1RDDA

Crystal structure of escherichia coli rnase hi in complex with mg2+ at 2.8 angstroms resolution: proof for a single mg2+ site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Crystal structure of Escherichia coli RNase HI in complex with Mg2+ at 2.8 A resolution: proof for a single Mg(2+)-binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rddA00
4DFMA 3QINA 3AVAA 1S1VA 3K59A 2AJQA 2KQ2A 1B92A 1KVCA 3OYCA 4HVJA 3MEGA 2X6NA 4KKOA 5J2MA 1X9MA 4CF2A 4LSNA 4KB1A 3LPUA 4NCGA 3LPTA 2ZQBA 1JLEA 4AH9A 4E1MA 1X9SA 4M3RA 2B5JA 3SNNA 2HVHA 4DQRA 2KW4A 4ELVA 3AVLA 4J2BA 4W5TA 2ZE2A 3NHGA 3P83D 3OYJA 4OJRA 4TSXA 3S3NA 3IS9A 1ZBIA 4HTUA 3SV4A 3THVA 4B9TA 4F2SA 1VSDA 4IFVA 2XY7A 2KFNA 3VQCA 4KHNA 1HYZA 1RTIA 4OPKA 3CFOA 2PZSA 3HP6A 2PYLA 4DTUA 4CK1A 1JLBA 5HP1A 3SUNA 3SUPA 3ZCMA 1LWCA 3KJVA 1T05A 2HMIA 3M8QA 2VWKA 3RMBA 4MFBA 1LWEA 1DTTA 1TL3A 4CIFA 3RMCA 3KTQA 3C94A 3OYMA 1RBRA 3M8SA 3K5LA 1LAWA 4OGCA 4FJKA 4O0IA 4F3TA 4I2QA 5C24A 3I8DA 2QKKA 4I9QA 5FRMA 2HVIA 3NF6A 1LWFA 2A1RA 1D9DA 1C0UA 1RDAA 3NH1A 3ZT0A 4CEZA 5HROA 1RBTA 1EP4A 2FBYA 4M42A 4O55A 2BANA 1TKTA 5JS2A 3AVCA 3OY9A 4CCHA 4FJ8A 5CZ1A 4JLHA 2XHBA 4Z4GA 1UOCA 2IDOA 3O3GA 4KO0A 2P5OA 4XIUA 1RBSA 3EY1A 3NCIA 4BDZA 4DFJA 1HJRA 4FJLA 4KI6A 4FK2A 3M8RA 2QK9A 3DOKA 3CFRA 2HHUA 1KFSA 4YNQA 3VQDA 1NK9A 1WAFA 4CHYA 5K14A 2OZSA 4KHQA 4N41A 1HYSA 4C8KA 2DFFA 4E7JA 4IG3A 1D9FA 3HO1A 4F2RA 1BI4B 3TAMA 3TR8A 4DU1A 1Q9YA 4CFCA 1J5OA 4Z4CA 5CY4A 3WNGA 3KLGA 1ZBLA 1SKWA 4F4KA 3NH0A 3DI6A 3S9HA 3SV3A 1A5VA 3CQ8A 3LWLA 2G8IA 5FRNA 3DOLA 3NFAA 1C1BA 1T03A 1RT6A 2E4LA 3P5JA 3SCXA 1Q9XA 4CEFA 5D3GA 4CF0A 4ZHRA 3P1GA 1J53A 1UA1A 1CLQA 4B08A 3AVNA 4E7HA 1JKHA 1RTJA 1TGOA 3L3UA 4W5QA 4FCYA 3QEIA 4KHSA 2YV0X 1W9HA 1J54A 3HVTA 2G8KA 1RBVA 1RDDA 1Z25A 1VRTA 4DS4A 3KD1E 4AHRA 4CIEA 1S1WA 2I5JA 4DQIA 4CJKA 4R5PA 2DTUA 3LALA 1L3SA 4CF9A 3OJSA 2PYJA 2Y1IA 3T1AA 1IKYA 4CHOA 3ZSYA 1X9WA 3C95A 4QAGA 3HM9A 3HPOA 2G8WA 1S1XA 3QNNA 3RWUA 3VQ9A 2HNDA 3AO1A 4AHSA 4CJ5A 4DTNA 4ID1A 3O3HA 4JS4A 3U3YA 2RKIA 1SKRA 3SZ2A 3U3GA 4DQPA 4K8XA 4DFKA 1A5WA 5CYMA 1TV6A 1NKCA 4DQQA 3AVJA 3NGYA 4IBNA 1U04A 2D5RA 4M41A 5HRPA 1SKSA 4L8RB 2KZZA 2E6LA 3OYIA 2EHGA 4OGEA 4CGJA 5KRSA 3KLEA 4DLGA 3HP9A 4PY5A 4KREA 1SV5A 1IO2A 3MAQA 3QEWA 3DRRA 1B9FA 1S9GA 2R7YA 1TK5A 1L3TA 4KFBA 3ZSZA 3AVMA 4EZ9A 3I0RA 2A1SA 2OPRA 4BE2A 3SPZA 1WSGA 4Z0UA 4ELUA 4ID5A 4Z4EA 1A5XA 1YVUA 1ZBUA 2XO7A 4E19A 2YNGA 4CERA 4DTJA 1JL1A 4GMJB 4DFPA 4AHTA 4CJTA 2D0CA 3OS0A 4CJ3A 2RN2A 4FLTA 1JL2A 2YNFA 3V6DA 4DSLA 4KAZA 4DQSA 4N56A 3F9KA 1NK5A 4LY7A 4CEBA 4M3XA 1EXQA 4C8NA 4CF8A 3L2WA 4B3OA 2BDPA 1C6VA 4IG0A 4KHYA 3PX6A 1QTMA 1IH7A 1S5JA 5DK5A 3KLHA 3V9WA 3K5NA 2XY8A 1KSPA 4N76A 3AA5X 4CJVA 3JSMA 1U47A 4C8MA 2OYQA 4FLZA 1SL1A 1KLMA 3OS1A 3PX0A 3VQAA 1NK8A 1WSJA 4FVMA 1NK4A 4HCBA 3LDSA 1WLJA 1JLFA 3SI6A 1U4BA 1WN7A 1WSEA 1NKBA 4AHVA 1DTQA 1X1PA 3TAEA 4DTOA 4KRFA 3NF9A 1BHLA 4I7FA 3V9SA 2F8SA 4RG8A 3ZSWA 3HT3A 3AO5A 1I39A 1IKXA 4OKKA 3V9ZA 4CEAA 4BACA 2FBTA 4C8LA 4FJ9A 1TAUA 2P51A 1RT4A 1WAJA 1BGXT 4CK3A 3OJUA 3I0SA 1RNHA 3L2VA 1ASUA 4OLAA 3PO5A 1VSLA 2IS3A 3NH2A 4LD0A 4CIGA 4DTRA 4BDPA 4BE0A 2EX3A 2VG5A 4CJ4A 3O4QA 3HPGA 4OPJA 2HHWA 4DU3A 2ZD1A 1VSJA 3ULDA 3OYKA 3TABA 3VQ8A 4CHZA 1KTQA 3RTVA 4FJMA 2VG6A 1NK6A 4PA1A 4CHPA 4BE1A 2QKBA 1JLAA 3IG1A 3T19A 4N47A 4H4OA 2Z1JA 4YFUA 1YTUA 1QSLA 4M45A 1B9DA 5KTQA 3TANA 2F96A 3AA2A 1VK0A 3WNEA 1HNIA 1L3VA 2ITGA 4FJHA 3C6UA 2RPIA 4O5BA 3CFPA 3ZT4A 3VN5A 4CJEA 3L8BA 4HUFA 3FFIA 4E7KA 1TKDA 3HXMA 4B9MA 2KTQA 2B6AA 3ALYA 5DMRA 4JS5A 2W42A 4DLEA 4EZ6A 3DMJA 4FJJA 1Q8IA 3V9XA 1T7PA 4K8ZA 2IOCA 4OKEA 2G8UA 1NOYA 1RT2A 3ISNC 4FZZA 3TARA 4ELTA 2D0BA 3DLGA 3DLBA 4E3SA 3WNFA 2HW3A 4GVMA 2F8TA 4GW6A 4FK0A 2X74A 4B9UA 3D0PA 4E1NA 3MXJA 5SZTA 4DF8A 3ZSQA 2OPSA 1CXUA 2P1JA 3PV8A 3VA3A 3BDPA 4F8RA 5FDLA 3QO9A 4Y1CA 4Z4HA 3V1RA 1ZYQA 3OYFA 3V9UA 3QEXA 1C1AA 5JS1A 1WSIA 3DRSA 3TAPA 4B9SA 3CM5A 3HK2A 3O3FA 4CF1A 1EKEA 1YTAA 3D45A 5T7BA 4PQUA 4DTXA 3IRXA 3QESA 3CG7A 4RW8A 3KKRA 4RW7A 4DU4A 3SQ2A 3HVRA 5I3UA 1RT3A 2O4IA 3ZSXA 3L2QA 2G8VA 2GUIA 4RW4A 4FLVA 4UQGA 1GOBA 3SUQA 4OLBA 3O4NA 3QEPA 3AVHA 4Y1DA 1RILA 1S6PA 1QHTA 3AA4A 1T8EA 1XHZA 4KHUA 2D0AA 4CEOA 4FLYA 1TAQA 1VSMA 4OKJA 4BWJA 4CJPA 2FBXA 5J1EA 2YKNA 2OA8A 4CFBA 4M3UA 1HRHA 4KHWA 4Q0BA 1U49A 2Z1HA 3RMDA 4W5NA 1BQNA 3RR7A 3AVKA 3UIQA 4E89A 5HRSA 3G0ZA 2HHVA 4DSFA 4CECA 4CGFA 3ZT2A 4LH5A 1JXEA 3NGZA 2X6SA 3V1QA 2JGUA 3AO2A 4HUEA 3HL8A 4PWDA 1FXXA 4H4MA 4FJ7A 3V81A 1HYVA 1UA0A 2Q3SA 4CK2A 3K5OA 3E01A 5I42A 3TAGA 4J2DA 4CGIA 4KB0A 3IAYA 1XWLA 1FKOA 3SYZA 2VWJA 3PO4A 1CXQA 1WNSA 1YT3A 2KZMA 3DYAA 3K2PA 3OYGA 3K57A 1VSFA 1RT7A 4FYDA 1NJYA 1ZBFA 2PY5A 2RF2A 1EETA 1NOZA 2B4JA 3LZIA 3SQ1A 1KRPA 1QS4A 3F73A 1U45A 1JXBA 1VSEA 4DWIA 4JRPA 3RR8A 4M3ZA 4BDYA 1BL3A 5CZ2A 3LANA 5HRNA 5J2QA 4DMNA 1RTDA 3LP0A 4Z4FA 4AHUA 1FK9A 4KI4A 1LAVA 2IAJA 3ITHA 3TWHA 3SQ0A 3OYEA 1QSSA 1GOCA 3KLFA 1SL0A 4CFDA 4CJRA 3SJJA 4QOZB 2OPQA 1JLGA 3BGRA 2GBZA 4RW6A 3NGIA 3OYNA 4I2PA 4CGGA 4W5OA 1LW0A 2BGGA 2HHTA 3TAQA 3KD5E 1F21A 4IDKA 1U48A 1D8YA 3EZ5A 3KK2A 3OYHA 1LV5A 3L2RA 1BIUA 1XHXA 3H08A 3HJFA 4PUOA 4WE1A 5C25A 1BI4A 5FROA 1VSIA 1G15A 4O0JA 2OPPA 2HNYA 4KTQA 2QXFA 2OZMA 1HPZA 1JLCA 1RBUA 1TVRA 3DLEA 3DLKA 3TAFA 2ATQA 2FC0A 3SPYA 3ZT3A 4W5RA 4RW9A 1UAXA 4DTSA 2KFZA 3PY8A 3LP1A 4CJQA 3U6FA 3TI0A 1TL1A 1L5UA 4DSJA 1C0TA 1QSYA 3VQ5A 3AVBA 4DF4A 1HQEA 4KTZA 3PX4A 3JYTA 3OVNA 4MQ3A 4KV8A 3KK3A 3VQPA 1ITGA 2DFHA 4HCCA 2G8FA 4FXDA 5E41A 1KLNA 3C6TA 2WONA 2HB5A 4FJIA 2LSNA 3DLRA 3ZT1A 3OYLA 4Z4IA 1NJZA 3B6OA 1S1UA 2VG7A 1JLQA 3QEVA 5HLFA 4NCBA 1XI1A 2YNIA 1N5YA 5EU7A 3AVIA 5HBMA 1BQMA 4KPYA 3QIPA 4DSKA 4FM1A 1S1TA 2BE2A 3NBPA 4CFAA 1L3UA 2WOMA 4M3WA 4FLWA 1KVBA 3A2FA 3LAMA 4DG1A 1NJWA 3ASMA 4CHNA 3MXIA 4CESA 3NF7A 1CZBA 2JLEA 1K6YA 4B8AB 2FBVA 4C8OA 4FJ5A 1S9EA 1D5AA 5KGWA 4DTPA 4B9NA 2YKMA 3KK1A 2YHAA 4CJLA 4Q5VA 5HRRA 3OYBA 4LH4A 4EP4A 3VQQA 1J9AA 1N6QA 2P5GA 4FK4A 4CJSA 4FZXC 3K5MA 4CGDA 3AVFA 4NYFA 4J2AA 3NAEA 1ZBHA 3M8PA 4F3OA 5KI6A 3L2UA 1RT1A 4ZTFA 1KVAA 3VQ4A 5J2PA 1ASWA 4FW1A 3OYAA 1IG9A 2IC3A 4B9LA 2DY4A 1KFDA 1RTHA 2NUBA 1NKEA 1C0MA 4DSIA 1S6QA 1NK0A 3DM2A 1MU2A 3ZSRA 2HHQA 3MECA 3LWMA 1HQUA 1FKPA 4DSEA 3LZJA 4AILC 1UWBA 3VQ6A 1WSHA 3HSTB 4FJGA 4FM2A 3SUOA 1Z26A 4FLXA 1KCFA 3MEDA 4CEEA 1R0AA 4E7LA 3QNOA 3S3OA 4ZTJA 4H8KA 1ASVA 1RDCA 2HHXA 4G1QA 3QLHA 3VA0A 2XY6A 1CZ9A 3G10A 3VQBA 1TKZA 4BWMA 4LSLA 1DLOA 5SWMA 1NJXA 1IKVA 3AVGA 3WNHA 1TK0A 3MEEA 2HHSA 2XRIA 1W0HA 3NF8A 1GOAA 3EYZA 4DTMA 3QERA 1TKXA 4M3YA 4OVLA 2YHBA 1WSFA 3HPHA 3OS2A 3LAKA 4NYNA 3VQEA 4CHQA 3NE6A 4JRQA 3RRHA 4KTWA 3VQ7A 3DRPA 4CEDA 4CJUA 3RRGA 3S3MA 1IKWA 1RT5A 5KGXA 3QIOA 3AO4A 3V4IA 3AA3A 4O4GA 3OYDA 3KKSA 3B6PA 2O4GA 4IFYA 1REVA 4EP5A 3NDKA 4FW2A 4B8CA 4B9VA 1XC9A 4J2EA 4FJNA 2Y1JA 3RMAA 4N5SA 4E7IA 3T3FA 2YNHA 4CEQA 1VSKA 2XY5A 4M3TA 1QQCA 1BIZA 5J2NA 3CYMA 2X78A 3LP2A 3HYFA 1VSHA 1BISA 1QE1A 4NCAA 1RCHA 2DFEA 1HMVA 1HNVA 4FZYA 4FM0A 1RDBA 2E6MA 1NK7A 1LW2A 4CE9A 1TK8A 2G8HA 5CYQA 3KIOA 3SQ4A 4QCLA 4CJWA 1BCMA 1VRUA 4HHTA 4HUGA 4O44A 2ETJA 1C1CA 2HNZA 4CGHA 4FLUA 2Z1GA 3DLHA 3ZSVA 5KRTA 4DS5A 2Z1IA 3PUFA 5C42A 3CM6A 1Y97A 2GV9A 1SL2A 4I9LA 2IGIA 4E0DA 3QETA 1SUQA 3MXMA 4FJXA 1I3AA 4IKFA 1O1WA 3ZSOA 4AHCA 3LP3A 3L3VA 4ICLA 3K58A 4CJFA 1BCOA 3V1OA 1EX4A 3AV9A 3KLIA 3AO3A
chains in the Genus database with same CATH superfamily
5FPNA 4DFMA 1TYQA 3MEGA 4H5VA 5CR4A 5J2MA 1X9MA 3WQUA 4NCGA 3LPTA 1JLEA 4PL7A 4GY2B 4DCHA 2B5JA 5BPNA 2KW4A 3R9PA 4W5TA 1IG8A 1NG9A 3QBWA 3SV4A 2CH6A 5KQDA 2XY7A 3LL3A 1RTIA 4OPKA 3UB5A 3FZMA 3HTVA 2PZSA 1NBWA 3C6AA 3HP6A 4DTUA 2PYLA 5HP1A 3SUPA 3G6EN 3H45C 2P9UB 3C6HA 3RMCA 3KTQA 1RBRA 1T44A 4FJKA 4H5WA 3D2EA 1T6CA 4I2QA 1OVYA 2D0OA 3NF6A 3PLAA 2V7YA 1C0UA 1RDAA 4CEZA 1TUUA 2P9PA 2A41A 4FJ8A 5CZ1A 4JLHA 4FWQA 4YDUC 4FJLA 4FK2A 4K43A 4K42A 3DOKA 5EVZA 2HMPA 4KHQA 3MN7A 4Z94A 3MX2A 1MWKA 4N41A 4C8KA 3CCJN 4B9QA 4DV3K 1QHAA 3RVCA 1BI4B 2CH5A 3TAMA 1J5OA 2AA4A 1SKWA 3KWGA 3LWLA 5A2QO 3D6RA 3P5JA 3ATUA 1T03A 3JXUA 4O8KA 5AQRA 4M7XA 4E7HA 3CI5A 3L3UA 4FCYA 2YV0X 3UKUB 1W9HA 2G8KA 1JJ2M 2I5JA 4A59A 2DTUA 1XUPO 3K9KA 3LDPA 2PYJA 1YF5L 3T1AA 3VEXA 4IJAA 3BEXA 2W6LA 4QAGA 3CIPA 3QNNA 1RGIA 4CJ5A 3THYB 4ID1A 2HBLA 1TUYA 3U3GA 4DQPA 4K8XA 5FLXO 2P9IB 2UXBK 3M5RA 4M63C 4DQQA 3EZWA 4YHHK 2UXDK 3ZX0A 1SKSA 5AQMA 2KZZA 2QW9A 3OYIA 4CGJA 4KREA 3HP9A 4G9ZA 3TTDA 1IO2A 3DRRA 1BA1A 1EWRA 3CC7N 5AFUH 3SPZA 2XO7A 1ZBUA 4CERA 4DFPA 4CJ3A 2RN2A 3V6DA 1ATNA 4M3XA 3VPZA 3L2WA 2J4RA 1C6VA 3CC4N 4KHYA 3PX6A 1Z05A 1U2VA 1NNEA 1S5JA 3G25A 3LDLA 4OPHA 3IDHA 3K5NA 4N76A 4CJVA 5AQLA 3NVKA 2V51B 1SL1A 4CZFA 4FWSA 2YHWA 4HCBA 3F9MA 3TAEA 4RG8A 3ZSWA 4FL9A 2WTUA 5M1OA 2EWSA 2ZJPL 1RT4A 1WAJA 4OLAA 4KHPK 1RNHA 2P9NA 4FWRA 3FE1A 3NH2A 4PKHA 3CPEA 4CJ4A 4BE0A 1Q86O 