3WNFA

Cyclic hexapeptide ckidnc in complex with hiv-1 integrase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
133
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
total genus 46
structure length 133
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnfA00
3NF8A 1UOCA 1RNHA 1TKZA 1C0UA 3QIPA 5K14A 1TL3A 5J2QA 3U6FA 3S3MA 5J2MA 4Z4IA 5CYMA 4DTJA 1CZBA 1RDAA 4JS4A 4O55A 2XY5A 1NK6A 3KD1E 1HMVA 3G0ZA 4DFKA 3DM2A 3SPYA 1TVRA 4DFJA 4CJEA 2O4IA 1WN7A 3HP9A 1NKBA 1T03A 2F8TA 2HW3A 1VRUA 1WSIA 3MXJA 2Z1IA 3ZSOA 1RT1A 5KGXA 3LWMA 3C95A 2X74A 5J2NA 1Q8IA 3ALYA 3H08A 4N47A 4CEBA 1HPZA 3D45A 1U49A 3SUQA 2G8HA 2HHWA 4CGJA 4CJUA 3NGIA 4JS5A 3SQ4A 2OPRA 3WNHA 2IAJA 4FJLA 3NDKA 3NH0A 2ITGA 1DTTA 1S1XA 1S5JA 3KLGA 1R0AA 3P1GA 4CK1A 4J2BA 2YHBA 4CK2A 1TKXA 4KKOA 4M3RA 3VQ5A 3LWLA 1VSJA 3FFIA 3JSMA 4OKJA 3C94A 2YNHA 1RBTA 3LP2A 3VQEA 2BDPA 4C8LA 1JLAA 3U3GA 4M41A 5JS1A 3ASMA 3DLGA 3PUFA 2G8IA 4LH5A 2A1RA 1YVUA 4OPKA 3OYIA 3IAYA 4DSFA 2RKIA 3DYAA 4CHYA 4BDZA 1U47A 2QKBA 4DS5A 4C8NA 4KI6A 3OYEA 1U45A 2HHTA 3BGRA 3AVJA 1ZBUA 3AVFA 3VA0A 1SKRA 3C6TA 3DI6A 1F21A 1RDBA 4F8RA 4BE2A 4EP5A 5HRNA 3KLHA 4CERA 1D9DA 3MEEA 1S1TA 1WAFA 3V1OA 1TAUA 1IKXA 3IG1A 4FJNA 1NOZA 5C24A 5J1EA 4BDPA 2XY6A 4FJHA 1RT4A 4DU3A 3M8PA 4IG0A 1C6VA 2OZMA 4CEQA 3KLEA 2E4LA 4FJGA 3V1RA 2IC3A 1C0MA 2PY5A 1UAXA 4CJQA 1TL1A 4CF9A 1EX4A 1CXQA 3OYKA 3VA3A 4E19A 1ASUA 5KTQA 1I39A 2YV0X 1KFSA 1T8EA 2HHVA 4FVMA 5DMRA 3SUNA 3AVGA 1UWBA 2EHGA 4KHSA 1RT6A 2D0AA 2FBXA 4DTMA 4E89A 3K5LA 1Q9YA 1BGXT 4KFBA 4GVMA 3VQ9A 3V4IA 3SQ0A 3LPUA 4FXDA 3TANA 2HNZA 4ELUA 2BE2A 3UIQA 1BI4B 1IKYA 2HB5A 1XC9A 4B9MA 3HPOA 3ZSZA 1EKEA 4TSXA 1JLBA 4FJ9A 5FROA 5KGWA 3QEPA 1T7PA 3HVTA 2ATQA 4CFAA 2F8SA 4CEZA 3E01A 4IDKA 3NAEA 3TABA 4RG8A 2IDOA 3PO4A 3HXMA 1BIZA 1C0TA 1S1UA 3G10A 1VK0A 4CGDA 3O3GA 2KQ2A 4CEDA 3QEWA 4M42A 3PX6A 3LANA 3C6UA 3MEDA 1TGOA 2KZMA 2HHSA 4DLGA 2XY8A 1RTIA 1KFDA 1WNSA 3CM6A 3K59A 3OYMA 1X9MA 4DQPA 3V9WA 5E41A 4I9QA 4KPYA 3DLEA 3OYJA 4FLUA 4AHSA 4M3YA 4CJLA 1KVCA 1KLNA 4CJ3A 3O4QA 4ZHRA 4OLBA 3OJUA 3NCIA 3OYDA 4DLEA 3V6DA 5KI6A 4HCCA 1RBSA 1FK9A 1BQNA 1LAVA 3MXMA 4RW8A 1HJRA 3M8RA 2QK9A 3CQ8A 4FJXA 4E1MA 2G8KA 1HRHA 4K8ZA 4DTPA 1U48A 3PY8A 4KAZA 3K5OA 4FK4A 4WE1A 3LZIA 3ZT0A 3V9XA 4M3WA 3TI0A 3TAGA 3KK1A 4F3TA 4QAGA 3HP6A 4AHRA 4B8CA 2I5JA 1NJZA 3PO5A 3HJFA 4FJ5A 3KKSA 1NJWA 1J54A 1O1WA 3RMAA 4GMJB 3VQ8A 2G8UA 1LWFA 4B9NA 4W5NA 2DTUA 1VSEA 4J2EA 4CFBA 4E7IA 1HQUA 3I8DA 2DFHA 4DS4A 4CEEA 3ZT2A 1JXEA 4LD0A 1BCMA 3K58A 2YKNA 3F73A 4CF0A 4DQRA 4DSJA 4Z4FA 1KRPA 1ASVA 3SPZA 3SYZA 2OYQA 2VWJA 3AO3A 4DFPA 1LAWA 3WNEA 4FLTA 4ELTA 3KJVA 2E6MA 1JKHA 1G15A 4DF8A 4CGGA 3OYNA 4O5BA 1JLGA 1WSJA 4N56A 2HHQA 2ETJA 4CE9A 4NYNA 3L8BA 3RTVA 3V81A 3ZT3A 4FK0A 3M8SA 3CG7A 3NFAA 4Z4CA 3WNFA 3VQDA 1RCHA 4F2RA 5T7BA 1C1CA 1A5WA 1RT7A 1RBRA 3VQ6A 3HPHA 2VG6A 3AA5X 1YT3A 3CYMA 4FZXC 4RW6A 3V9ZA 1ZBLA 4JRQA 5KRSA 4H4OA 1TAQA 4CHZA 1A5VA 3L2QA 4FM0A 4HCBA 1IKWA 2D5RA 1REVA 4DTNA 1TK5A 4CEFA 2OA8A 1RDDA 4RW4A 4C8MA 3CFRA 2HNYA 1NKCA 3V9SA 3NF9A 3P83D 3SI6A 4XIUA 1Y97A 1NJXA 2P5GA 4DSIA 3OYLA 1VRTA 2F96A 3L2RA 4K8XA 3MXIA 1EXQA 1KCFA 3OYGA 4ICLA 1B9DA 3MAQA 3B6PA 1JXBA 3AVAA 3DMJA 1QHTA 3CFOA 1ZBIA 4CFDA 1TKTA 3O4NA 3S9HA 2DY4A 3VQPA 2W42A 4KREA 2JGUA 1VSDA 4H8KA 1QE1A 4OKEA 3VQ7A 3DRRA 2WONA 4CJPA 2Y1IA 3SJJA 4HUEA 4OGCA 3QEVA 1C1AA 3AO5A 1VSHA 1IO2A 2BGGA 4B9UA 1QSSA 2YNFA 1B9FA 3LDSA 2P5OA 3OYFA 1SV5A 3AVBA 1VSFA 2JLEA 3QIOA 4MFBA 5CYQA 4M3TA 5J2PA 3OS1A 1JL2A 4IKFA 1ZBHA 4CIFA 4N76A 1HNVA 4IFVA 1BHLA 4O0IA 1J53A 4CEOA 4HUFA 3SUPA 1LWCA 3LPTA 1NK9A 3ZSRA 3AVHA 3RMBA 3AO4A 1QSYA 2G8VA 4CJRA 4FW1A 3DOLA 3MEGA 3KLFA 1FXXA 4KTQA 1RILA 3OYCA 3EYZA 5HP1A 1S1WA 3A2FA 2YNGA 2OPPA 2ZE2A 4N5SA 4E7HA 4Q5VA 4DQQA 4AILC 3TAQA 2RPIA 1QS4A 3HSTB 5HLFA 2G8FA 4B9TA 2KTQA 2AJQA 4R5PA 1VSMA 4Z4HA 4FJMA 3HL8A 4FLVA 4BWMA 1XHZA 4Z0UA 3ZSXA 5CY4A 4CJ4A 3VQBA 3QNOA 2X6NA 4AHTA 2YHAA 4C8KA 1KSPA 4FYDA 3TAMA 4YNQA 3K5NA 4HTUA 4CJWA 3DLBA 1TKDA 4CEAA 3OYHA 5FRMA 1D9FA 4KHNA 4FJ8A 3NHGA 1NK5A 2RF2A 5KRTA 4DTSA 1VSIA 4FZYA 5D3GA 4CJSA 5C25A 4F2SA 1GOBA 3OS2A 1HYZA 4CGHA 4M45A 5HROA 1WAJA 2RN2A 3RRHA 1X9WA 2GUIA 1KTQA 2HVHA 3K5MA 2XY7A 4F4KA 4Z4GA 4KV8A 4FLYA 2EX3A 4KI4A 4CGFA 3QINA 1SKSA 4QCLA 3LP1A 2GV9A 4E0DA 4W5QA 1NJYA 1WSFA 4E7LA 4KHWA 2YNIA 4FK2A 1NK7A 3KK2A 1J9AA 2HHXA 1X1PA 4DSKA 4DSEA 4L8RB 3IRXA 3ZCMA 3S3NA 1DTQA 3S3OA 1XI1A 1T05A 1JLEA 3NBPA 3OYBA 3QEXA 2R7YA 4RW7A 3ZSWA 3O3FA 1RBVA 4I7FA 2IOCA 4FLXA 1SL1A 4Y1DA 4B9SA 4CIGA 3KTQA 3ZT1A 2HNDA 2KFNA 3RR7A 3LAKA 2HVIA 5I42A 3HM9A 3DLRA 1KVBA 1S9EA 4DSLA 1N5YA 5CZ2A 2Q3SA 1W9HA 2FBYA 2NUBA 1LWEA 3NE6A 2PYLA 2IS3A 5FDLA 4LSNA 3LAMA 4CESA 2GBZA 1L5UA 1BL3A 2XRIA 5HBMA 1RTJA 3SQ2A 3LALA 2B4JA 3KKRA 1LV5A 4OPJA 3EZ5A 1L3UA 3AVNA 3L2WA 5HRPA 1XHXA 4IBNA 4B9LA 3VQ4A 4HVJA 3DRPA 2ZD1A 4FW2A 4DTRA 3HYFA 3RMDA 3AO1A 2X78A 3QESA 4PUOA 1I3AA 2P51A 4M3XA 4J2DA 4FJIA 1HNIA 1A5XA 4F3OA 3SV3A 3QNNA 4PY5A 3PX4A 4J2AA 3ZSVA 2KZZA 3TWHA 3MECA 4NCBA 1UA1A 2QXFA 1IH7A 1W0HA 3KIOA 3SZ2A 1RTDA 2B5JA 3LZJA 4O4GA 3HPGA 4IFYA 4CJKA 3OS0A 4FM1A 3OYAA 1NKEA 1N6QA 4PA1A 3DRSA 1KLMA 4IG3A 3O3HA 1RTHA 4C8OA 4LSLA 4RW9A 3V9UA 1WSEA 1SKWA 4M3UA 4EZ6A 4E7JA 4YFUA 4KB0A 1Z25A 2A1SA 2HHUA 4W5OA 1GOCA 1D8YA 3NF7A 1JLCA 1JLFA 1S6QA 3TAFA 3QLHA 1Z26A 3VN5A 3TAEA 4FJJA 1K6YA 1RT3A 4E3SA 1UA0A 4KRFA 2Z1JA 4FJ7A 3WNGA 4B8AB 4CIEA 1NK0A 4DF4A 4AH9A 4CJTA 4ZTJA 3ZSYA 4FZZA 2Y1JA 2ZQBA 3SCXA 1KVAA 1L3VA 4OLAA 5JS2A 4DQSA 4G1QA 2X6SA 4B3OA 3K2PA 3EY1A 4OKKA 4GW6A 3OVNA 3DLKA 3ZSQA 4DU4A 3QETA 2P1JA 4KHYA 1C1BA 5HRSA 3AVKA 3ITHA 3AVCA 3NH1A 3PX0A 4DTXA 5CZ1A 2VG7A 4B08A 3K57A 4E1NA 3CFPA 3TARA 3RWUA 1JL1A 3NGYA 3HVRA 4CF8A 3ZT4A 1B92A 2Z1GA 1ZYQA 3D0PA 1L3TA 1TK0A 4ID5A 3AA2A 3DOKA 2QKKA 3CM5A 4DTOA 3NH2A 4AHVA 1X9SA 2XHBA 1FKOA 1BCOA 1CLQA 4CFCA 5FRNA 1QTMA 5EU7A 2XO7A 2VWKA 2B6AA 3T19A 3ISNC 1VSKA 3HT3A 2DFEA 4KO0A 4CF2A 3SUOA 2FBTA 3IS9A 3VQCA 4FJKA 3AA4A 1Q9XA 4M3ZA 1CZ9A 4ID1A 4CGIA 4DWIA 4I2QA 1FKPA 3SNNA 4CJ5A 1D5AA 4NCGA 4KTZA 1TK8A 1ASWA 3OY9A 4CJFA 3KLIA 4Z4EA 2KFZA 4KHQA 1S9GA 4O44A 4Y1CA 1MU2A 3RRGA 1JLQA 1SUQA 1YTAA 3P5JA 4H4MA 1VSLA 2D0CA 1EP4A 2Z1HA 4CF1A 4CHQA 3ULDA 1S1VA 4KTWA 4QOZB 5SWMA 1U4BA 3RR8A 3JYTA 4BWJA 3VQAA 4AHUA 3PV8A 4B9VA 4PWDA 3L3UA 4DG1A 4CECA 1WLJA 3QERA 3I0SA 3TR8A 4DMNA 2PYJA 1NOYA 1IG9A 2WOMA 2BANA 1LW0A 2FC0A 3AV9A 1HYSA 3DLHA 4DQIA 4OVLA 4W5RA 4CCHA 3HK2A 1HQEA 4BE0A 3B6OA 1LW2A 4EP4A 3M8QA 5DK5A 3OJSA 1U04A 4CJVA 5I3UA 3RMCA 4DTUA 3AA3A 3LP3A 5C42A 4LH4A 3V1QA 4FLZA 1SL0A 1L3SA 2IGIA 3QO9A 4ZTFA 1NK4A 1YTUA 4NYFA 4O0JA 2E6LA 4UQGA 1HYVA 3L2VA 4PQUA 4Q0BA 4KHUA 3AVLA 1NK8A 1QSLA 3LP0A 4EZ9A 4OGEA 1BQMA 2OPQA 3I0RA 4OJRA 2D0BA 4CHNA 1ZBFA 4FM2A 1RDCA 3QEIA 1TV6A 4HUGA 3KD5E 3T1AA 4NCAA 4CHPA 2O4GA 3SQ1A 2DFFA 3NF6A 1RBUA 4BDYA 1J5OA 2G8WA 1WSHA 3AVMA 1CXUA 2YKMA 1EETA 3KK3A 3U3YA 1RT5A 3AVIA 5HRRA 3T3FA 3HO1A 4BE1A 4DFMA 4KB1A 4BACA 3BDPA 1DLOA 3L2UA 4E7KA 3SV4A 3NGZA 4N41A 1BI4A 4I2PA 4CK3A 1BIUA 2PZSA 1ITGA 5SZTA 3THVA 1S6PA 1BISA 2OPSA 4LY7A 4ELVA 3L3VA 3F9KA 4FLWA 4I9LA 4W5TA 2OZSA 2KW4A 4AHCA 4JRPA 4MQ3A 4HHTA 3TAPA 2FBVA 1QQCA 2LSNA 4CHOA 4JLHA 3AO2A 4DU1A 2VG5A 1IKVA 4FCYA 1XWLA 1RT2A 1SL2A 1WSGA 3VQQA 2HMIA 1GOAA
chains in the Genus database with same CATH superfamily
1E3MA 5J2QA 3S3MA 1BDGA 5J2MA 4DV7K 4JKGB 4O55A 1NK6A 3G0ZA 1VQKN 1X3NA 1NKBA 4GV6A 2F9TA 2HW3A 1VRUA 3MXJA 1IG8A 5KGXA 5J2NA 5EOYA 3C95A 2X74A 3IFRA 2WTUA 3ALYA 1S72N 3T1YK 4CZIA 2RE2A 3DWLA 2HHWA 3P39A 3KLGA 1R0AA 3P1GA 4CK2A 4R79A 1TKXA 3M3ZA 4KKOA 4M3RA 1VAZA 3A5NC 1VSJA 3LM9A 4OKJA 1TYQA 2BDPA 5JS1A 3ZETA 3U3GA 4M41A 4GKJK 4PL8A 1YVUA 3OYIA 2FF3B 2RKIA 3DYAA 4CHYA 1DEJA 1U47A 4ILHA 2QKBA 4WQ5C 2QI2A 3OYEA 3BGRA 3AVFA 3VA0A 1BUPA 1XQSC 5TKYA 1Z6RA 4EP5A 5HRNA 3I8BA 3KLHA 1D9DA 3MEEA 1S1TA 3V1OA 5EX5A 4ISGA 4FJNA 1NOZA 2XY6A 1KXPA 1RT4A 1C6VA 2OZMA 5AQTA 3OA9A 2IC3A 5AZIB 1UAXA 1TL1A 1EWQA 3VA3A 5LL6Z 1I39A 2ASMA 4FVMA 5GIPA 1EQYA 1VQ9N 4BR9A 2CH5A 1RDWX 2FBXA 5AQFA 1BGXT 4B1VA 5JICA 3LPUA 2W41A 2HNZA 3ZSZA 4TSXA 1JLBA 3SMPA 5FROA 5KGWA 3QEPA 2F8SA 4CZJA 3HXMA 1S1UA 4H0PA 5C15A 5I9EB 3PX6A 3MEDA 4YDUC 1RTIA 2VGNA 1N33K 3V9WA 4F9OA 3OYJA 4AHSA 4OLBA 5GAEP 3OYDA 1LAVA 2QK9A 2G8KA 3F9MA 4DTPA 1U48A 4KAZA 3LZIA 4FOEA 4M3WA 3TI0A 3TAGA 4B3MK 1NJZA 3KKSA 3RMAA 3VQ8A 4YHHK 2G8UA 3CJBA 2Q2RA 1NGIA 1VSEA 1NGDA 2QWMA 4CFBA 4DS4A 1T05A 4LD0A 2YKNA 4GY2B 1KRPA 4H0TB 3AO3A 1BA1A 3KZBA 1QVGM 4DF8A 2VCPA 3RVCA 4N56A 2HHQA 3RTVA 4BC2A 2E2NA 3I56N 1U6ZA 2GELA 4Z4CA 4BR2A 4F2RA 3VQDA 3HBTA 1A5WA 3AAQA 5M1FA 3CYMA 4FZXC 4RW6A 3V9ZA 4H0YB 4HTLA 1IKWA 3ZX3A 1HNWK 2O8FB 4C8MA 2HNYA 3TSUA 2P5GA 3PSFA 2CH6A 4K8XA 5M1NA 3DMJA 1QHTA 3THYB 1HNXK 3EEQA 3DRRA 2YJFA 4BRDA 3BUZB 3SJJA 5AQPA 3AO5A 3CETA 1VSHA 1IO2A 1MWMA 5AQLA 4B9UA 4CBWA 