2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
3EEQA 2W6KA 3BY5A 2W6LA
chains in the Genus database with same CATH superfamily
2UXBK 1RT3A 4BE1A 1T03A 2P9NA 3BF1A 4LF7K 2ASPA 4FZXC 4M3YA 4CFAA 4C23A 4OLBA 3U8XA 2QK9A 2O8EA 2D0CA 3L2VA 2YKMA 3C65A 1XNRK 1U2VA 4H5TA 3LZJA 4CZJA 3O6WA 5AQVA 1QQCA 4IFVA 3DJCA 4JV5K 2E6MA 3N4PA 2ZGYA 2F96A 2ZJRL 4BVPA 4KV8A 4RWTA 3LDQA 4EHTA 1GOBA 4U7BA 2NRWA 3EL2A 4LF4K 4BDYA 4WFBL 2RHKA 3CCQN 5AZJB 3ZSRA 3O3FA 3MN5A 3DAWA 3EY1A 3KHYA 1QHTA 1ZC6A 3T1YK 1KTQA 1NM1A 3NFAA 1Z05A 2IC3A 1D9DA 4LSNA 5J1EA 3O9UA 5CE3A 2A42A 3SMPA 4DR5K 1RBSA 1S72N 3MAQA 2QWRA 3CF5L 2ATQA 2VCPA 2OZMA 2GTDA 3CERA 4ZTFA 3DMJA 2PBDA 2YNGA 3AVJA 4CFDA 4R5PA 2QWNA 4R79A 5SWMA 4J8FA 3TSUA 2E2OA 3ZSQA 4KHYA 1XC3A 4B1WB 1RT6A 3QBXA 4EFHA 3D0PA 4J2DA 3EYZA 1NK6A 2QWPA 2ZWHA 3QLHA 1CXUA 1ZBHA 4ID1A 5BRDA 5KRTA 5JLHA 1MA9B 4DUYK 1BI4A 1V4TA 4QS7A 3EKSA 3ENOA 4K8XA 4O5BA 1RILA 3G71N 5FPEA 4DU1A 5I42A 2NRTA 2PY5A 3ZEUB 4J2EA 1NU0A 3CJAA 1JCGA 4KHSA 1KSPA 3K57A 4BDZA 2JLEA 1CZBA 2YNFA 3L3VA 4B9NA 1LAWA 2ITMA 2QWOA 4K25A 3J7ZO 2YJFA 4FW2A 4DTPA 1XHZA 4H0PA 3QINA 4LF5K 2IGIA 1YJNN 3HOTA 3CFOA 2QWLA 1RFQA 1T6CA 2QM1A 1W97L 5AZIA 4DS5A 1IBLK 4CZLA 4E3SA 3DLRA 1S1TA 4A2BA 1B92A 2NRZA 1TYQB 3IMXA 4CEEA 3OYIA 1JJ2M 4NLCA 1NJYA 2FBVA 2ZQBA 1Y97A 5C24A 2OTLN 3MN9A 3AVFA 4CK3A 1NK0A 5AQGA 2P9KA 4HUGA 4FPAA 4B9LA 1KFSA 1CZAN 2KZMA 2HBMA 2GX9A 3MK6A 3L3UA 4CGIA 4JRPA 1IBMK 1TKDA 4HHTA 4XIUA 4WYBA 4GMJB 1G15A 1FXXA 3KK1A 3JXUA 4BROA 5TKYA 2QW9A 4E7JA 5HRSA 4GW6A 3AGKA 3ZT1A 2V51B 4RW6A 3H1VX 2HHTA 3VERA 1NOZA 2O8CA 3C7NB 4BRNA 5GAEP 1ZBFA 4H0XB 4GVMA 5KQDA 5BRFA 2Y1JA 4C8OA 3WNHA 5CHIA 1XNQK 4KAZA 2ASMA 5H1SQ 5J2NA 2FBYA 4DR1K 2XO7A 1RTHA 1ESVA 3LPUA 1U04A 4CZGA 5JVHL 1YHQN 1DGKN 2UUBK 4CEDA 4BRCA 2FXUA 4O8KA 1SQKA 1IKVA 4A2AA 2F8SA 3SNNA 4CJUA 3PSIA 3ASMA 1LW2A 3GL1A 3M5RA 4NYNA 4DR7K 3LP2A 3LP0A 1NGGA 4WF9L 3EE8A 4CHYA 1HX1A 3G6EN 4KTZA 3PIPL 3I8BA 5AZJA 1VQPN 1TKZA 4KH4A 1SKSA 2P5GA 4CERA 3CIPA 3DLHA 4OPJA 2E20A 3OYCA 3SJJA 2YHBA 4CCHA 2X78A 1YI2N 4AHCA 4HWIA 3D2EB 4CIFA 5HOOA 1KXPA 2VQEK 1D9FA 3PY8A 4FM1A 4CF1A 3ISNC 4KTQA 2G8IA 1DTQA 2KTQA 5BN8A 1QHAA 1BISA 5M1QA 4C1NI 4IBNA 3VQEA 1IH7A 1TL1A 3DRPA 3VQPA 1VSMA 3OYDA 1HNVA 3U9ZA 3H45C 4E0DA 2P9UB 3NGIA 1IKWA 2I7NA 3CYMA 1TK5A 4IDHA 3F2KA 1ASUA 1K8KB 3MEGA 3O9SA 4FCYA 3JSMA 1JKHA 3M8QA 1HYZA 3NVMA 4H03B 5FPDA 4I9LA 3KLFA 3GOIA 2IVNA 1K8AO 4YDUC 3HOSA 3SUQA 4LD0A 1J53A 2IDOA 3CCVN 5AQQA 4X65K 4FOIA 4CGGA 3MWTA 4M41A 3HSCA 3H3OB 3S3MA 2QWMA 1VHXA 4DR4K 1VQMN 5JVGL 2FF6A 1W0HA 2YCHA 4HTUA 4DS4A 4CFBA 4DV5K 2HVHA 4FJ8A 4H0YB 2W41A 5AR0A 1Z25A 1NGIA 3QICA 5HRNA 4W5RA 1HYVA 4JKCA 3SQ2A 4JKBA 1KFDA 4FYDA 3C95A 2FF3B 2D4WA 5E41A 4JEPA 1N32K 3SJHA 4FJJA 3OJUA 3NVKA 1NWKA 4K0KK 4B9MA 3ZT2A 1JLCA 1NJIO 3T19A 4JKAA 3EE9A 1VK0A 4DFMA 4JK8A 2O8BB 2XRIA 1ZXOA 2UUCK 1X9JA 4QS9A 1GOAA 3OYNA 3AVHA 2ZD1A 4E1JA 4FSVA 1Q9XA 1GLDG 3VQ4A 4F3OA 5KGXA 5BREA 3NCIA 2W42A 3AVGA 1N36K 4CJVA 1VQ6N 3B6OA 3ID8A 4CJQA 5MLCQ 1LOTB 3AA2A 1HMVA 3VPZA 4YFUA 2HMPA 4GV3A 3SBTA 1R59O 3M3ZA 4FVUA 2F9TA 1N6QA 3NDKA 1JXBA 3RMBA 3LDNA 1HRHA 4E7HA 3MWPA 3IKMA 3DOLA 1OVYA 3OYAA 1NMNA 3G4SN 5C42A 3V81A 2A40A 3VGKA 3WQUA 3QEWA 4DSLA 4DQSA 3OY9A 2O4IA 3TAGA 3THVA 1TK8A 4PY5A 2HBJA 2DFEA 2W6LA 4JN4A 5LMNK 4N41A 4Z4IA 1ILYA 3FE1A 4N47A 3QDKA 1REVA 4DHYA 4H4OA 5AQRA 3AVCA 1UA1A 3CCJN 1L5UA 4B9TA 4O4GA 3MDQA 4CJWA 3A5LC 4YOUA 2CGJA 4FJLA 4OJRA 4KREA 3NH1A 2BUPA 3RWUA 4FJNA 5BPNA 3WEEA 5HP1A 1KCFA 1YXQA 4LY7A 3ZSXA 1NKEA 3WXLA 2GELA 3PO5A 3BUZB 2NRHA 3MCAB 4CEOA 3J7AP 4KB0A 5FPMA 3M8RA 2HHSA 4FWPA 3KLIA 3BF3A 1FJGK 3M6GA 4H4MA 2NRXA 2LSNA 1S1VA 4CZFA 1FKOA 3OYKA 3TAPA 3CQXA 3OYGA 3VETA 5EX5A 3TAQA 3TAFA 2ZGZA 4MFBA 1BA0A 4CK2A 2OYQA 4JAXA 2O4GA 4BG9A 1C6VA 1Q9YA 3LPTA 2QA4N 1BG3A 2Z1IA 2WFBA 3GDQA 4F8RA 1JLAA 4NB4A 3GG4A 4EZ9A 4N5SA 2D0AA 1E3MA 2BANA 3WQTA 3LZIA 3WNFA 4FK0A 2ZJPL 3LL3A 3SV3A 2P9UA 3AO4A 4PWDA 3AO5A 3SAFA 5F1XA 1VSJA 4EZ6A 1K8KA 4CEQA 3I55N 4RTFD 2UUAK 1IJJA 5D3GA 3AY9A 3WXJA 4PHTX 1GLJO 2FSNA 4WQ4A 1VSIA 4FJMA 2GBZA 1OH5A 4HTLA 2HHWA 2YHXA 1VRTA 1V4SA 3LALA 3O9RA 3U9DA 3MMVA 1OVQA 1TAQA 4HVJA 4E1NA 4DU3A 3UIQA 3VGLA 4IJAA 4CVNE 1RBVA 3WT0A 4B8CA 2UXDK 4X64K 4Z0UA 2VGMA 1IKYA 1UA0A 3ULEA 3ZSVA 1WSJA 4M7YA 3QNOA 1RBUA 1GLBG 4JK9A 2JWKA 4BR9A 1TV6A 3HVTA 3MEDA 1NGAA 2G8KA 4PQUA 3V9UA 3O9QA 4LC9B 3TAMA 3NF9A 4NYFA 5DM6L 4DLGA 1JLQA 4LFAK 2GUPA 2O8BA 4JKGB 