2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
2E6LA 2YKNA 4H4OB 1CXUA 3DRPA 4FZXC 4RNHA 1JKHA 2R8JA 4IR9A 4FJIA 1YTUA 3DLRA 5KFXA 4CERA 2ASLA 4QAGA 5HP1B 4YFUA 2G8VA 3HSTB 1T94A 1RT4B 4TLRA 5CZ1A 1SH0A 4H8KA 4IFVB 2XCAA 4QWBA 1J53A 2PZSA 1L3TA 5KG3A 5KFFA 1JIHA 4MK8A 2W42A 4E7LA 3RBDA 4ED8A 3FRZA 1VSFA 2UVRA 5KFVA 3N6NA 5DG7A 2XGQA 2E9RX 5FDLB 4Y1DA 4I7FA 5L1IA 5KFUA 1JLAA 4KV8B 4C8KA 2FVCA 4Y34A 5KFBA 2G8HA 1SH2A 2YNFB 5I3UB 4DS4A 3KHRA 3VQAA 3LZJA 3I0SA 5KFGA 1C0UB 4IRCA 4CGFA 4J9SA 1N6QA 4LSNB 3V6DA 4YQWA 3ZT4A 4NLWA 4PWDA 4RW8A 4FM1A 1XC9A 3SQ4A 1KSPA 2R2UA 1N56A 4FJGA 3AV9A 5KGXA 2J6UA 3ICLA 3VQ6A 2D3ZA 3BJYA 3OYDA 1U49A 2B5JA 3OY9A 2FVSA 4CJFA 3EPGA 2GUIA 4O44A 4FJLA 3ZSVA 3QIDA 1KVBA 3L2UA 3L8BA 4NLTA 4QWCA 3I0SB 2ITGA 4KREA 4B8CA 4DFJA 3T5KA 3VQDA 4KFBB 5FDLA 5KT3A 4CEEA 1ASVA 3FDSA 4FJ7A 3V9ZA 3OL9A 3OYHA 1U45A 5E41A 2OH2A 2AWZA 1UWBB 4ZHRA 1BI4A 2WONB 3P1GA 5CYQA 4ECUA 3M9OB 3DLGA 3VA3A 1D1UA 2I5JA 3RMBA 2ILZA 4CFCA 3OYMA 3DYAB 3RAXA 1EKEA 4NLGA 4RW4B 3L3VA 2CKWA 4XPEA 2V0NA 3BSOA 3JSMB 5HRNA 1RBVA 5C25B 5HBMA 4K4ZA 3HVTB 5KFDA 4CGIA 1QUVA 5KG1A 1BIZA 2Y1IA 3RMCA 4DTXA 1RTJB 1TV6B 2UVVA 1EP4B 1JKHB 3KLHA 4KAIA 1TK5A 5J2QA 2D0CA 4EZ6A 4ED2A 2ZKUA 4M42A 3T5HA 2E4LA 1JL2A 3H98A 3TR8A 4ED1A 4WZQA 3TAFA 5EWEA 4J2AA 1S9GA 4L8RB 4U6PA 3QO9B 3M9MB 3NGYA 5J2NB 1TL1A 1FK9A 2P51A 3MFIA 5F8NA 1RNHA 1NJYA 1RT7A 4KSEB 2AGPA 5D3GB 1SUQB 2WHOA 2HMIA 4H4MB 5K14B 2ATLA 2FVQA 1NNDA 2IA6A 4ECWA 4IG3A 3PUFA 5DMRA 2LSNA 4WXWA 4HKQA 3O3GA 1TKXB 4O0JA 4BE0A 2A1SA 3RMAA 1S6QB 4IH6A 3CVKA 1SKSA 4B9NA 3VQ7A 1QSSA 2F8TA 4Z4FA 5KT4A 1EXQA 4RU9A 3TVKA 5KT7A 2JLEA 4TYBA 3ALYA 4IRKA 3OYEA 4B9SA 3TAMB 3E01A 4FS1A 3C94A 1HPZA 3D5MA 2FJVA 4MFBA 3AVMA 2KZMA 5KFIA 1KLMB 3HVAA 2BRKA 5C42B 5SWMA 4NCGA 5HROA 1RAJA 3KMSA 4FK4A 1VRTB 1IKWB 4BWJA 3F9KA 4TN2A 3CJ0A 4KO0B 2I5JB 3SI6A 4OKEA 4CEZA 3ZSXA 3HT3A 4WFZA 4DL7A 1SV5B 2B6AB 3MECB 1BI4B 1JLQA 2WOMA 4LQ3A 2AJQA 4R8UA 4K4YA 3M8PA 1RT1B 2G8KA 1C6VA 3KLEB 4UQGA 2RF2A 3SQ1A 1TAUA 4F8RA 1VRTA 3SV4A 3RTVA 1NHUA 2HNZB 3ZSQA 3Q8SB 4Z0UA 4HUEA 4CHOA 4RUAA 5HROB 1I39A 4C8MA 4FJHA 2IJFA 4EP5A 3NF8A 1D9FA 3ZSRA 5KFYA 1Z4UA 3QLHB 2NUBA 4FLVA 1RT2B 1IG9A 1Q9XA 3K5OA 1S9FA 2ALZA 1TL1B 4DSLA 4CF9A 3PX4A 4K4VA 4CIEA 3TARA 3PVXA 3NMAA 3CFPA 4IFYA 1S9EA 3SPZA 1KCFA 4RW6B 1LV5A 5JS1A 4FK2A 3LP2B 4MQ3A 4FLYA 3S3OA 3UQSA 3B6PA 3IRXA 5KFSA 1XR6A 3PW4A 2HHWA 1NOZA 5KFAA 3G6VA 4YP3A 4F3OA 1QE1A 4CHYA 4DTRA 3HKWA 4FZZA 2AGQA 5D3GA 4CIFA 5KFWA 4EYHB 2VWJA 3OLAA 2C2DA 1TKZA 5J1EA 4CGJA 3KLIA 2VG6B 2BGGA 3OJSA 4O4GA 4ED3A 3KHHA 4C8LA 1T7PA 1N5YA 4CEFA 1WNEA 2R8KA 1QAJA 4DQSA 2IJNA 3JYTB 5EWFA 1KHWA 1RBSA 3NFAA 4M3ZA 4LH5A 4RNNA 4EO6A 3QEVA 4RNMA 1KRPA 2XI2A 4N41A 4CJPA 1QSYA 5KFHA 2BQUA 3KD5E 2HHXA 3KKRA 1KLNA 1CZ9A 5F8GA 2W9BA 4J9MA 4ZPBA 3LP3A 3DRRA 2IM2A 4CJQA 4W5NA 2B4JA 4TXSA 3VQPA 3SUQA 3T19A 5DGAA 4FM2A 3DLGB 3N6LA 1T03A 4HYKA 1QTMA 4KHQA 1QQCA 3NH1A 1HMVB 2YNGB 3S9HA 4YR3A 4AHUA 1N6QB 3QIPA 4M3YA 4OPKA 4W5QA 3M8QA 4CEQA 4MKAA 3DRSA 3CM5A 4NYFA 1JLEB 4ZVHA 5I3UA 3H4BA 4DSJA 4CFDA 2V9WA 4CK3A 1JLAB 3A2FA 1KTQA 3LANA 2ZD1B 1LWEB 2OPSB 2PYJA 3H40A 1SUQA 3CM6A 4BDYA 4R8UB 1SL2A 2IAJA 2WOMB 3HVRA 4NLVA 4ZPAA 2P5GA 1ZBIA 1HMVA 4DTPA 4NYNA 1KFSA 4CGGA 3NF9A 3PZPA 3QEPA 4EBEA 1IKWA 3V6DB 2IGIA 4DF4A 1X9SA 1Z25A 1S1TA 2WCXA 2XY7A 2QKKA 1WLJA 4QOZB 1RDCA 3RMDA 4AHTA 2FVPA 2QK9A 4IH7A 3V9XA 4RZRA 4DTOA 3HP9A 3S3NA 3HHKA 3AVKA 3ZT1A 4WE1A 3AVHA 1Z26A 4QWAA 3H4DA 2BQRA 4E3SA 1JLBA 1ZETA 4J9OA 4OKJA 4NCBA 2BANA 1DTQB 3KOAA 1NK7A 1FKPB 2AU0A 3FFIA 4CEDA 3AVFA 2FC0A 1HQUA 2Z1JA 3TQ1A 1HNVA 4RG8A 3OS0A 1WSIA 3Q8RB 3DLEB 4RW9A 5J2MA 3MEDB 3VQSA 4IG0A 4OL8A 1B92A 3SPYA 2XY8A 3KLFB 4BDZA 1HQUB 2D0BA 2V4RA 5C5JA 4CJSA 4J2EA 5KFOA 1GOBA 2R8GA 1RA6A 3NF7A 1DTQA 3QIOA 1KHVA 1HQEB 5HP1A 3KD1E 4QW8A 1C1CB 3MAQA 3EPIA 1HYSB 3G0ZA 1L5UA 4KB1A 1WSGA 3O3HA 2O4IA 1JLFA 3AO1A 1SKRA 4O4RA 4IH5A 3KIOA 4LQ9A 1MU2A 2B5JB 1LAVA 1IO2A 3FQLA 3SUPA 3BGRB 3FSIA 5KG6A 4GVMA 3GIIA 5CY4A 3KK3A 2RDJA 1RBTA 3OS1A 1U4BA 2D41A 5KFNA 4AH9A 3QINA 4I2PA 1FXXA 3NBPB 5KRTA 2WTFA 4I9LA 4FVMA 5HRSA 2Z1HA 2AX1A 1BISA 1YVUA 4F4KA 3DYAA 1JLEA 4Y2CA 3HL8A 4FJXA 1LAWA 4ELVA 1S0MA 4I7FB 5T7BA 3DLKB 1FKOA 3KLGA 4PY5A 2RKIA 4FXDA 3IAYA 4ZTFA 4O3NA 4DTNA 2O4GA 3RAQA 4C8NA 1S1UA 4M45A 3L2VA 1VRUA 2J6TA 4E7JA 3HPOA 1XHXA 3BSAA 1A5VA 4JRPA 2G8IA 1UAXA 4DLGA 3PHEA 3IGVA 3AA4A 4J9PA 4CCHA 1JXEA 1HNVB 4KHRA 4CJVA 4QWDA 4MK7A 4KTQA 3ZT3A 3FFIB 2HNYA 3VQBA 1ZBLA 3NBPA 3GILA 4OKKA 1TQLA 1S0OA 3O3FA 2XY5A 4KHWA 3AVIA 4PUOB 4M3RA 4KHUA 1D9DA 4ECXA 1KFDA 3U3GA 3TI0A 3BQ0A 4H4OA 1DLOA 2VG7A 1T05A 4AHRA 3T1AA 4PWDB 2DPJA 4O3PA 4FW1A 1N48A 4CIGA 2D3UA 5I42A 1MU2B 3H2LA 4NRUA 1CZBA 2YNHB 4ECRA 4NLYA 4DQIA 1RTHA 3IG1B 1TGOA 3EZ5A 1DTTA 3ZCMA 3CJ3A 3MXJA 2X6SA 1A5WA 4JRQA 4OJRA 3IS9A 1ZBHA 3CWJA 4KV8A 5J1EB 3EZUA 2VA3A 2JEGA 4CHZA 4QWEA 3NGIA 1TKXA 4DS5A 2XCPA 2YNIB 4GC7A 2YKMB 3NAIA 4DQQA 3F73A 3DOLB 4O3QA 2FVRA 2OPSA 3MEEA 