2HNDA

Crystal structure of k101e mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
534
structure length
522
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 143
structure length 522
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hndA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hndA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hndA05
2E9TA 5CYQA 4GW6A 4CEAA 3CDWA 3H5XA 1RYSA 4ID1A 3PW2A 1T3NA 1BQMB 1JKHA 3KLEA 4HKQA 2F96A 1VSLA 3V81B 3H59A 3HSTB 4C8MA 4I2QA 3SQ4A 1B9FA 2WOMA 3TAMA 2QE5A 3V9UA 1FKOB 4YQWA 3SYZA 2YKMB 4ZHRB 3QEIA 2DFFA 2FLNA 4TSXA 1KLNA 1NJXA 2XCPA 2UVVA 3HYFA 2BANB 1VSKA 1C2PA 3M8PB 3AO1A 2IAJB 1NHVA 2VWJA 2VWKA 2Y1JA 1KSPA 5HP1B 3QEWA 2YNGA 1U47A 5KFFA 3LP0A 3CJ5A 1NOZA 3ZSOA 1JL2A 4O3NA 4ZVFA 3DM2B 4E7HA 3LWMA 2O5DA 3LALA 3SQ0A 3DLGA 4O3PA 4CJ5A 3GYNA 3RB4A 3S3NA 3MEEB 4F2SA 3CJ4A 3O3HA 3DOLB 1BL3A 1QAIA 1C0TB 4DS5A 4IG3A 4IBNA 3O4QA 3LDSA 4N47A 1NKEA 5KFZA 5HROA 3L8BA 3P5JA 3NGYA 4KPYA 2YV0X 4ZP7A 1LAVA 2KW4A 5L1KA 3L3UA 3CJ2A 4RW7A 5DQGA 3Q8PB 4KFBA 4PQUB 3PVXA 1TVRA 1BIZA 3OS0A 4ED6A 1ITGA 4J2DA 4FJ7A 4E1MA 4MK7A 2UVUA 2X6SA 3G0ZA 4DF8A 4Y3CA 1XR7A 2R8JA 4O0JA 4M3RA 3OYKA 3V9WA 3ISNC 2P5GA 3VQ8A 4ZP6A 4PY5A 3MR3A 1JLCB 1NJWA 3DLKA 3RMBA 4ZVHA 3AVFA 1WAFA 2YKNB 3MR5A 4NYNA 3MR6A 4ZP8A 3ZSZA 3T19A 3PY8A 4F3TA 4DTOA 4OPKA 1RAJA 3QINA 3SI8A 2Z1HA 1MU2B 4DTNA 3LAKA 1QE1B 4W5NA 2HHWA 1XR5A 1RT3A 4URSA 1SL1A 1G15A 1S1VB 3ZSWA 4K8XA 2KFNA 2R8KA 4H4OA 2FVCA 2ZKUA 2CJQA 4FBTA 1W9HA 2BE2B 2VG5B 4Z0UA 4FM0A 2C2EA 1S1XB 3HPOA 3QIPA 2AGOA 4R5PB 1JL1A 4YFUA 4TQRA 3BQ2A 4ZTFA 1RT7B 3VQSA 2AQ4A 1HYVA 4M3WA 4LQ3A 4QW8A 3AVHA 1VSDA 4FS2A 5E41A 1T8EA 2HWHA 4TLRA 5KFOA 1CXUA 1ASWA 5KI6A 1S1UB 5KG0A 4MIBA 3KMQA 1TAQA 3ZSXA 4YMEA 3MAQA 4NLSA 4F3OA 3BSCA 2X6NA 2HVHA 2B5JA 3HT3A 4JLHA 4AHUA 1X9WA 2E4LA 4M41A 5F8JA 1QSLA 3C95A 3V6KA 2JEFA 2R2SA 3HVTB 3RB0A 4JV2A 3MF5A 3KK3A 4EZ6A 4NLVA 1S0MA 2JEJA 3T3FA 4FJGA 4ZVEA 3OHBA 3PR4A 3L2WA 1RTJA 3PJWA 2QV6A 3K5MA 1Y97A 3DOKB 4AILC 4JS4A 1RDRA 4DTJA 2IA6A 1EKEA 5KFRA 4ED0A 4U6PA 1S48A 2HNYA 3KIOA 2RF2B 1RA6A 4H4MA 3L2VA 4J9PA 4ECWA 3UQSA 4RNHA 5KG4A 3NGZA 3V1OA 1UWBA 3MXJA 2FBVA 3ZSVA 4ZHRA 4CGHA 3Q8SB 4F8RA 3ULDA 4ZPBA 5DK5A 2OPRB 5C25B 4O3SA 1OS5A 1RT6B 2XCAA 3D28A 4CFCA 2IAJA 1RBTA 4FYDA 4CEQA 4KO0A 3DLEB 5HP1A 1IO2A 2PY5A 3JYTB 3QYYA 3H2LA 4F50A 3PW0A 2HHQA 3U3YA 5HRRA 1HMVA 3BSOA 1QTMA 5DLFA 4AH9A 4MQ3A 1RT2B 5EWGA 1IKVB 5KFAA 4TQSA 2J6UA 4KKOB 2FBTA 1TK0A 1MMLA 4NLYA 4ID5A 4FK2A 4KI4A 4NLOA 4NLWA 4ECVA 3PZPA 3SUOA 4NZ0A 3KJVB 4IRDA 1EP4B 2ZE2A 4CGDA 5J2PB 1R0AB 2AU0A 4GC6A 4B9VA 4DQPA 4E1NA 1S1WB 4WYWA 1C1AA 4ECYA 3MEGB 3ZCMA 4BDYA 1TK8A 4WE1B 2OPPB 1BI4B 4AHTA 2HNZB 4M42A 2FLLA 3M9NB 3OYNA 1D1UA 2WCXA 2RDIA 2I5JB 3VA3A 2G8WA 4CJ4A 4B9TA 3IS9B 4LH4A 5HRSA 4M3TA 3H5UA 3FQKA 3V6JA 2VG6B 1RBSA 4WFXA 1EETA 1HNVB 4G1QA 1BCMA 4KTWA 1JLGB 2HNDB 3FQLA 4WYLA 2BR0A 2R7YA 2E9RX 1VRTA 3LP2B 1NK0A 2HHUA 1JLAB 2OPSB 3QGGA 3KD1E 3KMSA 3OJSA 4LSLB 3ZSRA 2LSNA 3N6NA 4G3IA 3MECB 4DL7A 2DPIA 3TVKA 1I3AA 5KFTA 1KVBA 3SFGA 1WN7A 1S4FA 4IFYA 3OYHA 4RUAA 2OYQA 3IG1B 4FLTA 1QUVA 2ILYA 4QW9A 3OS1A 1U09A 4DG1A 1BHLA 3NBPA 3MEDB 3DYAB 3M8QB 3V4IA 1S9EA 4JV0A 2XRIA 5L1JA 3OLBA 4F4XA 1TL3A 4CF2A 3I8DA 1JLFA 4ED1A 4RNMA 5KFLA 5KG1A 4NCAA 4GC7A 3DLHA 5F8GA 5KGXA 1U04A 4W5QA 1JLQA 4PUOB 2DFEA 4KSEB 3NMAA 3L2UA 1N5YB 3LPUA 3S9HA 1IKXA 3QETA 5KG3A 3OY9A 4I9QA 4CHPA 5KFUA 2OZMA 3RMDA 3WNFA 1LWFB 3CO9A 2G8FA 1UAXA 4WFZA 3AVKA 5J2MA 3KK2B 1N4LA 3WNGA 4DTXA 1ASUA 2FVRA 2WTFA 3BGRB 4JUZA 3PW4A 3OL9A 3C6TB 4AHCA 4IH6A 3Q8RB 1KFSA 3QZ8A 4K4ZA 5J2NB 3SPYA 1J5OA 5KFIA 3B6OA 2HMIB 2XI3A 3QNOA 3DRSA 4ECQA 2BQ3A 4IFVA 3OHAA 3CJ0A 4C8KA 4E0DA 4R0EA 3DOKA 3T1AA 5J1EA 4H8KA 1SV5B 1SL0A 5HLFB 4F4YA 4RNNA 4I2PB 4PA1A 3QEVA 4NYZA 5FROA 4CJVA 1T03B 4O44A 3LPTA 3ZT1A 3OYLA 4I7FA 4RW6B 1RT5B 3OSNA 1HNIB 3IRXB 5F8NA 4OVLA 1KLMB 3VN5A 4E89A 3RTVA 3OL7A 4JRQA 1VK0A 1WSHA 4YR0A 3K5OA 5HBMB 3VA0A 2D41A 3ZT4A 1ZBUA 4RW8A 4KHQA 3NH2A 2QK9A 1DTTA 4BWJA 3CDEA 3RBDA 5C24B 2KZMA 1D8YA 3Q8QB 5T14A 2B6AB 4Z4FA 4ECXA 2J6SA 3HM9A 4ED7A 4CJPA 4CF0A 3PX0A 5F9LA 4ICLA 3I5AA 3DI6A 4KHNA 1R0AA 3CFOA 2KZZA 1RILA 1WLJA 1Z25A 4NRUA 2C28A 1C1BB 4WE1A 1NNDA 4DSIA 4QCLA 1C1CB 2XO7A 4URQU 4EP5A 4NLTA 3HKWA 3VQCA 1TKTA 4NCGA 3BSAA 3SUPA 4FLUA 1NK5A 2FVPA 4BWMA 1T05B 2OZSA 3AA3A 2WONA 1SKSA 3LP1B 3LAMA 2EX3A 3KLHB 3MFIA 1X9MA 3K58A 4PWDB 1D9FA 3H4DA 3PX6A 1VRUA 2YNIB 4IDKB 3HP6A 4IQXA 1BQNB 3VQ7A 1RTDA 1S1TB 4HUFA 4RZRA 3UPFA 2KFZA 4K50A 3HVAA 2IDOA 4CGIA 3JSMB 1TV6A 1Q9YA 1RT1A 3PO5A 4Q8FA 1WAJA 1J53A 4TN2A 3RAXA 3NE6A 1QAJA 3SPZA 1HQEB 3AVCA 4FK0A 2UUTA 5KFMA 1VSJA 2ZD1B 2W8LA 1IKYA 1KCFA 1RBUA 3AO5A 1RTHA 1HQUB 4Y2CA 4O55A 3QGHA 3I0SA 5KG2A 3KLFB 4J9QA 1N6QB 4CIGA 4FJXA 4OKJA 3QO9B 3NDKA 3KLIA 5CYMA 3PHEA 3ZT2A 1DTQA 5EU7A 2RDJA 3FRZA 2IMWP 1DLOB 4HHTA 3KK1B 4OLAA 4TY8B 2ATQA 3SNNA 3CFRA 4DU4A 1C0UB 3TAEA 3NF6A 3AO2A 5KFHA 5I3UB 1QSSA 2ASLA 4IH5A 1S0OA 2Z1JA 2GV9A 1JXLA 1RDDA 1RDCA 4CHYA 3VQQA 2YNFB 