4X62K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4x62K00
1N32K 1HNWK 4YHHK 4DR5K 4DR7K 1N36K 1XNRK 4JV5K 4LFCK 4DR3K 4X66K 4LF9K 4OX9K 1HNZK 2UU9K 4B3RK 4NXNK 4DV7K 4LF5K 4V19S 1IBLK 3T1HK 4LF6K 3JAMO 4JI3K 4JI7K 2UUBK 4NXMK 4DV5K 3OTOK 2F4VK 4AQYK 4B3SK 5FLXO 5LMUK 4DR1K 5A2QO 1HNXK 4DR6K 3J80O 5IT9O 5LL6Z 4DV4K 3J7YP 4LF7K 4B3TK 1XMQK 5LMNK 4JI6K 4DV1K 1N33K 4DUZK 4JI0K 4DV0K 4X62K 4JI4K 4JI8K 2ZM6K 2UUAK 4YY3K 5IWAK 4X65K 1IBMK 2UXCK 4LFAK 4JI2K 2UUCK 4DV3K 1N34K 5BR8K 1J5EK 4DR2K 2VQEK 4DUYK 3T1YK 3J81O 1I94K 4LF8K 4B3MK 4DR4K 1FJGK 4DV2K 5AJ3K 1IBKK 2HHHK 4CW7B 4JI5K 2E5LK 4DV6K 4X64K 2UXDK 2VQFK 4LFBK 1HR0K 3J7AP 4CVNE 4JYAK 4KHPK 1XNQK 4GKJK 4LF4K 4K0KK 4GKKK 4JI1K 1XMOK 2UXBK
chains in the Genus database with same CATH superfamily
3P83D 2FBVA 2V52B 4O4GA 4CZHA 4UQGA 5BRFA 5KGWA 3RSEB 3T19A 1U04A 4KHNA 3ZSOA 3O9TA 2XY6A 3VENA 1EX4A 2UYTA 3BZKA 4OX9K 5EU7A 3DJCA 2UU9K 1E3MA 2O4GA 4DV7K 3CFOA 3THYA 1X9SA 3DAWA 3NF8A 3QICA 1JLQA 3KZBA 4K8XA 1TYQA 2QWNA 3VGKA 4OKEA 2IIRA 2FSJA 3SQ2A 4BRIA 4Z4FA 5GAEP 3ZT2A 4IG0A 3KWGA 4CGIA 2WFBA 1X9WA 3N4PA 1RGIA 4KO0A 3AA4A 5J2NA 3E9LA 3DLHA 3SAHA 5TKWA 1BDGA 2P9UA 2YKNA 3NF7A 3MMVA 3K2PA 4PA1A 4DU3A 4AH9A 1WAJA 2QWQA 3CCQN 1QZ6A 4KI6A 4CZEA 1KXPA 2GEMA 4OPAA 5HRPA 1J5EK 2Q0UA 1VK0A 4DUYK 3THXA 4DS5A 5BRHA 2ETJA 4IZ9A 3OYBA 1NBWA 3MXIA 1W0HA 2IDOA 3PX4A 3NVKA 1Y64A 4CGHA 4IJAA 3ULEB 4E7IA 4XH4A 3B8AX 1IKXA 4DSJA 4FZZA 2FSNA 5C0YA 4H4OA 5D3GA 2HBMA 3WQUA 3TTFA 4CIFA 2VQFK 5BREA 1M90O 4BROA 4FM2A 1QHAA 4JS4A 4FJ7A 4CZFA 4FWQA 3U9DA 5AQTA 3G71N 3AVMA 3H1QA 1CZBA 3ZSRA 3TAPA 3CCJN 3HVTA 1SKRA 1UAXA 3HPOA 1NGGA 1IO2A 2V7YA 3RRGA 1NU0A 4EHUA 3EY1A 3G25A 4IFYA 3GE1A 3TSPA 3ZSWA 2YHBA 2W42A 3QESA 1SQKA 3OYDA 2HHWA 1BIZA 1C0TA 2D0AA 4BRQA 4DFPA 1EKEA 3T1HK 4H5NA 3QFUA 1WSJA 1RT6A 1TAQA 3NBPA 3MDQA 1JLEA 3CPEA 1X9JA 2P5OA 3KTQA 1KD1O 1K8KB 5LL6Z 4KHQA 3GL1A 3KKSA 4ZTFA 3A2FA 5JLHA 1RDWX 3EZWA 3P39A 4HUGA 4IWVA 3ITHA 1NGEA 2YKMA 3VOVA 1NJXA 4K43A 3OS0A 3VEVA 1ASWA 4CGGA 1JLGA 3OS1A 3H45C 1VSMA 3CIPA 4B1WB 1JLCA 3AO5A 1HYSA 1ESVA 1LWFA 3E1YA 2VGMA 2D5RA 3QERA 3I0SA 1S6QA 2R7YA 3VEOA 3A5OC 2ITMA 2XO7A 4DR2K 4CFCA 3V1QA 3FZFA 1K6YA 2FXUA 3CQYA 4FK4A 3CCLN 1B9FA 1C6VA 1T03A 3FGUA 2P5GA 3CYMA 3QBXA 3M5RA 2ZQBA 3DXMB 1YXQA 4J8FA 4CJWA 4EP5A 1HYVA 1HPZA 3O80A 1ZXOA 4X64K 4HUEA 2J4RA 1K8AO 4CHYA 1TL3A 4ISEA 4PY5A 3TWHA 3WQTA 1RDUA 3C6UA 3UE5A 1T05A 4ELTA 4KTZA 3QFPA 3CF5L 1VQNN 2D0CA 1U47A 3A0IX 2ZWHA 1N32K 3IS9A 3ZLJA 3AVIA 2QWLA 3DLBA 4AF1A 1T6CA 5AQIA 5AQQA 1X1PA 3WXLA 3H3OB 3QNOA 2Q97A 1J5OA 1RBSA 4DSLA 4FW2A 2W41A 3KK2A 1GLCG 4CGFA 1JLFA 1Q7YO 1BISA 1W9HA 3VQ7A 4CHNA 3OBYA 3QIOA 1JL1A 3K58A 4DSEA 1Z05A 2GWKA 5AQKA 1HRHA 3SV3A 2BE2A 4CF8A 4RWTA 3PSIA 3SI6A 1Q9YA 1RCHA 4FLYA 5AQOA 3CJCA 2P9NB 4DFJA 1U2VB 2GUIA 4FPAA 2Q2RA 4XH5A 5KQDA 5LMNK 4DV1K 3DXKA 2OTLN 3FE1A 3AVLA 1G99A 4DTUA 1VSKA 3O1WA 4BR7A 4WQ4C 1OH7A 2KTQA 1NK8A 1DGKN 2OPRA 3ZETA 2ZM6K 4PQUA 1SV5A 1EWQA 1S22A 1NLVA 3PIPL 3RWUA 5IWAK 4X65K 4IBNA 3SUQA 3WEEA 2PAVA 4B9QA 2A1RA 1VSDA 3LWMA 2E2NA 5I3UA 2HB5A 4M3UA 2EWSA 2PY5A 2KKZA 3EL2A 1D8YA 4B1YB 5F2RA 3G6EN 1I3AA 1LOTB 4AHTA 4FK2A 3KHYA 3AVJA 4WE1A 3CCVN 3VEXA 1DTQA 3OYHA 4B9TA 4DS4A 5KPZA 3QEIA 3DRRA 4BRPA 4RW6A 4CVNE 4JYAK 5F1XA 3QETA 4GVMA 4CJ4A 3AVHA 3JSMA 2B6AA 3DOLA 1VSJA 3IMXA 1B9DA 2A40A 1CXQA 4EAHD 4CK3A 4FL9A 4CGJA 2X74A 2HBLA 4C8LA 1N36K 4F2RA 3F5TA 4C8NA 4CFDA 1BI4B 3FZMA 5HLFA 3LZJA 4WYBA 4H5RA 5JMVA 3PV8A 3LDQA 4EZ9A 3WNHA 4E1JA 4HCBA 4BR9A 5HP1A 2E1YA 4LH4A 5AQGA 3CI5A 1NK4A 3KKRA 2B4JA 3P38A 3QLHA 4H0OA 4DTRA 3NF9A 4BDYA 4Z4CA 5DMRA 3EZ5A 2ZJRL 3EKUA 4LC9B 2WOMA 2G8UA 2D0PA 1HLUA 2PFUA 5JICA 4O0IA 4CJRA 2G8VA 3L2QA 2O8FB 4FM0A 3QEXA 5FDLA 4FVMA 1NJZA 2ITGA 5AQPA 4FLTA 4GMJB 3CCEN 2AP1A 2OA8A 3C95A 1OKJA 4BQLA 4DTJA 4E3SA 3BF3A 2BDPA 1TV6A 5CE3A 1MA9B 4NYNA 1JL2A 4JKBA 3EYZA 2YX6A 2WUSA 3AVNA 2FF3B 2RF2A 2FSKA 4YOWA 4EZ6A 3M1FA 4I2PA 1U4BA 3VETA 4Z4HA 3SMSA 1BL3A 3P5JA 5JLFA 1Z6RA 3UKUB 4LFBK 2P9KA 4AHRA 5HROA 2OZMA 3EE9A 4YOTA 4KHSA 2VG7A 1NKCA 3I0RA 3IKMA 4BE2A 3EE8A 4GNIA 3F2KA 4BC3A 4IG3A 3NH0A 4OO1J 1NM1A 4JI1K 1QS4A 3LALA 3T7ZA 2OPSA 2VWKA 3LDOA 1OVYA 5CR4A 3UKRA 1YIJN 1J54A 1IH7A 2XY8A 4FLVA 3PO4A 3LDLA 2P9SA 3AAQA 1TGOA 5M1OA 4DR7K 2Q1NA 4JKFA 3NFAA 1ASVA 3BEXA 3R3LA 5K14A 3W3DA 1VQ8N 2HNDA 2BTFA 4QS7A 4F8RA 4B1ZA 4YNQA 1D5AA 5KQ8A 2NRVA 4LF5K 4B9SA 2QEXN 1NK9A 3VQ9A 3U3YA 3VGLA 5AQJA 3V6DA 4NXMK 2O8DB 3VGMA 1JXEA 4DR1K 2GBZA 3SQ4A 1QE1A 4WFNL 5IT9O 5CYQA 1JXBA 2F7TA 1RBUA 4M3TA 3HT3A 4NCAA 3D2EB 5SWMA 3K0SA 1W97L 1L3TA 4FYDA 4B9UA 3WT0A 5KPRA 2W40A 4CJSA 3SPYA 1LWEA 2YNIA 5HOOA 4OVLA 5AQXA 4AHSA 2UXCK 3HM8A 4RW7A 5EVZA 4DTMA 1MDUB 1ZBFA 4ILHA 1W2BM 4IOAL 2CH6A 3CJAA 4YDUA 3HP6A 4GVEA 3S3MA 4DV3K 3MAQA 3OYNA 4AHVA 4W5TA 4FJ8A 1Z26A 5FPEA 5KTQA 1S9GA 2O8CA 3KLGA 5KGXA 