3DRSA

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
549
structure length
549
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 148
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drsA05
2VWJA 2ZD1A 4B8AB 4CIGA 4ZTJA 3BJYA 4KHQA 2CKWA 3LPUA 2I1RA 3KLIA 3G6VA 4CGGA 4O44B 4CJFA 4J9NA 4ZPDA 3OL8A 1N5YB 4B9VA 4N5SA 3QEIA 2YKNA 4XO0A 1RT6B 2BR0A 2QKBA 4JV0A 5HLFB 4OLBA 4OL8A 1BIUA 3SJJA 3SI6A 3I5AA 2FJVA 3CO9A 4PQUA 3TVKA 3FQLA 2XCAA 1BI4A 4Y2CA 3VQBA 1RT2B 3SQ2A 4J2EA 3KK3B 3DYAB 1GOBA 1IG9A 3IG1B 3ZT3A 1IKWA 2QE5A 1BQNB 1C2PA 5L1IA 2IM1A 5KG1A 5DG8A 1S0NA 2VG7B 2VG5A 4EP5A 1SH0A 3H08A 3ISND 4PWDB 5KT6A 4CHNA 3H4BA 4HUEA 3QINA 3LPTA 1S6QA 4FK0A 3L2WA 2FLLA 3LDSA 4BWMA 1T7PA 4JLHA 2C2DA 5KI6A 3NCIA 1RT1B 2FVCA 4H54A 4Z4CA 1TAUA 4DTJA 1IH7A 1EETA 3PX6A 1KSPA 1IM4A 3DLEB 4EYHB 1TL3B 4RU9A 1S5JA 4GW6A 3JSMB 4FJMA 3IRXA 2R2RA 2UVWA 3THVA 4N76A 1J9AA 4OKKA 3O4NA 1IKXB 2B5JB 4E89A 1CLQA 3KK1A 3UQSA 3OVNA 4K50A 3H59A 4IR9A 1C1CB 4GC7A 5SWMA 1EKEA 4I7FB 3V9WA 4Q5VA 4BE1A 4FJLA 1TK8A 1RCHA 5KG5A 2E6LA 3HT3A 3SUPA 4AH9A 3CM5A 1D9FA 3RBDA 2DY4A 3RRGA 3RMBA 5KT3A 3KMSA 2JC0A 1CZBA 4ZVEA 4WYLA 2V0NA 1EP4B 4IRDA 1BIZA 3OLAA 1LW0B 3QEPA 4E7KA 3G6YA 4ZP8A 1RT5B 2IBKA 2PZSA 1HYZA 3PX0A 4CERA 1SUQA 4OPJA 1KRPA 3MECA 4O4GB 3L8BA 2C22A 2R7YA 1JLFB 2WONB 1LWFA 4NYNA 5JS1A 3V9SA 1YVFA 5SZTA 2R2TA 3I0RA 2HHWA 3DI6A 3KLFA 4C8NA 2HHTA 4W5NA 4DTPA 2UUWA 4CEOA 1CXQA 5L1JA 3OHBA 4FM0A 4OGCA 1FKOB 4JV2A 4K4TA 2HVIA 1VSEA 1JIHA 4DQSA 3V6DA 3CG7A 1LW2B 2HNYA 4CGIA 3TAFA 3HVAA 2PYLA 2Q3SA 1WN7A 1MU2A 3E01B 1FKPB 3DLBA 2UVRA 3CYMA 5F9LA 2R8GA 4HCBA 3ZSOA 3OYGA 5KFIA 3UDLA 4IFYA 3VQAA 1J54A 5J2MB 4DSIA 5HROA 2C2EA 1VSDA 1XHZA 1S1UB 4Y1CA 2GUIA 3KIOA 1REVA 1BCOA 3OHAA 1TV6B 4FXDA 4NCGA 3LAMA 5DGBA 4WZMA 4KRFA 4EO6A 1ASVA 1VRUB 1HNIB 4DMNA 3DOLA 1LAWA 1QSYA 4TN2A 3DRSB 1IKVB 1MMLA 1D0EA 1Z25A 5EUHA 4QW9A 3CVKA 2FVQA 5KFXA 2EC0A 3V81B 1BGXT 3DMJA 2GBZA 3FFIB 4YP3A 4KTWA 2ZQBA 1Q9XA 3QERA 2IGIA 5HRRA 2ILZA 2IJFA 4U6PA 2UVVA 1QSLA 1VSLA 4Y1DA 1OS5A 4RW8B 4E7LA 4XPCA 2EHGA 1NNDA 5KFBA 2FJWA 3FRZA 4OVLA 4R5PB 2JEJA 1HNVA 5C25A 5I42A 2EX3A 1JKHB 1TKZA 4IG0A 1HQEB 2DPIA 3K5MA 5F9NA 3M9NB 1ZBLA 1RBRA 2QXFA 3OYNA 3O3GA 3RAQA 4MK7A 4LH5A 3HL8A 1ZBHA 3MFHA 3RMDA 4R8UA 2IC3A 3QEWA 1QQCA 2E6MA 4KV8A 3H5UA 1G15A 1N48A 1S6PA 4O3NA 3M8PA 3V6HA 4WE1B 3C6TB 3RMCA 4RNHA 1RTHA 3I0SA 3MXIA 2IJNA 4CJWA 1J5OB 1NK4A 4O3OA 4WXWA 4KHYA 4LSLB 1LWCA 3ZT2A 1O1WA 1TK0A 3EZUA 4DSLA 3NH1A 4B08A 4CHYA 4ECTA 2X6SA 5K14B 4ZP7A 5KFMA 1J53A 4EBDA 2J6TA 2XY5A 4ZVGA 3MEDB 3EY1A 3KMQA 3HYFA 2I5JA 3QGIA 3GQCA 3TAEA 3CJ5A 2F8EX 4C8OA 2AQ4A 4FM2A 3I5CA 1WSIA 4IH7A 4O4RA 1T05B 4ED3A 3ZT1A 4DF8A 4QWDA 3SPYA 2XCPA 4Q43A 3LP2A 3PJWA 1A5XA 4KHNA 3K57A 1TKTA 4CJKA 4GC6A 4CJSA 3NAHA 5HBMA 4IDKB 2HNZB 1HPZB 1RT7B 4B8CA 5J1EB 3V6KA 4E19A 3TWHA 3EZ5A 2O4GA 1RYSA 3S9HA 3I5BA 2ALZA 1HQUA 4F4KA 2XI3A 3K58A 4M3TA 1KVBA 4N56A 1T3NA 3LZIA 4NLVA 3HSTB 4M3UA 3KK2A 3AO3A 2E9RX 3MXMA 4ZPCA 2P51A 3K59A 2LSNA 4DL7A 4O5BA 2XWYA 4KFBA 1RTJB 2C2RA 2BE2A 2B4JA 4AHTA 1R0AA 1SV5A 2FLNA 4KHWA 2F96A 2QV6A 3HVTB 2BRLA 2G8IA 3M8QA 4Q45A 5F8LA 2QK9A 2ZD1B 1C1AA 4J9SA 4O0IA 1VSJA 4HKQA 4TY8A 3ZSRA 2V4QA 5J2PA 1XR5A 3TAQA 2YKNB 4ZVHA 3PW4A 2AGPA 4QWBA 4O3RA 3C6UA 1K1SA 4Y2AA 2OPQA 1NJZA 3DDKA 5F8MA 4J9PA 4ZPBA 2W9BB 4NLGA 4PQUB 5KFQA 4MFBA 2RDIA 3VA0A 5KFHA 2OPPA 3WNFA 3LAKA 3NGDA 1DLOA 1TKXA 4Q0BA 3PW7A 3AA2A 4F4XA 1S1WB 3NAEA 1D8YA 5HP1B 4NLTA 4CEEA 2HMIB 3CJ3A 2YHAA 4EEYA 4FS1A 1F21A 4KPYA 3ZSZA 1Z4UA 4EZ9A 2YNHA 3QGHA 1S6QB 3CM6A 2FBVA 2JEFA 5KT5A 1X9WA 1WSFA 5FDLA 1KVCA 1VSMA 2XGPA 2OPSB 4ECWA 4NLXA 4JS5A 4MKBA 3DM2A 3AVFA 4H4OA 3CIZA 4ZVFA 1ZTWA 1C1BA 4K4ZA 5KFYA 4C8MA 5FROA 3TAGA 3O3HA 4L8RB 4RUAA 4K4VA 5KFPA 3KK1B 3SUNA 1XC9A 1TK5A 2E9ZA 1VSKA 5J2QA 4DQIA 2YKMA 5EWGA 3RB0A 4Q8EA 1NOZA 1CXUA 4CCHA 4CF9A 1Q8IA 1RDCA 1IO2A 1NK6A 5KG3A 1JLQA 3EYZA 4AHUA 4HHTA 4DTOA 1L5UA 3AVMA 4I2QB 3UPFA 1RBSA 2BQRA 4CEDA 1Q9YA 4RNFA 1FXXA 1X9MA 1SUQB 3MEGA 4ZHRA 2B6AA 4OPKA 3AVIA 3KHRA 3RWUA 3AVBA 3T5KA 4K4SA 1LWFB 3KHHA 4K8XA 1A5VA 2IAJA 3HP6A 2W7OA 5KTQA 4ELVA 3DI6B 3KLFB 3M9MB 3VQ4A 1S9FA 1S9GA 4DQQA 4ID5B 5L1LA 2JGUA 5KFWA 5DG7A 3DRPA 3OYFA 4CGFA 3T5JA 3MR5A 5DLFA 3PW2A 1JX4A 3NL0A 3VQ8A 2D3UA 3V6DB 1XR7A 4K4WA 2HNYB 2IMWP 1WNSA 3RB6A 3KHGA 4K4XA 1S9EA 4J2BA 1YTAA 5KFGA 3KOAA 4BDYA 3SV4A 1RT4B 1HMVA 1MU2B 3KLEA 4ECZA 3HPHA 4LY7A 4EBEA 5L9XA 2E4LA 2XI2A 4DTSA 4IFYB 4FK2A 3VQ5A 2P5GA 4CGJA 5HROB 3P1GA 1UWBA 5C42A 1ZBIA 2ITGA 1REVB 1KVAA 4JRPA 3RBEA 2DTUA 3OYIA 3VN5A 1YVUA 4FJ9A 3DOLB 3FQKA 1RTIA 1NHVA 3HP9A 3KLHB 2FVRA 2AGQA 4J2DA 1YTUA 3AO5A 1T03A 4RW4A 3H2LA 2G8WA 3NGYA 1QE1A 4DL5A 4KTZA 1UA0A 3V4IA 3OYDA 5KFKA 4FJGA 5F8HA 1B92A 4RNOA 4ED2A 1A5WA 4C8LA 4M3YA 4MIBA 2FJXA 3NHGA 1HNVB 1S49A 2RF2A 5KFOA 4ECXA 5C25B 5I42B 1TKZB 1JLGA 1S1XA 4IG0B 1UAXA 3SQ0A 4CE9A 3T1AA 4TXSA 1VSHA 2ASJA 4QWAA 3HKWA 4R8UB 3BR9A 2IC3B 4YMEA 4IRCA 3HO1A 3AVLA 3CWJA 1CZ9A 4AHCA 5HRNA 3K5NA 1RDAA 4DF4A 