2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
4O44A 3BJYA 1JKHB 3NGIA 3T19A 5J2QB 1FKOB 2G8UA 1YVUA 4TY9A 3V4IA 1JLFA 3QO9B 5L1KA 4RW7B 1RBUA 4F3OA 3VQEA 3SUQA 3HPOA 1J53A 4FZZA 1MU2B 4IH5A 4RNOA 3QIPB 5DG9A 4BWMA 2W9AA 3VQ9A 1C0TA 1D5AA 3ALYA 4DL4A 1VSDA 4IH7A 4PQUA 3AVGA 4KFBA 2XY5A 2KW4A 1DLOB 2GV9A 2GC8A 3KHGA 3QEPA 1T03A 4Y3CA 4OLAA 2YNGB 2WB4A 3PW4A 2DFHA 4FW1A 4F4KA 3BR9A 2HHXA 3EYZA 4WE1B 1BQMB 4ECTA 3RR8A 1LWFA 5C42B 4OKKA 4Y2AA 1N5YB 3A2FA 1EETA 1IKXB 1QSLA 3D5MA 1RA6A 5J2NB 3MEEA 2IM0A 1KHVA 1HQEB 2JGUA 1WNSA 2KTQA 1LW2A 3N6LA 3RAQA 3G0ZA 2VG5A 3LP1A 4QW8A 3LAMA 4NLTA 3F73A 1XR5A 1TK0A 4CJLA 4RW9A 2UUTA 4BDPA 3NGZA 3WNGA 4E3SA 3CO9A 3ZT4A 1LWCA 3OYJA 2XO7A 3SQ2A 5DQIA 4DS4A 3RTVA 3HVRA 3BSNA 3AVHA 4CK3A 3LANA 2QXFA 4DFMA 4CJ3A 2FVQA 1UWBB 1ZBUA 1XHZA 3O4QA 2B6AB 4KAZA 2OPSA 4CEAA 3OYAA 1HNVB 1NJWA 3E01B 2PYLA 1NK9A 5KFMA 3OLAA 3OYGA 3LPUA 1BQNB 1U47A 4LSNB 4CHQA 1CXUA 1RA7A 4WZQA 2Z1GA 2D0CA 4I2PB 2YV0X 2BE2A 4ECUA 3RMBA 1DTTB 1IKYB 2B43A 1KTQA 2VWJA 3TARA 3U6FA 4M3UA 1T7PA 2YNIA 4W5RA 4G1QB 1NK8A 3VQAA 3DRRA 3QESA 2XI3A 4Z4EA 3DI6B 3SNNA 1RILA 2OPPB 3SFUA 3I0SB 5K14A 4RNMA 4CHOA 4MK8A 4CERA 1QAIA 3ZSZA 4FJ8A 3SUPA 3QNNA 4R8UA 1ZBIA 4WYWA 1S1XB 3CJ4A 2YKNB 5FRNA 4FVMA 2FLNA 3OYCA 1SL2A 4M41A 4DTSA 2JLEA 3KLEA 1C1AA 3VA3A 4B9SA 2HMIA 4MKAA 4ELUA 1RT3B 1VRTA 4O3RA 3RR7A 3UDLA 3IGVA 3L2WA 1S97A 4KHRA 5JUMA 1ASWA 1C0UA 3V6DA 3VQQA 4KPYA 4YR0A 4Z4FA 3LWMA 5C5JA 3MFHA 4BDZA 4FBUA 4IG0A 4DLGA 2CKWA 2HHQA 3KTQA 3OL7A 1X9SA 2KFNA 3P1GA 4DQIA 1WAFA 4ZP6A 4FM1A 2YHAA 3ZCMA 2EHGA 1HYSB 3M8SA 3OYFA 4J9QA 3KK2A 4Q43A 5EU7A 3C95A 3THVA 1RTHB 1RTJB 2YNHB 2RF2A 4IFYA 2RDJA 1IH7A 4QAGA 4BDYA 2FVCA 1VSHA 4B9UA 1TV6A 4B9TA 3KKSA 4K4UA 3KNAA 4CEZA 3DLGB 3VQPA 2C28A 2WK4A 3DMJB 4XIUA 1VRUB 5CYQB 2AGOA 1TKZB 4ZPCA 3AVJA 4IG3B 4ZVFA 4ZVEA 4I9QA 4E7HA 1WSIA 3K58A 3KLGB 1IKVA 4DSLA 1K1QA 1G15A 3PW5A 2QKBA 1B92A 3KD1E 4HUGA 5KG2A 4ICLA 4M3TA 4RW4A 1WSGA 4J2EA 4WFXA 5KFYA 4KSEB 3RB6A 3UIQA 4IKFA 3BGRB 1VSJA 1IKWA 2AQ4A 1MMLA 3P83D 4EZ9A 3CJ5A 4LH5A 3FFIA 3MECB 5JS1A 2D41A 4F4XA 1Z4UA 4ECXA 5J2MB 3OYBA 1HJRA 1VK0A 3CG7A 4KKOA 3QIOA 4IFVA 2ALZA 3QETA 2R2TA 4WFYA 4J9SA 1NK5A 1K1SA 3T5LA 3AO3A 4MK9A 4FJGA 4B3OB 4QWBA 1RDRA 2DTUA 4HUFA 5T14A 1ASUA 3V1OA 2HVHA 5F9NA 3V6KA 1Q9YA 1RT5A 1T94A 5DGAA 2I1RA 1TKTA 2WCXA 1RT4B 1S4FA 1JLEB 4TQRA 5EDWA 5KT6A 4DTPA 1EP4A 4NRTA 2JEGA 4EO8A 2XGPA 4M42A 4DSKA 4DSFA 2YKMA 3M9NB 3Q8QB 4K4YA 4EBDA 3LDSA 1SH3A 3LAKA 5KFIA 4MQ3A 5J1EB 2ILZA 4DG1B 1N4LA 3HYFA 4ECWA 3AV9A 3LP0A 3PY8A 2IAJB 5D3GA 3RAXA 1BI4B 4O4GA 3EZUA 1SV5B 4RUAA 4CEQA 1TVRA 3L2UA 2IA6A 2ASJA 3IG1B 4U6PA 5KGXA 3DM2A 3NF9A 3GV5B 2R8JA 1S0OA 2Z1JA 4GVMA 4ID5A 3ZSXA 3HKWA 4FJ9A 3GQCA 3QZ7A 5I3UB 3I0RA 1VSEA 4Z4IA 2JC0A 2D5RA 4CECA 5T7BA 3EZ5A 2KFZA 1S10A 2ITGA 4CJWA 1C2PA 4QPXA 4CFBA 1ZTTA 1L5UA 4JV0A 3LP2B 1JLBA 1X9MA 1NJYA 2VG7A 1DTQB 1IO2A 2OYQA 2AGPA 3CWJA 4RW6A 4IDKB 4CIFA 4EZ6A 3NE6A 3AA3A 1C0MA 2X74A 1FKPA 4DL2A 4JLHA 4DLEA 2ATQA 5KG6A 1TL1A 3VQCA 1NJXA 4E7IA 3PX6A 4C8NA 3H5XA 4H4OA 3K57A 3KLHB 3NH2A 3KK1B 1FXXA 2WRMA 1RT1B 1S9EA 1RTIA 4Y34A 4IH6A 3SI8A 1WN7A 4ED7A 3JSMA 3ITHA 3GYNA 1D9DA 3K5OA 1NOZA 4J9KA 4MKBA 3PUFA 5KG1A 4MFBB 4O3PA 2W8KA 1RCHA 4FLUA 3MR6A 5KT2A 3OLBA 4Q0BB 1RBTA 2XCAA 3RWUA 2BANA 4CJFA 1RT7B 4NCGB 2FVPA 3DLEA 3AO2A 2IDOA 4TYBA 4HKQA 4M3XA 4NYNA 1S1WA 4K4XA 3DOLA 3NCIA 1CZBA 1XHXA 4DL3A 3SQ4A 4ED6A 4OLBA 4FW2A 3QEWA 3CJ2A 1QE1A 5HLFA 1O1WA 3G6VA 4ED0A 4M3WA 3T3FA 4E0DA 3PVXA 4FJXA 3QEVA 3ICLA 5E41A 1C1BA 4NCBA 1TL3A 1LAVA 4JUZA 4KTWA 1A5WA 3OL8A 1L3SA 3OHBA 2C2EA 3O3HA 3OYMA 1JLAA 3MF5A 1NJZA 1RT6A 5KFUA 4JS5A 4N5SA 4CJTA 3HVWA 5KFDA 3RBDA 1SKSA 4ZHRA 4CF0A 2RDIA 1WSHA 1T05B 3CM5A 1REVA 3DRSB 3OS1A 4CJUA 1W25A 1S49A 1S1VB 3NF8A 2WHOA 3KLFA 3DLBA 4C8OA 4IRCA 3QIDA 3TAEA 4JRPA 1RDDA 3OL9A 5F8NA 2AU0A 1QAJA 2E4LA 5CYMB 4Y2CA 1LAWA 1NHUA 2XRIA 3TAMB 2P51A 3DYAA 2W9CA 2Y1IA 3KJVA 5KFVA 4J9OA 3E51A 4J2AA 3QYYA 2FJWA 3KK3A 4F2RA 1S1UA 4ZPBA 1S1TB 4KB0A 2HNZA 3PW7A 5J2PA 2G8FA 4KO0A 3MEGB 4W5QA 4XPEA 2VA2A 1FK9B 2P5OA 5KFJA 2BQRA 3MAQA 3CJ0A 4OPKA 2BQUA 1CLQA 3TANA 2A1SA 4FCYA 4FZXC 1QS4A 3VQDA 5HRNA 1TK8A 1JLGB 4RG8A 4RU9A 3NMAA 1NK6A 5F8GA 1JLCA 4KREA 5JXSA 2G8WA 2YNFB 2DY4A 1HPZB 1A5XA 3KIOA 4CFAA 3OYEA 4C8KA 1HQUB 3OSNA 4EEYA 1JKHA 3SPZA 4HHTA 2WONA 5DQGA 3CQ8A 5J2QA 3KLIB 2IM3A 1JLFB 4WZMA 1FKOA 4GC7A 1R0AB 4LY7A 2E9TA 1SL0A 1XC9A 3TAPA 4CGFA 1NKCA 1HARA 3I8DA 1ZYQA 3ULDA 4MIAA 1KRPA 5KFLA 2R8HA 3QIPA 4J9MA 4DQSA 4NLYA 1QHTA 4OGCA 3KMSA 4KFBB 5KFCA 4CJRA 1T03B 2W42A 4AHSA 4JS4A 2HHUA 1WSJA 1LW0A 1DLOA 4IOBA 1LWEA 3ZSOA 3LZJA 2IC3A 4XPCA 5KFTA 3QEXA 1LWFB 3OJSA 1XWLA 4CF1A 3ZT0A 4WE1A 4FJJA 1EETB 4NRUA 4DTOA 4C8MA 5C42A 1N5YA 1KVAA 4E1MA 4QWDA 4C8LA 5HROA 3NBPB 4DF4A 1IKXA 3BDPA 3MEEB 4DL7A 2RKIA 1NK4A 2HHTA 5J2NA 3FQKA 3OYDA 1LW2B 1TQLA 4F50A 1F21A 1HQEA 2VG5B 3LP1B 1TP7A 4EBCA 4YMEA 1C1CB 2EX3A 2W9BB 5FDLA 3T5HA 3DDKA 4RW9B 3L2VA 4KHQA 4CF2A 2OPQB 