1RDDA

Crystal structure of escherichia coli rnase hi in complex with mg2+ at 2.8 angstroms resolution: proof for a single mg2+ site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli RNase HI in complex with Mg2+ at 2.8 A resolution: proof for a single Mg(2+)-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 37
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rddA00
1WSGA 3LWMA 3QINA 1L3TA 2Z1IA 4CHQA 5CZ1A 3AVLA 3M8RA 4OKKA 2KZMA 3VQQA 1KCFA 4JS4A 1BQMA 2VG5A 4H4OA 1TV6A 1NKEA 3HYFA 4CJ4A 3NH2A 2RKIA 2P5GA 4KI4A 1SKRA 3AO4A 4CFDA 4M45A 3VQBA 1YT3A 2EHGA 4Y1DA 3SCXA 1Q9YA 3OYFA 1CZBA 3OY9A 5HRNA 4LD0A 3AVCA 4CEQA 1JXBA 4O4GA 3SI6A 1T03A 1DTQA 3ULDA 4DU1A 4B9TA 3MECA 1RT5A 4DTPA 1ASVA 2ZD1A 3CM5A 2HHVA 1ITGA 2FBVA 3DRSA 3VQ5A 4IG3A 3KLEA 3V9WA 1EETA 4CGFA 4DTXA 3SUQA 1NK7A 3RMBA 2DFEA 4GMJB 3QEIA 2HMIA 2IS3A 1VSHA 3LP0A 2DFFA 1ASUA 4DQRA 1X9MA 3LALA 4F8RA 1N6QA 1G15A 1WLJA 3TAGA 3AO3A 3LAMA 1VSLA 3P1GA 3AVAA 4KI6A 1HNVA 3L2VA 1KLMA 4FJNA 1XHZA 4CIGA 2HHTA 4DFPA 4M42A 1SL0A 4FJMA 2BDPA 2Z1GA 3ZSWA 4CHOA 1S1TA 4G1QA 4Z4HA 5HLFA 5DK5A 4IFYA 3S9HA 2KZZA 3HO1A 1FKOA 2BE2A 5JS1A 3HSTB 4CGGA 3HK2A 3C6UA 3L2WA 2ETJA 1U47A 1J54A 2AJQA 4W5NA 3ZSOA 4HHTA 3P5JA 4O0IA 1S5JA 5CZ2A 4KPYA 2B6AA 1XI1A 4KREA 3NHGA 2DTUA 1NK6A 3I8DA 4ID1A 3QO9A 1TK0A 4J2BA 3KLGA 2OZSA 1LWCA 4ICLA 3NDKA 4N56A 4R5PA 2OPPA 2OPSA 3NF8A 5SZTA 3AA3A 3PY8A 5J2PA 3AVMA 4RW9A 2VG7A 3OYCA 5CY4A 1J5OA 2X78A 3QERA 1LW2A 4E7LA 3QEXA 2G8FA 1RBTA 4CHYA 1C1BA 3V6DA 4PQUA 2KW4A 1UA0A 3LPUA 1JL1A 1TK5A 4IG0A 1WSJA 3LAKA 2E6MA 2YNFA 5E41A 3SJJA 4DSLA 3QETA 1KFDA 4KHNA 3CYMA 3K2PA 3NBPA 4CHPA 1WAJA 3K5MA 1VSMA 1RDBA 4QAGA 3IAYA 2IDOA 3V1RA 5C42A 2DFHA 3AVBA 3DLGA 3KTQA 2XRIA 1ASWA 1RBSA 3DRRA 4OPKA 4KTWA 4O44A 4AH9A 4CF9A 3SUNA 1YTUA 1B92A 4DF4A 4HCBA 1X9SA 1QS4A 3VQPA 4F3OA 2Z1HA 3WNFA 4K8XA 2Y1JA 3OYGA 4NCGA 3LZJA 3TAQA 2LSNA 4CJQA 2X74A 4ID5A 2OYQA 3C94A 3DOLA 1VSKA 3AVHA 3DLKA 1IO2A 1RTHA 3KKSA 3RR7A 1QQCA 2HNZA 1Z25A 3M8PA 3KLFA 2YV0X 3LDSA 4J2DA 1HJRA 3LP1A 1NK4A 1KSPA 3SV3A 4CGIA 4BE1A 1FXXA 4B9SA 5J2QA 1RTDA 1RT3A 2OZMA 1JLQA 3KKRA 3AVFA 3O4NA 4EZ6A 1REVA 2B5JA 4I7FA 4DS4A 3HL8A 4I2QA 4E19A 4FVMA 3RMAA 4CIEA 2WONA 4CF0A 1RDCA 4OLAA 3OS2A 5J1EA 1LW0A 4TSXA 4OKEA 2G8KA 3UIQA 4FLWA 3DRPA 1NKBA 4CGJA 3AVIA 3AVJA 4CK3A 1HYVA 4Z4CA 2JLEA 4OVLA 1RT2A 3NGIA 1S9GA 3T3FA 2G8HA 4DSIA 1HQUA 3KK3A 3QESA 3NGYA 4Z4IA 4N76A 3WNHA 3ZSYA 4CJFA 4YNQA 4FK0A 4FJ7A 4OGEA 1C1AA 3JSMA 4F3TA 1WNSA 2D0BA 3OYBA 3LZIA 5I42A 2X6SA 2XO7A 4KRFA 3ZT1A 2FBXA 3QLHA 3LPTA 2XHBA 3DLRA 1N5YA 1NK8A 1A5XA 2XY6A 4M3UA 3PX6A 4DTOA 1O1WA 3JYTA 3QEVA 3U3YA 4E7JA 3BGRA 3S3MA 4FJ8A 1ZBIA 4DSKA 3V9UA 5C24A 2E4LA 1RBRA 1BI4B 3HXMA 3ZSRA 5KGXA 3AA2A 4CHZA 3KD1E 3ASMA 1NK5A 3VQCA 1FKPA 3ZT2A 1EXQA 1CLQA 1VSIA 3QEPA 1T8EA 1JL2A 1JLGA 3VQDA 3OJSA 3PX4A 3SV4A 1U49A 4HUGA 5EU7A 4DSJA 4FZZA 3V4IA 4XIUA 4DWIA 1BIUA 3AA4A 3CFRA 4BE0A 1S9EA 4E7HA 4DTUA 1A5WA 1ZBFA 4KO0A 4N47A 2IGIA 4E3SA 4FLZA 4KHYA 3HVTA 5FRMA 1BIZA 1VSJA 2Z1JA 4O0JA 2YKNA 2OPQA 3ZT3A 3VQEA 3L2QA 4RW8A 2Y1IA 3ZSVA 4CK1A 3SQ2A 4CEOA 1KLNA 3TARA 1WSHA 4DFKA 3OYMA 4C8LA 3D0PA 4FLUA 2A1SA 1ZBHA 4LY7A 1D9DA 4M3WA 4CECA 1S1UA 2JGUA 2FBTA 1LWFA 4FLXA 3K5LA 4AHRA 3U3GA 3OYAA 4FM2A 2HHSA 4KHWA 3SUPA 3PV8A 3MXIA 3L2UA 3PX0A 4PWDA 1IKXA 1Y97A 3LWLA 4CF2A 3AA5X 4H8KA 4CJTA 2HB5A 4CGDA 1NKCA 4M3ZA 3VA3A 3KJVA 3SQ1A 1CXUA 2IC3A 1HYZA 4AHTA 4RW7A 3TWHA 4FM0A 3NAEA 2HNYA 1SKSA 2OPRA 2KQ2A 3OYLA 4AILC 1SL2A 3V1QA 3VQ7A 2QK9A 4FLTA 4W5RA 4O5BA 3DLBA 4F4KA 5KRTA 4FZYA 3BDPA 1CXQA 3VQ4A 4H4MA 2KTQA 4NYNA 1TVRA 1W9HA 1NJWA 4F2RA 4CJKA 3KK1A 1S6QA 3DMJA 5HP1A 3OS1A 3OJUA 3DI6A 4DTJA 4K8ZA 1YVUA 1R0AA 2RF2A 3V1OA 2PYJA 3PO5A 1K6YA 3EYZA 4JS5A 1VRTA 3V9ZA 3F9KA 3QEWA 3SPZA 2XY8A 4GVMA 2F8SA 3SQ4A 3LP3A 4M3RA 1HPZA 3PUFA 1W0HA 2PYLA 1NK0A 2G8WA 3KD5E 4DF8A 3NGZA 1XHXA 1HMVA 3OYIA 3RWUA 3SUOA 2IOCA 3ALYA 2QXFA 3TAPA 2RPIA 3FFIA 4OLBA 3G10A 3RMDA 3F73A 1KTQA 4MFBA 4CJWA 3SYZA 1NOYA 4CJLA 4ELUA 4FW2A 4NCAA 2HW3A 4LSLA 2ATQA 4CJVA 3RRHA 3OYEA 2FC0A 3O3FA 1WSEA 1U48A 3SZ2A 4DQIA 4DTMA 1JLFA 1T7PA 1KFSA 1JLEA 1BI4A 3O4QA 4DTRA 3SQ0A 4ELVA 3IG1A 3LANA 4N5SA 1VSFA 2YNGA 3RMCA 3NF7A 2ZQBA 4CGHA 3AO1A 3O3GA 4FJJA 3DM2A 4CERA 3C6TA 2YKMA 1U04A 3AVKA 3SNNA 4ELTA 4LSNA 4KB0A 1TGOA 1IKYA 1S6PA 2VWKA 2D0CA 2ITGA 1TAUA 4CEAA 4C8MA 3NE6A 3RRGA 3KIOA 4HUFA 3NH0A 2HHQA 3NCIA 4CEFA 4OJRA 3NF9A 2WOMA 1NJYA 2QKKA 5KTQA 3AO2A 2KFZA 4AHVA 4KHSA 4Q0BA 4PA1A 3V9XA 2YHBA 4CJ5A 1JLBA 4IDKA 5FROA 3WNEA 3SPYA 4BDPA 3C95A 1SUQA 4B9LA 1BQNA 4EZ9A 3ZT0A 1TKDA 4DU3A 1BL3A 1UWBA 2F96A 3K59A 4C8OA 5CYQA 1TKTA 2X6NA 3LP2A 1LAVA 2W42A 4HUEA 1NJXA 1QTMA 1QSSA 4CK2A 3P83D 4IFVA 1VRUA 4I9QA 1VSEA 4DTSA 3RTVA 1C0TA 3IRXA 3VQ9A 5HRSA 5HRPA 4KFBA 4C8NA 4RW6A 3CFPA 2FBYA 4BDYA 4GW6A 5C25A 5HROA 1L3UA 1JLCA 4C8KA 4CFBA 2G8VA 4B3OA 1VSDA 4MQ3A 1L3VA 4DFMA 1D8YA 3OYJA 3HP9A 4B9UA 4DQSA 3EZ5A 4PUOA 3HT3A 2QKBA 3K5OA 1QE1A 1GOCA 3L3VA 2R7YA 1J53A 3HPOA 3QNOA 1Q8IA 1SKWA 4FJLA 3B6PA 4F2SA 3CFOA 4KV8A 1DTTA 4BE2A 1ZBUA 2ZE2A 3CQ8A 1NJZA 4FZXC 3ZT4A 1F21A 4AHSA 4FJXA 3HPGA 4KTQA 1UAXA 4UQGA 2G8IA 4FM1A 2XY7A 3E01A 1RNHA 2IAJA 4CEBA 2YNIA 4FJIA 1RDDA 1WSFA 4M3TA 2HVHA 4CJPA 1L3SA 4KKOA 4BACA 4DLGA 1RTIA 4BWMA 3U6FA 4ZTFA 4DTNA 4BDZA 4FJKA 4E7KA 4M41A 3I0RA 2XY5A 1WN7A 2NUBA 1XC9A 4J2AA 3KK2A 4DU4A 4B9MA 1Z26A 1GOAA 4CEZA 2A1RA 4FJ9A 1A5VA 3HVRA 1I3AA 5J2NA 1J9AA 5J2MA 5I3UA 2BANA 4CEDA 3K5NA 1TK8A 4E7IA 1C6VA 3A2FA 1RBUA 1LAWA 1U45A 2DY4A 1JLAA 1JXEA 4Z4EA 4Z0UA 2Q3SA 3VQ6A 4EP4A 1WSIA 2P51A 1BHLA 1UOCA 3WNGA 5HBMA 3IS9A 4CCHA 1T05A 2HHXA 4W5QA 1TKZA 4CIFA 3NFAA 3OYDA 3MXJA 1RBVA 4CJRA 4CJ3A 4BWJA 4DQPA 1X1PA 2D5RA 4E89A 2D0AA 4CE9A 4KHQA 2OA8A 1TL1A 4JRPA 3DYAA 1RT1A 4Z4FA 4CJSA 1S1XA 4HVJA 4JRQA 3TAFA 2YNHA 5K14A 3MXMA 3NF6A 4ZTJA 1D9FA 4HCCA 1X9WA 4QOZB 4NCBA 4LH5A 4M3YA 1Q9XA 1C0UA 4FCYA 1C0MA 4CFAA 5JS2A 3M8SA 3VA0A 3S3OA 1LV5A 4DS5A 2B4JA 4CESA 1IG9A 1ZBLA 3AV9A 1BISA 1D5AA 1WAFA 5DMRA 5FDLA 2VWJA 3THVA 1ZYQA 2KFNA 2I5JA 4FW1A 5CYMA 1B9FA 3S3NA 3ZCMA 3ZSXA 3MEDA 1CZ9A 5KRSA 2P5OA 1YTAA 4KTZA 3QIPA 1SL1A 3L3UA 4DFJA 4KB1A 3MEGA 4DLEA 4L8RB 4EP5A 4OGCA 3I0SA 4FYDA 3OYKA 5FRNA 3AVNA 2HHUA 1RT7A 3B6OA 3G0ZA 1EKEA 4NYFA 1C1CA 4DSFA 5T7BA 1TKXA 3NH1A 1IKVA 3L2RA 2P1JA 3TANA 1TL3A 1L5UA 2PZSA 3HPHA 1QSYA 1VK0A 1NOZA 1I39A 2RN2A 4PY5A 4FK2A 1MU2A 1RILA 2VG6A 4B8AB 3HM9A 3TAEA 4LH4A 5HRRA 4FJ5A 1TAQA 2EX3A 3AVGA 4QCLA 1DLOA 4N41A 1EX4A 5KI6A 4CEEA 1BCOA 4CF1A 3OYHA 4FXDA 1HRHA 1EP4A 4DMNA 4IKFA 4ZHRA 4DQQA 3DLEA 4B08A 1KRPA 4I2PA 4KAZA 3ISNC 4OPJA 1HQEA 4DG1A 1B9DA 1KVCA 1BCMA 1SV5A 2YHAA 4RW4A 3PO4A 3DOKA 3T19A 4B8CA 1HNIA 4Q5VA 1QSLA 4B9NA 4JLHA 4CHNA 3KLIA 4CFCA 4WE1A 4CJEA 4OKJA 4W5OA 4FLVA 2PY5A 3RR8A 4E1NA 4FJGA 4FJHA 3M8QA 4CF8A 3K58A 1RTJA 2O4IA 3QIOA 4I9LA 4AHUA 3DLHA 4B9VA 1UA1A 4J2EA 4W5TA 1RT6A 3VQAA 1RDAA 2HHWA 3OYNA 5D3GA 3AO5A 4RG8A 2F8TA 1RCHA 1GOBA 3H08A 1U4BA 2O4GA 2G8UA 3L8BA 1RT4A 1IKWA 3ITHA 3CG7A 1S1WA 4CJUA 3T1AA 3V9SA 1NK9A 3EY1A 3MEEA 1QHTA 1KVAA 1HYSA 2GUIA 4IBNA 3TR8A 3TI0A 3OS0A 3ZSQA 3HP6A 3OVNA 3HJFA 3VN5A 4HTUA 3CM6A 4KHUA 1LWEA 1IH7A 4Y1CA 3V81A 2GBZA 1BGXT 1JKHA 5KGWA 3K57A 4E0DA 3ZSZA 1KVBA 1S1VA 5SWMA 3TAMA 4AHCA 4YFUA 3O3HA 3MAQA 4DSEA 4O55A 4M3XA 3VQ8A 1XWLA 3KLHA 4FK4A 2HNDA 2E6LA 2HVIA 4Z4GA 4E1MA 1FK9A 2GV9A 3QNNA 2BGGA 3TABA 3D45A 4FLYA
chains in the Genus database with same CATH superfamily
2V52B 1WSGA 1Y64A 1FW6A 2VWBA 5LMUK 4H0PA 2ZM6K 4JS4A 3SLCA 3NH2A 4KI4A 1SKRA 3AO4A 3A5NC 1HLUA 5TKYA 3OYFA 5F1XA 3LDQA 4CEQA 1WB9A 1DTQA 1NGBA 3VERA 5KQ8A 1ASVA 4DUYK 4DTPA 5C0YA 2HHVA 2FBVA 1K73O 3ID6A 2HMIA 3RMBA 4GMJB 3QEIA 4BR4A 3WXLA 2J4RA 1ASUA 1IG8A 3MWPA 3HSCA 3HTVA 3TAGA 5GINA 3A0IX 3P1GA 1K9MO 3L2VA 4CIGA 2BDPA 5E84A 4CHOA 4YOYA 4G1QA 4IFYA 1QQNA 1ATNA 3Q7CA 3L2WA 2ETJA 1U2VB 3ZSOA 2IVNA 4O0IA 3BF3A 1GLBG 4FO0A 1XI1A 4KREA 1NK6A 5HL7L 2FF3B 3WXIA 3QO9A 1TK0A 4BR7A 1LWCA 4M7YA 3MWTA 2O8FA 5EY4A 4F9OA 1VQNN 5AQRA 2X78A 4KH6A 5KPZA 3D6RA 4E7LA 2UYTA 1RBTA 1C1BA 4MLEA 4FVUA 2KW4A 3LPUA 1JL1A 1U2VA 2HMPA 4IG0A 4L3QA 1W2BM 3R6MA 3SJJA 4DSLA 3QETA 1KFDA 3K2PA 4CHPA 1ATRA 2NRZA 2VQEK 2XRIA 3IDHA 4OPKA 4AH9A 3CIPA 3U8XA 3T7ZA 1X9SA 1XMOK 3WNFA 1X3MA 3OYGA 3TAQA 4ID5A 4JYAK 3KKSA 3G6EN 3BF1A 1QQCA 2HNZA 3VGKA 3MMVA 4FWPA 5F2RA 3LP1A 1KSPA 4IEIA 4KBOA 4QS7A 2O8DB 4K0KK 4H5VA 5BR8K 5I9EB 4X65K 4B9QA 3PLAA 1LW0A 2G8KA 2WUSA 3THYA 4CGJA 1VQ6N 5LL6Z 1HYVA 3QFPA 4OVLA 1RT2A 4DSIA 3PSFA 4WF9L 4Z4IA 4JI8K 3ZX0A 4CJFA 4YNQA 4FJ7A 1H1VA 5KPRA 1WNSA 5I42A 3DXMA 3TTFA 2XO7A 4KRFA 3C7NA 1XNQK 3QLHA 3DLRA 1A5XA 4PHTX 4M3UA 3S3MA 3BGRA 3E66A 4DSKA 5KGXA 3H3NO 3ULEA 1NK5A 4RCHA 2QEXN 1FKPA 3ZT2A 2HBLA 1T8EA 3VQDA 2QWQA 3OJSA 3CC7N 1OH7A 4DV0K 4X62K 3V4IA 3U9ZA 5LJWA 1BIUA 3CFRA 4DWIA 1KXPA 4LFBK 4A59A 3M5RA 5M1FA 3M6GA 2YKNA 2OPQA 