2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
1UWBB 1RT7A 1U04A 3F9KA 2XY5A 4J9OA 3JSMB 4DTOA 2HNDB 5CYMB 1N5YA 1L3VA 3V9ZA 3GILA 2DY4A 2JEJA 3ISND 4CEDA 4Z4HA 1HQUA 4HHTA 2FJXA 4NZ0A 1S10A 3UQSA 1HNVA 3CJ4A 5EWFA 4DQSA 4RNNA 4NLTA 4TSXA 1BGXT 4R5PA 1TKDA 3KIOA 3PVXA 4LQ3A 1ZTTA 4CHZA 3LAMA 4CGFA 4KB7A 2O5DA 3CG7A 2FLPA 3KKSA 4I9QA 1BIZA 4LSLA 4FS2A 1ZBIA 1A5VA 5KG6A 1EX4A 3QO9A 4DG1A 3QO9B 2AQ4A 3KHGA 2P5GA 3I0RA 4B8AB 3E01A 3CJ3A 4DSIA 3OYKA 4FBUA 3AO1A 4B3OB 1HYSB 2BANA 1HNVB 4WXOA 4ELTA 1RBTA 4K4TA 1JLCB 3LP0B 3MEDA 5HROA 4ZVHA 5KFQA 1CXUA 1D9FA 4CJRA 1YTAA 3U6FA 1BL3A 2B5JA 1LW0B 3C6TA 1LWEB 1W25A 3T5JA 3FQKA 4RW4A 4CIGA 1NK7A 3QLHA 3AO3A 4FJIA 4G1QA 4G1QB 1S1WA 4DTJA 4PUOB 1Q9YA 3RMDA 2BQ3A 2JEIA 3NGIA 4F4ZA 4C8MA 4M41A 3PUFA 3GIIA 1IKVB 4C8KA 3DLGA 1DLOA 1VSIA 1JLQA 3SYZA 2G8WA 5C5JA 2FVSA 4Y2AA 3MXIA 3K5LA 3UDLA 3SUPA 3IS9A 1TKTA 4CHPA 2IM2A 1C1AA 3SQ1A 4NRTA 3FDSA 2KQ2A 2A1SA 3VA3A 3QGHA 1JLBA 3QGIA 4CCHA 2F96A 1S1WB 4OLBA 1YT3A 2AX1A 3THVA 2G8HA 4OLAA 1TKTB 2G8VA 4HCBA 5C25A 2J6TA 5DG9A 1KLNA 1IKWB 1DTQB 1IKYB 1TVRB 5L1IA 3BQ2A 4CF9A 2V4QA 3M9OB 4E3SA 2OPQA 3PX4A 3CVKA 4RU9A 5KT2A 4OJRA 4M45A 1SH0A 4PQUB 4WXWA 4NLRA 3JSMA 2V0NA 4DG1B 3HXMA 3NGDA 4KO0B 1TV6A 5C25B 4CFBA 4M3UA 1DTTA 3LP2B 4M3XA 2VWKA 5EDWA 5EWEA 5C42A 3N6NA 4KHMA 3KD1E 1J9AA 2KW4A 4CJLA 1LWCA 3M8PA 4NCAA 4O44A 2OPRA 4YMEA 3F73A 1LW2A 1C1BB 4Q0BB 4YFUA 3PJXA 2AJQA 3PW5A 3OYMA 4DEZA 3H5XA 1IO2A 2W9BB 3N6LA 5F8NA 4BDYA 4F3TA 1SV5B 2FC0A 3WNGA 2HNDA 5CYMA 1N5YB 4IR9A 2QXFA 3VQDA 1N6QB 1SKWA 4IRCA 3ULDA 4EYHB 5HRRA 1N48A 1RDRA 4GVMA 1HMVA 3L2VA 1HPZA 5KFPA 3SQ2A 4M95A 3PV8A 4CJVA 4HUFA 1A5XA 3V6DA 1MU2B 2XCAA 2W9CA 4E7HA 2FBYA 5KFEA 4B08A 4RW7B 3JYTA 3OYBA 2J6SA 2UVVA 3CFRA 3QERA 4DSJA 4KB1A 3SI8A 4FJKA 3RRGA 4YP3A 4KKOB 2WK4A 1JXEA 4EBEA 1NHVA 1QQCA 4CEOA 1BQNB 4IG0B 1VSMA 1RNHA 3HT3A 5CYQB 1Q8IA 1B9DA 3U3GA 2FJVA 1IM4A 4FM0A 4QWDA 2UVWA 4O3QA 4H4MB 4CK1A 2OPSB 4DF8A 4MH8A 2CKWA 4KI6A 1MMLA 1HRHA 5F8LA 2JLEA 2XY6A 3T5KA 3HSTB 1TK0A 2HHXA 2IBKA 4I7FA 5T7BA 3KLGB 3OL9A 2XGQA 5HBMB 2V9WA 3V1QA 3DLEB 4PWDB 4IG0A 2XGPA 5C24A 4FZZA 4PQUA 4FS1A 4DTXA 2F8TA 1BCOA 3OYNA 4FJMA 4O3PA 4CJWA 3AVKA 3HL8A 4KAZA 4ZHRA 3NE6A 4CESA 2IC3B 2FBXA 5I3UA 3PY8A 3VQQA 1KVBA 2P51A 1EETB 1DTQA 5DG7A 1HNIA 1XC9A 2VG5B 2YNFA 1K1SA 1S9GA 1QTMA 4PUOA 4BE0A 2YKNB 1TP7A 3TAQA 3DOKB 2I5JA 5KFIA 3DRRB 4CHQA 2XY7A 2ILZA 4W5NA 1FKPA 4NRUA 4EZ6A 2BRLA 4PY5A 4FLWA 1TAQA 4ECQA 3DRSB 5KFYA 5E41A 1K6YA 3AVHA 1WSJA 1D8YA 1NKCA 3I0SB 3AVIA 2W9AA 5F9NA 2E6LA 4JRPA 5FDLB 2LSNA 3G6XA 1HMVB 3PR5B 3L2QA 4NLVA 4CHOA 4F2RA 1SH3A 3ZSRA 3TARA 2F8EX 4Q0BA 2B43A 3FFIA 3H59A 5CZ1A 3AVBA 1BQNA 4CIFA 1RILA 4CJ5A 2JGUA 4B9LA 4F4YA 2FVPA 1NJWA 1U48A 4DFMA 4ECXA 1YVFA 4C8NA 3OYFA 4MQ3A 4IH7A 3D5MA 2RPIA 1TL1B 3O3HA 4DLEA 2G8KA 1KSPA 4O0JA 1S1XA 3IGNA 5EWGA 2KZMA 5HRSA 1JLCA 1XWLA 4DSEA 4QOZB 1RCHA 3IAYA 1NKBA 1S9FA 1SKSA 2RKIA 3IRXA 1QSYA 1QHTA 4CJ3A 2ATQA 4IRKA 5K14A 1IH7A 4F4KA 3KHRA 1JIHA 4M3TA 4QCLA 1RTJA 2GIRA 4FLYA 3RMBA 3MFIA 4I7FB 3FRZA 3MEEB 4TYAA 4H4MA 5KT4A 5F8IA 4QWCA 4Q8FA 1S6QA 3V4IB 2E9RX 4DL4A 4FJJA 4Z4EA 3QIOA 1UA1A 1S97A 3H5UA 1C0TA 3ZSWA 3DLBA 4MFBA 4ZP6A 1RTJB 4DFJA 2HNZA 1R0AB 3LP3A 2ZE2A 4F8RA 4W5OA 4H54A 4E1NA 1LWFB 5J2MA 2X6SA 5FRNA 2G8FA 1JL1A 1WN7A 4NLGA 5F8HA 1NKEA 2AGOA 1S0NA 2UUTA 4K4XA 4TLRA 5DG8A 3OLAA 3AA5X 4CEEA 2HVIA 4OL8A 3EPIA 5CZ2A 4WZMA 3VN5A 1UWBA 4DSKA 1TKZA 2IM3A 2UUWA 5KRTA 4RW9A 1S9EB 3ZSYA 2OH2A 1TL3A 2IGIA 3KHHA 4M94A 4DQQA 2Z1JA 3CM6A 2DFFA 3QIPB 1HNIB 4IFVA 2ASLA 3ASMA 3KLIB 3RB0A 4KHQA 3P5JA 3BGRA 1U09A 1RTDA 1TL3B 4MIAA 2DFEA 4CGHA 1KFSA 4C8OA 2W9BA 4KHNA 4FLXA 1HYZA 1TKZB 4O4GA 1JLFB 3S9HA 1NK9A 3OYAA 2RDJA 5DLGA 1C1BA 3QNOA 4B3OA 4QW8A 4JLHA 1C0UA 1WNSA 4DSFA 3SJJA 3VQEA 4O4RA 3QEWA 5C42B 3NKYA 3D0PA 4H8KA 3NF9A 3AVJA 4KV8B 1CSJA 3EYZA 4F2SA 3HO1A 3QZ7A 4ED1A 3MFHA 1Z25A 4HUEA 1LW0A 1ZYQA 5HRNA 1RT7B 5SZTA 1RAJA 1JLGA 3GIJA 4DL7A 4CFCA 1U47A 1Z26A 4FJ9A 4RNFA 1VRTB 2JEGA 3CDEA 1RTIB 4ZPDA 1RTIA 2VWJA 3PO5A 2FJWA 2IAJB 4XO0A 4RW6A 1CXQA 3PZPA 1S1XB 4Y2CA 2AX0A 1RTHB 5K14B 1HQEB 3DYAB 1RT6A 4CJQA 4G3IA 4ZPCA 1J5OB 4ZPAA 4J9SA 4Q45A 1KHWA 3V9SA 1VSDA 2ATLA 3H4BA 4MK7A 4CJUA 1FKOB 3VQBA 1ITGA 3SCXA 1BCMA 3IS9B 4NLQA 3IN5A 2ZD1A 1RDBA 2GBZA 2B4JA 3ZT1A 3TAEA 4WE1A 5L9XA 4FLVA 1NHUA 4K50A 5F9LA 3V81A 4IBNA 4XIUA 4IRDA 4N76A 4KSEB 4YR0A 3FQLA 4F3OA 1QSLA 5KFJA 2VG6B 3WNHA 2OPPA 3AV9A 3NAIA 3BSOA 5J1EB 2D7SA 4KFBA 2OZMA 4TQRA 2W7OA 3ISNC 3IGVA 2YNHB 1C2PA 3M8SA 2IDOA 4URSA 3BQ1A 1S9GB 1W9HA 4IR1A 4WYLA 4ECRA 3LP1B 5I42B 2C2RA 3D45A 4FM1A 5KFKA 2RKIB 4KTZA 4CF1A 2XO7A 4RW9B 1JLGB 3DOLB 1J53A 4LD0A 2VG5A 3HP9A 4DS5A 1BISA 3AVGA 5FRMA 1FK9A 3PX6A 4NLOA 4ECUA 1BI4A 1I39A 4AHUA 5DQHA 4Q44A 2I1RA 3DLEA 4PWDA 3VQ4A 4ED8A 1LWCB 4DU1A 2ASJA 4AHTA 3SZ2A 4EBCA 4M3YA 4NLUA 1RT4B 3DLKB 2HNYA 4FJNA 3NBPB 4XPEA 5KFCA 1C0UB 3FFIB 4LSLB 2IJNA 2BDPA 3ALYA 4QWAA 4WFYA 3KLIA 2OZSA 1U45A 1S4FA 1WAJA 3MAQA 4AHCA 