1RDDA

Crystal structure of escherichia coli rnase hi in complex with mg2+ at 2.8 angstroms resolution: proof for a single mg2+ site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Crystal structure of Escherichia coli RNase HI in complex with Mg2+ at 2.8 A resolution: proof for a single Mg(2+)-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 37
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rddA00
3KLEA 4WE1A 4FJMA 1KVAA 1JLCA 1WSGA 3AVAA 2RKIA 3T19A 4PA1A 5HRRA 1TVRA 3NF9A 2R7YA 4FZYA 2YNGA 1C1BA 3AVBA 3DRSA 3HPGA 3M8QA 4Z4EA 1IKWA 3TAMA 4Y1CA 4IKFA 4KHQA 4KI6A 1HQUA 4EP4A 4DFPA 2PY5A 4E1NA 4CJEA 2OYQA 3S3MA 2HHQA 3WNHA 4DU1A 1K6YA 3CFOA 3AVKA 2B5JA 5KRSA 3PUFA 3K5LA 3LWLA 1N6QA 2XRIA 4JS5A 3NGYA 3ZT2A 4E7JA 4ZHRA 4DTRA 4FJHA 4BACA 1SKWA 4ID1A 4DQQA 4OKJA 4Z4IA 1LAWA 2GUIA 2OPRA 3NAEA 3JYTA 1LW0A 1VSEA 3ITHA 3QNNA 1VSLA 3AVHA 2HHXA 1UA0A 3LANA 4OLAA 3LP1A 3SPYA 1NOZA 3AA4A 3ZSZA 3LZIA 1KTQA 1W0HA 1GOBA 3RRGA 5D3GA 4M3ZA 3NH0A 4E7HA 1FK9A 4BE0A 4N5SA 3PV8A 1UAXA 3P5JA 3ZSYA 1RBUA 3SJJA 4DF8A 2HHWA 4CJPA 4IG0A 2E6MA 3TABA 4DTNA 1U49A 1W9HA 4ZTJA 1S1UA 3DLGA 2VWJA 3L2RA 4M42A 3DLEA 2E4LA 3KK2A 4JRPA 3VQAA 3A2FA 3CFRA 4C8LA 1I39A 3O3FA 5HBMA 5FRNA 1JLEA 1B92A 2XO7A 4F8RA 4HVJA 4FK2A 3QEIA 3K5MA 1DTTA 1IKYA 4B9UA 1BCMA 4FJGA 2HNDA 4CJKA 3VQEA 3THVA 3DI6A 1UA1A 4CEZA 1TKDA 4CFDA 3AA5X 3K57A 3NDKA 5HP1A 3NE6A 4FYDA 5EU7A 4O55A 4FZZA 1BL3A 2FBTA 1QHTA 3VQDA 1TK8A 4HHTA 4N76A 4CK2A 1SL1A 1EKEA 4JLHA 3OYLA 2ZQBA 4DTUA 3TAGA 3NBPA 3F9KA 3OYJA 1RTJA 3CM6A 2QXFA 4MQ3A 4CF0A 3LP3A 1WLJA 2HVHA 1GOCA 4FJKA 3HVRA 1NK0A 4N56A 4W5NA 1T7PA 4DU3A 4Z0UA 4KB0A 3VQQA 3VQ4A 4CEQA 1U47A 2YNHA 2EHGA 3KKRA 1REVA 2RF2A 4DQIA 5CYMA 4DTOA 2G8KA 4J2BA 1WSHA 1L3UA 1KCFA 4ID5A 4DSJA 2KW4A 3D0PA 4J2DA 1CLQA 2D5RA 3DRPA 4I2PA 1JLFA 3LP0A 1WSFA 3V1RA 5C25A 3NGZA 3AVCA 1J53A 1JLBA 1WAFA 1O1WA 1C0MA 3LAMA 3TWHA 4DLEA 3V4IA 4FK4A 4JRQA 4F3TA 3ASMA 1S1TA 3AA2A 3ZSWA 1T03A 4F2SA 3L3VA 5HRSA 5J2NA 3RMAA 4DSLA 1S6PA 1HNIA 3P83D 3OYFA 4BDZA 1IKXA 5CYQA 4DS4A 4B9VA 4KTQA 4FXDA 4HUFA 4ELTA 3NHGA 2XY7A 3ZCMA 1QSSA 4DU4A 1VK0A 1KSPA 2YKMA 3OYDA 3MXIA 4DF4A 3WNFA 3QIOA 3AV9A 4HUGA 1RT1A 1RTDA 4RW6A 1SL2A 3AVFA 3RR7A 1RT2A 3VQ9A 2OPQA 2LSNA 2VG5A 4OLBA 3HPHA 3CG7A 2KFNA 2DTUA 1HYZA 5I3UA 4F4KA 1LWFA 4FLTA 3LZJA 2G8UA 4L8RB 1QS4A 5J2PA 2P5OA 3LAKA 3C95A 4KTWA 1RT5A 5FDLA 3PX6A 2ZE2A 2BE2A 2ITGA 3DM2A 4C8NA 3AVJA 4CEOA 3KK1A 4B9TA 4KHNA 3AVLA 2HW3A 1JL2A 1Q9YA 1RT7A 4FLUA 1QSLA 2VG7A 3HPOA 4KHYA 2ATQA 3ZT0A 2P51A 3FFIA 4CEFA 1NJXA 5E41A 3MEDA 2IDOA 3QEVA 3HYFA 4FVMA 3NF8A 3AO4A 4FW2A 2IGIA 1X1PA 1SV5A 4Q0BA 4RG8A 5K14A 4FLWA 3QLHA 4CESA 3PX4A 3DOLA 4FW1A 1LAVA 2VWKA 3NF6A 2O4IA 1JL1A 3CQ8A 1RTIA 3DOKA 4LY7A 1KVBA 3P1GA 1JXEA 4IG3A 4O0IA 2Z1GA 1KFSA 3SUPA 4K8ZA 3O3HA 1NK5A 2XY6A 4OVLA 4C8KA 1NJWA 2O4GA 5HROA 1MU2A 2Z1HA 3KK3A 4F2RA 3HO1A 4DSKA 1TAQA 3RMBA 5JS2A 3HK2A 3V9XA 4CCHA 4EZ9A 4HCBA 4CJTA 1EETA 3H08A 1Y97A 3NCIA 2Y1IA 2OZMA 4KAZA 3QERA 4LD0A 3S3OA 2OZSA 4B8AB 1D9DA 4OKEA 2YNIA 4M3RA 4NCBA 3IG1A 4FLYA 3PY8A 3KLFA 3SQ0A 4XIUA 2XHBA 1IKVA 2QK9A 4CK1A 4J2EA 1JKHA 1VRUA 3VQ5A 2YNFA 1IH7A 1WNSA 4Z4CA 3HVTA 1FKPA 2P1JA 4IDKA 3HP6A 4KO0A 1U4BA 4PWDA 3SUNA 2PZSA 4FJLA 2D0BA 2G8WA 4HUEA 1S6QA 4CHPA 4I9LA 1LWCA 3U3YA 2G8IA 1VSMA 3VQ6A 1YT3A 1NK8A 1BISA 1Z25A 1C6VA 4IBNA 5KGWA 4CGFA 1ZBIA 4JS4A 3VQPA 4AHCA 4CEAA 4CJ5A 2X74A 4DSEA 3SQ4A 3ZT1A 3D45A 2HMIA 3LDSA 2X6SA 1LW2A 2XY8A 4CJQA 4CJRA 1U48A 3OYGA 1HMVA 4I7FA 3UIQA 3JSMA 4AILC 1L3VA 2IAJA 4OGEA 2KTQA 4UQGA 4BWJA 3IS9A 4CEEA 3L2VA 2AJQA 1HJRA 4IFYA 4CF1A 3TAPA 5CZ2A 4CFBA 3CFPA 3OYHA 4CEBA 1HNVA 3SCXA 1CXQA 3G10A 3SZ2A 1TAUA 3OJSA 1LV5A 3NGIA 1BGXT 5HRNA 3AO3A 3SQ1A 4ELUA 2G8VA 2HNZA 2HHTA 4W5RA 1X9MA 4FJNA 2JLEA 2KQ2A 4E7LA 1A5WA 4AHTA 3O4NA 3L2WA 1B9FA 1KLMA 3ZSRA 3TAEA 1ZBFA 1Z26A 4KTZA 4CERA 1TK0A 4CJFA 4GW6A 2KZZA 3O3GA 3RTVA 2Z1JA 3I0SA 4LSNA 3S3NA 4CJWA 2EX3A 3AVMA 3ZT4A 3QESA 3TARA 4DS5A 3OY9A 1ZBLA 1ZYQA 4KREA 1S9GA 3QINA 4DQRA 1C1AA 2XY5A 3V81A 4M3XA 3RR8A 3VA3A 1EX4A 4R5PA 1GOAA 1QE1A 1D9FA 4M3TA 3MEGA 4FZXC 3AVIA 4O5BA 1TL3A 3MAQA 4E1MA 1NJZA 1NOYA 1SKSA 4BWMA 3KLGA 4K8XA 2YKNA 4CGGA 4CEDA 4C8MA 2DFEA 1C0TA 3CM5A 3RMCA 5J2QA 1XHXA 3V9WA 4DTMA 1RBSA 4Q5VA 1RNHA 4B08A 4BE2A 1A5VA 3ZSXA 3OS2A 3LWMA 4DTXA 3PO4A 4B3OA 4E7IA 3DLHA 3PO5A 3NFAA 3V6DA 2FBYA 1SUQA 2FBXA 2B6AA 1IO2A 2I5JA 3AO1A 3C94A 2IS3A 3NF7A 5HLFA 3G0ZA 4Y1DA 5CY4A 4FJ8A 4E89A 1SKRA 1NJYA 4DWIA 5SWMA 4B9NA 2HNYA 3HJFA 4CHOA 3SI6A 4F3OA 5C42A 1ITGA 4QOZB 4OKKA 1HYSA 3TI0A 4KHWA 4NCAA 2HHUA 4AH9A 3OYKA 3WNGA 4KHUA 4B8CA 3LPTA 1RBVA 4O0JA 3KLHA 2JGUA 4CIGA 1FKOA 2OPSA 3QNOA 1VSIA 4RW8A 1HYVA 5FROA 1N5YA 4CE9A 1X9SA 1NK7A 3ZSOA 2GBZA 4B9LA 2WOMA 4AHRA 4DQSA 1NKEA 2OPPA 3SUQA 1TL1A 5J1EA 3AVGA 3BGRA 4W5QA 4RW9A 4CF9A 3ULDA 4FM1A 4FM2A 3SNNA 4DFJA 3C6UA 1I3AA 1JXBA 3WNEA 2A1RA 4FJ7A 1T05A 2YHBA 3NH1A 3OS0A 4CFCA 4CJSA 3SV4A 3QIPA 3DLKA 4Z4HA 4CK3A 1RDCA 1NK9A 4FJ9A 1IG9A 3TAFA 2G8FA 1TGOA 3IAYA 2RPIA 4KRFA 1TKTA 4OPJA 1RCHA 5FRMA 3KKSA 3HT3A 3ZT3A 1UOCA 4ZTFA 4E19A 4CGHA 4DTJA 3SYZA 2FBVA 1ASVA 3HL8A 3L2UA 3AO2A 1B9DA 3V1OA 4I2QA 4KV8A 1NK4A 1RBTA 3ZSVA 4W5OA 4O44A 1ASWA 4RW4A 2PYLA 5KTQA 3K5OA 3OYAA 5CZ1A 3V9UA 5HRPA 4EZ6A 1LWEA 1CZBA 3TR8A 1FXXA 4E0DA 4CJLA 3RWUA 3OJUA 2IOCA 4ICLA 2NUBA 3MXMA 4KKOA 3LALA 4AHUA 3EZ5A 3SUOA 1WSJA 3U6FA 1L5UA 4KI4A 2HHSA 2BDPA 4DMNA 4BDPA 4DTPA 1VSDA 3L3UA 5KGXA 2KZMA 3M8RA 3HM9A 4M45A 3MEEA 3E01A 2E6LA 4DFKA 3OVNA 3ZSQA 2D0CA 3K59A 3U3GA 4PY5A 3OYNA 1HRHA 3KD5E 1KVCA 4DSIA 4CJ4A 4DQPA 4C8OA 4M3WA 2BANA 2F8TA 3L2QA 1RDAA 4CIFA 1JLAA 3K5NA 1QTMA 1WSEA 2YHAA 3QEXA 3T3FA 1YTUA 2F8SA 1TKZA 1Q8IA 1UWBA 4N47A 4B9SA 4BDYA 1C0UA 3HSTB 1RDBA 1CXUA 1VSKA 3B6PA 1KFDA 4CGIA 4CJ3A 4CGDA 3K2PA 3SPZA 3ISNC 4FJXA 3VN5A 1DTQA 2WONA 3LP2A 4CF2A 3K58A 1RDDA 2G8HA 1RT6A 1VSHA 5KRTA 4M41A 4CGJA 3DMJA 2DY4A 3LPUA 1X9WA 2QKBA 1TKXA 1KLNA 3B6OA 4DSFA 1BCOA 2ZD1A 1BIZA 3CYMA 4LH5A 3L8BA 1CZ9A 3VA0A 4CF8A 1U45A 2P5GA 4TSXA 5C24A 2IC3A 3DRRA 4HTUA 2OA8A 3BDPA 3OYCA 4H8KA 4FLXA 3OYEA 1J9AA 1RTHA 1A5XA 1XHZA 2X6NA 4DTSA 1T8EA 1F21A 1ZBUA 3KLIA 1L3SA 3OYBA 1BI4B 3M8PA 3I8DA 4FJ5A 1ZBHA 4ELVA 2BGGA 1S9EA 2Q3SA 4EP5A 4NYNA 1JLQA 4Z4GA 5T7BA 1KRPA 4IFVA 3OYMA 1XI1A 2DFFA 1C1CA 2HB5A 3F73A 1NKBA 4FM0A 3DYAA 4FCYA 1BHLA 2QKKA 1J54A 3M8SA 1S1VA 1S1WA 1XC9A 2PYJA 4B9MA 3QO9A 1BIUA 4BE1A 4PUOA 4YNQA 2W42A 1RT4A 1L3TA 3AA3A 3OS1A 4OGCA 3KD1E 4I9QA 3OYIA 4PQUA 3PX0A 4E3SA 4O4GA 3VQCA 3NH2A 1VSFA 2D0AA 3EY1A 4YFUA 1D8YA 4CHZA 4DLGA 3RRHA 3V9SA 3QEWA 2Z1IA 2A1SA 1U04A 1WSIA 1Q9XA 1BI4A 1ASUA 3C6TA 4NCGA 4CHYA 1BQNA 1G15A 3HXMA 2VG6A 4HCCA 3AVNA 1D5AA 5J2MA 1S5JA 4CHNA 3EYZA 1TV6A 4GVMA 3T1AA 3KIOA 4NYFA 3SV3A 3S9HA 3TAQA 1DLOA 3DLBA 3VQ7A 4H4MA 3AO5A 4N41A 2RN2A 1NK6A 3MECA 3VQ8A 4CIEA 5KI6A 1TK5A 1NKCA 2ETJA 4AHVA 4DG1A 1EXQA 4FLVA 3QEPA 2HVIA 3IRXA 4FLZA 4Z4FA 4KB1A 3V1QA 4M3UA 4FJIA 5JS1A 1QSYA 4GMJB 2GV9A 4H4OA 3O4QA 1J5OA 1VRTA 1R0AA 2FC0A 4AHSA 3ALYA 2Y1JA 2X78A 3I0RA 4MFBA 4CHQA 1HPZA 1JLGA 1RILA 4CFAA 1YTAA 4OJRA 3HP9A 4DFMA 1SL0A 4FJJA 4M3YA 3TANA 4LSLA 4CJVA 1QQCA 3V9ZA 1WN7A 4CJUA 1VSJA 1BQMA 2YV0X 5I42A 1WAJA 1S1XA 4KPYA 4W5TA 4LH4A 1HQEA 3MXJA 3KJVA 4OPKA 2KFZA 5DMRA 2B4JA 4QAGA 4G1QA 3QETA 3RMDA 1XWLA 3VQBA 2DFHA 1YVUA 4E7KA 1RT3A 5DK5A 4KFBA 3SQ2A 4QCLA 4J2AA 1RBRA 1EP4A 3DLRA 4FK0A 2F96A 4KHSA 2HHVA 4CECA 3KTQA 5SZTA 4RW7A
chains in the Genus database with same CATH superfamily
5EX5A 1E4GT 4H03B 3T19A 3KHYA 2YNGA 1C1BA 3HPGA 4Z4EA 2JWLA 3KVGA 4EP4A 4DFPA 2OYQA 4BRIA 2PY5A 3S3MA 4JI3K 3TSQA 1K6YA 3K5LA 3LWLA 4E7JA 3L4IA 4R79A 4FO0A 1SKWA 4OKJA 4BROA 2GUIA 2HHXA 3LP1A 3OBWA 4CBWA 1GOBA 2P9PA 1VQ7N 2D0PA 4WCEL 4N5SA 5M1OA 3ZSYA 1RBUA 2F7TA 1IG8A 4CJPA 2E6MA 3TABA 3DLGA 1QQMA 3U8XA 4LF8K 3CI5A 3OW2M 4UY8O 3MN9A 1B92A 4OO1J 5C10A 4HVJA 4FK2A 3K5MA 1YI2N 4ISFA 3VQEA 4CJKA 3DI6A 4IOAL 3AA5X 3K57A 3NDKA 3NE6A 4FYDA 4FZZA 2GX9A 3Q7BA 1QHTA 4IOCL 3TTCA 1W2BM 4N76A 1EKEA 4JLHA 3VTIA 1E4FT 2O8BB 3VF4A 3F9KA 1MWMA 2NRZA 3CM6A 1GOCA 3HVRA 1DEJA 4H5WA 4KB0A 3VQ4A 5CYMA 2G8KA 1WSHA 1WB9A 3C0BA 4DSJA 2Q0UA 4I2PA 1JLFA 4PKGA 4JHDB 3LP0A 1WSFA 1J53A 3MDQA 4DLEA 1NGFA 1S72N 5MLCQ 4BRKA 1VQKN 3DXKB 4DSLA 3IFRA 1S6PA 4B9VA 4KTQA 4BGBA 5CYQA 4GV6A 3WXIA 4DU4A 4DF4A 1U2VB 3AV9A 1RT1A 3AVFA 3H6EA 4CD3A 4OLBA 3HPHA 2KFNA 5I3UA 1LWFA 4FLTA 1BWFO 2HBJA 3PX6A 3VGKA 1Q81O 2BE2A 4C8NA 3AVJA 2QM1A 4CEOA 3AVLA 2ZGZA 1QQNA 4FLUA 1Q9YA 2VG7A 1T3VA 3M1FA 3MEDA 2CH5A 1ILYA 3AGRA 2F4VK 3M6GA 2IGIA 1X1PA 3H3NO 4RG8A 3O6WA 1HNXK 2O4IA 4FW1A 1VHXA 1XC3A 4LY7A 1V4SA 1GLAG 3P1GA 3SUPA 2ZJRL 4OVLA 4F2RA 5HROA 1KQSM 3LDPA 1TAQA 3IKMA 3RMBA 2UUAK 3TU5A 4KAZA 2E1YA 5AQFA 1D9DA 1XMQK 3IG1A 3PY8A 1ZBSA 3QBXA 1XNQK 3WXLA 2QK9A 2P9NB 4J2EA 3QFPA 5IWAK 2P9KA 1IH7A 4DR1K 4KO0A 4XEIA 3SUNA 2PZSA 4FJLA 2D0BA 