4CK1A 3VEWA 4CEOA 3O1BA 2FSKA 3D0PA 4PKIA 4HTLA 1K8KA 1S1UA 5ADXH 2GWKA 4AHRA 3L2UA 3AY9A 2F9WA 1NM1A 4H8KA 4CJTA 1NKCA 5AJ3K 1VQ7N 3NAEA 3S41A 4IZ9A 3CJ9A 3SJHA 1YIJN 2QK9A 4FLTA 1Z05A 5KRTA 3T69A 4F2RA 4CJKA 2P9SB 3BZCA 1S6QA 3FE1A 3DI6A 3VEXA 4DTJA 4K8ZA 3PO5A 2PYJA 2QWNA 3EYZA 2E2NA 3V9ZA 3LP3A 3VGLA 4M3RA 1HPZA 5EXWA 4CZKA 1XHXA 4B1UB 5F0XA 2IOCA 3CMEN 4OLBA 3F73A 1NOYA 5AFUH 3SYZA 4CJLA 4NCAA 2ATQA 4CJVA 3M1FA 4A61A 1HX1A 2ZGZA 1T7PA 1KFSA 1NMDA 3IG1A 3KWGA 3CCRN 3H46O 2FLOA 3O3GA 5ADXA 3CHWA 3E9PA 3C6TA 2RE2A 3AVKA 4WCEL 3SNNA 3WXJA 3MX2A 2VWKA 2D0CA 1T3VA 2W6KA 4C8MA 5AFUA 2W40A 3NCIA 4CEFA 3AO2A 4PA1A 4NLBA 3V9XA 2YHBA 1JLBA 4IDKA 4BDPA 3GE1A 1SUQA 4EZ9A 3SBGA 4DU3A 2NRRA 4C8OA 2X6NA 1QSSA 1QTMA 3TTCA 4CK2A 3P83D 1VRUA 3CERA 3C0BA 3CFPA 4BDYA 1K8KB 4GW6A 3CC2N 4C8KA 2QTDA 3OYJA 4PUOA 3HT3A 1GOCA 1BDGA 1SKWA 3CFOA 3SBTA 2ZE2A 3CQ8A 5A2QO 4AHSA 3HPGA 5HOOA 4KTQA 1UAXA 3DXKA 4UQGA 2G8IA 1RNHA 2A42A 4CEBA 4CZGA 4BACA 1RTIA 4ZTFA 4BDZA 3ULEB 4CZIA 4M41A 1XC9A 4Z94A 4DU4A 4B9MA 3CQYA 5B8HA 1J9AA 4WFBL 5I3UA 1T6CA 4E7IA 2HF3A 4LC9B 1RBUA 3DXMB 4B1ZA 1JXEA 5ELZA 4YHHK 4JV5K 4FOEA 4DHYA 3WNGA 3IS9A 1R59O 5GADP 2NRTA 5M1OA 4CIFA 3NFAA 1RBVA 4CJRA 2V51B 1NGJA 4JNEA 1X1PA 4E89A 4CZEA 2V7YA 1TL1A 3DYAA 1T6DA 1HUXA 4NCBA 4DCHA 1Q9XA 1C0UA 1SS6A 5JS2A 3VA0A 1IG9A 3AV9A 4JI4K 1ATSA 4GKKK 1B9FA 3MEDA 4DR2K 1YTAA 4KTZA 3AAQA 3MEGA 1EQYA 1BO5O 4OGCA 2NRWA 3I0SA 5AQJA 4AM6A 4PL7A 5AQTA 2NZTA 1BA0A 1TKXA 3NH1A 2P1JA 5CR4A 1X3NA 1QSYA 1NOZA 3O08A 5FPDA 1I39A 4DR5K 3JS6A 3CPWM 4DV2K 1S72N 3HM9A 1VQMN 4DR4K 1NGDA 1DLOA 1EX4A 5M1KA 4IKFA 4B08A 3MN6A 4OPJA 1BG3A 1B9DA 3DJCA 1KVCA 1BCMA 4RW4A 3TSUA 4YORA 4CHNA 4MDBA 4FWOA 4WE1A 2ZWHA 4OKJA 3T1YK 3A5LC 4E1NA 4FJHA 4H5TA 5AZIA 3K58A 2QA4N 1RTJA 4DR6K 4WFNL 3DLHA 4JKCA 4W5TA 2HF4A 1RDAA 4BY9C 4I6MB 3OYNA 5D3GA 1RCHA 1GOBA 1IKWA 3CG7A 1S1WA 3WQTA 3V9SA 4NLCA 1QHTA 1KVAA 2E2OA 2P9SA 1T44A 3OVNA 2WBNA 3K57A 3ZSZA 5C2DA 1S1VA 3TAMA 1HR0K 1XWLA 2HNDA 2KHOA 2E6LA 4E1MA 2JWKA 4IO9L 5DM6L 5CHIA 2BGGA 4BRCA 4FLYA 3MCAB 1Q7YO 2V7ZA 1L3TA 4CHQA 3AVLA 3M8RA 1S22A 3E9LA 1VQKN 1NKEA 1BQMA 1TV6A 4CJ4A 3GDQA 4CFDA 5KPTA 3VQBA 4B1YB 3EL2A 2AP1A 2EHGA 4Y1DA 1GLFO 3IMXA 3FLCO 3AVCA 4LD0A 4O4GA 3VEVA 4B9TA 3MECA 1RT5A 4BR9A 4GV6A 1ITGA 4J8FA 4H0VB 1QZ5A 1J5EK 1NK7A 4CGFA 4B1VA 4DTXA 3SUQA 4BR2A 2P9PB 1VSHA 4DQRA 4F8RA 3QBWA 1N6QA 1G15A 3AO3A 1VSLA 4KI6A 1HNVA 1YVNA 2IIRA 2HHTA 2WTUA 1SL0A 4DV3K 3O5BA 3ZSWA 4Z4HA 5DK5A 2KZZA 2P9KB 2YHYA 2BE2A 5JS1A 3AAPA 4CGGA 4GV3A 2AJQA 3C7NB 4A57A 4H0YB 1S5JA 5CZ2A 2B6AA 3HI0A 2DTUA 4GV9A 1GLLO 4J2BA 3KLGA 4ICLA 4N56A 2UUCK 3PY8A 2OPSA 3SAHA 2VG7A 3QERA 3WT0A 3VEZA 2G8FA 4NXNK 4CHYA 3V6DA 2F9TA 5C12A 1UA0A 5DM7L 3C65A 3EEQA 3EO3A 3D7EO 3IAYA 2IDOA 3ZLJA 2CGKA 4R79A 2O8EB 3DLGA 4CBXA 1ASWA 1YTUA 4CF9A 2PFUA 1SAZA 4HCBA 2GUPA 4F3OA 2Z1HA 2FXUA 1GLCG 4CJQA 3HBTA 2X74A 3LDLA 3C94A 3UKUA 1VSKA 3AVHA 3DLKA 1IO2A 4BRGA 1BUPA 3L4IA 4J2DA 3QMLA 4CGIA 1V4SA 5M1PA 2QWOA 4PL8A 2GELA 1RT3A 2OZMA 3MK6A 4EZ6A 2YX6A 4I7FA 2VGMA 5BR9A 4A62A 4FVMA 1SZ2A 2WONA 1EO1A 3OTOK 5AQYA 3P4IA 2D0OA 5AQOA 3NGIA 2A5XA 2PBDA 3KK3A 3QESA 2E5LK 2O8CB 1NGHA 1OH6A 4XH1A 2UU9K 3MN5A 3WUHA 3FGUA 4HWIA 2PAVA 3OYBA 2FBXA 2XHBA 1N5YA 4IEEA 4FJ8A 4DTOA 5C24A 2E4LA 4E1JA 5JICA 5C10A 4CHZA 4BROA 3ASMA 1EXQA 1CLQA 1JL2A 3GG4A 4IJNA 4DV4K 4HUGA 1GLAG 4DSJA 4NO7A 4A2BA 4XIUA 1EWQA 3AA4A 4BE0A 1S9EA 4DTUA 1A5WA 1ZBFA 4KO0A 3O9SA 4KHYA 4O0JA 5M1NA 3L2QA 3VQEA 2P9IB 1N8RO 1KLNA 3TARA 1NU0A 3OYMA 2A1SA 1YHQN 1ZBHA 4BQLA 2VGNA 2JGUA 1LWFA 4FLXA 3U3GA 3OYAA 1NGCA 3SUPA 3VTHA 1IV0A 1ESVA 2BUPA 3LWLA 3AA5X 2HB5A 3J80O 1YJ9N 3VA3A 3KJVA 3B8AX 1QVFM 1SKSA 3OYLA 3O9RA 3AARA 3V1QA 3VQ7A 3DLBA 3BDPA 3VQ4A 4UY8O 4NYNA 1NJWA 1W9HA 1ZXOA 4AM7A 3HOSA 3LM2A 1R0AA 2RF2A 3K9KA 4KH5A 4LF8K 1K6YA 3L6QA 4MLHA 3J81O 3QICA 4GVMA 3O9TA 4K25A 3R1XA 2PYLA 1NK0A 2G8WA 1VQPN 1HNXK 3KD5E 3NGZA 3SUOA 3ALYA 3TAPA 4B3MK 2RPIA 3G10A 4FOIA 3RMDA 4ELUA 4MFBA 3FZMA 4FW2A 4WQ4A 3OYEA 3O3FA 4YY3K 3SZ2A 4DQIA 1E4GT 1BI4A 1JLEA 2P9LA 3LANA 4N5SA 4LF9K 2ZQBA 3AO1A 4B1XB 4JK8A 4KB0A 3KVGA 3N4PA 3NH0A 4OJRA 3NF9A 2WOMA 4LF6K 2QKKA 4Q0BA 4CJ5A 5FROA 3SPYA 2Q0RA 1KC8O 1QVGM 4B9LA 1YITN 3U4LA 3ZT0A 2VCPA 1TKTA 1NJXA 1LAVA 4LF4K 4FZZA 4I9QA 3KZBA 2F7TA 1QQMA 4PKGA 3RTVA 5HRPA 2UUAK 4C8NA 1L3UA 2FBYA 5HROA 3A8YA 4CFBA 4M63C 1VSDA 4FWMA 4MQ3A 5EOYA 4CBWA 2QKBA 3K5OA 1KAZA 3VF6A 2O8BA 4JD2B 4JKFA 2Q0UA 3QNOA 4FJLA 3BY5A 4F2SA 4KV8A 4FZXC 1F21A 2VQFK 2W6LA 1NGFA 3E01A 2IAJA 2GX9A 2YNIA 4FJIA 4M3TA 4H0XB 4CJPA 4DLGA 3U6FA 1KD1O 4E7KA 1WN7A 3VENA 1Z26A 1GOAA 4CEZA 2A1RA 4FJ9A 3PIPL 3ZYYX 3UE5A 4EHUA 2NNWA 2BANA 4CEDA 1TK8A 1C6VA 4CD1A 3F9MA 1LAWA 1VQ9N 1LCUA 2Q3SA 4EP4A 4X64K 2P51A 1UOCA 5AQQA 4IOCL 4CCHA 1T05A 2HHXA 4W5QA 1TKZA 4WFAL 3OYDA 4H5NA 1WBBA 4O8KA 2UUBK 2OA8A 3D2FA 4ILGB 4CJSA 1NMNA 1S1XA 3ZEUA 4CW7B 4JRQA 3ATVA 3D2EA 3NF6A 4CFAA 3S3OA 1ZBLA 2GEMA 1WAFA 1ZYQA 2KFNA 4OPAA 1V4TA 3S3NA 3ZCMA 3ZSXA 1XMQK 3O4WA 2YJFA 1RDUA 4L8RB 4EP5A 2YHXA 4B3TK 3M3ZA 3TTDA 3OYKA 4FYDA 4YDUA 3B6OA 3VOVA 1JCEA 4BREA 1KAYA 1G99A 3R8EA 1XC3A 3ZX3A 3TANA 1GLDG 4MO4A 1VK0A 4PY5A 3ZETB 2VG6A 3TAEA 2BTFA 4IOXA 5HRRA 4WQ5A 4QCLA 3CC4N 5KI6A 1BCOA 1HRHA 1KRPA 4KAZA 1HQEA 3PO4A 2YHAA 1HNIA 3WEEA 4JLHA 4CFCA 3RR8A 3TSPA 2O4IA 4I9LA 4AHUA 1UA1A 5JLHA 3RSEB 2F8TA 4DR7K 2ASOA 3H08A 1VQ5N 3G25A 2O4GA 2CH5A 3T1AA 1S3XA 1NK9A 1NG9A 2JWLA 3MEEA 2FSNA 3OS0A 3HP6A 2YHWA 3CM6A 5AQZA 4BRQA 1IH7A 2GBZA 1BGXT 1JKHA 5BPLA 3O1WA 5SWMA 1ZBIA 5AQUA 4YFUA 4M3XA 1BU6O 4O55A 4BRNA 2E1ZA 4BGBA 1P90A 1FK9A 3AGKA 4B9VA 3D45A 3LWMA 3NVMA 5CZ1A 4A2AA 2KZMA 3VQQA 2FF6A 1KCFA 4H4OA 3HYFA 2RKIA 3C6HA 4M45A 3FR0A 2YJEA 3VESA 5C15A 1T03A 3SI6A 4DU1A 1BA1A 3EE8A 3UKRB 4JK7A 5AQWA 4ISFA 4CZFA 4ILJA 3DRSA 3V9WA 1EETA 4JK9A 2IS3A 3LP0A 1WLJA 3P39A 4IXCA 1YUWA 4BRMA 3CCVN 3THWA 1KLMA 4XH5A 3U9DA 4DFPA 4M42A 4FJMA 5JMVA 3TPQA 2Z1GA 2IVOA 5HLFA 4ISEA 3HO1A 1FKOA 4FWKA 5M1QA 3HSTB 3HK2A 1J54A 5AQFA 4W5NA 1JCGA 4EIAA 1TYQB 2QWMA 4JI0K 4KPYA 3GOIA 3BEXA 3NHGA 2D0PA 3I8DA 4ID1A 1TUUA 3NDKA 2OPPA 3NF8A 5SZTA 3AA3A 5J2PA 1HNZK 4RW9A 1K8AO 1P8ZA 2Q97A 4KH4A 1LW2A 2D1KA 5CE3A 4KHPK 1MWKA 3ENHA 1KQSM 1HPMA 3K0SA 3LDNA 1TK5A 4JHDA 1WSJA 3LAKA 2YNFA 4LFCK 2Q1NA 3NBPA 5BN8A 1RDBA 1YJWN 5C42A 2DFHA 3AVBA 4BGAA 4BQZA 4JI3K 3DRRA 4WYBA 4O44A 3AGRA 3MN7A 1B92A 1BWFO 4DF4A 1QS4A 4LFAK 4K8XA 3THXB 4NCGA 3LZJA 2P9NA 3SMSA 2LSNA 1OH5A 1DGKN 3I55N 3DOLA 3QBXA 1Q18A 4LF5K 2E20A 3M8PA 1Z25A 2YV0X 1HJRA 4MDAA 1NK4A 2IVPA 4BRIA 3BP8A 4IDHA 4RTFD 5GAHP 3CF5L 5AZJA 4FPBA 4BE1A 3CMAN 4B9SA 2NRVA 5BPNA 1JLQA 3KKRA 4K42A 3LL3A 3HL8A 1OVQA 4E19A 3RMAA 5AQNA 4CIEA 2BH1A 1RDCA 3KWIA 4OKEA 3AVIA 4CK3A 4OLAA 4Z4CA 2JLEA 5BRHA 2DPNA 1NGIA 3WQUA 3ZSYA 4FK0A 5GAEP 1M90O 3RVCA 1C1AA 4F3TA 2D0BA 3J7YP 2YI1A 2X6SA 4JKDA 4JKEA 5AQHA 1NK8A 4WQ4C 2XY6A 4DV6K 3PX6A 5KQDA 1O1WA 3JYTA 3U3YA 5BPMA 3V9UA 2WC9A 4X66K 3O9UA 4BVOA 1BI4B 2P9LB 3ZSRA 3MN9A 3KD1E 4JKAA 4DV5K 1VSIA 1JLGA 3PX4A 5EU7A 1XQSC 3O6WA 4FWQA 4FLZA 5FRMA 1BIZA 4NXMK 2Z1JA 1Q82O 3CCQN 3ZT3A 2Y1IA 3O80A 1WSHA 4DFKA 4JI7K 1OKJA 1RGIA 4LY7A 3ZETA 2FBTA 3HOTA 3K5LA 2HHSA 4FPAA 4KHWA 1HKBA 3PV8A 3MXIA 4PWDA 1IKXA 3CCUN 3CJ1A 3SQ1A 1CXUA 2IC3A 4AHTA 3TWHA 4JI1K 2I7PA 4FM0A 2HNYA 1SL2A 5MLCQ 2ASMA 1SQKA 4K43A 4XEIA 3L4QA 4F4KA 4DR3K 4FZYA 4YOWA 4JKGB 5BRDA 4EFHA 1Q86O 4BG8A 3OS1A 3OJUA 4BR5A 1VQ8N 1VQON 4K41A 3V1OA 4JN4A 4B3SK 5BREA 4JS5A 5BN9A 4OX9K 4FSVA 3F9KA 2XY8A 3CJAA 5H1SQ 3PUFA 1W0HA 1U6ZA 3QDKA 4CJ7A 1HMVA 3RWUA 3EZWA 4IOAL 3CETA 1KTQA 4CJWA 2UXDK 4GVEA 5AQIA 2HW3A 3SMPA 2RHKA 2FC0A 1U48A 1M1KO 1QQOA 3HM8A 1W97L 4ELVA 5AR0A 1VSFA 3NF7A 4CGHA 4FJJA 4CERA 2ZF5O 3R9PA 2D4WA 1S6PA 4CEAA 3RRGA 3I8BA 3NE6A 1EWRA 4HUFA 2HHQA 2A40A 4CI6A 4BRKA 4AQYK 4KHSA 2O8BB 2Q31A 4M7XA 4OPHA 3E9OA 1BQNA 4ISGA 3FFKB 1BL3A 1UWBA 2F96A 3K59A 3H1VX 5CYQA 2W42A 2OANA 4HUEA 4IFVA 5JVHL 1VSEA 2HBMA 1C0TA 1N36K 4KFBA 3FZFA 5C25A 3H3OB 5AQGA 4DFMA 3HP9A 4B9UA 4DQSA 4G9ZA 5AQSA 4WQ5C 4IJAA 1QE1A 3L3VA 2HOEA 1N32K 1Q8IA 4DB3A 1DTTA 4BE2A 3EKSA 1NJZA 3ZT4A 3CI5A 5GIOA 1OH8A 1IBMK 4CZHA 2E8AA 3F2KA 4YOVA 4FM1A 2XY7A 1IJJA 1WSFA 5LJVA 3LDOA 4KKOA 3FZKA 4BWMA 4DTNA 3I0RA 4CZJA 2XY5A 2NUBA 3KK2A 3HVRA 1BOTO 3K5NA 3A2FA 2NLXA 3O8MA 1U45A 4BRDA 1JLAA 3A5OC 5TKWA 4Z4EA 4FWLA 4GKJK 3VQ6A 3VMFB 3GL1A 2ASPA 1BHLA 4BC5A 3MDQA 2A6AA 3MXJA 3VETA 2D5RA 2D0AA 4EHTA 4JRPA 1RT1A 1Q81O 2E88A 3TU5A 1Z6RA 2YNHA 5K14A 3MXMA 4ZTJA 1D9FA 4QOZB 3CCEN 3P31A 4FCYA 3M8SA 4DS5A 4CESA 3OBYA 1NJIO 4FW1A 4JI6K 3G4SN 2P5OA 3QIPA 1SL1A 4DFJA 2P9NB 1OVYA 4DLEA 2P9PA 3THXA 5FRNA 3CJ7A 3G0ZA 1EKEA 4NYFA 4JI5K 1IKVA 3L2RA 2PZSA 1TL3A 1HJOA 4C1NK 3HPHA 4JKHA 2RN2A 1E3MA 1RILA 4B8AB 3CJCA 3KK7A 1TAQA 2EX3A 3AVGA 4CEEA 4CF1A 3OYHA 4FXDA 2P9IA 4DQQA 3G71N 3CCLN 4AF1A 3DOKA 3T19A 4Q5VA 4B9NA 2PY5A 