3WNFA

Cyclic hexapeptide ckidnc in complex with hiv-1 integrase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
133
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
total genus 46
structure length 133
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnfA00
4E7KA 1SKWA 4RW6A 4K8XA 5J2NA 4AILC 1T8EA 4KTWA 4DQSA 4KI6A 3VQQA 4M3YA 4Y1CA 4CJWA 4CJFA 4FJHA 3S3OA 4N56A 3T19A 3ULDA 4DLGA 4MQ3A 1JKHA 1S1UA 4EP5A 4CJRA 5KGWA 4KTZA 4OJRA 3O3GA 3OYEA 5D3GA 1JLQA 4AHSA 3FFIA 4FM1A 1QE1A 2Z1HA 4KKOA 4CJEA 1IKXA 4DF4A 1EKEA 3PX6A 2ETJA 3LPTA 1TK8A 4CHPA 1REVA 3AVLA 1U04A 1UAXA 2G8HA 3VQ5A 4FM2A 4FZYA 4KRFA 3K2PA 2RF2A 4E0DA 3AVBA 1SL0A 1ITGA 1ZBLA 5HRNA 5KRTA 3OYIA 3TAFA 3V9WA 3DLHA 2HHVA 4CEZA 5C24A 4DU1A 4DFPA 3I8DA 3AO1A 2HNZA 3HL8A 1TKDA 3KK2A 4B3OA 3DLGA 4ID5A 2P1JA 3IS9A 5FROA 3KD1E 3M8QA 3DRPA 4AHTA 3K5MA 4KHUA 3MEDA 2HVIA 1JLAA 4Z4HA 4DTPA 2DFFA 3ASMA 4OPKA 3I0SA 3HVRA 1NKCA 3RWUA 3DOKA 4YFUA 3BGRA 3DRSA 4CHZA 5CYQA 3QESA 3V4IA 4OLAA 2P5OA 4HVJA 4E7HA 1YT3A 1IKWA 2RPIA 3QO9A 4B9TA 2F96A 4J2DA 1RNHA 2IGIA 1BQNA 4CIFA 1J5OA 4CHYA 2GV9A 1RBVA 4CJ4A 4LH4A 4Z4EA 4EZ6A 1RTHA 3CFRA 1GOBA 4F8RA 3VQ7A 3L2UA 2G8WA 3AVJA 3AA5X 3MEGA 3O3FA 3RMAA 4AHRA 4KHWA 5J2QA 1U47A 2Z1GA 2JGUA 1SKRA 4RG8A 4CFAA 4AHCA 1UA0A 4M42A 4RW7A 1LWEA 4I9QA 4KHNA 3SUQA 4NCAA 4G1QA 1RDBA 3KTQA 1VSEA 3T3FA 4FXDA 3NF8A 3OS0A 3HM9A 1KCFA 4LSLA 4KB1A 4FW2A 4FLUA 4DTNA 3QEIA 3SCXA 3NGYA 2YKMA 4CIGA 1C0TA 4FVMA 4DFJA 1KFDA 2YHBA 3L2QA 3TAPA 3LPUA 3AVAA 1ZBHA 3HK2A 1QTMA 3AVKA 1VSHA 4DTJA 4EZ9A 2IC3A 5CY4A 1LAWA 3ZT2A 1NKBA 3TAMA 1RT2A 2P51A 1BCOA 3V1QA 4DSIA 2Q3SA 4OKEA 3ZSRA 2YNGA 4LH5A 3VQCA 4CK3A 2FBYA 3OS2A 1FXXA 1TL3A 4UQGA 3PX0A 4ID1A 4F2SA 1VSIA 2YHAA 4K8ZA 4CF1A 3IAYA 2OPQA 4CF0A 3RMDA 1NK8A 4J2AA 3AO3A 3ZT3A 1VRTA 1KFSA 5CYMA 1NK6A 3U3GA 4CGIA 4FJJA 4B8CA 3OYCA 3F73A 3RRGA 4CF2A 4CGFA 1UOCA 3LANA 4WE1A 1BL3A 3QEWA 2PYLA 1LWCA 4M45A 4JS4A 3ZSOA 1KVBA 4E19A 3KKSA 4FLYA 3C94A 1L3SA 1ZBIA 3DOLA 1RDCA 1JL1A 3QIOA 4C8LA 4AHUA 3QIPA 1HYSA 1S9EA 3TI0A 4OPJA 2HHWA 2VWKA 1KLNA 4I2QA 1DTTA 1YVUA 1QSSA 4KTQA 3M8RA 3WNHA 2X6SA 4RW8A 3WNFA 3AO4A 4DTMA 1W0HA 1S1WA 2YV0X 2XRIA 3LZIA 2XHBA 5J2MA 1SL2A 3PO5A 4L8RB 4DMNA 4IBNA 3ZCMA 5CZ1A 4BWMA 3NF9A 5EU7A 1RDAA 4ZTFA 1NJWA 1C0UA 4OGCA 4QOZB 2IOCA 1KVCA 4DSJA 1CLQA 3HPOA 1LWFA 4FK4A 2VG7A 1BI4B 1WN7A 3TAGA 2B6AA 3O4NA 3SUPA 3O3HA 1YTUA 4ICLA 3K58A 3RTVA 3LP0A 3P5JA 4O0JA 2HHTA 1YTAA 1VSMA 3MEEA 1CXUA 4IFVA 4NYNA 2O4IA 4OKKA 1RBSA 2FBVA 4XIUA 5FRNA 3ISNC 3HO1A 2IS3A 1TK0A 3E01A 4NCGA 1J53A 3S3NA 5KI6A 1C1CA 1KSPA 5JS2A 1ZBUA 3L2VA 4JS5A 4HUGA 2XY7A 1WAJA 4O55A 2FBXA 4CJLA 4FJXA 1QHTA 4CJKA 4PWDA 4LY7A 3HSTB 2RN2A 1XC9A 3CFPA 4FM0A 1W9HA 3SQ2A 1L3UA 2HB5A 3V9ZA 1QQCA 2EX3A 3S9HA 1TK5A 2E4LA 4W5TA 4E1NA 3U3YA 3OYFA 3TABA 4IKFA 3HT3A 4IDKA 3SQ4A 3WNEA 3VQEA 1HMVA 3DLRA 3SYZA 3SI6A 2YKNA 1C6VA 3KLFA 3OYHA 4DQQA 4M3TA 3NH2A 1LW0A 4DQIA 3DYAA 4O4GA 3M8PA 4CJUA 4W5RA 1UWBA 3TARA 2KZMA 3SUOA 3VQ6A 4QCLA 3RMCA 4DTOA 1XI1A 1NK7A 1KRPA 4CEFA 1LAVA 3H08A 4FW1A 3I0RA 3KLIA 2R7YA 4E7LA 4IG0A 3TWHA 2HHXA 4DG1A 4DTUA 4OKJA 3LP3A 3PUFA 4FJNA 3NAEA 4M3UA 1A5XA 1A5VA 2HVHA 3QLHA 1I39A 1NK4A 1HPZA 2KZZA 4CFCA 1BCMA 2QK9A 3AVIA 1HQEA 1LV5A 1L5UA 2OA8A 3TR8A 3C6TA 4KB0A 3KLHA 3AO2A 4FJMA 4KREA 4ZTJA 1RBTA 4HUFA 3NE6A 2KQ2A 1QSYA 3HP9A 1BGXT 1UA1A 3B6OA 3NFAA 4CK1A 1T03A 4FZXC 3PO4A 4GW6A 4B8AB 4KHQA 1BI4A 4DU4A 1Z26A 1U49A 3G10A 4DSFA 1IKYA 4CGGA 2HHUA 3AVGA 2D5RA 1TAUA 4DWIA 1O1WA 1EX4A 1Y97A 3L2WA 2QKKA 1DTQA 3ZT0A 3OYAA 4DQPA 3ZSQA 4PA1A 3OJSA 4BE2A 2OPPA 2BE2A 1FK9A 4BE1A 1HJRA 2PZSA 4H4MA 3OJUA 2VG5A 5KRSA 3CG7A 1S1TA 4O44A 4Z4IA 4B9NA 1X9MA 1VSJA 4CEDA 3AVNA 1JLCA 3OYBA 4KPYA 1D8YA 2XY5A 4FZZA 4O5BA 3KD5E 4BDZA 4B9MA 3AA4A 2F8TA 1WSIA 3V9SA 2A1RA 1L3TA 3P83D 1SKSA 3NBPA 3VQ9A 1S6PA 3PV8A 1K6YA 4FK2A 4C8OA 4CJSA 5KTQA 3QEVA 3B6PA 2Y1IA 4OGEA 3AV9A 4FJ8A 4BE0A 4BDYA 1LW2A 1VSKA 1SUQA 2RKIA 5J1EA 3F9KA 3SPYA 1IH7A 1J9AA 1GOAA 3V6DA 4HCBA 3WNGA 4LSNA 3KK1A 1NK0A 3AVHA 3NDKA 4HCCA 5FRMA 1TVRA 3IG1A 4BWJA 2LSNA 3TAQA 1WNSA 3NGZA 3OYMA 4Z4GA 5C42A 1BQMA 5HP1A 3RR7A 3DLKA 4DLEA 3V1RA 4FLXA 3HJFA 3DRRA 1Q8IA 2FC0A 3OVNA 1JL2A 3LAMA 1JLBA 1MU2A 3L3VA 1RBRA 5K14A 2DFHA 2GUIA 3V81A 3K5LA 4MFBA 4BACA 1N6QA 4QAGA 4Q5VA 4I7FA 4J2EA 3KLGA 3CM5A 1WSEA 1D9FA 3ALYA 4FK0A 4I2PA 3ZT1A 4CHQA 1C1AA 1G15A 4KO0A 3LWLA 4N76A 3NF7A 2OPSA 4HTUA 4E7IA 4CJPA 3NCIA 4DF8A 1KLMA 4B9LA 2Z1IA 1X9WA 4N41A 5HRPA 4CJ5A 3RRHA 2HNDA 4C8NA 1KTQA 5J2PA 3MXMA 1NK9A 2PY5A 3KKRA 1X9SA 4B9UA 4KI4A 3L2RA 1CXQA 4FYDA 4HUEA 4E3SA 2YNFA 4CF9A 1WSFA 3DI6A 4AH9A 1IG9A 1ASWA 4JRPA 4F2RA 1BISA 4CHOA 2BGGA 2D0AA 3C95A 1WSJA 2XY8A 4R5PA 3HXMA 2VWJA 2ITGA 3SPZA 4DSEA 1RT3A 1VSDA 2HW3A 2HNYA 3DM2A 4CECA 3V9XA 4FJGA 4C8MA 4M41A 5DK5A 5HLFA 4PY5A 1RILA 1U48A 4CK2A 5CZ2A 2XY6A 3T1AA 2OYQA 1RCHA 2OZMA 1IKVA 3RR8A 3ITHA 3OYKA 4ELUA 4J2BA 4O0IA 3SQ1A 3OS1A 4FJLA 2A1SA 1F21A 1RT4A 4PUOA 4M3XA 2HHSA 4F4KA 4LD0A 4H4OA 3OYGA 3AA3A 2QXFA 5SWMA 1N5YA 1RT6A 4CJTA 3QINA 1A5WA 3D45A 3KK3A 4GMJB 1DLOA 2B5JA 3LDSA 4Z4FA 4OLBA 2F8SA 1S9GA 3JYTA 1XHZA 3VQAA 1NK5A 1RT5A 3HYFA 4Y1DA 4M3RA 1RT7A 4N5SA 3HPHA 3CFOA 1NKEA 4PQUA 1ZBFA 4CE9A 3EYZA 3DLEA 4E89A 1TKTA 3CQ8A 3NH0A 4C8KA 3PY8A 2G8KA 2D0BA 2ZD1A 4IG3A 4W5NA 3ZSXA 1CZBA 4ELTA 3SJJA 4CJ3A 1S5JA 4CIEA 3S3MA 3AO5A 3LAKA 1HQUA 4CGJA 3SV4A 2G8VA 2DY4A 4FJ7A 2IDOA 1WSGA 1BIUA 3SZ2A 3NHGA 1FKPA 4JRQA 1WAFA 1QSLA 1SV5A 1S6QA 3KLEA 2G8FA 2YNHA 5C25A 3NH1A 3RMBA 2YNIA 1TGOA 3LWMA 2EHGA 4CEEA 4CCHA 1JXEA 3A2FA 4RW9A 3ZSYA 4CF8A 5HBMA 2OZSA 1VSFA 3VQDA 3PX4A 3L3UA 2P5GA 2BANA 2DFEA 1JLGA 1EETA 4ELVA 1HRHA 4DQRA 2HHQA 1B92A 1EXQA 1TKXA 2ATQA 4W5QA 1D5AA 1VRUA 2ZQBA 4KFBA 3VQPA 3OYJA 1Z25A 5KGXA 3VA0A 2KFNA 1XWLA 3ZT4A 1S1VA 3LP1A 4RW4A 4TSXA 2I5JA 3OYNA 4CEAA 4FLZA 5HROA 3HVTA 3BDPA 3LP2A 3G0ZA 2G8UA 3DLBA 3UIQA 1SL1A 1RTDA 3V1OA 5I42A 2E6MA 1HYZA 3KJVA 3P1GA 3K59A 1KVAA 4CERA 3U6FA 1T7PA 1U45A 3QEPA 2WOMA 3EY1A 1B9FA 4ZHRA 3CYMA 3M8SA 1T05A 3VQ8A 2Z1JA 2W42A 4Z4CA 1GOCA 3SV3A 4NYFA 3K57A 3D0PA 2X78A 1ZYQA 2D0CA 3TANA 4FJ9A 2QKBA 1NJYA 1NJXA 3K5OA 2O4GA 2HMIA 3MXJA 4CGHA 4EP4A 5DMRA 4B9VA 4B08A 4KHYA 2Y1JA 1NOZA 1EP4A 3ZSVA 1NJZA 3KIOA 1Q9YA 3CM6A 3L8BA 4FLWA 4DS4A 1HNVA 3MXIA 2DTUA 4F3TA 3QNNA 3AVCA 2JLEA 4CFDA 4GVMA 3EZ5A 4H8KA 3SUNA 2PYJA 4YNQA 2X74A 4KAZA 1RT1A 2OPRA 4CEBA 4F3OA 4CEQA 1XHXA 1I3AA 2B4JA 2XO7A 3LALA 2WONA 1TAQA 1BIZA 4Q0BA 4FJ5A 4FJKA 1HNIA 3MAQA 1NOYA 2GBZA 2VG6A 4OVLA 4CJVA 3VN5A 4I9LA 1JLEA 3THVA 4DTSA 2E6LA 4HHTA 4IFYA 4Z0UA 1B9DA 3ZSWA 4FCYA 3NF6A 4M3ZA 1WSHA 4DU3A 2KW4A 4E1MA 1ASUA 2NUBA 5E41A 3V9UA 2KTQA 3AA2A 3OYLA 2X6NA 1J54A 4KV8A 1L3VA 4KHSA 1ASVA 1VSLA 3O4QA 3SQ0A 4CHNA 4B9SA 3ZSZA 4W5OA 4CJQA 5FDLA 2AJQA 3C6UA 4FLTA 1FKOA 1RTJA 4CESA 4DSKA 2G8IA 1RDDA 4CGDA 2KFZA 4DFKA 4DTXA 1C0MA 3QETA 1VK0A 4DTRA 2ZE2A 3NGIA 4FJIA 2IAJA 1D9DA 3AVMA 2BDPA 3OYDA 1U4BA 1IO2A 1QS4A 4E7JA 1R0AA 1X1PA 1TL1A 4NCBA 1RBUA 5JS1A 1BHLA 3VA3A 1JXBA 1TV6A 1Q9XA 4DFMA 3HP6A 4CEOA 5T7BA 3QNOA 1C1BA 4JLHA 3K5NA 3AVFA 1JLFA 5HRRA 4CFBA 1CZ9A 5SZTA 3JSMA 2FBTA 3MECA 3LZJA 4FLVA 4BDPA 1RTIA 3VQ4A 4M3WA 3OY9A 4N47A 5HRSA 5I3UA 1TKZA 3TAEA 3HPGA 1S1XA 3SNNA 3VQBA 1WLJA 3IRXA 4AHVA 4DS5A 1HYVA 4DSLA 3QERA 3DMJA 3QEXA
chains in the Genus database with same CATH superfamily
4E7KA 1SKWA 3A0IX 3FZHA 5AQMA 2VWBA 4AILC 4H0OA 1T8EA 4KTWA 4KI6A 3VQQA 4M3YA 1NJIO 4FJHA 3S3OA 3T19A 4DLGA 1JKHA 4EP5A 4CJRA 4KTZA 3OYEA 2QA4N 3FFIA 4FM1A 2Z1HA 4DF4A 1IKXA 2V7YA 3PX6A 4PKGA 2ETJA 2E2PA 1UAXA 4FZYA 1SL0A 5KRTA 3OYIA 4PL7A 3V9WA 3DLHA 3O9SA 2NRWA 1HKCA 3AO1A 3ZX0A 4K0KK 1JJ2M 2P1JA 3IS9A 5FROA 3VEWA 2P9UB 3M8QA 3ID8A 4KHUA 4FWOA 4JD2B 2HVIA 1C0GA 5GINA 4OPKA 3I0SA 3RWUA 4YFUA 2OANA 1RDWX 5CYQA 4B9TA 1IKWA 2E1YA 4J2DA 3LDNA 5LY3A 4CHYA 2GV9A 5KQDA 3CPEA 1QZ5A 1HNWK 3AA5X 3MEGA 3E66A 3ENBA 4O8UA 2NNWA 3ENOA 3RMAA 1K73O 2JGUA 1SKRA 4B1UB 4CFAA 1MA9B 1UA0A 4M42A 3D2EB 1J5EK 4NCAA 2A6AA 3R6MA 1WBBA 4FXDA 1NU0A 3MWPA 3VEVA 4DTNA 5IT9O 3NGYA 1C0TA 1KFDA 3SMPA 3BF1A 3G4SN 3CCJN 3C65A 1OH5A 1QTMA 2IC3A 5CY4A 1NKBA 1RT2A 2P51A 3HTVA 3V1QA 2Q3SA 4JI4K 2E5LK 1KAYA 4LH5A 3VQCA 4WFBL 4RTFD 1FXXA 1TL3A 5CHIA 3PX0A 4F2SA 1VSIA 2YHAA 4K8ZA 2F4VK 1QVGM 3AO3A 1YUWA 1VQ4N 4BC2A 4EFHA 1MDUB 4BRHA 3THWB 4WE1A 3QEWA 2FLOA 4JKHA 5AFUA 1RDCA 4C8LA 1VQ6N 1SZ2A 1S9EA 4EHTA 2HHWA 2VWKA 3O1BA 1QSSA 1LCUA 3MX2A 3OBWA 3JAMO 2YV0X 5AQNA 4BWMA 1NJWA 2E1ZA 2IOCA 1CLQA 4YDUA 3HPOA 3BEXA 4O5FA 3O4NA 2W6KA 3K58A 2ZJPL 4X65K 4OKKA 4FWRA 1RBSA 2FBVA 3SJHA 3WEEA 1J53A 1NWKA 2H3GX 4FJXA 4CJLA 3ZEUB 4ISEA 1VQKN 3SQ2A 2HB5A 1QQCA 1TK5A 4IKFA 2E2OA 3QFPA 1X3MA 2P9PA 4LFCK 1HMVA 3SYZA 4M3TA 3NH2A 4DQIA 4ILGB 3CD6N 3TSPA 3VQ6A 2FSJA 3EKSA 3RMCA 3GDQA 4QCLA 1P90A 4CEFA 1LAVA 4NXMK 4DV4K 4FWSA 2HVHA 4U67L 1HPZA 4CFCA 4FL9A 1NGEA 1LV5A 1L5UA 