3ZX3A 2HNZA 1I94K 5J1EA 2NUBA 3L4IA 4KHUA 2OTJN 4OPJA 3VA0A 5M1QA 1ZBLA 1GOCA 1YJ9N 1K73O 4QAGA 3HO1A 1XQSC 3CETA 4OGCA 1FK9A 3J8AA 4CJLA 2ZGZA 3E66A 1IG8A 4RTFD 4W5NA 3V1RA 4C8KA 3PX6A 4F9OA 1T44A 3RMAA 2HBKA 2O8EA 1TKTA 3QNNA 4H8KA 4DWIA 1ASUA 3OYJA 4I6MA 4BG8A 1VQPN 3RTVA 3FZLA 3S41A 1S1UA 3TABA 4JD2A 1KVAA 4PKIA 1D4XA 4JHDB 4BRHA 4L8RB 1WBDA 4M42A 4H5VA 3P4IA 1S1TA 4M3RA 1OH5A 2PYJA 4CEQA 2E4LA 2HSTA 4U67L 2HOEA 4CF1A 2WONA 3LP3A 4A59A 1BGXT 4BRLA 3MN9A 5GAHP 1RT4A 1RT3A 3SNNA 2P9IB 3MXJA 3WXKA 5JS1A 4H0TB 2HVHA 1Z25A 4DHYA 5AQLA 1B92A 3O9QA 1VQON 4NCGA 1L3VA 4DV4K 3VQ4A 4FM1A 2CGJA 3J7YP 2I5JA 1WSIA 4FSVA 4JK7A 1OH8A 3CM5A 1NJIO 1YHQN 3RMDA 5AZIA 1A5VA 3C0BA 3CQ8A 2OYQA 2NRZA 5GIOA 4NLCA 4DLGA 3K5LA 4YY3K 2EX3A 3DMJA 2QWOA 4F3OA 4IEEA 1TVRA 3MN5A 4CHOA 3RMCA 3AVCA 3E9PA 4ISGA 3CD6N 2NNWA 2P51A 3DLGA 2O8BA 1DT9A 3ENHA 1ATRA 1N34K 1ZYQA 1RTHA 4IFEA 2KZMA 3NMUA 4JK8A 4H5TA 3O8MA 1XC3A 4WFAL 1C0MA 5BR8K 1C0FA 4HHTA 1SL2A 1MWKA 3EKSA 2PYLA 2QA4N 3R6MA 5M1PA 5AQVA 4H0PA 3J81O 3MEGA 3RVCA 2JLEA 4JKCA 3RRHA 4A2BA 2DY4A 1O1WA 5AJ3K 3VQPA 3D6RA 4B9VA 5E26A 1TK8A 4DTSA 1NK0A 1NMDA 3L3VA 2YHXA 4EP4A 1Q82O 2UXDK 3ZEUA 3MXMA 2HHTA 3HXMA 4KHYA 1RT2A 1BOTO 4B3OA 2G8IA 1XWLA 1S1XA 2GUPA 3VEYA 1HMVA 2YHWA 5F0XA 4CEDA 4IDKA 2RHKA 4N41A 1V4SA 3LAKA 3U8XA 3H6EA 5EX5A 3NF6A 5KRTA 1WUAA 2HMPA 1XNRK 1NOZA 3OYAA 3LZIA 3HPHA 4FWRA 2HF3A 4KBOA 4CCHA 4M45A 1KTQA 2CGLA 2D1KA 4EHTA 2ZE2A 4GV9A 4DSKA 5FPNA 3KLEA 4CEBA 3OA9A 3DLKA 4CF0A 1T7PA 4LF6K 2P9PA 4CJVA 4I9QA 2ASMA 3AGKA 1JCFA 3AA3A 3S9HA 1QQNA 3J80O 3SUNA 5DM6L 1SS6A 2ATQA 3TAMA 4CZGA 4LF7K 3TSUA 4FJMA 3PX0A 1ZBUA 3QDKA 1QSYA 3DI6A 5AZJB 3WXIA 4CZLA 4KTQA 4KB0A 2E20A 3KWIA 3RSEA 4HTLA 3WNEA 1NNEA 5E41A 4CJKA 3O3FA 3FZHA 3BGRA 4JRQA 5EXWA 3U6FA 4ID1A 3RMBA 1S5JA 3ZETB 4O5BA 3HP9A 2HHVA 4CIGA 1KC8O 5KPTA 2QWRA 5BPMA 1NGDA 1NOYA 4ICLA 1EWRA 1JCGA 1O13A 2E5LK 3CJ7A 1JCEA 3F9MA 3CCSN 1C0UA 1S3XA 3NGYA 3VERA 4EFHA 4ELUA 3AVGA 3FFIA 1XNQK 3SAFA 3PLAA 4CECA 4YDUC 2IS3A 5AQMA 1RDBA 1TK5A 3ATUA 2D0OA 3DLRA 4CJFA 4BG9A 1LV5A 4CEZA 4CBUA 2RPIA 4JKGB 4BRGA 4BQZA 2F8SA 1M1KO 2HF4A 3AARA 4FJIA 3ZSZA 4ZHRA 4TSXA 3N4QA 2Q31A 1QHTA 4QS9A 3ULEA 4JI7K 4PKGA 4Y1CA 4E89A 2F4VK 3VQAA 5C2FA 1KAZA 1KVBA 4DR6K 4ID5A 4Y0WA 1E4GT 2YCHA 1DEJA 4CHZA 3K9JA 2XHBA 2HW3A 1WAFA 1RILA 5AFUA 2VG6A 3ZCMA 4JLHA 4WFBL 4FJKA 4PUOA 2QKBA 4Q0BA 1ATNA 3HOTA 1UWBA 5MLCQ 1BQNA 3Q7CA 3ZT4A 1RBTA 1QSSA 4MDAA 5M1KA 2A42A 3P31A 1QZ5A 4BR4A 4CJUA 4W5QA 2G8FA 1G15A 1YTUA 1YAGA 1KQSM 1QQCA 1U49A 1IV0A 1WSHA 2GV9A 3ZT3A 2E88A 1YUWA 1D9DA 2E8AA 4ELVA 3OJSA 2E1ZA 4BWJA 4CIEA 3MN7A 3SAGA 4BVPA 4C23A 3THWA 3OVNA 4IO8A 4CF2A 4Z4GA 3D7EO 5KRSA 3CFPA 3FFKB 1VRUA 2FLOA 3TAGA 1K8KA 2E2QA 3ZT0A 3GDQA 3FZKA 3MX2A 4FVUA 5LJWA 3NGZA 4FJ9A 1RDCA 1JLAA 3D2FB 2KW4A 2Z1HA 1MWMA 1DTTA 3HM9A 3UIQA 4KAZA 2W6KA 4C1NK 3LL3A 4K42A 1TUYA 2HHQA 3VQDA 3VMFB 4CJPA 1V4TA 4H4MA 4FJNA 5BR9A 3ASMA 1VHXA 4OLBA 1K9MO 3C6AA 1GLDG 3HPGA 4KI4A 4NLBA 3A8YA 3OHRA 3PIOL 3DM2A 3MX5A 3TU5A 2YHYA 3TSQA 1TAUA 3ZX0A 1WSFA 1RFQA 4JKHA 1IKWA 4E1MA 1HNZK 4B8AB 4DG1A 5BPNA 1QVGM 3SQ1A 4JI3K 3SUOA 4CEAA 3AA2A 3IFRA 1GLEG 3O4QA 5TKYA 4BY9C 3THVA 3KK3A 5B8HA 3HOSA 3TI0A 3V4IA 4DV0K 3T3FA 2OCEA 2NLXA 1NGIA 2W6LA 4BR0A 2GTDA 1BUPA 1BO5O 4RW4A 4KPYA 1GLFO 4MDBA 4FLXA 3A5NC 1HNVA 4LFAK 1JKHA 4FJGA 4A2AA 3SBTA 1HQUA 3EEQA 3HL8A 4OPKA 3HYFA 2FBTA 4FWMA 3LDPA 5AQZA 3R9PA 3HZ6A 4J2EA 1CZ9A 4W5OA 3D45A 4CESA 1SZ2A 3E01A 3LP2A 3ZSVA 2GX9A 2E2PA 1A5WA 2P9LB 2P9NA 1VSLA 1U2VA 4DB3A 1XHXA 5CYMA 4FJHA 2E2OA 3SK3A 4CE9A 2BH1A 4CHPA 2O4IA 3CQXA 3O3HA 1U6ZA 3MK6A 1WB9A 4O5FA 1C0GA 4CF9A 3GOIA 4KTWA 5ELZA 5HBMA 3QMLA 4HCCA 4FK0A 4CBWA 2A3ZA 3J7ZO 4CI6A 1NJWA 2XRIA 1Q86O 3HSTB 4FOEA 1RNHA 2QW9A 1R0AA 2YNHA 2O8CB 4U7BA 1YF5L 3MECA 1S6PA 5C10A 4DQIA 3CCRN 3CM6A 1NGAA 3L2UA 2G8KA 3OYIA 3DOKA 3KLFA 4FJ5A 4IXCA 2VWJA 2V51B 4OKKA 1T6DA 3ALYA 1YITN 2B5JA 4FW1A 4EIAA 4GW6A 4ZTJA 3VEWA 1BU6O 3DRPA 4ILJA 4B3RK 4H0XB 4LSLA 2E6LA 3JAMO 3OYKA 4CZJA 1LCUA 4B3SK 2VYPA 5FLXO 1HNXK 2A41A 3G10A 1QVFM 3LM9A 3BY5A 1C1BA 2FF6A 2QTDA 1ZC6A 4IOXA 4Q5VA 3QB0A 2PZSA 3DWLA 5CY4A 3SJHA 1GOBA 5CZ1A 4DQSA 1JLBA 3IG1A 4BDZA 3B6OA 3NE6A 4BGAA 4BRFA 1BA1A 3O08A 5E84A 1R59O 4BRNA 1P90A 1WSGA 1Y97A 3K5OA 3V81A 1BI4A 4CJ5A 1S1WA 3HVRA 2Y1IA 4FWNA 5C25A 4RG8A 3OBWA 4CJQA 4XEIA 1HJOA 2RE2A 5I9EB 4YOUA 2YJEA 5FROA 3ENBA 4I7FA 5H1SQ 3K5MA 2VWBA 4CD3A 3C6HA 4IEIA 3HSCA 3FR0A 4A5BA 3THYB 4M3YA 1LAWA 1TYQB 1YT3A 4WF9L 1HKCA 4JI5K 3TPQA 1BHLA 2X78A 3PSFA 3E9OA 2O8BB 3OYMA 2RN2A 3MEDA 2A5XA 5T7BA 3K57A 4BRAA 3KVGA 5HRNA 4KFBA 2O8FA 1NKBA 4LF4K 4CGDA 3NGIA 2QK9A 4I9LA 4FJXA 4M3ZA 4LH5A 4BC5A 3GG4A 1ILYA 2ASPA 4FLZA 4CEEA 4FPBA 3IDHA 4O8UA 3RR7A 2P9UB 2CH5A 1E4FT 1N6QA 1UA0A 3O4NA 3PUFA 1FXXA 3DYAA 1OH6A 2YNFA 4NCBA 3BUZB 5GADP 5J2QA 1Q18A 4LFCK 4A5AA 1T8EA 1CXUA 