2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
1EKEA 2W8KA 2IA6A 1SUQA 1JLFB 3KLHA 4CHNA 4MKAA 4DSJA 4B08A 1GOBA 1HRHA 4RW4A 1DLOB 1SV5B 4IFYB 5HP1B 1EP4B 2YNIB 5F9LA 5F8HA 5DLGA 4W5QA 5F8GA 5KRTA 3IS9B 1S1UB 4Z4FA 4RW9B 2JEGA 2KZMA 3NGDA 1D0EA 3DRRA 4IFVB 3KLFA 4LQ9A 1YVUA 1WSJA 1BQNA 1KHWA 5KFRA 3NE6A 2HW3A 3AO4A 4DL5A 4URQU 2ASJA 4BWJA 3OYAA 4IDKB 2YKMB 2OH2A 2X6SA 1TV6B 4M94A 3VA3A 3GIIA 1SUQB 3KLHB 3T5JA 4KFBB 5J2MB 2J6UA 4KBIA 3KHLA 4RW4B 4DU3A 3H5UA 4UQGA 3BGRA 4LQ3A 3NH0A 4TQSA 1TKDA 4O5BA 2HNZA 4ZPBA 3EPIA 1B9DA 2JGUA 2Z1HA 2BQ3A 2D5RA 2HHVA 3OHAA 4CF8A 1Q9XA 1TK0A 3E51A 2YNGA 1SL2A 5CYMA 3CDWA 4HUFA 2D41A 3K5NA 1BQNB 3GV5B 3QERA 4MK8A 1RTIB 1NJWA 3OY9A 4I7FA 4F4YA 3NH1A 4ED7A 1C0UB 1RA6A 4C8MA 3VQAA 2IBKA 3NAHA 5FDLA 3QEIA 3G6YA 2EX3A 4AHTA 5HLFB 1S4FA 4MK9A 5KT7A 1S10A 4J2BA 4FLWA 2BGGA 2WOMB 4JRQA 3BGRB 2YHBA 3V9WA 2E9ZA 4EBCA 2IJNA 4IG3A 3TAEA 4KHNA 4O0JA 1L3UA 3WNFA 4E1MA 3ITHB 5J2NB 3FDSA 1SH3A 5DG8A 2GBZA 3MEGA 4M3ZA 4QOZB 3KJVA 4KHMA 3PJXA 1W0HA 3HSTB 4FM0A 1REVB 3KOAA 4ZVEA 3DM2A 2DPJA 3SV4A 4M3UA 1T05A 5KG1A 3C6UA 4JV2A 4CJ3A 3ZSZA 3CDEA 1NK5A 5JS2A 2R8GA 2ZQBA 5FDLB 4DSEA 1NOYA 4W5RA 2WONA 4DF8A 4CHOA 4IH5A 3RTVA 4DTRA 4DEZA 1IKVA 4TN2A 4K4UA 4DMNA 1S1WA 4FJ9A 5KFIA 2RDJA 3V9ZA 2ILYA 1FXXA 4O44A 2XWYA 4ZVFA 3DOLA 5KT3A 1RT6A 2F8EX 3RAQA 4YP3A 4XO0A 3VQQA 3L2UA 4E89A 3MTKA 5EUHA 4OKJA 3ZT1A 4FJHA 4RW7A 4GC6A 3MR2A 2RKIB 3CJ5A 4J2EA 4JLHA 5EWEA 1Y97A 4TQRA 3MEGB 1RT3B 3KJVB 3CM6A 1C1CB 3AVAA 3DM2B 3V4IA 3C6UB 2R8KA 1VSMA 4ED0A 2WONB 2OPPB 1ASVA 4H4MB 2VG7A 2X6NA 3EY1A 5KFTA 1IKVB 3OYKA 4FJ8A 2BRLA 4FZZA 3QESA 3H5YA 1A5WA 1VSFA 1RT6B 5KFZA 3OL7A 2IS3A 1ASUA 1GX6A 1RA7A 1I6JA 3V1RA 3V1QA 2B6AA 1J9AA 3KNAA 1BL3A 1TKXA 3S3NA 4PY5A 5D3GA 3U3YA 4KAIA 1ZETA 1BHLA 4GW6A 4KAZA 2AGOA 1C1BA 3M8PB 4E7LA 2OPSB 3TARA 2Q3SA 4E7HA 2OZSA 3OYIA 2V4QA 4C8OA 4Y3CA 5KG0A 3SFGA 4FM1A 4H54A 1KFDA 4NRTA 3KLGA 4G3IA 2UVVA 4FS1A 3EPGA 1TAQA 3KK3A 3VQDA 2G8HA 1KHVA 3CJ0A 1Z4UA 3T3FA 2FLNA 4CFCA 5L1LA 1X9SA 1N56A 4Q45A 1T8EA 1VSKA 4TSXA 4CJPA 4PWDB 5JUMA 4FK4A 1IKWA 2B6AB 3I0SB 5KFGA 2ILZA 3IGNA 1WSEA 3AVFA 5J1EA 5EWGA 1IH7A 1TL1A 4NZ0A 1C1BB 3DI6A 5KFCA 2E4LA 4DTNA 4IQXA 3FQLA 3PX6A 5KT5A 3T5HA 3LPTA 1DTTA 5F9NA 4NYZA 4OJRA 3DRSA 2JLEA 2GUIA 3K58A 1HNIA 4TXSA 1B92A 4HYKA 2XGQA 3VQ5A 1VSHA 4U7CA 3SZ2A 3S3MA 4QAGA 1X1PA 2QKKA 2JC0A 4NLOA 3ZT0A 3H59A 3S3OA 3U3GA 2HNDB 1RBSA 4NCGA 2CKWA 2FBTA 1IKWB 4DTSA 4FJ7A 4DU4A 4Z4GA 4DSLA 3THVA 3KD1E 4ECUA 1WNEA 1TL1B 1S1XB 4YNQA 4FW2A 3H5SA 2B5JB 3DMJA 3HK2A 3DI6B 3V1OA 4OPJA 1DTQA 2WTFA 3NFAA 5HROA 4FJMA 4FLVA 3D5MA 4IRDA 4ED3A 1G15A 2FJXA 3DRSB 3QIPA 5KFWA 1HNIB 3OYHA 2ZD1A 4NLGA 3NMAA 1HMVB 3PZPA 3L3UA 4CGGA 2BQUA 4MIAA 4FBTA 3NHGA 4ZPDA 3SV3A 4PQUA 4CHPA 4Y2AA 5KTQA 1HYZA 1D5AA 5L1KA 3SPZA 2VA2A 4R5PA 2XC9A 2R8IA 4L8RB 1JXBA 4FJGA 5KFPA 5CZ1A 4HUGA 2VG6A 2KFZA 4RZRA 3VQCA 1N4LA 2IM0A 4CJ5A 5KT6A 3DLBA 1XR7A 1DTQB 5J2PA 5HROB 4Z4CA 4AILC 3AA2A 3RWUA 1FK9A 3H4BA 4ZTFA 2OZMA 1U09A 4CFAA 3AVBA 1QAJA 1U48A 3V6DA 3V81A 2O5DA 3OVNA 3PW7A 3GIKA 1XI1A 1IKYA 3M8SA 2AX0A 4QW9A 3QEWA 4CEOA 1HPZB 4OPKA 2IC3A 4ZMMA 2HHTA 3LP1A 2EC0A 3QZ8A 1KLNA 1TVRA 2VG6B 3PO5A 3BJYA 3NF8A 2J6TA 4J9QA 3OL9A 1NK8A 2I5JA 5J2PB 3QLHB 3DOKA 1KCFA 2VWJA 3PX0A 1FK9B 4CFBA 3HPGA 4F50A 4Z0UA 4F4XA 1TP7A 4J9PA 2I1RA 4DTJA 1JXLA 1RYSA 4QW8A 1LWCA 3JYTA 4B3OB 4URSA 4O3SA 1NK6A 1A5VA 3FFIA 3A2FA 3KK2B 3OYMA 3NBPA 3FRZA 4JRPA 1IKYB 2F8TA 3HVRA 4ECXA 3K2PA 3IG1A 2IC3B 1W9HA 3LP1B 3ALYA 4I2PA 1XHZA 3MR3A 4F2SA 5C5JA 3V6JA 3B6OA 3IRXB 3SQ0A 3TAFA 1ZBUA 3F73A 2HMIB 1LWEA 3ZT3A 3DOKB 1SKRA 3BSNA 4CK1A 3NAEA 1T03B 1F21A 1JL1A 1JLEA 2OPQA 3MAQA 3OS1A 2WRMA 3CFPA 1NHUA 2XY7A 4IH6A 2D3ZA 2ASDA 3RMDA 4WXWA 3JYTB 4NCBA 1JLFA 1JLQB 3OSPA 1W25A 2BDPA 4N5SA 4KHRA 2XI3A 1DLOA 4IFYA 4Z4IA 3RBEA 1EP4A 1NNDA 1HNVB 4RUAA 2FVRA 4ZHRA 1IKXA 4LH4A 5KI6A 1S6QB 1GX5A 5F8JA 3ZT2A 4CF2A 4KI6A 4I2QB 3IS9A 4I2PB 3RB0A 1RBUA 4RW9A 4WZMA 3CFOA 4LH5A 4KB1A 3AO5A 2G8UA 4BE2A 3VQBA 1WSHA 4EEYA 1KVAA 1NK0A 4WZQA 1L3VA 2IOCA 2QV6A 3EZUA 4BE0A 4CEQA 1J5OB 3KLVA 1JLEB 4IDKA 1S0OA 3K5MA 1TV6A 3ZSRA 4Q43A 3TVKA 4KFBA 5J2MA 2W9AA 1WLJA 3NKYA 5K14B 5KFBA 3VA0A 5L9XA 4K50A 3AA4A 2IM2A 4FLXA 4ZHRB 1T94A 1IKXB 3KHRA 4QWEA 1Z26A 4JV1A 1ASWA 3OHBA 4DFKA 4IRCA 2DFFA 2AJQA 3QEPA 1RTIA 3UPFA 4IKFA 1RILA 1C0UA 4B9SA 1QUVA 1RTDB 3CM5A 1RBVA 1L5UA 1U4BA 4PUOA 3UDLA 4CIGA 5HLFA 1KRPA 1NJZA 3L2VA 1BCOA 3HXMA 4DTPA 2OA8A 3DLEB 2V9WA 4JV0A 2WOMA 1S0MA 3PUFA 1YTUA 3E01A 2OYQA 3G10A 2C2EA 3H2LA 2DY4A 3LPUA 4DSKA 1BCMA 1LW2A 2PYJA 2R2TA 4OGEA 3Q8SB 1JLBB 4DWIA 5HBMB 3NF7A 3DLGB 3OL8A 3ITHA 5J2NA 3RR8A 3CO9A 3ZSQA 1RTJB 2Y1JA 2HHQA 4BDYA 1REVA 4J9MA 2GIRA 4ZP9A 3ZSYA 4Y1DA 1WN7A 3KIOA 4AHRA 2O4IA 3O4NA 2XY6A 4YQWA 4PUOB 4EBDA 2Z1GA 2G8VA 3VQ9A 4M45A 1N48A 2W8LA 4FZYA 5T7BA 3PW4A 2FLPA 3PVXA 4CF9A 4K8XA 2IJFA 1RNHA 1A5XA 1NJXA 3E01B 3LANA 3K5OA 4WYLA 3WNGA 3KTQA 2PYLA 1LW2B 3LZIA 4CGHA 3FQKA 2RKIA 5DMRA 3G6VA 3PX4A 