1QHAA 1GLEG 4BRAA 4W5OA 3M8QA 3QIOA 3K9JA 4J2EA 1RT6A 3VEOA 2HHWA 3AO5A 4RG8A 1NGEA 2G8UA 1RT4A 4C1NI 1TYQA 2GTDA 3FZHA 3Q7BA 2E2QA 4ILHA 1HYSA 4PKHA 3TR8A 4IBNA 3TI0A 3ZSQA 1C0FA 2NRHA 3HJFA 4JKGA 4KHUA 2NRXA 4I6MA 4Y1CA 5KGWA 3OA9A 4E0DA 1DKGD 3NVKA 2O8CA 1D4XA 1KVBA 3NMUA 4AHCA 5AQVA 5AZIB 3KLHA 4FK4A 4Z4GA 4FWRA 3QINA 3UKRA 2Z1IA 4A5BA 2F4VK 4OKKA 3BZKA 2VG5A 1LOTB 2P5GA 3OHRA 2UXBK 4A5AA 3T1HK 1C0GA 1YT3A 3SCXA 1Q9YA 1CZBA 3OY9A 5HRNA 4FL9A 1JXBA 3ULDA 5AQXA 3J7AP 2ZD1A 3CM5A 5BRFA 3VQ5A 3KLEA 4IG3A 2DFEA 2DFFA 1X9MA 3LALA 5GIPA 4O5FA 3LAMA 3AVAA 2YCHA 3GBTA 2O8EA 4FJNA 5JVGL 1XHZA 3ENOA 2QWRA 1J6ZA 4CVNE 3DLLL 1WUAA 3SAGA 1S1TA 1IBLK 4DKWA 3S9HA 2E1YA 3HRGA 3C6UA 1U47A 4HHTA 3P5JA 1NWKA 4OO1J 1KAXA 1MA9B 4U67L 4IFEA 2OZSA 2HBKA 4NB4A 4BRHA 1HKCA 4R5PA 3IKMA 2VYPA 3AVMA 1J5OA 3OYCA 5CY4A 4IWVA 3CPEA 4DUZK 3QEXA 3E1YA 3VPZA 3FZLA 4PQUA 5JLFA 4JAXA 5E41A 2E6MA 3ENBA 1NNEA 1I94K 2OTJN 4KHNA 1TUYA 3CYMA 5AZJB 1WAJA 3K5MA 1VSMA 3QFUA 4QAGA 3V1RA 3KTQA 5FPNA 4H03B 1RBSA 4DR1K 4KTWA 3SUNA 2KKZA 3VQPA 4Y0WA 4FWSA 3H1QA 5GAGP 2Y1JA 3F5TA 5AQPA 4B3RK 1DT9A 4H5WA 2OYQA 1XUPO 1RTHA 1JCFA 3IFRA 3RR7A 3LDSA 3KLFA 4YDUC 3SV3A 3WXMB 4CZLA 4BRLA 1VQ4N 1FXXA 3I33A 2QWPA 5J2QA 1RTDA 4JHDB 3AVFA 3O4NA 3ZEUB 1REVA 2B5JA 3PSIA 4DS4A 4I2QA 3D2FB 5FPMA 3QB0A 4CF0A 3OS2A 4FWNA 5J1EA 1RDWX 4TSXA 3UIQA 4H5RA 3DRPA 4FLWA 1NKBA 3AVJA 2G8HA 3T3FA 1S9GA 1HQUA 3NGYA 4JKBA 4N76A 3WNHA 3VEYA 2W41A 4OGEA 3JSMA 3J7ZO 3CCJN 3LZIA 3ZT1A 2AA4A 3LPTA 1HKGA 5LY3A 1NBWA 3QEVA 4E7JA 4BC2A 3W0LA 2CGLA 1MDUB 1RBRA 3HXMA 3AA2A 3THWB 3VQCA 4BC4A 3CCSN 3QEPA 3DAWA 3SV4A 3VTIA 1U49A 4H0TB 4E7HA 4N47A 2IGIA 4E3SA 1XNRK 3HVTA 1VSJA 4IO8A 4JD2A 4RW8A 3ZSVA 3SQ2A 3JXUA 4C8LA 3ZX2A 4FLUA 4V19S 2HBJA 1D9DA 4M3WA 2OCEA 1W7AA 3SAFA 2FSJA 1N33K 4CECA 5IT9O 4FM2A 1ZC6A 1VQLN 3PX0A 1Y97A 4CF2A 4BG9A 4CGDA 4MO5A 4B1WB 1HYZA 2EWSA 4RW7A 2OPRA 2KQ2A 3VF4A 4GY2B 4AILC 1RFQA 4W5RA 4O5BA 1O13A 1YF5L 4DQ8A 2UXCK 1CXQA 4H4MA 3IUCA 2KTQA 1TVRA 2A41A 3KK1A 5IWAK 3DMJA 1QZ6A 5HP1A 2CH6A 2ITMA 3VGMA 1YVUA 5AQMA 2OTLN 3PIOL 1HNWK 1VRTA 3UB5A 3QEWA 3SPZA 3RSEA 5FPEA 2F8SA 4BR0A 3SQ4A 4H0OA 3H6EA 3LM9A 4DF8A 3OYIA 2KLAA 3WEEB 2QXFA 3FFIA 5EX5A 2ZJRL 3JAMO 1YAGA 2QI2A 4LSLA 3RRHA 2GWJA 1WSEA 5AQKA 1YI2N 3BUZB 4DTMA 4BC3A 4C23A 1JLFA 3CJBA 1YJNN 3O4QA 3SQ0A 4DTRA 2YNGA 3RMCA 1YXQA 3DM2A 2YKMA 1U04A 3R3LA 3C6AA 4JEPA 4ELTA 4LSNA 1TGOA 1IKYA 3DXKB 2ITGA 3J8AA 1TAUA 3O9QA 3EN9A 3KIOA 2CGJA 3CD6N 1ILYA 1NJYA 3CQXA 1ZBSA 5KTQA 1WBDA 4CZMA 4AHVA 2HHHK 2KFZA 4JI2K 3WNEA 3C95A 1TKDA 4BRFA 3LP2A 4M3ZA 3D2EB 4DTSA 2O8DA 3VQ9A 3IRXA 5HRSA 3V81A 4RW6A 1WOQA 1JLCA 4O8UA 2G8VA 4B3OA 3CXCM 1L3VA 1D8YA 3EZ5A 1NGAA 2Q2RA 4QS8A 4CD3A 2R7YA 1J53A 3HPOA 3SK3A 3B6PA 1FJGK 1ZBUA 3P38A 3KHYA 4FJXA 1RDDA 2HVHA 1DEJA 1L3SA 4FJKA 2HSTA 2WFBA 5E26A 4J2AA 5AQLA 1MWMA 3CCMN 1VAZA 1A5VA 5J2NA 1I3AA 5J2MA 4BVPA 1VHXA 3OW2M 2DY4A 1NGGA 4Z0UA 1WSIA 2Q36A 4QS9A 5HBMA 4BRPA 4U7BA 4CJ3A 2O8FB 1E4FT 3LDPA 4BWJA 4DV7K 4DQPA 4CE9A 4KHQA 4RWTA 4Z4FA 4HVJA 3TAFA 4HCCA 4DV1K 3EKUA 1X9WA 2QXLA 3L0QA 3A5MC 4LH5A 4M3YA 3DWLA 1C0MA 3MCPA 1LV5A 3I56N 2B4JA 4YOXA 1BISA 1D5AA 2ZGYA 5DMRA 5FDLA 2VWJA 3THVA 2H3GX 2I5JA 5CYMA 3TSQA 3UKUB 1CZ9A 4CBUA 4GNIA 5KRSA 3L3UA 4KB1A 3EE9A 2ZJQL 3AVNA 2HHUA 1RT7A 2QW9A 1C1CA 4DSFA 5T7BA 1CZAN 1L5UA 1N34K 2ZJPL 1GLJO 4FK2A 3N4QA 1MU2A 4LH4A 4FJ5A 3MX5A 3WXKA 4N41A 4EAHD 1IBKK 1EP4A 4DMNA 4ZHRA 3DLEA 4I2PA 3ISNC 4DG1A 3ID8A 1SV5A 5EVZA 3W3DA 4YOTA 4B8CA 1QSLA 2QM1A 3KLIA 4CJEA 4FLVA 4FJGA 5C2FA 3OBWA 3VF2A 4CF8A 2QWLA 3VQAA 3HZ6A 1U4BA 2I7NA 3L8BA 2E2PA 4XH4A 3ITHA 5FLXO 1JJ2M 1NLVA 1X9JA 4CJUA 2P9UB 3EY1A 2P9UA 2A3ZA 3H45C 4LF7K 4YOUA 2P9KA 2GUIA 3ATUA 3VN5A 4HTUA 1LWEA 4DSEA 3O3HA 3MAQA 3VQ8A 5LMNK 2HVIA 2GV9A 3QNNA 3THYB 3TABA
chains in the Genus database with same CATH topology
1WSGA 3LWMA 3QINA 1L3TA 2Z1IA 4CHQA 5CZ1A 3AVLA 3M8RA 4OKKA 2KZMA 3VQQA 1KCFA 4JS4A 1BQMA 2VG5A 4H4OA 1TV6A 1NKEA 3HYFA 4CJ4A 3NH2A 2RKIA 2P5GA 4KI4A 1SKRA 3AO4A 4CFDA 4M45A 3VQBA 1YT3A 2EHGA 4Y1DA 3SCXA 1Q9YA 3OYFA 1CZBA 3OY9A 5HRNA 4LD0A 3AVCA 4CEQA 1JXBA 4O4GA 3SI6A 1T03A 1DTQA 3ULDA 4DU1A 4B9TA 3MECA 1RT5A 4DTPA 1ASVA 2ZD1A 3CM5A 2HHVA 1ITGA 2FBVA 3DRSA 3VQ5A 4IG3A 3KLEA 3V9WA 1EETA 4CGFA 4DTXA 3SUQA 1NK7A 3RMBA 2DFEA 4GMJB 3QEIA 2HMIA 2IS3A 1VSHA 3LP0A 2DFFA 1ASUA 4DQRA 1X9MA 3LALA 4F8RA 1N6QA 1G15A 1WLJA 3TAGA 3AO3A 3LAMA 1VSLA 3P1GA 3AVAA 4KI6A 1HNVA 3L2VA 1KLMA 4FJNA 1XHZA 4CIGA 2HHTA 4DFPA 4M42A 1SL0A 4FJMA 2BDPA 2Z1GA 3ZSWA 4CHOA 1S1TA 4G1QA 4Z4HA 5HLFA 5DK5A 4IFYA 3S9HA 2KZZA 3HO1A 1FKOA 2BE2A 5JS1A 3HSTB 4CGGA 3HK2A 3C6UA 3L2WA 2ETJA 1U47A 1J54A 2AJQA 4W5NA 3ZSOA 4HHTA 3P5JA 4O0IA 1S5JA 5CZ2A 4KPYA 2B6AA 1XI1A 4KREA 3NHGA 2DTUA 1NK6A 3I8DA 4ID1A 3QO9A 1TK0A 4J2BA 3KLGA 2OZSA 1LWCA 4ICLA 3NDKA 4N56A 4R5PA 2OPPA 2OPSA 3NF8A 5SZTA 3AA3A 3PY8A 5J2PA 3AVMA 4RW9A 2VG7A 3OYCA 5CY4A 1J5OA 2X78A 3QERA 1LW2A 4E7LA 3QEXA 2G8FA 1RBTA 4CHYA 1C1BA 3V6DA 4PQUA 2KW4A 1UA0A 3LPUA 1JL1A 1TK5A 4IG0A 1WSJA 3LAKA 2E6MA 2YNFA 5E41A 3SJJA 4DSLA 3QETA 1KFDA 4KHNA 3CYMA 3K2PA 3NBPA 4CHPA 1WAJA 3K5MA 1VSMA 1RDBA 4QAGA 3IAYA 2IDOA 3V1RA 5C42A 2DFHA 3AVBA 3DLGA 3KTQA 2XRIA 1ASWA 1RBSA 3DRRA 4OPKA 4KTWA 4O44A 4AH9A 4CF9A 3SUNA 1YTUA 1B92A 4DF4A 4HCBA 1X9SA 1QS4A 3VQPA 4F3OA 2Z1HA 3WNFA 4K8XA 2Y1JA 3OYGA 4NCGA 3LZJA 3TAQA 2LSNA 4CJQA 2X74A 4ID5A 2OYQA 3C94A 3DOLA 1VSKA 3AVHA 3DLKA 1IO2A 1RTHA 3KKSA 3RR7A 1QQCA 2HNZA 1Z25A 3M8PA 3KLFA 2YV0X 3LDSA 4J2DA 1HJRA 3LP1A 1NK4A 1KSPA 3SV3A 4CGIA 4BE1A 1FXXA 4B9SA 5J2QA 1RTDA 1RT3A 2OZMA 1JLQA 3KKRA 3AVFA 3O4NA 4EZ6A 1REVA 2B5JA 4I7FA 4DS4A 3HL8A 4I2QA 4E19A 4FVMA 3RMAA 4CIEA 2WONA 4CF0A 1RDCA 4OLAA 3OS2A 5J1EA 1LW0A 4TSXA 4OKEA 2G8KA 3UIQA 4FLWA 3DRPA 1NKBA 4CGJA 3AVIA 3AVJA 4CK3A 1HYVA 4Z4CA 2JLEA 4OVLA 1RT2A 3NGIA 1S9GA 3T3FA 2G8HA 4DSIA 1HQUA 3KK3A 3QESA 3NGYA 4Z4IA 4N76A 3WNHA 3ZSYA 4CJFA 4YNQA 4FK0A 4FJ7A 4OGEA 1C1AA 3JSMA 4F3TA 1WNSA 2D0BA 3OYBA 3LZIA 5I42A 2X6SA 2XO7A 4KRFA 3ZT1A 2FBXA 3QLHA 3LPTA 2XHBA 3DLRA 1N5YA 1NK8A 1A5XA 2XY6A 4M3UA 3PX6A 4DTOA 1O1WA 3JYTA 3QEVA 3U3YA 4E7JA 3BGRA 3S3MA 4FJ8A 1ZBIA 4DSKA 3V9UA 5C24A 2E4LA 1RBRA 1BI4B 3HXMA 3ZSRA 5KGXA 3AA2A 4CHZA 3KD1E 3ASMA 1NK5A 3VQCA 1FKPA 3ZT2A 1EXQA 1CLQA 1VSIA 3QEPA 1T8EA 1JL2A 1JLGA 3VQDA 3OJSA 3PX4A 3SV4A 1U49A 4HUGA 5EU7A 4DSJA 4FZZA 3V4IA 4XIUA 4DWIA 1BIUA 3AA4A 3CFRA 4BE0A 1S9EA 4E7HA 4DTUA 1A5WA 1ZBFA 4KO0A 4N47A 2IGIA 4E3SA 4FLZA 4KHYA 3HVTA 5FRMA 1BIZA 1VSJA 2Z1JA 4O0JA 2YKNA 2OPQA 3ZT3A 3VQEA 3L2QA 4RW8A 2Y1IA 3ZSVA 4CK1A 3SQ2A 4CEOA 1KLNA 3TARA 1WSHA 4DFKA 3OYMA 4C8LA 3D0PA 4FLUA 2A1SA 1ZBHA 4LY7A 1D9DA 4M3WA 4CECA 1S1UA 2JGUA 2FBTA 1LWFA 4FLXA 3K5LA 4AHRA 3U3GA 3OYAA 4FM2A 2HHSA 4KHWA 3SUPA 3PV8A 3MXIA 3L2UA 3PX0A 4PWDA 1IKXA 1Y97A 3LWLA 4CF2A 3AA5X 4H8KA 4CJTA 2HB5A 4CGDA 1NKCA 4M3ZA 3VA3A 3KJVA 3SQ1A 1CXUA 2IC3A 1HYZA 4AHTA 4RW7A 3TWHA 4FM0A 3NAEA 2HNYA 1SKSA 2OPRA 2KQ2A 3OYLA 4AILC 1SL2A 3V1QA 3VQ7A 2QK9A 4FLTA 4W5RA 4O5BA 3DLBA 4F4KA 5KRTA 4FZYA 3BDPA 1CXQA 3VQ4A 4H4MA 2KTQA 4NYNA 1TVRA 1W9HA 1NJWA 4F2RA 4CJKA 3KK1A 1S6QA 3DMJA 5HP1A 3OS1A 3OJUA 3DI6A 4DTJA 4K8ZA 1YVUA 1R0AA 2RF2A 3V1OA 2PYJA 3PO5A 1K6YA 3EYZA 4JS5A 1VRTA 3V9ZA 3F9KA 3QEWA 3SPZA 2XY8A 4GVMA 2F8SA 3SQ4A 3LP3A 4M3RA 1HPZA 3PUFA 1W0HA 2PYLA 1NK0A 2G8WA 3KD5E 4DF8A 3NGZA 1XHXA 1HMVA 3OYIA 3RWUA 3SUOA 2IOCA 3ALYA 2QXFA 3TAPA 2RPIA 3FFIA 4OLBA 3G10A 3RMDA 3F73A 1KTQA 4MFBA 4CJWA 3SYZA 1NOYA 4CJLA 4ELUA 4FW2A 4NCAA 2HW3A 4LSLA 2ATQA 4CJVA 3RRHA 3OYEA 2FC0A 3O3FA 1WSEA 1U48A 3SZ2A 4DQIA 4DTMA 1JLFA 1T7PA 1KFSA 1JLEA 1BI4A 3O4QA 4DTRA 3SQ0A 4ELVA 3IG1A 3LANA 4N5SA 1VSFA 2YNGA 3RMCA 3NF7A 2ZQBA 4CGHA 3AO1A 3O3GA 4FJJA 3DM2A 4CERA 3C6TA 2YKMA 1U04A 3AVKA 3SNNA 4ELTA 4LSNA 4KB0A 1TGOA 1IKYA 1S6PA 2VWKA 2D0CA 2ITGA 1TAUA 4CEAA 4C8MA 3NE6A 3RRGA 3KIOA 4HUFA 3NH0A 2HHQA 3NCIA 4CEFA 4OJRA 3NF9A 2WOMA 1NJYA 2QKKA 5KTQA 3AO2A 2KFZA 4AHVA 4KHSA 4Q0BA 4PA1A 3V9XA 2YHBA 4CJ5A 1JLBA 4IDKA 5FROA 3WNEA 3SPYA 4BDPA 3C95A 1SUQA 4B9LA 1BQNA 4EZ9A 3ZT0A 1TKDA 4DU3A 1BL3A 1UWBA 2F96A 3K59A 4C8OA 5CYQA 1TKTA 2X6NA 3LP2A 1LAVA 2W42A 4HUEA 1NJXA 1QTMA 1QSSA 4CK2A 3P83D 4IFVA 1VRUA 4I9QA 1VSEA 4DTSA 3RTVA 1C0TA 3IRXA 3VQ9A 5HRSA 5HRPA 4KFBA 4C8NA 4RW6A 3CFPA 2FBYA 4BDYA 4GW6A 5C25A 5HROA 1L3UA 1JLCA 4C8KA 4CFBA 2G8VA 4B3OA 1VSDA 4MQ3A 1L3VA 4DFMA 1D8YA 3OYJA 3HP9A 4B9UA 4DQSA 3EZ5A 4PUOA 3HT3A 2QKBA 3K5OA 1QE1A 1GOCA 3L3VA 2R7YA 1J53A 3HPOA 3QNOA 1Q8IA 1SKWA 4FJLA 3B6PA 4F2SA 3CFOA 4KV8A 1DTTA 4BE2A 1ZBUA 2ZE2A 3CQ8A 1NJZA 4FZXC 3ZT4A 1F21A 4AHSA 4FJXA 3HPGA 4KTQA 1UAXA 4UQGA 2G8IA 4FM1A 2XY7A 3E01A 1RNHA 2IAJA 4CEBA 2YNIA 4FJIA 1RDDA 1WSFA 4M3TA 2HVHA 4CJPA 1L3SA 4KKOA 4BACA 4DLGA 1RTIA 4BWMA 3U6FA 4ZTFA 4DTNA 4BDZA 4FJKA 4E7KA 4M41A 3I0RA 2XY5A 1WN7A 2NUBA 1XC9A 4J2AA 3KK2A 4DU4A 4B9MA 1Z26A 1GOAA 4CEZA 