3M1FA 4BRIA 4RW9A 2IIRA 3V1QA 3K9KA 3R8EA 4WQ5C 3CQ8A 5HROA 4MO4A 3K0SA 4E7KA 1WOQA 2YHAA 3PUFA 3LDPA 4MDBA 3HI0A 3PIOL 4CFCA 1T44A 1Q8IA 5AQZA 4JKEA 3SPYA 1BIZA 4GNIA 4C8MA 2PYLA 3DM2A 1RBRA 3I0SA 4DSIA 3VMFB 3IUCA 1CLQA 1YVUA 3ZLJA 4NCAA 4BE2A 5AFUH 3AAPA 1F21A 4M63C 3OYLA 4BRDA 3ENHA 4NXMK 3MX2A 4IFYA 1Q81O 4B1UB 4DR3K 3CCEN 4B3SK 4JK7A 1GLAG 4CGDA 3VEYA 3KLHA 2IVOA 3H3NO 4WFAL 4GV6A 3A0IX 4DV2K 2A1SA 3O1BA 4QOZB 1JXEA 2B4JA 2ITGA 4LFCK 2HNDA 1P8ZA 3F9KA 4RCHA 4MLEA 4JKDA 4M3ZA 5C2FA 4RW4A 4CHQA 4CJTA 4CZEA 3A8YA 5AQYA 3HRGA 4IWVA 2YX6A 1YT3A 3QESA 4A62A 1X9SA 4BRMA 1QQOA 2P9LB 4CI6A 4EP4A 2DY4A 2ZJQL 4KRFA 2V7ZA 3VN5A 1SKWA 4O0IA 3QIOA 3GE1A 3TWHA 1IBKK 2E1ZA 3QFUA 3NGZA 2X74A 3WNEA 3ZETB 1XI1A 1NGBA 2A1RA 3C6HA 4CEFA 4DTSA 3TI0A 3N4QA 3CM6A 4FLUA 2KFNA 4CF9A 3O80A 3O3GA 1VAZA 1A5XA 4E89A 3BDPA 1Q82O 4FK2A 4XH4A 1MDUB 2HF3A 1WSGA 3K5NA 2F8TA 4DQPA 4CBUA 4B08A 4CZHA 3BY5A 3E1YA 4CJKA 1IV0A 3HL8A 2VYPA 4BQZA 4X66K 3WUHA 2YJEA 1YITN 3HVRA 4CD3A 1BU6O 3HM8A 1NMDA 1SV5A 1VSLA 1MWMA 3F5TA 3I33A 4PKIA 4O0JA 3P31A 3QFPA 4HCBA 1A5VA 4U67L 3NAEA 1MWKA 4KPYA 3ENBA 4LF8K 1NGFA 5IWAK 3CCMN 2V52B 3VTHA 3KIOA 4IDKA 2XY6A 1BCOA 3RTVA 3D45A 4OKEA 4CJEA 4RW7A 3RVCA 3CHWA 1S3XA 1OH7A 1BIUA 4M3TA 3OW2M 1QVGM 4BVOA 2A5XA 2AA4A 1XUPO 1TUYA 4O8UA 1D8YA 4FK4A 3WNGA 1U47A 4FPBA 4UY8O 4J2AA 4N76A 1VRUA 2RKIA 4KFBA 4MO5A 3H46O 4CJPA 2O8FB 3EZWA 4Z4GA 1VQNN 3AVNA 4LH4A 4DB3A 3VF6A 4JKGA 4CF2A 2VQFK 3KK3A 1QSSA 1K6YA 4DQRA 3B8AX 4KTWA 4JI8K 4J2BA 1TUUA 3OVNA 4DQ8A 1DEJA 4BC4A 3DOKA 3AV9A 4DR6K 4JS5A 4B1VA 1BO5O 4BY9C 4BR4A 4M45A 5K14A 3L2QA 3SV4A 3FLCO 4DV4K 1C1BA 2FSJA 1S9EA 1NKCA 3AA4A 4I6MA 1XMQK 4OX9K 4I2QA 3AARA 4YORA 3VEVA 4B3OA 5TKWA 1J6ZA 1SL1A 3NH0A 3P1GA 1J9AA 3T1HK 3MXJA 1LWEA 4DV7K 4BACA 3P38A 1VQ5N 5ADXH 4F2RA 3SQ1A 1NK5A 1SZ2A 1RDCA 4CE9A 3S9HA 1RBTA 2E8AA 1WSFA 3S3OA 3CG7A 3RSEB 1I39A 3LDOA 4CHOA 3H6EA 4FJHA 2PZSA 5J2PA 2G8FA 4AF1A 1QZ6A 1M90O 3K5MA 5KTQA 1Q86O 1TK0A 3I56N 4RG8A 3CM5A 4M7XA 2BE2A 2VG6A 3E9OA 4CJ3A 1YTUA 5ADXA 3THYB 2ZE2A 4WFNL 3CI5A 3CFRA 4B9SA 4H5VA 1U48A 1E4GT 3T3FA 4KHQA 1RT7A 2EX3A 3HBTA 4Y1CA 4AH9A 4TSXA 1FKPA 3A5NC 1WLJA 2VGNA 3VOVA 4E19A 1TAUA 1GLFO 3DLKA 4M3UA 4AILC 4CEBA 3ZETA 1NJZA 1JLEA 4YY3K 4DSJA 3CCUN 4DTJA 2DFHA 4B1XB 3U6FA 2E4LA 4JKHA 4I9QA 1C0GA 1A5WA 5AQKA 4AHSA 1O1WA 1RTJA 2WOMA 4JRQA 3DLEA 4B8AB 4K8ZA 3HO1A 4QAGA 3SYZA 4C8KA 2R7YA 2DTUA 3LWMA 3NMUA 4PKGA 3J81O 3LM9A 1KVAA 3T7ZA 1KAYA 4DTNA 4XEIA 4FJ9A 2I5JA 1RDBA 1NBWA 4H5NA 1NGEA 5AQWA 2Z1HA 3OA9A 3L6QA 4KI4A 2FSKA 3CC4N 2CGKA 2H3GX 3K5LA 1TKXA 1U49A 3RRHA 1S5JA 4Y0WA 3QIPA 2KKZA 3NHGA 1YVNA 2HNYA 3Q7CA 5F0XA 2FBXA 1NGJA 4ISFA 4AM7A 2PYJA 4KB1A 2YHYA 3CC2N 3HJFA 1EWRA 4CECA 1Z26A 4DR2K 5HRPA 4B3RK 3UB5A 2VG5A 3KVGA 1VQ4N 2BH1A 3VQDA 3KWIA 1HNIA 1KD1O 3ZEUA 1RT4A 2IS3A 3ZCMA 1YF5L 4CGFA 4OKJA 3V4IA 5KI6A 4ILJA 4GY2B 1D5AA 2NNWA 4PL7A 5AQOA 1HLUA 3NGYA 4ZTJA 1UOCA 4CGJA 2FBTA 5I3UA 4IG0A 1T05A 2E2NA 3KZBA 2Q97A 2WTUA 1IG8A 1I94K 4DLEA 2O8FA 3RMCA 3KD1E 4ICLA 1RTIA 4W5TA 3TTDA 1LW0A 3P5JA 2EHGA 3G10A 1EWQA 4NCGA 4O5FA 1TYQA 1HNXK 4BRAA 2O8DB 3EZ5A 2KLAA 2Q36A 3IDHA 1ATSA 3D2FB 3FZKA 4B1YB 3K58A 2QKBA 3SBGA 3AGRA 3I8DA 1OKJA 4ELUA 2AJQA 1M1KO 4JYAK 4H0TB 1DT9A 2CH6A 3J80O 3T1AA 5I9EB 3S41A 3V9ZA 1T3VA 1HJOA 4YOXA 1B9FA 3CPEA 4KHUA 4MLHA 3O5BA 3OS0A 5AQFA 1VSKA 1VQ9N 4OKKA 5BR8K 3D6RA 3AVBA 1NK8A 3C7NA 5CYMA 3KKRA 4CJ5A 3OYFA 3PX4A 2XY8A 2XY7A 1OH8A 5CR4A 4DFKA 4PKHA 3K59A 5FLXO 4AM6A 3BGRA 5M1PA 5AQNA 4HUEA 1K73O 2D0BA 3AO3A 5GAGP 1NGHA 3QB0A 3TTFA 4ISEA 2X6SA 1EXQA 4BGAA 1WSHA 4C1NK 4FLVA 3RSEA 1YUWA 1HKGA 3L0QA 1KVCA 4LH5A 1BQNA 2UYTA 4A57A 5CZ1A 1HNWK 3S3NA 3P4IA 4DQQA 3FZFA 3TU5A 3V1RA 3V9WA 3R1XA 1W9HA 2HNZA 2P9PB 2E88A 5DM7L 4I2PA 2HOEA 3NBPA 1GOCA 3DLBA 3THYA 4X62K 3BP8A 2O8EB 3QERA 4F9OA 5EXWA 4EAHD 3JYTA 2QXFA 4HUFA 4CJSA 1WSIA 3SUOA 4KHNA 1RGIA 3R9PA 4DFPA 3VEXA 4FLXA 3QNNA 1HPMA 1NGCA 4CBWA 4DV3K 4IZ9A 1HNZK 3DYAA 2NZTA 4F2SA 3IRXA 1NG9A 3O4WA 3ZT3A 2KW4A 4GKJK 4Z4HA 4E7LA 4C8NA 1VSEA 2ASOA 3D2EA 5AQTA 3FFKB 5HLFA 3PLAA 5M1KA 4FLWA 1UWBA 3R3LA 2HBLA 3K5OA 1TKTA 3CMEN 1VQ7N 3HP9A 2KZZA 1ZYQA 3ZSZA 1S1WA 3OTOK 2HHUA 3TTCA 3QEVA 1KLMA 2OPSA 5E26A 1JCEA 3AA5X 3FZHA 4JKFA 3O9TA 1YTAA 5GIOA 4Z4CA 4CZIA 1NJWA 4WE1A 2YI1A 4DWIA 4OO1J 1HQEA 4YOWA 3VQ9A 3KK2A 3A5OC 4QS8A 3VF4A 2P51A 4GV9A 5AQJA 2ZM6K 3VQQA 5AQXA 4BC5A 2HHQA 5DMRA 1QS4A 4Z94A 5C0YA 5LL6Z 3TANA 3THWB 3EEQA 3KK7A 