2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
3RB0A 4FBUA 3N6LA 2W7PA 1RT1B 1L3VA 2Z1HA 3M8SA 2Y1JA 1RAJA 1D5AA 2HHVA 4XPEA 3MR2A 4FJ5A 1DLOA 2YNHA 5JUMA 4ED7A 2RKIA 1SKWA 2XCAA 2P5OA 1EP4A 4E0DA 4BDYA 3NGYA 3H5UA 3JSMB 2XWYA 2WOMB 4K4UA 3EZUA 4KB0A 2RF2B 3E01B 3SCXA 1WLJA 3WNHA 3QETA 4CGIA 4BDZA 3C6TA 3NBPA 2IM1A 1LAVA 2D7SA 4M3RA 1BISA 3AVKA 4MIBA 4IFVB 1S1TB 1WAFA 1RTDA 4IOBA 4QWEA 4KKOB 4DFKA 1JX4A 3M8PA 2XRIA 5KFKA 3C6UB 3GIJA 1R0AB 4CFBA 1RT3A 2ALZA 2R2RA 4DU1A 4U6PA 1S1XB 3V9ZA 4H4MB 1BGXT 1D1UA 1HARA 4ZTJA 5E41A 2FLNA 3M9MB 3CG7A 2AX1A 1CSJA 4ZVGA 1XHXA 4XO0A 3AVIA 4CEBA 1S9GA 3PO4A 4ECYA 4MQ3A 2IMWP 1VSKA 5HRNA 3VQEA 1GOCA 1XI1A 4RUAA 3HHKA 1WN7A 1GX5A 3H4BA 4M94A 4MH8A 3DLBA 1IO2A 1RTHA 2IBKA 3L3UA 2O4IA 2D3ZA 4O44A 4DL7A 4CK3A 3RR7A 2W9CA 4JRPA 4JV2A 3LP1A 2WCXA 4J2BA 5J1EB 1CZ9A 4IDKB 2F8SA 4EBCA 1HNVB 4IG3A 3QEVA 2R8HA 4FJKA 3BR9A 4CJ3A 3NE6A 1VRUA 3SV3A 4PWDB 3IRXB 4B8CA 5KG7A 4EYIB 3DM2A 3DRPB 1JL2A 2VA2A 2PYLA 4WFZA 1S1UA 3P1GA 4Z4HA 4CEOA 4B08A 1QE1B 3IAYA 4CESA 4J9KA 1JLAA 5DLGA 4KI4A 4NYFA 3OHBA 4KV8B 4NCGB 4EEYA 1KLMB 4IRDA 2HWIA 3KLGB 5HLFB 4LQ3A 4FJ7A 2F8EX 3NL0A 4CECA 1UOCA 4O0IA 1S6QB 2AX0A 4OKEA 3QEIA 1RBVA 1KCFA 3DOKA 2J6SA 2W9AA 2P51A 4NLWA 3BSCA 4EO8A 2O4GA 1ZBLA 4Y1DA 3HKWA 4RUCA 3AO2A 5EU7A 1REVB 4YMEA 5HRSA 1EXQA 5I42A 1JLCA 3QZ7A 4M45A 1TL3B 5J2QA 3MECA 1N5YB 4QCLA 1ZTTA 2ITGA 1KHVA 4L8RB 1TAUA 5CYMB 5KRSA 2QKBA 1C1BB 3DLHA 3KLEB 3PX6A 2C2DA 3KLIB 3HVWA 1O1WA 2BE2B 3ITHA 4CJWA 3NAIA 3M8QB 1NK8A 3DYAB 3BQ1A 1HMVB 2IAJA 4DQPA 4KE5A 3BGRB 1IKYB 5SZTA 5CZ2A 4OPJA 3QEPA 2VG5A 2ZKUA 1NJWA 4Y3CA 2HMIA 1LWEA 1YVUA 5KFAA 4CERA 2V0NA 4DU4A 4CJSA 2PYJA 4DFPA 5KFIA 2KW4A 3V1QA 3NH1A 1HQEB 3O3GA 3DLEB 4ZVHA 2YKMB 2WHOA 1J53A 3QLHB 3RMCA 1NNDA 5T14A 5J2NB 3MEDA 3DRSB 3VQBA 4OLBA 1FK9A 1CXUA 3VA0A 4E7IA 3MXMA 1LWFA 4ECWA 3T5JA 2B4JA 3NFAA 5KFRA 4W5TA 3OYLA 4JLHA 2J6TA 1VSFA 1SKRA 1F21A 3D0PA 4LH5A 2BGGA 3GV8B 3RBDA 4NLTA 4FJXA 1N56A 4DTOA 2IC3A 2OPSB 4LSLA 4F2SA 1B9DA 4GW6A 1TKDA 3LANA 2C28A 1XHZA 3V9XA 3TAQA 4RW4B 4ZHRB 2DPJA 1LV5A 1VSIA 3OYJA 2YV0X 5KG0A 1S1VB 4MFBA 2PY5A 1W9HA 1GX6A 4O3QA 2OYQA 3CDEA 4W5OA 4DMNA 3V6HA 5C5JA 3NF6A 3O3HA 4ICLA 3QIPB 3K5MA 4RNHA 4LH4A 4Z4FA 4G1QA 3KHHA 3T5KA 2HNZB 3WNFA 3IG1B 4EZ6A 2F96A 5KGWA 2HHUA 4QWCA 4YQWA 4DU3A 4J2EA 4W5NA 3I5BA 3V81B 3CQ8A 2ZQBA 3HYFA 4J2DA 1C1CA 3BREA 4F4YA 4PQUB 1JLGA 3H5YA 3SI8A 2HNYB 3MR6A 3UR0A 1NK5A 4C8KA 4QWDA 3SQ2A 1LW2B 1TKZA 4F4WA 4RNOA 4M3XA 4NLDA 1WSHA 3PUFA 4KHYA 1U4BA 4C8NA 4KTQA 1S0MA 2YKNA 1RNHA 4HCCA 5KGXA 3PY8A 4CHQA 4WYWA 2OA8A 2ASJA 5FDLB 3DLGB 4KREA 5HRPA 4GVMA 3T19A 3DRRB 4ZPBA 2I1RA 4FLUA 5FROA 3I5CA 1RT4A 5KFSA 2R8KA 2JGUA 4FZZA 4EP4A 1D9FA 4TSXA 5J2MA 1WNEA 3KKSA 4J9NA 4WZQA 3I0RB 3VQ8A 2YNGA 4ED2A 3ULDA 2BRKA 1RYSA 4CGGA 3DI6A 1NKCA 3A2FA 4CEDA 2YHBA 1QSSA 3MAQA 4MKAA 1D9DA 4K4XA 3O4NA 1NK4A 1S5JA 4F4ZA 2XI3A 4EP5A 3LP2A 4PUOB 1ASWA 1DTTA 1S0OA 3HXMA 4O3PA 2FJVA 2FVQA 2QV6A 4ED8A 1BQMA 1JLBA 3CJ4A 2E6LA 3KK1A 2Y1IA 1JLFB 1SUQA 4FJJA 4RW8A 2HB5A 1QUVA 3ISNC 5HROB 4NZ0A 2G8UA 3HM9A 3THVA 3Q8RB 2HHTA 3RRHA 3PR4A 3PR5B 2IJFA 3B6OA 1WSGA 4HUGA 2AJQA 2W9BB 4KO0B 4CEAA 3DLKB 3SQ1A 3TI0A 4OLAA 1RT5A 3M8RA 3SI6A 1RTIA 2WRMA 3D45A 3AVAA 4FJHA 4Y2CA 4ED0A 4JRQA 2JEFA 2KFNA 3L2RA 4I2PA 4CF8A 3KOAA 3AO3A 2VG6B 1LWCB 1WSFA 1FKPA 4CGFA 3S3MA 1LW0A 3GQCA 4F4XA 4DL5A 3LDSA 3OYNA 2ASDA 1S1WA 2I5JA 1TQLA 4AHTA 2R7YA 4WE1B 4IH6A 1RCHA 3SQ0A 4FJMA 3MEGA 4F8RA 4J9PA 4M3WA 3VQPA 3PX4A 4O4GA 4TYAA 5KFNA 5KT2A 2VA3A 1MU2A 1SL0A 3SPYA 1Q9YA 4CHZA 2JC1A 4JV0A 3NGZA 2IGIA 3SNNA 3AO1A 5KT5A 5DK5A 2V9WA 5KFBA 4ZPAA 1RBSA 2IJNA 3ZSXA 2WK4A 1X1PA 1NJXA 4B9VA 3TAMB 1Z26A 2VWJA 5D3GA 4IQXA 3OLAA 2ZE2B 1FKOB 3L2UA 4DG1A 4B9MA 4J9LA 3JYTB 2BR0A 1A5WA 1U47A 3PW7A 3CM5A 3HVTA 1T03B 3BJYA 2DPIA 4FYDA 1KTQA 1S6PB 3PVXA 2FBTA 5HBMA 3MFHA 4KHQA 3U3GA 5KT6A 4FVMA 4IG0B 1TVRB 1BCMA 1G15A 3RMDA 3SUPA 2HWHA 2R8GA 4ED6A 3KLFB 4O3RA 5CZ1A 4RZRA 2XY6A 1I39A 4R5PA 1XR7A 4FW1A 4OKKA 3H4DA 5DG9A 3EYZA 3V6DA 2WONB 4MK7A 4TY8B 3NGIA 1TL1A 1N4LA 1C0TB 1ASVA 3CDWA 1NK0A 4DSLA 3NH2A 3G6XA 3H98A 2KFZA 4FM0A 5KFXA 3ZT4A 3NH0A 2QE5A 4NLYA 3OJSA 2IOCA 3IS9A 1C0UB 3TARA 4KHWA 4FZXC 1KVCA 1T05A 5HRRA 2YNIB 4EYHB 3E51A 1EX4A 3SPZA 2CJQA 3CFRA 4J9RA 4FW2A 3RB4A 2B6AA 4CFCA 1N6QA 3QIOA 4OJRA 3FQLA 3DMJA 3OYGA 2R2SA 2FLLA 3V9UA 4LD0A 1NK7A 3VA3A 1JLQA 4CEFA 1RT2B 2E9ZA 4M3YA 4IRKA 1ZBIA 5F8MA 4CF2A 3PW2A 4WXWA 4HCBA 4X2BA 3SFGA 3OS0A 1TKTB 1YTAA 3QERA 3QIDA 1KLNA 2ILYA 3EY1A 1TK8A 2GIRA 4DTNA 2YNFB 1EETA 2QXFA 4NLUA 1VSDA 4O3NA 4KFBA 1BQNB 3V6JA 5HP1B 3LP0B 3OYKA 4I7FA 2E6MA 3KK3B 4M3TA 3FFIB 4QPXA 1J5OA 1JKHA 1L5UA 1RTJA 1HNIA 4NRUA 4IH5A 3RAXA 3KLHA 4ECTA 3RTVA 3F9KA 3G86A 1JIHA 5DQGA 2R2UA 4E7KA 3BQ2A 2JEIA 5FRMA 3T5LA 1VSMA 4Y1CA 3AVCA 4NLRA 1OS5A 2VG7B 4FLXA 1TKXB 3DOLB 3SQ4A 3PJXA 4Q43A 3L8BA 2HNDA 1JLEB 1ZBHA 1BHLA 4N56A 4B3OB 4RNMA 5KFJA 2BDPA 3CDUA 3FSIA 4IFYB 4ID5A 1ASUA 4J9MA 1S0NA 4ZP6A 4CF0A 5F8HA 