4X62K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x62K00
4DR4K 5A2QO 2UUAK 1J5EK 4DR6K 4DUZK 4LF6K 4CW7B 2F4VK 5IT9O 4DV7K 4DV4K 2VQEK 3J81O 1N36K 4JI2K 4JI4K 4DV3K 1IBKK 4JV5K 5AJ3K 2VQFK 2ZM6K 4LFAK 4JI8K 4KHPK 4JI5K 2UXBK 4JI3K 4DV6K 4B3MK 4DV1K 4DR5K 4YY3K 4LF5K 3T1YK 2UU9K 5BR8K 3J7YP 4X65K 1HNXK 1N34K 1IBLK 4X62K 4B3SK 4JYAK 4CVNE 4LFCK 2UUBK 4LF8K 4DR2K 4GKKK 4V19S 1I94K 3J7AP 4LFBK 1HNWK 4YHHK 5FLXO 5LMNK 4NXNK 1N33K 1XMQK 4DUYK 2E5LK 4NXMK 4B3TK 4DV2K 1XNQK 4X64K 2UUCK 4K0KK 5LMUK 4AQYK 1HNZK 1FJGK 4GKJK 1XMOK 2HHHK 4LF9K 4JI6K 3T1HK 4DR7K 4JI7K 4DR1K 4DR3K 4B3RK 4JI1K 4DV5K 4LF7K 1IBMK 4JI0K 4DV0K 4LF4K 3J80O 5IWAK 4X66K 1XNRK 2UXCK 5LL6Z 2UXDK 1N32K 4OX9K 3OTOK 1HR0K 3JAMO
chains in the Genus database with same CATH superfamily
4ZHRA 3A5MC 4XH1A 3VEXA 1RTDA 3VQEA 1DLOA 1JXEA 2KQ2A 4B3OA 4J2BA 3A5NC 1U2VA 4FJLA 1WUAA 4DTNA 2D5RA 5BPNA 1RT3A 2XY7A 4I9QA 3SQ2A 4Z4EA 4LH4A 1VSDA 1Q9XA 5HP1A 2QWNA 4XIUA 1TKXA 1KD1O 3GDQA 4M3WA 1JXBA 4FLXA 2HHSA 4H5WA 1ASWA 4CF0A 3AA5X 2QI2A 4JI5K 3VENA 3DLLL 4CD1A 4AHCA 3QIOA 1VSFA 2IAJA 1M1KO 4IO8A 4JKFA 1WSEA 3CPWM 4BR5A 4CCHA 2G8VA 2E2OA 3TAPA 3VQ5A 3O1BA 4DFJA 2HBMA 3UE5A 3L3VA 4BRLA 1S3XA 1D5AA 1QZ6A 2D0AA 3AGRA 4KO0A 3QESA 4CGJA 3LWMA 1J53A 3F9MA 4YHHK 5AZIA 5KQ8A 5KPRA 4FWSA 1KAZA 3L4QA 1QVFM 4FJ9A 4KTQA 1ZC6A 2QWRA 3NDKA 1NJIO 1YJNN 3HP9A 3CMEN 3KZBA 2YKMA 3H3OB 3C6HA 2D0CA 4DSFA 3V81A 1LWFA 3LM9A 3CCLN 4K0KK 1OH8A 4J2AA 3VEOA 3KLFA 3AVKA 4BRAA 4GKJK 3CI5A 3RSEB 2IVOA 3PO5A 1NGJA 1SV5A 4QCLA 3IRXA 2OTJN 4K43A 2VWJA 4DR7K 1W0HA 1BCOA 2NRXA 1C1BA 4CFDA 3BY5A 3AA4A 1NNEA 1N32K 4G9ZA 4MDBA 3WT0A 2HNZA 3FZHA 2IGIA 3O3FA 3V4IA 1R0AA 4BDYA 5AQJA 1HX1A 3A5LC 5AQOA 3SZ2A 4DR6K 4M41A 4AHRA 3Q7CA 1NJZA 4FYDA 3NAEA 3AA3A 3DI6A 4BR7A 2E1YA 4IDKA 2B5JA 4C1NK 4JNEA 5HL7L 2P9KA 3CC4N 2EX3A 1XC9A 4ID1A 3SUOA 1EKEA 4AF1A 3AO5A 3QEVA 5TKWA 3ZX2A 4CEOA 4E89A 3CJCA 2Y1JA 1RBVA 3UKUA 5M1QA 3VEZA 1IKYA 3ZT3A 4JI4K 3NFAA 4CEZA 1RBTA 3KVGA 3VETA 4LY7A 3IMXA 1GLFO 2P9IA 2DFEA 3QLHA 5D3GA 1X9WA 3F5TA 1X9JA 2HMPA 3H1VX 4HTLA 2P9SB 4DCHA 1YAGA 2GUPA 4QOZB 5M1OA 3V1OA 4G1QA 2Y1IA 4W5QA 2JWLA 3TSPA 1HYVA 1C0TA 4BREA 5GAHP 3G6EN 4KB1A 3NF8A 2FC0A 4HTUA 2HF4A 5GADP 1IBLK 4AHTA 2QKKA 4JKCA 2P51A 1I94K 3SMSA 1VQKN 1JLFA 4CJSA 4IWVA 3AVCA 1T44A 3OYFA 1N33K 4IDHA 4CZGA 1E3MA 2D0PA 4C8OA 3SMPA 1I3AA 2FLOA 3V1QA 1C1AA 2A41A 5BRHA 2QWLA 3DM2A 4E7LA 3THXA 3I55N 1XI1A 4DFMA 4CEBA 2O8CA 5F0XA 3QEIA 1HYZA 3T3FA 3DJCA 1NGDA 3VQ7A 3G0ZA 1KVBA 3TAEA 3ZT1A 4I2PA 3MDQA 5HRRA 3HTVA 5K14A 1BUPA 3WNHA 3E9OA 4DR3K 3MWPA 2E2PA 4BRHA 3TABA 3ZSQA 2ITGA 4NYFA 4PKHA 3NF7A 1XNRK 3CETA 5AQYA 1EETA 3MN7A 1BI4B 3L8BA 4OX9K 2WONA 4U67L 3RRGA 3D45A 3V9XA 3QINA 5HRPA 3SAGA 3H45C 1TYQA 5KI6A 2QM1A 4H0VB 4B1XB 3T7ZA 3PLAA 4Z4IA 3KHYA 2Q2RA 4EIAA 3SPZA 1ESVA 5LJWA 1RT4A 2IIRA 5CR4A 2O8FA 3TWHA 2ATQA 5AQWA 4BROA 3SPYA 2HB5A 4YFUA 4BRNA 1VHXA 3D2FB 3A0IX 3BF3A 2NRZA 3ATVA 3KK2A 3HPOA 2P5OA 3O9RA 4JI8K 4I7FA 4NYNA 3MMVA 4FZYA 4YNQA 2KZMA 4JI3K 1JLEA 5GAEP 3ZCMA 1NU0A 5ADXA 1HQUA 5B8HA 2E20A 3CJ1A 1QVGM 2FBYA 1G99A 4FJ5A 1S1UA 3OYHA 1XQSC 3AVGA 1NM1A 1WBBA 3HK2A 3QBXA 4GKKK 4FW1A 2X6SA 3DLRA 4F9OA 1B9DA 2X74A 4K41A 4HUEA 3MEEA 4DLGA 1OKJA 3EE9A 5SZTA 4ELUA 4NB4A 2V7YA 3TR8A 3WXLA 1QE1A 1WSGA 3OA9A 3RMBA 3DRRA 4DMNA 2ZJRL 1QZ5A 4FXDA 3KLIA 1SKRA 4JEPA 3C6UA 4B1WB 2HNDA 2VG6A 3K59A 3RMDA 3PV8A 5AQGA 3VGMA 1GLCG 3IAYA 3WNFA 2P9NA 4FJXA 4H5VA 4NLCA 1WBDA 3V1RA 3ISNC 3S41A 2XY8A 3O4NA 4PY5A 2B4JA 3D6RA 5SWMA 4CEAA 5H1SQ 4BG9A 1WAFA 4JK7A 3E1YA 4RWTA 1RFQA 4H0OA 4BR4A 4NCAA 3IG1A 3L6QA 3VTHA 4CF9A 5A2QO 3F9KA 3RVCA 3GL1A 4DUZK 4DTJA 1EWRA 1QQMA 3ALYA 2BANA 3HRGA 3MN9A 2P5GA 2OZSA 1NGAA 1VQNN 1VSHA 2UYTA 3CFOA 4B1YB 3ZSYA 1W7AA 1IKXA 4JKHA 4BRIA 5FRNA 4QS7A 1WNSA 3L2QA 3MX2A 3C7NA 2RKIA 3G25A 4CEQA 2O8EA 2KKZA 1A5WA 4GVMA 3UB5A 5HROA 4HCBA 1WB9A 4OLBA 4OPAA 4FOIA 5BN9A 4BQLA 1L3VA 3VF4A 2OANA 1F21A 5BR8K 4JS4A 2A40A 4LC9B 1VRUA 2Q1NA 3K5NA 4EHTA 3DOLA 5HLFA 3ID8A 3VQ4A 4PL7A 1K8AO 2DTUA 4CGGA 5BPLA 3J7AP 4KH5A 5KRTA 4A57A 2HMIA 2PY5A 1NMNA 3QFPA 3CCSN 1P8ZA 2CH6A 3DXKB 1HYSA 1WAJA 4WQ5A 1VQ8N 4EP4A 3SI6A 3SCXA 4FLVA 2HHUA 4FJMA 4CEFA 5E41A 1IV0A 4ILJA 3FZLA 5JVHL 1MWMA 3CQYA 4C8KA 3IS9A 4FSVA 3M3ZA 5EU7A 1GLBG 3ZSVA 3SYZA 4OVLA 1NOZA 4WQ4A 4JI7K 2A6AA 4JI1K 3TTDA 4O44A 2XY5A 4KPYA 4FWMA 2O8DB 4YOWA 4R5PA 4J2EA 4C1NI 1Z6RA 3CJBA 4TSXA 4HCCA 2GWKA 3VF6A 1RDUA 1HNVA 3FE1A 1WLJA 5FDLA 5FRMA 5CYQA 3M1FA 1NK4A 3HI0A 2VWBA 3SBTA 3QIPA 4WCEL 4HVJA 4KFBA 3IUCA 1DTQA 3K0SA 2QWOA 5HRSA 4CZKA 1IKWA 3DXMB 3AGKA 3RSEA 2GBZA 4FJHA 4K42A 4Y1CA 4GVEA 2A1RA 1HLUA 1T8EA 3FZFA 3LDOA 4IOXA 1RTJA 1ASUA 2ZM6K 4LFAK 3DLHA 3UKRB 4IEIA 2ZJPL 1UA0A 1NGIA 1NLVA 3F73A 4DV6K 2W6KA 2HVIA 3VGLA 2ZD1A 2ZWHA 4NCGA 4PKGA 5AFUA 1U47A 3LL3A 1SKWA 4FJGA 3LZJA 4ID5A 1S1WA 3CG7A 4FWRA 4N56A 