2P9LA 4YOYA 2AA4A 1NBWA 1B9FA 4WQ4A 3MMVA 2GWJA 2QWNA 4DR6K 5J2PA 4JYAK 1JL2A 1JCFA 4JI1K 2O8DA 1SZ2A 2GUPA 4CIFA 1HNVA 5HOOA 1RGIA 4IFVA 1J53A 3SUPA 4HUFA 3VGLA 3LPTA 2O8BA 3VENA 3K9JA 4JHDB 5CHIA 5AFUH 2G8VA 5AQKA 4IOAL 1FXXA 4BREA 4KTQA 3EYZA 3LDQA 4E7HA 2YNGA 3TAQA 4FZYA 4FJIA 2QKKA 4Q5VA 2OTJN 4AILC 2G8FA 2AJQA 1N36K 4Z4HA 3HL8A 3ZSXA 5DM6L 4GVEA 4J8FA 2FLOA 3QNOA 1Q86O 4FYDA 1TUYA 2QEXN 1JJ2M 1TKDA 3CJCA 4CD3A 3OYHA 4FJ8A 3O9RA 4IXCA 4CJSA 3QFUA 4BRFA 1GOBA 3WEEA 4K42A 1SKSA 1HJOA 4LF5K 1V4TA 2GV9A 2VQFK 5GADP 1NJYA 4KHWA 3D7EO 3VESA 1XUPO 1J9AA 4DSKA 1QHAA 4DSEA 4RWTA 3S3OA 1XI1A 2QTDA 3OYBA 5BN9A 3J8AA 1QZ5A 4I7FA 4B9SA 3ZT1A 3QB0A 2NRWA 1S9EA 3PIPL 2QWPA 4BR0A 3KWIA 4DUYK 3G6EN 1L5UA 1QVFM 3LDPA 5HBMA 3LALA 1LV5A 3KKRA 2E2OA 3LDNA 3L2WA 1XHXA 1H1VA 1XNQK 4B9LA 1Q81O 3SK3A 3HM8A 2PAVA 3HYFA 4BG9A 2X78A 3QESA 2A6AA 1I3AA 4FWMA 4J2AA 2P9SA 3ZSVA 3E9LA 3TWHA 5EVZA 4PKIA 4LF9K 1W0HA 5ADXA 1IBKK 4IFYA 3BY5A 4FM1A 4WQ5A 4PA1A 3CCUN 1E4GT 4IG3A 1RTHA 4LSLA 1SKWA 3A5LC 4DQ8A 4JI5K 4W5OA 1C0FA 3MX2A 3NF7A 1JLFA 3VN5A 1Z26A 4FJJA 1BOTO 5M1PA 3THXA 1VQNN 3CCVN 3CJ9A 3CJ1A 3M5RA 3DXMB 2X6SA 3EO3A 4OKKA 3OVNA 2P1JA 4BQLA 4QS7A 3RWUA 3NGYA 3UKRB 3D0PA 1L3TA 2NLXA 2D0OA 4DUZK 4YOTA 3O9UA 3CM5A 3NH2A 2BTFA 4AHVA 4JNEA 3UE5A 1NLVA 1FKOA 1NM1A 3L6QA 3ISNC 3MN5A 1CZ9A 4DWIA 1FKPA 1KAZA 4H5NA 4XH1A 4KHQA 1SUQA 1K8KB 2Z1HA 4JI4K 3HZ6A 3VEVA 4DG1A 2HSTA 3IKMA 1HKCA 3QERA 4DMNA 2Q0RA 5FPEA 3AV9A 1HYSA 4DQIA 4BQZA 3HK2A 3O9SA 3H1VX 4FWSA 4JK8A 5DK5A 1P90A 3ENHA 3RMCA 5AQOA 5C42A 4FLZA 1L3SA 1NK4A 3VTHA 4NYFA 2GX9A 3B8AX 4IZ9A 4EZ9A 4OGEA 3I0RA 3CERA 2D0BA 1MA9B 4HUGA 2E1ZA 3FZKA 2QWOA 5AQZA 3SQ1A 5BR9A 3NF6A 5GAGP 2G8WA 4JAXA 3AVMA 3KVGA 1EETA 1RT5A 2BUPA 4DFMA 2E2PA 4JKHA 3H1QA 4KH4A 2P9KB 1MWKA 2QWQA 3NGZA 3O4WA 4I2PA 4CK3A 1BIUA 2PZSA 3SBGA 4LY7A 4ELVA 4H5VA 3A5OC 2OZSA 1NJIO 3BZKA 3QFPA 4HHTA 1QQCA 2LSNA 3SMSA 3AO2A 4DU1A 5AQJA 5C2FA 2OTLN 1WSGA 3U6FA 3QIPA 1YHQN 1TKZA 5K14A 4Z4IA 4DTJA 5AQXA 5JVHL 3AGRA 1HMVA 4IJAA 1IBMK 5B8HA 1TVRA 2O4IA 4CJEA 3UKUB 2UXDK 1VHXA 1WSIA 3ZSOA 4QCLA 1RT1A 2H3GX 5KPTA 2F9WA 4BGBA 1HPZA 3VEWA 3D2EA 1FW6A 2WUSA 3SUQA 3CCJN 4CJUA 3NGIA 4JS5A 4BRAA 2IAJA 2ITGA 1S5JA 1T44A 4CK1A 3AGKA 3VQ5A 2V7YA 2ITMA 3JSMA 1RBTA 3LP2A 4JD2A 3DLGA 3PUFA 1OH6A 3CC2N 3IAYA 4RTFD 4M63C 4YOVA 4DS5A 4C8NA 5IWAK 1U45A 3AVJA 4FWNA 1NWKA 1GLEG 1SKRA 3C6TA 3DI6A 2NNWA 4DR2K 1WUAA 5J1EA 2A41A 4FJHA 4IG0A 4CEQA 2E4LA 2IVOA 4BR5A 2PY5A 4CJQA 4CF9A 1CXQA 5FPMA 2NRVA 1X3MA 1VQMN 2YV0X 4CI6A 1KFSA 4BRMA 1YJWN 5DMRA 5AQNA 3AVGA 2EHGA 1S3XA 1RT6A 2P9PA 4KBOA 2JWKA 3K5LA 3SQ0A 2BE2A 1BI4B 1GLJO 1IKYA 2HB5A 2VYPA 1XC9A 1EKEA 4FJ9A 3HVTA 2HF4A 4CEZA 3PO4A 2FXUA 3C6UA 2KZMA 1TGOA 2HHSA 1X9MA 5E41A 4KPYA 3DLEA 4FWQA 1KLNA 1KVCA 4O8KA 2P9NA 1ESVA 5KI6A 4CZEA 1RBSA 4HCCA 1FK9A 4RW8A 4BG8A 4MO4A 4FJXA 3FZFA 3PY8A 3C7NA 3K5OA 4WCEL 4JV5K 3SBTA 3ZT0A 4B3RK 4B1ZA 5BN8A 3KK1A 4AHRA 1ILYA 2I5JA 4XH5A 3CIPA 3O6WA 1NJWA 4NXNK 3FLCO 2ZGZA 1LWFA 1NG9A 4W5NA 3CCMN 1JCEA 1NNEA 1HQUA 3I8DA 1TYQB 4FPBA 3K58A 3ZETB 3U4LA 4CF0A 4DQRA 4JI0K 3SPZA 2VWJA 4DFPA 4ELTA 4X62K 4JI6K 4O5BA 2O8CA 2ETJA 3R3LA 4NYNA 3L8BA 3V81A 4FK0A 1EWRA 5FLXO 3MK6A 3WNFA 1RT7A 4DB3A 2CGJA 3AY9A 3AA5X 1VQLN 1WBDA 4JRQA 3L2QA 1A5VA 4FM0A 4FWOA 4I6MA 4X64K 1REVA 4DTNA 1TK5A 4CEFA 3T69A 1NKCA 3OHRA 4BR4A 3O1BA 3P83D 3ZEUA 3CPEA 1EXQA 1ZBIA 2DY4A 2HBLA 1TKTA 3O4NA 4GV9A 3VQPA 2W42A 1VSDA 4QS8A 4H8KA 1BO5O 1VQ8N 4CJPA 2Y1IA 3F2KA 1C1AA 4BRHA 2YHXA 4JKGA 1HLUA 3AVBA 3OBYA 3WXLA 4A59A 3QIOA 4MFBA 4A2AA 3OS1A 4IKFA 4V19S 3WQUA 1LWCA 3AO4A 4FW1A 5HP1A 4DV4K 2OYQA 1MDUB 4DQQA 4B9TA 2OANA 1T6CA 2RPIA 3HSTB 5AQYA 2E20A 4FJMA 4YORA 5M1OA 2ZJRL 3LL3A 4BWMA 1XHZA 4Z0UA 3VQBA 2X6NA 4AHTA 3TAMA 3K5NA 4HTUA 1Q7YO 3DLBA 5FRMA 1D9FA 4KHNA 4GV3A 1NK5A 3VF4A 1YVNA 4CGHA 4M45A 5HROA 1WAJA 1OKJA 5FPNA 1X9WA 2QA4N 3K5MA 2BH1A 5AJ3K 4CGFA 3QINA 1T3VA 4W5QA 4H5RA 4FWLA 3CC7N 5LMUK 4ILJA 3QEXA 2R7YA 3DXKA 3O3FA 1RBVA 2V51B 4FLXA 1SL1A 4CIGA 3KTQA 3RR7A 3LAKA 3DLRA 4DSLA 1N5YA 4DR7K 3ZYYX 3FZHA 5F1XA 1W9HA 4U7BA 5KQDA 1WB9A 4CESA 2XRIA 3SQ2A 3PLAA 1XMQK 1L3UA 3AVNA 2V52B 2ZWHA 4IBNA 2ASPA 5HRPA 3O5BA 1GLLO 3J80O 3HSCA 1HX1A 1U2VA 2CGLA 3FGUA 4EHUA 4J2DA 3TU5A 4F3OA 3HI0A 4PY5A 3CPWM 3PX4A 3MECA 2P9LB 1IH7A 1KD1O 3LZJA 1M90O 4O4GA 3VEOA 4BVOA 4RW9A 5AQGA 3V9UA 4M3UA 4EZ6A 4YFUA 5AQMA 4JKBA 1Z25A 3QMLA 4FWRA 3QLHA 4MO5A 1SAZA 1RT3A 2Z1JA 4JK9A 4CIEA 5KQ8A 4YOXA 4JN4A 2FSNA 4AH9A 1NGBA 1K8AO 2ZQBA 3SAHA 1KVAA 4FZZA 5JS2A 5CE3A 4B3OA 3K2PA 3EY1A 1NGAA 4GW6A 3ZSQA 4DU4A 4JKFA 3QETA 1BG3A 2FSKA 4MLHA 5CZ1A 3R9PA 3K57A 3CFPA 3TARA 1JL1A 3HVRA 3O80A 1B92A 3CMAN 1DGKN 2A5XA 3WEEB 1TK0A 4H0XB 4ID5A 3LDLA 3ULEA 4IWVA 5FPDA 1X9SA 5AR0A 1QTMA 4JI8K 5EU7A 2VWKA 3ID8A 3UB5A 4BRCA 1ATNA 2FBTA 2KKZA 4X65K 1Q9XA 4ID1A 1D5AA 4NCGA 1GLBG 3FR0A 4CZGA 4CJFA 3KLIA 4Z4EA 1S9GA 1JLQA 1YTAA 1EP4A 3RSEA 1U4BA 3JYTA 3BEXA 4B9VA 3D2FB 3OBWA 3CCSN 3I0SA 3TR8A 2PYJA 2WOMA 2QM1A 2BANA 3DLHA 5JLFA 4W5RA 3MWPA 1HQEA 4BE0A 3M8QA 4DR1K 5I3UA 4CJVA 4DTUA 3AA3A 4A61A 4LH4A 4FSVA 3V1QA 3HOSA 3QO9A 4ZTFA 1T6DA 3L2VA 3G25A 4Q0BA 4KHUA 3AVLA 1NK8A 3H6EA 3LP0A 4OJRA 3JAMO 1N32K 4CHNA 1ZBFA 3QEIA 3T1AA 4NCAA 4JKAA 1O13A 1RBUA 4BDYA 4PKGA 3T3FA 4BE1A 3SJHA 1ZBSA 3L3VA 3F9KA 5C10A 4W5TA 3THXB 3TAPA 1J5EK 4JLHA 3DAWA 2VG5A 4IJNA 4B1YB 4O5FA 2HMIA 1GOAA 1RNHA 1TL3A 3TTFA 4H5WA 5CYMA 5M1KA 1CZBA 3CMEN 5A2QO 4DFKA 3SPYA 3THWA 4BRGA 3P4IA 3HP9A 2ZJQL 2J4RA 3IUCA 3EZWA 1RDUA 3MWTA 1LCUA 5M1QA 4N47A 4CEBA 3KHYA 3D45A 2W6KA 2O8EA 2G8HA 2E1YA 4BGAA 4CGJA 2UUAK 3KK7A 4AQYK 1NGHA 3SQ4A 2OPRA 3ID6A 1LOTB 2YJEA 3NDKA 4IEEA 3NH0A 1DTTA 2YHBA 5HL7L 2PBDA 3C94A 3J7YP 3CJAA 2VQEK 4BY9C 4K41A 4IFEA 2VGMA 2NRHA 2A1RA 1ZC6A 1DKGD 1XMOK 4BDZA 3BF1A 1ZBUA 2E88A 1RDBA 1NU0A 5BRFA 4CERA 1WAFA 1IKXA 3IG1A 4BDPA 2ZF5O 3BF3A 4YDUA 1M1KO 4DU3A 3M8PA 4WF9L 3KLEA 3V1RA 4BROA 3R8EA 2QWLA 4WYBA 2NRZA 3OYKA 5AQWA 4MLEA 2HHVA 1N8RO 3SUNA 2D0AA 4DTMA 4E89A 3I55N 3Q7BA 3K0SA 4KFBA 1KAXA 4B9MA 4FOIA 3HPOA 3DXMA 4LFAK 1T7PA 2F7TA 4IDKA 4GNIA 4RG8A 4CGDA 4A2BA 3UKRA 2KQ2A 3LANA 5LJWA 2XY8A 1KFDA 3K59A 3VGKA 3OYMA 4DQPA 4PKHA 4M7XA 2V7ZA 4CJLA 4ZHRA 1ATSA 3K9KA 3NCIA 5AFUA 1BQNA 4DV2K 3MXMA 4OPHA 1QQOA 1HJRA 3CQ8A 4H0VB 3Q7CA 4K8ZA 1HRHA 2HMPA 5AQIA 4FK4A 4IDHA 4M7YA 1OH5A 3VF6A 3HP6A 3D2EB 3F5TA 1K8KA 1O1WA 3AARA 2NZTA 3L4IA 3LDOA 4LF8K 2DTUA 4J2EA 4E7IA 2DFHA 4CEEA 3F73A 1JXEA 4NLBA 4IOCL 4DV3K 4Z4FA 1ASVA 1HPMA 2Q31A 4JD2B 3MX5A 1LAWA 2E6MA 1JKHA 1G15A 1OH7A 1FJGK 1C0GA 5GINA 4XH4A 3OW2M 5AQRA 2HBJA 3ZT3A 1SQKA 3GDQA 3M8SA 3CG7A 3NFAA 1RCHA 5T7BA 1C1CA 1RBRA 5ELZA 2HOEA 3HPHA 2VG6A 2YHYA 1ZBLA 4X66K 5KRSA 1YAGA 1HKBA 2OA8A 4DV6K 3CFRA 3FZMA 3NF9A 4K43A 4XIUA 4DSIA 5MLCQ 3HTVA 3OYLA 2F96A 2GTDA 3OYGA 4JS4A 1B9DA 1VQ5N 1JXBA 2I7NA 3B6PA 3CFOA 4CFDA 2P9PB 2JGUA 5E84A 5AQUA 2WONA 3CJ7A 4HUEA 4OGCA 4FVUA 1QSSA 3M1FA 2QWRA 3O08A 2P5OA 1SV5A 5KPRA 5CYQA 4M3TA 1ZBHA 4N76A 2GEMA 4KH5A 4CEOA 1NK9A 3ZSRA 3AVHA 3RMBA 1QSYA 3DOLA 3KLFA 1GLCG 2A42A 1S1WA 3A2FA 3CCEN 3C7NB 3C0BA 5C0YA 4WFBL 2UXCK 1BWFO 5CY4A 4CJ4A 2AP1A 2YHAA 5JVGL 1KQSM 4CJWA 3WXKA 4CEAA 4OX9K 5KRTA 5D3GA 1XNRK 4BVPA 5C25A 4F2SA 1HYZA 2RN2A 4FWPA 3ATVA 1KTQA 2WC9A 2HVHA 2XY7A 4F4KA 4KV8A 2A40A 4FLYA 5GIOA 3AAPA 3LP1A 1WSFA 3H3NO 4E7LA 3EKSA 2YNIA 3G71N 2HHXA 2O8CB 1X1PA 4L8RB 3S3NA 1BA0A 3T1HK 3MDQA 1K73O 1JLEA 1YJ9N 4RW7A 3M6GA 3CF5L 2EWSA 2GWKA 2IOCA 3TSPA 1NGCA 3TSQA 3HM9A 1KVBA 5CZ2A 2FBYA 2NUBA 3D6RA 1LWEA 3NE6A 2PYLA 4I6MB 2IS3A 2P9UA 5F0XA 3ZX2A 3CXCM 4CZHA 5AQHA 2B4JA 3ZEUB 3SAFA 4OPJA 2HBMA 4LC9B 3NVKA 3VQ4A 4HVJA 4FW2A 3FFKB 4PUOA 3MN6A 4M3XA 3SV3A 4EAHD 1CZAN 3TTCA 2KLAA 4A5AA 2KZZA 5JLHA 4NCBA 2QXFA 3KIOA 2B5JA 4CZMA 3PIOL 3OS0A 3HPGA 1N6QA 1NKEA 5JMVA 1KLMA 3O3HA 4C8OA 4FO0A 3DLLL 1V4SA 4E7JA 4OPAA 2D4WA 2YX6A 4NXMK 4KB0A 2A1SA 1D8YA 1GOCA 3TAFA 1S6QA 4FL9A 5GAHP 1UA0A 3QBWA 3WNGA 4B8AB 4LF7K 1NK0A 4FWKA 5AZJA 3NMUA 4CJTA 1Q82O 3SCXA 1L3VA 2P9IA 4AF1A 4G1QA 3DLKA 3PSIA 5LJVA 3AVKA 3ITHA 1J6ZA 3NH1A 3PX0A 4DTXA 2VG7A 4DR4K 4E1NA 2HBKA 3TTDA 4CF8A 2IIRA 2Z1GA 5EY4A 3E9PA 3WT0A 4CFCA 2F4VK 2B6AA 3T19A 4C23A 4WFNL 3BP8A 2DFEA 4KO0A 4CF2A 3SUOA 3VQCA 3AA4A 4M3ZA 4I2QA 3S41A 4KTZA 3DXKB 5E26A 5EXWA 4CVNE 1TK8A 1ASWA 3OY9A 4JI7K 5BRDA 3RRGA 1MU2A 4H4MA 4CF1A 3P5JA 4CHQA 2D0CA 5BR8K 3H3OB 3ULDA 1S1VA 5SWMA 1TUUA 4BWJA 3GBTA 3J81O 3JS6A 4AHUA 3PV8A 4PWDA 3L3UA 3E66A 4CECA 3VEZA 1WLJA 3EL2A 3U9DA 1NOYA 1IG9A 2FC0A 4OVLA 4BRLA 4EFHA 1LW2A 2FF6A 4EP4A 1GLDG 3OJSA 4FJGA 3T7ZA 3LP3A 1SL0A 2IGIA 2CGKA 4PQUA 2QW9A 4O0JA 1U2VB 4Z94A 3GL1A 3NVMA 3VF2A 1BQMA 2OPQA 2ASOA 5AZIA 1RDCA 1TV6A 3KD5E 5ADXH 3J7AP 4DKWA 1WSHA 4JI3K 2YKMA 2VWBA 3HO1A 3SAGA 2D0PA 3G4SN 3CCLN 4BACA 3BDPA 3L2UA 2W40A 3JXUA 4N41A 4B3SK 4B3TK 3THVA 5KPZA 5C2DA 1BISA 1WBBA 2KW4A 4JKCA 