4CJPA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjpA00
3AA4A 1C6VA 2RKIA 4H4MA 4C8NA 4YFUA 3HVRA 4FLZA 1BL3A 1A5WA 1HPZA 3MXIA 3M8SA 3LWMA 4QCLA 1KSPA 1NK7A 2A1SA 3L3VA 3TAEA 3SQ0A 5D3GA 3KK1A 3K5NA 1WLJA 4RW6A 4FM2A 1RDBA 3H08A 4WE1A 1L5UA 4IG3A 4CHYA 4KI4A 3I0SA 4PA1A 5EU7A 4DLGA 1LWEA 4Z0UA 3VQPA 2W42A 3CYMA 3QETA 4FJNA 4CFCA 4CGDA 1LAWA 2XRIA 3VQ8A 1N6QA 4DSJA 3NGIA 3ZSQA 3AVAA 1QHTA 4G1QA 4R5PA 3SCXA 2G8KA 2AJQA 2VG5A 1RT6A 4KHYA 1C1AA 3U3GA 4BACA 4FLUA 3NGZA 4OLBA 3KLFA 2PY5A 3OYEA 2KFZA 3A2FA 3AVKA 1GOCA 4N47A 5KRTA 3K57A 4FLTA 1UA1A 2D0CA 4CEFA 2PZSA 3QLHA 4DTRA 3LP1A 4FVMA 1JLBA 5JS1A 3C6UA 1S1XA 1JLFA 2FBVA 3AVCA 3VQQA 3OYDA 3SYZA 2G8UA 1O1WA 3S3MA 3LZIA 3SPYA 1C0MA 4BDYA 1U47A 3VQ6A 2G8IA 4I2PA 3T3FA 4E7KA 3OVNA 1TAQA 1BCOA 2FC0A 4Y1CA 3LAKA 3V9ZA 2XY5A 2YNIA 3DMJA 3G0ZA 3HK2A 2QKKA 4KRFA 2KTQA 5T7BA 3QEWA 2YKNA 2BDPA 3CM5A 4DSIA 3HYFA 5HLFA 1RBSA 2HNDA 4CF8A 1HJRA 3VA3A 1L3TA 3AVMA 2RN2A 2P51A 2ETJA 3ULDA 1REVA 1JLEA 3TAFA 2OYQA 3DYAA 4EP4A 4FJ5A 4TSXA 2D0AA 4OVLA 3LPUA 4HTUA 4I7FA 3C95A 1ZBHA 1NOZA 4E1NA 4F2SA 1SKRA 1WN7A 3PX0A 3OYKA 4OKKA 1HYZA 4CK1A 4BDPA 5KI6A 1HNVA 3NAEA 2R7YA 4PWDA 1W0HA 3ZCMA 1FK9A 4FW1A 4B9MA 3HJFA 1SL0A 4O0JA 1C0TA 1S1VA 5J2QA 3V9SA 4C8KA 3RWUA 1LW2A 4FXDA 1BIZA 4F4KA 2GBZA 3OYBA 3QESA 1J53A 3M8QA 4KREA 3PX6A 1KFDA 2VWKA 3VQBA 1U45A 1TKDA 4JS5A 2Z1IA 2RF2A 4JS4A 3ZT4A 4KHNA 5KGWA 2DY4A 4KTWA 1DTQA 1JLGA 3QINA 3E01A 4CF0A 3KKSA 1LWCA 3KK2A 1YTAA 4AHTA 4E89A 4B3OA 4FLXA 1B92A 5DK5A 1RBUA 3IAYA 3V1OA 1U04A 4O44A 1Q9XA 1NK6A 3RRHA 4FYDA 2Q3SA 4LSLA 1IKXA 5KRSA 3LP0A 1GOBA 1WSEA 3TAMA 3MECA 1A5VA 1KVBA 4N5SA 3O3FA 1N5YA 1D9DA 4ELVA 4DS4A 4RG8A 2OPRA 3V1RA 3QEPA 2KFNA 4N41A 3VQDA 1VSDA 4ID5A 4B9SA 2ATQA 3QEXA 3M8PA 3O3HA 2I5JA 2DFFA 1VRTA 3TAGA 3RMBA 4E7HA 3RMAA 3V6DA 3KD1E 3SQ4A 2X78A 3AVHA 3RTVA 1BCMA 1JL1A 1RT5A 4FJIA 4FJJA 1JLQA 5J1EA 2P5OA 1VSIA 1BI4A 3D0PA 1RBVA 4JRPA 4DFJA 3HVTA 1KTQA 1KRPA 3OJUA 1CZBA 1LWFA 3ZSYA 3ZT0A 4CJUA 1Z25A 3NCIA 3K5MA 1VSLA 2Z1GA 4H8KA 2F8TA 3ALYA 2HVHA 3O3GA 4NYNA 3LZJA 2P1JA 1TK5A 3NF8A 4Z4HA 3SV3A 3QEVA 1DLOA 2HB5A 3SV4A 2G8WA 4CGGA 1YTUA 1RDAA 1WSIA 4AH9A 4DFPA 3DLGA 4RW8A 3HP6A 3ZSVA 3P1GA 3OS0A 1SL1A 3OYNA 4KAZA 3IS9A 4CIEA 1MU2A 2ZE2A 1ASVA 3C94A 3NBPA 4LH4A 3ZT1A 1IO2A 1UAXA 1QSSA 3DLHA 4AHCA 3HM9A 3VQ5A 4IBNA 1EP4A 3ZT2A 3MEDA 3L2QA 3NE6A 3NGYA 1TKTA 3VQCA 1BQNA 4N76A 3DRPA 3OYLA 3VQ4A 4E7IA 1L3SA 2LSNA 4YNQA 4HCCA 4RW9A 2FBXA 5HRPA 4CEOA 2Z1JA 4CFDA 4FJ9A 4CJQA 1C0UA 1HYVA 2OPQA 3IG1A 1NJWA 4DQPA 3S3NA 1UWBA 4B9UA 3L2VA 1S1TA 1T05A 3AO4A 3K5LA 2IAJA 3UIQA 4CHQA 1TAUA 2HMIA 2DTUA 4JLHA 1T7PA 4Q5VA 3WNGA 3KJVA 3SI6A 2X6SA 4OJRA 4OKJA 4H4OA 3LDSA 4FLYA 3LANA 1U49A 2KZZA 1HYSA 3IRXA 1J9AA 3FFIA 2IS3A 3BDPA 3EZ5A 3VQEA 4BE2A 1T8EA 3AO5A 5SZTA 5HRNA 4DTMA 2GUIA 4XIUA 2OZSA 4K8ZA 2HHVA 2IOCA 1NK8A 1NKBA 3MXJA 1UOCA 1ZBIA 1CXQA 4ELUA 4LH5A 4FM0A 2YNHA 1CLQA 4DG1A 3V81A 3S3OA 4KHWA 3SJJA 2HNZA 2O4IA 1RT4A 3CG7A 1JXBA 4MQ3A 1BISA 2HHQA 3AVFA 3HPOA 4FJ7A 4CFAA 1HRHA 1XWLA 5JS2A 4DTSA 1TL1A 2QXFA 3TI0A 3SNNA 1SKSA 3WNHA 2HVIA 4B9NA 3MEEA 3DLEA 4CHOA 5J2NA 3HL8A 2VWJA 2PYJA 3DLBA 4E1MA 1RILA 4FW2A 4KI6A 2X74A 3L2UA 3VN5A 1TV6A 3O4QA 4FLVA 1QQCA 3PY8A 1I3AA 2GV9A 1NJXA 3S9HA 4FK0A 3CQ8A 3AVGA 4E3SA 3V4IA 4AHSA 4DS5A 1T03A 4OPKA 4M45A 1KVAA 3HPGA 1S9GA 1NK9A 4E0DA 2BE2A 4CJVA 1BGXT 1WSJA 1JXEA 3OY9A 5C25A 4FCYA 2HHUA 4CF2A 3CFOA 3EY1A 4FM1A 4DF8A 3THVA 1HQEA 4AHRA 1RT3A 1W9HA 2HNYA 4Z4FA 5KGXA 1KLNA 4CJ5A 3SPZA 3OYFA 2XY8A 1IKVA 2VG7A 5HP1A 4LSNA 2JLEA 2OPPA 3OS2A 2KZMA 3L2RA 3AV9A 4L8RB 4AHUA 1ITGA 3CM6A 4LY7A 1XC9A 3AO2A 1JLAA 3T19A 3SQ1A 1FKOA 3QIPA 1ASWA 4DFKA 1RTDA 4F2RA 4PUOA 4PY5A 2IC3A 1WAFA 3DI6A 4HHTA 5CYMA 3OYIA 2DFHA 3LWLA 1RBRA 4AHVA 2RPIA 4M41A 4FJXA 3SUPA 4I2QA 1NK0A 1SL2A 1VSKA 4CESA 3TANA 3T1AA 2ZD1A 3VA0A 1RT7A 3PV8A 4CECA 4Z4GA 4E19A 5C42A 1WSGA 4O4GA 1RCHA 1UA0A 1NJYA 3QEIA 1S1UA 3RRGA 2WONA 3V9XA 4N56A 3HT3A 1XHZA 4CJEA 4FZZA 1WNSA 1S5JA 4KV8A 4NYFA 1DTTA 4RW7A 3AO3A 3RR8A 1S6QA 1C1BA 1EX4A 4E7LA 1SKWA 1TGOA 2P5GA 4KPYA 4M3UA 4E7JA 4DTXA 4DTOA 4FK2A 4IG0A 4CJLA 4W5RA 4JRQA 1JL2A 2A1RA 2WOMA 1K6YA 4Y1DA 3L3UA 1FXXA 4DQRA 2G8VA 2E6MA 3CFPA 4B08A 5K14A 4DSFA 2NUBA 4B9VA 4J2AA 3RMCA 3QERA 2EX3A 3LPTA 4ZTFA 1QSLA 3B6OA 4DTJA 3LAMA 4ID1A 1FKPA 3K59A 1D8YA 4CJFA 1IKYA 4DTPA 3DLKA 3AVJA 4KFBA 2HHWA 3OYCA 1IH7A 3HPHA 4F3TA 4UQGA 3EYZA 1B9DA 4M3XA 1VSMA 3TAQA 4C8MA 5HROA 1X9MA 1YT3A 1L3UA 4DMNA 5E41A 4CEBA 4DLEA 4CGFA 5J2MA 1WSFA 2VG6A 3NH0A 5FRNA 5I3UA 2DFEA 3K2PA 4NCGA 1XI1A 4OKEA 4CGJA 4DU4A 4CJ3A 2Y1JA 5DMRA 1SUQA 3OS1A 4W5QA 3AA2A 3AA5X 3AVIA 1KCFA 5J2PA 1JKHA 2B5JA 4OGEA 1VSJA 1ZYQA 4B8CA 4I9LA 4CGHA 4CGIA 1NKEA 2HW3A 2XY7A 4QAGA 1EETA 3QNNA 2ITGA 4NCBA 2HHXA 3ZSWA 2OA8A 4DU1A 5KTQA 4CEDA 4EP5A 1RT2A 1U4BA 1KLMA 1QS4A 3JSMA 3AVLA 4BWJA 4NCAA 1HNIA 1TK8A 4HCBA 4I9QA 4C8LA 2BGGA 1JLCA 1VSHA 4KKOA 4CJPA 4ZHRA 3WNEA 1C1CA 4Z4CA 1X1PA 3MAQA 3DOLA 4HUFA 2EHGA 3K5OA 3RMDA 1RTHA 3NF7A 3ZSZA 1X9SA 1LAVA 3OYMA 3KTQA 4CIFA 4F3OA 4DQQA 3KLGA 1CZ9A 2F96A 2YHAA 4CEQA 4HUEA 4OLAA 2B6AA 1BI4B 1LW0A 4CCHA 4OGCA 4GMJB 3QNOA 4DF4A 1ASUA 1RDDA 4CJRA 3ISNC 5HRSA 3DRRA 3C6TA 1D5AA 4EZ9A 4DSKA 2QK9A 4HVJA 3KIOA 4KHQA 2G8HA 3P83D 3KKRA 4FJKA 2YKMA 1A5XA 4DTUA 1ZBLA 3KLHA 3HO1A 3AA3A 4M3RA 4O0IA 2FBTA 4IKFA 1Z26A 3PO4A 2BANA 5CYQA 3M8RA 1S9EA 4IFVA 1QSYA 1QE1A 5CY4A 1L3VA 3DRSA 4MFBA 4O55A 3WNFA 4QOZB 4FZXC 5I42A 2D0BA 3V1QA 5FDLA 4IFYA 4CEEA 1VSEA 3KLIA 1VRUA 3OYAA 4J2DA 4C8OA 4CHNA 3I8DA 3MEGA 4FJHA 4J2EA 3PO5A 2B4JA 4O5BA 3DM2A 3QIOA 3DOKA 1F21A 3QO9A 5HBMA 1IG9A 4DSLA 3AVBA 4FJ8A 4CHPA 5SWMA 3NF9A 1GOAA 4CK2A 1RNHA 2YNFA 3NHGA 2QKBA 1BHLA 2YNGA 2XHBA 4M3TA 1I39A 1HMVA 3BGRA 3SUOA 4DQSA 4M3WA 3TAPA 4KHUA 2KW4A 3SZ2A 1S1WA 3JYTA 3SUNA 1ZBUA 4Z4IA 4DSEA 5CZ2A 3NH1A 4KB0A 2X6NA 3CFRA 1KFSA 4CEAA 1BIUA 3D45A 4FZYA 4FJGA 1WSHA 1WAJA 3B6PA 4FLWA 3AO1A 2YV0X 3V9WA 1EXQA 3VQAA 3ZSXA 4CIGA 5C24A 4BE0A 4ICLA 4CHZA 4CJKA 4ZTJA 2PYLA 3LALA 4CJTA 4LD0A 3OYGA 1TKXA 2Z1HA 3O4NA 4IDKA 1RTJA 4HUGA 4CJWA 1QTMA 1J5OA 3ZSRA 4B9LA 2YHBA 4CK3A 3HXMA 1NK4A 1LV5A 3ZT3A 3V9UA 4M42A 3NF6A 1J54A 4KTQA 1ZBFA 4CJSA 4KB1A 3RR7A 3MXMA 3NDKA 2FBYA 3VQ7A 4W5NA 1RTIA 4CF9A 4BDZA 3AVNA 4BWMA 4B9TA 2HHSA 3L2WA 3F73A 1BQMA 4M3YA 2XY6A 2E4LA 2O4GA 1NK5A 4DTNA 4EZ6A 1TK0A 4FK4A 3HP9A 1D9FA 1VSFA 4CE9A 4K8XA 2E6LA 3VQ9A 5HRRA 1CXUA 3K58A 4F8RA 1R0AA 1RDCA 3ASMA 1Y97A 1YVUA 1S6PA 2XO7A 1XHXA 1TVRA 2OPSA 3G10A 3OJSA 5CZ1A 1RT1A 3ITHA 1G15A 2F8SA 1KVCA 4DWIA 3I0RA 3DLRA 1U48A 2ZQBA 4BE1A 5FROA 3SUQA 1NJZA 3PUFA 1NOYA 2OZMA 1VK0A 4Z4EA 3LP2A 2G8FA 3U6FA 4W5OA 2Y1IA 4CJ4A 3KK3A 1SV5A 4KTZA 4CF1A 1HQUA 3ZSOA 1Q9YA 4Q0BA 3NH2A 4KHSA 4OPJA 3OYJA 4RW4A 1TKZA 2KQ2A 2IGIA 3TARA 4CFBA 4DFMA 3KD5E 2HHTA 3SQ2A 4B8AB 1Q8IA 3TR8A 3TABA 4GVMA 3NFAA 1EKEA 3L8BA 4CEZA 4M3ZA 3KLEA 1TL3A 3OYHA 2IDOA 3LP3A 3F9KA 4KO0A 4AILC 4ELTA 4FJLA 3HSTB 4DQIA 4PQUA 2D5RA 3P5JA 4DU3A 4FJMA 5FRMA 1IKWA 3U3YA 1B9FA 3PX4A 4W5TA 1NKCA 4J2BA 1RBTA 1X9WA 2JGUA 4GW6A 3TWHA 4CERA
chains in the Genus database with same CATH superfamily
4H5VA 3HRGA 3E1YA 4H0OA 3M8SA 4A5BA 1NK7A 2A1SA 3TAEA 3SQ0A 4RTFD 5D3GA 4KH5A 3VTHA 4RW6A 3TTFA 3H08A 4WE1A 4C1NK 1Q86O 5EU7A 4FJNA 4DLGA 2WUSA 3CYMA 4CFCA 4IO8A 5AZIB 4DSJA 3NGIA 1RDUA 1QHTA 4G1QA 3SCXA 2VG5A 4GNIA 4KHYA 3VERA 5EX5A 3UKUA 3W3DA 4EHUA 4FWNA 2PY5A 2KFZA 3A2FA 4CEFA 3MN6A 1W97L 4DTRA 1GLDG 5I9EB 1K8KB 3AVCA 3LDOA 3VQQA 3CC2N 2G8UA 4BDYA 4BGBA 4WFNL 4FO0A 3PIPL 3CETA 4KRFA 3HK2A 2QKKA 3WUHA 3CCMN 5F2RA 3VA3A 1NU0A 5IT9O 2YX6A 3TAFA 4M7YA 4TSXA 5FPDA 4AF1A 3LPUA 4H0YB 2FLOA 4LF8K 5KQ8A 3DXKB 4EHTA 4CK1A 3CCEN 3IUCA 1SL0A 5J2QA 4C8KA 1XC3A 3EN9A 1KFDA 4JS4A 3ZT4A 5KGWA 2DY4A 1JLGA 1ZC6A 3E01A 4JI3K 4JD2A 1LWCA 3KK2A 1YTAA 4FLXA 1B92A 3IAYA 3V1OA 4XH4A 1DEJA 4FL9A 4LSLA 1IKXA 4X65K 1YXQA 4ELVA 4RG8A 3ENBA 2ATQA 3TAGA 3RMAA 2DFFA 1VRTA 3RMBA 1VQON 3AVHA 1QVFM 4FJIA 3M6GA 1JLQA 1U6ZA 5AR0A 3CCUN 1E4FT 3HTVA 1BI4A 3D0PA 1ATNA 3WEEA 3CJBA 2VQFK 4JHDA 3I8BA 3OJUA 3K5MA 4YOWA 3OW2M 1T3VA 3R9PA 2HVHA 4IOXA 4XH1A 1M1KO 1TK5A 3LZJA 5EY4A 4CGGA 3DLGA 1SL1A 4LH4A 1NNEA 1QVGM 1H1VA 3A5LC 5MLCQ 3DLHA 4JI5K 2F9WA 4DB3A 3NE6A 1TKTA 1BQNA 4HTLA 4NB4A 4BRDA 3VQ4A 4E7IA 4YNQA 4WFBL 3AARA 4RW9A 5FPMA 3VEYA 4CEOA 4HCCA 2Z1JA 4FJ9A 2GUPA 4CD3A 1HKCA 2YJFA 3AO4A 3K5LA 1TAUA 2X6SA 3A0IX 4FLYA 1X3NA 1SAZA 1T8EA 4DTMA 4XIUA 2IOCA 1NK8A 5AQRA 2CH6A 4ELUA 4LH5A 4FM0A 1CLQA 3V81A 4KHWA 2HNZA 4KH6A 3CG7A 3J7AP 1JXBA 5JS2A 3WNHA 1VQKN 5AQPA 4BRFA 5J2NA 5BN8A 4E1MA 1RILA 1GLCG 2X74A 3L2UA 3PY8A 5LMUK 3S9HA 3AVGA 4OPKA 1GLAG 3HPGA 4CJVA 1BGXT 3UKRB 5AQNA 1JXEA 2HHUA 3U9DA 2DPNA 1RT3A 2HNYA 1XMOK 2WBNA 4K43A 4CJ5A 4CD1A 2XY8A 1IKVA 2VG7A 1E3MA 3MX5A 2JLEA 2KZMA 2P9NB 3AV9A 4AHUA 1ITGA 3AO2A 4JN4A 4JKBA 1EQYA 