2W6LA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
137
structure length
137
Chain Sequence
b'MPLPIPSLLIAGIGSRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBE
molecule tags Biosynthetic protein
source organism Pseudomonas aeruginosa
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
total genus 41
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6lA00
2W6KA 3EEQA 2W6LA 3BY5A
chains in the Genus database with same CATH superfamily
2IOCA 3JXUA 3PSIA 1E4GT 5DM6L 1MU2A 1VQKN 4DKWA 2PZSA 4LF8K 2P9SB 4CHPA 3CC4N 1RDDA 1KVBA 3AVCA 4RW8A 4JD2A 3VQ6A 2P9PA 2YNHA 3KK1A 1HQUA 4CGJA 1W97L 3QIOA 3KJVA 3DOKA 3D0PA 5KTQA 4GV9A 3KTQA 2YNIA 1C1CA 1EX4A 3CYMA 1GLCG 3H6EA 3CCJN 3RMDA 4J8FA 4IOXA 3CIPA 1BA0A 4K43A 4JNEA 4AHSA 3GOIA 5BPLA 2V52B 3PX4A 1UA1A 4FW1A 5AQGA 3KK3A 2UXCK 1Z25A 4H0PA 3TANA 4DSJA 1JCFA 1RBRA 2W41A 3K5OA 4H4MA 4CF8A 4J2AA 3CQXA 4YDUC 2IDOA 2WUSA 3EEQA 4DUZK 4FJKA 3ZX2A 5AQZA 2FSJA 1VSKA 4WQ4C 1P90A 4IXCA 4LFCK 1A5WA 2QI2A 2ATQA 2G8WA 4KH6A 1OVYA 4AM6A 2PBDA 2NRVA 4DB3A 5LL6Z 3QEIA 2G8KA 1QS4A 5BR8K 3DXMB 3O8MA 1KLMA 3THYA 1KQSM 4R5PA 4F8RA 1NK4A 5BN9A 4LC9B 2E1YA 5IWAK 2KZZA 2VWJA 5F0XA 1NLVA 1HPMA 3TARA 3OYLA 3V9WA 4DFJA 4KTWA 1YVNA 1ZBUA 4DLEA 5CZ1A 1LV5A 2RF2A 4DQQA 4C1NK 4B8AB 4B3RK 3BEXA 1IKVA 4G9ZA 2A1RA 2OZMA 3R8EA 4BQLA 4GMJB 3VEXA 1W2BM 3O1WA 5BRDA 3JSMA 2OANA 3ZSYA 4Q5VA 3CXCM 4H0OA 4CZGA 2GWJA 1IKWA 3M8SA 3CPEA 1ATNA 3MX2A 4WF9L 4KB0A 2E2QA 3TSPA 3CCRN 4ELVA 4N41A 3E9OA 5M1KA 4BACA 1XMQK 4ID1A 5HRSA 4JN4A 3QERA 3NGIA 4GKJK 4BRPA 4E7HA 3OYFA 3OYKA 1OH5A 2QKKA 2P9LA 3LP3A 4HTUA 1XQSC 3I8BA 3HI0A 4CZEA 2GUIA 5CYMA 1NOYA 3CMEN 4FXDA 2OTLN 3L2QA 4M42A 2O4GA 4O5BA 5GAEP 3OTOK 1QSLA 1C0MA 3K0SA 4Z4IA 3TI0A 5AQLA 1LWFA 3LL3A 2NUBA 1YVUA 4FWKA 1SKWA 3OYCA 1RBSA 4FLTA 5KPZA 4DQIA 1BUPA 4CD3A 2P5GA 3HPGA 3HP9A 5B8HA 4C8LA 4CW7B 3HT3A 4DF4A 3LDNA 3R9PA 5HRNA 4N56A 5J2QA 4JKHA 3LP2A 3H1QA 4AHVA 4GKKK 3FZKA 4IJAA 2ETJA 4FZXC 4KHSA 2CGJA 1XNQK 4OKEA 1TK8A 1N5YA 1L5UA 1ZBLA 4NXNK 4Y0WA 4B8CA 3TPQA 1A5XA 1BG3A 3VQEA 2P9IA 5AQTA 4CJ4A 2ZJQL 4DSKA 2RE2A 1ZC6A 3PIOL 3D45A 1YXQA 1C0UA 5FROA 2CH6A 1FXXA 5AZIA 4CF0A 4E1MA 3CCQN 3OS0A 1C0TA 1SQKA 1HPZA 2KZMA 1QHAA 2XY6A 1JLEA 1B9FA 2H3GX 4CFCA 3AAQA 2R7YA 4ZTFA 3PIPL 4FZZA 5F2RA 3PO5A 1Y97A 3FZLA 3ULEB 3W3DA 4ELUA 2PYLA 4FLUA 2O8EA 1I3AA 1WSFA 2I7PA 2HNZA 3O4WA 3I0SA 3C7NB 3WNHA 1NK9A 3EZWA 3SJJA 2GTDA 3AAPA 4NCGA 3THWA 1M90O 1OH6A 2UU9K 1VQ4N 2RHKA 3RRGA 4BR0A 4J2EA 1VQMN 2IS3A 3VF2A 1BIZA 2AJQA 5BRFA 3THVA 1TKZA 2XY8A 3ZEUA 1O13A 4IDHA 2E88A 2YKMA 3MAQA 4Z4FA 5M1NA 2A1SA 3QINA 3TTFA 1HLUA 1VQON 3OBWA 2A41A 3TAMA 4DTSA 1R59O 2O8DB 1TAUA 4RW4A 2IIRA 4EIAA 4BRDA 4E0DA 2ZM6K 3T3FA 2VG6A 1R0AA 2HHXA 1NWKA 3AVIA 4FWQA 1JLGA 3LWMA 2XY7A 5GADP 5EU7A 1N6QA 4K0KK 4AHCA 1XC9A 2DPNA 2BDPA 1GLEG 4LD0A 2BUPA 3UIQA 1TL3A 1OKJA 3UKRA 4FK0A 4DV1K 2J4RA 5JS1A 3LDPA 4AHTA 3LDLA 1YITN 2IVOA 3OJUA 3DM2A 2QWLA 3CHWA 4FCYA 1K8KA 3J7AP 3MDQA 3O4QA 3R6MA 1SL0A 5KPTA 4IDKA 5AFUH 4H0YB 4DV6K 4DU3A 4N5SA 4B1VA 4IFVA 1QSYA 2KFZA 3OYGA 1T6DA 2G8VA 1N32K 4JI7K 1DT9A 1MWKA 3SAFA 1Q9YA 3C0BA 3EZ5A 4J2DA 4EFHA 4BRKA 4FLZA 3AY9A 4NYFA 4CZJA 2ZF5O 2BGGA 3CJ7A 1Z6RA 4QS8A 2FSKA 5SWMA 3V9XA 1RT7A 1D9DA 2QWPA 5AZJB 4A2BA 1ZBHA 1HUXA 4CBUA 1JLCA 1FJGK 1UOCA 3A2FA 3MMVA 2E1ZA 1YJNN 1QHTA 1RBTA 1WN7A 4W5QA 3OYBA 1D8YA 1TUUA 3DLHA 3WXJA 1TV6A 3BY5A 4O55A 3VQ7A 1TYQA 3AO2A 4JD2B 1NBWA 3J7YP 2HVHA 5KGWA 2JLEA 3CJ1A 2Q0UA 1YI2N 4FJGA 5EX5A 3MWTA 4JAXA 4FK4A 1U49A 3C6AA 2KFNA 4AF1A 4DQSA 4BG9A 4BC5A 2Q3SA 3DLGA 1OVQA 4KHWA 3NF9A 3SAGA 1IG8A 4LFAK 4DSEA 3OYHA 4DTXA 3NGYA 3HPHA 4FLWA 2YKNA 2G8HA 4LY7A 2PYJA 2ZGYA 5JICA 4KKOA 3EKUA 5AQNA 4KRFA 1IV0A 2FBYA 4IFEA 1SZ2A 1IO2A 1S1VA 3OS1A 1WSIA 1HJRA 5BN8A 4BRHA 3RMBA 5AQMA 1U2VA 4CZIA 3MXMA 1JLFA 3AVHA 2NRZA 2WC9A 4FWLA 4H0TB 4JI4K 3U8XA 3HL8A 1RFQA 2WBNA 4PA1A 1BO5O 2XRIA 3CCEN 4RCHA 2ZWHA 1VQPN 3Q7BA 3PY8A 2YCHA 3SJHA 3ZEUB 1J6ZA 4BGBA 3D2FA 1WB9A 4M7XA 5AQWA 3QIPA 5E26A 4EP4A 2ZJPL 3ZSQA 4BDYA 3P83D 3IFRA 3J81O 4WQ4A 2YNGA 3AGKA 3BP8A 3OVNA 2F8TA 3ENBA 3DXKB 2X6NA 4M3XA 3GL1A 1FK9A 1V4SA 2YV0X 2B4JA 2ZGZA 3QFPA 3PO4A 1VQNN 3IAYA 3QNNA 3V1RA 3MXIA 2NRHA 3PSFA 3B8AX 5CYQA 2YJFA 4DG1A 5SZTA 4IG3A 3DLKA 3FR0A 4FPBA 3VOVA 4CF1A 2KW4A 1T3VA 1EO1A 2OPSA 1X9JA 3SAHA 3LWLA 3RR7A 2YJEA 2XHBA 1RT1A 3VEVA 3OYAA 4ZTJA 4IWVA 4FJIA 3K58A 3NBPA 3CM5A 3AA5X 5H1SQ 3WEEB 3RMCA 1TK5A 1S6QA 3BGRA 4K8XA 3DXKA 4JS4A 3AVKA 3ULDA 4CEEA 4KPYA 4B1WB 4F4KA 