3DRSA

Hiv reverse transcriptase k103n mutant in complex with inhibitor r8d
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
549
structure length
549
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 148
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drsA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drsA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drsA05
1SL0A 2E9RX 3CJ0A 4IG0A 2VWKA 3ISNC 3SUQA 3K57A 1XI1A 4ED3A 1BGXT 3NAIA 4HUGA 4PWDB 4LSNB 3LP0B 4NLQA 3D45A 5J1EA 4DQRA 3BQ1A 4M42A 5FROA 1KLNA 4DTJA 5CYMB 3H2LA 1BCOA 2HHWA 4M95A 4E19A 3AVAA 4B9UA 2VG6B 1BCMA 1KRPA 1DTQA 1NNDA 1VSJA 3G6VA 4RW4A 4CHPA 4NLRA 3LPTA 4RW9B 3HPOA 4MKAA 3HO1A 3IS9B 1N5YB 3MR6A 5KTQA 2B43A 2XY6A 4ECTA 3KD1E 1TKXB 3OL7A 4NYNA 2QKBA 4E3SA 1IKYB 5KFFA 4M3UA 1JLEA 3PUFA 1SUQA 3T5LA 4TSXA 3B6OA 4YNQA 4CJUA 2PZSA 4FJKA 3NBPB 4IFYB 1RT4A 3PW0A 5KRTA 3RB0A 1SKRA 1L5UA 1N6QA 2WONB 4Q43A 3CJ5A 2YKNB 1CXQA 1UWBB 3CJ2A 4HCCA 3KJVB 1C2PA 1S9GA 2QV6A 4Q8EA 3BQ0A 2B5JA 3V4IB 5J2PA 1SH3A 1ZBUA 4CF1A 2I5JA 3OYJA 4E0DA 1RAJA 4NRUA 3DOLB 4Q5VA 4ICLA 2FJVA 3ZT2A 5KFPA 3LP3A 3DM2A 3JSMA 1CSJA 2YKMB 4WE1B 1JLQB 5J2MA 4G1QA 2FJWA 4J9OA 4DSKA 5DLFA 1WNEA 4NLTA 4Y1CA 5L9XA 3RAXA 2OPSB 4LQ9A 1XR7A 2BR0A 4FXDA 3AVFA 4MK9A 1U49A 2R8GA 4JLHA 3KHRA 1J54A 4KV8B 1UA1A 1RT1B 3HPGA 3KD5E 2A1RA 2W8LA 1FK9A 3SYZA 4AILC 4K8ZA 4IH7A 4LSNA 3LP0A 2D3ZA 2AGQA 3AVKA 4DTUA 5J2NB 1NOZA 3TAQA 4NLWA 4KI6A 2JEFA 3SUNA 1UA0A 4EBEA 4U6PA 3N6MA 5FDLB 4K4ZA 3LDSA 3KLGA 4FLUA 3A2FA 2RDIA 3Q8SB 2HNZB 4CJWA 4RW9A 5KG1A 3AVMA 3NGZA 4OPKA 5DQIA 2OPPA 3NKYA 2HHUA 2R2SA 2AX0A 4M3WA 2DPIA 3V81B 1T8EA 2UVUA 4J2DA 2RKIB 1RYRA 3IGNA 2HNYB 5K14B 4JV0A 3VQQA 1HYSB 4RNFA 3MEGB 1S1UA 2BQRA 4O3PA 3TAPA 3VQ9A 1TVRB 2WB4A 3GIMA 3H59A 3V6HA 4F8RA 1KSPA 2ATLA 3NCIA 4GMJB 4TY8A 1C0UB 2HVIA 4ZPBA 2OZMA 4CESA 5KFVA 3VA0A 3RMDA 2BANB 5KFWA 1EETA 5KFUA 2G8IA 4F2RA 1WNSA 1KTQA 1UOCA 5D3GA 4W5TA 2J6UA 2AX1A 2HVHA 3OYMA 3M9NB 4ED8A 1RT7B 4DQPA 3THVA 2FVRA 3BDPA 3G0ZA 5KFBA 4FS2A 1C0MA 4R5PB 4BE1A 3VQBA 3CFRA 1F21A 4B08A 4BDZA 5C5JA 2Z1HA 2XY8A 3I5BA 1NK7A 5C42B 3TWHA 3OYNA 2EHGA 4Q45A 4CIFA 2Z1JA 2CKWA 3DRPA 5JUMA 3QEIA 3OJUA 4CEAA 1ASWA 3RMAA 4K8XA 1A5XA 1HMVA 1C1BB 3I5AA 4KV8A 3JYTB 3OYHA 4RZRA 3TARA 3ZSOA 4PQUA 4IFVA 4NCBA 3AA4A 4C8OA 4FZYA 1D5AA 4O44B 2AGPA 2R2TA 3SV3A 4DQQA 3T19A 4FJGA 2OZSA 1QE1A 3BSCA 2F96A 3VQ4A 4ED6A 4YMEA 1RA7A 3RRGA 4FZXC 3LWMA 4FJMA 2XI2A 4F4ZA 4TYBA 4FM1A 3CDEA 2IMWP 3DOKB 3V81A 1TV6B 3AVLA 3QEWA 1W9HA 2W9BB 4I9QA 2OPQB 3I0RB 2GC8A 1HYVA 3O4QA 3BGRB 4CEZA 3CVKA 4CECA 3I0SB 4AHRA 3VQEA 3OYAA 2R8JA 4FLWA 3OS2A 5HBMB 3PZPA 3EPGA 3OLAA 1C0UA 5HLFA 4CFAA 1TKTA 2VG5B 4CK1A 2GIRA 1BI4B 3KLHA 3ICLA 1T05B 4QWAA 1TKDA 3PJXA 3T5JA 3KKSA 3DRSB 2ASLA 3DRRB 2ASDA 3NDKA 3MEDB 3IG1A 3ZSZA 1UAXA 2JLEA 1B92A 3H5YA 3RMBA 4XPEA 1RT3A 3GV8B 3L2VA 4ELTA 3DLEB 3DLGB 4CJ4A 4EO6A 1XWLA 2B6AB 3CO9A 3AO5A 3SNNA 3FSIA 2R8HA 1T7PA 4RG8A 2XI3A 4FVMA 3PY8A 1N56A 2E6MA 3F9KA 3FRZA 4FBTA 1JKHB 3SQ2A 4QW8A 5SWMA 1S6QA 3K2PA 1GX5A 1ZYQA 4WZQA 3PO4A 4KHRA 1NKBA 1RBTA 3WNEA 4HCBA 2AWZA 2A1SA 4O44A 3LP1A 3KLFA 4DQIA 1LAWA 3OYFA 4M94A 2GV9A 4CHQA 3M8PA 3IGVA 4HHTA 2PYLA 3MECB 1Q9YA 4NZ0A 3UQSA 3QEXA 3D28A 4EEYA 3VQSA 2IC3A 4E7IA 2KZZA 3CYMA 2IM1A 4M45A 2IGIA 3P5JA 1NKCA 4IG3A 4WXWA 4M3YA 2F8TA 3MAQA 2OPQA 1JLGB 4I2QB 1C6VA 4DL6A 4BDYA 3AA5X 1MU2A 1BQMA 3ZSQA 3Q8QB 4EP5A 3WNHA 3QGHA 4F4YA 3MXJA 4R0EA 3CQ8A 2RF2B 4ECVA 3G6YA 4NLGA 1SV5B 3TVKA 1VRTB 2VG5A 4IRCA 1C1CA 3S3OA 4IH6A 5CY4A 5CYQB 3CG7A 3VQCA 4QWEA 4CK2A 3LALA 2WK4A 4KE5A 3QGIA 3OSNA 2XGPA 5KT5A 1LWFB 4DTPA 2YHAA 4FJIA 2VG7A 1JLAB 1IO2A 3CDUA 4QWCA 4HVJA 4O3SA 1HRHA 2YNFA 4WFXA 3ZSWA 3EY1A 4E89A 3C6UA 1X9SA 1HPZB 1VSEA 3H98A 4FLTA 4DTRA 4QWDA 4DFPA 4C8LA 1RBRA 2X6SA 2YNGA 1GX6A 2IAJB 4B9NA 4M3RA 3RTVA 3UDLA 4NCGA 5F8LA 1EXQA 4GW6A 1W25A 4H8KA 4O55A 4UQGA 4Z4GA 1BQNA 4IR9A 1ASVA 4NYFA 5DG8A 1OS5A 4MFBB 1C0TA 2KFNA 1RDRA 4CHNA 2HWIA 4M3ZA 4TQRA 2IA6A 5DMRA 1DLOA 3QGGA 3EPIA 5HROA 3ALYA 2WHOA 4OKJA 1S6PB 1YTAA 1RT5A 4J9SA 4F4XA 2G8KA 1L3VA 1JLCB 3NHGA 1KVCA 4ED1A 5DQGA 3HXMA 3SI8A 3AVCA 1QSSA 1QAJA 3ISND 5J2QB 2DY4A 4I2PA 1BHLA 2UVWA 2RPIA 3GILA 4FW1A 1EP4A 4ECQA 4CJSA 1YVFA 3BJYA 1D8YA 4FM2A 1FKOB 4QAGA 1K1SA 4CF0A 4URGA 1WSJA 4CK3A 4DFMA 3S3MA 4FK2A 1S48A 1JX4A 2ETJA 5JS1A 3H4BA 1TK0A 3LWLA 4TN2A 3OS1A 3SFGA 3QZ7A 2V4RA 4F2SA 4EP4A 4IBNA 4DMNA 3V9WA 4NYZA 2D0AA 4KRFA 1HNIB 4WFZA 5DG7A 1JLBA 5C25B 4Y3CA 3L2RA 3O4NA 3Q8RB 1EX4A 5KRSA 4N56A 4DL2A 3AA3A 2XWYA 3VQ5A 5I3UA 3B6PA 1IKVB 5KFDA 1MMLA 3NE6A 3RB4A 4N47A 2YHBA 1IKXA 3K5NA 1JLFA 2AGOA 2R8KA 2BDPA 2WCXA 4K4XA 4RW8A 3QIOA 3WNGA 1IKWA 4K4WA 2HHQA 3VQPA 1WLJA 2W9CA 1J53A 2ZD1B 3DDKA 3OHAA 4FBUA 3M8QA 4R8UB 1WSHA 3HSTB 4CF2A 2VWJA 2D3UA 3OYLA 4QPXA 2ITGA 4ECSA 1DTTA 1Y97A 1S1WB 4J9LA 3BQ2A 4FJ9A 1QSYA 2R2UA 4EZ6A 4NLDA 5EUHA 3KLIB 4FJJA 4DU3A 4K4VA 4DTXA 1U48A 3TAEA 5T7BA 3S3NA 4ID5A 1T03A 2JC0A 4MIBA 3OSPA 1X9MA 4E7JA 3K58A 2Y1IA 3IRXA 1LW0B 1ZTTA 3L2QA 4JS4A 1TK5A 