3HYFA

Crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
143
Chain Sequence
MYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIITQWIHNWKKRGWPVKNVDLVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/RNaseH
publication title RNase H active site inhibitors of human immunodeficiency virus type 1 reverse transcriptase: design, biochemical activity, and structural information.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
total genus 46
structure length 143
sequence length 149
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3hyfA00
3LP0A 1HNIA 4Q5VA 3QEWA 4Z4CA 3QO9A 4O4GA 4RW7A 3QNNA 1CXQA 3I8DA 4J2AA 1S1XA 3O3GA 2A1SA 3SPYA 1A5XA 1TKXA 1KLMA 4HUFA 1KFSA 4CIEA 3TAMA 3OYIA 2E6LA 2HHVA 3NBPA 1J5OA 4B3OA 3MEDA 3JSMA 4KI6A 2DFEA 4KAZA 4FK2A 2O4GA 4AHTA 3AVHA 4HVJA 4E7KA 2HHUA 2D0AA 2VWKA 2ZQBA 4CJUA 5J2PA 3T3FA 1RT3A 1S1VA 1IKXA 1U04A 5DK5A 3AO1A 3VQ6A 1RDAA 3VN5A 4OKEA 4RW8A 3MXJA 4CCHA 3ULDA 4J2DA 4FCYA 4FJGA 1CLQA 3AVFA 3SPZA 5KRSA 1RTDA 3ZT3A 2D5RA 1BI4A 3QLHA 3S3MA 1ZBIA 4W5NA 2RN2A 3EYZA 1L3UA 4BWMA 2I5JA 3OYDA 2Y1IA 1SKSA 3HVRA 1WSHA 4B9UA 3O3FA 1TK8A 1BIZA 1B9DA 4CJKA 1IH7A 4OJRA 3LWLA 1D5AA 1RT4A 3AO4A 3CFPA 5HROA 4CFAA 3U3YA 1Z26A 4PA1A 4KHQA 4Y1DA 4EP5A 3AA3A 5C25A 4B9VA 4FJJA 4RW4A 3L3UA 2D0CA 1XI1A 4CHZA 4XIUA 3THVA 1RTHA 4EP4A 3IRXA 1IKYA 2G8WA 3L2RA 4BDYA 3QIOA 3TAEA 5HRPA 3SNNA 1WAFA 4CEZA 1SKRA 3NCIA 3RMDA 3SQ4A 3S9HA 4NYNA 2HHSA 1S1TA 4ZTFA 3LP3A 3QEPA 2G8HA 1JXBA 4LSNA 1KVAA 1XWLA 3ZT2A 2DFFA 1IO2A 1FK9A 3F9KA 1MU2A 4DTRA 2YNFA 1SL0A 1WN7A 4FK4A 4Q0BA 2HHTA 1RBSA 4E1NA 1U45A 1TV6A 2XY8A 1FXXA 3PX0A 1T03A 4ELVA 1G15A 2Z1HA 1UA1A 1GOBA 1NK9A 4CFBA 3DRPA 4FJHA 2F96A 1NJXA 2Z1GA 3HSTB 4DLGA 3V1RA 4DQRA 3KK1A 1K6YA 3BDPA 1T8EA 4CF1A 4CHYA 2XO7A 1JXEA 3HP9A 3PX6A 4W5QA 1ZBFA 3I0SA 4E1MA 4C8LA 1EX4A 5FDLA 5J1EA 4CEEA 4CF2A 3HP6A 5JS2A 3OS0A 1S5JA 2XY5A 5HRSA 3VQ4A 3OYJA 1CZBA 2IC3A 3L2VA 4DSLA 3P5JA 2OZSA 1ZBHA 2D0BA 5JS1A 3V9XA 4CHNA 1VSIA 4RW6A 4FLTA 2F8SA 4W5OA 1R0AA 1SL1A 4FM2A 3HJFA 3AVGA 4FLYA 2DTUA 3CM6A 1Y97A 1VSHA 1U49A 4K8XA 2YNGA 3AVNA 3DRSA 3TAQA 1UA0A 1L3TA 2DY4A 1RNHA 5CYQA 2OPRA 1VSEA 1VSMA 2XRIA 1BISA 2YNHA 4JLHA 4I9LA 2ZE2A 2X6SA 3MEGA 3WNHA 4ZTJA 1L3SA 4L8RB 1IG9A 1B9FA 1WSJA 4LD0A 3KLEA 2XHBA 4E7HA 3HM9A 4KHSA 4KREA 1WSGA 3BGRA 3K5MA 4KTWA 3NF6A 1TL3A 4GMJB 3QINA 3QEIA 2HVIA 2O4IA 4KTZA 1CXUA 4F2RA 1VRTA 4AHSA 4CHQA 4FXDA 1RILA 3K59A 4KRFA 4UQGA 2BGGA 1SKWA 1NK8A 4M45A 2OPPA 1ASVA 1TVRA 1VSDA 3ZSOA 1O1WA 1S6QA 4CHOA 4DSFA 4DTMA 1NK5A 3KD1E 2IOCA 1LWFA 4OKJA 5EU7A 1ZYQA 4FJMA 4M3YA 4CFDA 4CJSA 4CF0A 3SCXA 1JLCA 1J54A 2DFHA 4GVMA 3OYEA 4HUEA 3IAYA 1TKTA 1GOAA 4OPKA 3TAGA 4DG1A 1D9FA 4CE9A 1RTJA 5CYMA 4Z4IA 1KLNA 2BE2A 3RMAA 4FVMA 2AJQA 3OYKA 1TK5A 4NCBA 5DMRA 4AHRA 4ELUA 1QSYA 5HLFA 1FKOA 1U4BA 3TWHA 1QHTA 3HT3A 1RT5A 4OGCA 3ZSZA 4M3RA 1D8YA 3ZSWA 2KZZA 2P5GA 3VQAA 3CQ8A 2G8FA 4NCAA 3NH1A 3AVLA 4Z4FA 3WNFA 3NGZA 3HVTA 3VQDA 3OYLA 3ZSRA 1EXQA 1GOCA 3KK2A 2OPQA 3SYZA 1S9EA 3V9WA 3TAPA 4Y1CA 3DYAA 3HYFA 3HPHA 1WNSA 4CJPA 2YKMA 3KKRA 3RMCA 4OVLA 1QSLA 4KI4A 2QK9A 5FRNA 4LY7A 1XC9A 2EX3A 3SUNA 2YHBA 2FC0A 3K58A 4N56A 2PYLA 4IDKA 3CFOA 1VK0A 4J2EA 2W42A 5KTQA 5KGWA 3DMJA 3QNOA 3TI0A 2HB5A 2PY5A 1HYZA 1TAQA 2VG7A 4O0JA 3QETA 4NYFA 5HBMA 4JS4A 5J2MA 4CHPA 2KFNA 4AHCA 1RDBA 4F3OA 4IG3A 2FBXA 1C0MA 3G10A 4Z4HA 2FBTA 2FBVA 1C1BA 4KHUA 3ALYA 1NJZA 3VA0A 4E7LA 4FJ5A 3LPUA 4OLAA 1QQCA 4NCGA 4J2BA 2WOMA 1RBRA 1JLGA 1U48A 1HYSA 4CEBA 3L2WA 4FW2A 3OJUA 4Z4EA 1LAVA 3VQ8A 3LZIA 2E4LA 1TL1A 3AV9A 3I0RA 3AVMA 4G1QA 1L5UA 4BDPA 4FJKA 4KHYA 1VRUA 4B8AB 2WONA 1SL2A 3AVJA 3LALA 3KTQA 2PYJA 1VSFA 4QOZB 3CG7A 3NGYA 3QIPA 3KD5E 3B6PA 3O4QA 5E41A 2BDPA 1KTQA 1Z25A 3PO4A 1VSLA 2Y1JA 3VQ5A 4YFUA 4O5BA 4DQSA 3TANA 4TSXA 4FJXA 4PY5A 4M3TA 4F3TA 1VSKA 1WLJA 4DTOA 5K14A 3V1QA 4LH5A 3AVBA 3ZT0A 1HNVA 4GW6A 3WNGA 4CJQA 3KLFA 4AHVA 3PX4A 3LPTA 3K5LA 2HMIA 3NFAA 1KRPA 3M8QA 1WSIA 5I3UA 4KHWA 4BWJA 3RR7A 5C24A 4BE0A 2OZMA 4DTJA 4IKFA 2PZSA 1LW0A 1BI4B 3MXIA 5CZ2A 3UIQA 4CK1A 1HPZA 1T7PA 4DU3A 4OPJA 2YNIA 1QE1A 4KO0A 1SV5A 4FW1A 4BE2A 4M3XA 4WE1A 1XHZA 3NH2A 3E01A 4CESA 4KB1A 2X78A 4DQQA 1EKEA 1JLBA 1VSJA 2VG6A 2YKNA 3OYMA 1D9DA 4N76A 4H8KA 3OYNA 2ATQA 2IAJA 4YNQA 4B9MA 1JL1A 3DLKA 1ITGA 3HPOA 3NDKA 3SJJA 4CJ3A 1WAJA 2ZD1A 4FZXC 1KVBA 3ASMA 3T1AA 4DMNA 4HCCA 2RF2A 2Z1IA 5KGXA 4E3SA 2Q3SA 4FLUA 4CJWA 3QEVA 1LWCA 1FKPA 1NK0A 1ASWA 1KFDA 2OPSA 4EZ9A 3AO3A 4K8ZA 2KZMA 3DLBA 4M41A 3NH0A 1NK6A 3FFIA 4I7FA 3O4NA 4B8CA 4CGHA 3OYHA 3SQ0A 4DS4A 4O55A 4CERA 2EHGA 4I2QA 3OS2A 4HTUA 4FZZA 4W5TA 5FRMA 4B08A 3U3GA 4CEFA 4ID1A 3VQQA 3H08A 4MFBA 4E0DA 2G8UA 1NK4A 1BCOA 3ISNC 4DF8A 1CZ9A 3U6FA 3OYBA 1B92A 2KW4A 1QTMA 3VQPA 4KV8A 4LSLA 3M8SA 4FLZA 4CJ5A 3CFRA 4DFKA 4FK0A 4DTNA 2GUIA 3VQEA 3AA4A 4FM0A 1KCFA 5KRTA 5CY4A 1RDCA 4KFBA 3NGIA 5J2NA 4FJNA 3LAKA 1A5WA 4Z0UA 3JYTA 3F73A 4DFJA 4C8KA 4FM1A 4DU1A 4PUOA 4CK2A 3SV3A 1NJWA 3SI6A 3CYMA 4M3ZA 4IFYA 5HRNA 1QSSA 3RMBA 3LP2A 1TK0A 2RKIA 1Q8IA 1LWEA 3C95A 4QCLA 1EP4A 1Q9XA 2HNZA 2KQ2A 2HNDA 3KLIA 4KKOA 1HMVA 4I2PA 4CEOA 3PY8A 4I9QA 4ELTA 1RBVA 1NKEA 4C8OA 5D3GA 3HK2A 4B9LA 4R5PA 3K57A 3SZ2A 2GBZA 4M42A 1RCHA 1JL2A 4CJ4A 1C1AA 3ZSXA 4E89A 3ITHA 3D0PA 4HHTA 1REVA 1LV5A 1KSPA 3NF9A 3P83D 3LDSA 3QEXA 3AVAA 1YT3A 4B9TA 4FJ9A 3QESA 4PQUA 2HHXA 1WSEA 1I3AA 3DM2A 1HYVA 2P5OA 1ZBUA 4BDZA 4FJ8A 2YV0X 3AVIA 4RW9A 4N5SA 3MECA 3SQ1A 3V1OA 1X1PA 3C6UA 3DLGA 4FLVA 1BGXT 4RG8A 3NE6A 4F8RA 4KB0A 4FZYA 2BANA 4O44A 3K5NA 3V9ZA 4IBNA 3VQ9A 3AA2A 2VG5A 3NAEA 4JRPA 4DTPA 2QXFA 4FLWA 5HP1A 4N47A 4E7IA 1BHLA 2HW3A 1IKVA 1C1CA 1DLOA 1X9SA 2G8IA 4FLXA 2QKBA 1YTAA 1X9MA 1LAWA 2HHWA 1KVCA 3LZJA 3DRRA 3SUQA 1JLQA 5T7BA 1TAUA 2HHQA 3EY1A 3HO1A 5CZ1A 1BCMA 4QAGA 1I39A 3V6DA 4DTXA 3AVCA 2FBYA 3OYAA 3PV8A 5SWMA 3S3OA 2HNYA 2G8VA 4M3WA 5SZTA 4IFVA 2JGUA 3ZSYA 4Z4GA 1N5YA 4DSKA 3ZSVA 3L2QA 1YTUA 3LWMA 3V9UA 3ZCMA 4DTSA 3HPGA 3MXMA 1W9HA 3HXMA 3D45A 3IS9A 3NF8A 2IDOA 1HQEA 3DLEA 3ZSQA 5HRRA 2XY7A 3VQBA 1C0TA 3RTVA 3OVNA 2X74A 4C8NA 1NOYA 4CEAA 2Z1JA 4DSIA 4CJRA 2P51A 4OLBA 4DSJA 1JLFA 1TKZA 4MQ3A 3OYFA 4JRQA 3V4IA 3VQCA 1T05A 1RBUA 3C94A 4CIFA 3TR8A 1HJRA 1A5VA 1L3VA 3AVKA 1QS4A 1DTTA 3VQ7A 1JLAA 3TAFA 3TABA 4DLEA 3DI6A 3S3NA 1BIUA 3DLRA 3ZT1A 3L8BA 4CK3A 3OYCA 4B9NA 3NF7A 3MAQA 2B5JA 4OKKA 2OYQA 4F4KA 3AO5A 5I42A 3EZ5A 4AHUA 3C6TA 3PUFA 1BQNA 4AH9A 4OGEA 1N6QA 4M3UA 3A2FA 1EETA 4CGDA 2ITGA 4CF8A 2VWJA 2RPIA 3RRGA 4CGGA 3RR8A 3KLGA 2KTQA 4ZHRA 2R7YA 1SUQA 4IG0A 1J9AA 1IKWA 4CFCA 4DU4A 3IG1A 5J2QA 1TKDA 2B6AA 1Q9YA 4CEQA 4F2SA 2HVHA 3SQ2A 1NK7A 2X6NA 3L3VA 3RWUA 4HCBA 1S1WA 3HL8A 2JLEA 3V9SA 1C0UA 4KTQA 4E7JA 4JS5A 4W5RA 1NOZA 4CGIA 2LSNA 3DOLA 1BL3A 3VA3A 3OY9A 2P1JA 1BQMA 3CM5A 3KK3A 3M8RA 2F8TA 2IS3A 5FROA 1U47A 3OYGA 3T19A 1X9WA 1RT2A 2NUBA 4FJLA 2B4JA 4CJEA 3DOKA 3G0ZA 1YVUA 4AILC 1HQUA 4CJLA 2A1RA 4EZ6A 1HRHA 4DQIA 4DQPA 1S9GA 2XY6A 4O0IA 3K5OA 2IGIA 1C6VA 4ID5A 4N41A 4KPYA 2ETJA 3SUOA 1NJYA 4BE1A 4H4OA 1NKCA 2G8KA 1F21A 4DWIA 1WSFA 3LANA 4CJVA 3KLHA 4DS5A 4DTUA 2KFZA 3DLHA 4CGJA 1XHXA 1ASUA 1W0HA 2E6MA 4DFPA 4B9SA 4H4MA 4CJFA 4DSEA 1S1UA 3PO5A 4FJ7A 4FYDA 2QKKA 3SUPA 1LW2A 3ZT4A 4CIGA 4CECA 3KKSA 2YHAA 1RT1A 3MEEA 4LH4A 3OJSA 3K2PA 3KJVA 1RT6A 1UAXA 1NKBA 3KIOA 1RT7A 5C42A 3WNEA 1UWBA 3LAMA 1RDDA 1RTIA 1RBTA 3M8PA 3V81A 3O3HA 4CJTA 4FJIA 3QERA 2OA8A 1S6PA 4PWDA 1UOCA 4ICLA 1JLEA 3RRHA 4CEDA 2GV9A 4DFMA 4CF9A 4CGFA 3L2UA 4C8MA 3NHGA 3OS1A 4E19A 1JKHA 3LP1A 1DTQA 3AA5X 4HUGA 1TGOA 4BACA 4DF4A 3TARA 1ZBLA 4KHNA 5KI6A 1J53A 3P1GA 3B6OA 3AO2A 3SV4A
chains in the Genus database with same CATH superfamily
