4CJPA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
148
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 148
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjpA00
1NKCA 2KZZA 1SL1A 2OYQA 3RMAA 4ELVA 5CZ2A 4I2PA 5HLFA 3K58A 2Z1GA 3AO3A 4DFKA 2G8VA 3DLBA 3NFAA 4CGHA 3KK3A 4BACA 3K59A 1JLQA 3V81A 1BGXT 5C24A 1U45A 2G8HA 4IFYA 4DTMA 4OVLA 4AHCA 2G8IA 2G8UA 1HQUA 3TABA 2Y1IA 3KKRA 4RW8A 4M3RA 5HRSA 3OS2A 2OZMA 3I0SA 2KQ2A 1SV5A 4O0IA 1NK8A 1WSEA 4CEEA 1XHXA 3M8RA 1KCFA 3S9HA 1XC9A 1VSJA 1VSMA 3ULDA 3TAQA 4CGFA 3OVNA 2DFEA 2KFZA 1D5AA 1NOZA 5KGXA 3KLFA 1B9DA 1I39A 1DTQA 1KTQA 4KFBA 3ALYA 4DFPA 1L3TA 2HNYA 1VRUA 2HHTA 2PZSA 2HHUA 1EX4A 1TAQA 2E6LA 2VG7A 4FLYA 3NGZA 3TAFA 2A1SA 1U47A 1WSGA 3T19A 3M8SA 2ATQA 4CCHA 3HPHA 1L3UA 4CGDA 5FDLA 1NOYA 1LWEA 4DTSA 1C1AA 4Y1CA 3OJUA 1C6VA 1WSIA 3ZT1A 2EHGA 3OYDA 1NK6A 4IBNA 4CK1A 1C0TA 4CJSA 3E01A 3VQEA 3TANA 1QSLA 1KFDA 4EP4A 3NBPA 4N41A 5I42A 4KI6A 1VSDA 4FYDA 2RPIA 1WSJA 2QXFA 3OYEA 4M45A 4DTJA 1QSSA 1RTDA 3AVCA 3QNOA 3M8QA 1NK5A 3NF9A 4DS5A 2IC3A 3NH2A 4BE0A 1RT5A 4FLXA 1BI4A 3V9UA 2HB5A 4FK4A 3KLHA 4XIUA 2DTUA 4CHQA 3QEVA 4H8KA 2YHBA 1TV6A 3SPYA 3H08A 1TKDA 3AVJA 4DLEA 4AHVA 1XI1A 4NYFA 5FROA 3OYKA 4HUGA 3QETA 2HVIA 2G8FA 4J2DA 4PQUA 2I5JA 3DI6A 4FJ7A 4JLHA 5C42A 1WSFA 4C8KA 3HPGA 1SKSA 1ZBHA 1HNVA 3V1RA 2OPSA 4C8NA 3MAQA 1NKEA 3VQCA 3AVLA 2BDPA 4B9MA 1Q9YA 3OYLA 3AA2A 2ZE2A 2E4LA 2OPQA 3ZSRA 3OYCA 5J2QA 3HM9A 1Q9XA 3I8DA 4J2EA 4B9SA 1MU2A 1RDAA 3HO1A 5CYMA 4BDZA 4FM0A 2FBVA 3FFIA 5HROA 1C1BA 4IFVA 1BIUA 3AA3A 3MEEA 4RW9A 3IG1A 3OYNA 1KVAA 4DSJA 1K6YA 3ISNC 1UA0A 4AHTA 3OS1A 1ZYQA 3VQAA 1UOCA 4CFAA 4KV8A 2D5RA 4GW6A 1TAUA 4LSLA 1O1WA 3DLRA 3KD5E 3KJVA 3DOKA 3NDKA 3VQ8A 4DS4A 1L3SA 3QEIA 2G8WA 3KD1E 1VSEA 3A2FA 3LP1A 4H4MA 4CFDA 3V9ZA 3RMDA 4CECA 1NJYA 3OYBA 1JLCA 4O4GA 4AILC 2A1RA 5HRPA 2FBTA 4FJ8A 4KB1A 2F8SA 2HHSA 2YNIA 1RT2A 4N56A 3DRSA 1ZBLA 2HHQA 1B9FA 3KIOA 4CF2A 1FK9A 3WNGA 3CG7A 1D9FA 4F4KA 3D45A 3LAMA 4FJKA 2YNGA 4F3OA 4ID1A 1RILA 1BQNA 4OGCA 2D0CA 1D8YA 5E41A 4ICLA 4QAGA 3NE6A 2HNZA 3P83D 2LSNA 2Z1HA 3JSMA 2YKNA 3BDPA 1TVRA 4KB0A 2XO7A 1J9AA 4CGGA 4FLUA 4BDPA 2BGGA 3QEXA 3HPOA 2KW4A 4FJLA 1RT7A 4CIGA 1X9MA 1ZBUA 1HYSA 4KKOA 1U48A 1TK5A 2HMIA 3HT3A 2X6NA 1Z26A 1F21A 3LDSA 1VSKA 1S6PA 3HP6A 3VA3A 4FXDA 2X74A 2GV9A 4QCLA 1TL1A 3L3UA 2GUIA 4HUFA 3O3GA 2X78A 5CYQA 1IH7A 1YTUA 4MQ3A 1RNHA 3P5JA 2QKBA 4E3SA 4KPYA 3ZT0A 3DLKA 3CM6A 1JLFA 4FJXA 1TKXA 3AVGA 1DLOA 3U3GA 3DRRA 1HNIA 1I3AA 3DRPA 1BISA 1RBSA 5JS2A 4DFMA 1HMVA 3I0RA 4G1QA 4IG0A 2ITGA 2JLEA 1WLJA 1CXQA 3HVRA 1QHTA 5KGWA 4DTPA 1UA1A 3NF6A 3RTVA 3HSTB 2HW3A 4OPKA 5DK5A 4Z4EA 1KLMA 4E0DA 1LW0A 3MXMA 4CEFA 3OY9A 2P5OA 3MEGA 2P51A 4W5NA 3PY8A 1SL0A 3O3HA 3SQ1A 1RT4A 4CGIA 3NGIA 3L3VA 1TL3A 3QIPA 4H4OA 4MFBA 1HJRA 1CLQA 3S3OA 4LH5A 4CHNA 4KREA 2EX3A 4KHQA 1A5WA 2RN2A 2VG6A 4CEAA 4B9VA 1S1VA 3MECA 1QQCA 2YV0X 4KTQA 4CJVA 3L2VA 2GBZA 1A5VA 4M3ZA 4Z4IA 1JXEA 4AHUA 1EETA 3SQ4A 4FJ5A 3HK2A 4DFJA 3ZSQA 1TK0A 1BHLA 3QESA 4O55A 2B4JA 4J2AA 5FRNA 4CHYA 3OS0A 2R7YA 1RDCA 3HYFA 4TSXA 4B9TA 3AO4A 3MXIA 4O5BA 3NF8A 3G10A 1EXQA 2XY8A 4BDYA 1U4BA 2E6MA 2OPRA 4DLGA 4C8LA 3AVFA 3AVKA 3LWLA 1EKEA 3C6TA 4NCBA 3D0PA 4DWIA 2PYLA 3ZSVA 4FZZA 4KI4A 4Z4FA 3KK2A 4B9UA 5KTQA 4FZYA 4I9LA 1RBTA 2ZD1A 3AVIA 4Q5VA 1N6QA 4JRPA 4I9QA 2IGIA 4K8ZA 1JL1A 3AA4A 3T3FA 3T1AA 4FM2A 3RRGA 4L8RB 2D0AA 3ZSXA 1VSFA 3RRHA 4KHWA 4KRFA 4M41A 4LH4A 4DSFA 1W9HA 3SPZA 4DSIA 3AA5X 4CJ5A 3AVNA 2XY5A 3TARA 3ASMA 4ZTJA 1TGOA 1WNSA 3AO1A 1KFSA 1A5XA 2IDOA 3OYGA 3F73A 2Q3SA 3V9WA 3OJSA 5J2PA 1L5UA 3C95A 1QS4A 1RBRA 1CXUA 3F9KA 4OPJA 4OKKA 4CF8A 4KHUA 4OLBA 4O0JA 3KLGA 3ZSWA 3OYAA 4FJHA 4Q0BA 3MXJA 1W0HA 4OGEA 1IKXA 2G8KA 4FK2A 3AO5A 2OZSA 1S1XA 3RMBA 2B6AA 4ZTFA 4FJMA 2FBXA 3SUPA 4E7KA 3TAGA 4CK2A 3CYMA 3JYTA 4BE1A 3AVHA 3QIOA 4CJWA 3ZCMA 4DSEA 4LD0A 1BCOA 1JXBA 4FJNA 1DTTA 4CFCA 3QINA 3QO9A 4IDKA 4W5QA 4CJRA 4CJTA 3AO2A 3O4NA 4B08A 4M3XA 4DQIA 1ZBIA 4FJ9A 1SKWA 3ZSOA 3IS9A 3MEDA 4FW1A 3QERA 3PO4A 1CZBA 2XY7A 3KKSA 2PY5A 3TAMA 1HYZA 4Z4CA 3OYFA 1RTHA 5I3UA 4B3OA 4GVMA 4Y1DA 3ZSZA 4CFBA 3SYZA 1ASUA 1RBVA 3CFPA 2QKKA 3V9XA 1NK4A 4E7LA 2F96A 1JKHA 1RCHA 1RTIA 2JGUA 4NCAA 3HP9A 1GOAA 3EY1A 2DY4A 3PX4A 3CM5A 5HRRA 4CERA 4FVMA 3B6OA 3HXMA 4DU4A 1NK0A 3UIQA 2HNDA 4OLAA 4IKFA 2BE2A 5HP1A 2Z1IA 2X6SA 3SJJA 3CFRA 2OPPA 1HQEA 2D0BA 3SQ0A 4KHYA 4CJ3A 3PX6A 5KRTA 2XRIA 4OJRA 3P1GA 4DG1A 3L8BA 1RTJA 4JS4A 3VN5A 2YNHA 1C0UA 4DQRA 3L2UA 4FJGA 1VSHA 4AHSA 4OKJA 3K5OA 2IAJA 4DMNA 1CZ9A 1VSIA 3LAKA 4BWMA 4CE9A 3HJFA 1G15A 5SWMA 4CJFA 2IS3A 1UWBA 3THVA 1FKPA 3V1QA 3DOLA 1TK8A 3VQPA 4PA1A 3S3MA 3BGRA 1LAVA 5J1EA 5KRSA 3SV4A 1JLEA 4DTOA 3VQ7A 5C25A 2YKMA 1L3VA 4HUEA 3NF7A 3VQ9A 3VQ4A 2IOCA 4E1NA 3DM2A 4FZXC 4E7HA 2ZQBA 3EZ5A 4CJEA 1EP4A 1WSHA 5JS1A 4NCGA 5K14A 2VWJA 3LP3A 3LP2A 3VQ5A 3LZJA 1ZBFA 4B8CA 4CJPA 1YVUA 4B9LA 4M3UA 1B92A 1GOBA 4IG3A 3OYIA 2XHBA 2HHXA 4EP5A 2HVHA 4F3TA 5FRMA 3K2PA 1Y97A 3NAEA 2RKIA 3TI0A 3TAEA 1X9SA 2KTQA 3HVTA 3QEPA 2QK9A 1Z25A 3ZT2A 4FCYA 2P5GA 4E89A 2VWKA 1IG9A 1REVA 1JLGA 4UQGA 4Z4HA 4DQSA 1Q8IA 2Z1JA 4DSKA 4AH9A 4M42A 1RDBA 3U6FA 1GOCA 1NK9A 3U3YA 2VG5A 1T7PA 3SI6A 3LANA 4DTUA 1S6QA 4DTNA 1NJXA 3RR7A 3WNHA 1WAJA 1U49A 4N76A 3NH1A 4N5SA 3DMJA 4CJ4A 2DFFA 1KRPA 4ELTA 4CF0A 2O4GA 4FJIA 4ZHRA 3AV9A 2DFHA 3NCIA 3AVBA 1XHZA 4EZ9A 4DQQA 5T7BA 1J5OA 3CQ8A 1JL2A 4QOZB 3VQQA 4DF4A 4FK0A 1JLAA 2HHWA 1BCMA 3EYZA 4AHRA 4BWJA 4CF1A 3K5LA 3K57A 4KAZA 4CEQA 4DQPA 1JLBA 3LALA 5EU7A 3LZIA 3TAPA 1C1CA 2W42A 4K8XA 4J2BA 4RW7A 4Z4GA 3CFOA 3K5NA 1T05A 4F2SA 4E7JA 4FLVA 4DTRA 4DTXA 4E7IA 4OKEA 5CY4A 1R0AA 4WE1A 3LPUA 1KVCA 3G0ZA 1LWFA 1RDDA 1YTAA 4CIFA 3ITHA 3NHGA 3HL8A 3SUNA 3RR8A 1LV5A 1S1TA 3ZT3A 4FLTA 5J2NA 2HHVA 4PY5A 2AJQA 4HVJA 1BQMA 3KLEA 1ASWA 2RF2A 4ELUA 5KI6A 4M3YA 1ITGA 4RG8A 3PV8A 1QSYA 1IO2A 3O4QA 3PO5A 4FJJA 2NUBA 3LWMA 1BIZA 1XWLA 4I7FA 4CJUA 1IKVA 1LW2A 1WN7A 4W5TA 4W5OA 4HCCA 5D3GA 4FLZA 1BL3A 4B9NA 2XY6A 4HCBA 4CJLA 4KTZA 3WNEA 3ZSYA 3NH0A 5J2MA 4LY7A 3DLGA 4CJQA 1IKYA 4CHOA 3VQ6A 4E19A 3C6UA 3SQ2A 1D9DA 4DSLA 4ID5A 4CGJA 1S9EA 1TKZA 3DLHA 3C94A 1VK0A 4PWDA 3AVAA 4M3WA 3SNNA 3IRXA 2F8TA 4LSNA 1QTMA 1T03A 3QLHA 1NKBA 1SL2A 3RWUA 3PUFA 5HBMA 4CK3A 5HRNA 3V9SA 2O4IA 3DLEA 3DYAA 4DU1A 4CJKA 1VSLA 3QNNA 4M3TA 5SZTA 2WOMA 4DF8A 1RBUA 1QE1A 3PX0A 3LP0A 1HPZA 1LAWA 1X1PA 3SUQA 1TKTA 2P1JA 3B6PA 3S3NA 4I2QA 1KSPA 4O44A 1U04A 1ASVA 3VA0A 4CEOA 3O3FA 3IAYA 4DU3A 2FBYA 3KLIA 2WONA 4FW2A 3NGYA 3V1OA 3RMCA 4NYNA 1HYVA 4CEBA 1HRHA 3ZT4A 4E1MA 1RT3A 3SZ2A 2B5JA 4F2RA 4YNQA 1NK7A 1T8EA 3TWHA 1X9WA 2ETJA 4R5PA 1SUQA 1N5YA 1C0MA 5CZ1A 3VQDA 1S1UA 3L2QA 4CEZA 4FM1A 3L2WA 1WAFA 1VRTA 4KO0A 3VQBA 3L2RA 1NJWA 4F8RA 2FC0A 3QEWA 4HHTA 3KTQA 1UAXA 2PYJA 1NJZA 2BANA 1BI4B 4CHPA 4RW4A 4KHSA 4CEDA 2Y1JA 4GMJB 4EZ6A 3V6DA 4N47A 1YT3A 4PUOA 5DMRA 1KVBA 3AVMA 4C8OA 1J54A 3K5MA 4KTWA 1LWCA 1J53A 3KK1A 4BE2A 1IKWA 4Z0UA 4HTUA 4YFUA 3OYHA 3LPTA 4W5RA 2YHAA 1RT1A 4KHNA 4CIEA 4CHZA 3SV3A 4B8AB 1FKOA 4CF9A 3OYMA 4JRQA 1FXXA 3SUOA 1RT6A 2YNFA 3WNFA 2KFNA 2OA8A 3M8PA 4RW6A 4C8MA 4CESA 3TR8A 1S5JA 4FLWA 1S1WA 2KZMA 3V4IA 1KLNA 3OYJA 3SCXA 4JS5A 1SKRA 1S9GA
chains in the Genus database with same CATH superfamily
1NKCA 2KZZA 1SL1A 3RMAA 2G8VA 4DFKA 4BQLA 3HSCA 3NFAA 4CGHA 1VQPN 4BACA 5BN9A 3ZX0A 3K59A 1GLDG 1BGXT 1U45A 1R59O 2G8UA 2Y1IA 3QMLA 4O0IA 1NK8A 3M8RA 1KCFA 5BREA 1VSJA 1VSMA 4JI3K 4DR7K 3HZ6A 4KFBA 3ALYA 4JD2B 1L3TA 2E6LA 2HHHK 1WSGA 2ATQA 4GVEA 3HPHA 4B3TK 1NOYA 1LWEA 2W6KA 3EZWA 4Y1CA 1JJ2M 3H1QA 4PHTX 1WSIA 4CD1A 1C0TA 4CJSA 4N41A 1KFDA 1VSDA 4FYDA 1WSJA 4QS9A 3OYEA 4DTJA 1QSSA 3VTIA 3M8QA 4FLXA 1BI4A 2FSKA 3V9UA 4FK4A 4FWQA 3KLHA 2YHBA 4BRHA 5GADP 4NXMK 3OYKA 4BC2A 4HUGA 2HVIA 4J2DA 4EAHD 4FJ7A 4JLHA 5C42A 4U67L 2VGMA 1SKSA 1ZBHA 4PL7A 2OPSA 3CJ7A 4MDBA 1Q9YA 4DV4K 2D4WA 3FFIA 4BREA 2P9IA 1C1BA 3WQUA 3CJBA 4IFVA 2NLXA 3AA3A 1GLAG 5AZJB 4JKBA 3WEEB 1OH6A 2KHOA 3VEZA 3KHYA 3T69A 1ZYQA 3VQAA 4KV8A 4KH6A 2YHYA 4WFNL 3KJVA 3NDKA 1L3SA 2G8WA 4CFDA 3V9ZA 1Q18A 1JLCA 2A1RA 4JHDB 3QBWA 5HRPA 4FJ8A 2HHSA 2F8SA 4HTLA 2YNIA 1KAXA 3G25A 4GY2B 4F4KA 4K0KK 3D45A 1CZAN 2YNGA 2YJFA 3WUHA 5M1KA 4ID1A 1RILA 5KPRA 3LL3A 3DJCA 3NE6A 3CJ1A 3P83D 3BDPA 4YOYA 4KB0A 1Z05A 4BC5A 4CGGA 4YOUA 3CCUN 2BGGA 2NRRA 2NZTA 1RT7A 4CIGA 1NMNA 4KKOA 3VEVA 1U48A 2HMIA 4B1XB 3HT3A 1F21A 3HP6A 3VA3A 2PFUA 4AM7A 3J7ZO 1SS6A 2E1ZA 3H3NO 4DQ8A 1VHXA 1YTUA 2IIRA 1RNHA 4KPYA 3CM6A 3FR0A 1TKXA 5BPLA 1DLOA 1HNIA 3DXMB 3CCSN 3DRPA 1RBSA 1NGDA 3I0RA 2NNWA 4FWSA 4IG0A 1UA1A 1WLJA 1QHTA 4OPKA 4O5FA 4B3RK 5AQPA 3M6GA 3KWIA 3CQYA 2P5OA 3WXKA 1XC3A 5JLFA 3TTCA 1RT4A 3U9ZA 4CGIA 2E1YA 3O80A 2OCEA 3H46O 4MFBA 3S3OA 2EX3A 4JI0K 2GBZA 1NLVA 4Z4IA 4AHUA 3VMFB 3PSFA 3ZSQA 5TKYA 4TSXA 1K73O 3AO4A 4O5BA 4V19S 4MO5A 1EXQA 5AQLA 3D2FA 3AVFA 3FZKA 