1A5VA 1TL3B 4DG1B 1D1UA 1WAJA 3KK1B 1SH0A 5KFMA 4LD0A 1VSDA 4B9SA 5F8NA 1VSMA 3VA3A 4FCYA 4DTMA 3QINA 4H4MA 2G8FA 2OPRB 4ID1A 1SH2A 2FVPA 1KCFA 4B3OA 1QAIA 2E6LA 5JS2A 2YNIB 5KG4A 4ECWA 2PYJA 1S0OA 4O3NA 3NF9A 2BE2B 4Q0BB 2BQ3A 3AVJA 3DI6B 2FVQA 1RTIB 1S1XB 4NRTA 4CHYA 3U3YA 4NCAA 3QZ8A 4Z4IA 4Y2AA 2G8UA 1HQEA 3EYZA 3DMJB 1LWEA 4CGFA 4TLRA 3K5MA 1R0AB 1S49A 3SI6A 5F8MA 5KT2A 3WNFA 4KTQA 5KG3A 4AHVA 1LV5A 4RW7B 4Z4HA 5I42B 4DWIA 4OKKA 2HW3A 5L1IA 4ZVFA 3ASMA 1HQUB 3NAHA 3H40A 1S1WA 4ECZA 3ZT1A 4KFBB 4KAIA 1QTMA 2XGQA 1RBVA 3PW7A 3OLBA 4YP3A 4PWDA 5L1KA 2IBKA 3AVBA 4DSJA 5KG2A 4IKFA 3MTKA 3LZJA 5CYMA 1KHWA 4W5QA 3T1AA 4N41A 4MIAA 3H4DA 2VG6A 2W8KA 1S1VB 3OS0A 3GIKA 2HNDB 2HMIB 2ALZA 4IRKA 3IS9A 1TKZB 1N5YA 3UIQA 3V6DB 1N4LA 5KT3A 1TKXA 1IKYA 3CFPA 3HVTB 4FW2A 2O4IA 2XCAA 4M3XA 4WYLA 3NBPA 4IFYA 3CFOA 4XO0A 1WSGA 4O4GB 4CJLA 2WONA 1S9FA 3OYKA 3E01B 2YKNA 1UWBA 1QSLA 4CF9A 2BE2A 3KJVA 3SPYA 2IS3A 1NK5A 2W9AA 2IM0A 5HP1B 1RBSA 4DTSA 4DSLA 4XIUA 3V4IA 3N6NA 4CCHA 5KFIA 4URSA 3QNOA 4DSIA 1A5WA 4CFBA 2ZKUA 3DOLA 2JEJA 2XY7A 3TI0A 4CFCA 2ZE2B 3DMJA 4TXSA 3MXMA 4I7FB 3NGYA 3ZSYA 3LPUA 4BACA 1KLMB 2YKMA 4WE1A 1JLQA 3KK2B 3CM5A 4CEEA 2XC9A 4DL4A 1ZBFA 2OPSA 4NLPA 1BISA 3HVRA 5KG7A 4KAZA 4ED7A 5EU7A 4ZMMA 5F8GA 1RT1A 3DYAB 2FJXA 4ZTFA 2GBZA 3TAMB 1HNVB 3MEEB 1S10A 1BIZA 2Y1JA 2OYQA 5J2NA 4KHWA 1FKPB 3PJWA 1RT6B 5DG9A 3KTQA 5KT4A 4ZTJA 5FDLA 4ECUA 1VRUB 4CJRA 3AVIA 4I9LA 2HNZA 3PR4A 2HB5A 3QLHB 3NF6A 1VSIA 2IDOA 3RRHA 3ZCMA 3DLKB 3LZIA 3HM9A 4DLEA 3SUOA 3ZT0A 1TL1B 1HYZA 4GVMA 4FK4A 3QETA 2RKIA 4JUZA 4KI4A 2HNYA 3M9MB 4DL3A 5K14A 1B9FA 3NH0A 1HYSA 3MEGA 4BWMA 4CJEA 3BREA 3NL0A 4EO8A 1TVRA 3H08A 1YT3A 3KLEB 3V1RA 2BGGA 3PX6A 1GOCA 4CGDA 4Y34A 3E01A 3ITHB 5F9LA 3HL8A 3L2UA 4AH9A 2KFZA 1G15A 5EDWA 3F73A 2BANA 3FFIB 3IN5A 1J5OB 1U45A 3LP2B 2E9ZA 1RT7A 5KFKA 4KB1A 4HYKA 1YTUA 3QEVA 2C22A 1I3AA 1QS4A 2FBYA 3N6LA 4I7FA 4FS1A 4KHNA 2XY5A 4R5PA 4IOBA 3OHBA 3ZT3A 3OYDA 3QESA 1NK8A 5C42A 1RT2B 4CJFA 2DFEA 4CJTA 1QQCA 2UUWA 4K4YA 1Z26A 1TGOA 4MK7A 3O3GA 4ZPAA 1T94A 1C1BA 1LW2B 3JYTA 3V9SA 2HHXA 3MR5A 3AO2A 3QYYA 2F8SA 3KMSA 2W42A 1RDAA 4PA1A 5KFQA 3KLVA 4IRDA 1FKPA 4ED2A 1SKWA 2IM2A 1VRUA 3T3FA 3OYBA 5KG6A 4J2EA 2V0NA 4CIEA 4W5RA 4OGCA 1VK0A 3QEPA 1TQLA 3P83D 3RMCA 5FRNA 3DOKA 1TV6A 4Y1DA 4WFYA 4KREA 2W9BA 4JV2A 3L3UA 1TAUA 3I0RA 1RTDB 3BGRA 4PUOB 2C2EA 4IDKB 3E51A 4BWJA 5KFRA 1NJXA 3KLEA 2FVCA 3I0SA 3KK3B 1IG9A 1REVB 5HBMA 4B8CA 1RTJB 3SQ0A 4EBDA 1VSLA 1KVAA 1S9EB 2R7YA 1BI4A 1GOBA 4NLOA 1O1WA 1T05A 2Q3SA 2IOCA 5JXSA 3DRSA 3K59A 3G86A 2P5GA 3DRRA 4CEBA 3MEDA 4KO0B 3BSAA 4CJQA 3NF7A 3RB6A 3EZUA 4CJ3A 3PV8A 4URQU 4TY9A 3ZSVA 5KFSA 4WZMA 3AVNA 4F3TA 4RW6B 3DLGA 3DLEA 4XPCA 4NLSA 4KBIA 2B6AA 4MH8A 5KFHA 4Z0UA 5KFLA 4Z4CA 2J6SA 3AO1A 3V6KA 3OYEA 1RT2A 4FJ7A 3TR8A 4ZHRB 3V9XA 1Q8IA 2QK9A 1JKHA 3QIPB 1IH7A 3TAGA 4CF8A 2X74A 4GC6A 4H4OB 3L8BA 1N48A 1RDBA 3ULDA 3QERA 4N76A 4CIGA 1HJRA 2J6TA 4O5BA 3RR8A 1NK9A 5KFYA 3PW5A 1U4BA 2AU0A 4YFUA 1S1TB 4IG0B 4OVLA 4NLUA 1L3TA 4W5OA 4MKBA 3P1GA 3MXIA 3MECA 2C2RA 5J1EB 2AJQA 1KFSA 2C28A 4FJHA 1JIHA 4OJRA 3DLRA 5KT6A 2V4QA 4YR0A 1NK0A 1S0NA 1ZBLA 1JLGA 1DTQB 2WRMA 4RNOA 4I2QA 4ZVHA 5KFTA 4RW4B 3U3GA 4H54A 5F9NA 5KFGA 1ZTWA 4OKEA 4KHSA 5DLGA 4BE0A 3KK3A 3NH1A 1WSIA 2RF2A 4FK0A 5EWEA 3TAFA 4AHTA 1SV5A 3CJ4A 1VRTA 4C8KA 1I6JA 4M3TA 1JLEB 2ASJA 1SUQB 2RDJA 5CYQA 3T5KA 1B9DA 2JC1A 3DLHA 2D5RA 4ZP7A 2YV0X 4DU4A 4DL5A 2ILZA 3AV9A 1RT4B 2B4JA 1LWFA 3HVWA 3SV4A 4KTZA 1N6QB 4LH4A 1JLAA 4DF8A 3DLBA 2X78A 2HHTA 5T14A 1S9GB 4E7KA 4OLBA 1HPZA 4DSFA 4IH5A 4AHUA 5J2PB 4DS5A 2I5JB 4TYAA 4FLVA 2XCPA 4RNNA 2IAJA 4EZ9A 4QWBA 2IM3A 2FBVA 3AA2A 4LY7A 1WN7A 3V9UA 4ICLB 3V6JA 4N5SA 1X9WA 3VN5A 3DM2B 3JSMB 3VQAA 1RILA 4G1QB 3GIJA 4MFBA 5KFJA 4FJ8A 3OYGA 2W7OA 1ZBHA 4H4OA 3VQDA 2DTUA 4CEQA 4HUEA 3NMAA 1QHTA 3NGIA 4YQWA 3LAMA 1RNHA 3V9ZA 4F3OA 5HRRA 3AVGA 1S6PA 4RNHA 1S1TA 2D0CA 1JLCA 4KB0A 1KHVA 4M41A 1FK9B 5J2QA 1RDCA 4ZP8A 5F8HA 3PW4A 3MR3A 1NK6A 4K4TA 3C6TB 4RU9A 2LSNA 4DL7A 2UUTA 1FKOA 4ZVEA 4ECYA 3KLGB 4Q8FA 3M8SA 2HHVA 4J9KA 3OVNA 4L8RB 4DTOA 3V1OA 2OPPB 2BRLA 1CXUA 4F50A 1LAVA 3GQCA 3CJ3A 4O3OA 4DS4A 1D9DA 1S4FA 5L1LA 4X2BA 3L3VA 4NLVA 4DSEA 4YR3A 1S1UB 4Y2CA 2WTFA 3SJJA 3D5MA 2G8HA 3GYNA 1HNIA 1NKEA 1LWCB 2IJNA 4O3RA 3NAEA 5C25A 3HKWA 4B9VA 1U47A 4KHQA 1RDDA 4LQ3A 5F8JA 4TY8B 5DGBA 2O5DA 3QNNA 4K50A 3VQ8A 1IKVA 4K4SA 2DPJA 1NJYA 4NLXA 1ZETA 1W0HA 4DEZA 3CDWA 3SPZA 1EETB 4LSLB 4TQSA 4OGEA 5D3GB 2ZD1A 1K1QA 1KVBA 2XO7A 3TQ1A 4R8UA 4WXOA 5HRNA 4CGGA 4FJNA 2D41A 1D0EA 1VSFA 4OL8A 4DU1A 4EYIB 3KLIA 3V1QA 4DLGA 4RNMA 3HK2A 4J9MA 2V9WA 2QE5A 3FQLA 1VSHA 3PR5B 3O3FA 1XHXA 4E7HA 3DRPB 2G8VA 4F4KA 3ZT4A 1TAQA 4KTWA 2FVSA 1HMVB 5DGAA 1LW0A 2HAIA 1WAFA 4ECXA 2R2RA 4PQUB 3HJFA 4IFVB 1TL3A 4DG1A 3OYCA 3RB3A 3KK1A 2HWHA 3C6TA 4PY5A 2DFHA 1JXBA 2WOMB 1QE1B 1ZBIA 5C24B 3KHLA 4C8MA 3RBEA 1CLQA 2FBXA 3KHGA 1WSFA 2OPRA 1NHVA 4HTUA 1I39A 2YNIA 3SQ4A 3OJSA 1J9AA 5KFNA 3BR9A 4HKQA 4CHZA 3OL9A 3CM6A 3BSOA 3C94A 5KFZA 1EKEA 2VA2A 