1VSFA 1S1XA 3OYEA 1BI4B 2YHWA 4IXCA 2E2PA 3B6PA 3V9SA 3PV8A 5AJ3K 2VG7A 1NKBA 3ZX2A 4NLBA 3CFPA 1BOTO 4H0OA 4CBXA 3UKRB 5EOYA 2DFFA 3RR7A 1QQMA 2OZSA 5HL7L 4CHPA 2O8DA 1X9WA 3KLEA 4M3XA 1QVFM 1KRPA 4BRHA 2YNIA 3DWLA 3CCRN 3RMDA 5GINA 3RR8A 1L3UA 4FJIA 2J4RA 2WUSA 3P83D 1ASWA 3D2FA 1JL2A 3M8PA 1BGXT 3ZX3A 4JNEA 1X9MA 1SL0A 1NK4A 1L3TA 4JI1K 1EO1A 1EETA 2JGUA 4B9QA 4JI5K 4N56A 5AQPA 1DTTA 4ID5A 3ZT0A 1KC8O 3DI6A 2RF2A 1KVBA 2FLOA 4KH6A 2P9KB 5B8HA 4JD2B 1P90A 4A61A 4LF6K 4IEEA 3WXMB 4A59A 3SAHA 4ELVA 3LDLA 2VWKA 3ZYYX 1NJXA 2AP1A 1J5OA 1U4BA 4DTMA 1S9GA 4OPHA 3SI6A 3ID6A 1TVRA 1S22A 3CXCM 4FJXA 2UU9K 1RCHA 1QSLA 3KD5E 3HTVA 4OPKA 1E4FT 5KGWA 3KLGA 3HT3A 3FR0A 3AA3A 3QMLA 2F7TA 1RNHA 4YOYA 3VQCA 3VESA 3HXMA 5AFUA 4B9VA 4BR7A 2P9SB 3SMSA 4OPAA 1D4XA 3QBWA 1W7AA 5JICA 4BRLA 3OYMA 1XQSC 4BR2A 2P9PA 2GV9A 4BRKA 5JLFA 5GIPA 5C15A 4BR5A 1BCMA 5BPLA 1HR0K 1J5EK 1HPZA 2KHOA 3HPHA 4Z4FA 2WONA 5DK5A 5KRSA 4DG1A 3LWLA 3NE6A 4CJFA 3VQ6A 3UE5A 1YAGA 3QEIA 1XHXA 1CZ9A 1X3MA 3VENA 1BHLA 4FXDA 2G8UA 2HMIA 5BR9A 5JS1A 3DXMB 4DTOA 2BDPA 3M8SA 1X3NA 4GVEA 3PX0A 2A41A 3EKUA 4A5AA 3O08A 3OS1A 1TL3A 1SAZA 2OA8A 1H1VA 4BRGA 1ZBUA 4KO0A 3AVKA 4H5RA 3AVMA 3CJBA 4M3RA 3TARA 1JCFA 1I3AA 4DSEA 4WQ4C 2OCEA 2WC9A 2NLXA 4CHZA 1YJ9N 2EWSA 4FWSA 3CETA 3IS9A 5FRNA 1T6DA 4L3QA 1EQYA 1LWFA 5LMUK 4LF9K 3TSPA 1QQNA 2E6LA 5M1FA 3IAYA 1RDAA 1DLOA 3PSFA 3W3DA 1SL2A 3Q7BA 4V19S 2CH5A 5LJWA 1XWLA 2Z1JA 3QEPA 4BC3A 3G25A 2YNHA 3PO4A 2B6AA 4JI4K 3LM2A 4FJGA 2YV0X 1Z6RA 1O13A 4RW8A 3V9XA 3AO2A 3L2WA 1EP4A 4DF4A 3EO3A 4FLZA 3HPGA 1JLGA 3LAMA 3CJ1A 1KLNA 3TABA 3KKSA 4OGCA 4FWOA 2P5OA 4CF0A 2PAVA 3THWA 3MECA 4Y1DA 5C25A 4K43A 3HZ6A 3AAQA 1NK7A 5M1OA 3LP1A 2HSTA 3L2RA 1RDWX 3H1QA 5AQIA 2G8WA 1WNSA 3WXKA 3AVLA 4AHVA 3CCSN 4CJLA 3F73A 1BQMA 4DFJA 4YOVA 2UXCK 2GUIA 4FO0A 4I7FA 2P1JA 3MXMA 4KHPK 4BC2A 3U3GA 4CIGA 4KKOA 4H0VB 3UKRA 1HKBA 2FC0A 1C0UA 3QO9A 3OJSA 1XC9A 4K41A 4L8RB 1FW6A 2WBNA 4CJRA 3OYHA 4JI3K 1WN7A 3CJ9A 2BTFA 4YDUA 5FPNA 3NF7A 5C2DA 4UQGA 4EIAA 1WAJA 5KPZA 1S6PA 3C6UA 1ASVA 2HHXA 3F9MA 4FLYA 4YNQA 4CK1A 2GWKA 4NCBA 5BRHA 3CD6N 4WCEL 3PX6A 1Y64A 3SCXA 1BL3A 2E5LK 4B3TK 1T7PA 4JD2A 3O4NA 3SPZA 2KQ2A 3LAKA 3FGUA 5KQ8A 3SUNA 4LFBK 4K42A 2NRVA 3DXKB 1G99A 1BDGA 4JI6K 2HF4A 4IOAL 3KJVA 4JLHA 1IO2A 2RPIA 3I0RA 4IO9L 2PFUA 4CIEA 4A5BA 4DSKA 3C6TA 3QETA 5A2QO 2OANA 2QI2A 5FDLA 5AQHA 2D5RA 3NF6A 4FJ7A 5SZTA 2P9SA 1YIJN 3CPWM 3ATVA 1C1CA 5JMVA 2XY5A 3VQ5A 2GWJA 1JL1A 1S6QA 4DSFA 2G8VA 4ISGA 4IKFA 2P9LA 3TR8A 1C1AA 4CZKA 3AVIA 2D1KA 4ZHRA 2HB5A 2NUBA 4CZMA 3CC7N 4M3WA 1WAFA 3UKUB 1NK9A 4FL9A 3WXIA 2W40A 1LV5A 4EP5A 1IG9A 1ATNA 1NOYA 3C0BA 3V6DA 3WEEB 1FK9A 3NF8A 1VQKN 2HW3A 3SLCA 1WBDA 3RMAA 1RT2A 4JI7K 3TPQA 3SQ4A 4KH5A 1XMOK 3IFRA 3DXMA 3ALYA 4MDAA 5CZ2A 4W5QA 2HHVA 4Q5VA 2IAJA 2RN2A 4B9UA 2P9IB 2OPRA 4YOTA 4DCHA 3OYBA 1NGDA 4CJ4A 4IOCL 2Q3SA 3C6AA 4BG8A 3CJ7A 4CEZA 3E01A 3D7EO 4DQIA 2OPPA 1QE1A 4CGHA 2E2QA 1JLBA 4IO8A 1YJWN 3ITHA 1VQLN 4W5NA 3MX5A 4EHUA 4DV6K 3VTIA 3ULDA 3HP6A 3R6MA 5FROA 4DV0K 3OYJA 4XH1A 3JS6A 3ZSYA 1TGOA 2Q0RA 1RT1A 2IVPA 3VA0A 3ATUA 2Q0UA 1L3SA 4DTUA 3VQ8A 3FFIA 2IOCA 4FWQA 5BN9A 1ZBSA 4C8LA 3CMAN 3VEWA 3QEXA 4IFEA 4AHUA 4FOEA 1K9MO 4CHNA 4DKWA 5C12A 3O3HA 5KPTA 1LWCA 3LANA 2QXLA 5JS2A 3O4QA 4HCCA 1NNEA 1JLFA 5EVZA 4JHDB 4AHTA 2A3ZA 1RDDA 3MN6A 3SK3A 4DMNA 1KQSM 4FZZA 3L4IA 2KFZA 5AQMA 5C10A 3GBTA 2XHBA 4G9ZA 3ULEB 4FJKA 1EX4A 4IG3A 4E7IA 4CW7B 5ELZA 1EKEA 1HYSA 3DRSA 1S1UA 2X6NA 4DTXA 5E84A 3LP3A 3TSQA 5EU7A 4BR0A 3V1OA 2ZF5O 4DF8A 1WB9A 4QCLA 4IOXA 3HK2A 3CCLN 1GLEG 2D0PA 1VSDA 1ZBLA 2G8HA 4ILHA 3SAGA 2QWQA 3FZLA 3J8AA 1T8EA 2QEXN 3K2PA 1HJRA 1N8RO 1VQ8N 5AQLA 4B1ZA 1SKRA 1IKXA 3U3YA 5CY4A 3VEOA 4FZYA 5T7BA 2I7PA 4ILGB 3DXKA 4CJ7A 1HKCA 2W6KA 1BA1A 4NO7A 3C94A 3E9PA 4OLAA 2Z1GA 3G0ZA 5AQUA 1WBBA 3VEZA 1ATRA 4IEIA 3ZSWA 1HUXA 4WQ5A 2OTJN 3THXB 3OBYA 3HPOA 4F3TA 3JAMO 5HRRA 2Q31A 4F4KA 1QSYA 4H8KA 4KI6A 4OGEA 3OS2A 2P9NB 3L2UA 4FLTA 4E1MA 4CF8A 2HBKA 2Q2RA 1VSHA 1U2VB 3EN9A 4KHWA 3L8BA 4Q0BA 5F2RA 3UKUA 4FWRA 4O44A 5AQSA 4PA1A 5GADP 5IT9O 4FWNA 3MXIA 2GEMA 1RTDA 4FM2A 4H5WA 1X1PA 2QTDA 4Z4EA 1DKGD 3ZX0A 4FWLA 2JWLA 4BWJA 2QKKA 1R0AA 5M1NA 2E1YA 4BRPA 2P9IA 3VQ7A 3J7YP 3CQYA 3T69A 1KAZA 4FWKA 1GLLO 1J54A 1NLVA 3E9LA 1C0MA 1LCUA 4AHRA 3MN7A 3E66A 5LJVA 2HHHK 4O55A 1N34K 1CXQA 3LDSA 1UAXA 2CGLA 4OVLA 2RE2A 3W0LA 3K9JA 4B3MK 3VQBA 3ZT4A 1LAVA 5EY4A 2HVIA 1OH6A 3DLLL 3FZMA 1SS6A 1C0TA 