3C6TA 3D0PA 3R8EA 3A8YA 4I9LA 4I9QA 4A5AA 4K8ZA 4FWPA 2I7NA 4YHHK 3EKUA 4L8RB 4BR0A 3TTDA 4C23A 1ATNA 1VSFA 3RRHA 4KRFA 2O8FA 4LH4A 1HKGA 1OVQA 2XY5A 4ZTJA 4CD3A 1E3MA 2P9LB 3O8MA 1KC8O 5M1OA 5C0YA 4A2AA 1CXUA 2GWKA 4CF8A 1BDGA 3ZSWA 2QW9A 4OGEA 2OZSA 3RMBA 3PIOL 2F7TA 2ITMA 3TAGA 3WQTA 3CYMA 3JYTA 1DT9A 3QIOA 1BCOA 4FJNA 4CFCA 3QINA 1P90A 4M3XA 4DQIA 1T6DA 3QERA 3THYB 4H0XB 5B8HA 3ZSZA 4CFBA 3SYZA 3A5MC 3A5NC 2QKKA 3BZCA 3V9XA 1NK4A 3IKMA 4E7LA 2W41A 1RTIA 4NCAA 4JKGA 4B1WB 3EY1A 1NK0A 3B6OA 3UIQA 4G9ZA 5HP1A 1GLEG 5FPEA 3SJJA 3O9SA 2D0BA 1NBWA 4YORA 2FSJA 4DG1A 3J81O 3L8BA 1C0UA 4DQRA 2BUPA 4GNIA 4OKJA 3K5OA 1S3XA 2IAJA 4B3SK 5SWMA 2E2QA 5KPTA 3THVA 1FKPA 3V1QA 5LMNK 3THWB 2G8KA 4DTOA 3VQ7A 4LF8K 4HUEA 3VQ9A 3H6EA 5IWAK 3CCLN 3DM2A 4FZXC 3DWLA 4E7HA 5JS1A 4NCGA 4E1JA 3CMAN 3LP3A 3LP2A 4BRIA 2O8EA 3AAPA 1B92A 1GOBA 5E26A 2HHXA 4EP5A 2E88A 3JAMO 5FRMA 3K2PA 1JCGA 1Y97A 5MLCQ 3NAEA 3GDQA 1X9SA 2D0OA 4H5VA 1Z25A 2WC9A 3CPEA 4QS8A 1IG9A 4DQSA 1Q8IA 1ZBSA 4DSKA 4AH9A 1EWRA 1NK9A 2VCPA 1T7PA 4A59A 3LANA 4DTNA 1S6QA 4K42A 2DFFA 4ZHRA 3NCIA 3I56N 2ZJRL 4LF4K 1JL2A 1IBKK 3QICA 3VQQA 3ID6A 2HHWA 3K5LA 4AHRA 4KAZA 3K57A 2UYTA 4PL8A 4XH5A 3TAPA 1C1CA 3I33A 3LM2A 1T05A 1RDWX 4E7JA 4FLVA 1VQLN 5CY4A 2BTFA 4WCEL 4LC9B 1LWFA 1YTAA 4NO7A 1QQMA 1S1TA 4FLTA 4Z94A 4HVJA 1BQMA 3KLEA 1NJIO 1ASWA 4ELUA 1LOTB 3CCRN 4RG8A 3PV8A 1YUWA 1QSYA 1IO2A 2P9KA 4YOTA 3ZEUA 1BIZA 1XWLA 3UKRA 1IKVA 4B1ZA 4IJNA 4HCBA 4B9NA 1SAZA 3WNEA 5J2MA 3DLGA 2P9PB 2E20A 4KH4A 2VQFK 4KBOA 4E19A 1RDUA 3C65A 4JI6K 4ID5A 3C94A 4PWDA 2UU9K 3O9RA 1NKBA 3RWUA 2W40A 3DLEA 3ZLJA 1VSLA 4FPBA 3VEWA 3PSIA 3SBTA 3LP0A 1HPZA 1TKTA 2P1JA 1KSPA 5AQFA 4I2QA 3VA0A 3ENOA 2FBYA 2O8DB 4NYNA 1HYVA 4E1MA 4YNQA 3SJHA 3Q7CA 4DV0K 2ETJA 3VGMA 5F1XA 3L2QA 1WAFA 3VQBA 3WXMB 4BRFA 1E4GT 3D2FB 1VQ4N 3KTQA 3H45C 3KVGA 4KHSA 4EZ6A 4GMJB 2E8AA 4C8OA 3MMVA 3BF3A 4IDHA 2UUAK 5BRHA 3MX5A 1LWCA 4DR2K 2YHAA 3LDLA 1NU0A 4CIEA 5JLHA 3SUOA 3ZETA 4A62A 2KFNA 2OA8A 1S5JA 5AQMA 1KLNA 4JS5A 1SKRA 4FJ5A 2IVPA 3ZYYX 4ELVA 3K58A 2Z1GA 3BEXA 3K0SA 3DLBA 3KK3A 1JLQA 4DCHA 1TYQA 4OVLA 4AHCA 2G8IA 3TABA 1BO5O 4X62K 3KKRA 4M3RA 3AY9A 3SMPA 4CEEA 5AQSA 4WF9L 3S9HA 1XC9A 3S41A 3ULDA 1K8KA 3TAQA 1D5AA 2KKZA 1B9DA 5AZIA 1DTQA 2HNYA 2HHUA 2VG7A 4IOCL 3TAFA 1U47A 4C1NI 1FW6A 2YI1A 4CGDA 5FDLA 3EE9A 1C1AA 3Q7BA 3ZT1A 3OYDA 1NK6A 4K41A 4CK1A 1D4XA 2QWMA 1QSLA 4EP4A 3NBPA 3VESA 4J8FA 1BA1A 3NF9A 1N33K 3D2EA 2DTUA 4XIUA 4CHQA 3SPYA 1TKDA 1TUYA 3R9PA 4AHVA 4NYFA 4ISFA 5JVGL 4CZKA 5FROA 2G8FA 4H0PA 3A0IX 2V7ZA 3CC4N 2D1KA 5JICA 2Q0UA 4C8NA 3RSEB 2BDPA 4FWMA 2ZE2A 2OPQA 3ZSRA 3TU5A 1N32K 3HM9A 3I8DA 3CF5L 5FPDA 4B9SA 1RDAA 5CYMA 4BDZA 5CE3A 4FM0A 4JKHA 1BG3A 1BIUA 3QBXA 2ASPA 3MEEA 4RW9A 3IG1A 3OYNA 4ILJA 1K6YA 1UA0A 1JCFA 3VF2A 5AQJA 4LSLA 1O1WA 3KD5E 4X66K 3LM9A 3VQ8A 1WB9A 1VSEA 5AQZA 5F0XA 4M7YA 4O4GA 3CQXA 4DR3K 4H0OA 2IVNA 1X9JA 4N56A 1B9FA 4BRAA 4CF2A 1D9FA 4YDUC 4M63C 4F3OA 5C2DA 4DV6K 4FO0A 5E41A 2HNZA 2Z1HA 1OKJA 4JI7K 3ZX3A 4XH4A 2Q36A 1P8ZA 4JI5K 3WT0A 1HYSA 1C0FA 4JN4A 1H1VA 4LF6K 4FXDA 1QQNA 2GV9A 4JV5K 4BC4A 2GUIA 5M1QA 2X78A 1IH7A 4MLEA 4MQ3A 5AQHA 3VEXA 1JLFA 2P9KB 1ZC6A 3AVGA 3UKRB 3H3OB 1BISA 4A5BA 4DFMA 3EE8A 4G1QA 2ITGA 1CXQA 4BRLA 5KGWA 3HVRA 2UXCK 4RTFD 2HW3A 3HOSA 1KLMA 4FWOA 4X64K 1LW0A 1KAYA 4YDUA 3MEGA 2P51A 3PY8A 2ZGZA 3SQ1A 3F2KA 4JAXA 2WBNA 4KREA 4KHQA 3SAFA 3I8BA 1QQCA 2YV0X 1A5VA 4M3ZA 1JXEA 3SQ4A 1EETA 3HK2A 4DFJA 3QESA 4JI4K 2B4JA 4DV5K 4UY8O 3OS0A 1RDCA 3HYFA 3THXB 4B9TA 2J4RA 5E84A 3P4IA 4CZFA 1YHQN 1N8RO 2XY8A 1HX1A 2GEMA 1U4BA 4DLGA 4IEEA 4IXCA 2PBDA 4ISEA 3LWLA 4NCBA 2PYLA 4FZZA 2O8CB 3G6EN 3KK2A 4B9UA 5KTQA 4FZYA 3AVIA 3FZFA 2IGIA 2NRXA 3LDPA 3T3FA 4FM2A 1HUXA 3ZSXA 4M41A 1W9HA 3AA5X 4CJ5A 3AVNA 4OPAA 1IG8A 3ASMA 1TGOA 1KFSA 1A5XA 2A3ZA 2IDOA 3F73A 1G99A 4JI8K 1KAZA 1QS4A 3O5BA 4NLBA 3F9KA 4OPJA 2CGKA 2QWPA 4OKKA 3KLGA 3OYAA 1W0HA 1IKXA 3AO5A 2GX9A 2B6AA 4JKCA 3SUPA 4BE1A 4CJWA 2O8BB 1JXBA 1YXQA 4BROA 4W5QA 3AO2A 3O4NA 4B08A 2P9SA 3OBYA 4JEPA 3ZSOA 4FW1A 3KKSA 3OYFA 1HYZA 4L3QA 4GVMA 4Y1DA 5BPMA 4U7BA 4LFCK 5AQUA 2ASMA 2JGUA 3HM8A 1GOAA 4IJAA 4JKFA 3PX4A 3CM5A 3HXMA 1M1KO 4FVMA 4OLAA 2FXUA 4IKFA 2BE2A 3UE5A 2Z1IA 3SAGA 1GLCG 2OPPA 1HQEA 3SQ0A 4KHYA 2HF3A 3O9UA 3P1GA 3L2UA 5ELZA 1CZ9A 4CE9A 4DMNA 3HJFA 1G15A 3VEYA 4OPHA 4CZMA 1VQ8N 3E9OA 2UUBK 3BGRA 3SV4A 5KRSA 3CHWA 1JLEA 2QI2A 2YKMA 1L3VA 4MLHA 3NF7A 3SMSA 4DR5K 4GV6A 2V51B 2IOCA 2ZQBA 2YHXA 4MO4A 4RWTA 5AFUH 1EP4A 2VWJA 1BA0A 2HBMA 3VQ5A 4B8CA 5CHIA 1GLJO 4M3UA 3KWGA 4B1VA 4IG3A 3OYIA 2ASOA 4F3TA 5EOYA 3BUZB 3WXJA 4A61A 1VAZA 3TI0A 3TAEA 3OTOK 4FCYA 1XMQK 3CETA 2VWKA 4Z4HA 1GLLO 3CJCA 1DKGD 1RDBA 4C1NK 4M42A 3U6FA 3W3DA 4I6MB 3UKUA 3WNHA 1U49A 3NH1A 3DXKA 3DMJA 4CJ4A 2P9UA 3ULEA 4FJIA 3AV9A 4DR4K 3AVBA 1XHZA 4EZ9A 4CJ7A 3U4LA 3VENA 4DF4A 1HLUA 1NGGA 5DM6L 3EYZA 4DV7K 4BRKA 1NGFA 3NVKA 4DQPA 3CCQN 3LZIA 3CI5A 4RW7A 3K5NA 4F2SA 4OKEA 3LPUA 1KVCA 3G0ZA 4YOVA 3RR8A 3NHGA 3KZBA 3CC7N 1KQSM 1Y64A 3IUCA 1HNXK 4WQ4C 4CZLA 3O4QA 4CVNE 4FJJA 3LWMA 4CJUA 4HCCA 5M1FA 5D3GA 1WN7A 1V4TA 1FJGK 3EO3A 2XY6A 4BVPA 4CJQA 4WQ5C 4CHOA 3WXIA 2P9NA 4DKWA 3C6UA 1D9DA 1TKZA 3IRXA 3PUFA 2NRHA 2O4IA 2WOMA 1RBUA 3OA9A 3SUQA 3B6PA 3VGKA 4O44A 1U04A 3IAYA 4EFHA 4DU3A 3RMCA 2WONA 1HRHA 3ZT4A 4PKHA 3SZ2A 4F2RA 2B5JA 4EHTA 4LF7K 1X9WA 3EKSA 1N34K 1MA9B 1SUQA 4R5PA 1V4SA 1N5YA 4GV9A 3VQDA 2HBKA 4BY9C 3FE1A 4KO0A 3MCPA 2IVOA 2ZJPL 2FC0A 4WQ4A 3QEWA 1BI4B 3D6RA 4CHPA 5BPNA 3TSPA 1IBLK 4N47A 3T7ZA 1YT3A 3MX2A 4PUOA 5DMRA 1KVBA 3K5MA 4GKKK 4WQ5A 1J53A 3OHRA 4Z0UA 3OYHA 4W5RA 2ZWHA 5BRFA 3SV3A 4JRQA 4BG8A 1RT6A 1OVYA 3M8PA 2P9IB 4C8MA 4CESA 1S1WA 2Q0RA 3OYJA 3SCXA 2HHVA 1T3VA 1QHAA 1S9GA 2OYQA 5HLFA 3MWTA 3TTFA 3V81A 3QB0A 5C24A 5C15A 4DTMA 3GL1A 2Q97A 4GV3A 1HQUA 2GUPA 3WXLA 5HRSA 3OS2A 3C7NA 2OZMA 2KQ2A 4RCHA 3I55N 3CD6N 4CGFA 4BGBA 3OVNA 2KFZA 5KGXA 1NOZA 3KLFA 1JCEA 3J7YP 1KTQA 4DFPA 5ADXA 2HHTA 1QZ5A 3NGZA 2YX6A 2RE2A 2CGLA 3T19A 4CCHA 5FPNA 4CZHA 2YJEA 2GWJA 4DR1K 3JXUA 1C6VA 2EHGA 4IBNA 3TANA 3B8AX 3FFKB 5AR0A 2QXFA 4DR6K 3AVCA 3QNOA 3KK7A 4DS5A 3SBGA 2HB5A 3CJAA 4H8KA 1TV6A 3AVJA 1YJNN 3M5RA 5KQDA 3QETA 5TKWA 2I5JA 3MDQA 1XNRK 3RVCA 5AQYA 3MAQA 1NKEA 1IV0A 3OYLA 3AA2A 5J2QA 1Q9XA 3OBWA 1MU2A 3T1HK 2FBVA 1YF5L 4HWIA 4BR5A 2NRVA 4OO1J 3EL2A 3ISNC 4AHTA 3OS1A 4KHPK 1TAUA 3N4QA 4LFBK 3DLRA 3DOKA 3QEIA 3A2FA 4H4MA 4M7XA 3RMDA 3UKUB 3VF6A 4KB1A 1RT2A 2HHQA 3KIOA 1NGHA 3WNGA 3CG7A 3DXKB 3LAMA 1N36K 1BQNA 4ICLA 3CPWM 3JS6A 2YKNA 4JD2A 3ZX2A 2XO7A 1J9AA 3HPOA 4FPAA 2KW4A 2ZM6K 3A5LC 1HR0K 4DV2K 4A57A 1TK5A 2X6NA 2O8FB 1Z26A 3LDSA 1VSKA 5JMVA 1S6PA 1SZ2A 4KH5A 2I7PA 4QCLA 3O1BA 3M3ZA 4HUFA 4IO8A 4PKIA 4IEIA 3IFRA 3P5JA 3DLKA 3U3GA 3DRRA 1HMVA 4JKDA 5HOOA 1TUUA 2JLEA 2Q2RA 4FWNA 2P9NB 3RTVA 3HSTB 5DK5A 1NGAA 4CEFA 3OY9A 2VWBA 1NMDA 5CR4A 3T1YK 4W5NA 1SL0A 3O3HA 1U2VA 3NGIA 3QIPA 5AZJA 4CHNA 4CI6A 4B9VA 4JKGB 3MECA 3FLCO 4KTQA 3L2VA 4EIAA 4O8UA 1OH5A 4DUZK 3EEQA 4J2AA 4CHYA 2R7YA 3ID8A 4JHDA 5AQWA 3SAHA 3MXIA 3CC2N 3NF8A 1W2BM 1NG9A 3G10A 1IJJA 4BDYA 2GTDA 2OPRA 4C8LA 4BR4A 3FZHA 3HI0A 3AVKA 3ZSVA 4KI4A 4Z4FA 1NM1A 4Q5VA 4JRPA 2WFBA 3T1AA 3RRGA 2D0AA 2QTDA 4DSFA 3E66A 3SPZA 3C0BA 3TARA 1WNSA 3SK3A 3AO1A 1HJOA 1NWKA 2O8EB 5EVZA 2Q3SA 3OJSA 5J2PA 1RBRA 2E2OA 4OLBA 4KHUA 4O0JA 4FJHA 4CK2A 3AVHA 1KXPA 3ZCMA 1DTTA 3QO9A 4IDKA 2QWRA 4CJTA 1ZBIA 1EWQA 4FJ9A 1Q86O 3IS9A 5HL7L 3HBTA 4FVUA 4DV3K 3TAMA 5I3UA 1RTHA 3VGLA 3A5OC 1ASUA 1RBVA 3CFPA 2Q31A 4FWRA 2VQEK 2A42A 3R6MA 1JKHA 1RCHA 3HP9A 4DHYA 2DY4A 4CERA 2RHKA 4DU4A 5AQRA 2HNDA 3C6HA 1NNEA 1YITN 3CFRA 3CCJN 2HBJA 2NRZA 4CJ3A 5KRTA 5AQNA 1RTJA 4JS4A 2YNHA 5DM7L 1ATRA 4FJGA 4AHSA 3LAKA 4CJFA 2QXLA 2F4VK 2VYPA 1TK8A 3DOLA 1ZXOA 1NGEA 5J1EA 3OW2M 2QWQA 5GINA 5C25A 3ZEUB 3DAWA 3MWPA 4CBUA 4E1NA 1MDUB 4AF1A 5K14A 3L6QA 4BRGA 3J7AP 3LZJA 1ZBFA 1RGIA 2P9LA 2AP1A 4CW7B 1XUPO 4FOEA 5AJ3K 2RKIA 4JNEA 4B3MK 2KTQA 3LDNA 4IO9L 5AQXA 4BC3A 2KLAA 3QEPA 3ZT2A 2P5GA 4E89A 1VQ5N 4JK9A 1YJ9N 5EX5A 1GOCA 5C12A 3SI6A 1NJXA 2OANA 3THYA 1WAJA 3U8XA 2VGNA 2ZJQL 4FL9A 4N5SA 4LF9K 1KRPA 4CF0A 5AQQA 2DFHA 4B1YB 5KPZA 4EHUA 4YOWA 4DQQA 5T7BA 1J5OA 3CQ8A 3PLAA 2HF4A 4CEQA 3M1FA 5EU7A 3G4SN 5F2RA 2W42A 1YVNA 4J2BA 2UXDK 4DTRA 4E7IA 5C2FA 1R0AA 4WE1A 1RDDA 3ZETB 4CIFA 3ITHA 4JI2K 1LV5A 1W97L 4CBXA 5J2NA 3TPQA 4ILGB 2QWNA 1MWKA 5KI6A 1ITGA 3THWA 3ENBA 2E2NA 3VPZA 2NUBA 4B3OA 2NRTA 1LW2A 4W5OA 2UXBK 4JI1K 4FLZA 4CJLA 4KTZA 3ZSYA 4LY7A 1TYQB 2A40A 1IKYA 3J80O 3VQ6A 2CH6A 4DSLA 4WFAL 1VQ9N 3BF1A 1VK0A 3AVAA 4M3WA 5EY4A 1LCUA 1NGJA 1U2VB 1K8KB 5HBMA 5AZIB 3DYAA 2E2PA 4CJKA 4DU1A 3QNNA 5SZTA 1QE1A 1ATSA 2D0PA 1VQ7N 3D7EO 1ASVA 4CEOA 3O3FA 3KLIA 4FW2A 4CEBA 1QVFM 2A6AA 1NK7A 1T8EA 4BR9A 1ESVA 3MN9A 3EN9A 1C0MA 5CZ1A 3GE1A 4CEZA 1QZ6A 1VRTA 4MDAA 1UAXA 2BANA 3D2EB 3CXCM 