1BI4A 3TAGA 3KJVA 2Q3SA 4R8UA 1Q8IA 1TAQA 4LSNA 4N5SA 1U04A 1EKEA 4BWJA 2X6NA 4IBNA 2W42A 4CJQA 3KK2A 2IM2A 4K4YA 4ECSA 2A1SA 4ELUA 4QOZB 2C2EA 1IKVB 4O3OA 3U3YA 4N76A 1XR5A 3QZ8A 1HQUB 5KFDA 3OL7A 2FC0A 4Z4EA 3AO4A 2X74A 4CEEA 4C8MA 2FVSA 3HO1A 4KHSA 3HVRA 4CIGA 5DQIA 2BQUA 4CIEA 3MF5A 1VK0A 5KRTA 4K50A 3O4QA 3QO9A 1SKSA 1T94A 1DLOB 3VQSA 1TK5A 2YNHB 4WYLA 2XI2A 3V9SA 2RKIB 4EBDA 4DLEA 1IKWA 2D3UA 4B9UA 1EP4B 3PHEA 4DF4A 1RBTA 5KFZA 3NAHA 4RW6A 3C6TB 3NBPB 4HUFA 4DWIA 5F8JA 2XHBA 1SL1A 4Q0BA 1RTDB 1VSHA 2W8KA 1S48A 3M8PB 4ECUA 5F9LA 4CGHA 4F50A 1RDRA 4CJPA 4RNNA 1RT3B 4DTRA 1SV5A 2OPPA 3ICLA 2XCPA 4JS5A 4CJ5A 4CJFA 2GC8A 3OL8A 5KFYA 4BE2A 4Q45A 4O0JA 3V4IA 1U48A 4F3TA 2G8FA 1S4FA 2BANA 4CEZA 4EBEA 5KFTA 3KKRA 4TN2A 4AHSA 4IR9A 3B6PA 4HVJA 3ZT0A 1S9GB 5KFMA 4BE1A 5KFHA 4Q8FA 4KHMA 3VQ9A 4M42A 3PZPA 2HHSA 4O55A 1RDBA 4RW9A 3HPOA 4KRFA 1RTHB 4ZP9A 3SYZA 4O44B 3CO9A 1DTQA 2W9CB 4O3SA 1C0MA 1J54A 4CGJA 4CHOA 3LP1B 2OZMA 4IG3B 3NAEA 1WAJA 1I3AA 1L3UA 1VSJA 4CJVA 1VRUB 3PO5A 2B5JA 1NOZA 3HK2A 4QWAA 4ZTFA 3DM2B 4DL6A 5DMRA 4FLTA 1S1UB 2QKKA 5HROA 4CEQA 3BSNA 4NRTA 4FLYA 3AA2A 4DEZA 5KFWA 4I2QA 3RMBA 3PW0A 2EHGA 1HYSA 3VQ7A 1JLAB 2ZD1A 3QESA 1QTMA 1TV6A 3I0SA 3BSAA 4E1NA 3F73A 3T5HA 4LQ9A 2G8WA 1LAWA 1Y97A 1NKEA 1IH7A 2AWZA 4JV1A 4E89A 3OYAA 1WSIA 3H5XA 1RT6B 3H2LA 3MEEA 4DF8A 1XWLA 3NDKA 1K1SA 2D0CA 4K4WA 3AV9A 3NF9A 3GIKA 3DOKB 3OHAA 3LWMA 1TK0A 5F8GA 4EO6A 3NF7A 1J9AA 1I6JA 3CM6A 2FLPA 2D41A 5I3UA 1X9MA 2OPQA 1A5XA 2G8VA 5I42B 1JLCB 1RT7A 2DFEA 4E3SA 4NLQA 5J2QB 5L9XA 4KHNA 1C1AA 3AVGA 4Q8EA 2BQRA 5CYQA 4WFXA 1IKXA 4B8AB 3ITHB 3AA4A 4NLXA 4KHRA 1S9EA 2IAJB 4DSJA 1NK9A 5L1JA 3L2WA 1HYVA 4AILC 3CFPA 2UVVA 2VG5B 1TP7A 2AU0A 5EDWA 1VRTA 1U09A 2HMIB 1LWEB 3S3OA 4B9SA 4DL2A 4M3UA 4J9OA 3U6FA 4QW9A 3K5OA 3FQKA 4GMJB 4NLSA 5KFUA 4H4OA 2PZSA 4NLOA 3OSPA 5C25A 1S6PA 3TR8A 3L3VA 3ZSWA 5J2PA 4CFDA 5C24A 2OPRA 4ELTA 4IKAA 4WZMA 4J9QA 4FK2A 3MEDB 3HJFA 1FK9B 4NYZA 2W7OA 1LWFB 4TYBA 3VQ5A 1RA6A 3HSTB 4CJUA 2O5DA 5F9NA 3RWUA 5KI6A 3TAPA 5DLFA 1B9FA 4M95A 3AA3A 4OGEA 4RW7A 2V4QA 3CYMA 1NJYA 2XGQA 3CJ0A 5KFLA 2IC3B 2JLEA 1JXBA 1SH3A 4LSLB 5C42A 3HP6A 4JS4A 1QAJA 1UWBA 2Z1IA 5K14A 4RNFA 3RB6A 3AVFA 4MFBB 4FK4A 3QINA 5DQHA 5KFQA 1QAIA 4YFUA 4B9NA 3H08A 3RBEA 2HHQA 1RT1A 5KFEA 3HT3A 4ICLB 3H40A 5T7BA 1RDDA 4E7LA 4G1QB 1NKBA 1XC9A 1Q9XA 2JEGA 5L1LA 4CF1A 1NOYA 3QEWA 3JSMA 1QHTA 1B92A 2FBXA 2WOMA 2VWKA 4G3IA 2RF2A 3E01A 5KFOA 4RU9A 3IGNA 1C1CB 4FK0A 4IFVA 4CJLA 1S1TA 4Y2AA 1UAXA 3RMAA 1KHWA 1JLGB 1QSYA 1ZYQA 4KKOA 4OL8A 4ECZA 3C6UA 5DGBA 3UQSA 2IS3A 5EWGA 4OGCA 1R0AA 1TKZB 1QQCA 4LY7A 4ED3A 1S1XA 4H4MA 1ZBUA 4URSA 2YKNB 3GIIA 4IR1A 4FZYA 3C95A 3OYFA 2HW3A 4WFYA 1KVBA 2P5GA 3M9NB 3C94A 3CWJA 4NCBA 5CY4A 4W5RA 4NLGA 1RT4B 1ZETA 4DL3A 2R2TA 3N6MA 2P1JA 5J2MB 2RPIA 4AHCA 3OYIA 2YNGB 3I5AA 3RB3A 4Q5VA 4GC6A 1HRHA 3OYMA 3LZIA 3ZT3A 3DI6B 3AA5X 3TAFA 1N48A 2R8IA 3OJUA 5J1EA 4IDKA 2G8IA 1HNVA 3I8DA 4F3OA 4N47A 3LP2B 4FS1A 2IM0A 4PWDA 3IRXA 1DTTB 3OYDA 3DRPA 1BQMB 3H59A 1VSEA 1JLBB 3KHLA 4K4ZA 2J6UA 5KFCA 4ECRA 3KK1B 2KZMA 1ITGA 4EZ9A 1QE1A 3UIQA 1SUQB 5EUHA 4ECQA 4RW8B 4JUZA 3D5MA 3GV7B 4FJNA 2YHAA 4BACA 3EPGA 4CK2A 3WNGA 4GC7A 4KV8A 4NCGA 2V4RA 2E9RX 1KLMA 4CE9A 3OVNA 4F2RA 4TXSA 2WB4A 2LSNA 3KLGA 1RT5B 5HLFA 1RTIB 1FXXA 3K59A 1S6QA 5KG4A 4U7CA 3M9OB 4I2PB 4CJTA 1FKPB 5KT7A 4PA1A 3O3FA 4F4KA 1LW0B 3QYYA 1BIUA 1S1WB 2I5JB 1C2PA 5KFPA 4DQQA 5KG5A 1NHUA 2EC0A 3MEGB 2A1RA 1IM4A 4R0EA 1REVA 4AHVA 3OS2A 3ZSYA 4ZP7A 2DY4A 4KAIA 1TL3A 4O4GB 1N5YA 4BWMA 4YP3A 2IA6A 4Z4IA 2XGPA 1CZBA 5CYMA 4E1MA 3UDLA 1MU2B 4KB7A 2BQ3A 1C1BA 3PV8A 3LWLA 3KLEA 3KLIA 3SFUA 3OYCA 2BE2A 4FJ8A 3M8QA 3LAMA 3ASMA 3DYAA 1HMVA 2D0AA 3ALYA 5JS2A 3BGRA 4O5BA 1IKYA 3L2VA 3GILA 2UVWA 1IG9A 5F8IA 1HPZB 4DSFA 4Q44A 3MTKA 3BQ0A 2JEJA 4ZVFA 5KFFA 4KB1A 1KRPA 5D3GB 4Z4CA 4YNQA 1T7PA 1GOBA 3V9WA 5KTQA 4DG1B 3Q8PB 3HPHA 4ZVEA 3HVTB 1HQEA 2E4LA 3DLEA 1D0EA 4K8XA 2YKMA 5HBMB 3EZ5A 3S3NA 3QLHA 4KHUA 3QEXA 5J2NA 3BSOA 2XY8A 2Z1JA 3DRSA 3ZSZA 4K4VA 3KTQA 4URQU 2HVIA 4K4SA 3LAKA 4DSEA 2ATQA 1MMLA 1NK6A 3SV4A 4URGA 5DG7A 4R5PB 4KBIA 1QSLA 4HYKA 3OL6A 3V6DB 4DTSA 1TL1B 2OPSA 3KNAA 1D8YA 4FLWA 2RDIA 3LPTA 4NLVA 4FLZA 2FVRA 4RW4A 4XPCA 4ZHRA 4N41A 3ZSOA 1K6YA 2GV9A 1S1VA 1YT3A 4M3ZA 3IS9B 4QWBA 4FJGA 3CJ2A 2Z1GA 1T05B 3QIPA 2C2RA 3V1OA 2KTQA 3KMQA 2HNZA 1RBUA 3IG1A 3OYHA 1RDAA 2XY7A 5KFVA 3TWHA 2B6AB 1N6QB 3V81A 4DTMA 3QNOA 1RT6A 3DMJB 2X78A 5KG6A 3QGIA 3SUQA 2AQ4A 1RYRA 1S97A 1JLQB 4PQUA 3Q8QB 2JC0A 1S9FA 2RDJA 3VQDA 2HNYA 1ZTWA 1LW2A 3AVJA 3TABA 2GUIA 1TGOA 4CF9A 1KFSA 4HTUA 2AGPA 5DGAA 3AVMA 3G6YA 3DDKA 4M41A 4B9TA 1EETB 3V6KA 4ZP8A 4KFBB 5EWFA 3HPGA 4BE0A 1SH0A 4K8ZA 4I7FB 5FDLA 3G6VA 3DLGA 3NF8A 4DS5A 2GIQA 4CJRA 2HAIA 2G8HA 3VQAA 3DRRA 1J5OB 4AHRA 1JKHB 1RTJB 1HNIB 2DFFA 1UA0A 3KLHB 4AHUA 4FJ9A 5EWEA 2AGQA 1JL1A 4ECVA 2ASLA 3IN5A 3UPFA 4B9LA 4J2AA 2UUWA 3P83D 3I0RA 4ECXA 3QGHA 3OY9A 4DQSA 1VSLA 2HNDB 3KD5E 4C8LA 3S9HA 3MFIA 2NUBA 3SJJA 