5LMUK 4Q5VA 4Z4CA 4O4GA 4J2AA 1S1XA 3SPYA 3TAMA 2E6LA 2UUBK 3NBPA 1J5OA 3MEDA 4KI6A 2DFEA 4HVJA 2HHUA 2D0AA 2O8BA 4CJUA 2F7TA 3T3FA 1RT3A 1S1VA 1U04A 5DK5A 3AO1A 4OKEA 4B1ZA 4J2DA 5BRHA 4FCYA 1CLQA 2NRWA 3SPZA 5KRSA 2P9UA 3ZT3A 1N34K 5LY3A 1IBKK 2RN2A 1L3UA 5KPRA 3BY5A 1BIZA 3CJAA 4CJKA 4OJRA 3CFPA 5HROA 3O9RA 3U3YA 4KHQA 4EP5A 4YOYA 1JCEA 2D0CA 1MDUB 3THVA 4X65K 4IEIA 3O1WA 3GBTA 1BUPA 3QIOA 3JAMO 1YF5L 3SNNA 4CEZA 4H5NA 4C23A 3GOIA 1ZBSA 4NYNA 2HHSA 4O8KA 2G8HA 2QW9A 4LSNA 1KVAA 5C15A 3ZT2A 2DFFA 1IO2A 1MU2A 4DTRA 4BQZA 4FK4A 2XY8A 1VHXA 4ELVA 1UA1A 4FJHA 1RGIA 4Z94A 1NJXA 4DQRA 3V1RA 3BDPA 3PX6A 1HX1A 3HP6A 1Q7YO 4H0OA 3VQ4A 3THWA 3P5JA 2D0BA 4CZJA 3IUCA 2QXLA 4FLTA 3CPEA 5GINA 3D2EB 4W5OA 4C1NI 4FLYA 3CM6A 1VSHA 2YNGA 1UA0A 4BRKA 3HOSA 1VSEA 2XRIA 3U4LA 4BG9A 2X6SA 3WNHA 5GAHP 1IG9A 3H1VX 4LF8K 3TTCA 3C7NA 4DCHA 1WSJA 4JYAK 1VQ5N 2XHBA 2HBMA 3HM9A 4GNIA 4DV6K 2HVIA 2O4IA 4AHSA 4CHQA 4DV5K 1RILA 3BF1A 4A59A 3K59A 4FXDA 1VQLN 2BGGA 1SKWA 4BRPA 1TVRA 1XUPO 4CHOA 4JI6K 4DSFA 3VGKA 4JKCA 4OKJA 3E9PA 5EU7A 4FJMA 4CZMA 4CFDA 2DFHA 3CCRN 2P9NB 1Z6RA 4BRQA 1YHQN 3E1YA 3EE9A 4FWLA 3VEYA 1V4TA 1D9FA 3THYB 1KLNA 3P39A 4FVMA 3EKSA 1TK5A 3M5RA 5JLHA 3HT3A 4OGCA 3CQ8A 2G8FA 1NM1A 1SQKA 4GKJK 3AVLA 3Q7BA 3NGZA 1GLBG 3OYLA 2CH5A 1GOCA 2OPQA 4CBUA 2P9SA 3DYAA 4LF9K 1W2BM 2YKMA 2W6LA 2EX3A 3C6AA 4NXMK 2PYLA 4IDKA 3CFOA 1VK0A 5A2QO 3LM9A 2NNWA 5KGWA 4EHUA 4CZLA 5DM7L 4DV7K 2O8CA 3QETA 4JS4A 1K9MO 3QDKA 4CHPA 4M7XA 2FBVA 4KHUA 4IO9L 4E7LA 5AFUA 4NCGA 4J2BA 1HYSA 4CEBA 3L2WA 3OJUA 1GLFO 3WQTA 3I0RA 5LJWA 3G6EN 1QQOA 1ZXOA 2V7ZA 3QIPA 3KD5E 4JI1K 3LDLA 3O4QA 4JI4K 5ELZA 4DQSA 3TANA 4MO5A 4H0PA 3O8MA 1WBDA 1VQ9N 3IDHA 4M3TA 1TYQA 1WLJA 2KKZA 5K14A 3V1QA 3ZT0A 1K8KB 2FSJA 3PX4A 3FZFA 1Z05A 3NFAA 4KHWA 2UXCK 1LW0A 5DM6L 5GAEP 1GLEG 3MXIA 4CK1A 1T7PA 4OPJA 1QVFM 4KO0A 5C12A 4ILJA 4FW1A 4WE1A 1WUAA 3NH2A 3E01A 4U7BA 3LDNA 4KB1A 4R79A 3VGLA 4BC2A 1JLBA 4ILGB 3OYMA 4LF7K 4N76A 5AQXA 1D9DA 1FW6A 2UUAK 2IAJA 1X3MA 4YNQA 1JL1A 3HPOA 3SJJA 2BUPA 3O9QA 4CJ3A 1WAJA 2QTDA 5CHIA 4DMNA 4HCCA 2RF2A 2Z1IA 1JJ2M 3BUZB 4XH1A 1WB9A 2KZMA 4A5AA 3FFIA 4ILHA 4K41A 5GIOA 3O9UA 2EHGA 1OVQA 4CERA 4W5TA 5FRMA 5AQHA 4E0DA 1QQMA 1NGBA 4LSLA 4FK0A 4CJ5A 3QBXA 4FM0A 4MLHA 5KRTA 4CBXA 4KFBA 2QWPA 4FJNA 4C8KA 1NJWA 4BRCA 3C95A 3VEVA 1EP4A 4BQLA 5JLFA 4IFEA 4I9QA 4Z4IA 1RBVA 3OHRA 4JEPA 2GBZA 1HNWK 5GAGP 1JL2A 4CJ4A 4E89A 4ISGA 1REVA 2E2QA 1KSPA 4BRGA 3QEXA 2P9PA 2O8EA 3PIPL 3QESA 4YOUA 2YV0X 3RSEA 3ZX0A 3V1OA 1X1PA 3C6UA 4NCBA 4O44A 3K5NA 1OH6A 3V9ZA 3SBTA 3VQ9A 4FPBA 2VG5A 3DXKB 2ZGYA 3F2KA 5AQYA 3UKRB 2HW3A 1C1CA 1DLOA 1EQYA 2QKBA 1LAWA 3EY1A 3HO1A 1BCMA 3V6DA 4I6MA 4DTXA 5AJ3K 3DLLL 2QEXN 4XH5A 2G8VA 4JKFA 2JGUA 4DSKA 1YTUA 3LWMA 3T7ZA 1R59O 2XY7A 4FOEA 1C0TA 3OVNA 2Z1JA 3ENOA 2P51A 2FF3B 4JRQA 4A5BA 1GLAG 4JI2K 3UB5A 5M1FA 1RBUA 4BRIA 4CIFA 2D1KA 4FOIA 1QS4A 1DTTA 3VQ7A 3ZEUB 3TAFA 2GELA 3TABA 4DR5K 4BRAA 3DLRA 3L8BA 4CK3A 4J8FA 4JKDA 4AHUA 1N6QA 4M3UA 1T6DA 1EETA 4DKWA 1YVNA 2ITGA 4CF8A 2VWJA 4ZHRA 1SUQA 1IKWA 4CFCA 1TKDA 4Y0WA 5M1NA 3SQ2A 3OTOK 3L3VA 3RWUA 3H45C 4YY3K 2JLEA 4E7JA 4JS5A 2LSNA 4XEIA 2ASMA 3OY9A 5AQZA 3B8AX 2ZWHA 2E8AA 3T19A 2GX9A 1RT2A 2E2OA 2NUBA 3CCMN 4JKGA 5KPZA 4BR5A 4CJLA 3AY9A 3ZLJA 1N8RO 2XY6A 3K5OA 4KPYA 2UXBK 1BO5O 4LC9B 4DWIA 3LANA 3KLHA 3HTVA 4DTUA 4RCHA 1ASUA 1W0HA 4B9SA 4H4MA 4CJFA 4FYDA 3ENHA 1RT1A 1RT6A 3O08A 3L6QA 3LAMA 1RDDA 1RTIA 3M8PA 3V81A 3J80O 4CJTA 4OO1J 4CEDA 4C8MA 3DLHA 4DF4A 3J7AP 5KI6A 1IV0A 3SV4A 5IT9O 3MMVA 5BRDA 3QNNA 1KFSA 4HUFA 5TKYA 3WUHA 3JSMA 2O4GA 3AVHA 4K43A 4E1JA 1IKXA 3VQ6A 1RDAA 4RW8A 4JI8K 4CCHA 3ULDA 1RTDA 1ATRA 1BI4A 3MN5A 4A61A 3S3MA 1N36K 2OANA 1M1KO 2P9LB 1SKSA 1WSHA 4LFAK 3O3FA 1XMOK 1TK8A 3M1FA 3AO4A 2FSKA 3EKUA 5C25A 4B9VA 4XIUA 4DV4K 3UKUA 3QICA 3L2RA 4WFAL 3TAEA 3NVKA 1WAFA 1SKRA 3RMDA 2EWSA 3KWIA 1XWLA 4M7YA 4JHDB 3R9PA 4BVPA 3D7EO 3O4WA 1WN7A 2GWKA 3T1HK 2HHTA 1J6ZA 1TV6A 1QVGM 1G15A 3DRPA 2F96A 1K6YA 4DQ8A 2P9KA 1T8EA 4CF1A 1JXEA 1ZBFA 3I0SA 4OPHA 1EX4A 5J1EA 4CEEA 2XY5A 5E84A 1CZBA 3LM2A 4DSLA 1KAYA 1P8ZA 4RW6A 1HR0K 1R0AA 4FM2A 3HJFA 3F5TA 3QBWA 3U9ZA 1Y97A 3H1QA 3S41A 4K8XA 3FZLA 5LMNK 3DRSA 2QM1A 5AQMA 2YNHA 4JLHA 2F4VK 2E88A 3MEGA 4H5VA 1HKBA 4UY8O 1B9FA 3KLEA 4B1WB 4KHSA 3K5MA 2OTLN 1TL3A 4GV3A 4KRFA 4UQGA 2Q0RA 1NK8A 3ZETB 3FZKA 3KD1E 1NGFA 5BREA 1NGHA 4HUEA 5FPMA 3OYEA 3TAGA 2FLOA 1RTJA 2VYPA 5CYMA 2BE2A 2AJQA 3VPZA 3SK3A 3G4SN 5DMRA 4ELUA 1QSYA 2P9IA 4H0YB 3BF3A 1U4BA 3TWHA 1QHTA 3W0LA 2KZZA 3ZSWA 1MWKA 3CXCM 3WXIA 4Z4FA 3WNFA 3PIOL 3TTDA 3ZSRA 1EXQA 3BEXA 3OBWA 4CZGA 3HYFA 4CJPA 1WNSA 3AAQA 3KKRA 2WUSA 3SMPA 1NG9A 3T1YK 2O8DA 3SUNA 4F9OA 4N56A 2W42A 1EO1A 1SAZA 3U9DA 3QNOA 3TI0A 4FWMA 4CZFA 5J2MA 5C10A 4DR4K 4F3OA 2FBXA 5AQVA 3TSUA 2GEMA 3G10A 4Z4HA 2A6AA 1C1BA 1NJZA 4OLAA 1QQCA 4LF4K 3VENA 4HTLA 1VAZA 2V51B 5AQFA 1U48A 5LL6Z 5GIPA 3VQ8A 3C6HA 2E4LA 4Z4EA 4G1QA 2ZJQL 3AVMA 4BDPA 3D6RA 4JKEA 4GV6A 2VWBA 2WONA 3AVJA 4FSVA 3LALA 5BR8K 4QOZB 3NGYA 1Z25A 4C8OA 2Y1JA 4FJXA 3VQ5A 4YFUA 4TSXA 4BRMA 4YOTA 4NXNK 2O8BB 4GW6A 4AHVA 3THXA 4EFHA 1BDGA 3K5LA 4CZIA 3AGKA 4BE0A 3ZX2A 5AQOA 4QS8A 2P9UB 2PZSA 2Q0UA 5KQ8A 5BPMA 5CZ2A 1VQ7N 2Q2RA 4DU3A 2YNIA 4YORA 4BGAA 1SV5A 3SLCA 4BE2A 4M3XA 1Y64A 2HBKA 3WXJA 1NJIO 3CCUN 5AQWA 4H8KA 3SBGA 4BRFA 4IKFA 3H3OB 3WEEA 3WXMB 2V52B 2E5LK 3VERA 1KVBA 4FPAA 3T1AA 3K9JA 4E3SA 2Q3SA 4CJWA 3QEVA 3F9MA 1KFDA 2OPSA 3DLBA 3CERA 3NH0A 2YCHA 1JCGA 3O4NA 4FWPA 4GY2B 3EZWA 1U2VA 3U3GA 4MFBA 3THXB 3OBYA 3U6FA 1YJNN 2KW4A 1QTMA 4OPAA 3VQPA 4FLZA 4DFKA 5IWAK 3THWB 2GUIA 3VQEA 2VQEK 1RDCA 3NGIA 5J2NA 1A5WA 4FWOA 4FM1A 3SV3A 4FVUA 3FZMA 3CYMA 2HSTA 5ADXH 4IFYA 5HRNA 3LP2A 1Q8IA 2RKIA 2KHOA 4CEOA 3KLIA 4KKOA 3PY8A 1HMVA 4I2PA 3DXMA 3T69A 1NKEA 2HMPA 3H6EA 5BN9A 3C7NB 3K57A 5AQUA 4B1VA 1C1AA 3KZBA 1LV5A 5M1OA 1DT9A 4PQUA 2HHXA 1WSEA 1FJGK 1I3AA 3DJCA 1Q18A 1HYVA 1VQ8N 4BDZA 4JK9A 4EIAA 5HP1A 1CZAN 1KAXA 2QXFA 4FLWA 1BHLA 2RHKA 4QS9A 1IKVA 2W40A 4FWNA 3KWGA 4U67L 2WC9A 4FLXA 4GV9A 2NRTA 4FO0A 1G99A 3LDQA 1HPMA 1KVCA 3LZJA 3DRRA 4YOXA 3SUQA 1TAUA 2AA4A 4BREA 1I39A 1IBLK 3DWLA 3M3ZA 3OYAA 2O8FA 5F0XA 1OH5A 3ZSYA 4Z4GA 3ZSVA 5KPTA 2W41A 2P9SB 4BR7A 3D45A 1HQEA 4B9TA 3VQBA 1NOYA 4DSIA 4BRHA 3OYFA 3ATVA 3CQYA 1VQ6N 5F1XA 3VQCA 3PLAA 3A5MC 2UXDK 1YAGA 3O9SA 1L3VA 5AQPA 4DR3K 4IZ9A 1ZC6A 2O8CB 3OYCA 4B9NA 2B5JA 2V7YA 4F4KA 3AO5A 3EZ5A 3C6TA 4GVEA 1OVYA 3KLGA 2R7YA 2YI1A 1NGIA 4DU4A 5J2QA 3IG1A 2D4WA 2B6AA 4CEQA 2HVHA 1RFQA 1T6CA 3MK6A 1S1WA 1C0UA 3MN7A 3RVCA 1Q82O 4CGIA 3ID8A 3DOLA 4BG8A 4CVNE 1BA1A 1J5EK 1BQMA 3MCAB 4CBWA 5FROA 5I9EB 1TYQB 3OYGA 4PL7A 1X9WA 2A40A 3CMAN 2B4JA 4EZ6A 1ILYA 1HRHA 3MCPA 3HOTA 3OW2M 1C6VA 4ID5A 3O80A 4B9QA 4IO8A 3SUOA 1F21A 1WSFA 3HZ6A 4GKKK 2ZF5O 4CJVA 4DS5A 1HNXK 2E6MA 4DFPA 4DSEA 1NGDA 2QKKA 3ZT4A 4BC5A 1ESVA 2YHAA 3MEEA 1XNRK 5C42A 3WNEA 1N32K 3SAFA 3QERA 1NWKA 1JLEA 5GADP 3CCQN 4DS4A 5M1KA 1DTQA 1ZBLA 1W7AA 3B6OA 3VOVA 2FXUA 3AO2A 1KC8O 3LP0A 1HNIA 3QEWA 3QO9A 1CXQA 3N4QA 2E20A 1TKXA 3ULEA 4PKHA 2HHVA 4B3OA 2YHYA 2DPNA 2FSNA 4AHTA 5AQRA 3MWPA 3C65A 2ZQBA 3CJ9A 3VN5A 2ZJRL 5EXWA 3J8AA 4FJGA 3QLHA 1ZBIA 3J81O 3CCLN 3D2FA 3EYZA 4AF1A 1VQON 3VTHA 2Y1IA 3E9LA 4WQ4C 1B9DA 3MN6A 2VQFK 1D5AA 1QQNA 1Z26A 4Y1DA 2NZTA 3AA3A 5AZJA 4RW4A 4CHZA 1RTHA 3P38A 1GLDG 2IVOA 2P9PB 2O8EB 3SQ4A 1S1TA 4MDBA 2I7NA 1JXBA 4FWSA 5CE3A 1S3XA 3SJHA 2PAVA 5BRFA 4DR7K 4BR4A 3RSEB 4Q0BA 4PKGA 1RBSA 1FXXA 1YXQA 2Z1HA 3U8XA 1NK9A 5C2DA 4KH4A 2Z1GA 4DLGA 3KK1A 2UYTA 2XO7A 3HP9A 2Q1NA 3VESA 4C8LA 2I7PA 1S5JA 5HRSA 3OYJA 2IC3A 1HJOA 1BOTO 4I6MB 3W3DA 4CHNA 4BRLA 1VSIA 4DV1K 2F8SA 2DTUA 3AVGA 1BU6O 1U49A 5F2RA 4BROA 4YHHK 4K0KK 1NGAA 1L3SA 2QWMA 2Q36A 5AQGA 5AQLA 4KREA 4KTWA 3NF6A 4GMJB 3QEIA 3A5OC 2Q97A 4KTZA 1CXUA 4F2RA 4MLEA 3C0BA 2KLAA 4M45A 3A8YA 3K0SA 2HBJA 2IIRA 2OPPA 1VSDA 4DTMA 1NK5A 1S6QA 4DR2K 2ZJPL 2IOCA 1ZYQA 2A42A 4B3RK 4M3YA 4CJSA 1J54A 3L0QA 4GVMA 1GOAA 3EN9A 4LFBK 4JNEA 4OPKA 1W97L 4DG1A 4CE9A 1NGEA 3OYKA 1KXPA 5HLFA 3SMSA 1FKOA 4IWVA 3ZX3A 3FE1A 2GTDA 3ZSZA 1QZ5A 4M3RA 1D8YA 2P5GA 3VQAA 1WOQA 4H0XB 5AQJA 1XC3A 1IBMK 3NH1A 4NCAA 3VQDA 2VGMA 3KK2A 4ISFA 3A5NC 4JKGB 3V9WA 3TAPA 1O13A 3HPHA 5EY4A 1QSLA 4KI4A 3FLCO 5H1SQ 4LY7A 5FPNA 1C0FA 1XC9A 1K8AO 1ATSA 2YHBA 1H1VA 2D0OA 2YX6A 4J2EA 3R6MA 4JD2A 3DMJA 4FL9A 1QZ6A 4BR0A 5FPEA 2HB5A 1HYZA 1TAQA 2VG7A 4AQYK 3SAGA 3I33A 2OCEA 2FBTA 3CETA 3ALYA 3VA0A 4FJ5A 3LPUA 1KAZA 1YJ9N 4B1XB 2ASOA 2HHHK 1RBRA 2HBLA 1LAVA 1TL1A 1RDWX 3AV9A 4FJKA 3VETA 4KHYA 4B8AB 2CGLA 1SL2A 1T44A 1LOTB 2A41A 3KTQA 1K73O 1VSFA 2ZGZA 3CG7A 3B6PA 5E41A 1KTQA 1VSLA 5AZIA 4F3TA 1OKJA 1VSKA 5EOYA 4IOCL 1VQNN 4DTOA 5AQKA 4LH5A 3AVBA 1HNVA 3KLFA 3CJ7A 2HMIA 3M8QA 3P31A 5I3UA 4PL8A 5C24A 2OZMA 4DTJA 4IDHA 4IJAA 4CI6A 1BI4B 1LCUA 3UIQA 5JMVA 1QE1A 3IFRA 5M1PA 5B8HA 1XHZA 3KVGA 2IVPA 3VEWA 4CESA 4DQQA 2RE2A 2YKNA 3UE5A 3KK7A 2NRXA 3UKUB 2ATQA 2VGNA 1VQKN 3NDKA 2F9WA 3FZHA 2JWLA 5KGXA 3Q7CA 2HF3A 1X3NA 4I7FA 4B8CA 4CGHA 3OYHA 3WXKA 2QWQA 4I2QA 3OS2A 4HTUA 3LL3A 4B08A 2HOEA 3VQQA 2P9KB 1RDUA 1BCOA 4OX9K 1B92A 2JWKA 4KV8A 3M8SA 4K42A 4MO4A 3VMFB 4DTNA 2ASPA 2QWNA 1KCFA 3G71N 5CY4A 3EL2A 3VEOA 3LAKA 2W6KA 4B1YB 3JYTA 3F73A 4DFJA 4DU1A 4PUOA 4M63C 3SI6A 4BY9C 4DV2K 3RMBA 1Q9XA 5TKWA 2HNZA 5D3GA 4R5PA 1TUUA 1RCHA 1WBBA 3KHYA 3H3NO 3ZSXA 3D0PA 4CJ7A 3P83D 4H5WA 3LDSA 4AM7A 1YT3A 4FJ9A 4WQ4A 3DM2A 4NLBA 4MDAA 2CGKA 2P5OA 1ZBUA 3MECA 5BPNA 2G8IA 3DLGA 4FLVA 4KB0A 2HHWA 1BGXT 4RG8A 3NE6A 1E3MA 2BANA 2ITMA 1BWFO 3AA2A 3NAEA 4DTPA 3WT0A 3M6GA 4N47A 3WXLA 4BRNA 1TUYA 2YJFA 4DHYA 1GLJO 1YTAA 4NO7A 2P9IB 3EEQA 4WYBA 4QAGA 4JI3K 3AVCA 2E1ZA 3S3OA 3BZCA 4FWQA 5SWMA 3D2EA 4M3WA 4CZHA 5SZTA 4IFVA 3ZCMA 3HPGA 4JKHA 3HXMA 3NF8A 3IS9A 4B9UA 2IDOA 3DLEA 4NLCA 3RTVA 4C8NA 4L8RB 4OLBA 4CEAA 3EE8A 4CJRA 4DSJA 2VCPA 4MQ3A 2O8DB 2NRVA 3V4IA 1T05A 3VF4A 4IEEA 3ENBA 1HJRA 3BP8A 1KD1O 3AVKA 4JV5K 1JLAA 3CCVN 2OTJN 3DI6A 3S3NA 3MAQA 4OKKA 2OYQA 5I42A 3DAWA 3PUFA 4BGBA 5BR9A 3A2FA 4CGDA 4O5FA 2P9NA 2RPIA 3RR8A 2KTQA 4IG0A 4NB4A 4H5RA 3THYA 3CD6N 1NK7A 3EO3A 2X6NA 2YHXA 4X66K 3HL8A 4KTQA 1SS6A 5KQDA 3PSIA 