4X62K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x62K00
1N32K 4DUZK 4YY3K 3J80O 4JI4K 4V19S 4JI7K 4DR1K 4JYAK 1HNZK 5LMNK 4B3RK 4GKJK 2ZM6K 3OTOK 4LFBK 4DR7K 4DR6K 4JI6K 4DV2K 4LF9K 5LMUK 4X62K 4JI1K 4AQYK 1IBKK 1HNXK 1N36K 2UU9K 3J81O 4DV7K 4GKKK 1J5EK 1XMQK 2UUBK 4JI8K 4DR2K 1IBLK 4KHPK 4LF5K 4LF6K 1XNQK 1XNRK 4LFCK 4B3TK 4DV3K 5FLXO 2UUAK 4DV4K 2E5LK 4DR4K 4NXMK 5AJ3K 4X64K 1XMOK 4DV6K 2UXBK 2HHHK 4DUYK 4JI5K 4JI3K 4LF4K 5A2QO 4X66K 5IT9O 4JI2K 4DR5K 4JV5K 2UXCK 4DV5K 2VQEK 2VQFK 4JI0K 4DV1K 4B3MK 3J7YP 1I94K 3J7AP 3JAMO 1N33K 4NXNK 4YHHK 5LL6Z 5IWAK 1N34K 4K0KK 2UXDK 4DV0K 5BR8K 3T1YK 2UUCK 4X65K 4B3SK 4CVNE 1IBMK 4LF8K 1HNWK 4LFAK 3T1HK 1HR0K 4CW7B 1FJGK 4LF7K 4OX9K 2F4VK 4DR3K
chains in the Genus database with same CATH superfamily
2ZF5O 4RW6A 4CJLA 3QEIA 4I9LA 3UE5A 3CCUN 1RBUA 3DMJA 4BQLA 4GKJK 4CCHA 3S41A 4CE9A 3TAFA 1NGFA 1U4BA 4CHPA 5SWMA 4B9MA 4BVOA 3CC7N 3AVKA 5FPNA 4AF1A 4BGBA 3BP8A 4L8RB 2WONA 4BRFA 4CEEA 2YNHA 2GWJA 4DF4A 3NE6A 3SNNA 4E7JA 3RRHA 1NMDA 4B1XB 3QDKA 4DWIA 1YJNN 4C1NK 4PWDA 3HM9A 1CZBA 1KVAA 2EX3A 1XNQK 4C23A 4BRAA 3IAYA 2GTDA 3SI6A 4DQPA 3K57A 3NAEA 4DFPA 5HLFA 3CYMA 4DCHA 2X78A 3HPGA 3LDQA 3DLEA 1HMVA 1X9JA 2UXBK 3LAKA 1HPMA 4TSXA 4M3UA 3NGZA 1DT9A 5KGXA 2GV9A 3DLLL 4KI4A 3ALYA 4IFYA 1IG9A 4HWIA 2HHQA 4RW9A 2G8FA 5EOYA 3TSPA 2UXCK 4BR4A 1QQOA 4HHTA 4OLBA 1MWMA 3R6MA 1LV5A 3W0LA 1ESVA 3CI5A 4N47A 3SQ2A 3VENA 1T8EA 1N33K 5BN9A 2V52B 1P90A 1VAZA 4FJJA 3VEOA 3AVHA 2NNWA 1LWEA 2NRVA 3UIQA 3NF7A 4FOEA 2VWJA 3MAQA 4LF8K 3FLCO 4CJSA 1I3AA 1T3VA 1XQSC 5DM6L 4DFMA 2QKKA 2A1SA 2OYQA 2CGKA 5AQUA 4CEZA 1NOZA 4JS4A 3RTVA 3CCJN 3G10A 4BRKA 4L3QA 4FK0A 3FZFA 5AQFA 4E0DA 1RILA 5AQOA 3ZYYX 1NJIO 3DOKA 4O5FA 1ILYA 4M45A 3C65A 2QWPA 3DJCA 2DY4A 3ISNC 3OY9A 2O8FB 2KZMA 2JWKA 1HNZK 2VWKA 3DLKA 3M8PA 1S6PA 1Z05A 3PIPL 3O9RA 3J8AA 2BTFA 2PZSA 3F9MA 1U04A 4K43A 3QEWA 4KREA 4F2SA 1EO1A 4BG9A 4H5RA 2DPNA 4GV9A 2ITMA 1ZXOA 4H5VA 4H0OA 3DAWA 3CCRN 1JKHA 1RDDA 1IG8A 3RMAA 4DTJA 4CF9A 4K8XA 4FLUA 3SQ4A 1T03A 3L4IA 2WUSA 4JKEA 4WF9L 1IBLK 4PA1A 3EL2A 4ZTFA 4DG1A 4MLHA 1M1KO 4M3ZA 2YNIA 4IEIA 4CJEA 5CZ1A 4B3TK 3MN5A 1T05A 4DV4K 2A6AA 3MX2A 1XMOK 4IO9L 1VQLN 1QVFM 4HCCA 1QHAA 3U6FA 5CYQA 4BR5A 4BQZA 1G15A 2YHYA 3CQXA 3C6UA 3H46O 3SAHA 1VHXA 4JI2K 5CE3A 3ZX3A 2F8TA 2KHOA 3LPUA 4QS7A 1I94K 4CJUA 4CF1A 4BREA 4XIUA 3THYA 4ELUA 4CBXA 2HB5A 3O3FA 3ZSVA 5J2QA 2AA4A 2D5RA 1CZ9A 4IOAL 1QZ5A 1WSJA 3WXLA 4H0PA 2F7TA 1IV0A 3D2FA 3AGKA 3C6TA 4W5OA 1LAWA 2BH1A 3D7EO 4CW7B 3A0IX 1BIZA 4LSLA 5C15A 1N32K 2YX6A 3ZT0A 4CESA 4DU3A 5CZ2A 1TL3A 4NB4A 5GINA 3GBTA 3L2QA 3HVRA 3NGIA 3UKRB 2PAVA 3ZT4A 4DR1K 4JKAA 4IG0A 2P9SA 4R5PA 3ZSZA 3M1FA 1R0AA 4O4GA 1BWFO 1QQNA 1K8AO 3D2EA 5LMUK 3AV9A 5E84A 3B8AX 3LALA 2H3GX 2E6MA 3KK2A 4BC5A 3CCSN 1N36K 4R79A 4BRIA 2E20A 4H0TB 5J1EA 3K5MA 5AFUA 1TK0A 3G0ZA 4FK4A 4RWTA 1D9DA 2A41A 4Y0WA 3SUQA 3SYZA 4CEOA 3M8RA 3SV4A 4N56A 2HHSA 4DTUA 3KZBA 1K73O 1NGGA 3IMXA 2F96A 5JLFA 2W40A 4NLCA 1BOTO 4H5NA 3WQTA 3SQ0A 4CJTA 1YHQN 2E88A 3MXJA 2ZJQL 4NXMK 2O8EA 3LP1A 2P5OA 1MU2A 1CXQA 3DLHA 3ZETA 4JI5K 3V4IA 4KTZA 2O8DA 3QNNA 5J2PA 4BWJA 4O0JA 1ZC6A 3KD1E 4CGGA 3J7ZO 2VQFK 1TK8A 4PKHA 3THWA 1VSDA 1B9FA 4BR0A 2HVIA 4YDUA 3UKUA 1SAZA 4XH1A 4OPHA 4KHNA 3VGKA 2WOMA 4DQRA 3VQ4A 4FLVA 1ASWA 3RR8A 3SUNA 3QEVA 1NNEA 4KH4A 4B3SK 4IBNA 3WNEA 4WE1A 2NRWA 5JS2A 4JD2A 3MMVA 1WNSA 5D3GA 5AQVA 3B6OA 4DTRA 1TYQB 4KFBA 2W42A 3EE9A 3NGYA 4H5TA 4ICLA 3MN6A 4BRQA 4CD3A 3GOIA 3SMSA 1VQ5N 4YY3K 2FBVA 3AVAA 1J54A 1HLUA 3HPHA 2HHUA 1RGIA 1NGIA 5BN8A 3DXMB 3WEEA 4CJWA 4E89A 3TWHA 3SK3A 3I56N 2JGUA 1KLNA 4M3TA 3H45C 4JI6K 3T19A 3RMCA 1RTJA 3OYGA 4AQYK 2FBXA 5BRFA 1L3VA 1YVUA 2OTLN 3I33A 1HYSA 4H5WA 1V4SA 1QSLA 3RWUA 4FJ9A 2F8SA 3P39A 3AVJA 3CD6N 4M7XA 2QW9A 4ISGA 4DU4A 4O55A 1U48A 4F8RA 4CJKA 1BG3A 2KW4A 5T7BA 2VG6A 4FJGA 4ILJA 4KB1A 1TK5A 5CYMA 1NM1A 2YHXA 1SUQA 4CZHA 1JLGA 5JMVA 3GL1A 1GLLO 3VQ8A 3A5OC 2CGJA 3VEYA 3QBXA 5JS1A 3IG1A 1S1XA 3LDNA 5KQDA 2P9UA 1RDBA 4Q0BA 3OYIA 3VA0A 3T1AA 1D4XA 1NGHA 1D8YA 5ELZA 3N4QA 3PUFA 3HM8A 5AQGA 2VCPA 3QINA 3GG4A 1JLQA 4DV5K 3RMDA 2O8BB 4FWNA 3HT3A 4IOCL 3PX6A 3H6EA 3P1GA 4B1YB 4C8NA 4JK7A 5C42A 4IG3A 3LM2A 4BDYA 3HVTA 2VYPA 3SAFA 2Q3SA 5EVZA 3VGMA 3KK7A 2P9KA 4YFUA 3K9KA 4K25A 4CHZA 4IJAA 4FSVA 2B5JA 3LL3A 3K0SA 3QO9A 1IO2A 2P51A 1FJGK 2A40A 5M1PA 1NK8A 4LF7K 1U47A 1DEJA 4DB3A 3ENBA 4BRNA 4H0VB 3CJ9A 2F9TA 3NBPA 4CJRA 4CBWA 4CIFA 3ID8A 4CEFA 1L3TA 1KAYA 1IKYA 1JXEA 1C1BA 4CFCA 1IJJA 4KRFA 3ZT3A 4IJNA 5E41A 3EKSA 4LH5A 2HF3A 5FDLA 2P9PB 2RF2A 5AZIB 3CJCA 4CF2A 4BR7A 4EAHD 3K9JA 1KLMA 4ILHA 2UU9K 2NUBA 2P9IA 3P83D 2X6NA 3VQ7A 3K59A 5TKWA 3CCEN 4B9VA 2KFNA 4B3OA 3QETA 3EKUA 4OLAA 4Z4IA 3LAMA 1ATNA 2QXLA 3HJFA 4FVMA 4J2DA 2D0OA 1NWKA 5AR0A 4YOTA 1XMQK 1FK9A 4CEAA 1U2VB 4KBOA 3VETA 4E1JA 3IDHA 1KQSM 4DSJA 3O9QA 3LDPA 