1T6CA 4M63C 3E9LA 4CGGA 1ESVA 1YIJN 3RSEB 1IH7A 3EY1A 2WTUA 4FVMA 1C1BA 1VSIA 3WXMB 2HSTA 1NGCA 3OY9A 4L8RB 1S9EA 4A5BA 2E2NA 3U6FA 3SUPA 1ZBIA 3CC2N 3ZT1A 1BA1A 5HROA 1TUYA 5I3UA 2CGLA 4K8ZA 3TAQA 2OPRA 3DRRA 3IRXA 4FZYA 3FFIA 1NK7A 1XMOK 3DLBA 4FM2A 4KHNA 1T8EA 1NK6A 5AJ3K 4CEDA 1UAXA 4RG8A 1SL1A 1HKCA 3OW2M 4CJEA 1UWBA 2XY5A 1DTTA 3WXKA 2W6LA 2RN2A 3F9MA 1KC8O 3JYTA 4FYDA 2YHAA 3NFAA 3OYIA 4PUOA 3CERA 3C94A 1QQMA 4BQZA 4HVJA 4MQ3A 3D2EB 4CI6A 5HP1A 1WSJA 1SUQA 5AQVA 1T05A 2FBVA 3HSCA 1QVGM 4BC2A 3L4QA 3QEPA 1UA0A 1ZBSA 3G0ZA 2VQEK 3M8QA 4W5RA 1RDAA 4CJFA 3NH1A 4OPHA 3PX0A 4PKGA 3P5JA 4H0VB 2KHOA 2E5LK 3KVGA 1S22A 2D1KA 3LPTA 2LSNA 5T7BA 5KPRA 3VF6A 5EY4A 4CHYA 4H8KA 4FK2A 1JCGA 2AA4A 2W42A 3C95A 5FPEA 4BE2A 4JRQA 1CZBA 5JLFA 4JI8K 1J53A 2PY5A 4PQUA 3KK7A 3LM9A 3CFPA 1YUWA 1NG9A 2X6SA 5HLFA 3QFUA 2Q97A 2DFHA 1SAZA 1VSLA 4H4OA 4CVNE 2OZSA 1VSJA 4BRMA 4CERA 4BRQA 3THXB 4CZFA 4FJMA 3ISNC 1VQ7N 2HNYA 1WSEA 3DXMA 1JL2A 4CGDA 2G8FA 3CETA 1K8KB 5ADXH 4KH5A 4RWTA 4CJTA 4B1UB 2CGKA 3WQUA 4JKBA 4O4GA 4Q0BA 1Q9XA 1L3TA 4JLHA 3SMSA 1XNRK 1NKEA 4YDUA 1CXUA 3CG7A 5JMVA 5C10A 3NHGA 1HYVA 1I39A 3LDQA 1VRUA 4B9SA 3VTIA 3S3NA 1NM1A 1VSHA 1LWEA 3FGUA 3J7ZO 3U9DA 3E01A 5KRSA 3ID6A 4O44A 4KI4A 1KRPA 1VQ6N 3RTVA 4M45A 1LAVA 4IJNA 4OGEA 3T1HK 3SI6A 2YX6A 4M3RA 5M1FA 5GIPA 1HYZA 3K9JA 1VAZA 3IKMA 4AH9A 2QKBA 1JLBA 4I9LA 4MO4A 2PFUA 3F5TA 2QXFA 3R3LA 1N34K 3PLAA 1KAYA 2G8IA 3MX5A 4EZ9A 4W5TA 3OYEA 4JKDA 3QMLA 1L3UA 2G8UA 4FOEA 1S1WA 4CJPA 4CBXA 3VA0A 1HNVA 4K42A 3K59A 2F4VK 3VGLA 1LW0A 1ZBFA 3G10A 5JLHA 1QZ5A 3V4IA 5J2NA 1HJOA 3CF5L 5GINA 3GDQA 5MLCQ 4CHQA 1NKBA 5FRNA 1U48A 2P9UB 1ZXOA 4CZKA 5AQRA 3QEWA 1NJXA 3EYZA 5M1PA 5JVHL 1JJ2M 2F9TA 4DV4K 4J2BA 1JCEA 2Z1HA 4DHYA 1DKGD 3P39A 3U4LA 4XH1A 2FC0A 5A2QO 3ZX3A 3SV3A 2F9WA 1EXQA 4WFNL 2ASMA 4DR7K 4FW2A 2VG7A 1WAFA 1BU6O 3L2RA 3SNNA 4CEOA 4M3UA 1ITGA 1NOZA 2QEXN 2FLOA 3QDKA 2WONA 5J2PA 3LP0A 1WAJA 1Z26A 3KKSA 2HOEA 3VEOA 5EXWA 4CK3A 3NCIA 3CQYA 4F3TA 3LAKA 2VGMA 4ISEA 3L3UA 3IDHA 2ZD1A 1NK0A 2B5JA 3CCMN 1HKGA 5E84A 2HHQA 1XHXA 3QETA 3H3NO 4JKEA 5CY4A 4MO5A 1KCFA 5CZ2A 1KVAA 4BRLA 2Q0RA 1QTMA 4QS7A 4PL8A 4DV2K 1GLAG 2FF6A 4E7JA 4CEAA 3DAWA 2IGIA 4RW6A 1X1PA 4R79A 5BPNA 2E4LA 2XO7A 3KK2A 2QWQA 4A2AA 1VHXA 1U4BA 4CFBA 3WXLA 1GLBG 3E9PA 3KLFA 1ATSA 1CZAN 3EE9A 2A42A 2FBXA 1DTQA 1G99A 3H46O 3K2PA 3HTVA 4DS4A 1REVA 3LZJA 3SYZA 4MFBA 1B92A 3D2FB 3IS9A 4CHNA 5LMNK 1GLFO 2A5XA 4CJSA 4XH4A 4CK2A 4X64K 3A8YA 3WXIA 2VQFK 4NLCA 3SUQA 4GV3A 3RRHA 3NH0A 3S41A 4Z4CA 1S1UA 1GLDG 3C6TA 4ICLA 3VQ9A 3WEEA 2P9PB 3K57A 3U9ZA 2RKIA 3KHYA 4OPJA 4DU1A 2AP1A 4DTMA 3RVCA 3A0IX 3SBTA 3U3YA 4WYBA 1SS6A 2P9NA 4NCAA 1K6YA 2X74A 3QICA 5M1OA 4OO1J 4KHQA 4KV8A 4BWJA 5J1EA 4QCLA 4OKKA 1WOQA 5HBMA 4DR4K 1WSGA 1P8ZA 2ZQBA 3AVFA 3D7EO 5HOOA 3OHRA 4ISGA 3OYNA 4B3TK 5KRTA 1X9SA 2HVIA 1BDGA 3AARA 2GWKA 3Q7CA 3KKRA 3HSTB 3ALYA 2CH5A 1W7AA 1DGKN 2V7ZA 1LWCA 1SKSA 1RTJA 1WUAA 3CPWM 3CFOA 1GOBA 1FKPA 4FJ8A 3AA3A 3E1YA 1RT6A 5D3GA 3AV9A 4H5WA 2ITGA 5C2DA 1GLLO 1FKOA 2I5JA 4B3OA 5HRPA 4KTZA 1S72N 1BOTO 4XIUA 4FLYA 3MWPA 4JHDA 3VENA 4DTOA 1XI1A 3VMFB 1NGIA 4KAZA 3VETA 5EOYA 1RT2A 3CJAA 1S5JA 1BQMA 4DV3K 4DQ8A 2YI1A 3BZCA 2P9KA 3H45C 4BDZA 2P1JA 3MEGA 3O80A 2OCEA 4OJRA 3CMAN 3G71N 3AVJA 4O8UA 1YJWN 1ASVA 2EX3A 1HQEA 3EKSA 4NLBA 4FJXA 1XWLA 3NE6A 4M7YA 4BGAA 3J8AA 2P9SA 1KFSA 4Z94A 4WCEL 1JKHA 4OKJA 4CJLA 4CEZA 3CI5A 3S9HA 2P9NB 3DLRA 4M3WA 1OH8A 4DLGA 5C24A 4YOYA 1NJYA 3SQ4A 3TABA 4B3MK 4BDPA 2UXDK 3AO3A 4IO8A 4CJVA 1B9DA 2ZJRL 3V81A 3L8BA 3LPUA 1Q81O 2FSNA 4IEIA 3V9ZA 1RDWX 4B1ZA 3P4IA 3QBWA 2FF3B 4DSFA 3ZX0A 3T7ZA 5BREA 1EETA 2E6MA 2IVPA 4FLXA 3WUHA 3KIOA 3SBGA 4FJ7A 2P9KB 4E7LA 4GNIA 4WE1A 3LAMA 3RWUA 1J9AA 3QB0A 4CCHA 4H0XB 4LF9K 3WNFA 3EL2A 5IT9O 3FLCO 3FZFA 4QOZB 4KO0A 1BIUA 4YNQA 3L2VA 3VF4A 4EZ6A 1NJIO 3EO3A 3RSEA 2QWOA 4BR9A 4PL7A 4O5FA 4BR4A 4RTFD 1NGJA 2VGNA 5TKWA 5C0YA 2NRWA 3AVBA 2F96A 4FWNA 2E6LA 2B6AA 2KKZA 3MEEA 3M8PA 4DR5K 3L3VA 2RPIA 4IEEA 1RTDA 4FJ9A 5F1XA 4CEBA 3MCAB 4BRAA 2FBTA 1VQ5N 4JI5K 3C7NA 3LALA 2OPPA 3ATUA 4M3YA 3QNOA 3BDPA 1HKBA 4ELTA 2QXLA 4FWMA 5AZIB 4HUFA 5FDLA 1E4FT 4EHTA 4FJHA 1QQCA 4ILGB 1NMNA 4C8OA 3CFRA 4FLVA 4JEPA 3BF1A 3J80O 1BL3A 4C1NI 4KI6A 4B9LA 4AHUA 4JYAK 2QWNA 2HMIA 3SMPA 4BR5A 1NMDA 3MEDA 4HWIA 5J2MA 4K41A 3ZYYX 1NU0A 1TYQB 2HBLA 3ZETB 2EWSA 3IG1A 4FWRA 3HVTA 2OPQA 5E41A 1NK8A 4M41A 4CJUA 4AILC 3TAFA 3M3ZA 3THWB 4JI2K 5LJWA 3A5MC 4K25A 5AQXA 3AA2A 4GW6A 3WT0A 3SLCA 4CZMA 