4Q0BA 4CGIA 2OH2A 1JL2A 5L1JA 3O3HA 2XRIA 3DI6A 1RTIA 1S1XA 2BQUA 1LWCA 4O0JA 3NH2A 1NHUA 2VA3A 5KFEA 5HLFB 1TKTB 3VQ6A 4ZP6A 4NLYA 3KLHB 4J9PA 3ZSXA 4KKOB 1R0AA 4LSLA 4RW7A 5KT7A 3IG1B 5I42A 3H5XA 1RT3B 1RA6A 4ELVA 1HQUA 4OLAA 4JS5A 3T5HA 4QCLA 4KFBA 4AHCA 4DFKA 3S9HA 1XHZA 2G8WA 5E41A 4RUCA 2KZMA 5KG0A 4BDPA 3AO3A 3NGDA 1S6QB 2FBTA 1TK8A 5CZ1A 4B8AB 1S1VA 4AHSA 1IM4A 4CEOA 4FLZA 2HNDA 2HMIA 1Z4UA 5KGXA 3SZ2A 4YR2A 1KFDA 1TKZA 3LP1B 5KFXA 3AO4A 3KLFB 2BRKA 3TANA 4LH5A 3V6DA 3M8RA 4J2BA 2HHSA 2P1JA 2WOMA 3M8PB 2KTQA 4CERA 3HVTA 5C24A 4CFDA 5KFCA 3H5UA 3HYFA 5FRMA 4JRQA 3QIDA 4ZVGA 3KOAA 4CGJA 3SQ1A 2IC3B 3RAQA 1RCHA 4O4GA 4CJKA 4CHOA 2W7PA 3RBDA 2P5OA 4B9MA 4IG3B 2EC0A 4DTNA 2O4GA 3HHKA 2EX3A 1U04A 5HP1A 2D7SA 2C2DA 3EZ5A 3HP6A 1MU2B 1BQMB 2Z1GA 3IAYA 5DK5A 2FLLA 3MFIA 1S97A 3GIIA 1NJWA 2ZE2A 4IKAA 1C1CB 3PVXA 3MF5A 2QXFA 4CJPA 2GIQA 4KKOA 3U6FA 4MQ3A 1KLMA 3KK2A 4FYDA 3AVHA 1ASUA 2ATQA 2VG7B 4J9NA 2YNHB 4KHMA 3MFHA 4KHUA 2YNFB 3Q8PB 3C6UB 1YVUA 1WSEA 3DYAA 4FZZA 4J9QA 2PY5A 2YNGB 4KSEB 3KNAA 3TAMA 4B9TA 1HNVA 4OPJA 3MEEA 3LAKA 4BE2A 3FDSA 4DF4A 3TABA 4NCGB 4MK8A 2Z1IA 1RT6A 1BQNB 1S5JA 1JXLA 1SKSA 2E9TA 4ECRA 1C0TB 3I5CA 4FJXA 3QLHA 3K5OA 3HVAA 4O3QA 3PO5A 1S0MA 3LANA 3DLKA 1NK4A 1DLOB 3FQKA 2P51A 3OL6A 1FXXA 5HROB 2FLPA 3L2WA 1TL1A 3UPFA 4B9LA 1RT5B 3OL8A 5F8IA 3SUPA 1L3SA 4JV1A 2GUIA 3PX4A 4I2PB 4ED0A 3QO9B 2JGUA 1EP4B 3C95A 3KIOA 2JEGA 2UVVA 2AQ4A 1L3UA 3ITHA 3PX0A 1D9FA 3GV7B 2I1RA 3VQ7A 3FFIA 2X6NA 2IJFA 4EYHB 1QUVA 2UVRA 1J5OA 1RTHB 3LP2A 4U7CA 2KW4A 2JEIA 4E1MA 3RWUA 1SL2A 4FM0A 1CZBA 2DFFA 1SL1A 4Z4EA 3PHEA 4DFJA 1JLBB 4KB7A 5EWGA 5CZ2A 4FLXA 2YNHA 5EWFA 4RUAA 5I3UB 4KPYA 1K6YA 2R8IA 4IR1A 4HUFA 1IKXB 4ZP9A 1JLFB 3CIZA 1X1PA 4DQSA 4QW9A 4EBCA 4RW8B 1IKWB 1LW2A 4FJ5A 2W9CB 1HARA 3M8QB 3BSNA 4Q44A 2NUBA 3SCXA 3SFUA 3NFAA 1DTTB 1Z25A 4W5NA 3K5LA 2KQ2A 2ZQBA 4Z4FA 2F8EX 4J9RA 3KHHA 4ZPDA 1NJZA 3RR7A 4C8NA 4ID5B 1T03B 4F4WA 1XR5A 4GC7A 3IRXB 5KG5A 1Q9XA 4J2AA 3MR2A 1RTDA 4FJLA 2D0BA 1U09A 3I8DA 4PUOA 3CWJA 4IDKA 2FC0A 1NOYA 4CGHA 3QO9A 4CJVA 4WYWA 2FLNA 1REVA 4JRPA 3G10A 1RTJA 3D0PA 1T3NA 5KGWA 2CJQA 4E1NA 1CZ9A 4H4MB 1S9EA 1JXEA 3NF8A 5KFOA 1BIUA 3G6XA 5KI6A 4FLYA 3OY9A 4B3OB 3H5SA 4KO0A 1XC9A 1RTHA 3HP9A 1JL1A 4CE9A 3GV5B 1GOAA 3HPHA 1BL3A 5DQHA 4RW6A 1VSKA 4K4UA 5KFAA 1C1AA 1RYSA 2B5JB 4O4RA 1HQEB 2RN2A 2E4LA 3UR0A 5HRPA 5SZTA 4ZHRA 1TP7A 3HT3A 3M9OB 2XHBA 4KHYA 4ZPCA 1LWEB 2QKKA 3QIPA 4IQXA 3OYIA 4QOZB 1RBUA 5HRSA 3KKRA 3KMQA 5J2MB 4CJ5A 1ITGA 4CEFA 2ILYA 2OA8A 4O0IA 4G3IA 4E7LA 4ELUA 3ZSRA 3PW2A 4CEDA 1XR6A
chains in the Genus database with same CATH superfamily
2YHXA 2VWKA 3ISNC 2A2DA 2H54B 3SUQA 3K57A 4Y0WA 1BGXT 4HUGA 1XNQJ 3NLCA 3LP0B 1WC6A 5J1EA 3DGVA 4DQRA 3IR6B 5FROA 3CSKA 2QWRA 4FKXA 4DTJA 4LFAJ 4YOXA 4K59A 2VOOA 2J7WA 1J5EF 2WVEA 2QW9A 1VSJA 3G6VA 4CHPA 1NWKA 1IV0A 5AZJB 2NXNA 4MKAA 1UMJA 3C14B 3EGNA 2B43A 1F3FA 4I69A 3KD1E 3OL7A 2CPXA 2HHHK 2GAHC 1XUPO 4TKTA 3PUFA 1AXQA 4YNQA 4JAXA 3CTRA 4CJUA 4IFYB 5D4NA 3PW0A 5KRTA 3RB0A 3G82B 5GMDA 4YOWA 5HQLA 2DGSA 1QZ6A 2XBPA 1NM1A 4JI4F 4PKHA 4QYZJ 4RBTA 3ZZPA 2KHOA 2DTJA 4Z2XA 1FESA 2H1YA 2B5JA 5J2PA 1SH3A 1SQGA 1ZBUA 2BBEA 5DRKA 4DV2F 1RAJA 4NRUA 3FEXB 3DDNA 1SQEA 3EMTA 1V9OA 4AF1A 2DB1A 2KT2A 1PG5B 2J9EA 2V63A 3LP3A 2GGPA 4LFBF 4GKKJ 4G1QA 1ZXOA 3WQUA 3R7BB 2IY5B 3AY9A 4Y1CA 1B0TA 2GV1A 1U1RA 1Q82O 2VFRA 3I4HX 3AVFA 1N36F 3EJMA 4JLHA 3DGPA 5LJ5Y 5B08A 1LK5A 2W8LA 3SYZA 3FBFA 1U1NA 3LP0A 3QFUA 1NOZA 5AQOA 1FRLA 3TAQA 2R4FA 2JEFA 1RSCA 4NYOA 4CO2A 5KQ8A 3N6MA 4FXVA 3T1HJ 5BR8J 1FWKA 2VPWB 3UN5A 2CGLA 1HNWK 1YRTA 3J7ZT 1ZM2A 2QA1A 3NKYA 3ZZ0A 3A0IX 1HNZJ 4M3WA 3V81B 2AYMA 1YAGA 4C11A 1T8EA 4J2DA 1ESVA 5EHHA 1T3VA 2RKIB 3QMLA 1VS3A 2E5HA 2UXCK 4CNZA 3VQQA 2AIRB 2BQRA 4O3PA 3MPUB 4OJ3A 3V6HA 3NCIA 3GCWP 4GMJB 5A8RB 1P8GA 4TY8A 1C0UB 5KPZA 1BU6O 4MO5A 4K2XA 3GSDA 2XLKA 4ZPBA 3UW1A 4JHDB 1GXLA 3SDEA 4DV1F 2OZMA 4CESA 1XMBA 4CVNE 5L9NA 5KFWA 3JAMO 3NEKA 4F2RA 1WNSA 2RE2A 3TR5A 2I7PA 4FWSA 2J6UA 2AX1A 2HVHA 2NYIA 3CCWA 2P9PB 1MN7A 3ZC4A 3THVA 3SMSA 3GBTA 2FVRA 1YSJA 3C0BA 2VUGA 2XSJB 1N54B 4R5PB 4BE1A 4FXWA 3CFRA 4KH0B 1F21A 5C5JA 3ZTPA 2Z1HA 3I5BA 4X66K 1NK7A 4WPAA 3N9UC 1RAOA 2P5VA 2GJFA 2OI2A 2CKWA 4EUVA 4OX9F 4K8XA 1WC0A 4Q7AA 3W8GA 2QLXA 4CRJA 1C1BB 4LF8F 2BABA 3VENA 4IFVA 3ATUA 3R5GA 1QVFR 1UFKA 4OIXA 1D5AA 3CO0P 5A8WA 1RGVA 4ES1A 3ILLA 3QBCA 1QE1A 2RQMA 5THWA 4CWBA 1RA7A 3LWMA 4FJMA 2CJBA 4F4ZA 4C9DA 3CDEA 4OYIA 3V81A 5LSLA 2XMAA 3VAMA 4DXLA 3MWBA 4A5BA 2AJ1A 2QWLA 1W9HA 1XMOK 3OFEA 3I0RB 1HYVA 3O4QA 3BGRB 3K9KA 2WSCC 4CEZA 3M05A 3TA1A 4Y28C 4F67A 1NGJA 3I0SB 5GAEP 1VOMA 3VAGA 4JYAK 1T11A 4BQLA 3MM6B 3OS2A 1C0UA 3HD2A 1FJGF 2W4DA 1SQKA 4JHDA 1TKDA 3PJXA 4UOHA 1YX2A 4EMDA 3DRRB 3D2WA 3LGMA 5HN0A 3ZXWA 1WEZA 1UAXA 1E6VB 1U2VB 2DGXA 4BS2A 3R7SB 3MUVP 4ELTA 3DLEB 3DLGB 2HS4A 2M2BA 3DLLL 2B6AB 3AO5A 2QA2A 1IWGA 4CJ7A 3RRKA 5AXMA 2CQGA 3HZEA 3PY8A 4BRIA 1AROP 1JMTA 1FERA 3SQ2A 4QW8A 2KM8B 1QVGR 3R2CJ 1ZYQA 3CDAA 4DUZJ 3WX8A 1NKBA 4JKBA 2AWZA 