2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH superfamily
4KTWA 4JRPA 3AA5X 3LAKA 3M8PA 3K9JA 4CJEA 3J7YP 2P9PB 2RE2A 4MDBA 1A5WA 1Q8IA 2PYLA 3O3GA 3PIPL 3VEWA 2ZGYA 3D45A 2D0OA 5BN8A 3O9TA 4NYFA 4BR7A 5FLXO 3L3UA 3LANA 4GNIA 4GV6A 2Z1HA 5TKWA 1S1XA 3RMCA 3JYTA 1C0FA 3VQ6A 3KHYA 4DTNA 2XY8A 4DSFA 1VSDA 4XIUA 2KKZA 1KLMA 4DV4K 3V9SA 4ZTFA 1QZ6A 3B6PA 1ZYQA 1YT3A 3AVCA 3EN9A 2NRZA 4FW1A 4KB1A 2Q36A 4H5RA 2G8UA 3CCVN 1D8YA 1TL1A 3VF4A 3IUCA 3RMBA 1ITGA 2V52B 1L3SA 2VWJA 4DV7K 4J8FA 2CGLA 4E7LA 2F8TA 5EU7A 4CBUA 1XHXA 4FL9A 4WFBL 4E7HA 4A2BA 4X66K 3P5JA 3R6MA 4EFHA 1JJ2M 1QQCA 1TV6A 2HSTA 1NOYA 3LDPA 3TR8A 4GV9A 2XO7A 2OCEA 3RR7A 4RW8A 5BN9A 5I3UA 4BR9A 2A5XA 3L2WA 1QQMA 1TVRA 4BROA 2IOCA 3L2QA 1VSFA 4DSKA 4IJNA 3ZSRA 2X6NA 3OBYA 3QLHA 3G10A 3P1GA 4PA1A 4CJ5A 1HRHA 1TGOA 4DV1K 4CD3A 1KCFA 3OBWA 3HPGA 1SS6A 1BA1A 1WNSA 1IKWA 4TSXA 4CF2A 4MQ3A 3O8MA 3VA3A 4MLEA 4YOUA 2E2PA 1WSIA 3BY5A 5JVGL 1SQKA 2HHUA 2E2NA 3NF6A 2A41A 1NG9A 2HHVA 5C2DA 4H5WA 1MWMA 3THYB 3VN5A 3C94A 1VQ7N 1WLJA 2OPRA 5J1EA 1JCGA 4BRFA 3CERA 1JLGA 4B9LA 3QO9A 3WUHA 1WBBA 3T1AA 2FLOA 2V7ZA 2FSNA 3LDNA 5AQYA 4CEDA 3EYZA 3CPWM 3PV8A 1VQON 4DTXA 4DR2K 3HVTA 1WOQA 4LF4K 5BRDA 3NAEA 5AQPA 3BP8A 1DEJA 4FJ8A 2A3ZA 2F9WA 4GY2B 4JN4A 1TK5A 1KFDA 4W5OA 5M1QA 4FZYA 1QS4A 2A6AA 4HUFA 4L3QA 3DMJA 4KHYA 3EE8A 4YNQA 2G8FA 2GWKA 3H1VX 1HX1A 2NLXA 4FJLA 4CZLA 4CK3A 3ZEUB 1T8EA 2O4IA 4C8OA 4JAXA 4Y1DA 4JHDA 3ID6A 5LJWA 1KXPA 3NH1A 3THXA 5AQGA 1SZ2A 1IKXA 3F73A 4W5NA 5LJVA 3QICA 1H1VA 1YJNN 1U2VA 1HYVA 3D2EA 2B4JA 1EXQA 3OYNA 4KHWA 3VQ7A 4H0TB 4NXMK 4Q0BA 4B1XB 1ESVA 1YITN 4FK4A 2WBNA 2V7YA 2HB5A 1RDAA 1LV5A 5HRNA 4NCGA 4EP4A 4FM2A 3OS2A 1M1KO 3GG4A 3LZJA 1EX4A 3HJFA 3NF9A 1W2BM 2O8EA 2O8FA 3BDPA 4CFDA 4GVEA 3C95A 3CIPA 4CHOA 5AQFA 4BREA 1NGCA 4DSLA 4KH5A 2HVHA 4CEQA 3AVHA 1BISA 2KTQA 1HJRA 5EXWA 2YHAA 3G25A 5E41A 1MWKA 3L6QA 2YHWA 4B9MA 5LMUK 4CEBA 5HRSA 4ELTA 2NRHA 3CCMN 4E1MA 5SZTA 4FYDA 3J81O 3F9KA 4BQZA 2CH5A 4CEZA 3PX6A 3CPEA 1XNRK 3CJCA 3SAFA 2RPIA 4WQ5C 4LSNA 4O55A 4Z94A 3ZT4A 2VQFK 3CXCM 3TWHA 4FLUA 3BF1A 4DQQA 3GL1A 1B9DA 3HM9A 2FSJA 2P9KB 1BWFO 1BO5O 1VHXA 2WOMA 4BC4A 4AF1A 4B3TK 3D0PA 2CGJA 3VQDA 2ZJQL 5ADXA 4EIAA 1DKGD 3VQPA 4OPKA 4CHNA 3RMDA 4IFEA 2E6LA 4DV0K 4M3UA 3LALA 2KQ2A 1G15A 4KI6A 3ENOA 3SCXA 1WN7A 1CZBA 2UXBK 3OYFA 2ASOA 3PLAA 2HBLA 4CZGA 3CI5A 3EZ5A 1YXQA 3B6OA 2P9LA 5EX5A 4DMNA 2KZZA 2IS3A 1ATNA 3O3FA 3HOSA 4G9ZA 3M5RA 1LAVA 5BREA 1J5EK 5FRNA 2VGNA 5AQRA 3VETA 3SUPA 4IFYA 3KD5E 1D5AA 3TTFA 3CCEN 4V19S 3MN9A 3WXIA 4E7JA 2KFNA 3VESA 3L4QA 3H3OB 1Z6RA 4LH5A 3WNEA 2XY5A 3DYAA 1ASVA 3MEGA 4K25A 4OVLA 4PUOA 5F0XA 3O3HA 4FVUA 4AQYK 1TKDA 1X3MA 1NGAA 4B3MK 1MU2A 5J2QA 4AH9A 2KW4A 3AA4A 3C6UA 3O9RA 3GDQA 3TI0A 3HSTB 3DI6A 4BRCA 1T7PA 3HTVA 3EE9A 2NRWA 3L3VA 5FPMA 1NNEA 1GOCA 3AO4A 1UA0A 2Y1JA 5E84A 3E1YA 1XC3A 1NK9A 4BC5A 1S9GA 4OKJA 4BDYA 3O08A 4A57A 2HF3A 3AVKA 4CF1A 1SAZA 1K73O 2OZMA 2FBXA 2UXDK 3DXMA 1C0TA 3UE5A 4ILGB 4DKWA 5H1SQ 1QHAA 1K6YA 1NGIA 3G0ZA 5HL7L 3TSPA 4LD0A 3RRGA 3KZBA 1IJJA 4BC3A 2UYTA 3R9PA 3SBTA 3MX2A 2QWLA 3J7ZO 3L2RA 4H5VA 4Z4HA 1HQEA 3T69A 3G71N 1T44A 4HCBA 3AVBA 3K5OA 3W3DA 1J9AA 4DG1A 1QSYA 4LF9K 4E3SA 4KPYA 3QFPA 1XC9A 3QNNA 4CJ3A 5AQHA 3VGLA 1TKTA 3C65A 1TYQB 3DLKA 3V9UA 3KKSA 4FLWA 2DY4A 4JEPA 1KVCA 2HOEA 1HKGA 4YDUA 5KTQA 3J7AP 4N41A 4JLHA 5KGWA 2E1YA 1KTQA 1ZBSA 4O5FA 4RTFD 5JS1A 1HYSA 3A5OC 1KAZA 1HJOA 1J6ZA 1R0AA 2BUPA 1QSSA 1C0UA 4FXDA 3NVKA 4O44A 4M7XA 4K43A 4OLAA 4FO0A 2G8VA 4BGAA 4LF8K 3VEXA 2ETJA 4FLTA 4IOCL 4BRNA 2HNDA 3A5MC 3R8EA 4I6MB 1VSHA 4ELVA 4ISEA 4IFVA 3F2KA 1KAXA 3V9XA 1VK0A 2OTJN 4GVMA 2YJEA 1YAGA 3NGZA 3CCSN 2LSNA 2ATQA 4ICLA 5AZIB 1K8KB 1RT1A 1E4FT 4IOAL 4BVPA 2D0AA 1U48A 2CGKA 3OTOK 3D2FB 4CD1A 1XI1A 1W97L 1HNWK 1VSIA 5EY4A 3OYIA 1RTHA 1V4SA 1S5JA 3M6GA 1YF5L 3ZSWA 4FOIA 4YOXA 3CQXA 3BZCA 3QEWA 3CC2N 3ENBA 4KI4A 4KH6A 3J80O 4B9NA 2HBMA 3FZFA 4JKGB 2WC9A 3U9ZA 1RT4A 5GAEP 4FM0A 1RTDA 3I8DA 3R3LA 1WSGA 1QE1A 3SJJA 1NBWA 1EQYA 4WQ4C 4FPBA 1U45A 4FWKA 3UKUA 2QA4N 2BH1A 4O8KA 2E20A 3VQCA 1WSFA 2P9UA 4ID1A 5HLFA 4JI8K 4A2AA 2QWNA 3ZETB 4DQSA 1OVQA 1KVAA 2KHOA 2W40A 1NJXA 3IDHA 4JI1K 4BR4A 4JD2B 5DM7L 2OPPA 2P9IB 2P51A 2YNHA 1IO2A 1ATRA 1Z25A 3DWLA 3VA0A 4FWOA 1HQUA 1T05A 4H0PA 1RTJA 5AQLA 3DLRA 3FE1A 3ENHA 3V1RA 1W7AA 4I9QA 1BI4A 1SKSA 4H0XB 3ISNC 3OYCA 1KVBA 3ZSVA 3WNFA 2B6AA 1JLFA 1N32K 1TUYA 3SLCA 4FJMA 5KPTA 4LFAK 4C8LA 1OH5A 