5CYQA 5BPMA 3HSTB 3VGMA 1Q18A 3SQ0A 2Q1NA 3KWGA 4DUZK 3HM9A 4XH5A 1SUQA 1C0FA 2F4VK 3MCPA 5GAHP 3VA3A 4BGBA 3HYFA 4FVMA 4CESA 1VQON 5J2QA 2ETJA 4BE0A 3O8MA 4BQLA 2D0OA 3DRRA 3VQAA 2Y1IA 1QZ5A 4BWMA 1WUAA 4JHDA 3BZCA 1WSEA 5LY3A 4PUOA 3OHRA 3CJCA 3TAEA 3MEEA 4FW1A 1RT5A 4M42A 4FWMA 2YKNA 1GLCG 2DPNA 4MQ3A 2VWBA 3OBWA 1W2BM 1HQUA 4BREA 3A2FA 1N5YA 1U45A 5AZIB 3U4LA 1QTMA 4NXNK 1B9DA 4JS4A 4GKKK 2OPQA 4PL8A 4CEAA 4DU4A 4CD1A 3SUPA 3VF2A 1BWFO 4IJNA 5HBMA 4KBOA 3IG1A 2VWJA 4FJ5A 4W5OA 1U6ZA 3BEXA 3O1WA 2BGGA 4BRFA 4ELTA 4LSLA 4DTRA 1ITGA 4BRQA 1RDUA 1Q7YO 4FM0A 3SZ2A 4JI2K 4YHHK 1ZBIA 4I6MB 2A6AA 1KAXA 5KPRA 5FRMA 4JI0K 3RRGA 1L3VA 3P39A 3H08A 2NRRA 2O8CB 1BUPA 3DLGA 3KTQA 2B5JA 2F9WA 3BZKA 3A5MC 5J2MA 3AO1A 3ZSOA 3NH2A 1MU2A 4G1QA 4BDPA 4AQYK 3THXA 2V7YA 3AVAA 3L4QA 1N33K 4DV1K
chains in the Genus database with same CATH topology
3EEQA 2W6KA 3BY5A 2W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEQ A;  2W6K A;  3BY5 A;  2W6L A; 
#chains in the Genus database with same CATH topology
 2UXB K;  1RT3 A;  4BE1 A;  1T03 A;  2P9N A;  3BF1 A;  4LF7 K;  2ASP A;  4FZX C;  4M3Y A;  4CFA A;  4C23 A;  4OLB A;  3U8X A;  2QK9 A;  2O8E A;  2D0C A;  3L2V A;  2YKM A;  3C65 A;  1XNR K;  1U2V A;  4H5T A;  3LZJ A;  4CZJ A;  3O6W A;  5AQV A;  1QQC A;  4IFV A;  3DJC A;  4JV5 K;  2E6M A;  3N4P A;  2ZGY A;  2F96 A;  2ZJR L;  4BVP A;  4KV8 A;  4RWT A;  3LDQ A;  4EHT A;  1GOB A;  4U7B A;  2NRW A;  3EL2 A;  4LF4 K;  4BDY A;  4WFB L;  2RHK A;  3CCQ N;  5AZJ B;  3ZSR A;  3O3F A;  3MN5 A;  3DAW A;  3EY1 A;  3KHY A;  1QHT A;  1ZC6 A;  3T1Y K;  1KTQ A;  1NM1 A;  3NFA A;  1Z05 A;  2IC3 A;  1D9D A;  4LSN A;  5J1E A;  3O9U A;  5CE3 A;  2A42 A;  3SMP A;  4DR5 K;  1RBS A;  1S72 N;  3MAQ A;  2QWR A;  3CF5 L;  2ATQ A;  2VCP A;  2OZM A;  2GTD A;  3CER A;  4ZTF A;  3DMJ A;  2PBD A;  2YNG A;  3AVJ A;  4CFD A;  4R5P A;  2QWN A;  4R79 A;  5SWM A;  4J8F A;  3TSU A;  2E2O A;  3ZSQ A;  4KHY A;  1XC3 A;  4B1W B;  1RT6 A;  3QBX A;  4EFH A;  3D0P A;  4J2D A;  3EYZ A;  1NK6 A;  2QWP A;  2ZWH A;  3QLH A;  1CXU A;  1ZBH A;  4ID1 A;  5BRD A;  5KRT A;  5JLH A;  1MA9 B;  4DUY K;  1BI4 A;  1V4T A;  4QS7 A;  3EKS A;  3ENO A;  4K8X A;  4O5B A;  1RIL A;  3G71 N;  5FPE A;  4DU1 A;  5I42 A;  2NRT A;  2PY5 A;  3ZEU B;  4J2E A;  1NU0 A;  3CJA A;  1JCG A;  4KHS A;  1KSP A;  3K57 A;  4BDZ A;  2JLE A;  1CZB A;  2YNF A;  3L3V A;  4B9N A;  1LAW A;  2ITM A;  2QWO A;  4K25 A;  3J7Z O;  2YJF A;  4FW2 A;  4DTP A;  1XHZ A;  4H0P A;  3QIN A;  4LF5 K;  2IGI A;  1YJN N;  3HOT A;  3CFO A;  2QWL A;  1RFQ A;  1T6C A;  2QM1 A;  1W97 L;  5AZI A;  4DS5 A;  1IBL K;  4CZL A;  4E3S A;  3DLR A;  1S1T A;  4A2B A;  1B92 A;  2NRZ A;  1TYQ B;  3IMX A;  4CEE A;  3OYI A;  1JJ2 M;  4NLC A;  1NJY A;  2FBV A;  2ZQB A;  1Y97 A;  5C24 A;  2OTL N;  3MN9 A;  3AVF A;  4CK3 A;  1NK0 A;  5AQG A;  2P9K A;  4HUG A;  4FPA A;  4B9L A;  1KFS A;  1CZA N;  2KZM A;  2HBM A;  2GX9 A;  3MK6 A;  3L3U A;  4CGI A;  4JRP A;  1IBM K;  1TKD A;  4HHT A;  4XIU A;  4WYB A;  4GMJ B;  1G15 A;  1FXX A;  3KK1 A;  3JXU A;  4BRO A;  5TKY A;  2QW9 A;  4E7J A;  5HRS A;  4GW6 A;  3AGK A;  3ZT1 A;  2V51 B;  4RW6 A;  3H1V X;  2HHT A;  3VER A;  1NOZ A;  2O8C A;  3C7N B;  4BRN A;  5GAE P;  1ZBF A;  4H0X B;  4GVM A;  5KQD A;  5BRF A;  2Y1J A;  4C8O A;  3WNH A;  5CHI A;  1XNQ K;  4KAZ A;  2ASM A;  5H1S Q;  5J2N A;  2FBY A;  4DR1 K;  2XO7 A;  1RTH A;  1ESV A;  3LPU A;  1U04 A;  4CZG A;  5JVH L;  1YHQ N;  1DGK N;  2UUB K;  4CED A;  4BRC A;  2FXU A;  4O8K A;  1SQK A;  1IKV A;  4A2A A;  2F8S A;  3SNN A;  4CJU A;  3PSI A;  3ASM A;  1LW2 A;  3GL1 A;  3M5R A;  4NYN A;  4DR7 K;  3LP2 A;  3LP0 A;  1NGG A;  4WF9 L;  3EE8 A;  4CHY A;  1HX1 A;  3G6E N;  4KTZ A;  3PIP L;  3I8B A;  5AZJ A;  1VQP N;  1TKZ A;  4KH4 A;  1SKS A;  2P5G A;  4CER A;  3CIP A;  3DLH A;  4OPJ A;  2E20 A;  3OYC A;  3SJJ A;  2YHB A;  4CCH A;  2X78 A;  1YI2 N;  4AHC A;  4HWI A;  3D2E B;  4CIF A;  5HOO A;  1KXP A;  2VQE K;  1D9F A;  3PY8 A;  4FM1 A;  4CF1 A;  3ISN C;  4KTQ A;  2G8I A;  1DTQ A;  2KTQ A;  5BN8 A;  1QHA A;  1BIS A;  5M1Q A;  4C1N I;  4IBN A;  3VQE A;  1IH7 A;  1TL1 A;  3DRP A;  3VQP A;  1VSM A;  3OYD A;  1HNV A;  3U9Z A;  3H45 C;  4E0D A;  2P9U B;  3NGI A;  1IKW A;  2I7N A;  3CYM A;  1TK5 A;  4IDH A;  3F2K A;  1ASU A;  1K8K B;  3MEG A;  3O9S A;  4FCY A;  3JSM A;  1JKH A;  3M8Q A;  1HYZ A;  3NVM A;  4H03 B;  5FPD A;  