2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
b'MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH superfamily
1BQNA 3AVJA 5AQNA 3VQ5A 1EETA 1KLMA 3T19A 3WNEA 5HRSA 2IIRA 4KAZA 3VQAA 3PO4A 1JLAA 4DTSA 2QWMA 4A62A 4O55A 4DV7K 1YIJN 1VSMA 1VSHA 2RE2A 2HBJA 5FRNA 2VYPA 2Z1HA 4KH6A 2DTUA 1Z05A 1VHXA 2NRRA 2P5GA 4GMJB 4O5BA 3TTFA 1T03A 1CZAN 2HW3A 1BI4A 1HMVA 1WSEA 3MDQA 1NGHA 1ZBIA 4B9TA 1SV5A 1N8RO 1TL3A 4CEEA 1S1TA 2QXFA 3RMBA 1REVA 4H0OA 3NBPA 1RT2A 3A5LC 3CHWA 4DV4K 4J2AA 4NCAA 4BRKA 2OA8A 4IDKA 4Y1CA 2A42A 3SI6A 4N47A 3NH1A 3G71N 5BN9A 4NCBA 5M1KA 3DOLA 1TL1A 4BVPA 3RR7A 3SMPA 3VF4A 3I8BA 5FRMA 1S1VA 4YFUA 2Q2RA 3SQ4A 4OPKA 4Q0BA 3BEXA 4CD3A 3BP8A 1RTDA 4KV8A 4QS7A 4AHCA 3CQXA 1K8AO 3HP9A 3K5MA 4BRFA 1IO2A 1YF5L 1S9EA 3O9RA 3MEGA 4Q5VA 3TAEA 3C95A 2Q0RA 4Z0UA 2XY7A 1VSDA 2G8KA 2KZMA 1ASVA 2P9IA 4RW8A 4CBWA 2RF2A 5J2QA 3PIPL 3OYEA 3MX5A 1VQNN 4C1NK 5AQKA 4DF8A 4XH4A 1KFDA 4EP5A 4KREA 4BDYA 2CH5A 1JLQA 4CHYA 5HRNA 3HOSA 4FWOA 1QVGM 1NU0A 5BREA 3J81O 2YJFA 1CLQA 2LSNA 1VQKN 1QS4A 4F9OA 4QOZB 3O5BA 5C24A 4F4KA 2V51B 1SUQA 4LF7K 4GKJK 2B4JA 5HL7L 4GY2B 4LD0A 4DU1A 3ZSVA 4JK7A 4I6MA 3KK7A 3TI0A 1ZC6A 1LWEA 4H5RA 1KRPA 4FWLA 5F2RA 1HNWK 4X65K 3CFOA 2IVOA 1GLLO 4E7IA 4F3OA 3DLHA 3PUFA 3OW2M 1ATRA 3L2WA 5KRTA 3T69A 2HHWA 4FLYA 3S9HA 4BRNA 1K6YA 2FSNA 2HBLA 4PKHA 3SBGA 3J8AA 4A61A 3VQ9A 1RBVA 3MN6A 3R3LA 1JCGA 3AO5A 4F8RA 3PY8A 4DFPA 2HB5A 2W6KA 4WQ5C 3SQ1A 3MWPA 4CHPA 4KHQA 1VQ5N 3DRRA 3NVKA 1WLJA 2EHGA 4JRQA 2D0CA 3ULEB 3PSIA 1WOQA 4JKHA 3SJHA 2G8WA 2D0OA 3O4WA 4BGAA 4JS4A 1FKPA 2QTDA 3OYNA 2D5RA 1RDDA 3LM9A 3V1RA 3RR8A 5EX5A 2QWRA 4OPJA 3VA0A 4IEEA 3IKMA 1NBWA 3SNNA 4JI0K 1EQYA 4XEIA 2JLEA 4CEDA 1NK7A 1UAXA 3T1AA 3D7EO 4QS9A 2X78A 1QQNA 2QW9A 1OVYA 1X9MA 1NJIO 2UUBK 1KD1O 5BPNA 2WUSA 2IGIA 4FZYA 4BY9C 5KI6A 3DRPA 4YHHK 1HKGA 3MMVA 1FXXA 4AM7A 3ZSWA 4M3UA 3HT3A 2BANA 4M3YA 4ELUA 4LFAK 1EKEA 2X6NA 3WXJA 3T1YK 5HP1A 1TKXA 3MECA 5LY3A 2P5OA 3A2FA 4UQGA 2F96A 4I9LA 4DFKA 3F9KA 2NUBA 4RWTA 2WFBA 3NF6A 1ITGA 1L3UA 5FPNA 2HF3A 1YTAA 4F2RA 2QWOA 2Y1JA 4DV1K 1VQ9N 4H5TA 4IO9L 1NGAA 1NGBA 1VQON 2UU9K 3NE6A 3I0RA 2V7YA 1K8KA 5KTQA 3ALYA 2ZM6K 3VQCA 1W97L 4DF4A 3D45A 3TANA 3TTDA 4CD1A 3MN9A 1RNHA 3SPZA 1U6ZA 4KBOA 3ZT4A 5JS2A 4CJ4A 4DSFA 3G6EN 3G10A 3VQPA 2Q31A 1IBMK 2WONA 5C42A 1A5WA 3HPHA 4KH5A 3O4QA 4M3TA 1TV6A 2ITMA 3LZIA 3IRXA 3QEIA 4BR7A 1UA0A 3NF8A 1RT6A 3QO9A 3OYHA 1HQEA 4JI8K 4O8UA 1WSGA 3L2VA 1NGCA 4LC9B 1D9FA 4RW6A 4CJFA 5CYQA 1EO1A 1BA1A 3O9UA 1JXEA 4C8LA 4X64K 4JKEA 2G8VA 3V81A 2E20A 4A57A 3C0BA 5GINA 2QI2A 4E0DA 4DR2K 1G15A 1RGIA 4B3TK 2VG7A 1J6ZA 3LP1A 4IEIA 3VEYA 3ZYYX 1QHAA 1I94K 5AQVA 2IS3A 3MN7A 5JS1A 2NZTA 1W2BM 5C10A 3ULEA 3QDKA 4DU3A 4K41A 1N32K 3LDSA 4DQIA 1MWKA 2GWJA 4FOEA 3O8MA 1YJNN 1Z26A 1VSIA 4DQ8A 3RTVA 4DV3K 2FBYA 3Q7CA 1S3XA 1HYSA 3SMSA 4F3TA 1C6VA 3VQBA 2VGNA 3UKRB 3QESA 1YJ9N 1OH6A 1B92A 4M3ZA 5HOOA 4M7XA 3UIQA 3SV3A 3MWTA 3OHRA 5C2FA 2ASOA 2O8BA 3SLCA 2A3ZA 3IMXA 2YHXA 5M1OA 3OA9A 4E1JA 1LW2A 3VETA 2UXDK 3KZBA 3MXJA 3T7ZA 2E1YA 1LOTB 3V9SA 1DT9A 5AQGA 2GTDA 4C8KA 2YHWA 4BRCA 1BIZA 2B6AA 3L0QA 1HR0K 1NKCA 4BRIA 1NGIA 4FJXA 3P38A 2Z1GA 5AQTA 5B8HA 1IG9A 3LP0A 1WSIA 1HJRA 3AA5X 4O44A 4IOXA 3AVAA 1VQLN 1D4XA 3HZ6A 3ZEUA 4FJ5A 4CGDA 3AA4A 3DWLA 1YAGA 4OLAA 4RCHA 2YCHA 1NJXA 2JWKA 5HBMA 4LF5K 1XHXA 2QKBA 1GOBA 3BY5A 3CERA 4JAXA 3HTVA 1NM1A 3ASMA 3DLGA 2A6AA 1X9JA 5HRRA 4B8AB 2ZGZA 4E7KA 1T6DA 2KZZA 3VOVA 3BDPA 1TKDA 4H5VA 4CEOA 3M8RA 1Q86O 3BUZB 4CZFA 5C12A 4CFAA 3AO1A 3K5NA 3AVNA 5AQPA 4KB0A 1NMNA 1I3AA 2E1ZA 3MCAB 3CMAN 4IFVA 1TKTA 1TYQB 3OTOK 3CJ7A 4DR6K 4JKBA 5J1EA 1OVQA 4DQRA 5AQRA 3PX0A 2NNWA 2D4WA 2P9NB 1Q18A 3AVBA 1IBKK 3L6QA 3FZKA 4JYAK 1V4SA 3HPGA 2PZSA 3JAMO 2RHKA 3DLKA 3RRGA 1HUXA 2ZWHA 3DI6A 1DTTA 4DR1K 3R6MA 4PY5A 5MLCQ 3U8XA 2ASPA 3ZLJA 4E1NA 3V9WA 4JKAA 4NLCA 2ZJQL 4IJAA 4U67L 3BZKA 4OPAA 1NGGA 4YOUA 1A5XA 3OYCA 4WE1A 4JI7K 1IH7A 4CFCA 3JS6A 3BGRA 4CJTA 3CG7A 2QXLA 3OYFA 1RDAA 4FJNA 3O1WA 3V6DA 1U2VA 4JI3K 2G8FA 4Y1DA 2ATQA 3PX4A 4JV5K 3CC2N 3U3GA 3EE8A 4FLWA 4GNIA 4OVLA 1NGJA 3CC7N 4J2DA 3HJFA 4JK9A 1NGEA 2ASMA 4Z4FA 4BRPA 5KPZA 3SUOA 4AILC 3CCQN 1QZ5A 5FROA 1ASWA 3ITHA 1WN7A 1T7PA 3FZHA 5K14A 4BDPA 2VWKA 3R9PA 1S9GA 5CHIA 1S1UA 4DTXA 3WNFA 2BE2A 3L3VA 3DM2A 4E7LA 4DSEA 2W40A 2VGMA 4B9MA 2A41A 4Z4CA 2YKNA 2I7NA 3KK1A 1WSFA 4B9LA 3QINA 1KVBA 2OZSA 1UA1A 2E88A 2GEMA 1EWQA 1JXBA 2HHHK 5EU7A 3O08A 4EAHD 