2ZD1A 1VSJA 3CF5L 3OYKA 4BRQA 3CCMN 2QKBA 4BE1A 5LJVA 3UKRB 4N47A 3MDQA 1QSLA 3WQTA 5LMUK 5GAEP 4A5BA 3VN5A 3L8BA 4HUFA 3FFIA 3CETA 4JS5A 4EZ6A 3K9JA 3CXCM 4B1XB 4KH4A 1RT2A 5EOYA 3DLBA 3ID6A 3WNFA 1WOQA 2HF3A 4GVMA 4FK0A 3VEZA 3D0PA 4E1NA 3QFUA 5SZTA 2AP1A 3ZSQA 3BDPA 2P1JA 5TKWA 4Z4HA 3JS6A 3V9UA 1ZYQA 1VQNN 4B9SA 3TAPA 3CM5A 2F9WA 3TSPA 3D45A 5T7BA 3O9UA 3QESA 3DLLL 4RWTA 1VQ6N 4EHUA 3L2QA 2G8VA 2GUIA 5BREA 4UQGA 3A5LC 2V7ZA 1V4SA 4Y1DA 1RILA 3AA4A 2ASMA 4FVUA 1T8EA 2D0AA 3O5BA 4BC5A 4FLYA 4OKJA 3H3OB 4GNIA 2YKNA 2OA8A 4M3UA 1HRHA 4K25A 1FJGK 3C7NA 5HRSA 1R59O 3PIOL 3AAPA 3ZETA 3NGZA 3ZT2A 2X6SA 3V1QA 2JGUA 1GLLO 1HYVA 2UYTA 3KVGA 4KB0A 3IAYA 3PO4A 3ZEUB 1C0FA 1WNSA 3VENA 3DYAA 3K2PA 4BR9A 1VSFA 4WQ4A 1ZBFA 2RF2A 2B4JA 5AQSA 1JXBA 1HR0K 3RR8A 4BDYA 5CZ2A 5HRNA 5KPTA 2P9LA 2YJFA 1FK9A 3TWHA 2GUPA 4CFDA 1IJJA 1JLGA 3BGRA 2HHTA 1MA9B 4IDKA 1D8YA 3OYHA 1BIUA 1XHXA 3H08A 1K8KB 4BR2A 3VF6A 4EHTA 5FROA 2QA4N 1VSIA 1VQON 3DLEA 3T7ZA 2ATQA 4RTFD 2ZJRL 4DTSA 4JKFA 3U6FA 1TL1A 1C0TA 3C7NB 3OVNA 3ENOA 1ITGA 1VQ9N 1YUWA 3SAFA 2HB5A 3MX5A 3TTFA 3DLRA 1VQ4N 4Z4IA 3B6OA 4BRPA 2D0PA 2YNIA 3VEVA 4CZKA 5EU7A 4KPYA 4DSKA 3NBPA 4CFAA 1X3MA 1MWMA 2WOMA 3AGKA 2GWJA 4LF7K 4M3WA 2WBNA 5AQOA 3A2FA 1NJWA 3ASMA 4CHNA 3MXIA 3BZKA 1XMQK 4B8AB 5AFUA 5LJWA 4FJ5A 1D5AA 1XNRK 2YHAA 4FWLA 3OYBA 5HRRA 4J2AA 4NYFA 3R1XA 4K41A 4QS8A 3L2UA 1RT1A 1DT9A 4ZTFA 5J2PA 3DWLA 2DY4A 1KFDA 1RTHA 1C0MA 2O8EB 1MU2A 3MECA 3P31A 2F4VK 1FKPA 3LZJA 4AILC 4FM2A 3SUOA 3MCPA 4JN4A 4E7LA 1ZC6A 3S3OA 4ZTJA 2HHXA 4G1QA 5F0XA 3VA0A 3G10A 4IFEA 3VQBA 4FOEA 1T3VA 4LSLA 5SWMA 3BP8A 4JI2K 4JI6K 2UXCK 3AVGA 3WNHA 2QWRA 1GOAA 1TKXA 2NZTA 3BF1A 2YHBA 4XH1A 3OS2A 5H1SQ 3NE6A 1YITN 2E2NA 3M6GA 1IKWA 2OANA 4B3SK 5KGXA 3AO4A 2FLOA 3V4IA 1HJOA 4BVOA 3CJCA 3E9OA 4IFYA 3VERA 4FJNA 4J2EA 2KKZA 4N5SA 4A62A 3T3FA 1VSKA 1HLUA 1QQCA 5J2NA 1HKBA 2PAVA 3HYFA 1NJIO 1BISA 4NCAA 3EEQA 3EE8A 4FZYA 3FZFA 2G8HA 3CQYA 2VGMA 5AQVA 3SQ4A 5BR8K 1VRUA 3EKSA 4O44A 4DV6K 2ETJA 2HNZA 4CZMA 5C42A 3CCEN 2GV9A 1SL2A 4E0DA 3IKMA 1KAXA 3QETA 4IKFA 3ZSOA 4H0TB 3LP3A 3SAHA 3CCVN 1GLFO 5FPMA 2E2PA 3KLIA 3W0LA 2YX6A 1ATRA 2X6NA 4KKOA 4CF2A 1NU0A 2ZQBA 2DPNA 1X9SA 1NMDA 3SNNA 2HVHA 4YORA 3O9SA 4CW7B 2FSNA 3NHGA 4HTUA 1RFQA 3THVA 3MN9A 2UUBK 3VQCA 1HYZA 3GDQA 1ZBSA 4M7YA 4CK1A 3WXMB 3WT0A 3O1BA 1LWCA 1S72N 3M8QA 2VWKA 3RMBA 1LWEA 3TU5A 1DTTA 4CIFA 3C94A 1NGJA 2Q36A 2GELA 3K5LA 4F3TA 4I9QA 2VYPA 4OO1J 1G99A 1LWFA 3MN5A 5AQXA 3VETA 3ZT0A 1RBTA 4M42A 4O55A 5JS2A 3OY9A 3LM2A 4MDBA 4BRDA 4CZIA 4U67L 4XIUA 4DFJA 3FLCO 1Q7YO 4KI6A 4B1WB 4PL8A 3H1QA 1VAZA 4CHYA 1HYSA 4DR6K 1YAGA 3WUHA 2DFFA 1D9FA 1VQLN 5DM7L 4F2RA 4JKGB 4DU1A 2Q1NA 5CY4A 3QB0A 4X62K 4BRGA 2G8IA 3J81O 1RT6A 3T1HK 3SCXA 4CF0A 4ZHRA 1J53A 4NO7A 1CLQA 1JKHA 1TGOA 3BZCA 4W5QA 4HTLA 3G71N 3QEIA 1J54A 1NGHA 1RDDA 1Z25A 1E4FT 4XEIA 3CCUN 3TPQA 3IFRA 1K73O 1L3SA 4CF9A 3OJSA 3CJ1A 1IKYA 4ISFA 3FGUA 3ZSYA 1X9WA 3C95A 3RWUA 3HPOA 1S1XA 3VQ9A 3HRGA 5GINA 4JS4A 1ESVA 5AJ3K 1DEJA 1A5WA 2NRZA 3MK6A 1TV6A 3MN6A 3OTOK 1XNQK 4M41A 4PKIA 2E6LA 3A0IX 4PY5A 2OTLN 1KXPA 3MAQA 1S9GA 5AZJB 4CZHA 3I0RA 3U9ZA 4BE2A 1WSGA 3DXMB 5E26A 1YVUA 2F9TA 4E19A 4DTJA 2VQEK 3UE5A 3SLCA 3TSUA 4JHDA 2YNFA 3U8XA 2ITMA 4DB3A 4N56A 3F9KA 1NK5A 4LY7A 4C8NA 2BDPA 1QTMA 3AA5X 3JSMA 1BU6O 1U47A 2Q2RA 4C8MA 2E1YA 1KAYA 1KLMA 1WLJA 4QS9A 2NRTA 1BG3A 1WN7A 1WSEA 4AHVA 1X1PA 2Q0RA 4I7FA 2F8SA 3HM8A 3AO5A 4OKKA 5AQNA 4CEAA 4C8LA 1OVQA 2P51A 3L2VA 3OJUA 2NLXA 2O8DB 3PO5A 2IS3A 1BO5O 2P9SA 4DTRA 3PSIA 2VG5A 4OPJA 2HBKA 4LF8K 5C0YA 3CJAA 2E20A 5M1FA 3TABA 4CHZA 4WYBA 4DV5K 4A2BA 1NK6A 4WCEL 4CHPA 3T19A 4IOCL 3QBXA 4H4OA 2Z1JA 5AQWA 4M45A 2F96A 1VK0A 3WNEA 1HNIA 2UUCK 1L3VA 1NGFA 3CFPA 2B6AA 3ALYA 3RSEA 4DLEA 4FJJA 1Q8IA 3V9XA 2IOCA 2YI1A 3G4SN 2D0BA 5AQYA 4FWPA 2HW3A 3T69A 1DGKN 2X74A 4B9UA 3QICA 1MDUB 2WC9A 4JK8A 1CXUA 3PV8A 3VA3A 2QWNA 5AQHA 1TYQB 2HBJA 4CF1A 1QZ6A 3S41A 3IRXA 4BG9A 3CG7A 3SQ2A 3KKRA 4RW7A 4YDUA 5BRFA 3CHWA 1VQ8N 4FLVA 3SUQA 4R79A 4WFBL 3AVHA 4FO0A 4KHUA 2A42A 4CEOA 4RCHA 1VSMA 2QWMA 4BWJA 4CFBA 2Z1HA 2E5LK 4IOAL 5GIOA 1BQNA 5AZIA 4CECA 4YOVA 2IIRA 3D2EB 4JKDA 4HUEA 5AQFA 3V81A 1UA0A 4A5AA 2P9PB 3SYZA 2FXUA 2HF4A 1YT3A 2KZMA 1NGBA 4FYDA 4YY3K 3LZIA 2O8CA 1U45A 2RE2A 2CGKA 1VSEA 3EO3A 1S3XA 4CI6A 5J2QA 4Z4FA 3LANA 4DMNA 3MWPA 4AHUA 4BGAA 4BR4A 1XC3A 4KI4A 4H0XB 3ITHA 3SQ0A 3OYEA 3KLFA 2YCHA 1SL0A 3I33A 4QOZB 3SJJA 1EWQA 5C2FA 2GBZA 3SMPA 4CGGA 4W5OA 1LW0A 5HOOA 3TAQA 1F21A 1U48A 3EZ5A 1LV5A 4WE1A 5C25A 4BREA 1G15A 3M3ZA 1YJNN 4KTQA 2OZMA 4WF9L 1TVRA 2FC0A 3SPYA 3ZT3A 1SAZA 4CJQA 5F1XA 4A57A 3ENHA 1QSYA 1P90A 4KTZA 3OBWA 1K8AO 3O9QA 4MQ3A 3KK3A 5AQJA 2NRHA 4FXDA 1KLNA 3C6TA 4FJIA 2LSNA 3OYLA 1NJZA 1NMNA 2VG7A 3QEVA 3GOIA 2VCPA 1XI1A 3SMSA 4X65K 3T1YK 1N5YA 3AVIA 5HBMA 5AQQA 3L0QA 3Q7CA 3H46O 3ATVA 1E4GT 2O8BA 1S9EA 5KGWA 4LF5K 3ZLJA 3GBTA 4CJLA 4Q5VA 4DUYK 4LH4A 4EP4A 2IVOA 1OKJA 1SQKA 4CGDA 1ZBHA 1U2VB 3M8PA 1YVNA 4JI3K 1CZAN 1QZ5A 4FW1A 3A5MC 1LCUA 1IG9A 2NUBA 3LWMA 2PFUA 3A8YA 4BC4A 4DSEA 1GLBG 1VHXA 4LC9B 3VTIA 4DR7K 4FLXA 5EXWA 2CGJA 3M1FA 4CEEA 4JV5K 4B1VA 1YHQN 3ULEA 3QNOA 4H8KA 1ASVA 1NGCA 3QLHA 2XY6A 1CZ9A 2P9NB 4B1YB 4DR1K 1WB9A 5JMVA 1TK0A 3CCLN 2HHSA 1W0HA 1LOTB 3QERA 4M3YA 3EYZA 2BH1A 1OH5A 4NYNA 1HPMA 3THWA 4KTWA 4CEDA 1N33K 1NGAA 1W7AA 2Y1JA 3RMAA 4E7IA 2YNHA 2XY5A 1Q18A 1RCHA 4H0PA 1HNVA 4XH5A 1RDBA 5GADP 1TK8A 5CYQA 1W2BM 4CJWA 1P8ZA 4FWMA 4HHTA 3THXA 4HUGA 1OH7A 3DLHA 3ZSVA 4BRIA 4DS5A 3L4IA 1W97L 4JKCA 2Q31A 4I9LA 2IGIA 4DV1K 4YOUA 3ENBA 4FJXA 1O1WA 3L3VA 2NRVA 4ICLA 4CJFA 1VQKN 3V1OA 3OBYA 3LDOA 3K59A 2KQ2A 2W40A 2E8AA 3OYCA 2QWPA 4HVJA 3OHRA 4LF4K 3LPUA 1WBDA 4E1MA 4M3RA 3TTCA 4DQRA 4ELVA 3AVLA 3P38A 3SAGA 2ZE2A 4OJRA 3THWB 3ZETB 1M90O 4B9TA 4BQZA 4F2SA 5JLHA 2KFNA 4KHNA 4Y0WA 4JI1K 1JLBA 1M1KO 3VEYA 3KJVA 2HMIA 4BC2A 4MLHA 1TL3A 3W3DA 3IUCA 3OYMA 3M8SA 1LAWA 4C23A 3CQXA 4O0IA 1YI2N 5C24A 3I8DA 3CD6N 2P9KA 3I55N 1NGGA 3NH1A 2ZJQL 5FPEA 1EP4A 2A6AA 3HOSA 1TKTA 3AVCA 4CCHA 2P9LB 4Z4GA 2XHBA 3THXB 1UOCA 2IDOA 3O08A 4KO0A 4PHTX 3AGRA 2P5OA 1RBSA 3EY1A 4BDZA 1HJRA 5TKYA 3WXJA 2QK9A 3M8RA 5JS1A 4YNQA 1QVGM 1NK9A 2OZSA 2BTFA 2NRXA 4MO5A 1N34K 4IG3A 4CBUA 5GIPA 1Q9YA 3TR8A 1YJ9N 4H5NA 1ZBLA 3NH0A 3PSFA 3SV3A 1A5VA 5LY3A 5FRNA 3DOLA 5JICA 2E4LA 1Q9XA 4IO9L 4NXMK 4CEFA 5D3GA 3P1GA 1UA1A 5AQKA 3AVNA 4B08A 1I94K 1YJWN 3MWTA 4LFBK 4KHSA 4BR0A 3CCRN 3HVTA 1VRTA 4V19S 4H0VB 4CIEA 1WUAA 4R5PA 4IDHA 3LALA 2Y1IA 4CHOA 4JKEA 4EIAA 3HM9A 2G8WA 2HNDA 4DTNA 4B3TK 3O3HA 3SZ2A 4XH4A 1NKCA 4DR4K 2D4WA 1NGDA 4JD2A 3AVJA 1N32K 5HRPA 1U04A 2D5RA 2EHGA 4OGEA 4WQ5C 4B1ZA 1SV5A 1L3TA 1B9FA 4KFBA 2D1KA 4EZ9A 4Z0UA 4ELUA 4ID5A 5AQIA 2H3GX 3O4WA 5HL7L 1JL1A 2E88A 4AHTA 4CJTA 2D0CA 3VGMA 3E66A 4BROA 4FLTA 1JL2A 3FZHA 4DSLA 3H3NO 4KAZA 5AQUA 4CEBA 4ILGB 3KZBA 5DK5A 2XY8A 5BN9A 4CZJA 2O8FA 2OYQA 3PX0A 3VQAA 1WSJA 3LDSA 1DTQA 4DTOA 1BHLA 3V9SA 1I39A 3V9ZA 3CPWM 2QTDA 4BACA 2FBTA 4FJ9A 1TAUA 1JCEA 1ATSA 3SK3A 4CK3A 3I0SA 1J5EK 4CIGA 1JCFA 3O4QA 3D7EO 4IEEA 1D4XA 3IMXA 3ULDA 4LFCK 2WFBA 1XQSC 4DR2K 1KTQA 3GG4A 3RTVA 3C65A 2VG6A 4FWNA 2FF6A 4BRFA 2KLAA 4YFUA 1YTUA 4DV0K 1B9DA 1EO1A 3AA2A 1ILYA 2E1ZA 2ITGA 5EX5A 2Q97A 3ZT4A 4CJEA 4H0YB 4B9MA 3HXMA 1VQ7N 1HUXA 2KTQA 3VEWA 3HI0A 4B1UB 4JKHA 2W42A 4K8ZA 2A40A 1BOTO 3OA9A 3VF2A 5ADXH 2UU9K 3ISNC 3TARA 4CBXA 4E3SA 3ZX3A 3ZYYX 2F8TA 3MXJA 3P39A 4JI4K 4DF8A 5BN8A 5FDLA 1V4TA 4JEPA 3QO9A 3V1RA 3A5OC 3QEXA 1C1AA 1WSIA 3HK2A 3O3FA 1EKEA 1YTAA 2I7PA 4FPAA 3BF3A 2HBMA 4PQUA 4DTXA 4GV6A 5C10A 3O8MA 1RT3A 3PIPL 2O4IA 3FR0A 4RW4A 1GOBA 3O4NA 4BRAA 1QHTA 3I56N 3N4QA 4ISGA 1QQMA 3VGLA 4JYAK 1TAQA 4CJPA 1IV0A 4KHWA 4Q0BA 3RMDA 1HNWK 4W5NA 2IVNA 3AVKA 4IO8A 5BPLA 4E89A 2HHVA 5GAGP 3CCQN 4DSFA 4CGFA 1JXEA 1GLEG 4DV7K 3AO2A 4PWDA 4H4MA 1IBLK 3K5OA 2A5XA 3TAGA 4J2DA 3VOVA 5AR0A 1FKOA 5M1QA 3GL1A 5JLFA 3JAMO 3VMFB 2PY5A 1NOZA 3SQ1A 3F73A 5BRDA 3AAQA 4DWIA 1HKCA 4IJNA 3MMVA 4JRPA 4M3ZA 4U7BA 4E1JA 3LP0A 1ZXOA 1QSSA 4LF6K 1GOCA 2ZGYA 4CJRA 1J6ZA 4RW6A 4ILHA 4CVNE 4YOWA 1IBKK 4DKWA 4BRKA 3KK2A 4CZLA 3HJFA 4FWKA 1KC8O 1BI4A 2OPPA 2HNYA 1JLCA 1HPZA 3DLKA 1NWKA 3GE1A 4RW9A 3J8AA 1BA0A 3WEEA 3D2FA 1L5UA 3VQ5A 3AVBA 3UKUA 4NXNK 3PX4A 3JYTA 3VQPA 2DFHA 4HCCA 4NLBA 5BPMA 2WONA 4KH6A 3ZT1A 3HOTA 1OH8A 4NCBA 3THYA 5IWAK 3EL2A 2P9IA 3QIPA 2W41A 4I6MA 2BE2A 3AY9A 4JHDB 3LAMA 4DG1A 3O9TA 4CESA 3HZ6A 2FBVA 4BG8A 3CC2N 3F2KA 1NM1A 5M1KA 5MLCQ 1N8RO 2YKMA 5KPZA 5CHIA 3VQQA 1J9AA 1N6QA 4FK4A 4CJSA 4FZXC 3K5MA 3AVFA 1VQMN 2GTDA 5KI6A 1IBMK 1ASWA 4MLEA 3OYAA 2IC3A 1T6DA 4DSIA 1S6QA 3ZSRA 4O8UA 3FZLA 4JI5K 4NB4A 4K0KK 1WSHA 3HSTB 3EE9A 1Z26A 1RDWX 1KCFA 1H1VA 2HSTA 2P9SB 1IKVA 3WEEB 3D2FB 4OVLA 1WSFA 3HPHA 4JAXA 3VQEA 4H03B 3S3MA 1RT5A 2QM1A 2QWOA 2YHYA 3AA3A 4O4GA 3OYDA 3J7ZO 4CJ7A 3F5TA 3B6PA 1REVA 4EP5A 4B9VA 4B8CA 3DAWA 2W6KA 