3DRSA

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
549
structure length
549
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 148
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drsA05
3HM9A 2YHAA 4FLTA 2C2DA 1LW2B 1RTHA 3LP1B 3ISNC 1L3SA 3PO4A 3SQ2A 3VQBA 4J2AA 1JLEB 3AVBA 2WB4A 3NGZA 4B08A 3QNNA 4FM0A 4O4RA 1IKVB 3CM5A 2R7YA 1XHXA 1Y97A 4Z4GA 4FJJA 5I3UB 5FDLB 4ZP6A 4G3IA 4NLYA 4OGEA 3MF5A 4CEQA 2BRLA 2IBKA 3VQDA 4CFBA 4WFYA 1BL3A 4CHPA 3M8SA 4FLXA 1QSSA 4M41A 4H54A 3H5YA 1S9FA 4TYAA 4NCBA 1IKWB 3HP6A 1MU2A 1C1CA 4FJ5A 2PY5A 1EP4A 3P5JA 3T3FA 5KGWA 2W8KA 1J5OB 1C0MA 1Z4UA 4IQXA 4DTPA 2GC8A 2FLLA 4ED2A 2JEFA 3GQCA 4FW1A 1J9AA 3IRXA 2D41A 4Q5VA 2YV0X 3NBPA 3MXIA 1JLQB 4EYHB 2BGGA 3JYTA 1RT1B 4DL5A 1C1CB 4ELTA 4Z4EA 4YFUA 2YNHB 2LSNA 4F4YA 3TAEA 4PWDB 1JXLA 4KSEB 2XC9A 5J1EB 1TKXB 4E1NA 2AJQA 3M9MB 4CJQA 4M3UA 4LD0A 3ZSVA 4IFVB 1ZBUA 4N76A 3S3OA 3L2VA 4KHQA 4Q0BA 4NRTA 3MFIA 4M3RA 1ZYQA 2HWIA 1XR7A 5L1JA 3V6JA 1RILA 3BREA 2C2EA 4F2SA 1NOZA 4QW8A 2WOMB 5HROA 4WXWA 3DRSA 1HNIB 4PQUA 4MK8A 5KT4A 3NHGA 4IFYA 3DLKB 4OGCA 2ATQA 5KFGA 4ZHRA 4J2EA 3Q8SB 2W9CB 1S6QA 2IM1A 4DWIA 3OLAA 4N56A 1LAWA 3GILA 5KFDA 1C2PA 4EBEA 4Q0BB 3GYNA 3GIKA 3DLGA 3H2LA 1KVCA 3THVA 1EXQA 3RBDA 3NAIA 1R0AA 5HLFA 4OPJA 2GV9A 3VA0A 4J9PA 2F8EX 4CGFA 3MR5A 4CE9A 1SL1A 1ASVA 5CZ1A 4K4XA 3QIPA 4CF0A 4HUFA 1RBSA 1BISA 4OL8A 2Z1HA 1BI4B 3QZ8A 2O4GA 1SV5B 4MQ3A 4IFVA 2IC3B 4IRKA 3BSAA 3KMSA 4F4WA 2YNFB 2R2RA 3LP2B 3OYGA 4H4OB 1UWBB 2HHVA 3WNGA 2AGQA 3SCXA 4KI6A 1KLMB 2FBTA 4WYLA 5KFPA 3AVIA 4E7IA 1L3VA 3KKRA 4M3TA 1UA0A 4HYKA 4B9TA 4FK4A 3ZSWA 4QPXA 2F96A 4YQWA 5CYQB 3PJXA 1KHWA 3DM2B 3Q8QB 1LW0B 5F8HA 1EETB 4KTZA 3OYIA 1HYSB 2OPPA 3DRPA 4ECUA 1C1BA 2XWYA 1SL0A 2BDPA 4RW6A 5CYMB 1BHLA 3BDPA 3RRGA 3G6VA 4YR2A 3CO9A 4EO6A 4RUAA 3HYFA 5F9LA 4WYWA 2BANB 3U6FA 4B9SA 4FVMA 5J2NA 3RR7A 5CY4A 3RB6A 4DG1A 4IH6A 3IG1B 3T5HA 4FK2A 4FS1A 3ZSRA 2ASDA 5KG1A 1JLBA 5KFJA 4AHVA 1VRUB 2W42A 1NK7A 3CDEA 4B9VA 3AVAA 2YNFA 1CZ9A 4Z4CA 1JLEA 1T05B 3LWMA 4HCBA 3HVAA 5HRSA 5CZ2A 4O0JA 3DRRB 4DTNA 4M3YA 2O5DA 4OLAA 1HMVB 1RT7B 3KHRA 3OYMA 2BANA 3ZSZA 4E19A 4LSNA 4IKFA 3VQPA 4CJ3A 4J9NA 2FJVA 3C6UA 4DU1A 1SH3A 2VG6B 5EWGA 4KO0B 3MFHA 4CGIA 2IGIA 1RBRA 4JUZA 2UVWA 1N6QB 1RDDA 1C0UB 1JIHA 2W9CA 3KK2B 3V81A 1S0NA 4URGA 4U6PA 3T1AA 4M45A 4ICLA 1BGXT 2ATLA 5JXSA 3CFOA 4CJVA 2HNDA 1S9GB 3EY1A 1TKTA 4EZ9A 4K4YA 2X78A 1RBVA 2C22A 3L2WA 1Q9YA 1A5WA 1BIZA 3FRZA 2WTFA 2R8HA 4DS4A 2VA3A 4XO0A 3CWJA 4EBCA 3LPUA 3LZJA 4KB7A 2HHSA 1B9DA 2R8GA 4ED1A 2XI2A 1S97A 4ZVFA 4KI4A 4E7LA 4FXDA 3TQ1A 2DPJA 1TK8A 3G86A 3KLGA 2W7OA 4RW8A 3QEXA 2OPRA 4JS5A 5DK5A 1TKDA 1TL1B 4O5BA 5KFFA 5F8JA 4DU4A 1KFSA 1IG9A 4ELUA 3RRHA 4LQ3A 3E51A 4DTXA 1XHZA 3SNNA 1DTTA 3KLEB 4ECVA 1LV5A 3L3UA 4O55A 4C8KA 1ASUA 3NMAA 1QSYA 4RUCA 4FW2A 1S9EB 5I42B 3MEGB 1SKWA 3PR5B 2FLNA 1RAJA 1EP4B 3SJJA 3IGNA 4F50A 3CJ5A 1WSJA 3CJ0A 4MKAA 2VG7A 1XC9A 4OVLA 4CFCA 1TP7A 1QE1B 2EX3A 3U3GA 3ALYA 4DL6A 4G1QB 1RDRA 4F8RA 3ICLA 2ZE2B 4PUOB 2D7SA 1W0HA 1O1WA 2AGOA 3OL6A 5F8IA 1J53A 3BR9A 3SI8A 4Y34A 2GUIA 1RT6A 3V9SA 1YVUA 4O44A 1X9SA 1NK0A 1TL1A 5KRSA 4CEAA 3O3HA 3JSMA 5EU7A 3VQEA 1NK6A 3HK2A 2D3UA 4QOZB 1G15A 3PZPA 3RB4A 2YKNA 4NYNA 3TANA 2GBZA 2E4LA 4DTSA 1IO2A 2X6SA 2HMIB 3OYKA 1WSFA 1A5XA 1QUVA 1VRTB 1NJXA 1N6QA 4DSKA 3UR0A 4ED6A 1RYRA 3SQ1A 2PZSA 3RMDA 4AHUA 4RNFA 3K57A 1TKZB 3KLHB 2HNYA 3K5OA 2BE2A 3NDKA 3TAMA 4CHNA 1S1WB 4HCCA 4ZTFA 1NJYA 3M8QB 2DFHA 3PVXA 4W5QA 2DPIA 1DTTB 3KLEA 3QIDA 3TAGA 4ZMMA 4RW7B 4B9LA 2XI3A 4R8UA 5DG9A 4WFXA 5C24A 3RBEA 4KKOA 4DTMA 2E6LA 3FFIA 5K14A 4CIGA 2ZQBA 2G8FA 1HQUB 4U7CA 2IJNA 4NLQA 4B9NA 1KLMA 5KFUA 1IKVA 1NKEA 1N5YB 3NH2A 3D45A 3P83D 4EP4A 5KT7A 3KHGA 1JLQA 3F9KA 5CYQA 4IH5A 1BCMA 4B8CA 3H59A 3HPHA 4IDKA 1EETA 5HRNA 1XI1A 3OL8A 3V6DB 5SZTA 3LP1A 3FFIB 5K14B 3QYYA 3TR8A 1NK9A 5F8NA 3KOAA 3L2UA 4TN2A 4GMJB 5DGAA 3NAHA 3ZT3A 4KKOB 3IN5A 1K6YA 3RWUA 4ECRA 1I39A 2HNZB 1IKWA 3HPOA 1CZBA 5F9NA 3H08A 3DLBA 3Q8PB 2AX1A 3OS0A 3B6PA 3BGRA 1X1PA 2NUBA 4CESA 4XPCA 4CCHA 3V9UA 3KK1B 1QAJA 4FBTA 3OYLA 3I0SA 4RU9A 3OHAA 3KTQA 5KFAA 3HHKA 1DTQA 4QWDA 4NLXA 4DU3A 4CFAA 4E89A 3MEEA 1CSJA 3T5LA 1U4BA 5C25B 1S1UB 3AA5X 3QINA 3VQ7A 4CJPA 4BDPA 5KT5A 1JLAA 4ZHRB 5KFSA 3MEDA 2OPQA 4KRFA 4CJUA 3T19A 2XCPA 4LH4A 1GOCA 3LALA 5HRRA 5KFEA 3M8PA 2FVSA 2PYLA 2IOCA 5J2NB 3MAQA 3IGVA 1D9DA 4OPKA 2Y1JA 5KFRA 2DFEA 4CJKA 1HYZA 3S3NA 2KZZA 1HNVB 4FM2A 4ECYA 1GOAA 4Q45A 3K2PA 2HHTA 1RTDA 3NBPB 4CHYA 3OYJA 4NLWA 4KPYA 2YNIB 3SUQA 4E1MA 3G6YA 1S1WA 4J2DA 1REVB 3HL8A 3I0RB 1TL3A 3K5LA 4RW7A 4DL3A 4FLUA 4Q8FA 4RW4A 3GIIA 3RMCA 3AO2A 1HRHA 4DQSA 5DQHA 4K4VA 2FBVA 3LP2A 1HJRA 3C6TB 3PX6A 2OPRB 4JLHA 3G10A 4HKQA 3AVHA 3CVKA 4YR0A 2IM3A 2V0NA 1S10A 2XO7A 1BQNA 3LDSA 4QWEA 4DSIA 3ZCMA 3VQSA 1JL1A 4KV8B 3G0ZA 1D5AA 4RG8A 1ITGA 2YKMA 4Y1DA 5HRPA 2YNHA 1UOCA 1RT6B 3O4NA 2FJWA 3V1OA 4KHMA 3M8PB 2J6SA 3ITHA 1S1VB 3LPTA 4AH9A 1ZBLA 2ILYA 2P5OA 5DLFA 2JC1A 4AILC 2AQ4A 5J2PB 3QEWA 2P5GA 1JXEA 