4O8KA 4XEIA 3U9DA 2Y1JA 4BR2A 3V6DA 1Q7YO 3AVMA 3F5TA 1J54A 3O08A 4NB4A 3KK1A 4BE2A 5BRDA 1IKWA 4FWKA 4KHNA 3DLLL 4CHZA 3CMEN 4H0TB 4CF9A 2JWKA 3OYMA 4RW6A 4FLWA 4LF5K 3V4IA 2Q1NA 4DV1K 3W0LA 1U6ZA 3K9KA 5CZ2A 4I2PA 3AO3A 1QQOA 3MCAB 4H0VB 1NGIA 1K9MO 2P9PA 2G8HA 4IFYA 3AAQA 3HRGA 3C6AA 4RW8A 1VQNN 3I0SA 1SV5A 1WSEA 4NLCA 1XHXA 3TSUA 2DFEA 4QS7A 1I39A 3E9PA 4FOIA 1VRUA 2CGJA 2PZSA 1EX4A 1TAQA 4FLYA 5M1NA 2A1SA 4CZGA 3M8SA 1L3UA 3GG4A 2O8DA 4DTSA 3QFUA 3O9QA 3OJUA 1YI2N 4B9QA 3E01A 3VQEA 4KI6A 5I42A 2RPIA 5IT9O 2QM1A 4M45A 1RTDA 1NK5A 3L4QA 2IC3A 4H5TA 3AGRA 1RT5A 3NH2A 4BE0A 4F9OA 3QEVA 3ATUA 3H08A 1XMOK 4DLEA 2F9WA 5JVHL 1XI1A 5GIPA 1OH7A 2FF3B 5GIOA 4PQUA 3BY5A 3DI6A 1HPMA 1C0GA 1WSFA 4C8KA 3HPGA 1HNVA 2ZGYA 4H5NA 3V1RA 4B9MA 4H03B 4XH1A 3AVLA 3VQCA 2E4LA 3OYCA 4J2EA 1X3MA 2YCHA 3HO1A 3MN6A 5HROA 2JWLA 5EXWA 1KVAA 4DSJA 1DEJA 1UOCA 1DGKN 4CFAA 2QEXN 2D5RA 1HKBA 4GW6A 4CZEA 2W6LA 4AM6A 2WTUA 2FSNA 4DS4A 3KD1E 1HNWK 3LP1A 1EO1A 1NJYA 3IMXA 4CECA 3OYBA 3VEOA 3HTVA 4AILC 2FBTA 1W7AA 2QWLA 1ZBLA 3DRSA 1FK9A 3R1XA 4FJKA 4OGCA 2D0CA 5AQIA 1D8YA 3MK6A 4QAGA 2LSNA 3JSMA 1TVRA 3J8AA 1I94K 4A2BA 4IWVA 4FLUA 4BDPA 3QEXA 2A41A 4FJLA 4FSVA 4BG9A 4BRDA 1X9MA 1ZBUA 4X65K 3N4PA 3MN7A 5FLXO 1S22A 1OH8A 3P31A 2X74A 1TL1A 3L3UA 2DPNA 3O3GA 2QWOA 5CYQA 1VQ6N 4BQZA 2QKBA 3CCVN 4E3SA 3ZT0A 1S72N 3FGUA 4H5RA 4FJXA 4JK8A 1I3AA 3TSQA 3VOVA 5JS2A 4R79A 1YJWN 1X3NA 3VF4A 4DTPA 4WFBL 3NF6A 4BGAA 3CJ9A 2P9SB 4Z4EA 4E0DA 4CZJA 3RSEA 2HBLA 3MXMA 5KQ8A 5AQTA 4LFAK 3CERA 3O6WA 3F9MA 2ZF5O 4H5WA 3L3VA 2E5LK 1TL3A 1HJRA 1CLQA 4LH5A 1WUAA 2HOEA 1A5WA 2RN2A 2VG6A 4CEAA 1BWFO 3NMUA 1S1VA 3E9LA 4BRQA 5LJWA 2HMPA 4CJVA 3LDQA 1HKCA 1TK0A 1BHLA 1BOTO 4O55A 2HSTA 5FRNA 1XQSC 4K43A 3SLCA 1NGCA 3CIPA 2E6MA 1J5EK 1K8AO 1EKEA 4B1UB 3MN5A 4GKJK 4DWIA 2FF6A 1GLFO 1RBTA 2ZD1A 4BRPA 4BR7A 1N6QA 1JL1A 3AA4A 2QA4N 4KHWA 3H1VX 4DSIA 4JYAK 2FLOA 1O13A 3FZMA 1SQKA 3OYGA 3V9WA 1L5UA 3C95A 2V7YA 4IOXA 4YOXA 4AQYK 4YY3K 4ILHA 4Q0BA 3MXJA 4FK2A 1S1XA 4ZTFA 4FJMA 2FBXA 4E7KA 1WBDA 4BRNA 3CCMN 4DSEA 4LD0A 4IFEA 4CJRA 5BR8K 1SKWA 3MEDA 5I9EB 3PO4A 1CZBA 3L4IA 2XY7A 3GOIA 2PY5A 4Z4CA 1J6ZA 4FWLA 2P9UB 1EQYA 3ULEB 2F96A 4BVOA 3E1YA 5HRRA 3BP8A 3UB5A 4NXNK 2NRWA 5GAGP 2X6SA 1GLBG 2A5XA 4IZ9A 1ILYA 3PIPL 3PX6A 2XRIA 1T6CA 4OJRA 1BUPA 3THXA 3VN5A 5GAEP 2OTLN 4H0YB 1VSHA 1VSIA 2H3GX 4BWMA 2IS3A 1UWBA 1YIJN 3VQPA 4PA1A 3S3MA 1LAVA 2O8CA 5LJVA 4BRCA 3VQ4A 2BH1A 1XNQK 3EZ5A 3R3LA 4CJEA 4DUYK 1HNZK 1WSHA 1NGBA 1YAGA 5AQOA 4WYBA 4CZIA 4CJPA 2OTJN 1YVUA 4B9LA 3LDOA 2XHBA 2HVHA 1Q82O 3HVTA 3WEEA 3O4WA 3CCEN 2QK9A 3VETA 1REVA 1JLGA 4UQGA 2O8BA 2Z1JA 1VQKN 3U3YA 2VG5A 4DTUA 3RR7A 3AARA 3P39A 4N76A 2V52B 5C10A 1QVGM 4ELTA 4OX9K 2O4GA 3O1WA 5FPMA 4QOZB 4FK0A 1JLAA 1BCMA 4BWJA 4CF1A 5H1SQ 1JLBA 3LALA 1RFQA 4PKGA 4K8XA 4BRMA 4Z4GA 3CFOA 3P38A 2WUSA 4DTXA 3SUNA 3HL8A 3ZT3A 4PY5A 2AJQA 1Z6RA 2RF2A 3IDHA 4M3YA 3PO5A 4I7FA 5M1PA 2CH5A 4W5TA 3DXMA 1BL3A 3O9TA 4JKEA 3NH0A 5AFUA 5AQVA 5LL6Z 3SQ2A 3AGKA 4CGJA 1S9EA 3C7NB 3DLHA 2F8TA 3SNNA 4LSNA 1QTMA 1T03A 2AA4A 3QLHA 4Y0WA 1VQON 1SL2A 4CK3A 5HRNA 3V9SA 5LY3A 1WOQA 1KD1O 4M3TA 2YHWA 4JKAA 5ADXH 4DF8A 2UUCK 3PX0A 3K9JA 1LAWA 1X1PA 3S3NA 5BR9A 3V1OA 3NGYA 1MWMA 4IOAL 3QFPA 1RT3A 3GBTA 3VERA 3TWHA 5GAHP 1WBBA 1S1UA 4I6MA 4FM1A 3L2WA 3VTHA 1NJWA 1T44A 3L2RA 4F8RA 4HHTA 3BZKA 2PYJA 1NJZA 4RW4A 2GELA 4CEDA 1E4FT 3G71N 1BU6O 3L0QA 4ISGA 5AQGA 4DB3A 4KTWA 1VQMN 3HOTA 4HTUA 4YFUA 1Q81O 3LPTA 3FZLA 3ATVA 1RT1A 3NVMA 5BN8A 2EWSA 3QDKA 3ENHA 4CBWA 2PAVA 4B8AB 1FKOA 1M90O 4K25A 5A2QO 1FXXA 3WNFA 2YNFA 5AQKA 1IBMK 5LMUK 3TR8A 2KZMA 4JK7A 2F9TA 4H4OA
chains in the Genus database with same CATH topology
1NKCA 2KZZA 1SL1A 2OYQA 3RMAA 4ELVA 5CZ2A 4I2PA 5HLFA 3K58A 2Z1GA 3AO3A 4DFKA 2G8VA 3DLBA 3NFAA 4CGHA 3KK3A 4BACA 3K59A 1JLQA 3V81A 1BGXT 5C24A 1U45A 2G8HA 4IFYA 4DTMA 4OVLA 4AHCA 2G8IA 2G8UA 1HQUA 3TABA 2Y1IA 3KKRA 4RW8A 4M3RA 5HRSA 3OS2A 2OZMA 3I0SA 2KQ2A 1SV5A 4O0IA 1NK8A 1WSEA 4CEEA 1XHXA 3M8RA 1KCFA 3S9HA 1XC9A 1VSJA 1VSMA 3ULDA 3TAQA 4CGFA 3OVNA 2DFEA 2KFZA 1D5AA 1NOZA 5KGXA 3KLFA 1B9DA 1I39A 1DTQA 1KTQA 4KFBA 3ALYA 4DFPA 1L3TA 2HNYA 1VRUA 2HHTA 2PZSA 2HHUA 1EX4A 1TAQA 2E6LA 2VG7A 4FLYA 3NGZA 3TAFA 2A1SA 1U47A 1WSGA 3T19A 3M8SA 2ATQA 4CCHA 3HPHA 1L3UA 4CGDA 5FDLA 1NOYA 1LWEA 4DTSA 1C1AA 4Y1CA 3OJUA 1C6VA 1WSIA 3ZT1A 2EHGA 3OYDA 1NK6A 4IBNA 4CK1A 1C0TA 4CJSA 3E01A 3VQEA 3TANA 1QSLA 1KFDA 4EP4A 3NBPA 4N41A 5I42A 4KI6A 1VSDA 4FYDA 2RPIA 1WSJA 2QXFA 3OYEA 4M45A 4DTJA 1QSSA 1RTDA 3AVCA 3QNOA 3M8QA 1NK5A 3NF9A 4DS5A 2IC3A 3NH2A 4BE0A 1RT5A 4FLXA 1BI4A 3V9UA 2HB5A 4FK4A 3KLHA 4XIUA 2DTUA 4CHQA 3QEVA 4H8KA 2YHBA 1TV6A 3SPYA 3H08A 1TKDA 3AVJA 4DLEA 4AHVA 1XI1A 4NYFA 5FROA 3OYKA 4HUGA 3QETA 2HVIA 2G8FA 4J2DA 4PQUA 2I5JA 3DI6A 4FJ7A 4JLHA 5C42A 1WSFA 4C8KA 3HPGA 1SKSA 1ZBHA 1HNVA 3V1RA 2OPSA 4C8NA 3MAQA 1NKEA 3VQCA 3AVLA 2BDPA 4B9MA 1Q9YA 3OYLA 3AA2A 2ZE2A 2E4LA 2OPQA 3ZSRA 3OYCA 5J2QA 3HM9A 1Q9XA 3I8DA 4J2EA 4B9SA 1MU2A 1RDAA 3HO1A 5CYMA 4BDZA 4FM0A 2FBVA 3FFIA 5HROA 1C1BA 4IFVA 1BIUA 3AA3A 3MEEA 4RW9A 3IG1A 3OYNA 1KVAA 4DSJA 1K6YA 3ISNC 1UA0A 4AHTA 3OS1A 1ZYQA 3VQAA 1UOCA 4CFAA 4KV8A 2D5RA 4GW6A 1TAUA 4LSLA 1O1WA 3DLRA 3KD5E 3KJVA 3DOKA 3NDKA 3VQ8A 4DS4A 1L3SA 3QEIA 2G8WA 3KD1E 1VSEA 3A2FA 3LP1A 4H4MA 4CFDA 3V9ZA 3RMDA 4CECA 1NJYA 3OYBA 1JLCA 4O4GA 4AILC 2A1RA 5HRPA 2FBTA 4FJ8A 4KB1A 2F8SA 2HHSA 2YNIA 1RT2A 4N56A 3DRSA 1ZBLA 2HHQA 1B9FA 3KIOA 4CF2A 1FK9A 3WNGA 3CG7A 1D9FA 4F4KA 3D45A 3LAMA 4FJKA 2YNGA 4F3OA 4ID1A 1RILA 1BQNA 4OGCA 2D0CA 1D8YA 5E41A 4ICLA 4QAGA 3NE6A 2HNZA 3P83D 2LSNA 2Z1HA 3JSMA 2YKNA 3BDPA 1TVRA 4KB0A 2XO7A 1J9AA 4CGGA 4FLUA 4BDPA 2BGGA 3QEXA 3HPOA 2KW4A 4FJLA 1RT7A 4CIGA 1X9MA 1ZBUA 1HYSA 4KKOA 1U48A 1TK5A 2HMIA 3HT3A 2X6NA 1Z26A 1F21A 3LDSA 1VSKA 1S6PA 3HP6A 3VA3A 4FXDA 2X74A 2GV9A 4QCLA 1TL1A 3L3UA 2GUIA 4HUFA 3O3GA 2X78A 5CYQA 1IH7A 1YTUA 4MQ3A 1RNHA 3P5JA 2QKBA 4E3SA 4KPYA 3ZT0A 3DLKA 3CM6A 1JLFA 4FJXA 1TKXA 3AVGA 1DLOA 3U3GA 3DRRA 1HNIA 1I3AA 3DRPA 1BISA 1RBSA 5JS2A 4DFMA 1HMVA 3I0RA 4G1QA 4IG0A 2ITGA 2JLEA 1WLJA 1CXQA 3HVRA 1QHTA 5KGWA 4DTPA 1UA1A 3NF6A 3RTVA 3HSTB 2HW3A 4OPKA 5DK5A 4Z4EA 1KLMA 4E0DA 1LW0A 3MXMA 4CEFA 3OY9A 2P5OA 3MEGA 2P51A 4W5NA 3PY8A 1SL0A 3O3HA 3SQ1A 1RT4A 4CGIA 3NGIA 3L3VA 1TL3A 3QIPA 4H4OA 4MFBA 1HJRA 1CLQA 3S3OA 4LH5A 4CHNA 4KREA 2EX3A 4KHQA 1A5WA 2RN2A 2VG6A 4CEAA 4B9VA 1S1VA 3MECA 1QQCA 2YV0X 4KTQA 4CJVA 3L2VA 2GBZA 1A5VA 4M3ZA 4Z4IA 1JXEA 4AHUA 1EETA 3SQ4A 4FJ5A 3HK2A 4DFJA 3ZSQA 1TK0A 1BHLA 3QESA 4O55A 2B4JA 4J2AA 5FRNA 4CHYA 3OS0A 2R7YA 1RDCA 3HYFA 4TSXA 4B9TA 3AO4A 3MXIA 4O5BA 3NF8A 3G10A 1EXQA 2XY8A 4BDYA 1U4BA 2E6MA 2OPRA 4DLGA 4C8LA 3AVFA 3AVKA 3LWLA 1EKEA 3C6TA 4NCBA 3D0PA 4DWIA 2PYLA 3ZSVA 4FZZA 4KI4A 4Z4FA 3KK2A 4B9UA 5KTQA 4FZYA 4I9LA 1RBTA 2ZD1A 3AVIA 4Q5VA 1N6QA 4JRPA 4I9QA 2IGIA 4K8ZA 1JL1A 3AA4A 3T3FA 3T1AA 4FM2A 3RRGA 4L8RB 2D0AA 3ZSXA 1VSFA 3RRHA 4KHWA 4KRFA 4M41A 4LH4A 4DSFA 1W9HA 3SPZA 4DSIA 3AA5X 4CJ5A 3AVNA 2XY5A 3TARA 3ASMA 4ZTJA 1TGOA 1WNSA 3AO1A 1KFSA 1A5XA 2IDOA 3OYGA 3F73A 2Q3SA 3V9WA 3OJSA 5J2PA 1L5UA 3C95A 1QS4A 1RBRA 1CXUA 3F9KA 4OPJA 4OKKA 4CF8A 4KHUA 4OLBA 4O0JA 3KLGA 3ZSWA 3OYAA 4FJHA 4Q0BA 3MXJA 1W0HA 4OGEA 1IKXA 2G8KA 4FK2A 3AO5A 2OZSA 1S1XA 3RMBA 2B6AA 4ZTFA 4FJMA 2FBXA 3SUPA 4E7KA 3TAGA 4CK2A 3CYMA 3JYTA 4BE1A 3AVHA 3QIOA 4CJWA 3ZCMA 4DSEA 4LD0A 1BCOA 1JXBA 4FJNA 1DTTA 4CFCA 3QINA 3QO9A 4IDKA 4W5QA 4CJRA 4CJTA 3AO2A 3O4NA 4B08A 4M3XA 4DQIA 1ZBIA 4FJ9A 1SKWA 3ZSOA 3IS9A 3MEDA 4FW1A 3QERA 3PO4A 1CZBA 2XY7A 3KKSA 2PY5A 3TAMA 1HYZA 4Z4CA 3OYFA 1RTHA 5I3UA 4B3OA 4GVMA 4Y1DA 3ZSZA 4CFBA 3SYZA 1ASUA 1RBVA 3CFPA 2QKKA 3V9XA 1NK4A 4E7LA 2F96A 1JKHA 1RCHA 1RTIA 2JGUA 4NCAA 3HP9A 1GOAA 3EY1A 2DY4A 3PX4A 3CM5A 5HRRA 4CERA 4FVMA 3B6OA 3HXMA 4DU4A 1NK0A 3UIQA 2HNDA 4OLAA 4IKFA 2BE2A 5HP1A 2Z1IA 2X6SA 3SJJA 3CFRA 2OPPA 1HQEA 2D0BA 3SQ0A 4KHYA 4CJ3A 3PX6A 5KRTA 2XRIA 4OJRA 3P1GA 4DG1A 3L8BA 1RTJA 4JS4A 3VN5A 2YNHA 1C0UA 4DQRA 3L2UA 4FJGA 1VSHA 4AHSA 4OKJA 3K5OA 2IAJA 4DMNA 1CZ9A 1VSIA 3LAKA 4BWMA 4CE9A 3HJFA 1G15A 5SWMA 4CJFA 2IS3A 1UWBA 3THVA 1FKPA 3V1QA 3DOLA 1TK8A 3VQPA 4PA1A 3S3MA 3BGRA 1LAVA 5J1EA 5KRSA 3SV4A 1JLEA 4DTOA 3VQ7A 5C25A 2YKMA 1L3VA 4HUEA 3NF7A 3VQ9A 3VQ4A 2IOCA 4E1NA 3DM2A 4FZXC 4E7HA 2ZQBA 3EZ5A 4CJEA 1EP4A 1WSHA 5JS1A 4NCGA 5K14A 2VWJA 3LP3A 3LP2A 3VQ5A 3LZJA 1ZBFA 4B8CA 4CJPA 1YVUA 4B9LA 4M3UA 1B92A 1GOBA 4IG3A 3OYIA 2XHBA 2HHXA 4EP5A 2HVHA 4F3TA 5FRMA 3K2PA 1Y97A 3NAEA 2RKIA 3TI0A 3TAEA 1X9SA 2KTQA 3HVTA 3QEPA 2QK9A 1Z25A 3ZT2A 4FCYA 2P5GA 4E89A 2VWKA 1IG9A 1REVA 1JLGA 4UQGA 4Z4HA 4DQSA 1Q8IA 2Z1JA 4DSKA 4AH9A 4M42A 1RDBA 3U6FA 1GOCA 1NK9A 3U3YA 2VG5A 1T7PA 3SI6A 3LANA 4DTUA 1S6QA 4DTNA 1NJXA 3RR7A 3WNHA 1WAJA 1U49A 4N76A 3NH1A 4N5SA 3DMJA 4CJ4A 2DFFA 1KRPA 4ELTA 4CF0A 2O4GA 4FJIA 