4B3OA 3GBTA 4DR1K 4DSJA 1JLQA 3BEXA 3OYMA 1C1AA 2VWBA 2VYPA 3V4IA 1GLEG 2Q0RA 3RSEA 3SMPA 3VQEA 4X65K 2A1RA 3LP3A 4DQ8A 2GEMA 1ZBHA 3KWGA 3OA9A 3SMSA 1IKYA 3R1XA 4BG8A 3THWA 3QEXA 3ZCMA 2QTDA 2IVPA 4KH4A 3SV3A 3OW2M 4BE1A 1BCOA 1VAZA 1CZAN 3MCPA 3EL2A 3FR0A 3A5NC 5M1NA 4CEAA 3SI6A 3C6HA 4BRKA 2YNFA 5K14A 5AQJA 4Z4GA 3PSIA 3SQ4A 2QWQA 3SYZA 1SL2A 4CEFA 2VCPA 3PIOL 3F9MA 5CYMA 1S72N 3OY9A 4M42A 3MAQA 3OYGA 1U2VB 4FJ5A 3IKMA 3U3GA 4AM6A 3E01A 3VEYA 2IDOA 1C0MA 4OGCA 3OYLA 5C42A 2O8BB 1HLUA 3S3NA 1NKEA 5M1KA 2H3GX 5IWAK 4FWPA 3QIPA 1HNXK 4CBXA 4F9OA 2ITGA 1X9MA 4NCBA 1SUQA 2D1KA 3WXMB 4W5TA 4C1NK 5BPLA 3MEEA 4DTPA 3AVNA 2Q0UA 3DJCA 3UKRB 4OX9K 4EHTA 2QW9A 1VRUA 1S1WA 4IBNA 3BUZB 3MXIA 3ZSZA 3NH2A 1U04A 3KTQA 3OJUA 3ULEA 1P8ZA 1U4BA 3ZT2A 3TSUA 3VQ5A 4B08A 1C6VA 1Q18A 2I7NA 2FC0A 2HMPA 3OYAA 1HNZK 5AQWA 1DTTA 5CHIA 3CF5L 3LP2A 1VSJA 2GWJA 3MWTA 4GKKK 4CBWA 1N8RO 3V1OA 3HT3A 4A5BA 2BE2A 2W6KA 3B8AX 1SL0A 4PQUA 3CM5A 2P9NA 5HOOA 4CJRA 1KFSA 2A40A 1SKRA 4ILJA 1T3VA 2GV9A 1XQSC 3PUFA 1EWQA 2E5LK 1JCFA 5AQMA 3S3OA 1XWLA 3P39A 1CZ9A 3NH0A 2YKNA 4O4GA 5KQDA 4CZIA 3VEZA 3WEEA 3O9SA 4DQRA 4QS8A 4H0OA 1GLJO 3C7NB 1NJIO 5CY4A 4DQPA 3ATUA 3CJAA 2NRRA 4KHPK 3KK2A 3TAFA 1JLAA 3HOTA 5D3GA 4CHYA 1QZ5A 3FLCO 3M3ZA 3LM2A 3S3MA 1IBKK 1IBLK 3KJVA 4O8UA 1XUPO 3PO5A 2D0PA 3HYFA 1ATSA 1YTUA 3VERA 3VTHA 4XEIA 2VQEK 2QKBA 3I8BA 3OYDA 3OYKA 2J4RA 1QVGM 3D6RA 4FWRA 3K57A 5AQKA 1FK9A 1EKEA 5JLHA 3BF3A 4J2DA 5AJ3K 1RT3A 1S6PA 5KRTA 1QQOA 1VQMN 3EEQA 4BG9A 3VQQA 2G8KA 2D5RA 2UUAK 5BR9A 2D4WA 2PYJA 3AA2A 3NHGA 4HUEA 1BIZA 2IVOA 3O4QA 1RDBA 5JS2A 4JKEA 4M41A 1D4XA 3G6EN 4IJAA 1Q7YO 2P9PA 3WXKA 4B9VA 4AHUA 4FJXA 3CM6A 3TTDA 2CH6A 3IMXA 1NGEA 2QXFA 4Z4FA 5LY3A 4UY8O 1VQNN 3E9PA 1VSMA 1EWRA 3AV9A 4FM1A 3SUNA 3CC4N 4K41A 3SBGA 4CEOA 3O80A 2QWPA 4JNEA 2JLEA 1LW2A 3W0LA 2P5OA 2Q2RA 4DSEA 2GUPA 4QOZB 2BANA 4OJRA 4BRQA 1VQ5N 1JXEA 4CGHA 2GUIA 2YHBA 4DB3A 3KWIA 3SPYA 4Z4CA 4DFKA 2G8WA 2PAVA 1ASUA 4JS4A 4DV3K 4DU1A 2G8IA 3DRSA 1GOAA 2FBTA 3MWPA 1YHQN 2IIRA 5JVHL 1L5UA 1NGGA 4CHZA 3JAMO 1VRTA 1YJ9N 3HI0A 3AAPA 1HNVA 1RT6A 4XH4A 3KLEA 2PBDA 3MN7A 1T6DA 3SAGA 1IKVA 3FZKA 4QS7A 5AFUH 4H5NA 4FJHA 1FKPA 3HVRA 3MXJA 2E2QA 4B1YB 2ZWHA 2YHYA 4ID5A 4IDHA 3T7ZA 3NF7A 3EZWA 4CJTA 3CFOA 1SL1A 1L3TA 4PKHA 2O8DB 3JXUA 4JI7K 5DM6L 2ITMA 5C25A 3HZ6A 1GLLO 4CZFA 5AQIA 3C0BA 4YOWA 1RDWX 1OKJA 4DTJA 3QMLA 3THYA 4CIGA 4FPAA 3LWMA 3DRRA 3WNHA 1NGJA 4JKBA 3QEIA 1O13A 3O5BA 1ZBFA 2O8CB 3HP9A 2QI2A 4WE1A 4GW6A 1C0GA 3ID8A 3TANA 3AVAA 4NYNA 2HW3A 4JI5K 4A62A 2F96A 1EO1A 3WT0A 4B9TA 2I7PA 4WYBA 5HP1A 1HKCA 4B1VA 4DV6K 2GTDA 3S9HA 4MLHA 2FBVA 1A5XA 1BIUA 2VG7A 2P1JA 1QVFM 1X9WA 4BGBA 2FF3B 3MX5A 1F21A 5AZJB 4FWQA 4BRGA 4X64K 4OO1J 1YJWN 4CJVA 4IO8A 3ZEUA 1HYZA 4K0KK 3CJBA 4JI0K 1RBUA 2YNGA 4JK9A 3WNGA 1U47A 1IBMK 4FJGA 4FOEA 4JK8A 3VMFB 2QM1A 2YJFA 2YHXA 4Z4IA 1GOBA 4WQ5A 4EZ9A 1RBRA 5HRPA 3HM8A 1QSLA 3VPZA 5C10A 1HPZA 2ZGZA 5HRRA 5BRHA 3P31A 2YKMA 4I2QA 3WQUA 4BR5A 4C23A 3AVFA 3BZKA 3CHWA 1W9HA 3ZT0A 3C6TA 1RBSA 3DOKA 2QWMA 5LMNK 3SPZA 5E26A 4M3YA 1RILA 3TPQA 5FPEA 4F8RA 1EETA 5IT9O 2JWLA 3M1FA 1ZBIA 4RCHA 2FSKA 4CHPA 4O0IA 3L2VA 1TKZA 1RBTA 3EO3A 3OS0A 1LWFA 4DR4K 3NGIA 3VQ8A 4KO0A 2E4LA 4H5TA 4OLBA 5EVZA 2VGMA 2Z1IA 4PHTX 4FJ9A 2P9SA 4ILHA 3CMAN 1WB9A 1NJZA 3LZIA 1XNQK 1P90A 1NOZA 4WFAL 3U4LA 5AQXA 4F4KA 2ZQBA 4GKJK 3A8YA 2IVNA 2P9KA 3LP1A 3Q7BA 4DSIA 1Q86O 3SQ1A 4KRFA 1LOTB 4B9QA 2HNZA 1QQNA 3VEOA 2DPNA 2QK9A 2DFEA 1IG8A 3BGRA 1CLQA 2XRIA 2R7YA 3AAQA 1NGBA 3H1QA 5I42A 1RDUA 3PY8A 3LM9A 3NMUA 4YORA 4JRQA 4AHCA 2Q1NA 2E8AA 1XMQK 4E1NA 3M8RA 2OTLN 2D0BA 2QKKA 3CQ8A 2WUSA 4CF8A 3VENA 2XHBA 3AGRA 1B92A 3FGUA 1U6ZA 2HBKA 3AO2A 2OANA 4KTZA 4IOXA 1X9SA 1VQKN 1RTIA 4BRLA 4HHTA 4QCLA 4HTUA 1MDUB 1W0HA 4RG8A 2QWRA 3EKUA 4LFCK 3SAHA 2XY6A 2HMIA 2OYQA 4CGFA 3O4NA 3LPUA 3CJ9A 4A61A 3ZT1A 1DGKN 4HWIA 1S9EA 3DAWA 5AR0A 2PY5A 1R59O 4LF5K 4W5QA 4DLEA 4C8NA 4CGIA 3V81A 4DFPA 3QIOA 1BGXT 3TTCA 2VG5A 4G1QA 1ZBUA 3HXMA 1YTAA 3C6AA 1NGHA 3H6EA 3CFRA 2HHXA 2WONA 2F9TA 4CZKA 4E1JA 3NCIA 3ASMA 4BR0A 2XY7A 2UXCK 2YI1A 3K9KA 4CJLA 3ULEB 1Q81O 1SV5A 4O5BA 2E6MA 4RW9A 1RFQA 4QAGA 2OZSA 4F3OA 4NLBA 1REVA 3IRXA 4DR5K 3I0SA 4DS5A 4E7IA 3HBTA 2HHHK 1TAUA 4MO5A 4CZEA 4AHSA 5FPNA 4CJKA 4OGEA 3KLHA 3AO1A 4KHNA 4NB4A 1TAQA 3A2FA 3LDQA 3N4QA 3K5MA 4BRHA 4FJJA 5A2QO 1C1CA 2BTFA 4CJUA 1VSKA 3TAQA 4E7KA 2D0CA 2GELA 5AQOA 5M1PA 3ITHA 4J2AA 3CQYA 3TAPA 