4L3QA 4M3TA 4I6MB 3J7AP 3CYMA 3RSEB 1O13A 1VSHA 2NRWA 4AQYK 1GLAG 1HMVA 3UKRA 2VWBA 3Q7BA 4AF1A 3SBGA 2E2OA 3EN9A 1BCMA 3CJBA 1VQ5N 5M1NA 4X66K 4HWIA 3ID8A 3WXKA 4CD3A 2Z1GA 5ADXA 1OH6A 3R3LA 3PUFA 4DHYA 3CM6A 1Y97A 5C15A 4J8FA 3MXMA 5IT9O 4O5FA 1I3AA 4B3MK 4GKKK 2GWKA 5AQGA 3K58A 2IVPA 3ZX2A 1EX4A 3QDKA 3QINA 3AVAA 1S1VA 2AJQA 1B92A 1KVCA 1BDGA 2VQFK 4YOYA 4AM7A 1EQYA 3C0BA 4LSNA 4KB1A 1KQSM 4DV4K 4AH9A 2FF3B 3AARA 1N36K 4J2BA 5B8HA 5AZIB 3P83D 3OYJA 4TSXA 3S3NA 3IS9A 1ZBIA 1Z6RA 4JK9A 4H5TA 1VSDA 4IFVA 3O9RA 2QXLA 3CFOA 4H0OA 3NVMA 3SUNA 5AQTA 3ZCMA 1T05A 1HKGA 2FSKA 2YHXA 2V52B 4MFBA 4OGCA 2QWLA 4BRNA 2QKKA 5FRMA 2O8CB 2HVIA 2A1RA 1D9DA 3P4IA 4QS7A 5HROA 2FBYA 2BANA 4JK7A 1QQNA 4FPBA 3ZEUA 3O3GA 2OCEA 3NCIA 3LM9A 3DJCA 1K9MO 1GLDG 4CD1A 3CFRA 4JI0K 2HHUA 1KFSA 3VQDA 1WAFA 3H1VX 5K14A 5LL6Z 5KQ8A 4E7JA 3HO1A 2ASPA 5AQPA 4CFCA 4Z4CA 3WNGA 3KLGA 4F4KA 3S9HA 3DI6A 1SZ2A 3CQ8A 4WFAL 3NFAA 1C1BA 3K0SA 2ZGZA 1RTJA 2GX9A 2QI2A 1K8KA 4YOTA 3QFPA 3LDQA 3KD1E 1RBVA 4BRMA 4DS4A 1Q81O 2ZWHA 4AHRA 1S1WA 3E9PA 4DQIA 4UY8O 4CJKA 3O1WA 2QEXN 2HHHK 3U9DA 3AO1A 4AHSA 1SKRA 3U3YA 1X9JA 2RKIA 4WQ4C 2NNWA 4DFKA 5CYMA 3R8EA 3DXKA 4LF9K 1RDUA 5JVGL 5DM6L 2I7NA 3NGYA 4IBNA 3VTHA 4BRLA 4PKGA 4L8RB 4DLGA 2A3ZA 5KRSA 3KLEA 3QEWA 2O8BB 2R7YA 1TK5A 4IOXA 4A2AA 2KHOA 3ZSZA 3AVMA 5LMNK 2A1SA 2OPRA 4EAHD 3CJ9A 1BUPA 4Z4EA 1A5XA 4BR5A 2YNGA 1QVFM 4BC3A 4GMJB 3B8AX 5F2RA 3OS0A 4DQSA 2WUSA 4KBOA 3VGKA 1U6ZA 1EXQA 4CF8A 4B3OA 4IG0A 5E84A 2ZF5O 1DKGD 5GAHP 1IH7A 3V9WA 3KLHA 3ULEB 1KSPA 4FLZA 1NK8A 3OS1A 2O8EA 4FVMA 1NK4A 1JLFA 4MDAA 3SI6A 1U4BA 1NKBA 1Y64A 4KRFA 4FOIA 3NF9A 5AQZA 3HT3A 1IKXA 4FWOA 4WFNL 1BGXT 3KK7A 2YJEA 1ASUA 1VSLA 3O6WA 5FPDA 4LD0A 4BDPA 2HHWA 2EX3A 3HPGA 4A61A 2JWLA 4DU3A 4BGBA 3LDNA 4DUZK 3VQ8A 5BRHA 3DXKB 4GV3A 4FJMA 4PA1A 1JLAA 4IEIA 3IG1A 4CZEA 3NMUA 1SS6A 5KTQA 3TANA 4FJHA 3C6UA 2RPIA 4O5BA 4EFHA 4E7KA 1TKDA 2PBDA 3CCSN 5DMRA 4OX9K 3DMJA 1FW6A 2Q0UA 1T7PA 3BY5A 4OKEA 1NOYA 2G8UA 4FZZA 4AM6A 4ELTA 3DLGA 4GW6A 1HX1A 3H6EA 3QMLA 2OPSA 4F8RA 4DQ8A 4Y1CA 3OW2M 3OYFA 3MCAB 2F7TA 3DRSA 5C2DA 3E9LA 3J7YP 2QWQA 4RW8A 4DU4A 3O80A 3HVRA 5I3UA 3CJ7A 4F9OA 3ZSXA 3WXIA 4OLBA 3QEPA 1S6PA 4JI8K 1XHZA 1GLCG 2FBXA 5J1EA 3HSCA 1U49A 1VQPN 3RR7A 3UIQA 3G0ZA 4KH5A 3SBTA 4LH5A 4B3RK 4C1NK 3HL8A 1FXXA 2P9KB 4FJ7A 3HBTA 4ILJA 2Q3SA 4CK2A 1NLVA 3E01A 5I42A 4CGIA 4YOXA 1NGIA 1XWLA 3EKUA 2VWJA 1CXQA 3OYGA 3K57A 1RT7A 4LFAK 1NJYA 1QQOA 1EETA 4JKBA 1KRPA 1QS4A 1BL3A 2RHKA 4WQ5A 4JI7K 1RTDA 5M1PA 4H5RA 2VGNA 1LAVA 1KD1O 2IAJA 4DV2K 2OPQA 3NGIA 3OYNA 4I2PA 2BGGA 3KD5E 3VESA 3L2RA 4PUOA 4BY9C 1C0GA 4JKGA 4O0JA 3FFKB 4FSVA 3J80O 2ZM6K 2QXFA 4MO4A 1RBUA 3TAFA 4W5RA 1YXQA 3KHYA 1HNXK 4C1NI 1UAXA 2KFZA 3PY8A 3LP1A 3TI0A 4DSJA 4DF4A 2UUAK 1HQEA 4IXCA 1GLJO 4ISEA 4DR5K 4IZ9A 4KV8A 4JD2B 5C12A 2G8FA 4BQLA 5E41A 3FZKA 3VF4A 1S1UA 1JLQA 2GEMA 5HLFA 4OPAA 2E2QA 3WXLA 1BQMA 2ASOA 4FM1A 1S1TA 5ELZA 1L3UA 3VEOA 1KVBA 3SJHA 4FLWA 4DR3K 3NF7A 1XMOK 1CZBA 2JLEA 1K6YA 3TSQA 4C8OA 4BRCA 4DTPA 4B9NA 3KK1A 5AZJA 3I8BA 2P5GA 3E1YA 5JVHL 2CGLA 3DXMA 3NAEA 3BUZB 4F3OA 3KWIA 4GVEA 1KVAA 4X64K 3VQ4A 2O8FB 4B9LA 4JKAA 1NKEA 2FSJA 1NK0A 3DM2A 2HHQA 3CMAN 1HQUA 2BUPA 1UWBA 3VQ6A 1Q82O 1HNZK 3L6QA 4FJGA 3MEDA 1R0AA 3CERA 3L4QA 5KPRA 1X3NA 1RDCA 5EY4A 1TKZA 4BWMA 1DLOA 4BR7A 1NJXA 3CMEN 4IWVA 3MEEA 1WBBA 2XRIA 3NF8A 4DTMA 1BWFO 3LAKA 4BRHA 4CZGA 4CHQA 4JRQA 3RRHA 1JCGA 3VQ7A 3DRPA 4CJUA 3RRGA 2O8DA 3QIOA 3KKSA 5CE3A 3R6MA 2O4GA 3NDKA 4FW2A 3U4LA 1XC9A 1KAZA 2OTJN 2NRRA 2P9UA 3N4PA 4CEQA 1NGEA 1BIZA 5BR9A 2X78A 3LP2A 1QE1A 2DFEA 4FM0A 2E6MA 1NK7A 1LW2A 4CE9A 3KIOA 1YIJN 4QCLA 4GV9A 5I9EB 1E3MA 1C1CA 4FLUA 4CGHA 4NLCA 5KRTA 2Z1IA 3A5NC 1SUQA 4CBWA 2JWKA 4BVPA 2HOEA 1S22A 4AHCA 4GKJK 1BCOA 4JNEA 3AV9A 3AO3A
chains in the Genus database with same CATH topology
4DFMA 3QINA 3AVAA 1S1VA 3K59A 2AJQA 2KQ2A 1B92A 1KVCA 3OYCA 4HVJA 3MEGA 2X6NA 4KKOA 5J2MA 1X9MA 4CF2A 4LSNA 4KB1A 3LPUA 4NCGA 3LPTA 2ZQBA 1JLEA 4AH9A 4E1MA 1X9SA 4M3RA 2B5JA 3SNNA 2HVHA 4DQRA 2KW4A 4ELVA 3AVLA 4J2BA 4W5TA 2ZE2A 3NHGA 3P83D 3OYJA 4OJRA 4TSXA 3S3NA 3IS9A 1ZBIA 4HTUA 3SV4A 3THVA 4B9TA 4F2SA 1VSDA 4IFVA 2XY7A 2KFNA 3VQCA 4KHNA 1HYZA 1RTIA 4OPKA 3CFOA 2PZSA 3HP6A 2PYLA 4DTUA 4CK1A 1JLBA 5HP1A 3SUNA 3SUPA 3ZCMA 1LWCA 3KJVA 1T05A 2HMIA 3M8QA 2VWKA 3RMBA 4MFBA 1LWEA 1DTTA 1TL3A 4CIFA 3RMCA 3KTQA 3C94A 3OYMA 1RBRA 3M8SA 3K5LA 1LAWA 4OGCA 4FJKA 4O0IA 4F3TA 4I2QA 5C24A 3I8DA 2QKKA 4I9QA 5FRMA 2HVIA 3NF6A 1LWFA 2A1RA 1D9DA 1C0UA 1RDAA 3NH1A 3ZT0A 4CEZA 5HROA 1RBTA 1EP4A 2FBYA 4M42A 4O55A 2BANA 1TKTA 5JS2A 3AVCA 3OY9A 4CCHA 4FJ8A 5CZ1A 4JLHA 2XHBA 4Z4GA 1UOCA 2IDOA 3O3GA 4KO0A 2P5OA 4XIUA 1RBSA 3EY1A 3NCIA 4BDZA 4DFJA 1HJRA 4FJLA 4KI6A 4FK2A 3M8RA 2QK9A 3DOKA 3CFRA 2HHUA 1KFSA 4YNQA 3VQDA 1NK9A 1WAFA 4CHYA 5K14A 2OZSA 4KHQA 4N41A 1HYSA 4C8KA 2DFFA 4E7JA 4IG3A 1D9FA 3HO1A 4F2RA 1BI4B 3TAMA 3TR8A 4DU1A 1Q9YA 4CFCA 1J5OA 4Z4CA 5CY4A 3WNGA 3KLGA 1ZBLA 1SKWA 4F4KA 3NH0A 3DI6A 3S9HA 3SV3A 1A5VA 3CQ8A 3LWLA 2G8IA 5FRNA 3DOLA 3NFAA 1C1BA 1T03A 1RT6A 2E4LA 3P5JA 3SCXA 1Q9XA 4CEFA 5D3GA 4CF0A 4ZHRA 3P1GA 1J53A 1UA1A 1CLQA 4B08A 3AVNA 4E7HA 1JKHA 1RTJA 1TGOA 3L3UA 4W5QA 4FCYA 3QEIA 4KHSA 2YV0X 1W9HA 1J54A 3HVTA 2G8KA 1RBVA 1RDDA 1Z25A 1VRTA 4DS4A 3KD1E 4AHRA 4CIEA 1S1WA 2I5JA 4DQIA 4CJKA 4R5PA 2DTUA 3LALA 1L3SA 4CF9A 3OJSA 2PYJA 2Y1IA 3T1AA 1IKYA 4CHOA 3ZSYA 1X9WA 3C95A 4QAGA 3HM9A 3HPOA 2G8WA 1S1XA 3QNNA 3RWUA 3VQ9A 2HNDA 3AO1A 4AHSA 4CJ5A 4DTNA 4ID1A 3O3HA 4JS4A 3U3YA 2RKIA 1SKRA 3SZ2A 3U3GA 4DQPA 4K8XA 4DFKA 1A5WA 5CYMA 1TV6A 1NKCA 4DQQA 3AVJA 3NGYA 4IBNA 1U04A 2D5RA 4M41A 5HRPA 1SKSA 4L8RB 2KZZA 2E6LA 3OYIA 2EHGA 4OGEA 4CGJA 5KRSA 3KLEA 4DLGA 3HP9A 4PY5A 4KREA 1SV5A 1IO2A 3MAQA 3QEWA 3DRRA 1B9FA 1S9GA 2R7YA 1TK5A 1L3TA 4KFBA 3ZSZA 3AVMA 4EZ9A 3I0RA 2A1SA 2OPRA 4BE2A 3SPZA 1WSGA 4Z0UA 4ELUA 4ID5A 4Z4EA 1A5XA 1YVUA 1ZBUA 2XO7A 4E19A 2YNGA 4CERA 4DTJA 1JL1A 4GMJB 4DFPA 4AHTA 4CJTA 2D0CA 3OS0A 4CJ3A 2RN2A 4FLTA 1JL2A 2YNFA 3V6DA 4DSLA 4KAZA 4DQSA 4N56A 3F9KA 1NK5A 4LY7A 4CEBA 4M3XA 1EXQA 4C8NA 4CF8A 3L2WA 4B3OA 2BDPA 1C6VA 4IG0A 4KHYA 3PX6A 1QTMA 1IH7A 1S5JA 5DK5A 3KLHA 3V9WA 3K5NA 2XY8A 1KSPA 4N76A 3AA5X 4CJVA 3JSMA 1U47A 4C8MA 2OYQA 4FLZA 1SL1A 1KLMA 3OS1A 3PX0A 3VQAA 1NK8A 1WSJA 4FVMA 1NK4A 4HCBA 3LDSA 1WLJA 1JLFA 3SI6A 1U4BA 1WN7A 1WSEA 1NKBA 4AHVA 1DTQA 1X1PA 3TAEA 4DTOA 4KRFA 3NF9A 1BHLA 4I7FA 3V9SA 2F8SA 4RG8A 3ZSWA 3HT3A 3AO5A 1I39A 1IKXA 4OKKA 3V9ZA 4CEAA 4BACA 2FBTA 4C8LA 4FJ9A 1TAUA 2P51A 1RT4A 1WAJA 1BGXT 4CK3A 3OJUA 3I0SA 1RNHA 3L2VA 1ASUA 4OLAA 3PO5A 1VSLA 2IS3A 3NH2A 4LD0A 4CIGA 4DTRA 4BDPA 4BE0A 2EX3A 2VG5A 4CJ4A 3O4QA 3HPGA 4OPJA 2HHWA 4DU3A 2ZD1A 1VSJA 3ULDA 3OYKA 3TABA 3VQ8A 4CHZA 1KTQA 3RTVA 4FJMA 2VG6A 1NK6A 4PA1A 4CHPA 4BE1A 2QKBA 1JLAA 3IG1A 3T19A 4N47A 4H4OA 2Z1JA 4YFUA 1YTUA 1QSLA 4M45A 1B9DA 5KTQA 3TANA 2F96A 3AA2A 1VK0A 3WNEA 1HNIA 1L3VA 2ITGA 4FJHA 3C6UA 2RPIA 4O5BA 3CFPA 3ZT4A 3VN5A 4CJEA 3L8BA 4HUFA 3FFIA 4E7KA 1TKDA 3HXMA 4B9MA 2KTQA 2B6AA 3ALYA 5DMRA 4JS5A 2W42A 4DLEA 4EZ6A 3DMJA 4FJJA 1Q8IA 3V9XA 1T7PA 4K8ZA 2IOCA 4OKEA 2G8UA 1NOYA 1RT2A 3ISNC 4FZZA 3TARA 4ELTA 2D0BA 3DLGA 3DLBA 4E3SA 3WNFA 2HW3A 4GVMA 2F8TA 4GW6A 4FK0A 2X74A 4B9UA 3D0PA 4E1NA 3MXJA 5SZTA 4DF8A 3ZSQA 2OPSA 1CXUA 2P1JA 3PV8A 3VA3A 3BDPA 4F8RA 5FDLA 3QO9A 4Y1CA 4Z4HA 3V1RA 1ZYQA 3OYFA 3V9UA 3QEXA 1C1AA 5JS1A 1WSIA 3DRSA 3TAPA 4B9SA 3CM5A 3HK2A 3O3FA 4CF1A 1EKEA 1YTAA 3D45A 5T7BA 4PQUA 4DTXA 3IRXA 3QESA 3CG7A 4RW8A 3KKRA 4RW7A 4DU4A 3SQ2A 3HVRA 5I3UA 1RT3A 2O4IA 3ZSXA 3L2QA 2G8VA 2GUIA 4RW4A 4FLVA 4UQGA 1GOBA 3SUQA 4OLBA 3O4NA 3QEPA 3AVHA 4Y1DA 1RILA 1S6PA 1QHTA 3AA4A 1T8EA 1XHZA 4KHUA 2D0AA 4CEOA 4FLYA 1TAQA 1VSMA 4OKJA 4BWJA 4CJPA 2FBXA 5J1EA 2YKNA 2OA8A 4CFBA 4M3UA 1HRHA 4KHWA 4Q0BA 1U49A 2Z1HA 3RMDA 4W5NA 1BQNA 3RR7A 3AVKA 3UIQA 4E89A 5HRSA 3G0ZA 2HHVA 4DSFA 4CECA 4CGFA 3ZT2A 4LH5A 1JXEA 3NGZA 2X6SA 3V1QA 2JGUA 3AO2A 4HUEA 3HL8A 4PWDA 1FXXA 4H4MA 4FJ7A 3V81A 1HYVA 1UA0A 2Q3SA 4CK2A 3K5OA 3E01A 5I42A 3TAGA 4J2DA 4CGIA 4KB0A 3IAYA 1XWLA 1FKOA 3SYZA 2VWJA 3PO4A 1CXQA 1WNSA 1YT3A 2KZMA 3DYAA 3K2PA 3OYGA 3K57A 1VSFA 1RT7A 4FYDA 1NJYA 1ZBFA 2PY5A 2RF2A 1EETA 1NOZA 2B4JA 3LZIA 3SQ1A 1KRPA 1QS4A 3F73A 1U45A 1JXBA 1VSEA 4DWIA 4JRPA 3RR8A 4M3ZA 4BDYA 1BL3A 5CZ2A 3LANA 5HRNA 5J2QA 4DMNA 1RTDA 3LP0A 4Z4FA 4AHUA 1FK9A 4KI4A 1LAVA 2IAJA 3ITHA 3TWHA 3SQ0A 3OYEA 1QSSA 1GOCA 3KLFA 1SL0A 4CFDA 4CJRA 3SJJA 4QOZB 2OPQA 1JLGA 3BGRA 2GBZA 4RW6A 3NGIA 3OYNA 4I2PA 4CGGA 4W5OA 1LW0A 2BGGA 2HHTA 3TAQA 3KD5E 1F21A 4IDKA 1U48A 1D8YA 3EZ5A 3KK2A 3OYHA 1LV5A 3L2RA 1BIUA 1XHXA 3H08A 3HJFA 4PUOA 4WE1A 5C25A 1BI4A 5FROA 1VSIA 1G15A 4O0JA 2OPPA 2HNYA 4KTQA 2QXFA 2OZMA 1HPZA 1JLCA 1RBUA 1TVRA 3DLEA 3DLKA 3TAFA 2ATQA 2FC0A 3SPYA 3ZT3A 4W5RA 4RW9A 1UAXA 4DTSA 2KFZA 3PY8A 3LP1A 4CJQA 3U6FA 3TI0A 1TL1A 