3C6TA 4CBUA 3QBWA 4FJMA 4ZTJA 1FW6A 4FZXC 3CJAA 1VHXA 3LDOA 1BI4A 4CGGA 1W2BM 4DWIA 1O1WA 4G9ZA 3ZT0A 4JN4A 4HWIA 4BE2A 2OPPA 4NLBA 2FF3B 4BRLA 3LM9A 4H4MA 4H5WA 5KRSA 4Z4IA 1X9MA 1XNRK 3O6WA 3JXUA 2XY5A 4WQ4C 4B3RK 3KD5E 3N4PA 1WSIA 3V9SA 3L0QA 4L3QA 2A1RA 1YIJN 4JI7K 1S6PA 1K6YA 4C8OA 3KWIA 1BWFO 5KTQA 4RCHA 3DXKB 1GLFO 5M1QA 4BE0A 4BDYA 1VSKA 2RKIA 2O8EA 3F9KA 4HCBA 2F9WA 1NK0A 4HCCA 2P9LA 1IJJA 4BWJA 3WXJA 3H3OB 5C42A 1BQMA 5AQZA 1IBMK 3HJFA 2Q0UA 1Q8IA 3DRRA 4BRAA 1MU2A 1RBRA 2GWJA 4B1ZA 1T6CA 4AM7A 4QAGA 4J2EA 2O8EB 4I2PA 1HNXK 1C1AA 4MDBA 2P9LB 1OH7A 4ILJA 3NF7A 2OPSA 4E7IA 2YJFA 2Z1IA 5AZJB 1D4XA 5HRPA 4B9UA 1TYQA 4FOIA 1GLDG 1WSFA 3MDQA 2BGGA 3C95A 3C7NA 2XY8A 3HXMA 4DV1K 4DR5K 2JWKA 2FSKA 5DK5A 3TTFA 4IXCA 2XY6A 3HOSA 4GNIA 2VQFK 5KPZA 4MO4A 3RR8A 3ITHA 3SQ1A 1HX1A 3OS1A 2A1SA 4M3XA 4R79A 3A8YA 4F4KA 4DR6K 2YHYA 4LD0A 3OYGA 2AP1A 1U2VA 5BREA 4H0XB 1VQNN 3O9TA 3TTCA 4H0TB 3QINA 1YJWN 4JV5K 1S9GA 3T1HK 1NK5A 1NKEA 4N5SA 3CFOA 4Y0WA 3BUZB 2Q2RA 3DLEA 3VERA 4C8KA 4CZJA 2ZD1A 3NMUA 4JI2K 4JKEA 4CVNE 1S5JA 4CIEA 4CGJA 5AFUH 4LF9K 2G8IA 1BIUA 1FKPA 4JRQA 4WFAL 3KLEA 1S6QA 2YNHA 3NH1A 4B9QA 1W97L 1JXEA 1V4TA 5HBMA 4RWTA 4B1WB 2BANA 1JLGA 3VGMA 4I6MA 4DQRA 2HHQA 4W5QA 3VA0A 1D5AA 2O8CB 1XWLA 5FPMA 3LP1A 2I5JA 4CEAA 3HVTA 3CC4N 3UIQA 3V1OA 1WUAA 1QVFM 4JAXA 3P1GA 5EXWA 1EWQA 2WOMA 2ASOA 3VQ8A 2Z1JA 1I94K 4NYFA 2QKBA 1K8KA 4DV3K 1NJYA 2AA4A 2O4GA 3DXMB 5DMRA 5AZIA 4B08A 3GL1A 4M7XA 3GBTA 3EN9A 1EP4A 3FFKB 1NGGA 3I8BA 3CM6A 4B3TK 4FLWA 1HNVA 3GG4A 3Q7CA 4F3TA 2DPNA 5AQGA 3EZ5A 4H8KA 4LC9B 4KAZA 4EIAA 4CEQA 2XO7A 3LALA 2WONA 4IO8A 4FWQA 1BIZA 5AQLA 3J7ZO 4FJ5A 3MAQA 2F7TA 5AQWA 1JLEA 4HHTA 1HR0K 4XEIA 2HBLA 2KTQA 4A57A 1L3VA 4IOAL 4B9SA 4FLTA 4DFKA 4YORA 2ZGZA 3QETA 1M90O 3NGIA 4FJIA 2IAJA 1D9DA 2BDPA 1U4BA 4FVUA 1NGDA 2QWQA 1YJNN 3EO3A 1RBUA 1ILYA 3VENA 5T7BA 3QICA 3K5NA 1JLFA 1Q18A 5HRRA 4CFBA 3D2FA 4FLVA 5BR9A 1VQPN 4BDPA 4BR4A 3HPGA 2HMPA 3SNNA 3VQBA 3IRXA 4DV2K 4FWNA 5AQQA 4DSLA 4FJKA 3THYA 3W0LA 4FLZA 3KVGA 4K8XA 5J2NA 4DQSA 4X66K 5B8HA 1MWKA 4DR2K 4Y1CA 3NVKA 3CF5L 3CJ7A 5GADP 4N56A 3ULDA 1S1UA 3CXCM 5MLCQ 4EHUA 4FJ7A 3LPTA 1OKJA 1U04A 1EO1A 3K2PA 1ZBLA 1E4FT 4IOXA 4DU1A 2OTJN 2HNZA 3HL8A 1TKDA 5M1PA 1WBDA 4JK8A 3DRPA 3EZWA 3K5MA 3MEDA 2NLXA 4DTPA 3HVRA 3F9MA 4BRKA 2F9TA 3DOKA 3BGRA 4H0YB 5AR0A 2P5OA 1YT3A 3OHRA 1BQNA 1RBVA 4LH4A 1RTHA 3WXLA 3VQ7A 3L2UA 3O80A 2OTLN 4AHRA 1HJOA 4KH6A 2YX6A 5AZJA 2ASPA 3HRGA 3HZ6A 4I9QA 4FPAA 3T3FA 3OS0A 3HM9A 4LSLA 4KB1A 4FW2A 4BC5A 1QZ6A 3QEIA 4DFJA 2IVOA 3TAPA 4NXNK 3HK2A 4FWLA 3UKUA 1GLEG 1LAWA 3IKMA 4OKEA 1G99A 3ZSRA 2YNGA 2FBYA 3OS2A 2O8DA 2UXCK 5HL7L 4UQGA 4GKKK 4FWKA 4J2AA 3IAYA 2OPQA 4CF0A 3ZT3A 1VRTA 3U3GA 3F73A 1K8AO 3RRGA 3H46O 4LFBK 3EKUA 3H45C 3M6GA 1UOCA 5AQOA 3IUCA 2VYPA 3KKSA 4FLYA 3C94A 1XMQK 1L3SA 2A41A 5EY4A 2WC9A 3TI0A 3VEXA 4I2QA 5LMUK 1NG9A 4CZIA 4BR5A 3PIOL 3AO4A 4DTMA 2Q1NA 1W0HA 1S1WA 3PO5A 2XRIA 2XHBA 4DMNA 3THXB 3NF9A 4WYBA 4QOZB 4OGCA 1JCGA 1KVCA 4BR9A 1LWFA 4DB3A 1BI4B 4LF7K 4QS9A 4E1JA 1NNEA 4ICLA 2HHTA 1YTAA 4IFVA 3VF4A 2IS3A 1TK0A 3E01A 4NCGA 3S3NA 1C1CA 5JS2A 3L2VA 4A61A 2XY7A 2NRVA 5ADXA 3O9RA 4CZEA 3CFPA 2CGJA 4FM0A 5C2DA 1L3UA 1NGAA 1E4GT 3CJBA 3C0BA 3S9HA 4M7YA 3CCEN 3U3YA 3OYFA 4IDKA 3WNEA 1SAZA 2UUCK 3SI6A 2YKNA 1LW0A 1S22A 3DYAA 4BY9C 3TARA 3ZETA 3ULEB 4K43A 3H08A 2NRZA 5JLHA 1WOQA 2CGLA 1A5XA 1NK4A 4IEEA 4QS8A 1U2VB 3TR8A 3VMFB 2W6LA 1QSYA 1RBTA 4HUFA 3NE6A 1BGXT 5M1NA 3NFAA 1TUUA 3PO4A 4B8AB 5BN9A 5GAEP 1U49A 3G10A 3ZSQA 3OJSA 2BE2A 1FK9A 4BE1A 2PZSA 3OJUA 2VG5A 1S1TA 3CC2N 2BTFA 1YJ9N 1VSJA 3C7NB 4CEDA 3OYBA 3BZCA 5F2RA 4C23A 3CJCA 4O5BA 3JS6A 4CBWA 3AA4A 2FF6A 4AM6A 2F8TA 3P83D 3NBPA 3VQ9A 3HSCA 4YOTA 2GELA 2V7ZA 4OGEA 1KD1O 1DKGD 2E2QA 3WXMB 4YY3K 4MLHA 1IH7A 4H5RA 1GOAA 3KK1A 4JHDA 2WUSA 1CZAN 2EWSA 3BY5A 4Z4GA 4B1VA 3RR7A 1Z6RA 4K41A 3OVNA 2FC0A 5K14A 4K42A 2Q97A 4WF9L 1N6QA 3ZX2A 5BRHA 3VF2A 3ZT1A 2O8BA 4CHQA 2YJEA 3D6RA 4OPAA 1KAXA 4N76A 3H1VX 4N41A 3RRHA 1NK9A 4C8NA 3MXMA 2HF4A 4CZMA 1X9SA 5M1OA 4FYDA 4IO9L 3K9KA 4CF9A 1ASWA 4JRPA 1ESVA 4CHOA 4R5PA 2VWJA 4HTLA 4M63C 2ITGA 1N34K 4DSEA 3OW2M 1Q86O 2HW3A 5AJ3K 3DM2A 3V9XA 4FJGA 1Z05A 3ZLJA 5HLFA 1MWMA 4CK2A 3T1AA 4YHHK 1OVYA 1BU6O 1M1KO 3WQTA 2OZMA 1IKVA 3CPWM 2YCHA 4BRNA 3OYKA 1K9MO 1NBWA 3UE5A 4PUOA 2RHKA 1GLLO 2QXFA 1RT6A 1NGFA 3KWGA 2ZJRL 3D45A 1NGIA 2B5JA 5KPRA 4AF1A 4OLBA 3JYTA 4AQYK 1XHZA 3VQAA 1RT5A 3L6QA 1RT7A 3EE8A 4PQUA 4CE9A 3EYZA 1J6ZA 1TKTA 2P9NA 4IG3A 3ZSXA 4FOEA 4ELTA 4CJ3A 2UXDK 3AO5A 4DKWA 4BRCA 4FWPA 1WSGA 1SS6A 1WAFA 1SV5A 3RMBA 2YNIA 3LWMA 2EHGA 2HBJA 3TU5A 3VTIA 4CCHA 3A2FA 3ID6A 2P5GA 3J7AP 4DV7K 2DFEA 3MK6A 4CZFA 4Z94A 4H0PA 1VRUA 1Z25A 4CW7B 2ZWHA 4U7BA 3ZT4A 1S1VA 3OYNA 4WFNL 3ZEUA 3QMLA 3LP2A 3G0ZA 1VQ5N 3DLBA 1RTDA 3IMXA 3K59A 1T7PA 3DWLA 3CJ9A 5AQJA 2W42A 1WB9A 3K57A 2VQEK 4FJ9A 3ENHA 2QWPA 1VQLN 2HMIA 1HPMA 3UB5A 2HOEA 3MN7A 3ZSVA 2GEMA 3KIOA 1Q9YA 3OA9A 3L8BA 4DS4A 2P9IA 5H1SQ 2JLEA 4CFDA 3EE9A 3E1YA 3THWA 2PYJA 3SAFA 1RT1A 2OPRA 2NRHA 1SQKA 4A59A 4NLCA 1XHXA 3WXKA 1I3AA 5LJWA 4DR4K 1E3MA 2CGKA 1NOYA 2VG6A 4OVLA 3FGUA 3C6HA 4CJVA 3VN5A 4I9LA 1ZBSA 3AGKA 3SBGA 5E84A 4DTSA 3DAWA 3UKUB 4FCYA 3V9UA 3MCAB 4JKCA 1ASVA 1VSLA 3SK3A 3SQ0A 4CHNA 1ATNA 4W5OA 4CJQA 2O8DB 1FKOA 4CESA 4DSKA 1Q82O 1RDDA 5KQ8A 2E8AA 2KFZA 4DQ8A 4PL8A 4DTXA 1C0MA 2QWMA 5AQHA 3AVMA 1NGCA 2PBDA 1QS4A 4E7JA 5JS1A 3WEEB 1BHLA 3VA3A 5GIOA 1JXBA 3T1YK 4A5BA 4FPBA 4JLHA 4EAHD 3AVFA 3K9JA 4BG8A 4BRPA 3VQ4A 4LF8K 4XH5A 4ILHA 4BR0A 1S1XA 3BF3A 4DS5A 3R1XA 3CMAN 1NGHA 5BR8K 2QWLA 4CJWA 4MQ3A 4FO0A 3LL3A 5CE3A 5KGWA 1JCEA 2BH1A 4OJRA 5FLXO 4AHSA 4KKOA 1TK8A 1EKEA 1REVA 3AVLA 3KHYA 3VOVA 2G8HA 3VQ5A 4KRFA 2RF2A 5KPTA 5HRNA 3ZYYX 4GKJK 4CEZA 2YHXA 4DFPA 3I8DA 3KK2A 1QQMA 3DLGA 4ID5A 3KD1E 1YF5L 4Z4HA 1LOTB 3CHWA 3CCSN 1NKCA 1VQON 3VGKA 3CCUN 1HLUA 4CHZA 3QESA 3V4IA 4HVJA 4ISGA 4E7HA 2RPIA 3U4LA 1RDUA 2IGIA 4CIFA 3ZETB 3CCMN 4CJ4A 4EZ6A 1NMDA 3M5RA 3CFRA 2G8WA 3AVJA 3O3FA 4DV6K 3IDHA 4KHWA 1V4SA 2D0OA 2BUPA 4RG8A 5I9EB 4AHCA 4RW7A 1LWEA 4KHNA 3SUQA 5JVGL 3NF8A 1KCFA 3SMSA 4CI6A 3E9LA 2YKMA 4CIGA 3L2QA 3AVAA 3FZMA 1VSHA 4EZ9A 2QW9A 4DSIA 1BCOA 2I7PA 4JI3K 4CZKA 3MN9A 3I55N 4NB4A 4ID1A 1IV0A 3J81O 3RMDA 1NK8A 1S3XA 5BRFA 4YDUC 4B8CA 4MDAA 5FPEA 1N8RO 4CF2A 2ITMA 1BL3A 2PYLA 3B8AX 1LWCA 4JS4A 3ZSOA 1KVBA 4E19A 1ZBIA 4KH5A 1HYSA 4OPJA 3MN5A 1DTTA 1YVUA 3M8RA 3J8AA 5AQSA 2X6SA 3WNFA 4JHDB 1K8KB 3LZIA 3O08A 2QWOA 4IBNA 3ZCMA 2Q31A 5A2QO 5EU7A 3P4IA 1H1VA 4DSJA 4FK4A 1WN7A 3TAGA 2B6AA 4DR7K 3O3HA 3F5TA 4JI0K 1YAGA 3LP0A 3P5JA 4O0JA 1VSMA 3MEEA 2O4IA 3MMVA 3SAHA 3HO1A 3ISNC 3F2KA 1YHQN 3T7ZA 4H5VA 3MX5A 2P9UA 4HUGA 3CC7N 1WAJA 4PWDA 4CJKA 3CCVN 3ULEA 2RN2A 3OBYA 2PAVA 1KQSM 3V9ZA 2EX3A 5C15A 2E4LA 4E1NA 4YOWA 4QS7A 3SQ4A 5JLFA 1HUXA 3VQEA 2O8FB 5BPNA 1C6VA 1TYQB 1IBLK 4DQQA 1KXPA 1OH6A 4W5RA 1UWBA 2KZMA 1XI1A 4YOXA 3H3NO 4FW1A 4C1NK 4BGBA 3KLIA 2R7YA 3WUHA 4IG0A 1YVNA 3TWHA 2HHXA 4OKJA 3U9ZA 3QLHA 1I39A 3O4WA 2QK9A 3AVIA 4WQ5A 1HQEA 4NO7A 3SBTA 2UUBK 2GUPA 4H5TA 4KB0A 2ZM6K 3AO2A 2NRTA 2KQ2A 4F9OA 4YOYA 1UA1A 4CK1A 4IZ9A 4GW6A 4KHQA 1VQ9N 1Z26A 4PKIA 1IKYA 1Q81O 2HHUA 3AVGA 3VEYA 2D5RA 1TAUA 1EX4A 3L2WA 2QKKA 4DQPA 1BOTO 3EL2A 3IFRA 4PA1A 3T69A 1HJRA 3CG7A 4B9NA 3A5NC 4GV3A 1JLCA 5AQIA 3MWTA 1X9JA 2FSNA 1T44A 1SKSA 3D2EA 1BO5O 3PV8A 4CJSA 3QEVA 4A2BA 3AV9A 4WQ4A 1BA0A 1SUQA 2HHHK 5M1FA 3SPYA 1NMNA 2GWKA 3V6DA 4B1XB 3WNGA 4LSNA 2RE2A 3AVHA 3NDKA 5FRMA 3TSUA 3IG1A 4IDHA 5DM6L 2LSNA 2E88A 1WNSA 3OYMA 1N32K 5HP1A 3AGRA 3V1RA 4BRGA 4FLXA 4CZGA 1JL2A 3LAMA 3EEQA 2GUIA 2UUAK 3V81A 3K5LA 4MFBA 4BACA 2P9NB 4I7FA 3KLGA 1D9FA 1WSEA 3ALYA 1FJGK 2QWNA 4KO0A 3LWLA 5HOOA 4HTUA 4B9LA 1O13A 4DCHA 1X9WA 2P9PB 2HBKA 3TTDA 1KTQA 5D3GA 3KKRA 2HSTA 4WQ5C 3HOTA 1GLBG 1IG9A 3DI6A 4WCEL 4BR2A 2IVNA 3L4QA 4F2RA 5C12A 4X64K 2D0AA 1WSJA 4JKGA 3SPZA 1RT3A 2HNYA 3R3LA 3RSEB 4LFAK 4JD2A 4M41A 1U48A 1VAZA 3VESA 5CZ2A 2OYQA 1RCHA 3THYB 3L4IA 1NM1A 4J2BA 4ELUA 1TUYA 5JMVA 4O0IA 4FJLA 2HHSA 1F21A 1RT4A 2UXBK 1YXQA 3OTOK 4CJTA 3RSEA 3DLLL 1A5WA 3VTHA 4GMJB 1DLOA 3LDSA 2F8SA 3HYFA 4Y1DA 3HPHA 1ZBFA 5AQPA 4E89A 3CQ8A 1ZXOA 5AQRA 5TKWA 2G8KA 3PY8A 2ZF5O 2Q0RA 3LAKA 4JKBA 2UYTA 3SV4A 2DY4A 3HI0A 5GAGP 4ISFA 1QSLA 2G8FA 3NHGA 4BRDA 5C25A 3D2FB 4CD1A 5EOYA 2GX9A 4CF8A 2OZSA 1VSFA 3VQDA 3L3UA 2D0PA 4A62A 1EETA 5C10A 4IJAA 1EXQA 1TKXA 2ATQA 2KZZA 2D1KA 4KFBA 5KGXA 5ELZA 2NZTA 3BDPA 2ZGYA 3FZKA 3CCLN 5I42A 1HYZA 2VGMA 3KJVA 1KVAA 1U45A 3QEPA 3EY1A 1B9FA 4ZHRA 3CYMA 2I7NA 3M8SA 2UU9K 3P39A 1T05A 3SV3A 2NRXA 1XNQK 3D0PA 2X78A 2D0CA 3O9QA 3LDPA 3A5LC 4A5AA 4C1NI 1VQ7N 1ATRA 4B1YB 1NJXA 4CGHA 4EP4A 4B9VA 1IBKK 1QQOA 3PIPL 1YITN 3AY9A 4XH4A 3MXIA 2FXUA 3AVCA 1S72N 4BRFA 2IVPA 3K0SA 4CEBA 3CMEN 3VPZA 4JKDA 1TAQA 1X3NA 2O8FA 3LDQA 3FZLA 4BVOA 4IFYA 4Z0UA 1B9DA 3ZSWA 