4JRPA 4MQ3A 2FBVA 4CHOA 1IKVA 1QQMA 1RT2A 1SL2A 3VQQA 3E1YA 3NF8A 1UOCA 1Q18A 1C0UA 3CHWA 3CI5A 3EE9A 1RDAA 2XY5A 3KD1E 3QBXA 3DM2A 4BC5A 4DFJA 2UUCK 1WN7A 1T03A 2F8TA 2O8DB 3LWMA 2Z1IA 1Q8IA 2O8BB 3H08A 3ULEB 3ZLJA 4E1JA 1U49A 1D4XA 3WNHA 3SLCA 4FJLA 1S1XA 3HJFA 1G99A 4J2BA 1OH8A 3LWLA 3FFIA 2YNHA 5AQVA 3VQEA 4C8LA 1JLAA 4A57A 3HOTA 3ASMA 4DR3K 3RSEB 2IVPA 4LH5A 2G8IA 4OPKA 4CZKA 4DSFA 4A62A 3VOVA 4U67L 1KC8O 1IBLK 4KI6A 2HHTA 3H46O 1RFQA 5BPMA 3L0QA 1YITN 1YUWA 1NGEA 2Q0UA 1F21A 1YF5L 4BE2A 4F8RA 4B1UB 1KAYA 1TAUA 5C24A 4DV1K 4BC4A 4CBUA 3J7ZO 2O8FA 2UXBK 1C0MA 1W97L 1EX4A 4G9ZA 4E19A 1ASUA 5KTQA 1T8EA 3GOIA 1UWBA 3THYA 4KHSA 4KHPK 1Q9YA 2NRRA 2NRXA 4GVMA 3VQ9A 3V4IA 4FXDA 3TANA 1VQ4N 4ELUA 1NGJA 2UU9K 3UIQA 4KH6A 4BRNA 1P8ZA 3KWGA 1GLFO 1BU6O 2ATQA 2NRTA 4CFAA 3E01A 3NAEA 3TABA 2IDOA 4MDAA 2I7PA 2WFBA 1BIZA 1C0TA 3G10A 3MCPA 1VK0A 4XEIA 2P9SB 4QS9A 4CEDA 3O3GA 3QEWA 4M42A 4BRPA 1HNZK 3I33A 4LF4K 4DLGA 1WNSA 3CM6A 4I9QA 5AQSA 3CQXA 4FLUA 4M3YA 1GLAG 4JHDA 4CJ3A 3O4QA 1W7AA 3OJUA 3THWB 4DLEA 5BPNA 3V6DA 3WUHA 4JK7A 4A5BA 1OVQA 2ZGYA 3M8RA 4E1MA 3TPQA 4LFCK 2YI1A 4WE1A 1YXQA 3V9XA 4F3TA 4ISEA 4QAGA 3ENBA 3QICA 3W0LA 4B8CA 2O8EB 3PO5A 4FJ5A 3BZCA 1J54A 4JKDA 4GMJB 1NGGA 1QZ6A 4B9NA 3C6AA 4OO1J 3D2FA 1YJNN 2JWLA 3ZT2A 1BCMA 5IT9O 4DSJA 5CR4A 4DR5K 3MN9A 3CCQN 3SYZA 4AM6A 3WNEA 4FLTA 1HR0K 3KJVA 3EKUA 4CGGA 4LFBK 3OYNA 1JLGA 1WSJA 4DCHA 4CE9A 4BC3A 5BPLA 2UUBK 3FE1A 4PHTX 1ATRA 3VQ6A 5H1SQ 1YT3A 2A3ZA 4H0OA 4NB4A 4H4OA 1TAQA 4ILGB 4CHZA 4CBXA 1OVYA 4HCBA 2D5RA 1RDDA 4RW4A 3V9SA 3SI6A 1Y97A 1NJXA 3O8MA 1VRTA 3L2RA 3MXIA 1KCFA 4ICLA 3MAQA 3AVAA 4JEPA 3S9HA 4UY8O 4KREA 1WOQA 1QE1A 4C1NI 4OKEA 3VQ7A 3VTIA 4EIAA 2ZM6K 3VEXA 3QEVA 2RHKA 2BGGA 3E9OA 1IJJA 2YCHA 2YNFA 1XC3A 3LDSA 3OYFA 1VSFA 2JLEA 3P31A 1R59O 1W2BM 3LM2A 1BHLA 1Z05A 4O0IA 3OTOK 3VEYA 3C65A 4CJRA 3MEGA 4GKKK 4WFAL 1RILA 3OYCA 4YY3K 2OPPA 2ZE2A 4N5SA 5HLFA 2E5LK 1QS4A 2KTQA 1VQPN 4B9QA 4R5PA 4CZLA 1VSMA 4IEIA 3GG4A 4FLVA 4K0KK 1EO1A 4C8KA 1KSPA 4YNQA 3A0IX 2Q36A 3NHGA 2RF2A 3O9QA 4DTSA 1VSIA 5DM7L 3OS2A 3H45C 3RRHA 2OCEA 2GUIA 4Z4GA 2EX3A 3A5MC 4KI4A 3N4QA 1HKGA 4EHTA 4E0DA 1SS6A 4L3QA 3VMFB 4FK2A 4B1WB 3KK2A 1NK7A 1NGFA 3P38A 3WXIA 3IRXA 4YOUA 3ZCMA 1DTQA 3C6HA 4CD1A 3O9TA 3NBPA 2WBNA 3ZSWA 5LY3A 4NLCA 1JCGA 4Y1DA 1DT9A 4YOWA 2HNDA 2KFNA 2HVIA 5I42A 4B1XB 4BR7A 4JI2K 2Q3SA 4FPAA 1E4FT 3VERA 3IDHA 4LSNA 5FDLA 3LAMA 2GBZA 4HWIA 1BL3A 3MN7A 1RTJA 4H03B 3ZX0A 4JKEA 5LMNK 3EZ5A 3CCRN 2PFUA 5C12A 3FZLA 4BRKA 3DRPA 3HRGA 2ZD1A 4DTRA 3RMDA 3AO1A 3N4PA 3VETA 2P51A 1HNIA 1A5XA 2KHOA 3QNNA 4BRIA 4CW7B 1UA1A 4O8UA 1VQ6N 3L4QA 1K9MO 3SZ2A 1RTDA 1YI2N 4CJKA 3OYAA 3DRSA 3MCAB 1WSEA 3IMXA 2P9KA 3CQYA 2HHUA 3QDKA 4BRQA 1JLCA 4IOXA 3TAEA 1K6YA 4KRFA 4E3SA 3U8XA 2ZJPL 1N34K 4FJ7A 1X9JA 4DF4A 4IO9L 4ZTJA 3ZSYA 4DV5K 2Y1JA 2DPNA 4OLAA 3WXJA 3A8YA 4DQSA 1Y64A 1IV0A 4K25A 4KHYA 1C1BA 5HRSA 3AVCA 1HUXA 4B08A 1ZXOA 3ZT4A 1I94K 3UKUA 3CD6N 4MDBA 2QXLA 1ZYQA 3O1WA 1NMDA 3EE8A 3AA2A 3DOKA 4DTOA 3DJCA 1VQ7N 2XHBA 1BCOA 3ATUA 1CLQA 5FRNA 4NO7A 2P9NB 4DHYA 5BRHA 2XO7A 1VSKA 3HT3A 4LF6K 3IS9A 4FJKA 4C1NK 4CGIA 5BREA 3R1XA 2HF3A 3SNNA 2FSJA 4CJ5A 2KFZA 4O44A 4Y1CA 1VSLA 4KTWA 4QOZB 3RR8A 3VQAA 4PL7A 4WQ4C 2P9UB 5F2RA 2Q1NA 4ISFA 3VGMA 1LW0A 4CZFA 4CCHA 3B6OA 2HHHK 1U04A 1VQON 3GE1A 4Y0WA 1YTUA 3VPZA 2E6LA 4UQGA 1HYVA 1QQNA 1QSLA 2UYTA 1S22A 2E2QA 4H5TA 4FM2A 2YHWA 4CHPA 2E8AA 2O4GA 3CC4N 2DFFA 3WXMB 1J5OA 2W6LA 1CXUA 4AM7A 3KK3A 3U3YA 3AVIA 5HRRA 3W3DA 4KB1A 2D1KA 1DLOA 4E7KA 4IO8A 3U9ZA 3SV4A 1BI4A 5AQQA 5TKWA 1ITGA 5SZTA 1S6PA 2OPSA 3EN9A 4FLWA 4I9LA 4AHCA 2IVNA 3ENOA 5AZJB 3R6MA 3WQTA 4RCHA 1NMNA 4FCYA 1XWLA 2P9IB 2Q97A 4DV0K 4CJ7A 1YIJN
chains in the Genus database with same CATH topology
3NF8A 1UOCA 1RNHA 1TKZA 1C0UA 3QIPA 5K14A 1TL3A 5J2QA 3U6FA 3S3MA 5J2MA 4Z4IA 5CYMA 4DTJA 1CZBA 1RDAA 4JS4A 4O55A 2XY5A 1NK6A 3KD1E 1HMVA 3G0ZA 4DFKA 3DM2A 3SPYA 1TVRA 4DFJA 4CJEA 2O4IA 1WN7A 3HP9A 1NKBA 1T03A 2F8TA 2HW3A 1VRUA 1WSIA 3MXJA 2Z1IA 3ZSOA 1RT1A 5KGXA 3LWMA 3C95A 2X74A 5J2NA 1Q8IA 3ALYA 3H08A 4N47A 4CEBA 1HPZA 3D45A 1U49A 3SUQA 2G8HA 2HHWA 4CGJA 4CJUA 3NGIA 4JS5A 3SQ4A 2OPRA 3WNHA 2IAJA 4FJLA 3NDKA 3NH0A 2ITGA 1DTTA 1S1XA 1S5JA 3KLGA 1R0AA 3P1GA 4CK1A 4J2BA 2YHBA 4CK2A 1TKXA 4KKOA 4M3RA 3VQ5A 3LWLA 1VSJA 3FFIA 3JSMA 4OKJA 3C94A 2YNHA 1RBTA 3LP2A 3VQEA 2BDPA 4C8LA 1JLAA 3U3GA 4M41A 5JS1A 3ASMA 3DLGA 3PUFA 2G8IA 4LH5A 2A1RA 1YVUA 4OPKA 3OYIA 3IAYA 4DSFA 2RKIA 3DYAA 4CHYA 4BDZA 1U47A 2QKBA 4DS5A 4C8NA 4KI6A 3OYEA 1U45A 2HHTA 3BGRA 3AVJA 1ZBUA 3AVFA 3VA0A 1SKRA 3C6TA 3DI6A 1F21A 1RDBA 4F8RA 4BE2A 4EP5A 5HRNA 3KLHA 4CERA 1D9DA 3MEEA 1S1TA 1WAFA 3V1OA 1TAUA 1IKXA 3IG1A 4FJNA 1NOZA 5C24A 5J1EA 4BDPA 2XY6A 4FJHA 1RT4A 4DU3A 3M8PA 4IG0A 1C6VA 2OZMA 4CEQA 3KLEA 2E4LA 4FJGA 3V1RA 2IC3A 1C0MA 2PY5A 1UAXA 4CJQA 1TL1A 4CF9A 1EX4A 1CXQA 3OYKA 3VA3A 4E19A 1ASUA 5KTQA 1I39A 2YV0X 1KFSA 1T8EA 2HHVA 4FVMA 5DMRA 3SUNA 3AVGA 1UWBA 2EHGA 4KHSA 1RT6A 2D0AA 2FBXA 4DTMA 4E89A 3K5LA 1Q9YA 1BGXT 4KFBA 4GVMA 3VQ9A 3V4IA 3SQ0A 3LPUA 4FXDA 3TANA 2HNZA 4ELUA 2BE2A 3UIQA 1BI4B 1IKYA 2HB5A 1XC9A 4B9MA 3HPOA 3ZSZA 1EKEA 4TSXA 1JLBA 4FJ9A 5FROA 5KGWA 3QEPA 1T7PA 3HVTA 2ATQA 4CFAA 2F8SA 4CEZA 3E01A 4IDKA 3NAEA 3TABA 4RG8A 2IDOA 3PO4A 3HXMA 1BIZA 1C0TA 1S1UA 3G10A 1VK0A 4CGDA 3O3GA 2KQ2A 4CEDA 3QEWA 4M42A 3PX6A 3LANA 3C6UA 3MEDA 1TGOA 2KZMA 2HHSA 4DLGA 2XY8A 1RTIA 1KFDA 1WNSA 3CM6A 3K59A 3OYMA 1X9MA 4DQPA 3V9WA 5E41A 4I9QA 4KPYA 3DLEA 3OYJA 4FLUA 4AHSA 4M3YA 4CJLA 1KVCA 1KLNA 4CJ3A 3O4QA 4ZHRA 4OLBA 3OJUA 3NCIA 3OYDA 4DLEA 3V6DA 5KI6A 4HCCA 1RBSA 1FK9A 1BQNA 1LAVA 3MXMA 4RW8A 1HJRA 3M8RA 2QK9A 3CQ8A 4FJXA 4E1MA 2G8KA 1HRHA 4K8ZA 4DTPA 1U48A 3PY8A 4KAZA 3K5OA 4FK4A 4WE1A 3LZIA 3ZT0A 3V9XA 4M3WA 3TI0A 3TAGA 3KK1A 4F3TA 4QAGA 3HP6A 4AHRA 4B8CA 2I5JA 1NJZA 3PO5A 3HJFA 4FJ5A 3KKSA 1NJWA 1J54A 1O1WA 3RMAA 4GMJB 3VQ8A 2G8UA 1LWFA 4B9NA 4W5NA 2DTUA 1VSEA 4J2EA 4CFBA 4E7IA 1HQUA 3I8DA 2DFHA 4DS4A 4CEEA 3ZT2A 1JXEA 4LD0A 1BCMA 3K58A 2YKNA 3F73A 4CF0A 4DQRA 4DSJA 4Z4FA 1KRPA 1ASVA 3SPZA 3SYZA 2OYQA 2VWJA 3AO3A 4DFPA 1LAWA 3WNEA 4FLTA 4ELTA 3KJVA 2E6MA 1JKHA 1G15A 4DF8A 4CGGA 3OYNA 4O5BA 1JLGA 1WSJA 4N56A 2HHQA 2ETJA 4CE9A 4NYNA 3L8BA 3RTVA 3V81A 3ZT3A 4FK0A 3M8SA 3CG7A 3NFAA 4Z4CA 3WNFA 3VQDA 1RCHA 4F2RA 5T7BA 1C1CA 1A5WA 1RT7A 1RBRA 3VQ6A 3HPHA 2VG6A 3AA5X 1YT3A 3CYMA 4FZXC 4RW6A 3V9ZA 1ZBLA 4JRQA 5KRSA 4H4OA 1TAQA 4CHZA 1A5VA 3L2QA 4FM0A 4HCBA 1IKWA 2D5RA 1REVA 4DTNA 1TK5A 4CEFA 2OA8A 1RDDA 4RW4A 4C8MA 3CFRA 2HNYA 1NKCA 3V9SA 3NF9A 3P83D 3SI6A 4XIUA 1Y97A 1NJXA 2P5GA 4DSIA 3OYLA 1VRTA 2F96A 3L2RA 4K8XA 3MXIA 1EXQA 1KCFA 3OYGA 4ICLA 1B9DA 3MAQA 3B6PA 1JXBA 3AVAA 3DMJA 1QHTA 3CFOA 1ZBIA 4CFDA 1TKTA 3O4NA 3S9HA 2DY4A 3VQPA 2W42A 4KREA 2JGUA 1VSDA 4H8KA 1QE1A 4OKEA 3VQ7A 3DRRA 2WONA 4CJPA 2Y1IA 3SJJA 4HUEA 4OGCA 3QEVA 1C1AA 3AO5A 1VSHA 1IO2A 2BGGA 4B9UA 1QSSA 2YNFA 1B9FA 3LDSA 2P5OA 3OYFA 1SV5A 3AVBA 1VSFA 2JLEA 3QIOA 4MFBA 5CYQA 4M3TA 5J2PA 3OS1A 1JL2A 4IKFA 1ZBHA 4CIFA 4N76A 1HNVA 4IFVA 1BHLA 4O0IA 1J53A 4CEOA 4HUFA 3SUPA 1LWCA 3LPTA 1NK9A 3ZSRA 3AVHA 3RMBA 3AO4A 1QSYA 2G8VA 4CJRA 4FW1A 3DOLA 3MEGA 3KLFA 1FXXA 4KTQA 1RILA 3OYCA 3EYZA 5HP1A 1S1WA 3A2FA 2YNGA 2OPPA 2ZE2A 4N5SA 4E7HA 4Q5VA 4DQQA 4AILC 3TAQA 2RPIA 1QS4A 3HSTB 5HLFA 2G8FA 4B9TA 2KTQA 2AJQA 4R5PA 1VSMA 4Z4HA 4FJMA 3HL8A 4FLVA 4BWMA 1XHZA 4Z0UA 3ZSXA 5CY4A 4CJ4A 3VQBA 3QNOA 2X6NA 4AHTA 2YHAA 4C8KA 1KSPA 4FYDA 3TAMA 4YNQA 3K5NA 4HTUA 4CJWA 3DLBA 1TKDA 4CEAA 3OYHA 5FRMA 1D9FA 4KHNA 4FJ8A 3NHGA 1NK5A 2RF2A 5KRTA 4DTSA 1VSIA 4FZYA 5D3GA 4CJSA 5C25A 4F2SA 1GOBA 3OS2A 1HYZA 4CGHA 4M45A 5HROA 1WAJA 2RN2A 3RRHA 1X9WA 2GUIA 1KTQA 2HVHA 3K5MA 2XY7A 4F4KA 4Z4GA 4KV8A 4FLYA 2EX3A 4KI4A 4CGFA 3QINA 1SKSA 4QCLA 3LP1A 2GV9A 4E0DA 4W5QA 1NJYA 1WSFA 4E7LA 4KHWA 2YNIA 4FK2A 1NK7A 3KK2A 1J9AA 2HHXA 1X1PA 4DSKA 4DSEA 4L8RB 3IRXA 3ZCMA 3S3NA 1DTQA 3S3OA 1XI1A 1T05A 1JLEA 3NBPA 3OYBA 3QEXA 2R7YA 4RW7A 3ZSWA 3O3FA 1RBVA 4I7FA 2IOCA 4FLXA 1SL1A 4Y1DA 4B9SA 4CIGA 3KTQA 3ZT1A 2HNDA 2KFNA 3RR7A 3LAKA 2HVIA 5I42A 3HM9A 3DLRA 1KVBA 1S9EA 4DSLA 1N5YA 5CZ2A 2Q3SA 1W9HA 2FBYA 2NUBA 1LWEA 3NE6A 2PYLA 2IS3A 5FDLA 4LSNA 3LAMA 4CESA 2GBZA 1L5UA 1BL3A 2XRIA 5HBMA 1RTJA 3SQ2A 3LALA 2B4JA 3KKRA 1LV5A 4OPJA 3EZ5A 1L3UA 3AVNA 3L2WA 5HRPA 1XHXA 4IBNA 4B9LA 3VQ4A 4HVJA 3DRPA 2ZD1A 4FW2A 4DTRA 3HYFA 3RMDA 3AO1A 2X78A 3QESA 4PUOA 1I3AA 2P51A 4M3XA 4J2DA 4FJIA 1HNIA 1A5XA 4F3OA 3SV3A 3QNNA 4PY5A 3PX4A 4J2AA 3ZSVA 2KZZA 3TWHA 3MECA 4NCBA 1UA1A 2QXFA 1IH7A 1W0HA 3KIOA 3SZ2A 1RTDA 2B5JA 3LZJA 4O4GA 3HPGA 4IFYA 4CJKA 3OS0A 4FM1A 3OYAA 1NKEA 1N6QA 4PA1A 3DRSA 1KLMA 4IG3A 3O3HA 1RTHA 4C8OA 4LSLA 4RW9A 3V9UA 1WSEA 1SKWA 4M3UA 4EZ6A 4E7JA 4YFUA 4KB0A 1Z25A 2A1SA 2HHUA 4W5OA 1GOCA 1D8YA 3NF7A 1JLCA 1JLFA 1S6QA 3TAFA 3QLHA 1Z26A 3VN5A 3TAEA 