5F8HA 1IG9A 1KFDA 4ZMMA 3ICLA 1TGOA 3AO3A 2JGUA 2QKBA 3SQ1A 4QWDA 1S6QA 2OPQA 1REVB 3SV3A 3DRPB 1FK9B 3FSIA 3RB6A 4IRKA 4BE1A 2RN2A 2JC1A 2UUWA 4IKFA 2HMIA 1JLBA 4IG0A 3SFUA 3ITHB 4QWEA 2P51A 4M95A 4Q0BB 5KFXA 4FVMA 1LW2A 3BJYA 3I0RB 4LQ9A 2D5RA 3AVBA 4JS5A 5I42B 4CJEA 4Z4EA 2IM2A 3QZ7A 2PYLA 3M9OB 4CJTA 1GX5A 1GX6A 1RBRA 4CERA 4ZPDA 4K4SA 2FLPA 3VQ4A 4EO6A 4CJLA 3V6DA 1YVUA 1KLMA 2BQUA 2VG7B 1HPZA 4CF1A 4FJ8A 3GV8B 1LWCB 1JLEA 3NL0A 3QERA 3MTKA 3OYJA 3RMAA 5FDLA 1FKPB 3NCIA 5FRNA 1NJYA 1TL1B 4ZPCA 4K4WA 1QHTA 1Q9XA 4ED8A 3T5HA 4LSNA 3QGIA 4KHYA 2QKKA 3K59A 2HHTA 1CZBA 4IR1A 4CK1A 4XPCA 3NFAA 4JRPA 4J9LA 2DFHA 4KHMA 2W9CA 4CGGA 5KFGA 2HW3A 1S10A 4QWCA 3S3MA 2FVSA 4CECA 4ECZA 2O4IA 3H5SA 1LW0B 2IJNA 3SUNA 3G10A 3QLHA 4E7LA 4CGJA 4DFMA 4DQIA 2VA3A 4HUGA 2R8IA 1S6PB 3O4NA 4RW9B 2C2DA 3RR7A 3RMCA 4LD0A 4MK8A 1CXQA 1TKZB 3LP1A 1IM4A 4CIFA 4Z4GA 2E6LA 4JV1A 1NKCA 5J2QA 2D3ZA 5KTQA 4UQGA 1EXQA 4U7CA 4OJRA 3KKRA 5KT7A 4DFKA 3DMJA 4ZPAA 1RTIB 1S9GA 1HYZA 5K14A 2G8HA 3THVA 1JX4A 2D0BA 1NK9A 3QIOA 4DF4A 2D7SA 4CHQA 2F8SA 4EO8A 5DGAA 3C6UB 4FLZA 4J9NA 1BQMA 4CHNA 3V81A 2HHVA 1K1SA 2XC9A 3IAYA 1GOAA 1FKOA 1HQUA 2YKMA 4WFYA 4IR9A 4DLEA 4O3RA 1TAUA 4RW4B 2BANA 3KOAA 2RKIB 3KLFA 1S9FA 3M8PA 2XY7A 1RT4B 3EY1A 3V6HA 1TKXB 3BSNA 5D3GB 4H54A 3DRRB 3DM2A 4QWAA 4FLVA 3KHGA 3RWUA 3D5MA 4E19A 4K4TA 4BE2A 2E6MA 4YNQA 4GVMA 1WNSA 3MEEA 4DQQA 4Y34A 1SH3A 3DOLA 3F73A 1C0TA 2GC8A 3S3OA 3VQBA 5KG5A 4MKAA 3RBEA 1SH2A 2VA2A 3PW7A 3M8RA 4O4GB 3E01B 5KG6A 4OKKA 3QNNA 3G86A 2GBZA 2Z1IA 2R2UA 3N6MA 2FJXA 4B8CA 5L1LA 4PQUA 3H08A 3KLVA 3SV4A 4R8UB 2AGPA 4Q44A 4XO0A 2HHSA 5DG7A 5F9NA 2YHBA 1WSFA 4DU3A 4ZVGA 1HARA 2G8IA 2R2TA 5KT5A 5DG9A 4B08A 3CQ8A 3NH0A 4J9MA 3LANA 3EPGA 1BGXT 1JLCA 4KREA 4O0IA 4M3XA 1XC9A 2YKNA 4WZQA 2R8HA 1J54A 3V1RA 4Q45A 1MU2A 3OYFA 1QE1A 4CEDA 5CZ2A 3PV8A 1VSIA 2YNHB 3F9KA 3T5LA 4MFBB 4DL3A 1S1VA 3TWHA 4OLBA 2XGQA 4NRTA 3VQPA 3GV5B 1ZBIA 3DLRA 2BE2A 3OSPA 1IKWB 2VG5A 2P5OA 1S1XA 4Q8EA 1J9AA 1L3UA 3PUFA 3L3VA 3D45A 5C42B 4R5PA 4FJIA 1RA7A 2IC3B 3TAGA 4CHZA 4AHSA 4CF9A 1RT7A 1JKHB 3KLEB 3M9MB 1U45A 4KI6A 4HCCA 3HPHA 2WOMB 3TAMB 5HRNA 4J2BA 4FLYA 4CJKA 2EC0A 3ZT0A 1XR6A 4DSJA 3CDUA 1L5UA 1S1UA 4W5RA 1K1QA 5KFWA 2YNGB 1CZ9A 1XWLA 2G8UA 3UIQA 4DTSA 2F8TA 1TKZA 4EZ9A 1WSIA 1L3SA 3TAFA 3DLGB 1KVAA 2G8VA 4HVJA 4X2BA 4F2RA 3HVTA 2YHAA 4CFBA 3RAQA 3K2PA 4HUEA 5F8IA 3CYMA 4IG3B 5KFVA 1WSJA 1I39A 3U3GA 4OGCA 1HYSB 4FLWA 1SH0A 2V4RA 3BR9A 4B9NA 1QQCA 2RF2A 4RW7B 1WNEA 1ASVA 4KFBB 2AX1A 1QSYA 1TVRB 3MFHA 2JEIA 4FCYA 4WXWA 3K5NA 2FVQA 4ECSA 5JS2A 1JXBA 3C94A 2P1JA 2OPRA 2RKIA 5C25A 2BRKA 1RT6A 4OPJA 3DLEA 4FZXC 3JYTA 3DLKB 4BE0A 4FJNA 3CVKA 3UDLA 2FBXA 1B92A 3PW5A 4CIEA 2V9WA 2R2RA 1RT2A 1RDAA 1X9SA 1IKVA 4MIAA 4KHSA 4CFDA 2HWIA 3P83D 4KKOA 5KFBA 3AVLA 3PR5B 4J2AA 2XY6A 1RT3B 2IS3A 1D0EA 5EWFA 1S49A 2V0NA 2JEGA 2CKWA 3NAEA 4H4OB 4CGFA 3KJVA 1RBVA 3TAPA 4O3QA 1EP4A 1XHZA 2D0AA 5J2PA 4EBCA 1S1WA 4CHOA 2XGPA 3MEGA 3IN5A 1S5JA 1UA0A 2W7PA 2OPPA 1BI4A 1UOCA 3QIPB 3ZSYA 4FW2A 2HNZA 3AVGA 4DEZA 3SUQA 2XHBA 1U49A 2XWYA 1RCHA 3VQAA 5KFSA 4J9KA 4CJ3A 4NLDA 4J2EA 5JUMA 2I5JA 3HHKA 1LAWA 1ZBHA 3NF8A 3IS9A 4ECUA 3CJ3A 4DL4A 5KRTA 4KB7A 3KTQA 2VG6A 4KAZA 2Z1GA 1HNVA 3OYGA 1BISA 4FJJA 3OYAA 4J9RA 3ALYA 1JLGA 2HNDA 1L3TA 2IJFA 5SZTA 1YTUA 3LP2A 1JLAA 2OPSA 3FFIB 4DSEA 1K6YA 2A1RA 4LSLA 2B5JB 4E7JA 2BDPA 3MECA 2HHXA 4FM1A 1L3VA 4M45A 3LZIA 4E3SA 3IG1A 4XIUA 4ECTA 3WNEA 3KK3B 5CY4A 2I1RA 4K4VA 4F4KA 3DDKA 5FRMA 3MEDA 5F8MA 3DYAA 1D9DA 1YVFA 3M8QA 3PO4A 4Z4HA 1ZTTA 4FM2A 3CWJA 1LWEB 4YR3A 3RB3A 4CEOA 3TARA 2HNYB 1XI1A 3H5YA 4BDPA 2DY4A 2C2RA 1LV5A 4EP4A 1SKWA 4H4MB 1YTAA 3TR8A 2J6TA 4PUOA 4DLGA 1UWBB 2B43A 4RU9A 3VQ9A 2W42A 1S0NA 1N5YA 1VSHA 3EZUA 2Q3SA 4CFAA 3SCXA 2O4GA 4NLRA 3P1GA 3OS2A 1LWFA 4KO0B 4I9LA 4N56A 5C5JA 3KK2A 2E9ZA 4W5OA 3AA2A 2ASJA 3KHHA 1HMVB 3BGRA 4KE5A 3GIIA 3HO1A 3C6TA 1TQLA 2PZSA 2XY8A 3U6FA 5J2NA 4ID5B 3G6XA 2GIQA 3VQ6A 4IOBA 4B9SA 3ZT3A 1N48A 3OYBA 2ZE2B 5DGBA 3QESA 1HYSA 2AGQA 4ELUA 3I5BA 4FW1A 3L2QA 3OJUA 4FZYA 2ASDA 1SV5A 2WK4A 5HLFA 4CEZA 2WHOA 4I2PA 1T03A 2WRMA 4FJMA 3AVNA 5L9XA 4DL2A 5DG8A 5KT4A 4RW6A 1RT5A 1HNIA 4DSLA 4FJ9A 1KHVA 4FXDA 3IRXA 3FDSA 3KLGB 3WNHA 1TKDA 2DTUA 1EETB 4TYBA 4NCBA 2IBKA 5HBMA 4G1QB 4ZP9A 3SI6A 1VRTB 4DWIA 2B4JA 1O1WA 4MH8A 4QOZB 4Y1CA 2AWZA 4B9LA 5C24A 4KTZA 3D0PA 3N6LA 1B9DA 2R8GA 2B6AA 4IFYB 1BIUA 1JXEA 3V9SA 1NK8A 3LWLA 4CJQA 3GILA 3V1QA 3VQDA 1N56A 4DG1B 3GV7B 4C8LA 2FBYA 3NBPB 5T7BA 1X1PA 3AVIA 3LP3A 3V4IB 1S9EB 1C1BA 4NLUA 4B9UA 1C1CA 3NH1A 1TL3B 3NHGA 4FJHA 5DQIA 2OA8A 1JLFB 4KAIA 3HK2A 2ILZA 4B9MA 4RG8A 4E7IA 2W9BB 4CEFA 1JLQB 4Y1DA 5JXSA 1T05A 3OL8A 3MXMA 5KFDA 4OKEA 3KLHA 3KD5E 1IKXB 2ITGA 2FJVA 3AV9A 4CJUA 3BDPA 3GIJA 4ED2A 4PWDA 3OLAA 3BQ1A 3OYEA 4F4ZA 2YNIA 4IDKA 3QIDA 3BREA 4AHVA 3FFIA 1SKRA 5J2MB 4BACA 4YP3A 3KKSA 1BQNA 1D5AA 5DQHA 4MKBA 4QWBA 4NLPA 1S1TA 4GMJB 3GIMA 2V4QA 1Q8IA 4IH7A 3OVNA 4DMNA 4CCHA 2D3UA 3JSMA 1UA1A 1ZETA 4N5SA 4ELVA 4RNFA 3HVWA 2NUBA 2UVRA 3B6PA 