3ZSXA 1HR0K 4N76A 1HKBA 1S3XA 4Z0UA 3SQ2A 2IC3A 2RF2A 1X9JA 1RDCA 4FK0A 3FZLA 3ZX3A 4XH1A 4EP5A 3ZT3A 3V6DA 1RNHA 2W41A 4JKDA 1NU0A 4OPAA 3HPHA 4WCEL 5HBMA 3QETA 1BQNA 2E88A 1NJYA 5C24A 1S1UA 2IGIA 4JI4K 5C12A 1S6QA 2YV0X 3PX0A 1T03A 1X1PA 3GE1A 3P83D 2X74A 4KFBA 3I0RA 4CEEA 2F8SA 3NGYA 3G4SN 2O4GA 3I55N 4DFMA 5KRSA 3VGKA 1TYQA 4JI6K 4H8KA 1NK0A 3SK3A 5GIPA 1B9FA 4LSLA 4JHDB 3FFKB 2JWKA 3DXKA 3THXB 3DOLA 5DMRA 3RTVA 4KAZA 5C0YA 1JXBA 3OJSA 3T1HK 1A5VA 3M8QA 3Q7CA 1N5YA 3HPOA 4FJ7A 2FF6A 3D2EB 5F2RA 4AHRA 4BC2A 3RWUA 4UQGA 4DUYK 2ASMA 2HHTA 1YVNA 3CJ7A 4CF9A 3SV4A 4CJSA 4CK2A 4DR3K 1JLEA 1L3VA 4JYAK 2Z1JA 1UAXA 3MEDA 4WQ4A 5FPDA 3U9DA 2GX9A 4JI3K 1GLCG 3AO5A 2FXUA 4I6MA 4FJKA 4PWDA 4AHTA 3K2PA 5C2FA 5TKYA 4JS5A 4JKHA 1I3AA 3KK7A 5AZIA 4R79A 1K8KA 4CFBA 2ZJPL 4J2BA 2O8FB 2O8EB 4BRDA 4B9SA 1ILYA 3P4IA 1TUUA 1C1BA 4DF4A 1DTQA 2X6SA 3ZX2A 3N4PA 3D2FA 4C8MA 3UB5A 1OVYA 1OH6A 1SKWA 4CI6A 2A42A 1NMNA 2HF4A 1NGFA 5DK5A 4DS4A 4JKGA 1YVUA 1JL1A 1TL3A 1N36K 4K42A 2Q97A 3AVGA 3HL8A 4DTUA 4FLXA 3RMAA 4BRAA 3VF2A 2IAJA 4KHUA 2DTUA 3O9UA 5AQZA 4GMJB 1LWCA 4M3ZA 4AILC 4CCHA 4IKFA 5CE3A 4FZXC 4FCYA 2RHKA 3ZETA 3QNOA 3TAGA 3SUOA 3OYEA 3CD6N 2ZE2A 3AVMA 3ZSQA 4B3SK 4JD2A 2P9IA 3K59A 4C8KA 4BDPA 3TAEA 3L0QA 1WUAA 1Z05A 3KK1A 3IS9A 1L3UA 3MDQA 4Q5VA 5HROA 3KLIA 3K58A 4BR2A 3OYJA 4QS9A 3E9OA 5JMVA 2HHQA 5T7BA 1BU6O 3MK6A 3NVMA 4J2EA 3H08A 1BHLA 4KB0A 3QINA 1RT5A 4M3RA 3KD1E 2P9LB 4CJWA 4W5RA 4B1UB 1JLCA 1DLOA 2HVIA 1HMVA 3U8XA 3ALYA 3TU5A 4M45A 3LPTA 5AFUA 1YIJN 2Q3SA 5CYQA 4NLCA 4WF9L 1BL3A 4Y1CA 2VWKA 3DLEA 4JI2K 4FLZA 3D7EO 4FLYA 4OKKA 3EY1A 3O9QA 3O1WA 4KKOA 5JLFA 3I33A 4Y0WA 2ZJRL 5BPNA 2HHWA 4EHUA 1WSEA 1IV0A 1WBDA 4DUZK 2QWOA 5KPRA 4CGJA 1RCHA 2W6LA 4BRPA 5LL6Z 1NLVA 3CG7A 4N5SA 1NK4A 5AQNA 2YNIA 3ATVA 5AQSA 5BR8K 3ZSOA 2KZMA 2OPSA 4F2SA 4BVOA 1RDDA 2AP1A 2YCHA 4CJQA 4B8AB 4MFBA 5J2PA 2QXLA 4CE9A 3CETA 4DQIA 3T19A 3HRGA 2OA8A 3VF6A 2QEXN 4FSVA 4RWTA 3RVCA 2O8BA 2Q31A 1Y97A 2EWSA 4CHQA 3NF8A 4IWVA 2NNWA 4KBOA 1S22A 1GLDG 3THVA 1E3MA 3NFAA 4IG3A 5CZ2A 1GLFO 3AVLA 4Z4EA 1TK8A 4BWJA 2Z1GA 4OKEA 4CVNE 3F5TA 3FFIA 4PL7A 5FRMA 3DXMB 5GIOA 4FWNA 2NUBA 3FZHA 4DTOA 3FZMA 3DLLL 1VSEA 1NK8A 3UKRA 4K8XA 2BGGA 1BDGA 1JCEA 4BWMA 3KLFA 3O6WA 4CF0A 2I5JA 5KGXA 4O0JA 1RT7A 1GLAG 4DLGA 4HVJA 3K5NA 2Y1IA 3PSFA 3HK2A 3AGKA 1TK0A 4H03B 3QEPA 3UIQA 3VOVA 1Q9XA 3S41A 1NK6A 1RT2A 4FWLA 4YY3K 1J53A 4LF7K 1TKXA 2PFUA 5J2NA 3P38A 4LH4A 3DM2A 5AQVA 4F2RA 3KIOA 1V4TA 4BE0A 2P9SB 4H0YB 3DLHA 4PKGA 1NM1A 2NRTA 3LDOA 1LAWA 3K5LA 5EOYA 3J8AA 5GADP 1NKCA 3VQAA 4YOYA 4F3TA 1BCMA 4DF8A 3TARA 2FBYA 2YX6A 3SUQA 4FWSA 5M1FA 1UWBA 3OS1A 3LDLA 3L4IA 1UOCA 3NDKA 4R5PA 4H4OA 3K0SA 3MCAB 4DFJA 3CYMA 4KHSA 2ZM6K 4M3WA 3DLBA 3RR8A 3C7NA 3AY9A 4DTRA 4JV5K 1N33K 4DTSA 2A1SA 3SJHA 2HHSA 2EX3A 1JLBA 3QEVA 3SNNA 1VQLN 4CJPA 3RRHA 2UUCK 4H0VB 2AJQA 2KLAA 1KRPA 3ZLJA 1KSPA 2X78A 4RW7A 4CZMA 3H45C 2W42A 1K9MO 3AA3A 1NK7A 1NGDA 4WFNL 4B1WB 3VGMA 2E2OA 1KQSM 1I94K 3H3NO 2E1ZA 4PL8A 1D9FA 3NBPA 1O1WA 4FVMA 4YOVA 3ULDA 4IEIA 4M63C 4IG0A 4CERA 2V51B 1NK5A 1S1VA 4YDUC 2P5GA 1BOTO 2UU9K 3TSQA 3VEVA 1VQ9N 2UUBK 5F1XA 4DV5K 2HNYA 3CCQN 1WAJA 4JKCA 3KVGA 5SWMA 3O1BA 3T3FA 3E66A 3WXJA 4YFUA 5JICA 1ZBLA 1VQ6N 4B3RK 1BG3A 3CMEN 5GAGP 3JSMA 4DU3A 3VQ9A 3UKUB 3MXMA 1M90O 3CCUN 4PKIA 5AQQA 3JS6A 4DWIA 4H4MA 4RW6A 2P9UB 4KTQA 4CJ4A 5ADXH 5MLCQ 1WAFA 5KI6A 3ZX0A 4I2PA 1MA9B 4BDZA 2BDPA 2B5JA 3L8BA 1FJGK 3MMVA 1I39A 3AVIA 3VQBA 4LF6K 4M7YA 4LFBK 1VQ4N 1ASWA 1J5OA 4KREA 1OH8A 1LCUA 3E9LA 3QBXA 2VG6A 4CGGA 1XHZA 3KK3A 3QB0A 4ZHRA 4B1ZA 1BI4B 4B8CA 1CXQA 4JK7A 4U67L 4PY5A 5FROA 5FDLA 3IAYA 3MN6A 3M8SA 4BE2A 3AO3A 4CW7B 3CCRN 1KAYA 5I9EB 4A59A 2RN2A 1KLNA 3EKSA 1BA0A 5ELZA 3RSEB 1DT9A 4CZHA 4RW4A 4CFCA 1N34K 4M3XA 1Q82O 1UA1A 3THWB 4CIFA 3CC7N 5BPMA 3T1YK 2O8DA 5KQ8A 3A0IX 3QDKA 1ZXOA 2F7TA 1HPMA 3IFRA 5KPZA 3ZYYX 3OYBA 4C1NI 3A5LC 4AM7A 1D9DA 4ISGA 3VTIA 1HNIA 4CECA 3DXKB 3KKRA 4N47A 1NKBA 4ISFA 3ZSYA 4DR6K 4L8RB 2O8CA 4E0DA 1RBVA 4ZTJA 3V9WA 5BRFA 1GLBG 1NJWA 4AHVA 3QESA 4FLVA 4KV8A 4CIEA 2AA4A 1KD1O 1IG9A 5GINA 2ZF5O 4BRIA 4CJFA 3V9ZA 1OH7A 3AVJA 1X3NA 3LWLA 4YOTA 4CESA 5CZ1A 4DU4A 3LP0A 4MO4A 3U6FA 2G8HA 1YUWA 4HTLA 5AZJA 1WSHA 2JGUA 5GAHP 1Z26A 3PX4A 1RGIA 4ELUA 1YI2N 2HBJA 4OPJA 1JKHA 1NWKA 3KLGA 4IO9L 3QBWA 2F4VK 1WSJA 4DTMA 3PO4A 2ZD1A 1T6CA 1G99A 5J2MA 4FW2A 4I9LA 4MDAA 3TAMA 3AARA 4FK2A 1QHTA 3O4WA 3QFUA 4BQLA 3VQ4A 4OPHA 