4YMEA 1QQCA 4EYIB 1RT3A 2KZZA 3QZ7A 1C1CA 4RNHA 2HNYA 1SKSA 5DG9A 2R7YA 4AHVA 4K4VA 3TR8A 3IN5A 1S0NA 1UOCA 2C2DA 3ZSWA 4DFJA 4IR1A 2RDIA 2OPPA 4H4MA 3BREA 1BQMB 3I0RA 4ICLA 1VSEA 3CJ4A 1R0AA 2V0NA 3DLRA 5J2QA 4RNFA 3UIQA 4K4SA 4H4OA 5HRRA 4ECYA 3TAMA 1XHXA 3LZJA 4Z4HA 2PZSA 3SQ2A 2QK9A 4B9NA 4Q5VA 4LY7A 3BQ0A 1VRTA 4EO8A 4DTXA 2R8JA 4F3OA 1S9GA 3M8PA 2OPSA 1YTAA 4G1QA 2HNYB 3UR0A 4CJSA 4HCCA 4WFYA 2W9BB 4CEEA 4EZ6A 2X78A 4BDPA 4W5OA 4FJJA 5SZTA 2YNHB 1HQEB 4F8RA 3I0RB 4QWBA 4DSFA 4ICLB 4Q0BB 2D7SA 1NKCA 1R0AB 1UA1A 3DLHA 5FRMA 5J2QB 2ITGA 4CEFA 2DPIA 4HHTA 4RU9A 3EYZA 2DTUA 4H4OB 3HO1A 3TAMB 4KV8B 1SH0A 4PWDA 3SJJA 1VRUA 3I0SA 4O3OA 2R2RA 1S1TB 1VRTB 4DTUA 5KFKA 4KB7A 1S9GB 1XR6A 5KT2A 4G1QB 3G6XA 3SPYA 3RR7A 4FJLA 3KMQA 5I42B 4NLWA 4H8KA 2BANA 4AHSA 4M3XA 4XPCA 5DQGA 3NGZA 3NF6A 1NKEA 5KG7A 3P5JA 4DLGA 1LW0A 4FJXA 4IKAA 3QNOA 5DQHA 2BE2B 4C8LA 1WAJA 2QE5A 4B8AB 4M41A 3K5LA 4QWCA 4CGFA 3VQPA 4WXOA 4YR3A 2XY5A 3QIOA 2HNDA 4MKBA 3CJ3A 2GIQA 2O4GA 1VRUB 4KI4A 4RW6B 3HVTA 5KFSA 4B9UA 1S49A 1RT2B 3LP2B 1HYSA 3VQSA 2W7PA 4NLQA 4NLDA 4J2DA 5I3UA 1S1XA 3H40A 1UAXA 5KFAA 2B5JA 1RT1A 1N5YA 5KG6A 3RB4A 3MR6A 4CJ4A 4DFMA 3N6NA 4HTUA 4CHYA 2BANB 3QYYA 1IG9A 4K4WA 4CHQA 1TQLA 1HMVA 4CEDA 1LW0B 1RBRA 4N47A 4KB0A 4M3WA 4AH9A 3HT3A 3LDSA 2G8FA 5DQIA 2FJVA 2D0AA 2E6MA 5JXSA 2FVCA 3F9KA 4MFBB 3HVTB 3JSMA 4TYAA 1HYSB 3NF9A 4ID1A 4WE1B 1YVFA 3CWJA 4RUCA 1ZYQA 3HL8A 4DL4A 5I3UB 4K4YA 4FJNA 5KFEA 1RT1B 1N5YB 3GV8B 2E9RX 3DRPB 2J6SA 3BSOA 1JX4A 1IO2A 3AVKA 4Z4EA 3HVAA 2Z1IA 1RTHB 4ECQA 3MXIA 1K1SA 1OS5A 3OLAA 1KFSA 4E7IA 4ID5B 1O1WA 1XWLA 5C25B 3NH2A 4ZP6A 1C2PA 4TLRA 3OYLA 3H5XA 4ED8A 1VSDA 2W9CB 3LALA 1HPZA 5KG5A 4C8NA 4TYBA 3JSMB 2VWKA 2G8IA 1QS4A 3OYBA 2AWZA 1EXQA 3ULDA 5DG7A 3AVGA 4FJIA 3U6FA 4ELTA 3GILA 4RNOA 5KFOA 1RBTA 1CLQA 3V9SA 4R8UA 3QLHA 4IRKA 4ELUA 4YR0A 3NGYA 1QHTA 2HAIA 1Z25A 5F8LA 4EZ9A 1T7PA 1S9FA 4F4ZA 1D9FA 3BSCA 4FXDA 1ZTTA 4B9LA 4YFUA 4B3OA 3TI0A 1TK5A 1TGOA 3KK2A 1S6PB 1JLGB 3KLIA 3VQ4A 4K4XA 3OS0A 5DK5A 4EO6A 3TANA 4O55A 1RT5B 3HM9A 1FKPB 3SUPA 4O3RA 4IOBA 4ED2A 3GIJA 1JL2A 1NK7A 4N76A 3M8RA 3KKRA 5KFFA 3UQSA 5KFMA 4CCHA 4MH8A 3IRXA 4ECTA 4FVMA 4CK2A 2B4JA 2HMIA 1NOZA 4DL2A 2C28A 4RW8A 4R8UB 4KREA 4OL8A 1CSJA 4J9NA 2JEJA 3WNEA 1TKZB 1T03A 1SL1A 4CJVA 4FM2A 3OYCA 1JKHB 5C42A 3M9NB 1U49A 1S48A 3MFHA 3QGHA 1C0TA 5F8MA 1JLQA 3WNHA 5DLFA 4CEZA 5KFUA 2FLLA 3RBDA 3BQ2A 4O4RA 2VA3A 4CJTA 3KLIB 4EYHB 4KTZA 1JLAB 4KE5A 1HNVA 4CJWA 3NCIA 5KT4A 4CJEA 4DF4A 5C24B 3MECA 1S6QA 2YKNA 4KKOA 5CYQB 4I2QA 4J2AA 3QETA 4J9KA 5KFLA 1RDRA 4BACA 4KHYA 4KO0B 4CJKA 2P5GA 4MIBA 2NUBA 1RDBA 4RW8B 3OYGA 1WSGA 4URGA 3LWMA 1J5OA 3V9XA 3M8QA 1S5JA 4RNNA 1CXUA 4GC7A 5C42B 3ZSVA 1C0TB 1D1UA 3P1GA 3HJFA 1C1AA 4BDZA 4NLTA 5K14A 4B8CA 4ZPCA 4CJUA 4DSIA 1VSLA 4O0IA 1SKWA 2FVQA 3MECB 4DQPA 3AA3A 2YKNB 4KKOB 1KTQA 4O3PA 4K4TA 2XCAA 1WSIA 4CIFA 4TY8A 4QWDA 2JC1A 3K59A 4IBNA 4NLYA 3QGIA 1NKBA 4RG8A 3QEXA 3LWLA 1S97A 3AVHA 1B9FA 2XO7A 4M95A 4WFXA 4X2BA 1CZBA 3N6LA 2JEIA 2F96A 4IG0B 4FW1A 2AU0A 3OJUA 2PY5A 1I39A 1RYRA 1YT3A 4FK2A 3D0PA 1RCHA 4ECZA 1FKOB 1RTDA 3L2WA 3M8QB 2WCXA 3QO9B 4QWAA 1KSPA 3LAKA 3CIZA 3Q8RB 3ZSXA 1UWBA 4FLZA 1RDAA 2B43A 3SI8A 3L2RA 2HWIA 4N56A 1RT4B 3ASMA 3QNNA 2GC8A 3DLEA 4Q8EA 1KVBA 3H98A 4DG1B 2YHAA 1QSSA 2V4RA 3VQ7A 4TY9A 2QXFA 3KHGA 2ZE2A 4DTMA 4B9VA 3AO1A 4Y1CA 5EU7A 3O3FA 2DFEA 1S1VA 4NCAA 1JLBA 1TKTB 2FC0A 3SUOA 5HBMA 4TY8B 3DLGA 1J53A 3OSNA 1RDCA 2GV9A 4W5TA 3HHKA 4KHWA 3MEDA 1RTJA 3ZT4A 1UA0A 4FYDA 3NGIA 3M9MB 3O4QA 4FK0A 4KHSA 2HHSA 1SH2A 1LWFA 3D28A 4CJLA 1UWBB 2ZKUA 3NAIA 3AVNA 1RDDA 4XIUA 1TL3A 4FJKA 2AGQA 1EX4A 1K6YA 4E19A 2YNFA 4E7KA 1JXEA 4F3TA 3SUNA 1Q8IA 4J9LA 1LAWA 3C6TB 2UUTA 4DQSA 4FBUA 1XC9A 4OGCA 4CEBA 4CFDA 2ZE2B 4M42A 3VQ6A 3OS2A 1S1VB 5FROA 1QSYA 1BI4A 1BISA 3VQ8A 4FS2A 2D3UA 3HVWA 1XR5A 3GYNA 4CERA 3MEDB 1WSFA 4ZP8A 2UVRA 4CECA 5KFXA 3V9UA 4I9QA 4NLSA 1LWFB 1JIHA 3LP0A 2UVWA 1TL3B 3DRRB 3KLFB 3HP9A 4CJRA 3I5BA 3AA5X 1BQMA 2YNFB 3OJSA 5CZ2A 2HVHA 3H08A 3BSAA 1CXQA 1J54A 4B9TA 4FLUA 2P51A 1N6QA 3M9OB 1BI4B 2W7OA 3KLEA 4NLRA 1TK8A 2A1SA 4F2RA 1U45A 4NLVA 3CDUA 2KFNA 4Y34A 1HARA 2VG5A 2CJQA 3HPOA 4IH7A 4OLAA 2AX1A 4DFPA 4FLYA 2HNZB 3G0ZA 4ZPAA 2OPRA 3QIDA 3BR9A 2W9BA 4LSLA 1LAVA 2HHUA 4E3SA 3LP0B 4FLTA 5KGXA 3NDKA 3LAMA 2YNGB 5CYMB 1D8YA 2YNHA 2XHBA 1HQEA 2XY8A 4Q0BA 4DU1A 2FVSA 4I7FB 4OLBA 3SQ1A 4KV8A 3BQ1A 5EWFA 5JS1A 3MFIA 1N6QB 4Q44A 1T3NA 3SCXA 3TAQA 3KLEB 4CK3A 2FBXA 4DQIA 1S1TA 1ZBFA 4ECWA 2P1JA 2RPIA 2ASLA 4CGDA 2VG5B 4ED6A 3ISND 2G8KA 2ATQA 5I42A 3AVIA 3C94A 4LSNA 4B9MA 4IG3B 2OPRB 2ETJA 3TABA 4LSLB 2UVUA 3L2QA 3P83D 3ICLA 4AHCA 4XPEA 2JEFA 1K1QA 3RMCA 2FVPA 2BE2A 2YV0X 3IAYA 3OYJA 2KTQA 2D0BA 1T05B 3DLKA 1NHVA 2G8WA 5HRPA 4KRFA 3RAXA 4DLEA 1X9WA 3MEEA 3C95A 4RW6A 1KVCA 2C2RA 2FBVA 4HVJA 1RT2A 3LP2A 5KFHA 4EBEA 5L1IA 3V6KA 1S1WB 3O3GA 2WHOA 3PW0A 5HRSA 3CJ2A 5KFVA 3L8BA 4ZVHA 3MF5A 4O44B 3DOLB 1JLCA 3RRGA 4DTOA 3PW5A 5DGAA 4NYNA 5F8NA 4LSNB 