3R8EA 3ULEA 2OCEA 4DV4K 1NK8A 1Z25A 4IBNA 1VQON 2FLOA 4BRPA 3VQPA 3CCVN 1Q18A 2X74A 4BVPA 3ZT1A 3O9TA 4DSEA 3QBWA 2HMIA 2X6SA 4CJQA 4CJRA 2P9UB 3OYGA 4I7FA 4ISGA 4BRLA 3H46O 3KK7A 4HTLA 1L3VA 2Q31A 4BWJA 4CEEA 1HJRA 5AQRA 3CFPA 4DQ8A 3JXUA 3SCXA 2V7ZA 5A2QO 3AO3A 2G8VA 4DR7K 4FJNA 2FF3B 4FWMA 1KLMA 3ZSRA 3OBYA 4CERA 4CJFA 2GEMA 3S3NA 3I0SA 1JJ2M 2EX3A 4DS5A 1ZBLA 3QINA 3WXMB 3FZLA 2XY5A 3A8YA 4JI1K 4F9OA 2A6AA 1TL3A 4BR2A 1NNEA 1NOYA 3EE9A 4BWMA 3KLGA 1SKSA 4K8XA 2WBNA 3CM5A 2O8BA 3SAHA 4EHTA 4LFCK 1VQMN 3C65A 4DTXA 4B3OA 3DLHA 3PO5A 3NFAA 1HLUA 2PBDA 1BG3A 2I5JA 2IS3A 4BQZA 5JMVA 4E89A 3THWB 3TSUA 3HJFA 4CHOA 3VPZA 3SI6A 3OTOK 4BRDA 3DXKA 1W97L 3FZKA 4KHUA 2CGJA 3OYKA 4MDBA 1KAYA 3L4QA 4FPBA 1RBVA 4O0JA 2JGUA 2OANA 4JKFA 5M1FA 1NK7A 2WOMA 3SUQA 4CF9A 4FM1A 1I3AA 1GLLO 2A1RA 4FJ7A 2YHBA 3CETA 3OS0A 3SV4A 3QIPA 4LF5K 4CK3A 1RDCA 2YHWA 4FJ9A 2G8FA 2RPIA 4OPJA 5FRMA 2P9IA 4CGHA 4DKWA 1H1VA 2FBVA 4DTJA 1NK4A 1WOQA 4FWLA 4FPAA 1ASWA 2PYLA 5CZ1A 3V9UA 4U7BA 1LWEA 4EHUA 5AQMA 4CJLA 3OJUA 2NUBA 4KKOA 3LALA 3EZ5A 3SUOA 1L5UA 1J5EK 2BDPA 3EN9A 3AAQA 5AQYA 5FPEA 1NJIO 2KZMA 4V19S 3E01A 2E6LA 5C2DA 4PY5A 2P9NA 4BRFA 4CJ4A 5I9EB 4CBUA 3RSEB 3K5NA 4ILHA 4IWVA 1YTUA 4LFBK 4BDYA 3HSTB 4YOUA 4FJXA 3GOIA 4CZGA 3K58A 2G8HA 1RDDA 4MO4A 3P31A 1VQ9N 2P9UA 5AQTA 2QKBA 1TKXA 1KLNA 1YVNA 3D2FA 3SJHA 3DRRA 4M7YA 4H8KA 4FLXA 1ATSA 1RTHA 1A5XA 3MX5A 3VF2A 1DGKN 1T8EA 4H5RA 3M8PA 2YHXA 1S9EA 4NYNA 1KRPA 2V52B 4IFVA 3OYMA 1XI1A 1X3MA 1C1CA 4H0YB 3F73A 1BHLA 5KQDA 3UE5A 1S1VA 2PYJA 4B9MA 2QWPA 4PUOA 2YX6A 3ID8A 1RT4A 3QICA 2E20A 1X3NA 1VSFA 2D0AA 3RRHA 3ID6A 3V9SA 3QEWA 2Z1IA 3H45C 3C6TA 1K8KA 4NCGA 1BQNA 2VG6A 4HCCA 5J2MA 2NRHA 3CCLN 3S9HA 3AARA 3VQ7A 3AO5A 4N41A 1NK6A 3MECA 4BGAA 1TK5A 1MWKA 3IRXA 4Z4FA 4B9QA 3R1XA 4BG8A 4KB1A 4M3UA 4FJIA 4NLBA 4K25A 4JK9A 2I7PA 3VEZA 4AHSA 3MWPA 1SL0A 1NJXA 1JLGA 4LSLA 4CJUA 2PAVA 4KPYA 4AQYK 3KJVA 5DMRA 3QETA 1SS6A 5BRFA 3CMAN 3VQBA 1N34K 2DFHA 4E7KA 5DK5A 5BRDA 4JKGB 4KHSA 1VQ4N 3HTVA 4CECA 5JVHL 4RW7A 2RKIA 4PA1A 1IKWA 3IUCA 4BR9A 5BR8K 3TAMA 4HWIA 3IMXA 2IVNA 1HQUA 4XH1A 4E1NA 2VGNA 1HX1A 2QWNA 4DU1A 4BRNA 2B5JA 3NGYA 3ZT2A 4ZHRA 4DTRA 3THXB 4FJHA 4PL7A 1OH8A 3NAEA 3JYTA 4WQ4C 4IO9L 2A3ZA 1W0HA 4GKJK 4M3ZA 3VTHA 3P38A 3PV8A 3P5JA 3SJJA 2ZM6K 5BN9A 2E5LK 3AGKA 3ENBA 4ZTJA 2VWJA 1QHAA 1BUPA 3QDKA 2YI1A 3SAFA 3I33A 3SBTA 4M42A 2E4LA 2O8EB 2GTDA 4JRPA 3VQAA 3CFRA 2WC9A 3C7NA 5E26A 3O3FA 1ESVA 3I55N 4F8RA 1NM1A 1J6ZA 3P39A 1IKYA 2HNDA 1UA1A 4CEZA 3RSEA 1LCUA 3E9OA 5HP1A 1BL3A 3NVKA 3DAWA 4HHTA 1SL1A 3OYLA 4DTUA 2QXFA 1QZ6A 1P90A 5LJWA 1U47A 4GKKK 2EHGA 2RF2A 2IVOA 4DTOA 1KCFA 4J2DA 3D0PA 2D5RA 1V4TA 3NGZA 4DV5K 1JLBA 3DXMB 1O1WA 2VCPA 3MN7A 4JRQA 3AA2A 4O8UA 4WQ5A 1Z6RA 3TSPA 4FXDA 4ELTA 2V51B 2XY7A 3O1WA 1QSSA 4A2BA 1VK0A 1KSPA 3CCSN 2NNWA 4IJAA 3MXIA 3QIOA 3TTDA 4HUGA 5BRHA 3VQ9A 2OPQA 4KH5A 2DTUA 1HYZA 1XUPO 3LZJA 5J2PA 1NMNA 1HR0K 3DM2A 1JL2A 4KHYA 1BA1A 3ZT0A 3CF5L 2P9LB 5E41A 3ATVA 5HOOA 3HYFA 3NF8A 4FW2A 1SV5A 3T69A 3O8MA 5AFUH 1RGIA 4BRCA 3DOLA 1LAVA 4IEEA 1JL1A 4NO7A 4MDAA 3DOKA 1M1KO 4XH5A 4FWOA 3F2KA 1DKGD 2J4RA 2Z1GA 1HKCA 4BRMA 3ULEB 4K8ZA 3VF6A 5HL7L 3GG4A 2NLXA 2Z1HA 3KK3A 1C0GA 4LF7K 3U9ZA 3EE8A 5AQHA 3VMFB 1NGHA 3GDQA 1SAZA 3QERA 4LD0A 4OKEA 4M3RA 4X66K 3F9MA 3O80A 3SQ0A 1HPMA 4XIUA 1IKVA 2NRXA 3HM8A 4JKGA 2NRTA 1NLVA 1JKHA 3VQ5A 4Z4CA 1WNSA 4PKHA 3HP6A 2P1JA 2WUSA 4DV7K 1S22A 3LM2A 3U3YA 1S6QA 4CHPA 1KC8O 2G8IA 3VQ6A 5AQKA 1BISA 5KGWA 4JS4A 4CD1A 4AHCA 4ISEA 4CEAA 3SQ4A 3D45A 5AQLA 1O13A 3LDSA 2XY8A 1YJNN 2ZWHA 5GAHP 3VENA 3THXA 3UIQA 3JSMA 2IAJA 4UQGA 4GV3A 2E2NA 1K8AO 3ZX2A 4CFBA 3O1BA 4MLHA 1HNVA 5AQGA 1TAUA 5HRNA 4ELUA 2HNZA 2HHTA 1NGAA 3L2WA 1ZBFA 3QMLA 4GW6A 3O3GA 1EWRA 4H0PA 4CJWA 2O8EA 1N33K 3TARA 4KREA 3OY9A 3MWTA 3V81A 5AQUA 5AFUA 3MK6A 4M3TA 4FWPA 3M3ZA 3MEGA 3AVIA 5H1SQ 2WFBA 2BUPA 1XHXA 3V9WA 3HOTA 4Q5VA 1RNHA 4BE2A 4EAHD 1TYQA 4NLCA 4E7IA 2FBYA 1SUQA 2B6AA 1IO2A 5HLFA 5ADXH 2V7YA 3NF7A 3VETA 5SWMA 4B9NA 3CCEN 3DXMA 3O9UA 2CH6A 4DV2K 3CJBA 2D1KA 4FWKA 4JKCA 4K43A 5AQPA 4DV1K 4AH9A 3FR0A 3LPTA 4EFHA 3O08A 3FZFA 3QNOA 1JCEA 1HYVA 5FPMA 1N5YA 2P9IB 4A5AA 4CE9A 4FVUA 4AHRA 3E66A 2UUCK 5J1EA 3BGRA 3ULDA 5GAGP 2F9TA 4DFJA 1JXBA 3WNEA 2D0OA 1T05A 4ILJA 2QWRA 5AQWA 3DWLA 4CFCA 4CJSA 4CBXA 2P9LA 5LL6Z 4JNEA 1W7AA 4A61A 4KRFA 1RCHA 1G99A 3HT3A 4FWRA 1ASVA 3AO2A 1B9DA 2GUPA 4I2QA 4KV8A 5KQ8A 3K5OA 3E9PA 3HI0A 5HRPA 3WEEB 3TR8A 4E0DA 4CZHA 4JKEA 2HF3A 4ICLA 2E2OA 2GWKA 4AHUA 5AQZA 4FWSA 5JLFA 3T7ZA 3MEEA 2D0CA 3D2FB 3VESA 5AZIB 3R6MA 4DQPA 2BANA 3L2QA 1RDAA 4CIFA 1FJGK 2FXUA 1WSEA 2YHAA 5ADXA 3T3FA 3ZETA 1Q8IA 1T44A 3EL2A 2Q36A 1C0UA 1XQSC 2HF4A 4CGIA 3K2PA 3SPZA 1VSHA 1Q82O 2A5XA 3LDQA 5BN8A 3A5OC 1Q7YO 3DMJA 2DY4A 3A5LC 1X9WA 4C1NK 4YOTA 5KPTA 1BIZA 1U45A 5TKYA 4TSXA 5C24A 3CJAA 3MN6A 4HTUA 2OA8A 2YJEA 1XHZA 3O9RA 4YY3K 2ZF5O 1ZBUA 3HSCA 4FJ5A 2HSTA 3CCRN 1K8KB 2BGGA 4EP5A 4WFBL 1JLQA 4Z4GA 1KAXA 2UU9K 2HB5A 3PLAA 4FM0A 2O8FB 5GAEP 1J54A 4IEIA 4OX9K 3QO9A 3W3DA 2W42A 1L3TA 4OGCA 5AR0A 4E3SA 3VQCA 2YJFA 4YFUA 1D8YA 4DR6K 1YXQA 2A1SA 2BH1A 4QS9A 1R59O 2FSJA 1G15A 3HXMA 1N32K 4K0KK 4B1VA 2OTJN 2JWKA 3CHWA 4A2AA 5C2FA 3T1AA 3C6AA 3SAGA 1DLOA 4JN4A 4CZMA 3VEOA 3VQ8A 3J81O 4AHVA 1IJJA 1EXQA 2EWSA 3QEPA 2HVIA 4FLZA 4LC9B 3BF3A 1GLFO 2RHKA 4JI4K 1QSYA 1HUXA 4DV3K 1VRTA 2QWOA 3D2EA 4MFBA 4M3YA 4FWNA 3HP9A 3PSFA 4BRAA 4DFMA 4FJJA 1QQCA 3EO3A 3V9ZA 1VSJA 3H1VX 1WAJA 3QB0A 4JKAA 1S1XA 3MCPA 4C1NI 1QQOA 4IXCA 2KFZA 4JI5K 4QAGA 3RMDA 3VOVA 1XWLA 2ZJPL 5KPZA 1TUUA 1XMOK 4KFBA 4QCLA 1RBRA 2F96A 4BC3A 2FF6A 1DT9A 5SZTA 4KBOA 4FJMA 1KVAA 3AVAA 4B3MK 1TVRA 3NF9A 2R7YA 3G6EN 3AVBA 3DRSA 3M8QA 4Y1CA 3WXJA 4KI6A 3P4IA 2O8DB 1ATRA 4CJEA 3WNHA 3CFOA 5KRSA 4DR3K 1N6QA 2QEXN 1YITN 4BR4A 4BACA 3C7NB 4DQQA 1IV0A 4Z4IA 1LW0A 3QNNA 5GIOA 4A59A 3AVHA 1UA0A 3LANA 3CCMN 4OLAA 1XNRK 1NOZA 3AA4A 3LZIA 1KTQA 3WEEA 3RRGA 5D3GA 1BA0A 1QVGM 5AJ3K 3THYB 4IG0A 3HBTA 4DTNA 3MCAB 1W9HA 1U49A 4X65K 3VEVA 3K0SA 3UKRB 3T1HK 3CJ7A 3KK2A 3A2FA 1JLEA 1YUWA 2AP1A 5AZIA 1DTTA 4FJGA 4B9UA 1TKDA 2O8CA 1JCGA 4B1YB 2A42A 3JS6A 4GVEA 2QTDA 4WFNL 2FBTA 1TK8A 1Q86O 4CK2A 3TAGA 3ZLJA 2ZQBA 4JAXA 1RTJA 2HVHA 5FPNA 4KH6A 4W5NA 1NK0A 4N56A 1T7PA 4DU3A 4Z0UA 4I6MA 4CEQA 2OTLN 1CZAN 1REVA 3KKRA 4DUZK 3JAMO 1OH6A 1L3UA 4ID5A 3D7EO 1GLDG 1CLQA 3DRPA 1OH5A 3AVCA 1WAFA 3E1YA 1VAZA 1C0MA 3LAMA 3TWHA 3OHRA 4F3TA 3ASMA 1S1TA 3QFUA 3R3LA 4PKIA 1T03A 5HRSA 4F2SA 4BDZA 1HNIA 3P83D 3OYFA 1IKXA 1X9JA 3L6QA 4FOIA 3NHGA 3ZCMA 2CGKA 3CJ9A 5FLXO 3OYDA 5M1KA 3WNFA 1RTDA 2O8FA 4JI6K 1SL2A 1RT2A 2Q97A 4A5BA 2LSNA 2VG5A 4BRQA 3CG7A 3VGLA 1HJOA 3BY5A 4F4KA 2KKZA 4NB4A 1QS4A 3LAKA 5AQOA 3C95A 2P9SB 4BREA 1D4XA 4B9TA 4KHNA 3SK3A 5B8HA 3O5BA 3EZWA 1RT7A 4IFEA 2ATQA 2P51A 3R9PA 1GLBG 3FFIA 4CEFA 3T1YK 3QEVA 3AO4A 4RWTA 4Q0BA 5K14A 5CE3A 4CW7B 3QLHA 4CESA 5BPLA 3PX4A 2VWKA 4IDHA 3CQ8A 1RTIA 1KVBA 4JI8K 1JXEA 4IG3A 4O0IA 3VEWA 1GLCG 3FZMA 2IVPA 3O3HA 4C8KA 1HNZK 1MU2A 3HO1A 1IBLK 3HK2A 3V9XA 4CCHA 4HCBA 2QWLA 4CJTA 3H08A 1Y97A 5C12A 4IZ9A 3S3OA 4B8AB 3FZHA 4NCBA 4FLYA 3BF1A 3KLFA 2HOEA 4DUYK 4FL9A 4CK1A 4BRHA 1KAZA 1VRUA 2YNFA 4U67L 4X64K 1U4BA 1FKPA 4IDKA 2WTUA 4PWDA 4B1ZA 5F0XA 4I9LA 1LWCA 1MDUB 1C6VA 2NRWA 1ZBIA 4CJ5A 2O8DA 1YHQN 1U48A 4YORA 3AY9A 2KLAA 3FFKB 4AILC 2AJQA 4CF1A 3TAPA 3OYHA 4WQ5C 3PIPL 3U4LA 1CXQA 3SZ2A 3OJSA 1LV5A 1BGXT 3SQ1A 4W5RA 3THYA 2JLEA 1A5WA 1B9FA 4YDUA 3NVMA 5EXWA 1TK0A 5LMNK 3UKRA 3RTVA 2Z1JA 3AVMA 1ZYQA 3QESA 1S9GA 1TYQB 1C1AA 4M3XA 4CJ7A 3RR8A 1EX4A 2UXBK 5FPDA 1GOAA 1EQYA 1D9FA 5JVGL 3MAQA 1NJZA 2NRRA 1YAGA 2YKNA 4CEDA 1ATNA 2DFEA 1C0TA 5J2QA 3FGUA 3I8BA 4B08A 3OS2A 3G71N 3PO4A 1NGJA 1NGBA 3O4WA 2FBXA 2E2QA 3AO1A 3C94A 1E3MA 2W6LA 3G0ZA 2VYPA 4Y1DA 5CY4A 4FJ8A 3VERA 4DWIA 4EIAA 1NGEA 2HNYA 4H0TB 4BQLA 5C42A 4OKKA 2W6KA 4KHWA 4NCAA 2HHUA 3M5RA 4B8CA 4DR2K 3F5TA 1VSIA 1X9SA 3BEXA 2GBZA 4B9LA 1NKEA 4DQSA 4B1WB 5GINA 3SMSA 3AVGA 4W5QA 4FM2A 3CXCM 3SNNA 3C6UA 1KD1O 2P9SA 2A41A 4Z4HA 1NK9A 3KZBA 1IG9A 5DM6L 1TGOA 4PHTX 1TKTA 3Q7CA 4JI2K 3ZT3A 4CVNE 4ZTFA 1VQPN 4E19A 5KPRA 3HL8A 3J8AA 2DPNA 1RBTA 4O44A 5AZJB 2UXDK 4RW4A 5JLHA 1OVYA 5KTQA 3OYAA 1IBKK 4AF1A 3J80O 1CZBA 4BRGA 3ZETB 4ILGB 4JI0K 3MXMA 4KI4A 1WSJA 3U6FA 2HHSA 4XH4A 4DMNA 4BDPA 1BOTO 2I7NA 4JD2B 3L3UA 4QS7A 4E1JA 3M8RA 3CCJN 2VQFK 3OVNA 3AAPA 5JICA 3KD5E 1KVCA 5F2RA 4C8OA 2F8TA 3K9JA 1JLAA 3TPQA 3QEXA 2A40A 1TKZA 1Z05A 3CJ1A 1UWBA 1VSKA 1KFDA 1U6ZA 3CC4N 5GIPA 3ISNC 4BY9C 4LFAK 4CF2A 2WONA 1K9MO 5KRTA 4CI6A 5TKWA 4M41A 3LDOA 1YJ9N 3A0IX 3EKUA 3LPUA 1BCOA 3CYMA 4A57A 2P5GA 3UKUB 1CZ9A 4CF8A 5AQJA 4JK8A 3WQTA 3C6HA 2YHYA 4H0VB 3BDPA 4IOXA 2QA4N 3OYCA 4H5TA 3OYEA 1J9AA 2QWQA 4DTSA 2NRVA 1F21A 3KLIA 3OYBA 2QW9A 4ELVA 2HBLA 1N36K 5AQNA 1NMDA 2DFFA 2Q0RA 3DYAA 2QKKA 3SLCA 5IT9O 1S1WA 1XC9A 2HBMA 1BIUA 4BE1A 4YNQA 3AA3A 3KD1E 