3M8PB 4IFVA 3I0SB 2OH2A 2AGOA 3ZSQA 4PUOA 5KG0A 1LWCB 1T94A 4NLYA 4CJTA 3SQ4A 4DLEA 4FZZA 4AHSA 4MKAA 3TI0A 1IKYA 2G8UA 3DLKA 1FK9A 1WNEA 1RDDA 1I39A 3LP3A 3ZSVA 2HNDB 1NK0A 2PYJA 4IKFA 1KHWA 3K5OA 3HHKA 5C24A 1TL1A 4CIEA 3LP0A 4Z4EA 1WSEA 2WB4A 1C0TA 3OJUA 3D0PA 4KHUA 4QCLA 4NLWA 3H5XA 1U49A 3OS2A 2ASLA 1S1TA 4CK1A 2ILYA 4CEBA 3T19A 2HWIA 4E1NA 2HHSA 2YNGA 1TKTB 4DTNA 4DL3A 2FC0A 2KFZA 2ZE2A 5DK5A 4FBTA 4EO8A 3U3GA 4URGA 4H8KA 1N6QA 5KFAA 4KE5A 4YFUA 3SPZA 4JUZA 1S1VB 4DL2A 4ED0A 1HYSA 4B9SA 4DFMA 3M8RA 4RW9B 4ECSA 3L2VA 1HQUB 2PY5A 3M9OB 3SV3A 1Z26A 3A2FA 3JYTA 3PO5A 3KK2B 1BQMB 4M42A 4KKOA 3H5YA 4NLSA 1JLBA 3AA5X 2XHBA 4XPEA 2BE2B 1R0AB 2YNIA 4HYKA 1HRHA 4DTUA 4MH8A 4W5TA 4F4WA 3PZPA 1ASUA 4E3SA 3EPIA 4Z0UA 3M8QB 1RYRA 1JXLA 4B9UA 3OJSA 4CF1A 4B9NA 1RT6A 1NKEA 3QIPA 3RRHA 3BSAA 4ZP6A 3QETA 3MXJA 4TY8B 3RB3A 4OJRA 5J2PB 3GIIA 3MR3A 5CZ2A 4CK2A 1KTQA 3G10A 2KQ2A 1TQLA 1U47A 1RT2A 1RTDB 3HM9A 4HUFA 3C6UB 2R2UA 3IG1A 3LP1A 1U09A 4DFKA 3OS0A 2Y1JA 4MFBB 3G6XA 3VQQA 1WSJA 2OPPB 1DLOB 1TKXB 3SCXA 3IAYA 3UR0A 3DRRA 1KFSA 2KW4A 4KREA 1S48A 1JLEB 3MTKA 4NLDA 3AV9A 3PW5A 4ICLB 2XC9A 4PY5A 4IKAA 4F2RA 1RT1A 2BRKA 2YNHB 1VSIA 1TAQA 4Z4IA 4C8KA 3DLEA 5L1KA 1TL3A 1C6VA 4J2AA 4M95A 2D0BA 3AVHA 1NK5A 1RDBA 2JLEA 4YR2A 5DG9A 1JL2A 3M8SA 3TARA 3QLHA 4DSFA 3PR4A 3DM2B 3K5LA 3ZT4A 3OL7A 4H4OB 3ULDA 1BL3A 2VG6A 4MIAA 2XY6A 3CFOA 4ECQA 3DLHA 3QEXA 3QEVA 1N56A 3C95A 3KKRA 4RZRA 2JC1A 4IBNA 2GIQA 4ECVA 4IRKA 1RBUA 3F73A 3CDEA 1JLQB 4CK3A 2KZZA 3KLGA 3SI8A 4O4GA 1QAJA 2AJQA 1NJWA 4DL6A 4DU1A 1QHTA 1JLFA 4AILC 3DOKB 5CYMA 5F8IA 3UIQA 3QO9A 3MR6A 4Y3CA 3KNAA 3RAXA 3MEGB 2OZMA 1VK0A 2B6AB 4FJ7A 3L2QA 2IAJB 3L2UA 4WZQA 3O4QA 1SKSA 4G1QA 4DWIA 4M3XA 1NHUA 3ITHA 1RA6A 1FKOA 3HXMA 1JLAA 1S9GB 2D7SA 5I3UB 2BQUA 4DG1A 3DRPB 4IG3A 4KHRA 4BE2A 4ID1A 1SL0A 3NF7A 4KB1A 3OSNA 1I6JA 3NF6A 4DQPA 5KT2A 3V1RA 3DLGA 1B9FA 3OYBA 1DTTA 1HMVB 5KFUA 5FRMA 5EWFA 4J9QA 1TV6A 3KLIB 1S0MA 2BDPA 4F4YA 4CEZA 3V1OA 3KD5E 2VA2A 1WSHA 4F8RA 3SFGA 1QTMA 1UWBB 4I9LA 3OYCA 2O5DA 1S10A 2OPRA 4WYWA 1I3AA 2WTFA 3OL9A 2QKKA 3KD1E 1JXEA 4DU3A 2DFEA 3QZ7A 3AA3A 1RTIB 1BI4B 4OLAA 1JLCA 3VQ7A 4J9OA 1IKWB 4RW8A 3GV5B 4B3OA 1T03B 3HPGA 4RW4B 3EPGA 3HPOA 1QE1B 4ED8A 4LQ9A 3P5JA 3V4IB 4HUGA 2V4RA 2VG5B 1WAFA 1EXQA 2BANA 1JKHA 1RT3A 2G8FA 3IS9A 3MEEA 4JRQA 1NK7A 4E1MA 5KG6A 1ZYQA 4OKJA 3OSPA 2RF2B 4HTUA 3H4DA 4O55A 1JLGB 1S1XB 2YNFA 3MFIA 2R2SA 5JS2A 4IOBA 3S3OA 4NYZA 2FBYA 3GV7B 4U7CA 2R8JA 1KLNA 1L3UA 4KO0A 4DS5A 1EETB 3OY9A 3HJFA 3BGRA 4CFDA 4LD0A 3IRXB 4KHMA 3C6TA 3TABA 3PV8A 4PA1A 3MR2A 3OYKA 3SNNA 4IFVB 5JUMA 1D9DA 4FJ8A 4H4MA 3B6PA 2ASDA 2Y1IA 3H98A 3OS1A 5K14A 3QESA 3ISNC 1HARA 4PUOB 3O3FA 2V9WA 5T14A 4NRUA 2DFFA 4QW8A 3KJVA 4KB0A 4TY9A 3RTVA 4CECA 2Z1HA 3N6LA 1IKYB 1FK9B 3MECB 1KLMA 2HVHA 2WOMA 5DQIA 3VQDA 4HVJA 4XIUA 3KLVA 5C24B 4Q44A 4TQSA 3AO4A 1C0UA 3L3VA 1TL1B 2G8KA 3PY8A 4EZ6A 3LP0B 4ELUA 4F2SA 3I0RB 3VQ9A 4N47A 4NZ0A 3GIJA 1X1PA 2HW3A 3CDWA 4DEZA 1S1TB 5DMRA 4FZXC 3Q8QB 2WCXA 1S4FA 3SQ1A 4DSEA 4Y34A 2XY7A 5F8JA 4CJVA 1D5AA 4ECUA 2RKIA 3N6NA 3GIKA 3BQ2A 2W9CA 2HHVA 4FBUA 4EP4A 3ZSXA 1KCFA 4RW7A 3NBPA 3NH2A 4QWCA 1N6QB 2FBTA 4DFJA 3GV8B 4ELTA 3S3MA 1TVRA 5DLGA 3BSOA 2GIRA 3PX4A 5J2NA 1RBVA 2YV0X 4NLPA 4W5OA 4FJHA 3P83D 2R8KA 4J9LA 4J9KA 4W5QA 3JYTB 3AVGA 4X2BA 3CQ8A 4KKOB 5D3GA 1VRTA 2FLPA 4CJPA 4DSKA 4CF8A 2J6SA 4NCGB 1JLBB 1BISA 2FBXA 1ZETA 3VQCA 2RDJA 5KFZA 2YNIB 3LWLA 2WK4A 3GIMA 2HHQA 1ASWA 4E7IA 1RA7A 3NDKA 4FLVA 2R8IA 3K2PA 4CJEA 4E7HA 2X74A 4ECRA 1K1QA 3QIPB 5KFRA 5KFNA 4CJUA 3DMJB 3C94A 4AHRA 1JXBA 2A1SA 3ZT0A 1QUVA 4CJRA 2W9BA 4ZTFA 4FJNA 5CZ1A 2KTQA 1W25A 3WNEA 1QAIA 1S1WA 3LP1B 4LSNA 1DTQA 3VQSA 5HP1A 2HMIA 3FSIA 1NOYA 3TAMA 3BSNA 4FJXA 4I2PA 2IDOA 3DRRB 3LALA 4M3RA 3G86A 4CJLA 4M3ZA 4ED6A 4DLGA 3PO4A 4M94A 3QNOA 2W8KA 2D41A 2F8SA 4KV8B 2OPSA 2AU0A 1RNHA 4FLWA 1S6PB 4RW6A 5KRTA 1ZBFA 3PW0A 1RTHB 1NJXA 2W9AA 1S0OA 2C28A 3QLHB 1WAJA 4IH5A 4ED7A 4FVMA 1ITGA 3PHEA 4AHVA 2VG6B 1NKBA 3CJ2A 3MAQA 4CGHA 3QZ8A 1UOCA 4FZYA 4KHSA 4KSEB 2I5JB 3FDSA 5KGWA 4CF2A 2W42A 4B9TA 4RNMA 3NE6A 4I2QA 4NLRA 4QAGA 2G8VA 1EX4A 4FLZA 4DU4A 4Z4HA 4J9RA 4WFXA 2W8LA 3KLGB 3F9KA 3LP2B 3KKSA 2RN2A 4FCYA 4CEFA 5DQHA 5CYMB 3BQ1A 4CJ4A 3NF9A 3QO9B 3SFUA 5HBMB 4BACA 4WFZA 4FJJA 3QIDA 4FW2A 2XGQA 3PUFA 4ID5A 1UA1A 3CFPA 4G1QB 4R0EA 2BGGA 2D0AA 2E9TA 4RUCA 3ITHB 3NF8A 3QGGA 4CEAA 4CHZA 1U48A 1JLAB 1LWEA 3BDPA 1U4BA 3RR7A 3PVXA 3IGVA 3V9XA 4ED1A 4DG1B 4IG3B 2WRMA 5KFSA 1C0MA 1HJRA 4Z4FA 1RT4A 4NRTA 3Q8SB 3HK2A 5CYQA 4KFBB 2ETJA 4F3OA 4DQRA 1RDRA 1SV5B 4KI6A 1TGOA 3WNGA 4O44A 4O0JA 4FS2A 4JS4A 5HRPA 5CY4A 1N5YA 3DLGB 5KG2A 3S3NA 1DTTB 1SL1A 2Z1GA 2KFNA 3TQ1A 3HVRA 4FLYA 5HRSA 2IM3A 5HLFA 3ASMA 5KT4A 1SL2A 4TYBA 5T7BA 1YT3A 3OYJA 4DTXA 4O3PA 3PJXA 2HHUA 3AVKA 4W5RA 2OPRB 1W9HA 2X6NA 3ZSWA 3KK3A 3DYAA 2OPQB 3BSCA 3KLHA 3AO2A 3VA3A 1BQNA 4URSA 3ICLA 4FLXA 3H40A 4NCAA 2XRIA 4ZMMA 1JLCB 4G3IA 4RNNA 1QSSA 1D1UA 2VG7A 4Q0BB 4PWDA 3OYAA 5DQGA 3VQEA 4B3OB 2W7PA 