4EP5A 2BQRA 3BGRB 1KRPA 3CYMA 1RTDB 4M3ZA 2R8GA 4O5BA 1EKEA 3VQAA 1DLOB 2HWIA 4JV1A 3RB3A 3OLBA 4TYBA 1IKYA 3DLHA 2HHQA 4MKAA 4ED0A 4CEFA 1U4BA 3QIDA 3BSNA 4ECZA 3SFGA 2OPPB 4CJEA 1RT5A 4KKOA 3Q8PB 1ASWA 4DSLA 2NUBA 3LANA 5D3GB 4Y1DA 2XI2A 4MKBA 3OYJA 2ASDA 3BJYA 1U49A 3CJ5A 3KK3B 4J2EA 3NAHA 1WSFA 1Z4UA 4O3SA 4CIEA 3RB6A 3HM9A 2RF2A 2D3ZA 1S6PB 4ZVGA 1CZBA 2ALZA 3I5BA 4H4OB 3KK2B 1GX5A 1ZBLA 1QUVA 2WHOA 4URQU 2X78A 2XI3A 2HWHA 1D5AA 3ZSVA 3DRPA 3IG1A 2QKKA 4WE1B 1C1CB 4AHVA 3OYEA 3QZ8A 3V1OA 2YNIA 4N56A 4O0IA 4N47A 1S1UA 1T7PA 4IH6A 3E51A 4DF4A 4K4YA 1TK8A 2HHUA 4RUAA 2YKNA 4Q5VA 2JC1A 1C0TB 1RT4A 3DLKA 5KFLA 4KO0A 3OSNA 3OY9A 4FYDA 3LP2A 1NK6A 1JX4A 4CFAA 1QAIA 3TI0A 2PYJA 2WTFA 4NLSA 5KFBA 4AHSA 4JS5A 2YNFB 2DTUA 2D0AA 4OKKA 5KFHA 1RT1A 3SUQA 4DU3A 2OPQB 1OS5A 4E7LA 4J2AA 2JEFA 1KVCA 3AA4A 4KHYA 5KFMA 1RA6A 1JLAB 2R2TA 1RBUA 3VQ5A 3L2RA 2Y1JA 1VRUA 3CJ2A 4B9UA 1SL1A 4B9TA 3N6MA 3QEIA 1JLEB 4ED2A 2DPIA 4FJHA 3OYCA 4TY8A 3QEVA 4E0DA 3RB4A 4CERA 3KMSA 4CF0A 1SUQA 2G8IA 5J2NB 3ZSQA 4C8LA 3OVNA 4E1MA 4TQSA 2YKMB 2R8KA 1VK0A 4OVLA 1JLBB 4FLUA 3PW4A 1WSIA 4BWMA 5HP1B 3H2LA 4IKFA 4CJTA 2D3UA 1KFDA 3V1RA 4FW1A 2XRIA 5HLFB 3ZT0A 3OYIA 2FLLA 1REVB 4LSNB 1RT3A 1RBRA 3TAMA 4YR2A 3KLEA 4B9MA 1IG9A 3MECA 1VSEA 3QIPA 4RG8A 3G6VA 3V6JA 3OHAA 4Q8EA 1JKHB 3QGGA 2VG7A 1JKHA 2EHGA 4RW8B 3LPTA 2Z1HA 4N5SA 4CJKA 2A1RA 3ZT4A 3H4DA 4F4WA 1IKVA 4RW4B 1C0MA 2UVUA 4NCBA 1G15A 4LH4A 3DM2A 4CK3A 4ZMMA 1RA7A 1HQEA 4FJXA 3RR7A 3OL8A 3DRRA 4BE1A 3V9UA 3QNNA 4W5TA 1UAXA 4HYKA 3SI6A 4EZ9A 2R8JA 1NK4A 1LWEA 4J9PA 4ICLB 3KLFA 4ED3A 3QLHB 4IG3A 4J9RA 3O3GA 5KGXA 3LP0A 3O3FA 4ECSA 4GW6A 3G10A 1LAVA 2C22A 3PJWA 3KLGA 4DQIA 4AH9A 3VQ6A 3KNAA 3CQ8A 3NF8A 3NGZA 1S48A 2FVCA 4O3RA 1S6QB 1R0AA 5DGAA 3NH1A 4JRQA 4NYFA 5KFWA 4O55A 4NYZA 3V6KA 1WSGA 4I2QB 3HVTB 4DTPA 2ETJA 5KG2A 1TL1A 5KG0A 5T14A 1XR7A 3TWHA 3VQPA 4BDZA 3OL7A 3GYNA 3AO2A 2OPSA 4RNHA 3K5NA 3NAEA 4FVMA 4ED7A 3LPUA 1T03B 5JXSA 1NK8A 1GOAA 3OS1A 1C1CA 4LSNA 3GV5B 4CF2A 2HAIA 4U7CA 4Y1CA 3QETA 3RBEA 3L3UA 4BACA 4JV2A 3HKWA 1ZETA 3P1GA 2E4LA 4I9LA 5J1EA 4NLPA 1UOCA 4KREA 1Y97A 3OL6A 4IFVB 1ZBUA 3MTKA 5KTQA 1BHLA 4QWEA 3MR3A 3AVCA 1NK0A 4Z4IA 1IKWA 2QV6A 3TABA 4YQWA 2IM0A 1SL0A 3NGYA 2VG7B 1F21A 4OGEA 1O1WA 1SKRA 1T05B 3I5AA 2VG6A 3P83D 4K4WA 3TAMB 3VQSA 4CEZA 3UIQA 2R2RA 4TN2A 1HYSA 2ZE2B 2XC9A 2EC0A 3DMJB 3I0SA 3SV4A 1A5WA 2AGPA 1KCFA 3MR2A 4ZTJA 5J2PA 4CFDA 3M8PB 4DFKA 4Z4GA 3KLVA 3HPGA 3AA3A 3MR6A 4CJSA 3ICLA 1REVA 1N56A 4DL2A 5KG4A 1JXLA 4KHWA 1DTTB 5KFOA 3DRSA 1JLQB 3D28A 4DL6A 2C2EA 3DYAA 2X74A 4E19A 3G6YA 1NJZA 1WLJA 3PW7A 3T1AA 3AA2A 1L5UA 4TY8B 4FW2A 1SUQB 4R8UA 1J5OA 4O44B 1TV6B 3OJUA 4HCCA 5DQGA 1Q9XA 2FVQA 1S1VB 4FCYA 3I5CA 5KG1A 4DL5A 2YKMA 1UA0A 3IRXB 3KLHA 2XY8A 5J2QB 2AU0A 5J2QA 4CJ4A 1L3SA 1RT1B 4R0EA 4J9KA 3LAKA 3EZUA 4Z4CA 4CGIA 4QW9A 2IOCA 3BSAA 4EBDA 3LZJA 1JLAA 1HJRA 4IDKB 1LV5A 3CFPA 1S1VA 5KG7A 1GOCA 3GV8B 3ZSXA 3CM5A 3SV3A 4R8UB 4ECTA 1NOYA 2OYQA 3HP6A 5KFFA 3LWLA 4GC7A 3OS2A 2BR0A 1QSSA 2YNIB 1QE1A 4J9QA 3VA0A 2HMIB 3HPHA 3KHLA 3WNEA 4RZRA 4CGJA 4I2PA 3KTQA 1S49A 4Y34A 5DK5A 3T3FA 3KD5E 4K8ZA 2HW3A 5L1JA 1W0HA 2RF2B 2ILYA 4CK2A 2Z1GA 4FBTA 4MIBA 3DMJA 4J2BA 3WNFA 4F50A 4FJ7A 5F8MA 3HPOA 4IG3B 2Y1IA 1L3TA 2F8SA 1RDCA 4FLZA 1T03A 3A2FA 3OYGA 5I42A 2CJQA 1WSHA 4CGDA 3NH2A 3QESA 4CHNA 3K2PA 2GUIA 4CF8A 2O4IA 4NCGB 3PO4A 3GV7B 1BIUA 2I5JB 3UPFA 1RT6B 4ZTFA 4K8XA 1XR5A 3AO5A 1S5JA 3KKRA 2Z1IA 4ID5A 2B5JB 4J9NA 4QWBA 1RYSA 1NJXA 1VSHA 4DTRA 1VRUB 3BREA 4ELUA 2QK9A 3DLRA 3KMQA 3OS0A 3L2UA 4NLYA 3OSPA 3O4NA 3LZIA 2D5RA 3PR4A 4KTQA 3C6UA 5DMRA 2XWYA 2RDIA 2BRKA 5C24B 3NDKA 3AVAA 5KFSA 1LWFA 4RNMA 3MXJA 2IMWP 1SL2A 3NL0A 3ZT3A 1IKXA 3E01B 2WONA 3SQ4A 2FVRA 4W5QA 3M9NB 4I2QA 2G8UA 2OPRB 4DLGA 1S0OA 5L1LA 4J9LA 3BR9A 4IQXA 1RBSA 3SPZA 1GOBA 3C6UB 1RTHA 4CEQA 4R5PB 4NLDA 1T94A 1B92A 5KGWA 2D0CA 4O3NA 3NF6A 5FROA 4RW8A 4CEBA 3ZSZA 1T05A 4M3RA 3QEPA 3MEEA 2R8IA 2ZKUA 4X2BA 4H4OA 3KLFB 3KK2A 5D3GA 1JL2A 1C6VA 1KHVA 4O4GB 4ZP8A 1D1UA 3MXMA 1YTUA 3C94A 3CWJA 3ZT2A 4KRFA 1FK9B 5F8GA 1HPZB 3M8QA 2JC0A 1RBVA 4YNQA 3NH0A 3Q8RB 3V6DB 2W9CB 4E7JA 3JYTB 1HYVA 3DM2B 4NCGA 2J6UA 4TY9A 4W5RA 3OYLA 2V4RA 4HVJA 4QAGA 1TVRA 4KTWA 3ITHB 1RDDA 4KPYA 3PW2A 4DTUA 3TAGA 2HHSA 5KFAA 1MU2A 4RUCA 2IC3A 2QKBA 1YVUA 3MEGA 2FBVA 2C2DA 4BDPA 4GMJB 3TQ1A 1LAWA 2DFHA 4B9SA 4EO8A 2YNHA 3OYDA 4IOBA 1NK5A 3LWMA 3DLGB 3MEDB 5HROB 1TK5A 4KI4A 3PHEA 3QEXA 1LW2B 4E7KA 5KT3A 2ZQBA 4I2PB 4GC6A 2GV9A 3RWUA 1FKPB 4KHRA 4B9NA 4KHUA 3NBPA 3K5OA 5KFTA 3OJSA 1NJYA 2E9TA 1CZ9A 3S3NA 2HMIA 2GC8A 1JLEA 3H08A 4NYNA 3TAFA 5J2MB 3CO9A 3OHBA 2IS3A 3TAPA 1ZTWA 1XHXA 4U6PA 4DL3A 4ECWA 1QE1B 3GIMA 2FLNA 2IA6A 1K1QA 5KT6A 4HTUA 3DOLA 2B6AB 4NLWA 3VQ7A 4PA1A 3CJ0A 3B6OA 4BWJA 3CDUA 3L8BA 2E9ZA 4Z0UA 1S6PA 3EPGA 3SUNA 3V9WA 5CY4A 3RMAA 3KLHB 4QPXA 1XR6A 1TGOA 4Z4FA 4UQGA 4HKQA 3VQ9A 4KV8A 3EY1A 2EX3A 2BANB 2HNYB 3B6PA 4OKJA 4ZP7A 4ZVEA 3MECB 3SPYA 3KK1B 4DTSA 5EU7A 3K57A 1S9EA 3RR8A 