4B1UB 4I9QA 3OYIA 3O9SA 4O4GA 4DV0K 3NH2A 3EY1A 3WXKA 3VEXA 4CHZA 4DLGA 4BR0A 3D2EB 1WSIA 1BI4A 1NGCA 3CC2N 1ZXOA 5EOYA 3WT0A 4JI7K 1TV6A 4GVMA 3KIOA 3A5NC 4NYFA 3S41A 3TAQA 1NGIA 4CIEA 3OA9A 4A62A 2ETJA 4FLVA 3EKSA 4RTFD 2GV9A 3ATUA 4H4OA 1J5OA 2GELA 2FC0A 3ALYA 2X78A 3CIPA 4CHQA 1RILA 4JV5K 4J8FA 2D4WA 4MLEA 4KH4A 1WN7A 5I42A 1BQMA 3MXJA 4OPKA 2B4JA 4G1QA 4GNIA 1YVUA 5LY3A 3SQ2A 4J2AA 1NGGA 2RE2A 1RFQA 2ITMA 2E1ZA 2Q2RA 4WE1A 3KLEA 1JLCA 1WSGA 3VGMA 5HRRA 4FZYA 1HKBA 4H5VA 4IKFA 4KHQA 4JK7A 1YJWN 3I56N 3ZX3A 2HHQA 4BR5A 3AVKA 3PUFA 5C0YA 2XRIA 4JS5A 3CD6N 1YIJN 4ID1A 1LAWA 2OPRA 1VSEA 3ITHA 2IIRA 1VSLA 5AZJA 3SPYA 3ZSZA 2O8CB 3NH0A 4E7HA 1FK9A 4BE0A 1VQ8N 1HNWK 1UAXA 2QWMA 5EVZA 4DF8A 2HHWA 3HZ6A 1M90O 3PIOL 1S1UA 4B3RK 4DR4K 4LF4K 1GLJO 3L2RA 3DLEA 4JD2A 4C8LA 1I39A 3ZEUB 1QZ5A 5HBMA 4CZJA 5FRNA 3B8AX 2XO7A 4I6MB 2UXCK 4WFAL 4B1XB 3QEIA 3J7ZO 1BCMA 4JEPA 3THVA 3WQUA 1RDWX 4CFDA 2QI2A 5EU7A 4O55A 3VQDA 2UYTA 3NBPA 2HMPA 2HHHK 2ASMA 3WUHA 3OYJA 3HRGA 4CF0A 4MQ3A 3LP3A 1WLJA 3CERA 4FJKA 5DM7L 1WUAA 3VQQA 2YNHA 1N8RO 1BO5O 3UKUA 4DQIA 3D6RA 3N4QA 4J2BA 4Y0WA 5BPNA 2ZGYA 2KW4A 1I94K 3V1RA 1TUYA 2HBKA 5C25A 1ZBHA 3SMPA 4CZEA 3V4IA 4FK4A 2W41A 4JKBA 3ZSWA 3L3VA 3CPEA 4CZIA 5J2NA 3RMAA 2NZTA 4DS4A 3LDNA 4HUFA 3J7YP 5C15A 2YKMA 3RR7A 4JKDA 4RW6A 1NG9A 3N4PA 2G8UA 4L8RB 4YOYA 4Z94A 2P5OA 4JHDA 1RT5A 4KTWA 5FDLA 5AQXA 2ZE2A 4BC5A 2ITGA 4BG9A 3KK1A 4YOXA 2HW3A 2FSNA 4WF9L 1QSLA 3HPOA 5BREA 3PSIA 5M1PA 2AA4A 4B3SK 2IDOA 2PFUA 4FVMA 1U2VA 4QS8A 4FLWA 5M1NA 4G9ZA 3NF6A 4L3QA 4FOEA 3J7AP 1KFSA 4YOVA 4FWQA 4CZLA 1NK5A 2XY6A 1NJWA 2O4GA 4DSKA 3ZX0A 5JS2A 4OPHA 4K41A 4EZ9A 3GE1A 1EETA 3NCIA 2Y1IA 2OZMA 5CR4A 4X62K 2OZSA 1ZC6A 2YNIA 1Y64A 5AQQA 2XHBA 1VQNN 1EWQA 4DR5K 3IDHA 3HVTA 3BZKA 1NU0A 4HUEA 2G8WA 4AM7A 3CJCA 1VSMA 1YT3A 3U9DA 4CGFA 4NXMK 3ENHA 4JYAK 1LW2A 4BC4A 1KXPA 1HMVA 3E9LA 3CC7N 1T6CA 4OGEA 2VQEK 2KTQA 1RDUA 3IS9A 3L2VA 4IFYA 1MA9B 2FSKA 1SQKA 5CZ2A 1WBBA 4CEBA 5GADP 4H0OA 3G10A 1HKGA 3NGIA 1X9MA 2KQ2A 4E7LA 4LF9K 3CPWM 4AHTA 3O4NA 3ZYYX 3TAEA 1Z26A 4KTZA 4DV6K 2KZZA 4LSNA 3ZT4A 3H3OB 4MO5A 1GLEG 4OPAA 4M7XA 3ZEUA 4C23A 4DQRA 2ZJQL 3VA3A 3UB5A 4R5PA 1QE1A 1T6DA 1OH7A 4FZXC 4O5BA 4E1MA 2ASOA 3BZCA 4CGGA 4C8MA 4K42A 3RMCA 4DTMA 1RBSA 3FLCO 1A5VA 3ZSXA 3LWMA 3V6DA 1S3XA 3GBTA 4H0XB 2E2PA 1SKRA 1NJYA 5F1XA 4H5NA 4F3OA 1OKJA 2KHOA 1K73O 1ITGA 4O8KA 4QOZB 1HYSA 5E84A 3TI0A 4JKHA 3WNGA 1YF5L 3KLHA 2YCHA 1NBWA 4CIGA 3G4SN 1FKOA 2OPSA 4RW8A 2Q1NA 1C0FA 5FROA 3ZSOA 3MN5A 2OPPA 1TL1A 3FE1A 3KWIA 4YHHK 4RW9A 3THWA 3CQXA 1OVQA 1JCFA 3NH1A 3LM9A 3MMVA 3G25A 3ENOA 4BVOA 3DLKA 3DLLL 2CGLA 3O9QA 5BPMA 3TAFA 2W40A 3IAYA 3KKSA 1UOCA 1SZ2A 2H3GX 3SYZA 3L2UA 3V1OA 3ZSVA 4W5OA 1BDGA 2BTFA 2F9WA 5AQVA 1NGDA 3W0LA 4YDUC 4EZ6A 2P9PB 1FXXA 5LMUK 3RWUA 1QVFM 4RCHA 2IOCA 4IO8A 1P8ZA 3RVCA 4AM6A 4DTPA 1VSDA 3CMEN 4CZFA 1VQ5N 5KGXA 5BR9A 3HM9A 4M45A 4DFKA 3CQYA 3ZSQA 3K59A 3U3GA 1LOTB 3OYNA 1HRHA 4DSIA 4B3TK 4M3WA 1QTMA 4BC2A 4YOWA 3BP8A 5EY4A 2F8SA 4N47A 4B9SA 1RDBA 1CXUA 4GV9A 3B6PA 4CJ3A 4CGDA 4FSVA 1VQLN 3VN5A 1DTQA 3LP2A 1RT6A 5M1QA 3H1QA 3LL3A 4CGJA 5AQSA 3B6OA 3K9KA 2UUBK 4DSFA 5LJVA 2ZD1A 4LH5A 3VA0A 3L8BA 3L0QA 2IC3A 4IJNA 3DJCA 2X6NA 3SBGA 3TTFA 4WQ4A 1L3SA 1BI4B 3I8DA 2Q3SA 5T7BA 3BUZB 3MX2A 4M63C 4CZKA 1FW6A 1NKBA 4FCYA 3VEYA 3M8SA 4GY2B 2GWJA 4PL8A 1BU6O 4LF6K 4PQUA 3PX0A 3KWGA 1U04A 1Q9XA 1ASUA 2ASPA 4BR7A 4CHYA 3GL1A 4DB3A 3AVNA 1D5AA 1S5JA 4CHNA 3EYZA 3DLBA 3SV3A 3EEQA 4H4MA 3CCUN 2RN2A 2E88A 4DCHA 5KI6A 1NKCA 4DG1A 4KHPK 4DHYA 1EO1A 3V1QA 1WBDA 5JS1A 4GMJB 5ELZA 3O4QA 3CCQN 1R0AA 3HOSA 4O5FA 1IBMK 2Y1JA 3I0RA 1HPZA 4CFAA 1YTAA 4OJRA 3TANA 4CJVA 5CHIA 5AQIA 1NWKA 2QXLA 2YV0X 2VGMA 4WYBA 4W5TA 4LH4A 1HQEA 4NXNK 2E8AA 1VQ6N 3LDLA 1RT3A 2VWBA 3A5MC 1EP4A 3DLRA 4FK0A 2P9KB 2HHVA 3KTQA 3NMUA 3OS1A
chains in the Genus database with same CATH topology
3KLEA 4WE1A 4FJMA 1KVAA 1JLCA 1WSGA 3AVAA 2RKIA 3T19A 4PA1A 5HRRA 1TVRA 3NF9A 2R7YA 4FZYA 2YNGA 1C1BA 3AVBA 3DRSA 3HPGA 3M8QA 4Z4EA 1IKWA 3TAMA 4Y1CA 4IKFA 4KHQA 4KI6A 1HQUA 4EP4A 4DFPA 2PY5A 4E1NA 4CJEA 2OYQA 3S3MA 2HHQA 3WNHA 4DU1A 1K6YA 3CFOA 3AVKA 2B5JA 5KRSA 3PUFA 3K5LA 3LWLA 1N6QA 2XRIA 4JS5A 3NGYA 3ZT2A 4E7JA 4ZHRA 4DTRA 4FJHA 4BACA 1SKWA 4ID1A 4DQQA 4OKJA 4Z4IA 1LAWA 2GUIA 2OPRA 3NAEA 3JYTA 1LW0A 1VSEA 3ITHA 3QNNA 1VSLA 3AVHA 2HHXA 1UA0A 3LANA 4OLAA 3LP1A 3SPYA 1NOZA 3AA4A 3ZSZA 3LZIA 1KTQA 1W0HA 1GOBA 3RRGA 5D3GA 4M3ZA 3NH0A 4E7HA 1FK9A 4BE0A 4N5SA 3PV8A 1UAXA 3P5JA 3ZSYA 1RBUA 3SJJA 4DF8A 2HHWA 4CJPA 4IG0A 2E6MA 3TABA 4DTNA 1U49A 1W9HA 4ZTJA 1S1UA 3DLGA 2VWJA 3L2RA 4M42A 3DLEA 2E4LA 3KK2A 4JRPA 3VQAA 3A2FA 3CFRA 4C8LA 1I39A 3O3FA 5HBMA 5FRNA 1JLEA 1B92A 2XO7A 4F8RA 4HVJA 4FK2A 3QEIA 3K5MA 1DTTA 1IKYA 4B9UA 1BCMA 4FJGA 2HNDA 4CJKA 3VQEA 3THVA 3DI6A 1UA1A 4CEZA 1TKDA 4CFDA 3AA5X 3K57A 3NDKA 5HP1A 3NE6A 4FYDA 5EU7A 4O55A 4FZZA 1BL3A 2FBTA 1QHTA 3VQDA 1TK8A 4HHTA 4N76A 4CK2A 1SL1A 1EKEA 4JLHA 3OYLA 2ZQBA 4DTUA 3TAGA 3NBPA 3F9KA 3OYJA 1RTJA 3CM6A 2QXFA 4MQ3A 4CF0A 3LP3A 1WLJA 2HVHA 1GOCA 4FJKA 3HVRA 1NK0A 4N56A 4W5NA 1T7PA 4DU3A 4Z0UA 4KB0A 3VQQA 3VQ4A 4CEQA 1U47A 2YNHA 2EHGA 3KKRA 1REVA 2RF2A 4DQIA 5CYMA 4DTOA 2G8KA 4J2BA 1WSHA 1L3UA 1KCFA 4ID5A 4DSJA 2KW4A 3D0PA 4J2DA 1CLQA 2D5RA 3DRPA 4I2PA 1JLFA 3LP0A 1WSFA 3V1RA 5C25A 3NGZA 3AVCA 1J53A 1JLBA 1WAFA 1O1WA 1C0MA 3LAMA 3TWHA 4DLEA 3V4IA 4FK4A 4JRQA 4F3TA 3ASMA 1S1TA 3AA2A 3ZSWA 1T03A 4F2SA 3L3VA 5HRSA 5J2NA 3RMAA 4DSLA 1S6PA 1HNIA 3P83D 3OYFA 4BDZA 1IKXA 5CYQA 4DS4A 4B9VA 4KTQA 4FXDA 4HUFA 4ELTA 3NHGA 2XY7A 3ZCMA 1QSSA 4DU4A 1VK0A 1KSPA 2YKMA 3OYDA 3MXIA 4DF4A 3WNFA 3QIOA 3AV9A 4HUGA 1RT1A 1RTDA 4RW6A 1SL2A 3AVFA 3RR7A 1RT2A 3VQ9A 2OPQA 2LSNA 2VG5A 4OLBA 3HPHA 3CG7A 2KFNA 2DTUA 1HYZA 5I3UA 4F4KA 1LWFA 4FLTA 3LZJA 2G8UA 4L8RB 1QS4A 5J2PA 2P5OA 3LAKA 3C95A 4KTWA 1RT5A 5FDLA 3PX6A 2ZE2A 2BE2A 2ITGA 3DM2A 4C8NA 3AVJA 4CEOA 3KK1A 4B9TA 4KHNA 3AVLA 2HW3A 1JL2A 1Q9YA 1RT7A 4FLUA 1QSLA 2VG7A 3HPOA 4KHYA 2ATQA 3ZT0A 2P51A 3FFIA 4CEFA 1NJXA 5E41A 3MEDA 2IDOA 3QEVA 3HYFA 4FVMA 3NF8A 3AO4A 4FW2A 2IGIA 1X1PA 1SV5A 4Q0BA 4RG8A 5K14A 4FLWA 3QLHA 4CESA 3PX4A 3DOLA 4FW1A 1LAVA 2VWKA 3NF6A 2O4IA 1JL1A 3CQ8A 1RTIA 3DOKA 4LY7A 1KVBA 3P1GA 1JXEA 4IG3A 4O0IA 2Z1GA 1KFSA 3SUPA 4K8ZA 3O3HA 1NK5A 2XY6A 4OVLA 4C8KA 1NJWA 2O4GA 5HROA 1MU2A 2Z1HA 3KK3A 4F2RA 3HO1A 4DSKA 1TAQA 3RMBA 5JS2A 3HK2A 3V9XA 4CCHA 4EZ9A 4HCBA 4CJTA 1EETA 3H08A 1Y97A 3NCIA 2Y1IA 2OZMA 4KAZA 3QERA 4LD0A 3S3OA 2OZSA 4B8AB 1D9DA 4OKEA 2YNIA 4M3RA 4NCBA 3IG1A 4FLYA 3PY8A 3KLFA 3SQ0A 4XIUA 2XHBA 1IKVA 2QK9A 4CK1A 4J2EA 1JKHA 1VRUA 3VQ5A 2YNFA 1IH7A 1WNSA 4Z4CA 3HVTA 1FKPA 2P1JA 4IDKA 3HP6A 4KO0A 1U4BA 4PWDA 3SUNA 2PZSA 4FJLA 2D0BA 2G8WA 4HUEA 1S6QA 4CHPA 4I9LA 1LWCA 3U3YA 2G8IA 1VSMA 3VQ6A 1YT3A 1NK8A 1BISA 1Z25A 1C6VA 4IBNA 5KGWA 4CGFA 1ZBIA 4JS4A 3VQPA 4AHCA 4CEAA 4CJ5A 2X74A 4DSEA 3SQ4A 3ZT1A 3D45A 2HMIA 3LDSA 2X6SA 1LW2A 2XY8A 4CJQA 4CJRA 1U48A 3OYGA 1HMVA 4I7FA 3UIQA 3JSMA 4AILC 1L3VA 2IAJA 4OGEA 2KTQA 4UQGA 4BWJA 3IS9A 4CEEA 3L2VA 2AJQA 1HJRA 4IFYA 4CF1A 3TAPA 5CZ2A 4CFBA 3CFPA 3OYHA 4CEBA 1HNVA 3SCXA 1CXQA 3G10A 3SZ2A 1TAUA 3OJSA 1LV5A 3NGIA 1BGXT 5HRNA 3AO3A 3SQ1A 4ELUA 2G8VA 2HNZA 2HHTA 4W5RA 1X9MA 4FJNA 2JLEA 2KQ2A 4E7LA 1A5WA 4AHTA 3O4NA 3L2WA 1B9FA 1KLMA 3ZSRA 3TAEA 1ZBFA 1Z26A 4KTZA 4CERA 1TK0A 4CJFA 4GW6A 2KZZA 3O3GA 3RTVA 2Z1JA 3I0SA 4LSNA 3S3NA 4CJWA 2EX3A 3AVMA 3ZT4A 3QESA 3TARA 4DS5A 3OY9A 1ZBLA 1ZYQA 4KREA 1S9GA 3QINA 4DQRA 1C1AA 2XY5A 3V81A 4M3XA 3RR8A 3VA3A 1EX4A 4R5PA 1GOAA 1QE1A 1D9FA 4M3TA 3MEGA 4FZXC 3AVIA 4O5BA 1TL3A 3MAQA 4E1MA 1NJZA 1NOYA 1SKSA 4BWMA 3KLGA 4K8XA 2YKNA 4CGGA 4CEDA 4C8MA 2DFEA 1C0TA 3CM5A 3RMCA 5J2QA 1XHXA 3V9WA 4DTMA 1RBSA 4Q5VA 1RNHA 4B08A 4BE2A 1A5VA 3ZSXA 3OS2A 3LWMA 4DTXA 3PO4A 4B3OA 4E7IA 3DLHA 3PO5A 3NFAA 3V6DA 2FBYA 1SUQA 2FBXA 2B6AA 1IO2A 2I5JA 3AO1A 3C94A 2IS3A 3NF7A 5HLFA 3G0ZA 4Y1DA 5CY4A 4FJ8A 4E89A 1SKRA 1NJYA 4DWIA 5SWMA 4B9NA 2HNYA 3HJFA 4CHOA 3SI6A 4F3OA 5C42A 1ITGA 4QOZB 4OKKA 1HYSA 3TI0A 4KHWA 4NCAA 2HHUA 4AH9A 3OYKA 3WNGA 4KHUA 4B8CA 3LPTA 1RBVA 4O0JA 3KLHA 2JGUA 4CIGA 1FKOA 2OPSA 3QNOA 1VSIA 4RW8A 1HYVA 5FROA 1N5YA 4CE9A 1X9SA 1NK7A 3ZSOA 2GBZA 4B9LA 2WOMA 4AHRA 4DQSA 1NKEA 2OPPA 3SUQA 1TL1A 5J1EA 3AVGA 3BGRA 4W5QA 4RW9A 4CF9A 3ULDA 4FM1A 4FM2A 3SNNA 4DFJA 3C6UA 1I3AA 1JXBA 3WNEA 2A1RA 4FJ7A 1T05A 2YHBA 3NH1A 3OS0A 4CFCA 4CJSA 3SV4A 3QIPA 3DLKA 4Z4HA 4CK3A 1RDCA 1NK9A 4FJ9A 1IG9A 3TAFA 2G8FA 1TGOA 3IAYA 2RPIA 4KRFA 1TKTA 4OPJA 1RCHA 5FRMA 3KKSA 3HT3A 3ZT3A 1UOCA 4ZTFA 4E19A 4CGHA 4DTJA 3SYZA 2FBVA 1ASVA 3HL8A 3L2UA 3AO2A 1B9DA 3V1OA 4I2QA 4KV8A 1NK4A 1RBTA 3ZSVA 4W5OA 4O44A 1ASWA 4RW4A 2PYLA 5KTQA 3K5OA 3OYAA 5CZ1A 3V9UA 5HRPA 4EZ6A 1LWEA 1CZBA 3TR8A 1FXXA 4E0DA 4CJLA 3RWUA 3OJUA 2IOCA 4ICLA 2NUBA 3MXMA 4KKOA 3LALA 4AHUA 3EZ5A 3SUOA 1WSJA 3U6FA 1L5UA 4KI4A 