3D45A 4FK4A 4M41A 4I9QA 3DLRA 4DL4A 1BCMA 5C5JA 3Q8RB 3TR8A 2BANB 3B6OA 4TLRA 1RT3B 3IS9B 3MEEB 4IH6A 1XR6A 4YNQA 3GILA 3V6JA 2GC8A 1Y97A 3NFAA 1T8EA 3OYHA 4CGDA 2D0CA 2HAIA 4FJIA 5EWEA 3JSMA 1K6YA 2HB5A 5FDLB 4OKEA 2FVSA 2VA3A 1IKXA 2B5JA 2YNFB 4Q8FA 2D3ZA 4FYDA 4ZP9A 5F8GA 4K4YA 1C1CA 4KO0B 2AWZA 4URQU 4I7FA 1RBTA 3BGRB 1C1BB 4CEQA 4F50A 4O3SA 3I8DA 2ATQA 3OYMA 4O3QA 4CIFA 3G0ZA 1ZTTA 3D28A 5J2QB 3BREA 2YKMB 1EP4A 1LW0A 4QPXA 1SKRA 4BDPA 3L3UA 1SH3A 3T3FA 5EDWA 1ZBUA 1WLJA 1RT5A 1W0HA 4UQGA 4H4MB 4HCCA 3CDUA 3AA4A 4KBIA 2KZMA 3NGZA 2HNDA 4FLUA 2R8HA 3KJVB 3ZCMA 3SZ2A 4K8ZA 2WONA 4CJ3A 1NJYA 4KAIA 3PR5B 2F8TA 5KT7A 4ZHRB 2D5RA 5EU7A 2CJQA 1KLMB 1LV5A 2WOMB 3D5MA 3ZSYA 1B9DA 3LWMA 1C0UB 2FVPA 1S97A 1KFDA 1GX6A 4JV1A 5KFEA 1GX5A 4CFAA 3RMAA 3CJ0A 4CF0A 3OL6A 1TP7A 1LW2A 4TSXA 4FJKA 2AX1A 3OYEA 2UUTA 1XI1A 2RKIB 3RR8A 1S1VA 4E0DA 4LQ3A 4NLOA 1WSGA 3AVCA 3AO1A 3E01A 2W9CB 4MK8A 1GOAA 1FKPA 4RW9A 4RW7B 3NBPB 2ATLA 4WXOA 1S9EB 3U3YA 4CHOA 5KRSA 3KHLA 4QOZB 1LAVA 3V1QA 2IS3A 4BWJA 3V9UA 4B9LA 1BQMA 1TVRB 5J2MA 4DTRA 3KLEB 1S1UA 5J2NB 4YR0A 4EBCA 3WNHA 3CJ4A 3T5LA 2BQ3A 3VQ6A 4CFBA 1JL1A 2XY8A 3QIOA 4NLUA 1VRUA 1HNIA 4OGEA 5D3GB 5C42B 1VRTB 2HWHA 3DRSA 4NYFA 1IKVA 4M45A 4J9MA 3IN5A 4FLTA 4MQ3A 3GYNA 2DPJA 5KFTA 2NUBA 3V81A 4TQRA 4DSJA 2UVUA 3FFIA 2A1RA 1RAJA 3MF5A 3NMAA 4BDZA 1BHLA 3N6MA 1U45A 1RTDA 3SYZA 4YR3A 3NH0A 3AVNA 3L2RA 4KAZA 5JXSA 4R5PA 5KFDA 3BQ0A 4N41A 4NCBA 4NLQA 3E51A 1HQEA 4CJ5A 4FW1A 1TKDA 4Z4GA 2P5OA 4WFYA 4LSNB 3TAPA 3Q8PB 1DTQB 5DGAA 3OYLA 3NKYA 1L3VA 2JEIA 2VWKA 4IR1A 4ZPAA 3TAMB 1JLEA 4QWEA 4E7JA 4ICLA 3OLBA 4I2PB 3U6FA 1RILA 1L3SA 2OYQA 1CSJA 5KG7A 1QS4A 1SKWA 4K4UA 3NAIA 4WE1A 3CFRA 4CHPA 1J5OA 3ALYA 3V9ZA 2G8HA 3SUQA 3QYYA 4LSLA 4RW6B 5KFJA 4CFCA 2HHXA 2AX0A 1N4LA 4YQWA 3MEDA 3HVWA 3IGNA 4DFPA 2P1JA 2J6UA 5KG4A 2YHBA 2IM0A 2DFHA 4CJQA 1HYVA 3AVJA 4DS4A 5KFLA 2JEGA 3H5SA 3DLKB 4F3TA 4GMJB 5E41A 2IA6A 4FJ5A 1T05A 4DTMA 4B9MA 2XO7A 1KHVA 2X78A 1NK8A 3DOKA 1C0TB 5FRNA 4KB7A 5F8NA 1VSFA 2Z1IA 2Z1JA 2IM2A 4M3WA 4IDKA 2HNZA 2WHOA 1HPZA 1RT7A 3VQPA 1NK9A 2YNGB 1XHXA 5J1EA 5KFFA 4FM1A 1SH2A 4EYIB 3T5HA 2IOCA 2ZE2B 2RPIA 4LH4A 3KTQA 1L3TA 4KTQA 4RG8A 4BE0A 4TYAA 3AVAA 4F4ZA 1GOCA 3LZJA 5I3UA 2GV9A 4IQXA 3LANA 1HYSB 3NGIA 3RB4A 4MK9A 3QNNA 1XWLA 2ZKUA 5KFVA 3TANA 4CESA 1LWEB 5KFCA 3SUOA 1NKCA 1RTJA 2B43A 4CHQA 1U04A 4KI4A 2OA8A 5KGXA 4ECYA 1X9SA 3HVTA 4GVMA 2O4IA 5CYQB 2OZSA
chains in the Genus database with same CATH superfamily
2J0SD 3BJYA 2CKWA 5A0YA 4H0XB 4CGGA 4CJFA 4DV5K 2V8VA 4LFBK 5EXWA 4B9VA 4YOYA 3QEIA 3TA1A 4EIAA 3BM7A 5CHIA 2MJNA 1AFJA 2QKBA 4JV0A 3MWTA 2CQ3A 4DR3F 3I5AA 3CO9A 1A9NB 2XCAA 4Y2CA 3VQBA 1RT2B 1Y3KA 3VAMA 4HDHA 1GOBA 1IG9A 3IG1B 5MLCV 1IKWA 5BREA 1NG9A 4USMA 1BQNB 2G2ZA 3S1TA 5LJWA 3CCLN 2IM1A 2VBXA 1YI2N 2VG5A 1SH0A 3MM8A 4CHNA 1F0XA 4LBHA 3H4BA 3QINA 1HI0P 3HFZB 4H4KA 3Q24A 2LXFA 3J8AA 1T7PA 2C2DA 1N36F 1RWOB 1IBKJ 4AUKA 4DR6F 1O5JA 4EYHB 4GW6A 2R2RA 2UVWA 4N76A 1IKXB 1HNZK 3KK1A 3OVNA 1RWKB 4FWQA 1EKEA 4RR5A 4CO4A 5LXYA 4X66K 5KG5A 4CZJA 3SUPA 2CGKA 1N5VA 3NEKA 1D9FA 4CJ7A 2DY4A 3RRGA 3RMBA 4QR2A 5KT3A 2GHWA 3OLAA 2HFVA 1LW0B 3HTVA 1GLFO 3G6YA 4ZP8A 1Q1KA 2IBKA 3BEGB 1KRPA 4CERA 3MECA 3L8BA 2W2NP 1LWFA 4NYNA 2NS1B 3VVUA 5B8HA 3V9SA 2FD2A 2KXHA 5SZTA 3DI6A 4C8NA 1HWUA 2LDIA 2YKAA 4OYAA 2B9WA 4KHPJ 1WI6A 2UUWA 4LFAF 2RHKA 1FX4A 4NYOA 4K4TA 2H9ZA 1OQ6A 4OX9K 4CYUB 3V6DA 4CH7A 4IZ9A 4CGIA 1IJJA 3Q89A 4WIQA 2QSWA 2H48B 5D0HA 3Q8UA 3H1QA 2Q3SA 3CMQA 1MU2A 3E01B 1FKPB 3DLBA 3H3NO 2R8GA 3ZSOA 1KVKA 3VQAA 4RU2A 5HROA 2C2EA 5T7LA 3KIOA 4FWLA 1BCOA 1TV6B 2J9DE 3K17A 2DGVA 2LDYA 2MMYA 5L39A 1QUPA 4EO6A 1VRUB 1F9EB 3DOLA 3TPQA 5HOOA 5B0CA 1BXNA 3DRSB 1MMLA 4B3TF 1Z25A 3HZEA 2RE2A 4I4BA 3EKSA 1OWXA 2P9NA 4USVA 4QW9A 2FVQA 4Y65A 3DMJA 3HOSA 2XBPA 4YP3A 2AP1A 4A61A 1NZ8A 1QSLA 4DR3K 2WSCC 1HW8A 4Y1DA 1N5SA 1OS5A 8AT1B 1MMDA 1NNDA 3PDNA 8RUCA 2P5VA 2JEJA 1NH8A 3FZFA 5F3ZA 1QLNA 4USTA 4GKJF 5C25A 1JKHB 2DR6A 1HQEB 2DPIA 4A46A 5F9NA 1WSVA 3OYNA 4MK7A 1UEUA 2DJWA 1RHMB 3HL8A 2HS3A 4R8UA 3QEWA 2BJ9A 2MZTA 1QQCA 2E6MA 3H5UA 2Z56B 2BX6A 5GAGI 1N48A 4P9SA 2E8AA 1YXQA 3F44A 3M8PA 1N36K 4F02A 4WE1B 1AYEA 3CIMA 4RNHA 1P90A 3RMCA 4F0MA 4YOEA 2IJNA 4O3OA 4WXWA 4KHYA 1LWCA 1O1WA 2XMMA 4G1PA 3TRGA 4ECTA 5IXUA 1UMJA 4ZP7A 1VQ9S 2XY5A 3HYFA 2CNLB 3QGIA 5CXTA 5JVHQ 1N33F 2CJBA 1ATRA 3I5CA 2XS7A 1RQ0A 3WXMB 4O4RA 5AXLA 2DR7A 2LKZA 4ED3A 1ZM2A 1U02A 4FXWA 1TUGB 2MDAA 5AQPA 3LP2A 2OIHA 4KHNA 3K57A 2VD3A 1TKTA 2O8EB 4GC6A 5B0EA 1D09B 3M8YA 4C3KA 5HBMA 3MPDA 4QYZJ 2QMXA 2N82B 2HNZB 1HPZB 4CO1A 2GQCA 4OIXA 3MD3A 3V6KA 2A42A 4EUVA 2GFFA 1RYSA 3LDLA 1RK8A 2ALZA 1HQUA 3UKRB 3ZTSA 2P6SA 4LFAK 2XI3A 2BXJA 1N88A 4FWSA 1KVBA 1GEHA 3HSTB 4WQ5A 2I2YA 2E9RX 1Y4ZB 3H20A 4Z37A 2K1RB 3QAUA 2VQEF 5F0WA 4DL7A 2LU2A 4B1ZA 4KFBA 1RTJB 4JK9A 4ETZA 1Q82O 2BE2A 4CIOA 4MMOA 1RAGB 4KHWA 4YDDB 5AZIA 1ZAVA 2YHWA 1AB8A 2UUCJ 3UVJA 2VASA 4YDXA 1C1AA 1S6UA 4O0IA 1X60A 3ZSRA 3JS9A 3DC2A 5J2PA 2BKOA 1XR5A 