4NRUA 1ZTWA 5CY4A 1HYVA 3OYDA 4GVMA 4RW7B 5E41A 4ZVGA 2Y1IA 4KTQA 2XRIA 3ZCMA 4KHUA 3V4IB 2D0CA 1U47A 3DLKB 3OYEA 4K4ZA 3PJWA 3MXJA 4I9LA 1S9EA 3MEEB 4MFBA 1SL0A 5T14A 3CVKA 4E7JA 2UUWA 2VG7B 4WE1A 3NL0A 1BIZA 1VSIA 1MMLA 4NYFA 1QTMA 1JLCB 2WB4A 5KRSA 3DRPA 1I3AA 1MU2A 4RNMA 4FZXC 3L3VA 1TKXB 4NLPA 1RTHA 4CJFA 5F8IA 3TQ1A 4JUZA 4ID5A 5D3GB 4HKQA 3AVCA 4CEAA 3HKWA 5C25A 1C0MA 1U04A 3V6HA 4IR9A 3G86A 1RT7A 3OLBA 3ZSOA 4KPYA 4AHUA 2W9CA 1QSLA 2IMWP 1S9EB 3KLGB 3OL6A 2R8HA 1L3SA 3CYMA 4DQQA 3O3HA 3D45A 4F4WA 4E1NA 2IAJA 4W5NA 2RF2A 1C6VA 3KK3B 3H4DA 3KHHA 1RAJA 3RRHA 4ECVA 3QGGA 3AVLA 3KD5E 3I5AA 3ISNC 4KHQA 1MU2B 1Q9YA 4KTWA 4DQRA 5J1EB 2DFHA 4J9OA 4O4GA 3T5LA 5FRNA 3Q8PB 3BDPA 4K8ZA 1S6PA 1JLGA 2KQ2A 1RT7B 2C22A 3GQCA 3RB3A 2HHXA 1DTTB 3PR5B 1GOCA 4DS5A 5KG2A 1RT5A 2R2SA 3SUQA 4F4KA 1FKPA 4CHZA 2ALZA 2AGPA 4EP4A 4QPXA 3GV7B 2AQ4A 1HQUA 5SWMA 2IAJB 2RF2B 3B6PA 1X9MA 3PHEA 4CF1A 4CJQA 3T5KA 1ZBLA 1WNSA 4OKKA 3GIMA 4CESA 4NCGB 4HUEA 1TKZA 4OKEA 4MK7A 4M3YA 1JKHA 3TAGA 3SNNA 4WYWA 5KFQA 4JS5A 3OYNA 3DMJB 3PR4A 4O4GB 3RMBA 5KG4A 3EZ5A 3OYFA 4HCBA 2HWHA 1TAUA 4WFZA 1JLAA 4CE9A 4M3TA 1ZBIA 2KW4A 5C24A 3QIPB 2P5OA 1EETA 5L1JA 3AO2A 2ZD1B 3IGVA 3RMAA 2XCPA 5CYQA 3PW2A 5KFNA 3SYZA 1HQUB 2EHGA 1KLMA 4KO0A 4C8KA 2IDOA 4PQUB 3T1AA 1WAFA 5EDWA 2IM1A 3PY8A 2LSNA 3CFRA 4R5PB 5KFYA 3I5CA 3HPHA 1BIUA 4MQ3A 4LD0A 3K57A 4ECRA 4CIEA 3RB6A 3Q8QB 5KGWA 4ECSA 3CG7A 3AVJA 2WK4A 4PA1A 3QEVA 4GMJB 4DS4A 1NK9A 3KKSA 1EETB 4CF0A 4M3RA 4Q8FA 1LV5A 1GOAA 2E9TA 3V6DB 3VQEA 2IM3A 3V81B 1KLMB 4ZTJA 3TWHA 1ITGA 3AVMA 4EP5A 4U6PA 2QKBA 2BRKA 4ZP7A 4OVLA 4IG0A 4BE1A 3N6MA 1ZBHA 1FKOA 3AV9A 3QO9A 2BR0A 1VK0A 5HRNA 3KK1A 1TVRB 1IM4A 3PO4A 3DYAA 3QINA 3LP3A 1RT4A 4BWMA 2FJWA 4FJ5A 1HJRA 4FCYA 2I5JB 4R0EA 4DL6A 1NJYA 2W42A 4QCLA 3DDKA 1VSJA 4DG1A 1QE1A 2XGPA 4N41A 2ATLA 4DL7A 5KFDA 4O3NA 5DGBA 1L3TA 3S9HA 2IGIA 1LWCB 3I8DA 4J9SA 1TKTA 5KG3A 4O3QA 3CQ8A 2HVIA 2X74A 3HP6A 3FFIB 4JS4A 4E0DA 1SV5A 3NBPB 5HP1A 2YNIA 5KFJA 2BQRA 1QAIA 3AO3A 4ELVA 3IG1B 3T19A 2XI2A 1NK4A 3FSIA 1BGXT 3KMSA 3VN5A 2HHWA 2Z1JA 3HYFA 3SQ4A 1S1UA 4DL3A 4KSEB 3KK1B 1D9DA 2F8SA 3DYAB 4CGJA 4YR2A 4NLXA 3MR5A 2RN2A 3PV8A 3SI6A 2FBYA 4IFVA 2R2UA 4Y2CA 1CZ9A 2HB5A 4J9RA 1LWEB 2A1RA 4CGIA 3MXMA 3SFUA 3C6TA 2E6LA 4NLUA 1QE1B 2OPQB 2YKMA 4ED1A 3TAPA
chains in the Genus database with same CATH superfamily
4KGZB 4DU8A 1GOBA 5CHIA 4JKEA 3MUMP 2RE2A 7FDRA 1T11A 2NRRA 2ADBA 4OPHA 3DDIA 4QR0A 3SSSA 2QWLA 5E84A 3BPSP 3BKTA 3IS9B 4NB4A 3CCMN 4DR3K 4HVZA 2KZMA 3NGDA 5E0OA 3KLFA 3DAWA 1WSJA 5B7WA 4FP9A 5KFRA 5M1FA 4BRLA 3AO4A 5HQMA 4DL5A 1VC0A 1YJNN 3LO3A 1RACB 1X9JA 1N33K 4LVOP 3VA3A 1LFPA 3ET6B 3CDBA 1OY9A 3K0JA 2GHWA 1CJTA 5E33A 3BGRA 1TKDA 4JI5J 4LQ3A 1UFLA 5AQWA 1IBKJ 2OP5A 2JGUA 4MLHA 1KQGB 1IBKF 3KK7A 2DIVA 2XNQA 4M1KA 4RBUA 3RYLA 3E51A 4K5RA 1SL2A 3PIPL 4A4JA 2KRBA 2CJXB 2D41A 5DO2A 4GV6A 3QERA 1WELA 1NJWA 3OY9A 3CUNA 1TFYA 4ED7A 1C0UB 1RA6A 2DXEA 4C8MA 2IBKA 3NAHA 1N5QA 1HD0A 3G6YA 1NDKA 2PBDA 1N8RO 3BBFA 1SJ4P 3OFEA 4MK9A 4LFCF 1PBUA 4FZVA 2G1DA 3AD7C 2FHKA 1CS4A 4M5IA 2EPIA 2WOMB 1CJTB 3BGRB 3BO4A 2YHBA 3GE9A 2E9ZA 5HSPA 1UVNA 3TAEA 4WFAL 3DU5A 1IBKK 1OQ6A 2DBBA 4RO0A 1SH3A 2DHGA 5DG8A 3J7A1 4HT5A 1WTBA 3GFHA 3HHLC 3CJ9A 4ZVEA 4ERDA 1T05A 1FXDA 3I55N 3RW6A 3CDEA 1H72C 1T9YA 2YWFA 2NQPA 4YB5A 3VV2B 2H5JB 2UUAJ 3D68A 2NZ4A 2UUAF 4DEZA 4LFCK 2DK2A 4BVOA 4KRWA 2ILYA 1CS4B 5KT3A 1EQYA 1RT6A 2V69A 2DHAA 4JI3F 2XSJB 3L2UA 2BE7D 2MKKA 4OKJA 4Y00A 1G2EA 4GC6A 4DX7A 3CJ5A 2ZEJA 1WSRA 5EWEA 3RSEB 1HIYA 1HNXK 1RT3B 1LEOA 3O9RA 4C97A 1NLVA 5BRFA 1MROA 1Y10A 4LMZA 2C3PA 2BJ3A 2CNKB 2HOEA 2E2PA 4H4MB 1K73O 3EY1A 3MGJA 5IC6B 5KFTA 3OYKA 4X4QA 3GR1A 4CLTA 1RT6B 5KFZA 2R7QA 3UKRA 4JI3K 1I6JA 1S72N 1VRQC 2DNLA 4QU6A 2B6AA 2GQCA 3FZHA 3CCVS 4USWA 5HVGA 1BHLA 4KAZA 1WORA 2AGOA 4J9UE 5HN0A 1Y11A 3TARA 1ICEB 2F40A 3LDLA 3OYIA 2K8GA 4A2AA 1X5PA 4Y3CA 1KQKA 2VZ9A 5ETKA 3MTJA 4NRTA 3D1HA 1K47A 2FXUA 4IXCA 3SAFA 4FS1A 1NGAA 2RD5C 3EPGA 3Q7BA 4C9DA 2QX0A 4CH7A 5IT0A 5IWAF 1X9SA 3UKRB 4O23A 4YB7A 2OFHX 4OYMA 4TSXA 5JUMA 3F44A 2B6AB 2UU9J 1VQ8N 3OT9A 2MHEA 1WSEA 4H5VA 3AVFA 1WF0A 2ZM6J 2XMAA 5EVZA 3CMES 3OTDA 3DI6A 4BR4A 4JI6J 2VQEJ 5I3PA 3PX6A 4JI6F 2VQEF 3T5HA 2P9SA 5F9NA 2GUIA 2JLEA 4KGMA 4OHYA 4TXSA 2BM0A 3IAM9 4HYKA 2V2ZA 1VSHA 1I1GA 4CYUB 1X1PA 1ATNA 4MKYA 3H59A 3MM7A 3S3OA 3U3GA 2GGPA 5IWAK 2GJ2A 2MLZA 4DU4A 4ZN1A 2D69A 2N7CA 1X31C 1EKSA 4FW2A 2B5JB 3DI6B 2D0PA 5EX0A 3WXKA 3CMAS 4OPJA 1DTQA 1BY9A 3UB5A 4CLPA 1Z2LA 1GLEG 4JI6K 2QRRA 3LDOA 2VQEK 2P9SB 2RQMA 4YHHJ 3OYHA 2ZD1A 3Q83A 1NJIT 3NNAA 4YHHF 4YY3J 3LGHA 2FTRA 2YWHA 4MIAA 2YJEA 1VYAA 3NHGA 3HULA 3MM7B 3SV3A 1JCEA 2C2NA 4NLBA 2O8DA 2EWHA 4ZCIA 1VLYA 4TKTA 4FJGA 5CZ1A 2DRDA 3CC4S 3FSYA 1EWRA 1IJEB 4CJ5A 1H74A 2ZJPL 1BXNA 1XR7A 1DTQB 3BH7B 3GG0A 4AILC 1BHNA 2V8PA 2Q0UA 4JI4J 2NXCA 4V19X 3LPYA 4AF1A 1QAJA 1NNEA 5FLXY 2OAUA 2P9NB 5L39A 2HPUA 4CZIA 4YHHK 4RX6A 3HFVA 1IKYA 3M8SA 1Q1KA 2AX0A 3QEWA 2IC3A 2O8DB 