4XH5A 3KLFA 3CCLN 3MCAB 2P9NB 1NK6A 3NH2A 3CHWA 2HNZA 4UY8O 4MO4A 2W41A 5GAHP 4O8KA 3V6DA 5KI6A 4CIGA 1KSPA 3NDKA 4Y1DA 4EZ6A 2G8WA 1RTDA 1JLCA 3CJAA 4JEPA 5IT9O 1A5XA 1RT5A 3ZEUA 3EZ5A 4KV8A 4A2AA 1HNIA 3WNGA 4PUOA 1W0HA 2BGGA 1Q86O 3C7NA 1WSGA 3CIPA 5AQLA 3SBGA 2D0AA 3EE8A 2ASMA 4FJ5A 5HRNA 1SS6A 2O4GA 1IBMK 1U45A 1S1TA 5FROA 4IDKA 1KC8O 5E26A 4LFAK 1J53A 2ZWHA 4FJ8A 3NVKA 2RN2A 1GLBG 3P31A 4EZ9A 3VGLA 2A5XA 2NRXA 4OVLA 3MN7A 4AM7A 2E1ZA 5I3UA 2O4IA 1HJRA 2NLXA 1VRUA 4MFBA 3SJHA 1GLFO 4KHWA 5I42A 4CZKA 4JKDA 4FLZA 4XEIA 3BDPA 3AO5A 3L3VA 3L6QA 5M1OA 2KQ2A 3FZKA 2XY6A 1S1WA 1TL1A 4C1NI 3TAEA 1NK7A 2Q97A 4CZIA 1VSKA 1T7PA 3PSFA 4DSKA 4KTWA 3AVGA 1E3MA 2IOCA 2Q2RA 3WXMB 1NKEA 3VQBA 4NCBA 1X9MA 3VQCA 1SKSA 4A2BA 2NRZA 1WBBA 4ID5A 2CH6A 4JI8K 2YNGA 1WN7A 1EWRA 3O4QA 3WQUA 4LFCK 4HTUA 5GAGP 3QERA 1X9SA 1NJWA 1M90O 1B92A 4JHDB 1X9WA 4WFNL 4W5TA 2LSNA 1NK0A 3Q7CA 3LWMA 4EHTA 1YI2N 1RDWX 1RTIA 1HYZA 2YHAA 3MCPA 4YDUC 2HHWA 5FPMA 3C6AA 4M42A 1GLJO 3KWIA 4CGJA 3K58A 1T6CA 2G8UA 3VF4A 1YTUA 3MEEA 5KRSA 3OYDA 1Q82O 2OZSA 3U3YA 3MXIA 4GVEA 2QWRA 4A57A 4GVMA 3CCVN 3QIPA 4B9TA 3K5NA 1QQCA 4FL9A 4WFAL 1KFSA 1VSLA 1NU0A 2FBTA 2HNDA 4YOVA 3T1YK 5HROA 1VQMN 3CJ1A 3R8EA 1S9EA 3PSIA 4I6MB 3U8XA 4GY2B 2ZJPL 2Z1IA 4U7BA 3CETA 1QTMA 3T1HK 2JLEA 3NCIA 4C8LA 3HRGA 1NGCA 1Y64A 2ZGYA 5M1QA 4IO8A 2OANA 1VSFA 4A61A 4IKFA 4DUZK 1YTAA 1BIUA 1BQNA 4JI4K 1R59O 2XY5A 2QWMA 1J6ZA 3FZMA 4CHYA 3ATUA 2HF4A 2RPIA 3D6RA 4DKWA 4DQSA 3VMFB 3ZT2A 3ZSWA 1YUWA 4J2AA 4DR6K 2HMIA 1RBSA 1S9GA 2RKIA 1NGBA 3AO4A 4CJVA 4IZ9A 4FJIA 4DSEA 2O8FA 3QEXA 4LD0A 2WBNA 4DU1A 3OS2A 3T3FA 5AQXA 3CJ7A 3TAQA 4B08A 3OYCA 3LPTA 3V9SA 4KHPK 1X1PA 4AILC 4Z4CA 5HOOA 3AA4A 1K6YA 5ADXA 1EETA 3QLHA 5KTQA 1VSIA 1C0TA 1FKPA 3BGRA 3VN5A 5HL7L 4PKIA 1JCGA 3U9ZA 1RT7A 1TGOA 4ISFA 2ZGZA 2RE2A 5HRRA 3ZX2A 3SUOA 4CIEA 2G8VA 1NJYA 4CFBA 4F3OA 4BRLA 2Q0UA 1I39A 1ATRA 1L3SA 3OJUA 1KXPA 2IVNA 5KPTA 3KLIA 4JI0K 1A5VA 1VQPN 2GEMA 3MEGA 4CZLA 4KKOA 4NXNK 4K8ZA 3ULDA 2UYTA 3F73A 4IOXA 4NYNA 4AHTA 4X65K 3AO2A 4U67L 3OW2M 3BUZB 4JK9A 1JCFA 4JKGA 1KVCA 2PFUA 1WAFA 2D0PA 3HXMA 1QSSA 1VSEA 3DXKB 3A5LC 4IEEA 4OX9K 2IVPA 3TARA 4OGEA 4E7KA 4G9ZA 3QBWA 3PY8A 2R7YA 3V9UA 3EN9A 4CEQA 1RDCA 1C6VA 1N8RO 1DGKN 4H8KA 5M1FA 2HBLA 3F9KA 3ZSRA 4AHSA 5J2NA 1OH8A 1XUPO 4B3RK 3A5MC 3E9LA 4CF8A 5F1XA 5LJVA 4JLHA 4HUEA 1CXUA 3TSQA 1JLFA 4X62K 3PO4A 2DFEA 3CM5A 4AHRA 1HNXK 1GLCG 1NGEA 2G8KA 1S3XA 4FPAA 5AQPA 4O0IA 4WYBA 4DV7K 5AFUH 4DQIA 4FWLA 1SZ2A 1ZYQA 4DF8A 3JS6A 1JJ2M 2NRTA 3E9PA 3D45A 4DHYA 2FC0A 3HI0A 3HTVA 4B8CA 4AHVA 4RCHA 3THYB 4M41A 4MQ3A 1QE1A 1ZBIA 4FLYA 3O4NA 5KPRA 3QFPA 1YT3A 4FW1A 3KWGA 4BACA 1VQ9N 4PL8A 2IAJA 4DLEA 4F2RA 1YJ9N 2FLOA 3ENOA 2AJQA 2O8CA 2YJEA 1LCUA 2YI1A 3DI6A 4X64K 5F2RA 2VGNA 3ULEB 1C0UA 4RG8A 4FM0A 3L2WA 5BPNA 1U49A 3AO3A 3OYAA 1VQ7N 2G8IA 1QZ6A 2HVHA 2P9SB 4PHTX 3KJVA 3CF5L 1RT2A 3BY5A 4CEBA 1DTQA 4B3MK 4WQ4A 3J7YP 3NVMA 3D2EB 4ID1A 1UOCA 4IXCA 1N34K 5AQSA 3S9HA 3SQ1A 3M5RA 4DV0K 3OYJA 3CCQN 4JKHA 2E2OA 4QAGA 4CJQA 3R1XA 3P38A 5BR8K 3L8BA 3NF6A 2ZD1A 3TTFA 2Y1JA 3BZKA 3GE1A 3L3UA 3WUHA 3H1QA 5DK5A 3FZHA 1OH5A 4CBUA 3CJBA 2Q36A 4FZYA 3F5TA 1EP4A 2QEXN 1QS4A 3IS9A 4CZJA 2J4RA 4BRGA 4I2QA 3C94A 3O6WA 4WFBL 4DTOA 5AZJB 1TYQA 3VESA 4F4KA 4KO0A 3ZETB 3HOTA 4FWQA 3V9ZA 3QFUA 5AQTA 2YV0X 3J81O 2DFFA 3LWLA 4E7LA 1BA0A 3THWB 1VQON 3I8BA 1CZAN 4KH5A 1LOTB 1WAJA 3UKUB 4ELVA 3ZSYA 3TANA 1DKGD 4JAXA 4YOYA 1HQEA 5JICA 4BRPA 4LF5K 3CM6A 3O9UA 2PYLA 3K5LA 3DLBA 1IKVA 4JD2B 3LM9A 1ZBHA 2YCHA 2OZMA 4NYFA 4DV3K 4KHUA 3AVMA 5B8HA 1Z26A 3MECA 3WXKA 2HOEA 1Q81O 2GELA 3NMUA 1HYVA 3CC2N 2HHTA 4A59A 4B9NA 1BI4A 3OBWA 5FRMA 1X3NA 4DQ8A 3KTQA 1S6QA 5BRHA 2W6KA 3G4SN 3LP2A 3RSEB 2NRRA 1S22A 4OKJA 5K14A 4PQUA 4DV1K 1NK5A 3U9DA 1IKWA 1JXBA 1XI1A 1HRHA 5IWAK 3VTHA 3FFKB 3H3OB 3KKRA 3CPEA 4E3SA 3SLCA 4DS5A 4H0YB 1T6DA 1NKCA 1BL3A 1VSMA 3LDLA 2O8BA 2PYJA 3P4IA 1VSHA 3W3DA 3MWTA 2IVOA 1GLDG 4BRMA 1QHTA 4FWRA 2JWLA 3BEXA 1K8KB 2V7ZA 4JKBA 3KK3A 3WXIA 4HTLA 3V1QA 4AHCA 1F21A 5EY4A 2ZQBA 3OA9A 2B6AA 3CG7A 1BQMA 3TTDA 3KVGA 1ATSA 4LFBK 2E2QA 1HUXA 4DV2K 4B9QA 5CHIA 4CZFA 4M3RA 3RR7A 3ZSXA 3L4QA 4FJHA 1BISA 1IBKK 4BE2A 2NRHA 5AQRA 4A62A 1B9DA 4FM2A 2HHXA 1BUPA 1GOBA 1BGXT 1JLEA 1JL1A 2A3ZA 4OJRA 2P9LB 3AVIA 4BR9A 3SMPA 3TTCA 3B6PA 4GNIA 4N5SA 2A42A 1Z6RA 2P9PA 1HQUA 2P9KB 3VF2A 3R9PA 3EEQA 4Z4EA 4FOIA 2FXUA 2QWNA 1XWLA 2I7PA 1X3MA 2I5JA 2RHKA 3DRSA 4CHQA 3M6GA 4DTMA 5C2DA 3EY1A 2G8HA 2EWSA 2GWKA 3D0PA 2OA8A 3VQ5A 3N4PA 3TSUA 4DLGA 1NJZA 5BREA 1U2VA 2PY5A 3THXA 2OPSA 3A8YA 3OS0A 1LWCA 1G99A 2E2PA 4CHNA 1TAUA 1TUUA 2HSTA 3E9OA 5A2QO 1W9HA 3O5BA 3ZLJA 3CQYA 4M63C 2VQEK 1SQKA 1SV5A 3BF3A 4C8OA 4BC4A 4IFEA 3JAMO 3Q7BA 3C95A 1WOQA 1VK0A 3TAGA 3VPZA 4B1WB 4I2PA 5AQJA 4ELTA 2UUCK 1T44A 1ASVA 1TAQA 3MEDA 3QMLA 4GMJB 1L3UA 2HMPA 4FJMA 4CJFA 1HKCA 4OPKA 