4ZHRA 3AV9A 2DFHA 3NCIA 3AVBA 1XHZA 4EZ9A 4DQQA 5T7BA 1J5OA 3CQ8A 1JL2A 4QOZB 3VQQA 4DF4A 4FK0A 1JLAA 2HHWA 1BCMA 3EYZA 4AHRA 4BWJA 4CF1A 3K5LA 3K57A 4KAZA 4CEQA 4DQPA 1JLBA 3LALA 5EU7A 3LZIA 3TAPA 1C1CA 2W42A 4K8XA 4J2BA 4RW7A 4Z4GA 3CFOA 3K5NA 1T05A 4F2SA 4E7JA 4FLVA 4DTRA 4DTXA 4E7IA 4OKEA 5CY4A 1R0AA 4WE1A 3LPUA 1KVCA 3G0ZA 1LWFA 1RDDA 1YTAA 4CIFA 3ITHA 3NHGA 3HL8A 3SUNA 3RR8A 1LV5A 1S1TA 3ZT3A 4FLTA 5J2NA 2HHVA 4PY5A 2AJQA 4HVJA 1BQMA 3KLEA 1ASWA 2RF2A 4ELUA 5KI6A 4M3YA 1ITGA 4RG8A 3PV8A 1QSYA 1IO2A 3O4QA 3PO5A 4FJJA 2NUBA 3LWMA 1BIZA 1XWLA 4I7FA 4CJUA 1IKVA 1LW2A 1WN7A 4W5TA 4W5OA 4HCCA 5D3GA 4FLZA 1BL3A 4B9NA 2XY6A 4HCBA 4CJLA 4KTZA 3WNEA 3ZSYA 3NH0A 5J2MA 4LY7A 3DLGA 4CJQA 1IKYA 4CHOA 3VQ6A 4E19A 3C6UA 3SQ2A 1D9DA 4DSLA 4ID5A 4CGJA 1S9EA 1TKZA 3DLHA 3C94A 1VK0A 4PWDA 3AVAA 4M3WA 3SNNA 3IRXA 2F8TA 4LSNA 1QTMA 1T03A 3QLHA 1NKBA 1SL2A 3RWUA 3PUFA 5HBMA 4CK3A 5HRNA 3V9SA 2O4IA 3DLEA 3DYAA 4DU1A 4CJKA 1VSLA 3QNNA 4M3TA 5SZTA 2WOMA 4DF8A 1RBUA 1QE1A 3PX0A 3LP0A 1HPZA 1LAWA 1X1PA 3SUQA 1TKTA 2P1JA 3B6PA 3S3NA 4I2QA 1KSPA 4O44A 1U04A 1ASVA 3VA0A 4CEOA 3O3FA 3IAYA 4DU3A 2FBYA 3KLIA 2WONA 4FW2A 3NGYA 3V1OA 3RMCA 4NYNA 1HYVA 4CEBA 1HRHA 3ZT4A 4E1MA 1RT3A 3SZ2A 2B5JA 4F2RA 4YNQA 1NK7A 1T8EA 3TWHA 1X9WA 2ETJA 4R5PA 1SUQA 1N5YA 1C0MA 5CZ1A 3VQDA 1S1UA 3L2QA 4CEZA 4FM1A 3L2WA 1WAFA 1VRTA 4KO0A 3VQBA 3L2RA 1NJWA 4F8RA 2FC0A 3QEWA 4HHTA 3KTQA 1UAXA 2PYJA 1NJZA 2BANA 1BI4B 4CHPA 4RW4A 4KHSA 4CEDA 2Y1JA 4GMJB 4EZ6A 3V6DA 4N47A 1YT3A 4PUOA 5DMRA 1KVBA 3AVMA 4C8OA 1J54A 3K5MA 4KTWA 1LWCA 1J53A 3KK1A 4BE2A 1IKWA 4Z0UA 4HTUA 4YFUA 3OYHA 3LPTA 4W5RA 2YHAA 1RT1A 4KHNA 4CIEA 4CHZA 3SV3A 4B8AB 1FKOA 4CF9A 3OYMA 4JRQA 1FXXA 3SUOA 1RT6A 2YNFA 3WNFA 2KFNA 2OA8A 3M8PA 4RW6A 4C8MA 4CESA 3TR8A 1S5JA 4FLWA 1S1WA 2KZMA 3V4IA 1KLNA 3OYJA 3SCXA 4JS5A 1SKRA 1S9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKC A;  2KZZ A;  1SL1 A;  2OYQ A;  3RMA A;  4ELV A;  5CZ2 A;  4I2P A;  5HLF A;  3K58 A;  2Z1G A;  3AO3 A;  4DFK A;  2G8V A;  3DLB A;  3NFA A;  4CGH A;  3KK3 A;  4BAC A;  3K59 A;  1JLQ A;  3V81 A;  1BGX T;  5C24 A;  1U45 A;  2G8H A;  4IFY A;  4DTM A;  4OVL A;  4AHC A;  2G8I A;  2G8U A;  1HQU A;  3TAB A;  2Y1I A;  3KKR A;  4RW8 A;  4M3R A;  5HRS A;  3OS2 A;  2OZM A;  3I0S A;  2KQ2 A;  1SV5 A;  4O0I A;  1NK8 A;  1WSE A;  4CEE A;  1XHX A;  3M8R A;  1KCF A;  3S9H A;  1XC9 A;  1VSJ A;  1VSM A;  3ULD A;  3TAQ A;  4CGF A;  3OVN A;  2DFE A;  2KFZ A;  1D5A A;  1NOZ A;  5KGX A;  3KLF A;  1B9D A;  1I39 A;  1DTQ A;  1KTQ A;  4KFB A;  3ALY A;  4DFP A;  1L3T A;  2HNY A;  1VRU A;  2HHT A;  2PZS A;  2HHU A;  1EX4 A;  1TAQ A;  2E6L A;  2VG7 A;  4FLY A;  3NGZ A;  3TAF A;  2A1S A;  1U47 A;  1WSG A;  3T19 A;  3M8S A;  2ATQ A;  4CCH A;  3HPH A;  1L3U A;  4CGD A;  5FDL A;  1NOY A;  1LWE A;  4DTS A;  1C1A A;  4Y1C A;  3OJU A;  1C6V A;  1WSI A;  3ZT1 A;  2EHG A;  3OYD A;  1NK6 A;  4IBN A;  4CK1 A;  1C0T A;  4CJS A;  3E01 A;  3VQE A;  3TAN A;  1QSL A;  1KFD A;  4EP4 A;  3NBP A;  4N41 A;  5I42 A;  4KI6 A;  1VSD A;  4FYD A;  2RPI A;  1WSJ A;  2QXF A;  3OYE A;  4M45 A;  4DTJ A;  1QSS A;  1RTD A;  3AVC A;  3QNO A;  3M8Q A;  1NK5 A;  3NF9 A;  4DS5 A;  2IC3 A;  3NH2 A;  4BE0 A;  1RT5 A;  4FLX A;  1BI4 A;  3V9U A;  2HB5 A;  4FK4 A;  3KLH A;  4XIU A;  2DTU A;  4CHQ A;  3QEV A;  4H8K A;  2YHB A;  1TV6 A;  3SPY A;  3H08 A;  1TKD A;  3AVJ A;  4DLE A;  4AHV A;  1XI1 A;  4NYF A;  5FRO A;  3OYK A;  4HUG A;  3QET A;  2HVI A;  2G8F A;  4J2D A;  4PQU A;  2I5J A;  3DI6 A;  4FJ7 A;  4JLH A;  5C42 A;  1WSF A;  4C8K A;  3HPG A;  1SKS A;  1ZBH A;  1HNV A;  3V1R A;  2OPS A;  4C8N A;  3MAQ A;  1NKE A;  3VQC A;  3AVL A;  2BDP A;  4B9M A;  1Q9Y A;  3OYL A;  3AA2 A;  2ZE2 A;  2E4L A;  2OPQ A;  3ZSR A;  3OYC A;  5J2Q A;  3HM9 A;  1Q9X A;  3I8D A;  4J2E A;  4B9S A;  1MU2 A;  1RDA A;  3HO1 A;  5CYM A;  4BDZ A;  4FM0 A;  2FBV A;  3FFI A;  5HRO A;  1C1B A;  4IFV A;  1BIU A;  3AA3 A;  3MEE A;  4RW9 A;  3IG1 A;  3OYN A;  1KVA A;  4DSJ A;  1K6Y A;  3ISN C;  1UA0 A;  4AHT A;  3OS1 A;  1ZYQ A;  3VQA A;  1UOC A;  4CFA A;  4KV8 A;  2D5R A;  4GW6 A;  1TAU A;  4LSL A;  1O1W A;  3DLR A;  3KD5 E;  3KJV A;  3DOK A;  3NDK A;  3VQ8 A;  4DS4 A;  1L3S A;  3QEI A;  2G8W A;  3KD1 E;  1VSE A;  3A2F A;  3LP1 A;  4H4M A;  4CFD A;  3V9Z A;  3RMD A;  4CEC A;  1NJY A;  3OYB A;  1JLC A;  4O4G A;  4AIL C;  2A1R A;  5HRP A;  2FBT A;  4FJ8 A;  4KB1 A;  2F8S A;  2HHS A;  2YNI A;  1RT2 A;  4N56 A;  3DRS A;  1ZBL A;  2HHQ A;  1B9F A;  3KIO A;  4CF2 A;  1FK9 A;  3WNG A;  3CG7 A;  1D9F A;  4F4K A;  3D45 A;  3LAM A;  4FJK A;  2YNG A;  4F3O A;  4ID1 A;  1RIL A;  1BQN A;  4OGC A;  2D0C A;  1D8Y A;  5E41 A;  4ICL A;  4QAG A;  3NE6 A;  2HNZ A;  3P83 D;  2LSN A;  2Z1H A;  3JSM A;  2YKN A;  3BDP A;  1TVR A;  4KB0 A;  2XO7 A;  1J9A A;  4CGG A;  4FLU A;  4BDP A;  2BGG A;  3QEX A;  3HPO A;  2KW4 A;  4FJL A;  1RT7 A;  4CIG A;  1X9M A;  1ZBU A;  1HYS A;  4KKO A;  1U48 A;  1TK5 A;  2HMI A;  3HT3 A;  2X6N A;  1Z26 A;  1F21 A;  3LDS A;  1VSK A;  1S6P A;  3HP6 A;  3VA3 A;  4FXD A;  2X74 A;  2GV9 A;  4QCL A;  1TL1 A;  3L3U A;  2GUI A;  4HUF A;  3O3G A;  2X78 A;  5CYQ A;  1IH7 A;  1YTU A;  4MQ3 A;  1RNH A;  3P5J A;  2QKB A;  4E3S A;  4KPY A;  3ZT0 A;  3DLK A;  3CM6 A;  1JLF A;  4FJX A;  1TKX A;  3AVG A;  1DLO A;  3U3G A;  3DRR A;  1HNI A;  1I3A A;  3DRP A;  1BIS A;  1RBS A;  5JS2 A;  4DFM A;  1HMV A;  3I0R A;  4G1Q A;  4IG0 A;  2ITG A;  2JLE A;  1WLJ A;  1CXQ A;  3HVR A;  1QHT A;  5KGW A;  4DTP A;  1UA1 A;  3NF6 A;  3RTV A;  3HST B;  2HW3 A;  4OPK A;  5DK5 A;  4Z4E A;  1KLM A;  4E0D A;  1LW0 A;  3MXM A;  4CEF A;  3OY9 A;  2P5O A;  3MEG A;  2P51 A;  4W5N A;  3PY8 A;  1SL0 A;  3O3H A;  3SQ1 A;  1RT4 A;  4CGI A;  3NGI A;  3L3V A;  1TL3 A;  3QIP A;  4H4O A;  4MFB A;  1HJR A;  1CLQ A;  3S3O A;  4LH5 A;  4CHN A;  4KRE A;  2EX3 A;  4KHQ A;  1A5W A;  2RN2 A;  2VG6 A;  4CEA A;  4B9V A;  1S1V A;  3MEC A;  1QQC A;  2YV0 X;  4KTQ A;  4CJV A;  3L2V A;  2GBZ A;  1A5V A;  4M3Z A;  4Z4I A;  1JXE A;  4AHU A;  1EET A;  3SQ4 A;  4FJ5 A;  3HK2 A;  4DFJ A;  3ZSQ A;  1TK0 A;  1BHL A;  3QES A;  4O55 A;  2B4J A;  4J2A A;  5FRN A;  4CHY A;  3OS0 A;  2R7Y A;  1RDC A;  3HYF A;  4TSX A;  4B9T A;  3AO4 A;  3MXI A;  4O5B A;  3NF8 A;  3G10 A;  1EXQ A;  2XY8 A;  4BDY A;  1U4B A;  2E6M A;  2OPR A;  4DLG A;  4C8L A;  3AVF A;  3AVK A;  3LWL A;  1EKE A;  3C6T A;  4NCB A;  3D0P A;  4DWI A;  2PYL A;  3ZSV A;  4FZZ A;  4KI4 A;  4Z4F A;  3KK2 A;  4B9U A;  5KTQ A;  4FZY A;  4I9L A;  1RBT A;  2ZD1 A;  3AVI A;  4Q5V A;  1N6Q A;  4JRP A;  4I9Q A;  2IGI A;  4K8Z A;  1JL1 A;  3AA4 A;  3T3F A;  3T1A A;  4FM2 A;  3RRG A;  4L8R B;  2D0A A;  3ZSX A;  1VSF A;  3RRH A;  4KHW A;  4KRF A;  4M41 A;  4LH4 A;  4DSF A;  1W9H A;  3SPZ A;  4DSI A;  3AA5 X;  4CJ5 A;  3AVN A;  2XY5 A;  3TAR A;  3ASM A;  4ZTJ A;  1TGO A;  1WNS A;  3AO1 A;  1KFS A;  1A5X A;  2IDO A;  3OYG A;  3F73 A;  2Q3S A;  3V9W A;  3OJS A;  5J2P A;  1L5U A;  3C95 A;  1QS4 A;  1RBR A;  1CXU A;  3F9K A;  4OPJ A;  4OKK A;  4CF8 A;  4KHU A;  4OLB A;  4O0J A;  3KLG A;  3ZSW A;  3OYA A;  4FJH A;  4Q0B A;  3MXJ A;  1W0H A;  4OGE A;  1IKX A;  2G8K A;  4FK2 A;  3AO5 A;  2OZS A;  1S1X A;  3RMB A;  2B6A A;  4ZTF A;  4FJM A;  2FBX A;  3SUP A;  4E7K A;  3TAG A;  4CK2 A;  3CYM A;  3JYT A;  4BE1 A;  3AVH A;  3QIO A;  4CJW A;  3ZCM A;  4DSE A;  4LD0 A;  1BCO A;  1JXB A;  4FJN A;  1DTT A;  4CFC A;  3QIN A;  3QO9 A;  4IDK A;  4W5Q A;  4CJR A;  4CJT A;  3AO2 A;  3O4N A;  4B08 A;  4M3X A;  4DQI A;  1ZBI A;  4FJ9 A;  1SKW A;  3ZSO A;  3IS9 A;  3MED A;  4FW1 A;  3QER A;  3PO4 A;  1CZB A;  2XY7 A;  3KKS A;  2PY5 A;  3TAM A;  1HYZ A;  4Z4C A;  3OYF A;  1RTH A;  5I3U A;  4B3O A;  4GVM A;  4Y1D A;  3ZSZ A;  4CFB A;  3SYZ A;  1ASU A;  1RBV A;  3CFP A;  2QKK A;  3V9X A;  1NK4 A;  4E7L A;  2F96 A;  1JKH A;  1RCH A;  1RTI A;  2JGU A;  4NCA A;  3HP9 A;  1GOA A;  3EY1 A;  2DY4 A;  3PX4 A;  3CM5 A;  5HRR A;  4CER A;  4FVM A;  3B6O A;  3HXM A;  4DU4 A;  1NK0 A;  3UIQ A;  2HND A;  4OLA A;  4IKF A;  2BE2 A;  5HP1 A;  2Z1I A;  2X6S A;  3SJJ A;  3CFR A;  2OPP A;  1HQE A;  2D0B A;  3SQ0 A;  4KHY A;  4CJ3 A;  3PX6 A;  5KRT A;  2XRI A;  4OJR A;  3P1G A;  4DG1 A;  3L8B A;  1RTJ A;  4JS4 A;  3VN5 A;  2YNH A;  1C0U A;  4DQR A;  3L2U A;  4FJG A;  1VSH A;  4AHS A;  4OKJ A;  3K5O A;  2IAJ A;  4DMN A;  1CZ9 A;  1VSI A;  3LAK A;  4BWM A;  4CE9 A;  3HJF A;  1G15 A;  5SWM A;  4CJF A;  2IS3 A;  1UWB A;  3THV A;  1FKP A;  3V1Q A;  3DOL A;  1TK8 A;  3VQP A;  4PA1 A;  3S3M A;  3BGR A;  1LAV A;  5J1E A;  5KRS A;  3SV4 A;  1JLE A;  4DTO A;  3VQ7 A;  5C25 A;  2YKM A;  1L3V A;  4HUE A;  3NF7 A;  3VQ9 A;  3VQ4 A;  2IOC A;  4E1N A;  3DM2 A;  4FZX C;  4E7H A;  2ZQB A;  3EZ5 A;  4CJE A;  1EP4 A;  