1L5UA 4DSJA 1C0TA 1QSYA 3VQ5A 3AVBA 4DF4A 1HQEA 4KTZA 3PX4A 3JYTA 3OVNA 4MQ3A 4KV8A 3KK3A 3VQPA 1ITGA 2DFHA 4HCCA 2G8FA 4FXDA 5E41A 1KLNA 3C6TA 2WONA 2HB5A 4FJIA 2LSNA 3DLRA 3ZT1A 3OYLA 4Z4IA 1NJZA 3B6OA 1S1UA 2VG7A 1JLQA 3QEVA 5HLFA 4NCBA 1XI1A 2YNIA 1N5YA 5EU7A 3AVIA 5HBMA 1BQMA 4KPYA 3QIPA 4DSKA 4FM1A 1S1TA 2BE2A 3NBPA 4CFAA 1L3UA 2WOMA 4M3WA 4FLWA 1KVBA 3A2FA 3LAMA 4DG1A 1NJWA 3ASMA 4CHNA 3MXIA 4CESA 3NF7A 1CZBA 2JLEA 1K6YA 4B8AB 2FBVA 4C8OA 4FJ5A 1S9EA 1D5AA 5KGWA 4DTPA 4B9NA 2YKMA 3KK1A 2YHAA 4CJLA 4Q5VA 5HRRA 3OYBA 4LH4A 4EP4A 3VQQA 1J9AA 1N6QA 2P5GA 4FK4A 4CJSA 4FZXC 3K5MA 4CGDA 3AVFA 4NYFA 4J2AA 3NAEA 1ZBHA 3M8PA 4F3OA 5KI6A 3L2UA 1RT1A 4ZTFA 1KVAA 3VQ4A 5J2PA 1ASWA 4FW1A 3OYAA 1IG9A 2IC3A 4B9LA 2DY4A 1KFDA 1RTHA 2NUBA 1NKEA 1C0MA 4DSIA 1S6QA 1NK0A 3DM2A 1MU2A 3ZSRA 2HHQA 3MECA 3LWMA 1HQUA 1FKPA 4DSEA 3LZJA 4AILC 1UWBA 3VQ6A 1WSHA 3HSTB 4FJGA 4FM2A 3SUOA 1Z26A 4FLXA 1KCFA 3MEDA 4CEEA 1R0AA 4E7LA 3QNOA 3S3OA 4ZTJA 4H8KA 1ASVA 1RDCA 2HHXA 4G1QA 3QLHA 3VA0A 2XY6A 1CZ9A 3G10A 3VQBA 1TKZA 4BWMA 4LSLA 1DLOA 5SWMA 1NJXA 1IKVA 3AVGA 3WNHA 1TK0A 3MEEA 2HHSA 2XRIA 1W0HA 3NF8A 1GOAA 3EYZA 4DTMA 3QERA 1TKXA 4M3YA 4OVLA 2YHBA 1WSFA 3HPHA 3OS2A 3LAKA 4NYNA 3VQEA 4CHQA 3NE6A 4JRQA 3RRHA 4KTWA 3VQ7A 3DRPA 4CEDA 4CJUA 3RRGA 3S3MA 1IKWA 1RT5A 5KGXA 3QIOA 3AO4A 3V4IA 3AA3A 4O4GA 3OYDA 3KKSA 3B6PA 2O4GA 4IFYA 1REVA 4EP5A 3NDKA 4FW2A 4B8CA 4B9VA 1XC9A 4J2EA 4FJNA 2Y1JA 3RMAA 4N5SA 4E7IA 3T3FA 2YNHA 4CEQA 1VSKA 2XY5A 4M3TA 1QQCA 1BIZA 5J2NA 3CYMA 2X78A 3LP2A 3HYFA 1VSHA 1BISA 1QE1A 4NCAA 1RCHA 2DFEA 1HMVA 1HNVA 4FZYA 4FM0A 1RDBA 2E6MA 1NK7A 1LW2A 4CE9A 1TK8A 2G8HA 5CYQA 3KIOA 3SQ4A 4QCLA 4CJWA 1BCMA 1VRUA 4HHTA 4HUGA 4O44A 2ETJA 1C1CA 2HNZA 4CGHA 4FLUA 2Z1GA 3DLHA 3ZSVA 5KRTA 4DS5A 2Z1IA 3PUFA 5C42A 3CM6A 1Y97A 2GV9A 1SL2A 4I9LA 2IGIA 4E0DA 3QETA 1SUQA 3MXMA 4FJXA 1I3AA 4IKFA 1O1WA 3ZSOA 4AHCA 3LP3A 3L3VA 4ICLA 3K58A 4CJFA 1BCOA 3V1OA 1EX4A 3AV9A 3KLIA 3AO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFM A;  3QIN A;  3AVA A;  1S1V A;  3K59 A;  2AJQ A;  2KQ2 A;  1B92 A;  1KVC A;  3OYC A;  4HVJ A;  3MEG A;  2X6N A;  4KKO A;  5J2M A;  1X9M A;  4CF2 A;  4LSN A;  4KB1 A;  3LPU A;  4NCG A;  3LPT A;  2ZQB A;  1JLE A;  4AH9 A;  4E1M A;  1X9S A;  4M3R A;  2B5J A;  3SNN A;  2HVH A;  4DQR A;  2KW4 A;  4ELV A;  3AVL A;  4J2B A;  4W5T A;  2ZE2 A;  3NHG A;  3P83 D;  3OYJ A;  4OJR A;  4TSX A;  3S3N A;  3IS9 A;  1ZBI A;  4HTU A;  3SV4 A;  3THV A;  4B9T A;  4F2S A;  1VSD A;  4IFV A;  2XY7 A;  2KFN A;  3VQC A;  4KHN A;  1HYZ A;  1RTI A;  4OPK A;  3CFO A;  2PZS A;  3HP6 A;  2PYL A;  4DTU A;  4CK1 A;  1JLB A;  5HP1 A;  3SUN A;  3SUP A;  3ZCM A;  1LWC A;  3KJV A;  1T05 A;  2HMI A;  3M8Q A;  2VWK A;  3RMB A;  4MFB A;  1LWE A;  1DTT A;  1TL3 A;  4CIF A;  3RMC A;  3KTQ A;  3C94 A;  3OYM A;  1RBR A;  3M8S A;  3K5L A;  1LAW A;  4OGC A;  4FJK A;  4O0I A;  4F3T A;  4I2Q A;  5C24 A;  3I8D A;  2QKK A;  4I9Q A;  5FRM A;  2HVI A;  3NF6 A;  1LWF A;  2A1R A;  1D9D A;  1C0U A;  1RDA A;  3NH1 A;  3ZT0 A;  4CEZ A;  5HRO A;  1RBT A;  1EP4 A;  2FBY A;  4M42 A;  4O55 A;  2BAN A;  1TKT A;  5JS2 A;  3AVC A;  3OY9 A;  4CCH A;  4FJ8 A;  5CZ1 A;  4JLH A;  2XHB A;  4Z4G A;  1UOC A;  2IDO A;  3O3G A;  4KO0 A;  2P5O A;  4XIU A;  1RBS A;  3EY1 A;  3NCI A;  4BDZ A;  4DFJ A;  1HJR A;  4FJL A;  4KI6 A;  4FK2 A;  3M8R A;  2QK9 A;  3DOK A;  3CFR A;  2HHU A;  1KFS A;  4YNQ A;  3VQD A;  1NK9 A;  1WAF A;  4CHY A;  5K14 A;  2OZS A;  4KHQ A;  4N41 A;  1HYS A;  4C8K A;  2DFF A;  4E7J A;  4IG3 A;  1D9F A;  3HO1 A;  4F2R A;  1BI4 B;  3TAM A;  3TR8 A;  4DU1 A;  1Q9Y A;  4CFC A;  1J5O A;  4Z4C A;  5CY4 A;  3WNG A;  3KLG A;  1ZBL A;  1SKW A;  4F4K A;  3NH0 A;  3DI6 A;  3S9H A;  3SV3 A;  1A5V A;  3CQ8 A;  3LWL A;  2G8I A;  5FRN A;  3DOL A;  3NFA A;  1C1B A;  1T03 A;  1RT6 A;  2E4L A;  3P5J A;  3SCX A;  1Q9X A;  4CEF A;  5D3G A;  4CF0 A;  4ZHR A;  3P1G A;  1J53 A;  1UA1 A;  1CLQ A;  4B08 A;  3AVN A;  4E7H A;  1JKH A;  1RTJ A;  1TGO A;  3L3U A;  4W5Q A;  4FCY A;  3QEI A;  4KHS A;  2YV0 X;  1W9H A;  1J54 A;  3HVT A;  2G8K A;  1RBV A;  1RDD A;  1Z25 A;  1VRT A;  4DS4 A;  3KD1 E;  4AHR A;  4CIE A;  1S1W A;  2I5J A;  4DQI A;  4CJK A;  4R5P A;  2DTU A;  3LAL A;  1L3S A;  4CF9 A;  3OJS A;  2PYJ A;  2Y1I A;  3T1A A;  1IKY A;  4CHO A;  3ZSY A;  1X9W A;  3C95 A;  4QAG A;  3HM9 A;  3HPO A;  2G8W A;  1S1X A;  3QNN A;  3RWU A;  3VQ9 A;  2HND A;  3AO1 A;  4AHS A;  4CJ5 A;  4DTN A;  4ID1 A;  3O3H A;  4JS4 A;  3U3Y A;  2RKI A;  1SKR A;  3SZ2 A;  3U3G A;  4DQP A;  4K8X A;  4DFK A;  1A5W A;  5CYM A;  1TV6 A;  1NKC A;  4DQQ A;  3AVJ A;  3NGY A;  4IBN A;  1U04 A;  2D5R A;  4M41 A;  5HRP A;  1SKS A;  4L8R B;  2KZZ A;  2E6L A;  3OYI A;  2EHG A;  4OGE A;  4CGJ A;  5KRS A;  3KLE A;  4DLG A;  3HP9 A;  4PY5 A;  4KRE A;  1SV5 A;  1IO2 A;  3MAQ A;  3QEW A;  3DRR A;  1B9F A;  1S9G A;  2R7Y A;  1TK5 A;  1L3T A;  4KFB A;  3ZSZ A;  3AVM A;  4EZ9 A;  3I0R A;  2A1S A;  2OPR A;  4BE2 A;  3SPZ A;  1WSG A;  4Z0U A;  4ELU A;  4ID5 A;  4Z4E A;  1A5X A;  1YVU A;  1ZBU A;  2XO7 A;  4E19 A;  2YNG A;  4CER A;  4DTJ A;  1JL1 A;  4GMJ B;  4DFP A;  4AHT A;  4CJT A;  2D0C A;  3OS0 A;  4CJ3 A;  2RN2 A;  4FLT A;  1JL2 A;  2YNF A;  3V6D A;  4DSL A;  4KAZ A;  4DQS A;  4N56 A;  3F9K A;  1NK5 A;  4LY7 A;  4CEB A;  4M3X A;  1EXQ A;  4C8N A;  4CF8 A;  3L2W A;  4B3O A;  2BDP A;  1C6V A;  4IG0 A;  4KHY A;  3PX6 A;  1QTM A;  1IH7 A;  1S5J A;  5DK5 A;  3KLH A;  3V9W A;  3K5N A;  2XY8 A;  1KSP A;  4N76 A;  3AA5 X;  4CJV A;  3JSM A;  1U47 A;  4C8M A;  2OYQ A;  4FLZ A;  1SL1 A;  1KLM A;  3OS1 A;  3PX0 A;  3VQA A;  1NK8 A;  1WSJ A;  4FVM A;  1NK4 A;  4HCB A;  3LDS A;  1WLJ A;  1JLF A;  3SI6 A;  1U4B A;  1WN7 A;  1WSE A;  1NKB A;  4AHV A;  1DTQ A;  1X1P A;  3TAE A;  4DTO A;  4KRF A;  3NF9 A;  1BHL A;  4I7F A;  3V9S A;  2F8S A;  4RG8 A;  3ZSW A;  3HT3 A;  3AO5 A;  1I39 A;  1IKX A;  4OKK A;  3V9Z A;  4CEA A;  4BAC A;  2FBT A;  4C8L A;  4FJ9 A;  1TAU A;  2P51 A;  1RT4 A;  1WAJ A;  1BGX T;  4CK3 A;  3OJU A;  3I0S A;  1RNH A;  3L2V A;  1ASU A;  4OLA A;  3PO5 A;  1VSL A;  2IS3 A;  3NH2 A;  4LD0 A;  4CIG A;  4DTR A;  4BDP A;  4BE0 A;  2EX3 A;  2VG5 A;  4CJ4 A;  3O4Q A;  3HPG A;  4OPJ A;  2HHW A;  4DU3 A;  2ZD1 A;  1VSJ A;  3ULD A;  3OYK A;  3TAB A;  3VQ8 A;  4CHZ A;  1KTQ A;  3RTV A;  4FJM A;  2VG6 A;  1NK6 A;  4PA1 A;  4CHP A;  4BE1 A;  2QKB A;  1JLA A;  3IG1 A;  3T19 A;  4N47 A;  4H4O A;  2Z1J A;  4YFU A;  1YTU A;  1QSL A;  4M45 A;  1B9D A;  5KTQ A;  3TAN A;  2F96 A;  3AA2 A;  1VK0 A;  3WNE A;  1HNI A;  1L3V A;  2ITG A;  4FJH A;  3C6U A;  2RPI A;  4O5B A;  3CFP A;  3ZT4 A;  3VN5 A;  4CJE A;  3L8B A;  4HUF A;  3FFI A;  4E7K A;  1TKD A;  3HXM A;  4B9M A;  2KTQ A;  2B6A A;  3ALY A;  5DMR A;  4JS5 A;  2W42 A;  4DLE A;  4EZ6 A;  3DMJ A;  4FJJ A;  1Q8I A;  3V9X A;  1T7P A;  4K8Z A;  2IOC A;  4OKE A;  2G8U A;  1NOY A;  1RT2 A;  3ISN C;  4FZZ A;  3TAR A;  4ELT A;  2D0B A;  3DLG A;  3DLB A;  4E3S A;  3WNF A;  2HW3 A;  4GVM A;  2F8T A;  4GW6 A;  4FK0 A;  2X74 A;  4B9U A;  3D0P A;  4E1N A;  3MXJ A;  5SZT A;  4DF8 A;  3ZSQ A;  2OPS A;  1CXU A;  2P1J A;  3PV8 A;  3VA3 A;  3BDP A;  4F8R A;  5FDL A;  3QO9 A;  4Y1C A;  4Z4H A;  3V1R A;  1ZYQ A;  3OYF A;  3V9U A;  3QEX A;  1C1A A;  5JS1 A;  1WSI A;  3DRS A;  3TAP A;  4B9S A;  3CM5 A;  3HK2 A;  3O3F A;  4CF1 A;  1EKE A;  1YTA A;  3D45 A;  5T7B A;  4PQU A;  4DTX A;  3IRX A;  3QES A;  3CG7 A;  4RW8 A;  3KKR A;  4RW7 A;  4DU4 A;  3SQ2 A;  3HVR A;  5I3U A;  1RT3 A;  2O4I A;  3ZSX A;  3L2Q A;  2G8V A;  2GUI A;  4RW4 A;  4FLV A;  4UQG A;  1GOB A;  3SUQ A;  4OLB A;  3O4N A;  3QEP A;  3AVH A;  4Y1D A;  1RIL A;  1S6P A;  1QHT A;  3AA4 A;  1T8E A;  1XHZ A;  4KHU A;  2D0A A;  4CEO A;  4FLY A;  1TAQ A;  1VSM A;  4OKJ A;  4BWJ A;  4CJP A;  2FBX A;  5J1E A;  2YKN A;  2OA8 A;  4CFB A;  4M3U A;  1HRH A;  4KHW A;  4Q0B A;  1U49 A;  2Z1H A;  3RMD A;  4W5N A;  1BQN A;  3RR7 A;  3AVK A;  3UIQ A;  4E89 A;  5HRS A;  3G0Z A;  2HHV A;  4DSF A;  4CEC A;  4CGF A;  3ZT2 A;  4LH5 A;  1JXE A;  3NGZ A;  2X6S A;  3V1Q A;  2JGU A;  3AO2 A;  4HUE A;  3HL8 A;  4PWD A;  1FXX A;  4H4M A;  4FJ7 A;  3V81 A;  1HYV A;  1UA0 A;  2Q3S A;  4CK2 A;  3K5O A;  3E01 A;  5I42 A;  3TAG A;  4J2D A;  4CGI A;  4KB0 A;  3IAY A;  1XWL A;  1FKO A;  3SYZ A;  2VWJ A;  3PO4 A;  1CXQ A;  1WNS A;  1YT3 A;  2KZM A;  3DYA A;  3K2P A;  3OYG A;  3K57 A;  1VSF A;  1RT7 A;  4FYD A;  1NJY A;  1ZBF A;  2PY5 A;  2RF2 A;  1EET A;  1NOZ A;  2B4J A;  3LZI A;  3SQ1 A;  1KRP A;  1QS4 A;  3F73 A;  1U45 A;  1JXB A;  1VSE A;  4DWI A;  4JRP A;  3RR8 A;  4M3Z A;  4BDY A;  1BL3 A;  5CZ2 A;  3LAN A;  5HRN A;  5J2Q A;  4DMN A;  1RTD A;  3LP0 A;  4Z4F A;  4AHU A;  1FK9 A;  4KI4 A;  1LAV A;  2IAJ A;  3ITH A;  3TWH A;  3SQ0 