3VQQA 3OBYA 4O4GA 1KAYA 3AVFA 2P9UB 2QWLA 4YY3K 1ZBFA 4DB3A 4XH1A 4BR0A 5CYMA 3KKRA 3KLIA 5BR8K 3EO3A 5FLXO 1HNIA 4BRMA 3A5NC 3SUPA 1NWKA 4HTUA 1V4TA 1RT5A 2OZMA 5AQXA 3CC4N 5AQUA 1BGXT 3KTQA 1YVUA 4QAGA 3TWHA 4FWQA 5F0XA 3NGZA 3VEXA 1KVCA 3O80A 1TUUA 3MXMA 1TAQA 3G0ZA 3QNNA 1MDUB 3TR8A 2HHQA 3ZETA 1BWFO 3BF1A 3CCUN 2P9NA 2HHXA 3DYAA 1VRTA 1YT3A 2E2OA 1JLEA 4L3QA 2Z1JA 1JCEA 2P1JA 3FE1A 4I2QA 5SWMA 3VEWA 1S1XA 1LW0A 4JEPA 4I2PA 5H1SQ 4KHSA 3PLAA 3D6RA 5E41A 5FPMA 4KI4A 4IXCA 4TSXA 5J2PA 2YKMA 4JD2B 1RTIA 3SJJA 2A5XA 3C6UA 4YORA 5DM7L 4JI5K 1GLJO 3CCVN 3AAPA 3TAQA 3QNOA 2DFFA 2FXUA 1KAXA 3OS1A 3NCIA 4C1NI 1S6PA 4ICLA 1RILA 4YNQA 4FM1A 3NVMA 1WAFA 1OH5A 1QVFM 1BHLA 5BPMA 5KGXA 2ZD1A 4CF0A 2E8AA 3HP6A 2G8UA 2OCEA 3HPOA 1OH8A 3KKSA 4A59A 3AVHA 1A5VA 4BE1A 2VCPA 5ADXH 4H4OA 2XY6A 4N41A 2HMIA 1X3NA 3VQ8A 4HCCA 3HYFA 4FJIA 5KQDA 3NH0A 1C0FA 1Q9XA 2F4VK 1YITN 2FSJA 4PHTX 3MCPA 3KIOA 4EHUA 3U4LA 1QTMA 4KPYA 4BC3A 1X3MA 5AZJB 4LY7A 1RDUA 2VG5A 4KTZA 4JI6K 4FCYA 3WUHA 1NNEA 2EWSA 3N4PA 4A5BA 4DV2K 3LPTA 4KRFA 1RBUA 3C7NA 1JL1A 1U47A 4B1XB 1SZ2A 5AQWA 3HSTB 1QSYA 2E6LA 4NXMK 3CMEN 4OX9K 2FBVA 2ZQBA 1N33K 2IVNA 3H46O 2BH1A 2CGLA 4UY8O 4OGCA 4Z4IA 2W41A 1NK9A 3C6TA 2O8EB 1FK9A 2B5JA 4ZTFA 3N4QA 3V9ZA 1FW6A 1XMOK 1H1VA 4J8FA 4KH4A 3VA3A 1SAZA 4EZ9A 1IKVA 2XO7A 1SL1A 3VTIA 4FLUA 4ISEA 3GDQA 4JKGB 1LV5A 1K73O 1YJWN 1KSPA 1YUWA 3O4NA 1XNRK 4J2EA 1B9FA 4LH5A 1C0GA 3EKSA 4FSVA 3K59A 3SPYA 3HRGA 1QZ6A 5AQOA 5GAGP 4DU4A 4FK0A 3K5OA 1VQMN 4CZIA 5GIOA 4NYFA 3LWLA 1TK0A 3GOIA 1NK5A 3LDLA 3ZSXA 4CJ3A 3M8QA 1BCOA 3MK6A 3KHYA 4DTMA 3EZWA 3GBTA 1C0MA 2UYTA 4RW9A 4B8CA 4DTNA 4H0PA 1QSSA 3O9SA 4A2BA 3TSUA 3SAFA 4CZGA 3O3HA 1WNSA 4BGBA 4KHNA 4JD2A 4OKKA 3P39A 4BQZA 4FLVA 4OKEA 1RT7A 3A5MC 1IV0A 3LALA 3QEWA 1RT3A 2YHAA 3CPWM 4CZKA 3TAMA 1YTUA 3GG4A 3HSCA 1FKOA 3H3NO 3WNGA 4DR5K 3QMLA 1R0AA 4H0TB 1FJGK 5FPDA 1GLBG 3JXUA 3WEEB 3ZSOA 2O4GA 5BRFA 1J9AA 1JLCA 3Q7BA 4B9NA 3CJ9A 4Z94A 4IJNA 1GLCG 1RCHA 4W5TA 1HX1A 2JWLA 2OPSA 1E4GT 4CEFA 1E4FT 1SQKA 1KAZA 4L8RB 3HVRA 3OVNA 1Q7YO 2E2PA 4QCLA 3G4SN 4KFBA 4CEBA 4E89A 3NHGA 2DY4A 5AZJA 3MN5A 4DTPA 3TAGA 4FZZA 5E84A 2P9PB 1ASUA 4BROA 1T05A 1QHTA 3LP3A 3KK3A 3ENOA 4E3SA 3K5LA 4DR3K 4E19A 4BR2A 1CXUA 3ENBA 4JI1K 4LFCK 4IG0A 3JYTA 1NLVA 3CI5A 1VK0A 2QEXN 2VWJA 3AAQA 4FWKA 1WAJA 4JS5A 4CJ7A 1NK6A 4FWNA 5AQFA 4CZLA 5IWAK 3HM8A 4AF1A 1NJWA 4CI6A 3VESA 4O5FA 1J5EK 1D8YA 4BC5A 2O8EA 3I33A 5GAHP 3OYIA 3ZT0A 2PBDA 3O3FA 3H45C 3AGKA 2HVHA 2NRWA 5LMUK 5J2NA 1XMQK 2P9LB 4BC4A 3VF6A 2DFEA 2BGGA 2YI1A 4CHNA 3OS0A 3FZMA 4BRDA 5C25A 4FWMA 4KB1A 1ILYA 1X1PA 1NMDA 2HOEA 4NXNK 4YOVA 1JL2A 1Z6RA 3KD5E 3EKUA 4WQ4A 1T6CA 3VEZA 4B9QA 3AVCA 2YNGA 3R1XA 4FJJA 1BL3A 4OO1J 1SL0A 4CF8A 4IOCL 4DSIA 4IOAL 3CJBA 3L2UA 3VQEA 2ZJPL 4NB4A 1BG3A 3D2FB 1TK5A 1F21A 5F1XA 5LMNK 3SAGA 3NMUA 4LH4A 1K9MO 1KC8O 3F5TA 1MWMA 4CHZA 4G1QA 3AY9A 4N5SA 1BO5O 4AHUA 2OTLN 4M3XA 4HWIA 3H1QA 3CCSN 2CGKA 4WYBA 2HHVA 1HPMA 4C8MA 1KFSA 5AFUH 5BR9A 2YHYA 3O1BA 3DLEA 1YI2N 2ZJRL 1NOYA 3OYDA 1KLNA 3HM9A 1VQPN 4YDUC 3AV9A 5HROA 1SKWA 3KVGA 1ZBHA 1MU2A 2IC3A 4KKOA 1LAVA 3G25A 1QQOA 4FO0A 4K42A 3PIOL 4MQ3A 4PWDA 2P9SB 3DXMB 4DWIA 1XHZA 1CXQA 4FWSA 5KQ8A 1VSFA 4H4MA 3HBTA 4HHTA 4DTOA 1NK4A 4DUYK 5AQLA 5EXWA 1RDBA 3RVCA 4CZMA 3TARA 2FBTA 3F9MA 4CBUA 3ENHA 5C15A 2P9PA 3O6WA 3KLFA 2FBXA 4CK3A 2VQFK 2O8FB 4CFBA 2HNYA 4B1VA 5AQYA 2E2QA 5HLFA 5CE3A 2Q36A 2RPIA 1TVRA 3L2RA 4CJVA 3OYGA 4DV0K 2DFHA 3VQ6A 1M90O 2OYQA 1RBTA 2F7TA 4CF2A 2J4RA 3ID8A 1VAZA 2E2NA 3WXLA 2KQ2A 2YNIA 3CF5L 3LAMA 4B9UA 2OPQA 4IWVA 1S72N 1T8EA 3DRSA 4WCEL 3CPEA 3HI0A 5LJWA 4GKKK 3GL1A 1IJJA 1ZXOA 3CM6A 4ILGB 3SV4A 1VQ8N 4RW4A 3QICA 3VTHA 1X9WA 2WC9A 3CYMA 4BG8A 4BE0A 1YXQA 3CD6N 4IZ9A 4K8ZA 2P9LA 2O8CB 4A2AA 2G8HA 1U4BA 2HBKA 4CJWA 5GIPA 1LWCA 3MEDA 2FSKA 5M1FA 5I9EB 3SAHA 3DXKB 4CEAA 3CJCA 4B3MK 1J53A 4FJ9A 4KTWA 1WUAA 4B3SK 3LP2A 3QB0A 1KCFA 1TGOA 3ATUA 5M1QA 4B08A 2YHBA 2EX3A 3AVLA 2I5JA 3S3NA 2O4IA 3KWGA 2GX9A 2E5LK 4BWJA 3J80O 5JLHA 3AA2A 2QWNA 3UKRA 1C0TA 3LWMA 4CJKA 1N5YA 4M3RA 4ZTJA 4AQYK 4MDAA 3FLCO 4DKWA 4CEQA 4B9VA 3CETA 1XUPO 2IOCA 1Q8IA 4EIAA 3K2PA 3EL2A 4CK2A 2QKKA 3AVGA 3WT0A 3K9KA 4WQ5A 3WXKA 5JLFA 3J7ZO 3SYZA 4CGJA 5BRDA 4GV9A 3E01A 1OH7A 3QETA 3U9ZA 3OYJA 1SKRA 5CZ2A 4HUGA 2X6SA 4CE9A 4DR4K 1E3MA 4BR5A 1HYVA 1C1AA 5T7BA 2YNFA 1U45A 3DXMA 4BR4A 1HNVA 1L3TA 3ISNC 3IAYA 4JNEA 3VPZA 3TTCA 4LSLA 5M1PA 5LJVA 1HKBA 2PYJA 2P9IB 