3DRSA

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
549
structure length
549
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 148
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drsA05
4ZP7A 3M8SA 1C0TB 4CE9A 4B08A 3PZPA 1Q9YA 2D0CA 1LW2B 2HWIA 3RBDA 3GIIA 3FFIA 1LV5A 4BE0A 2FBYA 3DYAB 5J2MB 1NHUA 1RT2B 4B3OA 5L1KA 1X1PA 5KG7A 5KFMA 3OL7A 3QEVA 4MKBA 3SQ4A 4N47A 4ZVEA 4Z4CA 5SWMA 3DLGA 4ZP6A 3DI6A 3V81B 2P1JA 4ICLA 3NFAA 3KHRA 2DY4A 3NAIA 1NHVA 4HUFA 1CXUA 2O5DA 3BGRA 4RUAA 5I42B 2PZSA 3SQ2A 4CGJA 3H5UA 1REVB 3KLEA 4FJ5A 3MEGB 1K6YA 4N5SA 1UOCA 2GC8A 1HJRA 4PQUA 1N48A 3NH2A 4QWEA 4CJPA 4AILC 3CJ4A 3PX0A 4RW7A 4ID1A 3VA3A 4YP3A 1RTJB 4X2BA 4IG0A 4IFVA 1N6QA 4B9TA 3KLFA 4ZMMA 5JS1A 2E9RX 3I0SA 4OGEA 4W5NA 4CESA 4URSA 2YNFB 4CIGA 4EYIB 1A5XA 3RR7A 4BDYA 3KIOA 3RB6A 3DLEA 3V6JA 1ITGA 2HB5A 5J2PB 4WYWA 2OPPB 4W5OA 4TXSA 1SKSA 3UIQA 1XC9A 4FJNA 4NRTA 5J2NA 1WSEA 3GQCA 3NF8A 1TL1A 4IH6A 3Q8PB 3JYTA 3SPZA 1I39A 3ZSYA 3K59A 2V4RA 4BWMA 3G86A 1MMLA 1RTHA 3LAKA 4TQRA 3QGHA 4MFBB 4DTUA 3IRXB 4KO0B 3TAMB 4MKAA 4IBNA 1MU2B 1ZTTA 3AVCA 1ASUA 2ILZA 5HRNA 4KBIA 3C6UB 4DWIA 4E7HA 3EYZA 4O3PA 2IM0A 3C6TA 4F50A 5C25B 2KZMA 1TKDA 1QHTA 2OA8A 2YHBA 4WYLA 2D0BA 3V1RA 3VN5A 2G8KA 3HSTB 4RW9A 3ZCMA 4O3QA 3PW4A 3NKYA 3ZT1A 2G8UA 4TQSA 3IAYA 5D3GA 3OVNA 3TVKA 1RILA 4DTOA 5KFVA 4ECTA 4Q45A 2AX0A 3FQKA 4RW6B 2WOMB 3GIMA 1WSHA 1Z25A 2UVUA 4CJFA 1TL1B 4O3SA 1JLBA 3IGVA 1NK0A 3V6HA 1W9HA 3ICLA 3NH0A 4FW1A 2D5RA 2GIQA 2GIRA 4ECQA 3QIPA 5KTQA 1RT4B 5C5JA 3QIOA 3L2UA 4WXOA 3SFUA 4ID5B 4IQXA 3ZSZA 4K4TA 4J9NA 4Y2AA 4URGA 2B4JA 3NMAA 1T03A 1G15A 1C0UA 3DLHA 3G6VA 2X78A 1HNIB 2FVQA 4DSJA 1I6JA 1CZBA 3DI6B 2IJFA 2BRLA 5KFAA 4RW9B 5EUHA 1FKOA 2JEJA 1K1QA 1RBTA 3QLHA 3RR8A 2HVHA 1S9EB 1QSYA 4J9PA 1HQUA 3CQ8A 3BSOA 3QNNA 4NLYA 3RRHA 1D9FA 2YKNA 1SH2A 1JLAA 2HNZA 3SV4A 4OVLA 5KFBA 1RBSA 4K4VA 3PJXA 5CZ2A 3GV5B 3BQ2A 2HHQA 2OPSA 3AO4A 4G1QB 3NDKA 2BE2A 2AGQA 3BQ1A 4KKOA 3KLHB 1RT6A 2OPRB 4FZYA 3V9UA 3SUNA 5KGXA 1JLCA 3KMSA 3IS9A 4ECXA 1IKXA 4KTQA 3LP2A 2A1RA 4NLTA 1BL3A 2YV0X 2BRKA 3BR9A 2VG6A 4NLRA 1S10A 4J2AA 5KFZA 3OL9A 4B8AB 2VWKA 4F4YA 3KHGA 4CFAA 3QLHB 4MQ3A 4CJEA 4CIFA 3PW7A 4HCBA 3MF5A 4KE5A 4W5TA 3VQEA 3PO4A 1F21A 1CSJA 3ZT2A 3B6PA 5EWEA 4H54A 4IG0B 3I8DA 1S6PA 2ZE2A 1TVRA 3SQ0A 2QKKA 3KLFB 1TAUA 3MEDB 1TL3B 4KV8B 3HVRA 2KFNA 3PO5A 4IDKA 3GIKA 3QGGA 3RMCA 4B8CA 4F2RA 4I9LA 5HBMA 1RT6B 4BE1A 4DL2A 1RA7A 2AQ4A 3N6LA 3D5MA 2R8KA 1JLCB 5J2QA 2R8HA 3OSNA 4DSFA 4AHVA 3EZ5A 1S4FA 2GV9A 1W25A 1RBVA 3LANA 1N5YB 4FLZA 4B9NA 3M9OB 4FYDA 3QETA 3S3NA 2HHXA 4O5BA 3IG1A 4DFJA 3DRRA 2G8WA 5KFUA 1IO2A 4ZVGA 4KHRA 1C1CB 5KRSA 3VQ7A 2HVIA 2CJQA 1RDCA 1EKEA 2IM1A 1ZBIA 5KT3A 3ZSVA 4KO0A 1TKXA 4Z4GA 4ECWA 2R2RA 3DOKA 4FJGA 3L2RA 2JC1A 1S1TA 3RMAA 2IM2A 3OSPA 2EX3A 1RT1A 1JXEA 1GX6A 3KLVA 3AVHA 2FJVA 1TKTB 4WZQA 2UVWA 2OZMA 4FS1A 4FZXC 1QUVA 5KFHA 4N41A 5KFOA 5FRMA 2BQRA 3HPGA 4ZPAA 4NZ0A 5KG0A 1NOYA 5KT6A 3QZ7A 2DTUA 3KLEB 4ZHRA 2PYLA 5F8MA 3NF7A 4Z4FA 2IDOA 3CDEA 3LZIA 2ALZA 1KLMA 4O0JA 1QQCA 3I5BA 2ASJA 2AWZA 3HYFA 4FJJA 3T5HA 3UPFA 4K4WA 1LW0A 4IH5A 3KHHA 1VSMA 4RNMA 3I0SB 3UDLA 3NH1A 1NK8A 5KI6A 4IOBA 4KREA 4LY7A 4Q0BA 1R0AA 5KFGA 4H8KA 2P5OA 1T03B 4E1MA 2WONB 2WRMA 1S1TB 1RDBA 4NLXA 1NJXA 2OPPA 2B6AA 2VG5B 3V4IA 5FRNA 4WFZA 5KFPA 4EBDA 3AO3A 3JSMA 1JLEA 1D1UA 1Q9XA 5DQIA 4BACA 2YHAA 4FLTA 1NJWA 5KFCA 1C0MA 4M94A 3NBPB 5L1JA 1VK0A 3AVBA 2YKNB 3V9SA 1XR5A 2O4IA 5HLFA 1SH0A 5KFYA 4WXWA 2JLEA 4K8XA 1CXQA 1UA0A 4M3XA 2YNHB 1LWFB 3L2QA 4L8RB 2HNDA 1ZYQA 1U04A 3CWJA 3OYBA 3MXJA 2G8FA 3MEEA 1JXLA 2Y1JA 4I2QA 4CJ5A 3VQAA 3OYHA 4AHCA 2C22A 4RU9A 3WNHA 3DLEB 1L3UA 4EO8A 4ED8A 2R8IA 2YNIB 3EY1A 3SUOA 4FVMA 3VA0A 1FXXA 5DLGA 4FJIA 3NAEA 1XHZA 5L1LA 5KFKA 3TAEA 3N6NA 4Y2CA 1LWCA 1KCFA 1IKWA 4KI6A 3AVGA 4DU4A 3VQ9A 1L3SA 3S9HA 3AO5A 3KLIB 2AGOA 1N6QB 1U48A 4ZPDA 1LWEA 2OZSA 3RWUA 4DL5A 4FS2A 5JS2A 4NLDA 4GC7A 3RB4A 3M8QA 1HQEA 4K50A 2HWHA 3NF9A 1DLOA 1VSIA 4LH4A 4YMEA 3LP3A 4FLVA 1IKVA 3CJ3A 4CF8A 4E7JA 3VQQA 2VG5A 4DQIA 3PW2A 4LSNB 1FKPA 2BQ3A 4BDZA 2OPQA 2RF2B 3EZUA 3H5XA 1SUQA 5L9XA 2P51A 3BJYA 4C8NA 4DSKA 2IOCA 1SV5B 1WAJA 2R7YA 1SKWA 5KG5A 3KHLA 4E7LA 1VSJA 1L3TA 3MR3A 4HUEA 3TAFA 1DTTA 4DF4A 3V1QA 5F8HA 3TI0A 2ATQA 1HMVB 5KG1A 5KFDA 3FDSA 3OY9A 4ZPBA 2QK9A 4NLPA 2KW4A 3FQLA 1YVFA 4CJWA 2RKIB 5HP1B 2D3ZA 1WNEA 1LAWA 3B6OA 4DS5A 4IRCA 3AA4A 4LH5A 3ZSWA 2HHTA 3LP1B 5C24A 4DEZA 1VRUA 3TAPA 5EWGA 2W9AA 3DOLA 1HYVA 3SI6A 3DDKA 3C95A 5J2PA 3CVKA 3KK3B 1SH3A 1GX5A 4DQSA 3RAXA 4N56A 2F8TA 2HHSA 1U09A 2VG6B 4CK2A 3LZJA 2ETJA 4O44B 1T05A 1ZETA 4CK1A 1LW2A 4JS5A 4K8ZA 4FM0A 3V9ZA 4O55A 4F3OA 4I7FA 1ZBUA 4F4ZA 4DG1B 4IR1A 4O4GA 2RDJA 4IG3A 2Z1HA 5HLFB 2ZQBA 5DGAA 4ID5A 1JL2A 2XY6A 2EC0A 3TAQA 2BDPA 4J9LA 4NRUA 3K58A 1YTAA 5KG4A 3K5OA 3ITHA 3QESA 1S49A 4N76A 2W8KA 1EX4A 1S1WB 1C1BB 4KFBB 2FC0A 2YNIA 1WLJA 4HCCA 4B9MA 4Q8EA 2QE5A 3ZT4A 1T8EA 1YTUA 4JUZA 3P1GA 5DG8A 1D9DA 1FK9B 3ZSRA 4KB0A 4NCAA 1WSFA 4LQ9A 1TV6A 3FFIB 1IM4A 