1S1TA 4EAHD 3VQ8A 1LCUA 3VN5A 3KD1E 4DF8A 1RNHA 3NF7A 5AQOA 3SPZA 4H5RA 1JL1A 3MK6A 3K5LA 2HHTA 3H08A 4AHRA 4BREA 3MECA 1BHLA 4I6MB 4FWSA 5BRHA 5AQSA 4C8MA 3NH2A 1V4TA 2FXUA 3CD6N 4CECA 4CD1A 3WQTA 1KAXA 5LJVA 3ZLJA 2Z1JA 4JRPA 2ZE2A 1TKDA 1EQYA 3KLEA 1JLAA 1ATRA 3HK2A 1ASWA 2E2OA 3VGMA 4DV0K 3VQAA 4FJJA 1RBUA 4NO7A 4OPKA 3KWIA 3ZETA 4O0JA 4DTUA 4F2SA 3FE1A 4OGCA 5FRMA 4YORA 2WOMA 3VQ5A 2F7TA 2GV9A 1JXEA 2NRRA 5DM7L 4CGFA 3BUZB 3DRPA 3S3MA 1XUPO 1GOCA 2Q1NA 1Q82O 4B1XB 3OJSA 2GEMA 3CM6A 5BPMA 1VRTA 3AO5A 3O9UA 3WNGA 1GOAA 1KLNA 4B08A 3ENHA 2VCPA 3H1VX 5JVGL 1X9MA 3RR8A 1EWRA 3QLHA 4W5OA 5K14A 1EKEA 5C42A 2V51B 4U7BA 4B9MA 2D0CA 2E20A 4JK7A 2KLAA 1CZ9A 3NDKA 3VTHA 3ULEA 2Q31A 3SUOA 2UUBK 3U3GA 1U04A 3NF8A 3SPYA 3DOLA 3KD5E 4C23A 4JKGB 4PKIA 5FPDA 4YOVA 2BTFA 2HHVA 5AQJA 3MN5A 3SZ2A 5C2FA 3SV4A 1KVCA 3ID8A 2E2PA 4EHUA 4LFBK 3L2UA 4CEFA 5AQFA 4KTQA 4CIFA 2P51A 3VQCA 2YHYA 3OYMA 4KH4A 5KQDA 4Y1CA 1VQLN 3K9KA 2DFFA 3I56N 4HUEA 4KHUA 1BWFO 3DLEA 4B9NA 4DWIA 2HHUA 3AVGA 4WQ5C 5AQYA 3L6QA 2VYPA 2HBKA 1JLQA 1RTIA 3NGZA 3KLHA 1XHZA 2GUPA 3HYFA 3V1QA 1DEJA 3C6UA 4YOUA 3A5LC 2D0AA 2QA4N 1QSSA 4NXMK 3ZSXA 4LSNA 4BRIA 4HHTA 4FVUA 4PKHA 3KLGA 1C0GA 2HB5A 3G6EN 1YAGA 2O4IA 5I42A 4DQPA 3T19A 2X78A 3PX6A 4Z0UA 4OVLA 3LM2A 4DV5K 1RTHA 3SCXA 1ASUA 3LZIA 4E19A 2YHXA 1NNEA 2P9LB 4H5NA 3LDSA 1C6VA 3V9SA 3KWGA 1EWQA 3VQ4A 1YTUA 1QZ6A 2UYTA 4JKGA 1NJWA 4LF4K 2DTUA 1O1WA 1RT5A 4KHYA 4OLAA 2KQ2A 3SK3A 4FSVA 4JV5K 2O8FA 4CJWA 1HNXK 2D4WA 3NAEA 4DR3K 3D6RA 4GY2B 3QO9A 4FWPA 3CCLN 2V7YA 4JS5A 1S6PA 3I8DA 1LW2A 4BRNA 3V9UA 3HJFA 4GVMA 5GIOA 4F2RA 4CBWA 4JI6K 3ZT0A 3GG4A 4CJQA 1VQ8N 1K9MO 3KZBA 5AZJA 4W5NA 2DFEA 2GELA 4HTLA 1YTAA 3HPOA 1QE1A 3MN7A 3ZSWA 4X62K 2Y1JA 4JK9A 1C1AA 3CC7N 3T1AA 1VK0A 3DI6A 4YOXA 4FL9A 4Z4HA 3R1XA 1YHQN 4IKFA 1TL1A 4CJ3A 4O0IA 3LDOA 3UKUB 3DMJA 4BVOA 1J54A 3QBXA 1H1VA 1RDCA 3IUCA 1HYSA 3CCVN 4FO0A 3AO4A 1E3MA 4BRCA 4E3SA 1FW6A 3VQQA 1WSHA 2QK9A 3PUFA 3A5NC 1Y64A 3CQ8A 1SKRA 4CJKA 3HP6A 3MXJA 5FPMA 1JXBA 1NK5A 4BVPA 4V19S 3BZKA 1RBVA 1VSDA 2VG5A 5CHIA 1IKYA 2HF4A 1BI4A 2A40A 1ZYQA 5DMRA 2WFBA 1MDUB 3F9KA 1A5VA 4NCBA 5TKYA 5AQUA 1RDBA 3AVMA 1K73O 3T69A 3TAEA 4AM7A 1SV5A 4KFBA 2QW9A 4O8KA 2D0OA 4X65K 1RGIA 3AVLA 4MDAA 3AO1A 4CFAA 4U67L 1RT3A 4BG8A 3JS6A 4FPAA 2HW3A 4XEIA 4XH5A 3M5RA 4FJ5A 4BC4A 3H3OB 2W6KA 2IC3A 1KD1O 4UQGA 4IG0A 2VWBA 4FJLA 2NRXA 4Z4GA 1LAWA 4IZ9A 3OYJA 5ADXA 2HHSA 4CZLA 2GX9A 1IBKK 4BR7A 2D0PA 1G15A 4CF2A 1S1XA 3BF3A 4DV7K 2IVNA 4DU4A 1W0HA 4CIGA 1EP4A 2YHBA 2UUCK 4BC3A 1NGDA 1WNSA 3UE5A 3F2KA 3QEVA 3F73A 3IMXA 1MA9B 3HXMA 1TK0A 4PHTX 4IOAL 3ZSZA 4DUYK 3W0LA 3B6PA 5GAHP 2D0BA 3O4NA 2HF3A 4NYNA 3OS2A 1T7PA 1C0FA 5C15A 3P31A 4B9UA 1IG9A 4FJNA 3G25A 4F3OA 1HX1A 2GBZA 2NRTA 1VSMA 3L0QA 4BRFA 4PY5A 3N4PA 4IFYA 4GVEA 2P9IB 3AA4A 2F8SA 2IAJA 1VSFA 4TSXA 5AQHA 3ATVA 2PAVA 4WFBL 5M1QA 1BCMA 2YHWA 3VQPA 4A61A 3NVKA 4F9OA 2ASOA 3ZT2A 4FWOA 4ILHA 2HHWA 5HL7L 1X3MA 4WFAL 3P38A 4FM0A 2W40A 4IO9L 4H5TA 4BROA 4I9QA 4KREA 1T03A 4JI0K 3L4IA 4DSIA 2O8EB 3K5NA 1U6ZA 3SQ0A 4HCBA 3NMUA 4LF7K 3L2WA 3HRGA 4G1QA 4DS5A 4DTRA 1GLJO 3MN9A 3OBYA 3SQ1A 4BY9C 2A3ZA 3HOSA 3JAMO 4PWDA 5JS2A 5AFUA 3M6GA 3TTDA 2BE2A 2JWKA 1N33K 5AQIA 4LH4A 1W9HA 4KBOA 4ILJA 3ZSVA 1XC3A 3CCUN 1NGFA 4JI1K 2HHHK 1Q7YO 4IBNA 2HMPA 3NF6A 4JKCA 1WBDA 2O8DA 3LANA 3B6OA 1HNWK 4A59A 1F21A 4WQ5A 4DFMA 4CIEA 4DTJA 1YT3A 1CLQA 1OH7A 4DQRA 4CZHA 1Q18A 3LP1A 3I33A 2KTQA 3VEYA 3O9RA 4E7KA 4E7IA 3QEXA 4NB4A 1U2VB 1L3VA 4DR2K 3TSUA 1IBMK 5C25A 3O5BA 1J5OA 4DSLA 3K5MA 2VWKA 4CK1A 1VSEA 1BGXT 2HNDA 5AR0A 4KHPK 1DLOA 3O9SA 4E1NA 3GE1A 5ELZA 2NZTA 2JWLA 3D2EA 4MLHA 1IBLK 2Q2RA 1KFDA 2P9UA 4JKAA 3VEZA 4H5VA 4DMNA 4B3SK 1T44A 3SQ2A 3VA3A 4UY8O 1TKTA 3DJCA 1KSPA 1NJZA 4JI3K 1HR0K 1KXPA 4DCHA 3VGKA 4JKFA 4M3TA 3AGRA 1Q86O 1D5AA 3S3OA 3TTCA 1N8RO 1IKXA 3GBTA 3DYAA 2Q36A 5AQQA 1D4XA 1QQNA 3ZSOA 1J5EK 1WBBA 4H03B 1RCHA 3NVMA 4CF9A 1KTQA 4HCCA 5C12A 2OYQA 2I7NA 4DTPA 2ASPA 1S3XA 1YF5L 3M8RA 4DFKA 4MDBA 4GV6A 4FOIA 3TAPA 2D5RA 4CEQA 3UB5A 4QS9A 3WNEA 4AQYK 3CJBA 1L3SA 4CGHA 3DRSA 4A62A 4B9QA 1Z05A 1BISA 1S9GA 1X3NA 3PV8A 1NKCA 1I94K 2ITMA 3O1BA 3HVRA 4QAGA 3RMAA 4KB1A 3HO1A 2O8FB 4L3QA 4N47A 2JGUA 4Y1DA 3FFKB 5FLXO 3E66A 4M3ZA 2QTDA 1TKXA 4BWMA 3TR8A 1U45A 4CJRA 4FM1A 3ASMA 4A57A 1VQ9N 3THYB 1HNZK 3ZSRA 2A6AA 4X66K 4YY3K 4MLEA 1QVFM 3ITHA 4LF5K 1TAQA 4A5AA 4Z4EA 4YOWA 1QQOA 1MWMA 3O6WA 3VQDA 5KGXA 3DLLL 3VPZA 4E1JA 3O08A 5LY3A 3SUNA 2UUAK 2DY4A 3UKUA 3TSQA 1IJJA 