4KHQA 1VQ8N 3SQ0A 3LAMA 5AQTA 4HCCA 1BQMA 4BRMA 3I56N 4XH5A 1FXXA 2KFZA 1KC8O 2ASPA 2GBZA 3OVNA 3HP6A 2P9NB 1QTMA 4BACA 5B8HA 1N6QA 4A5AA 4IXCA 3CJ1A 2NRXA 3SZ2A 1S1TA 3LL3A 4X62K 3NE6A 1CXUA 1NMDA 1VQPN 4EAHD 1FKOA 4IEEA 1LW0A 4IZ9A 3WEEB 4LY7A 4DHYA 4GV3A 3WQTA 3DLGA 5M1OA 3L2UA 2WTUA 4NCAA 4YHHK 4BY9C 3IG1A 3QERA 4EZ6A 4DR7K 1FW6A 2NRVA 5CR4A 4NXNK 5C15A 4B9UA 4JKFA 4K8ZA 3U3YA 1JL2A 1EP4A 3DRPA 4CK1A 4E89A 3HSCA 4CJ7A 3H46O 2OPQA 1XMOK 3MN5A 3CCJN 4CGDA 1HUXA 3WXLA 3OHRA 4I7FA 4DV2K 4CFAA 3MECA 2PZSA 2RKIA 1LWEA 1U49A 1BUPA 1IH7A 3LDSA 1J54A 4FWMA 4M3TA 3HO1A 4FZZA 2DFHA 1E4GT 3CCLN 3GOIA 4IDKA 1Y64A 4CZJA 4N56A 3V1QA 3CFPA 4E19A 4FJNA 2NZTA 1VSLA 2EHGA 3OYHA 4LC9B 4NO7A 2DFFA 1K8AO 5AQUA 4DCHA 2WFBA 1Q9YA 4HUGA 3TABA 4U7BA 4FJIA 1ZC6A 4JKAA
chains in the Genus database with same CATH topology
3BY5A 2W6LA 3EEQA 2W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
#chains in the Genus database with same CATH topology
 4KTW A;  4JRP A;  3AA5 X;  3LAK A;  3M8P A;  3K9J A;  4CJE A;  3J7Y P;  2P9P B;  2RE2 A;  4MDB A;  1A5W A;  1Q8I A;  2PYL A;  3O3G A;  3PIP L;  3VEW A;  2ZGY A;  3D45 A;  2D0O A;  5BN8 A;  3O9T A;  4NYF A;  4BR7 A;  5FLX O;  3L3U A;  3LAN A;  4GNI A;  4GV6 A;  2Z1H A;  5TKW A;  1S1X A;  3RMC A;  3JYT A;  1C0F A;  3VQ6 A;  3KHY A;  4DTN A;  2XY8 A;  4DSF A;  1VSD A;  4XIU A;  2KKZ A;  1KLM A;  4DV4 K;  3V9S A;  4ZTF A;  1QZ6 A;  3B6P A;  1ZYQ A;  1YT3 A;  3AVC A;  3EN9 A;  2NRZ A;  4FW1 A;  4KB1 A;  2Q36 A;  4H5R A;  2G8U A;  3CCV N;  1D8Y A;  1TL1 A;  3VF4 A;  3IUC A;  3RMB A;  1ITG A;  2V52 B;  1L3S A;  2VWJ A;  4DV7 K;  4J8F A;  2CGL A;  4E7L A;  2F8T A;  5EU7 A;  4CBU A;  1XHX A;  4FL9 A;  4WFB L;  4E7H A;  4A2B A;  4X66 K;  3P5J A;  3R6M A;  4EFH A;  1JJ2 M;  1QQC A;  1TV6 A;  2HST A;  1NOY A;  3LDP A;  3TR8 A;  4GV9 A;  2XO7 A;  2OCE A;  3RR7 A;  4RW8 A;  5BN9 A;  5I3U A;  4BR9 A;  2A5X A;  3L2W A;  1QQM A;  1TVR A;  4BRO A;  2IOC A;  3L2Q A;  1VSF A;  4DSK A;  4IJN A;  3ZSR A;  2X6N A;  3OBY A;  3QLH A;  3G10 A;  3P1G A;  4PA1 A;  4CJ5 A;  1HRH A;  1TGO A;  4DV1 K;  4CD3 A;  1KCF A;  3OBW A;  3HPG A;  1SS6 A;  1BA1 A;  1WNS A;  1IKW A;  4TSX A;  4CF2 A;  4MQ3 A;  3O8M A;  3VA3 A;  4MLE A;  4YOU A;  2E2P A;  1WSI A;  3BY5 A;  5JVG L;  1SQK A;  2HHU A;  2E2N A;  3NF6 A;  2A41 A;  1NG9 A;  2HHV A;  5C2D A;  4H5W A;  1MWM A;  3THY B;  3VN5 A;  3C94 A;  1VQ7 N;  1WLJ A;  2OPR A;  5J1E A;  1JCG A;  4BRF A;  3CER A;  1JLG A;  4B9L A;  3QO9 A;  3WUH A;  1WBB A;  3T1A A;  2FLO A;  2V7Z A;  2FSN A;  3LDN A;  5AQY A;  4CED A;  3EYZ A;  3CPW M;  3PV8 A;  1VQO N;  4DTX A;  4DR2 K;  3HVT A;  1WOQ A;  4LF4 K;  5BRD A;  3NAE A;  5AQP A;  3BP8 A;  1DEJ A;  4FJ8 A;  2A3Z A;  2F9W A;  4GY2 B;  4JN4 A;  1TK5 A;  1KFD A;  4W5O A;  5M1Q A;  4FZY A;  1QS4 A;  2A6A A;  4HUF A;  4L3Q A;  3DMJ A;  4KHY A;  3EE8 A;  4YNQ A;  2G8F A;  2GWK A;  3H1V X;  1HX1 A;  2NLX A;  4FJL A;  4CZL A;  4CK3 A;  3ZEU B;  1T8E A;  2O4I A;  4C8O A;  4JAX A;  4Y1D A;  4JHD A;  3ID6 A;  5LJW A;  1KXP A;  3NH1 A;  3THX A;  5AQG A;  1SZ2 A;  1IKX A;  3F73 A;  4W5N A;  5LJV A;  3QIC A;  1H1V A;  1YJN N;  1U2V A;  1HYV A;  3D2E A;  2B4J A;  1EXQ A;  3OYN A;  4KHW A;  3VQ7 A;  4H0T B;  4NXM K;  4Q0B A;  4B1X B;  1ESV A;  1YIT N;  4FK4 A;  2WBN A;  2V7Y A;  2HB5 A;  1RDA A;  1LV5 A;  5HRN A;  4NCG A;  4EP4 A;  4FM2 A;  3OS2 A;  1M1K O;  3GG4 A;  3LZJ A;  1EX4 A;  3HJF A;  3NF9 A;  1W2B M;  2O8E A;  2O8F A;  3BDP A;  4CFD A;  4GVE A;  3C95 A;  3CIP A;  4CHO A;  5AQF A;  4BRE A;  1NGC A;  4DSL A;  4KH5 A;  2HVH A;  4CEQ A;  3AVH A;  1BIS A;  2KTQ A;  1HJR A;  5EXW A;  2YHA A;  3G25 A;  5E41 A;  1MWK A;  3L6Q A;  2YHW A;  4B9M A;  5LMU K;  4CEB A;  5HRS A;  4ELT A;  2NRH A;  3CCM N;  4E1M A;  5SZT A;  4FYD A;  3J81 O;  3F9K A;  4BQZ A;  2CH5 A;  4CEZ A;  3PX6 A;  3CPE A;  1XNR K;  3CJC A;  3SAF A;  2RPI A;  4WQ5 C;  4LSN A;  4O55 A;  4Z94 A;  3ZT4 A;  2VQF K;  3CXC M;  3TWH A;  4FLU A;  3BF1 A;  4DQQ A;  3GL1 A;  1B9D A;  3HM9 A;  2FSJ A;  2P9K B;  1BWF O;  1BO5 O;  1VHX A;  2WOM A;  4BC4 A;  4AF1 A;  4B3T K;  3D0P A;  2CGJ A;  3VQD A;  2ZJQ L;  5ADX A;  4EIA A;  1DKG D;  3VQP A;  4OPK A;  4CHN A;  3RMD A;  4IFE A;  2E6L A;  4DV0 K;  4M3U A;  3LAL A;  2KQ2 A;  1G15 A;  4KI6 A;  3ENO A;  3SCX A;  1WN7 A;  1CZB A;  2UXB K;  3OYF A;  2ASO A;  3PLA A;  2HBL A;  4CZG A;  3CI5 