3RB3A 4K4TA 2C22A 4BWJA 1LWCB 2R8GA 4FLWA 4TY8B 4FJIA 4W5NA 2HNYB 2V4QA 4N41A 4M94A 1GX6A 5KGWA 4FZYA 4CGJA 1RBSA 1HMVB 1N6QB 3RMCA 3HVTB 4J9RA 4R5PB 2VG6A 4B9MA 2R2UA 1UWBA 3H2LA 1S9GA 2B6AA 3HL8A 1HNVA 1KHWA 3IGNA 1SUQB 3E01A 4F4ZA 1SH2A 2PY5A 4DU1A 2ZD1B 5HRRA 4CHPA 4LSLB 2HNDB 3IAYA 4KHMA 4I2QB 4IQXA 4LSNA 3QEIA 4CF9A 2BE2B 1W9HA 3BSOA 4CEDA 3NFAA 3H5SA 2XI2A 4OL8A 4ELVA 3NH1A 3PHEA 2FBXA 4PWDB 1DTTA 1IKYA 2YNIB 1IM4A 4MIBA 2WTFA 2BRLA 4WYLA 1VSIA 3HO1A 5C25B 5KFZA 3GIJA 1JIHA 3C6UB 3VA0A 3PW0A 3QNOA 3V81B 3DI6A 4CFDA 3D0PA 2OPPA 1SL1A 5HBMB 4R8UB 5HP1B 1U4BA 4B08A 1HNIB 4M95A 1ZBLA 3AO4A 3H59A 4NLVA 4K8XA 3NDKA 3GV7B 3NAHA 4DSIA 3BQ2A 2V9WA 3PV8A 5KRSA 3S3NA 2YKNA 5KFRA 2GIRA 3WNHA 3NAEA 5L1IA 3K59A 3C6TA 1UOCA 3KKRA 1KVBA 4DSEA 1BISA 1RDAA 4FS2A 2E6LA 2XC9A 2Q3SA 4W5TA 3AVLA 3KOAA 3G86A 4IRDA 1B9DA 4CGHA 4KBIA 1S6QB 4IR1A 2XCPA 4TLRA 5CZ2A 4ZPAA 1L3UA 1U09A 1ZBFA 3KHRA 5SZTA 2G8HA 3VQ6A 2E6MA 4FJHA 1HYSA 1TAUA 4AHUA 4FLTA 2I5JA 3HT3A 3KLVA 3MR2A 2OZSA 3G6YA 1RTJA 4CIGA 4DFJA 3OJUA 3FRZA 3TVKA 3Q8SB 4AHTA 1BCMA 4CIEA 3T5JA 3AVBA 4YR3A 2FBVA 1I6JA 3OYLA 1JX4A 4HUEA 3SCXA 4MH8A 1C6VA 4Q44A 3DMJA 2UUWA 4ED2A 1VRUA 3HM9A 5CYQA 1TKZA 1IKVB 4IG3A 3QGIA 5F8JA 4FLVA 2UVVA 4E89A 3KLGA 2OPRB 4Q8EA 1N56A 2G8KA 4RW4B 2RPIA 3MEDA 2FVSA 2AX1A 5KG4A 2VWKA 4CGDA 1IKWB 5L1LA 4FJ7A 3BGRA 2HAIA 2ZE2B 4WXOA 1S9FA 1N48A 3AVKA 2B5JB 3D28A 1YTAA 3CM6A 4PY5A 4KKOB 4IFVB 2J6SA 2UVUA 5J2MA 3FQLA 4J2DA 1S6PA 1KLMB 1U04A 3N6NA 3HK2A 1KSPA 3IS9A 1J5OA 5SWMA 4TN2A 5KG0A 3B6OA 4CK1A 2IJFA 4FJ5A 3HHKA 4KV8B 5C24A 3CFPA 3KMQA 1RBVA 4NLXA 3ZSQA 1NK0A 3V9ZA 4FK0A 1RT4A 1GX5A 4H8KA 3ZT3A 1JLEA 4W5OA 5EWGA 3IRXB 3OYKA 4J9NA 3QLHA 4YNQA 3CDEA 5L1JA 1BGXT 5DG8A 4Y1CA 3LP0B 2O5DA 4DG1A 3DLKB 4OKJA 5D3GB 2XGQA 2V0NA 5HRSA 4FJNA 2IBKA 3CFOA 3AA2A 1BI4A 4RNFA 1SV5A 2AJQA 1RDCA 1U45A 4FLXA 1KLNA 4EP4A 2D0BA 2F8TA 1TKXB 4GW6A 3U3YA 2IM1A 3GILA 1QUVA 4ECZA 4O55A 2KZMA 1JLBB 3F9KA 3H08A 2VG7B 3EPGA 4CFCA 4O4RA 4O3NA 1TK5A 3LP2A 4DQQA 3I5BA 3AVAA 4E7KA 3SYZA 3TAFA 1WSFA 4O5BA 1TL1B 4MK7A 1NKEA 1XR7A 3H5UA 2DFEA 4ED1A 4NLSA 4QWEA 4J9LA 3NGDA 4ZTJA 2F96A 1S9EB 2WOMB 3KLHA 1ZTWA 1Z26A 3S9HA 3DRPB 1RT1A 3JSMB 3ITHB 4NLGA 4IKAA 2QKKA 4TQSA 1Q8IA 4MFBA 1NNDA 2C2RA 5KI6A 1RT2A 4O3OA 3ZSRA 3NH0A 3DLEB 3RB4A 4DTRA 4RW8B 5DLFA 1VSFA 3L2RA 4B9VA 4H54A 1YVFA 4DTJA 4NCGA 4TXSA 5JS2A 4KB1A 3DOKB 1BHLA 5KFPA 3ZSVA 2C2DA 4OVLA 3PJWA 3PO4A 1QE1B 5HLFB 1RTDB 3P5JA 4KI4A 1JXEA 4M3ZA 4ECYA 4BE0A 4RNNA 5KFGA 4ZMMA 3TR8A 3QZ8A 3O3FA 3S3MA 5I42B 1GOAA 4AHRA 1CXQA 4CE9A 3NL0A 2IOCA 1C1BB 2HWIA 3NF6A 2AX0A 4CHNA 5KFHA 1Q9XA 2F8SA 4DWIA 5CZ1A 4WFZA 4KRFA 3T1AA 1NHVA 3G10A 3QERA 4K50A 4I7FB 3Q8RB 3SQ0A 2Y1JA 4LQ9A 4QWCA 4LQ3A 3M8QA 3K5MA 3V1RA 2KQ2A 1HRHA 1S0MA 3ZT2A 2J6UA 3CIZA 1XI1A 3WNFA 4KHSA 3HPHA 1JLQB 4O0JA 4RUCA 3TABA 1QSYA 2ETJA 3AO1A 1T05A 3M8PA 2AGQA 2FJXA 4ID1A 5KFKA 1JL2A 3G6XA 1S1VA 3V9SA 2ASDA 4RZRA 1SKRA 4FJLA 2UVRA 5F9LA 4DSJA 4E7LA 4H4MA 2GIQA 2NUBA 2BR0A 4O3QA 4KHYA 4CGIA 4FM0A 3GIKA 2GBZA 4CJEA 3AO5A 1JXBA 3DYAB 2FC0A 1UA1A 3KJVB 4ZP9A 2BGGA 1D9FA 3MFIA 4PUOB 2XY7A 3TWHA 3U3GA 2FLLA 2HNZB 5KFXA 4EBEA 3C94A 3OHAA 4CJ4A 3Q8PB 2HHSA 3H4BA 1EXQA 2D3UA 3V1QA 2IS3A 1FK9A 4KAIA 1X1PA 1W0HA 4URQU 4E7JA 1VSKA 3VQBA 2JEJA 4NLOA 3M8RA 1SKWA 3VQ4A 5KG5A 2IMWP 1JLGA 2KZZA 4O44B 1JLCB 3V9XA 1WLJA 3SJJA 3ZSWA 3JYTA 3O3GA 4TSXA 3SV4A 2PYJA 3NHGA 2HHVA 2YNFA 3V4IB 3HP6A 1D1UA 4FJMA 1QQCA 4JRQA 3TAGA 1HQUA 3VQSA 2WONB 4FLZA 5EUHA 1Z25A 3QO9A 4FS1A 2JEIA 4RW7A 3IN5A 4K4SA 5CY4A 4CJSA 5KTQA 4CF8A 2OH2A 1MU2A 4Q8FA 3KLIA 1C0TB 5DQHA 4DFPA 1R0AA 4PQUB 5KT5A 4WXWA 4J2BA 3T5KA 2D3ZA 4BE2A 2QE5A 2Z1IA 2R2SA 3RBEA 4DTXA 5KT3A 4KI6A 1WAJA 4QCLA 5FROA 4FK4A 2YNGA 3K2PA 1LW0B 3VN5A 4Z4GA 1LWEB 3LALA 2IC3B 4Q5VA 1BQMA 1A5VA 4DL5A 3NF7A 3EY1A 2LSNA 1YT3A 4K4WA 4CCHA 3SUNA 5HROB 2FJVA 4NLWA 3OY9A 1ASVA 2RKIB 2X6NA 3NBPA 1TKDA 3HVAA 3SUOA 4NYZA 1L3TA 1BIUA 4CHZA 3MXIA 4B9LA 1EKEA 4HTUA 2HHWA 1RYSA 3PR5B 4AHCA 2DFFA 5FDLB 3O4NA 4OJRA 1C1CA 4E19A 5DGBA 4HVJA 2ILYA 2P5GA 2W9BA 2DPJA 3VQ5A 3AVCA 1BIZA 3GV8B 5DMRA 2OPQA 5FRMA 3KHLA 3CVKA 2OPSB 4TY8A 2HNYA 4BE1A 2OZMA 4KHNA 3AA4A 4LH4A 2VG6B 1HMVA 4Z4HA 1N6QA 4HYKA 3HVTA 1S9GB 4R5PA 4DTMA 1BQNA 1CZ9A 4ZVGA 3SQ1A 3MTKA 4DU4A 4I2PA 3MXMA 2BDPA 2FBTA 1SUQA 1UA0A 2A1RA 1L3VA 2ZD1A 2J6TA 1GOBA 3GIMA 4NYFA 1NOYA 4LSLA 1KVCA 2IGIA 2HNDA 2X6SA 4I2QA 4HCCA 2GUIA 3OYIA 3DRRB 3CFRA 4FJKA 1RAJA 4ECRA 2FBYA 4G1QA 1CSJA 4HCBA 3OS2A 4DS5A 3CDWA 3HSTB 5K14B 4GMJB 4DU3A 4PWDA 4FXDA 2UVWA 4CK2A 4CGGA 3NAIA 4FYDA 3I0SA 2W7PA 2BRKA 3CJ3A 1X9WA 5C25A 1ITGA 3DLHA 3C6UA 4O0IA 4CJKA 2FVRA 3H4DA 3BQ0A 1S1XA 1T3NA 4I9LA 3V81A 3KLEB 5HBMA 4QWAA 4F8RA 5HP1A 3GIIA 4ECQA 4ZP8A 4EO6A 5KFBA 2HMIB 3CYMA 1HNIA 3OYHA 1RBRA 3H5YA 1VRTB 3ISND 1RT3A 2P1JA 4Z0UA 4FK2A 1C0UB 3C6TB 3V6DB 3M9MB 3TAQA 2W8LA 4IG0B 1S0NA 1Y97A 2RN2A 4Z4CA 2DPIA 4NLDA 4NCAA 2W7OA 3MR3A 4R0EA 3VQ7A 3BSCA 2AWZA 3KK2B 3SI6A 4JV2A 2O4GA 3HPGA 1BCOA 2HWHA 