1A5WA 4E7IA 4RW4A 1B9DA 4NYFA 5KG2A 3AVJA 3V6DB 1RT3B 4M3UA 4FK2A 5KRTA 4CCHA 2I5JA 2E9TA 4WE1A 1JIHA 1Z4UA 2Z1IA 4TN2A 1J54A 4W5QA 3NHGA 3MECB 3LP0B 4B9SA 2HNDB 1IH7A 3AVAA 1TKZB 3AVIA 1S6QA 1JLQA 3M9MB 4HYKA 4K4ZA 3MXMA 4QPXA 4DLEA 4M3YA 2B5JB 3OL6A 2FBVA 2BR0A 4PUOB 4CHZA 4HVJA 3LWLA 1KVAA 4KFBA 2X6NA 4ZTFA 4F4KA 5DLFA 3L8BA 3JYTB 3O4NA 4NLQA 1BIUA 1O1WA 3PW0A 3PX6A 1NJYA 3VQ4A 1NK7A 1D5AA 4FW2A 5J1EB 4F4WA 3KK2B 5L1IA 1IKWB 3Q8SB 3CFPA 1TV6B 2I1RA 4ED7A 4OLBA 4QWDA 2E6LA 4ZP8A 4O3RA 4E89A 4KAIA 5C25A 2OYQA 4B3OB 3O4QA 4ED0A 2G8HA 4U7CA 3ZSOA 1S0NA 3KKSA 3OJSA 2UVVA 1HARA 2C28A 1TK8A 3HP9A 4FBTA 1QTMA 2LSNA 3KJVB 1VRTA 4JLHA 3M8PA 3AVFA 4OPJA 5KFEA 3KLGA 1UWBA 4PA1A 3MR5A 4ECSA 1BI4B 4Y3CA 2J6UA 4HTUA 4QAGA 3DMJA 5KT4A 2RDIA 2XI3A 1KVCA 3KD5E 3DLRA 2AJQA 4CJ3A 4DFMA 4FZZA 3V1OA 1WAFA 4EBCA 3NCIA 4KHQA 3DLBA 2R8JA 3E01A 3CIZA 3SPYA 1RTDB 1S1XB 4AH9A 1BHLA 1RTJA 4ECYA 1S0MA 2XY5A 3D0PA 4ED2A 4CHYA 4YQWA 2AGPA 3OYEA 4CEQA 2WK4A 4CF9A 4O3OA 1QSLA 3SI8A 4RG8A 3H98A 4EEYA 1DTQB 2FBXA 4F4XA 5HBMB 2V4QA 3IS9B 5KFIA 2BANB 4F8RA 4B9LA 4M3ZA 3HPOA 2ASDA 1S97A 3MEGA 4R5PA 3PW5A 2HHWA 1RT7A 4DTSA 3O3GA 2EHGA 3Q8QB 1KHWA 1LAVA 1KLMB 2FLLA 1RDRA 1NK6A 4Y1DA 4IFYB 4FM1A 4WFYA 2FBTA 4CGHA 4RZRA 3MR6A 1XI1A 2D3UA 2XGPA 4AHSA 3MXIA 1JLGB 1YT3A 4O4GB 1U47A 1JL1A 4FLXA 4H4OA 4CJSA 3EPIA 2VWJA 2KZZA 1BIZA 5DGBA 3V6KA 3CJ5A 3MEEB 3OYMA 1YVUA 1T3NA 4CHQA 3FRZA 4IRKA 4BWJA 2HAIA 3BDPA 4NLOA 3BSNA 3KNAA 3T19A 4NLGA 3AA3A 4O3NA 2DPJA 4ZHRB 3WNEA 3NE6A 3CFRA 2W7PA 3S3MA 4C8LA 3TQ1A 4M42A 1RYSA 4KHUA 3P5JA 4ED6A 4G1QA 1LWFA 2HNYB 4OKJA 1TVRB 5C42A 3TANA 1ASVA 4EZ9A 4ZP9A 4I9QA 1X9MA 3M8RA 3QIDA 4FK4A 1KLNA 5DG7A 2QKBA 2G8VA 4CF2A 3AO1A 4CEOA 3HP6A 1VSKA 2BANA 3GIJA 2B43A 2PY5A 1FKOB 5J2QB 3TARA 3VQPA 4ICLB 3SJJA 5KFSA 1VSLA 4CGFA 3AO2A 4K4XA 3QEPA 4RNHA 4J2DA 3LAMA 3H4BA 1RT5B 3T1AA 4TY8A 4GC6A 2D7SA 2W8LA 5EU7A 2UUTA 3KLIA 2RPIA 2XY7A 1J9AA 4EZ6A 4Y1CA 1LWEB 3HM9A 3IGNA 3NGZA 3GYNA 1C1AA 4CJLA 4DS4A 4CFBA 3ULDA 1KFDA 2ZD1B 4KTWA 4CJRA 4KKOB 3DM2A 1TKXB 3RB0A 4FK0A 4KTZA 4Z4HA 1EP4A 5K14B 3U3YA 3LWMA 3MFHA 4RNOA 1JX4A 1S48A 2XY8A 1ZTWA 4MIBA 1RTIA 4JV1A 4K4YA 4KHSA 4UQGA 2J6TA 1WSGA 4CEEA 1ZBHA 5DK5A 3DOLB 2IAJA 3G6XA 3RMDA 1C1BA 5I42A 3QEIA 2Q3SA 5CY4A 1ZBLA 3ALYA 1U49A 1T94A 1C0TA 2FLNA 4IRDA 1UWBB 3U6FA 1JKHA 1RTHB 1BCOA 3ZT0A 4O44A 2IA6A 3G10A 4M95A 5KFLA 4CK3A 4TY8B 1TK0A 4TSXA 5F8GA 4I7FB 1RT2A 4MFBA 1RTDA 4CJUA 4MK7A 5CYMB 1NKEA 4KHNA 1S9GB 4DU1A 2W42A 3DRSB 4ZPCA 3HL8A 4IDKB 4CJVA 2XHBA 1BQNA 1NJZA 3OYAA 1N5YA 3RB3A 3LPUA 4E19A 2FJXA 4Q44A 1J53A 3I5AA 3IG1B 4CEDA 5HRPA 5F9NA 1WSJA 4O0IA 5FDLB 4CFCA 3CM5A 1BCMA 1S0OA 1HPZB 1GOCA 4R8UA 3WNFA 5EWFA 3AVMA 2QXFA 4YR3A 5J2MA 1GOAA 4RW7B 5CYQA 2BQUA 3TAMA 4Z4IA 3KK1A 3G0ZA 3ASMA 3OYLA 4C8MA 4QWAA 4LQ3A 4DTXA 1S6PB 3OYJA 2ATLA 4WFXA 5CZ1A 4NLSA 1RTIB 1D8YA 2Y1IA 3MAQA 2C2RA 3OLBA 2R2TA 1DLOB 3OS2A 2DFEA 4CJ4A 4EO6A 4DSLA 4NLUA 4CHNA 2IC3B 2B6AB 3V4IB 4F3TA 4LSLB 4YR2A 4W5RA 3DRPA 3K5NA 1SUQB 4DSEA 1KVBA 5KFTA 3QNOA 2XCPA 3UQSA 1KTQA 3L2VA 4H4MB 1NK9A 2FVPA 1HNVB 4IH7A 2JEIA 2WTFA 3N6MA 4TYBA 4J9MA 2R2SA 1C0UB 1C2PA 1S1VA 4NYZA 1IKXB 2PYJA 4J9RA 2NUBA 2F8SA 3LP0A 1HYSA 4K4SA 4ECVA 3K57A 1SL2A 4QW8A 3HPHA 4JS4A 2V0NA 1J5OB 3NF6A 2B5JA 4Q0BB 1N4LA 2IAJB 5SZTA 4BDPA 1C6VA 1XR6A 3ZSQA 4PWDB 4CFDA 3VQCA 3NGYA 3DLKA 5HRSA 2KTQA 1VSEA 1HYZA 4TLRA 4C8KA 3VQSA 2D41A 3DRPB 3JSMB 2XC9A 4CF0A 1I3AA 5FROA 4MK8A 4IFYA 4NCGB 3T3FA 4WZMA 1SL0A 2JC0A 4Z0UA 4F2SA 4LD0A 3QIPB 1RT4A 2HHVA 4FBUA 4M45A 4IG3B 2WHOA 1X9WA 2ZD1A 3TWHA 3BQ0A 4AHTA 4FLUA 3C6UA 3KD1E 5K14A 4FLWA 3H5SA 3MECA 1L3VA 3ISND 1JLFB 1S6QB 1ZBFA 3GV7B 2GBZA 3VQ6A 3OJUA 4FM2A 4ED3A 1S5JA 3O3FA 5J2NB 4QWCA 3PR4A 1WN7A 3DMJB 2ZKUA 4FJ7A 4DL7A 3HO1A 2XGQA 2OH2A 3AVLA 2FJWA 2WCXA 1C1CA 1EXQA 4TY9A 1RT7B 3K5LA 3E01B 1FK9A 3D28A 4Q43A 4JRQA 5J1EA 5CYQB 2Z1GA 2UUWA 3TAGA 4O4RA 1QS4A 1Z26A 2HW3A 2HMIB 1TK5A 5DMRA 4ZVFA 3SNNA 3PJWA 3SFGA 2ITGA 1RT1B 4KHYA 3OYFA 3KOAA 1KHVA 1OS5A 4ZVHA 4XO0A 5KGWA 4DTPA 4M3TA 3H5YA 3CO9A 1HNIA 1NKBA 3CYMA 3CFOA 3CG7A 4E3SA 1SKRA 4OJRA 3RAQA 3OYNA 5KT2A 3PR5B 3SZ2A 4DL4A 1ASWA 1JLAB 1KRPA 1BGXT 3GV8B 1SV5A 4NLVA 1JLBB 4DTNA 4B9UA 2X74A 2OPSB 1HQUB 3QERA 3HVTB 4RW8B 1HPZA 3V9WA 2V9WA 3HKWA 3U3GA 2YNFA 4ECRA 1XWLA 3V6DA 1DTTB 4YFUA 2A1SA 4CIEA 1NOZA 3I5CA 1D0EA 1NKCA 4WE1B 3RRGA 4NCBA 4DQPA 1R0AB 3CJ2A 1RCHA 4ELTA 3PVXA 2DFFA 4FJ8A 5C42B 5EDWA 3SV3A 3WNGA 3AVNA 3K5MA 3F73A 1RNHA 2KFZA 4GW6A 1VRUB 4LSNA 4CHPA 1L5UA 3VQBA 1CZ9A 3I0RA 1TAQA 4FJMA 5D3GB 1T7PA 1SL1A 4XPEA 3KK3A 4CGGA 1S1UA 3QO9B 4KPYA 3HJFA 3ZT3A 3M9NB 3M8PB 5KG6A 4OL8A 4ECUA 3VQ8A 1RT5A 2E4LA 2G8IA 3OS1A 4Q5VA 1JKHB 3L3UA 3IRXA 4B9VA 1NK4A 1EETB 4E7KA 5T7BA 1RDDA 3RTVA 2HNYA 4RW8A 4ECZA 3OLAA 1HRHA 1TL3A 4KV8A 4QWBA 3OHAA 2VG7A 3AVKA 4KHMA 4I2PB 4CGDA 3H08A 3RMBA 2VA3A 3HHKA 2WONA 1IKVB 3CJ0A 1N56A 2YKMA 3OYIA 3C94A 4JV2A 3ZSXA 1VRTB 2XRIA 1Q8IA 1KSPA 2OPQB 2RF2A 5KFNA 2WOMA 1S9FA 4PUOA 4AHRA 4PWDA 4FCYA 4HKQA 4CEZA 