A;  3EZ5 A;  1YXQ A;  3B6O A;  2P9L A;  5EX5 A;  4DMN A;  2KZZ A;  2IS3 A;  1ATN A;  3O3F A;  3HOS A;  4G9Z A;  3M5R A;  1LAV A;  5BRE A;  1J5E K;  5FRN A;  2VGN A;  5AQR A;  3VET A;  3SUP A;  4IFY A;  3KD5 E;  1D5A A;  3TTF A;  3CCE N;  4V19 S;  3MN9 A;  3WXI A;  4E7J A;  2KFN A;  3VES A;  3L4Q A;  3H3O B;  1Z6R A;  4LH5 A;  3WNE A;  2XY5 A;  3DYA A;  1ASV A;  3MEG A;  4K25 A;  4OVL A;  4PUO A;  5F0X A;  3O3H A;  4FVU A;  4AQY K;  1TKD A;  1X3M A;  1NGA A;  4B3M K;  1MU2 A;  5J2Q A;  4AH9 A;  2KW4 A;  3AA4 A;  3C6U A;  3O9R A;  3GDQ A;  3TI0 A;  3HST B;  3DI6 A;  4BRC A;  1T7P A;  3HTV A;  3EE9 A;  2NRW A;  3L3V A;  5FPM A;  1NNE A;  1GOC A;  3AO4 A;  1UA0 A;  2Y1J A;  5E84 A;  3E1Y A;  1XC3 A;  1NK9 A;  4BC5 A;  1S9G A;  4OKJ A;  4BDY A;  3O08 A;  4A57 A;  2HF3 A;  3AVK A;  4CF1 A;  1SAZ A;  1K73 O;  2OZM A;  2FBX A;  2UXD K;  3DXM A;  1C0T A;  3UE5 A;  4ILG B;  4DKW A;  5H1S Q;  1QHA A;  1K6Y A;  1NGI A;  3G0Z A;  5HL7 L;  3TSP A;  4LD0 A;  3RRG A;  3KZB A;  1IJJ A;  4BC3 A;  2UYT A;  3R9P A;  3SBT A;  3MX2 A;  2QWL A;  3J7Z O;  3L2R A;  4H5V A;  4Z4H A;  1HQE A;  3T69 A;  3G71 N;  1T44 A;  4HCB A;  3AVB A;  3K5O A;  3W3D A;  1J9A A;  4DG1 A;  1QSY A;  4LF9 K;  4E3S A;  4KPY A;  3QFP A;  1XC9 A;  3QNN A;  4CJ3 A;  5AQH A;  3VGL A;  1TKT A;  3C65 A;  1TYQ B;  3DLK A;  3V9U A;  3KKS A;  4FLW A;  2DY4 A;  4JEP A;  1KVC A;  2HOE A;  1HKG A;  4YDU A;  5KTQ A;  3J7A P;  4N41 A;  4JLH A;  5KGW A;  2E1Y A;  1KTQ A;  1ZBS A;  4O5F A;  4RTF D;  5JS1 A;  1HYS A;  3A5O C;  1KAZ A;  1HJO A;  1J6Z A;  1R0A A;  2BUP A;  1QSS A;  1C0U A;  4FXD A;  3NVK A;  4O44 A;  4M7X A;  4K43 A;  4OLA A;  4FO0 A;  2G8V A;  4BGA A;  4LF8 K;  3VEX A;  2ETJ A;  4FLT A;  4IOC L;  4BRN A;  2HND A;  3A5M C;  3R8E A;  4I6M B;  1VSH A;  4ELV A;  4ISE A;  4IFV A;  3F2K A;  1KAX A;  3V9X A;  1VK0 A;  2OTJ N;  4GVM A;  2YJE A;  1YAG A;  3NGZ A;  3CCS N;  2LSN A;  2ATQ A;  4ICL A;  5AZI B;  1K8K B;  1RT1 A;  1E4F T;  4IOA L;  4BVP A;  2D0A A;  1U48 A;  2CGK A;  3OTO K;  3D2F B;  4CD1 A;  1XI1 A;  1W97 L;  1HNW K;  1VSI A;  5EY4 A;  3OYI A;  1RTH A;  1V4S A;  1S5J A;  3M6G A;  1YF5 L;  3ZSW A;  4FOI A;  4YOX A;  3CQX A;  3BZC A;  3QEW A;  3CC2 N;  3ENB A;  4KI4 A;  4KH6 A;  3J80 O;  4B9N A;  2HBM A;  3FZF A;  4JKG B;  2WC9 A;  3U9Z A;  1RT4 A;  5GAE P;  4FM0 A;  1RTD A;  3I8D A;  3R3L A;  1WSG A;  1QE1 A;  3SJJ A;  1NBW A;  1EQY A;  4WQ4 C;  4FPB A;  1U45 A;  4FWK A;  3UKU A;  2QA4 N;  2BH1 A;  4O8K A;  2E20 A;  3VQC A;  1WSF A;  2P9U A;  4ID1 A;  5HLF A;  4JI8 K;  4A2A A;  2QWN A;  3ZET B;  4DQS A;  1OVQ A;  1KVA A;  2KHO A;  2W40 A;  1NJX A;  3IDH A;  4JI1 K;  4BR4 A;  4JD2 B;  5DM7 L;  2OPP A;  2P9I B;  2P51 A;  2YNH A;  1IO2 A;  1ATR A;  1Z25 A;  3DWL A;  3VA0 A;  4FWO A;  1HQU A;  1T05 A;  4H0P A;  1RTJ A;  5AQL A;  3DLR A;  3FE1 A;  3ENH A;  3V1R A;  1W7A A;  4I9Q A;  1BI4 A;  1SKS A;  4H0X B;  3ISN C;  3OYC A;  1KVB A;  3ZSV A;  3WNF A;  2B6A A;  1JLF A;  1N32 K;  1TUY A;  3SLC A;  4FJM A;  5KPT A;  4LFA K;  4C8L A;  1OH5 A;  4B3O A;  3GBT A;  4DR1 K;  4DSJ A;  1JLQ A;  3BEX A;  3OYM A;  1C1A A;  2VWB A;  2VYP A;  3V4I A;  1GLE G;  2Q0R A;  3RSE A;  3SMP A;  3VQE A;  4X65 K;  2A1R A;  3LP3 A;  4DQ8 A;  2GEM A;  1ZBH A;  3KWG A;  3OA9 A;  3SMS A;  1IKY A;  3R1X A;  4BG8 A;  3THW A;  3QEX A;  3ZCM A;  2QTD A;  2IVP A;  4KH4 A;  3SV3 A;  3OW2 M;  4BE1 A;  1BCO A;  1VAZ A;  1CZA N;  3MCP A;  3EL2 A;  3FR0 A;  3A5N C;  5M1N A;  4CEA A;  3SI6 A;  3C6H A;  4BRK A;  2YNF A;  5K14 A;  5AQJ A;  4Z4G A;  3PSI A;  3SQ4 A;  2QWQ A;  3SYZ A;  1SL2 A;  4CEF A;  2VCP A;  3PIO L;  3F9M A;  5CYM A;  1S72 N;  3OY9 A;  4M42 A;  3MAQ A;  3OYG A;  1U2V B;  4FJ5 A;  3IKM A;  3U3G A;  4AM6 A;  3E01 A;  3VEY A;  2IDO A;  1C0M A;  4OGC A;  3OYL A;  5C42 A;  2O8B B;  1HLU A;  3S3N A;  1NKE A;  5M1K A;  2H3G X;  5IWA K;  4FWP A;  3QIP A;  1HNX K;  4CBX A;  4F9O A;  2ITG A;  1X9M A;  4NCB A;  1SUQ A;  2D1K A;  3WXM B;  4W5T A;  4C1N K;  5BPL A;  3MEE A;  4DTP A;  3AVN A;  2Q0U A;  3DJC A;  3UKR B;  4OX9 K;  4EHT A;  2QW9 A;  1VRU A;  1S1W A;  4IBN A;  3BUZ B;  3MXI A;  3ZSZ A;  3NH2 A;  1U04 A;  3KTQ A;  3OJU A;  3ULE A;  1P8Z A;  1U4B A;  3ZT2 A;  3TSU A;  3VQ5 A;  4B08 A;  1C6V A;  1Q18 A;  2I7N A;  2FC0 A;  2HMP A;  3OYA A;  1HNZ K;  5AQW A;  1DTT A;  5CHI A;  3CF5 L;  3LP2 A;  1VSJ A;  2GWJ A;  3MWT