2WBNA 3NF6A 4M3ZA 1JCFA 1WSHA 4JKFA 4E1MA 5E41A 4DU3A 3AA2A 2A42A 3OYLA 2X6NA 4KV8A 3ZSZA 5FDLA 3C6UA 1RTJA 4K25A 3HM8A 3WQUA 2ZE2A 2V52B 1IO2A 1R0AA 3U8XA 3P38A 1TL1A 4NCBA 4OPHA 4PHTX 4DFMA 3HP6A 1C1BA 4IWVA 5AQUA 4JI5K 1CZ9A 4O8KA 5CR4A 2FBTA 3MECA 3LZJA 1RTIA 4OX9K 3OY9A 4N47A 3A5MC 5I3UA 1TKZA 4DHYA 3C6AA 3TAEA 3I33A 1HYVA 3QERA 4RW6A 2P9KA 4BGAA 2CH6A 3WT0A 2VCPA 3HBTA 2KHOA 5F0XA 4GY2B 4CJFA 4PKHA 4LF5K 3O3GA 1DT9A 1JLQA 2Q36A 1QE1A 1DGKN 2JWLA 4CJEA 4CHPA 2V51B 4FM2A 3PSFA 4E0DA 3AVBA 3DXKA 4BREA 1ITGA 2QTDA 3TAFA 2J4RA 2HHVA 3PLAA 5FPNA 5C24A 4B3OA 2D4WA 3FZFA 4AHTA 1JLAA 5DM7L 2DFFA 3ASMA 1Y64A 3DRSA 4OLAA 5EX5A 4JI1K 3E9OA 3QO9A 1QHAA 2F96A 4GV6A 1RNHA 1J5OA 4X62K 3CQXA 4YOVA 5AQVA 4Z4EA 5LL6Z 3CIPA 1GOBA 3QFUA 4F8RA 2OCEA 4CZHA 3LM2A 3H1QA 5J2QA 2Z1GA 1U47A 2ASMA 3DJCA 3GOIA 4JK9A 3FR0A 4G1QA 1RDBA 3KTQA 1VSEA 3AAQA 4JKAA 5M1KA 3R8EA 4BQZA 4KBOA 4FLUA 3BP8A 3SCXA 1OH8A 4FVMA 4H5NA 5C2FA 2YHBA 4DV5K 4BG9A 1HKBA 3LPUA 3LDLA 1ZBHA 3UKRA 3AVKA 4DTJA 2A3ZA 3ZT2A 3TAMA 2YHWA 4CK3A 5TKYA 4CF1A 1BDGA 3PSIA 1KFSA 5CYMA 1NK6A 1EQYA 3QBXA 4CGIA 4FJJA 3OYCA 4JNEA 1GLJO 4CGFA 3WXIA 3LANA 3BZKA 3R9PA 1RGIA 4M45A 2ZJQL 5C0YA 2KLAA 3DOLA 1JL1A 3QIOA 3ZX3A 4AHUA 3VEZA 3QIPA 3G25A 1KLNA 3G71N 4KTQA 3WNHA 3QDKA 4LF6K 4RW8A 1BA1A 1SL2A 5J2MA 4L8RB 5CZ1A 1RDAA 4ZTFA 3AARA 1C0UA 1EWRA 3W3DA 2VG7A 1T6DA 3U9DA 3O9UA 2E2NA 3SUPA 1YTUA 3RTVA 4DR3K 4NYNA 2QEXN 1CXUA 5FRNA 4XIUA 1XQSC 4J8FA 4CJ7A 1KSPA 4BRQA 5KI6A 1ZBUA 4JS5A 2QWRA 2O8CA 3J7YP 4O55A 2FBXA 1QHTA 4LY7A 1RFQA 3HSTB 1XC9A 1W9HA 4MO5A 3TABA 4W5TA 1ZC6A 3HT3A 4BR7A 3DLRA 3KLFA 3OYHA 1BG3A 3VEOA 4JI8K 4O4GA 3M8PA 4CJUA 3SUOA 1ATSA 4V19S 4DTOA 1NK7A 1KRPA 2QM1A 3E9PA 3H6EA 1U6ZA 3I0RA 4E7LA 2E20A 3RVCA 4DG1A 4DTUA 4FJNA 3LP3A 3PUFA 4M3UA 3NAEA 1N36K 2WFBA 4DV0K 1A5VA 3KZBA 3Q7BA 1BCMA 3FE1A 2OA8A 3KLHA 5BN8A 4KREA 3HP9A 3B6OA 1T03A 3VETA 1KC8O 4DU4A 4JEPA 4DSFA 5BRDA 1YI2N 1Y97A 2QI2A 1DTQA 2HBMA 2VGNA 4GVEA 3ATUA 3OYAA 4BVPA 4O44A 3AVNA 3CERA 4JKGB 4KPYA 1D8YA 4FZZA 4BDZA 4B9MA 1L3TA 4XH1A 2IIRA 4FK2A 1Q7YO 4DR1K 3B6PA 2Y1IA 4FJ8A 3THXA 1LW2A 5ADXH 4IFEA 5J1EA 1J9AA 1TVRA 4GV9A 3TAQA 3NGZA 5JVHL 3DLKA 3QB0A 4DLEA 3CI5A 1JLBA 3L3VA 3O5BA 5AQYA 4LF4K 2DFHA 4H0VB 5BPLA 4Q5VA 3TSQA 1P8ZA 3CM5A 4FK0A 2A5XA 1G15A 3O1WA 1GLCG 4CJPA 3NCIA 4DF8A 1KLMA 3J80O 4CJ5A 2HNDA 5J2PA 1NGBA 4YOUA 2PY5A 4KI4A 3L2RA 1CXQA 3M3ZA 4HUEA 4E3SA 2YNFA 4AH9A 4CZLA 1BISA 4KH4A 4OO1J 2KKZA 5JICA 4JYAK 4IEIA 1OVQA 2P9IB 1VSDA 4CECA 4C8MA 4PY5A 1RILA 3MN6A 3SAGA 4BRMA 2W40A 3N4QA 5AQKA 3NVMA 3SLCA 5AQFA 5AQXA 1N5YA 4H4OA 3AA3A 5SWMA 3KK3A 4Z4FA 4FSVA 3VF6A 4BC3A 4KHPK 1GLAG 4M3RA 4IOCL 5IWAK 3CQYA 2GTDA 1XUPO 3NH0A 4JK7A 1NGJA 2D0BA 4A2AA 5F1XA 3G6EN 2WTUA 4W5NA 1CZBA 3O8MA 4DUZK 3SJJA 3S3MA 1HQUA 4FWMA 2G8VA 1R59O 2IDOA 3AAPA 3SZ2A 4H03B 3P31A 1TGOA 4CEEA 3ZSYA 4RW9A 3PX4A 3CCQN 4ELVA 1HRHA 1B92A 3VQPA 2ZQBA 2KFNA 3OYJA 4B3SK 1VQ8N 4RW4A 5HROA 4TSXA 1XMOK 1W7AA 2G8UA 2CH5A 1SL1A 2W41A 3MCPA 3ATVA 2E6MA 4BRIA 1QQNA 4CERA 3U6FA 5GIPA 3A5OC 4CD3A 4I6MB 4Z4CA 1GOCA 1ZYQA 4CBXA 3TANA 3S41A 3K5OA 3MXJA 2P9SA 3CCRN 3VGLA 4UY8O 4KHYA 5LMNK 1DEJA 2Y1JA 1NOZA 3GE1A 4MLEA 1NJZA 2PFUA 3D7EO 4B3MK 1HNZK 2DTUA 1N33K 1NLVA 3QNNA 2P9KB 4GVMA 3SUNA 3DXMA 4YNQA 2X74A 4F3OA 5AZIB 2P9SB 1BUPA 1XC3A 2B4JA 4IJNA 5AQTA 4Q0BA 1HNIA 2GBZA 3TPQA 5E26A 4BC4A 3THVA 2E6LA 5BPMA 2YI1A 3UKRB 2KW4A 1ASUA 2NUBA 4JI6K 1J54A 3CJ1A 4KHSA 3CETA 3O4QA 2QXLA 4BROA 2O8BB 1KAZA 2AJQA 4CGDA 4BQLA 3KK7A 1VK0A 4DTRA 5LJVA 3OYDA 1T3VA 2A40A 1X1PA 2HF3A 5FPDA 4DUYK 1TV6A 1Q9XA 1VQMN 1HKGA 4CEOA 1C0FA 3QNOA 5GAHP 5SZTA 3JSMA 4M3WA 3FLCO 1IG8A 5HRSA 4AHVA 3M1FA 1WLJA 2NRRA 5EVZA 3I56N 3DMJA 3QEXA
chains in the Genus database with same CATH topology
4E7KA 1SKWA 4RW6A 4K8XA 5J2NA 4AILC 1T8EA 4KTWA 4DQSA 4KI6A 3VQQA 4M3YA 4Y1CA 4CJWA 4CJFA 4FJHA 3S3OA 4N56A 3T19A 3ULDA 4DLGA 4MQ3A 1JKHA 1S1UA 4EP5A 4CJRA 5KGWA 4KTZA 4OJRA 3O3GA 3OYEA 5D3GA 1JLQA 4AHSA 3FFIA 4FM1A 1QE1A 2Z1HA 4KKOA 4CJEA 1IKXA 4DF4A 1EKEA 3PX6A 2ETJA 3LPTA 1TK8A 4CHPA 1REVA 3AVLA 1U04A 1UAXA 2G8HA 3VQ5A 4FM2A 4FZYA 4KRFA 3K2PA 2RF2A 4E0DA 3AVBA 1SL0A 1ITGA 1ZBLA 5HRNA 5KRTA 3OYIA 3TAFA 3V9WA 3DLHA 2HHVA 4CEZA 5C24A 4DU1A 4DFPA 3I8DA 3AO1A 2HNZA 3HL8A 1TKDA 3KK2A 4B3OA 3DLGA 4ID5A 2P1JA 3IS9A 5FROA 3KD1E 3M8QA 3DRPA 4AHTA 3K5MA 4KHUA 3MEDA 2HVIA 1JLAA 4Z4HA 4DTPA 2DFFA 3ASMA 4OPKA 3I0SA 3HVRA 1NKCA 3RWUA 3DOKA 4YFUA 3BGRA 3DRSA 4CHZA 5CYQA 3QESA 3V4IA 4OLAA 2P5OA 4HVJA 4E7HA 1YT3A 1IKWA 2RPIA 3QO9A 4B9TA 2F96A 4J2DA 1RNHA 2IGIA 1BQNA 4CIFA 1J5OA 4CHYA 2GV9A 1RBVA 4CJ4A 4LH4A 4Z4EA 4EZ6A 1RTHA 3CFRA 1GOBA 4F8RA 3VQ7A 3L2UA 2G8WA 3AVJA 3AA5X 3MEGA 3O3FA 3RMAA 4AHRA 4KHWA 5J2QA 1U47A 2Z1GA 2JGUA 1SKRA 4RG8A 4CFAA 4AHCA 1UA0A 4M42A 4RW7A 1LWEA 4I9QA 4KHNA 3SUQA 4NCAA 4G1QA 1RDBA 3KTQA 1VSEA 3T3FA 4FXDA 3NF8A 3OS0A 3HM9A 1KCFA 4LSLA 4KB1A 4FW2A 4FLUA 4DTNA 3QEIA 3SCXA 3NGYA 2YKMA 4CIGA 1C0TA 4FVMA 4DFJA 1KFDA 2YHBA 3L2QA 3TAPA 3LPUA 3AVAA 1ZBHA 3HK2A 1QTMA 3AVKA 1VSHA 4DTJA 4EZ9A 2IC3A 5CY4A 1LAWA 3ZT2A 1NKBA 3TAMA 1RT2A 2P51A 1BCOA 3V1QA 4DSIA 2Q3SA 4OKEA 3ZSRA 2YNGA 4LH5A 3VQCA 4CK3A 2FBYA 3OS2A 1FXXA 1TL3A 4UQGA 3PX0A 4ID1A 4F2SA 1VSIA 2YHAA 4K8ZA 4CF1A 3IAYA 2OPQA 4CF0A 3RMDA 1NK8A 4J2AA 3AO3A 3ZT3A 1VRTA 1KFSA 5CYMA 1NK6A 3U3GA 4CGIA 4FJJA 4B8CA 3OYCA 3F73A 3RRGA 4CF2A 4CGFA 1UOCA 3LANA 4WE1A 1BL3A 3QEWA 2PYLA 1LWCA 4M45A 4JS4A 3ZSOA 1KVBA 4E19A 3KKSA 4FLYA 3C94A 1L3SA 1ZBIA 3DOLA 1RDCA 1JL1A 3QIOA 4C8LA 4AHUA 3QIPA 1HYSA 1S9EA 3TI0A 4OPJA 2HHWA 2VWKA 1KLNA 4I2QA 1DTTA 1YVUA 1QSSA 4KTQA 3M8RA 3WNHA 2X6SA 4RW8A 3WNFA 3AO4A 4DTMA 1W0HA 1S1WA 2YV0X 2XRIA 3LZIA 2XHBA 5J2MA 1SL2A 3PO5A 4L8RB 4DMNA 4IBNA 3ZCMA 5CZ1A 4BWMA 3NF9A 5EU7A 1RDAA 4ZTFA 1NJWA 1C0UA 4OGCA 4QOZB 2IOCA 1KVCA 4DSJA 1CLQA 3HPOA 1LWFA 4FK4A 2VG7A 1BI4B 1WN7A 3TAGA 2B6AA 3O4NA 3SUPA 3O3HA 1YTUA 4ICLA 3K58A 3RTVA 3LP0A 3P5JA 4O0JA 2HHTA 1YTAA 1VSMA 3MEEA 1CXUA 4IFVA 4NYNA 2O4IA 4OKKA 1RBSA 2FBVA 4XIUA 5FRNA 3ISNC 3HO1A 2IS3A 1TK0A 3E01A 4NCGA 1J53A 3S3NA 5KI6A 1C1CA 1KSPA 5JS2A 1ZBUA 3L2VA 4JS5A 4HUGA 2XY7A 1WAJA 4O55A 2FBXA 4CJLA 4FJXA 1QHTA 4CJKA 4PWDA 4LY7A 3HSTB 2RN2A 1XC9A 3CFPA 4FM0A 1W9HA 3SQ2A 1L3UA 2HB5A 3V9ZA 1QQCA 2EX3A 3S9HA 1TK5A 2E4LA 4W5TA 4E1NA 3U3YA 3OYFA 3TABA 4IKFA 3HT3A 4IDKA 3SQ4A 3WNEA 3VQEA 1HMVA 3DLRA 3SYZA 3SI6A 2YKNA 1C6VA 3KLFA 3OYHA 4DQQA 4M3TA 3NH2A 1LW0A 4DQIA 3DYAA 4O4GA 3M8PA 4CJUA 4W5RA 1UWBA 3TARA 2KZMA 3SUOA 3VQ6A 4QCLA 3RMCA 4DTOA 1XI1A 1NK7A 1KRPA 4CEFA 1LAVA 3H08A 4FW1A 3I0RA 3KLIA 2R7YA 4E7LA 4IG0A 3TWHA 2HHXA 4DG1A 4DTUA 4OKJA 3LP3A 3PUFA 4FJNA 3NAEA 4M3UA 1A5XA 1A5VA 2HVHA 3QLHA 1I39A 1NK4A 1HPZA 2KZZA 4CFCA 1BCMA 2QK9A 3AVIA 1HQEA 1LV5A 1L5UA 2OA8A 3TR8A 3C6TA 4KB0A 3KLHA 3AO2A 4FJMA 4KREA 4ZTJA 1RBTA 4HUFA 3NE6A 2KQ2A 1QSYA 3HP9A 1BGXT 1UA1A 3B6OA 3NFAA 4CK1A 1T03A 4FZXC 3PO4A 4GW6A 4B8AB 4KHQA 1BI4A 4DU4A 1Z26A 1U49A 3G10A 4DSFA 1IKYA 4CGGA 2HHUA 3AVGA 2D5RA 1TAUA 4DWIA 1O1WA 1EX4A 1Y97A 3L2WA 2QKKA 1DTQA 3ZT0A 3OYAA 4DQPA 3ZSQA 4PA1A 3OJSA 4BE2A 2OPPA 2BE2A 1FK9A 4BE1A 1HJRA 2PZSA 4H4MA 3OJUA 2VG5A 5KRSA 3CG7A 1S1TA 4O44A 4Z4IA 4B9NA 1X9MA 1VSJA 4CEDA 3AVNA 1JLCA 3OYBA 4KPYA 1D8YA 2XY5A 4FZZA 4O5BA 3KD5E 4BDZA 4B9MA 3AA4A 2F8TA 1WSIA 3V9SA 2A1RA 1L3TA 3P83D 1SKSA 3NBPA 3VQ9A 1S6PA 3PV8A 1K6YA 4FK2A 4C8OA 4CJSA 5KTQA 3QEVA 3B6PA 2Y1IA 4OGEA 3AV9A 4FJ8A 4BE0A 4BDYA 1LW2A 1VSKA 1SUQA 2RKIA 5J1EA 3F9KA 3SPYA 1IH7A 1J9AA 1GOAA 3V6DA 4HCBA 3WNGA 4LSNA 3KK1A 1NK0A 3AVHA 3NDKA 4HCCA 5FRMA 1TVRA 3IG1A 4BWJA 2LSNA 3TAQA 1WNSA 3NGZA 3OYMA 4Z4GA 5C42A 1BQMA 5HP1A 3RR7A 3DLKA 4DLEA 3V1RA 4FLXA 3HJFA 3DRRA 1Q8IA 2FC0A 3OVNA 1JL2A 3LAMA 1JLBA 1MU2A 3L3VA 1RBRA 5K14A 2DFHA 2GUIA 3V81A 3K5LA 4MFBA 4BACA 1N6QA 4QAGA 4Q5VA 4I7FA 4J2EA 3KLGA 3CM5A 1WSEA 1D9FA 3ALYA 4FK0A 4I2PA 3ZT1A 4CHQA 1C1AA 1G15A 4KO0A 3LWLA 4N76A 3NF7A 2OPSA 4HTUA 4E7IA 4CJPA 3NCIA 4DF8A 1KLMA 4B9LA 2Z1IA 1X9WA 4N41A 5HRPA 4CJ5A 3RRHA 2HNDA 4C8NA 1KTQA 5J2PA 3MXMA 1NK9A 2PY5A 3KKRA 1X9SA 4B9UA 4KI4A 3L2RA 1CXQA 4FYDA 4HUEA 4E3SA 2YNFA 4CF9A 1WSFA 3DI6A 4AH9A 1IG9A 1ASWA 4JRPA 4F2RA 1BISA 4CHOA 2BGGA 2D0AA 3C95A 1WSJA 2XY8A 4R5PA 3HXMA 2VWJA 2ITGA 3SPZA 4DSEA 1RT3A 1VSDA 2HW3A 2HNYA 3DM2A 4CECA 3V9XA 4FJGA 4C8MA 4M41A 5DK5A 5HLFA 4PY5A 1RILA 1U48A 4CK2A 5CZ2A 2XY6A 3T1AA 2OYQA 1RCHA 2OZMA 1IKVA 3RR8A 3ITHA 3OYKA 4ELUA 4J2BA 4O0IA 3SQ1A 3OS1A 4FJLA 2A1SA 1F21A 1RT4A 4PUOA 4M3XA 2HHSA 4F4KA 4LD0A 4H4OA 3OYGA 3AA3A 2QXFA 5SWMA 1N5YA 1RT6A 4CJTA 3QINA 1A5WA 3D45A 3KK3A 4GMJB 1DLOA 2B5JA 3LDSA 4Z4FA 4OLBA 2F8SA 1S9GA 3JYTA 1XHZA 3VQAA 1NK5A 1RT5A 3HYFA 4Y1DA 4M3RA 1RT7A 4N5SA 3HPHA 3CFOA 1NKEA 4PQUA 1ZBFA 4CE9A 3EYZA 3DLEA 4E89A 1TKTA 3CQ8A 3NH0A 4C8KA 3PY8A 2G8KA 2D0BA 2ZD1A 4IG3A 4W5NA 3ZSXA 1CZBA 4ELTA 3SJJA 4CJ3A 1S5JA 4CIEA 3S3MA 3AO5A 