2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
molecule keywords COBE
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
3BY5A 2W6KA 3EEQA 2W6LA
chains in the Genus database with same CATH superfamily
1Q82O 4B3TK 3CC2N 3E01A 5GINA 2GV9A 3M8QA 4JHDA 4A57A 3CCSN 3QEXA 3MXIA 3KIOA 2W6KA 3OS1A 4KBOA 3ALYA 4FWSA 1X1PA 4XEIA 3HBTA 3P4IA 3O80A 4JS5A 3OYEA 3ZLJA 2G8VA 1BISA 3DLKA 3O08A 4YOUA 1TYQA 5EX5A 3K5NA 1ZC6A 4BVOA 2ASOA 5AQWA 4M45A 1IJJA 3AO4A 3P1GA 1BCMA 4KHUA 3O1BA 4YDUA 3DXMB 4AM6A 4BRFA 1RT5A 2KW4A 3AY9A 3ENHA 2YNHA 3O3FA 5AJ3K 4M3XA 2P9NB 3DLGA 3SZ2A 1RBRA 4IFEA 2KHOA 2G8IA 4FLWA 4WFNL 4AQYK 3K9JA 4UQGA 3KKRA 3FGUA 3WXIA 5SZTA 4DFJA 3ZT4A 2BDPA 3LP0A 3FZHA 3LP2A 1L5UA 4DTNA 3LDQA 1JXEA 4FJLA 4I7FA 2RE2A 3NVMA 3VERA 1D4XA 3VQAA 4GY2B 1BOTO 3KHYA 2KTQA 4DQQA 1JLQA 4IDHA 4CIFA 5E84A 3AA4A 4JLHA 3ULEA 1OH8A 2D0BA 4FLUA 1Q18A 4OPJA 2ZF5O 2J4RA 2Z1JA 4H5TA 3ZSYA 1RDWX 1S6QA 3D2FA 2O8EB 4CEBA 4FXDA 3EKUA 2B5JA 3ZSXA 3SAHA 3CCLN 3CJBA 4JV5K 3QEVA 5AQSA 3AGRA 3NMUA 4I2PA 4JI1K 5J1EA 4BR0A 1VRTA 2QK9A 1JLEA 4JD2A 2D0CA 1MA9B 3E9PA 1VHXA 2ITMA 5HL7L 1NGAA 1QQNA 3LDLA 3V9XA 1U45A 5EY4A 1BG3A 4FZXC 2W40A 4B9NA 4H4OA 1C0UA 3CQ8A 3SLCA 3RMDA 3J80O 4QOZB 2DFHA 3KWIA 4QS8A 1HKGA 5AQMA 1GLDG 3LDSA 3CQYA 3V1QA 5AQTA 5AQJA 3S41A 4CIGA 3WNHA 3HPHA 1QZ6A 4KTZA 2QWQA 3LZIA 1X3MA 1XMOK 2HNZA 1RT4A 1YI2N 3LPUA 4M3ZA 2Y1JA 4CZGA 3VQ5A 3KKSA 4O0JA 3PY8A 1QHAA 4BRKA 4OPHA 5JLFA 3OYMA 3SJJA 2FLOA 3AVAA 4CGFA 1K73O 4JK7A 1VQMN 3VTIA 4M41A 4FWNA 2NRHA 3WT0A 3MWPA 1SL2A 4DV1K 5LJWA 1BA0A 5M1FA 5HRSA 3UIQA 3A0IX 3NH2A 4AHTA 3DOLA 1KXPA 3QFUA 4HUFA 3BUZB 3SJHA 1JCEA 1VSDA 1TK8A 3NGZA 1RT2A 4WFAL 1QSLA 2UXBK 3PIOL 1ZYQA 2FBTA 4FJIA 3D2FB 3MCAB 4FOEA 4DV7K 3TAQA 1K8KA 1HPMA 4Y0WA 3VTHA 5JVGL 4BRDA 3CCRN 3P83D 1S1WA 3VEYA 3NVKA 4M7YA 3A5OC 1IKYA 5DMRA 4M7XA 3VQ9A 2WC9A 1TUUA 4FCYA 4LF6K 3HK2A 1ITGA 4I2QA 1NJXA 4DTPA 2RPIA 4JRPA 1JLFA 2IC3A 3AVBA 3L3UA 1XC3A 5FRMA 2CH5A 2XY8A 4FYDA 5KQ8A 4DTSA 1I39A 4E89A 5DK5A 1XWLA 3P39A 1TK5A 3BY5A 3ITHA 3MK6A 5IT9O 3V4IA 1J5OA 3I56N 4DLGA 1HX1A 1JCFA 1BA1A 2E4LA 1NJZA 2NRWA 2O8DB 4K8ZA 3T1HK 3VA0A 4J2AA 5KRSA 3ZT0A 1XMQK 1YUWA 3L8BA 4AILC 1NGDA 5FROA 5AZIA 2QA4N 3O1WA 1MWKA 1RDDA 4BE1A 3IDHA 1BO5O 4OKEA 1GLAG 3HYFA 4CFCA 3AVIA 4OKKA 4CCHA 4RW8A 1C0MA 3ZYYX 4YOXA 4DSJA 3IKMA 3TPQA 1NM1A 3SUOA 1O1WA 3O3GA 4A5AA 1JXBA 2DY4A 1HQUA 3CCMN 2VQFK 1QSSA 3EEQA 4CZEA 2V52B 3DRPA 3MN6A 2G8WA 1S1VA 4FL9A 4LFCK 4E7JA 4IFVA 3VPZA 3KZBA 3J7YP 4W5TA 2HF4A 1U48A 1J54A 4FJ8A 4LSLA 2BANA 1Q86O 3QNNA 4IXCA 3M8RA 3WXMB 3LZJA 1XHXA 3QEWA 4Z4CA 1HNZK 1X3NA 4OPAA 3MX5A 4JKEA 4W5QA 4BDPA 4Q5VA 4DV2K 4FLXA 2FBVA 1T7PA 2F9WA 4BRAA 1C1BA 1KCFA 1KC8O 3QESA 2HHXA 4U7BA 5TKYA 1VQLN 2P5GA 3HI0A 3VQQA 1BIZA 4FM1A 5M1PA 3LPTA 1KFSA 5AQOA 4KHWA 1WAFA 1SL0A 3PX0A 5CE3A 2WBNA 2YV0X 3G25A 4KKOA 3F73A 2UU9K 3H45C 3VESA 3QMLA 1T8EA 4KH4A 3TR8A 4LF5K 3UKUB 5AQZA 1GLBG 2WFBA 4ICLA 1O13A 2Z1GA 1N36K 2VG7A 3HPGA 2PY5A 1KAXA 2V7YA 5KPTA 4OVLA 1CZ9A 3VGMA 3WQTA 4JEPA 1K8KB 1NOZA 3DLLL 1YVUA 4OGCA 3NF8A 3CFPA 1GLCG 1L3TA 3HP6A 3EE8A 2E6LA 3M8PA 4PUOA 3ULDA 1NGFA 3O9UA 2A41A 2JLEA 3H1VX 4TSXA 5LY3A 4IEEA 2QKBA 1NK7A 1YT3A 2HNDA 2IVPA 3EZWA 4NO7A 3CM5A 4DR3K 3E9OA 3LALA 1YJWN 3J7ZO 4NYFA 4BRLA 3D6RA 1RT3A 3RSEB 4CJUA 3FLCO 5AQUA 3SYZA 3LANA 3OY9A 1CZAN 2AP1A 1XNQK 2GELA 2QW9A 2YNFA 2HB5A 2V51B 4JS4A 5ELZA 3VF6A 3AGKA 3ISNC 4W5RA 3K5MA 2O8DA 3ATVA 2HVHA 3DLEA 1NG9A 4DSFA 1TV6A 3C6UA 4FJNA 3O9SA 5AFUA 4CHNA 2O8BA 1SAZA 2PFUA 4IJNA 1KRPA 1BDGA 1OH7A 2IVNA 1GOAA 2A5XA 5CY4A 4WFBL 3CMEN 1TYQB 4CF0A 5FLXO 3ZEUB 3ENOA 4C1NI 5F1XA 4YHHK 3LP3A 4XIUA 3TAPA 4KI4A 4Q0BA 3CERA 4B1XB 3O6WA 2P9PA 4CFBA 3K57A 3G0ZA 5F0XA 4H4MA 3KD1E 4CJVA 4CZLA 4OLAA 1ILYA 3DI6A 2W6LA 3L2VA 2Q31A 1HNVA 2VG6A 5C42A 4LY7A 2ZJQL 2AJQA 4C8MA 1KSPA 1SKSA 4YOWA 4FW2A 5C2DA 3L4IA 2QXFA 4R79A 1Q8IA 2OPPA 2HBMA 1GLEG 1HQEA 2P9UB 1I94K 4BC2A 3THWB 3NH1A 4B1YB 4ILJA 3I0SA 1TAUA 5J2PA 1LOTB 4CJKA 4KH6A 3K9KA 5E41A 1LV5A 2F4VK 3BGRA 4BACA 2D4WA 3OYKA 2OTLN 1DEJA 4LF7K 2YHBA 1M90O 3C6AA 2O8EA 2XRIA 4DF8A 4B9TA 1G15A 3S3MA 1HUXA 2HSTA 3K58A 3VQ6A 2HHVA 2Q3SA 3OYFA 2ETJA 3R1XA 4DS4A 3G10A 2QWPA 2FBXA 2NRRA 2OA8A 4JD2B 1VSLA 3HSTB 3OS2A 1HNIA 3M8SA 4DS5A 4N56A 3OYLA 1R0AA 4Y1CA 3CG7A 4CJ7A 1RTIA 3KK2A 1RILA 3KLHA 2WTUA 1J53A 1LWFA 5KRTA 4DR7K 3MXJA 5C2FA 4O4GA 4CZIA 1YTAA 3AO3A 4DF4A 5I42A 2I7PA 1FXXA 5BPLA 4HUEA 1EETA 4JI2K 4KI6A 3NH0A 4H5RA 