4IOCL 3BDPA 4RW9A 4MFBA 1ATSA 2H3GX 3KLHA 1X9MA 1IG9A 1FKOA 4JEPA 1KVCA 3LDNA 3THXB 1BA0A 3OYGA 3CC7N 3ID8A 4OKJA 4CERA 3B6PA 4DCHA 4F3TA 2X6SA 3UKUA 1D9FA 3AO3A 2OPPA 3O9UA 3VEZA 4AHCA 3DLEA 1HPMA 3F9KA 3I55N 4DU1A 3V9WA 3MEEA 1P8ZA 4G1QA 4PWDA 4DFMA 3L4QA 1EQYA 5GINA 4DTPA 5FPMA 1YVUA 3NH2A 4PL8A 3WXJA 2PBDA 4JKDA 1BIUA 1RT5A 1MU2A 3CG7A 4BVOA 3V9ZA 4C8OA 3IRXA 4M3WA 3L2RA 4N5SA 2EHGA 2G8HA 3O1BA 5SZTA 1FKPA 4M7XA 3AAPA 1VQ5N 1GLAG 2IC3A 2FBXA 4FO0A 1NK5A 1T3VA 4E7KA 1SL1A 3L2VA 4B1XB 1ZBHA 2IGIA 4WQ5C 4CBXA 4CJ7A 4IJNA 3KJVA 2AJQA 3DLLL 3D2EA 1VSIA 1VQ9N 4CW7B 4B8CA 1DLOA 1NGHA 1VAZA 5JVGL 2Z1JA 4CFBA 3VF6A 1VRTA 4HUFA 3CCMN 3J7AP 4H0YB 3TR8A 3VESA 4FJLA 1KAXA 1J9AA 1HKGA 2KQ2A 4GV6A 1HJRA 3LP1A 3MCPA 1XMOK 4ILGB 4J2AA 4IDHA 4E7JA 3SYZA 4CD1A 3U9ZA 4HVJA 3C6TA 4NB4A 2YNGA 3ZT1A 2NRRA 5C15A 1TKZA 1YJWN 3OJUA 1NK6A 4JV5K 2YI1A 4O0JA 4FCYA 4DR3K 1UA1A 1RDDA 5AQNA 1VSEA 5AQRA 3IAYA 4V19S 1LW0A 3FLCO 1NGJA 4BC4A 3H1VX 4B9MA 3HTVA 4AQYK 5FPDA 4OPHA 4Z94A 4Y1DA 1VQ7N 2D0BA 3CJBA 4H5WA 1KFSA 4DFKA 1WSEA 4H0VB 4AM6A 1EO1A 3R8EA 4BREA 4O55A 5DK5A 4KRFA 3PY8A 3O9SA 4OJRA 4B3TK 1N33K 1REVA 2F9TA 3L2WA 2QKKA 4JI8K 5EY4A 3V9SA 4JHDA 1JJ2M 1W7AA 5M1NA 3D0PA 2DFEA 4JI2K 1RTDA 3ZSQA 4YFUA 1I39A 3QEVA 3SLCA 3T1AA 3SZ2A 4KH4A 3L8BA 1L3UA 3VQ5A 4A61A 3ULDA 2GWJA 2P9IA 2KHOA 2VQEK 4CK1A 5CHIA 1LW2A 4YOXA 3CFRA 2JWKA 3C7NA 4BR5A 1KCFA 1WOQA 5C12A 1C1AA 4LF8K 4BGBA 4O8KA 2OPQA 1QQOA 2Q0RA 4DLEA 3H08A 3NH1A 3JYTA 2HHHK 2AA4A 4H03B 2F8TA 4G9ZA 2Z1GA 4DV6K 3M8SA 4FWPA 4CJEA 4FLUA 3WNFA 1NK7A 3HI0A 3SUPA 1TK0A 3DXKB 4DF4A 2HMIA 4BRDA 3THWB 1N8RO 3AO4A 2IVPA 2Z1IA 1YTAA 5J2MA 3SMPA 3VN5A 2DFFA 3HJFA 5JVHL 5AQWA 5FRMA 5KI6A 4R5PA 4AILC 1HNWK 4MQ3A 3ZX2A 4M7YA 3WEEB 2NRTA 4DR5K 2ZGYA 3NHGA 3CC2N 4AM7A 3S3NA 3I56N 1HQEA 4DTOA 3AVFA 4QCLA 2JGUA 2QM1A 4DV5K 4NYFA 4FJJA 1NJYA 4MLHA 5LMUK 1UOCA 2DTUA 1N5YA 4FOIA 5EOYA 4XIUA 2D4WA 4Z4IA 3CPWM 2XY7A 3O9RA 1NWKA 4IKFA 3VQEA 1KFDA 5AQHA 2OANA 1VQLN 5BN9A 4F2SA 1HX1A 3LPUA 4JI4K 4RW8A 1RDAA 1NKEA 3I8DA 4JKEA 3SQ0A 2A6AA 2YJFA 3AVAA 1WLJA 2QI2A 1EXQA 1Q8IA 4C1NI 4FWLA 4B1VA 3TAFA 3MN6A 2WBNA 3NDKA 1XUPO 2F9WA 2HVIA 2QWMA 4JK9A 1HNIA 4JS5A 4BDPA 4YOYA 4B3MK 4HWIA 2ZJQL 4KREA 4PHTX 3M8RA 2DFHA 1XC9A 3QIPA 1BCOA 4CEFA 3ZYYX 2NZTA 4LY7A 3OS2A 5ADXA 1X3NA 4RCHA 3AGRA 2IAJA 1QTMA 3AO1A 2VGNA 4YORA 5AZJA 2VG5A 1TKDA 5AR0A 1RBVA 4K0KK 2Q36A 1CZAN 4GKKK 3WUHA 1IJJA 1RTJA 1RBRA 2KZZA 2UXBK 3NCIA 4UY8O 4KH5A 4YHHK 3M8QA 5AQYA 4DMNA 3H3NO 1ITGA 3L0QA 3OW2M 1U45A 2DPNA 4O44A 4CZKA 4Z4EA 4DTXA 2WC9A 4MO5A 4X66K 4LF9K 1TKXA 2HBJA 4NXNK 3CMEN 2HHSA 4FWKA 4QS8A 2KFNA 3QINA 1GLJO 5AQFA 4FLWA 1IKYA 4WCEL 3VQBA 1KSPA 1EP4A 4NO7A 3JS6A 5BRDA 3VA3A 4BE0A 1XHZA 1VQ4N 3VPZA 3JXUA 4E1NA 1XMQK 4JI6K 3KLIA 4DUZK 4KB1A 4JN4A 1VSHA 4W5RA 5JS2A 5I42A 1GLBG 1LWCA 2UUAK 2JWLA 2KFZA 2P9KB 5HRSA 2NRHA 3DXMA 3CXCM 3VTIA 4JKGA 1SAZA 3V9XA 4DTNA 1RTIA 2GELA 4KV8A 3LWLA 3UKRB 1J53A 5BN8A 4WQ5A 4BACA 1LAVA 2P9SB 3CC4N 3CJ1A 3M3ZA 2KLAA 3U3GA 1NG9A 3WXMB 3V9UA 3TTDA 3OYEA 3QEPA 4IO9L 3MWPA 4DSIA 4DR4K 2FC0A 4F4KA 4N76A 4LD0A 1FJGK 4CJTA 4B9NA 2E6MA 1IBKK 3S3OA 3TTCA 5GIPA 3WNGA 3C94A 4AHUA 5LJVA 3VF2A 2QXFA 3ID6A 3VTHA 3C65A 3LDSA 1VQMN 3CJ9A 1BWFO 1NGBA 4R79A 4BRMA 4GKJK 5CZ2A 3CMAN 4DF8A 4OLAA 3ZSYA 4CHQA 4K41A 4KH6A 4CJ3A 3K59A 1VQ6N 4MLEA 1YI2N 1L5UA 1TUUA 2QWPA 4ISFA 3SCXA 2VCPA 5AFUH 1SKSA 3VQQA 4J2BA 2I7PA 3QEWA 3SJJA 3IUCA 2NRWA 4LSNA 1SL0A 4JAXA 4N47A 2I7NA 3HBTA 4PL7A 4BR2A 2NRXA 3TANA 4K8ZA 5HL7L 3GBTA 4JRPA 3TAQA 1OVQA 3LM2A 1KRPA 2UUBK 4DQPA 5GAGP 2HHXA 3AO2A 5ADXH 1Q81O 3D2FA 4BRKA 1H1VA 2RKIA 1VQKN 3AV9A 3AVBA 1IKVA 3KIOA 1SKWA 3OYCA 3NAEA 4FXDA 2IOCA 3EO3A 1F21A 5C42A 1QQMA 3F73A 1VSFA 2V7ZA 3TARA 1NGFA 1C1CA 3KK1A 2O8EB 4I6MB 4CEOA 4MO4A 3VF4A 1L3SA 4E0DA 2A1SA 4I2QA 4JD2B 4B9LA 4FZXC 3ENOA 1SUQA 3KK7A 1RT7A 3LP0A 4E7LA 3VQCA 5BPLA 1S72N 4DQRA 3RR8A 3VQ8A 3O5BA 5AQUA 1KLNA 4GY2B 2LSNA 4IFVA 4C8MA 3T1YK 1S1VA 3CCUN 1YVNA 3OYFA 4BWMA 3AY9A 4FZYA 4M63C 4JKAA 3OYLA 2HNYA 1YJNN 4BC2A 1BCMA 1WBBA 3ISNC 4QOZB 3O3GA 2BUPA 2Y1JA 4E7HA 4A57A 5LY3A 1HR0K 1EETA 3P1GA 2XY5A 3MCAB 4BRCA 5AQSA 3PO5A 1HUXA 1ZBSA 5AZIB 1BG3A 3M8PA 3A5MC 3OY9A 4B1UB 3QBWA 2OZSA 1QSLA 5FRNA 3TAEA 5C24A 3KD1E 2X6NA 3BP8A 2P1JA 4CZIA 4E19A 5HRRA 1KLMA 2FBYA 2YHAA 1J6ZA 4DU4A 2CGKA 3U4LA 3UB5A 3SBGA 3DRSA 4OGEA 1RT1A 2P9LA 4J2DA 1X3MA 4PKHA 3SPZA 2F96A 4HTUA 1IBLK 2Q3SA 1BQMA 1HKBA 4YOVA 4Z0UA 3OTOK 3I8BA 3LPTA 5DM7L 4CK2A 4DQQA 3H46O 5A2QO 5J2PA 4M41A 1CLQA 3O4WA 1WN7A 4L3QA 1ZBIA 3I33A 2BANA 2QXLA 4DKWA 3O6WA 1HYZA 3QO9A 3KD5E 1KAYA 3SV4A 3HRGA 4JI0K 3AVKA 1Q9XA 3W0LA 3AA5X 3CHWA 4X62K 3ZEUB 3ZSXA 3HK2A 5M1FA 1GLLO 1FW6A 1GOAA 1IBMK 3G0ZA 3R1XA 3BF1A 4KKOA 3K5NA 3BZCA 2IVOA 2UUCK 4N56A 2BGGA 4XH1A 2G8WA 1DKGD 3T69A 4DQ8A 3M6GA 2YV0X 3K9KA 4FWOA 3LAMA 3G4SN 2ZJPL 2ZD1A 4BE1A 4K25A 4CFAA 2ZF5O 4A62A 4B08A 4KHWA 4DV2K 3LANA 4JNEA 1TL1A 2P9PB 3V1OA 3A5LC 1U48A 4FWSA 3VQ6A 3MWTA 1NMNA 3L6QA 5C2DA 2ASOA 3ATVA 2HHUA 4M3XA 3CERA 2IVNA 3EN9A 4KHPK 1A5XA 4CZMA 1XI1A 2O8DA 4DSFA 1NGCA 1S9EA 3C7NB 3NVMA 3Q7BA 1WNSA 4GV3A 4WQ4A 2WTUA 3L3UA
