA 1HJRA 3QETA 2KZMA 2HNZA 4B9NA 1VSJA 1XWLA 1NK9A 2P5GA 4E19A 1L3SA 1TAUA 1Z25A 1S6QA 2YV0X 4YNQA 3TABA 3QEIA 1XI1A 1WSIA 1U4BA 1JLGA 1HYZA 4DU4A 1FXXA 4FW1A 4M42A 4BE0A 3AA3A 3V9UA 3TARA 4CF9A 2YHAA 1RTDA 4KTQA 3KLHA 3OYEA 4Z4EA 1RT5A 4IBNA 3LWLA 4DFJA 1JLEA 4CJLA 1S1UA 2VG7A 4W5RA 2OZSA 4B9LA 1YTUA 4B9MA 2RPIA 2ATQA 2I5JA 4CJTA 1VK0A 5KRTA 3VQ6A 1C6VA 3DYAA 3L2UA 3VQEA 4CEAA 4CJ3A 4H8KA 3I0RA 3HPGA 4HUFA 3SQ2A 1XHXA 2HHTA 1BI4B 3ZT3A 3AO4A 1RT4A 1Z26A 1JKHA 3LPUA 1QS4A 1VSDA 5CZ2A 3TAGA 3NAEA 3PV8A 3NBPA 1SL1A 4E7IA 4JS5A 5CY4A 3DOKA 3MXJA 4Z4CA 2F96A 1NJZA 2G8KA 1UAXA 3AO2A 3AA5X 1GOAA 3D45A 4CF0A 1QSLA 3ZSXA 3OS2A 3HYFA 4CGGA 3SI6A 4B3OA 2VG5A 2GV9A 3DRSA 4E1MA 4CHYA 3DLEA 3QIPA 3OYIA 3NCIA 1EETA 1L5UA 4O5BA 4RW7A 3PO5A 3C6TA 3I0SA 3AA2A 3LWMA 1S1VA 3KLIA 4IG0A 1MU2A 2HNYA 4QCLA 2WOMA 3ZT0A 2IAJA 5KRSA 3BDPA 1NOYA 3T19A 4AHTA 1TAQA 3P5JA 4LH4A 1A5VA 4CHZA 2YNFA 3VQDA 4KTWA 1C0UA 4CGFA 2R7YA 2HVIA 3HL8A 2XO7A 4FJXA 4K8XA 2QKBA 4I2PA 3AVNA 4LSNA 4MFBA 4J2EA 3JYTA 3OYBA 4PUOA 2NUBA 4RW4A 2D5RA 3H08A 4W5OA 1TKDA 1L3TA 4HVJA 4CECA 2PY5A 4LD0A 3ZSQA 2RF2A 2XHBA 3SQ0A 3F9KA 2D0CA 3ALYA 4W5TA 2HVHA 3OYFA 5JS2A 4J2DA 1TVRA 1KCFA 4Z0UA 4KFBA 4CHPA 2D0AA 3VQAA 1RTJA 3TAPA 3VQ5A 2IDOA 3OYDA 1KVCA 2KQ2A 3OYCA 3O3GA 4FM1A 4DTNA 2YNIA 1ASVA 4CIGA 1HPZA 4HUGA 1UA1A 2IGIA 1VSKA 1EKEA 2FC0A 2Z1GA 3ZSVA 4CF2A 1XHZA 1J5OA 2F8SA 1N6QA 3MXIA 1ASWA 5CYMA 4E7HA 3KD1E 2ZQBA 3VQCA 4DLGA 4FLUA 2DY4A 1WSGA 4DTXA 4ELUA 2HHSA 4KKOA 3OYLA 1HNIA 2X6SA 1S6PA 3AVKA 4CJUA 4Z4HA 4ZTFA 2G8VA 3KIOA 4F3OA 1BI4A 4FM0A 2QXFA 3V4IA 3UIQA 4QOZB 2EX3A 3U6FA 4LH5A 1RDDA 3M8QA 4BE1A 1VSMA 4F2SA 1GOBA 4F8RA 5FRMA 3P83D 4MQ3A 4KI4A 4FJHA 3CM5A 2RKIA 2HHQA 1NKCA 4AHCA 1A5XA 4RW6A 1Q9XA 3OYJA 3M8PA 2PZSA 4DTOA 3F73A 3TAQA 1U48A 3KK2A 4F3TA 4I9QA 3OVNA 3AVGA 3K58A 3V9WA 5FROA 1RT1A 2OPSA 2IC3A 4DQQA 4DFPA 5HRNA 1TK0A 4IG3A 3AVHA 3SCXA 4B9SA 2FBYA 4OVLA 1X1PA 4DU3A 5HRRA 1YTAA 4DMNA 4HCBA 4N5SA 3SPYA 2HMIA 4KB0A 1ZBHA 3L2VA 3P1GA 1RBRA 1G15A 4CGDA 3KLGA 4FLYA 2BDPA 1BIUA 1L3VA 3TAEA 3DRRA 3QEPA 4AHSA 2A1RA 2XY6A 3LP0A 1R0AA 1T8EA 1ZBIA 1C1AA 2O4GA 5SZTA 4G1QA 4B8CA 1TKXA 3K5OA 1WSJA 1LWEA 1S9GA 3CM6A 3LAKA 3SUQA 2KFNA 1IKXA 1RBSA 4R5PA 4H4OA 4GW6A 3VA0A 4E0DA 3AO3A 4FK4A 5I42A 4CEDA 2FBVA 2HNDA 3LAMA 2FBTA 4DSJA 4DLEA 3HM9A 1BGXT 4FJMA 4DSEA 4YFUA 1JLQA 3K59A 3SUPA 2OYQA 3QNOA 4DSKA 2Q3SA 4ICLA 4OLBA 3V9SA 4IFYA 2ITGA 1J54A 3K5MA 3QEWA 1BCOA 3E01A 1BIZA 2B4JA 4DQRA 4CJKA 3TAMA 1FKPA 3IG1A 3LZIA 4E1NA 3HPOA 2RN2A 3DLHA 4M3TA 2XRIA 4F2RA 3OY9A 4NCAA 5KGXA 4O0IA 2KZZA 4CJPA 2HB5A 4ELVA 3AVAA 2VG6A 4Q5VA 3U3GA 1Y97A 4M41A 3SUOA 4IDKA 3RR7A 1SL2A 4C8NA 4XIUA 3RWUA 4FK2A 3NGYA 4PY5A 3HP9A 3CFRA 1ASUA 5HBMA 1JXEA 4FW2A 1LW2A 1W9HA 4CGHA 1LWFA 4CEZA 1HQEA 4CCHA 3HVTA 2B6AA 3RRGA 5DK5A 3IS9A 1NK5A 3IAYA 1UWBA 1LW0A 1EP4A 4OKEA 1RT6A 3CQ8A 4GMJB 3NDKA 3HVRA 5J2PA 1SKWA 4KHNA 4M3YA 4BDZA 1QE1A 1X9WA 3T1AA 4CGIA 3LPTA 1SKRA 3L2RA 2BANA 4E89A 1IH7A 4CK2A 1REVA 4NCGA 3VN5A 1YT3A 1I3AA 2O4IA 4F4KA 3V9ZA 4I2QA 4CJQA 3V9XA 4N41A 3ZCMA 3QLHA 4FLWA 5HRSA 1XC9A 4OGCA 1CZ9A 4PWDA 1RNHA 1WN7A 4OGEA 4FYDA 2ETJA 4TSXA 1RBUA 4FJIA 3LP3A 4CEOA 2X6NA 3PY8A 4KHWA 4M3ZA 5KGWA 4FLVA 4FM2A 1KLMA 4N76A 3VQ9A 1TK5A 3DLBA 3AVBA 3V81A 1SUQA 3L2WA 3OS1A 4BWMA 2VWJA 5K14A 1B92A 4CJEA 5KTQA 1LAVA 5CZ1A 3IRXA 4RG8A 1KFSA 4CHNA 4CHOA 4JRPA 1Q8IA 2JLEA 3RR8A 2P5OA 4CGJA 4KHUA 2F8TA 4B9UA 3VQ7A 2HW3A 1IKWA 3VQ8A 1TGOA 3QERA 1SL0A 1D8YA 1NKBA 2QKKA 3S3OA 4J2AA 4LY7A 5FDLA 4O44A 1EX4A 3AVIA 4OKJA 4ZTJA 1DLOA 4J2BA 1T05A 3HK2A 1QHTA 2W42A 1BQNA 4FJ9A 4I7FA 3AVLA 4DG1A 4KTZA 1RDBA 3B6OA 2G8FA 1TV6A 3K57A 2DFEA 1C0TA 3L3UA 3MAQA 1T03A 3OJSA 1U47A 1KTQA 1WSFA 3NGIA 4Z4IA 2IS3A 3QNNA 3QIOA 1NK0A 3KTQA 3KKRA 4DSLA 3TI0A 3SV4A 4DQPA 4B8AB 1F21A 4AHUA 3DM2A 1C1BA 4M45A 2XY8A 3G10A 3MEGA 1CXQA 1IKVA 4IFVA 5SWMA 3KLFA 3DLKA 3TWHA 4DQIA 1S1XA 4KHYA 3ITHA 5C24A 3HJFA 4EZ9A 5I3UA 2QK9A 3S9HA 2ZE2A 4OPKA 3KJVA 4KB1A 3L3VA 3CYMA 3WNFA 4CEFA 3THVA 4H4MA 4CE9A 3ZSOA 4DF8A 1QSYA 2OZMA 4FZXC 1D5AA 2Z1JA 4C8OA 2KFZA 3C95A 3DI6A 1CZBA 1VSEA 3C94A 4CFBA 4QAGA 5HP1A 4PA1A 4M3UA 3DLGA 3TANA 3ZT1A 3AO5A 2G8WA 2KW4A 3KK1A 1B9FA 1JL1A 3CG7A 4Z4GA 1JL2A 4DF4A 4CF8A 4CIFA 2DTUA 3RTVA 3TR8A 4HHTA 4B9VA 5C42A 4OPJA 1DTTA 3NF8A 3A2FA 3AA4A 3NHGA 3K5LA 4DWIA 1C1CA 3MEDA 4EP4A 2X74A 1BISA 1TKTA 4AHRA 3KK3A 4FVMA 3RMDA 3HPHA 1QSSA 4PQUA 3I8DA 3JSMA 2Y1IA 3OYGA 3V6DA 3O4NA 4M3RA 4AH9A 1QTMA 1HRHA 1FKOA 5DMRA 1VSIA 4OLAA 4FJ8A 4UQGA 3AVFA 3KKSA 4CJWA 1TKZA 4BDPA 1HYVA 4DTMA 4W5NA 1JLAA 4IKFA 2HHXA 1JXBA 1B9DA 3VQPA 5HLFA 4FK0A 2XY5A 1J53A 3SQ4A 4KRFA 1BL3A 4AHVA 1N5YA 3L2QA 1JLCA 3L8BA 1X9SA 1JLFA 3WNGA 3D0PA 4LSLA 1D9FA 3SQ1A 3LP1A 1S9EA 1NK4A 2E6LA 4ID5A 2Z1HA 1S1WA 3DLRA 1RDAA 3VQQA 3PO4A 2YKMA 1D9DA 3ISNC 2A1SA
chains in the Genus database with same CATH superfamily
3ULDA 3SPZA 4L8RB 3HP6A 4O4GA 3E66A 3K5NA 4NB4A 3V1RA 2YHYA 3DOLA 3NMUA 1A5WA 4EHUA 1VQMN 3CCSN 3V1OA 2IVOA 3VPZA 4KI6A 1VQON 1RDCA 3B6PA 3ZEUB 3CFOA 3MEEA 1QZ5A 4E7KA 1ZC6A 1ZBFA 3L6QA 1T7PA 1IBLK 1KVBA 3UKRA 1YXQA 2WUSA 2XY7A 2PYLA 1J6ZA 3AV9A 1S5JA 3M8RA 1YJWN 2X78A 4FLXA 1RT3A 3OYHA 4Y0WA 4FWQA 4OKKA 2FF3B 5AR0A 1BQMA 3O1BA 4JHDA 2BGGA 3DRPA 1O1WA 1YJNN 2F4VK 1KRPA 4BDYA 4EFHA 4I6MA 5LJWA 3ZSYA 2QWNA 5J1EA 4FLZA 2NRVA 4CVNE 4CJRA 1QHAA 4WQ5C 4BQZA 5BR8K 1ZBUA 3SNNA 2YX6A 4W5QA 3KZBA 1M90O 4AILC 4WF9L 5J2QA 5EVZA 2EHGA 4IZ9A 5JMVA 3VEZA 1L3UA 4H0VB 3NH0A 4BGAA 2DPNA 1ZYQA 1X9MA 2DFFA 4IOAL 2QA4N 1QQCA 5C2FA 4JRQA 1NJXA 1NK6A 1VRTA 1TK8A 4CEEA 1EXQA 4FJJA 5AQKA 4BRQA 4BRKA 1HX1A 3OA9A 1HMVA 5JVHL 4CZLA 4NCBA 3FZMA 3NH1A 3TAFA 5AQFA 1NBWA 1X3NA 2VGMA 1IBKK 1VSLA 2WONA 4EAHD 5J2NA 2O8DB 4CJ4A 3QEXA 1U49A 2W6KA 4E3SA 3MN7A 3IUCA 2PYJA 5IWAK 5AZJA 1RT2A 3EL2A 3CC4N 3EY1A 5LJVA 4RCHA 5JLFA 4KHSA 3RMBA 1RT7A 3N4QA 4JKCA 4LFAK 1UA0A 4KAZA 4CESA 1RCHA 2GWJA 5BRDA 4BR9A 3ZT2A 4WE1A 4CJSA 4E7JA 4DS5A 1RTIA 1HJRA 4HWIA 4WQ4A 2NRHA 1U4BA 1WSIA 1JLGA 2GWKA 3VGMA 1Q82O 3GE1A 3AA3A 3U4LA 3TARA 2YHAA 1RTDA 3O6WA 1RT5A 4IBNA 4R79A 1YI2N 4W5RA 4CJTA 1VK0A 5M1KA 5KRTA 3EO3A 3D2EB 3E9LA 4CEAA 3HPGA 1T3VA 4JKGB 4FWPA 1RT4A 1Z26A 1IV0A 3LPUA 4MDBA 5CZ2A 1P8ZA 2D0OA 4JS5A 5CY4A 5ELZA 2NRZA 3BUZB 2G8KA 4ISEA 3CD6N 4H0PA 1MWMA 3AA5X 4H0TB 1GOAA 3ZSXA 3OS2A 3OHRA 3DRSA 4CHYA 3DLEA 1EETA 1BA0A 2Q2RA 4RW7A 3PO5A 3C6TA 1R59O 3UKUA 3G4SN 1S22A 3KLIA 2P9KA 2P9UB 2WOMA 3SLCA 3VQDA 4I2PA 4LSNA 2KLAA 4JYAK 4CW7B 4W5OA 1L3TA 3BP8A 2RF2A 3SQ0A 5BN8A 2YHWA 1TVRA 1KCFA 4Z0UA 3J7ZO 3K9KA 1DGKN 1RTJA 1KVCA 3PIPL 2ASOA 5A2QO 1ATSA 4JI6K 1ASWA 1RDWX 4E7HA 3VQCA 2DY4A 4ELUA 4DTXA 4CJUA 3AVKA 4ZTFA 3ZYYX 3KIOA 3UIQA 2GUPA 3VMFB 1SQKA 2A5XA 1GOBA 4BC4A 5FRMA 1NLVA 2NZTA 3CM5A 3HI0A 2RKIA 1NKCA 3D6RA 5M1PA 2PZSA 4F3TA 3OVNA 3OBWA 4BG8A 5FPDA 1NNEA 4DQQA 3EKUA 1W7AA 4KH4A 2FBYA 4OVLA 1YTAA 2HBLA 4DMNA 4HCBA 3P1GA 1RBRA 4CGDA 4FLYA 2BDPA 1L3VA 4BRDA 3DRRA 2UUBK 2A1RA 2W40A 1C1AA 1MA9B 4G1QA 3TSQA 3K5OA 1WSJA 2Q31A 3SUQA 3FZLA 1MDUB 3VA0A 3AO3A 2FBVA 3CJ7A 5TKWA 4FJMA 1JLQA 3THYB 4JI3K 5KQDA 3QNOA 2A42A 3H46O 3R8EA 1BIZA 2B4JA 1FKPA 3OY9A 1XNRK 4O0IA 2OTJN 2HB5A 5F0XA 3AVAA 2VG6A 3WEEA 4Q5VA 4DR2K 4PY5A 4C8NA 3NGYA 3DXKA 3CFRA 1H1VA 3VEOA 1BG3A 1W9HA 4X62K 4CEZA 4ILGB 2E2PA 3CXCM 3IS9A 5KQ8A 1LW0A 5J2PA 3NDKA 3HVRA 1X9WA 4FWSA 3CJ9A 3TPQA 1J5EK 4E89A 1EWQA 4ILJA 1REVA 4NCGA 4K0KK 2QXLA 1Z05A 4F4KA 4I2QA 4CJQA 3V9XA 4N41A 3ZCMA 3HTVA 5HRSA 2BUPA 4IOXA 5AQSA 4PWDA 5I9EB 2GTDA 4FJIA 4KHWA 2X6NA 3THXB 4PHTX 5KGWA 4FLVA 4N76A 2OANA 3LDQA 1VQ9N 5GINA 1DT9A 3L2WA 2VWJA 2QWRA 3HZ6A 5KTQA 4DQ8A 3IRXA 2NRXA 3SJHA 1KFSA 4CHNA 3MX2A 3MN9A 4CGJA 4KHUA 1BDGA 2V7YA 1HNWK 3VQ7A 2Q0RA 1KC8O 3AARA 2QKKA 4GV9A 2O8EA 2FF6A 3CCJN 4LY7A 4DR6K 4OKJA 4WQ4C 5AQRA 4J2BA 1QHTA 3MMVA 1BQNA 3J7AP 1RDBA 4B1XB 1TV6A 4IFEA 4BR4A 3K57A 2DFEA 3SMSA 5AQHA 3OJSA 4M7YA 3QIOA 3KKRA 3TI0A 4BR0A 3SV4A 4DQPA 3OBYA 3RSEB 4BR7A 3MEGA 1CXQA 3C7NB 4IFVA 2VWBA 3KLFA 4DQIA 1KQSM 5C24A 3CCLN 4RWTA 2QK9A 4FOEA 4BRMA 2PFUA 3VERA 4CEFA 3N4PA 3Q7BA 4KH6A 4CE9A 1D5AA 4C8OA 2KFZA 3C94A 1XC3A 4CFBA 3DLGA 4YORA 3KK1A 2E5LK 4Z4GA 4GKKK 2DTUA 4CF8A 3TR8A 4B9VA 3NF8A 3K5LA 1C1CA 3L4QA 3MEDA 2X74A 1TKTA 4AHRA 4B1ZA 4WCEL 2D1KA 3I8DA 5AZIA 3O4NA 4M7XA 5CHIA 3KKSA 4CJWA 1TKZA 4BDPA 4DTMA 4W5NA 3D7EO 3JS6A 1W2BM 4CBWA 3HOTA 2XY5A 1NMDA 1YHQN 5DM7L 4B1UB 3WNGA 3D0PA 2E2QA 2QW9A 1GLCG 1NK4A 2P9LB 4UY8O 2Z1HA 3PO4A 3ISNC 3H1VX 4DLGA 1ITGA 4AQYK 3QICA 4JK9A 4LF8K 5AQGA 4RW9A 4DV6K 5ADXA 2Q97A 4H0OA 2ZWHA 3CPEA 