4I9L A;  3KLF A;  3GOI A;  2IVN A;  1K8A O;  4YDU C;  3HOS A;  3SUQ A;  4LD0 A;  1J53 A;  2IDO A;  3CCV N;  5AQQ A;  4X65 K;  4FOI A;  4CGG A;  3MWT A;  4M41 A;  3HSC A;  3H3O B;  3S3M A;  2QWM A;  1VHX A;  4DR4 K;  1VQM N;  5JVG L;  2FF6 A;  1W0H A;  2YCH A;  4HTU A;  4DS4 A;  4CFB A;  4DV5 K;  2HVH A;  4FJ8 A;  4H0Y B;  2W41 A;  5AR0 A;  1Z25 A;  1NGI A;  3QIC A;  5HRN A;  4W5R A;  1HYV A;  4JKC A;  3SQ2 A;  4JKB A;  1KFD A;  4FYD A;  3C95 A;  2FF3 B;  2D4W A;  5E41 A;  4JEP A;  1N32 K;  3SJH A;  4FJJ A;  3OJU A;  3NVK A;  1NWK A;  4K0K K;  4B9M A;  3ZT2 A;  1JLC A;  1NJI O;  3T19 A;  4JKA A;  3EE9 A;  1VK0 A;  4DFM A;  4JK8 A;  2O8B B;  2XRI A;  1ZXO A;  2UUC K;  1X9J A;  4QS9 A;  1GOA A;  3OYN A;  3AVH A;  2ZD1 A;  4E1J A;  4FSV A;  1Q9X A;  1GLD G;  3VQ4 A;  4F3O A;  5KGX A;  5BRE A;  3NCI A;  2W42 A;  3AVG A;  1N36 K;  4CJV A;  1VQ6 N;  3B6O A;  3ID8 A;  4CJQ A;  5MLC Q;  1LOT B;  3AA2 A;  1HMV A;  3VPZ A;  4YFU A;  2HMP A;  4GV3 A;  3SBT A;  1R59 O;  3M3Z A;  4FVU A;  2F9T A;  1N6Q A;  3NDK A;  1JXB A;  3RMB A;  3LDN A;  1HRH A;  4E7H A;  3MWP A;  3IKM A;  3DOL A;  1OVY A;  3OYA A;  1NMN A;  3G4S N;  5C42 A;  3V81 A;  2A40 A;  3VGK A;  3WQU A;  3QEW A;  4DSL A;  4DQS A;  3OY9 A;  2O4I A;  3TAG A;  3THV A;  1TK8 A;  4PY5 A;  2HBJ A;  2DFE A;  2W6L A;  4JN4 A;  5LMN K;  4N41 A;  4Z4I A;  1ILY A;  3FE1 A;  4N47 A;  3QDK A;  1REV A;  4DHY A;  4H4O A;  5AQR A;  3AVC A;  1UA1 A;  3CCJ N;  1L5U A;  4B9T A;  4O4G A;  3MDQ A;  4CJW A;  3A5L C;  4YOU A;  2CGJ A;  4FJL A;  4OJR A;  4KRE A;  3NH1 A;  2BUP A;  3RWU A;  4FJN A;  5BPN A;  3WEE A;  5HP1 A;  1KCF A;  1YXQ A;  4LY7 A;  3ZSX A;  1NKE A;  3WXL A;  2GEL A;  3PO5 A;  3BUZ B;  2NRH A;  3MCA B;  4CEO A;  3J7A P;  4KB0 A;  5FPM A;  3M8R A;  2HHS A;  4FWP A;  3KLI A;  3BF3 A;  1FJG K;  3M6G A;  4H4M A;  2NRX A;  2LSN A;  1S1V A;  4CZF A;  1FKO A;  3OYK A;  3TAP A;  3CQX A;  3OYG A;  3VET A;  5EX5 A;  3TAQ A;  3TAF A;  2ZGZ A;  4MFB A;  1BA0 A;  4CK2 A;  2OYQ A;  4JAX A;  2O4G A;  4BG9 A;  1C6V A;  1Q9Y A;  3LPT A;  2QA4 N;  1BG3 A;  2Z1I A;  2WFB A;  3GDQ A;  4F8R A;  1JLA A;  4NB4 A;  3GG4 A;  4EZ9 A;  4N5S A;  2D0A A;  1E3M A;  2BAN A;  3WQT A;  3LZI A;  3WNF A;  4FK0 A;  2ZJP L;  3LL3 A;  3SV3 A;  2P9U A;  3AO4 A;  4PWD A;  3AO5 A;  3SAF A;  5F1X A;  1VSJ A;  4EZ6 A;  1K8K A;  4CEQ A;  3I55 N;  4RTF D;  2UUA K;  1IJJ A;  5D3G A;  3AY9 A;  3WXJ A;  4PHT X;  1GLJ O;  2FSN A;  4WQ4 A;  1VSI A;  4FJM A;  2GBZ A;  1OH5 A;  4HTL A;  2HHW A;  2YHX A;  1VRT A;  1V4S A;  3LAL A;  3O9R A;  3U9D A;  3MMV A;  1OVQ A;  1TAQ A;  4HVJ A;  4E1N A;  4DU3 A;  3UIQ A;  3VGL A;  4IJA A;  4CVN E;  1RBV A;  3WT0 A;  4B8C A;  2UXD K;  4X64 K;  4Z0U A;  2VGM A;  1IKY A;  1UA0 A;  3ULE A;  3ZSV A;  1WSJ A;  4M7Y A;  3QNO A;  1RBU A;  1GLB G;  4JK9 A;  2JWK A;  4BR9 A;  1TV6 A;  3HVT A;  3MED A;  1NGA A;  2G8K A;  4PQU A;  3V9U A;  3O9Q A;  4LC9 B;  3TAM A;  3NF9 A;  4NYF A;  5DM6 L;  4DLG A;  1JLQ A;  4LFA K;  2GUP A;  2O8B A;  4JKG B;  3M1F A;  4BRI A;  4RW9 A;  2IIR A;  3V1Q A;  3K9K A;  3R8E A;  4WQ5 C;  3CQ8 A;  5HRO A;  4MO4 A;  3K0S A;  4E7K A;  1WOQ A;  2YHA A;  3PUF A;  3LDP A;  4MDB A;  3HI0 A;  3PIO L;  4CFC A;  1T44 A;  1Q8I A;  5AQZ A;  4JKE A;  3SPY A;  1BIZ A;  4GNI A;  4C8M A;  2PYL A;  3DM2 A;  1RBR A;  3I0S A;  4DSI A;  3VMF B;  3IUC A;  1CLQ A;  1YVU A;  3ZLJ A;  4NCA A;  4BE2 A;  5AFU H;  3AAP A;  1F21 A;  4M63 C;  3OYL A;  4BRD A;  3ENH A;  4NXM K;  3MX2 A;  4IFY A;  1Q81 O;  4B1U B;  4DR3 K;  3CCE N;  4B3S K;  4JK7 A;  1GLA G;  4CGD A;  3VEY A;  3KLH A;  2IVO A;  3H3N O;  4WFA L;  4GV6 A;  3A0I X;  4DV2 K;  2A1S A;  3O1B A;  4QOZ B;  1JXE A;  2B4J A;  2ITG A;  4LFC K;  2HND A;  1P8Z A;  3F9K A;  4RCH A;  4MLE A;  4JKD A;  4M3Z A;  5C2F A;  4RW4 A;  4CHQ A;  4CJT A;  4CZE A;  3A8Y A;  5AQY A;  3HRG A;  4IWV A;  2YX6 A;  1YT3 A;  3QES A;  4A62 A;  1X9S A;  4BRM A;  1QQO A;  2P9L B;  4CI6 A;  4EP4 A;  2DY4 A;  2ZJQ L;  4KRF A;  2V7Z A;  3VN5 A;  1SKW A;  4O0I A;  3QIO A;  3GE1 A;  3TWH A;  1IBK K;  2E1Z A;  3QFU A;  3NGZ A;  2X74 A;  3WNE A;  3ZET B;  1XI1 A;  1NGB A;  2A1R A;  3C6H A;  4CEF A;  4DTS A;  3TI0 A;  3N4Q A;  3CM6 A;  4FLU A;  2KFN A;  4CF9 A;  3O80 A;  3O3G A;  1VAZ A;  1A5X A;  4E89 A;  3BDP A;  1Q82 O;  4FK2 A;  4XH4 A;  1MDU B;  2HF3 A;  1WSG A;  3K5N A;  2F8T A;  4DQP A;  4CBU A;  4B08 A;  