3ISND 3EPIA 3PW5A 3N6NA 3NMAA 4W5QA 2R8JA 3GIMA 1S10A 4PUOA 5JS1A 4ID5B 3ZT1A 1X9WA 2B43A 4O4RA 1BI4B 3ZT2A 3ZSRA 4ED1A 4MK8A 3L2QA 3KJVB 3AVNA 1Z25A 1A5VA 4R8UB 4LSNB 4KI6A 4HKQA 4WXOA 3H5SA 1YTUA 1JLFA 3MR3A 4ID1A 1JXLA 3ZSVA 3KK2B 4FM1A 4E7HA 2OZSA 3ZSQA 2AGOA 4DTUA 1S49A 2W9BA 4KO0A 1RILA 1WNSA 3DLKA 2ILZA 2IDOA 2XY5A 2EX3A 2HHXA 2VG6A 1LWCA 4NCAA 5F8LA 4ZMMA 3OSNA 3QO9B 4WE1A 5KFGA 5DG8A 3NGDA 2XO7A 5KG1A 3T3FA 1IKWB 4DL4A 3OS1A 3SZ2A 4J9SA 4QAGA 1NJZA 4Z0UA 4DS4A 1RA7A 3MECB 4RW6B 4UQGA 2F8TA 4CJEA 5SWMA 1RDCA 4Q0BB 4BDPA 3VQCA 2HVHA 4DTXA 3KHRA 2BRLA 4RG8A 1X9SA 3AO5A 4DSKA 3HVAA 2KZZA 1SH2A 4H54A 1NHVA 4KPYA 1SV5B 2OPPB 3TAMA 4DQRA 1U49A 4YR0A 3T1AA 3Q8SB 2FVCA 2RN2A 4XIUA 2ZE2A 1FKOA 1W25A 2FBYA 3LP3A 3V4IB 3JYTA 3KHGA 1JXEA 4CHNA 4OKJA 4CK1A 2BANB 1T03A 3VQ6A 1L3SA 1WSEA 2KQ2A 3CIZA 4ELVA 4OPKA 4YR2A 4IG0A 4CFAA 1TVRA 3CVKA 3KLFA 3PW4A 4FM2A 1U45A 2FVPA 3FDSA 4RW9B 2D0BA 5L1IA 4MIAA 1XR6A 3TQ1A 3OLBA 2WONA 4TY8A 1DTQB 5FRNA 4HUEA 1C0TA 4I9QA 1ZBFA 3RRGA 3TAEA 2ETJA 4YR3A 4KTZA 5L1KA 3FRZA 1CXQA 2B5JB 3WNEA 4CJKA 1UA1A 1KFDA 2OH2A 4E7JA 3PJWA 1C0UA 4IKFA 3VN5A 4DLGA 2G8KA 3K58A 3QGGA 2YNIA 4I9LA 4I2QB 2GBZA 3TANA 3MR5A 2UVUA 1HYSB 1T3NA 4KSEB 4MK9A 3LZJA 2ZD1B 3D28A 3MXIA 2CKWA 3HP9A 2HHWA 4CJ4A 1TV6B 3I0SB 5KG2A 4DTJA 1T8EA 3AVHA 2E9TA 5JXSA 3PX0A 4Y34A 2ATLA 4E19A 3GV5B 3LPUA 3MEEB 4DFJA 1HYZA 4AH9A 3TVKA 1RT2A 1BCOA 3LALA 3KMSA 2FJXA 1QS4A 2FJWA 2QK9A 1YVFA 2UUTA 4DFMA 3RAQA 1SL2A 3CJ5A 2FBVA 3OL9A 1TKTA 1L3TA 3RR8A 2IM3A 5I3UB 2OPQB 1BL3A 4C8OA 2DFHA 3KLVA 1KVAA 3V1RA 1RT7B 2D5RA 2YNFA 3SUNA 3AVBA 1BQNA 5HP1A 3LP0A 4FXDA 2UVRA 3IGVA 5CYQB 4CHYA 1IKXB 3KK3A 4DSIA 3FFIA 3AVLA 3HL8A 4CHPA 4FJIA 1S9EB 2C22A 1BIZA 1HPZA 5KG3A 1KSPA 3CJ3A 4FBTA 2XC9A 3GYNA 3VQ4A 3VQQA 1HJRA 3OYBA 1VRTB 4K4TA 3NHGA 5KT4A 4NYNA 4TY9A 5F8NA 2VG7A 3OYEA 4H4OB 4TQSA 4FS2A 1TKXA 4DQIA 3DOLA 1RBRA 1Z4UA 5C25B 4CIFA 3BDPA 1JLEA 4FCYA 5J2PB 4B3OA 5C24B 4TQRA 2OPRB 4Z4GA 4IFYA 3KD1E 4TLRA 3SUOA 1GOAA 3KIOA 4KAZA 3P5JA 2WTFA 1CLQA 3MXJA 2X6SA 3K57A 4FJLA 3QNNA 4OVLA 1K1QA 2W8LA 1WSJA 3K5LA 4RW7B 3NCIA 2DTUA 4CGDA 5KT3A 4ZPDA 4QW8A 4ZPCA 3ZCMA 3DLRA 1IKVA 4H8KA 3K5NA 4IRCA 1HQUA 3G10A 4FLVA 5C42B 4IH7A 1UWBB 4NLPA 4CCHA 3NKYA 4DTPA 1W0HA 4KTWA 5K14B 3G0ZA 3CFOA 4PY5A 4MKBA 4HHTA 3K2PA 1C6VA
chains in the Genus database with same CATH superfamily
3NGUA 1L3VA 1Y5NB 2ZBQA 1P90A 3CJCA 5DM7L 3MR2A 2CQPA 1BMQB 1N32J 4USWA 5JUMA 2ZJQL 1SKWA 4CO3A 2XCAA 1YF5L 3H5UA 1NMEB 3HHLB 5E26A 2RF2B 4I6WA 4BDZA 3C6TA 2IM1A 1NH8A 1LAVA 3ENOA 2D7SA 4WTYA 4M3RA 2XS7A 5AQQA 5AT1B 3TUPA 3SCJE 3KHYA 4IOBA 4H03B 1G2EA 1GLBG 1JX4A 3SXLA 3W2VB 3C6UB 1Y5LB 3GIJA 2OSRA 3IAS9 4OIXA 1N0UA 1TL4A 2ALZA 4U6PA 1S1XB 2R4FA 1HA1A 4I6AA 4A59A 1D1UA 4LF5F 5HQLA 1YGYA 2MY8A 4AYBD 4ZTJA 2PMHA 2FLNA 2RNEA 3IR6B 4IFEA 1MWYA 4U9RA 4K43A 2AX1A 3C66A 3CC2S 3SIPB 3AVIA 2Z8QA 4O0NA 2I6WA 5HQ8A 4AM6A 4KPCA 2EPIA 1K8AO 1GOCA 1KAXA 2OTLS 1Q7YT 2F8MA 2DKOB 1S7HA 2HSEB 1RTHA 1UTAA 1VBXA 2O4IA 4JAXA 2HKEA 3D9BA 4TU7A 4DL7A 1KC8O 3CCSN 3TZXA 3CD0A 2W9CA 1GLAG 3QFUA 3WC2A 1GXUA 4ZJQA 1HNVB 3BR9A 1VQLS 5IQ6A 3SV3A 3IRXB 4B8CA 2PMZD 1NM1A 2W24A 3PHTA 2KRRA 2JLGA 2PYLA 1FEHA 3MM6B 2MEWA 4Z4HA 4CEOA 4B08A 5B09A 3BF4A 2CXEA 3EGWB 1RAEB 3W66A 2W40A 2OFGX 3KLGB 3NL0A 4DU8A 4MYUA 3GMGA 4O0IA 1IM6A 3AQOA 3QEIA 1XIQA 4A8MP 3DOKA 4M63A 2L41A 2HF4A 2W9AA 4PPDA 4JD2B 4ZLNA 2J9DE 4C1NK 4HVZA 4RUCA 3AO2A 1REVB 3FVYA 2PE8A 3QJPA 1KTVA 3PDNA 2XMKA 2RUSA 3PX6A 4X64J 1F5AA 1YVNA 3HVWA 1O1WA 1NK8A 3BQ1A 1HMVB 4DQPA 4KE5A 1XQSC 3GP9A 4UT4A 1EIYB 2X51A 2NNWA 1NJWA 1UCNA 4M63C 2HMIA 1UW4A 4C23A 3ZZZA 5CAAA 3MMJA 2PYJA 2V8VA 4DFPA 5E0OA 5ITHA 4D3HA 4F25A 3I4PA 3G2XA 4WFNQ 3VPZA 2E5JA 4FKXA 2MGZA 3W5ZA 3QLHB 3RMCA 2O8DA 3RAMA 3MEDA 3DRSB 3GJQB 5G0RA 4E7IA 2YQ1A 3MXMA 1N88A 2DH9A 3NFAA 2DIUA 1OMSA 4JKGA 4DR7J 3ZX2A 1KD1T 2Z2LA 4JLHA 3QSYB 1VSFA 2BGGA 1NGEA 2LQ8A 3RBDA 4GKJJ 1Q16B 2A6MA 4H5TA 2UXDK 3HI0A 4F2SA 1B9DA 5IFMA 2JX2A 1XHZA 2FZCB 3V9XA 3TA0A 3JQJA 3WBZA 4ZHRB 2DHXA 4OZ2A 2Q6BA 1M5OC 1P9QC 1FJCA 4Y0FA 4CTAB 2B8QA 2DXDA 4Z4FA 1GMVA 2DITA 4G1QA 3IR5B 3KHHA 4EZ6A 2CZVC 1FXRA 3CQ8A 3R7BB 4F0KA 3AH6A 4FZVA 4OFZA 1MWMA 3TA1A 1C1CA 4K41A 2N7CA 3O5BA 1N0VC 4A8SA 1UL3A 1JLGA 1BDGA 2ZEJA 1HHSA 5CD4H 3UR0A 4C8KA 1IWAA 3K5PA 3EEQA 3Q83A 5THWA 2RUGA 1TKZA 1WSHA 2GVZA 3CCJN 3FEYB 1S0MA 2YKNA 4BRQA 3OFFA 3GJTB 3C3LA 1FDDA 4DUTA 4PQAA 2NXEA 2BUPA 4ES1A 3B6BA 5HRPA 4GVMA 3DRRB 2PIIA 4RLEA 3ZX3A 4ZITA 2W7AA 4JHDB 2JGUA 4FZZA 2F65A 4EP4A 1D9FA 3NG8A 3CCES 3BR8A 1ATSA 4J9NA 4WZQA 1LK7A 4BROA 5AZJB 3I0RB 4DR4F 2XMTA 4HHJA 3W64A 4OJHA 3ILLA 3A2FA 2RRAA 3GSDA 4UY8O 1D9DA 2UYTA 1WEYA 5IXUA 1AUDA 4F4ZA 3FR0A 4USHA 4EP5A 1JJ2M 4OX7A 4PUOB 2GAHC 3GWCA 4ATNA 1SQGA 4O3PA 1VDHA 2EC2A 2FJVA 1BQMA 1VQ8N 1JLBA 3R9LA 5AJ3J 2DRBA 4FL9A 4B3TF 4CYUB 1SUQA 3K0JA 3R7SB 4P73A 3VAIA 1KN6A 1EO1A 2MXYA 4CP5A 1XERA 3THVA 1R8AA 2I9SA 1NB7A 2HHTA 3PR4A 4LF6F 2DNKA 1S72S 3TI0A 4PL7A 4DCHA 2F5GA 