3WNFA

Cyclic hexapeptide ckidnc in complex with hiv-1 integrase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
153
structure length
133
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/peptide
molecule keywords Gag-Pol polyprotein
publication title Hexapeptide mimetics of LEDGF in complex with HIV-1 integrase
rcsb
source organism Human immunodeficiency virus type 1
total genus 46
structure length 133
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3wnfA00
1XHZA 2WONA 2ZD1A 3ZSQA 3K5LA 4H4MA 5C24A 3QERA 3D45A 3F73A 2XY7A 3K59A 4MFBA 1RBUA 5J2MA 1RTDA 4Y1CA 1BL3A 1LW2A 2KW4A 4FJ8A 2HB5A 1Y97A 1KLMA 3OY9A 4EZ6A 1RCHA 3NH1A 3WNFA 3ZSWA 3IS9A 3QNNA 4HCBA 1YTUA 2KFNA 1HPZA 1RT5A 1TVRA 4FLWA 2QKKA 1VRTA 3CFPA 1ASVA 1BHLA 3AA2A 3K2PA 4DTOA 2OZSA 2WOMA 4M42A 4E19A 1T7PA 3MAQA 1RBTA 3RTVA 1TK5A 1B9FA 4DS5A 3AO3A 5HLFA 1KVBA 1KCFA 1JLAA 3K5NA 1UA0A 4B9TA 3VQ9A 1S1XA 4M3XA 3V6DA 3RRHA 1YT3A 3M8QA 2PYJA 4NCBA 2HHWA 4NYFA 5SWMA 3AA5X 2YHAA 4BE2A 2G8FA 1BQMA 2D5RA 2LSNA 1I39A 4DQSA 4AILC 4CK1A 1QTMA 1A5XA 3T19A 4KAZA 4DSEA 5HBMA 5KI6A 3U3YA 1KSPA 1SV5A 3HPHA 3MEEA 3MXJA 5KRSA 3T3FA 2RPIA 2YKMA 2P5OA 4CJ5A 4ELUA 3SJJA 4ELVA 3F9KA 4OVLA 1TKZA 1YTAA 4JRQA 1SL1A 1KRPA 2VWJA 4KRFA 3VQQA 1CXUA 1MU2A 1YVUA 3FFIA 4KPYA 4J2BA 3DI6A 1JLGA 1IG9A 4CFDA 3HP9A 4CEZA 3SCXA 1RBVA 3P1GA 4ICLA 3AVKA 3CQ8A 1RDDA 5HRSA 1IKXA 3AVFA 4ZHRA 3OYBA 1WSGA 3BGRA 4IG0A 4W5RA 3QEIA 3OYAA 1WSIA 4FLXA 3SUQA 2G8KA 5KGXA 3PX4A 4CIGA 1X9MA 2D0AA 5JS1A 4JS4A 5T7BA 4OKKA 2EX3A 1R0AA 5FRNA 4N47A 4FM1A 3OYNA 1UA1A 4N56A 4F8RA 3ZT3A 4GVMA 4F2RA 2HHVA 4DQPA 4FM2A 4C8NA 3KK2A 4CIFA 4XIUA 2OPPA 4CESA 4DU3A 3DLBA 3E01A 4AHUA 4CGDA 3MXIA 3VQ5A 5J2NA 4E3SA 2QXFA 2HNZA 3C6UA 3OYIA 3B6OA 4DS4A 1WSEA 2XRIA 4CJWA 3AVCA 1L5UA 3RWUA 4KHWA 2ZE2A 4M3ZA 3AVHA 4CIEA 1C1CA 1S9GA 3DM2A 4I9LA 5HRPA 2OPSA 1NJWA 2HVHA 1S1UA 3DOLA 4HVJA 1TK8A 5K14A 3SV3A 1LV5A 4NCGA 2VWKA 2R7YA 4HUGA 1U49A 1VSIA 2Q3SA 3KLFA 1BCOA 4Q0BA 1XI1A 4N5SA 3SV4A 1S6QA 4CFAA 1QS4A 4AH9A 4H8KA 4PY5A 4IFVA 1D8YA 4C8LA 1ZYQA 3VQBA 4FK2A 1RDAA 4DSLA 4CERA 3K58A 3SUNA 2E6MA 1JXBA 3M8SA 2GBZA 1VSMA 3RRGA 1HQUA 2DFEA 3KIOA 3C94A 1WSFA 3CM5A 1SKWA 3TAQA 4B8CA 4M3YA 1ZBHA 3QEPA 2HW3A 4CJVA 3TAGA 3AO1A 2HHTA 1KFDA 4E7HA 4M3TA 1LAWA 1WNSA 4TSXA 4F3TA 1J54A 1TAQA 4KFBA 3TARA 1KTQA 3DRSA 1CXQA 4LSNA 4DTJA 1RTHA 3U6FA 3G10A 4BWJA 4RW9A 3VQ4A 3L2VA 3CFOA 3HVRA 1BIUA 1RT2A 1REVA 4DFPA 2P5GA 4CJEA 4CJLA 2F8TA 3QO9A 4KTQA 3JSMA 3PO4A 1TAUA 4CF0A 1KFSA 3C95A 1ZBFA 3ZT4A 1RT7A 1VSKA 1ITGA 1FKPA 4O4GA 4BDZA 4M3UA 1QQCA 1BIZA 5I42A 2HHSA 3NH2A 3LWLA 3NDKA 4KREA 4DTXA 4N41A 3QLHA 1VSFA 3NBPA 3OYJA 3EZ5A 1L3TA 4O0IA 4FCYA 1C0TA 2G8WA 4L8RB 4RW4A 3HT3A 1ASUA 3DLHA 2XY8A 4OGEA 4FJJA 2YHBA 3RMCA 1CZBA 4W5TA 1T05A 3LALA 3NF7A 4RW7A 1EETA 4CHYA 4FJ9A 2P51A 2HNYA 1RNHA 2I5JA 4B9NA 2FBTA 1LWFA 4LD0A 4CECA 1HQEA 4KHSA 1Z25A 1RBRA 2KZMA 4CHQA 3O3HA 4DQQA 4DF4A 1SKRA 5E41A 3RR8A 1S1VA 1NOZA 4CHZA 1NK6A 3TAPA 4CJUA 4KHNA 1TKDA 4LY7A 1GOBA 1BISA 1B92A 3PUFA 4Z4FA 4Z4IA 1NK9A 3OYKA 2X6NA 1NJZA 4I2PA 4CK3A 1RT4A 1G15A 4IFYA 3SPZA 2GUIA 3DLRA 2OPQA 4AHTA 3HXMA 1FXXA 5J1EA 4FJHA 4CEBA 1TL3A 2G8IA 3G0ZA 3C6TA 2Y1IA 4DQIA 1HYZA 3ZT0A 2BDPA 1UWBA 4I2QA 1X1PA 4DMNA 1EP4A 3NGZA 4J2EA 2ITGA 2QK9A 4CHNA 3QIOA 4KTWA 1WSJA 3HJFA 2DFFA 4FLVA 2BANA 5CZ1A 1LWEA 4FJNA 1D5AA 3AVMA 2HHXA 3DYAA 3HSTB 3H08A 3ZSXA 1XHXA 1S6PA 3NF6A 1ZBUA 4CEOA 4CF2A 4NCAA 3KLHA 1RDCA 3TI0A 1LW0A 1QE1A 3I0SA 4FJXA 1JLCA 1F21A 2A1SA 3AVIA 4I7FA 4O5BA 2XO7A 3SQ0A 4KHUA 2AJQA 3S3OA 3AVAA 3L2QA 2B5JA 4RG8A 3IAYA 2FBXA 4KI6A 4BACA 5FRMA 4HUFA 4DTNA 2KQ2A 3VQCA 2YKNA 3LAMA 3L2UA 3S3MA 4B9LA 4FJGA 2E4LA 2XY5A 1Q8IA 4C8OA 1KLNA 1WAJA 1L3SA 1A5WA 4B8AB 3TWHA 3KD1E 1S9EA 2F96A 3M8PA 4RW8A 1J53A 3ZSZA 3RMDA 4NYNA 3U3GA 3VQ7A 3EY1A 3LPTA 1TKXA 4CHOA 3AVNA 4E89A 4FYDA 1VSDA 4CF1A 2E6LA 3L3UA 4FLZA 4DSKA 1HYVA 3HVTA 4C8KA 3VQDA 1TKTA 1A5VA 3IG1A 4CGIA 3KLIA 4FZXC 1J9AA 1W9HA 1RBSA 4EP5A 2IAJA 4ZTJA 4OJRA 3OYDA 4IG3A 2D0BA 2Z1HA 3L3VA 4OLAA 4J2DA 2G8VA 2G8UA 2XY6A 4F4KA 2YV0X 4FK0A 1VSJA 3NHGA 4E1NA 1NKBA 2FBYA 4UQGA 4FJIA 3V4IA 4O44A 4CJKA 4CJRA 4KTZA 3K5OA 3KLGA 4DLEA 4GW6A 3NF9A 1LAVA 3B6PA 4DG1A 1B9DA 3VA0A 3PV8A 3HK2A 1L3UA 3O3FA 4K8ZA 4DSIA 3NCIA 3SQ4A 3L8BA 2HMIA 1D9FA 1RTJA 1HNVA 4JS5A 3CM6A 1S5JA 3TANA 4RW6A 5JS2A 5J2PA 1BQNA 3DLGA 3PY8A 3DMJA 3AA4A 4BDYA 3ISNC 1CZ9A 5HROA 3SQ1A 3AV9A 2VG5A 4W5NA 3NGYA 2ZQBA 1X9SA 1SKSA 3LZIA 2NUBA 2HNDA 3KK1A 3S3NA 1BI4B 4CEQA 1NKEA 1U45A 4ZTFA 4KHQA 1JL2A 3KK3A 4CFBA 2IOCA 1JLEA 2YNIA 4G1QA 4ID1A 4OKJA 3OS2A 4KKOA 1NK0A 4CK2A 1SL2A 3RR7A 4JLHA 4QAGA 3ZT1A 2OA8A 2Z1IA 4HUEA 4AHRA 1XC9A 4MQ3A 2HHQA 5EU7A 5HRRA 4CEFA 4FXDA 3HPOA 5CZ2A 3RMBA 3HO1A 3LZJA 2YNGA 3QNOA 5HP1A 4IBNA 2RN2A 3HM9A 3VN5A 4DFKA 4WE1A 2A1RA 4KV8A 1NJXA 2RKIA 2VG6A 3OJUA 1KVCA 4J2AA 2HHUA 3V1QA 1CLQA 2HVIA 1VSHA 3VQ8A 3LP3A 1IH7A 4Z4HA 4JRPA 3TR8A 1Z26A 1C1AA 4ID5A 1JLQA 4OKEA 4CF9A 1WAFA 1S1TA 3SQ2A 4E7LA 3HYFA 3KKSA 3MXMA 3MEGA 4R5PA 1XWLA 1LWCA 4FZZA 4CJQA 4B9MA 3MECA 1GOCA 1Q9YA 2B4JA 1JL1A 1ZBIA 4FW2A 5HRNA 2JLEA 3QIPA 4M41A 3ZSRA 1WN7A 4DLGA 1SUQA 3V9ZA 1TK0A 1DLOA 4C8MA 1VK0A 4CEAA 1U48A 1C1BA 3KKRA 2G8HA 4Z0UA 4N76A 5CYQA 5C25A 1IKWA 1Q9XA 3OS0A 4DTUA 3WNGA 3CG7A 3I0RA 4CFCA 1HRHA 5D3GA 1NK8A 1RT3A 4DF8A 3ALYA 1EKEA 1U4BA 3AVBA 4LH5A 4KO0A 5KRTA 3D0PA 1NJYA 4E7IA 3V9WA 4LSLA 1VSEA 2OPRA 3RMAA 1VSLA 1RDBA 2KTQA 3AO4A 5FROA 2BGGA 3AVLA 4PA1A 4BE1A 1C0UA 3OYFA 1W0HA 2IS3A 3TAEA 3OYMA 5SZTA 4DTMA 3SI6A 3WNEA 3ZT2A 3DRPA 2BE2A 5CYMA 3VQ6A 3KLEA 4DFMA 3DLKA 2VG7A 3SYZA 3QEXA 4BWMA 4FJLA 1C0MA 1NK7A 3CYMA 4OPJA 3PO5A 3HP6A 3EYZA 4CJFA 3LAKA 4CGFA 3DRRA 4HTUA 4FJ5A 2FC0A 3I8DA 1JKHA 4FLTA 2PYLA 4B9SA 3V81A 2X74A 3M8RA 4KB1A 3KTQA 1HYSA 1QSLA 5CY4A 3ZSYA 1X9WA 3LP0A 3ULDA 3V9UA 3V9SA 4EZ9A 2OZMA 3NF8A 2X6SA 2W42A 4Y1DA 1FKOA 1RTIA 3DLEA 3OYLA 4FM0A 3VA3A 3TAMA 1RT6A 3MEDA 1FK9A 2ETJA 3QETA 4B9VA 1BI4A 1QSSA 2YNFA 4FJKA 4KI4A 2QKBA 4M3RA 1N6QA 2Z1GA 5FDLA 3SUPA 3L2RA 2YNHA 4E7JA 4M3WA 3CFRA 4BDPA 4W5OA 1T03A 1ASWA 1UAXA 1NK4A 4FK4A 3WNHA 3SUOA 1GOAA 4H4OA 2PZSA 3KJVA 3UIQA 5KGWA 1HMVA 3OYEA 3KD5E 1SL0A 1S1WA 2GV9A 4FLUA 4OGCA 1UOCA 4IDKA 4AHSA 4DQRA 4FJ7A 3AVJA 3V1OA 2X78A 3OYCA 3PX0A 4HHTA 4CEDA 3PX6A 4DTRA 3QEVA 4PWDA 4Z4CA 3OS1A 2KZZA 2B6AA 1TL1A 3A2FA 2XHBA 3QESA 4DWIA 1WSHA 1TGOA 1L3VA 4O0JA 4Q5VA 3ZSOA 3P5JA 4CGHA 3T1AA 3ASMA 4Z4GA 4FJMA 1EX4A 4CF8A 1VRUA 4BE0A 4CEEA 4ELTA 2P1JA 4CGGA 1NK5A 4CJ4A 4FW1A 3NH0A 1BGXT 4CE9A 3VQEA 1U47A 1RT1A 2IC3A 1D9DA 4B9UA 3LDSA 4W5QA 1N5YA 3DOKA 3ITHA 5DK5A 3P83D 4PUOA 2FBVA 3NE6A 5DMRA 1JLFA 3JYTA 3VQPA 3V1RA 3LP1A 2DY4A 2ATQA 3LANA 1JLBA 4O55A 3OJSA 3AA3A 3K57A 3NAEA 4QCLA 4DFJA 4DSJA 3TAFA 1C6VA 1K6YA 4DU4A 3IRXA 4YFUA 4F2SA 4KHYA 3NFAA 4CJ3A 3L2WA 2EHGA 4GMJB 3LWMA 1NKCA 3BDPA 4CJSA 2Y1JA 2OYQA 4M45A 1T8EA 4E0DA 1IO2A 3AO2A 1WLJA 4YNQA 4DSFA 3V9XA 1HNIA 4CCHA 4IKFA 3OYGA 3NGIA 4FZYA 4HCCA 4DU1A 3TABA 1I3AA 4CJTA 3HPGA 4B08A 4AHCA 5KTQA 1ZBLA 2DTUA 1DTQA 4AHVA 1QSYA 3HL8A 4CGJA 1RILA 4K8XA 4DTSA 2JGUA 1JXEA 3VQAA 1KVAA 1TV6A 5C42A 3K5MA 4DTPA 3ZCMA 2KFZA 2O4GA 1O1WA 4CHPA 2F8SA 1IKVA 4OPKA 3AVGA 5I3UA 4OLBA 2O4IA 1U04A 4I9QA 1BCMA 4E1MA 4F3OA 4EP4A 3O4NA 3QINA 2RF2A 3O4QA 3SNNA 1IKYA 2IGIA 3LPUA 4KB0A 3LP2A 2PY5A 3S9HA 1HJRA 4FVMA 3OYHA 4PQUA 4B3OA 4LH4A 3ZSVA 3O3GA 1EXQA 4Z4EA 4E7KA 5J2QA 3SZ2A 1QHTA 4QOZB 1DTTA 2Z1JA 4CJPA 1J5OA 1NOYA 2D0CA 2DFHA 3AO5A 2IDOA 3QEWA 3THVA 3OVNA 3SPYA 4FLYA
chains in the Genus database with same CATH superfamily