4DQIA 5AQFA 4M94A 5GADI 1QZ5A 3PKMA 4AE5A 3BZKA 3MECB 4RWTA 1Q9YA 4NZ0A 5AR0A 2UU9J 2GHPA 3CCRS 4EEYA 2YPZA 4I67A 2KZZA 2ZJQL 3MN5A 3MMVA 1NKCA 3HULA 4IO9Q 5AQUA 4M3YA 2UUCF 4GVEA 4YB7A 1VQOS 4BDYA 1RGIA 3RBXA 2WW4A 3ENWA 4OFZA 2VHGA 3MM6A 1PC5A 1CJTB 4ZJLA 2DNZA 4WTYA 4NLGA 1VRTB 3D2EB 1NH7A 4IQMA 2CQ4A 4JV5F 4EK2A 4QWEA 4CK2A 1X3NA 2WK4A 1RWUA 3C8YA 1UFLA 4O0NA 1GNKA 5F0UA 2HKEA 1FXDA 2VG7A 1E6VA 4HVJA 1Y3KA 4WFXA 3LOUA 2QA4S 3E9OA 4DKWA 2IRYA 1HPZB 1VSEA 4L73A 2XS2A 1G1XA 4QWDA 2A2CA 2NSCA 3GFXA 3ADAC 1X5SA 4C8LA 4EHTA 1RBRA 2VU5A 2YNGA 2X6SA 3IWNC 3OTEA 1GX6A 1OH5A 5A76A 1H98A 3CUNA 1YJNS 2ZWOA 1K8KA 4LR8A 4IR9A 1QM9A 5DG8A 2PMHA 4MFBB 1C0TA 2VD3A 4PL7A 4I0WA 1VQ7N 3J7ZO 3UKRA 3MZIA 3B82A 2DHSA 5HVFA 1DLOA 4FPAA 3EWGA 4IOCQ 4J9SA 1QSSA 3AVCA 4BRAA 1SAZA 5J2QB 3BBBA 5B0FA 4P72A 1EP4A 2L9DA 4ECQA 1YVFA 1D8YA 4FM2A 1FKOB 3O2IA 5ADXA 2VASA 3G8QA 1WSJA 2E66A 2RUGA 1S48A 4CI6A 1GMWA 3W8PA 4RKUC 1S72S 1JX4A 2V8GA 3H4BA 3EL2A 3G8TA 3QT8A 2UV8G 1M90T 1XEZA 1RWKB 1RE1B 3V9WA 4NYZA 2DNGA 3VESA 2KJWA 4P7TA 5M2PA 1JLBA 5C25B 3LDOA 3HCXA 4PXEA 1Q1KA 3AA3A 2GS8A 5E3AA 2P9UB 4ZPWR 4NXNK 2RILA 3RB4A 1SC6A 3GWCA 2YHBA 1RWNB 3KWMA 2DGTA 3THWA 2R8KA 5GAEI 3UDEA 4RW8A 3VETA 3WNGA 1IKWA 3WXLA 1J53A 1U6FA 2ZD1B 2EEYA 3GJRB 4R8UB 1WSHA 5LXYA 1PJ6A 2VWJA 5ETPA 3HHNB 4FWLA 3D6HB 2ZGZA 2IFXA 1HR0K 3M2VB 2LYVA 3KLIB 1RTZA 2D74B 3AAQA 4FJJA 2CPZA 5F2RA 5T7BA 4ID5A 4MIBA 4A47A 1XMQJ 1X9MA 4CT9A 3K58A 4C48A 2PO4A 4AQYF 2QWNA 4DG1B 3J7AN 4WYBA 1WAJA 1RFQA 3KK1B 3X1LB 5HVHA 1VSDA 3K9JA 4B9SA 4M63C 1UVMA 2YX4A 3VVUA 1KNZA 1KXPA 1WKLA 3VA3A 3HHLB 2F4VF 4DTMA 3H7HB 2JJ4D 1CS4B 5JLHA 2FVPA 3OQ2A 3WXIA 2X3DA 1YJVA 1QAIA 5JS2A 1FDNA 3AJDA 3K8WA 1JK9B 3QFWA 2MZJA 1U7LA 1MROA 4JI8J 5M1OA 1S0OA 2L41A 1W7WA 3NF9A 1R6VA 4Q0BB 2Q43A 5AQLA 4CLTA 3KDOA 3MHYA 3KG1A 4GRSA 1RTIB 4M5DB 4NRTA 3H1VX 4Z4IA 2UXBJ 3TVZA 5KAKA 2V50A 4BGAA 3H42A 2VQEF 4P2XA 2D0OA 1NPRA 3EX7B 1VQNS 2RS8A 3VEVA 4DV6F 3CIMA 4MLHA 2FJBB 2IDLA 4RW7B 4Z4HA 5I42B 2O8FA 3H3OB 3OTOK 4DWIA 4YOVA 2HW3A 5L1IA 2E2NA 4DV0J 3IA0A 1V5VA 4KFBB 2XMUA 2VH7A 1QTMA 4P2SA 2AP1A 1RI7A 2XGQA 1RBVA 5BRDA 3OLBA 4YP3A 3HHLD 4PWDA 2IBKA 3AVBA 3AODA 4DSJA 1IBMK 4LVOP 4ZVQB 3IKMA 5IT0A 5LXRA 3TWZA 3T1AA 3VAIA 4N41A 3O8WA 2HBLA 3J7YU 3W5ZA 3WZ0A 2HVEA 1KTVA 3GIKA 2HNDB 1J2VA 2OAUA 3R5JB 4J90A 3DCAA 2WSFC 3U1NA 5DO2A 5HOOA 1N5YA 2ASMA 3UNYA 4C3KA 1V5IB 2ZM6K 3MR7A 4JKDA 1IKYA 1IWAA 3HVTB 4DQ8A 4FW2A 5EX0A 2XCAA 1TMMA 2GHVC 3PEHA 3RW7A 1CS4A 5JJBA 3S1TA 4WCEQ 4XO0A 1N33J 2WONA 2AF6A 1S9FA 5KOWA 2YKNA 1QSLA 2QXLA 2KI2A 4CF9A 4WFNL 2IS3A 3U4LA 1RBSA 2C3PA 2DEIA 4DSLA 2Z2YB 3K2YA 5KFIA 3QNOA 4TVAB 1A5WA 3OT9A 4CFBA 4L3KA 2JEJA 4MTPA 4TXSA 3MMJA 4LVNP 4U96A 3C2PA 4BROA 3NNAA 2MSSA 3BEXA 3LPUA 4OZLA 4H0TB 1U6BA 3CM5A 4JOUA 1FTRA 1YZ6A 2OPSA 2P9GA 3HVRA 4KAZA 1FI4A 4F3QA 4DV5K 1X0PA 3QBXA 1B0PA 5F8GA 5GAGP 3DYAB 4ZTFA 2GBZA 3TAMB 2AV5A 1VQPN 4X62K 4BC9A 3M6GA 1S10A 1VAZA 4BRKA 3PHTA 1FW6A 1TL7B 3MM5A 3T1HF 1RKJA 4ZTJA 5FDLA 2FGCA 4JI1J 3R6LB 3PR4A 3NF6A 2ZF5O 2X7IA 4LF6F 3RRHA 3ZCMA 4GV6A 2EVZA 3R5AA 4Q2MA 4DU8A 4DLEA 1M90O 3N4WA 4GVMA 5U47A 3OD2A 3M9MB 1B9FA 2XMMA 2EBEA 3EKSA 5BXIA 3LM2A 3MEGA 4BWMA 1HBMA 3G87A 2IVPA 2XHCA 2ZGYA 4EO8A 3H08A 2ZWPA 3V1RA 1GOCA 3BP8A 4CGDA 3DXMB 3RUBL 3KWGA 3TOQA 2BOPA 2OEJA 2BANA 1FNXH 1Q8KA 1J5OB 1U45A 3Q7CA 1G4CA 4JKAA 1VBYA 4CYUA 1RAFB 4M5NA 1FXLA 1I3AA 2FBYA 3N6LA 1BMQB 5D0EA 4IOBA 5ETKA 1XC3A 3OYDA 1I3OB 2M8DB 5C42A 3NCPA 1QQCA 2UUWA 4K4YA 1Z26A 2YKOA 4I6AA 3O3GA 4HTLA 5G0RB 2DH8A 5LMNK 1T94A 3JYTA 3GJTB 3DRXA 3A1YG 3KMSA 2W42A 3HKZD 5KFQA 1ZA2B 1TL7A 1WTBA 4M5LA 2W24A 2HZVA 2ATCB 3C6AA 3CJBA 1NSPA 2QLJB 1T95A 4PPZA 1TUYA 2X1GA 4W5RA 4LF2A 3QEPA 4DR2K 3P83D 2K1RA 2F8HA 4LC9B 1NLVA 3DOKA 5IOLA 1P9YA 2W9BA 3EXCX 4MDAA 1RDWX 1S79A 2J9CA 4WP9A 4BWJA 2WUSA 3CCLN 1YWXA 5KFRA 2XYHB 1OKJA 3THXB 2XNRA 1REVB 4B8CA 3HSJA 1WHWA 1T3OA 4JK9A 2KN4A 1WBDA 2R7YA 1O1WA 4NLOA 3O9SA 2C3OA 3P8BB 2ITMA 2ZBPA 1FFGB 2H3GX 2IJRA 4BC3A 4MMOA 1U2RA 3TNVA 4M7XA 5EXWA 1Q81T 3RSEA 2CQDA 5KFLA 1F5BA 2HQFA 3V6KA 3FZHA 4FJ7A 3Q89A 2B9YA 2QTWA 3ZZRA 3DOMA 3GIRA 2J0WA 2D3O1 5ADZA 5FD1A 1CG2A 1AFIA 4YHHJ 4FSVA 3LDQA 1BQXA 2D69A 5GAHU 1N48A 1E6YA 1NK9A 5KFYA 1P27B 3M8ZA 4YFUA 4IG0B 1YJWN 3MURP 2F65A 4EAHD 3P1GA 4KGMA 5HMZA 3EVMA 2P9LB 2C2RA 5IWAJ 2CQ0A 2VFTA 1U0HB 3AHPA 1KFSA 4AXJA 3PKYA 5EX3A 3ENVA 4FP9A 3EDQB 3KZBA 1NK0A 5FLXO 2XMTA 4FYXB 1HKCA 3G96A 1DTQB 4RNOA 5KFTA 5ITHA 3FVYA 3THXA 5C10A 3EICA 3I55N 2RF2A 1I6JA 1KN6A 4KBOA 4M3TA 1VC6A 1SUQB 5CYQA 3UI3A 2Q1LA 2RNEA 4KH6A 4DU4A 2B4JA 4TU7A 2OELA 3G71S 3RBZA 1JLAA 1PYSB 1VQ4N 4DR3K 2K7JA 4P71A 2ZVSA 2HHTA 5T14A 1S9GB 1X5TA 3O9RA 4OLBA 2RDDA 2DNKA 4DSFA 3FEZA 1YJRA 1KOOA 2FC9A 4HHJA 2OTLN 4X4VA 4WWSA 2VQFK 1FNMA 3V9UA 1OY8A 4ICLB 1MWZA 5IZHA 4B3SJ 4N5SA 1X9WA 3JSMB 1CJUB 1PO6A 3CD0A 5H9FJ 5CABA 1H6KX 2E29A 3T6BA 2V2VA 2W7OA 2C42A 2E88A 4HUEA 3NRBA 4F3OA 5JVGQ 1YI2N 3NGRA 3ZTOA 4BHQA 4M41A 2CJ9A 2E5LK 2WW8A 3PYFA 4H4KA 3MN9A 3C16B 3C6TB 4N8OA 