1WSIA 4DQRA 4MK9A 3V9XA 4DLGA 1XHXA 3T5JA 2W9BB 1MU2A 4OKKA 3SQ1A 1IG9A 3DOKB 2R8GA 4NCGA 2C2EA 3PUFA 2JGUA 1UAXA 5HRRA 4FJLA 4KHWA 1U45A 5DQHA 2VG7B 3ITHB 5F8JA 1VSFA 2UVRA 4IKFA 2W7OA 1TGOA 4E1NA 1WNSA 1S9GA 2C2DA 2CKWA 5KT5A 4C8OA 2VA2A 3KLGB 4LSLA 3D45A 4XPCA 1EETA 3VQDA 2AU0A 2XWYA 3G6YA 2BE2B 3PX4A 2BGGA 4FJXA 5KG3A 4EP4A 4DL6A 4J9SA 4DSIA 2E9ZA 5F8IA 1IKYB 2W9BA 1HMVA 1X9SA 3KTQA 5KFJA 3UR0A 5HROB 4DL3A 5F8NA 1S1VB 4DTMA 1B9FA 3CDUA 3HK2A 2XO7A 3I0RB 3PY8A 4G3IA 3S3OA 4QW9A 3PV8A 2JEFA 4CF1A 3HVWA 1UA1A 2D0AA 3Q8RB 3KKRA 4DG1A 1BI4A 4J9KA 1GOBA 2FVSA 1JLEB 3HVAA 1S1XA 4IR9A 5F9LA 4KB7A 5DG9A 1W0HA 5KFQA 4MH8A 1RBRA 2QV6A 2ZE2B 4OPKA 4HUGA 1RBUA 4M3WA 3L2WA 4YR0A 4FJKA 1TP7A 3C6TB 1Y97A 3QGIA 4ELVA 3KMQA 4QOZB 1JXBA 3QYYA 3GILA 3F9KA 4J2BA 2I5JB 4EP5A 3LALA 1QSSA 1CLQA 3CDWA 4J2EA 3OHBA 1QAIA 2YKMB 5KT7A 4CJKA 1HYSB 4OKEA 2IC3A 2GUIA 3BSCA 4Q8FA 2AX1A 1FKPB 4ZTJA 1K1SA 2IJNA 5JXSA 4BE2A 2DFHA 5KFXA 3MFIA 5FDLA 1BQMA 3LDSA 3QEWA 4J9OA 3DLKB 4KI4A 3DYAA 3AA5X 3NBPA 4M3RA 2E6MA 5I3UA 3THVA 5KFFA 4RUCA 3H59A 1JLGA 4DFKA 3SYZA 4ED1A 4CGIA 4XIUA 4M41A 1EP4B 2JEGA 4Z4EA 3P83D 4DQQA 3LPTA 3MEDA 4CHOA 3DLGB 3AV9A 3QEXA 4RNFA 3MTKA 3KLHA 2XCAA 4CEFA 5E41A 3CM6A 1QE1A 4I2PA 5DQGA 4DF8A 3BGRB 3LP2B 2J6SA 2IBKA 1TKZA 1JLQB 2KQ2A 2O4GA 3SCXA 1TQLA 4Y34A 4RW6A 2IMWP 4K4UA 2HHUA 4GMJB 3DRRB 3KK2A 3QZ8A 4IFVB 4KRFA 3SUPA 3T5KA 4FJ9A 2FVCA 1VSHA 2IGIA 4JV0A 4R8UB 3OYDA 2YNGA 4URQU 4JRPA 3OYKA 1RYRA 1NK5A 2RN2A 3E51A 3VQ5A 4E0DA 3M8QB 2OPRA 5F8LA 3EPGA 5C24B 1IKYA 3HT3A 2YNHA 5CYMA 5JUMA 4EBEA 2HMIA 5HROA 3NL0A 4R0EA 3K2PA 2F96A 4AHUA 3HXMA 3DRSA 3ISNC 3V81A 2W9CB 4CECA 3KJVA 4HHTA 1TKTA 1DTQA 4YNQA 3BREA 1QE1B 2Z1JA 4EYHB 3BSAA 3FSIA 1XR7A 4DTRA 4CEBA 4CJQA 1S9EA 4IKAA 4DMNA 1S1UB 3QO9A 4GVMA 1QAJA 4PQUB 4OGCA 4DU3A 3H2LA 5I3UB 2HNZB 2R2UA 4FXDA 4FJHA 1U4BA 3TABA 2IM3A 1B92A 4CJTA 4CEAA 3KK1B 3PHEA 2F8EX 4J9QA 4PY5A 4I2QB 1BISA 4NLWA 3LP1A 4KSEB 1S1WA 3SUQA 3OL8A 2WB4A 4DFPA 2FLPA 2X6SA 3H4DA 4ELUA 3IN5A 1NNDA 2ASLA 3OYGA 1RDAA 1BQNB 3TR8A 4NYNA 4R5PB 3NAHA 1KFSA 3NGIA 1RAJA 4OLAA 1LWCB 1T05B 3T5LA 2FVRA 1BQMB 1A5VA 4CERA 2YNGB 3HVTA 5KFWA 4U6PA 3AA2A 1RA6A 1VSDA 4H4MA 2P5GA 4KAZA 4TYAA 1HQEB 1HNVA 4QCLA 5KFRA 3QINA 3DM2B 4KB1A 4RNNA 2IS3A 4RW4B 2XI2A 5T14A 1LW0B 3OS0A 3OYCA 2RKIA 5HP1A 2W9CA 3RBEA 1RT3A 3MR2A 3A2FA 4H4OB 3H40A 4FLYA 1J5OA 2DPIA 4DTJA 3L3VA 4MIAA 1REVA 2ILYA 3NGDA 1JLFA 3O3HA
chains in the Genus database with same CATH superfamily
2RQ4A 4ZP7A 3M8SA 4CE9A 1NH7A 1XBWA 3OFEA 1UTAA 2D0CA 5DO2A 3GIIA 3GG4A 4O8KA 1HKCA 1LV5A 2CJ9A 2PDAA 2FBYA 3DYAB 2MKSA 5J2MB 3CJBA 4JBCA 4B3OA 2VV5A 1PO6A 4XH5A 4F02A 2Y1RI 2J5AA 5KFMA 5IZHA 4BR7A 5CH7B 1SVDA 3DWLA 1ZXOA 5H9EJ 3DLGA 2OD6A 2XNQA 4USHA 4ICLA 2OEJA 2QLJB 4HUFA 1CXUA 2W41A 1YJUA 4DR7K 1ZAXA 3DLLL 3C0BA 4FNIA 1CULB 1TL4A 3BGLA 1U2RA 3GWCA 2DEIA 3MEGB 2MZSA 2GC8A 5ITHA 1JCGA 3NH2A 2HF3A 3AAPA 4CJPA 3PX0A 4ID1A 4YP3A 1IBMK 4B9TA 4ZMMA 1NDKA 5E26A 4MLEA 2CQDA 3PACA 4CESA 3ZX0A 2YNFB 4A8YA 2DRBA 1A5XA 3K2YA 4NLBA 3RR7A 2EBGA 2F4VJ 2DR6A 3MM7B 3KIOA 2M8HA 3V6JA 4JB8B 1U6BA 2SXLA 2OPPB 3NMUA 4TXSA 4OMFG 4CH0S 3U8XA 4IOAQ 2HS3A 5JMNA 2GQCA 3CPWR 3H2VE 5DDQC 3A8JA 1Q8KA 1U8WA 2WVBA 2J0WA 3JYTA 3OTEA 5CCMA 3ZSYA 1KKHA 2JZ5A 1W26A 1Q7YT 2O8BA 2A1BA 2CPIA 3FBCA 1RTHA 3TEHB 4KO0B 4MKAA 4IBNA 5FLXY 1HNXJ 1MU2B 2ILZA 2FDNA 3K17A 4DWIA 4JI6F 4E7HA 4PXEA 2IM0A 1ESVA 3E3XA 2CJAA 1TKDA 2OA8A 2B9YA 5GAEU 3BO2A 3VN5A 2CZVC 3HSTB 4RW9A 1UPPA 1LK7A 4YHHF 3NKYA 3ZT1A 2KRBA 3C7NB 4EFHA 3Q7BA 4ECTA 1HL6A 3DXBA 4Q45A 4DI6A 3AARA 3KDOA 3F0NA 2WOMB 3GIMA 1WSHA 1U7LA 4CJFA 1TL1B 5A0YA 3IGVA 2VYPA 2UUCJ 1NK0A 2VZ9A 5IXUA 4FW1A 5BR9A 5ELZA 4AXIA 2GIRA 4ECQA 5DDOC 5C5JA 3IR6B 3FVYA 1KQSM 1N5TA 4J9NA 1Y7PA 2B4JA 3NMAA 1T03A 2P9UB 3UB5A 1Q7LB 2J0XA 4USWA 3W5YA 1E3MA 1I6JA 2MXYA 1X4EA 4DKWA 4OJ1A 4F04B 3ZYYX 2YVSA 4GV3A 1GFWB 3J80U 5KFAA 4RW9B 2J76E 4AL7A 1EIYB 2H4YB 1GK8A 3CQ8A 2O3DA 1K44A 2KO1A 2M7SA 2HQDA 1JLAA 2QA4G 4K4VA 3PJXA 4W90B 3AO4A 4G1QB 3CCVN 3IWNC 2AGQA 5JVHQ 4PZVA 4I6AA 4BS2A 2W4CA 5KGXA 2HHHJ 1JLCA 3O3LA 3DLLQ 2LMIA 1GXLA 4KTQA 2B4VA 3HOSA 2MKIA 1BL3A 2BRKA 1ZAVA 3TA1A 4MLHA 3BO3A 2FGCA 4J2AA 3OL9A 3ZTOA 4QIEA 5B8HA 2R7QA 4B8AB 3DRXA 2VWKA 4CFAA 3M6WA 2ASMA 2JWKA 3PW7A 2F9JA 4DV7K 2Y0BB 5FLXU 2ZM6K 3PO4A 2HBKA 4NXNJ 4WKYA 3U7JA 1TVRA 2E88A 4U67L 3BR8A 5AQFA 3J7YI 4WIIA 1HWIA 4B3TK 3VEXA 4B8CA 2O1PA 1OO0B 4I67A 5DS7A 4A46A 4DL2A 1VYAA 1U1OA 1UKUA 5GADU 2R8KA 1JLCB 2HQCA 5M1KA 4X62K 2P9SA 1RBVA 1VLOA 1N5YB 1G7CB 3B8HA 4B9NA 2VC1A 3M9OB 2DHXA 2NCKL 3GYGA 2OP5A 4NA2A 2HPUA 2E2NA 1RQ0A 5AT1B 2GS8A 1VS3A 4FWQA 1JJHA 4OYIA 3W60A 5KRSA 5EXWA 3J7A1 2CJQA 1RDCA 5AQUA 4F4AA 2Q0UA 2G4BA 1TKXA 3NG8A 4PWUA 1IBMJ 2JC1A 4J7CA 2ASPA 4JI3J 3OSPA 2EX3A 1JXEA 1U25A 4DPWA 1TKTB 4WZQA 5LSRA 3SAGA 1WACA 3AJ2A 5KFHA 5KFOA 2BQRA 2GFFA 6FD1A 5KG0A 3EGVA 2ZDPA 1Y5LB 3AJDA 3HBTA 3N4WA 4PQAA 1UPMB 3NF7A 4Z4FA 1QQCA 3I5BA 4EMDA 1EWQA 1LQ9A 3R8EA 1V3RA 1UCNA 3MX5A 3WEEB 3LA0A 