4H4MA 3VGMA 4BREA 3FFKB 4BR0A 1NNEA 2XY7A 4BRPA 3K59A 4MFBA 1RBUA 5AQZA 2KW4A 3VF6A 4FJ8A 1Y97A 4EZ6A 3OY9A 2VQFK 2YCHA 3TTFA 4M42A 3FGUA 3KHYA 4H5RA 3RTVA 1ILYA 4LF8K 1B9FA 5LJWA 5HLFA 1KVBA 3K5NA 1W97L 1YT3A 2JWLA 2PYJA 5SWMA 3AA5X 1SS6A 2YX6A 2LSNA 4DQSA 4PKGA 3T19A 2QA4N 5HBMA 2HMPA 3MEEA 5BPMA 2YKMA 4YDUA 1OVQA 4JRQA 4KRFA 3VQQA 3FFIA 2E8AA 1IG9A 4CFDA 3HP9A 4JD2A 3H45C 1N8RO 3BEXA 2CGKA 4EAHD 1ATSA 2OTLN 3QEIA 3SUQA 2G8KA 5KGXA 5AQMA 2D0AA 2OTJN 5TKYA 4OKKA 2WC9A 4DR7K 4N47A 3OYNA 5AQVA 4N56A 4F8RA 4F2RA 4GVMA 5JVGL 4DQPA 4FM2A 3K9KA 4BY9C 4C8NA 4CIFA 4XIUA 2OPPA 4CESA 3DLBA 4H0XB 1VQLN 3MXIA 2QXFA 2RE2A 4YOTA 3C6UA 3AARA 3CJ9A 1T6CA 3KWIA 1L5UA 4M3ZA 3C0BA 3AVHA 2HVHA 3MN6A 1TK8A 1LV5A 2VWKA 3QBWA 1U49A 1BG3A 1XI1A 4GY2B 4LF4K 4BR7A 2GEMA 4AH9A 4H0TB 1E4FT 4FWQA 4A5BA 4BRQA 4FWPA 1VSMA 4A5AA 3KIOA 5MLCQ 3U9DA 2O8FA 2Q97A 3QEPA 3L0QA 5GIPA 3VEYA 1C0GA 5CE3A 4WF9L 1KQSM 2HHTA 2ZGZA 1WNSA 1U2VB 1TAQA 2HF4A 3D2FB 1K8AO 3UE5A 4LSNA 2UXCK 3ZLJA 2PAVA 4BWJA 3VQ4A 3GBTA 4CJEA 2F8TA 4KTQA 3JSMA 3PO4A 1TAUA 3C95A 2QWMA 2O8CA 4RWTA 5AZJA 5BPLA 4B1WB 3CI5A 3TTDA 3LWLA 3NDKA 4IOCL 4RW4A 5AFUA 3RMCA 3CIPA 4W5TA 3LALA 3NF7A 1EETA 2HNYA 4DV3K 4DV7K 2FBTA 1Q18A 1Z25A 2KZMA 4KH6A 1TYQA 1S1VA 4IDHA 4DUZK 4WQ4A 4CK3A 1DGKN 4IFYA 3DLRA 1FXXA 4JKEA 4FJHA 2G8IA 4EIAA 3ZT0A 3O9QA 2I7NA 3QIOA 1WSJA 3DJCA 1D5AA 3DWLA 4CEOA 3ZSXA 4CF2A 3NF6A 2P9IA 5LMUK 1LW0A 1QE1A 1JLCA 1F21A 4I7FA 3C7NA 4O5BA 4CZMA 3CJBA 4KI6A 1DEJA 4DTNA 3I55N 3VQCA 5GAGP 4FJGA 3R6MA 2E4LA 3QMLA 4AM6A 3MN9A 4C8OA 4FPBA 4IFEA 3KD1E 4FWOA 1S9EA 3LPTA 2QWQA 4E89A 5GAHP 3R9PA 1QZ6A 4JI0K 2E6LA 4JK9A 4DSKA 1HYVA 3HVTA 3VQDA 4CGIA 1A5VA 2J4RA 4IJAA 3E9OA 4ZTJA 4OX9K 3CCQN 2D0BA 2XY6A 4F4KA 3MX5A 3D2EB 3NHGA 3CJ1A 3NVMA 2GX9A 3MX2A 1EWQA 1NLVA 3V4IA 5BRHA 1LAVA 3B6PA 4BRHA 3VA0A 3FZFA 1RTJA 2HSTA 3TANA 4WFNL 3EZWA 4BDYA 3QFUA 5EX5A 3CCLN 2P9PA 4W5NA 3VF4A 4JKGB 4FWLA 4OKJA 3UKUB 3ZT1A 4JI7K 5EU7A 5HRRA 4CEFA 3P31A 3RMBA 2YNGA 4B3RK 4ISGA 4IBNA 3T1YK 3VN5A 3V1QA 1VSHA 1IH7A 2P9UA 1Z26A 4FL9A 4FOEA 4ID5A 1ZBSA 3NVKA 3KKSA 1Y64A 3CQYA 3MEGA 1LWCA 3BY5A 3NMUA 1Q7YO 5HRNA 5GAEP 3KKRA 2G8HA 4N76A 1IKWA 3THXB 1P8ZA 4DV5K 4B1XB 3CJ7A 5M1FA 1NK8A 4DF8A 1U4BA 1NJYA 4IZ9A 3D0PA 1JCEA 4FWSA 2VYPA 1G99A 1W0HA 2IS3A 3OYMA 4JHDB 5SZTA 3SI6A 3SMPA 3QEXA 1WUAA 2VG7A 3SYZA 5LMNK 3VOVA 4CGFA 2FC0A 4ISEA 3M8RA 4M7XA 2RHKA 3PSIA 5AQJA 3NF8A 2W42A 4EZ9A 4DUYK 1W7AA 3ENOA 3E9LA 1QSSA 5AQRA 4KI4A 1ZXOA 5LJVA 1HKCA 4E7JA 3CFRA 5EY4A 4W5OA 1CZAN 3OHRA 1T03A 4PL8A 1GOAA 3F9MA 4X66K 3UIQA 1XQSC 4RTFD 3CCRN 3T7ZA 4H0PA 4OGCA 4AHSA 3AVJA 3OYCA 4HHTA 2Q31A 3CQXA 4BC4A 4Z4CA 4J8FA 3U9ZA 2B6AA 4DWIA 4DV0K 1TGOA 1X3MA 4O0JA 3ZSOA 3P5JA 3ASMA 4FJMA 5AQFA 1VRUA 4BE0A 5EVZA 1VQ7N 2FSJA 1NK5A 3VETA 3NH0A 1U47A 4OPHA 4I6MB 1S3XA 4JI6K 5KPZA 1N5YA 3DOKA 4YOVA 3JYTA 2VGMA 1YHQN 3LANA 3NAEA 1VQMN 3AA3A 3CJAA 1IJJA 4YFUA 2NRWA 3NFAA 1HX1A 3LWMA 1K73O 4E0DA 2Y1JA 3J7ZO 3HOTA 4YNQA 1WLJA 3V9XA 4JK7A 4DV4K 4HCCA 4AQYK 1IBKK 3VMFB 2D0PA 1P90A 2DTUA 1YJ9N 4AHVA 4CGJA 1YJWN 3VEOA 1JXEA 5C42A 2D0OA 4BRLA 1O1WA 1EWRA 1SQKA 4OPKA 4BGAA 3MK6A 5I3UA 3O4NA 3O4QA 3LPUA 3ZX2A 4KB0A 3LP2A 3TTCA 4FVMA 5E26A 4JV5K 4BRMA 4E7KA 5J2QA 3SAHA 3SZ2A 4CJPA 4WCEL 3D7EO 1EQYA 2DFHA 4DR1K 4B3MK 3OVNA 3SPYA 3CJCA 4KHPK 3D45A 3EN9A 5J2MA 3R3LA 1WBDA 3L4QA 2HB5A 3NH1A 4HCBA 2QKKA 1VRTA 2QXLA 2QI2A 3FE1A 4A62A 1XMQK 2OZSA 5F2RA 1T7PA 4O5FA 1TK5A 4JKDA 5AQWA 1YXQA 4FO0A 3OTOK 4GV9A 5BR8K 1UA0A 1J6ZA 4K0KK 1IV0A 4BRNA 4M3XA 3V6DA 3RRHA 3M8QA 4DB3A 2G8FA 2YHAA 1BQMA 2D5RA 3DXMB 3IKMA 3PIPL 1A5XA 5KI6A 3U3YA 3T3FA 5KRSA 3PLAA 2RPIA 4CJ5A 4ELUA 3SJJA 3F9KA 1VQ5N 1YTAA 3CC2N 3ZETA 4KPYA 2EWSA 1XNQK 1JLGA 4AF1A 1RBVA 3P1GA 4DCHA 3M3ZA 1BO5O 2OANA 3AVFA 4ZHRA 1WSGA 3QBXA 3OYAA 4FLXA 1X9MA 2QM1A 3BUZB 1U2VA 1R0AA 1KAZA 1GLLO 4C23A 2F9TA 1VQ9N 2O8EA 1QVFM 3O1BA 3MCAB 3E01A 4AHUA 4CGDA 5J2NA 4K42A 3B6OA 4X62K 1Q82O 4CJWA 2E5LK 3HSCA 1SZ2A 4CIEA 1S9GA 1HNXK 3HRGA 4Y0WA 3CPWM 3VGKA 2P9LB 1Z6RA 3A5MC 4NCGA 1NWKA 1VSIA 4UY8O 2Q3SA 3A0IX 3KLFA 2IVNA 1BCOA 4K25A 2UUCK 1X3NA 4CVNE 1Q86O 4A57A 3IFRA 5C10A 4BG8A 1ZYQA 3VQBA 1RDAA 3SLCA 4DSLA 3ENBA 2UXDK 3SUNA 2E6MA 3M8SA 1HQUA 1NGCA 1SKWA 4B8CA 3WT0A 4CJVA 4M3TA 1MDUB 1LAWA 4M63C 4EHTA 4KFBA 3CCEN 3DRSA 2HBLA 3DAWA 5AZIA 3U6FA 3CFOA 3HVRA 3THYA 4JKCA 2P5GA 3HM8A 2NZTA 3QO9A 2ZM6K 3SBGA 1ZBFA 1RT7A 4JI5K 1ITGA 4BDZA 4JKFA 1BIZA 1OKJA 3C65A 5I42A 1XC3A 4N41A 1L3TA 4O0IA 4FCYA 1C0TA 4L8RB 2YHXA 1ASUA 4OGEA 4C1NI 2NRTA 1T05A 2P51A 2E88A 1RNHA 4FOIA 2I5JA 4B9NA 4QS9A 1RBRA 4WYBA 3Q7CA 4DF4A 4MLEA 5E41A 3RR8A 4CJUA 2W6LA 2D1KA 2WBNA 4Z4IA 4Z4FA 3OYKA 1NMNA 2AA4A 4JK8A 1RT4A 4JI3K 2GUIA 4AHTA 2OPQA 1TL3A 4LF9K 5IT9O 2Y1IA 2BDPA 1VQ6N 1UWBA 1X1PA 4H5WA 4BC5A 1EP4A 1BOTO 2QK9A 2E20A 4CHNA 2GELA 1LWEA 3DYAA 3H08A 1XHXA 1S6PA 1ZBUA 1VQ4N 3KLHA 3TI0A 1YIJN 3VEWA 4FJXA 3SQ0A 4KHUA 1KXPA 5JICA 2B5JA 4RG8A 4HUFA 3O1WA 5ADXH 2KQ2A 3L2UA 4B9LA 1TUYA 3O5BA 2XY5A 2NLXA 4JKGA 1L3SA 1A5WA 3AGRA 5AQLA 3ZSZA 3RMDA 4WFBL 3U3GA 3AVNA 4CF1A 4GNIA 3N4PA 3VF2A 1RFQA 4C8KA 3KLIA 1GLJO 2HF3A 4FZXC 2A41A 1IBMK 4BRKA 2IAJA 5GIOA 5DM6L 2NNWA 4YOXA 4J2DA 4FK0A 4E1NA 2FBYA 4UQGA 4O44A 4KTZA 3K5OA 4QS7A 3HK2A 1B9DA 3PV8A 1T3VA 3L8BA 4YORA 1NJIO 1HNVA 1DKGD 1S5JA 4DV6K 5JS2A 1ATRA 3DMJA 3THXA 1K8KB 2VG5A 2O8BB 1X9SA 1SKSA 3LZIA 2NUBA 4KHQA 3G71N 4GVEA 2A6AA 2IOCA 3VEVA 3RR7A 4JHDA 1SL2A 2OA8A 2Z1IA 3AAQA 1XC9A 4DR4K 4FXDA 4IJNA 4G9ZA 3LZJA 5C15A 3JS6A 5HP1A 2RN2A 3HM9A 3AY9A 4MDBA 4BQZA 2A1RA 3QICA 4J2AA 2HVIA 4BGBA 2VCPA 4BROA 3A8YA 4A59A 1MA9B 4CF9A 3CCJN 3MXMA 2P9SA 4WQ5C 3R8EA 3MECA 3O80A 3DXKA 1JL1A 1ZBIA 4DR6K 2A42A 4FW2A 4KHYA 3ZSRA 1WN7A 4DLGA 1SUQA 4LC9B 2KHOA 5FPMA 1TK0A 1W2BM 4CEAA 1U48A 1C1BA 3CCMN 5GADP 1IBLK 2P9NB 3F5TA 3FZHA 3I0RA 4CFCA 5D3GA 3UKRA 1JJ2M 1RT3A 1EKEA 1OH7A 3CC4N 5KRTA 4KO0A 2W6KA 5AQUA 4E7IA 1VQNN 1VSEA 3HI0A 2KTQA 1RDBA 4JAXA 2BGGA 4PA1A 5AQYA 4BE1A 3OYFA 4DTMA 4IWVA 5BN9A 3DRPA 3VQ6A 4FJLA 1FJGK 2ZJPL 3PO5A 4OPJA 3HP6A 3I8DA 1JKHA 1HYSA 4I6MA 4B9SA 2V7ZA 3V81A 2UUBK 4YOWA 1X9WA 2UYTA 1NM1A 3ULDA 3V9SA 2X6SA 2O8DA 4Y1DA 2I7PA 1RTIA 3R1XA 3OYLA 1J5EK 1RT6A 3MEDA 3E66A 1BI4A 4FJKA 2YNFA 2QKBA 1DT9A 4M3RA 5FDLA 3L2RA 4M3WA 2IVPA 4BDPA 1UAXA 1NK4A 3KJVA 1NU0A 3BF1A 3IMXA 1SL0A 3VESA 3P4IA 4FLUA 4YOUA 4IDKA 4FJ7A 2X78A 3J8AA 4CZGA 4JKHA 3QEVA 2ITMA 3N4QA 1BDGA 1BA1A 1WOQA 1WSHA 2E1ZA 5AFUH 4CF8A 3I33A 4ELTA 5JLFA 4CGGA 3SBTA 3LM2A 3CC7N 1BUPA 4FW1A 4CE9A 5AR0A 5IWAK 2VQEK 4CI6A 4W5QA 1KD1O 5DK5A 3CETA 5FLXO 5H1SQ 3NE6A 3QFPA 3BP8A 3V1RA 2ATQA 3L4IA 1JLBA 4O55A 1HPMA 3OA9A 4DSJA 1K6YA 4F2SA 3KZBA 2UU9K 3O9UA 3L2WA 2EHGA 4BRIA 3BDPA 2OYQA 4M45A 1T8EA 3I56N 3CCVN 4BVPA 3NGIA 3J7YP 3CMAN 3B8AX 3HPGA 4B08A 4AHCA 1DTQA 2FSNA 2OCEA 5BR9A 5C2FA 1TV6A 4FSVA 2E1YA 4MLHA 1IKVA 3DXMA 1RDWX 3ULEB 2O4IA 1U04A 1BCMA 5F0XA 1NG9A 3SNNA 2CGLA 3S9HA 3RSEB 4PQUA 4XH1A 4LH4A 4JEPA 1QHTA 4K41A 2D0CA 1NOYA 2ASMA 3WXJA 2A40A 4PKHA 2IDOA 3QEWA 1XHZA 1VHXA 2ZD1A 3ZSQA 3K5LA 1LCUA 3MN7A 3F73A 3WEEB 4YDUC 3GOIA 2DPNA 1KLMA 1RCHA 2BH1A 4Z94A 3ZSWA 3QNNA 1YTUA 2KFNA 1HPZA 1RT5A 1TVRA 2CH5A 3CFPA 1ASVA 1KAYA 3AA2A 2HBJA 3K2PA 2WOMA 1YITN 2JWKA 3MAQA 1OH8A 4B9QA 2YI1A 3EE9A 3OBWA 1KCFA 1JLAA 1K9MO 4B9TA 3VQ9A 5JLHA 3VGLA 1YAGA 4FPAA 4NYFA 4BE2A 1OH6A 5DM7L 1I39A 4AILC 1QTMA 4CK1A 1Q81O 1KSPA 3WQTA 5CR4A 1SV5A 3HPHA 1VQKN 1JCGA 4OVLA 1TKZA 4DHYA 1SL1A 4ILHA 2VWJA 1KRPA 1CXUA 4A61A 2HBKA 4J2BA 3DI6A 3TSQA 3OBYA 3SMSA 3SCXA 2O8CB 3WXMB 4ICLA 3AVKA 3CQ8A 4BR2A 3OYBA 2YJEA 1WSIA 2FF6A 2CH6A 3PX4A 3FZMA 4CZEA 5JS1A 5T7BA 3G6EN 5AQSA 2EX3A 4U7BA 4JNEA 1UA1A 4BR5A 3MWPA 5KQDA 3ZT3A 2HHVA 4WFAL 2HHHK 1V4SA 1TYQB 3W3DA 2HBMA 3VQ5A 3ENHA 4E3SA 5HL7L 3VEZA 2HNZA 4DS4A 2XRIA 3AVCA 4KHWA 2ZE2A 1C1CA 5HRPA 2OPSA 4CD3A 4HVJA 3EKUA 5K14A 2V7YA 2R7YA 4ILJA 4H0VB 3D6RA 4Q0BA 4PKIA 3SV4A 4CFAA 3ZX3A 1QS4A 4H8KA 4IFVA 1D8YA 4FK2A 4CERA 3K58A 2UXBK 3S41A 2QWNA 2Q1NA 4AM7A 5JVHL 1WSFA 3CM5A 4ILGB 1ZBHA 3SAGA 1NBWA 3LDPA 2IVOA 1S72N 1KFDA 4TSXA 1KTQA 1CXQA 4DTJA 3FR0A 1BIUA 1RT2A 4WQ4C 1YVNA 3O9RA 3ZEUB 1QQNA 4JI8K 2Q0UA 3LDQA 4H5NA 4CF0A 1KFSA 3ZT4A 1VSKA 4CD1A 3GG4A 1FKPA 1D4XA 4M3UA 3K9JA 5AQGA 1QQCA 2HHSA 3ZYYX 3TSUA 1EO1A 4KREA 4DTXA 3QLHA 1VSFA 3NBPA 3EZ5A 4XH4A 2G8WA 1S22A 3HT3A 3DLHA 4FJJA 2YHBA 3LDOA 2GUPA 3HBTA 4KHSA 1HQEA 4RCHA 3MMVA 4CHZA 4NLBA 4KHNA 3K0SA 5FPEA 2P9PB 4E1JA 4I2PA 5ELZA 4XH5A 5J1EA 4CEBA 1HNZK 3G0ZA 1O13A 4GV3A 1HYZA 4J2EA 2ITGA 3HJFA 4B1UB 4FLVA 2BANA 2HHXA 3AVMA 3HSTB 4NCAA 1RDCA 3I0SA 3AVIA 1T44A 2FSKA 2XO7A 3S3OA 3ATUA 3AVAA 3L2QA 3THWB 2FLOA 3MWTA 3S3MA 3LAMA 3D2FA 1Q8IA 4OPAA 1KLNA 1WAJA 4B8AB 3M8PA 3J81O 1J53A 4A2BA 4NYNA 3VQ7A 3EY1A 4FWRA 1TKXA 4CHOA 4FYDA 1VSDA 2GWKA 1NGEA 3L3UA 3GE1A 4FLZA 4BRCA 5BPNA 1TKTA 3IG1A 1NGJA 3BZCA 1J9AA 1W9HA 2PFUA 2D4WA 4CZIA 4EP5A 4OJRA 3OYDA 3L3VA 2YV0X 4NB4A 5HOOA 2W40A 4DFKA 2QW9A 3KLGA 4DLEA 4GW6A 1HKGA 4H0YB 3O3FA 4DSIA 3NCIA 2HMIA 3WXIA 4IOXA 3VENA 2P9NA 1BQNA 3DLGA 1HKBA 3F2KA 3AA4A 2UUAK 3AV9A 1VAZA 3M1FA 3AAPA 1RDUA 4ZTFA 2P9KB 1JL2A 3KK3A 4ID1A 3OS2A 4KKOA 4CK2A 3LDLA 2VWBA 4AHRA 4MQ3A 1NGDA 1NGGA 3MDQA 3HPOA 4BC3A 2YJFA 4KV8A 4EHUA 2RKIA 1KVCA 2NRXA 5BREA 3VQ8A 3LP3A 4JRPA 4A2AA 2A3ZA 1JLQA 5ADXA 4NXNK 1WAFA 1S1TA 2ZF5O 3SQ2A 3HYFA 2E2PA 3CCUN 4R5PA 1U6ZA 4BVOA 4FZZA 1GOCA 2ZJQL 2GWJA 2JLEA 4M41A 3V9ZA 4C8MA 5AQOA 1VK0A 3RVCA 4IEEA 3G25A 4Z0UA 5CYQA 5C25A 4DTUA 4DKWA 3CG7A 1HRHA 3OW2M 2QWLA 3AVBA 3M5RA 4LH5A 1HNWK 3RMAA 4CBUA 1VSLA 5JMVA 3AVLA 3D2EA 1C0UA 3TAEA 5I9EB 1ESVA 3WNEA 3ZT2A 2BE2A 4NXMK 4DFMA 4BR9A 2AP1A 4BWMA 1HR0K 1C0MA 1NK7A 4CJFA 3DRRA 4HTUA 4FJ5A 4KB1A 1WB9A 5CY4A 4DQ8A 3VTIA 4MO5A 3CERA 3V9UA 2VGNA 4B3SK 2OZMA 3T1HK 1FKOA 3DLEA 4FM0A 3VA3A 1C0FA 2V51B 2ETJA 3H1VX 3QETA 4B9VA 3SAFA 1VQON 5FPNA 3SUPA 3GDQA 2NRHA 2YNHA 1ASWA 3UKUA 3PSFA 3SUOA 4H4OA 2PZSA 3CMEN 1UOCA 2ZGYA 4LFCK 3PX6A 3CHWA 2KZZA 1TL1A 3A2FA 2XHBA 4BR4A 3ULEA 3CPEA 3T1AA 4ISFA 5M1QA 1EX4A 3RSEA 4H5TA 5KPRA 4X64K 1VQ8N 4CJ4A 1BGXT 1MWMA 3VQEA 4PL7A 1KC8O 1RT1A 4B9UA 3LDSA 4L3QA 3FZKA 3ITHA 2FBVA 4DR2K 5DMRA 4QS8A 3O08A 3WEEA 3OJSA 4QCLA 4MO4A 1NMDA 4DFJA 4GKJK 3IRXA 4GMJB 1N33K 3ZETB 