2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
molecule keywords COBE
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
2W6KA 3EEQA 2W6LA 3BY5A
chains in the Genus database with same CATH superfamily
5FPEA 4BREA 4LFAK 1BDGA 5CZ1A 4CHPA 1CXUA 5AQSA 3J80O 1BISA 5AQMA 3V1RA 4KB0A 3LP1A 1BL3A 3OYIA 4K0KK 5CE3A 3FZMA 1CZ9A 3NVKA 3MMVA 4OPKA 4IEIA 4RW9A 4CEZA 3KK7A 2GV9A 1RT2A 5BPNA 4BC3A 1HKCA 4DUYK 1C0GA 1L5UA 5FRNA 2WC9A 1OVQA 2UUCK 4CJ5A 5LY3A 4CEDA 2G8FA 3LZJA 2RPIA 4FZZA 1NWKA 1YJWN 4WCEL 3IRXA 4E7LA 4KHNA 1J54A 5LL6Z 4KHQA 5F0XA 4GKJK 1JXBA 3O9SA 2D1KA 3ZLJA 4H0VB 2HBKA 3T19A 3ZETA 2D0AA 1JCGA 3HP6A 2DTUA 3BZKA 1NJXA 1E4FT 4DSJA 3VQ8A 4XH5A 3K59A 3CMAN 3CPWM 4DR1K 3HYFA 2KTQA 3AVHA 3ISNC 4DWIA 1XNQK 2QXFA 1U2VB 4NYNA 1SAZA 1HNZK 3PSFA 5D3GA 4H0PA 3QEPA 4FK0A 4CEAA 3VQ7A 5AZJB 4QCLA 1TUUA 1FJGK 1K8AO 3NHGA 2YHXA 5DM6L 1QE1A 2QWPA 4FPBA 1TKTA 4Q5VA 4B1XB 5KPZA 1VRTA 3WT0A 4BRMA 1NJIO 2Q0UA 1T6CA 3O3HA 4E1NA 3WNGA 3LP0A 4M45A 4DQQA 3SQ0A 2AA4A 2BE2A 1ZBHA 2HNZA 1YHQN 3BUZB 1X9WA 2F7TA 3QDKA 4GY2B 1QTMA 5C0YA 1X9SA 2HMPA 4IXCA 1TV6A 2G8VA 1S1XA 4BG8A 2BUPA 5I9EB 3K5OA 3EN9A 3L8BA 4IO8A 4A61A 3EKUA 1SL1A 2HHXA 5HLFA 3IG1A 3SPZA 1XC9A 2YNFA 4CZHA 4Z4CA 4W5NA 4KH4A 2W6KA 2PY5A 2GUIA 5I3UA 3LWLA 4DV2K 1JCFA 1K6YA 4DMNA 3V9XA 3CJ1A 3ZSQA 4KH5A 3EZ5A 3FFIA 3CCMN 1RBRA 4X64K 1VQ6N 1QQOA 2Q1NA 3ENHA 4Y1DA 5IT9O 4BR5A 4F3TA 4FZXC 2NZTA 3AY9A 4M42A 2WUSA 3JXUA 2QWLA 3DWLA 4O5FA 2I7PA 2YKMA 5AQOA 2UXBK 3THXB 2G8HA 5LMNK 3DM2A 2QWOA 2V7YA 3S3NA 4CZGA 2HHVA 1U6ZA 2DPNA 4FJ7A 4OLBA 4E7JA 3NGIA 2HHQA 1BG3A 3AA3A 4F9OA 4NB4A 5JVGL 1SS6A 2E6MA 5HRSA 3R1XA 4OPAA 4RWTA 1RDUA 3G0ZA 1T8EA 4CGDA 3TAMA 4JI2K 1RT4A 1ZC6A 3L2VA 5AQHA 1P8ZA 3TI0A 3R9PA 4BDYA 2P9UB 4I6MB 4MQ3A 5ELZA 2IVPA 4CIFA 2P9SB 4ICLA 4BRGA 4O5BA 1T3VA 5AQXA 3LZIA 3UB5A 4BVOA 4DU1A 4BE2A 5H1SQ 4KAZA 1C0UA 1NGJA 1OH5A 1YJNN 3AVBA 1QSYA 2ASPA 4CI6A 1VRUA 3SUPA 4G1QA 4K43A 1I39A 2DFEA 3ITHA 4CF9A 3B8AX 3SJHA 3TWHA 3LDLA 4RG8A 1A5VA 1VSMA 4XH1A 1FXXA 2CGKA 1BQMA 4IG3A 4QS8A 3H3NO 2P9NA 2QWQA 5GAEP 5KPRA 3O4QA 3TR8A 1JLCA 3ID6A 2ZF5O 3MXMA 1NOZA 2FBTA 3MN7A 5AQUA 4DFMA 4BE1A 3KK3A 1Q9XA 3O4WA 4CJVA 3OYNA 3WQTA 4KHUA 4FJGA 4CGFA 4DTJA 2ZE2A 4EHUA 4KTQA 3D6RA 2E88A 5KI6A 4R5PA 4A5AA 2O8DB 4CHZA 2F96A 3O9QA 1RT7A 4HTUA 4BRAA 3KTQA 2HNYA 4Z4FA 2A5XA 1KQSM 3O9RA 5FLXO 2GWJA 3SV3A 3T69A 3CM6A 1JLBA 1UWBA 3RMAA 2IOCA 3P4IA 2D0OA 3V9UA 4FLVA 1S22A 4OKJA 2P9PA 5AQNA 3VQEA 4KKOA 4RW7A 3FLCO 4G9ZA 1S6QA 2OANA 5AQGA 4JKAA 1QQCA 3ZSVA 3A5LC 3VF2A 4JI4K 5KGWA 3QO9A 2HMIA 3F73A 3U9ZA 1FKOA 2O8BB 1ILYA 5C2DA 3QB0A 4LF7K 3RMDA 3HOTA 4OKEA 2Q36A 3OYBA 3I8DA 1ATNA 4LFCK 3D0PA 4JI5K 2O8CA 4JI7K 4IEEA 5T7BA 3HSTB 1R0AA 2BH1A 3HPGA 2HHHK 4B9SA 4NLBA 1QSLA 3OJUA 5M1PA 1JXEA 4NCAA 1Y64A 4B3TK 4JKCA 4O0JA 1IBMK 3P5JA 3UIQA 3PV8A 1YXQA 1T44A 3O3FA 4FWQA 2VQEK 2KZZA 5C2FA 3LP2A 4FLWA 3NAEA 3MEDA 4BG9A 5SZTA 3OYCA 3R3LA 4FJHA 3M6GA 1KC8O 3FZHA 3AO4A 1HLUA 2AP1A 2P9UA 4I6MA 2Q97A 2PYJA 5GAGP 1TYQA 5AQQA 5BRHA 4CCHA 4JKBA 1LW2A 2ZWHA 3LP3A 3O6WA 2OCEA 4LSNA 1BCOA 3JSMA 2OZSA 1LWCA 3OA9A 3MK6A 3ZSOA 5FROA 4OO1J 1REVA 4CHYA 3MCAB 1RDDA 1NK7A 1BA1A 1NMDA 4FWMA 3L3UA 2QXLA 2E1ZA 1SV5A 3OYGA 2OA8A 1W97L 2KFZA 4H0YB 5J1EA 2OPQA 4B3SK 3ZSZA 3SMPA 1RDWX 5DK5A 1VQMN 1A5WA 4CZKA 5C25A 1KVAA 3E01A 5CR4A 2YHBA 2Q2RA 3KLFA 2HF4A 4PL7A 4EHTA 1N36K 4DSKA 2ZJPL 2G8KA 2YJEA 5EVZA 3WEEA 4K8XA 4CJLA 4CEBA 2O8FA 2KFNA 4CJEA 4H5RA 3EYZA 2B4JA 2W42A 3AO3A 4CJ4A 3ID8A 3EL2A 2KZMA 1HRHA 3ENBA 1QZ5A 1YIJN 3THWB 3QINA 2GWKA 4CIGA 3OYJA 2GTDA 1K8KB 3FR0A 1VSHA 3A8YA 1IH7A 1KXPA 1MWMA 2A6AA 2IGIA 4X66K 3OYMA 2PYLA 1BGXT 1B92A 5AQPA 4HHTA 2JWLA 3ATUA 2I5JA 3MWPA 2QKBA 4E1JA 5EX5A 2FBVA 3C7NB 3IFRA 3ZX0A 3ZSWA 4YFUA 1CLQA 1TK0A 2H3GX 1BI4B 4B9QA 1Z25A 4CEEA 1NK6A 1BQNA 4B9MA 1D9DA 2IDOA 4LSLA 3L2UA 4BR2A 4GNIA 4JK8A 3AVFA 3DMJA 3VEWA 3V1QA 3WXJA 3I56N 1UA0A 1WBDA 2FSJA 4FWKA 4NO7A 4W5TA 2E6LA 3P1GA 3RR7A 3HSCA 1GLLO 4WFAL 2IVNA 4F3OA 3VEYA 4PHTX 4FM2A 3LAMA 3VQ6A 1Q82O 1NGGA 2P9LA 3J81O 4FK2A 3L2QA 4CIEA 3OVNA 4FPAA 3AARA 4I7FA 2IC3A 1HPZA 2QK9A 3MN5A 4FWRA 1TK5A 1KFDA 2FXUA 3H08A 4FSVA 5CHIA 2X6SA 2E8AA 4CEOA 2HSTA 3WXLA 3MECA 1C0MA 4CEQA 1C1CA 1C0FA 4GMJB 5AZIB 1WAFA 1U47A 1EX4A 3BP8A 2A1SA 1BA0A 5BRFA 4NXNK 4JKGA 3TAPA 1U49A 1QQNA 2D0PA 4BR7A 3OS2A 1RT3A 3VEOA 5BR9A 3MX5A 4JKHA 3FZFA 3DJCA 4YOXA 1IBKK 3VF4A 4FO0A 3PSIA 4JKEA 4B1WB 3FZKA 1V4SA 5E84A 3IMXA 3O80A 3PO4A 