3KHHA 4RNMA 3I0SB 3VF2A 1Z2ZA 2QYGA 2QA4N 2Z2ZA 4LY7A 3BKTA 4Q0BA 4M5LA 1Y3KA 5KFGA 3ZETA 1RE1B 2PMZD 2WRMA 2KM8B 1S1TB 4OIXA 4NLXA 3W2VA 4BREA 3V4IA 2VG5B 5KFPA 5LOQA 4OPAA 2BJ1A 5A8RB 5DDPC 2MKJA 5M2RA 2C2KB 2IJRA 4A61A 4BACA 5B0BA 4YDUC 4FLTA 4ZCIA 1NJWA 4YY3J 5KFCA 1C0MA 2KT2A 1VK0A 1AFIA 2CQ3A 2JLEA 2RHKA 4K8XA 1CXQA 1UA0A 3KDNA 3D67A 2NZTA 2NLXA 1YRUA 2HBJA 2HNDA 5DM7Q 3CWJA 4XH4A 3MEEA 2Y1JA 1JXLA 3IA0A 2HSTA 3VQAA 3OYHA 4AHCA 2UYTA 3HOTA 2V8HA 4NO7A 4FVMA 1RU1A 1WC4A 5H9FJ 1NJIT 2D69A 4CLPA 3JSBA 4DU4A 2VHGA 3AO5A 2AGOA 2YBVA 3T1YK 2KT5A 1IBKK 3RWUA 4DL5A 3VAFA 1VQSA 1BU6O 3BF3A 4NLDA 5ETRA 3RB4A 2CPDA 3QFPA 1HQEA 2YQ3A 1DFDA 2WFBA 2HWHA 2RU3A 2Z2MA 2HLTA 3LP3A 3HSZA 2VFUA 1FD8A 2XS2A 3Q8VA 4OZLA 2VG5A 3CCSS 1X5SA 3PW2A 3QJLA 1PGZA 4LSNB 3UVJB 2RF2B 3EZUA 4OYBA 4X62J 5L9XA 2P51A 3R3LA 4C48A 1SV5B 4U96A 4E7LA 3L6QA 4NYOA 1DAXA 4IFEA 4UY8T 1F2HA 5AZJB 4FKXA 3TAFA 4DF4A 1KQGB 4AE5A 3V1QA 3TSQA 2MSTA 2FZKB 5KFDA 1U6ZA 3FDSA 4ZPBA 3MMCB 4BC5A 2R7VA 3CJ8A 5C2FA 2D3ZA 4UZBA 4EHUA 1OH8A 2V9KA 4IRCA 1QLNA 4K59A 5AZIB 2W9AA 2M2BA 3C3LA 1FDNA 5J2PA 2RH3A 3CVKA 4C4WA 1SH3A 3R5JB 4QQBA 4FWOA 4JI2K 3J81j 2F8TA 4CK2A 2JVRA 1X4CA 1LOTB 2KJWA 4O44B 1T05A 3I8BA 2HHHK 4B3SJ 1OH6A 5B09A 3CCVS 4I7FA 4F4ZA 3BKUA 2RDJA 2CAJA 2ZQBA 2D74B 5D4PA 2EC0A 1MA9B 4J9LA 2YJEA 1YTAA 1NMDA 2P9PB 5KG4A 3OR1B 2O8CA 4NWBA 4GKJK 1QHAA 3QESA 3CJSA 4PG7A 2R4FA 1KD1T 4HEA9 4HI1A 4BLGA 4EI2A 1HWKA 2W8KA 1CG2A 4K0KJ 1VIOA 3VTHA 2A0FB 2AD9A 2J8AA 3W8GA 4Q8EA 2QE5A 5EN1A 3ZT4A 4YOTA 5AQJA 1YTUA 4JUZA 4DR5F 5DG8A 1X8DA 1RAEB 1WG1A 4NCAA 1G4CA 2JX2A 2YY3A 1B9DA 4ZA1A 2GJ2A 3EGZA 3V6DB 4H0YB 3AQPA 5F41A 4YOYA 2KKHA 2EFPA 3HI0A 3D54A 2HNDB 5D77A 1R0CB 4OYPA 1JLQA 3FEZA 5JVGQ 3CQXA 4K5RA 3P45B 3I9V9 2BR0A 3DGPA 4XEIA 3LWLA 1KVAA 4KFBA 1R8BA 4ZTFA 3SEOA 3AD8C 2N7YA 2ZJRL 4UUWA 1NJYA 3Q83A 1CJTB 5J1EB 4F4WA 2BW7A 5GAGP 4JKFA 3Q8SB 3PEHA 3W9JA 2ZWHA 1J6ZA 4KAIA 2DO4A 1MROB 3Q89A 1UVNA 3C14B 5IQQA 3ZSOA 4PG6A 1S0NA 4AD6A 5SUHA 5F1XA 4FBTA 5KPTA 3QT5A 2KL8A 3HFKA 3M8PA 3AVFA 1PJ7A 3BDEA 4OPJA 5KFEA 1K8AT 3IWLA 1P1LA 4ZN1A 4HTUA 3DMJA 2RDIA 2K06A 4FN5A 4CJ3A 2JOQA 4FZZA 1C4AA 3V1OA 1R8PA 2F40A 5A6WA 1WAFA 3DCAA 3L7OA 4FYVB 4DPTA 5M1QA 3PSIA 3NCIA 1UFKA 3E01A 4OI0A 1WBDA 1NMNA 3O9SA 1BHLA 4BVOA 2ZJQL 3MDFA 4FO0A 2CIMA 3J81U 1DJ0A 4H0PA 1GEHA 3OYEA 3WEEA 5AQOA 2V4JA 3VZIA 2IDLA 1N34J 3H98A 1IR2A 5C15A 1FD2A 3IS9B 5KFIA 3VV2B 3MAAB 3OXGA 4AL5A 4PL7A 4DR2J 2RJZA 4GKJJ 5K9FA 1Z1ZA 2VIHA 2ASDA 3MEGA 3PW5A 4GMKA 3EN9A 2EHGA 1KHWA 3IM9A 3EWGA 2FLLA 4IFYB 4HTJA 4RZRA 3ZNUA 1KNZA 4QJVA 2QN6B 4OZ0A 4AHSA 3MXIA 5BXIA 3JAMU 1Q81T 2R3VA 1VDHA 4IEEA 2YTCA 3N4QA 1YGYA 4WQ4A 1BIZA 1FJCA 4M63C 3CJ5A 3OYMA 2H48B 1YVUA 1T3NA 3W62A 1EWRA 5FJ4A 3UKUB 4A2AA 1UW4A 4PKHA 4FWMA 1CVJA 4J37A 3GU0A 5D4LA 4OZNA 2VASA 2H4WB 2MKYA 3G71N 3CFRA 3EGNA 2CNNB 2DXFA 2W7PA 3HHDA 1NBEB 1P90A 4G1QA 3FFKB 2HNYB 1TVRB 1FRLA 2HIYA 2H65B 4ZP9A 4EZ9A 4I9QA 1X9MA 3QIDA 4FK4A 3CERA 2XMKA 2X1GA 4FPIA 4G1PA 3AO1A 4BCAA 4CEOA 1VSKA 1BA1A 2PY5A 2PFUA 2X1BA 3VQPA 1FVSA 1TELA 5E84A 3BV8A 2XM3A 4J2DA 1U26A 3T1AA 2W8LA 4OHYA 5EU7A 2B3TB 1MMDA 2RPIA 2XY7A 4B3MF 1J9AA 4X65K 3T41A 1KAXA 1LWEB 1SQGA 3HM9A 4KRWA 4ZLJA 3GYNA 4FOIA 1S22A 3MMAB 4KH0B 1IBLK 4DN0A 4KTZA 1L3KA 3LWMA 4C0BA 3H0PA 1RB0A 3G87A 4LF4F 2XY8A 1ZTWA 4OHVA 3ONQA 2BE9B 2H5EA 3AQOA 5A2QY 1OY9A 1URRA 1JNRB 4JV1A 4KHSA 2R7UA 2VONA 5DK5A 1RTZA 2VODA 3QMQA 5I42A 4QIGA 3OTOJ 2Q3SA 2F9DA 1HNZF 2Z8QA 2I7NA 1N32F 1RU2A 1UWBB 3U6FA 1DRZA 4DV4K 1BCOA 2FQQB 1TK0A 1T11A 3IXQA 4TSXA 1DEJA 3PRVA 4IOXA 3MM8B 2LU1A 2OTLS 2BOPA 1RT2A 2G2ZA 4CJUA 2OHDA 5CYMB 1NKEA 2DNMA 2L9WA 3OQ2A 1S9GB 7FDRA 2W42A 4ZPCA 4CJVA 2HQIA 3P38A 1M5OC 1FRKA 4KR0B 4DV0J 2FJXA 4Q44A 4CNYA 1J53A 4CEDA 4U95A 1WSJA 5FDLB 3MPVA 5D0RA 3TVYA 1BCMA 1Q8BA 3CJAA 3WNFA 2CWXA 4G1IA 4LFBJ 2QXFA 3GR0A 3CMAS 1HNWJ 1YITN 2IVOA 1H6KX 3ASMA 3GTYX 1HBUB 1NO8A 4QWAA 4LQ3A 1WTBA 1S6PB 1OQ6A 1N52B 5FPDA 1M90O 3G25A 3PXGa 4GRSA 1EARA 4NLSA 5GAHP 5K8OA 2NSBA 2O8DA 3THTA 2GGPA 2CNLB 2V2QA 2C2RA 4K43A 3OS2A 2DFEA 4CI0B 4CJ4A 2CVIA 4EO6A 4NLUA 4PPDA 4ISEA 2VB6A 1ATNA 3OR2A 2XZDB 2B6AB 4CTAA 1WEZA 1UZHA 3KVGA 2MKKA 2HBLA 3MEKA 4NEYA 3U27A 4WCEQ 1KVKA 2EFGA 4DSEA 3IBFB 1KVBA 3TR5A 1XNRF 5KFTA 4A57A 4DB3A 3ULEB 4GVEA 5LL6d 1NSAA 3C19A 4BRFA 1VQLN 3DDNA 1NGEA 3D6TB 4LF8K 1ZS6A 5EX5A 2CPZA 4IO9Q 2PYJA 2KI2A 2NUBA 3VF0B 3LP0A 4ECVA 1SL2A 4QW8A 1MMNA 3HPHA 2V0NA 1WBBA 1NGIA 3NF6A 3OBWA 2B5JA 3QFUA 1G3OA 3G6ES 4LRBA 5SZTA 4DV0F 4C3MA 4M5DA 5GAEI 2UV8A 1VSEA 4C8KA 3VQSA 4DR3K 3DRPB 5HQLA 4FVCA 2QWNA 2ZM6J 4DV7J 4CT9A 4FWKA 1GTHA 2JC0A 4BBYA 4IEIA 4F2SA 4LD0A 2AW0A 4IG3B 2ZD1A 1O13A 2J4RA 2E2QA 4HT7A 4B9QA 1L3VA 4CNZA 3OJUA 1VHIA 3CULA 1MWKA 1OVQA 1WN7A 1H0HB 3DMJB 1V3ZA 3T1HF 4RR5A 4JI4J 2RIJA 4JD2B 5LT5A 3AB2B 2ZH7A 3D66A 4NPOA 1EXQA 2YKPA 2I0XA 2XG8A 1FK9A 4CO5A 4Q43A 2Z30B 4JRQA 5J1EA 1IBCB 2Z1GA 2F4VF 1SCJB 1WHXA 4DZDA 4F9OA 1FEHA 2HW3A 5IFMA 4RO0A 3LGNA 3U1LA 5EX3A 3PJWA 3F44A 5DETA 