3H98A 1J5OB 1NJZA 4WZMA 3TAQA 4KRFA 1W0HA 4TYAA 2AX0A 1WSEA 1HQEA 3DRSB 2X74A 5L1IA 4IFVB 3SZ2A 5KFQA 2ZD1A 2ATLA 4K4YA 5KFCA 1LWEA 1W25A 4DTMA 5J1EB 4N76A 4EBDA 1HRHA 3OYMA 1N6QA 4DTRA 1CLQA 1A5WA 3QO9A 3CG7A 4M94A 1TP7A 1TK5A 3HL8A 4O44B 4Z4IA 1DLOA 4B3OB 1BCOA 3KK1A 4TY8A 4IRCA 3UR0A 4I7FB 4URGA 3AO4A 3NGIA 4KB1A 2BGGA 1C0UA 4ZTJA 2X78A 1NK4A 5I3UA 4KHRA 3KHRA 3OYIA 4DSKA 3MR2A 2KQ2A 5KRSA 4DU1A 2W9AA 1QS4A 4CK2A 2YNFA 3CM5A 2XY5A 3AA5X 4RW8B 4J9SA 5CZ1A 3RRGA 2C22A 2IM3A 5KG7A 1DTTB 1REVA 3DRPA 2DPJA 1FK9A 3PJXA 3K5LA 3SJJA 3NAIA 4KBIA 4IKAA 1A5XA 3ITHA 3EPIA 5KFEA 4DQRA 1T7PA 4ICLB 4KV8B 4NLXA 3DI6B 3HPGA 2HVIA 3SQ2A 3IGNA 3QEXA 4Q0BA 2EHGA 3I0RA 4FZZA 4CK3A 4NYFA 1GOCA 1KVCA 5I42A 5DLGA 2Y1IA 4CESA 4KHUA 3KNAA 1C0MA 2HAIA 3OYDA 3AVAA 1TKTB 4NCGB 4AHRA 1EX4A 3QEPA 5JS1A 5KFYA 3OL6A 2IGIA 2JC0A 3L2RA 3AVJA 2WB4A 3KLGA 2WONB 4DL5A 2GIRA 2VG7A 3DLBA 1IH7A 3V9ZA 2ZQBA 1LWCA 4CEBA 1RNHA 3EYZA 5KT2A 1VRUB 1YT3A 3EZ5A 1FKPA 1F21A 3NF9A 1TL1A 4J9OA 4CF8A 2OH2A 1RTDB 3NKYA 3VQEA 3M8SA 4M3ZA 1SUQB 1TV6B 3ISND 1RT1B 1HJRA 3ASMA 5CYQB 3AA4A 4M3YA 2W7OA 4QPXA 4FJKA 3T5KA 1VSMA 1C6VA 3IGVA 4I2QB 5HRPA 3CM6A 1IKYB 3CFPA 1T94A 1RTHB 1VSFA 3V9XA 1LW0A 1Z26A 2AJQA 3I0SB 2FJWA 4CJFA 2FC0A 2D0CA 4DTUA 3A2FA 3KLIB 5CYMB 4KHWA 1KRPA 1DTQB 1S6PA 2W9BA 4RW9A 3LP0B 5DMRA 3RR8A 4EYHB 4DFJA 1KTQA 4FK4A 3O3GA 5EDWA 4YR2A 4M3UA 1NKBA 2A1SA 4O5BA 1RTIA 4FS1A 2RPIA 3ZSQA 2JLEA 4FJ5A 3LZJA 1U4BA 4KB0A 5HROB 2ETJA 3HXMA 1S6QB 2OPQB 3HJFA 5KFKA 4Q5VA 3HP9A 3KHLA 3C6UA 3HVRA 3RRHA 4EBEA 1RDBA 4KTQA 1JLBB 4CE9A 4IG0B 4BDZA 4CJRA 1NHUA 4CEEA 2XI2A 2IOCA 2IM1A 1NOYA 3TQ1A 3O3FA 4FBUA 1LW2B 2HB5A 4RW4A 2PYJA 1GOBA 5KT6A 1RT4A 1ZBFA 1CSJA 1ZBLA 4O4RA 1TKXA 4NLQA 4EYIB 3TI0A 5D3GA 5KGWA 3TANA 4OL8A 4B3OA 4F4WA 4B8AB 3DRRA 2BRLA 4TXSA 3GQCA 4C8OA 4RNOA 1Z4UA 2W8KA 3V6DB 1VSEA 4Y2AA 1HPZB 4LH5A 4RUCA 3H4BA 4FJLA 3H40A 4WXOA 1JLEB 1S97A 4CJWA 5SWMA 5EWEA 3BQ0A 4Q43A 5FDLB 5KFJA 2KTQA 4O4GA 3NGDA 4O3OA 4ED3A 3E01A 1A5VA 5KFNA 2QXFA 4W5TA 4LSNB 2UVWA 3PX4A 4HTUA 4L8RB 3GIKA 4FLXA 4E7KA 4R8UA 4K4XA 4C8NA 3OYCA 4OGEA 4KV8A 2W9CB 2BQRA 4CJSA 3NF7A 4MK9A 2ALZA 2GUIA 4DS4A 3VQ5A 1I6JA 3QLHB 4ECRA 4QAGA 4LY7A 3MXIA 3T5JA 4N41A 4XPEA 1ZTWA 5EUHA 1U48A 2G8KA 5F8LA 4HCBA 1ZYQA 5KT3A 4K4UA 4HYKA 4DL6A 2IM0A 4ELTA 5J2QB 3I5CA 3TABA 2YNHA 1SL2A 4NLGA 1NK6A 4MFBA 3CIZA 3G6VA 4Z4CA 3DMJB 1JIHA 4DQSA 4EEYA 4DFPA 1S9GB 4DTPA 1NK7A 5K14B 1RTJB 1IKWA 1WSGA 4K8ZA 3G6YA 5KFPA 1KHWA 2F8EX 3NAHA 1FXXA 3E51A 1SUQA 1RYRA 3K57A 5C42A 3AVMA 4DSFA 2IC3A 1XHXA 4TY9A
chains in the Genus database with same CATH superfamily
4B3TK 4CEAA 3CDWA 1HD0A 2GTDA 1BQMB 2ZZMA 2F96A 2LQBA 2QWRA 4I2QA 2LQ9A 4G9ZA 3TAMA 1TTHB 3D6RA 4CTAB 2R7QA 2QE5A 2YKMB 3QEIA 4LREA 4TSXA 1RZMA 1N0VC 4IYQA 2Y1JA 4CT9A 4WFAL 3QWPA 2GQCA 3LP0A 2Y0SD 3ZSOA 1JL2A 3LO3A 4ZVFA 4E1JA 3DM2B 2PA3A 4DV7J 2W2MP 4BBYA 3SQ0A 2UUCK 3O9UA 3DLGA 3QFUA 3SAGA 4WU3A 3OXFA 3GYNA 4F2SA 1UAWA 2CZ4A 3CJ4A 3DLJA 3GYXB 4JI3F 2YHXA 1BL3A 4LRFA 4DS5A 2PO4A 3LDSA 4N47A 3A1YG 3L8BA 3NGYA 1RACB 2VUGA 3HD2A 2LQJA 3F9MA 1LAVA 2KW4A 4ID8A 4B3RF 1T02A 4DUZJ 2GWKA 3ENHA 4PQUB 2J0QD 1TVRA 3BV8A 3SMZA 1HJOA 2IYIA 2ZM6J 3CJKA 2OJ3A 3G0ZA 4DF8A 2QSWA 2W24A 4DV7K 1DHMA 1KKHA 2W40A 3ISNC 3POTB 5HQ8A 2IVYA 1JLCB 2W1BA 3DLKA 4YN3B 4BR5A 1L3KA 3ILJA 3GSIA 5AE1A 2OD4A 3ZSZA 3T19A 3CPEA 4H0TB 2V51B 4BRCA 3FZ2A 1RKIA 3R5CA 2DNKA 3J8AA 4FKXA 1E4FT 2V6AA 1SL1A 2UUCF 4K8XA 2KFNA 2ZM6K 1RWMB 1E3MA 2FVCA 2PA8D 4OLPA 4WWSA 2BE2B 4ZVRB 4FKYA 4FM0A 3R2DJ 2H3GX 3K9KA 1HFEL 3EO3A 2FLOA 1RTZA 2AP1A 4HLBA 2VJUA 1BWEA 3ZLJA 1SC1B 2EFVA 2EG1A 4M3WA 3AVHA 1VSDA 2HWHA 4TLRA 4GKKK 1HNXJ 4DV7F 1HNZJ 5BRHA 5ADZA 5KG0A 1C4AA 2NRRA 3ADAC 3CCZA 3WQTA 4JKBA 4X84A 5M1QA 3BSCA 4JKGA 4K0KK 1X9WA 2PFDA 2DGVA 5F8JA 1QSLA 2E1MC 4JV2A 3MF5A 3Q8VA 1W97L 3KK3A 4CLSA 4FVCA 4EZ6A 1JJCB 1R8CA 4NLVA 2JEJA 2XS5A 4I67A 4DUZF 5M1FA 4FJGA 4ZVEA 3L3CA 3D3CJ 2R9LA 2QV6A 2BA9A 2ZM6F 4DTJA 3KIOA 1HNXK 3N4QA 1OSCA 4IOAL 2DHAA 3T1HK 1HNZK 3KG4A 2UZAA 1EO1A 4H4MA 5E84A 3GFXA 4J9PA 2IDLA 3NGZA 1R59O 3HD1A 4CO2A 3UKRB 4ZHRA 3PRDA 1SQKA 2R7RA 5C25B 4USVA 4CEQA 1KBRA 1IR2A 2PY5A 3QYYA 5LMUK 1R3NA 3HZ6A 4F50A 4H0PA 2HHQA 3U3YA 2QZ8A 3GWCA 4K5SA 3VAJA 5DLFA 4MQ3A 5EWGA 4BRQA 5KFAA 4QJVA 3M3ZA 4ID5A 4ECVA 2XSFA 1GMWA 4NZ6A 4WFBL 5JLHA 3V2UC 3SMPA 2CQBA 4IRDA 1EP4B 4LJMA 4CGDA 2AU0A 4GC6A 2RS8A 4I6AA 1C1AA 3ZCMA 1TK8A 2WUSA 1EZZB 4KGMA 3NS7B 4AHTA 3H0PA 4OLOA 2HQFA 1WHVA 4H0OA 5M1KA 2QX0A 5FPMA 3M9NB 3OYNA 1PC5A 2WCXA 2RDIA 2J9CA 5E5NA 4XH4A 3MM5B 1TYQA 1QD1A 1IV0A 4M3TA 1RADB 3FQKA 2VG6B 1RBSA 3UE2A 2R7YA 4WYLA 1KS2A 5ETOA 2MLYA 2FSKA 1VRTA 1KNZA 5A8KA 1D8ZA 2JFDA 1NSQA 1QVFR 3ZSRA 1JXVA 2LSNA 3N6NA 1I3AA 3TVKA 5KFTA 2UUAJ 2MHNA 2F4VJ 4V19S 3OYHA 3IG1B 2P9LB 3K0JA 2F4FA 2CPXA 1UFKA 1ZPWX 4QW9A 3OS1A 3BDEA 3W60A 1P6TA 7FDRA 1N5SA 3EUNA 2VZ9A 4JV0A 4WIIA 2VPXB 2V8HA 1TL3A 2Y0BB 5EHHA 1NBEB 1FDBA 2GX9A 4ED1A 4RNMA 1YJUA 2NSCA 2XMTA 5KG1A 1JLQA 1FVSA 4PUOB 3B4MA 2DFEA 2AMCB 1TUVA 4FVUA 2GJ2A 4LFAJ 