1ZYQA 1RDRA 3DMJA 4FLWA 4EZ9A 4PQUB 3NL0A 4OGEA 3SQ2A 1JXBA 2FJWA 3KK2B 4XIUA 3HO1A 1RTHB 4AHSA 2HHTA 3SCXA 2YNHA 1U47A 4RW6A 4NLUA 4GW6A 2KFNA 3MEDA 1BCMA 1FKPA 4E7HA 4URGA 4CEBA 3MR2A 3M9NB 2W9AA 4GMJB 5CYMB 1JLBB 4F50A 4LSLA 4DG1A 3QLHA 1KVCA 3H08A 4KKOA 3M8SA 1CXQA 1BIUA 1L3SA 4N76A 4K4XA 4E89A 4IR1A 4DWIA 3I8DA 2GIQA 2JC1A 2W9BB 2HNZA 3OL7A 2JGUA 4TY8A 1BL3A 3NGDA 1S49A 4FLXA 4ZVFA 3QEXA 3MXMA 4MIBA 4KHSA 4JUZA 1VRUB 2RF2B 1S1UB 1VSDA 3O4NA 4MH8A 4FZYA 5F8MA 3LAKA 3PO5A 3SFGA 1QSLA 3G6XA 4B9UA 1QE1B 2QE5A 4Y3CA 4Q8FA 1K1QA 1S1WA 2UVWA 5KFZA 4TY8B 3I5AA 4CJKA 4N56A 2ETJA 2G8UA 4CJ4A 4DU1A 1RDBA 3NHGA 3VQQA 4BE2A 1JXLA 1BHLA 4FYDA 1VSIA 5FRNA 4FK0A 4I2PB 5C42A 4URQU 1S9EB 1SH3A 3ZSZA 2YNGA 2XGPA 3TANA 2D5RA 4E7IA 3SNNA 3ZT2A 5KT5A 4CJLA 5KFKA 2QKBA 3LP2A 3QGHA 2RPIA 4Q45A 2KFZA 4B9MA 1IKVB 4NLXA 3OL8A 1S5JA 1LW2B 3AO2A 3SYZA 1NK8A 4X2BA 3AVBA 3NAHA 1D0EA 3CDWA 4E0DA 3SI8A 5EUHA 1I6JA 1HYSA 1TAQA 3LP1A 1RT6A 1HYZA 4R0EA 2X78A 3NH0A 3PX6A 4JS4A 3CFOA 3G86A 1BGXT 3K5MA 4B08A 4H54A 4H4MA 5K14A 1SL0A 4IOBA 5FRMA 4M3WA 1YT3A 3ZSWA 1C1AA 1FK9B 4ECTA 5DG9A 1NK5A 1JLGB 4DSEA 2OYQA 2FBYA 1RDAA 3QGGA 1WN7A 5KFQA 4K8ZA 3IG1A 1RTDB 2JEIA 3ZSYA 4KE5A 1RT1A 4Q0BA 2BANB 4CJRA 3NAEA 5F9NA 4ZVEA 1IH7A 5J2QB 3HK2A 1S1XA 4K4WA 3KLHB 1CLQA 1RTIA 3IRXB 3H5UA 2F96A 4YMEA 4F2RA 3OYCA 1RT6B 4WFYA 3GIMA 4F4YA 5DLGA 1IKXA 4ZVGA 3OYBA 2XHBA 4Q0BB 3D0PA 3OL6A 3K5NA 1NJZA 4KAZA 4B9LA 1BQMA 5C24B 2GV9A 5KI6A 4ICLB 1JLGA 4M3XA 4G1QB 1NK4A 4DL6A 1LWCB 3P83D 1TVRB 4XPCA 2E6MA 1JLCA 2XI3A 3KK2A 2R2SA 5KT2A 2BRLA 3C95A 4TQSA 4HCCA 1XI1A 2OPPA 4Q5VA 4B3OB 2R2RA 1UOCA 4PA1A 2YKMA 4KFBA 1N4LA 5J2NA 5KFPA 4FCYA 4J9NA 1A5XA 3PR5B 1JL1A 2IM3A 1NK9A 4RW7B 1R0AA 4O5BA 3AO3A 3PX0A 3L2RA 4B3OA 3KLEA 4ECZA 5KFCA 3DI6A 3LP0B 1ZTWA 2ATQA 5KFJA 5EWGA 2W9CB 2P1JA 3WNGA 1RT5B 4DSKA 4ECYA 1HJRA 4Z4HA 4QW9A 2D0AA 1UA1A 1DLOB 2KZZA 3BGRA 1W25A 4CF8A 2IM1A 4WXOA 3VN5A 2C2EA 2PY5A 4PUOA 2R8IA 5EDWA 3OS2A 3ULDA 5HBMB 5KG0A 3QNNA 2WK4A 2KQ2A 3VQCA 1B9FA 3MEGA 3HPGA 4FM0A 1HARA 2IOCA 3RWUA 3LZIA 4CESA 1RTJA 3RB4A 1S1XB 1C1CA 2C2RA 3ITHB 4DFMA 2KTQA 3RB6A 1IKYA 3CJ2A 3HVWA 2HAIA 2RDIA 1HNIB 2P5OA 1I3AA 1X1PA 1K6YA 4ZTJA 4Z4CA 2HW3A 4O4GB 1ZTTA 5L1JA 3V6JA 4CJ3A 3KLIB 1S6QA 4RW9B 5J2MB 4J9KA 4WYLA 4JV0A 3VQ4A 3Q8PB 4N5SA 1UA0A 3SUNA 4PQUA 4R5PB 3AVGA 4ED6A 2HVHA 3NF6A 3K2PA 4OGCA 3V4IA 5KG7A 3SQ0A 3P5JA 5KFMA 1W0HA 1O1WA 1SL1A 3LP1B 4NLPA 4M94A 2WRMA 4K4UA 3V9WA 4QCLA 1S1VB 4AHVA 1DTTB 5KFEA 4KI4A 4IFYB 4Q8EA 2RN2A 1LW2A 2OZSA 4K8XA 3LWLA 1IKVA 3PW0A 4O44B 3PW5A 1C0UA 3CFRA 4CJTA 3V6KA 2AGOA 3KKSA 2DFEA 5SZTA 4F4XA 1LW0A 4RW8B 5F8IA 3LWMA 2BQ3A 3O4QA 1ASWA 1QHTA 3NCIA 1TL3A 4MIAA 4IDKA 4HUFA 2CJQA 1TKDA 3DDKA 2ZD1A 3H59A 3I5BA 1ITGA 4IBNA 1OS5A 1U09A 3MFHA 3MR3A 2J6SA 4ZP6A 4EBCA 4ECVA 4Q44A 3DRSB 3M8QB 2IBKA 1WNSA 4IG0B 3D28A 1J9AA 1NOYA 4ZHRB 4M3UA 3DLBA 3MTKA 1RBUA 2IC3A 2E9TA 3QZ7A 5HLFB 1RILA 4YR2A 3MR6A 2JEJA 4EP4A 3C6UB 4J9QA 3GQCA 1T03B 5J2PA 3C6TA 4EYIB 4IFVA 3RR8A 3DRPB 4BACA 1XHZA 2R7YA 2YHAA 5KFLA 2V4QA 1L3UA 1QAIA 2C22A 4KKOB 4DL2A 3H5XA 3KJVA 4DG1B 3GV8B 1HPZB 1S48A 1GOAA 3QEIA 3BQ2A 3DOKA 4I2QB 3TAMA 1VSLA 2W8LA 2YHBA 4O3RA 3ISND 4KHMA 3KK3B 2VWKA 4B9TA 3DM2B 2IC3B 1TK8A 2FBTA 4LSNA 3VA0A 2RKIB 1BQNA 2W7OA 1N5YB 1VK0A 1RCHA 2AQ4A 3QYYA 3OSNA 4FLZA 4ZMMA 4F4WA 1VSMA 2HHQA 4FJ8A 3TWHA 4CF1A 4DTUA 4CFBA 3NKYA 1TP7A 2VA2A 4URSA 4ZPCA 4JLHA 3DOLA 3T3FA 3ZT0A 2HMIB 5KGWA 2F8SA 1HQEA 4J9RA 2ILYA 1X9WA 3NH2A 2EC0A 4BDPA 3SUOA 3GYNA 1RDDA 2R2TA 3AVAA 4Y1CA 1XR5A 1JLCB 1D5AA 4NLQA 2HHUA 4CEAA 3CDUA 3AO5A 4G1QA 2IM0A 3BDPA 5C24A 3AVJA 1EETB 3WNHA 2IDOA 3OYLA 4NZ0A 1WSFA 1TK0A 3T5JA 3OYIA 4CF2A 3QZ8A 1S4FA 3IN5A 2HNDA 1HNIA 3DRRB 4AHCA 3CDEA 1NK0A 1IKYB 2FLLA 2X74A 1IKXB 1IM4A 4KB0A 2QV6A 1TV6A 1RT2A 1C0MA 2GIRA 1XR7A 2ASJA 4WE1B 4CE9A 2Y1JA 3V4IB 1KVAA 1YTAA 5FROA 5KFRA 4YR0A 1VSHA 4CK2A 2OPQA 3UPFA 2XC9A 2YKNB 4MK9A 3KK1B 2I1RA 1U04A 2VG5A 3I0RA 3NDKA 3NE6A 1EETA 5KTQA 1REVA 4KBIA 3AVCA 3C6TB 4YNQA 5J2PB 4KHNA 4EO8A 3SZ2A 1UWBA 4C8OA 3H5YA 4K4TA 5JUMA 3QNOA 1TKZB 3LDSA 4FJNA 2IAJB 4ZP8A 1RT5A 3B6OA 1JLQB 4G3IA 4MKBA 3IGNA 4KPYA 3L2WA 4DU4A 4NCAA 3GIKA 5F9LA 3DLKA 1LWEA 3KHGA 1GX6A 1RT3B 3N6MA 3RR7A 4FLUA 3AA2A 2BDPA 1TKTA 3CJ5A 3MF5A 1CSJA 3I5CA 2BE2A 3PW7A 4JV1A 3VQ8A 2EX3A 4WFXA 4DL3A 3S3MA 4B9VA 4KHYA 2OPPB 1WSEA 3BQ1A 1LW0B 4JV2A 2XY6A 5DQGA 3U3YA 3PR4A 3DOKB 5CZ2A 3V9UA 1NJWA 1LWCA 1WAFA 3VQ9A 4ICLA 2DFFA 2R8HA 4NYZA 4W5TA 4FLTA 2D7SA 2BR0A 3QGIA 3KLVA 1Q9YA 3MXIA 1S1VA 4F2SA 3SFUA 4Z4EA 2HHSA 1C1BA 4M3TA 2KW4A 4CHNA 3AVLA 3VQ5A 3OYJA 1K1SA 4N47A 3C6UA 1ZBUA 3V81B 4KB7A 1NKCA 4RNFA 1J54A 3PJWA 3PJXA 2HHVA 4TSXA 3RRHA 2IS3A 2X6NA 3M8PB 4NRTA 3HJFA 3U6FA 3JYTA 3LPUA 2UUWA 4TY9A 1SKWA 5DG8A 1ZBFA 3QO9A 1L3VA 4RUCA 4DFPA 1RA7A 4DSFA 4O55A 4O0IA 5L1LA 2EHGA 4HCBA 3I0RB 2JEFA 2VG5B 4E1NA 3ASMA 3ITHA 4IDKB 1B9DA 4XO0A 2FJXA 1TL3B 2WB4A 3AA3A 3UIQA 4J9LA 2Z1IA 1RTIB 1EP4A 4B8AB 4DTMA 4M41A 3RB0A 5EU7A 3KNAA 