3M5RA 1ASWA 3QIPA 4PUOA 4KBOA 5AQSA 3P38A 4YY3K 1RBRA 1HLUA 3RSEB 3MN9A 3H46O 4CESA 4CECA 2ZJRL 1WSGA 3FZMA 3V9XA 3HT3A 3PIOL 4H0XB 1HKBA 4NYFA 2JWKA 3AO3A 3SMSA 3LL3A 1SKWA 2ASMA 4E7JA 4FK2A 3FR0A 2A42A 4W5RA 1I94K 4JRQA 1JL2A 2A1RA 3CCRN 3L3UA 3VENA 4ISGA 3RMCA 3ZETB 1ILYA 1QZ6A 3QERA 2EX3A 2VGMA 4ZTFA 2Q36A 1QSLA 5JVGL 3ZX2A 3LAMA 4ID1A 2QWLA 1XQSC 3LDLA 4JKHA 2WTUA 4KFBA 4BQLA 3OYCA 2AP1A 4UQGA 3EYZA 1B9DA 1WB9A 4K41A 3BP8A 5HROA 4DMNA 4CEBA 5C2DA 2E2OA 4A59A 1WSFA 3H45C 1XI1A 4H03B 4K42A 5DMRA 1SUQA 2ZJPL 4E1JA 1KCFA 5C12A 1JKHA 2B5JA 4OGEA 5J2PA 3THXB 3K9KA 4B8CA 4CGHA 5BRHA 2HW3A 1OKJA 3QNNA 2HHXA 3HI0A 2OA8A 4BRHA 4EP5A 1RT2A 2YHYA 3D2FA 1FJGK 1HNIA 4H5TA 3RVCA 4HCBA 4I9QA 4C8LA 4YOXA 4ZHRA 3WNEA 1C1CA 3MAQA 1X1PA 3DOLA 3T1HK 3NF7A 3ZSZA 4A5AA 4CIFA 4F3OA 2P9PA 3J8AA 4DQQA 4CEQA 4GY2B 2UXBK 1LW0A 1WBBA 1YJNN 3U8XA 5AQLA 1RDDA 3G25A 3ISNC 5HRSA 4BR0A 4JKDA 3K0SA 4EZ9A 3QDKA 2QK9A 2NLXA 4HVJA 4KHQA 4BVPA 2G8HA 3ZYYX 4YHHK 3HO1A 1Q7YO 3EKUA 4M3RA 5ELZA 1Z26A 3IFRA 2BANA 3FGUA 3O9TA 2O8FA 4IFVA 5CR4A 3NVKA 3TTDA 1MWMA 3WNFA 3CJCA 2CGJA 3TSQA 5FDLA 1J6ZA 3D7EO 1JCFA 3KLIA 1VRUA 4U7BA 1GLLO 1SZ2A 4J2EA 2B4JA 5HBMA 3GDQA 1IG9A 4BR5A 4FJ8A 3AVBA 3U9ZA 3NF9A 1RNHA 3CQXA 5BR8K 2YNGA 3DJCA 3SUOA 4JYAK 3SZ2A 1S1WA 5BREA 4DV5K 2VQEK 1QQMA 3PSFA 4CEAA 1BIUA 1VQ6N 5LMNK 3VQAA 4CIGA 4PL8A 4OX9K 1KD1O 1RTJA 3L0QA 4B9LA 4CK3A 2HF3A 5ADXA 4W5NA 1RTIA 4BDZA 2QXLA 2Q31A 4BWMA 4R79A 4B9TA 2HHSA 3L2WA 4M3YA 2P9IB 3I56N 1NK5A 4EZ6A 4BRQA 1NBWA 1Q82O 1VQ9N 3GOIA 5AQUA 1R0AA 1RDCA 3ASMA 1S6PA 4CBWA 3OJSA 5AQYA 5M1OA 1RT1A 3ITHA 3TPQA 3TTCA 4BVOA 4CI6A 5JLFA 2HHHK 3MN5A 3SUQA 4Z4EA 4FVUA 2NRRA 4FWRA 2J4RA 2Y1IA 4JK8A 1SV5A 4Q0BA 4K25A 4OPJA 3CERA 3K9JA 1W7AA 2P9KA 3O9QA 3DXMB 2HHTA 3SQ2A 1Q8IA 3TABA 4GVMA 4RWTA 1YHQN 3LP3A 4FJLA 5ADXH 4DQIA 4PQUA 3NMUA 1VHXA 4JKGB 1NMDA 3O9UA 1KC8O 3G4SN 4GW6A 3TWHA 3OS1A 4FWKA 5BPNA 3MN7A 3KK1A 3CC7N 4PA1A 3QETA 4Z0UA 3VQPA 2F9TA 2XRIA 2FXUA 1TUYA 4R5PA 2QA4N 1C1AA 4FLUA 2VYPA 3NGZA 1VQPN 1NJIO 1HPMA 4JAXA 4B3MK 5E26A 3KLFA 3K57A 4FSVA 2D0CA 3MWPA 4FVMA 2A40A 2FF6A 2O8CB 1S1XA 4H5NA 3W0LA 3LZIA 2UYTA 2G8IA 4I2PA 3T3FA 4E7KA 1TAQA 1G99A 5T7BA 3QEWA 2YKNA 2BDPA 3VESA 5HLFA 2HNDA 2V7YA 2AA4A 1L3TA 4DR1K 3AVMA 2ETJA 2ZJQL 4JEPA 2OYQA 3DYAA 1VQ7N 4OVLA 1N32K 3O9SA 3C95A 4I7FA 5C0YA 1NOZA 4F2SA 1SKRA 1WN7A 4PWDA 2YHWA 4Y0WA 1TYQB 4O0JA 1C0TA 3OYBA 3QESA 1J53A 1FW6A 1U45A 1TKDA 5BR9A 4JS5A 2P9LA 2Z1IA 5AZJA 4DCHA 1SQKA 5M1KA 1HX1A 1EWRA 3KKSA 3F2KA 4BRAA 4E89A 4EIAA 1HNXK 4B3OA 1HKGA 4O44A 1Q9XA 4FYDA 3RRHA 5KRSA 1N6QA 3LP0A 1N5YA 2OZMA 2IVPA 4DS4A 4XH5A 2KFNA 4M7XA 4NXMK 3VQDA 5AQVA 4E7HA 3RTVA 1BCMA 1KXPA 1RT5A 5BPLA 4FJJA 5J1EA 4B1YB 3ID8A 4JRPA 4DFJA 1S72N 3ZSYA 1VSLA 4H8KA 2F8TA 1RFQA 3ALYA 3SAHA 4NYNA 3ZEUA 3NF8A 3SV3A 3QEVA 3DWLA 1YTUA 4JV5K 1WSIA 2A5XA 3P1GA 3OS0A 4KAZA 4CIEA 3C94A 1N34K 3ZT1A 4K0KK 4BQZA 4AHCA 3HM9A 3VQ5A 1LOTB 4IBNA 1ATSA 1EWQA 3NGYA 2I7PA 4I6MB 4IXCA 4N76A 3DRPA 3IMXA 3C6HA 2UUBK 1L3SA 1NLVA 3IG1A 1HYVA 4DQPA 4B9UA 4CZHA 2IAJA 3UIQA 3ZX0A 4JLHA 1T7PA 4Q5VA 4DR2K 3HSCA 3SI6A 3KZBA 4FWPA 1U49A 1J9AA 3FFIA 2P9UB 2IS3A 4WQ5A 2HBJA 4X66K 3VQEA 5SZTA 5HRNA 2OZSA 2GUIA 2WC9A 3OA9A 3CCQN 3MXJA 1UOCA 5KQDA 2E1ZA 4IJAA 3SJJA 1RT4A 2O8BA 3HPOA 4FJ7A 4CFAA 1XWLA 1N36K 2GEMA 1TL1A 3E66A 2QXFA 3SNNA 2HVIA 4C23A 3DLBA 3P39A 1BA1A 1TV6A 1QQCA 4YORA 1I3AA 4CZLA 5HOOA 4E3SA 3CD6N 3J7ZO 1T03A 5M1NA 4M45A 3QB0A 1NK9A 2BE2A 3FZKA 5C25A 4EFHA 4FM1A 1GLJO 3O8MA 4AHRA 1W9HA 4DV6K 2CGLA 1KLNA 3SPZA 1NG9A 2W40A 4JI0K 3CM6A 3BF1A 1FKOA 4DR4K 1NM1A 4A2BA 2OCEA 3DI6A 3EEQA 4HHTA 5CYMA 3OYIA 2DFHA 4AHVA 4CJ7A 3QBWA 3SUPA 4I2QA 3UKUB 3TANA 2QTDA 4Z4GA 2OTJN 1EO1A 1ZXOA 3RRGA 2WONA 3CCJN 4OO1J 4FZZA 1DTTA 1C1BA 4E7LA 4KPYA 4M3UA 5AQIA 4CJLA 5FLXO 5AQTA 1Q18A 3WXIA 2G8VA 2E6MA 3CIPA 3CFPA 5K14A 2NUBA 4J2AA 2QWRA 1O13A 3LPTA 1OH8A 1D8YA 3DLKA 3AVJA 2HHWA 4QS9A 4GV3A 1OVYA 4BROA 4IOAL 4C8MA 1X9MA 1YT3A 4CGFA 5J2MA 2VG6A 5FRNA 3VEXA 2QI2A 4NCGA 3LDQA 4DU4A 4CGJA 1XUPO 4CJ3A 2Y1JA 3M3ZA 4JD2B 3AVIA 2FSJA 3ATUA 1YJWN 1NKEA 4CGIA 1IG8A 2XY7A 4QAGA 3OBWA 3ZSWA 4DU1A 5KTQA 2QWPA 1QS4A 4OPHA 3C0BA 4CZKA 2P5OA 4KKOA 4CJPA 3WQUA 4DUYK 1X9SA 3RMDA 1RTHA 3KTQA 1YVNA 3KLGA 2F96A 2YHAA 4QS8A 2B6AA 1BI4B 3FFKB 3H6EA 4CZJA 4DHYA 4OGCA 2FSNA 1ASUA 4DKWA 4MDAA 1D5AA 4H5WA 4LF6K 3GL1A 3BUZB 3CI5A 1OH6A 1E4GT 3P83D 3UE5A 1MWKA 4A57A 3GG4A 4DV3K 4DTUA 2NZTA 1JCEA 2D4WA 4O0IA 2VGNA 4L3QA 4IKFA 3PO4A 4LF9K 2VCPA 1S9EA 4QOZB 5I42A 4X64K 3N4QA 3CJ7A 4CEEA 3I8DA 3MEGA 4FOIA 3DM2A 4JKEA 2HBLA 5SWMA 1BDGA 3TU5A 3L4IA 4IFEA 1I39A 2GWKA 1HMVA 3BGRA 4DQSA 4M3WA 3KVGA 4BRMA 2KW4A 1V4SA 2NRZA 5AQHA 5CZ2A 3NH1A 4DSEA 4Z4IA 2X6NA 3CFRA 4FJGA 2P9SA 3V9WA 3ZSXA 4BR4A 1GLEG 5AQQA 3MDQA 4ZTJA 3LALA 4FWOA 4PHTX 3CXCM 3O4NA 2RHKA 4IDKA 2GTDA 4CJWA 1QTMA 1J5OA 3ZSRA 4MLEA 4CJSA 1K9MO 4WQ5C 2FBYA 3VQ7A 2Q97A 3QFUA 4CZGA 1T44A 1BQMA 4CBUA 2ZGZA 2O8DA 5C2FA 4DTNA 2VWBA 3ULEA 2QW9A 5AQXA 4BG9A 4FK4A 3HP9A 1D9FA 3G6EN 4K8XA 3VQ9A 2QM1A 1YVUA 4B3TK 2NNWA 2QEXN 2OPSA 5CZ1A 5F0XA 3DLRA 1U48A 2GWJA 2NRXA 5FROA 3H1QA 4UY8O 3PUFA 4JK9A 3BEXA 3U6FA 4W5OA 3S41A 3KK3A 4BRIA 1HQUA 1Q9YA 4AM6A 4KHSA 1J5EK 4DFMA 3KD5E 3NFAA 2UXDK 1YITN 3C6AA 1TL3A 2D0OA 4FWLA 4DU3A 2W6LA 1D4XA 3T7ZA 4FJMA 5FRMA 3U3YA 3TSUA 1U2VA 1U4BA 4CERA 5AJ3K 4C8NA 3HVRA 4FLZA 1BL3A 2Q1NA 1HPZA 2NRHA 3MXIA 3LWMA 4QCLA 1S3XA 3K5NA 1XNQK 4FM2A 1RDBA 1L5UA 4KI4A 4IG3A 5DM7L 1HUXA 2W42A 5LJVA 4WYBA 3AVAA 4YOUA 2G8KA 2AJQA 4BACA 4B1ZA 4ILJA 1WBDA 4IDHA 4PKGA 2YHXA 4IJNA 3AVKA 3F9MA 2PZSA 5KRTA 3JAMO 4GKJK 3QLHA 3CMAN 3P31A 3C6UA 5JS1A 1JLFA 3AGRA 3S3MA 3SPYA 4H5RA 1U47A 3D2EA 2FC0A 3LAKA 3CQYA 2YNIA 3DMJA 3G0ZA 4DV7K 1IV0A 3HYFA 2ITMA 1DKGD 1HJRA 4BR2A 2A3ZA 4EP4A 4O8UA 1ZBHA 4E1NA 1CZAN 2V7ZA 4YDUA 3OYKA 3HBTA 2EWSA 3QFPA 4OKKA 3D2FB 4BDPA 5KI6A 1HNVA 1ZBSA 1MDUB 3ZCMA 1FK9A 4FW1A 2O8EA 3HJFA 1S1VA 3EL2A 3RWUA 3V9SA 3C7NA 2P9PB 3M8QA 3PX6A 2VWKA 3VQBA 2ZGYA 1JJ2M 1VAZA 4IEEA 4A62A 3EE8A 5BRDA 4KHNA 5CHIA 3QINA 4CF0A 3HOSA 4FWMA 1RBUA 1NK6A 3KK7A 4JKGA 1GLFO 4CVNE 3VGMA 3TAMA 1A5VA 3O3FA 3VMFB 1JCGA 2OPRA 3V1RA 4N41A 1NGCA 1VSDA 4ID5A 2HBMA 4B9SA 2O8FB 3QEXA 1NOYA 3LM2A 4BC4A 3V6DA 3THYA 4QS7A 3SQ4A 3MCAB 2QWNA 1VSIA 1RBVA 1KRPA 5AQKA 5LL6Z 3ZT0A 4CJUA 4DV0K 4DQ8A 2Z1GA 5GIPA 3MMVA 3THWA 1DLOA 3SV4A 1RDAA 4AH9A 3HP6A 3ZSVA 5M1PA 3OYNA 3IS9A 1MU2A 1ASVA 3NBPA 2IIRA 2PFUA 1Q81O 5F1XA 2O8CA 2HF4A 3ZT2A 5AQJA 1YAGA 2E1YA 3OYLA 3PLAA 4CBXA 4CFDA 4CJQA 1C0UA 1NJWA 3GE1A 3S3NA 1UWBA 3L2VA 1T05A 4Z94A 1W2BM 2DTUA 3KJVA 4OKJA 4H4OA 2KZZA 1HYSA 3IRXA 5GAGP 1TYQA 3CC4N 3JXUA 3EZ5A 1YJ9N 4BE2A 3AO5A 1VQ5N 2YNHA 1NGAA 4CZIA 1OVQA 2HHQA 3AVFA 4BC3A 4DTSA 2P9KB 1BA0A 1SKSA 3HL8A 3DLLL 2E8AA 3VN5A 3O4QA 3R1XA 4FLVA 4FK0A 4FOEA 4AHSA 5TKYA 5BN9A 1KVAA 1N33K 1WSJA 3OY9A 4FCYA 2JWLA 4CF2A 3CFOA 1OH5A 3IKMA 4DF8A 3THVA 1HQEA 1MA9B 1KAZA 1VQNN 5KGXA 2HSTA 4MLHA 3OYFA 5HP1A 4LSNA 3OS2A 4AQYK 1VQ8N 3L2RA 4LY7A 1N8RO 3SBGA 3HOTA 1NGGA 1HJOA 4PKIA 4GV9A 4F2RA 4B1WB 1XMQK 3E9PA 4NLBA 3KWIA 4M41A 3Q7BA 1Y64A 3OHRA 3T1AA 1IBKK 3LM9A 3J81O 4E19A 2E2NA 5C42A 2UXCK 1RCHA 1UA0A 1NJYA 5CE3A 3WXMB 3QEIA 2E88A 1XHZA 4CJEA 1WNSA 1M90O 1S5JA 4KV8A 4RW7A 3VPZA 3RR8A 1YUWA 1TGOA 2HOEA 4DTOA 4DTXA 3FE1A 4IG0A 3A5NC 5AZIA 3AAPA 2WOMA 1K6YA 4Y1DA 1FXXA 4DQRA 3AAQA 1NGDA 4DSFA 3ZX3A 1X3MA 3U4LA 4WQ4C 3E9OA 3M1FA 4BRGA 3B6OA 3H3OB 1QQNA 2NRVA 1FKPA 3KHYA 4IEIA 3SJHA 3K59A 1IKYA 3CJ9A 2GELA 4B1XB 1K8KA 1IH7A 3HPHA 4F3TA 4M3XA 3TAQA 4YDUC 3HZ6A 2UU9K 2P9LB 5AZJB 2ASPA 4BRPA 3NH0A 1V4TA 4CW7B 2E5LK 3K2PA 4LFBK 4OKEA 3AA2A 3AA5X 1ZYQA 3D6RA 1VSJA 1EETA 4CEDA 3DXKA 1KLMA 3AVLA 1JLCA 4EAHD 4FJXA 3VETA 2RE2A 4U67L 3CHWA 3OYMA 2Q0UA 2A41A 3SAGA 3HM8A 4CCHA 3KWGA 3DRRA 3C6TA 2UUAK 4GV6A 3KKRA 3ZEUB 1A5XA 1ZBLA 3KLHA 3AA3A 1C0FA 2FBTA 2FF3B 5CYQA 3M8RA 1QE1A 4MFBA 3VEWA 4FZXC 3V1QA 5GIOA 3DAWA 1VSEA 3MX2A 4LF7K 2QWQA 4JKAA 4BY9C 4J2DA 4FWQA 4FJHA 3PO5A 4O5BA 3QIOA 3DOKA 4DSLA 1NGBA 4CHPA 1GOAA 4KHPK 4CK2A 2YNFA 3SBTA 3CCSN 3JS6A 3FZFA 4M3TA 5C10A 3ENHA 2CH5A 4KHUA 5KPTA 4KB0A 2V51B 2D0PA 3SMPA 4FZYA 1WSHA 1WAJA 1NMNA 2YV0X 1EXQA 2BH1A 2Q0RA 4BE0A 4CHZA 3EO3A 4LD0A 3OYGA 2Z1HA 4CZFA 4HUGA 4JI2K 4IWVA 2YHBA 1NK4A 3J80O 1LV5A 2HMPA 3V9UA 4M42A 3NF6A 5JMVA 1J54A 4KTQA 3P4IA 3RR7A 4J8FA 3NDKA 2O8BB 4CF9A 3AVNA 5KPRA 2E4LA 2O4GA 1BUPA 4A2AA 1VSFA 4CE9A 1IBLK 5E84A 4FWSA 1Y97A 2XO7A 2BUPA 3G10A 1VQ4N 2F8SA 1KVCA 1Z6RA 4BE1A 1NWKA 2ZF5O 4CZMA 1VK0A 3LP2A 2G8FA 5GAHP 1BWFO 4CJ4A 4IOCL 4BRCA 4CF1A 2F4VK 3AY9A 3NH2A 4RW4A 2KQ2A 4CFBA 3TR8A 3A5MC 3L8BA 4PL7A 4M3ZA 3KLEA 3OYHA 2YJEA 4AILC 3A8YA 2OTLN 1QHAA 2Q2RA 3P5JA 4IO9L 3O9RA 1IKWA 1K8AO 3NVMA 3VEVA 3UKRA 3PX4A 4W5TA 1RBTA 1X9WA 2JGUA 1T6DA 5EXWA 3CCLN 3AA4A 1C6VA 2RKIA 4H4MA 4YFUA 1VQLN 1A5WA 3VGKA 