chains in the Genus database with same CATH topology
1N32K 1HNWK 4YHHK 4DR5K 4DR7K 1N36K 1XNRK 4JV5K 4LFCK 4DR3K 4X66K 4LF9K 4OX9K 1HNZK 2UU9K 4B3RK 4NXNK 4DV7K 4LF5K 4V19S 1IBLK 3T1HK 4LF6K 3JAMO 4JI3K 4JI7K 2UUBK 4NXMK 4DV5K 3OTOK 2F4VK 4AQYK 4B3SK 5FLXO 5LMUK 4DR1K 5A2QO 1HNXK 4DR6K 3J80O 5IT9O 5LL6Z 4DV4K 3J7YP 4LF7K 4B3TK 1XMQK 5LMNK 4JI6K 4DV1K 1N33K 4DUZK 4JI0K 4DV0K 4X62K 4JI4K 4JI8K 2ZM6K 2UUAK 4YY3K 5IWAK 4X65K 1IBMK 2UXCK 4LFAK 4JI2K 2UUCK 4DV3K 1N34K 5BR8K 1J5EK 4DR2K 2VQEK 4DUYK 3T1YK 3J81O 1I94K 4LF8K 4B3MK 4DR4K 1FJGK 4DV2K 5AJ3K 1IBKK 2HHHK 4CW7B 4JI5K 2E5LK 4DV6K 4X64K 2UXDK 2VQFK 4LFBK 1HR0K 3J7AP 4CVNE 4JYAK 4KHPK 1XNQK 4GKJK 4LF4K 4K0KK 4GKKK 4JI1K 1XMOK 2UXBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 K;  1HNW K;  4YHH K;  4DR5 K;  4DR7 K;  1N36 K;  1XNR K;  4JV5 K;  4LFC K;  4DR3 K;  4X66 K;  4LF9 K;  4OX9 K;  1HNZ K;  2UU9 K;  4B3R K;  4NXN K;  4DV7 K;  4LF5 K;  4V19 S;  1IBL K;  3T1H K;  4LF6 K;  3JAM O;  4JI3 K;  4JI7 K;  2UUB K;  4NXM K;  4DV5 K;  3OTO K;  2F4V K;  4AQY K;  4B3S K;  5FLX O;  5LMU K;  4DR1 K;  5A2Q O;  1HNX K;  4DR6 K;  3J80 O;  5IT9 O;  5LL6 Z;  4DV4 K;  3J7Y P;  4LF7 K;  4B3T K;  1XMQ K;  5LMN K;  4JI6 K;  4DV1 K;  1N33 K;  4DUZ K;  4JI0 K;  4DV0 K;  4X62 K;  4JI4 K;  4JI8 K;  2ZM6 K;  2UUA K;  4YY3 K;  5IWA K;  4X65 K;  1IBM K;  2UXC K;  4LFA K;  4JI2 K;  2UUC K;  4DV3 K;  1N34 K;  5BR8 K;  1J5E K;  4DR2 K;  2VQE K;  4DUY K;  3T1Y K;  3J81 O;  1I94 K;  4LF8 K;  4B3M K;  4DR4 K;  1FJG K;  4DV2 K;  5AJ3 K;  1IBK K;  2HHH K;  4CW7 B;  4JI5 K;  2E5L K;  4DV6 K;  4X64 K;  2UXD K;  2VQF K;  4LFB K;  1HR0 K;  3J7A P;  4CVN E;  4JYA K;  4KHP K;  1XNQ K;  4GKJ K;  4LF4 K;  4K0K K;  4GKK K;  4JI1 K;  1XMO K;  2UXB K; 
#chains in the Genus database with same CATH topology
 3P83 D;  2FBV A;  2V52 B;  4O4G A;  4CZH A;  4UQG A;  5BRF A;  5KGW A;  3RSE B;  3T19 A;  1U04 A;  4KHN A;  3ZSO A;  3O9T A;  2XY6 A;  3VEN A;  1EX4 A;  2UYT A;  3BZK A;  4OX9 K;  5EU7 A;  3DJC A;  2UU9 K;  1E3M A;  2O4G A;  4DV7 K;  3CFO A;  3THY A;  1X9S A;  3DAW A;  3NF8 A;  3QIC A;  1JLQ A;  3KZB A;  4K8X A;  1TYQ A;  2QWN A;  3VGK A;  4OKE A;  2IIR A;  2FSJ A;  3SQ2 A;  4BRI A;  4Z4F A;  5GAE P;  3ZT2 A;  4IG0 A;  3KWG A;  4CGI A;  2WFB A;  1X9W A;  3N4P A;  1RGI A;  4KO0 A;  3AA4 A;  5J2N A;  3E9L A;  3DLH A;  3SAH A;  5TKW A;  1BDG A;  2P9U A;  2YKN A;  3NF7 A;  3MMV A;  3K2P A;  4PA1 A;  4DU3 A;  4AH9 A;  1WAJ A;  2QWQ A;  3CCQ N;  1QZ6 A;  4KI6 A;  4CZE A;  1KXP A;  2GEM A;  4OPA A;  5HRP A;  1J5E K;  2Q0U A;  1VK0 A;  4DUY K;  3THX A;  4DS5 A;  5BRH A;  2ETJ A;  4IZ9 A;  3OYB A;  1NBW A;  3MXI A;  1W0H A;  2IDO A;  3PX4 A;  3NVK A;  1Y64 A;  4CGH A;  4IJA A;  3ULE B;  4E7I A;  4XH4 A;  3B8A X;  1IKX A;  4DSJ A;  4FZZ A;  2FSN A;  5C0Y A;  4H4O A;  5D3G A;  2HBM A;  3WQU A;  3TTF A;  4CIF A;  2VQF K;  5BRE A;  1M90 O;  4BRO A;  4FM2 A;  1QHA A;  4JS4 A;  4FJ7 A;  4CZF A;  4FWQ A;  3U9D A;  5AQT A;  3G71 N;  3AVM A;  3H1Q A;  1CZB A;  3ZSR A;  3TAP A;  3CCJ N;  3HVT A;  1SKR A;  1UAX A;  3HPO A;  1NGG A;  1IO2 A;  2V7Y A;  3RRG A;  1NU0 A;  4EHU A;  3EY1 A;  3G25 A;  4IFY A;  3GE1 A;  3TSP A;  3ZSW A;  2YHB A;  2W42 A;  3QES A;  1SQK A;  3OYD A;  2HHW A;  1BIZ A;  1C0T A;  2D0A A;  4BRQ A;  4DFP A;  1EKE A;  3T1H K;  4H5N A;  3QFU A;  1WSJ A;  1RT6 A;  1TAQ A;  3NBP A;  3MDQ A;  1JLE A;  3CPE A;  1X9J A;  2P5O A;  3KTQ A;  1KD1 O;  1K8K B;  5LL6 Z;  4KHQ A;  3GL1 A;  3KKS A;  4ZTF A;  3A2F A;  5JLH A;  1RDW X;  3EZW A;  3P39 A;  4HUG A;  4IWV A;  3ITH A;  1NGE A;  2YKM A;  3VOV A;  1NJX A;  4K43 A;  3OS0 A;  3VEV A;  1ASW A;  4CGG A;  1JLG A;  3OS1 A;  3H45 C;  1VSM A;  3CIP A;  4B1W B;  1JLC A;  3AO5 A;  1HYS A;  1ESV A;  1LWF A;  3E1Y A;  2VGM A;  2D5R A;  3QER A;  3I0S A;  1S6Q A;  2R7Y A;  3VEO A;  3A5O C;  2ITM A;  2XO7 A;  4DR2 K;  4CFC A;  3V1Q A;  3FZF A;  1K6Y A;  2FXU A;  3CQY A;  4FK4 A;  3CCL N;  1B9F A;  1C6V A;  1T03 A;  3FGU A;  2P5G A;  3CYM A;  3QBX A;  3M5R A;  2ZQB A;  3DXM B;  1YXQ A;  4J8F A;  4CJW A;  4EP5 A;  1HYV A;  1HPZ A;  3O80 A;  1ZXO A;  4X64 K;  4HUE A;  2J4R A;  1K8A O;  4CHY A;  1TL3 A;  4ISE A;  4PY5 A;  3TWH A;  3WQT A;  1RDU A;  3C6U A;  3UE5 A;  1T05 A;  4ELT A;  4KTZ A;  3QFP A;  3CF5 L;  1VQN N;  2D0C A;  1U47 A;  3A0I X;  2ZWH A;  1N32 K;  3IS9 A;  3ZLJ A;  3AVI A;  2QWL A;  3DLB A;  4AF1 A;  1T6C A;  5AQI A;  5AQQ A;  1X1P A;  3WXL A;  3H3O B;  3QNO A;  2Q97 A;  1J5O A;  1RBS A;  4DSL A;  4FW2 A;  2W41 A;  3KK2 A;  1GLC