2P1JA 3M8RA 3E66A 3CPWM 1Q81O 5HOOA 3MX2A 5ADXA 3HM8A 4CJEA 2H3GX 1YVUA 3G0ZA 1HQUA 5FPDA 3CCEN 4G9ZA 3K9KA 4DQIA 4DQPA 2UU9K 4N41A 2ETJA 1NJYA 4H4OA 2G8KA 5E26A 2KFZA 2WBNA 1OH8A 4CZKA 1S1UA 4FJ7A 3MX5A 3FGUA 3SUPA 1LW2A 4CIGA 3QMLA 1DEJA 4CECA 3OJSA 1VQMN 3CC7N 1RT7A 1UWBA 3O3HA 1DKGD 4FJIA 2OA8A 4PWDA 4ICLA 3WEEB 4DFMA 2GV9A 1X9SA 4CF9A 4CGFA 3S9HA 4BACA 1DGKN 4E19A 1JKHA 3LP1A 4HUGA 3AA5X 3ZYYX 3MDQA 4KHNA 2AP1A 3P1GA 4DV0K 4WFNL 4K25A 2QK9A 3CIPA 4RW7A 4KBOA 3I8DA 3O3GA 2A1SA 1A5XA 1KLMA 4BRDA 4CIEA 3OYIA 3HSCA 1U2VB 4KAZA 4FK2A 5C0YA 4BC4A 3AAPA 4E7KA 1K8KA 3MN9A 2VWKA 3IKMA 5J2PA 5EX5A 3NMUA 4BVOA 3MXJA 3AVFA 2BH1A 2D5RA 4W5NA 1NLVA 4BWMA 4PHTX 5BN8A 1YITN 2I5JA 3OYDA 3HVRA 5HL7L 1YJWN 1IH7A 2HF4A 3GE1A 3LWLA 1RT4A 4CFAA 4H03B 4PA1A 3CCJN 3DXMB 3ID6A 1XNQK 4FJJA 1XQSC 3L3UA 1XI1A 3GG4A 4EP4A 1S22A 1IKYA 3IRXA 2G8WA 5JICA 2YJEA 4BDYA 5HRPA 2D0PA 5AQTA 3VF2A 3NCIA 5AR0A 1NGGA 2UUCK 3QFPA 4ZTFA 3LP3A 3QEPA 3I8BA 1FK9A 3F9KA 2YNFA 4EAHD 5JVGL 1SL0A 1NU0A 4E1NA 1U45A 1GLLO 3PX0A 5AFUH 1T03A 1GOBA 4CFBA 1GLCG 3HSTB 1NMNA 4CHYA 4BC3A 2FF6A 3O1BA 4W5QA 4E1MA 5FDLA 4A62A 4CF2A 5JS2A 3OS0A 1NGCA 4IOAL 3L2VA 2OZSA 3CHWA 1ZBHA 5JS1A 3V9XA 4YDUC 4WQ5A 2O8FB 1BG3A 3G25A 2QWLA 1SL1A 3NVMA 3AVNA 3TAQA 3JXUA 1L3TA 1P90A 2DY4A 1RNHA 5CYQA 2OPRA 4I9LA 1VSMA 1BISA 3SAHA 2ZE2A 4ZTJA 4JKAA 4QS7A 4WFBL 1YI2N 4LD0A 2E2PA 4E7HA 1WSGA 3BGRA 3QINA 4HWIA 1IJJA 4BR2A 1NMDA 4DV3K 1VRTA 3R1XA 1ASVA 3ZSOA 1O1WA 1HNZK 4IJNA 1LWFA 4CF0A 1NGJA 1JLCA 4FWKA 3SCXA 3IAYA 1TKTA 4CD3A 3DXKA 1XMQK 4JAXA 3UKRA 3RMAA 4B3SK 4JN4A 3L4IA 4AHRA 3O6WA 4YOVA 4JI5K 1RT5A 1NNEA 2A5XA 2WTUA 2E1YA 3I55N 4JK7A 2NLXA 1VQ4N 3HVTA 4FWRA 3SYZA 1S9EA 4C1NK 4Y1CA 2GUPA 3RMCA 4OVLA 4DUZK 2CGJA 5FRNA 4KHPK 4X62K 1IG8A 2FC0A 4ISEA 3K58A 4H0VB 3H46O 2F9TA 5KTQA 3ZEUA 2PY5A 4DB3A 4O0JA 4NYFA 5HBMA 2KFNA 4AHCA 1RDBA 5LJVA 4CD1A 4IG3A 1C0MA 1E4FT 5AQIA 3I56N 5AQQA 2NRHA 4B3MK 3CI5A 3P4IA 2WOMA 1JLGA 4FW2A 3CMEN 4DR1K 4DR6K 3LZIA 3TU5A 1L5UA 1VRUA 2PYJA 4LFCK 2BDPA 3TTFA 4DUYK 3QB0A 3PO4A 4O5BA 5JVHL 4PY5A 3ULEB 3MWTA 1M90O 2Q31A 3GDQA 4KH5A 1QHAA 3WNGA 3CJBA 3AGRA 2QA4N 4CJQA 3LPTA 3CC2N 1KRPA 1WSIA 3O9TA 1MA9B 4BWJA 3RR7A 4CW7B 4L3QA 4XH4A 1VQPN 3D2FB 1HPZA 5FLXO 4WCEL 3LDPA 4JKBA 3ATUA 1MWMA 3J7ZO 2X78A 5AZJB 1N33K 3O5BA 4JK8A 2QWRA 1EKEA 1VSJA 2VG6A 3OYNA 4AM6A 4B9MA 3DLKA 1ITGA 3AARA 2ZD1A 4FZXC 3ASMA 3VF6A 1E4GT 4FLUA 1JCFA 1NK0A 1LWCA 1FKPA 3TSPA 1ASWA 3L4QA 4EZ9A 4K8ZA 3AO3A 4M41A 1NK6A 1OH7A 3VEZA 3SQ0A 4O55A 3VTIA 4FZZA 1I94K 1T3VA 4CEFA 5BPLA 1EWRA 4ID1A 3H08A 4O8UA 2G8UA 1NK4A 3ISNC 4DF8A 1CZ9A 3OYBA 4V19S 3CFRA 1D4XA 1ATNA 3AA4A 4X64K 3FFKB 3VGMA 4JI7K 4Z0UA 3R8EA 4A57A 4CK2A 2P9LA 4M3ZA 1QSSA 1TK0A 3HBTA 1Q86O 1LWEA 4H0TB 4RWTA 4QCLA 1EWQA 1U6ZA 2E2NA 3GL1A 2KQ2A 2HNDA 3A0IX 4PKIA 1YUWA 4ELTA 5C2FA 3HK2A 4B9LA 1V4SA 3SZ2A 4M42A 3HI0A 1HKGA 1KQSM 4B3TK 1X9JA 4EHTA 3ITHA 4CZEA 4HHTA 3NF9A 3AVAA 3PSFA 3CJ1A 4JI0K 4FJ8A 4JHDA 3AVIA 4RW9A 4N5SA 3SQ1A 5EVZA 1S72N 4FZYA 4F8RA 4BR9A 4IBNA 4WF9L 4JRPA 1HLUA 4E7IA 2YHWA 2WFBA 4A2BA 3N4PA 4IXCA 1X9MA 1JLQA 5T7BA 2A3ZA 2HHQA 3CC4N 5CZ1A 1SZ2A 2FBYA 2GWJA 5MLCQ 3PV8A 5CR4A 2HNYA 3FR0A 4KH6A 1C0GA 1N5YA 3L2QA 3V9UA 5M1QA 1HUXA 4DTSA 3MXMA 1W9HA 2PFUA 3ZSQA 5HRRA 2X74A 1JLFA 1TKZA 3CF5L 3OA9A 4YDUA 3C94A 2CH6A 3TR8A 2BTFA 1A5VA 4JD2B 4YOWA 4IOXA 3BZKA 1NBWA 4DLEA 1BIUA 3ZT1A 3NF7A 3ZETA 2NRRA 1BQNA 4AH9A 4OGEA 3RRGA 5AQSA 4CGGA 2QI2A 1J9AA 4F2SA 1Q9YA 4RTFD 4LF6K 4HCBA 4H5TA 3V9SA 3CJCA 3QFUA 1NOZA 4W5RA 1BL3A 3VA3A 1BA0A 3E9OA 3CM5A 5AZIB 3KK3A 2F8TA 2IS3A 3VEXA 2J4RA 1U47A 3HRGA 4FJLA 4WQ5C 2PBDA 3DOKA 4AILC 2A1RA 3J7YP 1S9GA 3A5LC 4O0IA 2IGIA 1HKCA 2IVNA 4BE1A 1NKCA 1YIJN 3TSQA 3JS6A 4LF5K 4CGJA 1XHXA 3PO5A 3CQXA 3KKSA 4LH4A 3KJVA 3K2PA 1UAXA 1NKBA 3LDOA 3KIOA 1RBTA 2ZM6K 4A2AA 3R3LA 1S6PA 1UOCA 3RRHA 3IMXA 5AQNA 3TPQA 3WQUA 3L2UA 2QWOA 3OS1A 3NHGA 4B1UB 1TGOA 3TARA 3CCSN 1J53A 2NRZA
chains in the Genus database with same CATH topology
3LP0A 1HNIA 4Q5VA 3QEWA 4Z4CA 3QO9A 4O4GA 4RW7A 3QNNA 1CXQA 3I8DA 4J2AA 1S1XA 3O3GA 2A1SA 3SPYA 1A5XA 1TKXA 1KLMA 4HUFA 1KFSA 4CIEA 3TAMA 3OYIA 2E6LA 2HHVA 3NBPA 1J5OA 4B3OA 3MEDA 3JSMA 4KI6A 2DFEA 4KAZA 4FK2A 2O4GA 4AHTA 3AVHA 4HVJA 4E7KA 2HHUA 2D0AA 2VWKA 2ZQBA 4CJUA 5J2PA 3T3FA 1RT3A 1S1VA 1IKXA 1U04A 5DK5A 3AO1A 3VQ6A 1RDAA 3VN5A 4OKEA 4RW8A 3MXJA 4CCHA 3ULDA 4J2DA 4FCYA 4FJGA 1CLQA 3AVFA 3SPZA 5KRSA 1RTDA 3ZT3A 2D5RA 1BI4A 3QLHA 3S3MA 1ZBIA 4W5NA 2RN2A 3EYZA 1L3UA 4BWMA 2I5JA 3OYDA 2Y1IA 1SKSA 3HVRA 1WSHA 4B9UA 3O3FA 1TK8A 1BIZA 1B9DA 4CJKA 1IH7A 4OJRA 3LWLA 1D5AA 1RT4A 3AO4A 3CFPA 5HROA 4CFAA 3U3YA 1Z26A 4PA1A 4KHQA 4Y1DA 4EP5A 3AA3A 5C25A 4B9VA 4FJJA 4RW4A 3L3UA 2D0CA 1XI1A 4CHZA 4XIUA 3THVA 1RTHA 4EP4A 3IRXA 1IKYA 2G8WA 3L2RA 4BDYA 3QIOA 3TAEA 5HRPA 3SNNA 1WAFA 4CEZA 1SKRA 3NCIA 3RMDA 3SQ4A 3S9HA 4NYNA 2HHSA 1S1TA 4ZTFA 3LP3A 3QEPA 2G8HA 1JXBA 4LSNA 1KVAA 1XWLA 3ZT2A 2DFFA 1IO2A 1FK9A 3F9KA 1MU2A 4DTRA 2YNFA 1SL0A 1WN7A 4FK4A 4Q0BA 2HHTA 1RBSA 4E1NA 1U45A 1TV6A 2XY8A 1FXXA 3PX0A 1T03A 4ELVA 1G15A 2Z1HA 1UA1A 1GOBA 1NK9A 4CFBA 3DRPA 4FJHA 2F96A 1NJXA 2Z1GA 3HSTB 4DLGA 3V1RA 4DQRA 3KK1A 1K6YA 3BDPA 1T8EA 4CF1A 4CHYA 2XO7A 1JXEA 3HP9A 3PX6A 4W5QA 1ZBFA 3I0SA 4E1MA 4C8LA 1EX4A 5FDLA 5J1EA 4CEEA 4CF2A 3HP6A 5JS2A 3OS0A 1S5JA 2XY5A 5HRSA 3VQ4A 3OYJA 1CZBA 2IC3A 3L2VA 4DSLA 3P5JA 2OZSA 1ZBHA 2D0BA 5JS1A 3V9XA 4CHNA 1VSIA 4RW6A 4FLTA 2F8SA 4W5OA 1R0AA 1SL1A 4FM2A 3HJFA 3AVGA 4FLYA 2DTUA 3CM6A 1Y97A 1VSHA 1U49A 4K8XA 2YNGA 3AVNA 3DRSA 3TAQA 1UA0A 1L3TA 2DY4A 1RNHA 5CYQA 2OPRA 1VSEA 1VSMA 2XRIA 1BISA 2YNHA 4JLHA 4I9LA 2ZE2A 2X6SA 3MEGA 3WNHA 4ZTJA 1L3SA 4L8RB 1IG9A 1B9FA 1WSJA 4LD0A 3KLEA 2XHBA 4E7HA 3HM9A 4KHSA 4KREA 1WSGA 3BGRA 3K5MA 4KTWA 3NF6A 1TL3A 4GMJB 3QINA 3QEIA 2HVIA 2O4IA 4KTZA 1CXUA 4F2RA 1VRTA 4AHSA 4CHQA 4FXDA 1RILA 3K59A 4KRFA 4UQGA 2BGGA 1SKWA 1NK8A 4M45A 2OPPA 1ASVA 1TVRA 1VSDA 3ZSOA 1O1WA 1S6QA 4CHOA 4DSFA 4DTMA 1NK5A 3KD1E 2IOCA 1LWFA 4OKJA 5EU7A 1ZYQA 4FJMA 4M3YA 4CFDA 4CJSA 4CF0A 3SCXA 1JLCA 1J54A 2DFHA 4GVMA 3OYEA 4HUEA 3IAYA 1TKTA 1GOAA 4OPKA 3TAGA 4DG1A 1D9FA 4CE9A 1RTJA 5CYMA 4Z4IA 1KLNA 2BE2A 3RMAA 4FVMA 2AJQA 3OYKA 1TK5A 4NCBA 5DMRA 4AHRA 4ELUA 1QSYA 5HLFA 1FKOA 1U4BA 3TWHA 1QHTA 3HT3A 1RT5A 4OGCA 3ZSZA 4M3RA 1D8YA 3ZSWA 2KZZA 2P5GA 3VQAA 3CQ8A 2G8FA 4NCAA 3NH1A 3AVLA 4Z4FA 3WNFA 3NGZA 3HVTA 3VQDA 3OYLA 3ZSRA 1EXQA 1GOCA 3KK2A 2OPQA 3SYZA 1S9EA 3V9WA 3TAPA 4Y1CA 3DYAA 3HYFA 3HPHA 1WNSA 4CJPA 2YKMA 3KKRA 3RMCA 4OVLA 1QSLA 4KI4A 2QK9A 5FRNA 4LY7A 1XC9A 2EX3A 3SUNA 2YHBA 2FC0A 3K58A 4N56A 2PYLA 4IDKA 3CFOA 1VK0A 4J2EA 2W42A 5KTQA 5KGWA 3DMJA 3QNOA 3TI0A 2HB5A 2PY5A 1HYZA 1TAQA 2VG7A 4O0JA 3QETA 4NYFA 5HBMA 4JS4A 5J2MA 4CHPA 2KFNA 4AHCA 1RDBA 4F3OA 4IG3A 2FBXA 1C0MA 3G10A 4Z4HA 2FBTA 2FBVA 1C1BA 4KHUA 3ALYA 1NJZA 3VA0A 4E7LA 4FJ5A 3LPUA 4OLAA 1QQCA 4NCGA 4J2BA 2WOMA 1RBRA 1JLGA 1U48A 1HYSA 4CEBA 3L2WA 4FW2A 3OJUA 4Z4EA 1LAVA 3VQ8A 3LZIA 2E4LA 1TL1A 3AV9A 3I0RA 3AVMA 4G1QA 1L5UA 4BDPA 4FJKA 4KHYA 1VRUA 4B8AB 2WONA 1SL2A 3AVJA 3LALA 3KTQA 2PYJA 1VSFA 4QOZB 3CG7A 3NGYA 3QIPA 3KD5E 3B6PA 3O4QA 5E41A 2BDPA 1KTQA 1Z25A 3PO4A 1VSLA 2Y1JA 3VQ5A 4YFUA 4O5BA 4DQSA 3TANA 4TSXA 4FJXA 4PY5A 4M3TA 4F3TA 1VSKA 1WLJA 4DTOA 5K14A 3V1QA 4LH5A 3AVBA 3ZT0A 1HNVA 4GW6A 3WNGA 4CJQA 3KLFA 4AHVA 3PX4A 3LPTA 3K5LA 2HMIA 3NFAA 1KRPA 3M8QA 1WSIA 5I3UA 4KHWA 4BWJA 3RR7A 5C24A 4BE0A 2OZMA 4DTJA 4IKFA 2PZSA 1LW0A 1BI4B 3MXIA 5CZ2A 3UIQA 4CK1A 1HPZA 1T7PA 4DU3A 4OPJA 2YNIA 1QE1A 4KO0A 1SV5A 4FW1A 4BE2A 4M3XA 4WE1A 1XHZA 3NH2A 3E01A 4CESA 4KB1A 2X78A 4DQQA 1EKEA 1JLBA 1VSJA 2VG6A 2YKNA 3OYMA 1D9DA 4N76A 4H8KA 3OYNA 2ATQA 2IAJA 4YNQA 4B9MA 1JL1A 3DLKA 1ITGA 3HPOA 3NDKA 3SJJA 4CJ3A 1WAJA 2ZD1A 4FZXC 1KVBA 3ASMA 3T1AA 4DMNA 4HCCA 2RF2A 2Z1IA 5KGXA 4E3SA 2Q3SA 4FLUA 4CJWA 3QEVA 1LWCA 1FKPA 1NK0A 1ASWA 1KFDA 2OPSA 4EZ9A 3AO3A 4K8ZA 2KZMA 3DLBA 4M41A 3NH0A 1NK6A 3FFIA 4I7FA 3O4NA 4B8CA 4CGHA 3OYHA 3SQ0A 4DS4A 4O55A 4CERA 2EHGA 4I2QA 3OS2A 4HTUA 4FZZA 4W5TA 5FRMA 4B08A 3U3GA 4CEFA 4ID1A 3VQQA 3H08A 4MFBA 4E0DA 2G8UA 1NK4A 1BCOA 3ISNC 4DF8A 1CZ9A 3U6FA 3OYBA 1B92A 2KW4A 1QTMA 3VQPA 4KV8A 4LSLA 3M8SA 4FLZA 4CJ5A 3CFRA 4DFKA 4FK0A 4DTNA 2GUIA 3VQEA 3AA4A 4FM0A 1KCFA 5KRTA 5CY4A 1RDCA 4KFBA 3NGIA 5J2NA 4FJNA 3LAKA 1A5WA 4Z0UA 3JYTA 3F73A 4DFJA 4C8KA 4FM1A 4DU1A 4PUOA 4CK2A 3SV3A 1NJWA 3SI6A 3CYMA 4M3ZA 4IFYA 5HRNA 1QSSA 3RMBA 3LP2A 1TK0A 2RKIA 1Q8IA 1LWEA 3C95A 4QCLA 1EP4A 1Q9XA 2HNZA 2KQ2A 2HNDA 3KLIA 4KKOA 1HMVA 4I2PA 4CEOA 3PY8A 4I9QA 4ELTA 1RBVA 1NKEA 4C8OA 5D3GA 3HK2A 4B9LA 4R5PA 3K57A 3SZ2A 2GBZA 4M42A 1RCHA 1JL2A 4CJ4A 1C1AA 3ZSXA 4E89A 3ITHA 3D0PA 4HHTA 1REVA 1LV5A 1KSPA 3NF9A 3P83D 3LDSA 3QEXA 3AVAA 1YT3A 4B9TA 4FJ9A 3QESA 4PQUA 2HHXA 1WSEA 1I3AA 3DM2A 1HYVA 2P5OA 1ZBUA 4BDZA 4FJ8A 2YV0X 3AVIA 4RW9A 4N5SA 3MECA 3SQ1A 3V1OA 1X1PA 3C6UA 3DLGA 4FLVA 