3U3YA 1RT2B 2UUTA 1LAVA 3BSNA 3DYAB 4K4WA 5L1KA 1N56A 4CJSA 2D0BA 3CIZA 4TY8B 5C42B 3OL9A 2ASLA 1UA1A 3SYZA 2DFFA 1CXQA 4CIEA 4WE1A 2JGUA 2QXFA 4MK7A 1VSKA 3ZT2A 1VSLA 1B92A 2IAJB 4NCGA 2V9WA 3L8BA 5FRMA 1QE1A 5KRTA 4F2RA 1R0AB 1EKEA 4M95A 3WNFA 4KTWA 1IM4A 3HPGA 1DLOB 4J9LA 3HT3A 1D1UA 1YT3A 4BWJA 3SQ4A 3UQSA 4MK9A 2XRIA 1SUQB 2HWHA 1VRTA 2E6MA 3DLEA 1S6PB 3GV7B 1RT2A 2GIRA 3VQ9A 3HXMA 1QQCA 4CHOA 3UDLA 5J2MB 3ZSQA 4F4XA 4ZPBA 4ZVGA 1JX4A 3ISND 2VG6A 4CFDA 4IH7A 3DOKB 3O4QA 4Q43A 5FROA 4LQ9A 4NCGB 4RNHA 1T3NA 5KFCA 3OSPA 1JKHB 3RR8A 4KHRA 4MIBA 3V9XA 1SL2A 2P51A 5KG4A 4ECTA 4TQSA 4CF8A 2B5JA 2W8LA 3H98A 4DF8A 4K4TA 1FXXA 1NOYA 4Y2CA 1YVFA 3E01B 3O3FA 3N6LA 1SV5A 3ITHB 2QV6A 1S1XB 4NZ0A 4ID5B 2X74A 3DLRA 3L3VA 2ZKUA 4C8MA 3QERA 3NH1A 3IG1A 2OZSA 5C24B 2ZD1B 2G8HA 2VG5A 3QO9A 1Z26A 1KHVA 3K59A 3BSCA 4I2PB 2AGPA 4F4ZA 5KFIA 3S3MA 5KFNA 5CYMA 1X9WA 4YR3A 1IKXB 5D3GB 1TL3B 5DQIA 4MKBA 3CQ8A 4NLOA 3CM6A 1N48A 4M3ZA 2XY8A 1RT4B 3VQ6A 3FQKA 2XHBA 4ZPCA 1VSIA 1MU2B 2ETJA 4Y3CA 2B6AB 3QGIA 4EZ6A 4DFPA 3NKYA 2FJXA 1VSEA 5KFTA 4K4ZA 1LWEA 3SFGA 4GW6A 4TXSA 5KFHA 1Z25A 2C2RA 3DMJB 4B3OA 4KHSA 4NLPA 4DMNA 1JLFA 2RF2B 2W9BB 3EZ5A 1VSDA 5J1EA 3KJVB 1C0TA 3PUFA 3OYFA 3IS9B 3HP9A 2JEJA 4IR9A 2VG7B 4O3QA 1ASWA 4FZYA 4MIAA 4FLZA 4CJEA 2HHQA 5J2QB 3OL7A 1XR6A 1HPZB 2P1JA 3N6NA 4NYZA 4X2BA 3I0RA 3QLHB 3AA2A 3DRSB 2FVPA 4CJWA 3CFPA 4CHQA 1FKOB 2WRMA 3CDUA 3M8RA 1RYSA 5FRNA 2YNIA 1Q9XA 4I2PA 3QIOA 3PW2A 3OJUA 2XY5A 1S6PA 3T5KA 4QCLA 2IMWP 2R8JA 3QEPA 4JV1A 3AV9A 3D0PA 4J9KA 2FVRA 4ECZA 2J6UA 2HVHA 4F3TA 5J2QA 4ZP9A 4RZRA 3RB0A 2YKNB 2IC3A 2WCXA 1JL2A 4KFBB 1NJZA 2Z1IA 1JLGA 4FJXA 2DTUA 4CJFA 5KFOA 3GIJA 2V4RA 1ZTWA 2IS3A 1BCOA 3KMQA 2V4QA 3EPIA 5HP1B 4Q44A 1QS4A 1JLAB 5EWEA 5KFMA 3VQQA 3K58A 4B9MA 1W25A 5I3UA 1S1TB 5KG0A 1SKRA 4DL2A 3AVJA 5KTQA 4E0DA 5KI6A 4KBIA 4KREA 3IRXB 1U09A 5KFXA 2QKKA 1TAUA 4AHSA 3RMBA 3I5CA 1HMVA 1RT7A 4CJTA 4CJ4A 1NKCA 3AVFA 4H4MB 3MR6A 1ZBIA 3C95A 4KFBA 5KFYA 3PV8A 1SH2A 3KNAA 3PW7A 3QGGA 1TGOA 4KB0A 1T05A 3DYAA 2E9RX 4OKJA 4RW9B 1TK0A 1C1BB 4O44B 5KFWA 4ECXA 1YTAA 1ZBFA 4PWDA 3L2QA 3UPFA 5KFKA 2ASJA 3NF9A 1KVAA 3CG7A 2B6AA 3TAMB 2XCAA 4DQIA 2UUWA 2OPSA 2QE5A 5JS2A 4IRDA 3V1QA 3TAQA 2HHWA 3P1GA 3V6HA 1T8EA 1WLJA 3TAPA 1A5VA 2CKWA 1J54A 1MMLA 3CJ2A 4ED7A 3C94A 3GV5B 1JLCA 3V4IB 2BRKA 5F8LA 4GVMA 4CGGA 4CK1A 4O4GA 2UVRA 4EEYA 3QESA 4QWBA 4RW4B 4OKKA 4AHCA 1UAXA 1NJWA 4C8LA 2A1RA 4NCAA 1RT5A 4HUGA 2B4JA 4J9RA 3H40A 2E9TA 3GIMA 3DLKA 2BQ3A 3VQ5A 1RA6A 1YTUA 4N41A 1S5JA 5KFLA 4FZZA 4TQRA 1B9FA 3KLGB 3V9ZA 2G8VA 4FM1A 1NK8A 4IG0A 4LY7A 2HW3A 2ITGA 4DF4A 2FVQA 4YNQA 2FVCA 4EYIB 4DTJA 1QSLA 5JUMA 2KFNA 3HVTB 4HHTA 5J2PA 2JEGA 3SUOA 2HHUA 4LH5A 2WK4A 2D3ZA 3KK3A 3NF7A 1TQLA 3MXMA 4BE0A 1TKTB 1FKPA 4ECSA 3I0SB 4LSLB 3DLHA 1LWCA 1LWFB 4I7FB 5SWMA 1C0UA 4HTUA 5J2MA 2IA6A 1ZTTA 3NGDA 3AVGA 4QWCA 4DL7A 3H5XA 4AHRA 4IFYB 1RT3A 3DI6B 3I5AA 3LANA 4NLSA 1BQMB 2JC0A 1GOBA 1JXBA 3AA3A 3I8DA 3OVNA 3MEGA 4L8RB 1S0OA 1FKPB 4Z4FA 3VQ4A 3SPYA 2WHOA 2RDIA 3QGHA 3K5NA 3KKSA 4FJNA 3SI6A 1RBTA 1KRPA 1KSPA 1T03B 4E7JA 4E3SA 3OYBA 4NLGA 4CK2A 4BACA 3RMAA 4O3RA 4NLRA 4DTUA 1D8YA 5EDWA 2KFZA 3NGYA 3OYCA 3PJWA 4CHZA 3I5BA 2G8IA 3KK1A 1IH7A 3FDSA 3PW5A 1JKHA 2AX0A 1T94A 4O3OA 2WOMA 5HROB 2YHBA 2B5JB 4ZPAA 4CJ5A 5KGXA 3CDWA 1T03A 4O3NA 3KHLA 3NH0A 3PY8A 5JS1A 4M3XA 3H5UA 3IAYA 1DTQB 5HLFB 4DLEA 5HBMB 4PUOA 1S1UA 1WAJA 3EPGA 4DTRA 4R0EA 3DM2A 3OHBA 2RN2A 2W7PA 3AVNA 4ID1A 2HNZA 4F3OA 2VA2A 2FC0A 3TWHA 3OYAA 4QW9A 5C25A 3AO3A 3TAFA 3A2FA 5F8GA 4DQRA 2O4IA 4FZXC 4RNOA 4K4SA 4KE5A 4FJGA 3AVLA 1LWCB 2RPIA 4FJIA 2VG5B 3QO9B 2QK9A 5KG2A 3M8QA 5KT6A 4M3WA 3E01A 4CJRA 3WNHA 2IM2A 2JLEA 3KK3B 4KHWA 4KHYA 3D28A 4ID5A 1WSEA 2XGPA 3HKWA 4B3OB 3PW0A 3JSMB 4ED0A 5EWFA 2OZMA 3OYEA 1C1AA 2J6TA 1SKSA 2X6NA 3ZT1A 3QIPB 1LW2A 1RTHB 3SV4A 1ZBHA 3ZSXA 4C8OA 4ED8A 4IR1A 5L1IA 2HB5A 2VWKA 3LAMA 4JRPA 4ECWA 4XIUA 3MECA 3MR2A 4W5NA 1RTJA 4Z4IA 3DMJA 3VQAA 3Q8RB 4K8ZA 4WFZA 1BQNB 4CEDA 4MH8A 3SUNA 3F73A 1S9GA 3PR4A 3HSTB 1TV6B 2I1RA 4R8UB 4CEZA 3LP3A 3NCIA 3CFRA 1NK4A 3AA4A 4W5TA 4FJ8A 3DLEB 1IKYA 3DOLB 4J9OA 4M94A 5F8MA 4HVJA 4J9QA 4I7FA 1JLCB 4RW9A 1U45A 1HQUA 1RTIA 2HNDB 4M42A 4Y2AA 4I2QB 2Y1IA 3BQ2A 1S6QB 4ZVHA 3K5MA 4BDYA 2BE2B 3AVMA 2IM0A 2PYJA 2KTQA 5KG5A 1TKZA 3C6UB 4KAZA 3DRPB 4DFKA 1I3AA 2YKMB 5E41A 5T7BA 3PX4A 4TSXA 4FJ9A 1U47A 3CJ3A 1RDCA 1N5YA 1S9EA 5I42A 1JLBB 2UVUA 1S1XA 5KFZA 1NK5A 4JV2A 1WN7A 4IG3B 3SPZA 3SUPA 1VSHA 3KLFA 1RBUA 1RTJB 1XR5A 1HQEA 4TY8A 3OS1A 4FK0A 3ZSOA 3BQ1A 2OPSB 4FJHA 5DLGA 3SFUA 3FSIA 2G8UA 3QEIA 4RNNA 1L5UA 1GX6A 1KCFA 3HVRA 5DMRA 4TYBA 2VWJA 3UIQA 4IG3A 4HUEA 2KQ2A 2BR0A 4H8KA 4K8XA 4BDZA 1RDAA 4KO0A 4K4UA 4I9QA 4MFBA 2I5JB 4EP5A 4O0IA 3PW4A 1RTIB 1L3UA 2ZE2A 1UWBA 4JV0A 3M9NB 1D9FA 4TY9A 3KLIA 2OH2A 1ZETA 4R5PB 3RB3A 3KLVA 1U04A 1IKYB 3DOLA 2HHXA 5FDLA 5KT3A 4DFJA 3IS9A 3KIOA 1NKBA 4H4OA 2AU0A 1RT3B 3DI6A 1FK9B 3RAQA 1GX5A 3VN5A 4CECA 2ALZA 1JLFB 2RF2A 2W9BA 4IBNA 4NLUA 2IDOA 3NAEA 2D5RA 