1CLQA 3KJVA 1T3NA 1KLMB 4ID1A 1EXQA 2W8LA 3T5HA 2KFNA 2X6NA 5KFDA 5EUHA 1BI4B 5KFUA 5DLFA 5KRSA 1WSEA 4LQ9A 5J2PB 4EO6A 2XHBA 3Q8QB 3MF5A 3AVFA 4ED6A 5CYQA 3G0ZA 2R7YA 4FK0A 1RT2B 4IH5A 5HLFA 4Q43A 3CFOA 1RT5B 4MK8A 2P5OA 4OGCA 1EP4B 3Q8SB 1BQMB 3KK1A 1FKOA 3ITHA 1JXBA 4IFYA 4DWIA 3V4IA 4E89A 4DQRA 5L1KA 2PYLA 1VRTA 3DI6B 4K4SA 4FJLA 2XCPA 1FXXA 3M8QB 3K5MA 3C6TB 2RN2A 1N4LA 3H5SA 3NMAA 2YHBA 4FJ8A 1EETA 2HHVA 4RW7A 3RAQA 3AVLA 4FJGA 3CIZA 2AWZA 4URGA 2B6AA 4DU4A 4KAIA 5SWMA 4ZP9A 1HARA 4ZHRB 4K4VA 3HK2A 3KOAA 2P1JA 4OPKA 3AVNA 2VA2A 1S0MA 5I3UB 2HNZB 4IDKA 3RBDA 3SUOA 2VA3A 3H98A 3QYYA 1VSLA 3OYHA 3DDKA 1L3UA 3K58A 1ASUA 4B9VA 4JUZA 5KT7A 4MFBB 4ECVA 4FK4A 4FZYA 5JUMA 1T8EA 5JS2A 2WRMA 4DTNA 3TANA 5KG5A 5KT5A 2OA8A 1IKXB 4NLXA 3H40A 4HUGA 2KFZA 3BQ0A 4ECYA 3V6HA 3IG1B 1I6JA 4ZVFA 1NOZA 2ITGA 2BGGA 3BDPA 2HHTA 4Y3CA 3PW0A 3RRHA 4CECA 2WB4A 2W7PA 4DS4A 1RYRA 4KBIA 3ZSOA 4KE5A 5DGBA 3LP1A 3BSCA 4LY7A 4F4XA 4LH5A 4RNOA 2WOMA 2R8HA 3UR0A 2HHWA 4ID5B 3HYFA 3HVAA 3L3VA 1S1TB 4KHSA 3DI6A 4FK2A 1X1PA 4M3WA 2KTQA 2WOMB 3VQ8A 5KFXA 4RW6B 4KB0A 1EP4A 2BQUA 2HVHA 3KLEB 2W8KA 4TXSA 4OKEA 5HP1A 3SNNA 1XHZA 4FXDA 2YNGB 1RDAA 3HJFA 5FDLA 2BE2B 1SH2A 3TR8A 3VQCA 4O3OA 3AO4A 3M8RA 1RT3B 3U3YA 4K4ZA 2W42A 3S3OA 3T19A 3H5YA 3KJVB 4K4UA 4CGGA 2D0BA 4CEAA 4AHRA 2WONB 2ZD1B 1VSFA 4CJPA 3DOKA 5J2NA 4CHYA 3GIKA 4WYWA 1TQLA 2IAJA 2YV0X 2O4GA 3G86A 1TKXA 1X9MA 5HRPA 5KFGA 1QAJA 4L8RB 3MR5A 5F8JA 1WNEA 3PX0A 4FLTA 4WFXA 2R2SA 4WFZA 1VSJA 1VSKA 4MK9A 1N6QA 1HQUB 4XPCA 3RTVA 2HB5A 5KG3A 1QS4A 1B9FA 4DQPA 1ASVA 3QINA 1ZBFA 3HHKA 1X9SA 4EP4A 4AILC 4EYIB 3NF7A 1XI1A 3L2WA 3SQ0A 2C28A 3NFAA 3SFUA 1WAFA 3HVRA 3CDWA 4BE2A 5KFNA 1J54A 3K59A 5HBMA 1TKXB 5KFZA 3HVTA 3GQCA 1I3AA 2D41A 3T5LA 1KVAA 5KI6A 2UVRA 1BQMA 3AVMA 3RMCA 4IFYB 2AGQA 2E6MA 4JS4A 5DQIA 2DPJA 3I0RB 4IKAA 4FZXC 3LDSA 2WCXA 4E7IA 3DRPB 3C95A 4ELVA 3O4QA 4FM2A 4KFBB 2PZSA 2FBTA 2GIQA 1KTQA 3M9MB 2IJFA 1S1UB 4DTMA 2QE5A 4DFPA 4OPJA 1D0EA 2Q3SA 3V9XA 5JS1A 3V81B 3NCIA 4ZPBA 1SV5A 1NNDA 3TVKA 4N41A 2KZZA 2YNGA 1JLFA 3KK3A 2BE2A 1KLMA 4CE9A 4WZQA 1S1TA 4EEYA 1ZBHA 5KFVA 3ZCMA 3I8DA 2IM1A 3MEGB 4B8CA 4FJ5A 4M42A 4ICLA 1GX6A 1X9WA 4JV0A 3RAXA 4J2DA 3S3MA 2PY5A 4YR3A 4CJFA 2R2UA 2YHAA 1RT2A 5KFRA 3FSIA 4DMNA 3HVWA 3EZ5A 4J9MA 1TAUA 3LALA 3NHGA 1D9DA
chains in the Genus database with same CATH superfamily
4M5MA 1U04A 4J9OA 5L46A 4BVPA 3JSMB 4OFZA 4DTOA 4EHTA 2M8DB 3CCVS 2QMXA 3WC0A 2JEJA 3CCMN 1O5JA 1IBMK 2YPYA 3W9IA 1Z2LA 4WPAA 5AZIB 2RNEA 1MA9B 4RNNA 4E2FB 3C7NA 4ZCLA 4LIWA 4R5PA 1FXLA 3LGNA 5IT4A 3PVXA 3U02A 2YQ0A 2J7UA 2Q31A 4CHZA 3CMEN 4TLQA 3CG7A 4H5TA 3CD5A 3OUYB 4EUVA 4YDDB 4LSLA 3CJBA 4MDAA 1W2BR 4WK1A 1A5VA 3QO9B 2P5GA 4OYMA 3HD2A 1FD2A 1BLUA 2J9DE 4DX6A 1HYSB 2BANA 4JOUA 4WXOA 2QA4G 4G1PA 5JLFA 2BJ9A 3D9BA 3OTCA 1MW7A 4NEZA 3LP0B 1DRZA 2PAVA 3MEDA 4ZVHA 3IWNC 5LJVA 5KFQA 2KHDA 2GHPA 1N0UA 3C6TA 4M1KA 4A8SA 2X1BA 4ANCA 3T5JA 3OBIA 2IVNA 4RW4A 3GJSB 4CIGA 1NK7A 4DKWA 5F0XA 1KAYA 4B3MJ 3CCQN 2YI1A 1NGEA 5I3PA 1S5ZA 2BOPA 2OEMA 3CC4S 3OA9A 2M8HA 3SCIE 1IKVB 2OSRA 3UFCX 4C8KA 3DLGA 3UE5A 2G8WA 5C5JA 4Y2AA 1B0PA 3UDLA 3K5LA 4A8XA 4CHPA 2F5GA 2IM2A 2ZH5A 3SQ1A 4NRTA 3VESA 4B1VA 1MMNA 2MQLA 2GWKA 1UFKA 4JKHA 2EC2A 3KUEA 1WB9A 3QGIA 2NXEA 1TKTB 3U9ZA 4GRSA 1MWQA 1E3MA 5AE2A 1UW9A 2DD8S 5HQ8A 1ZAXA 4CNZA 2A6MA 1DTQB 2KG1A 3OFFA 5L1IA 3BQ2A 4CF9A 4CBUA 2O8EB 3CVKA 1GQEA 4F67A 2G2YA 4OJRA 2P2CB 4BY9C 3CMES 3G96A 1SH0A 1JMTA 2VBYA 2HBJA 1S57A 3JSMA 1H6KX 1HW8A 4NXNK 5KQDA 4H5RA 2UU9J 1TV6A 1WKLA 2UXCK 5C25B 3LP2B 4ZVOB 1SVDA 3UCZP 3CC7N 5CA5A 2RHQB 5DDPC 2HFVA 5F3TA 3H90A 1KP6A 3X1LB 1G2EA 4FNIA 1LWCA 4A8KA 4NCAA 3D7SB 1RHMB 2KG0A 4Q0BB 1RWNB 2AJQA 3OYMA 2CJBA 1TU0B 2W9BB 5F8NA 1NJIT 3OVSA 3H2VE 2CXEA 5CYMA 4WK3A 2UUCK 1URNA 4ZVUB 5EVZA 3VQTA 1SKWA 4C6AA 5ETRA 2GZOA 5LOQA 4C11A 3ULDA 4EYHB 3EICA 4DR4K 4M5JA 3UWTA 1CULA 4BRLA 4GVMA 5J1PA 3B4DA 1FX2A 5U47A 4CJVA 4XAKA 4UOFA 2W9CA 4LC9B 4WCEQ 4E7HA 2FBYA 5KFEA 1ZH5A 1YJWN 3BO4A 2D3O1 3CFRA 3QERA 2D74B 1V9OA 4JI8J 5BRDA 4KB1A 4K0KK 3OFHA 4CZCA 3GONA 2F7VA 2A6OA 1KNZA 4TVAB 1JXEA 3ATVA 1NHVA 5D0GA 5HQMA 4CEOA 4IG0B 2DHGA 1GMVA 3R27A 1ZOTA 3DXKB 1RNHA 5CYQB 1R6VA 2FZKB 2ZM6F 4ED4A 3GCXP 1Q8IA 5HO4A 3I56N 3EE3A 1HQ2A 4FM0A 5BYSA 4YHHK 2JFDA 4CK1A 2QYCA 4KI6A 2HURA 4QS9A 2I6WA 5F8LA 1TK0A 2HHXA 3HSTB 8AT1B 4I7FA 3KLGB 2XGQA 2XO6A 2MHEA 2XGPA 5C24A 4L74A 3FGUA 2F8TA 2J9DA 4FWRA 4BCAA 3AVKA 3HL8A 3C6AA 3KWIA 4ZHRA 2DNNA 4XDCA 4CESA 3RRKA 5I3UA 1UEKA 5AQPA 4LBPA 2W4DA 1OSCA 1XC9A 2YNFA 1K1SA 2E66A 3QATA 1E6YB 5HMWA 4PKDB 5D0RA 4PUOA 3DOKB 5FD1A 2QWNA 3DRRB 4H5VA 4A8FA 3WXJA 2ILZA 3AJ1A 4KT0C 4NRUA 4EZ6A 1VQ8N 2MLXA 4ECQA 4FWSA 3OTEA 1RAFB 6FDRA 1K6YA 1NKCA 1CULB 5FDLB 3G6XA 2LSNA 5AQMA 4NLVA 4F2RA 2WC9A 4CLKA 3TARA 3ZSRA 4ZVPB 4DV7K 2LP4A 3BBFA 3AVBA 2OO4A 2BZ2A 4OYBA 4CJ5A 1Q81T 3MM6B 4CZKA 1ZBSA 2N82B 2CPYA 3QMQA 2FY1A 3OYFA 1YJRA 1X4CA 4GV6A 2RU3A 1IBLK 1TL1B 5EOYA 1KSPA 2G8KA 1IBKF 5IT9O 2KB2A 