3QDKA 4B9MA 5AQZA 1JCFA 3VEVA 3LPUA 4DSKA 4LFCK 4KI6A 2IS3A 2QTDA 4L8RB 3M5RA 3U9DA 1O13A 2F96A 1P90A 1HNWK 4GV3A 4FM1A 3DLKA 1CXQA 3AO4A 4JKEA 1RT6A 5KGXA 3HM8A 4CJQA 1JL1A 2IVPA 4NXMK 3T69A 4C8NA 2RE2A 4FWNA 1KC8O 4C8MA 2WC9A 1BIUA 4WFAL 2P9SA 3MECA 4FJIA 4YOTA 3VQDA 3HPHA 4QS8A 1S6QA 5C24A 1I39A 4CJUA 1VK0A 2KZZA 4IO9L 4JN4A 3QNNA 3MK6A 4CJPA 4FJNA 1QHTA 5FPEA 4CJ7A 5HOOA 3MCAB 4JKDA 1HR0K 2KTQA 3NE6A 1VRTA 3O9TA 2P9PB 5AQRA 1VQON 4DS4A 2DFHA 1BWFO 1UWBA 3BEXA 3ZSRA 1NGBA 3CM6A 1SQKA 1GOAA 4DLEA 4CHZA 3VQPA 4BRMA 2VQEK 4EP5A 1CZBA 2RN2A 4CZHA 3KK3A 3V9SA 1TGOA 5KGWA 1IBKK 4FJ8A 2V51B 2YNFA 1CZAN 3NMUA 1DEJA 1YVUA 3DRPA 4IEEA 4E1JA 3P31A 4DV1K 1LOTB 1BI4A 4F8RA 2I7NA 3ZT4A 1SL0A 4XH5A 3NF9A 4EAHD 4OJRA 1S72N 4NCBA 5M1PA 2GUIA 3AVLA 4CK2A 3VQCA 3CJAA 2VG5A 5C0YA 1Q81O 3MXMA 1NJWA 4B3SK 1RT5A 1QHAA 1X3MA 3KWIA 4AM7A 2ZGYA 4DQPA 4IFYA 4YDUA 1IG8A 3WUHA 2G8FA 3CJ7A 1ZBHA 3MXJA 2G8UA 2YHBA 1IG9A 4IG3A 3ZT0A 5GAGP 3D2FA 4IOAL 1MA9B 3O4WA 1NJYA 1SL1A 4DUYK 2ZE2A 1RNHA 2HVHA 3LWLA 4BRKA 4M3ZA 4DQSA 4KHYA 2NNWA 3L2RA 4GNIA 3LDPA 3V9UA 5LMUK 4FZXC 3FFKB 1RDCA 1YVNA 1BISA 5BRDA 2HHTA 1YF5L 4DU1A 4OLAA 3H1QA 4CJVA 2HF3A 4FM0A 3QETA 3CFRA 2A1SA 4ILHA 3LDSA 3BUZB 3VQ8A 4Z4CA 5JLHA 2D0BA 1SAZA 1QTMA 4OPJA 2UXDK 4E0DA 1FKOA 3THYB 5ELZA 1YHQN 3OYLA 2XY6A 2RHKA 3OS0A 1L3TA 5GIPA 4IG0A 4CHPA 3WXKA 4CK1A 1YTAA 1EXQA 2G8KA 1VSEA 3NHGA 2P9LB 5M1NA 1UAXA 1NGGA 1NKEA 3ZX3A 1KAYA 4IJAA 3WEEB 1B92A 3TAQA 2QW9A 4CGIA 4LSLA 5C2DA 1T6DA 2HSTA 2NUBA 3QEXA 2KFZA 4CE9A 3C95A 1C6VA 3LP2A 3G10A 3WXJA 3L3UA 3VEYA 4FO0A 1C0UA 3I56N 4KHPK 1VSIA 3DOKA 4PKIA 2UXBK 2JLEA 2YNHA 4F2RA 3CCMN 1SZ2A 3B6PA 4ISFA 3BP8A 3K2PA 1U45A 4ICLA 3VMFB 4FZZA 3OJSA 3RR7A 1ZBSA 4CJ4A 1KFDA 4KH6A 3L2VA 4IFEA 1Z26A 2VYPA 3TPQA 5C15A 1Y64A 4AHUA 3RR8A 3V9ZA 4YOVA 2CGJA 3ZT2A 4CZJA 3ZETB 3HXMA 2NRWA 4BWJA 1ILYA 2X6NA 1EX4A 1D9DA 3EE8A 3QERA 4HWIA 3P4IA 3ZSWA 3S3MA 5EOYA 2DY4A 3JS6A 2YNIA 4CHNA 4FK4A 1BL3A 3AVIA 1J5OA 4CF1A 3DAWA 3T1HK 4FWKA 3PX4A 1X1PA 3MXIA 1FK9A 2BUPA 1NJXA 1IH7A 3DLBA 1UA1A 5C12A 2VCPA 1X9MA 3VQBA 1JLAA 3OTOK 3NVKA 1C1CA 5DM7L 2UUAK 1BIZA 3SQ4A 4CI6A 2Z1HA 4BR9A 2IC3A 4Z4GA 3DXKA 2YI1A 1KLMA 3OW2M 3AARA 4Y1DA 2GWJA 4H0XB 1YJ9N 4YOUA 1ZXOA 3UIQA 2JWKA 1BHLA 4WYBA 3SJHA 1J54A 4BGAA 4W5OA 4B1ZA 4AILC 3SAHA 1XHZA 3CCVN 5EXWA 2IOCA 2YHAA 3OYMA 4JKAA 4DQRA 4YDUC 1N8RO 2O8DA 1D4XA 1TKTA 4EFHA 4FM2A 4B8CA 4KB0A 4LF5K 1RT1A 3T1YK 5J2MA 3A5OC 1WN7A 4CJFA 1T03A 3HO1A 3M6GA 3J7YP 1KSPA 2QWPA 4MQ3A 3QEWA 5AQXA 1BDGA 3HOTA 4CJKA 1WOQA 5F2RA 4RTFD 3VOVA 1BQMA 1Q18A 4A5AA 3DXMA 5FLXO 2NRRA 2R7YA 1VQ5N 3U6FA 4OGEA 4C8LA 4BE2A 3CYMA 4BWMA 3UKRA 2YX6A 1JLBA 4H4OA 2QK9A 4BACA 3FR0A 4KTZA 1Q86O 2KW4A 3K9KA 4ZTFA 2BDPA 1TAQA 3MEGA 3LAKA 2XRIA 3OJUA 4DQ8A 4JKBA 3OBWA 4BE1A 1L5UA 4LF9K 3QICA 3PUFA 3CC7N 4B3RK 1S1VA 4DV5K 4DSEA 4LF7K 4JI0K 4LF4K 5BN8A 5C42A 4C23A 5LL6Z 4BG8A 4CZIA 3BDPA 4RW4A 3AO3A 4CHYA 2YHXA 3TTCA 3CFPA 3CQ8A 4FLUA 4B9NA 1VQ4N 1BG3A 5AZJB 4OGCA 3R1XA 3ZSXA 3SV3A 4DTXA 4B9TA 1WSFA 4O8KA 2FSKA 1NKCA 3ENHA 4CIFA 2OTLN 1T7PA 5JMVA 1RBUA 3R3LA 1SUQA 4M3XA 4CF8A 3DWLA 2D0OA 4JHDB 4GY2B 4N5SA 1DGKN 1BA1A 2O4IA 4MFBA 5CHIA 3S3OA 2AP1A 3DLEA 3DMJA 1VQ9N 4FPAA 4M3RA 3VQQA 1TVRA 2XHBA 4CIEA 2FSNA 2GELA 4KHUA 3FLCO 2GV9A 4UQGA 1FW6A 2G8IA 5F1XA 5AQVA 4CFAA 1U6ZA 2P9PA 4H4MA 2FBTA 3TANA 4X62K 1NK8A 1IJJA 4NLBA 4QAGA 2W42A 3OVNA 3EY1A 3EN9A 3M8QA 4H5RA 1C0GA 1VQ7N 5EX5A 3VTIA 5AQFA 4KRFA 1GLDG 3I8DA 5AQQA 2FBVA 4DTPA 4B3TK 4FVMA 2O4GA 3DYAA 4E7JA 4X64K 4GV9A 3NF6A 3OHRA 1Q82O 3AVHA 4RW8A 3OYAA 3SUQA 3LP3A 4HHTA 1BU6O 3R6MA 3Q7BA 3J7ZO 2A3ZA 3L4IA 4B9QA 3EEQA 3O9UA 3LDLA 4FLYA 2IVNA 3TAGA 1R59O 3U8XA 3L2UA 4X66K 3ZSOA 4BRFA 1RDWX 5KPTA 3TTFA 1ITGA 3KLEA 1VAZA 3U3GA 4H03B 4FJKA 1RDBA 4CF2A 4J2DA 1JLCA 4FLZA 3LANA 1KAXA 3OYBA 1HPZA 2HBKA 3MWTA 1YT3A 1ZYQA 2O8CB 3M8PA 4A5BA 2CH5A 3DRSA 1HJOA 4CBUA 2NRHA 5IT9O 4DV7K 4DV4K 4YORA 3ID6A 4B9LA 2WOMA 3AVAA 3J81O 5I9EB 1VQLN 3CCQN 3VERA 1HKGA 3D7EO 4K8XA 4M3TA 3OYCA 3OS1A 4OKJA 4FPBA 3AY9A 2YCHA 3AVBA 3QB0A 5AQSA 3G4SN 3OYGA 3THYA 1TL3A 5AQUA 3SV4A 3O8MA 1KTQA 3HSTB 3IFRA 4ISGA 4Q5VA 1LCUA 2FF3B 4CK3A 3KKSA 1SS6A 3P39A 2P9LA 5BRFA 1N34K 1L3UA 2VG7A 3LPTA 2UUBK 1Q7YO 1YXQA 3HZ6A 3C6TA 4FW2A 2BTFA 3WEEA 4CJEA 5J2PA 3TI0A 3T1AA 3SJJA 4PHTX 3TAFA 3LZIA 5LMNK 1Q8IA 3HT3A 1TUYA 1KQSM 1KRPA 3VGKA 1NMDA 2AA4A 2OZMA 3KWGA 2Q31A 4CGFA 2DPNA 3NGIA 4FJJA 3TU5A 4U7BA 2FBXA 4KTWA 1N5YA 4CECA 1VSJA 1VSLA 4DWIA 1TAUA 4A59A 4CFBA 4BC3A 2GX9A 5JVGL 1KLNA 1NK9A 1BO5O 1REVA 4JKGB 5KRSA 3BF1A 3RMAA 4DQQA 2NRTA 1W9HA 4WFBL 3ATUA 2W40A 4NO7A 3ZETA 4JI2K 4A61A 1QQOA 3K5OA 1VQMN 4K8ZA 1U48A 2QWMA 2E8AA 3THWB 4EZ9A 2D4WA 3WQUA 2Q0RA 4E1NA 4XH4A 1ZBLA 3TSUA 3F2KA 1NOYA 1LAVA 2EHGA 2Q3SA 1LWCA 4CBWA 3JXUA 1A5VA 1JL2A 4H8KA 1N36K 4H0PA 4MLHA 3HP6A 5JS2A 4AH9A 1JJ2M 4JV5K 1N6QA 