4J9PA 2XHBA 1S6QA 5KFFA 4DL6A 3TQ1A 2RF2B 4B8CA 1RTHA 4IFYB 1T8EA 4DTNA 2I5JB 2YNHA 3M9OB 2FLPA 2R7YA 1TV6B 1HYVA 3QGGA 5KFAA 4ED8A 2EC0A 3H40A 4IRKA 4ZTFA 3DLGA 1GOCA 2O4IA 3D45A 1K6YA 2JEFA 4YR2A 3SV3A 3ZT1A 3AA5X 3NGYA 4KE5A 4ICLB 5KRTA 1I3AA 1U49A 4DQRA 1YTUA 2R8KA 3HJFA 5KFSA 2B4JA 2G8IA 2G8VA 2JC1A 3MEDB 4TYAA 3L8BA 2OPRA 2QK9A 1BL3A 3ASMA 3SZ2A 2R2RA 3FFIB 4AHVA 4NLQA 3QGHA 4GC6A 3LP3A 4YFUA 3BQ1A 3MECA 4AILC 4CEOA 4QW9A 1HYZA 4DF8A 2ZE2A 4NLPA 3RB0A 2B5JA 4EYIB 3UPFA 1RYRA 1S6PB 4CJVA 4B3OA 1KLMA 4ECSA 1RT5B 3IS9B 1J5OB 1TKTB 1TAQA 5C24B 4N47A 1B9FA 2YHBA 1WSEA 1EP4B 4K8ZA 1RDBA 3OSPA 3EPIA 3WNEA 4KV8A 2YKMB 2V4RA 3PW2A 5DG7A 4ED3A 4UQGA 3VQ8A 4EYHB 4B8AB 3TI0A 4KB7A 1KFDA 5J1EA 3QLHB 3ZSYA 3IRXA 1OS5A 3UQSA 1XR6A 3FSIA 2CJQA 4O4GB 5DK5A 5KT7A 4OGEA 3V6JA 1TVRB 4F4WA 2ZQBA 4EP5A 2IAJA 3DM2B 4RNHA 5KG3A 3IG1A 3DLKA 4K4ZA 4KTQA 3AVIA 2HVIA 4ID5B 3N6MA 3I0RB 5F8MA 4DMNA 2ZKUA 2Z1HA 3K5NA 5I3UA 2HW3A 3SFGA 2XWYA 1NK7A 1RNHA 1TKXA 5KFQA 4RW6B 3FDSA 3RMDA 1DTQA 4KHUA 3SPYA 4IDKA 3KHHA 1FKPB 4ZVHA 1J54A 3V9UA 4XO0A 3LPTA 1IG9A 3MR5A 3NKYA 3KD5E 4N76A 4QOZB 4H4OB 4K4VA 3MXJA 4DFKA 4KHWA 4E1NA 1RTIB 3KK1A 3HXMA 3HP9A 4ELTA 5EWFA 1VSLA 4URSA 4F3TA 5KFEA 4M45A 4X2BA 2WOMA 4NLRA 1KCFA 3BSAA 3DRPA 2BANB 3AVMA 3LWLA 4KTZA 4F4YA 1S5JA 4Q0BA 1S1WB 2X78A 1RT7A 3DOLB 1RT2B 5KG7A 4AH9A 4OPJA 4L8RB 3OL6A 1WNEA 2ASLA 3PX0A 1QSSA 4CESA 3RRHA 1UAXA 4RW8A 3PX4A 1KFSA 4PA1A 3PR4A 2E9RX 2OA8A 5L9XA 4Q45A 1JL1A 3DOKA 1U48A 3S3OA 5F8HA 4DEZA 1NKBA 1RTDA 4DQPA 4DTUA 3PO5A 3ISNC 1TL3B 3UR0A 2D7SA 4CEEA 4NLUA 3QINA 5I42A 3CDUA 1QTMA 3V9WA 2F8EX 2R8IA 1VSMA 3PZPA 1EX4A 1JLAB 5F8IA 1RT6B 4OKEA 5F8LA 3AVFA 4N56A 4ZHRB 3M8QB 3OS0A 4I7FA 1REVB 2VA3A 4FLYA 4IR9A 1ZBHA 3DRSA 1TGOA 4M3YA 3I5CA 3K5LA 3KLFB 4NZ0A 3M8PB 3L3UA 1JLQA 5KFOA 4CHYA 2XY8A 2HB5A 5KT4A 1SH0A 3H98A 2IM2A 4ZP7A 4U7CA 2PZSA 4B9NA 4H4MB 1D0EA 4LD0A 1D8YA 4CJ5A 2W9CB 5CYMA 3LZIA 3TAMA 4FM2A 2E9ZA 3KK3B 4M3RA 1S1UB 5KFWA 5DLGA 4IBNA 4CEFA 3L2QA 3B6PA 4YQWA 1I39A 5J2PB 5EWEA 4KO0B 1S1TA 4ZPDA 1S48A 2BQ3A 4PUOA 4CJPA 3OVNA 3MEGA 3RMAA 4CJQA 5HRPA 2D0AA 2IJNA 3BREA 1J9AA 3V6HA 3RRGA 4BACA 4JV1A 4Y1DA 3AVNA 1ZETA 1LV5A 4G3IA 4FBTA 4ECVA 3I5AA 4F2SA 4O3SA 2ATLA 4URGA 1JXLA 2QV6A 3DLRA 5KFNA 4CEBA 2XY6A 3PJXA 3L3VA 3JYTB 4YP3A 1HPZA 3OYNA
chains in the Genus database with same CATH superfamily
4LVNP 1TFWA 2VYPA 4YEAA 1JKHB 2WBNA 4AFFA 3T19A 5J2QB 3EGZA 1FKOB 2WSCC 1JLFA 3D66A 3VQEA 1Q5VA 2ZNYA 5AXKA 3L7PA 4RCHA 5DG9A 1TZ0A 1YJ7A 3BZKA 1D5AA 4XDCA 4NZ6A 2RAQA 4IH7A 4ZJOA 1TYQB 1KNZA 3GG1A 4KFBA 5BR8F 1LFWA 1DLOB 3LM9A 1T03A 2JDJA 3M1VA 1HHQA 4Y3CA 2VKRA 2WB4A 2MMYA 2DFHA 8AT1B 2B4PA 3BR9A 2E1YA 1UVKA 1YJ9S 5C42B 4OKKA 1GXUA 4YN3B 3BN4A 2ZJPQ 3CJCA 3J7ZO 2ABYA 3TTFA 1B0VA 3BGUA 3CQYA 3BBBA 1PC5A 3LM2A 4Z94A 1KHVA 5B7WA 5BN8A 2RB7A 1LW2A 1WOPA 1I1GA 2VDHA 4PXDA 1R43A 2E7WA 4QW8A 4K25A 2JL9A 1XR5A 1XQIA 2MKYA 4CJLA 2UUTA 4DQ8A 4BDPA 2GQQA 3NGZA 3JSYA 4E3SA 2N7CA 4B1WB 2EXUA 3M6XA 1LNQA 4DS4A 1UVIA 3RTVA 3C66A 2QWRA 2AMCB 2E1CA 3R97A 4DV5K 3R6GB 1FXRA 2QL5B 3W5XA 3T41A 3E01B 2PYLA 3OTCA 3RSEA 3OLAA 3LPUA 4P75A 1OYEA 1BQNB 4AE5A 1U1NA 2DXDA 4CNYA 2BE2A 3WUHA 3T9ZA 4B3RJ 1DTTB 1OIAA 1AFJA 4FWRA 5LT5A 4YHHJ 3LW5C 4ED5A 2LCWA 4ERDA 4M3UA 3LDOA 2GV1A 3UN5A 1DQAA 4FYVB 1NK8A 2OFHX 1XMOJ 4O8UA 5C2GA 3VALA 2IIHA 2BJ1A 2OPPB 4CHOA 4MK8A 4CERA 1R27B 3D9BA 3WQTA 4CTAA 5KQDA 2W25A 4DN9A 4DR5K 1SC6A 2FLNA 4ZCIA 5ADZA 5AQMA 5BXIA 4M5NA 4JYAJ 2HMIA 4MKAA 4ZPVR 1VRTA 3KXDA 2JZ5A 4EFAC 3AHPA 3OFEA 3L2WA 3R8EA 1S97A 4KHRA 5IV3A 1C0UA 4YR0A 5C5JA 2PFUA 4FBUA 4IG0A 4DLGA 1X9SA 4M7XA 3P1GA 2GJIA 2F40A 1YJNS 3WXMB 4ZP6A 3VAHA 4FM1A 1HYSB 3GYXB 4PXEA 3OYFA 1R8HA 4DUYK 3ZTQA 3THVA 1TMMA 1RTHB 3TX0A 1WD6A 1IWGA 4ZVTB 4DR4J 3RJMB 2FVCA 1HLWA 4B9UA 4B9TA 4BR7A 4CRJA 4QIWD 4CEZA 3DLGB 4OYWA 3VQPA 2WK4A 5B0FA 2AGOA 2G0JA 1K8AT 2ZVSA 3MPWA 4ZVEA 4I9QA 1RCXB 3QRQA 1SZ2A 2XWXA 2OAUA 4Q2LA 3KLGB 5IV4A 3PW5A 2UYTA 3ZO7A 1JJ2M 1S77D 4M5LA 5IWAK 1P9QC 2RHSB 4OJHA 4I0WA 5KFYA 2IVOA 1P9YA 2B4UA 4CZGA 3VEOA 3RB6A 3UIQA 4IKFA 2GELA 5D0EA 4QPTA 1MMLA 1X4BA 4JI8F 2QA1A 3MECB 2CNLB 2HBYB 1Z4UA 1VC5A 2K06A 3DXMB 5J2MB 1M5SA 4OYPA 4KKOA 3QIOA 1WACA 4IFVA 3QETA 4FVUA 4MTPA 2R2TA 1GLLO 3ENVA 4RL1A 4NXMK 3T5LA 5LMUJ 4B3OB 4QOTA 3W5ZA 2WVBA 1KAZA 4GKKF 2HVHA 3V6KA 3DHWC 1Q9YA 1RT5A 4NLBA 2MKJA 5DGAA 2X1FA 3N5BA 3U7JA 1RT4B 4JI5K 3IDHA 1ROFA 2UUAJ 1JLEB 1GLCG 3VQTA 3P3DA 1FFWB 1EP4A 5EDWA 4L3NA 3MMJA 4EO8A 4USVA 4BLGA 4Y28C 3VOVA 1FWPA 3Q8QB 1K8AO 4RBTA 2FY8A 5J1EB 2ALYB 3AV9A 3LP0A 4O23A 5AQTA 3PY8A 1T9XA 5D3GA 2CIMA 5E26A 3BPDA 3EZUA 1SV5B 1TVRA 3IAM9 3ENQA 2ASJA 5A2QU 5D0GA 4NASA 4JD2A 3DM2A 3GV5B 2PI4A 3EGVA 1OH8A 4YDUC 4WYBA 4ID5A 1BA0A 3GQCA 4X64K 5I3UB 3I9ZA 2ZH3A 4LIRA 4BGAA 4Z4IA 2JC0A 4CECA 4CJWA 4I6MA 2KU7A 1C2PA 4H0YB 4KH6A 5GAHP 1ZTTA 2C2ZB 4JI7J 2BACA 3A3NB 1JLBA 1X9MA 3O9UA 5HL7L 4LRBA 1LQ9A 3CWJA 5G0RB 5GAHI 4CIFA 1C0MA 3CCRN 2X74A 3DU5A 4JI6J 4JLHA 3HI0A 2ATQA 1TL1A 1FRKA 5EXWA 4H4OA 1CG2A 3KLHB 2F4VJ 2ZH4A 1XNRK 1FXXA 4Y0WA 4ZJQA 1VQOS 1S9EA 4UZBA 1M1GA 3THWB 5HMYA 3JSMA 3ITHA 4LR8A 2HZCA 5DM7Q 4FO0A 2W8KA 4FLUA 4F67A 2M5YA 4GV6A 3P8BB 3QFWA 4E2FB 3Q7BA 4LF8J 5D4LA 3THYA 4OHVA 1UPMB 1S99A 5JLHA 2IVNA 2P5VA 3RWUA 2BANA 3GP9A 2UZAA 2H3GX 1O5JA 4ANDA 3JTPA 3SQ4A 4ED6A 3BV8A 2E2QA 3CJ2A 5HLFA 1NGHA 3VESA 4XEIA 4LF5K 3G6VA 2IJRA 2RS2A 1JNRB 3L95X 4ED0A 2WUSA 2YBVA 2NRTA 3GJRB 3VEWA 2P9KB 2XULA 3U8XA 3ICLA 2HFVA 4YDXA 2JWKA 3D2EB 4ZOSA 4CZCA 4IOCQ 3H0PA 2QSFA 2A3JA 2H51B 2LDYA 5ETRA 3ADAC 3OYMA 4F26A 4DCOB 4EAHD 2E5IA 2CPHA 3BKTA 4MO4A 1AB8A 1SKSA 1SI9A 1ZA2B 1WSHA 5AZJB 2LQ8A 1EKRA 3OS1A 4CJUA 3R1HA 3O9SA 1S49A 1S1VB 3Q22A 1Y3JA 3K0SA 3CJTA 5AXNA 2DHHA 2EFVA 1IWAA 3QIDA 2IVFB 1RDDA 1V3SA 1WDDA 3TEGA 3G71S 4ES1A 3R5JB 4FWSA 1RISA 1LAWA 1NHUA 5LSRA 3AOCA 4J9OA 1S3XA 1KQSR 4ZCKA 3DC2A 3KK3A 4Y2MA 4F2RA 5C0YA 5D8HB 1IQZA 1Y0HA 1H3DA 3MEGB 4I6AA 5KFJA 4CM0A 2XEXA 2HHHJ 2NXUA 4CQ1A 3HOSA 3TANA 2WC9A 1IJFB 3SEOA 1JLGB 2EPIA 2FHJA 3MAAA 3I56S 5L8RC 3ETMA 1HBOA 5F8GA 5IT9O 1JLCA 1NB2A 4DV5F 4DMZA 2CQ4A 2E88A 4A47A 1VJQA 1HPZB 3SCKE 2XM3A 3KIOA 2GHVC 1GLDG 3VWSA 1NMNA 2ZGYA 2VPWB 4I1TA 4W90B 4OHZA 1Q8KA 1SB6A 3M2UA 1R0AB 1ZA1B 4LY7A 4KH0B 3CF5L 4CGFA 5DDRC 4GKJF 2ZBPA 1LK7A 1PAEX 2GNKA 4FXWA 1ZYQA 3I8DA 4MIWA 4MIAA 4QIFA 5IQQA 4OI3A 4J9MA 3R3TA 2M3DA 2EFGA 1WOQA 4CJRA 4YOVA 2AJ4A 1WSJA 1LW0A 4IOBA 3DAWA 1LWEA 3VHQA 5LOQA 2DY1A 3CD5A 4C23A 2GGPB 2ZGZA 3ZT0A 4WE1A 4JI2K 1EETB 4C8MA 2QEXN 3C14A 1BLUA 2IRXA 1KVAA 2P9NB 4E1MA 2A5XA 1EZZB 2ERRA 3CJBA 3CJQA 3MEEB 5AQOA 2GHPA 1TQLA 4RBUA 1HQEA 1PIEA 1C1CB 4L75A 2E2OA 5GMDA 3QJLA 3T5HA 4EWTA 3S1TA 2OPQB 1H2VZ 3RB3A 2V69A 2C22A 4AF1A 1VK3A 1LWCB 1D8ZA 2DNLA 4GVLA 2R8GA 3UD5A 2HNYB 2V4QA 1KD1T 4LR7A 2AEMA 2F7TA 2DXEA 1ZXOA 4DV3K 1MN7A 3CCRS 3HVTB 2WBRA 4E98A 4J9RA 4B9MA 1CLFA 2LQ9A 1HNVA 5LL6Z 3B8AX 5HRRA 4JBCA 2HNDB 3S6EA 3QEIA 5FIIA 3CJKB 3BSOA 4DUZF 4JOUA 2RVJA 2P9PB 2FBXA 2N7YA 3HULA 2YNIB 2HGNA 1WC5A 5C25B 3GIJA 3G4SN 2M9KA 2HQ3A 2OCEA 5BR8J 3IC1A 4X62F 4ILGB 4OZ1A 1ZM2A 5HBMB 4R8UB 5HP1B 4OYXA 3GV7B 1SXLA 3WX8A 1MROA 2W2NP 2G13A 4DSIA 2YKNA 3FGUA 3POTA 1ZC6A 4FDFA 3J81U 3K59A 4DR7K 5HQMA 1UOCA 3O9RA 1U2VA 2E6LA 2Q3SA 3A1YG 3FBBA 3CCTA 2JNJA 3IWNC 5E33A 3MI7X 3KOAA 2RQKA 4DX8H 1U0HB 2CPIA 4USKA 4H0TB 2ZJRL 1B9DA 4CGHA 4KBIA 4CLUA 4X4SA 2PE8A 1IQTA 3KWGA 1IBMF 2O8CA 2XCPA 3PIPL 4ZPAA 2GVZB 1I94F 3VQ6A 2XSJB 3T1YK 1VS3A 1TAUA 3DGVA 4XH4A 4DFJA 4CIGA 2CJXB 3TVKA 3AOBA 5B0EA 1Y11A 2VFSA 3P45B 4KPCA 3T5JA 4CYUB 5FD1A 1I6JA 1R8PA 3OYLA 1W7AA 5IM0A 3SCXA 4MH8A 2XMVA 3IWXA 3HM9A 3B78A 1TKZA 1IKVB 4E89A 4CBWA 1PBUA 2CPJA 3C15A 1K44A 2OPRB 1N56A 2GWJA 3MEDA 2WW8A 2FVSA 2RUGA 2AX1A 4JKBA 3HKZD 3TYTA 1OMSA 4KY3A 4JB8B 5HJYA 1IKWB 1GMVA 2PEBA 1SIWB 5L1LA 2O8FB 2KT2A 2Q97A 2W4DA 1NLKL 3BGRA 3SDEA 3ID8A 2CJBA 2MZSA 1H98A 2B5JB 2CQPA 1N33F 3D28A 3I33A 4PPZA 2UXBF 3JSRA 3UE2A 2J6SA 2UVUA 1WC1A 3B54A 2NRVA 5AZIB 3K2YA 5CR4A 3MM8A 3CXCR 4P73A 2AJ1A 3MCNA 5SWMA 3OHRA 4LBPA 4CK1A 4U67L 3V2UC 3HHKA 4KV8B 3CFPA 3H46O 3P6YC 2MGZB 4FWLA 3SCIE 2DCUB 1NRKA 3M8WA 1K9MT 3I82A 3T1HF 3QLHA 4KYZA 2KI2A 5DG8A 1FE4A 2KT5A 2VQEK 3DLKB 4OKJA 1HKBA 2KVQE 2PIIA 4DR1K 5M1FA 3QT8A 1KOOA 2QEXS 3QICA 4H5WA 2VOOA 3OTDA 3VAIA 2FF3B 4K5RA 3A5LC 5CZVA 4N8OA 2ZJPL 1EWQA 1Y3KA 2F8MA 5C7PA 4ECZA 4O55A 3H08A 5A0YA 3EX7B 1S7HA 2HS3A 2DPNA 4X66K 4CFCA 5D4PA 2ZC4A 1HI1A 1FX2A 3AVAA 4HEA9 4BROA 1EKSA 4E7KA 5BREA 1IJEB 3FSXA 1KC8O 3P38A 1FKAF 1M5HA 4RPFA 1VIXA 4A48A 5H9EK 1XR7A 3H5UA 1U1KA 4ED1A 1K9MO 5BPMA 3NGDA 1E6VA 1HBNA 4ZTJA 2A3ZA 2XSFA 1ZTWA 3QSIA 2UXDK 3CXCM 4OJ1A 3QGPA 5D77A 3H42A 4IKAA 1QZ6A 2E20A 3PFOA 4GKKJ 2IRYA 4LRFA 1Q8IA 4MFBA 1NNDA 3ZSRA 3NH0A 3J80O 3RB4A 2H3EB 2EFPA 2DO0A 2V34A 4TXSA 3J7AN 4KB1A 1F1BB 4NYOA 1UFWA 4LFAF 4BQLA 4OVLA 3PJWA 3ZYYX 2AHOB 3QPIA 3KKFA 4PCQA 3D6RA 3P5JA 4KI4A 4ECYA 4L3KA 2W6LA 2DH7A 5T7LB 4LF7F 2DEIA 2IDLA 2KN4A 4ZMMA 4TU9A 3M30A 3CMQA 3ZZTA 4AHRA 4B1YB 3QT5A 1UAWA 4NEYA 3WDOA 2JJ4D 4ILLA 1BU6O 2VQFK 2IOCA 1C1BB 4FP9A 3NF6A 2NXEA 2KT3A 3KWMA 2F8SA 4WQ4A 1RQ0A 2HYIB 1F5BA 4FYXB 4I7FB 3Q8RB 2VPZB 1WF1A 1HR0J 2QYGA 4YB7A 3K5MA 4YOWA 3IAS9 4A8XA 1HRHA 1NBWA 2CH6A 2J6UA 4ANEA 1YITN 4KHSA 3L6QA 4MDAA 3TABA 4J7CA 1T05A 2RMLA 4JV5K 2HOEA 2FJXA 3EE9A 1X3NA 3UKUA 2FTRA 1F0XA 2AYBA 4KGVB 3V9SA 1Q7YO 1SC4B 3I31A 4PYAA 1DY3A 4K5SA 2YH1A 4FF2A 3K8WA 4JI2F 2EFNA 4O3QA 1CS4B 1KR4A 5KOWA 2IYGA 2GBZA 1XN9A 3K89A 1JJCB 4JI3K 3MTJA 5CH7B 1Q18A 4R25A 2FC0A 3B6BA 4ZP9A 3R5GA 3MFIA 4H4KA 4PUOB 1MW7A 4CLTA 2FZKB 1T95A 4ZPWR 1K47A 3D6TB 3HLUA 4JKHA 3GE1A 3OHAA 1BE4A 3K7RA 3MHYA 2HHSA 3H4BA 1NGJA 1EXQA 4Y65A 2AJFE 4KAIA 2RD5C 1IV0A 3SAHA 3HFKA 3D2FA 5AE2A 1VC6A 3VQ4A 5B0DA 3MUTP 4DV0K 3ZSWA 2JX2A 2J0XA 2I8EA 3MM6A 2YKOA 5FLXO 1NGEA 2QA4G 1RLDA 2CNKB 3EE3A 4A4JA 4FJMA 3THTA 1QQCA 2QA2A 5L38A 1NMEB 3D0IE 4K4SA 4K0KK 1OSCA 3W8PA 2E1RA 2OH2A 1HD1A 2ZKTA 2RUSA 3UR3C 2KG1A 3T5KA 2D3ZA 2QRRA 3M1VB 2R2SA 3KNGA 1I5OB 5KT3A 2KJWA 