2ASDA 5CYMA 3HVTA 2HWHA 5C25A 1VSEA 3KMQA 3OHBA 2GBZA 4KTWA 1U48A 2B43A 4NLRA 4U7CA 3LALA 2DTUA 4CEOA 3TAQA 4FS2A 1WAJA 4HHTA 1NKEA 2WONA 2ZE2B 5JXSA 3DI6B 3LP0A 4CJUA 4DU3A 1C0TB 4IRDA 4ZPDA 3EYZA 3MEEB 4DTSA 1R0AB 4R5PA 4DFKA 1LWFB 1S0NA 2YNIA 4OLBA 3KHLA 2OZMA 1RT7B 3K58A 4KRFA 1HRHA 4DTJA 4WZMA 3GIJA 3OJUA 4FBUA 3IS9B 3HP6A 2JC0A 4NLSA 4ELUA 4ZP9A 1S1WB 1S6PA 2FBXA 2G8WA 1NK6A 2XO7A 5F8LA 1EX4A 5JS2A 4DSIA 3CQ8A 1C0TA 3TAGA 1T8EA 3K59A 1RBRA 3DM2A 5KG5A 2VG7B 1T05B 3QEWA 3LAMA 4M95A 5DQHA 4CECA 4CGDA 2DPIA 3GV7B 4I2QA 1QS4A 1MMLA 3V9SA 4DQRA 4ID1A 4E7KA 4AILC 3EY1A 1J5OA 1X9MA 3CYMA 4CGHA 1J5OB 4NCGB 3CG7A 4DL4A 4RW4A 5L9XA 2ZQBA 3OYFA 3MR5A 5KT6A 3AA5X 1KLMA 2GC8A 4MFBB 2IMWP 4J2BA 3Q8QB 3HXMA 3E01B 2OPRB 2W7PA 4FJ5A 2AX0A 4DMNA 3MECA 3D45A 3H5SA 3TAEA 1GOCA 3BREA 5DK5A 1GX5A 1C2PA 1NJXA 3ZSOA 4LD0A 4RW7A 2QXFA 3UDLA 4O3OA 1FKOB 3PV8A 2HWIA 4E1MA 2VG6A 4W5OA 2PYLA 1Q8IA 5KFTA 2C28A 4DQPA 3QERA 4EBDA 4IG3B 4FJ9A 4DL5A 5KRSA 5HRPA 4HTUA 4JS5A 4LSLB 4K4SA 2XWYA 4ECSA 3CO9A 2ZE2A 3WNEA 3NGZA 3TAPA 3HPHA 2W8KA 2XRIA 1C1BB 3SJJA 2Z1GA 4Y2AA 4ELTA 1S9GB 3G10A 3BR9A 1BQMB 2YV0X 3RRGA 5DGBA 4LH4A 5HRRA 1W9HA 3HYFA 1NKBA 4FJMA 2HB5A 5I42B 2FLPA 3V1OA 4W5RA 4CJ5A 2E9ZA 4ED7A 3HM9A 3BSNA 4Z4IA 2DFHA 4IKFA 2YNFA 1G15A 4HUGA 4TYAA 4NLOA 1RT3A 1VSKA 3OYKA 2FBVA 3AVNA 3SV3A 4GC6A 3BSCA 3GV5B 2UVUA 1Y97A 4K50A 4TQRA 5DLFA 3K57A 1T3NA 3LPTA 4DLEA 3G6YA 1S97A 2A1RA 3T5LA 1NHVA 3JSMA 5KG4A 1S10A 1TKTB 2G8FA 3QETA 3PW2A 3PY8A 4ZP7A 3KTQA 1VSJA 3L3UA 1RTDA 3QESA 4KI6A 4J2DA 4IKAA 3FQKA 5KG2A 3OYAA 3DLEA 3THVA 5DQIA 1XWLA 4QPXA 2OPRA 2B6AA 1SV5A 1RT4A 3TABA 3AO4A 4CFAA 3V81A 3CJ4A 2OPQB 4KO0A 4ID5A 2O5DA 4I9QA 1D8YA 3OYNA 3KJVB 3M8RA 4HVJA 4WYWA 3OYGA 2HNYB 3OLBA 2HNDB 4NLDA 3MEGB 1BCOA 3KK1A 4FW2A 1RYRA 4CJEA 5F8JA 2UUTA 3DLHA 4E19A 4ED0A 3RBEA 1HYVA 1S1TB 2F8EX 4KTZA 4DF8A 4OLAA 4CHPA 1WSHA 5CYQB 4CHQA 2FLNA 4ID5B 4DEZA 1JX4A 2Q3SA 4CF0A 1YVFA 4ECQA 5HLFA 4OPJA 4BWMA 2W9CA 3WNFA 1F21A 1S6PB 4CK1A 3KLGB 2BE2B 5F8HA 3V1QA 3K5LA 4Z4GA 1LWFA 4LY7A 3OSPA 3CIZA 1ASUA 3DMJB 3UR0A 4IQXA 5T14A 4F4ZA 2HVIA 3E51A 3QIPB 1WSJA 4FJKA 4FBTA 4OVLA 3VQEA 5L1KA 1RYSA 4CJWA 3V1RA 2OA8A 3ISNC 3V6HA 4Q43A 3KLFA 4BE1A 1TVRA 2DY4A 4FJJA 4F3TA 1REVB 3PO4A 4EEYA 1BQNB 3L2QA 4RNOA 4O3SA 3OHAA 3OVNA 1JLFB 3RB3A
chains in the Genus database with same CATH superfamily
1VJQA 2E6LA 4JHDB 3DRPA 4FZXC 4IR9A 3R7SB 1YTUA 5KFXA 4L73A 3EMTA 2ASLA 4YFUA 4DR5K 1T94A 3PIPL 4P74A 4TLRA 5CZ1A 4DUZK 3M32B 5A8KB 5AQWA 4IFVB 1E4FT 2DXFA 4DUZF 4Y2MA 4K5SA 1KAZA 4N7TA 2A40A 4OYOA 1CC7A 3CSKA 3GYXB 2W42A 2V52B 5D0HA 4ED8A 1KS2A 4ETZA 3FRZA 2DNPA 3BV8A 4A47A 2XGQA 2M4MA 3U27A 2B4UA 4I7FA 4AM7A 2OAUA 5L1IA 1T3VA 5I3UB 3WQUA 3VQAA 4I6WA 5KFGA 1C0UB 2GVZB 5SUHA 3E9PA 4J9SA 2OHDA 4K2JA 4HI2A 3EO3A 3V6DA 2OD4A 3M2UB 3ZT4A 4ES2A 4NLWA 4PWDA 2HVEA 3CCQN 1C4AA 2R2UA 3H1QA 2AW0A 1FO1A 1ZAXA 1DQ9A 3AV9A 4FJGA 3ICLA 1VQNS 3UR3C 2V2ZA 4DR3J 1X60A 4CJFA 1UVMA 4QWCA 1VBZA 2DTJA 2YX4A 3NRBA 3ZZUA 3MX5A 4GKJK 2MDAA 5AZJB 5FDLA 5KT3A 4JI8K 3H7HB 5D4LA 1ASVA 3FDSA 4U67Q 4FJ7A 2DH9A 3OL9A 2NXUA 1XBWA 3OYHA 4NMXA 2IJRA 2LCWA 2VIHA 1WKLA 3GG1A 2OH2A 2DGUA 4KGMA 2WONB 3CCES 5CYQA 1RHUB 1NGFA 2IVYA 2DH8A 1FF2A 5E3CA 3M9OB 1XNQF 3G25A 3VA3A 4YOUA 1OY8A 3W2WA 1BOTO 1JCFA 1TFWA 4H5NA 1N88A 3RAXA 1SBRA 5A8WA 5B0BA 3RVCA 3X1LB 3L3VA 1LXJA 3QQCD 1UP1A 1AYEA 3SDEA 1YK9A 5HRNA 1RBVA 5C25B 5HBMA 1S7HA 5KFDA 5KG1A 4FO0A 3RMCA 5IZHA 3ILLA 1RTJB 3QBCA 4ILRA 1EP4B 3KLHA 2LXFA 4PWWA 1TK5A 3IO1A 4A5BA 4ZDNA 1ELOA 4ED2A 4R25A 2ZKUA 3TJAA 2B9WA 2RIJA 5HQLA 4GV9A 3OR1A 4BQZA 5LSLA 2LQ9A 2YPZA 3DGPA 1JL2A 3GFZA 4FP9A 3TR8A 4ED1A 4WZQA 4DV0F 5EWEA 1UMJA 2JFKA 2ZUAA 1Y3KA 3MFIA 5F8NA 1D3WA 1W7AA 4DR6K 2AGPA 2WHOA 1SUQB 2LLZA 5K14B 4A8FA 1QHAA 2M3DA 2VKZG 2NLWA 3UNYA 4ECWA 1ZZFA 4MYTA 4IG3A 4WXWA 1XK8A 3PACA 3O3GA 5A8RA 4HT5A 1S6QB 4CM2A 5MLCV 1N0VC 1NU4A 2HEKA 3D2EB 5KT4A 2O8BB 4MIWA 2BJDA 4TYBA 3ALYA 1L3KA 3SBTA 2D1CA 3OYEA 4NA2A 3FCWA 3MM8A 3E01A 4HTIA 2DJWA 2FJVA 3MN7A 2XMUA 2O8CA 1KLMB 2QC3A 3U1LA 2BRKA 1V3RA 3G9CA 3W60A 4NCGA 5EGYA 2HYIB 5HROA 4J37A 3EGZA 4Z37A 2ZM6J 4FK4A 2RRNA 2R7TA 4C6AA 5ITHA 3QBWA 5D77A 3CJ0A 2I5JB 3SI6A 1BWVA 2UYTA 3UCUP 4P6QA 1VHIA 1BI4B 4LQ3A 1WD6A 2VHGA 4YOEA 1BC6A 3I96A 5BR8J 1N32K 3CC7N 1VRTA 1VHFA 3ZSQA 3QT8A 2POKA 3Q8SB 3LPEA 5CR4A 2JWKA 5K8PA 4Z0UA 4HUEA 4E2FB 5AXKA 3W64A 4C8MA 4FJHA 4FVCA 2HHHK 4P52A 3NF8A 2NUBA 2IY5B 1IG9A 1UWAA 2JLFA 1Q9XA 3K5OA 1S9FA 2ALZA 4CF9A 2ZH5A 1OVYA 2P9PB 1FRMA 2HZCA 1UVJA 3GFXA 2ITMA 2EG1A 1LV5A 2BJ7A 4DV7F 3CCRS 5M1OA 4FLYA 1UTAA 3GZ7A 4UOCA 3BYRA 2XMTA 2Q3PA 1BUPA 2M88A 2RQKA 3H2UB 1FFSB 1AT1B 2GW8A 5CE3A 1QE1A 4CHYA 2J7UA 3PYDA 2AGQA 4CIFA 5GAGU 1TKZA 2NRXA 4K42A 3CCMN 5KOXA 2DRBA 4MLHA 4C8LA 1N5YA 2NCKL 4DR6J 4FWSA 1GLAG 2DNQA 1QAJA 1KHWA 2WZ1A 1CQNA 2NRVA 4RNNA 2XI2A 4F3QA 2CH5A 3Q89A 3IWNC 4MO5A 2BQUA 2AT1B 2MQNA 1C4CA 4C48A 1QQOA 5ETLA 1HKCA 4B3TJ 2UUBK 5HJYA 3DRRA 2IM2A 1F5BA 3M1VB 1FTCA 