G;  4CGF A;  1JLF A;  1Q7Y O;  1BIS A;  1W9H A;  3VQ7 A;  4CHN A;  3OBY A;  3QIO A;  1JL1 A;  3K58 A;  4DSE A;  1Z05 A;  2GWK A;  5AQK A;  1HRH A;  3SV3 A;  2BE2 A;  4CF8 A;  4RWT A;  3PSI A;  3SI6 A;  1Q9Y A;  1RCH A;  4FLY A;  5AQO A;  3CJC A;  2P9N B;  4DFJ A;  1U2V B;  2GUI A;  4FPA A;  2Q2R A;  4XH5 A;  5KQD A;  5LMN K;  4DV1 K;  3DXK A;  2OTL N;  3FE1 A;  3AVL A;  1G99 A;  4DTU A;  1VSK A;  3O1W A;  4BR7 A;  4WQ4 C;  1OH7 A;  2KTQ A;  1NK8 A;  1DGK N;  2OPR A;  3ZET A;  2ZM6 K;  4PQU A;  1SV5 A;  1EWQ A;  1S22 A;  1NLV A;  3PIP L;  3RWU A;  5IWA K;  4X65 K;  4IBN A;  3SUQ A;  3WEE A;  2PAV A;  4B9Q A;  2A1R A;  1VSD A;  3LWM A;  2E2N A;  5I3U A;  2HB5 A;  4M3U A;  2EWS A;  2PY5 A;  2KKZ A;  3EL2 A;  1D8Y A;  4B1Y B;  5F2R A;  3G6E N;  1I3A A;  1LOT B;  4AHT A;  4FK2 A;  3KHY A;  3AVJ A;  4WE1 A;  3CCV N;  3VEX A;  1DTQ A;  3OYH A;  4B9T A;  4DS4 A;  5KPZ A;  3QEI A;  3DRR A;  4BRP A;  4RW6 A;  4CVN E;  4JYA K;  5F1X A;  3QET A;  4GVM A;  4CJ4 A;  3AVH A;  3JSM A;  2B6A A;  3DOL A;  1VSJ A;  3IMX A;  1B9D A;  2A40 A;  1CXQ A;  4EAH D;  4CK3 A;  4FL9 A;  4CGJ A;  2X74 A;  2HBL A;  4C8L A;  1N36 K;  4F2R A;  3F5T A;  4C8N A;  4CFD A;  1BI4 B;  3FZM A;  5HLF A;  3LZJ A;  4WYB A;  4H5R A;  5JMV A;  3PV8 A;  3LDQ A;  4EZ9 A;  3WNH A;  4E1J A;  4HCB A;  4BR9 A;  5HP1 A;  2E1Y A;  4LH4 A;  5AQG A;  3CI5 A;  1NK4 A;  3KKR A;  2B4J A;  3P38 A;  3QLH A;  4H0O A;  4DTR A;  3NF9 A;  4BDY A;  4Z4C A;  5DMR A;  3EZ5 A;  2ZJR L;  3EKU A;  4LC9 B;  2WOM A;  2G8U A;  2D0P A;  1HLU A;  2PFU A;  5JIC A;  4O0I A;  4CJR A;  2G8V A;  3L2Q A;  2O8F B;  4FM0 A;  3QEX A;  5FDL A;  4FVM A;  1NJZ A;  2ITG A;  5AQP A;  4FLT A;  4GMJ B;  3CCE N;  2AP1 A;  2OA8 A;  3C95 A;  1OKJ A;  4BQL A;  4DTJ A;  4E3S A;  3BF3 A;  2BDP A;  1TV6 A;  5CE3 A;  1MA9 B;  4NYN A;  1JL2 A;  4JKB A;  3EYZ A;  2YX6 A;  2WUS A;  3AVN A;  2FF3 B;  2RF2 A;  2FSK A;  4YOW A;  4EZ6 A;  3M1F A;  4I2P A;  1U4B A;  3VET A;  4Z4H A;  3SMS A;  1BL3 A;  3P5J A;  5JLF A;  1Z6R A;  3UKU B;  4LFB K;  2P9K A;  4AHR A;  5HRO A;  2OZM A;  3EE9 A;  4YOT A;  4KHS A;  2VG7 A;  1NKC A;  3I0R A;  3IKM A;  4BE2 A;  3EE8 A;  4GNI A;  3F2K A;  4BC3 A;  4IG3 A;  3NH0 A;  4OO1 J;  1NM1 A;  4JI1 K;  1QS4 A;  3LAL A;  3T7Z A;  2OPS A;  2VWK A;  3LDO A;  1OVY A;  5CR4 A;  3UKR A;  1YIJ N;  1J54 A;  1IH7 A;  2XY8 A;  4FLV A;  3PO4 A;  3LDL A;  2P9S A;  3AAQ A;  1TGO A;  5M1O A;  4DR7 K;  2Q1N A;  4JKF A;  3NFA A;  1ASV A;  3BEX A;  3R3L A;  5K14 A;  3W3D A;  1VQ8 N;  2HND A;  2BTF A;  4QS7 A;  4F8R A;  4B1Z A;  4YNQ A;  1D5A A;  5KQ8 A;  2NRV A;  4LF5 K;  4B9S A;  2QEX N;  1NK9 A;  3VQ9 A;  3U3Y A;  3VGL A;  5AQJ A;  3V6D A;  4NXM K;  2O8D B;  3VGM A;  1JXE A;  4DR1 K;  2GBZ A;  3SQ4 A;  1QE1 A;  4WFN L;  5IT9 O;  5CYQ A;  1JXB A;  2F7T A;  1RBU A;  4M3T A;  3HT3 A;  4NCA A;  3D2E B;  5SWM A;  3K0S A;  1W97 L;  1L3T A;  4FYD A;  4B9U A;  3WT0 A;  5KPR A;  2W40 A;  4CJS A;  3SPY A;  1LWE A;  2YNI A;  5HOO A;  4OVL A;  5AQX A;  4AHS A;  2UXC K;  3HM8 A;  4RW7 A;  5EVZ A;  4DTM A;  1MDU B;  1ZBF A;  4ILH A;  1W2B M;  4IOA L;  2CH6 A;  3CJA A;  4YDU A;  3HP6 A;  4GVE A;  3S3M A;  4DV3 K;  3MAQ A;  3OYN A;  4AHV A;  4W5T A;  4FJ8 A;  1Z26 A;  5FPE A;  5KTQ A;  1S9G A;  2O8C A;  3KLG A;  5KGX A;  3ZX3 A;  2HNZ A;  1I94 K;  5J1E A;  2NUB A;  3L4I A;  4KHU A;  2OTJ N;  4OPJ A;  3VA0 A;  5M1Q A;  1ZBL A;  1GOC A;  1YJ9 N;  1K73 O;  4QAG A;  3HO1 A;  1XQS C;  3CET A;  4OGC A;  1FK9 A;  3J8A A;  4CJL A;  2ZGZ A;  3E66 A;  1IG8 A;  4RTF D;  4W5N A;  3V1R A;  4C8K A;  3PX6 A;  4F9O A;  1T44 A;  3RMA A;  2HBK A;  2O8E A;  1TKT A;  3QNN A;  4H8K A;  4DWI A;  1ASU A;  3OYJ A;  4I6M A;  4BG8 A;  1VQP N;  3RTV A;  3FZL A;  3S41 A;  1S1U A;  3TAB A;  4JD2 A;  1KVA A;  4PKI A;  1D4X A;  4JHD B;  4BRH A;  4L8R B;  1WBD A;  4M42 A;  4H5V A;  3P4I A;  1S1T A;  4M3R A;  1OH5 A;  2PYJ A;  4CEQ A;  2E4L A;  2HST A;  4U67 L;  2HOE A;  4CF1 A;  2WON A;  3LP3 A;  4A59 A;  1BGX T;  4BRL A;  3MN9 A;  5GAH P;  1RT4 A;  1RT3 A;  3SNN A;  2P9I B;  3MXJ A;  3WXK A;  5JS1 A;  4H0T B;  2HVH A;  1Z25 A;  4DHY A;  5AQL A;  1B92 A;  3O9Q A;  1VQO N;  4NCG A;  1L3V A;  4DV4 K;  3VQ4 A;  4FM1 A;  2CGJ A;  3J7Y P;  2I5J A;  1WSI A;  4FSV A;  4JK7 A;  1OH8 A;  3CM5 A;  1NJI O;  1YHQ N;  3RMD A;  5AZI A;  1A5V A;  3C0B A;  3CQ8 A;  2OYQ A;  2NRZ A;  5GIO A;  4NLC A;  4DLG A;  3K5L A;  4YY3 K;  2EX3 A;  3DMJ A;  2QWO A;  4F3O A;  4IEE A;  1TVR A;  3MN5 A;  4CHO A;  3RMC A;  3AVC A;  3E9P A;  4ISG A;  3CD6 N;  2NNW A;  2P51 A;  3DLG A;  2O8B A;  1DT9 A;  3ENH A;  1ATR A;  1N34 K;  1ZYQ A;  1RTH A;  4IFE A;  2KZM A;  3NMU A;  4JK8 A;  4H5T A;  3O8M A;  1XC3 A;  4WFA L;  1C0M A;  5BR8 K;  1C0F A;  4HHT A;  1SL2 A;  1MWK A;  3EKS A;  2PYL A;  2QA4 N;  3R6M