3TR8A 3C6HA 1HR0K 3O4WA 1HX1A 3TAMA 4BWMA 1C0GA 1S1VA 3I0SA 3QB0A 4FWPA 5CY4A 4J8FA 3E66A 1MWKA 4A5AA 4E7HA 3PX4A 2FBYA 4CGDA 3BF1A 2Q0RA 3KKSA 2QKBA 5FRNA 4FJ7A 5LMNK 2ZE2A 3NH0A 4FLTA 4MDAA 2W6LA 3V1RA 3SZ2A 1YF5L 3AVCA 1Q9XA 4YOXA 3HZ6A 4LC9B 1C0MA 3HL8A 3ZEUB 3OYHA 1EQYA 5BPMA 4E1MA 2HNYA 3TPQA 3CPWM 4GV3A 4B9SA 3TAPA 3NFAA 1E4GT 3DM2A 1WSIA 4FO0A 2WC9A 3VA3A 3H08A 2ITGA 2GUPA 2ZJRL 5HBMA 3OJSA 3OYKA 3L0QA 1HPZA 4YOUA 5C10A 4N76A 1BA1A 4ILGB 4RW4A 3KLEA 2UUAK 2WFBA 3O08A 3MWPA 4WQ5A 1VRTA 4EHUA 4WQ4C 1DTTA 4BC3A 3WT0A 4K42A 1E4FT 2D1KA 2X6SA 1VQ4N 2XRIA 1RTHA 1NK9A 3ENHA 4DR5K 4F3TA 1WSFA 3G71N 4O5BA 4EP5A 3AVNA 3LDSA 2VWBA 1J9AA 4CZMA 3L2RA 4K0KK 3CMAN 1TKXA 4B1VA 1FXXA 1QQMA 1NOYA 1FW6A 4CGIA 1VQ6N 1HNWK 4BR2A 4KH6A 5AQKA 3LP3A 3CFPA 3AY9A 3VEXA 2QTDA 3FE1A 1IH7A 4NCAA 4O44A 3G25A 4DTPA 4FZZA 2QWOA 3QICA 1RBTA 3HOSA 5GIPA 4FK2A 4FWOA 1GLEG 3V81A 2I7NA 4I6MA 1NGDA 1NBWA 2Z1GA 4LY7A 5KGWA 5M1NA 3DYAA 5HP1A 4XH4A 3ZT1A 2YKMA 1WLJA 3O9SA 4KB0A 4DTXA 1QSYA 3E01A 3MX5A 4E19A 1JCEA 4CEDA 3IRXA 4BVPA 4FLXA 3S3MA 3SCXA 1RBRA 1J5OA 3QIOA 3KLGA 1LWFA 3PX0A 4YORA 1YAGA 4O8UA 3LZJA 1JLAA 2IIRA 1Q7YO 1KFDA 4OGCA 5J2MA 2UUBK 3FFIA 2GBZA 2OTJN 4W5NA 3T69A 1WSHA 3AO1A 3DWLA 3MXMA 2X74A 1YIJN 4HVJA 1HKGA 3MN9A 5ADXH 3U3GA 1UA1A 1BO5O 2XHBA 2CH5A 4HCBA 4RTFD 3H3NO 5MLCQ 1N6QA 3PIOL 4CK3A 4DR4K 1RFQA 2D4WA 3KIOA 2Q31A 1SL2A 1FKOA 2E6LA 1BDGA 4CFDA 3OVNA 5BPLA 4LH4A 1VSJA 3MDQA 3LDOA 4LF4K 1HKBA 2WTUA 4JV5K 2BANA 4CK2A 1CLQA 1O13A 3A5NC 4I7FA 5DM7L 4WCEL 3RRGA 4RW7A 4Z4HA 5JVHL 4EIAA 3KD5E 3JXUA 2ETJA 4B9UA 4H4MA 2IS3A 3DRPA 2KFZA 3ZSQA 1NLVA 1RT1A 1VQKN 3AAQA 5JLHA 2E1YA 4HUFA 2YKNA 4FVUA 4Z4GA 4CI6A 3VTIA 1QVGM 3G6EN 2QK9A 4CJ7A 2KTQA 5KRTA 1NMNA 1XHZA 5EX5A 3OS1A 4DR3K 1GOCA 4Z0UA 4PKGA 1IKXA 2FF6A 1VQ8N 2QWQA 1C1AA 3J80O 1EX4A 4JYAK 3HSCA 3SUPA 4BRCA 4DMNA 3DXKA 4M3XA 4FCYA 3HP6A 5H1SQ 1S5JA 1P8ZA 2YNFA 1U6ZA 2XY8A 1DLOA 5AQIA 4CZEA 2QWLA 3SV3A 2D0BA 4A5BA 5SZTA 4KI6A 2P5GA 4DR2K 2Y1IA 1ZBSA 5AQNA 2P1JA 1ZBUA 4DS4A 4JKGB 2V51B 4JN4A 4FWKA 5M1KA 5FPEA 1RT3A 4MO5A 3UKRA 3C0BA 2HBKA 4YNQA 4M3WA 5LJWA 5AJ3K 2A1RA 4B1ZA 3PV8A 4FZXC 3NF9A 1GLAG 1Y97A 3M8QA 2ASPA 4DFKA 4BDPA 3O3GA 4DFJA 1HJOA 4AM6A 1L5UA 1C0FA 3ASMA 3KLHA 2PBDA 5FPDA 4OKEA 4GW6A 4NLBA 1VQNN 4OKKA 3OYFA 5DMRA 4AH9A 3D2FB 5AQQA 1TVRA 1MA9B 1GOAA 3ULEA 1ZBFA 1ZBLA 4JK8A 1WUAA 1RT6A 5KQ8A 2KLAA 3L2UA 2HBMA 3KHYA 3GDQA 4UQGA 1BHLA 4GV6A 3AVFA 3HO1A 1KTQA 4OPAA 2HBJA 3HPOA 1BU6O 4ZTJA 3CXCM 3O3HA 2YHBA 4N41A 3EZWA 1XC9A 1NK4A 5C12A 2OPRA 4K41A 1TUYA 4FJNA 1LW2A 2VG7A 3RMBA 4CF0A 4CHOA 2O8CB 1RNHA 1XC3A 2BUPA 4FJXA 4KHSA 3PLAA 1MDUB 3K2PA 3P5JA 3OYBA 2D0CA 2ZM6K 1O1WA 3O80A 2OPQA 4DR7K 1ITGA 1NG9A 3AA5X 5C0YA 5GAEP 3AVLA 4I9QA 4M3YA 5GIOA 4EP4A 1EWQA 1OVYA 1V4TA 5C25A 3CFOA 1KAXA 4BG8A 4H03B 5AZJA 3SJJA 1REVA 4GKKK 3L2VA 3SAGA 1OH7A 4WQ5C 3ZCMA 2O8EB 2E8AA 3DLRA 3OYEA 1KRPA 2QM1A 4JRQA 4DSIA 4M7YA 4BE1A 2FSJA 3OYNA 2VGMA 2DTUA 5AQMA 4E1NA 4QS9A 3CFRA 2O8DB 3DRRA 2E4LA 3ATVA 3FGUA 3ITHA 3U4LA 1RBVA 5AQYA 3O1BA 3WNHA 3DXMA 3V9XA 2E5LK 1BCOA 3NHGA 1UAXA 3VERA 1W2BM 5AQWA 1K9MO 3I8DA 2HHHK 1XHXA 3A2FA 4CZGA 4DTNA 2IDOA 4JI3K 3AARA 1UWBA 3LANA 1Q9YA 2BDPA 2QI2A 3HYFA 2HHVA 1HNVA 3SPYA 3VF6A 3J7AP 3CCMN 2AP1A 4DTSA 4LSNA 4IWVA 3RSEA 2EHGA 3VEWA 4CVNE 3MK6A 3BZCA 2YJFA 1D5AA 3WEEB 2NZTA 4CK1A 3VQDA 1D9FA 3V9WA 5F0XA 2FSKA 4J2BA 4MLEA 1SL0A 1NJXA 3V1OA 2F4VK 5GADP 3IKMA 4FW2A 5TKYA 4JI7K 3LP0A 2XY7A 5EU7A 5JVGL 3IFRA 4Z4FA 1YITN 1SKRA 1BI4B 3K5OA 3OTOK 3ZX0A 3O8MA 1K8KA 4CJPA 1RT4A 5BRDA 1SKWA 4LF9K 4JI1K 2OPPA 3QEPA 3TI0A 4BY9C 5KPZA 4JKCA 1KD1O 2B4JA 3OHRA 3VQ9A 2BE2A 3R3LA 3KK1A 4C8KA 1OVQA 3AVBA 3LZIA 4JS5A 1J5EK 1JLBA 5I9EB 1C1CA 4MDBA 4RW8A 4LF6K 1WBDA 2P9UB 3H1VX 2F9WA 1XNRK 5EXWA 2P9LA 5AQZA 3O1WA 4CGFA 4W5RA 1TKTA 4IDHA 4QS8A 1NGAA 3NH1A 3HBTA 4Y1CA 4KHYA 3CQ8A 3ID6A 4DV6K 3SPZA 3VEZA 4ISEA 4E7IA 1JL2A 1KCFA 4B9LA 4EFHA 5AZIA 1SL1A 4X66K 4PL7A 4CJ3A 2E2NA 4OO1J 4NO7A 4OPJA 3TABA 2VG5A 3CC4N 1NGJA 2GX9A 3FR0A 4BROA 4FJLA 1TKZA 5LL6Z 3UB5A 4FXDA 4BRHA 4G1QA 3HP9A 2QXFA 3AAPA 3VOVA 3JYTA 2XO7A 4H4OA 3FZLA 5HRSA 4FLWA 4J2EA 2P9NA 4HUGA 1NKBA 5LY3A 2GUIA 1TV6A 3THVA 1TKDA 3QNOA 3AA2A 3M8SA 2IC3A 3HSTB 3DLGA 4W5QA 3I55N 3AGRA 2IGIA 4JNEA 3WNFA 4DQQA 1RCHA 4DSFA 1YJWN 1A5WA 4V19S 1H1VA 2P9IB 4BC2A 1Q8IA 3QESA 3VEVA 4FWSA 4PY5A 5C24A 4AHUA 3THXB 4KPYA 4BRDA 3VQAA 3DOLA 2DFHA 1N5YA 5HRPA 3IUCA 2Z1HA 2ATQA 4CFAA 4YOWA 3VQEA 4ZHRA 4CJ5A 4FJKA 1RDUA 4FPBA 1UA0A 1BCMA 3E1YA 4H0XB 4Q5VA 1EXQA 2OCEA 4JRPA 2FF3B 1KVBA 3RVCA 3SBTA 4B1UB 3F2KA 2ASOA 2YHWA 2Q1NA 1WB9A 5FLXO 4B8AB 3T7ZA 4FM1A 1OKJA 4KHQA 3AA3A 3EYZA 4IFVA 1LAVA 2KKZA 5BR9A 1OH6A 5AQHA 4BDZA 4BE0A 3OBYA 3C7NB 2HW3A 4DUYK 4NCGA 3I0RA 3VQ6A 4CD1A 3NF8A 2V7YA 1Q18A 4F9OA 4FYDA 4CJ4A 3VQQA 1KAZA 3TU5A 2CGLA 3O9TA 1S1UA 3S3NA 4QCLA 1WSEA 2FSNA 3PO5A 4YHHK 2UXDK 4FWMA 3JSMA 4JKFA 3VQPA 4KAZA 3S3OA 1S72N 4CGHA 1LW0A 3OYLA 3CMEN 4QOZB 1Z25A 1YXQA 3OYMA 3CERA 2KZZA 1EKEA 3M3ZA 4JHDA 1W97L 1YVNA 4DSLA 4Z94A 2Z1JA 3EO3A 1ASUA 4CECA 3ZSOA 1RDAA 3HK2A 4CERA 4BGAA 2QA4N 5C2FA 4KTQA 5CR4A 4C8MA 1W7AA 3WXJA