2UUAK 1IKXA 4DR6J 3OY9A 1VBXA 4NO7A 2VFSA 4LUBA 2FDNA 2WSEC 3WNFA 1ZBTA 2KM8C 5BRFA 2WTFA 3OR2A 3AGRA 3C6TB 1SJFA 1VK8A 3KDNA 4R25A 5LT5A 4K4ZA 2V7YA 3CCUS 1GLJO 1J5OA 4MO4A 2XI3A 1PBUA 2HEKA 3AJ2A 4IEIA 3OHAA 4C8KA 3GE1A 1TUGB 3T1AA 2M88A 2Q6CA 4O5FA 4LFAK 2HKEA 4H8KA 3CCTA 4DR6K 4ZVSB 4F4YA 4QIWD 4X4VA 4RNNA 1NDPA 1WF1A 2PFFB 4PA1A 4CJVA 4GVBA 1VS3A 2DXEA 4LF9J 1GAOA 2Z2MA 3DDIA 5EOYA 3OYLA 4BVPA 3DCAA 3T9ZA 4I7FA 3TJ9A 4RW6B 5E7OB 4OVLA 2LVWA 1O13A 3OL7A 4BRFA 4JRQA 5C7PA 3K5OA 3SEOA 4OX6A 3VA0A 2DGUA 1T9UA 3R5AA 2UUAF 2F4VF 4P2FA 5L46A 2XZWA 1WACA 1CS4B 3PYEA 3NGKA 4J5OA 2YY3A 3D2EA 3CMQA 3X1LB 2B4OA 3BF1A 1YJRA 4ECXA 5DDQC 4NEYA 3H46O 4CJPA 4PXEA 3PX0A 4USJC 2A2CA 4ICLA 1R0AA 2KZZA 3C2PA 4NRUA 4ZN1A 4WE1A 3R5BA 4NLTA 4LFAF 3K2YA 3SUPA 4FLUA 1S0VA 2AP6A 3FR0A 5AZIA 1WHWA 2PE8A 1VQMN 2OZSA 2QXLA 1SKSA 3M6GA 1U02A 4BCAA 4NZ7A 1D9FA 3H4DA 3M8WA 4IDKB 1VJWA 2V94A 1RE1B 3VTHA 4LF4K 3DXSX 1S1TB 2RJZA 2KG0A 2DNYA 2LEPA 4GO5X 3PO5A 1J53A 3J7A1 4FYYB 1HKAA 4MO5A 4GV9A 1ATRA 2R7VA 4C98A 3C46A 3EZWA 4BR7A 3J81j 3D0GE 1KCFA 4JKAA 4LF9F 3I0SA 2VV5A 3TA2A 3R1HA 4LBIA 2O8DA 3BKTA 2YWWA 3OTOJ 1DARA 2BM0A 3PHEA 1DTQA 1IJJA 7FD1A 1MWYA 5E33A 2CAJA 3KK1B 1RUSA 3L7UA 3L4IA 1RHUB 3B6BA 1KQSR 3SNNA 5AQZA 2HMPA 4DU4A 4AQYJ 2QM1A 4EK2A 1C0UB 2XMVA 4M5LA 5KFHA 4F3MA 1S0OA 2Z1JA 1RCXB 1JXLA 5L8RC 1U1OA 3N9UC 5E3AA 1NDKA 4WIQA 1HR0J 3GFHA 1IG9A 3S1TA 3FCWA 3ICLA 1TGOA 3OVAA 1REVB 1Q7YT 1FK9B 3FSIA 3CIPA 3RB6A 3FZKA 2RN2A 3L95X 1JB0C 2CDQA 2MKKA 1YTYA 4U95A 1JLBA 4HWIA 4KYZA 3SFUA 2WBMA 4M95A 4DU7A 3GG4A 1Q53A 3PSIA 5C2CA 4AQYK 4LQ9A 3AVBA 3DRYA 4CJEA 3MPYA 2CQ1A 5BN8A 2PYLA 3M9OB 2FXUA 3BGFA 3EMTA 4CERA 3BYPA 4ZPDA 1YVUA 1KLMA 2BQUA 4FJ8A 1CEZA 3A5OC 3GV8B 1JLEA 3NL0A 2CWXA 3OYJA 2P2CB 5FDLA 4M5IA 1K0TA 3ID6A 1MWZA 1VYAA 3ZNUA 1Q9XA 3T5HA 4LSNA 1OH5A 4KHYA 1S57A 2FTRA 3K59A 1W26A 1X5SA 2RHKA 4D3HA 4KH6A 2HHPA 1YG0A 2Z58B 1BD6A 3NFAA 1WSRA 4HI2A 3JS6A 2LDIA 1PAEX 3DDNA 1XTZA 2JWNA 5KFGA 1S10A 3PHTA 4QWCA 3OTOF 1RABB 2ZH3A 2VFUA 1FWPA 1JQGA 4ECZA 3MK6A 1LW0B 1RAEB 2R7OA 4N8NA 3JQJA 1WWHA 3O1BA 4AQYF 4PL8A 4HUGA 4LT6A 4OI0A 1B0TA 4P75A 3HBTA 3OA9A 3RMCA 4MK8A 1EHWA 1IM4A 3TP2A 1W7AA 4OI4A 1HR0F 2E6LA 2C2MB 3LM2A 1EXQA 4OJRA 1E6YA 3CCSS 4ZPAA 3KWIA 1VAZA 5TKWA 1HYZA 5K14A 3FCHA 1JX4A 2F40A 2D0BA 3FFKB 2EFGA 4DF4A 1ZAWA 2D7SA 1KOHA 5DGAA 2NUHA 5GMEA 4J9NA 1EWRA 2M9KA 1QVGR 4Y28C 2L9DA 3V81A 2HQGA 3MCPA 3U1MA 1OWXA 1VQLN 3MUVP 3IAYA 1FKOA 4JI6K 3RU0A 3PNIA 3R6LB 2YWEA 5AQKA 2P9CA 5FIIA 2YQ1A 4RW4B 3NS6A 4J91A 3KOAA 2ATCB 2FJBB 3M8PA 1VLYA 2HQDA 1TKXB 3OD2A 5D3GB 1YGYA 5KPZA 2Q43A 4OHWA 3PRBA 4E19A 2ROPA 5B0DA 2E6MA 3NGUA 1FJGK 2UV8A 2QLBB 3MEEA 4DQQA 1U1QA 1SH3A 3DOLA 3VQBA 1UZHA 1M1GA 2CGJA 2SXLA 3E01B 3FBFA 5LY3A 2O8CA 4OKKA 3QNNA 3G86A 1N52B 4CLPA 4HEA9 4L3KA 2Z1IA 3BP8A 1YIJN 3BGUA 3N6MA 1GLEG 1GLLO 3VGUA 4DU8A 4R8UB 1RAOA 4B1XB 2GWJA 5F9NA 2F7VA 1KVIA 4OI1A 2VODA 4ILMA 2BV3A 3P49B 3CXCR 3UD4P 3EICA 2RQCA 2JWKA 3CQ8A 2VBZA 4NLBA 4KREA 1JJHA 3MM8A 1J54A 1S72S 5ITHA 1MA9B 4CEDA 3DOMB 2O8FA 5CZ2A 4NB4A 5AR0A 2ZBPA 4DR5K 3HRGA 4DUYJ 1S1VA 1A9NB 3TWHA 4OLBA 2O8EA 4V19J 3VQPA 4HH0A 1FI4A 2QA4S 4NA3A 1EAYC 3I4HX 4IO9L 4YHHF 4QBUA 1S1XA 4IWVA 4U96A 3TAGA 1W2BR 3R1LA 3A8YA 4CHZA 2HRYA 2PEHA 1DZ5A 2W2PP 4HVZA 3TAMB 4ER8A 2XWXA 3SSRA 1DAXA 5D6GA 4H5RA 1S1UA 4DX5A 4Y00A 1K1QA 4OYPA 5AFUH 1X0FA 4YOVA 3I96A 4JK8A 2K2PA 2D4WA 3VTIA 1TKZA 2V8GA 2QW9A 1FRHA 2V2QA 1YJTA 3DLGB 4X66K 4A8XA 2G8VA 4X2BA 4GVEA 1NHKL 1RHKB 4U7UD 4CLFA 4A8QA 2LP4A 2YHAA 3RAQA 3K2PA 1JK9B 3L4QA 2KT2A 4RBVA 3U3GA 3H7HB 1HYSB 2QTWA 2FC9A 5J1PA 3FGUA 3BR9A 3LGNA 3SCLE 4B9NA 1QQCA 1ASVA 2FJEB 2AX1A 3QGPA 3LGMA 1TVRB 1H6KX 3D7SB 1KR4A 3CJKB 4KH5A 3J81O 2IY5B 1RLDA 4Y6IA 5IQQA 2G13A 9RUBA 5LSRA 4ECSA 1JXBA 3C94A 4C0BA 2OTLS 2OPRA 1G4CA 3UWTA 3J7AP 5AFUA 3DLEA 2P9UA 4FZXC 3DLKB 2HVEA 2NYHA 4FJNA 2FBXA 2RRNA 3PW5A 3CCMN 4DUYF 1WEZA 1RT2A 1QHAA 1IKVA 1GXTA 3P83D 2QWQA 2CDRB 2VC1A 2IS3A 4NE9C 3GG0A 4BRMA 2V0NA 3M05A 2JEGA 1YF5L 2WTUA 3KJVA 1CQMA 3BUZB 2D0AA 5J2PA 4OYAA 2PI4A 2V52B 3R97A 4H5VA 3MZIA 2Q66A 2XGPA 1S5JA 1UA0A 2W7PA 2AW0A 2OPPA 1HLWA 1PYOB 5HMYA 2J9DE 1YXQA 2YPZA 4FW2A 4DEZA 3SUQA 2RS2A 3NOGA 2XWYA 2HFOA 1RCHA 4J9KA 3THPA 2I5JA 1LAWA 4GY2B 2HBKA 3NF8A 3IS9A 1V4SA 2E1YA 1YRUA 2EVZA 3CJ3A 2RILA 4KB7A 1TMJA 4LR9A 2OUGA 1BXNA 4AFFA 3OYGA 4J9RA 2HNDA 5MAOA 1L3TA 4X4TA 3VF4A 2OPSA 4NWBA 1T9WA 3FFIB 5AXKA 2ZH5A 4JKGB 1FFWB 2VFVA 4FM1A 2BM1A 2Q0RA 4ITSA 4ECTA 2GUPA 4DCHA 1X3NA 3KK3B 3DDKA 3DYAA 1D9DA 1YVFA 3PO4A 1RWOB 4ISGA 4Z4HA 3TX8A 3CWJA 2CFXA 2LQ5A 2OEJA 3HF5A 3RB3A 4CEOA 5EXWA 1FKAF 2ZJRQ 3D4JA 1BWFO 4H4MB 3CCQS 2J6TA 2LXFA 3CD6N 4RU9A 2WVCA 2Q3SA 4A61A 3SCXA 3P1GA 1WDDA 4JKCA 1RHRB 1LWFA 2A6OA 1S22A 1TFWA 2J9EA 4UOGA 1YJ7A 1IBLJ 1GNKA 3BGRA 4USKA 1T0TV 1MROA 1Y9OA 5EVZA 3AT1B 2PZSA 3NNHA 5J2NA 1NU4A 5CHCB 4ID5B 4KH0B 1Q82T 4B9SA 3ZT3A 1PBAA 1DJ0A 1RK8A 4B1WB 2YX7A 3WBZA 2AGQA 4OYBA 1G3OA 3L2QA 2ZJRL 3LDNA 3KYLA 1BMQB 2GAGC 1T03A 2G2YA 1OKJA 5L9XA 4DL2A 4XH5A 