4CZH A;  3BY5 A;  3E1Y A;  4CJK A;  1IV0 A;  3HL8 A;  2VYP A;  4BQZ A;  4X66 K;  3WUH A;  2YJE A;  1YIT N;  3HVR A;  4CD3 A;  1BU6 O;  3HM8 A;  1NMD A;  1SV5 A;  1VSL A;  1MWM A;  3F5T A;  3I33 A;  4PKI A;  4O0J A;  3P31 A;  3QFP A;  4HCB A;  1A5V A;  4U67 L;  3NAE A;  1MWK A;  4KPY A;  3ENB A;  4LF8 K;  1NGF A;  5IWA K;  3CCM N;  2V52 B;  3VTH A;  3KIO A;  4IDK A;  2XY6 A;  1BCO A;  3RTV A;  3D45 A;  4OKE A;  4CJE A;  4RW7 A;  3RVC A;  3CHW A;  1S3X A;  1OH7 A;  1BIU A;  4M3T A;  3OW2 M;  1QVG M;  4BVO A;  2A5X A;  2AA4 A;  1XUP O;  1TUY A;  4O8U A;  1D8Y A;  4FK4 A;  3WNG A;  1U47 A;  4FPB A;  4UY8 O;  4J2A A;  4N76 A;  1VRU A;  2RKI A;  4KFB A;  4MO5 A;  3H46 O;  4CJP A;  2O8F B;  3EZW A;  4Z4G A;  1VQN N;  3AVN A;  4LH4 A;  4DB3 A;  3VF6 A;  4JKG A;  4CF2 A;  2VQF K;  3KK3 A;  1QSS A;  1K6Y A;  4DQR A;  3B8A X;  4KTW A;  4JI8 K;  4J2B A;  1TUU A;  3OVN A;  4DQ8 A;  1DEJ A;  4BC4 A;  3DOK A;  3AV9 A;  4DR6 K;  4JS5 A;  4B1V A;  1BO5 O;  4BY9 C;  4BR4 A;  4M45 A;  5K14 A;  3L2Q A;  3SV4 A;  3FLC O;  4DV4 K;  1C1B A;  2FSJ A;  1S9E A;  1NKC A;  3AA4 A;  4I6M A;  1XMQ K;  4OX9 K;  4I2Q A;  3AAR A;  4YOR A;  3VEV A;  4B3O A;  5TKW A;  1J6Z A;  1SL1 A;  3NH0 A;  3P1G A;  1J9A A;  3T1H K;  3MXJ A;  1LWE A;  4DV7 K;  4BAC A;  3P38 A;  1VQ5 N;  5ADX H;  4F2R A;  3SQ1 A;  1NK5 A;  1SZ2 A;  1RDC A;  4CE9 A;  3S9H A;  1RBT A;  2E8A A;  1WSF A;  3S3O A;  3CG7 A;  3RSE B;  1I39 A;  3LDO A;  4CHO A;  3H6E A;  4FJH A;  2PZS A;  5J2P A;  2G8F A;  4AF1 A;  1QZ6 A;  1M90 O;  3K5M A;  5KTQ A;  1Q86 O;  1TK0 A;  3I56 N;  4RG8 A;  3CM5 A;  4M7X A;  2BE2 A;  2VG6 A;  3E9O A;  4CJ3 A;  1YTU A;  5ADX A;  3THY B;  2ZE2 A;  4WFN L;  3CI5 A;  3CFR A;  4B9S A;  4H5V A;  1U48 A;  1E4G T;  3T3F A;  4KHQ A;  1RT7 A;  2EX3 A;  3HBT A;  4Y1C A;  4AH9 A;  4TSX A;  1FKP A;  3A5N C;  1WLJ A;  2VGN A;  3VOV A;  4E19 A;  1TAU A;  1GLF O;  3DLK A;  4M3U A;  4AIL C;  4CEB A;  3ZET A;  1NJZ A;  1JLE A;  4YY3 K;  4DSJ A;  3CCU N;  4DTJ A;  2DFH A;  4B1X B;  3U6F A;  2E4L A;  4JKH A;  4I9Q A;  1C0G A;  1A5W A;  5AQK A;  4AHS A;  1O1W A;  1RTJ A;  2WOM A;  4JRQ A;  3DLE A;  4B8A B;  4K8Z A;  3HO1 A;  4QAG A;  3SYZ A;  4C8K A;  2R7Y A;  2DTU A;  3LWM A;  3NMU A;  4PKG A;  3J81 O;  3LM9 A;  1KVA A;  3T7Z A;  1KAY A;  4DTN A;  4XEI A;  4FJ9 A;  2I5J A;  1RDB A;  1NBW A;  4H5N A;  1NGE A;  5AQW A;  2Z1H A;  3OA9 A;  3L6Q A;  4KI4 A;  2FSK A;  3CC4 N;  2CGK A;  2H3G X;  3K5L A;  1TKX A;  1U49 A;  3RRH A;  1S5J A;  4Y0W A;  3QIP A;  2KKZ A;  3NHG A;  1YVN A;  2HNY A;  3Q7C A;  5F0X A;  2FBX A;  1NGJ A;  4ISF A;  4AM7 A;  2PYJ A;  4KB1 A;  2YHY A;  3CC2 N;  3HJF A;  1EWR A;  4CEC A;  1Z26 A;  4DR2 K;  5HRP A;  4B3R K;  3UB5 A;  2VG5 A;  3KVG A;  1VQ4 N;  2BH1 A;  3VQD A;  3KWI A;  1HNI A;  1KD1 O;  3ZEU A;  1RT4 A;  2IS3 A;  3ZCM A;  1YF5 L;  4CGF A;  4OKJ A;  3V4I A;  5KI6 A;  4ILJ A;  4GY2 B;  1D5A A;  2NNW A;  4PL7 A;  5AQO A;  1HLU A;  3NGY A;  4ZTJ A;  1UOC A;  4CGJ A;  2FBT A;  5I3U A;  4IG0 A;  1T05 A;  2E2N A;  3KZB A;  2Q97 A;  2WTU A;  1IG8 A;  1I94 K;  4DLE A;  2O8F A;  3RMC A;  3KD1 E;  4ICL A;  1RTI A;  4W5T A;  3TTD A;  1LW0 A;  3P5J A;  2EHG A;  3G10 A;  1EWQ A;  4NCG A;  4O5F A;  1TYQ A;  1HNX K;  4BRA A;  2O8D B;  3EZ5 A;  2KLA A;  2Q36 A;  3IDH A;  1ATS A;  3D2F B;  3FZK A;  4B1Y B;  3K58 A;  2QKB A;  3SBG A;  3AGR A;  3I8D A;  1OKJ A;  4ELU A;  2AJQ A;  1M1K O;  4JYA K;  4H0T B;  1DT9 A;  2CH6 A;  3J80 O;  3T1A A;  5I9E B;  3S41 A;  3V9Z A;  1T3V A;  1HJO A;  4YOX A;  1B9F A;  3CPE A;  4KHU A;  4MLH A;  3O5B A;  3OS0 A;  5AQF A;  1VSK A;  1VQ9 N;  4OKK A;  5BR8 K;  3D6R A;  3AVB A;  1NK8 A;  3C7N A;  5CYM A;  3KKR A;  4CJ5 A;  3OYF A;  3PX4 A;  2XY8 A;  2XY7 A;  1OH8 A;  5CR4 A;  4DFK A;  4PKH A;  3K59 A;  5FLX O;  4AM6 A;  3BGR A;  5M1P A;  5AQN A;  4HUE A;  1K73 O;  2D0B A;  3AO3 A;  5GAG P;  1NGH A;  3QB0 A;  3TTF A;  4ISE A;  2X6S A;  1EXQ A;  4BGA A;  1WSH A;  4C1N K;  4FLV A;  3RSE A;  1YUW A;  1HKG A;  3L0Q A;  1KVC A;  4LH5 A;  1BQN A;  2UYT A;  4A57 A;  5CZ1 A;  1HNW K;  3S3N A;  3P4I A;  4DQQ A;  3FZF A;  3TU5 A;  3V1R A;  3V9W A;  3R1X A;  1W9H A;  2HNZ A;  2P9P B;  2E88 A;  5DM7 L;  4I2P A;  2HOE A;  3NBP A;  1GOC A;  3DLB A;  3THY A;  4X62 K;  3BP8 A;  2O8E B;  3QER A;  4F9O A;  5EXW A;  4EAH D;  3JYT A;  2QXF A;  4HUF A;  4CJS A;  1WSI A;  3SUO A;  4KHN A;  1RGI A;  