1RT1B 2DTJA 1GLDG 4KHYA 1K8KB 3L9ZA 3QDKA 1LK5A 1OS5A 4ZVHA 2Q97A 3CC2N 1G6BA 2LCWA 3RU0A 2AYEA 3G82B 3VWSA 4V1Ak 3CG7A 4E3SA 4BR2A 3GSIA 3MM5A 4OJRA 3RAQA 3OYNA 5KT2A 3SZ2A 5AQMA 3C6AA 1ASWA 3DGPB 2OMLA 1YBAA 4HTLA 4USUA 4NLVA 1JLBB 4B9UA 3P39A 2YCHA 4DTNA 3QERA 3D6FB 3V9WA 1YTYA 2V9WA 3HKWA 3U3GA 4ECRA 1XWLA 2JNJA 1Q86O 4CIEA 1FE4A 4M7YA 2HIQA 1PC4A 1KQKA 3PVXA 2DFFA 4FJ8A 3SV3A 2FJAB 1H3DA 3TNVA 2KFZA 4R25A 4GW6A 3C8YA 1L5UA 4WK3A 4CZCA 5K8NA 4FJMA 2U2FA 3J7YU 1SL1A 4XPEA 2RE1A 4KPYA 3QO9B 2E20A 4CGGA 2YX6A 1VQYA 2GVZB 1KQSR 4WJBA 3TA2A 4KHPF 2W01A 5KG6A 4Y0WA 1VQLS 2I8EA 1RT5A 2E4LA 3OS1A 2GIFA 3L3UA 4M8LA 1RISA 1NK4A 4Y65A 4S0MA 2Q1NA 2QRRA 3RTVA 3RZAA 5B0AA 3UI3A 3OHAA 4YORA 2A40A 4JEPA 4I2PB 1NM2A 3PYEA 2EWSA 2GHWA 4IWVA 4A5AA 3B6BA 3OA9A 1PIEA 3OTDA 1IKVB 3C94A 3CPEA 1KSPA 2KXHA 4MT1A 3MAHA 5KFNA 4PUOA 1LEOA 3ZZUA 4GNIA 3CCRS 4PWDA 3OUYA 2FHMA 3D2FB 1U1QA 4CP5A 4CEZA 4DQRA 2EW9A 1EKSA 3EZOA 1CC8A 4DLGA 1XHXA 2H5JB 3RW6A 1SIWB 4NCGA 2JGUA 3E9OA 1U45A 2O8CB 3MCNA 4HLBA 2O8DB 2HOEA 3F9MA 2MY8A 1TGOA 3ATVA 4DV7F 3QATA 5BPLA 4Y6IA 2FSNA 2DH9A 5KT5A 4C8OA 4I0WA 2PI5A 3KLGB 2ROPA 3OW2M 4XPCA 3CCUN 1EHWA 3KWGA 4USKA 3CETA 1ZC6A 4MDBA 3G6YA 2BE2B 1ROFA 2OEMA 1RHRB 4KH6A 4J9UE 3ENAA 1EQ0A 5KG3A 4U8VA 3TX8A 4J9SA 4DSIA 3DRYA 2W9BA 3KTQA 3UR0A 3M4XA 2ZOFA 1PCAA 2OFGX 5F8NA 1S1VB 1TR0A 2QJ3A 3CXCM 2MQPA 1UJ6A 1VBKA 4BQLA 3C14A 5K20B 2GGPB 3S8SA 2ZVSA 2BMBA 2XO7A 1F5CA 2AYMA 2V51B 4RWWA 1F3FA 2NRTA 4G3IA 4QW9A 3QBXA 3SIPB 2JEFA 4LMZA 4C3KA 3HVWA 2FLOA 2C3MA 2ITMA 3Q8RB 4J9KA 5ADXH 2FVSA 1O5JA 1VC5A 3PLAA 4IR9A 5F9LA 1W0HA 5DG9A 5KFQA 3R9PA 1WHWA 3P96A 4F0MA 4HUGA 2FJBB 4YR0A 4FJKA 1C0GA 4ELVA 1Y97A 3FKBA 1JXBA 4J2BA 3GG0A 1J27A 2X1AA 2DGXA 3LALA 1QAIA 1XJWB 5CHCB 4U7UK 2GUIA 4Q8FA 1FKPB 1T6DA 4ZTJA 2IJNA 5HANA 4B3RJ 3CF5L 3VVUA 1M5VC 2XHCA 4BRAA 4KI4A 2A2CA 3NBPA 3TZZA 4YHHK 4LF9F 3I4HX 4BG8A 1H72C 1BMQB 1GLAG 3SYZA 1VAZA 4ED1A 4CGIA 4NI2B 2JEGA 3CGIA 4DQQA 3LUYA 3MEDA 5E5NA 1JJ2R 4DQ8A 4OHWA 1M5SA 1Y10A 3MTKA 2ERRA 5HO4A 5E41A 3HD1A 1TUGB 3Q2TC 3CM6A 1QE1A 4EAHD 3I9ZA 4DF8A 1DQ8A 2J6SA 4EHTA 4RBVA 4MIWA 1YI2N 3SCXA 3MCAB 4C0HA 1NNEA 4K4UA 1S6UA 4Y2KA 3MCMA 2CVEA 4GMJB 4A2BA 5D4OA 4IFVB 2ZITA 2HYIB 4KRFA 3SUPA 3HHNB 3SBGA 2FVCA 3M32B 4JV0A 4R8UB 4DV2K 2QMUB 2IA0A 3OYDA 2YNGA 4KT0C 1VHXA 2DH8A 2R7TA 1X0PA 4CZMA 4C11B 2E66A 2OPRA 1IG8A 5C24B 3T7ZA 3SCIE 3HT3A 3NNCA 5JUMA 4A8MP 3HULA 1CBKA 1O0PA 2HMIA 3BPDA 5LMNF 4B1ZA 5FPMA 2MKCA 2DT9A 3W64A 3D6RA 4AHUA 3TSPA 4CECA 4DU8A 2JHEA 1YJ7A 2LXUA 3T9NA 2V8GA 1S3XA 3ZZOA 3BSAA 3FSIA 3MAAA 3THYB 4DMNA 3QO9A 1QAJA 5IWAF 3CUNA 8AT1B 5I3UB 2FSKA 4FDFA 4FWRA 3A8IA 4OFZA 4BRMA 3SMPA 3SDEB 1X5TA 2RUSA 1K9MT 1QQMA 2AF6A 2VF3A 2CNOB 4NA1A 1HNWF 3ETOA 1YLXA 4I2QB 4LBIA 1YF5L 1T9WA 1U2CA 1G1XA 2NRXA 2EBEA 2WB4A 3CMES 3H4DA 1VQ5S 3IN5A 2QC3A 3OYGA 2QMXA 3TR8A 7FD1A 3ENOA 3OHRA 5G4DA 1YZ7A 4CBXA 1VQ5N 2GEMA 5B0EA 3FR0A 1T05B 1EO1A 4UTGA 2VWBA 1UZDA 2FVRA 1A5VA 5AR0A 2YNGB 5EGYA 1SBRA 5KFWA 1M5PC 3AA2A 2P5GA 3BKFA 5HK4A 1QY7A 4TYAA 2QMWA 1FTCA 5E3PA 2W6KA 2DHHA 3DM2B 4KB1A 3R5DA 1HBUA 5T14A 1IJFB 3MCPA 4K5SA 2UU9K 2W9CA 3RBEA 1RT3A 3MR2A 1WD6A 1B0TA 3WX4A 1U0HA 2JVOA 1J5OA 4JP8A 2XMAA 3VGMA 1P27B 4ZJLA 3HSJA 2DB1A 1REVA 3NGDA 4QYZK 1JLFA 2D0OA 1FA0A 3F41A 1YWXA 2FYXA 1DQAA 1C0TB 2ZGYA 2IVMA 2LDYA 2AYBA 2MHNA 3OXLA 1SJ4P 4X4RA 2BM0A 4CZGA 3RBDA 4QU7A 4ILJA 3WHIA 3FFIA 2HZAA 3C15B 1NHUA 3VAHA 1RT2B 4DHVA 1P6TA 5KG7A 2QG9B 3SSQA 2UXCK 1FRHA 4N47A 3UFCX 3BGUA 3DI6A 1I1GA 3V81B 2QSFA 3NFAA 3TUZC 1NGAA 5HMYA 2N3LA 2DY4A 3NAIA 4A4JA 1Y0HA 4K7QA 1ATRA 2KG1A 5I42B 3SQ2A 2KG0A 4YY3F 1REVB 3KLEA 4YDUA 3G8QA 4UF4A 3X1LB 1VOMA 4B3TF 2W40A 5AJ3K 4AILC 2DO0A 3AY0A 5B0CA 1FNOA 1Q1KA 4X2BA 2RQKA 3BN7A 1WC6A 2I6WA 1N6QA 2E2OA 4JI1K 4BR9A 1EQMA 2HVZA 4RWXA 5EOYA 2BXJA 2E9RX 3I0SA 3QRQA 1IQTA 2IVPA 3GFYA 4CIGA 2OO4A 4EYIB 5C0YA 4OYOA 2X3DA 3DHWC 4H5NA 2HB5A 1FDDA 5IC6B 2HRUA 4A8OA 3BM7A 5BYQA 2GHVC 3VERA 3W2WA 2MQNA 4IH6A 4GV6A 2KT3A 2QLXA 2WVCA 3AAQA 2VQEK 1I39A 3K59A 1FFWB 2DKOB 2V4RA 1YZ6A 2R9LA 3G86A 1WHVA 2W24A 3IRXB 4USTA 2QWLA 4OJ3A 3AVCA 5M1PA 3HSGA 1KC8O 5HRNA 4KBIA 3C6UB 2ZUGA 2D9PA 3C6TA 4F50A 5C25B 3W65A 5G0RB 1XEZA 2YHBA 3V1RA 2QW9A 2G8KA 3MXHP 1R59O 1ZZNA 3ZCMA 2HURA 2FXUA 5BN8A 3PW4A 2UZAA 1LCUA 3OVNA 3O80A 3TVKA 1RILA 4YB7A 2CPJA 2HFVA 1QZ6A 2AX0A 4XTTA 2H5IB 2V50A 4WFAQ 3CCQN 3DC2A 1NSKL 4B3MJ 2AHOB 3FZLA 2C3UA 3D6MB 1FF2A 4CWBA 1S7IA 3V6HA 5HVHA 1W9HA 1WWHA 1S79A 3NH0A 2GIQA 3SQOP 5KTQA 3UDCA 4A8SA 5DM6L 3J7AN 4ER8A 3ZSZA 4K4TA 3KXDA 4DCOB 1WJ9A 4URGA 1H73A 3WIVA 5BPNA 3G6VA 3BO4A 2X78A 2G13A 4DSJA 2Q0RA 5BRHA 1QD1A 3I56N 2RHQB 2WVEA 4RBTA 2BRLA 1KS2A 3CDBA 4LVOP 3N28A 5E2QA 1VHFA 1RBTA 1Q4RA 3RR8A 1QSYA 2HK3A 3D2FA 1BWVA 3RRHA 5GIPA 2YH1A 2EC2A 2HNZA 4BHQA 3WT0A 4DR1J 1WUUA 3RUBL 3R5GA 1S57A 3BQ2A 4EU0A 4CLKA 3CDAA 3A5LC 2BE2A 3BQ1A 2CJYB 1JK9B 4BRKA 8RUCA 3KLHB 2V68A 1RT6A 2OPRB 2CPHA 1WF1A 1PBAA 1ZBSA 3SUNA 3ZEUB 2GZOA 3PYDA 3TOQA 2VICA 3A12A 4L3QA 