4FJJA 1K6YA 1RT3A 4E3SA 1UA0A 4KRFA 2Z1JA 4FJ7A 3WNGA 4B8AB 4CIEA 1NK0A 4DF4A 4AH9A 4CJTA 4ZTJA 3ZSYA 4FZZA 2Y1JA 2ZQBA 3SCXA 1KVAA 1L3VA 4OLAA 5JS2A 4DQSA 4G1QA 2X6SA 4B3OA 3K2PA 3EY1A 4OKKA 4GW6A 3OVNA 3DLKA 3ZSQA 4DU4A 3QETA 2P1JA 4KHYA 1C1BA 5HRSA 3AVKA 3ITHA 3AVCA 3NH1A 3PX0A 4DTXA 5CZ1A 2VG7A 4B08A 3K57A 4E1NA 3CFPA 3TARA 3RWUA 1JL1A 3NGYA 3HVRA 4CF8A 3ZT4A 1B92A 2Z1GA 1ZYQA 3D0PA 1L3TA 1TK0A 4ID5A 3AA2A 3DOKA 2QKKA 3CM5A 4DTOA 3NH2A 4AHVA 1X9SA 2XHBA 1FKOA 1BCOA 1CLQA 4CFCA 5FRNA 1QTMA 5EU7A 2XO7A 2VWKA 2B6AA 3T19A 3ISNC 1VSKA 3HT3A 2DFEA 4KO0A 4CF2A 3SUOA 2FBTA 3IS9A 3VQCA 4FJKA 3AA4A 1Q9XA 4M3ZA 1CZ9A 4ID1A 4CGIA 4DWIA 4I2QA 1FKPA 3SNNA 4CJ5A 1D5AA 4NCGA 4KTZA 1TK8A 1ASWA 3OY9A 4CJFA 3KLIA 4Z4EA 2KFZA 4KHQA 1S9GA 4O44A 4Y1CA 1MU2A 3RRGA 1JLQA 1SUQA 1YTAA 3P5JA 4H4MA 1VSLA 2D0CA 1EP4A 2Z1HA 4CF1A 4CHQA 3ULDA 1S1VA 4KTWA 4QOZB 5SWMA 1U4BA 3RR8A 3JYTA 4BWJA 3VQAA 4AHUA 3PV8A 4B9VA 4PWDA 3L3UA 4DG1A 4CECA 1WLJA 3QERA 3I0SA 3TR8A 4DMNA 2PYJA 1NOYA 1IG9A 2WOMA 2BANA 1LW0A 2FC0A 3AV9A 1HYSA 3DLHA 4DQIA 4OVLA 4W5RA 4CCHA 3HK2A 1HQEA 4BE0A 3B6OA 1LW2A 4EP4A 3M8QA 5DK5A 3OJSA 1U04A 4CJVA 5I3UA 3RMCA 4DTUA 3AA3A 3LP3A 5C42A 4LH4A 3V1QA 4FLZA 1SL0A 1L3SA 2IGIA 3QO9A 4ZTFA 1NK4A 1YTUA 4NYFA 4O0JA 2E6LA 4UQGA 1HYVA 3L2VA 4PQUA 4Q0BA 4KHUA 3AVLA 1NK8A 1QSLA 3LP0A 4EZ9A 4OGEA 1BQMA 2OPQA 3I0RA 4OJRA 2D0BA 4CHNA 1ZBFA 4FM2A 1RDCA 3QEIA 1TV6A 4HUGA 3KD5E 3T1AA 4NCAA 4CHPA 2O4GA 3SQ1A 2DFFA 3NF6A 1RBUA 4BDYA 1J5OA 2G8WA 1WSHA 3AVMA 1CXUA 2YKMA 1EETA 3KK3A 3U3YA 1RT5A 3AVIA 5HRRA 3T3FA 3HO1A 4BE1A 4DFMA 4KB1A 4BACA 3BDPA 1DLOA 3L2UA 4E7KA 3SV4A 3NGZA 4N41A 1BI4A 4I2PA 4CK3A 1BIUA 2PZSA 1ITGA 5SZTA 3THVA 1S6PA 1BISA 2OPSA 4LY7A 4ELVA 3L3VA 3F9KA 4FLWA 4I9LA 4W5TA 2OZSA 2KW4A 4AHCA 4JRPA 4MQ3A 4HHTA 3TAPA 2FBVA 1QQCA 2LSNA 4CHOA 4JLHA 3AO2A 4DU1A 2VG5A 1IKVA 4FCYA 1XWLA 1RT2A 1SL2A 1WSGA 3VQQA 2HMIA 1GOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF8 A;  1UOC A;  1RNH A;  1TKZ A;  1C0U A;  3QIP A;  5K14 A;  1TL3 A;  5J2Q A;  3U6F A;  3S3M A;  5J2M A;  4Z4I A;  5CYM A;  4DTJ A;  1CZB A;  1RDA A;  4JS4 A;  4O55 A;  2XY5 A;  1NK6 A;  3KD1 E;  1HMV A;  3G0Z A;  4DFK A;  3DM2 A;  3SPY A;  1TVR A;  4DFJ A;  4CJE A;  2O4I A;  1WN7 A;  3HP9 A;  1NKB A;  1T03 A;  2F8T A;  2HW3 A;  1VRU A;  1WSI A;  3MXJ A;  2Z1I A;  3ZSO A;  1RT1 A;  5KGX A;  3LWM A;  3C95 A;  2X74 A;  5J2N A;  1Q8I A;  3ALY A;  3H08 A;  4N47 A;  4CEB A;  1HPZ A;  3D45 A;  1U49 A;  3SUQ A;  2G8H A;  2HHW A;  4CGJ A;  4CJU A;  3NGI A;  4JS5 A;  3SQ4 A;  2OPR A;  3WNH A;  2IAJ A;  4FJL A;  3NDK A;  3NH0 A;  2ITG A;  1DTT A;  1S1X A;  1S5J A;  3KLG A;  1R0A A;  3P1G A;  4CK1 A;  4J2B A;  2YHB A;  4CK2 A;  1TKX A;  4KKO A;  4M3R A;  3VQ5 A;  3LWL A;  1VSJ A;  3FFI A;  3JSM A;  4OKJ A;  3C94 A;  2YNH A;  1RBT A;  3LP2 A;  3VQE A;  2BDP A;  4C8L A;  1JLA A;  3U3G A;  4M41 A;  5JS1 A;  3ASM A;  3DLG A;  3PUF A;  2G8I A;  4LH5 A;  2A1R A;  1YVU A;  4OPK A;  3OYI A;  3IAY A;  4DSF A;  2RKI A;  3DYA A;  4CHY A;  4BDZ A;  1U47 A;  2QKB A;  4DS5 A;  4C8N A;  4KI6 A;  3OYE A;  1U45 A;  2HHT A;  3BGR A;  3AVJ A;  1ZBU A;  3AVF A;  3VA0 A;  1SKR A;  3C6T A;  3DI6 A;  1F21 A;  1RDB A;  4F8R A;  4BE2 A;  4EP5 A;  5HRN A;  3KLH A;  4CER A;  1D9D A;  3MEE A;  1S1T A;  1WAF A;  3V1O A;  1TAU A;  1IKX A;  3IG1 A;  4FJN A;  1NOZ A;  5C24 A;  5J1E A;  4BDP A;  2XY6 A;  4FJH A;  1RT4 A;  4DU3 A;  3M8P A;  4IG0 A;  1C6V A;  2OZM A;  4CEQ A;  3KLE A;  2E4L A;  4FJG A;  3V1R A;  2IC3 A;  1C0M A;  2PY5 A;  1UAX A;  4CJQ A;  1TL1 A;  4CF9 A;  1EX4 A;  1CXQ A;  3OYK A;  3VA3 A;  4E19 A;  1ASU A;  5KTQ A;  1I39 A;  2YV0 X;  1KFS A;  1T8E A;  2HHV A;  4FVM A;  5DMR A;  3SUN A;  3AVG A;  1UWB A;  2EHG A;  4KHS A;  1RT6 A;  2D0A A;  2FBX A;  4DTM A;  4E89 A;  3K5L A;  1Q9Y A;  1BGX T;  4KFB A;  4GVM A;  3VQ9 A;  3V4I A;  3SQ0 A;  3LPU A;  4FXD A;  3TAN A;  2HNZ A;  4ELU A;  2BE2 A;  3UIQ A;  1BI4 B;  1IKY A;  2HB5 A;  1XC9 A;  4B9M A;  3HPO A;  3ZSZ A;  1EKE A;  4TSX A;  1JLB A;  4FJ9 A;  5FRO A;  5KGW A;  3QEP A;  1T7P A;  3HVT A;  2ATQ A;  4CFA A;  2F8S A;  4CEZ A;  3E01 A;  4IDK A;  3NAE A;  3TAB A;  4RG8 A;  2IDO A;  3PO4 A;  3HXM A;  1BIZ A;  1C0T A;  1S1U A;  3G10 A;  1VK0 A;  4CGD A;  3O3G A;  2KQ2 A;  4CED A;  3QEW A;  4M42 A;  3PX6 A;  3LAN A;  3C6U A;  3MED A;  1TGO A;  2KZM A;  2HHS A;  4DLG A;  2XY8 A;  1RTI A;  1KFD A;  1WNS A;  3CM6 A;  3K59 A;  3OYM A;  1X9M A;  4DQP A;  3V9W A;  5E41 A;  4I9Q A;  4KPY A;  3DLE A;  3OYJ A;  4FLU A;  4AHS A;  4M3Y A;  4CJL A;  1KVC A;  1KLN A;  4CJ3 A;  3O4Q A;  4ZHR A;  4OLB A;  3OJU A;  3NCI A;  3OYD A;  4DLE A;  3V6D A;  5KI6 A;  4HCC A;  1RBS A;  1FK9 A;  1BQN A;  1LAV A;  3MXM A;  4RW8 A;  1HJR A;  3M8R A;  2QK9 A;  3CQ8 A;  4FJX A;  4E1M A;  2G8K A;  1HRH A;  4K8Z A;  4DTP A;  1U48 A;  3PY8 A;  4KAZ A;  3K5O A;  4FK4 A;  4WE1 A;  3LZI A;  3ZT0 A;  3V9X A;  4M3W A;  3TI0 A;  3TAG A;  3KK1 A;  4F3T A;  4QAG A;  3HP6 A;  4AHR A;  4B8C A;  2I5J A;  1NJZ A;  3PO5 A;  3HJF A;  4FJ5 A;  3KKS A;  1NJW A;  1J54 A;  1O1W A;  3RMA A;  4GMJ B;  3VQ8 A;  2G8U A;  1LWF A;  4B9N A;  4W5N A;  2DTU A;  1VSE A;  4J2E A;  4CFB A;  4E7I A;  1HQU A;  3I8D A;  2DFH A;  4DS4 A;  4CEE A;  3ZT2 A;  1JXE A;  4LD0 A;  1BCM A;  3K58 A;  2YKN A;  3F73 A;  4CF0 A;  4DQR A;  4DSJ A;  4Z4F A;  1KRP A;  1ASV A;  3SPZ A;  3SYZ A;  2OYQ A;  2VWJ A;  3AO3 A;  4DFP A;  1LAW A;  3WNE A;  4FLT A;  4ELT A;  3KJV A;  2E6M A;  1JKH A;  1G15 A;  4DF8 A;  4CGG A;  3OYN A;  4O5B A;  1JLG A;  1WSJ A;  4N56 A;  2HHQ A;  2ETJ A;  4CE9 A;  4NYN A;  3L8B A;  3RTV A;  3V81 A;  3ZT3 A;  4FK0 A;  3M8S A;  3CG7 A;  3NFA A;  4Z4C A;  3WNF A;  3VQD A;  1RCH A;  4F2R A;  5T7B A;  1C1C A;  1A5W A;  1RT7 A;  1RBR A;  3VQ6 A;  3HPH A;  2VG6 A;  3AA5 X;  1YT3 A;  3CYM A;  4FZX C;  4RW6 A;  3V9Z A;  1ZBL A;  4JRQ A;  5KRS A;  4H4O A;  1TAQ A;  4CHZ A;  1A5V A;  3L2Q A;  4FM0 A;  4HCB A;  1IKW A;  2D5R A;  1REV A;  4DTN A;  1TK5 A;  4CEF A;  2OA8 A;  1RDD A;  4RW4 A;  4C8M A;  3CFR A;  2HNY A;  1NKC A;  3V9S A;  3NF9 A;  3P83 D;  3SI6 A;  4XIU A;  1Y97 A;  1NJX A;  2P5G A;  4DSI A;  3OYL A;  1VRT A;  2F96 A;  3L2R A;  4K8X A;  3MXI A;  1EXQ A;  1KCF A;  3OYG A;  4ICL A;  1B9D A;  3MAQ A;  3B6P A;  1JXB A;  3AVA A;  3DMJ A;  1QHT A;  3CFO A;  1ZBI A;  4CFD A;  1TKT A;  3O4N A;  3S9H A;  2DY4 A;  3VQP A;  2W42 A;  4KRE A;  2JGU A;  1VSD A;  4H8K A;  1QE1 A;  4OKE A;  3VQ7 A;  3DRR A;  2WON A;  4CJP A;  2Y1I A;  3SJJ A;  4HUE A;  4OGC A;  3QEV A;  1C1A A;  3AO5 A;  1VSH A;  1IO2 A;  2BGG A;  4B9U A;  1QSS A;  2YNF A;  1B9F A;  3LDS A;  2P5O A;  3OYF A;  1SV5 A;  3AVB A;  1VSF A;  2JLE A;  3QIO A;  4MFB A;  5CYQ A;  4M3T A;  5J2P A;  3OS1 A;  1JL2 A;  4IKF A;  1ZBH A;  4CIF A;  4N76 A;  1HNV A;  4IFV A;  1BHL A;  4O0I A;  1J53 A;  4CEO A;  4HUF A;  3SUP A;  1LWC A;  3LPT A;  1NK9 A;  3ZSR A;  3AVH A;  3RMB A;  3AO4 A;  1QSY A;  2G8V A;  4CJR A;  4FW1 A;  3DOL A;  3MEG A;  3KLF A;  1FXX A;  4KTQ A;  1RIL A;  3OYC A;  3EYZ A;  5HP1 A;  1S1W A;  3A2F A;  2YNG A;  2OPP A;  2ZE2 A;  4N5S A;  4E7H A;  4Q5V A;  4DQQ A;  4AIL C;  3TAQ A;  2RPI A;  1QS4 A;  3HST B;  5HLF A;  2G8F A;  4B9T A;  2KTQ A;  2AJQ A;  4R5P A;  1VSM A;  4Z4H A;  4FJM A;  3HL8 A;  4FLV A;  4BWM A;  1XHZ A;  4Z0U A;  3ZSX A;  5CY4 A;  4CJ4 A;  3VQB A;  3QNO A;  2X6N A;  4AHT A;  2YHA A;  4C8K A;  1KSP A;  4FYD A;  3TAM A;  4YNQ A;  3K5N A;  4HTU A;  4CJW A;  3DLB A;  1TKD A;  4CEA A;  3OYH A;  5FRM A;  1D9F A;  4KHN A;  4FJ8 A;  3NHG A;  1NK5 A;  2RF2 A;  5KRT A;  4DTS A;  1VSI A;  4FZY A;  5D3G A;  4CJS A;  5C25 A;  4F2S A;  1GOB A;  3OS2 A;  1HYZ A;  4CGH A;  4M45 A;  5HRO A;  1WAJ A;  2RN2 A;  3RRH A;  1X9W A;  2GUI A;  1KTQ A;  2HVH A;  3K5M A;  2XY7 A;  4F4K A;  4Z4G A;  4KV8 A;  4FLY A;  2EX3 A;  4KI4 A;  4CGF A;  3QIN A;  1SKS A;  4QCL A;  3LP1 A;  2GV9 A;  4E0D A;  4W5Q A;  1NJY A;  1WSF A;  4E7L A;  4KHW A;  2YNI A;  4FK2 A;  1NK7 A;  3KK2 A;  1J9A A;  2HHX A;  1X1P A;  4DSK A;  4DSE A;  4L8R B;  3IRX A;  3ZCM A;  3S3N A;  1DTQ A;  3S3O A;  1XI1 A;  1T05 A;  1JLE A;  3NBP A;  3OYB A;  3QEX A;  2R7Y A;  4RW7 A;  3ZSW A;  3O3F A;  1RBV A;  4I7F A;  2IOC A;  4FLX A;  1SL1 A;  4Y1D A;  4B9S A;  4CIG A;  3KTQ A;  3ZT1 A;  2HND A;  2KFN A;  3RR7 A;  3LAK A;  2HVI A;  5I42 A;  3HM9 A;  3DLR A;  1KVB A;  1S9E A;  4DSL A;  1N5Y A;  5CZ2 A;  2Q3S A;  1W9H A;  2FBY A;  2NUB A;  1LWE A;  3NE6 A;  2PYL A;  2IS3 A;  5FDL A;  4LSN A;  3LAM A;  4CES A;  2GBZ A;  1L5U A;  1BL3 A;  2XRI A;  5HBM A;  1RTJ A;  3SQ2 A;  3LAL A;  2B4J A;  3KKR A;  1LV5 A;  4OPJ A;  3EZ5 A;  1L3U A;  3AVN A;  3L2W A;  5HRP A;  1XHX A;  4IBN A;  4B9L A;  3VQ4 A;  4HVJ A;  3DRP A;  2ZD1 