A;  4GKK K;  4CBW A;  1N8R O;  3V1O A;  3HT3 A;  4A5B A;  2BE2 A;  2W6K A;  3B8A X;  1SL0 A;  4PQU A;  3CM5 A;  2P9N A;  5HOO A;  4CJR A;  1KFS A;  2A40 A;  1SKR A;  4ILJ A;  1T3V A;  2GV9 A;  1XQS C;  3PUF A;  1EWQ A;  2E5L K;  1JCF A;  5AQM A;  3S3O A;  1XWL A;  3P39 A;  1CZ9 A;  3NH0 A;  2YKN A;  4O4G A;  5KQD A;  4CZI A;  3VEZ A;  3WEE A;  3O9S A;  4DQR A;  4QS8 A;  4H0O A;  1GLJ O;  3C7N B;  1NJI O;  5CY4 A;  4DQP A;  3ATU A;  3CJA A;  2NRR A;  4KHP K;  3KK2 A;  3TAF A;  1JLA A;  3HOT A;  5D3G A;  4CHY A;  1QZ5 A;  3FLC O;  3M3Z A;  3LM2 A;  3S3M A;  1IBK K;  1IBL K;  3KJV A;  4O8U A;  1XUP O;  3PO5 A;  2D0P A;  3HYF A;  1ATS A;  1YTU A;  3VER A;  3VTH A;  4XEI A;  2VQE K;  2QKB A;  3I8B A;  3OYD A;  3OYK A;  2J4R A;  1QVG M;  3D6R A;  4FWR A;  3K57 A;  5AQK A;  1FK9 A;  1EKE A;  5JLH A;  3BF3 A;  4J2D A;  5AJ3 K;  1RT3 A;  1S6P A;  5KRT A;  1QQO A;  1VQM N;  3EEQ A;  4BG9 A;  3VQQ A;  2G8K A;  2D5R A;  2UUA K;  5BR9 A;  2D4W A;  2PYJ A;  3AA2 A;  3NHG A;  4HUE A;  1BIZ A;  2IVO A;  3O4Q A;  1RDB A;  5JS2 A;  4JKE A;  4M41 A;  1D4X A;  3G6E N;  4IJA A;  1Q7Y O;  2P9P A;  3WXK A;  4B9V A;  4AHU A;  4FJX A;  3CM6 A;  3TTD A;  2CH6 A;  3IMX A;  1NGE A;  2QXF A;  4Z4F A;  5LY3 A;  4UY8 O;  1VQN N;  3E9P A;  1VSM A;  1EWR A;  3AV9 A;  4FM1 A;  3SUN A;  3CC4 N;  4K41 A;  3SBG A;  4CEO A;  3O80 A;  2QWP A;  4JNE A;  2JLE A;  1LW2 A;  3W0L A;  2P5O A;  2Q2R A;  4DSE A;  2GUP A;  4QOZ B;  2BAN A;  4OJR A;  4BRQ A;  1VQ5 N;  1JXE A;  4CGH A;  2GUI A;  2YHB A;  4DB3 A;  3KWI A;  3SPY A;  4Z4C A;  4DFK A;  2G8W A;  2PAV A;  1ASU A;  4JS4 A;  4DV3 K;  4DU1 A;  2G8I A;  3DRS A;  1GOA A;  2FBT A;  3MWP A;  1YHQ N;  2IIR A;  5JVH L;  1L5U A;  1NGG A;  4CHZ A;  3JAM O;  1VRT A;  1YJ9 N;  3HI0 A;  3AAP A;  1HNV A;  1RT6 A;  4XH4 A;  3KLE A;  2PBD A;  3MN7 A;  1T6D A;  3SAG A;  1IKV A;  3FZK A;  4QS7 A;  5AFU H;  4H5N A;  4FJH A;  1FKP A;  3HVR A;  3MXJ A;  2E2Q A;  4B1Y B;  2ZWH A;  2YHY A;  4ID5 A;  4IDH A;  3T7Z A;  3NF7 A;  3EZW A;  4CJT A;  3CFO A;  1SL1 A;  1L3T A;  4PKH A;  2O8D B;  3JXU A;  4JI7 K;  5DM6 L;  2ITM A;  5C25 A;  3HZ6 A;  1GLL O;  4CZF A;  5AQI A;  3C0B A;  4YOW A;  1RDW X;  1OKJ A;  4DTJ A;  3QML A;  3THY A;  4CIG A;  4FPA A;  3LWM A;  3DRR A;  3WNH A;  1NGJ A;  4JKB A;  3QEI A;  1O13 A;  3O5B A;  1ZBF A;  2O8C B;  3HP9 A;  2QI2 A;  4WE1 A;  4GW6 A;  1C0G A;  3ID8 A;  3TAN A;  3AVA A;  4NYN A;  2HW3 A;  4JI5 K;  4A62 A;  2F96 A;  1EO1 A;  3WT0 A;  4B9T A;  2I7P A;  4WYB A;  5HP1 A;  1HKC A;  4B1V A;  4DV6 K;  2GTD A;  3S9H A;  4MLH A;  2FBV A;  1A5X A;  1BIU A;  2VG7 A;  2P1J A;  1QVF M;  1X9W A;  4BGB A;  2FF3 B;  3MX5 A;  1F21 A;  5AZJ B;  4FWQ A;  4BRG A;  4X64 K;  4OO1 J;  1YJW N;  4CJV A;  4IO8 A;  3ZEU A;  1HYZ A;  4K0K K;  3CJB A;  4JI0 K;  1RBU A;  2YNG A;  4JK9 A;  3WNG A;  1U47 A;  1IBM K;  4FJG A;  4FOE A;  4JK8 A;  3VMF B;  2QM1 A;  2YJF A;  2YHX A;  4Z4I A;  1GOB A;  4WQ5 A;  4EZ9 A;  1RBR A;  5HRP A;  3HM8 A;  1QSL A;  3VPZ A;  5C10 A;  1HPZ A;  2ZGZ A;  5HRR A;  5BRH A;  3P31 A;  2YKM A;  4I2Q A;  3WQU A;  4BR5 A;  4C23 A;  3AVF A;  3BZK A;  3CHW A;  1W9H A;  3ZT0 A;  3C6T A;  1RBS A;  3DOK A;  2QWM A;  5LMN K;  3SPZ A;  5E26 A;  4M3Y A;  1RIL A;  3TPQ A;  5FPE A;  4F8R A;  1EET A;  5IT9 O;  2JWL A;  3M1F A;  1ZBI A;  4RCH A;  2FSK A;  4CHP A;  4O0I A;  3L2V A;  1TKZ A;  1RBT A;  3EO3 A;  3OS0 A;  1LWF A;  4DR4 K;  3NGI A;  3VQ8 A;  4KO0 A;  2E4L A;  4H5T A;  4OLB A;  5EVZ A;  2VGM A;  2Z1I A;  4PHT X;  4FJ9 A;  2P9S A;  4ILH A;  3CMA N;  1WB9 A;  1NJZ A;  3LZI A;  1XNQ K;  1P90 A;  1NOZ A;  4WFA L;  3U4L A;  5AQX A;  4F4K A;  2ZQB A;  4GKJ K;  3A8Y A;  2IVN A;  2P9K A;  3LP1 A;  3Q7B A;  4DSI A;  1Q86 O;  3SQ1 A;  4KRF A;  1LOT B;  4B9Q A;  2HNZ A;  1QQN A;  3VEO A;  2DPN A;  2QK9 A;  2DFE A;  1IG8 A;  3BGR A;  1CLQ A;  2XRI A;  2R7Y A;  3AAQ A;  1NGB A;  3H1Q A;  5I42 A;  1RDU A;  3PY8 A;  3LM9 A;  3NMU A;  4YOR A;  4JRQ A;  4AHC A;  2Q1N A;  2E8A A;  1XMQ K;  4E1N A;  3M8R A;  2OTL N;  2D0B A;  2QKK A;  3CQ8 A;  2WUS A;  4CF8 A;  3VEN A;  2XHB A;  3AGR A;  1B92 A;  3FGU A;  1U6Z A;  2HBK A;  3AO2 A;  2OAN A;  4KTZ A;  4IOX A;  1X9S A;  1VQK N;  1RTI A;  4BRL A;  4HHT A;  4QCL A;  4HTU A;  1MDU B;  1W0H A;  4RG8 A;  2QWR A;  3EKU A;  4LFC K;  3SAH A;  2XY6 A;  2HMI A;  2OYQ A;  4CGF A;  3O4N A;  3LPU A;  3CJ9 A;  