1IO2A 4DSFA 1BA0A 1HNIA 4IKFA 2PBDA 1YJNN 4FZYA 4DU1A 4MDAA 3TABA 4CJTA 3AGKA 5KTQA 2V52B 1ZBLA 1QSYA 4YY3K 1RILA 4K8XA 5E84A 4DR5K 5A2QO 2JGUA 3VQAA 5AQIA 3K5MA 3ZCMA 2O4GA 2F8SA 3AVGA 4F9OA 4OLBA 3QB0A 4I9QA 4EP4A 3QINA 2O8EB 4R79A 1R59O 5AQPA 1HJRA 3OYHA 1TUUA 2NRRA 4B3OA 3ZSVA 2QTDA 3O3GA 3I8BA 1J5OA 3HZ6A 5C2DA 3THVA 3OS1A 4FLYA 2WONA 3U8XA 5C24A 5KPTA 3QERA 3CD6N 4JKBA 1NGBA 1RTDA 4Y1CA 3O6WA 1BL3A 1LW2A 1FW6A 4PHTX 3WNFA 3IS9A 1YUWA 4FLWA 1BHLA 4DTOA 1MWKA 4E19A 3EKSA 1RBTA 1E4GT 2YHWA 3TPQA 1Z05A 5F1XA 4DS5A 3FLCO 3AO3A 4B3TK 1RGIA 1S1XA 4NCBA 2HHWA 1WBBA 5B8HA 4KAZA 4DSEA 1IG8A 3MXJA 5AZIB 2P5OA 2Q36A 4GV6A 3THYB 4ELVA 4IOAL 1X9JA 1MU2A 1YVUA 5LY3A 1I94K 3H3NO 4CZJA 4DV1K 4CEZA 3VPZA 3KWGA 3C6HA 3H6EA 1RDDA 5HRSA 1IKXA 3BGRA 4IG0A 4W5RA 2F9WA 3H3OB 4CIGA 4JS4A 4B1ZA 3VERA 5FRNA 4FM1A 2W41A 5GINA 2WTUA 4LF5K 3KK2A 4DU3A 3ZEUA 4BC2A 3Q7BA 4JI1K 3C6AA 4C1NK 5LL6Z 3TSPA 3OYIA 1WSEA 3RWUA 5AQQA 4I9LA 3DM2A 1NJWA 1S1UA 3DOLA 3SV3A 3MCPA 4HUGA 2WFBA 4CW7B 4N5SA 2Q0RA 1S6QA 1SAZA 4JD2B 4C8LA 3P39A 2GTDA 1JXBA 2GBZA 3RRGA 3J7AP 4JYAK 1YI2N 2DFEA 4H03B 3C94A 5C12A 3TAQA 4M3YA 2HW3A 3LL3A 3TAGA 3AO1A 3O8MA 4E7HA 4F3TA 3IDHA 1J54A 5BN8A 3TARA 1M1KO 3H46O 1V4TA 1OH5A 1RTHA 3VEXA 3G10A 4RW9A 3L2VA 3WUHA 1REVA 4DFPA 4CJLA 2NRVA 1QZ5A 3WQUA 4CZFA 4O4GA 2FXUA 3NH2A 3THWA 4O8KA 2NRZA 3OYJA 3TU5A 2XY8A 1CZBA 4FJ9A 4RW7A 2E2QA 4B1VA 4CHYA 1LWFA 4LD0A 4CECA 1QHAA 1LOTB 3EE8A 4CHQA 5AQTA 3O3HA 4DQQA 5EXWA 1SKRA 3T69A 1NOZA 1NK6A 3TAPA 1TKDA 4LY7A 1GOBA 1BISA 1GLFO 2QEXN 2O8FB 4IO8A 1B92A 4JKAA 3PUFA 1NK9A 4JN4A 2X6NA 1NJZA 3ATVA 1QQMA 2E2NA 2E2OA 1G15A 3SPZA 3HXMA 3C6TA 2P9LA 4DQIA 3VTHA 4EFHA 4I2QA 4DMNA 4OO1J 3NGZA 5M1NA 3J80O 3KVGA 4IEIA 2QWOA 4KTWA 5C0YA 3E9PA 2DFFA 1OVYA 5CZ1A 5EOYA 4FJNA 4KH4A 5M1OA 4BRFA 5TKWA 5AZJB 4LFAK 4DR3K 3PIOL 2AJQA 2A1SA 4JI4K 1HLUA 2BTFA 3SK3A 4CZLA 4U67L 3A5NC 3IAYA 2P9SB 1GLAG 2FBXA 1QVGM 4BRAA 4BACA 5FRMA 1XMOK 2YKNA 2P9KA 3DXKB 5FPDA 4YHHK 2WUSA 3HOSA 5AQXA 3TWHA 2F96A 4RW8A 1BU6O 3FZLA 1NGIA 1GLDG 2Q2RA 4YOYA 1N34K 3UKRB 3UB5A 1RBSA 3MN5A 4IG3A 2Z1HA 1E3MA 4OLAA 2G8VA 4BRGA 2G8UA 1VQPN 4HWIA 1VSJA 1NKBA 2F7TA 4LF7K 4FWKA 4O8UA 1GLCG 4FJIA 3WXLA 5AQKA 4CJKA 4CJRA 4DG1A 3NF9A 1HJOA 1L3UA 4K8ZA 3SQ4A 1D9FA 4JS5A 3CM6A 2ZJRL 3O4WA 2P9IB 4RW6A 5J2PA 3PY8A 3C7NB 3BF3A 3ISNC 1CZ9A 5HROA 3SQ1A 2O8DB 3NGYA 3DLLL 4NLCA 2ZQBA 2ZWHA 1N32K 2HNDA 3KK1A 3S3NA 1BI4B 3JXUA 4CEQA 1NKEA 1U45A 3A5LC 4CFBA 4H0OA 4BQLA 1JLEA 2YNIA 4G1QA 2QWRA 1NK0A 5KQ8A 4NO7A 4PY5A 4JLHA 2YHYA 4QAGA 2HHQA 4HUEA 1KAXA 3HTVA 3HO1A 5CZ2A 3QNOA 1NGHA 3O9TA 4WE1A 5M1KA 1NJXA 2KKZA 3JAMO 2VG6A 1H1VA 4CZKA 3OJUA 1CLQA 2HHUA 4Z4HA 3TR8A 1C1AA 4CBWA 4OKEA 4E7LA 1HUXA 1ZC6A 1QQOA 1XWLA 1NGAA 4CJQA 4B9MA 1Q9YA 2B4JA 1ATNA 4B1YB 2QWPA 3QIPA 4CJ7A 3CXCM 4JI2K 1DLOA 3A5OC 3LM9A 3E1YA 3QDKA 1Q9XA 4KBOA 3OS0A 3WNGA 3ALYA 3CF5L 3EL2A 4LSLA 3V9WA 2OPRA 4CZHA 3AO4A 5FROA 3H1QA 3BZKA 5BRFA 3CCSN 4HTLA 3KLEA 4BG9A 5CYMA 3DLKA 3L6QA 4WQ5A 3CYMA 2HOEA 3LDNA 3W0LA 3G4SN 3EYZA 4M7YA 3LAKA 4XEIA 4FLTA 2PYLA 2X74A 3KTQA 2ASPA 1QSLA 3ZX0A 3ZSYA 4FWNA 1NGFA 2P9UB 3LP0A 4CBXA 5CHIA 2FF3B 1K8KA 5AQNA 2F4VK 1BWFO 3TAMA 2O8BA 1FK9A 2KLAA 1M90O 3O9SA 1N6QA 2Z1GA 4KH5A 3EEQA 3EO3A 4LF6K 3P38A 4FK4A 3WNHA 4IO9L 5BRDA 5KGWA 1HMVA 3OYEA 3KD5E 1S1WA 2GV9A 4H5VA 4IXCA 4DQRA 3V1OA 3PX0A 4CEDA 4DTRA 4V19S 4PWDA 5AQHA 3QESA 2CGJA 4FWMA 2BUPA 1L3VA 4Q5VA 1GLBG 4BRDA 4CGHA 4Z4GA 1GLEG 2H3GX 4GKKK 1N36K 4CEEA 2P1JA 3WXKA 1T6DA 3M6GA 2IC3A 1D9DA 2A5XA 3ID8A 3P83D 4PUOA 5AJ3K 1JLFA 3VQPA 3LP1A 2DY4A 3K57A 3TAFA 1C6VA 4DU4A 4CJ3A 1NKCA 4CJSA 3AO2A 4CCHA 4X65K 3OYGA 1I3AA 5M1PA 1XNRK 3ID6A 1JCFA 1YF5L 3HL8A 4DV2K 4DTSA 3U4LA 1KVAA 4DTPA 2KFZA 3SJHA 4CHPA 3IUCA 3GL1A 4LFBK 2ASOA 4E1MA 4F3OA 2RF2A 1IKYA 2IGIA 2PY5A 1EXQA 4Z4EA 1XUPO 4QOZB 1DTTA 2Z1JA 4FVUA 2IIRA 3AO5A 3KK7A 4K43A
chains in the Genus database with same CATH topology
1XHZA 2WONA 2ZD1A 3ZSQA 3K5LA 4H4MA 5C24A 3QERA 3D45A 3F73A 2XY7A 3K59A 4MFBA 1RBUA 5J2MA 1RTDA 4Y1CA 1BL3A 1LW2A 2KW4A 4FJ8A 2HB5A 1Y97A 1KLMA 3OY9A 4EZ6A 1RCHA 3NH1A 3WNFA 3ZSWA 3IS9A 3QNNA 4HCBA 1YTUA 2KFNA 1HPZA 1RT5A 1TVRA 4FLWA 2QKKA 1VRTA 3CFPA 1ASVA 1BHLA 3AA2A 3K2PA 4DTOA 2OZSA 2WOMA 4M42A 4E19A 1T7PA 3MAQA 1RBTA 3RTVA 1TK5A 1B9FA 4DS5A 3AO3A 5HLFA 1KVBA 1KCFA 1JLAA 3K5NA 1UA0A 4B9TA 3VQ9A 1S1XA 4M3XA 3V6DA 3RRHA 1YT3A 3M8QA 2PYJA 4NCBA 2HHWA 4NYFA 5SWMA 3AA5X 2YHAA 4BE2A 2G8FA 1BQMA 2D5RA 2LSNA 1I39A 4DQSA 4AILC 4CK1A 1QTMA 1A5XA 3T19A 4KAZA 4DSEA 5HBMA 5KI6A 3U3YA 1KSPA 1SV5A 3HPHA 3MEEA 3MXJA 5KRSA 3T3FA 2RPIA 2YKMA 2P5OA 4CJ5A 4ELUA 3SJJA 4ELVA 3F9KA 4OVLA 1TKZA 1YTAA 4JRQA 1SL1A 1KRPA 2VWJA 4KRFA 3VQQA 1CXUA 1MU2A 1YVUA 3FFIA 4KPYA 4J2BA 3DI6A 1JLGA 1IG9A 4CFDA 3HP9A 4CEZA 3SCXA 1RBVA 3P1GA 4ICLA 3AVKA 3CQ8A 1RDDA 5HRSA 1IKXA 3AVFA 4ZHRA 3OYBA 1WSGA 3BGRA 4IG0A 4W5RA 3QEIA 3OYAA 1WSIA 4FLXA 3SUQA 2G8KA 5KGXA 3PX4A 4CIGA 1X9MA 2D0AA 5JS1A 4JS4A 5T7BA 4OKKA 2EX3A 1R0AA 5FRNA 4N47A 4FM1A 3OYNA 1UA1A 4N56A 4F8RA 3ZT3A 4GVMA 4F2RA 2HHVA 4DQPA 4FM2A 4C8NA 3KK2A 4CIFA 4XIUA 2OPPA 4CESA 4DU3A 3DLBA 3E01A 4AHUA 4CGDA 3MXIA 3VQ5A 5J2NA 4E3SA 2QXFA 2HNZA 3C6UA 3OYIA 3B6OA 4DS4A 1WSEA 2XRIA 4CJWA 3AVCA 1L5UA 3RWUA 4KHWA 2ZE2A 4M3ZA 3AVHA 4CIEA 1C1CA 1S9GA 3DM2A 4I9LA 5HRPA 2OPSA 1NJWA 2HVHA 1S1UA 3DOLA 4HVJA 1TK8A 5K14A 3SV3A 1LV5A 4NCGA 2VWKA 2R7YA 4HUGA 1U49A 1VSIA 2Q3SA 3KLFA 1BCOA 4Q0BA 1XI1A 4N5SA 3SV4A 1S6QA 4CFAA 1QS4A 4AH9A 4H8KA 4PY5A 4IFVA 1D8YA 4C8LA 1ZYQA 3VQBA 4FK2A 1RDAA 4DSLA 4CERA 3K58A 3SUNA 2E6MA 1JXBA 3M8SA 2GBZA 1VSMA 3RRGA 1HQUA 2DFEA 3KIOA 3C94A 1WSFA 3CM5A 1SKWA 3TAQA 4B8CA 4M3YA 1ZBHA 3QEPA 2HW3A 4CJVA 3TAGA 3AO1A 2HHTA 1KFDA 4E7HA 4M3TA 1LAWA 1WNSA 4TSXA 4F3TA 1J54A 1TAQA 4KFBA 3TARA 1KTQA 3DRSA 1CXQA 4LSNA 4DTJA 1RTHA 3U6FA 3G10A 4BWJA 4RW9A 3VQ4A 3L2VA 3CFOA 3HVRA 1BIUA 1RT2A 1REVA 4DFPA 2P5GA 4CJEA 4CJLA 2F8TA 3QO9A 4KTQA 3JSMA 3PO4A 1TAUA 4CF0A 1KFSA 3C95A 1ZBFA 3ZT4A 1RT7A 1VSKA 1ITGA 1FKPA 4O4GA 4BDZA 4M3UA 1QQCA 1BIZA 5I42A 2HHSA 3NH2A 3LWLA 3NDKA 4KREA 4DTXA 4N41A 3QLHA 1VSFA 3NBPA 3OYJA 3EZ5A 1L3TA 4O0IA 4FCYA 1C0TA 2G8WA 4L8RB 4RW4A 3HT3A 1ASUA 3DLHA 2XY8A 4OGEA 4FJJA 2YHBA 3RMCA 1CZBA 4W5TA 1T05A 3LALA 3NF7A 4RW7A 1EETA 4CHYA 4FJ9A 2P51A 2HNYA 1RNHA 2I5JA 4B9NA 2FBTA 1LWFA 4LD0A 4CECA 1HQEA 4KHSA 1Z25A 1RBRA 2KZMA 4CHQA 3O3HA 4DQQA 4DF4A 1SKRA 5E41A 3RR8A 1S1VA 1NOZA 4CHZA 1NK6A 3TAPA 4CJUA 4KHNA 1TKDA 4LY7A 1GOBA 1BISA 1B92A 3PUFA 4Z4FA 4Z4IA 1NK9A 3OYKA 2X6NA 1NJZA 4I2PA 4CK3A 1RT4A 1G15A 4IFYA 3SPZA 2GUIA 3DLRA 2OPQA 4AHTA 3HXMA 1FXXA 5J1EA 4FJHA 4CEBA 1TL3A 2G8IA 3G0ZA 3C6TA 2Y1IA 4DQIA 1HYZA 3ZT0A 2BDPA 1UWBA 4I2QA 1X1PA 4DMNA 1EP4A 3NGZA 4J2EA 2ITGA 2QK9A 4CHNA 3QIOA 4KTWA 1WSJA 3HJFA 2DFFA 4FLVA 2BANA 5CZ1A 1LWEA 4FJNA 1D5AA 3AVMA 2HHXA 3DYAA 3HSTB 3H08A 3ZSXA 1XHXA 1S6PA 3NF6A 1ZBUA 4CEOA 4CF2A 4NCAA 3KLHA 1RDCA 3TI0A 1LW0A 1QE1A 3I0SA 4FJXA 1JLCA 1F21A 2A1SA 3AVIA 4I7FA 4O5BA 2XO7A 3SQ0A 4KHUA 2AJQA 3S3OA 3AVAA 3L2QA 2B5JA 4RG8A 3IAYA 2FBXA 4KI6A 4BACA 5FRMA 4HUFA 4DTNA 2KQ2A 3VQCA 2YKNA 3LAMA 3L2UA 3S3MA 4B9LA 4FJGA 2E4LA 2XY5A 1Q8IA 4C8OA 1KLNA 1WAJA 1L3SA 1A5WA 4B8AB 3TWHA 3KD1E 1S9EA 2F96A 3M8PA 4RW8A 1J53A 3ZSZA 3RMDA 4NYNA 3U3GA 3VQ7A 3EY1A 3LPTA 1TKXA 4CHOA 3AVNA 4E89A 4FYDA 1VSDA 4CF1A 2E6LA 3L3UA 4FLZA 4DSKA 1HYVA 3HVTA 4C8KA 3VQDA 1TKTA 1A5VA 3IG1A 4CGIA 3KLIA 4FZXC 1J9AA 1W9HA 1RBSA 4EP5A 2IAJA 4ZTJA 4OJRA 3OYDA 4IG3A 2D0BA 2Z1HA 3L3VA 4OLAA 4J2DA 2G8VA 2G8UA 2XY6A 4F4KA 2YV0X 4FK0A 1VSJA 3NHGA 4E1NA 1NKBA 2FBYA 4UQGA 4FJIA 3V4IA 4O44A 4CJKA 4CJRA 4KTZA 3K5OA 3KLGA 4DLEA 4GW6A 3NF9A 1LAVA 3B6PA 4DG1A 1B9DA 3VA0A 3PV8A 3HK2A 1L3UA 3O3FA 4K8ZA 4DSIA 3NCIA 3SQ4A 3L8BA 2HMIA 1D9FA 1RTJA 1HNVA 4JS5A 3CM6A 1S5JA 3TANA 4RW6A 5JS2A 5J2PA 1BQNA 3DLGA 3PY8A 3DMJA 3AA4A 4BDYA 3ISNC 1CZ9A 5HROA 3SQ1A 3AV9A 2VG5A 4W5NA 3NGYA 2ZQBA 1X9SA 1SKSA 3LZIA 2NUBA 2HNDA 3KK1A 3S3NA 1BI4B 4CEQA 1NKEA 1U45A 4ZTFA 4KHQA 1JL2A 3KK3A 4CFBA 2IOCA 1JLEA 2YNIA 4G1QA 4ID1A 4OKJA 3OS2A 4KKOA 1NK0A 4CK2A 1SL2A 3RR7A 4JLHA 4QAGA 3ZT1A 2OA8A 2Z1IA 4HUEA 4AHRA 1XC9A 4MQ3A 2HHQA 5EU7A 5HRRA 4CEFA 4FXDA 3HPOA 5CZ2A 3RMBA 3HO1A 3LZJA 2YNGA 3QNOA 5HP1A 4IBNA 2RN2A 3HM9A 3VN5A 4DFKA 4WE1A 2A1RA 4KV8A 1NJXA 2RKIA 2VG6A 3OJUA 1KVCA 4J2AA 2HHUA 3V1QA 1CLQA 2HVIA 1VSHA 3VQ8A 3LP3A 1IH7A 4Z4HA 4JRPA 3TR8A 1Z26A 1C1AA 4ID5A 1JLQA 4OKEA 4CF9A 1WAFA 1S1TA 3SQ2A 4E7LA 3HYFA 3KKSA 3MXMA 3MEGA 4R5PA 1XWLA 1LWCA 4FZZA 4CJQA 4B9MA 3MECA 1GOCA 1Q9YA 2B4JA 1JL1A 1ZBIA 4FW2A 5HRNA 2JLEA 3QIPA 4M41A 3ZSRA 1WN7A 4DLGA 1SUQA 3V9ZA 1TK0A 1DLOA 4C8MA 1VK0A 4CEAA 1U48A 1C1BA 3KKRA 2G8HA 4Z0UA 4N76A 5CYQA 5C25A 1IKWA 1Q9XA 3OS0A 4DTUA 3WNGA 3CG7A 3I0RA 4CFCA 1HRHA 5D3GA 1NK8A 1RT3A 4DF8A 3ALYA 1EKEA 1U4BA 3AVBA 4LH5A 4KO0A 5KRTA 3D0PA 1NJYA 4E7IA 3V9WA 4LSLA 1VSEA 2OPRA 3RMAA 1VSLA 1RDBA 2KTQA 