2GNKA 1K44A 4DN9A 4P7VA 3IGNA 3TYTA 3EO3A 4HEA9 3LDQA 1XWLA 2XZWA 3CCUN 4FN5A 3E2EA 2IFXA 1HLUA 1RCHA 4X84A 1S9FA 4DU7A 2LXFA 2RKIA 3IRXA 3I56S 3L4BC 1IH7A 4F4KA 3KHRA 1JIHA 4NZ6A 3MMBB 3QRPA 2LA4A 2B9EA 2VASA 4M3TA 3UCUP 1RTJA 2GIRA 4U8YA 3KZBA 3RMBA 2Z2YB 1TL7B 3FRZA 4TYAA 1RHRB 2QWLA 4FJJA 4Z4EA 4DUTA 1S97A 1C4AA 3H5UA 4DDFA 3TJ9A 2HF3A 4KPCA 4KGVB 3VGLA 4ILGB 4ZP6A 1RTJB 4DFJA 3RUBL 4W5OA 3HMJG 1Y5NB 1OH7A 2X6SA 5FRNA 3L4IA 4IOCQ 1DURA 1IR0A 1NKEA 2QYGA 2UYTA 3R7SB 1RSCA 3AA5X 1HKCA 1UEVA 4CEEA 4OL8A 2H54B 2MLYA 3FMWA 4WZMA 3VN5A 2UUWA 4KGMA 3THWA 3ZSYA 1TMMA 3I87A 2N4CA 1T95A 1GTHA 2EEYA 3HLUA 4OLOA 2R7SA 4CLZA 3TVZA 1UMJA 4B3MF 3NEKA 1BUPA 2ZF5O 3FCVA 2UUBK 3ASMA 3KLIB 3RB0A 3DGVA 5B08A 2G2OA 3VEXA 1FVSA 2P5VA 2K3KA 5IWAJ 4C8OA 2HHHK 2W9BA 4FLXA 1TUGB 2DNKA 2DTJA 1HYZA 3R5GA 1FRKA 1NAQA 3MGJA 4O4GA 1JLFB 3KVGA 3S9HA 2JLFA 1NK9A 3C19A 5DLGA 1HJOA 4QW8A 1C0UA 4QYRA 2K7KA 1DBDA 3CQXA 3OXGA 1ZM9A 3NKYA 3D0PA 5HVHA 3CJ7A 4HHHA 1DY3A 2F4FA 2Y0BB 1O51A 2W1BA 3MFHA 4Y65A 4HUEA 1YJNN 4JI4F 4LR9A 3IXQA 1RT7B 4FF1A 1U47A 4CFCA 3UE2A 1Z26A 5MAOA 4PR6A 5GAHP 3TPQA 4YORA 4RNFA 1VRTB 2JEGA 1LQ9A 2B8PA 4ZPDA 3WQUA 4NOHA 4XO0A 1K8AO 5LY3A 4RW6A 5IV4A 4OHYA 3WZ0A 1S1XB 1GLAG 3EDRB 4WF9Q 4NLBA 3UW1A 4OHWA 4DV6K 2AKWB 4PZVA 3CETA 5ETPA 1VQKS 3EKUA 4G3IA 3GBTA 4ZPCA 2AJ0A 3EKSA 3D1OA 2X51A 3OR1A 3WUHA 4LF1A 3V9SA 2KXNB 3P5TL 3VQBA 2O8BB 2QWQA 2CDQA 1VQOS 3DXKA 3LM2A 5ADXH 1U2CA 4JI1F 1RDBA 4QIFA 3ZT1A 3EE8A 2G4BA 3WIUA 2VODA 4GVBA 2W25A 3V81A 4XIUA 3DGPB 3D0HE 4F0MA 4IRDA 2DHHA 3DFEA 3VAGA 1RP5A 4U7BA 2QL5B 3JSRA 5KFJA 1VJWA 3WNHA 2W7OA 4F25A 2OKQA 1FFSB 3D68A 1EB0A 4JI0J 1GH8A 3VV2B 4HH0A 4IR1A 1XNRJ 4DV0K 4X64J 1YRTA 5I42B 1HNXK 2VUGA 2C2RA 3D45A 2OIHA 2O8FB 3A3NB 5KFKA 3MWBA 2Z2ZA 3IC1A 4KTZA 4CF1A 1WHWA 3C14A 3E9LA 2F40A 3ENQA 4RW9B 5AXKA 4P72A 1GXLA 3DOLB 3MMVA 4ILMA 2JWKA 2PBDA 2VQFJ 3BN7A 3DRXA 4DS5A 2BACA 4B1YB 1XTZA 3PX6A 1J5EJ 3TZYA 2RAQA 4Q44A 3MXHP 4ED8A 1QD1A 1LWCB 2DHXA 5CZVA 2UZAA 3KJQB 3SZ2A 4EBCA 3MX5A 1K0VA 5BYRA 4NLUA 2M70A 1MLAA 1QAYA 4H5WA 1C0UB 1KQSM 2IJNA 3BBBA 4P74A 3ALYA 2OZSA 4A8OA 1S4FA 3GDQA 3D67A 1SZ2A 3I4PA 2BQRA 3BGRB 1RTDB 1R8HA 4FYVB 2R8GA 3ZZZA 1WDDA 4AF1A 3R2CJ 4A47A 4UZBA 5LXYA 4ZKAA 3RB3A 2LCWA 3OLBA 4TYBA 1IKYA 3R1LA 1FW6A 1SBRA 3QIDA 3NLCA 2J76E 5FJ4A 1X5PA 2E1MC 4DSLA 5KPZA 2HQ3A 4Y1DA 1F2HA 2OTJN 3BJYA 1RDWX 3CJ5A 4J5OA 1KQFB 4J2EA 2DITA 2MY8A 1RE1B 1G99A 4ZVGA 3FC9A 2ALZA 3I5BA 4H4OB 1N8RT 4J7CA 2XI3A 2VQEJ 1CJKB 3A5NC 3HSCA 1D5AA 2VBWA 3ZSVA 4FOIA 4X62F 3THPA 1XK8A 2ZBQA 4JHDB 1FJCA 3OYEA 4IH6A 1CQNA 3NGRA 2MMYA 4RUAA 4IOCL 4Q5VA 2FC9A 5H9EK 4KO0A 2R7WA 2A3ZA 4FYDA 3LP2A 3NGUA 2VICA 1JX4A 4CFAA 4EWTA 3NY0A 4YB5A 2WTFA 5KFBA 4M5DB 2W41A 5E3RA 3P6YC 3UKUA 1RCXB 2DRDA 2V4JA 3AAWB 1OS5A 2LFVA 3VTIA 4FXWA 1SQFA 3D2EA 1JLAB 2R2TA 1UTAA 5M1OA 5E0OA 3BO2A 3CPWR 3ET6A 2DXDA 1X0PA 2B9WA 3QEIA 2V8HA 3RB4A 3KMSA 3I96A 5A2QO 5DM7L 5J2NB 1V4SA 1HR0K 4C8LA 5F2RA 5JICA 2AV5A 2VCPA 2RDDA 4FLUA 2N7CA 4BWMA 3BZQA 3IKMA 4IOAQ 1VISA 2VZ9A 2QL9B 2J0XA 2D3UA 4ZJOA 4K59A 2XRIA 3ZT0A 3OYIA 4LSNB 1RT3A 3ETOA 1RBRA 3KLEA 4HL9A 4P2SA 4WP9A 3V6JA 2Z2MA 1X0FA 3LPTA 2Z1HA 2HBZB 2VF3A 3EVWA 2DYAA 4EHUA 1NLKL 1RQ0A 2BBEA 4DR3F 5L39A 2I2YA 4BE1A 4W5TA 3DKDA 2LMIA 2KLAA 2CRLA 4LF5F 1APSA 2R8JA 4A57A 1LK5A 1WEXA 1LWEA 1H72C 1MN7A 2W4CA 2QEXS 1R8AA 2CPZA 1N36K 4IG3A 1V3ZA 4J9RA 4OJHA 5JLHA 4P75A 4K7QA 3PJWA 2CNKB 2KVQE 1NGHA 3CQ8A 1BDGA 3NF8A 1VQ4N 2XHCA 2Y1RI 1GTEA 3SDEA 1R43A 3MMAB 2O67A 3NH1A 4B3TJ 4JV5J 4NYFA 3V6KA 1RKIA 5ETSA 4CI0B 1WC5A 2ZWPA 3EMTA 5KG2A 1Q8LA 2H51B 4IYQA 3OL7A 4BDZA 1NMDA 6FD1A 3AO2A 4LFCK 4M5KA 2MZRA 4ED7A 2P9IB 4ZA1A 3LPUA 5JXSA 1FJEB 4FSVA 2I9SA 4HDGA 3M8YA 3FNNA 2YQ3A 3VAHA 5IM0A 2E20A 4NZ7A 2HAIA 1KKHA 2RU9A 4DV4F 1EO1A 5B0DA 5J1EA 5JVGQ 4OJ3A 3CMAN 1Y97A 3OL6A 4A8QA 2J9EA 3MTKA 3MR3A 1IKWA 4QR2A 2DHSA 2DPNA 3GMGA 2P9PA 3EWGA 4PRFA 3I5AA 3W9JA 2VG6A 2O01C 2F9TA 2NZ4A 2V2ZA 3VQSA 3UIQA 3QAUA 3T1HJ 1HYSA 2XC9A 3GE1A 1UP1A 2ZKTA 1RWMB 3MR2A 2ADBA 3M8PB 2ZC3A 5LSLA 5CE3A 4YOWA 3HPGA 5AE1A 1H0HB 4CJSA 3T1YJ 3HJVA 3DRSA 1JLQB 2G0JA 3D28A 3DYAA 4CZMA 1NJZA 5GVQA 3PW7A 3T1AA 1L5UA 4TY8B 4P6QA 4R8UA 5HK4A 4ZDNA 3CJQA 4DV5J 2R4FA 2DGTA 2MDAA 4NXMJ 4EAHD 2AEFA 2YKMA 3IRXB 1RK8A 2Y8YA 3KLHA 5D0EA 3OVBA 1XMOF 2GS8A 3PXGa 1RT1B 3NG8A 4DR4F 4CTAA 3DJCA 4Z4CA 3O9UA 4CGIA 3LZJA 2DCLA 5AQLA 5FIIA 1M5HA 1HJRA 4IDKB 3CFPA 2MJUA 1KQGB 3PYGA 1LEOA 2AJFE 3NRBA 3SV3A 3SQOP 2DH8A 3SAHA 3HULA 4JHDA 3JXUA 2Z8QA 4J9QA 3VA0A 2HMIB 2QEXN 3KHLA 1GXUA 4DV6J 1VI7A 4I2PA 2K06A 1S49A 2UXCF 2G13A 4CO2A 2K7JA 5K9FA 2ZWOA 3QRRA 2CQBA 3PG9A 3JS9A 2DJWA 3DMJA 4J2BA 1VQ4S 3HSDA 2GMJA 4OIXA 4FLZA 5I42A 1WSHA 3ZNJ1 2MB0B 5LT5A 2GCFA 1TFWA 1NGGA 1AW0A 4OZLA 2HF4A 1SQEA 4KH5A 2DCUB 4CZJA 1Y00A 2UXDF 1VK8A 3AO5A 4KHPJ 1CJVB 4I4BA 3A8IA 3KKRA 3MZIA 4Z7YA 4ID5A 4YOEA 2WFBA 3QFWA 6AT1B 2CG8A 3TX8A 2MQMA 3HCXA 1RYSA 1RBOB 2C3UA 2H48B 3VGKA 1M5VC 1X7VA 4ELUA 2NPIA 2QK9A 3J81O 3KMQA 2DRAA 