3V6KA 1C0TB 4PY5A 4KV8A 1U48A 1HNVA 4NLTA 3TI0A 1K1SA 4ECQA 3QLHA 1I6JA 1CLQA 2CJQA 2EHGA 3BGRB 1NHVA 2XGQA 3JYTB 2JEIA 3ZT4A 4WZQA 2OPQB 4FJ7A 2KW4A 2Z1GA 1HARA 4RNMA 3OLBA 2OPPB 4Z4HA 4G1QA 1FKOA 1Q8IA 4KTQA 3VQ8A 1NNDA 1S0MA 1IKXA 2ZD1A 5D3GA 4N47A 3OJSA 4URSA 1VSJA 2RKIA 1WSHA 5EUHA 4Q8EA 3HVWA 3EYZA 3KLIB 3MTKA 2HVIA 4J9SA 3FQLA 4WE1B 5KG3A 2C28A 3SV3A 4BWMA 2R8KA 1BQMA 1RT1A 1TAQA 3KD1E 3SZ2A 4CEOA 3LWLA 5HBMA 4TLRA 3NGIA 3OYNA 4DQPA 3BSOA 2D0AA 2R2TA 2HMIA 1RA7A 4CEFA 4FLWA 4ELVA 4Z0UA 4IDKB 3AVKA 3V9WA 5KG7A 1TKXA 4KAIA 4NYFA 3LZIA 4I9LA 4CERA 2R2SA 1EX4A 1CXUA 3KHHA 2KZMA 4DLGA 3AO1A 4FJLA 1HYSA 4B9UA 4DSJA 2XY6A 2IJFA 4WZMA 1QTMA 3MXJA 3CJ4A 3CYMA 4FYDA 1VK0A 1RT5B 2RDJA 4ED3A 3HJFA 4DS5A 1JLGB 3LAKA 4EBDA 1S1VA 1WSGA 3MECB 4OKEA 1T7PA 3KD5E 2DY4A 1TVRA 3M9OB 3DOKA 3MEDB 2HNYB 1FK9A 1F21A 3VQCA 4E7KA 4RW6B 4DSLA 5HP1A 2YNGA 3L2RA 1S48A 2BQRA 4IOBA 4AHTA 3O3GA 2Z1JA 3MEEB 1W9HA 3VA3A 2OA8A 3AVCA 2B43A 4CF9A 1KLNA 1D0EA 2OYQA 3G6XA 3OS2A 3NF8A 3N6MA 2WONB 1VSFA 4O4GB 4YP3A 3OY9A 3KLHA 4O3PA 3TVKA 3S9HA 4FLYA 1KFDA 3H5SA 4ZPDA 3TARA 4IRCA 3QNOA 2G8KA 3LP0B 2IAJA 2I5JA 4DSFA 3V81B 3V4IA 4BE2A 1QHTA 4CGHA 3BQ0A 1XWLA 3NF6A 4FBUA 4CEBA 4I2QA 1TK5A 3QEVA 2A1SA 4CGJA 2W9AA 3HVTA 3SQ0A 3AO4A 2FBXA 5KT2A 3AO5A 3TABA 3V6DA 4E7HA 4N5SA 4IG0B 1WNEA 3OYDA 3PHEA 1HQEB 3T5JA 3H4BA 4W5RA 4LSLA 1OS5A 2BQUA 4DQQA 4H4MA 2R2UA 2FLPA 3QZ7A 4CEEA 4FLVA 1S1TA 2HAIA 4CIFA 3C6TA 2ILZA 1BI4A 3GV8B 4FJMA 4RW8B 1DLOA 4CF2A 5C5JA 1KTQA 3RTVA 4DSEA 1WSIA 3KJVA 4CK3A 1SUQA 5L1LA 4QAGA 1LWEB 1RT4A 4XPEA 4EO8A 1WAFA 2FBYA 3NFAA 1S4FA 5KG6A 1N4LA 4NLVA 1SH0A 4IKAA 4NLDA 4MFBB 4J9MA 2E9ZA 2Q3SA 1KVBA 4WXOA 1WNSA 5DG7A 5L9XA 3ASMA 2WONA 2RKIB 4DTOA 1NHUA 1S49A 1TVRB 2F8TA 4FCYA 1RTDB 4LSNB 1HPZA 4C8NA 3NL0A 3WNEA 1RCHA 2F8SA 1HYVA 3DRRA 1BIUA 3H4DA 4UQGA 2UVVA 5KFBA 3B6OA 4PA1A 3ZT0A 4KHNA 1TV6A 4W5OA 3QETA 4ZP7A 2YNGB 3HO1A 4QWAA 5KFQA 4F4KA 2QKBA 3V1RA 3KLFB 4CJLA 4R5PA 4O3SA 1X9MA 4ZVEA 5KFVA 1RNHA 5DQGA 3KK2A 4KHUA 2AWZA 4DL4A 3D5MA 2D0CA 1K1QA 3EZUA 3ULDA 4OLBA 4FS2A 5T14A 4CGDA 1L3TA 1U49A 1REVA 2EC0A 4KB1A 4ZP8A 4YMEA 1C6VA 1LWFA 5DGBA 1LW0A 4BE1A 4DFMA 4FJKA 3OSNA 5DG8A 3LP0A 4ICLB 1HNIA 4PQUB 4NRUA 4URQU 4ZTJA 1QAIA 3MR3A 3DLGB 3DDKA 2GIQA 1VSMA 4B8AB 2XY7A 4GC7A 4K50A 1J5OA 3BJYA 1VRUA 3ZSYA 4DEZA 4JS4A 3NE6A 4CF1A 3PO5A 4JRQA 4DG1B 4GC6A 3RAXA 3PX0A 5C42A 3OYHA 4OJRA 2G8WA 4J2BA 1RDBA 4Y1CA 2R8IA
chains in the Genus database with same CATH superfamily
2C2DA 1LW2B 3LP1B 2VBYA 3ISNC 3SQ2A 1VHFA 5IWAF 1JLEB 4DV3K 2LMIA 1DKGD 2R7YA 1Y97A 1CLFA 3CNQP 5AZIA 2E2PA 5L38A 3R8YA 5H9EK 3OTBA 4BCAA 3R7NB 4DV7F 4F02A 4WKRA 4IZ9A 2QW9A 4YHHJ 2DO4A 1QSSA 3H5YA 4TYAA 3AD7C 2LU2A 1VK8A 3A1YG 4WU2A 4QQBA 6AT1B 3AAWB 1JK9B 3AJDA 5BPMA 3LGMA 3S7RA 3VF0B 2ZZNA 2HK3A 2HSEB 3L4IA 1KOOA 4DPYA 3WDOA 4YOUA 3GMGA 2EW9A 3US5A 4DTPA 2GC8A 2FLLA 2QGFB 4FW1A 1J9AA 5D4LA 1YK9A 2D41A 4Q5VA 1WHXA 3ZEUA 3JYTA 5GMKa 2J9DA 4DL5A 1C1CB 2M7SA 1U2VA 3F9MA 3H1QA 3W7BA 1O5JA 4YOTA 4F4YA 5AQZA 2ZOFA 2OLWA 4JYAF 5J1EB 3CJTA 4ID8A 3I4PA 5EX5A 1MNEA 2XZTB 3M9MB 4CJQA 3A8EA 3BYRA 4YOWA 4LD0A 4IFVB 3AARA 2DRAA 3L2VA 2XZDB 2FHJA 1WJ9A 3ENOA 3MFIA 2HWIA 1XR7A 5E5NA 1OH5A 2H3EB 3LDQA 4MYTA 1R3NA 1ZPVA 3VEWA 2EG2A 4M63A 4WXWA 2RRNA 1HNIB 1OH8A 2PGCA 3W2VB 4IFYA 5KT4A 3HMJG 3NHGA 4OGCA 3TUJC 4IOXA 2W9CB 1OQ6A 4DWIA 1NUEA 3R27A 1NDPA 2KU7A 4G1IA 3ZTRA 1OH7A 3D1OA 2WB1D 4BRMA 2HFZA 3DHWC 3GIKA 4DR7J 3DLGA 1KVCA 2FJDB 2XMUA 3E2EA 3NNCA 1U1NA 4QU6A 3OR1B 3I8BA 4OPAA 4ED5A 1ASVA 5BRDA 5K9FA 4CW7B 4YN3B 5GAEP 4YOXA 4BC4A 3MM9B 3E8OA 5IT4A 1BISA 1BI4B 3ET6A 1R8BA 3BBFA 2WBMA 3HD1A 3KMSA 3DXKA 2QEXS 1NBEB 3LTOA 1HWJA 1XNRJ 2QLFB 4ZDNA 2R7TA 3WNGA 4WFNQ 2ASOA 2HS3A 3AVIA 4M3TA 2JWNA 3KKRA 1UA0A 2HHHJ 4AF1A 2CAJA 3SJHA 4CZEA 4B9TA 4FK4A 4NXMF 2L41A 1XMOK 3SAFA 2H5EA 1Q18A 1KHWA 3DM2B 1LW0B 2ZH3A 3LA0A 5BXIA 4KTZA 4LR8A 1RWVB 3OA9A 4TLQA 2XWYA 1SL0A 3W64A 4RW6A 5JVHQ 2DO0A 3IDHA 1S5ZA 4A48A 4ZA1A 1IM6A 3C7NA 1JNZB 1HBMB 4RUAA 3BN4A 4ZJLA 5CY4A 3W9HA 2BV3A 1X5TA 4DG1A 4M5JA 4IH6A 4X66J 5HL7L 2RILA 4LRDA 1JLBA 4Z2XA 1VRUB 1BMQB 3CCSS 3NVMA 1CZ9A 4QIGA 1GLCG 3WC2A 4O0JA 4DTNA 2O5DA 2E5LF 4HTLA 4DR5J 5KOWA 4E19A 3SXLA 3TX0A 4ER8A 2Q0RA 4PKIA 4LC9B 1NGGA 4B9QA 3JAMO 3AFGA 1S77D 4IQMA 1SC1B 4PXCA 1C0UB 4DV4J 3J81U 2VC0A 1S0NA 2EFQA 2ZC4A 4U6PA 1K8KA 2PBDA 4M45A 3MWPA 5JXSA 1S9GB 2QWPA 4CP5A 5JMVA 4K4YA 4OHYA 1HHTP 4C11B 1HQ2A 2JWKA 1QAXA 1LXJA 1Q9YA 3PEJA 4GKKK 2WTFA 3RYLA 4DS4A 1RE1B 2JHEA 3M7VA 3R6GB 2FC9A 4W92B 3TQ1A 1M5KC 1TK8A 3QEXA 2OPRA 4JS5A 1TL1B 5F8JA 2U2FA 5ETLA 1VBZA 4K43A 4LQ3A 2ZBIA 3BF1A 4JKAA 1DTTA 3KLEB 3NVKA 3VOVA 4ECVA 4DX5A 1U1KA 3L3UA 3VEVA 2AT1B 2VDIA 3GG4A 1NGJA 3NMAA 3LH2S 2CH6A 2P9KB 1S9EB 5I42B 4UUXA 1SKWA 3HZ6A 2EBEA 2KG1A 4PG8A 2YKAA 1F5CA 4H0OA 1T9YA 4JNEA 3CJ5A 4MKAA 5H9EJ 3BM7A 3U3GA 1JJ2R 4DL6A 1RDRA 1VQNS 3ICLA 2D7SA 1H2TZ 4QIVA 2BTFA 3FZLA 2NS1B 3OL6A 4V1Ak 3JQMA 4A5BA 2IVYA 3BR9A 3CJ8A 4Y34A 2GUIA 4RU2A 1VQPS 3V9SA 1YVUA 