A;  3OYE A;  1QSS A;  1GOC A;  3KLF A;  1SL0 A;  4CFD A;  4CJR A;  3SJJ A;  4QOZ B;  2OPQ A;  1JLG A;  3BGR A;  2GBZ A;  4RW6 A;  3NGI A;  3OYN A;  4I2P A;  4CGG A;  4W5O A;  1LW0 A;  2BGG A;  2HHT A;  3TAQ A;  3KD5 E;  1F21 A;  4IDK A;  1U48 A;  1D8Y A;  3EZ5 A;  3KK2 A;  3OYH A;  1LV5 A;  3L2R A;  1BIU A;  1XHX A;  3H08 A;  3HJF A;  4PUO A;  4WE1 A;  5C25 A;  1BI4 A;  5FRO A;  1VSI A;  1G15 A;  4O0J A;  2OPP A;  2HNY A;  4KTQ A;  2QXF A;  2OZM A;  1HPZ A;  1JLC A;  1RBU A;  1TVR A;  3DLE A;  3DLK A;  3TAF A;  2ATQ A;  2FC0 A;  3SPY A;  3ZT3 A;  4W5R A;  4RW9 A;  1UAX A;  4DTS A;  2KFZ A;  3PY8 A;  3LP1 A;  4CJQ A;  3U6F A;  3TI0 A;  1TL1 A;  1L5U A;  4DSJ A;  1C0T A;  1QSY A;  3VQ5 A;  3AVB A;  4DF4 A;  1HQE A;  4KTZ A;  3PX4 A;  3JYT A;  3OVN A;  4MQ3 A;  4KV8 A;  3KK3 A;  3VQP A;  1ITG A;  2DFH A;  4HCC A;  2G8F A;  4FXD A;  5E41 A;  1KLN A;  3C6T A;  2WON A;  2HB5 A;  4FJI A;  2LSN A;  3DLR A;  3ZT1 A;  3OYL A;  4Z4I A;  1NJZ A;  3B6O A;  1S1U A;  2VG7 A;  1JLQ A;  3QEV A;  5HLF A;  4NCB A;  1XI1 A;  2YNI A;  1N5Y A;  5EU7 A;  3AVI A;  5HBM A;  1BQM A;  4KPY A;  3QIP A;  4DSK A;  4FM1 A;  1S1T A;  2BE2 A;  3NBP A;  4CFA A;  1L3U A;  2WOM A;  4M3W A;  4FLW A;  1KVB A;  3A2F A;  3LAM A;  4DG1 A;  1NJW A;  3ASM A;  4CHN A;  3MXI A;  4CES A;  3NF7 A;  1CZB A;  2JLE A;  1K6Y A;  4B8A B;  2FBV A;  4C8O A;  4FJ5 A;  1S9E A;  1D5A A;  5KGW A;  4DTP A;  4B9N A;  2YKM A;  3KK1 A;  2YHA A;  4CJL A;  4Q5V A;  5HRR A;  3OYB A;  4LH4 A;  4EP4 A;  3VQQ A;  1J9A A;  1N6Q A;  2P5G A;  4FK4 A;  4CJS A;  4FZX C;  3K5M A;  4CGD A;  3AVF A;  4NYF A;  4J2A A;  3NAE A;  1ZBH A;  3M8P A;  4F3O A;  5KI6 A;  3L2U A;  1RT1 A;  4ZTF A;  1KVA A;  3VQ4 A;  5J2P A;  1ASW A;  4FW1 A;  3OYA A;  1IG9 A;  2IC3 A;  4B9L A;  2DY4 A;  1KFD A;  1RTH A;  2NUB A;  1NKE A;  1C0M A;  4DSI A;  1S6Q A;  1NK0 A;  3DM2 A;  1MU2 A;  3ZSR A;  2HHQ A;  3MEC A;  3LWM A;  1HQU A;  1FKP A;  4DSE A;  3LZJ A;  4AIL C;  1UWB A;  3VQ6 A;  1WSH A;  3HST B;  4FJG A;  4FM2 A;  3SUO A;  1Z26 A;  4FLX A;  1KCF A;  3MED A;  4CEE A;  1R0A A;  4E7L A;  3QNO A;  3S3O A;  4ZTJ A;  4H8K A;  1ASV A;  1RDC A;  2HHX A;  4G1Q A;  3QLH A;  3VA0 A;  2XY6 A;  1CZ9 A;  3G10 A;  3VQB A;  1TKZ A;  4BWM A;  4LSL A;  1DLO A;  5SWM A;  1NJX A;  1IKV A;  3AVG A;  3WNH A;  1TK0 A;  3MEE A;  2HHS A;  2XRI A;  1W0H A;  3NF8 A;  1GOA A;  3EYZ A;  4DTM A;  3QER A;  1TKX A;  4M3Y A;  4OVL A;  2YHB A;  1WSF A;  3HPH A;  3OS2 A;  3LAK A;  4NYN A;  3VQE A;  4CHQ A;  3NE6 A;  4JRQ A;  3RRH A;  4KTW A;  3VQ7 A;  3DRP A;  4CED A;  4CJU A;  3RRG A;  3S3M A;  1IKW A;  1RT5 A;  5KGX A;  3QIO A;  3AO4 A;  3V4I A;  3AA3 A;  4O4G A;  3OYD A;  3KKS A;  3B6P A;  2O4G A;  4IFY A;  1REV A;  4EP5 A;  3NDK A;  4FW2 A;  4B8C A;  4B9V A;  1XC9 A;  4J2E A;  4FJN A;  2Y1J A;  3RMA A;  4N5S A;  4E7I A;  3T3F A;  2YNH A;  4CEQ A;  1VSK A;  2XY5 A;  4M3T A;  1QQC A;  1BIZ A;  5J2N A;  3CYM A;  2X78 A;  3LP2 A;  3HYF A;  1VSH A;  1BIS A;  1QE1 A;  4NCA A;  1RCH A;  2DFE A;  1HMV A;  1HNV A;  4FZY A;  4FM0 A;  1RDB A;  2E6M A;  1NK7 A;  1LW2 A;  4CE9 A;  1TK8 A;  2G8H A;  5CYQ A;  3KIO A;  3SQ4 A;  4QCL A;  4CJW A;  1BCM A;  1VRU A;  4HHT A;  4HUG A;  4O44 A;  2ETJ A;  1C1C A;  2HNZ A;  4CGH A;  4FLU A;  2Z1G A;  3DLH A;  3ZSV A;  5KRT A;  4DS5 A;  2Z1I A;  3PUF A;  5C42 A;  3CM6 A;  1Y97 A;  2GV9 A;  1SL2 A;  4I9L A;  2IGI A;  4E0D A;  3QET A;  1SUQ A;  3MXM A;  4FJX A;  1I3A A;  4IKF A;  1O1W A;  3ZSO A;  4AHC A;  3LP3 A;  3L3V A;  4ICL A;  3K58 A;  4CJF A;  1BCO A;  3V1O A;  1EX4 A;  3AV9 A;  3KLI A;  3AO3 A; 
#chains in the Genus database with same CATH topology
 5FPN A;  4DFM A;  1TYQ A;  3MEG A;  4H5V A;  5CR4 A;  5J2M A;  1X9M A;  3WQU A;  4NCG A;  3LPT A;  1JLE A;  4PL7 A;  4GY2 B;  4DCH A;  2B5J A;  5BPN A;  2KW4 A;  3R9P A;  4W5T A;  1IG8 A;  1NG9 A;  3QBW A;  3SV4 A;  2CH6 A;  5KQD A;  2XY7 A;  3LL3 A;  1RTI A;  4OPK A;  3UB5 A;  3FZM A;  3HTV A;  2PZS A;  1NBW A;  3C6A A;  3HP6 A;  4DTU A;  2PYL A;  5HP1 A;  3SUP A;  3G6E N;  3H45 C;  2P9U B;  3C6H A;  3RMC A;  3KTQ A;  1RBR A;  1T44 A;  4FJK A;  4H5W A;  3D2E A;  1T6C A;  4I2Q A;  1OVY A;  2D0O A;  3NF6 A;  3PLA A;  2V7Y A;  1C0U A;  1RDA A;  4CEZ A;  1TUU A;  2P9P A;  2A41 A;  4FJ8 A;  5CZ1 A;  4JLH A;  4FWQ A;  4YDU C;  4FJL A;  4FK2 A;  4K43 A;  4K42 A;  3DOK A;  5EVZ A;  2HMP A;  4KHQ A;  3MN7 A;  4Z94 A;  3MX2 A;  1MWK A;  4N41 A;  4C8K A;  3CCJ N;  4B9Q A;  4DV3 K;  1QHA A;  3RVC A;  1BI4 B;  2CH5 A;  3TAM A;  1J5O A;  2AA4 A;  1SKW A;  3KWG A;  3LWL A;  5A2Q O;  3D6R A;  3P5J A;  3ATU A;  1T03 A;  3JXU A;  4O8K A;  5AQR A;  4M7X A;  4E7H A;  3CI5 A;  3L3U A;  4FCY A;  2YV0 X;  3UKU B;  1W9H A;  2G8K A;  1JJ2 M;  2I5J A;  4A59 A;  2DTU A;  1XUP O;  3K9K A;  3LDP A;  2PYJ A;  1YF5 L;  3T1A A;  3VEX A;  4IJA A;  3BEX A;  2W6L A;  4QAG A;  3CIP A;  3QNN A;  1RGI A;  4CJ5 A;  3THY B;  4ID1 A;  2HBL A;  1TUY A;  3U3G A;  4DQP A;  4K8X A;  5FLX O;  2P9I B;  2UXB K;  3M5R A;  4M63 C;  4DQQ A;  3EZW A;  4YHH K;  2UXD K;  3ZX0 A;  1SKS A;  5AQM A;  2KZZ A;  2QW9 A;  3OYI A;  4CGJ A;  4KRE A;  3HP9 A;  4G9Z A;  3TTD A;  1IO2 A;  3DRR A;  1BA1 A;  1EWR A;  3CC7 N;  5AFU H;  3SPZ A;  2XO7 A;  1ZBU A;  4CER A;  4DFP A;  4CJ3 A;  2RN2 A;  3V6D A;  1ATN A;  4M3X A;  3VPZ A;  3L2W A;  2J4R A;  1C6V A;  3CC4 N;  4KHY A;  3PX6 A;  1Z05 A;  1U2V A;  1NNE A;  1S5J A;  3G25 A;  3LDL A;  4OPH A;  3IDH A;  3K5N A;  4N76 A;  4CJV A;  5AQL A;  3NVK A;  2V51 B;  1SL1 A;  4CZF A;  4FWS A;  2YHW A;  4HCB A;  3F9M A;  3TAE A;  4RG8 A;  3ZSW A;  4FL9 A;  2WTU A;  5M1O A;  2EWS A;  2ZJP L;  1RT4 A;  1WAJ A;  4OLA A;  4KHP K;  1RNH A;  2P9N A;  4FWR A;  3FE1 A;  3NH2 A;  4PKH A;  3CPE A;  4CJ4 A;  4BE0 A;  1Q86 O;  2ZD1 A;  1VSJ A;  3CF5 L;  3OYK A;  4BRQ A;  3CCM N;  2QKB A;  4BE1 A;  5LJV A;  3UKR B;  4N47 A;  3MDQ A;  1QSL A;  3WQT A;  5LMU K;  5GAE P;  4A5B A;  3VN5 A;  3L8B A;  4HUF A;  3FFI A;  3CET A;  4JS5 A;  4EZ6 A;  3K9J A;  3CXC M;  4B1X B;  4KH4 A;  1RT2 A;  5EOY A;  3DLB A;  3ID6 A;  3WNF A;  1WOQ A;  2HF3 A;  4GVM A;  4FK0 A;  3VEZ A;  3D0P A;  4E1N A;  3QFU A;  5SZT A;  2AP1 A;  3ZSQ A;  3BDP A;  2P1J A;  5TKW A;  4Z4H A;  3JS6 A;  3V9U A;  1ZYQ A;  1VQN N;  4B9S A;  3TAP A;  3CM5 A;  2F9W A;  3TSP A;  3D45 A;  5T7B A;  3O9U A;  3QES A;  3DLL L;  4RWT A;  1VQ6 N;  4EHU A;  3L2Q A;  2G8V A;  2GUI A;  5BRE A;  4UQG A;  3A5L C;  2V7Z A;  1V4S A;  4Y1D A;  1RIL A;  3AA4 A;  2ASM A;  4FVU A;  1T8E A;  2D0A A;  3O5B A;  4BC5 A;  4FLY A;  4OKJ A;  3H3O B;  4GNI A;  2YKN A;  2OA8 A;  4M3U A;  1HRH A;  4K25 A;  1FJG K;  3C7N A;  5HRS A;  1R59 O;  3PIO L;  3AAP A;  3ZET A;  3NGZ A;  3ZT2 A;  2X6S A;  3V1Q A;  2JGU A;  1GLL O;  1HYV A;  2UYT A;  3KVG A;  4KB0 A;  3IAY A;  3PO4 A;  3ZEU B;  1C0F A;  1WNS A;  3VEN A;  3DYA A;  3K2P A;  4BR9 A;  1VSF A;  4WQ4 A;  1ZBF A;  2RF2 A;  2B4J A;  5AQS A;  1JXB A;  1HR0 K;  3RR8 A;  4BDY A;  5CZ2 A;  5HRN A;  5KPT A;  2P9L A;  2YJF A;  1FK9 A;  3TWH A;  2GUP A;  4CFD A;  1IJJ A;  1JLG A;  3BGR A;  2HHT A;  1MA9 B;  4IDK A;  1D8Y A;  3OYH A;  1BIU A;  1XHX A;  3H08 A;  1K8K B;  4BR2 A;  3VF6 A;  4EHT A;  5FRO A;  2QA4 N;  1VSI A;  1VQO N;  3DLE A;  3T7Z A;  2ATQ A;  4RTF D;  2ZJR L;  4DTS A;  4JKF A;  3U6F A;  1TL1 A;  1C0T A;  3C7N B;  3OVN A;  3ENO A;  1ITG A;  1VQ9 N;  1YUW A;  3SAF A;  2HB5 A;  3MX5 A;  3TTF A;  3DLR A;  1VQ4 N;  4Z4I A;  3B6O A;  4BRP A;  2D0P A;  2YNI A;  3VEV A;  4CZK A;  5EU7 A;  4KPY A;  4DSK A;  3NBP A;  4CFA A;  1X3M A;  1MWM A;  2WOM A;  3AGK A;  2GWJ A;  4LF7 K;  4M3W A;  2WBN A;  5AQO A;  3A2F A;  1NJW A;  3ASM A;  4CHN A;  3MXI A;  3BZK A;  1XMQ K;  4B8A B;  5AFU A;  5LJW A;  4FJ5 A;  1D5A A;  1XNR K;  2YHA A;  4FWL A;  3OYB A;  5HRR A;  4J2A A;  4NYF A;  3R1X A;  4K41 A;  4QS8 A;  3L2U A;  1RT1 A;  1DT9 A;  4ZTF A;  5J2P A;  3DWL A;  2DY4 A;  1KFD A;  1RTH A;  1C0M A;  2O8E B;  1MU2 A;  3MEC A;  3P31 A;  2F4V K;  1FKP A;  3LZJ A;  4AIL C;  4FM2 A;  3SUO A;  3MCP A;  4JN4 A;  4E7L A;  1ZC6 A;  3S3O A;  4ZTJ A;  2HHX A;  4G1Q A;  5F0X A;  3VA0 A;  3G10 A;  4IFE A;  3VQB A;  4FOE A;  1T3V A;  4LSL A;  5SWM A;  3BP8 A;  4JI2 K;  4JI6 K;  2UXC K;  3AVG A;  3WNH A;  2QWR A;  1GOA A;  1TKX A;  2NZT A;  3BF1 A;  2YHB A;  4XH1 A;  3OS2 A;  5H1S Q;  3NE6 A;  1YIT N;  2E2N A;  3M6G A;  1IKW A;  2OAN A;  4B3S K;  5KGX A;  3AO4 A;  2FLO A;  3V4I A;  1HJO A;  4BVO A;  3CJC A;  3E9O A;  4IFY A;  3VER A;  4FJN A;  4J2E A;  2KKZ A;  4N5S A;  4A62 A;  3T3F A;  1VSK A;  1HLU A;  1QQC A;  5J2N A;  1HKB A;  2PAV A;  3HYF A;  1NJI O;  1BIS A;  4NCA A;  3EEQ A;  3EE8 A;  4FZY A;  3FZF A;  2G8H A;  3CQY A;  2VGM A;  5AQV A;  3SQ4 A;  5BR8 K;  1VRU A;  3EKS