3LAKA 1HQUA 4CGJA 3SV4A 2G8VA 2DY4A 4FJ7A 2IDOA 1WSGA 1BIUA 3SZ2A 3NHGA 1FKPA 4JRQA 1WAFA 1QSLA 1SV5A 1S6QA 3KLEA 2G8FA 2YNHA 5C25A 3NH1A 3RMBA 2YNIA 1TGOA 3LWMA 2EHGA 4CEEA 4CCHA 1JXEA 3A2FA 4RW9A 3ZSYA 4CF8A 5HBMA 2OZSA 1VSFA 3VQDA 3PX4A 3L3UA 2P5GA 2BANA 2DFEA 1JLGA 1EETA 4ELVA 1HRHA 4DQRA 2HHQA 1B92A 1EXQA 1TKXA 2ATQA 4W5QA 1D5AA 1VRUA 2ZQBA 4KFBA 3VQPA 3OYJA 1Z25A 5KGXA 3VA0A 2KFNA 1XWLA 3ZT4A 1S1VA 3LP1A 4RW4A 4TSXA 2I5JA 3OYNA 4CEAA 4FLZA 5HROA 3HVTA 3BDPA 3LP2A 3G0ZA 2G8UA 3DLBA 3UIQA 1SL1A 1RTDA 3V1OA 5I42A 2E6MA 1HYZA 3KJVA 3P1GA 3K59A 1KVAA 4CERA 3U6FA 1T7PA 1U45A 3QEPA 2WOMA 3EY1A 1B9FA 4ZHRA 3CYMA 3M8SA 1T05A 3VQ8A 2Z1JA 2W42A 4Z4CA 1GOCA 3SV3A 4NYFA 3K57A 3D0PA 2X78A 1ZYQA 2D0CA 3TANA 4FJ9A 2QKBA 1NJYA 1NJXA 3K5OA 2O4GA 2HMIA 3MXJA 4CGHA 4EP4A 5DMRA 4B9VA 4B08A 4KHYA 2Y1JA 1NOZA 1EP4A 3ZSVA 1NJZA 3KIOA 1Q9YA 3CM6A 3L8BA 4FLWA 4DS4A 1HNVA 3MXIA 2DTUA 4F3TA 3QNNA 3AVCA 2JLEA 4CFDA 4GVMA 3EZ5A 4H8KA 3SUNA 2PYJA 4YNQA 2X74A 4KAZA 1RT1A 2OPRA 4CEBA 4F3OA 4CEQA 1XHXA 1I3AA 2B4JA 2XO7A 3LALA 2WONA 1TAQA 1BIZA 4Q0BA 4FJ5A 4FJKA 1HNIA 3MAQA 1NOYA 2GBZA 2VG6A 4OVLA 4CJVA 3VN5A 4I9LA 1JLEA 3THVA 4DTSA 2E6LA 4HHTA 4IFYA 4Z0UA 1B9DA 3ZSWA 4FCYA 3NF6A 4M3ZA 1WSHA 4DU3A 2KW4A 4E1MA 1ASUA 2NUBA 5E41A 3V9UA 2KTQA 3AA2A 3OYLA 2X6NA 1J54A 4KV8A 1L3VA 4KHSA 1ASVA 1VSLA 3O4QA 3SQ0A 4CHNA 4B9SA 3ZSZA 4W5OA 4CJQA 5FDLA 2AJQA 3C6UA 4FLTA 1FKOA 1RTJA 4CESA 4DSKA 2G8IA 1RDDA 4CGDA 2KFZA 4DFKA 4DTXA 1C0MA 3QETA 1VK0A 4DTRA 2ZE2A 3NGIA 4FJIA 2IAJA 1D9DA 3AVMA 2BDPA 3OYDA 1U4BA 1IO2A 1QS4A 4E7JA 1R0AA 1X1PA 1TL1A 4NCBA 1RBUA 5JS1A 1BHLA 3VA3A 1JXBA 1TV6A 1Q9XA 4DFMA 3HP6A 4CEOA 5T7BA 3QNOA 1C1BA 4JLHA 3K5NA 3AVFA 1JLFA 5HRRA 4CFBA 1CZ9A 5SZTA 3JSMA 2FBTA 3MECA 3LZJA 4FLVA 4BDPA 1RTIA 3VQ4A 4M3WA 3OY9A 4N47A 5HRSA 5I3UA 1TKZA 3TAEA 3HPGA 1S1XA 3SNNA 3VQBA 1WLJA 3IRXA 4AHVA 4DS5A 1HYVA 4DSLA 3QERA 3DMJA 3QEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7K A;  1SKW A;  4RW6 A;  4K8X A;  5J2N A;  4AIL C;  1T8E A;  4KTW A;  4DQS A;  4KI6 A;  3VQQ A;  4M3Y A;  4Y1C A;  4CJW A;  4CJF A;  4FJH A;  3S3O A;  4N56 A;  3T19 A;  3ULD A;  4DLG A;  4MQ3 A;  1JKH A;  1S1U A;  4EP5 A;  4CJR A;  5KGW A;  4KTZ A;  4OJR A;  3O3G A;  3OYE A;  5D3G A;  1JLQ A;  4AHS A;  3FFI A;  4FM1 A;  1QE1 A;  2Z1H A;  4KKO A;  4CJE A;  1IKX A;  4DF4 A;  1EKE A;  3PX6 A;  2ETJ A;  3LPT A;  1TK8 A;  4CHP A;  1REV A;  3AVL A;  1U04 A;  1UAX A;  2G8H A;  3VQ5 A;  4FM2 A;  4FZY A;  4KRF A;  3K2P A;  2RF2 A;  4E0D A;  3AVB A;  1SL0 A;  1ITG A;  1ZBL A;  5HRN A;  5KRT A;  3OYI A;  3TAF A;  3V9W A;  3DLH A;  2HHV A;  4CEZ A;  5C24 A;  4DU1 A;  4DFP A;  3I8D A;  3AO1 A;  2HNZ A;  3HL8 A;  1TKD A;  3KK2 A;  4B3O A;  3DLG A;  4ID5 A;  2P1J A;  3IS9 A;  5FRO A;  3KD1 E;  3M8Q A;  3DRP A;  4AHT A;  3K5M A;  4KHU A;  3MED A;  2HVI A;  1JLA A;  4Z4H A;  4DTP A;  2DFF A;  3ASM A;  4OPK A;  3I0S A;  3HVR A;  1NKC A;  3RWU A;  3DOK A;  4YFU A;  3BGR A;  3DRS A;  4CHZ A;  5CYQ A;  3QES A;  3V4I A;  4OLA A;  2P5O A;  4HVJ A;  4E7H A;  1YT3 A;  1IKW A;  2RPI A;  3QO9 A;  4B9T A;  2F96 A;  4J2D A;  1RNH A;  2IGI A;  1BQN A;  4CIF A;  1J5O A;  4CHY A;  2GV9 A;  1RBV A;  4CJ4 A;  4LH4 A;  4Z4E A;  4EZ6 A;  1RTH A;  3CFR A;  1GOB A;  4F8R A;  3VQ7 A;  3L2U A;  2G8W A;  3AVJ A;  3AA5 X;  3MEG A;  3O3F A;  3RMA A;  4AHR A;  4KHW A;  5J2Q A;  1U47 A;  2Z1G A;  2JGU A;  1SKR A;  4RG8 A;  4CFA A;  4AHC A;  1UA0 A;  4M42 A;  4RW7 A;  1LWE A;  4I9Q A;  4KHN A;  3SUQ A;  4NCA A;  4G1Q A;  1RDB A;  3KTQ A;  1VSE A;  3T3F A;  4FXD A;  3NF8 A;  3OS0 A;  3HM9 A;  1KCF A;  4LSL A;  4KB1 A;  4FW2 A;  4FLU A;  4DTN A;  3QEI A;  3SCX A;  3NGY A;  2YKM A;  4CIG A;  1C0T A;  4FVM A;  4DFJ A;  1KFD A;  2YHB A;  3L2Q A;  3TAP A;  3LPU A;  3AVA A;  1ZBH A;  3HK2 A;  1QTM A;  3AVK A;  1VSH A;  4DTJ A;  4EZ9 A;  2IC3 A;  5CY4 A;  1LAW A;  3ZT2 A;  1NKB A;  3TAM A;  1RT2 A;  2P51 A;  1BCO A;  3V1Q A;  4DSI A;  2Q3S A;  4OKE A;  3ZSR A;  2YNG A;  4LH5 A;  3VQC A;  4CK3 A;  2FBY A;  3OS2 A;  1FXX A;  1TL3 A;  4UQG A;  3PX0 A;  4ID1 A;  4F2S A;  1VSI A;  2YHA A;  4K8Z A;  4CF1 A;  3IAY A;  2OPQ A;  4CF0 A;  3RMD A;  1NK8 A;  4J2A A;  3AO3 A;  3ZT3 A;  1VRT A;  1KFS A;  5CYM A;  1NK6 A;  3U3G A;  4CGI A;  4FJJ A;  4B8C A;  3OYC A;  3F73 A;  3RRG A;  4CF2 A;  4CGF A;  1UOC A;  3LAN A;  4WE1 A;  1BL3 A;  3QEW A;  2PYL A;  1LWC A;  4M45 A;  4JS4 A;  3ZSO A;  1KVB A;  4E19 A;  3KKS A;  4FLY A;  3C94 A;  1L3S A;  1ZBI A;  3DOL A;  1RDC A;  1JL1 A;  3QIO A;  4C8L A;  4AHU A;  3QIP A;  1HYS A;  1S9E A;  3TI0 A;  4OPJ A;  2HHW A;  2VWK A;  1KLN A;  4I2Q A;  1DTT A;  1YVU A;  1QSS A;  4KTQ A;  3M8R A;  3WNH A;  2X6S A;  4RW8 A;  3WNF A;  3AO4 A;  4DTM A;  1W0H A;  1S1W A;  2YV0 X;  2XRI A;  3LZI A;  2XHB A;  5J2M A;  1SL2 A;  3PO5 A;  4L8R B;  4DMN A;  4IBN A;  3ZCM A;  5CZ1 A;  4BWM A;  3NF9 A;  5EU7 A;  1RDA A;  4ZTF A;  1NJW A;  1C0U A;  4OGC A;  4QOZ B;  2IOC A;  1KVC A;  4DSJ A;  1CLQ A;  3HPO A;  1LWF A;  4FK4 A;  2VG7 A;  1BI4 B;  1WN7 A;  3TAG A;  2B6A A;  3O4N A;  3SUP A;  3O3H A;  1YTU A;  4ICL A;  3K58 A;  3RTV A;  3LP0 A;  3P5J A;  4O0J A;  2HHT A;  1YTA A;  1VSM A;  3MEE A;  1CXU A;  4IFV A;  4NYN A;  2O4I A;  4OKK A;  1RBS A;  2FBV A;  4XIU A;  5FRN A;  3ISN C;  3HO1 A;  2IS3 A;  1TK0 A;  3E01 A;  4NCG A;  1J53 A;  3S3N A;  5KI6 A;  1C1C A;  1KSP A;  5JS2 A;  1ZBU A;  3L2V A;  4JS5 A;  4HUG A;  2XY7 A;  1WAJ A;  4O55 A;  2FBX A;  4CJL A;  4FJX A;  1QHT A;  4CJK A;  4PWD A;  4LY7 A;  3HST B;  2RN2 A;  1XC9 A;  3CFP A;  4FM0 A;  1W9H A;  3SQ2 A;  1L3U A;  2HB5 A;  3V9Z A;  1QQC A;  2EX3 A;  3S9H A;  1TK5 A;  2E4L A;  4W5T A;  4E1N A;  3U3Y A;  3OYF A;  3TAB A;  4IKF A;  3HT3 A;  4IDK A;  3SQ4 A;  3WNE A;  3VQE A;  1HMV A;  3DLR A;  3SYZ A;  3SI6 A;  2YKN A;  1C6V A;  3KLF A;  3OYH A;  4DQQ A;  4M3T A;  3NH2 A;  1LW0 A;  4DQI A;  3DYA A;  4O4G A;  3M8P A;  4CJU A;  4W5R A;  1UWB A;  3TAR A;  2KZM A;  3SUO A;  3VQ6 A;  4QCL A;  3RMC A;  4DTO A;  1XI1 A;  1NK7 A;  1KRP A;  4CEF A;  1LAV A;  3H08 A;  4FW1 A;  3I0R A;  3KLI A;  2R7Y A;  4E7L A;  4IG0 A;  3TWH A;  2HHX A;  4DG1 A;  4DTU A;  4OKJ A;  3LP3 A;  3PUF A;  4FJN A;  3NAE A;  4M3U A;  1A5X A;  1A5V A;  2HVH A;  3QLH A;  1I39 A;  1NK4 A;  1HPZ A;  2KZZ A;  4CFC A;  1BCM A;  2QK9 A;  3AVI A;  1HQE A;  1LV5 A;  1L5U A;  2OA8 A;  3TR8 A;  3C6T A;  4KB0 A;  3KLH A;  3AO2 A;  4FJM A;  4KRE A;  4ZTJ A;  1RBT A;  4HUF A;  3NE6 A;  2KQ2 A;  1QSY A;  3HP9 A;  1BGX T;  1UA1 A;  3B6O A;  3NFA A;  4CK1 A;  1T03 A;  4FZX C;  3PO4 A;  4GW6 A;  4B8A B;  4KHQ A;  1BI4 A;  4DU4 A;  1Z26 A;  1U49 A;  3G10 A;  4DSF A;  1IKY A;  4CGG A;  2HHU A;  3AVG A;  2D5R A;  1TAU A;  4DWI A;  1O1W A;  1EX4 A;  1Y97 A;  3L2W A;  2QKK A;  1DTQ A;  3ZT0 A;  3OYA A;  4DQP A;  3ZSQ A;  4PA1 A;  3OJS A;  4BE2 A;  2OPP A;  2BE2 A;  1FK9 A;  4BE1 A;  1HJR A;  2PZS A;  4H4M A;  3OJU A;  2VG5 A;  5KRS A;  3CG7 A;  1S1T A;  4O44 A;  4Z4I A;  4B9N A;  1X9M A;  1VSJ A;  4CED A;  3AVN A;  1JLC A;  3OYB A;  4KPY A;  1D8Y A;  2XY5 A;  4FZZ A;  4O5B A;  3KD5 E;  4BDZ A;  4B9M A;  3AA4 A;  2F8T A;  1WSI A;  3V9S A;  2A1R A;  1L3T A;  3P83 D;  1SKS A;  3NBP A;  3VQ9 A;  1S6P A;  3PV8 A;  1K6Y A;  4FK2 A;  4C8O A;  4CJS A;  5KTQ A;  3QEV A;  3B6P A;  2Y1I A;  4OGE A;  3AV9 A;  4FJ8 A;  4BE0 A;  4BDY A;  1LW2 A;  1VSK A;  1SUQ A;  2RKI A;  5J1E A;  3F9K A;  3SPY A;  1IH7 A;  1J9A A;  1GOA A;  3V6D A;  4HCB A;  3WNG A;  4LSN A;  3KK1 A;  1NK0 A;  3AVH A;  3NDK A;  4HCC A;  5FRM A;  1TVR A;  3IG1 A;  4BWJ A;  2LSN A;  3TAQ A;  1WNS A;  3NGZ A;  3OYM A;  4Z4G A;  5C42 A;  1BQM A;  5HP1 A;  3RR7 A;  3DLK A;  4DLE A;  3V1R A;  4FLX A;  3HJF A;  3DRR A;  1Q8I A;  2FC0 A;  3OVN A;  1JL2 A;  3LAM A;  1JLB A;  1MU2 A;  3L3V A;  1RBR A;  5K14 A;  2DFH A;  2GUI A;  3V81 A;  3K5L A;  4MFB A;  4BAC A;  1N6Q A;  4QAG A;  4Q5V A;  4I7F A;  4J2E A;  3KLG A;  3CM5 A;  1WSE A;  1D9F A;  3ALY A;  4FK0 A;  4I2P A;  3ZT1 A;  4CHQ A;  1C1A A;  1G15 A;  4KO0 A;  3LWL A;  4N76 A;  3NF7 A;  2OPS A;  4HTU A;  4E7I A;  4CJP A;  3NCI A;  4DF8 A;  1KLM A;  4B9L A;  2Z1I A;  1X9W A;  4N41 A;  5HRP A;  4CJ5 A;  3RRH A;  2HND A;  4C8N A;  1KTQ A;  5J2P A;  3MXM A;  1NK9 A;  2PY5 A;  3KKR A;  1X9S A;  4B9U A;  4KI4 A;  3L2R A;  1CXQ A;  4FYD A;  4HUE A;  4E3S A;  2YNF A;  4CF9 A;  1WSF A;  3DI6 A;  4AH9 A;  1IG9 A;  1ASW A;  4JRP A;  4F2R A;  1BIS A;  4CHO A;  2BGG A;  2D0A A;  3C95 A;  1WSJ A;  2XY8 A;  4R5P A;  3HXM A;  2VWJ A;  2ITG A;  3SPZ A;  4DSE A;  1RT3 A;  1VSD A;  2HW3 A;  2HNY A;  3DM2 A;  4CEC A;  3V9X A;  4FJG A;  4C8M A;  4M41 A;  5DK5 A;  5HLF A;  4PY5 A;  1RIL A;  1U48 A;  4CK2 A;  5CZ2 A;  2XY6 A;  3T1A A;  2OYQ A;  1RCH A;  2OZM