3R9P A;  4DFP A;  3VEX A;  4FLX A;  3QNN A;  1HPM A;  1NGC A;  4CBW A;  4DV3 K;  4IZ9 A;  1HNZ K;  3DYA A;  2NZT A;  4F2S A;  3IRX A;  1NG9 A;  3O4W A;  3ZT3 A;  2KW4 A;  4GKJ K;  4Z4H A;  4E7L A;  4C8N A;  1VSE A;  2ASO A;  3D2E A;  5AQT A;  3FFK B;  5HLF A;  3PLA A;  5M1K A;  4FLW A;  1UWB A;  3R3L A;  2HBL A;  3K5O A;  1TKT A;  3CME N;  1VQ7 N;  3HP9 A;  2KZZ A;  1ZYQ A;  3ZSZ A;  1S1W A;  3OTO K;  2HHU A;  3TTC A;  3QEV A;  1KLM A;  2OPS A;  5E26 A;  1JCE A;  3AA5 X;  3FZH A;  4JKF A;  3O9T A;  1YTA A;  5GIO A;  4Z4C A;  4CZI A;  1NJW A;  4WE1 A;  2YI1 A;  4DWI A;  4OO1 J;  1HQE A;  4YOW A;  3VQ9 A;  3KK2 A;  3A5O C;  4QS8 A;  3VF4 A;  2P51 A;  4GV9 A;  5AQJ A;  2ZM6 K;  3VQQ A;  5AQX A;  4BC5 A;  2HHQ A;  5DMR A;  1QS4 A;  4Z94 A;  5C0Y A;  5LL6 Z;  3TAN A;  3THW B;  3EEQ A;  3KK7 A;  1VSF A;  1S1X A;  3OYE A;  1BI4 B;  2YHW A;  4IXC A;  2E2P A;  3B6P A;  3V9S A;  3PV8 A;  5AJ3 K;  2VG7 A;  1NKB A;  3ZX2 A;  4NLB A;  3CFP A;  1BOT O;  4H0O A;  4CBX A;  3UKR B;  5EOY A;  2DFF A;  3RR7 A;  1QQM A;  2OZS A;  5HL7 L;  4CHP A;  2O8D A;  1X9W A;  3KLE A;  4M3X A;  1QVF M;  1KRP A;  4BRH A;  2YNI A;  3DWL A;  3CCR N;  3RMD A;  5GIN A;  3RR8 A;  1L3U A;  4FJI A;  2J4R A;  2WUS A;  3P83 D;  1ASW A;  3D2F A;  1JL2 A;  3M8P A;  1BGX T;  3ZX3 A;  4JNE A;  1X9M A;  1SL0 A;  1NK4 A;  1L3T A;  4JI1 K;  1EO1 A;  1EET A;  2JGU A;  4B9Q A;  4JI5 K;  4N56 A;  5AQP A;  1DTT A;  4ID5 A;  3ZT0 A;  1KC8 O;  3DI6 A;  2RF2 A;  1KVB A;  2FLO A;  4KH6 A;  2P9K B;  5B8H A;  4JD2 B;  1P90 A;  4A61 A;  4LF6 K;  4IEE A;  3WXM B;  4A59 A;  3SAH A;  4ELV A;  3LDL A;  2VWK A;  3ZYY X;  1NJX A;  2AP1 A;  1J5O A;  1U4B A;  4DTM A;  1S9G A;  4OPH A;  3SI6 A;  3ID6 A;  1TVR A;  1S22 A;  3CXC M;  4FJX A;  2UU9 K;  1RCH A;  1QSL A;  3KD5 E;  3HTV A;  4OPK A;  1E4F T;  5KGW A;  3KLG A;  3HT3 A;  3FR0 A;  3AA3 A;  3QML A;  2F7T A;  1RNH A;  4YOY A;  3VQC A;  3VES A;  3HXM A;  5AFU A;  4B9V A;  4BR7 A;  2P9S B;  3SMS A;  4OPA A;  1D4X A;  3QBW A;  1W7A A;  5JIC A;  4BRL A;  3OYM A;  1XQS C;  4BR2 A;  2P9P A;  2GV9 A;  4BRK A;  5JLF A;  5GIP A;  5C15 A;  4BR5 A;  1BCM A;  5BPL A;  1HR0 K;  1J5E K;  1HPZ A;  2KHO A;  3HPH A;  4Z4F A;  2WON A;  5DK5 A;  5KRS A;  4DG1 A;  3LWL A;  3NE6 A;  4CJF A;  3VQ6 A;  3UE5 A;  1YAG A;  3QEI A;  1XHX A;  1CZ9 A;  1X3M A;  3VEN A;  1BHL A;  4FXD A;  2G8U A;  2HMI A;  5BR9 A;  5JS1 A;  3DXM B;  4DTO A;  2BDP A;  3M8S A;  1X3N A;  4GVE A;  3PX0 A;  2A41 A;  3EKU A;  4A5A A;  3O08 A;  3OS1 A;  1TL3 A;  1SAZ A;  2OA8 A;  1H1V A;  4BRG A;  1ZBU A;  4KO0 A;  3AVK A;  4H5R A;  3AVM A;  3CJB A;  4M3R A;  3TAR A;  1JCF A;  1I3A A;  4DSE A;  4WQ4 C;  2OCE A;  2WC9 A;  2NLX A;  4CHZ A;  1YJ9 N;  2EWS A;  4FWS A;  3CET A;  3IS9 A;  5FRN A;  1T6D A;  4L3Q A;  1EQY A;  1LWF A;  5LMU K;  4LF9 K;  3TSP A;  1QQN A;  2E6L A;  5M1F A;  3IAY A;  1RDA A;  1DLO A;  3PSF A;  3W3D A;  1SL2 A;  3Q7B A;  4V19 S;  2CH5 A;  5LJW A;  1XWL A;  2Z1J A;  3QEP A;  4BC3 A;  3G25 A;  2YNH A;  3PO4 A;  2B6A A;  4JI4 K;  3LM2 A;  4FJG A;  2YV0 X;  1Z6R A;  1O13 A;  4RW8 A;  3V9X A;  3AO2 A;  3L2W A;  1EP4 A;  4DF4 A;  3EO3 A;  4FLZ A;  3HPG A;  1JLG A;  3LAM A;  3CJ1 A;  1KLN A;  3TAB A;  3KKS A;  4OGC A;  4FWO A;  2P5O A;  4CF0 A;  2PAV A;  3THW A;  3MEC A;  4Y1D A;  5C25 A;  4K43 A;  3HZ6 A;  3AAQ A;  1NK7 A;  5M1O A;  3LP1 A;  2HST A;  3L2R A;  1RDW X;  3H1Q A;  5AQI A;  2G8W A;  1WNS A;  3WXK A;  3AVL A;  4AHV A;  3CCS N;  4CJL A;  3F73 A;  1BQM A;  4DFJ A;  4YOV A;  2UXC K;  2GUI A;  4FO0 A;  4I7F A;  2P1J A;  3MXM A;  4KHP K;  4BC2 A;  3U3G A;  4CIG A;  4KKO A;  4H0V B;  3UKR A;  1HKB A;  2FC0 A;  1C0U A;  3QO9 A;  3OJS A;  1XC9 A;  4K41 A;  4L8R B;  1FW6 A;  2WBN A;  4CJR A;  3OYH A;  4JI3 K;  1WN7 A;  3CJ9 A;  2BTF A;  4YDU A;  5FPN A;  3NF7 A;  5C2D A;  4UQG A;  4EIA A;  1WAJ A;  5KPZ A;  1S6P A;  3C6U A;  1ASV A;  2HHX A;  3F9M A;  4FLY A;  4YNQ A;  4CK1 A;  2GWK A;  4NCB A;  5BRH A;  3CD6 N;  4WCE L;  3PX6 A;  1Y64 A;  3SCX A;  1BL3 A;  2E5L K;  4B3T K;  1T7P A;  4JD2 A;  3O4N A;  3SPZ A;  2KQ2 A;  3LAK A;  3FGU A;  5KQ8 A;  3SUN A;  4LFB K;  4K42 A;  2NRV A;  3DXK B;  1G99 A;  1BDG A;  4JI6 K;  2HF4 A;  4IOA L;  3KJV A;  4JLH A;  1IO2 A;  2RPI A;  3I0R A;  4IO9 L;  2PFU A;  4CIE A;  4A5B A;  4DSK A;  3C6T A;  3QET A;  5A2Q O;  2OAN A;  2QI2 A;  5FDL A;  5AQH A;  2D5R A;  3NF6 A;  4FJ7 