A;  5M1P A;  5AQV A;  4H0P A;  3J81 O;  3MEG A;  3RVC A;  2JLE A;  4JKC A;  3RRH A;  4A2B A;  2DY4 A;  1O1W A;  5AJ3 K;  3VQP A;  3D6R A;  4B9V A;  5E26 A;  1TK8 A;  4DTS A;  1NK0 A;  1NMD A;  3L3V A;  2YHX A;  4EP4 A;  1Q82 O;  2UXD K;  3ZEU A;  3MXM A;  2HHT A;  3HXM A;  4KHY A;  1RT2 A;  1BOT O;  4B3O A;  2G8I A;  1XWL A;  1S1X A;  2GUP A;  3VEY A;  1HMV A;  2YHW A;  5F0X A;  4CED A;  4IDK A;  2RHK A;  4N41 A;  1V4S A;  3LAK A;  3U8X A;  3H6E A;  5EX5 A;  3NF6 A;  5KRT A;  1WUA A;  2HMP A;  1XNR K;  1NOZ A;  3OYA A;  3LZI A;  3HPH A;  4FWR A;  2HF3 A;  4KBO A;  4CCH A;  4M45 A;  1KTQ A;  2CGL A;  2D1K A;  4EHT A;  2ZE2 A;  4GV9 A;  4DSK A;  5FPN A;  3KLE A;  4CEB A;  3OA9 A;  3DLK A;  4CF0 A;  1T7P A;  4LF6 K;  2P9P A;  4CJV A;  4I9Q A;  2ASM A;  3AGK A;  1JCF A;  3AA3 A;  3S9H A;  1QQN A;  3J80 O;  3SUN A;  5DM6 L;  1SS6 A;  2ATQ A;  3TAM A;  4CZG A;  4LF7 K;  3TSU A;  4FJM A;  3PX0 A;  1ZBU A;  3QDK A;  1QSY A;  3DI6 A;  5AZJ B;  3WXI A;  4CZL A;  4KTQ A;  4KB0 A;  2E20 A;  3KWI A;  3RSE A;  4HTL A;  3WNE A;  1NNE A;  5E41 A;  4CJK A;  3O3F A;  3FZH A;  3BGR A;  4JRQ A;  5EXW A;  3U6F A;  4ID1 A;  3RMB A;  1S5J A;  3ZET B;  4O5B A;  3HP9 A;  2HHV A;  4CIG A;  1KC8 O;  5KPT A;  2QWR A;  5BPM A;  1NGD A;  1NOY A;  4ICL A;  1EWR A;  1JCG A;  1O13 A;  2E5L K;  3CJ7 A;  1JCE A;  3F9M A;  3CCS N;  1C0U A;  1S3X A;  3NGY A;  3VER A;  4EFH A;  4ELU A;  3AVG A;  3FFI A;  1XNQ K;  3SAF A;  3PLA A;  4CEC A;  4YDU C;  2IS3 A;  5AQM A;  1RDB A;  1TK5 A;  3ATU A;  2D0O A;  3DLR A;  4CJF A;  4BG9 A;  1LV5 A;  4CEZ A;  4CBU A;  2RPI A;  4JKG B;  4BRG A;  4BQZ A;  2F8S A;  1M1K O;  2HF4 A;  3AAR A;  4FJI A;  3ZSZ A;  4ZHR A;  4TSX A;  3N4Q A;  2Q31 A;  1QHT A;  4QS9 A;  3ULE A;  4JI7 K;  4PKG A;  4Y1C A;  4E89 A;  2F4V K;  3VQA A;  5C2F A;  1KAZ A;  1KVB A;  4DR6 K;  4ID5 A;  4Y0W A;  1E4G T;  2YCH A;  1DEJ A;  4CHZ A;  3K9J A;  2XHB A;  2HW3 A;  1WAF A;  1RIL A;  5AFU A;  2VG6 A;  3ZCM A;  4JLH A;  4WFB L;  4FJK A;  4PUO A;  2QKB A;  4Q0B A;  1ATN A;  3HOT A;  1UWB A;  5MLC Q;  1BQN A;  3Q7C A;  3ZT4 A;  1RBT A;  1QSS A;  4MDA A;  5M1K A;  2A42 A;  3P31 A;  1QZ5 A;  4BR4 A;  4CJU A;  4W5Q A;  2G8F A;  1G15 A;  1YTU A;  1YAG A;  1KQS M;  1QQC A;  1U49 A;  1IV0 A;  1WSH A;  2GV9 A;  3ZT3 A;  2E88 A;  1YUW A;  1D9D A;  2E8A A;  4ELV A;  3OJS A;  2E1Z A;  4BWJ A;  4CIE A;  3MN7 A;  3SAG A;  4BVP A;  4C23 A;  3THW A;  3OVN A;  4IO8 A;  4CF2 A;  4Z4G A;  3D7E O;  5KRS A;  3CFP A;  3FFK B;  1VRU A;  2FLO A;  3TAG A;  1K8K A;  2E2Q A;  3ZT0 A;  3GDQ A;  3FZK A;  3MX2 A;  4FVU A;  5LJW A;  3NGZ A;  4FJ9 A;  1RDC A;  1JLA A;  3D2F B;  2KW4 A;  2Z1H A;  1MWM A;  1DTT A;  3HM9 A;  3UIQ A;  4KAZ A;  2W6K A;  4C1N K;  3LL3 A;  4K42 A;  1TUY A;  2HHQ A;  3VQD A;  3VMF B;  4CJP A;  1V4T A;  4H4M A;  4FJN A;  5BR9 A;  3ASM A;  1VHX A;  4OLB A;  1K9M O;  3C6A A;  1GLD G;  3HPG A;  4KI4 A;  4NLB A;  3A8Y A;  3OHR A;  3PIO L;  3DM2 A;  3MX5 A;  3TU5 A;  2YHY A;  3TSQ A;  1TAU A;  3ZX0 A;  1WSF A;  1RFQ A;  4JKH A;  1IKW A;  4E1M A;  1HNZ K;  4B8A B;  4DG1 A;  5BPN A;  1QVG M;  3SQ1 A;  4JI3 K;  3SUO A;  4CEA A;  3AA2 A;  3IFR A;  1GLE G;  3O4Q A;  5TKY A;  4BY9 C;  3THV A;  3KK3 A;  5B8H A;  3HOS A;  3TI0 A;  3V4I A;  4DV0 K;  3T3F A;  2OCE A;  2NLX A;  1NGI A;  2W6L A;  4BR0 A;  2GTD A;  1BUP A;  1BO5 O;  4RW4 A;  4KPY A;  1GLF O;  4MDB A;  4FLX A;  3A5N C;  1HNV A;  4LFA K;  1JKH A;  4FJG A;  4A2A A;  3SBT A;  1HQU A;  3EEQ A;  3HL8 A;  4OPK A;  3HYF A;  2FBT A;  4FWM A;  3LDP A;  5AQZ A;  3R9P A;  3HZ6 A;  4J2E A;  1CZ9 A;  4W5O A;  3D45 A;  4CES A;  1SZ2 A;  3E01 A;  3LP2 A;  3ZSV A;  2GX9 A;  2E2P A;  1A5W A;  2P9L B;  2P9N A;  1VSL A;  1U2V A;  4DB3 A;  1XHX A;  5CYM A;  4FJH A;  2E2O A;  3SK3 A;  4CE9 A;  2BH1 A;  4CHP A;  2O4I A;  3CQX A;  3O3H A;  1U6Z A;  3MK6 A;  1WB9 A;  4O5F A;  1C0G A;  4CF9 A;  3GOI A;  4KTW A;  5ELZ A;  5HBM A;  3QML A;  4HCC A;  4FK0 A;  4CBW A;  2A3Z A;  3J7Z O;  4CI6 A;  1NJW A;  2XRI A;  1Q86 O;  3HST B;  4FOE A;  1RNH A;  2QW9 A;  1R0A A;  2YNH A;  2O8C B;  4U7B A;  1YF5 L;  3MEC A;  1S6P A;  5C10 A;  4DQI A;  3CCR N;  3CM6 A;  1NGA A;  3L2U A;  2G8K A;  3OYI A;  3DOK A;  3KLF A;  4FJ5 A;  4IXC A;  2VWJ A;  2V51 B;  4OKK A;  1T6D A;  3ALY A;  1YIT N;  2B5J A;  4FW1 A;  4EIA A;  4GW6 A;  4ZTJ A;  3VEW A;  1BU6 O;  3DRP A;  4ILJ A;  4B3R K;  4H0X B;  4LSL A;  2E6L A;  3JAM O;  3OYK A;  4CZJ A;  1LCU A;  4B3S K;  2VYP A;  5FLX O;  1HNX K;  2A41 A;  3G10 A;  1QVF M;  3LM9 A;  3BY5 A;  1C1B A;  2FF6 A;  2QTD A;  1ZC6 A;  4IOX A;  4Q5V A;  3QB0 A;  2PZS A;  3DWL A;  5CY4 A;  3SJH A;  1GOB A;  5CZ1 A;  4DQS A;  1JLB A;  3IG1 A;  4BDZ A;  3B6O A;  3NE6 A;  4BGA A;  4BRF A;  1BA1 A;  3O08 A;  5E84 A;  1R59 O;  4BRN A;  1P90 A;  