3PFEA 1XUPO 2CADA 1YRTA 4O3RA 3QRQA 3UWTA 3Q83A 2KI2A 4J9PA 3DGVA 2W9BB 4PQUB 3SMSA 1FWKA 5BPLA 3LAKA 1SC4B 1SXLA 3NGDA 1DLOA 3W66A 4F4XA 4IXCA 5B0DA 1D8YA 4NLTA 2QI2A 1RACB 4FS1A 1ULRA 4NO7A 2B4UA 4FVCA 4FSVA 1UVIA 4KPYA 1T3OA 3ZSZA 3ULEA 3UKUA 2NXEA 4NWBA 5A6WA 1O51A 1YX2A 4M7YA 1GLCG 4PL8A 2DHSA 5AQYA 4ECWA 4WYBA 3L4BC 4LRDA 1N8RO 2YWHA 4MKBA 3DM2A 2ZITA 3C16B 2C2KB 2NQPA 3KZBA 5FROA 1EB0A 3TAGA 4L8RB 3THYB 5KFPA 1CPZA 3J80U 3RB0A 5AQWA 3CHWA 4Q8EA 1NOZA 4CCHA 4CF9A 3PLAA 1NK6A 3EYZA 4AHUA 3JTPA 3NNHA 1YJNN 3OR2A 1CULA 4I2QB 1VISA 2HFNA 3UPFA 4M5JA 1FXXA 3FZBA 5GAGU 3MEGA 2L3MA 4OPAA 2B6AA 2ZKTA 4ZK7M 1XC3A 3KHRA 5IQ6A 3O2IA 1M1HA 4K4SA 2QC3A 5LJ5Y 4JI4K 3SQGA 4K8XA 5I3PA 3GDQA 3HP6A 2W7OA 2F9TA 4DOZA 2Q3PA 3M9MB 5IT0A 2QL7B 1RABB 4EU0A 3NRBA 4A8KA 4JI6K 5DG7A 3DRPA 3P5TL 3JTOA 4WQ4C 4CLLA 5A6PA 1VQKS 4DR4F 2YH1A 1RHUB 5D4PA 1JX4A 2KM8B 4DR2K 2HNYB 1WNSA 3RB6A 4KBOA 1S9EA 1J5EJ 3M30A 3VCDA 1U7LA 1U6FA 1QM9A 4BDYA 3O6QA 3WIVA 3PRVA 2GAHC 2ZGYA 5FIIA 4ECZA 2Q1NA 1K73O 2E4LA 1RADB 3W60A 4DTSA 4IFYB 4FK2A 3H46O 3TUJC 3AQOA 4X4OA 3G8TA 2KH9A 4XH4A 3ILIA 2FJAB 1LCUA 4X4UA 3RBEA 4CTAB 3N4QA 3AJ1A 4KC5A 3VN5A 4IO9Q 2HBMA 4MYUA 3BF1A 5HN0A 1RTIA 2F5GA 3HP9A 4NMXA 5H1SQ 4QR0A 5IM0B 4AL7A 1KNZA 3KLHB 4NI2A 3VF6A 3C2PA 3U1LA 2AYMA 4J2DA 3CJTA 1T03A 4V19J 2J9DA 5AQLA 3HFKA 2YX1A 2P9CA 4RNOA 4DPYA 2IYIA 4C8LA 4LF9K 3U1MA 3CCSS 1NXIA 2CA9A 2FJXA 5FLXU 3HHDA 3LF0A 2Y0BB 4MJKA 1CC8A 5KFOA 1PSDA 3TR5A 1O13A 4KH1B 1VSHA 4FWMA 4NPOA 4Y0FA 3BR8A 4OJ1A 1HHQA 4N7TA 1CG2A 2DGOA 5F1XA 5MLCQ 3HOTA 3ZNJ1 2A6MA 4OHXA 3VERA 2HQ3A 5KQ8A 3I0SB 1NZAA 4BRGA 2E29A 3ZSQA 4DPTA 2PAVA 1HBUA 3VAIA 4KYZA 4MKAA 2CQCA 9ATCB 4JI7F 4CW7B 1IQTA 3DLKA 1I39A 5GAHI 2J4RA 2PFDA 1NK0A 2VWBA 2PYJA 1WC4A 2A2DA 1TL1A 4CIEA 1XNQJ 1WSEA 3CEDA 3MX5A 3OJUA 4BBYA 4KHUA 1HR0F 2QLBB 4K2XA 4UTGA 3FGVA 3D1QA 4DX6A 4CK1A 1E4FT 2HWIA 1MWYA 2YNGA 3MOJB 2VQFF 4DTNA 2KFZA 2Y9HA 2ZE2A 1VC0A 4EO8A 1T0TV 2W4DA 4ILRA 3VAFA 1TUWA 5KFAA 4P52A 4YFUA 2CFXA 3HD2A 4ED0A 3M8RA 3L2VA 2IHR1 3PEHA 3M9OB 3SV3A 4KR0B 3NVMA 4B1XB 5ETTA 2WVDA 3U27A 3G2XA 4KKOA 1CQNA 2CPFA 1G3OA 4XEIA 5LMUK 2JWLA 4LFCJ 2QA4N 3JAMY 1HBMA 1R0AB 2YNIA 4HYKA 1HRHA 4E3SA 1HWKA 4FZVA 3EPIA 4Z0UA 4B9UA 3HKZD 4K59A 3OJSA 5JMNA 1FJGF 4I6MB 3BSAA 1U6BA 3N9UC 4DV6F 1FI4A 3GJQB 3MR3A 2LQBA 1KTQA 3G10A 3PIPL 1RT2A 4HUFA 1WBBA 3ET6B 2ZWHA 3IG1A 4DFKA 2KXNB 3OS0A 4MFBB 1IBLK 4LF5K 4TU8A 1TKXB 5CHCB 4WU3A 3I6PA 1KFSA 3GYXB 4PWUA 2NPIA 3MPUB 2POKA 1JLEB 1WHYA 4NLDA 2FJDB 5ADZA 3PW5A 2GO9A 4PY5A 4IKAA 2BJ3A 2BRKA 3MN5A 2E5LJ 4C3MA 5L1KA 3CCUS 4J2AA 3AVHA 2BUNA 4G6VB 3LPYA 4CO0A 1A7GE 3AB4B 2MZ1A 4DSFA 4DZ6A 2F3JA 3IAS9 2K3KA 4MIAA 2Q31A 3MZIA 4DV0J 3DXMB 4LF1A 3UNGC 3KKRA 2UXDF 4GVLA 4RZRA 2V67A 2GIQA 4IRKA 2ZJPL 1CJUB 5G0RA 5BR8K 2A6AA 4IJNA 1UJ4A 5KPTA 4AILC 2M88A 2M2BA 5CYMA 2ZM6J 4NZ6A 4Y3CA 2PI4A 4YOWA 1UP1A 4CZCA 4B17A 4FJ7A 2UZAA 3CULA 4ZVQB 3VEVA 3TZZA 3L2QA 2IAJB 1ILYA 1NHUA 1PC4A 1YUWA 4TVAB 3R6LB 3OQ2A 5ELZA 1OIAA 3NGKA 2VV5A 4IG3A 4KHRA 5GAHU 3U9ZA 4BE2A 1BWFO 4OJ3A 3NF7A 4EGLA 2QFIA 4I1TA 2MYFA 1MWQA 2CAJA 2KO1A 4DV7F 3NGRA 4ENOA 4JI5J 3V1RA 3DLGA 1B9FA 3OYBA 5FRMA 1UVKA 2F4VK 1DQ9A 3F5TA 1QVFM 3SBMA 2DYAA 2GVDA 3KXDA 2O8BB 4PAAA 1TV6A 3KLIB 2BDPA 2RD5C 4QPTA 4CEZA 3B54A 4F8RA 1RP5A 2VFUA 3IWNC 3FMWA 1S10A 4X65J 4NB4A 1BA0A 4WYWA 1I94F 2RS8A 3QZ7A 1FJGK 4OLAA 1NB7A 2Y0SD 4X84A 4CH0S 2FY8A 2OI2A 4J9OA 4JI1J 3PKMA 4B3OA 2E7WA 3JQMA 1QJHA 3HPOA 1QE1B 1GNKA 4E8UA 4Q7AA 3BH7B 3MAAB 1JKHA 3CMEN 3TA2A 4DCPB 4BRLA 2NPFA 3RUBL 3P49B 3UB5A 4JRQA 2W41A 3I31A 4E1MA 3OSPA 2RF2B 2R9LA 1H2VZ 4X62J 5JS2A 4IOBA 4NYZA 1F5CA 1ROFA 1RSCA 4BS2A 4I6WA 1K8AO 5C2DA 1X4CA 1VHXA 3AOCA 3BGRA 4LD0A 1N34K 2AIRB 3IRXB 1JCGA 4LVNP 4LJMA 5KOWA 3MM9A 1ZZNA 4F3MA 4JV5F 4IDHA 5IOLA 1VDHA 3HHLC 3MM6A 2AA4A 4PYAA 4S0MA 1D9DA 3B6PA 3ENAA 3QICA 3H98A 3QESA 1H74A 4P10A 1HARA 1N52B 3O3FA 2V9WA 1QVGR 2DFFA 4QW8A 3ZNUA 3EM1A 3RTVA 4CECA 3I56S 1HWJA 3DXKB 1FK9B 1D3WA 2J8AA 1MDUB 2YWGA 2WOMA 3WXKA 3CT9A 3IBCB 3OFEA 2FGOA 1XMQF 4RL1A 4JI3J 4XIUA 2LU1A 4TQSA 1C0UA 4DV2J 2G8KA 5DZ6A 2ZNYA 4KHPF 3I33A 2NXCA 4X64J 3VQ9A 3KJNB 3CF5L 5AXMA 2HW3A 1X3NA 5IT9Y 3A0IX 3EZWA 5DMRA 3E8OA 4FZXC 4ECUA 2RKIA 3GIKA 3M6UA 4C6AA 4JI8K 3NBPA 3CPWM 4FPAA 1NDCA 4MKYA 2FBTA 1Q81O 4DFJA 4ANDA 1U1KA 5LJ3Y 2DR9A 4QR1A 4LIRA 1PJ7A 4W5QA 2OANA 2G0IA 2HF3A 4CJPA 3SAHA 2M9KA 2ATCB 3D2FA 2IPOB 4OHZA 1DEJA 3LPEA 1ASWA 3HCXA 5D4LA 4KQZA 1HD1A 1MW7A 2MPUA 5KFNA 3ULHA 2VFVA 3AOBA 2PI5A 4CD3A 2A1SA 4C0HA 2W9BA 2OTJN 2VC0A 4U8VA 2KTQA 3ILLA 4BRQA 2HBZB 3IWLA 4DQ8A 1QAIA 1T9VA 3LP1B 1DTQA 5BPMA 3VQSA 4FVUA 2M7SA 3C19A 3N79A 3T41A 2YCHA 3K0JA 3QWUA 3PO4A 4M94A 3QNOA 2W8KA 2D41A 1IBKK 1FCAA 2CQGA 5I9EB 1OVQA 3UCUP 3EDRB 2IIRA 2AU0A 4FLWA 3Q86A 3WX8A 3HBTA 5ETNA 3QNWB 4M5LA 2RSQA 1NJXA 1S0OA 2Y8YA 2C28A 3ZX2A 4IH5A 2LQ5A 1Z6RA 4LRCA 3MAQA 4O8KA 3QZ8A 1OMSA 1UOCA 2QMWA 2NRXA 3AA8A 5KGWA 4I67A 2MSTA 2W42A 4B9TA 4BVOA 4RNMA 4I2QA 3BZCA 3C8YA 1EX4A 4FLZA 4Z4HA 