2P1JA 3SAGA 4YOTA 1VRUA 1SKSA 4F9OA 3K2PA 4CK1A 3TU5A 1KAYA 4H5NA 1HQUA 3AGRA 5ADXH 4GVMA 3NH2A 4DTPA 2VQFK 4BE2A 4JAXA 4EZ6A 1WSEA 3VQBA 3HO1A 2O8CA 2BE2A 4IJNA 3KLEA 3P39A 2O8BA 3DMJA 5AQLA 4I9LA 3R3LA 4Z94A 5C10A 4DV3K 4K42A 3ULEA 4BROA 2PAVA 2P9IB 3T1HK 3RMCA 3V1QA 2E2OA 3CCEN 3OYMA 1DKGD 1VQNN 5E41A 1NJWA 1NKEA 4O55A 1VQ8N 3CFPA 2YCHA 4FWOA 4H0XB 1K8KB 2FSJA 4DSFA 4A62A 1NGBA 4IO9L 2HHUA 4DV2K 3VF4A 3QINA 3CMAN 4CK3A 1I94K 3QFPA 1KFDA 2G8IA 3M8SA 4NYNA 5FPNA 2Z1IA 4FPBA 1I39A 3H3NO 5EXWA 4BVPA 1QQOA 2P51A 2F7TA 4NYFA 2JGUA 4DTRA 2E6MA 3BGRA 3SBGA 1ESVA 5T7BA 2HHWA 5GAHP 1NOZA 4FPAA 2W6LA 2AJQA 2OA8A 3WUHA 1NGCA 5FRNA 3C6UA 3LM9A 2VWKA 2KTQA 3OYAA 2P9NA 2D0BA 3S3MA 4FJKA 1WAJA 3O8MA 4EP5A 4CJVA 4IOCL 2YI1A 4M3WA 3LZJA 3THWA 3WNHA 1ZBLA 1Z6RA 1RTHA 2YHBA 3UE5A 3ZSWA 3MCPA 1VQPN 4ELTA 1WAFA 1M1KO 4CFAA 3LDLA 3FZFA 2ZJRL 1BCMA 1NJIO 1RBTA 3PX4A 2Y1JA 3LDPA 3FE1A 1FK9A 4WFNL 5FPMA 3S3NA 5AFUH 2VQEK 1RDUA 1LWCA 4XH5A 2O8FA 2KHOA 3BZKA 4FJNA 4DTJA 4BRFA 2KZMA 4B9NA 2E2NA 4GV3A 4DUYK 1Z25A 3VESA 1S6QA 3BF1A 3QEIA 3FGUA 3O9SA 4BR2A 4OX9K 3VGLA 3V9UA 4Z4EA 1VAZA 2OZSA 3LWLA 4B9LA 1YTUA 4A5AA 2I5JA 3L2UA 1C6VA 3CCRN 1T6DA 2IVPA 4OO1J 5DM6L 3W3DA 3EN9A 3SQ2A 3ZT3A 3PV8A 3NBPA 1SL1A 3J8AA 3SBTA 4E7IA 4C1NI 2F96A 3G6EN 1UAXA 4CD3A 1JCEA 2HSTA 4FVUA 2IVNA 3O9QA 3ZX3A 4E1MA 4BRLA 1W97L 2CGLA 5BREA 4O5BA 4MO4A 4ISGA 4C23A 4IG0A 1MU2A 4A2AA 2IAJA 1G99A 5KRSA 3BDPA 4AHTA 1A5VA 2R7YA 1E4GT 2XO7A 1K9MO 2QKBA 3AVNA 4KH5A 3FR0A 3G25A 5AQXA 1JCFA 3H08A 1TKDA 2YJFA 3O4WA 4JKDA 4LD0A 2QWOA 3F9KA 2E1ZA 3ALYA 1ATNA 4J2DA 4A57A 4KFBA 4CHPA 3VQAA 4U67L 1VQ5N 1YAGA 1UA1A 4HUGA 5BPNA 1VSKA 1XHZA 2FC0A 1WUAA 1J5OA 1VQ7N 3PLAA 1N6QA 3MXIA 4G9ZA 5BPMA 3KD1E 3ZETA 2HHSA 1S6PA 1VQ6N 1BI4A 2QXFA 2EX3A 3U6FA 2A3ZA 4LH5A 2WBNA 3M8QA 4BRNA 4BE1A 4F2SA 4CZMA 3P83D 2HHHK 2W41A 4AHCA 4JKBA 3OYJA 3TAQA 1U2VA 4I9QA 4LF6K 3AVGA 5FROA 1RT1A 2IC3A 1KAZA 3R9PA 2JWLA 5HRNA 3F2KA 4B9SA 3DXMB 5LY3A 3A5NC 1X1PA 3D2FA 2A41A 3P31A 4N5SA 2HMIA 5AQNA 5B8HA 3L2VA 4X65K 3ZX0A 2P9SA 3TAEA 3C6AA 3QEPA 2XY6A 1T8EA 2O4GA 4B8CA 1TKXA 2QWPA 3CM6A 2KFNA 4QS9A 1IKXA 4GW6A 5FLXO 4E0DA 4CEDA 2HNDA 4DSJA 3HM9A 4DSEA 4BY9C 2A6AA 4NXNK 3MN6A 2OYQA 4XH4A 1X3MA 1FJGK 2Q3SA 3K5MA 1N32K 2J4RA 1BCOA 3E01A 2GX9A 4DQRA 5M1NA 2FSNA 4JN4A 1OVYA 3M5RA 1N36K 3DLHA 2ASPA 4FWLA 4CJPA 3ID8A 3U3GA 1Y97A 1SL2A 4FK2A 5HBMA 3QBXA 3IAYA 1UWBA 4KHNA 4OKEA 3CQ8A 3CQXA 1SKWA 4M3YA 3T7ZA 3T1AA 4CGIA 5AQUA 4YY3K 1IH7A 4CK2A 4JI2K 3VN5A 4B9QA 2O4IA 5F2RA 3MCAB 1TYQB 3V9ZA 4GNIA 4FO0A 5AQPA 1Q81O 3QLHA 1WN7A 3CPWM 1NGGA 3CERA 3LP3A 4BRHA 1KLMA 1TK5A 3DLBA 1SUQA 1B92A 5CZ1A 3Q7CA 4EHTA 2QTDA 4YOXA 4ILHA 1GLBG 4B1YB 3VQ8A 1SL0A 4NLBA 2YJEA 3EKSA 4CI6A 1X9JA 4MLHA 1OH8A 3HK2A 4YDUC 2W42A 3AVLA 3B6OA 5GAEP 4DV5K 5M1FA 1WSFA 2IS3A 2D4WA 1F21A 3DM2A 1C1BA 2XY8A 5SWMA 2KKZA 5I3UA 1DEJA 3KJVA 5AQYA 4H4MA 2OZMA 1CZBA 3VF2A 1WBDA 3IMXA 3CJAA 3ZT1A 2KW4A 1B9FA 1JL1A 3CG7A 2F9TA 3VETA 1BWFO 4HHTA 3RTVA 5C42A 4OPJA 1DTTA 3UKRB 4A61A 3A2FA 3NHGA 3CCMN 5JVGL 3HBTA 4EP4A 4DR3K 1BISA 1QSSA 2QWQA 4JV5K 3DWLA 3V6DA 1YF5L 2E1YA 4M3RA 1GLFO 1HRHA 1FKOA 1NMNA 4GKJK 5DMRA 3O80A 4FJ8A 2Q1NA 3AVFA 2WTUA 1HYVA 3K0SA 3CI5A 4JHDB 2HHXA 1JXBA 3VQPA 2ZM6K 5HLFA 4YOWA 3H45C 5MLCQ 4KRFA 3L2QA 4YHHK 1SZ2A 4I6MB 3L8BA 3EE8A 5FPEA 1D9FA 2E6LA 2JWKA 4L3QA 5F1XA 1RDAA 4BRPA 1D9DA 4GVEA 3P38A 2A1SA 1W0HA 4KI4A 4B3TK 5KI6A 1GOCA 5AQOA 1C0MA 1GLJO 3SV3A 1NJYA 1KLNA 4B3RK 2UUAK 1NK8A 3O1WA 1E4FT 1UOCA 2P9PA 2DFHA 4CFCA 5C25A 2G8UA 3SMPA 4CZKA 2ZJQL 2ZD1A 1XUPO 1VSFA 4LFBK 2G8HA 4MLEA 4A2BA 4B9TA 3CQYA 4YOUA 3QESA 3SJJA 2IOCA 2QI2A 4KV8A 4NXMK 2UYTA 2PBDA 1HYSA 1U04A 3R1XA 3LL3A 1TL1A 3AVCA 3U9ZA 4CERA 3MDQA 3EYZA 4HTUA 3HT3A 4J8FA 5M1OA 5E26A 1KSPA 3S41A 3NGZA 4KHQA 1U2VB 4JD2A 3U3YA 5AZJB 3WQUA 2EWSA 3CCVN 5CYQA 3F5TA 5J2MA 3LALA 4JK8A 3H6EA 4DSIA 5C15A 3ASMA 2ZGZA 3ZLJA 3AVMA 3SK3A 3ZSZA 4K41A 4CEQA 1LAWA 4E7LA 4ID1A 4QS8A 4Y1CA 4Y1DA 4KREA 5HOOA 5HROA 5EU7A 2VYPA 3KHYA 2YNHA 5KPTA 5GAGP 1CXUA 2OPRA 3MECA 3NF6A 3OYNA 4N56A 4IEEA 1GLAG 1K8AO 3NF9A 3ZEUA 1HPMA 4H03B 1WNSA 3ZSRA 4FJ5A 1NGDA 1XNQK 1J9AA 3SAFA 3OJUA 3RRHA 2YNGA 5C2DA 4OPAA 1Q7YO 2OCEA 3C65A 4H5RA 2LSNA 5M1QA 4A59A 1TL3A 3QO9A 5LMUK 1TUYA 4V19S 3A5LC 4A5BA 4CZJA 1YVUA 4KO0A 4CHQA 1C0GA 1VHXA 3DJCA 5KPZA 4C8KA 4BWJA 4O0JA 3I33A 2HMPA 1BHLA 4CBXA 3AGKA 4FJLA 1VSHA 2OPPA 4RW8A 5LL6Z 5GIPA 3T3FA 1K6YA 3RMAA 1HJOA 3CJ1A 3UKUB 4B08A 4KBOA 3QEVA 1IG9A 2P9KB 2GBZA 2GUIA 3EEQA 3ZX2A 5HRPA 1Q9YA 3VQ4A 1WLJA 5AQIA 4BVOA 1WB9A 2GELA 4IO8A 3MK6A 4E1JA 1VSJA 3VEYA 3O9UA 4E19A 1L3SA 4YNQA 1XI1A 1XMQK 4DU4A 4IXCA 1FXXA 4FW1A 4M42A 1V4SA 4DB3A 3VENA 3AAPA 4KTQA 4DFJA 2WFBA 4FL9A 4PL8A 2RPIA 3HM8A 3GG4A 1BUPA 1OKJA 4QS7A 2NRWA 3DYAA 3VQ6A 4FWNA 4B1VA 3ENOA 4H8KA 1IBMK 4HUFA 2HHTA 1XHXA 4BGBA 2NLXA 1QS4A 2RHKA 2Q0UA 3OTOK 2O8DA 3DOKA 5C0YA 1NJZA 3AO2A 4OPHA 3QFUA 5JICA 1QSLA 1NGHA 2VG5A 2GV9A 3GBTA 3NCIA 3QIPA 1L5UA 1SAZA 1HNXK 3I0SA 3AA2A 3LWMA 3QMLA 4QCLA 3ZT0A 4CZHA 3T19A 1TAQA 3P5JA 3A5MC 4LH4A 3WXMB 4KTWA 1C0UA 4CGFA 3HL8A 4FJXA 4K8XA 3OYBA 4IWVA 4PUOA 2D5RA 2RE2A 2PY5A 1HKGA 3ZSQA 2XHBA 3F9MA 2HVHA 4JK7A 2QEXN 3VQ5A 1TUUA 3OYDA 4U7BA 2KQ2A 4DTNA 1SKRA 2YNIA 1ASVA 2F8SA 3ZSVA 4RTFD 5AQJA 3L0QA 5IT9O 1OH6A 3D2EA 3WEEB 5GADP 3OYLA 1HNIA 4FWRA 4AM7A 1E3MA 2BH1A 4Z4HA 4PKHA 3DXKB 4JKGA 2G8VA 3V4IA 1HNZK 4QOZB 2P9PB 3H3OB 5AQWA 1VSMA 3G71N 1OH7A 4F8RA 3GDQA 4FJHA 1JCGA 2V52B 2HHQA 1A5XA 3KWIA 4RW6A 1Q9XA 3M8PA 3BY5A 4DTOA 2CGKA 4BREA 5AFUA 3K58A 2OPSA 4IEIA 4IG3A 3SCXA 1NM1A 3KVGA 1XQSC 3GOIA 3JAMO 4DU3A 5HRRA 2P9UA 3SPYA 1S72N 1BIUA 4DV1K 4AHSA 1ZBIA 3C0BA 3T69A 1LWEA 1QVFM 4BRCA 3B8AX 4DLEA 2O8EB 4YFUA 4DR5K 4DSKA 4ICLA 4YDUA 4OLBA 3V9SA 2ITGA 1J54A 4CJKA 3TAMA 4MDAA 2RN2A 4NCAA 4JEPA 3CJBA 5KGXA 2KZZA 2NNWA 4ELVA 5AQMA 2HHVA 4M41A 3HP9A 1ASUA 1LW2A 4CGHA 1K73O 1LWFA 1HQEA 2OTLN 4CCHA 2UUCK 2CH6A 1EQYA 3TTFA 4GY2B 5DK5A 4O8UA 1EP4A 3EE9A 1RT6A 1D4XA 2Q36A 4BC3A 3CETA 3T1YK 3IFRA 3L2RA 2BANA 4JI4K 1YT3A 1I3AA 4DR7K 4FLWA 1YVNA 1CZ9A 4PL7A 4OGEA 2ETJA 2AP1A 2QWMA 3L4IA 4LF7K 3AVBA 3ID6A 3OS1A 4BWMA 3WXIA 4RG8A 4CHOA 4JRPA 5AZIB 2HBKA 3RR8A 2P5OA 1KAXA 2F8TA 4B9UA 3QERA 1D8YA 1NKBA 3VF6A 3THYA 4BRAA 2QWLA 1ZXOA 5FDLA 1EX4A 4FJ9A 4I7FA 3O9TA 4KTZA 3WQTA 4EIAA 2G8FA 1N34K 5LMNK 3M1FA 1C0TA 3L3UA 1BOTO 3QB0A 4XH1A 4CJ7A 1T03A 1U47A 3NGIA 4Z4IA 3QNNA 4DSLA 1NK0A 4M45A 3G10A 3DLKA 4O5FA 2ZF5O 1S1XA 1JJ2M 3ITHA 4DCHA 4EZ9A 1N8RO 2ZE2A 4OPKA 1ILYA 4KB1A 1OVQA 3FLCO 3CYMA 3E1YA 1NGEA 3WNFA 3ZSOA 4DF8A 2Z1JA 3C95A 4LF5K 3GL1A 1VQKN 4QAGA 5HP1A 4M3UA 1CZAN 3THXA 4CIFA 3C6HA 2O8CB 4DWIA 4CZIA 2O8BB 4FWMA 3RMDA 3HPHA 3JSMA 2Y1IA 4ISFA 3ULEB 1QTMA 5JLHA 1NG9A 5CR4A 4KHPK 1B9DA 1RFQA 3NVMA 4AHVA 1X9SA 1BA1A 3CIPA 4ID5A 3CHWA 1C0FA 1S1WA 3DLRA 3VQQA 2YKMA 4BRGA 3NE6A 4CF1A 4HUEA 4WFAL 4ZHRA 4DR4K 1EO1A 3RSEA 2F9WA 3C7NA 2VGNA 3O3HA 3PX0A 3DLLL 3PUFA 3J7YP 1YUWA 4PKIA 4FJGA 2FBXA 3OS0A 5D3GA 5BRFA 4Q0BA 1LV5A 4DU1A 3PSIA 1NK7A 1RBVA 1JLBA 4HCCA 1CLQA 3MWTA 4X64K 2CH5A 4DTSA 3J81O 3HSTB 1KVAA 2E88A 2CGJA 4FOIA 3SZ2A 3LM2A 3EZ5A 4DTUA 1GLLO 2P9NB 3AAQA 3O3FA 3THWB 3VEWA 3ENBA 4LC9B 1GLDG 4FJ7A 2D0PA 4BRIA 3HXMA 3I55N 4JS4A 1LCUA 3PSFA 3WNEA 1KXPA 2E8AA 3E9OA 5BRHA 1IKYA 1QQMA 2YKNA 2NRRA 3UB5A 4KPYA 3FFIA 4FLTA 2P9LA 1VQ4N 1FW6A 1XMOK 3LANA 1Q86O 4BACA 3BZCA 2ZJPL 3SUNA 2O8FB 3G0ZA 1SV5A 1RILA 1WBBA 1VQLN 4JI5K 4JLHA 3TTDA 1NU0A 5AQVA 3U9DA 1EWRA 3VTIA 3TSUA 5JS1A 1S1TA 1BU6O 4DQSA 1YITN 2OPQA 4K8ZA 1N33K 5H1SQ 4IJAA 4CEBA 3OYKA 3JXUA 1HLUA 4FZYA 4M63C 4BQLA 2B5JA 3AO1A 5BN9A 4XEIA 1IO2A 4BC2A 4FZZA 3EZWA 1DTQA 4M3XA 2UXCK 4OJRA 3CJCA 3NFAA 3NF7A 5AQTA 3KWGA 3O4QA 1OH5A 3SYZA 4DS4A 4JI1K 3WT0A 4CJ5A 1Y64A 2P9IA 2I7PA 4C1NK 4DKWA 3FZHA 3MXMA 4CIEA 4C8MA 4DFMA 1U45A 3VTHA 4PKGA 3ZT4A 3AVJA 4DFKA 4FCYA 4CJFA 4C8LA 1WSHA 2VCPA 5AQQA 1HNVA 3VA3A 3WXJA 1K8KA 2IIRA 4H5VA 3LP2A 3WXKA 3KD5E 1NGJA 4MO5A 3O9RA 3FFKB 1QQNA 3PX6A 4N47A 4CFDA 3LDSA 2E4LA 3QETA 2FXUA 3O08A 2HNZA 4H0YB 4DR1K 1XWLA 1NK9A 2P5GA 1TAUA 2YV0X 3TABA 1S3XA 1HYZA 2V7ZA 4BE0A 1O13A 3A5OC 3O5BA 4CF9A 4YOYA 3CC7N 3KLHA 3OYEA 4FXDA 1JLEA 4CJLA 1S1UA 2VG7A 3A0IX 4B9MA 2ATQA 1ZBSA 3ZETB 3VQEA 4CJ3A 3I0RA 4BG9A 1Q18A 1BI4B 3AO4A 1JKHA 1IJJA 1VSDA 3TAGA 3NAEA 4JNEA 3CF5L 3MXJA 4JKEA 4Z4CA 3RVCA 4JI7K 3D45A 4CF0A 3HYFA 4CGGA 3SI6A 4B3OA 4CZGA 3OYIA 3K9JA 3TTCA 2GEMA 4JKHA 1S1VA 3D2FB 2HNYA 3CCUN 1NOYA 4CHZA 2P9SB 2YNFA 2HVIA 5GIOA 1KD1O 3J80O 4J2EA 4MFBA 2HBMA 3JYTA 2NUBA 4RW4A 2ZGYA 4HVJA 4CECA 