A;  1IKV A;  3RR8 A;  3ITH A;  3OYK A;  4ELU A;  4J2B A;  4O0I A;  3SQ1 A;  3OS1 A;  4FJL A;  2A1S A;  1F21 A;  1RT4 A;  4PUO A;  4M3X A;  2HHS A;  4F4K A;  4LD0 A;  4H4O A;  3OYG A;  3AA3 A;  2QXF A;  5SWM A;  1N5Y A;  1RT6 A;  4CJT A;  3QIN A;  1A5W A;  3D45 A;  3KK3 A;  4GMJ B;  1DLO A;  2B5J A;  3LDS A;  4Z4F A;  4OLB A;  2F8S A;  1S9G A;  3JYT A;  1XHZ A;  3VQA A;  1NK5 A;  1RT5 A;  3HYF A;  4Y1D A;  4M3R A;  1RT7 A;  4N5S A;  3HPH A;  3CFO A;  1NKE A;  4PQU A;  1ZBF A;  4CE9 A;  3EYZ A;  3DLE A;  4E89 A;  1TKT A;  3CQ8 A;  3NH0 A;  4C8K A;  3PY8 A;  2G8K A;  2D0B A;  2ZD1 A;  4IG3 A;  4W5N A;  3ZSX A;  1CZB A;  4ELT A;  3SJJ A;  4CJ3 A;  1S5J A;  4CIE A;  3S3M A;  3AO5 A;  3LAK A;  1HQU A;  4CGJ A;  3SV4 A;  2G8V A;  2DY4 A;  4FJ7 A;  2IDO A;  1WSG A;  1BIU A;  3SZ2 A;  3NHG A;  1FKP A;  4JRQ A;  1WAF A;  1QSL A;  1SV5 A;  1S6Q A;  3KLE A;  2G8F A;  2YNH A;  5C25 A;  3NH1 A;  3RMB A;  2YNI A;  1TGO A;  3LWM A;  2EHG A;  4CEE A;  4CCH A;  1JXE A;  3A2F A;  4RW9 A;  3ZSY A;  4CF8 A;  5HBM A;  2OZS A;  1VSF A;  3VQD A;  3PX4 A;  3L3U A;  2P5G A;  2BAN A;  2DFE A;  1JLG A;  1EET A;  4ELV A;  1HRH A;  4DQR A;  2HHQ A;  1B92 A;  1EXQ A;  1TKX A;  2ATQ A;  4W5Q A;  1D5A A;  1VRU A;  2ZQB A;  4KFB A;  3VQP A;  3OYJ A;  1Z25 A;  5KGX A;  3VA0 A;  2KFN A;  1XWL A;  3ZT4 A;  1S1V A;  3LP1 A;  4RW4 A;  4TSX A;  2I5J A;  3OYN A;  4CEA A;  4FLZ A;  5HRO A;  3HVT A;  3BDP A;  3LP2 A;  3G0Z A;  2G8U A;  3DLB A;  3UIQ A;  1SL1 A;  1RTD A;  3V1O A;  5I42 A;  2E6M A;  1HYZ A;  3KJV A;  3P1G A;  3K59 A;  1KVA A;  4CER A;  3U6F A;  1T7P A;  1U45 A;  3QEP A;  2WOM A;  3EY1 A;  1B9F A;  4ZHR A;  3CYM A;  3M8S A;  1T05 A;  3VQ8 A;  2Z1J A;  2W42 A;  4Z4C A;  1GOC A;  3SV3 A;  4NYF A;  3K57 A;  3D0P A;  2X78 A;  1ZYQ A;  2D0C A;  3TAN A;  4FJ9 A;  2QKB A;  1NJY A;  1NJX A;  3K5O A;  2O4G A;  2HMI A;  3MXJ A;  4CGH A;  4EP4 A;  5DMR A;  4B9V A;  4B08 A;  4KHY A;  2Y1J A;  1NOZ A;  1EP4 A;  3ZSV A;  1NJZ A;  3KIO A;  1Q9Y A;  3CM6 A;  3L8B A;  4FLW A;  4DS4 A;  1HNV A;  3MXI A;  2DTU A;  4F3T A;  3QNN A;  3AVC A;  2JLE A;  4CFD A;  4GVM A;  3EZ5 A;  4H8K A;  3SUN A;  2PYJ A;  4YNQ A;  2X74 A;  4KAZ A;  1RT1 A;  2OPR A;  4CEB A;  4F3O A;  4CEQ A;  1XHX A;  1I3A A;  2B4J A;  2XO7 A;  3LAL A;  2WON A;  1TAQ A;  1BIZ A;  4Q0B A;  4FJ5 A;  4FJK A;  1HNI A;  3MAQ A;  1NOY A;  2GBZ A;  2VG6 A;  4OVL A;  4CJV A;  3VN5 A;  4I9L A;  1JLE A;  3THV A;  4DTS A;  2E6L A;  4HHT A;  4IFY A;  4Z0U A;  1B9D A;  3ZSW A;  4FCY A;  3NF6 A;  4M3Z A;  1WSH A;  4DU3 A;  2KW4 A;  4E1M A;  1ASU A;  2NUB A;  5E41 A;  3V9U A;  2KTQ A;  3AA2 A;  3OYL A;  2X6N A;  1J54 A;  4KV8 A;  1L3V A;  4KHS A;  1ASV A;  1VSL A;  3O4Q A;  3SQ0 A;  4CHN A;  4B9S A;  3ZSZ A;  4W5O A;  4CJQ A;  5FDL A;  2AJQ A;  3C6U A;  4FLT A;  1FKO A;  1RTJ A;  4CES A;  4DSK A;  2G8I A;  1RDD A;  4CGD A;  2KFZ A;  4DFK A;  4DTX A;  1C0M A;  3QET A;  1VK0 A;  4DTR A;  2ZE2 A;  3NGI A;  4FJI A;  2IAJ A;  1D9D A;  3AVM A;  2BDP A;  3OYD A;  1U4B A;  1IO2 A;  1QS4 A;  4E7J A;  1R0A A;  1X1P A;  1TL1 A;  4NCB A;  1RBU A;  5JS1 A;  1BHL A;  3VA3 A;  1JXB A;  1TV6 A;  1Q9X A;  4DFM A;  3HP6 A;  4CEO A;  5T7B A;  3QNO A;  1C1B A;  4JLH A;  3K5N A;  3AVF A;  1JLF A;  5HRR A;  4CFB A;  1CZ9 A;  5SZT A;  3JSM A;  2FBT A;  3MEC A;  3LZJ A;  4FLV A;  4BDP A;  1RTI A;  3VQ4 A;  4M3W A;  3OY9 A;  4N47 A;  5HRS A;  5I3U A;  1TKZ A;  3TAE A;  3HPG A;  1S1X A;  3SNN A;  3VQB A;  1WLJ A;  3IRX A;  4AHV A;  4DS5 A;  1HYV A;  4DSL A;  3QER A;  3DMJ A;  3QEX A; 
#chains in the Genus database with same CATH topology
 4E7K A;  1SKW A;  3A0I X;  3FZH A;  5AQM A;  2VWB A;  4AIL C;  4H0O A;  1T8E A;  4KTW A;  4KI6 A;  3VQQ A;  4M3Y A;  1NJI O;  4FJH A;  3S3O A;  3T19 A;  4DLG A;  1JKH A;  4EP5 A;  4CJR A;  4KTZ A;  3OYE A;  2QA4 N;  3FFI A;  4FM1 A;  2Z1H A;  4DF4 A;  1IKX A;  2V7Y A;  3PX6 A;  4PKG A;  2ETJ A;  2E2P A;  1UAX A;  4FZY A;  1SL0 A;  5KRT A;  3OYI A;  4PL7 A;  3V9W A;  3DLH A;  3O9S A;  2NRW A;  1HKC A;  3AO1 A;  3ZX0 A;  4K0K K;  1JJ2 M;  2P1J A;  3IS9 A;  5FRO A;  3VEW A;  2P9U B;  3M8Q A;  3ID8 A;  4KHU A;  4FWO A;  4JD2 B;  2HVI A;  1C0G A;  5GIN A;  4OPK A;  3I0S A;  3RWU A;  4YFU A;  2OAN A;  1RDW X;  5CYQ A;  4B9T A;  1IKW A;  2E1Y A;  4J2D A;  3LDN A;  5LY3 A;  4CHY A;  2GV9 A;  5KQD A;  3CPE A;  1QZ5 A;  1HNW K;  3AA5 X;  3MEG A;  3E66 A;  3ENB A;  4O8U A;  2NNW A;  3ENO A;  3RMA A;  1K73 O;  2JGU A;  1SKR A;  4B1U B;  4CFA A;  1MA9 B;  1UA0 A;  4M42 A;  3D2E B;  1J5E K;  4NCA A;  2A6A A;  3R6M A;  1WBB A;  4FXD A;  1NU0 A;  3MWP A;  3VEV A;  4DTN A;  5IT9 O;  3NGY A;  1C0T A;  1KFD A;  3SMP A;  3BF1 A;  3G4S N;  3CCJ N;  3C65 A;  1OH5 A;  1QTM A;  2IC3 A;  5CY4 A;  1NKB A;  1RT2 A;  2P51 A;  3HTV A;  3V1Q A;  2Q3S A;  4JI4 K;  2E5L K;  1KAY A;  4LH5 A;  3VQC A;  4WFB L;  4RTF D;  1FXX A;  1TL3 A;  5CHI A;  3PX0 A;  4F2S A;  1VSI A;  2YHA A;  4K8Z A;  2F4V K;  1QVG M;  3AO3 A;  1YUW A;  1VQ4 N;  4BC2 A;  4EFH A;  1MDU B;  4BRH A;  3THW B;  4WE1 A;  3QEW A;  2FLO A;  4JKH A;  5AFU A;  1RDC A;  4C8L A;  1VQ6 N;  1SZ2 A;  1S9E A;  4EHT A;  2HHW A;  2VWK A;  3O1B A;  1QSS A;  1LCU A;  3MX2 A;  3OBW A;  3JAM O;  2YV0 X;  5AQN A;  4BWM A;  1NJW A;  2E1Z A;  2IOC A;  1CLQ A;  4YDU A;  3HPO A;  3BEX A;  4O5F A;  3O4N A;  2W6K A;  3K58 A;  2ZJP L;  4X65 K;  4OKK A;  4FWR A;  1RBS A;  2FBV A;  3SJH A;  3WEE A;  1J53 A;  1NWK A;  2H3G X;  4FJX A;  4CJL A;  3ZEU B;  4ISE A;  1VQK N;  3SQ2 A;  2HB5 A;  1QQC A;  1TK5 A;  4IKF A;  2E2O A;  3QFP A;  1X3M A;  2P9P A;  4LFC K;  1HMV A;  3SYZ A;  4M3T A;  3NH2 A;  4DQI A;  4ILG B;  3CD6 N;  3TSP A;  3VQ6 A;  2FSJ A;  3EKS A;  3RMC A;  3GDQ A;  4QCL A;  1P90 A;  4CEF A;  1LAV A;  4NXM K;  4DV4 K;  4FWS A;  2HVH A;  4U67 L;  1HPZ A;  4CFC A;  4FL9 A;  1NGE A;  1LV5 A;  1L5U A;  3C6T A;  4CBU A;  3QBW A;  4FJM A;  4ZTJ A;  1FW6 A;  4FZX C;  3CJA A;  1VHX A;  3LDO A;  1BI4 A;  4CGG A;  1W2B M;  4DWI A;  1O1W A;  4G9Z A;  3ZT0 A;  4JN4 A;  4HWI A;  4BE2 A;  2OPP A;  4NLB A;  2FF3 B;  4BRL A;  3LM9 A;  4H4M A;  4H5W A;  5KRS A;  4Z4I A;  1X9M A;  1XNR K;  3O6W A;  3JXU A;  2XY5 A;  4WQ4 C;  4B3R K;  3KD5 E;  3N4P A;  1WSI A;  3V9S A;  3L0Q A;  4L3Q A;  2A1R A;  1YIJ N;  4JI7 K;  1S6P A;  1K6Y A;  4C8O A;  3KWI A;  1BWF O;  5KTQ A;  4RCH A;  3DXK B;  1GLF O;  5M1Q A;  4BE0 A;  4BDY A;  1VSK A;  2RKI A;  2O8E A;  3F9K A;  4HCB A;  2F9W A;  1NK0 A;  4HCC A;  2P9L A;  1IJJ A;  4BWJ A;  3WXJ A;  3H3O B;  5C42 A;  1BQM A;  5AQZ A;  1IBM K;  3HJF A;  2Q0U A;  1Q8I A;  3DRR A;  4BRA A;  1MU2 A;  1RBR A;  2GWJ A;  4B1Z A;  1T6C A;  4AM7 A;  4QAG A;  4J2E A;  2O8E B;  4I2P A;  1HNX K;  1C1A A;  4MDB A;  2P9L B;  1OH7 A;  4ILJ A;  3NF7 A;  2OPS A;  4E7I A;  2YJF A;  2Z1I A;  5AZJ B;  1D4X A;  5HRP A;  4B9U A;  1TYQ A;  4FOI A;  1GLD G;  1WSF A;  3MDQ A;  2BGG A;  3C95 A;  3C7N A;  2XY8 A;  3HXM A;  4DV1 K;  4DR5 K;  2JWK A;  2FSK A;  5DK5 A;  3TTF A;  4IXC A;  2XY6 A;  3HOS A;  4GNI A;  2VQF K;  5KPZ A;  4MO4 A;  3RR8 A;  3ITH A;  3SQ1 A;  1HX1 A;  3OS1 A;  2A1S A;  4M3X A;  4R79 A;  3A8Y A;  4F4K A;  4DR6 K;  2YHY A;  4LD0 A;  3OYG A;  2AP1 A;  1U2V A;  5BRE A;  4H0X B;  1VQN N;  3O9T A;  3TTC A;  4H0T B;  3QIN A;  1YJW N;  4JV5 K;  1S9G A;  3T1H K;  1NK5 A;  1NKE A;  4N5S A;  3CFO A;  4Y0W A;  3BUZ B;  2Q2R A;  3DLE A;  3VER A;  4C8K A;  4CZJ A;  2ZD1 A;  3NMU A;  4JI2 K;  4JKE A;  4CVN E;  1S5J A;  4CIE A;  4CGJ A;  5AFU H;  4LF9 K;  2G8I A;  1BIU A;  1FKP A;  4JRQ A;  4WFA L;  3KLE A;  1S6Q A;  2YNH A;  3NH1 A;  4B9Q A;  1W97 L;  1JXE A;  1V4T A;  5HBM A;  4RWT A;  4B1W B;  2BAN A;  1JLG A;  3VGM A;  4I6M A;  4DQR A;  2HHQ A;  4W5Q A;  3VA0 A;  1D5A A;  2O8C B;  1XWL A;  5FPM A;  3LP1 A;  2I5J A;  4CEA A;  3HVT A;  3CC4 N;  3UIQ A;  3V1O A;  1WUA A;  1QVF M;  4JAX A;  3P1G A;  5EXW A;  1EWQ A;  2WOM A;  2ASO A;  3VQ8 A;  2Z1J A;  1I94 K;  4NYF A;  2QKB A;  1K8K A;  4DV3 K;  1NJY A;  2AA4 A;  2O4G A;  3DXM B;  5DMR A;  5AZI A;  4B08 A;  3GL1 A;  4M7X A;  3GBT A;  3EN9 A;  1EP4 A;  3FFK B;  1NGG A;  3I8B A;  3CM6 A;  4B3T K;  4FLW A;  1HNV A;  3GG4 A;  3Q7C A;  4F3T A;  2DPN A;  5AQG A;  3EZ5 A;  4H8K A;  4LC9 B;  4KAZ A;  4EIA A;  4CEQ A;  2XO7 A;  3LAL A;  2WON A;  4IO8 A;  4FWQ A;  1BIZ A;  5AQL A;  3J7Z O;  4FJ5 A;  3MAQ A;  2F7T A;  5AQW A;  1JLE A;  4HHT A;  1HR0 K;  4XEI A;  2HBL A;  2KTQ A;  4A57 A;  1L3V A;  4IOA L;  4B9S A;  4FLT A;  4DFK A;  4YOR A;  2ZGZ A;  3QET A;  1M90 O;  3NGI A;  4FJI A;  2IAJ A;  1D9D A;  2BDP A;  1U4B A;  4FVU A;  1NGD A;  2QWQ A;  1YJN N;  3EO3 A;  1RBU A;  1ILY A;  3VEN A;  5T7B A;  3QIC A;  3K5N A;  1JLF A;  1Q18 A;  5HRR A;  4CFB A;  3D2F A;  4FLV A;  