1WSG A;  1Y97 A;  3K5O A;  3V81 A;  1BI4 A;  4CJ5 A;  1S1W A;  3HVR A;  2Y1I A;  4FWN A;  5C25 A;  4RG8 A;  3OBW A;  4CJQ A;  4XEI A;  1HJO A;  2RE2 A;  5I9E B;  4YOU A;  2YJE A;  5FRO A;  3ENB A;  4I7F A;  5H1S Q;  3K5M A;  2VWB A;  4CD3 A;  3C6H A;  4IEI A;  3HSC A;  3FR0 A;  4A5B A;  3THY B;  4M3Y A;  1LAW A;  1TYQ B;  1YT3 A;  4WF9 L;  1HKC A;  4JI5 K;  3TPQ A;  1BHL A;  2X78 A;  3PSF A;  3E9O A;  2O8B B;  3OYM A;  2RN2 A;  3MED A;  2A5X A;  5T7B A;  3K57 A;  4BRA A;  3KVG A;  5HRN A;  4KFB A;  2O8F A;  1NKB A;  4LF4 K;  4CGD A;  3NGI A;  2QK9 A;  4I9L A;  4FJX A;  4M3Z A;  4LH5 A;  4BC5 A;  3GG4 A;  1ILY A;  2ASP A;  4FLZ A;  4CEE A;  4FPB A;  3IDH A;  4O8U A;  3RR7 A;  2P9U B;  2CH5 A;  1E4F T;  1N6Q A;  1UA0 A;  3O4N A;  3PUF A;  1FXX A;  3DYA A;  1OH6 A;  2YNF A;  4NCB A;  3BUZ B;  5GAD P;  5J2Q A;  1Q18 A;  4LFC K;  4A5A A;  1T8E A;  1CXU A;  4IOC L;  3BDP A;  4RW9 A;  4MFB A;  1ATS A;  2H3G X;  3KLH A;  1X9M A;  1IG9 A;  1FKO A;  4JEP A;  1KVC A;  3LDN A;  3THX B;  1BA0 A;  3OYG A;  3CC7 N;  3ID8 A;  4OKJ A;  4CER A;  3B6P A;  4DCH A;  4F3T A;  2X6S A;  3UKU A;  1D9F A;  3AO3 A;  2OPP A;  3O9U A;  3VEZ A;  4AHC A;  3DLE A;  1HPM A;  3F9K A;  3I55 N;  4DU1 A;  3V9W A;  3MEE A;  1P8Z A;  4G1Q A;  4PWD A;  4DFM A;  3L4Q A;  1EQY A;  5GIN A;  4DTP A;  5FPM A;  1YVU A;  3NH2 A;  4PL8 A;  3WXJ A;  2PBD A;  4JKD A;  1BIU A;  1RT5 A;  1MU2 A;  3CG7 A;  4BVO A;  3V9Z A;  4C8O A;  3IRX A;  4M3W A;  3L2R A;  4N5S A;  2EHG A;  2G8H A;  3O1B A;  5SZT A;  1FKP A;  4M7X A;  3AAP A;  1VQ5 N;  1GLA G;  2IC3 A;  2FBX A;  4FO0 A;  1NK5 A;  1T3V A;  4E7K A;  1SL1 A;  3L2V A;  4B1X B;  1ZBH A;  2IGI A;  4WQ5 C;  4CBX A;  4CJ7 A;  4IJN A;  3KJV A;  2AJQ A;  3DLL L;  3D2E A;  1VSI A;  1VQ9 N;  4CW7 B;  4B8C A;  1DLO A;  1NGH A;  1VAZ A;  5JVG L;  2Z1J A;  4CFB A;  3VF6 A;  1VRT A;  4HUF A;  3CCM N;  3J7A P;  4H0Y B;  3TR8 A;  3VES A;  4FJL A;  1KAX A;  1J9A A;  1HKG A;  2KQ2 A;  4GV6 A;  1HJR A;  3LP1 A;  3MCP A;  1XMO K;  4ILG B;  4J2A A;  4IDH A;  4E7J A;  3SYZ A;  4CD1 A;  3U9Z A;  4HVJ A;  3C6T A;  4NB4 A;  2YNG A;  3ZT1 A;  2NRR A;  5C15 A;  1TKZ A;  1YJW N;  3OJU A;  1NK6 A;  4JV5 K;  2YI1 A;  4O0J A;  4FCY A;  4DR3 K;  1UA1 A;  1RDD A;  5AQN A;  1VSE A;  5AQR A;  3IAY A;  4V19 S;  1LW0 A;  3FLC O;  1NGJ A;  4BC4 A;  3H1V X;  4B9M A;  3HTV A;  4AQY K;  5FPD A;  4OPH A;  4Z94 A;  4Y1D A;  1VQ7 N;  2D0B A;  3CJB A;  4H5W A;  1KFS A;  4DFK A;  1WSE A;  4H0V B;  4AM6 A;  1EO1 A;  3R8E A;  4BRE A;  4O55 A;  5DK5 A;  4KRF A;  3PY8 A;  3O9S A;  4OJR A;  4B3T K;  1N33 K;  1REV A;  2F9T A;  3L2W A;  2QKK A;  4JI8 K;  5EY4 A;  3V9S A;  4JHD A;  1JJ2 M;  1W7A A;  5M1N A;  3D0P A;  2DFE A;  4JI2 K;  1RTD A;  3ZSQ A;  4YFU A;  1I39 A;  3QEV A;  3SLC A;  3T1A A;  3SZ2 A;  4KH4 A;  3L8B A;  1L3U A;  3VQ5 A;  4A61 A;  3ULD A;  2GWJ A;  2P9I A;  2KHO A;  2VQE K;  4CK1 A;  5CHI A;  1LW2 A;  4YOX A;  3CFR A;  2JWK A;  3C7N A;  4BR5 A;  1KCF A;  1WOQ A;  5C12 A;  1C1A A;  4LF8 K;  4BGB A;  4O8K A;  2OPQ A;  1QQO A;  2Q0R A;  4DLE A;  3H08 A;  3NH1 A;  3JYT A;  2HHH K;  2AA4 A;  4H03 B;  2F8T A;  4G9Z A;  2Z1G A;  4DV6 K;  3M8S A;  4FWP A;  4CJE A;  4FLU A;  3WNF A;  1NK7 A;  3HI0 A;  3SUP A;  1TK0 A;  3DXK B;  4DF4 A;  2HMI A;  4BRD A;  3THW B;  1N8R O;  3AO4 A;  2IVP A;  2Z1I A;  1YTA A;  5J2M A;  3SMP A;  3VN5 A;  2DFF A;  3HJF A;  5JVH L;  5AQW A;  5FRM A;  5KI6 A;  4R5P A;  4AIL C;  1HNW K;  4MQ3 A;  3ZX2 A;  4M7Y A;  3WEE B;  2NRT A;  4DR5 K;  2ZGY A;  3NHG A;  3CC2 N;  4AM7 A;  3S3N A;  3I56 N;  1HQE A;  4DTO A;  3AVF A;  4QCL A;  2JGU A;  2QM1 A;  4DV5 K;  4NYF A;  4FJJ A;  1NJY A;  4MLH A;  5LMU K;  1UOC A;  2DTU A;  1N5Y A;  4FOI A;  5EOY A;  4XIU A;  2D4W A;  4Z4I A;  3CPW M;  2XY7 A;  3O9R A;  1NWK A;  4IKF A;  3VQE A;  1KFD A;  5AQH A;  2OAN A;  1VQL N;  5BN9 A;  4F2S A;  1HX1 A;  3LPU A;  4JI4 K;  4RW8 A;  1RDA A;  1NKE A;  3I8D A;  4JKE A;  3SQ0 A;  2A6A A;  2YJF A;  3AVA A;  1WLJ A;  2QI2 A;  1EXQ A;  1Q8I A;  4C1N I;  4FWL A;  4B1V A;  3TAF A;  3MN6 A;  2WBN A;  3NDK A;  1XUP O;  2F9W A;  2HVI A;  2QWM A;  4JK9 A;  1HNI A;  4JS5 A;  4BDP A;  4YOY A;  4B3M K;  4HWI A;  2ZJQ L;  4KRE A;  4PHT X;  3M8R A;  2DFH A;  1XC9 A;  3QIP A;  1BCO A;  4CEF A;  3ZYY X;  2NZT A;  4LY7 A;  3OS2 A;  5ADX A;  1X3N A;  4RCH A;  3AGR A;  2IAJ A;  1QTM A;  3AO1 A;  2VGN A;  4YOR A;  5AZJ A;  2VG5 A;  1TKD A;  5AR0 A;  1RBV A;  4K0K K;  2Q36 A;  1CZA N;  4GKK K;  3WUH A;  1IJJ A;  1RTJ A;  1RBR A;  2KZZ A;  2UXB K;  3NCI A;  4UY8 O;  4KH5 A;  4YHH K;  3M8Q A;  5AQY A;  4DMN A;  3H3N O;  1ITG A;  3L0Q A;  3OW2 M;  1U45 A;  2DPN A;  4O44 A;  4CZK A;  4Z4E A;  4DTX A;  2WC9 A;  4MO5 A;  4X66 K;  4LF9 K;  1TKX A;  2HBJ A;  4NXN K;  3CME N;  2HHS A;  4FWK A;  4QS8 A;  