3AO4A 5FROA 2BGGA 3AVLA 4PA1A 4BE1A 1C0UA 3OYFA 1W0HA 2IS3A 3TAEA 3OYMA 5SZTA 4DTMA 3SI6A 3WNEA 3ZT2A 3DRPA 2BE2A 5CYMA 3VQ6A 3KLEA 4DFMA 3DLKA 2VG7A 3SYZA 3QEXA 4BWMA 4FJLA 1C0MA 1NK7A 3CYMA 4OPJA 3PO5A 3HP6A 3EYZA 4CJFA 3LAKA 4CGFA 3DRRA 4HTUA 4FJ5A 2FC0A 3I8DA 1JKHA 4FLTA 2PYLA 4B9SA 3V81A 2X74A 3M8RA 4KB1A 3KTQA 1HYSA 1QSLA 5CY4A 3ZSYA 1X9WA 3LP0A 3ULDA 3V9UA 3V9SA 4EZ9A 2OZMA 3NF8A 2X6SA 2W42A 4Y1DA 1FKOA 1RTIA 3DLEA 3OYLA 4FM0A 3VA3A 3TAMA 1RT6A 3MEDA 1FK9A 2ETJA 3QETA 4B9VA 1BI4A 1QSSA 2YNFA 4FJKA 4KI4A 2QKBA 4M3RA 1N6QA 2Z1GA 5FDLA 3SUPA 3L2RA 2YNHA 4E7JA 4M3WA 3CFRA 4BDPA 4W5OA 1T03A 1ASWA 1UAXA 1NK4A 4FK4A 3WNHA 3SUOA 1GOAA 4H4OA 2PZSA 3KJVA 3UIQA 5KGWA 1HMVA 3OYEA 3KD5E 1SL0A 1S1WA 2GV9A 4FLUA 4OGCA 1UOCA 4IDKA 4AHSA 4DQRA 4FJ7A 3AVJA 3V1OA 2X78A 3OYCA 3PX0A 4HHTA 4CEDA 3PX6A 4DTRA 3QEVA 4PWDA 4Z4CA 3OS1A 2KZZA 2B6AA 1TL1A 3A2FA 2XHBA 3QESA 4DWIA 1WSHA 1TGOA 1L3VA 4O0JA 4Q5VA 3ZSOA 3P5JA 4CGHA 3T1AA 3ASMA 4Z4GA 4FJMA 1EX4A 4CF8A 1VRUA 4BE0A 4CEEA 4ELTA 2P1JA 4CGGA 1NK5A 4CJ4A 4FW1A 3NH0A 1BGXT 4CE9A 3VQEA 1U47A 1RT1A 2IC3A 1D9DA 4B9UA 3LDSA 4W5QA 1N5YA 3DOKA 3ITHA 5DK5A 3P83D 4PUOA 2FBVA 3NE6A 5DMRA 1JLFA 3JYTA 3VQPA 3V1RA 3LP1A 2DY4A 2ATQA 3LANA 1JLBA 4O55A 3OJSA 3AA3A 3K57A 3NAEA 4QCLA 4DFJA 4DSJA 3TAFA 1C6VA 1K6YA 4DU4A 3IRXA 4YFUA 4F2SA 4KHYA 3NFAA 4CJ3A 3L2WA 2EHGA 4GMJB 3LWMA 1NKCA 3BDPA 4CJSA 2Y1JA 2OYQA 4M45A 1T8EA 4E0DA 1IO2A 3AO2A 1WLJA 4YNQA 4DSFA 3V9XA 1HNIA 4CCHA 4IKFA 3OYGA 3NGIA 4FZYA 4HCCA 4DU1A 3TABA 1I3AA 4CJTA 3HPGA 4B08A 4AHCA 5KTQA 1ZBLA 2DTUA 1DTQA 4AHVA 1QSYA 3HL8A 4CGJA 1RILA 4K8XA 4DTSA 2JGUA 1JXEA 3VQAA 1KVAA 1TV6A 5C42A 3K5MA 4DTPA 3ZCMA 2KFZA 2O4GA 1O1WA 4CHPA 2F8SA 1IKVA 4OPKA 3AVGA 5I3UA 4OLBA 2O4IA 1U04A 4I9QA 1BCMA 4E1MA 4F3OA 4EP4A 3O4NA 3QINA 2RF2A 3O4QA 3SNNA 1IKYA 2IGIA 3LPUA 4KB0A 3LP2A 2PY5A 3S9HA 1HJRA 4FVMA 3OYHA 4PQUA 4B3OA 4LH4A 3ZSVA 3O3GA 1EXQA 4Z4EA 4E7KA 5J2QA 3SZ2A 1QHTA 4QOZB 1DTTA 2Z1JA 4CJPA 1J5OA 1NOYA 2D0CA 2DFHA 3AO5A 2IDOA 3QEWA 3THVA 3OVNA 3SPYA 4FLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHZ A;  2WON A;  2ZD1 A;  3ZSQ A;  3K5L A;  4H4M A;  5C24 A;  3QER A;  3D45 A;  3F73 A;  2XY7 A;  3K59 A;  4MFB A;  1RBU A;  5J2M A;  1RTD A;  4Y1C A;  1BL3 A;  1LW2 A;  2KW4 A;  4FJ8 A;  2HB5 A;  1Y97 A;  1KLM A;  3OY9 A;  4EZ6 A;  1RCH A;  3NH1 A;  3WNF A;  3ZSW A;  3IS9 A;  3QNN A;  4HCB A;  1YTU A;  2KFN A;  1HPZ A;  1RT5 A;  1TVR A;  4FLW A;  2QKK A;  1VRT A;  3CFP A;  1ASV A;  1BHL A;  3AA2 A;  3K2P A;  4DTO A;  2OZS A;  2WOM A;  4M42 A;  4E19 A;  1T7P A;  3MAQ A;  1RBT A;  3RTV A;  1TK5 A;  1B9F A;  4DS5 A;  3AO3 A;  5HLF A;  1KVB A;  1KCF A;  1JLA A;  3K5N A;  1UA0 A;  4B9T A;  3VQ9 A;  1S1X A;  4M3X A;  3V6D A;  3RRH A;  1YT3 A;  3M8Q A;  2PYJ A;  4NCB A;  2HHW A;  4NYF A;  5SWM A;  3AA5 X;  2YHA A;  4BE2 A;  2G8F A;  1BQM A;  2D5R A;  2LSN A;  1I39 A;  4DQS A;  4AIL C;  4CK1 A;  1QTM A;  1A5X A;  3T19 A;  4KAZ A;  4DSE A;  5HBM A;  5KI6 A;  3U3Y A;  1KSP A;  1SV5 A;  3HPH A;  3MEE A;  3MXJ A;  5KRS A;  3T3F A;  2RPI A;  2YKM A;  2P5O A;  4CJ5 A;  4ELU A;  3SJJ A;  4ELV A;  3F9K A;  4OVL A;  1TKZ A;  1YTA A;  4JRQ A;  1SL1 A;  1KRP A;  2VWJ A;  4KRF A;  3VQQ A;  1CXU A;  1MU2 A;  1YVU A;  3FFI A;  4KPY A;  4J2B A;  3DI6 A;  1JLG A;  1IG9 A;  4CFD A;  3HP9 A;  4CEZ A;  3SCX A;  1RBV A;  3P1G A;  4ICL A;  3AVK A;  3CQ8 A;  1RDD A;  5HRS A;  1IKX A;  3AVF A;  4ZHR A;  3OYB A;  1WSG A;  3BGR A;  4IG0 A;  4W5R A;  3QEI A;  3OYA A;  1WSI A;  4FLX A;  3SUQ A;  2G8K A;  5KGX A;  3PX4 A;  4CIG A;  1X9M A;  2D0A A;  5JS1 A;  4JS4 A;  5T7B A;  4OKK A;  2EX3 A;  1R0A A;  5FRN A;  4N47 A;  4FM1 A;  3OYN A;  1UA1 A;  4N56 A;  4F8R A;  3ZT3 A;  4GVM A;  4F2R A;  2HHV A;  4DQP A;  4FM2 A;  4C8N A;  3KK2 A;  4CIF A;  4XIU A;  2OPP A;  4CES A;  4DU3 A;  3DLB A;  3E01 A;  4AHU A;  4CGD A;  3MXI A;  3VQ5 A;  5J2N A;  4E3S A;  2QXF A;  2HNZ A;  3C6U A;  3OYI A;  3B6O A;  4DS4 A;  1WSE A;  2XRI A;  4CJW A;  3AVC A;  1L5U A;  3RWU A;  4KHW A;  2ZE2 A;  4M3Z A;  3AVH A;  4CIE A;  1C1C A;  1S9G A;  3DM2 A;  4I9L A;  5HRP A;  2OPS A;  1NJW A;  2HVH A;  1S1U A;  3DOL A;  4HVJ A;  1TK8 A;  5K14 A;  3SV3 A;  1LV5 A;  4NCG A;  2VWK A;  2R7Y A;  4HUG A;  1U49 A;  1VSI A;  2Q3S A;  3KLF A;  1BCO A;  4Q0B A;  1XI1 A;  4N5S A;  3SV4 A;  1S6Q A;  4CFA A;  1QS4 A;  4AH9 A;  4H8K A;  4PY5 A;  4IFV A;  1D8Y A;  4C8L A;  1ZYQ A;  3VQB A;  4FK2 A;  1RDA A;  4DSL A;  4CER A;  3K58 A;  3SUN A;  2E6M A;  1JXB A;  3M8S A;  2GBZ A;  1VSM A;  3RRG A;  1HQU A;  2DFE A;  3KIO A;  3C94 A;  1WSF A;  3CM5 A;  1SKW A;  3TAQ A;  4B8C A;  4M3Y A;  1ZBH A;  3QEP A;  2HW3 A;  4CJV A;  3TAG A;  3AO1 A;  2HHT A;  1KFD A;  4E7H A;  4M3T A;  1LAW A;  1WNS A;  4TSX A;  4F3T A;  1J54 A;  1TAQ A;  4KFB A;  3TAR A;  1KTQ A;  3DRS A;  1CXQ A;  4LSN A;  4DTJ A;  1RTH A;  3U6F A;  3G10 A;  4BWJ A;  4RW9 A;  3VQ4 A;  3L2V A;  3CFO A;  3HVR A;  1BIU A;  1RT2 A;  1REV A;  4DFP A;  2P5G A;  4CJE A;  4CJL A;  2F8T A;  3QO9 A;  4KTQ A;  3JSM A;  3PO4 A;  1TAU A;  4CF0 A;  1KFS A;  3C95 A;  1ZBF A;  3ZT4 A;  1RT7 A;  1VSK A;  1ITG A;  1FKP A;  4O4G A;  4BDZ A;  4M3U A;  1QQC A;  1BIZ A;  5I42 A;  2HHS A;  3NH2 A;  3LWL A;  3NDK A;  4KRE A;  4DTX A;  4N41 A;  3QLH A;  1VSF A;  3NBP A;  3OYJ A;  3EZ5 A;  1L3T A;  4O0I A;  4FCY A;  1C0T A;  2G8W A;  4L8R B;  4RW4 A;  3HT3 A;  1ASU A;  3DLH A;  2XY8 A;  4OGE A;  4FJJ A;  2YHB A;  3RMC A;  1CZB A;  4W5T A;  1T05 A;  3LAL A;  3NF7 A;  4RW7 A;  1EET A;  4CHY A;  4FJ9 A;  2P51 A;  2HNY A;  1RNH A;  2I5J A;  4B9N A;  2FBT A;  1LWF A;  4LD0 A;  4CEC A;  1HQE A;  4KHS A;  1Z25 A;  1RBR A;  2KZM A;  4CHQ A;  3O3H A;  4DQQ A;  4DF4 A;  1SKR A;  5E41 A;  3RR8 A;  1S1V A;  1NOZ A;  4CHZ A;  1NK6 A;  3TAP A;  4CJU A;  4KHN A;  1TKD A;  4LY7 A;  1GOB A;  1BIS A;  1B92 A;  3PUF A;  4Z4F A;  4Z4I A;  1NK9 A;  3OYK A;  2X6N A;  1NJZ A;  4I2P A;  4CK3 A;  1RT4 A;  1G15 A;  4IFY A;  3SPZ A;  2GUI A;  3DLR A;  2OPQ A;  4AHT A;  3HXM A;  1FXX A;  5J1E A;  4FJH A;  4CEB A;  1TL3 A;  2G8I A;  3G0Z A;  3C6T A;  2Y1I A;  4DQI A;  1HYZ A;  3ZT0 A;  2BDP A;  1UWB A;  4I2Q A;  1X1P A;  4DMN A;  1EP4 A;  3NGZ A;  4J2E A;  2ITG A;  2QK9 A;  4CHN A;  3QIO A;  4KTW A;  1WSJ A;  3HJF A;  2DFF A;  4FLV A;  2BAN A;  5CZ1 A;  1LWE A;  4FJN A;  1D5A A;  3AVM A;  2HHX A;  3DYA A;  3HST B;  3H08 A;  3ZSX A;  1XHX A;  1S6P A;  3NF6 A;  1ZBU A;  4CEO A;  4CF2 A;  4NCA A;  3KLH A;  1RDC A;  3TI0 A;  1LW0 A;  1QE1 A;  3I0S A;  4FJX A;  1JLC A;  1F21 A;  2A1S A;  3AVI A;  4I7F A;  4O5B A;  2XO7 A;  3SQ0 A;  4KHU A;  2AJQ A;  3S3O A;  3AVA A;  3L2Q A;  2B5J A;  4RG8 A;  3IAY A;  2FBX A;  4KI6 A;  4BAC A;  5FRM A;  4HUF A;  4DTN A;  2KQ2 A;  3VQC A;  2YKN A;  3LAM A;  3L2U A;  3S3M A;  4B9L A;  4FJG A;  2E4L A;  2XY5 A;  1Q8I A;  4C8O A;  1KLN A;  1WAJ A;  1L3S A;  1A5W A;  4B8A B;  3TWH A;  3KD1 E;  1S9E A;  2F96 A;  3M8P A;  4RW8 A;  1J53 A;  3ZSZ A;  3RMD A;  4NYN A;  3U3G A;  3VQ7 A;  3EY1 A;  3LPT A;  1TKX A;  4CHO A;  3AVN A;  4E89 A;  4FYD A;  1VSD A;  4CF1 A;  2E6L A;  3L3U A;  4FLZ A;  4DSK A;  1HYV A;  3HVT A;  4C8K A;  3VQD A;  1TKT A;  1A5V A;  3IG1 A;  4CGI A;  3KLI A;  4FZX C;  1J9A A;  1W9H A;  1RBS A;  4EP5 A;  2IAJ A;  4ZTJ A;  4OJR A;  3OYD A;  4IG3 A;  2D0B A;  2Z1H A;  3L3V A;  4OLA A;  4J2D A;  2G8V A;  2G8U A;  2XY6 A;  4F4K A;  2YV0 X;  4FK0 A;  1VSJ A;  3NHG A;  4E1N A;  1NKB A;  2FBY A;  4UQG A;  4FJI A;  3V4I A;  4O44 A;  4CJK A;  4CJR A;  4KTZ A;  3K5O A;  3KLG A;  4DLE A;  4GW6 A;  3NF9 A;  1LAV A;  3B6P A;  4DG1 A;  1B9D A;  3VA0 A;  3PV8 A;  3HK2 A;  1L3U A;  3O3F A;  4K8Z A;  4DSI A;  3NCI A;  3SQ4 A;  3L8B A;  2HMI A;  1D9F A;  1RTJ A;  1HNV A;  4JS5 A;  3CM6 A;  1S5J A;  3TAN A;  4RW6 A;  5JS2 A;  5J2P A;  1BQN A;  3DLG A;  3PY8 A;  3DMJ A;  3AA4 A;  4BDY A;  3ISN C;  1CZ9 A;  5HRO A;  3SQ1 A;  3AV9 A;  2VG5 A;  4W5N A;  3NGY A;  2ZQB A;  1X9S A;  1SKS A;  3LZI A;  2NUB A;  2HND A;  3KK1 A;  3S3N A;  1BI4 B;  4CEQ A;  1NKE A;  1U45 A;  4ZTF A;  4KHQ A;  1JL2 A;  3KK3 A;  4CFB A;  2IOC A;  1JLE A;  2YNI A;  4G1Q A;  4ID1 A;  4OKJ A;  3OS2 A;  4KKO A;  1NK0 A;  4CK2 A;  1SL2 A;  3RR7 A;  4JLH A;  4QAG A;  3ZT1 A;  2OA8 A;  2Z1I A;  4HUE A;  4AHR A;  1XC9 A;  4MQ3 A;  2HHQ A;  5EU7 A;  5HRR A;  4CEF A;  4FXD A;  3HPO A;  5CZ2 A;  3RMB A;  3HO1 A;  3LZJ A;  2YNG A;  3QNO A;  5HP1 A;  4IBN A;  2RN2 A;  3HM9 A;  3VN5 A;  4DFK A;  4WE1 A;  2A1R A;  4KV8 A;  1NJX A;  2RKI A;  2VG6 A;  3OJU A;  1KVC A;  4J2A A;  2HHU A;  3V1Q A;  1CLQ A;  2HVI A;  1VSH A;  3VQ8 A;  3LP3 A;  1IH7 A;  4Z4H A;  4JRP A;  3TR8 A;  1Z26 A;  1C1A A;  4ID5 A;  1JLQ A;  4OKE A;  4CF9 A;  1WAF A;  1S1T A;  3SQ2 A;  4E7L A;  3HYF A;  3KKS A;  3MXM A;  3MEG