5HL7L 2D0CA 4W5TA 3OYFA 2HF3A 3MN5A 5JS2A 3TSPA 2AA4A 2D0AA 2QM1A 3TAPA 3AY9A 2IDOA 3OYCA 3O3GA 4FM1A 4CIGA 1HPZA 2IGIA 2Z1GA 1EKEA 3BEXA 4AM6A 4CF2A 2HW3A 5AJ3K 3CCQN 4IDHA 4K43A 1QVGM 2UU9K 1NWKA 5CYMA 1NGFA 2E20A 2ZQBA 4FLUA 2FSKA 1WSGA 4KKOA 2HF4A 3HOSA 4CZFA 2X6SA 3MWPA 4F3OA 5EOYA 3MX5A 4FM0A 2H3GX 1RDDA 4JI0K 1IG8A 4MQ3A 4GV6A 4FWKA 3M3ZA 4LF4K 4YOVA 3QDKA 3U8XA 3F73A 1U48A 3KK2A 3H1QA 3V9WA 2ASMA 5EY4A 2A40A 4DFPA 1TK0A 2UXDK 3AVHA 3KK7A 4B3SK 3M6GA 1ZBHA 4KB0A 1WOQA 3VOVA 4WFBL 1G15A 3W0LA 3KLGA 3WXLA 3ATUA 3LP0A 5CE3A 4DV4K 1R0AA 5SZTA 1GLEG 1S9GA 3LAKA 1RBSA 4R5PA 4H4OA 4DHYA 3OW2M 4FK4A 5I42A 2NRTA 1HKCA 3LAMA 2FBTA 1QZ6A 1BGXT 2FLOA 1LOTB 1P90A 3K59A 3SUPA 4JI8K 4K25A 4IFYA 1NGAA 3QEWA 3IG1A 4WQ5A 4E1NA 3HPOA 3LZIA 4M3TA 4HTLA 2XRIA 2HBJA 4WYBA 2ITMA 4CD1A 4F2RA 4DUZK 4JKAA 3SUOA 4IDKA 3RR7A 3RWUA 4XIUA 3LDOA 3SAHA 4H5WA 1JXEA 4FW2A 3P4IA 3HVTA 2B6AA 4O8KA 3RRGA 5KPRA 1NK5A 4H5TA 3NVKA 4GMJB 4BDZA 1QE1A 1MWKA 1T44A 3LPTA 4LF9K 3HRGA 4X66K 1SS6A 3PIOL 3CMEN 4LFCK 1HKBA 1XC9A 4OGCA 3DXMA 1RNHA 1U6ZA 4FYDA 4TSXA 1RBUA 4CEOA 3PY8A 2UXBK 4M3ZA 4JKFA 3FZKA 3IDHA 4FM2A 3VQ9A 3V81A 2I7NA 5K14A 4CJEA 4DV0K 1LAVA 5TKYA 3ATVA 1Q8IA 2JLEA 3ENHA 3R6MA 3BF3A 3LDNA 1IKWA 4B1WB 1TGOA 3S3OA 3DAWA 4J2AA 4O44A 3AVIA 4ZTJA 3VEXA 1DLOA 1T05A 4DV7K 4DG1A 1V4TA 5AQZA 3MAQA 1ATRA 5BR9A 3HSCA 1KTQA 5BPLA 3KTQA 4B8AB 3CC2N 4AHUA 1IKVA 3TWHA 2BTFA 5E84A 4AF1A 4KHYA 3HJFA 4CZEA 4CBUA 1RGIA 4B3MK 4BC5A 3S9HA 3E9PA 3I8BA 5C12A 3A8YA 3L3VA 4BR5A 3VGKA 3THVA 1QSYA 4FZXC 1BO5O 3DI6A 1TYQA 1VSEA 4PA1A 3TANA 3AO5A 5EX5A 2G8WA 1JL2A 4DF4A 3AA4A 4NO7A 1HUXA 3KK3A 2WC9A 3IKMA 4FVMA 2HOEA 4PQUA 3OYGA 4AH9A 3I56N 1YJ9N 4NLCA 1VSIA 4OLAA 1HR0K 4UQGA 4JD2B 1JLAA 4IKFA 4FK0A 3QBWA 3VEVA 2YHXA 1J53A 3SQ4A 1BL3A 1N5YA 1JLCA 1JLFA 4LSLA 1YIJN 3SQ1A 1NGIA 4FSVA 3LP1A 1S9EA 1T6CA 4Z4FA 2V51B
chains in the Genus database with same CATH topology
1ITGA 1W0HA 3NE6A 4CF1A 5KI6A 4HUEA 3ULDA 3SPZA 4L8RB 3HP6A 1GOCA 4ZHRA 4O4GA 1C0MA 4RW9A 3K5NA 3SV3A 1NJYA 1KLNA 3V1RA 3O3HA 1NK8A 1UOCA 4CFCA 2DFHA 5C25A 2G8UA 2HHVA 3PX0A 3PUFA 3DOLA 2P1JA 4FJGA 1A5WA 2FBXA 2ZD1A 1VRUA 3OS0A 1SKSA 1VSFA 5D3GA 3K2PA 4Q0BA 3V1OA 1LV5A 2G8HA 4CK1A 4DU1A 1NK7A 1RBVA 1JLBA 4HCCA 4KI6A 1RDCA 1CLQA 1HQUA 3B6PA 3CFOA 3MEEA 4B9TA 4E7KA 4GVMA 3QESA 3NH2A 3SJJA 4DTPA 2IOCA 4KV8A 4DTSA 3HSTB 1KVAA 1ZBFA 4BE2A 4EZ6A 1T7PA 3SZ2A 1KVBA 1WSEA 3VQBA 3HO1A 3EZ5A 4DTUA 1HYSA 1U04A 2XY7A 2PYLA 1TL1A 3AVCA 2BE2A 3AV9A 4CERA 3O3FA 3KLEA 3EYZA 1S5JA 3DMJA 3M8RA 4I9LA 3HT3A 4HTUA 2X78A 4FLXA 1RT3A 1KSPA 3OYHA 3NGZA 4FJ7A 4KHQA 3HXMA 4Z4FA 3RMCA 3U3YA 4OKKA 4JS4A 3V1QA 3WNEA 1BQMA 5CYQA 2BGGA 3DRPA 5J2MA 1O1WA 3LALA 3OYMA 4DSIA 5E41A 4BDYA 1NJWA 1NKEA 1KRPA 3ASMA 1IKYA 4O55A 2YKNA 4KPYA 3ZSYA 3AVMA 3CFPA 3FFIA 4FLTA 4DSFA 5J1EA 3ZSZA 4FLZA 2HHUA 4CEQA 4CJRA 1LAWA 4E7LA 3LANA 3QINA 4ID1A 1ZBUA 4Y1DA 4Y1CA 4KREA 4CK3A 3SNNA 4BACA 3SUNA 5HROA 5EU7A 1KFDA 3G0ZA 1SV5A 4W5QA 2G8IA 4AILC 3M8SA 1RILA 5J2QA 2EHGA 2YNHA 4JLHA 4NYNA 1L3UA 1CXUA 3NH0A 2OPRA 3MECA 2Z1IA 3NF6A 3OYNA 1I39A 5JS1A 1S1TA 2P51A 4N56A 4NYFA 1ZYQA 2JGUA 4DQSA 1X9MA 2OPQA 4DTRA 2E6MA 2DFFA 3BGRA 4K8ZA 4CEBA 3NF9A 1QQCA 5T7BA 2HHWA 4JRQA 1NOZA 1NJXA 1NK6A 3OYKA 1WNSA 3ZSRA 1VRTA 4FJ5A 1TK8A 4FZYA 1J9AA 2AJQA 2OA8A 4CEEA 1EXQA 2B5JA 3AO1A 3OJUA 3RRHA 4FJJA 2YNGA 1IO2A 1HMVA 3C6UA 4NCBA 4FZZA 5FRNA 2VWKA 3NH1A 3OYAA 2KTQA 1DTQA 2LSNA 3TAFA 1TL3A 2D0BA 3QO9A 4OJRA 4M3XA 3S3MA 4FJKA 1WAJA 1VSLA 4EP5A 3NFAA 1YVUA 3NF7A 4KO0A 4CHQA 2WONA 4CJVA 3O4QA 5J2NA 4M3WA 3LZJA 3WNHA 3SYZA 1ZBLA 4BWJA 4DS4A 4O0JA 4C8KA 4CJ4A 1RTHA 1BHLA 4CJ5A 3QEXA 2YHBA 1U49A 3ZSWA 4E3SA 3MXMA 4ELTA 4FJLA 1VSHA 1WAFA 4CIEA 2PYJA 4C8MA 4DFMA 4CFAA 1RT2A 1U45A 2OPPA 4RW8A 3T3FA 3ZT4A 3EY1A 3AVJA 1BCMA 1K6YA 4DFKA 3RMAA 4FCYA 4CJFA 4KHSA 1RBTA 4B08A 4C8LA 3QEVA 4FXDA 1IG9A 3RMBA 1WSHA 1RT7A 3PX4A 1HNVA 3VA3A 2GBZA 2Y1JA 2GUIA 1FK9A 1UA0A 4KAZA 3LP2A 4CESA 1RCHA 3S3NA 5HRPA 3KD5E 1Q9YA 3VQ4A 3PX6A 1WLJA 1LWCA 4N47A 4CFDA 4FJNA 3LDSA 3ZT2A 4DTJA 4WE1A 4CJSA 4E7JA 2E4LA 4DS5A 1RTIA 1HJRA 3QETA 2KZMA 2HNZA 4B9NA 1VSJA 1XWLA 1NK9A 2P5GA 4E19A 1L3SA 1TAUA 1Z25A 1S6QA 2YV0X 4YNQA 3TABA 3QEIA 1XI1A 1WSIA 1U4BA 1JLGA 1HYZA 4DU4A 1FXXA 4FW1A 4M42A 4BE0A 3AA3A 3V9UA 3TARA 4CF9A 2YHAA 1RTDA 4KTQA 3KLHA 3OYEA 4Z4EA 1RT5A 4IBNA 3LWLA 4DFJA 1JLEA 4CJLA 1S1UA 2VG7A 4W5RA 2OZSA 4B9LA 1YTUA 4B9MA 2RPIA 2ATQA 2I5JA 4CJTA 1VK0A 5KRTA 3VQ6A 1C6VA 3DYAA 3L2UA 3VQEA 4CEAA 4CJ3A 4H8KA 3I0RA 3HPGA 4HUFA 3SQ2A 1XHXA 2HHTA 1BI4B 3ZT3A 3AO4A 1RT4A 1Z26A 1JKHA 3LPUA 1QS4A 1VSDA 5CZ2A 3TAGA 3NAEA 3PV8A 3NBPA 1SL1A 4E7IA 4JS5A 5CY4A 3DOKA 3MXJA 4Z4CA 2F96A 1NJZA 2G8KA 1UAXA 3AO2A 3AA5X 1GOAA 3D45A 4CF0A 1QSLA 3ZSXA 3OS2A 3HYFA 4CGGA 3SI6A 4B3OA 2VG5A 2GV9A 3DRSA 4E1MA 4CHYA 3DLEA 3QIPA 3OYIA 3NCIA 1EETA 1L5UA 4O5BA 4RW7A 3PO5A 3C6TA 3I0SA 3AA2A 3LWMA 1S1VA 3KLIA 4IG0A 1MU2A 2HNYA 4QCLA 2WOMA 3ZT0A 2IAJA 5KRSA 3BDPA 1NOYA 3T19A 4AHTA 1TAQA 3P5JA 4LH4A 1A5VA 4CHZA 2YNFA 3VQDA 4KTWA 1C0UA 4CGFA 2R7YA 2HVIA 3HL8A 2XO7A 4FJXA 4K8XA 2QKBA 4I2PA 3AVNA 4LSNA 4MFBA 4J2EA 3JYTA 3OYBA 4PUOA 2NUBA 4RW4A 2D5RA 3H08A 4W5OA 1TKDA 1L3TA 4HVJA 4CECA 2PY5A 4LD0A 3ZSQA 2RF2A 2XHBA 3SQ0A 3F9KA 2D0CA 3ALYA 4W5TA 2HVHA 3OYFA 5JS2A 4J2DA 1TVRA 1KCFA 4Z0UA 4KFBA 4CHPA 2D0AA 3VQAA 1RTJA 3TAPA 3VQ5A 2IDOA 3OYDA 1KVCA 2KQ2A 3OYCA 3O3GA 4FM1A 4DTNA 2YNIA 1ASVA 4CIGA 1HPZA 4HUGA 1UA1A 2IGIA 1VSKA 1EKEA 2FC0A 2Z1GA 3ZSVA 4CF2A 1XHZA 1J5OA 2F8SA 1N6QA 3MXIA 1ASWA 5CYMA 4E7HA 3KD1E 2ZQBA 3VQCA 4DLGA 4FLUA 2DY4A 1WSGA 4DTXA 4ELUA 2HHSA 4KKOA 3OYLA 1HNIA 2X6SA 1S6PA 3AVKA 4CJUA 4Z4HA 4ZTFA 2G8VA 3KIOA 4F3OA 1BI4A 4FM0A 2QXFA 3V4IA 3UIQA 4QOZB 2EX3A 3U6FA 4LH5A 1RDDA 3M8QA 4BE1A 1VSMA 4F2SA 1GOBA 4F8RA 5FRMA 3P83D 4MQ3A 4KI4A 4FJHA 3CM5A 2RKIA 2HHQA 1NKCA 4AHCA 1A5XA 4RW6A 1Q9XA 3OYJA 3M8PA 2PZSA 4DTOA 3F73A 3TAQA 1U48A 3KK2A 4F3TA 4I9QA 3OVNA 3AVGA 3K58A 3V9WA 5FROA 1RT1A 2OPSA 2IC3A 4DQQA 4DFPA 5HRNA 1TK0A 4IG3A 3AVHA 3SCXA 4B9SA 2FBYA 4OVLA 1X1PA 4DU3A 5HRRA 1YTAA 4DMNA 4HCBA 4N5SA 3SPYA 2HMIA 4KB0A 1ZBHA 3L2VA 3P1GA 1RBRA 1G15A 4CGDA 3KLGA 4FLYA 2BDPA 1BIUA 1L3VA 3TAEA 3DRRA 3QEPA 4AHSA 2A1RA 2XY6A 3LP0A 1R0AA 1T8EA 1ZBIA 1C1AA 2O4GA 5SZTA 4G1QA 4B8CA 1TKXA 3K5OA 1WSJA 1LWEA 1S9GA 3CM6A 3LAKA 3SUQA 2KFNA 1IKXA 1RBSA 4R5PA 4H4OA 4GW6A 3VA0A 4E0DA 3AO3A 4FK4A 5I42A 4CEDA 2FBVA 2HNDA 3LAMA 2FBTA 4DSJA 4DLEA 3HM9A 1BGXT 4FJMA 4DSEA 4YFUA 1JLQA 3K59A 3SUPA 2OYQA 3QNOA 4DSKA 2Q3SA 4ICLA 4OLBA 3V9SA 4IFYA 2ITGA 1J54A 3K5MA 3QEWA 1BCOA 3E01A 1BIZA 2B4JA 4DQRA 4CJKA 3TAMA 1FKPA 3IG1A 3LZIA 4E1NA 3HPOA 2RN2A 3DLHA 4M3TA 2XRIA 4F2RA 3OY9A 4NCAA 5KGXA 4O0IA 2KZZA 4CJPA 2HB5A 4ELVA 3AVAA 2VG6A 4Q5VA 3U3GA 1Y97A 4M41A 3SUOA 4IDKA 3RR7A 1SL2A 4C8NA 4XIUA 3RWUA 4FK2A 3NGYA 4PY5A 3HP9A 3CFRA 1ASUA 5HBMA 1JXEA 4FW2A 1LW2A 1W9HA 4CGHA 1LWFA 4CEZA 1HQEA 4CCHA 3HVTA 2B6AA 3RRGA 5DK5A 3IS9A 1NK5A 3IAYA 1UWBA 1LW0A 1EP4A 4OKEA 1RT6A 3CQ8A 4GMJB 3NDKA 3HVRA 5J2PA 1SKWA 4KHNA 4M3YA 4BDZA 1QE1A 1X9WA 3T1AA 4CGIA 3LPTA 1SKRA 3L2RA 2BANA 4E89A 1IH7A 4CK2A 1REVA 4NCGA 3VN5A 1YT3A 1I3AA 2O4IA 4F4KA 3V9ZA 4I2QA 4CJQA 3V9XA 4N41A 3ZCMA 3QLHA 4FLWA 5HRSA 1XC9A 4OGCA 1CZ9A 4PWDA 1RNHA 1WN7A 4OGEA 4FYDA 2ETJA 4TSXA 1RBUA 4FJIA 3LP3A 4CEOA 2X6NA 3PY8A 4KHWA 4M3ZA 5KGWA 4FLVA 4FM2A 1KLMA 4N76A 3VQ9A 1TK5A 3DLBA 3AVBA 3V81A 1SUQA 3L2WA 3OS1A 4BWMA 2VWJA 5K14A 1B92A 4CJEA 5KTQA 1LAVA 5CZ1A 3IRXA 4RG8A 1KFSA 4CHNA 4CHOA 4JRPA 1Q8IA 2JLEA 3RR8A 2P5OA 4CGJA 4KHUA 2F8TA 4B9UA 3VQ7A 2HW3A 1IKWA 3VQ8A 1TGOA 3QERA 1SL0A 1D8YA 1NKBA 2QKKA 3S3OA 4J2AA 4LY7A 5FDLA 4O44A 1EX4A 3AVIA 4OKJA 4ZTJA 1DLOA 4J2BA 1T05A 3HK2A 1QHTA 2W42A 1BQNA 4FJ9A 4I7FA 3AVLA 4DG1A 4KTZA 1RDBA 3B6OA 2G8FA 1TV6A 3K57A 2DFEA 1C0TA 3L3UA 3MAQA 1T03A 3OJSA 1U47A 1KTQA 1WSFA 3NGIA 4Z4IA 2IS3A 3QNNA 3QIOA 1NK0A 3KTQA 3KKRA 4DSLA 3TI0A 3SV4A 4DQPA 4B8AB 1F21A 4AHUA 3DM2A 1C1BA 4M45A 2XY8A 3G10A 3MEGA 1CXQA 1IKVA 4IFVA 5SWMA 3KLFA 3DLKA 3TWHA 4DQIA 1S1XA 4KHYA 3ITHA 5C24A 3HJFA 4EZ9A 5I3UA 2QK9A 3S9HA 2ZE2A 4OPKA 3KJVA 4KB1A 3L3VA 3CYMA 3WNFA 4CEFA 3THVA 4H4MA 4CE9A 3ZSOA 4DF8A 1QSYA 2OZMA 4FZXC 1D5AA 2Z1JA 4C8OA 2KFZA 3C95A 3DI6A 1CZBA 1VSEA 3C94A 4CFBA 4QAGA 5HP1A 4PA1A 4M3UA 3DLGA 3TANA 3ZT1A 3AO5A 2G8WA 2KW4A 3KK1A 1B9FA 1JL1A 3CG7A 4Z4GA 1JL2A 4DF4A 4CF8A 4CIFA 2DTUA 3RTVA 3TR8A 4HHTA 4B9VA 5C42A 4OPJA 1DTTA 3NF8A 3A2FA 3AA4A 3NHGA 3K5LA 4DWIA 1C1CA 3MEDA 4EP4A 2X74A 1BISA 1TKTA 4AHRA 3KK3A 4FVMA 3RMDA 3HPHA 1QSSA 4PQUA 3I8DA 3JSMA 