2HHSA 2BDPA 4DMNA 4BDPA 4DTPA 1VSDA 3L3UA 5KGXA 2KZMA 3M8RA 3HM9A 4M45A 3MEEA 3E01A 2E6LA 4DFKA 3OVNA 3ZSQA 2D0CA 3K59A 3U3GA 4PY5A 3OYNA 1HRHA 3KD5E 1KVCA 4DSIA 4CJ4A 4DQPA 4C8OA 4M3WA 2BANA 2F8TA 3L2QA 1RDAA 4CIFA 1JLAA 3K5NA 1QTMA 1WSEA 2YHAA 3QEXA 3T3FA 1YTUA 2F8SA 1TKZA 1Q8IA 1UWBA 4N47A 4B9SA 4BDYA 1C0UA 3HSTB 1RDBA 1CXUA 1VSKA 3B6PA 1KFDA 4CGIA 4CJ3A 4CGDA 3K2PA 3SPZA 3ISNC 4FJXA 3VN5A 1DTQA 2WONA 3LP2A 4CF2A 3K58A 1RDDA 2G8HA 1RT6A 1VSHA 5KRTA 4M41A 4CGJA 3DMJA 2DY4A 3LPUA 1X9WA 2QKBA 1TKXA 1KLNA 3B6OA 4DSFA 1BCOA 2ZD1A 1BIZA 3CYMA 4LH5A 3L8BA 1CZ9A 3VA0A 4CF8A 1U45A 2P5GA 4TSXA 5C24A 2IC3A 3DRRA 4HTUA 2OA8A 3BDPA 3OYCA 4H8KA 4FLXA 3OYEA 1J9AA 1RTHA 1A5XA 1XHZA 2X6NA 4DTSA 1T8EA 1F21A 1ZBUA 3KLIA 1L3SA 3OYBA 1BI4B 3M8PA 3I8DA 4FJ5A 1ZBHA 4ELVA 2BGGA 1S9EA 2Q3SA 4EP5A 4NYNA 1JLQA 4Z4GA 5T7BA 1KRPA 4IFVA 3OYMA 1XI1A 2DFFA 1C1CA 2HB5A 3F73A 1NKBA 4FM0A 3DYAA 4FCYA 1BHLA 2QKKA 1J54A 3M8SA 1S1VA 1S1WA 1XC9A 2PYJA 4B9MA 3QO9A 1BIUA 4BE1A 4PUOA 4YNQA 2W42A 1RT4A 1L3TA 3AA3A 3OS1A 4OGCA 3KD1E 4I9QA 3OYIA 4PQUA 3PX0A 4E3SA 4O4GA 3VQCA 3NH2A 1VSFA 2D0AA 3EY1A 4YFUA 1D8YA 4CHZA 4DLGA 3RRHA 3V9SA 3QEWA 2Z1IA 2A1SA 1U04A 1WSIA 1Q9XA 1BI4A 1ASUA 3C6TA 4NCGA 4CHYA 1BQNA 1G15A 3HXMA 2VG6A 4HCCA 3AVNA 1D5AA 5J2MA 1S5JA 4CHNA 3EYZA 1TV6A 4GVMA 3T1AA 3KIOA 4NYFA 3SV3A 3S9HA 3TAQA 1DLOA 3DLBA 3VQ7A 4H4MA 3AO5A 4N41A 2RN2A 1NK6A 3MECA 3VQ8A 4CIEA 5KI6A 1TK5A 1NKCA 2ETJA 4AHVA 4DG1A 1EXQA 4FLVA 3QEPA 2HVIA 3IRXA 4FLZA 4Z4FA 4KB1A 3V1QA 4M3UA 4FJIA 5JS1A 1QSYA 4GMJB 2GV9A 4H4OA 3O4QA 1J5OA 1VRTA 1R0AA 2FC0A 4AHSA 3ALYA 2Y1JA 2X78A 3I0RA 4MFBA 4CHQA 1HPZA 1JLGA 1RILA 4CFAA 1YTAA 4OJRA 3HP9A 4DFMA 1SL0A 4FJJA 4M3YA 3TANA 4LSLA 4CJVA 1QQCA 3V9ZA 1WN7A 4CJUA 1VSJA 1BQMA 2YV0X 5I42A 1WAJA 1S1XA 4KPYA 4W5TA 4LH4A 1HQEA 3MXJA 3KJVA 4OPKA 2KFZA 5DMRA 2B4JA 4QAGA 4G1QA 3QETA 3RMDA 1XWLA 3VQBA 2DFHA 1YVUA 4E7KA 1RT3A 5DK5A 4KFBA 3SQ2A 4QCLA 4J2AA 1RBRA 1EP4A 3DLRA 4FK0A 2F96A 4KHSA 2HHVA 4CECA 3KTQA 5SZTA 4RW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLE A;  4WE1 A;  4FJM A;  1KVA A;  1JLC A;  1WSG A;  3AVA A;  2RKI A;  3T19 A;  4PA1 A;  5HRR A;  1TVR A;  3NF9 A;  2R7Y A;  4FZY A;  2YNG A;  1C1B A;  3AVB A;  3DRS A;  3HPG A;  3M8Q A;  4Z4E A;  1IKW A;  3TAM A;  4Y1C A;  4IKF A;  4KHQ A;  4KI6 A;  1HQU A;  4EP4 A;  4DFP A;  2PY5 A;  4E1N A;  4CJE A;  2OYQ A;  3S3M A;  2HHQ A;  3WNH A;  4DU1 A;  1K6Y A;  3CFO A;  3AVK A;  2B5J A;  5KRS A;  3PUF A;  3K5L A;  3LWL A;  1N6Q A;  2XRI A;  4JS5 A;  3NGY A;  3ZT2 A;  4E7J A;  4ZHR A;  4DTR A;  4FJH A;  4BAC A;  1SKW A;  4ID1 A;  4DQQ A;  4OKJ A;  4Z4I A;  1LAW A;  2GUI A;  2OPR A;  3NAE A;  3JYT A;  1LW0 A;  1VSE A;  3ITH A;  3QNN A;  1VSL A;  3AVH A;  2HHX A;  1UA0 A;  3LAN A;  4OLA A;  3LP1 A;  3SPY A;  1NOZ A;  3AA4 A;  3ZSZ A;  3LZI A;  1KTQ A;  1W0H A;  1GOB A;  3RRG A;  5D3G A;  4M3Z A;  3NH0 A;  4E7H A;  1FK9 A;  4BE0 A;  4N5S A;  3PV8 A;  1UAX A;  3P5J A;  3ZSY A;  1RBU A;  3SJJ A;  4DF8 A;  2HHW A;  4CJP A;  4IG0 A;  2E6M A;  3TAB A;  4DTN A;  1U49 A;  1W9H A;  4ZTJ A;  1S1U A;  3DLG A;  2VWJ A;  3L2R A;  4M42 A;  3DLE A;  2E4L A;  3KK2 A;  4JRP A;  3VQA A;  3A2F A;  3CFR A;  4C8L A;  1I39 A;  3O3F A;  5HBM A;  5FRN A;  1JLE A;  1B92 A;  2XO7 A;  4F8R A;  4HVJ A;  4FK2 A;  3QEI A;  3K5M A;  1DTT A;  1IKY A;  4B9U A;  1BCM A;  4FJG A;  2HND A;  4CJK A;  3VQE A;  3THV A;  3DI6 A;  1UA1 A;  4CEZ A;  1TKD A;  4CFD A;  3AA5 X;  3K57 A;  3NDK A;  5HP1 A;  3NE6 A;  4FYD A;  5EU7 A;  4O55 A;  4FZZ A;  1BL3 A;  2FBT A;  1QHT A;  3VQD A;  1TK8 A;  4HHT A;  4N76 A;  4CK2 A;  1SL1 A;  1EKE A;  4JLH A;  3OYL A;  2ZQB A;  4DTU A;  3TAG A;  3NBP A;  3F9K A;  3OYJ A;  1RTJ A;  3CM6 A;  2QXF A;  4MQ3 A;  4CF0 A;  3LP3 A;  1WLJ A;  2HVH A;  1GOC A;  4FJK A;  3HVR A;  1NK0 A;  4N56 A;  4W5N A;  1T7P A;  4DU3 A;  4Z0U A;  4KB0 A;  3VQQ A;  3VQ4 A;  4CEQ A;  1U47 A;  2YNH A;  2EHG A;  3KKR A;  1REV A;  2RF2 A;  4DQI A;  5CYM A;  4DTO A;  2G8K A;  4J2B A;  1WSH A;  1L3U A;  1KCF A;  4ID5 A;  4DSJ A;  2KW4 A;  3D0P A;  4J2D A;  1CLQ A;  2D5R A;  3DRP A;  4I2P A;  1JLF A;  3LP0 A;  1WSF A;  3V1R A;  5C25 A;  3NGZ A;  3AVC A;  1J53 A;  1JLB A;  1WAF A;  1O1W A;  1C0M A;  3LAM A;  3TWH A;  4DLE A;  3V4I A;  4FK4 A;  4JRQ A;  4F3T A;  3ASM A;  1S1T A;  3AA2 A;  3ZSW A;  1T03 A;  4F2S A;  3L3V A;  5HRS A;  5J2N A;  3RMA A;  4DSL A;  1S6P A;  1HNI A;  3P83 D;  3OYF A;  4BDZ A;  1IKX A;  5CYQ A;  4DS4 A;  4B9V A;  4KTQ A;  4FXD A;  4HUF A;  4ELT A;  3NHG A;  2XY7 A;  3ZCM A;  1QSS A;  4DU4 A;  1VK0 A;  1KSP A;  2YKM A;  3OYD A;  3MXI A;  4DF4 A;  3WNF A;  3QIO A;  3AV9 A;  4HUG A;  1RT1 A;  1RTD A;  4RW6 A;  1SL2 A;  3AVF A;  3RR7 A;  1RT2 A;  3VQ9 A;  2OPQ A;  2LSN A;  2VG5 A;  4OLB A;  3HPH A;  3CG7 A;  2KFN A;  2DTU A;  1HYZ A;  5I3U A;  4F4K A;  1LWF A;  4FLT A;  3LZJ A;  2G8U A;  4L8R B;  1QS4 A;  5J2P A;  2P5O A;  3LAK A;  3C95 A;  4KTW A;  1RT5 A;  5FDL A;  3PX6 A;  2ZE2 A;  2BE2 A;  2ITG A;  3DM2 A;  4C8N A;  3AVJ A;  4CEO A;  3KK1 A;  4B9T A;  4KHN A;  3AVL A;  2HW3 A;  1JL2 A;  1Q9Y A;  1RT7 A;  4FLU A;  1QSL A;  2VG7 A;  3HPO A;  4KHY A;  2ATQ A;  3ZT0 A;  2P51 A;  3FFI A;  4CEF A;  1NJX A;  5E41 A;  3MED A;  2IDO A;  3QEV A;  3HYF A;  4FVM A;  3NF8 A;  3AO4 A;  4FW2 A;  2IGI A;  1X1P A;  1SV5 A;  4Q0B A;  4RG8 A;  5K14 A;  4FLW A;  3QLH A;  4CES A;  3PX4 A;  3DOL A;  4FW1 A;  1LAV A;  2VWK A;  3NF6 A;  2O4I A;  1JL1 A;  3CQ8 A;  1RTI A;  3DOK A;  4LY7 A;  1KVB A;  3P1G A;  1JXE A;  4IG3 A;  4O0I A;  2Z1G A;  1KFS A;  3SUP A;  4K8Z A;  3O3H A;  1NK5 A;  2XY6 A;  4OVL A;  4C8K A;  1NJW A;  2O4G A;  5HRO A;  1MU2 A;  2Z1H A;  3KK3 A;  4F2R A;  3HO1 A;  4DSK A;  1TAQ A;  3RMB A;  5JS2 A;  3HK2 A;  3V9X A;  4CCH A;  4EZ9 A;  4HCB A;  4CJT A;  1EET A;  3H08 A;  1Y97 A;  3NCI A;  2Y1I A;  2OZM A;  4KAZ A;  3QER A;  4LD0 A;  3S3O A;  2OZS A;  4B8A B;  1D9D A;  4OKE A;  2YNI A;  4M3R A;  4NCB A;  3IG1 A;  4FLY A;  3PY8 A;  3KLF A;  3SQ0 A;  4XIU A;  2XHB A;  1IKV A;  2QK9 A;  4CK1 A;  4J2E A;  1JKH A;  1VRU A;  3VQ5 A;  2YNF A;  1IH7 A;  1WNS A;  4Z4C A;  3HVT A;  1FKP A;  2P1J A;  4IDK A;  3HP6 A;  4KO0 A;  1U4B A;  4PWD A;  3SUN A;  2PZS A;  4FJL A;  2D0B A;  2G8W A;  4HUE A;  1S6Q A;  4CHP A;  4I9L A;  1LWC A;  3U3Y A;  2G8I A;  1VSM A;  3VQ6 A;  1YT3 A;  1NK8 A;  1BIS A;  1Z25 A;  1C6V A;  4IBN A;  5KGW A;  4CGF A;  1ZBI A;  4JS4 A;  3VQP A;  4AHC A;  4CEA A;  4CJ5 A;  2X74 A;  4DSE A;  3SQ4 A;  3ZT1 A;  3D45 A;  2HMI A;  3LDS A;  2X6S A;  1LW2 A;  2XY8 A;  4CJQ A;  4CJR A;  1U48 A;  3OYG A;  1HMV A;  4I7F A;  3UIQ A;  3JSM A;  4AIL C;  1L3V A;  2IAJ A;  4OGE A;  2KTQ A;  4UQG A;  4BWJ A;  3IS9 A;  4CEE A;  3L2V A;  2AJQ A;  1HJR A;  4IFY A;  4CF1 A;  3TAP A;  5CZ2 A;  4CFB A;  3CFP A;  3OYH A;  4CEB A;  1HNV A;  3SCX A;  1CXQ A;  3G10 A;  3SZ2 A;  1TAU A;  3OJS A;  1LV5 A;  3NGI A;  1BGX T;  5HRN A;  3AO3 A;  3SQ1 A;  4ELU A;  2G8V A;  2HNZ A;  2HHT A;  4W5R A;  1X9M A;  4FJN A;  2JLE A;  2KQ2 A;  4E7L A;  1A5W A;  4AHT A;  3O4N A;  3L2W A;  1B9F A;  1KLM A;  3ZSR A;  3TAE A;  1ZBF A;  1Z26 A;  4KTZ A;  4CER A;  1TK0 A;  4CJF A;  4GW6 A;  2KZZ A;  3O3G A;  3RTV A;  2Z1J A;  3I0S A;  4LSN A;  3S3N A;  4CJW A;  2EX3 A;  3AVM A;  3ZT4 A;  3QES A;  3TAR A;  4DS5 A;  3OY9 A;  1ZBL A;  1ZYQ A;  4KRE A;  1S9G A;  3QIN A;  4DQR A;  1C1A A;  2XY5 A;  3V81 A;  4M3X A;  3RR8 A;  3VA3 A;  1EX4 A;  4R5P A;  1GOA A;  1QE1 A;  1D9F A;  4M3T A;  3MEG A;  4FZX C;  3AVI A;  4O5B A;  1TL3 A;  3MAQ A;  4E1M A;  1NJZ A;  1NOY A;  1SKS A;  4BWM A;  3KLG A;  4K8X A;  2YKN A;  4CGG A;  4CED A;  4C8M A;  2DFE A;  1C0T A;  3CM5 A;  3RMC A;  5J2Q A;  1XHX A;  3V9W A;  4DTM A;  1RBS A;  4Q5V A;  1RNH A;  4B08 A;  4BE2 A;  1A5V A;  3ZSX A;  3OS2 A;  3LWM A;  4DTX A;  3PO4 A;  4B3O A;  4E7I A;  3DLH A;  3PO5 A;  3NFA A;  3V6D A;  2FBY A;  1SUQ A;  2FBX A;  2B6A A;  1IO2 A;  2I5J A;  3AO1 A;  3C94 A;  2IS3 A;  3NF7 A;  5HLF A;  3G0Z A;  4Y1D A;  5CY4 A;  4FJ8 A;  4E89 A;  1SKR A;  1NJY A;  4DWI A;  5SWM A;  4B9N A;  2HNY A;  3HJF A;  4CHO A;  3SI6 A;  4F3O A;  5C42 A;  1ITG A;  4QOZ B;  4OKK A;  1HYS A;  3TI0 A;  4KHW A;  4NCA A;  2HHU A;  4AH9 A;  3OYK A;  3WNG A;  4KHU A;  4B8C A;  3LPT A;  1RBV A;  4O0J A;  3KLH A;  2JGU A;  4CIG A;  1FKO A;  2OPS A;  3QNO A;  1VSI A;  4RW8 A;  1HYV A;  5FRO A;  1N5Y A;  4CE9 A;  1X9S A;  1NK7 A;  3ZSO A;  2GBZ A;  4B9L A;  2WOM A;  4AHR A;  4DQS A;  1NKE A;  2OPP A;  3SUQ A;  1TL1 A;  5J1E A;  3AVG A;  3BGR A;  4W5Q A;  4RW9 A;  4CF9 A;  3ULD A;  4FM1 A;  4FM2 A;  3SNN A;  4DFJ A;  3C6U A;  1I3A A;  1JXB A;  3WNE A;  2A1R A;  4FJ7 A;  1T05 A;  2YHB A;  3NH1 A;  3OS0 A;  4CFC A;  4CJS A;  3SV4 A;  3QIP A;  3DLK A;  4Z4H A;  