5BR9 A;  1VQP N;  4BDP A;  4BR4 A;  3HPG A;  2HMP A;  3SNN A;  3VQB A;  3IRX A;  4DV2 K;  4FWN A;  5AQQ A;  4DSL A;  4FJK A;  3THY A;  3W0L A;  4FLZ A;  3KVG A;  4K8X A;  5J2N A;  4DQS A;  4X66 K;  5B8H A;  1MWK A;  4DR2 K;  4Y1C A;  3NVK A;  3CF5 L;  3CJ7 A;  5GAD P;  4N56 A;  3ULD A;  1S1U A;  3CXC M;  5MLC Q;  4EHU A;  4FJ7 A;  3LPT A;  1OKJ A;  1U04 A;  1EO1 A;  3K2P A;  1ZBL A;  1E4F T;  4IOX A;  4DU1 A;  2OTJ N;  2HNZ A;  3HL8 A;  1TKD A;  5M1P A;  1WBD A;  4JK8 A;  3DRP A;  3EZW A;  3K5M A;  3MED A;  2NLX A;  4DTP A;  3HVR A;  3F9M A;  4BRK A;  2F9T A;  3DOK A;  3BGR A;  4H0Y B;  5AR0 A;  2P5O A;  1YT3 A;  3OHR A;  1BQN A;  1RBV A;  4LH4 A;  1RTH A;  3WXL A;  3VQ7 A;  3L2U A;  3O80 A;  2OTL N;  4AHR A;  1HJO A;  4KH6 A;  2YX6 A;  5AZJ A;  2ASP A;  3HRG A;  3HZ6 A;  4I9Q A;  4FPA A;  3T3F A;  3OS0 A;  3HM9 A;  4LSL A;  4KB1 A;  4FW2 A;  4BC5 A;  1QZ6 A;  3QEI A;  4DFJ A;  2IVO A;  3TAP A;  4NXN K;  3HK2 A;  4FWL A;  3UKU A;  1GLE G;  1LAW A;  3IKM A;  4OKE A;  1G99 A;  3ZSR A;  2YNG A;  2FBY A;  3OS2 A;  2O8D A;  2UXC K;  5HL7 L;  4UQG A;  4GKK K;  4FWK A;  4J2A A;  3IAY A;  2OPQ A;  4CF0 A;  3ZT3 A;  1VRT A;  3U3G A;  3F73 A;  1K8A O;  3RRG A;  3H46 O;  4LFB K;  3EKU A;  3H45 C;  3M6G A;  1UOC A;  5AQO A;  3IUC A;  2VYP A;  3KKS A;  4FLY A;  3C94 A;  1XMQ K;  1L3S A;  2A41 A;  5EY4 A;  2WC9 A;  3TI0 A;  3VEX A;  4I2Q A;  5LMU K;  1NG9 A;  4CZI A;  4BR5 A;  3PIO L;  3AO4 A;  4DTM A;  2Q1N A;  1W0H A;  1S1W A;  3PO5 A;  2XRI A;  2XHB A;  4DMN A;  3THX B;  3NF9 A;  4WYB A;  4QOZ B;  4OGC A;  1JCG A;  1KVC A;  4BR9 A;  1LWF A;  4DB3 A;  1BI4 B;  4LF7 K;  4QS9 A;  4E1J A;  1NNE A;  4ICL A;  2HHT A;  1YTA A;  4IFV A;  3VF4 A;  2IS3 A;  1TK0 A;  3E01 A;  4NCG A;  3S3N A;  1C1C A;  5JS2 A;  3L2V A;  4A61 A;  2XY7 A;  2NRV A;  5ADX A;  3O9R A;  4CZE A;  3CFP A;  2CGJ A;  4FM0 A;  5C2D A;  1L3U A;  1NGA A;  1E4G T;  3CJB A;  3C0B A;  3S9H A;  4M7Y A;  3CCE N;  3U3Y A;  3OYF A;  4IDK A;  3WNE A;  1SAZ A;  2UUC K;  3SI6 A;  2YKN A;  1LW0 A;  1S22 A;  3DYA A;  4BY9 C;  3TAR A;  3ZET A;  3ULE B;  4K43 A;  3H08 A;  2NRZ A;  5JLH A;  1WOQ A;  2CGL A;  1A5X A;  1NK4 A;  4IEE A;  4QS8 A;  1U2V B;  3TR8 A;  3VMF B;  2W6L A;  1QSY A;  1RBT A;  4HUF A;  3NE6 A;  1BGX T;  5M1N A;  3NFA A;  1TUU A;  3PO4 A;  4B8A B;  5BN9 A;  5GAE P;  1U49 A;  3G10 A;  3ZSQ A;  3OJS A;  2BE2 A;  1FK9 A;  4BE1 A;  2PZS A;  3OJU A;  2VG5 A;  1S1T A;  3CC2 N;  2BTF A;  1YJ9 N;  1VSJ A;  3C7N B;  4CED A;  3OYB A;  3BZC A;  5F2R A;  4C23 A;  3CJC A;  4O5B A;  3JS6 A;  4CBW A;  3AA4 A;  2FF6 A;  4AM6 A;  2F8T A;  3P83 D;  3NBP A;  3VQ9 A;  3HSC A;  4YOT A;  2GEL A;  2V7Z A;  4OGE A;  1KD1 O;  1DKG D;  2E2Q A;  3WXM B;  4YY3 K;  4MLH A;  1IH7 A;  4H5R A;  1GOA A;  3KK1 A;  4JHD A;  2WUS A;  1CZA N;  2EWS A;  3BY5 A;  4Z4G A;  4B1V A;  3RR7 A;  1Z6R A;  4K41 A;  3OVN A;  2FC0 A;  5K14 A;  4K42 A;  2Q97 A;  4WF9 L;  1N6Q A;  3ZX2 A;  5BRH A;  3VF2 A;  3ZT1 A;  2O8B A;  4CHQ A;  2YJE A;  3D6R A;  4OPA A;  1KAX A;  4N76 A;  3H1V X;  4N41 A;  3RRH A;  1NK9 A;  4C8N A;  3MXM A;  2HF4 A;  4CZM A;  1X9S A;  5M1O A;  4FYD A;  4IO9 L;  3K9K A;  4CF9 A;  1ASW A;  4JRP A;  1ESV A;  4CHO A;  4R5P A;  2VWJ A;  4HTL A;  4M63 C;  2ITG A;  1N34 K;  4DSE A;  3OW2 M;  1Q86 O;  2HW3 A;  5AJ3 K;  3DM2 A;  3V9X A;  4FJG A;  1Z05 A;  3ZLJ A;  5HLF A;  1MWM A;  4CK2 A;  3T1A A;  4YHH K;  1OVY A;  1BU6 O;  1M1K O;  3WQT A;  2OZM A;  1IKV A;  3CPW M;  2YCH A;  4BRN A;  3OYK A;  1K9M O;  1NBW A;  3UE5 A;  4PUO A;  2RHK A;  1GLL O;  2QXF A;  1RT6 A;  1NGF A;  3KWG A;  2ZJR L;  3D45 A;  1NGI A;  2B5J A;  5KPR A;  4AF1 A;  4OLB A;  3JYT A;  4AQY K;  1XHZ A;  3VQA A;  1RT5 A;  3L6Q A;  1RT7 A;  3EE8 A;  4PQU A;  4CE9 A;  3EYZ A;  1J6Z A;  1TKT A;  2P9N A;  4IG3 A;  3ZSX A;  4FOE A;  4ELT A;  4CJ3 A;  2UXD K;  3AO5 A;  4DKW A;  4BRC A;  4FWP A;  1WSG A;  1SS6 A;  1WAF A;  1SV5 A;  3RMB A;  2YNI A;  3LWM A;  2EHG A;  2HBJ A;  3TU5 A;  3VTI A;  4CCH A;  3A2F A;  3ID6 A;  2P5G A;  3J7A P;  4DV7 K;  2DFE A;  3MK6 A;  4CZF A;  4Z94 A;  4H0P A;  1VRU A;  1Z25 A;  4CW7 B;  2ZWH A;  4U7B A;  3ZT4 A;  1S1V A;  3OYN A;  4WFN L;  3ZEU A;  3QML A;  3LP2 A;  3G0Z A;  1VQ5 N;  3DLB A;  1RTD A;  3IMX A;  3K59 A;  1T7P A;  3DWL A;  3CJ9 A;  5AQJ A;  2W42 A;  1WB9 A;  3K57 A;  2VQE K;  4FJ9 A;  3ENH A;  2QWP A;  1VQL N;  2HMI A;  1HPM A;  3UB5 A;  2HOE A;  3MN7 A;  3ZSV A;  2GEM A;  3KIO A;  1Q9Y A;  3OA9 A;  3L8B A;  4DS4 A;  2P9I A;  5H1S Q;  2JLE A;  4CFD A;  3EE9 A;  3E1Y A;  3THW A;  2PYJ A;  3SAF A;  1RT1 A;  2OPR A;  2NRH A;  1SQK A;  4A59 A;  4NLC A;  1XHX A;  3WXK A;  1I3A A;  5LJW A;  4DR4 K;  1E3M A;  2CGK A;  1NOY A;  2VG6 A;  4OVL A;  3FGU A;  3C6H A;  4CJV A;  3VN5 A;  4I9L A;  1ZBS A;  3AGK A;  3SBG A;  5E84 A;  4DTS A;  3DAW A;  3UKU B;  4FCY A;  3V9U A;  3MCA B;  4JKC A;  1ASV A;  1VSL A;  3SK3 A;  3SQ0 A;  4CHN A;  1ATN A;  4W5O A;  4CJQ A;  2O8D B;  1FKO A;  4CES A;  4DSK A;  1Q82 O;  1RDD A;  5KQ8 A;  2E8A A;  2KFZ A;  4DQ8 A;  4PL8 A;  4DTX A;  1C0M A;  2QWM A;  5AQH A;  3AVM A;  1NGC A;  2PBD A;  1QS4 A;  4E7J A;  5JS1 A;  3WEE B;  1BHL A;  3VA3 A;  5GIO A;  1JXB A;  3T1Y K;  4A5B A;  4FPB A;  4JLH A;  4EAH D;  3AVF A;  3K9J A;  4BG8 A;  4BRP A;  3VQ4 A;  4LF8 K;  4XH5 A;  4ILH A;  4BR0 A;  1S1X A;  3BF3 A;  4DS5 A;  3R1X A;  3CMA N;  1NGH A;  5BR8 K;  2QWL A;  4CJW A;  4MQ3 A;  4FO0 A;  3LL3 A;  5CE3 A;  5KGW A;  1JCE A;  2BH1 A;  4OJR A;  5FLX O;  4AHS A;  4KKO A;  1TK8 A;  1EKE A;  1REV A;  3AVL A;  3KHY A;  3VOV A;  2G8H A;  3VQ5 A;  4KRF A;  2RF2 A;  5KPT A;  5HRN A;  3ZYY X;  4GKJ K;  4CEZ A;  2YHX A;  4DFP A;  3I8D A;  3KK2 A;  1QQM A;  3DLG A;  4ID5 A;  3KD1 E;  1YF5 L;  4Z4H A;  1LOT B;  3CHW A;  3CCS N;  1NKC A;  1VQO N;  3VGK A;  3CCU N;  1HLU A;  4CHZ A;  3QES A;  3V4I A;  4HVJ A;  4ISG A;  4E7H A;  2RPI A;  3U4L A;  1RDU A;  2IGI A;  4CIF A;  3ZET B;  3CCM N;  4CJ4 A;  4EZ6 A;  1NMD A;  3M5R A;  3CFR A;  2G8W A;  3AVJ A;  3O3F A;  4DV6 K;  3IDH A;  4KHW A;  1V4S A;  2D0O A;  2BUP A;  4RG8 A;  5I9E B;  4AHC A;  4RW7 A;  1LWE A;  4KHN A;  3SUQ A;  5JVG L;  3NF8 A;  1KCF A;  3SMS A;  4CI6 A;  3E9L A;  2YKM A;  4CIG A;  3L2Q A;  3AVA A;  3FZM A;  1VSH A;  4EZ9 A;  2QW9 A;  4DSI A;  1BCO A;  2I7P A;  4JI3 K;  4CZK A;  3MN9 A;  3I55 N;  4NB4 A;  4ID1 A;  1IV0 A;  3J81 O;  3RMD A;  1NK8 A;  1S3X A;  5BRF A;  4YDU C;  4B8C A;  4MDA A;  5FPE A;  1N8R O;  4CF2 A;  2ITM A;  1BL3 A;  2PYL A;  3B8A X;  1LWC A;  4JS4 A;  3ZSO A;  1KVB A;  4E19 A;  1ZBI A;  4KH5 A;  1HYS A;  4OPJ A;  3MN5 A;  1DTT A;  1YVU A;  3M8R A;  3J8A A;  5AQS A;  2X6S A;  3WNF A;  4JHD B;  1K8K B;  3LZI A;  3O08 A;  2QWO A;  4IBN A;  3ZCM A;  2Q31 A;  5A2Q O;  5EU7 A;  3P4I A;  1H1V A;  4DSJ A;  4FK4 A;  1WN7 A;  3TAG A;  2B6A A;  4DR7 K;  3O3H A;  3F5T A;  4JI0 K;  1YAG A;  3LP0 A;  3P5J A;  4O0J A;  1VSM A;  3MEE A;  2O4I A;  3MMV A;  3SAH A;  3HO1 A;  3ISN C;  3F2K A;  1YHQ N;  3T7Z A;  4H5V A;  3MX5 A;  2P9U A;  4HUG A;  3CC7 N;  1WAJ A;  4PWD A;  4CJK A;  3CCV N;  3ULE A;  2RN2 A;  3OBY A;  2PAV A;  1KQS M;  3V9Z A;  2EX3 A;  5C15 A;  2E4L A;  4E1N A;  4YOW A;  4QS7 A;  3SQ4 A;  5JLF A;  1HUX A;  3VQE A;  2O8F B;  5BPN A;  1C6V A;  1TYQ B;  1IBL K;  4DQQ A;  1KXP A;  1OH6 A;  4W5R A;  1UWB A;  2KZM A;  1XI1 A;  4YOX A;  3H3N O;  4FW1 A;  4C1N K;  4BGB A;  3KLI A;  2R7Y A;  3WUH A;  4IG0 A;  1YVN A;  3TWH A;  2HHX A;  4OKJ A;  3U9Z A;  3QLH A;  1I39 A;  3O4W A;  2QK9 A;  3AVI A;  4WQ5 A;  1HQE A;  4NO7 A;  3SBT A;  2UUB K;  2GUP A;  4H5T A;  4KB0 A;  2ZM6 K;  3AO2 A;  2NRT A;  2KQ2 A;  4F9O A;  4YOY A;  1UA1 A;  4CK1 A;  4IZ9 A;  4GW6 A;  4KHQ A;  1VQ9 N;  1Z26 A;  4PKI A;  1IKY A;  1Q81 O;  2HHU A;  3AVG A;  3VEY A;  2D5R A;  1TAU A;  1EX4 A;  3L2W A;  2QKK A;  4DQP A;  1BOT O;  3EL2 A;  3IFR A;  4PA1 A;  3T69 A;  1HJR A;  3CG7 A;  4B9N A;  3A5N C;  4GV3 A;  1JLC A;  5AQI A;  3MWT A;  1X9J A;  2FSN A;  1T44 A;  1SKS A;  3D2E A;  1BO5 O;  3PV8 A;  4CJS A;  3QEV A;  4A2B A;  3AV9 A;  4WQ4 A;  1BA0 A;  1SUQ A;  2HHH K;  5M1F A;  3SPY A;  1NMN A;  2GWK A;  3V6D A;  4B1X B;  3WNG A;  4LSN A;  2RE2 A;  3AVH A;  3NDK A;  5FRM A;  3TSU A;  3IG1 A;  4IDH A;  5DM6 L;  2LSN A;  2E88 A;  1WNS A;  3OYM A;  1N32 K;  5HP1 A;  3AGR A;  3V1R A;  4BRG A;  4FLX A;  4CZG A;  1JL2 A;  3LAM A;  3EEQ A;  2GUI A;  2UUA K;  3V81 A;  3K5L A;  4MFB A;  4BAC A;  2P9N B;  4I7F A;  3KLG A;  1D9F A;  1WSE A;  3ALY A;  1FJG K;  2QWN A;  4KO0 A;  3LWL A;  5HOO A;  4HTU A;  4B9L A;  1O13 A;  4DCH A;  1X9W A;  2P9P B;  2HBK A;  3TTD A;  1KTQ A;  5D3G A;  3KKR A;  2HST A;  4WQ5 C;  3HOT A;  1GLB G;  1IG9 A;  3DI6 A;  4WCE L;  4BR2 A;  2IVN A;  3L4Q