3EE8A 3UKRB 1U47A 5AQPA 1HNIA 3MN6A 3QESA 1SL2A 2O8CB 2OTJN 1Q8IA 1K8AO 2E8AA 3VESA 3HBTA 3I55N 3A5OC 4E89A 1RDUA 4I2PA 4YFUA 1D9FA 5HRRA 2EHGA 3G4SN 3ZT3A 4I7FA 4CGIA 3DWLA 3AVNA 2OA8A 4CHOA 4HUGA 1NGGA 3AVAA 3FZHA 1NGHA 3OA9A 2QWMA 4RW9A 3O9QA 5KI6A 1BQNA 4YOTA 4N76A 1M1KO 3TAGA 1NGAA 3EN9A 4DFPA 4LF6K 1WLJA 4OX9K 4BE0A 4CFDA 4DR6K 2O8BB 5CR4A 4BE1A 2NNWA 4BRGA 3T1YK 2Y1IA 1LOTB 3HM8A 3CCSN 5CE3A 5DK5A 1ILYA 4B9TA 4I2QA 1CXQA 4EP5A 4ID5A 4IOCL 1RT4A 1NGEA 3VERA 5FPNA 4DR1K 3O3GA 3MCPA 2HBJA 3OYDA 2HBMA 2P5OA 4BR2A 2UXBK 5GAGP 3C65A 3ZT4A 5AQKA 1HRHA 3O9TA 4C8NA 4B1YB 1KAZA 4DTNA 4CESA 3VQBA 1X9WA 3TU5A 2BANA 2NLXA 5I9EB 1RILA 3THXA 2Z1IA 3HZ6A 5BR9A 4CJ5A 1YJ9N 3P1GA 5KQ8A 4LH5A 5EVZA 3CJ9A 1BI4B 3CJCA 3O3FA 3C6HA 2Z1GA 1HMVA 3ZCMA 4CE9A 1TGOA 4CJ7A 1NGBA 3FZMA 1BCOA 4JHDB 5LMUK 4OLBA 3M1FA 2O8CA 2YNFA 4ISFA 4OPAA 2BH1A 2O8BA 4LSLA 4ZHRA 1N36K 2QWRA 3HM9A 4JK8A 3HOTA 3O3HA 4CHZA 3ENOA 4C8KA 3I0RA 3KLIA 3VEWA 3TWHA 4I6MA 4YHHK 3V1OA 1TVRA 3V6DA 4B9VA 3N4QA 4RW7A 2QM1A
chains in the Genus database with same CATH topology
2W6KA 3EEQA 2W6LA 3BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6K A;  3EEQ A;  2W6L A;  3BY5 A; 
#chains in the Genus database with same CATH topology
 2IOC A;  3JXU A;  3PSI A;  1E4G T;  5DM6 L;  1MU2 A;  1VQK N;  4DKW A;  2PZS A;  4LF8 K;  2P9S B;  4CHP A;  3CC4 N;  1RDD A;  1KVB A;  3AVC A;  4RW8 A;  4JD2 A;  3VQ6 A;  2P9P A;  2YNH A;  3KK1 A;  1HQU A;  4CGJ A;  1W97 L;  3QIO A;  3KJV A;  3DOK A;  3D0P A;  5KTQ A;  4GV9 A;  3KTQ A;  2YNI A;  1C1C A;  1EX4 A;  3CYM A;  1GLC G;  3H6E A;  3CCJ N;  3RMD A;  4J8F A;  4IOX A;  3CIP A;  1BA0 A;  4K43 A;  4JNE A;  4AHS A;  3GOI A;  5BPL A;  2V52 B;  3PX4 A;  1UA1 A;  4FW1 A;  5AQG A;  3KK3 A;  2UXC K;  1Z25 A;  4H0P A;  3TAN A;  4DSJ A;  1JCF A;  1RBR A;  2W41 A;  3K5O A;  4H4M A;  4CF8 A;  4J2A A;  3CQX A;  4YDU C;  2IDO A;  2WUS A;  3EEQ A;  4DUZ K;  4FJK A;  3ZX2 A;  5AQZ A;  2FSJ A;  1VSK A;  4WQ4 C;  1P90 A;  4IXC A;  4LFC K;  1A5W A;  2QI2 A;  2ATQ A;  2G8W A;  4KH6 A;  1OVY A;  4AM6 A;  2PBD A;  2NRV A;  4DB3 A;  5LL6 Z;  3QEI A;  2G8K A;  1QS4 A;  5BR8 K;  3DXM B;  3O8M A;  1KLM A;  3THY A;  1KQS M;  4R5P A;  4F8R A;  1NK4 A;  5BN9 A;  4LC9 B;  2E1Y A;  5IWA K;  2KZZ A;  2VWJ A;  5F0X A;  1NLV A;  1HPM A;  3TAR A;  3OYL A;  3V9W A;  4DFJ A;  4KTW A;  1YVN A;  1ZBU A;  4DLE A;  5CZ1 A;  1LV5 A;  2RF2 A;  4DQQ A;  4C1N K;  4B8A B;  4B3R K;  3BEX A;  1IKV A;  4G9Z A;  2A1R A;  2OZM A;  3R8E A;  4BQL A;  4GMJ B;  3VEX A;  1W2B M;  3O1W A;  5BRD A;  3JSM A;  2OAN A;  3ZSY A;  4Q5V A;  3CXC M;  4H0O A;  4CZG A;  2GWJ A;  1IKW A;  3M8S A;  3CPE A;  1ATN A;  3MX2 A;  4WF9 L;  4KB0 A;  2E2Q A;  3TSP A;  3CCR N;  4ELV A;  4N41 A;  3E9O A;  5M1K A;  4BAC A;  1XMQ K;  4ID1 A;  5HRS A;  4JN4 A;  3QER A;  3NGI A;  4GKJ K;  4BRP A;  4E7H A;  3OYF A;  3OYK A;  1OH5 A;  2QKK A;  2P9L A;  3LP3 A;  4HTU A;  1XQS C;  3I8B A;  3HI0 A;  4CZE A;  2GUI A;  5CYM A;  1NOY A;  3CME N;  4FXD A;  2OTL N;  3L2Q A;  4M42 A;  2O4G A;  4O5B A;  5GAE P;  3OTO K;  1QSL A;  1C0M A;  3K0S A;  4Z4I A;  3TI0 A;  5AQL A;  1LWF A;  3LL3 A;  2NUB A;  1YVU A;  4FWK A;  1SKW A;  3OYC A;  1RBS A;  4FLT A;  5KPZ A;  4DQI A;  1BUP A;  4CD3 A;  2P5G A;  3HPG A;  3HP9 A;  5B8H A;  4C8L A;  4CW7 B;  3HT3 A;  4DF4 A;  3LDN A;  3R9P A;  5HRN A;  4N56 A;  5J2Q A;  4JKH A;  3LP2 A;  3H1Q A;  4AHV A;  4GKK K;  3FZK A;  4IJA A;  2ETJ A;  4FZX C;  4KHS A;  2CGJ A;  1XNQ K;  4OKE A;  1TK8 A;  1N5Y A;  1L5U A;  1ZBL A;  4NXN K;  4Y0W A;  4B8C A;  3TPQ A;  1A5X A;  1BG3 A;  3VQE A;  2P9I A;  5AQT A;  4CJ4 A;  2ZJQ L;  4DSK A;  2RE2 A;  1ZC6 A;  3PIO L;  3D45 A;  1YXQ A;  1C0U A;  5FRO A;  2CH6 A;  1FXX A;  5AZI A;  4CF0 A;  4E1M A;  3CCQ N;  3OS0 A;  1C0T A;  1SQK A;  1HPZ A;  2KZM A;  1QHA A;  2XY6 A;  1JLE A;  1B9F A;  2H3G X;  4CFC A;  3AAQ A;  2R7Y A;  4ZTF A;  3PIP L;  4FZZ A;  5F2R A;  3PO5 A;  1Y97 A;  3FZL A;  3ULE B;  3W3D A;  4ELU A;  2PYL A;  4FLU A;  2O8E A;  1I3A A;  1WSF A;  2I7P A;  2HNZ A;  3O4W A;  3I0S A;  3C7N B;  3WNH A;  1NK9 A;  3EZW A;  3SJJ A;  2GTD A;  3AAP A;  4NCG A;  3THW A;  1M90 O;  1OH6 A;  2UU9 K;  1VQ4 N;  2RHK A;  3RRG A;  4BR0 A;  4J2E A;  1VQM N;  2IS3 A;  3VF2 A;  1BIZ A;  2AJQ A;  5BRF A;  3THV A;  1TKZ A;  2XY8 A;  3ZEU A;  1O13 A;  4IDH A;  2E88 A;  2YKM A;  3MAQ A;  4Z4F A;  5M1N A;  2A1S A;  3QIN A;  3TTF A;  1HLU A;  1VQO N;  