1BGXT 4RG8A 3NE6A 4F8RA 4KB0A 4FZYA 2BANA 4O44A 3K5NA 3V9ZA 4IBNA 3VQ9A 3AA2A 2VG5A 3NAEA 4JRPA 4DTPA 2QXFA 4FLWA 5HP1A 4N47A 4E7IA 1BHLA 2HW3A 1IKVA 1C1CA 1DLOA 1X9SA 2G8IA 4FLXA 2QKBA 1YTAA 1X9MA 1LAWA 2HHWA 1KVCA 3LZJA 3DRRA 3SUQA 1JLQA 5T7BA 1TAUA 2HHQA 3EY1A 3HO1A 5CZ1A 1BCMA 4QAGA 1I39A 3V6DA 4DTXA 3AVCA 2FBYA 3OYAA 3PV8A 5SWMA 3S3OA 2HNYA 2G8VA 4M3WA 5SZTA 4IFVA 2JGUA 3ZSYA 4Z4GA 1N5YA 4DSKA 3ZSVA 3L2QA 1YTUA 3LWMA 3V9UA 3ZCMA 4DTSA 3HPGA 3MXMA 1W9HA 3HXMA 3D45A 3IS9A 3NF8A 2IDOA 1HQEA 3DLEA 3ZSQA 5HRRA 2XY7A 3VQBA 1C0TA 3RTVA 3OVNA 2X74A 4C8NA 1NOYA 4CEAA 2Z1JA 4DSIA 4CJRA 2P51A 4OLBA 4DSJA 1JLFA 1TKZA 4MQ3A 3OYFA 4JRQA 3V4IA 3VQCA 1T05A 1RBUA 3C94A 4CIFA 3TR8A 1HJRA 1A5VA 1L3VA 3AVKA 1QS4A 1DTTA 3VQ7A 1JLAA 3TAFA 3TABA 4DLEA 3DI6A 3S3NA 1BIUA 3DLRA 3ZT1A 3L8BA 4CK3A 3OYCA 4B9NA 3NF7A 3MAQA 2B5JA 4OKKA 2OYQA 4F4KA 3AO5A 5I42A 3EZ5A 4AHUA 3C6TA 3PUFA 1BQNA 4AH9A 4OGEA 1N6QA 4M3UA 3A2FA 1EETA 4CGDA 2ITGA 4CF8A 2VWJA 2RPIA 3RRGA 4CGGA 3RR8A 3KLGA 2KTQA 4ZHRA 2R7YA 1SUQA 4IG0A 1J9AA 1IKWA 4CFCA 4DU4A 3IG1A 5J2QA 1TKDA 2B6AA 1Q9YA 4CEQA 4F2SA 2HVHA 3SQ2A 1NK7A 2X6NA 3L3VA 3RWUA 4HCBA 1S1WA 3HL8A 2JLEA 3V9SA 1C0UA 4KTQA 4E7JA 4JS5A 4W5RA 1NOZA 4CGIA 2LSNA 3DOLA 1BL3A 3VA3A 3OY9A 2P1JA 1BQMA 3CM5A 3KK3A 3M8RA 2F8TA 2IS3A 5FROA 1U47A 3OYGA 3T19A 1X9WA 1RT2A 2NUBA 4FJLA 2B4JA 4CJEA 3DOKA 3G0ZA 1YVUA 4AILC 1HQUA 4CJLA 2A1RA 4EZ6A 1HRHA 4DQIA 4DQPA 1S9GA 2XY6A 4O0IA 3K5OA 2IGIA 1C6VA 4ID5A 4N41A 4KPYA 2ETJA 3SUOA 1NJYA 4BE1A 4H4OA 1NKCA 2G8KA 1F21A 4DWIA 1WSFA 3LANA 4CJVA 3KLHA 4DS5A 4DTUA 2KFZA 3DLHA 4CGJA 1XHXA 1ASUA 1W0HA 2E6MA 4DFPA 4B9SA 4H4MA 4CJFA 4DSEA 1S1UA 3PO5A 4FJ7A 4FYDA 2QKKA 3SUPA 1LW2A 3ZT4A 4CIGA 4CECA 3KKSA 2YHAA 1RT1A 3MEEA 4LH4A 3OJSA 3K2PA 3KJVA 1RT6A 1UAXA 1NKBA 3KIOA 1RT7A 5C42A 3WNEA 1UWBA 3LAMA 1RDDA 1RTIA 1RBTA 3M8PA 3V81A 3O3HA 4CJTA 4FJIA 3QERA 2OA8A 1S6PA 4PWDA 1UOCA 4ICLA 1JLEA 3RRHA 4CEDA 2GV9A 4DFMA 4CF9A 4CGFA 3L2UA 4C8MA 3NHGA 3OS1A 4E19A 1JKHA 3LP1A 1DTQA 3AA5X 4HUGA 1TGOA 4BACA 4DF4A 3TARA 1ZBLA 4KHNA 5KI6A 1J53A 3P1GA 3B6OA 3AO2A 3SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP0 A;  1HNI A;  4Q5V A;  3QEW A;  4Z4C A;  3QO9 A;  4O4G A;  4RW7 A;  3QNN A;  1CXQ A;  3I8D A;  4J2A A;  1S1X A;  3O3G A;  2A1S A;  3SPY A;  1A5X A;  1TKX A;  1KLM A;  4HUF A;  1KFS A;  4CIE A;  3TAM A;  3OYI A;  2E6L A;  2HHV A;  3NBP A;  1J5O A;  4B3O A;  3MED A;  3JSM A;  4KI6 A;  2DFE A;  4KAZ A;  4FK2 A;  2O4G A;  4AHT A;  3AVH A;  4HVJ A;  4E7K A;  2HHU A;  2D0A A;  2VWK A;  2ZQB A;  4CJU A;  5J2P A;  3T3F A;  1RT3 A;  1S1V A;  1IKX A;  1U04 A;  5DK5 A;  3AO1 A;  3VQ6 A;  1RDA A;  3VN5 A;  4OKE A;  4RW8 A;  3MXJ A;  4CCH A;  3ULD A;  4J2D A;  4FCY A;  4FJG A;  1CLQ A;  3AVF A;  3SPZ A;  5KRS A;  1RTD A;  3ZT3 A;  2D5R A;  1BI4 A;  3QLH A;  3S3M A;  1ZBI A;  4W5N A;  2RN2 A;  3EYZ A;  1L3U A;  4BWM A;  2I5J A;  3OYD A;  2Y1I A;  1SKS A;  3HVR A;  1WSH A;  4B9U A;  3O3F A;  1TK8 A;  1BIZ A;  1B9D A;  4CJK A;  1IH7 A;  4OJR A;  3LWL A;  1D5A A;  1RT4 A;  3AO4 A;  3CFP A;  5HRO A;  4CFA A;  3U3Y A;  1Z26 A;  4PA1 A;  4KHQ A;  4Y1D A;  4EP5 A;  3AA3 A;  5C25 A;  4B9V A;  4FJJ A;  4RW4 A;  3L3U A;  2D0C A;  1XI1 A;  4CHZ A;  4XIU A;  3THV A;  1RTH A;  4EP4 A;  3IRX A;  1IKY A;  2G8W A;  3L2R A;  4BDY A;  3QIO A;  3TAE A;  5HRP A;  3SNN A;  1WAF A;  4CEZ A;  1SKR A;  3NCI A;  3RMD A;  3SQ4 A;  3S9H A;  4NYN A;  2HHS A;  1S1T A;  4ZTF A;  3LP3 A;  3QEP A;  2G8H A;  1JXB A;  4LSN A;  1KVA A;  1XWL A;  3ZT2 A;  2DFF A;  1IO2 A;  1FK9 A;  3F9K A;  1MU2 A;  4DTR A;  2YNF A;  1SL0 A;  1WN7 A;  4FK4 A;  4Q0B A;  2HHT A;  1RBS A;  4E1N A;  1U45 A;  1TV6 A;  2XY8 A;  1FXX A;  3PX0 A;  1T03 A;  4ELV A;  1G15 A;  2Z1H A;  1UA1 A;  1GOB A;  1NK9 A;  4CFB A;  3DRP A;  4FJH A;  2F96 A;  1NJX A;  2Z1G A;  3HST B;  4DLG A;  3V1R A;  4DQR A;  3KK1 A;  1K6Y A;  3BDP A;  1T8E A;  4CF1 A;  4CHY A;  2XO7 A;  1JXE A;  3HP9 A;  3PX6 A;  4W5Q A;  1ZBF A;  3I0S A;  4E1M A;  4C8L A;  1EX4 A;  5FDL A;  5J1E A;  4CEE A;  4CF2 A;  3HP6 A;  5JS2 A;  3OS0 A;  1S5J A;  2XY5 A;  5HRS A;  3VQ4 A;  3OYJ A;  1CZB A;  2IC3 A;  3L2V A;  4DSL A;  3P5J A;  2OZS A;  1ZBH A;  2D0B A;  5JS1 A;  3V9X A;  4CHN A;  1VSI A;  4RW6 A;  4FLT A;  2F8S A;  4W5O A;  1R0A A;  1SL1 A;  4FM2 A;  3HJF A;  3AVG A;  4FLY A;  2DTU A;  3CM6 A;  1Y97 A;  1VSH A;  1U49 A;  4K8X A;  2YNG A;  3AVN A;  3DRS A;  3TAQ A;  1UA0 A;  1L3T A;  2DY4 A;  1RNH A;  5CYQ A;  2OPR A;  1VSE A;  1VSM A;  2XRI A;  1BIS A;  2YNH A;  4JLH A;  4I9L A;  2ZE2 A;  2X6S A;  3MEG A;  3WNH A;  4ZTJ A;  1L3S A;  4L8R B;  1IG9 A;  1B9F A;  1WSJ A;  4LD0 A;  3KLE A;  2XHB A;  4E7H A;  3HM9 A;  4KHS A;  4KRE A;  1WSG A;  3BGR A;  3K5M A;  4KTW A;  3NF6 A;  1TL3 A;  4GMJ B;  3QIN A;  3QEI A;  2HVI A;  2O4I A;  4KTZ A;  1CXU A;  4F2R A;  1VRT A;  4AHS A;  4CHQ A;  4FXD A;  1RIL A;  3K59 A;  4KRF A;  4UQG A;  2BGG A;  1SKW A;  1NK8 A;  4M45 A;  2OPP A;  1ASV A;  1TVR A;  1VSD A;  3ZSO A;  1O1W A;  1S6Q A;  4CHO A;  4DSF A;  4DTM A;  1NK5 A;  3KD1 E;  2IOC A;  1LWF A;  4OKJ A;  5EU7 A;  1ZYQ A;  4FJM A;  4M3Y A;  4CFD A;  4CJS A;  4CF0 A;  3SCX A;  1JLC A;  1J54 A;  2DFH A;  4GVM A;  3OYE A;  4HUE A;  3IAY A;  1TKT A;  1GOA A;  4OPK A;  3TAG A;  4DG1 A;  1D9F A;  4CE9 A;  1RTJ A;  5CYM A;  4Z4I A;  1KLN A;  2BE2 A;  3RMA A;  4FVM A;  2AJQ A;  3OYK A;  1TK5 A;  4NCB A;  5DMR A;  4AHR A;  4ELU A;  1QSY A;  5HLF A;  1FKO A;  1U4B A;  3TWH A;  1QHT A;  3HT3 A;  1RT5 A;  4OGC A;  3ZSZ A;  4M3R A;  1D8Y A;  3ZSW A;  2KZZ A;  2P5G A;  3VQA A;  3CQ8 A;  2G8F A;  4NCA A;  3NH1 A;  3AVL A;  4Z4F A;  3WNF A;  3NGZ A;  3HVT A;  3VQD A;  3OYL A;  3ZSR A;  1EXQ A;  1GOC A;  3KK2 A;  2OPQ A;  3SYZ A;  1S9E A;  3V9W A;  3TAP A;  4Y1C A;  3DYA A;  3HYF A;  3HPH A;  1WNS A;  4CJP A;  2YKM A;  3KKR A;  3RMC A;  4OVL A;  1QSL A;  4KI4 A;  2QK9 A;  5FRN A;  4LY7 A;  1XC9 A;  2EX3 A;  3SUN A;  2YHB A;  2FC0 A;  3K58 A;  4N56 A;  2PYL A;  4IDK A;  3CFO A;  1VK0 A;  4J2E A;  2W42 A;  5KTQ A;  5KGW A;  3DMJ A;  3QNO A;  3TI0 A;  2HB5 A;  2PY5 A;  1HYZ A;  1TAQ A;  2VG7 A;  4O0J A;  3QET A;  4NYF A;  5HBM A;  4JS4 A;  5J2M A;  4CHP A;  2KFN A;  4AHC A;  1RDB A;  4F3O A;  4IG3 A;  2FBX A;  1C0M A;  3G10 A;  4Z4H A;  2FBT A;  2FBV A;  1C1B A;  4KHU A;  3ALY A;  1NJZ A;  3VA0 A;  4E7L A;  4FJ5 A;  3LPU A;  4OLA A;  1QQC A;  4NCG A;  4J2B A;  2WOM A;  1RBR A;  1JLG A;  1U48 A;  1HYS A;  4CEB A;  3L2W A;  4FW2 A;  3OJU A;  4Z4E A;  1LAV A;  3VQ8 A;  3LZI A;  2E4L A;  1TL1 A;  3AV9 A;  3I0R A;  3AVM A;  4G1Q A;  1L5U A;  4BDP A;  4FJK A;  4KHY A;  1VRU A;  4B8A B;  2WON A;  1SL2 A;  3AVJ A;  3LAL A;  3KTQ A;  2PYJ A;  1VSF A;  4QOZ B;  3CG7 A;  3NGY A;  3QIP A;  3KD5 E;  3B6P A;  3O4Q A;  5E41 A;  2BDP A;  1KTQ A;  1Z25 A;  3PO4 A;  1VSL A;  2Y1J A;  3VQ5 A;  4YFU A;  4O5B A;  4DQS A;  3TAN A;  4TSX A;  4FJX A;  4PY5 A;  4M3T A;  4F3T A;  1VSK A;  1WLJ A;  4DTO A;  5K14 A;  3V1Q A;  4LH5 A;  3AVB A;  3ZT0 A;  1HNV A;  4GW6 A;  3WNG A;  4CJQ A;  3KLF A;  4AHV A;  3PX4 A;  3LPT A;  3K5L A;  2HMI A;  3NFA A;  1KRP A;  3M8Q A;  1WSI A;  5I3U A;  4KHW A;  4BWJ A;  3RR7 A;  5C24 A;  4BE0 A;  2OZM A;  4DTJ A;  4IKF A;  2PZS A;  1LW0 A;  1BI4 B;  3MXI A;  5CZ2 A;  3UIQ A;  4CK1 A;  1HPZ A;  1T7P A;  4DU3 A;  4OPJ A;  2YNI A;  1QE1 A;  4KO0 A;  1SV5 A;  4FW1 A;  4BE2 A;  4M3X A;  4WE1 A;  1XHZ A;  3NH2 A;  3E01 A;  4CES A;  4KB1 A;  2X78 A;  4DQQ A;  1EKE A;  1JLB A;  1VSJ A;  2VG6 A;  2YKN A;  3OYM A;  1D9D A;  4N76 A;  4H8K A;  3OYN A;  2ATQ A;  2IAJ A;  4YNQ A;  4B9M A;  1JL1 A;  3DLK A;  1ITG A;  3HPO A;  3NDK A;  3SJJ A;  4CJ3 A;  1WAJ A;  2ZD1 A;  4FZX C;  1KVB A;  3ASM A;  3T1A A;  4DMN A;  4HCC A;  2RF2 A;  2Z1I A;  5KGX A;  4E3S A;  2Q3S A;  4FLU A;  4CJW A;  3QEV A;  1LWC A;  1FKP A;  1NK0 A;  1ASW A;  1KFD A;  2OPS A;  4EZ9 A;  3AO3 A;  4K8Z A;  2KZM A;  3DLB A;  4M41 A;  3NH0 A;  1NK6 A;  3FFI A;  4I7F A;  3O4N A;  4B8C A;  4CGH A;  3OYH A;  3SQ0 A;  4DS4 A;  4O55 A;  4CER A;  2EHG A;  4I2Q A;  3OS2 A;  4HTU A;  4FZZ A;  4W5T A;  5FRM A;  4B08 A;  3U3G A;  4CEF A;  4ID1 A;  3VQQ A;  3H08 A;  4MFB A;  4E0D A;  2G8U A;  1NK4 A;  1BCO A;  3ISN C;  4DF8 A;  1CZ9 A;  3U6F A;  3OYB A;  1B92 A;  2KW4 A;  1QTM A;  3VQP A;  4KV8 A;  4LSL A;  3M8S A;  4FLZ A;  4CJ5 A;  3CFR A;  4DFK A;  4FK0 A;  4DTN A;  2GUI A;  3VQE A;  3AA4 A;  4FM0 A;  1KCF A;  5KRT A;  5CY4 A;  1RDC A;  4KFB A;  3NGI A;  5J2N A;  4FJN A;  3LAK A;  1A5W A;  4Z0U A;  3JYT A;  3F73 A;  4DFJ A;  4C8K A;  4FM1 A;  4DU1 A;  4PUO A;  4CK2 A;  3SV3 A;  1NJW A;  3SI6 A;  3CYM A;  4M3Z A;  4IFY A;  5HRN A;  1QSS A;  3RMB A;  3LP2 A;  1TK0 A;  2RKI A;  1Q8I A;  1LWE A;  3C95 A;  4QCL A;  1EP4 A;  1Q9X A;  2HNZ A;  2KQ2 