2A1RA 4FJ9A 1A5VA 3HVRA 1I3AA 5J2NA 1J9AA 5J2MA 5I3UA 2BANA 4CEDA 3K5NA 1TK8A 4E7IA 1C6VA 3A2FA 1RBUA 1LAWA 1U45A 2DY4A 1JLAA 1JXEA 4Z4EA 4Z0UA 2Q3SA 3VQ6A 4EP4A 1WSIA 2P51A 1BHLA 1UOCA 3WNGA 5HBMA 3IS9A 4CCHA 1T05A 2HHXA 4W5QA 1TKZA 4CIFA 3NFAA 3OYDA 3MXJA 1RBVA 4CJRA 4CJ3A 4BWJA 4DQPA 1X1PA 2D5RA 4E89A 2D0AA 4CE9A 4KHQA 2OA8A 1TL1A 4JRPA 3DYAA 1RT1A 4Z4FA 4CJSA 1S1XA 4HVJA 4JRQA 3TAFA 2YNHA 5K14A 3MXMA 3NF6A 4ZTJA 1D9FA 4HCCA 1X9WA 4QOZB 4NCBA 4LH5A 4M3YA 1Q9XA 1C0UA 4FCYA 1C0MA 4CFAA 5JS2A 3M8SA 3VA0A 3S3OA 1LV5A 4DS5A 2B4JA 4CESA 1IG9A 1ZBLA 3AV9A 1BISA 1D5AA 1WAFA 5DMRA 5FDLA 2VWJA 3THVA 1ZYQA 2KFNA 2I5JA 4FW1A 5CYMA 1B9FA 3S3NA 3ZCMA 3ZSXA 3MEDA 1CZ9A 5KRSA 2P5OA 1YTAA 4KTZA 3QIPA 1SL1A 3L3UA 4DFJA 4KB1A 3MEGA 4DLEA 4L8RB 4EP5A 4OGCA 3I0SA 4FYDA 3OYKA 5FRNA 3AVNA 2HHUA 1RT7A 3B6OA 3G0ZA 1EKEA 4NYFA 1C1CA 4DSFA 5T7BA 1TKXA 3NH1A 1IKVA 3L2RA 2P1JA 3TANA 1TL3A 1L5UA 2PZSA 3HPHA 1QSYA 1VK0A 1NOZA 1I39A 2RN2A 4PY5A 4FK2A 1MU2A 1RILA 2VG6A 4B8AB 3HM9A 3TAEA 4LH4A 5HRRA 4FJ5A 1TAQA 2EX3A 3AVGA 4QCLA 1DLOA 4N41A 1EX4A 5KI6A 4CEEA 1BCOA 4CF1A 3OYHA 4FXDA 1HRHA 1EP4A 4DMNA 4IKFA 4ZHRA 4DQQA 3DLEA 4B08A 1KRPA 4I2PA 4KAZA 3ISNC 4OPJA 1HQEA 4DG1A 1B9DA 1KVCA 1BCMA 1SV5A 2YHAA 4RW4A 3PO4A 3DOKA 3T19A 4B8CA 1HNIA 4Q5VA 1QSLA 4B9NA 4JLHA 4CHNA 3KLIA 4CFCA 4WE1A 4CJEA 4OKJA 4W5OA 4FLVA 2PY5A 3RR8A 4E1NA 4FJGA 4FJHA 3M8QA 4CF8A 3K58A 1RTJA 2O4IA 3QIOA 4I9LA 4AHUA 3DLHA 4B9VA 1UA1A 4J2EA 4W5TA 1RT6A 3VQAA 1RDAA 2HHWA 3OYNA 5D3GA 3AO5A 4RG8A 2F8TA 1RCHA 1GOBA 3H08A 1U4BA 2O4GA 2G8UA 3L8BA 1RT4A 1IKWA 3ITHA 3CG7A 1S1WA 4CJUA 3T1AA 3V9SA 1NK9A 3EY1A 3MEEA 1QHTA 1KVAA 1HYSA 2GUIA 4IBNA 3TR8A 3TI0A 3OS0A 3ZSQA 3HP6A 3OVNA 3HJFA 3VN5A 4HTUA 3CM6A 4KHUA 1LWEA 1IH7A 4Y1CA 3V81A 2GBZA 1BGXT 1JKHA 5KGWA 3K57A 4E0DA 3ZSZA 1KVBA 1S1VA 5SWMA 3TAMA 4AHCA 4YFUA 3O3HA 3MAQA 4DSEA 4O55A 4M3XA 3VQ8A 1XWLA 3KLHA 4FK4A 2HNDA 2E6LA 2HVIA 4Z4GA 4E1MA 1FK9A 2GV9A 3QNNA 2BGGA 3TABA 3D45A 4FLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSG A;  3LWM A;  3QIN A;  1L3T A;  2Z1I A;  4CHQ A;  5CZ1 A;  3AVL A;  3M8R A;  4OKK A;  2KZM A;  3VQQ A;  1KCF A;  4JS4 A;  1BQM A;  2VG5 A;  4H4O A;  1TV6 A;  1NKE A;  3HYF A;  4CJ4 A;  3NH2 A;  2RKI A;  2P5G A;  4KI4 A;  1SKR A;  3AO4 A;  4CFD A;  4M45 A;  3VQB A;  1YT3 A;  2EHG A;  4Y1D A;  3SCX A;  1Q9Y A;  3OYF A;  1CZB A;  3OY9 A;  5HRN A;  4LD0 A;  3AVC A;  4CEQ A;  1JXB A;  4O4G A;  3SI6 A;  1T03 A;  1DTQ A;  3ULD A;  4DU1 A;  4B9T A;  3MEC A;  1RT5 A;  4DTP A;  1ASV A;  2ZD1 A;  3CM5 A;  2HHV A;  1ITG A;  2FBV A;  3DRS A;  3VQ5 A;  4IG3 A;  3KLE A;  3V9W A;  1EET A;  4CGF A;  4DTX A;  3SUQ A;  1NK7 A;  3RMB A;  2DFE A;  4GMJ B;  3QEI A;  2HMI A;  2IS3 A;  1VSH A;  3LP0 A;  2DFF A;  1ASU A;  4DQR A;  1X9M A;  3LAL A;  4F8R A;  1N6Q A;  1G15 A;  1WLJ A;  3TAG A;  3AO3 A;  3LAM A;  1VSL A;  3P1G A;  3AVA A;  4KI6 A;  1HNV A;  3L2V A;  1KLM A;  4FJN A;  1XHZ A;  4CIG A;  2HHT A;  4DFP A;  4M42 A;  1SL0 A;  4FJM A;  2BDP A;  2Z1G A;  3ZSW A;  4CHO A;  1S1T A;  4G1Q A;  4Z4H A;  5HLF A;  5DK5 A;  4IFY A;  3S9H A;  2KZZ A;  3HO1 A;  1FKO A;  2BE2 A;  5JS1 A;  3HST B;  4CGG A;  3HK2 A;  3C6U A;  3L2W A;  2ETJ A;  1U47 A;  1J54 A;  2AJQ A;  4W5N A;  3ZSO A;  4HHT A;  3P5J A;  4O0I A;  1S5J A;  5CZ2 A;  4KPY A;  2B6A A;  1XI1 A;  4KRE A;  3NHG A;  2DTU A;  1NK6 A;  3I8D A;  4ID1 A;  3QO9 A;  1TK0 A;  4J2B A;  3KLG A;  2OZS A;  1LWC A;  4ICL A;  3NDK A;  4N56 A;  4R5P A;  2OPP A;  2OPS A;  3NF8 A;  5SZT A;  3AA3 A;  3PY8 A;  5J2P A;  3AVM A;  4RW9 A;  2VG7 A;  3OYC A;  5CY4 A;  1J5O A;  2X78 A;  3QER A;  1LW2 A;  4E7L A;  3QEX A;  2G8F A;  1RBT A;  4CHY A;  1C1B A;  3V6D A;  4PQU A;  2KW4 A;  1UA0 A;  3LPU A;  1JL1 A;  1TK5 A;  4IG0 A;  1WSJ A;  3LAK A;  2E6M A;  2YNF A;  5E41 A;  3SJJ A;  4DSL A;  3QET A;  1KFD A;  4KHN A;  3CYM A;  3K2P A;  3NBP A;  4CHP A;  1WAJ A;  3K5M A;  1VSM A;  1RDB A;  4QAG A;  3IAY A;  2IDO A;  3V1R A;  5C42 A;  2DFH A;  3AVB A;  3DLG A;  3KTQ A;  2XRI A;  1ASW A;  1RBS A;  3DRR A;  4OPK A;  4KTW A;  4O44 A;  4AH9 A;  4CF9 A;  3SUN A;  1YTU A;  1B92 A;  4DF4 A;  4HCB A;  1X9S A;  1QS4 A;  3VQP A;  4F3O A;  2Z1H A;  3WNF A;  4K8X A;  2Y1J A;  3OYG A;  4NCG A;  3LZJ A;  3TAQ A;  2LSN A;  4CJQ A;  2X74 A;  4ID5 A;  2OYQ A;  3C94 A;  3DOL A;  1VSK A;  3AVH A;  3DLK A;  1IO2 A;  1RTH A;  3KKS A;  3RR7 A;  1QQC A;  2HNZ A;  1Z25 A;  3M8P A;  3KLF A;  2YV0 X;  3LDS A;  4J2D A;  1HJR A;  3LP1 A;  1NK4 A;  1KSP A;  3SV3 A;  4CGI A;  4BE1 A;  1FXX A;  4B9S A;  5J2Q A;  1RTD A;  1RT3 A;  2OZM A;  1JLQ A;  3KKR A;  3AVF A;  3O4N A;  4EZ6 A;  1REV A;  2B5J A;  4I7F A;  4DS4 A;  3HL8 A;  4I2Q A;  4E19 A;  4FVM A;  3RMA A;  4CIE A;  2WON A;  4CF0 A;  1RDC A;  4OLA A;  3OS2 A;  5J1E A;  1LW0 A;  4TSX A;  4OKE A;  2G8K A;  3UIQ A;  4FLW A;  3DRP A;  1NKB A;  4CGJ A;  3AVI A;  3AVJ A;  4CK3 A;  1HYV A;  4Z4C A;  2JLE A;  4OVL A;  1RT2 A;  3NGI A;  1S9G A;  3T3F A;  2G8H A;  4DSI A;  1HQU A;  3KK3 A;  3QES A;  3NGY A;  4Z4I A;  4N76 A;  3WNH A;  3ZSY A;  4CJF A;  4YNQ A;  4FK0 A;  4FJ7 A;  4OGE A;  1C1A A;  3JSM A;  4F3T A;  1WNS A;  2D0B A;  3OYB A;  3LZI A;  5I42 A;  2X6S A;  2XO7 A;  4KRF A;  3ZT1 A;  2FBX A;  3QLH A;  3LPT A;  2XHB A;  3DLR A;  1N5Y A;  1NK8 A;  1A5X A;  2XY6 A;  4M3U A;  3PX6 A;  4DTO A;  1O1W A;  3JYT A;  3QEV A;  3U3Y A;  4E7J A;  3BGR A;  3S3M A;  4FJ8 A;  1ZBI A;  4DSK A;  3V9U A;  5C24 A;  2E4L A;  1RBR A;  1BI4 B;  3HXM A;  3ZSR A;  5KGX A;  3AA2 A;  4CHZ A;  3KD1 E;  3ASM A;  1NK5 A;  3VQC A;  1FKP A;  3ZT2 A;  1EXQ A;  1CLQ A;  1VSI A;  3QEP A;  1T8E A;  1JL2 A;  1JLG A;  3VQD A;  3OJS A;  3PX4 A;  3SV4 A;  1U49 A;  4HUG A;  5EU7 A;  4DSJ A;  4FZZ A;  3V4I A;  4XIU A;  4DWI A;  1BIU A;  3AA4 A;  3CFR A;  4BE0 A;  1S9E A;  4E7H A;  4DTU A;  1A5W A;  1ZBF A;  4KO0 A;  4N47 A;  2IGI A;  4E3S A;  4FLZ A;  4KHY A;  3HVT A;  5FRM A;  1BIZ A;  1VSJ A;  2Z1J A;  4O0J A;  2YKN A;  2OPQ A;  3ZT3 A;  3VQE A;  3L2Q A;  4RW8 A;  2Y1I A;  3ZSV A;  4CK1 A;  3SQ2 A;  4CEO A;  1KLN A;  3TAR A;  1WSH A;  4DFK A;  3OYM A;  4C8L A;  3D0P A;  4FLU A;  2A1S A;  1ZBH A;  4LY7 A;  1D9D A;  4M3W A;  4CEC A;  1S1U A;  2JGU A;  2FBT A;  1LWF A;  4FLX A;  3K5L A;  4AHR A;  3U3G A;  3OYA A;  4FM2 A;  2HHS A;  4KHW A;  3SUP A;  3PV8 A;  3MXI A;  3L2U A;  3PX0 A;  4PWD A;  1IKX A;  1Y97 A;  3LWL A;  4CF2 A;  3AA5 X;  4H8K A;  4CJT A;  2HB5 A;  4CGD A;  1NKC A;  4M3Z A;  3VA3 A;  3KJV A;  3SQ1 A;  1CXU A;  2IC3 A;  1HYZ A;  4AHT A;  4RW7 A;  3TWH A;  4FM0 A;  3NAE A;  2HNY A;  1SKS A;  2OPR A;  2KQ2 A;  3OYL A;  4AIL C;  1SL2 A;  3V1Q A;  3VQ7 A;  2QK9 A;  4FLT A;  4W5R A;  4O5B A;  3DLB A;  4F4K A;  5KRT A;  4FZY A;  3BDP A;  1CXQ A;  3VQ4 A;  4H4M A;  2KTQ A;  4NYN A;  1TVR A;  1W9H A;  1NJW A;  4F2R A;  4CJK A;  3KK1 A;  1S6Q A;  3DMJ A;  5HP1 A;  3OS1 A;  3OJU A;  3DI6 A;  4DTJ A;  4K8Z A;  1YVU A;  1R0A A;  2RF2 A;  3V1O A;  2PYJ A;  3PO5 A;  1K6Y A;  3EYZ A;  4JS5 A;  1VRT A;  3V9Z A;  3F9K A;  3QEW A;  3SPZ A;  2XY8 A;  4GVM A;  2F8S A;  3SQ4 A;  3LP3 A;  4M3R A;  1HPZ A;  3PUF A;  1W0H A;  2PYL A;  1NK0 A;  2G8W A;  3KD5 E;  4DF8 A;  3NGZ A;  1XHX A;  1HMV A;  3OYI A;  3RWU A;  3SUO A;  2IOC A;  3ALY A;  2QXF A;  3TAP A;  2RPI A;  3FFI A;  4OLB A;  3G10 A;  3RMD A;  3F73 A;  1KTQ A;  4MFB A;  4CJW A;  3SYZ A;  1NOY A;  4CJL A;  4ELU A;  4FW2 A;  4NCA A;  2HW3 A;  4LSL A;  2ATQ A;  4CJV A;  3RRH A;  3OYE A;  2FC0 A;  3O3F A;  1WSE A;  1U48 A;  3SZ2 A;  4DQI A;  4DTM A;  1JLF A;  1T7P A;  1KFS A;  1JLE A;  1BI4 A;  3O4Q A;  4DTR A;  3SQ0 A;  4ELV A;  3IG1 A;  3LAN A;  4N5S A;  1VSF A;  2YNG A;  3RMC A;  3NF7 A;  2ZQB A;  4CGH A;  3AO1 A;  3O3G A;  4FJJ A;  3DM2 A;  4CER A;  3C6T A;  2YKM A;  1U04 A;  3AVK A;  3SNN A;  4ELT A;  4LSN A;  4KB0 A;  1TGO A;  1IKY A;  1S6P A;  2VWK A;  2D0C A;  2ITG A;  1TAU A;  4CEA A;  4C8M A;  3NE6 A;  3RRG A;  3KIO A;  4HUF A;  3NH0 A;  2HHQ A;  3NCI A;  4CEF A;  4OJR A;  3NF9 A;  2WOM A;  1NJY A;  2QKK A;  5KTQ A;  3AO2 A;  2KFZ A;  4AHV A;  4KHS A;  4Q0B A;  4PA1 A;  3V9X A;  2YHB A;  4CJ5 A;  1JLB A;  4IDK A;  5FRO A;  3WNE A;  3SPY A;  4BDP A;  3C95 A;  1SUQ A;  4B9L A;  1BQN A;  4EZ9 A;  3ZT0 A;  1TKD A;  4DU3 A;  1BL3 A;  1UWB A;  2F96 A;  3K59 A;  4C8O A;  5CYQ A;  1TKT A;  2X6N A;  3LP2 A;  1LAV A;  2W42 A;  4HUE A;  1NJX A;  1QTM A;  1QSS A;  4CK2 A;  3P83 D;  4IFV A;  1VRU A;  4I9Q A;  1VSE A;  4DTS A;  3RTV A;  1C0T A;  3IRX A;  3VQ9 A;  5HRS A;  5HRP A;  4KFB A;  4C8N A;  4RW6 A;  3CFP A;  2FBY A;  4BDY A;  4GW6 A;  5C25 A;  5HRO A;  1L3U A;  1JLC A;  4C8K A;  4CFB A;  2G8V A;  4B3O A;  1VSD A;  4MQ3 A;  1L3V A;  4DFM A;  1D8Y A;  3OYJ A;  3HP9 A;  4B9U A;  4DQS A;  3EZ5 A;  4PUO