3H0PA 4Y00A 1S76D 4CD1A 2D5RA 3TU5A 2HEKA 4KTQA 2IVPA 3US5A 4PYDA 1T9UA 2IMWP 3UVJA 1SL2A 3R1XA 4CM2A 2H3GX 2O66A 2WONA 4OPHA 3SQ4A 4W5QA 1LOUA 2OPRB 2CGKA 1S0OA 5L1LA 4BS2A 4GVEA 5AJ3K 2OMOA 1KBRA 2LQ8A 4M5NA 1GOBA 4CEQA 3IBFB 1N32J 2Q6CA 4L72B 1T6CA 1NB2A 4JKCA 5HSPA 4JKFA 3FEZA 2JVRA 3LDNA 2BJEA 3ZSZA 3K2YA 1P27B 3Q7CA 3KK2A 1R8CA 1O13A 3ILJA 3IDHA 1C6VA 3SSQA 2HQFA 3SBMA 1Q7LB 3N4PA 4ZP8A 1X4EA 3JAMU 4ZCIA 3MXMA 2VC1A 1FK9B 4ETXA 1HPZB 5F8GA 2LVWA 2JC0A 1IBMF 4QIEA 4OYOA 3LA0A 4HTLA 4ANEA 4WFBL 3QICA 1KVJA 2HVDA 2V4RA 3PIPL 4QAGA 4JK9A 4K5SA 3ITHB 4KPYA 3B82A 2ZNYA 4DTUA 2ADCA 2ZH8A 3BKTA 4PXDA 2IC3A 4I68A 4LFBK 1O6XA 1YVUA 4GMJB 2RRAA 1T9TA 2PMWA 4B9SA 3ZX0A 1NK5A 3LWMA 3GWCA 3A3OB 4OI6A 4BQLA 3R7BB 1YGYA 4GVLA 4BVOA 4KGZB 1QJHA 4E7KA 5KT3A 3RWUA 2GV9A 4B9NA 3K5OA 1CG2A 2YBVA 3LF0A 4MIWA 2CQDA 1AROP 1H2VZ 2E9TA 2MSSA 8ATCB 3ENWA 2V8VA 3J7Z5 3F0NA 3WQPA 4LFAK 5J2MB 4JI2K 4M5LA 1UJ5A 5ETOA 3TAPA 2F9JA 4DI6A 1XHXA 4IZ9A 4U6PA 4JI2J 1QE1B 2KT3A 3GIMA 4G9ZA 4AE5A 1RLCL 4RJVA 1M1HA 4NLWA 1E6VA 2ZH6A 1Q8BA 1RKJA 4PA1A 3LUYA 1IG8A 3B6OA 1IBLF 2DO4A 3MPYA 4CRJA 1XEZA 3EPGA 2QX0A 5EN1A 5DDRC 2MQPA 4ISEA 1NZAA 2FC8A 4UQGA 3VQ9A 4CH0S 2AMCB 5BRHA 5C15A 1RHUB 4DXLA 3UN5A 2HNYB 4ZP7A 1MSWD 3MM6A 4CZHA 5H9FK 5EU7A 4KH6A 1PJ7A 3B4MA 5HVGA 4IO1A 4DCPB 3R8EA 3O44A 2RH3A 4PWUA 2CPEA 5EUHA 2VFVA 1U6BA 1U2RA 5KRSA 4LF7K 1U02A 4K2JA 1WSEA 4LQ9A 5CZXA 4EO6A 4JI7J 3GG1A 2XMMA 3Q8QB 2FJEB 3AVFA 4ED6A 5CYQA 7FD1A 3G0ZA 3VF2A 2C1EB 4B3TK 4FK0A 4BR9A 2XEXA 2E2OA 4MTPA 1VBKA 1U24A 4KYZA 4DV1K 1GT8A 3UDCA 4GV9A 3KK1A 3CCLS 4WFNQ 1UW4A 4NXNF 5GAEP 1VRTA 4CIOA 1HWJA 3QMLA 1QHAA 3BF4A 1FXXA 3GYXB 3LGMA 1EETA 4CH7A 5HANA 2C2ZB 3CCRS 2HYIB 3ZNUA 2AWZA 3TR5A 4AQYF 4URGA 4ZHRB 1H7WA 2V8GA 1VC5A 4OPKA 5C7PA 3E3XA 1P8ZA 3SUOA 3CCJS 2VA3A 3T6BA 4LREA 1VSLA 3WXMB 2CPIA 4LFCF 1H38A 3UCGA 3R9PA 4ZPTR 2APOA 4N8OA 4FZYA 5K5MA 2V7ZA 4F3MA 3E66A 4NLXA 1SPBP 5M1PA 4A61A 3IG1B 4ZOSA 2ITGA 3G25A 1NDLA 2HHTA 5KOXA 2GQ2A 2LYVA 4LFCJ 3MCOA 3RRHA 1U0SA 2Q66A 2IIRA 1RYRA 2BX6A 5DGBA 2C2MB 2EG1A 4ZCMA 4F4XA 2PN6A 2AYGA 1X5SA 3O1LA 2WOMA 4L3QA 2HHWA 4NL5A 5BR8K 1VIXA 2QA1A 5LMNK 5THWA 3HYFA 1S4EA 4YOYA 3HVAA 2FQQB 2P9LB 2HFSA 3E1YA 5F0WA 4W98A 2NCKL 2MGZA 5C2DA 5JJBA 1WC6A 3PHTA 2KTQA 1Y5IB 4RW6B 4KB0A 1VIOA 1EP4A 1NEEA 2HVHA 3M2UB 2W8KA 3SNNA 3CJRA 3ZO7A 2EWSA 2BE2B 4O3OA 1EARA 4OI4A 1RT3B 2WSEC 3U3YA 3CI5A 2W42A 3S3OA 2D1KA 2XNRA 3VR1A 4CLLA 3KJVB 2DH7A 2ASOA 4CGGA 2KDOA 2D0BA 1T0TV 3FLCO 3TTDA 4AHRA 2QLWA 4CZFA 1SI9A 4DV3J 4CJPA 2KL8A 4QBUA 4EMDA 3KJFB 1ZZFA 2O4GA 2H4WB 4R0JA 5KFGA 1T44A 1YI2S 5IOLA 1HBNB 1YG0A 5F8JA 1WNEA 1FWLA 2W40A 3H3NO 1S22A 3H42A 3BPSP 3T1YK 2CVIA 4WFZA 4CZLA 1VSKA 1HQUB 2ROPA 2B0GA 5KG3A 4W92B 1ASVA 1FWKA 1ZBFA 2D9PA 5M1NA 2EK1A 2MZJA 3I8BA 3NF7A 1XI1A 3L2WA 2HHPA 3SQ0A 3TZZA 1B0VA 3CDWA 5KFZA 1IR1A 3J7ZT 4LF4F 2GHWA 1J5EF 2UVRA 3GCWP 4JI8F 2KT2A 1NMNA 2ZNZA 1XBWA 2NPFA 1X4HA 3PTWA 3FK4A 4IFYB 2AGQA 2E6MA 4JS4A 1Q16B 5DQIA 5A0YA 4LF9J 2CWXA 2WCXA 4E7IA 3DRPB 4FM2A 4CT9A 4KFBB 2QWOA 2KU7A 2BXJA 4C3LA 1R8BA 2BJDA 3AAQA 2Q3SA 2CPDA 1CJUB 2GO9A 4ENOA 3NCIA 4HI2A 1JLFA 3GU0A 5MLCV 3ZETB 4WZQA 1S1TA 4ERDA 4EEYA 1ZBHA 5IQ6A 3ZCMA 2IM1A 3MEGB 2CPXA 4G1IA 3AARA 2PIIA 4JI1J 4FJ5A 1OYDA 4JI4K 4M42A 1G6BA 3SEOA 4CH1A 2PT0A 4MDBA 1X9WA 2ZHAA 4OZJA 4DPUA 4H0TB 2PY5A 1W26A 1Y3JA 2QA2A 1RT2A 3FSIA 2XSJB 4X65F 2CH5A 4IXCA 5A8KA 1TAUA 2BKPA 1WUAA 3MN5A 1KVIA 3JAMY 5E5NA 1Q78A 4FZVA 1I5OB 3WXIA 5CYMB 2X3GA 2DY4A 2WB1D 5B0EA 3ISND 2FJXA 4X4NA 2UU9F 2M88A 2L08A 5JVHQ 1A7GE 3CJ4A 4X4QA 1IBMJ 2UXBJ 4DQSA 4CLFA 1GK8A 2V2QA 1WF2A 4NLTA 2ZUAA 3SJHA 4B1WB 1HFEL 1BGXT 1TKDA 4EIAA 1NXIA 2Q2RA 4LQ3A 1SJ4P 1X4GA 5C12A 2DR8A 4OZ0A 2FJBB 3MR7A 1TFYA 1WJ9A 5EY4A 2Y8WA 3ZTPA 4C0HA 3CJ9A 1XC3A 3MMBA 1ZBIA 4LF9F 3VHQA 2AQ4A 2EKYA 3KHGA 3I0RA 1NGIA 3E01A 4DPYA 2BM0A 2MXYA 4DSIA 4HLBA 2CZ4A 1HNWF 4ES2A 4DV1J 1HNVB 4ELTA 3VPZA 1AT1B 2IBOA 1RBTA 2RRNA 1W2BM 3BKFA 1N32K 4CJRA 3AXKA 4C1NK 2KM8C 2W2OP 1LW0B 2ZOGA 3W63A 1W25A 3IUCA 2QM1A 3A12A 1YI2N 2CJ9A 4NO7A 1A0OB 2NSBA 4ZVSB 4DTJA 4PUOB 4DJBA 2JEIA 3NGIA 1J5EK 4F4ZA 1HIYA 4U9RA 1PBUA 4IOXA 3PUFA 3MURP 5C2FA 4AL7A 4O8UA 1HNZF 4C48A 4LF5J 1E4FT 1DLOA 2HBKA 1XMBA 3SYZA 1P1LA 3W7BA 1PYSB 3IS9A 2ZH7A 2YWEA 2N3LA 2DGXA 1U1RA 1TTHB 3FDSA 2KQ2A 1DQ8A 3VA3A 4BRIA 3NGSA 4JBCA 2HRYA 2PI5A 3BEGB 1BY9A 2ZWHA 1UFLA 2AX1A 3THVA 1SC4B 2SXLA 3D6FB 2G8VA 3IR6B 4HCBA 4NA1A 2OSQA 3SQGA 5AQYA 1IVZA 1IKWB 5D77A 4DV6F 3CQYA 5CH7B 3HHLA 4WKYA 2OPQA 4IO9L 1FXDA 2A3JA 4RU9A 5KT2A 1OH5A 3ZFVA 1BQXA 4R25A 4W90B 3UDVA 3MUVP 4WXWA 4J37A 2Q97A 1TMJA 3PRDA 3FZHA 4RLEA 3I55N 3AD8C 4M3XA 4BRPA 1CC7A 3BKUA 1N34J 3IFRA 4MLEA 1Q53A 3MCPA 2IYGA 1J9AA 3RU0A 3C16A 1I94F 3MM7A 2OPRA 4YMEA 4J8FA 2EFNA 3F73A 2M7SA 1C1BB 4YFUA 1VYAA 2HIQA 4JI5F 3PW5A 1NPKA 2BMBA 4P2MA 1AZSA 5AQRA 2KH9A 1XMQF 1NGAA 1EAYC 1SV5B 1IXKA 4GKKK 5GAEI 4BHQA 3AJ2A 5H1SQ 2J4RA 3FMBA 3MCAB 4IRCA 2XSFA 5D78A 4YB6A 1BXNA 3KG1A 1RDRA 3L2VA 