1ZBHA 3SAFA 1NK5A 4FLZA 3S3OA 1WNSA 4A2AA 1IH7A 3UE5A 2DFEA 4FM0A 4CVNE 3SK3A 1ZBUA 3QIPA 4WQ5A 3NFAA 1L3VA 4Z4IA 3RRHA 1K6YA 4CFAA 2UUCK 5CHIA 4FWKA 3SQ4A 1SS6A 4GV3A 2YI1A 3MCPA 3M3ZA 4JNEA 4C8NA 1GLJO 1UAXA 3HVTA 3MN9A 4DMNA 3S9HA 3EL2A 3ASMA 4E7LA 3LP1A 2CGJA 3TSPA 3TAMA 4CJWA 4Z4GA 4DQRA 2RKIA 2HHHK 4GV6A 4WCEL 4CD3A 2QWNA 3R3LA 4CEQA 4FLYA 1BCOA 1CXUA 2IOCA 3SAGA 4GKKK 1RNHA 1J9AA 4Z94A 5DM6L 1NGBA 4BDYA 3GDQA 2HOEA 4JAXA 3GOIA 1MWMA 2Z1HA 4WQ4C 3F9KA 1WLJA 1YAGA 2ASMA 5FRNA 2P5OA 1BWFO 5IWAK 3DMJA 1KLMA 1EQYA 3RMCA 3HOSA 5HP1A 4HTLA 5JVHL 3BF1A 3AVHA 2P9KA 4F8RA 2OZMA 3P31A 4JK9A 4YY3K 1RT6A 5CZ2A 3MX2A 4EP4A 1X9JA 4K8XA 3FFIA 3VN5A 4DCHA 1S5JA 3H08A 3NGIA 3BEXA 2VGMA 4BG8A 2VWKA 3AAQA 3U4LA 4JI4K 4U67L 2O8CB 4LD0A 4CECA 3AVNA 1WSHA 2NUBA 4ISGA 3RMBA 3FFKB 3ZX0A 2X74A 4X62K 1W9HA 2JWKA 4JKCA 5LJVA 5JICA 4CJSA 5AZIB 1VQ7N 4BROA 4BRPA 2A3ZA 1E3MA 1S1XA 3VEWA 3HXMA 1U47A 3VQEA 2FSKA 1NGJA 4BR4A 4KV8A 4CGGA 4LF4K 2FSNA 2Z1IA 1NBWA 3ZT1A 3AARA 3P5JA 4CERA 1VQ6N 1VQNN 3HO1A 4CHOA 3M6GA 1HKBA 4JKDA 3L2WA 5LMUK 1KVAA 5AR0A 4DQPA 2KZZA 1WBDA 1N33K 2IAJA 2HMPA 1Z05A 2HBLA 2WOMA 5ADXA 4FJ7A 2HW3A 3CCVN 1YIJN 4DR1K 4ID5A 5I9EB 4O44A 2XY6A 3S3NA 1V4TA 3R9PA 5AZJB 4PQUA 3DXKA 1FKOA 3MWTA 4BRHA 5C12A 1OVYA 4JKBA 3U6FA 5AQLA 4BRQA 5AQQA 4LSNA 1RDCA 3OYJA 4AM7A 1YHQN 5HLFA 3DLBA 5AQIA 2G8KA 3CPEA 1HJOA 3OS0A 1BUPA 3CI5A 3ZSWA 4K25A 1N6QA 3WXKA 2EX3A 1BI4A 4FW1A 4CHQA 4E1NA 3O4QA 3CIPA 3VGKA 4RTFD 1S6PA 4CEEA 3CCQN 2RHKA 3MMVA 5HBMA 5J2QA 5AQYA 4UY8O 5A2QO 3JSMA 4DU1A 2F7TA 1WSGA 3KK3A 1EKEA 4B3SK 4BC5A 4XH5A 4KH5A 2XO7A 2R7YA 3C94A 4CJFA 1K8AO 2YHXA 4J2BA 2GUPA 4DR5K 2BH1A 4NCGA 2ZJRL 1NLVA 3J8AA 3QO9A 3PO5A 4CD1A 2FSJA 4KTWA 1RT7A 3VQCA 3H6EA 1SQKA 4IFYA 3HZ6A 2EHGA 3VOVA 3HVRA 3V1OA 3OA9A 1ZBSA 4V19S 5AQNA 2NRZA 3BZCA 4KO0A 4ISEA 5ADXH 4DTJA 2A1RA 4CZHA 3EE9A 4FWMA 3L4QA 5T7BA 2QM1A 4CBWA 3THYB 4B9VA 3AVFA 4CF2A 2P9SA 2YHYA 2NZTA 3O9RA 3QFPA 4IDKA 1A5WA 5KI6A 2VQEK 3UKRA 5D3GA 3AVJA 3VQPA 3OYCA 2OPQA 3F9MA 3K5OA 5JS2A 3LAMA 3WEEA 2YKMA 3ATUA 3K5LA 3NF7A 2A1SA 3B6PA 3EO3A 3I55N 5I3UA 3BZKA 2PBDA 5AQXA 3THXB 4H5NA 3KD5E 2P9IA 4CEDA 4MQ3A 1BGXT 1Z25A 1NJYA 4GMJB 4BVPA 1D9FA 4JN4A 1N5YA 1GOBA 4AH9A 4M3UA 1M1KO 1HMVA 5M1KA 1K9MO 3I0RA 3LWMA 3V9UA 3VEXA 4F3TA 4DQIA 2P9LA 4CFDA 4BRNA 3A5LC 2HHUA 1QQCA 2UXDK 3BDPA 4H0YB 3SNNA 2BTFA 3HP9A 4MDAA 4FJ5A 3PV8A 3VQ7A 2E2OA 5GAGP 3P38A 3SBGA 4DR2K 3E66A 4FM2A 4I6MA 3BF3A 3MEDA 3RVCA 3KLIA 3TAFA 4CZMA 2HMIA 2WUSA 3WUHA 1ASWA 3VA3A 5FPMA 4X65K 2P51A 1VQON 4BWJA 3CJCA 5DM7L 2O4GA 2F8TA 4X64K 4HHTA 1JL2A 4CIEA 1KVBA 4JI6K 5AZJA 3L6QA 5KPZA 4Z4HA 3CFOA 4FLVA 3N4PA 3GBTA 4KHNA 3ZT2A 3TARA 3JAMO 3AV9A 5BREA 1S9GA 3F2KA 2QEXN 4L8RB 3C0BA 4PY5A 1IKWA 1X9SA 4RW9A 1RBUA 5FDLA 3VQ8A 1IG9A 4CEOA 4DFMA 2P9SB 3AVKA 4FOIA 3SQ1A 3TABA 2GUIA 1NMDA 4K41A 4YDUC 1NK6A 3AVMA 4YORA 4E3SA 4N5SA 4B9UA 3IFRA 1VSKA 4E7HA 1XUPO 4IO9L 2JGUA 3T7ZA 2Q1NA 1VK0A 1VSMA 4F9OA 3DWLA 3MXMA 3AVCA 5AQPA 1YF5L 4FWQA 1JL1A 1LWCA 3ZSQA 4CBUA 1ZBLA 1T03A 3W3DA 3DYAA 3W0LA 4CF8A 2A6AA 4H03B 4O0IA 2HF3A 4ELUA 4BE2A 3TANA 1FK9A 4CJ5A 2QXLA 1EO1A 5BPNA 1YTUA 4JK8A 3U3GA 3B6OA 1QQMA 2QWMA 4IZ9A 2YJFA 3TAEA 4JI5K 4LFBK 4FK0A 1SUQA 3TTDA 4HCBA 3QLHA 3FZKA 4DV6K 5HROA 4AHCA 4R5PA 4EAHD 1QS4A 2OZSA 3PUFA 1KFDA 4L3QA 2UYTA 4BR2A 4AHVA 1DKGD 4LF9K 3LM2A 4KREA 5BN9A 3LDPA 1NNEA 5C24A 1T3VA 3PX4A 3BP8A 2OPSA 4CEZA 3B8AX 4IOXA 3QIOA 4FJXA 3OYHA 5C10A 4IG0A 1KVCA 4OKJA 4KRFA 3QINA 2ZGYA 4FWLA 1JLBA 1WN7A 4MO4A 4RW6A 1EXQA 1EWRA 2VWBA 4PKGA 2FC0A 3V6DA 4OPKA 2NRXA 2OCEA 3AAPA 3SMSA 1W97L 2LSNA 1RTJA 3D2EB 4K0KK 2ZJPL 2E2PA 4CZKA 1QVFM 1RDAA 3RRGA 4F2SA 3L2QA 2Q97A 5AQFA 3ZEUA 4DFPA 4B3OA 1VRUA 4BRCA 3CMAN 1QZ5A 4BY9C 4KTQA 4DUZK 4FJMA 3G4SN 1KD1O 2P9PB 4FVMA 1CZBA 1RGIA 3KVGA 4CJQA 5J2NA 4CHPA 3V9ZA 1NK4A 1J5EK 2NRVA 3DRSA 3QEIA 4E7IA 1YITN 4JKAA 4JKGA 1U49A 1C0TA 1B9FA 3OYDA 3T69A 3U8XA 4BQLA 3LDNA 4WYBA 3IRXA 3OYGA 3LWLA 2UUAK 1QSYA 1L3SA 4DU3A 3CM6A 5BRHA 1Q7YO 3SQ0A 3DLRA 3NCIA 1C0FA 5C15A 3OYAA 3A8YA 3AVGA 3HPOA 1YXQA 4IBNA 1WOQA 2YNGA 2RN2A 2Q36A 4B9SA 4NB4A 1QTMA 4AHRA 4N41A 1OVQA 4H5WA 3KLEA 4XH1A 2HBJA 1XC9A 5GADP 4KHQA 4BC4A 4G9ZA 4CHYA 1XNRK 3EYZA 3DAWA 4KHSA 2YHWA 4XH4A 4CESA 1UOCA 5AQKA 4B9LA 2E1YA 4LFAK 2UUBK 2KFZA 1RTDA 2CGKA 3T1AA 4AF1A 4EHUA 1SKWA 3AVLA 3NF9A 1IBLK 4LF8K 3AA2A 4BR7A 4FPAA 5TKWA 1TK0A 3OJSA 4JHDB 4JYAK 1MDUB 1ZBIA 3T19A 3EZ5A 4MFBA 4DV4K 3O9QA 3WEEB 1DLOA 3SPZA 