A;  3HT3 A;  2QKB A;  3K5O A;  1QE1 A;  1GOC A;  3L3V A;  2R7Y A;  1J53 A;  3HPO A;  3QNO A;  1Q8I A;  1SKW A;  4FJL A;  3B6P A;  4F2S A;  3CFO A;  4KV8 A;  1DTT A;  4BE2 A;  1ZBU A;  2ZE2 A;  3CQ8 A;  1NJZ A;  4FZX C;  3ZT4 A;  1F21 A;  4AHS A;  4FJX A;  3HPG A;  4KTQ A;  1UAX A;  4UQG A;  2G8I A;  4FM1 A;  2XY7 A;  3E01 A;  1RNH A;  2IAJ A;  4CEB A;  2YNI A;  4FJI A;  1RDD A;  1WSF A;  4M3T A;  2HVH A;  4CJP A;  1L3S A;  4KKO A;  4BAC A;  4DLG A;  1RTI A;  4BWM A;  3U6F A;  4ZTF A;  4DTN A;  4BDZ A;  4FJK A;  4E7K A;  4M41 A;  3I0R A;  2XY5 A;  1WN7 A;  2NUB A;  1XC9 A;  4J2A A;  3KK2 A;  4DU4 A;  4B9M A;  1Z26 A;  1GOA A;  4CEZ A;  2A1R A;  4FJ9 A;  1A5V A;  3HVR A;  1I3A A;  5J2N A;  1J9A A;  5J2M A;  5I3U A;  2BAN A;  4CED A;  3K5N A;  1TK8 A;  4E7I A;  1C6V A;  3A2F A;  1RBU A;  1LAW A;  1U45 A;  2DY4 A;  1JLA A;  1JXE A;  4Z4E A;  4Z0U A;  2Q3S A;  3VQ6 A;  4EP4 A;  1WSI A;  2P51 A;  1BHL A;  1UOC A;  3WNG A;  5HBM A;  3IS9 A;  4CCH A;  1T05 A;  2HHX A;  4W5Q A;  1TKZ A;  4CIF A;  3NFA A;  3OYD A;  3MXJ A;  1RBV A;  4CJR A;  4CJ3 A;  4BWJ A;  4DQP A;  1X1P A;  2D5R A;  4E89 A;  2D0A A;  4CE9 A;  4KHQ A;  2OA8 A;  1TL1 A;  4JRP A;  3DYA A;  1RT1 A;  4Z4F A;  4CJS A;  1S1X A;  4HVJ A;  4JRQ A;  3TAF A;  2YNH A;  5K14 A;  3MXM A;  3NF6 A;  4ZTJ A;  1D9F A;  4HCC A;  1X9W A;  4QOZ B;  4NCB A;  4LH5 A;  4M3Y A;  1Q9X A;  1C0U A;  4FCY A;  1C0M A;  4CFA A;  5JS2 A;  3M8S A;  3VA0 A;  3S3O A;  1LV5 A;  4DS5 A;  2B4J A;  4CES A;  1IG9 A;  1ZBL A;  3AV9 A;  1BIS A;  1D5A A;  1WAF A;  5DMR A;  5FDL A;  2VWJ A;  3THV A;  1ZYQ A;  2KFN A;  2I5J A;  4FW1 A;  5CYM A;  1B9F A;  3S3N A;  3ZCM A;  3ZSX A;  3MED A;  1CZ9 A;  5KRS A;  2P5O A;  1YTA A;  4KTZ A;  3QIP A;  1SL1 A;  3L3U A;  4DFJ A;  4KB1 A;  3MEG A;  4DLE A;  4L8R B;  4EP5 A;  4OGC A;  3I0S A;  4FYD A;  3OYK A;  5FRN A;  3AVN A;  2HHU A;  1RT7 A;  3B6O A;  3G0Z A;  1EKE A;  4NYF A;  1C1C A;  4DSF A;  5T7B A;  1TKX A;  3NH1 A;  1IKV A;  3L2R A;  2P1J A;  3TAN A;  1TL3 A;  1L5U A;  2PZS A;  3HPH A;  1QSY A;  1VK0 A;  1NOZ A;  1I39 A;  2RN2 A;  4PY5 A;  4FK2 A;  1MU2 A;  1RIL A;  2VG6 A;  4B8A B;  3HM9 A;  3TAE A;  4LH4 A;  5HRR A;  4FJ5 A;  1TAQ A;  2EX3 A;  3AVG A;  4QCL A;  1DLO A;  4N41 A;  1EX4 A;  5KI6 A;  4CEE A;  1BCO A;  4CF1 A;  3OYH A;  4FXD A;  1HRH A;  1EP4 A;  4DMN A;  4IKF A;  4ZHR A;  4DQQ A;  3DLE A;  4B08 A;  1KRP A;  4I2P A;  4KAZ A;  3ISN C;  4OPJ A;  1HQE A;  4DG1 A;  1B9D A;  1KVC A;  1BCM A;  1SV5 A;  2YHA A;  4RW4 A;  3PO4 A;  3DOK A;  3T19 A;  4B8C A;  1HNI A;  4Q5V A;  1QSL A;  4B9N A;  4JLH A;  4CHN A;  3KLI A;  4CFC A;  4WE1 A;  4CJE A;  4OKJ A;  4W5O A;  4FLV A;  2PY5 A;  3RR8 A;  4E1N A;  4FJG A;  4FJH A;  3M8Q A;  4CF8 A;  3K58 A;  1RTJ A;  2O4I A;  3QIO A;  4I9L A;  4AHU A;  3DLH A;  4B9V A;  1UA1 A;  4J2E A;  4W5T A;  1RT6 A;  3VQA A;  1RDA A;  2HHW A;  3OYN A;  5D3G A;  3AO5 A;  4RG8 A;  2F8T A;  1RCH A;  1GOB A;  3H08 A;  1U4B A;  2O4G A;  2G8U A;  3L8B A;  1RT4 A;  1IKW A;  3ITH A;  3CG7 A;  1S1W A;  4CJU A;  3T1A A;  3V9S A;  1NK9 A;  3EY1 A;  3MEE A;  1QHT A;  1KVA A;  1HYS A;  2GUI A;  4IBN A;  3TR8 A;  3TI0 A;  3OS0 A;  3ZSQ A;  3HP6 A;  3OVN A;  3HJF A;  3VN5 A;  4HTU A;  3CM6 A;  4KHU A;  1LWE A;  1IH7 A;  4Y1C A;  3V81 A;  2GBZ A;  1BGX T;  1JKH A;  5KGW A;  3K57 A;  4E0D A;  3ZSZ A;  1KVB A;  1S1V A;  5SWM A;  3TAM A;  4AHC A;  4YFU A;  3O3H A;  3MAQ A;  4DSE A;  4O55 A;  4M3X A;  3VQ8 A;  1XWL A;  3KLH A;  4FK4 A;  2HND A;  2E6L A;  2HVI A;  4Z4G A;  4E1M A;  1FK9 A;  2GV9 A;  3QNN A;  2BGG A;  3TAB A;  3D45 A;  4FLY A; 
#chains in the Genus database with same CATH topology
 2V52 B;  1WSG A;  1Y64 A;  1FW6 A;  2VWB A;  5LMU K;  4H0P A;  2ZM6 K;  4JS4 A;  3SLC A;  3NH2 A;  4KI4 A;  1SKR A;  3AO4 A;  3A5N C;  1HLU A;  5TKY A;  3OYF A;  5F1X A;  3LDQ A;  4CEQ A;  1WB9 A;  1DTQ A;  1NGB A;  3VER A;  5KQ8 A;  1ASV A;  4DUY K;  4DTP A;  5C0Y A;  2HHV A;  2FBV A;  1K73 O;  3ID6 A;  2HMI A;  3RMB A;  4GMJ B;  3QEI A;  4BR4 A;  3WXL A;  2J4R A;  1ASU A;  1IG8 A;  3MWP A;  3HSC A;  3HTV A;  3TAG A;  5GIN A;  3A0I X;  3P1G A;  1K9M O;  3L2V A;  4CIG A;  2BDP A;  5E84 A;  4CHO A;  4YOY A;  4G1Q A;  4IFY A;  1QQN A;  1ATN A;  3Q7C A;  3L2W A;  2ETJ A;  1U2V B;  3ZSO A;  2IVN A;  4O0I A;  3BF3 A;  1GLB G;  4FO0 A;  1XI1 A;  4KRE A;  1NK6 A;  5HL7 L;  2FF3 B;  3WXI A;  3QO9 A;  1TK0 A;  4BR7 A;  1LWC A;  4M7Y A;  3MWT A;  2O8F A;  5EY4 A;  4F9O A;  1VQN N;  5AQR A;  2X78 A;  4KH6 A;  5KPZ A;  3D6R A;  4E7L A;  2UYT A;  1RBT A;  1C1B A;  4MLE A;  4FVU A;  2KW4 A;  3LPU A;  1JL1 A;  1U2V A;  2HMP A;  4IG0 A;  4L3Q A;  1W2B M;  3R6M A;  3SJJ A;  4DSL A;  3QET A;  1KFD A;  3K2P A;  4CHP A;  1ATR A;  2NRZ A;  2VQE K;  2XRI A;  3IDH A;  4OPK A;  4AH9 A;  3CIP A;  3U8X A;  3T7Z A;  1X9S A;  1XMO K;  3WNF A;  1X3M A;  3OYG A;  3TAQ A;  4ID5 A;  4JYA K;  3KKS A;  3G6E N;  3BF1 A;  1QQC A;  2HNZ A;  3VGK A;  3MMV A;  4FWP A;  5F2R A;  3LP1 A;  1KSP A;  4IEI A;  4KBO A;  4QS7 A;  2O8D B;  4K0K K;  4H5V A;  5BR8 K;  5I9E B;  4X65 K;  4B9Q A;  3PLA A;  1LW0 A;  2G8K A;  2WUS A;  3THY A;  4CGJ A;  1VQ6 N;  5LL6 Z;  1HYV A;  3QFP A;  4OVL A;  1RT2 A;  4DSI A;  3PSF A;  4WF9 L;  4Z4I A;  4JI8 K;  3ZX0 A;  4CJF A;  4YNQ A;  4FJ7 A;  1H1V A;  5KPR A;  1WNS A;  5I42 A;  3DXM A;  3TTF A;  2XO7 A;  4KRF A;  3C7N A;  1XNQ K;  3QLH A;  3DLR A;  1A5X A;  4PHT X;  4M3U A;  3S3M A;  3BGR A;  3E66 A;  4DSK A;  5KGX A;  3H3N O;  3ULE A;  1NK5 A;  4RCH A;  2QEX N;  1FKP A;  3ZT2 A;  2HBL A;  1T8E A;  3VQD A;  2QWQ A;  3OJS A;  3CC7 N;  1OH7 A;  4DV0 K;  4X62 K;  3V4I A;  3U9Z A;  5LJW A;  1BIU A;  3CFR A;  4DWI A;  1KXP A;  4LFB K;  4A59 A;  3M5R A;  5M1F A;  3M6G A;  2YKN A;  2OPQ A;  4CK1 A;  3VEW A;  4CEO A;  3O1B A;  2FSK A;  3D0P A;  4PKI A;  4HTL A;  1K8K A;  1S1U A;  5ADX H;  2GWK A;  4AHR A;  3L2U A;  3AY9 A;  2F9W A;  1NM1 A;  4H8K A;  4CJT A;  1NKC A;  5AJ3 K;  1VQ7 N;  3NAE A;  3S41 A;  4IZ9 A;  3CJ9 A;  3SJH A;  1YIJ N;  2QK9 A;  4FLT A;  1Z05 A;  5KRT A;  3T69 A;  4F2R A;  4CJK A;  2P9S B;  3BZC A;  1S6Q A;  3FE1 A;  3DI6 A;  3VEX A;  4DTJ A;  4K8Z A;  3PO5 A;  2PYJ A;  2QWN A;  3EYZ A;  2E2N A;  3V9Z A;  3LP3 A;  3VGL A;  4M3R A;  1HPZ A;  5EXW A;  4CZK A;  1XHX A;  4B1U B;  5F0X A;  2IOC A;  3CME N;  4OLB A;  3F73 A;  1NOY A;  5AFU H;  3SYZ A;  4CJL A;  4NCA A;  2ATQ A;  4CJV A;  3M1F A;  4A61 A;  1HX1 A;  2ZGZ A;  1T7P A;  1KFS A;  1NMD A;  3IG1 A;  3KWG A;  3CCR N;  3H46 O;  2FLO A;  3O3G A;  5ADX A;  3CHW A;  3E9P A;  3C6T A;  2RE2 A;  3AVK A;  4WCE L;  3SNN A;  3WXJ A;  3MX2 A;  2VWK A;  2D0C A;  1T3V A;  2W6K A;  4C8M A;  5AFU A;  2W40 A;  3NCI A;  4CEF A;  3AO2 A;  4PA1 A;  4NLB A;  3V9X A;  2YHB A;  1JLB A;  4IDK A;  4BDP A;  3GE1 A;  1SUQ A;  4EZ9 A;  3SBG A;  4DU3 A;  2NRR A;  4C8O A;  2X6N A;  1QSS A;  1QTM A;  3TTC A;  4CK2 A;  3P83 D;  1VRU A;  3CER A;  3C0B A;  3CFP A;  4BDY A;  1K8K B;  4GW6 A;  3CC2 N;  4C8K A;  2QTD A;  3OYJ A;  4PUO A;  3HT3 A;  1GOC A;  1BDG A;  1SKW A;  3CFO A;  3SBT A;  2ZE2 A;  3CQ8 A;  5A2Q O;  4AHS A;  3HPG A;  5HOO A;  4KTQ A;  1UAX A;  3DXK A;  4UQG A;  2G8I A;  1RNH A;  2A42 A;  4CEB A;  4CZG A;  4BAC A;  1RTI A;  4ZTF A;  4BDZ A;  3ULE B;  4CZI A;  4M41 A;  1XC9 A;  4Z94 A;  4DU4 A;  4B9M A;  3CQY A;  5B8H A;  1J9A A;  4WFB L;  5I3U A;  1T6C A;  4E7I A;  2HF3 A;  4LC9 B;  1RBU A;  3DXM B;  4B1Z A;  1JXE A;  5ELZ A;  4YHH K;  4JV5 K;  4FOE A;  4DHY A;  3WNG A;  3IS9 A;  1R59 O;  5GAD P;  2NRT A;  5M1O A;  4CIF A;  3NFA A;  1RBV A;  4CJR A;  2V51 B;  1NGJ A;  4JNE A;  1X1P A;  4E89 A;  4CZE A;  2V7Y A;  1TL1 A;  3DYA A;  1T6D A;  1HUX A;  4NCB A;  4DCH A;  1Q9X A;  1C0U A;  1SS6 A;  5JS2 A;  3VA0 A;  1IG9 A;  3AV9 A;  4JI4 K;  1ATS A;  4GKK K;  1B9F A;  3MED A;  4DR2 K;  1YTA A;  4KTZ A;  3AAQ A;  3MEG A;  1EQY A;  1BO5 O;  4OGC A;  2NRW A;  3I0S A;  5AQJ A;  4AM6 A;  4PL7 A;  5AQT A;  2NZT A;  1BA0 A;  1TKX A;  3NH1 A;  2P1J A;  5CR4 A;  1X3N A;  1QSY A;  1NOZ A;  3O08 A;  5FPD A;  1I39 A;  4DR5 K;  3JS6 A;  3CPW M;  4DV2 K;  1S72 N;  3HM9 A;  1VQM N;  4DR4 K;  1NGD A;  1DLO A;  1EX4 A;  5M1K A;  4IKF A;  4B08 A;  3MN6 A;  4OPJ A;  1BG3 A;  1B9D A;  3DJC A;  1KVC A;  1BCM A;  4RW4 A;  3TSU A;  4YOR A;  4CHN A;  4MDB A;  4FWO A;  4WE1 A;  2ZWH A;  4OKJ A;  3T1Y K;  3A5L C;  4E1N A;  4FJH A;  4H5T A;  5AZI A;  3K58 A;  2QA4 N;  1RTJ A;  4DR6 K;  4WFN L;  3DLH A;  4JKC A;  4W5T A;  2HF4 A;  1RDA A;  4BY9 C;  4I6M B;  3OYN A;  5D3G A;  1RCH A;  1GOB A;  1IKW A;  3CG7 A;  1S1W A;  3WQT A;  3V9S A;  4NLC A;  1QHT A;  1KVA A;  2E2O A;  2P9S A;  1T44 A;  3OVN A;  2WBN A;  3K57 A;  3ZSZ A;  5C2D A;  1S1V A;  3TAM A;  1HR0 K;  1XWL A;  2HND