2QW9A 3ENHA 5AFUH 3PV8A 2MZSA 3M2RA 4HUFA 4QIVA 3GLJA 3THYA 4RW7B 3OYBA 1S7IA 2J6SA 4ID8A 3TTFA 4MYTA 3SI8A 4KKOB 1H74A 2L9WA 2HRTA 3MM9B 3ZX3A 1LOTB 1QQCA 5DDOC 2J5AA 5IM0B 3QDKA 3GG0A 3FSYA 2YWFA 1XMQK 3HHLB 1EWRA 2HFUA 2XLKA 3KWMA 2FJVA 3TVYA 2UVWA 5K8MA 2HWTA 2R7QA 2RD5C 5D4NA 4DF8A 3I9V9 2CKWA 1HRHA 3T5KA 2IPOB 2IBKA 4LF7F 4AUKA 4QR1A 5LSOA 3WDOA 3V1QA 5HBMB 2V9WA 2H65B 1N0VC 4OHXA 2AP6A 4DTXA 2HFZA 4YY3J 3W3DA 4ZLJA 2CQ1A 3CXCR 2KHOA 4KAZA 3NE6A 1T9VA 2P51A 1U7LA 4MJKA 2DGSA 2O3DA 3H2UB 1S9GA 1QTMA 3TAQA 1TP7A 5KFIA 2GFFA 4CO5A 4AD6A 4FLWA 2PFDA 3AGKA 3DRSB 1HBNA 5E41A 3AVHA 1WSJA 4EFAC 1D8YA 3I0SB 1XNRF 3L2QA 1HMVB 3PR5B 2I0XA 3MI7X 4CHOA 1SH3A 2Q43A 4BR7A 4JNEA 1NMEB 5CQGA 5CZ1A 1BQNA 1DARA 2KKZA 4DPOA 2JGUA 4B9LA 2FVPA 3R3TA 5A2QU 4DFMA 3VZHA 2GW8A 4C8NA 5BN8A 4UW2A 4IH7A 3D5MA 2RPIA 1K73O 3WIVA 2P9SA 2VGNA 5AQXA 4CDIA 4OYPA 5EWGA 2KZMA 5HRSA 3RBZA 2NR0A 4B3RK 4DSEA 1WORA 3CCUS 3R5AA 3IAYA 3BV8A 2OUGA 4GKJK 1C0GA 2GO8A 1LFWA 1LK7A 4UQTA 2QFIA 1YZ6A 3MX2A 1QSYA 5IT0A 1X4DA 2ATQA 3L7OA 3GJRB 5J1NA 3J81j 1KD1T 2XLIA 3TZXA 1ATSA 1IV0A 3JSBA 1VR6A 2PA8D 4FLYA 4DR4J 1HD1A 3MEEB 4K43A 5KT4A 3VF6A 2FUG9 1CPZA 4XH1A 1ITPA 1OH6A 2ZM6J 1LXNA 1QTNB 3CF5Q 2W2PP 4MFBA 1HHTP 4DPTA 4J90A 5I3QA 1R0AB 2V34A 1HI8A 1YLXA 4H54A 4E1NA 3Q89A 3KYLA 3HI0A 1JL1A 2VKZG 4A8YA 1YKWA 4MYUA 5L8RC 1WN7A 4NLGA 1KAZA 1S0NA 2NUUG 5AJ3F 3CDBA 3D6MB 5DZ6A 4TLRA 3FE1A 1FFGB 2GELA 3EPIA 5CZ2A 2GQCA 1H98A 2VDIA 1TKZA 3HI9A 3D1HA 1UZHA 2L41A 2L48A 2J0QD 4WJBA 1VGYA 2IGIA 4I6YA 4M94A 5DZ7A 4QYZK 2Z1JA 5D15A 2MZQA 2JSXA 1HNIB 4IFVA 2ASLA 4FDFA 4Y28C 1Y9OA 3LDPA 2UXBK 4PXBA 3V4MA 4KHQA 2P6SA 1R0BG 2M5YA 3Q2SC 4MIAA 3Q24A 3THXB 2JH3A 4PG5A 1W97L 4KRWA 2OCEA 3QT8A 2NQPA 3QQCD 2A40A 1C1BA 3FEYB 3SJJA 1WNSA 1E4GT 1KDNA 2XMJA 5HMXA 3QEWA 3K7RA 5C42B 2BM1A 3C16B 2BJ3A 3UR3C 1ATRA 4JEPA 4KV8B 1F2GA 3EYZA 2IVFB 2D9OA 3QZ7A 4FYWB 1Z25A 3CJAA 4A59A 4MT1A 3ET6B 2EFQA 5HRNA 3U27A 1RAJA 1JLGA 4DL7A 4B3MK 1Q0NA 3CDEA 1FTCA 2MKKA 4NXMF 2IAJB 3PZPA 4Y2CA 5K14B 1B70B 4DPWA 4C2MA 3AFGA 3D2FB 4OHVA 2Q79A 2J0SD 2UU9K 3VAMA 4J9SA 1J5OB 1KHWA 1N5TA 3R2DJ 3IO1A 1NRKA 4H4KC 1VSDA 2DGOA 3D0GE 2F4VF 1T02A 3IS9B 4NLQA 2C3MA 3CJKA 3RGIA 1AFJA 2QMWA 2C2OB 2HLTA 1VK3A 4U8VA 2ROGA 2WBNA 4A4JA 4WE1A 5L9XA 3TJAA 4CBXA 4FLVA 2KM8B 1IWAA 2ABYA 5F9LA 1FO1A 1DJ0A 2ASMA 2V8PA 3FQLA 1M90T 2XB2D 3NAIA 3C15B 1QAXA 1ZM3A 1FCAA 1TL7A 3WX8A 4ISFA 3ISNC 1RBAA 2YNHB 5FPNA 5AZJB 5GAHU 3M8SA 3O08A 2IDOA 4JV5F 4M5GA 1W9HA 3NWRA 1WOPA 5HVFA 3P45B 4IO9Q 2YH1A 2RKIB 1RAHB 2LQ5A 2XO7A 3AOBA 2F8MA 5E3QA 1J53A 4LD0A 3AH6A 1FKAF 1BISA 3AVGA 5FRMA 1Q95G 1FK9A 2NZTA 4CO1A 2YWGA 1HNXF 1I39A 4AHUA 1VQ9N 3DLEA 4PWDA 1AB8A 1Q1KA 3VQ4A 4DU1A 2XZTB 2XG8A 1NGBA 4DR7J 3ZZ0A 1WI8A 1WG5A 1DEJA 5SUHA 2IRYA 3FFIB 5KFCA 4TU7A 1M1KO 2BW7A 4PXEA 2E1YA 2VD3A 2LQJA 4ZK7M 4QWAA 3B8AX 2EBGA 1U45A 1NBEB 1N33F 4Y2IA 1YRXA 3PYEA 1KRPA 5DM7Q 4M3ZA 1OIAA 1BU6O 4O5BA 1EKEA 3M32A 4JV1A 2UV8A 2HHQA 4MKYA 1EX8A 4MKAA 2B7BB 2WVDA 1GLFO 5F3ZA 1UAWA 1RT5A 2E1RA 1ASWA 2VOPA 2NUBA 3LANA 5D3GB 4MKBA 3QT7A 2ASDA 2ZGYA 2XNQA 4CLTA 1TR0A 1XMQJ 1EJ7L 2FF6A 4WU2A 4GO5X 4CIEA 2QT7A 3HM9A 3RB6A 5IWAK 2RF2A 3ZXWA 3M5RA 3M8WA 4FVUA 4MLHA 2WHOA 4URQU 2OHDA 5A0YB 1UJ6A 3DRPA 4YEAA 3IMQJ 3G4SS 2WSFC 4WE1B 3A8EA 1C1CB 2CQ3A 2CIMA 4AHVA 3JQJA 3QZ8A 1WKKA 4N56A 4FWMA 4BROA 3I6PA 3THTA 2LQBA 1TK8A 3N79A 2YKNA 2E5GA 3AGRA 1NSQA 5C10A 2JC1A 3QBWA 3W61A 1F5BA 3KK7A 4JB8B 4DV4K 2LEPA 3VGUA 1NK6A 4C4WA 2BV3A 4USIA 2LXUA 5LJWA 4JS5A 1VQ9S 2DTUA 2D0AA 2GX9A 4PG6A 5KFHA 3SUQA 2OPQB 4M7YA 3VVTA 3BR8A 4E7LA 3AA4A 1H3DA 2LA6A 2DEJA 1LWXA 3VQ5A 3L2RA 2Y1JA 4YY3K 1VRUA 5H9FJ 1SL1A 1JLEB 2LU2A 1B99A 4CERA 4CF0A 4BRDA 3M4XA 2KVIA 1O8BA 2DGWA 2YKMB 2MHNA 2R8KA 1FERA 3PW4A 5IT9U 4CZGA 3H2LA 3CJSA 4IKFA 4FWOA 1GLLO 3O6QA 5HLFB 3PNIA 1VQ5S 4BRHA 1MROB 3HHLD 4Y0FA 3I4HX 1X5OA 4GVBB 1IG9A 2AEMA 5FLXU 1VSEA 2ASPA 3G6VA 3OHAA 4Q8EA 1AUDA 4DR2K 1JKHB 2VG7A 1JKHA 2P6TA 4RW8B 2YH0A 3Q86A 2CQIA 2W4PA 3J81U 5D4LA 4N5SA 3CCLN 2Y1LB 5MLCQ 3GSDA 2YCHA 1M5SA 2UVUA 4X66F 2YHYA 4CK3A 3P5BP 1YJ9S 4FNHA 4FJXA 3OXFA 3OL8A 2O1PA 2BH1A 3V9UA 1UAXA 1RGIA 2DNPA 1HNXJ 3W8PA 4EZ9A 2CQ2A 2FTRA 3AB4B 1IJFB 4C11B 4J9PA 3KLFA 1YBAA 4ED3A 2G0IA 1QQMA 3O3GA 5KGXA 1NNEA 3MPWA 4ECSA 3DOMB 3G10A 1LAVA 4G65A 2VV5A 3AOCA 3OV7A 2XLJA 1R0AA 2RVJA 2V63A 2PEHA 3P8BB 2JLGA 3T7ZA 2YY3A 3JSYA 5KFWA 4NYZA 4V19J 5CD4H 3HVTB 4DTPA 3LOUA 5T14A 5KG0A 1Q8KA 1XR7A 3AOAA 4Z94A 2PA3A 4P7TA 4UOHA 1NO8A 4RNHA 1N52B 3E9PA 3H1QA 3K5NA 2C3OA 3MAAA 2CADA 4CLUA 1TELA 3PIPQ 1C1CA 3GL1A 2C2KB 2HS4A 3GV5B 4CF2A 5KOWA 1Y7PA 4N7TA 1UETA 4BGAA 2MY7A 3L3UA 5KPRA 2XM3A 3HKWA 2V2KA 1VC6A 4I9LA 2YX6A 3DU5A 3CJTA 2D0PA 1UOCA 4KREA 2FHJA 4IFVB 1VQ5N 1ZBUA 4QWEA 2V5HG 3PYFA 2KXHA 1NK0A 4Z4IA 3NGTA 2QV6A 3TABA 2P9EA 3NGYA 1F21A 1SKRA 2QSFA 1VQYA 2PO4A 3KDOA 3P83D 1PJ6A 4K4WA 4J91A 1SJQA 4C0BA 3FEXB 2CH6A 5AQVA 4NXMK 2ZE2B 2EC0A 3DMJB 3AQPA 3I0SA 3MEKA 3SV4A 2E1ZA 4ILRA 3GFXA 2VHGA 