2CQ0A 3BBBA 1IBLK 5KT4A 1RT5A 3AGKA 3OXLA 1TYQB 3IRXA 3CB4A 3W8GA 1AYEA 4DV4F 4ZP9A 4BVOA 3N5BA 4M5KA 1VRTB 2B4JA 1O1WA 4MH8A 5A8KB 1VQSA 4KH4A 1KQGB 4JI4J 1FE0A 4RX6A 3LDLA 4KQZA 5C24A 2RB7A 4HTJA 1S76D 5F41A 5DO2A 1ZPVA 2LMIA 1NGEA 4LFBK 2MB0B 5GAGU 3CUNA 2IVPA 3V1QA 2A10A 1AFIA 4PXDA 4C8LA 3GV7B 1R8HA 1FD8A 3AVIA 2L41A 4U8VA 2QC3A 4O0NA 1PYTA 5AQOA 4DR3J 1I94J 3ZTSA 1TL3B 2XHWA 3N79A 4FJHA 5LJVA 5DQIA 2HBMA 3SSQA 2OA8A 4KAIA 1RWWB 1X31C 2ILZA 1SS6A 4B9MA 3KUGA 2VBYA 1JLQB 4E2FB 3N01A 5KFDA 3AAQA 1FX2A 3X3UA 1IKXB 1IBLF 3AV9A 4CJUA 1FHTA 4PWDA 3C66A 3OLAA 3OYEA 2DR5A 4I6YA 1SKRA 4BACA 1PO6A 4QWBA 4GMJB 4IJAA 2NXUA 4CCHA 3OR2B 4P10A 5B7WA 4MDAA 1I94K 1UA1A 2LXIA 2OELA 2XHCA 2K8GA 2NUBA 1N36J 4DV2F 2B7CB 1J5OB 1LWXA 1VQ4S 4KRFA 4TYAA 1HQEA 1K9MT 3PM9A 5L1IA 2MY7A 5DS7A 2HWTA 4DPUA 5KFCA 5KOWA 3GR0A 1HL6A 4N76A 2RHQB 4C97A 1SQEA 4NA2A 4IO1A 1CLQA 1A5WA 2JJ4D 3CG7A 4GVBB 5CHIA 3MX5A 3D1OA 4Z4IA 1DLOA 2I9SA 4KT0C 1KDNA 4OZ1A 4IRCA 4I7FB 4HR2A 3O8WA 4A2AA 3CCLN 3CMEN 4DV3J 1Q81O 3KHRA 4JI4F 1C0GA 3MR2A 2KQ2A 3N0VA 3KG1A 2W9AA 4GMKA 1U6FA 2XY5A 1P9QC 1WHXA 3FK4A 2FQQB 2DB1A 3HSZA 2JFKA 3A3OB 1MG7A 3RW6A 2J7UA 5TKYA 5C0YA 3D2EB 3PJXA 4WU2A 4YB7A 4LF8J 1H74A 4WP3A 1J5EJ 1K8KA 2DNLA 2BUNA 4MDBA 4DR3F 3ITHA 4CP5A 3CD5A 5KFEA 4ICLB 3RGIA 1E6VB 2GV1A 4BR4A 3IGNA 1YQHA 4C9DA 4FPRA 4DV3K 4NYFA 2QMWA 5I42A 2QRRA 3GMGA 4PPDA 4ZVTB 3HZGA 5E3RA 3O9QA 4AHRA 3VEZA 3BH7B 5ETKA 2LYVA 4JI0F 4ED5A 5AZIB 3OL6A 5DZ7A 2E1AA 3KLGA 1QUPA 3V9ZA 2Z0GA 1DRZA 1KN6A 4CEBA 3EYZA 1J5EK 1AW0A 2PDAA 3Q0AA 3M6WA 3EZ5A 2VWBA 1BA0A 4LF5K 1F21A 3NF9A 1TL1A 4A5BA 1N36F 4IZ9A 3U27A 1PG5B 3NKYA 2C1EB 4PG7A 5C15A 1FFGB 2AJ1A 1FJCA 2Z4PA 3IXQA 2HOEA 3J7AN 3ASMA 3W1YC 3AA4A 2L9WA 1GXUA 2W7OA 4FJKA 1Q95G 2BJDA 5HRPA 4DHYA 1D9AA 1ITPA 2KHOA 2D3O1 1AA1B 4PABA 2A6MA 1VSFA 1ZM2A 3V9XA 4WQ4A 4QS9A 3I0SB 1SJRA 4KC5A 2FJWA 2O8DB 5A0YA 2P9KA 1FE4A 3CPWR 2DNPA 1KRPA 1DTQB 2H1YA 3CC4S 3NP5A 2DBBA 4OHVA 2YH1A 1UJ4A 4DFJA 2BTFA 3NCQA 2W7AA 3O3GA 1M0SA 3FCVA 4M3UA 4FS1A 5BRDA 3ZSQA 4LF8F 5D78A 3HTVA 3LZJA 1J5EF 4KB0A 2ETJA 3WQUA 2AYBA 1HBUA 2NRHA 2LCWA 2J9DA 5A8RA 3C6UA 2EI5A 1YITS 2MQ8A 1JLBB 2NPFA 4CJRA 4B1VA 3QSYB 2XI2A 3CCES 2IOCA 1P1LA 2FGOA 3HHLD 1X5PA 4GV3A 2HB5A 3L7PA 2PYJA 1GOBA 3R5JB 2DGOA 2ZHAA 1N33J 1HWIA 1ZBFA 4CWBA 2E66A 1FWKA 3ZEUA 2CNNB 5KGWA 4F4WA 3C8YA 2VCPA 2BRLA 2DGTA 2CPHA 4ZPTR 1B3TA 4NLCA 2W8KA 3L0QA 2M7SA 5HQLA 4RO0A 3H40A 3WXKA 1JLEB 3PCOB 3VEOA 4CJWA 1UEVA 2DHHA 2MMYA 1VQNN 1U1MA 5FDLB 3R5GA 3MMVA 1WUAA 1ZH5A 4LSNB 4OHYA 2UVWA 1UFLA 2RQ4A 3PX4A 5LMNJ 3CI5A 2JLGA 4L8RB 3GIKA 1N33K 2ZH8A 3WUHA 4E7KA 3CC2S 4B3SF 4C8NA 1AUDA 4KGZB 2CH5A 1NM1A 4LRDA 2DXFA 4CJSA 1MDUB 3NF7A 2KJWA 4CBXA 2ZH9A 2E2NA 1MWQA 5M1PA 3CCJS 3K8VA 4JK9A 4LY7A 1VQPN 1ZAXA 3AXMA 3L7OA 1W7WA 3J80O 2G8KA 5F8LA 4HCBA 4K4UA 3T6JA 3D7EO 4ELTA 2BJ9A 3MMCA 1WKLA 4CLLA 1RXOB 4MFBA 1E6YB 2MJUA 3CIZA 4CO1A 3GJQB 1JIHA 4DQSA 4EEYA 1NNEA 1FTCA 4DN0A 4DFPA 5K14B 1IKWA 2ZOFA 3J7YI 4K8ZA 1KHWA 5F0UA 3E51A 3QBXA 4A2BA 3SXLA 2IC3A 3VPZA 2YWFA 1DGKN 4ID1A 2ZWHA 1JKHA 4CYUA 3V81B 3HSTB 4A5AA 1N33F 4OHZA 3V9UA 1FKOB 4YQWA 2HBQB 1KLNA 2FLNA 3W9IA 2UVVA 4NX9A 1VSKA 2CYYA 1J2VA 2BJEA 2ZKTA 4LVOP 4PQAA 3M8PB 4CZEA 4ANCA 1OY9A 1KSPA 5HP1B 3QEWA 3IWNC 1U47A 5KFFA 1LNQA 3M2RA 4O3NA 4YDDB 1U1RA 2B9YA 2O5DA 1KC8O 4O3PA 3MMBA 2UXCK 4F36A 3S3NA 3MEEB 3NEKA 2E8AA 3O3HA 3DOLB 1QAIA 1CJVA 5LMNF 1UJ6A 5KFZA 1M5PC 2O8CB 2LQ8A 3VGKA 4WTOB 1F9EB 5DQGA 3Q8PB 4KFBA 1O6XA 4WQ4C 5AQJA 3QDKA 3PVXA 4WBFA 4PKHA 1WELA 2ZVSA 4J2DA 5LSLA 4E1MA 2UVUA 2M3DA 2QLFB 4RBTA 1XR7A 3Q24A 2R8JA 2B3TB 3V9WA 1IBMJ 4Z7CA 1NUEA 1T3OA 2P5GA 1M5SA 2EFNA 3MR3A 1NAQA 4ZVHA 2QL9B 2GHWA 3O6QA 2UXBJ 2BE9B 3MM8B 2QEXS 5SUHA 4ZP8A 4JI2J 3PY8A 5D0GA 3SI8A 3F44A 5GADI 2XLIA 4DTNA 1D4XA 1XR5A 2O8FB 1RT3A 1PIEA 3IWXA 4URSA 2V69A 1G15A 4B1ZA 1S1VB 3ZSWA 2R8KA 5CABA 4M63C 5AZJA 1Q5VA 2O8EB 2AJFE 1W9HA 3IUCA 2FGCA 4YOUA 4QOTA 1RHJB 5HK4A 1M90O 1EQMA 1S1XB 1RWNB 2M2BA 3GPAA 1WSVA 3PIOQ 2KB2A 4ZLPA 4TQRA 4ZTFA 3CETA 3VQSA 2XBPA 3DAWA 4CD3A 4JI2K 2JH3A 3GL1A 4FS2A 5E41A 3GG1A 1T8EA 5KFOA 3AHPA 3FZFA 5IWAK 1S1UB 3WX8A 2CPJA 1TAQA 2IBOA 1WG1A 2NRZA 4NLSA 4F3OA 4BR0A 5DRKA 4AHUA 4EHTA 3HULA 5BREA 4B3MJ 5M2UA 3ENQA 1A0OB 3C95A 2PC6A 2AF6A 3RBZA 2HSEB 5IZHA 1YZ6A 4FP9A 2JEFA 3RB0A 4OJGA 1FJEB 3ATVA 3HKZD 2CIMA 3PFOA 3OHBA 3P5BP 2DR6A 1RTJA 3K5MA 5FD1A 1S79A 4M5HA 2P5VA 4AILC 3W63A 3NWRA 2IA6A 3PIOL 5KFRA 2V5HG 1YJNN 3D6TB 2N3LA 2MSSA 2DIUA 1IBMF 2GMJA 4ECWA 5KG4A 1NPPA 1UWBA 3EXYA 3E9PA 2PI5A 4RL1A 2FBVA 2LU1A 1FO1A 4YORA 4CGHA 4F8RA 1VK3A 3ULDA 2UXBF 3SCJE 3BN4A 5DK5A 2OPRB 2GIFA 3TX0A 3WIVA 5LOQA 2W4PA 1IXKA 1OS5A 1NSAA 5GAHU 3FMWA 3DLEB 2P9UB 3ZX2A 1X4AA 4OZ5A 3H2VE 1Q5YA 2MQMA 3SJHA 3BSOA 4ZKAA 3AY9A 4AH9A 4JI5K 2QLWA 1RT2B 3E1YA 1IKVB 2J6UA 1TK0A 3Q23A 1MMLA 4KI4A 4NLWA 3PZPA 4NZ0A 3KJVB 4J37A 2ZE2A 4JI7K 5J2PB 5D77A 3UB5A 4B9VA 1NGCA 4WYWA 2DPNA 3I31A 2IDEA 4ECYA 4BDYA 2P6TA 2UU9J 2OPPB 3CMAS 3EX7B 3EGVA 3CD0A 2FLLA 3CJ1A 3EVMA 1D1UA 3ENVA 