2DFFA 3EZWA 4KREA 4CJWA 4MO4A 2QEXN 4DF4A 3FZKA 3EL2A 3O9SA 3A2FA 4KHQA 4Z0UA 1GLLO 1C0MA 5CE3A 4Z4FA 1KVCA 4BC2A 2HHWA 4IJNA 1BA0A 4JD2B 4B9SA 3LP0A 1BQNA 1HPMA 4H0TB 2G8HA 3LALA 4LF8K 3HJFA 4Z4HA 3ZEUB 4EZ6A 1EWQA 3D2EB 3VF2A 5E26A 3PY8A 5J1EA 2I7PA 1YUWA 2A42A 1U4BA 1XMQK 1TK0A 3AV9A 4LD0A 5AQNA 2OCEA 4M3UA 3SAFA 4WQ5C 4BRGA 3K5LA 1NK7A 1SL2A 3OYJA 5CZ1A 3CMAN 3LAMA 5BPMA 2P1JA 4BE0A 2O8BB 1VSMA 3V6DA 1ZBUA 3CD6N 4BDZA 3NH2A 2FXUA 2V7ZA 3OY9A 3NGYA 5M1FA 3ENOA 5I3UA 4JK8A 4I9LA 3I8BA 5KTQA 4XEIA 1TK5A 3VEWA 2E4LA 5GIOA 3GG4A 2ZQBA 4WQ4C 2OPQA 3PIOL 3WNEA 4IKFA 3K5MA 4M42A 4BR2A 1RBRA 2W41A 3QFUA 4DR4K 3CCRN 4RW6A 4BR0A 3TARA 1M90O 5CZ2A 4DTMA 3E66A 1L3SA 1W2BM 4B08A 4LF6K 2HW3A 5LJVA 1IKVA 4BDPA 3H46O 1XWLA 2ZGZA 3WQTA 4WF9L 3ULEB 4CZFA 3PO4A 3AAQA 4CW7B 3NVMA 3V9WA 3EO3A 2F8TA 2KFNA 3CCUN 1T3VA 3GBTA 2WFBA 4RW7A 3MCPA 1JLQA 1T6CA 2WBNA 4BQZA 4E7IA 3S9HA 2G8WA 3E9LA 1T05A 1IO2A 1S22A 5C2FA 4KHNA 1FKPA 4DS5A 3O6WA 3KD5E 3HVTA 3P5JA 2ASPA 4HUFA 2H3GX 1B9FA 3KIOA 3KJVA 4F2SA 4BRPA 3MX5A 2UU9K 4FJ7A 1RTIA 1HQEA 2AJQA 1Y97A 3KTQA 1J9AA 1XC3A 4JLHA 4JS5A 3C6AA 5AZJA 2YKNA 2OPRA 4PUOA 3JYTA 5C10A 4A62A 4M3YA 1YI2N 3H6EA 3SBGA 1RT2A 3E9PA 4CZMA 1TUUA 4Q0BA 5AQLA 4E7KA 4F3TA 1KCFA 2HBLA 4ELVA 4BVPA 4N41A 3KK7A 4JHDA 5M1KA 2Q36A 4OKKA 5HRNA 4FLWA 1XNQK 4E7HA 1Q9YA 1BOTO 5E84A 3BZKA 4CJ5A 2YHYA 4BGBA 4DFPA 1ZBFA 3MN5A 1HNZK 3ZLJA 3QEPA 3G71N 3AO2A 4FWOA 1RILA 5TKYA 2HHQA 5DMRA 3L0QA 4CBXA 2NRVA 1GLAG 3R8EA 4DSLA 1RDAA 1EQYA 3AVNA 3FFIA 2VGNA 3CQXA 3LDNA 3BGRA 3HM9A 3O9QA 4CHOA 1VSKA 3ZYYX 4CEDA 3CM5A 3P38A 4DSIA 5ADXH 1J5EK 3SK3A 3K9JA 3HSCA 4FK2A 4PL8A 1DTTA 4CD3A 2VWKA 2P9UB 2F7TA 3OYIA 4FLTA 3L2WA 2A5XA 1OVYA 3OBYA 1JKHA 1K8KB 1FXXA 3I0SA 1YITN 5T7BA 5C25A 1RT7A 5I42A 4B1UB 4DQIA 3ENBA 3PX0A 4O4GA 3C94A 1WSJA 1H1VA 4IZ9A 1QS4A 2Z1GA 3A8YA 4MLEA 1HNIA 2NZTA 4B3MK 3ITHA 4N76A 3LP1A 4DHYA 1NK0A 3E01A 3H3NO 2GEMA 3HVRA 1X3NA 4KV8A 3NH0A 4PWDA 4I6MB 4FL9A 1HNXK 4CERA 3OYEA 3EYZA 4O0JA 4JYAK 4CVNE 2ASMA 2OPSA 4KAZA 3SLCA 4CJ3A 3AAPA 3MN6A 1OH5A 1TK8A 4RG8A 1YJWN 1RGIA 2YV0X 4GW6A 3B8AX 4DU4A 3GE1A 1ZBIA 1WSIA 5FPMA 4DKWA 2E1ZA 1K6YA 2YHWA 1U2VB 1NWKA 2BH1A 4FCYA 1E4FT 4CIGA 1NG9A 3RWUA 4IBNA 4JRPA 1FJGK 4M7YA 3KD1E 1E4GT 3I33A 1ASVA 2JGUA 2PYJA 1NKBA 1QQNA 4DTOA 5AQHA 1CXUA 5EY4A 1RCHA 3U4LA 4K25A 2W6LA 3SQ1A 2HNYA 1VQPN 1SKSA 4OKEA 5IWAK 3O80A 1NGCA 2Q0UA 4EHUA 3I0RA 2QXLA 2B6AA 3AO1A 4BC5A 1C0FA 3PIPL 3CERA 2KLAA 4GV6A 2Z1IA 2PBDA 3CIPA 4YOXA 4OPKA 4DTSA 4AHVA 1S9GA 2NLXA 3WNGA 4O0IA 1JLGA 4FOEA 4ELTA 2ETJA 1QSSA 3PSIA 5AZIB 2Q97A 4CZLA 2ITMA 3AA2A 3CCEN 4M45A 3VN5A 2CGLA 5AQTA 3W0LA 3OYKA 3NH1A 3TAMA 1Z05A 4GMJB 3HL8A 5DK5A 4BRCA 1CZ9A 4IXCA 4FWQA 4M63C 5CYMA 4CJRA 2PZSA 2QKBA 4JKGA 2YJFA 3VESA 2I5JA 3VA0A 3S3NA 1ATRA 1OH6A 3KLHA 4O5FA 2WUSA 3EKSA 1VQ6N 4H5TA 2EWSA 4YY3K 4KI4A 1X9SA 3VPZA 5AQIA 3THWA 4CGDA 1OH7A 4Z94A 3PX6A 3M8SA 3CF5L 2OA8A 3W3DA 1NBWA 1NK6A 1GLJO 4B9UA 4A2BA 5FROA 1QSYA 5JLFA 3OS2A 1NGFA 4DG1A 3ULDA 2F9WA 4N47A 3ASMA 3MAQA 1BCMA 5CY4A 3U3YA 3H08A 4PA1A 2E88A 5AQPA 1D8YA 4E19A 4W5RA 2HOEA 1RBSA 4FWLA 4DV2K 2QXFA 4DF8A 2P9KB 2ZJQL 1TKDA 3CCJN 4MO5A 4F4KA 1OVQA 1KVAA 3O08A 3OYDA 1RDDA 5FPDA 3BZCA 3UKUB 4DFKA 4J8FA 2RPIA 4JD2A 4ZTJA 3B6OA 1HUXA 2CGKA 1W97L 2P9IB 4ISEA 3HBTA 1IBMK 3O3HA 4DV0K 3J8AA 3J80O 3P83D 3O3GA 4AHSA 4E3SA 2V52B 3VQ9A 3SQ0A 2UXCK 5HBMA 3ZEUA 4WFNL 5AFUH 3D2EA 1XHXA 3JAMO 3AVFA 1BGXT 1EP4A 3OYNA 2ZF5O 4JRQA 3LM2A 3CC2N 1O1WA 4KBOA 3HPGA 4MDAA 4H0YB 3D0PA 1S6PA 1S9EA 4W5TA 4CESA 1HJRA 3CXCM 4Y0WA 5KQDA 5BREA 2RF2A 3RRHA 2O8BA 1DT9A 2PAVA 1HKBA 2XO7A 1K73O 2LSNA 2OPPA 4W5NA 3U9ZA 2ASOA 4CJLA 5MLCQ 5J2QA 4DV3K 2VQFK 4KHWA 3THXB 4DSJA 3N4QA 3T19A 4UY8O 3CHWA 3HOSA 1K9MO 3DLGA 2HHVA 3N4PA 3CJ9A 2QWQA 5AR0A 4B1VA 1Z25A 3AVMA 5GINA 4H5NA 3QMLA 3FZMA 4M7XA 4X65K 4JAXA 3PSFA 3SUPA 4F3OA 4FWPA 4BY9C 1RTHA 4FVUA 5JS1A 4DR2K 2E6MA 4CEEA 1KFSA 3O1WA 3ULEA 3MEDA 4CJTA 1G15A 4R79A 4IOCL 2F8SA 4O5BA 2HHXA 2FSJA 4YOYA 1S1TA 1CLQA 4NXNK 3IDHA 5BR9A 1TL1A 1TYQB 3RTVA 1S1XA 2HBJA 4KKOA 4RCHA 2BGGA 5EVZA 1TKZA 2PFUA 4BVOA 1LW2A 4HUGA 3KK1A 2O8FB 3THVA 4AQYK 1V4SA 4DU3A 2F9TA 1XMOK 1YTUA 4BC4A 1ATSA 2HHHK 3FGUA 3VA3A 5AQMA 4OO1J 1HRHA 3KKRA 4JI6K 3ZSZA 1XUPO 3ZX0A 5J2NA 3RMCA 4OPHA 3K58A 1QQCA 2J4RA 5AQKA 2YNGA 1S5JA 1GLEG 2FF6A 3GOIA 3LDQA 3VQAA 1GOCA 1V4TA 4O8UA 1QSLA 2Z1JA 4I2QA 4B8AB 1NGEA 3WXIA 1TV6A 4L3QA 3M8RA 2E2NA 1WSHA 1GOBA 1LW0A 2F4VK 1YIJN 4CGHA 4CZEA 3NBPA 2QA4N 4ILGB 4E1MA 4CHQA 3EZ5A 5KPZA 3QO9A 1MWKA 5AJ3K 2BE2A 4BRQA 2WTUA 1MU2A 4FK0A 3EKUA 4B9VA 4BRDA 3IKMA 3HYFA 3R9PA 4RW9A 4DTRA 1U49A 1NK5A 5DM6L 4DR5K 2P9NB 2X78A 4AM6A 4LH5A 3P1GA 1HMVA 2E2QA 3QBWA 1JCEA 2E6LA 2P9UA 5LY3A 4CFCA 3NCIA 4V19S 4LFBK 4A2AA 1K8KA 1KXPA 3SUNA 2YJEA 4KHSA 1U04A 2E5LK 3C65A 2KHOA 1UOCA 1LV5A 3AVJA 4KH4A 3TSQA 3KLGA 2PYLA 1JCGA 4O55A 3O5BA 3JSMA 2VGMA 4LSNA 4WE1A 2UUCK 1ATNA 3K57A 4JK9A 1D9FA 3O4QA 5JICA 5FPNA 4PQUA 1HKCA 1J6ZA 3QNOA 3WXMB 2IDOA 3SNNA 1DKGD 3C7NB 4I6MA 2OYQA 1NGHA 2D1KA 1MDUB 4DR1K 1EO1A 4DB3A 4DTUA 1LWEA 4IFVA 2GTDA 2O8EB 1LAWA 4QS9A 3NGZA 3VQ6A 1A5XA 3C0BA 3CPEA