A;  4R5P A;  1XWL A;  1LWC A;  4FZZ A;  4CJQ A;  4B9M A;  3MEC A;  1GOC A;  1Q9Y A;  2B4J A;  1JL1 A;  1ZBI A;  4FW2 A;  5HRN A;  2JLE A;  3QIP A;  4M41 A;  3ZSR A;  1WN7 A;  4DLG A;  1SUQ A;  3V9Z A;  1TK0 A;  1DLO A;  4C8M A;  1VK0 A;  4CEA A;  1U48 A;  1C1B A;  3KKR A;  2G8H A;  4Z0U A;  4N76 A;  5CYQ A;  5C25 A;  1IKW A;  1Q9X A;  3OS0 A;  4DTU A;  3WNG A;  3CG7 A;  3I0R A;  4CFC A;  1HRH A;  5D3G A;  1NK8 A;  1RT3 A;  4DF8 A;  3ALY A;  1EKE A;  1U4B A;  3AVB A;  4LH5 A;  4KO0 A;  5KRT A;  3D0P A;  1NJY A;  4E7I A;  3V9W A;  4LSL A;  1VSE A;  2OPR A;  3RMA A;  1VSL A;  1RDB A;  2KTQ A;  3AO4 A;  5FRO A;  2BGG A;  3AVL A;  4PA1 A;  4BE1 A;  1C0U A;  3OYF A;  1W0H A;  2IS3 A;  3TAE A;  3OYM A;  5SZT A;  4DTM A;  3SI6 A;  3WNE A;  3ZT2 A;  3DRP A;  2BE2 A;  5CYM A;  3VQ6 A;  3KLE A;  4DFM A;  3DLK A;  2VG7 A;  3SYZ A;  3QEX A;  4BWM A;  4FJL A;  1C0M A;  1NK7 A;  3CYM A;  4OPJ A;  3PO5 A;  3HP6 A;  3EYZ A;  4CJF A;  3LAK A;  4CGF A;  3DRR A;  4HTU A;  4FJ5 A;  2FC0 A;  3I8D A;  1JKH A;  4FLT A;  2PYL A;  4B9S A;  3V81 A;  2X74 A;  3M8R A;  4KB1 A;  3KTQ A;  1HYS A;  1QSL A;  5CY4 A;  3ZSY A;  1X9W A;  3LP0 A;  3ULD A;  3V9U A;  3V9S A;  4EZ9 A;  2OZM A;  3NF8 A;  2X6S A;  2W42 A;  4Y1D A;  1FKO A;  1RTI A;  3DLE A;  3OYL A;  4FM0 A;  3VA3 A;  3TAM A;  1RT6 A;  3MED A;  1FK9 A;  2ETJ A;  3QET A;  4B9V A;  1BI4 A;  1QSS A;  2YNF A;  4FJK A;  4KI4 A;  2QKB A;  4M3R A;  1N6Q A;  2Z1G A;  5FDL A;  3SUP A;  3L2R A;  2YNH A;  4E7J A;  4M3W A;  3CFR A;  4BDP A;  4W5O A;  1T03 A;  1ASW A;  1UAX A;  1NK4 A;  4FK4 A;  3WNH A;  3SUO A;  1GOA A;  4H4O A;  2PZS A;  3KJV A;  3UIQ A;  5KGW A;  1HMV A;  3OYE A;  3KD5 E;  1SL0 A;  1S1W A;  2GV9 A;  4FLU A;  4OGC A;  1UOC A;  4IDK A;  4AHS A;  4DQR A;  4FJ7 A;  3AVJ A;  3V1O A;  2X78 A;  3OYC A;  3PX0 A;  4HHT A;  4CED A;  3PX6 A;  4DTR A;  3QEV A;  4PWD A;  4Z4C A;  3OS1 A;  2KZZ A;  2B6A A;  1TL1 A;  3A2F A;  2XHB A;  3QES A;  4DWI A;  1WSH A;  1TGO A;  1L3V A;  4O0J A;  4Q5V A;  3ZSO A;  3P5J A;  4CGH A;  3T1A A;  3ASM A;  4Z4G A;  4FJM A;  1EX4 A;  4CF8 A;  1VRU A;  4BE0 A;  4CEE A;  4ELT A;  2P1J A;  4CGG A;  1NK5 A;  4CJ4 A;  4FW1 A;  3NH0 A;  1BGX T;  4CE9 A;  3VQE A;  1U47 A;  1RT1 A;  2IC3 A;  1D9D A;  4B9U A;  3LDS A;  4W5Q A;  1N5Y A;  3DOK A;  3ITH A;  5DK5 A;  3P83 D;  4PUO A;  2FBV A;  3NE6 A;  5DMR A;  1JLF A;  3JYT A;  3VQP A;  3V1R A;  3LP1 A;  2DY4 A;  2ATQ A;  3LAN A;  1JLB A;  4O55 A;  3OJS A;  3AA3 A;  3K57 A;  3NAE A;  4QCL A;  4DFJ A;  4DSJ A;  3TAF A;  1C6V A;  1K6Y A;  4DU4 A;  3IRX A;  4YFU A;  4F2S A;  4KHY A;  3NFA A;  4CJ3 A;  3L2W A;  2EHG A;  4GMJ B;  3LWM A;  1NKC A;  3BDP A;  4CJS A;  2Y1J A;  2OYQ A;  4M45 A;  1T8E A;  4E0D A;  1IO2 A;  3AO2 A;  1WLJ A;  4YNQ A;  4DSF A;  3V9X A;  1HNI A;  4CCH A;  4IKF A;  3OYG A;  3NGI A;  4FZY A;  4HCC A;  4DU1 A;  3TAB A;  1I3A A;  4CJT A;  3HPG A;  4B08 A;  4AHC A;  5KTQ A;  1ZBL A;  2DTU A;  1DTQ A;  4AHV A;  1QSY A;  3HL8 A;  4CGJ A;  1RIL A;  4K8X A;  4DTS A;  2JGU A;  1JXE A;  3VQA A;  1KVA A;  1TV6 A;  5C42 A;  3K5M A;  4DTP A;  3ZCM A;  2KFZ A;  2O4G A;  1O1W A;  4CHP A;  2F8S A;  1IKV A;  4OPK A;  3AVG A;  5I3U A;  4OLB A;  2O4I A;  1U04 A;  4I9Q A;  1BCM A;  4E1M A;  4F3O A;  4EP4 A;  3O4N A;  3QIN A;  2RF2 A;  3O4Q A;  3SNN A;  1IKY A;  2IGI A;  3LPU A;  4KB0 A;  3LP2 A;  2PY5 A;  3S9H A;  1HJR A;  4FVM A;  3OYH A;  4PQU A;  4B3O A;  4LH4 A;  3ZSV A;  3O3G A;  1EXQ A;  4Z4E A;  4E7K A;  5J2Q A;  3SZ2 A;  1QHT A;  4QOZ B;  1DTT A;  2Z1J A;  4CJP A;  1J5O A;  1NOY A;  2D0C A;  2DFH A;  3AO5 A;  2IDO A;  3QEW A;  3THV A;  3OVN A;  3SPY A;  4FLY A; 
#chains in the Genus database with same CATH topology
 4H4M A;  3VGM A;  4BRE A;  3FFK B;  4BR0 A;  1NNE A;  2XY7 A;  4BRP A;  3K59 A;  4MFB A;  1RBU A;  5AQZ A;  2KW4 A;  3VF6 A;  4FJ8 A;  1Y97 A;  4EZ6 A;  3OY9 A;  2VQF K;  2YCH A;  3TTF A;  4M42 A;  3FGU A;  3KHY A;  4H5R A;  3RTV A;  1ILY A;  4LF8 K;  1B9F A;  5LJW A;  5HLF A;  1KVB A;  3K5N A;  1W97 L;  1YT3 A;  2JWL A;  2PYJ A;  5SWM A;  3AA5 X;  1SS6 A;  2YX6 A;  2LSN A;  4DQS A;  4PKG A;  3T19 A;  2QA4 N;  5HBM A;  2HMP A;  3MEE A;  5BPM A;  2YKM A;  4YDU A;  1OVQ A;  4JRQ A;  4KRF A;  3VQQ A;  3FFI A;  2E8A A;  1IG9 A;  4CFD A;  3HP9 A;  4JD2 A;  3H45 C;  1N8R O;  3BEX A;  2CGK A;  4EAH D;  1ATS A;  2OTL N;  3QEI A;  3SUQ A;  2G8K A;  5KGX A;  5AQM A;  2D0A A;  2OTJ N;  5TKY A;  4OKK A;  2WC9 A;  4DR7 K;  4N47 A;  3OYN A;  5AQV A;  4N56 A;  4F8R A;  4F2R A;  4GVM A;  5JVG L;  4DQP A;  4FM2 A;  3K9K A;  4BY9 C;  4C8N A;  4CIF A;  4XIU A;  2OPP A;  4CES A;  3DLB A;  4H0X B;  1VQL N;  3MXI A;  2QXF A;  2RE2 A;  4YOT A;  3C6U A;  3AAR A;  3CJ9 A;  1T6C A;  3KWI A;  1L5U A;  4M3Z A;  3C0B A;  3AVH A;  2HVH A;  3MN6 A;  1TK8 A;  1LV5 A;  2VWK A;  3QBW A;  1U49 A;  1BG3 A;  1XI1 A;  4GY2 B;  4LF4 K;  4BR7 A;  2GEM A;  4AH9 A;  4H0T B;  1E4F T;  4FWQ A;  4A5B A;  4BRQ A;  4FWP A;  1VSM A;  4A5A A;  3KIO A;  5MLC Q;  3U9D A;  2O8F A;  2Q97 A;  3QEP A;  3L0Q A;  5GIP A;  3VEY A;  1C0G A;  5CE3 A;  4WF9 L;  1KQS M;  2HHT A;  2ZGZ A;  1WNS A;  1U2V B;  1TAQ A;  2HF4 A;  3D2F B;  1K8A O;  3UE5 A;  4LSN A;  2UXC K;  3ZLJ A;  2PAV A;  4BWJ A;  3VQ4 A;  3GBT A;  4CJE A;  2F8T A;  4KTQ A;  3JSM A;  3PO4 A;  1TAU A;  3C95 A;  2QWM A;  2O8C A;  4RWT A;  5AZJ A;  5BPL A;  4B1W B;  3CI5 A;  3TTD A;  3LWL A;  3NDK A;  4IOC L;  4RW4 A;  5AFU A;  3RMC A;  3CIP A;  4W5T A;  3LAL A;  3NF7 A;  1EET A;  2HNY A;  4DV3 K;  4DV7 K;  2FBT A;  1Q18 A;  1Z25 A;  2KZM A;  4KH6 A;  1TYQ A;  1S1V A;  4IDH A;  4DUZ K;  4WQ4 A;  4CK3 A;  1DGK N;  4IFY A;  3DLR A;  1FXX A;  4JKE A;  4FJH A;  2G8I A;  4EIA A;  3ZT0 A;  3O9Q A;  2I7N A;  3QIO A;  1WSJ A;  3DJC A;  1D5A A;  3DWL A;  4CEO A;  3ZSX A;  4CF2 A;  3NF6 A;  2P9I A;  5LMU K;  1LW0 A;  1QE1 A;  1JLC A;  1F21 A;  4I7F A;  3C7N A;  4O5B A;  4CZM A;  3CJB A;  4KI6 A;  1DEJ A;  4DTN A;  3I55 N;  3VQC A;  5GAG P;  4FJG A;  3R6M A;  2E4L A;  3QML A;  4AM6 A;  3MN9 A;  4C8O A;  4FPB A;  4IFE A;  3KD1 E;  4FWO A;  1S9E A;  3LPT A;  2QWQ A;  4E89 A;  5GAH P;  3R9P A;  1QZ6 A;  4JI0 K;  2E6L A;  4JK9 A;  4DSK A;  1HYV A;  3HVT A;  3VQD A;  4CGI A;  1A5V A;  2J4R A;  4IJA A;  3E9O A;  4ZTJ A;  4OX9 K;  3CCQ N;  2D0B A;  2XY6 A;  4F4K A;  3MX5 A;  3D2E B;  3NHG A;  3CJ1 A;  3NVM A;  2GX9 A;  3MX2 A;  1EWQ A;  1NLV A;  3V4I A;  5BRH A;  1LAV A;  3B6P A;  4BRH A;  3VA0 A;  3FZF A;  1RTJ A;  2HST A;  3TAN A;  4WFN L;  3EZW A;  4BDY A;  3QFU A;  5EX5 A;  3CCL N;  2P9P A;  4W5N A;  3VF4 A;  4JKG B;  4FWL A;  4OKJ A;  3UKU B;  3ZT1 A;  4JI7 K;  5EU7 A;  5HRR A;  4CEF A;  3P31 A;  3RMB A;  2YNG A;  4B3R K;  4ISG A;  4IBN A;  3T1Y K;  3VN5 A;  3V1Q A;  1VSH A;  1IH7 A;  2P9U A;  1Z26 A;  4FL9 A;  4FOE A;  4ID5 A;  1ZBS A;  3NVK A;  3KKS A;  1Y64 A;  3CQY A;  3MEG A;  1LWC A;  3BY5 A;  3NMU A;  1Q7Y O;  5HRN A;  5GAE P;  3KKR A;  2G8H A;  4N76 A;  1IKW A;  3THX B;  1P8Z A;  4DV5 K;  4B1X B;  3CJ7 A;  5M1F A;  1NK8 A;  4DF8 A;  1U4B A;  1NJY A;  4IZ9 A;  3D0P A;  1JCE A;  4FWS A;  2VYP A;  1G99 A;  1W0H A;  2IS3 A;  3OYM A;  4JHD B;  5SZT A;  3SI6 A;  3SMP A;  3QEX A;  1WUA A;  2VG7 A;  3SYZ A;  5LMN K;  3VOV A;  4CGF A;  2FC0 A;  4ISE A;  3M8R A;  4M7X A;  2RHK A;  3PSI A;  5AQJ A;  3NF8 A;  2W42 A;  4EZ9 A;  4DUY K;  1W7A A;  3ENO A;  3E9L A;  1QSS A;  5AQR A;  4KI4 A;  1ZXO A;  5LJV A;  1HKC A;  4E7J A;  3CFR A;  5EY4 A;  4W5O A;  1CZA N;  3OHR A;  1T03 A;  4PL8 A;  1GOA A;  3F9M A;  4X66 K;  3UIQ A;  1XQS C;  4RTF D;  3CCR N;  3T7Z A;  4H0P A;  4OGC A;  4AHS A;  3AVJ A;  3OYC A;  4HHT A;  2Q31 A;  3CQX A;  4BC4 A;  4Z4C A;  4J8F A;  3U9Z A;  2B6A A;  4DWI A;  4DV0 K;  1TGO A;  1X3M A;  4O0J A;  3ZSO A;  3P5J A;  3ASM A;  4FJM A;  5AQF A;  1VRU A;  4BE0 A;  5EVZ A;  1VQ7 N;  2FSJ A;  1NK5 A;  3VET A;  3NH0 A;  1U47 A;  4OPH A;  4I6M B;  1S3X A;  4JI6 K;  5KPZ A;  1N5Y A;  3DOK A;  4YOV A;  3JYT A;  2VGM A;  1YHQ N;  3LAN A;  3NAE A;  1VQM N;  3AA3 A;  3CJA A;  1IJJ A;  4YFU A;  2NRW A;  3NFA A;  1HX1 A;  3LWM A;  1K73 O;  4E0D A;  2Y1J A;  3J7Z O;  3HOT A;  4YNQ A;  1WLJ A;  3V9X A;  4JK7 A;  4DV4 K;  4HCC A;  4AQY K;  1IBK K;  3VMF B;  2D0P A;  1P90 A;  2DTU A;  1YJ9 N;  4AHV A;  4CGJ A;  1YJW N;  3VEO A;  1JXE A;  5C42 A;  2D0O A;  4BRL A;  1O1W A;  1EWR A;  1SQK A;  4OPK A;  4BGA A;  3MK6 A;  5I3U A;  3O4N A;  3O4Q A;  3LPU A;  3ZX2 A;  4KB0 A;  3LP2 A;  3TTC A;  4FVM A;  5E26 A;  4JV5 K;  4BRM A;  4E7K A;  5J2Q A;  3SAH A;  3SZ2 A;  4CJP A;  4WCE L;  3D7E O;  1EQY A;  2DFH A;  4DR1 K;  4B3M K;  3OVN A;  3SPY A;  3CJC A;  4KHP K;  3D45 A;  3EN9 A;  5J2M A;  3R3L A;  1WBD A;  3L4Q A;  2HB5 A;  3NH1 A;  4HCB A;  2QKK A;  1VRT A;  2QXL