4FK2A 3C65A 4CW7B 5CYMA 3EN9A 3MECA 3V9WA 3KK7A 3TSQA 3D2EA 1QQOA 1VQ9N 5KTQA 5HRNA 1V4SA 1TKZA 5BPMA 4NYNA 4ILGB 1BL3A 1JLCA 3CCJN 2XY7A 1C1CA 4FJHA 4CEAA 1S72N 1RTHA 4ZTJA 1VQ4N 5FPNA 3WXLA 4C8LA 3HOTA 4BDZA 4OO1J 5LMNK 4CHZA 2JWLA 1JLAA 2HHWA 3D0PA 1EP4A 3TAGA 2YX6A 2E8AA 4Z0UA 4DSLA 1E4FT 4GVMA 4M3TA 5FPEA 4E0DA 4FJJA 3U9DA 3DM2A 3AA5X 4I6MB 1GLFO 3TU5A 3THVA 5AFUH 4DR6K 2D0OA 3QEPA 1D9DA 1S1UA 3DLHA 4C1NK 3CYMA 3GG4A 4GV9A 4IO8A 3V81A 2IGIA 3LM9A 3VEZA 4DU4A 4KB1A 4FWPA 2QI2A 3MAQA 2NLXA 1KLNA 2Q0RA 3UKUA 3T3FA 4CJLA 2D0PA 3QDKA 3SUNA 1VQ8N 4PKHA 4JI3K 4CJ4A 4B8CA 2ZD1A 5JLHA 4DTRA 3AO5A 5M1OA 3TWHA 3IS9A 2YHAA 2GWKA 5MLCQ 3O5BA 4AHUA 4CJEA 4H0TB 3CPWM 4OGEA 2UXCK 4O5FA 4B1WB 2A42A 5HOOA 4A5BA 4IJAA 5E26A 3L2UA 2G8FA 1ZBFA 4QAGA 2BE2A 3HL8A 2P9KB 5AQVA 1N8RO 4DUYK 5GIPA 1VSJA 1REVA 4X66K 1Q9YA 4Z4EA 3HSCA 1NGIA 3VQBA 1QHTA 3E1YA 3ZX2A 3QB0A 3WNEA 3SPYA 4RCHA 3ID6A 4DSEA 1NKCA 4H0OA 2QWRA 2KKZA 2ZM6K 3CCUN 4RW7A 2O8CA 4CGHA 2D0AA 1HRHA 3HTVA 1I3AA 4CJTA 4DTMA 4DWIA 1LWEA 4HTUA 5B8HA 4FPBA 2GWJA 1NGHA 3VEOA 4FK4A 4M3YA 3L0QA 5KQDA 4B1UB 5KGXA 2E2NA 2PYJA 1W0HA 2E88A 4ELTA 4EHTA 4HUGA 4DKWA 3ZX3A 3UB5A 1JJ2M 4BRGA 1B9DA 4J2DA 1RBVA 1LAVA 3SV3A 4IG3A 2Y1IA 1D8YA 1JCGA 1F21A 3MN5A 3SUQA 2HHTA 4ISFA 3SQ2A 2VG5A 5SWMA 3RWUA 1HYZA 1ATNA 1C6VA 1GLLO 4DV5K 1ESVA 3K2PA 3QBXA 2H3GX 3RMAA 1IBKK 1VSFA 2I5JA 1T6CA 3TTCA 1JLGA 2X6SA 1WB9A 3RTVA 2GX9A 5EXWA 2IS3A 2CGLA 1SL1A 1UA0A 4JI8K 4N47A 3T1YK 1NJIO 4YFUA 4B1VA 4H0PA 3H46O 5GAHP 1WSEA 2X6NA 4EZ6A 2D1KA 4KB0A 1ZXOA 3SV4A 4H0XB 2OANA 4O55A 4OJRA 3ZSVA 4DQSA 1UWBA 2P1JA 3QETA 5EVZA 3VETA 4RWTA 3PSIA 3C7NB 4ID1A 3VEVA 2E2QA 5AQHA 3QERA 4WQ5C 2WONA 3VENA 1MU2A 3AO1A 3C6HA 2E6MA 1Y64A 1YJNN 4CE9A 4QS9A 4MLEA 3CD6N 4M42A 1IV0A 1NMNA 4FWOA 2PYLA 3OYNA 2D5RA 3RR7A 4M3WA 2HNYA 1IBMK 5LL6Z 4B3MK 4DV0K 1FW6A 3KLFA 5C0YA 2G8HA 3LDOA 2E5LK 2GEMA 3DRRA 2ZGZA 4FJKA 2ZWHA 3JXUA 4QCLA 4PKIA 3VGLA 1WSIA 4A59A 3WXJA 2E1ZA 3VQ4A 3ZSOA 4NCAA 1XHZA 4CJRA 3CC4N 3GL1A 5C25A 2KFNA 1OH5A 3K59A 4BC3A 4O5BA 1RFQA 4FZYA 4YOTA 2X78A 1XQSC 4DR4K 4ILHA 4EFHA 1BQMA 3RSEA 3JYTA 3HM8A 4AHSA 3MDQA 2VGNA 3D45A 4FWRA 2FF6A 1B92A 2VCPA 1NJWA 3Q7BA 1W2BM 3THXA 1RBSA 1VQ5N 2YJEA 5BRFA 3V1RA 4KAZA 2XY5A 4J8FA 5KGWA 4M63C 4DQ8A 1LCUA 1HNWK 3OW2M 4CF9A 4BGAA 5M1NA 4CK1A 3G6EN 4WF9L 2O8BB 3KTQA 1Q81O 1HR0K 3PLAA 2FBYA 3PX6A 1U6ZA 4J2EA 4G1QA 2P9LB 2KQ2A 1J6ZA 3PIPL 1WBBA 4B08A 1NU0A 4DSKA 1LAWA 1NKEA 3DXMA 3O4NA 1KAZA 1RCHA 2BUPA 4GKJK 3E9LA 3FE1A 4PL8A 1QVGM 4O8KA 1NK8A 3EKSA 1CLQA 3IMXA 4HCCA 2CH6A 3L2RA 3TSUA 1WSJA 3OVNA 5AQGA 4A2BA 3WNGA 3ZETA 1Z6RA 2FF3B 3PO4A 2OTJN 4BRIA 3RR8A 3C95A 4A62A 5EOYA 4M3RA 4FJGA 3NE6A 1ASUA 5M1QA 4K43A 4B1ZA 2F96A 1RBTA 1A5VA 3THYA 3CF5L 1SV5A 4DTOA 1DTQA 5F2RA 4JRQA 2VYPA 1Y97A 1FKPA 1YVNA 2E20A 1H1VA 1NGCA 1TVRA 4K42A 1P90A 4RG8A 3NAEA 3UKRB 2IIRA 4CGJA 1HKCA 3M1FA 3N4QA 4BQZA 4CK2A 3H3OB 3C7NA 2OPRA 4CZFA 2I7NA 4EP5A 3ENBA 2W41A 3O9TA 3OYIA 4E19A 1GOCA 4FLTA 1IO2A 4MLHA 5GIOA 3D7EO 2KZMA 2W42A 1UA1A 1WAJA 2QWOA 1TGOA 1IKXA 5FPDA 1TKXA 4LH4A 4C8KA 2PZSA 4FZZA 1OH6A 3QNOA 4IOCL 5BR9A 4CGIA 3I33A 4GW6A 3F5TA 2RF2A 5KPRA 2P9IB 2XHBA 3DXKB 2O8FA 1WUAA 4FO0A 1HPZA 4KFBA 4F4KA 4NCBA 3O8MA 4IWVA 2B6AA 1WSFA 3CCEN 4DG1A 3R8EA 4JI0K 3FZMA 3HJFA 4H0VB 3MEEA 3CFRA 1NKBA 5BR8K 4NLBA 1TAQA 1OKJA 4MO5A 4WQ4A 3G71N 2OYQA 3KWGA 5HRRA 4CJPA 1NK9A 3FR0A 1P8ZA 2HBKA 3HRGA 4DTUA 3CJ7A 3A2FA 4NXMK 3JS6A 3O3HA 3H1QA 1ASVA 4CBXA 1T05A 1ATRA 3K0SA 2DTUA 1Q9XA 4YNQA 2YCHA 1NGGA 3EY1A 2ZE2A 3OTOK 2IDOA 4W5NA 4EIAA 4B8AB 3THWA 2HHQA 2EWSA 4B9QA 2AA4A 2Q0UA 3NHGA 3SI6A 3CJ9A 1IG8A 3MN7A 1C0GA 1VAZA 3OBYA 4BREA 4IOAL 1EX4A 4Y1DA 1W7AA 1BU6O 1X9WA 5AQRA 2P9UA 4CK3A 2ASPA 1A5XA 3NBPA 3WNFA 4NXNK 1D5AA 3FZLA 2ITGA 4BWMA 3WQUA 3CQXA 2DPNA 4OX9K 4KHPK 3CC7N 4BGBA 1S22A 4JKGB 4B3RK 4CI6A 3A5NC 4YOVA 1TUYA 3IUCA 4ELVA 3VF4A 4RW4A 2DFFA 4E7KA 3TI0A 4I9LA 1U4BA 4EZ9A 1S9EA 3ZETB 3DJCA 1N32K 5EU7A 1CXQA 2GTDA 2NNWA 3VMFB 3SCXA 2YKNA 4BG9A 1QE1A 2ZQBA 1HYSA 4CZJA 4FJ9A 5H1SQ 1HYVA 4Z4FA 1KTQA 5JMVA 1BHLA 3QICA 4C23A 1YJ9N 3H3NO 3MEGA 4E1JA 4DFKA 1U2VB 3SMPA 1R59O 2FXUA 1FJGK 1NWKA 1VQKN 1T6DA 4BRMA 3KLGA 3AA3A 3AO2A 1L3UA 3CJ1A 5BRDA 5J2MA 4GVEA 1DTTA 2B4JA 3GE1A 5CYQA 3I8BA 3ZCMA 3NDKA 2HVIA 1EWQA 1HNXK 2G8UA 4DV3K 3J7AP 3C6TA 1Z26A 4C8OA 1TL3A 5K14A 3IAYA 1TL1A 4WE1A 1S3XA 3R6MA 4DSIA 2QTDA 4BE0A 5JS1A 1XI1A 2NRTA 3NGYA 4CEFA 3Q7CA 3U3YA 4NLCA 2P9NA 1N34K 4H5VA 1ATSA 