5JMNA 4DL7A 2UUTA 2ZOGA 2N3LA 4GNIA 3MCNA 3KLGB 4Q8FA 2RIJA 3O5TB 2HHVA 1BE4A 1MG7A 1AZSA 3OTCA 4DTOA 4O8KA 3FKBA 2BRLA 4F50A 1TL5A 4WQ4A 1X5PA 4WP3A 3ZZZA 4W98A 2YI1A 4HACB 4O3OA 4ER8A 5L1LA 3L3VA 2W2NP 7FDRA 2D1CA 4YS2A 2WTFA 5E3QA 2G8HA 3U7JA 3ZNJ1 3GYNA 1NKEA 4IUFA 5E3RA 3HKWA 1U47A 1VQ6N 3AFGA 1YHQN 2IYIA 4X4RA 3G71N 5DGBA 2O5DA 2UUAK 1HNXJ 2DPJA 1BA1A 3H1QA 2ROPA 4HI1A 4X64J 3KUHA 1IR2A 4ERDA 1M0SA 1EETB 4LSLB 4TQSA 4JI5F 2BM1A 4IWVA 5D3GB 4X4NA 3W2WA 2VC0A 3MOZA 2B51A 1ZAXA 5HRNA 4CGGA 2VPYB 2NRWA 2G2YA 3MMBB 3E9LA 3A3OB 1D0EA 1PGZA 3GJSB 5GIOA 2VDIA 5CE3A 2OP5A 2SXLA 4EYIB 2FDNA 4RNMA 2YXLA 2V9WA 1FRMA 5CAAA 1XMQF 3C7NA 3VEXA 1M1KO 4F4KA 5MLCV 3UN2A 1N8RO 1RWOB 1YIJN 5DGAA 2XLIA 2HAIA 4ECXA 1RBLA 2LEBA 1TL3A 5GVQA 2W2PP 3OYCA 4OYMA 3C6TA 4GO7X 4WIQA 3JB9k 2BEFA 2ZC4A 4M8LA 2WOMB 1ZBIA 5K9FA 1E3MA 1CLQA 1M5KC 3KHGA 1NHVA 4V19J 1I39A 2HRUA 2O8DB 3SQ4A 3SIPB 4DUYK 1R8CA 1NGCA 2WBMA 3C94A 4BRNA 1NB7A 2DR5A 1Q81O 2A5XA 1JL2A 4BVPA 2DRAA 5L1JA 1HD0A 2BUPA 4QOTA 3DI6A 2RQCA 4XTTA 2BQUA 3VTHA 4CO1A 3IMQJ 2HRYA 1ZC6A 4DV1K 3I87A 4ZP6A 1SPBP 3TPQA 4LSLA 2VGNA 3TUJC 5KT7A 3IG1B 4LF7F 2VL1A 1RT3B 1RA6A 4DV0F 2B9EA 4E8UA 4QS9A 1VQKS 3T5HA 4CI0B 3HHLC 4BRCA 1XHZA 2ABYA 1FRXA 4J37A 1I1GA 4USKA 3M2RA 4ILJA 3C15B 5KG0A 4W90B 4BDPA 3NCQA 3NGDA 2O01C 2KYZA 2R7TA 2MGZB 1TK8A 1KC8T 5CZ1A 4B8AB 4AHSA 3W3SA 4BR2A 3HFVA 5KGXA 5E2QA 3LP1B 4LH5A 3M8RA 3HSCA 3I32A 1XJWB 4YEAA 2L9WA 2WOMA 3M8PB 2VB6A 3B4DA 3MPDA 4D3GA 4CERA 3W2VB 1I5OB 5HANA 2ACMA 4CZFA 4CGJA 1G6BA 3RAQA 3SQ1A 1N33F 4O4GA 4CJKA 1S3XA 2HSEB 2HVDA 1X5OA 4DTNA 4JI3F 1ZZNA 5HP1A 2L08A 2CNOB 3SBMA 2E5GA 1R89A 1M5HA 4CLSA 1NJWA 2ZE2A 3PTWA 1NNEA 4JKFA 4IJAA 3U6FA 2RT3A 4MQ3A 3NNCA 3CQYA 2R9LA 2E1AA 4FYDA 2N4DA 5JICA 1ASUA 4I68A 2F1FA 2YNFB 3HI0A 5LL6d 3Q8PB 2PMZD 2UUBF 2KKZA 1T9YA 3MTJA 4FZZA 1WDTA 3GCXP 1HNVA 4CLZA 3HT0A 3DLLQ 4DF4A 3TABA 3SLCA 3HBTA 1P6TA 1RT6A 2F8MA 4JI1F 1IR0A 1LOUA 1SKSA 2E9TA 4ECRA 2K3IA 4FJXA 3CMAN 3DLKA 4DPUA 3FR0A 5AQYA 3OL6A 2HBMA 3VGTA 3GL1A 5CD4H 3L2WA 1ZA1B 3SUPA 3WC2A 2GUIA 3PX4A 3SCKE 3QO9B 4DR7J 3C95A 3SQGB 4KJIA 2JEGA 3IBFB 3SAFA 3A8IA 3O9TA 1L3UA 1D9FA 1FVQA 3W62A 3FFIA 1VYAA 1HBUA 4JI7F 1NMNA 4FOIA 4LF9J 4DV7F 4YDUA 4FWKA 1BG3A 1NSAA 4PL8A 4U7CA 3BPSP 2JEIA 4LFCK 3RWUA 1SL2A 4FM0A 5AQSA 3R6GB 4DCPB 1NSQA 5IM0B 4A8YA 4KB7A 5EWGA 3CCQS 3KUGA 4KPYA 4BRGA 2R8IA 4IR1A 1GLCG 4OI4A 4RUBA 1JLFB 2YTCA 1Z2ZA 3CIZA 4DQSA 4EBCA 2QRRA 3SCLE 4OYWA 5EVZA 4FJ5A 2W9CB 4X4OA 1HIYA 3I56N 1N0UA 3M8QB 3SCXA 1LKZA 2J76E 1WI8A 3NFAA 3M2UA 4Z4FA 2AJ0A 2ASOA 1GXTA 2AEMA 1WJ9A 1OSCA 4ZPDA 1NJZA 3THYB 4C8NA 3LUYA 4DV3K 4LR9A 1T03B 2BXJA 3GG4A 1FF2A 3H46O 2QZ8A 1XR5A 1A9NB 1V3SA 4GO5X 1RDUA 2G0IA 3M6VA 3LH2S 1RTDA 1U09A 4PUOA 2XWXA 3CWJA 4IDKA 1PILA 4CGHA 3QO9A 4CJVA 3CD5A 1UEUA 4WYWA 2FLNA 5IT9U 2E2PA 2NREA 3D0PA 3IP0A 1HHTP 1WSRA 4LT6A 4F36A 4E1NA 1S59A 5C2CA 3NF8A 1QQOA 4CTAB 3OY9A 3O8MA 2OEMA 4I64A 4KO0A 3G6ES 1K9MT 4DPTA 3L4IA 2A6OA 4KQZA 1V3RA 1GOAA 3HPHA 1K73T 5DQHA 4OYZA 1VSKA 5KFAA 1C1AA 4UW2A 2OCEA 2E20A 4A48A 1TELA 3HT3A 3M9OB 2DO4A 2CQCA 3AQPA 1LWEB 3Q83A 4IQXA 3OYIA 5HRSA 3KMQA 4GVLA 4C3LA 2EFOA 3VF0B 1ITGA 4CEFA 3U02A 2OA8A 4O0IA 4E7LA 2AZ3A 3ZSRA 1P1LA 4BC5A 5I3QA 2DH7A 1CBKA 1SL0A 3CJ0A 5HMXA 4USHA 3ZETB 5BRFA 1LQ9A 3QJLA 2IVNA 1N32J 2UXDK 2CDRB 2BV3A 3QSYB 4M42A 2DIUA 3N4PA 3H2LA 3AVAA 2HSTA 1HWIA 5IS2A 3CIPA 2HQIA 1NNDA 4H0YB 3OTDA 2NRVA 3LPTA 2H65B 1EKRA 2KKHA 2LEPA 1VQMN 5KTQA 4ECTA 4NYNA 4E3SA 4G65A 3QATA 4X4QA 4TSXA 3B6OA 4DHVA 4FJKA 3NBPB 3DRYA 2ACYA 3ZLJA 3TQEA 5LJ3Y 4HTIA 3R1XA 1SKRA 4QS8A 1L5UA 3SSQA 3CJ5A 3KFWX 3OR1B 3BM7A 1CXQA 1UWBB 1Z1ZA 2XQCA 3CJ2A 4HCCA 1HI8A 1FRJA 1NXIA 4LRBA 1GLEG 1NZAA 3V4IB 2Y1RI 5LL6Z 3W61A 5DM7L 2FHJD 3O6WA 3DOLB 1DJ0A 4Q5VA 3TUPA 4B3SF 2FJVA 2LU1A 2CZ9A 5KFPA 3NGSA 4X65J 3DM2A 3PCOB 2YKMB 4WE1B 2FJWA 1FDAA 4J9OA 4DSKA 5DLFA 2IVYA 3CCUN 4LQ9A 2P6TA 1HKGA 1XR7A 4FXDA 2CG8A 3O80A 1XNRK 5SUHA 4YOTA 3D1QA 1XNQK 4KV8B 4CNYA 3KD5E 2A1RA 2FHJA 4ALZA 1Y10A 4K8ZA 4IH7A 2AGQA 3AVKA 1SB6A 2BW7A 4LFAK 1F9FA 5J2NB 5B0DA 3ENAA 3D0GE 4DV4J 4NLWA 4FPIA 2MQPA 1NCLA 1X8DA 4ILLA 4FKYA 3A2FA 2COLA 5E3CA 2QFJA 4RBVA 2AJ2A 3BO2A 3DXBA 5K5MA 4B3TK 2AX0A 3FZKA 3CCVN 3FLCO 2HNYB 3I9V9 4JV0A 4RNFA 1S1UA 4FN5A 5BYSA 2WB4A 1QVFM 1RAGB 3GIMA 2LXFA 3H59A 2ATLA 2F5GA 2VBXA 1H72C 4QYZK 2Y1LB 2ZHBA 4X64F 3Q0AA 5CQGA 3VA0A 4FYVB 3UVJA 3RMDA 3VGSA 1KTQA 4ZJQA 1UOCA 2EG2A 3SCJE 3B8HA 2APOA 4WFNQ 3KVGA 3AOBA 1HKAA 4ED8A 4K0KF 1RT7B 5HSPA 2YWEA 3BN7A 5AQXA 3WIVA 4GKKK 5KFBA 1MNEA 3DXKA 5AQVA 2VICA 2FHMA 3CC2S 3THPA 2EFVA 4BRLA 2XY8A 3OPKA 2GWKA 1AYEA 2OSQA 3BB5A 3ILOA 2FF6A 4WK3A 3DRPA 5JUMA 3OJUA 2V9KA 2CJAA 3GR0A 4KV8A 3TARA 4AM7A 2PEHA 3ZSOA 2VIHA 4PQUA 4NCBA 3HSGA 4C8OA 3AA4A 3IXQA 4YY3J 4O44B 1LCUA 2OHDA 2ZJRL 3T1HK 3L7UA 5BR8K 1RHKB 2VPZB 3T19A 2MZTA 5H1SQ 2F96A 2A40A 2QEXN 1KQGB 1HNZK 2BH1A 1VMBA 4FYWB 3RRGA 2IVOA 1K9MO 4FZXC 4KHPF 3ETMA 2XI2A 4FM1A 2IMWP 2H5IB 2GFFA 5DETA 1O8BA 4F4AA 5E84A 1Q5VA 2Y8WA 8RUCA 4O23A 4UY8O 