4W5RA 4ILJA 3RMCA 2QK9A 3L8BA 2IDOA 1BQMA 4DTJA 5J2MA 3RWUA 2JGUA 3AVKA 5KPTA 2FF6A 4KO0A 2QM1A 4DQPA 3ZX0A 4O0IA 4WFNL 3BF3A 4DSKA 4B1ZA 4PKGA 5SZTA 1WBDA 1O13A 5AQQA 1NK8A 3HK2A 3CCEN 2FLOA 3THVA 3FFIA 3DLLL 4FW2A 2A1SA 3RSEB 1S5JA 3FZFA 4I6MB 5AQSA 3VGMA 3U6FA 4R5PA 1NGDA 4EFHA 3M5RA 2Y1IA 1ZYQA 3GE1A 4QS8A 3QFUA 4IFYA 3M8SA 1TYQA 4DSJA 1DLOA 3TAPA 3ZSRA 2IAJA 5AZIB 3D0PA 2HHTA 4PL7A 3V1OA 4M42A 3HO1A 4ZHRA 3H3OB 2WOMA 1P8ZA 4M3WA 1XWLA 4AM6A 5DMRA 3L2QA 3R8EA 4H5WA 3W3DA 3EE9A 5DK5A 3J7YP 3DXKA 1D9DA 1YHQN 4YOTA 4H5NA 4H0VB 3IUCA 1WB9A 4B1WB 4X62K 2GUPA 4FVUA 4YOXA 3PSFA 3M3ZA 4FPAA 1R59O 1JCFA 5BPLA 3LANA 3HL8A 1EX4A 3I0SA 1D5AA 2QWQA 1XI1A 3EN9A 1XC3A 1NGFA 3KLHA 1HQUA 4CZEA 4XIUA 1IG8A 5JVHL 4H03B 2HNZA 4YOYA 5JMVA 4LFBK 4BRGA 3C65A 1ZBUA 3QBWA 2W42A 1Q9YA 4LF8K 3SBTA 3I55N 1HPZA 4BE2A 3W0LA 2NRXA 4FJKA 4CEZA 4MFBA 4CJQA 2HMPA 3THYB 1XC9A 3IS9A 4KI6A 4H8KA 3LPUA 1S6QA 1SS6A 4FWPA 5DM6L 1T3VA 5BRHA 3LDOA 2BUPA 3TPQA 4I9QA 4IBNA 4DS5A 3A8YA 3V9UA 4RW7A 2HHUA 4CZHA 3ZT2A 1GLAG 1DKGD 2WBNA 3SQ0A 1RDWX 3DOKA 4CGFA 1U48A 3UB5A 1K8KB 4DG1A 4MO4A 3OY9A 1RDCA 3LL3A 4W5NA 1Q82O 3C6HA 4PUOA 3OBWA 2A1RA 4JKDA 3AGRA 5FPEA 4XH5A 3TU5A 3RMAA 4YOWA 1BA0A 4PQUA 4EP4A 4B9SA 4W5QA 3B6OA 3WXMB 2P9UA 4JK8A 1KQSM 3TABA 3I56N 3NFAA 2ZGYA 3LAKA 4JI2K 2HBMA 3LZJA 3ZCMA 3RSEA 2Q1NA 2D0PA 4B3OA 2KKZA 1JJ2M 5TKWA 4DMNA 4YDUA 3E9PA 3D2EB 2GWKA 5ELZA 3NF9A 3NDKA 4KTQA 5EOYA 4DTUA 3AO3A 4HUEA 4MDBA 4JRPA 4DHYA 1IBLK 5AQJA 1RTJA 4JN4A 3VGLA 4AHTA 4DV6K 4OJRA 5AZIA 2G8IA 2NRZA 2GBZA 3VEVA 1NJZA 3QEPA 1RBSA 3OYMA 3OYBA 1UOCA 4FJ8A 3IFRA 5JVGL 4BC2A 4CIGA 2XRIA 1YVNA 3CQYA 3K9JA 4M45A 3DAWA 4CERA 4DLGA 2BDPA 5AQZA 1ZBLA 4J2BA 4BG9A 1HLUA 2ZE2A 2OPPA 3WXIA 2V7ZA 4DFMA 2KLAA 3EYZA 2NRHA 4LSNA 4CCHA 3CIPA 4BQLA 4FJ7A 4CF9A 2D0AA 2XY5A 3QERA 3MAQA 1ESVA 1L5UA 1B9DA 3JSMA 3SUQA 5C0YA 3QEXA 2H3GX 3LDQA 5I3UA 4IG3A 1M1KO 2RN2A 4WFBL 2KFZA 3U9DA 4JLHA 1N6QA 5EVZA 3H1VX 5CY4A 1VQ6N 4CFDA 1W0HA 1T44A 3UE5A 1HNXK 5D3GA 2P51A 5KRSA 3AVMA 2YNHA 3A5OC 3KK2A 1QSLA 1SL2A 1BU6O 4EHTA 3DLBA 1OKJA 4CESA 4NCGA 2GELA 4E7JA 4MO5A 3THYA 4FJGA 2O8BB 3QEVA 4CK1A 3RRHA 1BDGA 1TAUA 4ELVA 3ZX2A 4B1UB 1L3SA 4ID5A 3ID6A 4MLEA 5KGWA 3A0IX 2BTFA 1S22A 3H08A 4BR9A 4CECA 1KTQA 2KHOA 4K43A 1NOZA 4KHPK 3FFKB 1VSJA 1KVAA 4K0KK 5TKYA 3VENA 2XY8A 4WFAL 3HOTA 3M6GA 4B3RK 3PV8A 1Y97A 2OTJN 3P4IA 1QE1A 2GUIA 1JKHA 3OJUA 4ELTA 4JI4K 1DEJA 3THWB 5AQIA 1IKYA 1BOTO 1CZ9A 1RFQA 3E9OA 1C1BA 1Z25A 4CBXA 2QA4N 4AHVA 3CCLN 4LF9K 1DTQA 3ZEUB 1N34K 1MA9B 3MEEA 2ETJA 1I39A 3T3FA 3ZSZA 4A5AA 1U04A 3ATVA 4O8KA 1C1CA 2NLXA 4HVJA 4ID1A 1WBBA 4C8NA 5GADP 3EY1A 1L3VA 3THXB 3BZCA 3D2EA 4CJRA 4I7FA 4NLBA 1G99A 1JLGA 3K57A 3LDPA 2YX6A 4JHDB 3AVIA 4JKGA 3P31A 1UWBA 3DMJA 2F8TA 4H0YB 4GVMA 4PA1A 3VMFB 3I8DA 4DUZK 4NYNA 1NJYA 3V1QA 2OPRA 2IVPA 3F2KA 2Q0UA 3KLGA 4EZ6A 1IKWA 3B8AX 4G9ZA 3OYAA 4DS4A 1LAWA 5ADXA 3LDNA 1TK8A 4CJLA 5FDLA 2F8SA 3P1GA 4DV5K 2KFNA 4N56A 4GV6A 1W9HA 4GVEA 3CCMN 4FZXC 4HUFA 4JKCA 4FJMA 3IDHA 4E7HA 3SK3A 2HNDA 3KJVA 2AJQA 3H6EA 3P5JA 4X66K 1O1WA 2A40A 3SZ2A 3VQ7A 4BRHA 1ZBSA 4FXDA 1EWRA 4IDHA 1HKCA 4CJSA 5LL6Z 3SUNA 4BRQA 3KLEA 3L4QA 4B1YB 4V19S 4FLZA 3WNHA 2NRTA 5E26A 5AQHA 4IO8A 2VQEK 1GLFO 1EP4A 4Z4EA 3FR0A 5CZ1A 3K58A 1RT1A 3AO4A 1QQCA 2OANA 2Q3SA 4DTRA 1WSHA 4DQSA 4WF9L 4IFEA 2UXCK 3EZ5A 3NF7A 3ZX3A 1NK0A 1LWFA 1VSEA 2PAVA 3WEEA 2O8DB 4FM0A 3PX6A 3QLHA 1U2VB 2E6MA 3CFPA 2HHSA 4HTLA 4FK2A 4LF4K 4KHWA 1WSJA 4IKFA 4DCHA 2P9KB 3MX2A 2Z1IA 1GOAA 2PFUA 3KWIA 2Q97A 4FPBA 4W5OA 3KD1E 3RMDA 4HCBA 4DLEA 1U49A 3L3UA 4MLHA 4BACA 4BREA 3QIPA 3CCJN 4CJPA 2X74A 4JKFA 4RG8A 4KHYA 4OPHA 2GV9A 3QFPA 3NGYA 2VG6A 5HRPA 4CHQA 4FYDA 3VN5A 4NO7A 1CZBA 5M1NA 3THWA 5C2DA 1LCUA 1S1WA 2FF3B 2D1KA 3LM2A 3QIOA 3DJCA 1NKBA 4CGGA 4FWRA 2F9WA 3O9QA 3F73A 3CJ1A 3CCRN 2NRVA 4BVOA 2PYLA 4FLTA 2QWPA 5AQMA 2R7YA 3QBXA 3U3YA 2V52B 4DFJA 4O0JA 4CGIA 4CIEA 3THXA 3HVTA 4CJEA 3UKUB 2KW4A 3VF2A 4PKIA 1BCMA 4JHDA 2D0BA 2YJEA 3EEQA 3VQDA 1J54A 4DR7K 2YV0X 1NG9A 1ATSA 4Y0WA 3OJSA 3ZSYA 4CGHA 4M63C 2AP1A 4DSLA 2I7PA 2FC0A 5CR4A 4C8OA 4BDZA 1KXPA 1RTHA 1N36K 4GV3A 3T1HK 3E9LA 4CF1A 2AA4A 3OYKA 5I42A 1VQ7N 4AHSA 3NAEA 4H0XB 3OYLA 4DQQA 3CM5A 3ZETB 3J7AP 2ITGA 1BUPA 2HVIA 1XQSC 1BI4B 1TKZA 3DLRA 1JLBA 4Z4HA 1JLFA 4CHOA 4CIFA 1Q81O 3D2FA 3V9XA 3O3GA 3S3MA 1VRUA 2CH6A 3MXIA 2UUCK 1HYZA 3TSPA 3V4IA 1Y64A 4BWMA 3ZT1A 1XNQK 4CZJA 4BRLA 1VSLA 1J5OA 5IT9O 1GLDG 