3OBW A;  2A41 A;  3TAM A;  4DTS A;  1R59 O;  2O8D B;  1TAU A;  4RW4 A;  2IIR A;  4EIA A;  4BRD A;  4E0D A;  2ZM6 K;  3T3F A;  2VG6 A;  1R0A A;  2HHX A;  1NWK A;  3AVI A;  4FWQ A;  1JLG A;  3LWM A;  2XY7 A;  5GAD P;  5EU7 A;  1N6Q A;  4K0K K;  4AHC A;  1XC9 A;  2DPN A;  2BDP A;  1GLE G;  4LD0 A;  2BUP A;  3UIQ A;  1TL3 A;  1OKJ A;  3UKR A;  4FK0 A;  4DV1 K;  2J4R A;  5JS1 A;  3LDP A;  4AHT A;  3LDL A;  1YIT N;  2IVO A;  3OJU A;  3DM2 A;  2QWL A;  3CHW A;  4FCY A;  1K8K A;  3J7A P;  3MDQ A;  3O4Q A;  3R6M A;  1SL0 A;  5KPT A;  4IDK A;  5AFU H;  4H0Y B;  4DV6 K;  4DU3 A;  4N5S A;  4B1V A;  4IFV A;  1QSY A;  2KFZ A;  3OYG A;  1T6D A;  2G8V A;  1N32 K;  4JI7 K;  1DT9 A;  1MWK A;  3SAF A;  1Q9Y A;  3C0B A;  3EZ5 A;  4J2D A;  4EFH A;  4BRK A;  4FLZ A;  3AY9 A;  4NYF A;  4CZJ A;  2ZF5 O;  2BGG A;  3CJ7 A;  1Z6R A;  4QS8 A;  2FSK A;  5SWM A;  3V9X A;  1RT7 A;  1D9D A;  2QWP A;  5AZJ B;  4A2B A;  1ZBH A;  1HUX A;  4CBU A;  1JLC A;  1FJG K;  1UOC A;  3A2F A;  3MMV A;  2E1Z A;  1YJN N;  1QHT A;  1RBT A;  1WN7 A;  4W5Q A;  3OYB A;  1D8Y A;  1TUU A;  3DLH A;  3WXJ A;  1TV6 A;  3BY5 A;  4O55 A;  3VQ7 A;  1TYQ A;  3AO2 A;  4JD2 B;  1NBW A;  3J7Y P;  2HVH A;  5KGW A;  2JLE A;  3CJ1 A;  2Q0U A;  1YI2 N;  4FJG A;  5EX5 A;  3MWT A;  4JAX A;  4FK4 A;  1U49 A;  3C6A A;  2KFN A;  4AF1 A;  4DQS A;  4BG9 A;  4BC5 A;  2Q3S A;  3DLG A;  1OVQ A;  4KHW A;  3NF9 A;  3SAG A;  1IG8 A;  4LFA K;  4DSE A;  3OYH A;  4DTX A;  3NGY A;  3HPH A;  4FLW A;  2YKN A;  2G8H A;  4LY7 A;  2PYJ A;  2ZGY A;  5JIC A;  4KKO A;  3EKU A;  5AQN A;  4KRF A;  1IV0 A;  2FBY A;  4IFE A;  1SZ2 A;  1IO2 A;  1S1V A;  3OS1 A;  1WSI A;  1HJR A;  5BN8 A;  4BRH A;  3RMB A;  5AQM A;  1U2V A;  4CZI A;  3MXM A;  1JLF A;  3AVH A;  2NRZ A;  2WC9 A;  4FWL A;  4H0T B;  4JI4 K;  3U8X A;  3HL8 A;  1RFQ A;  2WBN A;  4PA1 A;  1BO5 O;  2XRI A;  3CCE N;  4RCH A;  2ZWH A;  1VQP N;  3Q7B A;  3PY8 A;  2YCH A;  3SJH A;  3ZEU B;  1J6Z A;  4BGB A;  3D2F A;  1WB9 A;  4M7X A;  5AQW A;  3QIP A;  5E26 A;  4EP4 A;  2ZJP L;  3ZSQ A;  4BDY A;  3P83 D;  3IFR A;  3J81 O;  4WQ4 A;  2YNG A;  3AGK A;  3BP8 A;  3OVN A;  2F8T A;  3ENB A;  3DXK B;  2X6N A;  4M3X A;  3GL1 A;  1FK9 A;  1V4S A;  2YV0 X;  2B4J A;  2ZGZ A;  3QFP A;  3PO4 A;  1VQN N;  3IAY A;  3QNN A;  3V1R A;  3MXI A;  2NRH A;  3PSF A;  3B8A X;  5CYQ A;  2YJF A;  4DG1 A;  5SZT A;  4IG3 A;  3DLK A;  3FR0 A;  4FPB A;  3VOV A;  4CF1 A;  2KW4 A;  1T3V A;  1EO1 A;  2OPS A;  1X9J A;  3SAH A;  3LWL A;  3RR7 A;  2YJE A;  2XHB A;  1RT1 A;  3VEV A;  3OYA A;  4ZTJ A;  4IWV A;  4FJI A;  3K58 A;  3NBP A;  3CM5 A;  3AA5 X;  5H1S Q;  3WEE B;  3RMC A;  1TK5 A;  1S6Q A;  3BGR A;  4K8X A;  3DXK A;  4JS4 A;  3AVK A;  3ULD A;  4CEE A;  4KPY A;  4B1W B;  4F4K A;  1T6C A;  4M63 C;  3E9L A;  4CGG A;  1ESV A;  1YIJ N;  3RSE B;  1IH7 A;  3EY1 A;  2WTU A;  4FVM A;  1C1B A;  1VSI A;  3WXM B;  2HST A;  1NGC A;  3OY9 A;  4L8R B;  1S9E A;  4A5B A;  2E2N A;  3U6F A;  3SUP A;  1ZBI A;  3CC2 N;  3ZT1 A;  1BA1 A;  5HRO A;  1TUY A;  5I3U A;  2CGL A;  4K8Z A;  3TAQ A;  2OPR A;  3DRR A;  3IRX A;  4FZY A;  3FFI A;  1NK7 A;  1XMO K;  3DLB A;  4FM2 A;  4KHN A;  1T8E A;  1NK6 A;  5AJ3 K;  4CED A;  1UAX A;  4RG8 A;  1SL1 A;  1HKC A;  3OW2 M;  4CJE A;  1UWB A;  2XY5 A;  1DTT A;  3WXK A;  2W6L A;  2RN2 A;  3F9M A;  1KC8 O;  3JYT A;  4FYD A;  2YHA A;  3NFA A;  3OYI A;  4PUO A;  3CER A;  3C94 A;  1QQM A;  4BQZ A;  4HVJ A;  4MQ3 A;  3D2E B;  4CI6 A;  5HP1 A;  1WSJ A;  1SUQ A;  5AQV A;  1T05 A;  2FBV A;  3HSC A;  1QVG M;  4BC2 A;  3L4Q A;  3QEP A;  1UA0 A;  1ZBS A;  3G0Z A;  2VQE K;  3M8Q A;  4W5R A;  1RDA A;  4CJF A;  3NH1 A;  4OPH A;  3PX0 A;  4PKG A;  3P5J A;  4H0V B;  2KHO A;  2E5L K;  3KVG A;  1S22 A;  2D1K A;  3LPT A;  2LSN A;  5T7B A;  5KPR A;  3VF6 A;  5EY4 A;  4CHY A;  4H8K A;  4FK2 A;  1JCG A;  2AA4 A;  2W42 A;  3C95 A;  5FPE A;  4BE2 A;  4JRQ A;  1CZB A;  5JLF A;  4JI8 K;  1J53 A;  2PY5 A;  4PQU A;  3KK7 A;  3LM9 A;  3CFP A;  1YUW A;  1NG9 A;  2X6S A;  5HLF A;  3QFU A;  2Q97 A;  2DFH A;  1SAZ A;  1VSL A;  4H4O A;  4CVN E;  2OZS A;  1VSJ A;  4BRM A;  4CER A;  4BRQ A;  3THX B;  4CZF A;  4FJM A;  3ISN C;  1VQ7 N;  2HNY A;  1WSE A;  3DXM A;  1JL2 A;  4CGD A;  2G8F A;  3CET A;  1K8K B;  5ADX H;  4KH5 A;  4RWT A;  4CJT A;  4B1U B;  2CGK A;  3WQU A;  4JKB A;  4O4G A;  4Q0B A;  1Q9X A;  1L3T A;  4JLH A;  3SMS A;  1XNR K;  1NKE A;  4YDU A;  1CXU A;  3CG7 A;  5JMV A;  5C10 A;  