chains in the Genus database with same CATH topology
1N32K 4DUZK 4YY3K 3J80O 4JI4K 4V19S 4JI7K 4DR1K 4JYAK 1HNZK 5LMNK 4B3RK 4GKJK 2ZM6K 3OTOK 4LFBK 4DR7K 4DR6K 4JI6K 4DV2K 4LF9K 5LMUK 4X62K 4JI1K 4AQYK 1IBKK 1HNXK 1N36K 2UU9K 3J81O 4DV7K 4GKKK 1J5EK 1XMQK 2UUBK 4JI8K 4DR2K 1IBLK 4KHPK 4LF5K 4LF6K 1XNQK 1XNRK 4LFCK 4B3TK 4DV3K 5FLXO 2UUAK 4DV4K 2E5LK 4DR4K 4NXMK 5AJ3K 4X64K 1XMOK 4DV6K 2UXBK 2HHHK 4DUYK 4JI5K 4JI3K 4LF4K 5A2QO 4X66K 5IT9O 4JI2K 4DR5K 4JV5K 2UXCK 4DV5K 2VQEK 2VQFK 4JI0K 4DV1K 4B3MK 3J7YP 1I94K 3J7AP 3JAMO 1N33K 4NXNK 4YHHK 5LL6Z 5IWAK 1N34K 4K0KK 2UXDK 4DV0K 5BR8K 3T1YK 2UUCK 4X65K 4B3SK 4CVNE 1IBMK 4LF8K 1HNWK 4LFAK 3T1HK 1HR0K 4CW7B 1FJGK 4LF7K 4OX9K 2F4VK 4DR3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 K;  4DUZ K;  4YY3 K;  3J80 O;  4JI4 K;  4V19 S;  4JI7 K;  4DR1 K;  4JYA K;  1HNZ K;  5LMN K;  4B3R K;  4GKJ K;  2ZM6 K;  3OTO K;  4LFB K;  4DR7 K;  4DR6 K;  4JI6 K;  4DV2 K;  4LF9 K;  5LMU K;  4X62 K;  4JI1 K;  4AQY K;  1IBK K;  1HNX K;  1N36 K;  2UU9 K;  3J81 O;  4DV7 K;  4GKK K;  1J5E K;  1XMQ K;  2UUB K;  4JI8 K;  4DR2 K;  1IBL K;  4KHP K;  4LF5 K;  4LF6 K;  1XNQ K;  1XNR K;  4LFC K;  4B3T K;  4DV3 K;  5FLX O;  2UUA K;  4DV4 K;  2E5L K;  4DR4 K;  4NXM K;  5AJ3 K;  4X64 K;  1XMO K;  4DV6 K;  2UXB K;  2HHH K;  4DUY K;  4JI5 K;  4JI3 K;  4LF4 K;  5A2Q O;  4X66 K;  5IT9 O;  4JI2 K;  4DR5 K;  4JV5 K;  2UXC K;  4DV5 K;  2VQE K;  2VQF K;  4JI0 K;  4DV1 K;  4B3M K;  3J7Y P;  1I94 K;  3J7A P;  3JAM O;  1N33 K;  4NXN K;  4YHH K;  5LL6 Z;  5IWA K;  1N34 K;  4K0K K;  2UXD K;  4DV0 K;  5BR8 K;  3T1Y K;  2UUC K;  4X65 K;  4B3S K;  4CVN E;  1IBM K;  4LF8 K;  1HNW K;  4LFA K;  3T1H K;  1HR0 K;  4CW7 B;  1FJG K;  4LF7 K;  4OX9 K;  2F4V K;  4DR3 K; 
#chains in the Genus database with same CATH topology
 2ZF5 O;  4RW6 A;  4CJL A;  3QEI A;  4I9L A;  3UE5 A;  3CCU N;  1RBU A;  3DMJ A;  4BQL A;  4GKJ K;  4CCH A;  3S41 A;  4CE9 A;  3TAF A;  1NGF A;  1U4B A;  4CHP A;  5SWM A;  4B9M A;  4BVO A;  3CC7 N;  3AVK A;  5FPN A;  4AF1 A;  4BGB A;  3BP8 A;  4L8R B;  2WON A;  4BRF A;  4CEE A;  2YNH A;  2GWJ A;  4DF4 A;  3NE6 A;  3SNN A;  4E7J A;  3RRH A;  1NMD A;  4B1X B;  3QDK A;  4DWI A;  1YJN N;  4C1N K;  4PWD A;  3HM9 A;  1CZB A;  1KVA A;  2EX3 A;  1XNQ K;  4C23 A;  4BRA A;  3IAY A;  2GTD A;  3SI6 A;  4DQP A;  3K57 A;  3NAE A;  4DFP A;  5HLF A;  3CYM A;  4DCH A;  2X78 A;  3HPG A;  3LDQ A;  3DLE A;  1HMV A;  1X9J A;  2UXB K;  3LAK A;  1HPM A;  4TSX A;  4M3U A;  3NGZ A;  1DT9 A;  5KGX A;  2GV9 A;  3DLL L;  4KI4 A;  3ALY A;  4IFY A;  1IG9 A;  4HWI A;  2HHQ A;  4RW9 A;  2G8F A;  5EOY A;  3TSP A;  2UXC K;  4BR4 A;  1QQO A;  4HHT A;  4OLB A;  1MWM A;  3R6M A;  1LV5 A;  3W0L A;  1ESV A;  3CI5 A;  4N47 A;  3SQ2 A;  3VEN A;  1T8E A;  1N33 K;  5BN9 A;  2V52 B;  1P90 A;  1VAZ A;  4FJJ A;  3VEO A;  3AVH A;  2NNW A;  1LWE A;  2NRV A;  3UIQ A;  3NF7 A;  4FOE A;  2VWJ A;  3MAQ A;  4LF8 K;  3FLC O;  4CJS A;  1I3A A;  1T3V A;  1XQS C;  5DM6 L;  4DFM A;  2QKK A;  2A1S A;  2OYQ A;  2CGK A;  5AQU A;  4CEZ A;  1NOZ A;  4JS4 A;  3RTV A;  3CCJ N;  3G10 A;  4BRK A;  4L3Q A;  4FK0 A;  3FZF A;  5AQF A;  4E0D A;  1RIL A;  5AQO A;  3ZYY X;  1NJI O;  3DOK A;  4O5F A;  1ILY A;  4M45 A;  3C65 A;  2QWP A;  3DJC A;  2DY4 A;  3ISN C;  3OY9 A;  2O8F B;  2KZM A;  2JWK A;  1HNZ K;  2VWK A;  3DLK A;  3M8P A;  1S6P A;  1Z05 A;  3PIP L;  3O9R A;  3J8A A;  2BTF A;  2PZS A;  3F9M A;  1U04 A;  4K43 A;  3QEW A;  4KRE A;  4F2S A;  1EO1 A;  4BG9 A;  4H5R A;  2DPN A;  4GV9 A;  2ITM A;  1ZXO A;  4H5V A;  4H0O A;  3DAW A;  3CCR N;  1JKH A;  1RDD A;  1IG8 A;  3RMA A;  4DTJ A;  4CF9 A;  4K8X A;  4FLU A;  3SQ4 A;  1T03 A;  3L4I A;  2WUS A;  4JKE A;  4WF9 L;  1IBL K;  4PA1 A;  3EL2 A;  4ZTF A;  4DG1 A;  4MLH A;  1M1K O;  4M3Z A;  2YNI A;  4IEI A;  4CJE A;  5CZ1 A;  4B3T K;  3MN5 A;  1T05 A;  4DV4 K;  2A6A A;  3MX2 A;  1XMO K;  4IO9 L;  1VQL N;  1QVF M;  4HCC A;  1QHA A;  3U6F A;  5CYQ A;  4BR5 A;  4BQZ A;  1G15 A;  2YHY A;  3CQX A;  3C6U A;  3H46 O;  3SAH A;  1VHX A;  4JI2 K;  5CE3 A;  3ZX3 A;  2F8T A;  2KHO A;  3LPU A;  4QS7 A;  1I94 K;  4CJU A;  4CF1 A;  4BRE A;  4XIU A;  3THY A;  4ELU A;  4CBX A;  2HB5 A;  3O3F A;  3ZSV A;  5J2Q A;  2AA4 A;  2D5R A;  1CZ9 A;  4IOA L;  1QZ5 A;  1WSJ A;  3WXL A;  4H0P A;  2F7T A;  1IV0 A;  3D2F A;  3AGK A;  3C6T A;  4W5O A;  1LAW A;  2BH1 A;  3D7E O;  4CW7 B;  3A0I X;  1BIZ A;  4LSL A;  5C15 A;  1N32 K;  2YX6 A;  3ZT0 A;  4CES A;  4DU3 A;  5CZ2 A;  1TL3 A;  4NB4 A;  5GIN A;  3GBT A;  3L2Q A;  3HVR