4JI6J 4PWUA 3JSRA 2ZFHA 2R8JA 2NLWA 4FLWA 1WUAA 5HBMB 3PZPA 3EPGA 5LSOA 5HLFA 3I6PA 1TKTA 2VG5B 2O8EA 2GIRA 3KLHA 3ICLA 4ETXA 3IUCA 2DVIA 3ENHA 3DRSB 3OXFA 3NDKA 1R8HA 3L0QA 2R7OA 5LMUJ 2JLEA 3H5YA 4XPEA 1TUWA 3TX8A 3L2VA 4OO1J 4EO6A 3SNNA 4LF5J 4RG8A 2XI3A 1PBAA 2J0SD 1E4FT 3F9KA 4FBTA 4USUA 5SWMA 1GX5A 3PXGa 4PHTX 2N4CA 1RBTA 3N79A 4HCBA 4O44A 4CLPA 2HURA 5H9EK 4MJKA 5T7LA 2GV9A 2MZQA 4CHQA 1OH8A 2E44A 2CQIA 2V4JA 2BACA 5AQMA 3W1YC 3UQSA 1VDHA 4MKVA 2IC3A 3UN3A 4ILMA 4DR6J 2KVIA 3CYMA 4BRHA 3FK4A 2GO8A 2IGIA 3P5JA 2UZAA 4YN3B 5A8KB 3AOCA 5BJRA 3MAQA 1JLGB 1NPPA 1R0CB 2DNPA 1BQMA 3Q8QB 4F9OA 5DS7A 3WNHA 2B3TB 3EZWA 2Q3PA 2VG5A 4UF4A 2HG4A 1C1CA 2ZJPL 3S3OA 2HEKA 3LALA 2XGPA 1V3ZA 1LWFB 2H4YB 2YJEA 3ELHA 4FJIA 3VMFB 4QWCA 1N34J 1URNA 2V69A 4MAKA 1X9SA 1UPPA 3WXJA 4FYYB 3R6MA 4FDFA 2BJ3A 4DTRA 4DFPA 1D09B 3P38A 3OTBA 3OUYA 2IAJB 3RTVA 4PKGA 1I94J 4B1ZA 5BREA 3UDLA 1FNOA 1EXQA 4GW6A 4H8KA 3OW2M 2YX1A 4O55A 4DUZK 4UQGA 1Z2LA 5A0YB 1ASVA 4NYFA 1RISA 2BKNA 4M3ZA 8AT1B 4TQRA 2IA6A 4ZCLA 2AA4A 5ETNA 3QGGA 3CD6S 3J81j 4YDUC 1S6PB 1S57A 1RT5A 2R7SA 5AZIA 3F2KA 5DQGA 1UW9A 2UU9K 1SBRA 2NYHA 3ISND 3PIPL 2DY4A 4I2PA 4DR7F 4A2AA 3S41A 4QAGA 1K1SA 3QBWA 4CF0A 2Z2MA 4URGA 3M32A 1J5EJ 4FK2A 1S7HA 1GMUA 4K2JA 3WIUA 3F9MA 2XMJA 1WEYA 4LF9F 3WX4A 1MMDA 3J7AP 4TN2A 3SFGA 3FBEA 1B64A 4EP4A 4B3RF 3H6EA 3SAHA 1R8AA 2O8CA 2HFUA 1HNIB 4GVBB 4KT0C 2K8GA 2HBKA 4DL2A 2XWYA 4ZVPB 5I3UA 3B6PA 5KFDA 1MMLA 3JTNA 4JI0K 1IKXA 3DU6A 3K5NA 3BPDA 2PIIA 3JQMA 3QIOA 1RAEB 4K4WA 2MQOA 3KNGA 5L39A 1WC4A 3OHAA 2W01A 2NLXA 4WKYA 2QLFB 1CULA 4J9LA 3SJHA 5A0YA 4NLDA 3CMEN 5EUHA 3AB2B 4MKYA 4CD1A 4DU3A 4OI6A 2ZBIA 1RHRB 3L6QA 1NRKA 2ASYA 3OSPA 3C19A 4BG9A 3R8EA 1N36J 1VRQC 3IRXA 3KHYA 5DDPC 2HGMA 4JK8A 4MO4A 2UYTA 1EB0A 1SH0A 1YRUA 3AD7C 4LD0A 1YZ7A 2GVDB 3W60A 1BXNA 4H4MA 1ELOA 2QO3A 4M1KA 3TJ9A 1SH2A 1KCFA 2UXCJ 2DEJA 4B3OA 3IWXA 2E6LA 2YNIB 4OQJA 5KG4A 1FJEB 5AQJA 4O3NA 1DQAA 2RRAA 2BE2B 1VR6A 3QNWB 4F02A 2QM1A 2A6MA 4CHYA 3GFZA 2G8UA 4K25A 1JNZB 1HQEA 2FZGB 5IXUA 2X1AA 2KT5A 2W7AA 3DMJB 2EKYA 2VJUA 2I9SA 4TLRA 2MTLA 1J6ZA 1S49A 2NRZA 2DPNA 1DEJA 5KT2A 5KG3A 4AHVA 3M1VA 3BF3A 3LO3A 5GADU 2EC2A 5IV3A 3HHEA 4ES3A 1FVSA 3CHWA 2XLJA 3FUYA 5GINA 1KQFB 1WOSA 1KAXA 1N32F 1IBLF 3G8SA 2V2QA 2DR8A 3J7YP 2CZ4A 5CYMA 3LZJA 1E4GT 4OX9J 3H4DA 2VG6A 1JWWA 4CDIA 1R8BA 2FJDB 4CLKA 3VAKA 3PJ9A 1MA9B 2HFZA 3IS9A 1TKZB 1RHJB 1UVLA 3V6DB 5K8NA 4BGBA 5KT3A 1TKXA 3VR1A 4ZVTB 1FXRA 3B78A 2YKAA 2NQPA 1VQ9S 2ZZMA 2DXFA 3P45B 2D0PA 5CD4A 4WYLA 1XMOJ 1ZOTA 3CFOA 2BKPA 4JI8K 1WSGA 2BVZA 3ID6A 4F3MA 1VJWA 5A2QY 2XMVA 1UVKA 3ZX3A 3R9PA 4DMZA 2BE2A 3KJVA 2BE9B 1QAYA 2HFSA 1NK5A 4A59A 2W9AA 2IM0A 2UXBK 1B7FA 3UKUB 2W4CA 1RHQB 4DR4F 4DSIA 2ADCA 5IQ6A 3I4PA 4CFCA 2GW8A 3DMJA 4OI1A 1WD6A 3MXMA 3NGYA 3FCWA 1PC4A 4BACA 1KLMB 1JLQA 3KK2B 5BPNA 2XC9A 2B4OA 4CZGA 3MAAA 3TP2A 1ZBFA 2B0GA 5KG7A 4ETZA 4QJVA 4L72B 4JKHA 3T1YK 5EU7A 3MWTA 4ZMMA 1RT1A 2FJXA 5D4PA 1G2EA 4Y2KA 5TKWA 4OX6A 3D3BJ 3X3UA 4KIAA 1FKPB 3PJWA 3KTQA 5KT4A 2HWTA 4OYAA 1C4AA 1VRUB 4CJRA 2HNZA 2HB5A 3CJKA 2Y8YA 1VSIA 4I4BA 3R5CA 3EN9A 4BRDA 2MZSA 4OYBA 4IO8A 3S01A 3ZT0A 4OI0A 1OH7A 4ZCKA 1TL1B 1HYZA 4NOHA 2EW9A 4FK4A 4JUZA 4F26A 3Q23A 1Q18A 2OTJS 5K14A 3NH0A 1YLXA 1HYSA 2DHGA 2HK3A 4J7CA 3GONA 1WHYA 2EK6A 5FPNA 1TVRA 1YT3A 2PSZA 1S12A 2BMBA 3PX6A 3R1HA 2YX6A 2ZNYA 5GAEU 4PYAA 3MCPA 1WHVA 5E7OB 1G15A 3U9DA 5EDWA 3LA0A 2HFVA 4QR0A 3FBCA 1KAZA 2BTFA 3SBGA 4U67L 4NXMF 3MM9A 5KFKA 4KB1A 3QWUA 3CCMS 1QS4A 4QU7A 2KRRA 5B0EA 4FS1A 3KG4A 5A2QO 5DDQC 3OHBA 3UNGC 5BPMA 3C46A 1B4SA 3EEQA 4CJTA 1K44A 3R9LA 2CNLB 4I6WA 2W2QP 2QC3A 1WELA 3D7SB 3BKUA 1LW2B 3MR5A 2CFXA 1F1BB 3QYYA 2F8SA 4YY3F 2ZH5A 1RDAA 3GMGA 1CJVB 4IRDA 1FRIA 2OD6A 1FKPA 1YVNA 2IM2A 4B3MK 1WG1A 1VRUA 3T3FA 3IBCB 2V0NA 3JAMU 1VK0A 4FF2A 2J5AA 1TV6A 4RU2A 3ET6A 2QJ3A 2R7UA 4KREA 4JV2A 2JWLA 1VQ5N 3L3UA 1TAUA 2LEAA 3UWTA 4Y2MA 2HF4A 4I56A 3AH6A 3GG1A 1RTJB 4BC7A 3BGOP 4X84A 1OSDA 4AYBD 4ZLPA 4EBDA 3OBYA 1VSLA 4DPWA 2R7QA 2CPDA 1BI4A 1GOBA 2Q3SA 4OI3A 1T05A 5ETOA 5JXSA 3EVWA 3K59A 3MEDA 4XEIA 3WC0A 3EZUA 5K8MA 4URQU 1OPIA 5LMUF 1KAYA 1VQLN 3ZSVA 2ZNZA 1MWYA 3MMCB 1U8SA 4WZMA 3RZAA 4H5WA 4XPCA 4NLSA 4NXNJ 3O1WA 4LF5F 3QWPA 2E2QA 2PDAA 1KP6A 4Z0UA 3V9XA 2DNMA 3VGVA 2QK9A 1JKHA 2HK2A 2HGNA 1U2FA 5GMEA 4ILGB 1Q78A 5GAHP 3GLJA 2LQ9A 2P9SA 3CJAA 3SSRA 4H4OB 1RDBA 2M88A 2LECA 3Q7BA 3OR2A 3ULDA 3EE8A 2JOQA 2KRBA 2VBWA 1S1TB 4OVLA 1B70B 1WF2A 2C2MB 1L3TA 4OPAA 4GMKA 3VF2A 4BRFA 5J1EB 4HR2A 2RD5C 3N28A 5KT6A 1M1GA 4DX6A 4CH7A 4YR0A 2W2MP 4Y00A 2MKKA 1HWKA 1S0NA 1ZBLA 2WRMA 4C0OC 4I2QA 4ZVHA 1WWHA 1RCOB 3U3GA 1UVJA 3QDKA 4BE0A 2LMIA 1NUEA 3D6MB 3DDIA 4LF1A 4PYDA 4FK0A 4AHTA 1SV5A 3ZZOA 4H0VB 2NUHA 4DN9A 3T5KA 1B9DA 1S77D 4ZP7A 2DCLA 4DL5A 2FJEB 2ILZA 1AB8A 2IVFB 5ETMA 3HVWA 3SV4A 2HIQA 4NLCA 1N34F 1BO5O 4RO0A 3QJPA 5AJ3F 2W6KA 3L7PA 3RVCA 1UFWA 3A13A 4IH5A 2W2OP 2VC1A 5J2PB 1KS2A 4DS5A 2IYGA 4TYAA 4FLVA 1H7WA 4EZ9A 3AA2A 1T9VA 4LY7A 1WN7A 4YHHK 3WQTA 2W41A 2GGPB 1WF0A 4G1QB 