4RX6A 2NYIA 2J7KA 3FCHA 4C0BA 2MHEA 1BQMA 1S4EA 2Y9HA 3C19A 3NF7A 2C3UA 2EC2A 5K8OA 4G65A 2LSNA 5HOOA 3F44A 5CYJA 3TNVA 1XERA 5HROB 2FJVA 1ASVA 4KGMA 1XMQF 2ASOA 4OZJA 1GLEG 3HVAA 2GJFA 1TUUA 2ZM6K 3CJAA 4CHZA 2AJ0A 3MXIA 3BH7B 4B9LA 2D4WA 4DB3A 4HTUA 5LM7E 2CWKA 1CQNA 1URRA 5DGBA 4PL7A 2P5GA 2W9BA 2UP1A 3GV8B 1G2EA 3QBWA 4YOUA 3QB0A 3N79A 4BE1A 4FPIA 3RSEB 3AT1B 1DURA 4Z4HA 5EX5A 3MMAB 4DV5J 1S9GB 3PEHA 1SVDA 2QWLA 4ZVGA 3SQ1A 4FKYA 3MN5A 4TLQA 4I2PA 2FBTA 1UA0A 2PDAA 1RDWX 3WEEB 3IFEA 1MWMA 5M1KA 4I2QA 4BR9A 1RAJA 4ECRA 1U1OA 2MSSA 3NMRA 4GKJJ 3HM8A 4LT6A 2J9CA 4DU3A 5DM7L 4CK2A 2L08A 2YVSA 4DBQA 3MDFA 4CTAB 1WEYA 3H8YA 2MLXA 4YB6A 2ZOFA 4CJKA 3BQ0A 1S1XA 1VQ6S 1HNZK 1QQOA 4QWAA 4F8RA 4EO6A 2BTFA 5KFBA 2HMIB 4FWQA 1NUEA 1DKGD 1HNIA 1RBRA 1VRTB 1B0TA 2DNMA 1IBKK 3IA0A 2NZCA 1BA1A 3ISND 2P1JA 4Z0UA 4P74A 4FK2A 1C0UB 1KBRA 4CLSA 4DV2K 2KXHA 1YJVA 4IG0B 1Y97A 4IO9Q 2VJUA 2DPIA 4OYBA 4HHJA 3VZHA 4R0EA 2V2KA 1QLNA 3BSCA 1UW9A 2W2MP 3OVSA 3GE9A 4IOCL 1SC1B 4JV2A 2O4GA 3HPGA 3D0GE 2UU9K 2VFUA 1S6QA 1TUWA 4DL6A 1Y5NB 4B8CA 1GNKA 3AJDA 1RGVA 4UUWA 3OBWA 2YNHA 1YITS 1FVQA 2VQEF 3WXJA 3QGGA 4ED8A 4DUYJ 3GZ7A 2EC0A 2A6OA 1ZM3A 1K6YA 3A5NC 5TKYA 4NEZA 5CCMA 5HI7A 3NGYA 1GTHA 5DDQC 3E9OA 1YTUA 3SBGA 1PG5B 5KFSA 2CZVC 2JC1A 4DUZJ 2PO4A 3L8BA 3CJ9A 4TKTA 2B7CB 4K43A 1AT1B 1QD1A 4YUDA 4AILC 3PHTA 4LF2A 2DRAA 4DF8A 4FN5A 3RB0A 1VQ8S 2YX7A 4X62J 2OIHA 3AJ2A 3BH6B 2DNQA 1WF0A 3NS7B 4NXNF 1O51A 4JKCA 1FDNA 1RT5B 2NRZA 1R3NA 3IS9B 1J5OB 1VISA 1MWZA 2UXDF 3H1VX 2MQNA 4GO7X 2G1HA 2FSJA 2BKNA 2HPUA 3W63A 3LA0A 1EP4B 1WSEA 4K8ZA 3OSPA 4YB5A 3SBTA 1T9UA 4EI2A 2V4RA 3PW2A 5DRKA 4ED3A 3VQ8A 4JI5J 2DY9A 3HSDA 1R8CA 1Q81T 4B8AB 2XYHB 1OWXA 1VIOA 3G82A 3IUCA 3JQMA 4K59A 5KT7A 3V6JA 1TVRB 4WFAQ 2D74B 4F4WA 4LF4F 4JD2B 3DM2B 1U2RA 2P9UA 2R9LA 4RNHA 2HSTA 3MPVA 1YX2A 4OYAA 1M5OC 2DK2A 3AVIA 4ID5B 2DITA 3BPSP 1K73T 4O5FA 1GEHA 4DMNA 2ZKUA 2NRWA 2DGVA 4WP8A 2HW3A 2BA9A 3GSDA 3O08A 4P7VA 1S79A 5FPDA 3SFGA 2XWYA 3CETA 1EQ0A 3VF2A 1NK7A 2Z8QA 2V6AA 1NPRA 5KFQA 4PRFA 3FDSA 3HHDA 2NYHA 2YQ3A 3SQGA 2XYGB 3HZ6A 1P8GA 1DTQA 1M5VC 3FMBA 4WJBA 5I3PA 3V9UA 3BGFA 3MR5A 2HURA 3KD5E 4QOZB 4H4OB 1QQNA 4A8YA 3QBCA 4KHWA 1ZM4A 2APOA 1N33J 1XTZA 4DR3F 4ELTA 2UXBJ 3O5BA 4URSA 1Q81O 4P71A 4XAKA 5KFEA 4X2BA 3W5YA 2H4YB 3PSFA 3THYB 2WOMA 2IRUA 5AJ3K 3BSAA 3DRPA 4DV1F 2BANB 3E3XA 1RTZA 2DB1A 4KTZA 2XS2A 1VQPN 1WTFA 1U6BA 3S41A 2EFQA 3TPQA 3BUZB 4OPJA 1RB0A 1WHWA 4ZVQB 1K73O 2B9XA 2FGCA 3OTBA 3RRHA 4IJAA 2VICA 4A61A 4CM2A 4RW8A 3PX4A 2ZNZA 3NVMA 3W2VB 2OA8A 1JL1A 3NNHA 3S3OA 4DEZA 3L0QA 1NKBA 3ZXWA 5BRFA 3CNQP 2KM8B 2E29A 4LF5J 3OQ2A 4QR1A 3PO5A 3ISNC 3X1LB 3UR0A 1XMBA 3R7BB 3G25A 1UETA 3OPKA 4NB4A 1QTMA 2B4OA 4AQYK 3PZPA 3U1MA 1VQKN 1YTYA 1BQXA 2J7WA 5C15A 4BRDA 2M88A 1HPMA 4N56A 1YLXA 2VU5A 3RU0A 4USTA 2VA3A 2MKHA 3A5OC 3TZYA 2ZZMA 3EUNA 3DRSA 1FXLA 1MDUB 5JJBA 3I5CA 2NREA 1FHTA 2VOPA 3L3UA 1JLQA 4CHYA 5E3AA 1BMQB 1XJWB 1NEEA 5KT4A 4H0XB 1SH0A 4U7CA 4LRDA 5ETOA 5H9FJ 1NLVA 5AQYA 3D54A 4JKGB 3H3NO 4B1XB 4CJ5A 3LGHA 5CYMA 4ZS6A 3TAMA 3P31A 3I55N 2RE1A 2ZJQQ 2PAVA 3BZCA 3KK3B 3NG8A 2E9ZA 3ENHA 3EDRB 3MEKA 5DLGA 4IBNA 2W6KA 5D15A 2RRBA 1S1TA 4FWKA 3EM1A 1UKUA 1R0BG 3OXFA 5AQVA 2KKZA 2D0AA 2IJNA 3DDNA 3MM9B 3MAAB 3AVNA 1T02A 4G3IA 2QC3A 3BF3A 4LFAJ 4ETZA 2COLA 2MZQA 3PJXA 3JYTB 4C97A 3OYNA 3CMAN 4LF7J 2DO4A 3A3OB 4ED4A 1URNA 3UDEA 2ZH8A 2XMJA 4QS9A 3M2UB 4IEEA 2IDEA 1EX8A 3QO9B 5K9FA 4YB1P 5L1KA 4F3OA 3HPOA 2HGLA 4IH5A 3TQEA 5CA5A 3ALYA 1Q82O 1VSDA 1VMBA 4PQUA 4FF1A 2UUBK 2MQLA 2H48B 2BE9B 3AY0A 1NGFA 5BPNA 3DU6A 2ZH9A 3JQJA 1N36F 4FW1A 4F4KA 3HCXA 3EYZA 4WE1B 4XH5A 4Y2AA 3A2FA 4WK1A 4BS2A 1HNZF 2Z56B 4OV6A 5F41A 3D5MA 1RA6A 1NG9A 4CVNE 4ZLPA 4JI2J 1FTRA 1UJ4A 1HQEB 2PA8D 4OV1A 2KTQA 1WNSA 1VQYA 3DGPA 2VG5A 3LP1A 4CZJA 3LAMA 1X4AA 5CE3A 3KDNA 1TK0A 1WC0A 2V94A 4RW9A 5JICA 2QLXA 1VHXA 1HIYA 4KR0B 1RHJB 3DN9A 3SQ2A 2P9EA 3O5TB 4B1UB 3HVRA 4FXVA 1QAYA 1S7IA 4CK3A 4CJ3A 1ZBUA 3VGUA 3O4QA 2J5AA 4BRAA 1HNVB 1NJWA 1F3FA 1WC6A 2WVFA 3K9JA 3C7NB 1NK9A 5KFMA 3F2KA 1VBKA 1CPZA 3VAGA 3RG6A 1U47A 4CHQA 1CXUA 4WZQA 3DJCA 2B43A 4R79A 4W5RA 4G1QB 4QIEA 3DRRA 2V67A 3GBTA 2GEMA 1VQPS 2DHAA 3SNNA 7FD1A 4I6WA 1CVJA 1S57A 3I0SB 2YHXA 1QAIA 5DDOC 3CJ4A 3MD3A 2EKNA 2YKNB 1HNWK 2YKQA 4FVMA 4HI2A 3MX5A 4UUXA 1SL2A 3OYCA 4M41A 3KLEA 1C1AA 1HBMA 2EBEA 3VA3A 1XK8A 1WKLA 3Q2SC 1M1HA 1RT3B 2BZ2A 4O3RA 5JUMA 1XMQJ 3PM9A 5KQ8A 4B3TF 3MFHA 4BDZA 4X65K 1VQKS 4WPAA 2O8CB 2KFNA 1RHRB 3MR7A 1FRXA 2YHAA 4PAAA 2XMUA 2BUNA 1FDBA 2B9EA 4ZVOB 1UVLA 2EG2A 4IFYA 2CZ9A 1IH7A 3J81O 1YJRA 3AQPA 3KKSA 4X4NA 5MLCQ 3K17A 4LC9B 1TKZB 2PMWA 4ZPCA 3AVJA 1N34K 2OI2A 2QKBA 4NYPA 4M5HA 4HUGA 3GFXA 1W26A 5KG2A 3MPUB 4DJBA 1R7IA 1U7LA 2VDIA 4I64A 4WFXA 4KSEB 1VBYA 4ZVUB 3TZZA 3BGRB 1VSJA 2BYCA 2XHWA 2AQ4A 3P83D 3NRBA 4KH1B 2HFZA 4OX9F 2R3VA 1LOTB 5A8RA 3NMUA 3FZHA 3DLJA 4JI0K 4ECXA 3ZX2A 2LEBA 5CQGA 2AT1B 1HJRA 1VK0A 4WFBL 3MM8B 1X8DA 4WFYA 4FJGA 5AE3A 1RDRA 1WTBA 3BGOP 