A;  4FW2 A;  4DTR A;  3HYF A;  3RMD A;  3AO1 A;  2X78 A;  3QES A;  4PUO A;  1I3A A;  2P51 A;  4M3X A;  4J2D A;  4FJI A;  1HNI A;  1A5X A;  4F3O A;  3SV3 A;  3QNN A;  4PY5 A;  3PX4 A;  4J2A A;  3ZSV A;  2KZZ A;  3TWH A;  3MEC A;  4NCB A;  1UA1 A;  2QXF A;  1IH7 A;  1W0H A;  3KIO A;  3SZ2 A;  1RTD A;  2B5J A;  3LZJ A;  4O4G A;  3HPG A;  4IFY A;  4CJK A;  3OS0 A;  4FM1 A;  3OYA A;  1NKE A;  1N6Q A;  4PA1 A;  3DRS A;  1KLM A;  4IG3 A;  3O3H A;  1RTH A;  4C8O A;  4LSL A;  4RW9 A;  3V9U A;  1WSE A;  1SKW A;  4M3U A;  4EZ6 A;  4E7J A;  4YFU A;  4KB0 A;  1Z25 A;  2A1S A;  2HHU A;  4W5O A;  1GOC A;  1D8Y A;  3NF7 A;  1JLC A;  1JLF A;  1S6Q A;  3TAF A;  3QLH A;  1Z26 A;  3VN5 A;  3TAE A;  4FJJ A;  1K6Y A;  1RT3 A;  4E3S A;  1UA0 A;  4KRF A;  2Z1J A;  4FJ7 A;  3WNG A;  4B8A B;  4CIE A;  1NK0 A;  4DF4 A;  4AH9 A;  4CJT A;  4ZTJ A;  3ZSY A;  4FZZ A;  2Y1J A;  2ZQB A;  3SCX A;  1KVA A;  1L3V A;  4OLA A;  5JS2 A;  4DQS A;  4G1Q A;  2X6S A;  4B3O A;  3K2P A;  3EY1 A;  4OKK A;  4GW6 A;  3OVN A;  3DLK A;  3ZSQ A;  4DU4 A;  3QET A;  2P1J A;  4KHY A;  1C1B A;  5HRS A;  3AVK A;  3ITH A;  3AVC A;  3NH1 A;  3PX0 A;  4DTX A;  5CZ1 A;  2VG7 A;  4B08 A;  3K57 A;  4E1N A;  3CFP A;  3TAR A;  3RWU A;  1JL1 A;  3NGY A;  3HVR A;  4CF8 A;  3ZT4 A;  1B92 A;  2Z1G A;  1ZYQ A;  3D0P A;  1L3T A;  1TK0 A;  4ID5 A;  3AA2 A;  3DOK A;  2QKK A;  3CM5 A;  4DTO A;  3NH2 A;  4AHV A;  1X9S A;  2XHB A;  1FKO A;  1BCO A;  1CLQ A;  4CFC A;  5FRN A;  1QTM A;  5EU7 A;  2XO7 A;  2VWK A;  2B6A A;  3T19 A;  3ISN C;  1VSK A;  3HT3 A;  2DFE A;  4KO0 A;  4CF2 A;  3SUO A;  2FBT A;  3IS9 A;  3VQC A;  4FJK A;  3AA4 A;  1Q9X A;  4M3Z A;  1CZ9 A;  4ID1 A;  4CGI A;  4DWI A;  4I2Q A;  1FKP A;  3SNN A;  4CJ5 A;  1D5A A;  4NCG A;  4KTZ A;  1TK8 A;  1ASW A;  3OY9 A;  4CJF A;  3KLI A;  4Z4E A;  2KFZ A;  4KHQ A;  1S9G A;  4O44 A;  4Y1C A;  1MU2 A;  3RRG A;  1JLQ A;  1SUQ A;  1YTA A;  3P5J A;  4H4M A;  1VSL A;  2D0C A;  1EP4 A;  2Z1H A;  4CF1 A;  4CHQ A;  3ULD A;  1S1V A;  4KTW A;  4QOZ B;  5SWM A;  1U4B A;  3RR8 A;  3JYT A;  4BWJ A;  3VQA A;  4AHU A;  3PV8 A;  4B9V A;  4PWD A;  3L3U A;  4DG1 A;  4CEC A;  1WLJ A;  3QER A;  3I0S A;  3TR8 A;  4DMN A;  2PYJ A;  1NOY A;  1IG9 A;  2WOM A;  2BAN A;  1LW0 A;  2FC0 A;  3AV9 A;  1HYS A;  3DLH A;  4DQI A;  4OVL A;  4W5R A;  4CCH A;  3HK2 A;  1HQE A;  4BE0 A;  3B6O A;  1LW2 A;  4EP4 A;  3M8Q A;  5DK5 A;  3OJS A;  1U04 A;  4CJV A;  5I3U A;  3RMC A;  4DTU A;  3AA3 A;  3LP3 A;  5C42 A;  4LH4 A;  3V1Q A;  4FLZ A;  1SL0 A;  1L3S A;  2IGI A;  3QO9 A;  4ZTF A;  1NK4 A;  1YTU A;  4NYF A;  4O0J A;  2E6L A;  4UQG A;  1HYV A;  3L2V A;  4PQU A;  4Q0B A;  4KHU A;  3AVL A;  1NK8 A;  1QSL A;  3LP0 A;  4EZ9 A;  4OGE A;  1BQM A;  2OPQ A;  3I0R A;  4OJR A;  2D0B A;  4CHN A;  1ZBF A;  4FM2 A;  1RDC A;  3QEI A;  1TV6 A;  4HUG A;  3KD5 E;  3T1A A;  4NCA A;  4CHP A;  2O4G A;  3SQ1 A;  2DFF A;  3NF6 A;  1RBU A;  4BDY A;  1J5O A;  2G8W A;  1WSH A;  3AVM A;  1CXU A;  2YKM A;  1EET A;  3KK3 A;  3U3Y A;  1RT5 A;  3AVI A;  5HRR A;  3T3F A;  3HO1 A;  4BE1 A;  4DFM A;  4KB1 A;  4BAC A;  3BDP A;  1DLO A;  3L2U A;  4E7K A;  3SV4 A;  3NGZ A;  4N41 A;  1BI4 A;  4I2P A;  4CK3 A;  1BIU A;  2PZS A;  1ITG A;  5SZT A;  3THV A;  1S6P A;  1BIS A;  2OPS A;  4LY7 A;  4ELV A;  3L3V A;  3F9K A;  4FLW A;  4I9L A;  4W5T A;  2OZS A;  2KW4 A;  4AHC A;  4JRP A;  4MQ3 A;  4HHT A;  3TAP A;  2FBV A;  1QQC A;  2LSN A;  4CHO A;  4JLH A;  3AO2 A;  4DU1 A;  2VG5 A;  1IKV A;  4FCY A;  1XWL A;  1RT2 A;  1SL2 A;  1WSG A;  3VQQ A;  2HMI A;  1GOA A; 
#chains in the Genus database with same CATH topology
 1E3M A;  5J2Q A;  3S3M A;  1BDG A;  5J2M A;  4DV7 K;  4JKG B;  4O55 A;  1NK6 A;  3G0Z A;  1VQK N;  1X3N A;  1NKB A;  4GV6 A;  2F9T A;  2HW3 A;  1VRU A;  3MXJ A;  1IG8 A;  5KGX A;  5J2N A;  5EOY A;  3C95 A;  2X74 A;  3IFR A;  2WTU A;  3ALY A;  1S72 N;  3T1Y K;  4CZI A;  2RE2 A;  3DWL A;  2HHW A;  3P39 A;  3KLG A;  1R0A A;  3P1G A;  4CK2 A;  4R79 A;  1TKX A;  3M3Z A;  4KKO A;  4M3R A;  1VAZ A;  3A5N C;  1VSJ A;  3LM9 A;  4OKJ A;  1TYQ A;  2BDP A;  5JS1 A;  3ZET A;  3U3G A;  4M41 A;  4GKJ K;  4PL8 A;  1YVU A;  3OYI A;  2FF3 B;  2RKI A;  3DYA A;  4CHY A;  1DEJ A;  1U47 A;  4ILH A;  2QKB A;  4WQ5 C;  2QI2 A;  3OYE A;  3BGR A;  3AVF A;  3VA0 A;  1BUP A;  1XQS C;  5TKY A;  1Z6R A;  4EP5 A;  5HRN A;  3I8B A;  3KLH A;  1D9D A;  3MEE A;  1S1T A;  3V1O A;  5EX5 A;  4ISG A;  4FJN A;  1NOZ A;  2XY6 A;  1KXP A;  1RT4 A;  1C6V A;  2OZM A;  5AQT A;  3OA9 A;  2IC3 A;  5AZI B;  1UAX A;  1TL1 A;  1EWQ A;  3VA3 A;  5LL6 Z;  1I39 A;  2ASM A;  4FVM A;  5GIP A;  1EQY A;  1VQ9 N;  4BR9 A;  2CH5 A;  1RDW X;  2FBX A;  5AQF A;  1BGX T;  4B1V A;  5JIC A;  3LPU A;  2W41 A;  2HNZ A;  3ZSZ A;  4TSX A;  1JLB A;  3SMP A;  5FRO A;  5KGW A;  3QEP A;  2F8S A;  4CZJ A;  3HXM A;  1S1U A;  4H0P A;  5C15 A;  5I9E B;  3PX6 A;  3MED A;  4YDU C;  1RTI A;  2VGN A;  1N33 K;  3V9W A;  4F9O A;  3OYJ A;  4AHS A;  4OLB A;  5GAE P;  3OYD A;  1LAV A;  2QK9 A;  2G8K A;  3F9M A;  4DTP A;  1U48 A;  4KAZ A;  3LZI A;  4FOE A;  4M3W A;  3TI0 A;  3TAG A;  4B3M K;  1NJZ A;  3KKS A;  3RMA A;  3VQ8 A;  4YHH K;  2G8U A;  3CJB A;  2Q2R A;  1NGI A;  1VSE A;  1NGD A;  2QWM A;  4CFB A;  4DS4 A;  1T05 A;  4LD0 A;  2YKN A;  4GY2 B;  1KRP A;  4H0T B;  3AO3 A;  1BA1 A;  3KZB A;  1QVG M;  4DF8 A;  2VCP A;  3RVC A;  4N56 A;  2HHQ A;  3RTV A;  4BC2 A;  2E2N A;  3I56 N;  1U6Z A;  2GEL A;  4Z4C A;  4BR2 A;  4F2R A;  3VQD A;  3HBT A;  1A5W A;  3AAQ A;  5M1F A;  3CYM A;  4FZX C;  4RW6 A;  3V9Z A;  4H0Y B;  4HTL A;  1IKW A;  3ZX3 A;  1HNW K;  2O8F B;  4C8M A;  2HNY A;  3TSU A;  2P5G A;  3PSF A;  2CH6 A;  4K8X A;  5M1N A;  3DMJ A;  1QHT A;  3THY B;  1HNX K;  3EEQ A;  3DRR A;  2YJF A;  4BRD A;  3BUZ B;  3SJJ A;  5AQP A;  3AO5 A;  3CET A;  1VSH A;  1IO2 A;  1MWM A;  5AQL A;  4B9U A;  4CBW A;  2P9L A;  4YOY A;  2AA4 A;  1NBW A;  1B9F A;  4WQ4 A;  3MMV A;  2GWJ A;  2QWN A;  4DR6 K;  5J2P A;  4JYA K;  1JL2 A;  1JCF A;  4JI1 K;  2O8D A;  1SZ2 A;  2GUP A;  4CIF A;  1HNV A;  5HOO A;  1RGI A;  4IFV A;  1J53 A;  3SUP A;  4HUF A;  3VGL A;  3LPT A;  2O8B A;  3VEN A;  3K9J A;  4JHD B;  5CHI A;  5AFU H;  2G8V A;  5AQK A;  4IOA L;  1FXX A;  4BRE A;  4KTQ A;  3EYZ A;  3LDQ A;  4E7H A;  2YNG A;  3TAQ A;  4FZY A;  4FJI A;  2QKK A;  4Q5V A;  2OTJ N;  4AIL C;  2G8F A;  2AJQ A;  1N36 K;  4Z4H A;  3HL8 A;  3ZSX A;  5DM6 L;  4GVE A;  4J8F A;  2FLO A;  3QNO A;  1Q86 O;  4FYD A;  1TUY A;  2QEX N;  1JJ2 M;  1TKD A;  3CJC A;  4CD3 A;  3OYH A;  4FJ8 A;  3O9R A;  4IXC A;  4CJS A;  3QFU A;  4BRF A;  1GOB A;  3WEE A;  4K42 A;  1SKS A;  1HJO A;  4LF5 K;  1V4T A;  2GV9 A;  2VQF K;  5GAD P;  1NJY A;  4KHW A;  3D7E O;  3VES A;  1XUP O;  1J9A A;  4DSK A;  1QHA A;  4DSE A;  4RWT A;  3S3O A;  1XI1 A;  2QTD A;  3OYB A;  5BN9 A;  3J8A A;  1QZ5 A;  4I7F A;  4B9S A;  3ZT1 A;  3QB0 A;  2NRW A;  1S9E A;  3PIP L;  2QWP A;  4BR0 A;  3KWI A;  4DUY K;  3G6E N;  1L5U A;  1QVF M;  3LDP A;  5HBM A;  3LAL A;  1LV5 A;  3KKR A;  2E2O A;  3LDN A;  3L2W A;  1XHX A;  1H1V A;  1XNQ K;  4B9L A;  1Q81 O;  3SK3 A;  3HM8 A;  2PAV A;  3HYF A;  4BG9 A;  2X78 A;  3QES A;  2A6A A;  1I3A A;  4FWM A;  4J2A A;  2P9S A;  3ZSV A;  3E9L A;  3TWH A;  5EVZ A;  4PKI A;  4LF9 K;  1W0H A;  5ADX A;  1IBK K;  4IFY A;  3BY5 A;  4FM1 A;  4WQ5 A;  4PA1 A;  3CCU N;  1E4G T;  4IG3 A;  1RTH A;  4LSL A;  1SKW A;  3A5L C;  4DQ8 A;  4JI5 K;  4W5O A;  1C0F A;  3MX2 A;  3NF7 A;  1JLF A;  3VN5 A;  1Z26 A;  4FJJ A;  1BOT O;  5M1P A;  3THX A;  1VQN N;  3CCV N;  3CJ9 A;  3CJ1 A;  3M5R A;  3DXM B;  2X6S A;  3EO3 A;  4OKK A;  3OVN A;  2P1J A;  4BQL A;  4QS7 A;  3RWU A;  3NGY A;  3UKR B;  3D0P A;  1L3T A;  2NLX A;  2D0O A;  4DUZ K;  4YOT A;  3O9U A;  3CM5 A;  3NH2 A;  2BTF A;  4AHV A;  4JNE A;  3UE5 A;  1NLV A;  1FKO A;  1NM1 A;  3L6Q A;  3ISN C;  3MN5 A;  1CZ9 A;  4DWI A;  1FKP A;  1KAZ A;  4H5N A;  4XH1 A;  4KHQ A;  1SUQ A;  1K8K B;  2Z1H A;  4JI4 K;  3HZ6 A;  3VEV A;  4DG1 A;  2HST A;  3IKM A;  1HKC A;  3QER A;  4DMN A;  2Q0R A;  5FPE A;  3AV9 A;  1HYS A;  4DQI A;  4BQZ A;  3HK2 A;  3O9S A;  3H1V X;  4FWS A;  4JK8 A;  5DK5 A;  1P90 A;  3ENH A;  3RMC A;  5AQO A;  5C42 A;  4FLZ A;  1L3S A;  1NK4 A;  3VTH A;  4NYF A;  2GX9 A;  3B8A X;  4IZ9 A;  4EZ9 A;  4OGE A;  3I0R A;  3CER A;  2D0B A;  1MA9 B;  4HUG A;  2E1Z A;  3FZK A;  2QWO A;  5AQZ A;  3SQ1 A;  5BR9 A;  3NF6 A;  5GAG P;  2G8W A;  4JAX A;  3AVM A;  3KVG A;  1EET A;  1RT5 A;  2BUP A;  4DFM A;  2E2P A;  4JKH A;  3H1Q A;  4KH4 A;  2P9K B;  1MWK A;  2QWQ A;  3NGZ A;  3O4W A;  4I2P A;  4CK3 A;  1BIU A;  2PZS A;  3SBG A;  4LY7 A;  4ELV A;  4H5V A;  3A5O C;  2OZS A;  1NJI O;  3BZK A;  3QFP A;  4HHT A;  1QQC A;  2LSN A;  3SMS A;  3AO2 A;  