A;  5SZT A;  2P9S A;  1YIJ N;  3CPW M;  3ATV A;  1C1C A;  5JMV A;  2XY5 A;  3VQ5 A;  2GWJ A;  1JL1 A;  1S6Q A;  4DSF A;  2G8V A;  4ISG A;  4IKF A;  2P9L A;  3TR8 A;  1C1A A;  4CZK A;  3AVI A;  2D1K A;  4ZHR A;  2HB5 A;  2NUB A;  4CZM A;  3CC7 N;  4M3W A;  1WAF A;  3UKU B;  1NK9 A;  4FL9 A;  3WXI A;  2W40 A;  1LV5 A;  4EP5 A;  1IG9 A;  1ATN A;  1NOY A;  3C0B A;  3V6D A;  3WEE B;  1FK9 A;  3NF8 A;  1VQK N;  2HW3 A;  3SLC A;  1WBD A;  3RMA A;  1RT2 A;  4JI7 K;  3TPQ A;  3SQ4 A;  4KH5 A;  1XMO K;  3IFR A;  3DXM A;  3ALY A;  4MDA A;  5CZ2 A;  4W5Q A;  2HHV A;  4Q5V A;  2IAJ A;  2RN2 A;  4B9U A;  2P9I B;  2OPR A;  4YOT A;  4DCH A;  3OYB A;  1NGD A;  4CJ4 A;  4IOC L;  2Q3S A;  3C6A A;  4BG8 A;  3CJ7 A;  4CEZ A;  3E01 A;  3D7E O;  4DQI A;  2OPP A;  1QE1 A;  4CGH A;  2E2Q A;  1JLB A;  4IO8 A;  1YJW N;  3ITH A;  1VQL N;  4W5N A;  3MX5 A;  4EHU A;  4DV6 K;  3VTI A;  3ULD A;  3HP6 A;  3R6M A;  5FRO A;  4DV0 K;  3OYJ A;  4XH1 A;  3JS6 A;  3ZSY A;  1TGO A;  2Q0R A;  1RT1 A;  2IVP A;  3VA0 A;  3ATU A;  2Q0U A;  1L3S A;  4DTU A;  3VQ8 A;  3FFI A;  2IOC A;  4FWQ A;  5BN9 A;  1ZBS A;  4C8L A;  3CMA N;  3VEW A;  3QEX A;  4IFE A;  4AHU A;  4FOE A;  1K9M O;  4CHN A;  4DKW A;  5C12 A;  3O3H A;  5KPT A;  1LWC A;  3LAN A;  2QXL A;  5JS2 A;  3O4Q A;  4HCC A;  1NNE A;  1JLF A;  5EVZ A;  4JHD B;  4AHT A;  2A3Z A;  1RDD A;  3MN6 A;  3SK3 A;  4DMN A;  1KQS M;  4FZZ A;  3L4I A;  2KFZ A;  5AQM A;  5C10 A;  3GBT A;  2XHB A;  4G9Z A;  3ULE B;  4FJK A;  1EX4 A;  4IG3 A;  4E7I A;  4CW7 B;  5ELZ A;  1EKE A;  1HYS A;  3DRS A;  1S1U A;  2X6N A;  4DTX A;  5E84 A;  3LP3 A;  3TSQ A;  5EU7 A;  4BR0 A;  3V1O A;  2ZF5 O;  4DF8 A;  1WB9 A;  4QCL A;  4IOX A;  3HK2 A;  3CCL N;  1GLE G;  2D0P A;  1VSD A;  1ZBL A;  2G8H A;  4ILH A;  3SAG A;  2QWQ A;  3FZL A;  3J8A A;  1T8E A;  2QEX N;  3K2P A;  1HJR A;  1N8R O;  1VQ8 N;  5AQL A;  4B1Z A;  1SKR A;  1IKX A;  3U3Y A;  5CY4 A;  3VEO A;  4FZY A;  5T7B A;  2I7P A;  4ILG B;  3DXK A;  4CJ7 A;  1HKC A;  2W6K A;  1BA1 A;  4NO7 A;  3C94 A;  3E9P A;  4OLA A;  2Z1G A;  3G0Z A;  5AQU A;  1WBB A;  3VEZ A;  1ATR A;  4IEI A;  3ZSW A;  1HUX A;  4WQ5 A;  2OTJ N;  3THX B;  3OBY A;  3HPO A;  4F3T A;  3JAM O;  5HRR A;  2Q31 A;  4F4K A;  1QSY A;  4H8K A;  4KI6 A;  4OGE A;  3OS2 A;  2P9N B;  3L2U A;  4FLT A;  4E1M A;  4CF8 A;  2HBK A;  2Q2R A;  1VSH A;  1U2V B;  3EN9 A;  4KHW A;  3L8B A;  4Q0B A;  5F2R A;  3UKU A;  4FWR A;  4O44 A;  5AQS A;  4PA1 A;  5GAD P;  5IT9 O;  4FWN A;  3MXI A;  2GEM A;  1RTD A;  4FM2 A;  4H5W A;  1X1P A;  2QTD A;  4Z4E A;  1DKG D;  3ZX0 A;  4FWL A;  2JWL A;  4BWJ A;  2QKK A;  1R0A A;  5M1N A;  2E1Y A;  4BRP A;  2P9I A;  3VQ7 A;  3J7Y P;  3CQY A;  3T69 A;  1KAZ A;  4FWK A;  1GLL O;  1J54 A;  1NLV A;  3E9L A;  1C0M A;  1LCU A;  4AHR A;  3MN7 A;  3E66 A;  5LJV A;  2HHH K;  4O55 A;  1N34 K;  1CXQ A;  3LDS A;  1UAX A;  2CGL A;  4OVL A;  2RE2 A;  3W0L A;  3K9J A;  4B3M K;  3VQB A;  3ZT4 A;  1LAV A;  5EY4 A;  2HVI A;  1OH6 A;  3DLL L;  3FZM A;  1SS6 A;  1C0T A;  5CYQ A;  5BPM A;  3HST B;  3VGM A;  1Q18 A;  3SQ0 A;  2Q1N A;  3KWG A;  4DUZ K;  3HM9 A;  4XH5 A;  1SUQ A;  1C0F A;  2F4V K;  3MCP A;  5GAH P;  3VA3 A;  4BGB A;  3HYF A;  4FVM A;  4CES A;  1VQO N;  5J2Q A;  2ETJ A;  4BE0 A;  3O8M A;  4BQL A;  2D0O A;  3DRR A;  3VQA A;  2Y1I A;  1QZ5 A;  4BWM A;  1WUA A;  4JHD A;  3BZC A;  1WSE A;  5LY3 A;  4PUO A;  3OHR A;  3CJC A;  3TAE A;  3MEE A;  4FW1 A;  1RT5 A;  4M42 A;  4FWM A;  2YKN A;  1GLC G;  2DPN A;  4MQ3 A;  2VWB A;  3OBW A;  1W2B M;  1HQU A;  4BRE A;  3A2F A;  1N5Y A;  1U45 A;  5AZI B;  3U4L A;  1QTM A;  4NXN K;  1B9D A;  4JS4 A;  4GKK K;  2OPQ A;  4PL8 A;  4CEA A;  4DU4 A;  4CD1 A;  3SUP A;  3VF2 A;  1BWF O;  4IJN A;  5HBM A;  4KBO A;  3IG1 A;  2VWJ A;  4FJ5 A;  4W5O A;  1U6Z A;  3BEX A;  3O1W A;  2BGG A;  4BRF A;  4ELT A;  4LSL A;  4DTR A;  1ITG A;  4BRQ A;  1RDU A;  1Q7Y O;  4FM0 A;  3SZ2 A;  4JI2 K;  4YHH K;  1ZBI A;  4I6M B;  2A6A A;  1KAX A;  5KPR A;  5FRM A;  4JI0 K;  3RRG A;  1L3V A;  3P39 A;  3H08 A;  2NRR A;  2O8C B;  1BUP A;  3DLG A;  3KTQ A;  2B5J A;  2F9W A;  3BZK A;  3A5M C;  5J2M A;  3AO1 A;  3ZSO A;  3NH2 A;  1MU2 A;  4G1Q A;  4BDP A;  4AQY K;  3THX A;  2V7Y A;  3AVA A;  3L4Q A;  1N33 K;  4DV1 K; 
#chains in the Genus database with same CATH homology
 3EEQ A;  2W6K A;  3BY5 A;  2W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...