A;  4F2R A;  5C12 A;  4X64 K;  2D0A A;  1WSJ A;  4JKG A;  3SPZ A;  1RT3 A;  2HNY A;  3R3L A;  3RSE B;  4LFA K;  4JD2 A;  4M41 A;  1U48 A;  1VAZ A;  3VES A;  5CZ2 A;  2OYQ A;  1RCH A;  3THY B;  3L4I A;  1NM1 A;  4J2B A;  4ELU A;  1TUY A;  5JMV A;  4O0I A;  4FJL A;  2HHS A;  1F21 A;  1RT4 A;  2UXB K;  1YXQ A;  3OTO K;  4CJT A;  3RSE A;  3DLL L;  1A5W A;  3VTH A;  4GMJ B;  1DLO A;  3LDS A;  2F8S A;  3HYF A;  4Y1D A;  3HPH A;  1ZBF A;  5AQP A;  4E89 A;  3CQ8 A;  1ZXO A;  5AQR A;  5TKW A;  2G8K A;  3PY8 A;  2ZF5 O;  2Q0R A;  3LAK A;  4JKB A;  2UYT A;  3SV4 A;  2DY4 A;  3HI0 A;  5GAG P;  4ISF A;  1QSL A;  2G8F A;  3NHG A;  4BRD A;  5C25 A;  3D2F B;  4CD1 A;  5EOY A;  2GX9 A;  4CF8 A;  2OZS A;  1VSF A;  3VQD A;  3L3U A;  2D0P A;  4A62 A;  1EET A;  5C10 A;  4IJA A;  1EXQ A;  1TKX A;  2ATQ A;  2KZZ A;  2D1K A;  4KFB A;  5KGX A;  5ELZ A;  2NZT A;  3BDP A;  2ZGY A;  3FZK A;  3CCL N;  5I42 A;  1HYZ A;  2VGM A;  3KJV A;  1KVA A;  1U45 A;  3QEP A;  3EY1 A;  1B9F A;  4ZHR A;  3CYM A;  2I7N A;  3M8S A;  2UU9 K;  3P39 A;  1T05 A;  3SV3 A;  2NRX A;  1XNQ K;  3D0P A;  2X78 A;  2D0C A;  3O9Q A;  3LDP A;  3A5L C;  4A5A A;  4C1N I;  1VQ7 N;  1ATR A;  4B1Y B;  1NJX A;  4CGH A;  4EP4 A;  4B9V A;  1IBK K;  1QQO A;  3PIP L;  1YIT N;  3AY9 A;  4XH4 A;  3MXI A;  2FXU A;  3AVC A;  1S72 N;  4BRF A;  2IVP A;  3K0S A;  4CEB A;  3CME N;  3VPZ A;  4JKD A;  1TAQ A;  1X3N A;  2O8F A;  3LDQ A;  3FZL A;  4BVO A;  4IFY A;  4Z0U A;  1B9D A;  3ZSW A;  2WBN A;  3NF6 A;  4M3Z A;  1JCF A;  1WSH A;  4JKF A;  4E1M A;  5E41 A;  4DU3 A;  3AA2 A;  2A42 A;  3OYL A;  2X6N A;  4KV8 A;  3ZSZ A;  5FDL A;  3C6U A;  1RTJ A;  4K25 A;  3HM8 A;  3WQU A;  2ZE2 A;  2V52 B;  1IO2 A;  1R0A A;  3U8X A;  3P38 A;  1TL1 A;  4NCB A;  4OPH A;  4PHT X;  4DFM A;  3HP6 A;  1C1B A;  4IWV A;  5AQU A;  4JI5 K;  1CZ9 A;  4O8K A;  5CR4 A;  2FBT A;  3MEC A;  3LZJ A;  1RTI A;  4OX9 K;  3OY9 A;  4N47 A;  3A5M C;  5I3U A;  1TKZ A;  4DHY A;  3C6A A;  3TAE A;  3I33 A;  1HYV A;  3QER A;  4RW6 A;  2P9K A;  4BGA A;  2CH6 A;  3WT0 A;  2VCP A;  3HBT A;  2KHO A;  5F0X A;  4GY2 B;  4CJF A;  4PKH A;  4LF5 K;  3O3G A;  1DT9 A;  1JLQ A;  2Q36 A;  1QE1 A;  1DGK N;  2JWL A;  4CJE A;  4CHP A;  2V51 B;  4FM2 A;  3PSF A;  4E0D A;  3AVB A;  3DXK A;  4BRE A;  1ITG A;  2QTD A;  3TAF A;  2J4R A;  2HHV A;  3PLA A;  5FPN A;  5C24 A;  4B3O A;  2D4W A;  3FZF A;  4AHT A;  1JLA A;  5DM7 L;  2DFF A;  3ASM A;  1Y64 A;  3DRS A;  4OLA A;  5EX5 A;  4JI1 K;  3E9O A;  3QO9 A;  1QHA A;  2F96 A;  4GV6 A;  1RNH A;  1J5O A;  4X62 K;  3CQX A;  4YOV A;  5AQV A;  4Z4E A;  5LL6 Z;  3CIP A;  1GOB A;  3QFU A;  4F8R A;  2OCE A;  4CZH A;  3LM2 A;  3H1Q A;  5J2Q A;  2Z1G A;  1U47 A;  2ASM A;  3DJC A;  3GOI A;  4JK9 A;  3FR0 A;  4G1Q A;  1RDB A;  3KTQ A;  1VSE A;  3AAQ A;  4JKA A;  5M1K A;  3R8E A;  4BQZ A;  4KBO A;  4FLU A;  3BP8 A;  3SCX A;  1OH8 A;  4FVM A;  4H5N A;  5C2F A;  2YHB A;  4DV5 K;  4BG9 A;  1HKB A;  3LPU A;  3LDL A;  1ZBH A;  3UKR A;  3AVK A;  4DTJ A;  2A3Z A;  3ZT2 A;  3TAM A;  2YHW A;  4CK3 A;  5TKY A;  4CF1 A;  1BDG A;  3PSI A;  1KFS A;  5CYM A;  1NK6 A;  1EQY A;  3QBX A;  4CGI A;  4FJJ A;  3OYC A;  4JNE A;  1GLJ O;  4CGF A;  3WXI A;  3LAN A;  3BZK A;  3R9P A;  1RGI A;  4M45 A;  2ZJQ L;  5C0Y A;  2KLA A;  3DOL A;  1JL1 A;  3QIO A;  3ZX3 A;  4AHU A;  3VEZ A;  3QIP A;  3G25 A;  1KLN A;  3G71 N;  4KTQ A;  3WNH A;  3QDK A;  4LF6 K;  4RW8 A;  1BA1 A;  1SL2 A;  5J2M A;  4L8R B;  5CZ1 A;  1RDA A;  4ZTF A;  3AAR A;  1C0U A;  1EWR A;  3W3D A;  2VG7 A;  1T6D A;  3U9D A;  3O9U A;  2E2N A;  3SUP A;  1YTU A;  3RTV A;  4DR3 K;  4NYN A;  2QEX N;  1CXU A;  5FRN A;  4XIU A;  1XQS C;  4J8F A;  4CJ7 A;  1KSP A;  4BRQ A;  5KI6 A;  1ZBU A;  4JS5 A;  2QWR A;  2O8C A;  3J7Y P;  4O55 A;  2FBX A;  1QHT A;  4LY7 A;  1RFQ A;  3HST B;  1XC9 A;  1W9H A;  4MO5 A;  3TAB A;  4W5T A;  1ZC6 A;  3HT3 A;  4BR7 A;  3DLR A;  3KLF A;  3OYH A;  1BG3 A;  3VEO A;  4JI8 K;  4O4G A;  3M8P A;  4CJU A;  3SUO A;  1ATS A;  4V19 S;  4DTO A;  1NK7 A;  1KRP A;  2QM1 A;  3E9P A;  3H6E A;  1U6Z A;  3I0R A;  4E7L A;  2E20 A;  3RVC A;  4DG1 A;  4DTU A;  4FJN A;  3LP3 A;  3PUF A;  4M3U A;  3NAE A;  1N36 K;  2WFB A;  4DV0 K;  1A5V A;  3KZB A;  3Q7B A;  1BCM A;  3FE1 A;  2OA8 A;  3KLH A;  5BN8 A;  4KRE A;  3HP9 A;  3B6O A;  1T03 A;  3VET A;  1KC8 O;  4DU4 A;  4JEP A;  4DSF A;  5BRD A;  1YI2 N;  1Y97 A;  2QI2 A;  1DTQ A;  2HBM A;  2VGN A;  4GVE A;  3ATU A;  3OYA A;  4BVP A;  4O44 A;  3AVN A;  3CER A;  4JKG B;  4KPY A;  1D8Y A;  4FZZ A;  4BDZ A;  4B9M A;  1L3T A;  4XH1 A;  2IIR A;  4FK2 A;  1Q7Y O;  4DR1 K;  3B6P A;  2Y1I A;  4FJ8 A;  3THX A;  1LW2 A;  5ADX H;  4IFE A;  5J1E A;  1J9A A;  1TVR A;  4GV9 A;  3TAQ A;  3NGZ A;  5JVH L;  3DLK A;  3QB0 A;  4DLE A;  3CI5 A;  1JLB A;  3L3V A;  3O5B A;  5AQY A;  4LF4 K;  2DFH A;  4H0V B;  5BPL A;  4Q5V A;  3TSQ A;  1P8Z A;  3CM5 A;  4FK0 A;  2A5X A;  1G15 A;  3O1W A;  1GLC G;  4CJP A;  3NCI A;  4DF8 A;  1KLM A;  3J80 O;  4CJ5 A;  2HND A;  5J2P A;  1NGB A;  4YOU A;  2PY5 A;  4KI4 A;  3L2R A;  1CXQ A;  3M3Z A;  4HUE A;  4E3S A;  2YNF A;  4AH9 A;  4CZL A;  1BIS A;  4KH4 A;  4OO1 J;  2KKZ A;  5JIC A;  4JYA K;  4IEI A;  1OVQ A;  2P9I B;  1VSD A;  4CEC A;  4C8M A;  4PY5 A;  1RIL A;  3MN6 A;  3SAG A;  4BRM A;  2W40 A;  3N4Q A;  5AQK A;  3NVM A;  3SLC A;  5AQF A;  5AQX A;  1N5Y A;  4H4O A;  3AA3 A;  5SWM A;  3KK3 A;  4Z4F A;  4FSV A;  3VF6 A;  4BC3 A;  4KHP K;  1GLA G;  4M3R A;  4IOC L;  5IWA K;  3CQY A;  2GTD A;  1XUP O;  3NH0 A;  4JK7 A;  1NGJ A;  2D0B A;  4A2A A;  5F1X A;  3G6E N;  2WTU A;  4W5N A;  1CZB A;  3O8M A;  4DUZ K;  3SJJ A;  3S3M A;  1HQU A;  4FWM A;  2G8V A;  1R59 O;  2IDO A;  3AAP A;  3SZ2 A;  4H03 B;  3P31 A;  1TGO A;  4CEE A;  3ZSY A;  4RW9 A;  3PX4 A;  3CCQ N;  4ELV A;  1HRH A;  1B92 A;  3VQP A;  2ZQB A;  2KFN A;  3OYJ A;  4B3S K;  1VQ8 N;  4RW4 A;  5HRO A;  4TSX A;  1XMO K;  1W7A A;  2G8U A;  2CH5 A;  1SL1 A;  2W41 A;  3MCP A;  3ATV A;  2E6M A;  4BRI A;  1QQN A;  4CER A;  3U6F A;  5GIP A;  3A5O C;  4CD3 A;  4I6M B;  4Z4C A;  1GOC A;  1ZYQ A;  4CBX A;  3TAN A;  3S41 A;  3K5O A;  3MXJ A;  2P9S A;  3CCR N;  3VGL A;  4UY8 O;  4KHY A;  5LMN K;  1DEJ A;  2Y1J A;  1NOZ A;  3GE1 A;  4MLE A;  1NJZ A;  2PFU A;  3D7E O;  4B3M K;  1HNZ K;  2DTU A;  1N33 K;  1NLV A;  3QNN A;  2P9K B;  4GVM A;  3SUN A;  3DXM A;  4YNQ A;  2X74 A;  4F3O A;  5AZI B;  2P9S B;  1BUP A;  1XC3 A;  2B4J A;  4IJN A;  5AQT A;  4Q0B A;  1HNI A;  2GBZ A;  3TPQ A;  5E26 A;  4BC4 A;  3THV A;  2E6L A;  5BPM A;  2YI1 A;  3UKR B;  2KW4 A;  1ASU A;  2NUB A;  4JI6 K;  1J54 A;  3CJ1 A;  4KHS A;  3CET A;  3O4Q A;  2QXL A;  4BRO A;  2O8B B;  1KAZ A;  2AJQ A;  4CGD A;  4BQL A;  3KK7 A;  1VK0 A;  4DTR A;  5LJV A;  3OYD A;  1T3V A;  2A40 A;  1X1P A;  2HF3 A;  5FPD A;  4DUY K;  1TV6 A;  1Q9X A;  1VQM N;  1HKG A;  4CEO A;  1C0F A;  3QNO A;  5GAH P;  5SZT A;  3JSM A;  4M3W A;  3FLC O;  1IG8 A;  5HRS A;  4AHV A;  3M1F A;  1WLJ A;  2NRR A;  5EVZ A;  3I56 N;  3DMJ A;  3QEX A; 
#chains in the Genus database with same CATH homology
 4E7K A;  1SKW A;  4RW6 A;  4K8X A;  5J2N A;  4AIL C;  1T8E A;  4KTW A;  4DQS A;  4KI6 A;  3VQQ A;  4M3Y A;  4Y1C A;  4CJW A;  4CJF A;  4FJH A;  3S3O A;  4N56 A;  3T19 A;  3ULD A;  4DLG A;  4MQ3 A;  1JKH A;  1S1U A;  4EP5 A;  4CJR A;  5KGW A;  4KTZ A;  4OJR A;  3O3G A;  3OYE A;  5D3G A;  1JLQ A;  4AHS A;  3FFI A;  4FM1 A;  1QE1 A;  2Z1H A;  4KKO A;  4CJE A;  1IKX A;  4DF4 A;  1EKE A;  3PX6 A;  2ETJ A;  3LPT A;  1TK8 A;  4CHP A;  1REV A;  3AVL A;  1U04 A;  1UAX A;  2G8H A;  3VQ5 A;  4FM2 A;  4FZY A;  4KRF A;  3K2P A;  2RF2 A;  4E0D A;  3AVB A;  1SL0 A;  1ITG A;  1ZBL A;  5HRN A;  5KRT A;  3OYI A;  3TAF A;  3V9W A;  3DLH A;  2HHV A;  4CEZ A;  5C24 A;  4DU1 A;  4DFP A;  3I8D A;  3AO1 A;  2HNZ A;  3HL8 A;  1TKD A;  3KK2 A;  4B3O A;  3DLG A;  4ID5 A;  2P1J A;  3IS9 A;  5FRO A;  3KD1 E;  3M8Q A;  3DRP A;  4AHT A;  3K5M A;  4KHU A;  3MED A;  2HVI A;  1JLA A;  4Z4H A;  4DTP A;  2DFF A;  3ASM A;  4OPK A;  3I0S A;  3HVR A;  1NKC A;  3RWU A;  3DOK A;  4YFU A;  3BGR A;  3DRS A;  4CHZ A;  5CYQ A;  3QES A;  3V4I A;  4OLA A;  2P5O A;  4HVJ A;  4E7H A;  1YT3 A;  1IKW A;  2RPI A;  3QO9 A;  4B9T A;  2F96 A;  4J2D A;  1RNH A;  2IGI A;  1BQN A;  4CIF A;  1J5O A;  4CHY A;  2GV9 A;  1RBV A;  4CJ4 A;  4LH4 A;  4Z4E A;  4EZ6 A;  1RTH A;  3CFR A;  1GOB A;  4F8R A;  3VQ7 A;  3L2U A;  2G8W A;  3AVJ A;  3AA5 X;  3MEG A;  3O3F A;  3RMA A;  4AHR A;  4KHW A;  5J2Q A;  1U47 A;  2Z1G A;  2JGU A;  1SKR A;  4RG8 A;  4CFA A;  4AHC A;  1UA0 A;  4M42 A;  4RW7 A;  1LWE A;  4I9Q A;  4KHN A;  3SUQ A;  4NCA A;  4G1Q A;  1RDB A;  3KTQ A;  1VSE A;  3T3F A;  4FXD A;  3NF8 A;  3OS0 A;  3HM9 A;  1KCF A;  4LSL A;  4KB1 A;  