1X9SA 4L74A 1DEJA 4K2XA 4QS7A 3LGHA 3O3HA 3OVBA 5AXNA 3JAMY 2IJRA 3RB4A 2GBZA 5JLFA 4PYAA 4Z94A 1Q78A 1VRQC 1A5XA 4Z37A 4FWRA 4NZ7A 2P2CB 2ALYB 1VRTB 3VAJA 3IR5B 4RBUA 4DSKA 1NB2A 4Y2IA 2DNPA 1RYRA 4PKGA 1YJWN 3K57A 1S6UA 3KLHB 5K5MA 1FNMA 1OYDA 4QIEA 1TUUA 3NDKA 1S1WB 1NJYA 3M8QB 2IYGA 3JTOA 5DDOC 3QIDA 3TAGA 4Y6IA 2W2QP 4OZ2A 2XI3A 4PWWA 4WFXA 2EFOA 1PYSB 4X4NA 5IWAK 3ENVA 1EHWA 1HI0P 4CIGA 2Y0SD 2CPDA 3VEYA 2G8FA 2ZWOA 2IJNA 4NLQA 1FWLA 3B4MA 1LFWA 1V3RA 4BG8A 1N5YB 2LEBA 3NH2A 4FNIA 3IBCB 2GJIA 2RS8A 3S1TA 1HNZF 4IDKA 2W40A 5HRNA 3OL8A 2ZH6A 3LP1A 5K14B 2HIYA 2IVMA 3FSYA 2ZBQA 2R7VA 3PYGA 2G0CA 1CJTA 4KKOB 2B8QA 2CJAA 1VLOA 1I39A 3OR2B 1Q82T 3QGPA 1QVFM 1KR4A 2DNGA 1U1LA 5AQLA 2AX1A 2VHGA 1TYQB 3B6PA 4PYDA 1X1PA 4XH1A 3EXCX 4OHWA 2MGZA 3CCMN 3KK1B 1R43A 3RW7A 2AD9A 4FBTA 3I0SA 1U7LA 2W6KA 5HI7A 1S1UB 3EMTA 1EARA 2JFKA 4CJPA 2MXYA 4ZHRB 1PAUB 3ID8A 4BC2A 3I56N 2D69A 2FVSA 2D1KA 2IOCA 2LQ8A 2DEJA 2BKOA 2QEXN 1YI2S 4NOHA 2GMHA 1HYZA 3S3NA 2AYGA 2QSFA 4ECYA 4QR2A 1KOHA 4Q45A 4FN5A 1OVYA 1T02A 5AQGA 3NBPB 3W62A 4NLWA 2YNIB 3SUQA 3G6YA 4C48A 3LPYA 1BXNA 2AJ2A 1A7GE 3IWXA 1F60B 1YTYA 4K25A 4OLOA 4RW7A 2VQFF 4FLUA 4BRLA 2ZHAA 1K73T 1RHJB 1NPRA 3PSIA 3JTNA 2FBVA 1WKJA 4K4VA 2Y9HA 1HJRA 1OIAA 2OD4A 2OPRB 4DUZF 2HFOA 2VF3A 3CVKA 4YR0A 2QIFA 3THXB 4AM6A 1NJIO 1S10A 2Y1RI 1W2BM 2KB2A 3G0ZA 1D5AA 1ITGA 1AYEA 3UDVA 5GAHU 3VZHA 2YWEA 3GWCA 4B3SF 1Q7YO 3V1OA 4KHMA 1UFKA 4YY3J 2AP1A 2P5OA 1B64A 5DLFA 2RIJA 5J2PB 3QEWA 3D6RA 2E1AA 1WD6A 3DYAB 5L1KA 1N56A 4CJSA 2D0BA 4TY8B 2GVDA 4CIEA 3TJ9A 4J5OA 1HBMA 2QXFA 4FWNA 2VQEK 1OH6A 2V9WA 3NP5A 4I4BA 1WC0A 1D1UA 1YT3A 5BJRA 2XRIA 3EE8A 1YAGA 3KVGA 3DGVA 2GIRA 1OY8A 4QYRA 4JKBA 5J2MB 2VQEF 4ZPBA 3SEOA 4OI4A 4P71A 3DOKB 4DXLA 4F0KA 2XEXA 2FHMA 1I3OB 3ATUA 4LQ9A 4NCGB 1T3NA 5T7LA 5KFCA 4BLGA 1YBTA 4BRKA 3RR8A 4KHRA 1F3VA 4JP8A 1SL2A 1GFWB 3R3TA 1I94K 4TQSA 4CF8A 3O1LA 2YKOA 2DGOA 1HLUA 1FXXA 3SAGA 4LFBK 1NOYA 1YVFA 2HVZA 3ITHB 1ATSA 3Q86A 4IOCL 3HX9A 1VHXA 4ID5B 1VK3A 2LKZA 1RK8A 1WKLA 5AQVA 4C8MA 3SSQA 3TJAA 4NO7A 3BPSP 2W25A 4OYBA 5C24B 2A10A 1Z26A 3V5RA 1KHVA 3RJMB 1X4CA 2K8GA 3P4IA 4CBWA 4F4ZA 3S3MA 1FWKA 1HUXA 5CYMA 1URRA 1TL3B 3CJCA 4MKBA 4LF7J 2GQQA 4I1TA 3CQ8A 4MTPA 3CM6A 5BYSA 1N48A 1D4XA 4DV6F 5C2DA 5AQUA 1ATRA 3FQKA 1MU2B 2UUBF 3D2EA 2XS2A 4Y3CA 3QGIA 1R6VA 2V8VA 4AQYF 1XNQK 1RWOB 2ABYA 3ATVA 4WP8A 1VSEA 5JMNA 1N32J 3SFGA 4ISGA 3W65A 2C2RA 2CPZA 4JI5J 4DMNA 1KAXA 2MQ8A 2RF2B 1ZM3A 2J9CA 2V9KA 3EZ5A 5J1EA 1RHUB 4K42A 2DB1A 5DRKA 2CH5A 1GH8A 4IR9A 2DHSA 5HQ8A 2HWTA 2FHOB 1ASWA 4FXWA 3WBZA 4FZYA 4FLZA 1OKJA 2UXDK 2K3IA 2P1JA 2P9UA 1UVIA 3UWTA 1FA0A 2DNHA 3N6NA 4JI1F 2NXCA 5F41A 1YG0A 2WRMA 1FRXA 3M8RA 2QTWA 2EFNA 3H25A 3ZTSA 1KXPA 3VGSA 3T5KA 5K8OA 2IMWP 4P2MA 2FY8A 3HSJA 3DU6A 3QQCD 4C98A 4J9KA 2FVRA 1R0BG 4ZP9A 5FLXO 4RZRA 2YKNB 2IC3A 3THYB 1JL2A 2E1PA 5C2CA 1JLGA 1HBOB 2DTUA 3CCJS 2J8SA 3BH7B 5KFOA 2V4RA 2RD5C 2CWKA 3KMQA 2GMJA 2V4QA 1MLAA 5B8HA 3MX2A 5KFMA 3VAIA 5I3UA 4DPOA 1SKRA 1AXQA 4YHHF 3TYTA 2O8BA 4ILMA 2R7WA 4E0DA 3IR7B 4UOFA 2W2NP 1NH8A 3ET6B 1NKCA 4CJ4A 2MQLA 2YY3A 1H2VZ 1XMOJ 5AZIB 1SH2A 2ZJQL 4FP9A 3LGNA 1Z05A 4X64K 4WK3A 2E9RX 4OKJA 3D2FA 1C1BB 3UD4P 1YTAA 4PZVA 3N4WA 4ILRA 3L2QA 4B3TK 2ZH5A 2ASJA 3HTVA 4A8QA 2AIRB 2HHWA 3V6HA 2AP6A 1MMLA 3CJ2A 1H6KX 4N7TA 1JLCA 1ILYA 3QBWA 4EEYA 5AQSA 4QJVA 3N9UC 2V8HA 3QESA 4QWBA 4RW4B 1UAXA 2QMUB 2M8HA 4HUGA 3OT9A 2B4JA 2DGSA 4LF7F 4BC3A 2FJBB 4I69A 3B54A 3HHLD 4C7QA 4FZZA 2OFHX 1L3KA 4TQRA 2DRDA 2HVDA 4JI4J 1X0PA 4IG0A 4BRAA 4LY7A 1VQYA 1YJNN 2FVQA 4YNQA 1YRUA 4JI3K 4LRCA 1HPMA 5JUMA 1NBWA 3VCDA 2KFNA 2JEGA 4LRAA 1N32F 3SUOA 2HHUA 3PRVA 2ZH1A 3KK3A 2FQQB 3P6YC 4BE0A 1TKTB 1FKPA 3CI5A 2Z0GA 4DCHA 4EAHD 3EXYA 3I0SB 1LWCA 1UTAA 2P9IA 2DYAA 1Q79A 2O66A 4ZITA 4HTUA 5J2MA 2ASPA 3NGDA 3VGTA 3OTCA 4H0PA 3H5XA 1AB8A 4IFYB 1HWLA 3T1YF 1BQMB 3PIOL 1NXIA 3GSIA 3MEGA 1DARA 3NNHA 1FKPB 1IBKF 3D4JA 5IV3A 3QRRA 1KTVA 1O13A 3SI6A 3CQXA 4A8XA 4OYAA 3OYBA 2H48B 4MAKA 4BACA 3ETOA 4XH4A 4DTUA 1XERA 5EDWA 3QMLA 3NGYA 3OYCA 3PJWA 1TR0A 3M2UA 2QLXA 2GO8A 2G8IA 3KK1A 2XMKA 3O8WA 1TMMA 4U7UK 2OP5A 1EWQA 4KH1B 3RW6A 1NLKL 2J7UA 2WOMA 1URNA 4BR4A 3LW5C 2YHBA 4CJ7A 4B1ZA 1MG7A 4LREA 3K5PA 4OX9K 2HHHF 5KGXA 3FBCA 3GB0A 3M4XA 3DRXA 4CYUB 3D6FB 4J7CA 2CNNB 3IAYA 1DTQB 1UPPA 3CF5L 4DLEA 1ZA1B 4PUOA 4CO0A 2A6AA 4CZHA 2XNQA 3QT7A 2RN2A 2ATCB 2CGLA 2W7PA 2BOAA 3AVNA 4Z7YA 2P9UB 2GAHC 3CD7A 5EN1A 3QFPA 2HNZA 3OD2A 3TW0A 4DX6A 3OUYB 3OYAA 2WFBA 3TAFA 3H90A 3I4HX 4RNOA 4LFAK 5KG2A 1FE0A 4DR6J 4FSVA 3E01A 4ES3A 2JLEA 3KK3B 4KHYA 3D28A 2XZWA 3HKWA 3G87A 3PW0A 3LPEA 3P49B 2OZMA 5B08A 3IWNC 1C1AA 2RH3A 1SKSA 3KG0A 3QIPB 3FZMA 1RTHB 3MM7B 4CM0A 2HB5A 2VWKA 4TKTA 2OTLN 3OFGA 3MECA 3MR2A 2VGMA 4LFBJ 3DMJA 4DV1F 2K2PA 1WHWA 3O9UA 5C10A 1IBMJ 2NZCA 3SUNA 1XMQK 3PR4A 1EKSA 1QQMA 4WFAQ 1XNQJ 1OQ3A 1RLDA 1FVSA 4F25A 3OTEA 1XNRK 3CF5Q 3CFRA 3DU5A 1IV0A 5CH7B 4DPWA 3CMEN 1M90O 4CLPA 4J9QA 4I7FA 4Q2MA 1VQ4N 2FTRA 1YF5L 5HVHA 4WKYA 4M42A 