4A61 A;  3ZT1 A;  1DGK N;  4HWI A;  1S9E A;  3DAW A;  5AR0 A;  2PY5 A;  1R59 O;  4LF5 K;  4W5Q A;  4DLE A;  4C8N A;  4CGI A;  3V81 A;  4DFP A;  3QIO A;  1BGX T;  3TTC A;  2VG5 A;  4G1Q A;  1ZBU A;  3HXM A;  1YTA A;  3C6A A;  1NGH A;  3H6E A;  3CFR A;  2HHX A;  2WON A;  2F9T A;  4CZK A;  4E1J A;  3NCI A;  3ASM A;  4BR0 A;  2XY7 A;  2UXC K;  2YI1 A;  3K9K A;  4CJL A;  3ULE B;  1Q81 O;  1SV5 A;  4O5B A;  2E6M A;  4RW9 A;  1RFQ A;  4QAG A;  2OZS A;  4F3O A;  4NLB A;  1REV A;  3IRX A;  4DR5 K;  3I0S A;  4DS5 A;  4E7I A;  3HBT A;  2HHH K;  1TAU A;  4MO5 A;  4CZE A;  4AHS A;  5FPN A;  4CJK A;  4OGE A;  3KLH A;  3AO1 A;  4KHN A;  4NB4 A;  1TAQ A;  3A2F A;  3LDQ A;  3N4Q A;  3K5M A;  4BRH A;  4FJJ A;  5A2Q O;  1C1C A;  2BTF A;  4CJU A;  1VSK A;  3TAQ A;  4E7K A;  2D0C A;  2GEL A;  5AQO A;  5M1P A;  3ITH A;  4J2A A;  3CQY A;  3TAP A;  3ZSX A;  1HR0 K;  4N76 A;  1HKB A;  1S3X A;  4Z0U A;  3SQ2 A;  2IC3 A;  2RF2 A;  1X9J A;  1RDC A;  4FK0 A;  3FZL A;  3ZX3 A;  4XH1 A;  4EP5 A;  3ZT3 A;  3V6D A;  1RNH A;  2W41 A;  4JKD A;  1NU0 A;  4OPA A;  3HPH A;  4WCE L;  5HBM A;  3QET A;  1BQN A;  2E88 A;  1NJY A;  5C24 A;  1S1U A;  2IGI A;  4JI4 K;  5C12 A;  1S6Q A;  2YV0 X;  3PX0 A;  1T03 A;  1X1P A;  3GE1 A;  3P83 D;  2X74 A;  4KFB A;  3I0R A;  4CEE A;  2F8S A;  3NGY A;  3G4S N;  2O4G A;  3I55 N;  4DFM A;  5KRS A;  3VGK A;  1TYQ A;  4JI6 K;  4H8K A;  1NK0 A;  3SK3 A;  5GIP A;  1B9F A;  4LSL A;  4JHD B;  3FFK B;  2JWK A;  3DXK A;  3THX B;  3DOL A;  5DMR A;  3RTV A;  4KAZ A;  5C0Y A;  1JXB A;  3OJS A;  3T1H K;  1A5V A;  3M8Q A;  3Q7C A;  1N5Y A;  3HPO A;  4FJ7 A;  2FF6 A;  3D2E B;  5F2R A;  4AHR A;  4BC2 A;  3RWU A;  4UQG A;  4DUY K;  2ASM A;  2HHT A;  1YVN A;  3CJ7 A;  4CF9 A;  3SV4 A;  4CJS A;  4CK2 A;  4DR3 K;  1JLE A;  1L3V A;  4JYA K;  2Z1J A;  1UAX A;  3MED A;  4WQ4 A;  5FPD A;  3U9D A;  2GX9 A;  4JI3 K;  1GLC G;  3AO5 A;  2FXU A;  4I6M A;  4FJK A;  4PWD A;  4AHT A;  3K2P A;  5C2F A;  5TKY A;  4JS5 A;  4JKH A;  1I3A A;  3KK7 A;  5AZI A;  4R79 A;  1K8K A;  4CFB A;  2ZJP L;  4J2B A;  2O8F B;  2O8E B;  4BRD A;  4B9S A;  1ILY A;  3P4I A;  1TUU A;  1C1B A;  4DF4 A;  1DTQ A;  2X6S A;  3ZX2 A;  3N4P A;  3D2F A;  4C8M A;  3UB5 A;  1OVY A;  1OH6 A;  1SKW A;  4CI6 A;  2A42 A;  1NMN A;  2HF4 A;  1NGF A;  5DK5 A;  4DS4 A;  4JKG A;  1YVU A;  1JL1 A;  1TL3 A;  1N36 K;  4K42 A;  2Q97 A;  3AVG A;  3HL8 A;  4DTU A;  4FLX A;  3RMA A;  4BRA A;  3VF2 A;  2IAJ A;  4KHU A;  2DTU A;  3O9U A;  5AQZ A;  4GMJ B;  1LWC A;  4M3Z A;  4AIL C;  4CCH A;  4IKF A;  5CE3 A;  4FZX C;  4FCY A;  2RHK A;  3ZET A;  3QNO A;  3TAG A;  3SUO A;  3OYE A;  3CD6 N;  2ZE2 A;  3AVM A;  3ZSQ A;  4B3S K;  4JD2 A;  2P9I A;  3K59 A;  4C8K A;  4BDP A;  3TAE A;  3L0Q A;  1WUA A;  1Z05 A;  3KK1 A;  3IS9 A;  1L3U A;  3MDQ A;  4Q5V A;  5HRO A;  3KLI A;  3K58 A;  4BR2 A;  3OYJ A;  4QS9 A;  3E9O A;  5JMV A;  2HHQ A;  5T7B A;  1BU6 O;  3MK6 A;  3NVM A;  4J2E A;  3H08 A;  1BHL A;  4KB0 A;  3QIN A;  1RT5 A;  4M3R A;  3KD1 E;  2P9L B;  4CJW A;  4W5R A;  4B1U B;  1JLC A;  1DLO A;  2HVI A;  1HMV A;  3U8X A;  3ALY A;  3TU5 A;  4M45 A;  3LPT A;  5AFU A;  1YIJ N;  2Q3S A;  5CYQ A;  4NLC A;  4WF9 L;  1BL3 A;  4Y1C A;  2VWK A;  3DLE A;  4JI2 K;  4FLZ A;  3D7E O;  4FLY A;  4OKK A;  3EY1 A;  3O9Q A;  3O1W A;  4KKO A;  5JLF A;  3I33 A;  4Y0W A;  2ZJR L;  5BPN A;  2HHW A;  4EHU A;  1WSE A;  1IV0 A;  1WBD A;  4DUZ K;  2QWO A;  5KPR A;  4CGJ A;  1RCH A;  2W6L A;  4BRP A;  5LL6 Z;  1NLV A;  3CG7 A;  4N5S A;  1NK4 A;  5AQN A;  2YNI A;  3ATV A;  5AQS A;  5BR8 K;  3ZSO A;  2KZM A;  2OPS A;  4F2S A;  4BVO A;  1RDD A;  2AP1 A;  2YCH A;  4CJQ A;  4B8A B;  4MFB A;  5J2P A;  2QXL A;  4CE9 A;  3CET A;  4DQI A;  3T19 A;  3HRG A;  2OA8 A;  3VF6 A;  2QEX N;  4FSV A;  4RWT A;  3RVC A;  2O8B A;  2Q31 A;  1Y97 A;  2EWS A;  4CHQ A;  3NF8 A;  4IWV A;  2NNW A;  4KBO A;  1S22 A;  1GLD G;  3THV A;  1E3M A;  3NFA A;  4IG3 A;  5CZ2 A;  1GLF O;  3AVL A;  4Z4E A;  1TK8 A;  4BWJ A;  2Z1G A;  4OKE A;  4CVN E;  3F5T A;  3FFI A;  4PL7 A;  5FRM A;  3DXM B;  5GIO A;  4FWN A;  2NUB A;  3FZH A;  4DTO A;  3FZM A;  3DLL L;  1VSE A;  1NK8 A;  3UKR A;  4K8X A;  2BGG A;  1BDG A;  1JCE A;  4BWM A;  3KLF A;  3O6W A;  4CF0 A;  2I5J A;  5KGX A;  4O0J A;  1RT7 A;  1GLA G;  4DLG A;  4HVJ A;  3K5N A;  2Y1I A;  3PSF A;  3HK2 A;  3AGK A;  1TK0 A;  4H03 B;  3QEP A;  3UIQ A;  3VOV A;  