2J9DA 3R5GA 4JRQA 2KFNA 3L2RA 1I51B 3L7PA 3UCUP 2CJ9A 1LWCB 4F67A 1HNZF 3WXJA 4DL5A 2ASDA 1N5QA 1PO6A 1TQLA 2J5AA 4Q2MA 4C0HA 3SQ0A 4Q7AA 1RP5A 1IBLK 2DHGA 2PSZA 1SXLA 4LFAJ 1M1KO 2JOQA 3VQPA 1W97L 4LIRA 3UNGC 2DRAA 5KFNA 2VA3A 2Q6CA 4B3MF 4CHZA 3NGZA 1UEKA 3CT9A 4FWLA 2PFDA 2YBVA 3BV8A 1BQXA 3IXQA 4U8VA 4HHUA 4ZA1A 4DV0F 2IVYA 4ZPAA 1RBSA 5F3ZA 3MTJA 4B3RF 3R3LA 1X1PA 1AT1B 6AT1B 3TAMB 2VWJA 2V94A 5D3GA 3OLAA 1FKOB 4J9LA 3ZTOA 3OR2B 1A5WA 3HBTA 2CJBA 4LRCA 3HVTA 3I56N 3BJYA 2VDHA 2E29A 3TW0A 4FYDA 4HTIA 2UUCF 1C0FA 4DCJB 2CG8A 3EKUA 2CNNB 3M32B 4KHQA 3CERA 2E88A 4ZCKA 1KONA 1G15A 3TA2A 1UW9A 3SUPA 2HWHA 1WEZA 2R8GA 3KLFB 1Z1ZA 4RZRA 4U7UD 4PXDA 2AJ4A 2V8GA 4OKKA 2D1KA 1XMQK 3PSIA 3EYZA 2EBGA 1S22A 2BW7A 1M0SA 1IN0A 1YHQS 1C0TB 2UU9J 1K47A 1ASVA 3OHRA 3CDWA 1Y00A 2C3MA 3MN6A 3G6XA 3H98A 1X5TA 3ZT4A 2QE5A 2AEJA 3SK3A 5IQQA 1C0UB 5C2DA 1KVCA 4GO5X 4EYHB 1OWXA 1EX4A 3AOBA 3A8KA 4PG4A 4UY85 1I1GA 2XLJA 4FW2A 3RB4A 1ZH5A 1QD1A 2B6AA 4P7VA 1N6QA 3QIOA 4L3NA 3VF2A 1X4AA 3FZ2A 4LD0A 1NK7A 1GXTA 3M4XA 2QWNA 4EU0A 3PYGA 1K0TA 4CEFA 1JMTA 2RU3A 2P9IB 4M3YA 3BH7B 4CF2A 4HCBA 1B99A 4IWVA 3SFGA 3RW7A 4JI8F 4EK2A 1ZAVA 2MKCA 1T6DA 1YTAA 4A46A 4OZLA 3J7YP 1XNQK 3QIDA 5LSRA 4F36A 2GIRA 5EN1A 1NUEA 2JVOA 4NLUA 4LMZA 2OMOA 1WOQA 1DURA 2E6MA 3KK3B 3EMTA 3Q24A 2C1EB 4IO1A 1LCUA 5LT5A 4WJBA 2D3O1 1L5UA 1FWLA 3R2DJ 1WC4A 1GMWA 1JIHA 2D3OR 1FRXA 5DQGA 4E7KA 2JEIA 1VSMA 2YWWA 4Y1CA 1S59A 4LSZB 2DNZA 3EGNA 1KS2A 4FLXA 1MN9A 2GA7A 3SQ4A 2BACA 2XTJP 3PJXA 2EKYA 2E7XA 4DV2K 2XMVA 2LEAA 3KJQB 5F8HA 1HI1A 2DNMA 1HBMA 3R1LA 2Q3SA 4R8UA 3MN5A 2Z2MA 2FSKA 2HVEA 3KK2A 2IM2A 4K4YA 4WK3A 4F3QA 1HKBA 4QOZB 3CMQA 3H7HB 1PC4A 4N76A 2QA4G 1XR5A 5KFDA 3RYLA 2X74A 4BCAA 2G2YA 5DQIA 3SBTA 5HSPA 4WKRA 1FWKA 3BEXA 2Z2ZA 5CH7B 1SKSA 4K50A 3O4QA 2KHCA 3IA0A 1T94A 4IEIA 1TK5A 2YNHB 1T02A 3T69A 1NSQA 3TU5A 2XI2A 4WBFA 2A41A 4HR2A 3J8AA 2MKSA 5I3PA 2MQ8A 4B9UA 3PHEA 3CJ7A 3WHIA 4DUYF 3P31A 3ZLJA 4OX6A 5JVHL 4RW6A 8AT1B 3PYEA 2P9NB 3BBFA 5F8JA 1SL1A 4H0TB 2H1YA 1VSHA 3M8PB 4Q2LA 2DJWA 4CGHA 4F50A 4CJPA 1O51A 1LWXA 5C10A 1SV5A 4X4RA 1KWMA 4DV4J 1EARA 4LF2A 2D9PA 3CW2C 4BE2A 2U1AA 2KB2A 2V2VA 2XHWA 4Q45A 2DT9A 4O0JA 4IOAQ 3EWGA 2BANA 4CEZA 4EBEA 5KFTA 2UP1A 4PCQA 1K9MO 1R3NA 4TN2A 3PIOQ 3ZZYA 5AE3A 4IR9A 1OYEA 4G9ZA 1S9GB 1HBOB 4CZJA 4BE1A 2CZ4A 2EVZA 2ASOA 3LM9A 5BRDA 1NGHA 3IP0A 2NUHA 4NASA 4RW9A 4LF9K 4KRFA 4ZP9A 5F41A 3CO9A 1VFJA 1C0MA 4Z37A 1I5OB 3LP1B 5BR9A 4C9DA 3ZTPA 2IY5B 3G82A 1Y3JA 5D6GA 5BRHA 1I3AA 4YOUA 1VSJA 4C3KA 1VRUB 1YJUA 2R7WA 2V7ZA 3DM2B 2NZCA 3G71S 4DL6A 4NA3A 3ENBA 3WT0A 4EAHD 1KOHA 4FXWA 2F7TA 2M52A 4KH0B 3W60A 3RMBA 3PW0A 2Z2YB 3NXZA 3DXBA 3QESA 3O4WA 1SI9A 3FBCA 1QAXA 1NKEA 4TKTA 4E89A 3H5XA 1RT6B 5B0GA 3MHYA 4ZN3A 4RU2A 4K4WA 1N8RO 2P9EA 1TK0A 4EO6A 3NEKA 4JYAF 2UV8A 3GOIA 5AQXA 1U24A 1I6JA 1CC7A 1NLKL 4DV1J 1XNRK 3IAM9 2D41A 3HKZD 1FESA 2G8VA 1NJIT 2BV3A 5I42B 3P4UB 1UMJA 3VR1A 2K1RA 5L39A 3G8TA 4Q8EA 3VAHA 1HIYA 4ILRA 4WFXA 3ITHB 3MM7B 3PEJA 2E2PA 3I9V9 1Q7LB 3THYB 3RVCA 4B1VA 2EFOA 2VG5B 2BJ3A 2APOA 4W98A 1TP7A 2B8PA 4NXMF 3ZETB 1U09A 1LWEB 1HWLA 4N7TA 2HHPA 3K5OA 3UKRA 4GMJB 1CULA 2FY1A 3OSPA 4FPRA 2KM8C 3I82A 3J81j 2VICA 5C24A 2B7BB 4ELTA 2AW0A 3OW2M 4X65K 1S4EA 3BO2A 4CLPA 4ES2A 5LMNK 4CJUA 3VESA 4BGAA 1WC3A 2X1GA 1B9FA 4JI4K 4ETXA 3AA3A 2DY1A 4DX5A 2XGQA 5KFLA 5D0RA 2IC3B 3EGVA 2JLEA 4X84A 1SH3A 2NRRA 3I55S 3M5RA 2I7NA 2VODA 4JS4A 1QAJA 3HFVA 4CBUA 3BGFA 1WG4A 2BVZA 4MFBB 4RUHA 1ZM2A 1XMOK 4YFUA 2BKPA 3H08A 1YRTA 5EY4A 3HT3A 2H4YB 3H40A 2IFXA 4MTPA 4ISGA 2ZFHA 4E7LA 2IYGA 3OXGA 4AT1B 1XC9A 5L1LA 2XYHB 2CJKA 3HHLA 4FNIA 4G3IA 2RF2A 5KFOA 3VWSA 2E20A 2ZZTA 3VVUA 2HLUA 5B0BA 3RMAA 1KHWA 1PJ5A 1CS4B 2E5IA 3CC4N 1XJWB 1YWXA 5BYSA 3W2VA 2PI4A 3C6UA 2MMYA 4F0HA 1LOTB 5JVGL 5EX3A 1S1XA 4R25A 3NNCA 3GIIA 4IR1A 4FZYA 2EG1A 3C95A 3TTDA 2V63A 4UOFA 3DAWA 4C6AA 3OYFA 2R7VA 1TZ0A 1KVBA 4MJKA 1U6ZA 3C94A 4NCBA 4LRBA 5CY4A 4IZ9A 3AJ1A 4DL3A 2R2TA 3DDNA 3FE1A 3NCQA 3N6MA 2JL9A 5HMYA 1U1RA 5J2MB 4V1Ak 2WVBA 1WI6A 1U2FA 5LJ5Y 3I5AA 1EQMA 5DS7A 4Q5VA 3LZIA 1HRHA 3VEYA 3DI6B 2CQGA 3MN9A 3ZT3A 2KU7A 4TVAB 3B8HA 3PRBA 1N48A 1OYDA 3CMAN 3OJUA 2G8IA 4DR3K 1HNVA 1S77D 2XNQA 3LP2B 1O0PA 5LM7E 4FS1A 1X4CA 2LQ5A 3T41A 3IRXA 2W1BA 3ZYYX 3HHDA 4TLQA 1VQ9N 2DGSA 3PNIA 1X4DA 3MM6A 4FF4A 1VSEA 3EVOA 3Q7CA 3DDIA 2KZMA 3BF1A 5EUHA 4OYIA 1AROP 3CCRS 2NSCA 1WBBA 1TUVA 2YHAA 4ANDA 1DJ0A 1Q86T 3EPGA 2VOPA 4CK2A 4J91A 2V4RA 4O8KA 3OVNA 4HEA9 3KLGA 1RT5B 3H45C 2RIJA 3UNYA 1OVYA 3VAFA 5C2FA 4U7CA 2JSXA 5E3PA 5T7LB 1EAYC 4CJTA 2UUBJ 1NH7A 1BIUA 2I5JB 2XYGB 4JD2A 4DQQA 1REGX 5KFPA 3AHPA 5KG5A 2XMJA 1H1VA 4JB8B 2A1RA 4R0EA 1REVA 3ZSYA 3TJ8A 1U25A 2DY4A 4KAIA 4HT7A 1WF2A 4O4GB 1RU2A 4BWMA 4YP3A 2GELA 2VC1A 2B4OA 3WIVA 1IG8A 4E1MA 1LFWA 3E9PA 4NLCA 5AQUA 2VJVA 5F0XA 3OYCA 5BPLA 4FJ8A 3LAMA 3ASMA 3RRKA 1HMVA 1N5VA 1R59O 3ALYA 1IG9A 3GILA 2WTUA 2NXJA 1UETA 1X60A 2QWOA 1NLVA 1FRMA 2QWRA 4ZVFA 2GJFA 2IDLA 5LMUJ 4BHQA 1KRPA 1T7PA 