A;  2QI2 A;  3FE1 A;  4A62 A;  1XMQ K;  2OZS A;  5F2R A;  1T7P A;  4O5F A;  1TK5 A;  4JKD A;  5AQW A;  1YXQ A;  4FO0 A;  3OTO K;  4GV9 A;  5BR8 K;  1UA0 A;  1J6Z A;  4K0K K;  1IV0 A;  4BRN A;  4M3X A;  3V6D A;  3RRH A;  3M8Q A;  4DB3 A;  2G8F A;  2YHA A;  1BQM A;  2D5R A;  3DXM B;  3IKM A;  3PIP L;  1A5X A;  5KI6 A;  3U3Y A;  3T3F A;  5KRS A;  3PLA A;  2RPI A;  4CJ5 A;  4ELU A;  3SJJ A;  3F9K A;  1VQ5 N;  1YTA A;  3CC2 N;  3ZET A;  4KPY A;  2EWS A;  1XNQ K;  1JLG A;  4AF1 A;  1RBV A;  3P1G A;  4DCH A;  3M3Z A;  1BO5 O;  2OAN A;  3AVF A;  4ZHR A;  1WSG A;  3QBX A;  3OYA A;  4FLX A;  1X9M A;  2QM1 A;  3BUZ B;  1U2V A;  1R0A A;  1KAZ A;  1GLL O;  4C23 A;  2F9T A;  1VQ9 N;  2O8E A;  1QVF M;  3O1B A;  3MCA B;  3E01 A;  4AHU A;  4CGD A;  5J2N A;  4K42 A;  3B6O A;  4X62 K;  1Q82 O;  4CJW A;  2E5L K;  3HSC A;  1SZ2 A;  4CIE A;  1S9G A;  1HNX K;  3HRG A;  4Y0W A;  3CPW M;  3VGK A;  2P9L B;  1Z6R A;  3A5M C;  4NCG A;  1NWK A;  1VSI A;  4UY8 O;  2Q3S A;  3A0I X;  3KLF A;  2IVN A;  1BCO A;  4K25 A;  2UUC K;  1X3N A;  4CVN E;  1Q86 O;  4A57 A;  3IFR A;  5C10 A;  4BG8 A;  1ZYQ A;  3VQB A;  1RDA A;  3SLC A;  4DSL A;  3ENB A;  2UXD K;  3SUN A;  2E6M A;  3M8S A;  1HQU A;  1NGC A;  1SKW A;  4B8C A;  3WT0 A;  4CJV A;  4M3T A;  1MDU B;  1LAW A;  4M63 C;  4EHT A;  4KFB A;  3CCE N;  3DRS A;  2HBL A;  3DAW A;  5AZI A;  3U6F A;  3CFO A;  3HVR A;  3THY A;  4JKC A;  2P5G A;  3HM8 A;  2NZT A;  3QO9 A;  2ZM6 K;  3SBG A;  1ZBF A;  1RT7 A;  4JI5 K;  1ITG A;  4BDZ A;  4JKF A;  1BIZ A;  1OKJ A;  3C65 A;  5I42 A;  1XC3 A;  4N41 A;  1L3T A;  4O0I A;  4FCY A;  1C0T A;  4L8R B;  2YHX A;  1ASU A;  4OGE A;  4C1N I;  2NRT A;  1T05 A;  2P51 A;  2E88 A;  1RNH A;  4FOI A;  2I5J A;  4B9N A;  4QS9 A;  1RBR A;  4WYB A;  3Q7C A;  4DF4 A;  4MLE A;  5E41 A;  3RR8 A;  4CJU A;  2W6L A;  2D1K A;  2WBN A;  4Z4I A;  4Z4F A;  3OYK A;  1NMN A;  2AA4 A;  4JK8 A;  1RT4 A;  4JI3 K;  2GUI A;  4AHT A;  2OPQ A;  1TL3 A;  4LF9 K;  5IT9 O;  2Y1I A;  2BDP A;  1VQ6 N;  1UWB A;  1X1P A;  4H5W A;  4BC5 A;  1EP4 A;  1BOT O;  2QK9 A;  2E20 A;  4CHN A;  2GEL A;  1LWE A;  3DYA A;  3H08 A;  1XHX A;  1S6P A;  1ZBU A;  1VQ4 N;  3KLH A;  3TI0 A;  1YIJ N;  3VEW A;  4FJX A;  3SQ0 A;  4KHU A;  1KXP A;  5JIC A;  2B5J A;  4RG8 A;  4HUF A;  3O1W A;  5ADX H;  2KQ2 A;  3L2U A;  4B9L A;  1TUY A;  3O5B A;  2XY5 A;  2NLX A;  4JKG A;  1L3S A;  1A5W A;  3AGR A;  5AQL A;  3ZSZ A;  3RMD A;  4WFB L;  3U3G A;  3AVN A;  4CF1 A;  4GNI A;  3N4P A;  3VF2 A;  1RFQ A;  4C8K A;  3KLI A;  1GLJ O;  2HF3 A;  4FZX C;  2A41 A;  1IBM K;  4BRK A;  2IAJ A;  5GIO A;  5DM6 L;  2NNW A;  4YOX A;  4J2D A;  4FK0 A;  4E1N A;  2FBY A;  4UQG A;  4O44 A;  4KTZ A;  3K5O A;  4QS7 A;  3HK2 A;  1B9D A;  3PV8 A;  1T3V A;  3L8B A;  4YOR A;  1NJI O;  1HNV A;  1DKG D;  1S5J A;  4DV6 K;  5JS2 A;  1ATR A;  3DMJ A;  3THX A;  1K8K B;  2VG5 A;  2O8B B;  1X9S A;  1SKS A;  3LZI A;  2NUB A;  4KHQ A;  3G71 N;  4GVE A;  2A6A A;  2IOC A;  3VEV A;  3RR7 A;  4JHD A;  1SL2 A;  2OA8 A;  2Z1I A;  3AAQ A;  1XC9 A;  4DR4 K;  4FXD A;  4IJN A;  4G9Z A;  3LZJ A;  5C15 A;  3JS6 A;  5HP1 A;  2RN2 A;  3HM9 A;  3AY9 A;  4MDB A;  4BQZ A;  2A1R A;  3QIC A;  4J2A A;  2HVI A;  4BGB A;  2VCP A;  4BRO A;  3A8Y A;  4A59 A;  1MA9 B;  4CF9 A;  3CCJ N;  3MXM A;  2P9S A;  4WQ5 C;  3R8E A;  3MEC A;  3O80 A;  3DXK A;  1JL1 A;  1ZBI A;  4DR6 K;  2A42 A;  4FW2 A;  4KHY A;  3ZSR A;  1WN7 A;  4DLG A;  1SUQ A;  4LC9 B;  2KHO A;  5FPM A;  1TK0 A;  1W2B M;  4CEA A;  1U48 A;  1C1B A;  3CCM N;  5GAD P;  1IBL K;  2P9N B;  3F5T A;  3FZH A;  3I0R A;  4CFC A;  5D3G A;  3UKR A;  1JJ2 M;  1RT3 A;  1EKE A;  1OH7 A;  3CC4 N;  5KRT A;  4KO0 A;  2W6K A;  5AQU A;  4E7I A;  1VQN N;  1VSE A;  3HI0 A;  2KTQ A;  1RDB A;  4JAX A;  2BGG A;  4PA1 A;  5AQY A;  4BE1 A;  3OYF A;  4DTM A;  4IWV A;  5BN9 A;  3DRP A;  3VQ6 A;  4FJL A;  1FJG K;  2ZJP L;  3PO5 A;  4OPJ A;  3HP6 A;  3I8D A;  1JKH A;  1HYS A;  4I6M A;  4B9S A;  2V7Z A;  3V81 A;  2UUB K;  4YOW A;  1X9W A;  2UYT A;  1NM1 A;  3ULD A;  3V9S A;  2X6S A;  2O8D A;  4Y1D A;  2I7P A;  1RTI A;  3R1X A;  3OYL A;  1J5E K;  1RT6 A;  3MED A;  3E66 A;  1BI4 A;  4FJK A;  2YNF A;  2QKB A;  1DT9 A;  4M3R A;  5FDL A;  3L2R A;  4M3W A;  2IVP A;  4BDP A;  1UAX A;  1NK4 A;  3KJV A;  1NU0 A;  3BF1 A;  3IMX A;  1SL0 A;  3VES A;  3P4I A;  4FLU A;  4YOU A;  4IDK A;  4FJ7 A;  2X78 A;  3J8A A;  4CZG A;  4JKH A;  3QEV A;  2ITM A;  3N4Q A;  1BDG A;  1BA1 A;  1WOQ A;  1WSH A;  2E1Z A;  5AFU H;  4CF8 A;  3I33 A;  4ELT A;  5JLF A;  4CGG A;  3SBT A;  3LM2 A;  3CC7 N;  1BUP A;  4FW1 A;  4CE9 A;  5AR0 A;  5IWA K;  2VQE K;  4CI6 A;  4W5Q A;  1KD1 O;  5DK5 A;  3CET A;  5FLX O;  5H1S Q;  3NE6 A;  3QFP A;  3BP8 A;  3V1R A;  2ATQ A;  3L4I A;  1JLB A;  4O55 A;  1HPM A;  3OA9 A;  4DSJ A;  1K6Y A;  4F2S A;  3KZB A;  2UU9 K;  3O9U A;  3L2W A;  2EHG A;  4BRI A;  3BDP A;  2OYQ A;  4M45 A;  1T8E A;  3I56 N;  3CCV N;  4BVP A;  3NGI A;  3J7Y P;  3CMA N;  3B8A X;  3HPG A;  4B08 A;  4AHC A;  1DTQ A;  2FSN A;  2OCE A;  5BR9 A;  5C2F A;  1TV6 A;  4FSV A;  2E1Y A;  4MLH A;  1IKV A;  3DXM A;  1RDW X;  3ULE B;  2O4I A;  1U04 A;  1BCM A;  5F0X A;  1NG9 A;  3SNN A;  2CGL A;  3S9H A;  3RSE B;  4PQU A;  4XH1 A;  4LH4 A;  4JEP A;  1QHT A;  4K41 A;  2D0C A;  1NOY A;  2ASM A;  3WXJ A;  2A40 A;  4PKH A;  2IDO A;  3QEW A;  1XHZ A;  1VHX A;  2ZD1 A;  3ZSQ A;  3K5L A;  1LCU A;  3MN7 A;  3F73 A;  3WEE B;  4YDU C;  3GOI A;  2DPN A;  1KLM A;  1RCH A;  2BH1 A;  4Z94 A;  3ZSW A;  3QNN A;  1YTU A;  2KFN A;  1HPZ A;  1RT5 A;  1TVR A;  2CH5 A;  3CFP A;  1ASV A;  1KAY A;  3AA2 A;  2HBJ A;  3K2P A;  2WOM A;  1YIT N;  2JWK A;  3MAQ A;  1OH8 A;  4B9Q A;  2YI1 A;  3EE9 A;  3OBW A;  1KCF A;  1JLA A;  1K9M O;  4B9T A;  3VQ9 A;  5JLH A;  3VGL A;  1YAG A;  4FPA A;  4NYF A;  4BE2 A;  1OH6 A;  5DM7 L;  1I39 A;  4AIL C;  1QTM A;  4CK1 A;  1Q81 O;  1KSP A;  3WQT A;  5CR4 A;  1SV5 A;  3HPH A;  1VQK N;  1JCG A;  4OVL A;  1TKZ A;  4DHY A;  1SL1 A;  4ILH A;  2VWJ A;  1KRP A;  1CXU A;  4A61 A;  2HBK A;  4J2B A;  3DI6 A;  3TSQ A;  3OBY A;  3SMS A;  3SCX A;  2O8C B;  3WXM B;  4ICL A;  3AVK A;  3CQ8 A;  4BR2 A;  3OYB A;  2YJE A;  1WSI A;  2FF6 A;  2CH6 A;  3PX4 A;  3FZM A;  4CZE A;  5JS1 A;  5T7B A;  3G6E N;  5AQS A;  2EX3 A;  4U7B A;  4JNE A;  1UA1 A;  4BR5 A;  3MWP A;  5KQD A;  3ZT3 A;  2HHV A;  4WFA L;  2HHH K;  1V4S A;  1TYQ B;  3W3D A;  2HBM A;  3VQ5 A;  3ENH A;  4E3S A;  5HL7 L;  3VEZ A;  2HNZ A;  4DS4 A;  2XRI A;  3AVC A;  4KHW A;  2ZE2 A;  1C1C A;  5HRP A;  2OPS A;  4CD3 A;  4HVJ A;  3EKU A;  5K14 A;  2V7Y A;  2R7Y A;  4ILJ A;  4H0V B;  3D6R A;  4Q0B A;  4PKI A;  3SV4 A;  4CFA A;  3ZX3 A;  1QS4 A;  4H8K A;  4IFV A;  1D8Y A;  4FK2 A;  4CER A;  3K58 A;  2UXB K;  3S41 A;  2QWN A;  2Q1N A;  4AM7 A;  5JVH L;  1WSF A;  3CM5 A;  4ILG B;  1ZBH A;  3SAG A;  1NBW A;  3LDP A;  2IVO A;  1S72 N;  1KFD A;  4TSX A;  1KTQ A;  1CXQ A;  4DTJ A;  3FR0 A;  1BIU A;  1RT2 A;  4WQ4 C;  1YVN A;  3O9R A;  3ZEU B;  1QQN A;  4JI8 K;  2Q0U A;  3LDQ A;  4H5N A;  4CF0 A;  1KFS A;  3ZT4 A;  1VSK A;  4CD1 A;  3GG4 A;  1FKP A;  1D4X A;  4M3U A;  3K9J A;  5AQG A;  1QQC A;  2HHS A;  3ZYY X;  3TSU A;  1EO1 A;  4KRE A;  4DTX A;  3QLH A;  1VSF A;  3NBP A;  3EZ5 A;  4XH4 A;  2G8W A;  1S22 A;  3HT3 A;  3DLH A;  4FJJ A;  2YHB A;  3LDO A;  2GUP A;  3HBT A;  4KHS A;  1HQE A;  4RCH A;  3MMV A;  4CHZ A;  4NLB A;  4KHN A;  3K0S A;  5FPE A;  2P9P B;  4E1J A;  4I2P A;  5ELZ A;  4XH5 A;  5J1E A;  4CEB A;  1HNZ K;  3G0Z A;  1O13 A;  4GV3 A;  1HYZ A;  4J2E A;  2ITG A;  3HJF A;  4B1U B;  4FLV A;  2BAN A;  2HHX A;  3AVM A;  3HST B;  4NCA A;  1RDC A;  3I0S A;  3AVI A;  1T44 A;  2FSK A;  2XO7 A;  3S3O A;  3ATU A;  3AVA A;  3L2Q A;  3THW B;  2FLO A;  3MWT A;  3S3M A;  3LAM A;  3D2F A;  1Q8I A;  4OPA A;  1KLN A;  1WAJ A;  4B8A B;  3M8P A;  3J81 O;  1J53 A;  4A2B A;  4NYN A;  3VQ7 A;  3EY1 A;  4FWR A;  1TKX A;  4CHO A;  4FYD A;  1VSD A;  2GWK A;  1NGE A;  3L3U A;  3GE1 A;  4FLZ A;  4BRC A;  5BPN A;  1TKT A;  3IG1 A;  1NGJ A;  3BZC A;  1J9A A;  1W9H A;  2PFU A;  2D4W A;  4CZI A;  4EP5 A;  4OJR A;  3OYD A;  3L3V A;  2YV0 X;  4NB4 A;  5HOO A;  2W40 A;  4DFK A;  2QW9 A;  3KLG A;  4DLE A;  4GW6 A;  1HKG A;  4H0Y B;  3O3F A;  4DSI A;  3NCI A;  2HMI A;  3WXI A;  4IOX A;  3VEN A;  2P9N A;  1BQN A;  3DLG A;  1HKB A;  3F2K A;  3AA4 A;  2UUA K;  3AV9 A;  1VAZ A;  3M1F A;  3AAP A;  1RDU A;  4ZTF A;  2P9K B;  1JL2 A;  3KK3 A;  4ID1 A;  3OS2 A;  4KKO A;  4CK2 A;  3LDL A;  2VWB A;  4AHR A;  4MQ3 A;  1NGD A;  1NGG A;  3MDQ A;  3HPO A;  4BC3 A;  2YJF A;  4KV8 A;  4EHU A;  2RKI A;  1KVC A;  2NRX A;  5BRE A;  3VQ8 A;  3LP3 A;  4JRP A;  4A2A A;  2A3Z A;  1JLQ A;  5ADX A;  4NXN K;  1WAF A;  1S1T A;  2ZF5 O;  3SQ2 A;  3HYF A;  2E2P A;  3CCU N;  