2HHTA 3OXFA 3QZ8A 2D1KA 4A8YA 1GTHA 2D3O1 2PA3A 1TVRA 1PJ7A 3MEKA 1UW9A 3NF8A 4BGBA 5TKWA 2CADA 1YI2N 1HBOA 4Z0UA 2E5HA 2I1RA 1HBNB 4TNOA 1UAWA 3QJJA 1LWCA 1KP6A 3JYTA 2DCLA 1VQPN 1FVSA 3M6WA 4UF4A 5AQUA 1A5VA 3FRZA 1LFWA 1IKYB 4LIRA 4ECXA 3WIUA 2IC3B 4OHXA 1DAXA 4KHPF 5IM0A 4LF1A 4NEYA 3O2IA 4ILRA 3SQ0A 3IRXB 3NCPA 4J90A 5AQGA 1ZBUA 1H2VZ 3F73A 1AFJA 3ZO7A 2QFJA 3BSNA 3FE1A 4CK1A 2BUNA 1JLEA 2OPQA 1HBOB 3MAQA 2UXCJ 3CFPA 2F8MA 1NHUA 1R0CB 2XY7A 3BM7A 3D0HE 3HD1A 1G1XA 3JYTB 4BR9A 4ZLJA 3OSPA 4LF5J 4NYPA 2Z56B 4N5SA 1MN9A 3BN7A 3WUHA 1DLOA 3KJQB 2M8HA 2FVRA 4DMZA 1GX5A 5F8JA 3R6GB 1EAYC 3ZT2A 4I2QB 5IM0B 1ROFA 4KHPK 2MJUA 3AO5A 5IV3A 4EEYA 3MCOA 1X4HA 2QV6A 3EZUA 4IOXA 4BLGA 4BE0A 2AMCB 4CEQA 5B0GA 2NRVA 2RQCA 2XMMA 1JLEB 3UN3A 3LUYA 1T9VA 5HQLA 5HMZA 3BUZB 4Q43A 1E4FT 1OYDA 3TVKA 3NKYA 2DNZA 2N4DA 4BRHA 2IYGA 3VA0A 4BR2A 4DKWA 3AA4A 2IM2A 3P8BB 2ROPA 2YH0A 3D0GE 1Z26A 1F9FA 2HFNA 3PTWA 2Q66A 4RWWA 1UL3A 1VQKN 3OQ2A 5GADU 1N36J 3GWCA 3LM2A 3C2PA 2AJQA 4ENOA 4DOZA 2G2OA 1RTIA 5BN8A 4DI6A 1SPBP 2MQNA 4B9SA 1QUVA 2IDLA 1E6YA 2QA4G 6AT1B 4CIGA 3E2EA 3O8WA 4EMDA 4BC2A 3HXMA 3J7YP 3QSYB 2ZWOA 1Z2ZA 2X7IA 1LOTB 4NZ7A 5GVQA 3F2KA 2DY4A 2MJNA 5AQPA 3LPUA 2O3DA 3M2UA 1FX4A 3Q8SB 1JLBB 2HMPA 4B1UB 4CH0S 4DWIA 3ZTQA 1UETA 4ILHA 2I9SA 2HGMA 4RJVA 4ZS6A 4IOCL 2FD2A 4JI2F 3CO9A 2HHQA 4DX5A 4H4KA 4NXNF 2GHPA 2GV1A 1NDCA 3AGKA 4Y1DA 4AHRA 4BQZA 3D7SB 2XY6A 1FDNA 5LJ3Y 1E6YB 4Z2XA 2Z1GA 2OEKA 3VQ9A 5LMUF 3NVKA 3C66A 1SS6A 4M45A 3DJCA 2NZCA 4FZYA 1RHQB 2VUGA 4CVNE 3JTOA 2NPFA 3PVXA 3VF4A 2XMKA 1RU2A 2IJFA 4AD6A 2O8BB 2ZGZA 1U8SA 3ID6A 3C15A 1MLAA 1V4SA 3LANA 4OMFG 1HHTP 2M52A 4UOFA 2PYLA 3M2UB 2HF3A 5HJXA 2QYGA 4H0PA 3LGNA 5LSLA 3CQYA 4CGHA 3S8SA 4JN4A 4JI2K 4EYIB 2PAVA 4P74A 4I56A 4DR1J 2E5LJ 4RNHA 1SKSA 5DG9A 4NXNK 5E7OB 2V5HG 2E5LF 4GVBA 3U1MA 1UOCA 4PKHA 4JV5F 3E3XA 4DFJA 2DCUB 4AFFA 5LMUK 4GNIA 5E3CA 1LK7A 5EXWA 1SJQA 3I0RA 3GONA 1VI7A 3S6EA 5AQQA 5M1QA 2PEBA 4WTOB 3MCAB 3S1TA 5BPLA 3X1LB 3AOCA 3B4MA 3LZJA 2RT3A 3TRGA 4A61A 1UJ4A 3BQ0A 2P9EA 1UVLA 1X3NA 3M8PA 2OPSA 1TYQB 4G1QA 1EQMA 1YJTA 2DGUA 4CBXA 3UR0A 1M0SA 2NLXA 4CJSA 4HCCA 1VQNN 3UCUP 4JV5K 4CEEA 1H2TZ 1NWKA 1VQ9N 2J0QD 4F8RA 3I0RB 1TMMA 4FWMA 5ETPA 4RU9A 4HHTA 3EYZA 3M8WA 2KJVA 2FSKA 3F56A 1ZA1B 3SCKE 4PWDA 1VRUA 3FZKA 3C6HA 4O3OA 1NH8A 4N77A 2ZC3A 4TU7A 2DH7A 1S1TB 1S79A 2L48A 5I4MA 4KB7A 1FDAA 1XR6A 4G1QB 2QW9A 1U1PA 2QEXS 3GFZA 1P9YA 2DNKA 5RUBA 1HWKA 5I42B 2W6LA 3K0SA 2V94A 2FJEB 3FGVA 4X4TA 4M3XA 4XPCA 2AZ1A 2W2QP 1AT1B 4CO0A 4LF4J 3P5JA 4CDIA 4DLGA 1CZAN 1F2GA 3QNOA 4CLYA 5DQHA 4C8LA 1XMQJ 1ZM4A 2QE5A 4CD1A 3TSQA 1YZ6A 3ETOA 3VQPA 4WXOA 4YR3A 4NX9A 2GIQA 2MMYA 3I6PA 5EX3A 2UYTA 3HSGA 1VRUB 1DKGD 4B9UA 1F0XA 1HYSA 3LP2B 2W7PA 4NLQA 1YUWA 3DXBA 2R9LA 2FGOA 1RT1A 5KG6A 3PSIA 3N6NA 3W66A 5BN9A 4HTUA 1C0FA 2V7ZA 2E2QA 2DR7A 2YWEA 5AXLA 5D4NA 1TQLA 2DGWA 1RBRA 3MN5A 4KB0A 1IV0A 4M3WA 3HT3A 5AQJA 3LDSA 2K1RA 3FBFA 1WOQA 2D0AA 1DQAA 4MFBB 1NU4A 4LF9F 3JSMA 1HYSB 3NF9A 2QM1A 1RUSA 3D2WA 2HFOA 1Q8KA 4DL4A 2F65A 5KFEA 1RT1B 3EVMA 2VQFJ 4I4BA 1NSPA 2GIFA 2VQFF 2EEYA 3ZZZA 4FVCA 4GKJJ 2KVQE 1U6ZA 4U7BA 2DRBA 1K1SA 4XH1A 1KFSA 3T1YJ 2BBEA 3K2YA 4HTLA 1NUEA 1D9AA 2GUPA 2K1RB 4DPWA 1R31A 2EFQA 2EK1A 4OI1A 3VERA 1BO5O 3LALA 2F9JA 5KG5A 2BXJA 4TYBA 3JSMB 2VWKA 1T9TA 4LF9K 4DV5J 3OYBA 2FZCB 2NXEA 2HGNA 3U6FA 1NMEB 4USTA 3BBBA 3OR1A 5T7LB 2DGXA 4OO1J 4U8YA 4YR0A 5LJVA 2VQFK 2VHGA 3G2XA 2YHYA 4CTAA 4DDFA 4PG8A 4ZJQA 3U4LA 3W2WA 2LA4A 4Z7CA 1W26A 4B9LA 1TK5A 1TGOA 1U1LA 2ZOMA 3MX2A 2MKCA 2D0OA 3OS0A 5DK5A 1R8AA 4G1PA 2CG8A 5H9EJ 1YHQS 4O55A 1RT5B 3HM9A 1ZPVA 2KKHA 4O3RA 4X62F 3GIJA 3CC7S 1B64A 1JL2A 3GJQB 3UQSA 5KFMA 4CCHA 5MAOA 4ECTA 2QSFA 3MN7A 1N5VA 1FWLA 2HMIA 1NOZA 2V63A 4DL2A 3OR1B 1V3SA 2GQ2A 3P4UB 2Y8YA 4OL8A 3J81O 1CSJA 4J9NA 2CA9A 3WNEA 1SL1A 2YTCA 4FM2A 5C42A 3QT7A 1S48A 3MFHA 3QGHA 4ZLNA 1EKRA 1MN7A 1JLQA 1F2HA 3B8HA 1FE0A 2FLLA 2CDQA 5AQMA 4CJTA 4KTZA 2QLXA 1HNVA 2P9GA 3H2VE 5KT4A 1U6BA 3BV8A 3CIPA 2AYMA 3FEYB 5CYQB 3HSDA 2X1BA 4X62K 1RDRA 4DV4K 4KHYA 3O4WA 4CJKA 3FVYA 1HKBA 2PI5A 1RDBA 2PDAA 2DJWA 4FPRA 4XDDA 4LT6A 3ZX3A 1ZAXA 2RRNA 1WSGA 2KRRA 1RGIA 5C42B 3BF1A 2HWTA 3ENBA 5GAGP 3VR1A 3EGVA 5K14A 4B8CA 4O0IA 3EN9A 2XNRA 4FYWB 2QYCA 2X3DA 2XCAA 4ES1A 2MKYA 4C1NK 3HI9A 2BKNA 4NLYA 1CJKA 2CG4A 2ZZTA 2XLKA 1SIZA 2C42A 3EM1A 2VBWA 4IG0B 2HBYB 2E1PA 4FK2A 4F67A 2VOPA 1RZMA 1UWBA 2H65B 3SI8A 2HWIA 3R1XA 1RT4B 3THYA 3DLEA 2C2KB 4LF8F 2E2OA 2Z4PA 1N32J 4USKA 1HHQA 4L3NA 1IQZA 3VENA 3O3FA 3D6HB 3N4QA 4NCAA 3K9KA 2HBQB 2IRUA 4BCAA 5HBMA 1J53A 5CD4A 4PXBA 1RWUA 1KDNA 1CJKB 2G2ZA 4W5TA 3HHKA 3MEDA 2VPWB 4FYDA 1Q4RA 2NSBA 4JKDA 3M9MB 1KQFB 3UDEA 1ACMB 1XNRF 2OTLS 2GX9A 5B08A 4LF7J 1UWBB 5IQQA 4XIUA 3FJ2A 3NOGA 2AGQA 3THYB 1EX4A 4C3MA 1I94F 3BYPA 4EFHA 4F3TA 3P45B 4LF8K 4DQSA 1XC9A 3IBCB 2P2CB 3OS2A 4USVA 2W2NP 2WVEA 1BI4A 3G4SN 2VDIA 4F25A 1GLJO 3GYNA 4CERA 4ITSA 3MEDB 3J7YI 1DT9A 5C15A 4CECA 3G71S 4AUKA 1FT8A 4F3MA 1XNRK 3W2VB 