1KQSR 1H3DA 2Y1IA 2IVFB 3D0GE 4FWMA 4ZVHA 3K5MA 4BDYA 2BE2B 2GZOA 3AVMA 1F2GA 1E6VB 2HFUA 2J4RA 4ZN3A 2PYJA 2KTQA 4WFBQ 5KPRA 3B78A 2NQPA 4WQ5C 4PG5A 3I96A 2YKMB 1NO8A 5T7BA 2K1RB 3ULEB 1FF2A 4FJ9A 2KHCA 1U47A 2GVZA 1RDCA 2H5IB 3M30B 4OZ1A 3VF6A 4P9SA 3MUVP 3KLFA 5BN8A 2LQ5A 3CETA 1VQSA 4TY8A 5J1PA 4YDXA 2DHAA 1IXKA 5DLGA 3PIOQ 2BOPA 2P9NB 4NI2A 4DB3A 3KG4A 3D2FB 4RNNA 1L5UA 1KCFA 3CC4S 5A8WA 2ZNYA 5DMRA 2PMZD 2FGCA 2BJ3A 3BGUA 4IG3A 4V19X 4DV1K 4HUEA 1RACB 3J7Z5 2KXHA 5GAEI 1KVIA 5GAGI 2DXDA 4CLWA 4YDUA 3K17A 4K8XA 4BDZA 2O8EB 1RDAA 4C11A 2KH9A 3UN2A 3TNVA 2V6AA 2I7PA 2MY8A 4PPZA 1RTIB 4CLYA 1UWBA 4NE9C 1PILA 4C3KA 3CCES 2OH2A 4CLKA 2X1BA 2HLTA 4R5PB 3KLVA 1Y7PA 3FCVA 1IKYB 1UJ5A 1MDUB 2HHXA 4PL8A 5F3TA 5KT3A 2YH0A 3CCTA 4OHVA 3W3SA 3C6HA 3K9KA 2CFXA 4JI6K 2AU0A 4WQ5A 1RT3B 1FK9B 4JEPA 1GX5A 2IDLA 5E3CA 2ALZA 2RF2A 5HQLA 4IBNA 3SLCA 4NLUA 4H5VA 3NAEA 2D5RA 2OAUA 4B1XB 3A8IA 4PY5A 4KV8A 3UE2A 1U48A 3G82B 4M5NA 4ILGB 4OV1A 4LSZB 2C2KB 4X4UA 2H3GX 3CCEN 4BRQA 4KJIA 1NHVA 2QYGA 5GADI 4UY85 4OYMA 2AZ3A 3MK6A 2OPQB 2Z1GA 2ADBA 2KRBA 3IFRA 2OPPB 2GQ2A 3UVJA 1Q8IA 4O23A 3UB5A 2ZD1A 2ZJQQ 3OJSA 4PXBA 4ZPTR 2B8PA 3VAKA 2CYYA 3MTKA 4CIOA 1HW8A 2HVIA 1GLJO 1RWPB 4M63C 5L8RC 4PXDA 2C3YA 5M1NA 2R8KA 1RT1A 2OD6A 2QFJA 3PKMA 3LWLA 1NAQA 2HBQB 4TLRA 3OYNA 2HMIA 4CEFA 3NGTA 4IDKB 3AVKA 5AQHA 5KG7A 3VVUA 9ATCB 2DGXA 5M1FA 2VOPA 3LZIA 4CERA 1EX4A 1F9EB 2PFFB 2DRBA 2W6LA 1CJUA 3AO1A 1HYSA 3KUHA 2DD8S 5BYQA 4EK2A 1KVJA 3CYMA 1RT5B 2A2CA 4YOYA 2RDJA 4DUTA 2V2KA 3MPUB 1T44A 3LAKA 3OBYA 1S1VA 3PIPL 2AJFE 1MROA 5F3ZA 1T7PA 3MECB 3J8AA 2PI4A 2DY4A 1NDLA 3ZLJA 5CHCB 2MZJA 1E4GT 4DSLA 5HP1A 2YNGA 1LK7A 2QG9B 4I67A 4A8FA 4MT1A 3O3GA 3TSPA 4OI6A 2OYQA 1D0EA 4BY9C 1GEHA 1MWKA 2XLKA 3I56S 3OS2A 3N6MA 2WONB 1B0VA 3T69A 3TVKA 3LOUA 1TL7A 4FLYA 4PR6A 1S7IA 3BF4A 4A46A 3QNOA 4WIQA 2G8KA 2IAJA 2I5JA 3DNCA 3V81B 2ZOGA 2HVEA 3ILIA 1XWLA 3FRYA 1TK5A 5I3QA 1K8AO 2RRBA 3VMFB 5KT2A 3W61A 1HD0A 4N5SA 4IG0B 1WNEA 1AA1B 3TEHB 3T5JA 2YX4A 3H4BA 4LSLA 4W5RA 1VQOS 4OV6A 4H4MA 4MIWA 2CDQA 1WOOA 1RQ0A 4LF5J 3MCPA 3C6TA 3R7SB 3V2UC 1NPPA 4JI2K 4ZVOB 3TZZA 3NS7B 3MXHP 3RTVA 3NGKA 4CK3A 4ZCMA 2M9KA 3AB2B 2VFUA 1WAFA 4EO8A 2CJBA 2FBYA 4LF7K 1WC5A 2JNJA 3TP2A 3DDNA 5KG6A 4NLVA 4NA2A 4XAKA 3GU0A 4MFBB 4J9MA 3FBEA 4DN9A 1KVBA 3TZYA 2WC9A 3HFZB 4WXOA 1FRMA 2VC1A 4WWSA 1RHQB 3HFVA 1WSRA 1KD1T 3I55N 2F8TA 4FCYA 1EQMA 2XS5A 2HPUA 3R8EA 1EJ7L 3NL0A 3R6MA 1SKUB 4C6AA 2C1EB 1B0PA 1YJ7A 2F8SA 1HBUA 4DHVA 3J7YU 1B7FA 2UVVA 1LWXA 3ZT0A 3J7ZO 1TV6A 4W5OA 2AV5A 1PCAA 2YNGB 3HO1A 3NS5A 2NLWA 2QKBA 4OMFG 3V1RA 1NCLA 1REGX 1KKHA 1GMVA 4CJLA 1RNHA 4ZIWA 3LDLA 4YOVA 1DRZA 2VONA 2YWHA 4DL4A 1PC5A 2CQ2A 4A57A 3A4TA 3EZUA 2ROEA 4OLBA 5T14A 4CGDA 1U49A 4KB1A 2I7NA 4JI6J 3DGPB 3R5CA 4JI3F 4DFMA 4BE1A 1R6YA 2QWQA 4XDDA 3Q2SC 4XDCA 5DG8A 4NRUA 4C8YA 4URQU 1PAEX 2ZH2A 1OMSA 2RSQA 3DLGB 5HVFA 3QFHA 1YBUA 4B8AB 3G71S 4GC7A 1N5SA 1J5OA 3BJYA 3EE9A 3ZSYA 4DEZA 3BS9A 3TSQA 2MJNA 2FZCB 4GC6A 3RAXA 2RE1A 3NXZA 3D7EO 1RDBA 4Y1CA 2DNZA 1L3SA 1RTHA 4N8NA 5AJ3F 3BKFA 1T0TV 4Q7AA 4U67Q 3VQBA 2JLFA 5E0OA 4NLCA 3AVBA 1Y4ZB 2B7CB 3CULA 3KXDA 2GCFA 4AL5A 2R4FA 3OBWA 4O4RA 4H03B 3LDPA 5IT9U 4LMZA 2MQNA 4Z4GA 1R31A 2VKZG 2DR7A 4FJJA 3MCNA 1P27B 4X65J 4CEQA 2PE8A 2P9SB 2IBOA 4CFBA 3MOJB 4WFYA 2ZVIA 3M8SA 1VIOA 4FLXA 1S9FA 3QRQA 4DV1J 2MZQA 2IIRA 3ZZZA 3P5JA 4YDDB 3Q0AA 3T3FA 4M1KA 2XYHB 2E66A 3M5RA 1J5OB 1C0MA 1NGEA 4IQXA 4MYUA 1LOUA 3N5FA 2RQCA 5AZJB 2JEFA 4P73A 3MXIA 2YV0X 2BGGA 4DV2K 2P9PA 4DOZA 3SMPA 5A2QY 2JOQA 4ELTA 2FB0A 2YNHB 2LSNA 2DR9A 2DGWA 1U2FA 4CD1A 4ZJOA 2RUSA 1N8RT 2Z2ZA 4KSEB 3C66A 2A6MA 5HVGA 1TKXB 2AJQA 1UEVA 5DJBA 4M3UA 3VGLA 3ZSVA 3FR0A 1WI6A 1I94J 1ZBUA 4J37A 2RAQA 4KHQA 1DHMA 1VQ7N 4Q0BA 4NRTA 4RPFA 5A8KB 5L1JA 2OTJS 2QLWA 3JAMU 5HROA 3CJRA 3Q83A 1MWMA 1RGIA 4H0XB 4RBTA 1P1TA 4ZPWR 4WPAA 1GNKA 2GV1A 5FLXY 4MK8A 2NREA 2E44A 3DLKB 3G4SN 2ATQA 5KFGA 2LYVA 4IO9L 2RVJA 3O9TA 3OLAA 4N56A 3A3NB 1LAWA 3GILA 2MKIA 1C2PA 1JXVA 4Q0BB 4DR5F 4ENOA 2E1CA 1IUJA 2KT5A 4BVOA 1ICEB 3N4QA 3H2LA 1HKCA 1EXQA 1T95A 3WXMB 3OXGA 5HLFA 4OPJA 2EI5A 1RHRB 4FWLA 4J9PA 4A61A 2DHHA 2UXBJ 3R2DJ 4XH5A 4DV0F 1SL1A 1N33F 4LBPA 2PC6A 4CF0A 4FPRA 1M1GA 4OL8A 4KGKA 2Q1LA 4L73A 3QZ8A 5C15A 2O4GA 1LXNA 3W2WB 4JV5K 5I9EB 5ETKA 5GIPA 4F4WA 4I6MA 4M5DA 2MSTA 2ZM6F 4EI2A 4H4OB 3ZZ0A 4FF1A 2HHVA 1N33K 4X64J 2FBTA 4MMOA 2MQQA 4Y65A 2VIHA 2WAQD 4U7BA 2MKCA 1AZSA 2B7BB 2V51B 4LFCK 4NL5A 3ZSWA 2V5HG 3A3PB 1HIYA 5D0GA 3GE1A 3BB5A 4BS2A 2F96A 4JKEA 1GTEA 4DCOB 4YQWA 2CZ4A 4QIWD 3CPWR 1ROFA 1UPMB 2BA9A 4LR7A 3R5AA 3OVAA 3BPDA 3C8YA 3S41A 5H9FJ 1HYSB 2F9WA 4X4RA 1UEKA 3WX4A 2ROGA 5CYMB 5ETNA 3M3ZA 5AQFA 3W2VA 4CZGA 3SBMA 3LDNA 4YR2A 3QAEA 2BANB 3F5TA 2QWLA 1CULA 4NEYA 2BBEA 3RB6A 4FNHA 2M2BA 5EY4A 2WVFA 3IG1B 2V2ZA 3U9DA 4FK2A 2ASDA 2C3MA 2WVDA 3ELHA 2V4JA 2W42A 1NK7A 4B9VA 2YNFA 1SQKA 3KUEA 3HVAA 1H7WA 5CZ2A 3FEXB 1M1HA 4RWXA 1HMVB 3C0BA 1PJ7A 3MDQA 4LF9K 4G6VB 4J9NA 1WEZA 1FXRA 2BYCA 1WACA 1SH3A 