A;  4O44 A;  4DV6 K;  2ETJ A;  2HNZ A;  4CZM A;  5C42 A;  3CCE N;  2GV9 A;  1SL2 A;  4E0D A;  3IKM A;  1KAX A;  3QET A;  4IKF A;  3ZSO A;  4H0T B;  3LP3 A;  3SAH A;  3CCV N;  1GLF O;  5FPM A;  2E2P A;  3KLI A;  3W0L A;  2YX6 A;  1ATR A;  2X6N A;  4KKO A;  4CF2 A;  1NU0 A;  2ZQB A;  2DPN A;  1X9S A;  1NMD A;  3SNN A;  2HVH A;  4YOR A;  3O9S A;  4CW7 B;  2FSN A;  3NHG A;  4HTU A;  1RFQ A;  3THV A;  3MN9 A;  2UUB K;  3VQC A;  1HYZ A;  3GDQ A;  1ZBS A;  4M7Y A;  4CK1 A;  3WXM B;  3WT0 A;  3O1B A;  1LWC A;  1S72 N;  3M8Q A;  2VWK A;  3RMB A;  1LWE A;  3TU5 A;  1DTT A;  4CIF A;  3C94 A;  1NGJ A;  2Q36 A;  2GEL A;  3K5L A;  4F3T A;  4I9Q A;  2VYP A;  4OO1 J;  1G99 A;  1LWF A;  3MN5 A;  5AQX A;  3VET A;  3ZT0 A;  1RBT A;  4M42 A;  4O55 A;  5JS2 A;  3OY9 A;  3LM2 A;  4MDB A;  4BRD A;  4CZI A;  4U67 L;  4XIU A;  4DFJ A;  3FLC O;  1Q7Y O;  4KI6 A;  4B1W B;  4PL8 A;  3H1Q A;  1VAZ A;  4CHY A;  1HYS A;  4DR6 K;  1YAG A;  3WUH A;  2DFF A;  1D9F A;  1VQL N;  5DM7 L;  4F2R A;  4JKG B;  4DU1 A;  2Q1N A;  5CY4 A;  3QB0 A;  4X62 K;  4BRG A;  2G8I A;  3J81 O;  1RT6 A;  3T1H K;  3SCX A;  4CF0 A;  4ZHR A;  1J53 A;  4NO7 A;  1CLQ A;  1JKH A;  1TGO A;  3BZC A;  4W5Q A;  4HTL A;  3G71 N;  3QEI A;  1J54 A;  1NGH A;  1RDD A;  1Z25 A;  1E4F T;  4XEI A;  3CCU N;  3TPQ A;  3IFR A;  1K73 O;  1L3S A;  4CF9 A;  3OJS A;  3CJ1 A;  1IKY A;  4ISF A;  3FGU A;  3ZSY A;  1X9W A;  3C95 A;  3RWU A;  3HPO A;  1S1X A;  3VQ9 A;  3HRG A;  5GIN A;  4JS4 A;  1ESV A;  5AJ3 K;  1DEJ A;  1A5W A;  2NRZ A;  3MK6 A;  1TV6 A;  3MN6 A;  3OTO K;  1XNQ K;  4M41 A;  4PKI A;  2E6L A;  3A0I X;  4PY5 A;  2OTL N;  1KXP A;  3MAQ A;  1S9G A;  5AZJ B;  4CZH A;  3I0R A;  3U9Z A;  4BE2 A;  1WSG A;  3DXM B;  5E26 A;  1YVU A;  2F9T A;  4E19 A;  4DTJ A;  2VQE K;  3UE5 A;  3SLC A;  3TSU A;  4JHD A;  2YNF A;  3U8X A;  2ITM A;  4DB3 A;  4N56 A;  3F9K A;  1NK5 A;  4LY7 A;  4C8N A;  2BDP A;  1QTM A;  3AA5 X;  3JSM A;  1BU6 O;  1U47 A;  2Q2R A;  4C8M A;  2E1Y A;  1KAY A;  1KLM A;  1WLJ A;  4QS9 A;  2NRT A;  1BG3 A;  1WN7 A;  1WSE A;  4AHV A;  1X1P A;  2Q0R A;  4I7F A;  2F8S A;  3HM8 A;  3AO5 A;  4OKK A;  5AQN A;  4CEA A;  4C8L A;  1OVQ A;  2P51 A;  3L2V A;  3OJU A;  2NLX A;  2O8D B;  3PO5 A;  2IS3 A;  1BO5 O;  2P9S A;  4DTR A;  3PSI A;  2VG5 A;  4OPJ A;  2HBK A;  4LF8 K;  5C0Y A;  3CJA A;  2E20 A;  5M1F A;  3TAB A;  4CHZ A;  4WYB A;  4DV5 K;  4A2B A;  1NK6 A;  4WCE L;  4CHP A;  3T19 A;  4IOC L;  3QBX A;  4H4O A;  2Z1J A;  5AQW A;  4M45 A;  2F96 A;  1VK0 A;  3WNE A;  1HNI A;  2UUC K;  1L3V A;  1NGF A;  3CFP A;  2B6A A;  3ALY A;  3RSE A;  4DLE A;  4FJJ A;  1Q8I A;  3V9X A;  2IOC A;  2YI1 A;  3G4S N;  2D0B A;  5AQY A;  4FWP A;  2HW3 A;  3T69 A;  1DGK N;  2X74 A;  4B9U A;  3QIC A;  1MDU B;  2WC9 A;  4JK8 A;  1CXU A;  3PV8 A;  3VA3 A;  2QWN A;  5AQH A;  1TYQ B;  2HBJ A;  4CF1 A;  1QZ6 A;  3S41 A;  3IRX A;  4BG9 A;  3CG7 A;  3SQ2 A;  3KKR A;  4RW7 A;  4YDU A;  5BRF A;  3CHW A;  1VQ8 N;  4FLV A;  3SUQ A;  4R79 A;  4WFB L;  3AVH A;  4FO0 A;  4KHU A;  2A42 A;  4CEO A;  4RCH A;  1VSM A;  2QWM A;  4BWJ A;  4CFB A;  2Z1H A;  2E5L K;  4IOA L;  5GIO A;  1BQN A;  5AZI A;  4CEC A;  4YOV A;  2IIR A;  3D2E B;  4JKD A;  4HUE A;  5AQF A;  3V81 A;  1UA0 A;  4A5A A;  2P9P B;  3SYZ A;  2FXU A;  2HF4 A;  1YT3 A;  2KZM A;  1NGB A;  4FYD A;  4YY3 K;  3LZI A;  2O8C A;  1U45 A;  2RE2 A;  2CGK A;  1VSE A;  3EO3 A;  1S3X A;  4CI6 A;  5J2Q A;  4Z4F A;  3LAN A;  4DMN A;  3MWP A;  4AHU A;  4BGA A;  4BR4 A;  1XC3 A;  4KI4 A;  4H0X B;  3ITH A;  3SQ0 A;  3OYE A;  3KLF A;  2YCH A;  1SL0 A;  3I33 A;  4QOZ B;  3SJJ A;  1EWQ A;  5C2F A;  2GBZ A;  3SMP A;  4CGG A;  4W5O A;  1LW0 A;  5HOO A;  3TAQ A;  1F21 A;  1U48 A;  3EZ5 A;  1LV5 A;  4WE1 A;  5C25 A;  4BRE A;  1G15 A;  3M3Z A;  1YJN N;  4KTQ A;  2OZM A;  4WF9 L;  1TVR A;  2FC0 A;  3SPY A;  3ZT3 A;  1SAZ A;  4CJQ A;  5F1X A;  4A57 A;  3ENH A;  1QSY A;  1P90 A;  4KTZ A;  3OBW A;  1K8A O;  3O9Q A;  4MQ3 A;  3KK3 A;  5AQJ A;  2NRH A;  4FXD A;  1KLN A;  3C6T A;  4FJI A;  2LSN A;  3OYL A;  1NJZ A;  1NMN A;  2VG7 A;  3QEV A;  3GOI A;  2VCP A;  1XI1 A;  3SMS A;  4X65 K;  3T1Y K;  1N5Y A;  3AVI A;  5HBM A;  5AQQ A;  3L0Q A;  3Q7C A;  3H46 O;  3ATV A;  1E4G T;  2O8B A;  1S9E A;  5KGW A;  4LF5 K;  3ZLJ A;  3GBT A;  4CJL A;  4Q5V A;  4DUY K;  4LH4 A;  4EP4 A;  2IVO A;  1OKJ A;  1SQK A;  4CGD A;  1ZBH A;  1U2V B;  3M8P A;  1YVN A;  4JI3 K;  1CZA N;  1QZ5 A;  4FW1 A;  3A5M C;  1LCU A;  1IG9 A;  2NUB A;  3LWM A;  2PFU A;  3A8Y A;  4BC4 A;  4DSE A;  1GLB G;  1VHX A;  4LC9 B;  3VTI A;  4DR7 K;  4FLX A;  5EXW A;  2CGJ A;  3M1F A;  4CEE A;  4JV5 K;  4B1V A;  1YHQ N;  3ULE A;  3QNO A;  4H8K A;  1ASV A;  1NGC A;  3QLH A;  2XY6 A;  1CZ9 A;  2P9N B;  4B1Y B;  4DR1 K;  1WB9 A;  5JMV A;  1TK0 A;  3CCL N;  2HHS A;  1W0H A;  1LOT B;  3QER A;  4M3Y A;  3EYZ A;  2BH1 A;  1OH5 A;  4NYN A;  1HPM A;  3THW A;  4KTW A;  4CED A;  1N33 K;  1NGA A;  1W7A A;  2Y1J A;  3RMA A;  4E7I A;  2YNH A;  2XY5 A;  1Q18 A;  1RCH A;  4H0P A;  1HNV A;  4XH5 A;  1RDB A;  5GAD P;  1TK8 A;  5CYQ A;  1W2B M;  4CJW A;  1P8Z A;  4FWM A;  4HHT A;  3THX A;  4HUG A;  1OH7 A;  3DLH A;  3ZSV A;  4BRI A;  4DS5 A;  3L4I A;  1W97 L;  4JKC A;  2Q31 A;  4I9L A;  2IGI A;  4DV1 K;  4YOU A;  3ENB A;  4FJX A;  1O1W A;  3L3V A;  2NRV A;  4ICL A;  4CJF A;  1VQK N;  3V1O A;  3OBY A;  3LDO A;  3K59 A;  2KQ2 A;  2W40 A;  2E8A A;  3OYC A;  2QWP A;  4HVJ A;  3OHR A;  4LF4 K;  3LPU A;  1WBD A;  4E1M A;  4M3R A;  3TTC A;  4DQR A;  4ELV A;  3AVL A;  3P38 A;  3SAG A;  2ZE2 A;  4OJR A;  3THW B;  3ZET B;  1M90 O;  4B9T A;  4BQZ A;  4F2S A;  5JLH A;  2KFN A;  4KHN A;  4Y0W A;  4JI1 K;  1JLB A;  1M1K O;  3VEY A;  3KJV A;  2HMI A;  4BC2 A;  4MLH A;  1TL3 A;  3W3D A;  3IUC A;  3OYM A;  3M8S A;  1LAW A;  4C23 A;  3CQX A;  4O0I A;  1YI2 N;  5C24 A;  3I8D A;  3CD6 N;  2P9K A;  3I55 N;  1NGG A;  3NH1 A;  2ZJQ L;  5FPE A;  1EP4 A;  2A6A A;  3HOS A;  1TKT A;  3AVC A;  4CCH A;  2P9L B;  4Z4G A;  2XHB A;  3THX B;  1UOC A;  2IDO A;  3O08 A;  4KO0 A;  4PHT X;  3AGR A;  2P5O A;  1RBS A;  3EY1 A;  4BDZ A;  1HJR A;  5TKY A;  3WXJ A;  2QK9 A;  3M8R A;  5JS1 A;  4YNQ A;  1QVG M;  1NK9 A;  2OZS A;  2BTF A;  2NRX A;  4MO5 A;  1N34 K;  4IG3 A;  4CBU A;  5GIP A;  1Q9Y A;  3TR8 A;  1YJ9 N;  4H5N A;  1ZBL A;  3NH0 A;  3PSF A;  3SV3 A;  1A5V A;  5LY3 A;  5FRN A;  3DOL A;  5JIC A;  2E4L A;  1Q9X A;  4IO9 L;  4NXM K;  4CEF A;  5D3G A;  3P1G A;  1UA1 A;  5AQK A;  3AVN A;  4B08 A;  1I94 K;  1YJW N;  3MWT A;  4LFB K;  4KHS A;  4BR0 A;  3CCR N;  3HVT A;  1VRT A;  4V19 S;  4H0V B;  4CIE A;  1WUA A;  4R5P A;  4IDH A;  3LAL A;  2Y1I A;  4CHO A;  4JKE A;  4EIA A;  3HM9 A;  2G8W A;  2HND A;  4DTN A;  4B3T K;  3O3H A;  3SZ2 A;  4XH4 A;  1NKC A;  4DR4 K;  2D4W A;  1NGD A;  4JD2 A;  3AVJ A;  1N32 K;  5HRP A;  1U04 A;  2D5R A;  2EHG A;  4OGE A;  4WQ5 C;  4B1Z A;  1SV5 A;  1L3T A;  1B9F A;  4KFB A;  2D1K A;  4EZ9 A;  4Z0U A;  4ELU A;  4ID5 A;  5AQI A;  2H3G X;  3O4W A;  5HL7 L;  1JL1 A;  2E88 A;  4AHT A;  4CJT A;  2D0C A;  3VGM A;  3E66 A;  4BRO A;  4FLT A;  1JL2 A;  3FZH A;  4DSL A;  3H3N O;  4KAZ A;  5AQU A;  4CEB A;  4ILG B;  3KZB A;  5DK5 A;  2XY8 A;  5BN9 A;  4CZJ A;  2O8F A;  2OYQ A;  3PX0 A;  3VQA A;  1WSJ A;  3LDS A;  1DTQ A;  4DTO A;  1BHL A;  3V9S A;  1I39 A;  3V9Z A;  3CPW M;  2QTD A;  4BAC A;  2FBT A;  4FJ9 A;  1TAU A;  1JCE A;  1ATS A;  3SK3 A;  4CK3 A;  3I0S A;  1J5E K;  4CIG A;  1JCF A;  3O4Q A;  3D7E O;  4IEE A;  1D4X A;  3IMX A;  3ULD A;  4LFC K;  2WFB A;  1XQS C;  4DR2 K;  1KTQ A;  3GG4 A;  3RTV A;  3C65 A;  2VG6 A;  4FWN A;  2FF6 A;  4BRF A;  2KLA A;  4YFU A;  1YTU A;  4DV0 K;  1B9D A;  1EO1 A;  3AA2 A;  1ILY A;  2E1Z A;  2ITG A;  5EX5 A;  2Q97 A;  3ZT4 A;  4CJE A;  4H0Y B;  4B9M A;  3HXM A;  1VQ7 N;  1HUX A;  2KTQ A;  3VEW A;  3HI0 A;  4B1U B;  4JKH A;  2W42 A;  4K8Z A;  2A40 A;  1BOT O;  3OA9 A;  3VF2 A;  5ADX H;  2UU9 K;  3ISN C;  3TAR A;  4CBX A;  4E3S A;  3ZX3 A;  3ZYY X;  2F8T A;  3MXJ A;  3P39 A;  4JI4 K;  4DF8 A;  5BN8 A;  5FDL A;  1V4T A;  4JEP A;  3QO9 A;  3V1R A;  3A5O C;  3QEX A;  1C1A A;  1WSI A;  3HK2 A;  3O3F A;  1EKE A;  1YTA A;  2I7P A;  4FPA A;  3BF3 A;  2HBM A;  4PQU A;  4DTX A;  4GV6 A;  5C10 A;  3O8M A;  1RT3 A;  3PIP L;  2O4I A;  3FR0 A;  4RW4 A;  1GOB A;  3O4N A;  4BRA A;  1QHT A;  3I56 N;  3N4Q A;  4ISG A;  1QQM A;  3VGL A;  4JYA K;  1TAQ A;  4CJP A;  1IV0 A;  4KHW A;  4Q0B A;  3RMD A;  1HNW K;  4W5N A;  2IVN A;  3AVK A;  4IO8 A;  5BPL A;  4E89 A;  2HHV A;  5GAG P;  3CCQ N;  4DSF A;  4CGF A;  1JXE A;  1GLE G;  4DV7 K;  3AO2 A;  4PWD A;  4H4M A;  1IBL K;  3K5O A;  2A5X A;  3TAG A;  4J2D A;  3VOV A;  5AR0 A;  1FKO A;  5M1Q A;  3GL1 A;  5JLF A;  3JAM O;  3VMF B;  2PY5 A;  1NOZ A;  