3O9TA 4LF6K 1QQMA 4CJUA 3AO2A 5KPRA 3NGIA 5EY4A 1RBRA 2PY5A 4RTFD 1P90A 3B6PA 2E4LA 3NH2A 4OKJA 3HXMA 3FZLA 1EXQA 1HJOA 4CW7B 4OLBA 1HNZK 5AJ3K 2O8DA 3TAFA 4FL9A 3ULDA 3PO5A 3CFRA 4FLXA 1C0UA 4M7YA 2WTUA 2UXBK 3CXCM 5JICA 3S3OA 2P9SA 4ISFA 3VGKA 2W6LA 2HF4A 2UUAK 4CJ5A 4N76A 2P9KA 3VEOA 2HSTA 2ZF5O 4ISGA 5AR0A 3VQ4A 4BRAA 4U7BA 4AH9A 2CGJA 4C23A 1VQ4N 4FK4A 5BN8A 4FM2A 3ZT3A 1W7AA 1VSKA 1SKSA 4AHRA 1RT4A 3AA3A 5GAEP 4K25A 4K8XA 1BISA 4F2SA 1BIUA 1DGKN 1IKXA 2O8FA 3TSQA 3CQ8A 1GOCA 2RKIA 4FOIA 4WQ4C 3L4IA 4FVMA 4KHUA 4R79A 3E66A 3WQUA 3C94A 3WQTA 4ILHA 2XHBA 3S41A 3IG1A 2VWBA 4FJLA 1ATNA 4PL8A 3C6AA 4FJHA 3AARA 3SCXA 3M8PA 3C7NB 1X9SA 3ZSQA 4OGEA 1TUYA 1GLEG 4FW1A 4M41A 3SQ2A 3FGUA 4GW6A 4E1MA 3M1FA 1NKEA 3UKUA 5AFUA 3P83D 1HRHA 3VERA 5A2QO 3K0SA 3CJAA 3E1YA 4CVNE 2KTQA 2O8CA 2DPNA 4Z4GA 3OS2A 2F9TA
chains in the Genus database with same CATH topology
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
#chains in the Genus database with same CATH topology
 1BQN A;  3AVJ A;  5AQN A;  3VQ5 A;  1EET A;  1KLM A;  3T19 A;  3WNE A;  5HRS A;  2IIR A;  4KAZ A;  3VQA A;  3PO4 A;  1JLA A;  4DTS A;  2QWM A;  4A62 A;  4O55 A;  4DV7 K;  1YIJ N;  1VSM A;  1VSH A;  2RE2 A;  2HBJ A;  5FRN A;  2VYP A;  2Z1H A;  4KH6 A;  2DTU A;  1Z05 A;  1VHX A;  2NRR A;  2P5G A;  4GMJ B;  4O5B A;  3TTF A;  1T03 A;  1CZA N;  2HW3 A;  1BI4 A;  1HMV A;  1WSE A;  3MDQ A;  1NGH A;  1ZBI A;  4B9T A;  1SV5 A;  1N8R O;  1TL3 A;  4CEE A;  1S1T A;  2QXF A;  3RMB A;  1REV A;  4H0O A;  3NBP A;  1RT2 A;  3A5L C;  3CHW A;  4DV4 K;  4J2A A;  4NCA A;  4BRK A;  2OA8 A;  4IDK A;  4Y1C A;  2A42 A;  3SI6 A;  4N47 A;  3NH1 A;  3G71 N;  5BN9 A;  4NCB A;  5M1K A;  3DOL A;  1TL1 A;  4BVP A;  3RR7 A;  3SMP A;  3VF4 A;  3I8B A;  5FRM A;  1S1V A;  4YFU A;  2Q2R A;  3SQ4 A;  4OPK A;  4Q0B A;  3BEX A;  4CD3 A;  3BP8 A;  1RTD A;  4KV8 A;  4QS7 A;  4AHC A;  3CQX A;  1K8A O;  3HP9 A;  3K5M A;  4BRF A;  1IO2 A;  1YF5 L;  1S9E A;  3O9R A;  3MEG A;  4Q5V A;  3TAE A;  3C95 A;  2Q0R A;  4Z0U A;  2XY7 A;  1VSD A;  2G8K A;  2KZM A;  1ASV A;  2P9I A;  4RW8 A;  4CBW A;  2RF2 A;  5J2Q A;  3PIP L;  3OYE A;  3MX5 A;  1VQN N;  4C1N K;  5AQK A;  4DF8 A;  4XH4 A;  1KFD A;  4EP5 A;  4KRE A;  4BDY A;  2CH5 A;  1JLQ A;  4CHY A;  5HRN A;  3HOS A;  4FWO A;  1QVG M;  1NU0 A;  5BRE A;  3J81 O;  2YJF A;  1CLQ A;  2LSN A;  1VQK N;  1QS4 A;  4F9O A;  4QOZ B;  3O5B A;  5C24 A;  4F4K A;  2V51 B;  1SUQ A;  4LF7 K;  4GKJ K;  2B4J A;  5HL7 L;  4GY2 B;  4LD0 A;  4DU1 A;  3ZSV A;  4JK7 A;  4I6M A;  3KK7 A;  3TI0 A;  1ZC6 A;  1LWE A;  4H5R A;  1KRP A;  4FWL A;  5F2R A;  1HNW K;  4X65 K;  3CFO A;  2IVO A;  1GLL O;  4E7I A;  4F3O A;  3DLH A;  3PUF A;  3OW2 M;  1ATR A;  3L2W A;  5KRT A;  3T69 A;  2HHW A;  4FLY A;  3S9H A;  4BRN A;  1K6Y A;  2FSN A;  2HBL A;  4PKH A;  3SBG A;  3J8A A;  4A61 A;  3VQ9 A;  1RBV A;  3MN6 A;  3R3L A;  1JCG A;  3AO5 A;  4F8R A;  3PY8 A;  4DFP A;  2HB5 A;  2W6K A;  4WQ5 C;  3SQ1 A;  3MWP A;  4CHP A;  4KHQ A;  1VQ5 N;  3DRR A;  3NVK A;  1WLJ A;  2EHG A;  4JRQ A;  2D0C A;  3ULE B;  3PSI A;  1WOQ A;  4JKH A;  3SJH A;  2G8W A;  2D0O A;  3O4W A;  4BGA A;  4JS4 A;  1FKP A;  2QTD A;  3OYN A;  2D5R A;  1RDD A;  3LM9 A;  3V1R A;  3RR8 A;  5EX5 A;  2QWR A;  4OPJ A;  3VA0 A;  4IEE A;  3IKM A;  1NBW A;  3SNN A;  4JI0 K;  1EQY A;  4XEI A;  2JLE A;  4CED A;  1NK7 A;  1UAX A;  3T1A A;  3D7E O;  4QS9 A;  2X78 A;  1QQN A;  2QW9 A;  1OVY A;  1X9M A;  1NJI O;  2UUB K;  1KD1 O;  5BPN A;  2WUS A;  2IGI A;  4FZY A;  4BY9 C;  5KI6 A;  3DRP A;  4YHH K;  1HKG A;  3MMV A;  1FXX A;  4AM7 A;  3ZSW A;  4M3U A;  3HT3 A;  2BAN A;  4M3Y A;  4ELU A;  4LFA K;  1EKE A;  2X6N A;  3WXJ A;  3T1Y K;  5HP1 A;  1TKX A;  3MEC A;  5LY3 A;  2P5O A;  3A2F A;  4UQG A;  2F96 A;  4I9L A;  4DFK A;  3F9K A;  2NUB A;  4RWT A;  2WFB A;  3NF6 A;  1ITG A;  1L3U A;  5FPN A;  2HF3 A;  1YTA A;  4F2R A;  2QWO A;  2Y1J A;  4DV1 K;  1VQ9 N;  4H5T A;  4IO9 L;  1NGA A;  1NGB A;  1VQO N;  2UU9 K;  3NE6 A;  3I0R A;  2V7Y A;  1K8K A;  5KTQ A;  3ALY A;  2ZM6 K;  3VQC A;  1W97 L;  4DF4 A;  3D45 A;  3TAN A;  3TTD A;  4CD1 A;  3MN9 A;  1RNH A;  3SPZ A;  1U6Z A;  4KBO A;  3ZT4 A;  5JS2 A;  4CJ4 A;  4DSF A;  3G6E N;  3G10 A;  3VQP A;  2Q31 A;  1IBM K;  2WON A;  5C42 A;  1A5W A;  3HPH A;  4KH5 A;  3O4Q A;  4M3T A;  1TV6 A;  2ITM A;  3LZI A;  3IRX A;  3QEI A;  4BR7 A;  1UA0 A;  3NF8 A;  