chains in the Genus database with same CATH topology
4DR4K 5A2QO 2UUAK 1J5EK 4DR6K 4DUZK 4LF6K 4CW7B 2F4VK 5IT9O 4DV7K 4DV4K 2VQEK 3J81O 1N36K 4JI2K 4JI4K 4DV3K 1IBKK 4JV5K 5AJ3K 2VQFK 2ZM6K 4LFAK 4JI8K 4KHPK 4JI5K 2UXBK 4JI3K 4DV6K 4B3MK 4DV1K 4DR5K 4YY3K 4LF5K 3T1YK 2UU9K 5BR8K 3J7YP 4X65K 1HNXK 1N34K 1IBLK 4X62K 4B3SK 4JYAK 4CVNE 4LFCK 2UUBK 4LF8K 4DR2K 4GKKK 4V19S 1I94K 3J7AP 4LFBK 1HNWK 4YHHK 5FLXO 5LMNK 4NXNK 1N33K 1XMQK 4DUYK 2E5LK 4NXMK 4B3TK 4DV2K 1XNQK 4X64K 2UUCK 4K0KK 5LMUK 4AQYK 1HNZK 1FJGK 4GKJK 1XMOK 2HHHK 4LF9K 4JI6K 3T1HK 4DR7K 4JI7K 4DR1K 4DR3K 4B3RK 4JI1K 4DV5K 4LF7K 1IBMK 4JI0K 4DV0K 4LF4K 3J80O 5IWAK 4X66K 1XNRK 2UXCK 5LL6Z 2UXDK 1N32K 4OX9K 3OTOK 1HR0K 3JAMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 K;  5A2Q O;  2UUA K;  1J5E K;  4DR6 K;  4DUZ K;  4LF6 K;  4CW7 B;  2F4V K;  5IT9 O;  4DV7 K;  4DV4 K;  2VQE K;  3J81 O;  1N36 K;  4JI2 K;  4JI4 K;  4DV3 K;  1IBK K;  4JV5 K;  5AJ3 K;  2VQF K;  2ZM6 K;  4LFA K;  4JI8 K;  4KHP K;  4JI5 K;  2UXB K;  4JI3 K;  4DV6 K;  4B3M K;  4DV1 K;  4DR5 K;  4YY3 K;  4LF5 K;  3T1Y K;  2UU9 K;  5BR8 K;  3J7Y P;  4X65 K;  1HNX K;  1N34 K;  1IBL K;  4X62 K;  4B3S K;  4JYA K;  4CVN E;  4LFC K;  2UUB K;  4LF8 K;  4DR2 K;  4GKK K;  4V19 S;  1I94 K;  3J7A P;  4LFB K;  1HNW K;  4YHH K;  5FLX O;  5LMN K;  4NXN K;  1N33 K;  1XMQ K;  4DUY K;  2E5L K;  4NXM K;  4B3T K;  4DV2 K;  1XNQ K;  4X64 K;  2UUC K;  4K0K K;  5LMU K;  4AQY K;  1HNZ K;  1FJG K;  4GKJ K;  1XMO K;  2HHH K;  4LF9 K;  4JI6 K;  3T1H K;  4DR7 K;  4JI7 K;  4DR1 K;  4DR3 K;  4B3R K;  4JI1 K;  4DV5 K;  4LF7 K;  1IBM K;  4JI0 K;  4DV0 K;  4LF4 K;  3J80 O;  5IWA K;  4X66 K;  1XNR K;  2UXC K;  5LL6 Z;  2UXD K;  1N32 K;  4OX9 K;  3OTO K;  1HR0 K;  3JAM O; 
#chains in the Genus database with same CATH topology
 4ZHR A;  3A5M C;  4XH1 A;  3VEX A;  1RTD A;  3VQE A;  1DLO A;  1JXE A;  2KQ2 A;  4B3O A;  4J2B A;  3A5N C;  1U2V A;  4FJL A;  1WUA A;  4DTN A;  2D5R A;  5BPN A;  1RT3 A;  2XY7 A;  4I9Q A;  3SQ2 A;  4Z4E A;  4LH4 A;  1VSD A;  1Q9X A;  5HP1 A;  2QWN A;  4XIU A;  1TKX A;  1KD1 O;  3GDQ A;  4M3W A;  1JXB A;  4FLX A;  2HHS A;  4H5W A;  1ASW A;  4CF0 A;  3AA5 X;  2QI2 A;  4JI5 K;  3VEN A;  3DLL L;  4CD1 A;  4AHC A;  3QIO A;  1VSF A;  2IAJ A;  1M1K O;  4IO8 A;  4JKF A;  1WSE A;  3CPW M;  4BR5 A;  4CCH A;  2G8V A;  2E2O A;  3TAP A;  3VQ5 A;  3O1B A;  4DFJ A;  2HBM A;  3UE5 A;  3L3V A;  4BRL A;  1S3X A;  1D5A A;  1QZ6 A;  2D0A A;  3AGR A;  4KO0 A;  3QES A;  4CGJ A;  3LWM A;  1J53 A;  3F9M A;  4YHH K;  5AZI A;  5KQ8 A;  5KPR A;  4FWS A;  1KAZ A;  3L4Q A;  1QVF M;  4FJ9 A;  4KTQ A;  1ZC6 A;  2QWR A;  3NDK A;  1NJI O;  1YJN N;  3HP9 A;  3CME N;  3KZB A;  2YKM A;  3H3O B;  3C6H A;  2D0C A;  4DSF A;  3V81 A;  1LWF A;  3LM9 A;  3CCL N;  4K0K K;  1OH8 A;  4J2A A;  3VEO A;  3KLF A;  3AVK A;  4BRA A;  4GKJ K;  3CI5 A;  3RSE B;  2IVO A;  3PO5 A;  1NGJ A;  1SV5 A;  4QCL A;  3IRX A;  2OTJ N;  4K43 A;  2VWJ A;  4DR7 K;  1W0H A;  1BCO A;  2NRX A;  1C1B A;  4CFD A;  3BY5 A;  3AA4 A;  1NNE A;  1N32 K;  4G9Z A;  4MDB A;  3WT0 A;  2HNZ A;  3FZH A;  2IGI A;  3O3F A;  3V4I A;  1R0A A;  4BDY A;  5AQJ A;  1HX1 A;  3A5L C;  5AQO A;  3SZ2 A;  4DR6 K;  4M41 A;  4AHR A;  3Q7C A;  1NJZ A;  4FYD A;  3NAE A;  3AA3 A;  3DI6 A;  4BR7 A;  2E1Y A;  4IDK A;  2B5J A;  4C1N K;  4JNE A;  5HL7 L;  2P9K A;  3CC4 N;  2EX3 A;  1XC9 A;  4ID1 A;  3SUO A;  1EKE A;  4AF1 A;  3AO5 A;  3QEV A;  5TKW A;  3ZX2 A;  4CEO A;  4E89 A;  3CJC A;  2Y1J A;  1RBV A;  3UKU A;  5M1Q A;  3VEZ A;  1IKY A;  3ZT3 A;  4JI4 K;  3NFA A;  4CEZ A;  1RBT A;  3KVG A;  3VET A;  4LY7 A;  3IMX A;  1GLF O;  2P9I A;  2DFE A;  3QLH A;  5D3G A;  1X9W A;  3F5T A;  1X9J A;  2HMP A;  3H1V X;  4HTL A;  2P9S B;  4DCH A;  1YAG A;  2GUP A;  4QOZ B;  5M1O A;  3V1O A;  4G1Q A;  2Y1I A;  4W5Q A;  2JWL A;  3TSP A;  1HYV A;  1C0T A;  4BRE A;  5GAH P;  3G6E N;  4KB1 A;  3NF8 A;  2FC0 A;  4HTU A;  2HF4 A;  5GAD P;  1IBL K;  4AHT A;  2QKK A;  4JKC A;  2P51 A;  1I94 K;  3SMS A;  1VQK N;  1JLF A;  4CJS A;  4IWV A;  3AVC A;  1T44 A;  3OYF A;  1N33 K;  4IDH A;  4CZG A;  1E3M A;  2D0P A;  4C8O A;  3SMP A;  1I3A A;  2FLO A;  3V1Q A;  1C1A A;  2A41 A;  5BRH A;  2QWL A;  3DM2 A;  4E7L A;  3THX A;  3I55 N;  1XI1 A;  4DFM A;  4CEB A;  2O8C A;  5F0X A;  3QEI A;  1HYZ A;  3T3F A;  3DJC A;  1NGD A;  3VQ7 A;  3G0Z A;  1KVB A;  3TAE A;  3ZT1 A;  4I2P A;  3MDQ A;  5HRR A;  3HTV A;  5K14 A;  1BUP A;  3WNH A;  3E9O A;  4DR3 K;  3MWP A;  2E2P A;  4BRH A;  3TAB A;  3ZSQ A;  2ITG A;  4NYF