4DHYA 1JKHA 2KLAA 3I8DA 4JKFA 4FVUA 1NGEA 3O4WA 1HJRA 4BR9A 2O8FB 5BN8A 4PHTX 2O4IA 2A40A 4PA1A 3M5RA 1E4GT 1RT1A 1C1AA 4HVJA 3ZT3A 3L3VA 2Q2RA 2V7ZA 1IKVA 3KJVA 2F8SA 3PSFA 4IEIA 1NK0A 2BGGA 2GBZA 4F3OA 3TTFA 3ULEB 4FSVA 4HWIA 1HLUA 3OJUA 4LH5A 2VWJA 5HRPA 3HM9A 2QKKA 1BI4B 2YNIA 3LL3A 3VF2A 3KK1A 3CXCM 3VQDA 2IVOA 4CJ3A 1TKDA 1T44A 4BR5A 4QS7A 3OBWA 4E1MA 4H8KA 3OYBA 3A5MC 4A61A 4YOYA 4ZTFA 1SKRA 2F9TA 3CJAA 3SUPA 3J81O 1X9MA 4DLEA 1NOYA 1VSEA 4LC9B 1RDUA 5CR4A 4DTXA 1DT9A 4O8UA 3DOKA 1U2VA 4OLBA 3CETA 3NF6A 1DGKN 4F2RA 3FZFA 4N76A 4JKHA 1VQPN 4I9QA 3HT3A 4CGDA 4KPYA 1LW0A 4ZHRA 3OHRA 1KQSM 3ID8A 4B9MA 3SBTA 1VSHA 4PWDA 4W5OA 2HHSA 3QBWA 4KHYA 3LAKA 1LW2A 1S1TA 1SZ2A 3ZSZA 1G99A 1TKTA 4CF1A 2PAVA 5CZ1A 2QWLA 4PL7A 4IKFA 1RDBA 4JI7K 5GAEP 4GNIA 4MDBA 1BIUA 2ATQA 1KAYA 3ZSRA 3CHWA 1VSIA 4DB3A 1U04A 1BQNA 3V9SA 3IG1A 3U9ZA
chains in the Genus database with same CATH topology
3BY5A 2W6KA 3EEQA 2W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY5 A;  2W6K A;  3EEQ A;  2W6L A; 
#chains in the Genus database with same CATH topology
 1Q82 O;  4B3T K;  3CC2 N;  3E01 A;  5GIN A;  2GV9 A;  3M8Q A;  4JHD A;  4A57 A;  3CCS N;  3QEX A;  3MXI A;  3KIO A;  2W6K A;  3OS1 A;  4KBO A;  3ALY A;  4FWS A;  1X1P A;  4XEI A;  3HBT A;  3P4I A;  3O80 A;  4JS5 A;  3OYE A;  3ZLJ A;  2G8V A;  1BIS A;  3DLK A;  3O08 A;  4YOU A;  1TYQ A;  5EX5 A;  3K5N A;  1ZC6 A;  4BVO A;  2ASO A;  5AQW A;  4M45 A;  1IJJ A;  3AO4 A;  3P1G A;  1BCM A;  4KHU A;  3O1B A;  4YDU A;  3DXM B;  4AM6 A;  4BRF A;  1RT5 A;  2KW4 A;  3AY9 A;  3ENH A;  2YNH A;  3O3F A;  5AJ3 K;  4M3X A;  2P9N B;  3DLG A;  3SZ2 A;  1RBR A;  4IFE A;  2KHO A;  2G8I A;  4FLW A;  4WFN L;  4AQY K;  3K9J A;  4UQG A;  3KKR A;  3FGU A;  3WXI A;  5SZT A;  4DFJ A;  3ZT4 A;  2BDP A;  3LP0 A;  3FZH A;  3LP2 A;  1L5U A;  4DTN A;  3LDQ A;  1JXE A;  4FJL A;  4I7F A;  2RE2 A;  3NVM A;  3VER A;  1D4X A;  3VQA A;  4GY2 B;  1BOT O;  3KHY A;  2KTQ A;  4DQQ A;  1JLQ A;  4IDH A;  4CIF A;  5E84 A;  3AA4 A;  4JLH A;  3ULE A;  1OH8 A;  2D0B A;  4FLU A;  1Q18 A;  4OPJ A;  2ZF5 O;  2J4R A;  2Z1J A;  4H5T A;  3ZSY A;  1RDW X;  1S6Q A;  3D2F A;  2O8E B;  4CEB A;  4FXD A;  3EKU A;  2B5J A;  3ZSX A;  3SAH A;  3CCL N;  3CJB A;  4JV5 K;  3QEV A;  5AQS A;  3AGR A;  3NMU A;  4I2P A;  4JI1 K;  5J1E A;  4BR0 A;  1VRT A;  2QK9 A;  1JLE A;  4JD2 A;  2D0C A;  1MA9 B;  3E9P A;  1VHX A;  2ITM A;  5HL7 L;  1NGA A;  1QQN A;  3LDL A;  3V9X A;  1U45 A;  5EY4 A;  1BG3 A;  4FZX C;  2W40 A;  4B9N A;  4H4O A;  1C0U A;  3CQ8 A;  3SLC A;  3RMD A;  3J80 O;  4QOZ B;  2DFH A;  3KWI A;  4QS8 A;  1HKG A;  5AQM A;  1GLD G;  3LDS A;  3CQY A;  3V1Q A;  5AQT A;  5AQJ A;  3S41 A;  4CIG A;  3WNH A;  3HPH A;  1QZ6 A;  4KTZ A;  2QWQ A;  3LZI A;  1X3M A;  1XMO K;  2HNZ A;  1RT4 A;  1YI2 N;  3LPU A;  4M3Z A;  2Y1J A;  4CZG A;  3VQ5 A;  3KKS A;  4O0J A;  3PY8 A;  1QHA A;  4BRK A;  4OPH A;  5JLF A;  3OYM A;  3SJJ A;  2FLO A;  3AVA A;  4CGF A;  1K73 O;  4JK7 A;  1VQM N;  3VTI A;  4M41 A;  4FWN A;  2NRH A;  3WT0 A;  3MWP A;  1SL2 A;  4DV1 K;  5LJW A;  1BA0 A;  5M1F A;  5HRS A;  3UIQ A;  3A0I X;  3NH2 A;  4AHT A;  3DOL A;  1KXP A;  3QFU A;  4HUF A;  3BUZ B;  3SJH A;  1JCE A;  1VSD A;  1TK8 A;  3NGZ A;  1RT2 A;  4WFA L;  1QSL A;  2UXB K;  3PIO L;  1ZYQ A;  2FBT A;  4FJI A;  3D2F B;  3MCA B;  4FOE A;  4DV7 K;  3TAQ A;  1K8K A;  1HPM A;  4Y0W A;  3VTH A;  5JVG L;  4BRD A;  3CCR N;  3P83 D;  1S1W A;  3VEY A;  3NVK A;  4M7Y A;  3A5O C;  1IKY A;  5DMR A;  4M7X A;  3VQ9 A;  2WC9 A;  1TUU A;  4FCY A;  4LF6 K;  3HK2 A;  1ITG A;  4I2Q A;  1NJX A;  4DTP A;  2RPI A;  4JRP A;  1JLF A;  2IC3 A;  3AVB A;  3L3U A;  1XC3 A;  5FRM A;  2CH5 A;  2XY8 A;  4FYD A;  5KQ8 A;  4DTS A;  1I39 A;  4E89 A;  5DK5 A;  1XWL A;  3P39 A;  1TK5 A;  3BY5 A;  3ITH A;  3MK6 A;  5IT9 O;  3V4I A;  1J5O A;  3I56 N;  4DLG A;  1HX1 A;  1JCF A;  1BA1 A;  2E4L A;  1NJZ A;  2NRW A;  2O8D B;  4K8Z A;  3T1H K;  3VA0 A;  4J2A A;  5KRS A;  3ZT0 A;  1XMQ K;  1YUW A;  3L8B A;  4AIL C;  1NGD A;  5FRO A;  5AZI A;  2QA4 N;  3O1W A;  1MWK A;  1RDD A;  4BE1 A;  3IDH A;  1BO5 O;  4OKE A;  1GLA G;  3HYF A;  4CFC A;  3AVI A;  4OKK A;  4CCH A;  4RW8 A;  1C0M A;  3ZYY X;  4YOX A;  4DSJ A;  3IKM A;  3TPQ A;  1NM1 A;  3SUO A;  1O1W A;  3O3G A;  4A5A A;  1JXB A;  2DY4 A;  1HQU A;  3CCM N;  2VQF K;  1QSS A;  3EEQ A;  4CZE A;  2V52 B;  3DRP A;  3MN6 A;  2G8W A;  1S1V