1VQ6S 3L95X 2IDEA 5HN0A 4JI3F 3MM7B 4CFDA 4DFKA 1WTFA 3U1LA 2E2NA 4Z4GA 3GR1A 1ELOA 3AA3A 3AQOA 3MR6A 4WIIA 2OTLN 2HGNA 1CZAN 1WEZA 4KHWA 1DTTB 3M6UA 3E9OA 4DL6A 1RLDA 4WU3A 4E19A 3G6YA 1NDPA 1HNWJ 1WLJA 1SUQB 3P38A 1J5OA 2PGCA 4O44B 1X60A 5B0BA 1YAGA 3OJUA 1RXOB 4HCCA 1Q9XA 4QU7A 5KG1A 2VONA 4DL5A 1UA0A 1UL3A 1NU0A 2XY8A 4IO8A 5J2QB 1OQ6A 4ZITA 4CJ4A 5D0HA 1QZ6A 5IC6B 1FRHA 4J9KA 3LAKA 3EZUA 1BA1A 3R9LA 2ZGZA 1VHXA 4DR3K 2HZAA 1K9MO 3W3SA 2HVEA 1X4FA 3W64A 3HFZB 1S1VA 4CW7B 3QBCA 5KG7A 5DDQC 2P9NA 3GV8B 3ZSXA 3CM5A 3POTA 3GYGA 4R8UB 1NOYA 2OYQA 3LWLA 4GC7A 4EI2A 4OHZA 2P8IA 1QE1A 3UKRB 3CCQS 5EHHA 3WNEA 1OO0B 5L1JA 4A2BA 1I3OB 1FTRA 4MIBA 2WVFA 4PQAA 4IG3B 3G2XA 1RDCA 1T03A 5GADU 3A2FA 3OYGA 2CJQA 4CGDA 1D3WA 3QESA 1SQKA 3TUJC 2O4IA 3GV7B 3W2VB 2E5LK 4CWBA 2QSWA 2XMVA 1K9MT 1QUPA 1KAXA 3WQTA 2PEBA 4QWBA 3RZAA 1VRUB 3BREA 2DXEA 2V69A 3M7VA 4ISGA 2DY1A 2HZVA 4KIAA 2UUAK 1VS3A 2E5LJ 3OS0A 2XMKA 5LMUJ 1MROA 3PR4A 5DMRA 2RDIA 2BRKA 1TL5A 5C24B 3C8YA 2AF6A 3AVAA 1LWFA 2BKNA 3FZMA 3ZT3A 3PEHA 3MTJA 2G8UA 4DLGA 3W60A 5T7LA 1FRMA 3GFZA 3KXDA 2YWHA 3H7HB 3SPZA 3C6UB 1RTHA 1VQPS 2HBYB 1B92A 2D0CA 4CVNE 5LJ3Y 5FROA 2YX4A 3DLLL 1VQMN 1RWKB 4UF4A 2QO3A 4LVOP 2V68A 4BRFA 3QEPA 5CXTA 4X2BA 1U1KA 1HR0J 1JL2A 3AHPA 4OPAA 4O4GB 4B3SK 3CEDA 1D1UA 5D8HB 2IVMA 2E5LF 3BGLA 2J9CA 4KRFA 3FR0A 3GR0A 5D4PA 3M8QA 1FFWB 2ZH9A 3Q8RB 2W9CB 4E7JA 5GIPA 3JYTB 4PG4A 1HYVA 1MN9A 2VH7A 3B78A 1VLYA 3MOZA 3DM2B 2NRTA 1OKJA 4RUHA 4KTWA 1RDDA 2E44A 2HHSA 5A8WA 3E8OA 1U2VB 2QKBA 4CM0A 3MEGA 3M1FA 2FBVA 2NLWA 4BDPA 3TQ1A 2XYGB 4XTTA 2C3YA 3DLGB 3M05A 5HROB 4NXNJ 1TK5A 3VALA 4KI4A 3PHEA 3KUHA 1LW2B 2P9CA 3CJCA 2QLJB 2A0FB 2HS3A 3PLAA 2OEKA 4DV2F 3H08A 4NYNA 3OHBA 1U25A 5LJ5Y 4J9VA 2QLBB 3ETMA 3J7ZO 3Q7BA 4DUZF 4ECWA 3C2PA 4C3KA 2A41A 3TRGA 2IA6A 4NMLA 2POKA 2B6AB 2WZ1A 3VQ7A 3BB5A 3CJ0A 5ETQA 1S3XA 3TUPA 4CO3A 2FD2A 3L8BA 1S12A 3KHYA 1VBZA 3SUNA 3RMAA 1G4CA 4ZLNA 3KLHB 3CD0A 1XR6A 4N77A 1YVNA 4Z4FA 4HTIA 4HKQA 4RWXA 1F3VA 4KV8A 3WT0A 4AM7A 2Y9HA 3HSZA 3M2RB 2EX3A 4LFBF 4OKJA 3S1TA 3MPUB 1VMBA 3CCVN 3KK1B 5RUBA 1S9EA 1FDBA 4LF2A 4YDXA 1K8KA 3GTYX 1T3NA 5E2QA 4ID1A 3CCZA 4IEIA 5KFDA 2IY5B 2HFOA 5KFUA 4L75A 3MCSA 4OX7A 5AZIA 3TSQA 2HGLA 5J2PB 4DX8H 1RT2B 3O4WA 4FWKA 5AQUA 4OI3A 4CI6A 3BF3A 3QGPA 5HJXA 2P5OA 4OGCA 3RSEB 2R7XA 2MKIA 1JXBA 4IFYA 4DWIA 1X4AA 1F5AA 3V4IA 4E89A 4DQRA 2P9UA 2B3TB 2XCPA 3C6TB 3U4LA 2PE8A 4DCOB 2A6AA 4PABA 1VQ7N 1N4LA 1GXTA 3H5SA 5A8RB 3NMAA 1NJIO 3AVLA 4FJGA 3FVYA 3CIZA 4HH1A 4IQMA 3ZTSA 4DU4A 4LRDA 3TNVA 1NGFA 4PYAA 1IJEB 5ADXA 3AVNA 3HKZD 2QMUB 4JAXA 2J8AA 4USUA 4BR2A 1X3MA 3MCNA 4ZPVR 1EWQA 2GVDA 1PC4A 2CPFA 2MSTA 3QYYA 3OYHA 2B4UA 3T41A 5GIOA 4F04B 1L3UA 2DNLA 1F6TA 3K58A 4B9VA 3EVOA 3QNWB 5I4MA 4FK4A 2HBMA 3CSKA 5I9EB 5KT5A 4ILJA 2OA8A 4L6V3 3BZKA 3VGMA 4M63C 4HUGA 3BQ0A 4ECYA 3VERA 2QGFB 3MCMA 2Q36A 2BGGA 3BDPA 1P8GA 4Y3CA 4NYPA 4CECA 1JNZB 2WB4A 2UXDK 2D0OA 2BUPA 4IUFA 4DS4A 3NCPA 4KE5A 3LP1A 4LY7A 3AD7C 4LT6A 2R8HA 4L76A 4JKGA 1U1PA 5B0FA 4XDDA 4RTFD 1YJUA 2QZ8A 4X65J 3DI6A 4H4KA 2B4VA 3J7A1 3RW6A 4M3WA 3K89A 2X1GA 3VQ8A 1SB6A 4RL1A 5B09A 3Q8VA 2BQUA 1SJFA 1WG4A 2ZJRL 3H46O 2KO1A 4TXSA 1OVYA 5HP1A 3MD3A 1RDAA 4BR4A 3K9KA 3ZETA 1SH2A 3VQCA 2MZ1A 4X64K 1FD8A 4K4ZA 1NM1A 3IAM9 4CEAA 2FYXA 2FGCA 2ZD1B 3W2WB 1UKUA 1HWKA 5J2NA 3CCWA 2YPZA 3GIKA 1TQLA 1TKXA 1X9MA 5HRPA 3I82A 2K3IA 3FZKA 2BJ8A 4QU6A 3MR5A 3H20A 1KC8T 2ZJQL 2R2SA 2BEFA 4MK9A 3HBTA 4XPCA 3RTVA 1Q79A 2O8CA 1QS4A 5BRFA 1X9SA 1B3TA 4EYIB 4PXCA 3PSFA 3HVRA 1QVGM 1K73T 3LM9A 1F3FA 4BE2A 1J54A 3H6EA 3HVTA 2VGMA 4AXJA 4X66J 4MKVA 2DPJA 3HX9A 4IKAA 4FZXC 4WQ4C 3QFHA 2E5JA 4ELVA 3C95A 1QZ5A 3PACA 2G0CA 1KTQA 2IMOA 2IJFA 1JJCB 3V9XA 5JS1A 1YITN 2Z0GA 3BZCA 4ZPBA 3TVKA 2YNGA 3VF4A 1GLCG 3KK3A 3M6XA 1VQON 2BE2A 3HD1A 2GGPA 1IBKK 2O8EA 3I8DA 1Q4RA 4ZPWR 1PIEA 5E3CA 3T1YF 3D2WA 1S7HA 4DL0C 4ICLA 2ZEJA 4C9DA 4FWLA 1E6YA 4J2DA 3GP9A 4YR3A 1R0CB 4CJFA 5B0GA 2R2UA 3THWB 3D7EO 1U0HA 4DMNA 4KHPK 3EZ5A 3NHGA 1UWBB 3OW2R 2HNDB 1N5YA 3U8XA 3V9ZA 3GILA 3TSUA 3D3CJ 4XK8C 1MMDA 1UEUA 4WTOB 1HQUA 4H0OA 1UCNA 3PSIA 3HSJA 3UQSA 1S10A 4KY3A 1HNVA 2AP1A 2ZOFA 4JI5K 4B9QA 4TSXA 4JI6K 2FSKA 3CJKB 4H03B 1NU4A 1ZTTA 1HX1A 3CD7A 3D3BJ 4CGFA 4KB7A 3UD3P 4BC4A 4I9QA 4LVNP 3F5TA 5G4DA 4YDUA 3R5CA 2W2QP 1K8KB 5KG6A 3QO9A 4DG1A 4OX6A 2FB0A 3A8KA 2FHJD 3OYKA 3MM9A 4B3OB 4DR6K 5L38A 2WW4A 3S7RA 3PFOA 2KT5A 5K8PA 1JLCB 2OP5A 5HROA 4DV2K 4K2XA 1CXUA 1D9FA 4YN3B 2DR6A 1U1OA 1YTAA 1F5CA 1BL3A 2CQCA 4AQYJ 1SAZA 2O8CB 3FQKA 3CW2C 3EGNA 2MEWA 2X1FA 1PYOB 2CQ0A 3QLHA 3AO3A 4G1QA 4L3NA 4G1QB 4GO7X 2ZH4A 3JTPA 2P9UB 1S1WA 3EDQB 1Q9YA 3H45C 3RMDA 1FNMA 4BRQA 2VPYB 1KONA 2CAJA 4C8YA 2ITMA 5IWAF 4PKHA 3N28A 3CC2S 4BR5A 2XYHB 4WFAL 2G2ZA 5LMUK 3VTHA 1JLQA 2FSJA 2FVSA 3MXIA 1TKTA 3OXLA 1RJJA 3SCLE 3QB0A 1N36J 2A1SA 1AXQA 3QGHA 3LGHA 2O8BA 3ISZA 2JL9A 2F96A 3ULHA 1YK9A 4OLBA 1YT3A 1U6FA 4NWBA 2YQ1A 4RO0A 2J6TA 3PRBA 2WBRA 2EVZA 5IS2A 2A42A 1FJ7A 1KLNA 1N33K 4GKKF 4NASA 