A;  4PKH A;  3NF7 A;  1XNR K;  3CET A;  5AQY A;  1EET A;  3MN7 A;  1BI4 B;  3L8B A;  4OX9 K;  2WON A;  4U67 L;  3RRG A;  3D45 A;  3V9X A;  3QIN A;  5HRP A;  3SAG A;  3H45 C;  1TYQ A;  5KI6 A;  2QM1 A;  4H0V B;  4B1X B;  3T7Z A;  3PLA A;  4Z4I A;  3KHY A;  2Q2R A;  4EIA A;  3SPZ A;  1ESV A;  5LJW A;  1RT4 A;  2IIR A;  5CR4 A;  2O8F A;  3TWH A;  2ATQ A;  5AQW A;  4BRO A;  3SPY A;  2HB5 A;  4YFU A;  4BRN A;  1VHX A;  3D2F B;  3A0I X;  3BF3 A;  2NRZ A;  3ATV A;  3KK2 A;  3HPO A;  2P5O A;  3O9R A;  4JI8 K;  4I7F A;  4NYN A;  3MMV A;  4FZY A;  4YNQ A;  2KZM A;  4JI3 K;  1JLE A;  5GAE P;  3ZCM A;  1NU0 A;  5ADX A;  1HQU A;  5B8H A;  2E20 A;  3CJ1 A;  1QVG M;  2FBY A;  1G99 A;  4FJ5 A;  1S1U A;  3OYH A;  1XQS C;  3AVG A;  1NM1 A;  1WBB A;  3HK2 A;  3QBX A;  4GKK K;  4FW1 A;  2X6S A;  3DLR A;  4F9O A;  1B9D A;  2X74 A;  4K41 A;  4HUE A;  3MEE A;  4DLG A;  1OKJ A;  3EE9 A;  5SZT A;  4ELU A;  4NB4 A;  2V7Y A;  3TR8 A;  3WXL A;  1QE1 A;  1WSG A;  3OA9 A;  3RMB A;  3DRR A;  4DMN A;  2ZJR L;  1QZ5 A;  4FXD A;  3KLI A;  1SKR A;  4JEP A;  3C6U A;  4B1W B;  2HND A;  2VG6 A;  3K59 A;  3RMD A;  3PV8 A;  5AQG A;  3VGM A;  1GLC G;  3IAY A;  3WNF A;  2P9N A;  4FJX A;  4H5V A;  4NLC A;  1WBD A;  3V1R A;  3ISN C;  3S41 A;  2XY8 A;  3O4N A;  4PY5 A;  2B4J A;  3D6R A;  5SWM A;  4CEA A;  5H1S Q;  4BG9 A;  1WAF A;  4JK7 A;  3E1Y A;  4RWT A;  1RFQ A;  4H0O A;  4BR4 A;  4NCA A;  3IG1 A;  3L6Q A;  3VTH A;  4CF9 A;  5A2Q O;  3F9K A;  3RVC A;  3GL1 A;  4DUZ K;  4DTJ A;  1EWR A;  1QQM A;  3ALY A;  2BAN A;  3HRG A;  3MN9 A;  2P5G A;  2OZS A;  1NGA A;  1VQN N;  1VSH A;  2UYT A;  3CFO A;  4B1Y B;  3ZSY A;  1W7A A;  1IKX A;  4JKH A;  4BRI A;  5FRN A;  4QS7 A;  1WNS A;  3L2Q A;  3MX2 A;  3C7N A;  2RKI A;  3G25 A;  4CEQ A;  2O8E A;  2KKZ A;  1A5W A;  4GVM A;  3UB5 A;  5HRO A;  4HCB A;  1WB9 A;  4OLB A;  4OPA A;  4FOI A;  5BN9 A;  4BQL A;  1L3V A;  3VF4 A;  2OAN A;  1F21 A;  5BR8 K;  4JS4 A;  2A40 A;  4LC9 B;  1VRU A;  2Q1N A;  3K5N A;  4EHT A;  3DOL A;  5HLF A;  3ID8 A;  3VQ4 A;  4PL7 A;  1K8A O;  2DTU A;  4CGG A;  5BPL A;  3J7A P;  4KH5 A;  5KRT A;  4A57 A;  2HMI A;  2PY5 A;  1NMN A;  3QFP A;  3CCS N;  1P8Z A;  2CH6 A;  3DXK B;  1HYS A;  1WAJ A;  4WQ5 A;  1VQ8 N;  4EP4 A;  3SI6 A;  3SCX A;  4FLV A;  2HHU A;  4FJM A;  4CEF A;  5E41 A;  1IV0 A;  4ILJ A;  3FZL A;  5JVH L;  1MWM A;  3CQY A;  4C8K A;  3IS9 A;  4FSV A;  3M3Z A;  5EU7 A;  1GLB G;  3ZSV A;  3SYZ A;  4OVL A;  1NOZ A;  4WQ4 A;  4JI7 K;  2A6A A;  4JI1 K;  3TTD A;  4O44 A;  2XY5 A;  4KPY A;  4FWM A;  2O8D B;  4YOW A;  4R5P A;  4J2E A;  4C1N I;  1Z6R A;  3CJB A;  4TSX A;  4HCC A;  2GWK A;  3VF6 A;  1RDU A;  1HNV A;  3FE1 A;  1WLJ A;  5FDL A;  5FRM A;  5CYQ A;  3M1F A;  1NK4 A;  3HI0 A;  2VWB A;  3SBT A;  3QIP A;  4WCE L;  4HVJ A;  4KFB A;  3IUC A;  1DTQ A;  3K0S A;  2QWO A;  5HRS A;  4CZK A;  1IKW A;  3DXM B;  3AGK A;  3RSE A;  2GBZ A;  4FJH A;  4K42 A;  4Y1C A;  4GVE A;  2A1R A;  1HLU A;  1T8E A;  3FZF A;  3LDO A;  4IOX A;  1RTJ A;  1ASU A;  2ZM6 K;  4LFA K;  3DLH A;  3UKR B;  4IEI A;  2ZJP L;  1UA0 A;  1NGI A;  1NLV A;  3F73 A;  4DV6 K;  2W6K A;  2HVI A;  3VGL A;  2ZD1 A;  2ZWH A;  4NCG A;  4PKG A;  5AFU A;  1U47 A;  3LL3 A;  1SKW A;  4FJG A;  3LZJ A;  4ID5 A;  1S1W A;  3CG7 A;  4FWR A;  4N56 A;  3QDK A;  4B9M A;  5AQZ A;  1JCF A;  3VEV A;  3LPU A;  4DSK A;  4LFC K;  4KI6 A;  2IS3 A;  2QTD A;  4L8R B;  3M5R A;  3U9D A;  1O13 A;  2F96 A;  1P90 A;  1HNW K;  4GV3 A;  4FM1 A;  3DLK A;  1CXQ A;  3AO4 A;  4JKE A;  1RT6 A;  5KGX A;  3HM8 A;  4CJQ A;  1JL1 A;  2IVP A;  4NXM K;  3T69 A;  4C8N A;  2RE2 A;  4FWN A;  1KC8 O;  4C8M A;  2WC9 A;  1BIU A;  4WFA L;  2P9S A;  3MEC A;  4FJI A;  4YOT A;  3VQD A;  3HPH A;  4QS8 A;  1S6Q A;  5C24 A;  1I39 A;  4CJU A;  1VK0 A;  2KZZ A;  4IO9 L;  4JN4 A;  3QNN A;  3MK6 A;  4CJP A;  4FJN A;  1QHT A;  5FPE A;  4CJ7 A;  5HOO A;  3MCA B;  4JKD A;  1HR0 K;  2KTQ A;  3NE6 A;  1VRT A;  3O9T A;  2P9P B;  5AQR A;  1VQO N;  4DS4 A;  2DFH A;  1BWF O;  1UWB A;  3BEX A;  3ZSR A;  1NGB A;  3CM6 A;  1SQK A;  1GOA A;  4DLE A;  4CHZ A;  3VQP A;  4BRM A;  2VQE K;  4EP5 A;  1CZB A;  2RN2 A;  4CZH A;  3KK3 A;  3V9S A;  1TGO A;  5KGW A;  1IBK K;  4FJ8 A;  2V51 B;  2YNF A;  1CZA N;  3NMU A;  1DEJ A;  1YVU A;  3DRP A;  4IEE A;  4E1J A;  3P31 A;  4DV1 K;  1LOT B;  1BI4 A;  4F8R A;  2I7N A;  3ZT4 A;  1SL0 A;  4XH5 A;  3NF9 A;  4EAH D;  4OJR A;  1S72 N;  4NCB A;  5M1P A;  2GUI A;  3AVL A;  4CK2 A;  3VQC A;  3CJA A;  2VG5 A;  5C0Y A;  1Q81 O;  3MXM A;  1NJW A;  4B3S K;  1RT5 A;  1QHA A;  1X3M A;  3KWI A;  4AM7 A;  2ZGY A;  4DQP A;  4IFY A;  4YDU A;  1IG8 A;  3WUH A;  2G8F A;  3CJ7 A;  1ZBH A;  3MXJ A;  2G8U A;  2YHB A;  1IG9 A;  4IG3 A;  3ZT0 A;  5GAG P;  3D2F A;  4IOA L;  1MA9 B;  3O4W A;  1NJY A;  1SL1 A;  4DUY