A;  4FL9 A;  4LFC K;  4E7J A;  4IFV A;  3VPZ A;  3KZB A;  3J7Y P;  4W5T A;  2HF4 A;  1U48 A;  1J54 A;  4FJ8 A;  4LSL A;  2BAN A;  1Q86 O;  3QNN A;  4IXC A;  3M8R A;  3WXM B;  3LZJ A;  1XHX A;  3QEW A;  4Z4C A;  1HNZ K;  1X3N A;  4OPA A;  3MX5 A;  4JKE A;  4W5Q A;  4BDP A;  4Q5V A;  4DV2 K;  4FLX A;  2FBV A;  1T7P A;  2F9W A;  4BRA A;  1C1B A;  1KCF A;  1KC8 O;  3QES A;  2HHX A;  4U7B A;  5TKY A;  1VQL N;  2P5G A;  3HI0 A;  3VQQ A;  1BIZ A;  4FM1 A;  5M1P A;  3LPT A;  1KFS A;  5AQO A;  4KHW A;  1WAF A;  1SL0 A;  3PX0 A;  5CE3 A;  2WBN A;  2YV0 X;  3G25 A;  4KKO A;  3F73 A;  2UU9 K;  3H45 C;  3VES A;  3QML A;  1T8E A;  4KH4 A;  3TR8 A;  4LF5 K;  3UKU B;  5AQZ A;  1GLB G;  2WFB A;  4ICL A;  1O13 A;  2Z1G A;  1N36 K;  2VG7 A;  3HPG A;  2PY5 A;  1KAX A;  2V7Y A;  5KPT A;  4OVL A;  1CZ9 A;  3VGM A;  3WQT A;  4JEP A;  1K8K B;  1NOZ A;  3DLL L;  1YVU A;  4OGC A;  3NF8 A;  3CFP A;  1GLC G;  1L3T A;  3HP6 A;  3EE8 A;  2E6L A;  3M8P A;  4PUO A;  3ULD A;  1NGF A;  3O9U A;  2A41 A;  2JLE A;  3H1V X;  4TSX A;  5LY3 A;  4IEE A;  2QKB A;  1NK7 A;  1YT3 A;  2HND A;  2IVP A;  3EZW A;  4NO7 A;  3CM5 A;  4DR3 K;  3E9O A;  3LAL A;  1YJW N;  3J7Z O;  4NYF A;  4BRL A;  3D6R A;  1RT3 A;  3RSE B;  4CJU A;  3FLC O;  5AQU A;  3SYZ A;  3LAN A;  3OY9 A;  1CZA N;  2AP1 A;  1XNQ K;  2GEL A;  2QW9 A;  2YNF A;  2HB5 A;  2V51 B;  4JS4 A;  5ELZ A;  3VF6 A;  3AGK A;  3ISN C;  4W5R A;  3K5M A;  2O8D A;  3ATV A;  2HVH A;  3DLE A;  1NG9 A;  4DSF A;  1TV6 A;  3C6U A;  4FJN A;  3O9S A;  5AFU A;  4CHN A;  2O8B A;  1SAZ A;  2PFU A;  4IJN A;  1KRP A;  1BDG A;  1OH7 A;  2IVN A;  1GOA A;  2A5X A;  5CY4 A;  4WFB L;  3CME N;  1TYQ B;  4CF0 A;  5FLX O;  3ZEU B;  3ENO A;  4C1N I;  5F1X A;  4YHH K;  3LP3 A;  4XIU A;  3TAP A;  4KI4 A;  4Q0B A;  3CER A;  4B1X B;  3O6W A;  2P9P A;  4CFB A;  3K57 A;  3G0Z A;  5F0X A;  4H4M A;  3KD1 E;  4CJV A;  4CZL A;  4OLA A;  1ILY A;  3DI6 A;  2W6L A;  3L2V A;  2Q31 A;  1HNV A;  2VG6 A;  5C42 A;  4LY7 A;  2ZJQ L;  2AJQ A;  4C8M A;  1KSP A;  1SKS A;  4YOW A;  4FW2 A;  5C2D A;  3L4I A;  2QXF A;  4R79 A;  1Q8I A;  2OPP A;  2HBM A;  1GLE G;  1HQE A;  2P9U B;  1I94 K;  4BC2 A;  3THW B;  3NH1 A;  4B1Y B;  4ILJ A;  3I0S A;  1TAU A;  5J2P A;  1LOT B;  4CJK A;  4KH6 A;  3K9K A;  5E41 A;  1LV5 A;  2F4V K;  3BGR A;  4BAC A;  2D4W A;  3OYK A;  2OTL N;  1DEJ A;  4LF7 K;  2YHB A;  1M90 O;  3C6A A;  2O8E A;  2XRI A;  4DF8 A;  4B9T A;  1G15 A;  3S3M A;  1HUX A;  2HST A;  3K58 A;  3VQ6 A;  2HHV A;  2Q3S A;  3OYF A;  2ETJ A;  3R1X A;  4DS4 A;  3G10 A;  2QWP A;  2FBX A;  2NRR A;  2OA8 A;  4JD2 B;  1VSL A;  3HST B;  3OS2 A;  1HNI A;  3M8S A;  4DS5 A;  4N56 A;  3OYL A;  1R0A A;  4Y1C A;  3CG7 A;  4CJ7 A;  1RTI A;  3KK2 A;  1RIL A;  3KLH A;  2WTU A;  1J53 A;  1LWF A;  5KRT A;  4DR7 K;  3MXJ A;  5C2F A;  4O4G A;  4CZI A;  1YTA A;  3AO3 A;  4DF4 A;  5I42 A;  2I7P A;  1FXX A;  5BPL A;  4HUE A;  1EET A;  4JI2 K;  4KI6 A;  3NH0 A;  4H5R A;  1ZBH A;  3SAF A;  1NK5 A;  4FLZ A;  3S3O A;  1WNS A;  4A2A A;  1IH7 A;  3UE5 A;  2DFE A;  4FM0 A;  4CVN E;  3SK3 A;  1ZBU A;  3QIP A;  4WQ5 A;  3NFA A;  1L3V A;  4Z4I A;  3RRH A;  1K6Y A;  4CFA A;  2UUC K;  5CHI A;  4FWK A;  3SQ4 A;  1SS6 A;  4GV3 A;  2YI1 A;  3MCP A;  3M3Z A;  4JNE A;  4C8N A;  1GLJ O;  1UAX A;  3HVT A;  3MN9 A;  4DMN A;  3S9H A;  3EL2 A;  3ASM A;  4E7L A;  3LP1 A;  2CGJ A;  3TSP A;  3TAM A;  4CJW A;  4Z4G A;  4DQR A;  2RKI A;  2HHH K;  4GV6 A;  4WCE L;  4CD3 A;  2QWN A;  3R3L A;  4CEQ A;  4FLY A;  1BCO A;  1CXU A;  2IOC A;  3SAG A;  4GKK K;  1RNH A;  1J9A A;  4Z94 A;  5DM6 L;  1NGB A;  4BDY A;  3GDQ A;  2HOE A;  4JAX A;  3GOI A;  1MWM A;  2Z1H A;  4WQ4 C;  3F9K A;  1WLJ A;  1YAG A;  2ASM A;  5FRN A;  2P5O A;  1BWF O;  5IWA K;  3DMJ A;  1KLM A;  1EQY A;  3RMC A;  3HOS A;  5HP1 A;  4HTL A;  5JVH L;  3BF1 A;  3AVH A;  2P9K A;  4F8R A;  2OZM A;  3P31 A;  4JK9 A;  4YY3 K;  1RT6 A;  5CZ2 A;  3MX2 A;  4EP4 A;  1X9J A;  4K8X A;  3FFI A;  3VN5 A;  4DCH A;  1S5J A;  3H08 A;  3NGI A;  3BEX A;  2VGM A;  4BG8 A;  2VWK A;  3AAQ A;  3U4L A;  4JI4 K;  4U67 L;  2O8C B;  4LD0 A;  4CEC A;  3AVN A;  1WSH A;  2NUB A;  4ISG A;  3RMB A;  3FFK B;  3ZX0 A;  2X74 A;  4X62 K;  1W9H A;  2JWK A;  4JKC A;  5LJV A;  5JIC A;  4CJS A;  5AZI B;  1VQ7 N;  4BRO A;  4BRP A;  2A3Z A;  1E3M A;  1S1X A;  3VEW A;  3HXM A;  1U47 A;  3VQE A;  2FSK A;  1NGJ A;  4BR4 A;  4KV8 A;  4CGG A;  4LF4 K;  