3SQ1 A;  3F73 A;  5BRD A;  3AAQ A;  4DWI A;  1HKC A;  4IJN A;  3MMV A;  4JRP A;  4M3Z A;  4U7B A;  4E1J A;  3LP0 A;  1ZXO A;  1QSS A;  4LF6 K;  1GOC A;  2ZGY A;  4CJR A;  1J6Z A;  4RW6 A;  4ILH A;  4CVN E;  4YOW A;  1IBK K;  4DKW A;  4BRK A;  3KK2 A;  4CZL A;  3HJF A;  4FWK A;  1KC8 O;  1BI4 A;  2OPP A;  2HNY A;  1JLC A;  1HPZ A;  3DLK A;  1NWK A;  3GE1 A;  4RW9 A;  3J8A A;  1BA0 A;  3WEE A;  3D2F A;  1L5U A;  3VQ5 A;  3AVB A;  3UKU A;  4NXN K;  3PX4 A;  3JYT A;  3VQP A;  2DFH A;  4HCC A;  4NLB A;  5BPM A;  2WON A;  4KH6 A;  3ZT1 A;  3HOT A;  1OH8 A;  4NCB A;  3THY A;  5IWA K;  3EL2 A;  2P9I A;  3QIP A;  2W41 A;  4I6M A;  2BE2 A;  3AY9 A;  4JHD B;  3LAM A;  4DG1 A;  3O9T A;  4CES A;  3HZ6 A;  2FBV A;  4BG8 A;  3CC2 N;  3F2K A;  1NM1 A;  5M1K A;  5MLC Q;  1N8R O;  2YKM A;  5KPZ A;  5CHI A;  3VQQ A;  1J9A A;  1N6Q A;  4FK4 A;  4CJS A;  4FZX C;  3K5M A;  3AVF A;  1VQM N;  2GTD A;  5KI6 A;  1IBM K;  1ASW A;  4MLE A;  3OYA A;  2IC3 A;  1T6D A;  4DSI A;  1S6Q A;  3ZSR A;  4O8U A;  3FZL A;  4JI5 K;  4NB4 A;  4K0K K;  1WSH A;  3HST B;  3EE9 A;  1Z26 A;  1RDW X;  1KCF A;  1H1V A;  2HST A;  2P9S B;  1IKV A;  3WEE B;  3D2F B;  4OVL A;  1WSF A;  3HPH A;  4JAX A;  3VQE A;  4H03 B;  3S3M A;  1RT5 A;  2QM1 A;  2QWO A;  2YHY A;  3AA3 A;  4O4G A;  3OYD A;  3J7Z O;  4CJ7 A;  3F5T A;  3B6P A;  1REV A;  4EP5 A;  4B9V A;  4B8C A;  3DAW A;  2W6K A;  4L3Q A;  4M3T A;  4I6M B;  3J7A P;  3CYM A;  3RSE B;  1O13 A;  1VSH A;  2NRW A;  4AQY K;  1GLA G;  1HMV A;  3UKR A;  2VWB A;  3Q7B A;  4AF1 A;  3SBG A;  2E2O A;  3EN9 A;  1BCM A;  3CJB A;  1VQ5 N;  5M1N A;  4X66 K;  4HWI A;  3ID8 A;  3WXK A;  4CD3 A;  2Z1G A;  5ADX A;  1OH6 A;  3R3L A;  3PUF A;  4DHY A;  3CM6 A;  1Y97 A;  5C15 A;  4J8F A;  3MXM A;  5IT9 O;  4O5F A;  1I3A A;  4B3M K;  4GKK K;  2GWK A;  5AQG A;  3K58 A;  2IVP A;  3ZX2 A;  1EX4 A;  3QDK A;  3QIN A;  3AVA A;  1S1V A;  2AJQ A;  1B92 A;  1KVC A;  1BDG A;  2VQF K;  4YOY A;  4AM7 A;  1EQY A;  3C0B A;  4LSN A;  4KB1 A;  1KQS M;  4DV4 K;  4AH9 A;  2FF3 B;  3AAR A;  1N36 K;  4J2B A;  5B8H A;  5AZI B;  3P83 D;  3OYJ A;  4TSX A;  3S3N A;  3IS9 A;  1ZBI A;  1Z6R A;  4JK9 A;  4H5T A;  1VSD A;  4IFV A;  3O9R A;  2QXL A;  3CFO A;  4H0O A;  3NVM A;  3SUN A;  5AQT A;  3ZCM A;  1T05 A;  1HKG A;  2FSK A;  2YHX A;  2V52 B;  4MFB A;  4OGC A;  2QWL A;  4BRN A;  2QKK A;  5FRM A;  2O8C B;  2HVI A;  2A1R A;  1D9D A;  3P4I A;  4QS7 A;  5HRO A;  2FBY A;  2BAN A;  4JK7 A;  1QQN A;  4FPB A;  3ZEU A;  3O3G A;  2OCE A;  3NCI A;  3LM9 A;  3DJC A;  1K9M O;  1GLD G;  4CD1 A;  3CFR A;  4JI0 K;  2HHU A;  1KFS A;  3VQD A;  1WAF A;  3H1V X;  5K14 A;  5LL6 Z;  5KQ8 A;  4E7J A;  3HO1 A;  2ASP A;  5AQP A;  4CFC A;  4Z4C A;  3WNG A;  3KLG A;  4F4K A;  3S9H A;  3DI6 A;  1SZ2 A;  3CQ8 A;  4WFA L;  3NFA A;  1C1B A;  3K0S A;  2ZGZ A;  1RTJ A;  2GX9 A;  2QI2 A;  1K8K A;  4YOT A;  3QFP A;  3LDQ A;  3KD1 E;  1RBV A;  4BRM A;  4DS4 A;  1Q81 O;  2ZWH A;  4AHR A;  1S1W A;  3E9P A;  4DQI A;  4UY8 O;  4CJK A;  3O1W A;  2QEX N;  2HHH K;  3U9D A;  3AO1 A;  4AHS A;  1SKR A;  3U3Y A;  1X9J A;  2RKI A;  4WQ4 C;  2NNW A;  4DFK A;  5CYM A;  3R8E A;  3DXK A;  4LF9 K;  1RDU A;  5JVG L;  5DM6 L;  2I7N A;  3NGY A;  4IBN A;  3VTH A;  4BRL A;  4PKG A;  4L8R B;  4DLG A;  2A3Z A;  5KRS A;  3KLE A;  3QEW A;  2O8B B;  2R7Y A;  1TK5 A;  4IOX A;  4A2A A;  2KHO A;  3ZSZ A;  3AVM A;  5LMN K;  2A1S A;  2OPR A;  4EAH D;  3CJ9 A;  1BUP A;  4Z4E A;  1A5X A;  4BR5 A;  2YNG A;  1QVF M;  4BC3 A;  4GMJ B;  3B8A X;  5F2R A;  3OS0 A;  4DQS A;  2WUS A;  4KBO A;  3VGK A;  1U6Z A;  1EXQ A;  4CF8 A;  4B3O A;  4IG0 A;  5E84 A;  2ZF5 O;  1DKG D;  5GAH P;  1IH7 A;  3V9W A;  3KLH A;  3ULE B;  1KSP A;  4FLZ A;  1NK8 A;  3OS1 A;  2O8E A;  4FVM A;  1NK4 A;  1JLF A;  4MDA A;  3SI6 A;  1U4B A;  1NKB A;  1Y64 A;  4KRF A;  4FOI A;  3NF9 A;  5AQZ A;  3HT3 A;  1IKX A;  4FWO A;  4WFN L;  1BGX T;  3KK7 A;  2YJE A;  1ASU A;  1VSL A;  3O6W A;  5FPD A;  4LD0 A;  4BDP A;  2HHW A;  2EX3 A;  3HPG A;  4A61 A;  2JWL A;  4DU3 A;  4BGB A;  3LDN A;  4DUZ K;  3VQ8 A;  5BRH A;  3DXK B;  4GV3 A;  4FJM A;  4PA1 A;  1JLA A;  4IEI A;  3IG1 A;  4CZE A;  3NMU A;  1SS6 A;  5KTQ A;  3TAN A;  4FJH A;  3C6U A;  2RPI A;  4O5B A;  4EFH A;  4E7K A;  1TKD A;  2PBD A;  3CCS N;  5DMR A;  4OX9 K;  3DMJ A;  1FW6 A;  2Q0U A;  1T7P A;  3BY5 A;  4OKE A;  1NOY A;  2G8U A;  4FZZ A;  4AM6 A;  4ELT A;  3DLG A;  4GW6 A;  1HX1 A;  3H6E A;  3QML A;  2OPS A;  4F8R A;  4DQ8 A;  4Y1C A;  3OW2 M;  3OYF A;  3MCA B;  2F7T A;  3DRS A;  5C2D A;  3E9L A;  3J7Y P;  2QWQ A;  4RW8 A;  4DU4 A;  3O80 A;  3HVR A;  5I3U A;  3CJ7 A;  4F9O A;  3ZSX A;  3WXI A;  4OLB A;  3QEP A;  1S6P A;  4JI8 K;  1XHZ A;  1GLC G;  2FBX A;  5J1E A;  3HSC A;  1U49 A;  1VQP N;  3RR7 A;  3UIQ A;  3G0Z A;  4KH5 A;  3SBT A;  4LH5 A;  4B3R K;  4C1N K;  3HL8 A;  1FXX A;  2P9K B;  4FJ7 A;  3HBT A;  4ILJ A;  2Q3S A;  4CK2 A;  1NLV A;  3E01 A;  5I42 A;  4CGI A;  4YOX A;  1NGI A;  1XWL A;  3EKU A;  2VWJ A;  1CXQ A;  3OYG A;  3K57 A;  1RT7 A;  4LFA K;  1NJY A;  1QQO A;  1EET A;  4JKB A;  1KRP A;  1QS4 A;  1BL3 A;  2RHK A;  4WQ5 A;  4JI7 K;  1RTD A;  5M1P A;  4H5R A;  2VGN A;  1LAV A;  1KD1 O;  2IAJ A;  4DV2 K;  2OPQ A;  3NGI A;  3OYN A;  4I2P A;  2BGG A;  3KD5 E;  3VES A;  3L2R A;  4PUO A;  4BY9 C;  1C0G A;  4JKG A;  4O0J A;  3FFK B;  4FSV A;  3J80 O;  2ZM6 K;  2QXF A;  4MO4 A;  1RBU A;  3TAF A;  4W5R A;  1YXQ A;  3KHY A;  1HNX K;  4C1N I;  1UAX A;  2KFZ A;  3PY8 A;  3LP1 A;  3TI0 A;  4DSJ A;  4DF4 A;  2UUA K;  1HQE A;  4IXC A;  1GLJ O;  4ISE A;  4DR5 K;  4IZ9 A;  4KV8 A;  4JD2 B;  5C12 A;  2G8F A;  4BQL A;  5E41 A;  3FZK A;  3VF4 A;  1S1U A;  1JLQ A;  2GEM A;  5HLF A;  4OPA A;  2E2Q A;  3WXL A;  1BQM A;  2ASO A;  4FM1 A;  1S1T A;  5ELZ A;  1L3U A;  3VEO A;  1KVB A;  3SJH A;  4FLW A;  4DR3 K;  3NF7 A;  1XMO K;  1CZB A;  2JLE A;  1K6Y A;  3TSQ A;  4C8O A;  4BRC A;  4DTP A;  4B9N A;  3KK1 A;  5AZJ A;  3I8B A;  2P5G A;  3E1Y A;  5JVH L;  2CGL A;  3DXM A;  3NAE A;  3BUZ B;  4F3O A;  3KWI A;  4GVE A;  1KVA A;  4X64 K;  3VQ4 A;  2O8F B;  4B9L A;  4JKA A;  1NKE A;  2FSJ A;  1NK0 A;  3DM2 A;  2HHQ A;  3CMA N;  1HQU A;  2BUP A;  1UWB A;  3VQ6 A;  1Q82 O;  1HNZ K;  3L6Q A;  4FJG A;  3MED A;  1R0A A;  3CER A;  3L4Q A;  5KPR A;  1X3N A;  1RDC A;  5EY4 A;  1TKZ A;  4BWM A;  1DLO A;  4BR7 A;  1NJX A;  3CME N;  4IWV A;  3MEE A;  1WBB A;  2XRI A;  3NF8 A;  4DTM A;  1BWF O;  3LAK A;  4BRH A;  4CZG A;  4CHQ A;  4JRQ A;  3RRH A;  1JCG A;  3VQ7 A;  3DRP A;  4CJU A;  3RRG A;  2O8D A;  3QIO A;  3KKS A;  5CE3 A;  3R6M A;  2O4G A;  3NDK A;  4FW2 A;  3U4L A;  1XC9 A;  1KAZ A;  2OTJ N;  2NRR A;  2P9U A;  3N4P A;  4CEQ A;  1NGE A;  1BIZ A;  5BR9 A;  2X78 A;  3LP2 A;  1QE1 A;  2DFE A;  4FM0 A;  2E6M A;  1NK7 A;  1LW2 A;  4CE9 A;  3KIO A;  1YIJ N;  4QCL A;  4GV9 A;  5I9E B;  1E3M A;  1C1C A;  4FLU A;  4CGH A;  4NLC A;  5KRT A;  2Z1I A;  3A5N C;  1SUQ A;  4CBW A;  2JWK A;  4BVP A;  2HOE A;  1S22 A;  4AHC A;  4GKJ K;  1BCO A;  4JNE A;  3AV9 A;  3AO3 A; 
#chains in the Genus database with same CATH homology
 4DFM A;  3QIN A;  3AVA A;  1S1V A;  3K59 A;  2AJQ A;  2KQ2 A;  1B92 A;  1KVC A;  3OYC A;  4HVJ A;  3MEG A;  2X6N A;  4KKO A;  5J2M A;  1X9M A;  4CF2 A;  4LSN A;  4KB1 A;  3LPU A;  4NCG A;  3LPT A;  2ZQB A;  1JLE A;  4AH9 A;  4E1M A;  1X9S A;  4M3R A;  2B5J A;  3SNN A;  2HVH A;  4DQR A;  2KW4 A;  4ELV A;  3AVL A;  4J2B A;  4W5T A;  2ZE2 A;  3NHG A;  3P83 D;  3OYJ A;  4OJR A;  4TSX A;  3S3N A;  3IS9 A;  1ZBI A;  4HTU A;  3SV4 A;  3THV A;  4B9T A;  4F2S A;  1VSD A;  4IFV A;  2XY7 A;  2KFN A;  3VQC A;  4KHN A;  1HYZ A;  1RTI A;  4OPK A;  3CFO A;  2PZS A;  3HP6 A;  2PYL A;  4DTU A;  4CK1 A;  1JLB A;  5HP1 A;  3SUN A;  3SUP A;  3ZCM A;  1LWC A;  3KJV A;  1T05 A;  2HMI A;  3M8Q A;  2VWK A;  3RMB A;  4MFB A;  1LWE A;  1DTT A;  1TL3 A;  4CIF A;  3RMC A;  3KTQ A;  3C94 A;  3OYM A;  1RBR A;  3M8S A;  3K5L A;  1LAW A;  4OGC A;  4FJK A;  4O0I A;  4F3T A;  4I2Q A;  5C24 A;  3I8D A;  2QKK A;  4I9Q A;  5FRM A;  2HVI A;  3NF6 A;  1LWF A;  2A1R A;  1D9D A;  1C0U A;  1RDA A;  3NH1 A;  3ZT0 A;  4CEZ A;  5HRO A;  1RBT A;  1EP4 A;  2FBY A;  4M42 A;  4O55 A;  2BAN A;  1TKT A;  5JS2 A;  3AVC A;  3OY9 A;  4CCH A;  4FJ8 A;  5CZ1 A;  4JLH A;  2XHB A;  4Z4G A;  1UOC A;  2IDO A;  3O3G A;  4KO0 A;  2P5O A;  4XIU A;  1RBS A;  3EY1 A;  3NCI A;  4BDZ A;  4DFJ A;  1HJR A;  4FJL A;  4KI6 A;  4FK2 A;  3M8R A;  2QK9 A;  3DOK A;  3CFR A;  2HHU A;  1KFS A;  4YNQ A;  3VQD A;  1NK9 A;  1WAF A;  4CHY A;  5K14 A;  2OZS A;  4KHQ A;  4N41 A;  1HYS A;  4C8K A;  2DFF A;  4E7J A;  4IG3 A;  1D9F A;  3HO1 A;  4F2R A;  1BI4 B;  3TAM A;  3TR8 A;  4DU1 A;  1Q9Y A;  4CFC A;  1J5O A;  4Z4C A;  5CY4 A;  3WNG A;  3KLG