A;  2HND A;  3KLI A;  4KKO A;  1HMV A;  4I2P A;  4CEO A;  3PY8 A;  4I9Q A;  4ELT A;  1RBV A;  1NKE A;  4C8O A;  5D3G A;  3HK2 A;  4B9L A;  4R5P A;  3K57 A;  3SZ2 A;  2GBZ A;  4M42 A;  1RCH A;  1JL2 A;  4CJ4 A;  1C1A A;  3ZSX A;  4E89 A;  3ITH A;  3D0P A;  4HHT A;  1REV A;  1LV5 A;  1KSP A;  3NF9 A;  3P83 D;  3LDS A;  3QEX A;  3AVA A;  1YT3 A;  4B9T A;  4FJ9 A;  3QES A;  4PQU A;  2HHX A;  1WSE A;  1I3A A;  3DM2 A;  1HYV A;  2P5O A;  1ZBU A;  4BDZ A;  4FJ8 A;  2YV0 X;  3AVI A;  4RW9 A;  4N5S A;  3MEC A;  3SQ1 A;  3V1O A;  1X1P A;  3C6U A;  3DLG A;  4FLV A;  1BGX T;  4RG8 A;  3NE6 A;  4F8R A;  4KB0 A;  4FZY A;  2BAN A;  4O44 A;  3K5N A;  3V9Z A;  4IBN A;  3VQ9 A;  3AA2 A;  2VG5 A;  3NAE A;  4JRP A;  4DTP A;  2QXF A;  4FLW A;  5HP1 A;  4N47 A;  4E7I A;  1BHL A;  2HW3 A;  1IKV A;  1C1C A;  1DLO A;  1X9S A;  2G8I A;  4FLX A;  2QKB A;  1YTA A;  1X9M A;  1LAW A;  2HHW A;  1KVC A;  3LZJ A;  3DRR A;  3SUQ A;  1JLQ A;  5T7B A;  1TAU A;  2HHQ A;  3EY1 A;  3HO1 A;  5CZ1 A;  1BCM A;  4QAG A;  1I39 A;  3V6D A;  4DTX A;  3AVC A;  2FBY A;  3OYA A;  3PV8 A;  5SWM A;  3S3O A;  2HNY A;  2G8V A;  4M3W A;  5SZT A;  4IFV A;  2JGU A;  3ZSY A;  4Z4G A;  1N5Y A;  4DSK A;  3ZSV A;  3L2Q A;  1YTU A;  3LWM A;  3V9U A;  3ZCM A;  4DTS A;  3HPG A;  3MXM A;  1W9H A;  3HXM A;  3D45 A;  3IS9 A;  3NF8 A;  2IDO A;  1HQE A;  3DLE A;  3ZSQ A;  5HRR A;  2XY7 A;  3VQB A;  1C0T A;  3RTV A;  3OVN A;  2X74 A;  4C8N A;  1NOY A;  4CEA A;  2Z1J A;  4DSI A;  4CJR A;  2P51 A;  4OLB A;  4DSJ A;  1JLF A;  1TKZ A;  4MQ3 A;  3OYF A;  4JRQ A;  3V4I A;  3VQC A;  1T05 A;  1RBU A;  3C94 A;  4CIF A;  3TR8 A;  1HJR A;  1A5V A;  1L3V A;  3AVK A;  1QS4 A;  1DTT A;  3VQ7 A;  1JLA A;  3TAF A;  3TAB A;  4DLE A;  3DI6 A;  3S3N A;  1BIU A;  3DLR A;  3ZT1 A;  3L8B A;  4CK3 A;  3OYC A;  4B9N A;  3NF7 A;  3MAQ A;  2B5J A;  4OKK A;  2OYQ A;  4F4K A;  3AO5 A;  5I42 A;  3EZ5 A;  4AHU A;  3C6T A;  3PUF A;  1BQN A;  4AH9 A;  4OGE A;  1N6Q A;  4M3U A;  3A2F A;  1EET A;  4CGD A;  2ITG A;  4CF8 A;  2VWJ A;  2RPI A;  3RRG A;  4CGG A;  3RR8 A;  3KLG A;  2KTQ A;  4ZHR A;  2R7Y A;  1SUQ A;  4IG0 A;  1J9A A;  1IKW A;  4CFC A;  4DU4 A;  3IG1 A;  5J2Q A;  1TKD A;  2B6A A;  1Q9Y A;  4CEQ A;  4F2S A;  2HVH A;  3SQ2 A;  1NK7 A;  2X6N A;  3L3V A;  3RWU A;  4HCB A;  1S1W A;  3HL8 A;  2JLE A;  3V9S A;  1C0U A;  4KTQ A;  4E7J A;  4JS5 A;  4W5R A;  1NOZ A;  4CGI A;  2LSN A;  3DOL A;  1BL3 A;  3VA3 A;  3OY9 A;  2P1J A;  1BQM A;  3CM5 A;  3KK3 A;  3M8R A;  2F8T A;  2IS3 A;  5FRO A;  1U47 A;  3OYG A;  3T19 A;  1X9W A;  1RT2 A;  2NUB A;  4FJL A;  2B4J A;  4CJE A;  3DOK A;  3G0Z A;  1YVU A;  4AIL C;  1HQU A;  4CJL A;  2A1R A;  4EZ6 A;  1HRH A;  4DQI A;  4DQP A;  1S9G A;  2XY6 A;  4O0I A;  3K5O A;  2IGI A;  1C6V A;  4ID5 A;  4N41 A;  4KPY A;  2ETJ A;  3SUO A;  1NJY A;  4BE1 A;  4H4O A;  1NKC A;  2G8K A;  1F21 A;  4DWI A;  1WSF A;  3LAN A;  4CJV A;  3KLH A;  4DS5 A;  4DTU A;  2KFZ A;  3DLH A;  4CGJ A;  1XHX A;  1ASU A;  1W0H A;  2E6M A;  4DFP A;  4B9S A;  4H4M A;  4CJF A;  4DSE A;  1S1U A;  3PO5 A;  4FJ7 A;  4FYD A;  2QKK A;  3SUP A;  1LW2 A;  3ZT4 A;  4CIG A;  4CEC A;  3KKS A;  2YHA A;  1RT1 A;  3MEE A;  4LH4 A;  3OJS A;  3K2P A;  3KJV A;  1RT6 A;  1UAX A;  1NKB A;  3KIO A;  1RT7 A;  5C42 A;  3WNE A;  1UWB A;  3LAM A;  1RDD A;  1RTI A;  1RBT A;  3M8P A;  3V81 A;  3O3H A;  4CJT A;  4FJI A;  3QER A;  2OA8 A;  1S6P A;  4PWD A;  1UOC A;  4ICL A;  1JLE A;  3RRH A;  4CED A;  2GV9 A;  4DFM A;  4CF9 A;  4CGF A;  3L2U A;  4C8M A;  3NHG A;  3OS1 A;  4E19 A;  1JKH A;  3LP1 A;  1DTQ A;  3AA5 X;  4HUG A;  1TGO A;  4BAC A;  4DF4 A;  3TAR A;  1ZBL A;  4KHN A;  5KI6 A;  1J53 A;  3P1G A;  3B6O A;  3AO2 A;  3SV4 A; 
#chains in the Genus database with same CATH topology
 5LMU K;  4Q5V A;  4Z4C A;  4O4G A;  4J2A A;  1S1X A;  3SPY A;  3TAM A;  2E6L A;  2UUB K;  3NBP A;  1J5O A;  3MED A;  4KI6 A;  2DFE A;  4HVJ A;  2HHU A;  2D0A A;  2O8B A;  4CJU A;  2F7T A;  3T3F A;  1RT3 A;  1S1V A;  1U04 A;  5DK5 A;  3AO1 A;  4OKE A;  4B1Z A;  4J2D A;  5BRH A;  4FCY A;  1CLQ A;  2NRW A;  3SPZ A;  5KRS A;  2P9U A;  3ZT3 A;  1N34 K;  5LY3 A;  1IBK K;  2RN2 A;  1L3U A;  5KPR A;  3BY5 A;  1BIZ A;  3CJA A;  4CJK A;  4OJR A;  3CFP A;  5HRO A;  3O9R A;  3U3Y A;  4KHQ A;  4EP5 A;  4YOY A;  1JCE A;  2D0C A;  1MDU B;  3THV A;  4X65 K;  4IEI A;  3O1W A;  3GBT A;  1BUP A;  3QIO A;  3JAM O;  1YF5 L;  3SNN A;  4CEZ A;  4H5N A;  4C23 A;  3GOI A;  1ZBS A;  4NYN A;  2HHS A;  4O8K A;  2G8H A;  2QW9 A;  4LSN A;  1KVA A;  5C15 A;  3ZT2 A;  2DFF A;  1IO2 A;  1MU2 A;  4DTR A;  4BQZ A;  4FK4 A;  2XY8 A;  1VHX A;  4ELV A;  1UA1 A;  4FJH A;  1RGI A;  4Z94 A;  1NJX A;  4DQR A;  3V1R A;  3BDP A;  3PX6 A;  1HX1 A;  3HP6 A;  1Q7Y O;  4H0O A;  3VQ4 A;  3THW A;  3P5J A;  2D0B A;  4CZJ A;  3IUC A;  2QXL A;  4FLT A;  3CPE A;  5GIN A;  3D2E B;  4W5O A;  4C1N I;  4FLY A;  3CM6 A;  1VSH A;  2YNG A;  1UA0 A;  4BRK A;  3HOS A;  1VSE A;  2XRI A;  3U4L A;  4BG9 A;  2X6S A;  3WNH A;  5GAH P;  1IG9 A;  3H1V X;  4LF8 K;  3TTC A;  3C7N A;  4DCH A;  1WSJ A;  4JYA K;  1VQ5 N;  2XHB A;  2HBM A;  3HM9 A;  4GNI A;  4DV6 K;  2HVI A;  2O4I A;  4AHS A;  4CHQ A;  4DV5 K;  1RIL A;  3BF1 A;  4A59 A;  3K59 A;  4FXD A;  1VQL N;  2BGG A;  1SKW A;  4BRP A;  1TVR A;  1XUP O;  4CHO A;  4JI6 K;  4DSF A;  3VGK A;  4JKC A;  4OKJ A;  3E9P A;  5EU7 A;  4FJM A;  4CZM A;  4CFD A;  2DFH A;  3CCR N;  2P9N B;  1Z6R A;  4BRQ A;  1YHQ N;  3E1Y A;  3EE9 A;  4FWL A;  3VEY A;  1V4T A;  1D9F A;  3THY B;  1KLN A;  3P39 A;  4FVM A;  3EKS A;  1TK5 A;  3M5R A;  5JLH A;  3HT3 A;  4OGC A;  3CQ8 A;  2G8F A;  1NM1 A;  1SQK A;  4GKJ K;  3AVL A;  3Q7B A;  3NGZ A;  1GLB G;  3OYL A;  2CH5 A;  1GOC A;  2OPQ A;  4CBU A;  2P9S A;  3DYA A;  4LF9 K;  1W2B M;  2YKM A;  2W6L A;  2EX3 A;  3C6A A;  4NXM K;  2PYL A;  4IDK A;  3CFO A;  1VK0 A;  5A2Q O;  3LM9 A;  2NNW A;  5KGW A;  4EHU A;  4CZL A;  5DM7 L;  4DV7 K;  2O8C A;  3QET A;  4JS4 A;  1K9M O;  3QDK A;  4CHP A;  4M7X A;  2FBV A;  4KHU A;  4IO9 L;  4E7L A;  5AFU A;  4NCG A;  4J2B A;  1HYS A;  4CEB A;  3L2W A;  3OJU A;  1GLF O;  3WQT A;  3I0R A;  5LJW A;  3G6E N;  1QQO A;  1ZXO A;  2V7Z A;  3QIP A;  3KD5 E;  4JI1 K;  3LDL A;  3O4Q A;  4JI4 K;  5ELZ A;  4DQS A;  3TAN A;  4MO5 A;  4H0P A;  3O8M A;  1WBD A;  1VQ9 N;  3IDH A;  4M3T A;  1TYQ A;  1WLJ A;  2KKZ A;  5K14 A;  3V1Q A;  3ZT0 A;  1K8K B;  2FSJ A;  3PX4 A;  3FZF A;  1Z05 A;  3NFA A;  4KHW A;  2UXC K;  1LW0 A;  5DM6 L;  5GAE P;  1GLE G;  3MXI A;  4CK1 A;  1T7P A;  4OPJ A;  1QVF M;  4KO0 A;  5C12 A;  4ILJ A;  4FW1 A;  4WE1 A;  1WUA A;  3NH2 A;  3E01 A;  4U7B A;  3LDN A;  4KB1 A;  4R79 A;  3VGL A;  4BC2 A;  1JLB A;  4ILG B;  3OYM A;  4LF7 K;  4N76 A;  5AQX A;  1D9D A;  1FW6 A;  2UUA K;  2IAJ A;  1X3M A;  4YNQ A;  1JL1 A;  3HPO A;  3SJJ A;  2BUP A;  3O9Q A;  4CJ3 A;  1WAJ A;  2QTD A;  5CHI A;  4DMN A;  4HCC A;  2RF2 A;  2Z1I A;  1JJ2 M;  3BUZ B;  4XH1 A;  1WB9 A;  2KZM A;  4A5A A;  3FFI A;  4ILH A;  4K41 A;  5GIO A;  3O9U A;  2EHG A;  1OVQ A;  4CER A;  4W5T A;  5FRM A;  5AQH A;  4E0D A;  1QQM A;  1NGB A;  4LSL A;  4FK0 A;  4CJ5 A;  3QBX A;  4FM0 A;  4MLH A;  5KRT A;  4CBX A;  4KFB A;  2QWP A;  4FJN A;  4C8K A;  1NJW A;  4BRC A;  3C95 A;  3VEV A;  1EP4 A;  4BQL A;  5JLF A;  4IFE A;  4I9Q A;  4Z4I A;  1RBV A;  3OHR A;  4JEP A;  2GBZ A;  1HNW K;  5GAG P;  1JL2 A;  4CJ4 A;  4E89 A;  4ISG A;  1REV A;  2E2Q A;  1KSP A;  4BRG A;  3QEX A;  2P9P A;  2O8E A;  3PIP L;  3QES A;  4YOU A;  2YV0 X;  3RSE A;  3ZX0 A;  3V1O A;  1X1P A;  3C6U A;  4NCB A;  4O44 A;  3K5N A;  1OH6 A;  3V9Z A;  3SBT A;  3VQ9 A;  4FPB A;  2VG5 A;  3DXK B;  2ZGY A;  3F2K A;  5AQY A;  3UKR B;  2HW3 A;  1C1C A;  1DLO A;  1EQY A;  2QKB A;  1LAW A;  3EY1 A;  3HO1 A;  1BCM A;  3V6D A;  4I6M A;  4DTX A;  5AJ3 K;  3DLL L;  2QEX N;  4XH5 A;  2G8V A;  4JKF A;  2JGU A;  4DSK A;  1YTU A;  3LWM A;  3T7Z A;  1R59 O;  2XY7 A;  4FOE A;  1C0T A;  3OVN A;  2Z1J A;  3ENO A;  2P51 A;  2FF3 B;  4JRQ A;  4A5B A;  1GLA G;  4JI2 K;  3UB5 A;  5M1F A;  1RBU A;  4BRI A;  4CIF A;  2D1K A;  4FOI A;  1QS4 A;  1DTT A;  3VQ7 A;  3ZEU B;  3TAF A;  2GEL A;  3TAB A;  4DR5 K;  4BRA A;  3DLR A;  3L8B A;  4CK3 A;  4J8F A;  4JKD A;  4AHU A;  1N6Q A;  4M3U A;  1T6D A;  1EET A;  4DKW A;  1YVN A;  2ITG A;  4CF8 A;  2VWJ A;  4ZHR A;  1SUQ A;  1IKW A;  4CFC A;  1TKD A;  4Y0W A;  5M1N A;  3SQ2 A;  3OTO K;  3L3V A;  3RWU A;  3H45 C;  4YY3 K;  2JLE A;  4E7J A;  4JS5 A;  2LSN A;  4XEI A;  2ASM A;  3OY9 A;  5AQZ A;  3B8A X;  2ZWH A;  2E8A A;  3T19 A;  2GX9 A;  1RT2 A;  2E2O A;  2NUB A;  3CCM N;  4JKG A;  5KPZ A;  4BR5 A;  4CJL A;  3AY9 A;  3ZLJ A;  1N8R O;  2XY6 A;  3K5O A;  4KPY A;  2UXB K;  1BO5 O;  4LC9 B;  4DWI A;  3LAN A;  3KLH A;  3HTV A;  4DTU A;  4RCH A;  1ASU A;  