1GOBA 4KC5A 3A3OB 4DDFA 1XMQF 3HPHA 4FKYA 2E4LA 2AJ1A 1D0EA 5JMNA 2MQNA 3QLHA 4DHYA 1ZAWA 3QEXA 5IZHA 3DRSA 3KTQA 2K3IA 4URQU 1GAOA 3U1MA 4OX9F 3BUZB 1RAGB 1HI8A 3BF3A 1RDUA 2BE9B 3SV4A 4AXJA 4KY3A 1NPRA 2CPDA 1QUPA 1RU1A 2OUGA 3OL6A 4AL6A 3DXMB 3V6DB 2ZWOA 4HLBA 3OVBA 2CQIA 4FLWA 4MT1A 4P7TA 2A42A 4ZHRA 2YHWA 2YQ0A 4LFBK 3JB9k 4M3ZA 1BY9A 4FJGA 1VQ7N 4CTAA 1YUWA 3BZKA 3CJ2A 4OZ1A 2WVDA 1T05B 1ESVA 4NMLA 4OJ1A 4LF7K 1KQGB 5A0YB 3V1OA 2KTQA 1ELOA 4OI4A 1AXQA 3PCOB 2GHPA 4RTFD 1RAIB 2CQCA 1RDAA 4DI6A 3TWHA 1FFSB 2P9SB 4DTMA 3DMJB 2X78A 1RAHB 1Z6RA 3SUQA 5BR8J 4PKHA 2YVSA 1S97A 1J5EK 2GCFA 3Q8QB 2LECA 3NWRA 3CJAA 3TABA 3K9KA 1PYTA 3LTOA 3PLAA 1RQ0A 4Y00A 2XQCA 5DDPC 1HNWF 4CDIA 4DV5K 5CQGA 2H5IB 4DJBA 3QAUA 5IT9O 4KFBB 1M90O 3TZWA 4I7FB 4I64A 1FNOA 4KGMA 2G8HA 2AT1B 3D66A 3DRRA 3AD7C 1JKHB 2F40A 1HNIB 3KLHB 4JHDA 2D69A 1Q4RA 1JL1A 4ECVA 3IN5A 2NS1B 4PXEA 4KIAA 3VOVA 5AZJA 3I0RA 4ECXA 2CQBA 4AUKA 4X62K 1SJFA 1VSLA 4NEYA 3S9HA 3MFIA 2NUBA 2K7KA 4QOTA 1YAGA 1JCFA 2IVFB 4C11B 4DR5F 2HBJA 1P8GA 3GIMA 5KQDA 4PUOA 2G2OA 3ZT1A 2V5HG 2OANA 1BI4B 5HN0A 3R3TA 3L2QA 2W2OP 3JAMY 4LSNB 3AFGA 4CYUA 1WBDA 2QM1A 3OQ2A 3W1YC 3A8EA 4E7HA 2OZSA 1OH8A 1YJ9N 4XH1A 2VQFF 1AFJA 1FWPA 4OYOA 5AQPA 1RWVB 2EX3A 4JV5K 4G65A 4Y2KA 2HHXA 3CB4A 4FYXB 3JTOA 1RCOB 3DRXA 2BM1A 1EWRA 1LWCA 1VLOA 5H1SV 2Y0BB 1U1LA 4CH0S 1OPIA 1JCGA 3BBBA 2DR9A 2H3GX 3GCXP 3H42A 3WX4A 3EVWA 1UFLA 2UUAK 2QXLA 5TKYA 4DL4A 3OS1A 1E4FT 1T9XA 3MECB 3ZZRA 5AQGA 2HF3A 5AXLA 2QWLA 4CJEA 4NZ7A 2EFNA 2E7WA 4Q0BB 5AQKA 3L4BC 1IJJA 1U6BA 3MGJA 4JI5F 3O6QA 3AO5A 2GZOA 2GMLA 3HVAA 1BC6A 3MPVA 4OHYA 3TAMA 5E3CA 4DQRA 3Q8SB 2RN2A 4GMKA 4CT8A 1FKOA 2EKNA 4LF9F 3R5CA 3OR2A 4DR2K 4EUVA 2DNYA 3VQ6A 2QRRA 1FRHA 2PMWA 3T7ZA 3FGVA 2CIMA 2MQLA 4KRWA 2DNNA 3CIZA 2DGOA 3U02A 3M32A 5BREA 2JWNA 4QS7A 4CFAA 2G2ZA 4EFHA 4NYOA 3CVKA 3KLFA 1X0PA 3FEZA 3O8WA 1VBZA 4UZBA 3UW1A 2E5LK 3O9TA 4JI7K 4IUFA 4DV7F 5L1IA 3TQ1A 5AXNA 3D4JA 3OLBA 2D74B 2FHOB 4LF8F 4HUEA 1C0TA 1URRA 4DXLA 2BEFA 1ZBFA 3KVGA 1VQPN 3J81U 2PA3A 3ONQA 4RO0A 2ETJA 3FRZA 3W9IA 1PGZA 3WNEA 1N34K 1UA1A 3O44A 4CJKA 4E7JA 1C0UA 3VAGA 4IKFA 3ENHA 3VALA 4JI1K 4I9LA 1CJVB 4I2QB 3MX2A 3CCMN 3MM5B 1HYSB 1T3NA 4KSEB 4MK9A 1XC3A 3CJKB 1FJEB 1TYQB 1YJRA 3O1WA 3I0SB 5ELZA 3X1LB 5FLXY 2E9TA 3MPYA 2LCWA 1H38A 3IMXA 3CQXA 4V19S 3LO3A 1BUPA 4USKA 4DV6K 2Q79A 4BC9A 4AH9A 1YIJS 1NSKL 3KMSA 2P9IA 1TTHB 4C1NI 1RLDA 3K7RA 2GMHA 3CDBA 2QMWA 4G1PA 2UXBF 3RR8A 3IM9A 2DY9A 1VQ4S 1BL3A 3KLVA 6FDRA 1KVAA 2RILA 1RAFB 4UOGA 1FJ7A 4F3MA 4YUDA 3UD3P 2ZHOA 3S6EA 3CC7S 1Q8BA 1YI2S 4CO5A 3EDRB 3P3DA 2ZH3A 3KK3A 4DSIA 3Q8UA 3AVLA 3HL8A 2KJVA 3TJAA 3R8YA 1BIZA 2J8AA 1IBMK 1VK8A 2HG4A 3GYNA 2E1CA 4GY2B 3E9LA 1W2BM 3OYBA 1VRTB 5KT4A 2WVFA 2HBLA 3H3OB 2XS2A 5ADZA 3M6WA 2QEXS 2VONA 4H4OB 3M1FA 5C25B 1VQMS 4CIFA 1S99A 5CZXA 2OPRB 1GMWD 4Z4GA 3R8EA 2B4PA 1U0HB 3UDCA 2UXDJ 3H1QA 3P5JA 1XBWA 4ZPWR 1CLQA 4AL7A 4PXCA 2FTRA 3K57A 3QNNA 4AL5A 3K5LA 4RW7B 1RTZA 1VS3A 4ZPDA 1W7WA 1KOOA 1AYEA 3G10A 5A2QY 3GZ7A 2OSQA 3CULA 5C42B 4NLPA 4ZCIA 4ZK7M 5K14B 3G0ZA 4MKBA 3HDSA 3K2PA 2VQEF 4J9VA 1C6VA 3IMQJ 4FBUA 5LL6d 4RWTA 3N6LA 2MPUA 2Z1HA 3M8SA 2N4DA 3VF6A 3CD7A 1D5AA 4XPEA 5LSOA 2VU5A 2F1FA 2YNHA 3FZMA 4QU7A 2CRLA 3OTOF 3MM8B 2D0OA 1YLXA 3CJ1A 3N4WA 3G87A 1Q78A 1UVLA 3QT5A 1G7CB 1BISA 1SVDA 2P9NA 2ADCA 4MIBA 4IFVB 1WAFA 1VQ5S 1OO0B 3ULEB 4DFKA 3M8PA 1TUYA 5KFKA 5DRKA 2QO3A 1YKWA 3E66A 3J7A1 4TU9A 1R0AB 1JXVA 3TX0A 4OLOA 1BD6A 4AE5A 3V9ZA 4NA2A 4H4MB 4AM7A 1RISA 5GADP 2XWXA 1Y64A 5E41A 2V69A 3NS7B 2CWXA 1NGGA 3ZXWA 2CJAA 3CG7A 1CSJA 2LU2A 1S9GA 4YY3F 1HBOA 3MM9B 4MQ3A 3I8BA 5HRNA 3BGOP 4BR4A 1FF2A 4R79A 2FXUA 3TPQA 3NY0A 1B0PA 4BRLA 5IT9U 5M1FA 2NUUG 4IYQA 1JJ4A 4M94A 4MH8A 3DLBA 2IBKA 3QT6A 2V7YA 2L3MA 5CHCB 3N5FA 2P2CB 2NYHA 3A5OC 3QICA 4JRPA 3N4QA 3LP1A 2CADA 2WCXA 4J2BA 5J1EB 2F8SA 3QT8A 3NE6A 1VRUA 4BC5A 2VPWB 1LNQA 2ZH9A 1HNXK 3DM2A 4OV1A 2V67A 3P1GA 2JWKA 3UKUB 4Y2MA 4CESA 2HS4A 4BRNA 3B4MA 1BOTO 2KH9A 5ETQA 5DLGA 2ZUGA 4KI4A 4NCGB 2F9JA 4PXBA 4CLLA 5CR4A 5HLFB 4NI2B 1UOCA 2GFFA 4WFNL 1RB0A 1S6QB 4BS2A 2AX0A 2W25A 4OKEA 1H6KX 1IBLJ 4CLZA 3H6EA 5F1XA 2RDDA 3N28A 2P51A 2Q36A 4OHXA 2O4GA 4Y1DA 5I42A 3M2VB 1S6OA 3AOCA 3QMQA 4YHHF 4QCLA 5KRSA 2QKBA 3CCSS 1MDUB 1P8ZA 3KLEB 1ZM3A 1UWAA 3H1VX 3ITHA 4FWNA 3MM7A 3M1VB 3BGRB 2YX4A 3THYA 5SZTA 2DNRA 1W7AA 2VG5A 2ZKUA 1MA9B 1G99A 3ZETA 3L4IA 1LWEA 3VHQA 2OJ3A 3Q89A 4CERA 2QL5B 2OTJN 3J80U 3VZIA 1WACA 4CD1A 2M8DB 4KHPK 2YI1A 1FRJA 3O3GA 3DLEB 2HEKA 2YKMB 1J53A 3QFPA 5HQMA 1NNDA 5J2NB 4WCEQ 2GNKA 1XEZA 3VQBA 1XMBA 2I0XA 1VBKA 1K8KB 2QX0A 4RWWA 1QDUB 3I33A 3TUIC 1N33K 2MZQA 1RGVA 4PWWA 3IBCB 4NLTA 4USJC 4CRJA 4DTOA 2IC3A 2OPSB 4B1XB 3C7NB 2ZJRQ 2OLWA 2P9UB 4CQ1A 2QT7A 5ETRA 3MR7A 4RW4B 3SEOA 2VBYA 1VSIA 2YV0X 1WG5A 1S1VB 1NU4A 4MFBA 4HDHA 3EZOA 2OYQA 2P9CA 4DL0C 4HI2A 4UY8T 4WKYA 4ITSA 3NF6A 2BABA 3QIPB 3R6LB 4PL8A 3DU6A 2HNZB 3WNFA 3H0PA 2EK6A 1S79A 4YQWA 4FWOA 4IOXA 3I5BA 4BBYA 4J2EA 3V81B 