5EWGA 2G1DA 3MFHA 3U27A 4IDHA 1RDDA 2W7AA 2PT0A 1KNZA 6FD1A 2W9CA 4NX9A 3O9QA 1CJKB 3V81A 2V52B 1QLNA 2V8GA 2ATLA 2WW8A 4QZVB 2HNDA 2GO9A 4EZ9A 3T41A 1GTHA 4C97A 2OANA 2A6OA 3PTWA 2C22A 3CEDA 5MAOA 2I38A 3T9NA 2A2DA 3D6TB 2B9XA 1NSQA 1PBAA 5HK4A 2VA3A 2MHNA 1HBNB 1B9DA 3THWA 2EWHA 2VASA 4ED1A 1S97A 3IMQJ 3DCAA 4KI4A 5B0CA 2ZVSA 2WVBA 4DUZJ 4E7LA 3D1QA 3MDFA 3G86A 5B0BA 3QSIA 4F26A 1TKDA 2PMHA 5CXTA 4NPOA 2VYPA 2RT3A 2A1BA 1KFSA 1IG9A 4WFAL 4DV3J 4GVLA 3SNNA 1N34J 2NRRA 4I68A 3AOBA 1X4HA 2GJFA 2RQ4A 3P45B 1RP5A 1PYTA 4O55A 2K1RA 4FXVA 4C8KA 4RX6A 4RUCA 1PSDA 5C12A 1IBLJ 3MEGB 4LF8K 3MD3A 3TA2A 4ZLJA 2FLNA 3FCWA 2BXJA 2DR6A 3CJ0A 1XC9A 3D66A 3FLCO 4G1QB 5GAGU 4F8RA 2CNKB 1EWRA 1O1WA 1VQMS 3MCAB 2AGOA 4QS8A 3WXLA 1VQ4S 3FMBA 1KBRA 2BKPA 4HEA9 1RT6A 1MWYA 4M5MA 1CBKA 4O44A 4JHDB 5T41A 2U1AA 2ZF5O 3KJQB 3PLAA 2YHYA 4CEAA 1MW7A 2EG1A 4AYBD 3UKRB 1TMJA 2GJ2A 1G15A 1ZS6A 1Q86T 5ETQA 4GO5X 2NUUG 2IRUA 1KQFB 1NGDA 4YB6A 3VF4A 2HMIB 3CCMS 4KGZB 4ZVSB 1QUVA 3IM8A 3TX8A 1FW6A 1NJXA 3IWLA 3UR0A 1XMQF 3MN6A 3RMDA 1VIXA 3K5OA 4A8WA 1FTCA 2E7WA 1E3MA 3TVYA 5IT0A 3FE1A 4NB4A 1IBCB 2ZC3A 5HMWA 1B3TA 2MLZA 4CHNA 3FGUA 3O80A 4HCCA 2CIMA 1DTTB 3KLEA 1ZAXA 2AZ1A 3MMVA 3ZC4A 3CE8A 4CTAA 4DTMA 5C7PA 4NXNK 5AXMA 4U7CA 4H4KA 4B9NA 1HNXK 2WUSA 3DHXA 4FF2A 5BPNA 3D45A 1AFIA 2LA4A 5KPZA 3GCXP 3EZWA 3PSFA 3F9KA 5IC4B 1BCMA 4B8CA 4AL6A 1XI1A 3T1YJ 5CZVA 2BE9B 1RUSA 1RAHB 3GSDA 4BRCA 3F41A 4TN2A 4GMJB 4LBHA 5DDPC 2W41A 4CYUA 3VETA 1K6YA 4DV2F 2CNLB 3UE5A 3O3LA 3HPOA 3HJVA 2D1CA 3OS0A 3NNAA 1FEEA 1M5HA 4XPCA 5AE2A 4CCHA 2MDAA 3M6WA 3IAM9 4I0WA 1QAJA 1IR1A 4JN4A 3N28A 3KTQA 5KFAA 2PN6A 4QWDA 3KDOA 4V19J 3VAFA 4MO4A 3AA5X 4BDPA 3C65A 1X8DA 3ID6A 5KFSA 3I9V9 4KRFA 2MSSA 4HTJA 2R7XA 3A5LC 2XCPA 1X7VA 5BN9A 5HRRA 4NYOA 3SDEB 4DR1K 5K8NA 4RR5A 3IGVA 1M5PC 1RABB 2DFEA 5AQMA 3PHTA 4CJKA 1IR2A 5TKYA 4JI0K 3LF0A 3ZTQA 2MZ1A 1HNVB 2R7SA 5ETOA 3CTRA 4CNYA 1R0CB 5BPLA 1QM9A 2RQMA 4M7XA 4KPYA 2VPYB 4BROA 3MD1A 3RAMA 4H5NA 1Q4RA 4YB5A 4PPDA 1TL3A 3K5LA 3VHQA 4RW4A 3I82A 3GIIA 2HGNA 5GMDA 4CWBA 3RMCA 3EUNA 2DNLA 1P8ZA 1BE4A 2QT7A 4FVCA 4LR9A 1FX4A 2B9YA 4JLHA 2Q43A 4K59A 3W2WA 2QA4G 3DGPA 4P52A 4Y28C 2I6WA 2PEBA 2XO7A 4QWEA 3ZCMA 3IR6B 4P7TA 3SDEA 3VQSA 1KQKA 2YKMA 3GJTB 4DCPB 4FOEA 2RB7A 3NY0A 1UOCA 1RT6B 3O4NA 2J6SA 3M8PB 3ITHA 3LPTA 1CJUB 4LF1A 4HR2A 5EX3A 3C46A 2O8BB 3OFHA 4GKJK 2JC1A 3ZYYX 5EGYA 3PCOB 2AQ4A 4YORA 3TZXA 2P5GA 1WC1A 1HJOA 1HWKA 1RT2B 2UUTA 2FZGB 3WXKA 3BSNA 5C0YA 3CIZA 4OYXA 2EXUA 1UA1A 1CXQA 1OO0B 1CJTB 3DLJA 3MAAB 1HNWJ 2D3OR 1VSLA 4ATNA 5FRMA 1QE1A 5KRTA 1R0AB 4DR3J 4FL9A 4M95A 3NGRA 3AXMA 3WNFA 3MM8B 3HT3A 2LEAA 2RU9A 3UQSA 4MK9A 1SUQB 1Q53A 2HWHA 1SJRA 2CJXB 3RRKA 2QL9B 4DCJB 2E7VA 3GV7B 3MEKA 3MOZA 1QQCA 4CHOA 2BJDA 1UW4A 4HT5A 4ZVGA 3FZ2A 1JX4A 3O4QA 3OVSA 2XNRA 2CUYA 3OHRA 1AFJA 1YJUA 4RNHA 3OSPA 2VQEJ 1IBKJ 4ZIVA 2GWKA 1WUAA 4MIBA 3V9XA 3EX7B 5MLCV 3TPQA 5AT1B 1RI7A 2CG8A 4K4TA 1ZA2B 4ISFA 5B7WA 4G1PA 4F67A 3N6LA 2XHWA 2MLXA 1U2CA 1S1XB 2MLYA 3L3VA 3QERA 5E84A 3BP8A 1Q8KA 3AQPA 1IWAA 1FFSB 1G1XA 1Y5NB 1WHYA 1KVKA 3IG1A 2OZSA 4IFEA 3HHLC 2G8HA 3QO9A 4UQTA 2E5IA 4OZ5A 3TO8A 1TUYA 4B02A 5KQDA 3OUYA 5KFIA 4N77A 1NZAA 2IVPA 2DT9A 1X9WA 4YR3A 4FDFA 5DQIA 4KH5A 4RWTA 4GO7X 4M8LA 1F5AA 2XULA 1FRLA 1J5EF 3MMAB 4DUYK 2XY8A 1UWAA 4BQZA 4IJAA 1VSIA 2GNKA 4BBYA 2E7XA 3C16B 3ZTPA 2E2OA 1FRIA 4DV6J 2D0OA 1GMWD 3NKYA 2FJXA 3U1NA 1HKBA 4DV7K 4K4ZA 2AKWB 1X4DA 2F4FA 3HRGA 3OR1A 3BUZB 5FLXU 3W8PA 1Z25A 3DMJB 4CD3A 2UUAJ 4JI8F 4KGXB 1JB0C 3NOGA 2E2QA 3KJVB 3ENBA 3IS9B 2CJ9A 3HP9A 3VEXA 4N8OA 1FVQA 2XMWA 2UU9K 2W4PA 4O3QA 2GVZB 3X3UA 4FPIA 3V4MA 2GUPA 1NSAA 1H1VA 4ES1A 3JQKA 1NU0A 2O01C 5FD1A 3VALA 3B8AX 4X2BA 3I0RA 4HDGA 3QJLA 4CHQA 3CDUA 3AD9C 1ZAVA 1RYSA 4AM7A 3BR8A 4I2PA 2XY5A 3CC7N 1Y0HA 1HR0K 5EVZA 4JV1A 1U6ZA 3K0JA 3D0PA 2H65B 3NWRA 1N0UA 4ECZA 2J6UA 2HVHA 1TL4A 2WCXA 4JYAJ 1NJZA 3N79A 3AT1B 4FJXA 5CAAA 1PJ6A 2SXLA 5JVGL 2IY5B 2IS3A 1Z2ZA 3ENAA 1VHIA 3EPIA 3WC0A 3K58A 3QJJA 4B9MA 3O4WA 2W01A 1VQ6N 1T9UA 2QA4S 5J1NA 4C0BA 2FSJA 2GFFA 1D8ZA 3DWLA 2G2ZA 2DHXA 5KFXA 2QKKA 2ZDOA 4JKGB 4JK8A 4AHSA 1ZBTA 1HMVA 3BN7A 3AVFA 3MR6A 1B4SA 2ZKTA 3GTYX 5AXLA 1ZBIA 3C95A 4KFBA 5KFYA 3KNAA 3G9CA 3PW7A 4KB0A 3DYAA 1S57A 1S7HA 3GR0A 1X5OA 4RW9B 1TK0A 5KFWA 5LJVA 2CPYA 2FLOA 1S0VA 2P9PB 1Q95G 2E5LK 1VQ9N 3KWIA 3KUGA 5CABA 2QLBB 2N82B 5EHHA 3TAQA 2X7IA 3TAPA 1A5VA 2CKWA 1J54A 3GV5B 1W7AA 2B4PA 4GVMA 3PM9A 4CK1A 3L95X 3M1FA 1FO1A 2BUNA 1NSPA 1KD1O 1NJWA 4EHTA 5D4PA 3CJKB 4J9RA 1U26A 3H40A 1RAIB 3SBTA 3GIMA 3O9RA 2FUG9 3EVWA 5AQXA 3KYLA 1HI8A 4OZJA 5LMNK 3THXA 1FX2A 1T9XA 3D9BA 4BR9A 3PKYA 1EX8A 1XK8A 1VQ5S 4GV9A 3KLGB 3V9ZA 4A8SA 2G8VA 4FM1A 2ITGA 2FVCA 2JX2A 4EYIB 2OELA 4DTJA 5AQWA 3SK3A 2P9LA 3PNIA 4LH5A 1SXLA 4C0HA 3BKTA 3IFEA 3MXMA 3VF2A 4JKCA 4CLUA 4ECSA 2C3OA 3DLHA 1RDUA 1HL6A 3M1VA 1EQYA 2QA2A 2F7VA 1FDDA 1ZTTA 4TNOA 2MKKA 2CVEA 2CZVC 5AR0A 4BRFA 2ZOMA 3TOQA 1EAYC 4NLSA 2F5GA 1MMNA 2Z57B 3I8DA 3OVNA 2UUCF 4L3NA 4LBIA 