1Q9X A;  3S41 A;  1NK6 A;  1RT2 A;  4FWL A;  4YY3 K;  1J53 A;  4LF7 K;  1TKX A;  2PFU A;  5J2N A;  3P38 A;  4LH4 A;  3DM2 A;  5AQV A;  4F2R A;  3KIO A;  1V4T A;  4BE0 A;  2P9S B;  4H0Y B;  3DLH A;  4PKG A;  1NM1 A;  2NRT A;  3LDO A;  1LAW A;  3K5L A;  5EOY A;  3J8A A;  5GAD P;  1NKC A;  3VQA A;  4YOY A;  4F3T A;  1BCM A;  4DF8 A;  3TAR A;  2FBY A;  2YX6 A;  3SUQ A;  4FWS A;  5M1F A;  1UWB A;  3OS1 A;  3LDL A;  3L4I A;  1UOC A;  3NDK A;  4R5P A;  4H4O A;  3K0S A;  3MCA B;  4DFJ A;  3CYM A;  4KHS A;  2ZM6 K;  4M3W A;  3DLB A;  3RR8 A;  3C7N A;  3AY9 A;  4DTR A;  4JV5 K;  1N33 K;  4DTS A;  2A1S A;  3SJH A;  2HHS A;  2EX3 A;  1JLB A;  3QEV A;  3SNN A;  1VQL N;  4CJP A;  3RRH A;  2UUC K;  4H0V B;  2AJQ A;  2KLA A;  1KRP A;  3ZLJ A;  1KSP A;  2X78 A;  4RW7 A;  4CZM A;  3H45 C;  2W42 A;  1K9M O;  3AA3 A;  1NK7 A;  1NGD A;  4WFN L;  4B1W B;  3VGM A;  2E2O A;  1KQS M;  1I94 K;  3H3N O;  2E1Z A;  4PL8 A;  1D9F A;  3NBP A;  1O1W A;  4FVM A;  4YOV A;  3ULD A;  4IEI A;  4M63 C;  4IG0 A;  4CER A;  2V51 B;  1NK5 A;  1S1V A;  4YDU C;  2P5G A;  1BOT O;  2UU9 K;  3TSQ A;  3VEV A;  1VQ9 N;  2UUB K;  5F1X A;  4DV5 K;  2HNY A;  3CCQ N;  1WAJ A;  4JKC A;  3KVG A;  5SWM A;  3O1B A;  3T3F A;  3E66 A;  3WXJ A;  4YFU A;  5JIC A;  1ZBL A;  1VQ6 N;  4B3R K;  1BG3 A;  3CME N;  5GAG P;  3JSM A;  4DU3 A;  3VQ9 A;  3UKU B;  3MXM A;  1M90 O;  3CCU N;  4PKI A;  5AQQ A;  3JS6 A;  4DWI A;  4H4M A;  4RW6 A;  2P9U B;  4KTQ A;  4CJ4 A;  5ADX H;  5MLC Q;  1WAF A;  5KI6 A;  3ZX0 A;  4I2P A;  1MA9 B;  4BDZ A;  2BDP A;  2B5J A;  3L8B A;  1FJG K;  3MMV A;  1I39 A;  3AVI A;  3VQB A;  4LF6 K;  4M7Y A;  4LFB K;  1VQ4 N;  1ASW A;  1J5O A;  4KRE A;  1OH8 A;  1LCU A;  3E9L A;  3QBX A;  2VG6 A;  4CGG A;  1XHZ A;  3KK3 A;  3QB0 A;  4ZHR A;  4B1Z A;  1BI4 B;  4B8C A;  1CXQ A;  4JK7 A;  4U67 L;  4PY5 A;  5FRO A;  5FDL A;  3IAY A;  3MN6 A;  3M8S A;  4BE2 A;  3AO3 A;  4CW7 B;  3CCR N;  1KAY A;  5I9E B;  4A59 A;  2RN2 A;  1KLN A;  3EKS A;  1BA0 A;  5ELZ A;  3RSE B;  1DT9 A;  4CZH A;  4RW4 A;  4CFC A;  1N34 K;  4M3X A;  1Q82 O;  1UA1 A;  3THW B;  4CIF A;  3CC7 N;  5BPM A;  3T1Y K;  2O8D A;  5KQ8 A;  3A0I X;  3QDK A;  1ZXO A;  2F7T A;  1HPM A;  3IFR A;  5KPZ A;  3ZYY X;  3OYB A;  4C1N I;  3A5L C;  4AM7 A;  1D9D A;  4ISG A;  3VTI A;  1HNI A;  4CEC A;  3DXK B;  3KKR A;  4N47 A;  1NKB A;  4ISF A;  3ZSY A;  4DR6 K;  4L8R B;  2O8C A;  4E0D A;  1RBV A;  4ZTJ A;  3V9W A;  5BRF A;  1GLB G;  1NJW A;  4AHV A;  3QES A;  4FLV A;  4KV8 A;  4CIE A;  2AA4 A;  1KD1 O;  1IG9 A;  5GIN A;  2ZF5 O;  4BRI A;  4CJF A;  3V9Z A;  1OH7 A;  3AVJ A;  1X3N A;  3LWL A;  4YOT A;  4CES A;  5CZ1 A;  4DU4 A;  3LP0 A;  4MO4 A;  3U6F A;  2G8H A;  1YUW A;  4HTL A;  5AZJ A;  1WSH A;  2JGU A;  5GAH P;  1Z26 A;  3PX4 A;  1RGI A;  4ELU A;  1YI2 N;  2HBJ A;  4OPJ A;  1JKH A;  1NWK A;  3KLG A;  4IO9 L;  3QBW A;  2F4V K;  1WSJ A;  4DTM A;  3PO4 A;  2ZD1 A;  1T6C A;  1G99 A;  5J2M A;  4FW2 A;  4I9L A;  4MDA A;  3TAM A;  3AAR A;  4FK2 A;  1QHT A;  3O4W A;  3QFU A;  4BQL A;  3VQ4 A;  4OPH A;  4KHQ A;  1VQ8 N;  3SQ0 A;  3LAM A;  5AQT A;  4HCC A;  1BQM A;  4BRM A;  3I56 N;  4XH5 A;  1FXX A;  2KFZ A;  1KC8 O;  2ASP A;  2GBZ A;  3OVN A;  3HP6 A;  2P9N B;  1QTM A;  4BAC A;  5B8H A;  1N6Q A;  4A5A A;  4IXC A;  3CJ1 A;  2NRX A;  3SZ2 A;  1S1T A;  3LL3 A;  4X62 K;  3NE6 A;  1CXU A;  1NMD A;  1VQP N;  4EAH D;  1FKO A;  4IEE A;  1LW0 A;  4IZ9 A;  3WEE B;  4LY7 A;  4DHY A;  4GV3 A;  3WQT A;  3DLG A;  5M1O A;  3L2U A;  2WTU A;  4NCA A;  4YHH K;  4BY9 C;  3IG1 A;  3QER A;  4EZ6 A;  4DR7 K;  1FW6 A;  2NRV A;  5CR4 A;  4NXN K;  5C15 A;  4B9U A;  4JKF A;  4K8Z A;  3U3Y A;  1JL2 A;  1EP4 A;  3DRP A;  4CK1 A;  4E89 A;  3HSC A;  4CJ7 A;  3H46 O;  2OPQ A;  1XMO K;  3MN5 A;  3CCJ N;  4CGD A;  1HUX A;  3WXL A;  3OHR A;  4I7F A;  4DV2 K;  4CFA A;  3MEC A;  2PZS A;  2RKI A;  1LWE A;  1U49 A;  1BUP A;  1IH7 A;  3LDS A;  1J54 A;  4FWM A;  4M3T A;  3HO1 A;  4FZZ A;  2DFH A;  1E4G T;  3CCL N;  3GOI A;  4IDK A;  1Y64 A;  4CZJ A;  4N56 A;  3V1Q A;  3CFP A;  4E19 A;  4FJN A;  2NZT A;  1VSL A;  2EHG A;  3OYH A;  4LC9 B;  4NO7 A;  2DFF A;  1K8A O;  5AQU A;  4DCH A;  2WFB A;  1Q9Y A;  4HUG A;  3TAB A;  4U7B A;  4FJI A;  1ZC6 A;  4JKA A; 
#chains in the Genus database with same CATH homology
 3BY5 A;  2W6L A;  3EEQ A;  2W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...