3NHG A;  1HYV A;  1I39 A;  3LDQ A;  1VRU A;  4B9S A;  3VTI A;  3S3N A;  1NM1 A;  1VSH A;  1LWE A;  3FGU A;  3J7Z O;  3U9D A;  3E01 A;  5KRS A;  3ID6 A;  4O44 A;  4KI4 A;  1KRP A;  1VQ6 N;  3RTV A;  4M45 A;  1LAV A;  4IJN A;  4OGE A;  3T1H K;  3SI6 A;  2YX6 A;  4M3R A;  5M1F A;  5GIP A;  1HYZ A;  3K9J A;  1VAZ A;  3IKM A;  4AH9 A;  2QKB A;  1JLB A;  4I9L A;  4MO4 A;  2PFU A;  3F5T A;  2QXF A;  3R3L A;  1N34 K;  3PLA A;  1KAY A;  2G8I A;  3MX5 A;  4EZ9 A;  4W5T A;  3OYE A;  4JKD A;  3QML A;  1L3U A;  2G8U A;  4FOE A;  1S1W A;  4CJP A;  4CBX A;  3VA0 A;  1HNV A;  4K42 A;  3K59 A;  2F4V K;  3VGL A;  1LW0 A;  1ZBF A;  3G10 A;  5JLH A;  1QZ5 A;  3V4I A;  5J2N A;  1HJO A;  3CF5 L;  5GIN A;  3GDQ A;  5MLC Q;  4CHQ A;  1NKB A;  5FRN A;  1U48 A;  2P9U B;  1ZXO A;  4CZK A;  5AQR A;  3QEW A;  1NJX A;  3EYZ A;  5M1P A;  5JVH L;  1JJ2 M;  2F9T A;  4DV4 K;  4J2B A;  1JCE A;  2Z1H A;  4DHY A;  1DKG D;  3P39 A;  3U4L A;  4XH1 A;  2FC0 A;  5A2Q O;  3ZX3 A;  3SV3 A;  2F9W A;  1EXQ A;  4WFN L;  2ASM A;  4DR7 K;  4FW2 A;  2VG7 A;  1WAF A;  1BU6 O;  3L2R A;  3SNN A;  4CEO A;  4M3U A;  1ITG A;  1NOZ A;  2QEX N;  2FLO A;  3QDK A;  2WON A;  5J2P A;  3LP0 A;  1WAJ A;  1Z26 A;  3KKS A;  2HOE A;  3VEO A;  5EXW A;  4CK3 A;  3NCI A;  3CQY A;  4F3T A;  3LAK A;  2VGM A;  4ISE A;  3L3U A;  3IDH A;  2ZD1 A;  1NK0 A;  2B5J A;  3CCM N;  1HKG A;  5E84 A;  2HHQ A;  1XHX A;  3QET A;  3H3N O;  4JKE A;  5CY4 A;  4MO5 A;  1KCF A;  5CZ2 A;  1KVA A;  4BRL A;  2Q0R A;  1QTM A;  4QS7 A;  4PL8 A;  4DV2 K;  1GLA G;  2FF6 A;  4E7J A;  4CEA A;  3DAW A;  2IGI A;  4RW6 A;  1X1P A;  4R79 A;  5BPN A;  2E4L A;  2XO7 A;  3KK2 A;  2QWQ A;  4A2A A;  1VHX A;  1U4B A;  4CFB A;  3WXL A;  1GLB G;  3E9P A;  3KLF A;  1ATS A;  1CZA N;  3EE9 A;  2A42 A;  2FBX A;  1DTQ A;  1G99 A;  3H46 O;  3K2P A;  3HTV A;  4DS4 A;  1REV A;  3LZJ A;  3SYZ A;  4MFB A;  1B92 A;  3D2F B;  3IS9 A;  4CHN A;  5LMN K;  1GLF O;  2A5X A;  4CJS A;  4XH4 A;  4CK2 A;  4X64 K;  3A8Y A;  3WXI A;  2VQF K;  4NLC A;  3SUQ A;  4GV3 A;  3RRH A;  3NH0 A;  3S41 A;  4Z4C A;  1S1U A;  1GLD G;  3C6T A;  4ICL A;  3VQ9 A;  3WEE A;  2P9P B;  3K57 A;  3U9Z A;  2RKI A;  3KHY A;  4OPJ A;  4DU1 A;  2AP1 A;  4DTM A;  3RVC A;  3A0I X;  3SBT A;  3U3Y A;  4WYB A;  1SS6 A;  2P9N A;  4NCA A;  1K6Y A;  2X74 A;  3QIC A;  5M1O A;  4OO1 J;  4KHQ A;  4KV8 A;  4BWJ A;  5J1E A;  4QCL A;  4OKK A;  1WOQ A;  5HBM A;  4DR4 K;  1WSG A;  1P8Z A;  2ZQB A;  3AVF A;  3D7E O;  5HOO A;  3OHR A;  4ISG A;  3OYN A;  4B3T K;  5KRT A;  1X9S A;  2HVI A;  1BDG A;  3AAR A;  2GWK A;  3Q7C A;  3KKR A;  3HST B;  3ALY A;  2CH5 A;  1W7A A;  1DGK N;  2V7Z A;  1LWC A;  1SKS A;  1RTJ A;  1WUA A;  3CPW M;  3CFO A;  1GOB A;  1FKP A;  4FJ8 A;  3AA3 A;  3E1Y A;  1RT6 A;  5D3G A;  3AV9 A;  4H5W A;  2ITG A;  5C2D A;  1GLL O;  1FKO A;  2I5J A;  4B3O A;  5HRP A;  4KTZ A;  1S72 N;  1BOT O;  4XIU A;  4FLY A;  3MWP A;  4JHD A;  3VEN A;  4DTO A;  1XI1 A;  3VMF B;  1NGI A;  4KAZ A;  3VET A;  5EOY A;  1RT2 A;  3CJA A;  1S5J A;  1BQM A;  4DV3 K;  4DQ8 A;  2YI1 A;  3BZC A;  2P9K A;  3H45 C;  4BDZ A;  2P1J A;  3MEG A;  3O80 A;  2OCE A;  4OJR A;  3CMA N;  3G71 N;  3AVJ A;  4O8U A;  1YJW N;  1ASV A;  2EX3 A;  1HQE A;  3EKS A;  4NLB A;  4FJX A;  1XWL A;  3NE6 A;  4M7Y A;  4BGA A;  3J8A A;  2P9S A;  1KFS A;  4Z94 A;  4WCE L;  1JKH A;  4OKJ A;  4CJL A;  4CEZ A;  3CI5 A;  3S9H A;  2P9N B;  3DLR A;  4M3W A;  1OH8 A;  4DLG A;  5C24 A;  4YOY A;  1NJY A;  3SQ4 A;  3TAB A;  4B3M K;  4BDP A;  2UXD K;  3AO3 A;  4IO8 A;  4CJV A;  1B9D A;  2ZJR L;  3V81 A;  3L8B A;  3LPU A;  1Q81 O;  2FSN A;  4IEI A;  3V9Z A;  1RDW X;  4B1Z A;  3P4I A;  3QBW A;  2FF3 B;  4DSF A;  3ZX0 A;  3T7Z A;  5BRE A;  1EET A;  2E6M A;  2IVP A;  4FLX A;  3WUH A;  3KIO A;  3SBG A;  4FJ7 A;  2P9K B;  4E7L A;  4GNI A;  4WE1 A;  3LAM A;  3RWU A;  1J9A A;  3QB0 A;  4CCH A;  4H0X B;  4LF9 K;  3WNF A;  3EL2 A;  5IT9 O;  3FLC O;  3FZF A;  4QOZ B;  4KO0 A;  1BIU A;  4YNQ A;  3L2V A;  3VF4 A;  4EZ6 A;  1NJI O;  3EO3 A;  3RSE A;  2QWO A;  4BR9 A;  4PL7 A;  4O5F A;  4BR4 A;  4RTF D;  1NGJ A;  2VGN A;  5TKW A;  5C0Y A;  2NRW A;  3AVB A;  2F96 A;  4FWN A;  2E6L A;  2B6A A;  2KKZ A;  3MEE A;  3M8P A;  4DR5 K;  3L3V A;  2RPI A;  4IEE A;  1RTD A;  4FJ9 A;  5F1X A;  4CEB A;  3MCA B;  4BRA A;  2FBT A;  1VQ5 N;  4JI5 K;  3C7N A;  3LAL A;  2OPP A;  3ATU A;  4M3Y A;  3QNO A;  3BDP A;  1HKB A;  4ELT A;  2QXL A;  4FWM A;  5AZI