2FSN A;  2Z1I A;  1NBW A;  3ZT1 A;  3AAR A;  3P5J A;  4CER A;  1VQ6 N;  1VQN N;  3HO1 A;  4CHO A;  3M6G A;  1HKB A;  4JKD A;  3L2W A;  5LMU K;  1KVA A;  5AR0 A;  4DQP A;  2KZZ A;  1WBD A;  1N33 K;  2IAJ A;  2HMP A;  1Z05 A;  2HBL A;  2WOM A;  5ADX A;  4FJ7 A;  2HW3 A;  3CCV N;  1YIJ N;  4DR1 K;  4ID5 A;  5I9E B;  4O44 A;  2XY6 A;  3S3N A;  1V4T A;  3R9P A;  5AZJ B;  4PQU A;  3DXK A;  1FKO A;  3MWT A;  4BRH A;  5C12 A;  1OVY A;  4JKB A;  3U6F A;  5AQL A;  4BRQ A;  5AQQ A;  4LSN A;  1RDC A;  3OYJ A;  4AM7 A;  1YHQ N;  5HLF A;  3DLB A;  5AQI A;  2G8K A;  3CPE A;  1HJO A;  3OS0 A;  1BUP A;  3CI5 A;  3ZSW A;  4K25 A;  1N6Q A;  3WXK A;  2EX3 A;  1BI4 A;  4FW1 A;  4CHQ A;  4E1N A;  3O4Q A;  3CIP A;  3VGK A;  4RTF D;  1S6P A;  4CEE A;  3CCQ N;  2RHK A;  3MMV A;  5HBM A;  5J2Q A;  5AQY A;  4UY8 O;  5A2Q O;  3JSM A;  4DU1 A;  2F7T A;  1WSG A;  3KK3 A;  1EKE A;  4B3S K;  4BC5 A;  4XH5 A;  4KH5 A;  2XO7 A;  2R7Y A;  3C94 A;  4CJF A;  1K8A O;  2YHX A;  4J2B A;  2GUP A;  4DR5 K;  2BH1 A;  4NCG A;  2ZJR L;  1NLV A;  3J8A A;  3QO9 A;  3PO5 A;  4CD1 A;  2FSJ A;  4KTW A;  1RT7 A;  3VQC A;  3H6E A;  1SQK A;  4IFY A;  3HZ6 A;  2EHG A;  3VOV A;  3HVR A;  3V1O A;  3OA9 A;  1ZBS A;  4V19 S;  5AQN A;  2NRZ A;  3BZC A;  4KO0 A;  4ISE A;  5ADX H;  4DTJ A;  2A1R A;  4CZH A;  3EE9 A;  4FWM A;  3L4Q A;  5T7B A;  2QM1 A;  4CBW A;  3THY B;  4B9V A;  3AVF A;  4CF2 A;  2P9S A;  2YHY A;  2NZT A;  3O9R A;  3QFP A;  4IDK A;  1A5W A;  5KI6 A;  2VQE K;  3UKR A;  5D3G A;  3AVJ A;  3VQP A;  3OYC A;  2OPQ A;  3F9M A;  3K5O A;  5JS2 A;  3LAM A;  3WEE A;  2YKM A;  3ATU A;  3K5L A;  3NF7 A;  2A1S A;  3B6P A;  3EO3 A;  3I55 N;  5I3U A;  3BZK A;  2PBD A;  5AQX A;  3THX B;  4H5N A;  3KD5 E;  2P9I A;  4CED A;  4MQ3 A;  1BGX T;  1Z25 A;  1NJY A;  4GMJ B;  4BVP A;  1D9F A;  4JN4 A;  1N5Y A;  1GOB A;  4AH9 A;  4M3U A;  1M1K O;  1HMV A;  5M1K A;  1K9M O;  3I0R A;  3LWM A;  3V9U A;  3VEX A;  4F3T A;  4DQI A;  2P9L A;  4CFD A;  4BRN A;  3A5L C;  2HHU A;  1QQC A;  2UXD K;  3BDP A;  4H0Y B;  3SNN A;  2BTF A;  3HP9 A;  4MDA A;  4FJ5 A;  3PV8 A;  3VQ7 A;  2E2O A;  5GAG P;  3P38 A;  3SBG A;  4DR2 K;  3E66 A;  4FM2 A;  4I6M A;  3BF3 A;  3MED A;  3RVC A;  3KLI A;  3TAF A;  4CZM A;  2HMI A;  2WUS A;  3WUH A;  1ASW A;  3VA3 A;  5FPM A;  4X65 K;  2P51 A;  1VQO N;  4BWJ A;  3CJC A;  5DM7 L;  2O4G A;  2F8T A;  4X64 K;  4HHT A;  1JL2 A;  4CIE A;  1KVB A;  4JI6 K;  5AZJ A;  3L6Q A;  5KPZ A;  4Z4H A;  3CFO A;  4FLV A;  3N4P A;  3GBT A;  4KHN A;  3ZT2 A;  3TAR A;  3JAM O;  3AV9 A;  5BRE A;  1S9G A;  3F2K A;  2QEX N;  4L8R B;  3C0B A;  4PY5 A;  1IKW A;  1X9S A;  4RW9 A;  1RBU A;  5FDL A;  3VQ8 A;  1IG9 A;  4CEO A;  4DFM A;  2P9S B;  3AVK A;  4FOI A;  3SQ1 A;  3TAB A;  2GUI A;  1NMD A;  4K41 A;  4YDU C;  1NK6 A;  3AVM A;  4YOR A;  4E3S A;  4N5S A;  4B9U A;  3IFR A;  1VSK A;  4E7H A;  1XUP O;  4IO9 L;  2JGU A;  3T7Z A;  2Q1N A;  1VK0 A;  1VSM A;  4F9O A;  3DWL A;  3MXM A;  3AVC A;  5AQP A;  1YF5 L;  4FWQ A;  1JL1 A;  1LWC A;  3ZSQ A;  4CBU A;  1ZBL A;  1T03 A;  3W3D A;  3DYA A;  3W0L A;  4CF8 A;  2A6A A;  4H03 B;  4O0I A;  2HF3 A;  4ELU A;  4BE2 A;  3TAN A;  1FK9 A;  4CJ5 A;  2QXL A;  1EO1 A;  5BPN A;  1YTU A;  4JK8 A;  3U3G A;  3B6O A;  1QQM A;  2QWM A;  4IZ9 A;  2YJF A;  3TAE A;  4JI5 K;  4LFB K;  4FK0 A;  1SUQ A;  3TTD A;  4HCB A;  3QLH A;  3FZK A;  4DV6 K;  5HRO A;  4AHC A;  4R5P A;  4EAH D;  1QS4 A;  2OZS A;  3PUF A;  1KFD A;  4L3Q A;  2UYT A;  4BR2 A;  4AHV A;  1DKG D;  4LF9 K;  3LM2 A;  4KRE A;  5BN9 A;  3LDP A;  1NNE A;  5C24 A;  1T3V A;  3PX4 A;  3BP8 A;  2OPS A;  4CEZ A;  3B8A X;  4IOX A;  3QIO A;  4FJX A;  3OYH A;  5C10 A;  4IG0 A;  1KVC A;  4OKJ A;  4KRF A;  3QIN A;  2ZGY A;  4FWL A;  1JLB A;  1WN7 A;  4MO4 A;  4RW6 A;  1EXQ A;  1EWR A;  2VWB A;  4PKG A;  2FC0 A;  3V6D A;  4OPK A;  2NRX A;  2OCE A;  3AAP A;  3SMS A;  1W97 L;  2LSN A;  1RTJ A;  3D2E B;  4K0K K;  2ZJP L;  2E2P A;  4CZK A;  1QVF M;  1RDA A;  3RRG A;  4F2S A;  3L2Q A;  2Q97 A;  5AQF A;  3ZEU A;  4DFP A;  4B3O A;  1VRU A;  4BRC A;  3CMA N;  1QZ5 A;  4BY9 C;  4KTQ A;  4DUZ K;  4FJM A;  3G4S N;  1KD1 O;  2P9P B;  4FVM A;  1CZB A;  1RGI A;  3KVG A;  4CJQ A;  5J2N A;  4CHP A;  3V9Z A;  1NK4 A;  1J5E K;  2NRV A;  3DRS A;  3QEI A;  4E7I A;  1YIT N;  4JKA A;  4JKG A;  1U49 A;  1C0T A;  1B9F A;  3OYD A;  3T69 A;  3U8X A;  4BQL A;  3LDN A;  4WYB A;  3IRX A;  3OYG A;  