4O55A 5ADXH 4Z4GA 3NH0A 3AO2A 4A2BA 4C23A 3MXIA 4CBUA 2F9TA 3K2PA 4A2AA 2J4RA 4W5OA 4KV8A 3GDQA 3SLCA 4DFJA 3LWMA 1G15A 1NK0A 3G25A 4IZ9A 3QESA 1C1BA 3AAPA 3DLBA 1WSJA 2Q0RA 5J2NA 1DLOA 1VSDA 1KD1O 4OX9K 3AA2A 3JAMO 4ELUA 3VQAA 1VSLA 2QA4N 1VQNN 3NCIA 4J8FA 3IUCA 4B9TA 4DCHA 4C8OA 2XY5A 2O8BA 1LV5A 5KRSA 3M1FA 2FBYA 3AO1A 1D4XA 4JD2A 3VA3A 2B5JA 3L2WA 4IFEA 3ZSXA 1FKPA 4DG1A 1HUXA 1U48A 4CJPA 1GLJO 4JHDB 1HNVA 4JK7A 4MFBA 5CYMA 3A5MC 4DSLA 3KD1E 3ALYA 1YUWA 1J6ZA 4HUGA 4CF0A 1C0TA 3L3VA 1O1WA 3DLKA 2NNWA 4FLUA 3THYB 4KI6A 1J53A 1GLCG 3ZT2A 3TARA 1HNIA 2UUAK 5DM7L 4QS9A 2YNHA 4JS4A 1KTQA 3VGKA 2EWSA 3AO5A 4ZTJA 4DTXA 3SQ4A 4H0OA 4IG0A 1S9GA 3LAKA 1N8RO 1OH7A 4DV6K 3QBWA 4BR9A 1XC3A 3AVLA 4YORA 3RRGA 3DXMB 1S1WA 2ZQBA 2HNDA 3D2FA 1DKGD 2WONA 5C12A 1MWKA 4I2PA 3CQ8A 3SJJA 4DFKA 5AQJA 3O4NA 4CFDA 4CFAA 1VHXA 4PL8A 1YAGA 3GE1A 4MLHA 2HHTA 4I2QA 3PLAA 1GOBA 4AH9A 4CHOA 4AHCA 3BEXA 4BC5A 5JVHL 4DR2K 2IAJA 2VGMA 1N6QA 3VQ5A 3HVTA 3O5BA 2QM1A 1VSIA 3AVNA 3JYTA 1WAJA 1ATSA 2G8WA 1RTDA 1NKCA 3O1BA 4CJWA 4DKWA 3UKUA 2A41A 3C95A 3L4QA 1TGOA 4HTLA 3VETA 4DU3A 4R79A 4IOAL 1D5AA 3KK1A 2OZMA 1J9AA 3EY1A 1NG9A 3CYMA 1KLNA 1CXQA 4BRCA 3HVRA 2RF2A 4M3RA 4LF4K 4DTRA 3PX0A 2W6LA 3N4PA 4BRFA 3SAHA 4QOZB 1S5JA 3SAGA 5TKWA 3ZEUB 4Z4IA 4Z0UA 2CH5A 2Q31A 3DI6A 1YVUA 3I33A 5HL7L 3C6AA 2DFFA 4X62K 3VTHA 5M1NA 1NJWA 4B9LA 4DR5K 1MDUB 3KWGA 3F9KA 4N5SA 5AQKA 1SZ2A 3HOSA 5FDLA 2HB5A 3E9OA 3HK2A 1XHXA 2HW3A 3H1VX 1KVBA 2JGUA 3OYEA 1ASWA 3AA5X 3M8PA 1FW6A 1S3XA 1C6VA 4FZYA 4BR4A 2V7ZA 5HROA 3AVCA 2FF6A 3V4IA 1U04A 2OPRA 2XY7A 3PY8A 4RTFD 1NOYA 2UXCK 3HJFA 1Z05A 4ID5A 3CCJN 4FYDA 5SWMA 4CK3A 1BUPA 4E0DA 5GIOA 3IAYA 3HPHA 1ASVA 3RR8A 4XIUA 5BPLA 4C8MA 3A5NC 3A0IX 4ZHRA 2E5LK 4B3RK 1RBUA 4YOWA 1WBBA 1N34K 4KRFA 3AAQA 4C1NK 4JYAK 3SQ2A 3VQ9A 4C8LA 1CZAN 2EHGA 5ADXA 4OVLA 5KQDA 2V51B 4E89A 1SUQA 1QVGM 3TSUA 2P9PB 1SKRA 1VQON 4K25A 4DV1K 4OLAA 3AA4A 3CQYA 4BVPA 3G71N 4E19A 4FWPA 1Q8IA 3VQ4A 2F8SA 4DSEA 1QHAA 3M8SA 1VK0A 5FRMA 4JHDA 1V4TA 3DRSA 3K5MA 4DSIA 4H5WA 4BRHA 4EAHD 1YITN 2ZJRL 3HT3A 2PZSA 3V81A 3MEEA 4EIAA 2WOMA 3VEZA 1I94K 1TL3A 4H5TA 2P5OA 2EX3A 3OYLA 4MDBA 4JNEA 1BHLA 1XUPO 3HZ6A 4JN4A 3OHRA 1M1KO 5AQVA 2ZGZA 3LM9A 3BZCA 3CI5A 2AJQA 4CESA 4CF8A 3H45C 4H4OA 4IO9L 1BIZA 5FPMA 1RT5A 5J2PA 3CCLN 1YTUA 1VQKN 2F9WA 4DV4K 1Z26A 3SMSA 4CGHA 4DSFA 2P9NB 2OTJN 1G99A 3AGRA 3D7EO 4O44A 2CGLA 3VQBA 4CF2A 1NK9A 3VGMA 3G6EN 1EO1A 2E20A 3ZSRA 5AQLA 3VEVA 1JLGA 4YDUC 5HBMA 4LH4A 1NGEA 3CC2N 4AHSA 2P5GA 3EO3A 1HR0K 4DS4A 5F2RA 3L0QA 4M3UA 2W41A 5J2QA 3O9UA 3S3OA 3ZEUA 4KI4A 4FWOA 4YOUA 4FM1A 4PKIA 3SUQA 1UA1A 4BRIA 4C1NI 4JKGB 2P9KB 1TK8A 4AHVA 3BY5A 1RT6A 1H1VA 5JS1A 4E3SA 3EEQA 3N4QA 3TAQA 1VQLN 5IWAK 1Q86O 1YI2N 4KH6A 3KLHA 4JS5A 3D45A 4HWIA 3KKSA 1JJ2M 2UUBK 1WNSA 3V9ZA 2VCPA 4J2EA 5AQRA 4Z94A 3THXA 1J5EK 3CHWA 3WNEA 1JLQA 1X1PA 3K9JA 3P31A 1TKXA 3CCVN 4JI0K 1LOTB 4BR0A 1XNRK 5B8HA 3BF3A 5MLCQ 4Y0WA 2P9LB 2O8CB 2HHWA 4FOIA 4M3XA 3UE5A 5CY4A 4CHQA 4PKGA 3TTCA 4FM0A 1VQ5N 2ITMA 1YJ9N 4MDAA 3LPUA 1VSKA 3L6QA 2QTDA 2Z1GA 4CGGA 1TUYA 1BI4A 3AVIA 3CFRA 2YHWA 1F21A 1VSEA 4PQUA 2QWMA 3KIOA 3VERA 3L4IA 3S3MA 3QETA 3I55N 1EKEA 3K0SA 3WQUA 3CM5A 2BGGA 1JL2A 3THVA 2G8UA 1NBWA 1GLFO 3RSEB 2HOEA 4BWJA 4ELTA 4E7HA 1N5YA 4H0XB 3OW2M 1VSFA 5LJVA 1BO5O 2YNGA 4WQ5A 3TTDA 4IFYA 2NRTA 1K8KA 2A3ZA 3ENOA 4YHHK 1HQUA 4B9VA 4YOYA 4FXDA 3LDQA 3W0LA 3KLGA 1ZBLA 4EZ6A 1SKWA 4DV3K 4FW2A 1UOCA 1WN7A 4CFBA 5AZJA 4DR3K 3CCSN 2LSNA 3QEIA 2R7YA 2YNIA 1VQ7N 4JI1K 4B1UB 1NKBA 1Q7YO 4JKDA 4RW6A 3CIPA 2ATQA 1I3AA 5JMVA 4N76A 1L3SA 5LJWA 3U4LA 3C6HA 3VENA 2D0CA 4NLCA 4MO4A 2UYTA 5JLHA 4DQIA 3M5RA 2F4VK 2BTFA 5F1XA 3I0RA 4KO0A 3SQ1A 3SCXA 3HXMA 1U45A 1QQMA 3PX4A 3CJBA 3WEEB 3RMCA 3K5LA 1HNWK 1JLAA 2E2NA 4EFHA 5KPTA 3S9HA 3HPOA 1P90A 3QFPA 1YT3A 2JLEA 2ZD1A 4I9QA 2ZGYA 2PBDA 5HRPA 2E4LA 1Q9YA 1RFQA 4AF1A 1EXQA 3PIOL 3TANA 4BE0A 3KKRA 2VWBA 4CK2A 4CJTA 4GV9A 3NVMA 1TKZA 3RVCA 3F9MA 3EZWA 3VTIA 3P39A 3IS9A 4JRPA 4FLYA 1EWRA 3NH1A 4F2SA 2NLXA 4FJLA 5HRNA 3VN5A 4CZFA 5KGXA 4AHRA 2CH6A 1WLJA 1RTJA 3ASMA 4KTZA 3O3GA 5A2QO 4DUZK 1DTTA 1WSEA 4FVMA 2GX9A 3K57A 2NRXA 4KPYA 1X9JA 4OGEA 4DQRA 1HKGA 1T7PA 3TU5A 1ZBUA 5E41A 2E1YA 3ZT0A 1IKYA 4N41A 2KW4A 3R8EA 4HVJA 1KRPA 1L3VA 4BROA 4XEIA 5BREA 3T1YK 3RMBA 3CPEA 3ZT4A 3CCRN 5M1OA 3H6EA 1IKWA 3NH2A 2D5RA 2F8TA 2ASMA 4IDKA 4CJQA 3FFKB 5C24A 3PUFA 4B9NA 5K14A 4PA1A 1NLVA 1RBVA 2PAVA 4ILHA 4AHTA 3OBWA 3DAWA 4DV7K 