1RT6 A;  3QO9 A;  3OYH A;  1HQE A;  4JI8 K;  4O8U A;  1WSG A;  3L2V A;  1NGC A;  4LC9 B;  1D9F A;  4RW6 A;  4CJF A;  5CYQ A;  1EO1 A;  1BA1 A;  3O9U A;  1JXE A;  4C8L A;  4X64 K;  4JKE A;  2G8V A;  3V81 A;  2E20 A;  4A57 A;  3C0B A;  5GIN A;  2QI2 A;  4E0D A;  4DR2 K;  1G15 A;  1RGI A;  4B3T K;  2VG7 A;  1J6Z A;  3LP1 A;  4IEI A;  3VEY A;  3ZYY X;  1QHA A;  1I94 K;  5AQV A;  2IS3 A;  3MN7 A;  5JS1 A;  2NZT A;  1W2B M;  5C10 A;  3ULE A;  3QDK A;  4DU3 A;  4K41 A;  1N32 K;  3LDS A;  4DQI A;  1MWK A;  2GWJ A;  4FOE A;  3O8M A;  1YJN N;  1Z26 A;  1VSI A;  4DQ8 A;  3RTV A;  4DV3 K;  2FBY A;  3Q7C A;  1S3X A;  1HYS A;  3SMS A;  4F3T A;  1C6V A;  3VQB A;  2VGN A;  3UKR B;  3QES A;  1YJ9 N;  1OH6 A;  1B92 A;  4M3Z A;  5HOO A;  4M7X A;  3UIQ A;  3SV3 A;  3MWT A;  3OHR A;  5C2F A;  2ASO A;  2O8B A;  3SLC A;  2A3Z A;  3IMX A;  2YHX A;  5M1O A;  3OA9 A;  4E1J A;  1LW2 A;  3VET A;  2UXD K;  3KZB A;  3MXJ A;  3T7Z A;  2E1Y A;  1LOT B;  3V9S A;  1DT9 A;  5AQG A;  2GTD A;  4C8K A;  2YHW A;  4BRC A;  1BIZ A;  2B6A A;  3L0Q A;  1HR0 K;  1NKC A;  4BRI A;  1NGI A;  4FJX A;  3P38 A;  2Z1G A;  5AQT A;  5B8H A;  1IG9 A;  3LP0 A;  1WSI A;  1HJR A;  3AA5 X;  4O44 A;  4IOX A;  3AVA A;  1VQL N;  1D4X A;  3HZ6 A;  3ZEU A;  4FJ5 A;  4CGD A;  3AA4 A;  3DWL A;  1YAG A;  4OLA A;  4RCH A;  2YCH A;  1NJX A;  2JWK A;  5HBM A;  4LF5 K;  1XHX A;  2QKB A;  1GOB A;  3BY5 A;  3CER A;  4JAX A;  3HTV A;  1NM1 A;  3ASM A;  3DLG A;  2A6A A;  1X9J A;  5HRR A;  4B8A B;  2ZGZ A;  4E7K A;  1T6D A;  2KZZ A;  3VOV A;  3BDP A;  1TKD A;  4H5V A;  4CEO A;  3M8R A;  1Q86 O;  3BUZ B;  4CZF A;  5C12 A;  4CFA A;  3AO1 A;  3K5N A;  3AVN A;  5AQP A;  4KB0 A;  1NMN A;  1I3A A;  2E1Z A;  3MCA B;  3CMA N;  4IFV A;  1TKT A;  1TYQ B;  3OTO K;  3CJ7 A;  4DR6 K;  4JKB A;  5J1E A;  1OVQ A;  4DQR A;  5AQR A;  3PX0 A;  2NNW A;  2D4W A;  2P9N B;  1Q18 A;  3AVB A;  1IBK K;  3L6Q A;  3FZK A;  4JYA K;  1V4S A;  3HPG A;  2PZS A;  3JAM O;  2RHK A;  3DLK A;  3RRG A;  1HUX A;  2ZWH A;  3DI6 A;  1DTT A;  4DR1 K;  3R6M A;  4PY5 A;  5MLC Q;  3U8X A;  2ASP A;  3ZLJ A;  4E1N A;  3V9W A;  4JKA A;  4NLC A;  2ZJQ L;  4IJA A;  4U67 L;  3BZK A;  4OPA A;  1NGG A;  4YOU A;  1A5X A;  3OYC A;  4WE1 A;  4JI7 K;  1IH7 A;  4CFC A;  3JS6 A;  3BGR A;  4CJT A;  3CG7 A;  2QXL A;  3OYF A;  1RDA A;  4FJN A;  3O1W A;  3V6D A;  1U2V A;  4JI3 K;  2G8F A;  4Y1D A;  2ATQ A;  3PX4 A;  4JV5 K;  3CC2 N;  3U3G A;  3EE8 A;  4FLW A;  4GNI A;  4OVL A;  1NGJ A;  3CC7 N;  4J2D A;  3HJF A;  4JK9 A;  1NGE A;  2ASM A;  4Z4F A;  4BRP A;  5KPZ A;  3SUO A;  4AIL C;  3CCQ N;  1QZ5 A;  5FRO A;  1ASW A;  3ITH A;  1WN7 A;  1T7P A;  3FZH A;  5K14 A;  4BDP A;  2VWK A;  3R9P A;  1S9G A;  5CHI A;  1S1U A;  4DTX A;  3WNF A;  2BE2 A;  3L3V A;  3DM2 A;  4E7L A;  4DSE A;  2W40 A;  2VGM A;  4B9M A;  2A41 A;  4Z4C A;  2YKN A;  2I7N A;  3KK1 A;  1WSF A;  4B9L A;  3QIN A;  1KVB A;  2OZS A;  1UA1 A;  2E88 A;  2GEM A;  1EWQ A;  1JXB A;  2HHH K;  5EU7 A;  3O08 A;  4EAH D;  3VQQ A;  3OBY A;  4O4G A;  1KAY A;  3AVF A;  2P9U B;  2QWL A;  4YY3 K;  1ZBF A;  4DB3 A;  4XH1 A;  4BR0 A;  5CYM A;  3KKR A;  3KLI A;  5BR8 K;  3EO3 A;  5FLX O;  1HNI A;  4BRM A;  3A5N C;  3SUP A;  1NWK A;  4HTU A;  1V4T A;  1RT5 A;  2OZM A;  5AQX A;  3CC4 N;  5AQU A;  1BGX T;  3KTQ A;  1YVU A;  4QAG A;  3TWH A;  4FWQ A;  5F0X A;  3NGZ A;  3VEX A;  1KVC A;  3O80 A;  1TUU A;  3MXM A;  1TAQ A;  3G0Z A;  3QNN A;  1MDU B;  3TR8 A;  2HHQ A;  3ZET A;  1BWF O;  3BF1 A;  3CCU N;  2P9N A;  2HHX A;  3DYA A;  1VRT A;  1YT3 A;  2E2O A;  1JLE A;  4L3Q A;  2Z1J A;  1JCE A;  2P1J A;  3FE1 A;  4I2Q A;  5SWM A;  3VEW A;  1S1X A;  1LW0 A;  4JEP A;  4I2P A;  5H1S Q;  4KHS A;  3PLA A;  3D6R A;  5E41 A;  5FPM A;  4KI4 A;  4IXC A;  4TSX A;  5J2P A;  2YKM A;  4JD2 B;  1RTI A;  3SJJ A;  2A5X A;  3C6U A;  4YOR A;  5DM7 L;  4JI5 K;  1GLJ O;  3CCV N;  3AAP A;  3TAQ A;  3QNO A;  2DFF A;  2FXU A;  1KAX A;  3OS1 A;  3NCI A;  4C1N I;  1S6P A;  4ICL A;  1RIL A;  4YNQ A;  4FM1 A;  3NVM A;  1WAF A;  1OH5 A;  1QVF M;  1BHL A;  5BPM A;  5KGX A;  2ZD1 A;  4CF0 A;  2E8A A;  3HP6 A;  2G8U A;  2OCE A;  3HPO A;  1OH8 A;  3KKS A;  4A59 A;  3AVH A;  1A5V A;  4BE1 A;  2VCP A;  5ADX H;  4H4O A;  2XY6 A;  4N41 A;  2HMI A;  1X3N A;  3VQ8 A;  4HCC A;  3HYF A;  4FJI A;  5KQD A;  3NH0 A;  1C0F A;  1Q9X A;  2F4V K;  1YIT N;  2FSJ A;  4PHT X;  3MCP A;  3KIO