3V9UA 4I9QA 2RNEA 3LP0A 1U2CA 4DBQA 2XZTB 4UW2A 1Q86O 5A0YA 3VGLA 2C2ZB 1EJ7L 3SCIE 1I94K 3L4IA 1Y9OA 4ANCA 1J54A 2WVBA 4MKVA 2HZCA 4M5NA 1J5EF 2P51A 3F0NA 3C6AA 1BI4B 1Q8BA 4NLRA 1F9HA 1FNMA 1U45A 3CDUA 5LM7E 2D1CA 4L3QA 1E6VA 3EO3A 4Y34A 4PKIA 2RDDA 4W4MA 2HVEA 2W4DA 5GAHP 3CCSS 4DFPA 3T6JA 3T7ZA 4FLYA 2HNZB 4DV0J 4LSLA 2G0IA 3LP0B 5KGXA 4XH5A 1VQMS 5CYMB 1D8YA 3MAAB 2XHBA 3PYFA 4Q0BA 2RSQA 4JKAA 3NXZA 2KHOA 2ZF5O 2PSZA 3BQ1A 3HHLB 5JS1A 5BR8J 3FMBA 4ZKAA 1J5EK 2CGLA 2RRBA 2DISA 4K43A 3R8EA 3TAQA 2PFUA 2HFUA 2AV5A 4DQIA 2OJ3A 1ZBFA 4ECWA 1VBXA 1E6VB 2GNKA 3TTDA 4CGDA 4ED6A 2G8KA 5IFMA 4HHJA 4USUA 4KT0C 4IG3B 4O5FA 5CR4A 2ETJA 4F26A 4LSLB 2ZZNA 3ICLA 2UUBJ 4AHCA 4XPEA 3RMCA 2BUPA 2B9XA 3ZTRA 2RHQB 2D0BA 2O8CA 2W2PP 1NHVA 5HRPA 4KRFA 4CT9A 3HMJG 1BUPA 4HVJA 5KFHA 5L1IA 4J9VA 2D3OR 1VQYA 3H42A 3O3GA 3FZBA 1Q5VA 3CJ2A 2Y9HA 3L8BA 2LXIA 3MF5A 4DV3F 3TTFA 3ZFVA 2A40A 3PW5A 2Q0RA 2EFNA 5F8NA 4JKFA 2I7PA 3U9ZA 3CCSN 2BABA 4HHHA 2WW8A 5CXTA 2Y1LB 2D0CA 2O8CB 5A2QU 3G8SA 2GCFA 2C2OB 4I9LA 2CWXA 1YBUA 5E5NA 4DCOB 2VG7B 4WE1A 3NL0A 1XQIA 1S6UA 1RWMB 3EWGA 4C0HA 1XTZA 4DV3K 4DUYJ 1U8WA 4MJKA 1O51A 1UTAA 4C3KA 1XBWA 4DUYF 1RWXB 4PG4A 2QA1A 1GLCG 1YZ7A 5D3GB 3AVCA 3UDCA 2VONA 3V6HA 3M8YA 3G86A 3OLBA 1X5SA 4FWLA 3ZSOA 2CJ9A 2ZJRQ 2IMWP 2CNNB 2R7UA 2HS3A 3CPEA 3OL6A 4LFAJ 2EXUA 2PN6A 4DQQA 4WU2A 3ZZ0A 2QLWA 1R27B 2RF2A 1C6VA 2I7NA 1FE4A 3H4DA 2B51A 3I5AA 4DUYK 4DV7J 4KTWA 4DQRA 4KC5A 3W5YA 5J1EB 5A8RB 3R3LA 3JQJA 1KAXA 4DV7F 1XUPO 1FWPA 2DFHA 4ZDNA 1KEKA 3WXJA 5FRNA 3GTYX 3CCTA 2H51B 4K8ZA 2XYHB 3D54A 2J0SD 3G9CA 5HL7L 2ZWPA 1Q7YT 2DH9A 5KG2A 3TX0A 1NLKL 3R5CA 4F4KA 3KZBA 2ALZA 4IYQA 4IEIA 1HQUA 2RF2B 2F4VJ 4UY85 4B3TK 1RCXB 3W7BA 1WNSA 1V9OA 4OKKA 3FEZA 5LJWA 1CULA 4NCGB 5CYJA 2HBLA 5AQXA 1TKZA 3B6BA 4MK7A 1T9XA 5HL7Q 4WYBA 1KD1T 5KFQA 4JS5A 5GINA 3PR4A 5CCLA 3J81Y 2R3VA 3HD2A 3M6VA 4CLKA 2V8HA 1NZAA 3OYFA 2KN4A 1TAUA 4WFZA 4CE9A 1ZBIA 1R6VA 2ASPA 4X66J 5L1JA 3EE8A 3MCNA 2DGSA 1WDTA 1RTZA 3MM5B 5KFNA 1HQUB 2FC8A 3GSIA 3OFHA 4USMA 3MWBA 4KO0A 3UW1A 1EARA 4PQUB 1CULB 3I32A 2KXFA 4R5PB 3ZZRA 3EDRB 4ZVPB 3ELHA 3HPHA 1BIUA 4X4VA 1UVMA 1WEYA 3K57A 3M3ZA 1WF1A 4OZJA 4CIEA 4ECSA 3BGLA 2VFVA 1P8ZA 3DHXA 4NMXA 4NLCA 1IWGA 4PA1A 4DS4A 2XMWA 2Z2LA 3E9OA 1GNKA 4DCHA 3JTPA 4CF0A 2YWKA 1RAGB 1FTRA 1Q5YA 4ZTJA 3TWHA 1ITGA 1G7CB 2QKBA 2QI2A 1Z05A 3CJTA 3AA9A 4O0NA 2LQ9A 2PA8D 1K8AO 2JH3A 2DPNA 3LGMA 1GMUA 1R8CA 3MHYA 3DYAA 3LP3A 1JNZB 1FEHA 4PCQA 2FJWA 1HJRA 4FCYA 2I5JB 4ZN3A 1MNEA 4ZOSA 2QWRA 4DG1A 3MPDA 4WBFA 4H5WA 3EZWA 2DNQA 5DGBA 1L3TA 2YPZA 3M2VA 1TKTA 4ZLLA 5ADXA 4JS4A 4ZLPA 5GAGI 1SV5A 3UE2A 1JB0C 3OTOF 2HHHF 5KAKA 3T19A 2JJ4D 4ZCLA 3FSIA 1WG4A 2HHWA 1S1UA 2LP4A 3NP5A 1YBTA 5AQNA 1D9DA 3DYAB 1NGDA 4EIAA 1YJRA 2RN2A 4A5AA 1E4GT 3SI6A 1X0PA 2CQ3A 4IDHA 3MMCA 3HHLD 2BMBA 1FJGF 2HB5A 1LWEB 1QVFR 3TUJC 4WQ4A 3TJ9A 3C6TA 3CDAA 3KWIA 2LVWA 4PRFA 4Y28C 4LF6F 3M2VB 1G3OA 2KG1A 1JLFB 1B4SA 2GVDA 3IA0A 1U25A 1SV5B 1GMWD 5F9LA 1S4EA 1S57A 3OTOK 2HHHK 1GFWB 4W5QA 4E1JA 1RU1A 4XK8C 5KRTA 4BROA 1S1UB 3VAFA 4RW9B 2XS2A 3W1YC 3UVJA 3G6ES 1RKJA 1OYEA 1RDWX 3DRRA 1XMBA 3P5BP 1PJ6A 3J80O 3R1HA 3P4IA 1FJGK 1BQNA 3DGVA 2CWKA 2HW3A 1VQ4S 2OH2A 4F0HA 2X6SA 2IYIA 4M94A 4LF6K 3ENVA 5BRDA 1R8HA 4KFBB 5AXMA 5J2MB 2CQDA 4KBIA 2IY5B 2GVDB 4CO3A 2HQGA 3H90A 1QUPA 4UQGA 4A48A 3C65A 3NH0A 4TQSA 1QJHA 2K06A 4ZPBA 3EPIA 3MD1A 2D5RA 4PL8A 3ULHA 2HHVA 3OHAA 2NPIA 2FDNA 2WVDA 3W65A 1CQMA 3CDWA 3W9HA 1M1KT 3K5NA 1BQNB 4EHUA 3C7NB 2VKRA 4MK8A 4F4YA 3NH1A 2SXLA 3DLLQ 1H0HB 3H1VX 4OI2A 4FWOA 2EG2A 2PMHA 2LDYA 2CQBA 5KT7A 4IJAA 4E8UA 2BGGA 2YKPA 3EICA 3L95X 3W64A 2G9OA 3RG6A 3ZZTA 1L3UA 3CEDA 3ENHA 4E1MA 2G4BA 1X4CA 1GEHA 3FDSA 1RAFB 2GBZA 3MEGA 4M3ZA 1PKUA 3M32A 3UD5A 4KHMA 3EGNA 3PJXA 1W0HA 3HSTB 4FM0A 2ROEA 2UUCF 2Z2MA 2DPJA 2AYEA 2BOAA 3C6UA 2XMTA 3ZTPA 3L3CA 2MZRA 5GAHI 1Q7LB 3ZSZA 5HK4A 2ZQBA 4BBYA 2XHWA 3SAGA 1PAUB 1NOYA 2HURA 4M63C 1KOOA 2BOPA 2B56A 4DF8A 4CHOA 3GPAA 4IH5A 4DTRA 4OHVA 4TN2A 4DMNA 1S1WA 4FJ9A 2CQ2A 4YOEA 4O44A 4ZVFA 3DOLA 4KH1B 5AJ3K 4CP5A 4FKYA 4YDXA 2Z30B 1XN9A 3PRBA 2A3ZA 3MTKA 3L7PA 1VFJA 3GR0A 2QL5B 3QICA 4RW7A 3ZZPA 3WX4A 1YIJS 3NS6A 1Y97A 3MEGB 2OGUA 3GU0A 3CM6A 1C1CB 2UUCK 4WP8A 4Y6IA 3C6UB 4KY3A 1N52B 1YJWN 1FRKA 4JP8A 2R8KA 1VSMA 1HBMB 2MZQA 4ED0A 3O6WA 2DT9A 5HANA 2X6NA 4CZGA 3JTNA 2ZBCA 2LCWA 4LVNP 4AL5A 4QZVB 3TU5A 3O9SA 4G1IA 4DJBA 2EC2A 1GX6A 1LWXA 3R5GA 1RA7A 3SDEA 3V1RA 3V1QA 2J9DE 1NJIO 3KNAA 1BL3A 1TKXA 2FJBB 2GA7A 4ZVSB 4KJIA 4E7LA 4M7YA 3BF4A 2AYGA 3T1HF 2E88A 1WBDA 2L3MA 4HDHA 5D4PA 3SFGA 1PG5B 3BEGB 3MM9A 1KFDA 1NEEA 2X51A 3WDOA 4F0MA 2UVVA 4QU7A 2YQ1A 3MMAA 4AL7A 3Q24A 1TAQA 3KK3A 2QL9B 3VQDA 1YAGA 1WC4A 4CFCA 5L1LA 1T8EA 4FK4A 4YB1P 1IKWA 5ETRA 2ILZA 3IGNA 5CQGA 4QR2A 1UPPA 1IH7A 1TL1A 2QWPA 2Z8QA 1OH7A 4C0BA 3FZLA 4DTNA 1N5SA 1SQEA 3CCUS 1T6CA 5AQZA 4UY8O 3T1HK 5KT5A 1U6FA 4OJRA 4JI1J 1AUSL 2DRAA 1B92A 4MLEA 4PG7A 4U7CA 3ZZUA 3SZ2A 1NZ8A 2QSWA 3TX8A 2IJRA 4NLOA 4HTJA 