4DU1 A;  5AQJ A;  5C2F A;  2OTL N;  1WSG A;  3U6F A;  3QIP A;  1YHQ N;  1TKZ A;  5K14 A;  4Z4I A;  4DTJ A;  5AQX A;  5JVH L;  3AGR A;  1HMV A;  4IJA A;  1IBM K;  5B8H A;  1TVR A;  2O4I A;  4CJE A;  3UKU B;  2UXD K;  1VHX A;  1WSI A;  3ZSO A;  4QCL A;  1RT1 A;  2H3G X;  5KPT A;  2F9W A;  4BGB A;  1HPZ A;  3VEW A;  3D2E A;  1FW6 A;  2WUS A;  3SUQ A;  3CCJ N;  4CJU A;  3NGI A;  4JS5 A;  4BRA A;  2IAJ A;  2ITG A;  1S5J A;  1T44 A;  4CK1 A;  3AGK A;  3VQ5 A;  2V7Y A;  2ITM A;  3JSM A;  1RBT A;  3LP2 A;  4JD2 A;  3DLG A;  3PUF A;  1OH6 A;  3CC2 N;  3IAY A;  4RTF D;  4M63 C;  4YOV A;  4DS5 A;  4C8N A;  5IWA K;  1U45 A;  3AVJ A;  4FWN A;  1NWK A;  1GLE G;  1SKR A;  3C6T A;  3DI6 A;  2NNW A;  4DR2 K;  1WUA A;  5J1E A;  2A41 A;  4FJH A;  4IG0 A;  4CEQ A;  2E4L A;  2IVO A;  4BR5 A;  2PY5 A;  4CJQ A;  4CF9 A;  1CXQ A;  5FPM A;  2NRV A;  1X3M A;  1VQM N;  2YV0 X;  4CI6 A;  1KFS A;  4BRM A;  1YJW N;  5DMR A;  5AQN A;  3AVG A;  2EHG A;  1S3X A;  1RT6 A;  2P9P A;  4KBO A;  2JWK A;  3K5L A;  3SQ0 A;  2BE2 A;  1BI4 B;  1GLJ O;  1IKY A;  2HB5 A;  2VYP A;  1XC9 A;  1EKE A;  4FJ9 A;  3HVT A;  2HF4 A;  4CEZ A;  3PO4 A;  2FXU A;  3C6U A;  2KZM A;  1TGO A;  2HHS A;  1X9M A;  5E41 A;  4KPY A;  3DLE A;  4FWQ A;  1KLN A;  1KVC A;  4O8K A;  2P9N A;  1ESV A;  5KI6 A;  4CZE A;  1RBS A;  4HCC A;  1FK9 A;  4RW8 A;  4BG8 A;  4MO4 A;  4FJX A;  3FZF A;  3PY8 A;  3C7N A;  3K5O A;  4WCE L;  4JV5 K;  3SBT A;  3ZT0 A;  4B3R K;  4B1Z A;  5BN8 A;  3KK1 A;  4AHR A;  1ILY A;  2I5J A;  4XH5 A;  3CIP A;  3O6W A;  1NJW A;  4NXN K;  3FLC O;  2ZGZ A;  1LWF A;  1NG9 A;  4W5N A;  3CCM N;  1JCE A;  1NNE A;  1HQU A;  3I8D A;  1TYQ B;  4FPB A;  3K58 A;  3ZET B;  3U4L A;  4CF0 A;  4DQR A;  4JI0 K;  3SPZ A;  2VWJ A;  4DFP A;  4ELT A;  4X62 K;  4JI6 K;  4O5B A;  2O8C A;  2ETJ A;  3R3L A;  4NYN A;  3L8B A;  3V81 A;  4FK0 A;  1EWR A;  5FLX O;  3MK6 A;  3WNF A;  1RT7 A;  4DB3 A;  2CGJ A;  3AY9 A;  3AA5 X;  1VQL N;  1WBD A;  4JRQ A;  3L2Q A;  1A5V A;  4FM0 A;  4FWO A;  4I6M A;  4X64 K;  1REV A;  4DTN A;  1TK5 A;  4CEF A;  3T69 A;  1NKC A;  3OHR A;  4BR4 A;  3O1B A;  3P83 D;  3ZEU A;  3CPE A;  1EXQ A;  1ZBI A;  2DY4 A;  2HBL A;  1TKT A;  3O4N A;  4GV9 A;  3VQP A;  2W42 A;  1VSD A;  4QS8 A;  4H8K A;  1BO5 O;  1VQ8 N;  4CJP A;  2Y1I A;  3F2K A;  1C1A A;  4BRH A;  2YHX A;  4JKG A;  1HLU A;  3AVB A;  3OBY A;  3WXL A;  4A59 A;  3QIO A;  4MFB A;  4A2A A;  3OS1 A;  4IKF A;  4V19 S;  3WQU A;  1LWC A;  3AO4 A;  4FW1 A;  5HP1 A;  4DV4 K;  2OYQ A;  1MDU B;  4DQQ A;  4B9T A;  2OAN A;  1T6C A;  2RPI A;  3HST B;  5AQY A;  2E20 A;  4FJM A;  4YOR A;  5M1O A;  2ZJR L;  3LL3 A;  4BWM A;  1XHZ A;  4Z0U A;  3VQB A;  2X6N A;  4AHT A;  3TAM A;  3K5N A;  4HTU A;  1Q7Y O;  3DLB A;  5FRM A;  1D9F A;  4KHN A;  4GV3 A;  1NK5 A;  3VF4 A;  1YVN A;  4CGH A;  4M45 A;  5HRO A;  1WAJ A;  1OKJ A;  5FPN A;  1X9W A;  2QA4 N;  3K5M A;  2BH1 A;  5AJ3 K;  4CGF A;  3QIN A;  1T3V A;  4W5Q A;  4H5R A;  4FWL A;  3CC7 N;  5LMU K;  4ILJ A;  3QEX A;  2R7Y A;  3DXK A;  3O3F A;  1RBV A;  2V51 B;  4FLX A;  1SL1 A;  4CIG A;  3KTQ A;  3RR7 A;  3LAK A;  3DLR A;  4DSL A;  1N5Y A;  4DR7 K;  3ZYY X;  3FZH A;  5F1X A;  1W9H A;  4U7B A;  5KQD A;  1WB9 A;  4CES A;  2XRI A;  3SQ2 A;  3PLA A;  1XMQ K;  1L3U A;  3AVN A;  2V52 B;  2ZWH A;  4IBN A;  2ASP A;  5HRP A;  3O5B A;  1GLL O;  3J80 O;  3HSC A;  1HX1 A;  1U2V A;  2CGL A;  3FGU A;  4EHU A;  4J2D A;  3TU5 A;  4F3O A;  3HI0 A;  4PY5 A;  3CPW M;  3PX4 A;  3MEC A;  2P9L B;  1IH7 A;  1KD1 O;  3LZJ A;  1M90 O;  4O4G A;  3VEO A;  4BVO A;  4RW9 A;  5AQG A;  3V9U A;  4M3U A;  4EZ6 A;  4YFU A;  5AQM A;  4JKB A;  1Z25 A;  3QML A;  4FWR A;  3QLH A;  4MO5 A;  1SAZ A;  1RT3 A;  2Z1J A;  4JK9 A;  4CIE A;  5KQ8 A;  4YOX A;  4JN4 A;  2FSN A;  4AH9 A;  1NGB A;  1K8A O;  2ZQB A;  3SAH A;  1KVA A;  4FZZ A;  5JS2 A;  5CE3 A;  4B3O A;  3K2P A;  3EY1 A;  1NGA A;  4GW6 A;  3ZSQ A;  4DU4 A;  4JKF A;  3QET A;  1BG3 A;  2FSK A;  4MLH A;  5CZ1 A;  3R9P A;  3K57 A;  3CFP A;  3TAR A;  1JL1 A;  3HVR A;  3O80 A;  1B92 A;  3CMA N;  1DGK N;  2A5X A;  3WEE B;  1TK0 A;  4H0X B;  4ID5 A;  3LDL A;  3ULE A;  4IWV A;  5FPD A;  1X9S A;  5AR0 A;  1QTM A;  4JI8 K;  5EU7 A;  2VWK A;  3ID8 A;  3UB5 A;  4BRC A;  1ATN A;  2FBT A;  2KKZ A;  4X65 K;  1Q9X A;  4ID1 A;  1D5A A;  4NCG A;  1GLB G;  3FR0 A;  4CZG A;  4CJF A;  3KLI A;  4Z4E A;  1S9G A;  1JLQ A;  1YTA A;  1EP4 A;  3RSE A;  1U4B A;  3JYT A;  3BEX A;  4B9V A;  3D2F B;  3OBW A;  3CCS N;  3I0S A;  3TR8 A;  2PYJ A;  2WOM A;  2QM1 A;  2BAN A;  3DLH A;  5JLF A;  4W5R A;  3MWP A;  1HQE A;  4BE0 A;  3M8Q A;  4DR1 K;  5I3U A;  4CJV A;  4DTU A;  3AA3 A;  4A61 A;  4LH4 A;  4FSV A;  3V1Q A;  3HOS A;  3QO9 A;  4ZTF A;  1T6D A;  3L2V A;  3G25 A;  4Q0B A;  4KHU A;  3AVL A;  1NK8 A;  3H6E A;  3LP0 A;  4OJR A;  3JAM O;  1N32 K;  4CHN A;  1ZBF A;  3QEI A;  3T1A A;  4NCA A;  4JKA A;  1O13 A;  1RBU A;  4BDY A;  4PKG A;  3T3F A;  4BE1 A;  3SJH A;  1ZBS A;  3L3V A;  3F9K A;  5C10 A;  4W5T A;  3THX B;  3TAP A;  1J5E K;  4JLH A;  3DAW A;  2VG5 A;  4IJN A;  4B1Y B;  4O5F A;  2HMI A;  1GOA A;  1RNH A;  1TL3 A;  3TTF A;  4H5W A;  5CYM A;  5M1K A;  1CZB A;  3CME N;  5A2Q O;  4DFK A;  3SPY A;  3THW A;  4BRG A;  3P4I A;  3HP9 A;  2ZJQ L;  2J4R A;  3IUC A;  3EZW A;  1RDU A;  3MWT A;  1LCU A;  5M1Q A;  4N47 A;  4CEB A;  3KHY A;  3D45 A;  2W6K A;  2O8E A;  2G8H A;  2E1Y A;  4BGA A;  4CGJ A;  2UUA K;  3KK7 A;  4AQY K;  1NGH A;  3SQ4 A;  2OPR A;  3ID6 A;  1LOT B;  2YJE A;  3NDK A;  4IEE A;  3NH0 A;  1DTT A;  2YHB A;  5HL7 L;  2PBD A;  3C94 A;  3J7Y P;  3CJA A;  2VQE K;  4BY9 C;  4K41 A;  4IFE A;  2VGM A;  2NRH A;  2A1R A;  1ZC6 A;  1DKG D;  1XMO K;  4BDZ A;  3BF1 A;  1ZBU A;  2E88 A;  1RDB A;  1NU0 A;  5BRF A;  4CER A;  1WAF A;  1IKX A;  3IG1 A;  4BDP A;  2ZF5 O;  3BF3 A;  4YDU A;  1M1K O;  4DU3 A;  3M8P A;  4WF9 L;  3KLE A;  3V1R A;  4BRO A;  3R8E A;  2QWL A;  4WYB A;  2NRZ A;  3OYK A;  5AQW A;  4MLE A;  2HHV A;  1N8R O;  3SUN A;  2D0A A;  4DTM A;  4E89 A;  3I55 N;  3Q7B A;  3K0S A;  4KFB A;  1KAX A;  4B9M A;  4FOI A;  3HPO A;  3DXM A;  4LFA K;  1T7P A;  2F7T A;  4IDK A;  4GNI A;  4RG8 A;  4CGD A;  4A2B A;  3UKR A;  2KQ2 A;  3LAN A;  5LJW A;  2XY8 A;  1KFD A;  3K59 A;  3VGK A;  3OYM A;  4DQP A;  4PKH A;  4M7X A;  2V7Z A;  4CJL A;  4ZHR A;  1ATS A;  3K9K A;  3NCI A;  5AFU A;  1BQN A;  4DV2 K;  3MXM A;  4OPH A;  1QQO A;  1HJR A;  3CQ8 A;  4H0V B;  3Q7C A;  4K8Z A;  1HRH A;  2HMP A;  5AQI A;  4FK4 A;  4IDH A;  4M7Y A;  1OH5 A;  3VF6 A;  3HP6 A;  3D2E B;  3F5T A;  1K8K A;  1O1W A;  3AAR A;  2NZT A;  3L4I A;  3LDO A;  4LF8 K;  2DTU A;  4J2E A;  4E7I A;  2DFH A;  4CEE A;  3F73 A;  1JXE A;  4NLB A;  4IOC L;  4DV3 K;  4Z4F A;  1ASV A;  1HPM A;  2Q31 A;  4JD2 B;  3MX5 A;  1LAW A;  2E6M A;  1JKH A;  1G15 A;  1OH7 A;  1FJG K;  1C0G A;  5GIN A;  4XH4 A;  3OW2 M;  5AQR A;  2HBJ A;  3ZT3 A;  1SQK A;  3GDQ A;  3M8S A;  3CG7 A;  3NFA A;  1RCH A;  5T7B A;  1C1C A;  1RBR A;  5ELZ A;  2HOE A;  3HPH A;  2VG6 A;  2YHY A;  1ZBL A;  4X66 K;  5KRS A;  1YAG A;  1HKB A;  2OA8 A;  4DV6 K;  3CFR A;  3FZM A;  3NF9 A;  4K43 A;  4XIU A;  4DSI A;  5MLC Q;  3HTV A;  3OYL A;  2F96 A;  2GTD A;  3OYG A;  4JS4 A;  1B9D A;  1VQ5 N;  1JXB A;  2I7N A;  3B6P A;  3CFO A;  4CFD A;  2P9P B;  2JGU A;  5E84 A;  5AQU A;  2WON A;  3CJ7 A;  4HUE A;  4OGC A;  4FVU A;  1QSS A;  3M1F A;  2QWR A;  3O08 A;  2P5O A;  1SV5 A;  5KPR A;  5CYQ A;  4M3T A;  1ZBH A;  4N76 A;  2GEM A;  4KH5 A;  4CEO A;  1NK9 A;  3ZSR A;  3AVH A;  3RMB A;  1QSY A;  3DOL A;  3KLF A;  1GLC G;  2A42 A;  1S1W A;  3A2F A;  3CCE N;  3C7N B;  3C0B A;  5C0Y A;  4WFB L;  2UXC K;  1BWF O;  5CY4 A;  4CJ4 A;  2AP1 A;  2YHA A;  5JVG L;  1KQS M;  4CJW A;  3WXK A;  4CEA A;  4OX9 K;  5KRT A;  5D3G A;  1XNR K;  4BVP A;  5C25 A;  4F2S A;  1HYZ A;  2RN2 A;  4FWP A;  3ATV A;  1KTQ A;  2WC9 A;  2HVH A;  2XY7 A;  4F4K A;  4KV8 A;  2A40 A;  4FLY A;  5GIO A;  3AAP A;  3LP1 A;  1WSF A;  3H3N O;  4E7L A;  3EKS A;  2YNI A;  3G71 N;  2HHX A;  2O8C B;  1X1P A;  4L8R B;  3S3N A;  1BA0 A;  3T1H K;  3MDQ A;  1K73 O;  1JLE A;  1YJ9 N;  4RW7 A;  3M6G A;  3CF5 L;  2EWS A;  2GWK A;  2IOC A;  3TSP A;  1NGC A;  3TSQ A;  3HM9 A;  1KVB A;  5CZ2 A;  2FBY A;  2NUB A;  3D6R A;  1LWE A;  3NE6 A;  2PYL A;  4I6M B;  2IS3 A;  2P9U A;  5F0X A;  3ZX2 A;  3CXC M;  4CZH A;  5AQH A;  2B4J A;  3ZEU B;  3SAF A;  4OPJ A;  2HBM A;  4LC9 B;  3NVK A;  3VQ4 A;  4HVJ A;  4FW2 A;  3FFK B;  4PUO A;  3MN6 A;  4M3X A;  3SV3 A;  4EAH D;  1CZA N;  3TTC A;  2KLA A;  4A5A A;  2KZZ A;  5JLH A;  4NCB A;  2QXF A;  3KIO A;  2B5J A;  4CZM A;  3PIO L;  3OS0 A;  3HPG A;  1N6Q A;  1NKE A;  5JMV A;  1KLM A;  3O3H A;  4C8O A;  4FO0 A;  3DLL L;  1V4S A;  4E7J A;  4OPA