A;  3NGI A;  3UKR B;  2PAV A;  3ZT4 A;  4DR1 K;  4JKA A;  4IG0 A;  2P9S A;  4R5P A;  3ZSZ A;  3M1F A;  1R0A A;  4O4G A;  1BWF O;  1QQN A;  1K8A O;  3D2E A;  5LMU K;  3AV9 A;  5E84 A;  3B8A X;  3LAL A;  2H3G X;  2E6M A;  3KK2 A;  4BC5 A;  3CCS N;  1N36 K;  4R79 A;  4BRI A;  2E20 A;  4H0T B;  5J1E A;  3K5M A;  5AFU A;  1TK0 A;  3G0Z A;  4FK4 A;  4RWT A;  1D9D A;  2A41 A;  4Y0W A;  3SUQ A;  3SYZ A;  4CEO A;  3M8R A;  3SV4 A;  4N56 A;  2HHS A;  4DTU A;  3KZB A;  1K73 O;  1NGG A;  3IMX A;  2F96 A;  5JLF A;  2W40 A;  4NLC A;  1BOT O;  4H5N A;  3WQT A;  3SQ0 A;  4CJT A;  1YHQ N;  2E88 A;  3MXJ A;  2ZJQ L;  4NXM K;  2O8E A;  3LP1 A;  2P5O A;  1MU2 A;  1CXQ A;  3DLH A;  3ZET A;  4JI5 K;  3V4I A;  4KTZ A;  2O8D A;  3QNN A;  5J2P A;  4BWJ A;  4O0J A;  1ZC6 A;  3KD1 E;  4CGG A;  3J7Z O;  2VQF K;  1TK8 A;  4PKH A;  3THW A;  1VSD A;  1B9F A;  4BR0 A;  2HVI A;  4YDU A;  3UKU A;  1SAZ A;  4XH1 A;  4OPH A;  4KHN A;  3VGK A;  2WOM A;  4DQR A;  3VQ4 A;  4FLV A;  1ASW A;  3RR8 A;  3SUN A;  3QEV A;  1NNE A;  4KH4 A;  4B3S K;  4IBN A;  3WNE A;  4WE1 A;  2NRW A;  5JS2 A;  4JD2 A;  3MMV A;  1WNS A;  5D3G A;  5AQV A;  3B6O A;  4DTR A;  1TYQ B;  4KFB A;  2W42 A;  3EE9 A;  3NGY A;  4H5T A;  4ICL A;  3MN6 A;  4BRQ A;  4CD3 A;  3GOI A;  3SMS A;  1VQ5 N;  4YY3 K;  2FBV A;  3AVA A;  1J54 A;  1HLU A;  3HPH A;  2HHU A;  1RGI A;  1NGI A;  5BN8 A;  3DXM B;  3WEE A;  4CJW A;  4E89 A;  3TWH A;  3SK3 A;  3I56 N;  2JGU A;  1KLN A;  4M3T A;  3H45 C;  4JI6 K;  3T19 A;  3RMC A;  1RTJ A;  3OYG A;  4AQY K;  2FBX A;  5BRF A;  1L3V A;  1YVU A;  2OTL N;  3I33 A;  1HYS A;  4H5W A;  1V4S A;  1QSL A;  3RWU A;  4FJ9 A;  2F8S A;  3P39 A;  3AVJ A;  3CD6 N;  4M7X A;  2QW9 A;  4ISG A;  4DU4 A;  4O55 A;  1U48 A;  4F8R A;  4CJK A;  1BG3 A;  2KW4 A;  5T7B A;  2VG6 A;  4FJG A;  4ILJ A;  4KB1 A;  1TK5 A;  5CYM A;  1NM1 A;  2YHX A;  1SUQ A;  4CZH A;  1JLG A;  5JMV A;  3GL1 A;  1GLL O;  3VQ8 A;  3A5O C;  2CGJ A;  3VEY A;  3QBX A;  5JS1 A;  3IG1 A;  1S1X A;  3LDN A;  5KQD A;  2P9U A;  1RDB A;  4Q0B A;  3OYI A;  3VA0 A;  3T1A A;  1D4X A;  1NGH A;  1D8Y A;  5ELZ A;  3N4Q A;  3PUF A;  3HM8 A;  5AQG A;  2VCP A;  3QIN A;  3GG4 A;  1JLQ A;  4DV5 K;  3RMD A;  2O8B B;  4FWN A;  3HT3 A;  4IOC L;  3PX6 A;  3H6E A;  3P1G A;  4B1Y B;  4C8N A;  4JK7 A;  5C42 A;  4IG3 A;  3LM2 A;  4BDY A;  3HVT A;  2VYP A;  3SAF A;  2Q3S A;  5EVZ A;  3VGM A;  3KK7 A;  2P9K A;  4YFU A;  3K9K A;  4K25 A;  4CHZ A;  4IJA A;  4FSV A;  2B5J A;  3LL3 A;  3K0S A;  3QO9 A;  1IO2 A;  2P51 A;  1FJG K;  2A40 A;  5M1P A;  1NK8 A;  4LF7 K;  1U47 A;  1DEJ A;  4DB3 A;  3ENB A;  4BRN A;  4H0V B;  3CJ9 A;  2F9T A;  3NBP A;  4CJR A;  4CBW A;  4CIF A;  3ID8 A;  4CEF A;  1L3T A;  1KAY A;  1IKY A;  1JXE A;  1C1B A;  4CFC A;  1IJJ A;  4KRF A;  3ZT3 A;  4IJN A;  5E41 A;  3EKS A;  4LH5 A;  2HF3 A;  5FDL A;  2P9P B;  2RF2 A;  5AZI B;  3CJC A;  4CF2 A;  4BR7 A;  4EAH D;  3K9J A;  1KLM A;  4ILH A;  2UU9 K;  2NUB A;  2P9I A;  3P83 D;  2X6N A;  3VQ7 A;  3K59 A;  5TKW A;  3CCE N;  4B9V A;  2KFN A;  4B3O A;  3QET A;  3EKU A;  4OLA A;  4Z4I A;  3LAM A;  1ATN A;  2QXL A;  3HJF A;  4FVM A;  4J2D A;  2D0O A;  1NWK A;  5AR0 A;  4YOT A;  1XMQ K;  1FK9 A;  4CEA A;  1U2V B;  4KBO A;  3VET A;  4E1J A;  3IDH A;  1KQS M;  4DSJ A;  3O9Q A;  3LDP A;  4XH5 A;  3KLF A;  3CCL N;  3MCA B;  2P9N B;  1NK6 A;  3NH2 A;  3CHW A;  2HNZ A;  4UY8 O;  4MO4 A;  2W41 A;  5GAH P;  4O8K A;  3V6D A;  5KI6 A;  4CIG A;  1KSP A;  3NDK A;  4Y1D A;  4EZ6 A;  2G8W A;  1RTD A;  1JLC A;  3CJA A;  4JEP A;  5IT9 O;  1A5X A;  1RT5 A;  3ZEU A;  3EZ5 A;  4KV8 A;  4A2A A;  1HNI A;  3WNG A;  4PUO A;  1W0H A;  2BGG A;  1Q86 O;  3C7N A;  1WSG A;  3CIP A;  5AQL A;  3SBG A;  2D0A A;  3EE8 A;  2ASM A;  4FJ5 A;  5HRN A;  1SS6 A;  2O4G A;  1IBM K;  1U45 A;  1S1T A;  5FRO A;  4IDK A;  1KC8 O;  5E26 A;  4LFA K;  1J53 A;  2ZWH A;  4FJ8 A;  3NVK A;  2RN2 A;  1GLB G;  3P31 A;  4EZ9 A;  3VGL A;  2A5X A;  2NRX A;  4OVL A;  3MN7 A;  4AM7 A;  2E1Z A;  5I3U A;  2O4I A;  1HJR A;  2NLX A;  1VRU A;  4MFB A;  3SJH A;  1GLF O;  4KHW A;  5I42 A;  4CZK A;  4JKD A;  4FLZ A;  4XEI A;  3BDP A;  3AO5 A;  3L3V A;  3L6Q A;  5M1O A;  2KQ2 A;  3FZK A;  2XY6 A;  1S1W A;  1TL1 A;  4C1N I;  3TAE A;  1NK7 A;  2Q97 A;  4CZI A;  1VSK A;  1T7P A;  3PSF A;  4DSK A;  4KTW A;  3AVG A;  1E3M A;  2IOC A;  2Q2R A;  3WXM B;  1NKE A;  3VQB A;  4NCB A;  1X9M A;  3VQC A;  1SKS A;  4A2B A;  2NRZ A;  1WBB A;  4ID5 A;  2CH6 A;  4JI8 K;  2YNG A;  1WN7 A;  1EWR A;  3O4Q A;  3WQU A;  4LFC K;  4HTU A;  5GAG P;  3QER A;  1X9S A;  1NJW A;  1M90 O;  1B92 A;  4JHD B;  1X9W A;  4WFN L;  4W5T A;  2LSN A;  1NK0 A;  3Q7C A;  3LWM A;  4EHT A;  1YI2 N;  1RDW X;  1RTI A;  1HYZ A;  2YHA A;  3MCP A;  4YDU C;  2HHW A;  5FPM A;  3C6A A;  4M42 A;  1GLJ O;  3KWI A;  4CGJ A;  3K58 A;  1T6C A;  2G8U A;  3VF4 A;  1YTU A;  3MEE A;  5KRS A;  3OYD A;  1Q82 O;  2OZS A;  3U3Y A;  3MXI A;  4GVE A;  2QWR A;  4A57 A;  4GVM A;  3CCV N;  3QIP A;  4B9T A;  3K5N A;  1QQC A;  4FL9 A;  4WFA L;  1KFS A;  1VSL A;  1NU0 A;  2FBT A;  2HND A;  4YOV A;  3T1Y K;  5HRO A;  1VQM N;  3CJ1 A;  3R8E A;  1S9E A;  3PSI A;  4I6M B;  3U8X A;  4GY2 B;  2ZJP L;  2Z1I A;  4U7B A;  3CET A;  1QTM A;  3T1H K;  2JLE A;  3NCI A;  4C8L A;  3HRG A;  1NGC A;  1Y64 A;  2ZGY A;  5M1Q A;  4IO8 A;  2OAN A;  1VSF A;  4A61 A;  4IKF A;  4DUZ K;  1YTA A;  1BIU A;  1BQN A;  4JI4 K;  1R59 O;  2XY5 A;  2QWM A;  1J6Z A;  3FZM A;  4CHY A;  3ATU A;  2HF4 A;  2RPI A;  3D6R A;  4DKW A;  4DQS A;  3VMF B;  3ZT2 A;  3ZSW A;  1YUW A;  4J2A A;  4DR6 K;  2HMI A;  1RBS A;  1S9G A;  2RKI A;  1NGB A;  3AO4 A;  4CJV A;  4IZ9 A;  4FJI A;  4DSE A;  2O8F A;  3QEX A;  4LD0 A;  2WBN A;  4DU1 A;  3OS2 A;  3T3F A;  5AQX A;  3CJ7 A;  3TAQ A;  4B08 A;  3OYC A;  3LPT A;  3V9S A;  4KHP K;  1X1P A;  4AIL C;  4Z4C A;  5HOO A;  3AA4 A;  1K6Y A;  5ADX A;  1EET A;  3QLH A;  5KTQ A;  1VSI A;  1C0T A;  1FKP A;  3BGR A;  3VN5 A;  5HL7 L;  4PKI A;  1JCG A;  3U9Z A;  1RT7 A;  1TGO A;  4ISF A;  2ZGZ A;  2RE2 A;  5HRR A;  3ZX2 A;  3SUO A;  4CIE A;  2G8V A;  1NJY A;  4CFB A;  4F3O A;  4BRL A;  2Q0U A;  1I39 A;  1ATR A;  1L3S A;  3OJU A;  1KXP A;  2IVN A;  5KPT A;  3KLI A;  4JI0 K;  1A5V A;  1VQP N;  2GEM A;  3MEG A;  4CZL A;  4KKO A;  4NXN K;  4K8Z A;  3ULD A;  2UYT A;  3F73 A;  4IOX A;  4NYN A;  4AHT A;  4X65 K;  3AO2 A;  4U67 L;  3OW2 M;  3BUZ B;  4JK9 A;  1JCF A;  4JKG A;  1KVC A;  2PFU A;  1WAF A;  2D0P A;  3HXM A;  1QSS A;  1VSE A;  3DXK B;  3A5L C;  4IEE A;  4OX9 K;  2IVP A;  3TAR A;  4OGE A;  4E7K A;  4G9Z A;  3QBW A;  3PY8 A;  2R7Y A;  3V9U A;  3EN9 A;  4CEQ A;  1RDC A;  1C6V A;  1N8R O;  1DGK N;  4H8K A;  5M1F A;  2HBL A;  3F9K A;  3ZSR A;  4AHS A;  5J2N A;  1OH8 A;  1XUP O;  4B3R K;  3A5M C;  3E9L A;  4CF8 A;  5F1X A;  5LJV A;  4JLH A;  4HUE A;  1CXU A;  3TSQ A;  1JLF A;  4X62 K;  3PO4 A;  2DFE A;  3CM5 A;  4AHR A;  1HNX K;  1GLC G;  1NGE A;  2G8K A;  1S3X A;  4FPA A;  5AQP A;  4O0I A;  4WYB A;  4DV7 K;  5AFU H;  4DQI A;  4FWL A;  1SZ2 A;  1ZYQ A;  4DF8 A;  3JS6 A;  1JJ2 M;  2NRT A;  3E9P A;  3D45 A;  4DHY A;  2FC0 A;  3HI0 A;  3HTV A;  4B8C A;  4AHV A;  4RCH A;  3THY B;  4M41 A;  4MQ3 A;  1QE1 A;  1ZBI A;  4FLY A;  3O4N A;  5KPR A;  3QFP A;  1YT3 A;  4FW1 A;  3KWG A;  4BAC A;  1VQ9 N;  4PL8 A;  2IAJ A;  4DLE A;  4F2R A;  1YJ9 N;  2FLO A;  3ENO A;  2AJQ A;  2O8C A;  2YJE A;  1LCU A;  2YI1 A;  3DI6 A;  4X64 K;  5F2R A;  2VGN A;  3ULE B;  1C0U A;  4RG8 A;  4FM0 A;  3L2W A;  5BPN A;  1U49 A;  3AO3 A;  3OYA A;  1VQ7 N;  2G8I A;  1QZ6 A;  2HVH A;  2P9S B;  4PHT X;  3KJV A;  3CF5 L;  1RT2 A;  3BY5 A;  4CEB A;  1DTQ A;  4B3M K;  4WQ4 A;  3J7Y P;  3NVM A;  3D2E B;  4ID1 A;  1UOC A;  4IXC A;  1N34 K;  5AQS A;  3S9H A;  3SQ1 A;  3M5R A;  4DV0 K;  3OYJ A;  3CCQ N;  4JKH A;  2E2O A;  4QAG A;  4CJQ A;  3R1X A;  3P38 A;  5BR8 K;  3L8B A;  3NF6 A;  2ZD1 A;  3TTF A;  2Y1J A;  3BZK A;  3GE1 A;  3L3U A;  3WUH A;  3H1Q A;  5DK5 A;  3FZH A;  1OH5 A;  4CBU A;  3CJB A;  2Q36 A;  4FZY A;  3F5T A;  1EP4 A;  2QEX N;  1QS4 A;  3IS9 A;  4CZJ A;  2J4R A;  4BRG A;  4I2Q A;  3C94 A;  3O6W A;  4WFB L;  4DTO A;  5AZJ B;  1TYQ A;  3VES A;  4F4K A;  4KO0 A;  3ZET B;  3HOT A;  4FWQ A;  3V9Z A;  3QFU A;  5AQT A;  2YV0 X;  3J81 O;  2DFF A;  3LWL A;  4E7L A;  1BA0 A;  3THW B;  1VQO N;  3I8B A;  1CZA N;  4KH5 A;  1LOT B;  1WAJ A;  3UKU B;  4ELV A;  3ZSY A;  3TAN A;  1DKG D;  4JAX A;  4YOY A;  1HQE A;  5JIC A;  4BRP A;  4LF5 K;  3CM6 A;  3O9U A;  2PYL A;  3K5L A;  3DLB A;  1IKV A;  4JD2 B;  3LM9 A;  1ZBH A;  2YCH A;  2OZM A;  4NYF A;  4DV3 K;  4KHU A;  3AVM A;  5B8H A;  1Z26 A;  3MEC A;  3WXK A;  2HOE A;  1Q81 O;  2GEL A;  3NMU A;  1HYV A;  3CC2 N;  2HHT A;  4A59 A;  4B9N A;  1BI4 A;  3OBW A;  5FRM A;  1X3N A;  4DQ8 A;  3KTQ A;  1S6Q A;  5BRH A;  2W6K A;  3G4S N;  3LP2 A;  3RSE B;  2NRR A;  1S22 A;  4OKJ A;  5K14 A;  4PQU A;  4DV1 K;  1NK5 A;  3U9D A;  1IKW A;  1JXB A;  1XI1 A;  1HRH A;  5IWA K;  3VTH A;  3FFK B;  3H3O B;  3KKR A;  3CPE A;  4E3S A;  3SLC A;  4DS5 A;  4H0Y B;  1T6D A;  1NKC A;  1BL3 A;  1VSM A;  3LDL A;  2O8B A;  2PYJ A;  3P4I A;  1VSH A;  3W3D A;  3MWT A;  2IVO A;  1GLD G;  4BRM A;  1QHT A;  4FWR A;  2JWL A;  3BEX A;  1K8K B;  2V7Z A;  4JKB A;  3KK3 A;  3WXI A;  4HTL A;  3V1Q A;  4AHC A;  1F21 A;  5EY4 A;  2ZQB A;  3OA9 A;  2B6A A;  3CG7 A;  1BQM A;  3TTD A;  3KVG A;  1ATS A;  4LFB K;  2E2Q A;  1HUX A;  4DV2 K;  4B9Q A;  5CHI A;  4CZF A;  4M3R A;  3RR7 A;  3ZSX A;  3L4Q A;  4FJH A;  1BIS A;  1IBK K;  4BE2 A;  2NRH A;  5AQR A;  4A62 A;  1B9D A;  4FM2 A;  2HHX A;  1BUP A;  1GOB A;  1BGX T;  1JLE A;  