3MMCB 1JJ2R 3ID8A 3G9CA 4J2DA 2VFUA 3EUNA 3HSGA 3BREA 5G4DA 4F4YA 1XNQJ 2H5EA 3H5YA 3SI8A 1CS4A 3MR6A 1T11A 1NK5A 2OAUA 4QWDA 3SQ2A 5D4OA 2EEYA 1HBUB 4M3XA 3PUFA 4ED4A 2ZJPQ 4QYZK 4JI3K 4RPFA 4QR1A 2EG2A 4X66K 2F9DA 3V5RA 1HFEL 4LIWA 5FDLB 4CW7B 4JI6F 4OI6A 1U2RA 1ILYA 1VHIA 4WU3A 3K2YA 3UD4P 2HS0A 1YJTA 5J2MA 5GVQA 3KKSA 4DV2J 2NSBA 1T9VA 1X3MA 3VQ8A 3ULDA 2M3DA 2BRKA 1RYSA 3DI6A 1NKCA 4P75A 2VDIA 2VYPA 3VV2B 2YHBA 3MAQA 1FD8A 2Y1LB 1NK4A 1S5JA 2YX6A 1NBEB 5E33A 4H0XB 4U95A 3LP2A 3D0IE 3KG0A 5GADU 3DWLA 4OI2A 4JV5F 1DQAA 2QV6A 2R7TA 3CJ4A 2E6LA 3T1YF 4USMA 5D0GA 4MIWA 2Y1IA 2DNGA 1QUVA 3ISNC 5HROB 4NZ0A 3RRHA 3PR5B 3P6YC 3B6OA 3AGRA 3CCJS 2AJQA 2W9BB 2UUAF 3PSFA 4CEAA 1EJ7L 3DLKB 2E5GA 1N32F 4OLAA 3NGKA 5E3AA 1RT5A 1SB6A 4EI2A 3F5TA 2QFJA 3W62A 1RHKB 5T7LA 4CF8A 3KOAA 4LUBA 4CGFA 3C6AA 3GQCA 4F4XA 3G4SN 2I5JA 2IDEA 1CEZA 4OYWA 4LREA 2JFKA 2VHGA 3WXMB 4ILLA 2HOEA 4J9PA 5E5NA 4M3WA 4O4GA 4TYAA 5F3TA 3JTNA 1HR0K 4DR2F 5IOLA 3SPYA 4RL1A 3LPEA 3LGMA 4LT6A 4WFAQ 3SNNA 2KRBA 3AO1A 5KT5A 3K8WA 5DK5A 5GAGP 5KOXA 4C7QA 2IJNA 2CH6A 3ZSXA 4J9UE 4LRFA 3U8XA 4ZIVA 1VQKN 2MSTA 1AUSL 4ER8A 4IQXA 1S7IA 4DUZK 1RABB 3KUGA 2BR0A 3PW7A 5A8KB 2YX7A 2V8DA 4HDGA 2CQDA 1KTQA 4CD3A 3MFHA 3SMPA 3TOQA 3DXKB 1FXLA 4IG0B 3M7VA 3U1NA 1HJOA 3DU5A 3GE1A 3HSZA 2G0IA 2XY6A 1I39A 4FW1A 3GB0A 3H2VE 4PG6A 1SS6A 4RUBA 3DXMA 3V6DA 2WONB 2HWTA 4MK7A 4BR5A 2J7UA 4FWSA 4YB7A 3UE2A 3BP8A 2DXFA 2DR8A 1NK0A 4DCPB 1MSWD 2KFZA 4ZKAA 2BW2A 3OBWA 2IOCA 3QAEA 4HTLA 4KHWA 1T05A 3O5TB 1UVNA 2XG8A 5A0YA 3E51A 3SPZA 3IBWA 2CJQA 3CFRA 4J9RA 2E1YA 3EXYA 2LQBA 2NLWA 4YDXA 4BC2A 3PRVA 2XM3A 2P9SA 4OJRA 3FZKA 3D6RA 3DMJA 2KN4A 2P9PB 1EZZB 2Z0GA 4YDUA 3V9UA 2DGXA 2A6AA 3GE9A 1XNRJ 3I56S 2B0GA 2QTDA 1KAYA 4FPAA 2MLXA 3B8AX 4W90B 2IIHA 3I9ZA 1ZBIA 1FA0A 4WXWA 3DHXA 4X64F 3OS0A 4P2SA 4OI3A 2L9WA 4QS9A 1P9YA 4WTOB 4KFBA 1BQNB 5HP1B 4I7FA 1RWXB 1B3TA 3R7NB 1JKHA 2WAQD 1HNIA 5DJBA 4IH5A 3ZEUB 3KLHA 1WKLA 4ECTA 2JWLA 3F9KA 4C0OC 4K25A 2QLJB 2R2UA 2PDAA 3T5LA 1YXQA 5M1PA 4X65J 4BR2A 1OS5A 1TKXB 4DR7F 3L8BA 3LQVA 4N56A 1E4GT 5LMNJ 4RNMA 3CQYA 3MUVP 5KFJA 4C11A 4GKJF 4JI4J 1P1TA 2ACMA 1S0NA 4ED5A 2VH7A 1BI4A 3TAGA 3ZX0A 5FPNA 5B0EA 1NDCA 1TAQA 2NR0A 4LSNA 4N5SA 4LFCK 4IBNA 4NYPA 2W42A 2ROPA 4ECSA 1RADB 4JKCA 2A1SA 4ELUA 2RS2A 4IOCQ 3QZ8A 3GG1A 1XMOJ 2FC0A 4CNYA 2AP6A 3AO4A 4IOAL 4CEEA 3PEHA 2FVSA 4B1ZA 4KHSA 2AHOB 2BQUA 1PBUA 4RBUA 4C97A 1CG2A 4CIEA 1UFKA 3SMZA 3MF5A 3HSDA 2EFPA 4CZGA 1X0FA 2R7OA 4H0OA 1IJFB 1FFWB 1LKZA 4GVEA 4ES3A 2C3OA 1DQ9A 2ZM6K 2RKIB 2LEBA 2M88A 4UUXA 2HSTA 2BMBA 4DF4A 3LDLA 5KFZA 3NBPB 1S6UA 4HUFA 4DPOA 4DWIA 4Q0BA 5AQIA 2GV1A 1S48A 4GKKK 5AQSA 3ETMA 1C4CA 4BRMA 5FPEA 1O5JA 1QLNA 1QZ5A 4K0KK 4Z94A 3SMSA 4I0WA 4CJ5A 3Q2TC 1N8RT 3L9ZA 1Q82T 3SBMA 2VL1A 4F3TA 3GIRA 4FXVA 1MROB 3MDQA 1VGYA 4K2XA 3MK6A 1WKKA 4AHSA 3A3NB 1RWKB 3ZT0A 1XK8A 5AQNA 4CT9A 3UN5A 4QIGA 1R0BG 3AAPA 4KHMA 1NGAA 4WP8A 1VIOA 4DR3J 1IWGA 3ADAC 4X4TA 4O44B 2UXCJ 5AJ3F 2O66A 5GAGU 3Q0AA 4O3SA 3QBCA 4CHOA 3A8JA 1MWZA 3CJBA 2OZMA 3GFHA 3M30B 2FDNA 1WAJA 1L3UA 4OPHA 2I8EA 1H2TZ 1H72C 2FJBB 3QRQA 1NOZA 4QWAA 4CBWA 4YN3B 5AQTA 5DMRA 1S1UB 2O8CB 5BN8A 2AJ0A 2CNKB 4FLYA 1CJVA 4I2QA 5HL7Q 3MM5A 1HYSA 1TUGB 4YORA 1YJ7A 4PZVA 3CJKA 4ZLLA 1TYQA 1S12A 2J9CA 1QTMA 4CLSA 1IJEB 3I0SA 2CDRB 1XTZA 2Y0SD 4LQ9A 1IBKK 2G8WA 4I6MB 3FMWA 3OW2R 1IH7A 5L38A 1LXNA 5CCLA 1I3OB 2MZJA 2H48B 2V50A 4LFAF 3NDKA 1K1SA 1VMBA 2D0CA 2GO9A 4J8FA 3NF9A 3GIKA 3LWMA 2Y9HA 5AE1A 1UZDA 1GH8A 2IYIA 5GMDA 2GMJA 1X9MA 4NB4A 1A5XA 4ID8A 3OFEA 2ROEA 2WSFC 1JLCB 4E3SA 4DX7A 4KHNA 5I4MA 3P38A 3AVGA 5AFUA 2ZF5O 2E1PA 2HFSA 5GIPA 1T9WA 2X1BA 1KD1O 4KHRA 2NRXA 4LF4K 2IAJB 5L1JA 2ATCB 1HYVA 3EE3A 2QTWA 2AV5A 5K9FA 4AILC 2CUYA 4OJ3A 1VRTA 2DH7A 2ZKTA 3S3OA 4B9SA 4DL2A 3U6FA 2H65B 4NLSA 4H4OA 2PZSA 4NLOA 5C25A 1S6PA 3TR8A 5LMUK 4FF3A 4CFDA 3KUHA 1OQ3A 1FKAF 2OPRA 4IKAA 1HD1A 4M5HA 1IXKA 1U0HA 2DBBA 1SPBP 2HAFA 4NYZA 1WHXA 2UU9F 1LWFB 2J0WA 4TYBA 3HSTB 1N5TA 5F9NA 3RWUA 1TL7B 4RW7A 1HKGA 2YPZA 5HAOA 1IV0A 5KPZA 4LFBJ 1JXBA 4LJMA 4LSLB 3W9HA 2LDYA 5C42A 2ZC3A 2R3VA 9ATCB 3HP6A 2CNOB 2ITMA 1KQFB 4WWSA 5IC4B 5K14A 4RNFA 4LF7J 1F5CA 1EB0A 3SSSA 5DQHA 4FK4A 3ZZUA 4B9NA 1QHAA 1I94K 1OH7A 4IO9Q 2QEXN 3VTHA 1R6VA 4DR1K 1V3RA 1IVZA 1NKBA 1VQYA 1Q9XA 2JEGA 2IVPA 1VBYA 3SQOP 3MM8A 1J5EJ 2W4PA 1UJ6A 4Y2IA 1SJ4P 1B92A 2FBXA 4OI0A 3IGNA 1NB2A 3P4IA 4IFVA 1OPZA 4CJLA 1BUXA 4FP9A 1ZYQA 3ULEA 2ZGZA 4OL8A 4ECZA 4DV5J 2QGFB 3Q7BA 1R0AA 2HHHJ 4I68A 4F7VA 1NGJA 4HT5A 3EE9A 2CJXB 4ED3A 1RAOA 5EHHA 3ENWA 4H4MA 1ZBUA 4URSA 1VHFA 3GBTA 3JSBA 3U7JA 4ZIWA 2F3JA 3LF0A 2LYVA 2VPXB 3T9ZA 3ET6B 1YJVA 1NG9A 2HW3A 2BZ2A 5HMWA 2JDJA 3MM9A 1EKSA 2YHXA 1ZETA 4E98A 4X62J 2XHCA 2QWPA 2J76E 5E3QA 1QQOA 3A5LC 1PCAA 3OYIA 2SXLA 4DQ8A 3VETA 3D1QA 3AA5X 3L6QA 5U47A 5J1EA 3RZAA 1OY9A 3M6UA 3CUNA 2ZBRA 4OZNA 4F3OA 3I8DA 2J7KA 4PAAA 3ID6A 1RCXB 2YJFA 4GRSA 3CE8A 1ACMB 2KL8A 3HZEA 4ZPVR 5EOYA 1DTTB 2R7SA 2JHEA 3T1HK 3OYDA 2ROGA 3KHLA 