3ZT0A 1CC8A 3TZYA 3VOVA 2ZZMA 4BC9A 4B3SJ 1RBSA 2ZHOA 2ZVIA 2CKWA 2W2OP 1IKWB 4DTSA 1WOSA 3IKMA 4FJ7A 5BYSA 2P9LA 1TL1B 2VCPA 2UP1A 3H5SA 3LDPA 3HK2A 3GZ7A 1RB0A 4FLVA 4L3KA 2VPZB 3QAUA 1ELOA 1G15A 3QIPA 5KFWA 2MQLA 4NLGA 4IUFA 3PZPA 4CGGA 4WF9L 4Z7YA 3E1YA 3QFWA 4FBTA 3ENQA 4ZPDA 5KTQA 1M5PC 1XIQA 1D5AA 1GXTA 3IUCA 2AJ4A 4HTIA 5L1KA 3SPZA 1JXBA 5KFPA 2HGLA 2KFZA 4RZRA 3SCJE 2DXFA 1ZXOA 4BRGA 2NS1B 1N4LA 2C1EB 2EG1A 4UOHA 5KT6A 4ZVUB 4L76A 5J2PA 3CHWA 4WF9Q 3OR2A 4PEOA 2I0XA 3RWUA 1FK9A 3H4BA 4DV2J 5D0HA 4IO8A 3R5JB 2N3LA 3WZ0A 1LCUA 4CFAA 5H9FJ 2YHXA 2OHDA 3V6DA 2EFPA 1C0GA 3V81A 5D0EA 3OVNA 3GIKA 1XI1A 4ZK7M 4CEOA 1RBOB 1V3ZA 3ENOA 2V34A 2EC0A 4FWQA 3QRPA 1VS3A 4M7XA 3MUVP 1Q16B 3OL9A 2Y3YA 1NK8A 1CJUA 5J2PB 2KB2A 3QLHB 3DOKA 1R3NA 3FUYA 1KCFA 1FK9B 2HQIA 3HPGA 3NGUA 4TLQA 4J9PA 3IR7B 1T6DA 4XAKA 1IN0A 2ZC4A 5DM7L 4B3OB 1NM1A 3FFIA 3KK2B 3ILIA 4JRPA 2H1YA 3HVRA 4PYDA 1VOMA 3MK6A 3IG1A 3PM9A 1W9HA 3QJLA 3ZZOA 2KYZA 1S7IA 4I2PA 3BYRA 3MR3A 4RUBA 3G8QA 1FKAF 4DPXA 3V6JA 4ES3A 3HT0A 3TAFA 1ZAVA 1Y3JA 2MZ1A 3ZT3A 3DOKB 3VVUA 1LXNA 1F21A 3OS1A 3TA1A 2VH7A 4IH6A 4YOYA 3RMDA 3TZXA 4NCBA 1TUVA 2HS4A 4KHRA 2G13A 2XI3A 4IFYA 1FWKA 3CXCM 1BD6A 1EP4A 1FXLA 1NNDA 1IKXA 4LH4A 2HFSA 4KI6A 4I2PB 4A47A 3L9ZA 4BHQA 1R43A 2P9PA 4WCEL 2HS0A 1LKZA 4QYZJ 4WZQA 1L3VA 5FJ4A 3UI3A 4K59A 4AXJA 5JJBA 2PI4A 3C46A 5C12A 4IDKA 1U2FA 1S0OA 1TV6A 1P1TA 3J80Y 2YPYA 5MLCV 2AP6A 4ZPTR 1WLJA 2GTDA 4DUZF 4ER8A 1RWVB 1T94A 1FNOA 1IKXB 3HSJA 3EL2A 5DM6L 2QWMA 1HI8A 4QWEA 4DV6J 5AQTA 3TOQA 3UDVA 3SMZA 2F9TA 3L4QA 2P9PB 2B7CB 2GWKA 1HBUA 4M5LA 4P73A 3ADAC 3WHIA 4H03B 1UVKA 2MSTA 3QEPA 3UPFA 2RS8A 2QJ3A 4BG9A 3QBCA 4QJVA 2RE1A 1OQ3A 2EBGA 3W5ZA 3GJRB 3CCLN 4YOUA 3LL3A 5HLFA 1NJZA 2LQ8A 3BKFA 3L2VA 1BCOA 1T3VA 2V9WA 4DUZK 5GMEA 3GDQA 5K9FA 3PUFA 3E01A 4FWKA 2C2EA 3H2LA 5D77A 1EB0A 2BJEA 4X64F 4OGEA 1IBMJ 3TUPA 2MLXA 1HI0P 3JQKA 3ITHA 5J2NA 3C19A 2YX7A 1QZ5A 2DO4A 3CCEN 1HBUB 1MWYA 3ZSQA 1FERA 1RTJB 1S22A 2Y1JA 1UVIA 4A2BA 3IBWA 3VF2A 5C0YA 1REVA 3MMBA 1WHWA 4K8RA 4ZP9A 3KIOA 5EOYA 1GK8A 4FYVB 4YQWA 4EBDA 1B3TA 3HX9A 1N48A 1T02A 2F1FA 5T7BA 1NSKL 3PW4A 4CIOA 4DN9A 5G0RA 1RNHA 1NJXA 3E01B 2LLZA 3I56S 1Q18A 4X64K 1GMWA 2MLYA 2COLA 1SC4B 4OHZA 2RKIA 5DMRA 3O44A 4H4KC 3PX4A 3CCQN 2WSEC 4OIXA 1QQCA 3QZ7A 1FRMA 3IWXA 3W9IA 5LSOA 4K4VA 3TR8A 4GKKJ 3D2FA 4X65J 1F3VA 2ZH9A 1BG3A 4IR1A 2LXFA 2ZHBA 2OPPA 1Q81O 4P9SA 4EAHD 4AYBD 1VSEA 3CJ4A 1UJ5A 3DLRA 4CLSA 5G0RB 5M2UA 3H1QA 3KYLA 1C4CA 3NWRA 2MSSA 1SC6A 3R5BA 2HYIB 4OX9F 4M5GA 5GADP 1XHXA 5F3TA 2VJUA 1NRKA 3C0BA 2FHMA 2QK9A 5LMNJ 4B9NA 3TP2A 3TJAA 5HJYA 1VRTA 3KXDA 1NBEB 1HFEL 4F3OA 4CJ7A 2FUG9 5AQSA 4E98A 4M5HA 1SJ3P 4WFYA 5KOXA 2P9KB 3D4JA 4LFBJ 1N0UA 4BDPA 4W5OA 4FJJA 5SZTA 2OTJS 1Q82O 2YNHB 4OX8A 2VJVA 4QWBA 4LFBF 3CO0P 2ITGA 2DTUA 1RKIA 4L6V3 3HO1A 4KV8B 2W40A 4OZ2A 3PKYA 2QLBB 2O67A 4OX9K 3I0SA 3PG9A 5LXRA 5AE2A 1VRTB 1NPRA 5EHHA 1F5AA 1N8RT 4DTUA 2WVCA 3S7RA 5KFKA 4OJ3A 2MKSA 2NXUA 4G6VB 3G6XA 4BRKA 4FXVA 4NLWA 4DR6F 2RUGA 4AHSA 4X4OA 2HQFA 4B1XB 3NGZA 5BXIA 3ZETB 4KQZA 2DR6A 1NGEA 3GCXP 1LW0A 1YRUA 4LFBK 3M5RA 3AAQA 4DV1J 1KQSR 4M41A 1DJ0A 4QWCA 4ZVQB 4CGFA 2E2NA 4YOTA 4YS2A 1ULRA 1TZ0A 2EW9A 2DNMA 2HNDA 3CJ3A 4WK3A 2V68A 1SC3B 2LKZA 3HVTA 4IOAL 1S1XA 3H40A 2KHCA 2YKAA 1MMNA 1UAXA 5D0GA 4CJ4A 5JVGQ 4DR6K 3TSPA 3NS7B 2QXLA 3HLUA 4CLZA 1FRJA 4CHQA 2ZGYA 3HSCA 3EXYA 1HMVA 4UT4A 2Z58B 2F63A 1LW0B 1REGX 1UEKA 4PKDB 2G8FA 5DQIA 2FJVA 1VQ5S 2OTJN 1W97L 3F5TA 3A8YA 4IOAQ 2GX8A 1DFDA 5AZIA 3HVTB 2VBYA 4TYAA 5K8MA 5A6WA 1FHTA 4HI2A 3CWJA 4RUCA 1ZYQA 5B0AA 2RS2A 3R8YA 3ZZYA 4NO7A 1K73T 4OZ1A 2A10A 2L9NA 1SJ1A 3GV8B 4OZ5A 2ZH7A 1JX4A 1HW9A 3MXIA 1OS5A 3OLAA 1R0BG 1BWVA 5C25B 1SXLA 3OV7A 3BDEA 1UPMB 4CWBA 4AM6A 4C1NI 5LL6Z 4TLRA 1JJ4A 4EU0A 1VSDA 2W9CB 5GAEU 4C23A 2NSCA 1HPZA 3MR7A 4YOWA 5AZIB 2ZH3A 3UN5A 1QS4A 2FJDB 2AWZA 2VKZG 1EXQA 1T95A 3I8BA 5BR9A 2R4FA 3PLAA 4ELTA 3M6UA 4YOXA 3GILA 2MB0B 1RBTA 1S12A 2CNOB 3R5AA 2UZAA 3CB4A 4IRKA 2CJYB 5DZ6A 4BVPA 1QHTA 1Z25A 3QMQA 4B1ZA 3R9PA 3CD5A 1D9FA 4H5RA 5ETTA 1ZTTA 4U95A 1H38A 2NRWA 1XNQF 4DCJB 3G25A 1H73A 1IQTA 3ZC4A 2BJ8A 3VQ4A 4A8XA 1H6KX 4K4XA 1IBLF 4A59A 1Q0NA 5F0WA 3RBZA 1VLOA 2NYIA 3OVBA 1M1GA 4QIVA 1FKPB 3SUPA 3CD0A 4RBVA 4ED2A 5ELZA 3M8RA 3CD6S 3KKRA 2A3JA 4ZIVA 2B4JA 2W41A 4YOVA 3CPWR 4KREA 2MQPA 1QDUB 5F3ZA 2XZWA 2IVOA 5IT9U 1T03A 1TL4A 5DDOC 3WBZA 3Q8YA 4CJVA 3OYCA 1JKHB 3M9NB 1U49A 3AHPA 5F8MA 3K7RA 1NB7A 5DDQC 5DLFA 3OHRA 4CEZA 1XNQK 1QVGR 2OUGA 4O4RA 1GH8A 1VIXA 1QVFM 2VA3A 3JSRA 4EYHB 3UFCX 1RADB 1YJ7A 1JLAB 4CJWA 1IBLK 4DR2J 4CH1A 3NCIA 4DF4A 3VQTA 2RIJA 1S6QA 4DZ6A 2YKNA 4KKOA 4J9KA 5KFLA 4BACA 3M05A 1VBZA 4IQMA 1HNWF 3CCMS 5F41A 4A8SA 2J9DA 4URGA 2X1GA 1J5OA 1X5OA 5LY3A 2YVSA 4RNNA 2E66A 1PAEX 1D1UA 5L8RC 3P1GA 4WKRA 1YJNS 3HJFA 1C1AA 4JAXA 2WC9A 4BDZA 1FRIA 4ZPCA 2JDJA 3BB5A 1SKWA 2FVQA 1RWWB 3CCRN 2G2YA 4H5NA 5D0RA 4DQPA 1RHMB 4CBWA 2YKNB 4KKOB 1HNZJ 1U1KA 1CBKA 1QLNA 5JLFA 1HNZF 4IBNA 3UD4P 