2GVDB 1WB9A 4Q2MA 4NLRA 1S77D 4DX5A 3CCLS 3NWGA 3MR7A 3QLHB 4HCBA 4DUTA 1APSA 2VJVA 1HBNA 3ZT2A 1CSJA 4LF5J 5GMKa 5EWEA 1WC1A 3CCJN 2ZE2A 1TAUA 3MEDB 1TL3B 2VQFF 2IMOA 3GIKA 2Y8YA 2IRYA 3QGGA 4F2RA 4H4KC 4BRPA 4I9LA 5HBMA 3QRPA 2V2KA 5A8KB 3I33A 4BE1A 2AV5A 2AQ4A 2PN6A 3R2DJ 5T7LB 1U0SA 2PA8D 1RAAB 5J2QA 1SJRA 2R8HA 4X4UA 5AQLA 4AHVA 3U1NA 2GV9A 5JLFA 1YAGA 9RUBA 1R6VA 4CLYA 4FYDA 3QETA 3S3NA 3E9LA 5JVHL 4PRFA 2G8WA 3FK4A 5KFUA 1R6YA 3M8WA 3DLJA 4ZVGA 3CC4S 2CPEA 2HVIA 1ZBIA 1RUSA 5KT3A 3ZSVA 2JRSA 2XMJA 4ECWA 3CMAN 4FJGA 1AZSB 2GW8A 2VD3A 1VBXA 1S1TA 1KQFB 2DGVA 4JI6J 1NB7A 2GCFA 2POKA 3AVHA 2FJVA 2UVWA 5CR4A 1VQMN 4FS1A 3DXSX 1T44A 2VFSA 2YWEA 1GXUA 4N41A 3G9CA 3IC1A 2UUBF 4ZPAA 3HZEA 5KT6A 4X66J 3KLEB 2OLWA 2PYLA 5CABA 2V2VA 2K7JA 2BUNA 3HHLD 4GKJF 4ILHA 1RADB 4WF9Q 4JI1J 4N8OA 3TQEA 2GUPA 3GFHA 1NHKL 2ASJA 2AWZA 2DGTA 4CO2A 4FJJA 2VOOA 3V4MA 1XMQK 3UPFA 5HOOA 4LFBK 4IH5A 1VSMA 2UUCF 2AMCB 5DRKA 5HVFA 3UDLA 6FDRA 2KM8C 1NK8A 5ETTA 4E8UA 4IOBA 4BQZA 4UY8O 2E8AA 1GMUA 4BGAA 1AT1B 1R0AA 4H8KA 3R7BB 2GAGC 1NZ8A 2VOPA 4IO1A 2IYGA 1WELA 2Q66A 1RDBA 1NLVA 1NJXA 4IO8A 3FZKA 4K2JA 2MSSA 3CJTA 3E1YA 4EBDA 1IBMF 2RRNA 5LMUJ 5KOWA 1JLEA 1NAQA 1D1UA 2JJ4D 2FC9A 3BY5A 2YH0A 3ZFVA 4M94A 2NLWA 2LEPA 4P7TA 5L1JA 2I2YA 5EHHA 2PBDA 1XR5A 4QYRA 5AFUA 2YNHB 3THWB 1LWFB 3K7RA 2MZQA 2ZH9A 4IDHA 1I94F 1QJHA 2HFOA 1X4DA 3MXJA 2G8FA 4CJ5A 1T3OA 2Y9HA 2C22A 3BYRA 3DLEB 4ED8A 2NZ4A 5IV3A 4ZVSB 2CWKA 1CPZA 4GVBA 1FXXA 5DLGA 3NAEA 2XMUA 1XHZA 5DDRC 5KFKA 3N6NA 2QL7B 3AVGA 3C66A 4X4PA 1L3SA 3KLIB 1I51B 2XMMA 3GJRB 3LGHA 3NF9A 5D8HB 3LDLA 3W5ZA 2W1BA 4CF8A 2NRVA 4JI0K 4FPBA 4DQIA 3M1VA 1DZ5A 1IJEB 2DGUA 2BQ3A 4G6VB 3H5XA 1SUQA 2XHWA 4C8NA 5AE1A 2IOCA 4NE9C 4IOCL 1SKWA 1GLLO 1L3TA 4XDCA 4XK8C 2W7AA 4V19J 2C1EB 3U9DA 4ETZA 5HL7Q 2ZGZA 4CO0A 4DV2F 1HMVB 1VJQA 5KG1A 2KVIA 3MM9B 2WBNA 5I3PA 4CDIA 3RYLA 4WFBQ 5HP1B 2YWHA 3P4UB 4FOEA 3B6OA 3HLUA 3AA4A 4LH5A 4ZOSA 5GAEP 5C24A 2XSJB 3TAPA 5IT0A 4H0TB 5I3QA 3HZGA 3JTPA 3DDKA 1BHNA 2NPFA 3KK3B 4R79A 1RHUB 1GX5A 1MLAA 1RBAA 3N5FA 4DQSA 4UOGA 4N56A 3RAXA 2HHSA 2VG6B 3R6GB 1HWLA 1VLYA 1S5ZA 4Y0FA 4IOCQ 1ZETA 4PG8A 1VFJA 3CCSN 4CK1A 3HJVA 1NGDA 3O4WA 4ILLA 1AFJA 4FM0A 4B02A 3ZZPA 4USJC 4IR1A 3PIOL 4IG3A 1B7FA 2Z1HA 5GAGU 1H2UX 2UV8G 1C0FA 2XY6A 2OGUA 3TAQA 1U1NA 5F0XA 4NRUA 2PIIA 3OXFA 4DR1K 1F1BB 1S49A 2ASOA 1EX4A 2KXFA 2L9DA 5LY3A 4KFBB 1TYQB 4P9SA 3LM2A 2YNIA 1WLJA 2V8DA 3L0QA 2V63A 4B9MA 3NOGA 2ZWOA 1ZM3A 2D0PA 1NGHA 2YWGA 4MJKA 1FRXA 4W4MA 5ETKA 3TZWA 4F0HA 3RG6A 1HIYA 4LQ9A 2RRAA 1XMOK 1FWPA 1IM4A 2WTUA 4RW4A 3CCJS 1ZM4A 3PRDA 1ZA2B 2W2PP 2EFQA 4I6YA 4M3UA 4FK2A 1RLCL 2K1RA 4CCHA 1JNZB 3NCRA 3Q23A 1KR4A 4DV3K 4B9SA 3W63A 1QVFM 3N9UC 2D9OA 1KWMA 4K4ZA 3TO8A 4DLEA 2XTJP 2Y3YA 4LT6A 1HNZJ 3EKSA 4CHZA 4HVJA 4GKKK 2X6NA 1ZPVA 3I96A 3MMJA 3BEXA 1BIUA 4AL6A 3VQ4A 3R6LB 1D5AA 2B7BB 3J80O 4KY3A 1ULRA 1IKWB 1PYSB 3CFPA 1VK3A 4BRQA 1TV6B 1NPPA 1PAEX 4OLBA 1YDLA 3Q8UA 2ZM6F 4O3RA 1GLJO 2MLYA 4B3OB 4ED0A 4U7CA 3D2EB 1FXRA 3OJSA 3SCJE 4LF7K 2C28A 4LBPA 3KUGA 2I7PA 4OI2A 2OKQA 2HRYA 1VRTA 3TTDA 3MWBA 5AXLA 3KLGA 3GPAA 2RILA 3KG4A 5AXNA 4ECSA 2XYPB 1RGVA 4Y3CA 3EEQA 4ISGA 1KVCA 3ZLJA 1HI1A 2LQBA 3DLRA 1BDGA 4DFMA 1QVFR 2ZDOA 1S6OA 2ZJPL 3DLBA 2R8JA 3CJ1A 2I38A 1H2TZ 3VQTA 2O8EA 1RTDB 1HBOB 1UWAA 4ECYA 4USMA 1VQ8S 4M5IA 4EK2A 4YQWA 2OD4A 2BKOA 3LDOA 4WQ5C 3AJ1A 3MM9A 3S7RA 3HCXA 2CDRB 1RWWB 3UW1A 1K8KA 3IMQJ 4RG8A 2QFJA 4F4XA 5HBMB 2KH9A 2V4QA 2NYHA 4LR8A 2E7VA 3KZBA 3C16A 3HPOA 4CO1A 4HDHA 4OYZA 4HH1A 3O3GA 4P73A 1KLMB 1SQKA 1YRTA 2FBTA 2VPYB 2ZH1A 3T1HK 2XGPA 2P9NA 4B3SK 1VQ9N 2YJFA 1JLGB 1YT3A 5BPMA 1CJKA 1JQGA 2VUGA 1U47A 3MMAA 3DU5A 4L73A 1VBYA 2VPZB 4ZJOA 1KONA 4ZKAA 2KZZA 3VGSA 1Y5IB 5DGBA 2QIFA 4ZCLA 4CHQA 1LNQA 3T9ZA 4QYZJ 2HAIA 3BDPA 3KNAA 2KYXA 4YEAA 4NLGA 4O3NA 2DPJA 4OV1A 3WNEA 3NE6A 2DXEA 3UO0A 1XN9A 3L4QA 4FPAA 5HMXA 4M42A 2UUBK 2BJ3A 4WFAL 4KHUA 3M6VA 3F2KA 3P5JA 1LWFA 4MTPA 2MQOA 3C15A 5C42A 3TANA 1M1KT 3ZXWA 2XLIA 3M8RA 2C2OB 2X51A 1YQHA 1N36K 4CF2A 2XBPA 3HP6A 2BANA 2P9UA 3I82A 2M4MA 1FKOB 5J2QB 4ICLB 3JSYA 1VSLA 3KJQB 3JQKA 3QEPA 1J5EF 5D15A 4TY8A 4GC6A 4X64J 5CCLA 2UUTA 3LQVA 3KLIA 2MHEA 4Y1CA 3BS9A 3CI5A 1OSCA 5IT4A 3PIOQ 4DS4A 4CFBA 4FWSA 2ZD1B 2GX8A 4KKOB 4M5GA 3DM2A 4PG4A 5LXYA 2CQPA 1EP4A 3EXYA 3WC2A 1VJWA 4C23A 4JAXA 1JX4A 1S48A 3BPSP 2EG1A 3GP9A 4UQGA 3ILIA 4ZLLA 3G6XA 1H1VA 3QEIA 4GO5X 3OFGA 1DKGD 4JV5J 4BGBA 3ALYA 4ZCKA 1U49A 1T94A 3W2WB 5A6PA 1RTHB 3ZT0A 4O44A 2IA6A 3G10A 4WKRA 4TY8B 3D1QA 4B1WB 2F8HA 4CYUB 2DYAA 4I7FB 3F56A 1PILA 4YDXA 2BYCA 3O5BA 2IVYA 1X4GA 3SBMA 2DBBA 4IZ9A 3DRSB 4RBUA 4O0NA 3HL8A 2IIRA 4L3KA 4IDKB 3HHEA 2C3YA 1N5YA 4RJVA 3AY9A 2NXCA 2FZGB 2OAUA 3IG1B 1YHQS 1BG3A 4CZIA 4CFCA 1S0OA 1N5VA 2AYGA 3M5RA 1HPZB 4JI0F 4LRFA 2O67A 4YR3A 1PBUA 5EVZA 3GL1A 5ETOA 4JK8A 4Z4IA 1B0VA 3BUZB 2EXUA 4C8MA 4BC3A 4CZEA 3OYJA 3NY0A 4O23A 3R7NB 3OW2R 2XMWA 1D8YA 5AQYA 1N8RO 2R2TA 4OYWA 4DSLA 1OSDA 4EUVA 4X4VA 2DGOA 5ETMA 4NXMK 4H5RA 1DHMA 3W61A 