1WSH A;  5JS1 A;  4NCG A;  5K14 A;  2VWJ A;  3LP3 A;  3LP2 A;  3VQ5 A;  3LZJ A;  1ZBF A;  4B8C A;  4CJP A;  1YVU A;  4B9L A;  4M3U A;  1B92 A;  1GOB A;  4IG3 A;  3OYI A;  2XHB A;  2HHX A;  4EP5 A;  2HVH A;  4F3T A;  5FRM A;  3K2P A;  1Y97 A;  3NAE A;  2RKI A;  3TI0 A;  3TAE A;  1X9S A;  2KTQ A;  3HVT A;  3QEP A;  2QK9 A;  1Z25 A;  3ZT2 A;  4FCY A;  2P5G A;  4E89 A;  2VWK A;  1IG9 A;  1REV A;  1JLG A;  4UQG A;  4Z4H A;  4DQS A;  1Q8I A;  2Z1J A;  4DSK A;  4AH9 A;  4M42 A;  1RDB A;  3U6F A;  1GOC A;  1NK9 A;  3U3Y A;  2VG5 A;  1T7P A;  3SI6 A;  3LAN A;  4DTU A;  1S6Q A;  4DTN A;  1NJX A;  3RR7 A;  3WNH A;  1WAJ A;  1U49 A;  4N76 A;  3NH1 A;  4N5S A;  3DMJ A;  4CJ4 A;  2DFF A;  1KRP A;  4ELT A;  4CF0 A;  2O4G A;  4FJI A;  4ZHR A;  3AV9 A;  2DFH A;  3NCI A;  3AVB A;  1XHZ A;  4EZ9 A;  4DQQ A;  5T7B A;  1J5O A;  3CQ8 A;  1JL2 A;  4QOZ B;  3VQQ A;  4DF4 A;  4FK0 A;  1JLA A;  2HHW A;  1BCM A;  3EYZ A;  4AHR A;  4BWJ A;  4CF1 A;  3K5L A;  3K57 A;  4KAZ A;  4CEQ A;  4DQP A;  1JLB A;  3LAL A;  5EU7 A;  3LZI A;  3TAP A;  1C1C A;  2W42 A;  4K8X A;  4J2B A;  4RW7 A;  4Z4G A;  3CFO A;  3K5N A;  1T05 A;  4F2S A;  4E7J A;  4FLV A;  4DTR A;  4DTX A;  4E7I A;  4OKE A;  5CY4 A;  1R0A A;  4WE1 A;  3LPU A;  1KVC A;  3G0Z A;  1LWF A;  1RDD A;  1YTA A;  4CIF A;  3ITH A;  3NHG A;  3HL8 A;  3SUN A;  3RR8 A;  1LV5 A;  1S1T A;  3ZT3 A;  4FLT A;  5J2N A;  2HHV A;  4PY5 A;  2AJQ A;  4HVJ A;  1BQM A;  3KLE A;  1ASW A;  2RF2 A;  4ELU A;  5KI6 A;  4M3Y A;  1ITG A;  4RG8 A;  3PV8 A;  1QSY A;  1IO2 A;  3O4Q A;  3PO5 A;  4FJJ A;  2NUB A;  3LWM A;  1BIZ A;  1XWL A;  4I7F A;  4CJU A;  1IKV A;  1LW2 A;  1WN7 A;  4W5T A;  4W5O A;  4HCC A;  5D3G A;  4FLZ A;  1BL3 A;  4B9N A;  2XY6 A;  4HCB A;  4CJL A;  4KTZ A;  3WNE A;  3ZSY A;  3NH0 A;  5J2M A;  4LY7 A;  3DLG A;  4CJQ A;  1IKY A;  4CHO A;  3VQ6 A;  4E19 A;  3C6U A;  3SQ2 A;  1D9D A;  4DSL A;  4ID5 A;  4CGJ A;  1S9E A;  1TKZ A;  3DLH A;  3C94 A;  1VK0 A;  4PWD A;  3AVA A;  4M3W A;  3SNN A;  3IRX A;  2F8T A;  4LSN A;  1QTM A;  1T03 A;  3QLH A;  1NKB A;  1SL2 A;  3RWU A;  3PUF A;  5HBM A;  4CK3 A;  5HRN A;  3V9S A;  2O4I A;  3DLE A;  3DYA A;  4DU1 A;  4CJK A;  1VSL A;  3QNN A;  4M3T A;  5SZT A;  2WOM A;  4DF8 A;  1RBU A;  1QE1 A;  3PX0 A;  3LP0 A;  1HPZ A;  1LAW A;  1X1P A;  3SUQ A;  1TKT A;  2P1J A;  3B6P A;  3S3N A;  4I2Q A;  1KSP A;  4O44 A;  1U04 A;  1ASV A;  3VA0 A;  4CEO A;  3O3F A;  3IAY A;  4DU3 A;  2FBY A;  3KLI A;  2WON A;  4FW2 A;  3NGY A;  3V1O A;  3RMC A;  4NYN A;  1HYV A;  4CEB A;  1HRH A;  3ZT4 A;  4E1M A;  1RT3 A;  3SZ2 A;  2B5J A;  4F2R A;  4YNQ A;  1NK7 A;  1T8E A;  3TWH A;  1X9W A;  2ETJ A;  4R5P A;  1SUQ A;  1N5Y A;  1C0M A;  5CZ1 A;  3VQD A;  1S1U A;  3L2Q A;  4CEZ A;  4FM1 A;  3L2W A;  1WAF A;  1VRT A;  4KO0 A;  3VQB A;  3L2R A;  1NJW A;  4F8R A;  2FC0 A;  3QEW A;  4HHT A;  3KTQ A;  1UAX A;  2PYJ A;  1NJZ A;  2BAN A;  1BI4 B;  4CHP A;  4RW4 A;  4KHS A;  4CED A;  2Y1J A;  4GMJ B;  4EZ6 A;  3V6D A;  4N47 A;  1YT3 A;  4PUO A;  5DMR A;  1KVB A;  3AVM A;  4C8O A;  1J54 A;  3K5M A;  4KTW A;  1LWC A;  1J53 A;  3KK1 A;  4BE2 A;  1IKW A;  4Z0U A;  4HTU A;  4YFU A;  3OYH A;  3LPT A;  4W5R A;  2YHA A;  1RT1 A;  4KHN A;  4CIE A;  4CHZ A;  3SV3 A;  4B8A B;  1FKO A;  4CF9 A;  3OYM A;  4JRQ A;  1FXX A;  3SUO A;  1RT6 A;  2YNF A;  3WNF A;  2KFN A;  2OA8 A;  3M8P A;  4RW6 A;  4C8M A;  4CES A;  3TR8 A;  1S5J A;  4FLW A;  1S1W A;  2KZM A;  3V4I A;  1KLN A;  3OYJ A;  3SCX A;  4JS5 A;  1SKR A;  1S9G A; 
#chains in the Genus database with same CATH topology
 1NKC A;  2KZZ A;  1SL1 A;  3RMA A;  2G8V A;  4DFK A;  4BQL A;  3HSC A;  3NFA A;  4CGH A;  1VQP N;  4BAC A;  5BN9 A;  3ZX0 A;  3K59 A;  1GLD G;  1BGX T;  1U45 A;  1R59 O;  2G8U A;  2Y1I A;  3QML A;  4O0I A;  1NK8 A;  3M8R A;  1KCF A;  5BRE A;  1VSJ A;  1VSM A;  4JI3 K;  4DR7 K;  3HZ6 A;  4KFB A;  3ALY A;  4JD2 B;  1L3T A;  2E6L A;  2HHH K;  1WSG A;  2ATQ A;  4GVE A;  3HPH A;  4B3T K;  1NOY A;  1LWE A;  2W6K A;  3EZW A;  4Y1C A;  1JJ2 M;  3H1Q A;  4PHT X;  1WSI A;  4CD1 A;  1C0T A;  4CJS A;  4N41 A;  1KFD A;  1VSD A;  4FYD A;  1WSJ A;  4QS9 A;  3OYE A;  4DTJ A;  1QSS A;  3VTI A;  3M8Q A;  4FLX A;  1BI4 A;  2FSK A;  3V9U A;  4FK4 A;  4FWQ A;  3KLH A;  2YHB A;  4BRH A;  5GAD P;  4NXM K;  3OYK A;  4BC2 A;  4HUG A;  2HVI A;  4J2D A;  4EAH D;  4FJ7 A;  4JLH A;  5C42 A;  4U67 L;  2VGM A;  1SKS A;  1ZBH A;  4PL7 A;  2OPS A;  3CJ7 A;  4MDB A;  1Q9Y A;  4DV4 K;  2D4W A;  3FFI A;  4BRE A;  2P9I A;  1C1B A;  3WQU A;  3CJB A;  4IFV A;  2NLX A;  3AA3 A;  1GLA G;  5AZJ B;  4JKB A;  3WEE B;  1OH6 A;  2KHO A;  3VEZ A;  3KHY A;  3T69 A;  1ZYQ A;  3VQA A;  4KV8 A;  4KH6 A;  2YHY A;  4WFN L;  3KJV A;  3NDK A;  1L3S A;  2G8W A;  4CFD A;  3V9Z A;  1Q18 A;  1JLC A;  2A1R A;  4JHD B;  3QBW A;  5HRP A;  4FJ8 A;  2HHS A;  2F8S A;  4HTL A;  2YNI A;  1KAX A;  3G25 A;  4GY2 B;  4F4K A;  4K0K K;  3D45 A;  1CZA N;  2YNG A;  2YJF A;  3WUH A;  5M1K A;  4ID1 A;  1RIL A;  5KPR A;  3LL3 A;  3DJC A;  3NE6 A;  3CJ1 A;  3P83 D;  3BDP A;  4YOY A;  4KB0 A;  1Z05 A;  4BC5 A;  4CGG A;  4YOU A;  3CCU N;  2BGG A;  2NRR A;  2NZT A;  1RT7 A;  4CIG A;  1NMN A;  4KKO A;  3VEV A;  1U48 A;  2HMI A;  4B1X B;  3HT3 A;  1F21 A;  3HP6 A;  3VA3 A;  2PFU A;  4AM7 A;  3J7Z O;  1SS6 A;  2E1Z A;  3H3N O;  4DQ8 A;  1VHX A;  1YTU A;  2IIR A;  1RNH A;  4KPY A;  3CM6 A;  3FR0 A;  1TKX A;  5BPL A;  1DLO A;  1HNI A;  3DXM B;  3CCS N;  3DRP A;  1RBS A;  1NGD A;  3I0R A;  2NNW A;  4FWS A;  4IG0 A;  1UA1 A;  1WLJ A;  1QHT A;  4OPK A;  4O5F A;  4B3R K;  5AQP A;  3M6G A;  3KWI A;  3CQY A;  2P5O A;  3WXK A;  1XC3 A;  5JLF A;  3TTC A;  1RT4 A;  3U9Z A;  4CGI A;  2E1Y A;  3O80 A;  2OCE A;  3H46 O;  4MFB A;  3S3O A;  2EX3 A;  4JI0 K;  2GBZ A;  1NLV A;  4Z4I A;  4AHU A;  3VMF B;  3PSF A;  3ZSQ A;  5TKY A;  4TSX A;  1K73 O;  3AO4 A;  4O5B A;  4V19 S;  4MO5 A;  1EXQ A;  5AQL A;  3D2F A;  3AVF A;  3FZK A;  3C6T A;  3D0P A;  3R8E A;  3A8Y A;  4I9L A;  4I9Q A;  4A5A A;  4K8Z A;  4FWP A;  2I7N A;  4YHH K;  3EKU A;  4L8R B;  4BR0 A;  3TTD A;  4C23 A;  1ATN A;  1VSF A;  3RRH A;  4KRF A;  2O8F A;  4LH4 A;  1HKG A;  1OVQ A;  2XY5 A;  4ZTJ A;  4CD3 A;  1E3M A;  2P9L B;  3O8M A;  1KC8 O;  5M1O A;  5C0Y A;  4A2A A;  1CXU A;  2GWK A;  4CF8 A;  1BDG A;  3ZSW A;  2QW9 A;  4OGE A;  2OZS A;  3RMB A;  3PIO L;  2F7T A;  2ITM A;  3TAG A;  3WQT A;  3CYM A;  3JYT A;  1DT9 A;  3QIO A;  1BCO A;  4FJN A;  4CFC A;  3QIN A;  1P90 A;  4M3X A;  4DQI A;  1T6D A;  3QER A;  3THY B;  4H0X B;  5B8H A;  3ZSZ A;  4CFB A;  3SYZ A;  3A5M C;  3A5N C;  2QKK A;  3BZC A;  3V9X A;  1NK4 A;  3IKM A;  4E7L A;  2W41 A;  1RTI A;  4NCA A;  4JKG A;  4B1W B;  3EY1 A;  1NK0 A;  3B6O A;  3UIQ A;  4G9Z A;  5HP1 A;  1GLE G;  5FPE A;  3SJJ A;  3O9S A;  2D0B A;  1NBW A;  4YOR A;  2FSJ A;  4DG1 A;  3J81 O;  3L8B A;  1C0U A;  4DQR A;  2BUP A;  4GNI A;  4OKJ A;  3K5O A;  1S3X A;  2IAJ A;  4B3S K;  5SWM A;  2E2Q A;  5KPT A;  3THV A;  1FKP A;  3V1Q A;  5LMN K;  3THW B;  2G8K A;  4DTO A;  3VQ7 A;  4LF8 K;  4HUE A;  3VQ9 A;  3H6E A;  5IWA K;  3CCL N;  3DM2 A;  4FZX C;  3DWL A;  4E7H A;  5JS1 A;  4NCG A;  4E1J A;  3CMA N;  3LP3 A;  3LP2 A;  4BRI A;  2O8E A;  3AAP A;  1B92 A;  1GOB A;  5E26 A;  2HHX A;  4EP5 A;  2E88 A;  3JAM O;  5FRM A;  3K2P A;  1JCG A;  1Y97 A;  5MLC Q;  3NAE A;  3GDQ A;  1X9S A;  2D0O A;  4H5V A;  1Z25 A;  2WC9 A;  3CPE A;  4QS8 A;  1IG9 A;  4DQS A;  1Q8I A;  1ZBS A;  4DSK A;  4AH9 A;  1EWR A;  1NK9 A;  2VCP A;  1T7P A;  4A59 A;  3LAN A;  4DTN A;  1S6Q A;  4K42 A;  2DFF A;  4ZHR A;  3NCI A;  3I56 N;  2ZJR L;  4LF4 K;  1JL2 A;  1IBK K;  3QIC A;  3VQQ A;  3ID6 A;  2HHW A;  3K5L A;  4AHR A;  4KAZ A;  3K57 A;  2UYT A;  4PL8 A;  4XH5 A;  3TAP A;  1C1C A;  3I33 A;  3LM2 A;  1T05 A;  1RDW X;  4E7J A;  4FLV A;  1VQL N;  5CY4 A;  2BTF A;  4WCE L;  4LC9 B;  1LWF A;  1YTA A;  4NO7 A;  1QQM A;  1S1T A;  4FLT A;  4Z94 A;  4HVJ A;  1BQM A;  3KLE A;  1NJI O;  1ASW A;  4ELU A;  1LOT B;  3CCR N;  4RG8 A;  3PV8 A;  1YUW A;  1QSY A;  1IO2 A;  2P9K A;  4YOT A;  3ZEU A;  1BIZ A;  1XWL A;  3UKR A;  1IKV A;  4B1Z A;  4IJN A;  4HCB A;  4B9N A;  1SAZ A;  3WNE A;  5J2M A;  3DLG A;  2P9P B;  2E20 A;  4KH4 A;  2VQF K;  4KBO A;  4E19 A;  1RDU A;  3C65 A;  4JI6 K;  4ID5 A;  3C94 A;  4PWD A;  2UU9 K;  3O9R A;  1NKB A;  3RWU A;  2W40 A;  3DLE A;  3ZLJ A;  1VSL A;  4FPB A;  3VEW A;  3PSI A;  3SBT A;  3LP0 A;  1HPZ A;  1TKT A;  2P1J A;  1KSP A;  5AQF A;  4I2Q A;  3VA0 A;  3ENO A;  2FBY A;  2O8D B;  4NYN A;  1HYV A;  4E1M A;  4YNQ A;  3SJH A;  3Q7C A;  4DV0 K;  2ETJ A;  3VGM A;  5F1X A;  3L2Q A;  1WAF A;  3VQB A;  3WXM B;  4BRF A;  1E4G T;  3D2F B;  1VQ4 N;  3KTQ A;  3H45 C;  3KVG A;  4KHS A;  4EZ6 A;  