4R5P A;  1U6Z A;  4BVO A;  4FZZ A;  1GOC A;  2ZJQ L;  2GWJ A;  2JLE A;  4M41 A;  3V9Z A;  4C8M A;  5AQO A;  1VK0 A;  3RVC A;  4IEE A;  3G25 A;  4Z0U A;  5CYQ A;  5C25 A;  4DTU A;  4DKW A;  3CG7 A;  1HRH A;  3OW2 M;  2QWL A;  3AVB A;  3M5R A;  4LH5 A;  1HNW K;  3RMA A;  4CBU A;  1VSL A;  5JMV A;  3AVL A;  3D2E A;  1C0U A;  3TAE A;  5I9E B;  1ESV A;  3WNE A;  3ZT2 A;  2BE2 A;  4NXM K;  4DFM A;  4BR9 A;  2AP1 A;  4BWM A;  1HR0 K;  1C0M A;  1NK7 A;  4CJF A;  3DRR A;  4HTU A;  4FJ5 A;  4KB1 A;  1WB9 A;  5CY4 A;  4DQ8 A;  3VTI A;  4MO5 A;  3CER A;  3V9U A;  2VGN A;  4B3S K;  2OZM A;  3T1H K;  1FKO A;  3DLE A;  4FM0 A;  3VA3 A;  1C0F A;  2V51 B;  2ETJ A;  3H1V X;  3QET A;  4B9V A;  3SAF A;  1VQO N;  5FPN A;  3SUP A;  3GDQ A;  2NRH A;  2YNH A;  1ASW A;  3UKU A;  3PSF A;  3SUO A;  4H4O A;  2PZS A;  3CME N;  1UOC A;  2ZGY A;  4LFC K;  3PX6 A;  3CHW A;  2KZZ A;  1TL1 A;  3A2F A;  2XHB A;  4BR4 A;  3ULE A;  3CPE A;  3T1A A;  4ISF A;  5M1Q A;  1EX4 A;  3RSE A;  4H5T A;  5KPR A;  4X64 K;  1VQ8 N;  4CJ4 A;  1BGX T;  1MWM A;  3VQE A;  4PL7 A;  1KC8 O;  1RT1 A;  4B9U A;  3LDS A;  4L3Q A;  3FZK A;  3ITH A;  2FBV A;  4DR2 K;  5DMR A;  4QS8 A;  3O08 A;  3WEE A;  3OJS A;  4QCL A;  4MO4 A;  1NMD A;  4DFJ A;  4GKJ K;  3IRX A;  4GMJ B;  1N33 K;  3ZET B;  1IO2 A;  4DSF A;  1BA0 A;  1HNI A;  4IKF A;  2PBD A;  1YJN N;  4FZY A;  4DU1 A;  4MDA A;  3TAB A;  4CJT A;  3AGK A;  5KTQ A;  2V52 B;  1ZBL A;  1QSY A;  4YY3 K;  1RIL A;  4K8X A;  5E84 A;  4DR5 K;  5A2Q O;  2JGU A;  3VQA A;  5AQI A;  3K5M A;  3ZCM A;  2O4G A;  2F8S A;  3AVG A;  4F9O A;  4OLB A;  3QB0 A;  4I9Q A;  4EP4 A;  3QIN A;  2O8E B;  4R79 A;  1R59 O;  5AQP A;  1HJR A;  3OYH A;  1TUU A;  2NRR A;  4B3O A;  3ZSV A;  2QTD A;  3O3G A;  3I8B A;  1J5O A;  3HZ6 A;  5C2D A;  3THV A;  3OS1 A;  4FLY A;  2WON A;  3U8X A;  5C24 A;  5KPT A;  3QER A;  3CD6 N;  4JKB A;  1NGB A;  1RTD A;  4Y1C A;  3O6W A;  1BL3 A;  1LW2 A;  1FW6 A;  4PHT X;  3WNF A;  3IS9 A;  1YUW A;  4FLW A;  1BHL A;  4DTO A;  1MWK A;  4E19 A;  3EKS A;  1RBT A;  1E4G T;  2YHW A;  3TPQ A;  1Z05 A;  5F1X A;  4DS5 A;  3FLC O;  3AO3 A;  4B3T K;  1RGI A;  1S1X A;  4NCB A;  2HHW A;  1WBB A;  5B8H A;  4KAZ A;  4DSE A;  1IG8 A;  3MXJ A;  5AZI B;  2P5O A;  2Q36 A;  4GV6 A;  3THY B;  4ELV A;  4IOA L;  1X9J A;  1MU2 A;  1YVU A;  5LY3 A;  1I94 K;  3H3N O;  4CZJ A;  4DV1 K;  4CEZ A;  3VPZ A;  3KWG A;  3C6H A;  3H6E A;  1RDD A;  5HRS A;  1IKX A;  3BGR A;  4IG0 A;  4W5R A;  2F9W A;  3H3O B;  4CIG A;  4JS4 A;  4B1Z A;  3VER A;  5FRN A;  4FM1 A;  2W41 A;  5GIN A;  2WTU A;  4LF5 K;  3KK2 A;  4DU3 A;  3ZEU A;  4BC2 A;  3Q7B A;  4JI1 K;  3C6A A;  4C1N K;  5LL6 Z;  3TSP A;  3OYI A;  1WSE A;  3RWU A;  5AQQ A;  4I9L A;  3DM2 A;  1NJW A;  1S1U A;  3DOL A;  3SV3 A;  3MCP A;  4HUG A;  2WFB A;  4CW7 B;  4N5S A;  2Q0R A;  1S6Q A;  1SAZ A;  4JD2 B;  4C8L A;  3P39 A;  2GTD A;  1JXB A;  2GBZ A;  3RRG A;  3J7A P;  4JYA K;  1YI2 N;  2DFE A;  4H03 B;  3C94 A;  5C12 A;  3TAQ A;  4M3Y A;  2HW3 A;  3LL3 A;  3TAG A;  3AO1 A;  3O8M A;  4E7H A;  4F3T A;  3IDH A;  1J54 A;  5BN8 A;  3TAR A;  1M1K O;  3H46 O;  1V4T A;  1OH5 A;  1RTH A;  3VEX A;  3G10 A;  4RW9 A;  3L2V A;  3WUH A;  1REV A;  4DFP A;  4CJL A;  2NRV A;  1QZ5 A;  3WQU A;  4CZF A;  4O4G A;  2FXU A;  3NH2 A;  3THW A;  4O8K A;  2NRZ A;  3OYJ A;  3TU5 A;  2XY8 A;  1CZB A;  4FJ9 A;  4RW7 A;  2E2Q A;  4B1V A;  4CHY A;  1LWF A;  4LD0 A;  4CEC A;  1QHA A;  1LOT B;  3EE8 A;  4CHQ A;  5AQT A;  3O3H A;  4DQQ A;  5EXW A;  1SKR A;  3T69 A;  1NOZ A;  1NK6 A;  3TAP A;  1TKD A;  4LY7 A;  1GOB A;  1BIS A;  1GLF O;  2QEX N;  2O8F B;  4IO8 A;  1B92 A;  4JKA A;  3PUF A;  1NK9 A;  4JN4 A;  2X6N A;  1NJZ A;  3ATV A;  1QQM A;  2E2N A;  2E2O A;  1G15 A;  3SPZ A;  3HXM A;  3C6T A;  2P9L A;  4DQI A;  3VTH A;  4EFH A;  4I2Q A;  4DMN A;  4OO1 J;  3NGZ A;  5M1N A;  3J80 O;  3KVG A;  4IEI A;  2QWO A;  4KTW A;  5C0Y A;  3E9P A;  2DFF A;  1OVY A;  5CZ1 A;  5EOY A;  4FJN A;  4KH4 A;  5M1O A;  4BRF A;  5TKW A;  5AZJ B;  4LFA K;  4DR3 K;  3PIO L;  2AJQ A;  2A1S A;  4JI4 K;  1HLU A;  2BTF A;  3SK3 A;  4CZL A;  4U67 L;  3A5N C;  3IAY A;  2P9S B;  1GLA G;  2FBX A;  1QVG M;  4BRA A;  4BAC A;  5FRM A;  1XMO K;  2YKN A;  2P9K A;  3DXK B;  5FPD A;  4YHH K;  2WUS A;  3HOS A;  5AQX A;  3TWH A;  2F96 A;  4RW8 A;  1BU6 O;  3FZL A;  1NGI A;  1GLD G;  2Q2R A;  4YOY A;  1N34 K;  3UKR B;  3UB5 A;  1RBS A;  3MN5 A;  4IG3 A;  2Z1H A;  1E3M A;  4OLA A;  2G8V A;  4BRG A;  2G8U A;  1VQP N;  4HWI A;  1VSJ A;  1NKB A;  2F7T A;  4LF7 K;  4FWK A;  4O8U A;  1GLC G;  4FJI A;  3WXL A;  5AQK A;  4CJK A;  4CJR A;  4DG1 A;  3NF9 A;  1HJO A;  1L3U A;  4K8Z A;  3SQ4 A;  1D9F A;  4JS5 A;  3CM6 A;  2ZJR L;  3O4W A;  2P9I B;  4RW6 A;  5J2P A;  3PY8 A;  3C7N B;  3BF3 A;  3ISN C;  1CZ9 A;  5HRO A;  3SQ1 A;  2O8D B;  3NGY A;  3DLL L;  4NLC A;  2ZQB A;  2ZWH A;  1N32 K;  2HND A;  3KK1 A;  3S3N A;  1BI4 B;  3JXU A;  4CEQ A;  1NKE A;  1U45 A;  3A5L C;  4CFB A;  4H0O A;  4BQL A;  1JLE A;  2YNI A;  4G1Q A;  2QWR A;  1NK0 A;  5KQ8 A;  4NO7 A;  4PY5 A;  4JLH A;  2YHY A;  4QAG A;  2HHQ A;  4HUE A;  1KAX A;  3HTV A;  3HO1 A;  5CZ2 A;  3QNO A;  1NGH A;  3O9T A;  4WE1 A;  5M1K A;  1NJX A;  2KKZ A;  3JAM O;  2VG6 A;  1H1V A;  4CZK A;  3OJU A;  1CLQ A;  2HHU A;  4Z4H A;  3TR8 A;  1C1A A;  4CBW A;  4OKE A;  4E7L A;  1HUX A;  1ZC6 A;  1QQO A;  1XWL A;  1NGA A;  4CJQ A;  4B9M A;  1Q9Y A;  2B4J A;  1ATN A;  4B1Y B;  2QWP A;  3QIP A;  4CJ7 A;  3CXC M;  4JI2 K;  1DLO A;  3A5O C;  3LM9 A;  3E1Y A;  3QDK A;  1Q9X A;  4KBO A;  3OS0 A;  3WNG A;  3ALY A;  3CF5 L;  3EL2 A;  4LSL A;  3V9W A;  2OPR A;  4CZH A;  3AO4 A;  5FRO A;  3H1Q A;  3BZK A;  5BRF A;  3CCS N;  4HTL A;  3KLE A;  4BG9 A;  5CYM A;  3DLK A;  3L6Q A;  4WQ5 A;  3CYM A;  2HOE A;  3LDN A;  3W0L A;  3G4S N;  3EYZ A;  4M7Y A;  3LAK A;  4XEI A;  4FLT A;  2PYL A;  2X74 A;  3KTQ A;  2ASP A;  1QSL A;  3ZX0 A;  3ZSY A;  4FWN A;  1NGF A;  2P9U B;  3LP0 A;  4CBX A;  5CHI A;  2FF3 B;  1K8K A;  5AQN A;  2F4V K;  1BWF O;  3TAM A;  2O8B A;  1FK9 A;  2KLA A;  1M90 O;  3O9S A;  1N6Q A;  2Z1G A;  4KH5 A;  3EEQ A;  3EO3 A;  4LF6 K;  3P38 A;  4FK4 A;  3WNH A;  4IO9 L;  5BRD A;  5KGW A;  1HMV A;  3OYE A;  3KD5 E;  1S1W A;  2GV9 A;  4H5V A;  4IXC A;  4DQR A;  3V1O A;  3PX0 A;  4CED A;  4DTR A;  4V19 S;  4PWD A;  5AQH A;  3QES A;  2CGJ A;  4FWM A;  2BUP A;  1L3V A;  4Q5V A;  1GLB G;  4BRD A;  4CGH A;  4Z4G A;  1GLE G;  2H3G X;  4GKK K;  1N36 K;  4CEE A;  2P1J A;  3WXK A;  1T6D A;  3M6G A;  2IC3 A;  1D9D A;  2A5X A;  3ID8 A;  3P83 D;  4PUO A;  5AJ3 K;  1JLF A;  3VQP A;  3LP1 A;  2DY4 A;  3K57 A;  3TAF A;  1C6V A;  4DU4 A;  4CJ3 A;  1NKC A;  4CJS A;  3AO2 A;  4CCH A;  4X65 K;  3OYG A;  1I3A A;  5M1P A;  1XNR K;  3ID6 A;  1JCF A;  1YF5 L;  3HL8 A;  4DV2 K;  4DTS A;  3U4L A;  1KVA A;  4DTP A;  2KFZ A;  3SJH A;  4CHP A;  3IUC A;  3GL1 A;  4LFB K;  2ASO A;  4E1M A;  4F3O A;  2RF2 A;  1IKY A;  2IGI A;  2PY5 A;  1EXQ A;  4Z4E A;  1XUP O;  4QOZ B;  1DTT A;  2Z1J A;  4FVU A;  2IIR A;  3AO5 A;  3KK7 A;  4K43 A; 
#chains in the Genus database with same CATH homology
 1XHZ A;  2WON A;  2ZD1 A;  3ZSQ A;  3K5L A;  4H4M A;  5C24 A;  3QER A;  3D45 A;  3F73 A;  2XY7 A;  3K59 A;  4MFB A;  1RBU A;  5J2M A;  1RTD A;  4Y1C A;  1BL3 A;  1LW2 A;  2KW4 A;  4FJ8 A;  2HB5 A;  1Y97 A;  1KLM A;  3OY9 A;  4EZ6 A;  1RCH A;  3NH1 A;  3WNF A;  3ZSW A;  3IS9 A;  3QNN A;  4HCB A;  1YTU A;  2KFN A;  1HPZ A;  1RT5 A;  1TVR A;  4FLW A;  2QKK A;  1VRT A;  3CFP A;  1ASV A;  1BHL A;  3AA2 A;  3K2P A;  4DTO A;  2OZS A;  2WOM A;  4M42 A;  4E19 A;  1T7P A;  3MAQ A;  1RBT A;  3RTV A;  1TK5 A;  1B9F A;  4DS5 A;  3AO3 A;  5HLF A;  1KVB A;  1KCF A;  1JLA A;  3K5N A;  1UA0 A;  4B9T A;  3VQ9 A;  1S1X A;  4M3X A;  3V6D A;  3RRH A;  1YT3 A;  3M8Q A;  2PYJ A;  4NCB A;  2HHW A;  4NYF A;  5SWM A;  3AA5 X;  2YHA A;  4BE2 A;  2G8F A;  1BQM A;  2D5R A;  2LSN A;  1I39 A;  4DQS A;  4AIL C;  4CK1 A;  1QTM A;  1A5X A;  3T19 A;  4KAZ A;  4DSE A;  5HBM A;  5KI6 A;  3U3Y A;  1KSP A;  1SV5 A;  3HPH A;  3MEE A;  3MXJ A;  5KRS A;  3T3F A;  2RPI A;  2YKM A;  2P5O A;  4CJ5 A;  4ELU A;  3SJJ A;  4ELV A;  3F9K A;  4OVL A;  1TKZ A;  1YTA A;  4JRQ A;  1SL1 A;  1KRP A;  2VWJ A;  4KRF A;  3VQQ A;  1CXU A;  1MU2 A;  1YVU A;  3FFI A;  4KPY A;  4J2B A;  3DI6 A;  1JLG A;  1IG9 A;  4CFD A;  3HP9 A;  4CEZ A;  3SCX A;  1RBV A;  3P1G A;  4ICL A;  3AVK A;  3CQ8 A;  1RDD A;  5HRS A;  1IKX A;  3AVF A;  4ZHR A;  3OYB A;  1WSG A;  3BGR A;  4IG0 A;  4W5R A;  3QEI A;  3OYA A;  1WSI A;  4FLX A;  3SUQ A;  2G8K A;  5KGX A;  3PX4 A;  4CIG A;  1X9M A;  2D0A A;  5JS1 A;  4JS4 A;  5T7B A;  4OKK A;  2EX3 A;  1R0A A;  5FRN A;  4N47 A;  4FM1 A;  3OYN A;  1UA1 A;  4N56 A;  4F8R A;  3ZT3 A;  4GVM A;  