3GIJA 5KFJA 2AEFA 2I8EA 4DI6A 1Q79A 2FSJA 4H4OA 5I3PA 4PXDA 4C8YA 1GK8A 1QHTA 3NGIA 1RNHA 2BUNA 2CRLA 1IBMJ 1K47A 3HDSA 4OX8A 3DGPB 1S1TA 2D0CA 1JLCA 5IWAK 3CXCM 4GKJJ 2P9NA 4BRMA 5F8HA 2F9TA 3MR3A 3UD4P 4K4TA 3TTDA 4RU9A 3UDCA 4ECYA 4PKDB 3FFKB 2HHHF 1HLWA 4DX7A 2ZM6J 3M8SA 1PYTA 3MMAA 3HRGA 3OVNA 3HSZA 2YPYA 2WC9A 5HJXA 4RCHA 1FFSB 2Y9HA 4L8RB 1R0BG 2GJ2A 1VQYA 3JAMY 4ZIVA 2GUPA 4C11B 2ZBQA 1NPKA 2LVWA 2M5YA 4X2BA 4NLVA 1DQ9A 1Y3JA 1OMSA 4CBWA 2KH9A 3D5MA 5ETLA 2MQ8A 1NGGA 2IJNA 3CC4N 1QLNA 2O8BA 2ZC3A 4KHQA 4LQ3A 4TY8B 3QNNA 3S6EA 4K50A 2I2YA 1IKVA 1NJYA 5AQRA 4LBIA 2YKPA 3SDEB 1ZETA 1JJ2R 3OFFA 1WOOA 1VQ8N 2CVIA 1BHNA 4CO4A 5K8OA 5B7WA 2CNNB 1K1QA 2XO7A 3TQ1A 3A5LC 4FPBA 2PN6A 4WXOA 2B7BB 4TU9A 3LM9A 1VSFA 5DM7Q 2JRSA 4OL8A 4DU1A 4DV5J 1RHMB 2BJ7A 4DLGA 3MPYA 3ENBA 4J9MA 1LFWA 1TFYA 1Q16B 2ZH9A 1H0HB 1FO1A 2E8AA 1YJ9S 2MB0B 1NDCA 4DZ6A 1TAQA 4KTWA 2FVSA 5ELZA 2E1YA 4ANEA 1LW0A 1WAFA 1M5PC 2Q0RA 1S76D 4IFVB 4WQ5A 3RB3A 1HNWF 5A8WB 5E33A 2WBNA 1HJOA 3U8XA 1QE1B 2LXIA 2F7TA 3A12A 4OZ5A 4C8MA 3KHLA 3RBEA 2P9IA 3P6YC 2OPRA 1RJJA 2UXCF 4DX8H 4IXCA 4LF6J 1D3WA 4C6AA 1RBAA 5EN1A 4CHZA 3OL9A 4UUWA 1KQKA 1XERA 2OH2A 2AHOB 4DL0C 4ES2A 4B1XB 1HBOB 3O3HA 3BS9A 5HMWA 1S1XA 3N01A 2LA6A 3TO8A 4PKIA 1HNXK 4WKRA 3CC7S 3TX0A 2Z4PA 1NHUA 1ZM9A 5CHCB 1ZPVA 2VA3A 1MSWD 1YBTA 3ZSXA 2XB2D 1TR0A 4KKOB 1R0AA 4L3NA 4HI2A 2CQ3A 4A5AA 3GR1A 4ZIWA 2MJNA 4X66F 1RACB 4LIWA 1HQUA 2MKIA 3MD3A 2XEXA 4CW7B 4KH4A 3G4SS 1UJ5A 4DFKA 3OXLA 4U95A 1X31C 3D2FA 4YDDB 1UJ4A 3GPAA 3AO3A 2V52B 1HW9A 1NHKL 2B8PA 2FYXA 1S1VA 1WI6A 1IM4A 3A8YA 2HMIA 1Z4UA 4YR2A 1KFDA 1WC3A 2NRRA 4DR1K 4L75A 2ASPA 5KFXA 2HZAA 3AO4A 1U25A 2HHSA 2P1JA 4DR2J 2ZKTA 2KTQA 1SIWB 3D6RA 5DDRC 4CFDA 4DCHA 2ZJRQ 1OO0B 1XMOF 4YOYA 2PA8D 2XULA 4NI2A 1V4SA 3RW6A 4JYAF 3RBDA 1VHXA 1MWQA 5JMVA 5BN8A 2EC0A 3HHKA 2EX3A 1HBOA 5AQKA 3VAJA 3OBWA 2E5JA 2J7KA 2Z1GA 3O5BA 3IAYA 2MLZA 1XQIA 1HHSA 1LNQA 2CQPA 3CNQP 1JCEA 1CC7A 2MKYA 2QXFA 2YWGA 2QL7B 2HMPA 4BRPA 2GIQA 4KKOA 2M8HA 2MZRA 1X4FA 3UCGA 4I6MA 5CCLA 3P3DA 4YDXA 2VG7B 3LDPA 2XG8A 4KHMA 1S0VA 1HQ2A 2GAGC 1RWMB 2FD2A 1RK8A 1U2CA 2EK1A 3MM8A 3S7RA 4P73A 2XMKA 4J9QA 2YNGB 2CVEA 1MDUB 2B9XA 4ZPVR 2GCFA 4OPJA 3MEEA 3LAKA 2QWQA 3HTVA 1EQMA 1RAIB 2UP1A 2WFBA 1K8KB 1HLUA 2YY3A 1S5JA 1UEVA 1C0TB 4RUHA 3QLHA 2Y0SD 3K5OA 5M1FA 3PO5A 3UKRB 1S0MA 2DNNA 1DLOB 4LUBA 2P51A 2JZ5A 2DGQA 3BBCA 3EM1A 2MEWA 2AJ4A 5F8IA 1L3SA 5D4OA 3J81Y 3PFEA 4ED0A 2X1FA 1EP4B 3KIOA 5I9EB 2L48A 3ITHA 3PX0A 1Q4RA 2ZH8A 5CCMA 2MQMA 4USVA 4CO3A 4OX7A 3DLJA 2I1RA 3EZOA 3VQ7A 3IR7B 2CDQA 2X6NA 2IJFA 4EYHB 2ZH6A 3AB4B 3LP2A 3ULHA 1T6DA 4YB1P 3CCJS 4OYOA 3EO3A 4B1YB 2DNHA 5D15A 2BX6A 1HWLA 5AQZA 5C12A 4FO0A 1JLBB 2ZJPQ 3QQCD 2ZUAA 2Q31A 3JSBA 4RUAA 3TW0A 1GLLO 4HHUA 4ITSA 1K6YA 1OYEA 3JSYA 4ZP9A 3VALA 3THWB 3CJSA 4LBHA 4QW9A 4RW8B 2I38A 1IKWB 1Q5YA 1IG8A 2GZOA 1DQ8A 4LSZB 5BPLA 3BSNA 1VCTA 4Q44A 2NUBA 3SFUA 1FRKA 3OXGA 1VJQA 3K5LA 2KQ2A 2ZQBA 4QIEA 5IC6B 2H4WB 2VBYA 4H0OA 2Q6CA 3KWIA 4NMXA 2QWPA 1LXNA 5M2RA 3F0NA 5D8HB 4ID5B 4F4WA 1F9EB 2E5LJ 1GMWD 4C23A 3LPYA 4A8OA 2KHDA 4GC7A 3CCES 1IJEB 2HLUA 5F0XA 3VV2B 3H25A 3CCRN 3G10A 2IBOA 3M1FA 3PIPQ 1SJ1A 4PABA 2G9OA 5D4LA 3H0PA 5KGWA 3C6HA 1S9EA 2EWHA 3G6XA 2EKNA 4JI2K 5KI6A 4FLYA 2XZDB 1X7VA 2GMHA 1VQON 1ACMB 4OJ1A 1YITS 3GTYX 7FD1A 3J81O 1MROB 3VEWA 3EGVA 4CE9A 3V2UC 2NXJA 3GP9A 3GV5B 4M7YA 2ZEJA 4FWQA 3OW2R 4NXNF 2UUAJ 1BL3A 4RW6A 3KUEA 3K0JA 1TUGB 5FPDA 1RYSA 1NGDA 5DM6L 1KD1T 1NU0A 2RN2A 2E4LA 3BKFA 3UR0A 5SZTA 5HRPA 4ZHRA 2GVZA 4KHYA 2QKKA 3QIPA 1RBUA 3LL3A 2QA4N 1F60B 3KKRA 5J2MB 4BR0A 1DT9A 4HL9A 4JI5J 4U7UD 3CGIA 1YF5L 5L8RC 2ILYA 2KVQE 1U1OA 2MQQA 1WB9A 4G3IA 2O8FB 2N82B 2M9KA 4CEDA 1ZBSA 4NZ7A 4P52A 2Z8QA 1YJNN 4AD6A 4UT4A 2YX7A 3PYEA 4PG8A 2OFGX 4PWDB 2FY8A 3EDRB 4DJBA 3BQ1A 3SMZA 3GDQA 2HHWA 1BCOA 4ZVRB 4M95A 2HRTA 2GNKA 1BCMA 1UP1A 4RW4A 2PFFB 2VPXB 1LFPA 3CJQA 4A62A 3HPOA 4FL9A 3HO1A 1N5YB 3MR6A 4C8ZA 1WC1A 3AD9C 2LFVA 2MDAA 1IKYB 4EU0A 2VODA 1JLEA 2FZCB 3K8VA 1QQNA 2CQ1A 1OVYA 4H5VA 1RT4A 1S72N 1N6QA 2WONB 3W64A 3CERA 2YKNB 2HBQB 4TLQA 4WJBA 2QV6A 3MD1A 3ULEA 4PAAA 2UV8A 4C4WA 5AE1A 4CF1A 4G9ZA 2I5JA 5L38A 4LF4K 1H2TZ 3OTOF 2NXUA 5AQHA 4EIAA 3CCSS 5J2MA 5FLXU 2P9KA 3KXDA 3D6TB 5L9XA 2A6AA 3RAXA 2OPSB 2VGMA 4V1Ak 4A8QA 4LF7J 3E1YA 2G4BA 4BG8A 2YWWA 2LU2A 1IBMF 4MK9A 4I6YA 1X4DA 3KHRA 1J54A 3I96A 1UA1A 4GKJF 3HPGA 3TZYA 1FK9A 4AILC 4IEEA 5M1KA 2RSQA 4HEA9 2D3ZA 2P6SA 4DTUA 4LIRA 2JWNA 4DR5K 3MM5B 4WU2A 1UA0A 4FWOA 5FDLB 1IQZA 4K4ZA 4JP8A 3CCTA 2ZM6F 1RWXB 2RDIA 1P8ZA 4UZBA 1IBKK 1S6OA 3AVMA 3WUHA 4OPKA 1J27A 5DQIA 3M30A 2OPPA 1LWXA 2HHUA 2R2SA 4USMA 3QFPA 5ETTA 2ROEA 2MQNA 1GMVA 3VEOA 2JHEA 3I9ZA 3MEGB 2E2OA 1A6LA 1HBMB 4MLEA 1UZHA 1BDGA 3VQ9A 3M8WA 2NZTA 1VFJA 4F8RA 2B4PA 3IM9A 1H74A 1RABB 2Y3YA 1VC5A 1RADB 3KJQB 5C2GA 2BANB 3VVTA 3C3LA 4JI3J 5KFUA 1T44A 3TJ8A 2G8IA 4AT1B 3H8YA 2KFYA 2LKZA 3OYMA 1FX4A 2J9DE 4WQ5C 3PRBA 3M9NB 3SXLA 4BR5A 4CYUB 5DZ6A 4DB3A 4H5RA 4DQPA 3S8SA 4X65K 2PMWA 4ZCIA 3G0ZA 4FS2A 4DV5F 