A;  4EHU A;  3U4L A;  1QTM A;  4KPY A;  4BC3 A;  1X3M A;  5AZJ B;  4LY7 A;  1RDU A;  2VG5 A;  4KTZ A;  4JI6 K;  4FCY A;  3WUH A;  1NNE A;  2EWS A;  3N4P A;  4A5B A;  4DV2 K;  3LPT A;  4KRF A;  1RBU A;  3C7N A;  1JL1 A;  1U47 A;  4B1X B;  1SZ2 A;  5AQW A;  3HST B;  1QSY A;  2E6L A;  4NXM K;  3CME N;  4OX9 K;  2FBV A;  2ZQB A;  1N33 K;  2IVN A;  3H46 O;  2BH1 A;  2CGL A;  4UY8 O;  4OGC A;  4Z4I A;  2W41 A;  1NK9 A;  3C6T A;  2O8E B;  1FK9 A;  2B5J A;  4ZTF A;  3N4Q A;  3V9Z A;  1FW6 A;  1XMO K;  1H1V A;  4J8F A;  4KH4 A;  3VA3 A;  1SAZ A;  4EZ9 A;  1IKV A;  2XO7 A;  1SL1 A;  3VTI A;  4FLU A;  4ISE A;  3GDQ A;  4JKG B;  1LV5 A;  1K73 O;  1YJW N;  1KSP A;  1YUW A;  3O4N A;  1XNR K;  4J2E A;  1B9F A;  4LH5 A;  1C0G A;  3EKS A;  4FSV A;  3K59 A;  3SPY A;  3HRG A;  1QZ6 A;  5AQO A;  5GAG P;  4DU4 A;  4FK0 A;  3K5O A;  1VQM N;  4CZI A;  5GIO A;  4NYF A;  3LWL A;  1TK0 A;  3GOI A;  1NK5 A;  3LDL A;  3ZSX A;  4CJ3 A;  3M8Q A;  1BCO A;  3MK6 A;  3KHY A;  4DTM A;  3EZW A;  3GBT A;  1C0M A;  2UYT A;  4RW9 A;  4B8C A;  4DTN A;  4H0P A;  1QSS A;  3O9S A;  4A2B A;  3TSU A;  3SAF A;  4CZG A;  3O3H A;  1WNS A;  4BGB A;  4KHN A;  4JD2 A;  4OKK A;  3P39 A;  4BQZ A;  4FLV A;  4OKE A;  1RT7 A;  3A5M C;  1IV0 A;  3LAL A;  3QEW A;  1RT3 A;  2YHA A;  3CPW M;  4CZK A;  3TAM A;  1YTU A;  3GG4 A;  3HSC A;  1FKO A;  3H3N O;  3WNG A;  4DR5 K;  3QML A;  1R0A A;  4H0T B;  1FJG K;  5FPD A;  1GLB G;  3JXU A;  3WEE B;  3ZSO A;  2O4G A;  5BRF A;  1J9A A;  1JLC A;  3Q7B A;  4B9N A;  3CJ9 A;  4Z94 A;  4IJN A;  1GLC G;  1RCH A;  4W5T A;  1HX1 A;  2JWL A;  2OPS A;  1E4G T;  4CEF A;  1E4F T;  1SQK A;  1KAZ A;  4L8R B;  3HVR A;  3OVN A;  1Q7Y O;  2E2P A;  4QCL A;  3G4S N;  4KFB A;  4CEB A;  4E89 A;  3NHG A;  2DY4 A;  5AZJ A;  3MN5 A;  4DTP A;  3TAG A;  4FZZ A;  5E84 A;  2P9P B;  1ASU A;  4BRO A;  1T05 A;  1QHT A;  3LP3 A;  3KK3 A;  3ENO A;  4E3S A;  3K5L A;  4DR3 K;  4E19 A;  4BR2 A;  1CXU A;  3ENB A;  4JI1 K;  4LFC K;  4IG0 A;  3JYT A;  1NLV A;  3CI5 A;  1VK0 A;  2QEX N;  2VWJ A;  3AAQ A;  4FWK A;  1WAJ A;  4JS5 A;  4CJ7 A;  1NK6 A;  4FWN A;  5AQF A;  4CZL A;  5IWA K;  3HM8 A;  4AF1 A;  1NJW A;  4CI6 A;  3VES A;  4O5F A;  1J5E K;  1D8Y A;  4BC5 A;  2O8E A;  3I33 A;  5GAH P;  3OYI A;  3ZT0 A;  2PBD A;  3O3F A;  3H45 C;  3AGK A;  2HVH A;  2NRW A;  5LMU K;  5J2N A;  1XMQ K;  2P9L B;  4BC4 A;  3VF6 A;  2DFE A;  2BGG A;  2YI1 A;  4CHN A;  3OS0 A;  3FZM A;  4BRD A;  5C25 A;  4FWM A;  4KB1 A;  1ILY A;  1X1P A;  1NMD A;  2HOE A;  4NXN K;  4YOV A;  1JL2 A;  1Z6R A;  3KD5 E;  3EKU A;  4WQ4 A;  1T6C A;  3VEZ A;  4B9Q A;  3AVC A;  2YNG A;  3R1X A;  4FJJ A;  1BL3 A;  4OO1 J;  1SL0 A;  4CF8 A;  4IOC L;  4DSI A;  4IOA L;  3CJB A;  3L2U A;  3VQE A;  2ZJP L;  4NB4 A;  1BG3 A;  3D2F B;  1TK5 A;  1F21 A;  5F1X A;  5LMN K;  3SAG A;  3NMU A;  4LH4 A;  1K9M O;  1KC8 O;  3F5T A;  1MWM A;  4CHZ A;  4G1Q A;  3AY9 A;  4N5S A;  1BO5 O;  4AHU A;  2OTL N;  4M3X A;  4HWI A;  3H1Q A;  3CCS N;  2CGK A;  4WYB A;  2HHV A;  1HPM A;  4C8M A;  1KFS A;  5AFU H;  5BR9 A;  2YHY A;  3O1B A;  3DLE A;  1YI2 N;  2ZJR L;  1NOY A;  3OYD A;  1KLN A;  3HM9 A;  1VQP N;  4YDU C;  3AV9 A;  5HRO A;  1SKW A;  3KVG A;  1ZBH A;  1MU2 A;  2IC3 A;  4KKO A;  1LAV A;  3G25 A;  1QQO A;  4FO0 A;  4K42 A;  3PIO L;  4MQ3 A;  4PWD A;  2P9S B;  3DXM B;  4DWI A;  1XHZ A;  1CXQ A;  4FWS A;  5KQ8 A;  1VSF A;  4H4M A;  3HBT A;  4HHT A;  4DTO A;  1NK4 A;  4DUY K;  5AQL A;  5EXW A;  1RDB A;  3RVC A;  4CZM A;  3TAR A;  2FBT A;  3F9M A;  4CBU A;  3ENH A;  5C15 A;  2P9P A;  3O6W A;  3KLF A;  2FBX A;  4CK3 A;  2VQF K;  2O8F B;  4CFB A;  2HNY A;  4B1V A;  5AQY A;  2E2Q A;  5HLF A;  5CE3 A;  2Q36 A;  2RPI A;  1TVR A;  3L2R A;  4CJV A;  3OYG A;  4DV0 K;  2DFH A;  3VQ6 A;  1M90 O;  2OYQ A;  1RBT A;  2F7T A;  4CF2 A;  2J4R A;  3ID8 A;  1VAZ A;  2E2N A;  3WXL A;  2KQ2 A;  2YNI A;  3CF5 L;  3LAM A;  4B9U A;  2OPQ A;  4IWV A;  1S72 N;  1T8E A;  3DRS A;  4WCE L;  3CPE A;  3HI0 A;  5LJW A;  4GKK K;  3GL1 A;  1IJJ A;  1ZXO A;  3CM6 A;  4ILG B;  3SV4 A;  1VQ8 N;  4RW4 A;  3QIC A;  3VTH A;  1X9W A;  2WC9 A;  3CYM A;  4BG8 A;  4BE0 A;  1YXQ A;  3CD6 N;  4IZ9 A;  4K8Z A;  2P9L A;  2O8C B;  4A2A A;  2G8H A;  1U4B A;  2HBK A;  4CJW A;  5GIP A;  1LWC A;  3MED A;  2FSK A;  5M1F A;  5I9E B;  3SAH A;  3DXK B;  4CEA A;  3CJC A;  4B3M K;  1J53 A;  4FJ9 A;  4KTW A;  1WUA A;  4B3S