4W5NA 3HOTA 5LJWA 5AZIB 4TXSA 1FXLA 2YWWA 5DGAA 2XLJA 4NA3A 3DLGB 3N6LA 2D3OR 3QJPA 4C98A 2RUSA 3LDNA 1QTMA 2Y8WA 1QQCA 4A8QA 3NH1A 3FBFA 1HMVB 4CNYA 3S9HA 2VDHA 4IOAQ 4YR3A 2I7NA 3L7UA 3QIPA 1FRIA 4OPKA 3HZ6A 5D0GA 1D4XA 4G1IA 4Y00A 3DRSA 4NYFA 4M5HA 4CD1A 1HNXK 3T1YK 2JFDA 4CZMA 3H4BA 4DSJA 4CFDA 4A8YA 4DR4J 1X8DA 2OPSB 3H40A 1H73A 3HHNB 4R8UB 1HBUB 3UDCA 1SL2A 4BRDA 4LF9K 2Q2RA 3TEGA 4NYNA 2W40A 3MM7B 2ABYA 3PZPA 3QEPA 3R8EA 2EK1A 1P90A 4BC5A 3M32A 2QKKA 1R7IA 1RDCA 3RMDA 2H3GX 3GONA 1RCXB 1PAUB 3ET6B 3CD5A 3M6XA 3CIPA 2KXHA 3S7RA 2ZOFA 2QK9A 4IH7A 4RZRA 3HP9A 1Y5NB 3GR1A 2BANA 2UXBK 2ROGA 4CEDA 2FC0A 4DV3K 3K17A 4OYZA 5M2UA 4RLEA 2YPYA 4RG8A 1X4EA 4RW9A 3MEDB 1B92A 3SPYA 2R9LA 4FWLA 5LT5A 2XY8A 1YZ7A 2NYIA 4BDZA 2LEAA 1OJ4A 3MPYA 1HQUB 2D0BA 2V4RA 2NRWA 4J2EA 5HAOA 4RWTA 1NGIA 1HKBA 1RA6A 4A4JA 5IV4A 3GTYX 1KHVA 2ZJQL 5E3QA 3Q8YA 2LA6A 4FNIA 3QPIA 1Q7LB 4DV2F 4BRNA 3H1VX 3R1XA 2XSFA 2W2PP 4IH5A 3SQGA 1TYQA 1LAVA 3AGKA 1WKJA 1IO2A 4J91A 3FQLA 5E5NA 1K8AT 3BH6B 1VYAA 3RZAA 3ATVA 4GVMA 2OD6A 5LJ3Y 2D41A 3GR0A 2J9DA 2HSTA 4JOUA 1APSA 4YB1P 1I94K 4Y0WA 1WBBA 2AX1A 1YG0A 3AXKA 2MGZA 1JLEA 4FJXA 1S0MA 5T7BA 3TJ9A 3KLGA 2NXNA 4LF9F 1XNRK 3NCRA 2B4PA 2V50A 3CDAA 3RAQA 1ZZNA 2BJ9A 1S1UA 4ILLA 4YDUA 3G71N 3L2VA 1RDUA 2J6TA 3IMQJ 4G6VB 2FDNA 3HPOA 3KG4A 2YKOA 2QJ3A 5CYJA 3AA4A 4J9PA 4RWWA 4ISFA 4L6V3 4WFBQ 4PXCA 2HAFA 1ACMB 4MK7A 3G8QA 2P9IA 5JVGL 2HBKA 3VQBA 4OKKA 3TA1A 3O3FA 2XY5A 2P9SA 4KC5A 3AVIA 3BO2A 1FFGB 1KFDA 1OYDA 1TL5A 2CJYB 3KUEA 4WU3A 3BQ0A 2B9XA 1ZXOA 1IXKA 1DLOA 1H7XA 4UOGA 2DPJA 2MY7A 1K0TA 1K8KA 3H2LA 4LF7F 3THPA 4NRUA 3IFRA 2YNHB 4ECRA 1OIAA 3IG1B 1PC4A 1GMWA 2DH7A 1A5WA 4NB4A 2W2OP 3CWJA 1U2VB 5GAEP 5J1EB 3EZUA 2VA3A 4CHZA 2HKEA 3A8JA 3FMBA 2XCPA 2YNIB 4GC7A 3DOLB 1SC4B 2XHCA 3IR5B 1RDRA 5AQRA 3LOUA 4FLWA 2BJ3A 2ZVSA 4EZ9A 3DGVA 5AQGA 1JXBA 3LUYA 1QZ5A 3JTNA 2M70A 2C3UA 4PPZA 2RT3A 4DX5A 2PA8D 5JLHA 2F8HA 1WHWA 1VQMN 3R5GA 1HL6A 1UPPA 4RBTA 3RAMA 1FKPA 3FSXA 3DAWA 3M9NB 5CYMB 2H5EA 1IBLK 2KLAA 3HOSA 4F50A 1FX2A 3BYPA 3J7YP 3M8SA 2CDRB 5HMXA 3I56S 4ZLPA 2Y8YA 1CC8A 1I5OB 2CDQA 4K4XA 1Q53A 3JSYA 4USTA 5IXUA 3VTIA 3OL7A 4LR9A 4OX9F 3UD4P 4MKVA 3SAHA 3QEXA 4MIBA 4A57A 4NXNF 4QIVA 3HSJA 4KHSA 1V4SA 5IT4A 1NPRA 1WTBA 1MWKA 5L39A 2GJFA 2Q6BA 2CYYA 3LAKA 3H6EA 2H5JB 1B3TA 3OFHA 1CS4B 3FNNA 1QSLA 3G6XA 3A5LC 4OX7A 1K1QA 3W9HA 1HA1A 1VBKA 2GGPB 4CJ4A 1RDBA 3CC4S 4FYDA 3WIUA 5FD1A 4FK0A 4ANCA 5C42A 5F3TA 1SH3A 3ZSZA 5GMDA 3C2PA 3SNNA 5KT5A 3CCJN 1N34K 4CJLA 1UJ5A 3L4BC 3QGHA 3R3LA 3AH6A 2RPIA 2KFZA 4CO1A 4B9MA 3OL8A 1S5JA 4WK3A 1LW2B 4FWOA 3DNCA 1NK8A 4X2BA 1R89A 1FRJA 4DPTA 3QWUA 2LA4A 1NO8A 2JL9A 3FE1A 1I6JA 4M63A 1TAQA 2ZM6F 1RT6A 5HL7L 1RZMA 4LFBK 4R0EA 2VFRA 2X78A 3EJMA 3NH0A 3PX6A 1JWWA 3VF4A 1BGXT 2KT2A 3M2VB 4H54A 1C0GA 4CLUA 1Y11A 4U95A 4PG7A 2X3DA 3QWPA 4M3WA 4IOAL 3ZSWA 2FC8A 2IHR1 1FK9B 1C1AA 1RBOB 2PN6A 2H5IB 4RBVA 3QGGA 5KFQA 4K8ZA 5DO2A 1X4DA 1F9HA 4DX6A 3MN9A 2AJ0A 4KE5A 1HX1A 2BJ8A 4ZJQA 1WACA 4CM0A 3J81U 2HFUA 2QWOA 2HQFA 2O8CB 2KYXA 1VQKN 3IRXB 5C15A 2F96A 4YMEA 3MCAB 1NSQA 4F2RA 5DLGA 1IKXA 4ZVGA 2QYCA 2VPWB 2VFSA 5EX3A 4KAZA 3LDLA 3UE5A 4WTYA 4M3XA 4G1QB 2A0FB 5GAGI 3KDNA 2E2OA 1SKUB 1RWWB 1TVRB 3TP2A 1RGIA 4XPCA 1EX8A 2BRLA 4HCCA 1XI1A 2OPPA 2HFOA 4Q5VA 4B3OB 2HGMA 2V6AA 3W5YA 2QZ8A 3MR7A 4QJVA 4KFBA 3R9PA 2KG1A 1Z2ZA 1N4LA 1LOUA 4EUVA 1KR4A 1O6XA 4ISEA 4LBPA 1HHSA 4USJC 5D4OA 2O1PA 1NDLA 4ECZA 3LP0B 2O66A 2V2KA 3N28A 2P1JA 4ECYA 4DX8H 1HJRA 3PNIA 1HNWF 1DLOB 2KZZA 1RHMB 3PLAA 3BGRA 1W25A 5ETNA 3VAKA 4OZ2A 4CQ1A 4CF8A 1AXQA 2YQ3A 4HDGA 2RE1A 2R8IA 2C42A 4MT1A 5BRDA 1T11A 5EDWA 3FEXB 5HBMB 5KG0A 1NGDA 1NUEA 3I6PA 2Z30B 1ICEB 4FM0A 4MYUA 1HARA 2IOCA 2PI4A 5AQFA 3LZIA 3JQMA 4RPFA 1VS3A 1RDWX 3FCVA 1RACB 1RTJA 1M5OC 4ALZA 1C1CA 3ITHB 4DFMA 1IKYA 4YY3F 4DR3F 5CD4H 2O01C 2EPIA 2Q43A 5AXNA 3J7A1 2GVDA 3PIOQ 2HW3A 3WHIA 2ROPA 3G4SS 1KAYA 5FJ4A 3SSQA 2DGWA 5H9FK 2GMLA 5J2MB 2D9PA 2OFHX 3VQ4A 1UA0A 3N5BA 4PQUA 1RLDA 5K8MA 3WX8A 5A76A 1QAYA 2CAJA 5B7WA 4EHUA 3V4IA 3SQ0A 5KFMA 1W0HA 3ID8A 3KJFB 1O1WA 4DR2K 4RUBA 4JI1F 4M94A 1KWMA 2QMXA 4C3KA 1FNXH 3VF6A 4ES3A 3PEJA 1BWEA 1S1VB 1J5EJ 4AHVA 3A8IA 1DTTB 5LXYA 3ENWA 1QQNA 1BXNA 4KI4A 4IFYB 1NM1A 4IQMA 4A46A 1GT8A 1U1MA 2DY9A 4ZOSA 1Y3JA 2PMZD 1C0UA 3CFRA 3VAGA 2HF3A 5SZTA 4DR7K 2AYGA 4ZCLA 3OUYB 2D69A 3SCJE 4F26A 1ASWA 2ZFHA 5LL6d 3HFZB 5HANA 4LIWA 5BPMA 2F7VA 3D0GE 1NGHA 3H59A 2Z2ZA 3CQXA 4IBNA 4JI1K 3FZBA 2J6SA 4EBCA 4Q44A 2CNLB 4I0WA 4V19X 4OPHA 4B3TF 1NOYA 1UEUA 4ZHRB 2DNKA 4FXVA 2ALYB 1YJNN 5HLFB 5HVHA 4J9QA 4DV6K 1T03B 3J80O 1CULB 2E8AA 3DRPB 3EE3A 4EI2A 3FZ2A 4BACA 3TTCA 3F0NA 3ENQA 3K0SA 1XHZA 2R7YA 2PGCA 2XS7A 3HHLB 3MAHA 2AP6A 9ATCB 1XMQF 3U1MA 1GOAA 3GV8B 1S48A 4DV1F 3QEIA 3ISND 4KHMA 3D1HA 2C2ZB 2IC3B 2NRHA 1HBUA 3CJSA 1F5CA 3ZEUB 4YHHJ 2W7OA 4JBCA 1BDGA 2XTJP 2E1PA 2VQEK 3FBBA 4HH1A 2F9DA 3QYYA 3SIPB 1X5TA 2DISA 3CO0P 1FTRA 3TWHA 4CF1A 3SLCA 2N3LA 4DTUA 2Q31A 3MMVA 2CXEA 4URSA 1YBAA 2DEJA 