4Y0FA 4HHHA 1VQNN 3SSSA 1LEOA 4B08A 4BDZA 2QTDA 3JXOA 5C42B 3TWHA 3P5BP 3OYNA 2DT9A 3QB0A 4Q45A 2ALYB 4X62F 1Y4ZB 5C15A 1JCGA 3FNNA 4CEAA 3LPEA 3PYDA 3J80Y 3RMAA 1A5XA 4AFFA 1HMVA 3JYTB 4LRFA 3Q8VA 4DZDA 3OYHA 2FLOA 2UUBJ 4H5TA 2CQBA 4UY85 4DV4K 2HHPA 3JS9A 4FZYA 5T41A 2R2TA 3SV3A 1FWLA 4FJGA 2OZSA 5DZ7A 3BSCA 4ED6A 3D0IE 4YMEA 1CEZA 1KQSM 4RL1A 4TYBA 1OY6A 2K1RB 3TSQA 1EARA 3DOKB 3FJ2A 3AVLA 3TEHB 2HQCA 1XK8A 2W9BB 6FDRA 2CPFA 5HQ8A 4I9QA 2OPQB 4A46A 3MWPA 1S99A 3CVKA 4OLOA 4CECA 1NMEB 3VQEA 3OYAA 4QIVA 3OLAA 3NS6A 2HFOA 5H1SV 4CFAA 1X9JA 2V6AA 3FGVA 5M1NA 2O66A 4KGKA 3UCUP 4DOZA 3BGUA 3T5JA 3KKSA 1UKUA 4ZN1A 1GT8A 4F0HA 1WTFA 4JI7J 1SC4B 1QD1A 1N0VC 4DV7J 1IVZA 2JVOA 1GAOA 3O1LA 1VIXA 3P5TL 4CH1A 4U67Q 4CJ4A 4M5HA 3CO9A 3RSEB 4CH0S 2H9ZA 3FSIA 2R8HA 5LMNF 3HSDA 4BC2A 4FVMA 4CBXA 3DOMB 2E6MA 3FRZA 2VFUA 1S6QA 3K2PA 3PO4A 4WZQA 4OZ3A 4KHRA 3W5XA 1DKGD 3WNEA 5FLXY 3AA9A 1QJHA 3NMUA 1E6YB 3PYGA 2A1SA 3BYRA 4DV3J 3KLFA 3L4QA 1RWWB 4XK8C 3OYFA 4DR2F 3FSYA 2DIVA 1YQHA 3A8JA 1FJ7A 1VLOA 1HI1A 3J80O 3VQSA 3LQVA 4NE9C 2YWFA 3GB0A 3ID8A 4M45A 3L4BC 3J7A1 2MY7A 2RRBA 3VOVA 4IG3A 4WXWA 2F8TA 2OPQA 4JI6K 3R27A 3AA5X 2ZDOA 5EY4A 1MU2A 4RWXA 1ZM4A 3QGHA 4R0EA 3CQ8A 2RF2B 2BZ2A 2WAQD 1R59O 3BUZB 4IRCA 2E1MC 3CMQA 2RH3A 3R1LA 5CYQB 3CG7A 4MT1A 3PFOA 4CO0A 1MWMA 5ETVA 3OSNA 3KJFB 1XBWA 3IR5B 2D9PA 1JLAB 3A5NC 4M5GA 1IO2A 2MQLA 3CDUA 2FSNA 1RQ0A 2V2ZA 1URRA 2Z30B 2WVBA 4E89A 4A8SA 3C6UA 1HBNA 3DWLA 4FLTA 3H98A 1Q8LA 4B9NA 1T6CA 4M3RA 1Q86T 1GH8A 3QRPA 4NCGA 4Z4GA 3WHIA 1BQNA 3LDLA 2AKWB 4Z37A 1OS5A 2XO6A 2KFNA 2YQ0A 1RDRA 4CHNA 2HWIA 5IV4A 1KVIA 3HM8A 2R42A 3HMJG 2UXDJ 3ZNUA 1QTNB 5HROA 1GLJO 1K0TA 2WHOA 1YTAA 2MHEA 1L3VA 5D0RA 3OFGA 3NHGA 3HXMA 2ZH4A 3NOCA 3BO3A 1QAJA 3FCVA 3IRWP 2HQDA 2WVFA 4DR6K 1BHLA 3VGLA 2UVWA 4FW1A 2VFSA 4QQBA 4CJSA 2A0FB 3BJYA 1Z6RA 5GAGI 1D9AA 2V8VA 2F3JA 1R7IA 4DFMA 3S3MA 1AZSB 1NH8A 2QSWA 3Q22A 2ETJA 4OMFG 3NGKA 3LWLA 4NEZA 3C65A 3CI5A 3MN6A 4IBNA 2LDIA 2DHHA 2HS0A 5CHIA 4WP8A 4DR3F 1KR4A 5LY3A 3L09A 1ZH5A 3H2VE 4WFZA 4Y3CA 1IQTA 3O4NA 2DNRA 1EX4A 3BGFA 4B1VA 4N47A 2VQFF 3ZX0A 2D3OR 5A6PA 3Q2TC 4OZNA 4AL7A 5JVHL 1Z05A 2NS1B 2PE8A 3VQPA 4UUXA 1WLJA 1I94K 3W2WB 4DPOA 4FBUA 4KPCA 4CF2A 1EWRA 2DNQA 4QPXA 1FJCA 2ITGA 4ECSA 3MCMA 1DTTA 1Y97A 3BQ2A 2R2UA 4EZ6A 2VKRA 3FE1A 1XNRJ 2EPIA 4K4VA 4DTXA 1U48A 4G1PA 3LW5C 2E5LF 1UVIA 2JC0A 2YKQA 3C7NB 3Q86A 5I4MA 2AW0A 2Y1IA 5HK4A 4USIA 4KR0B 4JS4A 4YB6A 2AYEA 2O67A 3NCRA 1A5VA 1TL3B 1D1UA 1NEEA 1BOTO 1WC5A 5F8NA 4B3TJ 1J5EK 4K7QA 1VSMA 1WBBA 4K42A 4FCYA 3IO1A 4CQ1A 3QINA 2VV5A 2G8FA 4DBQA 3NNHA 2A1BA 1REGX 4RLEA 1IJJA 4FNHA 2LQBA 3EKUA 4A4JA 2CPIA 4ECWA 2PYJA 3DU5A 2FJAB 2UUAF 2BQ3A 3AVJA 3DI6B 2Z2ZA 1BA0A 3U3YA 1RAHB 3QZ8A 5AQWA 4P10A 2HS3A 4LRCA 2B4UA 4FF1A 2H48B 4JI4K 3FMWA 1VLYA 1U1KA 1FKAF 1RAAB 3K5MA 4N77A 2Z2LA 3SI6A 3R5DA 3CXCR 4DV2K 5F8MA 5GADP 5HI7A 2GA7A 3CJ1A 2H51B 3O6QA 4OKKA 4K0KJ 2DGOA 4ZVFA 3ASMA 4X4TA 3H40A 3NAHA 4LFBK 3ZT1A 1CQMA 1HWJA 5HL7L 1NM2A 3PRDA 3M2RB 4ZVSB 2QYCA 4CZCA 4IKFA 1N36K 1R43A 2Z58B 4FVUA 2MHNA 3K7RA 3PNIA 2RRNA 4K5RA 1N5TA 5AZJA 2BA9A 2JX2A 2MKJA 4IRKA 3NVMA 3C14A 3UIQA 1BD6A 1JJCB 1N4LA 3V5RA 4NA3A 3CFPA 4DUYF 1N52B 6FD1A 3N4QA 1OY9A 4M3XA 1CQNA 4J9UE 4IFYA 3G82A 4KHPJ 4O4GB 2KHCA 3M6UA 3B6BA 3VZHA 4A8MP 1VIOA 3OYKA 3E01B 4W4MA 5LM7E 4UQTA 4AL6A 1EIYB 1HL6A 3CE8A 1HKBA 5HP1B 2EFNA 4URSA 1O6XA 1Q86O 2ZKUA 1Y7PA 3T7ZA 1W2BM 2XY7A 1P1TA 3TI0A 2RVJA 4WK1A 5D0GA 1XIQA 4JEPA 2ZE2B 5AXKA 2QSFA 3JQJA 3ZSYA 1Y0HA 1WG4A 1T9TA 2EXUA 3O3LA 4LRAA 4CEEA 2WVCA 2ZBRA 2F9DA 1K0VA 3VGMA 3BH6B 4NLPA 1NGAA 1SJFA 5KPTA 1UL3A 1NBEB 2P9EA 4XAKA 4HH0A 4IOAL 3A4TA 1HNVB 3D1HA 1EWQA 4OX9K 1R8PA 3CETA 1RT6B 2NPIA 4LF8K 4ECUA 5H9EJ 2OO4A 3G2XA 3MAHA 3DLKB 4MYTA 2X51A 3SUOA 3AAPA 2RKIA 4CZMA 4A8KA 3VERA 4G1IA 3BV8A 4R0JA 4OYPA 1TTHB 2M3DA 3GG0A 1U1MA 1NO8A 2JSXA 3KLEB 2BGGA 4A8XA 1Q8BA 5A8RA 1VBZA 2AZ1A 2OSRA 4Y34A 3E01A 3SBTA 3HL8A 4AH9A 1DBDA 1U6ZA 4I1TA 3FFIB 3WBZA 4BLGA 1HBUB 4PR6A 4RR5A 4Y6IA 5FPMA 2E9ZA 2L9NA 3W65A 3LGHA 1FJGK 2P9PA 1Y5IB 3RU0A 4HYKA 1UCNA 5FIIA 2C22A 3POTB 2YHYA 3BH7B 1PCAA 2LLZA 2XSJA 3DHXA 4R5PA 2AJFE 3MCSA 1YG0A 3QAUA 1Y5LB 2Z56B 1RT2B 3NG8A 4CJFA 1H73A 3M4XA 1TGOA 4MK7A 2EBGA 5C7PA 2G0CA 1AUSL 1C1BA 3NP5A 1VQKN 1VQ7S 2HHXA 2IMOA 3W63A 3TZXA 2F63A 2MXYA 4PA1A 2ZDPA 3KLVA 1UZDA 4WBFA 4N8NA 2B7CB 3L7OA 3M2UB 4KGXB 2ZZNA 3VAFA 1MWKA 3OYBA 1U1PA 3U1MA 4J2EA 4OGCA 1IXKA 1TQLA 3RMCA 3MM7B 3D3CJ 3BDEA 1C0FA 2CPJA 5CZVA 5HAOA 3I0RA 1RTDB 3BGRA 4PUOB 5C0YA 4ZLNA 2C2EA 4IDKB 3E51A 3KLEA 2FVCA 3I0SA 1IG9A 1G7CB 3FCHA 2LCWA 3HOTA 2UUCK 1KVAA 3JTOA 1NAQA 5D0HA 2VFVA 4LFCF 3DRRA 4CEBA 4KO0B 3NF7A 2CG4A 4CJ3A 3CCZA 3PV8A 4PG6A 3GFYA 2W40A 4TY9A 4K43A 1W7AA 1ZBTA 4JV5K 2M0GB 1U2VA 1PBUA 4F3TA 4OHWA 1Q53A 3POTA 4B3RJ 3DLGA 3DLEA 4KBIA 4P75A 2B6AA 4MH8A 4JI0J 3H20A 3UDVA 2R3VA 4AM6A 2J6SA 4Z4CA 1EQ0A 3AO1A 4EWTA 3OYEA 1RT2A 1X3MA 1KOHA 5D6GA 2FUG9 1Q8IA 1WF1A 1IH7A 5M2UA 4ZKAA 4Q2LA 3FZLA 1T0TV 3AY0A 4CF8A 2JLFA 3BZCA 4OHYA 4F7VA