2H5JB 2QTWA 4IOAL 1WF0A 2XLKA 4RX6A 1Y5IB 3NNAA 2HZVA 3KKSA 4ZIVA 3O1WA 5DQHA 3BQ1A 1NCLA 3QO9B 3SFUA 2QW9A 3S01A 2D0OA 2D1KA 3WZ0A 3QIDA 4FW2A 3QRPA 3PUFA 4PKGA 3NS7B 3LA0A 2CGLA 5LSLA 4R0EA 2BGGA 4CEAA 3CC2N 3E9LA 2QWNA 2WRMA 4HLBA 4M5HA 2ALYB 4NRTA 5F0UA 3HK2A 4NXNK 3SXLA 1LK7A 2Z2ZA 1RDRA 1SV5B 2EG2A 1TGOA 2HHHF 4ILHA 2WC9A 1N5YA 1QQOA 1Y5NB 4P74A 2PEBA 2KFNA 2V7ZA 2VDIA 4F7VA 4FLYA 5HRSA 4V19S 2IM3A 4HHHA 5HLFA 1F5AA 2ZOGA 3MD1A 3R5DA 1IWGA 5T7BA 3EGNA 3L7OA 1KD1T 1D4XA 2FJBB 4DV4F 4JKDA 1P27B 1DFDA 3ZSWA 4BROA 3DYAA 2OPQB 3KLHA 1KC8T 1U2VB 3AO2A 1GK8A 4ZJOA 3FSYA 4Z2XA 4TU9A 2W4PA 1D1UA 2VG7A 3D6TB 4XTTA 1V3SA 4YB6A 2XYGB 4JBCA 4C4WA 1W2IA 3GJRB 3W9IA 3KHYA 3OR1A 5K5MA 3QMQA 2P9LA 5FLXO 4TLRA 2IJRA 1XR6A 2E1YA 3AXKA 4CGDA 3HD1A 4FJIA 3HSGA 4AFFA 5FDLB 2VA3A 2B5JA 1HNXJ 5D6GA 2D3ZA 5D4NA 4ZP9A 5F8GA 4K4YA 2ZWPA 1R59O 4RUBA 1FVSA 5TKWA 1RU1A 4F50A 3OYMA 4O3QA 3LDOA 3OHRA 2JH3A 3D28A 5J2QB 2LVWA 4P73A 1SKRA 2YWKA 2NRWA 1W0HA 2CZVC 1SC1B 2KFYA 3VV2B 4X4QA 2R8HA 3GJSB 2WONA 3O9SA 4ES1A 3PR5B 4ZHRB 5IV4A 1LV5A 1OQ3A 2QLFB 4BG9A 4A8YA 1FERA 2LQ9A 4IJAA 3M2UA 5ETRA 4JKEA 3PIOQ 4FPRA 3RMAA 1GX5A 4QYZK 1QTNB 3CJ0A 3OL6A 1S72S 4GO7X 2YX6A 4TSXA 1NHKL 4NX9A 1WB9A 1J5EF 4PG4A 2UUTA 1XI1A 3W5XA 5AJ3J 3RR8A 5AQFA 4LQ3A 2WUSA 1JNRB 4L72B 2ATLA 5E84A 3U3YA 4MIWA 2EKYA 4OJHA 1TVRB 3KLEB 4IEIA 1R8CA 3R3LA 3TO8A 3KWIA 3K2YA 2HIYA 3DLJA 2ROGA 3VQ6A 2MZRA 3PKYA 4CFBA 2HVDA 3QIOA 4I6AA 4H4KC 1HNIA 2UUCK 4UT4A 1IKVA 4J9MA 3ILJA 3IN5A 4K5RA 1SJ3P 3MWBA 2JJ4D 4WFAL 1TL7B 2DPJA 2BW2A 1NGHA 4DPOA 3FFIA 1NSQA 2MGZA 3I8BA 1IWAA 1U45A 2GIFA 2F4FA 4ZCMA 3A8JA 4HTLA 5IQQA 3QFUA 3NH0A 4KAZA 2ITMA 5JXSA 4R5PA 3KJFB 3BQ0A 1KAYA 2ERRA 2R7QA 5ADXH 3D6MB 3IMXA 2A2CA 3BO4A 2P9GA 2CPXA 5LY3A 4ILMA 4AF1A 2P5OA 2WW4A 3ELHA 3QAEA 1U2CA 4C23A 4WFYA 4LSNB 3Q8PB 5DGAA 2VPZB 3NKYA 3ATUA 4IR1A 3MMVA 3TAMB 1JLEA 4E7JA 1OYDA 3VHQA 3OLBA 3TUIC 4Z7YA 4I2PB 4FNHA 2FZGB 2MLYA 2HK2A 1M1KT 4NL5A 1QS4A 4KGMA 4OI0A 3FUYA 5LT5A 5AQZA 3ENWA 3THXB 1MMNA 4CHPA 1J5OA 3ZZTA 2EKNA 4GKKF 1URRA 3SUQA 9RUBA 1SQFA 5AFUA 5KFJA 1ATSA 4CFCA 1WOPA 4LBIA 4DN9A 3IKMA 5B09A 1WUUA 1N4LA 3W9JA 1CQMA 3NS6A 4YQWA 3MEDA 2P1JA 2J6UA 2YHBA 3UFCX 2RRAA 3O80A 2IM0A 1S99A 4IUFA 4DS4A 1IXKA 3H5SA 4BRPA 4F3TA 1PKUA 1Q5VA 4FJ5A 1T05A 2CWKA 3FZMA 3J7ZO 4F3QA 1NK8A 1IG8A 5JVGQ 5F2RA 2KU7A 1C0TB 4Y0WA 1S79A 4KB7A 1X5SA 1VQON 1SB6A 5A8WB 5HAOA 3SQOP 4ZVOB 3R7BB 2IM2A 4LF7J 1FEEA 1RT7A 1XHXA 5J1EA 1SH2A 3T5HA 3KTQA 2RPIA 3ZETA 5BRFA 1L3TA 2KVIA 2KHCA 4BC5A 5LL6d 4F04B 2KT3A 3RBXA 4LRBA 3AVAA 2H5IB 1QZ5A 5T41A 1HYSB 2FDNA 3QNNA 3D1OA 4JD2B 1XNRJ 4CESA 3GG0A 3CDBA 3SUOA 4LFCF 1NKCA 4OI3A 1F3VA 3I55S 1J5EK 4ZLNA 3GR1A 1Y11A 1FNXH 3DGPB 2HQCA 4CZKA 2ZBPA 2A40A 4ZDNA 4B8AB 2O8BA 3ETMA 3PACA 2I1RA 3KLIA 4O44B 3EX7B 1O8BA 3R1XA 3BGFA 3T1YJ 5E5NA 2YKNA 1RWXB 4XO0A 3F2KA 2A1BA 4FNIA 5ETSA 3P4IA 4CM2A 4OLBA 2IYGA 3SI6A 3LTOA 1NMEB 2UP1A 2FJVA 3FQLA 4FF3A 2VC1A 4J2EA 3ZFVA 1GLLO 1ZH5A 1LK5A 4P7TA 5HQLA 1KKHA 1S0NA 4EP5A 3U8XA 3ISND 4PWDB 2O8CB 3MAAA 1MWMA 2FB0A 3IAM9 1WG4A 1S6QA 1Q16B 2E5LF 2P9PA 3CJRA 3M6VA 4WP3A 2QLWA 2RUSA 3LDSA 2W2MP 4BWMA 4JLHA 1RGIA 5KI6A 3NCIA 2YHXA 3I9ZA 2JZ5A 1HUXA 4H54A 4DTJA 3GFXA 5ADXA 4YB7A 5IZHA 3PX6A 1IM4A 4RU9A 1S5JA 3OW2M 3JSMB 3KDOA 4FJMA 3IRXA 3THVA 3OTEA 1J9AA 4OKKA 3O4NA 4A57A 4K50A 2KL8A 1C1CB 4GC7A 5SWMA 2XZDB 2VU5A 3JTNA 1RKIA 1FXLA 4I7FB 3RYLA 1QY7A 3R5CA 1WDTA 4BE1A 2PMWA 4FJLA 1TK8A 4U7BA 5CD4H 5ETPA 5E3PA 3A3NB 1IV0A 1G4CA 3RBDA 1UL3A 3ENHA 2H4YB 1QD1A 1VQ4S 4E7KA 2HIQA 4WQ5C 3J81U 2PZSA 3TP2A 2V34A 2ZM6F 3QRRA 4CZIA 2HS0A 1XNQK 4ZVRB 5CZXA 1R6YA 4FOIA 4MDBA 3D6RA 3KLFA 2UUAF 2V2QA 3ZZPA 1B0TA 4DTPA 4YY3F 2R7VA 3G96A 4PXBA 5L1JA 4FM0A 2HVIA 1Q79A 1VSEA 3TAFA 1JXVA 1V9OA 3GFZA 4LC9B 2PYLA 1VBZA 5HMXA 2DGWA 4H0VB 5HMYA 2HYIB 4NOHA 4JI5F 5H9EK 4YORA 1L3KA 2UVRA 1FDDA 3MK6A 2LQJA 2V2ZA 3UI3A 4NLBA 2YX4A 3R1LA 4WKYA 5GINA 3I32A 4LFCK 1VSDA 4NEYA 4I64A 1REVA 1RWNB 2RE1A 4X65F 3RW6A 1YHQN 3VR1A 1QSYA 1LAWA 5AQJA 1E4GT 5EUHA 1RE1B 4OYOA 3WXIA 5BRHA 2DNKA 5KFXA 5AQOA 1BGXT 3Q8VA 2GBZA 4IWVA 2FSNA 3LGHA 1YIJN 4LF6F 4KTWA 4IQMA 1SPBP 2ZQBA 4WQ4A 4LIWA 1YJ9N 2IGIA 2ILZA 2UVVA 4JOUA 4DR5K 1T9YA 4M63A 4DU7A 1UETA 4ZCIA 2AZ1A 2AP6A 4PCQA 4ISGA 1HKAA 5I42A 1YTYA 2EX3A 1TKZA 4IG0A 2ADCA 4X62F 2GCFA 4OZ1A 3H0PA 1YG0A 4HH1A 4OHVA 5DDPC 4FDFA 4Y28C 1V4SA 2RH3A 1H6KX 4C0BA 5A8RB 1VS3A 5DS7A 1ZBHA 3MFHA 3RMDA 3TJAA 2IC3A 3J81j 2E5LK 4DV1F 2GS8A 3OUYA 3G4SN 3QQCD 4XAKA 1GMWD 1MROA 2H4WB 2QA4G 4CJWA 4NYPA 4CZGA 2B0GA 1IUJA 4DV0K 4LSLB 3ZT2A 4DR6J 3H1VX 3EVMA 2UUBF 3JSYA 1YGYA 4CHYA 2X6SA 2DISA 5KFMA 4EBDA 4ZVGA 3CB4A 2YKQA 3GQCA 5BN9A 2U1AA 1U1OA 3ZZOA 3TAEA 2DNNA 1WSIA 4IH7A 1VBKA 5MAOA 4X64F 3QFWA 4DF8A 4U67L 4QWDA 1FT8A 5CD4A 1GFWB 2XMKA 2XCPA 1VQ6N 3RAMA 2ZM6K 5AXKA 1A5XA 3BN4A 2AW0A 4AE5A 1SIZA 2YWFA 3NAHA 1CS4B 2ZBQA 3CDAA 1T02A 3H8YA 4IOCL 3UN2A 2NZCA 3TWHA 1BDGA 2O4GA 2FSKA 3S9HA 2V7YA 3AODA 5FPDA 4CZLA 4PXDA 2QN6B 1T9XA 3K58A 2E2NA 3VENA 