3E66A 3KHYA 1XHZA 2E2OA 5BN9A 1MA9B 1N32K 5EXWA 4K8ZA 2X78A 4CZEA 3QFUA 1ESVA 3C6TA 4DLEA 3IKMA 3DOKA 3OYKA 1NK8A 2DY4A 2GUPA 3T1AA 4DQPA 1HPMA 4FJMA 2O8EB 2ASOA 2RHKA 3RSEA 2P51A 3MEGA 4X65K 4NYFA 1FK9A 3QBXA 4IOCL 1J5OA 4M41A 4FJJA 3CJCA 2FF3B 1U4BA 1OH8A 2NRHA 3VQPA 4LC9B 1S6PA 3FE1A 3T1HK 4CBXA 3OYHA 1QSSA 3HTVA 4JD2B 4H4MA 2NRZA 1SL2A 4E7IA 5JICA 1UAXA 1KSPA 3SBTA 1OH6A 1IV0A 3KJVA 4B08A 3ZETB 3HP9A 3G10A 2VQFK 4DTPA 1YVNA 1EWQA 3H1QA 1E4GT 2O8FB 4BRQA 1Q18A 3TABA 3C94A 4IWVA 1JL1A 3VQDA 3M8RA 4I9LA 4OGCA 1VSJA 4AILC 3V9WA 2I7NA 4JRQA 2VYPA 4LFBK 4BACA 1QHTA 4DQ8A 3VESA 3TSQA 3L2RA 4OKKA 3MX2A 1NNEA 1Y97A 3K58A 4NCBA 2XHBA 2VG5A 2XY6A 4M3TA 4M3YA 1ZBFA 4DR7K 3LALA 4Y1CA 4HCBA 1A5XA 2E2QA 4B1VA 3EE9A 5BN8A 3D2EB 2Z1HA 4CECA 3SYZA 3VEXA 3VQCA 4LH5A 3BGRA 1DEJA 4HUFA 1N33K 1RDCA 1RCHA 1RTIA 4E1MA 3AVMA 1RTHA 1BU6O 1T03A 1NJYA 3M8QA 3SUOA 2VGNA 2D4WA 3VOVA 4DTMA 4CJKA 5AR0A 3OS0A 2Z1JA 4E7KA 2XY8A 3I8BA 3LANA 4WQ4C 2RE2A 1TL1A 3DLHA 1CZBA 1T6DA 4OJRA 3WXKA 4CD3A 3TPQA 5FPNA 5AFUA 1ATRA 3C6UA 3U3YA 5CZ2A 4DF4A 4CGJA 4K41A 4BRKA 2WBNA 4DU4A 3NDKA 3KLEA 1RNHA 4LF8K 3JS6A 2IVOA 3LL3A 1WSHA 3CJAA 4C8KA 4ILGB 4FOEA 2UXDK 3CQXA 4GW6A 4MO5A 3DLLL 3QEVA 3ULEA 3A5OC 4QAGA 3NMUA 4CE9A 4CEFA 3CJ7A 3GG4A 3NF7A 1NU0A 4B3OA 3V6DA 3DLEA 4UQGA 3DLRA 1NGIA 2YHYA 3Q7CA 2GBZA 1WSGA 5KQ8A 5KTQA 2HHUA 3C7NA 3LDOA 4IJNA 1VQPN 1L3UA 3CMEN 3OYDA 3KZBA 1EQYA 3ZSYA 2OTLN 3RRHA 1BOTO 4RW8A 4DTOA 5AQWA 4FW1A 3OY9A 3E9LA 4YOTA 1X3NA 4LY7A 3V9SA 1K73O 1NGDA 4A5BA 5GADP 2Y1IA 3M3ZA 1RBSA 3KLIA 2O8DA 3ZX3A 5M1KA 2GEMA 2HBLA 3RWUA 4LD0A 5AQFA 5M1FA 4J2AA 2X74A 5GINA 3SPYA 3ULDA 4H5NA 4A62A 3UKRA 4U7BA 5M1QA 1D9FA 3HO1A 4JLHA 2HF3A 3CFOA 3QNNA 5KRTA 2Q3SA 3QICA 1BIUA 4AM6A 2PFUA 4N56A 2WTUA 4O4GA 1LAWA 2YJFA 4CJ7A 5C10A 4EP4A 1NK5A 2KLAA 3OS1A 3SAFA 4CZLA 4FJ9A 4BWMA 1NGFA 3V1OA 4DR6K 3U3GA 4DF8A 4LF9K 1RT1A 4KB1A 4WQ5C 1RGIA 4CK1A 1Z6RA 1KLMA 2V52B 1NGBA 2Z1IA 4CGIA 4BGBA 3HM8A 4CJ3A 3HM9A 4EP5A 4FWSA 4B8CA 4JI6K 1ASUA 4DLGA 1GOAA 4CFCA 3NGYA 3J7YP 4FJXA 1VQ9N 3NF8A 2OPPA 3DRRA 3J8AA 3MAQA 3J7ZO 4PWDA 3DOLA 1KAYA 3GL1A 3CD6N 3MXJA 3F2KA 1M90O 4FK4A 5JS2A 3WXMB 3U8XA 2E2PA 2ITGA 2A42A 3OJSA 1TYQB 1X3MA 3CCQN 1QS4A 5EU7A 1JLFA 4CZMA 4M7XA 3T7ZA 3UKUB 4J2BA 4KHWA 2IS3A 1WUAA 4ELVA 4OPHA 5CYQA 2YKNA 4A57A 1NKEA 3DXKB 1KCFA 1R59O 3DLGA 4OPJA 4FWLA 1XMQK 4JI8K 1VQ4N 4EZ9A 3NE6A 4CW7B 1B9FA 4CJRA 2QWNA 3FZLA 3QMLA 3B6PA 3LDNA 4JI3K 3QIPA 3HRGA 1O13A 5HP1A 3G4SN 1WOQA 5J2MA 4M7YA 2UU9K 3O1WA 1XI1A 3KWIA 4WFBL 3CCUN 5GAHP 4YY3K 3MN9A 4DTSA 3DXKA 2DFHA 2FLOA 4U67L 2HBMA 3HL8A 4L8RB 1OKJA 3LDSA 3PX6A 1RDBA 3VGLA 3MCPA 1HJRA 4JEPA 4FLZA 3GOIA 3C65A 3ZYYX 3ZX2A 4FJKA 1GLDG 2P9KA 2QW9A 1T05A 2YI1A 1LCUA 4LF5K 2IIRA 3NFAA 4NXMK 4F4KA 3AVKA 4KFBA 2HVHA 1QZ6A 1K9MO 1TAUA 1RILA 4FJ5A 3T3FA 5EOYA 3A2FA 3WXIA 1JLEA 3SUNA 4IDHA 1HYSA 2A40A 4ILJA 4M63C 4F8RA 1HQEA 2WFBA 1VAZA 1TAQA 3U6FA 1ZBIA 4ISFA 3RTVA 4IFVA 4M3WA 3THWA 1U2VA 5HOOA 4PY5A 1IKVA 3HBTA 5TKYA 1HJOA 2FBXA 1HMVA 1KAXA 4KHPK 1QVFM 3IDHA 1W0HA 4DV0K 3S41A 4BC4A 1GLAG 3LDPA 1SL0A 5JLFA 1NM1A 5C15A 1WB9A 4M3ZA 5AQYA 3VQQA 2QKKA 4IBNA 4CJSA 2NRVA 1LWEA 4KTWA 4ISGA 3VA0A 3CF5L 4RW4A 3D2FB 4B8AB 1XMOK 3CCEN 1RBTA 2FSKA 2OPSA 3ZCMA 1IKXA 5AQTA 3ZT1A 2Y1JA 4KHYA 4WQ4A 3DRPA 2P9IB 5GIPA 4Q0BA 2VG7A 4FL9A 2HVIA 4H5VA 4IKFA 3NF6A 3OTOK 4CD1A 4GVMA 3VPZA 3FGUA 1L3TA 4BC2A 2NUBA 4ZTFA 1NJZA 2NRRA 3E9PA 3P38A 2P9SA 3VF6A 2BDPA 4FJIA 4O8KA 4JK9A 3R6MA 4O8UA 2KQ2A 3E1YA 4MLEA 1S1TA 1KFSA 5C42A 4CJUA 4CF1A 4AHUA 3CXCM 3H3OB 5AFUH 5FPDA 1ITGA 4W5RA 4BDZA 1SKSA 4HCCA 1GLEG 1YF5L 3F5TA 4GKKK 3O9TA 2YHAA 3QEWA 5BRDA 1NGHA 3SI6A 4BY9C 1IJJA 4N47A 1TVRA 1WSIA 5AJ3K 2YX6A 5BPMA 3LM2A 4YNQA 4F2RA 4PUOA 3DYAA 3MDQA 3ATVA 3CG7A 4O0IA 3U9DA 4UY8O 3TAFA 4H0TB 3CETA 4BQLA 2FC0A 3BF1A 1S72N 2D0BA 3WNHA 4RCHA 4KHSA 3ZT3A 3HI0A 3VMFB 4BRDA 1NGCA 3KVGA 4LF6K 1S1UA 2HBJA 2HHSA 2YV0X 4W5QA 4BDPA 4BRNA 5BR8K 3D2EA 4JAXA 4WYBA 3QNOA 2O4GA 2A1RA 4CZIA 1S1VA 1X9MA 1DGKN 4FVUA 1GOCA 2NRWA 2RKIA 4IOXA 5AQZA 4AM7A 2ETJA 1C1AA 1S9EA 1IG8A 4KREA 3K5NA 2P9IA 3SNNA 2ZJQL 1KAZA 3KD5E 4B1YB 2VG6A 5AZIA 3SK3A 1GLBG 3C0BA 4JV5K 1JKHA 1YTAA 3H46O 1IO2A 4B9UA 4B1ZA 2VWKA 2KKZA 2BANA 3EKSA 3AVJA 4GVEA 1IG9A 3NF9A 3I0SA 4JKFA 4CBWA 1W2BM 3GBTA 4CZJA 3W3DA 5E26A 1JCEA 2KHOA 3CERA 4A59A 4YDUA 4GV3A 5HRRA 1XWLA 3B6OA 2OYQA 1XQSC 4TSXA 4WE1A 1OVYA 2JWKA 4BGAA 3DXMA 4WFNL 5LMUK 1ZYQA 4J2DA 3QIOA 1DTQA 4DR4K 4FLTA 