2Y1IA 3OYGA 3V6DA 3O4NA 4M3RA 4AH9A 1QTMA 1HRHA 1FKOA 5DMRA 1VSIA 4OLAA 4FJ8A 4UQGA 3AVFA 3KKSA 4CJWA 1TKZA 4BDPA 1HYVA 4DTMA 4W5NA 1JLAA 4IKFA 2HHXA 1JXBA 1B9DA 3VQPA 5HLFA 4FK0A 2XY5A 1J53A 3SQ4A 4KRFA 1BL3A 4AHVA 1N5YA 3L2QA 1JLCA 3L8BA 1X9SA 1JLFA 3WNGA 3D0PA 4LSLA 1D9FA 3SQ1A 3LP1A 1S9EA 1NK4A 2E6LA 4ID5A 2Z1HA 1S1WA 3DLRA 1RDAA 3VQQA 3PO4A 2YKMA 1D9DA 3ISNC 2A1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ITG A;  1W0H A;  3NE6 A;  4CF1 A;  5KI6 A;  4HUE A;  3ULD A;  3SPZ A;  4L8R B;  3HP6 A;  1GOC A;  4ZHR A;  4O4G A;  1C0M A;  4RW9 A;  3K5N A;  3SV3 A;  1NJY A;  1KLN A;  3V1R A;  3O3H A;  1NK8 A;  1UOC A;  4CFC A;  2DFH A;  5C25 A;  2G8U A;  2HHV A;  3PX0 A;  3PUF A;  3DOL A;  2P1J A;  4FJG A;  1A5W A;  2FBX A;  2ZD1 A;  1VRU A;  3OS0 A;  1SKS A;  1VSF A;  5D3G A;  3K2P A;  4Q0B A;  3V1O A;  1LV5 A;  2G8H A;  4CK1 A;  4DU1 A;  1NK7 A;  1RBV A;  1JLB A;  4HCC A;  4KI6 A;  1RDC A;  1CLQ A;  1HQU A;  3B6P A;  3CFO A;  3MEE A;  4B9T A;  4E7K A;  4GVM A;  3QES A;  3NH2 A;  3SJJ A;  4DTP A;  2IOC A;  4KV8 A;  4DTS A;  3HST B;  1KVA A;  1ZBF A;  4BE2 A;  4EZ6 A;  1T7P A;  3SZ2 A;  1KVB A;  1WSE A;  3VQB A;  3HO1 A;  3EZ5 A;  4DTU A;  1HYS A;  1U04 A;  2XY7 A;  2PYL A;  1TL1 A;  3AVC A;  2BE2 A;  3AV9 A;  4CER A;  3O3F A;  3KLE A;  3EYZ A;  1S5J A;  3DMJ A;  3M8R A;  4I9L A;  3HT3 A;  4HTU A;  2X78 A;  4FLX A;  1RT3 A;  1KSP A;  3OYH A;  3NGZ A;  4FJ7 A;  4KHQ A;  3HXM A;  4Z4F A;  3RMC A;  3U3Y A;  4OKK A;  4JS4 A;  3V1Q A;  3WNE A;  1BQM A;  5CYQ A;  2BGG A;  3DRP A;  5J2M A;  1O1W A;  3LAL A;  3OYM A;  4DSI A;  5E41 A;  4BDY A;  1NJW A;  1NKE A;  1KRP A;  3ASM A;  1IKY A;  4O55 A;  2YKN A;  4KPY A;  3ZSY A;  3AVM A;  3CFP A;  3FFI A;  4FLT A;  4DSF A;  5J1E A;  3ZSZ A;  4FLZ A;  2HHU A;  4CEQ A;  4CJR A;  1LAW A;  4E7L A;  3LAN A;  3QIN A;  4ID1 A;  1ZBU A;  4Y1D A;  4Y1C A;  4KRE A;  4CK3 A;  3SNN A;  4BAC A;  3SUN A;  5HRO A;  5EU7 A;  1KFD A;  3G0Z A;  1SV5 A;  4W5Q A;  2G8I A;  4AIL C;  3M8S A;  1RIL A;  5J2Q A;  2EHG A;  2YNH A;  4JLH A;  4NYN A;  1L3U A;  1CXU A;  3NH0 A;  2OPR A;  3MEC A;  2Z1I A;  3NF6 A;  3OYN A;  1I39 A;  5JS1 A;  1S1T A;  2P51 A;  4N56 A;  4NYF A;  1ZYQ A;  2JGU A;  4DQS A;  1X9M A;  2OPQ A;  4DTR A;  2E6M A;  2DFF A;  3BGR A;  4K8Z A;  4CEB A;  3NF9 A;  1QQC A;  5T7B A;  2HHW A;  4JRQ A;  1NOZ A;  1NJX A;  1NK6 A;  3OYK A;  1WNS A;  3ZSR A;  1VRT A;  4FJ5 A;  1TK8 A;  4FZY A;  1J9A A;  2AJQ A;  2OA8 A;  4CEE A;  1EXQ A;  2B5J A;  3AO1 A;  3OJU A;  3RRH A;  4FJJ A;  2YNG A;  1IO2 A;  1HMV A;  3C6U A;  4NCB A;  4FZZ A;  5FRN A;  2VWK A;  3NH1 A;  3OYA A;  2KTQ A;  1DTQ A;  2LSN A;  3TAF A;  1TL3 A;  2D0B A;  3QO9 A;  4OJR A;  4M3X A;  3S3M A;  4FJK A;  1WAJ A;  1VSL A;  4EP5 A;  3NFA A;  1YVU A;  3NF7 A;  4KO0 A;  4CHQ A;  2WON A;  4CJV A;  3O4Q A;  5J2N A;  4M3W A;  3LZJ A;  3WNH A;  3SYZ A;  1ZBL A;  4BWJ A;  4DS4 A;  4O0J A;  4C8K A;  4CJ4 A;  1RTH A;  1BHL A;  4CJ5 A;  3QEX A;  2YHB A;  1U49 A;  3ZSW A;  4E3S A;  3MXM A;  4ELT A;  4FJL A;  1VSH A;  1WAF A;  4CIE A;  2PYJ A;  4C8M A;  4DFM A;  4CFA A;  1RT2 A;  1U45 A;  2OPP A;  4RW8 A;  3T3F A;  3ZT4 A;  3EY1 A;  3AVJ A;  1BCM A;  1K6Y A;  4DFK A;  3RMA A;  4FCY A;  4CJF A;  4KHS A;  1RBT A;  4B08 A;  4C8L A;  3QEV A;  4FXD A;  1IG9 A;  3RMB A;  1WSH A;  1RT7 A;  3PX4 A;  1HNV A;  3VA3 A;  2GBZ A;  2Y1J A;  2GUI A;  1FK9 A;  1UA0 A;  4KAZ A;  3LP2 A;  4CES A;  1RCH A;  3S3N A;  5HRP A;  3KD5 E;  1Q9Y A;  3VQ4 A;  3PX6 A;  1WLJ A;  1LWC A;  4N47 A;  4CFD A;  4FJN A;  3LDS A;  3ZT2 A;  4DTJ A;  4WE1 A;  4CJS A;  4E7J A;  2E4L A;  4DS5 A;  1RTI A;  1HJR A;  3QET A;  2KZM A;  2HNZ A;  4B9N A;  1VSJ A;  1XWL A;  1NK9 A;  2P5G A;  4E19 A;  1L3S A;  1TAU A;  1Z25 A;  1S6Q A;  2YV0 X;  4YNQ A;  3TAB A;  3QEI A;  1XI1 A;  1WSI A;  1U4B A;  1JLG A;  1HYZ A;  4DU4 A;  1FXX A;  4FW1 A;  4M42 A;  4BE0 A;  3AA3 A;  3V9U A;  3TAR A;  4CF9 A;  2YHA A;  1RTD A;  4KTQ A;  3KLH A;  3OYE A;  4Z4E A;  1RT5 A;  4IBN A;  3LWL A;  4DFJ A;  1JLE A;  4CJL A;  1S1U A;  2VG7 A;  4W5R A;  2OZS A;  4B9L A;  1YTU A;  4B9M A;  2RPI A;  2ATQ A;  2I5J A;  4CJT A;  1VK0 A;  5KRT A;  3VQ6 A;  1C6V A;  3DYA A;  3L2U A;  3VQE A;  4CEA A;  4CJ3 A;  4H8K A;  3I0R A;  3HPG A;  4HUF A;  3SQ2 A;  1XHX A;  2HHT A;  1BI4 B;  3ZT3 A;  3AO4 A;  1RT4 A;  1Z26 A;  1JKH A;  3LPU A;  1QS4 A;  1VSD A;  5CZ2 A;  3TAG A;  3NAE A;  3PV8 A;  3NBP A;  1SL1 A;  4E7I A;  4JS5 A;  5CY4 A;  3DOK A;  3MXJ A;  4Z4C A;  2F96 A;  1NJZ A;  2G8K A;  1UAX A;  3AO2 A;  3AA5 X;  1GOA A;  3D45 A;  4CF0 A;  1QSL A;  3ZSX A;  3OS2 A;  3HYF A;  4CGG A;  3SI6 A;  4B3O A;  2VG5 A;  2GV9 A;  3DRS A;  4E1M A;  4CHY A;  3DLE A;  3QIP A;  3OYI A;  3NCI A;  1EET A;  1L5U A;  4O5B A;  4RW7 A;  3PO5 A;  3C6T A;  3I0S A;  3AA2 A;  3LWM A;  1S1V A;  3KLI A;  4IG0 A;  1MU2 A;  2HNY A;  4QCL A;  2WOM A;  3ZT0 A;  2IAJ A;  5KRS A;  3BDP A;  1NOY A;  3T19 A;  4AHT A;  1TAQ A;  3P5J A;  4LH4 A;  1A5V A;  4CHZ A;  2YNF A;  3VQD A;  4KTW A;  1C0U A;  4CGF A;  2R7Y A;  2HVI A;  3HL8 A;  2XO7 A;  4FJX A;  4K8X A;  2QKB A;  4I2P A;  3AVN A;  4LSN A;  4MFB A;  4J2E A;  3JYT A;  3OYB A;  4PUO A;  2NUB A;  4RW4 A;  2D5R A;  3H08 A;  4W5O A;  1TKD A;  1L3T A;  4HVJ A;  4CEC A;  2PY5 A;  4LD0 A;  3ZSQ A;  2RF2 A;  2XHB A;  3SQ0 A;  3F9K A;  2D0C A;  3ALY A;  4W5T A;  2HVH A;  3OYF A;  5JS2 A;  4J2D A;  1TVR A;  1KCF A;  4Z0U A;  4KFB A;  4CHP A;  2D0A A;  3VQA A;  1RTJ A;  3TAP A;  3VQ5 A;  2IDO A;  3OYD A;  1KVC A;  2KQ2 A;  3OYC A;  3O3G A;  4FM1 A;  4DTN A;  2YNI A;  1ASV A;  4CIG A;  1HPZ A;  4HUG A;  1UA1 A;  2IGI A;  1VSK A;  1EKE A;  2FC0 A;  2Z1G A;  3ZSV A;  4CF2 A;  1XHZ A;  1J5O A;  2F8S A;  1N6Q A;  3MXI A;  1ASW A;  5CYM A;  4E7H A;  3KD1 E;  2ZQB A;  3VQC A;  4DLG A;  4FLU A;  2DY4 A;  1WSG A;  4DTX A;  4ELU A;  2HHS A;  4KKO A;  3OYL A;  1HNI A;  2X6S A;  1S6P A;  3AVK A;  4CJU A;  4Z4H A;  4ZTF A;  2G8V A;  3KIO A;  4F3O A;  1BI4 A;  4FM0 A;  2QXF A;  3V4I A;  3UIQ A;  4QOZ B;  2EX3 A;  3U6F A;  4LH5 A;  1RDD A;  3M8Q A;  4BE1 A;  1VSM A;  4F2S A;  1GOB A;  4F8R A;  5FRM A;  3P83 D;  4MQ3 A;  4KI4 A;  4FJH A;  3CM5 A;  2RKI A;  2HHQ A;  1NKC A;  4AHC A;  1A5X A;  4RW6 A;  1Q9X A;  3OYJ A;  3M8P A;  2PZS A;  4DTO A;  3F73 A;  3TAQ A;  1U48 A;  3KK2 A;  4F3T A;  4I9Q A;  3OVN A;  3AVG A;  3K58 A;  3V9W A;  5FRO A;  1RT1 A;  2OPS A;  2IC3 A;  4DQQ A;  4DFP A;  5HRN A;  1TK0 A;  4IG3 A;  3AVH A;  3SCX A;  4B9S A;  2FBY A;  4OVL A;  1X1P A;  4DU3 A;  5HRR A;  1YTA A;  4DMN A;  4HCB A;  4N5S A;  3SPY A;  2HMI A;  4KB0 A;  1ZBH A;  3L2V A;  3P1G A;  1RBR A;  1G15 A;  4CGD A;  3KLG A;  4FLY A;  2BDP A;  1BIU A;  1L3V A;  3TAE A;  3DRR A;  3QEP A;  4AHS A;  2A1R A;  2XY6 A;  3LP0 A;  1R0A A;  1T8E A;  1ZBI A;  1C1A A;  2O4G A;  5SZT A;  4G1Q A;  4B8C A;  1TKX A;  3K5O A;  1WSJ A;  1LWE A;  1S9G A;  3CM6 A;  3LAK A;  3SUQ A;  2KFN A;  1IKX A;  1RBS A;  4R5P A;  4H4O A;  4GW6 A;  3VA0 A;  4E0D A;  3AO3 A;  4FK4 A;  5I42 A;  4CED A;  2FBV A;  2HND A;  3LAM A;  2FBT A;  4DSJ A;  4DLE A;  3HM9 A;  1BGX T;  4FJM A;  4DSE A;  4YFU A;  1JLQ A;  3K59 A;  3SUP A;  2OYQ A;  3QNO A;  4DSK A;  2Q3S A;  4ICL A;  4OLB A;  3V9S A;  4IFY A;  2ITG A;  1J54 A;  3K5M A;  3QEW A;  1BCO A;  3E01 A;  1BIZ A;  2B4J A;  4DQR A;  4CJK A;  3TAM A;  1FKP A;  3IG1 A;  3LZI A;  4E1N A;  3HPO A;  2RN2 A;  3DLH A;  4M3T A;  2XRI A;  4F2R A;  3OY9 A;  4NCA A;  5KGX A;  4O0I A;  2KZZ A;  4CJP A;  2HB5 A;  4ELV A;  3AVA A;  2VG6 A;  4Q5V A;  3U3G A;  1Y97 A;  4M41 A;  3SUO A;  4IDK A;  3RR7 A;  1SL2 A;  4C8N A;  4XIU A;  3RWU A;  4FK2 A;  3NGY A;  4PY5 A;  3HP9 A;  3CFR A;  1ASU A;  5HBM A;  1JXE A;  4FW2 A;  1LW2 A;  1W9H A;  4CGH A;  1LWF A;  4CEZ A;  1HQE A;  4CCH A;  3HVT A;  2B6A A;  3RRG A;  5DK5 A;  3IS9 A;  1NK5 A;  3IAY A;  1UWB A;  1LW0 A;  1EP4 A;  4OKE A;  1RT6 A;  3CQ8 A;  4GMJ B;  3NDK A;  3HVR A;  5J2P A;  1SKW A;  4KHN A;  4M3Y A;  4BDZ A;  1QE1 A;  1X9W A;  3T1A A;  4CGI A;  3LPT A;  1SKR A;  3L2R A;  2BAN A;  4E89 A;  1IH7 A;  4CK2 A;  1REV A;  4NCG A;  3VN5 A;  1YT3 A;  1I3A A;  2O4I A;  4F4K A;  3V9Z A;  4I2Q A;  4CJQ A;  3V9X A;  4N41 A;  3ZCM A;  3QLH A;  4FLW A;  5HRS A;  1XC9 A;  4OGC A;  1CZ9 A;  4PWD A;  1RNH A;  1WN7 A;  4OGE A;  4FYD A;  2ETJ A;  4TSX A;  1RBU A;  4FJI A;  3LP3 A;  4CEO A;  2X6N A;  3PY8 A;  4KHW A;  4M3Z A;  5KGW A;  4FLV A;  4FM2 