5AQGA 2ZC3A 3A3PB 3G4SN 3QNOA 2RQMA 3UQSA 3I31A 4JI5J 2P9IB 1FDAA 1PC5A 4C2MA 1CJTA 3SBTA 2HAFA 4F36A 4WYBA 1HNVB 2JEIA 4NB4A 1WI6A 2R2SA 4UOCA 1C0UB 1C2PA 4IO9L 5LJ5Y 4NYZA 5E3CA 1HKGA 1IKXB 1Y64A 4J9RA 2F8SA 1WF2A 4HHUA 4DR3J 3VALA 4Z94A 1J5OB 1OWXA 4H5VA 5AQXA 4X4OA 2OTLN 2NUHA 2DNKA 1RJJA 2IAJB 4LSZB 2CJXB 4BDPA 1XR6A 1VR6A 4KH4A 4CFDA 3TJAA 2VKZG 2KTQA 3R27A 1SC1B 4WCEL 3JTOA 1R3NA 1RHQB 1WOSA 2XC9A 1I3AA 3QT8A 1NBWA 2HQ3A 1M0SA 5FROA 4MK8A 3OPKA 1TTHB 9ATCB 2MTLA 2OUGA 8ATCB 1SL0A 2BABA 4Z0UA 2O8BB 1NGBA 5E3RA 2HHVA 2D4WA 2WHOA 1X9WA 3BQ0A 3SSSA 2VFRA 3T69A 3BGOP 4WTOB 1T95A 5K14A 4FXWA 3H5SA 3MECA 2KHDA 2J0SD 3TTCA 1JLFB 2XYGB 1S6QB 2KLAA 3GV7B 1Q79A 2P9GA 4DV1F 1UFWA 4LF7F 1OH5A 2RB7A 5J2NB 3PR4A 3VEYA 2IRXA 4P75A 3VETA 2VQFJ 3J7YP 2P9SB 3P8BB 3AVLA 2WCXA 1C1CA 1SC3B 4TY9A 3JQJA 3D28A 1HR0F 1LFPA 2DH7A 5CYQB 3CD0A 4FYYB 2LXIA 3CQYA 4O4RA 2HMIB 3HD2A 3EJMA 2HVEA 4ZVFA 1RACB 3SNNA 4ZVRB 1AUDA 4KH1B 2P9NB 4MO5A 4LJMA 3HF5A 3OYFA 1REGX 2PA3A 3MN9A 3H5YA 2CDQA 4K42A 3AB4B 3DOMA 4YN3B 3FUYA 3MGJA 1N54B 2JH3A 2DHGA 1SKRA 4DPXA 2HS0A 1W7WA 5C2CA 3PR5B 3RBZA 1RWXB 2M9KA 1KRPA 3OD2A 2JDJA 1BGXT 3ZTSA 4L74A 2RDDA 2FGOA 2XYHB 1FX4A 1Z2LA 2X74A 1HQUB 5IS2A 1H98A 3BF1A 2YNFA 1F5AA 4C8ZA 2A3JA 1NOZA 3THXA 1S72S 2LA4A 4ELTA 3GCWP 3SXLA 2CQCA 5C42B 5EDWA 5HAOA 3K5MA 4DV4J 1RNHA 1Q78A 4F3MA 1VRUB 4LSNA 4CHPA 3QSIA 1CZ9A 1TAQA 4DV6J 3IBCB 1OKJA 1T7PA 3H6EA 5DJBA 2VBWA 2WB1D 3VQ8A 5LXRA 3C65A 4JHDA 4P2XA 4B9VA 3IRXA 3WC0A 4E7KA 5HQ8A 2IFXA 1UEUA 1RABB 4ENOA 4OI1A 3KYLA 4ECZA 1NG9A 4QIFA 3MM8A 3OLAA 4FL9A 2KRRA 4KHMA 2RSQA 5THWA 2CQGA 4Y00A 1N56A 2YKMA 4JKGB 1RHJB 2E5GA 2AJ0A 1IJJA 2Z2YB 3ZSXA 3SJHA 1K73O 4Y28C 4JI0J 4ZIWA 2OPQB 1WKKA 2WBMA 2WOMA 1S9FA 2CGJA 1VQNS 2GMLA 2J0QD 2QL5B 3S41A 4HKQA 1OY8A 4MK9A 2EFVA 1JCEA 2P8IA 2CQ4A 2PD1A 4OKKA 1IG9A 1NDPA 5A76A 1RAIB 4FJLA 1Z6RA 2PI4A 2BX6A 2UVRA 1IV0A 1Y5NB 4IKFA 1GQEA 4E1NA 2F9WA 1WNSA 3M2UA 1WC5A 4JOUA 3BZQA 2NRHA 2DIUA 2C2DA 2DR8A 2VA2A 2GVDA 3VHQA 1V4SA 4KGMA 3VQDA 2P9EA 1RI7A 1DQ9A 3CJ9A 3QSYB 2A2DA 3JB9k 2A42A 4DL6A 2EFNA 4YY3K 2E9ZA 5F8IA 4FZVA 1HMVA 5MLCQ 3IWXA 2YHXA 3FZMA 5A2QU 1NPKA 1B9FA 2LQ8A 5AQNA 3GSDA 4C3LA 3CDUA 2DRAA 4LF7J 3I0RB 4CBUA 1RDWX 4CF1A 4JI8J 1NGGA 4HACA 1CLFA 5IWAK 1FFSB 2D0AA 5GIOA 1JLEB 1S1XA 4E1JA 3FE1A 4KB7A 4MH8A 1SQFA 2LKZA 3O6QA 4PYAA 4JN4A 4OLPA 2B9WA 2UP1A 4M1KA 3QYYA 4ATNA 3UCZP 2LQJA 2WSEC 1WDTA 4ZVOB 2ROGA 4EP5A 1QSSA 1CLQA 4P2FA 4X4NA 3A3NB 1X3MA 3J81Y 2PFDA 3OHBA 1TUWA 5B0DA 3E66A 5KT7A 1AXQA 1HYSB 3CO0P 3OR2B 3BSCA 1VQON 4JKHA 3EVOA 4JI6K 2GQQA 4Q7AA 3ZZZA 5JXSA 1TL5A 2DFHA 3MK6A 5KFXA 3MFIA 5K8MA 4B17A 1IR1A 2ADBA 3DYAA 1T9UA 5I3UA 2VBYA 3H59A 2C2NA 1GLBG 4JKAA 5HJXA 2RHSB 1CQNA 5KPZA 4LF5K 3LPTA 1NU0A 3W7BA 3KG1A 3UN2A 1URNA 1PYTA 1TKZA 1JLQB 5AQWA 3D0GE 1TQLA 2DITA 4DV0K 2MLZA 1WC0A 1W2IA 5J1PA 1XQSC 1DT9A 3KK2A 2KXNB 1HI0P 2A5XA 2ZC4A 3T5KA 2MZTA 2IGIA 1T3VA 1VC0A 1QQOA 3OYKA 3A13A 5JMVA 1PAUB 2GHPA 3HSDA 2MLXA 2YNHA 3THWA 4LIWA 2MJUA 5CYMA 4Z7CA 4OX9K 1XERA 3NL0A 5HROA 1DBDA 3K2PA 3AOAA 3UCGA 4UT4A 2C3OA 3V81A 2W9CB 3KJVA 3UKRA 1QE1B 3DHXA 3ENHA 1FX2A 1XR7A 3VAKA 4DBQA 2DR7A 2DHSA 5IT9Y 4IKAA 3NGUA 2PFFB 1S1UB 3EE9A 1XTZA 4OGCA 4DU3A 2E1CA 3MURP 3M2VA 4ISFA 1C4CA 1U4BA 2IM3A 1B92A 3KK1B 1P1TA 2AEJA 4YHHJ 4YDDB 2P6SA 1BISA 1CJKB 2QA4S 2VPWB 1IBKJ 4KSEB 4OZ2A 1RAOA 3TPQA 1S1WA 3OL8A 4E98A 2DNYA 1IM6A 4DFPA 4ELUA 1NNDA 4LF6K 2B8QA 4BC9A 4LUBA 3FMBA 3M2RA 3FZFA 4NYNA 3NGIA 3O1WA 3UKRB 1RAJA 4DX8H 1XIQA 2FF3B 3PCOB 5AE3A 3RAMA 3CSKA 3P5TL 4U7BA 3HVTA 4MKVA 4KAZA 5LM7E 2FPHX 2A6OA 5KFRA 4JI2F 2E2PA 2ZBRA 2EG2A 3OYCA 1D3WA 2RKIA 3CE8A 5H9FK 3H40A 2MQMA 4FLYA 3AD7C 3M6GA 5A8WA 2DPIA 3K9KA 1SIZA 1P9QC 1Q82O 2RMLA 1CULA 1XQIA 2N4DA 3EL2A 2UXCJ 3IAS9 1U2VA 4JKDA 1Q9YA 1AROP 2QTDA 3TRGA 2HWIA 4P74A 2QWPA 2W2NP 1IQZA 1JJ4A 3MPWA 3ID6A 3FBEA 2RS2A 4I6MA 5C10A 4BE0A 3R8YA 3VAMA 1X0FA 4D3HA 3SQGA 4OYXA 2QO3A 5LMNK 4QS8A 2FC8A 3SQ4A 1IR0A 5SWMA 2ZVIA 4ZP6A 3A8YA 3LTOA 3IFRA 3JTNA 2FF6A 1NHVA 1RWMB 2O5DA 2ZOGA 3PNIA 3DKDA 3UD4P 5L39A 3H5UA 1QZ5A 4FJ5A 4H0XB 1UOCA 4DR4F 4PQUA 1N48A 2LVWA 1HA1A 3CJ4A 4RW7A 2VGMA 4IG0A 4IFVA 5CXTA 1FWLA 4H5WA 2DNLA 3S1TA 1T02A 3TUJC 4W5NA 4U7UD 2GAHC 4DPOA 2DGSA 4BDYA 4J90A 2O66A 3RB6A 3P4IA 4WYWA 3SLCA 5D0GA 1HX1A 4M5DB 4W5OA 5KQ8A 1W2BM 3PKYA 4UZCA 2HFNA 2M0GB 1XC9A 2FJEB 5J2NA 1YJ9S 3QPIA 4OHXA 3GQCA 1FJGJ 2FHKA 1TL1A 5A0YB 2M5YA 4AM7A 4B1VA 3SPZA 2CADA 5I4MA 4DR3F 4DUYJ 1OYDA 3CCLN 3AA9A 4BWMA 4DR1F 1NPRA 2X1FA 3TZXA 4P52A 1RAGB 3M8ZA 3LAKA 4TQRA 3QGHA 4MFBB 3JAMY 3VF6A 3H20A 4R0JA 3L3CA 1RFQA 1ASUA 1XMBA 1XMQJ 3O08A 4O3PA 3DAWA 4M63A 3QT7A 3JS6A 2ZBIA 4LC9B 1X5OA 2X7IA 3AT1B 5AQKA 2D0BA 2KHOA 3BEGB 3OBIA 4KYZA 1TYQA 2G8UA 2OEKA 3CD6N 1KTVA 5D3GA 2OMOA 4DTOA 3CIMA 1P9YA 1VBZA 2ZH8A 1Z25A 1JLBA 1A7GE 3ICLA 1VQ4S 2D5RA 1T9VA 2HHPA 2QEXS 3CIPA 3QIOA 2CH6A 3L2UA 4A62A 4ID5B 1B0PA 4Y2AA 1BOTO 1G15A 4ES2A 3MOJB 5EX0A 3W9IA 3DLHA 4ZIVA 2FVQA 1CZBA 4ES3A 2IJFA 2NSCA 4FPRA 4IUFA 