4F2R A;  2HHV A;  4DQP A;  4FM2 A;  4C8N A;  3KK2 A;  4CIF A;  4XIU A;  2OPP A;  4CES A;  4DU3 A;  3DLB A;  3E01 A;  4AHU A;  4CGD A;  3MXI A;  3VQ5 A;  5J2N A;  4E3S A;  2QXF A;  2HNZ A;  3C6U A;  3OYI A;  3B6O A;  4DS4 A;  1WSE A;  2XRI A;  4CJW A;  3AVC A;  1L5U A;  3RWU A;  4KHW A;  2ZE2 A;  4M3Z A;  3AVH A;  4CIE A;  1C1C A;  1S9G A;  3DM2 A;  4I9L A;  5HRP A;  2OPS A;  1NJW A;  2HVH A;  1S1U A;  3DOL A;  4HVJ A;  1TK8 A;  5K14 A;  3SV3 A;  1LV5 A;  4NCG A;  2VWK A;  2R7Y A;  4HUG A;  1U49 A;  1VSI A;  2Q3S A;  3KLF A;  1BCO A;  4Q0B A;  1XI1 A;  4N5S A;  3SV4 A;  1S6Q A;  4CFA A;  1QS4 A;  4AH9 A;  4H8K A;  4PY5 A;  4IFV A;  1D8Y A;  4C8L A;  1ZYQ A;  3VQB A;  4FK2 A;  1RDA A;  4DSL A;  4CER A;  3K58 A;  3SUN A;  2E6M A;  1JXB A;  3M8S A;  2GBZ A;  1VSM A;  3RRG A;  1HQU A;  2DFE A;  3KIO A;  3C94 A;  1WSF A;  3CM5 A;  1SKW A;  3TAQ A;  4B8C A;  4M3Y A;  1ZBH A;  3QEP A;  2HW3 A;  4CJV A;  3TAG A;  3AO1 A;  2HHT A;  1KFD A;  4E7H A;  4M3T A;  1LAW A;  1WNS A;  4TSX A;  4F3T A;  1J54 A;  1TAQ A;  4KFB A;  3TAR A;  1KTQ A;  3DRS A;  1CXQ A;  4LSN A;  4DTJ A;  1RTH A;  3U6F A;  3G10 A;  4BWJ A;  4RW9 A;  3VQ4 A;  3L2V A;  3CFO A;  3HVR A;  1BIU A;  1RT2 A;  1REV A;  4DFP A;  2P5G A;  4CJE A;  4CJL A;  2F8T A;  3QO9 A;  4KTQ A;  3JSM A;  3PO4 A;  1TAU A;  4CF0 A;  1KFS A;  3C95 A;  1ZBF A;  3ZT4 A;  1RT7 A;  1VSK A;  1ITG A;  1FKP A;  4O4G A;  4BDZ A;  4M3U A;  1QQC A;  1BIZ A;  5I42 A;  2HHS A;  3NH2 A;  3LWL A;  3NDK A;  4KRE A;  4DTX A;  4N41 A;  3QLH A;  1VSF A;  3NBP A;  3OYJ A;  3EZ5 A;  1L3T A;  4O0I A;  4FCY A;  1C0T A;  2G8W A;  4L8R B;  4RW4 A;  3HT3 A;  1ASU A;  3DLH A;  2XY8 A;  4OGE A;  4FJJ A;  2YHB A;  3RMC A;  1CZB A;  4W5T A;  1T05 A;  3LAL A;  3NF7 A;  4RW7 A;  1EET A;  4CHY A;  4FJ9 A;  2P51 A;  2HNY A;  1RNH A;  2I5J A;  4B9N A;  2FBT A;  1LWF A;  4LD0 A;  4CEC A;  1HQE A;  4KHS A;  1Z25 A;  1RBR A;  2KZM A;  4CHQ A;  3O3H A;  4DQQ A;  4DF4 A;  1SKR A;  5E41 A;  3RR8 A;  1S1V A;  1NOZ A;  4CHZ A;  1NK6 A;  3TAP A;  4CJU A;  4KHN A;  1TKD A;  4LY7 A;  1GOB A;  1BIS A;  1B92 A;  3PUF A;  4Z4F A;  4Z4I A;  1NK9 A;  3OYK A;  2X6N A;  1NJZ A;  4I2P A;  4CK3 A;  1RT4 A;  1G15 A;  4IFY A;  3SPZ A;  2GUI A;  3DLR A;  2OPQ A;  4AHT A;  3HXM A;  1FXX A;  5J1E A;  4FJH A;  4CEB A;  1TL3 A;  2G8I A;  3G0Z A;  3C6T A;  2Y1I A;  4DQI A;  1HYZ A;  3ZT0 A;  2BDP A;  1UWB A;  4I2Q A;  1X1P A;  4DMN A;  1EP4 A;  3NGZ A;  4J2E A;  2ITG A;  2QK9 A;  4CHN A;  3QIO A;  4KTW A;  1WSJ A;  3HJF A;  2DFF A;  4FLV A;  2BAN A;  5CZ1 A;  1LWE A;  4FJN A;  1D5A A;  3AVM A;  2HHX A;  3DYA A;  3HST B;  3H08 A;  3ZSX A;  1XHX A;  1S6P A;  3NF6 A;  1ZBU A;  4CEO A;  4CF2 A;  4NCA A;  3KLH A;  1RDC A;  3TI0 A;  1LW0 A;  1QE1 A;  3I0S A;  4FJX A;  1JLC A;  1F21 A;  2A1S A;  3AVI A;  4I7F A;  4O5B A;  2XO7 A;  3SQ0 A;  4KHU A;  2AJQ A;  3S3O A;  3AVA A;  3L2Q A;  2B5J A;  4RG8 A;  3IAY A;  2FBX A;  4KI6 A;  4BAC A;  5FRM A;  4HUF A;  4DTN A;  2KQ2 A;  3VQC A;  2YKN A;  3LAM A;  3L2U A;  3S3M A;  4B9L A;  4FJG A;  2E4L A;  2XY5 A;  1Q8I A;  4C8O A;  1KLN A;  1WAJ A;  1L3S A;  1A5W A;  4B8A B;  3TWH A;  3KD1 E;  1S9E A;  2F96 A;  3M8P A;  4RW8 A;  1J53 A;  3ZSZ A;  3RMD A;  4NYN A;  3U3G A;  3VQ7 A;  3EY1 A;  3LPT A;  1TKX A;  4CHO A;  3AVN A;  4E89 A;  4FYD A;  1VSD A;  4CF1 A;  2E6L A;  3L3U A;  4FLZ A;  4DSK A;  1HYV A;  3HVT A;  4C8K A;  3VQD A;  1TKT A;  1A5V A;  3IG1 A;  4CGI A;  3KLI A;  4FZX C;  1J9A A;  1W9H A;  1RBS A;  4EP5 A;  2IAJ A;  4ZTJ A;  4OJR A;  3OYD A;  4IG3 A;  2D0B A;  2Z1H A;  3L3V A;  4OLA A;  4J2D A;  2G8V A;  2G8U A;  2XY6 A;  4F4K A;  2YV0 X;  4FK0 A;  1VSJ A;  3NHG A;  4E1N A;  1NKB A;  2FBY A;  4UQG A;  4FJI A;  3V4I A;  4O44 A;  4CJK A;  4CJR A;  4KTZ A;  3K5O A;  3KLG A;  4DLE A;  4GW6 A;  3NF9 A;  1LAV A;  3B6P A;  4DG1 A;  1B9D A;  3VA0 A;  3PV8 A;  3HK2 A;  1L3U A;  3O3F A;  4K8Z A;  4DSI A;  3NCI A;  3SQ4 A;  3L8B A;  2HMI A;  1D9F A;  1RTJ A;  1HNV A;  4JS5 A;  3CM6 A;  1S5J A;  3TAN A;  4RW6 A;  5JS2 A;  5J2P A;  1BQN A;  3DLG A;  3PY8 A;  3DMJ A;  3AA4 A;  4BDY A;  3ISN C;  1CZ9 A;  5HRO A;  3SQ1 A;  3AV9 A;  2VG5 A;  4W5N A;  3NGY A;  2ZQB A;  1X9S A;  1SKS A;  3LZI A;  2NUB A;  2HND A;  3KK1 A;  3S3N A;  1BI4 B;  4CEQ A;  1NKE A;  1U45 A;  4ZTF A;  4KHQ A;  1JL2 A;  3KK3 A;  4CFB A;  2IOC A;  1JLE A;  2YNI A;  4G1Q A;  4ID1 A;  4OKJ A;  3OS2 A;  4KKO A;  1NK0 A;  4CK2 A;  1SL2 A;  3RR7 A;  4JLH A;  4QAG A;  3ZT1 A;  2OA8 A;  2Z1I A;  4HUE A;  4AHR A;  1XC9 A;  4MQ3 A;  2HHQ A;  5EU7 A;  5HRR A;  4CEF A;  4FXD A;  3HPO A;  5CZ2 A;  3RMB A;  3HO1 A;  3LZJ A;  2YNG A;  3QNO A;  5HP1 A;  4IBN A;  2RN2 A;  3HM9 A;  3VN5 A;  4DFK A;  4WE1 A;  2A1R A;  4KV8 A;  1NJX A;  2RKI A;  2VG6 A;  3OJU A;  1KVC A;  4J2A A;  2HHU A;  3V1Q A;  1CLQ A;  2HVI A;  1VSH A;  3VQ8 A;  3LP3 A;  1IH7 A;  4Z4H A;  4JRP A;  3TR8 A;  1Z26 A;  1C1A A;  4ID5 A;  1JLQ A;  4OKE A;  4CF9 A;  1WAF A;  1S1T A;  3SQ2 A;  4E7L A;  3HYF A;  3KKS A;  3MXM A;  3MEG A;  4R5P A;  1XWL A;  1LWC A;  4FZZ A;  4CJQ A;  4B9M A;  3MEC A;  1GOC A;  1Q9Y A;  2B4J A;  1JL1 A;  1ZBI A;  4FW2 A;  5HRN A;  2JLE A;  3QIP A;  4M41 A;  3ZSR A;  1WN7 A;  4DLG A;  1SUQ A;  3V9Z A;  1TK0 A;  1DLO A;  4C8M A;  1VK0 A;  4CEA A;  1U48 A;  1C1B A;  3KKR A;  2G8H A;  4Z0U A;  4N76 A;  5CYQ A;  5C25 A;  1IKW A;  1Q9X A;  3OS0 A;  4DTU A;  3WNG A;  3CG7 A;  3I0R A;  4CFC A;  1HRH A;  5D3G A;  1NK8 A;  1RT3 A;  4DF8 A;  3ALY A;  1EKE A;  1U4B A;  3AVB A;  4LH5 A;  4KO0 A;  5KRT A;  3D0P A;  1NJY A;  4E7I A;  3V9W A;  4LSL A;  1VSE A;  2OPR A;  3RMA A;  1VSL A;  1RDB A;  2KTQ A;  3AO4 A;  5FRO A;  2BGG A;  3AVL A;  4PA1 A;  4BE1 A;  1C0U A;  3OYF A;  1W0H A;  2IS3 A;  3TAE A;  3OYM A;  5SZT A;  4DTM A;  3SI6 A;  3WNE A;  3ZT2 A;  3DRP A;  2BE2 A;  5CYM A;  3VQ6 A;  3KLE A;  4DFM A;  3DLK A;  2VG7 A;  3SYZ A;  3QEX A;  4BWM A;  4FJL A;  1C0M A;  1NK7 A;  3CYM A;  4OPJ A;  3PO5 A;  3HP6 A;  3EYZ A;  4CJF A;  3LAK A;  4CGF A;  3DRR A;  4HTU A;  4FJ5 A;  2FC0 A;  3I8D A;  1JKH A;  4FLT A;  2PYL A;  4B9S A;  3V81 A;  2X74 A;  3M8R A;  4KB1 A;  3KTQ A;  1HYS A;  1QSL A;  5CY4 A;  3ZSY A;  1X9W A;  3LP0 A;  3ULD A;  3V9U A;  3V9S A;  4EZ9 A;  2OZM A;  3NF8 A;  2X6S A;  2W42 A;  4Y1D A;  1FKO A;  1RTI A;  3DLE A;  3OYL A;  4FM0 A;  3VA3 A;  3TAM A;  1RT6 A;  3MED A;  1FK9 A;  2ETJ A;  3QET A;  4B9V A;  1BI4 A;  1QSS A;  2YNF A;  4FJK A;  4KI4 A;  2QKB A;  4M3R A;  1N6Q A;  2Z1G A;  5FDL A;  3SUP A;  3L2R A;  2YNH A;  4E7J A;  4M3W A;  3CFR A;  4BDP A;  4W5O A;  1T03 A;  1ASW A;  1UAX A;  1NK4 A;  4FK4 A;  3WNH A;  3SUO A;  1GOA A;  4H4O A;  2PZS A;  3KJV A;  3UIQ A;  5KGW A;  1HMV A;  3OYE A;  3KD5 E;  1SL0 A;  1S1W A;  2GV9 A;  4FLU A;  4OGC A;  1UOC A;  4IDK A;  4AHS A;  4DQR A;  4FJ7 A;  3AVJ A;  3V1O A;  2X78 A;  3OYC A;  3PX0 A;  4HHT A;  4CED A;  3PX6 A;  4DTR A;  3QEV A;  4PWD A;  4Z4C A;  3OS1 A;  2KZZ A;  2B6A A;  1TL1 A;  3A2F A;  2XHB A;  3QES A;  4DWI A;  1WSH A;  1TGO A;  1L3V A;  4O0J A;  4Q5V A;  3ZSO A;  3P5J A;  4CGH A;  3T1A A;  3ASM A;  4Z4G A;  4FJM A;  1EX4 A;  4CF8 A;  1VRU A;  4BE0 A;  4CEE A;  4ELT A;  2P1J A;  4CGG A;  1NK5 A;  4CJ4 A;  4FW1 A;  3NH0 A;  1BGX T;  4CE9 A;  3VQE A;  1U47 A;  1RT1 A;  2IC3 A;  1D9D A;  4B9U A;  3LDS A;  4W5Q A;  1N5Y A;  3DOK A;  3ITH A;  5DK5 A;  3P83 D;  4PUO A;  2FBV A;  3NE6 A;  5DMR A;  1JLF A;  3JYT A;  3VQP A;  3V1R A;  3LP1 A;  2DY4 A;  2ATQ A;  3LAN A;  1JLB A;  4O55 A;  3OJS A;  3AA3 A;  3K57 A;  3NAE A;  4QCL A;  4DFJ A;  4DSJ A;  3TAF A;  1C6V A;  1K6Y A;  4DU4 A;  3IRX A;  4YFU A;  4F2S A;  4KHY A;  3NFA A;  4CJ3 A;  3L2W A;  2EHG A;  4GMJ B;  3LWM A;  1NKC A;  3BDP A;  4CJS A;  2Y1J A;  2OYQ A;  4M45 A;  1T8E A;  4E0D A;  1IO2 A;  3AO2 A;  1WLJ A;  4YNQ A;  4DSF A;  3V9X A;  1HNI A;  4CCH A;  4IKF A;  3OYG A;  3NGI A;  4FZY A;  4HCC A;  4DU1 A;  3TAB A;  1I3A A;  4CJT A;  3HPG A;  4B08 A;  4AHC A;  5KTQ A;  1ZBL A;  2DTU A;  1DTQ A;  4AHV A;  1QSY A;  3HL8 A;  4CGJ A;  1RIL A;  4K8X A;  4DTS A;  2JGU A;  1JXE A;  3VQA A;  1KVA A;  1TV6 A;  5C42 A;  3K5M A;  4DTP A;  3ZCM A;  2KFZ A;  2O4G A;  1O1W A;  4CHP A;  2F8S A;  1IKV A;  4OPK A;  3AVG A;  5I3U A;  4OLB A;  2O4I A;  1U04 A;  4I9Q A;  1BCM A;  4E1M A;  4F3O A;  4EP4 A;  3O4N A;  3QIN A;  2RF2 A;  3O4Q A;  3SNN A;  1IKY A;  2IGI A;  3LPU A;  4KB0 A;  3LP2 A;  2PY5 A;  3S9H A;  1HJR A;  4FVM A;  3OYH A;  4PQU A;  4B3O A;  4LH4 A;  3ZSV A;  3O3G A;  1EXQ A;  4Z4E A;  4E7K A;  5J2Q A;  3SZ2 A;  1QHT A;  4QOZ B;  1DTT A;  2Z1J A;  4CJP A;  1J5O A;  1NOY A;  2D0C A;  2DFH A;  3AO5 A;  2IDO A;  3QEW A;  3THV A;  3OVN A;  3SPY A;  4FLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...