4JKBA 2CZVC 3KUGA 3DDIA 2X1AA 4DV1F 5E84A 4E3SA 4I64A 1ESVA 3DWLA 3J80U 3J7AN 2ROEA 4FWNA 4M45A 4PQUB 4WP3A 2FZGB 4V19S 2V0NA 4DG1B 3HXMA 2UP1A 4BG8A 3NGDA 4KO0B 1ACMB 4CFBA 1DTTA 5L9NA 2VWKA 4C7QA 4ZJLA 5EDWA 1JJ2R 3CUNA 5C42A 3N6NA 4KHMA 2KW4A 4CJLA 3M8PA 5LSRA 3SBGA 7FDRA 4O44A 3SMSA 4A46A 2PI4A 4ZJQA 1BD6A 1TL4A 4DEZA 1PJ5A 3H5XA 3J7YU 1IO2A 4JI0F 3KJNB 3GJTB 1FX4A 2DNRA 4F3TA 2IIHA 2YKAA 3WNGA 3DC2A 4IR9A 3MWPA 3VQDA 3I31A 1N6QB 4YHHF 3WEEB 5HRRA 2CQHA 2OLWA 4OI2A 5DRKA 3D4JA 3M2UA 3OFEA 3QJLA 4DR6F 5E3PA 3SQ2A 4OO1J 3V6DA 2XCAA 3VAIA 4B08A 3WEEA 3JYTA 3GFYA 2R7TA 1FWPA 2DK2A 4DSJA 2YKOA 3DXSX 3K0SA 1WSRA 4IFEA 4FJKA 2VDHA 1HNZK 3RRGA 1KS2A 2WK4A 1HNZJ 1BQNB 1UJ4A 4LF6F 1VSMA 4DR5J 3OR2A 4EK2A 2ACMA 2NRXA 4PCQA 3HT3A 4ED5A 1YBTA 3NVKA 3L9ZA 1B9DA 3U3GA 3CCSS 1IM4A 4G6VB 4QWDA 4O3QA 4H4MB 2OPSB 3L3CA 4TNOA 2VQFF 4RCHA 1BMQB 5FLXY 1MMLA 2XY6A 3Q0AA 1ZM4A 2GUPA 2KN4A 2KXFA 2H5IB 3OL9A 4M5IA 1RDUA 3DLEB 4PWDB 3NVMA 5B7WA 2A1BA 4PQUA 5LMNJ 1BCOA 1TUVA 4FJMA 3OTOK 4O3PA 4USJC 3IR5B 3DAWA 2IC3B 4KHPF 1S79A 1SC1B 2FBXA 1S77D 3PY8A 1OQ3A 1EETB 1DTQA 2VG5B 1RHKB 2I5JA 3VF0B 3DHWC 2GJ2A 4DN0A 4W5NA 2ZVIA 4FVCA 4PY5A 1TAQA 1FJGJ 5JMVA 4JI3K 4IWVA 4JRPA 4FF2A 1S59A 2VQFK 1ZPWX 2LLZA 2CPJA 4Q0BA 1KVKA 3H59A 1UVNA 4GNIA 4ITSA 1SQGA 1RILA 2QTWA 2HQIA 4OJGA 4F4YA 3U1NA 1R27B 1FHTA 4FPAA 3QWUA 1U48A 2UXCJ 1YVFA 1XNRK 4I6MB 2Q1LA 3O3HA 4DLEA 2A5XA 4PG7A 2DEIA 1ZAWA 5BN9A 3S41A 1S1XA 1JLCA 3POTB 1PC5A 3DLLQ 3CPEA 2E7VA 2VB6A 3ZTRA 4QOZB 2VU5A 4ZLPA 3AT1B 1SKSA 2LU1A 2ZJRQ 1B4SA 5IFMA 1QHTA 3BEXA 2NLXA 4IRKA 4DPXA 5A6WA 1F1BB 2ZUGA 3HTVA 2Q3PA 3VAFA 3R7NB 2V52B 5AQZA 4QQBA 3MFIA 4I7FB 1M1GA 4H4MA 4LRAA 4W4MA 4WF9L 4QWCA 4Q8FA 3N4QA 3QIOA 1UA1A 3ENVA 1M5PC 1C0TA 3RG6A 4USKA 2HNZA 3SDEB 2ZE2A 4F8RA 2YKPA 4H0PA 1LWFB 1Y5LB 5J2MA 2HBLA 3TTCA 3RYLA 2G8FA 1U1LA 3HHDA 5F8HA 2RE2A 2UUTA 2KI2A 4X66K 1U0HB 3CCSN 5DG8A 5HL7L 4WQ5A 1CJTA 3OLAA 1UWBA 3CDAA 4DSKA 3ZEUB 5KRTA 1IR2A 4RW9A 2W2MP 1S9EB 4AQYK 4WFBQ 3AY9A 1PCAA 1HA1A 3N4WA 2OH2A 1TL3A 2H5JB 4USWA 4DQQA 2NREA 4GKJF 1X9JA 3CM6A 5AQKA 3ZYYX 4JI6J 1Z6RA 2DR7A 2DH9A 4DBQA 3ZEUA 2AYBA 4LF8J 3C6HA 2KRRA 4F26A 1TL3B 3RAMA 3F41A 1KFSA 2J7WA 4KHNA 2EWHA 1P9QC 2XMAA 1TKZB 4U67Q 3G8SA 3VEVA 4YUDA 1U2FA 1URRA 2RDJA 1WG1A 4F4AA 3FJ2A 1FNOA 3QNOA 3WX4A 4B3OA 4JLHA 2Q0RA 1VQLN 2BYCA 2NRHA 1MG7A 1NWKA 4H8KA 3AVJA 3MMCB 1UVJA 1CSJA 4F2SA 3HO1A 4ED1A 1HUXA 1NSKL 5D6GA 4B3TF 2WTUA 1ZYQA 1HBMB 5SZTA 1IJJA 1SJ1A 3GIJA 2CGJA 1T6DA 3NWGA 1F0XA 1WF0A 5C2GA 4MAKA 1WKJA 1BHNA 4A5BA 2HS0A 2FJWA 2GWJA 1V3RA 1CXQA 5M2RA 3MM8A 2GJIA 3SCJE 5GADP 1HQEB 3DYAB 2CJXB 4UTGA 3PDNA 3J80Y 4CJQA 4U95A 1R59O 3W62A 5EXWA 3H4BA 4WFAQ 4CJUA 1LXJA 4UT4A 1ITGA 3SCXA 3IN5A 5CCLA 5HMYA 3UN3A 2DGQA 2B4JA 3M6VA 4O5FA 1NHUA 2H1YA 3SMZA 5LM7E 1ROFA 4IBNA 4N76A 4KSEB 4B02A 8RUCA 4F3OA 1QSLA 4GV3A 2NYHA 1YJTA 3ILOA 1RB0A 3AAPA 3AV9A 3BSOA 3L4QA 2D7SA 4KFBA 1MWYA 5CHIA 4E98A 1N5QA 3BBCA 1C2PA 5EX5A 3TZWA 4FL9A 2QXLA 4WYLA 3A4TA 3K9JA 1FT8A 3F56A 2EG2A 1WEYA 3JXOA 3EXYA 1WC0A 4WQ5C 1JLGB 1N34F 2VG5A 2RRBA 1MDUB 5M1FA 3G6ES 3IM8A 5DO2A 1RWWB 4NLOA 2JFKA 1BI4A 5DQHA 3UD4P 2I1RA 4M5DA 3FZBA 4QR0A 2ASJA 4IJAA 4P2XA 3Q8UA 1N8RO 1PBAA 1RT4B 3DLKB 5HAOA 2HNYA 4FJNA 2I7PA 4X4SA 1LKZA 5ETVA 4U67L 4LSLB 3M1VB 1VBXA 5JMNA 5EX3A 2BDPA 3MN6A 4LF9K 2ZFHA 3MAQA 1WAJA 4EP5A 2XMWA 4JV5K 4A2AA 1BE4A 4X65K 1YDLA 1KQSR 2HWIA 1VQLS 4HI1A 2Q1NA 3GPAA 5GMEA 1U4BA 4CEFA 1IN0A 1ZC6A 3SFGA 3UNGC 2OPPB 1FNXH 2BA9A 3Q8PB 2V2VA 2X7IA 2XI2A 4DZ6A 4KGXB 3OD2A 3GZ7A 3A1YG 4BR0A 3MPVA 3KK3B 2DY9A 4BC2A 3S01A 1VCTA 2HOEA 1BWVA 2KJVA 1Y64A 1S6PB 1VBYA 3KK2B 4OI0A 2DR5A 2V7YA 1OWXA 3DNCA 1V6HA 2HWHA 2IVYA 2ALYB 1GAOA 1OPIA 1BC6A 3BF1A 3Q2TC 2W6KA 1PAEX 5ETTA 3FZLA 5B8HA 3V1OA 4O0IA 4DF4A 3O1WA 4OYIA 1YTYA 3J81Y 5TKYA 2HHUA 3BGUA 3T1HK 1AFIA 1I51B 2JHEA 2NRRA 3CC4N 1C0TB 4HHJA 2Z4PA 3JQKA 3OSNA 4DR5K 4LMZA 5K8NA 3VEOA 2Q0UA 1QAIA 4X62K 3H25A 4AHSA 2YNFB 2CQ4A 2V8DA 2VFTA 2H3EB 2ACYA 4OKKA 2V4JB 2BUNA 4DU3A 3K17A 2UUCJ 5FPEA 4J2AA 4AYBD 1KVCA 4KHYA 5BJRA 2JDJA 3MDQA 4JI3J 1EHWA 3OTOJ 5HI7A 1FJGK 3C14B 4B9UA 3RW7A 3N6MA 1W2IA 4ED2A 1QVFR 3AB2B 4E0DA 1SUQA 2RUSA 3W2WA 2G8IA 4CZIA 1CS4A 2JNJA 4NLCA 3L09A 3O1BA 3ZSQA 4OMFG 3OVNA 4X62J 4TQSA 1M5KC 3CHWA 1JLBB 2WW8A 1BUXA 4OZ2A 2JVOA 4FW1A 1X3NA 1V4TA 2FLLA 1REVB 2CJKA 1FXRA 3TAMA 2VFSA 4YR2A 4GKJJ 3CNQP 4X4PA 3QIPA 1YJNS 3DN9A 3CCTA 2YVSA 3QGGA 2EHGA 2DXFA 4NEYA 3ZZPA 2A1RA 1XN9A 1ZXOA 1BO5O 4HVZA 3H4DA 2MTLA 2ZJPL 2CZ9A 3TX0A 5AQSA 1IKVA 4RW4B 5BR9A 3MM8B 2C3PA 3KG0A 1W7WA 4NCBA 1WACA 1G15A 4LH4A 3DM2A 4ZMMA 1RA7A 1HQEA 5AQFA 5AXNA 3RR7A 3DLJA 3M30B 1VQNS 1FJGF 2IHR1 3HSGA 2KKHA 3QNNA 2Z2LA 4HYKA 3RVCA 3OW2M 1NK4A 3P96A 1YSJA 4ICLB 3QLHB 3O3FA 4KH1B 1U1QA 1R7IA 2C22A 2NRZA 1M0SA 1NGCA 2XTJP 2EK6A 2MKSA 3KLGA 4OYXA 3KNAA 4XH5A 3NGZA 2OMLA 3IR7B 3O80A 3HHNB 4O3RA 1HHQA 3HZ6A 1UPMB 5DGAA 1Y10A 4JRQA 4Q7AA 4I2QB 3BDEA 1WBDA 2OFGX 2ETJA 4I1TA 3TWHA 3VQPA 1F60B 3GYNA 2OPSA