1J2VA 1XMOK 5DM6Q 2ZC4A 3DOMA 5GADP 3T3FA 1GMVA 2F8SA 5E2QA 1OH6A 2ILYA 2P6TA 1I51B 3E9LA 3TPQA 4B9QA 2EC0A 1VRQC 3SUOA 3TYTA 4C9DA 2R2TA 3C6AA 4Y1CA 1JLCB 3AY0A 1D5AA 2HHUA 2IVOA 3BDPA 4B17A 4JI5K 2IDOA 1WSFA 3T5JA 1Q82O 3QZ8A 2Z2MA 1W7WA 3WC2A 2HNDA 1HNIA 3CDEA 1SJ3P 2FHJA 2QV6A 2RS8A 1RT2A 1XR7A 2ASJA 1NPPA 4X65F 1CEZA 3KUGA 4YR0A 2OPQA 1WELA 4R0JA 2XC9A 3QFUA 3OFFA 5EN1A 2I1RA 1U04A 4PXDA 3U8XA 4ZLNA 3VR1A 3NE6A 4F25A 3K9KA 5KTQA 3LGHA 1ZBSA 3GJRB 4QS7A 4YNQA 5J2PB 1XEZA 3CJRA 3O4WA 3I4PA 2GVDB 4IWVA 4JI5F 1VQ7S 1RXOB 4DR4F 1JJ2M 5HL7Q 3QNOA 1TKZB 1T9TA 2IAJB 4H4KA 4PZVA 3B6OA 1WTFA 1CJKA 1NLKL 2DGQA 4MKBA 2P9KA 4BREA 4LRCA 2DHHA 5F9LA 3DLKA 1SIWB 3R5BA 3RR7A 1WSVA 4ANDA 3VGMA 3BGUA 4W92B 2YI1A 1PYOB 1CSJA 3TO8A 2HURA 3OPKA 2DRAA 4X64J 5EHHA 3J81Y 1GLBG 3MM7A 3BQ1A 3ZZTA 2X1BA 1UJ6A 5CHCB 3BR8A 1V5VA 2ZBQA 2ZNYA 2B3TB 3PR4A 1LWCA 1WAFA 3VQ9A 4YOYA 1KBRA 3C14B 3G87A 4Y28C 4MTPA 3VAMA 4BRHA 2ZOGA 4FLTA 2XNQA 4F2SA 3M6UA 2C3MA 1VQ4N 1H72C 2YQ0A 5B0CA 5ETMA 2FGOA 4KH4A 5HO4A 1I1GA 1KXPA 1FA0A 1UW4A 2YJFA 4C0BA 1TMMA 1PG5B 3FGUA 3B82A 4RNFA 3J80U 3PJWA 3PJXA 2HHVA 4X4TA 2W6KA 4PG4A 4NRTA 2EFOA 3JYTA 2UUWA 1HBMA 1ZBFA 3QO9A 3HLUA 5I3PA 5ETKA 2QLXA 2PI5A 1U1NA 4DSFA 3CDBA 2EHGA 4JI3K 1NGBA 4A8SA 4HCBA 3I0RB 1VHXA 4IDKB 2FJXA 1TL3B 2DB1A 4OZ1A 3UIQA 4OMFG 4X65J 2Z1IA 1N32F 2E7VA 1NSKL 3KNGA 3RB0A 2U2FA 1CJVA 3HVTA 4QOTA 2NSCA 1VSEA 1S57A 4YDXA 5EX5A 3IBWA 1WAJA 1Y5IB 1XIQA 3BPDA 2XS2A 3ZFVA 3VTHA 2ZE2B 5C7PA 3DI6B 5M1KA 1RHRB 3GIRA 4NEZA 2KI2A 5B8HA 1UVNA 4R5PA 3NGTA 2KVQE 1YWXA 1S0NA 3BGFA 1RT7B 3NY0A 1HRHA 3GIJA 3HP6A 1UCNA 5ETVA 2LU1A 2WB1D 1ROFA 2O3DA 3A5OC 2QN6B 1NMDA 1RBRA 4CZCA 2VG7B 1T05B 3CJQA 3O44A 4M95A 4XAKA 4CECA 3K8VA 2DPIA 4KHPJ 3CCWA 4I2QA 4ENOA 3KWMA 2MJNA 3PIPQ 3UI3A 1OH5A 4CGHA 1UW9A 2EW9A 1JMTA 4RW4A 3OYFA 5A8WB 3AA5X 4J2BA 4Q2LA 3Q8QB 4DR2F 3C6HA 3EL2A 2RS2A 3HXMA 3W3DA 2PT0A 2F8MA 4FJ5A 4DMNA 4DB3A 2YXLA 4U9RA 4JI0J 1YJ9S 2VBZA 2QLFB 3MMBA 4PG8A 3ZSOA 2WSCC 3PFOA 2QXFA 3UDLA 2D9OA 5CZVA 1WDDA 4E1MA 3BGOP 3NEKA 5KRSA 1YUWA 4CH0S 4C11B 4LSLB 3FRYA 3VZHA 5HQMA 2VYPA 1WI6A 1V5IB 3TVZA 1FRHA 3CD6S 3HPHA 1R8AA 3DXMB 2W8KA 2HRUA 1VJWA 1C1BB 3Q7CA 1BQMB 2W24A 2E5HA 2HB5A 4UZBA 3V1OA 2F5GA 4CJ5A 4ED7A 4RJVA 2YNFA 5LMNK 1DQAA 2XEXA 1LXNA 5C0YA 1RT3A 1VSKA 3NVMA 4GC6A 3BSCA 4XTTA 5AT1B 4K50A 5KPZA 2MKCA 1X5OA 5HVFA 3LPTA 4IJAA 3G6YA 3C15B 2QA4G 1TKTB 3PY8A 2HFVA 4XH4A 2K1RA 1DRZA 2HBRB 1VSJA 4I6MB 3NVKA 3NCQA 3NGRA 4J2DA 1TMJA 2VQFF 2BTFA 1EHWA 2KU7A 3OXLA 4OYAA 3DLEA 2QA2A 1PKUA 5E3PA 1SV5A 4GKKJ 2KRBA 2FHJD 4KO0A 4ID5A 3P4IA 2O5DA 2KXFA 3OVBA 3T9NA 4DV5F 1IBKF 5AQXA 1D8YA 2I38A 1SQEA 2E5LF 3OYGA 4CLLA 3RBXA 2QA4N 2ZM6K 2UXCK 4CJEA 3N01A 3EX7B 4E19A 2VQEJ 3I82A 3R5CA 4ED0A 1N34J 2M5YA 2QG9B 1WSHA 5CYQB 3OBWA 4DEZA 1T02A 4CF0A 2KL8A 1YVFA 4ECQA 1R6YA 1E6YB 3AHPA 2NXJA 5GIOA 4OIXA 2CQCA 2XZDB 4IO1A 5H9FJ 4CK1A 2WC9A 1NGJA 3CMAS 3K5LA 3CCQS 4L3QA 2QXLA 3OXGA 3ULEA 1QQMA 4B3TK 1FJCA 1OWXA 3GU0A 2V63A 5IM0A 2NPIA 4LUBA 3EZWA 3W66A 4DR5F 3I9ZA 4Q43A 1HFEL 2VD3A 1RKIA 3F2KA 3U02A 3VWSA 5I4MA 2AF6A 1BQNB 4RNOA 4QU6A 4UUWA 1NM2A 3J81j 1CJVB 3RB3A 3E3XA 2GX9A 1LKZA 2XYHB 3D4JA 4RNHA 1MWYA 2DXEA 4UF4A 4FJIA 4CERA 2P9UA 4NXMK 3MTJA 2MKKA 3HSTB 2CJ9A 1RT4B 4U8VA 5A2QY 3EXCX 4LFCK 3PRVA 4X4NA 1SH0A 4H8KA 2JJ4D 4WPAA 3P49B 2PZSA 4FNHA 4LC9B 5KG3A 4LF9J 2YCHA 3CCZA 4P72A 5AQYA 2OTLN 3RGIA 4YB6A 2XMVA 3TX0A 2LKZA 3K5PA 3N6NA 1ZH5A 4C3MA 1XNQK 5AR0A 4WQ4A 1ZAVA 4TU8A 4P73A 1TTHB 2B0GA 4BG8A 4Y1DA 1HJOA 4C8KA 5D4PA 5KFBA 1R27B 4CZLA 2J7WA 1UKUA 4QR2A 1V6HA 4CZFA 5E3RA 2G2YA 4JI8F 5BYQA 4LSNB 3E2EA 3EEQA 4AQYK 2VFUA 4FM1A 4X4VA 1KQSM 3SBGA 1GQEA 3CCSS 1LK7A 2D4WA 5KGXA 1U49A 3LH2S 4D3GA 3BJYA 3VQ6A 3OYDA 1SS6A 2GUIA 3CNQP 4I6AA 4NXMJ 3L2UA 3L8BA 4FSVA 3Q2TC 1TELA 4CLSA 4F67A 3DXKA 2WSEC 2QMWA 4BVPA 1ZBTA 3SCKE 4DFJA 3T5KA 1CULA 4KFBB 2A6OA 4AYBD 4CEEA 5HN0A 1NGGA 2AYMA 3C66A 3ISZA 1WWHA 2BKNA 1QM9A 4QS8A 5E41A 2AWZA 1VCTA 2IRUA 2B7BB 5AQNA 2EFQA 2F9JA 1D1UA 3B4DA 2ZEJA 2H48B 3RMBA 4JI4F 4DCJB 3DYAB 3OYMA 1EKEA 2F4FA 3UW1A 4NX9A 1I3OB 3MCSA 3BSOA 1KQKA 3JSMB 4DR2J 4BRGA 3C15A 3HVTB 1RSCA 4K4ZA 1NJIO 1JKHB 4KAIA 3KXDA 3A8EA 2D0CA 4EZ6A 3W5XA 3O5BA 4HEA9 3BM7A 2E4LA 4H5WA 4U67L 4LF8F 3H98A 1YHQN 4OI0A 3FUYA 1K73O 1QUPA 3TAFA 5JJBA 4L8RB 2DGSA 4U6PA 3AD7C 3M9MB 4FF1A 5J2NB 3M3ZA 3O3LA 1RJJA 1NJYA 1ESVA 5D3GB 3CCVS 3VHQA 1BO5O 3QRPA 3N5FA 2ASOA 2ZBRA 4C11A 1EIYB 4JI6F 2PD1A 1HBOA 3ZYYX 4QYRA 3TZZA 1H0HB 2V8GA 1GLFO 4GY2B 3UNGC 3R5AA 5DMRA 1TKXB 1Q95G 4TLQA 1VQ5S 5D8HB 4FL9A 5CAAA 2A1SA 2QA4S 1WG5A 4PKDB 4B9NA 2DR9A 1QSSA 1S3XA 2F8TA 4A8WA 2MKIA 5GMEA 3RU0A 3MURP 2BUPA 5LY3A 4B9SA 4YEAA 3FEZA 5HMZA 3ETMA 4FS1A 4F0MA 2UUAJ 1BUXA 1N5VA 5L8RC 2KZMA 1HI0P 4MDAA 2G9OA 4I64A 2UUCF 3OW2R 3ILIA 3L09A 4AQYJ 1P6TA 1U6ZA 4JYAK 2Q36A 1V3SA 1VRTB 1ZC6A 1S22A 4KO0B 2VZ9A 1E6VB 4OKEA 3HT3A 4DL7A 4QIEA 2P9KB 3MECB 3RW7A 3OBYA 2WOMA 3L3CA 4R8UA 3EVOA 1RT1B 2NNWA 4WK1A 2N3OA 3MUVP 3SV4A 