1KSPA 3L3VA 2P9NA 2KKZA 2I7NA 1WLJA 4V19S 4JI1K 3WEEB 4CHYA 3I0SA 1LWEA 4JHDB 4JI8K 4CGDA 1LAWA 3WXKA 3O5BA 3VQ8A 5AFUA 1NGEA 3ZSQA 3EZWA 2E2PA 3RSEA 1RT6A 3WQTA 3U3GA 1QZ5A 1BG3A 4OLBA 3O6WA 3VGLA 3OYEA 4FLTA 1GOCA 4N47A 1UA1A 3L6QA 1RDWX 4DUZK 4LFCK 1NGFA 3LP1A 1JLBA 3VEZA 2ASOA 2FBVA 3OYDA 3SYZA 1O1WA 3Q7CA 1C0MA 3VQ6A 4BR7A 4BRLA 2GX9A 4DV4K 3OVNA 4G9ZA 1BCOA 4Y1CA 3V9ZA 2XY5A 2KTQA 4DSIA 3CM5A 4NO7A 1RBSA 4CF8A 3CPWM 2RN2A 2P51A 3ULDA 1REVA 1JLEA 3ZETA 3R6MA 4FJ5A 1LCUA 2D0AA 4HTUA 5BRFA 3EE9A 3PX0A 1HYZA 3NAEA 2R7YA 1W0HA 5AFUH 3VEOA 4FPAA 4B9MA 3R3LA 4O5FA 4FXDA 5M1QA 1ESVA 1LW2A 1BIZA 3CMEN 4F4KA 2GBZA 4KREA 1ATRA 3FLCO 4FPBA 1YI2N 2RF2A 2OANA 4MO5A 4KTWA 1DTQA 4BRKA 5C15A 3O4WA 4AHTA 3THXA 5DK5A 4HWIA 1U04A 1P8ZA 3CJAA 2F7TA 2Q3SA 4N5SA 1GOBA 1WSEA 4H0VB 3MECA 1KVBA 1KQSM 1D9DA 4PKHA 3QEPA 1DGKN 4C1NI 3M8PA 3O3HA 2I5JA 4IZ9A 3KD1E 2X78A 1T6CA 5AQGA 1JL1A 4NLCA 4BGAA 3OTOK 4NXNK 4ILHA 4WF9L 3HVTA 1KTQA 3T1YK 1CZBA 1LWFA 3NCIA 1Z25A 1RGIA 2E20A 3O3GA 2P1JA 4Z4HA 1BO5O 2HB5A 2G8WA 5IWAK 2HBKA 4DFPA 4RW8A 4MDBA 2P9SB 2ZE2A 5B8HA 1IO2A 1UAXA 1QSSA 1EP4A 5GAEP 3L4QA 3MEDA 4RCHA 3L2QA 1HNZK 3VF2A 5H1SQ 3O08A 3UB5A 3VQCA 1SS6A 1K73O 2W6KA 1R59O 2LSNA 5HRPA 2FBXA 2OPQA 2D1KA 5AQZA 1S1TA 2O8DB 3ULEB 4CHQA 2HMIA 4H0PA 4O8KA 5AQOA 3WNGA 1TUUA 4OJRA 3LDSA 2NRTA 3LANA 4A61A 4AM7A 3BDPA 2ZWHA 2NRWA 4K8ZA 2HHVA 3ATVA 1NKBA 1ZBIA 1CXQA 3WXLA 4ISFA 4JI6K 4DG1A 3S3OA 3CF5L 3LDPA 2O4IA 3SK3A 4JK7A 4MQ3A 4B3RK 1BISA 4WCEL 1OH7A 1HRHA 3MK6A 2P9IA 4WQ4A 4OPAA 4H0TB 3MWTA 3TI0A 1GLBG 4YOVA 3GBTA 3QMLA 4B9NA 2YCHA 3MEEA 3DLEA 2FSKA 4CHOA 2VWJA 2PYJA 5GADP 4FW2A 4KI6A 4B1UB 1WOQA 3VTIA 2GV9A 1NJXA 2ZM6K 3CQ8A 3V4IA 4CZEA 4YOTA 4DS5A 4LF4K 1S9GA 4BC2A 4JKCA 4E0DA 3I33A 5EVZA 5JVHL 3WT0A 3EY1A 1U2VB 3E9LA 4DR5K 5HL7L 2KLAA 4Z4FA 4GKKK 2CGKA 3FZHA 4ISEA 2OPPA 3DXMA 2YI1A 4L8RB 1HR0K 3VF4A 1XC9A 5FPEA 1JLAA 3G71N 5LY3A 3T19A 3SQ1A 1RTDA 1NGJA 4DFKA 1C0GA 4PY5A 2IC3A 1WAFA 4MO4A 3LWLA 5AQFA 3IDHA 2RPIA 1NK0A 5BPMA 1SL2A 1VSKA 1WUAA 2ZD1A 3VA0A 1RT7A 1YF5L 3PV8A 3ENOA 2PBDA 4O4GA 3AGKA 1S1UA 4N56A 3CPEA 3T69A 3VF6A 1S6QA 5LJWA 1EX4A 2P5GA 5AQMA 2QWMA 3D2EB 3CJ1A 3O1BA 4B08A 3A5OC 4B9VA 3SLCA 2IVOA 2WFBA 2PAVA 4ILGB 4DTJA 4BRNA 1S22A 4CJFA 4DTPA 3BY5A 1QQOA 3J7YP 2O8EB 3C7NB 3BZCA 1VSMA 1BOTO 1L3UA 5E41A 5EOYA 4DLEA 4BG8A 4JI4K 5I3UA 2DFEA 4DR3K 3F5TA 4W5QA 4DV1K 5M1FA 3SAFA 1KAYA 3N4PA 4I9LA 1YIJN 2ITGA 4NCBA 1IBMK 1BU6O 5KPZA 3BF3A 3JSMA 4NCAA 4BWJA 1TK8A 2BGGA 4JI7K 1VSHA 4Z4CA 5FPNA 4HUFA 3THYB 2EHGA 3K5OA 3VOVA 1LAVA 4DV2K 1CZ9A 4HUEA 4OLAA 5JICA 2H3GX 4GMJB 4JKFA 3QNOA 4DF4A 5TKWA 2BTFA 4DR7K 4CJRA 1DT9A 3QICA 4YOYA 4DSKA 4LFAK 3KIOA 3THWB 4FJKA 2KHOA 2YKMA 3C65A 3H1VX 4WFAL 1QSYA 5CY4A 3CCVN 3DRSA 4O55A 1L3VA 2D0BA 4IFYA 3OYAA 1P90A 4C8OA 4CHNA 3PSIA 1F21A 3QO9A 3NHGA 2QKBA 1BHLA 2XHBA 2QWOA 4F9OA 3TAPA 3JYTA 3SUNA 1ZBUA 5A2QO 1KFSA 3ID6A 3D45A 4LC9B 3B6PA 4FLWA 3AO1A 4B1VA 4X62K 5C24A 4JNEA 1NGHA 4ICLA 4CJKA 3LDNA 2PYLA 4CJTA 1TKXA 4BR9A 3I55N 3WXJA 4I6MA 3MCPA 3ZLJA 3HXMA 3FZLA 3ZT3A 1ZBFA 1KAXA 4KB1A 3MXMA 3BZKA 4B3SK 3F73A 5GINA 3O1WA 2XY6A 1HNWK 1TK0A 3TSPA 1VQMN 3O80A 2E6LA 5HRRA 1CXUA 3K58A 3EKSA 4F8RA 2IVNA 2P9UA 1XHXA 4BC5A 1TVRA 2W41A 4B9QA 1G15A 2E2QA 4DWIA 3I0RA 2ZQBA 5JLHA 1X9JA 3OBYA 1NJZA 4DR6K 4GVEA 2V52B 1XNRK 1Z05A 1NGIA 5AQWA 4KTZA 3ZSOA 3OYJA 1IJJA 1TKZA 3TARA 2IGIA 3R8EA 4XEIA 4BREA 2UUCK 4B8AB 1EKEA 4CEZA 4KH4A 2IDOA 3F9KA 4LF5K 4KO0A 4ELTA 3HSTB 4M63C 2D5RA 3H3NO 3B8AX 1B9FA 1NKCA 4J2BA 2A6AA 3QBXA 5DM6L
chains in the Genus database with same CATH topology
3AA4A 1C6VA 2RKIA 4H4MA 4C8NA 4YFUA 3HVRA 4FLZA 1BL3A 1A5WA 1HPZA 3MXIA 3M8SA 3LWMA 4QCLA 1KSPA 1NK7A 2A1SA 3L3VA 3TAEA 3SQ0A 5D3GA 3KK1A 3K5NA 1WLJA 4RW6A 4FM2A 1RDBA 3H08A 4WE1A 1L5UA 4IG3A 4CHYA 4KI4A 3I0SA 4PA1A 5EU7A 4DLGA 1LWEA 4Z0UA 3VQPA 2W42A 3CYMA 3QETA 4FJNA 4CFCA 4CGDA 1LAWA 2XRIA 3VQ8A 1N6QA 4DSJA 3NGIA 3ZSQA 3AVAA 1QHTA 4G1QA 4R5PA 3SCXA 2G8KA 2AJQA 2VG5A 1RT6A 4KHYA 1C1AA 3U3GA 4BACA 4FLUA 3NGZA 4OLBA 3KLFA 2PY5A 3OYEA 2KFZA 3A2FA 3AVKA 1GOCA 4N47A 5KRTA 3K57A 4FLTA 1UA1A 2D0CA 4CEFA 2PZSA 3QLHA 4DTRA 3LP1A 4FVMA 1JLBA 5JS1A 3C6UA 1S1XA 1JLFA 2FBVA 3AVCA 3VQQA 3OYDA 3SYZA 2G8UA 1O1WA 3S3MA 3LZIA 3SPYA 1C0MA 4BDYA 1U47A 3VQ6A 2G8IA 4I2PA 3T3FA 4E7KA 3OVNA 1TAQA 1BCOA 2FC0A 4Y1CA 3LAKA 3V9ZA 2XY5A 2YNIA 3DMJA 3G0ZA 3HK2A 2QKKA 4KRFA 2KTQA 5T7BA 3QEWA 2YKNA 2BDPA 3CM5A 4DSIA 3HYFA 5HLFA 1RBSA 2HNDA 4CF8A 1HJRA 3VA3A 1L3TA 3AVMA 2RN2A 2P51A 2ETJA 3ULDA 1REVA 1JLEA 3TAFA 2OYQA 3DYAA 4EP4A 4FJ5A 4TSXA 2D0AA 4OVLA 3LPUA 4HTUA 4I7FA 3C95A 1ZBHA 1NOZA 4E1NA 4F2SA 1SKRA 1WN7A 3PX0A 3OYKA 4OKKA 1HYZA 4CK1A 4BDPA 5KI6A 1HNVA 3NAEA 2R7YA 4PWDA 1W0HA 3ZCMA 1FK9A 4FW1A 4B9MA 3HJFA 1SL0A 4O0JA 1C0TA 1S1VA 5J2QA 3V9SA 4C8KA 3RWUA 1LW2A 4FXDA 1BIZA 4F4KA 2GBZA 3OYBA 3QESA 1J53A 3M8QA 4KREA 3PX6A 1KFDA 2VWKA 3VQBA 1U45A 1TKDA 4JS5A 2Z1IA 2RF2A 4JS4A 3ZT4A 4KHNA 5KGWA 2DY4A 4KTWA 1DTQA 1JLGA 3QINA 3E01A 4CF0A 3KKSA 1LWCA 3KK2A 1YTAA 4AHTA 4E89A 4B3OA 4FLXA 1B92A 5DK5A 1RBUA 3IAYA 3V1OA 1U04A 4O44A 1Q9XA 1NK6A 3RRHA 4FYDA 2Q3SA 4LSLA 1IKXA 5KRSA 3LP0A 1GOBA 1WSEA 3TAMA 3MECA 1A5VA 1KVBA 4N5SA 3O3FA 1N5YA 1D9DA 4ELVA 4DS4A 4RG8A 2OPRA 3V1RA 3QEPA 2KFNA 4N41A 3VQDA 1VSDA 4ID5A 4B9SA 2ATQA 3QEXA 3M8PA 3O3HA 2I5JA 2DFFA 1VRTA 3TAGA 3RMBA 4E7HA 3RMAA 3V6DA 3KD1E 3SQ4A 2X78A 3AVHA 3RTVA 1BCMA 1JL1A 1RT5A 4FJIA 4FJJA 1JLQA 5J1EA 2P5OA 1VSIA 1BI4A 3D0PA 1RBVA 4JRPA 4DFJA 3HVTA 1KTQA 1KRPA 3OJUA 1CZBA 1LWFA 3ZSYA 3ZT0A 4CJUA 1Z25A 3NCIA 3K5MA 1VSLA 2Z1GA 4H8KA 2F8TA 3ALYA 2HVHA 3O3GA 4NYNA 3LZJA 2P1JA 1TK5A 3NF8A 4Z4HA 3SV3A 3QEVA 1DLOA 2HB5A 3SV4A 2G8WA 4CGGA 1YTUA 1RDAA 1WSIA 4AH9A 4DFPA 3DLGA 4RW8A 3HP6A 3ZSVA 3P1GA 3OS0A 1SL1A 3OYNA 4KAZA 3IS9A 4CIEA 1MU2A 2ZE2A 1ASVA 3C94A 3NBPA 4LH4A 3ZT1A 1IO2A 1UAXA 1QSSA 3DLHA 4AHCA 3HM9A 3VQ5A 4IBNA 1EP4A 3ZT2A 3MEDA 3L2QA 3NE6A 3NGYA 1TKTA 3VQCA 1BQNA 4N76A 3DRPA 3OYLA 3VQ4A 4E7IA 1L3SA 2LSNA 4YNQA 4HCCA 4RW9A 2FBXA 5HRPA 4CEOA 2Z1JA 4CFDA 4FJ9A 4CJQA 1C0UA 1HYVA 2OPQA 3IG1A 1NJWA 4DQPA 3S3NA 1UWBA 4B9UA 3L2VA 1S1TA 1T05A 3AO4A 3K5LA 2IAJA 3UIQA 4CHQA 1TAUA 2HMIA 2DTUA 4JLHA 1T7PA 4Q5VA 3WNGA 3KJVA 3SI6A 2X6SA 4OJRA 4OKJA 4H4OA 3LDSA 4FLYA 3LANA 1U49A 2KZZA 1HYSA 3IRXA 1J9AA 3FFIA 2IS3A 3BDPA 3EZ5A 3VQEA 4BE2A 1T8EA 3AO5A 5SZTA 5HRNA 4DTMA 2GUIA 4XIUA 2OZSA 4K8ZA 2HHVA 2IOCA 1NK8A 1NKBA 3MXJA 1UOCA 1ZBIA 1CXQA 4ELUA 4LH5A 4FM0A 2YNHA 1CLQA 4DG1A 3V81A 3S3OA 4KHWA 3SJJA 2HNZA 2O4IA 1RT4A 3CG7A 1JXBA 4MQ3A 1BISA 2HHQA 3AVFA 3HPOA 4FJ7A 4CFAA 1HRHA 1XWLA 5JS2A 4DTSA 1TL1A 2QXFA 3TI0A 3SNNA 1SKSA 3WNHA 2HVIA 4B9NA 3MEEA 3DLEA 4CHOA 5J2NA 3HL8A 2VWJA 2PYJA 3DLBA 4E1MA 1RILA 4FW2A 4KI6A 2X74A 3L2UA 3VN5A 1TV6A 3O4QA 4FLVA 1QQCA 3PY8A 1I3AA 2GV9A 1NJXA 3S9HA 4FK0A 3CQ8A 3AVGA 4E3SA 3V4IA 4AHSA 4DS5A 1T03A 4OPKA 4M45A 1KVAA 3HPGA 1S9GA 1NK9A 4E0DA 2BE2A 4CJVA 1BGXT 1WSJA 1JXEA 3OY9A 5C25A 4FCYA 2HHUA 4CF2A 3CFOA 3EY1A 4FM1A 4DF8A 3THVA 1HQEA 4AHRA 1RT3A 1W9HA 2HNYA 4Z4FA 5KGXA 1KLNA 4CJ5A 3SPZA 3OYFA 2XY8A 1IKVA 2VG7A 5HP1A 4LSNA 2JLEA 2OPPA 3OS2A 2KZMA 3L2RA 3AV9A 4L8RB 4AHUA 1ITGA 3CM6A 4LY7A 1XC9A 3AO2A 1JLAA 3T19A 3SQ1A 1FKOA 3QIPA 1ASWA 4DFKA 1RTDA 4F2RA 4PUOA 4PY5A 2IC3A 1WAFA 3DI6A 4HHTA 5CYMA 3OYIA 2DFHA 3LWLA 1RBRA 4AHVA 2RPIA 4M41A 4FJXA 3SUPA 4I2QA 1NK0A 1SL2A 1VSKA 4CESA 3TANA 3T1AA 2ZD1A 3VA0A 1RT7A 3PV8A 4CECA 4Z4GA 4E19A 5C42A 1WSGA 4O4GA 1RCHA 1UA0A 1NJYA 3QEIA 1S1UA 3RRGA 2WONA 3V9XA 4N56A 3HT3A 1XHZA 4CJEA 4FZZA 1WNSA 1S5JA 4KV8A 4NYFA 1DTTA 4RW7A 3AO3A 3RR8A 1S6QA 1C1BA 1EX4A 4E7LA 1SKWA 1TGOA 2P5GA 4KPYA 4M3UA 4E7JA 4DTXA 4DTOA 4FK2A 4IG0A 4CJLA 4W5RA 4JRQA 1JL2A 2A1RA 2WOMA 1K6YA 4Y1DA 3L3UA 1FXXA 4DQRA 2G8VA 2E6MA 3CFPA 4B08A 5K14A 4DSFA 2NUBA 4B9VA 4J2AA 3RMCA 3QERA 2EX3A 3LPTA 4ZTFA 1QSLA 3B6OA 4DTJA 3LAMA 4ID1A 1FKPA 3K59A 1D8YA 4CJFA 1IKYA 4DTPA 3DLKA 3AVJA 4KFBA 2HHWA 3OYCA 1IH7A 3HPHA 4F3TA 4UQGA 3EYZA 1B9DA 4M3XA 1VSMA 3TAQA 4C8MA 5HROA 1X9MA 1YT3A 1L3UA 4DMNA 5E41A 4CEBA 4DLEA 4CGFA 5J2MA 1WSFA 2VG6A 3NH0A 5FRNA 5I3UA 2DFEA 3K2PA 4NCGA 1XI1A 4OKEA 4CGJA 4DU4A 4CJ3A 2Y1JA 5DMRA 1SUQA 3OS1A 4W5QA 3AA2A 3AA5X 3AVIA 1KCFA 5J2PA 1JKHA 2B5JA 4OGEA 1VSJA 1ZYQA 4B8CA 4I9LA 4CGHA 4CGIA 1NKEA 2HW3A 2XY7A 4QAGA 1EETA 3QNNA 2ITGA 4NCBA 2HHXA 3ZSWA 2OA8A 4DU1A 5KTQA 4CEDA 4EP5A 1RT2A 1U4BA 1KLMA 1QS4A 3JSMA 3AVLA 4BWJA 4NCAA 1HNIA 1TK8A 4HCBA 4I9QA 4C8LA 2BGGA 1JLCA 1VSHA 4KKOA 4CJPA 4ZHRA 3WNEA 1C1CA 4Z4CA 1X1PA 3MAQA 3DOLA 4HUFA 2EHGA 3K5OA 3RMDA 1RTHA 3NF7A 3ZSZA 1X9SA 1LAVA 3OYMA 3KTQA 4CIFA 4F3OA 4DQQA 3KLGA 1CZ9A 2F96A 2YHAA 4CEQA 4HUEA 4OLAA 2B6AA 1BI4B 1LW0A 4CCHA 4OGCA 4GMJB 3QNOA 4DF4A 1ASUA 1RDDA 4CJRA 3ISNC 5HRSA 3DRRA 3C6TA 1D5AA 4EZ9A 4DSKA 2QK9A 4HVJA 3KIOA 4KHQA 2G8HA 3P83D 3KKRA 4FJKA 