2CWXA 4HUFA 1ASUA 3CMAS 1T94A 3MWBA 2I1RA 1WC3A 5H1SQ 3LGMA 3GCXP 4TQRA 5FLXY 5ETPA 1H6KX 4M42A 3PLAA 3M9NB 4EBDA 1SH3A 4USHA 1X31C 4CH1A 3ENBA 3HYFA 2MLZA 3OUYA 1LWXA 1IBLF 3HBTA 3RAXA 4EIAA 4O4GA 1SBRA 4RUAA 2DNOA 2KXNB 4AM7A 3JXUA 3TTCA 2IA6A 1UZHA 1B99A 4CP5A 4KBOA 2LQJA 2VQEJ 2NS1B 1J2VA 2ZZTA 2R8JA 1FFGB 2V8VA 4GVMA 3AB4B 4LF6K 4M7YA 3PDNA 3I0RA 4AQYF 1NAQA 2RS8A 3RW7A 5GMKa 3GL1A 3EZ5A 1S10A 2ITGA 5ADXH 2P8IA 2OD6A 4DHYA 4QPXA 1UPPA 4CFBA 5DM6Q 3W0LA 4JV0A 1MA9B 2OYQA 3W3DA 2NZTA 1O8BA 4RW6A 3NE6A 4YDUA 5D6GA 2D0OA 4C3LA 1FTCA 2N4DA 3GLJA 1AUDA 2AEFA 2O8BB 1FKPA 5KG6A 2OKQA 2YX4A 3VQCA 1NJXA 2W40A 4W92B 2W41A 2PSZA 4E7IA 3PX6A 4C8NA 4LF9F 1HBNB 3AAWB 5EGYA 3NH2A 4CLKA 4FVCA 3KK1B 5H1SV 2WRMA 1RTIA 1FT8A 4IH6A 5IC4B 3BS9A 4NXNJ 3GYNA 1D9DA 1NCLA 3PUFA 4MFBB 3EGNA 3TRGA 5AQLA 1UVJA 2XS7A 1H74A 2UXDJ 1VQ4N 5KT2A 3OLBA 1PSDA 2XCAA 1VBXA 3L7OA 1RT7B 2GMHA 5IT0A 1YVNA 3FUYA 3EL2A 3LL3A 4M3XA 4HKQA 3EVWA 4L76A 3AOAA 3O2IA 4J37A 3ZNUA 5LJWA 1QE1A 2A2DA 1WG5A 1O1WA 1QY7A 2GO8A 3M30B 3EKSA 1KAYA 2J7UA 4K7QA 3PVXA 4LF4J 1YJWN 5LY3A 3QEVA 2QX0A 4NCBA 3FR0A 3OR1B 1O13A 2VFVA 3C65A 3VV2B 4DR2K 3FZMA 3IM8A 3AGRA 1SJFA 3ZZ0A 4I68A 1NJZA 5CABA 3D7EO 3NS6A 4CJTA 1JCEA 1WOOA 1T05B 1C0GA 1LCUA 2L3MA 2CVEA 2KVIA 3UKUB 5A76A 2A0FB 5AQRA 4IO9L 2ACMA 3DLBA 4C8OA 3NCQA 3GOIA 4K8RA 4BREA 4KRWA 4H4KC 4JRPA 2O3DA 3DWLA 1VQSA 2AU0A 3O44A 4KC5A 3VAKA 4DR3J 2ZH2A 2AF6A 1KVKA 3DYAA 3EZWA 2Y1IA 5KFVA 4B3MK 4ISFA 4PABA 2X1GA 3PFEA 4JI3J 4F04B 4DV1J 4M8LA 2B7BB 5J2PA 2G2ZA 2VA2A 3QT7A 1NU0A 4OPKA 4BC2A 3D2FB 4HWIA 3BZQA 4YS2A 2G4BA 3VGTA 1NK6A 5HAOA 3CC7N 3MM6B 1EAYC 4KREA 1T3OA 2AP1A 5BYRA 2G8WA 2DY4A 3T6JA 3OYEA 1WBDA 4C8KA 4DV0J 4OYOA 5GAEP 1S12A 4X4UA 1KP6A 4EEYA 1CJTA 3O6QA 3WIUA 3DDIA 2DH8A 1F3VA 2QTWA 2GX8A 3TUPA 4WZMA 3ULEA 4F02A 4ZLNA 4NE9C 4GC7A 3MWTA 2E9TA 1SL0A 2XQCA 1ZAXA 4BRFA 1X4EA 3MOZA 1HARA 4YHHF 4Y0FA 5EY4A 1KRPA 3C3LA 2X7IA 5KFLA 3QIPA 1UEVA 4HACB 4DQSA 2GCFA 1QHTA 5KFCA 4ZA1A 3U1LA 2W42A 2IC3A 4BC3A 1NJIO 5KFTA 1LWFB 2J0WA 4CF1A 4DTOA 3J7AP 1HNWF 4BC5A 1N5YA 1KOHA 4QWDA 1VQ5S 1IKXA 1JMTA 4FOIA 4WFAL 3GG0A 4BR5A 4BC7A 4F50A 1P27B 1TP7A 4USWA 3CMES 4YMEA 2W2OP 4A8QA 2DGTA 3JXOA 2EX3A 3ZC4A 2W9BB 5FDLA 2RQ4A 3NXZA 3CCLN 2Z2ZA 4KHQA 3L2VA 2ZM6J 2DRBA 4ETXA 2QMWA 4K4TA 5I3QA 3IR6B 4FJIA 1GX6A 4GV9A 3JQKA 3G8TA 5GAGP 2ZBQA 1UWBA 2YX1A 1X9JA 5GAGI 5HVGA 1SH2A 3OTOK 4CHPA 1N5TA 3ILJA 1A6LA 3M32A 3CJ7A 4I2QB 4LSNA 3NCPA 1G6BA 2I2YA 4CF9A 3M7VA 4CEDA 2YJFA 5E7OB 3H5SA 3K5PA 2B4VA 3PHEA 7AT1B 2FUG9 3GJQB 2ZBCA 1IKYA 1IM4A 1RAFB 4NA1A 4MIBA 2WTFA 1VQ4S 5E2QA 1JIHA 2RNEA 5EX0A 3VA0A 3KJFB 1X4HA 4B02A 3PW0A 3QNOA 3DI6A 2MY8A 3MCMA 1FJEB 5E3CA 2CQHA 3PKMA 3N4WA 4A8SA 2CJ9A 1NGIA 1N36J 2CPEA 2YWHA 1HNIB 4EHUA 3M2VB 3NAHA 3O9TA 2Q79A 3IMQJ 2V9WA 1FJGK 5GIOA 5KFRA 1K0VA 1HNZJ 2DR7A 3NAEA 2PMHA 5L1IA 5E5NA 3SQOP 1YJWS 2W7AA 3EGWB 3C6TA 3KKRA 2WW4A 3VZIA 1BISA 1RDAA 2E2NA 1KAXA 4Z7YA 1AUSL 2XC9A 2UUAF 3AVLA 1UJ6A 4DV2J 3DOMA 1R59O 2CUYA 1ACMB 1ICEB 3GFYA 2BH1A 5BYQA 3U27A 1S6QB 2DD8S 4JKEA 3VEZA 3CCWA 3KHRA 5SZTA 4FJHA 2Q1LA 2DGWA 4AHUA 2HBQB 2GVDA 3NNCA 2UU9J 3MR2A 2BMBA 2OEMA 3FRZA 1U2FA 3TP2A 3Q8SB 4WQ5C 4AHTA 1RK8A 2QWOA 2HGMA 4CIEA 2VV5A 2FBVA 3A4TA 2JHEA 1JX4A 4LF6F 4ED2A 1C6VA 3DMJA 1R0CB 4CD1A 1VRUA 5CYQA 3ZETA 4IG3A 4FLVA 2FXUA 2UVVA 5HVFA 4WP3A 1J5EK 1VQ7N 2R7TA 3D1OA 4RW4B 4B1ZA 2K7JA 3EZOA 4KGZB 1H7XA 2VWKA 1S22A 2ZJQL 4OZ3A 4RWXA 4DV4K 1V6HA 2CG8A 1S9FA 3DXKA 1APSA 2P9GA 1RWVB 2A41A 3E9PA 4LFCK 1N52B 3CM6A 1PO6A 3W65A 2AZ3A 5AFUH 5AE1A 2L9DA 3X3UA 2DIVA 3GDQA 5HQ8A 3C46A 2I0XA 3CPWR 1XEZA 3L4QA 1LEOA 2P6TA 2IJFA 2IFXA 4FJ5A 5C24A 3KMQA 4Q7AA 1RBVA 1NB7A 4NLXA 1NK0A 1EIYB 3OBYA 4QYRA 2VKZG 1B0PA 3FJ2A 3PYGA 1ZBTA 2ZWHA 3ZT3A 2YWGA 4J9NA 4G9ZA 5L1JA 1BGXT 1NU4A 4A8MP 4I67A 2P9UB 2MKIA 3VTHA 3OBIA 4DG1A 2LXIA 2DNNA 2V0NA 1T3VA 4CZMA 5HRSA 4O8KA 4FJNA 3MZIA 2H5JB 2AJQA 1RDCA 4LFBK 4NI2B 2NSBA 3OVAA 4EP4A 2VWBA 1G7CB 4C9DA 1O0PA 1HWKA 2PC6A 3ISZA 3GILA 1QUVA 1NPPA 3GFZA 2DKOB 2VG7B 2GTDA 4O4RA 3D4JA 3FZFA 3LP2A 4DQQA 3WQUA 3SYZA 3MN7A 1WF2A 2JOQA 2ASPA 4NLSA 3R2CJ 2F96A 2WOMB 3LO3A 1Z26A 3DRPB 1RT1A 3CPWM 3U9ZA 4HLBA 4NLGA 1CC7A 2W2QP 3OXGA 3M2RA 3HTVA 4BCAA 5KI6A 1RT2A 4O3OA 4X4RA 3QRPA 3DLEB 4RW8B 3L2RA 4B9VA 4DTJA 4NCGA 3M5RA 5JS2A 4WBFA 1BHLA 4FKXA 3R2DJ 1KQFB 1T0TV 1RHUB 1CQMA 3TJ9A 4RNNA 3CJRA 5KFGA 2OFGX 4C4WA 3S3MA 2YY3A 4V19S 4BR2A 1RWKB 3NL0A 3PG9A 4MO5A 2BJ8A 1VAZA 1OY8A 2XBPA 4L3QA 2E66A 4J90A 2F9JA 3TVYA 4CHNA 2OTJN 5F3TA 2ZJRQ 1Q9XA 1OVQA 3AAPA 1VC0A 3MMCB 3G10A 4C0OC 3KVGA 4K50A 2HBMA 5I9EB 4AQYJ 1C4CA 1YF5L 4L73A 4LQ3A 2UUCK 2FJEB 1JB0C 1CBKA 2EVZA 1NO8A 4QS7A 4WCEQ 5M1NA 4NZ7A 1XI1A 3WNFA 1S6UA 1Z1ZA 3HPHA 1JLQB 4O0JA 3W60A 4KHPK 3N0VA 2V7ZA 1ATSA 4ID1A 1JL2A 1U2CA 2ASDA 1SKRA 4FJLA 1ZS6A 5F9LA 3NS5A 4E7LA 4H4MA 2GIQA 2CGKA 1HFEL 4KHYA 4CGIA 3GIKA 2H4WB 2OTLN 1R89A 3KJVB 1D9FA 1OQ6A 3LF0A 2XY7A 2KRRA 4DV6K 5FLXU 2HF3A 5AQZA 1Y4ZB 2HNZB 3H3OB 1UJ5A 4EBEA 