3CJ7A 4FWRA 2D1KA 2HNZB 2O8DA 4DZDA 5HROB 3OHRA 3UN5A 2I8EA 1O51A 1I39A 2IJFA 4EP5A 4S0MA 3IAS9 2MPUA 1Z4UA 2IVPA 4H0XB 1S99A 1KN6A 1H2VZ 3TWZA 2HBLA 8AT1B 4XEIA 1CZAN 3JTPA 3VGTA 3PVXA 1S9EA 1P9QC 2VPZB 4JK9A 4BC9A 3QFHA 4USWA 3LP2B 4MQ3A 3OT9A 4ED4A 3UQSA 1Q82T 2CJBA 1WEXA 3G6VA 3O1WA 3OA9A 1S79A 5CD4A 2EK6A 5KFWA 1N5QA 4ZJOA 2RAQA 2VWJA 3DC2A 5J1EA 4CGJA 1ZA1B 2VG6B 2BGGA 3OJSA 2ROEA 2VOOA 4O4GA 3TZWA 4CLYA 2DR5A 5DRKA 3FCHA 1T7PA 1WNEA 1RWPB 2R8KA 5E26A 2CNKB 1TUYA 3AJ2A 4EWTA 2RJZA 4DQSA 2IJNA 5LMUF 3CCSN 3CTRA 2K8GA 3NFAA 4N41A 2CPJA 4CJPA 4WWSA 1YVNA 3D2FB 5M2PA 2VQEF 4JKFA 2E44A 2W9BA 4J9MA 2P2CB 4OLPA 4ZPBA 3W7BA 2B4JA 5AQUA 5IWAK 1HD1A 1YRXA 3T19A 3NLCA 1O8BA 1VQYA 4M63C 1XMBA 4LF5F 1T03A 1VLOA 1U8SA 2FLOA 4KHQA 4HHUA 3I9V9 4DV3F 1IQTA 4DDFA 3CC4N 3MN5A 2ZH2A 2W4PA 2MKHA 1N6QB 4ED5A 1VC6A 4M3YA 4W5QA 4CEQA 4MKAA 1JLEB 4BR2A 4ZVHA 3MM5A 1JLAB 3LANA 4N8OA 2CJKA 3CM6A 3LDQA 2ADBA 1FESA 5AE1A 2QTWA 2IAJA 4UQTA 2KT5A 2XNRA 3O9QA 1YBUA 4NLVA 1KC8T 4M5JA 1T6DA 3WQPA 1KFSA 4OZ0A 1DFDA 5E33A 1IKWA 4P10A 4A62A 4DV7K 3BN7A 5D4NA 2GS8A 2CQ2A 2GELA 5E3AA 2WCXA 2KKHA 1NSAA 1RUSA 2H9ZA 4ERDA 1U1RA 2HVZA 2HRYA 1GLEG 3G8SA 4C23A 2BOPA 3A8KA 2HQIA 3S3NA 3HHKA 3ZT1A 2P9UB 2E7WA 2B56A 2GMJA 1MDUB 3THXB 4J9OA 3DHXA 1XNQJ 1NK7A 1FKPB 3UN2A 3AVFA 3NOCA 5CCLA 3VQSA 4DR6F 2NSBA 2WUSA 2F7TA 1WUUA 4ITSA 3KLFB 3HHDA 2PC6A 2VH7A 5C5JA 4OZNA 2LDIA 1GOBA 3BDEA 3NF7A 4M5GA 1HQEB 4O5FA 1C1CB 2DVIA 3DOMB 3HCXA 3EPIA 3ULEB 1G1XA 3VMFB 2ZOMA 4KB1A 1WSGA 3O3HA 3NGSA 3QT7A 2VPYB 2GNKA 1M5SA 2KHOA 1JCEA 2CGKA 1D09B 4DUTA 4O4RA 3KVGA 4BG9A 1SCJB 3TOQA 2QWPA 3C14A 4HACB 1K44A 4ZS6A 3PRDA 3RUBL 2BKOA 3VGUA 4WQ5C 2V9KA 3BGRB 3FSIA 5CY4A 3N79A 4X84A 1T9VA 5KFNA 4AH9A 1JB0C 5M1QA 3TTDA 4KYZA 5FPEA 2KRRA 3NBPB 3O1BA 2WTFA 3ZNJ1 2MB0B 5KPRA 1KOOA 3ADAC 3QRRA 3GPAA 5LXRA 3J7AN 5HJXA 3Q7BA 1CJUA 2W25A 4ELVA 4P7TA 4IO9L 1F9FA 3EKSA 3BZCA 2CG8A 4PY5A 4FXDA 1DZ5A 2X3GA 5HQ8A 3VAJA 4DTNA 5HMWA 2G13A 1NSPA 2FQQB 3CCUS 4M45A 1HNXF 2UP1A 1XHXA 4U8YA 4JRPA 4W90B 4KT0C 1NAQA 3PHEA 4CT8A 4OHWA 3BPSP 2IBOA 4LF7K 5DDPC 1PYSB 3L95X 1JXEA 1HNVB 3MDFA 3MAAB 4KHRA 4QWDA 4CJVA 4CIOA 3ZT3A 2R4FA 1N54B 2K3KA 2FY1A 3GILA 1FEHA 3DU6A 4YOWA 4QYZK 4KHUA 2N82B 3S41A 4H4OA 2O8FB 3MM8B 5CHIA 3T1AA 3D0HE 4PWDB 4A59A 4FW1A 3KG0A 4P2XA 1OQ3A 3GCWP 1F2HA 5H1SV 4OJ3A 3EZ5A 1DTTA 2I7PA 3ZCMA 3CJ3A 3VCDA 4OJRA 3IS9A 5AQJA 4UT4A 4EU0A 4YHHF 4FYWB 4QWEA 4DHYA 1RBLA 2GWJA 2OCEA 3HI9A 4O3QA 1N5SA 4TU7A 4KQZA 3DMJA 4DHVA 4KPCA 4B3MF 4PQUB 3SQ2A 5MAOA 3CCRN 4XIUA 3HO1A 1RTHB 4AHSA 4HHHA 3OTOK 1U47A 4NLUA 4GW6A 4ETXA 1EZZB 4LF7J 4E7HA 5A0YA 4PPDA 3HJVA 2KT3A 3H08A 4B3MK 4PKGA 2LFVA 4QIGA 3QAEA 1CXQA 4LRDA 1NGCA 5B09A 2IPOB 1X31C 5KPTA 4E89A 3MEKA 5FPNA 2B4OA 4DWIA 3OXFA 5T7LA 3I8DA 2GIQA 1GXUA 2W9BB 1OKJA 1JJHA 2JGUA 1BL3A 4FLXA 4PG6A 3MXMA 4DUYK 2ZZMA 2I9SA 3O8MA 1VQ8S 1NCLA 1S1UB 4OJHA 4MH8A 3SFGA 2O8EB 3VZIA 3LPYA 4JI5J 4B9UA 2AKWB 4DU7A 2FXUA 2CPIA 1KQGB 2UVWA 4TY8B 3R2DJ 2N7CA 2ZVIA 3I5AA 3J8AA 4CJKA 2ETJA 2P9LB 4DU1A 2XZTB 1JXLA 1PBUA 5ETRA 2YX1A 5FRNA 4I2PB 4CLFA 4A8MP 1RU2A 1R0CB 2HSEB 3GFHA 4JI2F 4RO0A 2DO0A 4E7IA 3EE8A 3ZT2A 1T95A 4ZA1A 1GLJO 5KFKA 2QKBA 3LP2A 5CQGA 3CD7A 1EB0A 4Q45A 2YY3A 1IKVB 1H74A 4NLXA 3EGNA 3A5MC 2WVFA 3ZTOA 2CWKA 2B9EA 3AVBA 2MSSA 3JS9A 2KHDA 2G1DA 4CLKA 3WEEA 4NO7A 2OMLA 3TX8A 1HYZA 2UUCJ 5DM7Q 2XMJA 3G86A 4I6YA 3K5MA 1SL0A 4IOBA 1YT3A 5K20B 3IBFB 5JMVA 5DG9A 1JLGB 1RDAA 1WN7A 3CMEN 1YJUA 3T41A 1RTDB 3A0IX 1WKKA 2EKNA 5BRHA 4WQ4C 3ZSYA 2KDOA 3NWGA 1YJWN 3DGPB 1RT1A 4PAAA 4Q0BA 1RGVA 2A10A 5F9NA 3US5A 4ZVEA 2P9NA 1IH7A 3HK2A 1S1XA 4K4WA 3KLHB 4CTAA 2J8SA 1RTIA 3SJHA 4LF4K 1U6BA 2AJ4A 3BY5A 5LSOA 3VEYA 2AYBA 1RT6B 4PYDA 4F3MA 2XHBA 4Q0BB 4LFBF 3OL6A 5BN9A 1QVGM 2UXDK 4H03B 2GV9A 3P83D 3C0BA 4AT1B 4FYVB 1EKRA 4B3MJ 3VAFA 1WSRA 5KT2A 2EBGA 1Q86T 1UL3A 2KG0A 2R2RA 3ZNUA 4Y2KA 2CQGA 3BEGB 4FCYA 3PR5B 3C7NA 1JL1A 3VESA 1NK9A 2OANA 3FK4A 4RW7B 1R0AA 1FWKA 4O5BA 3AO3A 3PX0A 4J9VA 4JKEA 2WVEA 3I32A 2AEFA 2ATQA 3WNGA 1RT5B 4DSKA 3P96A 5GADU 4Z4HA 5H1SQ 2D0AA 3JQJA 1NRKA 2C3OA 1U26A 2IM1A 3VQTA 1UEKA 3M2UA 4B1VA 4TU9A 4H0PA 5GAHI 4J90A 2WK4A 4V19S 4M8LA 4DN0A 3MEGA 3O6WA 1LEOA 1WC4A 1O13A 1TL4A 3RWUA 3P38A 2FZCB 1VQPS 1X0FA 2KFYA 4WFNQ 2A6AA 3HVWA 3HSGA 1HNIB 2VFVA 2DNLA 1I3AA 1VQNN 3IM8A 2XMAA 3BO3A 1X1PA 1UEVA 1K6YA 3RSEA 3AAWB 3HSZA 1ZTTA 4MKYA 3GFYA 4LF5J 3V6JA 5JLFA 4TVAB 4RW9B 4HI1A 3ZXWA 4JV0A 3Q8PB 4X4UA 4C0HA 2HVHA 2M2BA 2Q1LA 4LBIA 3WXIA 3K2PA 5KG7A 2CA9A 2AYEA 5G0RB 4FYXB 2WRMA 4NLCA 1NZ8A 4WP8A 4QCLA 2NRRA 1VISA 3EICA 1YSJA 5KFEA 3NMRA 3BBBA 2RN2A 1LW2A 4HACA 4J5OA 3LWLA 1N8RT 4CJTA 3V6KA 2CVIA 2AGOA 1V9OA 4LF4J 2J0WA 5GAHU 2DFEA 4K0KF 4F4XA 3R6MA 4RW8B 3R9LA 3LWMA 2BQ3A 4Z7CA 1N36K 3TUJC 4AL7A 3O4QA 2JH3A 1FVQA 3S1TA 2B7CB 4HUFA 2ZD1A 1U09A 2MEWA 2GEMA 4ZP6A 4ECVA 3TUPA 2XMKA 1Z1ZA 1MLAA 1S0VA 4JKAA 1RISA 1WC3A 2IBKA 5GAEU 5CCMA 2E5IA 3Q22A 4LRFA 1J9AA 2NRZA 3VEVA 4MLEA 4M3UA 3I31A 3MTKA 1UAWA 