3LWLA 1CG2A 1V6HA 3RW7A 1S97A 2V51B 1G6BA 1HNWK 4UOCA 1CZBA 3WC0A 3OJUA 4CM2A 2VV5A 5F0UA 1RTDA 3L2WA 3AY0A 3QO9B 1KSPA 3O6QA 3OVSA 3PFOA 3L2RA 4CLUA 4N56A 2XLIA 1KOHA 3ASMA 2GAGC 1RHRB 4NL5A 4Q8EA 3D1QA 2YY3A 4CQ1A 2V4RA 3VQ7A 1WC1A 4TY9A 1HWJA 3KHGA 2ZE2A 5EU7A 3N0VA 1UCNA 2DFEA 2VGNA 3DLGA 5KOWA 2ZH4A 3OSNA 4YORA 1HNZK 1RDCA 1SAZA 4KHWA 3MXHP 1UA0A 3FBBA 3NGIA 3O4QA 3CCWA 4NASA 4ZA1A 4KHSA 1SH2A 3PEHA 3NAIA 1RDDA 1ITPA 4FJKA 1JCFA 3I55S 2YNFA 4E7KA 4LRDA 3SUNA 5ETQA 3MI7X 2JWKA 2FZGB 1UFWA 3PFEA 3ZTOA 2UUTA 4HH0A 2M70A 4FBUA 2XG8A 4OGCA 3NGTA 2ZE2B 4DR5J 2NYHA 1VC5A 1IJJA 3OXLA 3VQ6A 4A57A 3O5BA 3VQ8A 3JSBA 5AXKA 3DNCA 3HVWA 4IJNA 2P9IA 1AFIA 4ZP8A 3U1NA 2UVRA 1QHAA 4C8ZA 3W3SA 3HHEA 4JI5F 1JIHA 4ED5A 4GV9A 3PKMA 3THXA 3KLFB 1BQMA 3KVGA 5ETSA 2YNFB 1PSDA 2HVHA 3H08A 3VVTA 2A6OA 1FA0A 4FLUA 3SAHA 3EGZA 1N6QA 3M9OB 3RAMA 4Y65A 2XB2D 1VHFA 1BQXA 2G1HA 1S72S 4U67L 4UUWA 2CJQA 5L38A 5AZJA 2ZNYA 3GFXA 3PIPQ 3H0PA 2AX1A 1NGBA 4GMKA 2IHR1 2W9BA 4JI5K 1LAVA 1HL6A 4E3SA 4PABA 5JMVA 1OIAA 3LAMA 3THXB 1HQEA 4IO1A 3GB0A 4DU1A 3MDFA 3UNYA 1VR6A 2JHEA 3MPVA 4LBHA 1B7FA 4U67Q 1N6QB 3O1LA 3N9UC 1RAIB 4CZKA 3J7Z5 1RAHB 2I6WA 3VTIA 4WFAQ 2RPIA 2ASLA 1VQ8S 4MIWA 1QD1A 3O5TB 2W25A 2E44A 5AZJB 2ATQA 5HI7A 4ZJOA 5GADI 4C7QA 2MQ8A 5LOQA 2YQ3A 3L2QA 4BRCA 2ZOGA 4JI7J 3TEHB 1RAAB 1K1QA 3Q0AA 2HQDA 4PQAA 1KVIA 2BE2A 3CGIA 3IAYA 2KTQA 1T05B 3DKDA 3MN6A 3ILLA 2HIYA 1M90O 4YUDA 2G8WA 3RAXA 4Q2MA 4RW6A 1KVCA 2C2RA 1RT2A 3CMQA 5AQHA 2UUAK 1ILYA 2KO1A 2WHOA 2EFVA 5HRSA 2EK6A 3DRXA 4ZVHA 4DPOA 3RRGA 4DTOA 4CO5A 2W01A 1BDGA 4NYNA 1NMNA 1ZTWA 2NXNA 3W62A 4ZVGA 1ATSA 1PC4A 3L09A 4ILMA 4KHUA 1YBAA 3OYEA 2E20A 1HR0J 1MROB 1WKLA 1S9EA 1P6TA 1NU0A 4HL9A 1KD1O 3CVKA 2V2KA 1VQON 4M5DA 1U26A 5BJRA 3AXMA 4P71A 5M2PA 3H8YA 1QTMA 2E7WA 4OYIA 4WK1A 3P6YC 3J7AP 2CAJA 5KRSA 3DRPA 1I3AA 1MU2A 4FZXC 1S3XA 3VALA 1RTHA 1O5JA 4CJFA 3LTOA 2UU9F 4ZPWR 4ID5A 1HA1A 1NM2A 3QWUA 4HWIA 2ZM6F 4LBPA 1U04A 4L73A 2PFFB 3GFYA 2CPZA 5KPZA 1ZM3A 1BWFO 1SCJB 5K8OA 1N34J 2Z57B 1ESVA 4AHUA 2VASA 4IFEA 1S9EB 2J5AA 5AQOA 5ETLA 1WACA 2R8HA 2G0JA 3JAMU 4GO7X 3D45A 2IAJA 4W5NA 3Q89A 3MURP 3RRHA 2HBKA 1IR0A 4ECVA 3AVLA 4ISFA 3ISNC 3IMQJ 4KHQA 1MU2B 3B54A 2DHSA 2XYPB 1NPPA 1OMSA 4U7UD 2CH5A 2UU9K 1B0PA 4J9OA 1YI2S 2ZM6K 1WWHA 1YDLA 1S6PA 5AQKA 1JLGA 3RB3A 3FZMA 4AE5A 3PR5B 1VQPS 3M1VA 4DS5A 2EFOA 5A8KA 4G65A 3MM6A 4FWNA 3Q2TC 2J7UA 1BC6A 2AGPA 1D09B 1PILA 2AQ4A 2W4CA 4JI8J 2IAJB 3GE1A 3B6PA 4G9ZA 1X9MA 4CF1A 4YY3F 3KHYA 2GGPB 3TVYA 2M2BA 4MDBA 3EVOA 4QPTA 3SQOP 3FSXA 3ZNUA 5EY4A 3HZ6A 5L9NA 2CQGA 1PYSB 4D3GA 4OKEA 1OO0B 5AQRA 2DXDA 1A7GE 3SNNA 3CJQA 4WYWA 5B09A 1RFQA 3QSIA 3RMBA 3CJBA 4HLBA 4AQYJ 2FB0A 4HCBA 3CJRA 2HWHA 2NUHA 3OBYA 4M3TA 4B1YB 1M5OC 2VB6A 3EXCX 3A5OC 1URNA 5C24A 2CPJA 4DR4J 1EETA 3KJNB 2VC0A 5M1KA 2ZD1B 3MM6B 2DKOB 3V4MA 4A5BA 4DR4F 4WPAA 1NHKL 1VDHA 4BS2A 4JI4F 3SYZA 1X4FA 2QWOA 1RWKB 2LEBA 4I6WA 4C6AA 2EHGA 1FD8A 1KLMA 3EE3A 2DR8A 1TFWA 1K8KA 4YY3K 3QT8A 2UV8A 1WAFA 3C16A 2LSNA 2ZJPQ 4NA1A 3CFRA 2H5IB 2ZFHA 2OMLA 1HW8A 4B1VA 3CG7A 4YDUA 4M8LA 3AVJA 3R7NB 2WK4A 2KG0A 2XS7A 3KKSA 2LEAA 2X1FA 1EETB 4UOGA 4M3RA 1LV5A 4DPTA 1GOAA 2QWQA 1NSAA 4JI4K 2IM3A 1KLMB 1IM6A 1NGGA 2ALYB 3GBTA 3UKUA 2WAQD 3AJ2A 1VQKS 2BJDA 2BRKA 4OVLA 2E1ZA 3N6MA 2WSCC 3SBMA 1FKOA 2KFYA 1VK0A 2VIHA 5K8NA 1TVRB 3PO4A 2P9UA 5HOOA 3QINA 1FI4A 4BWMA 3EMTA 3MUTP 4WFNL 2MKHA 4F7VA 2W42A 1BOTO 3DDKA 1VSJA 2LYVA 8RUCA 1VQ7N 1FDBA 1ZBTA 2LDIA 1RQ0A 4N41A 2ATLA 5KFDA 4O3NA 3NCRA 3S9HA 1TUUA 2IGIA 1LWCB 4OI3A 2UXCF 2FSJA 3MPUB 1FRXA 3CQ8A 2HSEB 3HP6A 2X74A 2GJFA 2CZVC 3LPEA 4LF5F 5HP1A 2YNIA 4HI1A 1E3MA 2OEJA 3VEOA 1WG1A 4ELVA 4CNZA 2DVIA 1WI6A 3HCXA 3QT6A 1UZDA 3IR6B 2Z1JA 3CF5L 2YI1A 3HYFA 4DL3A 2JVRA 2DHHA 2F8SA 2P9UB 3SBGA 2BEFA 3D2EA 2R2UA 2YX4A 5CH7B 3NG8A 4EFAC 2KT3A 4A8KA 3MXMA 3SFUA 1GLLO 4NLUA 3SMPA 2OPQB 2HLUA 1IWAA 4NWBA 1EKEA 2W8KA 5SUHA 2IA6A 1SUQA 2UXCK 4MKAA 3G96A 1HRHA 4RW4A 1DLOB 4ZJLA 5HP1B 2P9CA 4LF5K 2YNIB 2FC9A 2CQ4A 1UFKA 5E3RA 3FCHA 3QBXA 1Q79A 5DLGA 5CABA 5F8GA 1A9NB 3IRWP 2Y1RI 5AFUH 4CZMA 4ZVTB 3D2EB 4LQ9A 4WWSA 1YVUA 2ZBQA 1N36F 3NE6A 1RDUA 2XTJP 4CZLA 1FX2A 2E1RA 4URQU 4BWJA 3OYAA 1VCTA 4A46A 2QLFB 4DXLA 4P7VA 1SUQB 2J6UA 3KHLA 3O1WA 4RW4B 3EKUA 4OI0A 1TL7A 4ZPVR 5D6GA 1Y4ZB 5K5MA 2HVDA 4PL7A 1X5TA 4QS7A 2BQ3A 1VQ6N 3ATVA 4L72B 3OFFA 5T41A 2YNGA 4NA3A 3AA8A 1VQNS 3PYEA 3J7ZO 1RAOA 3GV5B 1N36K 1RTIB 4I7FA 1RWNB 4IO9L 3GIRA 1VQ9S 3VQAA 1Y5LB 1R7IA 1SVDA 3DXKA 1S4FA 1DEJA 3Q2SC 5K20B 4ILJA 4TU8A 4FLWA 4QQBA 1S77D 4IOCQ 3V9WA 4EBCA 2IDEA 4CM0A 4F02A 4KHNA 3QFHA 1RHKB 4O0JA 3WNFA 4DU7A 4FN5A 4E2FB 3KJVA 2QA4N 2ZUAA 3PEJA 1FJCA 5KG1A 1CEZA 4JV2A 4DR1F 3I96A 4CJ3A 3R27A 1SIWB 2BACA 2GEMA 1NK5A 4DSEA 1DQ9A 2E5JA 3KUGA 2WUSA 4K4UA 5KFIA 2RDJA 3V9ZA 1YITS 1B99A 1FXXA 2XWYA 3MDQA 1KQSM 3D66A 3VWSA 2UXDJ 5D78A 3C15B 4J91A 2F8EX 3RAQA 4C48A 1X4EA 3HM8A 4FJHA 2ZITA 3MR2A 2BM1A 3CT9A 3K5PA 2MZSA 3W61A 2MDAA 3VGMA 3GL1A 2C3MA 3KJVB 1VGYA 4HACA 