2YKMA 1A5XA 4DTUA 1ZBLA 3KLHA 3HO1A 3AA3A 4M3RA 4O0IA 2FBTA 4IKFA 1Z26A 3PO4A 2BANA 5CYQA 3M8RA 1S9EA 4IFVA 1QSYA 1QE1A 5CY4A 1L3VA 3DRSA 4MFBA 4O55A 3WNFA 4QOZB 4FZXC 5I42A 2D0BA 3V1QA 5FDLA 4IFYA 4CEEA 1VSEA 3KLIA 1VRUA 3OYAA 4J2DA 4C8OA 4CHNA 3I8DA 3MEGA 4FJHA 4J2EA 3PO5A 2B4JA 4O5BA 3DM2A 3QIOA 3DOKA 1F21A 3QO9A 5HBMA 1IG9A 4DSLA 3AVBA 4FJ8A 4CHPA 5SWMA 3NF9A 1GOAA 4CK2A 1RNHA 2YNFA 3NHGA 2QKBA 1BHLA 2YNGA 2XHBA 4M3TA 1I39A 1HMVA 3BGRA 3SUOA 4DQSA 4M3WA 3TAPA 4KHUA 2KW4A 3SZ2A 1S1WA 3JYTA 3SUNA 1ZBUA 4Z4IA 4DSEA 5CZ2A 3NH1A 4KB0A 2X6NA 3CFRA 1KFSA 4CEAA 1BIUA 3D45A 4FZYA 4FJGA 1WSHA 1WAJA 3B6PA 4FLWA 3AO1A 2YV0X 3V9WA 1EXQA 3VQAA 3ZSXA 4CIGA 5C24A 4BE0A 4ICLA 4CHZA 4CJKA 4ZTJA 2PYLA 3LALA 4CJTA 4LD0A 3OYGA 1TKXA 2Z1HA 3O4NA 4IDKA 1RTJA 4HUGA 4CJWA 1QTMA 1J5OA 3ZSRA 4B9LA 2YHBA 4CK3A 3HXMA 1NK4A 1LV5A 3ZT3A 3V9UA 4M42A 3NF6A 1J54A 4KTQA 1ZBFA 4CJSA 4KB1A 3RR7A 3MXMA 3NDKA 2FBYA 3VQ7A 4W5NA 1RTIA 4CF9A 4BDZA 3AVNA 4BWMA 4B9TA 2HHSA 3L2WA 3F73A 1BQMA 4M3YA 2XY6A 2E4LA 2O4GA 1NK5A 4DTNA 4EZ6A 1TK0A 4FK4A 3HP9A 1D9FA 1VSFA 4CE9A 4K8XA 2E6LA 3VQ9A 5HRRA 1CXUA 3K58A 4F8RA 1R0AA 1RDCA 3ASMA 1Y97A 1YVUA 1S6PA 2XO7A 1XHXA 1TVRA 2OPSA 3G10A 3OJSA 5CZ1A 1RT1A 3ITHA 1G15A 2F8SA 1KVCA 4DWIA 3I0RA 3DLRA 1U48A 2ZQBA 4BE1A 5FROA 3SUQA 1NJZA 3PUFA 1NOYA 2OZMA 1VK0A 4Z4EA 3LP2A 2G8FA 3U6FA 4W5OA 2Y1IA 4CJ4A 3KK3A 1SV5A 4KTZA 4CF1A 1HQUA 3ZSOA 1Q9YA 4Q0BA 3NH2A 4KHSA 4OPJA 3OYJA 4RW4A 1TKZA 2KQ2A 2IGIA 3TARA 4CFBA 4DFMA 3KD5E 2HHTA 3SQ2A 4B8AB 1Q8IA 3TR8A 3TABA 4GVMA 3NFAA 1EKEA 3L8BA 4CEZA 4M3ZA 3KLEA 1TL3A 3OYHA 2IDOA 3LP3A 3F9KA 4KO0A 4AILC 4ELTA 4FJLA 3HSTB 4DQIA 4PQUA 2D5RA 3P5JA 4DU3A 4FJMA 5FRMA 1IKWA 3U3YA 1B9FA 3PX4A 4W5TA 1NKCA 4J2BA 1RBTA 1X9WA 2JGUA 4GW6A 3TWHA 4CERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA4 A;  1C6V A;  2RKI A;  4H4M A;  4C8N A;  4YFU A;  3HVR A;  4FLZ A;  1BL3 A;  1A5W A;  1HPZ A;  3MXI A;  3M8S A;  3LWM A;  4QCL A;  1KSP A;  1NK7 A;  2A1S A;  3L3V A;  3TAE A;  3SQ0 A;  5D3G A;  3KK1 A;  3K5N A;  1WLJ A;  4RW6 A;  4FM2 A;  1RDB A;  3H08 A;  4WE1 A;  1L5U A;  4IG3 A;  4CHY A;  4KI4 A;  3I0S A;  4PA1 A;  5EU7 A;  4DLG A;  1LWE A;  4Z0U A;  3VQP A;  2W42 A;  3CYM A;  3QET A;  4FJN A;  4CFC A;  4CGD A;  1LAW A;  2XRI A;  3VQ8 A;  1N6Q A;  4DSJ A;  3NGI A;  3ZSQ A;  3AVA A;  1QHT A;  4G1Q A;  4R5P A;  3SCX A;  2G8K A;  2AJQ A;  2VG5 A;  1RT6 A;  4KHY A;  1C1A A;  3U3G A;  4BAC A;  4FLU A;  3NGZ A;  4OLB A;  3KLF A;  2PY5 A;  3OYE A;  2KFZ A;  3A2F A;  3AVK A;  1GOC A;  4N47 A;  5KRT A;  3K57 A;  4FLT A;  1UA1 A;  2D0C A;  4CEF A;  2PZS A;  3QLH A;  4DTR A;  3LP1 A;  4FVM A;  1JLB A;  5JS1 A;  3C6U A;  1S1X A;  1JLF A;  2FBV A;  3AVC A;  3VQQ A;  3OYD A;  3SYZ A;  2G8U A;  1O1W A;  3S3M A;  3LZI A;  3SPY A;  1C0M A;  4BDY A;  1U47 A;  3VQ6 A;  2G8I A;  4I2P A;  3T3F A;  4E7K A;  3OVN A;  1TAQ A;  1BCO A;  2FC0 A;  4Y1C A;  3LAK A;  3V9Z A;  2XY5 A;  2YNI A;  3DMJ A;  3G0Z A;  3HK2 A;  2QKK A;  4KRF A;  2KTQ A;  5T7B A;  3QEW A;  2YKN A;  2BDP A;  3CM5 A;  4DSI A;  3HYF A;  5HLF A;  1RBS A;  2HND A;  4CF8 A;  1HJR A;  3VA3 A;  1L3T A;  3AVM A;  2RN2 A;  2P51 A;  2ETJ A;  3ULD A;  1REV A;  1JLE A;  3TAF A;  2OYQ A;  3DYA A;  4EP4 A;  4FJ5 A;  4TSX A;  2D0A A;  4OVL A;  3LPU A;  4HTU A;  4I7F A;  3C95 A;  1ZBH A;  1NOZ A;  4E1N A;  4F2S A;  1SKR A;  1WN7 A;  3PX0 A;  3OYK A;  4OKK A;  1HYZ A;  4CK1 A;  4BDP A;  5KI6 A;  1HNV A;  3NAE A;  2R7Y A;  4PWD A;  1W0H A;  3ZCM A;  1FK9 A;  4FW1 A;  4B9M A;  3HJF A;  1SL0 A;  4O0J A;  1C0T A;  1S1V A;  5J2Q A;  3V9S A;  4C8K A;  3RWU A;  1LW2 A;  4FXD A;  1BIZ A;  4F4K A;  2GBZ A;  3OYB A;  3QES A;  1J53 A;  3M8Q A;  4KRE A;  3PX6 A;  1KFD A;  2VWK A;  3VQB A;  1U45 A;  1TKD A;  4JS5 A;  2Z1I A;  2RF2 A;  4JS4 A;  3ZT4 A;  4KHN A;  5KGW A;  2DY4 A;  4KTW A;  1DTQ A;  1JLG A;  3QIN A;  3E01 A;  4CF0 A;  3KKS A;  1LWC A;  3KK2 A;  1YTA A;  4AHT A;  4E89 A;  4B3O A;  4FLX A;  1B92 A;  5DK5 A;  1RBU A;  3IAY A;  3V1O A;  1U04 A;  4O44 A;  1Q9X A;  1NK6 A;  3RRH A;  4FYD A;  2Q3S A;  4LSL A;  1IKX A;  5KRS A;  3LP0 A;  1GOB A;  1WSE A;  3TAM A;  3MEC A;  1A5V A;  1KVB A;  4N5S A;  3O3F A;  1N5Y A;  1D9D A;  4ELV A;  4DS4 A;  4RG8 A;  2OPR A;  3V1R A;  3QEP A;  2KFN A;  4N41 A;  3VQD A;  1VSD A;  4ID5 A;  4B9S A;  2ATQ A;  3QEX A;  3M8P A;  3O3H A;  2I5J A;  2DFF A;  1VRT A;  3TAG A;  3RMB A;  4E7H A;  3RMA A;  3V6D A;  3KD1 E;  3SQ4 A;  2X78 A;  3AVH A;  3RTV A;  1BCM A;  1JL1 A;  1RT5 A;  4FJI A;  4FJJ A;  1JLQ A;  5J1E A;  2P5O A;  1VSI A;  1BI4 A;  3D0P A;  1RBV A;  4JRP A;  4DFJ A;  3HVT A;  1KTQ A;  1KRP A;  3OJU A;  1CZB A;  1LWF A;  3ZSY A;  3ZT0 A;  4CJU A;  1Z25 A;  3NCI A;  3K5M A;  1VSL A;  2Z1G A;  4H8K A;  2F8T A;  3ALY A;  2HVH A;  3O3G A;  4NYN A;  3LZJ A;  2P1J A;  1TK5 A;  3NF8 A;  4Z4H A;  3SV3 A;  3QEV A;  1DLO A;  2HB5 A;  3SV4 A;  2G8W A;  4CGG A;  1YTU A;  1RDA A;  1WSI A;  4AH9 A;  4DFP A;  3DLG A;  4RW8 A;  3HP6 A;  3ZSV A;  3P1G A;  3OS0 A;  1SL1 A;  3OYN A;  4KAZ A;  3IS9 A;  4CIE A;  1MU2 A;  2ZE2 A;  1ASV A;  3C94 A;  3NBP A;  4LH4 A;  3ZT1 A;  1IO2 A;  1UAX A;  1QSS A;  3DLH A;  4AHC A;  3HM9 A;  3VQ5 A;  4IBN A;  1EP4 A;  3ZT2 A;  3MED A;  3L2Q A;  3NE6 A;  3NGY A;  1TKT A;  3VQC A;  1BQN A;  4N76 A;  3DRP A;  3OYL A;  3VQ4 A;  4E7I A;  1L3S A;  2LSN A;  4YNQ A;  4HCC A;  4RW9 A;  2FBX A;  5HRP A;  4CEO A;  2Z1J A;  4CFD A;  4FJ9 A;  4CJQ A;  1C0U A;  1HYV A;  2OPQ A;  3IG1 A;  1NJW A;  4DQP A;  3S3N A;  1UWB A;  4B9U A;  3L2V A;  1S1T A;  1T05 A;  3AO4 A;  3K5L A;  2IAJ A;  3UIQ A;  4CHQ A;  1TAU A;  2HMI A;  2DTU A;  4JLH A;  1T7P A;  4Q5V A;  3WNG A;  3KJV A;  3SI6 A;  2X6S A;  4OJR A;  4OKJ A;  4H4O A;  3LDS A;  4FLY A;  3LAN A;  1U49 A;  2KZZ A;  1HYS A;  3IRX A;  1J9A A;  3FFI A;  2IS3 A;  3BDP A;  3EZ5 A;  3VQE A;  4BE2 A;  1T8E A;  3AO5 A;  5SZT A;  5HRN A;  4DTM A;  2GUI A;  4XIU A;  2OZS A;  4K8Z A;  2HHV A;  2IOC A;  1NK8 A;  1NKB A;  3MXJ A;  1UOC A;  1ZBI A;  1CXQ A;  4ELU A;  4LH5 A;  4FM0 A;  2YNH A;  1CLQ A;  4DG1 A;  3V81 A;  3S3O A;  4KHW A;  3SJJ A;  2HNZ A;  2O4I A;  1RT4 A;  3CG7 A;  1JXB A;  4MQ3 A;  1BIS A;  2HHQ A;  3AVF A;  3HPO A;  4FJ7 A;  4CFA A;  1HRH A;  1XWL A;  5JS2 A;  4DTS A;  1TL1 A;  2QXF A;  3TI0 A;  3SNN A;  1SKS A;  3WNH A;  2HVI A;  4B9N A;  3MEE A;  3DLE A;  4CHO A;  5J2N A;  3HL8 A;  2VWJ A;  2PYJ A;  3DLB A;  4E1M A;  1RIL A;  4FW2 A;  4KI6 A;  2X74 A;  3L2U A;  3VN5 A;  1TV6 A;  3O4Q A;  4FLV A;  1QQC A;  3PY8 A;  1I3A A;  2GV9 A;  1NJX A;  3S9H A;  4FK0 A;  3CQ8 A;  3AVG A;  4E3S A;  3V4I A;  4AHS A;  4DS5 A;  1T03 A;  4OPK A;  4M45 A;  1KVA A;  3HPG A;  1S9G A;  1NK9 A;  4E0D A;  2BE2 A;  4CJV A;  1BGX T;  1WSJ A;  1JXE A;  3OY9 A;  5C25 A;  4FCY A;  2HHU A;  4CF2 A;  3CFO A;  3EY1 A;  4FM1 A;  4DF8 A;  3THV A;  1HQE A;  4AHR A;  1RT3 A;  1W9H A;  2HNY A;  4Z4F A;  5KGX A;  1KLN A;  4CJ5 A;  3SPZ A;  3OYF A;  2XY8 A;  1IKV A;  2VG7 A;  5HP1 A;  4LSN A;  2JLE A;  2OPP A;  3OS2 A;  2KZM A;  3L2R A;  3AV9 A;  4L8R B;  4AHU A;  1ITG A;  3CM6 A;  4LY7 A;  1XC9 A;  3AO2 A;  1JLA A;  3T19 A;  3SQ1 A;  1FKO A;  3QIP A;  1ASW A;  4DFK A;  1RTD A;  4F2R A;  4PUO A;  4PY5 A;  2IC3 A;  1WAF A;  3DI6 A;  4HHT A;  5CYM A;  3OYI A;  2DFH A;  3LWL A;  1RBR A;  4AHV A;  2RPI A;  4M41 A;  4FJX A;  3SUP A;  4I2Q A;  1NK0 A;  1SL2 A;  1VSK A;  4CES A;  3TAN A;  3T1A A;  2ZD1 A;  3VA0 A;  1RT7 A;  3PV8 A;  4CEC A;  4Z4G A;  4E19 A;  5C42 A;  1WSG A;  4O4G A;  1RCH A;  1UA0 A;  1NJY A;  3QEI A;  1S1U A;  3RRG A;  2WON A;  3V9X A;  4N56 A;  3HT3 A;  1XHZ A;  4CJE A;  4FZZ A;  1WNS A;  1S5J A;  4KV8 A;  4NYF A;  1DTT A;  4RW7 A;  3AO3 A;  3RR8 A;  1S6Q A;  1C1B A;  1EX4 A;  4E7L A;  1SKW A;  1TGO A;  2P5G A;  4KPY A;  4M3U A;  4E7J A;  4DTX A;  4DTO A;  4FK2 A;  4IG0 A;  4CJL A;  4W5R A;  4JRQ A;  1JL2 A;  2A1R A;  2WOM A;  1K6Y A;  4Y1D A;  3L3U A;  1FXX A;  4DQR A;  2G8V A;  2E6M A;  3CFP A;  4B08 A;  5K14 A;  4DSF A;  2NUB A;  4B9V A;  4J2A A;  3RMC A;  3QER A;  2EX3 A;  3LPT A;  4ZTF A;  1QSL A;  3B6O A;  4DTJ A;  3LAM A;  4ID1 A;  1FKP A;  3K59 A;  1D8Y A;  4CJF A;  1IKY A;  4DTP A;  3DLK A;  3AVJ A;  4KFB A;  2HHW A;  3OYC A;  1IH7 A;  3HPH A;  4F3T A;  4UQG A;  3EYZ A;  1B9D A;  4M3X A;  1VSM A;  3TAQ A;  4C8M A;  5HRO A;  1X9M A;  1YT3 A;  1L3U A;  4DMN A;  5E41 A;  4CEB A;  4DLE A;  4CGF A;  5J2M A;  1WSF A;  2VG6 A;  3NH0 A;  5FRN A;  5I3U A;  2DFE A;  3K2P A;  4NCG A;  1XI1 A;  4OKE A;  4CGJ A;  4DU4 A;  4CJ3 A;  2Y1J A;  5DMR A;  1SUQ A;  3OS1 A;  4W5Q A;  3AA2 A;  3AA5 X;  3AVI A;  1KCF A;  5J2P A;  1JKH A;  2B5J A;  4OGE A;  1VSJ A;  1ZYQ A;  4B8C A;  4I9L A;  4CGH A;  4CGI A;  