4CK3 A;  1RDC A;  1NK9 A;  4FJ9 A;  1IG9 A;  3TAF A;  2G8F A;  1TGO A;  3IAY A;  2RPI A;  4KRF A;  1TKT A;  4OPJ A;  1RCH A;  5FRM A;  3KKS A;  3HT3 A;  3ZT3 A;  1UOC A;  4ZTF A;  4E19 A;  4CGH A;  4DTJ A;  3SYZ A;  2FBV A;  1ASV A;  3HL8 A;  3L2U A;  3AO2 A;  1B9D A;  3V1O A;  4I2Q A;  4KV8 A;  1NK4 A;  1RBT A;  3ZSV A;  4W5O A;  4O44 A;  1ASW A;  4RW4 A;  2PYL A;  5KTQ A;  3K5O A;  3OYA A;  5CZ1 A;  3V9U A;  5HRP A;  4EZ6 A;  1LWE A;  1CZB A;  3TR8 A;  1FXX A;  4E0D A;  4CJL A;  3RWU A;  3OJU A;  2IOC A;  4ICL A;  2NUB A;  3MXM A;  4KKO A;  3LAL A;  4AHU A;  3EZ5 A;  3SUO A;  1WSJ A;  3U6F A;  1L5U A;  4KI4 A;  2HHS A;  2BDP A;  4DMN A;  4BDP A;  4DTP A;  1VSD A;  3L3U A;  5KGX A;  2KZM A;  3M8R A;  3HM9 A;  4M45 A;  3MEE A;  3E01 A;  2E6L A;  4DFK A;  3OVN A;  3ZSQ A;  2D0C A;  3K59 A;  3U3G A;  4PY5 A;  3OYN A;  1HRH A;  3KD5 E;  1KVC A;  4DSI A;  4CJ4 A;  4DQP A;  4C8O A;  4M3W A;  2BAN A;  2F8T A;  3L2Q A;  1RDA A;  4CIF A;  1JLA A;  3K5N A;  1QTM A;  1WSE A;  2YHA A;  3QEX A;  3T3F A;  1YTU A;  2F8S A;  1TKZ A;  1Q8I A;  1UWB A;  4N47 A;  4B9S A;  4BDY A;  1C0U A;  3HST B;  1RDB A;  1CXU A;  1VSK A;  3B6P A;  1KFD A;  4CGI A;  4CJ3 A;  4CGD A;  3K2P A;  3SPZ A;  3ISN C;  4FJX A;  3VN5 A;  1DTQ A;  2WON A;  3LP2 A;  4CF2 A;  3K58 A;  1RDD A;  2G8H A;  1RT6 A;  1VSH A;  5KRT A;  4M41 A;  4CGJ A;  3DMJ A;  2DY4 A;  3LPU A;  1X9W A;  2QKB A;  1TKX A;  1KLN A;  3B6O A;  4DSF A;  1BCO A;  2ZD1 A;  1BIZ A;  3CYM A;  4LH5 A;  3L8B A;  1CZ9 A;  3VA0 A;  4CF8 A;  1U45 A;  2P5G A;  4TSX A;  5C24 A;  2IC3 A;  3DRR A;  4HTU A;  2OA8 A;  3BDP A;  3OYC A;  4H8K A;  4FLX A;  3OYE A;  1J9A A;  1RTH A;  1A5X A;  1XHZ A;  2X6N A;  4DTS A;  1T8E A;  1F21 A;  1ZBU A;  3KLI A;  1L3S A;  3OYB A;  1BI4 B;  3M8P A;  3I8D A;  4FJ5 A;  1ZBH A;  4ELV A;  2BGG A;  1S9E A;  2Q3S A;  4EP5 A;  4NYN A;  1JLQ A;  4Z4G A;  5T7B A;  1KRP A;  4IFV A;  3OYM A;  1XI1 A;  2DFF A;  1C1C A;  2HB5 A;  3F73 A;  1NKB A;  4FM0 A;  3DYA A;  4FCY A;  1BHL A;  2QKK A;  1J54 A;  3M8S A;  1S1V A;  1S1W A;  1XC9 A;  2PYJ A;  4B9M A;  3QO9 A;  1BIU A;  4BE1 A;  4PUO A;  4YNQ A;  2W42 A;  1RT4 A;  1L3T A;  3AA3 A;  3OS1 A;  4OGC A;  3KD1 E;  4I9Q A;  3OYI A;  4PQU A;  3PX0 A;  4E3S A;  4O4G A;  3VQC A;  3NH2 A;  1VSF A;  2D0A A;  3EY1 A;  4YFU A;  1D8Y A;  4CHZ A;  4DLG A;  3RRH A;  3V9S A;  3QEW A;  2Z1I A;  2A1S A;  1U04 A;  1WSI A;  1Q9X A;  1BI4 A;  1ASU A;  3C6T A;  4NCG A;  4CHY A;  1BQN A;  1G15 A;  3HXM A;  2VG6 A;  4HCC A;  3AVN A;  1D5A A;  5J2M A;  1S5J A;  4CHN A;  3EYZ A;  1TV6 A;  4GVM A;  3T1A A;  3KIO A;  4NYF A;  3SV3 A;  3S9H A;  3TAQ A;  1DLO A;  3DLB A;  3VQ7 A;  4H4M A;  3AO5 A;  4N41 A;  2RN2 A;  1NK6 A;  3MEC A;  3VQ8 A;  4CIE A;  5KI6 A;  1TK5 A;  1NKC A;  2ETJ A;  4AHV A;  4DG1 A;  1EXQ A;  4FLV A;  3QEP A;  2HVI A;  3IRX A;  4FLZ A;  4Z4F A;  4KB1 A;  3V1Q A;  4M3U A;  4FJI A;  5JS1 A;  1QSY A;  4GMJ B;  2GV9 A;  4H4O A;  3O4Q A;  1J5O A;  1VRT A;  1R0A A;  2FC0 A;  4AHS A;  3ALY A;  2Y1J A;  2X78 A;  3I0R A;  4MFB A;  4CHQ A;  1HPZ A;  1JLG A;  1RIL A;  4CFA A;  1YTA A;  4OJR A;  3HP9 A;  4DFM A;  1SL0 A;  4FJJ A;  4M3Y A;  3TAN A;  4LSL A;  4CJV A;  1QQC A;  3V9Z A;  1WN7 A;  4CJU A;  1VSJ A;  1BQM A;  2YV0 X;  5I42 A;  1WAJ A;  1S1X A;  4KPY A;  4W5T A;  4LH4 A;  1HQE A;  3MXJ A;  3KJV A;  4OPK A;  2KFZ A;  5DMR A;  2B4J A;  4QAG A;  4G1Q A;  3QET A;  3RMD A;  1XWL A;  3VQB A;  2DFH A;  1YVU A;  4E7K A;  1RT3 A;  5DK5 A;  4KFB A;  3SQ2 A;  4QCL A;  4J2A A;  1RBR A;  1EP4 A;  3DLR A;  4FK0 A;  2F96 A;  4KHS A;  2HHV A;  4CEC A;  3KTQ A;  5SZT A;  4RW7 A; 
#chains in the Genus database with same CATH topology
 5EX5 A;  1E4G T;  4H03 B;  3T19 A;  3KHY A;  2YNG A;  1C1B A;  3HPG A;  4Z4E A;  2JWL A;  3KVG A;  4EP4 A;  4DFP A;  2OYQ A;  4BRI A;  2PY5 A;  3S3M A;  4JI3 K;  3TSQ A;  1K6Y A;  3K5L A;  3LWL A;  4E7J A;  3L4I A;  4R79 A;  4FO0 A;  1SKW A;  4OKJ A;  4BRO A;  2GUI A;  2HHX A;  3LP1 A;  3OBW A;  4CBW A;  1GOB A;  2P9P A;  1VQ7 N;  2D0P A;  4WCE L;  4N5S A;  5M1O A;  3ZSY A;  1RBU A;  2F7T A;  1IG8 A;  4CJP A;  2E6M A;  3TAB A;  3DLG A;  1QQM A;  3U8X A;  4LF8 K;  3CI5 A;  3OW2 M;  4UY8 O;  3MN9 A;  1B92 A;  4OO1 J;  5C10 A;  4HVJ A;  4FK2 A;  3K5M A;  1YI2 N;  4ISF A;  3VQE A;  4CJK A;  3DI6 A;  4IOA L;  3AA5 X;  3K57 A;  3NDK A;  3NE6 A;  4FYD A;  4FZZ A;  2GX9 A;  3Q7B A;  1QHT A;  4IOC L;  3TTC A;  1W2B M;  4N76 A;  1EKE A;  4JLH A;  3VTI A;  1E4F T;  2O8B B;  3VF4 A;  3F9K A;  1MWM A;  2NRZ A;  3CM6 A;  1GOC A;  3HVR A;  1DEJ A;  4H5W A;  4KB0 A;  3VQ4 A;  5CYM A;  2G8K A;  1WSH A;  1WB9 A;  3C0B A;  4DSJ A;  2Q0U A;  4I2P A;  1JLF A;  4PKG A;  4JHD B;  3LP0 A;  1WSF A;  1J53 A;  3MDQ A;  4DLE A;  1NGF A;  1S72 N;  5MLC Q;  4BRK A;  1VQK N;  3DXK B;  4DSL A;  3IFR A;  1S6P A;  4B9V A;  4KTQ A;  4BGB A;  5CYQ A;  4GV6 A;  3WXI A;  4DU4 A;  4DF4 A;  1U2V B;  3AV9 A;  1RT1 A;  3AVF A;  3H6E A;  4CD3 A;  4OLB A;  3HPH A;  2KFN A;  5I3U A;  1LWF A;  4FLT A;  1BWF O;  2HBJ A;  3PX6 A;  3VGK A;  1Q81 O;  2BE2 A;  4C8N A;  3AVJ A;  2QM1 A;  4CEO A;  3AVL A;  2ZGZ A;  1QQN A;  4FLU A;  1Q9Y A;  2VG7 A;  1T3V A;  3M1F A;  3MED A;  2CH5 A;  1ILY A;  3AGR A;  2F4V K;  3M6G A;  2IGI A;  1X1P A;  3H3N O;  4RG8 A;  3O6W A;  1HNX K;  2O4I A;  4FW1 A;  1VHX A;  1XC3 A;  4LY7 A;  1V4S A;  1GLA G;  3P1G A;  3SUP A;  2ZJR L;  4OVL A;  4F2R A;  5HRO A;  1KQS M;  3LDP A;  1TAQ A;  3IKM A;  3RMB A;  2UUA K;  3TU5 A;  4KAZ A;  2E1Y A;  5AQF A;  1D9D A;  1XMQ K;  3IG1 A;  3PY8 A;  1ZBS A;  3QBX A;  1XNQ K;  3WXL A;  2QK9 A;  2P9N B;  4J2E A;  3QFP A;  5IWA K;  2P9K A;  1IH7 A;  4DR1 K;  4KO0 A;  4XEI A;  3SUN A;  2PZS A;  4FJL A;  2D0B A;  3R8E A;  3ULE A;  2OCE A;  4DV4 K;  1NK8 A;  1Z25 A;  4IBN A;  1VQO N;  2FLO A;  4BRP A;  3VQP A;  3CCV N;  1Q18 A;  2X74 A;  4BVP A;  3ZT1 A;  3O9T A;  4DSE A;  3QBW A;  2HMI A;  2X6S A;  4CJQ A;  4CJR A;  2P9U B;  3OYG A;  4I7F A;  4ISG A;  4BRL A;  3H46 O;  3KK7 A;  4HTL A;  1L3V A;  2Q31 A;  4BWJ A;  4CEE A;  1HJR A;  5AQR A;  3CFP A;  4DQ8 A;  3JXU A;  3SCX A;  2V7Z A;  5A2Q O;  3AO3 A;  2G8V A;  4DR7 K;  4FJN A;  2FF3 B;  4FWM A;  1KLM A;  3ZSR A;  3OBY A;  4CER A;  4CJF A;  2GEM A;  3S3N A;  3I0S A;  1JJ2 M;  2EX3 A;  4DS5 A;  1ZBL A;  3QIN A;  3WXM B;  3FZL A;  2XY5 A;  3A8Y A;  4JI1 K;  4F9O A;  2A6A A;  1TL3 A;  4BR2 A;  1NNE A;  1NOY A;  3EE9 A;  4BWM A;  3KLG A;  1SKS A;  4K8X A;  2WBN A;  3CM5 A;  2O8B A;  3SAH A;  4EHT A;  4LFC K;  1VQM N;  3C65 A;  4DTX A;  4B3O A;  3DLH A;  3PO5 A;  3NFA A;  1HLU A;  2PBD A;  1BG3 A;  2I5J A;  2IS3 A;  4BQZ A;  5JMV A;  4E89 A;  3THW B;  3TSU A;  3HJF A;  4CHO A;  3VPZ A;  3SI6 A;  3OTO K;  4BRD A;  3DXK A;  1W97 L;  3FZK A;  4KHU A;  2CGJ A;  3OYK A;  4MDB A;  1KAY A;  3L4Q A;  4FPB A;  1RBV A;  4O0J A;  2JGU A;  2OAN A;  4JKF A;  5M1F A;  1NK7 A;  2WOM A;  3SUQ A;  4CF9 A;  4FM1 A;  1I3A A;  1GLL O;  2A1R A;  4FJ7 A;  2YHB A;  3CET A;  3OS0 A;  3SV4 A;  3QIP A;  4LF5 K;  4CK3 A;  1RDC A;  2YHW A;  4FJ9 A;  2G8F A;  2RPI A;  4OPJ A;  5FRM A;  2P9I A;  4CGH A;  4DKW A;  1H1V A;  2FBV A;  4DTJ A;  1NK4 A;  1WOQ A;  4FWL A;  4FPA A;  1ASW A;  2PYL A;  5CZ1 A;  3V9U A;  4U7B A;  1LWE A;  4EHU A;  5AQM A;  4CJL A;  3OJU A;  2NUB A;  4KKO A;  3LAL A;  3EZ5 A;  3SUO A;  1L5U A;  1J5E K;  2BDP A;  3EN9 A;  3AAQ A;  5AQY A;  5FPE A;  1NJI O;  2KZM A;  4V19 S;  3E01 A;  2E6L A;  5C2D A;  4PY5 A;  2P9N A;  4BRF A;  4CJ4 A;  5I9E B;  4CBU A;  3RSE B;  3K5N A;  4ILH A;  4IWV A;  1YTU A;  4LFB K;  4BDY A;  3HST B;  4YOU A;  4FJX A;  3GOI A;  4CZG A;  3K58 A;  2G8H A;  1RDD A;  4MO4 A;  3P31 A;  1VQ9 N;  2P9U A;  5AQT A;  2QKB A;  1TKX A;  1KLN A;  1YVN A;  3D2F A;  3SJH A;  3DRR A;  4M7Y A;  4H8K A;  4FLX A;  1ATS A;  1RTH A;  1A5X A;  3MX5 A;  3VF2 A;  1DGK N;  1T8E A;  4H5R A;  3M8P A;  2YHX A;  1S9E A;  4NYN A;  1KRP A;  2V52 B;  4IFV A;  3OYM A;  1XI1 A;  1X3M A;  1C1C A;  4H0Y B;  3F73 A;  1BHL A;  5KQD A;  3UE5 A;  1S1V A;  2PYJ A;  4B9M A;  2QWP A;  4PUO A;  2YX6 A;  3ID8 A;  1RT4 A;  3QIC A;  2E20 A;  1X3N A;  1VSF A;  2D0A A;  3RRH A;  3ID6 A;  3V9S A;  3QEW A;  2Z1I A;  3H45 C;  3C6T A;  1K8K A;  4NCG A;  1BQN A;  2VG6 A;  4HCC A;  5J2M A;  2NRH A;  3CCL N;  3S9H A;  3AAR A;  3VQ7 A;  3AO5 A;  4N41 A;  1NK6 A;  3MEC A;  4BGA A;  1TK5 A;  1MWK A;  3IRX A;  4Z4F A;  4B9Q A;  3R1X A;  4BG8 A;  4KB1 A;  4M3U A;  4FJI A;  4NLB A;  4K25 A;  4JK9 A;  2I7P A;  3VEZ A;  4AHS A;  3MWP A;  1SL0 A;  1NJX A;  1JLG A;  4LSL A;  4CJU A;  2PAV A;  4KPY A;  4AQY K;  3KJV A;  5DMR A;  3QET A;  1SS6 A;  5BRF A;  3CMA N;  3VQB A;  1N34 K;  2DFH A;  4E7K A;  5DK5 A;  5BRD A;  4JKG B;  4KHS A;  1VQ4 N;  3HTV A;  