3P83D 1BCMA 3UKRB 2QEXN 3QEXA 3OYAA 4FLXA 4DB3A 3WNFA 2O8EA 1LW0A 1NMNA 1TKDA 2P1JA 3KK2A 2G8IA 3THYA 1HKBA 4H03B 3WUHA 2FSNA 4GV6A 1DT9A 3Q7BA 3O8MA 4ISEA 1LAVA 3K9KA 1B9DA 1WSFA 4AQYK 2W40A 1LWFA 4CVNE 2QI2A 4DTNA 1BWFO 1E3MA 4L3QA 5DMRA 3AV9A 3PIPL 1VQ8N 4DS5A 2GELA 4ID1A 4IJAA 1KVCA 3CC4N 1ZXOA 3SBGA 3ULEB 3CC7N 3OBYA 4YOVA 3NGZA 3SV4A 3AVGA 3J7AP 1HYVA 4FJ8A 2YCHA 3O08A 3QERA 3EE8A 1HX1A 4HUEA 2CGJA 4BRLA 3MWTA 4DHYA 3BDPA 3AVAA 1RDAA 4KBOA 3CFPA 4DFPA 3TSPA 4B3MK 4V19S 4Z4EA 4DTUA 4WF9L 1MU2A 4DQSA 1EP4A 5AQIA 2RN2A 2QWRA 4H8KA 4PKHA 1W9HA 1NGAA 4NCGA 5I42A 4XH4A 1W7AA 4BRPA 2VWJA 3TAEA 3TTFA 4FWNA 4DV5K 3QLHA 3LPTA 2X6NA 1IBLK 4CHNA 1Q81O 4FJNA 1HNXK 1NK4A 1ZBSA 4C8NA 3TAGA 1SQKA 3MN6A 3OYFA 1D8YA 4CERA 1HYZA 2B6AA 4BQZA 4K42A 4QS7A 4CJFA 4FCYA 3CJ9A 2XRIA 3PO5A 5EY4A 2XO7A 3NBPA 4Z4HA 3AGKA 3SZ2A 1EETA 2O4IA 2ZM6K
chains in the Genus database with same CATH topology
2W6KA 3EEQA 2W6LA 3BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6K A;  3EEQ A;  2W6L A;  3BY5 A; 
#chains in the Genus database with same CATH topology
 5FPE A;  4BRE A;  4LFA K;  1BDG A;  5CZ1 A;  4CHP A;  1CXU A;  5AQS A;  3J80 O;  1BIS A;  5AQM A;  3V1R A;  4KB0 A;  3LP1 A;  1BL3 A;  3OYI A;  4K0K K;  5CE3 A;  3FZM A;  1CZ9 A;  3NVK A;  3MMV A;  4OPK A;  4IEI A;  4RW9 A;  4CEZ A;  3KK7 A;  2GV9 A;  1RT2 A;  5BPN A;  4BC3 A;  1HKC A;  4DUY K;  1C0G A;  1L5U A;  5FRN A;  2WC9 A;  1OVQ A;  2UUC K;  4CJ5 A;  5LY3 A;  4CED A;  2G8F A;  3LZJ A;  2RPI A;  4FZZ A;  1NWK A;  1YJW N;  4WCE L;  3IRX A;  4E7L A;  4KHN A;  1J54 A;  5LL6 Z;  4KHQ A;  5F0X A;  4GKJ K;  1JXB A;  3O9S A;  2D1K A;  3ZLJ A;  4H0V B;  2HBK A;  3T19 A;  3ZET A;  2D0A A;  1JCG A;  3HP6 A;  2DTU A;  3BZK A;  1NJX A;  1E4F T;  4DSJ A;  3VQ8 A;  4XH5 A;  3K59 A;  3CMA N;  3CPW M;  4DR1 K;  3HYF A;  2KTQ A;  3AVH A;  3ISN C;  4DWI A;  1XNQ K;  2QXF A;  1U2V B;  4NYN A;  1SAZ A;  1HNZ K;  3PSF A;  5D3G A;  4H0P A;  3QEP A;  4FK0 A;  4CEA A;  3VQ7 A;  5AZJ B;  4QCL A;  1TUU A;  1FJG K;  1K8A O;  3NHG A;  2YHX A;  5DM6 L;  1QE1 A;  2QWP A;  4FPB A;  1TKT A;  4Q5V A;  4B1X B;  5KPZ A;  1VRT A;  3WT0 A;  4BRM A;  1NJI O;  2Q0U A;  1T6C A;  3O3H A;  4E1N A;  3WNG A;  3LP0 A;  4M45 A;  4DQQ A;  3SQ0 A;  2AA4 A;  2BE2 A;  1ZBH A;  2HNZ A;  1YHQ N;  3BUZ B;  1X9W A;  2F7T A;  3QDK A;  4GY2 B;  1QTM A;  5C0Y A;  1X9S A;  2HMP A;  4IXC A;  1TV6 A;  2G8V A;  1S1X A;  4BG8 A;  2BUP A;  5I9E B;  3K5O A;  3EN9 A;  3L8B A;  4IO8 A;  4A61 A;  3EKU A;  1SL1 A;  2HHX A;  5HLF A;  3IG1 A;  3SPZ A;  1XC9 A;  2YNF A;  4CZH A;  4Z4C A;  4W5N A;  4KH4 A;  2W6K A;  2PY5 A;  2GUI A;  5I3U A;  3LWL A;  4DV2 K;  1JCF A;  1K6Y A;  4DMN A;  3V9X A;  3CJ1 A;  3ZSQ A;  4KH5 A;  3EZ5 A;  3FFI A;  3CCM N;  1RBR A;  4X64 K;  1VQ6 N;  1QQO A;  2Q1N A;  3ENH A;  4Y1D A;  5IT9 O;  4BR5 A;  4F3T A;  4FZX C;  2NZT A;  3AY9 A;  4M42 A;  2WUS A;  3JXU A;  2QWL A;  3DWL A;  4O5F A;  2I7P A;  2YKM A;  5AQO A;  2UXB K;  3THX B;  2G8H A;  5LMN K;  3DM2 A;  2QWO A;  2V7Y A;  3S3N A;  4CZG A;  2HHV A;  1U6Z A;  2DPN A;  4FJ7 A;  4OLB A;  4E7J A;  3NGI A;  2HHQ A;  1BG3 A;  3AA3 A;  4F9O A;  4NB4 A;  5JVG L;  1SS6 A;  2E6M A;  5HRS A;  3R1X A;  4OPA A;  4RWT A;  1RDU A;  3G0Z A;  1T8E A;  4CGD A;  3TAM A;  4JI2 K;  1RT4 A;  1ZC6 A;  3L2V A;  5AQH A;  1P8Z A;  3TI0 A;  3R9P A;  4BDY A;  2P9U B;  4I6M B;  4MQ3 A;  5ELZ A;  2IVP A;  4CIF A;  2P9S B;  4ICL A;  4BRG A;  4O5B A;  1T3V A;  5AQX A;  3LZI A;  3UB5 A;  4BVO A;  4DU1 A;  4BE2 A;  5H1S Q;  4KAZ A;  1C0U A;  1NGJ A;  1OH5 A;  1YJN N;  3AVB A;  1QSY A;  2ASP A;  4CI6 A;  1VRU A;  3SUP A;  4G1Q A;  4K43 A;  1I39 A;  2DFE A;  3ITH A;  4CF9 A;  3B8A X;  3SJH A;  3TWH A;  3LDL A;  4RG8 A;  1A5V A;  1VSM A;  4XH1 A;  1FXX A;  2CGK A;  1BQM A;  4IG3 A;  4QS8 A;  3H3N O;  2P9N A;  2QWQ A;  5GAE P;  5KPR A;  3O4Q A;  3TR8 A;  1JLC A;  3ID6 A;  2ZF5 O;  3MXM A;  1NOZ A;  2FBT A;  3MN7 A;  5AQU A;  4DFM A;  4BE1 A;  3KK3 A;  1Q9X A;  3O4W A;  4CJV A;  3OYN A;  3WQT A;  4KHU A;  4FJG A;  4CGF A;  4DTJ A;  2ZE2 A;  4EHU A;  4KTQ A;  3D6R A;  2E88 A;  5KI6 A;  4R5P A;  4A5A A;  2O8D B;  4CHZ A;  2F96 A;  3O9Q A;  1RT7 A;  4HTU A;  4BRA A;  3KTQ A;  2HNY A;  4Z4F A;  2A5X A;  1KQS M;  3O9R A;  5FLX O;  2GWJ A;  3SV3 A;  3T69 A;  3CM6 A;  1JLB A;  1UWB A;  3RMA A;  2IOC A;  3P4I A;  2D0O A;  3V9U A;  4FLV A;  1S22 A;  4OKJ A;  2P9P