K;  2ZE2 A;  1RNH A;  2HVH A;  3LWL A;  4BRK A;  4M3Z A;  4DQS A;  4KHY A;  2NNW A;  3L2R A;  4GNI A;  3LDP A;  3V9U A;  5LMU K;  4FZX C;  3FFK B;  1RDC A;  1YVN A;  1BIS A;  5BRD A;  2HHT A;  1YF5 L;  4DU1 A;  4OLA A;  3H1Q A;  4CJV A;  2HF3 A;  4FM0 A;  3QET A;  3CFR A;  2A1S A;  4ILH A;  3LDS A;  3BUZ B;  3VQ8 A;  4Z4C A;  5JLH A;  2D0B A;  1SAZ A;  1QTM A;  4OPJ A;  2UXD K;  4E0D A;  1FKO A;  3THY B;  5ELZ A;  1YHQ N;  3OYL A;  2XY6 A;  2RHK A;  3OS0 A;  1L3T A;  5GIP A;  4IG0 A;  4CHP A;  3WXK A;  4CK1 A;  1YTA A;  1EXQ A;  2G8K A;  1VSE A;  3NHG A;  2P9L B;  5M1N A;  1UAX A;  1NGG A;  1NKE A;  3ZX3 A;  1KAY A;  4IJA A;  3WEE B;  1B92 A;  3TAQ A;  2QW9 A;  4CGI A;  4LSL A;  5C2D A;  1T6D A;  2HST A;  2NUB A;  3QEX A;  2KFZ A;  4CE9 A;  3C95 A;  1C6V A;  3LP2 A;  3G10 A;  3WXJ A;  3L3U A;  3VEY A;  4FO0 A;  1C0U A;  3I56 N;  4KHP K;  1VSI A;  3DOK A;  4PKI A;  2UXB K;  2JLE A;  2YNH A;  4F2R A;  3CCM N;  1SZ2 A;  3B6P A;  4ISF A;  3BP8 A;  3K2P A;  1U45 A;  4ICL A;  3VMF B;  4FZZ A;  3OJS A;  3RR7 A;  1ZBS A;  4CJ4 A;  1KFD A;  4KH6 A;  3L2V A;  4IFE A;  1Z26 A;  2VYP A;  3TPQ A;  5C15 A;  1Y64 A;  4AHU A;  3RR8 A;  3V9Z A;  4YOV A;  2CGJ A;  3ZT2 A;  4CZJ A;  3ZET B;  3HXM A;  2NRW A;  4BWJ A;  1ILY A;  2X6N A;  1EX4 A;  1D9D A;  3EE8 A;  3QER A;  4HWI A;  3P4I A;  3ZSW A;  3S3M A;  5EOY A;  2DY4 A;  3JS6 A;  2YNI A;  4CHN A;  4FK4 A;  1BL3 A;  3AVI A;  1J5O A;  4CF1 A;  3DAW A;  3T1H K;  4FWK A;  3PX4 A;  1X1P A;  3MXI A;  1FK9 A;  2BUP A;  1NJX A;  1IH7 A;  3DLB A;  1UA1 A;  5C12 A;  2VCP A;  1X9M A;  3VQB A;  1JLA A;  3OTO K;  3NVK A;  1C1C A;  5DM7 L;  2UUA K;  1BIZ A;  3SQ4 A;  4CI6 A;  2Z1H A;  4BR9 A;  2IC3 A;  4Z4G A;  3DXK A;  2YI1 A;  1KLM A;  3OW2 M;  3AAR A;  4Y1D A;  2GWJ A;  4H0X B;  1YJ9 N;  4YOU A;  1ZXO A;  3UIQ A;  2JWK A;  1BHL A;  4WYB A;  3SJH A;  1J54 A;  4BGA A;  4W5O A;  4B1Z A;  4AIL C;  3SAH A;  1XHZ A;  3CCV N;  5EXW A;  2IOC A;  2YHA A;  3OYM A;  4JKA A;  4DQR A;  4YDU C;  1N8R O;  2O8D A;  1D4X A;  1TKT A;  4EFH A;  4FM2 A;  4B8C A;  4KB0 A;  4LF5 K;  1RT1 A;  3T1Y K;  5J2M A;  3A5O C;  1WN7 A;  4CJF A;  1T03 A;  3HO1 A;  3M6G A;  3J7Y P;  1KSP A;  2QWP A;  4MQ3 A;  3QEW A;  5AQX A;  1BDG A;  3HOT A;  4CJK A;  1WOQ A;  5F2R A;  4RTF D;  3VOV A;  1BQM A;  1Q18 A;  4A5A A;  3DXM A;  5FLX O;  2NRR A;  2R7Y A;  1VQ5 N;  3U6F A;  4OGE A;  4C8L A;  4BE2 A;  3CYM A;  4BWM A;  3UKR A;  2YX6 A;  1JLB A;  4H4O A;  2QK9 A;  4BAC A;  3FR0 A;  4KTZ A;  1Q86 O;  2KW4 A;  3K9K A;  4ZTF A;  2BDP A;  1TAQ A;  3MEG A;  3LAK A;  2XRI A;  3OJU A;  4DQ8 A;  4JKB A;  3OBW A;  4BE1 A;  1L5U A;  4LF9 K;  3QIC A;  3PUF A;  3CC7 N;  4B3R K;  1S1V A;  4DV5 K;  4DSE A;  4LF7 K;  4JI0 K;  4LF4 K;  5BN8 A;  5C42 A;  4C23 A;  5LL6 Z;  4BG8 A;  4CZI A;  3BDP A;  4RW4 A;  3AO3 A;  4CHY A;  2YHX A;  3TTC A;  3CFP A;  3CQ8 A;  4FLU A;  4B9N A;  1VQ4 N;  1BG3 A;  5AZJ B;  4OGC A;  3R1X A;  3ZSX A;  3SV3 A;  4DTX A;  4B9T A;  1WSF A;  4O8K A;  2FSK A;  1NKC A;  3ENH A;  4CIF A;  2OTL N;  1T7P A;  5JMV A;  1RBU A;  3R3L A;  1SUQ A;  4M3X A;  4CF8 A;  3DWL A;  2D0O A;  4JHD B;  4GY2 B;  4N5S A;  1DGK N;  1BA1 A;  2O4I A;  4MFB A;  5CHI A;  3S3O A;  2AP1 A;  3DLE A;  3DMJ A;  1VQ9 N;  4FPA A;  4M3R A;  3VQQ A;  1TVR A;  2XHB A;  4CIE A;  2FSN A;  2GEL A;  4KHU A;  3FLC O;  2GV9 A;  4UQG A;  1FW6 A;  2G8I A;  5F1X A;  5AQV A;  4CFA A;  1U6Z A;  2P9P A;  4H4M A;  2FBT A;  3TAN A;  4X62 K;  1NK8 A;  1IJJ A;  4NLB A;  4QAG A;  2W42 A;  3OVN A;  3EY1 A;  3EN9 A;  3M8Q A;  4H5R A;  1C0G A;  1VQ7 N;  5EX5 A;  3VTI A;  5AQF A;  4KRF A;  1GLD G;  3I8D A;  5AQQ A;  2FBV A;  4DTP A;  4B3T K;  4FVM A;  2O4G A;  3DYA A;  4E7J A;  4X64 K;  4GV9 A;  3NF6 A;  3OHR A;  1Q82 O;  3AVH A;  4RW8 A;  3OYA A;  3SUQ A;  3LP3 A;  4HHT A;  1BU6 O;  3R6M A;  3Q7B A;  3J7Z O;  2A3Z A;  3L4I A;  4B9Q A;  3EEQ A;  3O9U A;  3LDL A;  4FLY A;  2IVN A;  3TAG A;  1R59 O;  3U8X A;  3L2U A;  4X66 K;  3ZSO A;  4BRF A;  1RDW X;  5KPT A;  3TTF A;  1ITG A;  3KLE A;  1VAZ A;  3U3G A;  4H03 B;  4FJK A;  1RDB A;  4CF2 A;  4J2D A;  1JLC A;  4FLZ A;  3LAN A;  1KAX A;  3OYB A;  1HPZ A;  2HBK A;  3MWT A;  1YT3 A;  1ZYQ A;  2O8C B;  3M8P A;  4A5B A;  2CH5 A;  3DRS A;  1HJO A;  4CBU A;  2NRH A;  5IT9 O;  4DV7 K;  4DV4 K;  4YOR A;  3ID6 A;  4B9L A;  2WOM A;  3AVA A;  3J81 O;  5I9E B;  1VQL N;  3CCQ N;  3VER A;  1HKG A;  3D7E O;  4K8X A;  4M3T A;  3OYC A;  3OS1 A;  4OKJ A;  4FPB A;  3AY9 A;  2YCH A;  3AVB A;  3QB0 A;  5AQS A;  3G4S N;  3OYG A;  3THY A;  1TL3 A;  5AQU A;  3SV4 A;  3O8M A;  1KTQ A;  3HST B;  3IFR A;  4ISG A;  4Q5V A;  1LCU A;  2FF3 B;  4CK3 A;  3KKS A;  1SS6 A;  3P39 A;  2P9L A;  5BRF A;  1N34 K;  1L3U A;  2VG7 A;  3LPT A;  2UUB K;  1Q7Y O;  1YXQ A;  3HZ6 A;  3C6T A;  