4CEC A;  5JVH L;  4RW7 A;  2RKI A;  4PA1 A;  1IKW A;  3IUC A;  4BR9 A;  5BR8 K;  3TAM A;  4HWI A;  3IMX A;  2IVN A;  1HQU A;  4XH1 A;  4E1N A;  2VGN A;  1HX1 A;  2QWN A;  4DU1 A;  4BRN A;  2B5J A;  3NGY A;  3ZT2 A;  4ZHR A;  4DTR A;  3THX B;  4FJH A;  4PL7 A;  1OH8 A;  3NAE A;  3JYT A;  4WQ4 C;  4IO9 L;  2A3Z A;  1W0H A;  4GKJ K;  4M3Z A;  3VTH A;  3P38 A;  3PV8 A;  3P5J A;  3SJJ A;  2ZM6 K;  5BN9 A;  2E5L K;  3AGK A;  3ENB A;  4ZTJ A;  2VWJ A;  1QHA A;  1BUP A;  3QDK A;  2YI1 A;  3SAF A;  3I33 A;  3SBT A;  4M42 A;  2E4L A;  2O8E B;  2GTD A;  4JRP A;  3VQA A;  3CFR A;  2WC9 A;  3C7N A;  5E26 A;  3O3F A;  1ESV A;  3I55 N;  4F8R A;  1NM1 A;  1J6Z A;  3P39 A;  1IKY A;  2HND A;  1UA1 A;  4CEZ A;  3RSE A;  1LCU A;  3E9O A;  5HP1 A;  1BL3 A;  3NVK A;  3DAW A;  4HHT A;  1SL1 A;  3OYL A;  4DTU A;  2QXF A;  1QZ6 A;  1P90 A;  5LJW A;  1U47 A;  4GKK K;  2EHG A;  2RF2 A;  2IVO A;  4DTO A;  1KCF A;  4J2D A;  3D0P A;  2D5R A;  1V4T A;  3NGZ A;  4DV5 K;  1JLB A;  3DXM B;  1O1W A;  2VCP A;  3MN7 A;  4JRQ A;  3AA2 A;  4O8U A;  4WQ5 A;  1Z6R A;  3TSP A;  4FXD A;  4ELT A;  2V51 B;  2XY7 A;  3O1W A;  1QSS A;  4A2B A;  1VK0 A;  1KSP A;  3CCS N;  2NNW A;  4IJA A;  3MXI A;  3QIO A;  3TTD A;  4HUG A;  5BRH A;  3VQ9 A;  2OPQ A;  4KH5 A;  2DTU A;  1HYZ A;  1XUP O;  3LZJ A;  5J2P A;  1NMN A;  1HR0 K;  3DM2 A;  1JL2 A;  4KHY A;  1BA1 A;  3ZT0 A;  3CF5 L;  2P9L B;  5E41 A;  3ATV A;  5HOO A;  3HYF A;  3NF8 A;  4FW2 A;  1SV5 A;  3T69 A;  3O8M A;  5AFU H;  1RGI A;  4BRC A;  3DOL A;  1LAV A;  4IEE A;  1JL1 A;  4NO7 A;  4MDA A;  3DOK A;  1M1K O;  4XH5 A;  4FWO A;  3F2K A;  1DKG D;  2J4R A;  2Z1G A;  1HKC A;  4BRM A;  3ULE B;  4K8Z A;  3VF6 A;  5HL7 L;  3GG4 A;  2NLX A;  2Z1H A;  3KK3 A;  1C0G A;  4LF7 K;  3U9Z A;  3EE8 A;  5AQH A;  3VMF B;  1NGH A;  3GDQ A;  1SAZ A;  3QER A;  4LD0 A;  4OKE A;  4M3R A;  4X66 K;  3F9M A;  3O80 A;  3SQ0 A;  1HPM A;  4XIU A;  1IKV A;  2NRX A;  3HM8 A;  4JKG A;  2NRT A;  1NLV A;  1JKH A;  3VQ5 A;  4Z4C A;  1WNS A;  4PKH A;  3HP6 A;  2P1J A;  2WUS A;  4DV7 K;  1S22 A;  3LM2 A;  3U3Y A;  1S6Q A;  4CHP A;  1KC8 O;  2G8I A;  3VQ6 A;  5AQK A;  1BIS A;  5KGW A;  4JS4 A;  4CD1 A;  4AHC A;  4ISE A;  4CEA A;  3SQ4 A;  3D45 A;  5AQL A;  1O13 A;  3LDS A;  2XY8 A;  1YJN N;  2ZWH A;  5GAH P;  3VEN A;  3THX A;  3UIQ A;  3JSM A;  2IAJ A;  4UQG A;  4GV3 A;  2E2N A;  1K8A O;  3ZX2 A;  4CFB A;  3O1B A;  4MLH A;  1HNV A;  5AQG A;  1TAU A;  5HRN A;  4ELU A;  2HNZ A;  2HHT A;  1NGA A;  3L2W A;  1ZBF A;  3QML A;  4GW6 A;  3O3G A;  1EWR A;  4H0P A;  4CJW A;  2O8E A;  1N33 K;  3TAR A;  4KRE A;  3OY9 A;  3MWT A;  3V81 A;  5AQU A;  5AFU A;  3MK6 A;  4M3T A;  4FWP A;  3M3Z A;  3MEG A;  3AVI A;  5H1S Q;  2WFB A;  2BUP A;  1XHX A;  3V9W A;  3HOT A;  4Q5V A;  1RNH A;  4BE2 A;  4EAH D;  1TYQ A;  4NLC A;  4E7I A;  2FBY A;  1SUQ A;  2B6A A;  1IO2 A;  5HLF A;  5ADX H;  2V7Y A;  3NF7 A;  3VET A;  5SWM A;  4B9N A;  3CCE N;  3DXM A;  3O9U A;  2CH6 A;  4DV2 K;  3CJB A;  2D1K A;  4FWK A;  4JKC A;  4K43 A;  5AQP A;  4DV1 K;  4AH9 A;  3FR0 A;  3LPT A;  4EFH A;  3O08 A;  3FZF A;  3QNO A;  1JCE A;  1HYV A;  5FPM A;  1N5Y A;  2P9I B;  4A5A A;  4CE9 A;  4FVU A;  4AHR A;  3E66 A;  2UUC K;  5J1E A;  3BGR A;  3ULD A;  5GAG P;  2F9T A;  4DFJ A;  1JXB A;  3WNE A;  2D0O A;  1T05 A;  4ILJ A;  2QWR A;  5AQW A;  3DWL A;  4CFC A;  4CJS A;  4CBX A;  2P9L A;  5LL6 Z;  4JNE A;  1W7A A;  4A61 A;  4KRF A;  1RCH A;  1G99 A;  3HT3 A;  4FWR A;  1ASV A;  3AO2 A;  1B9D A;  2GUP A;  4I2Q A;  4KV8 A;  5KQ8 A;  3K5O A;  3E9P A;  3HI0 A;  5HRP A;  3WEE B;  3TR8 A;  4E0D A;  4CZH A;  4JKE A;  2HF3 A;  4ICL A;  2E2O A;  2GWK A;  4AHU A;  5AQZ A;  4FWS A;  5JLF A;  3T7Z A;  3MEE A;  2D0C A;  3D2F B;  3VES A;  5AZI B;  3R6M A;  4DQP A;  2BAN A;  3L2Q A;  1RDA A;  4CIF A;  1FJG K;  2FXU A;  1WSE A;  2YHA A;  5ADX A;  3T3F A;  3ZET A;  1Q8I A;  1T44 A;  3EL2 A;  2Q36 A;  1C0U A;  1XQS C;  2HF4 A;  4CGI A;  3K2P A;  3SPZ A;  1VSH A;  1Q82 O;  2A5X A;  3LDQ A;  5BN8 A;  3A5O C;  1Q7Y O;  3DMJ A;  2DY4 A;  3A5L C;  1X9W A;  4C1N K;  4YOT A;  5KPT A;  1BIZ A;  1U45 A;  5TKY A;  4TSX A;  5C24 A;  3CJA A;  3MN6 A;  4HTU A;  2OA8 A;  2YJE A;  1XHZ A;  3O9R A;  4YY3 K;  2ZF5 O;  1ZBU A;  3HSC A;  4FJ5 A;  2HST A;  3CCR N;  1K8K B;  2BGG A;  4EP5 A;  4WFB L;  1JLQ A;  4Z4G A;  1KAX A;  2UU9 K;  2HB5 A;  3PLA A;  4FM0 A;  2O8F B;  5GAE P;  1J54 A;  4IEI A;  4OX9 K;  3QO9 A;  3W3D A;  2W42 A;  1L3T A;  4OGC A;  5AR0 A;  4E3S A;  3VQC A;  2YJF A;  4YFU A;  1D8Y A;  4DR6 K;  1YXQ A;  2A1S A;  2BH1 A;  4QS9 A;  1R59 O;  2FSJ A;  1G15 A;  3HXM A;  1N32 K;  4K0K K;  4B1V A;  2OTJ N;  2JWK A;  3CHW A;  4A2A A;  5C2F A;  3T1A A;  3C6A A;  3SAG A;  1DLO A;  4JN4 A;  4CZM A;  3VEO A;  3VQ8 A;  3J81 O;  4AHV A;  1IJJ A;  1EXQ A;  2EWS A;  3QEP A;  2HVI A;  4FLZ A;  4LC9 B;  3BF3 A;  1GLF O;  2RHK A;  4JI4 K;  1QSY A;  1HUX A;  4DV3 K;  1VRT A;  2QWO A;  3D2E A;  4MFB A;  4M3Y A;  4FWN A;  3HP9 A;  3PSF A;  4BRA A;  4DFM A;  4FJJ A;  1QQC A;  3EO3 A;  3V9Z A;  1VSJ A;  3H1V X;  1WAJ A;  3QB0 A;  4JKA A;  1S1X A;  3MCP A;  4C1N I;  1QQO A;  4IXC A;  2KFZ A;  4JI5 K;  4QAG A;  3RMD A;  3VOV A;  1XWL A;  2ZJP L;  5KPZ A;  1TUU A;  1XMO K;  4KFB A;  4QCL A;  1RBR A;  2F96 A;  4BC3 A;  2FF6 A;  1DT9 A;  5SZT A;  4KBO A;  4FJM A;  1KVA A;  3AVA A;  4B3M K;  1TVR A;  3NF9 A;  2R7Y A;  3G6E N;  3AVB A;  3DRS A;  3M8Q A;  4Y1C A;  3WXJ A;  4KI6 A;  3P4I A;  2O8D B;  1ATR A;  4CJE A;  3WNH A;  3CFO A;  5KRS A;  4DR3 K;  1N6Q A;  2QEX N;  1YIT N;  4BR4 A;  4BAC A;  3C7N B;  4DQQ A;  1IV0 A;  4Z4I A;  1LW0 A;  3QNN A;  5GIO A;  4A59 A;  3AVH A;  1UA0 A;  3LAN A;  3CCM N;  4OLA A;  1XNR K;  1NOZ A;  3AA4 A;  3LZI A;  1KTQ A;  3WEE A;  3RRG A;  5D3G A;  1BA0 A;  1QVG M;  5AJ3 K;  3THY B;  4IG0 A;  3HBT A;  4DTN A;  3MCA B;  1W9H A;  1U49 A;  4X65 K;  3VEV A;  3K0S A;  3UKR B;  3T1H K;  3CJ7 A;  3KK2 A;  3A2F A;  1JLE A;  1YUW A;  2AP1 A;  5AZI A;  1DTT A;  4FJG A;  4B9U A;  1TKD A;  2O8C A;  1JCG A;  4B1Y B;  2A42 A;  3JS6 A;  4GVE A;  2QTD A;  4WFN L;  2FBT A;  1TK8 A;  1Q86 O;  4CK2 A;  3TAG A;  3ZLJ A;  2ZQB A;  4JAX A;  1RTJ A;  2HVH A;  5FPN A;  4KH6 A;  4W5N A;  1NK0 A;  4N56 A;  1T7P A;  4DU3 A;  4Z0U A;  4I6M A;  4CEQ A;  2OTL N;  1CZA N;  1REV A;  3KKR A;  4DUZ K;  3JAM O;  1OH6 A;  1L3U A;  4ID5 A;  3D7E O;  1GLD G;  1CLQ A;  3DRP A;  1OH5 A;  3AVC A;  1WAF A;  3E1Y A;  1VAZ A;  1C0M A;  3LAM A;  3TWH A;  3OHR A;  4F3T A;  3ASM A;  1S1T A;  3QFU A;  3R3L A;  4PKI A;  1T03 A;  5HRS A;  4F2S A;  4BDZ A;  1HNI A;  3P83 D;  3OYF A;  1IKX A;  1X9J A;  3L6Q A;  4FOI A;  3NHG A;  3ZCM A;  2CGK A;  3CJ9 A;  5FLX O;  3OYD A;  5M1K A;  3WNF A;  1RTD A;  2O8F A;  4JI6 K;  1SL2 A;  1RT2 A;  2Q97 A;  4A5B A;  2LSN A;  2VG5 A;  4BRQ A;  3CG7 A;  3VGL A;  1HJO A;  3BY5 A;  4F4K A;  2KKZ A;  4NB4 A;  1QS4 A;  3LAK A;  5AQO A;  3C95 A;  2P9S B;  4BRE A;  1D4X A;  4B9T A;  4KHN A;  3SK3 A;  5B8H A;  3O5B A;  3EZW A;  1RT7 A;  4IFE A;  2ATQ A;  2P51 A;  3R9P A;  1GLB G;  3FFI A;  4CEF A;  3T1Y K;  3QEV A;  3AO4 A;  4RWT A;  4Q0B A;  5K14 A;  5CE3 A;  4CW7 B;  3QLH A;  4CES A;  5BPL A;  3PX4 A;  2VWK A;  4IDH A;  3CQ8 A;  1RTI A;  1KVB A;  4JI8 K;  1JXE A;  4IG3 A;  4O0I A;  3VEW A;  1GLC G;  3FZM A;  2IVP A;  3O3H A;  4C8K A;  1HNZ K;  1MU2 A;  3HO1 A;  1IBL K;  3HK2 A;  3V9X A;  4CCH A;  4HCB A;  2QWL A;  4CJT A;  3H08 A;  1Y97 A;  5C12 A;  4IZ9 A;  3S3O A;  4B8A B;  3FZH A;  4NCB A;  4FLY A;  3BF1 A;  3KLF A;  2HOE A;  4DUY K;  4FL9 A;  4CK1 A;  4BRH A;  1KAZ A;  1VRU A;  2YNF A;  4U67 L;  4X64 K;  1U4B A;  1FKP A;  4IDK A;  2WTU A;  4PWD A;  4B1Z A;  5F0X A;  4I9L A;  1LWC A;  1MDU B;  1C6V A;  2NRW A;  1ZBI A;  4CJ5 A;  2O8D A;  1YHQ N;  1U48 A;  4YOR A;  3AY9 A;  2KLA A;  3FFK B;  4AIL C;  2AJQ A;  4CF1 A;  3TAP A;  3OYH A;  4WQ5 C;  3PIP L;  3U4L A;  1CXQ A;  3SZ2 A;  3OJS A;  1LV5 A;  1BGX T;  3SQ1 A;  4W5R A;  3THY A;  2JLE A;  1A5W A;  1B9F A;  4YDU A;  3NVM A;  5EXW A;  1TK0 A;  5LMN K;  3UKR A;  3RTV A;  2Z1J A;  3AVM A;  1ZYQ A;  3QES A;  1S9G A;  1TYQ B;  1C1A A;  4M3X A;  4CJ7 A;  3RR8 A;  1EX4 A;  2UXB K;  5FPD A;  1GOA A;  1EQY A;  1D9F A;  5JVG L;  3MAQ A;  1NJZ A;  2NRR A;  1YAG A;  2YKN A;  4CED A;  1ATN A;  2DFE A;  1C0T A;  5J2Q A;  3FGU A;  3I8B A;  4B08 A;  3OS2 A;  3G71 N;  3PO4 A;  1NGJ A;  1NGB A;  3O4W A;  2FBX A;  2E2Q A;  3AO1 A;  3C94 A;  1E3M A;  2W6L A;  3G0Z A;  2VYP A;  4Y1D A;  5CY4 A;  4FJ8 A;  3VER A;  4DWI A;  4EIA A;  1NGE A;  2HNY A;  4H0T B;  4BQL A;  5C42 A;  4OKK A;  2W6K A;  4KHW A;  4NCA A;  2HHU A;  3M5R A;  4B8C A;  4DR2 K;  3F5T A;  1VSI A;  1X9S A;  3BEX A;  2GBZ A;  4B9L A;  1NKE A;  4DQS A;  4B1W B;  5GIN A;  3SMS