A;  5AQN A;  3VQE A;  4KKO A;  4RW7 A;  3FLC O;  4G9Z A;  1S6Q A;  2OAN A;  5AQG A;  4JKA A;  1QQC A;  3ZSV A;  3A5L C;  3VF2 A;  4JI4 K;  5KGW A;  3QO9 A;  2HMI A;  3F73 A;  3U9Z A;  1FKO A;  2O8B B;  1ILY A;  5C2D A;  3QB0 A;  4LF7 K;  3RMD A;  3HOT A;  4OKE A;  2Q36 A;  3OYB A;  3I8D A;  1ATN A;  4LFC K;  3D0P A;  4JI5 K;  2O8C A;  4JI7 K;  4IEE A;  5T7B A;  3HST B;  1R0A A;  2BH1 A;  3HPG A;  2HHH K;  4B9S A;  4NLB A;  1QSL A;  3OJU A;  5M1P A;  1JXE A;  4NCA A;  1Y64 A;  4B3T K;  4JKC A;  4O0J A;  1IBM K;  3P5J A;  3UIQ A;  3PV8 A;  1YXQ A;  1T44 A;  3O3F A;  4FWQ A;  2VQE K;  2KZZ A;  5C2F A;  3LP2 A;  4FLW A;  3NAE A;  3MED A;  4BG9 A;  5SZT A;  3OYC A;  3R3L A;  4FJH A;  3M6G A;  1KC8 O;  3FZH A;  3AO4 A;  1HLU A;  2AP1 A;  2P9U A;  4I6M A;  2Q97 A;  2PYJ A;  5GAG P;  1TYQ A;  5AQQ A;  5BRH A;  4CCH A;  4JKB A;  1LW2 A;  2ZWH A;  3LP3 A;  3O6W A;  2OCE A;  4LSN A;  1BCO A;  3JSM A;  2OZS A;  1LWC A;  3OA9 A;  3MK6 A;  3ZSO A;  5FRO A;  4OO1 J;  1REV A;  4CHY A;  3MCA B;  1RDD A;  1NK7 A;  1BA1 A;  1NMD A;  4FWM A;  3L3U A;  2QXL A;  2E1Z A;  1SV5 A;  3OYG A;  2OA8 A;  1W97 L;  2KFZ A;  4H0Y B;  5J1E A;  2OPQ A;  4B3S K;  3ZSZ A;  3SMP A;  1RDW X;  5DK5 A;  1VQM N;  1A5W A;  4CZK A;  5C25 A;  1KVA A;  3E01 A;  5CR4 A;  2YHB A;  2Q2R A;  3KLF A;  2HF4 A;  4PL7 A;  4EHT A;  1N36 K;  4DSK A;  2ZJP L;  2G8K A;  2YJE A;  5EVZ A;  3WEE A;  4K8X A;  4CJL A;  4CEB A;  2O8F A;  2KFN A;  4CJE A;  4H5R A;  3EYZ A;  2B4J A;  2W42 A;  3AO3 A;  4CJ4 A;  3ID8 A;  3EL2 A;  2KZM A;  1HRH A;  3ENB A;  1QZ5 A;  1YIJ N;  3THW B;  3QIN A;  2GWK A;  4CIG A;  3OYJ A;  2GTD A;  1K8K B;  3FR0 A;  1VSH A;  3A8Y A;  1IH7 A;  1KXP A;  1MWM A;  2A6A A;  2IGI A;  4X66 K;  3OYM A;  2PYL A;  1BGX T;  1B92 A;  5AQP A;  4HHT A;  2JWL A;  3ATU A;  2I5J A;  3MWP A;  2QKB A;  4E1J A;  5EX5 A;  2FBV A;  3C7N B;  3IFR A;  3ZX0 A;  3ZSW A;  4YFU A;  1CLQ A;  1TK0 A;  2H3G X;  1BI4 B;  4B9Q A;  1Z25 A;  4CEE A;  1NK6 A;  1BQN A;  4B9M A;  1D9D A;  2IDO A;  4LSL A;  3L2U A;  4BR2 A;  4GNI A;  4JK8 A;  3AVF A;  3DMJ A;  3VEW A;  3V1Q A;  3WXJ A;  3I56 N;  1UA0 A;  1WBD A;  2FSJ A;  4FWK A;  4NO7 A;  4W5T A;  2E6L A;  3P1G A;  3RR7 A;  3HSC A;  1GLL O;  4WFA L;  2IVN A;  4F3O A;  3VEY A;  4PHT X;  4FM2 A;  3LAM A;  3VQ6 A;  1Q82 O;  1NGG A;  2P9L A;  3J81 O;  4FK2 A;  3L2Q A;  4CIE A;  3OVN A;  4FPA A;  3AAR A;  4I7F A;  2IC3 A;  1HPZ A;  2QK9 A;  3MN5 A;  4FWR A;  1TK5 A;  1KFD A;  2FXU A;  3H08 A;  4FSV A;  5CHI A;  2X6S A;  2E8A A;  4CEO A;  2HST A;  3WXL A;  3MEC A;  1C0M A;  4CEQ A;  1C1C A;  1C0F A;  4GMJ B;  5AZI B;  1WAF A;  1U47 A;  1EX4 A;  3BP8 A;  2A1S A;  1BA0 A;  5BRF A;  4NXN K;  4JKG A;  3TAP A;  1U49 A;  1QQN A;  2D0P A;  4BR7 A;  3OS2 A;  1RT3 A;  3VEO A;  5BR9 A;  3MX5 A;  4JKH A;  3FZF A;  3DJC A;  4YOX A;  1IBK K;  3VF4 A;  4FO0 A;  3PSI A;  4JKE A;  4B1W B;  3FZK A;  1V4S A;  5E84 A;  3IMX A;  3O80 A;  3PO4 A;  4O55 A;  5ADX H;  4Z4G A;  3NH0 A;  3AO2 A;  4A2B A;  4C23 A;  3MXI A;  4CBU A;  2F9T A;  3K2P A;  4A2A A;  2J4R A;  4W5O A;  4KV8 A;  3GDQ A;  3SLC A;  4DFJ A;  3LWM A;  1G15 A;  1NK0 A;  3G25 A;  4IZ9 A;  3QES A;  1C1B A;  3AAP A;  3DLB A;  1WSJ A;  2Q0R A;  5J2N A;  1DLO A;  1VSD A;  1KD1 O;  4OX9 K;  3AA2 A;  3JAM O;  4ELU A;  3VQA A;  1VSL A;  2QA4 N;  1VQN N;  3NCI A;  4J8F A;  3IUC A;  4B9T A;  4DCH A;  4C8O A;  2XY5 A;  2O8B A;  1LV5 A;  5KRS A;  3M1F A;  2FBY A;  3AO1 A;  1D4X A;  4JD2 A;  3VA3 A;  2B5J A;  3L2W A;  4IFE A;  3ZSX A;  1FKP A;  4DG1 A;  1HUX A;  1U48 A;  4CJP A;  1GLJ O;  4JHD B;  1HNV A;  4JK7 A;  4MFB A;  5CYM A;  3A5M C;  4DSL A;  3KD1 E;  3ALY A;  1YUW A;  1J6Z A;  4HUG A;  4CF0 A;  1C0T A;  3L3V A;  1O1W A;  3DLK A;  2NNW A;  4FLU A;  3THY B;  4KI6 A;  1J53 A;  1GLC G;  3ZT2 A;  3TAR A;  1HNI A;  2UUA K;  5DM7 L;  4QS9 A;  2YNH A;  4JS4 A;  1KTQ A;  3VGK A;  2EWS A;  3AO5 A;  4ZTJ A;  4DTX A;  3SQ4 A;  4H0O A;  4IG0 A;  1S9G A;  3LAK A;  1N8R O;  1OH7 A;  4DV6 K;  3QBW A;  4BR9 A;  1XC3 A;  3AVL A;  4YOR A;  3RRG A;  3DXM B;  1S1W A;  2ZQB A;  2HND A;  3D2F A;  1DKG D;  2WON A;  5C12 A;  1MWK A;  4I2P A;  3CQ8 A;  3SJJ A;  4DFK A;  5AQJ A;  3O4N A;  4CFD A;  4CFA A;  1VHX A;  4PL8 A;  1YAG A;  3GE1 A;  4MLH A;  2HHT A;  4I2Q A;  3PLA A;  1GOB A;  4AH9 A;  4CHO A;  4AHC A;  3BEX A;  4BC5 A;  5JVH L;  4DR2 K;  2IAJ A;  2VGM A;  1N6Q A;  3VQ5 A;  