1T3NA 3MXMA 2P51A 3DFEA 3MMCA 2R7TA 1NGDA 2XWYA 3VGUA 3FCVA 4FF4A 2C2RA 1SV5A 2FLNA 2YQ1A 2YQ0A 1DT9A 1PGZA 2B56A 2QV6A 4J9VA 2QK9A 3G6ES 2CPDA 5A0YB 1VSJA 4PG8A 2V4QA 3TQEA 3PSFA 4X65K 4ZVHA 2LCWA 3CCQS 1WC6A 1WD6A 3MMBA 4QWBA 1NMDA 3IM9A 3AGRA 1K1SA 2OPQA 2EVZA 3D68A 1XQIA 4NLGA 2CQ4A 1TUUA 3EDQB 2NXUA 3VA0A 2G0CA 2K06A 3CC4S 4OX7A 4B3TJ 3A5MC 3FKBA 2R7SA 2OPPA 4JI1K 3WNFA 2ZH9A 3PW7A 3AA2A 1VQ8S 5HP1B 3JS6A 3CJ3A 4AD6A 2YHAA 2FF3B 2E66A 2C2NA 3G82A 3MM8B 2FSJA 3DXBA 4EZ9A 2J9EA 3W1YC 4DV3F 2YKPA 3R8EA 2X7IA 4X62K 1KEKA 4GKJJ 1Y00A 4EHTA 5FDLA 2OPSB 1NLVA 4NLXA 4JS5A 1X5TA 4HI2A 5FD1A 3AVFA 4H4OA 3CIZA 3AGKA 4DUZF 2HRTA 2ZHOA 4CLPA 4K4ZA 4ZCLA 5A8KB 1SI9A 4FYWB 3KK1B 4O8UA 2V52B 3SUNA 4H5TA 1XC9A 2FHKA 4DPXA 2D1CA 3W5ZA 5J2QA 2DK2A 2MY7A 3BV8A 4R25A 5AQRA 3NNCA 4OMFG 1Q8IA 1RDCA 1KP6A 3CCMN 1L5UA 3VF4A 1T6DA 1LKZA 1IR1A 4NE9C 3KFWX 5IT9U 4CO5A 1X9MA 3J80Y 1HHTP 4ZHRA 3L6QA 2PBDA 4JI3K 4DV2K 2VH7A 3AVBA 3T5KA 1KS2A 1N33J 4DR1F 1LWFB 4X64K 3FNNA 1AFIA 3KHHA 2V6AA 1YF5L 1ZZFA 3AQPA 3DI6B 3GZ7A 4WK3A 3VQ4A 1XMBA 2HFZA 4OZ3A 1VK8A 3PXGa 2IY5B 1S3XA 4BC3A 3OYFA 2DITA 2V2KA 3T5JA 3MR5A 2MQOA 1OVYA 3NL0A 1YITS 2P9KB 3V6DB 2IRXA 4K4WA 2DR5A 2I8EA 4K4XA 4DXLA 3ID8A 2ZZNA 5KAKA 2DGUA 3CC7S 1RT4B 2GEMA 1HMVA 1MU2B 3KLEA 3VEXA 4Z94A 3R27A 4BRDA 2FHJD 2DR8A 2XI2A 1HJOA 2PGCA 3VQ5A 3T1HJ 2NYIA 5HROB 1UZDA 4NA1A 1JCFA 2VQEJ 2ITGA 3VQTA 2J5AA 3AAQA 3CO0P 2GX9A 3OYIA 1HWIA 3RSEA 1YVUA 3GL1A 3I82A 1S7IA 4U7UK 3DOLB 2OD6A 3NCPA 3AY9A 1E6YB 4ETXA 4I69A 5EY4A 4CBUA 2NZTA 2FVRA 4OYXA 2LEAA 2NYHA 1HA1A 3ZZZA 3H2LA 3HHLD 4WCEQ 3ATVA 5AE2A 2VODA 2Q6CA 1UA0A 3V4IA 4DUYF 1WC5A 1FFSB 4ED2A 5U47A 4HEA9 3U1NA 4M3YA 5CYJA 1EQYA 1S49A 3VEZA 1OPIA 4A5BA 1NH7A 5LSOA 5C25B 1S1XA 3WQTA 1UAXA 3SQ0A 4J37A 3QMLA 4QWAA 2DO4A 3W0LA 3HKWA 3THXA 4R8UB 4ZOSA 1NEEA 4UOFA 3OVBA 3FK4A 4DCHA 3CWJA 5D4OA 1CZ9A 2M8DB 3MN6A 2VKRA 1R0BG 3SAFA 4WK1A 3M8PB 2IMOA 1VCTA 3TSQA 4IFVA 1VHFA 4LF4J 1IJFB 2B9XA 1LWCB 2C3OA 2OKQA 1T94A 1SQEA 1S5ZA 4NLYA 3TVZA 3QBXA 2X1BA 4CJTA 3TJ8A 4AQYF 3QT7A 3SQ4A 4C97A 4AHSA 2AMCB 1WOQA 3TI0A 5AQKA 2G8UA 1RDDA 1B4SA 1WNEA 3LP3A 3ZSVA 1JJ4A 2B8QA 2OFGX 3VGLA 1KHWA 5AT1B 3NG8A 2OTLN 1WG5A 3HHKA 3NMRA 1AT1B 1C0TA 3D0PA 1Q82T 4QCLA 4NLWA 5A8WA 2CQHA 4H5RA 3AD8C 3QBCA 3T19A 2GJFA 1TKTB 2FC0A 1N32J 5DK5A 3IMQJ 1P9YA 2XZTB 4YN3B 3TSPA 1N6QA 3IA0A 1GLAG 4JUZA 2HFUA 4DDFA 1HYSA 1RAOA 4DFMA 1X4BA 4CZMA 4BRFA 1HQUB 2CH5A 2F65A 1OY8A 3KVGA 3BN7A 4OJGA 3JYTA 3PO5A 4DR4J 5M1QA 3V5RA 3H5YA 1BLUA 3DGPA 1HNWJ 4A59A 1NPPA 1LFPA 4CI6A 4F67A 1U2RA 3A8YA 4WCEL 5IWAJ 1JLBA 4BCAA 4L76A 3AA5X 2E5IA 2OAUA 4XPEA 2BE2B 1BO5O 4DTUA 2E88A 1ASUA 5AZIB 2PIIA 1VQPS 4BRIA 4HTJA 1RYRA 1UVNA 3UVJB 4USUA 2VCPA 3BKUA 4USIA 3BKFA 4ZP6A 3QETA 3HM8A 3HX9A 3ZZ0A 1T44A 1FRHA 5J2PB 5EN1A 1N8RT 5DM6Q 1NGEA 3QJJA 1U47A 3CMAS 2R2UA 2IVFB 1U09A 3M7VA 2H3GX 5HJXA 2A3JA 1NGBA 3G6XA 3MR7A 3PCOB 1YJWS 1DLOB 2Z2LA 2C3PA 5HQ8A 4MKVA 3IFRA 3DRRA 2EC2A 2VFSA 2MKYA 2KW4A 1YRUA 2W4CA 4WU2A 1GLBG 4KREA 5BJRA 4B3SF 3CGIA 4H0OA 4K7QA 2XC9A 4F2RA 3K7RA 3ULEB 1VSIA 3UKUB 4Z4IA 1NSKL 3M6WA 4C8KA 1HNXK 1C6VA 2D3O1 3R7NB 2JLEA 5DG9A 2P2CB 1K0TA 2ZZTA 3DM2B 3K5LA 4TLQA 2RB7A 2VG6A 2RT3A 3F41A 2XY6A 2C42A 3QEXA 3QEVA 1N56A 2R3VA 2VICA 1EWRA 3CD5A 1APSA 1NPRA 3F73A 1GLJO 3MM5B 4CK3A 4IO8A 5AQXA 3KLGA 3GG4A 2NLXA 1T9TA 3OR2B 1CULB 1IR0A 5CCMA 2AJQA 2DHAA 3AT1B 2UXCJ 1S4EA 4DU1A 4KT0C 2CQDA 3MR6A 3O8WA 3RAXA 3MEGB 1K73T 2C2MB 2B6AB 4F36A 1F2GA 2F9DA 2DNMA 3J7A1 3SQGB 3GE1A 2QFJA 1Y3JA 3O4QA 1SKSA 1CZAN 4M5KA 1HR0J 3ITHA 2HWTA 4WBFA 1JLAA 1VQ7S 2IRUA 2DRBA 4A2BA 3R6MA 1FRJA 2APOA 3DRPB 5AJ3K 2GWJA 4ID1A 5E0OA 1SL0A 2XB2D 1O6XA 2BOAA 1I6JA 5AXNA 4MYTA 3JAMO 4H0TB 4C1NK 3M30B 3AY0A 4KPCA 1DTTA 2QEXS 2QSFA 2R7OA 2JX2A 3E9OA 5EWFA 4FYXB 3FGUA 1U0SA 2PSZA 1NM1A 2ZZMA 2K8GA 3KD5E 3BGLA 3K8WA 2VHGA 2CPEA 2PMHA 3OYCA 2OPRA 3VF0B 3H2VE 4FF1A 2WTFA 1I3AA 4GV6A 2G2OA 2HVZA 3D3BJ 3OL9A 4RO0A 4CLKA 4X4SA 4DU3A 4OZ5A 2DFEA 1FHTA 1RTIB 1BI4B 2ZJQL 3VQ7A 1TL4A 2V5HG 2VYPA 4DV6J 4OV1A 1T03B 3HPGA 2LXUA 5AR0A 4OYWA 2DHHA 3OTBA 4B3RF 4HUGA 4UQTA 2H5EA 4OZ2A 1EXQA 1WAFA 2BANA 3QB0A 3IS9A 4OYMA 4ZPVR 1DHMA 3BEXA 3MX2A 5SUHA 5KG6A 2DRAA 4OKJA 4BC7A 3H4DA 4O55A 3CCRS 2YNFA 2R2SA 3VEOA 4U7CA 1M5VC 3C65A 1EETB 3O1LA 2E1ZA 3AOAA 2OHDA 1IN0A 4KHMA 4L75A 2Q0RA 2W6LA 2GHVC 3BO2A 3CUNA 2PA3A 1U1MA 2HBKA 3OYKA 4FJ8A 4H4MA 2A10A 2GO8A 1RAEB 2DGXA 3L7UA 3KJVA 2B9EA 1R8AA 4TY9A 1HBUB 5B0AA 4ZJLA 8ATCB 5E2QA 3E66A 3VMFB 1KLMA 4K0KF 5DQIA 1FWLA 2UXDJ 3FCHA 5FPNA 2R42A 4HVJA 3KLVA 4Q44A 4K41A 3MEKA 4EZ6A 1TL1B 2AJ4A 3L3VA 4F2SA 3AB2B 3I0RB 3M05A 3P8BB 3CCES 4LF7K 2ZWOA 1JJCB 3GIJA 3GSDA 3W2WA 3KJQB 3D0HE 1WHXA 3WC2A 2G4BA 1DY3A 1F9FA 4AXJA 2WCXA 1W97L 4P71A 3W7BA 3CW2C 4FF2A 4UOCA 1RISA 4CJVA 1D5AA 4F9OA 3N6NA 3BQ2A 2W9CA 2HHVA 4BQZA 3ZSXA 1UPPA 2AJ1A 1NU0A 1QVGM 5J1PA 4RW7A 4JKBA 1YJ7A 2CG8A 3D1HA 2XMAA 3SSSA 4NXMJ 1XNRK 3S3MA 2ZBCA 2ZDOA 1FE4A 3PX4A 5J2NA 2N4DA 3BZQA 4W5OA 2JWKA 1EHWA 4A2AA 2R8KA 