A;  3AVG A;  4W5Q A;  4FM2 A;  3CXC M;  3SNN A;  3C6U A;  1KD1 O;  2P9S A;  2A41 A;  4Z4H A;  1NK9 A;  3KZB A;  1IG9 A;  5DM6 L;  1TGO A;  4PHT X;  1TKT A;  3Q7C A;  4JI2 K;  3ZT3 A;  4CVN E;  4ZTF A;  1VQP N;  4E19 A;  5KPR A;  3HL8 A;  3J8A A;  2DPN A;  1RBT A;  4O44 A;  5AZJ B;  2UXD K;  4RW4 A;  5JLH A;  1OVY A;  5KTQ A;  3OYA A;  1IBK K;  4AF1 A;  3J80 O;  1CZB A;  4BRG A;  3ZET B;  4ILG B;  4JI0 K;  3MXM A;  4KI4 A;  1WSJ A;  3U6F A;  2HHS A;  4XH4 A;  4DMN A;  4BDP A;  1BOT O;  2I7N A;  4JD2 B;  3L3U A;  4QS7 A;  4E1J A;  3M8R A;  3CCJ N;  2VQF K;  3OVN A;  3AAP A;  5JIC A;  3KD5 E;  1KVC A;  5F2R A;  4C8O A;  2F8T A;  3K9J A;  1JLA A;  3TPQ A;  3QEX A;  2A40 A;  1TKZ A;  1Z05 A;  3CJ1 A;  1UWB A;  1VSK A;  1KFD A;  1U6Z A;  3CC4 N;  5GIP A;  3ISN C;  4BY9 C;  4LFA K;  4CF2 A;  2WON A;  1K9M O;  5KRT A;  4CI6 A;  5TKW A;  4M41 A;  3LDO A;  1YJ9 N;  3A0I X;  3EKU A;  3LPU A;  1BCO A;  3CYM A;  4A57 A;  2P5G A;  3UKU B;  1CZ9 A;  4CF8 A;  5AQJ A;  4JK8 A;  3WQT A;  3C6H A;  2YHY A;  4H0V B;  3BDP A;  4IOX A;  2QA4 N;  3OYC A;  4H5T A;  3OYE A;  1J9A A;  2QWQ A;  4DTS A;  2NRV A;  1F21 A;  3KLI A;  3OYB A;  2QW9 A;  4ELV A;  2HBL A;  1N36 K;  5AQN A;  1NMD A;  2DFF A;  2Q0R A;  3DYA A;  2QKK A;  3SLC A;  5IT9 O;  1S1W A;  1XC9 A;  2HBM A;  1BIU A;  4BE1 A;  4YNQ A;  3AA3 A;  3KD1 E;  4B1U B;  4I9Q A;  3OYI A;  3O9S A;  4O4G A;  4DV0 K;  3NH2 A;  3EY1 A;  3WXK A;  3VEX A;  4CHZ A;  4DLG A;  4BR0 A;  3D2E B;  1WSI A;  1BI4 A;  1NGC A;  3CC2 N;  1ZXO A;  5EOY A;  3WT0 A;  4JI7 K;  1TV6 A;  4GVM A;  3KIO A;  3A5N C;  4NYF A;  3S41 A;  3TAQ A;  1NGI A;  4CIE A;  3OA9 A;  4A62 A;  2ETJ A;  4FLV A;  3EKS A;  4RTF D;  2GV9 A;  3ATU A;  4H4O A;  1J5O A;  2GEL A;  2FC0 A;  3ALY A;  2X78 A;  3CIP A;  4CHQ A;  1RIL A;  4JV5 K;  4J8F A;  2D4W A;  4MLE A;  4KH4 A;  1WN7 A;  5I42 A;  1BQM A;  3MXJ A;  4OPK A;  2B4J A;  4G1Q A;  4GNI A;  1YVU A;  5LY3 A;  3SQ2 A;  4J2A A;  1NGG A;  2RE2 A;  1RFQ A;  2ITM A;  2E1Z A;  2Q2R A;  4WE1 A;  3KLE A;  1JLC A;  1WSG A;  3VGM A;  5HRR A;  4FZY A;  1HKB A;  4H5V A;  4IKF A;  4KHQ A;  4JK7 A;  1YJW N;  3I56 N;  3ZX3 A;  2HHQ A;  4BR5 A;  3AVK A;  3PUF A;  5C0Y A;  2XRI A;  4JS5 A;  3CD6 N;  1YIJ N;  4ID1 A;  1LAW A;  2OPR A;  1VSE A;  3ITH A;  2IIR A;  1VSL A;  5AZJ A;  3SPY A;  3ZSZ A;  2O8C B;  3NH0 A;  4E7H A;  1FK9 A;  4BE0 A;  1VQ8 N;  1HNW K;  1UAX A;  2QWM A;  5EVZ A;  4DF8 A;  2HHW A;  3HZ6 A;  1M90 O;  3PIO L;  1S1U A;  4B3R K;  4DR4 K;  4LF4 K;  1GLJ O;  3L2R A;  3DLE A;  4JD2 A;  4C8L A;  1I39 A;  3ZEU B;  1QZ5 A;  5HBM A;  4CZJ A;  5FRN A;  3B8A X;  2XO7 A;  4I6M B;  2UXC K;  4WFA L;  4B1X B;  3QEI A;  3J7Z O;  1BCM A;  4JEP A;  3THV A;  3WQU A;  1RDW X;  4CFD A;  2QI2 A;  5EU7 A;  4O55 A;  3VQD A;  2UYT A;  3NBP A;  2HMP A;  2HHH K;  2ASM A;  3WUH A;  3OYJ A;  3HRG A;  4CF0 A;  4MQ3 A;  3LP3 A;  1WLJ A;  3CER A;  4FJK A;  5DM7 L;  1WUA A;  3VQQ A;  2YNH A;  1N8R O;  1BO5 O;  3UKU A;  4DQI A;  3D6R A;  3N4Q A;  4J2B A;  4Y0W A;  5BPN A;  2ZGY A;  2KW4 A;  1I94 K;  3V1R A;  1TUY A;  2HBK A;  5C25 A;  1ZBH A;  3SMP A;  4CZE A;  3V4I A;  4FK4 A;  2W41 A;  4JKB A;  3ZSW A;  3L3V A;  3CPE A;  4CZI A;  5J2N A;  3RMA A;  2NZT A;  4DS4 A;  3LDN A;  4HUF A;  3J7Y P;  5C15 A;  2YKM A;  3RR7 A;  4JKD A;  4RW6 A;  1NG9 A;  3N4P A;  2G8U A;  4L8R B;  4YOY A;  4Z94 A;  2P5O A;  4JHD A;  1RT5 A;  4KTW A;  5FDL A;  5AQX A;  2ZE2 A;  4BC5 A;  2ITG A;  4BG9 A;  3KK1 A;  4YOX A;  2HW3 A;  2FSN A;  4WF9 L;  1QSL A;  3HPO A;  5BRE A;  3PSI A;  5M1P A;  2AA4 A;  4B3S K;  2IDO A;  2PFU A;  4FVM A;  1U2V A;  4QS8 A;  4FLW A;  5M1N A;  4G9Z A;  3NF6 A;  4L3Q A;  4FOE A;  3J7A P;  1KFS A;  4YOV A;  4FWQ A;  4CZL A;  1NK5 A;  2XY6 A;  1NJW A;  2O4G A;  4DSK A;  3ZX0 A;  5JS2 A;  4OPH A;  4K41 A;  4EZ9 A;  3GE1 A;  1EET A;  3NCI A;  2Y1I A;  2OZM A;  5CR4 A;  4X62 K;  2OZS A;  1ZC6 A;  2YNI A;  1Y64 A;  5AQQ A;  2XHB A;  1VQN N;  1EWQ A;  4DR5 K;  3IDH A;  3HVT A;  3BZK A;  1NU0 A;  4HUE A;  2G8W A;  4AM7 A;  3CJC A;  1VSM A;  1YT3 A;  3U9D A;  4CGF A;  4NXM K;  3ENH A;  4JYA K;  1LW2 A;  4BC4 A;  1KXP A;  1HMV A;  3E9L A;  3CC7 N;  1T6C A;  4OGE A;  2VQE K;  2KTQ A;  1RDU A;  3IS9 A;  3L2V A;  4IFY A;  1MA9 B;  2FSK A;  1SQK A;  5CZ2 A;  1WBB A;  4CEB A;  5GAD P;  4H0O A;  3G10 A;  1HKG A;  3NGI A;  1X9M A;  2KQ2 A;  4E7L A;  4LF9 K;  3CPW M;  4AHT A;  3O4N A;  3ZYY X;  3TAE A;  1Z26 A;  4KTZ A;  4DV6 K;  2KZZ A;  4LSN A;  3ZT4 A;  3H3O B;  4MO5 A;  1GLE G;  4OPA A;  4M7X A;  3ZEU A;  4C23 A;  4DQR A;  2ZJQ L;  3VA3 A;  3UB5 A;  4R5P A;  1QE1 A;  1T6D A;  1OH7 A;  4FZX C;  4O5B A;  4E1M A;  2ASO A;  3BZC A;  4CGG A;  4C8M A;  4K42 A;  3RMC A;  4DTM A;  1RBS A;  3FLC O;  1A5V A;  3ZSX A;  3LWM A;  3V6D A;  1S3X A;  3GBT A;  4H0X B;  2E2P A;  1SKR A;  1NJY A;  5F1X A;  4H5N A;  4F3O A;  1OKJ A;  2KHO A;  1K73 O;  1ITG A;  4O8K A;  4QOZ B;  1HYS A;  5E84 A;  3TI0 A;  4JKH A;  3WNG A;  1YF5 L;  3KLH A;  2YCH A;  1NBW A;  4CIG A;  3G4S N;  1FKO A;  2OPS A;  4RW8 A;  2Q1N A;  1C0F A;  5FRO A;  3ZSO A;  3MN5 A;  2OPP A;  1TL1 A;  3FE1 A;  3KWI A;  4YHH K;  4RW9 A;  3THW A;  3CQX A;  1OVQ A;  1JCF A;  3NH1 A;  3LM9 A;  3MMV A;  3G25 A;  3ENO A;  4BVO A;  3DLK A;  3DLL L;  2CGL A;  3O9Q A;  5BPM A;  3TAF A;  2W40 A;  3IAY A;  3KKS A;  1UOC A;  1SZ2 A;  2H3G X;  3SYZ A;  3L2U A;  3V1O A;  3ZSV A;  4W5O A;  1BDG A;  2BTF A;  2F9W A;  5AQV A;  1NGD A;  3W0L A;  4YDU C;  4EZ6 A;  2P9P B;  1FXX A;  5LMU K;  3RWU A;  1QVF M;  4RCH A;  2IOC A;  4IO8 A;  1P8Z A;  3RVC A;  4AM6 A;  4DTP A;  1VSD A;  3CME N;  4CZF A;  1VQ5 N;  5KGX A;  5BR9 A;  3HM9 A;  4M45 A;  4DFK A;  3CQY A;  3ZSQ A;  3K59 A;  3U3G A;  1LOT B;  3OYN A;  1HRH A;  4DSI A;  4B3T K;  4M3W A;  1QTM A;  4BC2 A;  4YOW A;  3BP8 A;  5EY4 A;  2F8S A;  4N47 A;  4B9S A;  1RDB A;  1CXU A;  4GV9 A;  3B6P A;  4CJ3 A;  4CGD A;  4FSV A;  1VQL N;  3VN5 A;  1DTQ A;  3LP2 A;  1RT6 A;  5M1Q A;  3H1Q A;  3LL3 A;  4CGJ A;  5AQS A;  3B6O A;  3K9K A;  2UUB K;  4DSF A;  5LJV A;  2ZD1 A;  4LH5 A;  3VA0 A;  3L8B A;  3L0Q A;  2IC3 A;  4IJN A;  3DJC A;  2X6N A;  3SBG A;  3TTF A;  4WQ4 A;  1L3S A;  1BI4 B;  3I8D A;  2Q3S A;  5T7B A;  3BUZ B;  3MX2 A;  4M63 C;  4CZK A;  1FW6 A;  1NKB A;  4FCY A;  3VEY A;  3M8S A;  4GY2 B;  2GWJ A;  4PL8 A;  1BU6 O;  4LF6 K;  4PQU A;  3PX0 A;  3KWG A;  1U04 A;  1Q9X A;  1ASU A;  2ASP A;  4BR7 A;  4CHY A;  3GL1 A;  4DB3 A;  3AVN A;  1D5A A;  1S5J A;  4CHN A;  3EYZ A;  3DLB A;  3SV3 A;  3EEQ A;  4H4M A;  3CCU N;  2RN2 A;  2E88 A;  4DCH A;  5KI6 A;  1NKC A;  4DG1 A;  4KHP K;  4DHY A;  1EO1 A;  3V1Q A;  1WBD A;  5JS1 A;  4GMJ B;  5ELZ A;  3O4Q A;  3CCQ N;  1R0A A;  3HOS A;  4O5F A;  1IBM K;  2Y1J A;  3I0R A;  1HPZ A;  4CFA A;  1YTA A;  4OJR A;  3TAN A;  4CJV A;  5CHI A;  5AQI A;  1NWK A;  2QXL A;  2YV0 X;  2VGM A;  4WYB A;  4W5T A;  4LH4 A;  1HQE A;  4NXN K;  2E8A A;  1VQ6 N;  3LDL A;  1RT3 A;  2VWB A;  3A5M C;  1EP4 A;  3DLR A;  4FK0 A;  2P9K B;  2HHV A;  3KTQ A;  3NMU A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 3KLE A;  4WE1 A;  4FJM A;  1KVA A;  1JLC A;  1WSG A;  3AVA A;  2RKI A;  3T19 A;  4PA1 A;  5HRR A;  1TVR A;  3NF9 A;  2R7Y A;  4FZY A;  2YNG A;  1C1B A;  3AVB A;  3DRS A;  3HPG A;  3M8Q A;  4Z4E A;  1IKW A;  3TAM A;  4Y1C A;  4IKF A;  4KHQ A;  4KI6 A;  1HQU A;  4EP4 A;  4DFP A;  2PY5 A;  4E1N A;  4CJE A;  2OYQ A;  3S3M A;  2HHQ A;  3WNH A;  4DU1 A;  1K6Y A;  3CFO A;  3AVK A;  2B5J A;  5KRS A;  3PUF A;  3K5L A;  3LWL A;  1N6Q A;  2XRI A;  4JS5 A;  3NGY A;  3ZT2 A;  4E7J A;  4ZHR A;  4DTR A;  4FJH A;  4BAC A;  1SKW A;  4ID1 A;  4DQQ A;  4OKJ A;  4Z4I A;  1LAW A;  2GUI A;  2OPR A;  3NAE A;  3JYT A;  1LW0 A;  1VSE A;  3ITH A;  3QNN A;  1VSL A;  3AVH A;  2HHX A;  1UA0 A;  3LAN A;  4OLA A;  3LP1 A;  3SPY A;  1NOZ A;  3AA4 A;  3ZSZ A;  3LZI A;  1KTQ A;  1W0H A;  1GOB A;  3RRG A;  5D3G A;  4M3Z A;  3NH0 A;  4E7H A;  1FK9 A;  4BE0 A;  4N5S A;  3PV8 A;  1UAX A;  3P5J A;  3ZSY A;  1RBU A;  3SJJ A;  4DF8 A;  2HHW A;  4CJP A;  4IG0 A;  2E6M A;  3TAB A;  4DTN A;  1U49 A;  1W9H A;  4ZTJ A;  1S1U A;  3DLG A;  2VWJ A;  3L2R A;  4M42 A;  3DLE A;  2E4L A;  3KK2 A;  4JRP A;  3VQA A;  3A2F A;  3CFR A;  4C8L A;  1I39 A;  3O3F A;  5HBM A;  5FRN A;  1JLE A;  1B92 A;  2XO7 A;  4F8R A;  4HVJ A;  4FK2 A;  3QEI A;  3K5M A;  1DTT A;  1IKY A;  4B9U A;  1BCM A;  4FJG A;  2HND A;  4CJK A;  3VQE A;  3THV A;  3DI6 A;  1UA1 A;  4CEZ A;  1TKD A;  4CFD A;  3AA5 X;  3K57 A;  3NDK A;  5HP1 A;  3NE6 A;  4FYD A;  5EU7 A;  4O55 A;  4FZZ A;  1BL3 A;  2FBT A;  1QHT A;  3VQD A;  1TK8 A;  4HHT A;  4N76 A;  4CK2 A;  1SL1 A;  1EKE A;  4JLH A;  3OYL A;  2ZQB A;  4DTU A;  3TAG A;  3NBP A;  3F9K A;  3OYJ A;  