3HVT A;  3O5B A;  2QM1 A;  1VSI A;  3AVN A;  3JYT A;  1WAJ A;  1ATS A;  2G8W A;  1RTD A;  1NKC A;  3O1B A;  4CJW A;  4DKW A;  3UKU A;  2A41 A;  3C95 A;  3L4Q A;  1TGO A;  4HTL A;  3VET A;  4DU3 A;  4R79 A;  4IOA L;  1D5A A;  3KK1 A;  2OZM A;  1J9A A;  3EY1 A;  1NG9 A;  3CYM A;  1KLN A;  1CXQ A;  4BRC A;  3HVR A;  2RF2 A;  4M3R A;  4LF4 K;  4DTR A;  3PX0 A;  2W6L A;  3N4P A;  4BRF A;  3SAH A;  4QOZ B;  1S5J A;  3SAG A;  5TKW A;  3ZEU B;  4Z4I A;  4Z0U A;  2CH5 A;  2Q31 A;  3DI6 A;  1YVU A;  3I33 A;  5HL7 L;  3C6A A;  2DFF A;  4X62 K;  3VTH A;  5M1N A;  1NJW A;  4B9L A;  4DR5 K;  1MDU B;  3KWG A;  3F9K A;  4N5S A;  5AQK A;  1SZ2 A;  3HOS A;  5FDL A;  2HB5 A;  3E9O A;  3HK2 A;  1XHX A;  2HW3 A;  3H1V X;  1KVB A;  2JGU A;  3OYE A;  1ASW A;  3AA5 X;  3M8P A;  1FW6 A;  1S3X A;  1C6V A;  4FZY A;  4BR4 A;  2V7Z A;  5HRO A;  3AVC A;  2FF6 A;  3V4I A;  1U04 A;  2OPR A;  2XY7 A;  3PY8 A;  4RTF D;  1NOY A;  2UXC K;  3HJF A;  1Z05 A;  4ID5 A;  3CCJ N;  4FYD A;  5SWM A;  4CK3 A;  1BUP A;  4E0D A;  5GIO A;  3IAY A;  3HPH A;  1ASV A;  3RR8 A;  4XIU A;  5BPL A;  4C8M A;  3A5N C;  3A0I X;  4ZHR A;  2E5L K;  4B3R K;  1RBU A;  4YOW A;  1WBB A;  1N34 K;  4KRF A;  3AAQ A;  4C1N K;  4JYA K;  3SQ2 A;  3VQ9 A;  4C8L A;  1CZA N;  2EHG A;  5ADX A;  4OVL A;  5KQD A;  2V51 B;  4E89 A;  1SUQ A;  1QVG M;  3TSU A;  2P9P B;  1SKR A;  1VQO N;  4K25 A;  4DV1 K;  4OLA A;  3AA4 A;  3CQY A;  4BVP A;  3G71 N;  4E19 A;  4FWP A;  1Q8I A;  3VQ4 A;  2F8S A;  4DSE A;  1QHA A;  3M8S A;  1VK0 A;  5FRM A;  4JHD A;  1V4T A;  3DRS A;  3K5M A;  4DSI A;  4H5W A;  4BRH A;  4EAH D;  1YIT N;  2ZJR L;  3HT3 A;  2PZS A;  3V81 A;  3MEE A;  4EIA A;  2WOM A;  3VEZ A;  1I94 K;  1TL3 A;  4H5T A;  2P5O A;  2EX3 A;  3OYL A;  4MDB A;  4JNE A;  1BHL A;  1XUP O;  3HZ6 A;  4JN4 A;  3OHR A;  1M1K O;  5AQV A;  2ZGZ A;  3LM9 A;  3BZC A;  3CI5 A;  2AJQ A;  4CES A;  4CF8 A;  3H45 C;  4H4O A;  4IO9 L;  1BIZ A;  5FPM A;  1RT5 A;  5J2P A;  3CCL N;  1YTU A;  1VQK N;  2F9W A;  4DV4 K;  1Z26 A;  3SMS A;  4CGH A;  4DSF A;  2P9N B;  2OTJ N;  1G99 A;  3AGR A;  3D7E O;  4O44 A;  2CGL A;  3VQB A;  4CF2 A;  1NK9 A;  3VGM A;  3G6E N;  1EO1 A;  2E20 A;  3ZSR A;  5AQL A;  3VEV A;  1JLG A;  4YDU C;  5HBM A;  4LH4 A;  1NGE A;  3CC2 N;  4AHS A;  2P5G A;  3EO3 A;  1HR0 K;  4DS4 A;  5F2R A;  3L0Q A;  4M3U A;  2W41 A;  5J2Q A;  3O9U A;  3S3O A;  3ZEU A;  4KI4 A;  4FWO A;  4YOU A;  4FM1 A;  4PKI A;  3SUQ A;  1UA1 A;  4BRI A;  4C1N I;  4JKG B;  2P9K B;  1TK8 A;  4AHV A;  3BY5 A;  1RT6 A;  1H1V A;  5JS1 A;  4E3S A;  3EEQ A;  3N4Q A;  3TAQ A;  1VQL N;  5IWA K;  1Q86 O;  1YI2 N;  4KH6 A;  3KLH A;  4JS5 A;  3D45 A;  4HWI A;  3KKS A;  1JJ2 M;  2UUB K;  1WNS A;  3V9Z A;  2VCP A;  4J2E A;  5AQR A;  4Z94 A;  3THX A;  1J5E K;  3CHW A;  3WNE A;  1JLQ A;  1X1P A;  3K9J A;  3P31 A;  1TKX A;  3CCV N;  4JI0 K;  1LOT B;  4BR0 A;  1XNR K;  5B8H A;  3BF3 A;  5MLC Q;  4Y0W A;  2P9L B;  2O8C B;  2HHW A;  4FOI A;  4M3X A;  3UE5 A;  5CY4 A;  4CHQ A;  4PKG A;  3TTC A;  4FM0 A;  1VQ5 N;  2ITM A;  1YJ9 N;  4MDA A;  3LPU A;  1VSK A;  3L6Q A;  2QTD A;  2Z1G A;  4CGG A;  1TUY A;  1BI4 A;  3AVI A;  3CFR A;  2YHW A;  1F21 A;  1VSE A;  4PQU A;  2QWM A;  3KIO A;  3VER A;  3L4I A;  3S3M A;  3QET A;  3I55 N;  1EKE A;  3K0S A;  3WQU A;  3CM5 A;  2BGG A;  1JL2 A;  3THV A;  2G8U A;  1NBW A;  1GLF O;  3RSE B;  2HOE A;  4BWJ A;  4ELT A;  4E7H A;  1N5Y A;  4H0X B;  3OW2 M;  1VSF A;  5LJV A;  1BO5 O;  2YNG A;  4WQ5 A;  3TTD A;  4IFY A;  2NRT A;  1K8K A;  2A3Z A;  3ENO A;  4YHH K;  1HQU A;  4B9V A;  4YOY A;  4FXD A;  3LDQ A;  3W0L A;  3KLG A;  1ZBL A;  4EZ6 A;  1SKW A;  4DV3 K;  4FW2 A;  1UOC A;  1WN7 A;  4CFB A;  5AZJ A;  4DR3 K;  3CCS N;  2LSN A;  3QEI A;  2R7Y A;  2YNI A;  1VQ7 N;  4JI1 K;  4B1U B;  1NKB A;  1Q7Y O;  4JKD A;  4RW6 A;  3CIP A;  2ATQ A;  1I3A A;  5JMV A;  4N76 A;  1L3S A;  5LJW A;  3U4L A;  3C6H A;  3VEN A;  2D0C A;  4NLC A;  4MO4 A;  2UYT A;  5JLH A;  4DQI A;  3M5R A;  2F4V K;  2BTF A;  5F1X A;  3I0R A;  4KO0 A;  3SQ1 A;  3SCX A;  3HXM A;  1U45 A;  1QQM A;  3PX4 A;  3CJB A;  3WEE B;  3RMC A;  3K5L A;  1HNW K;  1JLA A;  2E2N A;  4EFH A;  5KPT A;  3S9H A;  3HPO A;  1P90 A;  3QFP A;  1YT3 A;  2JLE A;  2ZD1 A;  4I9Q A;  2ZGY A;  2PBD A;  5HRP A;  2E4L A;  1Q9Y A;  1RFQ A;  4AF1 A;  1EXQ A;  3PIO L;  3TAN A;  4BE0 A;  3KKR A;  2VWB A;  4CK2 A;  4CJT A;  4GV9 A;  3NVM A;  1TKZ A;  