1NKE A;  2HW3 A;  2XY7 A;  4QAG A;  1EET A;  3QNN A;  2ITG A;  4NCB A;  2HHX A;  3ZSW A;  2OA8 A;  4DU1 A;  5KTQ A;  4CED A;  4EP5 A;  1RT2 A;  1U4B A;  1KLM A;  1QS4 A;  3JSM A;  3AVL A;  4BWJ A;  4NCA A;  1HNI A;  1TK8 A;  4HCB A;  4I9Q A;  4C8L A;  2BGG A;  1JLC A;  1VSH A;  4KKO A;  4CJP A;  4ZHR A;  3WNE A;  1C1C A;  4Z4C A;  1X1P A;  3MAQ A;  3DOL A;  4HUF A;  2EHG A;  3K5O A;  3RMD A;  1RTH A;  3NF7 A;  3ZSZ A;  1X9S A;  1LAV A;  3OYM A;  3KTQ A;  4CIF A;  4F3O A;  4DQQ A;  3KLG A;  1CZ9 A;  2F96 A;  2YHA A;  4CEQ A;  4HUE A;  4OLA A;  2B6A A;  1BI4 B;  1LW0 A;  4CCH A;  4OGC A;  4GMJ B;  3QNO A;  4DF4 A;  1ASU A;  1RDD A;  4CJR A;  3ISN C;  5HRS A;  3DRR A;  3C6T A;  1D5A A;  4EZ9 A;  4DSK A;  2QK9 A;  4HVJ A;  3KIO A;  4KHQ A;  2G8H A;  3P83 D;  3KKR A;  4FJK A;  2YKM A;  1A5X A;  4DTU A;  1ZBL A;  3KLH A;  3HO1 A;  3AA3 A;  4M3R A;  4O0I A;  2FBT A;  4IKF A;  1Z26 A;  3PO4 A;  2BAN A;  5CYQ A;  3M8R A;  1S9E A;  4IFV A;  1QSY A;  1QE1 A;  5CY4 A;  1L3V A;  3DRS A;  4MFB A;  4O55 A;  3WNF A;  4QOZ B;  4FZX C;  5I42 A;  2D0B A;  3V1Q A;  5FDL A;  4IFY A;  4CEE A;  1VSE A;  3KLI A;  1VRU A;  3OYA A;  4J2D A;  4C8O A;  4CHN A;  3I8D A;  3MEG A;  4FJH A;  4J2E A;  3PO5 A;  2B4J A;  4O5B A;  3DM2 A;  3QIO A;  3DOK A;  1F21 A;  3QO9 A;  5HBM A;  1IG9 A;  4DSL A;  3AVB A;  4FJ8 A;  4CHP A;  5SWM A;  3NF9 A;  1GOA A;  4CK2 A;  1RNH A;  2YNF A;  3NHG A;  2QKB A;  1BHL A;  2YNG A;  2XHB A;  4M3T A;  1I39 A;  1HMV A;  3BGR A;  3SUO A;  4DQS A;  4M3W A;  3TAP A;  4KHU A;  2KW4 A;  3SZ2 A;  1S1W A;  3JYT A;  3SUN A;  1ZBU A;  4Z4I A;  4DSE A;  5CZ2 A;  3NH1 A;  4KB0 A;  2X6N A;  3CFR A;  1KFS A;  4CEA A;  1BIU A;  3D45 A;  4FZY A;  4FJG A;  1WSH A;  1WAJ A;  3B6P A;  4FLW A;  3AO1 A;  2YV0 X;  3V9W A;  1EXQ A;  3VQA A;  3ZSX A;  4CIG A;  5C24 A;  4BE0 A;  4ICL A;  4CHZ A;  4CJK A;  4ZTJ A;  2PYL A;  3LAL A;  4CJT A;  4LD0 A;  3OYG A;  1TKX A;  2Z1H A;  3O4N A;  4IDK A;  1RTJ A;  4HUG A;  4CJW A;  1QTM A;  1J5O A;  3ZSR A;  4B9L A;  2YHB A;  4CK3 A;  3HXM A;  1NK4 A;  1LV5 A;  3ZT3 A;  3V9U A;  4M42 A;  3NF6 A;  1J54 A;  4KTQ A;  1ZBF A;  4CJS A;  4KB1 A;  3RR7 A;  3MXM A;  3NDK A;  2FBY A;  3VQ7 A;  4W5N A;  1RTI A;  4CF9 A;  4BDZ A;  3AVN A;  4BWM A;  4B9T A;  2HHS A;  3L2W A;  3F73 A;  1BQM A;  4M3Y A;  2XY6 A;  2E4L A;  2O4G A;  1NK5 A;  4DTN A;  4EZ6 A;  1TK0 A;  4FK4 A;  3HP9 A;  1D9F A;  1VSF A;  4CE9 A;  4K8X A;  2E6L A;  3VQ9 A;  5HRR A;  1CXU A;  3K58 A;  4F8R A;  1R0A A;  1RDC A;  3ASM A;  1Y97 A;  1YVU A;  1S6P A;  2XO7 A;  1XHX A;  1TVR A;  2OPS A;  3G10 A;  3OJS A;  5CZ1 A;  1RT1 A;  3ITH A;  1G15 A;  2F8S A;  1KVC A;  4DWI A;  3I0R A;  3DLR A;  1U48 A;  2ZQB A;  4BE1 A;  5FRO A;  3SUQ A;  1NJZ A;  3PUF A;  1NOY A;  2OZM A;  1VK0 A;  4Z4E A;  3LP2 A;  2G8F A;  3U6F A;  4W5O A;  2Y1I A;  4CJ4 A;  3KK3 A;  1SV5 A;  4KTZ A;  4CF1 A;  1HQU A;  3ZSO A;  1Q9Y A;  4Q0B A;  3NH2 A;  4KHS A;  4OPJ A;  3OYJ A;  4RW4 A;  1TKZ A;  2KQ2 A;  2IGI A;  3TAR A;  4CFB A;  4DFM A;  3KD5 E;  2HHT A;  3SQ2 A;  4B8A B;  1Q8I A;  3TR8 A;  3TAB A;  4GVM A;  3NFA A;  1EKE A;  3L8B A;  4CEZ A;  4M3Z A;  3KLE A;  1TL3 A;  3OYH A;  2IDO A;  3LP3 A;  3F9K A;  4KO0 A;  4AIL C;  4ELT A;  4FJL A;  3HST B;  4DQI A;  4PQU A;  2D5R A;  3P5J A;  4DU3 A;  4FJM A;  5FRM A;  1IKW A;  3U3Y A;  1B9F A;  3PX4 A;  4W5T A;  1NKC A;  4J2B A;  1RBT A;  1X9W A;  2JGU A;  4GW6 A;  3TWH A;  4CER A; 
#chains in the Genus database with same CATH topology
 4H5V A;  3HRG A;  3E1Y A;  4H0O A;  3M8S A;  4A5B A;  1NK7 A;  2A1S A;  3TAE A;  3SQ0 A;  4RTF D;  5D3G A;  4KH5 A;  3VTH A;  4RW6 A;  3TTF A;  3H08 A;  4WE1 A;  4C1N K;  1Q86 O;  5EU7 A;  4FJN A;  4DLG A;  2WUS A;  3CYM A;  4CFC A;  4IO8 A;  5AZI B;  4DSJ A;  3NGI A;  1RDU A;  1QHT A;  4G1Q A;  3SCX A;  2VG5 A;  4GNI A;  4KHY A;  3VER A;  5EX5 A;  3UKU A;  3W3D A;  4EHU A;  4FWN A;  2PY5 A;  2KFZ A;  3A2F A;  4CEF A;  3MN6 A;  1W97 L;  4DTR A;  1GLD G;  5I9E B;  1K8K B;  3AVC A;  3LDO A;  3VQQ A;  3CC2 N;  2G8U A;  4BDY A;  4BGB A;  4WFN L;  4FO0 A;  3PIP L;  3CET A;  4KRF A;  3HK2 A;  2QKK A;  3WUH A;  3CCM N;  5F2R A;  3VA3 A;  1NU0 A;  5IT9 O;  2YX6 A;  3TAF A;  4M7Y A;  4TSX A;  5FPD A;  4AF1 A;  3LPU A;  4H0Y B;  2FLO A;  4LF8 K;  5KQ8 A;  3DXK B;  4EHT A;  4CK1 A;  3CCE N;  3IUC A;  1SL0 A;  5J2Q A;  4C8K A;  1XC3 A;  3EN9 A;  1KFD A;  4JS4 A;  3ZT4 A;  5KGW A;  2DY4 A;  1JLG A;  1ZC6 A;  3E01 A;  4JI3 K;  4JD2 A;  1LWC A;  3KK2 A;  1YTA A;  4FLX A;  1B92 A;  3IAY A;  3V1O A;  4XH4 A;  1DEJ A;  4FL9 A;  4LSL A;  1IKX A;  4X65 K;  1YXQ A;  4ELV A;  4RG8 A;  3ENB A;  2ATQ A;  3TAG A;  3RMA A;  2DFF A;  1VRT A;  3RMB A;  1VQO N;  3AVH A;  1QVF M;  4FJI A;  3M6G A;  1JLQ A;  1U6Z A;  5AR0 A;  3CCU N;  1E4F T;  3HTV A;  1BI4 A;  3D0P A;  1ATN A;  3WEE A;  3CJB A;  2VQF K;  4JHD A;  3I8B A;  3OJU A;  3K5M A;  4YOW A;  3OW2 M;  1T3V A;  3R9P A;  2HVH A;  4IOX A;  4XH1 A;  1M1K O;  1TK5 A;  3LZJ A;  5EY4 A;  4CGG A;  3DLG A;  1SL1 A;  4LH4 A;  1NNE A;  1QVG M;  1H1V A;  3A5L C;  5MLC Q;  3DLH A;  4JI5 K;  2F9W A;  4DB3 A;  3NE6 A;  1TKT A;  1BQN A;  4HTL A;  4NB4 A;  4BRD A;  3VQ4 A;  4E7I A;  4YNQ A;  4WFB L;  3AAR A;  4RW9 A;  5FPM A;  3VEY A;  4CEO A;  4HCC A;  2Z1J A;  4FJ9 A;  2GUP A;  4CD3 A;  1HKC A;  2YJF A;  3AO4 A;  3K5L A;  1TAU A;  2X6S A;  3A0I X;  4FLY A;  1X3N A;  1SAZ A;  1T8E A;  4DTM A;  4XIU A;  2IOC A;  1NK8 A;  5AQR A;  2CH6 A;  4ELU A;  4LH5 A;  4FM0 A;  1CLQ A;  3V81 A;  4KHW A;  2HNZ A;  4KH6 A;  3CG7 A;  3J7A P;  1JXB A;  5JS2 A;  3WNH A;  1VQK N;  5AQP A;  4BRF A;  5J2N A;  5BN8 A;  4E1M A;  1RIL A;  1GLC G;  2X74 A;  3L2U A;  3PY8 A;  5LMU K;  3S9H A;  3AVG A;  4OPK A;  1GLA G;  3HPG A;  4CJV A;  1BGX T;  3UKR B;  5AQN A;  1JXE A;  2HHU A;  3U9D A;  2DPN A;  1RT3 A;  2HNY A;  1XMO K;  2WBN A;  4K43 A;  4CJ5 A;  4CD1 A;  2XY8 A;  1IKV A;  2VG7 A;  1E3M A;  3MX5 A;  2JLE A;  2KZM A;  2P9N B;  3AV9 A;  4AHU A;  1ITG A;  3AO2 A;  4JN4 A;  4JKB A;  1EQY A;  3M5R A;  1ASW A;  3QIP A;  4PUO A;  4KBO A;  5AQS A;  3P38 A;  4YY3 K;  1RBR A;  1HLU A;  3RSE B;  3MN9 A;  3H46 O;  4CES A;  4CEC A;  2ZJR L;  1WSG A;  3FZM A;  3V9X A;  3HT3 A;  3PIO L;  4H0X B;  1HKB A;  4NYF A;  2JWK A;  3AO3 A;  3SMS A;  3LL3 A;  1SKW A;  2ASM A;  4E7J A;  4FK2 A;  3FR0 A;  2A42 A;  4W5R A;  1I94 K;  4JRQ A;  1JL2 A;  2A1R A;  3CCR N;  3L3U A;  3VEN A;  4ISG A;  3RMC A;  3ZET B;  1ILY A;  1QZ6 A;  3QER A;  2EX3 A;  2VGM A;  4ZTF A;  2Q36 A;  1QSL A;  5JVG L;  3ZX2 A;  3LAM A;  4ID1 A;  2QWL A;  1XQS C;  3LDL A;  4JKH A;  2WTU A;  4KFB A;  4BQL A;  3OYC A;  2AP1 A;  4UQG A;  3EYZ A;  1B9D A;  1WB9 A;  4K41 A;  3BP8 A;  5HRO A;  4DMN A;  4CEB A;  5C2D A;  2E2O A;  4A59 A;  1WSF A;  3H45 C;  1XI1 A;  4H03 B;  4K42 A;  5DMR A;  1SUQ A;  2ZJP L;  4E1J A;  1KCF A;  5C12 A;  1JKH A;  2B5J A;  4OGE A;  5J2P A;  3THX B;  3K9K A;  4B8C A;  4CGH A;  5BRH A;  2HW3 A;  1OKJ A;  3QNN A;  2HHX A;  3HI0 A;  2OA8 A;  4BRH A;  4EP5 A;  1RT2 A;  2YHY A;  3D2F A;  1FJG K;  1HNI A;  4H5T A;  3RVC A;  4HCB A;  4I9Q A;  4C8L A;  4YOX A;  4ZHR A;  3WNE A;  1C1C A;  3MAQ A;  1X1P A;  3DOL A;  3T1H K;  3NF7 A;  3ZSZ A;  4A5A A;  4CIF A;  4F3O A;  2P9P A;  3J8A A;  4DQQ A;  4CEQ A;  4GY2 B;  2UXB K;  1LW0 A;  1WBB A;  1YJN N;  3U8X A;  5AQL A;  1RDD A;  3G25 A;  3ISN C;  5HRS A;  4BR0 A;  4JKD A;  3K0S A;  4EZ9 A;  3QDK A;  2QK9 A;  2NLX A;  4HVJ A;  4KHQ A;  4BVP A;  2G8H A;  3ZYY X;  4YHH K;  3HO1 A;  1Q7Y O;  3EKU A;  4M3R A;  5ELZ A;  1Z26 A;  3IFR A;  2BAN A;  3FGU A;  3O9T A;  2O8F A;  4IFV A;  5CR4 A;  3NVK A;  3TTD A;  1MWM A;  3WNF A;  3CJC A;  2CGJ A;  3TSQ A;  5FDL A;  1J6Z A;  3D7E O;  1JCF A;  3KLI A;  1VRU A;  4U7B A;  1GLL O;  1SZ2 A;  4J2E A;  2B4J A;  5HBM A;  3GDQ A;  1IG9 A;  4BR5 A;  4FJ8 A;  3AVB A;  3U9Z A;  3NF9 A;  1RNH A;  3CQX A;  5BR8 K;  2YNG A;  3DJC A;  3SUO A;  4JYA K;  3SZ2 A;  1S1W A;  5BRE A;  4DV5 K;  2VQE K;  1QQM A;  3PSF A;  4CEA A;  1BIU A;  1VQ6 N;  5LMN K;  3VQA A;  4CIG A;  4PL8 A;  4OX9 K;  1KD1 O;  1RTJ A;  3L0Q A;  4B9L A;  4CK3 A;  2HF3 A;  5ADX A;  4W5N A;  1RTI A;  4BDZ A;  2QXL A;  2Q31 A;  4BWM A;  4R79 A;  4B9T A;  2HHS A;  3L2W A;  4M3Y A;  2P9I B;  3I56 N;  1NK5 A;  4EZ6 A;  4BRQ A;  1NBW A;  1Q82 O;  1VQ9 N;  3GOI A;  5AQU A;  1R0A A;  1RDC A;  3ASM A;  1S6P A;  4CBW A;  3OJS A;  5AQY A;  5M1O A;  1RT1 A;  3ITH A;  3TPQ A;  3TTC A;  4BVO A;  4CI6 A;  5JLF A;  2HHH K;  3MN5 A;  3SUQ A;  4Z4E A;  4FVU A;  2NRR A;  4FWR A;  2J4R A;  2Y1I A;  4JK8 A;  1SV5 A;  4Q0B A;  4K25 A;  4OPJ A;  3CER A;  3K9J A;  1W7A A;  2P9K A;  3O9Q A;  3DXM B;  2HHT A;  3SQ2 A;  1Q8I A;  3TAB A;  