B;  4HUF A;  5FDL A;  1E4F T;  4EHT A;  4FJH A;  1QQC A;  4ILG B;  1NMN A;  4C8O A;  3CFR A;  4FLV A;  4JEP A;  3BF1 A;  3J80 O;  1BL3 A;  4C1N I;  4KI6 A;  4B9L A;  4AHU A;  4JYA K;  2QWN A;  2HMI A;  3SMP A;  4BR5 A;  1NMD A;  3MED A;  4HWI A;  5J2M A;  4K41 A;  3ZYY X;  1NU0 A;  1TYQ B;  2HBL A;  3ZET B;  2EWS A;  3IG1 A;  4FWR A;  3HVT A;  2OPQ A;  5E41 A;  1NK8 A;  4M41 A;  4CJU A;  4AIL C;  3TAF A;  3M3Z A;  3THW B;  4JI2 K;  5LJW A;  3A5M C;  4K25 A;  5AQX A;  3AA2 A;  4GW6 A;  3WT0 A;  3SLC A;  4CZM A;  1S1T A;  4EAH D;  3VQ8 A;  1LCU A;  3VN5 A;  3KD1 E;  4DF8 A;  1RNH A;  3NF7 A;  5AQO A;  3SPZ A;  4H5R A;  1JL1 A;  3MK6 A;  3K5L A;  2HHT A;  3H08 A;  4AHR A;  4BRE A;  3MEC A;  1BHL A;  4I6M B;  4FWS A;  5BRH A;  5AQS A;  4C8M A;  3NH2 A;  1V4T A;  2FXU A;  3CD6 N;  4CEC A;  4CD1 A;  3WQT A;  1KAX A;  5LJV A;  3ZLJ A;  2Z1J A;  4JRP A;  2ZE2 A;  1TKD A;  1EQY A;  3KLE A;  1JLA A;  1ATR A;  3HK2 A;  1ASW A;  2E2O A;  3VGM A;  4DV0 K;  3VQA A;  4FJJ A;  1RBU A;  4NO7 A;  4OPK A;  3KWI A;  3ZET A;  4O0J A;  4DTU A;  4F2S A;  3FE1 A;  4OGC A;  5FRM A;  4YOR A;  2WOM A;  3VQ5 A;  2F7T A;  2GV9 A;  1JXE A;  2NRR A;  5DM7 L;  4CGF A;  3BUZ B;  3DRP A;  3S3M A;  1XUP O;  1GOC A;  2Q1N A;  1Q82 O;  4B1X B;  3OJS A;  2GEM A;  3CM6 A;  5BPM A;  1VRT A;  3AO5 A;  3O9U A;  3WNG A;  1GOA A;  1KLN A;  4B08 A;  3ENH A;  2VCP A;  3H1V X;  5JVG L;  1X9M A;  3RR8 A;  1EWR A;  3QLH A;  4W5O A;  5K14 A;  1EKE A;  5C42 A;  2V51 B;  4U7B A;  4B9M A;  2D0C A;  2E20 A;  4JK7 A;  2KLA A;  1CZ9 A;  3NDK A;  3VTH A;  3ULE A;  2Q31 A;  3SUO A;  2UUB K;  3U3G A;  1U04 A;  3NF8 A;  3SPY A;  3DOL A;  3KD5 E;  4C23 A;  4JKG B;  4PKI A;  5FPD A;  4YOV A;  2BTF A;  2HHV A;  5AQJ A;  3MN5 A;  3SZ2 A;  5C2F A;  3SV4 A;  1KVC A;  3ID8 A;  2E2P A;  4EHU A;  4LFB K;  3L2U A;  4CEF A;  5AQF A;  4KTQ A;  4CIF A;  2P51 A;  3VQC A;  2YHY A;  3OYM A;  4KH4 A;  5KQD A;  4Y1C A;  1VQL N;  3K9K A;  2DFF A;  3I56 N;  4HUE A;  4KHU A;  1BWF O;  3DLE A;  4B9N A;  4DWI A;  2HHU A;  3AVG A;  4WQ5 C;  5AQY A;  3L6Q A;  2VYP A;  2HBK A;  1JLQ A;  1RTI A;  3NGZ A;  3KLH A;  1XHZ A;  2GUP A;  3HYF A;  3V1Q A;  1DEJ A;  3C6U A;  4YOU A;  3A5L C;  2D0A A;  2QA4 N;  1QSS A;  4NXM K;  3ZSX A;  4LSN A;  4BRI A;  4HHT A;  4FVU A;  4PKH A;  3KLG A;  1C0G A;  2HB5 A;  3G6E N;  1YAG A;  2O4I A;  5I42 A;  4DQP A;  3T19 A;  2X78 A;  3PX6 A;  4Z0U A;  4OVL A;  3LM2 A;  4DV5 K;  1RTH A;  3SCX A;  1ASU A;  3LZI A;  4E19 A;  2YHX A;  1NNE A;  2P9L B;  4H5N A;  3LDS A;  1C6V A;  3V9S A;  3KWG A;  1EWQ A;  3VQ4 A;  1YTU A;  1QZ6 A;  2UYT A;  4JKG A;  1NJW A;  4LF4 K;  2DTU A;  1O1W A;  1RT5 A;  4KHY A;  4OLA A;  2KQ2 A;  3SK3 A;  4FSV A;  4JV5 K;  2O8F A;  4CJW A;  1HNX K;  2D4W A;  3NAE A;  4DR3 K;  3D6R A;  4GY2 B;  3QO9 A;  4FWP A;  3CCL N;  2V7Y A;  4JS5 A;  1S6P A;  3I8D A;  1LW2 A;  4BRN A;  3V9U A;  3HJF A;  4GVM A;  5GIO A;  4F2R A;  4CBW A;  4JI6 K;  3ZT0 A;  3GG4 A;  4CJQ A;  1VQ8 N;  1K9M O;  3KZB A;  5AZJ A;  4W5N A;  2DFE A;  2GEL A;  4HTL A;  1YTA A;  3HPO A;  1QE1 A;  3MN7 A;  3ZSW A;  4X62 K;  2Y1J A;  4JK9 A;  1C1A A;  3CC7 N;  3T1A A;  1VK0 A;  3DI6 A;  4YOX A;  4FL9 A;  4Z4H A;  3R1X A;  1YHQ N;  4IKF A;  1TL1 A;  4CJ3 A;  4O0I A;  3LDO A;  3UKU B;  3DMJ A;  4BVO A;  1J54 A;  3QBX A;  1H1V A;  1RDC A;  3IUC A;  1HYS A;  3CCV N;  4FO0 A;  3AO4 A;  1E3M A;  4BRC A;  4E3S A;  1FW6 A;  3VQQ A;  1WSH A;  2QK9 A;  3PUF A;  3A5N C;  1Y64 A;  3CQ8 A;  1SKR A;  4CJK A;  3HP6 A;  3MXJ A;  5FPM A;  1JXB A;  1NK5 A;  4BVP A;  4V19 S;  3BZK A;  1RBV A;  1VSD A;  2VG5 A;  5CHI A;  1IKY A;  2HF4 A;  1BI4 A;  2A40 A;  1ZYQ A;  5DMR A;  2WFB A;  1MDU B;  3F9K A;  1A5V A;  4NCB A;  5TKY A;  5AQU A;  1RDB A;  3AVM A;  1K73 O;  3T69 A;  3TAE A;  4AM7 A;  1SV5 A;  4KFB A;  2QW9 A;  4O8K A;  2D0O A;  4X65 K;  1RGI A;  3AVL A;  4MDA A;  3AO1 A;  4CFA A;  4U67 L;  1RT3 A;  4BG8 A;  3JS6 A;  4FPA A;  2HW3 A;  4XEI A;  4XH5 A;  3M5R A;  4FJ5 A;  4BC4 A;  3H3O B;  2W6K A;  2IC3 A;  1KD1 O;  4UQG A;  4IG0 A;  2VWB A;  4FJL A;  2NRX A;  4Z4G A;  1LAW A;  4IZ9 A;  3OYJ A;  5ADX A;  2HHS A;  4CZL A;  2GX9 A;  1IBK K;  4BR7 A;  2D0P A;  1G15 A;  4CF2 A;  1S1X A;  3BF3 A;  4DV7 K;  2IVN A;  4DU4 A;  1W0H A;  4CIG A;  1EP4 A;  2YHB A;  2UUC K;  4BC3 A;  1NGD A;  1WNS A;  3UE5 A;  3F2K A;  3QEV A;  3F73 A;  3IMX A;  1MA9 B;  3HXM A;  1TK0 A;  4PHT X;  4IOA L;  3ZSZ A;  