1B0TA 4K4ZA 2POKA 2PAVA 3KK1B 3UKUA 3O2IA 1WOSA 3W3DA 3CC4S 4RW8B 4JUZA 4NE9C 2N3LA 5H1SQ 3L7UA 1CJKB 3A13A 3OVAA 4A48A 2HVDA 1YSJA 1GK8A 4BACA 2BKNA 4GC7A 4NCGA 2YKQA 4CE9A 2WB4A 5HLFA 4NI2A 3K59A 3D0GE 1S6QA 2H51B 3CJQA 5EVZA 3O3FA 4F4KA 2UUAJ 1C2PA 5KOWA 2GAGC 4DPWA 4MMOA 5HOOA 2GQCA 4BREA 1RWMB 3M2VA 4ZP7A 4M7YA 1CBKA 1FDBA 2IA6A 1CZBA 4ZVPB 3PV8A 1RHMB 2BQ3A 3LWLA 3KLEA 3GU0A 4DV4F 1R43A 1YJWN 3GCWP 3CMAS 4C48A 2PEBA 3KG1A 1KNZA 3R1XA 3M05A 3M1VA 5JS2A 3BGRA 4FDFA 5F8IA 4DR2J 1HPZB 3ETOA 4DSFA 4Q44A 5AQRA 1N36K 1VQ9S 5K8NA 3BQ0A 2JEJA 1PSDA 1Z05A 3IC1A 3KKFA 1UVMA 2Q2RA 3QJJA 4ANCA 2RQCA 8RUCA 4Z4CA 4YNQA 3THXB 3V9WA 5KTQA 3Q8PB 2N3OA 1FX4A 1M1HA 4ZVEA 4OYZA 2QA4S 3DLEA 4K8XA 2YKMA 3S3NA 2LXIA 4K59A 4PYAA 5J2NA 3D2EB 2E5LJ 2XY8A 5MLCQ 2Z1JA 2HS3A 4JI7J 1CVJA 1K8KA 5K8MA 4K4SA 3LAKA 2VPYB 4DSEA 2C2MB 2HQCA 1URNA 4URGA 4R5PB 3A5MC 1VQSA 4KBIA 4FVUA 3J7YI 2OPSA 1N34J 3C7NA 2RDIA 2P9UA 1NZ8A 4MO4A 1UFWA 4NLVA 2FVRA 4RW4A 4JI1J 1KKHA 2YTCA 4FPIA 1YJNN 1S1VA 4CZLA 4Y0WA 1YT3A 1VOMA 3PTWA 4JI0K 2Z1GA 3QIPA 1R7IA 2XULA 2QC3A 3HD1A 2HNZA 1RBUA 4DV6J 5KFVA 5ETKA 3V81A 3MMCA 4DV1F 3QGIA 4ZLPA 1X4FA 6FD1A 4K5SA 3M8WA 2AQ4A 1RYRA 2VFVA 2DGVA 1JLQB 4FF1A 1HLWA 2RDJA 3H2UB 1ZTWA 3AVJA 3MAAB 2GUIA 4LRAA 4JKDA 4CM2A 3QSIA 4B3SK 1HBUA 3PRDA 2DXEA 3VZHA 4M5MA 3R6MA 4HTUA 2ZC4A 2J8SA 2PGCA 1VISA 5CA5A 4BRKA 1MWQA 4M41A 3FMBA 1JJCB 5ETNA 2E2OA 3FBEA 2DO4A 3V6KA 1IBMJ 2J0SD 3HPGA 1SH0A 1HUXA 5FDLA 3NF8A 4E2FB 1ZS6A 3C6HA 4CJRA 1QVGM 1J5OB 2VV5A 1RTJB 1APSA 3MWPA 1HHQA 2OELA 1JJHA 3UPFA 2A5XA 1VQ7S 2FD2A 3P83D 3C14B 3BB5A 3M2RB 2HZVA 1FFGB 2OO4A 4DPYA 3OY9A 2XB2D 1YBAA 3KK7A 3KD5E 4C8LA 3CPWM 1GNKA 3ISND 4DZ6A 3PW5A 3N6NA 1S10A 1HW8A 4ID5B 2J0QD 3ZSRA 1FW6A 3KJVB 2NREA 2CQ1A 1LXJA 4IQMA 5LXYA 2YH0A 2Z56B 2W2QP 4FWMA 3O8MA 3THWB 1S49A 2W9BA 1FJGK 3DLKA 2ILZA 2XLKA 3GG4A 4JKBA 3HD2A 2J9EA 2AJ2A 4L76A 2DO0A 5F8LA 4U7UK 1KBRA 1YTYA 1OVQA 3FNNA 5T41A 4L75A 2O01C 3BPDA 5KFGA 3NGDA 2CPIA 5HJXA 5KG1A 3T3FA 3FZBA 5HVFA 3SZ2A 4J9SA 1NJZA 4Z0UA 2MKKA 4DS4A 1RA7A 2YKAA 1SJ3P 1ZBTA 4UQGA 2F4FA 1F0XA 1ZZFA 2BA9A 3TTFA 1PJ7A 5B0AA 3A1YG 4DZDA 5M1QA 2BRLA 3ZO7A 2OPPB 3BH6B 1IQTA 1U49A 4YR0A 5AE2A 2VF3A 4PKDB 5IM0B 2DGWA 4NZ6A 3W63A 4OKJA 5A8KA 2M5YA 4CK1A 2ZH2A 3NRBA 1WSEA 1YJ9S 1U2CA 3RBZA 2KQ2A 1VC5A 2N4CA 4PRFA 3DXKA 4OPAA 4YR2A 4IG0A 3ILIA 1E6VB 1KQKA 3PW4A 1Y5IB 1U45A 1VQ6N 2HFNA 3FDSA 1QAYA 2D0BA 3AGKA 2ZHAA 2WONA 2Y8WA 2MZTA 5FRNA 1HNXJ 4M5LA 3D6MB 3VENA 4KTZA 1CXQA 2Q0UA 2B5JB 2O1PA 2EK1A 1W2BR 1NSAA 4DLGA 4AQYK 3K58A 3Q23A 3N9UC 5ETMA 5CABA 3TANA 3MR5A 2ZD1B 2UUBF 3MXIA 4CJ4A 1TV6B 3BEGB 5BXIA 1VK3A 4Y34A 2P9PA 2Z4PA 2HFUA 4XDDA 2ZGYA 3MEEB 4DFJA 3BZCA 3S1TA 4LC9B 3TVKA 1P27B 4BRAA 1BCOA 2FJXA 3IUCA 2DRDA 5K5MA 2KHOA 5LJWA 1YVFA 2UUTA 4DFMA 2DCLA 3TQEA 1SL2A 3B54A 3CCWA 3EN9A 2OPQB 4DR6J 4BRCA 2DFHA 2E44A 1RT7B 3CCLN 4A4JA 3AVBA 1QQNA 2RAQA 1BQNA 5HP1A 4IDHA 2HK2A 5LMUF 5GAHP 2M2BA 4EFAC 4CHYA 2XS5A 1RHJB 2ZDPA 1VQPS 1S9EB 2C22A 2V51B 3ZEUA 3CJ3A 3QRRA 1Q0NA 4C8YA 4MLEA 3VQQA 3WZ0A 3CD6N 1K73T 4KHPJ 1O13A 4K4TA 3NHGA 4NYNA 2BE7D 3OPKA 4FNHA 1EQYA 1RHRB 4LF5K 4B9QA 5F8NA 3CCMS 4TQSA 4DQIA 4FS2A 1TKXA 3WXIA 3K8VA 3HI9A 4PG8A 1H3DA 2CA9A 1U1OA 3L95X 1D09B 4MAKA 2PI5A 1N33J 3HZ6A 3I4HX 3SUOA 2JVRA 3MI7X 3MXJA 2X6SA 4FVCA 4FJLA 4OVLA 1WSJA 1T9TA 1RAAB 2VGNA 5KT3A 1Q1KA 2HZCA 1H7XA 4ZPCA 3BN4A 3DLRA 3K5NA 3NGRA 2W2NP 1JB0C 1UWBB 1EX8A 4CCHA 3HX9A 3QJLA 1SC1B 1R8BA 2FJEB 3AY9A 1PIEA 2O8EB 4HHTA 3K89A 3RB0A 5IWAJ 2DNPA 2W7PA 1RT1B 4ZS6A 3AAWB 2Y1JA 2KG1A 5BR8F 3F56A 2MQMA 2RSQA 2QN6B 4ED7A 3UB5A 2DHHA 2RKIA 4ZVSB 3K17A 3UN3A 1A6LA 2QZ8A 4BDYA 3NGYA 2XWYA 3D6FB 3EZUA 3PACA 4KB0A 4HHHA 1WTBA 3NBPA 3AVKA 2Q1LA 2KI2A 4BG8A 1AFIA 2KG0A 4QYZJ 2HFOA 2V9KA 4KKOB 1ITPA 4JI3J 2XRIA 4LVNP 4JKFA 2Q97A 1K0VA 4X66J 4DU1A 3OTEA 3W5YA 3S7RA 4ILHA 1FCAA 1HARA 3RJMB 1MROA 2HRYA 1RWUA 5A6WA 3AOAA 2WUSA 3RW6A 1WF1A 2UZAA 4P71A 1XHXA 4XO0A 1NWKA 4CEBA 3PO4A 2IMWP 1VSKA 3E8OA 4HH1A 1FX2A 4USUA 1Q79A 2FC9A 1Q86O 1XI1A 1QM9A 2HQGA 4L3KA 4RUAA 1WN7A 3H4BA 5ADXA 3VMFB 4A8OA 3L3UA 1HL6A 2D3ZA 4O44A 3RR7A 4C4WA 2VIHA 4IJAA 1CZ9A 4EBCA 3M30A 2R8HA 4IO8A 4FJKA 2ZITA 1FNXH 4CJ3A 4BRGA 5DM6Q 4PWDB 5KG7A 4EYIB 1R31A 2VA2A 1JCEA 4WFZA 1S1UA 2O8CA 3R5DA 5D15A 1QE1B 4BRFA 2FHMA 1YBTA 5IT9Y 3HFKA 5ETTA 4NYFA 1KDNA 1J6ZA 3OHBA 4KV8B 1FVSA 2HVZA 4EEYA 4I6MA 1KLMB 4OO1J 4XAKA 4LQ3A 4FJ7A 4FN5A 2PEHA 4CECA 1GLJO 4M7XA 2MKJA 4WCEL 3IWLA 5JMVA 2CPXA 2YH1A 3WQTA 4NLWA 3BSCA 4EO8A 1HR0J 1ZBLA 3HKWA 1OSDA 2P9LB 1EXQA 4XH4A 1JLCA 3THPA 2A2DA 1Q81O 1H98A 4M45A 3DHWC 1ZTTA 1KHVA 4L8RB 2ZJRL 1C1BB 2C2DA 3KLIB 2BE2B 2VKZG 2HZAA 3M8QB 4F02A 4RR5A 2AZ1A 2IAJA 3JAMU 1IKYB 4DUZJ 4P2FA 2VCPA 4OPJA 2BKOA 5HATA 4QQBA 2Y8YA 4Y3CA 1J2VA 1YVUA 5GAEP 5KFAA 2V0NA 4DU4A 4CJSA 1QVFM 2GO8A 5KFIA 2KW4A 4P2XA 3NH1A 1HQEB 5L9NA 1BWEA 3CF5Q 4ZVHA 4LR9A 1F2HA 2CWKA 2WHOA 2QYCA 3TSPA 5T14A 4L72B 4OLBA 1LWFA 3T5JA 2ASMA 4OV6A 1TUWA 4W5TA 3W65A 3OYLA 1TL7A 2J6TA 