1RBUA 3WXMB 3QZ7A 4RWXA 4RU2A 1PC5A 2JEJA 4EP4A 1IG8A 2DBBA 1URNA 3C6UB 3A5NC 3C6TA 5LM7E 3GYGA 4EYIB 3RR8A 2DHSA 1BY9A 2QW9A 4IZ9A 5HI7A 1YF5L 5IT9O 2QO3A 2G4BA 3EDRB 3OTCA 1YJ9N 3IUCA 2EI5A 1QAIA 3NNHA 4KKOB 4DG1B 4K5RA 1FDNA 3QB0A 3SMPA 4WFAQ 2YHBA 1WF1A 4ZVOB 3VVTA 1A0OB 4WJBA 3DM2B 2J76E 2AMCB 4WKYA 2FBTA 1B70B 2FSJA 3VA0A 2RKIB 2CVEA 3GJQB 2AA4A 2ZITA 1T44A 1YIJN 4MO4A 5AXMA 1RCHA 2AQ4A 5IQ6A 1FRKA 3OSNA 4F4WA 2HHQA 1U2CA 1HNZF 3IP0A 4CFBA 3DXSX 3D1QA 4DCOB 2VA2A 2AZ3A 1DHMA 4JLHA 1M0SA 3DOLA 1H2TZ 1YBTA 5EVZA 3RBZA 5KGWA 1MG7A 4Z2XA 1WHXA 4CLWA 5TKYA 1X9WA 1KEKA 1N33K 3SAFA 3GYNA 4QPTA 2F9WA 5K9FA 4QR1A 4NLQA 3CDUA 1SIZA 1LFWA 5C24A 3AVJA 3QBXA 3OYLA 1TK0A 3R6LB 3CF5Q 3VALA 2HBMA 1GTEA 3IN5A 2VL1A 2CPEA 3W61A 4AHCA 1IKYB 1HWKA 2QFIA 1Q1KA 2ADCA 2KJWA 2MQPA 5FROA 5KFRA 1VSHA 2PMWA 1N33F 3UPFA 1RAHB 4FWPA 2H65B 3SDEB 1LFPA 3TQEA 3HZEA 3WXLA 2VG5A 3UB5A 3NDKA 1REVA 4KBIA 1RADB 1ZM3A 2GV1A 2GJIA 2UUBJ 3KJQB 2ASYA 3PM9A 4OYWA 3LDSA 3AJDA 4FJNA 4ZP8A 3RJMB 4G3IA 2QRRA 2WW8A 3IGNA 2DKOB 2VDIA 1LWEA 3KHGA 5E0OA 4Q2MA 1RT3B 3PIOL 4FLUA 3A3OB 3UN3A 2DNGA 3CJ1A 3VGKA 1TKTA 3OTDA 1QLNA 1FE0A 3CJ5A 1YRUA 2BE2A 1BA0A 4V1Ak 4GKKF 4WFXA 3AARA 1OY6A 3UD3P 2KM8B 1LW0B 4DV7J 2RNEA 1GNKA 1P9YA 1NJWA 2FJEB 3UDVA 4ICLA 2XYPB 4W5TA 4LVNP 2KM8C 2FF3B 4OI2A 3F41A 1U1KA 1DEJA 4D3HA 3KLVA 1Q9YA 1FJ7A 2GTDA 1S1VA 2YQ1A 2HHSA 1KQSR 4BCAA 3DXMA 2KW4A 4FOEA 4YY3K 4KBOA 3AVLA 3A3PB 4BRFA 1A7GE 1D9AA 1K9MT 4CYUB 3ZX2A 5GAHP 1JNRB 4WTOB 5A6WA 3L7PA 2WVBA 3RRHA 2IS3A 2X6NA 3M8PB 4K2XA 3HJFA 3U6FA 3K2YA 1FJGK 3PYFA 2B4VA 1L3VA 2E1YA 4GKKK 1NB7A 4RUCA 3T69A 1WDTA 4DFPA 5AQMA 4O55A 3CUNA 3FZKA 2VG5B 4HVZA 2J0QD 2ZDOA 3ASMA 1PCAA 1RU1A 1B9DA 4BY9C 3T6BA 3AA3A 1RTIB 3QGPA 1S4EA 1WHYA 3UD5A 4M41A 5IT0A 2ASDA 3TW0A 3JB9k 3KMQA 3OHBA 1U48A 4NLRA 5DZ6A 3V2UC 1RP5A 2BM1A 4CEOA 1KONA 1IJEB 3TAQA 1U25A 1GAOA 4GRSA 3R5DA 4FS2A 1NH8A 1NKEA 3ZZOA 4CO4A 5B0EA 1JJ2R 3MXHP 2BH1A 2KH9A 4BROA 5JXSA 3LP0A 2M7SA 1VIOA 4DU3A 1YJ7A 3MPDA 1VQSA 1X5SA 3EYZA 4FWQA 4DTSA 4WFNL 3L4QA 1Q8KA 1AZSB 4DFKA 4FDFA 3CJCA 2CQ1A 2OZMA 4NEYA 1WF2A 1H7WA 1NB2A 1AFIA 4FBUA 1X4CA 4ELUA 4B1WB 1S1WB 1N0UA 2FIUA 1NK6A 3LGNA 2XO7A 5JS2A 4DSIA 5JICA 2OKQA 1P1LA 5TKWA 3K59A 1U24A 1R8BA 4DN9A 2XMWA 3QT5A 4FPIA 4YDUC 4B3SF 4DV0J 3NGKA 2R7OA 3QNWB 5F0XA 3KJNB 4DQRA 4WCEL 4E7KA 3EY1A 3T1YJ 2HS4A 1J5OA 1X9MA 4BBYA 1XJWB 3MPVA 2RHQB 1J5OB 1WOPA 3HI0A 4NCGB 3CG7A 4JI4J 2DNZA 5KT6A 4OJ1A 2OMOA 5IQQA 4JKDA 4DR1F 2IMWP 1VOMA 2UU9K 1XMOJ 3J7ZO 1HBNB 3BKFA 2LQ8A 2OPRB 2Z2YB 3FBEA 2AX0A 4IOXA 4EAHD 1Y10A 2DHAA 1YJTA 2AEMA 3TAEA 3BREA 5DK5A 2AEJA 2WW4A 1SAZA 1GX5A 1C2PA 1NJXA 3U9DA 4N8NA 4OFZA 2RRAA 2Z2LA 3EXYA 2CZ9A 2VGNA 1FE4A 1HBMB 4LVOP 2Z8QA 4W5OA 2PYLA 4JI0F 2UUAK 2MMYA 5DZ7A 4IG3B 2C2KB 1J5EK 3Q8UA 4DL5A 4KGZB 5BYRA 4HTUA 4K4SA 4BGBA 3OTOJ 4DV3J 1N36J 2DK2A 3ZO7A 2V34A 3WDOA 4ELTA 1S9GB 1T9YA 1SJFA 4F0HA 3P8BB 5DGBA 3EWGA 1Q81O 2R7QA 1ATSA 5I42B 4OV6A 2FLPA 3T1HJ 5CABA 1VQ5N 4X4SA 4JEPA 4IUFA 4HUGA 2X1GA 4NLOA 1RAGB 3SV3A 1F5AA 4HR2A 5DLFA 2IYIA 3PCOB 4DLEA 2H4WB 4DX7A 1NHVA 3HT0A 5KG4A 4DUYJ 3QETA 3PW2A 2HIYA 4EMDA 4ZIVA 4X65K 2BBEA 3L3UA 1RTDA 3L4IA 3W2VB 4KI6A 4M7XA 1S7IA 4IKAA 3SK3A 4NLBA 5EX0A 2DGXA 4B3SK 3BGLA 4I67A 1JJ4A 5ADZA 4RBUA 1RT4A 3TABA 3AO4A 4Z94A 2OPQB 4ZPVR 2BJ1A 4H0TB 4F9OA 1T9XA 2HS0A 2PMHA 3DLLL 4OZ5A 5DM6L 3M8RA 4HVJA 4F04B 4A8OA 2KVIA 4NLDA 2W4CA 3PRBA 4AL6A 1RYRA 1BA1A 2UUTA 1IM6A 2VWBA 1KOHA 1KVJA 5BPNA 3FKBA 1B7YB 2LECA 1HYVA 3G82B 4KTZA 1OY9A 4DF8A 2CJXB 4CHPA 3NS5A 5M1PA 2DR7A 3OQ2A 2V8DA 2BUNA 3D6TB 5L9NA 3J7YU 3CT9A 1X3NA 1SC3B 2V2QA 5KAKA 1NG9A 1UZHA 2BE2B 3V1QA 1MW7A 2Q97A 3JAMU 1BQXA 2L9DA 3AOCA 3OSPA 3CIZA 3L9ZA 4IEEA 2F9TA 5AQZA 5IOLA 2V7YA 3GL1A 3JQKA 1U2FA 2HVIA 2LDYA 4O8UA 1VAZA 1FWPA 3VQEA 3K7RA 3HKZD 4CD3A 2RQ4A 2OA8A 3ISNC 2ZH3A 5ETQA 3N4WA 1Q18A 1YXQA 2JX2A 4BE1A 4EK2A 1GFWB 1WUAA 1NDPA 1Y64A 4UY8O 3W9IA 4EEYA 3QJLA 3ZEUA 1R59O 4O3SA 4OPAA 1V3ZA 3VEXA 3OHAA 4OV1A 3RW6A 3OVNA 3SMSA 4NZ6A 3CXCR 2R8JA 3DLRA 2P9EA 2G0CA 4QAGA 4QU7A 1FNOA 4CZGA 5GVQA 1HI1A 2UV8A 4BQLA 1H6KX 1QD1A 1H98A 3T1HK 2XCAA 4HTJA 4HWIA 1J53A 1L3TA 2K7KA 1XC3A 3IM9A 3VGSA 4KRWA 3P4UB 4MK8A 3I4HX 3ZC4A 2IRXA 3IRWP 1VSFA 2UVRA 5KFVA 1U1OA 2VPXB 1HHQA 5LMUJ 1WI8A 4USVA 4EIAA 4KHPK 2EFPA 5FDLB 2DNRA 5KFUA 3OUYA 5B0GA 2G8HA 1SH2A 2YNFB 2I0XA 4DS4A 1VQON 3KHRA 6FD1A 4G1PA 4GKJJ 4IRCA 1RBAA 5L46A 2MHEA 3UKUB 1QVGR 1IWAA 3D3CJ 3D66A 1B0PA 4U7UK 4B3RF 2Y9HA 5BRFA 1XC9A 3SQ4A 1KSPA 1EQYA 5DM7L 2D3ZA 1NWKA 2B5JA 3EPGA 3VENA 2IMOA 2RVJA 3ZSVA 3QIDA 2F4VK 3BF4A 1FJGJ 2ITGA 1U2RA 4KREA 1SQFA 1F0XA 3VQDA 1J27A 2MSTA 2WBNA 2Z57B 1V4TA 4H5VA 1AZSA 2GHVC 5F3ZA 4NYPA 2XBPA 2YWFA 2IYGA 3WC0A 3GB0A 4L76A 2H51B 1U45A 2XLKA 2FJAB 5IWAF 4ECUA 5C2CA 5AJ3J 1YZ6A 3EN9A 2NXCA 2DR6A 2ILZA 1WC6A 4CFCA 3M8WA 2MZTA 4RW4B 1QTNB 4XPEA 4W4MA 5AXLA 4CGIA 7AT1B 1QUVA 1BIZA 2Y1IA 3ILJA 2P6SA 3Q83A 5LOQA 2UVVA 4WP9A 4MAKA 4ES1A 2J0XA 1YQHA 3JSBA 2CIMA 1YTYA 2QT7A 5DDRC 