4FW2 A;  2BTF A;  3WEE A;  4CJE A;  5J2P A;  3TI0 A;  3T1A A;  3SJJ A;  4PHT X;  3TAF A;  3LZI A;  5LMN K;  1Q8I A;  3HT3 A;  1TUY A;  1KQS M;  1KRP A;  3VGK A;  1NMD A;  2AA4 A;  2OZM A;  3KWG A;  2Q31 A;  4CGF A;  2DPN A;  3NGI A;  4FJJ A;  3TU5 A;  4U7B A;  2FBX A;  4KTW A;  1N5Y A;  4CEC A;  1VSJ A;  1VSL A;  4DWI A;  1TAU A;  4A59 A;  4CFB A;  4BC3 A;  2GX9 A;  5JVG L;  1KLN A;  1NK9 A;  1BO5 O;  1REV A;  4JKG B;  5KRS A;  3BF1 A;  3RMA A;  4DQQ A;  2NRT A;  1W9H A;  4WFB L;  3ATU A;  2W40 A;  4NO7 A;  3ZET A;  4JI2 K;  4A61 A;  1QQO A;  3K5O A;  1VQM N;  4K8Z A;  1U48 A;  2QWM A;  2E8A A;  3THW B;  4EZ9 A;  2D4W A;  3WQU A;  2Q0R A;  4E1N A;  4XH4 A;  1ZBL A;  3TSU A;  3F2K A;  1NOY A;  1LAV A;  2EHG A;  2Q3S A;  1LWC A;  4CBW A;  3JXU A;  1A5V A;  1JL2 A;  4H8K A;  1N36 K;  4H0P A;  4MLH A;  3HP6 A;  5JS2 A;  4AH9 A;  1JJ2 M;  4JV5 K;  1N6Q A;  2DFF A;  3EZW A;  4KRE A;  4CJW A;  4MO4 A;  2QEX N;  4DF4 A;  3FZK A;  3EL2 A;  3O9S A;  3A2F A;  4KHQ A;  4Z0U A;  1GLL O;  1C0M A;  5CE3 A;  4Z4F A;  1KVC A;  4BC2 A;  2HHW A;  4IJN A;  1BA0 A;  4JD2 B;  4B9S A;  3LP0 A;  1BQN A;  1HPM A;  4H0T B;  2G8H A;  3LAL A;  4LF8 K;  3HJF A;  4Z4H A;  3ZEU B;  4EZ6 A;  1EWQ A;  3D2E B;  3VF2 A;  5E26 A;  3PY8 A;  5J1E A;  2I7P A;  1YUW A;  2A42 A;  1U4B A;  1XMQ K;  1TK0 A;  3AV9 A;  4LD0 A;  5AQN A;  2OCE A;  4M3U A;  3SAF A;  4WQ5 C;  4BRG A;  3K5L A;  1NK7 A;  1SL2 A;  3OYJ A;  5CZ1 A;  3CMA N;  3LAM A;  5BPM A;  2P1J A;  4BE0 A;  2O8B B;  1VSM A;  3V6D A;  1ZBU A;  3CD6 N;  4BDZ A;  3NH2 A;  2FXU A;  2V7Z A;  3OY9 A;  3NGY A;  5M1F A;  3ENO A;  5I3U A;  4JK8 A;  4I9L A;  3I8B A;  5KTQ A;  4XEI A;  1TK5 A;  3VEW A;  2E4L A;  5GIO A;  3GG4 A;  2ZQB A;  4WQ4 C;  2OPQ A;  3PIO L;  3WNE A;  4IKF A;  3K5M A;  4M42 A;  4BR2 A;  1RBR A;  2W41 A;  3QFU A;  4DR4 K;  3CCR N;  4RW6 A;  4BR0 A;  3TAR A;  1M90 O;  5CZ2 A;  4DTM A;  3E66 A;  1L3S A;  1W2B M;  4B08 A;  4LF6 K;  2HW3 A;  5LJV A;  1IKV A;  4BDP A;  3H46 O;  1XWL A;  2ZGZ A;  3WQT A;  4WF9 L;  3ULE B;  4CZF A;  3PO4 A;  3AAQ A;  4CW7 B;  3NVM A;  3V9W A;  3EO3 A;  2F8T A;  2KFN A;  3CCU N;  1T3V A;  3GBT A;  2WFB A;  4RW7 A;  3MCP A;  1JLQ A;  1T6C A;  2WBN A;  4BQZ A;  4E7I A;  3S9H A;  2G8W A;  3E9L A;  1T05 A;  1IO2 A;  1S22 A;  5C2F A;  4KHN A;  1FKP A;  4DS5 A;  3O6W A;  3KD5 E;  3HVT A;  3P5J A;  2ASP A;  4HUF A;  2H3G X;  1B9F A;  3KIO A;  3KJV A;  4F2S A;  4BRP A;  3MX5 A;  2UU9 K;  4FJ7 A;  1RTI A;  1HQE A;  2AJQ A;  1Y97 A;  3KTQ A;  1J9A A;  1XC3 A;  4JLH A;  4JS5 A;  3C6A A;  5AZJ A;  2YKN A;  2OPR A;  4PUO A;  3JYT A;  5C10 A;  4A62 A;  4M3Y A;  1YI2 N;  3H6E A;  3SBG A;  1RT2 A;  3E9P A;  4CZM A;  1TUU A;  4Q0B A;  5AQL A;  4E7K A;  4F3T A;  1KCF A;  2HBL A;  4ELV A;  4BVP A;  4N41 A;  3KK7 A;  4JHD A;  5M1K A;  2Q36 A;  4OKK A;  5HRN A;  4FLW A;  1XNQ K;  4E7H A;  1Q9Y A;  1BOT O;  5E84 A;  3BZK A;  4CJ5 A;  2YHY A;  4BGB A;  4DFP A;  1ZBF A;  3MN5 A;  1HNZ K;  3ZLJ A;  3QEP A;  3G71 N;  3AO2 A;  4FWO A;  1RIL A;  5TKY A;  2HHQ A;  5DMR A;  3L0Q A;  4CBX A;  2NRV A;  1GLA G;  3R8E A;  4DSL A;  1RDA A;  1EQY A;  3AVN A;  3FFI A;  2VGN A;  3CQX A;  3LDN A;  3BGR A;  3HM9 A;  3O9Q A;  4CHO A;  1VSK A;  3ZYY X;  4CED A;  3CM5 A;  3P38 A;  4DSI A;  5ADX H;  1J5E K;  3SK3 A;  3K9J A;  3HSC A;  4FK2 A;  4PL8 A;  1DTT A;  4CD3 A;  2VWK A;  2P9U B;  2F7T A;  3OYI A;  4FLT A;  3L2W A;  2A5X A;  1OVY A;  3OBY A;  1JKH A;  1K8K B;  1FXX A;  3I0S A;  1YIT N;  5T7B A;  5C25 A;  1RT7 A;  5I42 A;  4B1U B;  4DQI A;  3ENB A;  3PX0 A;  4O4G A;  3C94 A;  1WSJ A;  1H1V A;  4IZ9 A;  1QS4 A;  2Z1G A;  3A8Y A;  4MLE A;  1HNI A;  2NZT A;  4B3M K;  3ITH A;  4N76 A;  3LP1 A;  4DHY A;  1NK0 A;  3E01 A;  3H3N O;  2GEM A;  3HVR A;  1X3N A;  4KV8 A;  3NH0 A;  4PWD A;  4I6M B;  4FL9 A;  1HNX K;  4CER A;  3OYE A;  3EYZ A;  4O0J A;  4JYA K;  4CVN E;  2ASM A;  2OPS A;  4KAZ A;  3SLC A;  4CJ3 A;  3AAP A;  3MN6 A;  1OH5 A;  1TK8 A;  4RG8 A;  1YJW N;  1RGI A;  2YV0 X;  4GW6 A;  3B8A X;  4DU4 A;  3GE1 A;  1ZBI A;  1WSI A;  5FPM A;  4DKW A;  2E1Z A;  1K6Y A;  2YHW A;  1U2V B;  1NWK A;  2BH1 A;  4FCY A;  1E4F T;  4CIG A;  1NG9 A;  3RWU A;  4IBN A;  4JRP A;  1FJG K;  4M7Y A;  3KD1 E;  1E4G T;  3I33 A;  1ASV A;  2JGU A;  2PYJ A;  1NKB A;  1QQN A;  4DTO A;  5AQH A;  1CXU A;  5EY4 A;  1RCH A;  3U4L A;  4K25 A;  2W6L A;  3SQ1 A;  2HNY A;  1VQP N;  1SKS A;  4OKE A;  5IWA K;  3O80 A;  1NGC A;  2Q0U A;  4EHU A;  3I0R A;  2QXL A;  2B6A A;  3AO1 A;  4BC5 A;  1C0F A;  3PIP L;  3CER A;  2KLA A;  4GV6 A;  2Z1I A;  2PBD A;  3CIP A;  4YOX A;  4OPK A;  4DTS A;  4AHV A;  1S9G A;  2NLX A;  3WNG A;  4O0I A;  1JLG A;  4FOE A;  4ELT A;  2ETJ A;  1QSS A;  3PSI A;  5AZI B;  2Q97 A;  4CZL A;  2ITM A;  3AA2 A;  3CCE N;  4M45 A;  3VN5 A;  