4UOHA 1NDLA 4JKEA 2W2QP 3IM8A 2I5JB 3FJ2A 2G0CA 2E5GA 5ETPA 4CJ4A 2J0WA 2ZHBA 3IS9B 4DR4K 3MUTP 1TU0B 4X4OA 1EETA 3GIRA 4K2XA 5H1SQ 3BF4A 3JQKA 2BR0A 2HNDB 4B3MF 3D66A 3J7ZO 2HHUA 1NK0A 5K20B 2OPSB 3QGGA 3KD1E 1F5BA 3OJSA 4F67A 4G3IA 1WI8A 4DL7A 4QIGA 4CZLA 4IFYA 2FJDB 2UU9K 1LCUA 4RUAA 3VGVA 3W3DA 1PJ7A 3OT9A 2ILYA 1U09A 5D4PA 3DYAB 4C4WA 4RR5A 1SAZA 5L1JA 1V3SA 3OLBA 4F4XA 4PAAA 1JLFA 5E3PA 4JB8B 4NCAA 4GC7A 2HFUA 4H0YB 2DY9A 4W5QA 4ILRA 2E5LJ 4A46A 3Q8UA 3L2UA 3FLCO 2Y8YA 2O01C 4YDUA 3QETA 4X65K 1WD6A 4I9QA 1H7XA 2W25A 4LF6J 3VEVA 1KQFB 1LWFB 1UAXA 2NXJA 3AVKA 1QAXA 4AXIA 2FUG9 2QA4G 2FVRA 3BGRB 2HURA 1MROB 4AHCA 4IH6A 3Q8RB 2RHSB 3QZ8A 5J2NB 3U9ZA 5KFIA 3B6OA 1IJFB 1ROFA 3UCGA 1LK5A 3I56N 2MJNA 3DRSA 2UU9F 4IFVA 1RP5A 2YVSA 4LRBA 2DVIA 4E0DA 4OO1J 5J1EA 4PCQA 3S6EA 2ZGYA 2FZGB 5H9EK 4OMFG 4LF6K 5FROA 1T03B 4DMZA 3R2CJ 3D2FB 2LEAA 2HFNA 3K0SA 2B51A 4CT8A 3THWA 3GONA 3MOZA 3LPTA 3NXZA 4Y2IA 1RT5B 3GE9A 2J4RA 3IRXB 5F8NA 2E2PA 3AD9C 3LGHA 3JAMU 1VK0A 4WKRA 2PGCA 2VPYB 2D41A 3IMQJ 2VQFJ 1ZBUA 3W9JA 1R8AA 2HGNA 3K8WA 4EUVA 5C24B 2A2DA 2KZMA 1D8YA 3Q8QB 4GV6A 5GVQA 5T14A 1F3FA 1LOTB 3WZ0A 2YH0A 5F9LA 1WF2A 3ZX0A 3M6UA 4KHNA 3GFZA 2ZVIA 3CFOA 4WYBA 1R31A 1RILA 1WLJA 2MZ1A 2C28A 2DNHA 4DKWA 1Z1ZA 1NNDA 4DSIA 4QCLA 4OZ2A 2E5LF 3I6PA 2GEMA 2G2ZA 4EP5A 3MPDA 2WC9A 1WEYA 2FPHX 3THXA 3U8XA 4CQ1A 3MM5A 4BWMA 2YI1A 1FRJA 3OTEA 3GJRB 3CQXA 3ZYYX 3EXCX 3K58A 4PWDB 1LEOA 1FFSB 1PC4A 4IQXA 3W2VA 2BKOA 1VGYA 4BC9A 3UPFA 4K50A 3ELHA 2HZVA 2IDOA 5F2RA 1TV6A 2GMLA 4FDFA 2I7PA 2XMKA 2NCKL 1N32J 2IRYA 1U0HA 1HQEB 1VSJA 4FN5A 1DY3A 3C14A 4JI8J 1RBUA 1VOMA 3AO5A 4Y2CA 2W2OP 1RGIA 4ZITA 5KG2A 4J9QA 4FJXA 3LF0A 1WC6A 1RB0A 2AJ4A 5CYMA 1S3XA 2IMWP 1DLOB 1HA1A 4OLAA 3QB0A 4KPCA 5HVFA 2ATQA 3DHWC 8AT1B 3FEYB 4IUFA 2BABA 4OHXA 1YLXA 2VQFF 4DDFA 3TAEA 3QT8A 1QSSA 2KXFA 3LDPA 4C3MA 3BEXA 1SVDA 4FF2A 1N32K 3O1WA 4K25A 4CHYA 2MDAA 5F8HA 2CGKA 2HS3A 1KFDA 2FSJA 3VCDA 1MW7A 1B99A 3EZOA 3SV3A 1VQ8N 4KIAA 2LXUA 2JC1A 4IKFA 1BOTO 1X9JA 1K8KB 2DGWA 4IG0A 2MY8A 5HL7Q 3O3LA 4DV6J 3ITHB 4QWEA 3BPSP 2P51A 3N4WA 2XSJA 2MQPA 3UD3P 3D1HA 4FVMA 3KJFB 3BJYA 2D5RA 3W61A 5I42B 3JB9k 4YDUC 3NNAA 3VVTA 4P2XA 1W2IA 4Z4EA 4GNIA 4I6WA 1H38A 1Z6RA 1VQ6N 2ZF5O 5FLXU 4CJLA 2B0GA 3VGLA 2VICA 3BKUA 4ISEA 2EWHA 2P6SA 1MSWD 3G9CA 3MDFA 3MTKA 4A59A 5J1NA 4DX8H 2P9SA 2VBWA 4DV6K 1TL1B 2HQ3A 3U02A 1QHTA 4ED8A 4DQ8A 2W01A 2QKKA 4PXBA 2CPYA 4JI8F 5HL7L 4C48A 4XPCA 2RE1A 4JRPA 1U1NA 3G2XA 1RSCA 4KHMA 1FA0A 2W9CA 4CGGA 1NZAA 1YVNA 2Y1RI 2FSNA 1VDHA 2PSZA 2KHDA 1OQ3A 3W64A 5A0YB 2P9KB 3QLHA 4FWOA 4NYPA 4FYVB 2VA3A 4L6V3 3EE8A 3R7BB 2KXNB 2V63A 2C2DA 2XMAA 2XLKA 1Q16B 4KBOA 2KG1A 3ZXWA 4OI3A 4U7CA 3KKRA 5KT7A 1OYEA 4CLZA 4DV0J 4Y0WA 2DNMA 2RIJA 3THVA 1NK9A 3HI0A 3QIOA 3ZZUA 4DV6F 1UWAA 1UZDA 2B4VA 1HBUB 1RFQA 4EO8A 1UVLA 3C6UB 4DPTA 1QLNA 2R42A 3VGMA 1UP1A 4A8FA 2GHVC 1SKUB 1B4SA 2D0PA 1GOAA 2ITMA 4IR9A 1FW6A 4P2SA 2OO4A 4KGVB 1HHTP 3EY1A 3V6HA 1MN7A 3ZEUB 4DV0K 3AQPA 1RKJA 1NZ8A 3SMSA 3RWUA 4K4TA 2XULA 4P73A 4G1PA 4BE2A 3ENOA 4H0VB 3TA0A 2QLJB 1WNSA 2YXLA 4DCPB 5LJ3Y 1NGBA 2GC8A 4DR7J 2VA2A 3M8RA 1BC6A 2HHHJ 4GO7X 3SK3A 2DR8A 2GBZA 4P7TA 4OJ1A 2R2UA 4JKFA 1NGDA 5AQTA 5L1LA 2ASMA 1KONA 3WEEA 4JV5J 1VBKA 4QYZK 1TL7A 4LBHA 2HHSA 3JSYA 4ZCKA 2RD5C 2YHBA 1WSFA 4HDHA 1HARA 3D3BJ 2R2TA 1YUWA 5KT5A 2Q79A 5DG9A 4BRGA 2HS4A 3NH0A 4J9MA 3EPGA 3TZZA 1CVJA 2HZCA 4DR7K 4DV1J 2YKNA 5DDRC 4HT7A 1Q1KA 2DHXA 4WCEQ 2H5JB 4OI6A 4DV0F 5IQ6A 3E2EA 2WW8A 2CXEA 2YX1A 3MMCB 3F9KA 3W8PA 3T5LA 4MFBB 1XMOJ 2XGQA 1F6TA 5M2PA 3DLRA 2DNRA 1IKWB 2VG5A 4CO3A 2P5OA 2ZWOA 1L3UA 3PUFA 1YJ9S 1IWAA 4B17A 1KAZA 2IC3B 2B8QA 2MLZA 3A12A 5ETQA 1AZSA 1RT7A 1JKHB 5EX3A 2KT3A 3M9MB 4CYUB 4CDIA 1U45A 2MZTA 4NMXA 2NR0A 5HRNA 4J2BA 1YBTA 1NGJA 3ZT0A 2ZUGA 4DSJA 3CDUA 4K59A 1KP6A 2C3YA 1ZS6A 4W5RA 2V4JA 1UCNA 2DD8S 3BN7A 4ISFA 2A3JA 4WCEL 1CZ9A 2B7BB 2G8UA 5AQFA 3UVJA 4DTSA 3UCUP 3M2RB 2F8TA 2XS2A 4EZ9A 4OZJA 1L3SA 1SC4B 1VQMS 1KVAA 4J9VA 4HVJA 3MMBB 2HHHF 2JLFA 4BRKA 4F2RA 3EKUA 3FMBA 3VMFB 3C6HA 1WSJA 1CJVB 5IT4A 4C8ZA 4PKIA 2WZ1A 4JV5F 3SSSA 1ZZFA 2CZVC 2KH9A 5B0GA 2Q1LA 2V4RA 2V8PA 1XNRJ 3IBWA 4KFBB 3MM6A 4PYDA 3I9ZA 3MCAB 3P5TL 3MFHA 1SZ2A 4K41A 3C19A 4LFCJ 4FPBA 4U7UK 5CYJA 3K5NA 3EE3A 3O4WA 2ZDOA 4DV1F 3AJ1A 2CG8A 2F5GA 3NS5A 1HD1A 2GX8A 3MWBA 4EIAA 3DGPA 1QTNB 2JOQA 4DXLA 4QR1A 5CH7B 3MD3A 4BE0A 3CVKA 5THWA 3UDLA 2VGMA 3U9DA 5BPNA 2R2RA 1WF0A 1XMOF 1Q18A 1RDAA 2DNQA 4DHVA 5AQPA 2NNWA 4PEOA 5RUBA 5KFBA 3AVLA 1RT3B 5EWFA 2GAHC 3C3LA 1S49A 3NOCA 3G6EN 2Q6BA 4CNYA 4FF4A 2CKWA 4LFCK 1HIYA 2VHGA 3OVSA 3KWGA 4EBCA 3I8BA 4FYXB 2YKAA 3TOQA 1GTHA 2CNKB 3NMUA 2VU5A 1HW8A 3ZSYA 5B0AA 2HNZA 1U49A 3U1NA 3VQAA 5KFSA 3NMRA 5JUMA 4NXMJ 5AE2A 4ECUA 2P9NA 1ZZNA 2BUPA 1RBAA 3HFZB 3KTQA 5LJWA 4KAZA 2Z1GA 2PN6A 2FHJD 2QSFA 1R7IA 3OYAA 3ALYA 2IJFA 5SZTA 2M4MA 3LP2A 1JLAA 2H5EA 4DSEA 5U47A 1K6YA 4JEPA 3W5ZA 2IA0A 5BJRA 5A2QU 4JI3K 2B8PA 3MAHA 3LZIA 5B08A 3EGZA 4XIUA 2GFFA 2KVQE 3BGOP 1F1BB 2I1RA 2L9NA 1JJ4A 1XNRF 4F4KA 