4X4SA 3H2UB 3CNQP 4P72A 2XMUA 1L3KA 2JWLA 3V4IA 5AR0A 2V52B 4GVBB 4DR1K 4OYBA 1YJUA 2E5LK 2F7TA 1F60B 3AAWB 4ES2A 3BS9A 3MCSA 2BRLA 3WT0A 4FZZA 4FOIA 3E9PA 3SQGA 4FF2A 5E3QA 5AT1B 3H5YA 3VZIA 1ASUA 2H3EB 3WX8A 2A5XA 3TZZA 3A8IA 1J9AA 2E7VA 5EGYA 1EO1A 4PY5A 4ETXA 3U3YA 1FD2A 4KAIA 3OXGA 1ZETA 2GVZA 4GW6A 8ATCB 1Q78A 3M8PB 4QOTA 2OPSB 4HACB 5C2FA 4E7HA 2OZSA 4P2FA 2ASMA 5KG0A 4FM1A 4NYOA 1AB8A 3KLGA 4G3IA 2CPYA 1BU6O 5IOLA 3THTA 4LF4F 2WB1D 2H9ZA 2G8HA 1KHVA 1XMQF 1N56A 4Q45A 1VSKA 1YITN 4PWDB 4DR7J 1WDDA 5KFGA 3SBTA 3VEZA 1YQHA 2DHXA 5EWGA 2RJZA 1U24A 4FNHA 4PAAA 2M7SA 1JXVA 2GVZB 2E29A 4Y2MA 2CPEA 4BY9C 4IQXA 3FQLA 5CAAA 4WIQA 3LPTA 3CC2N 1DTTA 3DRSA 3K58A 1CPZA 5A2QO 2RHKA 5IXUA 4JI0J 1SBRA 4QAGA 4LF4K 4BRMA 2QKKA 4RPFA 3U27A 2DGOA 3W60A 4FPAA 4C98A 1XMQK 4K0KJ 2FBTA 5ETNA 2MTLA 3K9JA 5G4DA 3ZX0A 4Z4GA 4DSLA 3THVA 3KD1E 4ECUA 3DGPA 4P10A 1XMOJ 1D3WA 1KAZA 3DMJA 2W2MP 3AOAA 1XK8A 2QT7A 5BYRA 4OLPA 3FBEA 2VDHA 3NFAA 3CPWM 4FJMA 4IRDA 1T3OA 2BJ1A 1UEUA 2HQCA 3DRSB 4GKJF 1GLBG 3M30A 1QVGM 2ZDOA 3T1YF 1F1BB 1UJ6A 1YJ9S 4BREA 4Y2AA 1HYZA 3VESA 1X4DA 3GSDA 2DH8A 2XC9A 2R8IA 3ONQA 2GELA 3W63A 3SCLE 3CJ1A 4HUGA 2VG6A 2KH9A 4DV5F 1YRTA 4DPYA 3VQCA 3BZKA 2IM0A 2UXBJ 2A2CA 3A0IX 4A8WA 2UXBF 2HRYA 2CH6A 1MWZA 2GMJA 1RBAA 2OZMA 2G0CA 3AVBA 4GKJK 2F5GA 2VL1A 4QS9A 4KR0B 3H20A 2ZHAA 4NOHA 3T1YK 4UUXA 4P7TA 4I1TA 4ZMMA 1AZSA 2E1YA 2H54B 6FDRA 4NXMJ 1KLNA 1FDDA 2FF3B 2DR5A 3K17A 2VG6B 3PO5A 4UZCA 4DV5K 1JQGA 1KC8T 2O8EA 4C11A 4DL0C 1OH8A 3EE9A 3MAHA 2UXBK 4CTAB 4WU3A 3W2WB 1H2UX 1TP7A 1JXLA 5IS2A 4O3SA 3G82A 1NK6A 3A2FA 3OYMA 3NBPA 4OZNA 2F8TA 3K2PA 3TR5A 1AZSB 5H9EK 1YJ9N 1GLDG 3CJ7A 2MQQA 4F2SA 5C5JA 4LC9B 2V50A 4RU2A 1RLCL 2LMIA 4C11B 3QGPA 2HMIB 4HEA9 4ATNA 3MOJB 1JL1A 2AEJA 3U02A 3AJ1A 2D3ZA 2ASDA 4WQ5A 4WXWA 2E5IA 2KT2A 1JLQB 2BW2A 1W25A 3EZOA 3D9BA 1K9MO 3I9V9 4HDGA 3A3NB 1HNVB 4RUAA 4DR3J 4ZHRA 5KI6A 3VAJA 3G4SS 1DURA 4Q7AA 4CF2A 1VQLN 3IS9A 4BGAA 3WQUA 4FYXB 1WHYA 4LH5A 2K3KA 2G8UA 4BE2A 4KIAA 4U8VA 1WSHA 1VBYA 1WTFA 1X60A 3P5TL 4OFZA 1U7LA 1NK0A 5AQFA 2BA9A 3ZNJ1 3RVCA 4RTFD 1N33J 3IO1A 1BA1A 1M5KC 3K5MA 3L7OA 3CETA 4JB8B 3ET6A 1IR1A 2W9AA 1U2RA 5K14B 1FFGB 5J1NA 2DNYA 2GS8A 2DITA 3AH6A 2CJKA 3TNVA 2F8HA 4ZHRB 1WEZA 2JFDA 3KHRA 2Q31A 1N32F 4JV1A 1ASWA 1R8BA 4NEZA 3OHBA 3UE5A 4H0OA 3WXMB 3WEEA 3LM9A 2FF6A 3EJMA 4QYRA 3CERA 4JKGA 3MMVA 4H0VB 4IKFA 1RILA 1C0UA 1OH5A 2RB7A 2NR0A 4H0YB 1L5UA 1U4BA 5KPTA 3VGUA 2C3OA 1KR4A 2V6AA 3UDLA 1KRPA 1K8AT 1YJVA 4LF7F 4TVAB 3FGUA 1FFSB 4DTPA 4PKGA 2WW4A 2OA8A 3DLEB 1NPKA 4X4PA 2WOMA 1S0MA 2EWSA 1YTUA 2OYQA 2J9EA 3G10A 4DSKA 1BCMA 3MOZA 5EN1A 1LW2A 2CQIA 2PYJA 1N32K 3I9ZA 2MGZA 3SXLA 2RILA 1XJWB 5HBMB 3S41A 1N88A 3NF7A 3BGFA 3OL8A 3S01A 3RR8A 3WEEB 3QPIA 2VBZA 3O9QA 4W92B 2F7VA 2WBNA 4JKGB 4J9MA 4CZHA 2GIRA 3ZSYA 1O13A 2O4IA 5ITHA 3O4NA 4K2JA 2G8VA 4LFCJ 4NMLA 1PCAA 3FMWA 4LF7K 4QIGA 3AFGA 5HMWA 4M63A 1BUXA 1YRXA 2XYGB 1X7VA 1KVKA 1M1HA 2AJ2A 4JKHA 1H7WA 3WNGA 2XSJA 2IRYA 3KTQA 9RUBA 1LW2B 3BBCA 1BLUA 2MGZB 2I2YA 5DRKA 1HNXJ 3HBTA 3T9ZA 3W3DA 4Y0WA 3FQKA 3G8TA 4YMEA 1HNXF 3RSEA 1RT3A 4B17A 2GWJA 2R7YA 2FJAB 1JJ2R 4AHVA 3FBCA 2RH3A 3IN5A 5JVHL 2LECA 2PFDA 3HOSA 3ZSWA 4KGVB 4DV0F 4H4MA 2DR9A 7AT1B 5A0YB 4GO5X 4FWPA 2V0NA 5J2QA 1T9UA 4RNFA 4JI3J 4K4SA 3UIQA 4H4OA 3CJKA 2OSRA 4ECYA 2RQ4A 2EBEA 4BRIA 4Z4HA 5BR8F 3A4TA 4Q5VA 5JVHQ 3ISZA 2R8JA 2QIFA 4W98A 2HIQA 1S9GA 4OYWA 1MMDA 2HBZB 4R79A 2IVMA 2JLFA 4I6YA 1QM9A 1Y0HA 1FF2A 1QTNB 4EZ6A 2A42A 1YX2A 4Q2LA 2X78A 1KWMA 1NCLA 4DV0K 3THWA 1Z6RA 4I68A 4DSFA 2K7JA 4JK9A 4Q0BB 2D7SA 1NKCA 2UUBF 3U8XA 5FRMA 3DLHA 5J2QB 2KXHA 3FZ2A 4H4OB 2D9PA 1TL5A 3CJKB 2L41A 3GLJA 2Y0BB 3TA2A 2R2RA 2GO9A 5BR8K 1GXUA 2AIRB 4PYAA 4NE9C 2VU5A 1S9GB 5BREA 4LF2A 4FJLA 4EI2A 3PJ9A 2VBXA 1AUDA 3VZHA 4H8KA 2BANA 2DGQA 2D74B 3QATA 3OTEA 3NF6A 3THWB 5KG7A 3NCQA 4CYUA 4JBCA 5IWAJ 2UUBK 3FCWA 2JVOA 2DGVA 1ATRA 2CIMA 3K89A 5AE3A 5A2QY 5CZXA 4MKBA 1XC3A 4K42A 1U1QA 1WSVA 4KI4A 5KFSA 1S49A 3VQSA 1DHMA 1NXIA 4NLDA 4FWSA 5I3UA 5KFAA 6FD1A 2B5JA 1N5YA 4DFMA 3MR6A 2CDRB 3IWNC 4DCPB 2D4WA 1Q53A 5ADXH 4A8QA 2BANB 1QQNA 1W7WA 1PC5A 3QYYA 4ILLA 4ZVRB 1IG9A 1P90A 4K4WA 2ZBIA 2LFVA 5C2CA 4N47A 4AH9A 1SQGA 1IVZA 5HAOA 3TTCA 2FSNA 4A8MP 2E6MA 4RR5A 5JXSA 2E1AA 2KDOA 3F9KA 5KPRA 5D15A 1TUYA 4PWWA 4ID1A 4WE1B 4CI6A 3HL8A 4FJNA 5I3UB 4LFAF 1ZZNA 1YG0A 1N5YB 3TA0A 3CCVN 2J6SA 4LIWA 3GMGA 2Z1IA 3O8MA 4ECQA 3CQXA 3RRKA 1CLFA 2I38A 3P31A 1TELA 2VYPA 1XWLA 2P9NA 2DIUA 3RUBL 2AT1B 2HLTA 2VPXB 1C2PA 3H5XA 4ED8A 2FZKB 2QMXA 2FY1A 4C8NA 5IQ6A 4KPCA 2G8IA 1HI1A 3DDNA 4FYYB 3PRVA 3AVGA 4FJIA 4LFAK 4OV1A 3A5NC 2J9CA 1CLQA 3JQMA 2F4VF 1U2VA 4OPAA 1V4TA 1U1OA 4RCHA 5B8HA 4R8UA 3CMEN 1LQ9A 4EZ9A 4C2MA 1WI8A 2OLWA 3VAIA 1NBWA 1S9FA 1PGZA 4F4ZA 1RP5A 1HBNA 3BSCA 4DV7K 2YHWA 4FXDA 5FLXU 4YFUA 5C10A 2CQPA 3TI0A 1HLWA 2CUYA 1R6YA 4OJ1A 3BEXA 4OX7A 1RAEB 2W7AA 1Y7PA 3UN2A 3TANA 2E1MC 3FLCO 4UY8T 3MZIA 4X66F 3WQPA 4IOBA 4N76A 3J81j 2J0XA 1FJ7A 3IRXA 3BZCA