K;  3LP2 A;  3QB0 A;  1KCF A;  1TGO A;  3ATU A;  5M1Q A;  4B08 A;  2YHB A;  2EX3 A;  3AVL A;  2I5J A;  3S3N A;  2O4I A;  3KWG A;  2GX9 A;  2E5L K;  4BWJ A;  3J80 O;  5JLH A;  3AA2 A;  2QWN A;  3UKR A;  1C0T A;  3LWM A;  4CJK A;  1N5Y A;  4M3R A;  4ZTJ A;  4AQY K;  4MDA A;  3FLC O;  4DKW A;  4CEQ A;  4B9V A;  3CET A;  1XUP O;  2IOC A;  1Q8I A;  4EIA A;  3K2P A;  3EL2 A;  4CK2 A;  2QKK A;  3AVG A;  3WT0 A;  3K9K A;  4WQ5 A;  3WXK A;  5JLF A;  3J7Z O;  3SYZ A;  4CGJ A;  5BRD A;  4GV9 A;  3E01 A;  1OH7 A;  3QET A;  3U9Z A;  3OYJ A;  1SKR A;  5CZ2 A;  4HUG A;  2X6S A;  4CE9 A;  4DR4 K;  1E3M A;  4BR5 A;  1HYV A;  1C1A A;  5T7B A;  2YNF A;  1U45 A;  3DXM A;  4BR4 A;  1HNV A;  1L3T A;  3ISN C;  3IAY A;  4JNE A;  3VPZ A;  3TTC A;  4LSL A;  5M1P A;  5LJV A;  1HKB A;  2PYJ A;  2P9I B;  4W5R A;  4ILJ A;  3RMC A;  2QK9 A;  3L8B A;  2IDO A;  1BQM A;  4DTJ A;  5J2M A;  3RWU A;  2JGU A;  3AVK A;  5KPT A;  2FF6 A;  4KO0 A;  2QM1 A;  4DQP A;  3ZX0 A;  4O0I A;  4WFN L;  3BF3 A;  4DSK A;  4B1Z A;  4PKG A;  5SZT A;  1WBD A;  1O13 A;  5AQQ A;  1NK8 A;  3HK2 A;  3CCE N;  2FLO A;  3THV A;  3FFI A;  3DLL L;  4FW2 A;  2A1S A;  3RSE B;  1S5J A;  3FZF A;  4I6M B;  5AQS A;  3VGM A;  3U6F A;  4R5P A;  1NGD A;  4EFH A;  3M5R A;  2Y1I A;  1ZYQ A;  3GE1 A;  4QS8 A;  3QFU A;  4IFY A;  3M8S A;  1TYQ A;  4DSJ A;  1DLO A;  3TAP A;  3ZSR A;  2IAJ A;  5AZI B;  3D0P A;  2HHT A;  4PL7 A;  3V1O A;  4M42 A;  3HO1 A;  4ZHR A;  3H3O B;  2WOM A;  1P8Z A;  4M3W A;  1XWL A;  4AM6 A;  5DMR A;  3L2Q A;  3R8E A;  4H5W A;  3W3D A;  3EE9 A;  5DK5 A;  3J7Y P;  3DXK A;  1D9D A;  1YHQ N;  4YOT A;  4H5N A;  4H0V B;  3IUC A;  1WB9 A;  4B1W B;  4X62 K;  2GUP A;  4FVU A;  4YOX A;  3PSF A;  3M3Z A;  4FPA A;  1R59 O;  1JCF A;  5BPL A;  3LAN A;  3HL8 A;  1EX4 A;  3I0S A;  1D5A A;  2QWQ A;  1XI1 A;  3EN9 A;  1XC3 A;  1NGF A;  3KLH A;  1HQU A;  4CZE A;  4XIU A;  1IG8 A;  5JVH L;  4H03 B;  2HNZ A;  4YOY A;  5JMV A;  4LFB K;  4BRG A;  3C65 A;  1ZBU A;  3QBW A;  2W42 A;  1Q9Y A;  4LF8 K;  3SBT A;  3I55 N;  1HPZ A;  4BE2 A;  3W0L A;  2NRX A;  4FJK A;  4CEZ A;  4MFB A;  4CJQ A;  2HMP A;  3THY B;  1XC9 A;  3IS9 A;  4KI6 A;  4H8K A;  3LPU A;  1S6Q A;  1SS6 A;  4FWP A;  5DM6 L;  1T3V A;  5BRH A;  3LDO A;  2BUP A;  3TPQ A;  4I9Q A;  4IBN A;  4DS5 A;  3A8Y A;  3V9U A;  4RW7 A;  2HHU A;  4CZH A;  3ZT2 A;  1GLA G;  1DKG D;  2WBN A;  3SQ0 A;  1RDW X;  3DOK A;  4CGF A;  1U48 A;  3UB5 A;  1K8K B;  4DG1 A;  4MO4 A;  3OY9 A;  1RDC A;  3LL3 A;  4W5N A;  1Q82 O;  3C6H A;  4PUO A;  3OBW A;  2A1R A;  4JKD A;  3AGR A;  5FPE A;  4XH5 A;  3TU5 A;  3RMA A;  4YOW A;  1BA0 A;  4PQU A;  4EP4 A;  4B9S A;  4W5Q A;  3B6O A;  3WXM B;  2P9U A;  4JK8 A;  1KQS M;  3TAB A;  3I56 N;  3NFA A;  2ZGY A;  3LAK A;  4JI2 K;  2HBM A;  3LZJ A;  3ZCM A;  3RSE A;  2Q1N A;  2D0P A;  4B3O A;  2KKZ A;  1JJ2 M;  5TKW A;  4DMN A;  4YDU A;  3E9P A;  3D2E B;  2GWK A;  5ELZ A;  3NF9 A;  3NDK A;  4KTQ A;  5EOY A;  4DTU A;  3AO3 A;  4HUE A;  4MDB A;  4JRP A;  4DHY A;  1IBL K;  5AQJ A;  1RTJ A;  4JN4 A;  3VGL A;  4AHT A;  4DV6 K;  4OJR A;  5AZI A;  2G8I A;  2NRZ A;  2GBZ A;  3VEV A;  1NJZ A;  3QEP A;  1RBS A;  3OYM A;  3OYB A;  1UOC A;  4FJ8 A;  3IFR A;  5JVG L;  4BC2 A;  4CIG A;  2XRI A;  1YVN A;  3CQY A;  3K9J A;  4M45 A;  3DAW A;  4CER A;  4DLG A;  2BDP A;  5AQZ A;  1ZBL A;  4J2B A;  4BG9 A;  1HLU A;  2ZE2 A;  2OPP A;  3WXI A;  2V7Z A;  4DFM A;  2KLA A;  3EYZ A;  2NRH A;  4LSN A;  4CCH A;  3CIP A;  4BQL A;  4FJ7 A;  4CF9 A;  2D0A A;  2XY5 A;  3QER A;  3MAQ A;  1ESV A;  1L5U A;  1B9D A;  3JSM A;  3SUQ A;  5C0Y A;  3QEX A;  2H3G X;  3LDQ A;  5I3U A;  4IG3 A;  1M1K O;  2RN2 A;  4WFB L;  2KFZ A;  3U9D A;  4JLH A;  1N6Q A;  5EVZ A;  3H1V X;  5CY4 A;  1VQ6 N;  4CFD A;  1W0H A;  1T44 A;  3UE5 A;  1HNX K;  5D3G A;  2P51 A;  5KRS A;  3AVM A;  2YNH A;  3A5O C;  3KK2 A;  1QSL A;  1SL2 A;  1BU6 O;  4EHT A;  3DLB A;  1OKJ A;  4CES A;  4NCG A;  2GEL A;  4E7J A;  4MO5 A;  3THY A;  4FJG A;  2O8B B;  3QEV A;  4CK1 A;  3RRH A;  1BDG A;  1TAU A;  4ELV A;  3ZX2 A;  4B1U B;  1L3S A;  4ID5 A;  3ID6 A;  4MLE A;  5KGW A;  3A0I X;  2BTF A;  1S22 A;  3H08 A;  4BR9 A;  4CEC A;  1KTQ A;  2KHO A;  4K43 A;  1NOZ A;  4KHP K;  3FFK B;  1VSJ A;  1KVA A;  4K0K K;  5TKY A;  3VEN A;  2XY8 A;  4WFA L;  3HOT A;  3M6G A;  4B3R K;  3PV8 A;  1Y97 A;  2OTJ N;  3P4I A;  1QE1 A;  2GUI A;  1JKH A;  3OJU