1JL1 A;  2A3Z A;  4OJR A;  2P9L B;  3AVI A;  4BR9 A;  3SMP A;  3TTC A;  3B6P A;  4GNI A;  4N5S A;  2A42 A;  1Z6R A;  2P9P A;  1HQU A;  2P9K B;  3VF2 A;  3R9P A;  3EEQ A;  4Z4E A;  4FOI A;  2FXU A;  2QWN A;  1XWL A;  2I7P A;  1X3M A;  2I5J A;  2RHK A;  3DRS A;  4CHQ A;  3M6G A;  4DTM A;  5C2D A;  3EY1 A;  2G8H A;  2EWS A;  2GWK A;  3D0P A;  2OA8 A;  3VQ5 A;  3N4P A;  3TSU A;  4DLG A;  1NJZ A;  5BRE A;  1U2V A;  2PY5 A;  3THX A;  2OPS A;  3A8Y A;  3OS0 A;  1LWC A;  1G99 A;  2E2P A;  4CHN A;  1TAU A;  1TUU A;  2HST A;  3E9O A;  5A2Q O;  1W9H A;  3O5B A;  3ZLJ A;  3CQY A;  4M63 C;  2VQE K;  1SQK A;  1SV5 A;  3BF3 A;  4C8O A;  4BC4 A;  4IFE A;  3JAM O;  3Q7B A;  3C95 A;  1WOQ A;  1VK0 A;  3TAG A;  3VPZ A;  4B1W B;  4I2P A;  5AQJ A;  4ELT A;  2UUC K;  1T44 A;  1ASV A;  1TAQ A;  3MED A;  3QML A;  4GMJ B;  1L3U A;  2HMP A;  4FJM A;  4CJF A;  1HKC A;  4OPK A;  3TR8 A;  3C6H A;  1HR0 K;  3O4W A;  1HX1 A;  3TAM A;  4BWM A;  1C0G A;  1S1V A;  3I0S A;  3QB0 A;  4FWP A;  5CY4 A;  4J8F A;  3E66 A;  1MWK A;  4A5A A;  4E7H A;  3PX4 A;  2FBY A;  4CGD A;  3BF1 A;  2Q0R A;  3KKS A;  2QKB A;  5FRN A;  4FJ7 A;  5LMN K;  2ZE2 A;  3NH0 A;  4FLT A;  4MDA A;  2W6L A;  3V1R A;  3SZ2 A;  1YF5 L;  3AVC A;  1Q9X A;  4YOX A;  3HZ6 A;  4LC9 B;  1C0M A;  3HL8 A;  3ZEU B;  3OYH A;  1EQY A;  5BPM A;  4E1M A;  2HNY A;  3TPQ A;  3CPW M;  4GV3 A;  4B9S A;  3TAP A;  3NFA A;  1E4G T;  3DM2 A;  1WSI A;  4FO0 A;  2WC9 A;  3VA3 A;  3H08 A;  2ITG A;  2GUP A;  2ZJR L;  5HBM A;  3OJS A;  3OYK A;  3L0Q A;  1HPZ A;  4YOU A;  5C10 A;  4N76 A;  1BA1 A;  4ILG B;  4RW4 A;  3KLE A;  2UUA K;  2WFB A;  3O08 A;  3MWP A;  4WQ5 A;  1VRT A;  4EHU A;  4WQ4 C;  1DTT A;  4BC3 A;  3WT0 A;  4K42 A;  1E4F T;  2D1K A;  2X6S A;  1VQ4 N;  2XRI A;  1RTH A;  1NK9 A;  3ENH A;  4DR5 K;  4F3T A;  1WSF A;  3G71 N;  4O5B A;  4EP5 A;  3AVN A;  3LDS A;  2VWB A;  1J9A A;  4CZM A;  3L2R A;  4K0K K;  3CMA N;  1TKX A;  4B1V A;  1FXX A;  1QQM A;  1NOY A;  1FW6 A;  4CGI A;  1VQ6 N;  1HNW K;  4BR2 A;  4KH6 A;  5AQK A;  3LP3 A;  3CFP A;  3AY9 A;  3VEX A;  2QTD A;  3FE1 A;  1IH7 A;  4NCA A;  4O44 A;  3G25 A;  4DTP A;  4FZZ A;  2QWO A;  3QIC A;  1RBT A;  3HOS A;  5GIP A;  4FK2 A;  4FWO A;  1GLE G;  3V81 A;  2I7N A;  4I6M A;  1NGD A;  1NBW A;  2Z1G A;  4LY7 A;  5KGW A;  5M1N A;  3DYA A;  5HP1 A;  4XH4 A;  3ZT1 A;  2YKM A;  1WLJ A;  3O9S A;  4KB0 A;  4DTX A;  1QSY A;  3E01 A;  3MX5 A;  4E19 A;  1JCE A;  4CED A;  3IRX A;  4BVP A;  4FLX A;  3S3M A;  3SCX A;  1RBR A;  1J5O A;  3QIO A;  3KLG A;  1LWF A;  3PX0 A;  4YOR A;  1YAG A;  4O8U A;  3LZJ A;  1JLA A;  2IIR A;  1Q7Y O;  1KFD A;  4OGC A;  5J2M A;  2UUB K;  3FFI A;  2GBZ A;  2OTJ N;  4W5N A;  3T69 A;  1WSH A;  3AO1 A;  3DWL A;  3MXM A;  2X74 A;  1YIJ N;  4HVJ A;  1HKG A;  3MN9 A;  5ADX H;  3U3G A;  1UA1 A;  1BO5 O;  2XHB A;  2CH5 A;  4HCB A;  4RTF D;  3H3N O;  5MLC Q;  1N6Q A;  3PIO L;  4CK3 A;  4DR4 K;  1RFQ A;  2D4W A;  3KIO A;  2Q31 A;  1SL2 A;  1FKO A;  2E6L A;  1BDG A;  4CFD A;  3OVN A;  5BPL A;  4LH4 A;  1VSJ A;  3MDQ A;  3LDO A;  4LF4 K;  1HKB A;  2WTU A;  4JV5 K;  2BAN A;  4CK2 A;  1CLQ A;  1O13 A;  3A5N C;  4I7F A;  5DM7 L;  4WCE L;  3RRG A;  4RW7 A;  4Z4H A;  5JVH L;  4EIA A;  3KD5 E;  3JXU A;  2ETJ A;  4B9U A;  4H4M A;  2IS3 A;  3DRP A;  2KFZ A;  3ZSQ A;  1NLV A;  1RT1 A;  1VQK N;  3AAQ A;  5JLH A;  2E1Y A;  4HUF A;  2YKN A;  4FVU A;  4Z4G A;  4CI6 A;  3VTI A;  1QVG M;  3G6E N;  2QK9 A;  4CJ7 A;  2KTQ A;  5KRT A;  1NMN A;  1XHZ A;  5EX5 A;  3OS1 A;  4DR3 K;  1GOC A;  4Z0U A;  4PKG A;  1IKX A;  2FF6 A;  1VQ8 N;  2QWQ A;  1C1A A;  3J80 O;  1EX4 A;  4JYA K;  3HSC A;  3SUP A;  4BRC A;  4DMN A;  3DXK A;  4M3X A;  4FCY A;  3HP6 A;  5H1S Q;  1S5J A;  1P8Z A;  2YNF A;  1U6Z A;  2XY8 A;  1DLO A;  5AQI A;  4CZE A;  2QWL A;  3SV3 A;  2D0B A;  4A5B A;  5SZT A;  4KI6 A;  2P5G A;  4DR2 K;  2Y1I A;  1ZBS A;  5AQN A;  2P1J A;  1ZBU A;  4DS4 A;  4JKG B;  2V51 B;  4JN4 A;  4FWK A;  5M1K A;  5FPE A;  1RT3 A;  4MO5 A;  3UKR A;  3C0B A;  2HBK A;  4YNQ A;  4M3W A;  5LJW A;  5AJ3 K;  2A1R A;  4B1Z A;  3PV8 A;  4FZX C;  3NF9 A;  1GLA G;  1Y97 A;  3M8Q A;  2ASP A;  4DFK A;  4BDP A;  3O3G A;  4DFJ A;  1HJO A;  4AM6 A;  1L5U A;  1C0F A;  3ASM A;  3KLH A;  2PBD A;  5FPD A;  4OKE A;  4GW6 A;  4NLB A;  1VQN N;  4OKK A;  3OYF A;  5DMR A;  4AH9 A;  3D2F B;  5AQQ A;  1TVR A;  1MA9 B;  1GOA A;  3ULE A;  1ZBF A;  1ZBL A;  4JK8 A;  1WUA A;  1RT6 A;  5KQ8 A;  2KLA A;  3L2U A;  2HBM A;  3KHY A;  3GDQ A;  4UQG A;  1BHL A;  4GV6 A;  3AVF A;  3HO1 A;  1KTQ A;  4OPA A;  2HBJ A;  3HPO A;  1BU6 O;  4ZTJ A;  3CXC M;  3O3H A;  2YHB A;  4N41 A;  3EZW A;  1XC9 A;  1NK4 A;  5C12 A;  2OPR A;  4K41 A;  1TUY A;  4FJN A;  1LW2 A;  2VG7 A;  3RMB A;  4CF0 A;  4CHO A;  2O8C B;  1RNH A;  1XC3 A;  2BUP A;  4FJX A;  