A;  1ZBL A;  1SKW A;  4F4K A;  3NH0 A;  3DI6 A;  3S9H A;  3SV3 A;  1A5V A;  3CQ8 A;  3LWL A;  2G8I A;  5FRN A;  3DOL A;  3NFA A;  1C1B A;  1T03 A;  1RT6 A;  2E4L A;  3P5J A;  3SCX A;  1Q9X A;  4CEF A;  5D3G A;  4CF0 A;  4ZHR A;  3P1G A;  1J53 A;  1UA1 A;  1CLQ A;  4B08 A;  3AVN A;  4E7H A;  1JKH A;  1RTJ A;  1TGO A;  3L3U A;  4W5Q A;  4FCY A;  3QEI A;  4KHS A;  2YV0 X;  1W9H A;  1J54 A;  3HVT A;  2G8K A;  1RBV A;  1RDD A;  1Z25 A;  1VRT A;  4DS4 A;  3KD1 E;  4AHR A;  4CIE A;  1S1W A;  2I5J A;  4DQI A;  4CJK A;  4R5P A;  2DTU A;  3LAL A;  1L3S A;  4CF9 A;  3OJS A;  2PYJ A;  2Y1I A;  3T1A A;  1IKY A;  4CHO A;  3ZSY A;  1X9W A;  3C95 A;  4QAG A;  3HM9 A;  3HPO A;  2G8W A;  1S1X A;  3QNN A;  3RWU A;  3VQ9 A;  2HND A;  3AO1 A;  4AHS A;  4CJ5 A;  4DTN A;  4ID1 A;  3O3H A;  4JS4 A;  3U3Y A;  2RKI A;  1SKR A;  3SZ2 A;  3U3G A;  4DQP A;  4K8X A;  4DFK A;  1A5W A;  5CYM A;  1TV6 A;  1NKC A;  4DQQ A;  3AVJ A;  3NGY A;  4IBN A;  1U04 A;  2D5R A;  4M41 A;  5HRP A;  1SKS A;  4L8R B;  2KZZ A;  2E6L A;  3OYI A;  2EHG A;  4OGE A;  4CGJ A;  5KRS A;  3KLE A;  4DLG A;  3HP9 A;  4PY5 A;  4KRE A;  1SV5 A;  1IO2 A;  3MAQ A;  3QEW A;  3DRR A;  1B9F A;  1S9G A;  2R7Y A;  1TK5 A;  1L3T A;  4KFB A;  3ZSZ A;  3AVM A;  4EZ9 A;  3I0R A;  2A1S A;  2OPR A;  4BE2 A;  3SPZ A;  1WSG A;  4Z0U A;  4ELU A;  4ID5 A;  4Z4E A;  1A5X A;  1YVU A;  1ZBU A;  2XO7 A;  4E19 A;  2YNG A;  4CER A;  4DTJ A;  1JL1 A;  4GMJ B;  4DFP A;  4AHT A;  4CJT A;  2D0C A;  3OS0 A;  4CJ3 A;  2RN2 A;  4FLT A;  1JL2 A;  2YNF A;  3V6D A;  4DSL A;  4KAZ A;  4DQS A;  4N56 A;  3F9K A;  1NK5 A;  4LY7 A;  4CEB A;  4M3X A;  1EXQ A;  4C8N A;  4CF8 A;  3L2W A;  4B3O A;  2BDP A;  1C6V A;  4IG0 A;  4KHY A;  3PX6 A;  1QTM A;  1IH7 A;  1S5J A;  5DK5 A;  3KLH A;  3V9W A;  3K5N A;  2XY8 A;  1KSP A;  4N76 A;  3AA5 X;  4CJV A;  3JSM A;  1U47 A;  4C8M A;  2OYQ A;  4FLZ A;  1SL1 A;  1KLM A;  3OS1 A;  3PX0 A;  3VQA A;  1NK8 A;  1WSJ A;  4FVM A;  1NK4 A;  4HCB A;  3LDS A;  1WLJ A;  1JLF A;  3SI6 A;  1U4B A;  1WN7 A;  1WSE A;  1NKB A;  4AHV A;  1DTQ A;  1X1P A;  3TAE A;  4DTO A;  4KRF A;  3NF9 A;  1BHL A;  4I7F A;  3V9S A;  2F8S A;  4RG8 A;  3ZSW A;  3HT3 A;  3AO5 A;  1I39 A;  1IKX A;  4OKK A;  3V9Z A;  4CEA A;  4BAC A;  2FBT A;  4C8L A;  4FJ9 A;  1TAU A;  2P51 A;  1RT4 A;  1WAJ A;  1BGX T;  4CK3 A;  3OJU A;  3I0S A;  1RNH A;  3L2V A;  1ASU A;  4OLA A;  3PO5 A;  1VSL A;  2IS3 A;  3NH2 A;  4LD0 A;  4CIG A;  4DTR A;  4BDP A;  4BE0 A;  2EX3 A;  2VG5 A;  4CJ4 A;  3O4Q A;  3HPG A;  4OPJ A;  2HHW A;  4DU3 A;  2ZD1 A;  1VSJ A;  3ULD A;  3OYK A;  3TAB A;  3VQ8 A;  4CHZ A;  1KTQ A;  3RTV A;  4FJM A;  2VG6 A;  1NK6 A;  4PA1 A;  4CHP A;  4BE1 A;  2QKB A;  1JLA A;  3IG1 A;  3T19 A;  4N47 A;  4H4O A;  2Z1J A;  4YFU A;  1YTU A;  1QSL A;  4M45 A;  1B9D A;  5KTQ A;  3TAN A;  2F96 A;  3AA2 A;  1VK0 A;  3WNE A;  1HNI A;  1L3V A;  2ITG A;  4FJH A;  3C6U A;  2RPI A;  4O5B A;  3CFP A;  3ZT4 A;  3VN5 A;  4CJE A;  3L8B A;  4HUF A;  3FFI A;  4E7K A;  1TKD A;  3HXM A;  4B9M A;  2KTQ A;  2B6A A;  3ALY A;  5DMR A;  4JS5 A;  2W42 A;  4DLE A;  4EZ6 A;  3DMJ A;  4FJJ A;  1Q8I A;  3V9X A;  1T7P A;  4K8Z A;  2IOC A;  4OKE A;  2G8U A;  1NOY A;  1RT2 A;  3ISN C;  4FZZ A;  3TAR A;  4ELT A;  2D0B A;  3DLG A;  3DLB A;  4E3S A;  3WNF A;  2HW3 A;  4GVM A;  2F8T A;  4GW6 A;  4FK0 A;  2X74 A;  4B9U A;  3D0P A;  4E1N A;  3MXJ A;  5SZT A;  4DF8 A;  3ZSQ A;  2OPS A;  1CXU A;  2P1J A;  3PV8 A;  3VA3 A;  3BDP A;  4F8R A;  5FDL A;  3QO9 A;  4Y1C A;  4Z4H A;  3V1R A;  1ZYQ A;  3OYF A;  3V9U A;  3QEX A;  1C1A A;  5JS1 A;  1WSI A;  3DRS A;  3TAP A;  4B9S A;  3CM5 A;  3HK2 A;  3O3F A;  4CF1 A;  1EKE A;  1YTA A;  3D45 A;  5T7B A;  4PQU A;  4DTX A;  3IRX A;  3QES A;  3CG7 A;  4RW8 A;  3KKR A;  4RW7 A;  4DU4 A;  3SQ2 A;  3HVR A;  5I3U A;  1RT3 A;  2O4I A;  3ZSX A;  3L2Q A;  2G8V A;  2GUI A;  4RW4 A;  4FLV A;  4UQG A;  1GOB A;  3SUQ A;  4OLB A;  3O4N A;  3QEP A;  3AVH A;  4Y1D A;  1RIL A;  1S6P A;  1QHT A;  3AA4 A;  1T8E A;  1XHZ A;  4KHU A;  2D0A A;  4CEO A;  4FLY A;  1TAQ A;  1VSM A;  4OKJ A;  4BWJ A;  4CJP A;  2FBX A;  5J1E A;  2YKN A;  2OA8 A;  4CFB A;  4M3U A;  1HRH A;  4KHW A;  4Q0B A;  1U49 A;  2Z1H A;  3RMD A;  4W5N A;  1BQN A;  3RR7 A;  3AVK A;  3UIQ A;  4E89 A;  5HRS A;  3G0Z A;  2HHV A;  4DSF A;  4CEC A;  4CGF A;  3ZT2 A;  4LH5 A;  1JXE A;  3NGZ A;  2X6S A;  3V1Q A;  2JGU A;  3AO2 A;  4HUE A;  3HL8 A;  4PWD A;  1FXX A;  4H4M A;  4FJ7 A;  3V81 A;  1HYV A;  1UA0 A;  2Q3S A;  4CK2 A;  3K5O A;  3E01 A;  5I42 A;  3TAG A;  4J2D A;  4CGI A;  4KB0 A;  3IAY A;  1XWL A;  1FKO A;  3SYZ A;  2VWJ A;  3PO4 A;  1CXQ A;  1WNS A;  1YT3 A;  2KZM A;  3DYA A;  3K2P A;  3OYG A;  3K57 A;  1VSF A;  1RT7 A;  4FYD A;  1NJY A;  1ZBF A;  2PY5 A;  2RF2 A;  1EET A;  1NOZ A;  2B4J A;  3LZI A;  3SQ1 A;  1KRP A;  1QS4 A;  3F73 A;  1U45 A;  1JXB A;  1VSE A;  4DWI A;  4JRP A;  3RR8 A;  4M3Z A;  4BDY A;  1BL3 A;  5CZ2 A;  3LAN A;  5HRN A;  5J2Q A;  4DMN A;  1RTD A;  3LP0 A;  4Z4F A;  4AHU A;  1FK9 A;  4KI4 A;  1LAV A;  2IAJ A;  3ITH A;  3TWH A;  3SQ0 A;  3OYE A;  1QSS A;  1GOC A;  3KLF A;  1SL0 A;  4CFD A;  4CJR A;  3SJJ A;  4QOZ B;  2OPQ A;  1JLG A;  3BGR A;  2GBZ A;  4RW6 A;  3NGI A;  3OYN A;  4I2P A;  4CGG A;  4W5O A;  1LW0 A;  2BGG A;  2HHT A;  3TAQ A;  3KD5 E;  1F21 A;  4IDK A;  1U48 A;  1D8Y A;  3EZ5 A;  3KK2 A;  3OYH A;  1LV5 A;  3L2R A;  1BIU A;  1XHX A;  3H08 A;  3HJF A;  4PUO A;  4WE1 A;  5C25 A;  1BI4 A;  5FRO A;  1VSI A;  1G15 A;  4O0J A;  2OPP A;  2HNY A;  4KTQ A;  2QXF A;  2OZM A;  1HPZ A;  1JLC A;  1RBU A;  1TVR A;  3DLE A;  3DLK A;  3TAF A;  2ATQ A;  2FC0 A;  3SPY A;  3ZT3 A;  4W5R A;  4RW9 A;  1UAX A;  4DTS A;  2KFZ A;  3PY8 A;  3LP1 A;  4CJQ A;  3U6F A;  3TI0 A;  1TL1 A;  1L5U A;  4DSJ A;  1C0T A;  1QSY A;  3VQ5 A;  3AVB A;  4DF4 A;  1HQE A;  4KTZ A;  3PX4 A;  3JYT A;  3OVN A;  4MQ3 A;  4KV8 A;  3KK3 A;  3VQP A;  1ITG A;  2DFH A;  4HCC A;  2G8F A;  4FXD A;  5E41 A;  1KLN A;  3C6T A;  2WON A;  2HB5 A;  4FJI A;  2LSN A;  3DLR A;  3ZT1 A;  3OYL A;  4Z4I A;  1NJZ A;  3B6O A;  1S1U A;  2VG7 A;  1JLQ A;  3QEV A;  5HLF A;  4NCB A;  1XI1 A;  2YNI A;  1N5Y A;  5EU7 A;  3AVI A;  5HBM A;  1BQM A;  4KPY A;  3QIP A;  4DSK A;  4FM1 A;  1S1T A;  2BE2 A;  3NBP A;  4CFA A;  1L3U A;  2WOM A;  4M3W A;  4FLW A;  1KVB A;  3A2F A;  3LAM A;  4DG1 A;  1NJW A;  3ASM A;  4CHN A;  3MXI A;  4CES A;  3NF7 A;  1CZB A;  2JLE A;  1K6Y A;  4B8A B;  2FBV A;  4C8O A;  4FJ5 A;  1S9E A;  1D5A A;  5KGW A;  4DTP A;  4B9N A;  2YKM A;  3KK1 A;  2YHA A;  4CJL A;  4Q5V A;  5HRR A;  3OYB A;  4LH4 A;  4EP4 A;  3VQQ A;  1J9A A;  1N6Q A;  2P5G A;  4FK4 A;  4CJS A;  4FZX C;  3K5M A;  4CGD A;  3AVF A;  4NYF A;  4J2A A;  3NAE A;  1ZBH A;  3M8P A;  4F3O A;  5KI6 A;  3L2U A;  1RT1 A;  4ZTF A;  1KVA A;  3VQ4 A;  5J2P A;  1ASW A;  4FW1 A;  3OYA A;  1IG9 A;  2IC3 A;  4B9L A;  2DY4 A;  1KFD A;  1RTH A;  2NUB A;  1NKE A;  1C0M A;  4DSI A;  1S6Q A;  1NK0 A;  3DM2 A;  1MU2 A;  3ZSR A;  2HHQ A;  3MEC A;  3LWM A;  1HQU A;  1FKP A;  4DSE A;  3LZJ A;  4AIL C;  1UWB A;  3VQ6 A;  1WSH A;  3HST B;  4FJG A;  4FM2 A;  3SUO A;  1Z26 A;  4FLX A;  1KCF A;  3MED A;  4CEE A;  1R0A A;  4E7L A;  3QNO A;  3S3O A;  4ZTJ A;  4H8K A;  1ASV A;  1RDC A;  2HHX A;  4G1Q A;  3QLH A;  3VA0 A;  2XY6 A;  1CZ9 A;  3G10 A;  3VQB A;  1TKZ A;  4BWM A;  4LSL A;  1DLO A;  5SWM A;  1NJX A;  1IKV A;  3AVG A;  3WNH A;  1TK0 A;  3MEE A;  2HHS A;  2XRI A;  1W0H A;  3NF8 A;  1GOA A;  3EYZ A;  4DTM A;  3QER A;  1TKX A;  4M3Y A;  4OVL A;  2YHB A;  1WSF A;  3HPH A;  3OS2 A;  3LAK A;  4NYN A;  3VQE A;  4CHQ A;  3NE6 A;  4JRQ A;  3RRH A;  4KTW A;  3VQ7 A;  3DRP A;  4CED A;  4CJU A;  3RRG A;  3S3M A;  1IKW A;  1RT5 A;  5KGX A;  3QIO A;  3AO4 A;  3V4I A;  3AA3 A;  4O4G A;  3OYD A;  3KKS A;  3B6P A;  2O4G A;  4IFY A;  1REV A;  4EP5 A;  3NDK A;  4FW2 A;  4B8C A;  4B9V A;  1XC9 A;  4J2E A;  4FJN A;  2Y1J A;  3RMA A;  4N5S A;  4E7I A;  3T3F A;  2YNH A;  4CEQ A;  1VSK A;  2XY5 A;  4M3T A;  1QQC A;  1BIZ A;  5J2N A;  3CYM A;  2X78 A;  3LP2 A;  3HYF A;  1VSH A;  1BIS A;  1QE1 A;  4NCA A;  1RCH A;  2DFE A;  1HMV A;  1HNV A;  4FZY A;  4FM0 A;  1RDB A;  2E6M A;  1NK7 A;  1LW2 A;  4CE9 A;  1TK8 A;  2G8H A;  5CYQ A;  3KIO A;  3SQ4 A;  4QCL A;  4CJW A;  1BCM A;  1VRU A;  4HHT A;  4HUG A;  4O44 A;  2ETJ A;  1C1C A;  2HNZ A;  4CGH A;  4FLU A;  2Z1G A;  3DLH A;  3ZSV A;  5KRT A;  4DS5 A;  2Z1I A;  3PUF A;  5C42 A;  3CM6 A;  1Y97 A;  2GV9 A;  1SL2 A;  4I9L A;  2IGI A;  4E0D A;  3QET A;  1SUQ A;  3MXM A;  4FJX A;  1I3A A;  4IKF A;  1O1W A;  3ZSO A;  4AHC A;  3LP3 A;  3L3V A;  4ICL A;  3K58 A;  4CJF A;  1BCO A;  3V1O A;  1EX4 A;  3AV9 A;  3KLI A;  3AO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...