4B3RK 5CZVA 1G6BA 2M70A 3M8QA 1ZTTA 3SBTA 1U1KA 4MLHA 1CJKA 2RU9A 2ZC3A 3D67A 1VQON 3UFCX 2JZ5A 3TZWA 3H5YA 2O1PA 1T3VA 1LV5A 3VAIA 1S6OA 1SKWA 4EP4A 4UY85 3TR8A 5C12A 3SIPB 1UWBB 1I5OB 2B43A 4OYOA 3KZBA 2W42A 1H2VZ 3EZUA 2AKWB 4ENOA 4CFAA 3FRYA 3N28A 4BG9A 3G4SN 5EGYA 3OS2A 3EJMA 4N56A 3KK2A 5DJBA 1PAUB 3AA2A 2ASJA 4L74A 3PYFA 4KE5A 2HK3A 2RU3A 3GIIA 2XY8A 4FWQA 2GQQA 3U6FA 3CIMA 1FNXH 4IOBA 1XBWA 1UW4A 3W9HA 4AL5A 2ZE2B 1Y3JA 1HYSA 4ELUA 2ASDA 1URNA 5HLFA 1X5OA 2DRDA 2QG9B 4NXMF 4ETZA 3MXHP 1F2HA 1ICEB 4OPHA 3EVOA 2QL7B 2YHYA 4DSLA 4LBPA 4YOTA 2MKYA 1VQLS 1HW9A 4JAXA 3WNHA 2DTUA 2OAUA 4GKJJ 1EETB 3SQGA 5A6WA 5HBMA 3FZHA 2D0OA 2JVOA 2CVEA 3R9LA 3W5XA 2RNEA 2DNOA 4W92B 4KTZA 5GINA 2ADBA 3N6LA 2B6AA 4DUZK 4IFYB 2OCEA 3V9SA 3LWLA 3SBMA 3GILA 2GJIA 2OEKA 3A13A 3DXMA 4NLUA 1C1BA 5IFMA 3FSYA 4B9UA 2DEIA 1C1CA 3EEQA 4UOFA 4EAHD 3ATUA 5MLCQ 2HLUA 1YIJS 1JLFB 2NZCA 4FO0A 4RG8A 4E7IA 4U67Q 2W9BB 3A3PB 4Y1DA 1WJ9A 3F56A 2KRRA 2MKIA 2HRTA 4OKEA 4RLEA 2RUGA 3KD5E 2FJVA 4CW7B 3BDPA 3GIJA 4BG8A 2A41A 4ED2A 1K73O 1R8PA 4CZGA 4F4ZA 2YNIA 3IAM9 4BRLA 4AHVA 3FFIA 2Y3YA 5D4LA 2COLA 1BQNA 1Q8KA 4DOZA 4MKBA 2JL9A 3GIMA 1Q8IA 3IAS9 3VEXA 3TSQA 1J6ZA 2D3UA 3JSMA 2MXYA 2NUUG 4RNFA 2EK6A 2YWGA 1IBKJ 2ASPA 2ZZNA 2HQCA 3M8YA 1IVZA 1XEZA 3D6MB 1FRLA 3TAQA 3G25A 3T1YJ 3P6YC 1W0HA 1WSEA 2QWPA 3DRSB 1WOOA 2X74A 5EX5A 4IFVB 3TVZA 2ZH6A 3PRVA 4K4YA 4DTMA 4I69A 5J1EB 4EBDA 1OH8A 1HRHA 2Q36A 3FVYA 4UOCA 3OYMA 4DTRA 4U67L 1NSPA 1QQNA 1YHQN 1TK5A 4KH1B 3THWB 1RWVB 4F3QA 4B3OB 4GKJF 2WVDA 1BE4A 2A0FB 4XDCA 2BKPA 3NGIA 2K3IA 4P74A 3H20A 2DGXA 2MEWA 3M1VA 1NK4A 3OYIA 4DSKA 1IBKK 1LFPA 2IJRA 5C10A 4FPIA 2YNFA 3CM5A 1CZAN 2EFOA 4OYZA 4J9SA 3IC1A 4L72B 4A8SA 1B0PA 3SJJA 4X4NA 4B1YB 1T44A 3RBXA 9ATCB 4KBIA 2ABYA 4IKAA 3M2VA 2E2OA 3EPIA 3O6WA 1T7PA 4KV8B 5L38A 2F63A 4NLXA 3SQ2A 4Q0BA 1AXQA 3C6AA 3A8KA 3MN9A 1IJEB 1SJ3P 1GOCA 4OYWA 3CCVS 3HHEA 1FXDA 2RRAA 3A8IA 1K0VA 2HAIA 4HI1A 3AVAA 3HSDA 3THXB 3AA9A 1TL5A 2EWSA 4C3LA 4DL5A 3M2UB 4PRFA 2JX2A 4FWPA 3FGVA 3DLBA 1Z2ZA 1IH7A 1T6CA 2ZQBA 1LWCA 3RAMA 1RNHA 5I9EB 4JHDA 2BZ2A 5KT2A 4ZPVR 4OYMA 1IR0A 1FKPA 1IQTA 2F8HA 1IBKF 3W2VB 4CF8A 3JSBA 3T1YF 3V5RA 4M3ZA 5D15A 1SUQB 1TV6B 3ISND 1F3VA 4JNEA 4YY3J 4RBUA 5CYQB 2ZOMA 4M3YA 3VOVA 3NGSA 3OTCA 4QPXA 2OHDA 1N54B 3T5KA 1U0HB 3IGVA 2J0SD 3CM6A 1OQ6A 3C14B 3CFPA 1ZM9A 1T94A 2HBLA 3OW2M 3W5YA 4MKYA 4CJFA 5E26A 3A2FA 2YPYA 4X62F 1YJWN 3RZAA 2BOAA 5CYMB 4KHWA 5CE3A 4RW9A 2NXEA 5DMRA 2LECA 2ALYB 5ETMA 4YDXA 1XK8A 2F4VK 4MJKA 1KTQA 5IC4B 4FK4A 2KJVA 1WKKA 5EDWA 3LOUA 2GGPA 4YY3K 1WTBA 4EWTA 2BBEA 3MCSA 4NEZA 2MQNA 1NKBA 2A1SA 4O5BA 1RTIA 2RPIA 2JLEA 3P4IA 2H9ZA 1SIWB 5HROB 1F0XA 1U25A 3CEDA 2ZJPQ 1REGX 3ETMA 1WOQA 4HHHA 3HVRA 1RDBA 1HWLA 3WC0A 4CLYA 2QGFB 4IG0B 1T9VA 3CW2C 1NHUA 4CEEA 2GW8A 4QU7A 2XSJB 4F0MA 2Q97A 1NOYA 2CG4A 4H0XB 2H3EB 2ZDPA 4FBUA 3GLJA 3EVWA 4BC5A 1OPZA 4IQMA 5KT6A 2DGSA 1ZBLA 1NEEA 4NLQA 1JCGA 4YOYA 3DGVA 1H2TZ 4B8AB 3DRRA 3GQCA 3WX4A 1A6LA 3UI3A 4ES2A 3CD6S 1VSEA 4Y2AA 4LH5A 4ANEA 1EQ0A 3H4BA 4FJLA 2RT3A 5EWEA 5FPDA 2P9SB 3D68A 4OFZA 3EE9A 2RUSA 4DL0C 5DM7Q 2KTQA 4O4GA 4O3OA 4YY3F 4ED3A 2ZJPL 1UFWA 1GLBG 2FB0A 4LF1A 3K9JA 5KPRA 1RBLA 1XNQF 4K4XA 4LF9K 1SJ1A 2W9CB 1E6VA 2BQRA 1M1KO 3BR8A 2H4WB 2MSTA 1J27A 1S4EA 4HHJA 4DS4A 1NB2A 3CD7A 3QLHB 1XIQA 4QAGA 4ZPWR 4I56A 3ILIA 5IT9Y 2F9WA 3T5JA 3KJQB 1ZTWA 5EUHA 1U48A 3KWMA 3TO8A 1O8BA 4N7TA 3OHRA 1N88A 1TMMA 5GAHI 2IPOB 3I5CA 4E8UA 2Q31A 1P8ZA 2NZTA 2J8SA 1RAFB 5DM7L 2FF3B 4A8MP 1M90T 3N5FA 4UUXA 3ZC4A 2DY1A 3CCEN 2CJBA 2ROEA 4H4KA 3P96A 3N4PA 3R9PA 2F8EX 3T7ZA 2A1BA 3LPEA 3K57A 5C42A 2MZQA 3AVMA 1FT8A 1XHXA 4TY9A 4F25A 3CJ9A 2FZCB 3H5XA 1RYSA 1T3NA 3KLEA 4HKQA 1VQ9N 2CA9A 4C8MA 3SQ4A 4M1KA 2V68A 1UJ5A 3E8OA 4EHUA 2E5HA 2XCPA 3MMJA 3ID8A 2RRBA 2IAJB 2MHEA 4YUDA 2VWJA 4W90B 1FTRA 2YNGA 4QPTA 3CJ5A 1NH7A 1HBOA 4N8OA 2P9GA 5CCMA 3LWMA 2YKPA 3LALA 4WQ5A 4CJ5A 4P6QA 1XUPO 5KQ8A 3RB4A 3HI9A 3PYDA 6FDRA 4IBNA 1NKEA 3TTFA 3VESA 4LRCA 1SIZA 3P5JA 3DFEA 4JK7A 2YV0X 3M32A 1B7YB 4ZP7A 5L1KA 2KL8A 1V3ZA 5HMWA 2DKOB 3OTOK 3WEEB 3KUEA 4U8YA 3UE5A 1BIZA 1WBDA 3PEJA 3OS0A 4ED6A 4GRSA 1ITGA 2E20A 1TL7B 4MK7A 3HX9A 1YX2A 4JYAJ 4XK8C 3GSDA 2PIIA 1U24A 3OYKA 5EX0A 3G87A 3KK7A 4CZMA 1B0VA 4ZP6A 4PY5A 1V9OA 3A3NB 2EK1A 2GS8A 1HR0K 2YKNB 1RJJA 3MR5A 3LTOA 5MLCV 5K9FA 3DJCA 3MR6A 2D9PA 3H45C 2JRSA 4F3TA 2DNNA 5ETLA 2E1ZA 4LC9B 1Y3KA 1LK7A 3DLLQ 2HHWA 2OANA 1S77D 1XQSC 3GZ7A 4BC4A 4H4OA 1FNOA 1DKGD 2ZKUA 3LL3A 2CJQA 4NA1A 2M0GB 4S0MA 2VG5B 2WFBA 1JL1A 2ZNYA 2YJFA 3G8SA 4UTGA 4X4QA 3BQ2A 1AZSB 1RT7B 1KTVA 2AQ4A 3IKMA 4MMOA 4K2JA 4LQ3A 4ZCLA 2FF6A 4QW8A 3KKFA 2VBXA 3LUYA 1EKSA 2V4JB 3ZTPA 4X4RA 3KMQA 3BZCA 2OMLA 4EI2A 3MAQA 3UVJB 4RJVA 2B5JA 4JI1J 3HT3A 2QL5B 3DLLL 3A5NC 3QATA 2E4LA 1N5VA 3BBCA 3VEYA 2R2SA 5AQXA 5F1XA 2QFJA 3MR7A 4Y0FA 2V67A 4J90A 5CD4H 3T3FA 2R4FA 4EU0A 3O1LA 3PACA 3L2WA 3PJWA 1WORA 1Y97A 4USWA 4PXCA 3DOKB 5AQMA 1EKEA 4U6PA 1S48A 3TUPA 4QZVB 2WVFA 1CJTB 2PMWA 1NPKA 4JYAF 1R8BA 3MM6B 1KD1O 1RA6A 4BRHA 