4FW2 A;  4FLU A;  4DTN A;  3QEI A;  3SCX A;  3NGY A;  2YKM A;  4CIG A;  1C0T A;  4FVM A;  4DFJ A;  1KFD A;  2YHB A;  3L2Q A;  3TAP A;  3LPU A;  3AVA A;  1ZBH A;  3HK2 A;  1QTM A;  3AVK A;  1VSH A;  4DTJ A;  4EZ9 A;  2IC3 A;  5CY4 A;  1LAW A;  3ZT2 A;  1NKB A;  3TAM A;  1RT2 A;  2P51 A;  1BCO A;  3V1Q A;  4DSI A;  2Q3S A;  4OKE A;  3ZSR A;  2YNG A;  4LH5 A;  3VQC A;  4CK3 A;  2FBY A;  3OS2 A;  1FXX A;  1TL3 A;  4UQG A;  3PX0 A;  4ID1 A;  4F2S A;  1VSI A;  2YHA A;  4K8Z A;  4CF1 A;  3IAY A;  2OPQ A;  4CF0 A;  3RMD A;  1NK8 A;  4J2A A;  3AO3 A;  3ZT3 A;  1VRT A;  1KFS A;  5CYM A;  1NK6 A;  3U3G A;  4CGI A;  4FJJ A;  4B8C A;  3OYC A;  3F73 A;  3RRG A;  4CF2 A;  4CGF A;  1UOC A;  3LAN A;  4WE1 A;  1BL3 A;  3QEW A;  2PYL A;  1LWC A;  4M45 A;  4JS4 A;  3ZSO A;  1KVB A;  4E19 A;  3KKS A;  4FLY A;  3C94 A;  1L3S A;  1ZBI A;  3DOL A;  1RDC A;  1JL1 A;  3QIO A;  4C8L A;  4AHU A;  3QIP A;  1HYS A;  1S9E A;  3TI0 A;  4OPJ A;  2HHW A;  2VWK A;  1KLN A;  4I2Q A;  1DTT A;  1YVU A;  1QSS A;  4KTQ A;  3M8R A;  3WNH A;  2X6S A;  4RW8 A;  3WNF A;  3AO4 A;  4DTM A;  1W0H A;  1S1W A;  2YV0 X;  2XRI A;  3LZI A;  2XHB A;  5J2M A;  1SL2 A;  3PO5 A;  4L8R B;  4DMN A;  4IBN A;  3ZCM A;  5CZ1 A;  4BWM A;  3NF9 A;  5EU7 A;  1RDA A;  4ZTF A;  1NJW A;  1C0U A;  4OGC A;  4QOZ B;  2IOC A;  1KVC A;  4DSJ A;  1CLQ A;  3HPO A;  1LWF A;  4FK4 A;  2VG7 A;  1BI4 B;  1WN7 A;  3TAG A;  2B6A A;  3O4N A;  3SUP A;  3O3H A;  1YTU A;  4ICL A;  3K58 A;  3RTV A;  3LP0 A;  3P5J A;  4O0J A;  2HHT A;  1YTA A;  1VSM A;  3MEE A;  1CXU A;  4IFV A;  4NYN A;  2O4I A;  4OKK A;  1RBS A;  2FBV A;  4XIU A;  5FRN A;  3ISN C;  3HO1 A;  2IS3 A;  1TK0 A;  3E01 A;  4NCG A;  1J53 A;  3S3N A;  5KI6 A;  1C1C A;  1KSP A;  5JS2 A;  1ZBU A;  3L2V A;  4JS5 A;  4HUG A;  2XY7 A;  1WAJ A;  4O55 A;  2FBX A;  4CJL A;  4FJX A;  1QHT A;  4CJK A;  4PWD A;  4LY7 A;  3HST B;  2RN2 A;  1XC9 A;  3CFP A;  4FM0 A;  1W9H A;  3SQ2 A;  1L3U A;  2HB5 A;  3V9Z A;  1QQC A;  2EX3 A;  3S9H A;  1TK5 A;  2E4L A;  4W5T A;  4E1N A;  3U3Y A;  3OYF A;  3TAB A;  4IKF A;  3HT3 A;  4IDK A;  3SQ4 A;  3WNE A;  3VQE A;  1HMV A;  3DLR A;  3SYZ A;  3SI6 A;  2YKN A;  1C6V A;  3KLF A;  3OYH A;  4DQQ A;  4M3T A;  3NH2 A;  1LW0 A;  4DQI A;  3DYA A;  4O4G A;  3M8P A;  4CJU A;  4W5R A;  1UWB A;  3TAR A;  2KZM A;  3SUO A;  3VQ6 A;  4QCL A;  3RMC A;  4DTO A;  1XI1 A;  1NK7 A;  1KRP A;  4CEF A;  1LAV A;  3H08 A;  4FW1 A;  3I0R A;  3KLI A;  2R7Y A;  4E7L A;  4IG0 A;  3TWH A;  2HHX A;  4DG1 A;  4DTU A;  4OKJ A;  3LP3 A;  3PUF A;  4FJN A;  3NAE A;  4M3U A;  1A5X A;  1A5V A;  2HVH A;  3QLH A;  1I39 A;  1NK4 A;  1HPZ A;  2KZZ A;  4CFC A;  1BCM A;  2QK9 A;  3AVI A;  1HQE A;  1LV5 A;  1L5U A;  2OA8 A;  3TR8 A;  3C6T A;  4KB0 A;  3KLH A;  3AO2 A;  4FJM A;  4KRE A;  4ZTJ A;  1RBT A;  4HUF A;  3NE6 A;  2KQ2 A;  1QSY A;  3HP9 A;  1BGX T;  1UA1 A;  3B6O A;  3NFA A;  4CK1 A;  1T03 A;  4FZX C;  3PO4 A;  4GW6 A;  4B8A B;  4KHQ A;  1BI4 A;  4DU4 A;  1Z26 A;  1U49 A;  3G10 A;  4DSF A;  1IKY A;  4CGG A;  2HHU A;  3AVG A;  2D5R A;  1TAU A;  4DWI A;  1O1W A;  1EX4 A;  1Y97 A;  3L2W A;  2QKK A;  1DTQ A;  3ZT0 A;  3OYA A;  4DQP A;  3ZSQ A;  4PA1 A;  3OJS A;  4BE2 A;  2OPP A;  2BE2 A;  1FK9 A;  4BE1 A;  1HJR A;  2PZS A;  4H4M A;  3OJU A;  2VG5 A;  5KRS A;  3CG7 A;  1S1T A;  4O44 A;  4Z4I A;  4B9N A;  1X9M A;  1VSJ A;  4CED A;  3AVN A;  1JLC A;  3OYB A;  4KPY A;  1D8Y A;  2XY5 A;  4FZZ A;  4O5B A;  3KD5 E;  4BDZ A;  4B9M A;  3AA4 A;  2F8T A;  1WSI A;  3V9S A;  2A1R A;  1L3T A;  3P83 D;  1SKS A;  3NBP A;  3VQ9 A;  1S6P A;  3PV8 A;  1K6Y A;  4FK2 A;  4C8O A;  4CJS A;  5KTQ A;  3QEV A;  3B6P A;  2Y1I A;  4OGE A;  3AV9 A;  4FJ8 A;  4BE0 A;  4BDY A;  1LW2 A;  1VSK A;  1SUQ A;  2RKI A;  5J1E A;  3F9K A;  3SPY A;  1IH7 A;  1J9A A;  1GOA A;  3V6D A;  4HCB A;  3WNG A;  4LSN A;  3KK1 A;  1NK0 A;  3AVH A;  3NDK A;  4HCC A;  5FRM A;  1TVR A;  3IG1 A;  4BWJ A;  2LSN A;  3TAQ A;  1WNS A;  3NGZ A;  3OYM A;  4Z4G A;  5C42 A;  1BQM A;  5HP1 A;  3RR7 A;  3DLK A;  4DLE A;  3V1R A;  4FLX A;  3HJF A;  3DRR A;  1Q8I A;  2FC0 A;  3OVN A;  1JL2 A;  3LAM A;  1JLB A;  1MU2 A;  3L3V A;  1RBR A;  5K14 A;  2DFH A;  2GUI A;  3V81 A;  3K5L A;  4MFB A;  4BAC A;  1N6Q A;  4QAG A;  4Q5V A;  4I7F A;  4J2E A;  3KLG A;  3CM5 A;  1WSE A;  1D9F A;  3ALY A;  4FK0 A;  4I2P A;  3ZT1 A;  4CHQ A;  1C1A A;  1G15 A;  4KO0 A;  3LWL A;  4N76 A;  3NF7 A;  2OPS A;  4HTU A;  4E7I A;  4CJP A;  3NCI A;  4DF8 A;  1KLM A;  4B9L A;  2Z1I A;  1X9W A;  4N41 A;  5HRP A;  4CJ5 A;  3RRH A;  2HND A;  4C8N A;  1KTQ A;  5J2P A;  3MXM A;  1NK9 A;  2PY5 A;  3KKR A;  1X9S A;  4B9U A;  4KI4 A;  3L2R A;  1CXQ A;  4FYD A;  4HUE A;  4E3S A;  2YNF A;  4CF9 A;  1WSF A;  3DI6 A;  4AH9 A;  1IG9 A;  1ASW A;  4JRP A;  4F2R A;  1BIS A;  4CHO A;  2BGG A;  2D0A A;  3C95 A;  1WSJ A;  2XY8 A;  4R5P A;  3HXM A;  2VWJ A;  2ITG A;  3SPZ A;  4DSE A;  1RT3 A;  1VSD A;  2HW3 A;  2HNY A;  3DM2 A;  4CEC A;  3V9X A;  4FJG A;  4C8M A;  4M41 A;  5DK5 A;  5HLF A;  4PY5 A;  1RIL A;  1U48 A;  4CK2 A;  5CZ2 A;  2XY6 A;  3T1A A;  2OYQ A;  1RCH A;  2OZM A;  1IKV A;  3RR8 A;  3ITH A;  3OYK A;  4ELU A;  4J2B A;  4O0I A;  3SQ1 A;  3OS1 A;  4FJL A;  2A1S A;  1F21 A;  1RT4 A;  4PUO A;  4M3X A;  2HHS A;  4F4K A;  4LD0 A;  4H4O A;  3OYG A;  3AA3 A;  2QXF A;  5SWM A;  1N5Y A;  1RT6 A;  4CJT A;  3QIN A;  1A5W A;  3D45 A;  3KK3 A;  4GMJ B;  1DLO A;  2B5J A;  3LDS A;  4Z4F A;  4OLB A;  2F8S A;  1S9G A;  3JYT A;  1XHZ A;  3VQA A;  1NK5 A;  1RT5 A;  3HYF A;  4Y1D A;  4M3R A;  1RT7 A;  4N5S A;  3HPH A;  3CFO A;  1NKE A;  4PQU A;  1ZBF A;  4CE9 A;  3EYZ A;  3DLE A;  4E89 A;  1TKT A;  3CQ8 A;  3NH0 A;  4C8K A;  3PY8 A;  2G8K A;  2D0B A;  2ZD1 A;  4IG3 A;  4W5N A;  3ZSX A;  1CZB A;  4ELT A;  3SJJ A;  4CJ3 A;  1S5J A;  4CIE A;  3S3M A;  3AO5 A;  3LAK A;  1HQU A;  4CGJ A;  3SV4 A;  2G8V A;  2DY4 A;  4FJ7 A;  2IDO A;  1WSG A;  1BIU A;  3SZ2 A;  3NHG A;  1FKP A;  4JRQ A;  1WAF A;  1QSL A;  1SV5 A;  1S6Q A;  3KLE A;  2G8F A;  2YNH A;  5C25 A;  3NH1 A;  3RMB A;  2YNI A;  1TGO A;  3LWM A;  2EHG A;  4CEE A;  4CCH A;  1JXE A;  3A2F A;  4RW9 A;  3ZSY A;  4CF8 A;  5HBM A;  2OZS A;  1VSF A;  3VQD A;  3PX4 A;  3L3U A;  2P5G A;  2BAN A;  2DFE A;  1JLG A;  1EET A;  4ELV A;  1HRH A;  4DQR A;  2HHQ A;  1B92 A;  1EXQ A;  1TKX A;  2ATQ A;  4W5Q A;  1D5A A;  1VRU A;  2ZQB A;  4KFB A;  3VQP A;  3OYJ A;  1Z25 A;  5KGX A;  3VA0 A;  2KFN A;  1XWL A;  3ZT4 A;  1S1V A;  3LP1 A;  4RW4 A;  4TSX A;  2I5J A;  3OYN A;  4CEA A;  4FLZ A;  5HRO A;  3HVT A;  3BDP A;  3LP2 A;  3G0Z A;  2G8U A;  3DLB A;  3UIQ A;  1SL1 A;  1RTD A;  3V1O A;  5I42 A;  2E6M A;  1HYZ A;  3KJV A;  3P1G A;  3K59 A;  1KVA A;  4CER A;  3U6F A;  1T7P A;  1U45 A;  3QEP A;  2WOM A;  3EY1 A;  1B9F A;  4ZHR A;  3CYM A;  3M8S A;  1T05 A;  3VQ8 A;  2Z1J A;  2W42 A;  4Z4C A;  1GOC A;  3SV3 A;  4NYF A;  3K57 A;  3D0P A;  2X78 A;  1ZYQ A;  2D0C A;  3TAN A;  4FJ9 A;  2QKB A;  1NJY A;  1NJX A;  3K5O A;  2O4G A;  2HMI A;  3MXJ A;  4CGH A;  4EP4 A;  5DMR A;  4B9V A;  4B08 A;  4KHY A;  2Y1J A;  1NOZ A;  1EP4 A;  3ZSV A;  1NJZ A;  3KIO A;  1Q9Y A;  3CM6 A;  3L8B A;  4FLW A;  4DS4 A;  1HNV A;  3MXI A;  2DTU A;  4F3T A;  3QNN A;  3AVC A;  2JLE A;  4CFD A;  4GVM A;  3EZ5 A;  4H8K A;  3SUN A;  2PYJ A;  4YNQ A;  2X74 A;  4KAZ A;  1RT1 A;  2OPR A;  4CEB A;  4F3O A;  4CEQ A;  1XHX A;  1I3A A;  2B4J A;  2XO7 A;  3LAL A;  2WON A;  1TAQ A;  1BIZ A;  4Q0B A;  4FJ5 A;  4FJK A;  1HNI A;  3MAQ A;  1NOY A;  2GBZ A;  2VG6 A;  4OVL A;  4CJV A;  3VN5 A;  4I9L A;  1JLE A;  3THV A;  4DTS A;  2E6L A;  4HHT A;  4IFY A;  4Z0U A;  1B9D A;  3ZSW A;  4FCY A;  3NF6 A;  4M3Z A;  1WSH A;  4DU3 A;  2KW4 A;  4E1M A;  1ASU A;  2NUB A;  5E41 A;  3V9U A;  2KTQ A;  3AA2 A;  3OYL A;  2X6N A;  1J54 A;  4KV8 A;  1L3V A;  4KHS A;  1ASV A;  1VSL A;  3O4Q A;  3SQ0 A;  4CHN A;  4B9S A;  3ZSZ A;  4W5O A;  4CJQ A;  5FDL A;  2AJQ A;  3C6U A;  4FLT A;  1FKO A;  1RTJ A;  4CES A;  4DSK A;  2G8I A;  1RDD A;  4CGD A;  2KFZ A;  4DFK A;  4DTX A;  1C0M A;  3QET A;  1VK0 A;  4DTR A;  2ZE2 A;  3NGI A;  4FJI A;  2IAJ A;  1D9D A;  3AVM A;  2BDP A;  3OYD A;  1U4B A;  1IO2 A;  1QS4 A;  4E7J A;  1R0A A;  1X1P A;  1TL1 A;  4NCB A;  1RBU A;  5JS1 A;  1BHL A;  3VA3 A;  1JXB A;  1TV6 A;  1Q9X A;  4DFM A;  3HP6 A;  4CEO A;  5T7B A;  3QNO A;  1C1B A;  4JLH A;  3K5N A;  3AVF A;  1JLF A;  5HRR A;  4CFB A;  1CZ9 A;  5SZT A;  3JSM A;  2FBT A;  3MEC A;  3LZJ A;  4FLV A;  4BDP A;  1RTI A;  3VQ4 A;  4M3W A;  3OY9 A;  4N47 A;  5HRS A;  5I3U A;  1TKZ A;  3TAE A;  3HPG A;  1S1X A;  3SNN A;  3VQB A;  1WLJ A;  3IRX A;  4AHV A;  4DS5 A;  1HYV A;  4DSL A;  3QER A;  3DMJ A;  3QEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...