A;  2D4W A;  2YX6 A;  4NXM K;  4KB0 A;  2A1S A;  1D8Y A;  1GOC A;  3TAF A;  1S6Q A;  4FL9 A;  5GAH P;  1UA0 A;  3QBW A;  3WNG A;  4B8A B;  4LF7 K;  1NK0 A;  4FWK A;  5AZJ A;  3NMU A;  4CJT A;  1Q82 O;  3SCX A;  1L3V A;  2P9I A;  4AF1 A;  4G1Q A;  3DLK A;  3PSI A;  5LJV A;  3AVK A;  3ITH A;  1J6Z A;  3NH1 A;  3PX0 A;  4DTX A;  2VG7 A;  4DR4 K;  4E1N A;  2HBK A;  3TTD A;  4CF8 A;  2IIR A;  2Z1G A;  5EY4 A;  3E9P A;  3WT0 A;  4CFC A;  2F4V K;  2B6A A;  3T19 A;  4C23 A;  4WFN L;  3BP8 A;  2DFE A;  4KO0 A;  4CF2 A;  3SUO A;  3VQC A;  3AA4 A;  4M3Z A;  4I2Q A;  3S41 A;  4KTZ A;  3DXK B;  5E26 A;  5EXW A;  4CVN E;  1TK8 A;  1ASW A;  3OY9 A;  4JI7 K;  5BRD A;  3RRG A;  1MU2 A;  4H4M A;  4CF1 A;  3P5J A;  4CHQ A;  2D0C A;  5BR8 K;  3H3O B;  3ULD A;  1S1V A;  5SWM A;  1TUU A;  4BWJ A;  3GBT A;  3J81 O;  3JS6 A;  4AHU A;  3PV8 A;  4PWD A;  3L3U A;  3E66 A;  4CEC A;  3VEZ A;  1WLJ A;  3EL2 A;  3U9D A;  1NOY A;  1IG9 A;  2FC0 A;  4OVL A;  4BRL A;  4EFH A;  1LW2 A;  2FF6 A;  4EP4 A;  1GLD G;  3OJS A;  4FJG A;  3T7Z A;  3LP3 A;  1SL0 A;  2IGI A;  2CGK A;  4PQU A;  2QW9 A;  4O0J A;  1U2V B;  4Z94 A;  3GL1 A;  3NVM A;  3VF2 A;  1BQM A;  2OPQ A;  2ASO A;  5AZI A;  1RDC A;  1TV6 A;  3KD5 E;  5ADX H;  3J7A P;  4DKW A;  1WSH A;  4JI3 K;  2YKM A;  2VWB A;  3HO1 A;  3SAG A;  2D0P A;  3G4S N;  3CCL N;  4BAC A;  3BDP A;  3L2U A;  2W40 A;  3JXU A;  4N41 A;  4B3S K;  4B3T K;  3THV A;  5KPZ A;  5C2D A;  1BIS A;  1WBB A;  2KW4 A;  4JKC A;  4JRP A;  4MQ3 A;  2FBV A;  4CHO A;  1IKV A;  1QQM A;  1RT2 A;  1SL2 A;  3VQQ A;  3E1Y A;  3NF8 A;  1UOC A;  1Q18 A;  1C0U A;  3CHW A;  3CI5 A;  3EE9 A;  1RDA A;  2XY5 A;  3KD1 E;  3QBX A;  3DM2 A;  4BC5 A;  4DFJ A;  2UUC K;  1WN7 A;  1T03 A;  2F8T A;  2O8D B;  3LWM A;  2Z1I A;  1Q8I A;  2O8B B;  3H08 A;  3ULE B;  3ZLJ A;  4E1J A;  1U49 A;  1D4X A;  3WNH A;  3SLC A;  4FJL A;  1S1X A;  3HJF A;  1G99 A;  4J2B A;  1OH8 A;  3LWL A;  3FFI A;  2YNH A;  5AQV A;  3VQE A;  4C8L A;  1JLA A;  4A57 A;  3HOT A;  3ASM A;  4DR3 K;  3RSE B;  2IVP A;  4LH5 A;  2G8I A;  4OPK A;  4CZK A;  4DSF A;  4A62 A;  3VOV A;  4U67 L;  1KC8 O;  1IBL K;  4KI6 A;  2HHT A;  3H46 O;  1RFQ A;  5BPM A;  3L0Q A;  1YIT N;  1YUW A;  1NGE A;  2Q0U A;  1F21 A;  1YF5 L;  4BE2 A;  4F8R A;  4B1U B;  1KAY A;  1TAU A;  5C24 A;  4DV1 K;  4BC4 A;  4CBU A;  3J7Z O;  2O8F A;  2UXB K;  1C0M A;  1W97 L;  1EX4 A;  4G9Z A;  4E19 A;  1ASU A;  5KTQ A;  1T8E A;  3GOI A;  1UWB A;  3THY A;  4KHS A;  4KHP K;  1Q9Y A;  2NRR A;  2NRX A;  4GVM A;  3VQ9 A;  3V4I A;  4FXD A;  3TAN A;  1VQ4 N;  4ELU A;  1NGJ A;  2UU9 K;  3UIQ A;  4KH6 A;  4BRN A;  1P8Z A;  3KWG A;  1GLF O;  1BU6 O;  2ATQ A;  2NRT A;  4CFA A;  3E01 A;  3NAE A;  3TAB A;  2IDO A;  4MDA A;  2I7P A;  2WFB A;  1BIZ A;  1C0T A;  3G10 A;  3MCP A;  1VK0 A;  4XEI A;  2P9S B;  4QS9 A;  4CED A;  3O3G A;  3QEW A;  4M42 A;  4BRP A;  1HNZ K;  3I33 A;  4LF4 K;  4DLG A;  1WNS A;  3CM6 A;  4I9Q A;  5AQS A;  3CQX A;  4FLU A;  4M3Y A;  1GLA G;  4JHD A;  4CJ3 A;  3O4Q A;  1W7A A;  3OJU A;  3THW B;  4DLE A;  5BPN A;  3V6D A;  3WUH A;  4JK7 A;  4A5B A;  1OVQ A;  2ZGY A;  3M8R A;  4E1M A;  3TPQ A;  4LFC K;  2YI1 A;  4WE1 A;  1YXQ A;  3V9X A;  4F3T A;  4ISE A;  4QAG A;  3ENB A;  3QIC A;  3W0L A;  4B8C A;  2O8E B;  3PO5 A;  4FJ5 A;  3BZC A;  1J54 A;  4JKD A;  4GMJ B;  1NGG A;  1QZ6 A;  4B9N A;  3C6A A;  4OO1 J;  3D2F A;  1YJN N;  2JWL A;  3ZT2 A;  1BCM A;  5IT9 O;  4DSJ A;  5CR4 A;  4DR5 K;  3MN9 A;  3CCQ N;  3SYZ A;  4AM6 A;  3WNE A;  4FLT A;  1HR0 K;  3KJV A;  3EKU A;  4CGG A;  4LFB K;  3OYN A;  1JLG A;  1WSJ A;  4DCH A;  4CE9 A;  4BC3 A;  5BPL A;  2UUB K;  3FE1 A;  4PHT X;  1ATR A;  3VQ6 A;  5H1S Q;  1YT3 A;  2A3Z A;  4H0O A;  4NB4 A;  4H4O A;  1TAQ A;  4ILG B;  4CHZ A;  4CBX A;  1OVY A;  4HCB A;  2D5R A;  1RDD A;  4RW4 A;  3V9S A;  3SI6 A;  1Y97 A;  1NJX A;  3O8M A;  1VRT A;  3L2R A;  3MXI A;  1KCF A;  4ICL A;  3MAQ A;  3AVA A;  4JEP A;  3S9H A;  4UY8 O;  4KRE A;  1WOQ A;  1QE1 A;  4C1N I;  4OKE A;  3VQ7 A;  3VTI A;  4EIA A;  2ZM6 K;  3VEX A;  3QEV A;  2RHK A;  2BGG A;  3E9O A;  1IJJ A;  2YCH A;  2YNF A;  1XC3 A;  3LDS A;  3OYF A;  1VSF A;  2JLE A;  3P31 A;  1R59 O;  1W2B M;  3LM2 A;  1BHL A;  1Z05 A;  4O0I A;  3OTO K;  3VEY A;  3C65 A;  4CJR A;  3MEG A;  4GKK K;  4WFA L;  1RIL A;  3OYC A;  4YY3 K;  2OPP A;  2ZE2 A;  4N5S A;  5HLF A;  2E5L K;  1QS4 A;  2KTQ A;  1VQP N;  4B9Q A;  4R5P A;  4CZL A;  1VSM A;  4IEI A;  3GG4 A;  4FLV A;  4K0K K;  1EO1 A;  4C8K A;  1KSP A;  4YNQ A;  3A0I X;  2Q36 A;  3NHG A;  2RF2 A;  3O9Q A;  4DTS A;  1VSI A;  5DM7 L;  3OS2 A;  3H45 C;  3RRH A;  2OCE A;  2GUI A;  4Z4G A;  2EX3 A;  3A5M C;  4KI4 A;  3N4Q A;  1HKG A;  4EHT A;  4E0D A;  1SS6 A;  4L3Q A;  3VMF B;  4FK2 A;  4B1W B;  3KK2 A;  1NK7 A;  1NGF A;  3P38 A;  3WXI A;  3IRX A;  4YOU A;  3ZCM A;  1DTQ A;  3C6H A;  4CD1 A;  3O9T A;  3NBP A;  2WBN A;  3ZSW A;  5LY3 A;  4NLC A;  1JCG A;  4Y1D A;  1DT9 A;  4YOW A;  2HND A;  2KFN A;  2HVI A;  5I42 A;  4B1X B;  4BR7 A;  4JI2 K;  2Q3S A;  4FPA A;  1E4F T;  3VER A;  3IDH A;  4LSN A;  5FDL A;  3LAM A;  2GBZ A;  4HWI A;  1BL3 A;  3MN7 A;  1RTJ A;  4H03 B;  3ZX0 A;  4JKE A;  5LMN K;  3EZ5 A;  3CCR N;  2PFU A;  5C12 A;  3FZL A;  4BRK A;  3DRP A;  3HRG A;  2ZD1 A;  4DTR A;  3RMD A;  3AO1 A;  3N4P A;  3VET A;  2P51 A;  1HNI A;  1A5X A;  2KHO A;  3QNN A;  4BRI A;  4CW7 B;  1UA1 A;  4O8U A;  1VQ6 N;  3L4Q A;  1K9M O;  3SZ2 A;  1RTD A;  1YI2 N;  4CJK A;  3OYA A;  3DRS A;  3MCA B;  1WSE A;  3IMX A;  2P9K A;  3CQY A;  2HHU A;  3QDK A;  4BRQ A;  1JLC A;  4IOX A;  3TAE A;  1K6Y A;  4KRF A;  4E3S A;  3U8X A;  2ZJP L;  1N34 K;  4FJ7 A;  1X9J A;  4DF4 A;  4IO9 L;  4ZTJ A;  3ZSY A;  4DV5 K;  2Y1J A;  2DPN A;  4OLA A;  3WXJ A;  3A8Y A;  4DQS A;  1Y64 A;  1IV0 A;  4K25 A;  4KHY A;  1C1B A;  5HRS A;  3AVC A;  1HUX A;  4B08 A;  1ZXO A;  3ZT4 A;  1I94 K;  3UKU A;  3CD6 N;  4MDB A;  2QXL A;  1ZYQ A;  3O1W A;  1NMD A;  3EE8 A;  3AA2 A;  3DOK A;  4DTO A;  3DJC A;  1VQ7 N;  2XHB A;  1BCO A;  3ATU A;  1CLQ A;  5FRN A;  4NO7 A;  2P9N B;  4DHY A;  5BRH A;  2XO7 A;  1VSK A;  3HT3 A;  4LF6 K;  3IS9 A;  4FJK A;  4C1N K;  4CGI A;  5BRE A;  3R1X A;  2HF3 A;  3SNN A;  2FSJ A;  4CJ5 A;  2KFZ A;  4O44 A;  4Y1C A;  1VSL A;  4KTW A;  4QOZ B;  3RR8 A;  3VQA A;  4PL7 A;  4WQ4 C;  2P9U B;  5F2R A;  2Q1N A;  4ISF A;  3VGM A;  1LW0 A;  4CZF A;  4CCH A;  3B6O A;  2HHH K;  1U04 A;  1VQO N;  3GE1 A;  4Y0W A;  1YTU A;  3VPZ A;  2E6L A;  4UQG A;  1HYV A;  1QQN A;  1QSL A;  2UYT A;  1S22 A;  2E2Q A;  4H5T A;  4FM2 A;  2YHW A;  4CHP A;  2E8A A;  2O4G A;  3CC4 N;  2DFF A;  3WXM B;  1J5O A;  2W6L A;  1CXU A;  4AM7 A;  3KK3 A;  3U3Y A;  3AVI A;  5HRR A;  3W3D A;  4KB1 A;  2D1K A;  1DLO A;  4E7K A;  4IO8 A;  3U9Z A;  3SV4 A;  1BI4 A;  5AQQ A;  5TKW A;  1ITG A;  5SZT A;  1S6P A;  2OPS A;  3EN9 A;  4FLW A;  4I9L A;  4AHC A;  2IVN A;  3ENO A;  5AZJ B;  3R6M A;  3WQT A;  4RCH A;  1NMN A;  4FCY A;  1XWL A;  2P9I B;  2Q97 A;  4DV0 K;  4CJ7 A;  1YIJ N; 
#chains in the Genus database with same CATH homology
 3NF8 A;  1UOC A;  1RNH A;  1TKZ A;  1C0U A;  3QIP A;  5K14 A;  1TL3 A;  5J2Q A;  3U6F A;  3S3M A;  5J2M A;  4Z4I A;  5CYM A;  4DTJ A;  1CZB A;  1RDA A;  4JS4 A;  4O55 A;  2XY5 A;  1NK6 A;  3KD1 E;  1HMV A;  3G0Z A;  4DFK A;  3DM2 A;  3SPY A;  1TVR A;  4DFJ A;  4CJE A;  2O4I A;  1WN7 A;  3HP9 A;  1NKB A;  1T03 A;  2F8T A;  2HW3 A;  1VRU A;  1WSI A;  3MXJ A;  2Z1I A;  3ZSO A;  1RT1 A;  5KGX A;  3LWM A;  3C95 A;  2X74 A;  5J2N A;  1Q8I A;  3ALY A;  3H08 A;  4N47 A;  4CEB A;  1HPZ A;  3D45 A;  1U49 A;  3SUQ A;  2G8H A;  2HHW A;  4CGJ A;  4CJU A;  3NGI A;  4JS5 A;  3SQ4 A;  2OPR A;  3WNH A;  2IAJ A;  4FJL A;  3NDK A;  3NH0 A;  2ITG A;  1DTT A;  1S1X A;  1S5J A;  3KLG A;  1R0A A;  3P1G A;  4CK1 A;  4J2B A;  2YHB A;  4CK2 A;  1TKX A;  4KKO A;  4M3R A;  3VQ5 A;  3LWL A;  1VSJ A;  3FFI A;  3JSM A;  4OKJ A;  3C94 A;  2YNH A;  1RBT A;  3LP2 A;  3VQE A;  2BDP A;  4C8L A;  1JLA A;  3U3G A;  4M41 A;  5JS1 A;  3ASM A;  3DLG A;  3PUF A;  2G8I A;  4LH5 A;  2A1R A;  1YVU A;  4OPK A;  3OYI A;  3IAY A;  4DSF A;  2RKI A;  3DYA A;  4CHY A;  4BDZ A;  1U47 A;  2QKB A;  4DS5 A;  4C8N A;  4KI6 A;  3OYE A;  1U45 A;  2HHT A;  3BGR A;  3AVJ A;  1ZBU A;  3AVF A;  3VA0 A;  1SKR A;  3C6T A;  3DI6 A;  1F21 A;  1RDB A;  4F8R A;  4BE2 A;  4EP5 A;  5HRN A;  3KLH A;  4CER A;  1D9D A;  3MEE A;  1S1T A;  1WAF A;  3V1O A;  1TAU A;  1IKX A;  3IG1 A;  4FJN A;  1NOZ A;  5C24 A;  5J1E A;  4BDP A;  2XY6 A;  4FJH A;  1RT4 A;  4DU3 A;  3M8P A;  4IG0 A;  1C6V A;  2OZM A;  4CEQ A;  3KLE A;  2E4L A;  4FJG A;  3V1R A;  2IC3 A;  1C0M A;  2PY5 A;  1UAX A;  4CJQ A;  1TL1 A;  4CF9 A;  1EX4 A;  1CXQ A;  3OYK A;  3VA3 A;  4E19 A;  