4GVM A;  4RWT A;  1YHQ N;  3LP3 A;  4FJL A;  5ADX H;  4DQI A;  4PQU A;  3NMU A;  1VHX A;  4JKG B;  1NMD A;  3O9U A;  1KC8 O;  3G4S N;  4GW6 A;  3TWH A;  3OS1 A;  4FWK A;  5BPN A;  3MN7 A;  3KK1 A;  3CC7 N;  4PA1 A;  3QET A;  4Z0U A;  3VQP A;  2F9T A;  2XRI A;  2FXU A;  1TUY A;  4R5P A;  2QA4 N;  1C1A A;  4FLU A;  2VYP A;  3NGZ A;  1VQP N;  1NJI O;  1HPM A;  4JAX A;  4B3M K;  5E26 A;  3KLF A;  3K57 A;  4FSV A;  2D0C A;  3MWP A;  4FVM A;  2A40 A;  2FF6 A;  2O8C B;  1S1X A;  4H5N A;  3W0L A;  3LZI A;  2UYT A;  2G8I A;  4I2P A;  3T3F A;  4E7K A;  1TAQ A;  1G99 A;  5T7B A;  3QEW A;  2YKN A;  2BDP A;  3VES A;  5HLF A;  2HND A;  2V7Y A;  2AA4 A;  1L3T A;  4DR1 K;  3AVM A;  2ETJ A;  2ZJQ L;  4JEP A;  2OYQ A;  3DYA A;  1VQ7 N;  4OVL A;  1N32 K;  3O9S A;  3C95 A;  4I7F A;  5C0Y A;  1NOZ A;  4F2S A;  1SKR A;  1WN7 A;  4PWD A;  2YHW A;  4Y0W A;  1TYQ B;  4O0J A;  1C0T A;  3OYB A;  3QES A;  1J53 A;  1FW6 A;  1U45 A;  1TKD A;  5BR9 A;  4JS5 A;  2P9L A;  2Z1I A;  5AZJ A;  4DCH A;  1SQK A;  5M1K A;  1HX1 A;  1EWR A;  3KKS A;  3F2K A;  4BRA A;  4E89 A;  4EIA A;  1HNX K;  4B3O A;  1HKG A;  4O44 A;  1Q9X A;  4FYD A;  3RRH A;  5KRS A;  1N6Q A;  3LP0 A;  1N5Y A;  2OZM A;  2IVP A;  4DS4 A;  4XH5 A;  2KFN A;  4M7X A;  4NXM K;  3VQD A;  5AQV A;  4E7H A;  3RTV A;  1BCM A;  1KXP A;  1RT5 A;  5BPL A;  4FJJ A;  5J1E A;  4B1Y B;  3ID8 A;  4JRP A;  4DFJ A;  1S72 N;  3ZSY A;  1VSL A;  4H8K A;  2F8T A;  1RFQ A;  3ALY A;  3SAH A;  4NYN A;  3ZEU A;  3NF8 A;  3SV3 A;  3QEV A;  3DWL A;  1YTU A;  4JV5 K;  1WSI A;  2A5X A;  3P1G A;  3OS0 A;  4KAZ A;  4CIE A;  3C94 A;  1N34 K;  3ZT1 A;  4K0K K;  4BQZ A;  4AHC A;  3HM9 A;  3VQ5 A;  1LOT B;  4IBN A;  1ATS A;  1EWQ A;  3NGY A;  2I7P A;  4I6M B;  4IXC A;  4N76 A;  3DRP A;  3IMX A;  3C6H A;  2UUB K;  1L3S A;  1NLV A;  3IG1 A;  1HYV A;  4DQP A;  4B9U A;  4CZH A;  2IAJ A;  3UIQ A;  3ZX0 A;  4JLH A;  1T7P A;  4Q5V A;  4DR2 K;  3HSC A;  3SI6 A;  3KZB A;  4FWP A;  1U49 A;  1J9A A;  3FFI A;  2P9U B;  2IS3 A;  4WQ5 A;  2HBJ A;  4X66 K;  3VQE A;  5SZT A;  5HRN A;  2OZS A;  2GUI A;  2WC9 A;  3OA9 A;  3CCQ N;  3MXJ A;  1UOC A;  5KQD A;  2E1Z A;  4IJA A;  3SJJ A;  1RT4 A;  2O8B A;  3HPO A;  4FJ7 A;  4CFA A;  1XWL A;  1N36 K;  2GEM A;  1TL1 A;  3E66 A;  2QXF A;  3SNN A;  2HVI A;  4C23 A;  3DLB A;  3P39 A;  1BA1 A;  1TV6 A;  1QQC A;  4YOR A;  1I3A A;  4CZL A;  5HOO A;  4E3S A;  3CD6 N;  3J7Z O;  1T03 A;  5M1N A;  4M45 A;  3QB0 A;  1NK9 A;  2BE2 A;  3FZK A;  5C25 A;  4EFH A;  4FM1 A;  1GLJ O;  3O8M A;  4AHR A;  1W9H A;  4DV6 K;  2CGL A;  1KLN A;  3SPZ A;  1NG9 A;  2W40 A;  4JI0 K;  3CM6 A;  3BF1 A;  1FKO A;  4DR4 K;  1NM1 A;  4A2B A;  2OCE A;  3DI6 A;  3EEQ A;  4HHT A;  5CYM A;  3OYI A;  2DFH A;  4AHV A;  4CJ7 A;  3QBW A;  3SUP A;  4I2Q A;  3UKU B;  3TAN A;  2QTD A;  4Z4G A;  2OTJ N;  1EO1 A;  1ZXO A;  3RRG A;  2WON A;  3CCJ N;  4OO1 J;  4FZZ A;  1DTT A;  1C1B A;  4E7L A;  4KPY A;  4M3U A;  5AQI A;  4CJL A;  5FLX O;  5AQT A;  1Q18 A;  3WXI A;  2G8V A;  2E6M A;  3CIP A;  3CFP A;  5K14 A;  2NUB A;  4J2A A;  2QWR A;  1O13 A;  3LPT A;  1OH8 A;  1D8Y A;  3DLK A;  3AVJ A;  2HHW A;  4QS9 A;  4GV3 A;  1OVY A;  4BRO A;  4IOA L;  4C8M A;  1X9M A;  1YT3 A;  4CGF A;  5J2M A;  2VG6 A;  5FRN A;  3VEX A;  2QI2 A;  4NCG A;  3LDQ A;  4DU4 A;  4CGJ A;  1XUP O;  4CJ3 A;  2Y1J A;  3M3Z A;  4JD2 B;  3AVI A;  2FSJ A;  3ATU A;  1YJW N;  1NKE A;  4CGI A;  1IG8 A;  2XY7 A;  4QAG A;  3OBW A;  3ZSW A;  4DU1 A;  5KTQ A;  2QWP A;  1QS4 A;  4OPH A;  3C0B A;  4CZK A;  2P5O A;  4KKO A;  4CJP A;  3WQU A;  4DUY K;  1X9S A;  3RMD A;  1RTH A;  3KTQ A;  1YVN A;  3KLG A;  2F96 A;  2YHA A;  4QS8 A;  2B6A A;  1BI4 B;  3FFK B;  3H6E A;  4CZJ A;  4DHY A;  4OGC A;  2FSN A;  1ASU A;  4DKW A;  4MDA A;  1D5A A;  4H5W A;  4LF6 K;  3GL1 A;  3BUZ B;  3CI5 A;  1OH6 A;  1E4G T;  3P83 D;  3UE5 A;  1MWK A;  4A57 A;  3GG4 A;  4DV3 K;  4DTU A;  2NZT A;  1JCE A;  2D4W A;  4O0I A;  2VGN A;  4L3Q A;  4IKF A;  3PO4 A;  4LF9 K;  2VCP A;  1S9E A;  4QOZ B;  5I42 A;  4X64 K;  3N4Q A;  3CJ7 A;  4CEE A;  3I8D A;  3MEG A;  4FOI A;  3DM2 A;  4JKE A;  2HBL A;  5SWM A;  1BDG A;  3TU5 A;  3L4I A;  4IFE A;  1I39 A;  2GWK A;  1HMV A;  3BGR A;  4DQS A;  4M3W A;  3KVG A;  4BRM A;  2KW4 A;  1V4S A;  2NRZ A;  5AQH A;  5CZ2 A;  3NH1 A;  4DSE A;  4Z4I A;  2X6N A;  3CFR A;  4FJG A;  2P9S A;  3V9W A;  3ZSX A;  4BR4 A;  1GLE G;  5AQQ A;  3MDQ A;  4ZTJ A;  3LAL A;  4FWO A;  4PHT X;  3CXC M;  3O4N A;  2RHK A;  4IDK A;  2GTD A;  4CJW A;  1QTM A;  1J5O A;  3ZSR A;  4MLE A;  4CJS A;  1K9M O;  4WQ5 C;  2FBY A;  3VQ7 A;  2Q97 A;  3QFU A;  4CZG A;  1T44 A;  1BQM A;  4CBU A;  2ZGZ A;  2O8D A;  5C2F A;  4DTN A;  2VWB A;  3ULE A;  2QW9 A;  5AQX A;  4BG9 A;  4FK4 A;  3HP9 A;  1D9F A;  3G6E N;  4K8X A;  3VQ9 A;  2QM1 A;  1YVU A;  4B3T K;  2NNW A;  2QEX N;  2OPS A;  5CZ1 A;  5F0X A;  3DLR A;  1U48 A;  2GWJ A;  2NRX A;  5FRO A;  3H1Q A;  4UY8 O;  3PUF A;  4JK9 A;  3BEX A;  3U6F A;  4W5O A;  3S41 A;  3KK3 A;  4BRI A;  1HQU A;  1Q9Y A;  4AM6 A;  4KHS A;  1J5E K;  4DFM A;  3KD5 E;  3NFA A;  2UXD K;  1YIT N;  3C6A A;  1TL3 A;  2D0O A;  4FWL A;  4DU3 A;  2W6L A;  1D4X A;  3T7Z A;  4FJM A;  5FRM A;  3U3Y A;  3TSU A;  1U2V A;  1U4B A;  4CER A;  5AJ3 K;  4C8N A;  3HVR A;  4FLZ A;  1BL3 A;  2Q1N A;  1HPZ A;  2NRH A;  3MXI A;  3LWM A;  4QCL A;  1S3X A;  3K5N A;  1XNQ K;  4FM2 A;  1RDB A;  1L5U A;  4KI4 A;  4IG3 A;  5DM7 L;  1HUX A;  2W42 A;  5LJV A;  4WYB A;  3AVA A;  4YOU A;  2G8K A;  2AJQ A;  4BAC A;  4B1Z A;  4ILJ A;  1WBD A;  4IDH A;  4PKG A;  2YHX A;  4IJN A;  3AVK A;  3F9M A;  2PZS A;  5KRT A;  3JAM O;  4GKJ K;  3QLH A;  3CMA N;  3P31 A;  3C6U A;  5JS1 A;  1JLF A;  3AGR A;  3S3M A;  3SPY A;  4H5R A;  1U47 A;  3D2E A;  2FC0 A;  3LAK A;  3CQY A;  2YNI A;  3DMJ A;  3G0Z A;  4DV7 K;  1IV0 A;  3HYF A;  2ITM A;  1DKG D;  1HJR A;  4BR2 A;  2A3Z A;  4EP4 A;  4O8U A;  1ZBH A;  4E1N A;  1CZA N;  2V7Z A;  4YDU A;  3OYK A;  3HBT A;  2EWS A;  3QFP A;  4OKK A;  3D2F B;  4BDP A;  5KI6 A;  1HNV A;  1ZBS A;  1MDU B;  3ZCM A;  1FK9 A;  4FW1 A;  2O8E A;  3HJF A;  1S1V A;  3EL2 A;  3RWU A;  3V9S A;  3C7N A;  2P9P B;  3M8Q A;  3PX6 A;  2VWK A;  3VQB A;  2ZGY A;  1JJ2 M;  1VAZ A;  4IEE A;  4A62 A;  3EE8 A;  5BRD A;  4KHN A;  5CHI A;  3QIN A;  4CF0 A;  3HOS A;  4FWM A;  1RBU A;  1NK6 A;  3KK7 A;  4JKG A;  1GLF O;  4CVN E;  3VGM A;  3TAM A;  1A5V A;  3O3F A;  3VMF B;  1JCG A;  2OPR A;  3V1R A;  4N41 A;  1NGC A;  1VSD A;  4ID5 A;  2HBM A;  4B9S A;  2O8F B;  3QEX A;  1NOY A;  3LM2 A;  4BC4 A;  3V6D A;  3THY A;  4QS7 A;  3SQ4 A;  3MCA B;  2QWN A;  1VSI A;  1RBV A;  1KRP A;  5AQK A;  5LL6 Z;  3ZT0 A;  4CJU A;  4DV0 K;  4DQ8 A;  2Z1G A;  5GIP A;  3MMV A;  3THW A;  1DLO A;  3SV4 A;  1RDA A;  4AH9 A;  3HP6 A;  3ZSV A;  5M1P A;  3OYN A;  3IS9 A;  1MU2 A;  1ASV A;  3NBP A;  2IIR A;  2PFU A;  1Q81 O;  5F1X A;  2O8C A;  2HF4 A;  3ZT2 A;  5AQJ A;  1YAG A;  2E1Y A;  3OYL A;  3PLA A;  4CBX A;  4CFD A;  4CJQ A;  1C0U A;  1NJW A;  3GE1 A;  3S3N A;  1UWB A;  3L2V A;  1T05 A;  4Z94 A;  1W2B M;  2DTU A;  3KJV A;  4OKJ A;  4H4O A;  2KZZ A;  1HYS A;  3IRX A;  5GAG P;  1TYQ A;  3CC4 N;  3JXU A;  3EZ5 A;  1YJ9 N;  4BE2 A;  3AO5 A;  1VQ5 N;  2YNH A;  1NGA A;  4CZI A;  1OVQ A;  2HHQ A;  3AVF A;  4BC3 A;  4DTS A;  2P9K B;  1BA0 A;  1SKS A;  3HL8 A;  3DLL L;  2E8A A;  3VN5 A;  3O4Q A;  3R1X A;  4FLV A;  4FK0 A;  4FOE A;  4AHS A;  5TKY A;  5BN9 A;  1KVA A;  1N33 K;  1WSJ A;  3OY9 A;  4FCY A;  2JWL A;  4CF2 A;  3CFO A;  1OH5 A;  3IKM A;  4DF8 A;  3THV A;  1HQE A;  1MA9 B;  1KAZ A;  1VQN N;  5KGX A;  2HST A;  4MLH A;  3OYF A;  5HP1 A;  4LSN A;  3OS2 A;  4AQY K;  1VQ8 N;  3L2R A;  4LY7 A;  1N8R O;  3SBG A;  3HOT A;  1NGG A;  1HJO A;  4PKI A;  4GV9 A;  4F2R A;  4B1W B;  1XMQ K;  3E9P A;  4NLB A;  3KWI A;  4M41 A;  3Q7B A;  1Y64 A;  3OHR A;  3T1A A;  1IBK K;  3LM9 A;  3J81 O;  4E19 A;  2E2N A;  5C42 A;  2UXC K;  1RCH A;  1UA0 A;  1NJY A;  5CE3 A;  3WXM B;  3QEI A;  2E88 A;  1XHZ A;  4CJE A;  1WNS A;  1M90 O;  1S5J A;  4KV8 A;  4RW7 A;  3VPZ A;  3RR8 A;  1YUW A;  1TGO A;  2HOE A;  4DTO A;  4DTX A;  3FE1 A;  4IG0 A;  3A5N C;  5AZI A;  3AAP A;  2WOM A;  1K6Y A;  4Y1D A;  1FXX A;  4DQR A;  3AAQ A;  1NGD A;  4DSF A;  3ZX3 A;  1X3M A;  3U4L A;  4WQ4 C;  3E9O A;  3M1F A;  4BRG A;  3B6O A;  3H3O B;  1QQN A;  2NRV A;  1FKP A;  3KHY A;  4IEI A;  3SJH A;  3K59 A;  1IKY A;  3CJ9 A;  2GEL A;  4B1X B;  1K8K A;  1IH7 A;  3HPH A;  4F3T A;  4M3X A;  3TAQ A;  4YDU C;  3HZ6 A;  2UU9 K;  2P9L B;  5AZJ B;  2ASP A;  4BRP A;  3NH0 A;  1V4T A;  4CW7 B;  2E5L K;  3K2P A;  4LFB K;  4OKE A;  3AA2 A;  3AA5 X;  1ZYQ A;  3D6R A;  1VSJ A;  1EET A;  4CED A;  3DXK A;  1KLM A;  3AVL A;  1JLC