4QIVA 2G1HA 4WK3A 4YHHJ 3UQSA 4RNHA 1VIXA 1JNZB 3ZSVA 4H5WA 2N3OA 3FSXA 4ZPBA 3TR5A 1VCTA 1PSDA 1X3MA 3MPWA 3D28A 3DGPB 5CCLA 5HP1A 1IO2A 2ZOGA 4RPFA 5HRRA 1HMVA 1FD2A 4H4KC 3UN3A 4NYOA 1EIYB 1Q78A 4OZ0A 3ET6A 4TQSA 5ETNA 2K06A 4DPYA 3ZETA 1F5AA 3EKSA 1DEJA 1PJ5A 5CD4A 4YHHK 4ZLJA 3SUOA 3R5DA 2MQQA 4DQPA 3IM9A 4E1NA 3MPUB 1XERA 2EW9A 1UVMA 1ATNA 2V8VA 1X4GA 3OBYA 2XG8A 3F5TA 2HF4A 2HNZB 2J7WA 1IG8A 2KI2A 1T6DA 4MLEA 5HRSA 2P9NB 3V6JA 2G2OA 4WQ5C 3Q22A 3C0BA 4JI1F 3BGLA 2Z2YB 4C6AA 3PDNA 1BCMA 3FQLA 5HMZA 1NMDA 2CGLA 3LP2B 1JLAB 1X7VA 3KMSA 2C2OB 1KVKA 4PG4A 5HO4A 2RVJA 1HKBA 2DPIA 4X64F 4OZLA 4DR2J 3WXMB 1S4FA 4PWWA 2AEJA 5AXNA 4C1NK 4K5RA 3OV7A 3UDCA 2OYQA 2DCUB 2LLZA 4FLTA 2BJ7A 1LFWA 2RE2A 2AYMA 2HIYA 4WP9A 4HDGA 3CJQA 1XQIA 1VQNS 3NBPA 4UZCA 4RWTA 3GOIA 3M8QB 2EKNA 2C42A 1BUPA 1S9EA 3CNQP 1CJKB 2XRIA 1S5ZA 2CQHA 5KFLA 2DO4A 3AY0A 1U04A 1OYDA 2EPIA 5IT0A 3J7Z5 3S9HA 4YOXA 5KG3A 4QU6A 2RH3A 5KFUA 3RMDA 4DUYK 3CO9A 2G8FA 4DPOA 2XNRA 3KK2B 3NCRA 5AE3A 4DV5J 4DTXA 2H54B 1VQPS 3UNYA 5F0WA 2FC8A 4JUZA 3I32A 3PW4A 3QRQA 1T9XA 1KFSA 2KVIA 3GCWP 1RLCL 2XMMA 5LJ5Y 3IR5B 3QT5A 2ASYA 4AYBD 2HMIB 3G8QA 4CO4A 4KHPJ 2BQ3A 4NI2A 3CJ0A 3E66A 1X8DA 1P27B 3OVBA 5HLFB 4CLUA 3IBCB 1BLUA 3QEVA 2DHGA 5CQGA 4HT5A 4O44A 4PG6A 1SQGA 4ETXA 3ZT1A 5ETVA 3CQYA 1WI6A 3OSNA 1WG4A 3JS9A 2AYEA 3D6HB 4NPOA 1S59A 3SQGB 2ERRA 3TSPA 2GELA 5HBMB 5AQUA 5FPNA 4OZNA 4DR2F 3OFFA 2XMWA 3ZT4A 4KHPK 3P3DA 1HHSA 3KHYA 4BC2A 3NH2A 1RWKB 3ZZPA 4DR1J 5B0EA 4BWJA 3CDEA 3RBDA 2O3DA 4OQJA 5BPMA 2B6AB 1VIOA 5GAEU 3C7NA 3T6BA 3HM9A 4ED7A 4CF0A 1VQ7N 5BR8J 2XTJP 2I6WA 1Z25A 2FY1A 3DXMB 1C1BB 3VAFA 1C1CB 2XO7A 1JCEA 4URQU 2VF3A 5D0EA 3WT0A 4L75A 1TKTA 3VR1A 2GMHA 5JVHQ 1EARA 4DR1K 3CE8A 2BW7A 4DN9A 3LP1B 3LAMA 2R7XA 2XZDB 4USMA 4DV5F 1GMVA 4ZVOB 2MQLA 4UY8O 2JNJA 2H5IB 3MFIA 1ESVA 1X9MA 4ZVQB 4RUBA 4CZKA 3PX6A 1LQ9A 3AOAA 2YNIB 3HZEA 1WTFA 1BQNB 3VQ7A 3WIUA 4JN4A 1CPZA 4RWWA 1TELA 4DV4J 4KHPF 1FCAA 3JSMB 1Q9YA 1RT1A 3MWPA 2DITA 4Q8FA 4TN2A 1QQOA 3MM9B 3NE6A 3V4MA 3SPZA 3MM7B 3SCKE 3AVCA 2UUTA 5KFMA 3IP0A 1IKYA 1UPPA 1Z05A 3RJMB 5BR9A 3HOSA 1HQUB 4ILGB 2Q0UA 2XB2D 4O55A 1N5TA 4UUWA 2GA7A 3KLFB 4IOCQ 3NDKA 5JVHL 1NO8A 5EU7A 3LA0A 2RDJA 4WTYA 4HHTA 1TFYA 2BJ1A 1VBZA 3GDQA 2ZITA 2CQ4A 1YBAA 5AQYA 4DV4K 3PSFA 3CC7N 4JD2B 1AB8A 3NF6A 2XYHB 3AO2A 3M1VB 5JLFA 4DR1F 2CQPA 1WG5A 4F9OA 2WB1D 3T9NA 2GV9A 2IHR1 1RDDA 2YNFB 1M5KC 4KRWA 3HHDA 5KPTA 3NG8A 1S6QA 2OPQA 5BR8F 2W4DA 3L6QA 3AFGA 5HVHA 2I2YA 5A8WA 1HI8A 5M1OA 2D9OA 2JVRA 3PYGA 1GXLA 1IBCB 3M2VB 1S6UA 4B3TF 2P9PA 4DV2J 4Q0BB 5KFXA 4IOCL 4MIWA 2MPUA 4JS5A 1H72C 3I9V9 3NGTA 3ZZYA 2EC2A 2X1AA 3D2FA 5IT9U 1YJNS 3IR6B 4P72A 3BO3A 4CJTA 1C0FA 1GX6A 1RBRA 4BR2A 4K4SA 2O8BA 4UW2A 1UVIA 3MCMA 4EO6A 3NWGA 1HPZA 1IR1A 4DX6A 4GKKJ 2YBVA 1LWCB 2CRLA 3MMAB 4JHDB 4BGBA 3ZTRA 2BEFA 3AARA 1FKPB 4ZPCA 4K4WA 4DV2K 4K0KJ 2MTLA 3QGIA 4UZBA 2C2KB 2HHTA 1CZBA 4CK1A 5GAHP 4NMLA 5HSPA 4BRAA 4IOAQ 1OJ4A 2DFHA 3MOJB 5HANA 3CHWA 3FE1A 2QJ3A 3TZXA 3Q2SC 1JMTA 2FVSA 4FXWA 2O4IA 3H5SA 2IJNA 2QI2A 3SUNA 1QDUB 3T1HJ 3G10A 4L3NA 4DFMA 3QT6A 4DQIA 2R8IA 1C4CA 4RW9B 3RR7A 4JI4K 4LD0A 1EQYA 2KN4A 1XMBA 1VQKS 4CIFA 4Z4GA 1OPIA 1F5CA 4G65A 5FPEA 1EJ7L 4JV1A 5J2QA 3BZKA 5KTQA 4JI0J 1VC0A 3C16A 2GGPB 2RQMA 2HBYB 5LMUJ 1RTIB 1HWKA 4WFBQ 4CI0B 3W65A 4HTLA 4MTPA 4DR3K 3AOCA 2IVOA 2PBDA 2F8SA 3ZFVA 3IBFB 4FLZA 4RU2A 2PMZD 4C2MA 1K1SA 1F9FA 2XC9A 2K3KA 3I55N 5I4MA 4DLEA 1TAUA 2BANA 2RKIB 4JI0K 2DNGA 1S9FA 2BH1A 4GKKF 4H54A 3DRRB 3TVYA 3I87A 4QWAA 2XEXA 2KLAA 3KHGA 3E9LA 4H5NA 5D0RA 3MUMP 3H90A 4CRJA 4F0KA 3CJAA 3H6EA 1TR0A 3JSRA 4GVMA 3J7YU 1N36K 2OGUA 4K0KF 4BY9C 2ZBQA 3F73A 2BJ8A 1C0TA 3PFEA 3S3OA 2JWLA 4MKAA 3RBEA 1RU1A 3PW7A 1H98A 2BE7D 4O4GB 5KG6A 3OTDA 3B82A 1SB6A 1UVKA 2BVZA 1ZM4A 1IWGA 4B8CA 5E0OA 3H08A 3KLVA 4UQTA 1RDWX 1TUYA 5CA5A 3QRRA 3M6XA 3SV4A 5IV3A 2Z8QA 3UCZP 2AGPA 4Q44A 4WPAA 4XO0A 1HNXF 4BRPA 1HNZF 3T1HF 2HG4A 5DG7A 3I56S 2IFXA 1PCAA 3VEWA 3DU6A 2C3PA 3A5LC 1RHMB 2OIHA 2JDJA 3LANA 1BGXT 1Y4ZB 4O0IA 1WC4A 3QAUA 4M3XA 4WZQA 3Q7BA 1NM2A 3V1RA 2E88A 2HIQA 2W6KA 1NGIA 4Q45A 5LMUF 2NS1B 4AXJA 1MU2A 4A8WA 1QE1A 4LF8K 3ZZOA 1VSIA 2D69A 3CJSA 3JAMY 3CJ7A 5L39A 1YKWA 1F9HA 2I38A 1WB9A 3L3VA 3D45A 5C42B 4R5PA 4BC3A 1RA7A 4FJIA 2XMUA 5K8OA 3IWLA 2CQ2A 4CF9A 3KLEB 5I3PA 4KI6A 4HCCA 3HPHA 1YSJA 2L08A 3GYGA 3JTPA 4FLYA 4CJKA 4B3SJ 2E29A 4WFNQ 3UKUA 5GADU 1U6BA 1OH7A 2YNGB 1XWLA 2C2NA 2CPZA 1HBOB 2XZTB 4CH7A 1WSIA 5AQSA 2WW4A 2FHKA 1Q8LA 1YK9A 3DRXA 3TAFA 4FNIA 3VAMA 4TU9A 3QMQA 4ES1A 3HVTA 1CULA 4CFBA 5F8IA 3ULHA 2X3GA 1RBOB 5KFVA 2X51A 4PG8A 1R0CB 4OGCA 1JWWA 3M32B 4ED4A 4B3SK 3JQMA 2RF2A 3VF0B 5DM6Q 4YB1P 1WNEA 4FYWB 1QSYA 3S01A 3LDQA 4O23A 2NZ4A 5HN0A 1FWLA 3QJPA 2FVQA 4BRIA 4K8RA 2P1JA 4AM6A 3EDRB 4WFNL 2BRKA 3AODA 1RT6A 2NQPA 3MURP 1RHQB 3JYTA 3WQPA 4XEIA 4PG5A 5KQDA 1P90A 1B92A 3JTNA 4C11A 1ZA1B 1K8AO 4CIEA 2V9WA 3OXGA 1X9SA 4KHSA 3O8MA 1YJ9N 4KKOA 3D6FB 3A8JA 2XY6A 3WC2A 1FERA 4C7QA 4LVNP 4IO8A 3NAEA 4H4OB 1VBYA 1RBVA 3TAPA 4O3QA 1XHZA</