2LQ5A 4IDHA 3KUHA 1S9GA 2GO9A 5JMNA 3IR6B 1TL1A 2P51A 4L74A 1P8ZA 1RT7A 4FWKA 3CERA 1XQSC 2HMIA 2ATLA 3CE8A 3ZZPA 3QDKA 4FPAA 5FLXY 3W9JA 4B1ZA 3SMZA 3PUFA 3AA9A 2LSNA 2OFGX 4O0JA 5ETOA 2ZUGA 4FKXA 4BE0A 3P3DA 4IH6A 1N8RO 1FJGF 2M0GB 3VQ7A 1IJFB 2NZCA 3RSEB 3WXJA 4BR4A 1VMBA 4Z4FA 4USHA 2V67A 5KT7A 2FZGB 4NI2A 5FLXU 5ELZA 4QZVB 3B8AX 4ZKAA 3DDNA 4JD2B 3TAMB 3DLJA 4BRCA 3M6WA 3C94A 1N32J 3D5MA 3QSYB 4CDIA 3VEOA 3AVMA 2HLTA 3HVAA 1B4SA 2Y1LB 1SZ2A 2OEJA 1RAJA 4USIA 2YH0A 2N4DA 3CCUN 3KMSA 3G6ES 4HT7A 4OZJA 1IKWB 4BWJA 2HBYB 4TN2A 2EG2A 2XO6A 4CEZA 1UVLA 1RWVB 3P6YC 1FCAA 4LMZA 4K25A 1EARA 1JLQA 1EKSA 2AJQA 4K4YA 1PIEA 3QRQA 1RABB 2G8KA 4BVOA 1C6VA 4HTLA 2RF2A 5M1FA 4OHZA 3SQ1A 4F8RA 3ZZYA 3RTVA 1NHUA 4CO0A 1E4GT 4IOCL 4RUAA 1PJ7A 4HH0A 1D9FA 2DGTA 3QLHB 4FLVA 3P5TL 2FSKA 4L3KA 2MYFA 3IBCB 1TL1B 4DSLA 2PDAA 3PX4A 4K4VA 2CQ3A 4CIEA 3FLCO 3C46A 3TARA 4JK7A 2HQGA 3CFPA 1N5TA 4RW6B 2WBRA 1RFQA 3LQVA 4MDBA 3O9SA 1VI7A 2LVWA 2E5LJ 1QY7A 2HQCA 2IA0A 3PW4A 1MSWD 1B0VA 2HHWA 4YP3A 4DTRA 4DPUA 5D3GA 3I55S 2XULA 4EYHB 3MGJA 4JP8A 4DU8A 4USMA 2MXYA 4I4BA 1B64A 2UXDF 2MJUA 2QA1A 3GP9A 2V8VA 1P8GA 3W2WB 2E1MC 4IEIA 2YWKA 3SSRA 5EWFA 2MQQA 1VQLN 4M3ZA 2E5JA 4LH5A 3L7OA 4EO6A 1KRPA 1U0HA 3NGUA 1WEZA 4WFAL 1FI4A 4I1TA 5KFHA 1QSYA 3KD5E 3MCMA 3KKRA 4BR7A 4OO1J 4JI1J 1ZAWA 5F8GA 4CLZA 3W63A 1DQ8A 3WEEB 2DRDA 4QYZJ 2CFXA 4DCHA 2WSFC 3PKYA 4CJQA 4DR4K 3MAAA 2Q79A 3NS7B 5F0WA 2RRBA 2VJVA 3PDNA 4LFAK 2YBVA 4HYKA 3H3NO 4CLTA 2XSJB 3P31A 4A2AA 2V51B 5IM0B 1W2BR 1RCOB 1UVIA 3D6MB 1JXVA 2QMUB 3CM5A 1NGEA 1OH7A 4ZITA 3CD0A 5A8RB 2OGUA 3ULHA 5I3UA 3IA0A 2V9WA 3LF0A 2CGJA 4PXEA 4CO5A 3A2FA 4DKWA 2ZD1B 1LWEB 2PYJA 4YB5A 1SUQA 3D9BA 2WOMB 4JNEA 4ZVUB 5H9EJ 1S12A 1ZBIA 4DQ8A 4XDCA 4YDDB 2KO1A 2NS1B 2UXDJ 4CGGA 1F3VA 4DR7J 4OYBA 4EBEA 1OMSA 2IGIA 2ZZNA 1AA1B 1ATRA 1Z25A 1PBAA 4A8KA 1PO6A 2FYXA 3IC1A 4C1NK 3C8YA 2FVPA 4DTOA 2ACMA 4LF6K 5G0RA 5HVGA 1WHVA 3AVKA 4WE1A 3GE9A 4KHPF 2P9SB 4QWAA 2BQRA 4E3SA 1JLBA 1NBWA 4NCBA 3AQOA 3KOAA 3J80Y 2D74B 2P9IB 2Z1JA 3OS0A 4QS9A 2LU2A 3DLEB 1Q81T 3IXQA 1R8PA 2NZTA 3O9UA 1ATNA 2CG4A 1RWOB 2L3MA 3B8HA 2C3PA 3TZYA 3GG4A 3MOJB 2VBWA 2XG8A 4KH1B 3WZ0A 5KFOA 2MQOA 1DTQA 4DV2J 3RYLA 5JVGQ 5HP1A 5M2RA 2W1BA 1HR0K 4IYQA 2OEMA 1BWFO 1X4GA 1HYSB 3G0ZA 1L5UA 1HPMA 1RLCL 2O4IA 4OYXA 3TEHB 3G2XA 3FVYA 4IO8A 1SKRA 2FY8A 2D3O1 3QAUA 4LQ9A 1MU2A 2B5JB 3U7JA 4PQAA 1IUJA 1RHKB 3SUPA 1Q86O 1OPIA 4P2SA 2OEKA 3DKDA 4LF6F 1U4BA 3CJBA 4L72B 3NG8A 2M9KA 4I2PA 4ZLJA 3G82A 1UFLA 4ZCIA 4I9LA 4FVMA 2Z1HA 4JI3F 4F4KA 1BISA 1YVUA 3DYAA 4LFAJ 2ZWHA 4PL7A 2QLWA 4Y2CA 3OVSA 1HW9A 4I7FB 1K73T 1FKOA 1GMUA 2ZJPL 3IAYA 4ZTFA 1GLDG 3CPEA 1KC8O 4O3NA 3O5TB 3I8BA 3M5RA 5D78A 5C12A 4E7JA 3BSAA 1A5VA 2HBJA 3VGVA 3AAPA 3OTOF 4DLGA 1UAXA 3IGVA 1E6VA 1VQ8N 3PSFA 4AQYF 3KWGA 1M90O 2AJFE 2BVZA 2CPFA 4KTQA 4F4AA 1G99A 5ETTA 1FJEB 3CJKA 4XH1A 3NBPA 1ZA2B 1S0OA 1UZDA 4KHWA 4M3RA 1FXDA 3CJTA 4JKBA 4ECXA 3TI0A 4CTAB 1FNMA 3A4TA 1ILYA 3THYB 2VG7A 1T05A 2VKRA 2NQPA 4AHRA 1PYTA 2HK2A 3QT6A 4CIGA 5I42A 3DXBA 1RTHA 2JRSA 2L08A 2X6SA 4O8KA 1ZBHA 5LMUK 4KV8A 4BR9A 4Q7AA 3BZKA 1TKXA 3O1LA 3PEHA 1IJJA 1Y4ZB 4DQQA 3F73A 1KVIA 2OPSA 1ZYQA 4B02A 3GG0A 2XHWA 1FDDA 3NL0A 4OGEA 2C2NA 3CMQA 3PJ9A 4CZHA 4JI8J 5D0RA 4B3SJ 3MCNA 4FPRA 2HHTA 5IWAJ 3SCXA 3ID6A 2BACA 2KJVA 2KFNA 3Q24A 4NZ7A 4F02A 2O8FA 1WJ9A 4BR0A 2W9AA 1TR0A 2DR8A 2QTDA 4LSLA 4WKRA 4DG1A 4JYAJ 1SB6A 4KKOA 1U0HB 4U96A 4RR5A 1L3SA 2HGNA 3EZOA 4N76A 2JOQA 3OFGA 5GAGP 4IR1A 2JC1A 5FPMA 1PGZA 2Y0SD 3VOVA 2HNZA 4TY8A 4DV4K 1S49A 2JVRA 1X0PA 2YKQA 4JUZA 1VRUB 1VSDA 2FUG9 3O4NA 4FZYA 4WU2A 5U47A 3PO5A 4JI3J 1KTVA 3RRKA 1I94F 3W8PA 2BZ2A 2VC0A 1QE1B 4RCHA 2QE5A 2V4JB 4Y3CA 3GOIA 4Q8FA 3L0QA 5FPDA 1S1WA 3MM6B 4M5NA 1UPMB 4BRQA 3FFKB 4K43A 4KGKA 4N56A 2YHYA 3NHGA 4BE2A 4YUDA 1BHLA 2BW2A 3MMAB 1VSIA 4C1NI 1WC5A 2YNGA 3TANA 2D5RA 1W2BM 2E5LK 1IBMF 3D2WA 3KYLA 4GO7X 3M7VA 2IDLA 2EBEA 4CVNE 3T1HF 2OI2A 4DV1J 4NA1A 2BOAA 3AO2A 4UUXA 7FD1A 3NAHA 1D0EA 3CDWA 4E0DA 3SI8A 4NE9C 5EUHA 2FJDB 2XM3A 4J9UE 3AODA 3HX9A 2NLXA 1HWUA 4X62K 2PEHA 3BKUA 4JS4A 2EVZA 1VLYA 4B08A 3CC2N 1CS4A 4H4MA 5FRMA 4LF1A 2CADA 1BHNA 3MD3A 2ZF5O 1CVJA 1NK5A 2OYQA 4DSEA 2FBYA 1YJRA 1MMNA 2JEIA 2VJUA 1REGX 4FWMA 3FSYA 2JLGA 2R42A 4ZN3A 4CJRA 3NAEA 2XB2D 1R8HA 5J2QB 2ERRA 4B1YB 1S76D 2CPZA 4FF3A 1CLQA 1SJ1A 3VGLA 3TNVA 2DHGA 3WBZA 1KD1T 1CJTB 4WFYA 2IVMA 4DR7F 4EHTA 2X51A 5AQQA 1YX2A 3J7YI 2AHOB 4JKHA 1BQMA 4BC3A 5KI6A 4ICLB 1NK4A 3PFEA 1JLCA 4KY3A 3MWTA 2YTCA 3BUZB 2J9DE 4TNOA 3C95A 4DOZA 1DURA 2W4DA 2M8DB 3J7Z5 3C3LA 1UOCA 2A3JA 4KGXB 4PA1A 1IN0A 2D0OA 3HHLC 5KFPA 3LGMA 1A5XA 2IM3A 3EVWA 2W2MP 3LL3A 2PBDA 3L2RA 3K9JA 3KLEA 5DDOC 4WQ5A 1F60B 1VQ7N 3V5RA 3C65A 2ZC3A 5EOYA 4QW9A 1RK8A 4YS2A 3G96A 3THYA 1MROA 2CUYA 5LMNJ 1HWIA 2NRTA 4WXOA 4OI6A 2X1AA 1NBEB 3GE1A 4OX9K 3OS2A 3ULDA 3CEDA 2KQ2A 2FPHX 4ZLLA 2RQCA 3VQCA 5G4DA 3CCTA 4K0KK 1ZOTA 2E2NA 2WFBA 3UWTA 4CESA 4YOTA 1S1XB 2CPDA 2C2RA 3RB6A 3CJ2A 2NYHA 2V5HG