3LWL A;  2UUA K;  1QSY A;  1L3S A;  4DU3 A;  3CM6 A;  5BRH A;  1Q7Y O;  3SQ0 A;  3DLR A;  3NCI A;  1C0F A;  5C15 A;  3OYA A;  3A8Y A;  3AVG A;  3HPO A;  1YXQ A;  4IBN A;  1WOQ A;  2YNG A;  2RN2 A;  2Q36 A;  4B9S A;  4NB4 A;  1QTM A;  4AHR A;  4N41 A;  1OVQ A;  4H5W A;  3KLE A;  4XH1 A;  2HBJ A;  1XC9 A;  5GAD P;  4KHQ A;  4BC4 A;  4G9Z A;  4CHY A;  1XNR K;  3EYZ A;  3DAW A;  4KHS A;  2YHW A;  4XH4 A;  4CES A;  1UOC A;  5AQK A;  4B9L A;  2E1Y A;  4LFA K;  2UUB K;  2KFZ A;  1RTD A;  2CGK A;  3T1A A;  4AF1 A;  4EHU A;  1SKW A;  3AVL A;  3NF9 A;  1IBL K;  4LF8 K;  3AA2 A;  4BR7 A;  4FPA A;  5TKW A;  1TK0 A;  3OJS A;  4JHD B;  4JYA K;  1MDU B;  1ZBI A;  3T19 A;  3EZ5 A;  4MFB A;  4DV4 K;  3O9Q A;  3WEE B;  1DLO A;  3SPZ A;  4FK2 A;  3C65 A;  4CW7 B;  5CYM A;  3EN9 A;  3MEC A;  3V9W A;  3KK7 A;  3TSQ A;  3D2E A;  1QQO A;  1VQ9 N;  5KTQ A;  5HRN A;  1V4S A;  1TKZ A;  5BPM A;  4NYN A;  4ILG B;  1BL3 A;  1JLC A;  3CCJ N;  2XY7 A;  1C1C A;  4FJH A;  4CEA A;  1S72 N;  1RTH A;  4ZTJ A;  1VQ4 N;  5FPN A;  3WXL A;  4C8L A;  3HOT A;  4BDZ A;  4OO1 J;  5LMN K;  4CHZ A;  2JWL A;  1JLA A;  2HHW A;  3D0P A;  1EP4 A;  3TAG A;  2YX6 A;  2E8A A;  4Z0U A;  4DSL A;  1E4F T;  4GVM A;  4M3T A;  5FPE A;  4E0D A;  4FJJ A;  3U9D A;  3DM2 A;  3AA5 X;  4I6M B;  1GLF O;  3TU5 A;  3THV A;  5AFU H;  4DR6 K;  2D0O A;  3QEP A;  1D9D A;  1S1U A;  3DLH A;  4C1N K;  3CYM A;  3GG4 A;  4GV9 A;  4IO8 A;  3V81 A;  2IGI A;  3LM9 A;  3VEZ A;  4DU4 A;  4KB1 A;  4FWP A;  2QI2 A;  3MAQ A;  2NLX A;  1KLN A;  2Q0R A;  3UKU A;  3T3F A;  4CJL A;  2D0P A;  3QDK A;  3SUN A;  1VQ8 N;  4PKH A;  4JI3 K;  4CJ4 A;  4B8C A;  2ZD1 A;  5JLH A;  4DTR A;  3AO5 A;  5M1O A;  3TWH A;  3IS9 A;  2YHA A;  2GWK A;  5MLC Q;  3O5B A;  4AHU A;  4CJE A;  4H0T B;  3CPW M;  4OGE A;  2UXC K;  4O5F A;  4B1W B;  2A42 A;  5HOO A;  4A5B A;  4IJA A;  5E26 A;  3L2U A;  2G8F A;  1ZBF A;  4QAG A;  2BE2 A;  3HL8 A;  2P9K B;  5AQV A;  1N8R O;  4DUY K;  5GIP A;  1VSJ A;  1REV A;  4X66 K;  1Q9Y A;  4Z4E A;  3HSC A;  1NGI A;  3VQB A;  1QHT A;  3E1Y A;  3ZX2 A;  3QB0 A;  3WNE A;  3SPY A;  4RCH A;  3ID6 A;  4DSE A;  1NKC A;  4H0O A;  2QWR A;  2KKZ A;  2ZM6 K;  3CCU N;  4RW7 A;  2O8C A;  4CGH A;  2D0A A;  1HRH A;  3HTV A;  1I3A A;  4CJT A;  4DTM A;  4DWI A;  1LWE A;  4HTU A;  5B8H A;  4FPB A;  2GWJ A;  1NGH A;  3VEO A;  4FK4 A;  4M3Y A;  3L0Q A;  5KQD A;  4B1U B;  5KGX A;  2E2N A;  2PYJ A;  1W0H A;  2E88 A;  4ELT A;  4EHT A;  4HUG A;  4DKW A;  3ZX3 A;  3UB5 A;  1JJ2 M;  4BRG A;  1B9D A;  4J2D A;  1RBV A;  1LAV A;  3SV3 A;  4IG3 A;  2Y1I A;  1D8Y A;  1JCG A;  1F21 A;  3MN5 A;  3SUQ A;  2HHT A;  4ISF A;  3SQ2 A;  2VG5 A;  5SWM A;  3RWU A;  1HYZ A;  1ATN A;  1C6V A;  1GLL O;  4DV5 K;  1ESV A;  3K2P A;  3QBX A;  2H3G X;  3RMA A;  1IBK K;  1VSF A;  2I5J A;  1T6C A;  3TTC A;  1JLG A;  2X6S A;  1WB9 A;  3RTV A;  2GX9 A;  5EXW A;  2IS3 A;  2CGL A;  1SL1 A;  1UA0 A;  4JI8 K;  4N47 A;  3T1Y K;  1NJI O;  4YFU A;  4B1V A;  4H0P A;  3H46 O;  5GAH P;  1WSE A;  2X6N A;  4EZ6 A;  2D1K A;  4KB0 A;  1ZXO A;  3SV4 A;  4H0X B;  2OAN A;  4O55 A;  4OJR A;  3ZSV A;  4DQS A;  1UWB A;  2P1J A;  3QET A;  5EVZ A;  3VET A;  4RWT A;  3PSI A;  3C7N B;  4ID1 A;  3VEV A;  2E2Q A;  5AQH A;  3QER A;  4WQ5 C;  2WON A;  3VEN A;  1MU2 A;  3AO1 A;  3C6H A;  2E6M A;  1Y64 A;  1YJN N;  4CE9 A;  4QS9 A;  4MLE A;  3CD6 N;  4M42 A;  1IV0 A;  1NMN A;  4FWO A;  2PYL A;  3OYN A;  2D5R A;  3RR7 A;  4M3W A;  2HNY A;  1IBM K;  5LL6 Z;  4B3M K;  4DV0 K;  1FW6 A;  3KLF A;  5C0Y A;  2G8H A;  3LDO A;  2E5L K;  2GEM A;  3DRR A;  2ZGZ A;  4FJK A;  2ZWH A;  3JXU A;  4QCL A;  4PKI A;  3VGL A;  1WSI A;  4A59 A;  3WXJ A;  2E1Z A;  3VQ4 A;  3ZSO A;  4NCA A;  1XHZ A;  4CJR A;  3CC4 N;  3GL1 A;  5C25 A;  2KFN A;  1OH5 A;  3K59 A;  4BC3 A;  4O5B A;  1RFQ A;  4FZY A;  4YOT A;  2X78 A;  1XQS C;  4DR4 K;  4ILH A;  4EFH A;  1BQM A;  3RSE A;  3JYT A;  3HM8 A;  4AHS A;  3MDQ A;  2VGN A;  3D45 A;  4FWR A;  2FF6 A;  1B92 A;  2VCP A;  1NJW A;  3Q7B A;  1W2B M;  3THX A;  1RBS A;  1VQ5 N;  2YJE A;  5BRF A;  3V1R A;  4KAZ A;  2XY5 A;  4J8F A;  5KGW A;  4M63 C;  4DQ8 A;  1LCU A;  1HNW K;  3OW2 M;  4CF9 A;  4BGA A;  5M1N A;  4CK1 A;  3G6E N;  4WF9 L;  2O8B B;  3KTQ A;  1Q81 O;  1HR0 K;  3PLA A;  2FBY A;  3PX6 A;  1U6Z A;  4J2E A;  4G1Q A;  2P9L B;  2KQ2 A;  1J6Z A;  3PIP L;  1WBB A;  4B08 A;  1NU0 A;  4DSK A;  1LAW A;  1NKE A;  3DXM