1S0OA 3UR3C 1FKAF 3WQTA 4V19S 3QGHA 3J7A1 4FJNA 3T1HJ 4E7JA 4CK2A 1Y3KA 4KGMA 2XYGB 3RMAA 2P8IA 2X1GA 4NLRA 3TU5A 2C42A 3D0IE 4IEIA 5M1PA 1RZMA 1IH7A 1HW9A 3PW5A 5HROB 4ZPAA 4CJ5A 4O3NA 4AQYK 1N8RO 3MMAA 3W9JA 5IQQA 1UVMA 3CDBA 2ASMA 1V3ZA 5BREA 4ZLNA 2DCUB 3C16A 2CG4A 3CXCM 4JKHA 4DTRA 2BJ1A 4YEAA 3SQGA 4USUA 1PGZA 3PIPQ 3GJQB 2RE2A 3CXCR 2VA2A 2FC0A 2ZGYA 1MN7A 5C25A 2WSCC 3A2FA 3NWGA 5F8GA 2HQFA 4K4SA 4KE5A 2DH9A 3A13A 2ZH4A 2HF3A 3ZX0A 2L08A 2QK9A 3M8QA 2DXFA 4LF5K 4JI1K 3D0HE 3MPWA 4ID5A 2YQ3A 5FIIA 4UF4A 3S6EA 4CH7A 5DZ7A 2V67A 2XWXA 4B3OB 2K7KA 4PEOA 3JSMB 2J7WA 1DFDA 3OYEA 2J6TA 4B3RF 1LW2A 1F0XA 4YOEA 2Q36A 3SV4A 2XMTA 1WF0A 4IR1A 3AQOA 2Y8WA 4I6AA 4JRPA 4XIUA 4W5NA 2V8PA 3K89A 4FF3A 3CJBA 3BO3A 2MPUA 1BQNB 2FSKA 3DN9A 3BEXA 3HSTB 5GADP 2I1RA 4R8UB 1FJ7A 1U8SA 1X4GA 4FJ8A 4W5TA 4K7QA 1IKYA 4X4TA 2O8EA 5F8MA 4HVJA 4LF9F 1YJVA 3DLLQ 4RW9A 1ESVA 5AZJA 1G7CB 4OLPA 3MM8A 3U4LA 1HQUA 1RTIA 2DNRA 4G65A 4Y2AA 3BQ2A 2Z2YB 2GIFA 5A8WB 4B17A 4DUYJ 3AGKA 2VFRA 2ZGZA 3VGKA 3CHWA 5KG5A 4EHUA 1B99A 4KAZA 3DRPB 2C2OB 4EU0A 3H46O 3PX4A 4TSXA 2OSQA 5CR4A 1TZ0A 3O2IA 1S9EA 5I42A 3SCJE 4JV2A 4WCEQ 1WF2A 3E9PA 2OFGX 4RUBA 4ES2A 2KRRA 3R2CJ 1R8CA 1XR5A 2E5JA 2XSFA 4KGVB 5GAGP 1W97L 1W2BR 2OPSB 1BUXA 2ZZTA 1X4AA 3SFUA 1CQMA 3UN3A 3FSIA 3E9OA 2VQFJ 3RSEB 5ETTA 2G8UA 3BBCA 3QEIA 1GX6A 3GJSB 3U1MA 3IXQA 1U25A 2PI5A 1Y5LB 2F1FA 1E4FT 2VWJA 4OYWA 3ZFVA 5LJ5Y 3VERA 5A76A 3JXUA 4CLZA 2IIHA 4JAXA 2BR0A 1VQKS 2G1HA 3TWZA 3BZCA 4KO0A 5HANA 5HL7Q 3BY5A 2PAVA 4GKKJ 1FRKA 4EP5A 1J6ZA 4K5RA 1L3UA 4LF4K 2ZE2A 2YPYA 4JV5F 1OJ4A 2ASYA 1CPZA 1D9FA 1VR6A 2R7RA 3UDEA 1ZETA 5F1XA 3DXMB 4IO1A 3U9ZA 3TUPA 5JVHL 5FDLA 4DFJA 3NOCA 1NKBA 3DI6A 3RAQA 3QRPA 5M1KA 2KI2A 1JLFB 2W9BA 2VBWA 4ZKAA 2QWOA 4WFBL 1FNOA 4LF4F 4NLTA 4ZVPB 1K1SA 2EBGA 3CB4A 5AFUH 3HD2A 4ILHA 3OXFA 3CJSA 4WFNL 2PFDA 2XGQA 5IZHA 3O44A 4DV5K 4WZQA 2O8FA 1T3OA 1H73A 4DV4K 5LM7E 4RNMA 2XMVA 1SB6A 2CJYB 1EKRA 2J9DE 4NYPA 2CQDA 3CCUS 4PABA 3JS6A 1NNDA 1IKXA 5D3GA 5AQPA 1FD8A 3FGVA 4URSA 3QDKA 4DUZK 3CJ7A 1RWXB 1PC4A 4ZOSA 2QZ8A 4DR1F 2M4MA 2O8DB 1DQAA 3VPZA 3FQLA 5KG3A 4WP3A 7FD1A 3T6JA 2CQPA 2CQ1A 2EFPA 1S3XA 2P9CA 1PO6A 5IV4A 1FJCA 4XK8C 5EXWA 4DQPA 3BSOA 2LU1A 1RFQA 4Z0UA 1TKXA 4KAIA 4NYFA 5JICA 5ETSA 4F9OA 3MUTP 3OXLA 2OMLA 5DETA 2DCLA 2VOOA 4LFAJ 2P9NA 4B9UA 4DSJA 3LUYA 2IJFA 1VAZA 2FHKA 2BMBA 3FUYA 3EZOA 1EO1A 4DU8A 1RHKB 3G71N 1WSGA 4OKEA 2XB2D 3KD5E 3M9OB 1F21A 2DPNA 2F40A 4P6QA 3L2RA 4AHTA 2Z1JA 4ITSA 5DM7Q 5LL6d 3UNYA 3HSGA 3NF8A 3UKUA 5C2FA 3OY9A 4DR2F 4BRPA 3QJPA 2HKEA 2J9EA 3H5SA 5T7LB 4KRWA 3DAWA 4IRCA 2CQBA 1YIJS 3Q7BA 4YS2A 3LP0B 4DSFA 3V4IA 4CGHA 4OZ0A 4CEBA 4I2QA 1UL3A 5U47A 2K06A 3QEVA 2A1SA 1RADB 1F3FA 2G0IA 2FBXA 2FZKB 2O8FB 1FFGB 2NZ4A 3RUBL 2D74B 3EKUA 3PFEA 4OYZA 3PHEA 1TU0B 4Y2MA 4Y00A 4K8RA 2Y3YA 4DR4K 2FLPA 1WOQA 4FLVA 3ZZPA 2YPZA 4DR7K 2ILZA 1BI4A 4LF6F 4LFCF 2F4VJ 2HURA 5LSOA 4M5HA 1DLOA 4CF2A 4JI1J 5A2QU 4X66F 3WEEB 3SCLE 3HULA 4XPEA 2HF4A 2WZ1A 5ETPA 1HNXJ 1SH0A 3BYPA 4NLDA 3RGIA 5AQIA 4DZDA 3CCJN 3OR2A 5DG7A 3HT0A 4FWPA 4DV6K 3UO0A 2PO4A 1I5OB 1KC8O 2WW4A 5HO4A 3FMWA 1GAOA 1MN9A 1JCFA 4LSNB 4C8NA 3WNEA 4BR7A 1AUSL 3TA1A 1NGBA 3F0NA 4KC5A 3HBTA 1V4SA 4OI0A 1UP1A 4PG7A 2VGNA 1GLEG 3T1HF 2OMOA 1M5VC 1R8HA 4F4KA 3P39A 3MCOA 2J0WA 3O1BA 1QD1A 1IR0A 4R5PA 1LQ9A 4ZVEA 5DQGA 1WB9A 1BQXA 4OZLA 1R7IA 2H54B 1WDDA 4BQLA 2A40A 1NGCA 8AT1B 2Q6BA 1RTZA 2FYXA 2G13A 1VQLS 4CLSA 1REVA 2EC0A 2N3OA 1V6HA 1NMDA 4YMEA 2VKRA 5DGBA 2KXNB 1LW0A 4FJKA 3OSNA 3MCSA 1KWMA 4WTOB 2VPXB 1QAIA 1WHVA 3EL2A 4DDFA 3DDKA 3W60A 4K0KK 2XY7A 3TZWA 4IEEA 4K50A 3HHEA 1CJVB 1M0SA 3NE6A 3MPVA 2CQGA 3O6WA 2WBNA 2ZH8A 4Y0WA 4DG1B 3M05A 3JQJA 2VUGA 4OJRA 4J2BA 1U1PA 2YHAA 4FLTA 2UV8G 1SIWB 4J2AA 2CQ3A 2HRUA 2OHDA 2W2PP 4B08A 1Y10A 3QNNA 4FM0A 1QY7A 1IKVB 1SZ2A 2AJ1A 5FDLB 4G3IA 4NLYA 3SSRA 2BRLA 2RNEA 1Q81T 5E3AA 3W5YA 5E3QA 3KWMA 4HWIA 1BL3A 2JJ4D 4H54A 1AZSB 4LF6J 1IKWB 3D68A 1C1CA 3K8WA 2R7UA 5I3PA 2DY9A 2IDEA 2Y1LB 3BV8A 4MLHA 3UCZP 5KGWA 3JS9A 2W8KA 5IOLA 1FWPA 3H0PA 1WSVA 1M1KO 1GMWA 3M32A 1TYQA 2M70A 3NBPA 1JLQB 4EYHB 1BU6O 1YXQA 1XQIA 2MY7A 3CMAS 4L6V3 1RT1B 4OYPA 2VFTA 4Z4EA 4YFUA 2UZAA 1O51A 4PWDB 5HN0A 1LEOA 1J2VA 2XC9A 2VZ9A 4E1NA 5D4OA 1HR0F 1NZ8A 2WVEA 4N76A 4WYBA 2P5VA 3FVYA 3VEOA 1ZYQA 3V6JA 3CCRN 2Y8YA 1RILA 1NOZA 5A8RB 4QW8A 2WOMB 5IXUA 1OPZA 3DRSA 4BR0A 1LNQA 2ZJRL 4QYZJ 4WTYA 1S6QA 1R8PA 2UU9F 2IM1A 5ADXH 1V9OA 4FWSA 4W90B 4OHXA 2DH8A 3ULHA 4IOCQ 5KFDA 1ZXOA 1RWWB 5D0HA 2CVIA 5IQ6A 5KQ8A 3UD3P 3THVA 2R9LA 3CT9A 1HLWA 3RBDA 1R0AA 2O1PA 1YIJN 3VA0A 1SVDA 2B9WA 1DQ8A 1ZBSA 4CGFA 4ZVRB 5BR8K 4IWVA 3JXOA 1QQOA 2B3TB 3TJ8A 3OFEA 1SQGA 2QYCA 1RBSA 2A3JA 3MURP 1BDGA 4UZCA 1IBMF 1XC3A 4P10A 2L3MA 3GJRB 5F2RA 3Q24A 1SV5B 4XEIA 2AJ0A 1H7XA 4IRKA 3BSAA 4M5IA 2ZZMA 2MKHA 4IJNA 3MM5A 2AGQA 3PEHA 1V4TA 1KLMB 1YITN 1PG5B 1FXLA 2CDRB 1L3VA 3IBWA 3M6XA 1HKGA 2KN4A 3IUCA 4C0OC 2H5JB 5B09A 4QPXA 4IO8A 3AY9A 5CYQB 3PJXA 4L72B 1BY9A 1EETB 3I33A 1S99A 1U1RA 3DRPA 