2YX1A 1K1QA 2YPZA 4JD2A 3QLHA 2ZFHA 1AB8A 2UU9F 2HVHA 4J9PA 1HQUA 3BSOA 3B82A 4OI4A 2YQ1A 2E1YA 2ROEA 2F5GA 4DUYF 1NDCA 4I68A 4FNHA 5KFBA 4CIOA 1RBSA 5CZ2A 3GZ7A 2HHQA 2HFSA 1KAZA 4ZVPB 3L4IA 2XSJA 1NM1A 5A8KA 4B3RK 3V9UA 1ZOTA 3S6EA 4ECXA 3CCWA 2JLFA 2A1RA 3WXMB 4NLTA 1YJWS 3KNGA 3PFEA 1R31A 3BR9A 3MN5A 1RAFB 2XLKA 1S10A 5CE3A 5KFZA 2OTJS 3TEGA 3MUMP 1VQPN 1U6FA 3CCRN 4BRHA 3L4BC 1X7VA 3KHGA 4MQ3A 4CJEA 4DJBA 3TJ9A 5D78A 2E1ZA 2BV3A 2O8EB 5BR8F 4KE5A 4W5TA 1W2BR 1E6VB 3VQEA 1F21A 5GVQA 3B6PA 4H54A 4IG0B 1ZM9A 1S6PA 2DNGA 3SQ0A 3GFXA 4KV8B 3HVRA 2KFNA 3PO5A 3CJRA 1B7YB 4IDKA 3RMCA 1NXIA 1RT6B 2W25A 2VH7A 1TFYA 1RA7A 2CQ2A 4BR4A 4LFAK 3N6LA 2QL9B 4DOZA 3A5NC 2E7WA 4DSFA 3EZ5A 1DARA 1S4FA 3NS7B 1W25A 4M7XA 1E6YA 3CJKB 4OZ3A 4WFBL 1FVQA 5CZXA 4FLZA 2HHXA 4ITSA 3GLJA 5LJ3Y 4WIQA 3IMXA 1FW6A 4O5BA 2CXEA 3BN4A 1IO2A 1C1CB 5M1NA 1DGKN 1IBKF 4CI6A 3VQ7A 2XNRA 2IM1A 2C2ZB 2LEBA 4PKIA 5GMDA 3A5OC 3P5BP 3FZHA 1S12A 4JK7A 4DR6F 5CYJA 3RMAA 2P5VA 1RT1A 1GX6A 3G4SS 4XH1A 3SCKE 1VISA 3UKUA 4FZXC 1S72N 1QUVA 2MB0B 5FRMA 4DDFA 3HPGA 3D68A 4DR7J 1NOYA 3U9ZA 3QZ7A 2DTUA 1YVNA 2FHJD 5F8MA 3KG0A 2IDOA 3LL3A 2UXCF 3LZIA 2ALZA 1X60A 1EJ7L 3IO1A 4O0JA 2Z56B 2L9NA 3ULEA 2OTJN 3HYFA 1CJVB 3NLCA 3CC2S 1LW0A 3VEZA 1NSQA 2LQ9A 5CAAA 2QXLA 4CZLA 4KREA 3TW0A 2APOA 1RKJA 2OFHX 2B0GA 1T03B 4E1MA 2WONB 3ENQA 4LF1A 2JFKA 3M6UA 1FJGK 5HL7L 1YHQN 2OPPA 3UNGC 2DIVA 4WFZA 4PYDA 3OBYA 2L08A 3AO3A 3JSMA 2FJDB 4P2MA 1Y3JA 5DQIA 4ES1A 3D1HA 2YHAA 2PGCA 3KUEA 2N3OA 3NBPB 4WP9A 2HK2A 3V9SA 4I69A 2HBRB 2JSXA 5HLFA 1SH0A 3JXOA 4GO7X 1K0VA 2PEBA 3DU6A 3L2QA 1ZYQA 1U04A 3OYBA 2AJ1A 4AF1A 4ZDNA 2HBZB 4RU9A 2R7SA 3WNHA 2ZH6A 4EO8A 2R8IA 4RL1A 3VA0A 3W2VB 4FJIA 2YHWA 2UU9J 1JJ2M 4OLOA 4BRCA 3QWPA 4DUZF 2DY9A 1LOUA 4KI6A 3VQ9A 2M3DA 3FZ2A 4FWPA 1HBMB 1LWEA 2LFVA 2MDAA 3SCLE 4FS2A 5JS2A 4CBWA 1TMJA 4GC7A 1MSWD 5ETNA 3ZETB 1HWJA 4NI2A 3G2XA 4LH4A 3NCPA 4JK9A 2ZH2A 2ZWPA 3VQQA 4LF6J 4QR0A 3TSUA 4K8RA 1B3TA 2OPQA 1VQ7S 1N36J 3BJYA 4DSKA 3GE1A 3RVCA 5KG5A 3KHLA 1VSJA 1MDUB 4HUEA 5E7OB 2G1HA 4DV4F 2ATQA 2ZZNA 4P72A 1HD0A 2QK9A 2KW4A 1YVFA 4P7VA 4CJWA 4IYQA 3A0IX 4HDGA 3H8YA 1WNEA 1UAWA 4FF2A 3RW7A 4DS5A 3ZSWA 4DEZA 1HJOA 5EWGA 4GV9A 2PE8A 1HYVA 1N5QA 3DOMB 1FJGF 3O8MA 4JYAF 2PMHA 2MQ8A 4FF1A 3RSEB 2AJ2A 2ZNYA 4RU2A 6AT1B 3THYA 4FWNA 4F3OA 4DG1B 3C2PA 3E8OA 4O4GA 2DCLA 5HLFB 4X4SA 4ID5A 4LR9A 1CS4B 1ICEB 1MWZA 3SQGB 2BDPA 3VVTA 3NGTA 5BYRA 1DY3A 3N79A 3TJ8A 3ITHA 5F3ZA 4N76A 1Q53A 1NGFA 1U1RA 3ZNJ1 1S1WB 4ZS6A 3QMLA 1C1BB 2FC0A 4BRLA 2UXBK 1NGJA 3H45C 1FI4A 3GONA 3SSRA 1SJFA 2N82B 4NEZA 3P1GA 1FHTA 1X4HA 1D9DA 3ZSRA 5GADI 3VESA 1OPZA 4Y2IA 1OIAA 5T41A 5AXKA 1WSFA 1TV6A 3M3ZA 5CD4H 3FFIB 2K8GA 4M5NA 4NYFA 5KG2A 3AVJA 4AQYF 3AD9C 1SI9A 4LF8F 5KRTA 2I5JA 2CFXA 3PIPL 4WE1A 1JIHA 3WXKA 1RK8A 1Z4UA 3MUVP 2Z1IA 1J54A 4W5QA 3NHGA 4B3MK 3AVIA 3EO3A 3D0HE 3M9MB 1B70B 4B1UB 3MM5B 4QPXA 4M3YA 5H1SQ 3OL6A 3R5AA 2FBVA 1WSRA 1WOPA 4PUOB 5AQRA 3TA0A 1GLEG 1U24A 3VGUA 1N32J 1I94K 5DLFA 3L8BA 2XZTB 4NLQA 1O1WA 3PW0A 1M1GA 3PX6A 2EKNA 1NK7A 4PKGA 1E4GT 5B7WA 2CRLA 3KK2B 5L1IA 3J7ZO 2X3GA 2KB2A 1CJVA 4E89A 4ZP8A 1N33J 3NMRA 1FXDA 3A1YG 2U1AA 3Q86A 1N32K 2DCUB 2XULA 2VQEJ 1HARA 1RBLA 2IPOB 1TK8A 4CZKA 3KJVB 2E44A 1FXLA 2MMYA 1UWBA 3I56S 3IFEA 2J6UA 4QAGA 1F0XA 1O8BA 3DXMA 1V5VA 3KD5E 5L38A 3HFZB 2AJQA 1RWOB 2KU7A 3AXKA 1IVZA 3BGFA 2ZJPQ 2F4VK 1KBRA 2BKPA 2DK2A 3CIZA 1KVIA 1TUYA 5E3AA 4H0OA 1ELOA 2RD5C 5GAHI 4AH9A 2R7RA 2HGNA 4M5HA 2XY5A 1S0MA 1ZPWX 4CHYA 2VCPA 4A8KA 3O44A 1WHYA 3D7EO 2CQHA 4WFNL 4O3OA 1QSLA 4PXCA 1KDNA 4JI7F 2FBXA 1WG5A 2KYZA 2VBXA 3PYFA 4F8RA 5ADXA 2HEKA 2ZHAA 1U8SA 2MZ1A 2MYFA 3V2UC 1S97A 2F9TA 4ANDA 1F5BA 1GNKA 4CW7B 2BEFA 4R5PA 3CTRA 5B0GA 2HHWA 4DR5K 1RCXB 4JYAJ 4DTSA 3Q8QB 4Q2LA 4OZ1A 3EKUA 1NK6A 3ETMA 4FXVA 4Y1DA 4L76A 4WFYA 4K25A 4CGHA 5FIIA 3MR6A 2VFVA 1E4FT 2LA6A 2N4CA 3VCDA 3KJNB 4O4GB 2BBEA 1JL1A 4X64K 4FLXA 1VK8A 4CJSA 1JXVA 1X4AA 4H0VB 3BYPA 2QX0A 1VQ6S 3V6KA 3BZKA 2DVIA 1VQ9S 3NRBA 3FRZA 4IRKA 4BWJA 2QWQA 4NLOA 1TL7B 4FKYA 3BSNA 3GOIA 4WQ5A 3T19A 1NGCA 2FTRA 1R43A 4WFNQ 2DHAA 3WXLA 4ZHRB 2F7VA 1V5IB 3B4DA 1YIJS 2G2YA 1MW7A 3OTBA 3MMBB 2WVFA 3W8PA 3S3MA 1VQKN 2CZ4A 4PL8A 3M32A 4PG5A 2DRDA 4OKJA 4CYUA 4C11A 1U1KA 1KLNA 2V67A 5DG7A 3OFHA 3EMTA 2G8VA 3H25A 5C7PA 2ZHBA 3TARA 4CZJA 4OHZA 4JKEA 4CGFA 2B56A 4HACB 4MAKA 4BC4A 3AO2A 3ZTRA 1WEXA 4OPHA 2HGLA 3QT6A 1RT5B 4ED5A 1IWGA 2ZHOA 2D7SA 5MAOA 3J80Y 5M1FA 3Q0AA 4C98A 2RRBA 3CXCR 2BVZA 3IGNA 3NGZA 1U1PA 1NEEA 4CJLA 1KFDA 2OANA 4KTWA 4CJRA 3R9LA 2CJKA 3RB0A 1GLCG 4FK0A 4Z4HA 2GWJA 4JYAK 1AZSA 5K14B 1VQ4N 3U3YA 4K0KF 3MFHA 1FRIA 4MIBA 2OCEA 1RTIA 4NL5A 4BRIA 4BY9C 2J6TA 1ZBHA 3DOLB 2IAJA 1H38A 5L46A 2WVDA 2CH5A 3CCMN 5CY4A 2HFZA 1ZBLA 2DGWA 3M30B 3MX2A 5KAKA 4CTAB 1C0TA 3PIPQ 2FLNA 2HRTA 1IWAA 4IRDA 4BROA 2QFIA 1OYEA 1BY9A 3U1MA 2ZH3A 3MCSA 3E2EA 4JI8F 2QGFB 4MFBA 2XMTA 3O2IA 2P9KA 3ELHA 2Q31A 3FGVA 4HH0A 4DU1A 5BR8J 4UUXA 3AFGA 1YI2S 1BC6A 4WF9L 1BQNA 1NJZA 3WQPA 1KXPA 3OYAA