1W0H A;  4B9S A;  4H4M A;  4CJF A;  4FYD A;  3ENH A;  1RT1 A;  1RT6 A;  3O08 A;  3L6Q A;  3LAM A;  1RDD A;  1RTI A;  3M8P A;  3V81 A;  3J80 O;  4CJT A;  4OO1 J;  4CED A;  4C8M A;  3DLH A;  4DF4 A;  3J7A P;  5KI6 A;  1IV0 A;  3SV4 A;  5IT9 O;  3MMV A;  5BRD A;  3QNN A;  1KFS A;  4HUF A;  5TKY A;  3WUH A;  3JSM A;  2O4G A;  3AVH A;  4K43 A;  4E1J A;  1IKX A;  3VQ6 A;  1RDA A;  4RW8 A;  4JI8 K;  4CCH A;  3ULD A;  1RTD A;  1ATR A;  1BI4 A;  3MN5 A;  4A61 A;  3S3M A;  1N36 K;  2OAN A;  1M1K O;  2P9L B;  1SKS A;  1WSH A;  4LFA K;  3O3F A;  1XMO K;  1TK8 A;  3M1F A;  3AO4 A;  2FSK A;  3EKU A;  5C25 A;  4B9V A;  4XIU A;  4DV4 K;  3UKU A;  3QIC A;  3L2R A;  4WFA L;  3TAE A;  3NVK A;  1WAF A;  1SKR A;  3RMD A;  2EWS A;  3KWI A;  1XWL A;  4M7Y A;  4JHD B;  3R9P A;  4BVP A;  3D7E O;  3O4W A;  1WN7 A;  2GWK A;  3T1H K;  2HHT A;  1J6Z A;  1TV6 A;  1QVG M;  1G15 A;  3DRP A;  2F96 A;  1K6Y A;  4DQ8 A;  2P9K A;  1T8E A;  4CF1 A;  1JXE A;  1ZBF A;  3I0S A;  4OPH A;  1EX4 A;  5J1E A;  4CEE A;  2XY5 A;  5E84 A;  1CZB A;  3LM2 A;  4DSL A;  1KAY A;  1P8Z A;  4RW6 A;  1HR0 K;  1R0A A;  4FM2 A;  3HJF A;  3F5T A;  3QBW A;  3U9Z A;  1Y97 A;  3H1Q A;  3S41 A;  4K8X A;  3FZL A;  5LMN K;  3DRS A;  2QM1 A;  5AQM A;  2YNH A;  4JLH A;  2F4V K;  2E88 A;  3MEG A;  4H5V A;  1HKB A;  4UY8 O;  1B9F A;  3KLE A;  4B1W B;  4KHS A;  3K5M A;  2OTL N;  1TL3 A;  4GV3 A;  4KRF A;  4UQG A;  2Q0R A;  1NK8 A;  3ZET B;  3FZK A;  3KD1 E;  1NGF A;  5BRE A;  1NGH A;  4HUE A;  5FPM A;  3OYE A;  3TAG A;  2FLO A;  1RTJ A;  2VYP A;  5CYM A;  2BE2 A;  2AJQ A;  3VPZ A;  3SK3 A;  3G4S N;  5DMR A;  4ELU A;  1QSY A;  2P9I A;  4H0Y B;  3BF3 A;  1U4B A;  3TWH A;  1QHT A;  3W0L A;  2KZZ A;  3ZSW A;  1MWK A;  3CXC M;  3WXI A;  4Z4F A;  3WNF A;  3PIO L;  3TTD A;  3ZSR A;  1EXQ A;  3BEX A;  3OBW A;  4CZG A;  3HYF A;  4CJP A;  1WNS A;  3AAQ A;  3KKR A;  2WUS A;  3SMP A;  1NG9 A;  3T1Y K;  2O8D A;  3SUN A;  4F9O A;  4N56 A;  2W42 A;  1EO1 A;  1SAZ A;  3U9D A;  3QNO A;  3TI0 A;  4FWM A;  4CZF A;  5J2M A;  5C10 A;  4DR4 K;  4F3O A;  2FBX A;  5AQV A;  3TSU A;  2GEM A;  3G10 A;  4Z4H A;  2A6A A;  1C1B A;  1NJZ A;  4OLA A;  1QQC A;  4LF4 K;  3VEN A;  4HTL A;  1VAZ A;  2V51 B;  5AQF A;  1U48 A;  5LL6 Z;  5GIP A;  3VQ8 A;  3C6H A;  2E4L A;  4Z4E A;  4G1Q A;  2ZJQ L;  3AVM A;  4BDP A;  3D6R A;  4JKE A;  4GV6 A;  2VWB A;  2WON A;  3AVJ A;  4FSV A;  3LAL A;  5BR8 K;  4QOZ B;  3NGY A;  1Z25 A;  4C8O A;  2Y1J A;  4FJX A;  3VQ5 A;  4YFU A;  4TSX A;  4BRM A;  4YOT A;  4NXN K;  2O8B B;  4GW6 A;  4AHV A;  3THX A;  4EFH A;  1BDG A;  3K5L A;  4CZI A;  3AGK A;  4BE0 A;  3ZX2 A;  5AQO A;  4QS8 A;  2P9U B;  2PZS A;  2Q0U A;  5KQ8 A;  5BPM A;  5CZ2 A;  1VQ7 N;  2Q2R A;  4DU3 A;  2YNI A;  4YOR A;  4BGA A;  1SV5 A;  3SLC A;  4BE2 A;  4M3X A;  1Y64 A;  2HBK A;  3WXJ A;  1NJI O;  3CCU N;  5AQW A;  4H8K A;  3SBG A;  4BRF A;  4IKF A;  3H3O B;  3WEE A;  3WXM B;  2V52 B;  2E5L K;  3VER A;  1KVB A;  4FPA A;  3T1A A;  3K9J A;  4E3S A;  2Q3S A;  4CJW A;  3QEV A;  3F9M A;  1KFD A;  2OPS A;  3DLB A;  3CER A;  3NH0 A;  2YCH A;  1JCG A;  3O4N A;  4FWP A;  4GY2 B;  3EZW A;  1U2V A;  3U3G A;  4MFB A;  3THX B;  3OBY A;  3U6F A;  1YJN N;  2KW4 A;  1QTM A;  4OPA A;  3VQP A;  4FLZ A;  4DFK A;  5IWA K;  3THW B;  2GUI A;  3VQE A;  2VQE K;  1RDC A;  3NGI A;  5J2N A;  1A5W A;  4FWO A;  4FM1 A;  3SV3 A;  4FVU A;  3FZM A;  3CYM A;  2HST A;  5ADX H;  4IFY A;  5HRN A;  3LP2 A;  1Q8I A;  2RKI A;  2KHO A;  4CEO A;  3KLI A;  4KKO A;  3PY8 A;  1HMV A;  4I2P A;  3DXM A;  3T69 A;  1NKE A;  2HMP A;  3H6E A;  5BN9 A;  3C7N B;  3K57 A;  5AQU A;  4B1V A;  1C1A A;  3KZB A;  1LV5 A;  5M1O A;  1DT9 A;  4PQU A;  2HHX A;  1WSE A;  1FJG K;  1I3A A;  3DJC A;  1Q18 A;  1HYV A;  1VQ8 N;  4BDZ A;  4JK9 A;  4EIA A;  5HP1 A;  1CZA N;  1KAX A;  2QXF A;  4FLW A;  1BHL A;  2RHK A;  4QS9 A;  1IKV A;  2W40 A;  4FWN A;  3KWG A;  4U67 L;  2WC9 A;  4FLX A;  4GV9 A;  2NRT A;  4FO0 A;  1G99 A;  3LDQ A;  1HPM A;  1KVC A;  3LZJ A;  3DRR A;  4YOX A;  3SUQ A;  1TAU A;  2AA4 A;  4BRE A;  1I39 A;  1IBL K;  3DWL A;  3M3Z A;  3OYA A;  2O8F A;  5F0X A;  1OH5 A;  3ZSY A;  4Z4G A;  3ZSV A;  5KPT A;  2W41 A;  2P9S B;  4BR7 A;  3D45 A;  1HQE A;  4B9T A;  3VQB A;  1NOY A;  4DSI A;  4BRH A;  3OYF A;  3ATV A;  3CQY A;  1VQ6 N;  5F1X A;  3VQC A;  3PLA A;  3A5M C;  2UXD K;  1YAG A;  3O9S A;  1L3V A;  5AQP A;  4DR3 K;  4IZ9 A;  1ZC6 A;  2O8C B;  3OYC A;  4B9N A;  2B5J A;  2V7Y A;  4F4K A;  3AO5 A;  3EZ5 A;  3C6T A;  4GVE A;  1OVY A;  3KLG A;  2R7Y A;  2YI1 A;  1NGI A;  4DU4 A;  5J2Q A;  3IG1 A;  2D4W A;  2B6A A;  4CEQ A;  2HVH A;  1RFQ A;  1T6C A;  3MK6 A;  1S1W A;  1C0U A;  3MN7 A;  3RVC A;  1Q82 O;  4CGI A;  3ID8 A;  3DOL A;  4BG8 A;  4CVN E;  1BA1 A;  1J5E K;  1BQM A;  3MCA B;  4CBW A;  5FRO A;  5I9E B;  1TYQ B;  3OYG A;  4PL7 A;  1X9W A;  2A40 A;  3CMA N;  2B4J A;  4EZ6 A;  1ILY A;  1HRH A;  3MCP A;  3HOT A;  3OW2 M;  1C6V A;  4ID5 A;  3O80 A;  4B9Q A;  4IO8 A;  3SUO A;  1F21 A;  1WSF A;  3HZ6 A;  4GKK K;  2ZF5 O;  4CJV A;  4DS5 A;  1HNX K;  2E6M A;  4DFP A;  4DSE A;  1NGD A;  2QKK A;  3ZT4 A;  4BC5 A;  1ESV A;  2YHA A;  3MEE A;  1XNR K;  5C42 A;  3WNE A;  1N32 K;  3SAF A;  3QER A;  1NWK A;  1JLE A;  5GAD P;  3CCQ N;  4DS4 A;  5M1K A;  1DTQ A;  1ZBL A;  1W7A A;  3B6O A;  3VOV A;  2FXU A;  3AO2 A;  1KC8 O;  3LP0 A;  1HNI A;  3QEW A;  3QO9 A;  1CXQ A;  3N4Q A;  2E20 A;  1TKX A;  3ULE A;  4PKH A;  2HHV A;  4B3O A;  2YHY A;  2DPN A;  2FSN A;  4AHT A;  5AQR A;  3MWP A;  3C65 A;  2ZQB A;  3CJ9 A;  3VN5 A;  2ZJR L;  5EXW A;  3J8A A;  4FJG A;  3QLH A;  1ZBI A;  3J81 O;  3CCL N;  3D2F A;  3EYZ A;  4AF1 A;  1VQO N;  3VTH A;  2Y1I A;  3E9L A;  4WQ4 C;  1B9D A;  3MN6 A;  2VQF K;  1D5A A;  1QQN A;  1Z26 A;  4Y1D A;  2NZT A;  3AA3 A;  5AZJ A;  4RW4 A;  4CHZ A;  1RTH A;  3P38 A;  1GLD G;  2IVO A;  2P9P B;  2O8E B;  3SQ4 A;  1S1T A;  4MDB A;  2I7N A;  1JXB A;  4FWS A;  5CE3 A;  1S3X A;  3SJH A;  2PAV A;  5BRF A;  4DR7 K;  4BR4 A;  3RSE B;  4Q0B A;  4PKG A;  1RBS A;  1FXX A;  1YXQ A;  2Z1H A;  3U8X A;  1NK9 A;  5C2D A;  4KH4 A;  2Z1G A;  4DLG A;  3KK1 A;  2UYT A;  2XO7 A;  3HP9 A;  2Q1N A;  3VES A;  4C8L A;  2I7P A;  1S5J A;  5HRS A;  3OYJ A;  2IC3 A;  1HJO A;  1BOT O;  4I6M B;  3W3D A;  4CHN A;  4BRL A;  1VSI A;  4DV1 K;  2F8S A;  2DTU A;  3AVG A;  1BU6 O;  1U49 A;  5F2R A;  4BRO A;  4YHH K;  4K0K K;  1NGA A;  1L3S A;  2QWM A;  2Q36 A;  5AQG A;  5AQL A;  4KRE A;  4KTW A;  3NF6 A;  4GMJ B;  3QEI A;  3A5O C;  2Q97 A;  4KTZ A;  1CXU A;  4F2R A;  4MLE A;  3C0B A;  2KLA A;  4M45 A;  3A8Y A;  3K0S A;  2HBJ A;  2IIR A;  2OPP A;  1VSD A;  4DTM A;  1NK5 A;  1S6Q A;  4DR2 K;  2ZJP L;  2IOC A;  1ZYQ A;  2A42 A;  4B3R K;  4M3Y A;  4CJS A;  1J54 A;  3L0Q A;  4GVM A;  1GOA A;  3EN9 A;  4LFB K;  4JNE A;  4OPK A;  1W97 L;  4DG1 A;  4CE9 A;  1NGE A;  3OYK A;  1KXP A;  5HLF A;  3SMS A;  1FKO A;  4IWV A;  3ZX3 A;  3FE1 A;  2GTD A;  3ZSZ A;  1QZ5 A;  4M3R A;  1D8Y A;  2P5G A;  3VQA A;  1WOQ A;  4H0X B;  5AQJ A;  1XC3 A;  1IBM K;  3NH1 A;  4NCA A;  3VQD A;  2VGM A;  3KK2 A;  4ISF A;  3A5N C;  4JKG B;  3V9W A;  3TAP A;  1O13 A;  3HPH A;  5EY4 A;  1QSL A;  4KI4 A;  3FLC O;  5H1S Q;  4LY7 A;  5FPN A;  1C0F A;  1XC9 A;  1K8A O;  1ATS A;  2YHB A;  1H1V A;  2D0O A;  2YX6 A;  4J2E A;  3R6M A;  4JD2 A;  3DMJ A;  4FL9 A;  1QZ6 A;  4BR0 A;  5FPE A;  2HB5 A;  1HYZ A;  1TAQ A;  2VG7 A;  4AQY K;  3SAG A;  3I33 A;  2OCE A;  2FBT A;  3CET A;  3ALY A;  3VA0 A;  4FJ5 A;  3LPU A;  1KAZ A;  1YJ9 N;  4B1X B;  2ASO A;  2HHH K;  1RBR A;  2HBL A;  1LAV A;  1TL1 A;  1RDW X;  3AV9 A;  4FJK A;  3VET A;  4KHY A;  4B8A B;  2CGL A;  1SL2 A;  1T44 A;  1LOT B;  2A41 A;  3KTQ A;  1K73 O;  1VSF A;  2ZGZ A;  3CG7 A;  3B6P A;  5E41 A;  1KTQ A;  1VSL A;  5AZI A;  4F3T A;  1OKJ A;  1VSK A;  5EOY A;  4IOC L;  1VQN N;  4DTO A;  5AQK A;  4LH5 A;  3AVB A;  1HNV A;  3KLF A;  3CJ7 A;  2HMI A;  3M8Q A;  3P31 A;  5I3U A;  4PL8 A;  5C24 A;  2OZM A;  4DTJ A;  4IDH A;  4IJA A;  4CI6 A;  1BI4 B;  1LCU A;  3UIQ A;  5JMV A;  1QE1 A;  3IFR A;  5M1P A;  5B8H A;  1XHZ A;  3KVG A;  2IVP A;  3VEW A;  4CES A;  4DQQ A;  2RE2 A;  2YKN A;  3UE5 A;  3KK7 A;  2NRX A;  3UKU B;  2ATQ A;  2VGN A;  1VQK N;  3NDK A;  2F9W A;  3FZH A;  2JWL A;  5KGX A;  3Q7C A;  2HF3 A;  1X3N A;  4I7F A;  4B8C A;  4CGH A;  3OYH A;  3WXK A;  2QWQ A;  4I2Q A;  3OS2 A;  4HTU A;  3LL3 A;  4B08 A;  2HOE A;  3VQQ A;  2P9K B;  1RDU A;  1BCO A;  4OX9 K;  1B92 A;  2JWK A;  4KV8 A;  3M8S A;  4K42 A;  4MO4 A;  3VMF B;  4DTN A;  2ASP A;  2QWN A;  1KCF A;  3G71 N;  5CY4 A;  3EL2 A;  3VEO A;  3LAK A;  2W6K A;  4B1Y B;  3JYT A;  3F73 A;  4DFJ A;  4DU1 A;  4PUO A;  4M63 C;  3SI6 A;  4BY9 C;  4DV2 K;  3RMB A;  1Q9X A;  5TKW A;  2HNZ A;  5D3G A;  4R5P A;  1TUU