2KFN A;  3QIN A;  1GLJ O;  5AQF A;  4FLW A;  1IKY A;  4WCE L;  3VQB A;  1KSP A;  1EP4 A;  4NO7 A;  3JS6 A;  5BRD A;  3VA3 A;  4BE0 A;  1XHZ A;  1VQ4 N;  3VPZ A;  3JXU A;  4E1N A;  1XMQ K;  4JI6 K;  3KLI A;  4DUZ K;  4KB1 A;  4JN4 A;  1VSH A;  4W5R A;  5JS2 A;  5I42 A;  1GLB G;  1LWC A;  2UUA K;  2JWL A;  2KFZ A;  2P9K B;  5HRS A;  2NRH A;  3DXM A;  3CXC M;  3VTI A;  4JKG A;  1SAZ A;  3V9X A;  4DTN A;  1RTI A;  2GEL A;  4KV8 A;  3LWL A;  3UKR B;  1J53 A;  5BN8 A;  4WQ5 A;  4BAC A;  1LAV A;  2P9S B;  3CC4 N;  3CJ1 A;  3M3Z A;  2KLA A;  3U3G A;  1NG9 A;  3WXM B;  3V9U A;  3TTD A;  3OYE A;  3QEP A;  4IO9 L;  3MWP A;  4DSI A;  4DR4 K;  2FC0 A;  4F4K A;  4N76 A;  4LD0 A;  1FJG K;  4CJT A;  4B9N A;  2E6M A;  1IBK K;  3S3O A;  3TTC A;  5GIP A;  3WNG A;  3C94 A;  4AHU A;  5LJV A;  3VF2 A;  2QXF A;  3ID6 A;  3VTH A;  3C65 A;  3LDS A;  1VQM N;  3CJ9 A;  1BWF O;  1NGB A;  4R79 A;  4BRM A;  4GKJ K;  5CZ2 A;  3CMA N;  4DF8 A;  4OLA A;  3ZSY A;  4CHQ A;  4K41 A;  4KH6 A;  4CJ3 A;  3K59 A;  1VQ6 N;  4MLE A;  1YI2 N;  1L5U A;  1TUU A;  2QWP A;  4ISF A;  3SCX A;  2VCP A;  5AFU H;  1SKS A;  3VQQ A;  4J2B A;  2I7P A;  3QEW A;  3SJJ A;  3IUC A;  2NRW A;  4LSN A;  1SL0 A;  4JAX A;  4N47 A;  2I7N A;  3HBT A;  4PL7 A;  4BR2 A;  2NRX A;  3TAN A;  4K8Z A;  5HL7 L;  3GBT A;  4JRP A;  3TAQ A;  1OVQ A;  3LM2 A;  1KRP A;  2UUB K;  4DQP A;  5GAG P;  2HHX A;  3AO2 A;  5ADX H;  1Q81 O;  3D2F A;  4BRK A;  1H1V A;  2RKI A;  1VQK N;  3AV9 A;  3AVB A;  1IKV A;  3KIO A;  1SKW A;  3OYC A;  3NAE A;  4FXD A;  2IOC A;  3EO3 A;  1F21 A;  5C42 A;  1QQM A;  3F73 A;  1VSF A;  2V7Z A;  3TAR A;  1NGF A;  1C1C A;  3KK1 A;  2O8E B;  4I6M B;  4CEO A;  4MO4 A;  3VF4 A;  1L3S A;  4E0D A;  2A1S A;  4I2Q A;  4JD2 B;  4B9L A;  4FZX C;  3ENO A;  1SUQ A;  3KK7 A;  1RT7 A;  3LP0 A;  4E7L A;  3VQC A;  5BPL A;  1S72 N;  4DQR A;  3RR8 A;  3VQ8 A;  3O5B A;  5AQU A;  1KLN A;  4GY2 B;  2LSN A;  4IFV A;  4C8M A;  3T1Y K;  1S1V A;  3CCU N;  1YVN A;  3OYF A;  4BWM A;  3AY9 A;  4FZY A;  4M63 C;  4JKA A;  3OYL A;  2HNY A;  1YJN N;  4BC2 A;  1BCM A;  1WBB A;  3ISN C;  4QOZ B;  3O3G A;  2BUP A;  2Y1J A;  4E7H A;  4A57 A;  5LY3 A;  1HR0 K;  1EET A;  3P1G A;  2XY5 A;  3MCA B;  4BRC A;  5AQS A;  3PO5 A;  1HUX A;  1ZBS A;  5AZI B;  1BG3 A;  3M8P A;  3A5M C;  3OY9 A;  4B1U B;  3QBW A;  2OZS A;  1QSL A;  5FRN A;  3TAE A;  5C24 A;  3KD1 E;  2X6N A;  3BP8 A;  2P1J A;  4CZI A;  4E19 A;  5HRR A;  1KLM A;  2FBY A;  2YHA A;  1J6Z A;  4DU4 A;  2CGK A;  3U4L A;  3UB5 A;  3SBG A;  3DRS A;  4OGE A;  1RT1 A;  2P9L A;  4J2D A;  1X3M A;  4PKH A;  3SPZ A;  2F96 A;  4HTU A;  1IBL K;  2Q3S A;  1BQM A;  1HKB A;  4YOV A;  4Z0U A;  3OTO K;  3I8B A;  3LPT A;  5DM7 L;  4CK2 A;  4DQQ A;  3H46 O;  5A2Q O;  5J2P A;  4M41 A;  1CLQ A;  3O4W A;  1WN7 A;  4L3Q A;  1ZBI A;  3I33 A;  2BAN A;  2QXL A;  4DKW A;  3O6W A;  1HYZ A;  3QO9 A;  3KD5 E;  1KAY A;  3SV4 A;  3HRG A;  4JI0 K;  3AVK A;  1Q9X A;  3W0L A;  3AA5 X;  3CHW A;  4X62 K;  3ZEU B;  3ZSX A;  3HK2 A;  5M1F A;  1GLL O;  1FW6 A;  1GOA A;  1IBM K;  3G0Z A;  3R1X A;  3BF1 A;  4KKO A;  3K5N A;  3BZC A;  2IVO A;  2UUC K;  4N56 A;  2BGG A;  4XH1 A;  2G8W A;  1DKG D;  3T69 A;  4DQ8 A;  3M6G A;  2YV0 X;  3K9K A;  4FWO A;  3LAM A;  3G4S N;  2ZJP L;  2ZD1 A;  4BE1 A;  4K25 A;  4CFA A;  2ZF5 O;  4A62 A;  4B08 A;  4KHW A;  4DV2 K;  3LAN A;  4JNE A;  1TL1 A;  2P9P B;  3V1O A;  3A5L C;  1U48 A;  4FWS A;  3VQ6 A;  3MWT A;  1NMN A;  3L6Q A;  5C2D A;  2ASO A;  3ATV A;  2HHU A;  4M3X A;  3CER A;  2IVN A;  3EN9 A;  4KHP K;  1A5X A;  4CZM A;  1XI1 A;  2O8D A;  4DSF A;  1NGC A;  1S9E A;  3C7N B;  3NVM A;  3Q7B A;  1WNS A;  4GV3 A;  4WQ4 A;  2WTU A;  3L3U A; 
#chains in the Genus database with same CATH homology
 1N32 K;  1HNW K;  4YHH K;  4DR5 K;  4DR7 K;  1N36 K;  1XNR K;  4JV5 K;  4LFC K;  4DR3 K;  4X66 K;  4LF9 K;  4OX9 K;  1HNZ K;  2UU9 K;  4B3R K;  4NXN K;  4DV7 K;  4LF5 K;  4V19 S;  1IBL K;  3T1H K;  4LF6 K;  3JAM O;  4JI3 K;  4JI7 K;  2UUB K;  4NXM K;  4DV5 K;  3OTO K;  2F4V K;  4AQY K;  4B3S K;  5FLX O;  5LMU K;  4DR1 K;  5A2Q O;  1HNX K;  4DR6 K;  3J80 O;  5IT9 O;  5LL6 Z;  4DV4 K;  3J7Y P;  4LF7 K;  4B3T K;  1XMQ K;  5LMN K;  4JI6 K;  4DV1 K;  1N33 K;  4DUZ K;  4JI0 K;  4DV0 K;  4X62 K;  4JI4 K;  4JI8 K;  2ZM6 K;  2UUA K;  4YY3 K;  5IWA K;  4X65 K;  1IBM K;  2UXC K;  4LFA K;  4JI2 K;  2UUC K;  4DV3 K;  1N34 K;  5BR8 K;  1J5E K;  4DR2 K;  2VQE K;  4DUY K;  3T1Y K;  3J81 O;  1I94 K;  4LF8 K;  4B3M K;  4DR4 K;  1FJG K;  4DV2 K;  5AJ3 K;  1IBK K;  2HHH K;  4CW7 B;  4JI5 K;  2E5L K;  4DV6 K;  4X64 K;  2UXD K;  2VQF K;  4LFB K;  1HR0 K;  3J7A P;  4CVN E;  4JYA K;  4KHP K;  1XNQ K;  4GKJ K;  4LF4 K;  4K0K K;  4GKK K;  4JI1 K;  1XMO K;  2UXB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...