A;  3O4N A;  1KAZ A;  1RCH A;  2BUP A;  4GKJ K;  3E9L A;  3FE1 A;  4PL8 A;  1QVG M;  4O8K A;  1NK8 A;  3EKS A;  1CLQ A;  3IMX A;  4HCC A;  2CH6 A;  3L2R A;  3TSU A;  1WSJ A;  3OVN A;  5AQG A;  4A2B A;  3WNG A;  3ZET A;  1Z6R A;  2FF3 B;  3PO4 A;  2OTJ N;  4BRI A;  3RR8 A;  3C95 A;  4A62 A;  5EOY A;  4M3R A;  4FJG A;  3NE6 A;  1ASU A;  5M1Q A;  4K43 A;  4B1Z A;  2F96 A;  1RBT A;  1A5V A;  3THY A;  3CF5 L;  1SV5 A;  4DTO A;  1DTQ A;  5F2R A;  4JRQ A;  2VYP A;  1Y97 A;  1FKP A;  1YVN A;  2E20 A;  1H1V A;  1NGC A;  1TVR A;  4K42 A;  1P90 A;  4RG8 A;  3NAE A;  3UKR B;  2IIR A;  4CGJ A;  1HKC A;  3M1F A;  3N4Q A;  4BQZ A;  4CK2 A;  3H3O B;  3C7N A;  2OPR A;  4CZF A;  2I7N A;  4EP5 A;  3ENB A;  2W41 A;  3O9T A;  3OYI A;  4E19 A;  1GOC A;  4FLT A;  1IO2 A;  4MLH A;  5GIO A;  3D7E O;  2KZM A;  2W42 A;  1UA1 A;  1WAJ A;  2QWO A;  1TGO A;  1IKX A;  5FPD A;  1TKX A;  4LH4 A;  4C8K A;  2PZS A;  4FZZ A;  1OH6 A;  3QNO A;  4IOC L;  5BR9 A;  4CGI A;  3I33 A;  4GW6 A;  3F5T A;  2RF2 A;  5KPR A;  2P9I B;  2XHB A;  3DXK B;  2O8F A;  1WUA A;  4FO0 A;  1HPZ A;  4KFB A;  4F4K A;  4NCB A;  3O8M A;  4IWV A;  2B6A A;  1WSF A;  3CCE N;  4DG1 A;  3R8E A;  4JI0 K;  3FZM A;  3HJF A;  4H0V B;  3MEE A;  3CFR A;  1NKB A;  5BR8 K;  4NLB A;  1TAQ A;  1OKJ A;  4MO5 A;  4WQ4 A;  3G71 N;  2OYQ A;  3KWG A;  5HRR A;  4CJP A;  1NK9 A;  3FR0 A;  1P8Z A;  2HBK A;  3HRG A;  4DTU A;  3CJ7 A;  3A2F A;  4NXM K;  3JS6 A;  3O3H A;  3H1Q A;  1ASV A;  4CBX A;  1T05 A;  1ATR A;  3K0S A;  2DTU A;  1Q9X A;  4YNQ A;  2YCH A;  1NGG A;  3EY1 A;  2ZE2 A;  3OTO K;  2IDO A;  4W5N A;  4EIA A;  4B8A B;  3THW A;  2HHQ A;  2EWS A;  4B9Q A;  2AA4 A;  2Q0U A;  3NHG A;  3SI6 A;  3CJ9 A;  1IG8 A;  3MN7 A;  1C0G A;  1VAZ A;  3OBY A;  4BRE A;  4IOA L;  1EX4 A;  4Y1D A;  1W7A A;  1BU6 O;  1X9W A;  5AQR A;  2P9U A;  4CK3 A;  2ASP A;  1A5X A;  3NBP A;  3WNF A;  4NXN K;  1D5A A;  3FZL A;  2ITG A;  4BWM A;  3WQU A;  3CQX A;  2DPN A;  4OX9 K;  4KHP K;  3CC7 N;  4BGB A;  1S22 A;  4JKG B;  4B3R K;  4CI6 A;  3A5N C;  4YOV A;  1TUY A;  3IUC A;  4ELV A;  3VF4 A;  4RW4 A;  2DFF A;  4E7K A;  3TI0 A;  4I9L A;  1U4B A;  4EZ9 A;  1S9E A;  3ZET B;  3DJC A;  1N32 K;  5EU7 A;  1CXQ A;  2GTD A;  2NNW A;  3VMF B;  3SCX A;  2YKN A;  4BG9 A;  1QE1 A;  2ZQB A;  1HYS A;  4CZJ A;  4FJ9 A;  5H1S Q;  1HYV A;  4Z4F A;  1KTQ A;  5JMV A;  1BHL A;  3QIC A;  4C23 A;  1YJ9 N;  3H3N O;  3MEG A;  4E1J A;  4DFK A;  1U2V B;  3SMP A;  1R59 O;  2FXU A;  1FJG K;  1NWK A;  1VQK N;  1T6D A;  4BRM A;  3KLG A;  3AA3 A;  3AO2 A;  1L3U A;  3CJ1 A;  5BRD A;  5J2M A;  4GVE A;  1DTT A;  2B4J A;  3GE1 A;  5CYQ A;  3I8B A;  3ZCM A;  3NDK A;  2HVI A;  1EWQ A;  1HNX K;  2G8U A;  4DV3 K;  3J7A P;  3C6T A;  1Z26 A;  4C8O A;  1TL3 A;  5K14 A;  3IAY A;  1TL1 A;  4WE1 A;  1S3X A;  3R6M A;  4DSI A;  2QTD A;  4BE0 A;  5JS1 A;  1XI1 A;  2NRT A;  3NGY A;  4CEF A;  3Q7C A;  3U3Y A;  4NLC A;  2P9N A;  1N34 K;  4H5V A;  1ATS A;  4DHY A;  1JKH A;  2KLA A;  3I8D A;  4JKF A;  4FVU A;  1NGE A;  3O4W A;  1HJR A;  4BR9 A;  2O8F B;  5BN8 A;  4PHT X;  2O4I A;  2A40 A;  4PA1 A;  3M5R A;  1E4G T;  1RT1 A;  1C1A A;  4HVJ A;  3ZT3 A;  3L3V A;  2Q2R A;  2V7Z A;  1IKV A;  3KJV A;  2F8S A;  3PSF A;  4IEI A;  1NK0 A;  2BGG A;  2GBZ A;  4F3O A;  3TTF A;  3ULE B;  4FSV A;  4HWI A;  1HLU A;  3OJU A;  4LH5 A;  2VWJ A;  5HRP A;  3HM9 A;  2QKK A;  1BI4 B;  2YNI A;  3LL3 A;  3VF2 A;  3KK1 A;  3CXC M;  3VQD A;  2IVO A;  4CJ3 A;  1TKD A;  1T44 A;  4BR5 A;  4QS7 A;  3OBW A;  4E1M A;  4H8K A;  3OYB A;  3A5M C;  4A61 A;  4YOY A;  4ZTF A;  1SKR A;  2F9T A;  3CJA A;  3SUP A;  3J81 O;  1X9M A;  4DLE A;  1NOY A;  1VSE A;  4LC9 B;  1RDU A;  5CR4 A;  4DTX A;  1DT9 A;  4O8U A;  3DOK A;  1U2V A;  4OLB A;  3CET A;  3NF6 A;  1DGK N;  4F2R A;  3FZF A;  4N76 A;  4JKH A;  1VQP N;  4I9Q A;  3HT3 A;  4CGD A;  4KPY A;  1LW0 A;  4ZHR A;  3OHR A;  1KQS M;  3ID8 A;  4B9M A;  3SBT A;  1VSH A;  4PWD A;  4W5O A;  2HHS A;  3QBW A;  4KHY A;  3LAK A;  1LW2 A;  1S1T A;  1SZ2 A;  3ZSZ A;  1G99 A;  1TKT A;  4CF1 A;  2PAV A;  5CZ1 A;  2QWL A;  4PL7 A;  4IKF A;  1RDB A;  4JI7 K;  5GAE P;  4GNI A;  4MDB A;  1BIU A;  2ATQ A;  1KAY A;  3ZSR A;  3CHW A;  1VSI A;  4DB3 A;  1U04 A;  1BQN A;  3V9S A;  3IG1 A;  3U9Z A; 
#chains in the Genus database with same CATH homology
 3BY5 A;  2W6K A;  3EEQ A;  2W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...