4GMJ B;  2E8A A;  4C8O A;  3MMV A;  3BF3 A;  4IDH A;  2UUA K;  5BRH A;  3MX5 A;  1LWC A;  4DR2 K;  2YHA A;  3LDL A;  1NU0 A;  4CIE A;  5JLH A;  3SUO A;  3ZET A;  4A62 A;  2KFN A;  2OA8 A;  1S5J A;  5AQM A;  1KLN A;  4JS5 A;  1SKR A;  4FJ5 A;  2IVP A;  3ZYY X;  4ELV A;  3K58 A;  2Z1G A;  3BEX A;  3K0S A;  3DLB A;  3KK3 A;  1JLQ A;  4DCH A;  1TYQ A;  4OVL A;  4AHC A;  2G8I A;  3TAB A;  1BO5 O;  4X62 K;  3KKR A;  4M3R A;  3AY9 A;  3SMP A;  4CEE A;  5AQS A;  4WF9 L;  3S9H A;  1XC9 A;  3S41 A;  3ULD A;  1K8K A;  3TAQ A;  1D5A A;  2KKZ A;  1B9D A;  5AZI A;  1DTQ A;  2HNY A;  2HHU A;  2VG7 A;  4IOC L;  3TAF A;  1U47 A;  4C1N I;  1FW6 A;  2YI1 A;  4CGD A;  5FDL A;  3EE9 A;  1C1A A;  3Q7B A;  3ZT1 A;  3OYD A;  1NK6 A;  4K41 A;  4CK1 A;  1D4X A;  2QWM A;  1QSL A;  4EP4 A;  3NBP A;  3VES A;  4J8F A;  1BA1 A;  3NF9 A;  1N33 K;  3D2E A;  2DTU A;  4XIU A;  4CHQ A;  3SPY A;  1TKD A;  1TUY A;  3R9P A;  4AHV A;  4NYF A;  4ISF A;  5JVG L;  4CZK A;  5FRO A;  2G8F A;  4H0P A;  3A0I X;  2V7Z A;  3CC4 N;  2D1K A;  5JIC A;  2Q0U A;  4C8N A;  3RSE B;  2BDP A;  4FWM A;  2ZE2 A;  2OPQ A;  3ZSR A;  3TU5 A;  1N32 K;  3HM9 A;  3I8D A;  3CF5 L;  5FPD A;  4B9S A;  1RDA A;  5CYM A;  4BDZ A;  5CE3 A;  4FM0 A;  4JKH A;  1BG3 A;  1BIU A;  3QBX A;  2ASP A;  3MEE A;  4RW9 A;  3IG1 A;  3OYN A;  4ILJ A;  1K6Y A;  1UA0 A;  1JCF A;  3VF2 A;  5AQJ A;  4LSL A;  1O1W A;  3KD5 E;  4X66 K;  3LM9 A;  3VQ8 A;  1WB9 A;  1VSE A;  5AQZ A;  5F0X A;  4M7Y A;  4O4G A;  3CQX A;  4DR3 K;  4H0O A;  2IVN A;  1X9J A;  4N56 A;  1B9F A;  4BRA A;  4CF2 A;  1D9F A;  4YDU C;  4M63 C;  4F3O A;  5C2D A;  4DV6 K;  4FO0 A;  5E41 A;  2HNZ A;  2Z1H A;  1OKJ A;  4JI7 K;  3ZX3 A;  4XH4 A;  2Q36 A;  1P8Z A;  4JI5 K;  3WT0 A;  1HYS A;  1C0F A;  4JN4 A;  1H1V A;  4LF6 K;  4FXD A;  1QQN A;  2GV9 A;  4JV5 K;  4BC4 A;  2GUI A;  5M1Q A;  2X78 A;  1IH7 A;  4MLE A;  4MQ3 A;  5AQH A;  3VEX A;  1JLF A;  2P9K B;  1ZC6 A;  3AVG A;  3UKR B;  3H3O B;  1BIS A;  4A5B A;  4DFM A;  3EE8 A;  4G1Q A;  2ITG A;  1CXQ A;  4BRL A;  5KGW A;  3HVR A;  2UXC K;  4RTF D;  2HW3 A;  3HOS A;  1KLM A;  4FWO A;  4X64 K;  1LW0 A;  1KAY A;  4YDU A;  3MEG A;  2P51 A;  3PY8 A;  2ZGZ A;  3SQ1 A;  3F2K A;  4JAX A;  2WBN A;  4KRE A;  4KHQ A;  3SAF A;  3I8B A;  1QQC A;  2YV0 X;  1A5V A;  4M3Z A;  1JXE A;  3SQ4 A;  1EET A;  3HK2 A;  4DFJ A;  3QES A;  4JI4 K;  2B4J A;  4DV5 K;  4UY8 O;  3OS0 A;  1RDC A;  3HYF A;  3THX B;  4B9T A;  2J4R A;  5E84 A;  3P4I A;  4CZF A;  1YHQ N;  1N8R O;  2XY8 A;  1HX1 A;  2GEM A;  1U4B A;  4DLG A;  4IEE A;  4IXC A;  2PBD A;  4ISE A;  3LWL A;  4NCB A;  2PYL A;  4FZZ A;  2O8C B;  3G6E N;  3KK2 A;  4B9U A;  5KTQ A;  4FZY A;  3AVI A;  3FZF A;  2IGI A;  2NRX A;  3LDP A;  3T3F A;  4FM2 A;  1HUX A;  3ZSX A;  4M41 A;  1W9H A;  3AA5 X;  4CJ5 A;  3AVN A;  4OPA A;  1IG8 A;  3ASM A;  1TGO A;  1KFS A;  1A5X A;  2A3Z A;  2IDO A;  3F73 A;  1G99 A;  4JI8 K;  1KAZ A;  1QS4 A;  3O5B A;  4NLB A;  3F9K A;  4OPJ A;  2CGK A;  2QWP A;  4OKK A;  3KLG A;  3OYA A;  1W0H A;  1IKX A;  3AO5 A;  2GX9 A;  2B6A A;  4JKC A;  3SUP A;  4BE1 A;  4CJW A;  2O8B B;  1JXB A;  1YXQ A;  4BRO A;  4W5Q A;  3AO2 A;  3O4N A;  4B08 A;  2P9S A;  3OBY A;  4JEP A;  3ZSO A;  4FW1 A;  3KKS A;  3OYF A;  1HYZ A;  4L3Q A;  4GVM A;  4Y1D A;  5BPM A;  4U7B A;  4LFC K;  5AQU A;  2ASM A;  2JGU A;  3HM8 A;  1GOA A;  4IJA A;  4JKF A;  3PX4 A;  3CM5 A;  3HXM A;  1M1K O;  4FVM A;  4OLA A;  2FXU A;  4IKF A;  2BE2 A;  3UE5 A;  2Z1I A;  3SAG A;  1GLC G;  2OPP A;  1HQE A;  3SQ0 A;  4KHY A;  2HF3 A;  3O9U A;  3P1G A;  3L2U A;  5ELZ A;  1CZ9 A;  4CE9 A;  4DMN A;  3HJF A;  1G15 A;  3VEY A;  4OPH A;  4CZM A;  1VQ8 N;  3E9O A;  2UUB K;  3BGR A;  3SV4 A;  5KRS A;  3CHW A;  1JLE A;  2QI2 A;  2YKM A;  1L3V A;  4MLH A;  3NF7 A;  3SMS A;  4DR5 K;  4GV6 A;  2V51 B;  2IOC A;  2ZQB A;  2YHX A;  4MO4 A;  4RWT A;  5AFU H;  1EP4 A;  2VWJ A;  1BA0 A;  2HBM A;  3VQ5 A;  4B8C A;  5CHI A;  1GLJ O;  4M3U A;  3KWG A;  4B1V A;  4IG3 A;  3OYI A;  2ASO A;  4F3T A;  5EOY A;  3BUZ B;  3WXJ A;  4A61 A;  1VAZ A;  3TI0 A;  3TAE A;  3OTO K;  4FCY A;  1XMQ K;  3CET A;  2VWK A;  4Z4H A;  1GLL O;  3CJC A;  1DKG D;  1RDB A;  4C1N K;  4M42 A;  3U6F A;  3W3D A;  4I6M B;  3UKU A;  3WNH A;  1U49 A;  3NH1 A;  3DXK A;  3DMJ A;  4CJ4 A;  2P9U A;  3ULE A;  4FJI A;  3AV9 A;  4DR4 K;  3AVB A;  1XHZ A;  4EZ9 A;  4CJ7 A;  3U4L A;  3VEN A;  4DF4 A;  1HLU A;  1NGG A;  5DM6 L;  3EYZ A;  4DV7 K;  4BRK A;  1NGF A;  3NVK A;  4DQP A;  3CCQ N;  3LZI A;  3CI5 A;  4RW7 A;  3K5N A;  4F2S A;  4OKE A;  3LPU A;  1KVC A;  3G0Z A;  4YOV A;  3RR8 A;  3NHG A;  3KZB A;  3CC7 N;  1KQS M;  1Y64 A;  3IUC A;  1HNX K;  4WQ4 C;  4CZL A;  3O4Q A;  4CVN E;  4FJJ A;  3LWM A;  4CJU A;  4HCC A;  5M1F A;  5D3G A;  1WN7 A;  1V4T A;  1FJG K;  3EO3 A;  2XY6 A;  4BVP A;  4CJQ A;  4WQ5 C;  4CHO A;  3WXI A;  2P9N A;  4DKW A;  3C6U A;  1D9D A;  1TKZ A;  3IRX A;  3PUF A;  2NRH A;  2O4I A;  2WOM A;  1RBU A;  3OA9 A;  3SUQ A;  3B6P A;  3VGK A;  4O44 A;  1U04 A;  3IAY A;  4EFH A;  4DU3 A;  3RMC A;  2WON A;  1HRH A;  3ZT4 A;  4PKH A;  3SZ2 A;  4F2R A;  2B5J A;  4EHT A;  4LF7 K;  1X9W A;  3EKS A;  1N34 K;  1MA9 B;  1SUQ A;  4R5P A;  1V4S A;  1N5Y A;  4GV9 A;  3VQD A;  2HBK A;  4BY9 C;  3FE1 A;  4KO0 A;  3MCP A;  2IVO A;  2ZJP L;  2FC0 A;  4WQ4 A;  3QEW A;  1BI4 B;  3D6R A;  4CHP A;  5BPN A;  3TSP A;  1IBL K;  4N47 A;  3T7Z A;  1YT3 A;  3MX2 A;  4PUO A;  5DMR A;  1KVB A;  3K5M A;  4GKK K;  4WQ5 A;  1J53 A;  3OHR A;  4Z0U A;  3OYH A;  4W5R A;  2ZWH A;  5BRF A;  3SV3 A;  4JRQ A;  4BG8 A;  1RT6 A;  1OVY A;  3M8P A;  2P9I B;  4C8M A;  4CES A;  1S1W A;  2Q0R A;  3OYJ A;  3SCX A;  2HHV A;  1T3V A;  1QHA A;  1S9G A;  2OYQ A;  5HLF A;  3MWT A;  3TTF A;  3V81 A;  3QB0 A;  5C24 A;  5C15 A;  4DTM A;  3GL1 A;  2Q97 A;  4GV3 A;  1HQU A;  2GUP A;  3WXL A;  5HRS A;  3OS2 A;  3C7N A;  2OZM A;  2KQ2 A;  4RCH A;  3I55 N;  3CD6 N;  4CGF A;  4BGB A;  3OVN A;  2KFZ A;  5KGX A;  1NOZ A;  3KLF A;  1JCE A;  3J7Y P;  1KTQ A;  4DFP A;  5ADX A;  2HHT A;  1QZ5 A;  3NGZ A;  2YX6 A;  2RE2 A;  2CGL A;  3T19 A;  4CCH A;  5FPN A;  4CZH A;  2YJE A;  2GWJ A;  4DR1 K;  3JXU A;  1C6V A;  2EHG A;  4IBN A;  3TAN A;  3B8A X;  3FFK B;  5AR0 A;  2QXF A;  4DR6 K;  3AVC A;  3QNO A;  3KK7 A;  4DS5 A;  3SBG A;  2HB5 A;  3CJA A;  4H8K A;  1TV6 A;  3AVJ A;  1YJN N;  3M5R A;  5KQD A;  3QET A;  5TKW A;  2I5J A;  3MDQ A;  1XNR K;  3RVC A;  5AQY A;  3MAQ A;  1NKE A;  1IV0 A;  3OYL A;  3AA2 A;  5J2Q A;  1Q9X A;  3OBW A;  1MU2 A;  3T1H K;  2FBV A;  1YF5 L;  4HWI A;  4BR5 A;  2NRV A;  4OO1 J;  3EL2 A;  3ISN C;  4AHT A;  3OS1 A;  4KHP K;  1TAU A;  3N4Q A;  4LFB K;  3DLR A;  3DOK A;  3QEI A;  3A2F A;  4H4M A;  4M7X A;  3RMD A;  3UKU B;  3VF6 A;  4KB1 A;  1RT2 A;  2HHQ A;  3KIO A;  1NGH A;  3WNG A;  3CG7 A;  3DXK B;  3LAM A;  1N36 K;  1BQN A;  4ICL A;  3CPW M;  3JS6 A;  2YKN A;  4JD2 A;  3ZX2 A;  2XO7 A;  1J9A A;  3HPO A;  4FPA A;  2KW4 A;  2ZM6 K;  3A5L C;  1HR0 K;  4DV2 K;  4A57 A;  1TK5 A;  2X6N A;  2O8F B;  1Z26 A;  3LDS A;  1VSK A;  5JMV A;  1S6P A;  1SZ2 A;  4KH5 A;  2I7P A;  4QCL A;  3O1B A;  3M3Z A;  4HUF A;  4IO8 A;  4PKI A;  4IEI A;  3IFR A;  3P5J A;  3DLK A;  3U3G A;  3DRR A;  1HMV A;  4JKD A;  5HOO A;  1TUU A;  2JLE A;  2Q2R A;  4FWN A;  2P9N B;  3RTV A;  3HST B;  5DK5 A;  1NGA A;  4CEF A;  3OY9 A;  2VWB A;  1NMD A;  5CR4 A;  3T1Y K;  4W5N A;  1SL0 A;  3O3H A;  1U2V A;  3NGI A;  3QIP A;  5AZJ A;  4CHN A;  4CI6 A;  4B9V A;  4JKG B;  3MEC A;  3FLC O;  4KTQ A;  3L2V A;  4EIA A;  4O8U A;  1OH5 A;  4DUZ K;  3EEQ A;  4J2A A;  4CHY A;  2R7Y A;  3ID8 A;  4JHD A;  5AQW A;  3SAH A;  3MXI A;  3CC2 N;  3NF8 A;  1W2B M;  1NG9 A;  3G10 A;  1IJJ A;  4BDY A;  2GTD A;  2OPR A;  4C8L A;  4BR4 A;  3FZH A;  3HI0 A;  3AVK A;  3ZSV A;  4KI4 A;  4Z4F A;  1NM1 A;  4Q5V A;  4JRP A;  2WFB A;  3T1A A;  3RRG A;  2D0A A;  2QTD A;  4DSF A;  3E66 A;  3SPZ A;  3C0B A;  3TAR A;  1WNS A;  3SK3 A;  3AO1 A;  1HJO A;  1NWK A;  2O8E B;  5EVZ A;  2Q3S A;  3OJS A;  5J2P A;  1RBR A;  2E2O A;  4OLB A;  4KHU A;  4O0J A;  4FJH A;  4CK2 A;  3AVH A;  1KXP A;  3ZCM A;  1DTT A;  3QO9 A;  4IDK A;  2QWR A;  4CJT A;  1ZBI A;  1EWQ A;  4FJ9 A;  1Q86 O;  3IS9 A;  5HL7 L;  3HBT A;  4FVU A;  4DV3 K;  3TAM A;  5I3U A;  1RTH A;  3VGL A;  3A5O C;  1ASU A;  1RBV A;  3CFP A;  2Q31 A;  4FWR A;  2VQE K;  2A42 A;  3R6M A;  1JKH A;  1RCH A;  3HP9 A;  4DHY A;  2DY4 A;  4CER A;  2RHK A;  4DU4 A;  5AQR A;  2HND A;  3C6H A;  1NNE A;  1YIT N;  3CFR A;  3CCJ N;  2HBJ A;  2NRZ A;  4CJ3 A;  5KRT A;  5AQN A;  1RTJ A;  4JS4 A;  2YNH A;  5DM7 L;  1ATR A;  4FJG A;  4AHS A;  3LAK A;  4CJF A;  2QXL A;  2F4V K;  2VYP A;  1TK8 A;  3DOL A;  1ZXO A;  1NGE A;  5J1E A;  3OW2 M;  