A;  4ELT A;  4JI4 K;  1DEJ A;  3THW B;  5AQI A;  1IKY A;  1BOT O;  1CZ9 A;  1RFQ A;  3E9O A;  1C1B A;  1Z25 A;  4CBX A;  2QA4 N;  4AHV A;  3CCL N;  4LF9 K;  1DTQ A;  3ZEU B;  1N34 K;  1MA9 B;  3MEE A;  2ETJ A;  1I39 A;  3T3F A;  3ZSZ A;  4A5A A;  1U04 A;  3ATV A;  4O8K A;  1C1C A;  2NLX A;  4HVJ A;  4ID1 A;  1WBB A;  4C8N A;  5GAD P;  3EY1 A;  1L3V A;  3THX B;  3BZC A;  3D2E A;  4CJR A;  4I7F A;  4NLB A;  1G99 A;  1JLG A;  3K57 A;  3LDP A;  2YX6 A;  4JHD B;  3AVI A;  4JKG A;  3P31 A;  1UWB A;  3DMJ A;  2F8T A;  4H0Y B;  4GVM A;  4PA1 A;  3VMF B;  3I8D A;  4DUZ K;  4NYN A;  1NJY A;  3V1Q A;  2OPR A;  2IVP A;  3F2K A;  2Q0U A;  3KLG A;  4EZ6 A;  1IKW A;  3B8A X;  4G9Z A;  3OYA A;  4DS4 A;  1LAW A;  5ADX A;  3LDN A;  1TK8 A;  4CJL A;  5FDL A;  2F8S A;  3P1G A;  4DV5 K;  2KFN A;  4N56 A;  4GV6 A;  1W9H A;  4GVE A;  3CCM N;  4FZX C;  4HUF A;  4JKC A;  4FJM A;  3IDH A;  4E7H A;  3SK3 A;  2HND A;  3KJV A;  2AJQ A;  3H6E A;  3P5J A;  4X66 K;  1O1W A;  2A40 A;  3SZ2 A;  3VQ7 A;  4BRH A;  1ZBS A;  4FXD A;  1EWR A;  4IDH A;  1HKC A;  4CJS A;  5LL6 Z;  3SUN A;  4BRQ A;  3KLE A;  3L4Q A;  4B1Y B;  4V19 S;  4FLZ A;  3WNH A;  2NRT A;  5E26 A;  5AQH A;  4IO8 A;  2VQE K;  1GLF O;  1EP4 A;  4Z4E A;  3FR0 A;  5CZ1 A;  3K58 A;  1RT1 A;  3AO4 A;  1QQC A;  2OAN A;  2Q3S A;  4DTR A;  1WSH A;  4DQS A;  4WF9 L;  4IFE A;  2UXC K;  3EZ5 A;  3NF7 A;  3ZX3 A;  1NK0 A;  1LWF A;  1VSE A;  2PAV A;  3WEE A;  2O8D B;  4FM0 A;  3PX6 A;  3QLH A;  1U2V B;  2E6M A;  3CFP A;  2HHS A;  4HTL A;  4FK2 A;  4LF4 K;  4KHW A;  1WSJ A;  4IKF A;  4DCH A;  2P9K B;  3MX2 A;  2Z1I A;  1GOA A;  2PFU A;  3KWI A;  2Q97 A;  4FPB A;  4W5O A;  3KD1 E;  3RMD A;  4HCB A;  4DLE A;  1U49 A;  3L3U A;  4MLH A;  4BAC A;  4BRE A;  3QIP A;  3CCJ N;  4CJP A;  2X74 A;  4JKF A;  4RG8 A;  4KHY A;  4OPH A;  2GV9 A;  3QFP A;  3NGY A;  2VG6 A;  5HRP A;  4CHQ A;  4FYD A;  3VN5 A;  4NO7 A;  1CZB A;  5M1N A;  3THW A;  5C2D A;  1LCU A;  1S1W A;  2FF3 B;  2D1K A;  3LM2 A;  3QIO A;  3DJC A;  1NKB A;  4CGG A;  4FWR A;  2F9W A;  3O9Q A;  3F73 A;  3CJ1 A;  3CCR N;  2NRV A;  4BVO A;  2PYL A;  4FLT A;  2QWP A;  5AQM A;  2R7Y A;  3QBX A;  3U3Y A;  2V52 B;  4DFJ A;  4O0J A;  4CGI A;  4CIE A;  3THX A;  3HVT A;  4CJE A;  3UKU B;  2KW4 A;  3VF2 A;  4PKI A;  1BCM A;  4JHD A;  2D0B A;  2YJE A;  3EEQ A;  3VQD A;  1J54 A;  4DR7 K;  2YV0 X;  1NG9 A;  1ATS A;  4Y0W A;  3OJS A;  3ZSY A;  4CGH A;  4M63 C;  2AP1 A;  4DSL A;  2I7P A;  2FC0 A;  5CR4 A;  4C8O A;  4BDZ A;  1KXP A;  1RTH A;  1N36 K;  4GV3 A;  3T1H K;  3E9L A;  4CF1 A;  2AA4 A;  3OYK A;  5I42 A;  1VQ7 N;  4AHS A;  3NAE A;  4H0X B;  3OYL A;  4DQQ A;  3CM5 A;  3ZET B;  3J7A P;  2ITG A;  1BUP A;  2HVI A;  1XQS C;  1BI4 B;  1TKZ A;  3DLR A;  1JLB A;  4Z4H A;  1JLF A;  4CHO A;  4CIF A;  1Q81 O;  3D2F A;  3V9X A;  3O3G A;  3S3M A;  1VRU A;  2CH6 A;  3MXI A;  2UUC K;  1HYZ A;  3TSP A;  3V4I A;  1Y64 A;  4BWM A;  3ZT1 A;  1XNQ K;  4CZJ A;  4BRL A;  1VSL A;  1J5O A;  5IT9 O;  1GLD G;  3O9T A;  4LF6 K;  1QQM A;  4CJU A;  3AO2 A;  5KPR A;  3NGI A;  5EY4 A;  1RBR A;  2PY5 A;  4RTF D;  1P90 A;  3B6P A;  2E4L A;  3NH2 A;  4OKJ A;  3HXM A;  3FZL A;  1EXQ A;  1HJO A;  4CW7 B;  4OLB A;  1HNZ K;  5AJ3 K;  2O8D A;  3TAF A;  4FL9 A;  3ULD A;  3PO5 A;  3CFR A;  4FLX A;  1C0U A;  4M7Y A;  2WTU A;  2UXB K;  3CXC M;  5JIC A;  3S3O A;  2P9S A;  4ISF A;  3VGK A;  2W6L A;  2HF4 A;  2UUA K;  4CJ5 A;  4N76 A;  2P9K A;  3VEO A;  2HST A;  2ZF5 O;  4ISG A;  5AR0 A;  3VQ4 A;  4BRA A;  4U7B A;  4AH9 A;  2CGJ A;  4C23 A;  1VQ4 N;  4FK4 A;  5BN8 A;  4FM2 A;  3ZT3 A;  1W7A A;  1VSK A;  1SKS A;  4AHR A;  1RT4 A;  3AA3 A;  5GAE P;  4K25 A;  4K8X A;  1BIS A;  4F2S A;  1BIU A;  1DGK N;  1IKX A;  2O8F A;  3TSQ A;  3CQ8 A;  1GOC A;  2RKI A;  4FOI A;  4WQ4 C;  3L4I A;  4FVM A;  4KHU A;  4R79 A;  3E66 A;  3WQU A;  3C94 A;  3WQT A;  4ILH A;  2XHB A;  3S41 A;  3IG1 A;  2VWB A;  4FJL A;  1ATN A;  4PL8 A;  3C6A A;  4FJH A;  3AAR A;  3SCX A;  3M8P A;  3C7N B;  1X9S A;  3ZSQ A;  4OGE A;  1TUY A;  1GLE G;  4FW1 A;  4M41 A;  3SQ2 A;  3FGU A;  4GW6 A;  4E1M A;  3M1F A;  1NKE A;  3UKU A;  5AFU A;  3P83 D;  1HRH A;  3VER A;  5A2Q O;  3K0S A;  3CJA A;  3E1Y A;  4CVN E;  2KTQ A;  2O8C A;  2DPN A;  4Z4G A;  3OS2 A;  2F9T A; 
#chains in the Genus database with same CATH homology
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...