3RVC A;  3F9M A;  3EZW A;  3VTI A;  3P39 A;  3IS9 A;  4JRP A;  4FLY A;  1EWR A;  3NH1 A;  4F2S A;  2NLX A;  4FJL A;  5HRN A;  3VN5 A;  4CZF A;  5KGX A;  4AHR A;  2CH6 A;  1WLJ A;  1RTJ A;  3ASM A;  4KTZ A;  3O3G A;  5A2Q O;  4DUZ K;  1DTT A;  1WSE A;  4FVM A;  2GX9 A;  3K57 A;  2NRX A;  4KPY A;  1X9J A;  4OGE A;  4DQR A;  1HKG A;  1T7P A;  3TU5 A;  1ZBU A;  5E41 A;  2E1Y A;  3ZT0 A;  1IKY A;  4N41 A;  2KW4 A;  3R8E A;  4HVJ A;  1KRP A;  1L3V A;  4BRO A;  4XEI A;  5BRE A;  3T1Y K;  3RMB A;  3CPE A;  3ZT4 A;  3CCR N;  5M1O A;  3H6E A;  1IKW A;  3NH2 A;  2D5R A;  2F8T A;  2ASM A;  4IDK A;  4CJQ A;  3FFK B;  5C24 A;  3PUF A;  4B9N A;  5K14 A;  4PA1 A;  1NLV A;  1RBV A;  2PAV A;  4ILH A;  4AHT A;  3OBW A;  3DAW A;  4DV7 K;  3E66 A;  3KHY A;  1XHZ A;  2E2O A;  5BN9 A;  1MA9 B;  1N32 K;  5EXW A;  4K8Z A;  2X78 A;  4CZE A;  3QFU A;  1ESV A;  3C6T A;  4DLE A;  3IKM A;  3DOK A;  3OYK A;  1NK8 A;  2DY4 A;  2GUP A;  3T1A A;  4DQP A;  1HPM A;  4FJM A;  2O8E B;  2ASO A;  2RHK A;  3RSE A;  2P51 A;  3MEG A;  4X65 K;  4NYF A;  1FK9 A;  3QBX A;  4IOC L;  1J5O A;  4M41 A;  4FJJ A;  3CJC A;  2FF3 B;  1U4B A;  1OH8 A;  2NRH A;  3VQP A;  4LC9 B;  1S6P A;  3FE1 A;  3T1H K;  4CBX A;  3OYH A;  1QSS A;  3HTV A;  4JD2 B;  4H4M A;  2NRZ A;  1SL2 A;  4E7I A;  5JIC A;  1UAX A;  1KSP A;  3SBT A;  1OH6 A;  1IV0 A;  3KJV A;  4B08 A;  3ZET B;  3HP9 A;  3G10 A;  2VQF K;  4DTP A;  1YVN A;  1EWQ A;  3H1Q A;  1E4G T;  2O8F B;  4BRQ A;  1Q18 A;  3TAB A;  3C94 A;  4IWV A;  1JL1 A;  3VQD A;  3M8R A;  4I9L A;  4OGC A;  1VSJ A;  4AIL C;  3V9W A;  2I7N A;  4JRQ A;  2VYP A;  4LFB K;  4BAC A;  1QHT A;  4DQ8 A;  3VES A;  3TSQ A;  3L2R A;  4OKK A;  3MX2 A;  1NNE A;  1Y97 A;  3K58 A;  4NCB A;  2XHB A;  2VG5 A;  2XY6 A;  4M3T A;  4M3Y A;  1ZBF A;  4DR7 K;  3LAL A;  4Y1C A;  4HCB A;  1A5X A;  2E2Q A;  4B1V A;  3EE9 A;  5BN8 A;  3D2E B;  2Z1H A;  4CEC A;  3SYZ A;  3VEX A;  3VQC A;  4LH5 A;  3BGR A;  1DEJ A;  4HUF A;  1N33 K;  1RDC A;  1RCH A;  1RTI A;  4E1M A;  3AVM A;  1RTH A;  1BU6 O;  1T03 A;  1NJY A;  3M8Q A;  3SUO A;  2VGN A;  2D4W A;  3VOV A;  4DTM A;  4CJK A;  5AR0 A;  3OS0 A;  2Z1J A;  4E7K A;  2XY8 A;  3I8B A;  3LAN A;  4WQ4 C;  2RE2 A;  1TL1 A;  3DLH A;  1CZB A;  1T6D A;  4OJR A;  3WXK A;  4CD3 A;  3TPQ A;  5FPN A;  5AFU A;  1ATR A;  3C6U A;  3U3Y A;  5CZ2 A;  4DF4 A;  4CGJ A;  4K41 A;  4BRK A;  2WBN A;  4DU4 A;  3NDK A;  3KLE A;  1RNH A;  4LF8 K;  3JS6 A;  2IVO A;  3LL3 A;  1WSH A;  3CJA A;  4C8K A;  4ILG B;  4FOE A;  2UXD K;  3CQX A;  4GW6 A;  4MO5 A;  3DLL L;  3QEV A;  3ULE A;  3A5O C;  4QAG A;  3NMU A;  4CE9 A;  4CEF A;  3CJ7 A;  3GG4 A;  3NF7 A;  1NU0 A;  4B3O A;  3V6D A;  3DLE A;  4UQG A;  3DLR A;  1NGI A;  2YHY A;  3Q7C A;  2GBZ A;  1WSG A;  5KQ8 A;  5KTQ A;  2HHU A;  3C7N A;  3LDO A;  4IJN A;  1VQP N;  1L3U A;  3CME N;  3OYD A;  3KZB A;  1EQY A;  3ZSY A;  2OTL N;  3RRH A;  1BOT O;  4RW8 A;  4DTO A;  5AQW A;  4FW1 A;  3OY9 A;  3E9L A;  4YOT A;  1X3N A;  4LY7 A;  3V9S A;  1K73 O;  1NGD A;  4A5B A;  5GAD P;  2Y1I A;  3M3Z A;  1RBS A;  3KLI A;  2O8D A;  3ZX3 A;  5M1K A;  2GEM A;  2HBL A;  3RWU A;  4LD0 A;  5AQF A;  5M1F A;  4J2A A;  2X74 A;  5GIN A;  3SPY A;  3ULD A;  4H5N A;  4A62 A;  3UKR A;  4U7B A;  5M1Q A;  1D9F A;  3HO1 A;  4JLH A;  2HF3 A;  3CFO A;  3QNN A;  5KRT A;  2Q3S A;  3QIC A;  1BIU A;  4AM6 A;  2PFU A;  4N56 A;  2WTU A;  4O4G A;  1LAW A;  2YJF A;  4CJ7 A;  5C10 A;  4EP4 A;  1NK5 A;  2KLA A;  3OS1 A;  3SAF A;  4CZL A;  4FJ9 A;  4BWM A;  1NGF A;  3V1O A;  4DR6 K;  3U3G A;  4DF8 A;  4LF9 K;  1RT1 A;  4KB1 A;  4WQ5 C;  1RGI A;  4CK1 A;  1Z6R A;  1KLM A;  2V52 B;  1NGB A;  2Z1I A;  4CGI A;  4BGB A;  3HM8 A;  4CJ3 A;  3HM9 A;  4EP5 A;  4FWS A;  4B8C A;  4JI6 K;  1ASU A;  4DLG A;  1GOA A;  4CFC A;  3NGY A;  3J7Y P;  4FJX A;  1VQ9 N;  3NF8 A;  2OPP A;  3DRR A;  3J8A A;  3MAQ A;  3J7Z O;  4PWD A;  3DOL A;  1KAY A;  3GL1 A;  3CD6 N;  3MXJ A;  3F2K A;  1M90 O;  4FK4 A;  5JS2 A;  3WXM B;  3U8X A;  2E2P A;  2ITG A;  2A42 A;  3OJS A;  1TYQ B;  1X3M A;  3CCQ N;  1QS4 A;  5EU7 A;  1JLF A;  4CZM A;  4M7X A;  3T7Z A;  3UKU B;  4J2B A;  4KHW A;  2IS3 A;  1WUA A;  4ELV A;  4OPH A;  5CYQ A;  2YKN A;  4A57 A;  1NKE A;  3DXK B;  1KCF A;  1R59 O;  3DLG A;  4OPJ A;  4FWL A;  1XMQ K;  4JI8 K;  1VQ4 N;  4EZ9 A;  3NE6 A;  4CW7 B;  1B9F A;  4CJR A;  2QWN A;  3FZL A;  3QML A;  3B6P A;  3LDN A;  4JI3 K;  3QIP A;  3HRG