A;  2KHO A;  2E6L A;  4E1M A;  2JWK A;  4IO9 L;  5DM6 L;  5CHI A;  2BGG A;  4BRC A;  4FLY A;  3MCA B;  1Q7Y O;  2V7Z A;  1L3T A;  4CHQ A;  3AVL A;  3M8R A;  1S22 A;  3E9L A;  1VQK N;  1NKE A;  1BQM A;  1TV6 A;  4CJ4 A;  3GDQ A;  4CFD A;  5KPT A;  3VQB A;  4B1Y B;  3EL2 A;  2AP1 A;  2EHG A;  4Y1D A;  1GLF O;  3IMX A;  3FLC O;  3AVC A;  4LD0 A;  4O4G A;  3VEV A;  4B9T A;  3MEC A;  1RT5 A;  4BR9 A;  4GV6 A;  1ITG A;  4J8F A;  4H0V B;  1QZ5 A;  1J5E K;  1NK7 A;  4CGF A;  4B1V A;  4DTX A;  3SUQ A;  4BR2 A;  2P9P B;  1VSH A;  4DQR A;  4F8R A;  3QBW A;  1N6Q A;  1G15 A;  3AO3 A;  1VSL A;  4KI6 A;  1HNV A;  1YVN A;  2IIR A;  2HHT A;  2WTU A;  1SL0 A;  4DV3 K;  3O5B A;  3ZSW A;  4Z4H A;  5DK5 A;  2KZZ A;  2P9K B;  2YHY A;  2BE2 A;  5JS1 A;  3AAP A;  4CGG A;  4GV3 A;  2AJQ A;  3C7N B;  4A57 A;  4H0Y B;  1S5J A;  5CZ2 A;  2B6A A;  3HI0 A;  2DTU A;  4GV9 A;  1GLL O;  4J2B A;  3KLG A;  4ICL A;  4N56 A;  2UUC K;  3PY8 A;  2OPS A;  3SAH A;  2VG7 A;  3QER A;  3WT0 A;  3VEZ A;  2G8F A;  4NXN K;  4CHY A;  3V6D A;  2F9T A;  5C12 A;  1UA0 A;  5DM7 L;  3C65 A;  3EEQ A;  3EO3 A;  3D7E O;  3IAY A;  2IDO A;  3ZLJ A;  2CGK A;  4R79 A;  2O8E B;  3DLG A;  4CBX A;  1ASW A;  1YTU A;  4CF9 A;  2PFU A;  1SAZ A;  4HCB A;  2GUP A;  4F3O A;  2Z1H A;  2FXU A;  1GLC G;  4CJQ A;  3HBT A;  2X74 A;  3LDL A;  3C94 A;  3UKU A;  1VSK A;  3AVH A;  3DLK A;  1IO2 A;  4BRG A;  1BUP A;  3L4I A;  4J2D A;  3QML A;  4CGI A;  1V4S A;  5M1P A;  2QWO A;  4PL8 A;  2GEL A;  1RT3 A;  2OZM A;  3MK6 A;  4EZ6 A;  2YX6 A;  4I7F A;  2VGM A;  5BR9 A;  4A62 A;  4FVM A;  1SZ2 A;  2WON A;  1EO1 A;  3OTO K;  5AQY A;  3P4I A;  2D0O A;  5AQO A;  3NGI A;  2A5X A;  2PBD A;  3KK3 A;  3QES A;  2E5L K;  2O8C B;  1NGH A;  1OH6 A;  4XH1 A;  2UU9 K;  3MN5 A;  3WUH A;  3FGU A;  4HWI A;  2PAV A;  3OYB A;  2FBX A;  2XHB A;  1N5Y A;  4IEE A;  4FJ8 A;  4DTO A;  5C24 A;  2E4L A;  4E1J A;  5JIC A;  5C10 A;  4CHZ A;  4BRO A;  3ASM A;  1EXQ A;  1CLQ A;  1JL2 A;  3GG4 A;  4IJN A;  4DV4 K;  4HUG A;  1GLA G;  4DSJ A;  4NO7 A;  4A2B A;  4XIU A;  1EWQ A;  3AA4 A;  4BE0 A;  1S9E A;  4DTU A;  1A5W A;  1ZBF A;  4KO0 A;  3O9S A;  4KHY A;  4O0J A;  5M1N A;  3L2Q A;  3VQE A;  2P9I B;  1N8R O;  1KLN A;  3TAR A;  1NU0 A;  3OYM A;  2A1S A;  1YHQ N;  1ZBH A;  4BQL A;  2VGN A;  2JGU A;  1LWF A;  4FLX A;  3U3G A;  3OYA A;  1NGC A;  3SUP A;  3VTH A;  1IV0 A;  1ESV A;  2BUP A;  3LWL A;  3AA5 X;  2HB5 A;  3J80 O;  1YJ9 N;  3VA3 A;  3KJV A;  3B8A X;  1QVF M;  1SKS A;  3OYL A;  3O9R A;  3AAR A;  3V1Q A;  3VQ7 A;  3DLB A;  3BDP A;  3VQ4 A;  4UY8 O;  4NYN A;  1NJW A;  1W9H A;  1ZXO A;  4AM7 A;  3HOS A;  3LM2 A;  1R0A A;  2RF2 A;  3K9K A;  4KH5 A;  4LF8 K;  1K6Y A;  3L6Q A;  4MLH A;  3J81 O;  3QIC A;  4GVM A;  3O9T A;  4K25 A;  3R1X A;  2PYL A;  1NK0 A;  2G8W A;  1VQP N;  1HNX K;  3KD5 E;  3NGZ A;  3SUO A;  3ALY A;  3TAP A;  4B3M K;  2RPI A;  3G10 A;  4FOI A;  3RMD A;  4ELU A;  4MFB A;  3FZM A;  4FW2 A;  4WQ4 A;  3OYE A;  3O3F A;  4YY3 K;  3SZ2 A;  4DQI A;  1E4G T;  1BI4 A;  1JLE A;  2P9L A;  3LAN A;  4N5S A;  4LF9 K;  2ZQB A;  3AO1 A;  4B1X B;  4JK8 A;  4KB0 A;  3KVG A;  3N4P A;  3NH0 A;  4OJR A;  3NF9 A;  2WOM A;  4LF6 K;  2QKK A;  4Q0B A;  4CJ5 A;  5FRO A;  3SPY A;  2Q0R A;  1KC8 O;  1QVG M;  4B9L A;  1YIT N;  3U4L A;  3ZT0 A;  2VCP A;  1TKT A;  1NJX A;  1LAV A;  4LF4 K;  4FZZ A;  4I9Q A;  3KZB A;  2F7T A;  1QQM A;  4PKG A;  3RTV A;  5HRP A;  2UUA K;  4C8N A;  1L3U A;  2FBY A;  5HRO A;  3A8Y A;  4CFB A;  4M63 C;  1VSD A;  4FWM A;  4MQ3 A;  5EOY A;  4CBW A;  2QKB A;  3K5O A;  1KAZ A;  3VF6 A;  2O8B A;  4JD2 B;  4JKF A;  2Q0U A;  3QNO A;  4FJL A;  3BY5 A;  4F2S A;  4KV8 A;  4FZX C;  1F21 A;  2VQF K;  2W6L A;  1NGF A;  3E01 A;  2IAJ A;  2GX9 A;  2YNI A;  4FJI A;  4M3T A;  4H0X B;  4CJP A;  4DLG A;  3U6F A;  1KD1 O;  4E7K A;  1WN7 A;  3VEN A;  1Z26 A;  1GOA A;  4CEZ A;  2A1R A;  4FJ9 A;  3PIP L;  3ZYY X;  3UE5 A;  4EHU A;  2NNW A;  2BAN A;  4CED A;  1TK8 A;  1C6V A;  4CD1 A;  3F9M A;  1LAW A;  1VQ9 N;  1LCU A;  2Q3S A;  4EP4 A;  4X64 K;  2P51 A;  1UOC A;  5AQQ A;  4IOC L;  4CCH A;  1T05 A;  2HHX A;  4W5Q A;  1TKZ A;  4WFA L;  3OYD A;  4H5N A;  1WBB A;  4O8K A;  2UUB K;  2OA8 A;  3D2F A;  4ILG B;  4CJS A;  1NMN A;  1S1X A;  3ZEU A;  4CW7 B;  4JRQ A;  3ATV A;  3D2E A;  3NF6 A;  4CFA A;  3S3O A;  1ZBL A;  2GEM A;  1WAF A;  1ZYQ A;  2KFN A;  4OPA A;  1V4T A;  3S3N A;  3ZCM A;  3ZSX A;  1XMQ K;  3O4W A;  2YJF A;  1RDU A;  4L8R B;  4EP5 A;  2YHX A;  4B3T K;  3M3Z A;  3TTD A;  3OYK A;  4FYD A;  4YDU A;  3B6O A;  3VOV A;  1JCE A;  4BRE A;  1KAY A;  1G99 A;  3R8E A;  1XC3 A;  3ZX3 A;  3TAN A;  1GLD G;  4MO4 A;  1VK0 A;  4PY5 A;  3ZET B;  2VG6 A;  3TAE A;  2BTF A;  4IOX A;  5HRR A;  4WQ5 A;  4QCL A;  3CC4 N;  5KI6 A;  1BCO A;  1HRH A;  1KRP A;  4KAZ A;  1HQE A;  3PO4 A;  2YHA A;  1HNI A;  3WEE A;  4JLH A;  4CFC A;  3RR8 A;  3TSP A;  2O4I A;  4I9L A;  4AHU A;  1UA1 A;  5JLH A;  3RSE B;  2F8T A;  4DR7 K;  2ASO A;  3H08 A;  1VQ5 N;  3G25 A;  2O4G A;  2CH5 A;  3T1A A;  1S3X A;  1NK9 A;  1NG9 A;  2JWL A;  3MEE A;  2FSN A;  3OS0 A;  3HP6 A;  2YHW A;  3CM6 A;  5AQZ A;  4BRQ A;  1IH7 A;  2GBZ A;  1BGX T;  1JKH A;  5BPL A;  3O1W A;  5SWM A;  1ZBI A;  5AQU A;  4YFU A;  4M3X A;  1BU6 O;  4O55 A;  4BRN A;  2E1Z A;  4BGB A;  1P90 A;  1FK9 A;  3AGK A;  4B9V A;  3D45 A;  3LWM A;  3NVM A;  5CZ1 A;  4A2A A;  2KZM A;  3VQQ A;  2FF6 A;  1KCF A;  4H4O A;  3HYF A;  2RKI A;  3C6H A;  4M45 A;  3FR0 A;  2YJE A;  3VES A;  5C15 A;  1T03 A;  3SI6 A;  4DU1 A;  1BA1 A;  3EE8 A;  3UKR B;  4JK7 A;  5AQW A;  4ISF A;  4CZF A;  4ILJ A;  3DRS A;  3V9W A;  1EET A;  4JK9 A;  2IS3 A;  3LP0 A;  1WLJ A;  3P39 A;  4IXC A;  1YUW A;  4BRM A;  3CCV N;  3THW A;  1KLM A;  4XH5 A;  3U9D A;  4DFP A;  4M42 A;  4FJM A;  5JMV A;  3TPQ A;  2Z1G A;  2IVO A;  5HLF A;  4ISE A;  3HO1 A;  1FKO A;  4FWK A;  5M1Q A;  3HST B;  3HK2 A;  1J54 A;  5AQF A;  4W5N A;  1JCG A;  4EIA A;  1TYQ B;  2QWM A;  4JI0 K;  4KPY A;  3GOI A;  3BEX A;  3NHG A;  2D0P A;  3I8D A;  4ID1 A;  1TUU A;  3NDK A;  2OPP A;  3NF8 A;  5SZT A;  3AA3 A;  5J2P A;  1HNZ K;  4RW9 A;  1K8A O;  1P8Z A;  2Q97 A;  4KH4 A;  1LW2 A;  2D1K A;  5CE3 A;  4KHP K;  1MWK A;  3ENH A;  1KQS M;  1HPM A;  3K0S A;  3LDN A;  1TK5 A;  4JHD A;  1WSJ A;  3LAK A;  2YNF A;  4LFC K;  2Q1N A;  3NBP A;  5BN8 A;  1RDB A;  1YJW N;  5C42 A;  2DFH A;  3AVB A;  4BGA A;  4BQZ A;  4JI3 K;  3DRR A;  4WYB A;  4O44 A;  3AGR A;  3MN7 A;  1B92 A;  1BWF O;  4DF4 A;  1QS4 A;  4LFA K;  4K8X A;  3THX B;  4NCG A;  3LZJ A;  2P9N A;  3SMS A;  2LSN A;  1OH5 A;  1DGK N;  3I55 N;  3DOL A;  3QBX A;  1Q18 A;  4LF5 K;  2E20 A;  3M8P A;  1Z25 A;  2YV0 X;  1HJR A;  4MDA A;  1NK4 A;  2IVP A;  4BRI A;  3BP8 A;  4IDH A;  4RTF D;  5GAH P;  3CF5 L;  5AZJ A;  4FPB A;  4BE1 A;  3CMA N;  4B9S A;  2NRV A;  5BPN A;  1JLQ A;  3KKR A;  4K42 A;  3LL3 A;  3HL8 A;  1OVQ A;  4E19 A;  3RMA A;  5AQN A;  4CIE A;  2BH1 A;  1RDC A;  3KWI A;  4OKE A;  3AVI A;  4CK3 A;  4OLA A;  4Z4C A;  2JLE A;  5BRH A;  2DPN A;  1NGI A;  3WQU A;  3ZSY A;  4FK0 A;  5GAE P;  1M90 O;  3RVC A;  1C1A A;  4F3T A;  2D0B A;  3J7Y P;  2YI1 A;  2X6S A;  4JKD A;  4JKE A;  5AQH A;  1NK8 A;  4WQ4 C;  2XY6 A;  4DV6 K;  3PX6 A;  5KQD A;  1O1W A;  3JYT A;  3U3Y A;  5BPM A;  3V9U A;  2WC9 A;  4X66 K;  3O9U A;  4BVO A;  1BI4 B;  2P9L B;  3ZSR A;  3MN9 A;  3KD1 E;  4JKA A;  4DV5 K;  1VSI A;  1JLG A;  3PX4 A;  5EU7 A;  1XQS C;  3O6W A;  4FWQ A;  4FLZ A;  5FRM A;  1BIZ A;  4NXM K;  2Z1J A;  1Q82 O;  3CCQ N;  3ZT3 A;  2Y1I A;  3O80 A;  1WSH A;  4DFK A;  4JI7 K;  1OKJ A;  1RGI A;  4LY7 A;  3ZET A;  2FBT A;  3HOT A;  3K5L A;  2HHS A;  4FPA A;  4KHW A;  1HKB A;  3PV8 A;  3MXI A;  4PWD A;  1IKX A;  3CCU N;  3CJ1 A;  3SQ1 A;  1CXU A;  2IC3 A;  4AHT A;  3TWH A;  4JI1 K;  2I7P A;  4FM0 A;  2HNY A;  1SL2 A;  5MLC Q;  2ASM A;  1SQK A;  4K43 A;  4XEI A;  3L4Q A;  4F4K A;  4DR3 K;  4FZY A;  4YOW A;  4JKG B;  5BRD A;  4EFH A;  1Q86 O;  4BG8 A;  3OS1 A;  3OJU A;  4BR5 A;  1VQ8 N;  1VQO N;  4K41 A;  3V1O A;  4JN4 A;  4B3S K;  5BRE A;  4JS5 A;  5BN9 A;  4OX9 K;  4FSV A;  3F9K A;  2XY8 A;  3CJA A;  5H1S Q;  3PUF A;  1W0H A;  1U6Z A;  3QDK A;  4CJ7 A;  1HMV A;  3RWU A;  3EZW A;  4IOA L;  3CET A;  1KTQ A;  4CJW A;  2UXD K;  4GVE A;  5AQI A;  2HW3 A;  3SMP A;  2RHK A;  2FC0 A;  1U48 A;  1M1K O;  1QQO A;  3HM8 A;  1W97 L;  4ELV A;  5AR0 A;  1VSF A;  3NF7 A;  4CGH A;  4FJJ A;  4CER A;  2ZF5 O;  3R9P A;  2D4W A;  1S6P A;  4CEA A;  3RRG A;  3I8B A;  3NE6 A;  1EWR A;  4HUF A;  2HHQ A;  2A40 A;  4CI6 A;  4BRK A;  4AQY K;  4KHS A;  2O8B B;  2Q31 A;  4M7X A;  4OPH A;  3E9O A;  1BQN A;  4ISG A;  3FFK B;  1BL3 A;  1UWB A;  2F96 A;  3K59 A;  3H1V X;  5CYQ A;  2W42 A;  2OAN A;  4HUE A;  4IFV