A;  1RCH A;  1WBB A;  3KHY A;  3H3N O;  3ZSX A;  3D0P A;  4CJ7 A;  3P83 D;  4H5W A;  3LDS A;  4AM7 A;  1YT3 A;  4FJ9 A;  4WQ4 A;  3DM2 A;  4NLB A;  4MDA A;  2CGK A;  2P5O A;  1ZBU A;  3MEC A;  5BPN A;  2G8I A;  3DLG A;  4FLV A;  4KB0 A;  2HHW A;  1BGX T;  4RG8 A;  3NE6 A;  1E3M A;  2BAN A;  2ITM A;  1BWF O;  3AA2 A;  3NAE A;  4DTP A;  3WT0 A;  3M6G A;  4N47 A;  3WXL A;  4BRN A;  1TUY A;  2YJF A;  4DHY A;  1GLJ O;  1YTA A;  4NO7 A;  2P9I B;  3EEQ A;  4WYB A;  4QAG A;  4JI3 K;  3AVC A;  2E1Z A;  3S3O A;  3BZC A;  4FWQ A;  5SWM A;  3D2E A;  4M3W A;  4CZH A;  5SZT A;  4IFV A;  3ZCM A;  3HPG A;  4JKH A;  3HXM A;  3NF8 A;  3IS9 A;  4B9U A;  2IDO A;  3DLE A;  4NLC A;  3RTV A;  4C8N A;  4L8R B;  4OLB A;  4CEA A;  3EE8 A;  4CJR A;  4DSJ A;  2VCP A;  4MQ3 A;  2O8D B;  2NRV A;  3V4I A;  1T05 A;  3VF4 A;  4IEE A;  3ENB A;  1HJR A;  3BP8 A;  1KD1 O;  3AVK A;  4JV5 K;  1JLA A;  3CCV N;  2OTJ N;  3DI6 A;  3S3N A;  3MAQ A;  4OKK A;  2OYQ A;  5I42 A;  3DAW A;  3PUF A;  4BGB A;  5BR9 A;  3A2F A;  4CGD A;  4O5F A;  2P9N A;  2RPI A;  3RR8 A;  2KTQ A;  4IG0 A;  4NB4 A;  4H5R A;  3THY A;  3CD6 N;  1NK7 A;  3EO3 A;  2X6N A;  2YHX A;  4X66 K;  3HL8 A;  4KTQ A;  1SS6 A;  5KQD A;  3PSI A;  2P1J A;  3M8R A;  3E66 A;  3CPW M;  1Q81 O;  5HOO A;  3MX2 A;  5ADX A;  3HM8 A;  4CJE A;  2H3G X;  1YVU A;  3G0Z A;  1HQU A;  5FPD A;  3CCE N;  4G9Z A;  3K9K A;  4DQI A;  4DQP A;  2UU9 K;  4N41 A;  2ETJ A;  1NJY A;  4H4O A;  2G8K A;  5E26 A;  2KFZ A;  2WBN A;  1OH8 A;  4CZK A;  1S1U A;  4FJ7 A;  3MX5 A;  3FGU A;  3SUP A;  1LW2 A;  4CIG A;  3QML A;  1DEJ A;  4CEC A;  3OJS A;  1VQM N;  3CC7 N;  1RT7 A;  1UWB A;  3O3H A;  1DKG D;  4FJI A;  2OA8 A;  4PWD A;  4ICL A;  3WEE B;  4DFM A;  2GV9 A;  1X9S A;  4CF9 A;  4CGF A;  3S9H A;  4BAC A;  1DGK N;  4E19 A;  1JKH A;  3LP1 A;  4HUG A;  3AA5 X;  3ZYY X;  3MDQ A;  4KHN A;  2AP1 A;  3P1G A;  4DV0 K;  4WFN L;  4K25 A;  2QK9 A;  3CIP A;  4RW7 A;  4KBO A;  3I8D A;  3O3G A;  2A1S A;  1A5X A;  1KLM A;  4BRD A;  4CIE A;  3OYI A;  3HSC A;  1U2V B;  4KAZ A;  4FK2 A;  5C0Y A;  4BC4 A;  3AAP A;  4E7K A;  1K8K A;  3MN9 A;  2VWK A;  3IKM A;  5J2P A;  5EX5 A;  3NMU A;  4BVO A;  3MXJ A;  3AVF A;  2BH1 A;  2D5R A;  4W5N A;  1NLV A;  4BWM A;  4PHT X;  5BN8 A;  1YIT N;  2I5J A;  3OYD A;  3HVR A;  5HL7 L;  1YJW N;  1IH7 A;  2HF4 A;  3GE1 A;  3LWL A;  1RT4 A;  4CFA A;  4H03 B;  4PA1 A;  3CCJ N;  3DXM B;  3ID6 A;  1XNQ K;  4FJJ A;  1XQS C;  3L3U A;  1XI1 A;  3GG4 A;  4EP4 A;  1S22 A;  1IKY A;  3IRX A;  2G8W A;  5JIC A;  2YJE A;  4BDY A;  5HRP A;  2D0P A;  5AQT A;  3VF2 A;  3NCI A;  5AR0 A;  1NGG A;  2UUC K;  3QFP A;  4ZTF A;  3LP3 A;  3QEP A;  3I8B A;  1FK9 A;  3F9K A;  2YNF A;  4EAH D;  5JVG L;  1SL0 A;  1NU0 A;  4E1N A;  1U45 A;  1GLL O;  3PX0 A;  5AFU H;  1T03 A;  1GOB A;  4CFB A;  1GLC G;  3HST B;  1NMN A;  4CHY A;  4BC3 A;  2FF6 A;  3O1B A;  4W5Q A;  4E1M A;  5FDL A;  4A62 A;  4CF2 A;  5JS2 A;  3OS0 A;  1NGC A;  4IOA L;  3L2V A;  2OZS A;  3CHW A;  1ZBH A;  5JS1 A;  3V9X A;  4YDU C;  4WQ5 A;  2O8F B;  1BG3 A;  3G25 A;  2QWL A;  1SL1 A;  3NVM A;  3AVN A;  3TAQ A;  3JXU A;  1L3T A;  1P90 A;  2DY4 A;  1RNH A;  5CYQ A;  2OPR A;  4I9L A;  1VSM A;  1BIS A;  3SAH A;  2ZE2 A;  4ZTJ A;  4JKA A;  4QS7 A;  4WFB L;  1YI2 N;  4LD0 A;  2E2P A;  4E7H A;  1WSG A;  3BGR A;  3QIN A;  4HWI A;  1IJJ A;  4BR2 A;  1NMD A;  4DV3 K;  1VRT A;  3R1X A;  1ASV A;  3ZSO A;  1O1W A;  1HNZ K;  4IJN A;  1LWF A;  4CF0 A;  1NGJ A;  1JLC A;  4FWK A;  3SCX A;  3IAY A;  1TKT A;  4CD3 A;  3DXK A;  1XMQ K;  4JAX A;  3UKR A;  3RMA A;  4B3S K;  4JN4 A;  3L4I A;  4AHR A;  3O6W A;  4YOV A;  4JI5 K;  1RT5 A;  1NNE A;  2A5X A;  2WTU A;  2E1Y A;  3I55 N;  4JK7 A;  2NLX A;  1VQ4 N;  3HVT A;  4FWR A;  3SYZ A;  1S9E A;  4C1N K;  4Y1C A;  2GUP A;  3RMC A;  4OVL A;  4DUZ K;  2CGJ A;  5FRN A;  4KHP K;  4X62 K;  1IG8 A;  2FC0 A;  4ISE A;  3K58 A;  4H0V B;  3H46 O;  2F9T A;  5KTQ A;  3ZEU A;  2PY5 A;  4DB3 A;  4O0J A;  4NYF A;  5HBM A;  2KFN A;  4AHC A;  1RDB A;  5LJV A;  4CD1 A;  4IG3 A;  1C0M A;  1E4F T;  5AQI A;  3I56 N;  5AQQ A;  2NRH A;  4B3M K;  3CI5 A;  3P4I A;  2WOM A;  1JLG A;  4FW2 A;  3CME N;  4DR1 K;  4DR6 K;  3LZI A;  3TU5 A;  1L5U A;  1VRU A;  2PYJ A;  4LFC K;  2BDP A;  3TTF A;  4DUY K;  3QB0 A;  3PO4 A;  4O5B A;  5JVH L;  4PY5 A;  3ULE B;  3MWT A;  1M90 O;  2Q31 A;  3GDQ A;  4KH5 A;  1QHA A;  3WNG A;  3CJB A;  3AGR A;  2QA4 N;  4CJQ A;  3LPT A;  3CC2 N;  1KRP A;  1WSI A;  3O9T A;  1MA9 B;  4BWJ A;  3RR7 A;  4CW7 B;  4L3Q A;  4XH4 A;  1VQP N;  3D2F B;  1HPZ A;  5FLX O;  4WCE L;  3LDP A;  4JKB A;  3ATU A;  1MWM A;  3J7Z O;  2X78 A;  5AZJ B;  1N33 K;  3O5B A;  4JK8 A;  2QWR A;  1EKE A;  1VSJ A;  2VG6 A;  3OYN A;  4AM6 A;  4B9M A;  3DLK A;  1ITG A;  3AAR A;  2ZD1 A;  4FZX C;  3ASM A;  3VF6 A;  1E4G T;  4FLU A;  1JCF A;  1NK0 A;  1LWC A;  1FKP A;  3TSP A;  1ASW A;  3L4Q A;  4EZ9 A;  4K8Z A;  3AO3 A;  4M41 A;  1NK6 A;  1OH7 A;  3VEZ A;  3SQ0 A;  4O55 A;  3VTI A;  4FZZ A;  1I94 K;  1T3V A;  4CEF A;  5BPL A;  1EWR A;  4ID1 A;  3H08 A;  4O8U A;  2G8U A;  1NK4 A;  3ISN C;  4DF8 A;  1CZ9 A;  3OYB A;  4V19 S;  3CFR A;  1D4X A;  1ATN A;  3AA4 A;  4X64 K;  3FFK B;  3VGM A;  4JI7 K;  4Z0U A;  3R8E A;  4A57 A;  4CK2 A;  2P9L A;  4M3Z A;  1QSS A;  1TK0 A;  3HBT A;  1Q86 O;  1LWE A;  4H0T B;  4RWT A;  4QCL A;  1EWQ A;  1U6Z A;  2E2N A;  3GL1 A;  2KQ2 A;  2HND A;  3A0I X;  4PKI A;  1YUW A;  4ELT A;  5C2F A;  3HK2 A;  4B9L A;  1V4S A;  3SZ2 A;  4M42 A;  3HI0 A;  1HKG A;  1KQS M;  4B3T K;  1X9J A;  4EHT A;  3ITH A;  4CZE A;  4HHT A;  3NF9 A;  3AVA A;  3PSF A;  3CJ1 A;  4JI0 K;  4FJ8 A;  4JHD A;  3AVI A;  4RW9 A;  4N5S A;  3SQ1 A;  5EVZ A;  1S72 N;  4FZY A;  4F8R A;  4BR9 A;  4IBN A;  4WF9 L;  4JRP A;  1HLU A;  4E7I A;  2YHW A;  2WFB A;  4A2B A;  3N4P A;  4IXC A;  1X9M A;  1JLQ A;  5T7B A;  2A3Z A;  2HHQ A;  3CC4 N;  5CZ1 A;  1SZ2 A;  2FBY A;  2GWJ A;  5MLC Q;  3PV8 A;  5CR4 A;  2HNY A;  3FR0 A;  4KH6 A;  1C0G A;  1N5Y A;  3L2Q A;  3V9U A;  5M1Q A;  1HUX A;  4DTS A;  3MXM A;  1W9H A;  2PFU A;  3ZSQ A;  5HRR A;  2X74 A;  1JLF A;  1TKZ A;  3CF5 L;  3OA9 A;  4YDU A;  3C94 A;  2CH6 A;  3TR8 A;  2BTF A;  1A5V A;  4JD2 B;  4YOW A;  4IOX A;  3BZK A;  1NBW A;  4DLE A;  1BIU A;  3ZT1 A;  3NF7 A;  3ZET A;  2NRR A;  1BQN A;  4AH9 A;  4OGE A;  3RRG A;  5AQS A;  4CGG A;  2QI2 A;  1J9A A;  4F2S A;  1Q9Y A;  4RTF D;  4LF6 K;  4HCB A;  4H5T A;  3V9S A;  3CJC A;  3QFU A;  1NOZ A;  4W5R A;  1BL3 A;  3VA3 A;  1BA0 A;  3E9O A;  3CM5 A;  5AZI B;  3KK3 A;  2F8T A;  2IS3 A;  3VEX A;  2J4R A;  1U47 A;  3HRG A;  4FJL A;  4WQ5 C;  2PBD A;  3DOK A;  4AIL C;  2A1R A;  3J7Y P;  1S9G A;  3A5L C;  4O0I A;  2IGI A;  1HKC A;  2IVN A;  4BE1 A;  1NKC A;  1YIJ N;  3TSQ A;  3JS6 A;  4LF5 K;  4CGJ A;  1XHX A;  3PO5 A;  3CQX A;  3KKS A;  4LH4 A;  3KJV A;  3K2P A;  1UAX A;  1NKB A;  3LDO A;  3KIO A;  1RBT A;  2ZM6 K;  4A2A A;  3R3L A;  1S6P A;  1UOC A;  3RRH A;  3IMX A;  5AQN A;  3TPQ A;  3WQU A;  3L2U A;  2QWO A;  3OS1 A;  3NHG A;  4B1U B;  1TGO A;  3TAR A;  3CCS N;  1J53 A;  2NRZ A; 
#chains in the Genus database with same CATH homology
 3LP0 A;  1HNI A;  4Q5V A;  3QEW A;  4Z4C A;  3QO9 A;  4O4G A;  4RW7 A;  3QNN A;  1CXQ A;  3I8D A;  4J2A A;  1S1X A;  3O3G A;  2A1S A;  3SPY A;  1A5X A;  1TKX A;  1KLM A;  4HUF A;  1KFS A;  4CIE A;  3TAM A;  3OYI A;  2E6L A;  2HHV A;  3NBP A;  1J5O A;  4B3O A;  3MED A;  3JSM A;  4KI6 A;  2DFE A;  4KAZ A;  4FK2 A;  2O4G A;  4AHT A;  3AVH A;  4HVJ A;  4E7K A;  2HHU A;  2D0A A;  2VWK A;  2ZQB A;  4CJU A;  5J2P A;  3T3F A;  1RT3 A;  1S1V A;  1IKX A;  1U04 A;  5DK5 A;  3AO1 A;  3VQ6 A;  1RDA A;  3VN5 A;  4OKE A;  4RW8 A;  3MXJ A;  4CCH A;  3ULD A;  4J2D A;  4FCY A;  4FJG A;  1CLQ A;  3AVF A;  3SPZ A;  5KRS A;  1RTD A;  3ZT3 A;  2D5R A;  1BI4 A;  3QLH A;  3S3M A;  1ZBI A;  4W5N A;  2RN2 A;  3EYZ A;  1L3U A;  4BWM A;  2I5J A;  3OYD A;  2Y1I A;  1SKS A;  3HVR A;  1WSH A;  4B9U A;  3O3F A;  1TK8 A;  1BIZ A;  1B9D A;  4CJK A;  1IH7 A;  4OJR A;  3LWL A;  1D5A A;  1RT4 A;  3AO4 A;  3CFP A;  5HRO A;  4CFA A;  3U3Y A;  1Z26 A;  4PA1 A;  4KHQ A;  4Y1D A;  4EP5 A;  3AA3 A;  5C25 A;  4B9V A;  4FJJ A;  4RW4 A;  3L3U A;  2D0C A;  1XI1 A;  4CHZ A;  4XIU A;  3THV A;  1RTH A;  4EP4 A;  3IRX A;  1IKY A;  2G8W A;  3L2R A;  4BDY A;  3QIO A;  3TAE A;  5HRP A;  3SNN A;  1WAF A;  4CEZ A;  1SKR A;  3NCI A;  3RMD A;  3SQ4 A;  3S9H A;  4NYN A;  2HHS A;  1S1T A;  4ZTF A;  3LP3 A;  3QEP A;  2G8H A;  1JXB A;  4LSN A;  1KVA A;  1XWL A;  3ZT2 A;  2DFF A;  1IO2 A;  1FK9 A;  3F9K A;  1MU2 A;  4DTR A;  2YNF A;  1SL0 A;  1WN7 A;  4FK4 A;  4Q0B A;  2HHT A;  1RBS A;  4E1N A;  1U45 A;  1TV6 A;  2XY8 A;  1FXX A;  3PX0 A;  1T03 A;  4ELV A;  1G15 A;  2Z1H A;  1UA1 A;  1GOB A;  1NK9 A;  