1NB7A 5AQRA 4PWUA 1BHLA 2OKQA 1QTNB 2NUHA 4DR1J 3CO9A 3HYFA 4A8YA 4WYWA 5G0RA 4A4JA 4B9SA 4FVMA 5J2NA 2GS8A 3RR7A 1BLUA 4FF4A 3N01A 2K7JA 3ULEA 1RDWX 2DNKA 5KG1A 1UZHA 5KFJA 3IM9A 2UXDJ 4KH0B 5CD4A 1QUPA 3AVAA 3M2VA 2XBPA 2Z30B 1XNRF 1JLEA 1T05B 2VWBA 4YY3K 5I4MA 5HRSA 1T9VA 2YI1A 4OX7A 3UKRA 4OLAA 1FNXH 2MHEA 3A5OC 3OYMA 2E8AA 5AQKA 4CT8A 2ZFHA 4ZLPA 4PCQA 1J5EJ 3MN9A 3C6UA 4DU1A 3VTIA 1HBUB 1KAZA 4DKWA 4KO0B 3FEZA 1EQ0A 2IGIA 4JUZA 2UVWA 2NXEA 1N6QB 3A5MC 2AF6A 1H0HB 4M5DB 1BA0A 3T1AA 3H1VX 4ICLA 1BGXT 3CFOA 1CQNA 4HACA 2XLJA 3CC7S 3L2WA 4BGAA 2YWFA 1PYOB 1BIZA 5IC6B 1A5WA 3FRZA 2J0QD 2R8HA 4LF6K 4XTTA 3LPUA 3BZQA 4KB7A 2HHSA 2R8GA 2XI2A 2J5AA 1K9MT 1VQ8N 3H45C 1IVZA 4USJC 2ZHOA 3RVCA 4RW8A 4A8MP 3CCLN 5DK5A 1N36K 1D09B 4JK7A 3C19A 4ELUA 1XNQF 1VC5A 1K8AT 2QTDA 3E51A 4DTXA 2Q66A 3VEZA 4FYYB 2HZVA 2BABA 1LV5A 1RBAA 4E2FB 4BRIA 1MWQA 4DV4F 4LVOP 3ZXWA 4L3QA 2XSJA 1ASUA 4BVPA 3FZBA 2XQCA 1QSYA 4FW2A 1HHQA 2KHDA 1K8KB 3VGUA 3PR5B 2FSNA 1EP4B 2GVDB 3SJJA 3IGNA 4K0KJ 5CD4H 1WSJA 2RHKA 1XJWB 4OVLA 4CFCA 1Q8LA 3CC2N 1Q1KA 1TP7A 2EX3A 3CJAA 4F4AA 1UEUA 2XO6A 5E3PA 4ZVUB 2RRAA 2ZE2B 1SJFA 4FPBA 3KFWX 1W0HA 1EZZB 4B3RJ 4A8OA 3A5NC 3QB0A 3R5BA 1OPIA 1J53A 3W0LA 1OWXA 3FZFA 2E29A 2QL5B 2XLIA 1TL1A 3S8SA 5KRSA 5A6WA 1K44A 3JSMA 3VQEA 4JI8K 3HK2A 2F65A 3PZPA 1F9HA 2YKNA 4NYNA 1D3WA 2E4LA 1WC6A 1RKJA 2X6SA 1WBBA 3OYKA 1WSFA 1HKAA 4LRBA 3GZ7A 3J80U 5L39A 4OX6A 3POTA 4ED6A 3SQ1A 2PZSA 2Q3PA 4DJBA 1G3OA 3TTCA 1SI9A 1OY9A 4HTIA 2BE2A 1DURA 2KM8B 4ZTFA 2UXBF 4DR2K 2DFHA 3R9PA 4W5QA 4IOAQ 4I56A 3A12A 4O8UA 3RG6A 1SJ3P 2DBBA 1WOSA 4ZPVR 4ZMMA 1TL7B 4B9LA 4R8UA 5DG9A 5C24A 3EICA 1RAOA 5CQGA 1WG1A 2E6LA 2HS4A 5K14A 2ZQBA 1HQUB 3J81O 3R9LA 5LJ3Y 4WF9Q 1KLMA 1KDNA 5LSRA 1IKVA 2VV5A 2HFVA 2B56A 4R0JA 3TUZC 4HH1A 1N54B 4UY8O 4X62J 5CYQA 4IH5A 4DBQA 3NGSA 1EETA 2Z4PA 5SZTA 3TR8A 1NK9A 5F8NA 3KOAA 3L2UA 2P6TA 1HR0J 5AE1A 1NRKA 5F0UA 1DZ5A 4A2AA 4ECRA 4JV5J 1ZH5A 2HNZB 1CZBA 3DLBA 3EO3A 4DV3F 1OSCA 3HHNB 2NUBA 4CESA 3B82A 4HT7A 3O5TB 5DM6L 3V9UA 4RU9A 3WIVA 1MA9B 1DTQA 3K7RA 4FOIA 4DU3A 2LDYA 4CFAA 4E89A 3EEQA 2IHR1 1Z6RA 3MEEA 3UVJB 3T5LA 1U4BA 5C25B 3VQ7A 2VCPA 1JLAA 1VJQA 4CJUA 4DR3F 2MZTA 2F9JA 4LH4A 3F56A 1F5BA 1GOCA 4G9ZA 2I9SA 2K3KA 3M8PA 3J81j 2MKJA 3D2WA 1D9DA 4PG6A 4HDHA 1X3NA 2Y1JA 3ZZUA 4P75A 4JI3J 1X60A 4GV3A 1AUDA 4JI2J 1UVKA 2AEMA 2F63A 3JSRA 4DV5J 3WQUA 2A41A 2RUGA 2XTJP 3K2PA 2HHTA 1RTDA 2QM1A 4CHYA 1BHNA 2HHHK 1VQ5N 4E1MA 2EK6A 3EN9A 3HL8A 3I0RB 3ILJA 2DTJA 4DL3A 5LJWA 3J81Y 3E9LA 3J7YI 1SBRA 4LJMA 2JVOA 2MMYA 1VDHA 5JJBA 1HRHA 3CD5A 4CO3A 1O0PA 5DQHA 4BC9A 3LP2A 3Q8UA 3ZO7A 3PX6A 3G10A 4HKQA 1C4CA 2N3LA 4CO2A 1HHSA 5IS2A 4ALZA 3MN5A 2CGKA 1N5VA 2VFVA 3G25A 2FD2A 3LDSA 3JSBA 3WEEA 2MTLA 4MKYA 4RG8A 4YB1P 4Y1DA 3MM5B 5HRPA 3NCQA 1RU2A 3FZHA 2CA9A 3HHLA 2XMAA 1S1VB 2LQBA 2ILYA 3D2EB 3P96A 4AXIA 4OX9J 4X65K 2B4OA 4AILC 3B6BA 2QWMA 2RJZA 1JXEA 3U3YA 3QNWB 1H38A 1LAVA 3ILLA 2UUAF 3MPYA 1P6TA 3PDNA 1GLDG 2W4CA 2ASLA 2DFFA 1BUPA 4WE1A 4MK7A 3ZT2A 1B92A 2IAJB 4NCGA 1VBKA 4CM2A 1HWIA 4F2RA 3R1HA 1EKEA 3C3LA 2NSCA 5LY3A 4KTWA 1S4EA 1P1LA 4J9LA 4BWJA 8ATCB 3SQ4A 1HX1A 2E6MA 4GVBA 3FBFA 4ILLA 1I94F 1S6PB 4B1YB 3QT8A 3VQ9A 4ZCLA 3HXMA 3UDLA 4F4XA 4OO1J 3IAS9 3ISND 2VG6A 5IT9O 4CFDA 4IH7A 1T11A 2XHCA 5D0RA 4WK1A 2MYFA 4CH0S 3OTOJ 2H51B 1MSWD 1UAWA 7FDRA 2BEFA 2B0GA 5KG4A 2V63A 1ZPWX 2W8LA 3H98A 4DF8A 1FRHA 2CQCA 2DKOB 2DY1A 3ZEUB 5FPNA 4GVEA 1N88A 3O3FA 3C7NB 1SV5A 1WELA 2C2NA 4NZ0A 4NXNF 2X74A 3DLRA 3ZZTA 1RSCA 2KKZA 1MMDA 2ZD1B 2VG5A 3K59A 4E8UA 1NLVA 4B3MJ 3NMRA 4LFBF 4I2PB 2R7OA 4JI7J 3C15A 3GFHA 1WEYA 2CPHA 5K8MA 5KFNA 1IKXB 5D3GB 2M5YA 3CQYA 2VFSA 2M52A 1CJKA 1RT4B 3NS6A 4ZPCA 3F44A 5D8HB 2ETJA 4NASA 2B6AB 1SQFA 4EZ6A 1YKWA 5THWA 2CQ4A 4K0KF 2ZM6J 2V4JB 5BYRA 5KFTA 1H2UX 3TTDA 2G2YA 1TUVA 4CNZA 3WX8A 4DR7F 1ZZFA 4RO0A 4GW6A 1NEEA 3PYFA 1CZAN 1IWGA 2F8MA 4ZCKA 2ZH7A 2VJVA 2E1RA 1M5OC 3GFZA 1VSDA 3L6QA 2YVSA 3PUFA 1N32K 2AEJA 3EGNA 2JEJA 1YZ7A 1RAAB 1GLAG 2ACYA 4CJEA 3R1XA 5CCMA 4C1NK 5J2QB 3OL7A 1HPZB 4DV7J 1VQ9S 3L09A 3QLHB 3AA2A 3DRSB 2FVPA 1T9TA 1FKOB 5FRNA 1UJ4A 3FKBA 2YNIA 1Q9XA 3GONA 3L0QA 3PW2A 2UUBJ 1JCEA 3OJUA 2HBLA 3RSEA 2NR0A 2R8JA 3O1WA 2N4CA 4USIA 5J2QA 1GMUA 2QMWA 4GMKA 3RB0A 2CNOB 1U02A 2QSWA 1FEHA 2UV8A 5L46A 4DL0C 4AUKA 4RLEA 4CJFA 3GIJA 4JI5F 1KN6A 2QA4N 3NG8A 4PHTX 1DGKN 4KHPK 1HNZJ 4F0HA 5HP1B 4Q44A 1QS4A 2E2NA 3LO3A 1W25A 3ZNJ1 4RWWA 1S1TB 5KG0A 2QL7B 4DL2A 3QBCA 4H4KC 1YWXA 4KBIA 5KI6A 3IRXB 3B8HA 1U09A 3HI0A 4KH4A 1TAUA 2XM3A 3RMBA 2ZM6K 4MJKA 4CJTA 4OQJA 3P3DA 2ZJPQ 2EVZA 4UOHA 3PV8A 5B0AA 3HDSA 1ZOTA 4Z7CA 3CO0P 2NRXA 1RCOB 4ECXA 1KQSM 1R27B 1KVAA 3CG7A 2B6AA 3GL1A 2DEIA 5CCLA 2XCAA 5AXKA 5JS2A 3TA0A 1ZZNA 1N36F 4IRDA 5CZXA 5FJ4A 3P1GA 2LCWA 1T8EA 3ZETA 1FI4A 4J8FA 4DV0K 3V4IB 1J5EK 3AA9A 5F8LA 3CC4N 4L75A 2DHGA 4O4GA 1RWUA 1U0HB 2VICA 2UVRA 2BUPA 5RUBA 2Z8QA 1X4FA 4OKKA 4AHCA 2BW7A 1UCNA 3KNGA 2QJ3A 3G96A 4C8LA 2A1RA 4LIWA 2E9TA 3GIRA 3R6LB 4NEZA 2NLXA 5AJ3K 3DLKA