A;  5JVH L;  1VSE A;  2HBM A;  1C0T A;  1N36 K;  4KFB A;  3FZF A;  5C25 A;  3H3O B;  5AQG A;  4DFM A;  3HP9 A;  4B9U A;  4DQS A;  4G9Z A;  5AQS A;  4WQ5 C;  4IJA A;  1QE1 A;  3L3V A;  2HOE A;  1N32 K;  1Q8I A;  4DB3 A;  1DTT A;  4BE2 A;  3EKS A;  1NJZ A;  3ZT4 A;  3CI5 A;  5GIO A;  1OH8 A;  1IBM K;  4CZH A;  2E8A A;  3F2K A;  4YOV A;  4FM1 A;  2XY7 A;  1IJJ A;  1WSF A;  5LJV A;  3LDO A;  4KKO A;  3FZK A;  4BWM A;  4DTN A;  3I0R A;  4CZJ A;  2XY5 A;  2NUB A;  3KK2 A;  3HVR A;  1BOT O;  3K5N A;  3A2F A;  2NLX A;  3O8M A;  1U45 A;  4BRD A;  1JLA A;  3A5O C;  5TKW A;  4Z4E A;  4FWL A;  4GKJ K;  3VQ6 A;  3VMF B;  3GL1 A;  2ASP A;  1BHL A;  4BC5 A;  3MDQ A;  2A6A A;  3MXJ A;  3VET A;  2D5R A;  2D0A A;  4EHT A;  4JRP A;  1RT1 A;  1Q81 O;  2E88 A;  3TU5 A;  1Z6R A;  2YNH A;  5K14 A;  3MXM A;  4ZTJ A;  1D9F A;  4QOZ B;  3CCE N;  3P31 A;  4FCY A;  3M8S A;  4DS5 A;  4CES A;  3OBY A;  1NJI O;  4FW1 A;  4JI6 K;  3G4S N;  2P5O A;  3QIP A;  1SL1 A;  4DFJ A;  2P9N B;  1OVY A;  4DLE A;  2P9P A;  3THX A;  5FRN A;  3CJ7 A;  3G0Z A;  1EKE A;  4NYF A;  4JI5 K;  1IKV A;  3L2R A;  2PZS A;  1TL3 A;  1HJO A;  4C1N K;  3HPH A;  4JKH A;  2RN2 A;  1E3M A;  1RIL A;  4B8A B;  3CJC A;  3KK7 A;  1TAQ A;  2EX3 A;  3AVG A;  4CEE A;  4CF1 A;  3OYH A;  4FXD A;  2P9I A;  4DQQ A;  3G71 N;  3CCL N;  4AF1 A;  3DOK A;  3T19 A;  4Q5V A;  4B9N A;  2PY5 A;  1QHA A;  1GLE G;  4BRA A;  4W5O A;  3M8Q A;  3QIO A;  3K9J A;  4J2E A;  1RT6 A;  3VEO A;  2HHW A;  3AO5 A;  4RG8 A;  1NGE A;  2G8U A;  1RT4 A;  4C1N I;  1TYQ A;  2GTD A;  3FZH A;  3Q7B A;  2E2Q A;  4ILH A;  1HYS A;  4PKH A;  3TR8 A;  4IBN A;  3TI0 A;  3ZSQ A;  1C0F A;  2NRH A;  3HJF A;  4JKG A;  4KHU A;  2NRX A;  4I6M A;  4Y1C A;  5KGW A;  3OA9 A;  4E0D A;  1DKG D;  3NVK A;  2O8C A;  1D4X A;  1KVB A;  3NMU A;  4AHC A;  5AQV A;  5AZI B;  3KLH A;  4FK4 A;  4Z4G A;  4FWR A;  3QIN A;  3UKR A;  2Z1I A;  4A5B A;  2F4V K;  4OKK A;  3BZK A;  2VG5 A;  1LOT B;  2P5G A;  3OHR A;  2UXB K;  4A5A A;  3T1H K;  1C0G A;  1YT3 A;  3SCX A;  1Q9Y A;  1CZB A;  3OY9 A;  5HRN A;  4FL9 A;  1JXB A;  3ULD A;  5AQX A;  3J7A P;  2ZD1 A;  3CM5 A;  5BRF A;  3VQ5 A;  3KLE A;  4IG3 A;  2DFE A;  2DFF A;  1X9M A;  3LAL A;  5GIP A;  4O5F A;  3LAM A;  3AVA A;  2YCH A;  3GBT A;  2O8E A;  4FJN A;  5JVG L;  1XHZ A;  3ENO A;  2QWR A;  1J6Z A;  4CVN E;  3DLL L;  1WUA A;  3SAG A;  1S1T A;  1IBL K;  4DKW A;  3S9H A;  2E1Y A;  3HRG A;  3C6U A;  1U47 A;  4HHT A;  3P5J A;  1NWK A;  4OO1 J;  1KAX A;  1MA9 B;  4U67 L;  4IFE A;  2OZS A;  2HBK A;  4NB4 A;  4BRH A;  1HKC A;  4R5P A;  3IKM A;  2VYP A;  3AVM A;  1J5O A;  3OYC A;  5CY4 A;  4IWV A;  3CPE A;  4DUZ K;  3QEX A;  3E1Y A;  3VPZ A;  3FZL A;  4PQU A;  5JLF A;  4JAX A;  5E41 A;  2E6M A;  3ENB A;  1NNE A;  1I94 K;  2OTJ N;  4KHN A;  1TUY A;  3CYM A;  5AZJ B;  1WAJ A;  3K5M A;  1VSM A;  3QFU A;  4QAG A;  3V1R A;  3KTQ A;  5FPN A;  4H03 B;  1RBS A;  4DR1 K;  4KTW A;  3SUN A;  2KKZ A;  3VQP A;  4Y0W A;  4FWS A;  3H1Q A;  5GAG P;  2Y1J A;  3F5T A;  5AQP A;  4B3R K;  1DT9 A;  4H5W A;  2OYQ A;  1XUP O;  1RTH A;  1JCF A;  3IFR A;  3RR7 A;  3LDS A;  3KLF A;  4YDU C;  3SV3 A;  3WXM B;  4CZL A;  4BRL A;  1VQ4 N;  1FXX A;  3I33 A;  2QWP A;  5J2Q A;  1RTD A;  4JHD B;  3AVF A;  3O4N A;  3ZEU B;  1REV A;  2B5J A;  3PSI A;  4DS4 A;  4I2Q A;  3D2F B;  5FPM A;  3QB0 A;  4CF0 A;  3OS2 A;  4FWN A;  5J1E A;  1RDW X;  4TSX A;  3UIQ A;  4H5R A;  3DRP A;  4FLW A;  1NKB A;  3AVJ A;  2G8H A;  3T3F A;  1S9G A;  1HQU A;  3NGY A;  4JKB A;  4N76 A;  3WNH A;  3VEY A;  2W41 A;  4OGE A;  3JSM A;  3J7Z O;  3CCJ N;  3LZI A;  3ZT1 A;  2AA4 A;  3LPT A;  1HKG A;  5LY3 A;  1NBW A;  3QEV A;  4E7J A;  4BC2 A;  3W0L A;  2CGL A;  1MDU B;  1RBR A;  3HXM A;  3AA2 A;  3THW B;  3VQC A;  4BC4 A;  3CCS N;  3QEP A;  3DAW A;  3SV4 A;  3VTI A;  1U49 A;  4H0T B;  4E7H A;  4N47 A;  2IGI A;  4E3S A;  1XNR K;  3HVT A;  1VSJ A;  4IO8 A;  4JD2 A;  4RW8 A;  3ZSV A;  3SQ2 A;  3JXU A;  4C8L A;  3ZX2 A;  4FLU A;  4V19 S;  2HBJ A;  1D9D A;  4M3W A;  2OCE A;  1W7A A;  3SAF A;  2FSJ A;  1N33 K;  4CEC A;  5IT9 O;  4FM2 A;  1ZC6 A;  1VQL N;  3PX0 A;  1Y97 A;  4CF2 A;  4BG9 A;  4CGD A;  4MO5 A;  4B1W B;  1HYZ A;  2EWS A;  4RW7 A;  2OPR A;  2KQ2 A;  3VF4 A;  4GY2 B;  4AIL C;  1RFQ A;  4W5R A;  4O5B A;  1O13 A;  1YF5 L;  4DQ8 A;  2UXC K;  1CXQ A;  4H4M A;  3IUC A;  2KTQ A;  1TVR A;  2A41 A;  3KK1 A;  5IWA K;  3DMJ A;  1QZ6 A;  5HP1 A;  2CH6 A;  2ITM A;  3VGM A;  1YVU A;  5AQM A;  2OTL N;  3PIO L;  1HNW K;  1VRT A;  3UB5 A;  3QEW A;  3SPZ A;  3RSE A;  5FPE A;  2F8S A;  4BR0 A;  3SQ4 A;  4H0O A;  3H6E A;  3LM9 A;  4DF8 A;  3OYI A;  2KLA A;  3WEE B;  2QXF A;  3FFI A;  5EX5 A;  2ZJR L;  3JAM O;  1YAG A;  2QI2 A;  4LSL A;  3RRH A;  2GWJ A;  1WSE A;  5AQK A;  1YI2 N;  3BUZ B;  4DTM A;  4BC3 A;  4C23 A;  1JLF A;  3CJB A;  1YJN N;  3O4Q A;  3SQ0 A;  4DTR A;  2YNG A;  3RMC A;  1YXQ A;  3DM2 A;  2YKM A;  1U04 A;  3R3L A;  3C6A A;  4JEP A;  4ELT A;  4LSN A;  1TGO A;  1IKY A;  3DXK B;  2ITG A;  3J8A A;  1TAU A;  3O9Q A;  3EN9 A;  3KIO A;  2CGJ A;  3CD6 N;  1ILY A;  1NJY A;  3CQX A;  1ZBS A;  5KTQ A;  1WBD A;  4CZM A;  4AHV A;  2HHH K;  2KFZ A;  4JI2 K;  3WNE A;  3C95 A;  1TKD A;  4BRF A;  3LP2 A;  4M3Z A;  3D2E B;  4DTS A;  2O8D A;  3VQ9 A;  3IRX A;  5HRS A;  3V81 A;  4RW6 A;  1WOQ A;  1JLC A;  4O8U A;  2G8V A;  4B3O A;  3CXC M;  1L3V A;  1D8Y A;  3EZ5 A;  1NGA A;  2Q2R A;  4QS8 A;  4CD3 A;  2R7Y A;  1J53 A;  3HPO A;  3SK3 A;  3B6P A;  1FJG K;  1ZBU A;  3P38 A;  3KHY A;  4FJX A;  1RDD A;  2HVH A;  1DEJ A;  1L3S A;  4FJK A;  2HST A;  2WFB A;  5E26 A;  4J2A A;  5AQL A;  1MWM A;  3CCM N;  1VAZ A;  1A5V A;  5J2N A;  1I3A A;  5J2M A;  4BVP A;  1VHX A;  3OW2 M;  2DY4 A;  1NGG A;  4Z0U A;  1WSI A;  2Q36 A;  4QS9 A;  5HBM A;  4BRP A;  4U7B A;  4CJ3 A;  2O8F B;  1E4F T;  3LDP A;  4BWJ A;  4DV7 K;  4DQP A;  4CE9 A;  4KHQ A;  4RWT A;  4Z4F A;  4HVJ A;  3TAF A;  4HCC A;  4DV1 K;  3EKU A;  1X9W A;  2QXL A;  3L0Q A;  3A5M C;  4LH5 A;  4M3Y A;  3DWL A;  1C0M A;  3MCP A;  1LV5 A;  3I56 N;  2B4J A;  4YOX A;  1BIS A;  1D5A A;  2ZGY A;  5DMR A;  5FDL A;  2VWJ A;  3THV A;  2H3G X;  2I5J A;  5CYM A;  3TSQ A;  3UKU B;  1CZ9 A;  4CBU A;  4GNI A;  5KRS A;  3L3U A;  4KB1 A;  3EE9 A;  2ZJQ L;  3AVN A;  2HHU A;  1RT7 A;  2QW9 A;  1C1C A;  4DSF A;  5T7B A;  1CZA N;  1L5U A;  1N34 K;  2ZJP L;  1GLJ O;  4FK2 A;  3N4Q A;  1MU2 A;  4LH4 A;  4FJ5 A;  3MX5 A;  3WXK A;  4N41 A;  4EAH D;  1IBK K;  1EP4 A;  4DMN A;  4ZHR A;  3DLE A;  4I2P A;  3ISN C;  4DG1 A;  3ID8 A;  1SV5 A;  5EVZ A;  3W3D A;  4YOT A;  4B8C A;  1QSL A;  2QM1 A;  3KLI A;  4CJE A;  4FLV A;  4FJG A;  5C2F A;  3OBW A;  3VF2 A;  4CF8 A;  2QWL A;  3VQA A;  3HZ6 A;  1U4B A;  2I7N A;  3L8B A;  2E2P A;  4XH4 A;  3ITH A;  5FLX O;  1JJ2 M;  1NLV A;  1X9J A;  4CJU A;  2P9U B;  3EY1 A;  2P9U A;  2A3Z A;  3H45 C;  4LF7 K;  4YOU A;  2P9K A;  2GUI A;  3ATU A;  3VN5 A;  4HTU A;  1LWE A;  4DSE A;  3O3H A;  3MAQ A;  3VQ8 A;  5LMN K;  2HVI A;  2GV9 A;  3QNN A;  3THY B;  3TAB A; 
#chains in the Genus database with same CATH homology
 1WSG A;  3LWM A;  3QIN A;  1L3T A;  2Z1I A;  4CHQ A;  5CZ1 A;  3AVL A;  3M8R A;  4OKK A;  2KZM A;  3VQQ A;  1KCF A;  4JS4 A;  1BQM A;  2VG5 A;  4H4O A;  1TV6 A;  1NKE A;  3HYF A;  4CJ4 A;  3NH2 A;  2RKI A;  2P5G A;  4KI4 A;  1SKR A;  3AO4 A;  4CFD A;  4M45 A;  3VQB A;  1YT3 A;  2EHG A;  4Y1D A;  3SCX A;  1Q9Y A;  3OYF A;  1CZB A;  3OY9 A;  5HRN A;  4LD0 A;  3AVC A;  4CEQ A;  1JXB A;  4O4G A;  3SI6 A;  1T03 A;  1DTQ A;  3ULD A;  4DU1 A;  4B9T A;  3MEC A;  1RT5 A;  4DTP A;  1ASV A;  2ZD1 A;  3CM5 A;  2HHV A;  1ITG A;  2FBV A;  3DRS A;  3VQ5 A;  4IG3 A;  3KLE A;  3V9W A;  1EET A;  4CGF A;  4DTX A;  3SUQ A;  1NK7 A;  3RMB A;  2DFE A;  4GMJ B;  3QEI A;  2HMI A;  2IS3 A;  1VSH A;  3LP0 A;  2DFF A;  1ASU A;  4DQR A;  1X9M A;  3LAL A;  4F8R A;  1N6Q A;  1G15 A;  1WLJ A;  3TAG A;  3AO3 A;  3LAM A;  1VSL A;  3P1G A;  3AVA A;  4KI6 A;  1HNV A;  3L2V A;  1KLM A;  4FJN A;  1XHZ A;  4CIG A;  2HHT A;  4DFP A;  4M42 A;  1SL0 A;  4FJM A;  2BDP A;  2Z1G A;  3ZSW A;  4CHO A;  1S1T A;  4G1Q A;  4Z4H A;  5HLF A;  5DK5 A;  4IFY A;  3S9H A;  2KZZ A;  3HO1 A;  1FKO A;  2BE2 A;  5JS1 A;  3HST B;  4CGG A;  3HK2 A;  3C6U A;  3L2W A;  2ETJ A;  1U47 A;  1J54 A;  2AJQ A;  4W5N A;  3ZSO A;  4HHT A;  3P5J A;  4O0I A;  1S5J A;  5CZ2 A;  4KPY A;  2B6A A;  1XI1 A;  4KRE A;  3NHG A;  2DTU A;  1NK6 A;  3I8D A;  4ID1 A;  3QO9 A;  1TK0 A;  4J2B A;  3KLG A;  2OZS A;  1LWC A;  4ICL A;  3NDK A;  4N56 A;  4R5P A;  2OPP A;  2OPS A;  3NF8 A;  5SZT A;  3AA3 A;  3PY8 A;  5J2P A;  3AVM A;  4RW9 A;  2VG7 A;  3OYC A;  5CY4 A;  1J5O A;  2X78 A;  3QER A;  1LW2 A;  4E7L A;  3QEX A;  2G8F A;  1RBT A;  4CHY A;  1C1B