2QWQ A;  5GIN A;  5C25 A;  3ZEU B;  3DAW A;  3MWP A;  4CBU A;  4E1N A;  1MDU B;  4AF1 A;  5K14 A;  3L6Q A;  4BRG A;  3J7A P;  3LZJ A;  1ZBF A;  1RGI A;  2P9L A;  2AP1 A;  4CW7 B;  1XUP O;  4FOE A;  5AJ3 K;  2RKI A;  4JNE A;  4B3M K;  2KTQ A;  3LDN A;  4IO9 L;  5AQX A;  4BC3 A;  2KLA A;  3QEP A;  3ZT2 A;  2P5G A;  4E89 A;  1VQ5 N;  4JK9 A;  1YJ9 N;  5EX5 A;  1GOC A;  5C12 A;  3SI6 A;  1NJX A;  2OAN A;  3THY A;  1WAJ A;  3U8X A;  2VGN A;  2ZJQ L;  4FL9 A;  4N5S A;  4LF9 K;  1KRP A;  4CF0 A;  5AQQ A;  2DFH A;  4B1Y B;  5KPZ A;  4EHU A;  4YOW A;  4DQQ A;  5T7B A;  1J5O A;  3CQ8 A;  3PLA A;  2HF4 A;  4CEQ A;  3M1F A;  5EU7 A;  3G4S N;  5F2R A;  2W42 A;  1YVN A;  4J2B A;  2UXD K;  4DTR A;  4E7I A;  5C2F A;  1R0A A;  4WE1 A;  1RDD A;  3ZET B;  4CIF A;  3ITH A;  4JI2 K;  1LV5 A;  1W97 L;  4CBX A;  5J2N A;  3TPQ A;  4ILG B;  2QWN A;  1MWK A;  5KI6 A;  1ITG A;  3THW A;  3ENB A;  2E2N A;  3VPZ A;  2NUB A;  4B3O A;  2NRT A;  1LW2 A;  4W5O A;  2UXB K;  4JI1 K;  4FLZ A;  4CJL A;  4KTZ A;  3ZSY A;  4LY7 A;  1TYQ B;  2A40 A;  1IKY A;  3J80 O;  3VQ6 A;  2CH6 A;  4DSL A;  4WFA L;  1VQ9 N;  3BF1 A;  1VK0 A;  3AVA A;  4M3W A;  5EY4 A;  1LCU A;  1NGJ A;  1U2V B;  1K8K B;  5HBM A;  5AZI B;  3DYA A;  2E2P A;  4CJK A;  4DU1 A;  3QNN A;  5SZT A;  1QE1 A;  1ATS A;  2D0P A;  1VQ7 N;  3D7E O;  1ASV A;  4CEO A;  3O3F A;  3KLI A;  4FW2 A;  4CEB A;  1QVF M;  2A6A A;  1NK7 A;  1T8E A;  4BR9 A;  1ESV A;  3MN9 A;  3EN9 A;  1C0M A;  5CZ1 A;  3GE1 A;  4CEZ A;  1QZ6 A;  1VRT A;  4MDA A;  1UAX A;  2BAN A;  3D2E B;  3CXC M;  4O8K A;  4XEI A;  3U9D A;  2Y1J A;  4BR2 A;  3V6D A;  1Q7Y O;  3AVM A;  3F5T A;  1J54 A;  3O08 A;  4NB4 A;  3KK1 A;  4BE2 A;  5BRD A;  1IKW A;  4FWK A;  4KHN A;  3DLL L;  4CHZ A;  3CME N;  4H0T B;  4CF9 A;  2JWK A;  3OYM A;  4RW6 A;  4FLW A;  4LF5 K;  3V4I A;  2Q1N A;  4DV1 K;  3W0L A;  1U6Z A;  3K9K A;  5CZ2 A;  4I2P A;  3AO3 A;  1QQO A;  3MCA B;  4H0V B;  1NGI A;  1K9M O;  2P9P A;  2G8H A;  4IFY A;  3AAQ A;  3HRG A;  3C6A A;  4RW8 A;  1VQN N;  3I0S A;  1SV5 A;  1WSE A;  4NLC A;  1XHX A;  3TSU A;  2DFE A;  4QS7 A;  1I39 A;  3E9P A;  4FOI A;  1VRU A;  2CGJ A;  2PZS A;  1EX4 A;  1TAQ A;  4FLY A;  5M1N A;  2A1S A;  4CZG A;  3M8S A;  1L3U A;  3GG4 A;  2O8D A;  4DTS A;  3QFU A;  3O9Q A;  3OJU A;  1YI2 N;  4B9Q A;  3E01 A;  3VQE A;  4KI6 A;  5I42 A;  2RPI A;  5IT9 O;  2QM1 A;  4M45 A;  1RTD A;  1NK5 A;  3L4Q A;  2IC3 A;  4H5T A;  3AGR A;  1RT5 A;  3NH2 A;  4BE0 A;  4F9O A;  3QEV A;  3ATU A;  3H08 A;  1XMO K;  4DLE A;  2F9W A;  5JVH L;  1XI1 A;  5GIP A;  1OH7 A;  2FF3 B;  5GIO A;  4PQU A;  3BY5 A;  3DI6 A;  1HPM A;  1C0G A;  1WSF A;  4C8K A;  3HPG A;  1HNV A;  2ZGY A;  4H5N A;  3V1R A;  4B9M A;  4H03 B;  4XH1 A;  3AVL A;  3VQC A;  2E4L A;  3OYC A;  4J2E A;  1X3M A;  2YCH A;  3HO1 A;  3MN6 A;  5HRO A;  2JWL A;  5EXW A;  1KVA A;  4DSJ A;  1DEJ A;  1UOC A;  1DGK N;  4CFA A;  2QEX N;  2D5R A;  1HKB A;  4GW6 A;  4CZE A;  2W6L A;  4AM6 A;  2WTU A;  2FSN A;  4DS4 A;  3KD1 E;  1HNW K;  3LP1 A;  1EO1 A;  1NJY A;  3IMX A;  4CEC A;  3OYB A;  3VEO A;  3HTV A;  4AIL C;  2FBT A;  1W7A A;  2QWL A;  1ZBL A;  3DRS A;  1FK9 A;  3R1X A;  4FJK A;  4OGC A;  2D0C A;  5AQI A;  1D8Y A;  3MK6 A;  4QAG A;  2LSN A;  3JSM A;  1TVR A;  3J8A A;  1I94 K;  4A2B A;  4IWV A;  4FLU A;  4BDP A;  3QEX A;  2A41 A;  4FJL A;  4FSV A;  4BG9 A;  4BRD A;  1X9M A;  1ZBU A;  4X65 K;  3N4P A;  3MN7 A;  5FLX O;  1S22 A;  1OH8 A;  3P31 A;  2X74 A;  1TL1 A;  3L3U A;  2DPN A;  3O3G A;  2QWO A;  5CYQ A;  1VQ6 N;  4BQZ A;  2QKB A;  3CCV N;  4E3S A;  3ZT0 A;  1S72 N;  3FGU A;  4H5R A;  4FJX A;  4JK8 A;  1I3A A;  3TSQ A;  3VOV A;  5JS2 A;  4R79 A;  1YJW N;  1X3N A;  3VF4 A;  4DTP A;  4WFB L;  3NF6 A;  4BGA A;  3CJ9 A;  2P9S B;  4Z4E A;  4E0D A;  4CZJ A;  3RSE A;  2HBL A;  3MXM A;  5KQ8 A;  5AQT A;  4LFA K;  3CER A;  3O6W A;  3F9M A;  2ZF5 O;  4H5W A;  3L3V A;  2E5L K;  1TL3 A;  1HJR A;  1CLQ A;  4LH5 A;  1WUA A;  2HOE A;  1A5W A;  2RN2 A;  2VG6 A;  4CEA A;  1BWF O;  3NMU A;  1S1V A;  3E9L A;  4BRQ A;  5LJW A;  2HMP A;  4CJV A;  3LDQ A;  1HKC A;  1TK0 A;  1BHL A;  1BOT O;  4O55 A;  2HST A;  5FRN A;  1XQS C;  4K43 A;  3SLC A;  1NGC A;  3CIP A;  2E6M A;  1J5E K;  1K8A O;  1EKE A;  4B1U B;  3MN5 A;  4GKJ K;  4DWI A;  2FF6 A;  1GLF O;  1RBT A;  2ZD1 A;  4BRP A;  4BR7 A;  1N6Q A;  1JL1 A;  3AA4 A;  2QA4 N;  4KHW A;  3H1V X;  4DSI A;  4JYA K;  2FLO A;  1O13 A;  3FZM A;  1SQK A;  3OYG A;  3V9W A;  1L5U A;  3C95 A;  2V7Y A;  4IOX A;  4YOX A;  4AQY K;  4YY3 K;  4ILH A;  4Q0B A;  3MXJ A;  4FK2 A;  1S1X A;  4ZTF A;  4FJM A;  2FBX A;  4E7K A;  1WBD A;  4BRN A;  3CCM N;  4DSE A;  4LD0 A;  4IFE A;  4CJR A;  5BR8 K;  1SKW A;  3MED A;  5I9E B;  3PO4 A;  1CZB A;  3L4I A;  2XY7 A;  3GOI A;  2PY5 A;  4Z4C A;  1J6Z A;  4FWL A;  2P9U B;  1EQY A;  3ULE B;  2F96 A;  4BVO A;  3E1Y A;  5HRR A;  3BP8 A;  3UB5 A;  4NXN K;  2NRW A;  5GAG P;  2X6S A;  1GLB G;  2A5X A;  4IZ9 A;  1ILY A;  3PIP L;  3PX6 A;  2XRI A;  1T6C A;  4OJR A;  1BUP A;  3THX A;  3VN5 A;  5GAE P;  2OTL N;  4H0Y B;  1VSH A;  1VSI A;  2H3G X;  4BWM A;  2IS3 A;  1UWB A;  1YIJ N;  3VQP A;  4PA1 A;  3S3M A;  1LAV A;  2O8C A;  5LJV A;  4BRC A;  3VQ4 A;  2BH1 A;  1XNQ K;  3EZ5 A;  3R3L A;  4CJE A;  4DUY K;  1HNZ K;  1WSH A;  1NGB A;  1YAG A;  5AQO A;  4WYB A;  4CZI A;  4CJP A;  2OTJ N;  1YVU A;  4B9L A;  3LDO A;  2XHB A;  2HVH A;  1Q82 O;  3HVT A;  3WEE A;  3O4W A;  3CCE N;  2QK9 A;  3VET A;  1REV A;  1JLG A;  4UQG A;  2O8B A;  2Z1J A;  1VQK N;  3U3Y A;  2VG5 A;  4DTU A;  3RR7 A;  3AAR A;  3P39 A;  4N76 A;  2V52 B;  5C10 A;  1QVG M;  4ELT A;  4OX9 K;  2O4G A;  3O1W A;  5FPM A;  4QOZ B;  4FK0 A;  1JLA A;  1BCM A;  4BWJ A;  4CF1 A;  5H1S Q;  1JLB A;  3LAL A;  1RFQ A;  4PKG A;  4K8X A;  4BRM A;  4Z4G A;  3CFO A;  3P38 A;  2WUS A;  4DTX A;  3SUN A;  3HL8 A;  3ZT3 A;  4PY5 A;  2AJQ A;  1Z6R A;  2RF2 A;  3IDH A;  4M3Y A;  3PO5 A;  4I7F A;  5M1P A;  2CH5 A;  4W5T A;  3DXM A;  1BL3 A;  3O9T A;  4JKE A;  3NH0 A;  5AFU A;  5AQV A;  5LL6 Z;  3SQ2 A;  3AGK A;  4CGJ A;  1S9E A;  3C7N B;  3DLH A;  2F8T A;  3SNN A;  4LSN A;  1QTM A;  1T03 A;  2AA4 A;  3QLH A;  4Y0W A;  1VQO N;  1SL2 A;  4CK3 A;  5HRN A;  3V9S A;  5LY3 A;  1WOQ A;  1KD1 O;  4M3T A;  2YHW A;  4JKA A;  5ADX H;  4DF8 A;  2UUC K;  3PX0 A;  3K9J A;  1LAW A;  1X1P A;  3S3N A;  5BR9 A;  3V1O A;  3NGY A;  1MWM A;  4IOA L;  3QFP A;  1RT3 A;  3GBT A;  3VER A;  3TWH A;  5GAH P;  1WBB A;  1S1U A;  4I6M A;  4FM1 A;  3L2W A;  3VTH A;  1NJW A;  1T44 A;  3L2R A;  4F8R A;  4HHT A;  3BZK A;  2PYJ A;  1NJZ A;  4RW4 A;  2GEL A;  4CED A;  1E4F T;  3G71 N;  1BU6 O;  3L0Q A;  4ISG A;  5AQG A;  4DB3 A;  4KTW A;  1VQM N;  3HOT A;  4HTU A;  4YFU A;  1Q81 O;  3LPT A;  3FZL A;  3ATV A;  1RT1 A;  3NVM A;  5BN8 A;  2EWS A;  3QDK A;  3ENH A;  4CBW A;  2PAV A;  4B8A B;  1FKO A;  1M90 O;  4K25 A;  5A2Q O;  1FXX A;  3WNF A;  2YNF A;  5AQK A;  1IBM K;  5LMU K;  3TR8 A;  2KZM A;  4JK7 A;  2F9T A;  4H4O A; 
#chains in the Genus database with same CATH homology
 1NKC A;  2KZZ A;  1SL1 A;  2OYQ A;  3RMA A;  4ELV A;  5CZ2 A;  4I2P A;  5HLF A;  3K58 A;  2Z1G A;  3AO3 A;  4DFK A;  2G8V A;  3DLB A;  3NFA A;  4CGH A;  3KK3 A;  4BAC A;  3K59 A;  1JLQ A;  3V81 A;  1BGX T;  5C24 A;  1U45 A;  2G8H A;  4IFY A;  4DTM A;  4OVL A;  4AHC A;  2G8I A;  2G8U A;  1HQU A;  3TAB A;  2Y1I A;  3KKR A;  4RW8 A;  4M3R A;  5HRS A;  3OS2 A;  2OZM A;  3I0S A;  2KQ2 A;  1SV5 A;  4O0I A;  1NK8 A;  1WSE A;  4CEE A;  1XHX A;  3M8R A;  1KCF A;  3S9H A;  1XC9 A;  1VSJ A;  1VSM A;  3ULD A;  3TAQ A;  4CGF A;  3OVN A;  2DFE A;  2KFZ A;  1D5A A;  1NOZ A;  5KGX A;  3KLF A;  1B9D A;  1I39 A;  1DTQ A;  1KTQ A;  4KFB A;  3ALY A;  4DFP A;  1L3T A;  2HNY A;  1VRU A;  2HHT A;  2PZS A;  2HHU A;  1EX4 A;  1TAQ A;  2E6L A;  2VG7 A;  4FLY A;  3NGZ A;  3TAF A;  2A1S A;  1U47 A;  1WSG A;  3T19 A;  3M8S A;  2ATQ A;  4CCH A;  3HPH A;  1L3U A;  4CGD A;  5FDL A;  1NOY A;  1LWE A;  4DTS A;  1C1A A;  4Y1C A;  3OJU A;  1C6V A;  1WSI A;  3ZT1 A;  2EHG A;  3OYD A;  1NK6 A;  4IBN A;  4CK1 A;  1C0T A;  4CJS A;  3E01 A;  3VQE A;  3TAN A;  1QSL A;  1KFD A;  4EP4 A;  3NBP A;  4N41 A;  5I42 A;  4KI6 A;  1VSD A;  4FYD A;  2RPI A;  1WSJ A;  2QXF A;  3OYE A;  4M45 A;  4DTJ A;  1QSS A;  1RTD A;  3AVC A;  3QNO A;  3M8Q A;  1NK5 A;  3NF9 A;  4DS5 A;  2IC3 A;  3NH2 A;  4BE0 A;  1RT5 A;  4FLX A;  1BI4 A;  3V9U A;  2HB5 A;  4FK4 A;  3KLH A;  4XIU A;  2DTU A;  4CHQ A;  3QEV A;  4H8K A;  2YHB A;  1TV6 A;  3SPY A;  3H08 A;  1TKD A;  3AVJ A;  4DLE A;  4AHV A;  1XI1 A;  4NYF A;  5FRO A;  3OYK A;  4HUG A;  3QET A;  2HVI A;  2G8F A;  4J2D A;  4PQU A;  2I5J A;  3DI6 A;  4FJ7 A;  4JLH A;  5C42 A;  1WSF A;  4C8K A;  3HPG A;  1SKS