A;  4EAH D;  4FJX A;  3VET A;  2RE2 A;  4U67 L;  3CHW A;  3OYM A;  2Q0U A;  2A41 A;  3SAG A;  3HM8 A;  4CCH A;  3KWG A;  3DRR A;  3C6T A;  2UUA K;  4GV6 A;  3KKR A;  3ZEU B;  1A5X A;  1ZBL A;  3KLH A;  3AA3 A;  1C0F A;  2FBT A;  2FF3 B;  5CYQ A;  3M8R A;  1QE1 A;  4MFB A;  3VEW A;  4FZX C;  3V1Q A;  5GIO A;  3DAW A;  1VSE A;  3MX2 A;  4LF7 K;  2QWQ A;  4JKA A;  4BY9 C;  4J2D A;  4FWQ A;  4FJH A;  3PO5 A;  4O5B A;  3QIO A;  3DOK A;  4DSL A;  1NGB A;  4CHP A;  1GOA A;  4KHP K;  4CK2 A;  2YNF A;  3SBT A;  3CCS N;  3JS6 A;  3FZF A;  4M3T A;  5C10 A;  3ENH A;  2CH5 A;  4KHU A;  5KPT A;  4KB0 A;  2V51 B;  2D0P A;  3SMP A;  4FZY A;  1WSH A;  1WAJ A;  1NMN A;  2YV0 X;  1EXQ A;  2BH1 A;  2Q0R A;  4BE0 A;  4CHZ A;  3EO3 A;  4LD0 A;  3OYG A;  2Z1H A;  4CZF A;  4HUG A;  4JI2 K;  4IWV A;  2YHB A;  1NK4 A;  3J80 O;  1LV5 A;  2HMP A;  3V9U A;  4M42 A;  3NF6 A;  5JMV A;  1J54 A;  4KTQ A;  3P4I A;  3RR7 A;  4J8F A;  3NDK A;  2O8B B;  4CF9 A;  3AVN A;  5KPR A;  2E4L A;  2O4G A;  1BUP A;  4A2A A;  1VSF A;  4CE9 A;  1IBL K;  5E84 A;  4FWS A;  1Y97 A;  2XO7 A;  2BUP A;  3G10 A;  1VQ4 N;  2F8S A;  1KVC A;  1Z6R A;  4BE1 A;  1NWK A;  2ZF5 O;  4CZM A;  1VK0 A;  3LP2 A;  2G8F A;  5GAH P;  1BWF O;  4CJ4 A;  4IOC L;  4BRC A;  4CF1 A;  2F4V K;  3AY9 A;  3NH2 A;  4RW4 A;  2KQ2 A;  4CFB A;  3TR8 A;  3A5M C;  3L8B A;  4PL7 A;  4M3Z A;  3KLE A;  3OYH A;  2YJE A;  4AIL C;  3A8Y A;  2OTL N;  1QHA A;  2Q2R A;  3P5J A;  4IO9 L;  3O9R A;  1IKW A;  1K8A O;  3NVM A;  3VEV A;  3UKR A;  3PX4 A;  4W5T A;  1RBT A;  1X9W A;  2JGU A;  1T6D A;  5EXW A;  3CCL N;  3AA4 A;  1C6V A;  2RKI A;  4H4M A;  4YFU A;  1VQL N;  1A5W A;  3VGK A;  1KSP A;  3L3V A;  2P9N A;  2KKZ A;  2I7N A;  1WLJ A;  4V19 S;  4JI1 K;  3WEE B;  4CHY A;  3I0S A;  1LWE A;  4JHD B;  4JI8 K;  4CGD A;  1LAW A;  3WXK A;  3O5B A;  3VQ8 A;  5AFU A;  1NGE A;  3ZSQ A;  3EZW A;  2E2P A;  3RSE A;  1RT6 A;  3WQT A;  3U3G A;  1QZ5 A;  1BG3 A;  4OLB A;  3O6W A;  3VGL A;  3OYE A;  4FLT A;  1GOC A;  4N47 A;  1UA1 A;  3L6Q A;  1RDW X;  4DUZ K;  4LFC K;  1NGF A;  3LP1 A;  1JLB A;  3VEZ A;  2ASO A;  2FBV A;  3OYD A;  3SYZ A;  1O1W A;  3Q7C A;  1C0M A;  3VQ6 A;  4BR7 A;  4BRL A;  2GX9 A;  4DV4 K;  3OVN A;  4G9Z A;  1BCO A;  4Y1C A;  3V9Z A;  2XY5 A;  2KTQ A;  4DSI A;  3CM5 A;  4NO7 A;  1RBS A;  4CF8 A;  3CPW M;  2RN2 A;  2P51 A;  3ULD A;  1REV A;  1JLE A;  3ZET A;  3R6M A;  4FJ5 A;  1LCU A;  2D0A A;  4HTU A;  5BRF A;  3EE9 A;  3PX0 A;  1HYZ A;  3NAE A;  2R7Y A;  1W0H A;  5AFU H;  3VEO A;  4FPA A;  4B9M A;  3R3L A;  4O5F A;  4FXD A;  5M1Q A;  1ESV A;  1LW2 A;  1BIZ A;  3CME N;  4F4K A;  2GBZ A;  4KRE A;  1ATR A;  3FLC O;  4FPB A;  1YI2 N;  2RF2 A;  2OAN A;  4MO5 A;  4KTW A;  1DTQ A;  4BRK A;  5C15 A;  3O4W A;  4AHT A;  3THX A;  5DK5 A;  4HWI A;  1U04 A;  1P8Z A;  3CJA A;  2F7T A;  2Q3S A;  4N5S A;  1GOB A;  1WSE A;  4H0V B;  3MEC A;  1KVB A;  1KQS M;  1D9D A;  4PKH A;  3QEP A;  1DGK N;  4C1N I;  3M8P A;  3O3H A;  2I5J A;  4IZ9 A;  3KD1 E;  2X78 A;  1T6C A;  5AQG A;  1JL1 A;  4NLC A;  4BGA A;  3OTO K;  4NXN K;  4ILH A;  4WF9 L;  3HVT A;  1KTQ A;  3T1Y K;  1CZB A;  1LWF A;  3NCI A;  1Z25 A;  1RGI A;  2E20 A;  3O3G A;  2P1J A;  4Z4H A;  1BO5 O;  2HB5 A;  2G8W A;  5IWA K;  2HBK A;  4DFP A;  4RW8 A;  4MDB A;  2P9S B;  2ZE2 A;  5B8H A;  1IO2 A;  1UAX A;  1QSS A;  1EP4 A;  5GAE P;  3L4Q A;  3MED A;  4RCH A;  3L2Q A;  1HNZ K;  3VF2 A;  5H1S Q;  3O08 A;  3UB5 A;  3VQC A;  1SS6 A;  1K73 O;  2W6K A;  1R59 O;  2LSN A;  5HRP A;  2FBX A;  2OPQ A;  2D1K A;  5AQZ A;  1S1T A;  2O8D B;  3ULE B;  4CHQ A;  2HMI A;  4H0P A;  4O8K A;  5AQO A;  3WNG A;  1TUU A;  4OJR A;  3LDS A;  2NRT A;  3LAN A;  4A61 A;  4AM7 A;  3BDP A;  2ZWH A;  2NRW A;  4K8Z A;  2HHV A;  3ATV A;  1NKB A;  1ZBI A;  1CXQ A;  3WXL A;  4ISF A;  4JI6 K;  4DG1 A;  3S3O A;  3CF5 L;  3LDP A;  2O4I A;  3SK3 A;  4JK7 A;  4MQ3 A;  4B3R K;  1BIS A;  4WCE L;  1OH7 A;  1HRH A;  3MK6 A;  2P9I A;  4WQ4 A;  4OPA A;  4H0T B;  3MWT A;  3TI0 A;  1GLB G;  4YOV A;  3GBT A;  3QML A;  4B9N A;  2YCH A;  3MEE A;  3DLE A;  2FSK A;  4CHO A;  2VWJ A;  2PYJ A;  5GAD P;  4FW2 A;  4KI6 A;  4B1U B;  1WOQ A;  3VTI A;  2GV9 A;  1NJX A;  2ZM6 K;  3CQ8 A;  3V4I A;  4CZE A;  4YOT A;  4DS5 A;  4LF4 K;  1S9G A;  4BC2 A;  4JKC A;  4E0D A;  3I33 A;  5EVZ A;  5JVH L;  3WT0 A;  3EY1 A;  1U2V B;  3E9L A;  4DR5 K;  5HL7 L;  2KLA A;  4Z4F A;  4GKK K;  2CGK A;  3FZH A;  4ISE A;  2OPP A;  3DXM A;  2YI1 A;  4L8R B;  1HR0 K;  3VF4 A;  1XC9 A;  5FPE A;  1JLA A;  3G71 N;  5LY3 A;  3T19 A;  3SQ1 A;  1RTD A;  1NGJ A;  4DFK A;  1C0G A;  4PY5 A;  2IC3 A;  1WAF A;  4MO4 A;  3LWL A;  5AQF A;  3IDH A;  2RPI A;  1NK0 A;  5BPM A;  1SL2 A;  1VSK A;  1WUA A;  2ZD1 A;  3VA0 A;  1RT7 A;  1YF5 L;  3PV8 A;  3ENO A;  2PBD A;  4O4G A;  3AGK A;  1S1U A;  4N56 A;  3CPE A;  3T69 A;  3VF6 A;  1S6Q A;  5LJW A;  1EX4 A;  2P5G A;  5AQM A;  2QWM A;  3D2E B;  3CJ1 A;  3O1B A;  4B08 A;  3A5O C;  4B9V A;  3SLC A;  2IVO A;  2WFB A;  2PAV A;  4ILG B;  4DTJ A;  4BRN A;  1S22 A;  4CJF A;  4DTP A;  3BY5 A;  1QQO A;  3J7Y P;  2O8E B;  3C7N B;  3BZC A;  1VSM A;  1BOT O;  1L3U A;  5E41 A;  5EOY A;  4DLE A;  4BG8 A;  4JI4 K;  5I3U A;  2DFE A;  4DR3 K;  3F5T A;  4W5Q A;  4DV1 K;  5M1F A;  3SAF A;  1KAY A;  3N4P A;  4I9L A;  1YIJ N;  2ITG A;  4NCB A;  1IBM K;  1BU6 O;  5KPZ A;  3BF3 A;  3JSM A;  4NCA A;  4BWJ A;  1TK8 A;  2BGG A;  4JI7 K;  1VSH A;  4Z4C A;  5FPN A;  4HUF A;  3THY B;  2EHG A;  3K5O A;  3VOV A;  1LAV A;  4DV2 K;  1CZ9 A;  4HUE A;  4OLA A;  5JIC A;  2H3G X;  4GMJ B;  4JKF A;  3QNO A;  4DF4 A;  5TKW A;  2BTF A;  4DR7 K;  4CJR A;  1DT9 A;  3QIC A;  4YOY A;  4DSK A;  4LFA K;  3KIO A;  3THW B;  4FJK A;  2KHO A;  2YKM A;  3C65 A;  3H1V X;  4WFA L;  1QSY A;  5CY4 A;  3CCV N;  3DRS A;  4O55 A;  1L3V A;  2D0B A;  4IFY A;  3OYA A;  1P90 A;  4C8O A;  4CHN A;  3PSI A;  1F21 A;  3QO9 A;  3NHG A;  2QKB A;  1BHL A;  2XHB A;  2QWO A;  4F9O A;  3TAP A;  3JYT A;  3SUN A;  1ZBU A;  5A2Q O;  1KFS A;  3ID6 A;  3D45 A;  4LC9 B;  3B6P A;  4FLW A;  3AO1 A;  4B1V A;  4X62 K;  5C24 A;  4JNE A;  1NGH A;  4ICL A;  4CJK A;  3LDN A;  2PYL A;  4CJT A;  1TKX A;  4BR9 A;  3I55 N;  3WXJ A;  4I6M A;  3MCP A;  3ZLJ A;  3HXM A;  3FZL A;  3ZT3 A;  1ZBF A;  1KAX A;  4KB1 A;  3MXM A;  3BZK A;  4B3S K;  3F73 A;  5GIN A;  3O1W A;  2XY6 A;  1HNW K;  1TK0 A;  3TSP A;  1VQM N;  3O80 A;  2E6L A;  5HRR A;  1CXU A;  3K58 A;  3EKS A;  4F8R A;  2IVN A;  2P9U A;  1XHX A;  4BC5 A;  1TVR A;  2W41 A;  4B9Q A;  1G15 A;  2E2Q A;  4DWI A;  3I0R A;  2ZQB A;  5JLH A;  1X9J A;  3OBY A;  1NJZ A;  4DR6 K;  4GVE A;  2V52 B;  1XNR K;  1Z05 A;  1NGI A;  5AQW A;  4KTZ A;  3ZSO A;  3OYJ A;  1IJJ A;  1TKZ A;  3TAR A;  2IGI A;  3R8E A;  4XEI A;  4BRE A;  2UUC K;  4B8A B;  1EKE A;  4CEZ A;  4KH4 A;  2IDO A;  3F9K A;  4LF5 K;  4KO0 A;  4ELT A;  3HST B;  4M63 C;  2D5R A;  3H3N O;  3B8A X;  1B9F A;  1NKC A;  4J2B A;  2A6A A;  3QBX A;  5DM6 L; 
#chains in the Genus database with same CATH homology
 3AA4 A;  1C6V A;  2RKI A;  4H4M A;  4C8N A;  4YFU A;  3HVR A;  4FLZ A;  1BL3 A;  1A5W A;  1HPZ A;  3MXI A;  3M8S A;  3LWM A;  4QCL A;  1KSP A;  1NK7 A;  2A1S A;  3L3V A;  3TAE A;  3SQ0 A;  5D3G A;  3KK1 A;  3K5N A;  1WLJ A;  4RW6 A;  4FM2 A;  1RDB A;  3H08 A;  4WE1 A;  1L5U A;  4IG3 A;  4CHY A;  4KI4 A;  3I0S A;  4PA1 A;  5EU7 A;  4DLG A;  1LWE A;  4Z0U A;  3VQP A;  2W42 A;  3CYM A;  3QET A;  4FJN A;  4CFC A;  4CGD A;  1LAW A;  2XRI A;  3VQ8 A;  1N6Q A;  4DSJ A;  3NGI A;  3ZSQ A;  3AVA A;  1QHT A;  4G1Q A;  4R5P A;  3SCX A;  2G8K A;  2AJQ A;  2VG5 A;  1RT6 A;  4KHY A;  1C1A A;  3U3G A;  4BAC A;  4FLU A;  3NGZ A;  4OLB A;  3KLF A;  2PY5 A;  3OYE A;  2KFZ A;  3A2F A;  3AVK A;  1GOC A;  4N47 A;  5KRT A;  3K57 A;  4FLT A;  1UA1 A;  2D0C A;  4CEF A;  2PZS A;  3QLH A;  4DTR A;  3LP1 A;  4FVM A;  1JLB A;  5JS1 A;  3C6U A;  1S1X A;  1JLF A;  2FBV A;  3AVC A;  3VQQ A;  3OYD A;  3SYZ A;  2G8U A;  1O1W A;  3S3M A;  3LZI A;  3SPY A;  1C0M A;  4BDY A;  1U47 A;  3VQ6 A;  2G8I A;  4I2P A;  3T3F A;  4E7K A;  3OVN A;  1TAQ A;  1BCO A;  2FC0 A;  4Y1C A;  3LAK A;  3V9Z A;  2XY5 A;  2YNI A;  3DMJ A;  3G0Z A;  3HK2 A;  2QKK A;  4KRF A;  2KTQ A;  5T7B A;  3QEW A;  2YKN A;  2BDP A;  3CM5 A;  4DSI A;  3HYF A;  5HLF A;  1RBS A;  2HND A;  4CF8 A;  1HJR A;  3VA3 A;  1L3T A;  3AVM A;  2RN2 A;  2P51 A;  2ETJ A;  3ULD A;  1REV A;  1JLE A;  3TAF A;  2OYQ A;  3DYA A;  4EP4 A;  4FJ5 A;  4TSX A;  2D0A A;  4OVL A;  3LPU A;  4HTU A;  4I7F A;  3C95 A;  1ZBH A;  1NOZ A;  4E1N A;  4F2S A;  1SKR A;  1WN7 A;  3PX0 A;  3OYK A;  4OKK A;  1HYZ A;  4CK1 A;  4BDP A;  5KI6 A;  1HNV A;  3NAE A;  2R7Y A;  4PWD A;  1W0H A;  3ZCM A;  1FK9 A;  4FW1 A;  