4DL0C 4XDDA 5DETA 2IS3A 1FK9A 3J7A1 2ZH5A 3JAMY 3KUGA 1NSKL 3N4QA 3M8RA 1XBWA 3SAFA 2IMWP 2KZZA 2V63A 5C2DA 3HHLD 3O3GA 1PJ6A 4CI0B 3PNIA 3RYLA 2HRUA 3R6MA 2QN6B 1WOSA 3ULHA 1D1UA 4MMOA 5LSLA 2Y0SD 3SJHA 4JRQA 1Q1KA 1HQUA 2WONB 3PTWA 1Z25A 2K3KA 3OTOF 4FS1A 5CY4A 3KLIA 2HLTA 1PBAA 2R7SA 4DFPA 4PQUB 4FF3A 4WXWA 4J2BA 2A10A 3L7UA 1KN6A 4BE2A 1HKAA 1TYQA 2CPXA 2QE5A 5HATA 1NDPA 3RBEA 4DTXA 2JLGA 4QCLA 2ROEA 1HI0P 5FROA 3K2PA 3VN5A 4N77A 2RJZA 2UUBJ 4DL5A 2UV8G 2BEFA 3EY1A 1QUPA 3G8SA 1FRLA 3TU5A 2DJWA 2ZUAA 1FJGF 4NLWA 2QW9A 3VGSA 1OY6A 5AQFA 2HS4A 2RKIB 3HFZB 4CI6A 3NGSA 7FDRA 1TKDA 2NUUG 4A59A 1VQLN 3VEXA 3CIMA 1P8ZA 1L3TA 3BB5A 5AQJA 1EKEA 1H2UX 2HHWA 1RYSA 3PR5B 3WT0A 2QWQA 4AHCA 4FL9A 3CCSN 1VI7A 4E19A 3NY0A 2ILYA 2YKPA 2DPJA 4YDDB 5HMWA 3ET6B 4TY8A 1VOMA 2VGMA 5DM6L 1TL5A 2OZMA 4M5KA 1CJKB 3AA4A 4AM6A 3H6EA 2KHCA 2VG6B 2VC1A 1HMVA 4OLPA 4B3RK 1N6QA 4HYKA 3QFHA 1Q8LA 1AROP 2ZH6A 1UEKA 3DXSX 4QJVA 1BQNA 1CZ9A 4X4PA 1GFWB 2V9KA 2I7PA 1XMOK 3MXMA 1SUQA 2D9OA 4RO0A 5EX3A 2ZD1A 3C16B 2HVDA 3GIMA 3EKUA 4LSLA 4KJIA 1KVCA 2IGIA 3VPZA 5THWA 1SJQA 1JJ2R 3OYIA 1WG1A 3DRRB 4FJKA 2ROGA 4UZCA 3QDKA 2FBYA 4HCBA 3N28A 3CDWA 5F0UA 4FXDA 3P4IA 5IQ6A 3BO3A 4CGGA 5CCLA 2BRKA 3BKFA 3CB4A 4EK2A 1XNQF 2YCHA 3C6UA 3PYFA 1Q8BA 2FVRA 3MPDA 2XLJA 4Z2XA 2B0GA 3KLEB 2CQBA 3AARA 4KH4A 1OVYA 4F3QA 1HL6A 2AD9A 1HNWJ 3IBFB 3L4BC 3O80A 2A1BA 4J8FA 4ILMA 2JFDA 3GYGA 3TAQA 4LBIA 1YXQA 1YKWA 1Y7PA 2OTJS 2R7QA 1X4DA 2W7OA 2YH0A 3I6PA 3VQ7A 3B82A 2FF6A 2CPYA 3SI6A 4DR4K 2U2FA 4CO4A 1BCOA 4XTTA 4P10A 2HWHA 2LLZA 4C3KA 4J9PA 4JK9A 3NEKA 3TQ1A 2L9WA 1RTHA 4IFYB 3MOJB 1HNXF 4DTNA 2WBMA 1H7WA 1CULA 2I5JB 4B3SK 2FLPA 2R7YA 3D2WA 1U02A 2K7KA 2G2YA 4ZTFA 4OZNA 2M70A 3DLGA 3UCUP 4UW2A 1GOCA 4W98A 1N8RT 4H0VB 3Q83A 4YR2A 3SV3A 4NOHA 3ZT1A 3AA5X 4KE5A 2QM1A 1I3AA 1FD8A 1A9NB 2B4JA 2G8VA 2OTLS 4P6QA 2Z58B 3W9IA 2QK9A 4NA2A 5LMNK 3TEHB 3SZ2A 4AHVA 2X3DA 5A8RB 4GC6A 2CA9A 2E7XA 4YFUA 3BQ1A 2VBYA 3MECA 5LMUK 3HHLC 4QW9A 3PYDA 3O4WA 2ZE2A 1NWKA 1NMDA 4Z7CA 5T41A 4YOEA 1WI6A 3UPFA 1RYRA 1S6PB 1QQMA 2QLFB 3SAGA 4B3OA 2M0GB 1KLMA 3EVMA 3ZX3A 1RBAA 1K8KA 1PYSB 3CE8A 2YHBA 1PILA 3EPIA 3FZLA 3WNEA 2QZ8A 2HK3A 5DG7A 4CLWA 2IYIA 5L9NA 1AFIA 4PYDA 4PEOA 5J1EA 3OUYB 1OS5A 2ZWOA 3FSIA 2VF3A 4O4GB 2CAJA 4ZDNA 1VFJA 4RLEA 3EN9A 2VBZA 5KG3A 4K4ZA 4KTQA 4AL7A 1ESVA 4J9UE 2LA4A 3I0RB 3R7NB 3B4DA 3K5NA 5I3UA 1UFLA 2GIFA 3THPA 4EMDA 2CADA 2DRDA 2F65A 3GJSB 4OI6A 4CIOA 2P9IB 4UT4A 4LF6J 3F56A 5CHIA 1HR0F 4JI6K 4RW6B 4DX7A 4KHUA 2CQGA 5JVGQ 3SPYA 4H0PA 3KHHA 1FKPB 4U95A 2HRYA 2F4VK 4QQBA 1VJWA 2HFUA 1QTNB 2L9NA 3SCLE 2CDQA 5K8NA 2Q0UA 3LPTA 5ELZA 3CCSS 1GMUA 2ZHOA 1EJ7L 2QIFA 4K4VA 2EK6A 2FIUA 4DFKA 1IJJA 4E1NA 5CD4H 1RTIB 2Q0RA 1JQGA 2FYXA 4F3TA 3THWA 2CG4A 4M45A 1WUUA 4U96A 4IUFA 5D0RA 1WORA 2LEAA 2V68A 1KCFA 4HHHA 1QDUB 3AVMA 1T11A 2DXFA 1N5SA 2JH3A 3BP8A 4J91A 2EWSA 3FCVA 4L8RB 3OL6A 3IO1A 2ASLA 3PX0A 1QSSA 1AW0A 4CESA 1SQKA 2VFRA 2D1CA 4PXBA 4OIXA 2E9RX 1BD6A 3DOKA 4ZCMA 4BRPA 1JK9B 1RTDA 2B8PA 4DR6K 3QJJA 2SXLA 3ZNJ1 2P9KA 1PAUB 2D7SA 1FESA 2XNQA 3LPYA 5U47A 4OZLA 3QINA 4Q2MA 4CEEA 1BG3A 1RWUA 2BOAA 3PYEA 1HBUA 4P2XA 4C48A 2CNNB 5F8IA 2BJEA 4OKEA 1BUPA 2LU1A 4Y00A 2AW0A 5BRDA 3T9NA 3ZTOA 1KEKA 2QSWA 3MWPA 3M8QB 1CJUA 3A8KA 2BW7A 1SIZA 3HX9A 1N0VC 4IQMA 4KQZA 1OO0B 1REGX 3UNGC 3MX2A 5GAEU 3M8PB 2IPOB 4P9SA 2CNOB 3DRYA 5KFOA 1TU0B 2FDNA 2XY8A 3W2WA 2LYVA 2C2KB 3CD6N 2HQFA 1U1LA 3PJ9A 4HH0A 1NM1A 3ATUA 4LD0A 3OFHA 1D8YA 2DNGA 3LZIA 4NO7A 1SPBP 2ITMA 3OR2B 2YJEA 4BRCA 4OJGA 4M3RA 3CCMN 2HHHK 5J2PB 1FNOA 5KPRA 3HFVA 4OMFG 4M63C 1UVMA 3OVNA 3MEGA 3OXLA 4CJQA 5HRPA 3W61A 4D3GA 4BC9A 3D6HB 3W1YC 4FYWB 1LV5A 2FHKA 3AJ1A 4PXCA 4F2SA 3SIPB 4GMKA 1AA1B 2FC9A 1AZSA 3RW6A 1HPZA 3BJYA 3TA0A 2FHMA 3EJMA 4OYZA 4TY9A 3V4IA 1FVSA 4RW7B 4YY3K 4AXIA 4U8YA 1MU2B 3RUBL 4RNOA 3QIPB 1Q4RA 5LL6d 4ZLLA 1C0TA 3AVGA 2XY5A 5GAGU 2E5GA 2GC8A 3KHGA 2YNGB 3OD2A 4NMXA 1F6TA 2WFBA 3UDVA 2QYCA 5AT1B 2GGPA 4K41A 3VERA 4CZLA 2F9DA 1N5YB 2UXCK 1EETA 3VGVA 3QMQA 1IVZA 1IKXB 1NGAA 1L3KA 2P9NA 3CC4N 2C2OB 3MEEA 4DR5F 2Z2YB 2OELA 3G87A 4PG8A 2CVIA 2JGUA 1E6YB 4CNZA 4CO2A 1HW8A 2H5IB 3N6LA 3RAQA 4WF9Q 4BY9C 5HANA 1EHWA 1YBTA 3F73A 3OFFA 1ZZNA 2CJYB 4DZ6A 3CO9A 1CZAN 2D9PA 1LWCA 3OYJA 1Z2ZA 4LREA 2XO7A 5DQIA 5IXUA 3AVHA 3LANA 2QXFA 2FVQA 1UWBB 3GONA 2G9OA 4F0KA 4B3SF 3CUNA 2E8AA 2MQQA 4DUYF 4KAZA 4X4OA 4CEAA 3VGLA 1BWEA 4RTFD 2DHXA 5JVHQ 1NH7A 3OYGA 3NP5A 3M32B 4F7VA 4LSNB 2D0CA 5L39A 2YV0X 3R5CA 4ECUA 3RMBA 1IKYB 3OTOJ 2ZBRA 2FZCB 1KTQA 2P9PA 2VWJA 2DR5A 1RDUA 4PG4A 1T7PA 5B8HA 4CLZA 2YNIA 1TFYA 3BDEA 4X84A 4A5BA 4PHTX 2XB2D 4Z4EA 5IWAF 5LMNF 1N88A 3DI6B 4UY85 3SFUA 3L3CA 3OVBA 3SUPA 3QNNA 2FY1A 4R8UA 1OPZA 2KKHA 3HMJG 1FJ7A 4KH5A 1ZBIA 1LKZA 2MEWA 1CJVA 2XLIA 1B7YB 1RLCL 4V1Ak 3PXGa 4FWNA 3ZZUA 4WKYA 4DTSA 3UE5A 5F1XA 2JLEA 4ZK7M 3C6HA 4YOTA 4B9SA 6AT1B 3ILOA 4CT9A 3VCDA 5L46A 3AD7C 1FJGJ 4NXMF 3LPEA 5FPMA 3UDLA 3IGVA 3DOMB 1KD1O 3H90A 3TZWA 4KPYA 3VQQA 4Z4FA 5ETVA 