1WF1A 4W90B 3VAKA 3OT9A 3CQ8A 4KKOB 4DSKA 3HLUA 5CH7B 2MKCA 2M8HA 3OBYA 1HBMB 2SXLA 3VQCA 1F60B 5KFZA 2YNIB 5GAEU 4DV7J 1XMOF 2WK4A 3CJKA 3T1YK 1VQ5S 4CNZA 3DDNA 3P3DA 2I0XA 1EKRA 3E2EA 3K5PA 4E2FB 2E5HA 1RA7A 3D7SB 2R8IA 4CD1A 3AA9A 4CJUA 3T7ZA 3LGNA 1SC3B 1QUVA 4CJRA 2FGCA 3H25A 3E1YA 1VQNN 2AEFA 2B8PA 1I94J 3IP0A 1VJQA 3ENVA 2CZ4A 3D67A 3X1LB 3A12A 5HP1A 3FSIA 4ZVPB 2QWOA 5M1OA 3CCLS 1YI2S 2AJFE 4ZVSB 3LALA 2Z58B 2WZ1A 2WVFA 4ED6A 4DLGA 3J7AN 1URNA 1NUEA 5C2FA 4KV8B 2OPSA 2KG0A 3KG0A 3CJCA 3FZKA 3CXCR 1RTHB 2D69A 3RG6A 4PXEA 2W9AA 3BBBA 5A8KA 2E7XA 2MSSA 2WVCA 1WAJA 3HT0A 5DZ7A 4QIGA 3CJ2A 1KQSR 1FRIA 3Q0AA 4CGHA 4JHDA 4PQAA 3M2VA 4FZYA 3LDPA 3QSIA 4KSEB 4KHSA 2L48A 3CJ1A 4JV5J 4ANEA 4RWWA 3V4MA 4NLRA 2HQDA 2G8VA 4DKWA 3A5OC 3O9QA 3IFEA 4AT1B 5G0RB 7FD1A 4PZVA 4TNOA 5IT9O 2CNKB 5CYMB 1XEZA 4BQLA 2EFVA 4B1VA 1XMQJ 2XGQA 4HH0A 1B7FA 3SCLE 3CFPA 1NB2A 3GPAA 3EICA 4A8FA 2DNHA 2D0AA 4B1YB 1LOUA 3SBTA 2V8PA 1LWEA 3BDPA 4QIFA 2EWHA 2P9KA 3RR7A 4IG3B 1K9MO 3N5BA 4A8OA 4Z4FA 5DJBA 2ZUGA 1RT4A 2L9WA 3D7EO 4F3OA 2ETJA 1NNEA 1IR2A 2P6TA 3VPZA 3OD2A 4KI6A 1BWVA 2GHPA 3GU0A 2QWMA 3DLGB 3S3NA 3TQ1A 3HVRA 4X4TA 4LMZA 4HWIA 2GVDB 2WBMA 2H1YA 3SMPA 5KT4A 1A6LA 1WKLA 4O3PA 3PJXA 4OLOA 1K8AT 1E6YA 2KRRA 2X6NA 4MDAA 3LDNA 3KK3A 1PG5B 3BSCA 4OFZA 4X4PA 3MMJA 3VA3A 2XMJA 4URSA 1PBUA 1SIWB 1M5SA 4NCAA 1SZ2A 2XRIA 3RZAA 4ZMMA 1QSSA 2IA0A 2OJ3A 3HSDA 1LXJA 2YJFA 1TMMA 5M1FA 2UXBF 2MZQA 2AZ3A 4B3OB 2UU9F 4FK4A 4M41A 2RUGA 3UE2A 1EQ0A 2ZC4A 4DL4A 4E98A 1F5BA 3R8YA 4UY8O 3MUMP 3CCVN 3M2RA 1NDPA 3TEHB 3GILA 2GC8A 3NFAA 3H6EA 3OYHA 1AW0A 4F4AA 5EWEA 2OD4A 2ZHAA 1K6YA 2FVSA 4Q8FA 4FYDA 3P45B 3FE1A 1D9AA 3HJVA 5FPMA 1RBTA 3BGRB 3HZGA 1C1BB 5I4MA 4DCOB 4CEQA 2U2FA 2R7XA 5ETKA 4DR6K 4ALZA 3MM9B 2ZBIA 5B0GA 2YKMB 3A8IA 4CT8A 4ZN1A 5GMKa 1EP4A 4QPXA 3T3FA 3MM6B 1ZBUA 4G1IA 1WLJA 1RT5A 1YZ6A 4NA2A 1P8GA 2QRRA 4KBIA 1Q81T 3I96A 4WKRA 3NGZA 3ZCMA 4CP5A 1RFQA 3CE8A 4DB3A 1VQMN 2ZBRA 4KAIA 5KT7A 1ICEB 1MNEA 4Q2MA 1QVFR 2WOMB 2PO4A 3OFFA 1C0UB 3WHIA 1NM2A 4ZLLA 3RW7A 1GX6A 4CLYA 1S22A 2JVRA 2KVQE 4CFAA 1KR4A 2HBLA 1LW2A 4PPDA 2OEMA 4HR2A 4NASA 4AL6A 1H3DA 1CJKB 1Z2LA 4DR7F 3OYEA 2RKIB 3MN7A 4E0DA 4NLOA 1WSGA 4CVNE 2R4FA 4PYDA 3NBPB 2B4PA 3KDNA 4WXOA 3B82A 5L8RC 2XYHB 3FZ2A 2V2VA 2IS3A 4BWJA 4B9LA 3T1HF 5J2MA 2NXNA 4OLPA 1J2VA 1NMNA 1S1UA 3BBCA 2J7KA 3CJ4A 1SJFA 3BGUA 2PA8D 2XY8A 1TTHB 5JICA 3LDQA 3CCQN 4NLUA 2P9SA 1NGGA 2MKHA 4WP9A 2BA9A 4NYFA 1GAOA 4CZEA 2E1MC 3UCZP 1FESA 4MQ3A 1R3NA 2W1BA 3GYNA 3A3OB 3D2FB 3V81A 4TQRA 4LBPA 2HHHJ 1LOTB 4DU8A 2A1RA 2OO4A 3MF5A 2GZOA 3FJ2A 2M3DA 3N6MA 3PYGA 4OI4A 5C10A 5B0BA 1F1BB 4YR3A 4PKDB 5K8PA 4WF9L 3MMAB 2MZJA 4B3TK 3Q8YA 1DKGD 5KFDA 1WDDA 4CQ1A 2WBNA 4DV4J 1EAYC 2NR0A 5CQGA 1TKDA 3R1HA 4KY3A 2BM0A 4PR6A 3TAPA 4BHQA 5D0GA 1DTQB 1T6CA 3OYLA 1L3VA 2JEIA 4ZPAA 1VOMA 6AT1B 3PG9A 5BPNA 1Q95G 1RILA 1VMBA 3ENQA 3E3XA 2HSEB 5KG7A 4GKJK 4ZS6A 1KC8O 4FYVB 3NAIA 4ITSA 2HGMA 4V1Ak 3G71N 1IBMJ 4HVZA 3V9ZA 4LF4F 1LWXA 3GIRA 3QYYA 2HBQB 4OZNA 4KGKA 2OEJA 2AX0A 1RI7A 3VZHA 1HQ2A 4OX8A 1ZBSA 5K8NA 4OYPA 3IGNA 3CPWR 2IVNA 2E1AA 4LR9A 3L95X 3OFGA 2PT0A 3EE9A 3OTOF 2ZH7A 1YKWA 5KFLA 2HLUA 2JEGA 4GMJB 2IA6A 3MM5A 4DTMA 1HW9A 1UW4A 1N5TA 2X78A 3W65A 1YJNS 1PYOB 4WFNL 5FRNA 2WTUA 2KYXA 2F7TA 1X5PA 1N32F 2Z1IA 1N33K 2CQ0A 3G8QA 1X4EA 4IDKA 1NU4A 2WHOA 2LP4A 3BKTA 3CJ8A 2IOCA 3O9UA 5M1PA 1HWLA 2Y1LB 1BHNA 1FKAF 3D2WA 4DR2J 3IDHA 4BR0A 3CC7N 2ACMA 3OBIA 2FY1A 1ZM4A 5F3TA 3NGIA 3RB4A 2NZ4A 3L4QA 2DRDA 1XWLA 5KFVA 3TANA 3FEZA 1QDUB 4RUHA 1HNWF 2CQ1A 1U2FA 2PEHA 2NSCA 2MLXA 5I3QA 5IWAF 4KH5A 1GMVA 1K47A 1WF2A 4FYYB 2B43A 3RGIA 4M63C 2RU3A 1DAXA 2MQ8A 1AXQA 1X9SA 1FX2A 3HVTA 5L9NA 4GVMA 2O4IA 5EX5A 3W8PA 2OZSA 2ZD1A 1YVNA 3IO1A 1YSJA 4ZTJA 5EX0A 2I9SA 1Q7YO 2VQEK 4CNYA 1WHVA 1N5YB 3P6YC 3HRGA 5HL7L 5HLFB 5E3AA 3RBZA 2QM1A 3ENBA 1PJ5A 3D3CJ 1BI4A 3ZXWA 3TYTA 3TEGA 3DYAB 2HVEA 1C2PA 3CQXA 3F56A 2AYGA 1TMJA 5DG8A 3EKUA 2VG7B 3LL3A 3H08A 2GMLA 4J90A 2R7RA 1F6TA 3OR1B 1M90O 1NPKA 2C2OB 2XTJP 2P9LB 3CD7A 3DJCA 2A41A 2RAQA 3GFHA 2FVCA 4Z4CA 2N7CA 4M5MA 3GONA 1OY9A 1EETA 4FOEA 3DLEB 3W63A 3PIPQ 1FVQA 3S41A 1NBWA 2GAGC 2F8HA 2X1FA 1CLQA 2B5JB 3UQSA 2MKIA 2XNRA 4F0KA 4X4RA 4Q5VA 2HQGA 2E6LA 3FEYB 4AH9A 3CM5A 4OX6A 1X7VA 4GKKJ 3SSRA 2FHJA 4WYLA 2V0NA 4IRDA 2KKZA 3WEEA 2CXEA 2UXCF 1I5OB 1CVJA 1HYZA 2QLJB 3PX0A 1SUQA 4OPJA 1DRZA 2C22A 4EHUA 1JLFB 4OI2A 4RLEA 4FN5A 1SKUB 4KJIA 2WONB 1HPMA 5K8OA 5HK4A 5C2GA 3I0RA 1S0VA 1PYSB 2X3GA 3MGJA 1K8KB 2HHTA 2BJDA 1BE4A 3P96A 1NGIA 3J81Y 1UAWA 4TU7A 1JK9B 3M2UB 4YS2A 1HX1A 2JRSA 4OGCA 2YY3A 2E1CA 4UOHA 1LQ9A 2ZJPQ 1JIHA 2V50A 3CG7A 6FD1A 1RDWX 3HVAA 2HZAA 3U02A 4M5DA 1WN7A 4Q2LA 3H3OB 5F9LA 1F2HA 3THWA 1NLKL 4N8OA 3OYGA 1WBDA 4DR4K 4AL5A 3UDLA 3BS9A 2MQNA 2L41A 2BJ8A 5M1NA 4DSIA 2DEJA 1XHZA 4Y1CA 2GUIA 2FJEB 1KQGB 3OHAA 4FXDA 3LAMA 5DGBA 4XH5A 2WBRA 1X4AA 1BOTO 4KRFA 1ASVA 2QA4S 1HNIB 4DMNA 1ITPA 2UYTA 1PC5A 1VQLN 1IKVB 2E5GA 2XSJA 2EXUA 4JKHA 3KUEA 4EK2A 1OH5A 2EC0A 2HBRB 