4B9M A;  3HJF A;  1SL0 A;  4O0J A;  1C0T A;  1S1V A;  5J2Q A;  3V9S A;  4C8K A;  3RWU A;  1LW2 A;  4FXD A;  1BIZ A;  4F4K A;  2GBZ A;  3OYB A;  3QES A;  1J53 A;  3M8Q A;  4KRE A;  3PX6 A;  1KFD A;  2VWK A;  3VQB A;  1U45 A;  1TKD A;  4JS5 A;  2Z1I A;  2RF2 A;  4JS4 A;  3ZT4 A;  4KHN A;  5KGW A;  2DY4 A;  4KTW A;  1DTQ A;  1JLG A;  3QIN A;  3E01 A;  4CF0 A;  3KKS A;  1LWC A;  3KK2 A;  1YTA A;  4AHT A;  4E89 A;  4B3O A;  4FLX A;  1B92 A;  5DK5 A;  1RBU A;  3IAY A;  3V1O A;  1U04 A;  4O44 A;  1Q9X A;  1NK6 A;  3RRH A;  4FYD A;  2Q3S A;  4LSL A;  1IKX A;  5KRS A;  3LP0 A;  1GOB A;  1WSE A;  3TAM A;  3MEC A;  1A5V A;  1KVB A;  4N5S A;  3O3F A;  1N5Y A;  1D9D A;  4ELV A;  4DS4 A;  4RG8 A;  2OPR A;  3V1R A;  3QEP A;  2KFN A;  4N41 A;  3VQD A;  1VSD A;  4ID5 A;  4B9S A;  2ATQ A;  3QEX A;  3M8P A;  3O3H A;  2I5J A;  2DFF A;  1VRT A;  3TAG A;  3RMB A;  4E7H A;  3RMA A;  3V6D A;  3KD1 E;  3SQ4 A;  2X78 A;  3AVH A;  3RTV A;  1BCM A;  1JL1 A;  1RT5 A;  4FJI A;  4FJJ A;  1JLQ A;  5J1E A;  2P5O A;  1VSI A;  1BI4 A;  3D0P A;  1RBV A;  4JRP A;  4DFJ A;  3HVT A;  1KTQ A;  1KRP A;  3OJU A;  1CZB A;  1LWF A;  3ZSY A;  3ZT0 A;  4CJU A;  1Z25 A;  3NCI A;  3K5M A;  1VSL A;  2Z1G A;  4H8K A;  2F8T A;  3ALY A;  2HVH A;  3O3G A;  4NYN A;  3LZJ A;  2P1J A;  1TK5 A;  3NF8 A;  4Z4H A;  3SV3 A;  3QEV A;  1DLO A;  2HB5 A;  3SV4 A;  2G8W A;  4CGG A;  1YTU A;  1RDA A;  1WSI A;  4AH9 A;  4DFP A;  3DLG A;  4RW8 A;  3HP6 A;  3ZSV A;  3P1G A;  3OS0 A;  1SL1 A;  3OYN A;  4KAZ A;  3IS9 A;  4CIE A;  1MU2 A;  2ZE2 A;  1ASV A;  3C94 A;  3NBP A;  4LH4 A;  3ZT1 A;  1IO2 A;  1UAX A;  1QSS A;  3DLH A;  4AHC A;  3HM9 A;  3VQ5 A;  4IBN A;  1EP4 A;  3ZT2 A;  3MED A;  3L2Q A;  3NE6 A;  3NGY A;  1TKT A;  3VQC A;  1BQN A;  4N76 A;  3DRP A;  3OYL A;  3VQ4 A;  4E7I A;  1L3S A;  2LSN A;  4YNQ A;  4HCC A;  4RW9 A;  2FBX A;  5HRP A;  4CEO A;  2Z1J A;  4CFD A;  4FJ9 A;  4CJQ A;  1C0U A;  1HYV A;  2OPQ A;  3IG1 A;  1NJW A;  4DQP A;  3S3N A;  1UWB A;  4B9U A;  3L2V A;  1S1T A;  1T05 A;  3AO4 A;  3K5L A;  2IAJ A;  3UIQ A;  4CHQ A;  1TAU A;  2HMI A;  2DTU A;  4JLH A;  1T7P A;  4Q5V A;  3WNG A;  3KJV A;  3SI6 A;  2X6S A;  4OJR A;  4OKJ A;  4H4O A;  3LDS A;  4FLY A;  3LAN A;  1U49 A;  2KZZ A;  1HYS A;  3IRX A;  1J9A A;  3FFI A;  2IS3 A;  3BDP A;  3EZ5 A;  3VQE A;  4BE2 A;  1T8E A;  3AO5 A;  5SZT A;  5HRN A;  4DTM A;  2GUI A;  4XIU A;  2OZS A;  4K8Z A;  2HHV A;  2IOC A;  1NK8 A;  1NKB A;  3MXJ A;  1UOC A;  1ZBI A;  1CXQ A;  4ELU A;  4LH5 A;  4FM0 A;  2YNH A;  1CLQ A;  4DG1 A;  3V81 A;  3S3O A;  4KHW A;  3SJJ A;  2HNZ A;  2O4I A;  1RT4 A;  3CG7 A;  1JXB A;  4MQ3 A;  1BIS A;  2HHQ A;  3AVF A;  3HPO A;  4FJ7 A;  4CFA A;  1HRH A;  1XWL A;  5JS2 A;  4DTS A;  1TL1 A;  2QXF A;  3TI0 A;  3SNN A;  1SKS A;  3WNH A;  2HVI A;  4B9N A;  3MEE A;  3DLE A;  4CHO A;  5J2N A;  3HL8 A;  2VWJ A;  2PYJ A;  3DLB A;  4E1M A;  1RIL A;  4FW2 A;  4KI6 A;  2X74 A;  3L2U A;  3VN5 A;  1TV6 A;  3O4Q A;  4FLV A;  1QQC A;  3PY8 A;  1I3A A;  2GV9 A;  1NJX A;  3S9H A;  4FK0 A;  3CQ8 A;  3AVG A;  4E3S A;  3V4I A;  4AHS A;  4DS5 A;  1T03 A;  4OPK A;  4M45 A;  1KVA A;  3HPG A;  1S9G A;  1NK9 A;  4E0D A;  2BE2 A;  4CJV A;  1BGX T;  1WSJ A;  1JXE A;  3OY9 A;  5C25 A;  4FCY A;  2HHU A;  4CF2 A;  3CFO A;  3EY1 A;  4FM1 A;  4DF8 A;  3THV A;  1HQE A;  4AHR A;  1RT3 A;  1W9H A;  2HNY A;  4Z4F A;  5KGX A;  1KLN A;  4CJ5 A;  3SPZ A;  3OYF A;  2XY8 A;  1IKV A;  2VG7 A;  5HP1 A;  4LSN A;  2JLE A;  2OPP A;  3OS2 A;  2KZM A;  3L2R A;  3AV9 A;  4L8R B;  4AHU A;  1ITG A;  3CM6 A;  4LY7 A;  1XC9 A;  3AO2 A;  1JLA A;  3T19 A;  3SQ1 A;  1FKO A;  3QIP A;  1ASW A;  4DFK A;  1RTD A;  4F2R A;  4PUO A;  4PY5 A;  2IC3 A;  1WAF A;  3DI6 A;  4HHT A;  5CYM A;  3OYI A;  2DFH A;  3LWL A;  1RBR A;  4AHV A;  2RPI A;  4M41 A;  4FJX A;  3SUP A;  4I2Q A;  1NK0 A;  1SL2 A;  1VSK A;  4CES A;  3TAN A;  3T1A A;  2ZD1 A;  3VA0 A;  1RT7 A;  3PV8 A;  4CEC A;  4Z4G A;  4E19 A;  5C42 A;  1WSG A;  4O4G A;  1RCH A;  1UA0 A;  1NJY A;  3QEI A;  1S1U A;  3RRG A;  2WON A;  3V9X A;  4N56 A;  3HT3 A;  1XHZ A;  4CJE A;  4FZZ A;  1WNS A;  1S5J A;  4KV8 A;  4NYF A;  1DTT A;  4RW7 A;  3AO3 A;  3RR8 A;  1S6Q A;  1C1B A;  1EX4 A;  4E7L A;  1SKW A;  1TGO A;  2P5G A;  4KPY A;  4M3U A;  4E7J A;  4DTX A;  4DTO A;  4FK2 A;  4IG0 A;  4CJL A;  4W5R A;  4JRQ A;  1JL2 A;  2A1R A;  2WOM A;  1K6Y A;  4Y1D A;  3L3U A;  1FXX A;  4DQR A;  2G8V A;  2E6M A;  3CFP A;  4B08 A;  5K14 A;  4DSF A;  2NUB A;  4B9V A;  4J2A A;  3RMC A;  3QER A;  2EX3 A;  3LPT A;  4ZTF A;  1QSL A;  3B6O A;  4DTJ A;  3LAM A;  4ID1 A;  1FKP A;  3K59 A;  1D8Y A;  4CJF A;  1IKY A;  4DTP A;  3DLK A;  3AVJ A;  4KFB A;  2HHW A;  3OYC A;  1IH7 A;  3HPH A;  4F3T A;  4UQG A;  3EYZ A;  1B9D A;  4M3X A;  1VSM A;  3TAQ A;  4C8M A;  5HRO A;  1X9M A;  1YT3 A;  1L3U A;  4DMN A;  5E41 A;  4CEB A;  4DLE A;  4CGF A;  5J2M A;  1WSF A;  2VG6 A;  3NH0 A;  5FRN A;  5I3U A;  2DFE A;  3K2P A;  4NCG A;  1XI1 A;  4OKE A;  4CGJ A;  4DU4 A;  4CJ3 A;  2Y1J A;  5DMR A;  1SUQ A;  3OS1 A;  4W5Q A;  3AA2 A;  3AA5 X;  3AVI A;  1KCF A;  5J2P A;  1JKH A;  2B5J A;  4OGE A;  1VSJ A;  1ZYQ A;  4B8C A;  4I9L A;  4CGH A;  4CGI A;  1NKE A;  2HW3 A;  2XY7 A;  4QAG A;  1EET A;  3QNN A;  2ITG A;  4NCB A;  2HHX A;  3ZSW A;  2OA8 A;  4DU1 A;  5KTQ A;  4CED A;  4EP5 A;  1RT2 A;  1U4B A;  1KLM A;  1QS4 A;  3JSM A;  3AVL A;  4BWJ A;  4NCA A;  1HNI A;  1TK8 A;  4HCB A;  4I9Q A;  4C8L A;  2BGG A;  1JLC A;  1VSH A;  4KKO A;  4CJP A;  4ZHR A;  3WNE A;  1C1C A;  4Z4C A;  1X1P A;  3MAQ A;  3DOL A;  4HUF A;  2EHG A;  3K5O A;  3RMD A;  1RTH A;  3NF7 A;  3ZSZ A;  1X9S A;  1LAV A;  3OYM A;  3KTQ A;  4CIF A;  4F3O A;  4DQQ A;  3KLG A;  1CZ9 A;  2F96 A;  2YHA A;  4CEQ A;  4HUE A;  4OLA A;  2B6A A;  1BI4 B;  1LW0 A;  4CCH A;  4OGC A;  4GMJ B;  3QNO A;  4DF4 A;  1ASU A;  1RDD A;  4CJR A;  3ISN C;  5HRS A;  3DRR A;  3C6T A;  1D5A A;  4EZ9 A;  4DSK A;  2QK9 A;  4HVJ A;  3KIO A;  4KHQ A;  2G8H A;  3P83 D;  3KKR A;  4FJK A;  2YKM A;  1A5X A;  4DTU A;  1ZBL A;  3KLH A;  3HO1 A;  3AA3 A;  4M3R A;  4O0I A;  2FBT A;  4IKF A;  1Z26 A;  3PO4 A;  2BAN A;  5CYQ A;  3M8R A;  1S9E A;  4IFV A;  1QSY A;  1QE1 A;  5CY4 A;  1L3V A;  3DRS A;  4MFB A;  4O55 A;  3WNF A;  4QOZ B;  4FZX C;  5I42 A;  2D0B A;  3V1Q A;  5FDL A;  4IFY A;  4CEE A;  1VSE A;  3KLI A;  1VRU A;  3OYA A;  4J2D A;  4C8O A;  4CHN A;  3I8D A;  3MEG A;  4FJH A;  4J2E A;  3PO5 A;  2B4J A;  4O5B A;  3DM2 A;  3QIO A;  3DOK A;  1F21 A;  3QO9 A;  5HBM A;  1IG9 A;  4DSL A;  3AVB A;  4FJ8 A;  4CHP A;  5SWM A;  3NF9 A;  1GOA A;  4CK2 A;  1RNH A;  2YNF A;  3NHG A;  2QKB A;  1BHL A;  2YNG A;  2XHB A;  4M3T A;  1I39 A;  1HMV A;  3BGR A;  3SUO A;  4DQS A;  4M3W A;  3TAP A;  4KHU A;  2KW4 A;  3SZ2 A;  1S1W A;  3JYT A;  3SUN A;  1ZBU A;  4Z4I A;  4DSE A;  5CZ2 A;  3NH1 A;  4KB0 A;  2X6N A;  3CFR A;  1KFS A;  4CEA A;  1BIU A;  3D45 A;  4FZY A;  4FJG A;  1WSH A;  1WAJ A;  3B6P A;  4FLW A;  3AO1 A;  2YV0 X;  3V9W A;  1EXQ A;  3VQA A;  3ZSX A;  4CIG A;  5C24 A;  4BE0 A;  4ICL A;  4CHZ A;  4CJK A;  4ZTJ A;  2PYL A;  3LAL A;  4CJT A;  4LD0 A;  3OYG A;  1TKX A;  2Z1H A;  3O4N A;  4IDK A;  1RTJ A;  4HUG A;  4CJW A;  1QTM A;  1J5O A;  3ZSR A;  4B9L A;  2YHB A;  4CK3 A;  3HXM A;  1NK4 A;  1LV5 A;  3ZT3 A;  3V9U A;  4M42 A;  3NF6 A;  1J54 A;  4KTQ A;  1ZBF A;  4CJS A;  4KB1 A;  3RR7 A;  3MXM A;  3NDK A;  2FBY A;  3VQ7 A;  4W5N A;  1RTI A;  4CF9 A;  4BDZ A;  3AVN A;  4BWM A;  4B9T A;  2HHS A;  3L2W A;  3F73 A;  1BQM A;  4M3Y A;  2XY6 A;  2E4L A;  2O4G A;  1NK5 A;  4DTN A;  4EZ6 A;  1TK0 A;  4FK4 A;  3HP9 A;  1D9F A;  1VSF A;  4CE9 A;  4K8X A;  2E6L A;  3VQ9 A;  5HRR A;  1CXU A;  3K58 A;  4F8R A;  1R0A A;  1RDC A;  3ASM A;  1Y97 A;  1YVU A;  1S6P A;  2XO7 A;  1XHX A;  1TVR A;  2OPS A;  3G10 A;  3OJS A;  5CZ1 A;  1RT1 A;  3ITH A;  1G15 A;  2F8S A;  1KVC A;  4DWI A;  3I0R A;  3DLR A;  1U48 A;  2ZQB A;  4BE1 A;  5FRO A;  3SUQ A;  1NJZ A;  3PUF A;  1NOY A;  2OZM A;  1VK0 A;  4Z4E A;  3LP2 A;  2G8F A;  3U6F A;  4W5O A;  2Y1I A;  4CJ4 A;  3KK3 A;  1SV5 A;  4KTZ A;  4CF1 A;  1HQU A;  3ZSO A;  1Q9Y A;  4Q0B A;  3NH2 A;  4KHS A;  4OPJ A;  3OYJ A;  4RW4 A;  1TKZ A;  2KQ2 A;  2IGI A;  3TAR A;  4CFB A;  4DFM A;  3KD5 E;  2HHT A;  3SQ2 A;  4B8A B;  1Q8I A;  3TR8 A;  3TAB A;  4GVM A;  3NFA A;  1EKE A;  3L8B A;  4CEZ A;  4M3Z A;  3KLE A;  1TL3 A;  3OYH A;  2IDO A;  3LP3 A;  3F9K A;  4KO0 A;  4AIL C;  4ELT A;  4FJL A;  3HST B;  4DQI A;  4PQU A;  2D5R A;  3P5J A;  4DU3 A;  4FJM A;  5FRM A;  1IKW A;  3U3Y A;  1B9F A;  3PX4 A;  4W5T A;  1NKC A;  4J2B A;  1RBT A;  1X9W A;  2JGU A;  4GW6 A;  3TWH A;  4CER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...