A;  1KLM A;  4N76 A;  3VQ9 A;  1TK5 A;  3DLB A;  3AVB A;  3V81 A;  1SUQ A;  3L2W A;  3OS1 A;  4BWM A;  2VWJ A;  5K14 A;  1B92 A;  4CJE A;  5KTQ A;  1LAV A;  5CZ1 A;  3IRX A;  4RG8 A;  1KFS A;  4CHN A;  4CHO A;  4JRP A;  1Q8I A;  2JLE A;  3RR8 A;  2P5O A;  4CGJ A;  4KHU A;  2F8T A;  4B9U A;  3VQ7 A;  2HW3 A;  1IKW A;  3VQ8 A;  1TGO A;  3QER A;  1SL0 A;  1D8Y A;  1NKB A;  2QKK A;  3S3O A;  4J2A A;  4LY7 A;  5FDL A;  4O44 A;  1EX4 A;  3AVI A;  4OKJ A;  4ZTJ A;  1DLO A;  4J2B A;  1T05 A;  3HK2 A;  1QHT A;  2W42 A;  1BQN A;  4FJ9 A;  4I7F A;  3AVL A;  4DG1 A;  4KTZ A;  1RDB A;  3B6O A;  2G8F A;  1TV6 A;  3K57 A;  2DFE A;  1C0T A;  3L3U A;  3MAQ A;  1T03 A;  3OJS A;  1U47 A;  1KTQ A;  1WSF A;  3NGI A;  4Z4I A;  2IS3 A;  3QNN A;  3QIO A;  1NK0 A;  3KTQ A;  3KKR A;  4DSL A;  3TI0 A;  3SV4 A;  4DQP A;  4B8A B;  1F21 A;  4AHU A;  3DM2 A;  1C1B A;  4M45 A;  2XY8 A;  3G10 A;  3MEG A;  1CXQ A;  1IKV A;  4IFV A;  5SWM A;  3KLF A;  3DLK A;  3TWH A;  4DQI A;  1S1X A;  4KHY A;  3ITH A;  5C24 A;  3HJF A;  4EZ9 A;  5I3U A;  2QK9 A;  3S9H A;  2ZE2 A;  4OPK A;  3KJV A;  4KB1 A;  3L3V A;  3CYM A;  3WNF A;  4CEF A;  3THV A;  4H4M A;  4CE9 A;  3ZSO A;  4DF8 A;  1QSY A;  2OZM A;  4FZX C;  1D5A A;  2Z1J A;  4C8O A;  2KFZ A;  3C95 A;  3DI6 A;  1CZB A;  1VSE A;  3C94 A;  4CFB A;  4QAG A;  5HP1 A;  4PA1 A;  4M3U A;  3DLG A;  3TAN A;  3ZT1 A;  3AO5 A;  2G8W A;  2KW4 A;  3KK1 A;  1B9F A;  1JL1 A;  3CG7 A;  4Z4G A;  1JL2 A;  4DF4 A;  4CF8 A;  4CIF A;  2DTU A;  3RTV A;  3TR8 A;  4HHT A;  4B9V A;  5C42 A;  4OPJ A;  1DTT A;  3NF8 A;  3A2F A;  3AA4 A;  3NHG A;  3K5L A;  4DWI A;  1C1C A;  3MED A;  4EP4 A;  2X74 A;  1BIS A;  1TKT A;  4AHR A;  3KK3 A;  4FVM A;  3RMD A;  3HPH A;  1QSS A;  4PQU A;  3I8D A;  3JSM A;  2Y1I A;  3OYG A;  3V6D A;  3O4N A;  4M3R A;  4AH9 A;  1QTM A;  1HRH A;  1FKO A;  5DMR A;  1VSI A;  4OLA A;  4FJ8 A;  4UQG A;  3AVF A;  3KKS A;  4CJW A;  1TKZ A;  4BDP A;  1HYV A;  4DTM A;  4W5N A;  1JLA A;  4IKF A;  2HHX A;  1JXB A;  1B9D A;  3VQP A;  5HLF A;  4FK0 A;  2XY5 A;  1J53 A;  3SQ4 A;  4KRF A;  1BL3 A;  4AHV A;  1N5Y A;  3L2Q A;  1JLC A;  3L8B A;  1X9S A;  1JLF A;  3WNG A;  3D0P A;  4LSL A;  1D9F A;  3SQ1 A;  3LP1 A;  1S9E A;  1NK4 A;  2E6L A;  4ID5 A;  2Z1H A;  1S1W A;  3DLR A;  1RDA A;  3VQQ A;  3PO4 A;  2YKM A;  1D9D A;  3ISN C;  2A1S A; 
#chains in the Genus database with same CATH topology
 3ULD A;  3SPZ A;  4L8R B;  3HP6 A;  4O4G A;  3E66 A;  3K5N A;  4NB4 A;  3V1R A;  2YHY A;  3DOL A;  3NMU A;  1A5W A;  4EHU A;  1VQM N;  3CCS N;  3V1O A;  2IVO A;  3VPZ A;  4KI6 A;  1VQO N;  1RDC A;  3B6P A;  3ZEU B;  3CFO A;  3MEE A;  1QZ5 A;  4E7K A;  1ZC6 A;  1ZBF A;  3L6Q A;  1T7P A;  1IBL K;  1KVB A;  3UKR A;  1YXQ A;  2WUS A;  2XY7 A;  2PYL A;  1J6Z A;  3AV9 A;  1S5J A;  3M8R A;  1YJW N;  2X78 A;  4FLX A;  1RT3 A;  3OYH A;  4Y0W A;  4FWQ A;  4OKK A;  2FF3 B;  5AR0 A;  1BQM A;  3O1B A;  4JHD A;  2BGG A;  3DRP A;  1O1W A;  1YJN N;  2F4V K;  1KRP A;  4BDY A;  4EFH A;  4I6M A;  5LJW A;  3ZSY A;  2QWN A;  5J1E A;  4FLZ A;  2NRV A;  4CVN E;  4CJR A;  1QHA A;  4WQ5 C;  4BQZ A;  5BR8 K;  1ZBU A;  3SNN A;  2YX6 A;  4W5Q A;  3KZB A;  1M90 O;  4AIL C;  4WF9 L;  5J2Q A;  5EVZ A;  2EHG A;  4IZ9 A;  5JMV A;  3VEZ A;  1L3U A;  4H0V B;  3NH0 A;  4BGA A;  2DPN A;  1ZYQ A;  1X9M A;  2DFF A;  4IOA L;  2QA4 N;  1QQC A;  5C2F A;  4JRQ A;  1NJX A;  1NK6 A;  1VRT A;  1TK8 A;  4CEE A;  1EXQ A;  4FJJ A;  5AQK A;  4BRQ A;  4BRK A;  1HX1 A;  3OA9 A;  1HMV A;  5JVH L;  4CZL A;  4NCB A;  3FZM A;  3NH1 A;  3TAF A;  5AQF A;  1NBW A;  1X3N A;  2VGM A;  1IBK K;  1VSL A;  2WON A;  4EAH D;  5J2N A;  2O8D B;  4CJ4 A;  3QEX A;  1U49 A;  2W6K A;  4E3S A;  3MN7 A;  3IUC A;  2PYJ A;  5IWA K;  5AZJ A;  1RT2 A;  3EL2 A;  3CC4 N;  3EY1 A;  5LJV A;  4RCH A;  5JLF A;  4KHS A;  3RMB A;  1RT7 A;  3N4Q A;  4JKC A;  4LFA K;  1UA0 A;  4KAZ A;  4CES A;  1RCH A;  2GWJ A;  5BRD A;  4BR9 A;  3ZT2 A;  4WE1 A;  4CJS A;  4E7J A;  4DS5 A;  1RTI A;  1HJR A;  4HWI A;  4WQ4 A;  2NRH A;  1U4B A;  1WSI A;  1JLG A;  2GWK A;  3VGM A;  1Q82 O;  3GE1 A;  3AA3 A;  3U4L A;  3TAR A;  2YHA A;  1RTD A;  3O6W A;  1RT5 A;  4IBN A;  4R79 A;  1YI2 N;  4W5R A;  4CJT A;  1VK0 A;  5M1K A;  5KRT A;  3EO3 A;  3D2E B;  3E9L A;  4CEA A;  3HPG A;  1T3V A;  4JKG B;  4FWP A;  1RT4 A;  1Z26 A;  1IV0 A;  3LPU A;  4MDB A;  5CZ2 A;  1P8Z A;  2D0O A;  4JS5 A;  5CY4 A;  5ELZ A;  2NRZ A;  3BUZ B;  2G8K A;  4ISE A;  3CD6 N;  4H0P A;  1MWM A;  3AA5 X;  4H0T B;  1GOA A;  3ZSX A;  3OS2 A;  3OHR A;  3DRS A;  4CHY A;  3DLE A;  1EET A;  1BA0 A;  2Q2R A;  4RW7 A;  3PO5 A;  3C6T A;  1R59 O;  3UKU A;  3G4S N;  1S22 A;  3KLI A;  2P9K A;  2P9U B;  2WOM A;  3SLC A;  3VQD A;  4I2P A;  4LSN A;  2KLA A;  4JYA K;  4CW7 B;  4W5O A;  1L3T A;  3BP8 A;  2RF2 A;  3SQ0 A;  5BN8 A;  2YHW A;  1TVR A;  1KCF A;  4Z0U A;  3J7Z O;  3K9K A;  1DGK N;  1RTJ A;  1KVC A;  3PIP L;  2ASO A;  5A2Q O;  1ATS A;  4JI6 K;  1ASW A;  1RDW X;  4E7H A;  3VQC A;  2DY4 A;  4ELU A;  4DTX A;  4CJU A;  3AVK A;  4ZTF A;  3ZYY X;  3KIO A;  3UIQ A;  2GUP A;  3VMF B;  1SQK A;  2A5X A;  1GOB A;  4BC4 A;  5FRM A;  1NLV A;  2NZT A;  3CM5 A;  3HI0 A;  2RKI A;  1NKC A;  3D6R A;  5M1P A;  2PZS A;  4F3T A;  3OVN A;  3OBW A;  4BG8 A;  5FPD A;  1NNE A;  4DQQ A;  3EKU A;  1W7A A;  4KH4 A;  2FBY A;  4OVL A;  1YTA A;  2HBL A;  4DMN A;  4HCB A;  3P1G A;  1RBR A;  4CGD A;  4FLY A;  2BDP A;  1L3V A;  4BRD A;  3DRR A;  2UUB K;  2A1R A;  2W40 A;  1C1A A;  1MA9 B;  4G1Q A;  3TSQ A;  3K5O A;  1WSJ A;  2Q31 A;  3SUQ A;  3FZL A;  1MDU B;  3VA0 A;  3AO3 A;  2FBV A;  3CJ7 A;  5TKW A;  4FJM A;  1JLQ A;  3THY B;  4JI3 K;  5KQD A;  3QNO A;  2A42 A;  3H46 O;  3R8E A;  1BIZ A;  2B4J A;  1FKP A;  3OY9 A;  1XNR K;  4O0I A;  2OTJ N;  2HB5 A;  5F0X A;  3AVA A;  2VG6 A;  3WEE A;  4Q5V A;  4DR2 K;  4PY5 A;  4C8N A;  3NGY A;  3DXK A;  3CFR A;  1H1V A;  3VEO A;  1BG3 A;  1W9H A;  4X62 K;  4CEZ A;  4ILG B;  2E2P A;  3CXC M;  3IS9 A;  5KQ8 A;  1LW0 A;  5J2P A;  3NDK A;  3HVR A;  1X9W A;  4FWS A;  3CJ9 A;  3TPQ A;  1J5E K;  4E89 A;  1EWQ A;  4ILJ A;  1REV A;  4NCG A;  4K0K K;  2QXL A;  1Z05 A;  4F4K A;  4I2Q A;  4CJQ A;  3V9X A;  4N41 A;  3ZCM A;  3HTV A;  5HRS A;  2BUP A;  4IOX A;  5AQS A;  4PWD A;  5I9E B;  2GTD A;  4FJI A;  4KHW A;  2X6N A;  3THX B;  4PHT X;  5KGW A;  4FLV A;  4N76 A;  2OAN A;  3LDQ A;  1VQ9 N;  5GIN A;  1DT9 A;  3L2W A;  2VWJ A;  2QWR A;  3HZ6 A;  5KTQ A;  4DQ8 A;  3IRX A;  2NRX A;  3SJH A;  1KFS A;  4CHN A;  3MX2 A;  3MN9 A;  4CGJ A;  4KHU A;  1BDG A;  2V7Y A;  1HNW K;  3VQ7 A;  2Q0R A;  1KC8 O;  3AAR A;  2QKK A;  4GV9 A;  2O8E A;  2FF6 A;  3CCJ N;  4LY7 A;  4DR6 K;  4OKJ A;  4WQ4 C;  5AQR A;  4J2B A;  1QHT A;  3MMV A;  1BQN A;  3J7A P;  1RDB A;  4B1X B;  1TV6 A;  4IFE A;  4BR4 A;  3K57 A;  2DFE A;  3SMS A;  5AQH A;  3OJS A;  4M7Y A;  3QIO A;  3KKR A;  3TI0 A;  4BR0 A;  3SV4 A;  4DQP A;  3OBY A;  3RSE B;  4BR7 A;  3MEG A;  1CXQ A;  3C7N B;  4IFV A;  2VWB A;  3KLF A;  4DQI A;  1KQS M;  5C24 A;  3CCL N;  4RWT A;  2QK9 A;  4FOE A;  4BRM A;  2PFU A;  3VER A;  4CEF A;  3N4P A;  3Q7B A;  4KH6 A;  4CE9 A;  1D5A A;  4C8O A;  2KFZ A;  3C94 A;  1XC3 A;  4CFB A;  3DLG A;  4YOR A;  3KK1 A;  2E5L K;  4Z4G A;  4GKK K;  2DTU A;  4CF8 A;  3TR8 A;  4B9V A;  3NF8 A;  3K5L A;  1C1C A;  3L4Q A;  3MED A;  2X74 A;  1TKT A;  4AHR A;  4B1Z A;  4WCE L;  2D1K A;  3I8D A;  5AZI A;  3O4N A;  4M7X A;  5CHI A;  3KKS A;  4CJW A;  1TKZ A;  4BDP A;  4DTM A;  4W5N A;  3D7E O;  3JS6 A;  1W2B M;  4CBW A;  3HOT A;  2XY5 A;  1NMD A;  1YHQ N;  5DM7 L;  4B1U B;  3WNG A;  3D0P A;  2E2Q A;  2QW9 A;  1GLC G;  1NK4 A;  2P9L B;  4UY8 O;  2Z1H A;  3PO4 A;  3ISN C;  3H1V X;  4DLG A;  1ITG A;  4AQY K;  3QIC A;  4JK9 A;  4LF8 K;  5AQG A;  4RW9 A;  4DV6 K;  5ADX A;  2Q97 A;  4H0O A;  2ZWH A;  3CPE A;  2P1J A;  3SAG A;  4YOT A;  1VRU A;  1SKS A;  4F9O A;  3K2P A;  4CK1 A;  3TU5 A;  1KAY A;  4H5N A;  1HQU A;  3AGR A;  5ADX H;  4GVM A;  3NH2 A;  4DTP A;  2VQF K;  4BE2 A;  4JAX A;  4EZ6 A;  1WSE A;  3VQB A;  3HO1 A;  2O8C A;  2BE2 A;  4IJN A;  3KLE A;  3P39 A;  2O8B A;  3DMJ A;  5AQL A;  4I9L A;  3R3L A;  4Z94 A;  5C10 A;  4DV3 K;  4K42 A;  3ULE A;  4BRO A;  2PAV A;  2P9I B;  3T1H K;  3RMC A;  3V1Q A;  2E2O A;  3CCE N;  3OYM A;  1DKG D;  1VQN N;  5E41 A;  1NJW A;  1NKE A;  4O55 A;  1VQ8 N;  3CFP A;  2YCH A;  4FWO A;  4H0X B;  1K8K B;  2FSJ A;  4DSF A;  4A62 A;  1NGB A;  4IO9 L;  