A;  1O13 A;  5HP1 A;  3G4S N;  1WOQ A;  5J2M A;  4M7Y A;  2UU9 K;  3O1W A;  1XI1 A;  3KWI A;  4WFB L;  3CCU N;  5GAH P;  4YY3 K;  3MN9 A;  4DTS A;  3DXK A;  2DFH A;  2FLO A;  4U67 L;  2HBM A;  3HL8 A;  4L8R B;  1OKJ A;  3LDS A;  3PX6 A;  1RDB A;  3VGL A;  3MCP A;  1HJR A;  4JEP A;  4FLZ A;  3GOI A;  3C65 A;  3ZYY X;  3ZX2 A;  4FJK A;  1GLD G;  2P9K A;  2QW9 A;  1T05 A;  2YI1 A;  1LCU A;  4LF5 K;  2IIR A;  3NFA A;  4NXM K;  4F4K A;  3AVK A;  4KFB A;  2HVH A;  1QZ6 A;  1K9M O;  1TAU A;  1RIL A;  4FJ5 A;  3T3F A;  5EOY A;  3A2F A;  3WXI A;  1JLE A;  3SUN A;  4IDH A;  1HYS A;  2A40 A;  4ILJ A;  4M63 C;  4F8R A;  1HQE A;  2WFB A;  1VAZ A;  1TAQ A;  3U6F A;  1ZBI A;  4ISF A;  3RTV A;  4IFV A;  4M3W A;  3THW A;  1U2V A;  5HOO A;  4PY5 A;  1IKV A;  3HBT A;  5TKY A;  1HJO A;  2FBX A;  1HMV A;  1KAX A;  4KHP K;  1QVF M;  3IDH A;  1W0H A;  4DV0 K;  3S41 A;  4BC4 A;  1GLA G;  3LDP A;  1SL0 A;  5JLF A;  1NM1 A;  5C15 A;  1WB9 A;  4M3Z A;  5AQY A;  3VQQ A;  2QKK A;  4IBN A;  4CJS A;  2NRV A;  1LWE A;  4KTW A;  4ISG A;  3VA0 A;  3CF5 L;  4RW4 A;  3D2F B;  4B8A B;  1XMO K;  3CCE N;  1RBT A;  2FSK A;  2OPS A;  3ZCM A;  1IKX A;  5AQT A;  3ZT1 A;  2Y1J A;  4KHY A;  4WQ4 A;  3DRP A;  2P9I B;  5GIP A;  4Q0B A;  2VG7 A;  4FL9 A;  2HVI A;  4H5V A;  4IKF A;  3NF6 A;  3OTO K;  4CD1 A;  4GVM A;  3VPZ A;  3FGU A;  1L3T A;  4BC2 A;  2NUB A;  4ZTF A;  1NJZ A;  2NRR A;  3E9P A;  3P38 A;  2P9S A;  3VF6 A;  2BDP A;  4FJI A;  4O8K A;  4JK9 A;  3R6M A;  4O8U A;  2KQ2 A;  3E1Y A;  4MLE A;  1S1T A;  1KFS A;  5C42 A;  4CJU A;  4CF1 A;  4AHU A;  3CXC M;  3H3O B;  5AFU H;  5FPD A;  1ITG A;  4W5R A;  4BDZ A;  1SKS A;  4HCC A;  1GLE G;  1YF5 L;  3F5T A;  4GKK K;  3O9T A;  2YHA A;  3QEW A;  5BRD A;  1NGH A;  3SI6 A;  4BY9 C;  1IJJ A;  4N47 A;  1TVR A;  1WSI A;  5AJ3 K;  2YX6 A;  5BPM A;  3LM2 A;  4YNQ A;  4F2R A;  4PUO A;  3DYA A;  3MDQ A;  3ATV A;  3CG7 A;  4O0I A;  3U9D A;  4UY8 O;  3TAF A;  4H0T B;  3CET A;  4BQL A;  2FC0 A;  3BF1 A;  1S72 N;  2D0B A;  3WNH A;  4RCH A;  4KHS A;  3ZT3 A;  3HI0 A;  3VMF B;  4BRD A;  1NGC A;  3KVG A;  4LF6 K;  1S1U A;  2HBJ A;  2HHS A;  2YV0 X;  4W5Q A;  4BDP A;  4BRN A;  5BR8 K;  3D2E A;  4JAX A;  4WYB A;  3QNO A;  2O4G A;  2A1R A;  4CZI A;  1S1V A;  1X9M A;  1DGK N;  4FVU A;  1GOC A;  2NRW A;  2RKI A;  4IOX A;  5AQZ A;  4AM7 A;  2ETJ A;  1C1A A;  1S9E A;  1IG8 A;  4KRE A;  3K5N A;  2P9I A;  3SNN A;  2ZJQ L;  1KAZ A;  3KD5 E;  4B1Y B;  2VG6 A;  5AZI A;  3SK3 A;  1GLB G;  3C0B A;  4JV5 K;  1JKH A;  1YTA A;  3H46 O;  1IO2 A;  4B9U A;  4B1Z A;  2VWK A;  2KKZ A;  2BAN A;  3EKS A;  3AVJ A;  4GVE A;  1IG9 A;  3NF9 A;  3I0S A;  4JKF A;  4CBW A;  1W2B M;  3GBT A;  4CZJ A;  3W3D A;  5E26 A;  1JCE A;  2KHO A;  3CER A;  4A59 A;  4YDU A;  4GV3 A;  5HRR A;  1XWL A;  3B6O A;  2OYQ A;  1XQS C;  4TSX A;  4WE1 A;  1OVY A;  2JWK A;  4BGA A;  3DXM A;  4WFN L;  5LMU K;  1ZYQ A;  4J2D A;  3QIO A;  1DTQ A;  4DR4 K;  4FLT A;  3P83 D;  1BCM A;  3UKR B;  2QEX N;  3QEX A;  3OYA A;  4FLX A;  4DB3 A;  3WNF A;  2O8E A;  1LW0 A;  1NMN A;  1TKD A;  2P1J A;  3KK2 A;  2G8I A;  3THY A;  1HKB A;  4H03 B;  3WUH A;  2FSN A;  4GV6 A;  1DT9 A;  3Q7B A;  3O8M A;  4ISE A;  1LAV A;  3K9K A;  1B9D A;  1WSF A;  4AQY K;  2W40 A;  1LWF A;  4CVN E;  2QI2 A;  4DTN A;  1BWF O;  1E3M A;  4L3Q A;  5DMR A;  3AV9 A;  3PIP L;  1VQ8 N;  4DS5 A;  2GEL A;  4ID1 A;  4IJA A;  1KVC A;  3CC4 N;  1ZXO A;  3SBG A;  3ULE B;  3CC7 N;  3OBY A;  4YOV A;  3NGZ A;  3SV4 A;  3AVG A;  3J7A P;  1HYV A;  4FJ8 A;  2YCH A;  3O08 A;  3QER A;  3EE8 A;  1HX1 A;  4HUE A;  2CGJ A;  4BRL A;  3MWT A;  4DHY A;  3BDP A;  3AVA A;  1RDA A;  4KBO A;  3CFP A;  4DFP A;  3TSP A;  4B3M K;  4V19 S;  4Z4E A;  4DTU A;  4WF9 L;  1MU2 A;  4DQS A;  1EP4 A;  5AQI A;  2RN2 A;  2QWR A;  4H8K A;  4PKH A;  1W9H A;  1NGA A;  4NCG A;  5I42 A;  4XH4 A;  1W7A A;  4BRP A;  2VWJ A;  3TAE A;  3TTF A;  4FWN A;  4DV5 K;  3QLH A;  3LPT A;  2X6N A;  1IBL K;  4CHN A;  1Q81 O;  4FJN A;  1HNX K;  1NK4 A;  1ZBS A;  4C8N A;  3TAG A;  1SQK A;  3MN6 A;  3OYF A;  1D8Y A;  4CER A;  1HYZ A;  2B6A A;  4BQZ A;  4K42 A;  4QS7 A;  4CJF A;  4FCY A;  3CJ9 A;  2XRI A;  3PO5 A;  5EY4 A;  2XO7 A;  3NBP A;  4Z4H A;  3AGK A;  3SZ2 A;  1EET A;  2O4I A;  2ZM6 K; 
#chains in the Genus database with same CATH homology
 2W6K A;  3EEQ A;  2W6L A;  3BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...