4DUY K;  3W0L A;  3B6P A;  5GAH P;  2D0B A;  3O4N A;  2HF3 A;  4NYN A;  3OS2 A;  1T7P A;  1C0F A;  5C15 A;  3P31 A;  4B9U A;  1IG9 A;  4FJN A;  3G25 A;  4F3O A;  1HX1 A;  2GBZ A;  2NRT A;  1VSM A;  3L0Q A;  4BRF A;  4PY5 A;  3N4P A;  4IFY A;  4GVE A;  2P9I B;  3AA4 A;  2F8S A;  2IAJ A;  1VSF A;  4TSX A;  5AQH A;  3ATV A;  2PAV A;  4WFB L;  5M1Q A;  1BCM A;  2YHW A;  3VQP A;  4A61 A;  3NVK A;  4F9O A;  2ASO A;  3ZT2 A;  4FWO A;  4ILH A;  2HHW A;  5HL7 L;  1X3M A;  4WFA L;  3P38 A;  4FM0 A;  2W40 A;  4IO9 L;  4H5T A;  4BRO A;  4I9Q A;  4KRE A;  1T03 A;  4JI0 K;  3L4I A;  4DSI A;  2O8E B;  3K5N A;  1U6Z A;  3SQ0 A;  4HCB A;  3NMU A;  4LF7 K;  3L2W A;  3HRG A;  4G1Q A;  4DS5 A;  4DTR A;  1GLJ O;  3MN9 A;  3OBY A;  3SQ1 A;  4BY9 C;  2A3Z A;  3HOS A;  3JAM O;  4PWD A;  5JS2 A;  5AFU A;  3M6G A;  3TTD A;  2BE2 A;  2JWK A;  1N33 K;  5AQI A;  4LH4 A;  1W9H A;  4KBO A;  4ILJ A;  3ZSV A;  1XC3 A;  3CCU N;  1NGF A;  4JI1 K;  2HHH K;  1Q7Y O;  4IBN A;  2HMP A;  3NF6 A;  4JKC A;  1WBD A;  2O8D A;  3LAN A;  3B6O A;  1HNW K;  4A59 A;  1F21 A;  4WQ5 A;  4DFM A;  4CIE A;  4DTJ A;  1YT3 A;  1CLQ A;  1OH7 A;  4DQR A;  4CZH A;  1Q18 A;  3LP1 A;  3I33 A;  2KTQ A;  3VEY A;  3O9R A;  4E7K A;  4E7I A;  3QEX A;  4NB4 A;  1U2V B;  1L3V A;  4DR2 K;  3TSU A;  1IBM K;  5C25 A;  3O5B A;  1J5O A;  4DSL A;  3K5M A;  2VWK A;  4CK1 A;  1VSE A;  1BGX T;  2HND A;  5AR0 A;  4KHP K;  1DLO A;  3O9S A;  4E1N A;  3GE1 A;  5ELZ A;  2NZT A;  2JWL A;  3D2E A;  4MLH A;  1IBL K;  2Q2R A;  1KFD A;  2P9U A;  4JKA A;  3VEZ A;  4H5V A;  4DMN A;  4B3S K;  1T44 A;  3SQ2 A;  3VA3 A;  4UY8 O;  1TKT A;  3DJC A;  1KSP A;  1NJZ A;  4JI3 K;  1HR0 K;  1KXP A;  4DCH A;  3VGK A;  4JKF A;  4M3T A;  3AGR A;  1Q86 O;  1D5A A;  3S3O A;  3TTC A;  1N8R O;  1IKX A;  3GBT A;  3DYA A;  2Q36 A;  5AQQ A;  1D4X A;  1QQN A;  3ZSO A;  1J5E K;  1WBB A;  4H03 B;  1RCH A;  3NVM A;  4CF9 A;  1KTQ A;  4HCC A;  5C12 A;  2OYQ A;  2I7N A;  4DTP A;  2ASP A;  1S3X A;  1YF5 L;  3M8R A;  4DFK A;  4MDB A;  4GV6 A;  4FOI A;  3TAP A;  2D5R A;  4CEQ A;  3UB5 A;  4QS9 A;  3WNE A;  4AQY K;  3CJB A;  1L3S A;  4CGH A;  3DRS A;  4A62 A;  4B9Q A;  1Z05 A;  1BIS A;  1S9G A;  1X3N A;  3PV8 A;  1NKC A;  1I94 K;  2ITM A;  3O1B A;  3HVR A;  4QAG A;  3RMA A;  4KB1 A;  3HO1 A;  2O8F B;  4L3Q A;  4N47 A;  2JGU A;  4Y1D A;  3FFK B;  5FLX O;  3E66 A;  4M3Z A;  2QTD A;  1TKX A;  4BWM A;  3TR8 A;  1U45 A;  4CJR A;  4FM1 A;  3ASM A;  4A57 A;  1VQ9 N;  3THY B;  1HNZ K;  3ZSR A;  2A6A A;  4X66 K;  4YY3 K;  4MLE A;  1QVF M;  3ITH A;  4LF5 K;  1TAQ A;  4A5A A;  4Z4E A;  4YOW A;  1QQO A;  1MWM A;  3O6W A;  3VQD A;  5KGX A;  3DLL L;  3VPZ A;  4E1J A;  3O08 A;  5LY3 A;  3SUN A;  2UUA K;  2DY4 A;  3UKU A;  3TSQ A;  1IJJ A;  3EE8 A;  3UKR B;  1U47 A;  5AQP A;  1HNI A;  3MN6 A;  3QES A;  1SL2 A;  2O8C B;  2OTJ N;  1Q8I A;  1K8A O;  2E8A A;  3VES A;  3HBT A;  3I55 N;  3A5O C;  4E89 A;  1RDU A;  4I2P A;  4YFU A;  1D9F A;  5HRR A;  2EHG A;  3G4S N;  3ZT3 A;  4I7F A;  4CGI A;  3DWL A;  3AVN A;  2OA8 A;  4CHO A;  4HUG A;  1NGG A;  3AVA A;  3FZH A;  1NGH A;  3OA9 A;  2QWM A;  4RW9 A;  3O9Q A;  5KI6 A;  1BQN A;  4YOT A;  4N76 A;  1M1K O;  3TAG A;  1NGA A;  3EN9 A;  4DFP A;  4LF6 K;  1WLJ A;  4OX9 K;  4BE0 A;  4CFD A;  4DR6 K;  2O8B B;  5CR4 A;  4BE1 A;  2NNW A;  4BRG A;  3T1Y K;  2Y1I A;  1LOT B;  3HM8 A;  3CCS N;  5CE3 A;  5DK5 A;  1ILY A;  4B9T A;  4I2Q A;  1CXQ A;  4EP5 A;  4ID5 A;  4IOC L;  1RT4 A;  1NGE A;  3VER A;  5FPN A;  4DR1 K;  3O3G A;  3MCP A;  2HBJ A;  3OYD A;  2HBM A;  2P5O A;  4BR2 A;  2UXB K;  5GAG P;  3C65 A;  3ZT4 A;  5AQK A;  1HRH A;  3O9T A;  4C8N A;  4B1Y B;  1KAZ A;  4DTN A;  4CES A;  3VQB A;  1X9W A;  3TU5 A;  2BAN A;  2NLX A;  5I9E B;  1RIL A;  3THX A;  2Z1I A;  3HZ6 A;  5BR9 A;  4CJ5 A;  1YJ9 N;  3P1G A;  5KQ8 A;  4LH5 A;  5EVZ A;  3CJ9 A;  1BI4 B;  3CJC A;  3O3F A;  3C6H A;  2Z1G A;  1HMV A;  3ZCM A;  4CE9 A;  1TGO A;  4CJ7 A;  1NGB A;  3FZM A;  1BCO A;  4JHD B;  5LMU K;  4OLB A;  3M1F A;  2O8C A;  2YNF A;  4ISF A;  4OPA A;  2BH1 A;  2O8B A;  4LSL A;  4ZHR A;  1N36 K;  2QWR A;  3HM9 A;  4JK8 A;  3HOT A;  3O3H A;  4CHZ A;  3ENO A;  4C8K A;  3I0R A;  3KLI A;  3VEW A;  3TWH A;  4I6M A;  4YHH K;  3V1O A;  1TVR A;  3V6D A;  4B9V A;  3N4Q A;  4RW7 A;  2QM1 A; 
#chains in the Genus database with same CATH homology
 2W6K A;  3EEQ A;  2W6L A;  3BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...