1RTJ A;  3CM6 A;  2QXF A;  4MQ3 A;  4CF0 A;  3LP3 A;  1WLJ A;  2HVH A;  1GOC A;  4FJK A;  3HVR A;  1NK0 A;  4N56 A;  4W5N A;  1T7P A;  4DU3 A;  4Z0U A;  4KB0 A;  3VQQ A;  3VQ4 A;  4CEQ A;  1U47 A;  2YNH A;  2EHG A;  3KKR A;  1REV A;  2RF2 A;  4DQI A;  5CYM A;  4DTO A;  2G8K A;  4J2B A;  1WSH A;  1L3U A;  1KCF A;  4ID5 A;  4DSJ A;  2KW4 A;  3D0P A;  4J2D A;  1CLQ A;  2D5R A;  3DRP A;  4I2P A;  1JLF A;  3LP0 A;  1WSF A;  3V1R A;  5C25 A;  3NGZ A;  3AVC A;  1J53 A;  1JLB A;  1WAF A;  1O1W A;  1C0M A;  3LAM A;  3TWH A;  4DLE A;  3V4I A;  4FK4 A;  4JRQ A;  4F3T A;  3ASM A;  1S1T A;  3AA2 A;  3ZSW A;  1T03 A;  4F2S A;  3L3V A;  5HRS A;  5J2N A;  3RMA A;  4DSL A;  1S6P A;  1HNI A;  3P83 D;  3OYF A;  4BDZ A;  1IKX A;  5CYQ A;  4DS4 A;  4B9V A;  4KTQ A;  4FXD A;  4HUF A;  4ELT A;  3NHG A;  2XY7 A;  3ZCM A;  1QSS A;  4DU4 A;  1VK0 A;  1KSP A;  2YKM A;  3OYD A;  3MXI A;  4DF4 A;  3WNF A;  3QIO A;  3AV9 A;  4HUG A;  1RT1 A;  1RTD A;  4RW6 A;  1SL2 A;  3AVF A;  3RR7 A;  1RT2 A;  3VQ9 A;  2OPQ A;  2LSN A;  2VG5 A;  4OLB A;  3HPH A;  3CG7 A;  2KFN A;  2DTU A;  1HYZ A;  5I3U A;  4F4K A;  1LWF A;  4FLT A;  3LZJ A;  2G8U A;  4L8R B;  1QS4 A;  5J2P A;  2P5O A;  3LAK A;  3C95 A;  4KTW A;  1RT5 A;  5FDL A;  3PX6 A;  2ZE2 A;  2BE2 A;  2ITG A;  3DM2 A;  4C8N A;  3AVJ A;  4CEO A;  3KK1 A;  4B9T A;  4KHN A;  3AVL A;  2HW3 A;  1JL2 A;  1Q9Y A;  1RT7 A;  4FLU A;  1QSL A;  2VG7 A;  3HPO A;  4KHY A;  2ATQ A;  3ZT0 A;  2P51 A;  3FFI A;  4CEF A;  1NJX A;  5E41 A;  3MED A;  2IDO A;  3QEV A;  3HYF A;  4FVM A;  3NF8 A;  3AO4 A;  4FW2 A;  2IGI A;  1X1P A;  1SV5 A;  4Q0B A;  4RG8 A;  5K14 A;  4FLW A;  3QLH A;  4CES A;  3PX4 A;  3DOL A;  4FW1 A;  1LAV A;  2VWK A;  3NF6 A;  2O4I A;  1JL1 A;  3CQ8 A;  1RTI A;  3DOK A;  4LY7 A;  1KVB A;  3P1G A;  1JXE A;  4IG3 A;  4O0I A;  2Z1G A;  1KFS A;  3SUP A;  4K8Z A;  3O3H A;  1NK5 A;  2XY6 A;  4OVL A;  4C8K A;  1NJW A;  2O4G A;  5HRO A;  1MU2 A;  2Z1H A;  3KK3 A;  4F2R A;  3HO1 A;  4DSK A;  1TAQ A;  3RMB A;  5JS2 A;  3HK2 A;  3V9X A;  4CCH A;  4EZ9 A;  4HCB A;  4CJT A;  1EET A;  3H08 A;  1Y97 A;  3NCI A;  2Y1I A;  2OZM A;  4KAZ A;  3QER A;  4LD0 A;  3S3O A;  2OZS A;  4B8A B;  1D9D A;  4OKE A;  2YNI A;  4M3R A;  4NCB A;  3IG1 A;  4FLY A;  3PY8 A;  3KLF A;  3SQ0 A;  4XIU A;  2XHB A;  1IKV A;  2QK9 A;  4CK1 A;  4J2E A;  1JKH A;  1VRU A;  3VQ5 A;  2YNF A;  1IH7 A;  1WNS A;  4Z4C A;  3HVT A;  1FKP A;  2P1J A;  4IDK A;  3HP6 A;  4KO0 A;  1U4B A;  4PWD A;  3SUN A;  2PZS A;  4FJL A;  2D0B A;  2G8W A;  4HUE A;  1S6Q A;  4CHP A;  4I9L A;  1LWC A;  3U3Y A;  2G8I A;  1VSM A;  3VQ6 A;  1YT3 A;  1NK8 A;  1BIS A;  1Z25 A;  1C6V A;  4IBN A;  5KGW A;  4CGF A;  1ZBI A;  4JS4 A;  3VQP A;  4AHC A;  4CEA A;  4CJ5 A;  2X74 A;  4DSE A;  3SQ4 A;  3ZT1 A;  3D45 A;  2HMI A;  3LDS A;  2X6S A;  1LW2 A;  2XY8 A;  4CJQ A;  4CJR A;  1U48 A;  3OYG A;  1HMV A;  4I7F A;  3UIQ A;  3JSM A;  4AIL C;  1L3V A;  2IAJ A;  4OGE A;  2KTQ A;  4UQG A;  4BWJ A;  3IS9 A;  4CEE A;  3L2V A;  2AJQ A;  1HJR A;  4IFY A;  4CF1 A;  3TAP A;  5CZ2 A;  4CFB A;  3CFP A;  3OYH A;  4CEB A;  1HNV A;  3SCX A;  1CXQ A;  3G10 A;  3SZ2 A;  1TAU A;  3OJS A;  1LV5 A;  3NGI A;  1BGX T;  5HRN A;  3AO3 A;  3SQ1 A;  4ELU A;  2G8V A;  2HNZ A;  2HHT A;  4W5R A;  1X9M A;  4FJN A;  2JLE A;  2KQ2 A;  4E7L A;  1A5W A;  4AHT A;  3O4N A;  3L2W A;  1B9F A;  1KLM A;  3ZSR A;  3TAE A;  1ZBF A;  1Z26 A;  4KTZ A;  4CER A;  1TK0 A;  4CJF A;  4GW6 A;  2KZZ A;  3O3G A;  3RTV A;  2Z1J A;  3I0S A;  4LSN A;  3S3N A;  4CJW A;  2EX3 A;  3AVM A;  3ZT4 A;  3QES A;  3TAR A;  4DS5 A;  3OY9 A;  1ZBL A;  1ZYQ A;  4KRE A;  1S9G A;  3QIN A;  4DQR A;  1C1A A;  2XY5 A;  3V81 A;  4M3X A;  3RR8 A;  3VA3 A;  1EX4 A;  4R5P A;  1GOA A;  1QE1 A;  1D9F A;  4M3T A;  3MEG A;  4FZX C;  3AVI A;  4O5B A;  1TL3 A;  3MAQ A;  4E1M A;  1NJZ A;  1NOY A;  1SKS A;  4BWM A;  3KLG A;  4K8X A;  2YKN A;  4CGG A;  4CED A;  4C8M A;  2DFE A;  1C0T A;  3CM5 A;  3RMC A;  5J2Q A;  1XHX A;  3V9W A;  4DTM A;  1RBS A;  4Q5V A;  1RNH A;  4B08 A;  4BE2 A;  1A5V A;  3ZSX A;  3OS2 A;  3LWM A;  4DTX A;  3PO4 A;  4B3O A;  4E7I A;  3DLH A;  3PO5 A;  3NFA A;  3V6D A;  2FBY A;  1SUQ A;  2FBX A;  2B6A A;  1IO2 A;  2I5J A;  3AO1 A;  3C94 A;  2IS3 A;  3NF7 A;  5HLF A;  3G0Z A;  4Y1D A;  5CY4 A;  4FJ8 A;  4E89 A;  1SKR A;  1NJY A;  4DWI A;  5SWM A;  4B9N A;  2HNY A;  3HJF A;  4CHO A;  3SI6 A;  4F3O A;  5C42 A;  1ITG A;  4QOZ B;  4OKK A;  1HYS A;  3TI0 A;  4KHW A;  4NCA A;  2HHU A;  4AH9 A;  3OYK A;  3WNG A;  4KHU A;  4B8C A;  3LPT A;  1RBV A;  4O0J A;  3KLH A;  2JGU A;  4CIG A;  1FKO A;  2OPS A;  3QNO A;  1VSI A;  4RW8 A;  1HYV A;  5FRO A;  1N5Y A;  4CE9 A;  1X9S A;  1NK7 A;  3ZSO A;  2GBZ A;  4B9L A;  2WOM A;  4AHR A;  4DQS A;  1NKE A;  2OPP A;  3SUQ A;  1TL1 A;  5J1E A;  3AVG A;  3BGR A;  4W5Q A;  4RW9 A;  4CF9 A;  3ULD A;  4FM1 A;  4FM2 A;  3SNN A;  4DFJ A;  3C6U A;  1I3A A;  1JXB A;  3WNE A;  2A1R A;  4FJ7 A;  1T05 A;  2YHB A;  3NH1 A;  3OS0 A;  4CFC A;  4CJS A;  3SV4 A;  3QIP A;  3DLK A;  4Z4H A;  4CK3 A;  1RDC A;  1NK9 A;  4FJ9 A;  1IG9 A;  3TAF A;  2G8F A;  1TGO A;  3IAY A;  2RPI A;  4KRF A;  1TKT A;  4OPJ A;  1RCH A;  5FRM A;  3KKS A;  3HT3 A;  3ZT3 A;  1UOC A;  4ZTF A;  4E19 A;  4CGH A;  4DTJ A;  3SYZ A;  2FBV A;  1ASV A;  3HL8 A;  3L2U A;  3AO2 A;  1B9D A;  3V1O A;  4I2Q A;  4KV8 A;  1NK4 A;  1RBT A;  3ZSV A;  4W5O A;  4O44 A;  1ASW A;  4RW4 A;  2PYL A;  5KTQ A;  3K5O A;  3OYA A;  5CZ1 A;  3V9U A;  5HRP A;  4EZ6 A;  1LWE A;  1CZB A;  3TR8 A;  1FXX A;  4E0D A;  4CJL A;  3RWU A;  3OJU A;  2IOC A;  4ICL A;  2NUB A;  3MXM A;  4KKO A;  3LAL A;  4AHU A;  3EZ5 A;  3SUO A;  1WSJ A;  3U6F A;  1L5U A;  4KI4 A;  2HHS A;  2BDP A;  4DMN A;  4BDP A;  4DTP A;  1VSD A;  3L3U A;  5KGX A;  2KZM A;  3M8R A;  3HM9 A;  4M45 A;  3MEE A;  3E01 A;  2E6L A;  4DFK A;  3OVN A;  3ZSQ A;  2D0C A;  3K59 A;  3U3G A;  4PY5 A;  3OYN A;  1HRH A;  3KD5 E;  1KVC A;  4DSI A;  4CJ4 A;  4DQP A;  4C8O A;  4M3W A;  2BAN A;  2F8T A;  3L2Q A;  1RDA A;  4CIF A;  1JLA A;  3K5N A;  1QTM A;  1WSE A;  2YHA A;  3QEX A;  3T3F A;  1YTU A;  2F8S A;  1TKZ A;  1Q8I A;  1UWB A;  4N47 A;  4B9S A;  4BDY A;  1C0U A;  3HST B;  1RDB A;  1CXU A;  1VSK A;  3B6P A;  1KFD A;  4CGI A;  4CJ3 A;  4CGD A;  3K2P A;  3SPZ A;  3ISN C;  4FJX A;  3VN5 A;  1DTQ A;  2WON A;  3LP2 A;  4CF2 A;  3K58 A;  1RDD A;  2G8H A;  1RT6 A;  1VSH A;  5KRT A;  4M41 A;  4CGJ A;  3DMJ A;  2DY4 A;  3LPU A;  1X9W A;  2QKB A;  1TKX A;  1KLN A;  3B6O A;  4DSF A;  1BCO A;  2ZD1 A;  1BIZ A;  3CYM A;  4LH5 A;  3L8B A;  1CZ9 A;  3VA0 A;  4CF8 A;  1U45 A;  2P5G A;  4TSX A;  5C24 A;  2IC3 A;  3DRR A;  4HTU A;  2OA8 A;  3BDP A;  3OYC A;  4H8K A;  4FLX A;  3OYE A;  1J9A A;  1RTH A;  1A5X A;  1XHZ A;  2X6N A;  4DTS A;  1T8E A;  1F21 A;  1ZBU A;  3KLI A;  1L3S A;  3OYB A;  1BI4 B;  3M8P A;  3I8D A;  4FJ5 A;  1ZBH A;  4ELV A;  2BGG A;  1S9E A;  2Q3S A;  4EP5 A;  4NYN A;  1JLQ A;  4Z4G A;  5T7B A;  1KRP A;  4IFV A;  3OYM A;  1XI1 A;  2DFF A;  1C1C A;  2HB5 A;  3F73 A;  1NKB A;  4FM0 A;  3DYA A;  4FCY A;  1BHL A;  2QKK A;  1J54 A;  3M8S A;  1S1V A;  1S1W A;  1XC9 A;  2PYJ A;  4B9M A;  3QO9 A;  1BIU A;  4BE1 A;  4PUO A;  4YNQ A;  2W42 A;  1RT4 A;  1L3T A;  3AA3 A;  3OS1 A;  4OGC A;  3KD1 E;  4I9Q A;  3OYI A;  4PQU A;  3PX0 A;  4E3S A;  4O4G A;  3VQC A;  3NH2 A;  1VSF A;  2D0A A;  3EY1 A;  4YFU A;  1D8Y A;  4CHZ A;  4DLG A;  3RRH A;  3V9S A;  3QEW A;  2Z1I A;  2A1S A;  1U04 A;  1WSI A;  1Q9X A;  1BI4 A;  1ASU A;  3C6T A;  4NCG A;  4CHY A;  1BQN A;  1G15 A;  3HXM A;  2VG6 A;  4HCC A;  3AVN A;  1D5A A;  5J2M A;  1S5J A;  4CHN A;  3EYZ A;  1TV6 A;  4GVM A;  3T1A A;  3KIO A;  4NYF A;  3SV3 A;  3S9H A;  3TAQ A;  1DLO A;  3DLB A;  3VQ7 A;  4H4M A;  3AO5 A;  4N41 A;  2RN2 A;  1NK6 A;  3MEC A;  3VQ8 A;  4CIE A;  5KI6 A;  1TK5 A;  1NKC A;  2ETJ A;  4AHV A;  4DG1 A;  1EXQ A;  4FLV A;  3QEP A;  2HVI A;  3IRX A;  4FLZ A;  4Z4F A;  4KB1 A;  3V1Q A;  4M3U A;  4FJI A;  5JS1 A;  1QSY A;  4GMJ B;  2GV9 A;  4H4O A;  3O4Q A;  1J5O A;  1VRT A;  1R0A A;  2FC0 A;  4AHS A;  3ALY A;  2Y1J A;  2X78 A;  3I0R A;  4MFB A;  4CHQ A;  1HPZ A;  1JLG A;  1RIL A;  4CFA A;  1YTA A;  4OJR A;  3HP9 A;  4DFM A;  1SL0 A;  4FJJ A;  4M3Y A;  3TAN A;  4LSL A;  4CJV A;  1QQC A;  3V9Z A;  1WN7 A;  4CJU A;  1VSJ A;  1BQM A;  2YV0 X;  5I42 A;  1WAJ A;  1S1X A;  4KPY A;  4W5T A;  4LH4 A;  1HQE A;  3MXJ A;  3KJV A;  4OPK A;  2KFZ A;  5DMR A;  2B4J A;  4QAG A;  4G1Q A;  3QET A;  3RMD A;  1XWL A;  3VQB A;  2DFH A;  1YVU A;  4E7K A;  1RT3 A;  5DK5 A;  4KFB A;  3SQ2 A;  4QCL A;  4J2A A;  1RBR A;  1EP4 A;  3DLR A;  4FK0 A;  2F96 A;  4KHS A;  2HHV A;  4CEC A;  3KTQ A;  5SZT A;  4RW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...