A;  1ZBH A;  1HNV A;  3V1R A;  2OPS A;  4C8N A;  3MAQ A;  1NKE A;  3VQC A;  3AVL A;  2BDP A;  4B9M A;  1Q9Y A;  3OYL A;  3AA2 A;  2ZE2 A;  2E4L A;  2OPQ A;  3ZSR A;  3OYC A;  5J2Q A;  3HM9 A;  1Q9X A;  3I8D A;  4J2E A;  4B9S A;  1MU2 A;  1RDA A;  3HO1 A;  5CYM A;  4BDZ A;  4FM0 A;  2FBV A;  3FFI A;  5HRO A;  1C1B A;  4IFV A;  1BIU A;  3AA3 A;  3MEE A;  4RW9 A;  3IG1 A;  3OYN A;  1KVA A;  4DSJ A;  1K6Y A;  3ISN C;  1UA0 A;  4AHT A;  3OS1 A;  1ZYQ A;  3VQA A;  1UOC A;  4CFA A;  4KV8 A;  2D5R A;  4GW6 A;  1TAU A;  4LSL A;  1O1W A;  3DLR A;  3KD5 E;  3KJV A;  3DOK A;  3NDK A;  3VQ8 A;  4DS4 A;  1L3S A;  3QEI A;  2G8W A;  3KD1 E;  1VSE A;  3A2F A;  3LP1 A;  4H4M A;  4CFD A;  3V9Z A;  3RMD A;  4CEC A;  1NJY A;  3OYB A;  1JLC A;  4O4G A;  4AIL C;  2A1R A;  5HRP A;  2FBT A;  4FJ8 A;  4KB1 A;  2F8S A;  2HHS A;  2YNI A;  1RT2 A;  4N56 A;  3DRS A;  1ZBL A;  2HHQ A;  1B9F A;  3KIO A;  4CF2 A;  1FK9 A;  3WNG A;  3CG7 A;  1D9F A;  4F4K A;  3D45 A;  3LAM A;  4FJK A;  2YNG A;  4F3O A;  4ID1 A;  1RIL A;  1BQN A;  4OGC A;  2D0C A;  1D8Y A;  5E41 A;  4ICL A;  4QAG A;  3NE6 A;  2HNZ A;  3P83 D;  2LSN A;  2Z1H A;  3JSM A;  2YKN A;  3BDP A;  1TVR A;  4KB0 A;  2XO7 A;  1J9A A;  4CGG A;  4FLU A;  4BDP A;  2BGG A;  3QEX A;  3HPO A;  2KW4 A;  4FJL A;  1RT7 A;  4CIG A;  1X9M A;  1ZBU A;  1HYS A;  4KKO A;  1U48 A;  1TK5 A;  2HMI A;  3HT3 A;  2X6N A;  1Z26 A;  1F21 A;  3LDS A;  1VSK A;  1S6P A;  3HP6 A;  3VA3 A;  4FXD A;  2X74 A;  2GV9 A;  4QCL A;  1TL1 A;  3L3U A;  2GUI A;  4HUF A;  3O3G A;  2X78 A;  5CYQ A;  1IH7 A;  1YTU A;  4MQ3 A;  1RNH A;  3P5J A;  2QKB A;  4E3S A;  4KPY A;  3ZT0 A;  3DLK A;  3CM6 A;  1JLF A;  4FJX A;  1TKX A;  3AVG A;  1DLO A;  3U3G A;  3DRR A;  1HNI A;  1I3A A;  3DRP A;  1BIS A;  1RBS A;  5JS2 A;  4DFM A;  1HMV A;  3I0R A;  4G1Q A;  4IG0 A;  2ITG A;  2JLE A;  1WLJ A;  1CXQ A;  3HVR A;  1QHT A;  5KGW A;  4DTP A;  1UA1 A;  3NF6 A;  3RTV A;  3HST B;  2HW3 A;  4OPK A;  5DK5 A;  4Z4E A;  1KLM A;  4E0D A;  1LW0 A;  3MXM A;  4CEF A;  3OY9 A;  2P5O A;  3MEG A;  2P51 A;  4W5N A;  3PY8 A;  1SL0 A;  3O3H A;  3SQ1 A;  1RT4 A;  4CGI A;  3NGI A;  3L3V A;  1TL3 A;  3QIP A;  4H4O A;  4MFB A;  1HJR A;  1CLQ A;  3S3O A;  4LH5 A;  4CHN A;  4KRE A;  2EX3 A;  4KHQ A;  1A5W A;  2RN2 A;  2VG6 A;  4CEA A;  4B9V A;  1S1V A;  3MEC A;  1QQC A;  2YV0 X;  4KTQ A;  4CJV A;  3L2V A;  2GBZ A;  1A5V A;  4M3Z A;  4Z4I A;  1JXE A;  4AHU A;  1EET A;  3SQ4 A;  4FJ5 A;  3HK2 A;  4DFJ A;  3ZSQ A;  1TK0 A;  1BHL A;  3QES A;  4O55 A;  2B4J A;  4J2A A;  5FRN A;  4CHY A;  3OS0 A;  2R7Y A;  1RDC A;  3HYF A;  4TSX A;  4B9T A;  3AO4 A;  3MXI A;  4O5B A;  3NF8 A;  3G10 A;  1EXQ A;  2XY8 A;  4BDY A;  1U4B A;  2E6M A;  2OPR A;  4DLG A;  4C8L A;  3AVF A;  3AVK A;  3LWL A;  1EKE A;  3C6T A;  4NCB A;  3D0P A;  4DWI A;  2PYL A;  3ZSV A;  4FZZ A;  4KI4 A;  4Z4F A;  3KK2 A;  4B9U A;  5KTQ A;  4FZY A;  4I9L A;  1RBT A;  2ZD1 A;  3AVI A;  4Q5V A;  1N6Q A;  4JRP A;  4I9Q A;  2IGI A;  4K8Z A;  1JL1 A;  3AA4 A;  3T3F A;  3T1A A;  4FM2 A;  3RRG A;  4L8R B;  2D0A A;  3ZSX A;  1VSF A;  3RRH A;  4KHW A;  4KRF A;  4M41 A;  4LH4 A;  4DSF A;  1W9H A;  3SPZ A;  4DSI A;  3AA5 X;  4CJ5 A;  3AVN A;  2XY5 A;  3TAR A;  3ASM A;  4ZTJ A;  1TGO A;  1WNS A;  3AO1 A;  1KFS A;  1A5X A;  2IDO A;  3OYG A;  3F73 A;  2Q3S A;  3V9W A;  3OJS A;  5J2P A;  1L5U A;  3C95 A;  1QS4 A;  1RBR A;  1CXU A;  3F9K A;  4OPJ A;  4OKK A;  4CF8 A;  4KHU A;  4OLB A;  4O0J A;  3KLG A;  3ZSW A;  3OYA A;  4FJH A;  4Q0B A;  3MXJ A;  1W0H A;  4OGE A;  1IKX A;  2G8K A;  4FK2 A;  3AO5 A;  2OZS A;  1S1X A;  3RMB A;  2B6A A;  4ZTF A;  4FJM A;  2FBX A;  3SUP A;  4E7K A;  3TAG A;  4CK2 A;  3CYM A;  3JYT A;  4BE1 A;  3AVH A;  3QIO A;  4CJW A;  3ZCM A;  4DSE A;  4LD0 A;  1BCO A;  1JXB A;  4FJN A;  1DTT A;  4CFC A;  3QIN A;  3QO9 A;  4IDK A;  4W5Q A;  4CJR A;  4CJT A;  3AO2 A;  3O4N A;  4B08 A;  4M3X A;  4DQI A;  1ZBI A;  4FJ9 A;  1SKW A;  3ZSO A;  3IS9 A;  3MED A;  4FW1 A;  3QER A;  3PO4 A;  1CZB A;  2XY7 A;  3KKS A;  2PY5 A;  3TAM A;  1HYZ A;  4Z4C A;  3OYF A;  1RTH A;  5I3U A;  4B3O A;  4GVM A;  4Y1D A;  3ZSZ A;  4CFB A;  3SYZ A;  1ASU A;  1RBV A;  3CFP A;  2QKK A;  3V9X A;  1NK4 A;  4E7L A;  2F96 A;  1JKH A;  1RCH A;  1RTI A;  2JGU A;  4NCA A;  3HP9 A;  1GOA A;  3EY1 A;  2DY4 A;  3PX4 A;  3CM5 A;  5HRR A;  4CER A;  4FVM A;  3B6O A;  3HXM A;  4DU4 A;  1NK0 A;  3UIQ A;  2HND A;  4OLA A;  4IKF A;  2BE2 A;  5HP1 A;  2Z1I A;  2X6S A;  3SJJ A;  3CFR A;  2OPP A;  1HQE A;  2D0B A;  3SQ0 A;  4KHY A;  4CJ3 A;  3PX6 A;  5KRT A;  2XRI A;  4OJR A;  3P1G A;  4DG1 A;  3L8B A;  1RTJ A;  4JS4 A;  3VN5 A;  2YNH A;  1C0U A;  4DQR A;  3L2U A;  4FJG A;  1VSH A;  4AHS A;  4OKJ A;  3K5O A;  2IAJ A;  4DMN A;  1CZ9 A;  1VSI A;  3LAK A;  4BWM A;  4CE9 A;  3HJF A;  1G15 A;  5SWM A;  4CJF A;  2IS3 A;  1UWB A;  3THV A;  1FKP A;  3V1Q A;  3DOL A;  1TK8 A;  3VQP A;  4PA1 A;  3S3M A;  3BGR A;  1LAV A;  5J1E A;  5KRS A;  3SV4 A;  1JLE A;  4DTO A;  3VQ7 A;  5C25 A;  2YKM A;  1L3V A;  4HUE A;  3NF7 A;  3VQ9 A;  3VQ4 A;  2IOC A;  4E1N A;  3DM2 A;  4FZX C;  4E7H A;  2ZQB A;  3EZ5 A;  4CJE A;  1EP4 A;  1WSH A;  5JS1 A;  4NCG A;  5K14 A;  2VWJ A;  3LP3 A;  3LP2 A;  3VQ5 A;  3LZJ A;  1ZBF A;  4B8C A;  4CJP A;  1YVU A;  4B9L A;  4M3U A;  1B92 A;  1GOB A;  4IG3 A;  3OYI A;  2XHB A;  2HHX A;  4EP5 A;  2HVH A;  4F3T A;  5FRM A;  3K2P A;  1Y97 A;  3NAE A;  2RKI A;  3TI0 A;  3TAE A;  1X9S A;  2KTQ A;  3HVT A;  3QEP A;  2QK9 A;  1Z25 A;  3ZT2 A;  4FCY A;  2P5G A;  4E89 A;  2VWK A;  1IG9 A;  1REV A;  1JLG A;  4UQG A;  4Z4H A;  4DQS A;  1Q8I A;  2Z1J A;  4DSK A;  4AH9 A;  4M42 A;  1RDB A;  3U6F A;  1GOC A;  1NK9 A;  3U3Y A;  2VG5 A;  1T7P A;  3SI6 A;  3LAN A;  4DTU A;  1S6Q A;  4DTN A;  1NJX A;  3RR7 A;  3WNH A;  1WAJ A;  1U49 A;  4N76 A;  3NH1 A;  4N5S A;  3DMJ A;  4CJ4 A;  2DFF A;  1KRP A;  4ELT A;  4CF0 A;  2O4G A;  4FJI A;  4ZHR A;  3AV9 A;  2DFH A;  3NCI A;  3AVB A;  1XHZ A;  4EZ9 A;  4DQQ A;  5T7B A;  1J5O A;  3CQ8 A;  1JL2 A;  4QOZ B;  3VQQ A;  4DF4 A;  4FK0 A;  1JLA A;  2HHW A;  1BCM A;  3EYZ A;  4AHR A;  4BWJ A;  4CF1 A;  3K5L A;  3K57 A;  4KAZ A;  4CEQ A;  4DQP A;  1JLB A;  3LAL A;  5EU7 A;  3LZI A;  3TAP A;  1C1C A;  2W42 A;  4K8X A;  4J2B A;  4RW7 A;  4Z4G A;  3CFO A;  3K5N A;  1T05 A;  4F2S A;  4E7J A;  4FLV A;  4DTR A;  4DTX A;  4E7I A;  4OKE A;  5CY4 A;  1R0A A;  4WE1 A;  3LPU A;  1KVC A;  3G0Z A;  1LWF A;  1RDD A;  1YTA A;  4CIF A;  3ITH A;  3NHG A;  3HL8 A;  3SUN A;  3RR8 A;  1LV5 A;  1S1T A;  3ZT3 A;  4FLT A;  5J2N A;  2HHV A;  4PY5 A;  2AJQ A;  4HVJ A;  1BQM A;  3KLE A;  1ASW A;  2RF2 A;  4ELU A;  5KI6 A;  4M3Y A;  1ITG A;  4RG8 A;  3PV8 A;  1QSY A;  1IO2 A;  3O4Q A;  3PO5 A;  4FJJ A;  2NUB A;  3LWM A;  1BIZ A;  1XWL A;  4I7F A;  4CJU A;  1IKV A;  1LW2 A;  1WN7 A;  4W5T A;  4W5O A;  4HCC A;  5D3G A;  4FLZ A;  1BL3 A;  4B9N A;  2XY6 A;  4HCB A;  4CJL A;  4KTZ A;  3WNE A;  3ZSY A;  3NH0 A;  5J2M A;  4LY7 A;  3DLG A;  4CJQ A;  1IKY A;  4CHO A;  3VQ6 A;  4E19 A;  3C6U A;  3SQ2 A;  1D9D A;  4DSL A;  4ID5 A;  4CGJ A;  1S9E A;  1TKZ A;  3DLH A;  3C94 A;  1VK0 A;  4PWD A;  3AVA A;  4M3W A;  3SNN A;  3IRX A;  2F8T A;  4LSN A;  1QTM A;  1T03 A;  3QLH A;  1NKB A;  1SL2 A;  3RWU A;  3PUF A;  5HBM A;  4CK3 A;  5HRN A;  3V9S A;  2O4I A;  3DLE A;  3DYA A;  4DU1 A;  4CJK A;  1VSL A;  3QNN A;  4M3T A;  5SZT A;  2WOM A;  4DF8 A;  1RBU A;  1QE1 A;  3PX0 A;  3LP0 A;  1HPZ A;  1LAW A;  1X1P A;  3SUQ A;  1TKT A;  2P1J A;  3B6P A;  3S3N A;  4I2Q A;  1KSP A;  4O44 A;  1U04 A;  1ASV A;  3VA0 A;  4CEO A;  3O3F A;  3IAY A;  4DU3 A;  2FBY A;  3KLI A;  2WON A;  4FW2 A;  3NGY A;  3V1O A;  3RMC A;  4NYN A;  1HYV A;  4CEB A;  1HRH A;  3ZT4 A;  4E1M A;  1RT3 A;  3SZ2 A;  2B5J A;  4F2R A;  4YNQ A;  1NK7 A;  1T8E A;  3TWH A;  1X9W A;  2ETJ A;  4R5P A;  1SUQ A;  1N5Y A;  1C0M A;  5CZ1 A;  3VQD A;  1S1U A;  3L2Q A;  4CEZ A;  4FM1 A;  3L2W A;  1WAF A;  1VRT A;  4KO0 A;  3VQB A;  3L2R A;  1NJW A;  4F8R A;  2FC0 A;  3QEW A;  4HHT A;  3KTQ A;  1UAX A;  2PYJ A;  1NJZ A;  2BAN A;  1BI4 B;  4CHP A;  4RW4 A;  4KHS A;  4CED A;  2Y1J A;  4GMJ B;  4EZ6 A;  3V6D A;  4N47 A;  1YT3 A;  4PUO A;  5DMR A;  1KVB A;  3AVM A;  4C8O A;  1J54 A;  3K5M A;  4KTW A;  1LWC A;  1J53 A;  3KK1 A;  4BE2 A;  1IKW A;  4Z0U A;  4HTU A;  4YFU A;  3OYH A;  3LPT A;  4W5R A;  2YHA A;  1RT1 A;  4KHN A;  4CIE A;  4CHZ A;  3SV3 A;  4B8A B;  1FKO A;  4CF9 A;  3OYM A;  4JRQ A;  1FXX A;  3SUO A;  1RT6 A;  2YNF A;  3WNF A;  2KFN A;  2OA8 A;  3M8P A;  4RW6 A;  4C8M A;  4CES A;  3TR8 A;  1S5J A;  4FLW A;  1S1W A;  2KZM A;  3V4I A;  1KLN A;  3OYJ A;  3SCX A;  4JS5 A;  1SKR A;  1S9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...