A;  3V6D A;  4PQU A;  2KW4 A;  1UA0 A;  3LPU A;  1JL1 A;  1TK5 A;  4IG0 A;  1WSJ A;  3LAK A;  2E6M A;  2YNF A;  5E41 A;  3SJJ A;  4DSL A;  3QET A;  1KFD A;  4KHN A;  3CYM A;  3K2P A;  3NBP A;  4CHP A;  1WAJ A;  3K5M A;  1VSM A;  1RDB A;  4QAG A;  3IAY A;  2IDO A;  3V1R A;  5C42 A;  2DFH A;  3AVB A;  3DLG A;  3KTQ A;  2XRI A;  1ASW A;  1RBS A;  3DRR A;  4OPK A;  4KTW A;  4O44 A;  4AH9 A;  4CF9 A;  3SUN A;  1YTU A;  1B92 A;  4DF4 A;  4HCB A;  1X9S A;  1QS4 A;  3VQP A;  4F3O A;  2Z1H A;  3WNF A;  4K8X A;  2Y1J A;  3OYG A;  4NCG A;  3LZJ A;  3TAQ A;  2LSN A;  4CJQ A;  2X74 A;  4ID5 A;  2OYQ A;  3C94 A;  3DOL A;  1VSK A;  3AVH A;  3DLK A;  1IO2 A;  1RTH A;  3KKS A;  3RR7 A;  1QQC A;  2HNZ A;  1Z25 A;  3M8P A;  3KLF A;  2YV0 X;  3LDS A;  4J2D A;  1HJR A;  3LP1 A;  1NK4 A;  1KSP A;  3SV3 A;  4CGI A;  4BE1 A;  1FXX A;  4B9S A;  5J2Q A;  1RTD A;  1RT3 A;  2OZM A;  1JLQ A;  3KKR A;  3AVF A;  3O4N A;  4EZ6 A;  1REV A;  2B5J A;  4I7F A;  4DS4 A;  3HL8 A;  4I2Q A;  4E19 A;  4FVM A;  3RMA A;  4CIE A;  2WON A;  4CF0 A;  1RDC A;  4OLA A;  3OS2 A;  5J1E A;  1LW0 A;  4TSX A;  4OKE A;  2G8K A;  3UIQ A;  4FLW A;  3DRP A;  1NKB A;  4CGJ A;  3AVI A;  3AVJ A;  4CK3 A;  1HYV A;  4Z4C A;  2JLE A;  4OVL A;  1RT2 A;  3NGI A;  1S9G A;  3T3F A;  2G8H A;  4DSI A;  1HQU A;  3KK3 A;  3QES A;  3NGY A;  4Z4I A;  4N76 A;  3WNH A;  3ZSY A;  4CJF A;  4YNQ A;  4FK0 A;  4FJ7 A;  4OGE A;  1C1A A;  3JSM A;  4F3T A;  1WNS A;  2D0B A;  3OYB A;  3LZI A;  5I42 A;  2X6S A;  2XO7 A;  4KRF A;  3ZT1 A;  2FBX A;  3QLH A;  3LPT A;  2XHB A;  3DLR A;  1N5Y A;  1NK8 A;  1A5X A;  2XY6 A;  4M3U A;  3PX6 A;  4DTO A;  1O1W A;  3JYT A;  3QEV A;  3U3Y A;  4E7J A;  3BGR A;  3S3M A;  4FJ8 A;  1ZBI A;  4DSK A;  3V9U A;  5C24 A;  2E4L A;  1RBR A;  1BI4 B;  3HXM A;  3ZSR A;  5KGX A;  3AA2 A;  4CHZ A;  3KD1 E;  3ASM A;  1NK5 A;  3VQC A;  1FKP A;  3ZT2 A;  1EXQ A;  1CLQ A;  1VSI A;  3QEP A;  1T8E A;  1JL2 A;  1JLG A;  3VQD A;  3OJS A;  3PX4 A;  3SV4 A;  1U49 A;  4HUG A;  5EU7 A;  4DSJ A;  4FZZ A;  3V4I A;  4XIU A;  4DWI A;  1BIU A;  3AA4 A;  3CFR A;  4BE0 A;  1S9E A;  4E7H A;  4DTU A;  1A5W A;  1ZBF A;  4KO0 A;  4N47 A;  2IGI A;  4E3S A;  4FLZ A;  4KHY A;  3HVT A;  5FRM A;  1BIZ A;  1VSJ A;  2Z1J A;  4O0J A;  2YKN A;  2OPQ A;  3ZT3 A;  3VQE A;  3L2Q A;  4RW8 A;  2Y1I A;  3ZSV A;  4CK1 A;  3SQ2 A;  4CEO A;  1KLN A;  3TAR A;  1WSH A;  4DFK A;  3OYM A;  4C8L A;  3D0P A;  4FLU A;  2A1S A;  1ZBH A;  4LY7 A;  1D9D A;  4M3W A;  4CEC A;  1S1U A;  2JGU A;  2FBT A;  1LWF A;  4FLX A;  3K5L A;  4AHR A;  3U3G A;  3OYA A;  4FM2 A;  2HHS A;  4KHW A;  3SUP A;  3PV8 A;  3MXI A;  3L2U A;  3PX0 A;  4PWD A;  1IKX A;  1Y97 A;  3LWL A;  4CF2 A;  3AA5 X;  4H8K A;  4CJT A;  2HB5 A;  4CGD A;  1NKC A;  4M3Z A;  3VA3 A;  3KJV A;  3SQ1 A;  1CXU A;  2IC3 A;  1HYZ A;  4AHT A;  4RW7 A;  3TWH A;  4FM0 A;  3NAE A;  2HNY A;  1SKS A;  2OPR A;  2KQ2 A;  3OYL A;  4AIL C;  1SL2 A;  3V1Q A;  3VQ7 A;  2QK9 A;  4FLT A;  4W5R A;  4O5B A;  3DLB A;  4F4K A;  5KRT A;  4FZY A;  3BDP A;  1CXQ A;  3VQ4 A;  4H4M A;  2KTQ A;  4NYN A;  1TVR A;  1W9H A;  1NJW A;  4F2R A;  4CJK A;  3KK1 A;  1S6Q A;  3DMJ A;  5HP1 A;  3OS1 A;  3OJU A;  3DI6 A;  4DTJ A;  4K8Z A;  1YVU A;  1R0A A;  2RF2 A;  3V1O A;  2PYJ A;  3PO5 A;  1K6Y A;  3EYZ A;  4JS5 A;  1VRT A;  3V9Z A;  3F9K A;  3QEW A;  3SPZ A;  2XY8 A;  4GVM A;  2F8S A;  3SQ4 A;  3LP3 A;  4M3R A;  1HPZ A;  3PUF A;  1W0H A;  2PYL A;  1NK0 A;  2G8W A;  3KD5 E;  4DF8 A;  3NGZ A;  1XHX A;  1HMV A;  3OYI A;  3RWU A;  3SUO A;  2IOC A;  3ALY A;  2QXF A;  3TAP A;  2RPI A;  3FFI A;  4OLB A;  3G10 A;  3RMD A;  3F73 A;  1KTQ A;  4MFB A;  4CJW A;  3SYZ A;  1NOY A;  4CJL A;  4ELU A;  4FW2 A;  4NCA A;  2HW3 A;  4LSL A;  2ATQ A;  4CJV A;  3RRH A;  3OYE A;  2FC0 A;  3O3F A;  1WSE A;  1U48 A;  3SZ2 A;  4DQI A;  4DTM A;  1JLF A;  1T7P A;  1KFS A;  1JLE A;  1BI4 A;  3O4Q A;  4DTR A;  3SQ0 A;  4ELV A;  3IG1 A;  3LAN A;  4N5S A;  1VSF A;  2YNG A;  3RMC A;  3NF7 A;  2ZQB A;  4CGH A;  3AO1 A;  3O3G A;  4FJJ A;  3DM2 A;  4CER A;  3C6T A;  2YKM A;  1U04 A;  3AVK A;  3SNN A;  4ELT A;  4LSN A;  4KB0 A;  1TGO A;  1IKY A;  1S6P A;  2VWK A;  2D0C A;  2ITG A;  1TAU A;  4CEA A;  4C8M A;  3NE6 A;  3RRG A;  3KIO A;  4HUF A;  3NH0 A;  2HHQ A;  3NCI A;  4CEF A;  4OJR A;  3NF9 A;  2WOM A;  1NJY A;  2QKK A;  5KTQ A;  3AO2 A;  2KFZ A;  4AHV A;  4KHS A;  4Q0B A;  4PA1 A;  3V9X A;  2YHB A;  4CJ5 A;  1JLB A;  4IDK A;  5FRO A;  3WNE A;  3SPY A;  4BDP A;  3C95 A;  1SUQ A;  4B9L A;  1BQN A;  4EZ9 A;  3ZT0 A;  1TKD A;  4DU3 A;  1BL3 A;  1UWB A;  2F96 A;  3K59 A;  4C8O A;  5CYQ A;  1TKT A;  2X6N A;  3LP2 A;  1LAV A;  2W42 A;  4HUE A;  1NJX A;  1QTM A;  1QSS A;  4CK2 A;  3P83 D;  4IFV A;  1VRU A;  4I9Q A;  1VSE A;  4DTS A;  3RTV A;  1C0T A;  3IRX A;  3VQ9 A;  5HRS A;  5HRP A;  4KFB A;  4C8N A;  4RW6 A;  3CFP A;  2FBY A;  4BDY A;  4GW6 A;  5C25 A;  5HRO A;  1L3U A;  1JLC A;  4C8K A;  4CFB A;  2G8V A;  4B3O A;  1VSD A;  4MQ3 A;  1L3V A;  4DFM A;  1D8Y A;  3OYJ A;  3HP9 A;  4B9U A;  4DQS A;  3EZ5 A;  4PUO A;  3HT3 A;  2QKB A;  3K5O A;  1QE1 A;  1GOC A;  3L3V A;  2R7Y A;  1J53 A;  3HPO A;  3QNO A;  1Q8I A;  1SKW A;  4FJL A;  3B6P A;  4F2S A;  3CFO A;  4KV8 A;  1DTT A;  4BE2 A;  1ZBU A;  2ZE2 A;  3CQ8 A;  1NJZ A;  4FZX C;  3ZT4 A;  1F21 A;  4AHS A;  4FJX A;  3HPG A;  4KTQ A;  1UAX A;  4UQG A;  2G8I A;  4FM1 A;  2XY7 A;  3E01 A;  1RNH A;  2IAJ A;  4CEB A;  2YNI A;  4FJI A;  1RDD A;  1WSF A;  4M3T A;  2HVH A;  4CJP A;  1L3S A;  4KKO A;  4BAC A;  4DLG A;  1RTI A;  4BWM A;  3U6F A;  4ZTF A;  4DTN A;  4BDZ A;  4FJK A;  4E7K A;  4M41 A;  3I0R A;  2XY5 A;  1WN7 A;  2NUB A;  1XC9 A;  4J2A A;  3KK2 A;  4DU4 A;  4B9M A;  1Z26 A;  1GOA A;  4CEZ A;  2A1R A;  4FJ9 A;  1A5V A;  3HVR A;  1I3A A;  5J2N A;  1J9A A;  5J2M A;  5I3U A;  2BAN A;  4CED A;  3K5N A;  1TK8 A;  4E7I A;  1C6V A;  3A2F A;  1RBU A;  1LAW A;  1U45 A;  2DY4 A;  1JLA A;  1JXE A;  4Z4E A;  4Z0U A;  2Q3S A;  3VQ6 A;  4EP4 A;  1WSI A;  2P51 A;  1BHL A;  1UOC A;  3WNG A;  5HBM A;  3IS9 A;  4CCH A;  1T05 A;  2HHX A;  4W5Q A;  1TKZ A;  4CIF A;  3NFA A;  3OYD A;  3MXJ A;  1RBV A;  4CJR A;  4CJ3 A;  4BWJ A;  4DQP A;  1X1P A;  2D5R A;  4E89 A;  2D0A A;  4CE9 A;  4KHQ A;  2OA8 A;  1TL1 A;  4JRP A;  3DYA A;  1RT1 A;  4Z4F A;  4CJS A;  1S1X A;  4HVJ A;  4JRQ A;  3TAF A;  2YNH A;  5K14 A;  3MXM A;  3NF6 A;  4ZTJ A;  1D9F A;  4HCC A;  1X9W A;  4QOZ B;  4NCB A;  4LH5 A;  4M3Y A;  1Q9X A;  1C0U A;  4FCY A;  1C0M A;  4CFA A;  5JS2 A;  3M8S A;  3VA0 A;  3S3O A;  1LV5 A;  4DS5 A;  2B4J A;  4CES A;  1IG9 A;  1ZBL A;  3AV9 A;  1BIS A;  1D5A A;  1WAF A;  5DMR A;  5FDL A;  2VWJ A;  3THV A;  1ZYQ A;  2KFN A;  2I5J A;  4FW1 A;  5CYM A;  1B9F A;  3S3N A;  3ZCM A;  3ZSX A;  3MED A;  1CZ9 A;  5KRS A;  2P5O A;  1YTA A;  4KTZ A;  3QIP A;  1SL1 A;  3L3U A;  4DFJ A;  4KB1 A;  3MEG A;  4DLE A;  4L8R B;  4EP5 A;  4OGC A;  3I0S A;  4FYD A;  3OYK A;  5FRN A;  3AVN A;  2HHU A;  1RT7 A;  3B6O A;  3G0Z A;  1EKE A;  4NYF A;  1C1C A;  4DSF A;  5T7B A;  1TKX A;  3NH1 A;  1IKV A;  3L2R A;  2P1J A;  3TAN A;  1TL3 A;  1L5U A;  2PZS A;  3HPH A;  1QSY A;  1VK0 A;  1NOZ A;  1I39 A;  2RN2 A;  4PY5 A;  4FK2 A;  1MU2 A;  1RIL A;  2VG6 A;  4B8A B;  3HM9 A;  3TAE A;  4LH4 A;  5HRR A;  4FJ5 A;  1TAQ A;  2EX3 A;  3AVG A;  4QCL A;  1DLO A;  4N41 A;  1EX4 A;  5KI6 A;  4CEE A;  1BCO A;  4CF1 A;  3OYH A;  4FXD A;  1HRH A;  1EP4 A;  4DMN A;  4IKF A;  4ZHR A;  4DQQ A;  3DLE A;  4B08 A;  1KRP A;  4I2P A;  4KAZ A;  3ISN C;  4OPJ A;  1HQE A;  4DG1 A;  1B9D A;  1KVC A;  1BCM A;  1SV5 A;  2YHA A;  4RW4 A;  3PO4 A;  3DOK A;  3T19 A;  4B8C A;  1HNI A;  4Q5V A;  1QSL A;  4B9N A;  4JLH A;  4CHN A;  3KLI A;  4CFC A;  4WE1 A;  4CJE A;  4OKJ A;  4W5O A;  4FLV A;  2PY5 A;  3RR8 A;  4E1N A;  4FJG A;  4FJH A;  3M8Q A;  4CF8 A;  3K58 A;  1RTJ A;  2O4I A;  3QIO A;  4I9L A;  4AHU A;  3DLH A;  4B9V A;  1UA1 A;  4J2E A;  4W5T A;  1RT6 A;  3VQA A;  1RDA A;  2HHW A;  3OYN A;  5D3G A;  3AO5 A;  4RG8 A;  2F8T A;  1RCH A;  1GOB A;  3H08 A;  1U4B A;  2O4G A;  2G8U A;  3L8B A;  1RT4 A;  1IKW A;  3ITH A;  3CG7 A;  1S1W A;  4CJU A;  3T1A A;  3V9S A;  1NK9 A;  3EY1 A;  3MEE A;  1QHT A;  1KVA A;  1HYS A;  2GUI A;  4IBN A;  3TR8 A;  3TI0 A;  3OS0 A;  3ZSQ A;  3HP6 A;  3OVN A;  3HJF A;  3VN5 A;  4HTU A;  3CM6 A;  4KHU A;  1LWE A;  1IH7 A;  4Y1C A;  3V81 A;  2GBZ A;  1BGX T;  1JKH A;  5KGW A;  3K57 A;  4E0D A;  3ZSZ A;  1KVB A;  1S1V A;  5SWM A;  3TAM A;  4AHC A;  4YFU A;  3O3H A;  3MAQ A;  4DSE A;  4O55 A;  4M3X A;  3VQ8 A;  1XWL A;  3KLH A;  4FK4 A;  2HND A;  2E6L A;  2HVI A;  4Z4G A;  4E1M A;  1FK9 A;  2GV9 A;  3QNN A;  2BGG A;  3TAB A;  3D45 A;  4FLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...