2HHU A;  4DV2 K;  3VF4 A;  3QIN A;  3CMA N;  4CK3 A;  1I94 K;  3QFP A;  1KFD A;  2G8I A;  3M8S A;  4NYN A;  5FPN A;  2Z1I A;  4FPB A;  1I39 A;  3H3N O;  5EXW A;  4BVP A;  1QQO A;  2P51 A;  2F7T A;  4NYF A;  2JGU A;  4DTR A;  2E6M A;  3BGR A;  3SBG A;  1ESV A;  5T7B A;  2HHW A;  5GAH P;  1NOZ A;  4FPA A;  2W6L A;  2AJQ A;  2OA8 A;  3WUH A;  1NGC A;  5FRN A;  3C6U A;  3LM9 A;  2VWK A;  2KTQ A;  3OYA A;  2P9N A;  2D0B A;  3S3M A;  4FJK A;  1WAJ A;  3O8M A;  4EP5 A;  4CJV A;  4IOC L;  2YI1 A;  4M3W A;  3LZJ A;  3THW A;  3WNH A;  1ZBL A;  1Z6R A;  1RTH A;  2YHB A;  3UE5 A;  3ZSW A;  3MCP A;  1VQP N;  4ELT A;  1WAF A;  1M1K O;  4CFA A;  3LDL A;  3FZF A;  2ZJR L;  1BCM A;  1NJI O;  1RBT A;  3PX4 A;  2Y1J A;  3LDP A;  3FE1 A;  1FK9 A;  4WFN L;  5FPM A;  3S3N A;  5AFU H;  2VQE K;  1RDU A;  1LWC A;  4XH5 A;  2O8F A;  2KHO A;  3BZK A;  4FJN A;  4DTJ A;  4BRF A;  2KZM A;  4B9N A;  2E2N A;  4GV3 A;  4DUY K;  1Z25 A;  3VES A;  1S6Q A;  3BF1 A;  3QEI A;  3FGU A;  3O9S A;  4BR2 A;  4OX9 K;  3VGL A;  3V9U A;  4Z4E A;  1VAZ A;  2OZS A;  3LWL A;  4B9L A;  1YTU A;  4A5A A;  2I5J A;  3L2U A;  1C6V A;  3CCR N;  1T6D A;  2IVP A;  4OO1 J;  5DM6 L;  3W3D A;  3EN9 A;  3SQ2 A;  3ZT3 A;  3PV8 A;  3NBP A;  1SL1 A;  3J8A A;  3SBT A;  4E7I A;  4C1N I;  2F96 A;  3G6E N;  1UAX A;  4CD3 A;  1JCE A;  2HST A;  4FVU A;  2IVN A;  3O9Q A;  3ZX3 A;  4E1M A;  4BRL A;  1W97 L;  2CGL A;  5BRE A;  4O5B A;  4MO4 A;  4ISG A;  4C23 A;  4IG0 A;  1MU2 A;  4A2A A;  2IAJ A;  1G99 A;  5KRS A;  3BDP A;  4AHT A;  1A5V A;  2R7Y A;  1E4G T;  2XO7 A;  1K9M O;  2QKB A;  3AVN A;  4KH5 A;  3FR0 A;  3G25 A;  5AQX A;  1JCF A;  3H08 A;  1TKD A;  2YJF A;  3O4W A;  4JKD A;  4LD0 A;  2QWO A;  3F9K A;  2E1Z A;  3ALY A;  1ATN A;  4J2D A;  4A57 A;  4KFB A;  4CHP A;  3VQA A;  4U67 L;  1VQ5 N;  1YAG A;  1UA1 A;  4HUG A;  5BPN A;  1VSK A;  1XHZ A;  2FC0 A;  1WUA A;  1J5O A;  1VQ7 N;  3PLA A;  1N6Q A;  3MXI A;  4G9Z A;  5BPM A;  3KD1 E;  3ZET A;  2HHS A;  1S6P A;  1VQ6 N;  1BI4 A;  2QXF A;  2EX3 A;  3U6F A;  2A3Z A;  4LH5 A;  2WBN A;  3M8Q A;  4BRN A;  4BE1 A;  4F2S A;  4CZM A;  3P83 D;  2HHH K;  2W41 A;  4AHC A;  4JKB A;  3OYJ A;  3TAQ A;  1U2V A;  4I9Q A;  4LF6 K;  3AVG A;  5FRO A;  1RT1 A;  2IC3 A;  1KAZ A;  3R9P A;  2JWL A;  5HRN A;  3F2K A;  4B9S A;  3DXM B;  5LY3 A;  3A5N C;  1X1P A;  3D2F A;  2A41 A;  3P31 A;  4N5S A;  2HMI A;  5AQN A;  5B8H A;  3L2V A;  4X65 K;  3ZX0 A;  2P9S A;  3TAE A;  3C6A A;  3QEP A;  2XY6 A;  1T8E A;  2O4G A;  4B8C A;  1TKX A;  2QWP A;  3CM6 A;  2KFN A;  4QS9 A;  1IKX A;  4GW6 A;  5FLX O;  4E0D A;  4CED A;  2HND A;  4DSJ A;  3HM9 A;  4DSE A;  4BY9 C;  2A6A A;  4NXN K;  3MN6 A;  2OYQ A;  4XH4 A;  1X3M A;  1FJG K;  2Q3S A;  3K5M A;  1N32 K;  2J4R A;  1BCO A;  3E01 A;  2GX9 A;  4DQR A;  5M1N A;  2FSN A;  4JN4 A;  1OVY A;  3M5R A;  1N36 K;  3DLH A;  2ASP A;  4FWL A;  4CJP A;  3ID8 A;  3U3G A;  1Y97 A;  1SL2 A;  4FK2 A;  5HBM A;  3QBX A;  3IAY A;  1UWB A;  4KHN A;  4OKE A;  3CQ8 A;  3CQX A;  1SKW A;  4M3Y A;  3T7Z A;  3T1A A;  4CGI A;  5AQU A;  4YY3 K;  1IH7 A;  4CK2 A;  4JI2 K;  3VN5 A;  4B9Q A;  2O4I A;  5F2R A;  3MCA B;  1TYQ B;  3V9Z A;  4GNI A;  4FO0 A;  5AQP A;  1Q81 O;  3QLH A;  1WN7 A;  3CPW M;  1NGG A;  3CER A;  3LP3 A;  4BRH A;  1KLM A;  1TK5 A;  3DLB A;  1SUQ A;  1B92 A;  5CZ1 A;  3Q7C A;  4EHT A;  2QTD A;  4YOX A;  4ILH A;  1GLB G;  4B1Y B;  3VQ8 A;  1SL0 A;  4NLB A;  2YJE A;  3EKS A;  4CI6 A;  1X9J A;  4MLH A;  1OH8 A;  3HK2 A;  4YDU C;  2W42 A;  3AVL A;  3B6O A;  5GAE P;  4DV5 K;  5M1F A;  1WSF A;  2IS3 A;  2D4W A;  1F21 A;  3DM2 A;  1C1B A;  2XY8 A;  5SWM A;  2KKZ A;  5I3U A;  1DEJ A;  3KJV A;  5AQY A;  4H4M A;  2OZM A;  1CZB A;  3VF2 A;  1WBD A;  3IMX A;  3CJA A;  3ZT1 A;  2KW4 A;  1B9F A;  1JL1 A;  3CG7 A;  2F9T A;  3VET A;  1BWF O;  4HHT A;  3RTV A;  5C42 A;  4OPJ A;  1DTT A;  3UKR B;  4A61 A;  3A2F A;  3NHG A;  3CCM N;  5JVG L;  3HBT A;  4EP4 A;  4DR3 K;  1BIS A;  1QSS A;  2QWQ A;  4JV5 K;  3DWL A;  3V6D A;  1YF5 L;  2E1Y A;  4M3R A;  1GLF O;  1HRH A;  1FKO A;  1NMN A;  4GKJ K;  5DMR A;  3O80 A;  4FJ8 A;  2Q1N A;  3AVF A;  2WTU A;  1HYV A;  3K0S A;  3CI5 A;  4JHD B;  2HHX A;  1JXB A;  3VQP A;  2ZM6 K;  5HLF A;  4YOW A;  3H45 C;  5MLC Q;  4KRF A;  3L2Q A;  4YHH K;  1SZ2 A;  4I6M B;  3L8B A;  3EE8 A;  5FPE A;  1D9F A;  2E6L A;  2JWK A;  4L3Q A;  5F1X A;  1RDA A;  4BRP A;  1D9D A;  4GVE A;  3P38 A;  2A1S A;  1W0H A;  4KI4 A;  4B3T K;  5KI6 A;  1GOC A;  5AQO A;  1C0M A;  1GLJ O;  3SV3 A;  1NJY A;  1KLN A;  4B3R K;  2UUA K;  1NK8 A;  3O1W A;  1E4F T;  1UOC A;  2P9P A;  2DFH A;  4CFC A;  5C25 A;  2G8U A;  3SMP A;  4CZK A;  2ZJQ L;  2ZD1 A;  1XUP O;  1VSF A;  4LFB K;  2G8H A;  4MLE A;  4A2B A;  4B9T A;  3CQY A;  4YOU A;  3QES A;  3SJJ A;  2IOC A;  2QI2 A;  4KV8 A;  4NXM K;  2UYT A;  2PBD A;  1HYS A;  1U04 A;  3R1X A;  3LL3 A;  1TL1 A;  3AVC A;  3U9Z A;  4CER A;  3MDQ A;  3EYZ A;  4HTU A;  3HT3 A;  4J8F A;  5M1O A;  5E26 A;  1KSP A;  3S41 A;  3NGZ A;  4KHQ A;  1U2V B;  4JD2 A;  3U3Y A;  5AZJ B;  3WQU A;  2EWS A;  3CCV N;  5CYQ A;  3F5T A;  5J2M A;  3LAL A;  4JK8 A;  3H6E A;  4DSI A;  5C15 A;  3ASM A;  2ZGZ A;  3ZLJ A;  3AVM A;  3SK3 A;  3ZSZ A;  4K41 A;  4CEQ A;  1LAW A;  4E7L A;  4ID1 A;  4QS8 A;  4Y1C A;  4Y1D A;  4KRE A;  5HOO A;  5HRO A;  5EU7 A;  2VYP A;  3KHY A;  2YNH A;  5KPT A;  5GAG P;  1CXU A;  2OPR A;  3MEC A;  3NF6 A;  3OYN A;  4N56 A;  4IEE A;  1GLA G;  1K8A O;  3NF9 A;  3ZEU A;  1HPM A;  4H03 B;  1WNS A;  3ZSR A;  4FJ5 A;  1NGD A;  1XNQ K;  1J9A A;  3SAF A;  3OJU A;  3RRH A;  2YNG A;  5C2D A;  4OPA A;  1Q7Y O;  2OCE A;  3C65 A;  4H5R A;  2LSN A;  5M1Q A;  4A59 A;  1TL3 A;  3QO9 A;  5LMU K;  1TUY A;  4V19 S;  3A5L C;  4A5B A;  4CZJ A;  1YVU A;  4KO0 A;  4CHQ A;  1C0G A;  1VHX A;  3DJC A;  5KPZ A;  4C8K A;  4BWJ A;  4O0J A;  3I33 A;  2HMP A;  1BHL A;  4CBX A;  3AGK A;  4FJL A;  1VSH A;  2OPP A;  4RW8 A;  5LL6 Z;  5GIP A;  3T3F A;  1K6Y A;  3RMA A;  1HJO A;  3CJ1 A;  3UKU B;  4B08 A;  4KBO A;  3QEV A;  1IG9 A;  2P9K B;  2GBZ A;  2GUI A;  3EEQ A;  3ZX2 A;  5HRP A;  1Q9Y A;  3VQ4 A;  1WLJ A;  5AQI A;  4BVO A;  1WB9 A;  2GEL A;  4IO8 A;  3MK6 A;  4E1J A;  1VSJ A;  3VEY A;  3O9U A;  4E19 A;  1L3S A;  4YNQ A;  1XI1 A;  1XMQ K;  4DU4 A;  4IXC A;  1FXX A;  4FW1 A;  4M42 A;  1V4S A;  4DB3 A;  3VEN A;  3AAP A;  4KTQ A;  4DFJ A;  2WFB A;  4FL9 A;  4PL8 A;  2RPI A;  3HM8 A;  3GG4 A;  1BUP A;  1OKJ A;  4QS7 A;  2NRW A;  3DYA A;  3VQ6 A;  4FWN A;  4B1V A;  3ENO A;  4H8K A;  1IBM K;  4HUF A;  2HHT A;  1XHX A;  4BGB A;  2NLX A;  1QS4 A;  2RHK A;  2Q0U A;  3OTO K;  2O8D A;  3DOK A;  5C0Y A;  1NJZ A;  3AO2 A;  4OPH A;  3QFU A;  5JIC A;  1QSL A;  1NGH A;  2VG5 A;  2GV9 A;  3GBT A;  3NCI A;  3QIP A;  1L5U A;  1SAZ A;  1HNX K;  3I0S A;  3AA2 A;  3LWM A;  3QML A;  4QCL A;  3ZT0 A;  4CZH A;  3T19 A;  1TAQ A;  3P5J A;  3A5M C;  4LH4 A;  3WXM B;  4KTW A;  1C0U A;  4CGF A;  3HL8 A;  4FJX A;  4K8X A;  3OYB A;  4IWV A;  4PUO A;  2D5R A;  2RE2 A;  2PY5 A;  1HKG A;  3ZSQ A;  2XHB A;  3F9M A;  2HVH A;  4JK7 A;  2QEX N;  3VQ5 A;  1TUU A;  3OYD A;  4U7B A;  2KQ2 A;  4DTN A;  1SKR A;  2YNI A;  1ASV A;  2F8S A;  3ZSV A;  4RTF D;  5AQJ A;  3L0Q A;  5IT9 O;  1OH6 A;  3D2E A;  3WEE B;  5GAD P;  3OYL A;  1HNI A;  4FWR A;  4AM7 A;  1E3M A;  2BH1 A;  4Z4H A;  4PKH A;  3DXK B;  4JKG A;  2G8V A;  3V4I A;  1HNZ K;  4QOZ B;  2P9P B;  3H3O B;  5AQW A;  1VSM A;  3G71 N;  1OH7 A;  4F8R A;  3GDQ A;  4FJH A;  1JCG A;  2V52 B;  2HHQ A;  1A5X A;  3KWI A;  4RW6 A;  1Q9X A;  3M8P A;  3BY5 A;  4DTO A;  2CGK A;  4BRE A;  5AFU A;  3K58 A;  2OPS A;  4IEI A;  4IG3 A;  3SCX A;  1NM1 A;  3KVG A;  1XQS C;  3GOI A;  3JAM O;  4DU3 A;  5HRR A;  2P9U A;  3SPY A;  1S72 N;  1BIU A;  4DV1 K;  4AHS A;  1ZBI A;  3C0B A;  3T69 A;  1LWE A;  1QVF M;  4BRC A;  3B8A X;  4DLE A;  2O8E B;  4YFU A;  4DR5 K;  4DSK A;  4ICL A;  4YDU A;  4OLB A;  3V9S A;  2ITG A;  1J54 A;  4CJK A;  3TAM A;  4MDA A;  2RN2 A;  4NCA A;  4JEP A;  3CJB A;  5KGX A;  2KZZ A;  2NNW A;  4ELV A;  5AQM A;  2HHV A;  4M41 A;  3HP9 A;  1ASU A;  1LW2 A;  4CGH A;  1K73 O;  1LWF A;  1HQE A;  2OTL N;  4CCH A;  2UUC K;  2CH6 A;  1EQY A;  3TTF A;  4GY2 B;  5DK5 A;  4O8U A;  1EP4 A;  3EE9 A;  1RT6 A;  1D4X A;  2Q36 A;  4BC3 A;  3CET A;  3T1Y K;  3IFR A;  3L2R A;  2BAN A;  4JI4 K;  1YT3 A;  1I3A A;  4DR7 K;  4FLW A;  1YVN A;  1CZ9 A;  4PL7 A;  4OGE A;  2ETJ A;  2AP1 A;  2QWM A;  