4CFB A;  3DRP A;  4FJH A;  2F96 A;  1NJX A;  2Z1G A;  3HST B;  4DLG A;  3V1R A;  4DQR A;  3KK1 A;  1K6Y A;  3BDP A;  1T8E A;  4CF1 A;  4CHY A;  2XO7 A;  1JXE A;  3HP9 A;  3PX6 A;  4W5Q A;  1ZBF A;  3I0S A;  4E1M A;  4C8L A;  1EX4 A;  5FDL A;  5J1E A;  4CEE A;  4CF2 A;  3HP6 A;  5JS2 A;  3OS0 A;  1S5J A;  2XY5 A;  5HRS A;  3VQ4 A;  3OYJ A;  1CZB A;  2IC3 A;  3L2V A;  4DSL A;  3P5J A;  2OZS A;  1ZBH A;  2D0B A;  5JS1 A;  3V9X A;  4CHN A;  1VSI A;  4RW6 A;  4FLT A;  2F8S A;  4W5O A;  1R0A A;  1SL1 A;  4FM2 A;  3HJF A;  3AVG A;  4FLY A;  2DTU A;  3CM6 A;  1Y97 A;  1VSH A;  1U49 A;  4K8X A;  2YNG A;  3AVN A;  3DRS A;  3TAQ A;  1UA0 A;  1L3T A;  2DY4 A;  1RNH A;  5CYQ A;  2OPR A;  1VSE A;  1VSM A;  2XRI A;  1BIS A;  2YNH A;  4JLH A;  4I9L A;  2ZE2 A;  2X6S A;  3MEG A;  3WNH A;  4ZTJ A;  1L3S A;  4L8R B;  1IG9 A;  1B9F A;  1WSJ A;  4LD0 A;  3KLE A;  2XHB A;  4E7H A;  3HM9 A;  4KHS A;  4KRE A;  1WSG A;  3BGR A;  3K5M A;  4KTW A;  3NF6 A;  1TL3 A;  4GMJ B;  3QIN A;  3QEI A;  2HVI A;  2O4I A;  4KTZ A;  1CXU A;  4F2R A;  1VRT A;  4AHS A;  4CHQ A;  4FXD A;  1RIL A;  3K59 A;  4KRF A;  4UQG A;  2BGG A;  1SKW A;  1NK8 A;  4M45 A;  2OPP A;  1ASV A;  1TVR A;  1VSD A;  3ZSO A;  1O1W A;  1S6Q A;  4CHO A;  4DSF A;  4DTM A;  1NK5 A;  3KD1 E;  2IOC A;  1LWF A;  4OKJ A;  5EU7 A;  1ZYQ A;  4FJM A;  4M3Y A;  4CFD A;  4CJS A;  4CF0 A;  3SCX A;  1JLC A;  1J54 A;  2DFH A;  4GVM A;  3OYE A;  4HUE A;  3IAY A;  1TKT A;  1GOA A;  4OPK A;  3TAG A;  4DG1 A;  1D9F A;  4CE9 A;  1RTJ A;  5CYM A;  4Z4I A;  1KLN A;  2BE2 A;  3RMA A;  4FVM A;  2AJQ A;  3OYK A;  1TK5 A;  4NCB A;  5DMR A;  4AHR A;  4ELU A;  1QSY A;  5HLF A;  1FKO A;  1U4B A;  3TWH A;  1QHT A;  3HT3 A;  1RT5 A;  4OGC A;  3ZSZ A;  4M3R A;  1D8Y A;  3ZSW A;  2KZZ A;  2P5G A;  3VQA A;  3CQ8 A;  2G8F A;  4NCA A;  3NH1 A;  3AVL A;  4Z4F A;  3WNF A;  3NGZ A;  3HVT A;  3VQD A;  3OYL A;  3ZSR A;  1EXQ A;  1GOC A;  3KK2 A;  2OPQ A;  3SYZ A;  1S9E A;  3V9W A;  3TAP A;  4Y1C A;  3DYA A;  3HYF A;  3HPH A;  1WNS A;  4CJP A;  2YKM A;  3KKR A;  3RMC A;  4OVL A;  1QSL A;  4KI4 A;  2QK9 A;  5FRN A;  4LY7 A;  1XC9 A;  2EX3 A;  3SUN A;  2YHB A;  2FC0 A;  3K58 A;  4N56 A;  2PYL A;  4IDK A;  3CFO A;  1VK0 A;  4J2E A;  2W42 A;  5KTQ A;  5KGW A;  3DMJ A;  3QNO A;  3TI0 A;  2HB5 A;  2PY5 A;  1HYZ A;  1TAQ A;  2VG7 A;  4O0J A;  3QET A;  4NYF A;  5HBM A;  4JS4 A;  5J2M A;  4CHP A;  2KFN A;  4AHC A;  1RDB A;  4F3O A;  4IG3 A;  2FBX A;  1C0M A;  3G10 A;  4Z4H A;  2FBT A;  2FBV A;  1C1B A;  4KHU A;  3ALY A;  1NJZ A;  3VA0 A;  4E7L A;  4FJ5 A;  3LPU A;  4OLA A;  1QQC A;  4NCG A;  4J2B A;  2WOM A;  1RBR A;  1JLG A;  1U48 A;  1HYS A;  4CEB A;  3L2W A;  4FW2 A;  3OJU A;  4Z4E A;  1LAV A;  3VQ8 A;  3LZI A;  2E4L A;  1TL1 A;  3AV9 A;  3I0R A;  3AVM A;  4G1Q A;  1L5U A;  4BDP A;  4FJK A;  4KHY A;  1VRU A;  4B8A B;  2WON A;  1SL2 A;  3AVJ A;  3LAL A;  3KTQ A;  2PYJ A;  1VSF A;  4QOZ B;  3CG7 A;  3NGY A;  3QIP A;  3KD5 E;  3B6P A;  3O4Q A;  5E41 A;  2BDP A;  1KTQ A;  1Z25 A;  3PO4 A;  1VSL A;  2Y1J A;  3VQ5 A;  4YFU A;  4O5B A;  4DQS A;  3TAN A;  4TSX A;  4FJX A;  4PY5 A;  4M3T A;  4F3T A;  1VSK A;  1WLJ A;  4DTO A;  5K14 A;  3V1Q A;  4LH5 A;  3AVB A;  3ZT0 A;  1HNV A;  4GW6 A;  3WNG A;  4CJQ A;  3KLF A;  4AHV A;  3PX4 A;  3LPT A;  3K5L A;  2HMI A;  3NFA A;  1KRP A;  3M8Q A;  1WSI A;  5I3U A;  4KHW A;  4BWJ A;  3RR7 A;  5C24 A;  4BE0 A;  2OZM A;  4DTJ A;  4IKF A;  2PZS A;  1LW0 A;  1BI4 B;  3MXI A;  5CZ2 A;  3UIQ A;  4CK1 A;  1HPZ A;  1T7P A;  4DU3 A;  4OPJ A;  2YNI A;  1QE1 A;  4KO0 A;  1SV5 A;  4FW1 A;  4BE2 A;  4M3X A;  4WE1 A;  1XHZ A;  3NH2 A;  3E01 A;  4CES A;  4KB1 A;  2X78 A;  4DQQ A;  1EKE A;  1JLB A;  1VSJ A;  2VG6 A;  2YKN A;  3OYM A;  1D9D A;  4N76 A;  4H8K A;  3OYN A;  2ATQ A;  2IAJ A;  4YNQ A;  4B9M A;  1JL1 A;  3DLK A;  1ITG A;  3HPO A;  3NDK A;  3SJJ A;  4CJ3 A;  1WAJ A;  2ZD1 A;  4FZX C;  1KVB A;  3ASM A;  3T1A A;  4DMN A;  4HCC A;  2RF2 A;  2Z1I A;  5KGX A;  4E3S A;  2Q3S A;  4FLU A;  4CJW A;  3QEV A;  1LWC A;  1FKP A;  1NK0 A;  1ASW A;  1KFD A;  2OPS A;  4EZ9 A;  3AO3 A;  4K8Z A;  2KZM A;  3DLB A;  4M41 A;  3NH0 A;  1NK6 A;  3FFI A;  4I7F A;  3O4N A;  4B8C A;  4CGH A;  3OYH A;  3SQ0 A;  4DS4 A;  4O55 A;  4CER A;  2EHG A;  4I2Q A;  3OS2 A;  4HTU A;  4FZZ A;  4W5T A;  5FRM A;  4B08 A;  3U3G A;  4CEF A;  4ID1 A;  3VQQ A;  3H08 A;  4MFB A;  4E0D A;  2G8U A;  1NK4 A;  1BCO A;  3ISN C;  4DF8 A;  1CZ9 A;  3U6F A;  3OYB A;  1B92 A;  2KW4 A;  1QTM A;  3VQP A;  4KV8 A;  4LSL A;  3M8S A;  4FLZ A;  4CJ5 A;  3CFR A;  4DFK A;  4FK0 A;  4DTN A;  2GUI A;  3VQE A;  3AA4 A;  4FM0 A;  1KCF A;  5KRT A;  5CY4 A;  1RDC A;  4KFB A;  3NGI A;  5J2N A;  4FJN A;  3LAK A;  1A5W A;  4Z0U A;  3JYT A;  3F73 A;  4DFJ A;  4C8K A;  4FM1 A;  4DU1 A;  4PUO A;  4CK2 A;  3SV3 A;  1NJW A;  3SI6 A;  3CYM A;  4M3Z A;  4IFY A;  5HRN A;  1QSS A;  3RMB A;  3LP2 A;  1TK0 A;  2RKI A;  1Q8I A;  1LWE A;  3C95 A;  4QCL A;  1EP4 A;  1Q9X A;  2HNZ A;  2KQ2 A;  2HND A;  3KLI A;  4KKO A;  1HMV A;  4I2P A;  4CEO A;  3PY8 A;  4I9Q A;  4ELT A;  1RBV A;  1NKE A;  4C8O A;  5D3G A;  3HK2 A;  4B9L A;  4R5P A;  3K57 A;  3SZ2 A;  2GBZ A;  4M42 A;  1RCH A;  1JL2 A;  4CJ4 A;  1C1A A;  3ZSX A;  4E89 A;  3ITH A;  3D0P A;  4HHT A;  1REV A;  1LV5 A;  1KSP A;  3NF9 A;  3P83 D;  3LDS A;  3QEX A;  3AVA A;  1YT3 A;  4B9T A;  4FJ9 A;  3QES A;  4PQU A;  2HHX A;  1WSE A;  1I3A A;  3DM2 A;  1HYV A;  2P5O A;  1ZBU A;  4BDZ A;  4FJ8 A;  2YV0 X;  3AVI A;  4RW9 A;  4N5S A;  3MEC A;  3SQ1 A;  3V1O A;  1X1P A;  3C6U A;  3DLG A;  4FLV A;  1BGX T;  4RG8 A;  3NE6 A;  4F8R A;  4KB0 A;  4FZY A;  2BAN A;  4O44 A;  3K5N A;  3V9Z A;  4IBN A;  3VQ9 A;  3AA2 A;  2VG5 A;  3NAE A;  4JRP A;  4DTP A;  2QXF A;  4FLW A;  5HP1 A;  4N47 A;  4E7I A;  1BHL A;  2HW3 A;  1IKV A;  1C1C A;  1DLO A;  1X9S A;  2G8I A;  4FLX A;  2QKB A;  1YTA A;  1X9M A;  1LAW A;  2HHW A;  1KVC A;  3LZJ A;  3DRR A;  3SUQ A;  1JLQ A;  5T7B A;  1TAU A;  2HHQ A;  3EY1 A;  3HO1 A;  5CZ1 A;  1BCM A;  4QAG A;  1I39 A;  3V6D A;  4DTX A;  3AVC A;  2FBY A;  3OYA A;  3PV8 A;  5SWM A;  3S3O A;  2HNY A;  2G8V A;  4M3W A;  5SZT A;  4IFV A;  2JGU A;  3ZSY A;  4Z4G A;  1N5Y A;  4DSK A;  3ZSV A;  3L2Q A;  1YTU A;  3LWM A;  3V9U A;  3ZCM A;  4DTS A;  3HPG A;  3MXM A;  1W9H A;  3HXM A;  3D45 A;  3IS9 A;  3NF8 A;  2IDO A;  1HQE A;  3DLE A;  3ZSQ A;  5HRR A;  2XY7 A;  3VQB A;  1C0T A;  3RTV A;  3OVN A;  2X74 A;  4C8N A;  1NOY A;  4CEA A;  2Z1J A;  4DSI A;  4CJR A;  2P51 A;  4OLB A;  4DSJ A;  1JLF A;  1TKZ A;  4MQ3 A;  3OYF A;  4JRQ A;  3V4I A;  3VQC A;  1T05 A;  1RBU A;  3C94 A;  4CIF A;  3TR8 A;  1HJR A;  1A5V A;  1L3V A;  3AVK A;  1QS4 A;  1DTT A;  3VQ7 A;  1JLA A;  3TAF A;  3TAB A;  4DLE A;  3DI6 A;  3S3N A;  1BIU A;  3DLR A;  3ZT1 A;  3L8B A;  4CK3 A;  3OYC A;  4B9N A;  3NF7 A;  3MAQ A;  2B5J A;  4OKK A;  2OYQ A;  4F4K A;  3AO5 A;  5I42 A;  3EZ5 A;  4AHU A;  3C6T A;  3PUF A;  1BQN A;  4AH9 A;  4OGE A;  1N6Q A;  4M3U A;  3A2F A;  1EET A;  4CGD A;  2ITG A;  4CF8 A;  2VWJ A;  2RPI A;  3RRG A;  4CGG A;  3RR8 A;  3KLG A;  2KTQ A;  4ZHR A;  2R7Y A;  1SUQ A;  4IG0 A;  1J9A A;  1IKW A;  4CFC A;  4DU4 A;  3IG1 A;  5J2Q A;  1TKD A;  2B6A A;  1Q9Y A;  4CEQ A;  4F2S A;  2HVH A;  3SQ2 A;  1NK7 A;  2X6N A;  3L3V A;  3RWU A;  4HCB A;  1S1W A;  3HL8 A;  2JLE A;  3V9S A;  1C0U A;  4KTQ A;  4E7J A;  4JS5 A;  4W5R A;  1NOZ A;  4CGI A;  2LSN A;  3DOL A;  1BL3 A;  3VA3 A;  3OY9 A;  2P1J A;  1BQM A;  3CM5 A;  3KK3 A;  3M8R A;  2F8T A;  2IS3 A;  5FRO A;  1U47 A;  3OYG A;  3T19 A;  1X9W A;  1RT2 A;  2NUB A;  4FJL A;  2B4J A;  4CJE A;  3DOK A;  3G0Z A;  1YVU A;  4AIL C;  1HQU A;  4CJL A;  2A1R A;  4EZ6 A;  1HRH A;  4DQI A;  4DQP A;  1S9G A;  2XY6 A;  4O0I A;  3K5O A;  2IGI A;  1C6V A;  4ID5 A;  4N41 A;  4KPY A;  2ETJ A;  3SUO A;  1NJY A;  4BE1 A;  4H4O A;  1NKC A;  2G8K A;  1F21 A;  4DWI A;  1WSF A;  3LAN A;  4CJV A;  3KLH A;  4DS5 A;  4DTU A;  2KFZ A;  3DLH A;  4CGJ A;  1XHX A;  1ASU A;  1W0H A;  2E6M A;  4DFP A;  4B9S A;  4H4M A;  4CJF A;  4DSE A;  1S1U A;  3PO5 A;  4FJ7 A;  4FYD A;  2QKK A;  3SUP A;  1LW2 A;  3ZT4 A;  4CIG A;  4CEC A;  3KKS A;  2YHA A;  1RT1 A;  3MEE A;  4LH4 A;  3OJS A;  3K2P A;  3KJV A;  1RT6 A;  1UAX A;  1NKB A;  3KIO A;  1RT7 A;  5C42 A;  3WNE A;  1UWB A;  3LAM A;  1RDD A;  1RTI A;  1RBT A;  3M8P A;  3V81 A;  3O3H A;  4CJT A;  4FJI A;  3QER A;  2OA8 A;  1S6P A;  4PWD A;  1UOC A;  4ICL A;  1JLE A;  3RRH A;  4CED A;  2GV9 A;  4DFM A;  4CF9 A;  4CGF A;  3L2U A;  4C8M A;  3NHG A;  3OS1 A;  4E19 A;  1JKH A;  3LP1 A;  1DTQ A;  3AA5 X;  4HUG A;  1TGO A;  4BAC A;  4DF4 A;  3TAR A;  1ZBL A;  4KHN A;  5KI6 A;  1J53 A;  3P1G A;  3B6O A;  3AO2 A;  3SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...