5E33A 3FFIB 3CCWA 1UZHA 2H65B 4IO1A 4MT1A 2MGZB 3ZTPA 3QERA 5HRRA 2JFDA 2A18A 1VSLA 4RW8B 3SJHA 4XPCA 3TSUA 2EHGA 4OVLA 4R5PB 1HNVA 3CTRA 4U95A 1B0PA 1KXPA 4RBTA 1Z05A 1ZBLA 4QIVA 2QXFA 3O3GA 2RRBA 3W2VA 2PE8A 3J7YU 3J7ZT 4OHYA 2CVIA 1FJEB 4KV8A 3LQVA 3MCSA 2CUYA 4ZKAA 3DNCA 3V6HA 3C6TB 1RTHA 5HQMA 3MXIA 2L9DA 4USHA 1J5OB 3TUPA 1NK4A 1ATNA 4QBUA 1FDNA 4XDCA 1TL5A 1FE0A 2DY9A 3EZUA 4JN4A 1XBWA 2VJVA 1MSWD 3MPWA 5K14B 5GIOA 1J53A 4DZDA 1IQZA 3MEDB 3EY1A 3KMQA 4WFBL 1Q18A 2M70A 3CJ5A 3Q7CA 5KOXA 1Y64A 4ZN3A 2AQ4A 2VDHA 3CD6N 1EWQA 2X1AA 3RJMB 3UN3A 1T05B 3ZT1A 4H0PA 2LEPA 2UXCK 3SPYA 4Y00A 1SJRA 3MAHA 3PJWA 1SJ1A 3T9NA 4JI7K 3T69A 2N3LA 4ZIWA 1Y10A 4H0YB 1HBNB 2CZ9A 4CJSA 4LF8F 2DVIA 7AT1B 1RT7B 2J8SA 4OHWA 1M5KC 5J1EB 1HR0K 1WI8A 3EZ5A 3ZETB 4NXMF 2VZ9A 2V9KA 3I5BA 4OI1A 2UUAJ 4CLUA 2EW9A 2DNGA 2VQFK 4M3TA 4YY3J 3LZIA 3KK2A 1CJTA 1DQAA 4ZPCA 4QS9A 3NP5A 2M5YA 1GT8A 2MQPA 4O5BA 1UVLA 3CF5Q 4CLWA 1PILA 2B4JA 2QT7A 4AHTA 3FR0A 4O0NA 2YKOA 2RHQB 2PMZD 1NDLA 2BRLA 3M8QA 4Q45A 5F8LA 2EFQA 3KG4A 2IIHA 4IEEA 1VC6A 3EL2A 4J9SA 2J0WA 2C1EB 1HL6A 4HKQA 4TY8A 4UZBA 2ZHBA 4OZ0A 5C15A 1EZZB 3TAQA 2YKNB 2R7UA 3PW4A 2AGPA 1CBKA 1OO0B 4YDUA 3C6UA 2HS4A 3SCIE 2CVEA 3DDKA 5F8MA 2RDIA 4GVEA 1HI8A 5KFHA 4FPBA 1CLFA 2ASOA 4DV6K 4FO0A 3EVWA 2ZUAA 3NAEA 4LF6J 2HMIB 4CEEA 4Y2KA 4BR9A 3DLLL 3BUZB 1MG7A 2XYPB 1KONA 5IS2A 1HNZF 3V2UC 3HSJA 2YNHA 2PN6A 3CMES 4ZPTR 1S6QB 3CM6A 2FBVA 1OSDA 2P9PB 2M4MA 1VIOA 3IR6B 4BLGA 5KT5A 1CJVB 5DO2A 1WSFA 4R79A 1FXDA 2QX0A 3WUHA 4X66F 1UVJA 3CETA 2NRTA 4RCHA 2CJXB 3GG1A 2GJ2A 4XK8C 1NGFA 1WACA 1UFLA 3VWSA 5EOYA 1C1BA 3CCJN 5KFYA 3O3HA 4RUAA 3SCKE 1TK5A 2E9ZA 2X51A 4PRFA 4DV1J 1VSKA 3EXYA 2YKMA 2OLWA 2ZEJA 3C6AA 4BRAA 2YXLA 1IO2A 1JLQA 5LJVA 4HHTA 4DTOA 3OTDA 1RBSA 2BQRA 2UUBJ 4UZCA 4YUDA 2O8FA 3LUYA 1WTFA 5CE3A 3ILOA 3CJQA 2UXDK 2FIUA 4OPKA 4HHJA 3ID6A 3AVIA 3RWUA 2YX7A 2KT2A 4OX9F 2XO6A 5E7OB 1A5VA 2ZNZA 3DU5A 5DM7L 3KLFB 3KK7A 2RMLA 4X4NA 1S9FA 1S9GA 4DQQA 3EGVA 3B78A 4A8XA 5L1LA 4GVBA 2JGUA 1WSRA 4PABA 1CJKA 3UNYA 3HHEA 4CDIA 3VQ8A 2D3UA 2QJ3A 5HATA 1XR7A 1BU6O 4IOAQ 5ETVA 2HSTA 2XZWA 3KHGA 2FXUA 3G9CA 4IYQA 5M2UA 1HI1A 4ZVTB 3SV4A 1RGVA 1XN9A 1NJIO 4D3HA 3HPHA 2LLZA 2I7NA 1VQ5N 1UCNA 1B99A 3GBTA 1FNOA 3MUVP 3NOCA 4J8FA 1UWBA 2RJZA 1REVB 2P9UA 1KVAA 4JRPA 3Q7BA 4DV7K 1F9HA 3OW2R 5L38A 5J1NA 2O1PA 3FQKA 3GP9A 4WIIA 1BG3A 1OKJA 1NHVA 1H98A 1YBUA 2IRYA 4JI2J 4LRFA 4FKXA 1ZA1B 3A13A 4RW4A 4CM0A 2CNOB 3NGYA 3MMAA 4FPIA 4G65A 5L46A 4DL5A 4KTZA 3I87A 1I94K 3THTA 2W7AA 3OYDA 3HF5A 5KFKA 1WELA 4FJGA 5F8HA 2OTJS 3VVTA 4DCJB 4MIBA 3NHGA 1UPMB 1K0VA 1KQFB 4ECXA 5I42B 4I68A 1LXNA 1TKZB 1JLGA 4IG0B 1OH7A 4E1JA 3OVAA 3SDEA 3T1AA 4CE9A 4LSZB 2ASJA 1FDAA 2DGSA 5EGYA 1HD0A 1Z2ZA 2RILA 4K5SA 1Q0NA 3A5LC 2IC3B 3B8HA 1EX8A 4YMEA 2VOPA 4IRCA 3MCMA 2WSEC 4DV3J 3OUYB 3AVLA 2WFBA 1HKGA 4KGVB 3WXLA 2QG9B 4DF4A 2Q66A 2VF3A 1MROB 3C14B 2V4JA 2AGOA 2XWXA 4PUOA 1BWEA 1EJ7L 4DUZJ 2QYCA 4DLEA 1IKYA 1RWMB 3W61A 1U1LA 2Q6BA 4JV5K 4UOGA 5HMWA 3NMUA 3J80O 3R5BA 1RUSA 1T11A 4ISFA 1QQNA 4JKGA 2DXDA 5IC4B 5C24A 1JJ2R 2L9NA 3LP0A 1GXUA 2WB4A 2KHDA 4M5GA 5B7WA 1S1TA 2ILYA 4CEBA 4CI0B 4E1NA 4B02A 1OYEA 2HHSA 2EBEA 4DL3A 1XMQK 4FBTA 3ZEUA 5IC6B 3O5TB 5ITHA 4KHPK 5D15A 4L6V3 3AAWB 4URGA 4H8KA 4L74A 4DR1J 4KE5A 3SPZA 1S1VB 4DL2A 5HMZA 2C3MA 3K89A 4ECSA 2E20A 3IXQA 2PY5A 2GQQA 2EWSA 2LQ8A 3NLCA 1KQKA 3T6JA 3CC2S 3A2FA 4NXNJ 3GCWP 1HFEL 3R5JB 1BQMB 4YOTA 3ZYYX 4NLSA 5LMNJ 3MMCB 2CQBA 1RAAB 2HFOA 2XHBA 1Q5YA 3NCQA 1M5HA 4MH8A 4W5TA 3PZPA 3L3CA 1FW6A 5ETMA 1JXLA 1RJJA 3QIPA 3RRHA 5K20B 3MXJA 4BR5A 4P2FA 3TZXA 2DB1A 5CZ2A 2G9OA 1TQLA 1R27B 3MMBB 4KGXB 1RTDB 3CI5A 2FC8A 2GVZA 2DHXA 3CD0A 2OP5A 2QA1A 2MQLA 2Y1JA 1WHWA 2OPPB 2DTJA 4NA3A 3IAYA 4B3MJ 3C15A 3SSQA 4F0HA 1FXRA 1S48A 4WFAQ 3MTKA 4DUYJ 3AV9A 4ICLB 3G82B 3M6XA 3VTHA 1IBMF 1TAQA 3PEJA 3DLEA 3MCNA 3D66A 1RDBA 1R43A 4YR2A 2KLAA 1JL2A 3MM7A 3QLHA 4MO5A 3D0GE 4B1UB 3ZT4A 3OL7A 2AYBA 1I3OB 1H0HB 4H4OB 3ULDA 3U7JA 1UVMA 4UF4A 1VQ9N 1RKJA 3CFOA 2D9OA 4ECQA 3IBWA 2N7YA 2PDAA 4A8WA 2F1FA 3NWRA 1SVDA 4IBNA 4ILLA 4ES2A 1KAXA 4JI4F 3M32A 3WQUA 3QWPA 2PD1A 2KZZA 3TZYA 1ZA2B 3I4HX 3K9JA 1QAJA 1NJWA 4DL6A 1JLFA 4AQYJ 4H5WA 3DOKB 5F8IA 3UIQA 1WOOA 3MPYA 1KOOA 4JI6F 2Y3YA 1G1XA 1SC6A 3SCJE 4DUTA 1JQGA 1TUVA 1ZAXA 1K8KA 1YK9A 1RU2A 4NEZA 2ZDPA 5IV3A 1GXLA 4DR2F 2Q79A 2HEKA 5A2QY 4G1QA 4DWIA 4JYAJ 4M3XA 1H38A 1S12A 3LO3A 1VLOA 2BVZA 4DG1A 4M5IA 5E3QA 3GYGA 2NLWA 5CABA 4KB1A 3OSNA 3ZO7A 4BRMA 1FRLA 1UJ5A 3AAPA 4BC2A 2Q97A 3IR5B 1HMVB 3C46A 5KFUA 2Z0GA 3BF3A 2YHYA 3EJMA 2FZKB 4P72A 2D9PA 3V1OA 1WSHA 4BVPA 5E3CA 3RRKA 3ZTRA 1QTMA 3AXMA 1PJ6A 3EVOA 4EFHA 2HHHK 4QJVA 2D3OR 3RSEB 2QKKA 3KD1E 5LXRA 4LF9F 1C4CA 2DGTA 3AA3A 1N0VC 4USKA 4ZLPA 1JLCA 2CH6A 2P9IA 4RBUA 1V3ZA 4KGZB 1XJWB 3R97A 4RW8A 3GV5B 5ETQA 4DV4K 1SBRA 3W5YA 1C4AA 4LQ9A 3E9PA 3V4IB 2V4RA 2MQMA 1RT3A 3MEEA 2KB2A 4QIEA 1WG1A 5BYSA 1ZYQA 1X4GA 1Y5LB 2JHEA 2LMIA 1S1XB 3LM9A 4ATNA 3MFIA 5JVHL 3QT5A 3S3OA 2MHEA 4KO0A 4DS5A