3L4I A;  4LF7 K;  3AVB A;  3ID6 A;  3OS1 A;  4BWM A;  3WXI A;  4RG8 A;  4CHO A;  4JRP A;  5AZI B;  2HBK A;  3RR8 A;  2P5O A;  1KAX A;  2F8T A;  4B9U A;  3QER A;  1D8Y A;  1NKB A;  3VF6 A;  3THY A;  4BRA A;  2QWL A;  1ZXO A;  5FDL A;  1EX4 A;  4FJ9 A;  4I7F A;  3O9T A;  4KTZ A;  3WQT A;  4EIA A;  2G8F A;  1N34 K;  5LMN K;  3M1F A;  1C0T A;  3L3U A;  1BOT O;  3QB0 A;  4XH1 A;  4CJ7 A;  1T03 A;  1U47 A;  3NGI A;  4Z4I A;  3QNN A;  4DSL A;  1NK0 A;  4M45 A;  3G10 A;  3DLK A;  4O5F A;  2ZF5 O;  1S1X A;  1JJ2 M;  3ITH A;  4DCH A;  4EZ9 A;  1N8R O;  2ZE2 A;  4OPK A;  1ILY A;  4KB1 A;  1OVQ A;  3FLC O;  3CYM A;  3E1Y A;  1NGE A;  3WNF A;  3ZSO A;  4DF8 A;  2Z1J A;  3C95 A;  4LF5 K;  3GL1 A;  1VQK N;  4QAG A;  5HP1 A;  4M3U A;  1CZA N;  3THX A;  4CIF A;  3C6H A;  2O8C B;  4DWI A;  4CZI A;  2O8B B;  4FWM A;  3RMD A;  3HPH A;  3JSM A;  2Y1I A;  4ISF A;  3ULE B;  1QTM A;  5JLH A;  1NG9 A;  5CR4 A;  4KHP K;  1B9D A;  1RFQ A;  3NVM A;  4AHV A;  1X9S A;  1BA1 A;  3CIP A;  4ID5 A;  3CHW A;  1C0F A;  1S1W A;  3DLR A;  3VQQ A;  2YKM A;  4BRG A;  3NE6 A;  4CF1 A;  4HUE A;  4WFA L;  4ZHR A;  4DR4 K;  1EO1 A;  3RSE A;  2F9W A;  3C7N A;  2VGN A;  3O3H A;  3PX0 A;  3DLL L;  3PUF A;  3J7Y P;  1YUW A;  4PKI A;  4FJG A;  2FBX A;  3OS0 A;  5D3G A;  5BRF A;  4Q0B A;  1LV5 A;  4DU1 A;  3PSI A;  1NK7 A;  1RBV A;  1JLB A;  4HCC A;  1CLQ A;  3MWT A;  4X64 K;  2CH5 A;  4DTS A;  3J81 O;  3HST B;  1KVA A;  2E88 A;  2CGJ A;  4FOI A;  3SZ2 A;  3LM2 A;  3EZ5 A;  4DTU A;  1GLL O;  2P9N B;  3AAQ A;  3O3F A;  3THW B;  3VEW A;  3ENB A;  4LC9 B;  1GLD G;  4FJ7 A;  2D0P A;  4BRI A;  3HXM A;  3I55 N;  4JS4 A;  1LCU A;  3PSF A;  3WNE A;  1KXP A;  2E8A A;  3E9O A;  5BRH A;  1IKY A;  1QQM A;  2YKN A;  2NRR A;  3UB5 A;  4KPY A;  3FFI A;  4FLT A;  2P9L A;  1VQ4 N;  1FW6 A;  1XMO K;  3LAN A;  1Q86 O;  4BAC A;  3BZC A;  2ZJP L;  3SUN A;  2O8F B;  3G0Z A;  1SV5 A;  1RIL A;  1WBB A;  1VQL N;  4JI5 K;  4JLH A;  3TTD A;  1NU0 A;  5AQV A;  3U9D A;  1EWR A;  3VTI A;  3TSU A;  5JS1 A;  1S1T A;  1BU6 O;  4DQS A;  1YIT N;  2OPQ A;  4K8Z A;  1N33 K;  5H1S Q;  4IJA A;  4CEB A;  3OYK A;  3JXU A;  1HLU A;  4FZY A;  4M63 C;  4BQL A;  2B5J A;  3AO1 A;  5BN9 A;  4XEI A;  1IO2 A;  4BC2 A;  4FZZ A;  3EZW A;  1DTQ A;  4M3X A;  2UXC K;  4OJR A;  3CJC A;  3NFA A;  3NF7 A;  5AQT A;  3KWG A;  3O4Q A;  1OH5 A;  3SYZ A;  4DS4 A;  4JI1 K;  3WT0 A;  4CJ5 A;  1Y64 A;  2P9I A;  2I7P A;  4C1N K;  4DKW A;  3FZH A;  3MXM A;  4CIE A;  4C8M A;  4DFM A;  1U45 A;  3VTH A;  4PKG A;  3ZT4 A;  3AVJ A;  4DFK A;  4FCY A;  4CJF A;  4C8L A;  1WSH A;  2VCP A;  5AQQ A;  1HNV A;  3VA3 A;  3WXJ A;  1K8K A;  2IIR A;  4H5V A;  3LP2 A;  3WXK A;  3KD5 E;  1NGJ A;  4MO5 A;  3O9R A;  3FFK B;  1QQN A;  3PX6 A;  4N47 A;  4CFD A;  3LDS A;  2E4L A;  3QET A;  2FXU A;  3O08 A;  2HNZ A;  4H0Y B;  4DR1 K;  1XWL A;  1NK9 A;  2P5G A;  1TAU A;  2YV0 X;  3TAB A;  1S3X A;  1HYZ A;  2V7Z A;  4BE0 A;  1O13 A;  3A5O C;  3O5B A;  4CF9 A;  4YOY A;  3CC7 N;  3KLH A;  3OYE A;  4FXD A;  1JLE A;  4CJL A;  1S1U A;  2VG7 A;  3A0I X;  4B9M A;  2ATQ A;  1ZBS A;  3ZET B;  3VQE A;  4CJ3 A;  3I0R A;  4BG9 A;  1Q18 A;  1BI4 B;  3AO4 A;  1JKH A;  1IJJ A;  1VSD A;  3TAG A;  3NAE A;  4JNE A;  3CF5 L;  3MXJ A;  4JKE A;  4Z4C A;  3RVC A;  4JI7 K;  3D45 A;  4CF0 A;  3HYF A;  4CGG A;  3SI6 A;  4B3O A;  4CZG A;  3OYI A;  3K9J A;  3TTC A;  2GEM A;  4JKH A;  1S1V A;  3D2F B;  2HNY A;  3CCU N;  1NOY A;  4CHZ A;  2P9S B;  2YNF A;  2HVI A;  5GIO A;  1KD1 O;  3J80 O;  4J2E A;  4MFB A;  2HBM A;  3JYT A;  2NUB A;  4RW4 A;  2ZGY A;  4HVJ A;  4CEC A;  5HL7 L;  2D0C A;  4W5T A;  3OYF A;  2HF3 A;  3MN5 A;  5JS2 A;  3TSP A;  2AA4 A;  2D0A A;  2QM1 A;  3TAP A;  3AY9 A;  2IDO A;  3OYC A;  3O3G A;  4FM1 A;  4CIG A;  1HPZ A;  2IGI A;  2Z1G A;  1EKE A;  3BEX A;  4AM6 A;  4CF2 A;  2HW3 A;  5AJ3 K;  3CCQ N;  4IDH A;  4K43 A;  1QVG M;  2UU9 K;  1NWK A;  5CYM A;  1NGF A;  2E20 A;  2ZQB A;  4FLU A;  2FSK A;  1WSG A;  4KKO A;  2HF4 A;  3HOS A;  4CZF A;  2X6S A;  3MWP A;  4F3O A;  5EOY A;  3MX5 A;  4FM0 A;  2H3G X;  1RDD A;  4JI0 K;  1IG8 A;  4MQ3 A;  4GV6 A;  4FWK A;  3M3Z A;  4LF4 K;  4YOV A;  3QDK A;  3U8X A;  3F73 A;  1U48 A;  3KK2 A;  3H1Q A;  3V9W A;  2ASM A;  5EY4 A;  2A40 A;  4DFP A;  1TK0 A;  2UXD K;  3AVH A;  3KK7 A;  4B3S K;  3M6G A;  1ZBH A;  4KB0 A;  1WOQ A;  3VOV A;  4WFB L;  1G15 A;  3W0L A;  3KLG A;  3WXL A;  3ATU A;  3LP0 A;  5CE3 A;  4DV4 K;  1R0A A;  5SZT A;  1GLE G;  1S9G A;  3LAK A;  1RBS A;  4R5P A;  4H4O A;  4DHY A;  3OW2 M;  4FK4 A;  5I42 A;  2NRT A;  1HKC A;  3LAM A;  2FBT A;  1QZ6 A;  1BGX T;  2FLO A;  1LOT B;  1P90 A;  3K59 A;  3SUP A;  4JI8 K;  4K25 A;  4IFY A;  1NGA A;  3QEW A;  3IG1 A;  4WQ5 A;  4E1N A;  3HPO A;  3LZI A;  4M3T A;  4HTL A;  2XRI A;  2HBJ A;  4WYB A;  2ITM A;  4CD1 A;  4F2R A;  4DUZ K;  4JKA A;  3SUO A;  4IDK A;  3RR7 A;  3RWU A;  4XIU A;  3LDO A;  3SAH A;  4H5W A;  1JXE A;  4FW2 A;  3P4I A;  3HVT A;  2B6A A;  4O8K A;  3RRG A;  5KPR A;  1NK5 A;  4H5T A;  3NVK A;  4GMJ B;  4BDZ A;  1QE1 A;  1MWK A;  1T44 A;  3LPT A;  4LF9 K;  3HRG A;  4X66 K;  1SS6 A;  3PIO L;  3CME N;  4LFC K;  1HKB A;  1XC9 A;  4OGC A;  3DXM A;  1RNH A;  1U6Z A;  4FYD A;  4TSX A;  1RBU A;  4CEO A;  3PY8 A;  2UXB K;  4M3Z A;  4JKF A;  3FZK A;  3IDH A;  4FM2 A;  3VQ9 A;  3V81 A;  2I7N A;  5K14 A;  4CJE A;  4DV0 K;  1LAV A;  5TKY A;  3ATV A;  1Q8I A;  2JLE A;  3ENH A;  3R6M A;  3BF3 A;  3LDN A;  1IKW A;  4B1W B;  1TGO A;  3S3O A;  3DAW A;  4J2A A;  4O44 A;  3AVI A;  4ZTJ A;  3VEX A;  1DLO A;  1T05 A;  4DV7 K;  4DG1 A;  1V4T A;  5AQZ A;  3MAQ A;  1ATR A;  5BR9 A;  3HSC A;  1KTQ A;  5BPL A;  3KTQ A;  4B8A B;  3CC2 N;  4AHU A;  1IKV A;  3TWH A;  2BTF A;  5E84 A;  4AF1 A;  4KHY A;  3HJF A;  4CZE A;  4CBU A;  1RGI A;  4B3M K;  4BC5 A;  3S9H A;  3E9P A;  3I8B A;  5C12 A;  3A8Y A;  3L3V A;  4BR5 A;  3VGK A;  3THV A;  1QSY A;  4FZX C;  1BO5 O;  3DI6 A;  1TYQ A;  1VSE A;  4PA1 A;  3TAN A;  3AO5 A;  5EX5 A;  2G8W A;  1JL2 A;  4DF4 A;  3AA4 A;  4NO7 A;  1HUX A;  3KK3 A;  2WC9 A;  3IKM A;  4FVM A;  2HOE A;  4PQU A;  3OYG A;  4AH9 A;  3I56 N;  1YJ9 N;  4NLC A;  1VSI A;  4OLA A;  1HR0 K;  4UQG A;  4JD2 B;  1JLA A;  4IKF A;  4FK0 A;  3QBW A;  3VEV A;  2YHX A;  1J53 A;  3SQ4 A;  1BL3 A;  1N5Y A;  1JLC A;  1JLF A;  4LSL A;  1YIJ N;  3SQ1 A;  1NGI A;  4FSV A;  3LP1 A;  1S9E A;  1T6C A;  4Z4F A;  2V51 B; 
#chains in the Genus database with same CATH homology
 1ITG A;  1W0H A;  3NE6 A;  4CF1 A;  5KI6 A;  4HUE A;  3ULD A;  3SPZ A;  4L8R B;  3HP6 A;  1GOC A;  4ZHR A;  4O4G A;  1C0M A;  4RW9 A;  3K5N A;  3SV3 A;  1NJY A;  1KLN A;  3V1R A;  3O3H A;  1NK8 A;  1UOC A;  4CFC A;  2DFH A;  5C25 A;  2G8U A;  2HHV A;  3PX0 A;  3PUF A;  3DOL A;  2P1J A;  4FJG A;  1A5W A;  2FBX A;  2ZD1 A;  1VRU A;  3OS0 A;  1SKS A;  1VSF A;  5D3G A;  3K2P A;  4Q0B A;  3V1O A;  1LV5 A;  2G8H A;  4CK1 A;  4DU1 A;  1NK7 A;  1RBV A;  1JLB A;  4HCC A;  4KI6 A;  1RDC A;  1CLQ A;  1HQU A;  3B6P A;  3CFO A;  3MEE A;  4B9T A;  4E7K A;  4GVM A;  3QES A;  3NH2 A;  3SJJ A;  4DTP A;  2IOC A;  4KV8 A;  4DTS A;  3HST B;  1KVA A;  1ZBF A;  4BE2 A;  4EZ6 A;  1T7P A;  3SZ2 A;  1KVB A;  1WSE A;  3VQB A;  3HO1 A;  3EZ5 A;  4DTU A;  1HYS A;  1U04 A;  2XY7 A;  2PYL A;  1TL1 A;  3AVC A;  2BE2 A;  3AV9 A;  4CER A;  3O3F A;  3KLE A;  3EYZ A;  1S5J A;  3DMJ A;  3M8R A;  4I9L A;  3HT3 A;  4HTU A;  2X78 A;  4FLX A;  1RT3 A;  1KSP A;  3OYH A;  3NGZ A;  4FJ7 A;  4KHQ A;  3HXM A;  4Z4F A;  3RMC A;  3U3Y A;  4OKK A;  4JS4 A;  3V1Q A;  3WNE A;  1BQM A;  5CYQ A;  2BGG A;  3DRP A;  5J2M A;  1O1W A;  3LAL A;  3OYM A;  4DSI A;  5E41 A;  4BDY A;  1NJW A;  1NKE A;  1KRP A;  3ASM A;  1IKY A;  4O55 A;  2YKN A;  4KPY A;  3ZSY A;  3AVM A;  3CFP A;  3FFI A;  4FLT A;  4DSF A;  5J1E A;  3ZSZ A;  4FLZ A;  2HHU A;  4CEQ A;  4CJR A;  1LAW A;  4E7L A;  3LAN A;  3QIN A;  4ID1 A;  1ZBU A;  4Y1D A;  4Y1C A;  4KRE A;  4CK3 A;  3SNN A;  4BAC A;  3SUN A;  5HRO A;  5EU7 A;  1KFD A;  3G0Z A;  1SV5 A;  4W5Q A;  2G8I A;  4AIL C;  3M8S A;  1RIL A;  5J2Q A;  2EHG A;  2YNH A;  4JLH A;  4NYN A;  1L3U A;  1CXU A;  3NH0 A;  2OPR A;  3MEC A;  2Z1I A;  3NF6 A;  3OYN A;  1I39 A;  5JS1 A;  1S1T A;  2P51 A;  4N56 A;  4NYF A;  1ZYQ A;  2JGU A;  4DQS A;  1X9M A;  2OPQ A;  4DTR A;  2E6M A;  2DFF A;  3BGR A;  4K8Z A;  4CEB A;  3NF9 A;  1QQC A;  5T7B A;  2HHW A;  4JRQ A;  1NOZ A;  1NJX A;  1NK6 A;  3OYK A;  1WNS A;  