1FWLA 4KT0C 3KTQA 4DQIA 4JI5F 2KB2A 2XG8A 3ONQA 4BRNA 3ZCMA 3BYPA 2EHGA 3MXHP 1SQFA 3M8SA 3JAMU 2VD3A 2GVDB 3KK2A 5EU7A 4BRKA 1JCGA 3C95A 2CQ3A 3MCAB 4CZKA 1P6TA 3TVZA 3VAJA 3MN6A 2RDJA 3UCZP 4BDYA 1RAAB 1VSHA 3U9DA 1VRQC 2QFIA 3KNAA 2NPIA 4WCEL 2NR0A 2QT7A 4IOXA 2C28A 3DMJB 4XIUA 1WDTA 1VRUB 5CYQB 3ZETB 2G0IA 4IG3B 4BG8A 3CD6S 1WHVA 4E7HA 3WZ0A 1WSIA 1U8WA 4JNEA 2O1PA 1IKVA 3MAHA 4DSLA 1G15A 3MUMP 2W4PA 3ILIA 4OI0A 4X64F 5E3QA 4ICLA 3FZKA 4J2EA 2NCKL 2I9SA 2DTJA 1IKWA 4NLCA 3DXKB 1F5CA 3FFKB 1U0SA 3CJ5A 4LH5A 2Y8WA 4OZ2A 3CQXA 3K0JA 1X5OA 1YZ6A 2KL8A 1XNQJ 2GHWA 4OZ0A 5GADU 4DV4J 2ALZA 5E3PA 4X4QA 4HTLA 1FW6A 1K1SA 3LDQA 3AO3A 4ISGA 3DRXA 4QWBA 1TMJA 5EHHA 4OQJA 3C6AA 2DTUA 1XNRF 2OLWA 3HRGA 2RU9A 1ZM9A 1TKTA 4TVAB 3H1QA 3GR0A 2MGZA 1W2IA 3BGLA 1GAOA 5AQPA 4H03B 5KT6A 4DTPA 4NRTA 3U4LA 1GH8A 2XGPA 4BRLA 2YKMA 4K4YA 3LAKA 4CLYA 3O9QA 5BJRA 2CQDA 5ETSA 1TTHB 2ILZA 4DG1B 4MKYA 1LFPA 3BY5A 2P9LA 2OSQA 2ZWPA 3H7HB 2IAJB 1IR2A 2MLYA 1HNXJ 3L2UA 4LSZB 3SSSA 3IG1B 4LF5F 2HK2A 3AXKA 1RXOB 2RDDA 4NWBA 1S0OA 3VF0B 3RAMA 3HKWA 3ZEUA 4FJ9A 3QZ7A 2MB0B 1M5PC 3IXQA 5FJ4A 2B3TB 2VIHA 2D5RA 5T7BA 4OHYA 3J7YP 1H0HB 3CC4S 2YWKA 4TNOA 3OW2M 1L5UA 2RIJA 3J7YI 4JI8K 3LP2B 1F2HA 4OPAA 2NLWA 4IDKB 2WZ1A 4EZ6A 3UO0A 4RWTA 2JVOA 3TO8A 4DN0A 1NZAA 2M8HA 4DL2A 2GFFA 4DLEA 3VVTA 2Z2LA 4ZIVA 3H5XA 1WKKA 1FD2A 4GKKK 4U8VA 3Q86A 3ZX0A 2WSFC 1RT1B 4IJNA 2B9WA 1KKHA 3BBCA 1WN7A 4FZVA 2LU2A 3K5OA 2DR9A 3M2RB 3NOCA 4MKBA 1MNEA 4O3PA 2GUPA 4M5DB 3MR6A 2HS0A 4Q0BB 2RQCA 4Z37A 2HFNA 1RAIB 4NCGB 2FVPA 2W01A 5LJ5Y 3MUVP 5BN9A 2YWEA 4TYBA 3ATVA 3DOLA 3NCIA 3J8AA 1XHXA 4DL3A 4GO5X 4FW2A 3QEWA 4FPAA 2NXNA 1D9AA 3I96A 2D1KA 4GVEA 4M3WA 1EWRA 5T7LA 3DCAA 1WHYA 1FRIA 1S5ZA 2KJVA 3THXA 4NMLA 4FJXA 2GAHC 2E5LK 3G4SS 4CO5A 5E41A 4ZKAA 2VH7A 2AZ1A 3U1NA 1C1BA 1UVNA 1LAVA 4C98A 4JUZA 3R9LA 2FSNA 2MQOA 1L3SA 3W3SA 3OHBA 2HF4A 3KZBA 1JLAA 3MF5A 2V4JA 5KFUA 1YBUA 4N5SA 1HQ2A 2EWHA 4CH0S 4BRHA 4PKHA 4ZHRA 2RDIA 3CM5A 2XMAA 1X5SA 1WC4A 3UD4P 3NF8A 2PFFB 2WHOA 4P52A 3JSBA 1N32K 4PWWA 2EK1A 4KHPJ 5F8NA 1CS4A 3CCQN 3IM9A 4Y2CA 3EEQA 2XRIA 2P51A 3GTYX 3N5FA 2W9CA 3HD1A 3E51A 5AXMA 4AYBD 4J5OA 2QWMA 3QT6A 1UCNA 3QYYA 1BWVA 2FJWA 2MQPA 2V2ZA 1WUAA 2ZHBA 2LFVA 4KB0A 3J7ZT 2Q36A 2Q66A 1N5QA 3ILLA 4KO0A 4IXCA 4W5QA 1NPKA 3AD8C 4ILRA 2A2CA 1FK9B 2BQRA 3MAQA 3CJ0A 3O1WA 1RUSA 4WFBQ 4FCYA 4FZXC 3VQDA 3GG4A 1DJ0A 1TK8A 1S76D 4RG8A 4RU9A 1JNZB 1T6DA 3R1XA 1RGIA 3ZZPA 5DZ7A 5AQWA 4PKIA 1NZ8A 5ETMA 4CFAA 2R4FA 3TSQA 1HQUB 3LH2S 4DV3F 3OSNA 2VB6A 4IOAL 2HVEA 2JWLA 4HHTA 1DEJA 5DQGA 3CQ8A 3GPAA 4I56A 1M5KC 2F9TA 2F5GA 3KLIB 5CZXA 1JLFB 5E0OA 1XC9A 3F41A 3CD0A 3HSGA 3QRRA 3ULDA 2R8HA 2B51A 3CCUN 4NLYA 4KFBB 1YUWA 1BHNA 2HMPA 1T03B 4ZVRB 5B0GA 1DZ5A 2HHUA 4AHSA 3FZBA 3WIVA 1U6ZA 4XPCA 5F0WA 3I8BA 3OJSA 1YZ7A 4FJJA 4MLHA 4NRUA 2WVEA 2LQBA 3M1FA 4EGLA 1ZPVA 5HROA 2RRAA 4C8LA 1OJ4A 4DL7A 1NK4A 5J2NA 2W2PP 4V19X 3FQKA 1LW2B 3GFHA 1F21A 3E8OA 4DR7F 1YGYA 3MDQA 2ZVIA 4C11A 3CJ1A 1YJUA 1QVFR 1GXLA 4CZHA 2CQ2A 1I51B 3EWGA 1VQON 1IBCB 1KS2A 1VQMN 4BWJA 4FLWA 4TY8B 4WP9A 1DQ8A 2E44A 3VETA 4M94A 1H73A 2U1AA 1BC6A 4CGJA 1HMVB 1N6QB 1LK5A 3WBZA 4DZDA 3T1YF 3FSYA 4Y2IA 1OKJA 5JVGL 4WU2A 3MMAA 1F9HA 1S9GA 2B6AA 3UKRA 1KHWA 3IGNA 3S01A 1SUQB 4F4ZA 3D1HA 1Y5LB 2ZD1B 4GKJK 4BGBA 4LSLB 3IAYA 4KHMA 2RRNA 2D0PA 2BE2B 3Q8YA 3WEEA 1S0VA 4OL8A 3NH1A 2KDOA 2C3OA 4E1JA 3PIOQ 2BRLA 2CYYA 3R7SB 3HO1A 1VSIA 2YWFA 5KFZA 3C6UB 2CPDA 4CFDA 1JJHA 3Q89A 2WVDA 1U4BA 1DGKN 2CJKA 2IBOA 3AO4A 3H59A 4K8XA 3NDKA 2J8SA 3PV8A 5KRSA 3S3NA 5EN1A 2GIRA 3WNHA 1U1QA 2ATCB 3W66A 1KVBA 4DR5J 4DSEA 2NUHA 3VGKA 4PG6A 4FS2A 4QBUA 3AA8A 4DCPB 4W5TA 4H5VA 2QJ3A 2ASMA 1QJHA 1G1XA 3HT0A 5M2PA 1QVFM 2DIUA 4TLRA 3G71N 5CZ2A 1L3UA 1U09A 1CULB 4FNHA 5ETQA 2E6MA 3BM7A 2E5JA 3KLVA 3G6YA 1RTJA 3OJUA 1FXDA 3QATA 4B3SJ 1BCMA 2BW2A 4DUZK 4DR1F 4YR3A 2X1BA 4OHWA 3RZAA 2OP5A 4Q44A 5A6PA 4RUBA 3CCQS 2F1FA 5TKWA 3I56N 2KXFA 3UDCA 2G8KA 4WQ5A 5A8KA 2ADBA 3AD9C 4X62K 4JK8A 2BJ7A 4ALZA 4FPRA 3DNCA 4W4MA 2ZE2B 2J0SD 5IWAJ 4X66F 5LMNJ 2DH9A 1N48A 3AVKA 2QI2A 1YTAA 4KKOB 4IFVB 2Y3YA 4LR9A 1OY9A 3FQLA 4J2DA 1KLMB 1U04A 3FBCA 2MKCA 1KSPA 3F5TA 1K8KB 3IS9A 1J5OA 2QA4N 3B6OA 1JCFA 2KFYA 3BF4A 4N7TA 4CH7A 2YX6A 4B9QA 2Y8YA 4NXMJ 3V9ZA 4FK0A 2IVYA 1IBMK 3KUHA 1DBDA 1GT8A 5HMZA 1B7FA 1P1TA 1NBEB 1I94K 1GX5A 4W5OA 4WWSA 3WXKA 4YNQA 2XMTA 5LSOA 1RJJA 3LP0B 3LDNA 3NWRA 3CCUS 4UTGA 2O5DA 5D3GB 2CRLA 5C10A 2IBKA 3CFOA 3AA2A 2B56A 2R7WA 1BI4A 2B9YA 2ZOGA 4RNFA 1EARA 1KVIA 1OSDA 4F9OA 2E5LF 1U45A 4I6YA 2FLOA 1FJCA 3VF4A 2D0BA 1QM9A 2F8TA 1WKJA 3E2EA 4C2MA 2VQFF 3U3YA 4I6MB 2IM1A 3R8YA 2KZMA 4JP8A 1V3RA 4B1VA 1JLBB 4X64J 3EPGA 4UY8T 1TK5A 3EE8A 1N33K 3M05A 2IIRA 4YORA 4A5AA 2UXBK 3GCWP 4ZPTR 1WSFA 3TAFA 4O5BA 3CEDA 3KWIA 2HRTA 4WF9L 2KYXA 1TL1B 1DAXA 3A13A 2K2PA 1VQMS 4L6V3 1N32F 4JV5F 2DFEA 2G1DA 3BEXA 4QWEA 4J9LA 3GIRA 1S9EB 5ETKA 2DHGA 3S9HA 3JSMB 3ITHB 2KYZA 2MKSA 3VMFB 1Q5YA 1GMWA 1Y10A 3AY9A 5D78A 4OI4A 1XNRJ