4KHS A;  3PLA A;  1MDU B;  3K2P A;  3P5J A;  3OYB A;  2D0C A;  2ZM6 K;  1O1W A;  3O80 A;  2OPQ A;  4DR7 K;  1ITG A;  1NG9 A;  3AA5 X;  5C0Y A;  5GAE P;  3AVL A;  4I9Q A;  4M3Y A;  5GIO A;  4EP4 A;  1EWQ A;  1OVY A;  1V4T A;  5C25 A;  3CFO A;  1KAX A;  4BG8 A;  4H03 B;  5AZJ A;  3SJJ A;  1REV A;  4GKK K;  3L2V A;  3SAG A;  1OH7 A;  4WQ5 C;  3ZCM A;  2O8E B;  2E8A A;  3DLR A;  3OYE A;  1KRP A;  2QM1 A;  4JRQ A;  4DSI A;  4M7Y A;  4BE1 A;  2FSJ A;  3OYN A;  2VGM A;  2DTU A;  5AQM A;  4E1N A;  4QS9 A;  3CFR A;  2O8D B;  3DRR A;  2E4L A;  3ATV A;  3FGU A;  3ITH A;  3U4L A;  1RBV A;  5AQY A;  3O1B A;  3WNH A;  3DXM A;  3V9X A;  2E5L K;  1BCO A;  3NHG A;  1UAX A;  3VER A;  1W2B M;  5AQW A;  1K9M O;  3I8D A;  2HHH K;  1XHX A;  3A2F A;  4CZG A;  4DTN A;  2IDO A;  4JI3 K;  3AAR A;  1UWB A;  3LAN A;  1Q9Y A;  2BDP A;  2QI2 A;  3HYF A;  2HHV A;  1HNV A;  3SPY A;  3VF6 A;  3J7A P;  3CCM N;  2AP1 A;  4DTS A;  4LSN A;  4IWV A;  3RSE A;  2EHG A;  3VEW A;  4CVN E;  3MK6 A;  3BZC A;  2YJF A;  1D5A A;  3WEE B;  2NZT A;  4CK1 A;  3VQD A;  1D9F A;  3V9W A;  5F0X A;  2FSK A;  4J2B A;  4MLE A;  1SL0 A;  1NJX A;  3V1O A;  2F4V K;  5GAD P;  3IKM A;  4FW2 A;  5TKY A;  4JI7 K;  3LP0 A;  2XY7 A;  5EU7 A;  5JVG L;  3IFR A;  4Z4F A;  1YIT N;  1SKR A;  1BI4 B;  3K5O A;  3OTO K;  3ZX0 A;  3O8M A;  1K8K A;  4CJP A;  1RT4 A;  5BRD A;  1SKW A;  4LF9 K;  4JI1 K;  2OPP A;  3QEP A;  3TI0 A;  4BY9 C;  5KPZ A;  4JKC A;  1KD1 O;  2B4J A;  3OHR A;  3VQ9 A;  2BE2 A;  3R3L A;  3KK1 A;  4C8K A;  1OVQ A;  3AVB A;  3LZI A;  4JS5 A;  1J5E K;  1JLB A;  5I9E B;  1C1C A;  4MDB A;  4RW8 A;  4LF6 K;  1WBD A;  2P9U B;  3H1V X;  2F9W A;  1XNR K;  5EXW A;  2P9L A;  5AQZ A;  3O1W A;  4CGF A;  4W5R A;  1TKT A;  4IDH A;  4QS8 A;  1NGA A;  3NH1 A;  3HBT A;  4Y1C A;  4KHY A;  3CQ8 A;  3ID6 A;  4DV6 K;  3SPZ A;  3VEZ A;  4ISE A;  4E7I A;  1JL2 A;  1KCF A;  4B9L A;  4EFH A;  5AZI A;  1SL1 A;  4X66 K;  4PL7 A;  4CJ3 A;  2E2N A;  4OO1 J;  4NO7 A;  4OPJ A;  3TAB A;  2VG5 A;  3CC4 N;  1NGJ A;  2GX9 A;  3FR0 A;  4BRO A;  4FJL A;  1TKZ A;  5LL6 Z;  3UB5 A;  4FXD A;  4BRH A;  4G1Q A;  3HP9 A;  2QXF A;  3AAP A;  3VOV A;  3JYT A;  2XO7 A;  4H4O A;  3FZL A;  5HRS A;  4FLW A;  4J2E A;  2P9N A;  4HUG A;  1NKB A;  5LY3 A;  2GUI A;  1TV6 A;  3THV A;  1TKD A;  3QNO A;  3AA2 A;  3M8S A;  2IC3 A;  3HST B;  3DLG A;  4W5Q A;  3I55 N;  3AGR A;  2IGI A;  4JNE A;  3WNF A;  4DQQ A;  1RCH A;  4DSF A;  1YJW N;  1A5W A;  4V19 S;  1H1V A;  2P9I B;  4BC2 A;  1Q8I A;  3QES A;  3VEV A;  4FWS A;  4PY5 A;  5C24 A;  4AHU A;  3THX B;  4KPY A;  4BRD A;  3VQA A;  3DOL A;  2DFH A;  1N5Y A;  5HRP A;  3IUC A;  2Z1H A;  2ATQ A;  4CFA A;  4YOW A;  3VQE A;  4ZHR A;  4CJ5 A;  4FJK A;  1RDU A;  4FPB A;  1UA0 A;  1BCM A;  3E1Y A;  4H0X B;  4Q5V A;  1EXQ A;  2OCE A;  4JRP A;  2FF3 B;  1KVB A;  3RVC A;  3SBT A;  4B1U B;  3F2K A;  2ASO A;  2YHW A;  2Q1N A;  1WB9 A;  5FLX O;  4B8A B;  3T7Z A;  4FM1 A;  1OKJ A;  4KHQ A;  3AA3 A;  3EYZ A;  4IFV A;  1LAV A;  2KKZ A;  5BR9 A;  1OH6 A;  5AQH A;  4BDZ A;  4BE0 A;  3OBY A;  3C7N B;  2HW3 A;  4DUY K;  4NCG A;  3I0R A;  3VQ6 A;  4CD1 A;  3NF8 A;  2V7Y A;  1Q18 A;  4F9O A;  4FYD A;  4CJ4 A;  3VQQ A;  1KAZ A;  3TU5 A;  2CGL A;  3O9T A;  1S1U A;  3S3N A;  4QCL A;  1WSE A;  2FSN A;  3PO5 A;  4YHH K;  2UXD K;  4FWM A;  3JSM A;  4JKF A;  3VQP A;  4KAZ A;  3S3O A;  1S72 N;  4CGH A;  1LW0 A;  3OYL A;  3CME N;  4QOZ B;  1Z25 A;  1YXQ A;  3OYM A;  3CER A;  2KZZ A;  1EKE A;  3M3Z A;  4JHD A;  1W97 L;  1YVN A;  4DSL A;  4Z94 A;  2Z1J A;  3EO3 A;  1ASU A;  4CEC A;  3ZSO A;  1RDA A;  3HK2 A;  4CER A;  4BGA A;  2QA4 N;  5C2F A;  4KTQ A;  5CR4 A;  4C8M A;  1W7A A;  3WXJ A; 
#chains in the Genus database with same CATH homology
 1N32 K;  4DUZ K;  4YY3 K;  3J80 O;  4JI4 K;  4V19 S;  4JI7 K;  4DR1 K;  4JYA K;  1HNZ K;  5LMN K;  4B3R K;  4GKJ K;  2ZM6 K;  3OTO K;  4LFB K;  4DR7 K;  4DR6 K;  4JI6 K;  4DV2 K;  4LF9 K;  5LMU K;  4X62 K;  4JI1 K;  4AQY K;  1IBK K;  1HNX K;  1N36 K;  2UU9 K;  3J81 O;  4DV7 K;  4GKK K;  1J5E K;  1XMQ K;  2UUB K;  4JI8 K;  4DR2 K;  1IBL K;  4KHP K;  4LF5 K;  4LF6 K;  1XNQ K;  1XNR K;  4LFC K;  4B3T K;  4DV3 K;  5FLX O;  2UUA K;  4DV4 K;  2E5L K;  4DR4 K;  4NXM K;  5AJ3 K;  4X64 K;  1XMO K;  4DV6 K;  2UXB K;  2HHH K;  4DUY K;  4JI5 K;  4JI3 K;  4LF4 K;  5A2Q O;  4X66 K;  5IT9 O;  4JI2 K;  4DR5 K;  4JV5 K;  2UXC K;  4DV5 K;  2VQE K;  2VQF K;  4JI0 K;  4DV1 K;  4B3M K;  3J7Y P;  1I94 K;  3J7A P;  3JAM O;  1N33 K;  4NXN K;  4YHH K;  5LL6 Z;  5IWA K;  1N34 K;  4K0K K;  2UXD K;  4DV0 K;  5BR8 K;  3T1Y K;  2UUC K;  4X65 K;  4B3S K;  4CVN E;  1IBM K;  4LF8 K;  1HNW K;  4LFA K;  3T1H K;  1HR0 K;  4CW7 B;  1FJG K;  4LF7 K;  4OX9 K;  2F4V K;  4DR3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...