3ZSR A;  1VRT A;  4FJ5 A;  1TK8 A;  4FZY A;  1J9A A;  2AJQ A;  2OA8 A;  4CEE A;  1EXQ A;  2B5J A;  3AO1 A;  3OJU A;  3RRH A;  4FJJ A;  2YNG A;  1IO2 A;  1HMV A;  3C6U A;  4NCB A;  4FZZ A;  5FRN A;  2VWK A;  3NH1 A;  3OYA A;  2KTQ A;  1DTQ A;  2LSN A;  3TAF A;  1TL3 A;  2D0B A;  3QO9 A;  4OJR A;  4M3X A;  3S3M A;  4FJK A;  1WAJ A;  1VSL A;  4EP5 A;  3NFA A;  1YVU A;  3NF7 A;  4KO0 A;  4CHQ A;  2WON A;  4CJV A;  3O4Q A;  5J2N A;  4M3W A;  3LZJ A;  3WNH A;  3SYZ A;  1ZBL A;  4BWJ A;  4DS4 A;  4O0J A;  4C8K A;  4CJ4 A;  1RTH A;  1BHL A;  4CJ5 A;  3QEX A;  2YHB A;  1U49 A;  3ZSW A;  4E3S A;  3MXM A;  4ELT A;  4FJL A;  1VSH A;  1WAF A;  4CIE A;  2PYJ A;  4C8M A;  4DFM A;  4CFA A;  1RT2 A;  1U45 A;  2OPP A;  4RW8 A;  3T3F A;  3ZT4 A;  3EY1 A;  3AVJ A;  1BCM A;  1K6Y A;  4DFK A;  3RMA A;  4FCY A;  4CJF A;  4KHS A;  1RBT A;  4B08 A;  4C8L A;  3QEV A;  4FXD A;  1IG9 A;  3RMB A;  1WSH A;  1RT7 A;  3PX4 A;  1HNV A;  3VA3 A;  2GBZ A;  2Y1J A;  2GUI A;  1FK9 A;  1UA0 A;  4KAZ A;  3LP2 A;  4CES A;  1RCH A;  3S3N A;  5HRP A;  3KD5 E;  1Q9Y A;  3VQ4 A;  3PX6 A;  1WLJ A;  1LWC A;  4N47 A;  4CFD A;  4FJN A;  3LDS A;  3ZT2 A;  4DTJ A;  4WE1 A;  4CJS A;  4E7J A;  2E4L A;  4DS5 A;  1RTI A;  1HJR A;  3QET A;  2KZM A;  2HNZ A;  4B9N A;  1VSJ A;  1XWL A;  1NK9 A;  2P5G A;  4E19 A;  1L3S A;  1TAU A;  1Z25 A;  1S6Q A;  2YV0 X;  4YNQ A;  3TAB A;  3QEI A;  1XI1 A;  1WSI A;  1U4B A;  1JLG A;  1HYZ A;  4DU4 A;  1FXX A;  4FW1 A;  4M42 A;  4BE0 A;  3AA3 A;  3V9U A;  3TAR A;  4CF9 A;  2YHA A;  1RTD A;  4KTQ A;  3KLH A;  3OYE A;  4Z4E A;  1RT5 A;  4IBN A;  3LWL A;  4DFJ A;  1JLE A;  4CJL A;  1S1U A;  2VG7 A;  4W5R A;  2OZS A;  4B9L A;  1YTU A;  4B9M A;  2RPI A;  2ATQ A;  2I5J A;  4CJT A;  1VK0 A;  5KRT A;  3VQ6 A;  1C6V A;  3DYA A;  3L2U A;  3VQE A;  4CEA A;  4CJ3 A;  4H8K A;  3I0R A;  3HPG A;  4HUF A;  3SQ2 A;  1XHX A;  2HHT A;  1BI4 B;  3ZT3 A;  3AO4 A;  1RT4 A;  1Z26 A;  1JKH A;  3LPU A;  1QS4 A;  1VSD A;  5CZ2 A;  3TAG A;  3NAE A;  3PV8 A;  3NBP A;  1SL1 A;  4E7I A;  4JS5 A;  5CY4 A;  3DOK A;  3MXJ A;  4Z4C A;  2F96 A;  1NJZ A;  2G8K A;  1UAX A;  3AO2 A;  3AA5 X;  1GOA A;  3D45 A;  4CF0 A;  1QSL A;  3ZSX A;  3OS2 A;  3HYF A;  4CGG A;  3SI6 A;  4B3O A;  2VG5 A;  2GV9 A;  3DRS A;  4E1M A;  4CHY A;  3DLE A;  3QIP A;  3OYI A;  3NCI A;  1EET A;  1L5U A;  4O5B A;  4RW7 A;  3PO5 A;  3C6T A;  3I0S A;  3AA2 A;  3LWM A;  1S1V A;  3KLI A;  4IG0 A;  1MU2 A;  2HNY A;  4QCL A;  2WOM A;  3ZT0 A;  2IAJ A;  5KRS A;  3BDP A;  1NOY A;  3T19 A;  4AHT A;  1TAQ A;  3P5J A;  4LH4 A;  1A5V A;  4CHZ A;  2YNF A;  3VQD A;  4KTW A;  1C0U A;  4CGF A;  2R7Y A;  2HVI A;  3HL8 A;  2XO7 A;  4FJX A;  4K8X A;  2QKB A;  4I2P A;  3AVN A;  4LSN A;  4MFB A;  4J2E A;  3JYT A;  3OYB A;  4PUO A;  2NUB A;  4RW4 A;  2D5R A;  3H08 A;  4W5O A;  1TKD A;  1L3T A;  4HVJ A;  4CEC A;  2PY5 A;  4LD0 A;  3ZSQ A;  2RF2 A;  2XHB A;  3SQ0 A;  3F9K A;  2D0C A;  3ALY A;  4W5T A;  2HVH A;  3OYF A;  5JS2 A;  4J2D A;  1TVR A;  1KCF A;  4Z0U A;  4KFB A;  4CHP A;  2D0A A;  3VQA A;  1RTJ A;  3TAP A;  3VQ5 A;  2IDO A;  3OYD A;  1KVC A;  2KQ2 A;  3OYC A;  3O3G A;  4FM1 A;  4DTN A;  2YNI A;  1ASV A;  4CIG A;  1HPZ A;  4HUG A;  1UA1 A;  2IGI A;  1VSK A;  1EKE A;  2FC0 A;  2Z1G A;  3ZSV A;  4CF2 A;  1XHZ A;  1J5O A;  2F8S A;  1N6Q A;  3MXI A;  1ASW A;  5CYM A;  4E7H A;  3KD1 E;  2ZQB A;  3VQC A;  4DLG A;  4FLU A;  2DY4 A;  1WSG A;  4DTX A;  4ELU A;  2HHS A;  4KKO A;  3OYL A;  1HNI A;  2X6S A;  1S6P A;  3AVK A;  4CJU A;  4Z4H A;  4ZTF A;  2G8V A;  3KIO A;  4F3O A;  1BI4 A;  4FM0 A;  2QXF A;  3V4I A;  3UIQ A;  4QOZ B;  2EX3 A;  3U6F A;  4LH5 A;  1RDD A;  3M8Q A;  4BE1 A;  1VSM A;  4F2S A;  1GOB A;  4F8R A;  5FRM A;  3P83 D;  4MQ3 A;  4KI4 A;  4FJH A;  3CM5 A;  2RKI A;  2HHQ A;  1NKC A;  4AHC A;  1A5X A;  4RW6 A;  1Q9X A;  3OYJ A;  3M8P A;  2PZS A;  4DTO A;  3F73 A;  3TAQ A;  1U48 A;  3KK2 A;  4F3T A;  4I9Q A;  3OVN A;  3AVG A;  3K58 A;  3V9W A;  5FRO A;  1RT1 A;  2OPS A;  2IC3 A;  4DQQ A;  4DFP A;  5HRN A;  1TK0 A;  4IG3 A;  3AVH A;  3SCX A;  4B9S A;  2FBY A;  4OVL A;  1X1P A;  4DU3 A;  5HRR A;  1YTA A;  4DMN A;  4HCB A;  4N5S A;  3SPY A;  2HMI A;  4KB0 A;  1ZBH A;  3L2V A;  3P1G A;  1RBR A;  1G15 A;  4CGD A;  3KLG A;  4FLY A;  2BDP A;  1BIU A;  1L3V A;  3TAE A;  3DRR A;  3QEP A;  4AHS A;  2A1R A;  2XY6 A;  3LP0 A;  1R0A A;  1T8E A;  1ZBI A;  1C1A A;  2O4G A;  5SZT A;  4G1Q A;  4B8C A;  1TKX A;  3K5O A;  1WSJ A;  1LWE A;  1S9G A;  3CM6 A;  3LAK A;  3SUQ A;  2KFN A;  1IKX A;  1RBS A;  4R5P A;  4H4O A;  4GW6 A;  3VA0 A;  4E0D A;  3AO3 A;  4FK4 A;  5I42 A;  4CED A;  2FBV A;  2HND A;  3LAM A;  2FBT A;  4DSJ A;  4DLE A;  3HM9 A;  1BGX T;  4FJM A;  4DSE A;  4YFU A;  1JLQ A;  3K59 A;  3SUP A;  2OYQ A;  3QNO A;  4DSK A;  2Q3S A;  4ICL A;  4OLB A;  3V9S A;  4IFY A;  2ITG A;  1J54 A;  3K5M A;  3QEW A;  1BCO A;  3E01 A;  1BIZ A;  2B4J A;  4DQR A;  4CJK A;  3TAM A;  1FKP A;  3IG1 A;  3LZI A;  4E1N A;  3HPO A;  2RN2 A;  3DLH A;  4M3T A;  2XRI A;  4F2R A;  3OY9 A;  4NCA A;  5KGX A;  4O0I A;  2KZZ A;  4CJP A;  2HB5 A;  4ELV A;  3AVA A;  2VG6 A;  4Q5V A;  3U3G A;  1Y97 A;  4M41 A;  3SUO A;  4IDK A;  3RR7 A;  1SL2 A;  4C8N A;  4XIU A;  3RWU A;  4FK2 A;  3NGY A;  4PY5 A;  3HP9 A;  3CFR A;  1ASU A;  5HBM A;  1JXE A;  4FW2 A;  1LW2 A;  1W9H A;  4CGH A;  1LWF A;  4CEZ A;  1HQE A;  4CCH A;  3HVT A;  2B6A A;  3RRG A;  5DK5 A;  3IS9 A;  1NK5 A;  3IAY A;  1UWB A;  1LW0 A;  1EP4 A;  4OKE A;  1RT6 A;  3CQ8 A;  4GMJ B;  3NDK A;  3HVR A;  5J2P A;  1SKW A;  4KHN A;  4M3Y A;  4BDZ A;  1QE1 A;  1X9W A;  3T1A A;  4CGI A;  3LPT A;  1SKR A;  3L2R A;  2BAN A;  4E89 A;  1IH7 A;  4CK2 A;  1REV A;  4NCG A;  3VN5 A;  1YT3 A;  1I3A A;  2O4I A;  4F4K A;  3V9Z A;  4I2Q A;  4CJQ A;  3V9X A;  4N41 A;  3ZCM A;  3QLH A;  4FLW A;  5HRS A;  1XC9 A;  4OGC A;  1CZ9 A;  4PWD A;  1RNH A;  1WN7 A;  4OGE A;  4FYD A;  2ETJ A;  4TSX A;  1RBU A;  4FJI A;  3LP3 A;  4CEO A;  2X6N A;  3PY8 A;  4KHW A;  4M3Z A;  5KGW A;  4FLV A;  4FM2 A;  1KLM A;  4N76 A;  3VQ9 A;  1TK5 A;  3DLB A;  3AVB A;  3V81 A;  1SUQ A;  3L2W A;  3OS1 A;  4BWM A;  2VWJ A;  5K14 A;  1B92 A;  4CJE A;  5KTQ A;  1LAV A;  5CZ1 A;  3IRX A;  4RG8 A;  1KFS A;  4CHN A;  4CHO A;  4JRP A;  1Q8I A;  2JLE A;  3RR8 A;  2P5O A;  4CGJ A;  4KHU A;  2F8T A;  4B9U A;  3VQ7 A;  2HW3 A;  1IKW A;  3VQ8 A;  1TGO A;  3QER A;  1SL0 A;  1D8Y A;  1NKB A;  2QKK A;  3S3O A;  4J2A A;  4LY7 A;  5FDL A;  4O44 A;  1EX4 A;  3AVI A;  4OKJ A;  4ZTJ A;  1DLO A;  4J2B A;  1T05 A;  3HK2 A;  1QHT A;  2W42 A;  1BQN A;  4FJ9 A;  4I7F A;  3AVL A;  4DG1 A;  4KTZ A;  1RDB A;  3B6O A;  2G8F A;  1TV6 A;  3K57 A;  2DFE A;  1C0T A;  3L3U A;  3MAQ A;  1T03 A;  3OJS A;  1U47 A;  1KTQ A;  1WSF A;  3NGI A;  4Z4I A;  2IS3 A;  3QNN A;  3QIO A;  1NK0 A;  3KTQ A;  3KKR A;  4DSL A;  3TI0 A;  3SV4 A;  4DQP A;  4B8A B;  1F21 A;  4AHU A;  3DM2 A;  1C1B A;  4M45 A;  2XY8 A;  3G10 A;  3MEG A;  1CXQ A;  1IKV A;  4IFV A;  5SWM A;  3KLF A;  3DLK A;  3TWH A;  4DQI A;  1S1X A;  4KHY A;  3ITH A;  5C24 A;  3HJF A;  4EZ9 A;  5I3U A;  2QK9 A;  3S9H A;  2ZE2 A;  4OPK A;  3KJV A;  4KB1 A;  3L3V A;  3CYM A;  3WNF A;  4CEF A;  3THV A;  4H4M A;  4CE9 A;  3ZSO A;  4DF8 A;  1QSY A;  2OZM A;  4FZX C;  1D5A A;  2Z1J A;  4C8O A;  2KFZ A;  3C95 A;  3DI6 A;  1CZB A;  1VSE A;  3C94 A;  4CFB A;  4QAG A;  5HP1 A;  4PA1 A;  4M3U A;  3DLG A;  3TAN A;  3ZT1 A;  3AO5 A;  2G8W A;  2KW4 A;  3KK1 A;  1B9F A;  1JL1 A;  3CG7 A;  4Z4G A;  1JL2 A;  4DF4 A;  4CF8 A;  4CIF A;  2DTU A;  3RTV A;  3TR8 A;  4HHT A;  4B9V A;  5C42 A;  4OPJ A;  1DTT A;  3NF8 A;  3A2F A;  3AA4 A;  3NHG A;  3K5L A;  4DWI A;  1C1C A;  3MED A;  4EP4 A;  2X74 A;  1BIS A;  1TKT A;  4AHR A;  3KK3 A;  4FVM A;  3RMD A;  3HPH A;  1QSS A;  4PQU A;  3I8D A;  3JSM A;  2Y1I A;  3OYG A;  3V6D A;  3O4N A;  4M3R A;  4AH9 A;  1QTM A;  1HRH A;  1FKO A;  5DMR A;  1VSI A;  4OLA A;  4FJ8 A;  4UQG A;  3AVF A;  3KKS A;  4CJW A;  1TKZ A;  4BDP A;  1HYV A;  4DTM A;  4W5N A;  1JLA A;  4IKF A;  2HHX A;  1JXB A;  1B9D A;  3VQP A;  5HLF A;  4FK0 A;  2XY5 A;  1J53 A;  3SQ4 A;  4KRF A;  1BL3 A;  4AHV A;  1N5Y A;  3L2Q A;  1JLC A;  3L8B A;  1X9S A;  1JLF A;  3WNG A;  3D0P A;  4LSL A;  1D9F A;  3SQ1 A;  3LP1 A;  1S9E A;  1NK4 A;  2E6L A;  4ID5 A;  2Z1H A;  1S1W A;  3DLR A;  1RDA A;  3VQQ A;  3PO4 A;  2YKM A;  1D9D A;  3ISN C;  2A1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...