1TFYA 3N79A 1F21A 4DPTA 5GAHU 3I32A 1X5PA 4LH5A 1PC5A 4DR4K 4FJXA 1N56A 2ZJPL 3G8SA 4LSLA 5AQYA 1B4SA 2CPYA 4HI1A 2ZDOA 3GJRB 1TKDA 3LANA 2XLIA 1RI7A 3TAQA 2LQ9A 2XBPA 2DPJA 1LV5A 2PY5A 1GX6A 4Y65A 1VQON 4W5OA 7FDRA 4DMNA 3V6HA 5C5JA 1RJJA 3POTB 1X3NA 3VGMA 3O3HA 4B3TK 2CVIA 4QU6A 2HLTA 3K5MA 4RNHA 4LH4A 5CCMA 2GGPB 3AODA 1YRXA 2OCEA 4UZCA 3T5KA 3IG1B 2F96A 3D3BJ 4DU3A 4W5NA 3EXCX 1JNZB 4LF6K 2OTJS 2ZQBA 4L74A 3HYFA 2QYGA 3AXKA 3CCZA 2HIYA 2K2PA 3GJSB 4OJGA 2E2QA 3IWNC 2RD5C 1HNZK 3SSRA 4USIA 1VI7A 3ILJA 1KR4A 3NCRA 4NLDA 3B82A 4OYAA 1FXDA 1U4BA 3W7BA 2DIVA 3VERA 4KTQA 3FC9A 2P9KB 5D4LA 4HCCA 3KDOA 4NPOA 3BZQA 3MEKA 2YXLA 2LLZA 2C2ZB 3ET6A 4V19J 3UFCX 4F04B 5HMXA 3KWIA 2ASJA 4B3MK 2V6AA 3T19A 3RSEB 3AD9C 4EWTA 2OEMA 4CLYA 4DV0K 2I1RA 4FLUA 1MMDA 2R8KA 4B3RK 1ZM4A 3E9OA 1QY7A 1ZAXA 4TSXA 2KXHA 4FF2A 2IVNA 4RWXA 2UXDF 4ED2A 5D4PA 2AZ3A 5ETOA 4X4PA 1QSSA 4CZKA 9RUBA 3BBCA 2A3ZA 4K4XA 3O4NA 2UUCK 3J7YU 3EICA 1KEKA 4LFCJ 4GVLA 1ASWA 4WFAL 1DTTA 1S0OA 3HXMA 4ED8A 3EDQB 4JEPA 3KK1A 4AD6A 4USTA 1JLFB 2BOAA 4FJJA 4RW8A 2HB5A 2G8UA 3HM9A 5K8OA 1CJKA 1ZA2B 4DV3J 2IJFA 1WC5A 3AJDA 4ZN1A 3N01A 1WSGA 4HUGA 3M8RA 3SI6A 1WD6A 3AVAA 4FJHA 1G6BA 4ED0A 1UZHA 2JEFA 4M5JA 2ZM6J 3NS6A 1X4EA 5M2RA 3AO3A 2VG6B 3LDSA 1IBCB 4NXNJ 4CVNE 2DHAA 4AHTA 2Z30B 1F6TA 2BJDA 4KH1B 4WE1B 4NX9A 2KDOA 4FJMA 3U9ZA 1T0TV 1U7LA 3PX4A 2CZ9A 2EWSA 4GKKJ 1Q9YA 4JK7A 1WWHA 2JC1A 1UP1A 2IGIA 4H0PA 2CQ2A 4X4SA 4K0KJ 3F9MA 3O3LA 2V9WA 2GQQA 1H2VZ 3GFYA 3PIPQ 2DPNA 3W2WB 3JS6A 3D7SB 4B9VA 2AEFA 2ZUAA 1WELA 4JI8K 1Z26A 5H9EK 1R8HA 2ERRA 5A2QU 3THXA 4B9MA 3L2UA 4F9OA 3AB4B 1AW0A 3CM5A 2MZRA 2XNRA 2EWHA 2DYAA 3MCNA 2WSCC 3VGTA 2V8PA 2QIFA 3U3GA 3D2EA 4FVMA 1TMMA 3J81O 3MMBB 1TVRB 2NRZA 1BCMA 3RMDA 3OA9A 1B0VA 2F4VJ 3DKDA 4DX6A 4ED6A 4ZLJA 4R5PA 1AA1B 3G4SS 5DG9A 4DHVA 3NGIA 1Z2LA 2IJRA 4OZ5A 1VCTA 4DSLA 2UXCK 3QMLA 2OD4A 3LM2A 2AYMA 4BRDA 4FM0A 5GAEU 5AQOA 4OYPA 3OJSA 1V9OA 1WC6A 4JI2J 2PC6A 1QQMA 4CLTA 1IBKJ 5HRRA 2QA4N 2IVMA 1IBLF 4RKUC 3CCVN 4PG5A 1X9JA 1SBRA 5CD4A 4CFCA 3D6TB 2YPYA 3FQLA 1VQKS 5HMZA 4WQ4C 3OYGA 2R2SA 4OYXA 3HRGA 5HVHA 2NLXA 4WFBQ 5AR0A 1JLQA 1RT2B 2F8HA 2GEMA 4IRKA 5F8MA 3U1LA 3MAAA 4PKGA 3QERA 4M1KA 2XMMA 2B4VA 2ILYA 5HO4A 3EY1A 1TK8A 4LBHA 1U1QA 2K8GA 1U02A 4DUYK 4LF4J 4IOCL 2QMXA 4O3NA 4HWIA 4A62A 3V6JA 2BTFA 3LP0B 1GLEG 3CJTA 4UTGA 4O23A 3BYPA 4M3TA 3FFIB 1NGDA 1J5OA 2HBKA 1RTJA 3WX8A 2MKHA 4NRUA 3B78A 2NZTA 3H25A 3JXOA 4MYTA 2VWBA 3C14A 1EQ0A 3M2RA 4NLRA 2VFTA 5EX5A 4ZVTB 2VKRA 1ZBHA 2ZVIA 2VD3A 1KQSM 3CNQP 1RUSA 5IV4A 2BDPA 3FSIA 3VGUA 4IFYB 3Q8YA 4ID5A 1ASUA 4J9MA 4CLFA 4ZP6A 4CF0A 3SJHA 4KR0B 1BA0A 3QDKA 3KJVA 5F2RA 1Q8IA 4B02A 1PAUB 1WHWA 3IRWP 1FVQA 5E7OB 1SC3B 2X6NA 4LF1A 4OZ3A 4UQTA 2LA6A 4CJQA 1WHVA 3CEDA 3EZWA 3THWA 2C2EA 4O3OA 3U3YA 3OL7A 2B56A 4W92B 5GADI 5AZIB 1F3FA 2VB6A 1I94J 4A2BA 4KT0C 5E84A 4C8MA 1F2GA 4DPXA 3W61A 5GMEA 1FI4A 3HVRA 4DR1J 4CIGA 1YQHA 2HBZB 2I2YA 3I6PA 3TUZC 3OT9A 2FSJA 4KH4A 3MMAB 3WDOA 1VK0A 3CI5A 1DLOB 3VQSA 4HL9A 4WYLA 4A8FA 1XNQF 4EBDA 3P8BB 2Q43A 3FZLA 1EP4B 1HX1A 4M5GA 4A8YA 4DCOB 1T44A 2E7VA 1WJ9A 1RACB 2I38A 2C2OB 4U8YA 4HH0A 2MKIA 2XHBA 1RTDB 3GL1A 2W8KA 2XSJB 5CXTA 4JYAK 5F9LA 4RNNA 1RT3B 4DTRA 4OLPA 2OPPA 2ZBPA 2IPOB 2XCPA 1SQKA 4JKAA 5HL7L 2GC8A 2NCKL 5IM0A 2HHHK 4P10A 4G6VB 2E8AA 1U48A 5C2CA 4CLUA 2G8FA 1S4FA 4C2MA 4DV2F 1WF0A 1MNEA 2C3YA 4HVJA 4E1JA 2X7IA 5B8HA 5KFMA 1U8SA 3CCTA 1E6VA 5KFHA 4Q8FA 1RZMA 2DR7A 3UDEA 3VQ9A 4M42A 2FSNA 2HHSA 4YOWA 3W8GA 4NXMK 4JN4A 1NCLA 3ZZTA 3SYZA 4BGBA 4ZJOA 3OFGA 3D6HB 3L3CA 3AT1B 1UJ5A 4BRIA 2NPFA 3RU0A 3T1HJ 1SKUB 4IG3B 2G0CA 1EKRA 1X4GA 4CJVA 3VAKA 3PO5A 2B5JA 3HK2A 3HCXA 2MQQA 1Y4ZB 1Y9OA 1FNMA 1DAXA 3AB2B 4FLTA 2E2NA 3J7ZO 3NNAA 4CEQA 3BSNA 4G1IA 4GV9A 3MUMP 4NRTA 4ANEA 1O8BA 2YKOA 4A5BA 1JLAB 2ZD1A 4EMDA 2ZH8A 1TV6A 3BSAA 5ETVA 5FPDA 3F73A 4E1NA 2QMUB 3K9JA 1Y97A 4UF4A 3ZZPA 2AWZA 3OYAA 4WIIA 1WSIA 3MEEA 2F9TA 3GYGA 4DF8A 3IDHA 3AV9A 1YITN 3OHAA 2AYGA 5F8GA 2DNHA 3S8SA 3NF7A 5AQHA 1HWIA 3KNGA 2FLPA 2CVEA 2V52B 2G1DA 2OPQA 1V5IB 4ENOA 2QLXA 1RT7A 1BWVA 2DFEA 2HQIA 4YB1P 3O9SA 2MDAA 3S01A 5J2QB 2DVIA 3MDFA 2P5VA 3PFOA 3QBXA 2O8BB 2HMPA 3D67A 2W4CA 3J80O 2VFSA 2DGTA 1N36J 3P39A 3AA4A 1VQNN 1YRUA 3QQCD 4NLXA 1S9EA 3L2WA 3HHEA 4I1TA 3ISZA 1T3OA 1WI8A 2UVVA 3CFPA 4IO9L 4B1UB 4WQ5A 3QRPA 2Q0RA 2K06A 2ZBCA 4CH1A 4QIFA 5K20B 1S57A 2V4JB 2NQPA 2G13A 1DGKN 1T9YA 4JKEA 4X4QA 3HJFA 1FK9B 1NMDA 3F44A 3VQ5A 2O5DA 5KI6A 5DLFA 4M95A 1WG1A 3KXDA 3CYMA 1NJYA 3CJ0A 2OD6A 4DN9A 5MLCV 4WQ5C 2AJFE 1FO1A 3VTIA 5EXWA 1UWBA 2B4UA 2DGQA 3M3ZA 1O6XA 4JI0J 2Z1IA 3G6EN 2O8EA 4W4MA 3MPWA 1QAIA 3P96A 2QW9A 2HHQA 1RT1A 1Y0HA 3SCKE 3TR5A 4ICLB 2NRVA 5BN9A 1RDDA 1XNRF 2WBMA 4OMFG 4MDAA 2W6KA 5BRFA 2OIHA 3AA8A 4OYBA 3QEWA 1QHTA 1NGCA 1V3SA 3MWTA 2E5HA 4RU9A 3O1LA 1HWKA 2EBEA 2A6OA 4B3SJ 2CAJA 3J7Z5 2KYZA 1QSYA 2A1BA 2RE1A 4KKOA 5DGBA 3A4TA 3AJ2A 4A2AA 5EWGA 4PKIA 4OGCA 3SAFA 2G9OA 2NYIA 3MD1A 2ZH5A 1QQCA 4U96A 5IV3A 3L09A 2RJZA