2CGL A;  5AQT A;  3W0L A;  3OYK A;  3NH1 A;  3TAM A;  1Z05 A;  4GMJ B;  3HL8 A;  5DK5 A;  4BRC A;  1CZ9 A;  4IXC A;  4FWQ A;  4M63 C;  5CYM A;  4CJR A;  2PZS A;  2QKB A;  4JKG A;  2YJF A;  3VES A;  2I5J A;  3VA0 A;  3S3N A;  1ATR A;  1OH6 A;  3KLH A;  4O5F A;  2WUS A;  3EKS A;  1VQ6 N;  4H5T A;  2EWS A;  4YY3 K;  4KI4 A;  1X9S A;  3VPZ A;  5AQI A;  3THW A;  4CGD A;  1OH7 A;  4Z94 A;  3PX6 A;  3M8S A;  3CF5 L;  2OA8 A;  3W3D A;  1NBW A;  1NK6 A;  1GLJ O;  4B9U A;  4A2B A;  5FRO A;  1QSY A;  5JLF A;  3OS2 A;  1NGF A;  4DG1 A;  3ULD A;  2F9W A;  4N47 A;  3ASM A;  3MAQ A;  1BCM A;  5CY4 A;  3U3Y A;  3H08 A;  4PA1 A;  2E88 A;  5AQP A;  1D8Y A;  4E19 A;  4W5R A;  2HOE A;  1RBS A;  4FWL A;  4DV2 K;  2QXF A;  4DF8 A;  2P9K B;  2ZJQ L;  1TKD A;  3CCJ N;  4MO5 A;  4F4K A;  1OVQ A;  1KVA A;  3O08 A;  3OYD A;  1RDD A;  5FPD A;  3BZC A;  3UKU B;  4DFK A;  4J8F A;  2RPI A;  4JD2 A;  4ZTJ A;  3B6O A;  1HUX A;  2CGK A;  1W97 L;  2P9I B;  4ISE A;  3HBT A;  1IBM K;  3O3H A;  4DV0 K;  3J8A A;  3J80 O;  3P83 D;  3O3G A;  4AHS A;  4E3S A;  2V52 B;  3VQ9 A;  3SQ0 A;  2UXC K;  5HBM A;  3ZEU A;  4WFN L;  5AFU H;  3D2E A;  1XHX A;  3JAM O;  3AVF A;  1BGX T;  1EP4 A;  3OYN A;  2ZF5 O;  4JRQ A;  3LM2 A;  3CC2 N;  1O1W A;  4KBO A;  3HPG A;  4MDA A;  4H0Y B;  3D0P A;  1S6P A;  1S9E A;  4W5T A;  4CES A;  1HJR A;  3CXC M;  4Y0W A;  5KQD A;  5BRE A;  2RF2 A;  3RRH A;  2O8B A;  1DT9 A;  2PAV A;  1HKB A;  2XO7 A;  1K73 O;  2LSN A;  2OPP A;  4W5N A;  3U9Z A;  2ASO A;  4CJL A;  5MLC Q;  5J2Q A;  4DV3 K;  2VQF K;  4KHW A;  3THX B;  4DSJ A;  3N4Q A;  3T19 A;  4UY8 O;  3CHW A;  3HOS A;  1K9M O;  3DLG A;  2HHV A;  3N4P A;  3CJ9 A;  2QWQ A;  5AR0 A;  4B1V A;  1Z25 A;  3AVM A;  5GIN A;  4H5N A;  3QML A;  3FZM A;  4M7X A;  4X65 K;  4JAX A;  3PSF A;  3SUP A;  4F3O A;  4FWP A;  4BY9 C;  1RTH A;  4FVU A;  5JS1 A;  4DR2 K;  2E6M A;  4CEE A;  1KFS A;  3O1W A;  3ULE A;  3MED A;  4CJT A;  1G15 A;  4R79 A;  4IOC L;  2F8S A;  4O5B A;  2HHX A;  2FSJ A;  4YOY A;  1S1T A;  1CLQ A;  4NXN K;  3IDH A;  5BR9 A;  1TL1 A;  1TYQ B;  3RTV A;  1S1X A;  2HBJ A;  4KKO A;  4RCH A;  2BGG A;  5EVZ A;  1TKZ A;  2PFU A;  4BVO A;  1LW2 A;  4HUG A;  3KK1 A;  2O8F B;  3THV A;  4AQY K;  1V4S A;  4DU3 A;  2F9T A;  1XMO K;  1YTU A;  4BC4 A;  1ATS A;  2HHH K;  3FGU A;  3VA3 A;  5AQM A;  4OO1 J;  1HRH A;  3KKR A;  4JI6 K;  3ZSZ A;  1XUP O;  3ZX0 A;  5J2N A;  3RMC A;  4OPH A;  3K58 A;  1QQC A;  2J4R A;  5AQK A;  2YNG A;  1S5J A;  1GLE G;  2FF6 A;  3GOI A;  3LDQ A;  3VQA A;  1GOC A;  1V4T A;  4O8U A;  1QSL A;  2Z1J A;  4I2Q A;  4B8A B;  1NGE A;  3WXI A;  1TV6 A;  4L3Q A;  3M8R A;  2E2N A;  1WSH A;  1GOB A;  1LW0 A;  2F4V K;  1YIJ N;  4CGH A;  4CZE A;  3NBP A;  2QA4 N;  4ILG B;  4E1M A;  4CHQ A;  3EZ5 A;  5KPZ A;  3QO9 A;  1MWK A;  5AJ3 K;  2BE2 A;  4BRQ A;  2WTU A;  1MU2 A;  4FK0 A;  3EKU A;  4B9V A;  4BRD A;  3IKM A;  3HYF A;  3R9P A;  4RW9 A;  4DTR A;  1U49 A;  1NK5 A;  5DM6 L;  4DR5 K;  2P9N B;  2X78 A;  4AM6 A;  4LH5 A;  3P1G A;  1HMV A;  2E2Q A;  3QBW A;  1JCE A;  2E6L A;  2P9U A;  5LY3 A;  4CFC A;  3NCI A;  4V19 S;  4LFB K;  4A2A A;  1K8K A;  1KXP A;  3SUN A;  2YJE A;  4KHS A;  1U04 A;  2E5L K;  3C65 A;  2KHO A;  1UOC A;  1LV5 A;  3AVJ A;  4KH4 A;  3TSQ A;  3KLG A;  2PYL A;  1JCG A;  4O55 A;  3O5B A;  3JSM A;  2VGM A;  4LSN A;  4WE1 A;  2UUC K;  1ATN A;  3K57 A;  4JK9 A;  1D9F A;  3O4Q A;  5JIC A;  5FPN A;  4PQU A;  1HKC A;  1J6Z A;  3QNO A;  3WXM B;  2IDO A;  3SNN A;  1DKG D;  3C7N B;  4I6M A;  2OYQ A;  1NGH A;  2D1K A;  1MDU B;  4DR1 K;  1EO1 A;  4DB3 A;  4DTU A;  1LWE A;  4IFV A;  2GTD A;  2O8E B;  1LAW A;  4QS9 A;  3NGZ A;  3VQ6 A;  1A5X A;  3C0B A;  3CPE A; 
#chains in the Genus database with same CATH homology
 4DR4 K;  5A2Q O;  2UUA K;  1J5E K;  4DR6 K;  4DUZ K;  4LF6 K;  4CW7 B;  2F4V K;  5IT9 O;  4DV7 K;  4DV4 K;  2VQE K;  3J81 O;  1N36 K;  4JI2 K;  4JI4 K;  4DV3 K;  1IBK K;  4JV5 K;  5AJ3 K;  2VQF K;  2ZM6 K;  4LFA K;  4JI8 K;  4KHP K;  4JI5 K;  2UXB K;  4JI3 K;  4DV6 K;  4B3M K;  4DV1 K;  4DR5 K;  4YY3 K;  4LF5 K;  3T1Y K;  2UU9 K;  5BR8 K;  3J7Y P;  4X65 K;  1HNX K;  1N34 K;  1IBL K;  4X62 K;  4B3S K;  4JYA K;  4CVN E;  4LFC K;  2UUB K;  4LF8 K;  4DR2 K;  4GKK K;  4V19 S;  1I94 K;  3J7A P;  4LFB K;  1HNW K;  4YHH K;  5FLX O;  5LMN K;  4NXN K;  1N33 K;  1XMQ K;  4DUY K;  2E5L K;  4NXM K;  4B3T K;  4DV2 K;  1XNQ K;  4X64 K;  2UUC K;  4K0K K;  5LMU K;  4AQY K;  1HNZ K;  1FJG K;  4GKJ K;  1XMO K;  2HHH K;  4LF9 K;  4JI6 K;  3T1H K;  4DR7 K;  4JI7 K;  4DR1 K;  4DR3 K;  4B3R K;  4JI1 K;  4DV5 K;  4LF7 K;  1IBM K;  4JI0 K;  4DV0 K;  4LF4 K;  3J80 O;  5IWA K;  4X66 K;  1XNR K;  2UXC K;  5LL6 Z;  2UXD K;  1N32 K;  4OX9 K;  3OTO K;  1HR0 K;  3JAM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...