1ASU A;  5KTQ A;  1I39 A;  2YV0 X;  1KFS A;  1T8E A;  2HHV A;  4FVM A;  5DMR A;  3SUN A;  3AVG A;  1UWB A;  2EHG A;  4KHS A;  1RT6 A;  2D0A A;  2FBX A;  4DTM A;  4E89 A;  3K5L A;  1Q9Y A;  1BGX T;  4KFB A;  4GVM A;  3VQ9 A;  3V4I A;  3SQ0 A;  3LPU A;  4FXD A;  3TAN A;  2HNZ A;  4ELU A;  2BE2 A;  3UIQ A;  1BI4 B;  1IKY A;  2HB5 A;  1XC9 A;  4B9M A;  3HPO A;  3ZSZ A;  1EKE A;  4TSX A;  1JLB A;  4FJ9 A;  5FRO A;  5KGW A;  3QEP A;  1T7P A;  3HVT A;  2ATQ A;  4CFA A;  2F8S A;  4CEZ A;  3E01 A;  4IDK A;  3NAE A;  3TAB A;  4RG8 A;  2IDO A;  3PO4 A;  3HXM A;  1BIZ A;  1C0T A;  1S1U A;  3G10 A;  1VK0 A;  4CGD A;  3O3G A;  2KQ2 A;  4CED A;  3QEW A;  4M42 A;  3PX6 A;  3LAN A;  3C6U A;  3MED A;  1TGO A;  2KZM A;  2HHS A;  4DLG A;  2XY8 A;  1RTI A;  1KFD A;  1WNS A;  3CM6 A;  3K59 A;  3OYM A;  1X9M A;  4DQP A;  3V9W A;  5E41 A;  4I9Q A;  4KPY A;  3DLE A;  3OYJ A;  4FLU A;  4AHS A;  4M3Y A;  4CJL A;  1KVC A;  1KLN A;  4CJ3 A;  3O4Q A;  4ZHR A;  4OLB A;  3OJU A;  3NCI A;  3OYD A;  4DLE A;  3V6D A;  5KI6 A;  4HCC A;  1RBS A;  1FK9 A;  1BQN A;  1LAV A;  3MXM A;  4RW8 A;  1HJR A;  3M8R A;  2QK9 A;  3CQ8 A;  4FJX A;  4E1M A;  2G8K A;  1HRH A;  4K8Z A;  4DTP A;  1U48 A;  3PY8 A;  4KAZ A;  3K5O A;  4FK4 A;  4WE1 A;  3LZI A;  3ZT0 A;  3V9X A;  4M3W A;  3TI0 A;  3TAG A;  3KK1 A;  4F3T A;  4QAG A;  3HP6 A;  4AHR A;  4B8C A;  2I5J A;  1NJZ A;  3PO5 A;  3HJF A;  4FJ5 A;  3KKS A;  1NJW A;  1J54 A;  1O1W A;  3RMA A;  4GMJ B;  3VQ8 A;  2G8U A;  1LWF A;  4B9N A;  4W5N A;  2DTU A;  1VSE A;  4J2E A;  4CFB A;  4E7I A;  1HQU A;  3I8D A;  2DFH A;  4DS4 A;  4CEE A;  3ZT2 A;  1JXE A;  4LD0 A;  1BCM A;  3K58 A;  2YKN A;  3F73 A;  4CF0 A;  4DQR A;  4DSJ A;  4Z4F A;  1KRP A;  1ASV A;  3SPZ A;  3SYZ A;  2OYQ A;  2VWJ A;  3AO3 A;  4DFP A;  1LAW A;  3WNE A;  4FLT A;  4ELT A;  3KJV A;  2E6M A;  1JKH A;  1G15 A;  4DF8 A;  4CGG A;  3OYN A;  4O5B A;  1JLG A;  1WSJ A;  4N56 A;  2HHQ A;  2ETJ A;  4CE9 A;  4NYN A;  3L8B A;  3RTV A;  3V81 A;  3ZT3 A;  4FK0 A;  3M8S A;  3CG7 A;  3NFA A;  4Z4C A;  3WNF A;  3VQD A;  1RCH A;  4F2R A;  5T7B A;  1C1C A;  1A5W A;  1RT7 A;  1RBR A;  3VQ6 A;  3HPH A;  2VG6 A;  3AA5 X;  1YT3 A;  3CYM A;  4FZX C;  4RW6 A;  3V9Z A;  1ZBL A;  4JRQ A;  5KRS A;  4H4O A;  1TAQ A;  4CHZ A;  1A5V A;  3L2Q A;  4FM0 A;  4HCB A;  1IKW A;  2D5R A;  1REV A;  4DTN A;  1TK5 A;  4CEF A;  2OA8 A;  1RDD A;  4RW4 A;  4C8M A;  3CFR A;  2HNY A;  1NKC A;  3V9S A;  3NF9 A;  3P83 D;  3SI6 A;  4XIU A;  1Y97 A;  1NJX A;  2P5G A;  4DSI A;  3OYL A;  1VRT A;  2F96 A;  3L2R A;  4K8X A;  3MXI A;  1EXQ A;  1KCF A;  3OYG A;  4ICL A;  1B9D A;  3MAQ A;  3B6P A;  1JXB A;  3AVA A;  3DMJ A;  1QHT A;  3CFO A;  1ZBI A;  4CFD A;  1TKT A;  3O4N A;  3S9H A;  2DY4 A;  3VQP A;  2W42 A;  4KRE A;  2JGU A;  1VSD A;  4H8K A;  1QE1 A;  4OKE A;  3VQ7 A;  3DRR A;  2WON A;  4CJP A;  2Y1I A;  3SJJ A;  4HUE A;  4OGC A;  3QEV A;  1C1A A;  3AO5 A;  1VSH A;  1IO2 A;  2BGG A;  4B9U A;  1QSS A;  2YNF A;  1B9F A;  3LDS A;  2P5O A;  3OYF A;  1SV5 A;  3AVB A;  1VSF A;  2JLE A;  3QIO A;  4MFB A;  5CYQ A;  4M3T A;  5J2P A;  3OS1 A;  1JL2 A;  4IKF A;  1ZBH A;  4CIF A;  4N76 A;  1HNV A;  4IFV A;  1BHL A;  4O0I A;  1J53 A;  4CEO A;  4HUF A;  3SUP A;  1LWC A;  3LPT A;  1NK9 A;  3ZSR A;  3AVH A;  3RMB A;  3AO4 A;  1QSY A;  2G8V A;  4CJR A;  4FW1 A;  3DOL A;  3MEG A;  3KLF A;  1FXX A;  4KTQ A;  1RIL A;  3OYC A;  3EYZ A;  5HP1 A;  1S1W A;  3A2F A;  2YNG A;  2OPP A;  2ZE2 A;  4N5S A;  4E7H A;  4Q5V A;  4DQQ A;  4AIL C;  3TAQ A;  2RPI A;  1QS4 A;  3HST B;  5HLF A;  2G8F A;  4B9T A;  2KTQ A;  2AJQ A;  4R5P A;  1VSM A;  4Z4H A;  4FJM A;  3HL8 A;  4FLV A;  4BWM A;  1XHZ A;  4Z0U A;  3ZSX A;  5CY4 A;  4CJ4 A;  3VQB A;  3QNO A;  2X6N A;  4AHT A;  2YHA A;  4C8K A;  1KSP A;  4FYD A;  3TAM A;  4YNQ A;  3K5N A;  4HTU A;  4CJW A;  3DLB A;  1TKD A;  4CEA A;  3OYH A;  5FRM A;  1D9F A;  4KHN A;  4FJ8 A;  3NHG A;  1NK5 A;  2RF2 A;  5KRT A;  4DTS A;  1VSI A;  4FZY A;  5D3G A;  4CJS A;  5C25 A;  4F2S A;  1GOB A;  3OS2 A;  1HYZ A;  4CGH A;  4M45 A;  5HRO A;  1WAJ A;  2RN2 A;  3RRH A;  1X9W A;  2GUI A;  1KTQ A;  2HVH A;  3K5M A;  2XY7 A;  4F4K A;  4Z4G A;  4KV8 A;  4FLY A;  2EX3 A;  4KI4 A;  4CGF A;  3QIN A;  1SKS A;  4QCL A;  3LP1 A;  2GV9 A;  4E0D A;  4W5Q A;  1NJY A;  1WSF A;  4E7L A;  4KHW A;  2YNI A;  4FK2 A;  1NK7 A;  3KK2 A;  1J9A A;  2HHX A;  1X1P A;  4DSK A;  4DSE A;  4L8R B;  3IRX A;  3ZCM A;  3S3N A;  1DTQ A;  3S3O A;  1XI1 A;  1T05 A;  1JLE A;  3NBP A;  3OYB A;  3QEX A;  2R7Y A;  4RW7 A;  3ZSW A;  3O3F A;  1RBV A;  4I7F A;  2IOC A;  4FLX A;  1SL1 A;  4Y1D A;  4B9S A;  4CIG A;  3KTQ A;  3ZT1 A;  2HND A;  2KFN A;  3RR7 A;  3LAK A;  2HVI A;  5I42 A;  3HM9 A;  3DLR A;  1KVB A;  1S9E A;  4DSL A;  1N5Y A;  5CZ2 A;  2Q3S A;  1W9H A;  2FBY A;  2NUB A;  1LWE A;  3NE6 A;  2PYL A;  2IS3 A;  5FDL A;  4LSN A;  3LAM A;  4CES A;  2GBZ A;  1L5U A;  1BL3 A;  2XRI A;  5HBM A;  1RTJ A;  3SQ2 A;  3LAL A;  2B4J A;  3KKR A;  1LV5 A;  4OPJ A;  3EZ5 A;  1L3U A;  3AVN A;  3L2W A;  5HRP A;  1XHX A;  4IBN A;  4B9L A;  3VQ4 A;  4HVJ A;  3DRP A;  2ZD1 A;  4FW2 A;  4DTR A;  3HYF A;  3RMD A;  3AO1 A;  2X78 A;  3QES A;  4PUO A;  1I3A A;  2P51 A;  4M3X A;  4J2D A;  4FJI A;  1HNI A;  1A5X A;  4F3O A;  3SV3 A;  3QNN A;  4PY5 A;  3PX4 A;  4J2A A;  3ZSV A;  2KZZ A;  3TWH A;  3MEC A;  4NCB A;  1UA1 A;  2QXF A;  1IH7 A;  1W0H A;  3KIO A;  3SZ2 A;  1RTD A;  2B5J A;  3LZJ A;  4O4G A;  3HPG A;  4IFY A;  4CJK A;  3OS0 A;  4FM1 A;  3OYA A;  1NKE A;  1N6Q A;  4PA1 A;  3DRS A;  1KLM A;  4IG3 A;  3O3H A;  1RTH A;  4C8O A;  4LSL A;  4RW9 A;  3V9U A;  1WSE A;  1SKW A;  4M3U A;  4EZ6 A;  4E7J A;  4YFU A;  4KB0 A;  1Z25 A;  2A1S A;  2HHU A;  4W5O A;  1GOC A;  1D8Y A;  3NF7 A;  1JLC A;  1JLF A;  1S6Q A;  3TAF A;  3QLH A;  1Z26 A;  3VN5 A;  3TAE A;  4FJJ A;  1K6Y A;  1RT3 A;  4E3S A;  1UA0 A;  4KRF A;  2Z1J A;  4FJ7 A;  3WNG A;  4B8A B;  4CIE A;  1NK0 A;  4DF4 A;  4AH9 A;  4CJT A;  4ZTJ A;  3ZSY A;  4FZZ A;  2Y1J A;  2ZQB A;  3SCX A;  1KVA A;  1L3V A;  4OLA A;  5JS2 A;  4DQS A;  4G1Q A;  2X6S A;  4B3O A;  3K2P A;  3EY1 A;  4OKK A;  4GW6 A;  3OVN A;  3DLK A;  3ZSQ A;  4DU4 A;  3QET A;  2P1J A;  4KHY A;  1C1B A;  5HRS A;  3AVK A;  3ITH A;  3AVC A;  3NH1 A;  3PX0 A;  4DTX A;  5CZ1 A;  2VG7 A;  4B08 A;  3K57 A;  4E1N A;  3CFP A;  3TAR A;  3RWU A;  1JL1 A;  3NGY A;  3HVR A;  4CF8 A;  3ZT4 A;  1B92 A;  2Z1G A;  1ZYQ A;  3D0P A;  1L3T A;  1TK0 A;  4ID5 A;  3AA2 A;  3DOK A;  2QKK A;  3CM5 A;  4DTO A;  3NH2 A;  4AHV A;  1X9S A;  2XHB A;  1FKO A;  1BCO A;  1CLQ A;  4CFC A;  5FRN A;  1QTM A;  5EU7 A;  2XO7 A;  2VWK A;  2B6A A;  3T19 A;  3ISN C;  1VSK A;  3HT3 A;  2DFE A;  4KO0 A;  4CF2 A;  3SUO A;  2FBT A;  3IS9 A;  3VQC A;  4FJK A;  3AA4 A;  1Q9X A;  4M3Z A;  1CZ9 A;  4ID1 A;  4CGI A;  4DWI A;  4I2Q A;  1FKP A;  3SNN A;  4CJ5 A;  1D5A A;  4NCG A;  4KTZ A;  1TK8 A;  1ASW A;  3OY9 A;  4CJF A;  3KLI A;  4Z4E A;  2KFZ A;  4KHQ A;  1S9G A;  4O44 A;  4Y1C A;  1MU2 A;  3RRG A;  1JLQ A;  1SUQ A;  1YTA A;  3P5J A;  4H4M A;  1VSL A;  2D0C A;  1EP4 A;  2Z1H A;  4CF1 A;  4CHQ A;  3ULD A;  1S1V A;  4KTW A;  4QOZ B;  5SWM A;  1U4B A;  3RR8 A;  3JYT A;  4BWJ A;  3VQA A;  4AHU A;  3PV8 A;  4B9V A;  4PWD A;  3L3U A;  4DG1 A;  4CEC A;  1WLJ A;  3QER A;  3I0S A;  3TR8 A;  4DMN A;  2PYJ A;  1NOY A;  1IG9 A;  2WOM A;  2BAN A;  1LW0 A;  2FC0 A;  3AV9 A;  1HYS A;  3DLH A;  4DQI A;  4OVL A;  4W5R A;  4CCH A;  3HK2 A;  1HQE A;  4BE0 A;  3B6O A;  1LW2 A;  4EP4 A;  3M8Q A;  5DK5 A;  3OJS A;  1U04 A;  4CJV A;  5I3U A;  3RMC A;  4DTU A;  3AA3 A;  3LP3 A;  5C42 A;  4LH4 A;  3V1Q A;  4FLZ A;  1SL0 A;  1L3S A;  2IGI A;  3QO9 A;  4ZTF A;  1NK4 A;  1YTU A;  4NYF A;  4O0J A;  2E6L A;  4UQG A;  1HYV A;  3L2V A;  4PQU A;  4Q0B A;  4KHU A;  3AVL A;  1NK8 A;  1QSL A;  3LP0 A;  4EZ9 A;  4OGE A;  1BQM A;  2OPQ A;  3I0R A;  4OJR A;  2D0B A;  4CHN A;  1ZBF A;  4FM2 A;  1RDC A;  3QEI A;  1TV6 A;  4HUG A;  3KD5 E;  3T1A A;  4NCA A;  4CHP A;  2O4G A;  3SQ1 A;  2DFF A;  3NF6 A;  1RBU A;  4BDY A;  1J5O A;  2G8W A;  1WSH A;  3AVM A;  1CXU A;  2YKM A;  1EET A;  3KK3 A;  3U3Y A;  1RT5 A;  3AVI A;  5HRR A;  3T3F A;  3HO1 A;  4BE1 A;  4DFM A;  4KB1 A;  4BAC A;  3BDP A;  1DLO A;  3L2U A;  4E7K A;  3SV4 A;  3NGZ A;  4N41 A;  1BI4 A;  4I2P A;  4CK3 A;  1BIU A;  2PZS A;  1ITG A;  5SZT A;  3THV A;  1S6P A;  1BIS A;  2OPS A;  4LY7 A;  4ELV A;  3L3V A;  3F9K A;  4FLW A;  4I9L A;  4W5T A;  2OZS A;  2KW4 A;  4AHC A;  4JRP A;  4MQ3 A;  4HHT A;  3TAP A;  2FBV A;  1QQC A;  2LSN A;  4CHO A;  4JLH A;  3AO2 A;  4DU1 A;  2VG5 A;  1IKV A;  4FCY A;  1XWL A;  1RT2 A;  1SL2 A;  1WSG A;  3VQQ A;  2HMI A;  1GOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...